1PLFA

The three-dimensional structure of bovine platelet factor 4 at 3.0 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
63
Chain Sequence
LQCVCLKTTSGINPRHISSLEVIGAGLHCPSPQLIATLKTGRKICLDQQNPLYKKIIKRLLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Platelet factor
molecule keywords PLATELET FACTOR 4
publication title The three-dimensional structure of bovine platelet factor 4 at 3.0-A resolution.
pubmed rcsb
source organism Bos taurus
total genus 8
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1plfA00
1SAPA 1NAPA 3DEPA 3UI2A 4CJ2C 1AP0A 1HRJA 1MSHA 1U4LA 1HFGA 1G2TA 1GUWA 1RJTA 1MSGA 2B2VA 2CVRA 1WTWA 1WTPA 2HUGA 2Q8RE 4IURA 5JJZA 2MJ8A 4LMQD 3DM1A 5COYA 1IKMA 1CA6A 4ZKBB 3P7JA 1RHPA 2B2WC 2H1EA 4X3SA 1XYIA 4R8IA 2HCCA 3DEOA 1B4OA 2JYOA 1QNKA 2K03A 3LWEA 2HCIA 3MTSA 5CORA 5EQ0A 2MP1A 1WD0A 1B50A 2HDLA 1O80A 1RTOA 1QG7A 4MN3A 2B2UA 2N88A 1G6ZA 1EIHA 2B2YC 1O7ZA 1U4MA 2KEDA 1PLFA 3F2UA 2FHTA 4HEDA 2X6LA 2RVLA 4ZK9B 5CBEE 5EPJA 1AZPA 1ILPA 1HFNA 1RODA 2KECA 2HDMA 1J9OA 3H91A 1F2LA 3R93A 4QUFA 1DOLA 2N55A 4ZKCB 5CBAE 1IKLA 2K05A 3TZDA 1VMPA 1PFNA 5CMDA 2X69A 2K04A 4OIKA 4X3UA 5DNFA 1C8CA 5D14A 2EPBA 4QUCA 1B53A 2L12A 1RTNA 2L4NA 2FINB 2MGSA 4NW2A 2K01A 1WTOA 1DONA 1U4RA 2JP1A 3KUPA 4MHEA 1AZQA 1SDFA 2NYZD 1U4PA 2SDFA 3I90A 3MWYW 2B2TC 1ILQA 1MI2A 2DY8A 1F9SA 1WVLA 1DOKA 4RWSC 4X3KA 1PFBA 1HA6A 2FFKB 1ML0D 2VXWA 4HAEA 1DZ1A 4XDXA 4ZAIA 3GV6A 1XX8A 1X3QA 1HUMA 3FPUB 2XIWA 1CA5A 3GV3A 3Q6SA 1G2SA 1JE4A 1A15A 1S4ZA 2RA4A 1F9PA 2B2VC 2X6GA 2FJ2A 3IL8A 4XT3B 1HHVA 1WTQA 2EOTA 4IUQA 1WD1A 2FMMA 4X3TA 3D6WA 1F9RA 1Q3LA 1ESRA 2K28A 1M8AA 2KEEA 2KOLA 3N52A 1EL0A 4IUPA 1CM9A 2B2WA 4OIJA 2K1BA 2RSNA 2M2LA 3QO2A 4RAUC 1ZXTA 2L11A 2L9HA 5AFWA 1IL8A 2IL8A 2KUMA 1J8IA 1HUNA 4CJ0B 2D9UA 2DY7A 2J7ZA 2B2UC 4CJ1B 5E4WC 1WTVA 1E0BA 4RA8A 2B2YA 1BBXC 4XT1B 2L1BA 3I8ZA 5EPLA 2RSOA 3FDTA 3I91A 1LV9A 2KVMA 2NZ1D 1QE6A 1KNEA 3IFDA 2EE1A 3TN2A 1JICA 4UAIA 3G7LA 1KNAA 1EOTA 1BF4A 1DOMA 4IUTA 1SSOA 4IUUA 5EJWA 1ICWA 1EQTA 5EPKA 3KBXA 1MGSA 1X3PA 5D65A 4O42A 1F9QA 1B3AA 1X32A 5T1IA 1PDQA 2BDNA 2Q8TA 1WTRA 3SVMA 1PFMA 4ZLTF 1EIGA 4IUVA 4DN4M 2MPMA 1NR2A 3HP3A 1BO0A 5E4XA 1BNZA 1G91A 5EKIA 1B2TA 2NWGA 4HCSA 5T1GA 1NCVA 1O7YA 2B2TA 1TVXA 4R9WA 3I3CA 1WTXA 2R3ZA 4U68A 1VMCA 1NR4A 4HSVA 3ONAB
chains in the Genus database with same CATH superfamily
1RKNA 1IYVA 1GUWA 1S40A 4BY7H 4LJZC 3F1ZA 4DV4L 4A3LG 2E76C 4ME5A 3E9IA 3T51B 1DGSA 2H1EA 2HIXA 1PV4A 5GADC 3OSOA 4V0BA 1TWAB 1MD2D 1T5XD 1D7QA 2UUCL 4NDXA 4GKKQ 2EYPA 3HKZG 1RODA 1PZJD 5IYDG 3NE5B 5M3FG 5CBAE 1A62A 4IFDH 1QJOA 1B53A 1WJJA 2R6GA 3S1RB 1VQOA 4EQPA 4IZ8A 3SGIA 4JCVE 5C6AA 5KYIA 3HG9A 2DY8A 2B39A 3ND8A 2N3SA 1Q86C 2AUKA 2OTLA 3K7UC 1UE1A 1EU3A 5C44G 1GO3E 5J22A 3IL8A 5EKLA 1B9NA 2B2VC 2FJ2A 1V1PB 4DV0Q 3G71A 1UEAB 3J81i 2KCCA 1ENCA 4BXXH 2WB1G 4DKAC 2Q2HA 4IUPA 4DNIA 4PZ7A 2A6HC 4JPBW 2QA4A 1S72A 3K0YA 2L11A 1CT1D 4JI4L 2XGTA 2VZAA 3J81L 2CKZB 4XT1B 2D5DA 1EQVA 4KLKA 1SNQA 2UXDL 1JICA 4UAIA 4DUZQ 1BF4A 1PZID 1NNXA 1UE7A 1X32A 4UP8A 4KY5A 5BN4A 3PO2B 2SNSA 1P16A 1HNWQ 1BNZA 3IKJA 4YCVA 1K83B 1NR2A 3TP7A 2SOBA 4DR2L 3RZDB 5FKAC 5C0XG 4OO1H 1CUKA 3SE0A 1BBWA 3BS1A 2K52A 4A3CG 1CQVA 3AYHB 4DNRB 3EIVA 4LF8L 1K83H 3N6RA 3U9OA 2R7ZG 4V190 1EY9A 3RZDH 1RJTA 2F0JA 1AFPA 3K80C 1X3GA 2HUGA 3CPWA 2MJ8A 4JI0L 2JA8H 1Q1EA 1I4GA 1LTTD 4QIWB 4AYBE 5ELDA 2CCZA 3S1MH 1HZBA 2G9DA 2N49A 3D4DA 2OT2A 1IBML 1EEID 4P2CB 2I5MX 2KJXA 1E22A 1TWFB 2A68D 3FKIH 5LMNW 4DR7L 1O7ZA 1WI5A 2JA5B 5EPJA 4OL7A 4BY1G 1DOLA 3NK9A 5KRUA 4ZKCB 2XSCA 3L0OA 1VQFA 1JC7A 1B3QA 2JN4A 2GVBA 1C7YA 4OEMB 3RD4A 2ZTEA 4ME3A 1VCIA 2JA5H 1KAWA 3RLOA 1RTNA 1ONLA 1UUPA 1SYFA 1YEZA 3J7YW 1LTBD 2NYZD 3TSSA 4IOAA 5IGGA 3DWPA 2B63G 3X3NA 1HA6A 4DXFA 1ET9A 4KV6A 4RGMA 2LY7A 2EXDA 4ILWA 4ZAIA 3P1HA 1BXTA 1IW7D 3PQIA 2OEOA 4DR6Q 1S4ZA 1HHVA 4KJNA 4DR4L 3D6WA 1D8LA 5IY0A 4Q5VA 1X54A 1MHWC 4A93H 1XPRA 1GHKA 1SNPA 2AMCB 2L9HA 2IL8A 4NXMQ 4CDCC 2D9UA 4YY3Q 2PO4A 1BOSA 1STEA 5IP7H 2ATWA 4DXGA 2B2YA 2BA0A 3K5NA 3TBIB 1ENAA 3KK7A 4EX5A 2UUAL 1Z9FA 2ZXPA 1PFSA 3I91A 2A6ED 3I2ZA 1YZ6A 5H1SE 1PH7A 1DYQA 3JC66 1A3VA 1ICWA 4ABNA 5GAGC 3TRZA 3U58A 1B1ZA 3A7AB 3NWSA 4C2MH 5C5LA 2PW5A 4B3TQ 2Z6KA 4JI5Q 1BCPB 4GOPB 3PUYA 4HIDA 4A3JH 4JI6Q 4U68A 3S2DH 3W3AA 1SMYD 1KRSA 4X64L 2IX0A 1SE3A 4U673 3V96A 1HFGA 1SLJA 3T53B 2Q8RE 2F0WA 2ZXRA 4POGA 4YWLA 4X62L 1V1OA 2PI2A 1V8QA 2EYMA 4G7HC 1QVGA 3HOZB 3ICEA 2E2IB 3NHHA 3VDYA 4BXXG 3CF5A 4A3MH 1SYBA 3GTOH 1NMGA 3J81E 3H91A 1DCZA 3J7AV 1L1OA 4CDFC 4DGZA 2KENA 2UXBL 2KCMA 1JQYD 4IUNA 4GLVB 2EPBA 3CW2C 4JYAQ 4HN7A 5LL6S 1WYDA 3L9AX 3BVMA 3H09A 1DD2A 4ZUJA 2EY2A 5LL6X 4LF6Q 1OXXK 3KUPA 4JI7L 2Q2IA 1Z6HA 2PZTA 1ILQA 2DNEA 3PO3G 4DUYL 4OWXB 3KDFB 2JA7G 1DZ1A 4HSPA 4QIWE 2VQFL 1KDBA 2EYHA 1X65A 4LK1C 1VQ7A 1CHQD 1XTDA 3ER0A 3ND9A 4JBKA 3GTPB 3BG3A 5IOCA 4ZCKA 2WAQE 4DNTB 4IUQA 1WD1A 5GROA 5I6YA 3UE0A 1V43A 1VQEA 1YJ9A 2IWHA 4K5WA 3PO2G 4ID6A 3SK8A 4LF7L 1KLGD 4PV1C 2PZWA 2JA6B 2A6HD 1WCMB 2K6AA 2QILA 3MC0B 3NP8A 4X66L 3GTPH 2OF1A 5AJ3L 5LMNQ 4DR1L 1HZ9A 5EPLA 5K36G 2B29A 4PQXA 5L37A 5C3EG 3GDEA 3DMUA 4GLXA 2AQ1B 3CCJA 1SEBD 1OO9B 1EYCA 1TU2B 4JI3L 1Y8PB 1E2ZA 2V1CC 1BDOA 1YIJA 1STHA 1XMOL 4AQYQ 1PRTB 2E8GA 1IBKQ 1TS4A 4WJ3M 2OWOA 1ASYA 3NTKA 2VL6A 2B2VA 3I73A 2CVRA 3IRBA 5I9OA 1XNQL 1JJCB 1FVIA 1UEBA 2D2CC 2ZTDA 3M4QA 2NVYB 1HJPA 2CWPA 3F8TA 1M1KC 2E2HB 2CHBD 3MFYA 3OWFA 4G57A 4HJAA 4P74A 5EKKA 2NVYH 5CV4A 1Q8KA 1O78A 4IPGA 1HFNA 2HDMA 4A76A 4M1UB 1E24A 1RCVD 1QILA 5C4JB 5GAHC 2K04A 2K75A 1N34Q 4QUCA 3SHLA 5IT9L 3RN2A 1Q46A 2F0FA 4JK1C 3OTOQ 4LF4Q 2F0VA 4DV2L 3AB9A 1KTKA 2PMZB 1AZQA 1S5DD 1WTHA 3OIPA 1MI2A 1SXTA 1S5ED 2QKIC 4C3HB 4AIMA 2NN6I 3VYSA 4N8X1 1XX8A 1STBA 2YTVA 4OWWB 4EQ5A 3J7A5 1I4HA 2QGQA 1L2FA 1WTQA 1I4PA 4FF2A 5JJLA 1VQPA 4X3TA 5FLMH 3ULJA 3CCLA 1F9RA 2KOLA 4F8MA 1NE3A 1IYJB 3I72A 4LF5L 1C9OA 2F0MA 2UXCL 4XYQA 4CJ0B 4A3KB 4RG1A 1R4PB 2LS01 2RCFA 4CJ1B 3D4WA 2NVXH 4IPCA 2JK8A 4X65L 2SEBD 4BA2I 4A3LH 1STAA 2L1BA 1EYAA 2RSOA 4UP7A 3M3YB 4JI2L 3HKZB 1PHJA 2KHJA 3M7NA 3STBC 1HQMC 5M3FB 1K8GA 4CKEA 1EYGA 2O5IC 1PH8A 3HOZG 1QCBD 4DN4M 5E3FA 5CV7A 5IYBG 3M3YH 5IYDH 1I6VC 3GTQH 1TVXA 4JI8L 5M3FH 1IYUA 5I2YA 1VQLA 4DV3L 1LTID 4GLAC 3KF6B 1ASZA 1CK1A 5JJZA 4K2KA 4LMQD 4PZ8A 5COYA 1W3SA 4ZYSA 1IKMA 1E2VA 2F0GA 4DV5L 4HIMA 1HCZA 2Z4IA 2WB1B 5CORA 4IO9A 5C44H 2RHQB 4LFAL 5BN3A 1PH4A 1LT5D 1PTOH 3OOCA 5NUCA 4LUZA 1GKHA 4HJ5A 3Q24A 3ITPA 1D1IA 1D6EC 4K5XA 1VMPA 2K5QA 4A3IG 2X69A 1LT6D 3KF8A 2NUCA 1CKOA 4DAYB 1KDAA 3HZXA 2JA6G 1WCMG 3S15B 5C3WA 2MGSA 1VS0A 4DV0L 5IYCG 3CRKC 5HURA 4K8IA 3MA2B 1ML0D 3H0GG 3S15H 3H3VH 2EXZA 3FPPA 1W6JA 3FPUB 4A3DG 1N32L 1N36L 1GM5A 4N9TA 2Q2TA 1TY0A 1G6PA 1A0IA 2A69C 2R7ZB 2R92G 3TDQA 5C0XH 4HTHA 2BE5C 4KK7A 2O4XA 4QMGA 1EU4A 3CAMA 3BU2A 4A3CH 1YNNC 4B3RQ 2RSNA 5AFWA 2R7DA 3GQBA 2B2UC 2BDOA 2R7ZH 3K6OA 2EJMA 3NXWA 2OQKA 3PUWA 2WV6D 3AMUA 1IW7C 4LWCA 2OXPA 1PYSB 1PYBA 1K3BC 2F0OA 3A56A 3IFDA 4KTAA 5J1ZA 5GAEC 1II3A 2RDHA 2PMZE 5M5YH 2UU9Q 1I4XA 4RGNA 3CXCA 2E5LL 2PQAB 5IT9E 3UDXA 1CKMA 1PH6A 4R4QA 3LWUA 4KHPQ 1NCVA 2F4IA 3FEWX 4BY1H 2MO1A 3T13A 4A3EG 3L3OC 5J3BA 5DEHA 2FXQA 2R3ZA 4K0KQ 4LUVA 1K8MA 4YWMA 4QF4A 2B63B 3PIO3 1OTCA 2A6EC 3BVZA 1AP0A 4QB4A 2NZHA 1MSHA 1V1QA 1G2TA 2XVSA 3GD7A 3A7LA 1HXYD 4J6HA 1TIID 1Z47A 2F0UA 1PVOA 1FNWA 1TXYA 2B63H 1YNJC 3CU7A 2K03A 1HR0W 4BS9A 5EBCA 3MEFA 2DGYA 3CQZB 3TZUA 3HKZE 4C3HG 2F0IA 4A3BB 3J81c 2C35B 3C3LA 3F2UA 3FMCA 1QVFA 5CBEE 3S1NH 3A54A 3OPOA 3PF5A 1JWUD 4QUFA 2K5VA 3S17H 2H5XA 1FGUA 3WDNA 5A2QL 3CMEA 3CQZH 1SMXA 3OIQA 1MJCA 1I50B 1TWHB 2RQXA 1C48A 2K01A 3MXGA 4R4TA 2RF4A 3CCUA 4DR6L 4A3KG 1WTOA 4DPGA 3TS2A 1I6HB 5CC4A 1UE6A 1M90C 2NN6G 1I50H 1DOKA 1TWHH 4X3KA 4HMJA 4YHHQ 3M4OB 4DK3C 4NXML 1I6HH 1A63A 3Q0AA 2F0SA 2WB1E 2X6GA 2LXJA 3KLSA 1TWAH 3MFGA 2JA9A 4K6LA 1XNRQ 1D5MC 1KIXA 4DV7Q 2KEEA 3U4ZA 3M4OH 1EL0A 3CCVA 2EJFC 5A35A 4ULLA 2YYZA 1Q82C 4DF7A 1QNUA 4RCNA 1UE5A 4L5RC 3BDCA 1VQNA 1FL0A 4H0LC 1I5FA 1J6QA 2VQEQ 3S1RH 3K5OA 4B3TL 4OX9L 5CV5A 3I70A 1QE6A 1K0RA 1E2WA 3K58A 1SJHD 1MGSA 3FVQA 4JI6L 3PF4A 1CQFA 1KHIA 3STBD 3OW2A 1TQOA 1RDPD 2I07B 5JPMC 1TWGB 4IUVA 5E4XA 3CHBD 1EWHA 2AKWB 4B3MQ 1I4RA 1KD1C 1DXMA 1IBLL 2L55A 1HA5A 3QB3A 2M00A 5IP9G 2AUJD 1AW7A 2MHVA 2VNUD 1IXRA 4OELB 1QUQB 1ZYRD 3PO3B 3ONAB 2JA7B 1G8ZD 3LGJA 3K5LA 1WTWA 3G6EA 1W2BA 3NENA 3PO3H 2F1MA 2O5JC 2F0QA 3WOEA 2JA7H 2HCIA 5CYUA 1RTOA 3P75A 3E6ZX 1NMFA 1U4MA 5FO8B 2IHFA 1SRUA 1YHBA 2KECA 4LF6L 1J9OA 3PO2H 2NVTB 2L15A 4RHSA 4JI1L 1F2ZA 1YHAA 4PZ6A 2VB2X 5D14A 2O2LD 4ODGA 4FF1A 4H13C 4FXDA 5C3EB 5I9PA 3SXHA 3EA6A 2HHHQ 2NVTH 1B44D 4IJLA 1TR5A 1HH2P 3DM3A 5K36H 1N33Q 4K5VA 2NTTA 3AEVA 1MBYA 5C3EH 2VXWA 2UUBL 3T56B 4L63B 1X3QA 1CA5A 2HIVA 4LFBQ 3KBGA 4IALA 1JCKB 4LW1A 1TWFH 2A69D 1JE5A 1M8AA 1BCPC 4GOPC 2BE5D 2F4VQ 2YTXA 3QO2A 4BWGB 5KEEA 1YNND 2F52A 1FNVA 1RIPA 2R61A 4FO2A 2BH2A 4GKJL 1WTVA 4YCWA 1PMRA 1BKBA 2SNMA 3ULLA 2IY5B 5JJIA 3U50C 3FDTA 4TKOB 2KCNA 2Z4HA 4IJHA 1KNEA 3TN2A 2EE1A 1I94Q 3UDGA 2CH4W 1DOMA 5EJWA 3K7AB 5A2QE 4AQYL 3W1BA 3MXPA 3MEHA 3PUZA 1LABA 3I56A 4DV6Q 3S24A 2C9OA 3MXNA 3JAMc 1BO0A 3TMEA 4A3BG 4NPSA 3NTHA 3K7AH 5CV8A 2EIFA 3VR6A 1VF5C 5M5WB 3BVGA 3UI2A 4HIOA 1GUGA 4EQNA 2WKCA 3FRPB 1EQRA 1L0YB 1GUNA 4K2LA 4KJOA 3P7JA 3B6YA 1KABA 4UP9A 1RHPA 3AU7A 1NTGA 4X3SA 2EYLA 5C4ZA 3K59A 4BBRG 1B4OA 3HOYB 2PCFB 1PH2A 2K5NA 3UE1A 1QNKA 1YNJD 2EJGC 1LTAD 1D5XC 4JBWA 4TSSA 1QG7A 4KD4A 2B2UA 3PCOB 1EIYB 3HOUG 1EY7A 3SK4A 1OXUA 1LTLA 1RL2A 3OTOL 4ZK9B 1BCPF 2RVLA 4LF4L 1SNMA 5KYLA 3T1HL 3R93A 1EY6A 3ZYYX 1WFQA 3MXUA 5CMDA 4P75A 1KXLA 4NP5A 4PMWA 1A2TA 1VDZA 2I5HA 2KHIA 4DA2A 5GQOA 1Y1WB 1JJGA 3F2DA 3VYRA 4Y7NB 3I90A 2E75C 3MWYW 1SE4A 2N8NA 4KKSA 4UY8C 2K5DA 3GTLB 4HAEA 1Y1WH 1HTLD 3JAMi 3RLFA 4BBSG 3HOZH 2NVQB 4Y52H 2TSSA 2E2IH 1JE4A 5IYBH 1H9SB 2FMMA 1AN8A 2YV5A 2PW7A 1FYCA 1PH3A 3N52A 1Q3LA 1QZGA 2VB3X 4NB3A 1EZ8A 1EZ6A 2PYKA 3JAML 1EQQA 2CFMA 1PRTC 2UXDQ 1L0WA 1EY0A 3SDZA 3RMHA 1NBWA 4CKCA 1V1PA 1S3OA 2NZOA 2YTYA 3I8ZA 1LACA 1E1TA 1UAPA 4B3SQ 4IFDJ 5JEAG 4DR2Q 4WRDA 2HQLA 2Y0SB 4O0AA 1H95A 4A3IB 4MZ9A 1H9KA 5IT9c 2KA7A 3KF8B 2D0PA 2MPMA 2Q8IB 1B8AA 1GXDC 4DR5L 3HKSA 1B2TA 1JB3A 3TREA 1B7YB 4A3IH 3A8JE 1VMCA 3VA7A 4JV5L 2JA6H 5KIXA 1B9MA 1WCMH 3H0GB 4WJWA 2BCOA 2MO0A 4OONA 2A74C 1FR3A 3R2IA 4IURA 4A3DB 4GNXC 3KOJA 5IWAQ 2WKDA 5IYCH 1VQCA 4B08A 4R8IA 2R92B 3H0GH 4IN3A 1OXTA 4UPAA 1MIUA 4A3DH 4YCUA 3NUCA 3O13A 2KEDA 4B9XA 1SE2A 1GHJA 1AZPA 2R92H 1L0XB 2HQEA 3QWNA 1BVSA 2I46A 1PRTF 5LMUL 2N55A 1X3FA 2K05A 4F87A 2EY1A 1TS3A 3EROA 4FF4A 1TKWB 1Q90A 1HZAA 1CKNA 3EJIA 1GVPA 1YNXA 2E74C 2VUMG 3I4LA 4DR4Q 5ISRA 5BR8Q 2DJGC 4XDXA 4A3EB 3H15A 1DJRD 2AWNA 2RDGA 2EYOA 1XMQL 3GV6A 4B3RL 3S16B 3RLNA 2K50A 4GN4B 2KHSA 1A15A 2RA4A 3RUZA 1F9PA 1EY4A 4CHTB 2E2HH 1PXUA 4C1NK 1LM0A 1FNUA 2ZJRA 3G6JB 3DLLA 4A3EH 2UUAQ 3S16H 1BCPD 1YHQA 2QW7A 1ZXTA 5HY6A 1E3PA 5C4JH 4RFBA 3G4SA 3BZKA 3M7GA 2CH4A 3V05A 5DM73 3MZ5A 1PTOC 1Y69U 1VQ4A 1TS2A 1LV9A 1T5EA 4DR3Q 4HCEA 4KMUC 1SYDA 3E0EA 1KNAA 3K81C 2KCTA 4XXEA 2JSOA 2XTIA 1QVCA 3HOYG 4C3HH 1U0LA 2QDBA 1PFMA 3EBEA 1EIGA 4X64Q 4MTNA 4FNFA 4HMIA 2JEAI 3BZCA 4QL5A 3I4NG 1O7YA 4LF9L 1A2UA 1O7IA 3FHWA 3TS0A 3CCMA 2L0CA 3W1GA 3T1YQ 3BYTB 4M8AA 5IGBA 4G7OC 3S2HB 2OTJA 5IGFA 3H3VC 1IZ6A 2IX3A 4A3KH 1K8OA 5C4XB 5HGTA 4PMCA 1YJWA 4ZKBB 1Y1WG 1HNXL 2NN6H 3UDIA 3E0JA 1CI3M 3S2HH 5KNCA 3JAME 5CGKA 1WD0A 1O80A 1EIFA 4A3FB 2G9HD 2RHSB 1ZYRC 2Y0SE 2RBMA 1ICFB 2JE6I 4C3JB 3TZDA 4JI7Q 5DNFA 3BYYB 3OW7A 1JOQA 1Q12A 4GKKL 1D2BA 2L4NA 1PTOF 2VQFQ 1SBBB 4N9PA 3U4VA 4C3JH 1S5CD 2XNAC 1SDFA 5ELOA 5M5XB 1WVLA 1F9SA 2J4XA 3V2TA 1ESFA 1G51A 1BBUA 3PMFA 3TP6A 2MFIA 3KLRA 2XIWA 3J80i 4LF7Q 4QGUA 2F0DA 4X66Q 1YJNA 1YVCA 1EFID 2Y0SG 2EOTA 3U9SA 5AJ3Q 3L7ZC 3Q8DA 4CDDC 4JG2A 1CM9A 1X6OA 3OYYA 5IP9H 1Q81C 1C0AA 2ASBA 1B70B 5FLXc 3E5SA 3J80L 3K8AA 1PRTD 2DY7A 2J7ZA 3K57A 1VQHA 2F0KA 4RA8A 3EVQA 4MNOA 1FJGQ 3D6CA 4XQJA 3CKIB 4B3ML 2EYFA 4FXKC 4JI3Q 3VA5A 1B50A 4TQUS 1ZKOA 2QF7A 4O1NA 4WFN3 3J81j 1B3AA 2JEBI 1XMOQ 2BDNA 2YU9B 4EQOA 1QZHA 5JVH3 4DUZL 4CBVA 1X56A 1GUOA 2F0LA 3S9WA 1A3UA 3HRZC 4UDUC 1NR4A 1HNWL 2E2DC 3S1QB 4APVA 4FYDA 2R93G 5FOBB 2LMCB 3S1QH 5DLQE 4PG3A 1XPUA 1VQ8A 1CSPA 1K3RA 2M9VA 1G6ZA 1STYA 1EIHA 4KD3A 3EN2A 5EGTA 4XTCS 1SYEA 1LTRD 2IT1A 1VQ9A 1EUJA 4DV2Q 5CV9A 4N8FA 1ET6A 4H7BA 2F03A 5F2DA 5C3XA 3MVVA 2L12A 3D8GA 1SYCA 1D5ZC 4MTKA 4LFBL 5FLXL 1XTCD 2RCNA 4C56C 1GUSA 2XRQD 3HOVB 1K0SA 4QJFA 4AYBB 1U4PA 5M3MG 3NWTA 2B2TC 1LYLA 3MXNB 2FFKB 1Q8IA 2TMPA 2ZXOA 3D31A 1KAAA 1HUMA 2B8FA 4JBMA 3LNNA 4LF5Q 3KLWA 3EQLC 4E6IA 4GNXA 2RDFA 1XPOA 4A3BH 4X65Q 1EY8A 3PIP3 5E1FA 4I7ZC 2XN9C 1S5FD 1IL8A 4IPDA 4JI2Q 3I7FA 4BBRB 4IFDI 3M9BA 2ICIA 3CCEA 3D3RA 1X3EA 4DV6L 4WJ4A 3HOUB 4WORA 1PTOD 4BBRH 4YY3L 5C4XG 2CW0C 1UNSA 3I55A 5D65A 4JI8Q 4O42A 4K6DA 1KRTA 1JWMD 3HOUH 1DM0B 2E2JB 3NBHA 3X3MA 4DV3Q 1Y8NB 3CCQA 3D0FA 4QCLA 5IGDA 4HCSA 4A3FG 3S14B 3CPFA 2AQ2B 1HTPA 2MNAA 5CV6A 2ZJQA 5E7NA 4K14A 4DV5Q 2E2JH 4HSVA 4FP5D 4C3JG 2ICEC 1VQMA 3DEPA 3RNUA 1HRJA 4POFA 4JI5L 1Z7TA 3S14H 3RZOB 2N78A 4LFAQ 4BBSB 3GP7A 2K33A 1L1OB 4I7AA 2K5WA 4RKLA 1C4QA 1VQIA 1EOVA 2B2WC 4ZQ3A 3G48A 2QDLA 1IHZA 4RMFA 2IW3A 3J80E 3RZOH 4BBSH 4MN3A 3GTJB 4H02A 4TVAB 1PA6A 3HS0C 3KF6A 3DWQA 4HEDA 2FHTA 1PH1A 4DV1Q 2QEXA 2ALYB 2Z1CA 3NSWA 1TWGH 4XYOA 2R7FA 1J5EQ 4GN3B 3GTJH 2ZM6Q 4OIKA 4OO1I 3HOXG 3CP0A 1X55A 1N8RC 4KHVA 4BA1I 4LNQA 2FINB 3J7ZC 3QOJA 5ELBA 5FJ8H 1KQSA 2AQ3B 4DAVA 1N32Q 1N36Q 1SE8A 3RR5A 2I0QA 4JYAL 5JEAH 1EEFD 1PFBA 1LT3D 3VR3A 2JJQA 2ENBA 2F0TA 3CRLC 3K0XA 3VR2A 1NJIC 1K28A 2NTSA 4DAYA 1VQDA 4NXNQ 5IODA 4Q0FA 4YWKA 3BZDB 5EBDA 1VQKA 4B3SL 4B9WA 1HQRD 4RAUC 3DUZA 1SN8A 1TS5A 4ZUIA 2LFNA 4F88A 2FMCA 2JA8B 4A3GG 5E4WC 4F7XA 3S1MB 2E5LQ 5D3DA 4DK6C 4JBJA 4DU9A 1HNZQ 3Q22A 4H44C 2KBNA 2GVAA 3SR1A 3C46A 2PQEA 4C3IG 1SSOA 2LKVA 4HJ7A 1WOCA 3FKIB 5LMNL 3GO5A 3NQIA 2PPBC 1MJEA 2A5HA 4LFCQ 2BA1A 2WAQB 5JVG3 5FLXE 1CZWA 1HR0Q 5IWAL 1CKNB 1EY5A 2VUMB 3E3XA 2CQOA 4ZRZA 1A6XA 3I4OA 3I4MG 2B8GA 2PQAA 1U4LA 3UDFA 3PGZA 2EY6A 1WTPA 2ES2A 4OWTB 3PV0A 2VUMH 3R2TA 5C0XJ 1IBKL 3HOVG 4RGTA 1XYIA 1RD9D 2XRSD 4AYBG 3AQQA 1VQBA 3MTSA 4RHRA 3HOWG 3TP8A 2EYJA 2N88A 4O2DA 1Y1VG 1STGA 4DV4Q 5ELEA 5FO7B 3QOLA 4A93B 3W2DA 3BJUA 3IFTA 1IKLA 3AFPA 5BR8L 3NEMA 5JAVA 2PI2E 2UUCQ 2BH8A 2F3WA 2HD3A 4JOIC 2IHEA 4BY7G 4J8QA 5M5WH 4MHEA 4KY6A 4S3SA 1N34L 3NBIA 3VR5A 3I4NB 3ERSX 1H9RA 1EYDA 4C2MB 1KC8C 3HOYH 3GV3A 1JR0D 4YIJA 1I3QB 1X9NA 3D4RA 5FO9B 1BR9A 3QG1A 1QWYA 4A3JB 3I4NH 1ESRA 2XWBB 3S2DB 3ERQA 1PH5A 1JT8A 2ZTCA 4DR3L 4IFDG 4KHZA 1SYGA 2DN8A 2M2LA 1Q1BA 1I3QH 3A74A 2V4DA 4OX9Q 2KUMA 4QQBX 4NKLA 2GA4B 2Z6BA 3ZJYC 3CD6A 2MQHA 4Y7NH 3RN5A 1N9WA 3HFZB 4KKTA 1IBLQ 4JI4Q 4A3MB 1X3PA 1IL2A 2CW0D 3E9HA 3GTOB 3H6MA 4ALPA 3T1YL 1KDCA 4EGVA 1HPCA 3LX0A 3GTLH 1SR3A 1OXSC 3KJOA 1WTRA 1LLRD 5ELCA 3M85A 2NVQH 3M4YA 5EKIA 3C1FA 1YBYA 2QEJC 2B2TA 3I3CA 2WFWA 2ZJPA 5FJ8G 1U5KA 4R1JA 3EFXD 3DXJC 2PNHA 2PNRC 3PUXA 1H9MA 3DHQA 1I4QA 3A8IE 2QCPX 5C5MA 2L5TA 5I2XA 3OMCA 1NSNS 1VQ5A 1RF2D 2F3IA 3GTKB 1BUVT 1HZCA 2WACA 2HCCA 1CTMA 1GUTA 4L5SA 4LF8Q 4JI1Q 4JVZA 5EQ0A 3NPPA 2KQ3A 5KNDA 1MKHA 1QUQA 2HDLA 4JI0Q 1S5BD 2K32A 4LAAA 2Q2UA 3GTKH 4L6TB 4L8JA 5JOBA 1EFWA 1ILPA 4HJ9A 1KL9A 1TWCB 1Q7YC 1VQAA 1T9HA 3KYHC 4OO1G 1IBMQ 2WP8J 3Q23A 2AHOB 4DR7Q 3GTGB 1SNDA 2UUBQ 1TWCH 3KJPA 1PYWD 4OHJA 2JA8G 1LTSD 2JP1A 5ELFA 3C1EA 4G7ZC 1AH9A 2LXKA 2IX1A 4CKBA 1CSQA 1JJ2A 4IPHA 1AEXA 2MUYA 2A19A 2K5HA 3GTGH 4HIKA 3QJYA 3FP9A 3R3OA 3Q6SA 4R4IA 4RH6A 1K9MC 3FKIG 5M9OA 4RGOS 4XT3B 1JOOA 1FJGL 1VQ6A 4P71A 1A8VA 4GKJQ 3A0JA 2R93B 4KN7C 2WAQG 2B2WA 4KKUA 1SJED 5JEAJ 2ZT9C 2JA5G 3TQYA 4CDEC 2ID0A 4R4CA 1E0BA 1JMCA 1BBXC 3VR4A 2R93H 3URYA 1Y14B 4Z9CB 4X6AH 5BN5A 2NZ1D 1ENFA 4RCOA 1EOTA 1EQTA 3NELA 3PUVA 1PH9A 3VYTA 3CC2A 5T1IA 1P8LA 1PDQA 1SROA 1XXGA 3SK6A 2Q8TA 2OQ0A 4ZLTF 1VF7A 4OXPA 5FK9C 3CC7A 4A75A 5T1GA 3MAQA 2HT1A 4K8JA 4R9WA 2UU9L 3DWAA 1LTGD 2A8VA 2WIIB 1GJXA 5M3MB 2AWOA 4A93G 1M4VA 3OWEB 4J1MA 1AE2A 3WWVA 2F0HA 1NAPA 5KNBA 4L5TA 5IP7G 3KLSX 4KHPL 3TP5A 2EY5A 1CZGA 4OGQC 5I6WA 4G4KA 4UHVA 3T16A 3GTMB 3DM1A 2Z9HA 5M3MH 1EWCA 4K0KL 1W6KA 2GN5A 3NQTA 2G5DA 3H94A 5JPNC 3DEOA 4GNXB 3T1HQ 3HEJA 3LWEA 4QY7A 4LUOA 3J80c 4DK0A 2MP1A 5KGUA 3QR8A 5IIFA 3GTMH 1SFOB 3WOFA 1PLFA 2B3GA 4X62Q 1H9JA 2EDGA 3CCSA 4A3JG 1Y8OB 5DM63 4X3UA 4DFAA 1SFOH 4CGYB 3F2BA 1R9TB 2NVXB 1CHPD 3PIOA 4DAMA 3M4PA 4IOCA 2D62A 4GOPA 4GZYC 1PZKD 1E7ZA 2VY3A 1U4RA 2LSSA 4PNYA 2IJ0A 3NBHB 5IGCA 1VQJA 1R9TH 1F77A 2UXBQ 5C4XH 1FD7D 1GOZA 3A8KE 2CQAA 5J39A 4FDBA 1U9RA 1G2SA 4A3MG 4XQNA 3GTQB 2P5ZX 1K8AC 2F0EA 1EWIA 4JC0A 5G3LF 3L2PA 4PMBA 1LT4D 4A3FH 1F2MA 4KN4C 5JJKA 4YHHL 4DUYQ 1V9PA 4OIJA 3MHBA 2J0TD 1CFMA 2OCEA 4R8NA 4DAPA 2NB0A 1HUNA 2EZVA 3F2CA 3PIPA 1XNRL 4FF3A 4HR7B 4I65A 4DV7L 4EVOA 5LHY1 1H9SA 3SK5A 1YITA 3A5ZB 2I5LX 1VQGA 2KVMA 4DR5Q 5C44B 3A55A 3G7LA 2IPKD 4IUTA 1BQQT 5EPKA 1PTOB 5C4HA 2Z0SA 3KBXA 5M5XH 1F9QA 2VQEL 1LO5D 3CC4A 1NY4A 1K73C 3IAYA 2K4KA 3H3VI 4DR1Q 1FGBD 3SVMA 3CCRA 2A73B 2DNCA 3HOXB 4JOIA 4JV5Q 1G91A 5HGQA 1LUZA 3KDFA 2NWGA 1GD7A 4HJ8A 3TEHB 4A4IA 3HGBA 1WTXA 1JORA 5C0XI 2VW9A 4GS3A 2K14A 3HOXH 1KLUD 3BDLA 1SAPA 4CJ2C 1SNCA 1QB5D 1MSGA 1OXVA 1ZEQX 4DV1L 1CA6A 3OHXC 4AH6A 1UWVA 2H4OA 2JYOA 5EAYA 1J5EL 5IE8A 5D3IB 5I4DA 5LMUQ 2XWJB 2ZM6L 2JQOA 4TRDA 2A68C 2F0NA 4JW0A 4C1NI 4FXGC 4RKBA 3QIAA 2B2YC 3AFQA 1XNQQ 3J7AF 2X6LA 3T4AC 4A3GB 1D1KA 2YU9H 1F2LA 4FVMA 2RKSA 3SEBA 1AE3A 1JOKA 1PFNA 1C8CA 1E1OA 1YI2A 5DAUA 1SNOA 3PSIA 4C3IB 2EVBA 5CR3A 3R8BA 4A3GH 1NUCA 4NW2A 1XMQQ 4NXNL 4MIUA 1DONA 1XWEA 2PZUA 3ULPA 5ELNA 3K5MA 2SDFA 2Z6KC 4KY7A 3VYUA 5M5YB 4RWSC 4C3IH 5TSSA 2WINB 3CMAA 2HHHL 2DUDA 1G291 3C2PA 3OMGA 4GN5A 3I4MB 1N33L 4BY1B 4XIGS 2JXMB 1HNZL 1A3TA 2K28A 5IGEA 4KI0A 3BDOA 1O7LA 4P73A 2K1BA 3W5OA 1R4QB 2K7VA 4NMZA 1J8IA 3I4MH 2VS1A 2A1AA 2D0OA 3A5UA 3HOWB 4LFCL 3NTIA 2F4VL 1L1OC 1JWSD 1Y1VB 1XJVA 4IQZA 3HOVH 4J15A 2BOSA 1HR0L 2NBFA 4IUUA 4L5QA 2UXCQ 5K5PA 2F0PA 1JB7A 4LF9Q 2Z8LA 4XQQA 3HOWH 2C5CA 1TY2A 3S1NB 1F2YA 1Y1VH 3HP3A 3S17B 1I94L 2CWAA 3P20A 5FLMG 2EQSA 1TT2A 1QOHA 2F3VA 4P72A 4BY7B 2DJFC 4DK1A 5G3LD 1SMYC 1HNXQ 1STNA 4R4OA 3KFUA
chains in the Genus database with same CATH topology
1RKNA 1IYVA 1GUWA 4LJZC 2E76C 4ME5A 3T51B 2H1EA 3OSOA 4V0BA 1TWAB 1MD2D 1T5XD 4NDXA 2EYPA 1RODA 1PZJD 3NE5B 5CBAE 4IFDH 1QJOA 1B53A 2R6GA 3S1RB 4EQPA 4IZ8A 5C6AA 5KYIA 3HG9A 2DY8A 2B39A 3ND8A 2AUKA 1EU3A 5J22A 3IL8A 5EKLA 1B9NA 2B2VC 2FJ2A 1V1PB 1UEAB 2KCCA 1ENCA 4IUPA 2A6HC 3K0YA 2L11A 1CT1D 3J81L 4XT1B 2D5DA 1EQVA 1SNQA 1JICA 4UAIA 1BF4A 1PZID 1X32A 4KY5A 5BN4A 3PO2B 2SNSA 1BNZA 3IKJA 1K83B 1NR2A 3TP7A 2SOBA 3RZDB 5FKAC 5C0XG 4OO1H 3SE0A 3BS1A 1CQVA 4DNRB 3N6RA 3U9OA 4V190 1EY9A 1RJTA 2F0JA 1AFPA 2HUGA 2MJ8A 1Q1EA 1I4GA 1LTTD 4QIWB 5ELDA 2G9DA 3D4DA 2OT2A 1EEID 4P2CB 2KJXA 1TWFB 2A68D 1O7ZA 2JA5B 5EPJA 4OL7A 1DOLA 3NK9A 5KRUA 4ZKCB 2XSCA 1JC7A 3RD4A 1VCIA 1RTNA 1ONLA 1UUPA 1SYFA 3J7YW 1LTBD 2NYZD 3TSSA 5IGGA 3DWPA 1HA6A 3X3NA 4DXFA 1ET9A 4KV6A 4RGMA 2LY7A 4ILWA 4ZAIA 3P1HA 1BXTA 1IW7D 2OEOA 1S4ZA 1HHVA 4KJNA 3D6WA 4Q5VA 1GHKA 1SNPA 2L9HA 2IL8A 2D9UA 2PO4A 1BOSA 1STEA 4DXGA 2B2YA 2BA0A 3K5NA 3TBIB 1ENAA 3KK7A 2ZXPA 3I91A 2A6ED 1DYQA 1A3VA 1ICWA 4ABNA 1B1ZA 3A7AB 3NWSA 5C5LA 2PW5A 1BCPB 3PUYA 4U68A 3W3AA 1SMYD 2IX0A 1SE3A 4U673 3V96A 1HFGA 3T53B 2Q8RE 2F0WA 2ZXRA 1V1OA 1V8QA 2EYMA 4G7HC 3HOZB 2E2IB 3NHHA 1SYBA 3J81E 1DCZA 3H91A 3J7AV 4DGZA 1JQYD 4IUNA 2EPBA 4HN7A 5LL6S 3L9AX 3BVMA 3H09A 1DD2A 4ZUJA 2EY2A 5LL6X 1OXXK 3KUPA 1Z6HA 2PZTA 1ILQA 2DNEA 1DZ1A 4HSPA 1KDBA 2EYHA 4LK1C 1CHQD 3ND9A 3GTPB 3BG3A 5IOCA 4DNTB 4IUQA 1WD1A 5I6YA 1V43A 2IWHA 4K5WA 4ID6A 3SK8A 1KLGD 4PV1C 2PZWA 2JA6B 2A6HD 1WCMB 2K6AA 2QILA 3MC0B 3NP8A 2OF1A 5EPLA 5K36G 4PQXA 3DMUA 2AQ1B 1SEBD 1OO9B 1EYCA 1TU2B 1Y8PB 1E2ZA 1BDOA 1STHA 1PRTB 1TS4A 3NTKA 2B2VA 3I73A 2CVRA 5I9OA 2D2CC 2NVYB 2E2HB 2CHBD 3MFYA 3OWFA 4G57A 5EKKA 5CV4A 1O78A 1HFNA 2HDMA 4M1UB 1RCVD 1QILA 5C4JB 2K04A 4QUCA 3SHLA 5IT9L 4JK1C 2F0FA 2F0VA 3AB9A 1KTKA 2PMZB 1AZQA 1S5DD 3OIPA 1MI2A 1SXTA 1S5ED 2QKIC 4C3HB 2NN6I 3VYSA 1XX8A 1STBA 1I4HA 1WTQA 1I4PA 4FF2A 4X3TA 1F9RA 2KOLA 4F8MA 3I72A 2F0MA 4XYQA 4CJ0B 4A3KB 1R4PB 2LS01 4CJ1B 3D4WA 2SEBD 4BA2I 1STAA 2L1BA 1EYAA 2RSOA 3M3YB 3HKZB 3M7NA 1HQMC 5M3FB 4CKEA 2O5IC 1QCBD 4DN4M 5E3FA 5CV7A 1I6VC 1TVXA 1IYUA 5I2YA 1LTID 1CK1A 5JJZA 4K2KA 4LMQD 5COYA 1IKMA 4ZYSA 1E2VA 2F0GA 1HCZA 2Z4IA 2WB1B 5CORA 5BN3A 1LT5D 1PTOH 3OOCA 5NUCA 3Q24A 3ITPA 1D1IA 1D6EC 4K5XA 1VMPA 2K5QA 2X69A 1LT6D 3KF8A 2NUCA 1KDAA 3HZXA 3S15B 5C3WA 2MGSA 3CRKC 5HURA 4K8IA 3MA2B 1ML0D 2EXZA 3FPPA 1W6JA 3FPUB 4N9TA 1TY0A 2A69C 2R7ZB 3TDQA 5C0XH 4HTHA 2BE5C 4KK7A 2O4XA 4QMGA 1EU4A 1YNNC 2RSNA 5AFWA 3GQBA 2B2UC 2BDOA 3K6OA 2EJMA 3NXWA 3PUWA 2WV6D 3AMUA 1IW7C 2OXPA 2F0OA 3A56A 3IFDA 4KTAA 5J1ZA 1II3A 2RDHA 1I4XA 4RGNA 5IT9E 3LWUA 1NCVA 2F4IA 3FEWX 3T13A 3L3OC 5DEHA 2R3ZA 1K8MA 4QF4A 2B63B 3PIO3 2A6EC 3BVZA 1AP0A 4QB4A 1MSHA 1G2TA 2XVSA 3GD7A 3A7LA 1HXYD 4J6HA 1TIID 1Z47A 2F0UA 1FNWA 1YNJC 3CU7A 2K03A 4BS9A 5EBCA 3CQZB 3TZUA 4C3HG 2F0IA 4A3BB 3C3LA 3F2UA 3FMCA 5CBEE 3A54A 3OPOA 1JWUD 4QUFA 3WDNA 5A2QL 3OIQA 1I50B 1TWHB 2RQXA 1C48A 2K01A 3MXGA 1WTOA 1I6HB 5CC4A 2NN6G 1DOKA 4X3KA 4HMJA 3M4OB 3Q0AA 2F0SA 2X6GA 3KLSA 3MFGA 4K6LA 1D5MC 2KEEA 1EL0A 2EJFC 5A35A 4ULLA 2YYZA 4DF7A 1QNUA 4RCNA 3BDCA 4H0LC 3K5OA 5CV5A 3I70A 1QE6A 1E2WA 3K58A 1SJHD 1MGSA 3FVQA 1CQFA 1TQOA 1RDPD 2I07B 5JPMC 1TWGB 4IUVA 5E4XA 3CHBD 1EWHA 1I4RA 1DXMA 2L55A 1HA5A 3QB3A 2M00A 2AUJD 1AW7A 2MHVA 2VNUD 1ZYRD 3PO3B 3ONAB 2JA7B 1G8ZD 3K5LA 1WTWA 2F1MA 2O5JC 2F0QA 3WOEA 2HCIA 5CYUA 1RTOA 3P75A 3E6ZX 1U4MA 5FO8B 2KECA 2NVTB 1J9OA 4RHSA 1F2ZA 2VB2X 5D14A 2O2LD 4ODGA 4FF1A 4H13C 4FXDA 5C3EB 5I9PA 3SXHA 3EA6A 1B44D 1TR5A 5K36H 4K5VA 2NTTA 1MBYA 2VXWA 3T56B 4L63B 1X3QA 1CA5A 3KBGA 4IALA 1JCKB 2A69D 1M8AA 1BCPC 2BE5D 3QO2A 4BWGB 5KEEA 1YNND 1FNVA 2R61A 4FO2A 1WTVA 1PMRA 2SNMA 3FDTA 4TKOB 2KCNA 2Z4HA 1KNEA 3TN2A 2EE1A 1DOMA 5EJWA 3K7AB 5A2QE 3MXPA 3MEHA 3PUZA 1LABA 2C9OA 3MXNA 1BO0A 3TMEA 3NTHA 5CV8A 3VR6A 1VF5C 5M5WB 3BVGA 3UI2A 1GUGA 4EQNA 2WKCA 3FRPB 1L0YB 1GUNA 4K2LA 4KJOA 3P7JA 1KABA 5C4ZA 1RHPA 3AU7A 4X3SA 3K59A 2EYLA 1B4OA 3HOYB 2PCFB 1QNKA 1YNJD 2EJGC 1LTAD 1D5XC 4JBWA 4TSSA 1QG7A 4KD4A 2B2UA 1EY7A 3SK4A 1OXUA 4ZK9B 1BCPF 2RVLA 1SNMA 5KYLA 3R93A 1EY6A 3ZYYX 3MXUA 5CMDA 4NP5A 4PMWA 1A2TA 1VDZA 4DA2A 1Y1WB 3VYRA 4Y7NB 3I90A 2E75C 3MWYW 1SE4A 4KKSA 2K5DA 3GTLB 4HAEA 1HTLD 3RLFA 2NVQB 2TSSA 1JE4A 1H9SB 2FMMA 1AN8A 2PW7A 1FYCA 3N52A 1Q3LA 2VB3X 1EZ8A 1EZ6A 2PYKA 3JAML 1PRTC 1EY0A 3SDZA 3RMHA 4CKCA 1V1PA 3I8ZA 1LACA 1UAPA 4IFDJ 5JEAG 4WRDA 2Y0SB 4A3IB 1H9KA 2KA7A 2MPMA 2Q8IB 1GXDC 1B2TA 1JB3A 3A8JE 1VMCA 3VA7A 5KIXA 1B9MA 3H0GB 4WJWA 2BCOA 2A74C 1FR3A 3R2IA 4IURA 4A3DB 2WKDA 4B08A 4R8IA 2R92B 4IN3A 1OXTA 3NUCA 3O13A 2KEDA 4B9XA 1SE2A 1GHJA 1AZPA 1L0XB 2HQEA 3QWNA 2I46A 1PRTF 2N55A 2K05A 4F87A 2EY1A 1TS3A 3EROA 4FF4A 1TKWB 1Q90A 3EJIA 2E74C 3I4LA 5ISRA 4XDXA 4A3EB 1DJRD 2AWNA 2RDGA 2EYOA 3GV6A 3S16B 2KHSA 1A15A 2RA4A 3RUZA 1F9PA 1EY4A 4CHTB 1PXUA 4C1NK 1FNUA 3G6JB 1BCPD 1ZXTA 4RFBA 3M7GA 3V05A 5DM73 3MZ5A 1PTOC 1Y69U 1TS2A 1LV9A 1T5EA 4HCEA 4KMUC 1SYDA 1KNAA 4XXEA 2JSOA 2QDBA 1PFMA 1EIGA 4FNFA 4HMIA 2JEAI 1O7YA 1A2UA 2L0CA 3BYTB 4M8AA 5IGBA 4G7OC 3S2HB 5IGFA 3H3VC 2IX3A 1K8OA 5C4XB 5HGTA 4PMCA 4ZKBB 2NN6H 3E0JA 1CI3M 5KNCA 3JAME 5CGKA 1WD0A 1O80A 4A3FB 2G9HD 1ZYRC 2RBMA 2JE6I 4C3JB 3TZDA 5DNFA 3BYYB 3OW7A 1JOQA 1Q12A 1D2BA 2L4NA 1PTOF 1SBBB 4N9PA 1S5CD 2XNAC 1SDFA 5M5XB 1WVLA 1F9SA 2J4XA 3V2TA 1ESFA 3PMFA 3TP6A 3KLRA 2XIWA 2F0DA 1EFID 2EOTA 3U9SA 3L7ZC 1CM9A 3E5SA 3J80L 1PRTD 2DY7A 2J7ZA 3K57A 4RA8A 2F0KA 3EVQA 3D6CA 4XQJA 3CKIB 2EYFA 4FXKC 3VA5A 1B50A 4TQUS 4O1NA 1ZKOA 2QF7A 4WFN3 1B3AA 2JEBI 2BDNA 2YU9B 4EQOA 5JVH3 4CBVA 1GUOA 2F0LA 3S9WA 1A3UA 3HRZC 4UDUC 1NR4A 2E2DC 3S1QB 4FYDA 5FOBB 2LMCB 2M9VA 1G6ZA 1STYA 1EIHA 4KD3A 5EGTA 4XTCS 1SYEA 1LTRD 2IT1A 5CV9A 1ET6A 4H7BA 2F03A 5F2DA 5C3XA 3MVVA 2L12A 3D8GA 1SYCA 1D5ZC 5FLXL 1XTCD 3HOVB 4C56C 1GUSA 2XRQD 4AYBB 1U4PA 3NWTA 2B2TC 2FFKB 1Q8IA 2TMPA 2ZXOA 3D31A 1KAAA 1HUMA 2B8FA 3LNNA 3EQLC 4E6IA 2RDFA 1EY8A 3PIP3 5E1FA 4I7ZC 2XN9C 1S5FD 1IL8A 4BBRB 4IFDI 2ICIA 3D3RA 3HOUB 4WORA 1PTOD 2CW0C 1UNSA 5D65A 4O42A 4K6DA 1JWMD 1DM0B 2E2JB 3NBHA 3X3MA 1Y8NB 4QCLA 5IGDA 4HCSA 3S14B 2AQ2B 1HTPA 5CV6A 4K14A 4HSVA 4FP5D 4C3JG 2ICEC 3DEPA 1HRJA 1Z7TA 3RZOB 4BBSB 3GP7A 2K33A 2K5WA 4RKLA 1C4QA 2B2WC 4ZQ3A 1IHZA 2IW3A 3J80E 4MN3A 3GTJB 3HS0C 3DWQA 4HEDA 2FHTA 2Z1CA 3NSWA 4XYOA 4OIKA 4OO1I 4KHVA 4BA1I 2FINB 3QOJA 5ELBA 2AQ3B 4DAVA 5JEAH 1EEFD 1PFBA 1LT3D 3VR3A 2ENBA 2F0TA 3CRLC 3VR2A 2NTSA 4DAYA 5IODA 4Q0FA 3BZDB 5EBDA 4B9WA 1HQRD 4RAUC 3DUZA 1TS5A 4ZUIA 2LFNA 4F88A 2FMCA 2JA8B 5E4WC 4F7XA 3S1MB 5D3DA 4DU9A 3Q22A 4H44C 3C46A 3SR1A 2PQEA 4C3IG 1SSOA 2LKVA 3FKIB 3GO5A 3NQIA 2PPBC 2A5HA 2BA1A 2WAQB 5JVG3 5FLXE 1CZWA 1EY5A 2VUMB 4ZRZA 1A6XA 2B8GA 1U4LA 2EY6A 1WTPA 3PV0A 3R2TA 5C0XJ 4RGTA 1XYIA 1RD9D 2XRSD 3MTSA 4RHRA 3TP8A 2EYJA 2N88A 1STGA 5ELEA 5FO7B 3QOLA 4A93B 3W2DA 3IFTA 1IKLA 5JAVA 2F3WA 4J8QA 4MHEA 4KY6A 4S3SA 3NBIA 3VR5A 3I4NB 1H9RA 1EYDA 4C2MB 3GV3A 1JR0D 4YIJA 1I3QB 3D4RA 5FO9B 1BR9A 3QG1A 1QWYA 4A3JB 1ESRA 2XWBB 3S2DB 3ERQA 4IFDG 4KHZA 1SYGA 2DN8A 2M2LA 1Q1BA 2V4DA 2KUMA 4NKLA 2GA4B 4KKTA 4A3MB 1X3PA 2CW0D 3GTOB 3H6MA 1KDCA 4EGVA 1HPCA 3LX0A 1OXSC 1WTRA 1LLRD 5ELCA 3M85A 3M4YA 5EKIA 3C1FA 2QEJC 2B2TA 3I3CA 3EFXD 3DXJC 2PNRC 3PUXA 1H9MA 3DHQA 1I4QA 3A8IE 2QCPX 5C5MA 2L5TA 5I2XA 3OMCA 1NSNS 1RF2D 3GTKB 1BUVT 2WACA 2HCCA 1CTMA 1GUTA 5EQ0A 3NPPA 2KQ3A 5KNDA 2HDLA 1S5BD 2K32A 4LAAA 4L6TB 4L8JA 5JOBA 1ILPA 1TWCB 4OO1G 2WP8J 3Q23A 3GTGB 1SNDA 1PYWD 4OHJA 1LTSD 2JP1A 5ELFA 3C1EA 4G7ZC 2IX1A 4CKBA 1AEXA 2MUYA 3QJYA 3R3OA 3Q6SA 4RH6A 5M9OA 4RGOS 4XT3B 1JOOA 2R93B 4KN7C 2B2WA 4KKUA 1SJED 5JEAJ 2ZT9C 2ID0A 1E0BA 1BBXC 3VR4A 3URYA 4Z9CB 5BN5A 2NZ1D 1ENFA 4RCOA 1EOTA 1EQTA 3PUVA 3VYTA 5T1IA 1PDQA 1XXGA 3SK6A 2Q8TA 4ZLTF 1VF7A 5FK9C 5T1GA 3MAQA 4K8JA 4R9WA 3DWAA 1LTGD 2WIIB 1GJXA 5M3MB 2AWOA 1M4VA 3OWEB 4J1MA 2F0HA 1NAPA 5KNBA 3KLSX 3TP5A 2EY5A 1CZGA 4OGQC 5I6WA 4G4KA 3T16A 3GTMB 3DM1A 1EWCA 1W6KA 3NQTA 3H94A 5JPNC 3DEOA 3HEJA 3LWEA 4DK0A 2MP1A 5KGUA 5IIFA 1SFOB 3WOFA 1PLFA 1H9JA 2EDGA 1Y8OB 5DM63 4X3UA 4DFAA 4CGYB 1R9TB 2NVXB 1CHPD 2D62A 4GZYC 1PZKD 1U4RA 4PNYA 2IJ0A 5IGCA 1F77A 1FD7D 1GOZA 3A8KE 2CQAA 5J39A 1U9RA 1G2SA 4XQNA 3GTQB 2F0EA 5G3LF 4PMBA 1LT4D 1F2MA 4KN4C 4OIJA 3MHBA 2J0TD 1CFMA 4R8NA 4DAPA 2NB0A 1HUNA 2EZVA 4FF3A 4HR7B 4I65A 4EVOA 5LHY1 1H9SA 3SK5A 2KVMA 5C44B 3A55A 3G7LA 2IPKD 4IUTA 1BQQT 5EPKA 1PTOB 5C4HA 3KBXA 1F9QA 1LO5D 3IAYA 1FGBD 3SVMA 2A73B 2DNCA 3HOXB 1G91A 2NWGA 3HGBA 1WTXA 1JORA 5C0XI 1KLUD 3BDLA 1SAPA 4CJ2C 1SNCA 1QB5D 1MSGA 1OXVA 1ZEQX 1CA6A 3OHXC 2H4OA 2JYOA 5D3IB 5I4DA 2XWJB 4TRDA 2A68C 2F0NA 4C1NI 4FXGC 4RKBA 3QIAA 2B2YC 3J7AF 2X6LA 3T4AC 4A3GB 1D1KA 1F2LA 4FVMA 2RKSA 3SEBA 1JOKA 1PFNA 1C8CA 5DAUA 1SNOA 4C3IB 2EVBA 5CR3A 3R8BA 1NUCA 4NW2A 4MIUA 1DONA 1XWEA 2PZUA 3K5MA 2SDFA 4KY7A 3VYUA 5M5YB 4RWSC 5TSSA 2WINB 1G291 3C2PA 3OMGA 3I4MB 4BY1B 4XIGS 2JXMB 1A3TA 2K28A 5IGEA 4KI0A 3BDOA 1O7LA 2K1BA 1R4QB 2K7VA 4NMZA 1J8IA 3HOWB 3NTIA 1JWSD 1Y1VB 4IQZA 2BOSA 2NBFA 4IUUA 5K5PA 2F0PA 2Z8LA 4XQQA 2C5CA 1TY2A 3S1NB 1F2YA 3HP3A 3S17B 3P20A 1TT2A 1QOHA 2F3VA 4BY7B 4DK1A 5G3LD 1SMYC 1STNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAP A;  1NAP A;  3DEP A;  3UI2 A;  4CJ2 C;  1AP0 A;  1HRJ A;  1MSH A;  1U4L A;  1HFG A;  1G2T A;  1GUW A;  1RJT A;  1MSG A;  2B2V A;  2CVR A;  1WTW A;  1WTP A;  2HUG A;  2Q8R E;  4IUR A;  5JJZ A;  2MJ8 A;  4LMQ D;  3DM1 A;  5COY A;  1IKM A;  1CA6 A;  4ZKB B;  3P7J A;  1RHP A;  2B2W C;  2H1E A;  4X3S A;  1XYI A;  4R8I A;  2HCC A;  3DEO A;  1B4O A;  2JYO A;  1QNK A;  2K03 A;  3LWE A;  2HCI A;  3MTS A;  5COR A;  5EQ0 A;  2MP1 A;  1WD0 A;  1B50 A;  2HDL A;  1O80 A;  1RTO A;  1QG7 A;  4MN3 A;  2B2U A;  2N88 A;  1G6Z A;  1EIH A;  2B2Y C;  1O7Z A;  1U4M A;  2KED A;  1PLF A;  3F2U A;  2FHT A;  4HED A;  2X6L A;  2RVL A;  4ZK9 B;  5CBE E;  5EPJ A;  1AZP A;  1ILP A;  1HFN A;  1ROD A;  2KEC A;  2HDM A;  1J9O A;  3H91 A;  1F2L A;  3R93 A;  4QUF A;  1DOL A;  2N55 A;  4ZKC B;  5CBA E;  1IKL A;  2K05 A;  3TZD A;  1VMP A;  1PFN A;  5CMD A;  2X69 A;  2K04 A;  4OIK A;  4X3U A;  5DNF A;  1C8C A;  5D14 A;  2EPB A;  4QUC A;  1B53 A;  2L12 A;  1RTN A;  2L4N A;  2FIN B;  2MGS A;  4NW2 A;  2K01 A;  1WTO A;  1DON A;  1U4R A;  2JP1 A;  3KUP A;  4MHE A;  1AZQ A;  1SDF A;  2NYZ D;  1U4P A;  2SDF A;  3I90 A;  3MWY W;  2B2T C;  1ILQ A;  1MI2 A;  2DY8 A;  1F9S A;  1WVL A;  1DOK A;  4RWS C;  4X3K A;  1PFB A;  1HA6 A;  2FFK B;  1ML0 D;  2VXW A;  4HAE A;  1DZ1 A;  4XDX A;  4ZAI A;  3GV6 A;  1XX8 A;  1X3Q A;  1HUM A;  3FPU B;  2XIW A;  1CA5 A;  3GV3 A;  3Q6S A;  1G2S A;  1JE4 A;  1A15 A;  1S4Z A;  2RA4 A;  1F9P A;  2B2V C;  2X6G A;  2FJ2 A;  3IL8 A;  4XT3 B;  1HHV A;  1WTQ A;  2EOT A;  4IUQ A;  1WD1 A;  2FMM A;  4X3T A;  3D6W A;  1F9R A;  1Q3L A;  1ESR A;  2K28 A;  1M8A A;  2KEE A;  2KOL A;  3N52 A;  1EL0 A;  4IUP A;  1CM9 A;  2B2W A;  4OIJ A;  2K1B A;  2RSN A;  2M2L A;  3QO2 A;  4RAU C;  1ZXT A;  2L11 A;  2L9H A;  5AFW A;  1IL8 A;  2IL8 A;  2KUM A;  1J8I A;  1HUN A;  4CJ0 B;  2D9U A;  2DY7 A;  2J7Z A;  2B2U C;  4CJ1 B;  5E4W C;  1WTV A;  1E0B A;  4RA8 A;  2B2Y A;  1BBX C;  4XT1 B;  2L1B A;  3I8Z A;  5EPL A;  2RSO A;  3FDT A;  3I91 A;  1LV9 A;  2KVM A;  2NZ1 D;  1QE6 A;  1KNE A;  3IFD A;  2EE1 A;  3TN2 A;  1JIC A;  4UAI A;  3G7L A;  1KNA A;  1EOT A;  1BF4 A;  1DOM A;  4IUT A;  1SSO A;  4IUU A;  5EJW A;  1ICW A;  1EQT A;  5EPK A;  3KBX A;  1MGS A;  1X3P A;  5D65 A;  4O42 A;  1F9Q A;  1B3A A;  1X32 A;  5T1I A;  1PDQ A;  2BDN A;  2Q8T A;  1WTR A;  3SVM A;  1PFM A;  4ZLT F;  1EIG A;  4IUV A;  4DN4 M;  2MPM A;  1NR2 A;  3HP3 A;  1BO0 A;  5E4X A;  1BNZ A;  1G91 A;  5EKI A;  1B2T A;  2NWG A;  4HCS A;  5T1G A;  1NCV A;  1O7Y A;  2B2T A;  1TVX A;  4R9W A;  3I3C A;  1WTX A;  2R3Z A;  4U68 A;  1VMC A;  1NR4 A;  4HSV A;  3ONA B; 
#chains in the Genus database with same CATH topology
 1RKN A;  1IYV A;  1GUW A;  1S40 A;  4BY7 H;  4LJZ C;  3F1Z A;  4DV4 L;  4A3L G;  2E76 C;  4ME5 A;  3E9I A;  3T51 B;  1DGS A;  2H1E A;  2HIX A;  1PV4 A;  5GAD C;  3OSO A;  4V0B A;  1TWA B;  1MD2 D;  1T5X D;  1D7Q A;  2UUC L;  4NDX A;  4GKK Q;  2EYP A;  3HKZ G;  1ROD A;  1PZJ D;  5IYD G;  3NE5 B;  5M3F G;  5CBA E;  1A62 A;  4IFD H;  1QJO A;  1B53 A;  1WJJ A;  2R6G A;  3S1R B;  1VQO A;  4EQP A;  4IZ8 A;  3SGI A;  4JCV E;  5C6A A;  5KYI A;  3HG9 A;  2DY8 A;  2B39 A;  3ND8 A;  2N3S A;  1Q86 C;  2AUK A;  2OTL A;  3K7U C;  1UE1 A;  1EU3 A;  5C44 G;  1GO3 E;  5J22 A;  3IL8 A;  5EKL A;  1B9N A;  2B2V C;  2FJ2 A;  1V1P B;  4DV0 Q;  3G71 A;  1UEA B;  3J81 i;  2KCC A;  1ENC A;  4BXX H;  2WB1 G;  4DKA C;  2Q2H A;  4IUP A;  4DNI A;  4PZ7 A;  2A6H C;  4JPB W;  2QA4 A;  1S72 A;  3K0Y A;  2L11 A;  1CT1 D;  4JI4 L;  2XGT A;  2VZA A;  3J81 L;  2CKZ B;  4XT1 B;  2D5D A;  1EQV A;  4KLK A;  1SNQ A;  2UXD L;  1JIC A;  4UAI A;  4DUZ Q;  1BF4 A;  1PZI D;  1NNX A;  1UE7 A;  1X32 A;  4UP8 A;  4KY5 A;  5BN4 A;  3PO2 B;  2SNS A;  1P16 A;  1HNW Q;  1BNZ A;  3IKJ A;  4YCV A;  1K83 B;  1NR2 A;  3TP7 A;  2SOB A;  4DR2 L;  3RZD B;  5FKA C;  5C0X G;  4OO1 H;  1CUK A;  3SE0 A;  1BBW A;  3BS1 A;  2K52 A;  4A3C G;  1CQV A;  3AYH B;  4DNR B;  3EIV A;  4LF8 L;  1K83 H;  3N6R A;  3U9O A;  2R7Z G;  4V19 0;  1EY9 A;  3RZD H;  1RJT A;  2F0J A;  1AFP A;  3K80 C;  1X3G A;  2HUG A;  3CPW A;  2MJ8 A;  4JI0 L;  2JA8 H;  1Q1E A;  1I4G A;  1LTT D;  4QIW B;  4AYB E;  5ELD A;  2CCZ A;  3S1M H;  1HZB A;  2G9D A;  2N49 A;  3D4D A;  2OT2 A;  1IBM L;  1EEI D;  4P2C B;  2I5M X;  2KJX A;  1E22 A;  1TWF B;  2A68 D;  3FKI H;  5LMN W;  4DR7 L;  1O7Z A;  1WI5 A;  2JA5 B;  5EPJ A;  4OL7 A;  4BY1 G;  1DOL A;  3NK9 A;  5KRU A;  4ZKC B;  2XSC A;  3L0O A;  1VQF A;  1JC7 A;  1B3Q A;  2JN4 A;  2GVB A;  1C7Y A;  4OEM B;  3RD4 A;  2ZTE A;  4ME3 A;  1VCI A;  2JA5 H;  1KAW A;  3RLO A;  1RTN A;  1ONL A;  1UUP A;  1SYF A;  1YEZ A;  3J7Y W;  1LTB D;  2NYZ D;  3TSS A;  4IOA A;  5IGG A;  3DWP A;  2B63 G;  3X3N A;  1HA6 A;  4DXF A;  1ET9 A;  4KV6 A;  4RGM A;  2LY7 A;  2EXD A;  4ILW A;  4ZAI A;  3P1H A;  1BXT A;  1IW7 D;  3PQI A;  2OEO A;  4DR6 Q;  1S4Z A;  1HHV A;  4KJN A;  4DR4 L;  3D6W A;  1D8L A;  5IY0 A;  4Q5V A;  1X54 A;  1MHW C;  4A93 H;  1XPR A;  1GHK A;  1SNP A;  2AMC B;  2L9H A;  2IL8 A;  4NXM Q;  4CDC C;  2D9U A;  4YY3 Q;  2PO4 A;  1BOS A;  1STE A;  5IP7 H;  2ATW A;  4DXG A;  2B2Y A;  2BA0 A;  3K5N A;  3TBI B;  1ENA A;  3KK7 A;  4EX5 A;  2UUA L;  1Z9F A;  2ZXP A;  1PFS A;  3I91 A;  2A6E D;  3I2Z A;  1YZ6 A;  5H1S E;  1PH7 A;  1DYQ A;  3JC6 6;  1A3V A;  1ICW A;  4ABN A;  5GAG C;  3TRZ A;  3U58 A;  1B1Z A;  3A7A B;  3NWS A;  4C2M H;  5C5L A;  2PW5 A;  4B3T Q;  2Z6K A;  4JI5 Q;  1BCP B;  4GOP B;  3PUY A;  4HID A;  4A3J H;  4JI6 Q;  4U68 A;  3S2D H;  3W3A A;  1SMY D;  1KRS A;  4X64 L;  2IX0 A;  1SE3 A;  4U67 3;  3V96 A;  1HFG A;  1SLJ A;  3T53 B;  2Q8R E;  2F0W A;  2ZXR A;  4POG A;  4YWL A;  4X62 L;  1V1O A;  2PI2 A;  1V8Q A;  2EYM A;  4G7H C;  1QVG A;  3HOZ B;  3ICE A;  2E2I B;  3NHH A;  3VDY A;  4BXX G;  3CF5 A;  4A3M H;  1SYB A;  3GTO H;  1NMG A;  3J81 E;  3H91 A;  1DCZ A;  3J7A V;  1L1O A;  4CDF C;  4DGZ A;  2KEN A;  2UXB L;  2KCM A;  1JQY D;  4IUN A;  4GLV B;  2EPB A;  3CW2 C;  4JYA Q;  4HN7 A;  5LL6 S;  1WYD A;  3L9A X;  3BVM A;  3H09 A;  1DD2 A;  4ZUJ A;  2EY2 A;  5LL6 X;  4LF6 Q;  1OXX K;  3KUP A;  4JI7 L;  2Q2I A;  1Z6H A;  2PZT A;  1ILQ A;  2DNE A;  3PO3 G;  4DUY L;  4OWX B;  3KDF B;  2JA7 G;  1DZ1 A;  4HSP A;  4QIW E;  2VQF L;  1KDB A;  2EYH A;  1X65 A;  4LK1 C;  1VQ7 A;  1CHQ D;  1XTD A;  3ER0 A;  3ND9 A;  4JBK A;  3GTP B;  3BG3 A;  5IOC A;  4ZCK A;  2WAQ E;  4DNT B;  4IUQ A;  1WD1 A;  5GRO A;  5I6Y A;  3UE0 A;  1V43 A;  1VQE A;  1YJ9 A;  2IWH A;  4K5W A;  3PO2 G;  4ID6 A;  3SK8 A;  4LF7 L;  1KLG D;  4PV1 C;  2PZW A;  2JA6 B;  2A6H D;  1WCM B;  2K6A A;  2QIL A;  3MC0 B;  3NP8 A;  4X66 L;  3GTP H;  2OF1 A;  5AJ3 L;  5LMN Q;  4DR1 L;  1HZ9 A;  5EPL A;  5K36 G;  2B29 A;  4PQX A;  5L37 A;  5C3E G;  3GDE A;  3DMU A;  4GLX A;  2AQ1 B;  3CCJ A;  1SEB D;  1OO9 B;  1EYC A;  1TU2 B;  4JI3 L;  1Y8P B;  1E2Z A;  2V1C C;  1BDO A;  1YIJ A;  1STH A;  1XMO L;  4AQY Q;  1PRT B;  2E8G A;  1IBK Q;  1TS4 A;  4WJ3 M;  2OWO A;  1ASY A;  3NTK A;  2VL6 A;  2B2V A;  3I73 A;  2CVR A;  3IRB A;  5I9O A;  1XNQ L;  1JJC B;  1FVI A;  1UEB A;  2D2C C;  2ZTD A;  3M4Q A;  2NVY B;  1HJP A;  2CWP A;  3F8T A;  1M1K C;  2E2H B;  2CHB D;  3MFY A;  3OWF A;  4G57 A;  4HJA A;  4P74 A;  5EKK A;  2NVY H;  5CV4 A;  1Q8K A;  1O78 A;  4IPG A;  1HFN A;  2HDM A;  4A76 A;  4M1U B;  1E24 A;  1RCV D;  1QIL A;  5C4J B;  5GAH C;  2K04 A;  2K75 A;  1N34 Q;  4QUC A;  3SHL A;  5IT9 L;  3RN2 A;  1Q46 A;  2F0F A;  4JK1 C;  3OTO Q;  4LF4 Q;  2F0V A;  4DV2 L;  3AB9 A;  1KTK A;  2PMZ B;  1AZQ A;  1S5D D;  1WTH A;  3OIP A;  1MI2 A;  1SXT A;  1S5E D;  2QKI C;  4C3H B;  4AIM A;  2NN6 I;  3VYS A;  4N8X 1;  1XX8 A;  1STB A;  2YTV A;  4OWW B;  4EQ5 A;  3J7A 5;  1I4H A;  2QGQ A;  1L2F A;  1WTQ A;  1I4P A;  4FF2 A;  5JJL A;  1VQP A;  4X3T A;  5FLM H;  3ULJ A;  3CCL A;  1F9R A;  2KOL A;  4F8M A;  1NE3 A;  1IYJ B;  3I72 A;  4LF5 L;  1C9O A;  2F0M A;  2UXC L;  4XYQ A;  4CJ0 B;  4A3K B;  4RG1 A;  1R4P B;  2LS0 1;  2RCF A;  4CJ1 B;  3D4W A;  2NVX H;  4IPC A;  2JK8 A;  4X65 L;  2SEB D;  4BA2 I;  4A3L H;  1STA A;  2L1B A;  1EYA A;  2RSO A;  4UP7 A;  3M3Y B;  4JI2 L;  3HKZ B;  1PHJ A;  2KHJ A;  3M7N A;  3STB C;  1HQM C;  5M3F B;  1K8G A;  4CKE A;  1EYG A;  2O5I C;  1PH8 A;  3HOZ G;  1QCB D;  4DN4 M;  5E3F A;  5CV7 A;  5IYB G;  3M3Y H;  5IYD H;  1I6V C;  3GTQ H;  1TVX A;  4JI8 L;  5M3F H;  1IYU A;  5I2Y A;  1VQL A;  4DV3 L;  1LTI D;  4GLA C;  3KF6 B;  1ASZ A;  1CK1 A;  5JJZ A;  4K2K A;  4LMQ D;  4PZ8 A;  5COY A;  1W3S A;  4ZYS A;  1IKM A;  1E2V A;  2F0G A;  4DV5 L;  4HIM A;  1HCZ A;  2Z4I A;  2WB1 B;  5COR A;  4IO9 A;  5C44 H;  2RHQ B;  4LFA L;  5BN3 A;  1PH4 A;  1LT5 D;  1PTO H;  3OOC A;  5NUC A;  4LUZ A;  1GKH A;  4HJ5 A;  3Q24 A;  3ITP A;  1D1I A;  1D6E C;  4K5X A;  1VMP A;  2K5Q A;  4A3I G;  2X69 A;  1LT6 D;  3KF8 A;  2NUC A;  1CKO A;  4DAY B;  1KDA A;  3HZX A;  2JA6 G;  1WCM G;  3S15 B;  5C3W A;  2MGS A;  1VS0 A;  4DV0 L;  5IYC G;  3CRK C;  5HUR A;  4K8I A;  3MA2 B;  1ML0 D;  3H0G G;  3S15 H;  3H3V H;  2EXZ A;  3FPP A;  1W6J A;  3FPU B;  4A3D G;  1N32 L;  1N36 L;  1GM5 A;  4N9T A;  2Q2T A;  1TY0 A;  1G6P A;  1A0I A;  2A69 C;  2R7Z B;  2R92 G;  3TDQ A;  5C0X H;  4HTH A;  2BE5 C;  4KK7 A;  2O4X A;  4QMG A;  1EU4 A;  3CAM A;  3BU2 A;  4A3C H;  1YNN C;  4B3R Q;  2RSN A;  5AFW A;  2R7D A;  3GQB A;  2B2U C;  2BDO A;  2R7Z H;  3K6O A;  2EJM A;  3NXW A;  2OQK A;  3PUW A;  2WV6 D;  3AMU A;  1IW7 C;  4LWC A;  2OXP A;  1PYS B;  1PYB A;  1K3B C;  2F0O A;  3A56 A;  3IFD A;  4KTA A;  5J1Z A;  5GAE C;  1II3 A;  2RDH A;  2PMZ E;  5M5Y H;  2UU9 Q;  1I4X A;  4RGN A;  3CXC A;  2E5L L;  2PQA B;  5IT9 E;  3UDX A;  1CKM A;  1PH6 A;  4R4Q A;  3LWU A;  4KHP Q;  1NCV A;  2F4I A;  3FEW X;  4BY1 H;  2MO1 A;  3T13 A;  4A3E G;  3L3O C;  5J3B A;  5DEH A;  2FXQ A;  2R3Z A;  4K0K Q;  4LUV A;  1K8M A;  4YWM A;  4QF4 A;  2B63 B;  3PIO 3;  1OTC A;  2A6E C;  3BVZ A;  1AP0 A;  4QB4 A;  2NZH A;  1MSH A;  1V1Q A;  1G2T A;  2XVS A;  3GD7 A;  3A7L A;  1HXY D;  4J6H A;  1TII D;  1Z47 A;  2F0U A;  1PVO A;  1FNW A;  1TXY A;  2B63 H;  1YNJ C;  3CU7 A;  2K03 A;  1HR0 W;  4BS9 A;  5EBC A;  3MEF A;  2DGY A;  3CQZ B;  3TZU A;  3HKZ E;  4C3H G;  2F0I A;  4A3B B;  3J81 c;  2C35 B;  3C3L A;  3F2U A;  3FMC A;  1QVF A;  5CBE E;  3S1N H;  3A54 A;  3OPO A;  3PF5 A;  1JWU D;  4QUF A;  2K5V A;  3S17 H;  2H5X A;  1FGU A;  3WDN A;  5A2Q L;  3CME A;  3CQZ H;  1SMX A;  3OIQ A;  1MJC A;  1I50 B;  1TWH B;  2RQX A;  1C48 A;  2K01 A;  3MXG A;  4R4T A;  2RF4 A;  3CCU A;  4DR6 L;  4A3K G;  1WTO A;  4DPG A;  3TS2 A;  1I6H B;  5CC4 A;  1UE6 A;  1M90 C;  2NN6 G;  1I50 H;  1DOK A;  1TWH H;  4X3K A;  4HMJ A;  4YHH Q;  3M4O B;  4DK3 C;  4NXM L;  1I6H H;  1A63 A;  3Q0A A;  2F0S A;  2WB1 E;  2X6G A;  2LXJ A;  3KLS A;  1TWA H;  3MFG A;  2JA9 A;  4K6L A;  1XNR Q;  1D5M C;  1KIX A;  4DV7 Q;  2KEE A;  3U4Z A;  3M4O H;  1EL0 A;  3CCV A;  2EJF C;  5A35 A;  4ULL A;  2YYZ A;  1Q82 C;  4DF7 A;  1QNU A;  4RCN A;  1UE5 A;  4L5R C;  3BDC A;  1VQN A;  1FL0 A;  4H0L C;  1I5F A;  1J6Q A;  2VQE Q;  3S1R H;  3K5O A;  4B3T L;  4OX9 L;  5CV5 A;  3I70 A;  1QE6 A;  1K0R A;  1E2W A;  3K58 A;  1SJH D;  1MGS A;  3FVQ A;  4JI6 L;  3PF4 A;  1CQF A;  1KHI A;  3STB D;  3OW2 A;  1TQO A;  1RDP D;  2I07 B;  5JPM C;  1TWG B;  4IUV A;  5E4X A;  3CHB D;  1EWH A;  2AKW B;  4B3M Q;  1I4R A;  1KD1 C;  1DXM A;  1IBL L;  2L55 A;  1HA5 A;  3QB3 A;  2M00 A;  5IP9 G;  2AUJ D;  1AW7 A;  2MHV A;  2VNU D;  1IXR A;  4OEL B;  1QUQ B;  1ZYR D;  3PO3 B;  3ONA B;  2JA7 B;  1G8Z D;  3LGJ A;  3K5L A;  1WTW A;  3G6E A;  1W2B A;  3NEN A;  3PO3 H;  2F1M A;  2O5J C;  2F0Q A;  3WOE A;  2JA7 H;  2HCI A;  5CYU A;  1RTO A;  3P75 A;  3E6Z X;  1NMF A;  1U4M A;  5FO8 B;  2IHF A;  1SRU A;  1YHB A;  2KEC A;  4LF6 L;  1J9O A;  3PO2 H;  2NVT B;  2L15 A;  4RHS A;  4JI1 L;  1F2Z A;  1YHA A;  4PZ6 A;  2VB2 X;  5D14 A;  2O2L D;  4ODG A;  4FF1 A;  4H13 C;  4FXD A;  5C3E B;  5I9P A;  3SXH A;  3EA6 A;  2HHH Q;  2NVT H;  1B44 D;  4IJL A;  1TR5 A;  1HH2 P;  3DM3 A;  5K36 H;  1N33 Q;  4K5V A;  2NTT A;  3AEV A;  1MBY A;  5C3E H;  2VXW A;  2UUB L;  3T56 B;  4L63 B;  1X3Q A;  1CA5 A;  2HIV A;  4LFB Q;  3KBG A;  4IAL A;  1JCK B;  4LW1 A;  1TWF H;  2A69 D;  1JE5 A;  1M8A A;  1BCP C;  4GOP C;  2BE5 D;  2F4V Q;  2YTX A;  3QO2 A;  4BWG B;  5KEE A;  1YNN D;  2F52 A;  1FNV A;  1RIP A;  2R61 A;  4FO2 A;  2BH2 A;  4GKJ L;  1WTV A;  4YCW A;  1PMR A;  1BKB A;  2SNM A;  3ULL A;  2IY5 B;  5JJI A;  3U50 C;  3FDT A;  4TKO B;  2KCN A;  2Z4H A;  4IJH A;  1KNE A;  3TN2 A;  2EE1 A;  1I94 Q;  3UDG A;  2CH4 W;  1DOM A;  5EJW A;  3K7A B;  5A2Q E;  4AQY L;  3W1B A;  3MXP A;  3MEH A;  3PUZ A;  1LAB A;  3I56 A;  4DV6 Q;  3S24 A;  2C9O A;  3MXN A;  3JAM c;  1BO0 A;  3TME A;  4A3B G;  4NPS A;  3NTH A;  3K7A H;  5CV8 A;  2EIF A;  3VR6 A;  1VF5 C;  5M5W B;  3BVG A;  3UI2 A;  4HIO A;  1GUG A;  4EQN A;  2WKC A;  3FRP B;  1EQR A;  1L0Y B;  1GUN A;  4K2L A;  4KJO A;  3P7J A;  3B6Y A;  1KAB A;  4UP9 A;  1RHP A;  3AU7 A;  1NTG A;  4X3S A;  2EYL A;  5C4Z A;  3K59 A;  4BBR G;  1B4O A;  3HOY B;  2PCF B;  1PH2 A;  2K5N A;  3UE1 A;  1QNK A;  1YNJ D;  2EJG C;  1LTA D;  1D5X C;  4JBW A;  4TSS A;  1QG7 A;  4KD4 A;  2B2U A;  3PCO B;  1EIY B;  3HOU G;  1EY7 A;  3SK4 A;  1OXU A;  1LTL A;  1RL2 A;  3OTO L;  4ZK9 B;  1BCP F;  2RVL A;  4LF4 L;  1SNM A;  5KYL A;  3T1H L;  3R93 A;  1EY6 A;  3ZYY X;  1WFQ A;  3MXU A;  5CMD A;  4P75 A;  1KXL A;  4NP5 A;  4PMW A;  1A2T A;  1VDZ A;  2I5H A;  2KHI A;  4DA2 A;  5GQO A;  1Y1W B;  1JJG A;  3F2D A;  3VYR A;  4Y7N B;  3I90 A;  2E75 C;  3MWY W;  1SE4 A;  2N8N A;  4KKS A;  4UY8 C;  2K5D A;  3GTL B;  4HAE A;  1Y1W H;  1HTL D;  3JAM i;  3RLF A;  4BBS G;  3HOZ H;  2NVQ B;  4Y52 H;  2TSS A;  2E2I H;  1JE4 A;  5IYB H;  1H9S B;  2FMM A;  1AN8 A;  2YV5 A;  2PW7 A;  1FYC A;  1PH3 A;  3N52 A;  1Q3L A;  1QZG A;  2VB3 X;  4NB3 A;  1EZ8 A;  1EZ6 A;  2PYK A;  3JAM L;  1EQQ A;  2CFM A;  1PRT C;  2UXD Q;  1L0W A;  1EY0 A;  3SDZ A;  3RMH A;  1NBW A;  4CKC A;  1V1P A;  1S3O A;  2NZO A;  2YTY A;  3I8Z A;  1LAC A;  1E1T A;  1UAP A;  4B3S Q;  4IFD J;  5JEA G;  4DR2 Q;  4WRD A;  2HQL A;  2Y0S B;  4O0A A;  1H95 A;  4A3I B;  4MZ9 A;  1H9K A;  5IT9 c;  2KA7 A;  3KF8 B;  2D0P A;  2MPM A;  2Q8I B;  1B8A A;  1GXD C;  4DR5 L;  3HKS A;  1B2T A;  1JB3 A;  3TRE A;  1B7Y B;  4A3I H;  3A8J E;  1VMC A;  3VA7 A;  4JV5 L;  2JA6 H;  5KIX A;  1B9M A;  1WCM H;  3H0G B;  4WJW A;  2BCO A;  2MO0 A;  4OON A;  2A74 C;  1FR3 A;  3R2I A;  4IUR A;  4A3D B;  4GNX C;  3KOJ A;  5IWA Q;  2WKD A;  5IYC H;  1VQC A;  4B08 A;  4R8I A;  2R92 B;  3H0G H;  4IN3 A;  1OXT A;  4UPA A;  1MIU A;  4A3D H;  4YCU A;  3NUC A;  3O13 A;  2KED A;  4B9X A;  1SE2 A;  1GHJ A;  1AZP A;  2R92 H;  1L0X B;  2HQE A;  3QWN A;  1BVS A;  2I46 A;  1PRT F;  5LMU L;  2N55 A;  1X3F A;  2K05 A;  4F87 A;  2EY1 A;  1TS3 A;  3ERO A;  4FF4 A;  1TKW B;  1Q90 A;  1HZA A;  1CKN A;  3EJI A;  1GVP A;  1YNX A;  2E74 C;  2VUM G;  3I4L A;  4DR4 Q;  5ISR A;  5BR8 Q;  2DJG C;  4XDX A;  4A3E B;  3H15 A;  1DJR D;  2AWN A;  2RDG A;  2EYO A;  1XMQ L;  3GV6 A;  4B3R L;  3S16 B;  3RLN A;  2K50 A;  4GN4 B;  2KHS A;  1A15 A;  2RA4 A;  3RUZ A;  1F9P A;  1EY4 A;  4CHT B;  2E2H H;  1PXU A;  4C1N K;  1LM0 A;  1FNU A;  2ZJR A;  3G6J B;  3DLL A;  4A3E H;  2UUA Q;  3S16 H;  1BCP D;  1YHQ A;  2QW7 A;  1ZXT A;  5HY6 A;  1E3P A;  5C4J H;  4RFB A;  3G4S A;  3BZK A;  3M7G A;  2CH4 A;  3V05 A;  5DM7 3;  3MZ5 A;  1PTO C;  1Y69 U;  1VQ4 A;  1TS2 A;  1LV9 A;  1T5E A;  4DR3 Q;  4HCE A;  4KMU C;  1SYD A;  3E0E A;  1KNA A;  3K81 C;  2KCT A;  4XXE A;  2JSO A;  2XTI A;  1QVC A;  3HOY G;  4C3H H;  1U0L A;  2QDB A;  1PFM A;  3EBE A;  1EIG A;  4X64 Q;  4MTN A;  4FNF A;  4HMI A;  2JEA I;  3BZC A;  4QL5 A;  3I4N G;  1O7Y A;  4LF9 L;  1A2U A;  1O7I A;  3FHW A;  3TS0 A;  3CCM A;  2L0C A;  3W1G A;  3T1Y Q;  3BYT B;  4M8A A;  5IGB A;  4G7O C;  3S2H B;  2OTJ A;  5IGF A;  3H3V C;  1IZ6 A;  2IX3 A;  4A3K H;  1K8O A;  5C4X B;  5HGT A;  4PMC A;  1YJW A;  4ZKB B;  1Y1W G;  1HNX L;  2NN6 H;  3UDI A;  3E0J A;  1CI3 M;  3S2H H;  5KNC A;  3JAM E;  5CGK A;  1WD0 A;  1O80 A;  1EIF A;  4A3F B;  2G9H D;  2RHS B;  1ZYR C;  2Y0S E;  2RBM A;  1ICF B;  2JE6 I;  4C3J B;  3TZD A;  4JI7 Q;  5DNF A;  3BYY B;  3OW7 A;  1JOQ A;  1Q12 A;  4GKK L;  1D2B A;  2L4N A;  1PTO F;  2VQF Q;  1SBB B;  4N9P A;  3U4V A;  4C3J H;  1S5C D;  2XNA C;  1SDF A;  5ELO A;  5M5X B;  1WVL A;  1F9S A;  2J4X A;  3V2T A;  1ESF A;  1G51 A;  1BBU A;  3PMF A;  3TP6 A;  2MFI A;  3KLR A;  2XIW A;  3J80 i;  4LF7 Q;  4QGU A;  2F0D A;  4X66 Q;  1YJN A;  1YVC A;  1EFI D;  2Y0S G;  2EOT A;  3U9S A;  5AJ3 Q;  3L7Z C;  3Q8D A;  4CDD C;  4JG2 A;  1CM9 A;  1X6O A;  3OYY A;  5IP9 H;  1Q81 C;  1C0A A;  2ASB A;  1B70 B;  5FLX c;  3E5S A;  3J80 L;  3K8A A;  1PRT D;  2DY7 A;  2J7Z A;  3K57 A;  1VQH A;  2F0K A;  4RA8 A;  3EVQ A;  4MNO A;  1FJG Q;  3D6C A;  4XQJ A;  3CKI B;  4B3M L;  2EYF A;  4FXK C;  4JI3 Q;  3VA5 A;  1B50 A;  4TQU S;  1ZKO A;  2QF7 A;  4O1N A;  4WFN 3;  3J81 j;  1B3A A;  2JEB I;  1XMO Q;  2BDN A;  2YU9 B;  4EQO A;  1QZH A;  5JVH 3;  4DUZ L;  4CBV A;  1X56 A;  1GUO A;  2F0L A;  3S9W A;  1A3U A;  3HRZ C;  4UDU C;  1NR4 A;  1HNW L;  2E2D C;  3S1Q B;  4APV A;  4FYD A;  2R93 G;  5FOB B;  2LMC B;  3S1Q H;  5DLQ E;  4PG3 A;  1XPU A;  1VQ8 A;  1CSP A;  1K3R A;  2M9V A;  1G6Z A;  1STY A;  1EIH A;  4KD3 A;  3EN2 A;  5EGT A;  4XTC S;  1SYE A;  1LTR D;  2IT1 A;  1VQ9 A;  1EUJ A;  4DV2 Q;  5CV9 A;  4N8F A;  1ET6 A;  4H7B A;  2F03 A;  5F2D A;  5C3X A;  3MVV A;  2L12 A;  3D8G A;  1SYC A;  1D5Z C;  4MTK A;  4LFB L;  5FLX L;  1XTC D;  2RCN A;  4C56 C;  1GUS A;  2XRQ D;  3HOV B;  1K0S A;  4QJF A;  4AYB B;  1U4P A;  5M3M G;  3NWT A;  2B2T C;  1LYL A;  3MXN B;  2FFK B;  1Q8I A;  2TMP A;  2ZXO A;  3D31 A;  1KAA A;  1HUM A;  2B8F A;  4JBM A;  3LNN A;  4LF5 Q;  3KLW A;  3EQL C;  4E6I A;  4GNX A;  2RDF A;  1XPO A;  4A3B H;  4X65 Q;  1EY8 A;  3PIP 3;  5E1F A;  4I7Z C;  2XN9 C;  1S5F D;  1IL8 A;  4IPD A;  4JI2 Q;  3I7F A;  4BBR B;  4IFD I;  3M9B A;  2ICI A;  3CCE A;  3D3R A;  1X3E A;  4DV6 L;  4WJ4 A;  3HOU B;  4WOR A;  1PTO D;  4BBR H;  4YY3 L;  5C4X G;  2CW0 C;  1UNS A;  3I55 A;  5D65 A;  4JI8 Q;  4O42 A;  4K6D A;  1KRT A;  1JWM D;  3HOU H;  1DM0 B;  2E2J B;  3NBH A;  3X3M A;  4DV3 Q;  1Y8N B;  3CCQ A;  3D0F A;  4QCL A;  5IGD A;  4HCS A;  4A3F G;  3S14 B;  3CPF A;  2AQ2 B;  1HTP A;  2MNA A;  5CV6 A;  2ZJQ A;  5E7N A;  4K14 A;  4DV5 Q;  2E2J H;  4HSV A;  4FP5 D;  4C3J G;  2ICE C;  1VQM A;  3DEP A;  3RNU A;  1HRJ A;  4POF A;  4JI5 L;  1Z7T A;  3S14 H;  3RZO B;  2N78 A;  4LFA Q;  4BBS B;  3GP7 A;  2K33 A;  1L1O B;  4I7A A;  2K5W A;  4RKL A;  1C4Q A;  1VQI A;  1EOV A;  2B2W C;  4ZQ3 A;  3G48 A;  2QDL A;  1IHZ A;  4RMF A;  2IW3 A;  3J80 E;  3RZO H;  4BBS H;  4MN3 A;  3GTJ B;  4H02 A;  4TVA B;  1PA6 A;  3HS0 C;  3KF6 A;  3DWQ A;  4HED A;  2FHT A;  1PH1 A;  4DV1 Q;  2QEX A;  2ALY B;  2Z1C A;  3NSW A;  1TWG H;  4XYO A;  2R7F A;  1J5E Q;  4GN3 B;  3GTJ H;  2ZM6 Q;  4OIK A;  4OO1 I;  3HOX G;  3CP0 A;  1X55 A;  1N8R C;  4KHV A;  4BA1 I;  4LNQ A;  2FIN B;  3J7Z C;  3QOJ A;  5ELB A;  5FJ8 H;  1KQS A;  2AQ3 B;  4DAV A;  1N32 Q;  1N36 Q;  1SE8 A;  3RR5 A;  2I0Q A;  4JYA L;  5JEA H;  1EEF D;  1PFB A;  1LT3 D;  3VR3 A;  2JJQ A;  2ENB A;  2F0T A;  3CRL C;  3K0X A;  3VR2 A;  1NJI C;  1K28 A;  2NTS A;  4DAY A;  1VQD A;  4NXN Q;  5IOD A;  4Q0F A;  4YWK A;  3BZD B;  5EBD A;  1VQK A;  4B3S L;  4B9W A;  1HQR D;  4RAU C;  3DUZ A;  1SN8 A;  1TS5 A;  4ZUI A;  2LFN A;  4F88 A;  2FMC A;  2JA8 B;  4A3G G;  5E4W C;  4F7X A;  3S1M B;  2E5L Q;  5D3D A;  4DK6 C;  4JBJ A;  4DU9 A;  1HNZ Q;  3Q22 A;  4H44 C;  2KBN A;  2GVA A;  3SR1 A;  3C46 A;  2PQE A;  4C3I G;  1SSO A;  2LKV A;  4HJ7 A;  1WOC A;  3FKI B;  5LMN L;  3GO5 A;  3NQI A;  2PPB C;  1MJE A;  2A5H A;  4LFC Q;  2BA1 A;  2WAQ B;  5JVG 3;  5FLX E;  1CZW A;  1HR0 Q;  5IWA L;  1CKN B;  1EY5 A;  2VUM B;  3E3X A;  2CQO A;  4ZRZ A;  1A6X A;  3I4O A;  3I4M G;  2B8G A;  2PQA A;  1U4L A;  3UDF A;  3PGZ A;  2EY6 A;  1WTP A;  2ES2 A;  4OWT B;  3PV0 A;  2VUM H;  3R2T A;  5C0X J;  1IBK L;  3HOV G;  4RGT A;  1XYI A;  1RD9 D;  2XRS D;  4AYB G;  3AQQ A;  1VQB A;  3MTS A;  4RHR A;  3HOW G;  3TP8 A;  2EYJ A;  2N88 A;  4O2D A;  1Y1V G;  1STG A;  4DV4 Q;  5ELE A;  5FO7 B;  3QOL A;  4A93 B;  3W2D A;  3BJU A;  3IFT A;  1IKL A;  3AFP A;  5BR8 L;  3NEM A;  5JAV A;  2PI2 E;  2UUC Q;  2BH8 A;  2F3W A;  2HD3 A;  4JOI C;  2IHE A;  4BY7 G;  4J8Q A;  5M5W H;  4MHE A;  4KY6 A;  4S3S A;  1N34 L;  3NBI A;  3VR5 A;  3I4N B;  3ERS X;  1H9R A;  1EYD A;  4C2M B;  1KC8 C;  3HOY H;  3GV3 A;  1JR0 D;  4YIJ A;  1I3Q B;  1X9N A;  3D4R A;  5FO9 B;  1BR9 A;  3QG1 A;  1QWY A;  4A3J B;  3I4N H;  1ESR A;  2XWB B;  3S2D B;  3ERQ A;  1PH5 A;  1JT8 A;  2ZTC A;  4DR3 L;  4IFD G;  4KHZ A;  1SYG A;  2DN8 A;  2M2L A;  1Q1B A;  1I3Q H;  3A74 A;  2V4D A;  4OX9 Q;  2KUM A;  4QQB X;  4NKL A;  2GA4 B;  2Z6B A;  3ZJY C;  3CD6 A;  2MQH A;  4Y7N H;  3RN5 A;  1N9W A;  3HFZ B;  4KKT A;  1IBL Q;  4JI4 Q;  4A3M B;  1X3P A;  1IL2 A;  2CW0 D;  3E9H A;  3GTO B;  3H6M A;  4ALP A;  3T1Y L;  1KDC A;  4EGV A;  1HPC A;  3LX0 A;  3GTL H;  1SR3 A;  1OXS C;  3KJO A;  1WTR A;  1LLR D;  5ELC A;  3M85 A;  2NVQ H;  3M4Y A;  5EKI A;  3C1F A;  1YBY A;  2QEJ C;  2B2T A;  3I3C A;  2WFW A;  2ZJP A;  5FJ8 G;  1U5K A;  4R1J A;  3EFX D;  3DXJ C;  2PNH A;  2PNR C;  3PUX A;  1H9M A;  3DHQ A;  1I4Q A;  3A8I E;  2QCP X;  5C5M A;  2L5T A;  5I2X A;  3OMC A;  1NSN S;  1VQ5 A;  1RF2 D;  2F3I A;  3GTK B;  1BUV T;  1HZC A;  2WAC A;  2HCC A;  1CTM A;  1GUT A;  4L5S A;  4LF8 Q;  4JI1 Q;  4JVZ A;  5EQ0 A;  3NPP A;  2KQ3 A;  5KND A;  1MKH A;  1QUQ A;  2HDL A;  4JI0 Q;  1S5B D;  2K32 A;  4LAA A;  2Q2U A;  3GTK H;  4L6T B;  4L8J A;  5JOB A;  1EFW A;  1ILP A;  4HJ9 A;  1KL9 A;  1TWC B;  1Q7Y C;  1VQA A;  1T9H A;  3KYH C;  4OO1 G;  1IBM Q;  2WP8 J;  3Q23 A;  2AHO B;  4DR7 Q;  3GTG B;  1SND A;  2UUB Q;  1TWC H;  3KJP A;  1PYW D;  4OHJ A;  2JA8 G;  1LTS D;  2JP1 A;  5ELF A;  3C1E A;  4G7Z C;  1AH9 A;  2LXK A;  2IX1 A;  4CKB A;  1CSQ A;  1JJ2 A;  4IPH A;  1AEX A;  2MUY A;  2A19 A;  2K5H A;  3GTG H;  4HIK A;  3QJY A;  3FP9 A;  3R3O A;  3Q6S A;  4R4I A;  4RH6 A;  1K9M C;  3FKI G;  5M9O A;  4RGO S;  4XT3 B;  1JOO A;  1FJG L;  1VQ6 A;  4P71 A;  1A8V A;  4GKJ Q;  3A0J A;  2R93 B;  4KN7 C;  2WAQ G;  2B2W A;  4KKU A;  1SJE D;  5JEA J;  2ZT9 C;  2JA5 G;  3TQY A;  4CDE C;  2ID0 A;  4R4C A;  1E0B A;  1JMC A;  1BBX C;  3VR4 A;  2R93 H;  3URY A;  1Y14 B;  4Z9C B;  4X6A H;  5BN5 A;  2NZ1 D;  1ENF A;  4RCO A;  1EOT A;  1EQT A;  3NEL A;  3PUV A;  1PH9 A;  3VYT A;  3CC2 A;  5T1I A;  1P8L A;  1PDQ A;  1SRO A;  1XXG A;  3SK6 A;  2Q8T A;  2OQ0 A;  4ZLT F;  1VF7 A;  4OXP A;  5FK9 C;  3CC7 A;  4A75 A;  5T1G A;  3MAQ A;  2HT1 A;  4K8J A;  4R9W A;  2UU9 L;  3DWA A;  1LTG D;  2A8V A;  2WII B;  1GJX A;  5M3M B;  2AWO A;  4A93 G;  1M4V A;  3OWE B;  4J1M A;  1AE2 A;  3WWV A;  2F0H A;  1NAP A;  5KNB A;  4L5T A;  5IP7 G;  3KLS X;  4KHP L;  3TP5 A;  2EY5 A;  1CZG A;  4OGQ C;  5I6W A;  4G4K A;  4UHV A;  3T16 A;  3GTM B;  3DM1 A;  2Z9H A;  5M3M H;  1EWC A;  4K0K L;  1W6K A;  2GN5 A;  3NQT A;  2G5D A;  3H94 A;  5JPN C;  3DEO A;  4GNX B;  3T1H Q;  3HEJ A;  3LWE A;  4QY7 A;  4LUO A;  3J80 c;  4DK0 A;  2MP1 A;  5KGU A;  3QR8 A;  5IIF A;  3GTM H;  1SFO B;  3WOF A;  1PLF A;  2B3G A;  4X62 Q;  1H9J A;  2EDG A;  3CCS A;  4A3J G;  1Y8O B;  5DM6 3;  4X3U A;  4DFA A;  1SFO H;  4CGY B;  3F2B A;  1R9T B;  2NVX B;  1CHP D;  3PIO A;  4DAM A;  3M4P A;  4IOC A;  2D62 A;  4GOP A;  4GZY C;  1PZK D;  1E7Z A;  2VY3 A;  1U4R A;  2LSS A;  4PNY A;  2IJ0 A;  3NBH B;  5IGC A;  1VQJ A;  1R9T H;  1F77 A;  2UXB Q;  5C4X H;  1FD7 D;  1GOZ A;  3A8K E;  2CQA A;  5J39 A;  4FDB A;  1U9R A;  1G2S A;  4A3M G;  4XQN A;  3GTQ B;  2P5Z X;  1K8A C;  2F0E A;  1EWI A;  4JC0 A;  5G3L F;  3L2P A;  4PMB A;  1LT4 D;  4A3F H;  1F2M A;  4KN4 C;  5JJK A;  4YHH L;  4DUY Q;  1V9P A;  4OIJ A;  3MHB A;  2J0T D;  1CFM A;  2OCE A;  4R8N A;  4DAP A;  2NB0 A;  1HUN A;  2EZV A;  3F2C A;  3PIP A;  1XNR L;  4FF3 A;  4HR7 B;  4I65 A;  4DV7 L;  4EVO A;  5LHY 1;  1H9S A;  3SK5 A;  1YIT A;  3A5Z B;  2I5L X;  1VQG A;  2KVM A;  4DR5 Q;  5C44 B;  3A55 A;  3G7L A;  2IPK D;  4IUT A;  1BQQ T;  5EPK A;  1PTO B;  5C4H A;  2Z0S A;  3KBX A;  5M5X H;  1F9Q A;  2VQE L;  1LO5 D;  3CC4 A;  1NY4 A;  1K73 C;  3IAY A;  2K4K A;  3H3V I;  4DR1 Q;  1FGB D;  3SVM A;  3CCR A;  2A73 B;  2DNC A;  3HOX B;  4JOI A;  4JV5 Q;  1G91 A;  5HGQ A;  1LUZ A;  3KDF A;  2NWG A;  1GD7 A;  4HJ8 A;  3TEH B;  4A4I A;  3HGB A;  1WTX A;  1JOR A;  5C0X I;  2VW9 A;  4GS3 A;  2K14 A;  3HOX H;  1KLU D;  3BDL A;  1SAP A;  4CJ2 C;  1SNC A;  1QB5 D;  1MSG A;  1OXV A;  1ZEQ X;  4DV1 L;  1CA6 A;  3OHX C;  4AH6 A;  1UWV A;  2H4O A;  2JYO A;  5EAY A;  1J5E L;  5IE8 A;  5D3I B;  5I4D A;  5LMU Q;  2XWJ B;  2ZM6 L;  2JQO A;  4TRD A;  2A68 C;  2F0N A;  4JW0 A;  4C1N I;  4FXG C;  4RKB A;  3QIA A;  2B2Y C;  3AFQ A;  1XNQ Q;  3J7A F;  2X6L A;  3T4A C;  4A3G B;  1D1K A;  2YU9 H;  1F2L A;  4FVM A;  2RKS A;  3SEB A;  1AE3 A;  1JOK A;  1PFN A;  1C8C A;  1E1O A;  1YI2 A;  5DAU A;  1SNO A;  3PSI A;  4C3I B;  2EVB A;  5CR3 A;  3R8B A;  4A3G H;  1NUC A;  4NW2 A;  1XMQ Q;  4NXN L;  4MIU A;  1DON A;  1XWE A;  2PZU A;  3ULP A;  5ELN A;  3K5M A;  2SDF A;  2Z6K C;  4KY7 A;  3VYU A;  5M5Y B;  4RWS C;  4C3I H;  5TSS A;  2WIN B;  3CMA A;  2HHH L;  2DUD A;  1G29 1;  3C2P A;  3OMG A;  4GN5 A;  3I4M B;  1N33 L;  4BY1 B;  4XIG S;  2JXM B;  1HNZ L;  1A3T A;  2K28 A;  5IGE A;  4KI0 A;  3BDO A;  1O7L A;  4P73 A;  2K1B A;  3W5O A;  1R4Q B;  2K7V A;  4NMZ A;  1J8I A;  3I4M H;  2VS1 A;  2A1A A;  2D0O A;  3A5U A;  3HOW B;  4LFC L;  3NTI A;  2F4V L;  1L1O C;  1JWS D;  1Y1V B;  1XJV A;  4IQZ A;  3HOV H;  4J15 A;  2BOS A;  1HR0 L;  2NBF A;  4IUU A;  4L5Q A;  2UXC Q;  5K5P A;  2F0P A;  1JB7 A;  4LF9 Q;  2Z8L A;  4XQQ A;  3HOW H;  2C5C A;  1TY2 A;  3S1N B;  1F2Y A;  1Y1V H;  3HP3 A;  3S17 B;  1I94 L;  2CWA A;  3P20 A;  5FLM G;  2EQS A;  1TT2 A;  1QOH A;  2F3V A;  4P72 A;  4BY7 B;  2DJF C;  4DK1 A;  5G3L D;  1SMY C;  1HNX Q;  1STN A;  4R4O A;  3KFU A; 
#chains in the Genus database with same CATH homology
 1RKN A;  1IYV A;  1GUW A;  4LJZ C;  2E76 C;  4ME5 A;  3T51 B;  2H1E A;  3OSO A;  4V0B A;  1TWA B;  1MD2 D;  1T5X D;  4NDX A;  2EYP A;  1ROD A;  1PZJ D;  3NE5 B;  5CBA E;  4IFD H;  1QJO A;  1B53 A;  2R6G A;  3S1R B;  4EQP A;  4IZ8 A;  5C6A A;  5KYI A;  3HG9 A;  2DY8 A;  2B39 A;  3ND8 A;  2AUK A;  1EU3 A;  5J22 A;  3IL8 A;  5EKL A;  1B9N A;  2B2V C;  2FJ2 A;  1V1P B;  1UEA B;  2KCC A;  1ENC A;  4IUP A;  2A6H C;  3K0Y A;  2L11 A;  1CT1 D;  3J81 L;  4XT1 B;  2D5D A;  1EQV A;  1SNQ A;  1JIC A;  4UAI A;  1BF4 A;  1PZI D;  1X32 A;  4KY5 A;  5BN4 A;  3PO2 B;  2SNS A;  1BNZ A;  3IKJ A;  1K83 B;  1NR2 A;  3TP7 A;  2SOB A;  3RZD B;  5FKA C;  5C0X G;  4OO1 H;  3SE0 A;  3BS1 A;  1CQV A;  4DNR B;  3N6R A;  3U9O A;  4V19 0;  1EY9 A;  1RJT A;  2F0J A;  1AFP A;  2HUG A;  2MJ8 A;  1Q1E A;  1I4G A;  1LTT D;  4QIW B;  5ELD A;  2G9D A;  3D4D A;  2OT2 A;  1EEI D;  4P2C B;  2KJX A;  1TWF B;  2A68 D;  1O7Z A;  2JA5 B;  5EPJ A;  4OL7 A;  1DOL A;  3NK9 A;  5KRU A;  4ZKC B;  2XSC A;  1JC7 A;  3RD4 A;  1VCI A;  1RTN A;  1ONL A;  1UUP A;  1SYF A;  3J7Y W;  1LTB D;  2NYZ D;  3TSS A;  5IGG A;  3DWP A;  1HA6 A;  3X3N A;  4DXF A;  1ET9 A;  4KV6 A;  4RGM A;  2LY7 A;  4ILW A;  4ZAI A;  3P1H A;  1BXT A;  1IW7 D;  2OEO A;  1S4Z A;  1HHV A;  4KJN A;  3D6W A;  4Q5V A;  1GHK A;  1SNP A;  2L9H A;  2IL8 A;  2D9U A;  2PO4 A;  1BOS A;  1STE A;  4DXG A;  2B2Y A;  2BA0 A;  3K5N A;  3TBI B;  1ENA A;  3KK7 A;  2ZXP A;  3I91 A;  2A6E D;  1DYQ A;  1A3V A;  1ICW A;  4ABN A;  1B1Z A;  3A7A B;  3NWS A;  5C5L A;  2PW5 A;  1BCP B;  3PUY A;  4U68 A;  3W3A A;  1SMY D;  2IX0 A;  1SE3 A;  4U67 3;  3V96 A;  1HFG A;  3T53 B;  2Q8R E;  2F0W A;  2ZXR A;  1V1O A;  1V8Q A;  2EYM A;  4G7H C;  3HOZ B;  2E2I B;  3NHH A;  1SYB A;  3J81 E;  1DCZ A;  3H91 A;  3J7A V;  4DGZ A;  1JQY D;  4IUN A;  2EPB A;  4HN7 A;  5LL6 S;  3L9A X;  3BVM A;  3H09 A;  1DD2 A;  4ZUJ A;  2EY2 A;  5LL6 X;  1OXX K;  3KUP A;  1Z6H A;  2PZT A;  1ILQ A;  2DNE A;  1DZ1 A;  4HSP A;  1KDB A;  2EYH A;  4LK1 C;  1CHQ D;  3ND9 A;  3GTP B;  3BG3 A;  5IOC A;  4DNT B;  4IUQ A;  1WD1 A;  5I6Y A;  1V43 A;  2IWH A;  4K5W A;  4ID6 A;  3SK8 A;  1KLG D;  4PV1 C;  2PZW A;  2JA6 B;  2A6H D;  1WCM B;  2K6A A;  2QIL A;  3MC0 B;  3NP8 A;  2OF1 A;  5EPL A;  5K36 G;  4PQX A;  3DMU A;  2AQ1 B;  1SEB D;  1OO9 B;  1EYC A;  1TU2 B;  1Y8P B;  1E2Z A;  1BDO A;  1STH A;  1PRT B;  1TS4 A;  3NTK A;  2B2V A;  3I73 A;  2CVR A;  5I9O A;  2D2C C;  2NVY B;  2E2H B;  2CHB D;  3MFY A;  3OWF A;  4G57 A;  5EKK A;  5CV4 A;  1O78 A;  1HFN A;  2HDM A;  4M1U B;  1RCV D;  1QIL A;  5C4J B;  2K04 A;  4QUC A;  3SHL A;  5IT9 L;  4JK1 C;  2F0F A;  2F0V A;  3AB9 A;  1KTK A;  2PMZ B;  1AZQ A;  1S5D D;  3OIP A;  1MI2 A;  1SXT A;  1S5E D;  2QKI C;  4C3H B;  2NN6 I;  3VYS A;  1XX8 A;  1STB A;  1I4H A;  1WTQ A;  1I4P A;  4FF2 A;  4X3T A;  1F9R A;  2KOL A;  4F8M A;  3I72 A;  2F0M A;  4XYQ A;  4CJ0 B;  4A3K B;  1R4P B;  2LS0 1;  4CJ1 B;  3D4W A;  2SEB D;  4BA2 I;  1STA A;  2L1B A;  1EYA A;  2RSO A;  3M3Y B;  3HKZ B;  3M7N A;  1HQM C;  5M3F B;  4CKE A;  2O5I C;  1QCB D;  4DN4 M;  5E3F A;  5CV7 A;  1I6V C;  1TVX A;  1IYU A;  5I2Y A;  1LTI D;  1CK1 A;  5JJZ A;  4K2K A;  4LMQ D;  5COY A;  1IKM A;  4ZYS A;  1E2V A;  2F0G A;  1HCZ A;  2Z4I A;  2WB1 B;  5COR A;  5BN3 A;  1LT5 D;  1PTO H;  3OOC A;  5NUC A;  3Q24 A;  3ITP A;  1D1I A;  1D6E C;  4K5X A;  1VMP A;  2K5Q A;  2X69 A;  1LT6 D;  3KF8 A;  2NUC A;  1KDA A;  3HZX A;  3S15 B;  5C3W A;  2MGS A;  3CRK C;  5HUR A;  4K8I A;  3MA2 B;  1ML0 D;  2EXZ A;  3FPP A;  1W6J A;  3FPU B;  4N9T A;  1TY0 A;  2A69 C;  2R7Z B;  3TDQ A;  5C0X H;  4HTH A;  2BE5 C;  4KK7 A;  2O4X A;  4QMG A;  1EU4 A;  1YNN C;  2RSN A;  5AFW A;  3GQB A;  2B2U C;  2BDO A;  3K6O A;  2EJM A;  3NXW A;  3PUW A;  2WV6 D;  3AMU A;  1IW7 C;  2OXP A;  2F0O A;  3A56 A;  3IFD A;  4KTA A;  5J1Z A;  1II3 A;  2RDH A;  1I4X A;  4RGN A;  5IT9 E;  3LWU A;  1NCV A;  2F4I A;  3FEW X;  3T13 A;  3L3O C;  5DEH A;  2R3Z A;  1K8M A;  4QF4 A;  2B63 B;  3PIO 3;  2A6E C;  3BVZ A;  1AP0 A;  4QB4 A;  1MSH A;  1G2T A;  2XVS A;  3GD7 A;  3A7L A;  1HXY D;  4J6H A;  1TII D;  1Z47 A;  2F0U A;  1FNW A;  1YNJ C;  3CU7 A;  2K03 A;  4BS9 A;  5EBC A;  3CQZ B;  3TZU A;  4C3H G;  2F0I A;  4A3B B;  3C3L A;  3F2U A;  3FMC A;  5CBE E;  3A54 A;  3OPO A;  1JWU D;  4QUF A;  3WDN A;  5A2Q L;  3OIQ A;  1I50 B;  1TWH B;  2RQX A;  1C48 A;  2K01 A;  3MXG A;  1WTO A;  1I6H B;  5CC4 A;  2NN6 G;  1DOK A;  4X3K A;  4HMJ A;  3M4O B;  3Q0A A;  2F0S A;  2X6G A;  3KLS A;  3MFG A;  4K6L A;  1D5M C;  2KEE A;  1EL0 A;  2EJF C;  5A35 A;  4ULL A;  2YYZ A;  4DF7 A;  1QNU A;  4RCN A;  3BDC A;  4H0L C;  3K5O A;  5CV5 A;  3I70 A;  1QE6 A;  1E2W A;  3K58 A;  1SJH D;  1MGS A;  3FVQ A;  1CQF A;  1TQO A;  1RDP D;  2I07 B;  5JPM C;  1TWG B;  4IUV A;  5E4X A;  3CHB D;  1EWH A;  1I4R A;  1DXM A;  2L55 A;  1HA5 A;  3QB3 A;  2M00 A;  2AUJ D;  1AW7 A;  2MHV A;  2VNU D;  1ZYR D;  3PO3 B;  3ONA B;  2JA7 B;  1G8Z D;  3K5L A;  1WTW A;  2F1M A;  2O5J C;  2F0Q A;  3WOE A;  2HCI A;  5CYU A;  1RTO A;  3P75 A;  3E6Z X;  1U4M A;  5FO8 B;  2KEC A;  2NVT B;  1J9O A;  4RHS A;  1F2Z A;  2VB2 X;  5D14 A;  2O2L D;  4ODG A;  4FF1 A;  4H13 C;  4FXD A;  5C3E B;  5I9P A;  3SXH A;  3EA6 A;  1B44 D;  1TR5 A;  5K36 H;  4K5V A;  2NTT A;  1MBY A;  2VXW A;  3T56 B;  4L63 B;  1X3Q A;  1CA5 A;  3KBG A;  4IAL A;  1JCK B;  2A69 D;  1M8A A;  1BCP C;  2BE5 D;  3QO2 A;  4BWG B;  5KEE A;  1YNN D;  1FNV A;  2R61 A;  4FO2 A;  1WTV A;  1PMR A;  2SNM A;  3FDT A;  4TKO B;  2KCN A;  2Z4H A;  1KNE A;  3TN2 A;  2EE1 A;  1DOM A;  5EJW A;  3K7A B;  5A2Q E;  3MXP A;  3MEH A;  3PUZ A;  1LAB A;  2C9O A;  3MXN A;  1BO0 A;  3TME A;  3NTH A;  5CV8 A;  3VR6 A;  1VF5 C;  5M5W B;  3BVG A;  3UI2 A;  1GUG A;  4EQN A;  2WKC A;  3FRP B;  1L0Y B;  1GUN A;  4K2L A;  4KJO A;  3P7J A;  1KAB A;  5C4Z A;  1RHP A;  3AU7 A;  4X3S A;  3K59 A;  2EYL A;  1B4O A;  3HOY B;  2PCF B;  1QNK A;  1YNJ D;  2EJG C;  1LTA D;  1D5X C;  4JBW A;  4TSS A;  1QG7 A;  4KD4 A;  2B2U A;  1EY7 A;  3SK4 A;  1OXU A;  4ZK9 B;  1BCP F;  2RVL A;  1SNM A;  5KYL A;  3R93 A;  1EY6 A;  3ZYY X;  3MXU A;  5CMD A;  4NP5 A;  4PMW A;  1A2T A;  1VDZ A;  4DA2 A;  1Y1W B;  3VYR A;  4Y7N B;  3I90 A;  2E75 C;  3MWY W;  1SE4 A;  4KKS A;  2K5D A;  3GTL B;  4HAE A;  1HTL D;  3RLF A;  2NVQ B;  2TSS A;  1JE4 A;  1H9S B;  2FMM A;  1AN8 A;  2PW7 A;  1FYC A;  3N52 A;  1Q3L A;  2VB3 X;  1EZ8 A;  1EZ6 A;  2PYK A;  3JAM L;  1PRT C;  1EY0 A;  3SDZ A;  3RMH A;  4CKC A;  1V1P A;  3I8Z A;  1LAC A;  1UAP A;  4IFD J;  5JEA G;  4WRD A;  2Y0S B;  4A3I B;  1H9K A;  2KA7 A;  2MPM A;  2Q8I B;  1GXD C;  1B2T A;  1JB3 A;  3A8J E;  1VMC A;  3VA7 A;  5KIX A;  1B9M A;  3H0G B;  4WJW A;  2BCO A;  2A74 C;  1FR3 A;  3R2I A;  4IUR A;  4A3D B;  2WKD A;  4B08 A;  4R8I A;  2R92 B;  4IN3 A;  1OXT A;  3NUC A;  3O13 A;  2KED A;  4B9X A;  1SE2 A;  1GHJ A;  1AZP A;  1L0X B;  2HQE A;  3QWN A;  2I46 A;  1PRT F;  2N55 A;  2K05 A;  4F87 A;  2EY1 A;  1TS3 A;  3ERO A;  4FF4 A;  1TKW B;  1Q90 A;  3EJI A;  2E74 C;  3I4L A;  5ISR A;  4XDX A;  4A3E B;  1DJR D;  2AWN A;  2RDG A;  2EYO A;  3GV6 A;  3S16 B;  2KHS A;  1A15 A;  2RA4 A;  3RUZ A;  1F9P A;  1EY4 A;  4CHT B;  1PXU A;  4C1N K;  1FNU A;  3G6J B;  1BCP D;  1ZXT A;  4RFB A;  3M7G A;  3V05 A;  5DM7 3;  3MZ5 A;  1PTO C;  1Y69 U;  1TS2 A;  1LV9 A;  1T5E A;  4HCE A;  4KMU C;  1SYD A;  1KNA A;  4XXE A;  2JSO A;  2QDB A;  1PFM A;  1EIG A;  4FNF A;  4HMI A;  2JEA I;  1O7Y A;  1A2U A;  2L0C A;  3BYT B;  4M8A A;  5IGB A;  4G7O C;  3S2H B;  5IGF A;  3H3V C;  2IX3 A;  1K8O A;  5C4X B;  5HGT A;  4PMC A;  4ZKB B;  2NN6 H;  3E0J A;  1CI3 M;  5KNC A;  3JAM E;  5CGK A;  1WD0 A;  1O80 A;  4A3F B;  2G9H D;  1ZYR C;  2RBM A;  2JE6 I;  4C3J B;  3TZD A;  5DNF A;  3BYY B;  3OW7 A;  1JOQ A;  1Q12 A;  1D2B A;  2L4N A;  1PTO F;  1SBB B;  4N9P A;  1S5C D;  2XNA C;  1SDF A;  5M5X B;  1WVL A;  1F9S A;  2J4X A;  3V2T A;  1ESF A;  3PMF A;  3TP6 A;  3KLR A;  2XIW A;  2F0D A;  1EFI D;  2EOT A;  3U9S A;  3L7Z C;  1CM9 A;  3E5S A;  3J80 L;  1PRT D;  2DY7 A;  2J7Z A;  3K57 A;  4RA8 A;  2F0K A;  3EVQ A;  3D6C A;  4XQJ A;  3CKI B;  2EYF A;  4FXK C;  3VA5 A;  1B50 A;  4TQU S;  4O1N A;  1ZKO A;  2QF7 A;  4WFN 3;  1B3A A;  2JEB I;  2BDN A;  2YU9 B;  4EQO A;  5JVH 3;  4CBV A;  1GUO A;  2F0L A;  3S9W A;  1A3U A;  3HRZ C;  4UDU C;  1NR4 A;  2E2D C;  3S1Q B;  4FYD A;  5FOB B;  2LMC B;  2M9V A;  1G6Z A;  1STY A;  1EIH A;  4KD3 A;  5EGT A;  4XTC S;  1SYE A;  1LTR D;  2IT1 A;  5CV9 A;  1ET6 A;  4H7B A;  2F03 A;  5F2D A;  5C3X A;  3MVV A;  2L12 A;  3D8G A;  1SYC A;  1D5Z C;  5FLX L;  1XTC D;  3HOV B;  4C56 C;  1GUS A;  2XRQ D;  4AYB B;  1U4P A;  3NWT A;  2B2T C;  2FFK B;  1Q8I A;  2TMP A;  2ZXO A;  3D31 A;  1KAA A;  1HUM A;  2B8F A;  3LNN A;  3EQL C;  4E6I A;  2RDF A;  1EY8 A;  3PIP 3;  5E1F A;  4I7Z C;  2XN9 C;  1S5F D;  1IL8 A;  4BBR B;  4IFD I;  2ICI A;  3D3R A;  3HOU B;  4WOR A;  1PTO D;  2CW0 C;  1UNS A;  5D65 A;  4O42 A;  4K6D A;  1JWM D;  1DM0 B;  2E2J B;  3NBH A;  3X3M A;  1Y8N B;  4QCL A;  5IGD A;  4HCS A;  3S14 B;  2AQ2 B;  1HTP A;  5CV6 A;  4K14 A;  4HSV A;  4FP5 D;  4C3J G;  2ICE C;  3DEP A;  1HRJ A;  1Z7T A;  3RZO B;  4BBS B;  3GP7 A;  2K33 A;  2K5W A;  4RKL A;  1C4Q A;  2B2W C;  4ZQ3 A;  1IHZ A;  2IW3 A;  3J80 E;  4MN3 A;  3GTJ B;  3HS0 C;  3DWQ A;  4HED A;  2FHT A;  2Z1C A;  3NSW A;  4XYO A;  4OIK A;  4OO1 I;  4KHV A;  4BA1 I;  2FIN B;  3QOJ A;  5ELB A;  2AQ3 B;  4DAV A;  5JEA H;  1EEF D;  1PFB A;  1LT3 D;  3VR3 A;  2ENB A;  2F0T A;  3CRL C;  3VR2 A;  2NTS A;  4DAY A;  5IOD A;  4Q0F A;  3BZD B;  5EBD A;  4B9W A;  1HQR D;  4RAU C;  3DUZ A;  1TS5 A;  4ZUI A;  2LFN A;  4F88 A;  2FMC A;  2JA8 B;  5E4W C;  4F7X A;  3S1M B;  5D3D A;  4DU9 A;  3Q22 A;  4H44 C;  3C46 A;  3SR1 A;  2PQE A;  4C3I G;  1SSO A;  2LKV A;  3FKI B;  3GO5 A;  3NQI A;  2PPB C;  2A5H A;  2BA1 A;  2WAQ B;  5JVG 3;  5FLX E;  1CZW A;  1EY5 A;  2VUM B;  4ZRZ A;  1A6X A;  2B8G A;  1U4L A;  2EY6 A;  1WTP A;  3PV0 A;  3R2T A;  5C0X J;  4RGT A;  1XYI A;  1RD9 D;  2XRS D;  3MTS A;  4RHR A;  3TP8 A;  2EYJ A;  2N88 A;  1STG A;  5ELE A;  5FO7 B;  3QOL A;  4A93 B;  3W2D A;  3IFT A;  1IKL A;  5JAV A;  2F3W A;  4J8Q A;  4MHE A;  4KY6 A;  4S3S A;  3NBI A;  3VR5 A;  3I4N B;  1H9R A;  1EYD A;  4C2M B;  3GV3 A;  1JR0 D;  4YIJ A;  1I3Q B;  3D4R A;  5FO9 B;  1BR9 A;  3QG1 A;  1QWY A;  4A3J B;  1ESR A;  2XWB B;  3S2D B;  3ERQ A;  4IFD G;  4KHZ A;  1SYG A;  2DN8 A;  2M2L A;  1Q1B A;  2V4D A;  2KUM A;  4NKL A;  2GA4 B;  4KKT A;  4A3M B;  1X3P A;  2CW0 D;  3GTO B;  3H6M A;  1KDC A;  4EGV A;  1HPC A;  3LX0 A;  1OXS C;  1WTR A;  1LLR D;  5ELC A;  3M85 A;  3M4Y A;  5EKI A;  3C1F A;  2QEJ C;  2B2T A;  3I3C A;  3EFX D;  3DXJ C;  2PNR C;  3PUX A;  1H9M A;  3DHQ A;  1I4Q A;  3A8I E;  2QCP X;  5C5M A;  2L5T A;  5I2X A;  3OMC A;  1NSN S;  1RF2 D;  3GTK B;  1BUV T;  2WAC A;  2HCC A;  1CTM A;  1GUT A;  5EQ0 A;  3NPP A;  2KQ3 A;  5KND A;  2HDL A;  1S5B D;  2K32 A;  4LAA A;  4L6T B;  4L8J A;  5JOB A;  1ILP A;  1TWC B;  4OO1 G;  2WP8 J;  3Q23 A;  3GTG B;  1SND A;  1PYW D;  4OHJ A;  1LTS D;  2JP1 A;  5ELF A;  3C1E A;  4G7Z C;  2IX1 A;  4CKB A;  1AEX A;  2MUY A;  3QJY A;  3R3O A;  3Q6S A;  4RH6 A;  5M9O A;  4RGO S;  4XT3 B;  1JOO A;  2R93 B;  4KN7 C;  2B2W A;  4KKU A;  1SJE D;  5JEA J;  2ZT9 C;  2ID0 A;  1E0B A;  1BBX C;  3VR4 A;  3URY A;  4Z9C B;  5BN5 A;  2NZ1 D;  1ENF A;  4RCO A;  1EOT A;  1EQT A;  3PUV A;  3VYT A;  5T1I A;  1PDQ A;  1XXG A;  3SK6 A;  2Q8T A;  4ZLT F;  1VF7 A;  5FK9 C;  5T1G A;  3MAQ A;  4K8J A;  4R9W A;  3DWA A;  1LTG D;  2WII B;  1GJX A;  5M3M B;  2AWO A;  1M4V A;  3OWE B;  4J1M A;  2F0H A;  1NAP A;  5KNB A;  3KLS X;  3TP5 A;  2EY5 A;  1CZG A;  4OGQ C;  5I6W A;  4G4K A;  3T16 A;  3GTM B;  3DM1 A;  1EWC A;  1W6K A;  3NQT A;  3H94 A;  5JPN C;  3DEO A;  3HEJ A;  3LWE A;  4DK0 A;  2MP1 A;  5KGU A;  5IIF A;  1SFO B;  3WOF A;  1PLF A;  1H9J A;  2EDG A;  1Y8O B;  5DM6 3;  4X3U A;  4DFA A;  4CGY B;  1R9T B;  2NVX B;  1CHP D;  2D62 A;  4GZY C;  1PZK D;  1U4R A;  4PNY A;  2IJ0 A;  5IGC A;  1F77 A;  1FD7 D;  1GOZ A;  3A8K E;  2CQA A;  5J39 A;  1U9R A;  1G2S A;  4XQN A;  3GTQ B;  2F0E A;  5G3L F;  4PMB A;  1LT4 D;  1F2M A;  4KN4 C;  4OIJ A;  3MHB A;  2J0T D;  1CFM A;  4R8N A;  4DAP A;  2NB0 A;  1HUN A;  2EZV A;  4FF3 A;  4HR7 B;  4I65 A;  4EVO A;  5LHY 1;  1H9S A;  3SK5 A;  2KVM A;  5C44 B;  3A55 A;  3G7L A;  2IPK D;  4IUT A;  1BQQ T;  5EPK A;  1PTO B;  5C4H A;  3KBX A;  1F9Q A;  1LO5 D;  3IAY A;  1FGB D;  3SVM A;  2A73 B;  2DNC A;  3HOX B;  1G91 A;  2NWG A;  3HGB A;  1WTX A;  1JOR A;  5C0X I;  1KLU D;  3BDL A;  1SAP A;  4CJ2 C;  1SNC A;  1QB5 D;  1MSG A;  1OXV A;  1ZEQ X;  1CA6 A;  3OHX C;  2H4O A;  2JYO A;  5D3I B;  5I4D A;  2XWJ B;  4TRD A;  2A68 C;  2F0N A;  4C1N I;  4FXG C;  4RKB A;  3QIA A;  2B2Y C;  3J7A F;  2X6L A;  3T4A C;  4A3G B;  1D1K A;  1F2L A;  4FVM A;  2RKS A;  3SEB A;  1JOK A;  1PFN A;  1C8C A;  5DAU A;  1SNO A;  4C3I B;  2EVB A;  5CR3 A;  3R8B A;  1NUC A;  4NW2 A;  4MIU A;  1DON A;  1XWE A;  2PZU A;  3K5M A;  2SDF A;  4KY7 A;  3VYU A;  5M5Y B;  4RWS C;  5TSS A;  2WIN B;  1G29 1;  3C2P A;  3OMG A;  3I4M B;  4BY1 B;  4XIG S;  2JXM B;  1A3T A;  2K28 A;  5IGE A;  4KI0 A;  3BDO A;  1O7L A;  2K1B A;  1R4Q B;  2K7V A;  4NMZ A;  1J8I A;  3HOW B;  3NTI A;  1JWS D;  1Y1V B;  4IQZ A;  2BOS A;  2NBF A;  4IUU A;  5K5P A;  2F0P A;  2Z8L A;  4XQQ A;  2C5C A;  1TY2 A;  3S1N B;  1F2Y A;  3HP3 A;  3S17 B;  3P20 A;  1TT2 A;  1QOH A;  2F3V A;  4BY7 B;  4DK1 A;  5G3L D;  1SMY C;  1STN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...