1PLFA

The three-dimensional structure of bovine platelet factor 4 at 3.0 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
63
Chain Sequence
LQCVCLKTTSGINPRHISSLEVIGAGLHCPSPQLIATLKTGRKICLDQQNPLYKKIIKRLLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of bovine platelet factor 4 at 3.0-A resolution.
pubmed rcsb
source organism Bos taurus
molecule tags Platelet factor
molecule keywords PLATELET FACTOR 4
total genus 8
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1plfA00
3DEPA 2KEEA 2FJ2A 4RWSC 1KNEA 1DZ1A 4X3SA 1WD0A 1KNAA 1X3PA 5T1GA 2X6LA 2H1EA 2RSNA 1WTWA 1U4LA 1Q3LA 2K1BA 1NR2A 3I3CA 1TVXA 4LMQD 1WVLA 2RA4A 1RTNA 4ZKBB 4HEDA 3H91A 5D14A 1WTXA 2HDLA 1WTRA 1VMCA 2HCCA 2B2YA 2NWGA 1BO0A 4MN3A 1RHPA 2EOTA 1AP0A 1HUMA 1EOTA 1E0BA 1MSGA 1NCVA 2N88A 3GV3A 3MTSA 3G7LA 1IL8A 5E4XA 3I8ZA 3KUPA 2B2WC 3GV6A 4OIJA 3D6WA 2K01A 1XYIA 5DNFA 3ONAB 5D65A 1DOKA 3FDTA 4O42A 5CBEE 1HRJA 4RAUC 1ILPA 1HUNA 4IURA 4X3TA 4HSVA 1M8AA 2L1BA 5E4WC 2KECA 2B2WA 2KOLA 1PFBA 2B2UA 2HCIA 4ZKCB 1O7YA 2L4NA 1IKLA 2BDNA 4XDXA 1G6ZA 1A15A 1J8IA 5EPLA 2D9UA 2B2VC 1HFGA 1X32A 2FHTA 1F9PA 1ESRA 1IKMA 1XX8A 2XIWA 5CORA 1DOMA 1WTPA 1U4PA 4IUQA 2B2YC 2K28A 4R8IA 2DY7A 3N52A 4MHEA 1G91A 1PLFA 1DONA 3IL8A 2FMMA 1ICWA 4ZAIA 4X3UA 1CA6A 1MI2A 1AZPA 1HFNA 3DM1A 1HA6A 4IUUA 2RSOA 1U4MA 1B2TA 1EL0A 4R9WA 1SDFA 1CM9A 3QO2A 1F9SA 1SSOA 3TN2A 4XT1B 1NAPA 5COYA 4U68A 1RJTA 4X3KA 1PFMA 4HAEA 4HCSA 4IUPA 4IUTA 1SAPA 4IUVA 2K05A 2MPMA 1EIGA 2B2UC 2FFKB 3LWEA 4ZK9B 1VMPA 3P7JA 1BBXC 1WD1A 1MGSA 1BF4A 5EPJA 1PDQA 2JYOA 3I90A 4XT3B 1O7ZA 2RVLA 3UI2A 4CJ1B 3F2UA 1WTOA 2B2VA 2MGSA 2X69A 4ZLTF 1F2LA 2B2TC 2KVMA 1MSHA 3MWYW 4QUCA 4OIKA 5EKIA 4CJ0B 1QNKA 5AFWA 1WTQA 3HP3A 3IFDA 5CBAE 1B3AA 1EQTA 1QG7A 1ML0D 2HDMA 1C8CA 2L11A 4NW2A 2MP1A 1F9QA 1G2TA 1B4OA 5EJWA 1ILQA 1JICA 2B2TA 4CJ2C 1LV9A 1ZXTA 1JE4A 1B53A 2Q8RE 5EPKA 2L12A 2M2LA 3Q6SA 2Q8TA 2KUMA 1RTOA 2R3ZA 3I91A 3TZDA 1QE6A 1X3QA 2NYZD 5CMDA 1B50A 2K04A 2FINB 2N55A 1GUWA 2L9HA 2DY8A 2JP1A 3KBXA 5T1IA 3DEOA 1RODA 2EPBA 1NR4A 1J9OA 1O80A 2J7ZA 2X6GA 2K03A 2EE1A 4RA8A 4UAIA 4QUFA 5JJZA 1HHVA 2IL8A 4DN4M 1EIHA 2CVRA 2VXWA 1G2SA 1PFNA 5EQ0A 1DOLA 2NZ1D 1U4RA 3SVMA 1BNZA 2HUGA 1S4ZA 1WTVA 1CA5A 1AZQA 2KEDA 3FPUB 3R93A 2SDFA 2MJ8A 1F9RA
chains in the Genus database with same CATH superfamily
3QB3A 4RGMA 2F3VA 2F52A 1NY4A 4JVZA 2X6LA 4PNYA 1I4QA 4ID6A 4Y7NH 1WTWA 1NR2A 4UY8C 2Z8LA 3TBIB 1EZ6A 2ZTCA 2PNRC 5HURA 1VMCA 1EYCA 2HCCA 1BR9A 3MVVA 4E6IA 2M9VA 3I4MG 2EOTA 2C35B 2JEBI 4QJFA 4A75A 3W2DA 1C0AA 3F1ZA 4JI2L 2MHVA 1MKHA 5C0XH 1I6HB 5C4HA 4YHHQ 2YU9H 5CC4A 1TY2A 5CBEE 2B63G 2A68D 1HRJA 5KNBA 3S14B 4HJAA 2B2WA 2KOLA 4BA2I 2NVXB 3NWTA 1B3QA 1H95A 1FVIA 3GO5A 1NSNS 5EPLA 3PUWA 1XNQQ 3NSWA 4C3HG 2OQ0A 1U4PA 5EKKA 1SNCA 1TWGH 2YTVA 1A6XA 3HOUB 3J80L 2DJFC 1ICWA 4M8AA 1TQOA 4KN4C 3T13A 1K8AC 4PZ8A 4DV5L 3S15H 4A3IH 3E3XA 4LUVA 3H3VI 3I4LA 4DR7L 3HOUH 1F9SA 4KD3A 3T1HL 3HKZB 2K5DA 1SAPA 1U0LA 1EIGA 3M3YB 4QCLA 3S1NB 4FF2A 1WD1A 4ZCKA 3OSOA 1Y1VH 1YEZA 1SJHD 3F2UA 2VB2X 3MWYW 5EKIA 3OW7A 4NDXA 3Q24A 1R4PB 4QY7A 1K3BC 4KJOA 4C3HH 4YY3Q 4CKEA 3I2ZA 3HGBA 1AE3A 1QNUA 2DUDA 4KKUA 4EQNA 1KRTA 4LF6L 1SE4A 1B53A 1BVSA 1XPOA 2NYZD 1PTOC 3NTHA 3BG3A 2UXBQ 1LTBD 4BWGB 4BS9A 5T1IA 2F0UA 3A0JA 5C0XI 1K0SA 4QUFA 4DR3Q 1YHQA 5KYLA 1VQ8A 2NZ1D 1PZJD 4FXGC 4CGYB 5AJ3Q 5LL6X 3V2TA 3CQZH 5M5WB 3MFYA 1PRTB 1KNAA 1RKNA 4BBSH 3MXUA 5L37A 5JVG3 4GOPC 3IRBA 4IFDH 1TWHB 4DAMA 4F8MA 3SHLA 2A6HC 3MA2B 3CC7A 1KHIA 2JK8A 3MTSA 3EJIA 4YCUA 5GADC 1PH1A 4IJLA 4R4OA 4FXKC 4A93H 1XYIA 2YU9B 1IW7D 1STEA 3TP6A 3ONAB 4R4IA 3CCRA 1EUJA 4GNXB 5FO7B 4GLXA 4LF9L 4DK1A 4CDFC 1EIFA 4A93B 1GUTA 2A69D 2JA9A 2TMPA 1D7QA 2L0CA 1HPCA 3PUZA 4BXXG 1PRTD 5CORA 1I6VC 1TWCB 4R8IA 2PI2A 1X54A 3N52A 4DV6Q 4C3IB 2F4VL 2BH8A 4GNXA 3QOJA 4OELB 1IYVA 4X65L 2HIXA 5C4JH 3S1QB 2KCTA 2OEOA 3I70A 5JAVA 1X65A 3A74A 4JI8Q 4ALPA 3MXNB 5A2QL 1RDPD 4HCSA 5DLQE 2R7ZG 2JA7G 3AFPA 3M7GA 4PMWA 2IX1A 3KJOA 2EYPA 1QB5D 3N6RA 4AYBG 4HMJA 5FO8B 4KY6A 3RLNA 3STBC 1PZKD 3Q8DA 1B8AA 3TEHB 5M3FB 4DA2A 1JE5A 4G4KA 4PZ7A 5C5MA 4BY7B 5JEAH 2HIVA 1BCPC 5IGGA 4P73A 1Q12A 3GTKH 1LYLA 1HQRD 1IZ6A 2KUMA 5M3FG 3CCLA 2K04A 1PFSA 5ELOA 1GUWA 3KDFB 2EJFC 5ELNA 5FJ8H 2FXQA 2EPBA 3J81j 3KFUA 1EIHA 2O4XA 1CK1A 2H5XA 2G5DA 3CF5A 3C46A 1NMGA 2ZJQA 5IGFA 1OXXK 4L5TA 4RWSC 2MO1A 4ZYSA 2K1BA 3A8KE 4EGVA 2K52A 3BU2A 1Q7YC 4HEDA 5FJ8G 4CDCC 1BUVT 5JJKA 2OCEA 2R93H 2LS01 5M3FH 1SN8A 1TWHH 1ZYRC 2K32A 5IT9c 2UUAQ 1KABA 2AQ1B 3RZOH 2JA5B 2EXZA 2PW5A 1I5FA 2Z6KA 5IP9H 3S9WA 1XJVA 1M8AA 2A6ED 1YITA 1PFBA 2B2UA 1BCPF 3KF8B 2K5HA 5ISRA 1SE8A 1MHWC 4RCOA 4DR4L 1IKMA 2DN8A 1HTPA 1AE2A 2QA4A 2LXKA 2K28A 4JOIA 1SR3A 4O1NA 3RNUA 2EDGA 1HXYD 4IPCA 1K9MC 1LT4D 5KRUA 4EQPA 1VF5C 4TSSA 4F88A 2CKZB 2Y0SE 1I94L 1KTKA 1I4XA 2CQOA 2NVYB 3CMAA 1LTID 2F0MA 4HJ9A 2K4KA 2MPMA 1HZAA 3I4NH 1SYEA 3T4AC 3LWEA 5IT9E 2D0OA 3I4MB 1BCPD 2LSSA 2YTYA 4IJHA 4LF5L 3D31A 1Y1WG 3I72A 2B2TC 2JA6G 1STGA 1J5EQ 1LTGD 1HQMC 2F0KA 2KCCA 2PMZB 3K5OA 4AYBB 2UXCQ 3T1HQ 3S1RH 3J7A5 4R4CA 2VZAA 3S16H 2JJQA 1G291 3P20A 4GKKQ 5FLXE 5M3MH 2AQ3B 3NK9A 4A3GB 5EPKA 3Q6SA 4UHVA 5FOBB 3A55A 4OO1I 2A8VA 4PMCA 5I2YA 1STAA 5C4JB 3S1QH 3KBXA 1RODA 1NR4A 2J7ZA 3KLRA 1D5XC 1GUNA 1WI5A 1I4RA 2F1MA 2XN9C 4I7ZC 4RH6A 1VS0A 2HUGA 1IBLQ 1WTVA 1X6OA 1JR0D 3HEJA 2Z6KC 4A93G 1FNVA 3TRZA 3S1MB 4O2DA 5FLXc 3TS2A 1N33Q 2JA7B 3LNNA 4R8NA 1QJOA 4HIMA 3UE0A 5M5XH 3SK4A 2RA4A 3QIAA 3GTOH 2IX3A 3H09A 3C1FA 2EYMA 2MUYA 2NN6H 2B2YA 2WKDA 3CRLC 3DM3A 1DXMA 3GTGH 3P75A 2K50A 1PRTF 4CBVA 2PPBC 3CCQA 2KBNA 3ZYYX 2L5TA 3EA6A 2LXJA 4DF7A 3QR8A 1ILPA 3E0JA 2DNEA 4IURA 4X3TA 1LTLA 3KDFA 2VQEQ 1EIYB 1BQQT 1HR0Q 1C4QA 1YHBA 2HCIA 3EBEA 5C3WA 3GTLB 3NBHB 2QILA 4PQXA 5EBCA 3A5ZB 2JA5H 1QVGA 3Q22A 1UNSA 3VR4A 5EAYA 1ICFB 4A3BG 1EFID 1XX8A 1TWFH 5J22A 1RL2A 1RCVD 5IODA 2CW0C 3J81i 3TQYA 3RN2A 3C1EA 1GM5A 4A3FB 4ZUJA 4ZAIA 4CKCA 1MI2A 2NN6G 1K28A 2I5LX 4B3RL 3NBHA 3QO2A 4J8QA 4AYBE 2CWAA 4GLVB 2E2HH 1PVOA 5BN4A 3FKIG 4A76A 1JC7A 1WJJA 2VQFQ 1SLJA 2NVQB 1TS5A 1N33L 4FP5D 4DGZA 4TVAB 1QNKA 3HP3A 3PO2G 2L11A 1A3UA 3JAMc 1LTAD 1G2TA 5IGEA 4GNXC 5M3MB 4L5QA 1B7YB 1TR5A 1VQBA 3NHHA 4WFN3 3TZDA 2UXBL 1YNND 1EZ8A 5GAEC 3BVGA 4X64L 4MTNA 1K83H 3DWPA 3T1YL 5C4ZA 2F3IA 2NZHA 3NE5B 4JI1Q 1BKBA 4GKKL 2YV5A 1L0YB 1W6JA 3HOYH 3NTIA 4Y7NB 1SNMA 3AU7A 3TP5A 2SDFA 2IHEA 3S2DB 2L55A 4JI3L 4UP9A 3S24A 4GN4B 3SK6A 2FJ2A 1JCKB 1J5EL 1VQJA 2EYLA 4DUYQ 1CZWA 2Z0SA 4TKOB 1VQIA 3K80C 4OHJA 4G7ZC 1QWYA 4RGTA 4S3SA 3F8TA 2UU9L 1XPRA 1AZPA 1E0BA 4Y52H 4FF4A 5KGUA 4A3KG 2B2WC 1M90C 3S16B 2K01A 4BY7G 1Z47A 4OL7A 2R7ZB 1D5ZC 1E1OA 4B3SQ 1PYSB 2HT1A 2YYZA 2L1BA 4JPBW 4ZKCB 1I4GA 1EWIA 2MFIA 2ZXPA 4YCWA 3CCEA 1G6ZA 3NELA 1J8IA 1V43A 2H4OA 4LF8Q 1SNDA 2JA6B 2E5LQ 3CCMA 1OXTA 4UPAA 1A63A 1C48A 1CKNA 1VQDA 2XWBB 4A3JH 1JWUD 2EZVA 1HA6A 3GDEA 2F0EA 2WP8J 2XRQD 4IUNA 1I50B 3W3AA 1PTOB 5ELCA 5DAUA 3ULLA 1PFMA 3J7AV 3DHQA 4K6DA 2EY1A 2B2UC 4C56C 1PTOD 2KCMA 2K33A 2JYOA 3GTJH 2ID0A 2RVLA 1CKNB 2WFWA 4C3HB 1D2BA 1CTMA 1SNQA 2KVMA 4FXDA 4OXPA 2ZJPA 1SBBB 5CBAE 3SR1A 1F9QA 3HKZE 4BY7H 1JJ2A 5IYBG 1C9OA 1JE4A 4FF3A 2Q8TA 1QVCA 2EY5A 5I6YA 4IFDJ 4NXNL 2B29A 3PO3B 2AQ2B 2GVBA 2IW3A 2WB1B 5CR3A 2DY8A 4P2CB 3CKIB 1IXRA 3OYYA 3R2TA 1SXTA 2VXWA 1CI3M 3PO3H 5GAGC 4DV2Q 4HIDA 2O5JC 1F2ZA 4TRDA 4ABNA 2PQEA 2KEDA 1IBKQ 1STNA 1UE6A 3R2IA 4GOPA 1EQRA 3E0EA 4DR3L 3K5MA 5IWAL 3RMHA 4K8IA 3AMUA 1YNXA 2VY3A 2MNAA 3FKIB 3EVQA 3HRZC 5M5WH 3RR5A 1XTDA 3URYA 2A73B 3KJPA 1BDOA 4KI0A 3SDZA 1PH6A 4RKBA 1G8ZD 1TS3A 3I55A 1JJCB 1A2UA 1F77A 2WIIB 3HOXG 1KL9A 2EY2A 5IOCA 3PIO3 1HH2P 4JG2A 3RLOA 5GQOA 3SE0A 4DV7L 1LT6D 3FDTA 2RCNA 4CDEC 2RKSA 5JPNC 1XNRL 5FKAC 2UU9Q 2BA0A 2IY5B 4RGNA 1PRTC 2J0TD 4J15A 2BDNA 1AW7A 3D8GA 1SMXA 1HNWQ 2RBMA 3K8AA 1F9PA 1EOVA 4UDUC 4KTAA 1XMOL 2PZUA 1EYAA 3GTQH 3GD7A 2B2YC 4LFBL 1LTSD 2R6GA 5M5XB 4HJ5A 3IL8A 4L5SA 4JI5Q 4X3UA 1EY4A 1CKOA 1O7IA 1T9HA 5ELFA 4K2LA 1QZGA 4IUUA 4XQJA 1EL0A 1LO5D 2F0QA 3U4VA 3GTGB 2KHJA 4LFCQ 4DV2L 3SXHA 3S1MH 3BZCA 2EQSA 1MGSA 1UWVA 3NQTA 4YHHL 3IAYA 4OIKA 2AHOB 4NXNQ 4BBSG 1F2YA 2E2IH 3HOZG 3IFDA 4JI2Q 4PMBA 2F0JA 4BBRG 3CXCA 2MP1A 4BY1B 2NB0A 4R4QA 3K7UC 4FO2A 1JICA 4DV3L 3NP8A 4YWMA 3RZOB 1FJGL 4GKJL 2XWJB 4DV1Q 1RD9D 4EQ5A 1YVCA 2FINB 1I6HH 1LTTD 2NZOA 1TS2A 5JJZA 3FEWX 3OTOL 1HHVA 2CVRA 2D0PA 1DOLA 2EY6A 3P1HA 3BYTB 1D6EC 3KK7A 4V190 2VNUD 4WORA 3EROA 1KNEA 1DGSA 1X3PA 3NTKA 5IIFA 3IKJA 1L0WA 4AH6A 1STYA 2F0TA 1XMQQ 3AFQA 2NWGA 1FL0A 2KHSA 1TXYA 1RHPA 1YBYA 4DAPA 4JYAL 3OIPA 3JAME 2EYFA 1OXUA 3GTMH 2O2LD 4JI4Q 5JJIA 1SNOA 2WKCA 2QF7A 1EEFD 1HUNA 1ZYRD 3HKSA 1II3A 1Z7TA 3V96A 5E4WC 3VR6A 5KIXA 3PUXA 3PIOA 2ENBA 4DV4L 4JI7L 1IBLL 1BXTA 2M00A 3L0OA 4X62Q 4NXMQ 4A3LH 3M4PA 4RHRA 2BA1A 3J80i 4B3TL 1ESRA 2Z6BA 2F0GA 4RMFA 5CV9A 5LMUL 3ERQA 3A5UA 3BYYB 4ZRZA 5GROA 3WOEA 2R92H 2R61A 1U9RA 1MBYA 4A3MB 1HFNA 2OWOA 1EQQA 1PYWD 3PO2H 3H0GG 3S2HH 1V1QA 3TN2A 3SGIA 3ULJA 1GVPA 4XXEA 3RLFA 3ND8A 5A35A 2FFKB 1Q8IA 2GVAA 4DXGA 1BBXC 3PO2B 3K7AH 4ODGA 2DNCA 3ICEA 4X64Q 1FYCA 3FHWA 4LFBQ 4F87A 5K5PA 5FLMH 3CCSA 1F2LA 4QIWE 1CHQD 1WTQA 2QW7A 1VQAA 1EQTA 1PH7A 3HOVG 3X3NA 4KN7C 1ILQA 1LT3D 3DLLA 1A3TA 1ZXTA 3J7ZC 1HA5A 4DUYL 2E2DC 3TP7A 3A8JE 4BY1G 2N55A 4A3BH 1P16A 5IP7H 2ES2A 1EEID 3CCVA 4NKLA 5M9OA 5TSSA 5IE8A 1KC8C 2JA6H 1BNZA 3T1YQ 1SFOH 1EY0A 3F2BA 2F0FA 2Q2IA 3HOWG 3KF6B 2N88A 5LMNQ 5NUCA 2IWHA 2Q2HA 1VQEA 3EFXD 4P75A 3V05A 2ZTDA 1A0IA 1Q3LA 1WFQA 2RHSB 3I73A 5I9OA 4LMQD 5IGDA 1AH9A 1X3EA 1KDAA 2RHQB 3BJUA 1BBWA 4M1UB 5M5YH 1LM0A 4AQYL 4DR5Q 1WVLA 1VQOA 2EXDA 3G6JB 2F3WA 2OXPA 1DOKA 2B63H 1GUSA 2XNAC 1I3QB 4HN7A 3PSIA 3JAMi 2CWPA 2K14A 5C6AA 4XIGS 1K73C 4JCVE 1GOZA 3H94A 4L8JA 1NE3A 1DOMA 4A4IA 4IUQA 4KLKA 4LF7Q 2HQEA 3NQIA 1G91A 3RUZA 1Z9FA 3FP9A 1OTCA 4DNTB 2K5VA 4UP7A 3J80E 4IPHA 5C3XA 2E2JH 4A3IB 2NVTB 3CQZB 1L1OB 1O78A 2BE5C 4DAYA 4IOCA 4HAEA 3AYHB 1LT5D 5CV6A 1JJGA 3S1NH 1PDQA 3CW2C 4DK6C 1VQ7A 4LFAQ 3VDYA 1ONLA 1LACA 2BDOA 1G6PA 3ITPA 1YNJD 5DEHA 3GP7A 1E7ZA 3CCUA 4K5VA 5I9PA 1ENAA 4P74A 4DNIA 3HOZB 4A3BB 4OX9Q 4LF5Q 1CKMA 5CV8A 4WRDA 1K8GA 1FNWA 1PMRA 1SYFA 1YNNC 4JI3Q 4B9WA 4X65Q 1RF2D 4LF9Q 3B6YA 1Y1WB 1GHJA 2ASBA 1F9RA 5C4XG 4GLAC 3NBIA 2A1AA 1DZ1A 2NTTA 2IJ0A 1A62A 2AUKA 1JB7A 4LJZC 1X3GA 2O5IC 1TVXA 1YJNA 2HHHL 2ICIA 5KNDA 4QIWB 4H0LC 4XQNA 3GV3A 5EBDA 1Y14B 1V1PA 5IP9G 2PO4A 1VQLA 1S5DD 4O42A 4RKLA 1NUCA 3G4SA 5LMUQ 4A3EH 4A3LG 2EJMA 4XYOA 4EQOA 2KECA 5FLXL 3U9SA 5BN3A 2L4NA 1T5XD 1VDZA 1IBMQ 4WJ3M 1A15A 1GD7A 2V4DA 3CPFA 1E2WA 4YCVA 2NN6I 1MJEA 2ZM6Q 1IW7C 2F4IA 1OXVA 3WWVA 1N32L 1IYUA 4K14A 1K8OA 4X66Q 1MD2D 3BZDB 2FMMA 5IYCH 2F0DA 4K5XA 3KOJA 3QOLA 3G6EA 4KY7A 4YY3L 1XMQL 5CV5A 1SSOA 1TU2B 2VL6A 5ELEA 1NMFA 4IUTA 4PV1C 4DAVA 3ND9A 3I4NB 5JEAG 2ZTEA 4A3IG 4DNRB 4LAAA 1O7ZA 2YTXA 1R4QB 4K5WA 3MZ5A 4ME5A 2E74C 5K36G 2XTIA 5AFWA 1JB3A 5C4XB 2B8FA 4DV5Q 2NUCA 4H44C 3DUZA 4HTHA 3TZUA 4BA1I 1LV9A 1HR0L 4A3GH 1KDCA 1YI2A 1EWCA 2Z9HA 1SYDA 4A3DB 3VA7A 1A3VA 4IZ8A 4GKJQ 2K5NA 2N3SA 4LFAL 5IYDH 1SYCA 1UE1A 4K0KL 1FGUA 1KDBA 3PMFA 3DWAA 1PYBA 1CA5A 1K83B 4JK1C 4OONA 3OPOA 2NVQH 1PA6A 3A7AB 2WAQB 2H1EA 1UE5A 1VQ6A 1WTHA 4DR1Q 3UDFA 3I3CA 4F7XA 1NJIC 1KQSA 1RTNA 4HMIA 4LK1C 3MAQA 1TWAH 4ILWA 1X55A 1W2BA 3EIVA 2CHBD 3TSSA 3K7AB 5KNCA 1EY5A 3NWSA 1IL2A 1MSGA 3K0XA 4K0KQ 3K0YA 5E4XA 2Y0SB 2Z4IA 2UXCL 2HQLA 5CV7A 4JBMA 1VF7A 1H9JA 2B8GA 5D65A 3STBD 3Q0AA 4EVOA 2LKVA 1H9SA 2B3GA 4A3CH 3WDNA 2RCFA 3GQBA 4NMZA 2A5HA 3BVZA 1N34L 3GTLH 1MJCA 3ULPA 1SRUA 3GTKB 4C3IH 5BR8Q 3BDOA 1Y1WH 2D9UA 1GO3E 3BVMA 4DU9A 1HFGA 1UEBA 2XIWA 2F4VQ 4A3MH 4YIJA 3GTPB 3IFTA 5EKLA 3I4NG 2PQAB 1ESFA 2EVBA 1CUKA 1PLFA 1T5EA 3RD4A 4KV6A 1AN8A 1QOHA 4V0BA 3DWQA 1CA6A 4Q0FA 4HSPA 1EFWA 3S15B 3NUCA 3LGJA 5CYUA 3OTOQ 4L5RC 5FO9B 2E75C 1WCMH 4DKAC 4DXFA 3U58A 1L2FA 1VMPA 3AQQA 4FF1A 3I90A 3KLSX 3GTOB 4QMGA 2PNHA 3MXGA 3U9OA 3CRKC 4OO1G 1EY6A 1CFMA 4JI0L 1QG7A 3MXNA 1JWSD 3L9AX 2LY7A 1ZKOA 2F03A 1Y8PB 1YJ9A 1EY7A 4B3ML 4DK3C 2L12A 1YZ6A 3OW2A 5JOBA 3CCJA 2KQ3A 3E9IA 2L9HA 5JJLA 1HJPA 2ATWA 1SNPA 1G2SA 1FNUA 1W3SA 3SVMA 1FD7D 5J3BA 1N34Q 3MXPA 4ME3A 1AZQA 4QQBX 3M3YH 3W1GA 5J39A 4KKTA 3ZJYC 3GTJB 1MIUA 3ER0A 1S5CD 2XSCA 4I7AA 3KLWA 2VW9A 1PH5A 1DD2A 1EYGA 4LF6Q 1PH4A 2Q8IB 1IHZA 2RF4A 4HR7B 3EN2A 4DR6L 2PZTA 3PF4A 3KF8A 1WCMG 3AB9A 3D4DA 1BO0A 1VQ9A 2ZXRA 1PTOH 1XNRQ 1TS4A 3KF6A 4DR1L 1PH2A 1VQMA 1RIPA 1UUPA 4DV4Q 3PQIA 1VQ4A 2F0OA 2BH2A 1ET6A 1GUOA 1KD1C 4DUZQ 3JC66 2AUJD 3NENA 4LWCA 1VQKA 4B3TQ 2RDFA 5ELDA 2I07B 3A54A 4QL5A 4X62L 3VYSA 4BXXH 5JVH3 2FHTA 4B3SL 4IFDI 1N36Q 5DM63 1HZBA 4DR2L 3FKIH 4DR2Q 3D4WA 1EY9A 3LX0A 1DONA 3W1BA 3K58A 1LABA 4JI4L 1HTLD 3GTPH 3HOWB 2RSOA 1U4MA 4R9WA 2R92B 4XT1B 4DUZL 1Q1EA 1QVFA 3HOUG 4C3JB 1E24A 2N49A 4K6LA 4RGOS 1E2ZA 2WV6D 4JW0A 1NBWA 4XT3B 4CJ1B 1HNXQ 3F2DA 2MGSA 3BDLA 2X69A 3PUVA 1VQ5A 4CJ0B 2WB1G 1FGBD 1ENCA 5A2QE 3I4MH 5ELBA 4DV1L 1LLRD 4ZUIA 1CSQA 5IYBH 1B3AA 2SNMA 3CU7A 3UE1A 4DR6Q 1H9RA 2TSSA 2ICEC 4RFBA 4RCNA 1I4HA 2B63B 2Q8RE 3M9BA 1RTOA 2R3ZA 2I0QA 3SK8A 1Q46A 2K7VA 2UXDL 3HOYB 4WJ4A 2QGQA 2X6GA 4R1JA 1WYDA 2EE1A 1JOQA 2IL8A 4DN4M 2IHFA 2EYHA 1JWMD 1C7YA 5F2DA 1PH9A 4DV0L 2NVXH 4MZ9A 3H3VH 1GJXA 4KHZA 1SYBA 2EYJA 3M4YA 4BBSB 5T1GA 4A3KH 1E22A 4LF8L 1D1KA 3J81E 3M7NA 4UP8A 3J81L 3H91A 1L1OA 5AJ3L 1WTXA 4FDBA 5DM73 1EYDA 3I4OA 4A3FG 4IN3A 4DAYB 4K8JA 4C3IG 3UDIA 2OT2A 3Q23A 3S1RB 2EIFA 4L63B 3I8ZA 1VQFA 4A3CG 3GV6A 4N8FA 1WCMB 4C2MB 3UDGA 1U5KA 2LMCB 3KBGA 5I4DA 2CH4A 2QEXA 4C2MH 1O7YA 1IKLA 2BE5D 2K6AA 4MNOA 4I65A 5J1ZA 3K59A 4DR7Q 2QDBA 1EU3A 4A3JB 1WTPA 3S17B 1V1PB 2AWOA 2D5DA 2D2CC 4N9PA 2F0LA 3HKZG 1YIJA 4DV7Q 1YHAA 5IWAQ 5C44B 3NXWA 4B08A 2PZWA 3FMCA 4GOPB 4IUVA 1GXDC 5IGCA 2VUMB 1AFPA 1LUZA 5CGKA 5CV4A 3I56A 3OOCA 1KAAA 2G9HD 1TIID 2B39A 4G57A 2KJXA 4ULLA 1JORA 4H13C 4KJNA 2B2TA 3WOFA 4POGA 1CZGA 4JI7Q 1PTOF 2M2LA 1V8QA 1L1OC 4LUOA 2JA8B 3VYRA 3GTMB 2XVSA 4JBJA 4KMUC 2OTJA 1O80A 3HZXA 3T56B 1UEAB 1KLUD 1PFNA 4JYAQ 4P71A 2C5CA 4LF4Q 3H0GH 3C2PA 2KEEA 3FPPA 1BOSA 3PUYA 1OO9B 1JT8A 1ET9A 3H0GB 4WJWA 4PG3A 3ERSX 1Q8KA 3OIQA 2PMZE 1G51A 4KHPL 3HOWH 1GUGA 1L0XB 3VYTA 1HUMA 1EOTA 2IPKD 4DFAA 1IL8A 4IO9A 3KUPA 2CW0D 1DM0B 2KHIA 2EYOA 4R4TA 1K0RA 2C9OA 5I6WA 4BBRB 1X9NA 3RN5A 2UUCQ 5LMNL 1N9WA 1X3FA 5EGTA 1KIXA 1SROA 2SEBD 2V1CC 1Y8OB 2A74C 4HSVA 4BY1H 1FJGQ 1KLGD 1WOCA 3TS0A 1IBML 4POFA 4JV5Q 3CMEA 4A3EG 2KCNA 3SEBA 4KY5A 4X66L 2OQKA 1N32Q 2JA7H 3A8IE 4XYQA 1TY0A 1SMYD 1A2TA 1STHA 2RDGA 4L6TB 4GS3A 1ASZA 2G9DA 1TWFB 4HJ8A 3DM1A 4H02A 1CM9A 2R93B 2NTSA 1NAPA 4LFCL 1JQYD 2QDLA 5JPMC 4IUPA 2QKIC 3CD6A 3RZDB 1KRSA 1ENFA 2QEJC 2E2JB 4ZK9B 4FYDA 3R3OA 2UUBQ 2D62A 4JI6L 2JSOA 1WTOA 4RHSA 4CDDC 4ZLTF 2RQXA 2VUMG 5C5LA 2L15A 2XRSD 4QGUA 1PH3A 1UE7A 1C8CA 3MFGA 1D1IA 3H15A 3R8BA 1OXSC 1HCZA 3PIPA 1B9NA 4JI1L 3QJYA 2JA5G 3G48A 1QUQA 4IQZA 1QE6A 2UUBL 4PZ6A 4GN3B 3J81c 4GN5A 1VQNA 1CQFA 4A3JG 2JP1A 4N8X1 4JC0A 3DEOA 1H9MA 1H9KA 1J9OA 1TWGB 3SK5A 2HD3A 1AEXA 3OWFA 1Q1BA 2NVYH 4H7BA 3L7ZC 1I94Q 5KYIA 4N9TA 1SFOB 5HGQA 3J80c 5C3EB 4J1MA 3BDCA 3R93A 1XTCD 2PW7A 5C44H 1E2VA 3VR3A 1M4VA 3DEPA 3U4ZA 4X3SA 2LFNA 3MHBA 5K36H 3C3LA 5C3EH 1U4LA 3TP8A 3D3RA 4ZKBB 3FVQA 1VCIA 4NP5A 4JBKA 2I5HA 4HIKA 4KHPQ 4OWWB 1QILA 1Q82C 2A69C 4NB3A 1Z6HA 1NCVA 3BZKA 4XQQA 2ZXOA 4LNQA 4OIJA 3E5SA 2ZJRA 1FR3A 4CKBA 4MTKA 1S5ED 5C44G 4LF7L 4C3JG 1PHJA 1DYQA 3VR2A 1HNZL 3J7YW 2PI2E 3HOXH 3FRPB 5C3EG 4A3DG 3HOZH 4CHTB 2E76C 3TDQA 4A3GG 1KAWA 2IT1A 5BR8L 3BS1A 1X32A 5I2XA 3HOYG 1F2MA 2F0VA 4DK0A 2VS1A 2ZT9C 3M4OB 2VQEL 1KXLA 4J6HA 1D5MC 1PXUA 3L2PA 4LF4L 3CC4A 3HG9A 3CPWA 5D3DA 5C0XG 1I50H 1K8MA 2WACA 2ZM6L 1S40A 4IOAA 4G7OC 4OWXB 2DJGC 3AEVA 1RJTA 3HFZB 2R7DA 3E9HA 2K05A 3M85A 5FK9C 2GA4B 4NPSA 1EY8A 4Z9CB 2F0WA 1Y8NB 1B70B 3PCOB 2B2VA 1DJRD 4GZYC 4DR5L 4A3KB 4AQYQ 4HCEA 1MSHA 2E5LL 3CAMA 4X6AH 3X3MA 2XGTA 5C0XJ 1SYGA 3UDXA 1EWHA 2RDHA 4FNFA 2N78A 4C1NK 2CFMA 1E1TA 2AWNA 4CJ2C 5E7NA 4JI5L 3OHXC 4OO1H 1M1KC 1B50A 5CMDA 3TMEA 3I91A 2I46A 4A3DH 2K5QA 1HZCA 1N8RC 2KENA 3H3VC 1VQCA 1B9MA 3T16A 1I3QH 4RA8A 4UAIA 2BCOA 2E2HB 2WINB 1J6QA 1I4PA 5G3LD 3PO3G 1U4RA 1QZHA 2CQAA 3G71A 1X56A 3I7FA 2MJ8A 1Y1VB 3JAML 1WD0A 2JE6I 5KEEA 2R92G 3K57A 2NVTH 1BCPB 1PZID 2FMCA 3CC2A 1HZ9A 2A6EC 2MQHA 4MN3A 3DMUA 2PYKA 2AMCB 2AKWB 1TKWB 3KYHC 1AP0A 4OEMB 4JV5L 3J7AF 3G7LA 4KK7A 1PV4A 4JI6Q 2JXMB 1NTGA 3RZDH 3K81C 3D6WA 5LHY1 3QWNA 2PQAA 5DNFA 5M3MG 1QUQB 4IPDA 1VQHA 5E1FA 1ZEQX 4IALA 2Q2TA 1S5BD 4A3EB 3HOXB 2J4XA 2A6HD 2Y0SG 3CP0A 4NXML 3L3OC 4K2KA 4G7HC 1Y69U 2CH4W 4DR4Q 4XDXA 5IYDG 2Z1CA 4C1NI 2B2VC 4LW1A 3VYUA 1R9TB 1P8LA 3LWUA 4P72A 3EQLC 3VA5A 2VQFL 1XXGA 3H6MA 2Q2UA 1BBUA 2UUAL 3DXJC 2JA8G 3GTQB 2EJGC 1SMYC 3MEHA 3PGZA 1B2TA 4JOIC 4O0AA 3S2DH 2F0NA 2VB3X 2ALYB 3D4RA 4B3RQ 5D3IB 2UXDQ 1SEBD 1VQPA 1CHPD 1DCZA 2HHHQ 1HNZQ 3D6CA 3S2HB 4FVMA 3CHBD 1HNXL 1JMCA 3K5NA 3KLSA 1QCBD 1JOKA 1SE2A 2CCZA 4QUCA 4U673 2R93G 2E2IB 1LTRD 3OMCA 4TQUS 2JN4A 1XPUA 1Y1VG 2SOBA 1ML0D 3HS0C 5C4XH 2JA8H 3T53B 1CQVA 3QG1A 3PF5A 3OWEB 1TWCH 4DPGA 1B1ZA 4YWKA 2OF1A 5HY6A 5LL6S 1HR0W 4OX9L 4LUZA 2GN5A 1STBA 2WB1E 4YWLA 3MEFA 4BBRH 4XTCS 2K03A 2A19A 3F2CA 1O7LA 5EQ0A 2DGYA 4KHVA 4RG1A 2P5ZX 3TREA 4JBWA 2OTLA 4JI8L 1EU4A 5LMNW 2R7FA 4IFDG 3T51B 1CT1D 2F0HA 1NNXA 2RSNA 1N36L 5HGTA 4DV3Q 1Q86C 4DV6L 2MO0A 1XNQL 5D14A 1TWAB 2HDLA 3MC0B 3HOVH 1WTRA 1B44D 3M4QA 1V9PA 1EQVA 5JEAJ 5IYCG 1SE3A 3D0FA 5BN5A 3PV0A 5GAHC 1D8LA 3S14H 1YNJC 1Q90A 1CSPA 1Q81C 2E8GA 3A7LA 5IT9L 1XMOQ 5IP7G 2KA7A 4RAUC 2N8NA 3PIP3 4QB4A 2K75A 1IYJB 2PCFB 1ASYA 4HIOA 5IGBA 4A3MG 1A8VA 2QCPX 2WAQE 3A56A 4A3FH 1E3PA 3U50C 3VR5A 5H1SE 2JEAI 4KKSA 1V1OA 3M4OH 2DY7A 4MHEA 2IX0A 2JQOA 3W5OA 4EX5A 5IY0A 1GHKA 1GKHA 1S72A 2A68C 1PH8A 1HNWL 2F0IA 4OWTB 4ZQ3A 1SDFA 2BOSA 3E6ZX 5COYA 4JI0Q 4U68A 4B9XA 2WAQG 4X3KA 4KD4A 3HOVB 5M5YB 3P7JA 1BF4A 5EPJA 3UI2A 2UUCL 2F0PA 1SJED 4B3MQ 4QF4A 2VUMH 1W6KA 1TT2A 1K3RA 1UAPA 2HDMA 1JOOA 3NEMA 4NW2A 4AIMA 1YJWA 3K5LA 1B4OA 5EJWA 5G3LF 2R7ZH 2I5MX 1S5FD 1R9TH 2K5WA 3NPPA 3K6OA 2Z4HA 3O13A 4IPGA 2F0SA 4Q5VA 1X3QA 4HJ7A 1S3OA 1XWEA 2NBFA 1H9SB 1IBKL 3S17H 1VQGA 4DV0Q 2SNSA 3OMGA 4MIUA 4OGQC 1S4ZA 5FLMG 4APVA 4C3JH 3FPUB 5E3FA
chains in the Genus database with same CATH topology
3QB3A 4RGMA 2F3VA 2X6LA 4PNYA 1I4QA 4ID6A 1WTWA 1NR2A 2Z8LA 3TBIB 1EZ6A 2PNRC 5HURA 1VMCA 1EYCA 2HCCA 1BR9A 3MVVA 4E6IA 2M9VA 2EOTA 2JEBI 3W2DA 2MHVA 5C0XH 1I6HB 5C4HA 5CC4A 1TY2A 5CBEE 2A68D 1HRJA 5KNBA 3S14B 2B2WA 2KOLA 4BA2I 2NVXB 3NWTA 3GO5A 1NSNS 5EPLA 3PUWA 3NSWA 4C3HG 1U4PA 5EKKA 1SNCA 1A6XA 3HOUB 3J80L 1ICWA 4M8AA 1TQOA 4KN4C 3T13A 3I4LA 1F9SA 4KD3A 3HKZB 2K5DA 1SAPA 1EIGA 3M3YB 4QCLA 3S1NB 4FF2A 1WD1A 3OSOA 1SJHD 3F2UA 2VB2X 3MWYW 5EKIA 3OW7A 4NDXA 3Q24A 1R4PB 4KJOA 4CKEA 3HGBA 1QNUA 4KKUA 4EQNA 1SE4A 1B53A 2NYZD 1PTOC 3NTHA 3BG3A 1LTBD 4BWGB 4BS9A 5T1IA 2F0UA 5C0XI 4QUFA 5KYLA 2NZ1D 1PZJD 4FXGC 4CGYB 5LL6X 3V2TA 5M5WB 3MFYA 1PRTB 1KNAA 1RKNA 3MXUA 5JVG3 4IFDH 1TWHB 4F8MA 3SHLA 2A6HC 3MA2B 3MTSA 3EJIA 4FXKC 1XYIA 2YU9B 1IW7D 1STEA 3TP6A 3ONAB 5FO7B 4DK1A 4A93B 1GUTA 2A69D 2TMPA 2L0CA 1HPCA 3PUZA 1PRTD 5CORA 1I6VC 1TWCB 4R8IA 3N52A 4C3IB 3QOJA 1IYVA 3S1QB 2OEOA 3I70A 5JAVA 5A2QL 1RDPD 4HCSA 3M7GA 4PMWA 2IX1A 2EYPA 1QB5D 3N6RA 4HMJA 5FO8B 4KY6A 1PZKD 5M3FB 4DA2A 4G4KA 5C5MA 4BY7B 5JEAH 1BCPC 5IGGA 1Q12A 1HQRD 2KUMA 2K04A 1GUWA 2EJFC 2EPBA 1EIHA 2O4XA 1CK1A 3C46A 5IGFA 1OXXK 4RWSC 4ZYSA 2K1BA 3A8KE 4EGVA 4HEDA 1BUVT 2LS01 1ZYRC 2K32A 1KABA 2AQ1B 2JA5B 2EXZA 2PW5A 3S9WA 1M8AA 2A6ED 1PFBA 2B2UA 1BCPF 5ISRA 4RCOA 1IKMA 2DN8A 1HTPA 2K28A 4O1NA 2EDGA 1HXYD 1LT4D 5KRUA 4EQPA 1VF5C 4TSSA 4F88A 1KTKA 1I4XA 2NVYB 1LTID 2F0MA 2MPMA 1SYEA 3T4AC 3LWEA 5IT9E 3I4MB 1BCPD 3D31A 3I72A 2B2TC 1STGA 1LTGD 4AYBB 1HQMC 2F0KA 2KCCA 2PMZB 3K5OA 3P20A 1G291 5FLXE 2AQ3B 3NK9A 4A3GB 5EPKA 3Q6SA 5FOBB 3A55A 4OO1I 4PMCA 5I2YA 1STAA 5C4JB 3KBXA 1RODA 1NR4A 2J7ZA 3KLRA 1D5XC 1GUNA 1I4RA 2F1MA 2XN9C 4I7ZC 4RH6A 2HUGA 1WTVA 1JR0D 3HEJA 1FNVA 3S1MB 2JA7B 3LNNA 4R8NA 1QJOA 3SK4A 2RA4A 3QIAA 2IX3A 3H09A 3C1FA 2EYMA 2MUYA 2NN6H 2B2YA 2WKDA 3CRLC 1DXMA 3P75A 1PRTF 4CBVA 2PPBC 3ZYYX 2L5TA 3EA6A 4DF7A 1ILPA 3E0JA 2DNEA 4IURA 4X3TA 1BQQT 1C4QA 2HCIA 5C3WA 3GTLB 2QILA 4PQXA 5EBCA 3Q22A 1UNSA 3VR4A 1EFID 1XX8A 5J22A 5IODA 1RCVD 2CW0C 3C1EA 4A3FB 4ZUJA 4ZAIA 4CKCA 1MI2A 2NN6G 3NBHA 3QO2A 4J8QA 5BN4A 1JC7A 2NVQB 1TS5A 4FP5D 4DGZA 1QNKA 3HP3A 2L11A 1A3UA 1LTAD 1G2TA 5IGEA 5M3MB 1TR5A 4WFN3 3NHHA 3TZDA 1YNND 1EZ8A 3BVGA 3DWPA 5C4ZA 3NE5B 1L0YB 1W6JA 3NTIA 4Y7NB 1SNMA 3AU7A 3TP5A 2SDFA 3S2DB 2L55A 3SK6A 2FJ2A 1JCKB 2EYLA 1CZWA 4TKOB 4OHJA 4G7ZC 1QWYA 4RGTA 4S3SA 1AZPA 1E0BA 4FF4A 5KGUA 2B2WC 3S16B 2K01A 1Z47A 4OL7A 2R7ZB 1D5ZC 2YYZA 2L1BA 4ZKCB 1I4GA 2ZXPA 1G6ZA 1J8IA 1V43A 2H4OA 1SNDA 2JA6B 1OXTA 1C48A 2XWBB 1JWUD 2EZVA 1HA6A 2F0EA 2WP8J 2XRQD 4IUNA 1I50B 3W3AA 1PTOB 5ELCA 5DAUA 1PFMA 3J7AV 3DHQA 4K6DA 2EY1A 2B2UC 4C56C 1PTOD 2K33A 2JYOA 2ID0A 2RVLA 4C3HB 1D2BA 1CTMA 1SNQA 2KVMA 4FXDA 1SBBB 5CBAE 3SR1A 1F9QA 1JE4A 4FF3A 2Q8TA 2EY5A 5I6YA 4IFDJ 3PO3B 2AQ2B 2WB1B 2IW3A 5CR3A 2DY8A 4P2CB 3CKIB 3R2TA 1SXTA 2VXWA 1CI3M 2O5JC 1F2ZA 4TRDA 4ABNA 2PQEA 2KEDA 1STNA 3R2IA 3K5MA 3RMHA 4K8IA 3AMUA 3FKIB 3EVQA 3HRZC 3URYA 2A73B 1BDOA 4KI0A 3SDZA 4RKBA 1G8ZD 1TS3A 1A2UA 1F77A 2WIIB 2EY2A 5IOCA 3PIO3 3SE0A 1LT6D 3FDTA 2RKSA 5JPNC 5FKAC 2BA0A 4RGNA 1PRTC 2J0TD 2BDNA 1AW7A 3D8GA 2RBMA 1F9PA 4UDUC 4KTAA 2PZUA 1EYAA 3GD7A 2B2YC 1LTSD 2R6GA 5M5XB 3IL8A 4X3UA 1EY4A 5ELFA 4K2LA 4IUUA 4XQJA 1EL0A 1LO5D 2F0QA 3GTGB 3SXHA 1MGSA 3NQTA 3IAYA 4OIKA 1F2YA 3IFDA 4PMBA 2F0JA 2MP1A 4BY1B 2NB0A 4FO2A 1JICA 3NP8A 3RZOB 2XWJB 1RD9D 2FINB 1LTTD 1TS2A 5JJZA 3FEWX 1HHVA 2CVRA 1DOLA 2EY6A 3P1HA 3BYTB 1D6EC 3KK7A 4V190 2VNUD 4WORA 3EROA 1KNEA 1X3PA 3NTKA 5IIFA 3IKJA 1STYA 2F0TA 2NWGA 2KHSA 1RHPA 4DAPA 3OIPA 3JAME 2EYFA 1OXUA 2O2LD 1SNOA 2WKCA 2QF7A 1EEFD 1HUNA 1ZYRD 1II3A 1Z7TA 3V96A 5E4WC 3VR6A 5KIXA 3PUXA 2ENBA 1BXTA 2M00A 4RHRA 2BA1A 1ESRA 2F0GA 5CV9A 3ERQA 3BYYB 4ZRZA 3WOEA 2R61A 1U9RA 1MBYA 4A3MB 1HFNA 1PYWD 3TN2A 4XXEA 3RLFA 3ND8A 5A35A 2FFKB 1Q8IA 4DXGA 1BBXC 3PO2B 4ODGA 2DNCA 1FYCA 4F87A 5K5PA 1F2LA 1CHQD 1WTQA 1EQTA 3X3NA 4KN7C 1ILQA 1LT3D 1A3TA 1ZXTA 1HA5A 2E2DC 3TP7A 3A8JE 2N55A 1EEID 4NKLA 5M9OA 5TSSA 1BNZA 1EY0A 2F0FA 2N88A 5NUCA 2IWHA 3EFXD 3V05A 1Q3LA 5I9OA 3I73A 4LMQD 5IGDA 1KDAA 4M1UB 1WVLA 3G6JB 2F3WA 2OXPA 1DOKA 1GUSA 2XNAC 1I3QB 4HN7A 5C6AA 4XIGS 1GOZA 3H94A 4L8JA 1DOMA 4IUQA 2HQEA 3NQIA 1G91A 3RUZA 4DNTB 3J80E 5C3XA 4A3IB 2NVTB 3CQZB 1O78A 2BE5C 4DAYA 4HAEA 1LT5D 5CV6A 1PDQA 1ONLA 1LACA 2BDOA 3ITPA 1YNJD 5DEHA 3GP7A 4K5VA 5I9PA 1ENAA 3HOZB 4A3BB 5CV8A 4WRDA 1FNWA 1PMRA 1SYFA 1YNNC 4B9WA 1RF2D 1Y1WB 1GHJA 1F9RA 3NBIA 1DZ1A 2NTTA 2IJ0A 2AUKA 4LJZC 2O5IC 1TVXA 2ICIA 5KNDA 4QIWB 4H0LC 4XQNA 3GV3A 5EBDA 1V1PA 2PO4A 1S5DD 4O42A 4RKLA 1NUCA 2EJMA 4XYOA 4EQOA 2KECA 5FLXL 3U9SA 5BN3A 2L4NA 1T5XD 1VDZA 1A15A 2V4DA 1E2WA 2NN6I 1IW7C 2F4IA 1OXVA 1IYUA 4K14A 1K8OA 1MD2D 3BZDB 2FMMA 2F0DA 4K5XA 3QOLA 4KY7A 5CV5A 1SSOA 1TU2B 5ELEA 4IUTA 4PV1C 4DAVA 3ND9A 3I4NB 5JEAG 4DNRB 1O7ZA 4LAAA 1R4QB 4K5WA 3MZ5A 4ME5A 2E74C 5K36G 5AFWA 1JB3A 5C4XB 2B8FA 2NUCA 4H44C 3DUZA 4HTHA 3TZUA 4BA1I 1LV9A 1KDCA 1EWCA 1SYDA 4A3DB 3VA7A 1A3VA 4IZ8A 1SYCA 1KDBA 3PMFA 3DWAA 1CA5A 1K83B 4JK1C 3OPOA 3A7AB 2WAQB 2H1EA 3I3CA 4F7XA 1RTNA 4HMIA 4LK1C 3MAQA 4ILWA 2CHBD 3TSSA 3K7AB 5KNCA 1EY5A 3NWSA 1MSGA 3K0YA 5E4XA 2Y0SB 2Z4IA 5CV7A 1VF7A 1H9JA 2B8GA 5D65A 3Q0AA 4EVOA 2LKVA 1H9SA 3WDNA 4NMZA 3GQBA 2A5HA 3BVZA 3GTKB 3BDOA 2D9UA 3BVMA 4DU9A 1HFGA 2XIWA 4YIJA 3GTPB 3IFTA 5EKLA 1ESFA 2EVBA 1T5EA 1PLFA 3RD4A 4KV6A 1AN8A 1QOHA 4V0BA 3DWQA 1CA6A 4Q0FA 4HSPA 3S15B 3NUCA 5CYUA 5FO9B 2E75C 4DXFA 1VMPA 4FF1A 3I90A 3KLSX 3GTOB 4QMGA 3MXGA 3U9OA 3CRKC 4OO1G 1EY6A 1CFMA 1QG7A 3MXNA 1JWSD 3L9AX 2LY7A 1ZKOA 2F03A 1Y8PB 1EY7A 2L12A 5JOBA 2KQ3A 2L9HA 1SNPA 1G2SA 1FNUA 3SVMA 1FD7D 3MXPA 1AZQA 5J39A 4KKTA 3GTJB 1S5CD 2XSCA 1DD2A 2Q8IB 1IHZA 4HR7B 2PZTA 3KF8A 1BO0A 3AB9A 3D4DA 2ZXRA 1PTOH 1TS4A 1UUPA 2F0OA 1ET6A 1GUOA 2AUJD 2RDFA 5ELDA 2I07B 3A54A 3VYSA 5JVH3 2FHTA 4IFDI 5DM63 3D4WA 1EY9A 3LX0A 1DONA 3K58A 1LABA 1HTLD 3HOWB 2RSOA 1U4MA 4R9WA 2R92B 4XT1B 1Q1EA 4C3JB 4K6LA 4RGOS 1E2ZA 2WV6D 4CJ1B 4XT3B 2MGSA 3BDLA 2X69A 3PUVA 4CJ0B 1FGBD 1ENCA 5A2QE 5ELBA 1LLRD 4ZUIA 1B3AA 2SNMA 3CU7A 1H9RA 2TSSA 2ICEC 4RFBA 4RCNA 1I4HA 2B63B 2Q8RE 1RTOA 2R3ZA 3SK8A 2K7VA 3HOYB 2X6GA 2EE1A 1JOQA 2IL8A 4DN4M 2EYHA 1JWMD 5F2DA 1GJXA 4KHZA 1SYBA 2EYJA 3M4YA 4BBSB 5T1GA 1D1KA 3J81E 3M7NA 3J81L 3H91A 1WTXA 5DM73 1EYDA 4IN3A 4K8JA 4C3IG 2OT2A 3Q23A 3S1RB 4L63B 3I8ZA 3GV6A 1WCMB 4C2MB 2LMCB 3KBGA 5I4DA 1O7YA 1IKLA 2BE5D 2K6AA 4I65A 5J1ZA 3K59A 2QDBA 1EU3A 4A3JB 1WTPA 3S17B 1V1PB 2AWOA 2D5DA 2D2CC 4N9PA 2F0LA 5C44B 4B08A 3NXWA 2PZWA 3FMCA 4IUVA 1GXDC 5IGCA 2VUMB 1AFPA 5CGKA 5CV4A 3OOCA 1KAAA 2G9HD 1TIID 2B39A 4G57A 2KJXA 4ULLA 1JORA 4H13C 4KJNA 2B2TA 3WOFA 1CZGA 1PTOF 2M2LA 1V8QA 2JA8B 3VYRA 3GTMB 2XVSA 4KMUC 1O80A 3HZXA 3T56B 1UEAB 1KLUD 1PFNA 2C5CA 3C2PA 2KEEA 3FPPA 1BOSA 3PUYA 1OO9B 1ET9A 3H0GB 4WJWA 3OIQA 1GUGA 1L0XB 3VYTA 1HUMA 1EOTA 2IPKD 4DFAA 1IL8A 3KUPA 2CW0D 1DM0B 2EYOA 2C9OA 5I6WA 4BBRB 5EGTA 2SEBD 4HSVA 1Y8OB 2A74C 1KLGD 2KCNA 3SEBA 4KY5A 3A8IE 4XYQA 1SMYD 1TY0A 1A2TA 1STHA 2RDGA 4L6TB 2G9DA 1TWFB 3DM1A 1CM9A 2R93B 2NTSA 1NAPA 1JQYD 5JPMC 4IUPA 2QKIC 3RZDB 2QEJC 1ENFA 2E2JB 4ZK9B 4FYDA 3R3OA 2D62A 2JSOA 1WTOA 4RHSA 4ZLTF 2RQXA 5C5LA 2XRSD 1C8CA 3MFGA 1D1IA 3R8BA 1OXSC 1HCZA 1B9NA 3QJYA 1QE6A 4IQZA 1CQFA 2JP1A 3DEOA 1H9MA 1TWGB 1H9KA 1J9OA 3SK5A 1AEXA 3OWFA 1Q1BA 4H7BA 3L7ZC 5KYIA 4N9TA 1SFOB 5C3EB 4J1MA 3BDCA 3R93A 1XTCD 2PW7A 1E2VA 3VR3A 1M4VA 3DEPA 4X3SA 2LFNA 3MHBA 5K36H 3C3LA 1U4LA 3TP8A 3D3RA 4ZKBB 3FVQA 1VCIA 4NP5A 1QILA 2A69C 1Z6HA 1NCVA 4XQQA 2ZXOA 4OIJA 3E5SA 1FR3A 4CKBA 1S5ED 4C3JG 1DYQA 3VR2A 3J7YW 3FRPB 4CHTB 2E76C 3TDQA 2IT1A 3BS1A 1X32A 5I2XA 1F2MA 2F0VA 4DK0A 2ZT9C 3M4OB 4J6HA 1D5MC 1PXUA 3HG9A 5D3DA 5C0XG 2WACA 1K8MA 4G7OC 1RJTA 2K05A 3M85A 5FK9C 2GA4B 1EY8A 4Z9CB 2F0WA 1Y8NB 2B2VA 1DJRD 4GZYC 4A3KB 4HCEA 1MSHA 3X3MA 5C0XJ 1SYGA 1EWHA 2RDHA 4FNFA 4C1NK 2AWNA 4CJ2C 3OHXC 4OO1H 1B50A 5CMDA 3TMEA 3I91A 2I46A 2K5QA 3H3VC 1B9MA 3T16A 4RA8A 4UAIA 2BCOA 2E2HB 2WINB 1I4PA 5G3LD 1U4RA 2CQAA 2MJ8A 1Y1VB 3JAML 1WD0A 2JE6I 5KEEA 3K57A 1BCPB 1PZID 2FMCA 2A6EC 4MN3A 3DMUA 2PYKA 1TKWB 1AP0A 3J7AF 3G7LA 4KK7A 2JXMB 3D6WA 5LHY1 3QWNA 5DNFA 5E1FA 1ZEQX 4IALA 1S5BD 4A3EB 3HOXB 2J4XA 2A6HD 3L3OC 4K2KA 4G7HC 1Y69U 4XDXA 2Z1CA 4C1NI 2B2VC 3VYUA 1R9TB 3LWUA 3EQLC 3VA5A 1XXGA 3H6MA 3DXJC 3GTQB 2EJGC 1SMYC 3MEHA 1B2TA 2F0NA 2VB3X 3D4RA 5D3IB 1SEBD 1CHPD 1DCZA 3D6CA 3S2HB 4FVMA 3CHBD 3K5NA 3KLSA 1QCBD 1JOKA 1SE2A 4QUCA 4U673 2E2IB 1LTRD 3OMCA 4TQUS 2SOBA 1ML0D 3HS0C 3T53B 1CQVA 3QG1A 3OWEB 1B1ZA 2OF1A 5LL6S 1STBA 4XTCS 2K03A 1O7LA 5EQ0A 4KHVA 4JBWA 1EU4A 4IFDG 3T51B 1CT1D 2F0HA 2RSNA 5HGTA 5D14A 1TWAB 2HDLA 3MC0B 1WTRA 1B44D 1EQVA 5JEAJ 1SE3A 5BN5A 3PV0A 1YNJC 1Q90A 3A7LA 5IT9L 2KA7A 4RAUC 3PIP3 4QB4A 2PCFB 5IGBA 2QCPX 3A56A 3VR5A 2JEAI 4KKSA 1V1OA 2DY7A 4MHEA 2IX0A 1GHKA 2A68C 2F0IA 4ZQ3A 1SDFA 2BOSA 3E6ZX 5COYA 4U68A 4B9XA 4X3KA 4KD4A 3HOVB 5M5YB 3P7JA 1BF4A 5EPJA 3UI2A 2F0PA 1SJED 4QF4A 1W6KA 1TT2A 1UAPA 2HDMA 1JOOA 4NW2A 3K5LA 1B4OA 5EJWA 5G3LF 1S5FD 2K5WA 3NPPA 3K6OA 2Z4HA 3O13A 4Q5VA 2F0SA 1X3QA 1XWEA 2NBFA 1H9SB 2SNSA 3OMGA 4MIUA 4OGQC 1S4ZA 3FPUB 5E3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEP A;  2KEE A;  2FJ2 A;  4RWS C;  1KNE A;  1DZ1 A;  4X3S A;  1WD0 A;  1KNA A;  1X3P A;  5T1G A;  2X6L A;  2H1E A;  2RSN A;  1WTW A;  1U4L A;  1Q3L A;  2K1B A;  1NR2 A;  3I3C A;  1TVX A;  4LMQ D;  1WVL A;  2RA4 A;  1RTN A;  4ZKB B;  4HED A;  3H91 A;  5D14 A;  1WTX A;  2HDL A;  1WTR A;  1VMC A;  2HCC A;  2B2Y A;  2NWG A;  1BO0 A;  4MN3 A;  1RHP A;  2EOT A;  1AP0 A;  1HUM A;  1EOT A;  1E0B A;  1MSG A;  1NCV A;  2N88 A;  3GV3 A;  3MTS A;  3G7L A;  1IL8 A;  5E4X A;  3I8Z A;  3KUP A;  2B2W C;  3GV6 A;  4OIJ A;  3D6W A;  2K01 A;  1XYI A;  5DNF A;  3ONA B;  5D65 A;  1DOK A;  3FDT A;  4O42 A;  5CBE E;  1HRJ A;  4RAU C;  1ILP A;  1HUN A;  4IUR A;  4X3T A;  4HSV A;  1M8A A;  2L1B A;  5E4W C;  2KEC A;  2B2W A;  2KOL A;  1PFB A;  2B2U A;  2HCI A;  4ZKC B;  1O7Y A;  2L4N A;  1IKL A;  2BDN A;  4XDX A;  1G6Z A;  1A15 A;  1J8I A;  5EPL A;  2D9U A;  2B2V C;  1HFG A;  1X32 A;  2FHT A;  1F9P A;  1ESR A;  1IKM A;  1XX8 A;  2XIW A;  5COR A;  1DOM A;  1WTP A;  1U4P A;  4IUQ A;  2B2Y C;  2K28 A;  4R8I A;  2DY7 A;  3N52 A;  4MHE A;  1G91 A;  1PLF A;  1DON A;  3IL8 A;  2FMM A;  1ICW A;  4ZAI A;  4X3U A;  1CA6 A;  1MI2 A;  1AZP A;  1HFN A;  3DM1 A;  1HA6 A;  4IUU A;  2RSO A;  1U4M A;  1B2T A;  1EL0 A;  4R9W A;  1SDF A;  1CM9 A;  3QO2 A;  1F9S A;  1SSO A;  3TN2 A;  4XT1 B;  1NAP A;  5COY A;  4U68 A;  1RJT A;  4X3K A;  1PFM A;  4HAE A;  4HCS A;  4IUP A;  4IUT A;  1SAP A;  4IUV A;  2K05 A;  2MPM A;  1EIG A;  2B2U C;  2FFK B;  3LWE A;  4ZK9 B;  1VMP A;  3P7J A;  1BBX C;  1WD1 A;  1MGS A;  1BF4 A;  5EPJ A;  1PDQ A;  2JYO A;  3I90 A;  4XT3 B;  1O7Z A;  2RVL A;  3UI2 A;  4CJ1 B;  3F2U A;  1WTO A;  2B2V A;  2MGS A;  2X69 A;  4ZLT F;  1F2L A;  2B2T C;  2KVM A;  1MSH A;  3MWY W;  4QUC A;  4OIK A;  5EKI A;  4CJ0 B;  1QNK A;  5AFW A;  1WTQ A;  3HP3 A;  3IFD A;  5CBA E;  1B3A A;  1EQT A;  1QG7 A;  1ML0 D;  2HDM A;  1C8C A;  2L11 A;  4NW2 A;  2MP1 A;  1F9Q A;  1G2T A;  1B4O A;  5EJW A;  1ILQ A;  1JIC A;  2B2T A;  4CJ2 C;  1LV9 A;  1ZXT A;  1JE4 A;  1B53 A;  2Q8R E;  5EPK A;  2L12 A;  2M2L A;  3Q6S A;  2Q8T A;  2KUM A;  1RTO A;  2R3Z A;  3I91 A;  3TZD A;  1QE6 A;  1X3Q A;  2NYZ D;  5CMD A;  1B50 A;  2K04 A;  2FIN B;  2N55 A;  1GUW A;  2L9H A;  2DY8 A;  2JP1 A;  3KBX A;  5T1I A;  3DEO A;  1ROD A;  2EPB A;  1NR4 A;  1J9O A;  1O80 A;  2J7Z A;  2X6G A;  2K03 A;  2EE1 A;  4RA8 A;  4UAI A;  4QUF A;  5JJZ A;  1HHV A;  2IL8 A;  4DN4 M;  1EIH A;  2CVR A;  2VXW A;  1G2S A;  1PFN A;  5EQ0 A;  1DOL A;  2NZ1 D;  1U4R A;  3SVM A;  1BNZ A;  2HUG A;  1S4Z A;  1WTV A;  1CA5 A;  1AZQ A;  2KED A;  3FPU B;  3R93 A;  2SDF A;  2MJ8 A;  1F9R A; 
#chains in the Genus database with same CATH topology
 3QB3 A;  4RGM A;  2F3V A;  2F52 A;  1NY4 A;  4JVZ A;  2X6L A;  4PNY A;  1I4Q A;  4ID6 A;  4Y7N H;  1WTW A;  1NR2 A;  4UY8 C;  2Z8L A;  3TBI B;  1EZ6 A;  2ZTC A;  2PNR C;  5HUR A;  1VMC A;  1EYC A;  2HCC A;  1BR9 A;  3MVV A;  4E6I A;  2M9V A;  3I4M G;  2EOT A;  2C35 B;  2JEB I;  4QJF A;  4A75 A;  3W2D A;  1C0A A;  3F1Z A;  4JI2 L;  2MHV A;  1MKH A;  5C0X H;  1I6H B;  5C4H A;  4YHH Q;  2YU9 H;  5CC4 A;  1TY2 A;  5CBE E;  2B63 G;  2A68 D;  1HRJ A;  5KNB A;  3S14 B;  4HJA A;  2B2W A;  2KOL A;  4BA2 I;  2NVX B;  3NWT A;  1B3Q A;  1H95 A;  1FVI A;  3GO5 A;  1NSN S;  5EPL A;  3PUW A;  1XNQ Q;  3NSW A;  4C3H G;  2OQ0 A;  1U4P A;  5EKK A;  1SNC A;  1TWG H;  2YTV A;  1A6X A;  3HOU B;  3J80 L;  2DJF C;  1ICW A;  4M8A A;  1TQO A;  4KN4 C;  3T13 A;  1K8A C;  4PZ8 A;  4DV5 L;  3S15 H;  4A3I H;  3E3X A;  4LUV A;  3H3V I;  3I4L A;  4DR7 L;  3HOU H;  1F9S A;  4KD3 A;  3T1H L;  3HKZ B;  2K5D A;  1SAP A;  1U0L A;  1EIG A;  3M3Y B;  4QCL A;  3S1N B;  4FF2 A;  1WD1 A;  4ZCK A;  3OSO A;  1Y1V H;  1YEZ A;  1SJH D;  3F2U A;  2VB2 X;  3MWY W;  5EKI A;  3OW7 A;  4NDX A;  3Q24 A;  1R4P B;  4QY7 A;  1K3B C;  4KJO A;  4C3H H;  4YY3 Q;  4CKE A;  3I2Z A;  3HGB A;  1AE3 A;  1QNU A;  2DUD A;  4KKU A;  4EQN A;  1KRT A;  4LF6 L;  1SE4 A;  1B53 A;  1BVS A;  1XPO A;  2NYZ D;  1PTO C;  3NTH A;  3BG3 A;  2UXB Q;  1LTB D;  4BWG B;  4BS9 A;  5T1I A;  2F0U A;  3A0J A;  5C0X I;  1K0S A;  4QUF A;  4DR3 Q;  1YHQ A;  5KYL A;  1VQ8 A;  2NZ1 D;  1PZJ D;  4FXG C;  4CGY B;  5AJ3 Q;  5LL6 X;  3V2T A;  3CQZ H;  5M5W B;  3MFY A;  1PRT B;  1KNA A;  1RKN A;  4BBS H;  3MXU A;  5L37 A;  5JVG 3;  4GOP C;  3IRB A;  4IFD H;  1TWH B;  4DAM A;  4F8M A;  3SHL A;  2A6H C;  3MA2 B;  3CC7 A;  1KHI A;  2JK8 A;  3MTS A;  3EJI A;  4YCU A;  5GAD C;  1PH1 A;  4IJL A;  4R4O A;  4FXK C;  4A93 H;  1XYI A;  2YU9 B;  1IW7 D;  1STE A;  3TP6 A;  3ONA B;  4R4I A;  3CCR A;  1EUJ A;  4GNX B;  5FO7 B;  4GLX A;  4LF9 L;  4DK1 A;  4CDF C;  1EIF A;  4A93 B;  1GUT A;  2A69 D;  2JA9 A;  2TMP A;  1D7Q A;  2L0C A;  1HPC A;  3PUZ A;  4BXX G;  1PRT D;  5COR A;  1I6V C;  1TWC B;  4R8I A;  2PI2 A;  1X54 A;  3N52 A;  4DV6 Q;  4C3I B;  2F4V L;  2BH8 A;  4GNX A;  3QOJ A;  4OEL B;  1IYV A;  4X65 L;  2HIX A;  5C4J H;  3S1Q B;  2KCT A;  2OEO A;  3I70 A;  5JAV A;  1X65 A;  3A74 A;  4JI8 Q;  4ALP A;  3MXN B;  5A2Q L;  1RDP D;  4HCS A;  5DLQ E;  2R7Z G;  2JA7 G;  3AFP A;  3M7G A;  4PMW A;  2IX1 A;  3KJO A;  2EYP A;  1QB5 D;  3N6R A;  4AYB G;  4HMJ A;  5FO8 B;  4KY6 A;  3RLN A;  3STB C;  1PZK D;  3Q8D A;  1B8A A;  3TEH B;  5M3F B;  4DA2 A;  1JE5 A;  4G4K A;  4PZ7 A;  5C5M A;  4BY7 B;  5JEA H;  2HIV A;  1BCP C;  5IGG A;  4P73 A;  1Q12 A;  3GTK H;  1LYL A;  1HQR D;  1IZ6 A;  2KUM A;  5M3F G;  3CCL A;  2K04 A;  1PFS A;  5ELO A;  1GUW A;  3KDF B;  2EJF C;  5ELN A;  5FJ8 H;  2FXQ A;  2EPB A;  3J81 j;  3KFU A;  1EIH A;  2O4X A;  1CK1 A;  2H5X A;  2G5D A;  3CF5 A;  3C46 A;  1NMG A;  2ZJQ A;  5IGF A;  1OXX K;  4L5T A;  4RWS C;  2MO1 A;  4ZYS A;  2K1B A;  3A8K E;  4EGV A;  2K52 A;  3BU2 A;  1Q7Y C;  4HED A;  5FJ8 G;  4CDC C;  1BUV T;  5JJK A;  2OCE A;  2R93 H;  2LS0 1;  5M3F H;  1SN8 A;  1TWH H;  1ZYR C;  2K32 A;  5IT9 c;  2UUA Q;  1KAB A;  2AQ1 B;  3RZO H;  2JA5 B;  2EXZ A;  2PW5 A;  1I5F A;  2Z6K A;  5IP9 H;  3S9W A;  1XJV A;  1M8A A;  2A6E D;  1YIT A;  1PFB A;  2B2U A;  1BCP F;  3KF8 B;  2K5H A;  5ISR A;  1SE8 A;  1MHW C;  4RCO A;  4DR4 L;  1IKM A;  2DN8 A;  1HTP A;  1AE2 A;  2QA4 A;  2LXK A;  2K28 A;  4JOI A;  1SR3 A;  4O1N A;  3RNU A;  2EDG A;  1HXY D;  4IPC A;  1K9M C;  1LT4 D;  5KRU A;  4EQP A;  1VF5 C;  4TSS A;  4F88 A;  2CKZ B;  2Y0S E;  1I94 L;  1KTK A;  1I4X A;  2CQO A;  2NVY B;  3CMA A;  1LTI D;  2F0M A;  4HJ9 A;  2K4K A;  2MPM A;  1HZA A;  3I4N H;  1SYE A;  3T4A C;  3LWE A;  5IT9 E;  2D0O A;  3I4M B;  1BCP D;  2LSS A;  2YTY A;  4IJH A;  4LF5 L;  3D31 A;  1Y1W G;  3I72 A;  2B2T C;  2JA6 G;  1STG A;  1J5E Q;  1LTG D;  1HQM C;  2F0K A;  2KCC A;  2PMZ B;  3K5O A;  4AYB B;  2UXC Q;  3T1H Q;  3S1R H;  3J7A 5;  4R4C A;  2VZA A;  3S16 H;  2JJQ A;  1G29 1;  3P20 A;  4GKK Q;  5FLX E;  5M3M H;  2AQ3 B;  3NK9 A;  4A3G B;  5EPK A;  3Q6S A;  4UHV A;  5FOB B;  3A55 A;  4OO1 I;  2A8V A;  4PMC A;  5I2Y A;  1STA A;  5C4J B;  3S1Q H;  3KBX A;  1ROD A;  1NR4 A;  2J7Z A;  3KLR A;  1D5X C;  1GUN A;  1WI5 A;  1I4R A;  2F1M A;  2XN9 C;  4I7Z C;  4RH6 A;  1VS0 A;  2HUG A;  1IBL Q;  1WTV A;  1X6O A;  1JR0 D;  3HEJ A;  2Z6K C;  4A93 G;  1FNV A;  3TRZ A;  3S1M B;  4O2D A;  5FLX c;  3TS2 A;  1N33 Q;  2JA7 B;  3LNN A;  4R8N A;  1QJO A;  4HIM A;  3UE0 A;  5M5X H;  3SK4 A;  2RA4 A;  3QIA A;  3GTO H;  2IX3 A;  3H09 A;  3C1F A;  2EYM A;  2MUY A;  2NN6 H;  2B2Y A;  2WKD A;  3CRL C;  3DM3 A;  1DXM A;  3GTG H;  3P75 A;  2K50 A;  1PRT F;  4CBV A;  2PPB C;  3CCQ A;  2KBN A;  3ZYY X;  2L5T A;  3EA6 A;  2LXJ A;  4DF7 A;  3QR8 A;  1ILP A;  3E0J A;  2DNE A;  4IUR A;  4X3T A;  1LTL A;  3KDF A;  2VQE Q;  1EIY B;  1BQQ T;  1HR0 Q;  1C4Q A;  1YHB A;  2HCI A;  3EBE A;  5C3W A;  3GTL B;  3NBH B;  2QIL A;  4PQX A;  5EBC A;  3A5Z B;  2JA5 H;  1QVG A;  3Q22 A;  1UNS A;  3VR4 A;  5EAY A;  1ICF B;  4A3B G;  1EFI D;  1XX8 A;  1TWF H;  5J22 A;  1RL2 A;  1RCV D;  5IOD A;  2CW0 C;  3J81 i;  3TQY A;  3RN2 A;  3C1E A;  1GM5 A;  4A3F B;  4ZUJ A;  4ZAI A;  4CKC A;  1MI2 A;  2NN6 G;  1K28 A;  2I5L X;  4B3R L;  3NBH A;  3QO2 A;  4J8Q A;  4AYB E;  2CWA A;  4GLV B;  2E2H H;  1PVO A;  5BN4 A;  3FKI G;  4A76 A;  1JC7 A;  1WJJ A;  2VQF Q;  1SLJ A;  2NVQ B;  1TS5 A;  1N33 L;  4FP5 D;  4DGZ A;  4TVA B;  1QNK A;  3HP3 A;  3PO2 G;  2L11 A;  1A3U A;  3JAM c;  1LTA D;  1G2T A;  5IGE A;  4GNX C;  5M3M B;  4L5Q A;  1B7Y B;  1TR5 A;  1VQB A;  3NHH A;  4WFN 3;  3TZD A;  2UXB L;  1YNN D;  1EZ8 A;  5GAE C;  3BVG A;  4X64 L;  4MTN A;  1K83 H;  3DWP A;  3T1Y L;  5C4Z A;  2F3I A;  2NZH A;  3NE5 B;  4JI1 Q;  1BKB A;  4GKK L;  2YV5 A;  1L0Y B;  1W6J A;  3HOY H;  3NTI A;  4Y7N B;  1SNM A;  3AU7 A;  3TP5 A;  2SDF A;  2IHE A;  3S2D B;  2L55 A;  4JI3 L;  4UP9 A;  3S24 A;  4GN4 B;  3SK6 A;  2FJ2 A;  1JCK B;  1J5E L;  1VQJ A;  2EYL A;  4DUY Q;  1CZW A;  2Z0S A;  4TKO B;  1VQI A;  3K80 C;  4OHJ A;  4G7Z C;  1QWY A;  4RGT A;  4S3S A;  3F8T A;  2UU9 L;  1XPR A;  1AZP A;  1E0B A;  4Y52 H;  4FF4 A;  5KGU A;  4A3K G;  2B2W C;  1M90 C;  3S16 B;  2K01 A;  4BY7 G;  1Z47 A;  4OL7 A;  2R7Z B;  1D5Z C;  1E1O A;  4B3S Q;  1PYS B;  2HT1 A;  2YYZ A;  2L1B A;  4JPB W;  4ZKC B;  1I4G A;  1EWI A;  2MFI A;  2ZXP A;  4YCW A;  3CCE A;  1G6Z A;  3NEL A;  1J8I A;  1V43 A;  2H4O A;  4LF8 Q;  1SND A;  2JA6 B;  2E5L Q;  3CCM A;  1OXT A;  4UPA A;  1A63 A;  1C48 A;  1CKN A;  1VQD A;  2XWB B;  4A3J H;  1JWU D;  2EZV A;  1HA6 A;  3GDE A;  2F0E A;  2WP8 J;  2XRQ D;  4IUN A;  1I50 B;  3W3A A;  1PTO B;  5ELC A;  5DAU A;  3ULL A;  1PFM A;  3J7A V;  3DHQ A;  4K6D A;  2EY1 A;  2B2U C;  4C56 C;  1PTO D;  2KCM A;  2K33 A;  2JYO A;  3GTJ H;  2ID0 A;  2RVL A;  1CKN B;  2WFW A;  4C3H B;  1D2B A;  1CTM A;  1SNQ A;  2KVM A;  4FXD A;  4OXP A;  2ZJP A;  1SBB B;  5CBA E;  3SR1 A;  1F9Q A;  3HKZ E;  4BY7 H;  1JJ2 A;  5IYB G;  1C9O A;  1JE4 A;  4FF3 A;  2Q8T A;  1QVC A;  2EY5 A;  5I6Y A;  4IFD J;  4NXN L;  2B29 A;  3PO3 B;  2AQ2 B;  2GVB A;  2IW3 A;  2WB1 B;  5CR3 A;  2DY8 A;  4P2C B;  3CKI B;  1IXR A;  3OYY A;  3R2T A;  1SXT A;  2VXW A;  1CI3 M;  3PO3 H;  5GAG C;  4DV2 Q;  4HID A;  2O5J C;  1F2Z A;  4TRD A;  4ABN A;  2PQE A;  2KED A;  1IBK Q;  1STN A;  1UE6 A;  3R2I A;  4GOP A;  1EQR A;  3E0E A;  4DR3 L;  3K5M A;  5IWA L;  3RMH A;  4K8I A;  3AMU A;  1YNX A;  2VY3 A;  2MNA A;  3FKI B;  3EVQ A;  3HRZ C;  5M5W H;  3RR5 A;  1XTD A;  3URY A;  2A73 B;  3KJP A;  1BDO A;  4KI0 A;  3SDZ A;  1PH6 A;  4RKB A;  1G8Z D;  1TS3 A;  3I55 A;  1JJC B;  1A2U A;  1F77 A;  2WII B;  3HOX G;  1KL9 A;  2EY2 A;  5IOC A;  3PIO 3;  1HH2 P;  4JG2 A;  3RLO A;  5GQO A;  3SE0 A;  4DV7 L;  1LT6 D;  3FDT A;  2RCN A;  4CDE C;  2RKS A;  5JPN C;  1XNR L;  5FKA C;  2UU9 Q;  2BA0 A;  2IY5 B;  4RGN A;  1PRT C;  2J0T D;  4J15 A;  2BDN A;  1AW7 A;  3D8G A;  1SMX A;  1HNW Q;  2RBM A;  3K8A A;  1F9P A;  1EOV A;  4UDU C;  4KTA A;  1XMO L;  2PZU A;  1EYA A;  3GTQ H;  3GD7 A;  2B2Y C;  4LFB L;  1LTS D;  2R6G A;  5M5X B;  4HJ5 A;  3IL8 A;  4L5S A;  4JI5 Q;  4X3U A;  1EY4 A;  1CKO A;  1O7I A;  1T9H A;  5ELF A;  4K2L A;  1QZG A;  4IUU A;  4XQJ A;  1EL0 A;  1LO5 D;  2F0Q A;  3U4V A;  3GTG B;  2KHJ A;  4LFC Q;  4DV2 L;  3SXH A;  3S1M H;  3BZC A;  2EQS A;  1MGS A;  1UWV A;  3NQT A;  4YHH L;  3IAY A;  4OIK A;  2AHO B;  4NXN Q;  4BBS G;  1F2Y A;  2E2I H;  3HOZ G;  3IFD A;  4JI2 Q;  4PMB A;  2F0J A;  4BBR G;  3CXC A;  2MP1 A;  4BY1 B;  2NB0 A;  4R4Q A;  3K7U C;  4FO2 A;  1JIC A;  4DV3 L;  3NP8 A;  4YWM A;  3RZO B;  1FJG L;  4GKJ L;  2XWJ B;  4DV1 Q;  1RD9 D;  4EQ5 A;  1YVC A;  2FIN B;  1I6H H;  1LTT D;  2NZO A;  1TS2 A;  5JJZ A;  3FEW X;  3OTO L;  1HHV A;  2CVR A;  2D0P A;  1DOL A;  2EY6 A;  3P1H A;  3BYT B;  1D6E C;  3KK7 A;  4V19 0;  2VNU D;  4WOR A;  3ERO A;  1KNE A;  1DGS A;  1X3P A;  3NTK A;  5IIF A;  3IKJ A;  1L0W A;  4AH6 A;  1STY A;  2F0T A;  1XMQ Q;  3AFQ A;  2NWG A;  1FL0 A;  2KHS A;  1TXY A;  1RHP A;  1YBY A;  4DAP A;  4JYA L;  3OIP A;  3JAM E;  2EYF A;  1OXU A;  3GTM H;  2O2L D;  4JI4 Q;  5JJI A;  1SNO A;  2WKC A;  2QF7 A;  1EEF D;  1HUN A;  1ZYR D;  3HKS A;  1II3 A;  1Z7T A;  3V96 A;  5E4W C;  3VR6 A;  5KIX A;  3PUX A;  3PIO A;  2ENB A;  4DV4 L;  4JI7 L;  1IBL L;  1BXT A;  2M00 A;  3L0O A;  4X62 Q;  4NXM Q;  4A3L H;  3M4P A;  4RHR A;  2BA1 A;  3J80 i;  4B3T L;  1ESR A;  2Z6B A;  2F0G A;  4RMF A;  5CV9 A;  5LMU L;  3ERQ A;  3A5U A;  3BYY B;  4ZRZ A;  5GRO A;  3WOE A;  2R92 H;  2R61 A;  1U9R A;  1MBY A;  4A3M B;  1HFN A;  2OWO A;  1EQQ A;  1PYW D;  3PO2 H;  3H0G G;  3S2H H;  1V1Q A;  3TN2 A;  3SGI A;  3ULJ A;  1GVP A;  4XXE A;  3RLF A;  3ND8 A;  5A35 A;  2FFK B;  1Q8I A;  2GVA A;  4DXG A;  1BBX C;  3PO2 B;  3K7A H;  4ODG A;  2DNC A;  3ICE A;  4X64 Q;  1FYC A;  3FHW A;  4LFB Q;  4F87 A;  5K5P A;  5FLM H;  3CCS A;  1F2L A;  4QIW E;  1CHQ D;  1WTQ A;  2QW7 A;  1VQA A;  1EQT A;  1PH7 A;  3HOV G;  3X3N A;  4KN7 C;  1ILQ A;  1LT3 D;  3DLL A;  1A3T A;  1ZXT A;  3J7Z C;  1HA5 A;  4DUY L;  2E2D C;  3TP7 A;  3A8J E;  4BY1 G;  2N55 A;  4A3B H;  1P16 A;  5IP7 H;  2ES2 A;  1EEI D;  3CCV A;  4NKL A;  5M9O A;  5TSS A;  5IE8 A;  1KC8 C;  2JA6 H;  1BNZ A;  3T1Y Q;  1SFO H;  1EY0 A;  3F2B A;  2F0F A;  2Q2I A;  3HOW G;  3KF6 B;  2N88 A;  5LMN Q;  5NUC A;  2IWH A;  2Q2H A;  1VQE A;  3EFX D;  4P75 A;  3V05 A;  2ZTD A;  1A0I A;  1Q3L A;  1WFQ A;  2RHS B;  3I73 A;  5I9O A;  4LMQ D;  5IGD A;  1AH9 A;  1X3E A;  1KDA A;  2RHQ B;  3BJU A;  1BBW A;  4M1U B;  5M5Y H;  1LM0 A;  4AQY L;  4DR5 Q;  1WVL A;  1VQO A;  2EXD A;  3G6J B;  2F3W A;  2OXP A;  1DOK A;  2B63 H;  1GUS A;  2XNA C;  1I3Q B;  4HN7 A;  3PSI A;  3JAM i;  2CWP A;  2K14 A;  5C6A A;  4XIG S;  1K73 C;  4JCV E;  1GOZ A;  3H94 A;  4L8J A;  1NE3 A;  1DOM A;  4A4I A;  4IUQ A;  4KLK A;  4LF7 Q;  2HQE A;  3NQI A;  1G91 A;  3RUZ A;  1Z9F A;  3FP9 A;  1OTC A;  4DNT B;  2K5V A;  4UP7 A;  3J80 E;  4IPH A;  5C3X A;  2E2J H;  4A3I B;  2NVT B;  3CQZ B;  1L1O B;  1O78 A;  2BE5 C;  4DAY A;  4IOC A;  4HAE A;  3AYH B;  1LT5 D;  5CV6 A;  1JJG A;  3S1N H;  1PDQ A;  3CW2 C;  4DK6 C;  1VQ7 A;  4LFA Q;  3VDY A;  1ONL A;  1LAC A;  2BDO A;  1G6P A;  3ITP A;  1YNJ D;  5DEH A;  3GP7 A;  1E7Z A;  3CCU A;  4K5V A;  5I9P A;  1ENA A;  4P74 A;  4DNI A;  3HOZ B;  4A3B B;  4OX9 Q;  4LF5 Q;  1CKM A;  5CV8 A;  4WRD A;  1K8G A;  1FNW A;  1PMR A;  1SYF A;  1YNN C;  4JI3 Q;  4B9W A;  4X65 Q;  1RF2 D;  4LF9 Q;  3B6Y A;  1Y1W B;  1GHJ A;  2ASB A;  1F9R A;  5C4X G;  4GLA C;  3NBI A;  2A1A A;  1DZ1 A;  2NTT A;  2IJ0 A;  1A62 A;  2AUK A;  1JB7 A;  4LJZ C;  1X3G A;  2O5I C;  1TVX A;  1YJN A;  2HHH L;  2ICI A;  5KND A;  4QIW B;  4H0L C;  4XQN A;  3GV3 A;  5EBD A;  1Y14 B;  1V1P A;  5IP9 G;  2PO4 A;  1VQL A;  1S5D D;  4O42 A;  4RKL A;  1NUC A;  3G4S A;  5LMU Q;  4A3E H;  4A3L G;  2EJM A;  4XYO A;  4EQO A;  2KEC A;  5FLX L;  3U9S A;  5BN3 A;  2L4N A;  1T5X D;  1VDZ A;  1IBM Q;  4WJ3 M;  1A15 A;  1GD7 A;  2V4D A;  3CPF A;  1E2W A;  4YCV A;  2NN6 I;  1MJE A;  2ZM6 Q;  1IW7 C;  2F4I A;  1OXV A;  3WWV A;  1N32 L;  1IYU A;  4K14 A;  1K8O A;  4X66 Q;  1MD2 D;  3BZD B;  2FMM A;  5IYC H;  2F0D A;  4K5X A;  3KOJ A;  3QOL A;  3G6E A;  4KY7 A;  4YY3 L;  1XMQ L;  5CV5 A;  1SSO A;  1TU2 B;  2VL6 A;  5ELE A;  1NMF A;  4IUT A;  4PV1 C;  4DAV A;  3ND9 A;  3I4N B;  5JEA G;  2ZTE A;  4A3I G;  4DNR B;  4LAA A;  1O7Z A;  2YTX A;  1R4Q B;  4K5W A;  3MZ5 A;  4ME5 A;  2E74 C;  5K36 G;  2XTI A;  5AFW A;  1JB3 A;  5C4X B;  2B8F A;  4DV5 Q;  2NUC A;  4H44 C;  3DUZ A;  4HTH A;  3TZU A;  4BA1 I;  1LV9 A;  1HR0 L;  4A3G H;  1KDC A;  1YI2 A;  1EWC A;  2Z9H A;  1SYD A;  4A3D B;  3VA7 A;  1A3V A;  4IZ8 A;  4GKJ Q;  2K5N A;  2N3S A;  4LFA L;  5IYD H;  1SYC A;  1UE1 A;  4K0K L;  1FGU A;  1KDB A;  3PMF A;  3DWA A;  1PYB A;  1CA5 A;  1K83 B;  4JK1 C;  4OON A;  3OPO A;  2NVQ H;  1PA6 A;  3A7A B;  2WAQ B;  2H1E A;  1UE5 A;  1VQ6 A;  1WTH A;  4DR1 Q;  3UDF A;  3I3C A;  4F7X A;  1NJI C;  1KQS A;  1RTN A;  4HMI A;  4LK1 C;  3MAQ A;  1TWA H;  4ILW A;  1X55 A;  1W2B A;  3EIV A;  2CHB D;  3TSS A;  3K7A B;  5KNC A;  1EY5 A;  3NWS A;  1IL2 A;  1MSG A;  3K0X A;  4K0K Q;  3K0Y A;  5E4X A;  2Y0S B;  2Z4I A;  2UXC L;  2HQL A;  5CV7 A;  4JBM A;  1VF7 A;  1H9J A;  2B8G A;  5D65 A;  3STB D;  3Q0A A;  4EVO A;  2LKV A;  1H9S A;  2B3G A;  4A3C H;  3WDN A;  2RCF A;  3GQB A;  4NMZ A;  2A5H A;  3BVZ A;  1N34 L;  3GTL H;  1MJC A;  3ULP A;  1SRU A;  3GTK B;  4C3I H;  5BR8 Q;  3BDO A;  1Y1W H;  2D9U A;  1GO3 E;  3BVM A;  4DU9 A;  1HFG A;  1UEB A;  2XIW A;  2F4V Q;  4A3M H;  4YIJ A;  3GTP B;  3IFT A;  5EKL A;  3I4N G;  2PQA B;  1ESF A;  2EVB A;  1CUK A;  1PLF A;  1T5E A;  3RD4 A;  4KV6 A;  1AN8 A;  1QOH A;  4V0B A;  3DWQ A;  1CA6 A;  4Q0F A;  4HSP A;  1EFW A;  3S15 B;  3NUC A;  3LGJ A;  5CYU A;  3OTO Q;  4L5R C;  5FO9 B;  2E75 C;  1WCM H;  4DKA C;  4DXF A;  3U58 A;  1L2F A;  1VMP A;  3AQQ A;  4FF1 A;  3I90 A;  3KLS X;  3GTO B;  4QMG A;  2PNH A;  3MXG A;  3U9O A;  3CRK C;  4OO1 G;  1EY6 A;  1CFM A;  4JI0 L;  1QG7 A;  3MXN A;  1JWS D;  3L9A X;  2LY7 A;  1ZKO A;  2F03 A;  1Y8P B;  1YJ9 A;  1EY7 A;  4B3M L;  4DK3 C;  2L12 A;  1YZ6 A;  3OW2 A;  5JOB A;  3CCJ A;  2KQ3 A;  3E9I A;  2L9H A;  5JJL A;  1HJP A;  2ATW A;  1SNP A;  1G2S A;  1FNU A;  1W3S A;  3SVM A;  1FD7 D;  5J3B A;  1N34 Q;  3MXP A;  4ME3 A;  1AZQ A;  4QQB X;  3M3Y H;  3W1G A;  5J39 A;  4KKT A;  3ZJY C;  3GTJ B;  1MIU A;  3ER0 A;  1S5C D;  2XSC A;  4I7A A;  3KLW A;  2VW9 A;  1PH5 A;  1DD2 A;  1EYG A;  4LF6 Q;  1PH4 A;  2Q8I B;  1IHZ A;  2RF4 A;  4HR7 B;  3EN2 A;  4DR6 L;  2PZT A;  3PF4 A;  3KF8 A;  1WCM G;  3AB9 A;  3D4D A;  1BO0 A;  1VQ9 A;  2ZXR A;  1PTO H;  1XNR Q;  1TS4 A;  3KF6 A;  4DR1 L;  1PH2 A;  1VQM A;  1RIP A;  1UUP A;  4DV4 Q;  3PQI A;  1VQ4 A;  2F0O A;  2BH2 A;  1ET6 A;  1GUO A;  1KD1 C;  4DUZ Q;  3JC6 6;  2AUJ D;  3NEN A;  4LWC A;  1VQK A;  4B3T Q;  2RDF A;  5ELD A;  2I07 B;  3A54 A;  4QL5 A;  4X62 L;  3VYS A;  4BXX H;  5JVH 3;  2FHT A;  4B3S L;  4IFD I;  1N36 Q;  5DM6 3;  1HZB A;  4DR2 L;  3FKI H;  4DR2 Q;  3D4W A;  1EY9 A;  3LX0 A;  1DON A;  3W1B A;  3K58 A;  1LAB A;  4JI4 L;  1HTL D;  3GTP H;  3HOW B;  2RSO A;  1U4M A;  4R9W A;  2R92 B;  4XT1 B;  4DUZ L;  1Q1E A;  1QVF A;  3HOU G;  4C3J B;  1E24 A;  2N49 A;  4K6L A;  4RGO S;  1E2Z A;  2WV6 D;  4JW0 A;  1NBW A;  4XT3 B;  4CJ1 B;  1HNX Q;  3F2D A;  2MGS A;  3BDL A;  2X69 A;  3PUV A;  1VQ5 A;  4CJ0 B;  2WB1 G;  1FGB D;  1ENC A;  5A2Q E;  3I4M H;  5ELB A;  4DV1 L;  1LLR D;  4ZUI A;  1CSQ A;  5IYB H;  1B3A A;  2SNM A;  3CU7 A;  3UE1 A;  4DR6 Q;  1H9R A;  2TSS A;  2ICE C;  4RFB A;  4RCN A;  1I4H A;  2B63 B;  2Q8R E;  3M9B A;  1RTO A;  2R3Z A;  2I0Q A;  3SK8 A;  1Q46 A;  2K7V A;  2UXD L;  3HOY B;  4WJ4 A;  2QGQ A;  2X6G A;  4R1J A;  1WYD A;  2EE1 A;  1JOQ A;  2IL8 A;  4DN4 M;  2IHF A;  2EYH A;  1JWM D;  1C7Y A;  5F2D A;  1PH9 A;  4DV0 L;  2NVX H;  4MZ9 A;  3H3V H;  1GJX A;  4KHZ A;  1SYB A;  2EYJ A;  3M4Y A;  4BBS B;  5T1G A;  4A3K H;  1E22 A;  4LF8 L;  1D1K A;  3J81 E;  3M7N A;  4UP8 A;  3J81 L;  3H91 A;  1L1O A;  5AJ3 L;  1WTX A;  4FDB A;  5DM7 3;  1EYD A;  3I4O A;  4A3F G;  4IN3 A;  4DAY B;  4K8J A;  4C3I G;  3UDI A;  2OT2 A;  3Q23 A;  3S1R B;  2EIF A;  4L63 B;  3I8Z A;  1VQF A;  4A3C G;  3GV6 A;  4N8F A;  1WCM B;  4C2M B;  3UDG A;  1U5K A;  2LMC B;  3KBG A;  5I4D A;  2CH4 A;  2QEX A;  4C2M H;  1O7Y A;  1IKL A;  2BE5 D;  2K6A A;  4MNO A;  4I65 A;  5J1Z A;  3K59 A;  4DR7 Q;  2QDB A;  1EU3 A;  4A3J B;  1WTP A;  3S17 B;  1V1P B;  2AWO A;  2D5D A;  2D2C C;  4N9P A;  2F0L A;  3HKZ G;  1YIJ A;  4DV7 Q;  1YHA A;  5IWA Q;  5C44 B;  3NXW A;  4B08 A;  2PZW A;  3FMC A;  4GOP B;  4IUV A;  1GXD C;  5IGC A;  2VUM B;  1AFP A;  1LUZ A;  5CGK A;  5CV4 A;  3I56 A;  3OOC A;  1KAA A;  2G9H D;  1TII D;  2B39 A;  4G57 A;  2KJX A;  4ULL A;  1JOR A;  4H13 C;  4KJN A;  2B2T A;  3WOF A;  4POG A;  1CZG A;  4JI7 Q;  1PTO F;  2M2L A;  1V8Q A;  1L1O C;  4LUO A;  2JA8 B;  3VYR A;  3GTM B;  2XVS A;  4JBJ A;  4KMU C;  2OTJ A;  1O80 A;  3HZX A;  3T56 B;  1UEA B;  1KLU D;  1PFN A;  4JYA Q;  4P71 A;  2C5C A;  4LF4 Q;  3H0G H;  3C2P A;  2KEE A;  3FPP A;  1BOS A;  3PUY A;  1OO9 B;  1JT8 A;  1ET9 A;  3H0G B;  4WJW A;  4PG3 A;  3ERS X;  1Q8K A;  3OIQ A;  2PMZ E;  1G51 A;  4KHP L;  3HOW H;  1GUG A;  1L0X B;  3VYT A;  1HUM A;  1EOT A;  2IPK D;  4DFA A;  1IL8 A;  4IO9 A;  3KUP A;  2CW0 D;  1DM0 B;  2KHI A;  2EYO A;  4R4T A;  1K0R A;  2C9O A;  5I6W A;  4BBR B;  1X9N A;  3RN5 A;  2UUC Q;  5LMN L;  1N9W A;  1X3F A;  5EGT A;  1KIX A;  1SRO A;  2SEB D;  2V1C C;  1Y8O B;  2A74 C;  4HSV A;  4BY1 H;  1FJG Q;  1KLG D;  1WOC A;  3TS0 A;  1IBM L;  4POF A;  4JV5 Q;  3CME A;  4A3E G;  2KCN A;  3SEB A;  4KY5 A;  4X66 L;  2OQK A;  1N32 Q;  2JA7 H;  3A8I E;  4XYQ A;  1TY0 A;  1SMY D;  1A2T A;  1STH A;  2RDG A;  4L6T B;  4GS3 A;  1ASZ A;  2G9D A;  1TWF B;  4HJ8 A;  3DM1 A;  4H02 A;  1CM9 A;  2R93 B;  2NTS A;  1NAP A;  4LFC L;  1JQY D;  2QDL A;  5JPM C;  4IUP A;  2QKI C;  3CD6 A;  3RZD B;  1KRS A;  1ENF A;  2QEJ C;  2E2J B;  4ZK9 B;  4FYD A;  3R3O A;  2UUB Q;  2D62 A;  4JI6 L;  2JSO A;  1WTO A;  4RHS A;  4CDD C;  4ZLT F;  2RQX A;  2VUM G;  5C5L A;  2L15 A;  2XRS D;  4QGU A;  1PH3 A;  1UE7 A;  1C8C A;  3MFG A;  1D1I A;  3H15 A;  3R8B A;  1OXS C;  1HCZ A;  3PIP A;  1B9N A;  4JI1 L;  3QJY A;  2JA5 G;  3G48 A;  1QUQ A;  4IQZ A;  1QE6 A;  2UUB L;  4PZ6 A;  4GN3 B;  3J81 c;  4GN5 A;  1VQN A;  1CQF A;  4A3J G;  2JP1 A;  4N8X 1;  4JC0 A;  3DEO A;  1H9M A;  1H9K A;  1J9O A;  1TWG B;  3SK5 A;  2HD3 A;  1AEX A;  3OWF A;  1Q1B A;  2NVY H;  4H7B A;  3L7Z C;  1I94 Q;  5KYI A;  4N9T A;  1SFO B;  5HGQ A;  3J80 c;  5C3E B;  4J1M A;  3BDC A;  3R93 A;  1XTC D;  2PW7 A;  5C44 H;  1E2V A;  3VR3 A;  1M4V A;  3DEP A;  3U4Z A;  4X3S A;  2LFN A;  3MHB A;  5K36 H;  3C3L A;  5C3E H;  1U4L A;  3TP8 A;  3D3R A;  4ZKB B;  3FVQ A;  1VCI A;  4NP5 A;  4JBK A;  2I5H A;  4HIK A;  4KHP Q;  4OWW B;  1QIL A;  1Q82 C;  2A69 C;  4NB3 A;  1Z6H A;  1NCV A;  3BZK A;  4XQQ A;  2ZXO A;  4LNQ A;  4OIJ A;  3E5S A;  2ZJR A;  1FR3 A;  4CKB A;  4MTK A;  1S5E D;  5C44 G;  4LF7 L;  4C3J G;  1PHJ A;  1DYQ A;  3VR2 A;  1HNZ L;  3J7Y W;  2PI2 E;  3HOX H;  3FRP B;  5C3E G;  4A3D G;  3HOZ H;  4CHT B;  2E76 C;  3TDQ A;  4A3G G;  1KAW A;  2IT1 A;  5BR8 L;  3BS1 A;  1X32 A;  5I2X A;  3HOY G;  1F2M A;  2F0V A;  4DK0 A;  2VS1 A;  2ZT9 C;  3M4O B;  2VQE L;  1KXL A;  4J6H A;  1D5M C;  1PXU A;  3L2P A;  4LF4 L;  3CC4 A;  3HG9 A;  3CPW A;  5D3D A;  5C0X G;  1I50 H;  1K8M A;  2WAC A;  2ZM6 L;  1S40 A;  4IOA A;  4G7O C;  4OWX B;  2DJG C;  3AEV A;  1RJT A;  3HFZ B;  2R7D A;  3E9H A;  2K05 A;  3M85 A;  5FK9 C;  2GA4 B;  4NPS A;  1EY8 A;  4Z9C B;  2F0W A;  1Y8N B;  1B70 B;  3PCO B;  2B2V A;  1DJR D;  4GZY C;  4DR5 L;  4A3K B;  4AQY Q;  4HCE A;  1MSH A;  2E5L L;  3CAM A;  4X6A H;  3X3M A;  2XGT A;  5C0X J;  1SYG A;  3UDX A;  1EWH A;  2RDH A;  4FNF A;  2N78 A;  4C1N K;  2CFM A;  1E1T A;  2AWN A;  4CJ2 C;  5E7N A;  4JI5 L;  3OHX C;  4OO1 H;  1M1K C;  1B50 A;  5CMD A;  3TME A;  3I91 A;  2I46 A;  4A3D H;  2K5Q A;  1HZC A;  1N8R C;  2KEN A;  3H3V C;  1VQC A;  1B9M A;  3T16 A;  1I3Q H;  4RA8 A;  4UAI A;  2BCO A;  2E2H B;  2WIN B;  1J6Q A;  1I4P A;  5G3L D;  3PO3 G;  1U4R A;  1QZH A;  2CQA A;  3G71 A;  1X56 A;  3I7F A;  2MJ8 A;  1Y1V B;  3JAM L;  1WD0 A;  2JE6 I;  5KEE A;  2R92 G;  3K57 A;  2NVT H;  1BCP B;  1PZI D;  2FMC A;  3CC2 A;  1HZ9 A;  2A6E C;  2MQH A;  4MN3 A;  3DMU A;  2PYK A;  2AMC B;  2AKW B;  1TKW B;  3KYH C;  1AP0 A;  4OEM B;  4JV5 L;  3J7A F;  3G7L A;  4KK7 A;  1PV4 A;  4JI6 Q;  2JXM B;  1NTG A;  3RZD H;  3K81 C;  3D6W A;  5LHY 1;  3QWN A;  2PQA A;  5DNF A;  5M3M G;  1QUQ B;  4IPD A;  1VQH A;  5E1F A;  1ZEQ X;  4IAL A;  2Q2T A;  1S5B D;  4A3E B;  3HOX B;  2J4X A;  2A6H D;  2Y0S G;  3CP0 A;  4NXM L;  3L3O C;  4K2K A;  4G7H C;  1Y69 U;  2CH4 W;  4DR4 Q;  4XDX A;  5IYD G;  2Z1C A;  4C1N I;  2B2V C;  4LW1 A;  3VYU A;  1R9T B;  1P8L A;  3LWU A;  4P72 A;  3EQL C;  3VA5 A;  2VQF L;  1XXG A;  3H6M A;  2Q2U A;  1BBU A;  2UUA L;  3DXJ C;  2JA8 G;  3GTQ B;  2EJG C;  1SMY C;  3MEH A;  3PGZ A;  1B2T A;  4JOI C;  4O0A A;  3S2D H;  2F0N A;  2VB3 X;  2ALY B;  3D4R A;  4B3R Q;  5D3I B;  2UXD Q;  1SEB D;  1VQP A;  1CHP D;  1DCZ A;  2HHH Q;  1HNZ Q;  3D6C A;  3S2H B;  4FVM A;  3CHB D;  1HNX L;  1JMC A;  3K5N A;  3KLS A;  1QCB D;  1JOK A;  1SE2 A;  2CCZ A;  4QUC A;  4U67 3;  2R93 G;  2E2I B;  1LTR D;  3OMC A;  4TQU S;  2JN4 A;  1XPU A;  1Y1V G;  2SOB A;  1ML0 D;  3HS0 C;  5C4X H;  2JA8 H;  3T53 B;  1CQV A;  3QG1 A;  3PF5 A;  3OWE B;  1TWC H;  4DPG A;  1B1Z A;  4YWK A;  2OF1 A;  5HY6 A;  5LL6 S;  1HR0 W;  4OX9 L;  4LUZ A;  2GN5 A;  1STB A;  2WB1 E;  4YWL A;  3MEF A;  4BBR H;  4XTC S;  2K03 A;  2A19 A;  3F2C A;  1O7L A;  5EQ0 A;  2DGY A;  4KHV A;  4RG1 A;  2P5Z X;  3TRE A;  4JBW A;  2OTL A;  4JI8 L;  1EU4 A;  5LMN W;  2R7F A;  4IFD G;  3T51 B;  1CT1 D;  2F0H A;  1NNX A;  2RSN A;  1N36 L;  5HGT A;  4DV3 Q;  1Q86 C;  4DV6 L;  2MO0 A;  1XNQ L;  5D14 A;  1TWA B;  2HDL A;  3MC0 B;  3HOV H;  1WTR A;  1B44 D;  3M4Q A;  1V9P A;  1EQV A;  5JEA J;  5IYC G;  1SE3 A;  3D0F A;  5BN5 A;  3PV0 A;  5GAH C;  1D8L A;  3S14 H;  1YNJ C;  1Q90 A;  1CSP A;  1Q81 C;  2E8G A;  3A7L A;  5IT9 L;  1XMO Q;  5IP7 G;  2KA7 A;  4RAU C;  2N8N A;  3PIP 3;  4QB4 A;  2K75 A;  1IYJ B;  2PCF B;  1ASY A;  4HIO A;  5IGB A;  4A3M G;  1A8V A;  2QCP X;  2WAQ E;  3A56 A;  4A3F H;  1E3P A;  3U50 C;  3VR5 A;  5H1S E;  2JEA I;  4KKS A;  1V1O A;  3M4O H;  2DY7 A;  4MHE A;  2IX0 A;  2JQO A;  3W5O A;  4EX5 A;  5IY0 A;  1GHK A;  1GKH A;  1S72 A;  2A68 C;  1PH8 A;  1HNW L;  2F0I A;  4OWT B;  4ZQ3 A;  1SDF A;  2BOS A;  3E6Z X;  5COY A;  4JI0 Q;  4U68 A;  4B9X A;  2WAQ G;  4X3K A;  4KD4 A;  3HOV B;  5M5Y B;  3P7J A;  1BF4 A;  5EPJ A;  3UI2 A;  2UUC L;  2F0P A;  1SJE D;  4B3M Q;  4QF4 A;  2VUM H;  1W6K A;  1TT2 A;  1K3R A;  1UAP A;  2HDM A;  1JOO A;  3NEM A;  4NW2 A;  4AIM A;  1YJW A;  3K5L A;  1B4O A;  5EJW A;  5G3L F;  2R7Z H;  2I5M X;  1S5F D;  1R9T H;  2K5W A;  3NPP A;  3K6O A;  2Z4H A;  3O13 A;  4IPG A;  2F0S A;  4Q5V A;  1X3Q A;  4HJ7 A;  1S3O A;  1XWE A;  2NBF A;  1H9S B;  1IBK L;  3S17 H;  1VQG A;  4DV0 Q;  2SNS A;  3OMG A;  4MIU A;  4OGQ C;  1S4Z A;  5FLM G;  4APV A;  4C3J H;  3FPU B;  5E3F A; 
#chains in the Genus database with same CATH homology
 3QB3 A;  4RGM A;  2F3V A;  2X6L A;  4PNY A;  1I4Q A;  4ID6 A;  1WTW A;  1NR2 A;  2Z8L A;  3TBI B;  1EZ6 A;  2PNR C;  5HUR A;  1VMC A;  1EYC A;  2HCC A;  1BR9 A;  3MVV A;  4E6I A;  2M9V A;  2EOT A;  2JEB I;  3W2D A;  2MHV A;  5C0X H;  1I6H B;  5C4H A;  5CC4 A;  1TY2 A;  5CBE E;  2A68 D;  1HRJ A;  5KNB A;  3S14 B;  2B2W A;  2KOL A;  4BA2 I;  2NVX B;  3NWT A;  3GO5 A;  1NSN S;  5EPL A;  3PUW A;  3NSW A;  4C3H G;  1U4P A;  5EKK A;  1SNC A;  1A6X A;  3HOU B;  3J80 L;  1ICW A;  4M8A A;  1TQO A;  4KN4 C;  3T13 A;  3I4L A;  1F9S A;  4KD3 A;  3HKZ B;  2K5D A;  1SAP A;  1EIG A;  3M3Y B;  4QCL A;  3S1N B;  4FF2 A;  1WD1 A;  3OSO A;  1SJH D;  3F2U A;  2VB2 X;  3MWY W;  5EKI A;  3OW7 A;  4NDX A;  3Q24 A;  1R4P B;  4KJO A;  4CKE A;  3HGB A;  1QNU A;  4KKU A;  4EQN A;  1SE4 A;  1B53 A;  2NYZ D;  1PTO C;  3NTH A;  3BG3 A;  1LTB D;  4BWG B;  4BS9 A;  5T1I A;  2F0U A;  5C0X I;  4QUF A;  5KYL A;  2NZ1 D;  1PZJ D;  4FXG C;  4CGY B;  5LL6 X;  3V2T A;  5M5W B;  3MFY A;  1PRT B;  1KNA A;  1RKN A;  3MXU A;  5JVG 3;  4IFD H;  1TWH B;  4F8M A;  3SHL A;  2A6H C;  3MA2 B;  3MTS A;  3EJI A;  4FXK C;  1XYI A;  2YU9 B;  1IW7 D;  1STE A;  3TP6 A;  3ONA B;  5FO7 B;  4DK1 A;  4A93 B;  1GUT A;  2A69 D;  2TMP A;  2L0C A;  1HPC A;  3PUZ A;  1PRT D;  5COR A;  1I6V C;  1TWC B;  4R8I A;  3N52 A;  4C3I B;  3QOJ A;  1IYV A;  3S1Q B;  2OEO A;  3I70 A;  5JAV A;  5A2Q L;  1RDP D;  4HCS A;  3M7G A;  4PMW A;  2IX1 A;  2EYP A;  1QB5 D;  3N6R A;  4HMJ A;  5FO8 B;  4KY6 A;  1PZK D;  5M3F B;  4DA2 A;  4G4K A;  5C5M A;  4BY7 B;  5JEA H;  1BCP C;  5IGG A;  1Q12 A;  1HQR D;  2KUM A;  2K04 A;  1GUW A;  2EJF C;  2EPB A;  1EIH A;  2O4X A;  1CK1 A;  3C46 A;  5IGF A;  1OXX K;  4RWS C;  4ZYS A;  2K1B A;  3A8K E;  4EGV A;  4HED A;  1BUV T;  2LS0 1;  1ZYR C;  2K32 A;  1KAB A;  2AQ1 B;  2JA5 B;  2EXZ A;  2PW5 A;  3S9W A;  1M8A A;  2A6E D;  1PFB A;  2B2U A;  1BCP F;  5ISR A;  4RCO A;  1IKM A;  2DN8 A;  1HTP A;  2K28 A;  4O1N A;  2EDG A;  1HXY D;  1LT4 D;  5KRU A;  4EQP A;  1VF5 C;  4TSS A;  4F88 A;  1KTK A;  1I4X A;  2NVY B;  1LTI D;  2F0M A;  2MPM A;  1SYE A;  3T4A C;  3LWE A;  5IT9 E;  3I4M B;  1BCP D;  3D31 A;  3I72 A;  2B2T C;  1STG A;  1LTG D;  4AYB B;  1HQM C;  2F0K A;  2KCC A;  2PMZ B;  3K5O A;  3P20 A;  1G29 1;  5FLX E;  2AQ3 B;  3NK9 A;  4A3G B;  5EPK A;  3Q6S A;  5FOB B;  3A55 A;  4OO1 I;  4PMC A;  5I2Y A;  1STA A;  5C4J B;  3KBX A;  1ROD A;  1NR4 A;  2J7Z A;  3KLR A;  1D5X C;  1GUN A;  1I4R A;  2F1M A;  2XN9 C;  4I7Z C;  4RH6 A;  2HUG A;  1WTV A;  1JR0 D;  3HEJ A;  1FNV A;  3S1M B;  2JA7 B;  3LNN A;  4R8N A;  1QJO A;  3SK4 A;  2RA4 A;  3QIA A;  2IX3 A;  3H09 A;  3C1F A;  2EYM A;  2MUY A;  2NN6 H;  2B2Y A;  2WKD A;  3CRL C;  1DXM A;  3P75 A;  1PRT F;  4CBV A;  2PPB C;  3ZYY X;  2L5T A;  3EA6 A;  4DF7 A;  1ILP A;  3E0J A;  2DNE A;  4IUR A;  4X3T A;  1BQQ T;  1C4Q A;  2HCI A;  5C3W A;  3GTL B;  2QIL A;  4PQX A;  5EBC A;  3Q22 A;  1UNS A;  3VR4 A;  1EFI D;  1XX8 A;  5J22 A;  5IOD A;  1RCV D;  2CW0 C;  3C1E A;  4A3F B;  4ZUJ A;  4ZAI A;  4CKC A;  1MI2 A;  2NN6 G;  3NBH A;  3QO2 A;  4J8Q A;  5BN4 A;  1JC7 A;  2NVQ B;  1TS5 A;  4FP5 D;  4DGZ A;  1QNK A;  3HP3 A;  2L11 A;  1A3U A;  1LTA D;  1G2T A;  5IGE A;  5M3M B;  1TR5 A;  4WFN 3;  3NHH A;  3TZD A;  1YNN D;  1EZ8 A;  3BVG A;  3DWP A;  5C4Z A;  3NE5 B;  1L0Y B;  1W6J A;  3NTI A;  4Y7N B;  1SNM A;  3AU7 A;  3TP5 A;  2SDF A;  3S2D B;  2L55 A;  3SK6 A;  2FJ2 A;  1JCK B;  2EYL A;  1CZW A;  4TKO B;  4OHJ A;  4G7Z C;  1QWY A;  4RGT A;  4S3S A;  1AZP A;  1E0B A;  4FF4 A;  5KGU A;  2B2W C;  3S16 B;  2K01 A;  1Z47 A;  4OL7 A;  2R7Z B;  1D5Z C;  2YYZ A;  2L1B A;  4ZKC B;  1I4G A;  2ZXP A;  1G6Z A;  1J8I A;  1V43 A;  2H4O A;  1SND A;  2JA6 B;  1OXT A;  1C48 A;  2XWB B;  1JWU D;  2EZV A;  1HA6 A;  2F0E A;  2WP8 J;  2XRQ D;  4IUN A;  1I50 B;  3W3A A;  1PTO B;  5ELC A;  5DAU A;  1PFM A;  3J7A V;  3DHQ A;  4K6D A;  2EY1 A;  2B2U C;  4C56 C;  1PTO D;  2K33 A;  2JYO A;  2ID0 A;  2RVL A;  4C3H B;  1D2B A;  1CTM A;  1SNQ A;  2KVM A;  4FXD A;  1SBB B;  5CBA E;  3SR1 A;  1F9Q A;  1JE4 A;  4FF3 A;  2Q8T A;  2EY5 A;  5I6Y A;  4IFD J;  3PO3 B;  2AQ2 B;  2WB1 B;  2IW3 A;  5CR3 A;  2DY8 A;  4P2C B;  3CKI B;  3R2T A;  1SXT A;  2VXW A;  1CI3 M;  2O5J C;  1F2Z A;  4TRD A;  4ABN A;  2PQE A;  2KED A;  1STN A;  3R2I A;  3K5M A;  3RMH A;  4K8I A;  3AMU A;  3FKI B;  3EVQ A;  3HRZ C;  3URY A;  2A73 B;  1BDO A;  4KI0 A;  3SDZ A;  4RKB A;  1G8Z D;  1TS3 A;  1A2U A;  1F77 A;  2WII B;  2EY2 A;  5IOC A;  3PIO 3;  3SE0 A;  1LT6 D;  3FDT A;  2RKS A;  5JPN C;  5FKA C;  2BA0 A;  4RGN A;  1PRT C;  2J0T D;  2BDN A;  1AW7 A;  3D8G A;  2RBM A;  1F9P A;  4UDU C;  4KTA A;  2PZU A;  1EYA A;  3GD7 A;  2B2Y C;  1LTS D;  2R6G A;  5M5X B;  3IL8 A;  4X3U A;  1EY4 A;  5ELF A;  4K2L A;  4IUU A;  4XQJ A;  1EL0 A;  1LO5 D;  2F0Q A;  3GTG B;  3SXH A;  1MGS A;  3NQT A;  3IAY A;  4OIK A;  1F2Y A;  3IFD A;  4PMB A;  2F0J A;  2MP1 A;  4BY1 B;  2NB0 A;  4FO2 A;  1JIC A;  3NP8 A;  3RZO B;  2XWJ B;  1RD9 D;  2FIN B;  1LTT D;  1TS2 A;  5JJZ A;  3FEW X;  1HHV A;  2CVR A;  1DOL A;  2EY6 A;  3P1H A;  3BYT B;  1D6E C;  3KK7 A;  4V19 0;  2VNU D;  4WOR A;  3ERO A;  1KNE A;  1X3P A;  3NTK A;  5IIF A;  3IKJ A;  1STY A;  2F0T A;  2NWG A;  2KHS A;  1RHP A;  4DAP A;  3OIP A;  3JAM E;  2EYF A;  1OXU A;  2O2L D;  1SNO A;  2WKC A;  2QF7 A;  1EEF D;  1HUN A;  1ZYR D;  1II3 A;  1Z7T A;  3V96 A;  5E4W C;  3VR6 A;  5KIX A;  3PUX A;  2ENB A;  1BXT A;  2M00 A;  4RHR A;  2BA1 A;  1ESR A;  2F0G A;  5CV9 A;  3ERQ A;  3BYY B;  4ZRZ A;  3WOE A;  2R61 A;  1U9R A;  1MBY A;  4A3M B;  1HFN A;  1PYW D;  3TN2 A;  4XXE A;  3RLF A;  3ND8 A;  5A35 A;  2FFK B;  1Q8I A;  4DXG A;  1BBX C;  3PO2 B;  4ODG A;  2DNC A;  1FYC A;  4F87 A;  5K5P A;  1F2L A;  1CHQ D;  1WTQ A;  1EQT A;  3X3N A;  4KN7 C;  1ILQ A;  1LT3 D;  1A3T A;  1ZXT A;  1HA5 A;  2E2D C;  3TP7 A;  3A8J E;  2N55 A;  1EEI D;  4NKL A;  5M9O A;  5TSS A;  1BNZ A;  1EY0 A;  2F0F A;  2N88 A;  5NUC A;  2IWH A;  3EFX D;  3V05 A;  1Q3L A;  5I9O A;  3I73 A;  4LMQ D;  5IGD A;  1KDA A;  4M1U B;  1WVL A;  3G6J B;  2F3W A;  2OXP A;  1DOK A;  1GUS A;  2XNA C;  1I3Q B;  4HN7 A;  5C6A A;  4XIG S;  1GOZ A;  3H94 A;  4L8J A;  1DOM A;  4IUQ A;  2HQE A;  3NQI A;  1G91 A;  3RUZ A;  4DNT B;  3J80 E;  5C3X A;  4A3I B;  2NVT B;  3CQZ B;  1O78 A;  2BE5 C;  4DAY A;  4HAE A;  1LT5 D;  5CV6 A;  1PDQ A;  1ONL A;  1LAC A;  2BDO A;  3ITP A;  1YNJ D;  5DEH A;  3GP7 A;  4K5V A;  5I9P A;  1ENA A;  3HOZ B;  4A3B B;  5CV8 A;  4WRD A;  1FNW A;  1PMR A;  1SYF A;  1YNN C;  4B9W A;  1RF2 D;  1Y1W B;  1GHJ A;  1F9R A;  3NBI A;  1DZ1 A;  2NTT A;  2IJ0 A;  2AUK A;  4LJZ C;  2O5I C;  1TVX A;  2ICI A;  5KND A;  4QIW B;  4H0L C;  4XQN A;  3GV3 A;  5EBD A;  1V1P A;  2PO4 A;  1S5D D;  4O42 A;  4RKL A;  1NUC A;  2EJM A;  4XYO A;  4EQO A;  2KEC A;  5FLX L;  3U9S A;  5BN3 A;  2L4N A;  1T5X D;  1VDZ A;  1A15 A;  2V4D A;  1E2W A;  2NN6 I;  1IW7 C;  2F4I A;  1OXV A;  1IYU A;  4K14 A;  1K8O A;  1MD2 D;  3BZD B;  2FMM A;  2F0D A;  4K5X A;  3QOL A;  4KY7 A;  5CV5 A;  1SSO A;  1TU2 B;  5ELE A;  4IUT A;  4PV1 C;  4DAV A;  3ND9 A;  3I4N B;  5JEA G;  4DNR B;  1O7Z A;  4LAA A;  1R4Q B;  4K5W A;  3MZ5 A;  4ME5 A;  2E74 C;  5K36 G;  5AFW A;  1JB3 A;  5C4X B;  2B8F A;  2NUC A;  4H44 C;  3DUZ A;  4HTH A;  3TZU A;  4BA1 I;  1LV9 A;  1KDC A;  1EWC A;  1SYD A;  4A3D B;  3VA7 A;  1A3V A;  4IZ8 A;  1SYC A;  1KDB A;  3PMF A;  3DWA A;  1CA5 A;  1K83 B;  4JK1 C;  3OPO A;  3A7A B;  2WAQ B;  2H1E A;  3I3C A;  4F7X A;  1RTN A;  4HMI A;  4LK1 C;  3MAQ A;  4ILW A;  2CHB D;  3TSS A;  3K7A B;  5KNC A;  1EY5 A;  3NWS A;  1MSG A;  3K0Y A;  5E4X A;  2Y0S B;  2Z4I A;  5CV7 A;  1VF7 A;  1H9J A;  2B8G A;  5D65 A;  3Q0A A;  4EVO A;  2LKV A;  1H9S A;  3WDN A;  4NMZ A;  3GQB A;  2A5H A;  3BVZ A;  3GTK B;  3BDO A;  2D9U A;  3BVM A;  4DU9 A;  1HFG A;  2XIW A;  4YIJ A;  3GTP B;  3IFT A;  5EKL A;  1ESF A;  2EVB A;  1T5E A;  1PLF A;  3RD4 A;  4KV6 A;  1AN8 A;  1QOH A;  4V0B A;  3DWQ A;  1CA6 A;  4Q0F A;  4HSP A;  3S15 B;  3NUC A;  5CYU A;  5FO9 B;  2E75 C;  4DXF A;  1VMP A;  4FF1 A;  3I90 A;  3KLS X;  3GTO B;  4QMG A;  3MXG A;  3U9O A;  3CRK C;  4OO1 G;  1EY6 A;  1CFM A;  1QG7 A;  3MXN A;  1JWS D;  3L9A X;  2LY7 A;  1ZKO A;  2F03 A;  1Y8P B;  1EY7 A;  2L12 A;  5JOB A;  2KQ3 A;  2L9H A;  1SNP A;  1G2S A;  1FNU A;  3SVM A;  1FD7 D;  3MXP A;  1AZQ A;  5J39 A;  4KKT A;  3GTJ B;  1S5C D;  2XSC A;  1DD2 A;  2Q8I B;  1IHZ A;  4HR7 B;  2PZT A;  3KF8 A;  1BO0 A;  3AB9 A;  3D4D A;  2ZXR A;  1PTO H;  1TS4 A;  1UUP A;  2F0O A;  1ET6 A;  1GUO A;  2AUJ D;  2RDF A;  5ELD A;  2I07 B;  3A54 A;  3VYS A;  5JVH 3;  2FHT A;  4IFD I;  5DM6 3;  3D4W A;  1EY9 A;  3LX0 A;  1DON A;  3K58 A;  1LAB A;  1HTL D;  3HOW B;  2RSO A;  1U4M A;  4R9W A;  2R92 B;  4XT1 B;  1Q1E A;  4C3J B;  4K6L A;  4RGO S;  1E2Z A;  2WV6 D;  4CJ1 B;  4XT3 B;  2MGS A;  3BDL A;  2X69 A;  3PUV A;  4CJ0 B;  1FGB D;  1ENC A;  5A2Q E;  5ELB A;  1LLR D;  4ZUI A;  1B3A A;  2SNM A;  3CU7 A;  1H9R A;  2TSS A;  2ICE C;  4RFB A;  4RCN A;  1I4H A;  2B63 B;  2Q8R E;  1RTO A;  2R3Z A;  3SK8 A;  2K7V A;  3HOY B;  2X6G A;  2EE1 A;  1JOQ A;  2IL8 A;  4DN4 M;  2EYH A;  1JWM D;  5F2D A;  1GJX A;  4KHZ A;  1SYB A;  2EYJ A;  3M4Y A;  4BBS B;  5T1G A;  1D1K A;  3J81 E;  3M7N A;  3J81 L;  3H91 A;  1WTX A;  5DM7 3;  1EYD A;  4IN3 A;  4K8J A;  4C3I G;  2OT2 A;  3Q23 A;  3S1R B;  4L63 B;  3I8Z A;  3GV6 A;  1WCM B;  4C2M B;  2LMC B;  3KBG A;  5I4D A;  1O7Y A;  1IKL A;  2BE5 D;  2K6A A;  4I65 A;  5J1Z A;  3K59 A;  2QDB A;  1EU3 A;  4A3J B;  1WTP A;  3S17 B;  1V1P B;  2AWO A;  2D5D A;  2D2C C;  4N9P A;  2F0L A;  5C44 B;  4B08 A;  3NXW A;  2PZW A;  3FMC A;  4IUV A;  1GXD C;  5IGC A;  2VUM B;  1AFP A;  5CGK A;  5CV4 A;  3OOC A;  1KAA A;  2G9H D;  1TII D;  2B39 A;  4G57 A;  2KJX A;  4ULL A;  1JOR A;  4H13 C;  4KJN A;  2B2T A;  3WOF A;  1CZG A;  1PTO F;  2M2L A;  1V8Q A;  2JA8 B;  3VYR A;  3GTM B;  2XVS A;  4KMU C;  1O80 A;  3HZX A;  3T56 B;  1UEA B;  1KLU D;  1PFN A;  2C5C A;  3C2P A;  2KEE A;  3FPP A;  1BOS A;  3PUY A;  1OO9 B;  1ET9 A;  3H0G B;  4WJW A;  3OIQ A;  1GUG A;  1L0X B;  3VYT A;  1HUM A;  1EOT A;  2IPK D;  4DFA A;  1IL8 A;  3KUP A;  2CW0 D;  1DM0 B;  2EYO A;  2C9O A;  5I6W A;  4BBR B;  5EGT A;  2SEB D;  4HSV A;  1Y8O B;  2A74 C;  1KLG D;  2KCN A;  3SEB A;  4KY5 A;  3A8I E;  4XYQ A;  1SMY D;  1TY0 A;  1A2T A;  1STH A;  2RDG A;  4L6T B;  2G9D A;  1TWF B;  3DM1 A;  1CM9 A;  2R93 B;  2NTS A;  1NAP A;  1JQY D;  5JPM C;  4IUP A;  2QKI C;  3RZD B;  2QEJ C;  1ENF A;  2E2J B;  4ZK9 B;  4FYD A;  3R3O A;  2D62 A;  2JSO A;  1WTO A;  4RHS A;  4ZLT F;  2RQX A;  5C5L A;  2XRS D;  1C8C A;  3MFG A;  1D1I A;  3R8B A;  1OXS C;  1HCZ A;  1B9N A;  3QJY A;  1QE6 A;  4IQZ A;  1CQF A;  2JP1 A;  3DEO A;  1H9M A;  1TWG B;  1H9K A;  1J9O A;  3SK5 A;  1AEX A;  3OWF A;  1Q1B A;  4H7B A;  3L7Z C;  5KYI A;  4N9T A;  1SFO B;  5C3E B;  4J1M A;  3BDC A;  3R93 A;  1XTC D;  2PW7 A;  1E2V A;  3VR3 A;  1M4V A;  3DEP A;  4X3S A;  2LFN A;  3MHB A;  5K36 H;  3C3L A;  1U4L A;  3TP8 A;  3D3R A;  4ZKB B;  3FVQ A;  1VCI A;  4NP5 A;  1QIL A;  2A69 C;  1Z6H A;  1NCV A;  4XQQ A;  2ZXO A;  4OIJ A;  3E5S A;  1FR3 A;  4CKB A;  1S5E D;  4C3J G;  1DYQ A;  3VR2 A;  3J7Y W;  3FRP B;  4CHT B;  2E76 C;  3TDQ A;  2IT1 A;  3BS1 A;  1X32 A;  5I2X A;  1F2M A;  2F0V A;  4DK0 A;  2ZT9 C;  3M4O B;  4J6H A;  1D5M C;  1PXU A;  3HG9 A;  5D3D A;  5C0X G;  2WAC A;  1K8M A;  4G7O C;  1RJT A;  2K05 A;  3M85 A;  5FK9 C;  2GA4 B;  1EY8 A;  4Z9C B;  2F0W A;  1Y8N B;  2B2V A;  1DJR D;  4GZY C;  4A3K B;  4HCE A;  1MSH A;  3X3M A;  5C0X J;  1SYG A;  1EWH A;  2RDH A;  4FNF A;  4C1N K;  2AWN A;  4CJ2 C;  3OHX C;  4OO1 H;  1B50 A;  5CMD A;  3TME A;  3I91 A;  2I46 A;  2K5Q A;  3H3V C;  1B9M A;  3T16 A;  4RA8 A;  4UAI A;  2BCO A;  2E2H B;  2WIN B;  1I4P A;  5G3L D;  1U4R A;  2CQA A;  2MJ8 A;  1Y1V B;  3JAM L;  1WD0 A;  2JE6 I;  5KEE A;  3K57 A;  1BCP B;  1PZI D;  2FMC A;  2A6E C;  4MN3 A;  3DMU A;  2PYK A;  1TKW B;  1AP0 A;  3J7A F;  3G7L A;  4KK7 A;  2JXM B;  3D6W A;  5LHY 1;  3QWN A;  5DNF A;  5E1F A;  1ZEQ X;  4IAL A;  1S5B D;  4A3E B;  3HOX B;  2J4X A;  2A6H D;  3L3O C;  4K2K A;  4G7H C;  1Y69 U;  4XDX A;  2Z1C A;  4C1N I;  2B2V C;  3VYU A;  1R9T B;  3LWU A;  3EQL C;  3VA5 A;  1XXG A;  3H6M A;  3DXJ C;  3GTQ B;  2EJG C;  1SMY C;  3MEH A;  1B2T A;  2F0N A;  2VB3 X;  3D4R A;  5D3I B;  1SEB D;  1CHP D;  1DCZ A;  3D6C A;  3S2H B;  4FVM A;  3CHB D;  3K5N A;  3KLS A;  1QCB D;  1JOK A;  1SE2 A;  4QUC A;  4U67 3;  2E2I B;  1LTR D;  3OMC A;  4TQU S;  2SOB A;  1ML0 D;  3HS0 C;  3T53 B;  1CQV A;  3QG1 A;  3OWE B;  1B1Z A;  2OF1 A;  5LL6 S;  1STB A;  4XTC S;  2K03 A;  1O7L A;  5EQ0 A;  4KHV A;  4JBW A;  1EU4 A;  4IFD G;  3T51 B;  1CT1 D;  2F0H A;  2RSN A;  5HGT A;  5D14 A;  1TWA B;  2HDL A;  3MC0 B;  1WTR A;  1B44 D;  1EQV A;  5JEA J;  1SE3 A;  5BN5 A;  3PV0 A;  1YNJ C;  1Q90 A;  3A7L A;  5IT9 L;  2KA7 A;  4RAU C;  3PIP 3;  4QB4 A;  2PCF B;  5IGB A;  2QCP X;  3A56 A;  3VR5 A;  2JEA I;  4KKS A;  1V1O A;  2DY7 A;  4MHE A;  2IX0 A;  1GHK A;  2A68 C;  2F0I A;  4ZQ3 A;  1SDF A;  2BOS A;  3E6Z X;  5COY A;  4U68 A;  4B9X A;  4X3K A;  4KD4 A;  3HOV B;  5M5Y B;  3P7J A;  1BF4 A;  5EPJ A;  3UI2 A;  2F0P A;  1SJE D;  4QF4 A;  1W6K A;  1TT2 A;  1UAP A;  2HDM A;  1JOO A;  4NW2 A;  3K5L A;  1B4O A;  5EJW A;  5G3L F;  1S5F D;  2K5W A;  3NPP A;  3K6O A;  2Z4H A;  3O13 A;  4Q5V A;  2F0S A;  1X3Q A;  1XWE A;  2NBF A;  1H9S B;  2SNS A;  3OMG A;  4MIU A;  4OGQ C;  1S4Z A;  3FPU B;  5E3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...