1PLFA

The three-dimensional structure of bovine platelet factor 4 at 3.0 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
63
Chain Sequence
b'LQCVCLKTTSGINPRHISSLEVIGAGLHCPSPQLIATLKTGRKICLDQQNPLYKKIIKRLLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title The three-dimensional structure of bovine platelet factor 4 at 3.0-A resolution.
pubmed rcsb
source organism Bos taurus
molecule tags Platelet factor
total genus 8
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1plfA00
5T1IA 1S4ZA 2B2UC 2CVRA 4HEDA 4RWSC 2KOLA 2B2VA 1WTWA 1A15A 1EQTA 1PLFA 4XDXA 1U4RA 2HCCA 3GV3A 4MN3A 1XYIA 2FINB 2RSOA 4DN4M 1PFBA 2EPBA 3HP3A 1F9SA 2L1BA 4LMQD 1DONA 1DZ1A 5E4XA 1EIGA 1MSHA 5JJZA 2MJ8A 3D6WA 1B50A 2KUMA 4OIJA 1CA6A 4IURA 2L11A 4IUTA 3G7LA 1PDQA 1ESRA 1DOMA 2HDLA 3MWYW 1IL8A 1F2LA 1CM9A 4IUPA 2SDFA 4U68A 1WTQA 1F9QA 2L12A 1HFNA 5EQ0A 2NZ1D 3I90A 1ZXTA 4QUCA 4ZLTF 2K28A 2EOTA 2MP1A 1G91A 1SAPA 2L9HA 4ZK9B 1RJTA 3DM1A 1HA6A 4UAIA 1WTOA 2KVMA 1SSOA 2HUGA 1NR4A 2Q8TA 1AP0A 1XX8A 2B2TC 2JP1A 4HCSA 1RHPA 2B2UA 1KNEA 2K1BA 1B4OA 3TN2A 1WTRA 2K01A 4X3KA 4R9WA 1RTNA 2KEDA 1WTXA 1TVXA 1WD0A 2RA4A 2NWGA 4CJ1B 5E4WC 4QUFA 1C8CA 4XT3B 5CORA 4ZAIA 3I8ZA 2XIWA 5CBAE 1G2SA 1QG7A 2NYZD 1BNZA 1J8IA 1QE6A 1B3AA 1X3QA 1HFGA 1U4PA 5EJWA 1G6ZA 2FHTA 2VXWA 3UI2A 2KEEA 3R93A 1NAPA 2DY8A 2MGSA 1O80A 2B2YC 2N55A 3KBXA 5EPLA 2X6GA 1EIHA 1O7YA 2FFKB 1ICWA 1GUWA 1BBXC 1U4LA 4IUVA 2M2LA 1BF4A 2RSNA 4R8IA 3I3CA 1M8AA 1X32A 1JICA 4ZKCB 3IFDA 4X3UA 1U4MA 3IL8A 5CBEE 4NW2A 2RVLA 4RA8A 2K03A 3FPUB 2Q8RE 1HUMA 2B2WC 1ML0D 3MTSA 5EPJA 3QO2A 5EPKA 1HHVA 2HCIA 1KNAA 4IUUA 3KUPA 1CA5A 1J9OA 4HAEA 2J7ZA 4ZKBB 3F2UA 2KECA 3P7JA 4X3SA 1VMCA 1DOLA 3H91A 5EKIA 5DNFA 5CMDA 1RTOA 2B2VC 2EE1A 3GV6A 4X3TA 4XT1B 1ILQA 1AZQA 4IUQA 1NCVA 2R3ZA 4HSVA 4RAUC 3I91A 1G2TA 1HRJA 1WVLA 2JYOA 1QNKA 1BO0A 1EOTA 2H1EA 1SDFA 3TZDA 2BDNA 3N52A 1WTVA 2X6LA 2X69A 4MHEA 1PFNA 2N88A 1EL0A 1F9RA 2DY7A 5D14A 1AZPA 5T1GA 2B2YA 1O7ZA 2HDMA 3Q6SA 4OIKA 3DEOA 1IKLA 2D9UA 2FJ2A 3DEPA 5COYA 1WTPA 1E0BA 5D65A 3SVMA 1MI2A 1MGSA 2K05A 1VMPA 1ILPA 3LWEA 4CJ2C 1B53A 1WD1A 1X3PA 4O42A 2MPMA 4CJ0B 2B2TA 1B2TA 2B2WA 2FMMA 3ONAB 1Q3LA 1DOKA 1NR2A 5AFWA 1LV9A 2K04A 1IKMA 2IL8A 1JE4A 1PFMA 2L4NA 3FDTA 1RODA 1MSGA 1F9PA 1HUNA
chains in the Genus database with same CATH superfamily
3OTOL 5F2DA 3KF6A 1QVFA 2B2UC 4Q5VA 1CKNA 1BQQT 1W3SA 4B3TL 4K5WA 4BY1H 1RDPD 1K8MA 3DMUA 4KY5A 2MJ8A 1VQCA 5C3EH 4J8QA 2O5JC 4IN3A 1PDQA 1PTOC 4C2MH 1TU2B 4P71A 2F4VQ 2E8GA 2VB2X 4K14A 4A3EB 1I94Q 2R92H 3HKZE 4NDXA 2DN8A 3GTPB 4AQYL 2Q2HA 3RUZA 3KF6B 1CKNB 1JOQA 4WFN3 4EX5A 4CDEC 4QUCA 3TREA 2F0SA 4PV1C 3T1HL 1WTOA 3VR2A 4GKJL 4DV2L 2OT2A 1UUPA 1PH1A 3AFPA 1SYFA 1FGUA 1KDAA 2RA4A 1W2BA 2M00A 1A3TA 3L7ZC 5E4WC 1C8CA 2JA8B 4NMZA 4HJ7A 1TWGB 1JC7A 4TSSA 4L63B 5C0XH 4A3FH 4C3IG 3MXGA 2JA5G 4IPHA 3UI2A 4IFDI 2JJQA 4OL7A 1WI5A 3OSOA 5EKLA 3K5OA 3Q22A 4L6TB 2VUMB 5HGQA 2PZTA 5LMUQ 2WKCA 1B70B 5JJLA 4N8FA 2RVLA 4RA8A 2MFIA 2HCIA 4HAEA 2J7ZA 3J80L 3F2UA 4X66L 4F7XA 3K58A 1VQKA 3H91A 3L2PA 5IT9c 2B2VC 3V05A 2YYZA 4IO9A 2R7DA 1FJGL 4R4TA 5DM73 1G2TA 2Z0SA 1R9TB 2UUAQ 1GUSA 4CKCA 4C3HB 1VQIA 5T1GA 1J6QA 2VY3A 5C4ZA 4AIMA 1D5MC 1I4XA 4JC0A 1MBYA 2E76C 1LLRD 4O42A 1VQGA 2KCCA 1KRSA 4A3GG 1TWFH 5JJIA 1HR0W 5IE8A 3CCQA 4G7OC 4FF1A 1F9PA 3AEVA 1A0IA 2UXDQ 2Z6BA 2CVRA 2KOLA 2ENBA 5M5YH 5C44B 1VQ5A 1SBBB 1UE7A 4XDXA 4KHPL 2JA8H 3H0GG 1E24A 1MSHA 4UDUC 1BKBA 4ME3A 4LAAA 5JEAH 1RCVD 4JCVE 1HCZA 2F0TA 2UXCL 1MJCA 1QZHA 2VUMH 4JBWA 2P5ZX 3CHBD 4A3IB 2JE6I 4UHVA 4CGYB 4G57A 4JI5Q 2NBFA 3Q23A 2YU9B 4H44C 4GZYC 2Z4IA 1I94L 3R2TA 4HCSA 1QOHA 1IBLL 4X62L 1PMRA 1XMQL 5IYDG 2BH2A 2V1CC 3W3AA 3J7ZC 2B8FA 5CBAE 3K0XA 3NP8A 5LMNQ 3HOZB 4OO1G 2BCOA 4JI3Q 3C46A 3MFYA 1TS2A 3HOWG 4LNQA 1EWHA 5GADC 3M4QA 1U0LA 4KV6A 4R8IA 2O4XA 2DNEA 2B29A 2YTXA 3I7FA 3C2PA 1Z6HA 2K5DA 3EJIA 1J9OA 1X6OA 4LFCQ 3VR4A 1D1IA 1UWVA 4NXNL 4C3IB 2EY2A 4NKLA 3OYYA 4J1MA 3F2DA 2UU9L 4ZUIA 4C1NK 2A6ED 4XT1B 1ILQA 2E5LQ 1NCVA 4RAUC 5J39A 1OXTA 2A6EC 1B1ZA 5M3MG 1Y8PB 2EYOA 2UUCQ 4P72A 2MQHA 3DEOA 3Q24A 1AZPA 1K28A 3FHWA 1XNRQ 4DNTB 2R7ZG 1I50B 1PZID 4N9TA 5IP9G 1B2TA 4O1NA 2KHJA 1NR2A 1Z7TA 2ALYB 1PFSA 4RGTA 2YU9H 1JE4A 4FVMA 5KNBA 1VQAA 2EIFA 1NY4A 3OPOA 3JAME 2Z9HA 1WTWA 3PIPA 2A69D 4ID6A 5BN4A 4DV5Q 1A15A 1PLFA 2A69C 2F0GA 2RQXA 2EDGA 2CW0C 3GTMB 3S1MB 1XXGA 3W2DA 1CQFA 2XWBB 1KHIA 1L0YB 3S15H 4JYAQ 3S1NB 2AMCB 4A3GB 2RF4A 4BBRB 4B9XA 4U68A 1QUQB 1VQOA 2L12A 4CHTB 3DWPA 1PH9A 1SNCA 1G91A 2IJ0A 3S1QB 1T9HA 1AEXA 2CHBD 4GLAC 5J22A 1DCZA 3BU2A 3HOUB 3C1FA 3CQZB 3CCVA 3SXHA 4C3IH 2B8GA 2JA5H 3QIAA 3BVGA 5CV9A 2RKSA 3D8GA 3MZ5A 2KEDA 4Y7NB 3VR3A 1Y1VG 3RLNA 4CJ1B 1VQ8A 1BCPF 4ZAIA 1K3RA 1BNZA 3STBD 4X65L 3STBC 2OCEA 3K81C 5CV5A 5HURA 2TSSA 2XGTA 2Z6KC 1ICWA 2ID0A 4RCNA 3V96A 1CKOA 2EYPA 3I3CA 1M8AA 2L5TA 2KHIA 1I50H 3OIPA 4DV1L 5GQOA 5IGEA 4B3RQ 4QQBX 1STAA 4MIUA 4ZKBB 4RGMA 3P7JA 2AHOB 3UE1A 4X3TA 2ES2A 4YHHQ 4L8JA 3GTMH 4PMWA 1IBKQ 4JI4Q 1E2ZA 2RCFA 5DM63 1JMCA 4A76A 4U673 4LF4L 1EL0A 4ALPA 2D0OA 3S1NH 2C9OA 5I4DA 1OXUA 4A3GH 1C0AA 3W1GA 2FMCA 5COYA 3Q8DA 1RL2A 1CHPD 3HFZB 3GTLH 2NB0A 1CZGA 4A3MG 2UUCL 4DUZQ 3CRLC 2VQEL 3J81E 4LF8L 3S1QH 4R4CA 1M90C 4CDDC 2NN6G 3HOUH 4LFBQ 3D3RA 1E2VA 5M3MB 3CQZH 1SYBA 1Q1EA 1UAPA 2DUDA 1EIFA 2N78A 3HOYB 2HIXA 4RMFA 1JWMD 4B9WA 1SJHD 4Y7NH 1ICFB 4NPSA 4HIDA 3BZKA 2FINB 5LL6S 1VQEA 3S1RB 2QEXA 2WV6D 4IURA 4R4IA 3CPFA 5ELBA 1XMOL 2PI2E 3SDZA 2YTVA 1YITA 2RHQB 1GO3E 4IUPA 1AE3A 1CSQA 1PXUA 1Z47A 4F88A 1BBUA 4DR1Q 1D2BA 1GJXA 4JI7Q 1ZXTA 4HJ5A 4N8X1 1PYBA 2L9HA 4DK0A 3MC0B 1V1OA 3I55A 1Q81C 4DV3Q 1KNEA 4OO1H 4GLXA 2PYKA 1STEA 2WAQE 1TVXA 3HOWH 2NWGA 3KJOA 1KXLA 3I8ZA 3PQIA 3G6EA 1CZWA 2SEBD 1QE6A 3OIQA 4YCWA 1U4PA 3WOEA 1HNXQ 1N33L 3SE0A 2B39A 3A7LA 1A6XA 1B9NA 1F2ZA 2K7VA 3CMEA 1QB5D 3RD4A 1GHKA 4JOIC 2E2HB 4A93G 5KNCA 3I4MB 3Q0AA 2RBMA 1OXXK 4A3KG 2ZTCA 1EFID 1WTHA 2QDBA 1PH6A 4UY8C 1YJNA 3FPUB 3NBIA 1LTID 2B2WC 1Q1BA 3TZUA 1PH3A 1Z9FA 1G291 3UDIA 4L5RC 1VQJA 5IOCA 5M3MH 1SXTA 2KECA 1DOLA 3CU7A 1S40A 3MHBA 1GKHA 3I4NG 4GKKL 3PSIA 4TVAB 5C4JH 2M9VA 1XTCD 3KK7A 1SLJA 2R61A 4IPGA 1DGSA 2R7ZH 4KTAA 1E1TA 5IP9H 2KHSA 3BZCA 3Q6SA 1N36L 1TWAB 2FJ2A 5FO7B 4A3CG 1MGSA 4A3BB 3EVQA 4UP7A 3E9HA 4OEMB 4GS3A 1X3PA 3CF5A 5DEHA 3ERSX 4HMJA 2RCNA 1ET6A 1Q3LA 5FJ8G 4DAYA 1IYJB 4LF7L 1GD7A 2NVQH 3FDTA 1RODA 2EPBA 3K0YA 3RLFA 1KABA 2H5XA 1II3A 4O2DA 4YWLA 3KFUA 3FP9A 4DR5L 1SFOB 2AUJD 2NVXH 4DR3Q 4X64L 1IW7D 3D6WA 4JOIA 4GNXA 3URYA 4DV6L 1IW7C 3TDQA 3J81i 1SN8A 2IHEA 2YTYA 2E2JB 2JA6B 1MKHA 3DWAA 4DAYB 2E2HH 4C3JB 4R1JA 5IODA 4A75A 2EZVA 3E5SA 3CP0A 4OWWB 1HA5A 3I70A 3H6MA 1VQFA 2NZ1D 1S3OA 3I90A 2MP1A 2L55A 1NSNS 2GVBA 4ZK9B 1Y1VH 2J0TD 3HOXG 4JK1C 4EQ5A 1TIID 1XX8A 2F0IA 3MXUA 4TKOB 4JI6L 2K01A 2KENA 4LK1C 1N8RC 1EYDA 4WJWA 4IALA 2HQEA 1STBA 1I6HB 2F0JA 2AQ3B 1QILA 2FHTA 3J80E 4K5XA 2PQAA 3TP7A 2EXDA 1QVGA 1BR9A 1PHJA 1ENCA 4ULLA 2JA9A 1Q12A 1TWAH 2FFKB 2K50A 1GUWA 4KK7A 1BF4A 4A3BH 1EYGA 4FXKC 5ELFA 4DK6C 4AYBG 1SYCA 1HNXL 2PZUA 4YCUA 4GOPC 2G5DA 1YHQA 1Q8IA 3MTSA 2I07B 1JQYD 4YIJA 2BOSA 4B08A 3PUXA 1H9SB 1SE2A 3SGIA 5GAGC 3A74A 3KJPA 1JJGA 2EE1A 2NZOA 1RD9D 1SFOH 1SEBD 1LTSD 5C3EB 1ONLA 4KN7C 1W6JA 3WDNA 1BO0A 4A3KB 2IT1A 4QIWB 2Z1CA 1K8GA 5IWAQ 3W5OA 2QKIC 4DR7Q 1PFNA 1C9OA 4A3MH 2R92B 5IGFA 2E2JH 1X3FA 4A3DG 1GXDC 1IKLA 2E75C 2NN6H 3D4DA 4OO1I 3K5MA 5ELDA 2SNSA 3H09A 3A8KE 4JBJA 3P75A 2CKZB 3BVMA 5JJKA 1NBWA 2PCFB 3I4LA 1UEBA 2JEAI 4A3FB 4K8JA 3NK9A 5GAHC 4LMQD 3M7GA 2F0MA 1EIGA 5JJZA 3K5LA 2WFWA 3FVQA 1ESRA 3TP8A 4IPCA 2EXZA 2Y0SE 2EYHA 1A3VA 2F0PA 3VYTA 2F0EA 2EQSA 5CV7A 1F9QA 4DV7Q 1JCKB 4XXEA 3GTJH 1HFNA 3NQIA 2EJMA 1A63A 5AJ3Q 3DM1A 1K3BC 1HA6A 5JPNC 4HTHA 2Q8TA 2ZTDA 4KN4C 3HKZG 1I4PA 4G7ZC 1Q82C 3I56A 1VQBA 2IPKD 2K1BA 1WTRA 4K6LA 5FO8B 1STGA 5FLXL 4R8NA 3D4RA 2HHHQ 4EGVA 4GOPB 4A93H 3MEHA 4A3KH 2KQ3A 2A74C 3S14H 5G3LF 2XSCA 3G4SA 4F8MA 1EY9A 4HJ8A 1SMXA 4OWTB 2MGSA 1QCBD 3VDYA 3KBXA 3P1HA 3T56B 4XTCS 3HOXB 2F4IA 4A4IA 1TWFB 4ZKCB 1BCPD 2LKVA 1S5CD 3I4NH 3VR6A 1JOOA 1RIPA 5M5YB 1CA5A 1HR0L 1IZ6A 3M4PA 2BE5D 4RFBA 4DR6Q 3ULLA 1KLUD 3J80i 1VQ4A 1VF5C 1ENFA 2BE5C 4KJOA 1AW7A 1SYDA 4L5TA 5FOBB 1H9RA 4JI8L 4H02A 2D2CC 2Z8LA 4DR2L 2NZHA 4IJHA 3K59A 3NWSA 1YZ6A 1HQRD 2B2YA 1PZKD 2B63G 2JQOA 1N34Q 2CCZA 1BDOA 1F77A 2QDLA 1PH8A 4LF9Q 3ND8A 1Y69U 4MNOA 1ML0D 5E4XA 1HUNA 3S16H 1HNWQ 3M4YA 1A2UA 1EY8A 1S5ED 1U4RA 1F9SA 3ITPA 4CDCC 4DAVA 2OTLA 4NXML 3KLWA 1STHA 1ENAA 4DR4L 3HOXH 3A8JE 3K5NA 3NPPA 1N9WA 1KLGD 5J1ZA 5KIXA 1QWYA 3T1YQ 5EQ0A 1Y14B 5FLMG 4K6DA 4IOAA 3NELA 1RJTA 3D4WA 4H7BA 4LF6Q 1FNUA 5GAEC 4G7HC 1Q86C 4DV7L 1IBMQ 3T13A 1RHPA 3I73A 2SNMA 4LUZA 2K33A 2NN6I 1YNJD 2BA0A 2K5VA 1BCPB 1YNJC 2XN9C 1B3AA 3E9IA 1YHBA 5JOBA 4DUYQ 4BA1I 2F4VL 2EY1A 4JI2Q 1EEFD 4OONA 2RSNA 1SYEA 3G48A 3JAMc 3A55A 3HKZB 4KKTA 3H15A 3M4OB 4NW2A 2MO1A 2MO0A 1EYAA 3NEMA 4C56C 4IUUA 1LTRD 2CQAA 2GVAA 2K6AA 4XIGS 3PO3G 3BYTB 1EWCA 1F2YA 3A54A 4B3SQ 3AB9A 3BYYB 4A3DH 3S15B 4RHSA 4S3SA 1W6KA 3DM3A 1I4RA 4BXXG 3I91A 2JYOA 1JORA 1C4QA 2F3VA 2X69A 4V190 1PV4A 2O5IC 1Q7YC 3CKIB 2N3SA 1GM5A 2D9UA 1JJ2A 3H3VI 1K8AC 5CV8A 5M9OA 1ILPA 1VQDA 3LWEA 3C3LA 4FYDA 1EY4A 1LABA 2KA7A 3EN2A 4DA2A 5LMUL 1SE8A 1X3EA 2JA5B 5IYCG 2ICIA 3CRKC 3BZDB 3C1EA 2ATWA 1DD2A 1MD2D 3BDCA 1S4ZA 3OMCA 1C7YA 3TS0A 3M7NA 4LF9L 2ZXOA 4DAMA 2IW3A 1PVOA 2IHFA 3I2ZA 1G8ZD 1KDBA 1QNUA 3VR5A 2B63B 5FO9B 1VQ9A 2K5QA 3HP3A 2D62A 4BA2I 3GD7A 3G7LA 2OTJA 1LTTD 2UUAL 4BS9A 4HIOA 4UP9A 4MTNA 4A3JG 3UDFA 4K2KA 3UDXA 4NB3A 3M4OH 1LTLA 1BXTA 5C3WA 5C5LA 2EJGC 3PIP3 1LT5D 1SSOA 1KIXA 1ESFA 1N32Q 5C5MA 1U9RA 2UXDL 4POGA 4Q0FA 4JPBW 3R8BA 3VA7A 1AH9A 1BVSA 1FNVA 2K5WA 1DXMA 4N9PA 4IUNA 1D7QA 2VXWA 1SMYD 2KEEA 5NUCA 4JI1Q 3J81c 4OX9Q 3GTLB 1UE6A 4PNYA 5CV4A 5DLQE 4JI0Q 4KLKA 5C6AA 4KJNA 3CCLA 2LSSA 3HOVG 3H0GB 2MNAA 2Q8IB 1B7YB 2R6GA 2LY7A 4HJ9A 2V4DA 4NP5A 2B3GA 3SK8A 5I6YA 5GROA 4JI5L 3ZJYC 1PTOF 1JT8A 5KYIA 1A8VA 3NXWA 2B63H 2A8VA 1PYSB 3PUVA 1XTDA 2H1EA 3RR5A 3K7AB 1CFMA 2UXBQ 1DM0B 5D14A 1O7ZA 5LMNL 1EFWA 5ELCA 4CKBA 3OW7A 2VB3X 4JI3L 1MI2A 5C4XG 3CCJA 1D1KA 4KD4A 3DLLA 4YWMA 1ASYA 1HTLD 5FKAC 1GUTA 3OWFA 2RDFA 2F0DA 3MFGA 5M5WH 4R4OA 2HD3A 2CWAA 2D5DA 1PFMA 3HOWB 4DAPA 1EOVA 3BDOA 4LFCL 1MIUA 1V8QA 3RZDH 4MN3A 4DN4M 5KGUA 2E5LL 1PZJD 2WB1G 4DV4Q 4LFAQ 1Y1WG 4PQXA 2XVSA 1VQMA 3HG9A 2L11A 3MEFA 4IUTA 1B3QA 3R3OA 1X65A 4YY3Q 1L1OA 5FLMH 1J5EQ 4TQUS 4YCVA 4DKAC 1O7IA 5IIFA 3H0GH 2WB1E 1L0WA 3CC4A 3VA5A 1XNRL 3M85A 3L9AX 4ZLTF 4BY7G 2EY6A 1WJJA 1G51A 2JSOA 4QF4A 5IT9L 1PH4A 2F0KA 1XNQQ 2Z4HA 5C4JB 3OOCA 2Q2IA 5H1SE 5E1FA 3EIVA 3QOLA 2R7ZB 2F0QA 4L5QA 4DV5L 1TY0A 5IGDA 5EKKA 2CQOA 1CUKA 4WORA 4A3JB 4RCOA 4CBVA 1P8LA 2NTTA 1D8LA 3K7AH 4YWKA 3OMGA 3DXJC 3MXPA 3FMCA 3TBIB 1XPOA 3D0FA 2N55A 2WAQG 3CC7A 5IYDH 4JYAL 3BJUA 4FDBA 3VYRA 2F1MA 3PO3H 1SNMA 1R4QB 4FXDA 4JW0A 1P16A 2NVQB 1K73C 2Q8RE 5G3LD 3FKIG 2OQKA 1RF2D 4BXXH 2EYJA 1OTCA 1LTAD 2KCTA 3HGBA 3NQTA 1TS5A 4X3SA 1K9MC 1HNZQ 3PMFA 2NVXB 1EU3A 3F1ZA 4OXPA 1IYVA 4B3MQ 1HRJA 2I0QA 2EJFC 1EOTA 4GNXC 3N52A 5ISRA 2R93G 2EYMA 4RGOS 1X54A 4BBSG 1WFQA 2JN4A 1T5EA 1X3GA 4OIKA 5IYCH 2A68D 2N49A 2ZJPA 2I5HA 4PZ7A 2JEBI 3S2DH 1Y1VB 2A68C 1OXVA 1YJWA 5JPMC 4CJ0B 1GHJA 2DJGC 2QF7A 2IL8A 3GO5A 5IP7G 1HPCA 3O13A 4E6IA 1MSGA 4OGQC 4CKEA 4B3RL 3CCUA 5K36G 4DNRB 3J80c 3VYUA 1EU4A 5BN5A 1EQTA 2RDHA 1EY0A 2JA7G 4LUVA 2RHSB 1FR3A 5C4XB 4A3JH 3H3VC 4YHHL 4K0KQ 2WP8J 4OIJA 4LF5Q 1IBKL 4JI4L 1I4GA 4H0LC 3T4AC 3A8IE 4QIWE 3SR1A 1EY6A 1GVPA 1TR5A 1ET9A 2O2LD 5FLXE 2G9DA 1QZGA 1IHZA 4PMCA 3J7AF 4ZUJA 2QA4A 4OHJA 2PI2A 4JV5Q 1Q8KA 4DUZL 4TRDA 2HUGA 1NR4A 3MXNA 1Y1WB 1AFPA 2E74C 4LFBL 2UUBQ 3J81j 3TN2A 4R9WA 3AYHB 1H9JA 4A3MB 4KHVA 4XT3B 4HJAA 1BBWA 1QG7A 1J8IA 1HTPA 4EQOA 1HZ9A 2ZM6Q 3IFTA 5BN3A 2PMZB 3R93A 3SK6A 1SRUA 1NJIC 4QY7A 1O7YA 1R4PB 2DNCA 2PZWA 3QWNA 4ZCKA 2F0VA 1X32A 4Z9CB 2VZAA 3IL8A 4GNXB 4DR1L 1JB7A 1SNQA 3OTOQ 1KD1C 4JI7L 2OQ0A 3CD6A 1TKWB 4B3TQ 3MAQA 1SE4A 3T51B 3CC2A 1RTOA 4WRDA 4A3EG 1GOZA 2YV5A 3ULPA 1AZQA 4DV3L 3A7AB 1WOCA 2NUCA 5C4XH 3LNNA 3SHLA 1SNOA 3E0JA 3FKIB 3GTJB 2HDMA 2PW7A 4AQYQ 5ELOA 2QGQA 1YIJA 1GUNA 2C35B 1E2WA 4I65A 3U4ZA 1B53A 5A2QL 1JOKA 1XPRA 2FMMA 4GKJQ 3ONAB 2K04A 4DV2Q 3CXCA 2PQAB 3AFQA 2F52A 2L4NA 2LMCB 1Y1WH 5C3XA 5T1IA 4JG2A 4A93B 2R93B 2Q2TA 4QB4A 2F0UA 4XQJA 3S14B 3T53B 1JE5A 2HCCA 4IOCA 2RSOA 2VUMG 1PFBA 1ZYRD 1V43A 4K8IA 1FNWA 3WWVA 2E2DC 2A19A 4KHZA 4QJFA 3KLSX 1LT3D 4HMIA 2C5CA 3I4NB 2I5MX 2IY5B 4XQNA 3PCOB 2PNRC 4G4KA 2JA7B 1PYWD 1SAPA 1V1PA 4X66Q 2Y0SG 1MJEA 3TSSA 5C4HA 4C3HG 2MHVA 1WCMG 3S2HB 1X55A 3TQYA 1WYDA 2L15A 2XWJB 3LX0A 3U4VA 1FJGQ 4GN4B 3DUZA 4DXGA 2RDGA 5IGCA 1RTNA 1L0XB 3KDFA 2AWOA 1S72A 3PIOA 1G2SA 2NYZD 5C0XJ 4DR3L 1HFGA 4RH6A 4X6AH 1CKMA 3KLSA 3FKIH 1NAPA 2B2YC 2X6GA 3FEWX 1SYGA 1YNXA 1BBXC 1U4LA 4IUVA 2LXJA 5C44G 4QL5A 5KNDA 2BA1A 1TT2A 1STNA 2OF1A 1VF7A 3H3VH 1I6VC 5ELNA 1HUMA 3S16B 1EZ8A 1KNAA 3KDFB 4APVA 4RHRA 2KJXA 5JVH3 5EBCA 1M1KC 1JR0D 5CGKA 4FXGC 2R93H 4KHPQ 3JC66 4WJ4A 2IX1A 2HT1A 1YI2A 3V2TA 4BBSH 2I5LX 4IUQA 3RLOA 2CFMA 2XRSD 3QG1A 1VQNA 1YJ9A 1QVCA 1XPUA 4A3IG 1ASZA 3TZDA 2GA4B 1D5ZC 2UXCQ 1B44D 1HZCA 3CCEA 1NUCA 3L3OC 5CR3A 1PTOD 1BCPC 5IP7H 3HEJA 1I5FA 1SJED 3UDGA 3K80C 5K36H 1D5XC 1SE3A 2NVYB 4IJLA 2JA7H 5AFWA 1LV9A 4RKLA 1IBLQ 1KTKA 4X62Q 1XJVA 3ERQA 1XMQQ 3HOZG 5I2YA 3RZOB 5KYLA 3S2HH 4A3CH 1LT6D 1KL9A 3B6YA 4KKUA 1VCIA 4AYBB 1I4HA 3RN2A 2K52A 3NWTA 3K57A 4DPGA 1DZ1A 2L1BA 4ODGA 1AE2A 5FJ8H 1TQOA 4XYQA 1B8AA 1SNDA 2KUMA 1CA6A 1V1QA 4ME5A 5EBDA 1HXYD 3BDLA 5IWAL 4EQPA 4DR7L 5JEAJ 4HIMA 4DNIA 2SDFA 1PRTF 2N8NA 3ZYYX 4P74A 2JXMB 4RKBA 2EOTA 4ZYSA 4NXNQ 4A3DB 4KMUC 1K0SA 4KY7A 2B2TC 2UU9Q 1BUVT 2B2UA 1LT4D 3KF8A 2NVTB 3BG3A 2PPBC 2OEOA 2QW7A 3SK5A 4HCEA 4QMGA 5EJWA 3GTGB 3A56A 1EEID 4KKSA 4QCLA 1B9MA 1O80A 2Y0SB 3TP6A 4BWGB 1XWEA 2OWOA 1JICA 1WCMB 4A3EH 2CH4A 2NVYH 3KF8B 3GTPH 3SEBA 5TSSA 2AQ1B 1EYCA 3RZOH 1EY7A 5AJ3L 5I6WA 2G9HD 5BR8Q 1PA6A 1SR3A 5CMDA 4BBRG 4WJ3M 3GV6A 1PTOB 1X9NA 2F0LA 4HSPA 5HGTA 3KBGA 3OWEB 1QNKA 2HHHL 3FPPA 5EAYA 1SDFA 2BDNA 3OW2A 2X6LA 2EYFA 3HOUG 3R2IA 1TWGH 1TY2A 1ZEQX 2WIIB 4R4QA 3K7UC 5KRUA 2XTIA 3UE0A 2B2TA 2PQEA 2ZXRA 1MHWC 3NTKA 2AQ2B 1S5BD 4JBKA 3K6OA 1K0RA 2N88A 1NMGA 5E7NA 2J4XA 3PUYA 2F0FA 3L0OA 4HEDA 4MTKA 4AH6A 2B2VA 2SOBA 4DR6L 3G6JB 2NVTH 2DGYA 4X65Q 3GTOB 1B50A 3GTGH 5IT9E 4H13C 1UE1A 1R9TH 3PF5A 1VQ6A 1F2LA 3QR8A 1K83B 2F0WA 1EIYB 4DV1Q 4C3HH 1N34L 3RN5A 1WCMH 3DWQA 3CCSA 1FGBD 3U58A 2K28A 1KDCA 3QOJA 5CYUA 3T16A 5M3FG 4JVZA 4ILWA 3MA2B 2K4KA 1TWHB 2IX3A 4FF4A 2LXKA 3BS1A 1BOSA 1U5KA 1PTOH 5CC4A 1HNWL 4OWXB 1WD0A 3CCMA 4DK3C 3QJYA 1HQMC 1JB3A 5C44H 4LF4Q 2XIWA 1KAWA 2I46A 1KRTA 5I2XA 1O7LA 2PO4A 3HKSA 1LACA 5M5WB 3HOYG 4UP8A 2VQEQ 1JWSD 5KEEA 4LF8Q 4O0AA 4UPAA 3WOFA 1HHVA 5EPKA 1T5XD 3T1YL 5IYBG 1EQVA 4KY6A 3RZDB 4A3IH 4LF6L 1H9MA 3S17B 2VNUD 2ZT9C 5C0XI 1IBML 1QUQA 4LW1A 3GTOH 1WVLA 2MUYA 2CW0D 5D3DA 1FYCA 1XMOQ 3EFXD 1GUGA 1SMYC 5BR8L 3F2CA 5IGBA 1A3UA 1L2FA 1GUOA 1D6EC 4FO2A 1L1OC 1QJOA 1VDZA 2F3WA 2JK8A 2F03A 1KQSA 3DEPA 5EGTA 3S24A 1WTPA 1K83H 5D65A 3SVMA 2K05A 5LL6X 3HOZH 1EY5A 3A5ZB 4GN5A 5CV6A 4DUYL 4JI2L 1TS4A 1OO9B 1X56A 1YBYA 1DOKA 1IKMA 2ZXPA 3A0JA 3N6RA 4DGZA 5K5PA 3J7YW 4F87A 1VQHA 3CAMA 2DY7A 5E3FA 2CH4W 1B4OA 3LGJA 4P2CB 1TWHH 3NE5B 3D6CA 3A5UA 4PZ8A 5JVG3 3I4MG 4B3SL 4IFDG 1N33Q 3G71A 1DONA 2IWHA 3U50C 4A3LG 2R7FA 3PO2G 3NTIA 4JBMA 3PO3B 2HDLA 1HZAA 1EZ6A 1YEZA 3MWYW 1IL8A 3CMAA 1WTQA 3EROA 1VQ7A 2ZJQA 1NMFA 3SK4A 1TS3A 4P73A 3PV0A 2EVBA 1VS0A 5I9PA 2WINB 3GP7A 3LWUA 1VQLA 4UAIA 2KVMA 2LS01 3AMUA 1CQVA 1I4QA 3S17H 4GKKQ 5D3IB 1E7ZA 1F2MA 3FRPB 4X3KA 3E6ZX 3QB3A 4A3BG 2KCMA 4J6HA 1FL0A 4HN7A 1WTXA 3IAYA 1YNND 3EBEA 5IGGA 1HZBA 4M1UB 4QUFA 1YNNC 1CTMA 1G6ZA 1LM0A 1N36Q 2IX0A 2KBNA 1DJRD 2F0OA 3S2DB 3TEHB 3S1MH 2DY8A 5EPLA 3NHHA 1YVCA 3NTHA 3J7A5 1K8OA 1UNSA 4M8AA 5M3FB 4K2LA 4LUOA 1CSPA 3J7AV 4DF7A 5CBEE 4BBRH 4LF7Q 3GDEA 3QO2A 2VL6A 2EYLA 3TMEA 1L1OB 1FD7D 4DR5Q 2K75A 2JA6G 3I4OA 4GLVB 1SROA 1FVIA 4C3JG 1O78A 4X64Q 5A2QE 2R3ZA 4I7ZC 2K5HA 3K8AA 4DV6Q 1N32L 5FLXc 4FF3A 3CPWA 1DYQA 4MHEA 3ICEA 1F9RA 3X3MA 4ZRZA 1OXSC 2Z6KA 1E0BA 4GN3B 4JI1L 2PMZE 4OX9L 4JI0L 4CJ2C 3KYHC 4LWCA 5LMNW 3NUCA 2GN5A 2MPMA 3JAMi 3TS2A 2DJFC 2VW9A 4DXFA 4KD3A 4DK1A 1JJCB 4JI6Q 3M3YB 2BDOA 3E0EA 1E3PA 4PMBA 4RWSC 1HJPA 3AQQA 3HOVB 3PF4A 1XYIA 4L5SA 2VS1A 3NBHA 3OHXC 3KLRA 3IRBA 1KAAA 3RMHA 1E22A 1DOMA 5DAUA 3JAML 1RKNA 4BY1G 3HRZC 2UXBL 1TXYA 5M3FH 4IFDJ 1JWUD 5C3EG 2E2IB 4K5VA 2F0HA 2KCNA 3NBHB 1AP0A 2R92G 3PO2B 1UEAB 3EQLC 1PRTD 2WKDA 5L37A 3TRZA 1PRTC 1S5FD 5I9OA 2AWNA 2ZTEA 2D0PA 5CORA 5JAVA 3HOYH 4DV0Q 2K5NA 1X3QA 4ABNA 4DV4L 4LFAL 2ICEC 5FK9C 3VYSA 4HIKA 1NTGA 2EY5A 5M5XB 4C1NI 1PH2A 3AU7A 3S1RH 5IYBH 3GQBA 5LHY1 1Q46A 3D31A 4YY3L 4XQQA 1J5EL 4FNFA 3DHQA 5C0XG 1Q90A 4MZ9A 3IFDA 4A3FG 1U4MA 2WB1B 2ZJRA 2WACA 5EPJA 3IKJA 1TWCB 3KUPA 1M4VA 1H9KA 1I3QB 3M3YH 5EKIA 1CK1A 2A73B 3HOVH 1XNQL 2NTSA 4HSVA 1S5DD 3BVZA 1KC8C 1EQRA 4PG3A 2QILA 4BY7B 3PUWA 3M9BA 4HR7B 1CI3M 3PUZA 1LTGD 1NNXA 3KOJA 3MXNB 3H94A 1LO5D 2Q2UA 2VQFQ 4RGNA 1A2TA 1VMPA 2XNAC 1ZKOA 2E2IH 1IYUA 2B2WA 3I4MH 3U9SA 3P20A 2CWPA 1Y8OB 4DU9A 4IFDH 1YHAA 1WD1A 1CT1D 2PW5A 2WAQB 3NENA 3CW2C 4A3LH 4Y52H 3PO2H 5A35A 3HZXA 4FF2A 1HNZL 1PH5A 3GV3A 2FXQA 1IXRA 3TP5A 3F8TA 2ASBA 2QEJC 3J81L 4B3ML 3EA6A 4CDFC 5M5XH 1H9SA 3T1HQ 2JA8G 1LUZA 1CM9A 1PRTB 2OXPA 4J15A 4KI0A 4IQZA 4FP5D 1HH2P 5ELEA 3GTKB 1HR0Q 1V9PA 4ZQ3A 4RG1A 5HY6A 5JEAG 3GTQB 2A6HD 1TWCH 1STYA 4BBSB 2A6HC 2JP1A 1I3QH 1Y8NB 1CHQD 2TMPA 4JI8Q 1ZYRC 4LJZC 4BY1B 2AUKA 3X3NA 3E3XA 4DR2Q 4BY7H 4AYBE 2BH8A 2HQLA 1E1OA 1G6PA 2H4OA 4C2MB 2A1AA 2K32A 4K0KL 2LFNA 4LF5L 2K14A 1EIHA 1PH7A 1VQPA 2M2LA 4EQNA 4DV0L 4QGUA 4X3UA 1H95A 2JA6H 2F3IA 2K03A 2L0CA 3I72A 2QCPX 3HS0C 4C3JH 4EVOA 1EUJA 3PGZA 4XYOA 5IY0A 4JV5L 1VMCA 4P75A 1LYLA 1C48A 5DNFA 1A62A 1EQQA 4IZ8A 2UUBL 4NXMQ 1LTBD 3W1BA 3PIO3 2PNHA 4DFAA 3ND9A 3NSWA 3F2BA 4DR4Q 1V1PB 3MVVA 1WTVA 1SNPA 4V0BA 1AN8A 2ZM6L 1EWIA 3CCRA 3ULJA 4IPDA 1I6HH 1NE3A 4I7AA 4OELB 3S9WA 2F0NA 2XRQD 1IL2A 4PZ6A 4GOPA 3GTKH 3ER0A 2AKWB 1UE5A 2HIVA 3GTQH 5J3BA 3RNUA 4POFA 2VQFL 2A5HA 3U9OA
chains in the Genus database with same CATH topology
5F2DA 2B2UC 4Q5VA 1BQQT 4K5WA 1RDPD 1K8MA 3DMUA 4KY5A 2MJ8A 4J8QA 2O5JC 4IN3A 1PDQA 1PTOC 1TU2B 2VB2X 4K14A 4A3EB 4NDXA 2DN8A 3GTPB 3RUZA 1JOQA 4WFN3 4QUCA 2F0SA 4PV1C 1WTOA 3VR2A 2OT2A 1UUPA 1SYFA 2RA4A 1KDAA 2M00A 1A3TA 3L7ZC 5E4WC 1C8CA 2JA8B 4NMZA 1TWGB 1JC7A 4TSSA 4L63B 5C0XH 4C3IG 3MXGA 3UI2A 4IFDI 4OL7A 3OSOA 5EKLA 3K5OA 3Q22A 4L6TB 2VUMB 2PZTA 2WKCA 2RVLA 4RA8A 2HCIA 4HAEA 2J7ZA 3J80L 3F2UA 4F7XA 3K58A 3H91A 2B2VC 3V05A 2YYZA 5DM73 1G2TA 1R9TB 1GUSA 4CKCA 4C3HB 5T1GA 5C4ZA 1D5MC 1I4XA 1MBYA 2E76C 1LLRD 4O42A 2KCCA 4G7OC 4FF1A 1F9PA 2CVRA 2KOLA 2ENBA 5C44B 1SBBB 4XDXA 1MSHA 4UDUC 4LAAA 5JEAH 1RCVD 1HCZA 2F0TA 4JBWA 3CHBD 4A3IB 2JE6I 4CGYB 4G57A 2NBFA 3Q23A 2YU9B 4H44C 4GZYC 2Z4IA 3R2TA 4HCSA 1QOHA 1PMRA 3W3AA 2B8FA 5CBAE 3NP8A 3HOZB 4OO1G 2BCOA 3C46A 3MFYA 1TS2A 1EWHA 4KV6A 4R8IA 2O4XA 2DNEA 3C2PA 1Z6HA 2K5DA 3EJIA 1J9OA 3VR4A 1D1IA 4C3IB 2EY2A 4NKLA 4J1MA 4ZUIA 4C1NK 2A6ED 4XT1B 1ILQA 1NCVA 4RAUC 5J39A 1OXTA 2A6EC 1B1ZA 1Y8PB 2EYOA 3DEOA 3Q24A 1AZPA 4DNTB 1I50B 1PZID 4N9TA 1B2TA 4O1NA 1NR2A 1Z7TA 4RGTA 1JE4A 4FVMA 5KNBA 3OPOA 3JAME 1WTWA 2A69D 4ID6A 5BN4A 1A15A 1PLFA 2A69C 2F0GA 2RQXA 2EDGA 2CW0C 3GTMB 3S1MB 1XXGA 3W2DA 1CQFA 2XWBB 1L0YB 3S1NB 4A3GB 4BBRB 4B9XA 4U68A 2L12A 4CHTB 3DWPA 1SNCA 1G91A 2IJ0A 3S1QB 1AEXA 2CHBD 5J22A 1DCZA 3HOUB 3C1FA 3CQZB 3SXHA 2B8GA 3QIAA 3BVGA 5CV9A 2RKSA 3D8GA 3MZ5A 2KEDA 4Y7NB 3VR3A 4CJ1B 1BCPF 4ZAIA 1BNZA 5CV5A 5HURA 2TSSA 1ICWA 2ID0A 4RCNA 3V96A 2EYPA 3I3CA 1M8AA 2L5TA 3OIPA 5IGEA 1STAA 4MIUA 4ZKBB 4RGMA 3P7JA 4X3TA 4L8JA 4PMWA 1E2ZA 5DM63 4U673 1EL0A 2C9OA 5I4DA 1OXUA 2FMCA 5COYA 1CHPD 2NB0A 1CZGA 3CRLC 3J81E 2NN6G 3D3RA 1E2VA 5M3MB 1SYBA 1Q1EA 1UAPA 3HOYB 1JWMD 4B9WA 1SJHD 5LL6S 2FINB 3S1RB 2WV6D 4IURA 5ELBA 3SDZA 4IUPA 1PXUA 1Z47A 4F88A 1D2BA 1GJXA 1ZXTA 2L9HA 4DK0A 3MC0B 1V1OA 1KNEA 4OO1H 2PYKA 1STEA 1TVXA 2NWGA 3I8ZA 1CZWA 2SEBD 1QE6A 3OIQA 3WOEA 1U4PA 3SE0A 2B39A 3A7LA 1A6XA 1B9NA 1F2ZA 2K7VA 1QB5D 3RD4A 1GHKA 2E2HB 5KNCA 3I4MB 3Q0AA 2RBMA 1OXXK 1EFID 2QDBA 3FPUB 3NBIA 1LTID 2B2WC 1Q1BA 3TZUA 1G291 5IOCA 1SXTA 2KECA 1DOLA 3CU7A 3MHBA 2M9VA 1XTCD 3KK7A 2R61A 4KTAA 2KHSA 3Q6SA 1TWAB 2FJ2A 5FO7B 1MGSA 4A3BB 3EVQA 1X3PA 5DEHA 4HMJA 1ET6A 1Q3LA 4DAYA 2A5HA 3FDTA 1RODA 2EPBA 3K0YA 3RLFA 1KABA 1II3A 1SFOB 2AUJD 1IW7D 3D6WA 3URYA 1IW7C 3TDQA 2E2JB 2JA6B 3DWAA 4C3JB 5IODA 2EZVA 3E5SA 1HA5A 3I70A 3H6MA 2NZ1D 3I90A 2MP1A 2L55A 1NSNS 4ZK9B 2J0TD 4JK1C 1TIID 1XX8A 2F0IA 3MXUA 4TKOB 2K01A 4LK1C 1EYDA 4WJWA 4IALA 2HQEA 1STBA 1I6HB 2F0JA 2AQ3B 1QILA 2FHTA 3J80E 4K5XA 3TP7A 1BR9A 1ENCA 4ULLA 1Q12A 2FFKB 1GUWA 4KK7A 1BF4A 4FXKC 5ELFA 1SYCA 2PZUA 1Q8IA 3MTSA 2I07B 1JQYD 4YIJA 2BOSA 4B08A 3PUXA 1H9SB 1SE2A 2EE1A 1RD9D 1SEBD 1LTSD 5C3EB 1ONLA 4KN7C 1W6JA 3WDNA 1BO0A 4A3KB 2IT1A 4QIWB 2Z1CA 2QKIC 1PFNA 2R92B 5IGFA 1GXDC 1IKLA 2E75C 2NN6H 3D4DA 4OO1I 3K5MA 5ELDA 2SNSA 3H09A 3A8KE 3P75A 3BVMA 2PCFB 3I4LA 2JEAI 4A3FB 4K8JA 3NK9A 4LMQD 3M7GA 2F0MA 1EIGA 5JJZA 3K5LA 3FVQA 1ESRA 3TP8A 2EXZA 2EYHA 1A3VA 2F0PA 3VYTA 2F0EA 5CV7A 1F9QA 1JCKB 4XXEA 1HFNA 3NQIA 2EJMA 3DM1A 1HA6A 5JPNC 4HTHA 2Q8TA 4KN4C 1I4PA 4G7ZC 2IPKD 2K1BA 1WTRA 4K6LA 5FO8B 1STGA 5FLXL 4R8NA 3D4RA 4EGVA 3MEHA 2KQ3A 2A74C 5G3LF 2XSCA 4F8MA 1EY9A 2MGSA 1QCBD 3KBXA 3P1HA 3T56B 4XTCS 3HOXB 2F4IA 1TWFB 4ZKCB 1BCPD 2LKVA 1S5CD 3VR6A 1JOOA 5M5YB 1CA5A 2BE5D 4RFBA 1KLUD 1VF5C 1ENFA 2BE5C 4KJOA 1AW7A 1SYDA 5FOBB 1H9RA 2D2CC 2Z8LA 3K59A 3NWSA 1HQRD 2B2YA 1PZKD 1BDOA 1F77A 3ND8A 1Y69U 1ML0D 5E4XA 1HUNA 3M4YA 1A2UA 1EY8A 1S5ED 1U4RA 1F9SA 3ITPA 4DAVA 1STHA 1ENAA 3A8JE 3K5NA 3NPPA 1KLGD 5J1ZA 5KIXA 1QWYA 5EQ0A 4K6DA 1RJTA 3D4WA 4H7BA 1FNUA 4G7HC 3T13A 1RHPA 3I73A 2SNMA 2K33A 2NN6I 1YNJD 2BA0A 1BCPB 1YNJC 2XN9C 1B3AA 5JOBA 4BA1I 2EY1A 1EEFD 2RSNA 1SYEA 3A55A 3HKZB 4KKTA 3M4OB 4NW2A 1EYAA 4C56C 4IUUA 1LTRD 2CQAA 2K6AA 4XIGS 3BYTB 1EWCA 1F2YA 3A54A 3AB9A 3BYYB 3S15B 4RHSA 4S3SA 1W6KA 1I4RA 3I91A 2JYOA 1JORA 1C4QA 2F3VA 2X69A 4V190 2O5IC 3CKIB 2D9UA 5CV8A 5M9OA 1ILPA 3LWEA 3C3LA 4FYDA 1EY4A 1LABA 2KA7A 4DA2A 2JA5B 2ICIA 3CRKC 3BZDB 3C1EA 1DD2A 1MD2D 3BDCA 1S4ZA 3OMCA 3M7NA 2ZXOA 2IW3A 3VR5A 1G8ZD 1KDBA 1QNUA 2B63B 5FO9B 2K5QA 3HP3A 2D62A 4BA2I 3GD7A 3G7LA 1LTTD 4BS9A 4K2KA 1BXTA 5C3WA 5C5LA 2EJGC 3PIP3 1LT5D 1SSOA 1ESFA 5C5MA 1U9RA 4Q0FA 3R8BA 3VA7A 1FNVA 2K5WA 1DXMA 4N9PA 4IUNA 2VXWA 5NUCA 1SMYD 2KEEA 3GTLB 4PNYA 5CV4A 5C6AA 4KJNA 3H0GB 2Q8IB 2R6GA 2LY7A 2V4DA 4NP5A 3SK8A 5I6YA 1PTOF 5KYIA 3NXWA 2H1EA 3PUVA 3K7AB 1CFMA 1DM0B 5D14A 1O7ZA 5ELCA 4CKBA 3OW7A 2VB3X 1MI2A 1D1KA 4KD4A 1HTLD 5FKAC 1GUTA 3OWFA 2RDFA 2F0DA 3MFGA 1PFMA 2D5DA 3HOWB 4DAPA 3BDOA 1V8QA 4MN3A 4DN4M 5KGUA 1PZJD 4PQXA 2XVSA 3HG9A 2L11A 4IUTA 3R3OA 4TQUS 5IIFA 3VA5A 3M85A 3L9AX 4ZLTF 2EY6A 2JSOA 4QF4A 5IT9L 2F0KA 2Z4HA 5C4JB 3OOCA 5E1FA 3QOLA 2R7ZB 2F0QA 1TY0A 5IGDA 5EKKA 4WORA 4A3JB 4RCOA 4CBVA 2NTTA 3OMGA 3DXJC 3MXPA 3FMCA 3TBIB 2N55A 3VYRA 2F1MA 1SNMA 1R4QB 4FXDA 2NVQB 2Q8RE 5G3LD 1RF2D 2EYJA 1LTAD 3HGBA 3NQTA 1TS5A 4X3SA 2NVXB 3PMFA 1EU3A 1IYVA 1HRJA 2EJFC 1EOTA 3N52A 5ISRA 2EYMA 4RGOS 1T5EA 4OIKA 2A68D 2JEBI 1Y1VB 2A68C 1OXVA 5JPMC 4CJ0B 1GHJA 2QF7A 2IL8A 3GO5A 1HPCA 3O13A 4E6IA 1MSGA 4OGQC 4CKEA 5K36G 4DNRB 3VYUA 1EU4A 5BN5A 1EQTA 2RDHA 1EY0A 1FR3A 5C4XB 3H3VC 2WP8J 4OIJA 1I4GA 4H0LC 3T4AC 3A8IE 3SR1A 1EY6A 1TR5A 1ET9A 2O2LD 5FLXE 2G9DA 1IHZA 4PMCA 3J7AF 4ZUJA 4OHJA 4TRDA 2HUGA 1NR4A 3MXNA 1Y1WB 1AFPA 2E74C 3TN2A 4R9WA 1H9JA 4A3MB 4KHVA 4XT3B 1QG7A 1J8IA 1HTPA 4EQOA 3IFTA 5BN3A 2PMZB 3R93A 3SK6A 1O7YA 1R4PB 2DNCA 2PZWA 3QWNA 2F0VA 1X32A 4Z9CB 3IL8A 1SNQA 1TKWB 3MAQA 1SE4A 3T51B 1RTOA 4WRDA 1GOZA 1AZQA 3A7AB 2NUCA 3LNNA 3SHLA 1SNOA 3E0JA 3FKIB 3GTJB 2HDMA 2PW7A 1GUNA 1E2WA 4I65A 1B53A 5A2QL 1JOKA 2FMMA 3ONAB 2K04A 2L4NA 2LMCB 5C3XA 5T1IA 4A93B 2R93B 4QB4A 2F0UA 4XQJA 3S14B 3T53B 2HCCA 2RSOA 1PFBA 1ZYRD 1V43A 4K8IA 1FNWA 2E2DC 4KHZA 3KLSX 1LT3D 4HMIA 2C5CA 3I4NB 4XQNA 2PNRC 4G4KA 2JA7B 1PYWD 1SAPA 1V1PA 3TSSA 5C4HA 4C3HG 2MHVA 3S2HB 3LX0A 2XWJB 3DUZA 4DXGA 2RDGA 5IGCA 1RTNA 1L0XB 2AWOA 1G2SA 2NYZD 5C0XJ 1HFGA 4RH6A 3KLSA 1NAPA 2B2YC 2X6GA 3FEWX 1SYGA 1BBXC 1U4LA 4IUVA 5KNDA 2BA1A 1TT2A 1STNA 2OF1A 1VF7A 1I6VC 3S16B 1HUMA 1EZ8A 1KNAA 4RHRA 2KJXA 5JVH3 5EBCA 1JR0D 5CGKA 4FXGC 2IX1A 3V2TA 4IUQA 2XRSD 3QG1A 3TZDA 2GA4B 1D5ZC 1B44D 1NUCA 3L3OC 5CR3A 1PTOD 1BCPC 3HEJA 1SJED 5K36H 1D5XC 1SE3A 2NVYB 5AFWA 1LV9A 4RKLA 1KTKA 3ERQA 5I2YA 3RZOB 5KYLA 1LT6D 4KKUA 1VCIA 4AYBB 1I4HA 3NWTA 3K57A 1DZ1A 2L1BA 4ODGA 1TQOA 4XYQA 1SNDA 2KUMA 1CA6A 4ME5A 5EBDA 1HXYD 3BDLA 4EQPA 5JEAJ 2SDFA 1PRTF 3ZYYX 2JXMB 4RKBA 2EOTA 4ZYSA 4A3DB 4KMUC 4KY7A 2B2TC 1BUVT 2B2UA 1LT4D 3KF8A 2NVTB 3BG3A 2PPBC 2OEOA 3SK5A 4HCEA 4QMGA 5EJWA 3GTGB 3A56A 1EEID 4KKSA 4QCLA 1B9MA 1O80A 2Y0SB 3TP6A 4BWGB 1XWEA 1JICA 1WCMB 3SEBA 5TSSA 2AQ1B 1EYCA 1EY7A 5I6WA 2G9HD 5CMDA 3GV6A 1PTOB 2F0LA 4HSPA 5HGTA 3KBGA 3OWEB 1QNKA 3FPPA 1SDFA 2BDNA 2X6LA 2EYFA 3R2IA 1TY2A 1ZEQX 2WIIB 5KRUA 2B2TA 2PQEA 2ZXRA 3NTKA 2AQ2B 1S5BD 3K6OA 2N88A 2J4XA 3PUYA 2F0FA 4HEDA 2B2VA 2SOBA 3G6JB 3GTOB 1B50A 5IT9E 4H13C 1F2LA 1K83B 2F0WA 3DWQA 1FGBD 2K28A 1KDCA 3QOJA 5CYUA 3T16A 4ILWA 3MA2B 4FF4A 1TWHB 2IX3A 3BS1A 1BOSA 1PTOH 5CC4A 1WD0A 3QJYA 1HQMC 1JB3A 2XIWA 2I46A 5I2XA 1O7LA 2PO4A 1LACA 5M5WB 1JWSD 5KEEA 3WOFA 1HHVA 5EPKA 1T5XD 1EQVA 4KY6A 3RZDB 1H9MA 3S17B 2VNUD 2ZT9C 5C0XI 1WVLA 2MUYA 2CW0D 5D3DA 1FYCA 3EFXD 1GUGA 1SMYC 5IGBA 1A3UA 1GUOA 1D6EC 4FO2A 1QJOA 1VDZA 2F3WA 2F03A 3DEPA 5EGTA 1WTPA 3SVMA 5D65A 2K05A 5LL6X 1EY5A 5CV6A 1TS4A 1OO9B 1DOKA 1IKMA 2ZXPA 3N6RA 5K5PA 3J7YW 4F87A 2DY7A 5E3FA 1B4OA 4P2CB 3NE5B 3D6CA 5JVG3 4IFDG 1DONA 2IWHA 3NTIA 3PO3B 2HDLA 1EZ6A 3MWYW 1IL8A 1WTQA 3EROA 3SK4A 1TS3A 3PV0A 2EVBA 5I9PA 2WINB 3GP7A 3LWUA 4UAIA 2KVMA 2LS01 3AMUA 1CQVA 1I4QA 5D3IB 3FRPB 1F2MA 4X3KA 3E6ZX 3QB3A 4J6HA 1WTXA 4HN7A 3IAYA 1YNND 5IGGA 4M1UB 4QUFA 1YNNC 1CTMA 1G6ZA 2IX0A 1DJRD 2F0OA 3S2DB 2DY8A 5EPLA 3NHHA 3NTHA 1K8OA 1UNSA 4M8AA 5M3FB 4K2LA 3J7AV 4DF7A 5CBEE 3QO2A 2EYLA 3TMEA 1FD7D 4C3JG 1O78A 5A2QE 2R3ZA 4I7ZC 4FF3A 1DYQA 4MHEA 1F9RA 3X3MA 4ZRZA 1OXSC 1E0BA 4CJ2C 3NUCA 2MPMA 4DXFA 4KD3A 4DK1A 3M3YB 2BDOA 4PMBA 4RWSC 3HOVB 1XYIA 3NBHA 3OHXC 3KLRA 1KAAA 3RMHA 1DOMA 5DAUA 3JAML 1RKNA 3HRZC 4IFDJ 1JWUD 2E2IB 4K5VA 2F0HA 2KCNA 1AP0A 3PO2B 1UEAB 3EQLC 1PRTD 2WKDA 1PRTC 1S5FD 5I9OA 2AWNA 5CORA 5JAVA 1X3QA 4ABNA 2ICEC 5FK9C 3VYSA 5M5XB 2EY5A 4C1NI 3AU7A 3GQBA 5LHY1 3D31A 4XQQA 4FNFA 3DHQA 5C0XG 1Q90A 3IFDA 1U4MA 2WB1B 2WACA 5EPJA 3IKJA 1TWCB 3KUPA 1M4VA 1H9KA 1I3QB 5EKIA 1CK1A 2A73B 2NTSA 4HSVA 1S5DD 3BVZA 2QILA 4BY7B 3PUWA 4HR7B 1CI3M 3PUZA 1LTGD 3H94A 1LO5D 4RGNA 1A2TA 1VMPA 2XNAC 1ZKOA 1IYUA 2B2WA 3U9SA 3P20A 1Y8OB 4DU9A 4IFDH 1WD1A 1CT1D 2PW5A 2WAQB 5A35A 3HZXA 4FF2A 3GV3A 3TP5A 2QEJC 3J81L 3EA6A 1H9SA 1CM9A 1PRTB 2OXPA 4KI0A 4IQZA 4FP5D 5ELEA 3GTKB 4ZQ3A 5JEAG 3GTQB 2A6HD 1STYA 4BBSB 2A6HC 2JP1A 1Y8NB 1CHQD 2TMPA 1ZYRC 4LJZC 4BY1B 2AUKA 3X3NA 2H4OA 4C2MB 2K32A 2LFNA 1EIHA 2M2LA 4EQNA 4X3UA 2K03A 2L0CA 2QCPX 3I72A 3HS0C 4EVOA 4XYOA 1VMCA 1C48A 5DNFA 4IZ8A 1LTBD 3PIO3 4DFAA 3ND9A 3NSWA 1V1PB 3MVVA 1WTVA 1SNPA 4V0BA 1AN8A 3S9WA 2F0NA 2XRQD 4DGZA 3U9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1I A;  1S4Z A;  2B2U C;  2CVR A;  4HED A;  4RWS C;  2KOL A;  2B2V A;  1WTW A;  1A15 A;  1EQT A;  1PLF A;  4XDX A;  1U4R A;  2HCC A;  3GV3 A;  4MN3 A;  1XYI A;  2FIN B;  2RSO A;  4DN4 M;  1PFB A;  2EPB A;  3HP3 A;  1F9S A;  2L1B A;  4LMQ D;  1DON A;  1DZ1 A;  5E4X A;  1EIG A;  1MSH A;  5JJZ A;  2MJ8 A;  3D6W A;  1B50 A;  2KUM A;  4OIJ A;  1CA6 A;  4IUR A;  2L11 A;  4IUT A;  3G7L A;  1PDQ A;  1ESR A;  1DOM A;  2HDL A;  3MWY W;  1IL8 A;  1F2L A;  1CM9 A;  4IUP A;  2SDF A;  4U68 A;  1WTQ A;  1F9Q A;  2L12 A;  1HFN A;  5EQ0 A;  2NZ1 D;  3I90 A;  1ZXT A;  4QUC A;  4ZLT F;  2K28 A;  2EOT A;  2MP1 A;  1G91 A;  1SAP A;  2L9H A;  4ZK9 B;  1RJT A;  3DM1 A;  1HA6 A;  4UAI A;  1WTO A;  2KVM A;  1SSO A;  2HUG A;  1NR4 A;  2Q8T A;  1AP0 A;  1XX8 A;  2B2T C;  2JP1 A;  4HCS A;  1RHP A;  2B2U A;  1KNE A;  2K1B A;  1B4O A;  3TN2 A;  1WTR A;  2K01 A;  4X3K A;  4R9W A;  1RTN A;  2KED A;  1WTX A;  1TVX A;  1WD0 A;  2RA4 A;  2NWG A;  4CJ1 B;  5E4W C;  4QUF A;  1C8C A;  4XT3 B;  5COR A;  4ZAI A;  3I8Z A;  2XIW A;  5CBA E;  1G2S A;  1QG7 A;  2NYZ D;  1BNZ A;  1J8I A;  1QE6 A;  1B3A A;  1X3Q A;  1HFG A;  1U4P A;  5EJW A;  1G6Z A;  2FHT A;  2VXW A;  3UI2 A;  2KEE A;  3R93 A;  1NAP A;  2DY8 A;  2MGS A;  1O80 A;  2B2Y C;  2N55 A;  3KBX A;  5EPL A;  2X6G A;  1EIH A;  1O7Y A;  2FFK B;  1ICW A;  1GUW A;  1BBX C;  1U4L A;  4IUV A;  2M2L A;  1BF4 A;  2RSN A;  4R8I A;  3I3C A;  1M8A A;  1X32 A;  1JIC A;  4ZKC B;  3IFD A;  4X3U A;  1U4M A;  3IL8 A;  5CBE E;  4NW2 A;  2RVL A;  4RA8 A;  2K03 A;  3FPU B;  2Q8R E;  1HUM A;  2B2W C;  1ML0 D;  3MTS A;  5EPJ A;  3QO2 A;  5EPK A;  1HHV A;  2HCI A;  1KNA A;  4IUU A;  3KUP A;  1CA5 A;  1J9O A;  4HAE A;  2J7Z A;  4ZKB B;  3F2U A;  2KEC A;  3P7J A;  4X3S A;  1VMC A;  1DOL A;  3H91 A;  5EKI A;  5DNF A;  5CMD A;  1RTO A;  2B2V C;  2EE1 A;  3GV6 A;  4X3T A;  4XT1 B;  1ILQ A;  1AZQ A;  4IUQ A;  1NCV A;  2R3Z A;  4HSV A;  4RAU C;  3I91 A;  1G2T A;  1HRJ A;  1WVL A;  2JYO A;  1QNK A;  1BO0 A;  1EOT A;  2H1E A;  1SDF A;  3TZD A;  2BDN A;  3N52 A;  1WTV A;  2X6L A;  2X69 A;  4MHE A;  1PFN A;  2N88 A;  1EL0 A;  1F9R A;  2DY7 A;  5D14 A;  1AZP A;  5T1G A;  2B2Y A;  1O7Z A;  2HDM A;  3Q6S A;  4OIK A;  3DEO A;  1IKL A;  2D9U A;  2FJ2 A;  3DEP A;  5COY A;  1WTP A;  1E0B A;  5D65 A;  3SVM A;  1MI2 A;  1MGS A;  2K05 A;  1VMP A;  1ILP A;  3LWE A;  4CJ2 C;  1B53 A;  1WD1 A;  1X3P A;  4O42 A;  2MPM A;  4CJ0 B;  2B2T A;  1B2T A;  2B2W A;  2FMM A;  3ONA B;  1Q3L A;  1DOK A;  1NR2 A;  5AFW A;  1LV9 A;  2K04 A;  1IKM A;  2IL8 A;  1JE4 A;  1PFM A;  2L4N A;  3FDT A;  1ROD A;  1MSG A;  1F9P A;  1HUN A; 
#chains in the Genus database with same CATH topology
 3OTO L;  5F2D A;  3KF6 A;  1QVF A;  2B2U C;  4Q5V A;  1CKN A;  1BQQ T;  1W3S A;  4B3T L;  4K5W A;  4BY1 H;  1RDP D;  1K8M A;  3DMU A;  4KY5 A;  2MJ8 A;  1VQC A;  5C3E H;  4J8Q A;  2O5J C;  4IN3 A;  1PDQ A;  1PTO C;  4C2M H;  1TU2 B;  4P71 A;  2F4V Q;  2E8G A;  2VB2 X;  4K14 A;  4A3E B;  1I94 Q;  2R92 H;  3HKZ E;  4NDX A;  2DN8 A;  3GTP B;  4AQY L;  2Q2H A;  3RUZ A;  3KF6 B;  1CKN B;  1JOQ A;  4WFN 3;  4EX5 A;  4CDE C;  4QUC A;  3TRE A;  2F0S A;  4PV1 C;  3T1H L;  1WTO A;  3VR2 A;  4GKJ L;  4DV2 L;  2OT2 A;  1UUP A;  1PH1 A;  3AFP A;  1SYF A;  1FGU A;  1KDA A;  2RA4 A;  1W2B A;  2M00 A;  1A3T A;  3L7Z C;  5E4W C;  1C8C A;  2JA8 B;  4NMZ A;  4HJ7 A;  1TWG B;  1JC7 A;  4TSS A;  4L63 B;  5C0X H;  4A3F H;  4C3I G;  3MXG A;  2JA5 G;  4IPH A;  3UI2 A;  4IFD I;  2JJQ A;  4OL7 A;  1WI5 A;  3OSO A;  5EKL A;  3K5O A;  3Q22 A;  4L6T B;  2VUM B;  5HGQ A;  2PZT A;  5LMU Q;  2WKC A;  1B70 B;  5JJL A;  4N8F A;  2RVL A;  4RA8 A;  2MFI A;  2HCI A;  4HAE A;  2J7Z A;  3J80 L;  3F2U A;  4X66 L;  4F7X A;  3K58 A;  1VQK A;  3H91 A;  3L2P A;  5IT9 c;  2B2V C;  3V05 A;  2YYZ A;  4IO9 A;  2R7D A;  1FJG L;  4R4T A;  5DM7 3;  1G2T A;  2Z0S A;  1R9T B;  2UUA Q;  1GUS A;  4CKC A;  4C3H B;  1VQI A;  5T1G A;  1J6Q A;  2VY3 A;  5C4Z A;  4AIM A;  1D5M C;  1I4X A;  4JC0 A;  1MBY A;  2E76 C;  1LLR D;  4O42 A;  1VQG A;  2KCC A;  1KRS A;  4A3G G;  1TWF H;  5JJI A;  1HR0 W;  5IE8 A;  3CCQ A;  4G7O C;  4FF1 A;  1F9P A;  3AEV A;  1A0I A;  2UXD Q;  2Z6B A;  2CVR A;  2KOL A;  2ENB A;  5M5Y H;  5C44 B;  1VQ5 A;  1SBB B;  1UE7 A;  4XDX A;  4KHP L;  2JA8 H;  3H0G G;  1E24 A;  1MSH A;  4UDU C;  1BKB A;  4ME3 A;  4LAA A;  5JEA H;  1RCV D;  4JCV E;  1HCZ A;  2F0T A;  2UXC L;  1MJC A;  1QZH A;  2VUM H;  4JBW A;  2P5Z X;  3CHB D;  4A3I B;  2JE6 I;  4UHV A;  4CGY B;  4G57 A;  4JI5 Q;  2NBF A;  3Q23 A;  2YU9 B;  4H44 C;  4GZY C;  2Z4I A;  1I94 L;  3R2T A;  4HCS A;  1QOH A;  1IBL L;  4X62 L;  1PMR A;  1XMQ L;  5IYD G;  2BH2 A;  2V1C C;  3W3A A;  3J7Z C;  2B8F A;  5CBA E;  3K0X A;  3NP8 A;  5LMN Q;  3HOZ B;  4OO1 G;  2BCO A;  4JI3 Q;  3C46 A;  3MFY A;  1TS2 A;  3HOW G;  4LNQ A;  1EWH A;  5GAD C;  3M4Q A;  1U0L A;  4KV6 A;  4R8I A;  2O4X A;  2DNE A;  2B29 A;  2YTX A;  3I7F A;  3C2P A;  1Z6H A;  2K5D A;  3EJI A;  1J9O A;  1X6O A;  4LFC Q;  3VR4 A;  1D1I A;  1UWV A;  4NXN L;  4C3I B;  2EY2 A;  4NKL A;  3OYY A;  4J1M A;  3F2D A;  2UU9 L;  4ZUI A;  4C1N K;  2A6E D;  4XT1 B;  1ILQ A;  2E5L Q;  1NCV A;  4RAU C;  5J39 A;  1OXT A;  2A6E C;  1B1Z A;  5M3M G;  1Y8P B;  2EYO A;  2UUC Q;  4P72 A;  2MQH A;  3DEO A;  3Q24 A;  1AZP A;  1K28 A;  3FHW A;  1XNR Q;  4DNT B;  2R7Z G;  1I50 B;  1PZI D;  4N9T A;  5IP9 G;  1B2T A;  4O1N A;  2KHJ A;  1NR2 A;  1Z7T A;  2ALY B;  1PFS A;  4RGT A;  2YU9 H;  1JE4 A;  4FVM A;  5KNB A;  1VQA A;  2EIF A;  1NY4 A;  3OPO A;  3JAM E;  2Z9H A;  1WTW A;  3PIP A;  2A69 D;  4ID6 A;  5BN4 A;  4DV5 Q;  1A15 A;  1PLF A;  2A69 C;  2F0G A;  2RQX A;  2EDG A;  2CW0 C;  3GTM B;  3S1M B;  1XXG A;  3W2D A;  1CQF A;  2XWB B;  1KHI A;  1L0Y B;  3S15 H;  4JYA Q;  3S1N B;  2AMC B;  4A3G B;  2RF4 A;  4BBR B;  4B9X A;  4U68 A;  1QUQ B;  1VQO A;  2L12 A;  4CHT B;  3DWP A;  1PH9 A;  1SNC A;  1G91 A;  2IJ0 A;  3S1Q B;  1T9H A;  1AEX A;  2CHB D;  4GLA C;  5J22 A;  1DCZ A;  3BU2 A;  3HOU B;  3C1F A;  3CQZ B;  3CCV A;  3SXH A;  4C3I H;  2B8G A;  2JA5 H;  3QIA A;  3BVG A;  5CV9 A;  2RKS A;  3D8G A;  3MZ5 A;  2KED A;  4Y7N B;  3VR3 A;  1Y1V G;  3RLN A;  4CJ1 B;  1VQ8 A;  1BCP F;  4ZAI A;  1K3R A;  1BNZ A;  3STB D;  4X65 L;  3STB C;  2OCE A;  3K81 C;  5CV5 A;  5HUR A;  2TSS A;  2XGT A;  2Z6K C;  1ICW A;  2ID0 A;  4RCN A;  3V96 A;  1CKO A;  2EYP A;  3I3C A;  1M8A A;  2L5T A;  2KHI A;  1I50 H;  3OIP A;  4DV1 L;  5GQO A;  5IGE A;  4B3R Q;  4QQB X;  1STA A;  4MIU A;  4ZKB B;  4RGM A;  3P7J A;  2AHO B;  3UE1 A;  4X3T A;  2ES2 A;  4YHH Q;  4L8J A;  3GTM H;  4PMW A;  1IBK Q;  4JI4 Q;  1E2Z A;  2RCF A;  5DM6 3;  1JMC A;  4A76 A;  4U67 3;  4LF4 L;  1EL0 A;  4ALP A;  2D0O A;  3S1N H;  2C9O A;  5I4D A;  1OXU A;  4A3G H;  1C0A A;  3W1G A;  2FMC A;  5COY A;  3Q8D A;  1RL2 A;  1CHP D;  3HFZ B;  3GTL H;  2NB0 A;  1CZG A;  4A3M G;  2UUC L;  4DUZ Q;  3CRL C;  2VQE L;  3J81 E;  4LF8 L;  3S1Q H;  4R4C A;  1M90 C;  4CDD C;  2NN6 G;  3HOU H;  4LFB Q;  3D3R A;  1E2V A;  5M3M B;  3CQZ H;  1SYB A;  1Q1E A;  1UAP A;  2DUD A;  1EIF A;  2N78 A;  3HOY B;  2HIX A;  4RMF A;  1JWM D;  4B9W A;  1SJH D;  4Y7N H;  1ICF B;  4NPS A;  4HID A;  3BZK A;  2FIN B;  5LL6 S;  1VQE A;  3S1R B;  2QEX A;  2WV6 D;  4IUR A;  4R4I A;  3CPF A;  5ELB A;  1XMO L;  2PI2 E;  3SDZ A;  2YTV A;  1YIT A;  2RHQ B;  1GO3 E;  4IUP A;  1AE3 A;  1CSQ A;  1PXU A;  1Z47 A;  4F88 A;  1BBU A;  4DR1 Q;  1D2B A;  1GJX A;  4JI7 Q;  1ZXT A;  4HJ5 A;  4N8X 1;  1PYB A;  2L9H A;  4DK0 A;  3MC0 B;  1V1O A;  3I55 A;  1Q81 C;  4DV3 Q;  1KNE A;  4OO1 H;  4GLX A;  2PYK A;  1STE A;  2WAQ E;  1TVX A;  3HOW H;  2NWG A;  3KJO A;  1KXL A;  3I8Z A;  3PQI A;  3G6E A;  1CZW A;  2SEB D;  1QE6 A;  3OIQ A;  4YCW A;  1U4P A;  3WOE A;  1HNX Q;  1N33 L;  3SE0 A;  2B39 A;  3A7L A;  1A6X A;  1B9N A;  1F2Z A;  2K7V A;  3CME A;  1QB5 D;  3RD4 A;  1GHK A;  4JOI C;  2E2H B;  4A93 G;  5KNC A;  3I4M B;  3Q0A A;  2RBM A;  1OXX K;  4A3K G;  2ZTC A;  1EFI D;  1WTH A;  2QDB A;  1PH6 A;  4UY8 C;  1YJN A;  3FPU B;  3NBI A;  1LTI D;  2B2W C;  1Q1B A;  3TZU A;  1PH3 A;  1Z9F A;  1G29 1;  3UDI A;  4L5R C;  1VQJ A;  5IOC A;  5M3M H;  1SXT A;  2KEC A;  1DOL A;  3CU7 A;  1S40 A;  3MHB A;  1GKH A;  3I4N G;  4GKK L;  3PSI A;  4TVA B;  5C4J H;  2M9V A;  1XTC D;  3KK7 A;  1SLJ A;  2R61 A;  4IPG A;  1DGS A;  2R7Z H;  4KTA A;  1E1T A;  5IP9 H;  2KHS A;  3BZC A;  3Q6S A;  1N36 L;  1TWA B;  2FJ2 A;  5FO7 B;  4A3C G;  1MGS A;  4A3B B;  3EVQ A;  4UP7 A;  3E9H A;  4OEM B;  4GS3 A;  1X3P A;  3CF5 A;  5DEH A;  3ERS X;  4HMJ A;  2RCN A;  1ET6 A;  1Q3L A;  5FJ8 G;  4DAY A;  1IYJ B;  4LF7 L;  1GD7 A;  2NVQ H;  3FDT A;  1ROD A;  2EPB A;  3K0Y A;  3RLF A;  1KAB A;  2H5X A;  1II3 A;  4O2D A;  4YWL A;  3KFU A;  3FP9 A;  4DR5 L;  1SFO B;  2AUJ D;  2NVX H;  4DR3 Q;  4X64 L;  1IW7 D;  3D6W A;  4JOI A;  4GNX A;  3URY A;  4DV6 L;  1IW7 C;  3TDQ A;  3J81 i;  1SN8 A;  2IHE A;  2YTY A;  2E2J B;  2JA6 B;  1MKH A;  3DWA A;  4DAY B;  2E2H H;  4C3J B;  4R1J A;  5IOD A;  4A75 A;  2EZV A;  3E5S A;  3CP0 A;  4OWW B;  1HA5 A;  3I70 A;  3H6M A;  1VQF A;  2NZ1 D;  1S3O A;  3I90 A;  2MP1 A;  2L55 A;  1NSN S;  2GVB A;  4ZK9 B;  1Y1V H;  2J0T D;  3HOX G;  4JK1 C;  4EQ5 A;  1TII D;  1XX8 A;  2F0I A;  3MXU A;  4TKO B;  4JI6 L;  2K01 A;  2KEN A;  4LK1 C;  1N8R C;  1EYD A;  4WJW A;  4IAL A;  2HQE A;  1STB A;  1I6H B;  2F0J A;  2AQ3 B;  1QIL A;  2FHT A;  3J80 E;  4K5X A;  2PQA A;  3TP7 A;  2EXD A;  1QVG A;  1BR9 A;  1PHJ A;  1ENC A;  4ULL A;  2JA9 A;  1Q12 A;  1TWA H;  2FFK B;  2K50 A;  1GUW A;  4KK7 A;  1BF4 A;  4A3B H;  1EYG A;  4FXK C;  5ELF A;  4DK6 C;  4AYB G;  1SYC A;  1HNX L;  2PZU A;  4YCU A;  4GOP C;  2G5D A;  1YHQ A;  1Q8I A;  3MTS A;  2I07 B;  1JQY D;  4YIJ A;  2BOS A;  4B08 A;  3PUX A;  1H9S B;  1SE2 A;  3SGI A;  5GAG C;  3A74 A;  3KJP A;  1JJG A;  2EE1 A;  2NZO A;  1RD9 D;  1SFO H;  1SEB D;  1LTS D;  5C3E B;  1ONL A;  4KN7 C;  1W6J A;  3WDN A;  1BO0 A;  4A3K B;  2IT1 A;  4QIW B;  2Z1C A;  1K8G A;  5IWA Q;  3W5O A;  2QKI C;  4DR7 Q;  1PFN A;  1C9O A;  4A3M H;  2R92 B;  5IGF A;  2E2J H;  1X3F A;  4A3D G;  1GXD C;  1IKL A;  2E75 C;  2NN6 H;  3D4D A;  4OO1 I;  3K5M A;  5ELD A;  2SNS A;  3H09 A;  3A8K E;  4JBJ A;  3P75 A;  2CKZ B;  3BVM A;  5JJK A;  1NBW A;  2PCF B;  3I4L A;  1UEB A;  2JEA I;  4A3F B;  4K8J A;  3NK9 A;  5GAH C;  4LMQ D;  3M7G A;  2F0M A;  1EIG A;  5JJZ A;  3K5L A;  2WFW A;  3FVQ A;  1ESR A;  3TP8 A;  4IPC A;  2EXZ A;  2Y0S E;  2EYH A;  1A3V A;  2F0P A;  3VYT A;  2F0E A;  2EQS A;  5CV7 A;  1F9Q A;  4DV7 Q;  1JCK B;  4XXE A;  3GTJ H;  1HFN A;  3NQI A;  2EJM A;  1A63 A;  5AJ3 Q;  3DM1 A;  1K3B C;  1HA6 A;  5JPN C;  4HTH A;  2Q8T A;  2ZTD A;  4KN4 C;  3HKZ G;  1I4P A;  4G7Z C;  1Q82 C;  3I56 A;  1VQB A;  2IPK D;  2K1B A;  1WTR A;  4K6L A;  5FO8 B;  1STG A;  5FLX L;  4R8N A;  3D4R A;  2HHH Q;  4EGV A;  4GOP B;  4A93 H;  3MEH A;  4A3K H;  2KQ3 A;  2A74 C;  3S14 H;  5G3L F;  2XSC A;  3G4S A;  4F8M A;  1EY9 A;  4HJ8 A;  1SMX A;  4OWT B;  2MGS A;  1QCB D;  3VDY A;  3KBX A;  3P1H A;  3T56 B;  4XTC S;  3HOX B;  2F4I A;  4A4I A;  1TWF B;  4ZKC B;  1BCP D;  2LKV A;  1S5C D;  3I4N H;  3VR6 A;  1JOO A;  1RIP A;  5M5Y B;  1CA5 A;  1HR0 L;  1IZ6 A;  3M4P A;  2BE5 D;  4RFB A;  4DR6 Q;  3ULL A;  1KLU D;  3J80 i;  1VQ4 A;  1VF5 C;  1ENF A;  2BE5 C;  4KJO A;  1AW7 A;  1SYD A;  4L5T A;  5FOB B;  1H9R A;  4JI8 L;  4H02 A;  2D2C C;  2Z8L A;  4DR2 L;  2NZH A;  4IJH A;  3K59 A;  3NWS A;  1YZ6 A;  1HQR D;  2B2Y A;  1PZK D;  2B63 G;  2JQO A;  1N34 Q;  2CCZ A;  1BDO A;  1F77 A;  2QDL A;  1PH8 A;  4LF9 Q;  3ND8 A;  1Y69 U;  4MNO A;  1ML0 D;  5E4X A;  1HUN A;  3S16 H;  1HNW Q;  3M4Y A;  1A2U A;  1EY8 A;  1S5E D;  1U4R A;  1F9S A;  3ITP A;  4CDC C;  4DAV A;  2OTL A;  4NXM L;  3KLW A;  1STH A;  1ENA A;  4DR4 L;  3HOX H;  3A8J E;  3K5N A;  3NPP A;  1N9W A;  1KLG D;  5J1Z A;  5KIX A;  1QWY A;  3T1Y Q;  5EQ0 A;  1Y14 B;  5FLM G;  4K6D A;  4IOA A;  3NEL A;  1RJT A;  3D4W A;  4H7B A;  4LF6 Q;  1FNU A;  5GAE C;  4G7H C;  1Q86 C;  4DV7 L;  1IBM Q;  3T13 A;  1RHP A;  3I73 A;  2SNM A;  4LUZ A;  2K33 A;  2NN6 I;  1YNJ D;  2BA0 A;  2K5V A;  1BCP B;  1YNJ C;  2XN9 C;  1B3A A;  3E9I A;  1YHB A;  5JOB A;  4DUY Q;  4BA1 I;  2F4V L;  2EY1 A;  4JI2 Q;  1EEF D;  4OON A;  2RSN A;  1SYE A;  3G48 A;  3JAM c;  3A55 A;  3HKZ B;  4KKT A;  3H15 A;  3M4O B;  4NW2 A;  2MO1 A;  2MO0 A;  1EYA A;  3NEM A;  4C56 C;  4IUU A;  1LTR D;  2CQA A;  2GVA A;  2K6A A;  4XIG S;  3PO3 G;  3BYT B;  1EWC A;  1F2Y A;  3A54 A;  4B3S Q;  3AB9 A;  3BYY B;  4A3D H;  3S15 B;  4RHS A;  4S3S A;  1W6K A;  3DM3 A;  1I4R A;  4BXX G;  3I91 A;  2JYO A;  1JOR A;  1C4Q A;  2F3V A;  2X69 A;  4V19 0;  1PV4 A;  2O5I C;  1Q7Y C;  3CKI B;  2N3S A;  1GM5 A;  2D9U A;  1JJ2 A;  3H3V I;  1K8A C;  5CV8 A;  5M9O A;  1ILP A;  1VQD A;  3LWE A;  3C3L A;  4FYD A;  1EY4 A;  1LAB A;  2KA7 A;  3EN2 A;  4DA2 A;  5LMU L;  1SE8 A;  1X3E A;  2JA5 B;  5IYC G;  2ICI A;  3CRK C;  3BZD B;  3C1E A;  2ATW A;  1DD2 A;  1MD2 D;  3BDC A;  1S4Z A;  3OMC A;  1C7Y A;  3TS0 A;  3M7N A;  4LF9 L;  2ZXO A;  4DAM A;  2IW3 A;  1PVO A;  2IHF A;  3I2Z A;  1G8Z D;  1KDB A;  1QNU A;  3VR5 A;  2B63 B;  5FO9 B;  1VQ9 A;  2K5Q A;  3HP3 A;  2D62 A;  4BA2 I;  3GD7 A;  3G7L A;  2OTJ A;  1LTT D;  2UUA L;  4BS9 A;  4HIO A;  4UP9 A;  4MTN A;  4A3J G;  3UDF A;  4K2K A;  3UDX A;  4NB3 A;  3M4O H;  1LTL A;  1BXT A;  5C3W A;  5C5L A;  2EJG C;  3PIP 3;  1LT5 D;  1SSO A;  1KIX A;  1ESF A;  1N32 Q;  5C5M A;  1U9R A;  2UXD L;  4POG A;  4Q0F A;  4JPB W;  3R8B A;  3VA7 A;  1AH9 A;  1BVS A;  1FNV A;  2K5W A;  1DXM A;  4N9P A;  4IUN A;  1D7Q A;  2VXW A;  1SMY D;  2KEE A;  5NUC A;  4JI1 Q;  3J81 c;  4OX9 Q;  3GTL B;  1UE6 A;  4PNY A;  5CV4 A;  5DLQ E;  4JI0 Q;  4KLK A;  5C6A A;  4KJN A;  3CCL A;  2LSS A;  3HOV G;  3H0G B;  2MNA A;  2Q8I B;  1B7Y B;  2R6G A;  2LY7 A;  4HJ9 A;  2V4D A;  4NP5 A;  2B3G A;  3SK8 A;  5I6Y A;  5GRO A;  4JI5 L;  3ZJY C;  1PTO F;  1JT8 A;  5KYI A;  1A8V A;  3NXW A;  2B63 H;  2A8V A;  1PYS B;  3PUV A;  1XTD A;  2H1E A;  3RR5 A;  3K7A B;  1CFM A;  2UXB Q;  1DM0 B;  5D14 A;  1O7Z A;  5LMN L;  1EFW A;  5ELC A;  4CKB A;  3OW7 A;  2VB3 X;  4JI3 L;  1MI2 A;  5C4X G;  3CCJ A;  1D1K A;  4KD4 A;  3DLL A;  4YWM A;  1ASY A;  1HTL D;  5FKA C;  1GUT A;  3OWF A;  2RDF A;  2F0D A;  3MFG A;  5M5W H;  4R4O A;  2HD3 A;  2CWA A;  2D5D A;  1PFM A;  3HOW B;  4DAP A;  1EOV A;  3BDO A;  4LFC L;  1MIU A;  1V8Q A;  3RZD H;  4MN3 A;  4DN4 M;  5KGU A;  2E5L L;  1PZJ D;  2WB1 G;  4DV4 Q;  4LFA Q;  1Y1W G;  4PQX A;  2XVS A;  1VQM A;  3HG9 A;  2L11 A;  3MEF A;  4IUT A;  1B3Q A;  3R3O A;  1X65 A;  4YY3 Q;  1L1O A;  5FLM H;  1J5E Q;  4TQU S;  4YCV A;  4DKA C;  1O7I A;  5IIF A;  3H0G H;  2WB1 E;  1L0W A;  3CC4 A;  3VA5 A;  1XNR L;  3M85 A;  3L9A X;  4ZLT F;  4BY7 G;  2EY6 A;  1WJJ A;  1G51 A;  2JSO A;  4QF4 A;  5IT9 L;  1PH4 A;  2F0K A;  1XNQ Q;  2Z4H A;  5C4J B;  3OOC A;  2Q2I A;  5H1S E;  5E1F A;  3EIV A;  3QOL A;  2R7Z B;  2F0Q A;  4L5Q A;  4DV5 L;  1TY0 A;  5IGD A;  5EKK A;  2CQO A;  1CUK A;  4WOR A;  4A3J B;  4RCO A;  4CBV A;  1P8L A;  2NTT A;  1D8L A;  3K7A H;  4YWK A;  3OMG A;  3DXJ C;  3MXP A;  3FMC A;  3TBI B;  1XPO A;  3D0F A;  2N55 A;  2WAQ G;  3CC7 A;  5IYD H;  4JYA L;  3BJU A;  4FDB A;  3VYR A;  2F1M A;  3PO3 H;  1SNM A;  1R4Q B;  4FXD A;  4JW0 A;  1P16 A;  2NVQ B;  1K73 C;  2Q8R E;  5G3L D;  3FKI G;  2OQK A;  1RF2 D;  4BXX H;  2EYJ A;  1OTC A;  1LTA D;  2KCT A;  3HGB A;  3NQT A;  1TS5 A;  4X3S A;  1K9M C;  1HNZ Q;  3PMF A;  2NVX B;  1EU3 A;  3F1Z A;  4OXP A;  1IYV A;  4B3M Q;  1HRJ A;  2I0Q A;  2EJF C;  1EOT A;  4GNX C;  3N52 A;  5ISR A;  2R93 G;  2EYM A;  4RGO S;  1X54 A;  4BBS G;  1WFQ A;  2JN4 A;  1T5E A;  1X3G A;  4OIK A;  5IYC H;  2A68 D;  2N49 A;  2ZJP A;  2I5H A;  4PZ7 A;  2JEB I;  3S2D H;  1Y1V B;  2A68 C;  1OXV A;  1YJW A;  5JPM C;  4CJ0 B;  1GHJ A;  2DJG C;  2QF7 A;  2IL8 A;  3GO5 A;  5IP7 G;  1HPC A;  3O13 A;  4E6I A;  1MSG A;  4OGQ C;  4CKE A;  4B3R L;  3CCU A;  5K36 G;  4DNR B;  3J80 c;  3VYU A;  1EU4 A;  5BN5 A;  1EQT A;  2RDH A;  1EY0 A;  2JA7 G;  4LUV A;  2RHS B;  1FR3 A;  5C4X B;  4A3J H;  3H3V C;  4YHH L;  4K0K Q;  2WP8 J;  4OIJ A;  4LF5 Q;  1IBK L;  4JI4 L;  1I4G A;  4H0L C;  3T4A C;  3A8I E;  4QIW E;  3SR1 A;  1EY6 A;  1GVP A;  1TR5 A;  1ET9 A;  2O2L D;  5FLX E;  2G9D A;  1QZG A;  1IHZ A;  4PMC A;  3J7A F;  4ZUJ A;  2QA4 A;  4OHJ A;  2PI2 A;  4JV5 Q;  1Q8K A;  4DUZ L;  4TRD A;  2HUG A;  1NR4 A;  3MXN A;  1Y1W B;  1AFP A;  2E74 C;  4LFB L;  2UUB Q;  3J81 j;  3TN2 A;  4R9W A;  3AYH B;  1H9J A;  4A3M B;  4KHV A;  4XT3 B;  4HJA A;  1BBW A;  1QG7 A;  1J8I A;  1HTP A;  4EQO A;  1HZ9 A;  2ZM6 Q;  3IFT A;  5BN3 A;  2PMZ B;  3R93 A;  3SK6 A;  1SRU A;  1NJI C;  4QY7 A;  1O7Y A;  1R4P B;  2DNC A;  2PZW A;  3QWN A;  4ZCK A;  2F0V A;  1X32 A;  4Z9C B;  2VZA A;  3IL8 A;  4GNX B;  4DR1 L;  1JB7 A;  1SNQ A;  3OTO Q;  1KD1 C;  4JI7 L;  2OQ0 A;  3CD6 A;  1TKW B;  4B3T Q;  3MAQ A;  1SE4 A;  3T51 B;  3CC2 A;  1RTO A;  4WRD A;  4A3E G;  1GOZ A;  2YV5 A;  3ULP A;  1AZQ A;  4DV3 L;  3A7A B;  1WOC A;  2NUC A;  5C4X H;  3LNN A;  3SHL A;  1SNO A;  3E0J A;  3FKI B;  3GTJ B;  2HDM A;  2PW7 A;  4AQY Q;  5ELO A;  2QGQ A;  1YIJ A;  1GUN A;  2C35 B;  1E2W A;  4I65 A;  3U4Z A;  1B53 A;  5A2Q L;  1JOK A;  1XPR A;  2FMM A;  4GKJ Q;  3ONA B;  2K04 A;  4DV2 Q;  3CXC A;  2PQA B;  3AFQ A;  2F52 A;  2L4N A;  2LMC B;  1Y1W H;  5C3X A;  5T1I A;  4JG2 A;  4A93 B;  2R93 B;  2Q2T A;  4QB4 A;  2F0U A;  4XQJ A;  3S14 B;  3T53 B;  1JE5 A;  2HCC A;  4IOC A;  2RSO A;  2VUM G;  1PFB A;  1ZYR D;  1V43 A;  4K8I A;  1FNW A;  3WWV A;  2E2D C;  2A19 A;  4KHZ A;  4QJF A;  3KLS X;  1LT3 D;  4HMI A;  2C5C A;  3I4N B;  2I5M X;  2IY5 B;  4XQN A;  3PCO B;  2PNR C;  4G4K A;  2JA7 B;  1PYW D;  1SAP A;  1V1P A;  4X66 Q;  2Y0S G;  1MJE A;  3TSS A;  5C4H A;  4C3H G;  2MHV A;  1WCM G;  3S2H B;  1X55 A;  3TQY A;  1WYD A;  2L15 A;  2XWJ B;  3LX0 A;  3U4V A;  1FJG Q;  4GN4 B;  3DUZ A;  4DXG A;  2RDG A;  5IGC A;  1RTN A;  1L0X B;  3KDF A;  2AWO A;  1S72 A;  3PIO A;  1G2S A;  2NYZ D;  5C0X J;  4DR3 L;  1HFG A;  4RH6 A;  4X6A H;  1CKM A;  3KLS A;  3FKI H;  1NAP A;  2B2Y C;  2X6G A;  3FEW X;  1SYG A;  1YNX A;  1BBX C;  1U4L A;  4IUV A;  2LXJ A;  5C44 G;  4QL5 A;  5KND A;  2BA1 A;  1TT2 A;  1STN A;  2OF1 A;  1VF7 A;  3H3V H;  1I6V C;  5ELN A;  1HUM A;  3S16 B;  1EZ8 A;  1KNA A;  3KDF B;  4APV A;  4RHR A;  2KJX A;  5JVH 3;  5EBC A;  1M1K C;  1JR0 D;  5CGK A;  4FXG C;  2R93 H;  4KHP Q;  3JC6 6;  4WJ4 A;  2IX1 A;  2HT1 A;  1YI2 A;  3V2T A;  4BBS H;  2I5L X;  4IUQ A;  3RLO A;  2CFM A;  2XRS D;  3QG1 A;  1VQN A;  1YJ9 A;  1QVC A;  1XPU A;  4A3I G;  1ASZ A;  3TZD A;  2GA4 B;  1D5Z C;  2UXC Q;  1B44 D;  1HZC A;  3CCE A;  1NUC A;  3L3O C;  5CR3 A;  1PTO D;  1BCP C;  5IP7 H;  3HEJ A;  1I5F A;  1SJE D;  3UDG A;  3K80 C;  5K36 H;  1D5X C;  1SE3 A;  2NVY B;  4IJL A;  2JA7 H;  5AFW A;  1LV9 A;  4RKL A;  1IBL Q;  1KTK A;  4X62 Q;  1XJV A;  3ERQ A;  1XMQ Q;  3HOZ G;  5I2Y A;  3RZO B;  5KYL A;  3S2H H;  4A3C H;  1LT6 D;  1KL9 A;  3B6Y A;  4KKU A;  1VCI A;  4AYB B;  1I4H A;  3RN2 A;  2K52 A;  3NWT A;  3K57 A;  4DPG A;  1DZ1 A;  2L1B A;  4ODG A;  1AE2 A;  5FJ8 H;  1TQO A;  4XYQ A;  1B8A A;  1SND A;  2KUM A;  1CA6 A;  1V1Q A;  4ME5 A;  5EBD A;  1HXY D;  3BDL A;  5IWA L;  4EQP A;  4DR7 L;  5JEA J;  4HIM A;  4DNI A;  2SDF A;  1PRT F;  2N8N A;  3ZYY X;  4P74 A;  2JXM B;  4RKB A;  2EOT A;  4ZYS A;  4NXN Q;  4A3D B;  4KMU C;  1K0S A;  4KY7 A;  2B2T C;  2UU9 Q;  1BUV T;  2B2U A;  1LT4 D;  3KF8 A;  2NVT B;  3BG3 A;  2PPB C;  2OEO A;  2QW7 A;  3SK5 A;  4HCE A;  4QMG A;  5EJW A;  3GTG B;  3A56 A;  1EEI D;  4KKS A;  4QCL A;  1B9M A;  1O80 A;  2Y0S B;  3TP6 A;  4BWG B;  1XWE A;  2OWO A;  1JIC A;  1WCM B;  4A3E H;  2CH4 A;  2NVY H;  3KF8 B;  3GTP H;  3SEB A;  5TSS A;  2AQ1 B;  1EYC A;  3RZO H;  1EY7 A;  5AJ3 L;  5I6W A;  2G9H D;  5BR8 Q;  1PA6 A;  1SR3 A;  5CMD A;  4BBR G;  4WJ3 M;  3GV6 A;  1PTO B;  1X9N A;  2F0L A;  4HSP A;  5HGT A;  3KBG A;  3OWE B;  1QNK A;  2HHH L;  3FPP A;  5EAY A;  1SDF A;  2BDN A;  3OW2 A;  2X6L A;  2EYF A;  3HOU G;  3R2I A;  1TWG H;  1TY2 A;  1ZEQ X;  2WII B;  4R4Q A;  3K7U C;  5KRU A;  2XTI A;  3UE0 A;  2B2T A;  2PQE A;  2ZXR A;  1MHW C;  3NTK A;  2AQ2 B;  1S5B D;  4JBK A;  3K6O A;  1K0R A;  2N88 A;  1NMG A;  5E7N A;  2J4X A;  3PUY A;  2F0F A;  3L0O A;  4HED A;  4MTK A;  4AH6 A;  2B2V A;  2SOB A;  4DR6 L;  3G6J B;  2NVT H;  2DGY A;  4X65 Q;  3GTO B;  1B50 A;  3GTG H;  5IT9 E;  4H13 C;  1UE1 A;  1R9T H;  3PF5 A;  1VQ6 A;  1F2L A;  3QR8 A;  1K83 B;  2F0W A;  1EIY B;  4DV1 Q;  4C3H H;  1N34 L;  3RN5 A;  1WCM H;  3DWQ A;  3CCS A;  1FGB D;  3U58 A;  2K28 A;  1KDC A;  3QOJ A;  5CYU A;  3T16 A;  5M3F G;  4JVZ A;  4ILW A;  3MA2 B;  2K4K A;  1TWH B;  2IX3 A;  4FF4 A;  2LXK A;  3BS1 A;  1BOS A;  1U5K A;  1PTO H;  5CC4 A;  1HNW L;  4OWX B;  1WD0 A;  3CCM A;  4DK3 C;  3QJY A;  1HQM C;  1JB3 A;  5C44 H;  4LF4 Q;  2XIW A;  1KAW A;  2I46 A;  1KRT A;  5I2X A;  1O7L A;  2PO4 A;  3HKS A;  1LAC A;  5M5W B;  3HOY G;  4UP8 A;  2VQE Q;  1JWS D;  5KEE A;  4LF8 Q;  4O0A A;  4UPA A;  3WOF A;  1HHV A;  5EPK A;  1T5X D;  3T1Y L;  5IYB G;  1EQV A;  4KY6 A;  3RZD B;  4A3I H;  4LF6 L;  1H9M A;  3S17 B;  2VNU D;  2ZT9 C;  5C0X I;  1IBM L;  1QUQ A;  4LW1 A;  3GTO H;  1WVL A;  2MUY A;  2CW0 D;  5D3D A;  1FYC A;  1XMO Q;  3EFX D;  1GUG A;  1SMY C;  5BR8 L;  3F2C A;  5IGB A;  1A3U A;  1L2F A;  1GUO A;  1D6E C;  4FO2 A;  1L1O C;  1QJO A;  1VDZ A;  2F3W A;  2JK8 A;  2F03 A;  1KQS A;  3DEP A;  5EGT A;  3S24 A;  1WTP A;  1K83 H;  5D65 A;  3SVM A;  2K05 A;  5LL6 X;  3HOZ H;  1EY5 A;  3A5Z B;  4GN5 A;  5CV6 A;  4DUY L;  4JI2 L;  1TS4 A;  1OO9 B;  1X56 A;  1YBY A;  1DOK A;  1IKM A;  2ZXP A;  3A0J A;  3N6R A;  4DGZ A;  5K5P A;  3J7Y W;  4F87 A;  1VQH A;  3CAM A;  2DY7 A;  5E3F A;  2CH4 W;  1B4O A;  3LGJ A;  4P2C B;  1TWH H;  3NE5 B;  3D6C A;  3A5U A;  4PZ8 A;  5JVG 3;  3I4M G;  4B3S L;  4IFD G;  1N33 Q;  3G71 A;  1DON A;  2IWH A;  3U50 C;  4A3L G;  2R7F A;  3PO2 G;  3NTI A;  4JBM A;  3PO3 B;  2HDL A;  1HZA A;  1EZ6 A;  1YEZ A;  3MWY W;  1IL8 A;  3CMA A;  1WTQ A;  3ERO A;  1VQ7 A;  2ZJQ A;  1NMF A;  3SK4 A;  1TS3 A;  4P73 A;  3PV0 A;  2EVB A;  1VS0 A;  5I9P A;  2WIN B;  3GP7 A;  3LWU A;  1VQL A;  4UAI A;  2KVM A;  2LS0 1;  3AMU A;  1CQV A;  1I4Q A;  3S17 H;  4GKK Q;  5D3I B;  1E7Z A;  1F2M A;  3FRP B;  4X3K A;  3E6Z X;  3QB3 A;  4A3B G;  2KCM A;  4J6H A;  1FL0 A;  4HN7 A;  1WTX A;  3IAY A;  1YNN D;  3EBE A;  5IGG A;  1HZB A;  4M1U B;  4QUF A;  1YNN C;  1CTM A;  1G6Z A;  1LM0 A;  1N36 Q;  2IX0 A;  2KBN A;  1DJR D;  2F0O A;  3S2D B;  3TEH B;  3S1M H;  2DY8 A;  5EPL A;  3NHH A;  1YVC A;  3NTH A;  3J7A 5;  1K8O A;  1UNS A;  4M8A A;  5M3F B;  4K2L A;  4LUO A;  1CSP A;  3J7A V;  4DF7 A;  5CBE E;  4BBR H;  4LF7 Q;  3GDE A;  3QO2 A;  2VL6 A;  2EYL A;  3TME A;  1L1O B;  1FD7 D;  4DR5 Q;  2K75 A;  2JA6 G;  3I4O A;  4GLV B;  1SRO A;  1FVI A;  4C3J G;  1O78 A;  4X64 Q;  5A2Q E;  2R3Z A;  4I7Z C;  2K5H A;  3K8A A;  4DV6 Q;  1N32 L;  5FLX c;  4FF3 A;  3CPW A;  1DYQ A;  4MHE A;  3ICE A;  1F9R A;  3X3M A;  4ZRZ A;  1OXS C;  2Z6K A;  1E0B A;  4GN3 B;  4JI1 L;  2PMZ E;  4OX9 L;  4JI0 L;  4CJ2 C;  3KYH C;  4LWC A;  5LMN W;  3NUC A;  2GN5 A;  2MPM A;  3JAM i;  3TS2 A;  2DJF C;  2VW9 A;  4DXF A;  4KD3 A;  4DK1 A;  1JJC B;  4JI6 Q;  3M3Y B;  2BDO A;  3E0E A;  1E3P A;  4PMB A;  4RWS C;  1HJP A;  3AQQ A;  3HOV B;  3PF4 A;  1XYI A;  4L5S A;  2VS1 A;  3NBH A;  3OHX C;  3KLR A;  3IRB A;  1KAA A;  3RMH A;  1E22 A;  1DOM A;  5DAU A;  3JAM L;  1RKN A;  4BY1 G;  3HRZ C;  2UXB L;  1TXY A;  5M3F H;  4IFD J;  1JWU D;  5C3E G;  2E2I B;  4K5V A;  2F0H A;  2KCN A;  3NBH B;  1AP0 A;  2R92 G;  3PO2 B;  1UEA B;  3EQL C;  1PRT D;  2WKD A;  5L37 A;  3TRZ A;  1PRT C;  1S5F D;  5I9O A;  2AWN A;  2ZTE A;  2D0P A;  5COR A;  5JAV A;  3HOY H;  4DV0 Q;  2K5N A;  1X3Q A;  4ABN A;  4DV4 L;  4LFA L;  2ICE C;  5FK9 C;  3VYS A;  4HIK A;  1NTG A;  2EY5 A;  5M5X B;  4C1N I;  1PH2 A;  3AU7 A;  3S1R H;  5IYB H;  3GQB A;  5LHY 1;  1Q46 A;  3D31 A;  4YY3 L;  4XQQ A;  1J5E L;  4FNF A;  3DHQ A;  5C0X G;  1Q90 A;  4MZ9 A;  3IFD A;  4A3F G;  1U4M A;  2WB1 B;  2ZJR A;  2WAC A;  5EPJ A;  3IKJ A;  1TWC B;  3KUP A;  1M4V A;  1H9K A;  1I3Q B;  3M3Y H;  5EKI A;  1CK1 A;  2A73 B;  3HOV H;  1XNQ L;  2NTS A;  4HSV A;  1S5D D;  3BVZ A;  1KC8 C;  1EQR A;  4PG3 A;  2QIL A;  4BY7 B;  3PUW A;  3M9B A;  4HR7 B;  1CI3 M;  3PUZ A;  1LTG D;  1NNX A;  3KOJ A;  3MXN B;  3H94 A;  1LO5 D;  2Q2U A;  2VQF Q;  4RGN A;  1A2T A;  1VMP A;  2XNA C;  1ZKO A;  2E2I H;  1IYU A;  2B2W A;  3I4M H;  3U9S A;  3P20 A;  2CWP A;  1Y8O B;  4DU9 A;  4IFD H;  1YHA A;  1WD1 A;  1CT1 D;  2PW5 A;  2WAQ B;  3NEN A;  3CW2 C;  4A3L H;  4Y52 H;  3PO2 H;  5A35 A;  3HZX A;  4FF2 A;  1HNZ L;  1PH5 A;  3GV3 A;  2FXQ A;  1IXR A;  3TP5 A;  3F8T A;  2ASB A;  2QEJ C;  3J81 L;  4B3M L;  3EA6 A;  4CDF C;  5M5X H;  1H9S A;  3T1H Q;  2JA8 G;  1LUZ A;  1CM9 A;  1PRT B;  2OXP A;  4J15 A;  4KI0 A;  4IQZ A;  4FP5 D;  1HH2 P;  5ELE A;  3GTK B;  1HR0 Q;  1V9P A;  4ZQ3 A;  4RG1 A;  5HY6 A;  5JEA G;  3GTQ B;  2A6H D;  1TWC H;  1STY A;  4BBS B;  2A6H C;  2JP1 A;  1I3Q H;  1Y8N B;  1CHQ D;  2TMP A;  4JI8 Q;  1ZYR C;  4LJZ C;  4BY1 B;  2AUK A;  3X3N A;  3E3X A;  4DR2 Q;  4BY7 H;  4AYB E;  2BH8 A;  2HQL A;  1E1O A;  1G6P A;  2H4O A;  4C2M B;  2A1A A;  2K32 A;  4K0K L;  2LFN A;  4LF5 L;  2K14 A;  1EIH A;  1PH7 A;  1VQP A;  2M2L A;  4EQN A;  4DV0 L;  4QGU A;  4X3U A;  1H95 A;  2JA6 H;  2F3I A;  2K03 A;  2L0C A;  3I72 A;  2QCP X;  3HS0 C;  4C3J H;  4EVO A;  1EUJ A;  3PGZ A;  4XYO A;  5IY0 A;  4JV5 L;  1VMC A;  4P75 A;  1LYL A;  1C48 A;  5DNF A;  1A62 A;  1EQQ A;  4IZ8 A;  2UUB L;  4NXM Q;  1LTB D;  3W1B A;  3PIO 3;  2PNH A;  4DFA A;  3ND9 A;  3NSW A;  3F2B A;  4DR4 Q;  1V1P B;  3MVV A;  1WTV A;  1SNP A;  4V0B A;  1AN8 A;  2ZM6 L;  1EWI A;  3CCR A;  3ULJ A;  4IPD A;  1I6H H;  1NE3 A;  4I7A A;  4OEL B;  3S9W A;  2F0N A;  2XRQ D;  1IL2 A;  4PZ6 A;  4GOP A;  3GTK H;  3ER0 A;  2AKW B;  1UE5 A;  2HIV A;  3GTQ H;  5J3B A;  3RNU A;  4POF A;  2VQF L;  2A5H A;  3U9O A; 
#chains in the Genus database with same CATH homology
 5F2D A;  2B2U C;  4Q5V A;  1BQQ T;  4K5W A;  1RDP D;  1K8M A;  3DMU A;  4KY5 A;  2MJ8 A;  4J8Q A;  2O5J C;  4IN3 A;  1PDQ A;  1PTO C;  1TU2 B;  2VB2 X;  4K14 A;  4A3E B;  4NDX A;  2DN8 A;  3GTP B;  3RUZ A;  1JOQ A;  4WFN 3;  4QUC A;  2F0S A;  4PV1 C;  1WTO A;  3VR2 A;  2OT2 A;  1UUP A;  1SYF A;  2RA4 A;  1KDA A;  2M00 A;  1A3T A;  3L7Z C;  5E4W C;  1C8C A;  2JA8 B;  4NMZ A;  1TWG B;  1JC7 A;  4TSS A;  4L63 B;  5C0X H;  4C3I G;  3MXG A;  3UI2 A;  4IFD I;  4OL7 A;  3OSO A;  5EKL A;  3K5O A;  3Q22 A;  4L6T B;  2VUM B;  2PZT A;  2WKC A;  2RVL A;  4RA8 A;  2HCI A;  4HAE A;  2J7Z A;  3J80 L;  3F2U A;  4F7X A;  3K58 A;  3H91 A;  2B2V C;  3V05 A;  2YYZ A;  5DM7 3;  1G2T A;  1R9T B;  1GUS A;  4CKC A;  4C3H B;  5T1G A;  5C4Z A;  1D5M C;  1I4X A;  1MBY A;  2E76 C;  1LLR D;  4O42 A;  2KCC A;  4G7O C;  4FF1 A;  1F9P A;  2CVR A;  2KOL A;  2ENB A;  5C44 B;  1SBB B;  4XDX A;  1MSH A;  4UDU C;  4LAA A;  5JEA H;  1RCV D;  1HCZ A;  2F0T A;  4JBW A;  3CHB D;  4A3I B;  2JE6 I;  4CGY B;  4G57 A;  2NBF A;  3Q23 A;  2YU9 B;  4H44 C;  4GZY C;  2Z4I A;  3R2T A;  4HCS A;  1QOH A;  1PMR A;  3W3A A;  2B8F A;  5CBA E;  3NP8 A;  3HOZ B;  4OO1 G;  2BCO A;  3C46 A;  3MFY A;  1TS2 A;  1EWH A;  4KV6 A;  4R8I A;  2O4X A;  2DNE A;  3C2P A;  1Z6H A;  2K5D A;  3EJI A;  1J9O A;  3VR4 A;  1D1I A;  4C3I B;  2EY2 A;  4NKL A;  4J1M A;  4ZUI A;  4C1N K;  2A6E D;  4XT1 B;  1ILQ A;  1NCV A;  4RAU C;  5J39 A;  1OXT A;  2A6E C;  1B1Z A;  1Y8P B;  2EYO A;  3DEO A;  3Q24 A;  1AZP A;  4DNT B;  1I50 B;  1PZI D;  4N9T A;  1B2T A;  4O1N A;  1NR2 A;  1Z7T A;  4RGT A;  1JE4 A;  4FVM A;  5KNB A;  3OPO A;  3JAM E;  1WTW A;  2A69 D;  4ID6 A;  5BN4 A;  1A15 A;  1PLF A;  2A69 C;  2F0G A;  2RQX A;  2EDG A;  2CW0 C;  3GTM B;  3S1M B;  1XXG A;  3W2D A;  1CQF A;  2XWB B;  1L0Y B;  3S1N B;  4A3G B;  4BBR B;  4B9X A;  4U68 A;  2L12 A;  4CHT B;  3DWP A;  1SNC A;  1G91 A;  2IJ0 A;  3S1Q B;  1AEX A;  2CHB D;  5J22 A;  1DCZ A;  3HOU B;  3C1F A;  3CQZ B;  3SXH A;  2B8G A;  3QIA A;  3BVG A;  5CV9 A;  2RKS A;  3D8G A;  3MZ5 A;  2KED A;  4Y7N B;  3VR3 A;  4CJ1 B;  1BCP F;  4ZAI A;  1BNZ A;  5CV5 A;  5HUR A;  2TSS A;  1ICW A;  2ID0 A;  4RCN A;  3V96 A;  2EYP A;  3I3C A;  1M8A A;  2L5T A;  3OIP A;  5IGE A;  1STA A;  4MIU A;  4ZKB B;  4RGM A;  3P7J A;  4X3T A;  4L8J A;  4PMW A;  1E2Z A;  5DM6 3;  4U67 3;  1EL0 A;  2C9O A;  5I4D A;  1OXU A;  2FMC A;  5COY A;  1CHP D;  2NB0 A;  1CZG A;  3CRL C;  3J81 E;  2NN6 G;  3D3R A;  1E2V A;  5M3M B;  1SYB A;  1Q1E A;  1UAP A;  3HOY B;  1JWM D;  4B9W A;  1SJH D;  5LL6 S;  2FIN B;  3S1R B;  2WV6 D;  4IUR A;  5ELB A;  3SDZ A;  4IUP A;  1PXU A;  1Z47 A;  4F88 A;  1D2B A;  1GJX A;  1ZXT A;  2L9H A;  4DK0 A;  3MC0 B;  1V1O A;  1KNE A;  4OO1 H;  2PYK A;  1STE A;  1TVX A;  2NWG A;  3I8Z A;  1CZW A;  2SEB D;  1QE6 A;  3OIQ A;  3WOE A;  1U4P A;  3SE0 A;  2B39 A;  3A7L A;  1A6X A;  1B9N A;  1F2Z A;  2K7V A;  1QB5 D;  3RD4 A;  1GHK A;  2E2H B;  5KNC A;  3I4M B;  3Q0A A;  2RBM A;  1OXX K;  1EFI D;  2QDB A;  3FPU B;  3NBI A;  1LTI D;  2B2W C;  1Q1B A;  3TZU A;  1G29 1;  5IOC A;  1SXT A;  2KEC A;  1DOL A;  3CU7 A;  3MHB A;  2M9V A;  1XTC D;  3KK7 A;  2R61 A;  4KTA A;  2KHS A;  3Q6S A;  1TWA B;  2FJ2 A;  5FO7 B;  1MGS A;  4A3B B;  3EVQ A;  1X3P A;  5DEH A;  4HMJ A;  1ET6 A;  1Q3L A;  4DAY A;  2A5H A;  3FDT A;  1ROD A;  2EPB A;  3K0Y A;  3RLF A;  1KAB A;  1II3 A;  1SFO B;  2AUJ D;  1IW7 D;  3D6W A;  3URY A;  1IW7 C;  3TDQ A;  2E2J B;  2JA6 B;  3DWA A;  4C3J B;  5IOD A;  2EZV A;  3E5S A;  1HA5 A;  3I70 A;  3H6M A;  2NZ1 D;  3I90 A;  2MP1 A;  2L55 A;  1NSN S;  4ZK9 B;  2J0T D;  4JK1 C;  1TII D;  1XX8 A;  2F0I A;  3MXU A;  4TKO B;  2K01 A;  4LK1 C;  1EYD A;  4WJW A;  4IAL A;  2HQE A;  1STB A;  1I6H B;  2F0J A;  2AQ3 B;  1QIL A;  2FHT A;  3J80 E;  4K5X A;  3TP7 A;  1BR9 A;  1ENC A;  4ULL A;  1Q12 A;  2FFK B;  1GUW A;  4KK7 A;  1BF4 A;  4FXK C;  5ELF A;  1SYC A;  2PZU A;  1Q8I A;  3MTS A;  2I07 B;  1JQY D;  4YIJ A;  2BOS A;  4B08 A;  3PUX A;  1H9S B;  1SE2 A;  2EE1 A;  1RD9 D;  1SEB D;  1LTS D;  5C3E B;  1ONL A;  4KN7 C;  1W6J A;  3WDN A;  1BO0 A;  4A3K B;  2IT1 A;  4QIW B;  2Z1C A;  2QKI C;  1PFN A;  2R92 B;  5IGF A;  1GXD C;  1IKL A;  2E75 C;  2NN6 H;  3D4D A;  4OO1 I;  3K5M A;  5ELD A;  2SNS A;  3H09 A;  3A8K E;  3P75 A;  3BVM A;  2PCF B;  3I4L A;  2JEA I;  4A3F B;  4K8J A;  3NK9 A;  4LMQ D;  3M7G A;  2F0M A;  1EIG A;  5JJZ A;  3K5L A;  3FVQ A;  1ESR A;  3TP8 A;  2EXZ A;  2EYH A;  1A3V A;  2F0P A;  3VYT A;  2F0E A;  5CV7 A;  1F9Q A;  1JCK B;  4XXE A;  1HFN A;  3NQI A;  2EJM A;  3DM1 A;  1HA6 A;  5JPN C;  4HTH A;  2Q8T A;  4KN4 C;  1I4P A;  4G7Z C;  2IPK D;  2K1B A;  1WTR A;  4K6L A;  5FO8 B;  1STG A;  5FLX L;  4R8N A;  3D4R A;  4EGV A;  3MEH A;  2KQ3 A;  2A74 C;  5G3L F;  2XSC A;  4F8M A;  1EY9 A;  2MGS A;  1QCB D;  3KBX A;  3P1H A;  3T56 B;  4XTC S;  3HOX B;  2F4I A;  1TWF B;  4ZKC B;  1BCP D;  2LKV A;  1S5C D;  3VR6 A;  1JOO A;  5M5Y B;  1CA5 A;  2BE5 D;  4RFB A;  1KLU D;  1VF5 C;  1ENF A;  2BE5 C;  4KJO A;  1AW7 A;  1SYD A;  5FOB B;  1H9R A;  2D2C C;  2Z8L A;  3K59 A;  3NWS A;  1HQR D;  2B2Y A;  1PZK D;  1BDO A;  1F77 A;  3ND8 A;  1Y69 U;  1ML0 D;  5E4X A;  1HUN A;  3M4Y A;  1A2U A;  1EY8 A;  1S5E D;  1U4R A;  1F9S A;  3ITP A;  4DAV A;  1STH A;  1ENA A;  3A8J E;  3K5N A;  3NPP A;  1KLG D;  5J1Z A;  5KIX A;  1QWY A;  5EQ0 A;  4K6D A;  1RJT A;  3D4W A;  4H7B A;  1FNU A;  4G7H C;  3T13 A;  1RHP A;  3I73 A;  2SNM A;  2K33 A;  2NN6 I;  1YNJ D;  2BA0 A;  1BCP B;  1YNJ C;  2XN9 C;  1B3A A;  5JOB A;  4BA1 I;  2EY1 A;  1EEF D;  2RSN A;  1SYE A;  3A55 A;  3HKZ B;  4KKT A;  3M4O B;  4NW2 A;  1EYA A;  4C56 C;  4IUU A;  1LTR D;  2CQA A;  2K6A A;  4XIG S;  3BYT B;  1EWC A;  1F2Y A;  3A54 A;  3AB9 A;  3BYY B;  3S15 B;  4RHS A;  4S3S A;  1W6K A;  1I4R A;  3I91 A;  2JYO A;  1JOR A;  1C4Q A;  2F3V A;  2X69 A;  4V19 0;  2O5I C;  3CKI B;  2D9U A;  5CV8 A;  5M9O A;  1ILP A;  3LWE A;  3C3L A;  4FYD A;  1EY4 A;  1LAB A;  2KA7 A;  4DA2 A;  2JA5 B;  2ICI A;  3CRK C;  3BZD B;  3C1E A;  1DD2 A;  1MD2 D;  3BDC A;  1S4Z A;  3OMC A;  3M7N A;  2ZXO A;  2IW3 A;  3VR5 A;  1G8Z D;  1KDB A;  1QNU A;  2B63 B;  5FO9 B;  2K5Q A;  3HP3 A;  2D62 A;  4BA2 I;  3GD7 A;  3G7L A;  1LTT D;  4BS9 A;  4K2K A;  1BXT A;  5C3W A;  5C5L A;  2EJG C;  3PIP 3;  1LT5 D;  1SSO A;  1ESF A;  5C5M A;  1U9R A;  4Q0F A;  3R8B A;  3VA7 A;  1FNV A;  2K5W A;  1DXM A;  4N9P A;  4IUN A;  2VXW A;  5NUC A;  1SMY D;  2KEE A;  3GTL B;  4PNY A;  5CV4 A;  5C6A A;  4KJN A;  3H0G B;  2Q8I B;  2R6G A;  2LY7 A;  2V4D A;  4NP5 A;  3SK8 A;  5I6Y A;  1PTO F;  5KYI A;  3NXW A;  2H1E A;  3PUV A;  3K7A B;  1CFM A;  1DM0 B;  5D14 A;  1O7Z A;  5ELC A;  4CKB A;  3OW7 A;  2VB3 X;  1MI2 A;  1D1K A;  4KD4 A;  1HTL D;  5FKA C;  1GUT A;  3OWF A;  2RDF A;  2F0D A;  3MFG A;  1PFM A;  2D5D A;  3HOW B;  4DAP A;  3BDO A;  1V8Q A;  4MN3 A;  4DN4 M;  5KGU A;  1PZJ D;  4PQX A;  2XVS A;  3HG9 A;  2L11 A;  4IUT A;  3R3O A;  4TQU S;  5IIF A;  3VA5 A;  3M85 A;  3L9A X;  4ZLT F;  2EY6 A;  2JSO A;  4QF4 A;  5IT9 L;  2F0K A;  2Z4H A;  5C4J B;  3OOC A;  5E1F A;  3QOL A;  2R7Z B;  2F0Q A;  1TY0 A;  5IGD A;  5EKK A;  4WOR A;  4A3J B;  4RCO A;  4CBV A;  2NTT A;  3OMG A;  3DXJ C;  3MXP A;  3FMC A;  3TBI B;  2N55 A;  3VYR A;  2F1M A;  1SNM A;  1R4Q B;  4FXD A;  2NVQ B;  2Q8R E;  5G3L D;  1RF2 D;  2EYJ A;  1LTA D;  3HGB A;  3NQT A;  1TS5 A;  4X3S A;  2NVX B;  3PMF A;  1EU3 A;  1IYV A;  1HRJ A;  2EJF C;  1EOT A;  3N52 A;  5ISR A;  2EYM A;  4RGO S;  1T5E A;  4OIK A;  2A68 D;  2JEB I;  1Y1V B;  2A68 C;  1OXV A;  5JPM C;  4CJ0 B;  1GHJ A;  2QF7 A;  2IL8 A;  3GO5 A;  1HPC A;  3O13 A;  4E6I A;  1MSG A;  4OGQ C;  4CKE A;  5K36 G;  4DNR B;  3VYU A;  1EU4 A;  5BN5 A;  1EQT A;  2RDH A;  1EY0 A;  1FR3 A;  5C4X B;  3H3V C;  2WP8 J;  4OIJ A;  1I4G A;  4H0L C;  3T4A C;  3A8I E;  3SR1 A;  1EY6 A;  1TR5 A;  1ET9 A;  2O2L D;  5FLX E;  2G9D A;  1IHZ A;  4PMC A;  3J7A F;  4ZUJ A;  4OHJ A;  4TRD A;  2HUG A;  1NR4 A;  3MXN A;  1Y1W B;  1AFP A;  2E74 C;  3TN2 A;  4R9W A;  1H9J A;  4A3M B;  4KHV A;  4XT3 B;  1QG7 A;  1J8I A;  1HTP A;  4EQO A;  3IFT A;  5BN3 A;  2PMZ B;  3R93 A;  3SK6 A;  1O7Y A;  1R4P B;  2DNC A;  2PZW A;  3QWN A;  2F0V A;  1X32 A;  4Z9C B;  3IL8 A;  1SNQ A;  1TKW B;  3MAQ A;  1SE4 A;  3T51 B;  1RTO A;  4WRD A;  1GOZ A;  1AZQ A;  3A7A B;  2NUC A;  3LNN A;  3SHL A;  1SNO A;  3E0J A;  3FKI B;  3GTJ B;  2HDM A;  2PW7 A;  1GUN A;  1E2W A;  4I65 A;  1B53 A;  5A2Q L;  1JOK A;  2FMM A;  3ONA B;  2K04 A;  2L4N A;  2LMC B;  5C3X A;  5T1I A;  4A93 B;  2R93 B;  4QB4 A;  2F0U A;  4XQJ A;  3S14 B;  3T53 B;  2HCC A;  2RSO A;  1PFB A;  1ZYR D;  1V43 A;  4K8I A;  1FNW A;  2E2D C;  4KHZ A;  3KLS X;  1LT3 D;  4HMI A;  2C5C A;  3I4N B;  4XQN A;  2PNR C;  4G4K A;  2JA7 B;  1PYW D;  1SAP A;  1V1P A;  3TSS A;  5C4H A;  4C3H G;  2MHV A;  3S2H B;  3LX0 A;  2XWJ B;  3DUZ A;  4DXG A;  2RDG A;  5IGC A;  1RTN A;  1L0X B;  2AWO A;  1G2S A;  2NYZ D;  5C0X J;  1HFG A;  4RH6 A;  3KLS A;  1NAP A;  2B2Y C;  2X6G A;  3FEW X;  1SYG A;  1BBX C;  1U4L A;  4IUV A;  5KND A;  2BA1 A;  1TT2 A;  1STN A;  2OF1 A;  1VF7 A;  1I6V C;  3S16 B;  1HUM A;  1EZ8 A;  1KNA A;  4RHR A;  2KJX A;  5JVH 3;  5EBC A;  1JR0 D;  5CGK A;  4FXG C;  2IX1 A;  3V2T A;  4IUQ A;  2XRS D;  3QG1 A;  3TZD A;  2GA4 B;  1D5Z C;  1B44 D;  1NUC A;  3L3O C;  5CR3 A;  1PTO D;  1BCP C;  3HEJ A;  1SJE D;  5K36 H;  1D5X C;  1SE3 A;  2NVY B;  5AFW A;  1LV9 A;  4RKL A;  1KTK A;  3ERQ A;  5I2Y A;  3RZO B;  5KYL A;  1LT6 D;  4KKU A;  1VCI A;  4AYB B;  1I4H A;  3NWT A;  3K57 A;  1DZ1 A;  2L1B A;  4ODG A;  1TQO A;  4XYQ A;  1SND A;  2KUM A;  1CA6 A;  4ME5 A;  5EBD A;  1HXY D;  3BDL A;  4EQP A;  5JEA J;  2SDF A;  1PRT F;  3ZYY X;  2JXM B;  4RKB A;  2EOT A;  4ZYS A;  4A3D B;  4KMU C;  4KY7 A;  2B2T C;  1BUV T;  2B2U A;  1LT4 D;  3KF8 A;  2NVT B;  3BG3 A;  2PPB C;  2OEO A;  3SK5 A;  4HCE A;  4QMG A;  5EJW A;  3GTG B;  3A56 A;  1EEI D;  4KKS A;  4QCL A;  1B9M A;  1O80 A;  2Y0S B;  3TP6 A;  4BWG B;  1XWE A;  1JIC A;  1WCM B;  3SEB A;  5TSS A;  2AQ1 B;  1EYC A;  1EY7 A;  5I6W A;  2G9H D;  5CMD A;  3GV6 A;  1PTO B;  2F0L A;  4HSP A;  5HGT A;  3KBG A;  3OWE B;  1QNK A;  3FPP A;  1SDF A;  2BDN A;  2X6L A;  2EYF A;  3R2I A;  1TY2 A;  1ZEQ X;  2WII B;  5KRU A;  2B2T A;  2PQE A;  2ZXR A;  3NTK A;  2AQ2 B;  1S5B D;  3K6O A;  2N88 A;  2J4X A;  3PUY A;  2F0F A;  4HED A;  2B2V A;  2SOB A;  3G6J B;  3GTO B;  1B50 A;  5IT9 E;  4H13 C;  1F2L A;  1K83 B;  2F0W A;  3DWQ A;  1FGB D;  2K28 A;  1KDC A;  3QOJ A;  5CYU A;  3T16 A;  4ILW A;  3MA2 B;  4FF4 A;  1TWH B;  2IX3 A;  3BS1 A;  1BOS A;  1PTO H;  5CC4 A;  1WD0 A;  3QJY A;  1HQM C;  1JB3 A;  2XIW A;  2I46 A;  5I2X A;  1O7L A;  2PO4 A;  1LAC A;  5M5W B;  1JWS D;  5KEE A;  3WOF A;  1HHV A;  5EPK A;  1T5X D;  1EQV A;  4KY6 A;  3RZD B;  1H9M A;  3S17 B;  2VNU D;  2ZT9 C;  5C0X I;  1WVL A;  2MUY A;  2CW0 D;  5D3D A;  1FYC A;  3EFX D;  1GUG A;  1SMY C;  5IGB A;  1A3U A;  1GUO A;  1D6E C;  4FO2 A;  1QJO A;  1VDZ A;  2F3W A;  2F03 A;  3DEP A;  5EGT A;  1WTP A;  3SVM A;  5D65 A;  2K05 A;  5LL6 X;  1EY5 A;  5CV6 A;  1TS4 A;  1OO9 B;  1DOK A;  1IKM A;  2ZXP A;  3N6R A;  5K5P A;  3J7Y W;  4F87 A;  2DY7 A;  5E3F A;  1B4O A;  4P2C B;  3NE5 B;  3D6C A;  5JVG 3;  4IFD G;  1DON A;  2IWH A;  3NTI A;  3PO3 B;  2HDL A;  1EZ6 A;  3MWY W;  1IL8 A;  1WTQ A;  3ERO A;  3SK4 A;  1TS3 A;  3PV0 A;  2EVB A;  5I9P A;  2WIN B;  3GP7 A;  3LWU A;  4UAI A;  2KVM A;  2LS0 1;  3AMU A;  1CQV A;  1I4Q A;  5D3I B;  3FRP B;  1F2M A;  4X3K A;  3E6Z X;  3QB3 A;  4J6H A;  1WTX A;  4HN7 A;  3IAY A;  1YNN D;  5IGG A;  4M1U B;  4QUF A;  1YNN C;  1CTM A;  1G6Z A;  2IX0 A;  1DJR D;  2F0O A;  3S2D B;  2DY8 A;  5EPL A;  3NHH A;  3NTH A;  1K8O A;  1UNS A;  4M8A A;  5M3F B;  4K2L A;  3J7A V;  4DF7 A;  5CBE E;  3QO2 A;  2EYL A;  3TME A;  1FD7 D;  4C3J G;  1O78 A;  5A2Q E;  2R3Z A;  4I7Z C;  4FF3 A;  1DYQ A;  4MHE A;  1F9R A;  3X3M A;  4ZRZ A;  1OXS C;  1E0B A;  4CJ2 C;  3NUC A;  2MPM A;  4DXF A;  4KD3 A;  4DK1 A;  3M3Y B;  2BDO A;  4PMB A;  4RWS C;  3HOV B;  1XYI A;  3NBH A;  3OHX C;  3KLR A;  1KAA A;  3RMH A;  1DOM A;  5DAU A;  3JAM L;  1RKN A;  3HRZ C;  4IFD J;  1JWU D;  2E2I B;  4K5V A;  2F0H A;  2KCN A;  1AP0 A;  3PO2 B;  1UEA B;  3EQL C;  1PRT D;  2WKD A;  1PRT C;  1S5F D;  5I9O A;  2AWN A;  5COR A;  5JAV A;  1X3Q A;  4ABN A;  2ICE C;  5FK9 C;  3VYS A;  5M5X B;  2EY5 A;  4C1N I;  3AU7 A;  3GQB A;  5LHY 1;  3D31 A;  4XQQ A;  4FNF A;  3DHQ A;  5C0X G;  1Q90 A;  3IFD A;  1U4M A;  2WB1 B;  2WAC A;  5EPJ A;  3IKJ A;  1TWC B;  3KUP A;  1M4V A;  1H9K A;  1I3Q B;  5EKI A;  1CK1 A;  2A73 B;  2NTS A;  4HSV A;  1S5D D;  3BVZ A;  2QIL A;  4BY7 B;  3PUW A;  4HR7 B;  1CI3 M;  3PUZ A;  1LTG D;  3H94 A;  1LO5 D;  4RGN A;  1A2T A;  1VMP A;  2XNA C;  1ZKO A;  1IYU A;  2B2W A;  3U9S A;  3P20 A;  1Y8O B;  4DU9 A;  4IFD H;  1WD1 A;  1CT1 D;  2PW5 A;  2WAQ B;  5A35 A;  3HZX A;  4FF2 A;  3GV3 A;  3TP5 A;  2QEJ C;  3J81 L;  3EA6 A;  1H9S A;  1CM9 A;  1PRT B;  2OXP A;  4KI0 A;  4IQZ A;  4FP5 D;  5ELE A;  3GTK B;  4ZQ3 A;  5JEA G;  3GTQ B;  2A6H D;  1STY A;  4BBS B;  2A6H C;  2JP1 A;  1Y8N B;  1CHQ D;  2TMP A;  1ZYR C;  4LJZ C;  4BY1 B;  2AUK A;  3X3N A;  2H4O A;  4C2M B;  2K32 A;  2LFN A;  1EIH A;  2M2L A;  4EQN A;  4X3U A;  2K03 A;  2L0C A;  2QCP X;  3I72 A;  3HS0 C;  4EVO A;  4XYO A;  1VMC A;  1C48 A;  5DNF A;  4IZ8 A;  1LTB D;  3PIO 3;  4DFA A;  3ND9 A;  3NSW A;  1V1P B;  3MVV A;  1WTV A;  1SNP A;  4V0B A;  1AN8 A;  3S9W A;  2F0N A;  2XRQ D;  4DGZ A;  3U9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...