1PLFA

The three-dimensional structure of bovine platelet factor 4 at 3.0 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
63
Chain Sequence
LQCVCLKTTSGINPRHISSLEVIGAGLHCPSPQLIATLKTGRKICLDQQNPLYKKIIKRLLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title The three-dimensional structure of bovine platelet factor 4 at 3.0-A resolution.
pubmed rcsb
source organism Bos taurus
molecule tags Platelet factor
total genus 8
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1plfA00
3MWYW 2KECA 1HHVA 1B3AA 3UI2A 5COYA 1AP0A 3FDTA 1J9OA 1PFNA 2B2TA 2MJ8A 2HDLA 3Q6SA 2HCCA 1B50A 1S4ZA 5E4WC 3ONAB 2L12A 4IUUA 4R8IA 2B2WA 1WTXA 2RA4A 1NR4A 1QG7A 2L11A 3DEOA 5T1IA 4UAIA 3G7LA 1F9SA 1VMCA 1PFBA 2KEEA 5E4XA 3FPUB 1J8IA 1LV9A 1HFGA 4XT3B 4RWSC 3F2UA 2B2YA 1ZXTA 2K01A 2KEDA 2X69A 1GUWA 1TVXA 1EIHA 2EOTA 5D14A 4OIJA 2SDFA 2DY8A 1O7YA 4QUCA 1HUMA 4IUQA 3IFDA 2HDMA 1F9RA 4RAUC 2L9HA 2X6LA 1WD0A 4IUPA 1RJTA 4IURA 1DOKA 4HSVA 1A15A 4HCSA 3QO2A 1G91A 1AZPA 3IL8A 5T1GA 1HRJA 1WVLA 1NAPA 5JJZA 5CORA 5EKIA 5CBEE 3P7JA 1JE4A 1IL8A 4ZK9B 1IKMA 2EE1A 2B2VC 4X3KA 4HAEA 3MTSA 1G6ZA 1JICA 4CJ0B 5EPKA 2B2UC 2K05A 2X6GA 4CJ1B 2BDNA 4CJ2C 3SVMA 2K04A 1DOLA 1X3QA 1PLFA 1X3PA 1B53A 2D9UA 2FJ2A 5DNFA 2L1BA 5CMDA 3D6WA 4R9WA 2K28A 4ZAIA 2NZ1D 4XDXA 2B2TC 1EOTA 2KUMA 1F9PA 2NYZD 2FHTA 2RSNA 3DM1A 3H91A 1QNKA 4U68A 4X3TA 1DOMA 1HUNA 1F9QA 1ESRA 2K03A 2Q8TA 2MGSA 1NR2A 2XIWA 1C8CA 2HCIA 4DN4M 5D65A 1U4RA 4OIKA 4X3UA 2FINB 1E0BA 1CM9A 1KNAA 1WTOA 1O7ZA 1X32A 3GV6A 3TN2A 4QUFA 1G2TA 1PFMA 2B2YC 3LWEA 4LMQD 3R93A 4X3SA 1ICWA 1MSHA 1F2LA 2EPBA 1XYIA 1HFNA 4NW2A 1U4PA 2K1BA 3HP3A 1RODA 1SSOA 5EPJA 1BBXC 1M8AA 4IUTA 5EPLA 2L4NA 2FMMA 5CBAE 1MSGA 1XX8A 2MP1A 2VXWA 5EQ0A 1BF4A 1ILQA 2N55A 4MHEA 1QE6A 2CVRA 1RHPA 4IUVA 5AFWA 2RSOA 1B2TA 2DY7A 1BNZA 1MGSA 4MN3A 2NWGA 1SAPA 1EL0A 4ZLTF 1EQTA 2B2WC 2FFKB 2KOLA 3GV3A 5EJWA 1G2SA 1WTRA 3KBXA 1CA5A 1IKLA 1WTQA 4ZKBB 1SDFA 1HA6A 1DONA 1ML0D 1WTVA 1B4OA 1RTNA 1CA6A 2N88A 4RA8A 2Q8RE 1AZQA 2JP1A 2R3ZA 3I91A 3N52A 1BO0A 4O42A 1O80A 2J7ZA 1NCVA 2HUGA 2M2LA 3DEPA 3I8ZA 3I90A 1PDQA 3I3CA 3TZDA 1U4MA 1EIGA 1ILPA 2JYOA 2IL8A 2KVMA 3KUPA 1KNEA 2B2VA 2RVLA 1U4LA 1VMPA 1WTPA 1Q3LA 2H1EA 4HEDA 2B2UA 4XT1B 1WTWA 1WD1A 2MPMA 1MI2A 1DZ1A 1RTOA 4ZKCB
chains in the Genus database with same CATH superfamily
3OTOQ 1PH3A 4IPGA 4FDBA 2PQAA 2VS1A 1AP0A 1VQCA 1R9TH 1I4XA 4JBKA 4K6LA 2YU9H 1JB7A 3J81L 1PTOH 1TWCB 5C3WA 3CMEA 1X56A 4IOAA 4ULLA 5M3MB 2NTTA 1ZXTA 5E7NA 1G8ZD 3KBGA 1VQ6A 1TS3A 1F9RA 5CV7A 3NELA 5A2QE 3HOXH 4UDUC 4JI2Q 1YVCA 3E9HA 2F3VA 1FNUA 3FRPB 4K0KQ 1EYGA 2EXZA 3R8BA 1DCZA 4GKKL 1JE4A 1JR0D 3MXPA 2EE1A 3TS2A 2UXBQ 5EPKA 5A35A 4A3BG 2BDNA 1EYAA 1X3QA 1X3PA 4IPDA 1QUQA 1X54A 2Z0SA 4J8QA 4N8FA 4YCVA 5CV5A 4APVA 5C4JH 2IT1A 5ELOA 3HOUH 3NTKA 1SROA 1EFWA 3H6MA 1S72A 3OW2A 1E1OA 1Y1WG 3F8TA 1PFMA 4LF8L 4KY5A 3S17B 2PNRC 1F2LA 3FP9A 1UAPA 3A8KE 5HGQA 1EFID 3EFXD 4LF5Q 4IUTA 4CKEA 1PH1A 1IBLL 2ES2A 2F0IA 2KA7A 2LXJA 2XSCA 2EYPA 3G4SA 2NUCA 4XXEA 3AQQA 1EQTA 1SYDA 1G2SA 4TSSA 1AH9A 5JJIA 4I7AA 2K5VA 1H9JA 5IOCA 1WJJA 1WYDA 5GADC 1PRTF 4GOPC 3JAMc 4GKKQ 1L0WA 1Y8OB 1TU2B 1EUJA 1GVPA 4RGOS 4OGQC 4HEDA 1WD1A 1PTOB 4H02A 3GTKH 5BN4A 5I6YA 3C2PA 3MWYW 4LF9L 4FXKC 3SR1A 3G6JB 1SE4A 1B50A 1YNXA 2R93H 4GNXA 4QIWB 5C4XH 4LK1C 2B2WA 4J15A 2NTSA 5M9OA 1YJ9A 2PZUA 3E5SA 2H4OA 3G7LA 4LF8Q 3VR5A 1HFGA 1CQVA 1OXTA 2QEJC 4IFDG 1HNWL 4LJZC 1G51A 4MZ9A 3DWAA 3IFDA 4JOIC 2HDMA 4MTKA 1FR3A 1WD0A 1V1OA 1YHBA 2VNUD 1A15A 3OMGA 1VQPA 3U9OA 2EY2A 4LW1A 4WJWA 1XPRA 5C4JB 1PA6A 3E0JA 2B8GA 2ATWA 1CK1A 2EYJA 4QJFA 2K05A 2I5HA 4HJ5A 2KHJA 2NZ1D 2A6HC 2B2TC 4JI6Q 2Z4IA 4H44C 3QWNA 5M5XH 1YHAA 4DU9A 5D65A 4OIKA 3SK8A 4LF9Q 2FINB 3J7A5 1O7LA 2A6HD 4QUFA 2Z1CA 1G2TA 3MZ5A 2EXDA 4DKAC 4X3SA 4MIUA 1ICWA 1LO5D 1TQOA 2JA5B 4NW2A 2WFWA 5IWAL 3HP3A 4Z9CB 3KDFB 3W5OA 1XX8A 4DV6L 3GTLB 2A74C 4X65L 3FKIG 3J81i 1TY0A 1HNWQ 2R7ZH 5BN3A 3LGJA 1SAPA 2EY6A 4XTCS 1EL0A 4HJ9A 1I4PA 3GTKB 4KTAA 3HOWB 3A7AB 5IE8A 4BY7H 1PH5A 1A8VA 1OXXK 3KF8A 4N9TA 3SEBA 1KIXA 2R93B 2BA0A 2LXKA 5CR3A 5FLXc 1KNEA 3DMUA 4L5QA 1SNOA 5FO9B 5FLMG 1EEID 3K58A 2NN6I 3HOVH 1RTOA 1K3BC 2EY5A 4OO1G 3NXWA 1QCBD 1ZEQX 2MJ8A 5C3XA 4DNRB 1AEXA 3TP6A 4RCNA 1P16A 2XN9C 1SMYC 3F2CA 4C3JB 1UEAB 4LAAA 4QCLA 5EAYA 5IYDH 1QWYA 4JYAL 3BG3A 2B2YA 4A93H 1RKNA 1K0RA 1EU4A 1A3UA 1V9PA 1SMYD 5J22A 4DV2L 2QA4A 5DEHA 3SE0A 4DV6Q 3RZDH 1XNRL 4X65Q 3EIVA 1DOKA 3PO2H 2JE6I 3C1EA 4KJOA 1DGSA 3MVVA 1PMRA 5M5XB 1FGBD 2O5JC 2JA7B 2KJXA 2CFMA 1G6ZA 3VDYA 3Q23A 1Q86C 4OX9L 3CP0A 2MUYA 4RFBA 4ZAIA 5C4ZA 1UWVA 3Q24A 3U4ZA 2AUJD 2PI2A 4DK1A 4A3IG 2Y0SG 3HZXA 1TWGH 5K36G 2R7ZB 4IUNA 1S5BD 4KKUA 4AYBB 1JORA 4A3MH 3OW7A 5M3FG 5IIFA 2A5HA 4YWLA 3SK5A 4PQXA 5KNCA 4TKOB 4JYAQ 2VXWA 1EIFA 1VQMA 4R8NA 1CTMA 1ILQA 3IKJA 3GTQH 3PF5A 2DY7A 4DV2Q 2F0SA 1K8AC 4I65A 4A3DH 1XNRQ 3HOVB 5JAVA 3GTOH 2N88A 1AZQA 1TIID 5GAGC 4X62L 2RQXA 3HKZB 4JBWA 3S15B 4YY3L 2PQAB 3R3OA 4ME5A 2XTIA 1D5XC 5I9OA 2JYOA 4KD4A 3I7FA 4P2CB 3T1YL 3H0GB 4XQQA 3IAYA 2B2UA 4OX9Q 3RZOH 4G4KA 2B63G 4A4IA 4A93B 4B3RL 5I9PA 4H7BA 4XYOA 4KHVA 3NWTA 2I5LX 1S4ZA 4A3KB 2CQAA 5ISRA 3RZDB 1JB3A 1BBUA 1TKWB 1GXDC 4C3HB 2PO4A 4FXDA 2UUBL 4JVZA 3OIPA 3T13A 1EIHA 2DY8A 3DXJC 5CV6A 5JPNC 3QOLA 4AIMA 1HNZL 2R6GA 5FO7B 4LUOA 1SMXA 3PGZA 4EQ5A 1VQ7A 4G7ZC 5M3MG 3D4RA 1CSQA 2B2VC 5C0XH 3PV0A 4OWTB 3HEJA 1XXGA 2D9UA 2FJ2A 1TWHB 4IALA 4X62Q 4U673 3E9IA 1STGA 3JAME 4YY3Q 2PW7A 1SYBA 4K2KA 1I4HA 4A3MB 3T1YQ 4AQYQ 1DOMA 3DLLA 4DR5L 1F2MA 3F2BA 1S5CD 1VQJA 4CDCC 4B3RQ 3GTQB 1O7ZA 3LWEA 3W3AA 1R4PB 1ET6A 4DR3L 1MSHA 3J7AV 1EY4A 4FP5D 5IYCG 2HT1A 1K28A 1RL2A 2MP1A 3WOFA 1SNPA 4DK6C 1W6KA 4BBRB 3HGBA 4B9WA 3EJIA 3EN2A 1JQYD 5DM63 2FFKB 4Y7NH 4HIMA 1JWMD 3K5MA 2HD3A 3RZOB 3B6YA 3J80L 4A3LH 2NVXB 1HNZQ 3A55A 2YTXA 4ZRZA 3NP8A 2A69C 3HOYH 3N52A 1BO0A 1BR9A 3OOCA 3KF6A 4CDDC 3NUCA 5IGDA 1I4RA 2L55A 1GHKA 3FVQA 3RN2A 5I2XA 4GNXB 1EY8A 2RVLA 4HMJA 3I4LA 1Q3LA 1EY0A 2A69D 4C2MH 2KHIA 4A3CG 2A8VA 1VF7A 4RG1A 2EDGA 4Y52H 3ERQA 3FMCA 4DR5Q 3UDXA 2JA6H 1B7YB 3KDFA 3ONAB 1C7YA 2YV5A 3L7ZC 3H3VH 1UE7A 5ELCA 3C3LA 1PYSB 3J81j 4C3IB 5LL6X 5JEAG 2E8GA 1HPCA 2K75A 3RR5A 1DJRD 2B3GA 1VMCA 2KEEA 2GVBA 4KJNA 4LFAL 1EYDA 1TY2A 4DR3Q 2KHSA 2ICIA 3L9AX 1HQRD 3TMEA 3K57A 2SDFA 3O13A 4TQUS 3A74A 3K5OA 3OWFA 2XNAC 4IUPA 1UE5A 4RHRA 4CDEC 4R4CA 3NQTA 1CFMA 1SNCA 5KIXA 2BA1A 4TVAB 1SJED 1JWUD 5CBEE 3OPOA 1B3QA 3MTSA 3VR2A 1H9KA 2F0NA 4CJ1B 2K04A 4B9XA 1UE6A 2L1BA 3ZYYX 1L0YB 2EYFA 3NBIA 4NP5A 4BY1H 1EOTA 1HZCA 1F9PA 3DHQA 5FLXE 2Z4HA 2JSOA 1A3TA 2KENA 1ASYA 5DM73 4BWGB 1D1KA 4V0BA 1LTSD 1WTOA 3TN2A 4DR7L 3CF5A 4PZ7A 2N8NA 1N33L 1CZGA 1GKHA 4Y7NB 2I07B 3BYYB 5EPJA 1NE3A 5CC4A 2JA9A 4LFAQ 1A6XA 1EZ8A 1STBA 3FPPA 4H0LC 1RHPA 2NWGA 2D5DA 3CCVA 2CKZB 3W1BA 3HKSA 1CA5A 1WTRA 1W2BA 3KBXA 1IKLA 3TP8A 2F0MA 2JA5G 3GTJH 3NWSA 3WWVA 3ZJYC 3T56B 3P1HA 2R92B 2K5HA 5JPMC 3GTGB 2NVTH 1KRSA 2HUGA 1ENCA 2M2LA 2OXPA 1SR3A 2JA6B 3BS1A 5FJ8G 2IL8A 2KVMA 2D62A 5TSSA 4HIDA 3PF4A 4WJ4A 1SYFA 4L5SA 2PZTA 1XTDA 2PNHA 5LL6S 3TDQA 4HIKA 1C0AA 4JI2L 2IHFA 1IW7D 4IN3A 3MXUA 4HSPA 3ULJA 3HOWG 4A3JB 2XRSD 1AW7A 3S1NH 4RMFA 2R93G 1NR4A 3CQZH 1B44D 4DR7Q 1PH7A 4KHZA 1Y1VH 4JW0A 3S2DB 3M4OB 1PRTB 1KDCA 1N33Q 2PMZE 4RWSC 4FNFA 5C0XJ 2K01A 2KEDA 1GUWA 3OSOA 3K5NA 3A8IE 1HCZA 2O2LD 4IUQA 5J3BA 2L9HA 5IGFA 4DK0A 1V1PA 4X6AH 4C3JG 1Q1EA 2LY7A 1Q1BA 1QOHA 3J81c 2EIFA 1NSNS 2Z9HA 1QZHA 1IZ6A 1YI2A 4LF5L 1PZKD 2X6GA 5DNFA 3J80i 2UU9L 1I4QA 3BZKA 1PH9A 3KLSA 1OXSC 2KUMA 2IHEA 4NXMQ 2UXCL 3CPWA 1C9OA 1F9QA 1KD1C 1AE3A 3PO3B 5C3EH 2JA7G 2AWNA 1X32A 2ZJQA 1VQEA 3S14H 2BE5C 4CHTB 1DD2A 4DV7Q 1LTID 2JA8H 1BBWA 1Q81C 4LNQA 2JK8A 4N8X1 1H9SB 2RHSB 1SFOB 5M5YB 1M8AA 5EPLA 4QF4A 3CCLA 2B8FA 1MSGA 2BE5D 5G3LD 2VB2X 2NVTB 1CSPA 2Q2HA 1QE6A 2CVRA 4IUVA 1CKNA 1ZYRC 1BNZA 4A3GH 2R7ZG 1IYJB 1GUSA 2VQEL 1YJWA 2RCNA 3K0XA 2I0QA 1GUOA 4AH6A 1VQKA 4AYBG 4LWCA 2PZWA 1LT4D 1D5MC 1ZYRD 1U9RA 1LABA 1NMFA 4ID6A 1Z7TA 4DPGA 1G6PA 2AUKA 1VQIA 3BDOA 3CQZB 1B1ZA 2K5DA 4YCWA 2H1EA 1WTPA 4RCOA 2UU9Q 1N9WA 1XNQL 3HOVG 4UP8A 2F0KA 4JBJA 1B3AA 3UI2A 2UXCQ 1J9OA 1EQRA 5JVG3 2F0PA 2E2DC 1L1OB 5EBCA 3HKZG 4IUUA 4DV5L 4K5VA 1HA5A 1S5DD 3CHBD 5T1IA 5IYBG 4X66L 3H0GG 1R9TB 1EQVA 1RIPA 1PHJA 4L5TA 4JI6L 1I6HH 2IX1A 2YU9B 1VQGA 4GOPA 5CYUA 4A93G 2K33A 3PUYA 4QUCA 5BR8L 5KGUA 2V1CC 4R4OA 1BXTA 4HTHA 1LYLA 4JCVE 1HZBA 4A3KG 4CGYB 1EIYB 3E3XA 2F03A 3RUZA 2WAQE 5T1GA 1F2YA 3SDZA 4BS9A 2VQEQ 4BBSH 4C3HG 1MJCA 4A3EH 3HOXB 1VDZA 1VF5C 3MEFA 4YCUA 5LMNQ 1U0LA 4FF4A 4WRDA 3SVMA 2DJFC 1ICFB 3S14B 4B3TL 3G6EA 1IXRA 4DV4L 1MHWC 3GP7A 1LT5D 4I7ZC 4K14A 3G71A 2RSNA 3UDIA 1XPOA 5CV8A 1HTLD 3CW2C 4JOIA 3GO5A 1XNQQ 4UP9A 3A5ZB 4IO9A 2VUMH 4HJAA 1CM9A 1V43A 3QOJA 1VQAA 5IT9E 3S1QH 4JI4L 3J7AF 1UNSA 4QGUA 3S16H 1PYBA 4DV5Q 4PMBA 1STEA 3HOUB 3Q8DA 5C4HA 4X66Q 4A3MG 1AN8A 1OXVA 2QILA 2WB1E 1FNVA 2Q2UA 2L15A 4MHEA 5C5MA 5IY0A 1J5EL 2Q2TA 2WIIB 5BR8Q 4KD3A 4E6IA 1HJPA 1EU3A 3KF6B 1Y69U 1PZJD 3I4MH 5ELEA 1K8OA 3MC0B 3VYTA 5JJKA 2WP8J 1Y8PB 1WTVA 1B4OA 1FNWA 4GS3A 1D8LA 4JPBW 3D3RA 4XQJA 4F7XA 2F0EA 4QB4A 4S3SA 4BBRG 1EYCA 3A54A 4OEMB 1LTGD 4KMUC 1PFSA 2BOSA 2MO1A 1X65A 4B3TQ 2RDHA 4DV4Q 4IFDI 4UP7A 1EOVA 1A63A 2A19A 1RD9D 4JI8L 2OCEA 3QIAA 3V96A 4DA2A 2L12A 4CBVA 1WTXA 1TS5A 1J6QA 1JE5A 4JI4Q 1F9SA 1SN8A 2F1MA 4IOCA 2KQ3A 2E75C 4ILWA 5C4XB 3S2HH 2QCPX 3CRKC 4ME3A 1X3GA 4QQBX 4A75A 2EY1A 3I56A 3M85A 3CCJA 1J5EQ 4C3IG 3G48A 4CDFC 1ZKOA 2RDFA 4HJ8A 1A62A 4RKBA 1JJCB 3NENA 2F0GA 1TXYA 1PLFA 1CUKA 4NMZA 5CMDA 2CCZA 4FF1A 4RGMA 1H9RA 2HHHL 2OWOA 4HR7B 2EJFC 2NYZD 1YIJA 1QNKA 2F0VA 1VQ9A 3ER0A 5I4DA 5KYLA 1N8RC 2AQ1B 2XIWA 3D31A 2FXQA 3LNNA 2NVYH 3GQBA 5HURA 4JI8Q 2B2YC 3TZUA 4Q0FA 4K8IA 2K4KA 3K81C 1TWAH 1E3PA 1YBYA 3I4MB 1KC8C 2JJQA 3SK4A 4KLKA 3GD7A 1Z9FA 1A2TA 2YTVA 4PMCA 1VQ5A 3S9WA 3TREA 1JJ2A 1H95A 4P71A 3NE5B 2F0QA 1WCMH 5IP9G 4OO1I 5LHY1 1Y14B 2V4DA 4DK3C 2CWAA 3Q22A 4G7OC 3I73A 4A3FH 3U9SA 2QEXA 3J81E 4DR2L 4O42A 2J7ZA 5GROA 3M7NA 4JI5L 2E2IH 3SGIA 3V2TA 1QVGA 4F87A 4KN4C 1BUVT 1AE2A 1U4LA 4BY7B 1QJOA 1SYCA 1IHZA 5DLQE 5DAUA 1UEBA 2HHHQ 4J6HA 3SK6A 1GHJA 1SNDA 2ZXOA 1HHVA 2KCNA 3WDNA 4M8AA 4ZUJA 3FDTA 4Q5VA 1H9SA 2HCCA 1II3A 1Z47A 2R92G 5BN5A 2XWBB 3IFTA 4B08A 4YIJA 2JA6G 4MNOA 1CT1D 3M3YH 2ICEC 1RF2D 2NN6H 1V1PB 1VQ4A 2Z8LA 1LTBD 3H94A 4B3ML 2LKVA 1KDBA 4AQYL 5KNDA 4A3JG 1L2FA 1CKOA 2AHOB 4RAUC 2BH2A 4HJ7A 4XIGS 3U4VA 1LACA 3K0YA 1SJHD 3VYRA 1VCIA 1X3EA 1E7ZA 1NAPA 3NQIA 1E2ZA 5C5LA 1PH4A 1IBKL 5EKIA 3KYHC 2NB0A 3PO2B 5ELFA 1X55A 2B2UC 2VB3X 2NVYB 4DR2Q 2QF7A 3A5UA 3HFZB 1U5KA 4JI5Q 4CKCA 1HR0L 1L1OA 2WINB 2CH4W 3CC7A 1CZWA 1P8LA 3U50C 3AFQA 4O1NA 1K3RA 5A2QL 4JI7L 2EZVA 3KLRA 4DN4M 3TBIB 3K7AH 4DAPA 1VS0A 2EYLA 2A68C 3RMHA 1CKNB 1WCMB 2PQEA 1HZAA 1HXYD 1I5FA 1MJEA 1TWGB 4J1MA 4A3FB 3K7UC 3OIQA 1D5ZC 4HN7A 1BF4A 2UUCL 2A68D 4B3MQ 3PO3G 4LUVA 1A3VA 2UUAL 2E2IB 3S1MH 1PTOC 5IGBA 3IRBA 1CHQD 4FO2A 3URYA 1K73C 1NUCA 5EBDA 4PMWA 2QGQA 3RNUA 1X6OA 4WJ3M 1PTOD 4JC0A 1IBKQ 3BZDB 4A3DB 3TZDA 3GTOB 1YEZA 4LF7L 2Z6KC 3M3YB 1VMPA 3T16A 1DZ1A 1WTWA 3I72A 5ELNA 1VQ8A 1ET9A 1HR0Q 5NUCA 3I55A 1IYUA 2A1AA 3AYHB 3J80c 5COYA 3Q6SA 4JI7Q 1SE8A 5E4WC 2CQOA 3R2TA 4GN4B 4GOPB 2AQ2B 5EKLA 1YHQA 3HS0C 2YYZA 4CKBA 3F2UA 2X69A 1F2ZA 2EOTA 2F0UA 3NTHA 5D14A 3L2PA 3ITPA 1HTPA 2LSSA 4KKTA 1VQFA 1XTCD 1O78A 4G7HC 4A3IH 2UUCQ 5K36H 2O4XA 5F2DA 2UUAQ 2MNAA 3GTMH 1SEBD 5M5WH 3GTPH 5IODA 1WVLA 1Q8KA 2DNCA 5H1SE 4OWWB 2J0TD 4EVOA 4ZK9B 4DNIA 4FYDA 2L5TA 1BCPC 4BA2I 5K5PA 1E24A 5FKAC 2K5WA 1IL2A 2C35B 4YWMA 3DM1A 4LF7Q 4U68A 4X64L 1BCPD 2HCIA 3SXHA 3L0OA 2IX0A 5G3LF 4X3UA 4MTNA 5IT9L 3HOXG 1XMOL 1KNAA 2NBFA 3GV6A 4OELB 4QY7A 4AYBE 3Q0AA 1G291 4LMQD 3S1MB 1SE2A 3S1RH 5E1FA 3CCMA 3KJPA 2G9HD 1E2WA 2L4NA 4DNTB 2VQFL 2K5NA 2B63H 3OMCA 2IWHA 5EQ0A 4LFBL 4FXGC 4P74A 2IY5B 1YNNC 2EYHA 1N32L 2K5QA 2ZXRA 1TWFH 5EGTA 2PCFB 3HOUG 1SLJA 2NVQH 4EGVA 3BVMA 1VQHA 1YNND 2Q8RE 2R7DA 1WOCA 4JV5L 1CI3M 1YZ6A 2OTJA 1U4MA 1S3OA 2OQ0A 4DXFA 3CXCA 1B8AA 4XT1B 3HOYB 1WFQA 4NXNL 3TRZA 1STNA 3EROA 3OHXC 1N34L 1K9MC 4X64Q 2HDLA 4DV0L 2E76C 2WACA 2WAQB 1H9MA 4C2MB 1XMOQ 3NHHA 1JJGA 1JMCA 2F0WA 5E4XA 1K8GA 3GTMB 4C1NI 3GTPB 1IYVA 4KY7A 5IP7H 4HMIA 2WKDA 2ZTDA 2A6EC 2NZOA 4KI0A 1E2VA 4NXML 2VQFQ 4PG3A 1L0XB 4G57A 3K5LA 2R61A 2F4IA 4LFBQ 3TP5A 2HIVA 4HSVA 1ENFA 1VQNA 1HH2P 2A6ED 2RF4A 1N32Q 1T9HA 1KHIA 4DV7L 2JXMB 3JC66 3M4QA 1T5XD 3BZCA 4X3KA 5C4XG 3BVZA 4CJ0B 2J4XA 2AQ3B 4CJ2C 2MHVA 3MAQA 3H09A 1NNXA 1SE3A 3BJUA 4PZ8A 1B9NA 4JV5Q 1JOQA 1SXTA 3D6WA 3I4OA 3WOEA 3X3NA 1QVFA 2DGYA 5J1ZA 1YITA 1XWEA 2F4VL 2WB1B 2CHBD 3KJOA 1HUNA 2Q8TA 1FJGQ 1BKBA 4NXNQ 2QKIC 1CQFA 2F52A 1E0BA 1EY7A 4DUYL 4BY1B 1N34Q 4DV0Q 1PH8A 1KLGD 1KLUD 2EPBA 2F0TA 1VQDA 5I2YA 3NBHA 1TWFB 3QG1A 2K1BA 1TS2A 2XWJB 2NVQB 4A3CH 2D0OA 2I46A 1D7QA 1I6VC 3RLFA 5JJLA 2KOLA 3QJYA 5FO8B 3AB9A 2Q8IB 4F88A 1WTQA 5JEAH 1DONA 2E2HH 3I4MG 5C44H 4K2LA 1K0SA 1PV4A 2G5DA 4NKLA 1LM0A 2M9VA 4ZUIA 1PDQA 1PVOA 3HOZH 1ILPA 3NEMA 3GTJB 2DNEA 3KK7A 2JN4A 3AFPA 1PZID 2MPMA 1MI2A 2WKCA 2F4VQ 1Y8NB 3P20A 4YWKA 4NDXA 4DAYB 3VA5A 1S5FD 1W3SA 4R8IA 5L37A 2C5CA 5LMNL 4DUYQ 3ULPA 4BY7G 2CW0C 2NZHA 1HNXL 1IBMQ 1Q90A 3S1NB 5FK9C 1NJIC 3CMAA 4DV3L 4OIJA 1LLRD 1GM5A 2F0HA 2B39A 2ALYB 1Y1VB 3ND9A 1D1IA 2CW0D 4IURA 4OWXB 2F0LA 5CV4A 2QDLA 4WFN3 3TP7A 1HQMC 2ZT9C 2LFNA 2SNMA 1SNMA 3P7JA 1IL8A 1OTCA 4A76A 1JOKA 1I50H 3L3OC 4UY8C 1BOSA 3A7LA 1KABA 1DOLA 4QMGA 1NBWA 5IYDG 1PXUA 1YNJC 3C1FA 4OHJA 2VL6A 2F3WA 1VQOA 3W1GA 2ID0A 1ESRA 1MBYA 2LMCB 2JA5H 2BDOA 2K14A 1YNJD 4UHVA 1K8MA 2E2JH 3PO2G 3D4WA 2AMCB 3J80E 2Y0SE 5HGTA 4JI0L 2TMPA 3GTLH 4POGA 3NPPA 5FJ8H 1LUZA 1KQSA 5C3EB 3EBEA 3AMUA 1RODA 2E2HB 5CBAE 1JWSD 2F0OA 5C44B 3JAML 1HNXQ 3AEVA 2JA8B 1ASZA 2N55A 1EY6A 5C6AA 1GD7A 1EQQA 3HOWH 4BXXH 1D2BA 5GAEC 4DV3Q 4GNXC 1B9MA 3HOZB 1MGSA 3BU2A 2KBNA 2B2WC 4R4IA 5D3IB 3DWQA 1LTRD 1WCMG 1S40A 2CWPA 1SYGA 3OYYA 4RA8A 5AJ3L 4A3GB 4DR4L 4A3FG 3DEPA 3I4NH 1X3FA 2MFIA 2ZTCA 4L8JA 3VA7A 2KCMA 4DUZL 2ASBA 5KEEA 3VR4A 1IBLQ 3PUZA 1JCKB 4C3JH 1F77A 2L0CA 3T4AC 1C48A 2B2TA 1ENAA 3VR6A 4B3SL 3EVQA 3TSSA 3RLNA 4EQOA 2D2CC 5KNBA 2RA4A 4IJLA 4A3DG 2L11A 3BVGA 4ODGA 4JI0Q 4L5RC 4EQPA 1Q12A 2NN6G 2WV6D 1TVXA 4LF4L 1LTLA 3F2DA 1GUGA 1HUMA 1I50B 1K83H 2CH4A 1EEFD 4HIOA 2JA7H 1VQLA 4KV6A 4OXPA 4WORA 3K80C 1AZPA 3D6CA 1I6HB 5CGKA 1EZ6A 2ZXPA 2A73B 1BCPB 4A3BH 2ZJRA 1IKMA 2PI2E 1MIUA 3TEHB 1STHA 5AJ3Q 2E2JB 4DR4Q 4P72A 4KKSA 4R4TA 4KHPL 1UE1A 1C4QA 2ENBA 3CC4A 3VYUA 2K28A 4BBSB 4XDXA 2LS01 4OL7A 4A3EB 3MFGA 4DUZQ 4X3TA 2RHQB 2EYMA 3J7ZC 3MXNB 5JVH3 3KFUA 1U4RA 4NB3A 1Y1WH 3UDFA 3UE0A 1KXLA 3MFYA 5JEAJ 2EYOA 3NSWA 4B3SQ 3CC2A 4IJHA 3VR3A 2F0DA 4FF2A 3QR8A 1U4PA 1FD7D 2G9DA 3M4YA 4BA1I 2VUMB 1Q7YC 2RDGA 1QZGA 5I6WA 4JBMA 3S1QB 4C1NK 3EQLC 4JG2A 5C0XG 2I5MX 1PTOF 5ELBA 4GLAC 3I2ZA 5FLXL 3H3VC 3S16B 4DXGA 3I4NB 4LF4Q 2SNSA 2GN5A 2F0FA 3GDEA 2YTYA 1LTAD 2N78A 1RDPD 4FVMA 4LUZA 3S15H 1DYQA 4ZKBB 1SDFA 1TR5A 1GJXA 5IYBH 1HA6A 1SRUA 1GO3E 4F8MA 3H0GH 2N3SA 4R4QA 1KAWA 1ESFA 3E0EA 5IWAQ 1EIGA 1GOZA 3PUVA 3D0FA 4TRDA 1PRTC 2EJGC 4A3KH 3K8AA 4KHPQ 2RCFA 2SEBD 1E22A 3AU7A 1NMGA 1EY5A 1QNUA 4C3HH 1PRTD 4DAMA 1K83B 2E5LL 2QW7A 2PW5A 2MO0A 1QG7A 1V8QA 3S24A 4O2DA 4A3LG 3ND8A 1PFBA 1J8IA 1LV9A 4IFDH 4FF3A 3HOYG 4RKLA 2D0PA 2DJGC 4A3BB 4IPHA 3DM3A 3CCRA 4ZCKA 5C0XI 2B29A 5D3DA 3CRLC 2WAQG 1LTTD 2UXDL 2IPKD 4O0AA 3S2HB 1G91A 3JAMi 1EWIA 4QIWE 1HRJA 1TWHH 1HR0W 4DV1L 1JT8A 1BCPF 3FHWA 2EQSA 2ZM6L 1JICA 1Y1WB 2RKSA 1FL0A 2Q2IA 4RH6A 1KDAA 4DAYA 3KLWA 5IGEA 4RHSA 3A0JA 4ALPA 1M1KC 3ERSX 4EX5A 4R1JA 4K8JA 1JOOA 3MHBA 2K03A 1EY9A 3EA6A 3NBHB 4GLXA 2OQKA 5IGGA 1ONLA 4M1UB 3NTIA 2E5LQ 4BBRH 5FOBB 1Z6HA 2GVAA 2F3IA 4IZ8A 3TQYA 4KK7A 2WB1G 3UE1A 4QL5A 3PUXA 3FKIH 3W2DA 1WI5A 2K32A 3M4PA 3KLSX 1PH6A 2NVXH 1TWAB 1KTKA 2RBMA 2RSOA 1B2TA 5GAHC 4MN3A 4BY1G 4ZLTF 1OXUA 2ZTEA 5E3FA 3PSIA 1N36L 2UXDQ 2H5XA 4GLVB 2KCTA 1CA6A 2R3ZA 3I91A 3CCQA 1EWHA 5LMUL 1L1OC 4DV1Q 4K6DA 4LF6L 1NCVA 1FYCA 3OWEB 3I3CA 5FLMH 2ZM6Q 3H3VI 1M90C 3KUPA 2B2VA 4JK1C 3P75A 2BH8A 4RGNA 4OO1H 3UDGA 1XMQL 1MD2D 4C3IH 2KECA 1SNQA 2K6AA 2OT2A 4DR6L 1T5EA 1QUQB 2KCCA 2VW9A 3KOJA 4DR1L 4GZYC 3PCOB 2JEBI 2PYKA 3FEWX 1SYEA 4UAIA 2DN8A 4EQNA 1HZ9A 2EVBA 3BYTB 3FPUB 4DFAA 2SOBA 4XT3B 1BQQT 2AKWB 3CPFA 2PMZB 5IP7G 1O7YA 2AWOA 3D8GA 1KRTA 4RGTA 5CV9A 1LT3D 2OTLA 4GN3B 1RJTA 3A56A 2Z6KA 1I94L 1Q46A 2XGTA 1B70B 2BCOA 3CCSA 1PYWD 3QO2A 4K5WA 3K6OA 4YHHL 1FVIA 4KN7C 1N36Q 2GA4B 3C46A 4HAEA 2JQOA 2HQLA 4C56C 4NPSA 4K5XA 5LMUQ 1B53A 4LF6Q 1Y1VG 4ABNA 5EKKA 1E1TA 4R9WA 3H15A 2UUBQ 3QB3A 1NTGA 1KAAA 2FHTA 3H91A 1SBBB 4ZYSA 5IP9H 4GKJL 2R7FA 3MA2B 1S5ED 1NR2A 2K52A 2MGSA 1OO9B 1XMQQ 3FKIB 1C8CA 4ZQ3A 1TS4A 4P73A 3STBC 3V05A 4GN5A 4DAVA 4DR6Q 1DXMA 1XPUA 3E6ZX 4KY6A 5M3FH 1HFNA 4DF7A 4DR1Q 3ICEA 2JEAI 3RN5A 1SSOA 1BBXC 3STBD 5KYIA 3K7AB 1MKHA 3MXGA 4L6TB 1STYA 1YJNA 3M9BA 2PPBC 3RLOA 4PZ6A 5AFWA 3CCEA 2VY3A 4N9PA 3LWUA 1V1QA 5IT9c 2R92H 1I3QH 3GTGH 3GV3A 2XRQD 5EJWA 3CKIB 1I94Q 4PV1C 3PIP3 2P5ZX 4JI1L 2MQHA 3BDLA 3DUZA 1WTHA 5C3EG 2N49A 2TSSA 3R2IA 2OF1A 4YHHQ 5JOBA 2E74C 3X3MA 3RD4A 5C44G 5GQOA 2HIXA 3PUWA 3I90A 3MXNA 5ELDA 1QB5D 2M00A 4P75A 4LFCL 2JA8G 1AFPA 1JC7A 4IFDJ 4A3JH 3HOZG 1CHPD 3CAMA 3M7GA 1D6EC 1I4GA 4JI3L 1PH2A 3N6RA 1UUPA 2QDBA 3S2DH 3PMFA 3M4OH 1PFNA 3LX0A 4GKJQ 4A3GG 3HRZC 1QILA 4POFA 3HG9A 3PQIA 1NY4A 3DEOA 3HKZE 1QVCA 3PIO3 4OONA 1O7IA 3T1HL 3F1ZA 1CKMA 2IJ0A 3BDCA 1STAA 1Q8IA 3CD6A 1FJGL 2X6LA 2FMCA 3TS0A 3VYSA 3PIPA 1Q82C 2HQEA 1BVSA 1TWCH 4HCSA 2F0JA 3IL8A 5M3MH 5JJZA 1A0IA 4IPCA 5CORA 1W6JA 4A3IB 2Y0SB 2Z6BA 4JI1Q 3U58A 3D4DA 5KRUA 5M5WB 3PO3H 3MEHA 2ZJPA 4LFCQ 5M3FB 2O5IC 3OTOL 1FGUA 3A8JE 3KF8B 4UPAA 1EWCA 2XVSA 3ULLA 5J39A 4JI3Q 1GUTA 1R4QB 1DM0B 5M5YH 1SFOH 1GUNA 4IQZA 4XQNA 3PIOA 3T51B 1BDOA 2IX3A 3R93A 1I3QB 2K7VA 5IYCH 4HCEA 1XYIA 1LT6D 3I70A 2C9OA 2K50A 4BBSG 1IW7C 4A3EG 2OEOA 3SHLA 5HY6A 2FMMA 3T1HQ 3NK9A 2IW3A 1X9NA 1XJVA 1TT2A 2VZAA 3S1RB 1KL9A 5IGCA 4PNYA 4K0KL 3CCUA 3S17H 4BXXG 2DUDA 3J7YW 2B63B 3T53B 3CU7A 4XYQA 2EJMA 4H13C 2UXBL 1ML0D 1RTNA 4DGZA 2VUMG 2JP1A 1IBML 1O80A 1RCVD 1VQBA 3I8ZA 3K59A 4V190 3I4NG 3DWPA 1M4VA 4L63B 1A2UA 5LMNW 4ZKCB
chains in the Genus database with same CATH topology
1AP0A 1I4XA 4K6LA 3J81L 1PTOH 1TWCB 5C3WA 4ULLA 5M3MB 2NTTA 1ZXTA 1G8ZD 3KBGA 1TS3A 1F9RA 5CV7A 5A2QE 4UDUC 2F3VA 1FNUA 3FRPB 2EXZA 3R8BA 1DCZA 1JE4A 1JR0D 3MXPA 2EE1A 5EPKA 5A35A 2BDNA 1EYAA 1X3QA 1X3PA 4J8QA 5CV5A 2IT1A 3NTKA 3H6MA 1PFMA 4KY5A 3S17B 2PNRC 1F2LA 1UAPA 3A8KE 1EFID 3EFXD 4IUTA 4CKEA 2F0IA 2KA7A 2XSCA 2EYPA 2NUCA 4XXEA 1EQTA 1SYDA 1G2SA 4TSSA 1H9JA 5IOCA 1PRTF 1Y8OB 1TU2B 4RGOS 4OGQC 4HEDA 1WD1A 1PTOB 5BN4A 5I6YA 3C2PA 3MWYW 4FXKC 3SR1A 3G6JB 1SE4A 1B50A 4QIWB 4LK1C 2B2WA 2NTSA 5M9OA 2PZUA 3E5SA 2H4OA 3G7LA 3VR5A 1HFGA 1CQVA 1OXTA 2QEJC 4IFDG 4LJZC 3DWAA 3IFDA 2HDMA 1FR3A 1WD0A 1V1OA 2VNUD 1A15A 3OMGA 3U9OA 2EY2A 4WJWA 5C4JB 3E0JA 2B8GA 1CK1A 2EYJA 2K05A 2NZ1D 2A6HC 2B2TC 2Z4IA 4H44C 3QWNA 4DU9A 5D65A 4OIKA 3SK8A 2FINB 1O7LA 2A6HD 4QUFA 2Z1CA 1G2TA 3MZ5A 4X3SA 4MIUA 1ICWA 1LO5D 1TQOA 2JA5B 4NW2A 3HP3A 4Z9CB 1XX8A 3GTLB 2A74C 1TY0A 5BN3A 1SAPA 2EY6A 4XTCS 1EL0A 1I4PA 3GTKB 4KTAA 3HOWB 3A7AB 1OXXK 3KF8A 4N9TA 3SEBA 2R93B 2BA0A 5CR3A 1KNEA 3DMUA 1SNOA 5FO9B 1EEID 3K58A 2NN6I 1RTOA 2EY5A 4OO1G 3NXWA 1QCBD 1ZEQX 2MJ8A 5C3XA 4DNRB 1AEXA 3TP6A 4RCNA 2XN9C 1SMYC 4C3JB 1UEAB 4LAAA 4QCLA 1QWYA 3BG3A 2B2YA 1RKNA 1EU4A 1A3UA 1SMYD 5J22A 5DEHA 3SE0A 1DOKA 2JE6I 3C1EA 4KJOA 3MVVA 1PMRA 5M5XB 1FGBD 2O5JC 2JA7B 2KJXA 1G6ZA 3Q23A 2MUYA 4RFBA 4ZAIA 5C4ZA 3Q24A 2AUJD 4DK1A 3HZXA 5K36G 2R7ZB 4IUNA 1S5BD 4KKUA 4AYBB 1JORA 3OW7A 5IIFA 2A5HA 3SK5A 4PQXA 5KNCA 4TKOB 2VXWA 4R8NA 1CTMA 1ILQA 3IKJA 2DY7A 2F0SA 4I65A 3HOVB 5JAVA 2N88A 1AZQA 1TIID 2RQXA 3HKZB 4JBWA 3S15B 3R3OA 4ME5A 1D5XC 5I9OA 2JYOA 4KD4A 4P2CB 3H0GB 4XQQA 3IAYA 2B2UA 4G4KA 4A93B 5I9PA 4H7BA 4XYOA 4KHVA 3NWTA 1S4ZA 4A3KB 2CQAA 5ISRA 3RZDB 1JB3A 1TKWB 1GXDC 4C3HB 2PO4A 4FXDA 3OIPA 3T13A 1EIHA 2DY8A 3DXJC 5CV6A 5JPNC 3QOLA 2R6GA 5FO7B 4G7ZC 3D4RA 2B2VC 5C0XH 3PV0A 3HEJA 1XXGA 2D9UA 2FJ2A 1TWHB 4IALA 4U673 1STGA 3JAME 2PW7A 1SYBA 4K2KA 1I4HA 4A3MB 1DOMA 1F2MA 1S5CD 3GTQB 1O7ZA 3LWEA 3W3AA 1R4PB 1ET6A 1MSHA 3J7AV 1EY4A 4FP5D 2MP1A 3WOFA 1SNPA 1W6KA 4BBRB 3HGBA 4B9WA 3EJIA 1JQYD 5DM63 2FFKB 1JWMD 3K5MA 3RZOB 3J80L 2NVXB 3A55A 4ZRZA 3NP8A 2A69C 3N52A 1BO0A 1BR9A 3OOCA 5IGDA 3NUCA 1I4RA 2L55A 1GHKA 3FVQA 5I2XA 1EY8A 2RVLA 4HMJA 3I4LA 1Q3LA 1EY0A 2A69D 1VF7A 2EDGA 3ERQA 3FMCA 3ONAB 3L7ZC 5ELCA 3C3LA 4C3IB 5LL6X 5JEAG 1HPCA 1DJRD 1VMCA 2KEEA 4KJNA 1EYDA 1TY2A 2KHSA 2ICIA 3L9AX 1HQRD 3TMEA 3K57A 2SDFA 3O13A 4TQUS 3K5OA 3OWFA 2XNAC 4IUPA 4RHRA 3NQTA 1CFMA 1SNCA 5KIXA 2BA1A 1SJED 1JWUD 5CBEE 3OPOA 3MTSA 3VR2A 1H9KA 2F0NA 4CJ1B 2K04A 4B9XA 3ZYYX 2L1BA 1L0YB 2EYFA 3NBIA 4NP5A 1EOTA 3DHQA 1F9PA 5FLXE 2Z4HA 2JSOA 1A3TA 5DM73 4BWGB 1D1KA 4V0BA 1LTSD 1WTOA 3TN2A 1CZGA 4Y7NB 2I07B 3BYYB 5EPJA 5CC4A 1A6XA 1EZ8A 1STBA 3FPPA 4H0LC 1RHPA 2NWGA 2D5DA 1CA5A 1WTRA 3KBXA 1IKLA 3TP8A 2F0MA 3NWSA 3T56B 3P1HA 2R92B 5JPMC 3GTGB 2HUGA 1ENCA 2M2LA 2OXPA 2JA6B 3BS1A 2IL8A 2KVMA 2D62A 5TSSA 1SYFA 2PZTA 5LL6S 3TDQA 1IW7D 4IN3A 3MXUA 4HSPA 4A3JB 2XRSD 1AW7A 1NR4A 1B44D 4KHZA 3S2DB 3M4OB 1PRTB 1KDCA 4RWSC 4FNFA 5C0XJ 2K01A 2KEDA 1GUWA 3OSOA 3K5NA 3A8IE 1HCZA 2O2LD 4IUQA 2L9HA 5IGFA 4DK0A 1V1PA 4C3JG 1Q1EA 2LY7A 1Q1BA 1QOHA 1NSNS 1PZKD 2X6GA 5DNFA 1I4QA 3KLSA 1OXSC 2KUMA 1F9QA 3PO3B 2AWNA 1X32A 2BE5C 4CHTB 1DD2A 1LTID 5M5YB 1H9SB 1SFOB 1M8AA 5EPLA 4QF4A 2B8FA 1MSGA 2BE5D 5G3LD 2VB2X 2NVTB 1QE6A 2CVRA 4IUVA 1ZYRC 1BNZA 1GUSA 1GUOA 2PZWA 1LT4D 1D5MC 1ZYRD 1U9RA 1LABA 4ID6A 1Z7TA 2AUKA 3BDOA 3CQZB 1B1ZA 2K5DA 1WTPA 2H1EA 4RCOA 2F0KA 1B3AA 3UI2A 1J9OA 5JVG3 2F0PA 2E2DC 5EBCA 4IUUA 4K5VA 1HA5A 1S5DD 3CHBD 5T1IA 1R9TB 1EQVA 2IX1A 2YU9B 5CYUA 2K33A 3PUYA 4QUCA 5KGUA 1BXTA 4HTHA 4CGYB 2F03A 3RUZA 5T1GA 1F2YA 3SDZA 4BS9A 4C3HG 3HOXB 1VDZA 1VF5C 4FF4A 4WRDA 3SVMA 3S14B 3GP7A 1LT5D 4I7ZC 4K14A 2RSNA 5CV8A 1HTLD 3GO5A 1CM9A 1V43A 3QOJA 5IT9E 3J7AF 1UNSA 4PMBA 1STEA 3HOUB 5C4HA 1AN8A 1OXVA 2QILA 1FNVA 4MHEA 5C5MA 2WIIB 4KD3A 4E6IA 1EU3A 1Y69U 1PZJD 5ELEA 1K8OA 3MC0B 3VYTA 2WP8J 1Y8PB 1WTVA 1B4OA 1FNWA 3D3RA 4XQJA 4F7XA 2F0EA 4QB4A 4S3SA 1EYCA 3A54A 1LTGD 4KMUC 2BOSA 2RDHA 4IFDI 1RD9D 4DA2A 3QIAA 3V96A 2L12A 4CBVA 1WTXA 1TS5A 1F9SA 2F1MA 2KQ3A 2E75C 4ILWA 5C4XB 2QCPX 3CRKC 2EY1A 3M85A 4C3IG 1ZKOA 2RDFA 4RKBA 2F0GA 5CMDA 1PLFA 4NMZA 4FF1A 4RGMA 1H9RA 4HR7B 2EJFC 2NYZD 1QNKA 2F0VA 5I4DA 5KYLA 2AQ1B 2XIWA 3D31A 3LNNA 3GQBA 5HURA 2B2YC 3TZUA 4Q0FA 4K8IA 3I4MB 3SK4A 3GD7A 1A2TA 4PMCA 3S9WA 3NE5B 2F0QA 4OO1I 5LHY1 2V4DA 3Q22A 4G7OC 3I73A 3U9SA 3J81E 4O42A 2J7ZA 3M7NA 3V2TA 4F87A 4KN4C 1BUVT 1U4LA 4BY7B 1QJOA 1IHZA 1SYCA 5DAUA 4J6HA 3SK6A 1GHJA 1SNDA 2ZXOA 1HHVA 2KCNA 3WDNA 4M8AA 4ZUJA 3FDTA 4Q5VA 1H9SA 2HCCA 1II3A 1Z47A 5BN5A 2XWBB 3IFTA 4B08A 4YIJA 1CT1D 2ICEC 1RF2D 2NN6H 1V1PB 2Z8LA 1LTBD 3H94A 2LKVA 1KDBA 5KNDA 4RAUC 4XIGS 1LACA 3K0YA 1SJHD 3VYRA 1VCIA 1NAPA 3NQIA 5C5LA 1E2ZA 5EKIA 2NB0A 3PO2B 5ELFA 2B2UC 2VB3X 2NVYB 2QF7A 4CKCA 2WINB 1CZWA 4O1NA 5A2QL 2EZVA 3KLRA 4DN4M 3TBIB 4DAPA 2EYLA 2A68C 3RMHA 1WCMB 2PQEA 1HXYD 1TWGB 4J1MA 4A3FB 3OIQA 1D5ZC 4HN7A 1BF4A 2A68D 1A3VA 2E2IB 1PTOC 5IGBA 1CHQD 4FO2A 3URYA 1NUCA 5EBDA 4PMWA 1PTOD 3BZDB 4A3DB 3TZDA 3GTOB 3M3YB 1VMPA 3T16A 1DZ1A 1WTWA 3I72A 1ET9A 5NUCA 1IYUA 5COYA 3Q6SA 5E4WC 3R2TA 2AQ2B 5EKLA 3HS0C 2YYZA 4CKBA 3F2UA 2X69A 1F2ZA 2EOTA 2F0UA 3NTHA 5D14A 3ITPA 1HTPA 4KKTA 1XTCD 1O78A 4G7HC 5K36H 2O4XA 5F2DA 1SEBD 5IODA 1WVLA 2DNCA 2J0TD 4EVOA 4ZK9B 4FYDA 2L5TA 1BCPC 4BA2I 5K5PA 5FKAC 2K5WA 3DM1A 4U68A 1BCPD 2HCIA 3SXHA 2IX0A 5G3LF 4X3UA 5IT9L 1KNAA 2NBFA 3GV6A 3Q0AA 1G291 4LMQD 3S1MB 1SE2A 5E1FA 2G9HD 1E2WA 2L4NA 4DNTB 3OMCA 2IWHA 5EQ0A 4FXGC 1YNNC 2EYHA 2K5QA 2ZXRA 5EGTA 2PCFB 4EGVA 3BVMA 1YNND 2Q8RE 1CI3M 1U4MA 4DXFA 4XT1B 3HOYB 1STNA 3EROA 3OHXC 2HDLA 2E76C 2WACA 2WAQB 1H9MA 4C2MB 3NHHA 2F0WA 5E4XA 3GTMB 4C1NI 3GTPB 1IYVA 4KY7A 4HMIA 2WKDA 2A6EC 4KI0A 1E2VA 1L0XB 4G57A 3K5LA 2R61A 2F4IA 3TP5A 4HSVA 1ENFA 2A6ED 2JXMB 1T5XD 4X3KA 3BVZA 4CJ0B 2J4XA 2AQ3B 4CJ2C 2MHVA 3MAQA 3H09A 1SE3A 1B9NA 1JOQA 1SXTA 3D6WA 3X3NA 3WOEA 5J1ZA 1XWEA 2WB1B 2CHBD 1HUNA 2Q8TA 2QKIC 1CQFA 1E0BA 1EY7A 4BY1B 1KLGD 1KLUD 2EPBA 2F0TA 5I2YA 3NBHA 1TWFB 3QG1A 2K1BA 1TS2A 2XWJB 2NVQB 2I46A 1I6VC 3RLFA 2KOLA 3QJYA 5FO8B 3AB9A 2Q8IB 4F88A 1WTQA 5JEAH 1DONA 4K2LA 4NKLA 2M9VA 4ZUIA 1PDQA 1ILPA 3GTJB 2DNEA 3KK7A 1PZID 2MPMA 1MI2A 2WKCA 1Y8NB 3P20A 4NDXA 3VA5A 1S5FD 4R8IA 2C5CA 2CW0C 1Q90A 3S1NB 5FK9C 4OIJA 1LLRD 2F0HA 2B39A 3ND9A 1Y1VB 1D1IA 2CW0D 4IURA 2F0LA 5CV4A 4WFN3 3TP7A 1HQMC 2ZT9C 2LFNA 2SNMA 1SNMA 3P7JA 1IL8A 1JOKA 3L3OC 1BOSA 3A7LA 1KABA 1DOLA 4QMGA 1PXUA 1YNJC 3C1FA 4OHJA 2F3WA 2ID0A 1ESRA 1MBYA 2LMCB 2BDOA 1YNJD 1K8MA 3D4WA 3J80E 5HGTA 2TMPA 3NPPA 5C3EB 3AMUA 1RODA 2E2HB 5CBAE 1JWSD 2F0OA 5C44B 3JAML 2JA8B 2N55A 1EY6A 5C6AA 1D2BA 1B9MA 3HOZB 1MGSA 2B2WC 5D3IB 3DWQA 1LTRD 1SYGA 4RA8A 4A3GB 3DEPA 4L8JA 3VA7A 5KEEA 3VR4A 3PUZA 1JCKB 1F77A 2L0CA 3T4AC 1C48A 2B2TA 1ENAA 3VR6A 3EVQA 3TSSA 4EQOA 2D2CC 5KNBA 2RA4A 2L11A 3BVGA 4ODGA 4EQPA 1Q12A 2NN6G 2WV6D 1TVXA 1GUGA 1HUMA 1I50B 1EEFD 4KV6A 4WORA 1AZPA 1I6HB 3D6CA 5CGKA 1EZ6A 2ZXPA 2A73B 1BCPB 1IKMA 1STHA 2E2JB 4KKSA 1C4QA 2ENBA 3VYUA 2K28A 4BBSB 4XDXA 2LS01 4OL7A 4A3EB 3MFGA 4X3TA 2EYMA 5JVH3 1U4RA 3MFYA 5JEAJ 2EYOA 3NSWA 3VR3A 2F0DA 4FF2A 1U4PA 1FD7D 2G9DA 3M4YA 4BA1I 2VUMB 2RDGA 5I6WA 3S1QB 4C1NK 3EQLC 5C0XG 1PTOF 5ELBA 5FLXL 3H3VC 3S16B 4DXGA 3I4NB 2SNSA 2F0FA 1LTAD 1RDPD 4FVMA 1DYQA 4ZKBB 1SDFA 1TR5A 1GJXA 1HA6A 4F8MA 1ESFA 1EIGA 1GOZA 3PUVA 4TRDA 1PRTC 2EJGC 2SEBD 3AU7A 1EY5A 1QNUA 1PRTD 1K83B 2PW5A 1QG7A 1V8QA 3ND8A 1PFBA 1J8IA 1LV9A 4IFDH 4FF3A 4RKLA 4A3BB 5C0XI 5D3DA 3CRLC 1LTTD 2IPKD 1G91A 3S2HB 1HRJA 1BCPF 1JICA 1Y1WB 2RKSA 4RH6A 1KDAA 4DAYA 5IGEA 4RHSA 4K8JA 1JOOA 3MHBA 2K03A 1EY9A 3EA6A 5IGGA 1ONLA 4M1UB 3NTIA 5FOBB 1Z6HA 4IZ8A 4KK7A 3PUXA 3W2DA 2K32A 3KLSX 1TWAB 1KTKA 2RBMA 2RSOA 1B2TA 4MN3A 4ZLTF 1OXUA 5E3FA 1CA6A 2R3ZA 3I91A 1EWHA 4K6DA 1NCVA 1FYCA 3OWEB 3I3CA 3KUPA 2B2VA 4JK1C 3P75A 4RGNA 4OO1H 1MD2D 2KECA 1SNQA 2K6AA 2OT2A 1T5EA 2KCCA 4GZYC 2JEBI 2PYKA 3FEWX 1SYEA 4UAIA 2DN8A 4EQNA 2EVBA 3BYTB 3FPUB 4DFAA 2SOBA 4XT3B 1BQQT 2PMZB 1O7YA 2AWOA 3D8GA 4RGTA 5CV9A 1LT3D 1RJTA 3A56A 2BCOA 1PYWD 3QO2A 4K5WA 3K6OA 4KN7C 2GA4B 3C46A 4HAEA 4C56C 4K5XA 1B53A 4ABNA 5EKKA 4R9WA 3QB3A 1KAAA 2FHTA 3H91A 1SBBB 4ZYSA 1S5ED 1NR2A 2MGSA 3MA2B 1C8CA 1OO9B 3FKIB 4ZQ3A 1TS4A 3V05A 4DAVA 1DXMA 3E6ZX 4KY6A 1HFNA 4DF7A 2JEAI 1SSOA 1BBXC 5KYIA 3K7AB 3MXGA 4L6TB 1STYA 2PPBC 5AFWA 4N9PA 3LWUA 3GV3A 2XRQD 5EJWA 3CKIB 4PV1C 3PIP3 3BDLA 3DUZA 2TSSA 3R2IA 2OF1A 5JOBA 2E74C 3X3MA 3RD4A 3PUWA 3I90A 3MXNA 5ELDA 1QB5D 2M00A 1AFPA 1JC7A 4IFDJ 1CHPD 3M7GA 1D6EC 1I4GA 3N6RA 1UUPA 2QDBA 3PMFA 1PFNA 3LX0A 3HRZC 1QILA 3HG9A 3DEOA 3PIO3 2IJ0A 3BDCA 1STAA 1Q8IA 2X6LA 2FMCA 3VYSA 2HQEA 4HCSA 2F0JA 3IL8A 5JJZA 5CORA 1W6JA 4A3IB 2Y0SB 3D4DA 5KRUA 5M5WB 3MEHA 2O5IC 5M3FB 3A8JE 1EWCA 2XVSA 5J39A 1GUTA 1R4QB 1DM0B 1GUNA 4IQZA 4XQNA 3T51B 1BDOA 2IX3A 3R93A 1I3QB 2K7VA 4HCEA 1XYIA 1LT6D 3I70A 2C9OA 1IW7C 2OEOA 3SHLA 2FMMA 3NK9A 2IW3A 1TT2A 3S1RB 5IGCA 4PNYA 3J7YW 2B63B 3T53B 3CU7A 4XYQA 2EJMA 4H13C 1ML0D 1RTNA 4DGZA 2JP1A 1O80A 1RCVD 3I8ZA 3K59A 4V190 3DWPA 1M4VA 4L63B 1A2UA 4ZKCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MWY W;  2KEC A;  1HHV A;  1B3A A;  3UI2 A;  5COY A;  1AP0 A;  3FDT A;  1J9O A;  1PFN A;  2B2T A;  2MJ8 A;  2HDL A;  3Q6S A;  2HCC A;  1B50 A;  1S4Z A;  5E4W C;  3ONA B;  2L12 A;  4IUU A;  4R8I A;  2B2W A;  1WTX A;  2RA4 A;  1NR4 A;  1QG7 A;  2L11 A;  3DEO A;  5T1I A;  4UAI A;  3G7L A;  1F9S A;  1VMC A;  1PFB A;  2KEE A;  5E4X A;  3FPU B;  1J8I A;  1LV9 A;  1HFG A;  4XT3 B;  4RWS C;  3F2U A;  2B2Y A;  1ZXT A;  2K01 A;  2KED A;  2X69 A;  1GUW A;  1TVX A;  1EIH A;  2EOT A;  5D14 A;  4OIJ A;  2SDF A;  2DY8 A;  1O7Y A;  4QUC A;  1HUM A;  4IUQ A;  3IFD A;  2HDM A;  1F9R A;  4RAU C;  2L9H A;  2X6L A;  1WD0 A;  4IUP A;  1RJT A;  4IUR A;  1DOK A;  4HSV A;  1A15 A;  4HCS A;  3QO2 A;  1G91 A;  1AZP A;  3IL8 A;  5T1G A;  1HRJ A;  1WVL A;  1NAP A;  5JJZ A;  5COR A;  5EKI A;  5CBE E;  3P7J A;  1JE4 A;  1IL8 A;  4ZK9 B;  1IKM A;  2EE1 A;  2B2V C;  4X3K A;  4HAE A;  3MTS A;  1G6Z A;  1JIC A;  4CJ0 B;  5EPK A;  2B2U C;  2K05 A;  2X6G A;  4CJ1 B;  2BDN A;  4CJ2 C;  3SVM A;  2K04 A;  1DOL A;  1X3Q A;  1PLF A;  1X3P A;  1B53 A;  2D9U A;  2FJ2 A;  5DNF A;  2L1B A;  5CMD A;  3D6W A;  4R9W A;  2K28 A;  4ZAI A;  2NZ1 D;  4XDX A;  2B2T C;  1EOT A;  2KUM A;  1F9P A;  2NYZ D;  2FHT A;  2RSN A;  3DM1 A;  3H91 A;  1QNK A;  4U68 A;  4X3T A;  1DOM A;  1HUN A;  1F9Q A;  1ESR A;  2K03 A;  2Q8T A;  2MGS A;  1NR2 A;  2XIW A;  1C8C A;  2HCI A;  4DN4 M;  5D65 A;  1U4R A;  4OIK A;  4X3U A;  2FIN B;  1E0B A;  1CM9 A;  1KNA A;  1WTO A;  1O7Z A;  1X32 A;  3GV6 A;  3TN2 A;  4QUF A;  1G2T A;  1PFM A;  2B2Y C;  3LWE A;  4LMQ D;  3R93 A;  4X3S A;  1ICW A;  1MSH A;  1F2L A;  2EPB A;  1XYI A;  1HFN A;  4NW2 A;  1U4P A;  2K1B A;  3HP3 A;  1ROD A;  1SSO A;  5EPJ A;  1BBX C;  1M8A A;  4IUT A;  5EPL A;  2L4N A;  2FMM A;  5CBA E;  1MSG A;  1XX8 A;  2MP1 A;  2VXW A;  5EQ0 A;  1BF4 A;  1ILQ A;  2N55 A;  4MHE A;  1QE6 A;  2CVR A;  1RHP A;  4IUV A;  5AFW A;  2RSO A;  1B2T A;  2DY7 A;  1BNZ A;  1MGS A;  4MN3 A;  2NWG A;  1SAP A;  1EL0 A;  4ZLT F;  1EQT A;  2B2W C;  2FFK B;  2KOL A;  3GV3 A;  5EJW A;  1G2S A;  1WTR A;  3KBX A;  1CA5 A;  1IKL A;  1WTQ A;  4ZKB B;  1SDF A;  1HA6 A;  1DON A;  1ML0 D;  1WTV A;  1B4O A;  1RTN A;  1CA6 A;  2N88 A;  4RA8 A;  2Q8R E;  1AZQ A;  2JP1 A;  2R3Z A;  3I91 A;  3N52 A;  1BO0 A;  4O42 A;  1O80 A;  2J7Z A;  1NCV A;  2HUG A;  2M2L A;  3DEP A;  3I8Z A;  3I90 A;  1PDQ A;  3I3C A;  3TZD A;  1U4M A;  1EIG A;  1ILP A;  2JYO A;  2IL8 A;  2KVM A;  3KUP A;  1KNE A;  2B2V A;  2RVL A;  1U4L A;  1VMP A;  1WTP A;  1Q3L A;  2H1E A;  4HED A;  2B2U A;  4XT1 B;  1WTW A;  1WD1 A;  2MPM A;  1MI2 A;  1DZ1 A;  1RTO A;  4ZKC B; 
#chains in the Genus database with same CATH topology
 3OTO Q;  1PH3 A;  4IPG A;  4FDB A;  2PQA A;  2VS1 A;  1AP0 A;  1VQC A;  1R9T H;  1I4X A;  4JBK A;  4K6L A;  2YU9 H;  1JB7 A;  3J81 L;  1PTO H;  1TWC B;  5C3W A;  3CME A;  1X56 A;  4IOA A;  4ULL A;  5M3M B;  2NTT A;  1ZXT A;  5E7N A;  1G8Z D;  3KBG A;  1VQ6 A;  1TS3 A;  1F9R A;  5CV7 A;  3NEL A;  5A2Q E;  3HOX H;  4UDU C;  4JI2 Q;  1YVC A;  3E9H A;  2F3V A;  1FNU A;  3FRP B;  4K0K Q;  1EYG A;  2EXZ A;  3R8B A;  1DCZ A;  4GKK L;  1JE4 A;  1JR0 D;  3MXP A;  2EE1 A;  3TS2 A;  2UXB Q;  5EPK A;  5A35 A;  4A3B G;  2BDN A;  1EYA A;  1X3Q A;  1X3P A;  4IPD A;  1QUQ A;  1X54 A;  2Z0S A;  4J8Q A;  4N8F A;  4YCV A;  5CV5 A;  4APV A;  5C4J H;  2IT1 A;  5ELO A;  3HOU H;  3NTK A;  1SRO A;  1EFW A;  3H6M A;  1S72 A;  3OW2 A;  1E1O A;  1Y1W G;  3F8T A;  1PFM A;  4LF8 L;  4KY5 A;  3S17 B;  2PNR C;  1F2L A;  3FP9 A;  1UAP A;  3A8K E;  5HGQ A;  1EFI D;  3EFX D;  4LF5 Q;  4IUT A;  4CKE A;  1PH1 A;  1IBL L;  2ES2 A;  2F0I A;  2KA7 A;  2LXJ A;  2XSC A;  2EYP A;  3G4S A;  2NUC A;  4XXE A;  3AQQ A;  1EQT A;  1SYD A;  1G2S A;  4TSS A;  1AH9 A;  5JJI A;  4I7A A;  2K5V A;  1H9J A;  5IOC A;  1WJJ A;  1WYD A;  5GAD C;  1PRT F;  4GOP C;  3JAM c;  4GKK Q;  1L0W A;  1Y8O B;  1TU2 B;  1EUJ A;  1GVP A;  4RGO S;  4OGQ C;  4HED A;  1WD1 A;  1PTO B;  4H02 A;  3GTK H;  5BN4 A;  5I6Y A;  3C2P A;  3MWY W;  4LF9 L;  4FXK C;  3SR1 A;  3G6J B;  1SE4 A;  1B50 A;  1YNX A;  2R93 H;  4GNX A;  4QIW B;  5C4X H;  4LK1 C;  2B2W A;  4J15 A;  2NTS A;  5M9O A;  1YJ9 A;  2PZU A;  3E5S A;  2H4O A;  3G7L A;  4LF8 Q;  3VR5 A;  1HFG A;  1CQV A;  1OXT A;  2QEJ C;  4IFD G;  1HNW L;  4LJZ C;  1G51 A;  4MZ9 A;  3DWA A;  3IFD A;  4JOI C;  2HDM A;  4MTK A;  1FR3 A;  1WD0 A;  1V1O A;  1YHB A;  2VNU D;  1A15 A;  3OMG A;  1VQP A;  3U9O A;  2EY2 A;  4LW1 A;  4WJW A;  1XPR A;  5C4J B;  1PA6 A;  3E0J A;  2B8G A;  2ATW A;  1CK1 A;  2EYJ A;  4QJF A;  2K05 A;  2I5H A;  4HJ5 A;  2KHJ A;  2NZ1 D;  2A6H C;  2B2T C;  4JI6 Q;  2Z4I A;  4H44 C;  3QWN A;  5M5X H;  1YHA A;  4DU9 A;  5D65 A;  4OIK A;  3SK8 A;  4LF9 Q;  2FIN B;  3J7A 5;  1O7L A;  2A6H D;  4QUF A;  2Z1C A;  1G2T A;  3MZ5 A;  2EXD A;  4DKA C;  4X3S A;  4MIU A;  1ICW A;  1LO5 D;  1TQO A;  2JA5 B;  4NW2 A;  2WFW A;  5IWA L;  3HP3 A;  4Z9C B;  3KDF B;  3W5O A;  1XX8 A;  4DV6 L;  3GTL B;  2A74 C;  4X65 L;  3FKI G;  3J81 i;  1TY0 A;  1HNW Q;  2R7Z H;  5BN3 A;  3LGJ A;  1SAP A;  2EY6 A;  4XTC S;  1EL0 A;  4HJ9 A;  1I4P A;  3GTK B;  4KTA A;  3HOW B;  3A7A B;  5IE8 A;  4BY7 H;  1PH5 A;  1A8V A;  1OXX K;  3KF8 A;  4N9T A;  3SEB A;  1KIX A;  2R93 B;  2BA0 A;  2LXK A;  5CR3 A;  5FLX c;  1KNE A;  3DMU A;  4L5Q A;  1SNO A;  5FO9 B;  5FLM G;  1EEI D;  3K58 A;  2NN6 I;  3HOV H;  1RTO A;  1K3B C;  2EY5 A;  4OO1 G;  3NXW A;  1QCB D;  1ZEQ X;  2MJ8 A;  5C3X A;  4DNR B;  1AEX A;  3TP6 A;  4RCN A;  1P16 A;  2XN9 C;  1SMY C;  3F2C A;  4C3J B;  1UEA B;  4LAA A;  4QCL A;  5EAY A;  5IYD H;  1QWY A;  4JYA L;  3BG3 A;  2B2Y A;  4A93 H;  1RKN A;  1K0R A;  1EU4 A;  1A3U A;  1V9P A;  1SMY D;  5J22 A;  4DV2 L;  2QA4 A;  5DEH A;  3SE0 A;  4DV6 Q;  3RZD H;  1XNR L;  4X65 Q;  3EIV A;  1DOK A;  3PO2 H;  2JE6 I;  3C1E A;  4KJO A;  1DGS A;  3MVV A;  1PMR A;  5M5X B;  1FGB D;  2O5J C;  2JA7 B;  2KJX A;  2CFM A;  1G6Z A;  3VDY A;  3Q23 A;  1Q86 C;  4OX9 L;  3CP0 A;  2MUY A;  4RFB A;  4ZAI A;  5C4Z A;  1UWV A;  3Q24 A;  3U4Z A;  2AUJ D;  2PI2 A;  4DK1 A;  4A3I G;  2Y0S G;  3HZX A;  1TWG H;  5K36 G;  2R7Z B;  4IUN A;  1S5B D;  4KKU A;  4AYB B;  1JOR A;  4A3M H;  3OW7 A;  5M3F G;  5IIF A;  2A5H A;  4YWL A;  3SK5 A;  4PQX A;  5KNC A;  4TKO B;  4JYA Q;  2VXW A;  1EIF A;  1VQM A;  4R8N A;  1CTM A;  1ILQ A;  3IKJ A;  3GTQ H;  3PF5 A;  2DY7 A;  4DV2 Q;  2F0S A;  1K8A C;  4I65 A;  4A3D H;  1XNR Q;  3HOV B;  5JAV A;  3GTO H;  2N88 A;  1AZQ A;  1TII D;  5GAG C;  4X62 L;  2RQX A;  3HKZ B;  4JBW A;  3S15 B;  4YY3 L;  2PQA B;  3R3O A;  4ME5 A;  2XTI A;  1D5X C;  5I9O A;  2JYO A;  4KD4 A;  3I7F A;  4P2C B;  3T1Y L;  3H0G B;  4XQQ A;  3IAY A;  2B2U A;  4OX9 Q;  3RZO H;  4G4K A;  2B63 G;  4A4I A;  4A93 B;  4B3R L;  5I9P A;  4H7B A;  4XYO A;  4KHV A;  3NWT A;  2I5L X;  1S4Z A;  4A3K B;  2CQA A;  5ISR A;  3RZD B;  1JB3 A;  1BBU A;  1TKW B;  1GXD C;  4C3H B;  2PO4 A;  4FXD A;  2UUB L;  4JVZ A;  3OIP A;  3T13 A;  1EIH A;  2DY8 A;  3DXJ C;  5CV6 A;  5JPN C;  3QOL A;  4AIM A;  1HNZ L;  2R6G A;  5FO7 B;  4LUO A;  1SMX A;  3PGZ A;  4EQ5 A;  1VQ7 A;  4G7Z C;  5M3M G;  3D4R A;  1CSQ A;  2B2V C;  5C0X H;  3PV0 A;  4OWT B;  3HEJ A;  1XXG A;  2D9U A;  2FJ2 A;  1TWH B;  4IAL A;  4X62 Q;  4U67 3;  3E9I A;  1STG A;  3JAM E;  4YY3 Q;  2PW7 A;  1SYB A;  4K2K A;  1I4H A;  4A3M B;  3T1Y Q;  4AQY Q;  1DOM A;  3DLL A;  4DR5 L;  1F2M A;  3F2B A;  1S5C D;  1VQJ A;  4CDC C;  4B3R Q;  3GTQ B;  1O7Z A;  3LWE A;  3W3A A;  1R4P B;  1ET6 A;  4DR3 L;  1MSH A;  3J7A V;  1EY4 A;  4FP5 D;  5IYC G;  2HT1 A;  1K28 A;  1RL2 A;  2MP1 A;  3WOF A;  1SNP A;  4DK6 C;  1W6K A;  4BBR B;  3HGB A;  4B9W A;  3EJI A;  3EN2 A;  1JQY D;  5DM6 3;  2FFK B;  4Y7N H;  4HIM A;  1JWM D;  3K5M A;  2HD3 A;  3RZO B;  3B6Y A;  3J80 L;  4A3L H;  2NVX B;  1HNZ Q;  3A55 A;  2YTX A;  4ZRZ A;  3NP8 A;  2A69 C;  3HOY H;  3N52 A;  1BO0 A;  1BR9 A;  3OOC A;  3KF6 A;  4CDD C;  3NUC A;  5IGD A;  1I4R A;  2L55 A;  1GHK A;  3FVQ A;  3RN2 A;  5I2X A;  4GNX B;  1EY8 A;  2RVL A;  4HMJ A;  3I4L A;  1Q3L A;  1EY0 A;  2A69 D;  4C2M H;  2KHI A;  4A3C G;  2A8V A;  1VF7 A;  4RG1 A;  2EDG A;  4Y52 H;  3ERQ A;  3FMC A;  4DR5 Q;  3UDX A;  2JA6 H;  1B7Y B;  3KDF A;  3ONA B;  1C7Y A;  2YV5 A;  3L7Z C;  3H3V H;  1UE7 A;  5ELC A;  3C3L A;  1PYS B;  3J81 j;  4C3I B;  5LL6 X;  5JEA G;  2E8G A;  1HPC A;  2K75 A;  3RR5 A;  1DJR D;  2B3G A;  1VMC A;  2KEE A;  2GVB A;  4KJN A;  4LFA L;  1EYD A;  1TY2 A;  4DR3 Q;  2KHS A;  2ICI A;  3L9A X;  1HQR D;  3TME A;  3K57 A;  2SDF A;  3O13 A;  4TQU S;  3A74 A;  3K5O A;  3OWF A;  2XNA C;  4IUP A;  1UE5 A;  4RHR A;  4CDE C;  4R4C A;  3NQT A;  1CFM A;  1SNC A;  5KIX A;  2BA1 A;  4TVA B;  1SJE D;  1JWU D;  5CBE E;  3OPO A;  1B3Q A;  3MTS A;  3VR2 A;  1H9K A;  2F0N A;  4CJ1 B;  2K04 A;  4B9X A;  1UE6 A;  2L1B A;  3ZYY X;  1L0Y B;  2EYF A;  3NBI A;  4NP5 A;  4BY1 H;  1EOT A;  1HZC A;  1F9P A;  3DHQ A;  5FLX E;  2Z4H A;  2JSO A;  1A3T A;  2KEN A;  1ASY A;  5DM7 3;  4BWG B;  1D1K A;  4V0B A;  1LTS D;  1WTO A;  3TN2 A;  4DR7 L;  3CF5 A;  4PZ7 A;  2N8N A;  1N33 L;  1CZG A;  1GKH A;  4Y7N B;  2I07 B;  3BYY B;  5EPJ A;  1NE3 A;  5CC4 A;  2JA9 A;  4LFA Q;  1A6X A;  1EZ8 A;  1STB A;  3FPP A;  4H0L C;  1RHP A;  2NWG A;  2D5D A;  3CCV A;  2CKZ B;  3W1B A;  3HKS A;  1CA5 A;  1WTR A;  1W2B A;  3KBX A;  1IKL A;  3TP8 A;  2F0M A;  2JA5 G;  3GTJ H;  3NWS A;  3WWV A;  3ZJY C;  3T56 B;  3P1H A;  2R92 B;  2K5H A;  5JPM C;  3GTG B;  2NVT H;  1KRS A;  2HUG A;  1ENC A;  2M2L A;  2OXP A;  1SR3 A;  2JA6 B;  3BS1 A;  5FJ8 G;  2IL8 A;  2KVM A;  2D62 A;  5TSS A;  4HID A;  3PF4 A;  4WJ4 A;  1SYF A;  4L5S A;  2PZT A;  1XTD A;  2PNH A;  5LL6 S;  3TDQ A;  4HIK A;  1C0A A;  4JI2 L;  2IHF A;  1IW7 D;  4IN3 A;  3MXU A;  4HSP A;  3ULJ A;  3HOW G;  4A3J B;  2XRS D;  1AW7 A;  3S1N H;  4RMF A;  2R93 G;  1NR4 A;  3CQZ H;  1B44 D;  4DR7 Q;  1PH7 A;  4KHZ A;  1Y1V H;  4JW0 A;  3S2D B;  3M4O B;  1PRT B;  1KDC A;  1N33 Q;  2PMZ E;  4RWS C;  4FNF A;  5C0X J;  2K01 A;  2KED A;  1GUW A;  3OSO A;  3K5N A;  3A8I E;  1HCZ A;  2O2L D;  4IUQ A;  5J3B A;  2L9H A;  5IGF A;  4DK0 A;  1V1P A;  4X6A H;  4C3J G;  1Q1E A;  2LY7 A;  1Q1B A;  1QOH A;  3J81 c;  2EIF A;  1NSN S;  2Z9H A;  1QZH A;  1IZ6 A;  1YI2 A;  4LF5 L;  1PZK D;  2X6G A;  5DNF A;  3J80 i;  2UU9 L;  1I4Q A;  3BZK A;  1PH9 A;  3KLS A;  1OXS C;  2KUM A;  2IHE A;  4NXM Q;  2UXC L;  3CPW A;  1C9O A;  1F9Q A;  1KD1 C;  1AE3 A;  3PO3 B;  5C3E H;  2JA7 G;  2AWN A;  1X32 A;  2ZJQ A;  1VQE A;  3S14 H;  2BE5 C;  4CHT B;  1DD2 A;  4DV7 Q;  1LTI D;  2JA8 H;  1BBW A;  1Q81 C;  4LNQ A;  2JK8 A;  4N8X 1;  1H9S B;  2RHS B;  1SFO B;  5M5Y B;  1M8A A;  5EPL A;  4QF4 A;  3CCL A;  2B8F A;  1MSG A;  2BE5 D;  5G3L D;  2VB2 X;  2NVT B;  1CSP A;  2Q2H A;  1QE6 A;  2CVR A;  4IUV A;  1CKN A;  1ZYR C;  1BNZ A;  4A3G H;  2R7Z G;  1IYJ B;  1GUS A;  2VQE L;  1YJW A;  2RCN A;  3K0X A;  2I0Q A;  1GUO A;  4AH6 A;  1VQK A;  4AYB G;  4LWC A;  2PZW A;  1LT4 D;  1D5M C;  1ZYR D;  1U9R A;  1LAB A;  1NMF A;  4ID6 A;  1Z7T A;  4DPG A;  1G6P A;  2AUK A;  1VQI A;  3BDO A;  3CQZ B;  1B1Z A;  2K5D A;  4YCW A;  2H1E A;  1WTP A;  4RCO A;  2UU9 Q;  1N9W A;  1XNQ L;  3HOV G;  4UP8 A;  2F0K A;  4JBJ A;  1B3A A;  3UI2 A;  2UXC Q;  1J9O A;  1EQR A;  5JVG 3;  2F0P A;  2E2D C;  1L1O B;  5EBC A;  3HKZ G;  4IUU A;  4DV5 L;  4K5V A;  1HA5 A;  1S5D D;  3CHB D;  5T1I A;  5IYB G;  4X66 L;  3H0G G;  1R9T B;  1EQV A;  1RIP A;  1PHJ A;  4L5T A;  4JI6 L;  1I6H H;  2IX1 A;  2YU9 B;  1VQG A;  4GOP A;  5CYU A;  4A93 G;  2K33 A;  3PUY A;  4QUC A;  5BR8 L;  5KGU A;  2V1C C;  4R4O A;  1BXT A;  4HTH A;  1LYL A;  4JCV E;  1HZB A;  4A3K G;  4CGY B;  1EIY B;  3E3X A;  2F03 A;  3RUZ A;  2WAQ E;  5T1G A;  1F2Y A;  3SDZ A;  4BS9 A;  2VQE Q;  4BBS H;  4C3H G;  1MJC A;  4A3E H;  3HOX B;  1VDZ A;  1VF5 C;  3MEF A;  4YCU A;  5LMN Q;  1U0L A;  4FF4 A;  4WRD A;  3SVM A;  2DJF C;  1ICF B;  3S14 B;  4B3T L;  3G6E A;  1IXR A;  4DV4 L;  1MHW C;  3GP7 A;  1LT5 D;  4I7Z C;  4K14 A;  3G71 A;  2RSN A;  3UDI A;  1XPO A;  5CV8 A;  1HTL D;  3CW2 C;  4JOI A;  3GO5 A;  1XNQ Q;  4UP9 A;  3A5Z B;  4IO9 A;  2VUM H;  4HJA A;  1CM9 A;  1V43 A;  3QOJ A;  1VQA A;  5IT9 E;  3S1Q H;  4JI4 L;  3J7A F;  1UNS A;  4QGU A;  3S16 H;  1PYB A;  4DV5 Q;  4PMB A;  1STE A;  3HOU B;  3Q8D A;  5C4H A;  4X66 Q;  4A3M G;  1AN8 A;  1OXV A;  2QIL A;  2WB1 E;  1FNV A;  2Q2U A;  2L15 A;  4MHE A;  5C5M A;  5IY0 A;  1J5E L;  2Q2T A;  2WII B;  5BR8 Q;  4KD3 A;  4E6I A;  1HJP A;  1EU3 A;  3KF6 B;  1Y69 U;  1PZJ D;  3I4M H;  5ELE A;  1K8O A;  3MC0 B;  3VYT A;  5JJK A;  2WP8 J;  1Y8P B;  1WTV A;  1B4O A;  1FNW A;  4GS3 A;  1D8L A;  4JPB W;  3D3R A;  4XQJ A;  4F7X A;  2F0E A;  4QB4 A;  4S3S A;  4BBR G;  1EYC A;  3A54 A;  4OEM B;  1LTG D;  4KMU C;  1PFS A;  2BOS A;  2MO1 A;  1X65 A;  4B3T Q;  2RDH A;  4DV4 Q;  4IFD I;  4UP7 A;  1EOV A;  1A63 A;  2A19 A;  1RD9 D;  4JI8 L;  2OCE A;  3QIA A;  3V96 A;  4DA2 A;  2L12 A;  4CBV A;  1WTX A;  1TS5 A;  1J6Q A;  1JE5 A;  4JI4 Q;  1F9S A;  1SN8 A;  2F1M A;  4IOC A;  2KQ3 A;  2E75 C;  4ILW A;  5C4X B;  3S2H H;  2QCP X;  3CRK C;  4ME3 A;  1X3G A;  4QQB X;  4A75 A;  2EY1 A;  3I56 A;  3M85 A;  3CCJ A;  1J5E Q;  4C3I G;  3G48 A;  4CDF C;  1ZKO A;  2RDF A;  4HJ8 A;  1A62 A;  4RKB A;  1JJC B;  3NEN A;  2F0G A;  1TXY A;  1PLF A;  1CUK A;  4NMZ A;  5CMD A;  2CCZ A;  4FF1 A;  4RGM A;  1H9R A;  2HHH L;  2OWO A;  4HR7 B;  2EJF C;  2NYZ D;  1YIJ A;  1QNK A;  2F0V A;  1VQ9 A;  3ER0 A;  5I4D A;  5KYL A;  1N8R C;  2AQ1 B;  2XIW A;  3D31 A;  2FXQ A;  3LNN A;  2NVY H;  3GQB A;  5HUR A;  4JI8 Q;  2B2Y C;  3TZU A;  4Q0F A;  4K8I A;  2K4K A;  3K81 C;  1TWA H;  1E3P A;  1YBY A;  3I4M B;  1KC8 C;  2JJQ A;  3SK4 A;  4KLK A;  3GD7 A;  1Z9F A;  1A2T A;  2YTV A;  4PMC A;  1VQ5 A;  3S9W A;  3TRE A;  1JJ2 A;  1H95 A;  4P71 A;  3NE5 B;  2F0Q A;  1WCM H;  5IP9 G;  4OO1 I;  5LHY 1;  1Y14 B;  2V4D A;  4DK3 C;  2CWA A;  3Q22 A;  4G7O C;  3I73 A;  4A3F H;  3U9S A;  2QEX A;  3J81 E;  4DR2 L;  4O42 A;  2J7Z A;  5GRO A;  3M7N A;  4JI5 L;  2E2I H;  3SGI A;  3V2T A;  1QVG A;  4F87 A;  4KN4 C;  1BUV T;  1AE2 A;  1U4L A;  4BY7 B;  1QJO A;  1SYC A;  1IHZ A;  5DLQ E;  5DAU A;  1UEB A;  2HHH Q;  4J6H A;  3SK6 A;  1GHJ A;  1SND A;  2ZXO A;  1HHV A;  2KCN A;  3WDN A;  4M8A A;  4ZUJ A;  3FDT A;  4Q5V A;  1H9S A;  2HCC A;  1II3 A;  1Z47 A;  2R92 G;  5BN5 A;  2XWB B;  3IFT A;  4B08 A;  4YIJ A;  2JA6 G;  4MNO A;  1CT1 D;  3M3Y H;  2ICE C;  1RF2 D;  2NN6 H;  1V1P B;  1VQ4 A;  2Z8L A;  1LTB D;  3H94 A;  4B3M L;  2LKV A;  1KDB A;  4AQY L;  5KND A;  4A3J G;  1L2F A;  1CKO A;  2AHO B;  4RAU C;  2BH2 A;  4HJ7 A;  4XIG S;  3U4V A;  1LAC A;  3K0Y A;  1SJH D;  3VYR A;  1VCI A;  1X3E A;  1E7Z A;  1NAP A;  3NQI A;  1E2Z A;  5C5L A;  1PH4 A;  1IBK L;  5EKI A;  3KYH C;  2NB0 A;  3PO2 B;  5ELF A;  1X55 A;  2B2U C;  2VB3 X;  2NVY B;  4DR2 Q;  2QF7 A;  3A5U A;  3HFZ B;  1U5K A;  4JI5 Q;  4CKC A;  1HR0 L;  1L1O A;  2WIN B;  2CH4 W;  3CC7 A;  1CZW A;  1P8L A;  3U50 C;  3AFQ A;  4O1N A;  1K3R A;  5A2Q L;  4JI7 L;  2EZV A;  3KLR A;  4DN4 M;  3TBI B;  3K7A H;  4DAP A;  1VS0 A;  2EYL A;  2A68 C;  3RMH A;  1CKN B;  1WCM B;  2PQE A;  1HZA A;  1HXY D;  1I5F A;  1MJE A;  1TWG B;  4J1M A;  4A3F B;  3K7U C;  3OIQ A;  1D5Z C;  4HN7 A;  1BF4 A;  2UUC L;  2A68 D;  4B3M Q;  3PO3 G;  4LUV A;  1A3V A;  2UUA L;  2E2I B;  3S1M H;  1PTO C;  5IGB A;  3IRB A;  1CHQ D;  4FO2 A;  3URY A;  1K73 C;  1NUC A;  5EBD A;  4PMW A;  2QGQ A;  3RNU A;  1X6O A;  4WJ3 M;  1PTO D;  4JC0 A;  1IBK Q;  3BZD B;  4A3D B;  3TZD A;  3GTO B;  1YEZ A;  4LF7 L;  2Z6K C;  3M3Y B;  1VMP A;  3T16 A;  1DZ1 A;  1WTW A;  3I72 A;  5ELN A;  1VQ8 A;  1ET9 A;  1HR0 Q;  5NUC A;  3I55 A;  1IYU A;  2A1A A;  3AYH B;  3J80 c;  5COY A;  3Q6S A;  4JI7 Q;  1SE8 A;  5E4W C;  2CQO A;  3R2T A;  4GN4 B;  4GOP B;  2AQ2 B;  5EKL A;  1YHQ A;  3HS0 C;  2YYZ A;  4CKB A;  3F2U A;  2X69 A;  1F2Z A;  2EOT A;  2F0U A;  3NTH A;  5D14 A;  3L2P A;  3ITP A;  1HTP A;  2LSS A;  4KKT A;  1VQF A;  1XTC D;  1O78 A;  4G7H C;  4A3I H;  2UUC Q;  5K36 H;  2O4X A;  5F2D A;  2UUA Q;  2MNA A;  3GTM H;  1SEB D;  5M5W H;  3GTP H;  5IOD A;  1WVL A;  1Q8K A;  2DNC A;  5H1S E;  4OWW B;  2J0T D;  4EVO A;  4ZK9 B;  4DNI A;  4FYD A;  2L5T A;  1BCP C;  4BA2 I;  5K5P A;  1E24 A;  5FKA C;  2K5W A;  1IL2 A;  2C35 B;  4YWM A;  3DM1 A;  4LF7 Q;  4U68 A;  4X64 L;  1BCP D;  2HCI A;  3SXH A;  3L0O A;  2IX0 A;  5G3L F;  4X3U A;  4MTN A;  5IT9 L;  3HOX G;  1XMO L;  1KNA A;  2NBF A;  3GV6 A;  4OEL B;  4QY7 A;  4AYB E;  3Q0A A;  1G29 1;  4LMQ D;  3S1M B;  1SE2 A;  3S1R H;  5E1F A;  3CCM A;  3KJP A;  2G9H D;  1E2W A;  2L4N A;  4DNT B;  2VQF L;  2K5N A;  2B63 H;  3OMC A;  2IWH A;  5EQ0 A;  4LFB L;  4FXG C;  4P74 A;  2IY5 B;  1YNN C;  2EYH A;  1N32 L;  2K5Q A;  2ZXR A;  1TWF H;  5EGT A;  2PCF B;  3HOU G;  1SLJ A;  2NVQ H;  4EGV A;  3BVM A;  1VQH A;  1YNN D;  2Q8R E;  2R7D A;  1WOC A;  4JV5 L;  1CI3 M;  1YZ6 A;  2OTJ A;  1U4M A;  1S3O A;  2OQ0 A;  4DXF A;  3CXC A;  1B8A A;  4XT1 B;  3HOY B;  1WFQ A;  4NXN L;  3TRZ A;  1STN A;  3ERO A;  3OHX C;  1N34 L;  1K9M C;  4X64 Q;  2HDL A;  4DV0 L;  2E76 C;  2WAC A;  2WAQ B;  1H9M A;  4C2M B;  1XMO Q;  3NHH A;  1JJG A;  1JMC A;  2F0W A;  5E4X A;  1K8G A;  3GTM B;  4C1N I;  3GTP B;  1IYV A;  4KY7 A;  5IP7 H;  4HMI A;  2WKD A;  2ZTD A;  2A6E C;  2NZO A;  4KI0 A;  1E2V A;  4NXM L;  2VQF Q;  4PG3 A;  1L0X B;  4G57 A;  3K5L A;  2R61 A;  2F4I A;  4LFB Q;  3TP5 A;  2HIV A;  4HSV A;  1ENF A;  1VQN A;  1HH2 P;  2A6E D;  2RF4 A;  1N32 Q;  1T9H A;  1KHI A;  4DV7 L;  2JXM B;  3JC6 6;  3M4Q A;  1T5X D;  3BZC A;  4X3K A;  5C4X G;  3BVZ A;  4CJ0 B;  2J4X A;  2AQ3 B;  4CJ2 C;  2MHV A;  3MAQ A;  3H09 A;  1NNX A;  1SE3 A;  3BJU A;  4PZ8 A;  1B9N A;  4JV5 Q;  1JOQ A;  1SXT A;  3D6W A;  3I4O A;  3WOE A;  3X3N A;  1QVF A;  2DGY A;  5J1Z A;  1YIT A;  1XWE A;  2F4V L;  2WB1 B;  2CHB D;  3KJO A;  1HUN A;  2Q8T A;  1FJG Q;  1BKB A;  4NXN Q;  2QKI C;  1CQF A;  2F52 A;  1E0B A;  1EY7 A;  4DUY L;  4BY1 B;  1N34 Q;  4DV0 Q;  1PH8 A;  1KLG D;  1KLU D;  2EPB A;  2F0T A;  1VQD A;  5I2Y A;  3NBH A;  1TWF B;  3QG1 A;  2K1B A;  1TS2 A;  2XWJ B;  2NVQ B;  4A3C H;  2D0O A;  2I46 A;  1D7Q A;  1I6V C;  3RLF A;  5JJL A;  2KOL A;  3QJY A;  5FO8 B;  3AB9 A;  2Q8I B;  4F88 A;  1WTQ A;  5JEA H;  1DON A;  2E2H H;  3I4M G;  5C44 H;  4K2L A;  1K0S A;  1PV4 A;  2G5D A;  4NKL A;  1LM0 A;  2M9V A;  4ZUI A;  1PDQ A;  1PVO A;  3HOZ H;  1ILP A;  3NEM A;  3GTJ B;  2DNE A;  3KK7 A;  2JN4 A;  3AFP A;  1PZI D;  2MPM A;  1MI2 A;  2WKC A;  2F4V Q;  1Y8N B;  3P20 A;  4YWK A;  4NDX A;  4DAY B;  3VA5 A;  1S5F D;  1W3S A;  4R8I A;  5L37 A;  2C5C A;  5LMN L;  4DUY Q;  3ULP A;  4BY7 G;  2CW0 C;  2NZH A;  1HNX L;  1IBM Q;  1Q90 A;  3S1N B;  5FK9 C;  1NJI C;  3CMA A;  4DV3 L;  4OIJ A;  1LLR D;  1GM5 A;  2F0H A;  2B39 A;  2ALY B;  1Y1V B;  3ND9 A;  1D1I A;  2CW0 D;  4IUR A;  4OWX B;  2F0L A;  5CV4 A;  2QDL A;  4WFN 3;  3TP7 A;  1HQM C;  2ZT9 C;  2LFN A;  2SNM A;  1SNM A;  3P7J A;  1IL8 A;  1OTC A;  4A76 A;  1JOK A;  1I50 H;  3L3O C;  4UY8 C;  1BOS A;  3A7L A;  1KAB A;  1DOL A;  4QMG A;  1NBW A;  5IYD G;  1PXU A;  1YNJ C;  3C1F A;  4OHJ A;  2VL6 A;  2F3W A;  1VQO A;  3W1G A;  2ID0 A;  1ESR A;  1MBY A;  2LMC B;  2JA5 H;  2BDO A;  2K14 A;  1YNJ D;  4UHV A;  1K8M A;  2E2J H;  3PO2 G;  3D4W A;  2AMC B;  3J80 E;  2Y0S E;  5HGT A;  4JI0 L;  2TMP A;  3GTL H;  4POG A;  3NPP A;  5FJ8 H;  1LUZ A;  1KQS A;  5C3E B;  3EBE A;  3AMU A;  1ROD A;  2E2H B;  5CBA E;  1JWS D;  2F0O A;  5C44 B;  3JAM L;  1HNX Q;  3AEV A;  2JA8 B;  1ASZ A;  2N55 A;  1EY6 A;  5C6A A;  1GD7 A;  1EQQ A;  3HOW H;  4BXX H;  1D2B A;  5GAE C;  4DV3 Q;  4GNX C;  1B9M A;  3HOZ B;  1MGS A;  3BU2 A;  2KBN A;  2B2W C;  4R4I A;  5D3I B;  3DWQ A;  1LTR D;  1WCM G;  1S40 A;  2CWP A;  1SYG A;  3OYY A;  4RA8 A;  5AJ3 L;  4A3G B;  4DR4 L;  4A3F G;  3DEP A;  3I4N H;  1X3F A;  2MFI A;  2ZTC A;  4L8J A;  3VA7 A;  2KCM A;  4DUZ L;  2ASB A;  5KEE A;  3VR4 A;  1IBL Q;  3PUZ A;  1JCK B;  4C3J H;  1F77 A;  2L0C A;  3T4A C;  1C48 A;  2B2T A;  1ENA A;  3VR6 A;  4B3S L;  3EVQ A;  3TSS A;  3RLN A;  4EQO A;  2D2C C;  5KNB A;  2RA4 A;  4IJL A;  4A3D G;  2L11 A;  3BVG A;  4ODG A;  4JI0 Q;  4L5R C;  4EQP A;  1Q12 A;  2NN6 G;  2WV6 D;  1TVX A;  4LF4 L;  1LTL A;  3F2D A;  1GUG A;  1HUM A;  1I50 B;  1K83 H;  2CH4 A;  1EEF D;  4HIO A;  2JA7 H;  1VQL A;  4KV6 A;  4OXP A;  4WOR A;  3K80 C;  1AZP A;  3D6C A;  1I6H B;  5CGK A;  1EZ6 A;  2ZXP A;  2A73 B;  1BCP B;  4A3B H;  2ZJR A;  1IKM A;  2PI2 E;  1MIU A;  3TEH B;  1STH A;  5AJ3 Q;  2E2J B;  4DR4 Q;  4P72 A;  4KKS A;  4R4T A;  4KHP L;  1UE1 A;  1C4Q A;  2ENB A;  3CC4 A;  3VYU A;  2K28 A;  4BBS B;  4XDX A;  2LS0 1;  4OL7 A;  4A3E B;  3MFG A;  4DUZ Q;  4X3T A;  2RHQ B;  2EYM A;  3J7Z C;  3MXN B;  5JVH 3;  3KFU A;  1U4R A;  4NB3 A;  1Y1W H;  3UDF A;  3UE0 A;  1KXL A;  3MFY A;  5JEA J;  2EYO A;  3NSW A;  4B3S Q;  3CC2 A;  4IJH A;  3VR3 A;  2F0D A;  4FF2 A;  3QR8 A;  1U4P A;  1FD7 D;  2G9D A;  3M4Y A;  4BA1 I;  2VUM B;  1Q7Y C;  2RDG A;  1QZG A;  5I6W A;  4JBM A;  3S1Q B;  4C1N K;  3EQL C;  4JG2 A;  5C0X G;  2I5M X;  1PTO F;  5ELB A;  4GLA C;  3I2Z A;  5FLX L;  3H3V C;  3S16 B;  4DXG A;  3I4N B;  4LF4 Q;  2SNS A;  2GN5 A;  2F0F A;  3GDE A;  2YTY A;  1LTA D;  2N78 A;  1RDP D;  4FVM A;  4LUZ A;  3S15 H;  1DYQ A;  4ZKB B;  1SDF A;  1TR5 A;  1GJX A;  5IYB H;  1HA6 A;  1SRU A;  1GO3 E;  4F8M A;  3H0G H;  2N3S A;  4R4Q A;  1KAW A;  1ESF A;  3E0E A;  5IWA Q;  1EIG A;  1GOZ A;  3PUV A;  3D0F A;  4TRD A;  1PRT C;  2EJG C;  4A3K H;  3K8A A;  4KHP Q;  2RCF A;  2SEB D;  1E22 A;  3AU7 A;  1NMG A;  1EY5 A;  1QNU A;  4C3H H;  1PRT D;  4DAM A;  1K83 B;  2E5L L;  2QW7 A;  2PW5 A;  2MO0 A;  1QG7 A;  1V8Q A;  3S24 A;  4O2D A;  4A3L G;  3ND8 A;  1PFB A;  1J8I A;  1LV9 A;  4IFD H;  4FF3 A;  3HOY G;  4RKL A;  2D0P A;  2DJG C;  4A3B B;  4IPH A;  3DM3 A;  3CCR A;  4ZCK A;  5C0X I;  2B29 A;  5D3D A;  3CRL C;  2WAQ G;  1LTT D;  2UXD L;  2IPK D;  4O0A A;  3S2H B;  1G91 A;  3JAM i;  1EWI A;  4QIW E;  1HRJ A;  1TWH H;  1HR0 W;  4DV1 L;  1JT8 A;  1BCP F;  3FHW A;  2EQS A;  2ZM6 L;  1JIC A;  1Y1W B;  2RKS A;  1FL0 A;  2Q2I A;  4RH6 A;  1KDA A;  4DAY A;  3KLW A;  5IGE A;  4RHS A;  3A0J A;  4ALP A;  1M1K C;  3ERS X;  4EX5 A;  4R1J A;  4K8J A;  1JOO A;  3MHB A;  2K03 A;  1EY9 A;  3EA6 A;  3NBH B;  4GLX A;  2OQK A;  5IGG A;  1ONL A;  4M1U B;  3NTI A;  2E5L Q;  4BBR H;  5FOB B;  1Z6H A;  2GVA A;  2F3I A;  4IZ8 A;  3TQY A;  4KK7 A;  2WB1 G;  3UE1 A;  4QL5 A;  3PUX A;  3FKI H;  3W2D A;  1WI5 A;  2K32 A;  3M4P A;  3KLS X;  1PH6 A;  2NVX H;  1TWA B;  1KTK A;  2RBM A;  2RSO A;  1B2T A;  5GAH C;  4MN3 A;  4BY1 G;  4ZLT F;  1OXU A;  2ZTE A;  5E3F A;  3PSI A;  1N36 L;  2UXD Q;  2H5X A;  4GLV B;  2KCT A;  1CA6 A;  2R3Z A;  3I91 A;  3CCQ A;  1EWH A;  5LMU L;  1L1O C;  4DV1 Q;  4K6D A;  4LF6 L;  1NCV A;  1FYC A;  3OWE B;  3I3C A;  5FLM H;  2ZM6 Q;  3H3V I;  1M90 C;  3KUP A;  2B2V A;  4JK1 C;  3P75 A;  2BH8 A;  4RGN A;  4OO1 H;  3UDG A;  1XMQ L;  1MD2 D;  4C3I H;  2KEC A;  1SNQ A;  2K6A A;  2OT2 A;  4DR6 L;  1T5E A;  1QUQ B;  2KCC A;  2VW9 A;  3KOJ A;  4DR1 L;  4GZY C;  3PCO B;  2JEB I;  2PYK A;  3FEW X;  1SYE A;  4UAI A;  2DN8 A;  4EQN A;  1HZ9 A;  2EVB A;  3BYT B;  3FPU B;  4DFA A;  2SOB A;  4XT3 B;  1BQQ T;  2AKW B;  3CPF A;  2PMZ B;  5IP7 G;  1O7Y A;  2AWO A;  3D8G A;  1KRT A;  4RGT A;  5CV9 A;  1LT3 D;  2OTL A;  4GN3 B;  1RJT A;  3A56 A;  2Z6K A;  1I94 L;  1Q46 A;  2XGT A;  1B70 B;  2BCO A;  3CCS A;  1PYW D;  3QO2 A;  4K5W A;  3K6O A;  4YHH L;  1FVI A;  4KN7 C;  1N36 Q;  2GA4 B;  3C46 A;  4HAE A;  2JQO A;  2HQL A;  4C56 C;  4NPS A;  4K5X A;  5LMU Q;  1B53 A;  4LF6 Q;  1Y1V G;  4ABN A;  5EKK A;  1E1T A;  4R9W A;  3H15 A;  2UUB Q;  3QB3 A;  1NTG A;  1KAA A;  2FHT A;  3H91 A;  1SBB B;  4ZYS A;  5IP9 H;  4GKJ L;  2R7F A;  3MA2 B;  1S5E D;  1NR2 A;  2K52 A;  2MGS A;  1OO9 B;  1XMQ Q;  3FKI B;  1C8C A;  4ZQ3 A;  1TS4 A;  4P73 A;  3STB C;  3V05 A;  4GN5 A;  4DAV A;  4DR6 Q;  1DXM A;  1XPU A;  3E6Z X;  4KY6 A;  5M3F H;  1HFN A;  4DF7 A;  4DR1 Q;  3ICE A;  2JEA I;  3RN5 A;  1SSO A;  1BBX C;  3STB D;  5KYI A;  3K7A B;  1MKH A;  3MXG A;  4L6T B;  1STY A;  1YJN A;  3M9B A;  2PPB C;  3RLO A;  4PZ6 A;  5AFW A;  3CCE A;  2VY3 A;  4N9P A;  3LWU A;  1V1Q A;  5IT9 c;  2R92 H;  1I3Q H;  3GTG H;  3GV3 A;  2XRQ D;  5EJW A;  3CKI B;  1I94 Q;  4PV1 C;  3PIP 3;  2P5Z X;  4JI1 L;  2MQH A;  3BDL A;  3DUZ A;  1WTH A;  5C3E G;  2N49 A;  2TSS A;  3R2I A;  2OF1 A;  4YHH Q;  5JOB A;  2E74 C;  3X3M A;  3RD4 A;  5C44 G;  5GQO A;  2HIX A;  3PUW A;  3I90 A;  3MXN A;  5ELD A;  1QB5 D;  2M00 A;  4P75 A;  4LFC L;  2JA8 G;  1AFP A;  1JC7 A;  4IFD J;  4A3J H;  3HOZ G;  1CHP D;  3CAM A;  3M7G A;  1D6E C;  1I4G A;  4JI3 L;  1PH2 A;  3N6R A;  1UUP A;  2QDB A;  3S2D H;  3PMF A;  3M4O H;  1PFN A;  3LX0 A;  4GKJ Q;  4A3G G;  3HRZ C;  1QIL A;  4POF A;  3HG9 A;  3PQI A;  1NY4 A;  3DEO A;  3HKZ E;  1QVC A;  3PIO 3;  4OON A;  1O7I A;  3T1H L;  3F1Z A;  1CKM A;  2IJ0 A;  3BDC A;  1STA A;  1Q8I A;  3CD6 A;  1FJG L;  2X6L A;  2FMC A;  3TS0 A;  3VYS A;  3PIP A;  1Q82 C;  2HQE A;  1BVS A;  1TWC H;  4HCS A;  2F0J A;  3IL8 A;  5M3M H;  5JJZ A;  1A0I A;  4IPC A;  5COR A;  1W6J A;  4A3I B;  2Y0S B;  2Z6B A;  4JI1 Q;  3U58 A;  3D4D A;  5KRU A;  5M5W B;  3PO3 H;  3MEH A;  2ZJP A;  4LFC Q;  5M3F B;  2O5I C;  3OTO L;  1FGU A;  3A8J E;  3KF8 B;  4UPA A;  1EWC A;  2XVS A;  3ULL A;  5J39 A;  4JI3 Q;  1GUT A;  1R4Q B;  1DM0 B;  5M5Y H;  1SFO H;  1GUN A;  4IQZ A;  4XQN A;  3PIO A;  3T51 B;  1BDO A;  2IX3 A;  3R93 A;  1I3Q B;  2K7V A;  5IYC H;  4HCE A;  1XYI A;  1LT6 D;  3I70 A;  2C9O A;  2K50 A;  4BBS G;  1IW7 C;  4A3E G;  2OEO A;  3SHL A;  5HY6 A;  2FMM A;  3T1H Q;  3NK9 A;  2IW3 A;  1X9N A;  1XJV A;  1TT2 A;  2VZA A;  3S1R B;  1KL9 A;  5IGC A;  4PNY A;  4K0K L;  3CCU A;  3S17 H;  4BXX G;  2DUD A;  3J7Y W;  2B63 B;  3T53 B;  3CU7 A;  4XYQ A;  2EJM A;  4H13 C;  2UXB L;  1ML0 D;  1RTN A;  4DGZ A;  2VUM G;  2JP1 A;  1IBM L;  1O80 A;  1RCV D;  1VQB A;  3I8Z A;  3K59 A;  4V19 0;  3I4N G;  3DWP A;  1M4V A;  4L63 B;  1A2U A;  5LMN W;  4ZKC B; 
#chains in the Genus database with same CATH homology
 1AP0 A;  1I4X A;  4K6L A;  3J81 L;  1PTO H;  1TWC B;  5C3W A;  4ULL A;  5M3M B;  2NTT A;  1ZXT A;  1G8Z D;  3KBG A;  1TS3 A;  1F9R A;  5CV7 A;  5A2Q E;  4UDU C;  2F3V A;  1FNU A;  3FRP B;  2EXZ A;  3R8B A;  1DCZ A;  1JE4 A;  1JR0 D;  3MXP A;  2EE1 A;  5EPK A;  5A35 A;  2BDN A;  1EYA A;  1X3Q A;  1X3P A;  4J8Q A;  5CV5 A;  2IT1 A;  3NTK A;  3H6M A;  1PFM A;  4KY5 A;  3S17 B;  2PNR C;  1F2L A;  1UAP A;  3A8K E;  1EFI D;  3EFX D;  4IUT A;  4CKE A;  2F0I A;  2KA7 A;  2XSC A;  2EYP A;  2NUC A;  4XXE A;  1EQT A;  1SYD A;  1G2S A;  4TSS A;  1H9J A;  5IOC A;  1PRT F;  1Y8O B;  1TU2 B;  4RGO S;  4OGQ C;  4HED A;  1WD1 A;  1PTO B;  5BN4 A;  5I6Y A;  3C2P A;  3MWY W;  4FXK C;  3SR1 A;  3G6J B;  1SE4 A;  1B50 A;  4QIW B;  4LK1 C;  2B2W A;  2NTS A;  5M9O A;  2PZU A;  3E5S A;  2H4O A;  3G7L A;  3VR5 A;  1HFG A;  1CQV A;  1OXT A;  2QEJ C;  4IFD G;  4LJZ C;  3DWA A;  3IFD A;  2HDM A;  1FR3 A;  1WD0 A;  1V1O A;  2VNU D;  1A15 A;  3OMG A;  3U9O A;  2EY2 A;  4WJW A;  5C4J B;  3E0J A;  2B8G A;  1CK1 A;  2EYJ A;  2K05 A;  2NZ1 D;  2A6H C;  2B2T C;  2Z4I A;  4H44 C;  3QWN A;  4DU9 A;  5D65 A;  4OIK A;  3SK8 A;  2FIN B;  1O7L A;  2A6H D;  4QUF A;  2Z1C A;  1G2T A;  3MZ5 A;  4X3S A;  4MIU A;  1ICW A;  1LO5 D;  1TQO A;  2JA5 B;  4NW2 A;  3HP3 A;  4Z9C B;  1XX8 A;  3GTL B;  2A74 C;  1TY0 A;  5BN3 A;  1SAP A;  2EY6 A;  4XTC S;  1EL0 A;  1I4P A;  3GTK B;  4KTA A;  3HOW B;  3A7A B;  1OXX K;  3KF8 A;  4N9T A;  3SEB A;  2R93 B;  2BA0 A;  5CR3 A;  1KNE A;  3DMU A;  1SNO A;  5FO9 B;  1EEI D;  3K58 A;  2NN6 I;  1RTO A;  2EY5 A;  4OO1 G;  3NXW A;  1QCB D;  1ZEQ X;  2MJ8 A;  5C3X A;  4DNR B;  1AEX A;  3TP6 A;  4RCN A;  2XN9 C;  1SMY C;  4C3J B;  1UEA B;  4LAA A;  4QCL A;  1QWY A;  3BG3 A;  2B2Y A;  1RKN A;  1EU4 A;  1A3U A;  1SMY D;  5J22 A;  5DEH A;  3SE0 A;  1DOK A;  2JE6 I;  3C1E A;  4KJO A;  3MVV A;  1PMR A;  5M5X B;  1FGB D;  2O5J C;  2JA7 B;  2KJX A;  1G6Z A;  3Q23 A;  2MUY A;  4RFB A;  4ZAI A;  5C4Z A;  3Q24 A;  2AUJ D;  4DK1 A;  3HZX A;  5K36 G;  2R7Z B;  4IUN A;  1S5B D;  4KKU A;  4AYB B;  1JOR A;  3OW7 A;  5IIF A;  2A5H A;  3SK5 A;  4PQX A;  5KNC A;  4TKO B;  2VXW A;  4R8N A;  1CTM A;  1ILQ A;  3IKJ A;  2DY7 A;  2F0S A;  4I65 A;  3HOV B;  5JAV A;  2N88 A;  1AZQ A;  1TII D;  2RQX A;  3HKZ B;  4JBW A;  3S15 B;  3R3O A;  4ME5 A;  1D5X C;  5I9O A;  2JYO A;  4KD4 A;  4P2C B;  3H0G B;  4XQQ A;  3IAY A;  2B2U A;  4G4K A;  4A93 B;  5I9P A;  4H7B A;  4XYO A;  4KHV A;  3NWT A;  1S4Z A;  4A3K B;  2CQA A;  5ISR A;  3RZD B;  1JB3 A;  1TKW B;  1GXD C;  4C3H B;  2PO4 A;  4FXD A;  3OIP A;  3T13 A;  1EIH A;  2DY8 A;  3DXJ C;  5CV6 A;  5JPN C;  3QOL A;  2R6G A;  5FO7 B;  4G7Z C;  3D4R A;  2B2V C;  5C0X H;  3PV0 A;  3HEJ A;  1XXG A;  2D9U A;  2FJ2 A;  1TWH B;  4IAL A;  4U67 3;  1STG A;  3JAM E;  2PW7 A;  1SYB A;  4K2K A;  1I4H A;  4A3M B;  1DOM A;  1F2M A;  1S5C D;  3GTQ B;  1O7Z A;  3LWE A;  3W3A A;  1R4P B;  1ET6 A;  1MSH A;  3J7A V;  1EY4 A;  4FP5 D;  2MP1 A;  3WOF A;  1SNP A;  1W6K A;  4BBR B;  3HGB A;  4B9W A;  3EJI A;  1JQY D;  5DM6 3;  2FFK B;  1JWM D;  3K5M A;  3RZO B;  3J80 L;  2NVX B;  3A55 A;  4ZRZ A;  3NP8 A;  2A69 C;  3N52 A;  1BO0 A;  1BR9 A;  3OOC A;  5IGD A;  3NUC A;  1I4R A;  2L55 A;  1GHK A;  3FVQ A;  5I2X A;  1EY8 A;  2RVL A;  4HMJ A;  3I4L A;  1Q3L A;  1EY0 A;  2A69 D;  1VF7 A;  2EDG A;  3ERQ A;  3FMC A;  3ONA B;  3L7Z C;  5ELC A;  3C3L A;  4C3I B;  5LL6 X;  5JEA G;  1HPC A;  1DJR D;  1VMC A;  2KEE A;  4KJN A;  1EYD A;  1TY2 A;  2KHS A;  2ICI A;  3L9A X;  1HQR D;  3TME A;  3K57 A;  2SDF A;  3O13 A;  4TQU S;  3K5O A;  3OWF A;  2XNA C;  4IUP A;  4RHR A;  3NQT A;  1CFM A;  1SNC A;  5KIX A;  2BA1 A;  1SJE D;  1JWU D;  5CBE E;  3OPO A;  3MTS A;  3VR2 A;  1H9K A;  2F0N A;  4CJ1 B;  2K04 A;  4B9X A;  3ZYY X;  2L1B A;  1L0Y B;  2EYF A;  3NBI A;  4NP5 A;  1EOT A;  3DHQ A;  1F9P A;  5FLX E;  2Z4H A;  2JSO A;  1A3T A;  5DM7 3;  4BWG B;  1D1K A;  4V0B A;  1LTS D;  1WTO A;  3TN2 A;  1CZG A;  4Y7N B;  2I07 B;  3BYY B;  5EPJ A;  5CC4 A;  1A6X A;  1EZ8 A;  1STB A;  3FPP A;  4H0L C;  1RHP A;  2NWG A;  2D5D A;  1CA5 A;  1WTR A;  3KBX A;  1IKL A;  3TP8 A;  2F0M A;  3NWS A;  3T56 B;  3P1H A;  2R92 B;  5JPM C;  3GTG B;  2HUG A;  1ENC A;  2M2L A;  2OXP A;  2JA6 B;  3BS1 A;  2IL8 A;  2KVM A;  2D62 A;  5TSS A;  1SYF A;  2PZT A;  5LL6 S;  3TDQ A;  1IW7 D;  4IN3 A;  3MXU A;  4HSP A;  4A3J B;  2XRS D;  1AW7 A;  1NR4 A;  1B44 D;  4KHZ A;  3S2D B;  3M4O B;  1PRT B;  1KDC A;  4RWS C;  4FNF A;  5C0X J;  2K01 A;  2KED A;  1GUW A;  3OSO A;  3K5N A;  3A8I E;  1HCZ A;  2O2L D;  4IUQ A;  2L9H A;  5IGF A;  4DK0 A;  1V1P A;  4C3J G;  1Q1E A;  2LY7 A;  1Q1B A;  1QOH A;  1NSN S;  1PZK D;  2X6G A;  5DNF A;  1I4Q A;  3KLS A;  1OXS C;  2KUM A;  1F9Q A;  3PO3 B;  2AWN A;  1X32 A;  2BE5 C;  4CHT B;  1DD2 A;  1LTI D;  5M5Y B;  1H9S B;  1SFO B;  1M8A A;  5EPL A;  4QF4 A;  2B8F A;  1MSG A;  2BE5 D;  5G3L D;  2VB2 X;  2NVT B;  1QE6 A;  2CVR A;  4IUV A;  1ZYR C;  1BNZ A;  1GUS A;  1GUO A;  2PZW A;  1LT4 D;  1D5M C;  1ZYR D;  1U9R A;  1LAB A;  4ID6 A;  1Z7T A;  2AUK A;  3BDO A;  3CQZ B;  1B1Z A;  2K5D A;  1WTP A;  2H1E A;  4RCO A;  2F0K A;  1B3A A;  3UI2 A;  1J9O A;  5JVG 3;  2F0P A;  2E2D C;  5EBC A;  4IUU A;  4K5V A;  1HA5 A;  1S5D D;  3CHB D;  5T1I A;  1R9T B;  1EQV A;  2IX1 A;  2YU9 B;  5CYU A;  2K33 A;  3PUY A;  4QUC A;  5KGU A;  1BXT A;  4HTH A;  4CGY B;  2F03 A;  3RUZ A;  5T1G A;  1F2Y A;  3SDZ A;  4BS9 A;  4C3H G;  3HOX B;  1VDZ A;  1VF5 C;  4FF4 A;  4WRD A;  3SVM A;  3S14 B;  3GP7 A;  1LT5 D;  4I7Z C;  4K14 A;  2RSN A;  5CV8 A;  1HTL D;  3GO5 A;  1CM9 A;  1V43 A;  3QOJ A;  5IT9 E;  3J7A F;  1UNS A;  4PMB A;  1STE A;  3HOU B;  5C4H A;  1AN8 A;  1OXV A;  2QIL A;  1FNV A;  4MHE A;  5C5M A;  2WII B;  4KD3 A;  4E6I A;  1EU3 A;  1Y69 U;  1PZJ D;  5ELE A;  1K8O A;  3MC0 B;  3VYT A;  2WP8 J;  1Y8P B;  1WTV A;  1B4O A;  1FNW A;  3D3R A;  4XQJ A;  4F7X A;  2F0E A;  4QB4 A;  4S3S A;  1EYC A;  3A54 A;  1LTG D;  4KMU C;  2BOS A;  2RDH A;  4IFD I;  1RD9 D;  4DA2 A;  3QIA A;  3V96 A;  2L12 A;  4CBV A;  1WTX A;  1TS5 A;  1F9S A;  2F1M A;  2KQ3 A;  2E75 C;  4ILW A;  5C4X B;  2QCP X;  3CRK C;  2EY1 A;  3M85 A;  4C3I G;  1ZKO A;  2RDF A;  4RKB A;  2F0G A;  5CMD A;  1PLF A;  4NMZ A;  4FF1 A;  4RGM A;  1H9R A;  4HR7 B;  2EJF C;  2NYZ D;  1QNK A;  2F0V A;  5I4D A;  5KYL A;  2AQ1 B;  2XIW A;  3D31 A;  3LNN A;  3GQB A;  5HUR A;  2B2Y C;  3TZU A;  4Q0F A;  4K8I A;  3I4M B;  3SK4 A;  3GD7 A;  1A2T A;  4PMC A;  3S9W A;  3NE5 B;  2F0Q A;  4OO1 I;  5LHY 1;  2V4D A;  3Q22 A;  4G7O C;  3I73 A;  3U9S A;  3J81 E;  4O42 A;  2J7Z A;  3M7N A;  3V2T A;  4F87 A;  4KN4 C;  1BUV T;  1U4L A;  4BY7 B;  1QJO A;  1IHZ A;  1SYC A;  5DAU A;  4J6H A;  3SK6 A;  1GHJ A;  1SND A;  2ZXO A;  1HHV A;  2KCN A;  3WDN A;  4M8A A;  4ZUJ A;  3FDT A;  4Q5V A;  1H9S A;  2HCC A;  1II3 A;  1Z47 A;  5BN5 A;  2XWB B;  3IFT A;  4B08 A;  4YIJ A;  1CT1 D;  2ICE C;  1RF2 D;  2NN6 H;  1V1P B;  2Z8L A;  1LTB D;  3H94 A;  2LKV A;  1KDB A;  5KND A;  4RAU C;  4XIG S;  1LAC A;  3K0Y A;  1SJH D;  3VYR A;  1VCI A;  1NAP A;  3NQI A;  5C5L A;  1E2Z A;  5EKI A;  2NB0 A;  3PO2 B;  5ELF A;  2B2U C;  2VB3 X;  2NVY B;  2QF7 A;  4CKC A;  2WIN B;  1CZW A;  4O1N A;  5A2Q L;  2EZV A;  3KLR A;  4DN4 M;  3TBI B;  4DAP A;  2EYL A;  2A68 C;  3RMH A;  1WCM B;  2PQE A;  1HXY D;  1TWG B;  4J1M A;  4A3F B;  3OIQ A;  1D5Z C;  4HN7 A;  1BF4 A;  2A68 D;  1A3V A;  2E2I B;  1PTO C;  5IGB A;  1CHQ D;  4FO2 A;  3URY A;  1NUC A;  5EBD A;  4PMW A;  1PTO D;  3BZD B;  4A3D B;  3TZD A;  3GTO B;  3M3Y B;  1VMP A;  3T16 A;  1DZ1 A;  1WTW A;  3I72 A;  1ET9 A;  5NUC A;  1IYU A;  5COY A;  3Q6S A;  5E4W C;  3R2T A;  2AQ2 B;  5EKL A;  3HS0 C;  2YYZ A;  4CKB A;  3F2U A;  2X69 A;  1F2Z A;  2EOT A;  2F0U A;  3NTH A;  5D14 A;  3ITP A;  1HTP A;  4KKT A;  1XTC D;  1O78 A;  4G7H C;  5K36 H;  2O4X A;  5F2D A;  1SEB D;  5IOD A;  1WVL A;  2DNC A;  2J0T D;  4EVO A;  4ZK9 B;  4FYD A;  2L5T A;  1BCP C;  4BA2 I;  5K5P A;  5FKA C;  2K5W A;  3DM1 A;  4U68 A;  1BCP D;  2HCI A;  3SXH A;  2IX0 A;  5G3L F;  4X3U A;  5IT9 L;  1KNA A;  2NBF A;  3GV6 A;  3Q0A A;  1G29 1;  4LMQ D;  3S1M B;  1SE2 A;  5E1F A;  2G9H D;  1E2W A;  2L4N A;  4DNT B;  3OMC A;  2IWH A;  5EQ0 A;  4FXG C;  1YNN C;  2EYH A;  2K5Q A;  2ZXR A;  5EGT A;  2PCF B;  4EGV A;  3BVM A;  1YNN D;  2Q8R E;  1CI3 M;  1U4M A;  4DXF A;  4XT1 B;  3HOY B;  1STN A;  3ERO A;  3OHX C;  2HDL A;  2E76 C;  2WAC A;  2WAQ B;  1H9M A;  4C2M B;  3NHH A;  2F0W A;  5E4X A;  3GTM B;  4C1N I;  3GTP B;  1IYV A;  4KY7 A;  4HMI A;  2WKD A;  2A6E C;  4KI0 A;  1E2V A;  1L0X B;  4G57 A;  3K5L A;  2R61 A;  2F4I A;  3TP5 A;  4HSV A;  1ENF A;  2A6E D;  2JXM B;  1T5X D;  4X3K A;  3BVZ A;  4CJ0 B;  2J4X A;  2AQ3 B;  4CJ2 C;  2MHV A;  3MAQ A;  3H09 A;  1SE3 A;  1B9N A;  1JOQ A;  1SXT A;  3D6W A;  3X3N A;  3WOE A;  5J1Z A;  1XWE A;  2WB1 B;  2CHB D;  1HUN A;  2Q8T A;  2QKI C;  1CQF A;  1E0B A;  1EY7 A;  4BY1 B;  1KLG D;  1KLU D;  2EPB A;  2F0T A;  5I2Y A;  3NBH A;  1TWF B;  3QG1 A;  2K1B A;  1TS2 A;  2XWJ B;  2NVQ B;  2I46 A;  1I6V C;  3RLF A;  2KOL A;  3QJY A;  5FO8 B;  3AB9 A;  2Q8I B;  4F88 A;  1WTQ A;  5JEA H;  1DON A;  4K2L A;  4NKL A;  2M9V A;  4ZUI A;  1PDQ A;  1ILP A;  3GTJ B;  2DNE A;  3KK7 A;  1PZI D;  2MPM A;  1MI2 A;  2WKC A;  1Y8N B;  3P20 A;  4NDX A;  3VA5 A;  1S5F D;  4R8I A;  2C5C A;  2CW0 C;  1Q90 A;  3S1N B;  5FK9 C;  4OIJ A;  1LLR D;  2F0H A;  2B39 A;  3ND9 A;  1Y1V B;  1D1I A;  2CW0 D;  4IUR A;  2F0L A;  5CV4 A;  4WFN 3;  3TP7 A;  1HQM C;  2ZT9 C;  2LFN A;  2SNM A;  1SNM A;  3P7J A;  1IL8 A;  1JOK A;  3L3O C;  1BOS A;  3A7L A;  1KAB A;  1DOL A;  4QMG A;  1PXU A;  1YNJ C;  3C1F A;  4OHJ A;  2F3W A;  2ID0 A;  1ESR A;  1MBY A;  2LMC B;  2BDO A;  1YNJ D;  1K8M A;  3D4W A;  3J80 E;  5HGT A;  2TMP A;  3NPP A;  5C3E B;  3AMU A;  1ROD A;  2E2H B;  5CBA E;  1JWS D;  2F0O A;  5C44 B;  3JAM L;  2JA8 B;  2N55 A;  1EY6 A;  5C6A A;  1D2B A;  1B9M A;  3HOZ B;  1MGS A;  2B2W C;  5D3I B;  3DWQ A;  1LTR D;  1SYG A;  4RA8 A;  4A3G B;  3DEP A;  4L8J A;  3VA7 A;  5KEE A;  3VR4 A;  3PUZ A;  1JCK B;  1F77 A;  2L0C A;  3T4A C;  1C48 A;  2B2T A;  1ENA A;  3VR6 A;  3EVQ A;  3TSS A;  4EQO A;  2D2C C;  5KNB A;  2RA4 A;  2L11 A;  3BVG A;  4ODG A;  4EQP A;  1Q12 A;  2NN6 G;  2WV6 D;  1TVX A;  1GUG A;  1HUM A;  1I50 B;  1EEF D;  4KV6 A;  4WOR A;  1AZP A;  1I6H B;  3D6C A;  5CGK A;  1EZ6 A;  2ZXP A;  2A73 B;  1BCP B;  1IKM A;  1STH A;  2E2J B;  4KKS A;  1C4Q A;  2ENB A;  3VYU A;  2K28 A;  4BBS B;  4XDX A;  2LS0 1;  4OL7 A;  4A3E B;  3MFG A;  4X3T A;  2EYM A;  5JVH 3;  1U4R A;  3MFY A;  5JEA J;  2EYO A;  3NSW A;  3VR3 A;  2F0D A;  4FF2 A;  1U4P A;  1FD7 D;  2G9D A;  3M4Y A;  4BA1 I;  2VUM B;  2RDG A;  5I6W A;  3S1Q B;  4C1N K;  3EQL C;  5C0X G;  1PTO F;  5ELB A;  5FLX L;  3H3V C;  3S16 B;  4DXG A;  3I4N B;  2SNS A;  2F0F A;  1LTA D;  1RDP D;  4FVM A;  1DYQ A;  4ZKB B;  1SDF A;  1TR5 A;  1GJX A;  1HA6 A;  4F8M A;  1ESF A;  1EIG A;  1GOZ A;  3PUV A;  4TRD A;  1PRT C;  2EJG C;  2SEB D;  3AU7 A;  1EY5 A;  1QNU A;  1PRT D;  1K83 B;  2PW5 A;  1QG7 A;  1V8Q A;  3ND8 A;  1PFB A;  1J8I A;  1LV9 A;  4IFD H;  4FF3 A;  4RKL A;  4A3B B;  5C0X I;  5D3D A;  3CRL C;  1LTT D;  2IPK D;  1G91 A;  3S2H B;  1HRJ A;  1BCP F;  1JIC A;  1Y1W B;  2RKS A;  4RH6 A;  1KDA A;  4DAY A;  5IGE A;  4RHS A;  4K8J A;  1JOO A;  3MHB A;  2K03 A;  1EY9 A;  3EA6 A;  5IGG A;  1ONL A;  4M1U B;  3NTI A;  5FOB B;  1Z6H A;  4IZ8 A;  4KK7 A;  3PUX A;  3W2D A;  2K32 A;  3KLS X;  1TWA B;  1KTK A;  2RBM A;  2RSO A;  1B2T A;  4MN3 A;  4ZLT F;  1OXU A;  5E3F A;  1CA6 A;  2R3Z A;  3I91 A;  1EWH A;  4K6D A;  1NCV A;  1FYC A;  3OWE B;  3I3C A;  3KUP A;  2B2V A;  4JK1 C;  3P75 A;  4RGN A;  4OO1 H;  1MD2 D;  2KEC A;  1SNQ A;  2K6A A;  2OT2 A;  1T5E A;  2KCC A;  4GZY C;  2JEB I;  2PYK A;  3FEW X;  1SYE A;  4UAI A;  2DN8 A;  4EQN A;  2EVB A;  3BYT B;  3FPU B;  4DFA A;  2SOB A;  4XT3 B;  1BQQ T;  2PMZ B;  1O7Y A;  2AWO A;  3D8G A;  4RGT A;  5CV9 A;  1LT3 D;  1RJT A;  3A56 A;  2BCO A;  1PYW D;  3QO2 A;  4K5W A;  3K6O A;  4KN7 C;  2GA4 B;  3C46 A;  4HAE A;  4C56 C;  4K5X A;  1B53 A;  4ABN A;  5EKK A;  4R9W A;  3QB3 A;  1KAA A;  2FHT A;  3H91 A;  1SBB B;  4ZYS A;  1S5E D;  1NR2 A;  2MGS A;  3MA2 B;  1C8C A;  1OO9 B;  3FKI B;  4ZQ3 A;  1TS4 A;  3V05 A;  4DAV A;  1DXM A;  3E6Z X;  4KY6 A;  1HFN A;  4DF7 A;  2JEA I;  1SSO A;  1BBX C;  5KYI A;  3K7A B;  3MXG A;  4L6T B;  1STY A;  2PPB C;  5AFW A;  4N9P A;  3LWU A;  3GV3 A;  2XRQ D;  5EJW A;  3CKI B;  4PV1 C;  3PIP 3;  3BDL A;  3DUZ A;  2TSS A;  3R2I A;  2OF1 A;  5JOB A;  2E74 C;  3X3M A;  3RD4 A;  3PUW A;  3I90 A;  3MXN A;  5ELD A;  1QB5 D;  2M00 A;  1AFP A;  1JC7 A;  4IFD J;  1CHP D;  3M7G A;  1D6E C;  1I4G A;  3N6R A;  1UUP A;  2QDB A;  3PMF A;  1PFN A;  3LX0 A;  3HRZ C;  1QIL A;  3HG9 A;  3DEO A;  3PIO 3;  2IJ0 A;  3BDC A;  1STA A;  1Q8I A;  2X6L A;  2FMC A;  3VYS A;  2HQE A;  4HCS A;  2F0J A;  3IL8 A;  5JJZ A;  5COR A;  1W6J A;  4A3I B;  2Y0S B;  3D4D A;  5KRU A;  5M5W B;  3MEH A;  2O5I C;  5M3F B;  3A8J E;  1EWC A;  2XVS A;  5J39 A;  1GUT A;  1R4Q B;  1DM0 B;  1GUN A;  4IQZ A;  4XQN A;  3T51 B;  1BDO A;  2IX3 A;  3R93 A;  1I3Q B;  2K7V A;  4HCE A;  1XYI A;  1LT6 D;  3I70 A;  2C9O A;  1IW7 C;  2OEO A;  3SHL A;  2FMM A;  3NK9 A;  2IW3 A;  1TT2 A;  3S1R B;  5IGC A;  4PNY A;  3J7Y W;  2B63 B;  3T53 B;  3CU7 A;  4XYQ A;  2EJM A;  4H13 C;  1ML0 D;  1RTN A;  4DGZ A;  2JP1 A;  1O80 A;  1RCV D;  3I8Z A;  3K59 A;  4V19 0;  3DWP A;  1M4V A;  4L63 B;  1A2U A;  4ZKC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...