1S4ZA

Hp1 chromo shadow domain in complex with pxvxl motif of caf-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
75
structure length
75
Chain Sequence
HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromobox protein homolog 1
publication title Structural basis of HP1/PXVXL motif peptide interactions and HP1 localisation to heterochromatin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 7
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s4zA00
2KEEA 1ICWA 1J9OA 1F9QA 2EPBA 3GV3A 5COYA 1NR4A 1F9SA 2L12A 3DM1A 5EKIA 5EPJA 1AZPA 1B3AA 1HFNA 1U4PA 1DOLA 1LV9A 2B2VC 2VXWA 1C8CA 1G6ZA 1AP0A 1HRJA 1MI2A 1Q3LA 2L4NA 1NAPA 2FMMA 2MJ8A 1JE4A 2EOTA 1HUMA 4ZAIA 3H91A 1KNAA 3FDTA 1BNZA 1DZ1A 1EIHA 1ILQA 4U68A 2MPMA 2B2YC 5T1GA 3IFDA 1CM9A 2FINB 1G2TA 2KEDA 1WVLA 2DY7A 2NZ1D 4ZLTF 2HDLA 4ZKBB 1XYIA 1A15A 1RTOA 5D65A 2B2WA 3FPUB 1G91A 1WTXA 1WTOA 2M2LA 1MSGA 3MTSA 1F9RA 2FJ2A 4QUFA 1HUNA 1QG7A 1DOMA 3P7JA 2K04A 5CMDA 2KUMA 1EQTA 2NWGA 1SSOA 2RSNA 4OIJA 1F2LA 2RA4A 2B2UC 1EOTA 3LWEA 3Q6SA 4R8IA 1WTQA 1SDFA 2IL8A 1SAPA 2B2VA 1BO0A 1HFGA 3DEPA 2K1BA 4IUUA 2CVRA 2HDMA 4LMQD 1QE6A 2Q8TA 4OIKA 1DOKA 2HCIA 3MWYW 4RWSC 1QNKA 1HHVA 4HAEA 3UI2A 1HA6A 2D9UA 1PFNA 2RVLA 3DEOA 4X3TA 2MP1A 4RAUC 4HCSA 1WTRA 5EPKA 4IUPA 1IL8A 1ESRA 5EQ0A 3F2UA 5CORA 2BDNA 1KNEA 1WTVA 1XX8A 3KUPA 1CA6A 1X32A 1BF4A 1ML0D 5E4XA 4CJ0B 4XT3B 5EJWA 1WTPA 3TN2A 1NCVA 1B2TA 2L11A 2FFKB 2H1EA 4X3KA 3IL8A 2DY8A 1X3PA 5DNFA 1JICA 2FHTA 2JP1A 2KECA 2X6LA 1MGSA 2KVMA 4IUVA 1DONA 1WTWA 4X3SA 1VMPA 2B2TC 2KOLA 5CBEE 2K03A 5AFWA 2N55A 1NR2A 3KBXA 4R9WA 4NW2A 1PFMA 1EIGA 1E0BA 2L9HA 1IKLA 2NYZD 1G2SA 3N52A 4X3UA 5JJZA 2RSOA 5T1IA 3GV6A 4RA8A 1ZXTA 2K05A 2B2YA 3G7LA 3I91A 4UAIA 1J8IA 3I90A 3HP3A 1PFBA 1CA5A 2L1BA 1U4RA 2X6GA 5CBAE 1RJTA 4XDXA 1WD0A 1B53A 3D6WA 4HEDA 4IUTA 2MGSA 1B4OA 4ZK9B 2EE1A 1O7YA 3ONAB 3I3CA 1ILPA 2HCCA 1O80A 4QUCA 1RODA 2J7ZA 3SVMA 3QO2A 4CJ2C 3R93A 2B2UA 2K28A 1IKMA 4IUQA 4DN4M 1AZQA 2B2TA 2Q8RE 2SDFA 1PLFA 4MHEA 1RHPA 4XT1B 1S4ZA 3TZDA 1PDQA 1RTNA 2X69A 3I8ZA 4CJ1B 2XIWA 1WD1A 2HUGA 1VMCA 2JYOA 1O7ZA 2R3ZA 5E4WC 1EL0A 5D14A 1MSHA 2K01A 4ZKCB 4MN3A 1U4LA 2B2WC 1U4MA 2N88A 1BBXC 4O42A 1TVXA 5EPLA 4HSVA 1B50A 4IURA 1F9PA 1M8AA 1GUWA 1X3QA
chains in the Genus database with same CATH superfamily
2B3GA 4X66L 1GUNA 5EKLA 3M3YH 1YJWA 4TSSA 4RMFA 2WAQG 1SRUA 3NHHA 1VS0A 2OEOA 1G6ZA 1AP0A 3D4RA 2HHHQ 5IYDH 1S3OA 3D3RA 3MHBA 4K8JA 4JYAL 4BBRH 3RZDB 2KEDA 2I46A 2BE5C 2A6EC 2F0EA 4KHPL 1RTOA 3I4OA 2WB1G 3OYYA 1Q46A 1ZYRD 1UE6A 4KHVA 2HT1A 3V2TA 1H95A 3TP8A 1I4QA 2XRQD 2SEBD 2VQEQ 1SE4A 3P1HA 4X64Q 1HR0W 2B2VA 1QWYA 1YHAA 1HNZL 2CVRA 4JCVE 2RHSB 3CPFA 5BN3A 1GO3E 5FO8B 1QNKA 3PV0A 3NTKA 3JAMi 3S24A 4JBJA 4X65L 3VR6A 2ZM6Q 4RFBA 3F2UA 4JI7Q 1XX8A 1H9SA 1MBYA 1I3QB 4A3BG 5E4XA 3IFTA 4GKJQ 1KC8C 1TIID 3E3XA 5IYBH 2BA0A 3IL8A 1SMYC 2KECA 3CQZH 2KVMA 3TS0A 4A3FG 2B29A 2R7DA 3KBXA 2WINB 3CKIB 2SOBA 3PIOA 2KCNA 4LF8L 1L0YB 1EFID 3S16B 4IUNA 1Y1WB 3IAYA 4A93B 1EY0A 2EDGA 3E9HA 1YZ6A 5KGUA 1RKNA 4G7HC 4HJ5A 3D8GA 4YIJA 3LWUA 3GTMB 1VQ7A 3CHBD 2EXZA 2VL6A 1FNWA 1RD9D 2VY3A 4P75A 5I2XA 5C44B 3DHQA 3ND8A 4B3TQ 4DV6L 4JI6L 5IE8A 4J1MA 1L0WA 3VR5A 1UE5A 4CHTB 2R92G 5ELCA 2Y0SG 1A3VA 2CFMA 2TMPA 4A3EH 4FYDA 1QNUA 4XYOA 4JI1Q 1TWHB 4DFAA 1PH8A 1YEZA 2L55A 3EJIA 1KDCA 1U4PA 1GOZA 3T4AC 2CCZA 3NENA 1D5MC 4PZ8A 5EBDA 4KD4A 5A2QE 3KYHC 1J6QA 4RCOA 3HOWH 1SMXA 2YV5A 3EN2A 1IL2A 1AE3A 1FGBD 4FXDA 5JVG3 2G9DA 4JI5Q 4FO2A 1CQVA 3GTQH 1EWIA 4DR6L 2F03A 1SSOA 3BVZA 3OWFA 3W1BA 1I6HH 2MO0A 3ERQA 3LWEA 2ZXRA 3KLWA 3A8KE 1IZ6A 2F0LA 3I70A 4JI2L 5C4XG 1HFGA 2E76C 4DV5Q 3HG9A 5IT9L 4C3HG 4LF4Q 3MWYW 4MTNA 5IP9H 1IHZA 1MHWC 2RCNA 2AQ2B 1LTTD 1PTOC 4RAUC 5TSSA 3AYHB 5EQ0A 2A68C 4A3DG 4JI3Q 3UDFA 1ML0D 1Y1VB 2P5ZX 1G6PA 2PO4A 1U0LA 1W6JA 4XT3B 3OW7A 4OONA 4DAYB 4A76A 5DNFA 4DNRB 1VQ9A 1L2FA 1RCVD 1D6EC 3K7AB 2A5HA 4P72A 3UDIA 1E22A 3CCSA 1IYJB 2QILA 4BY1G 3M4OB 1AEXA 1BBUA 1SYGA 4WJWA 4GZYC 2K52A 4IFDG 1K8OA 5KNDA 1BR9A 4KD3A 1VQBA 1HZCA 3AQQA 1PFBA 2UUAL 3ZJYC 3AU7A 2CHBD 5CV9A 5J1ZA 1YNXA 1CKMA 4NDXA 4K5VA 3PO2B 4YWMA 2EE1A 5C3EH 3F2BA 1ILPA 2HCCA 2PW7A 3ICEA 2JA6G 1PRTC 3RN2A 3J7AV 1HH2P 1AZQA 5A2QL 5D3IB 1IBLQ 1YITA 1JMCA 2B8GA 3PF4A 4BA2I 2PQAB 2R3ZA 5E4WC 1SNPA 4DV2L 4A3IG 1HCZA 4XXEA 3TZUA 4IURA 2JA5B 2WP8J 1M8AA 3RLFA 1NBWA 3S2DB 3SGIA 2ZTEA 1J9OA 3F1ZA 4H44C 5EPJA 4ULLA 3OSOA 1M90C 1K8AC 4DR7L 2UXBQ 1GHKA 2WIIB 3T51B 3QR8A 5T1GA 3M4QA 1PH1A 1G2TA 3S1RB 1XYIA 4JI0Q 3HOXB 3MVVA 3GTOH 1F2ZA 3FPUB 1LT5D 1WTOA 4DV0Q 1TY2A 1UNSA 4RG1A 4F7XA 1HUNA 1VQMA 3VR3A 2J0TD 3PMFA 1KRSA 4M1UB 4E6IA 2MNAA 3GP7A 4L6TB 2KHJA 4R1JA 2KCCA 3BG3A 3VYTA 3SK6A 4XYQA 2QGQA 2HDMA 4LUZA 1B44D 3PSIA 3AEVA 1HHVA 1ZKOA 1VQ4A 3UI2A 3T1YL 3PIPA 2F0GA 2F0DA 1JC7A 4CKCA 4GNXC 4V190 2BDNA 1WYDA 1YNND 3NUCA 2FFKB 3FP9A 1GUSA 1TWAB 3V96A 3X3MA 1QVFA 2XVSA 2N55A 4IOCA 1CKNB 3C1EA 4QY7A 3CC4A 3N52A 5JJZA 1XPUA 1V1PB 1N34L 4IPDA 2EJFC 3KLSA 1CHQD 5M5YH 3T1HQ 1WFQA 4UHVA 5I9PA 4HJ9A 3I4MG 5JEAJ 3OTOQ 3EBEA 4K2LA 5C3XA 4QMGA 4LUVA 1KDAA 1O80A 1Q7YC 4QUCA 5BN5A 3KOJA 3QOJA 1GVPA 2SDFA 3KF6A 3TZDA 1RHPA 2F0HA 2E75C 3J80c 3RUZA 2UU9L 5CV5A 2XIWA 1S72A 4KJNA 3H3VI 4DPGA 3NXWA 4A3GH 5GAEC 4LFCQ 2B2WC 1X6OA 4A3MG 4DUYQ 2JSOA 3Q24A 1HZBA 3GTGH 4OO1G 1EU4A 3NWSA 4L63B 1II3A 3HOVG 4JBWA 3CU7A 2KEEA 4CKBA 4LUOA 4K0KQ 1LV9A 2EQSA 3RLOA 2RKSA 3HOUB 5LL6S 1TWGB 1HUMA 3A5UA 3FDTA 1K73C 4U68A 1OXVA 4RGNA 4A3BH 3I55A 3RNUA 1XMQL 3KDFB 5IYBG 4TVAB 1UAPA 4L5RC 3SR1A 1GM5A 1XNRL 1PTOD 3MA2B 1CI3M 2JA9A 4IPGA 2N8NA 3BZKA 2EY2A 2B39A 4PMWA 4HIDA 1ICFB 3OHXC 1Z6HA 2JXMB 4X6AH 3CF5A 1ENAA 2K1BA 1O7IA 3A8JE 2EYMA 1VCIA 5C4JH 3GTLB 4X3TA 1JWUD 1EEID 1WI5A 1FJGL 1AE2A 3KF8B 2Z4HA 1LACA 4JYAQ 3A5ZB 3I7FA 3W1GA 4R4CA 1PHJA 4QJFA 1IBML 2UXDL 3E6ZX 4EQPA 4X3KA 2JK8A 1OXUA 2NTTA 2R92H 5IP7G 2AWOA 4C3JG 2EJMA 2K5DA 4A3EG 3EVQA 3M85A 1A62A 4OL7A 2Z9HA 1BUVT 3HGBA 2RSOA 4RA8A 1HNZQ 1C7YA 4HJ8A 2CWAA 4FP5D 1K3BC 1KRTA 1B53A 4G7ZC 1CFMA 1V8QA 1FYCA 5HGTA 5IGFA 3I3CA 5M5WH 1KABA 4CJ2C 3H15A 4DN4M 2KQ3A 2EYHA 3TQYA 3SXHA 1XPOA 2A69D 1WD1A 5IGBA 3SHLA 1PTOF 3ND9A 4KY6A 3U9OA 1LYLA 1JT8A 1JB3A 5C4XH 1B50A 3JAML 1E7ZA 1F9PA 1LTGD 1XXGA 1LTLA 2EYOA 4C3HH 1PTOB 4EQNA 5C5LA 1TWCB 1SJED 2ENBA 1E24A 5COYA 1EZ6A 1NR4A 1F9SA 4R4QA 3E5SA 2JA7B 4R8NA 4BY7B 2AUJD 4C2MH 2F0TA 3J80E 4WJ4A 3J7YW 4X62L 2F4VL 2L4NA 4CKEA 4ZAIA 2IT1A 3KLSX 4A3DH 1DZ1A 2YTXA 1EIHA 3FMCA 1CUKA 3S1MH 3WOEA 2LXKA 4P2CB 4LNQA 1YNJD 4IQZA 4JG2A 1A15A 2OF1A 4LFAL 4DV6Q 1WTXA 1SFOH 4JI6Q 1LTRD 4OX9L 1MSGA 1QG7A 4NXML 4BY1H 1EU3A 1LTBD 3FVQA 5KEEA 5IGEA 2RSNA 1B1ZA 4IFDH 4L5TA 1Y8PB 2PQAA 5I4DA 3QJYA 2VZAA 2HQEA 3DEPA 1QE6A 1HXYD 3I4LA 2F1MA 1I94L 2HCIA 3BDLA 1E2WA 5A35A 4HAEA 4MIUA 1LTAD 5G3LF 2E8GA 5C3EG 1T5EA 2XSCA 3CMAA 3DEOA 1EZ8A 3K8AA 3U4ZA 1SLJA 2VUMB 1ESRA 5FO9B 2XNAC 4DV1L 4I65A 1C9OA 5KYIA 1PH5A 2A6HD 4OWWB 1YI2A 1JOOA 3NWTA 1FNUA 4DV4Q 4DV3L 4DR3L 4MNOA 3PGZA 1MGSA 2UUCL 4DR6Q 4A3IH 1JR0D 4R9WA 3S1NH 4NW2A 4N9TA 3HZXA 1G2SA 3NE5B 1S5CD 1TQOA 4RGMA 1GUGA 2IX0A 4JW0A 3I90A 2EYLA 1HZ9A 2LY7A 2O5IC 1SYCA 5DM63 2AUKA 1WD0A 4UP7A 3S2HB 4ZK9B 4NKLA 2RF4A 1K0RA 4B3SL 3A56A 3K5LA 4KKUA 3M3YB 1KDBA 1Q12A 5KNBA 5IY0A 2QCPX 4FF1A 1G8ZD 1IBKL 4CJ1B 3I56A 3MXPA 4N8X1 3CP0A 4MN3A 4NXNL 4BBRB 2WKDA 1TKWB 4TQUS 5CV4A 1NTGA 1F77A 4X3SA 5DM73 3HOZB 2M00A 2JA8G 4JV5L 1QUQB 2UUAQ 2L12A 1GHJA 5EKIA 4PQXA 1V1PA 3A55A 2EOTA 3H91A 1JWMD 3ITPA 2WAQE 4GLAC 4ME3A 1KAAA 3SK8A 3HOYB 4GOPA 1SNMA 2NN6H 3RD4A 3TREA 4J15A 1J5EL 2KUMA 1EQTA 4DV2Q 2ZJQA 2E2IB 3MFGA 1LM0A 5C4ZA 5IWAL 2QA4A 1S5FD 2ZXPA 1OXTA 3S14H 3DXJC 1K28A 1SAPA 4XQQA 1BKBA 3CQZB 1C48A 3PF5A 3I4MH 4RWSC 1KAWA 2C35B 4DR7Q 4B3RQ 4DR4Q 2RVLA 1L0XB 1YVCA 4K5WA 2K5QA 3HS0C 4DGZA 2Q2UA 4BBSH 3PUYA 1BF4A 4QIWB 3NK9A 4CJ0B 3TN2A 4A3JG 4A3GG 4DUZL 4BS9A 2A19A 1YIJA 3RZOH 1DONA 4IUVA 4A3MH 3V05A 3KDFA 5AFWA 3RLNA 3U4VA 4OO1H 1ET6A 3K80C 4DR1L 3A0JA 4GOPC 4X3UA 1A6XA 3HOVH 2K05A 2Z6KA 4EQ5A 1MIUA 1TT2A 2QKIC 1E2ZA 3EIVA 4J8QA 1TU2B 3GTJB 2CW0D 2K4KA 4O0AA 4DAMA 3OMGA 3F2CA 3T56B 5K5PA 1RODA 4PMCA 1Z7TA 3UE0A 4DXGA 1LT3D 4P74A 1CSPA 2DN8A 1IKMA 1HA5A 1K3RA 4XT1B 1SE2A 1H9RA 2L5TA 1VMCA 5IT9E 1AW7A 3J7A5 1AN8A 4ZKCB 3HOWB 4P71A 1STNA 1U4MA 2MFIA 3TRZA 1SJHD 2JE6I 1H9MA 2UUBL 1ENFA 1JQYD 2KCMA 1N34Q 1UE7A 1GUWA 1GXDC 3GTQB 1F9QA 2Y0SE 4C3IB 3QOLA 1SYDA 1I6HB 2SNSA 5C4HA 2R7ZG 2B2VC 1MI2A 4GKKL 2JN4A 4XIGS 1CKOA 1HR0Q 1NSNS 5E3FA 4JI4Q 2FINB 1Q82C 2DY7A 4GN4B 2UU9Q 4NB3A 1SNOA 1G91A 3S17H 5IP7H 2Z8LA 4C3JH 1LO5D 1LABA 5BN4A 2LS01 4Y52H 1MJEA 5IOCA 1K8MA 1JE5A 1N36L 1BO0A 3T13A 4ME5A 1XNQL 1TWFH 3IRBA 5I2YA 5M3MG 1TS3A 5LL6X 1Z47A 2MUYA 4QB4A 4AQYL 1L1OA 1CQFA 3CCVA 1NE3A 4KV6A 2F0MA 2WV6D 3STBD 2E5LL 4OXPA 3EQLC 1EEFD 2XN9C 1P16A 3ULJA 2L11A 3T53B 2H1EA 4JPBW 1HNXL 2NYZD 1G291 1Y1WH 4A93H 3GV6A 5LMUQ 5FO7B 3J7AF 1J8IA 1T9HA 1SN8A 3ERSX 3FPPA 1NMFA 1SXTA 3A54A 3O13A 2QEJC 1FJGQ 2VQFL 5JJLA 1IW7C 4HMJA 1RDPD 2BA1A 1Y8NB 1H9JA 4DV7Q 2E74C 4AYBG 2EZVA 1UEAB 3FKIG 2IW3A 2UXDQ 1JJGA 4IUQA 2B2TA 3KK7A 1ENCA 1PLFA 4CGYB 4IJLA 4FNFA 5EAYA 3UE1A 3CAMA 3G71A 2UXCQ 2OQ0A 3CCEA 2MQHA 5M5XH 1FGUA 1U4LA 3OPOA 3GTPH 1BBXC 4H7BA 4ZUIA 4ZRZA 3GTOB 4IN3A 3T16A 3BVGA 3FEWX 4MZ9A 1VQGA 4F8MA 1EWHA 3TDQA 3SE0A 1HFNA 3SK4A 1HRJA 1N33L 1JE4A 1KNAA 1X65A 1EY8A 1ILQA 5GADC 2F52A 3M4YA 1WTHA 1EIFA 3J81i 4S3SA 2M2LA 2BE5D 2A6ED 3N6RA 2I5HA 3K5OA 2B63G 5I9OA 1PZJD 1B9MA 3I4NG 1A8VA 3JAMc 2IPKD 1QZHA 1PH9A 4LF9L 1WTQA 2YU9H 1I4XA 3TEHB 4LFBQ 1A2UA 3L0OA 4ZCKA 4OGQC 4DAVA 1PV4A 1PXUA 2ZJRA 2F3IA 5M3FG 3VDYA 4X62Q 4RHRA 5M9OA 4QF4A 1D1IA 3NSWA 4TRDA 4FF2A 1TS5A 1Y1VH 2K5HA 4KK7A 5M5YB 2WAQB 1GUTA 4CDFC 2BDOA 1I4GA 5ELOA 2HIXA 2HHHL 4I7ZC 2B8FA 4LFAQ 1DGSA 4KN7C 4NXMQ 4OELB 2VNUD 4ZUJA 5ELNA 2JEAI 1SMYD 2WB1B 4HIOA 1EIGA 2R7FA 2ATWA 2F3WA 2JA8H 3MXNA 3ZYYX 1BDOA 4FDBA 4UAIA 4IFDJ 1IYVA 1OTCA 3H0GH 3PO2H 1KTKA 2ZXOA 2K75A 2PI2A 4HEDA 4B3ML 3GTGB 3MXUA 2F0IA 2BH2A 3W5OA 3PO3G 2RDFA 4DK6C 2F0FA 4DV1Q 2LKVA 5NUCA 1Z9FA 1ONLA 1V1OA 2NN6G 3TS2A 1TY0A 2JYOA 1M4VA 4A3KG 1M1KC 3HKZG 2N49A 4DKAC 3W3AA 3OW2A 4A3BB 2GN5A 2YYZA 5ELFA 4YCUA 3L2PA 2GA4B 2C5CA 3CCRA 4O42A 1QOHA 1VQ5A 4G4KA 2RDHA 2OCEA 5CV8A 3TP6A 1WCMG 2NZ1D 4POGA 4A3FB 3OMCA 3KJPA 3K58A 1HQMC 1VQJA 3NBHB 4MTKA 2NVQB 1QCBD 1E1OA 3EROA 1DJRD 1QB5D 3HKSA 2R93G 1Q3LA 1I50H 1BNZA 5GROA 4BBSG 3S1RH 2YTVA 3ULLA 4U673 2VW9A 1CT1D 4PZ6A 4A3JH 2HDLA 2PNRC 1IBKQ 5C4JB 4GLVB 1X56A 1QZGA 1JOKA 3D4WA 4QQBX 4KY7A 3QG1A 3MTSA 1F9RA 3CPWA 1EQRA 1VQOA 1VQIA 4HMIA 1FD7D 4B3TL 5BR8Q 4JV5Q 1EYGA 1N8RC 5HURA 1VF7A 2R92B 1DOKA 5J39A 1XJVA 2Y0SB 4V0BA 2Z4IA 4QIWE 2AMCB 4FXGC 1E3PA 4HCSA 4RKLA 3S15H 1HJPA 2F3VA 3BDCA 3MXGA 3JAME 4LW1A 2A68D 5EJWA 2J4XA 4PMBA 4Q0FA 2DY8A 1J5EQ 1WTWA 5M5WB 2K03A 4XTCS 2FMCA 3K0XA 4X66Q 1VQDA 2M9VA 2L9HA 2O2LD 3NTHA 1JJ2A 4IFDI 4JI5L 4DU9A 2NVYB 3DUZA 3VR4A 1CZWA 4R4TA 2KJXA 4UPAA 2B2YA 5C3WA 1OXXK 4RKBA 5C0XG 3G48A 2R7ZH 1BVSA 4K5XA 4TKOB 1UWVA 4WJ3M 1SBBB 2WKCA 4DNTB 5C4XB 4K8IA 4EGVA 3CCQA 4KHPQ 4DV5L 4C3HB 3ONAB 1K83H 3GO5A 2AQ3B 4LF4L 4LF6L 1SNQA 2Z1CA 1H9SB 3J81c 5J3BA 3C1FA 4H0LC 1H9KA 5LMNL 1B8AA 2Q8RE 2L15A 1PRTD 5L37A 4DUZQ 3DM3A 1XMOL 4L5SA 2F0SA 1R9TH 4A3DB 1NJIC 4JI3L 2OTJA 3S1MB 2PPBC 4GLXA 4K14A 4DR1Q 4JBMA 1YHBA 2ID0A 5G3LD 2TSSA 3J81j 3BDOA 2PNHA 2IHFA 4X65Q 2E2JH 2EPBA 4BY1B 1A0IA 3DM1A 5M3MH 1AZPA 2OTLA 4R4IA 3PCOB 3M4PA 1NAPA 1SE3A 2CWPA 1N32L 3R8BA 1YHQA 2MPMA 1Q1EA 5KIXA 2B2YC 2PQEA 1CM9A 4N8FA 4Z9CB 2E2HH 1ZYRC 1E1TA 3MC0B 4ZLTF 5HY6A 3R2TA 2AKWB 1STEA 4P73A 3W2DA 2JA6B 4LF8Q 4DAYA 1S40A 1DOMA 2RQXA 2K14A 1EOVA 1X3EA 1Y1WG 4A93G 1VQKA 1LLRD 4CDEC 1XWEA 4KKSA 4IUUA 2H5XA 3F2DA 4A3IB 5GAHC 1D8LA 3BZDB 1KD1C 4Q5VA 2XTIA 3CCMA 1HA6A 4GKKQ 5C44G 4EX5A 1MD2D 2MO1A 2DNEA 5EKKA 3FKIH 4PNYA 4N9PA 2DJFC 4C1NI 3OWEB 1WTPA 1AFPA 2F0UA 3U9SA 4BA1I 3Q22A 1B2TA 1UUPA 3I73A 2NB0A 1PRTF 1JICA 1O7LA 2JP1A 2NN6I 2X6LA 4KI0A 1VMPA 2KOLA 3C3LA 1NR2A 4JOIA 4OWTB 3DMUA 3E0JA 4IJHA 4A4IA 4HN7A 1SE8A 4GN3B 4DV0L 2NVTH 4UDUC 5IIFA 2Q2HA 1PRTB 1ZXTA 1SNCA 2LSSA 1KHIA 4F87A 1D2BA 4C56C 1EYAA 4F88A 1XNQQ 1TXYA 1PYWD 1LTID 2F0WA 4AQYQ 1C0AA 2ZJPA 4YHHL 3WWVA 4A3LG 2J7ZA 2A1AA 2A8VA 2E5LQ 2B2UA 1PDQA 2B63H 3I4NH 5D14A 4JI2Q 1GKHA 3S1QH 4LF7L 4OO1I 5FLMG 1TVXA 1TWCH 2AQ1B 3I72A 4GN5A 3CC2A 5JOBA 4BY7H 4CDDC 4K6LA 5F2DA 2VS1A 3J81E 2G5DA 5M3FH 3E0EA 3GTKH 1KLUD 2EVBA 1DOLA 2F0PA 4JOIC 2VQFQ 4HTHA 2ICEC 1SEBD 3M7NA 2MJ8A 2FMMA 1Y1VG 3S14B 3T1HL 2I5MX 4H13C 3I4MB 3OTOL 3P75A 1K8GA 3NEMA 3EFXD 2A74C 4HIKA 1R4QB 4KHZA 5JJKA 2HD3A 3P7JA 1LTSD 1G51A 4HR7B 4RGTA 1PZKD 3K81C 1S5ED 5DEHA 1P8LA 5CMDA 1CKNA 1MKHA 4HSPA 2B2UC 1EOTA 4YCVA 1D5ZC 1WOCA 4GNXB 2ALYB 5CGKA 3RZOB 4XQNA 3H0GG 3PO2G 1UE1A 4A3MB 2Q8TA 5IODA 3K7UC 1VQFA 4ZQ3A 4DUYL 1XPRA 2NTSA 4FVMA 1JJCB 4RCNA 1N33Q 1OXSC 3PO3H 2D9UA 3HOVB 4A3CG 4EQOA 5EPKA 1MJCA 1D1KA 4K0KL 5AJ3L 1WTVA 1YJNA 1CA6A 3GDEA 3MFYA 4A3KH 1EY9A 2WB1E 1EY7A 5CV6A 1KLGD 3E9IA 2JA5G 2Q2TA 4RHSA 4DK1A 1WCMH 1LT6D 3NP8A 4LF9Q 2DNCA 2QF7A 2ZTCA 3K57A 3HFZB 1ZEQX 1DCZA 5CBAE 2R93H 1A2TA 1N9WA 3VYUA 1X3GA 1EWCA 1EUJA 1GUOA 2K33A 1I4HA 3J81L 3HOXG 1YJ9A 4JI8L 4RH6A 1XTDA 3Q0AA 1FR3A 2NZOA 4DXFA 2EY5A 4M8AA 3TP5A 4YY3L 5IGCA 3C46A 1EY6A 4EVOA 3RMHA 3X3NA 3K0YA 4WORA 2IY5B 3HOZH 3KBGA 4DAPA 1Q8IA 3S17B 2AHOB 1X3QA 3T1YQ 4C3JB 2NVXH 2VB2X 3BVMA 4Y7NH 4A3EB 1FNVA 2LFNA 2H4OA 2KBNA 4B3MQ 2K6AA 1C8CA 1AH9A 1HNWL 1NY4A 1BCPC 2D5DA 3HOYH 4L5QA 4QGUA 3KF8A 5IGDA 1A63A 2IHEA 4DK3C 3Q8DA 4JBKA 3KF6B 4ZKBB 1TWFB 1EYDA 4IPCA 5D65A 3BS1A 4FXKC 1F2YA 2EY1A 2E2IH 2D62A 1QVGA 2NUCA 2BCOA 4KJOA 4OHJA 1EY4A 1RF2D 2QDLA 2RA4A 5ELEA 4DR2L 1I5FA 4LF5L 4R8IA 5C0XH 5E1FA 3AB9A 4OIKA 3CCUA 3RZDH 2Z6KC 4DNIA 4IZ8A 3DWQA 3EA6A 2PYKA 5C6AA 4AIMA 4IUPA 1YNNC 1KXLA 3B6YA 3H3VC 1ASZA 4O1NA 2N78A 5HGQA 5IYCH 3CRLC 3KFUA 4ALPA 5KRUA 5FLXc 3PQIA 4YCWA 1SYFA 4LK1C 4AH6A 2IX1A 3BYTB 4G7OC 1UEBA 4PG3A 2LXJA 5LMNW 1V43A 1W3SA 1X55A 4B9XA 1WJJA 4ODGA 1STYA 3HOUG 5M5XB 4O2DA 3GTJH 1I4PA 1CA5A 2PMZB 1DXMA 1U4RA 2X6GA 1EFWA 3GTPB 2Q2IA 1I3QH 1XMQQ 2FXQA 3URYA 5DLQE 1X9NA 1XNRQ 5C3EB 3R93A 3RN5A 4OWXB 2NZHA 2X69A 4AYBE 2HUGA 4KKTA 3S16H 1EL0A 2CQOA 5FOBB 2I0QA 2E2DC 2N88A 2R61A 4DV4L 1Y14B 1PA6A 1GD7A 1Y8OB 3CW2C 3MEFA 3J80i 4HIMA 4C3IH 3DWAA 1VQCA 1E2VA 3GTMH 3A7LA 5D3DA 1D5XC 4K2KA 2OT2A 3BZCA 4UP8A 1GJXA 5C44H 1B7YB 1JCKB 1CK1A 1NMGA 1DM0B 1IBMQ 2KCTA 3I2ZA 2YU9B 1SROA 4LF6Q 1KQSA 5J22A 4HJ7A 3LNNA 3NTIA 3P20A 4LAAA 5LMNQ 1VQ6A 3CC7A 1L1OC 4DR5L 3VR2A 3JC66 2EY6A 1XMOQ 1X3FA 3A7AB 4JVZA 1TWHH 1FL0A 2L0CA 2PZWA 2PW5A 1B70B 2F4IA 2VB3X 4KLKA 2NWGA 3FRPB 3D31A 1F2MA 5CV7A 3S9WA 4KY5A 1SDFA 3LX0A 2IL8A 2PCFB 1V9PA 5K36G 1PFNA 2RCFA 2JA8B 2QW7A 3WDNA 1N32Q 4B9WA 4A3LH 1WTRA 1B9NA 2PZTA 1PMRA 1CZGA 2OQKA 5JVH3 2OWOA 4PZ7A 1T5XD 3H0GB 2JJQA 4NPSA 2FHTA 1PH3A 1VQLA 5CBEE 2B2TC 5FLMH 1NNXA 1PFMA 1PYBA 1JWSD 2JA7G 3NELA 4BY7G 2K5WA 1D7QA 2F4VQ 3HP3A 3NPPA 3R3OA 2EYJA 5C5MA 1QUQA 1RJTA 5JEAG 2JQOA 4GNXA 5FKAC 3U50C 1Q86C 3A8IE 5FLXE 1VQPA 5DAUA 2QDBA 1BBWA 4OX9Q 1ET9A 3GQBA 2A69C 3K7AH 1HQRD 3PUVA 4PV1C 5ELDA 5I6YA 3PIO3 4B3RL 4DR4L 3M4OH 4MHEA 2RHQB 1S4ZA 1I50B 2F0VA 2XWJB 3I8ZA 1BCPD 3R2IA 3LGJA 2F0KA 4I7AA 1MSHA 4K6DA 2K01A 2QEXA 3SK5A 4A3JB 4A3GB 1I94Q 2VQEL 1EQVA 5EPLA 3HKZE 1RL2A 2EIFA 4X64L 3BJUA 2VUMG 1A3UA 2KHSA 1B3AA 2XWBB 4A3CH 2VXWA 1DD2A 4ZYSA 2ZM6L 4YHHQ 1YNJC 4DV3Q 4DR3Q 1C4QA 2Z0SA 2LMCB 4JI7L 2UUCQ 5FJ8G 1STBA 4GKJL 2B2WA 1R4PB 1YBYA 5E7NA 2JA5H 4KTAA 3BU2A 4J6HA 2ZT9C 4QL5A 3S2DH 2HQLA 2FJ2A 2Z6BA 4QUFA 3TP7A 3S15B 4LF7Q 2CKZB 4R4OA 1PH2A 4IPHA 4BXXG 3K5MA 1STHA 4WRDA 4IALA 2MHVA 4B3SQ 3UDGA 3PUXA 2K50A 1HTLD 3NQTA 1STGA 2DUDA 3HOXH 5FK9C 1S5DD 2MP1A 4UP9A 2A6HC 5IYDG 4DK0A 3L9AX 4GOPB 5JJIA 2R7ZB 3AFQA 1X32A 1ASYA 3MZ5A 1VF5C 5FLXL 4NXNQ 4BBRG 1W2BA 1HR0L 4NMZA 2D2CC 1X3PA 5CC4A 1K83B 4JI4L 1BCPF 3HOZG 2SNMA 3SEBA 1BXTA 1B3QA 1VQAA 1Y69U 2ZTDA 3MAQA 1R9TB 5I6WA 3GD7A 1BCPB 1SR3A 4JI1L 3K5NA 2V4DA 2PI2E 4NP5A 4FF4A 2K5NA 1QVCA 5CYUA 3HOYG 1Q1BA 2IX3A 1B4OA 1CTMA 1W6KA 3NQIA 4IOAA 1TWAH 2GVAA 5GAGC 5AJ3Q 1BQQT 4G57A 2E2JB 3SVMA 3QO2A 1IW7D 5M3MB 5JAVA 1PFSA 1S5BD 1LUZA 1RTNA 5IWAQ 2EYPA 3F8TA 1ESFA 4YWLA 5LHY1 1PVOA 4RGOS 2E2HB 2O5JC 4CDCC 1PH6A 4A3FH 4HCEA 2F0QA 3SDZA 2NVQH 1ICWA 3TBIB 2CQAA 3VA7A 2ICIA 2F0JA 2GVBA 3VA5A 3M7GA 5LMUL 2K7VA 3VYSA 4C2MB 2K5VA 4JI8Q 1HTPA 1XTCD 3A74A 5IYCG 4HJAA 1LT4D 1WVLA 3D4DA 3AFPA 2G9HD 5JPMC 2ES2A 1QJOA 4YY3Q 4ILWA 4DV7L 4AYBB 3J7ZC 4JK1C 2R6GA 3FKIB 1OO9B 4ID6A 2K04A 1SFOB 2D0PA 2DGYA 2UXCL 3OIQA 3HOUH 1TWGH 2WFWA 3Q6SA 3KLRA 4BWGB 5JPNC 4LMQD 4KMUC 2BOSA 5CR3A 3CCLA 4B08A 5IGGA 1RIPA 2A73B 5GQOA 2NBFA 1HNWQ 1EQQA 2NVTB 1PZID 3KJOA 4OEMB 4KN4C 3ULPA 3K6OA 3OOCA 5CORA 1KNEA 2CH4W 3KUPA 1VQEA 2F0NA 1KL9A 3HOWG 2KENA 2AWNA 4H02A 1QILA 3TMEA 1IBLL 3H3VH 2UUBQ 3PUWA 1VDZA 1Q8KA 3H6MA 2BH8A 2NVYH 3PIP3 3WOFA 2PMZE 1EYCA 4C3IG 4DR2Q 4LF5Q 3GTLH 4LWCA 2I07B 5T1IA 3S1NB 2B63B 1U5KA 3G7LA 3I91A 3G6EA 2K32A 3I4NB 3AMUA 2CW0C 1V1QA 2L1BA 3S1QB 5ISRA 4XDXA 5C0XJ 1VQHA 3DWPA 3D6WA 4IUTA 4ABNA 2MGSA 4UY8C 4LFBL 1SNDA 5IP9G 2UXBL 1L1OB 3D6CA 4A75A 5M3FB 1EY5A 1JOQA 3OIPA 2DJGC 4FF3A 1PH7A 3GTKB 2XRSD 1JORA 4JI0L 1EIYB 3CXCA 4XQJA 1TR5A 2OXPA 1N36Q 1DYQA 4LJZC 2Q8IB 3M9BA 3QIAA 1K9MC 3QB3A 2HIVA 1I4RA 1SYEA 3UDXA 1HPCA 4DA2A 2RDGA 3GV3A 5K36H 1CHPD 1Q90A 1VQ8A 1CSQA 1PYSB 4C1NK 5EGTA 3IFDA 1JB7A 3C2PA 1VQNA 4JC0A 2IJ0A 2N3SA 1HNXQ 2JA6H 3BYYB 3QWNA 3PO3B 1K0SA 4APVA 1Q81C 3HEJA 3IKJA 1PTOH 5KYLA 2RBMA 4DF7A 3K59A 3DLLA 3CRKC 3NBIA 2JA7H 4GS3A 1IYUA 4OIJA 1F2LA 3TSSA 1FVIA 4A3KB 3FHWA 1U9RA 3HKZB 3L7ZC 1TS4A 3VYRA 2ASBA 5JEAH 1STAA 4POFA 3CD6A 1O78A 2KA7A 1WCMB 5IT9c 4YWKA 1BOSA 2PZUA 3STBC 1X54A 1IL8A 5H1SE 3CCJA 2WACA 5EBCA 2R93B 4DR5Q 3H09A 4BBSB 1NCVA 3J80L 3L3OC 3MEHA 3Q23A 2F0OA 2YTYA 2XGTA 1TS2A 4LFCL 3G4SA 1E0BA 2KHIA 1IKLA 1SYBA 2VUMH 5C0XI 3PUZA 4WFN3 1PH4A 1A3TA 3NBHA 5BR8L 5KNCA 2CH4A 2O4XA 1I6VC 1KIXA 3D0FA 2D0OA 1IXRA 3CMEA 2C9OA 3ER0A 1O7YA 2I5LX 4CBVA 5FJ8H 2JEBI 4IO9A 4Y7NB 2NVXB 3H94A 2K28A 4QCLA 3U58A 2EXDA 1HZAA 1O7ZA 1NUCA 2EJGC 3HRZC 2EYFA 4BXXH 5ELBA 2IWHA 3MXNB 4HSVA 3G6JB 3RR5A 3S2HH 2V1CC 4L8JA
chains in the Genus database with same CATH topology
1GUNA 5EKLA 4TSSA 3NHHA 2OEOA 1G6ZA 1AP0A 3D4RA 3D3RA 3MHBA 4K8JA 3RZDB 2KEDA 2I46A 2BE5C 2A6EC 2F0EA 1RTOA 1ZYRD 4KHVA 3V2TA 3TP8A 1I4QA 2XRQD 2SEBD 1SE4A 3P1HA 2B2VA 1QWYA 2CVRA 5BN3A 5FO8B 1QNKA 3PV0A 3NTKA 3VR6A 4RFBA 3F2UA 1XX8A 1H9SA 1MBYA 1I3QB 5E4XA 3IFTA 1TIID 2BA0A 3IL8A 1SMYC 2KECA 2KVMA 3KBXA 2WINB 3CKIB 2SOBA 2KCNA 1L0YB 1EFID 3S16B 4IUNA 1Y1WB 3IAYA 4A93B 1EY0A 2EDGA 5KGUA 1RKNA 4G7HC 3D8GA 4YIJA 3LWUA 3GTMB 3CHBD 2EXZA 1FNWA 1RD9D 5I2XA 5C44B 3DHQA 3ND8A 4J1MA 3VR5A 4CHTB 5ELCA 1A3VA 2TMPA 4FYDA 1QNUA 4XYOA 1TWHB 4DFAA 2L55A 3EJIA 1KDCA 1U4PA 1GOZA 3T4AC 1D5MC 5EBDA 4KD4A 5A2QE 4RCOA 1FGBD 4FXDA 5JVG3 2G9DA 4FO2A 1CQVA 2F03A 1SSOA 3BVZA 3OWFA 3ERQA 3LWEA 2ZXRA 3A8KE 2F0LA 3I70A 1HFGA 2E76C 3HG9A 5IT9L 4C3HG 3MWYW 1IHZA 2AQ2B 1LTTD 1PTOC 4RAUC 5TSSA 5EQ0A 2A68C 1ML0D 1Y1VB 2PO4A 4XT3B 1W6JA 3OW7A 5DNFA 4DNRB 1RCVD 1D6EC 3K7AB 2A5HA 2QILA 3M4OB 1AEXA 1SYGA 4WJWA 4GZYC 4IFDG 1K8OA 5KNDA 1BR9A 4KD3A 1PFBA 3AU7A 2CHBD 5CV9A 5J1ZA 4NDXA 4K5VA 3PO2B 2EE1A 1ILPA 2HCCA 2PW7A 1PRTC 3J7AV 1AZQA 5A2QL 5D3IB 2B8GA 4BA2I 2R3ZA 5E4WC 1SNPA 1HCZA 4XXEA 3TZUA 4IURA 2JA5B 2WP8J 1M8AA 3RLFA 3S2DB 1J9OA 4H44C 5EPJA 4ULLA 3OSOA 1GHKA 2WIIB 3T51B 5T1GA 1G2TA 3S1RB 1XYIA 3HOXB 3MVVA 1F2ZA 3FPUB 1LT5D 1WTOA 1TY2A 1UNSA 4F7XA 1HUNA 3VR3A 2J0TD 3PMFA 4M1UB 4E6IA 3GP7A 4L6TB 2KCCA 3BG3A 3VYTA 3SK6A 4XYQA 2HDMA 1B44D 1HHVA 1ZKOA 3UI2A 2F0GA 2F0DA 1JC7A 4CKCA 4V190 2BDNA 1YNND 3NUCA 2FFKB 1GUSA 1TWAB 3V96A 3X3MA 2XVSA 2N55A 3C1EA 3N52A 5JJZA 1V1PB 2EJFC 3KLSA 1CHQD 5I9PA 5JEAJ 4K2LA 5C3XA 4QMGA 1KDAA 1O80A 4QUCA 5BN5A 3QOJA 3TZDA 2SDFA 1RHPA 2F0HA 2E75C 3RUZA 5CV5A 2XIWA 4KJNA 3NXWA 2B2WC 2JSOA 3Q24A 4OO1G 1EU4A 3NWSA 4L63B 1II3A 4JBWA 3CU7A 2KEEA 4CKBA 1LV9A 2RKSA 3HOUB 5LL6S 1TWGB 1HUMA 3FDTA 4U68A 1OXVA 4RGNA 1UAPA 3SR1A 1PTOD 3MA2B 1CI3M 2EY2A 2B39A 4PMWA 3OHXC 1Z6HA 2JXMB 1ENAA 2K1BA 3A8JE 2EYMA 1VCIA 3GTLB 4X3TA 1JWUD 1EEID 2Z4HA 1LACA 3E6ZX 4EQPA 4X3KA 1OXUA 2NTTA 2AWOA 4C3JG 2EJMA 2K5DA 3EVQA 3M85A 4OL7A 1BUVT 3HGBA 2RSOA 4RA8A 4FP5D 1B53A 4G7ZC 1CFMA 1V8QA 1FYCA 5HGTA 5IGFA 3I3CA 1KABA 4CJ2C 4DN4M 2KQ3A 2EYHA 3SXHA 2A69D 1WD1A 5IGBA 3SHLA 1PTOF 3ND9A 4KY6A 3U9OA 1JB3A 1B50A 3JAML 1F9PA 1LTGD 1XXGA 2EYOA 1PTOB 4EQNA 5C5LA 1TWCB 1SJED 2ENBA 5COYA 1EZ6A 1NR4A 1F9SA 2JA7B 3E5SA 4R8NA 4BY7B 2AUJD 2F0TA 3J80E 3J7YW 2L4NA 4CKEA 4ZAIA 2IT1A 3KLSX 1DZ1A 1EIHA 3FMCA 3WOEA 4P2CB 1YNJD 4IQZA 1A15A 2OF1A 1WTXA 1LTRD 1MSGA 1QG7A 1EU3A 1LTBD 3FVQA 5KEEA 5IGEA 2RSNA 1B1ZA 4IFDH 1Y8PB 5I4DA 3QJYA 2HQEA 3DEPA 1QE6A 1HXYD 3I4LA 2F1MA 2HCIA 3BDLA 1E2WA 5A35A 4HAEA 4MIUA 1LTAD 5G3LF 1T5EA 2XSCA 2VUMB 3DEOA 1EZ8A 1ESRA 5FO9B 2XNAC 4I65A 5KYIA 2A6HD 1JOOA 3NWTA 1FNUA 1MGSA 1JR0D 4R9WA 4NW2A 4N9TA 3HZXA 1G2SA 3NE5B 1S5CD 1TQOA 4RGMA 1GUGA 2IX0A 3I90A 2EYLA 2LY7A 2O5IC 1SYCA 5DM63 2AUKA 1WD0A 3S2HB 4ZK9B 4NKLA 3A56A 3K5LA 4KKUA 3M3YB 1KDBA 1Q12A 5KNBA 2QCPX 4FF1A 1G8ZD 4CJ1B 3MXPA 4MN3A 4BBRB 2WKDA 1TKWB 4TQUS 5CV4A 1F77A 4X3SA 5DM73 3HOZB 2M00A 2L12A 1GHJA 5EKIA 4PQXA 1V1PA 3A55A 2EOTA 3H91A 1JWMD 3ITPA 1KAAA 3SK8A 3HOYB 1SNMA 2NN6H 3RD4A 2KUMA 1EQTA 2E2IB 3MFGA 5C4ZA 1S5FD 2ZXPA 1OXTA 3DXJC 1SAPA 4XQQA 3CQZB 1C48A 4RWSC 2RVLA 1L0XB 4K5WA 2K5QA 3HS0C 4DGZA 3PUYA 1BF4A 4QIWB 3NK9A 4CJ0B 3TN2A 4BS9A 1DONA 4IUVA 3V05A 5AFWA 4OO1H 1ET6A 4X3UA 1A6XA 2K05A 1TT2A 2QKIC 1E2ZA 4J8QA 1TU2B 3GTJB 2CW0D 3OMGA 3T56B 5K5PA 1RODA 4PMCA 1Z7TA 4DXGA 1LT3D 1IKMA 2DN8A 1HA5A 4XT1B 1SE2A 1H9RA 2L5TA 1VMCA 5IT9E 1AW7A 1AN8A 4ZKCB 3HOWB 1STNA 1U4MA 1SJHD 2JE6I 1H9MA 1ENFA 1JQYD 1GUWA 1GXDC 3GTQB 1F9QA 4C3IB 3QOLA 1SYDA 1I6HB 2SNSA 5C4HA 2B2VC 1MI2A 4XIGS 1NSNS 5E3FA 2FINB 2DY7A 1SNOA 1G91A 2Z8LA 1LO5D 1LABA 5BN4A 2LS01 5IOCA 1K8MA 1BO0A 3T13A 4ME5A 5I2YA 1TS3A 5LL6X 1Z47A 2MUYA 4QB4A 1CQFA 4KV6A 2F0MA 2WV6D 3EQLC 1EEFD 2XN9C 2L11A 3T53B 2H1EA 2NYZD 1G291 3GV6A 5FO7B 3J7AF 1J8IA 3FPPA 1SXTA 3A54A 3O13A 2QEJC 1IW7C 4HMJA 1RDPD 2BA1A 1Y8NB 1H9JA 2EZVA 2E74C 1UEAB 2IW3A 4IUQA 2B2TA 3KK7A 4CGYB 1ENCA 1PLFA 4FNFA 1U4LA 3OPOA 1BBXC 4H7BA 4ZUIA 4ZRZA 3GTOB 4IN3A 3T16A 3BVGA 3FEWX 4F8MA 1EWHA 3TDQA 3SE0A 1HFNA 3SK4A 1HRJA 1JE4A 1KNAA 1EY8A 1ILQA 3M4YA 4S3SA 2M2LA 2BE5D 2A6ED 3N6RA 3K5OA 5I9OA 1PZJD 1B9MA 2IPKD 1WTQA 1I4XA 1A2UA 4OGQC 4DAVA 1PXUA 4RHRA 5M9OA 4QF4A 1D1IA 3NSWA 4TRDA 4FF2A 1TS5A 4KK7A 5M5YB 2WAQB 1GUTA 2BDOA 1I4GA 4I7ZC 2B8FA 4KN7C 2VNUD 4ZUJA 2JEAI 1SMYD 2WB1B 1EIGA 2F3WA 3MXNA 3ZYYX 1BDOA 1IYVA 4UAIA 4IFDJ 1KTKA 2ZXOA 4HEDA 3GTGB 3MXUA 2F0IA 2RDFA 2F0FA 2LKVA 5NUCA 1ONLA 1V1OA 2NN6G 1TY0A 2JYOA 1M4VA 3W3AA 4A3BB 2YYZA 5ELFA 2GA4B 2C5CA 4O42A 1QOHA 4G4KA 2RDHA 5CV8A 3TP6A 2NZ1D 4A3FB 3OMCA 3K58A 1HQMC 2NVQB 1QCBD 3EROA 1DJRD 1QB5D 1Q3LA 1BNZA 4U673 1CT1D 2HDLA 2PNRC 5C4JB 1JOKA 3D4WA 4KY7A 3QG1A 3MTSA 1F9RA 4HMIA 1FD7D 5HURA 1VF7A 2R92B 1DOKA 5J39A 2Y0SB 4V0BA 2Z4IA 4FXGC 4HCSA 4RKLA 2F3VA 3BDCA 3MXGA 3JAME 2A68D 5EJWA 2J4XA 4PMBA 4Q0FA 2DY8A 1WTWA 5M5WB 2K03A 4XTCS 2FMCA 2M9VA 3NTHA 2L9HA 2O2LD 4IFDI 4DU9A 2NVYB 3DUZA 3VR4A 1CZWA 2KJXA 2B2YA 5C3WA 1OXXK 4RKBA 5C0XG 4K5XA 4TKOB 1SBBB 2WKCA 4DNTB 5C4XB 4K8IA 4EGVA 4C3HB 3ONAB 3GO5A 2AQ3B 1SNQA 2Z1CA 1H9SB 3C1FA 4H0LC 1H9KA 2Q8RE 1PRTD 2F0SA 4A3DB 3S1MB 2PPBC 4K14A 2ID0A 5G3LD 2TSSA 3BDOA 2EPBA 4BY1B 3DM1A 1AZPA 1NAPA 1SE3A 3R8BA 2MPMA 1Q1EA 5KIXA 2B2YC 2PQEA 1CM9A 4Z9CB 1ZYRC 3MC0B 4ZLTF 3R2TA 1STEA 3W2DA 2JA6B 4DAYA 1DOMA 2RQXA 1LLRD 1XWEA 4KKSA 4IUUA 4A3IB 3BZDB 4Q5VA 1HA6A 1MD2D 2DNEA 5EKKA 4PNYA 4N9PA 4C1NI 3OWEB 1WTPA 1AFPA 2F0UA 3U9SA 4BA1I 3Q22A 1B2TA 1UUPA 2NB0A 1PRTF 3I73A 1JICA 1O7LA 2JP1A 2NN6I 2X6LA 4KI0A 1VMPA 2KOLA 3C3LA 1NR2A 3DMUA 3E0JA 4HN7A 4UDUC 5IIFA 1PRTB 1ZXTA 1SNCA 4F87A 1D2BA 4C56C 1EYAA 4F88A 1PYWD 1LTID 2F0WA 2J7ZA 2B2UA 1PDQA 5D14A 4OO1I 1TVXA 2AQ1B 3I72A 5JOBA 4K6LA 5F2DA 3J81E 1KLUD 2EVBA 1DOLA 2F0PA 4HTHA 2ICEC 1SEBD 3M7NA 2MJ8A 2FMMA 3S14B 4H13C 3I4MB 3P75A 3EFXD 2A74C 1R4QB 4KHZA 3P7JA 1LTSD 4HR7B 5CMDA 4RGTA 1PZKD 5DEHA 1S5ED 4HSPA 2B2UC 1EOTA 1D5ZC 5CGKA 3RZOB 4XQNA 4A3MB 2Q8TA 5IODA 4ZQ3A 2NTSA 4FVMA 4RCNA 1OXSC 2D9UA 3HOVB 4EQOA 5EPKA 1D1KA 1WTVA 1CA6A 3MFYA 1EY9A 1EY7A 5CV6A 1KLGD 4RHSA 4DK1A 1LT6D 3NP8A 2DNCA 2QF7A 3K57A 1ZEQX 1DCZA 5CBAE 1A2TA 3VYUA 1EWCA 1GUOA 2K33A 1I4HA 3J81L 4RH6A 3Q0AA 1FR3A 4DXFA 2EY5A 4M8AA 3TP5A 5IGCA 3C46A 1EY6A 4EVOA 3RMHA 3X3NA 3K0YA 4WORA 3KBGA 4DAPA 1Q8IA 3S17B 1X3QA 4C3JB 2VB2X 3BVMA 4A3EB 1FNVA 2LFNA 2H4OA 2K6AA 1C8CA 1BCPC 2D5DA 3KF8A 5IGDA 4ZKBB 1TWFB 1EYDA 5D65A 3BS1A 4FXKC 1F2YA 2EY1A 2D62A 2NUCA 2BCOA 4KJOA 4OHJA 1EY4A 1RF2D 2RA4A 5ELEA 4R8IA 5C0XH 5E1FA 3AB9A 4OIKA 4IZ8A 3DWQA 3EA6A 2PYKA 5C6AA 4IUPA 1YNNC 3H3VC 4O1NA 3CRLC 5KRUA 1SYFA 4LK1C 2IX1A 3BYTB 4G7OC 1V43A 4B9XA 4ODGA 1STYA 5M5XB 1I4PA 1CA5A 2PMZB 1DXMA 1U4RA 2X6GA 3GTPB 3URYA 5C3EB 3R93A 2X69A 2HUGA 4KKTA 1EL0A 5FOBB 2E2DC 2N88A 2R61A 1Y8OB 3DWAA 1E2VA 3A7LA 5D3DA 1D5XC 4K2KA 2OT2A 1GJXA 1JCKB 1CK1A 1DM0B 2YU9B 5J22A 3LNNA 3NTIA 3P20A 4LAAA 3VR2A 2EY6A 3A7AB 2L0CA 2PZWA 2PW5A 2F4IA 2VB3X 2NWGA 3FRPB 3D31A 1F2MA 5CV7A 3S9WA 4KY5A 1SDFA 3LX0A 2IL8A 2PCFB 5K36G 1PFNA 2JA8B 3WDNA 4B9WA 1WTRA 1B9NA 2PZTA 1PMRA 1CZGA 5JVH3 1T5XD 3H0GB 2FHTA 5CBEE 2B2TC 1PFMA 1JWSD 2K5WA 3HP3A 3NPPA 3R3OA 2EYJA 5C5MA 1RJTA 5JEAG 5FKAC 3A8IE 5FLXE 5DAUA 2QDBA 1ET9A 3GQBA 2A69C 3PUVA 1HQRD 4PV1C 5I6YA 5ELDA 3PIO3 4MHEA 1S4ZA 1I50B 2F0VA 2XWJB 3I8ZA 1BCPD 3R2IA 2F0KA 1MSHA 4K6DA 2K01A 3SK5A 4A3JB 4A3GB 1EQVA 5EPLA 1A3UA 2KHSA 1B3AA 2XWBB 2VXWA 1DD2A 4ZYSA 1YNJC 1C4QA 2LMCB 1STBA 2B2WA 1R4PB 4KTAA 4J6HA 2ZT9C 4QUFA 2FJ2A 3TP7A 3S15B 3K5MA 1STHA 4WRDA 4IALA 2MHVA 3PUXA 1HTLD 3NQTA 1STGA 5FK9C 1S5DD 2MP1A 2A6HC 4DK0A 3L9AX 2R7ZB 1X32A 3MZ5A 1VF5C 5FLXL 4NMZA 2D2CC 1X3PA 5CC4A 1K83B 1BCPF 2SNMA 3SEBA 1BXTA 1Y69U 3MAQA 1R9TB 5I6WA 3GD7A 1BCPB 3K5NA 2V4DA 4NP5A 4FF4A 5CYUA 1Q1BA 2IX3A 1B4OA 1CTMA 1W6KA 3NQIA 1BQQT 4G57A 2E2JB 3SVMA 3QO2A 1IW7D 5M3MB 5JAVA 1S5BD 1RTNA 2EYPA 1ESFA 5LHY1 4RGOS 2E2HB 2O5JC 4HCEA 2F0QA 3SDZA 1ICWA 3TBIB 2CQAA 3VA7A 2ICIA 2F0JA 3VA5A 3M7GA 2K7VA 3VYSA 4C2MB 1HTPA 1XTCD 1LT4D 1WVLA 3D4DA 2G9HD 5JPMC 1QJOA 4ILWA 4AYBB 4JK1C 2R6GA 3FKIB 1OO9B 4ID6A 2K04A 1SFOB 3OIQA 3Q6SA 3KLRA 4BWGB 5JPNC 4LMQD 4KMUC 2BOSA 5CR3A 4B08A 5IGGA 2A73B 2NBFA 2NVTB 1PZID 4KN4C 3K6OA 3OOCA 5CORA 1KNEA 3KUPA 2F0NA 2AWNA 1QILA 3TMEA 3PUWA 1VDZA 3H6MA 3PIP3 3WOFA 1EYCA 4C3IG 2I07B 5T1IA 3S1NB 2B63B 3G7LA 3I91A 2K32A 3I4NB 3AMUA 2CW0C 2L1BA 3S1QB 5ISRA 4XDXA 5C0XJ 3DWPA 3D6WA 4IUTA 4ABNA 2MGSA 1SNDA 3D6CA 5M3FB 1EY5A 1JOQA 3OIPA 4FF3A 3GTKB 2XRSD 1JORA 4XQJA 1TR5A 2OXPA 1DYQA 4LJZC 2Q8IB 3QIAA 3QB3A 1I4RA 1SYEA 1HPCA 4DA2A 2RDGA 3GV3A 5K36H 1CHPD 1Q90A 4C1NK 5EGTA 3IFDA 3C2PA 2IJ0A 3BYYB 3QWNA 3PO3B 3HEJA 3IKJA 1PTOH 5KYLA 2RBMA 4DF7A 3K59A 3CRKC 3NBIA 1IYUA 4OIJA 1F2LA 3TSSA 4A3KB 1U9RA 3HKZB 3L7ZC 1TS4A 3VYRA 5JEAH 1STAA 1O78A 2KA7A 1WCMB 1BOSA 2PZUA 1IL8A 2WACA 5EBCA 2R93B 3H09A 4BBSB 1NCVA 3J80L 3L3OC 3MEHA 3Q23A 2F0OA 1TS2A 1E0BA 1IKLA 1SYBA 5C0XI 3PUZA 4WFN3 1A3TA 3NBHA 5KNCA 2O4XA 1I6VC 2C9OA 1O7YA 4CBVA 2NVXB 2JEBI 4Y7NB 3H94A 2K28A 4QCLA 1O7ZA 1NUCA 2EJGC 3HRZC 2EYFA 5ELBA 2IWHA 4HSVA 3G6JB 4L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEE A;  1ICW A;  1J9O A;  1F9Q A;  2EPB A;  3GV3 A;  5COY A;  1NR4 A;  1F9S A;  2L12 A;  3DM1 A;  5EKI A;  5EPJ A;  1AZP A;  1B3A A;  1HFN A;  1U4P A;  1DOL A;  1LV9 A;  2B2V C;  2VXW A;  1C8C A;  1G6Z A;  1AP0 A;  1HRJ A;  1MI2 A;  1Q3L A;  2L4N A;  1NAP A;  2FMM A;  2MJ8 A;  1JE4 A;  2EOT A;  1HUM A;  4ZAI A;  3H91 A;  1KNA A;  3FDT A;  1BNZ A;  1DZ1 A;  1EIH A;  1ILQ A;  4U68 A;  2MPM A;  2B2Y C;  5T1G A;  3IFD A;  1CM9 A;  2FIN B;  1G2T A;  2KED A;  1WVL A;  2DY7 A;  2NZ1 D;  4ZLT F;  2HDL A;  4ZKB B;  1XYI A;  1A15 A;  1RTO A;  5D65 A;  2B2W A;  3FPU B;  1G91 A;  1WTX A;  1WTO A;  2M2L A;  1MSG A;  3MTS A;  1F9R A;  2FJ2 A;  4QUF A;  1HUN A;  1QG7 A;  1DOM A;  3P7J A;  2K04 A;  5CMD A;  2KUM A;  1EQT A;  2NWG A;  1SSO A;  2RSN A;  4OIJ A;  1F2L A;  2RA4 A;  2B2U C;  1EOT A;  3LWE A;  3Q6S A;  4R8I A;  1WTQ A;  1SDF A;  2IL8 A;  1SAP A;  2B2V A;  1BO0 A;  1HFG A;  3DEP A;  2K1B A;  4IUU A;  2CVR A;  2HDM A;  4LMQ D;  1QE6 A;  2Q8T A;  4OIK A;  1DOK A;  2HCI A;  3MWY W;  4RWS C;  1QNK A;  1HHV A;  4HAE A;  3UI2 A;  1HA6 A;  2D9U A;  1PFN A;  2RVL A;  3DEO A;  4X3T A;  2MP1 A;  4RAU C;  4HCS A;  1WTR A;  5EPK A;  4IUP A;  1IL8 A;  1ESR A;  5EQ0 A;  3F2U A;  5COR A;  2BDN A;  1KNE A;  1WTV A;  1XX8 A;  3KUP A;  1CA6 A;  1X32 A;  1BF4 A;  1ML0 D;  5E4X A;  4CJ0 B;  4XT3 B;  5EJW A;  1WTP A;  3TN2 A;  1NCV A;  1B2T A;  2L11 A;  2FFK B;  2H1E A;  4X3K A;  3IL8 A;  2DY8 A;  1X3P A;  5DNF A;  1JIC A;  2FHT A;  2JP1 A;  2KEC A;  2X6L A;  1MGS A;  2KVM A;  4IUV A;  1DON A;  1WTW A;  4X3S A;  1VMP A;  2B2T C;  2KOL A;  5CBE E;  2K03 A;  5AFW A;  2N55 A;  1NR2 A;  3KBX A;  4R9W A;  4NW2 A;  1PFM A;  1EIG A;  1E0B A;  2L9H A;  1IKL A;  2NYZ D;  1G2S A;  3N52 A;  4X3U A;  5JJZ A;  2RSO A;  5T1I A;  3GV6 A;  4RA8 A;  1ZXT A;  2K05 A;  2B2Y A;  3G7L A;  3I91 A;  4UAI A;  1J8I A;  3I90 A;  3HP3 A;  1PFB A;  1CA5 A;  2L1B A;  1U4R A;  2X6G A;  5CBA E;  1RJT A;  4XDX A;  1WD0 A;  1B53 A;  3D6W A;  4HED A;  4IUT A;  2MGS A;  1B4O A;  4ZK9 B;  2EE1 A;  1O7Y A;  3ONA B;  3I3C A;  1ILP A;  2HCC A;  1O80 A;  4QUC A;  1ROD A;  2J7Z A;  3SVM A;  3QO2 A;  4CJ2 C;  3R93 A;  2B2U A;  2K28 A;  1IKM A;  4IUQ A;  4DN4 M;  1AZQ A;  2B2T A;  2Q8R E;  2SDF A;  1PLF A;  4MHE A;  1RHP A;  4XT1 B;  1S4Z A;  3TZD A;  1PDQ A;  1RTN A;  2X69 A;  3I8Z A;  4CJ1 B;  2XIW A;  1WD1 A;  2HUG A;  1VMC A;  2JYO A;  1O7Z A;  2R3Z A;  5E4W C;  1EL0 A;  5D14 A;  1MSH A;  2K01 A;  4ZKC B;  4MN3 A;  1U4L A;  2B2W C;  1U4M A;  2N88 A;  1BBX C;  4O42 A;  1TVX A;  5EPL A;  4HSV A;  1B50 A;  4IUR A;  1F9P A;  1M8A A;  1GUW A;  1X3Q A; 
#chains in the Genus database with same CATH topology
 2B3G A;  4X66 L;  1GUN A;  5EKL A;  3M3Y H;  1YJW A;  4TSS A;  4RMF A;  2WAQ G;  1SRU A;  3NHH A;  1VS0 A;  2OEO A;  1G6Z A;  1AP0 A;  3D4R A;  2HHH Q;  5IYD H;  1S3O A;  3D3R A;  3MHB A;  4K8J A;  4JYA L;  4BBR H;  3RZD B;  2KED A;  2I46 A;  2BE5 C;  2A6E C;  2F0E A;  4KHP L;  1RTO A;  3I4O A;  2WB1 G;  3OYY A;  1Q46 A;  1ZYR D;  1UE6 A;  4KHV A;  2HT1 A;  3V2T A;  1H95 A;  3TP8 A;  1I4Q A;  2XRQ D;  2SEB D;  2VQE Q;  1SE4 A;  3P1H A;  4X64 Q;  1HR0 W;  2B2V A;  1QWY A;  1YHA A;  1HNZ L;  2CVR A;  4JCV E;  2RHS B;  3CPF A;  5BN3 A;  1GO3 E;  5FO8 B;  1QNK A;  3PV0 A;  3NTK A;  3JAM i;  3S24 A;  4JBJ A;  4X65 L;  3VR6 A;  2ZM6 Q;  4RFB A;  3F2U A;  4JI7 Q;  1XX8 A;  1H9S A;  1MBY A;  1I3Q B;  4A3B G;  5E4X A;  3IFT A;  4GKJ Q;  1KC8 C;  1TII D;  3E3X A;  5IYB H;  2BA0 A;  3IL8 A;  1SMY C;  2KEC A;  3CQZ H;  2KVM A;  3TS0 A;  4A3F G;  2B29 A;  2R7D A;  3KBX A;  2WIN B;  3CKI B;  2SOB A;  3PIO A;  2KCN A;  4LF8 L;  1L0Y B;  1EFI D;  3S16 B;  4IUN A;  1Y1W B;  3IAY A;  4A93 B;  1EY0 A;  2EDG A;  3E9H A;  1YZ6 A;  5KGU A;  1RKN A;  4G7H C;  4HJ5 A;  3D8G A;  4YIJ A;  3LWU A;  3GTM B;  1VQ7 A;  3CHB D;  2EXZ A;  2VL6 A;  1FNW A;  1RD9 D;  2VY3 A;  4P75 A;  5I2X A;  5C44 B;  3DHQ A;  3ND8 A;  4B3T Q;  4DV6 L;  4JI6 L;  5IE8 A;  4J1M A;  1L0W A;  3VR5 A;  1UE5 A;  4CHT B;  2R92 G;  5ELC A;  2Y0S G;  1A3V A;  2CFM A;  2TMP A;  4A3E H;  4FYD A;  1QNU A;  4XYO A;  4JI1 Q;  1TWH B;  4DFA A;  1PH8 A;  1YEZ A;  2L55 A;  3EJI A;  1KDC A;  1U4P A;  1GOZ A;  3T4A C;  2CCZ A;  3NEN A;  1D5M C;  4PZ8 A;  5EBD A;  4KD4 A;  5A2Q E;  3KYH C;  1J6Q A;  4RCO A;  3HOW H;  1SMX A;  2YV5 A;  3EN2 A;  1IL2 A;  1AE3 A;  1FGB D;  4FXD A;  5JVG 3;  2G9D A;  4JI5 Q;  4FO2 A;  1CQV A;  3GTQ H;  1EWI A;  4DR6 L;  2F03 A;  1SSO A;  3BVZ A;  3OWF A;  3W1B A;  1I6H H;  2MO0 A;  3ERQ A;  3LWE A;  2ZXR A;  3KLW A;  3A8K E;  1IZ6 A;  2F0L A;  3I70 A;  4JI2 L;  5C4X G;  1HFG A;  2E76 C;  4DV5 Q;  3HG9 A;  5IT9 L;  4C3H G;  4LF4 Q;  3MWY W;  4MTN A;  5IP9 H;  1IHZ A;  1MHW C;  2RCN A;  2AQ2 B;  1LTT D;  1PTO C;  4RAU C;  5TSS A;  3AYH B;  5EQ0 A;  2A68 C;  4A3D G;  4JI3 Q;  3UDF A;  1ML0 D;  1Y1V B;  2P5Z X;  1G6P A;  2PO4 A;  1U0L A;  1W6J A;  4XT3 B;  3OW7 A;  4OON A;  4DAY B;  4A76 A;  5DNF A;  4DNR B;  1VQ9 A;  1L2F A;  1RCV D;  1D6E C;  3K7A B;  2A5H A;  4P72 A;  3UDI A;  1E22 A;  3CCS A;  1IYJ B;  2QIL A;  4BY1 G;  3M4O B;  1AEX A;  1BBU A;  1SYG A;  4WJW A;  4GZY C;  2K52 A;  4IFD G;  1K8O A;  5KND A;  1BR9 A;  4KD3 A;  1VQB A;  1HZC A;  3AQQ A;  1PFB A;  2UUA L;  3ZJY C;  3AU7 A;  2CHB D;  5CV9 A;  5J1Z A;  1YNX A;  1CKM A;  4NDX A;  4K5V A;  3PO2 B;  4YWM A;  2EE1 A;  5C3E H;  3F2B A;  1ILP A;  2HCC A;  2PW7 A;  3ICE A;  2JA6 G;  1PRT C;  3RN2 A;  3J7A V;  1HH2 P;  1AZQ A;  5A2Q L;  5D3I B;  1IBL Q;  1YIT A;  1JMC A;  2B8G A;  3PF4 A;  4BA2 I;  2PQA B;  2R3Z A;  5E4W C;  1SNP A;  4DV2 L;  4A3I G;  1HCZ A;  4XXE A;  3TZU A;  4IUR A;  2JA5 B;  2WP8 J;  1M8A A;  3RLF A;  1NBW A;  3S2D B;  3SGI A;  2ZTE A;  1J9O A;  3F1Z A;  4H44 C;  5EPJ A;  4ULL A;  3OSO A;  1M90 C;  1K8A C;  4DR7 L;  2UXB Q;  1GHK A;  2WII B;  3T51 B;  3QR8 A;  5T1G A;  3M4Q A;  1PH1 A;  1G2T A;  3S1R B;  1XYI A;  4JI0 Q;  3HOX B;  3MVV A;  3GTO H;  1F2Z A;  3FPU B;  1LT5 D;  1WTO A;  4DV0 Q;  1TY2 A;  1UNS A;  4RG1 A;  4F7X A;  1HUN A;  1VQM A;  3VR3 A;  2J0T D;  3PMF A;  1KRS A;  4M1U B;  4E6I A;  2MNA A;  3GP7 A;  4L6T B;  2KHJ A;  4R1J A;  2KCC A;  3BG3 A;  3VYT A;  3SK6 A;  4XYQ A;  2QGQ A;  2HDM A;  4LUZ A;  1B44 D;  3PSI A;  3AEV A;  1HHV A;  1ZKO A;  1VQ4 A;  3UI2 A;  3T1Y L;  3PIP A;  2F0G A;  2F0D A;  1JC7 A;  4CKC A;  4GNX C;  4V19 0;  2BDN A;  1WYD A;  1YNN D;  3NUC A;  2FFK B;  3FP9 A;  1GUS A;  1TWA B;  3V96 A;  3X3M A;  1QVF A;  2XVS A;  2N55 A;  4IOC A;  1CKN B;  3C1E A;  4QY7 A;  3CC4 A;  3N52 A;  5JJZ A;  1XPU A;  1V1P B;  1N34 L;  4IPD A;  2EJF C;  3KLS A;  1CHQ D;  5M5Y H;  3T1H Q;  1WFQ A;  4UHV A;  5I9P A;  4HJ9 A;  3I4M G;  5JEA J;  3OTO Q;  3EBE A;  4K2L A;  5C3X A;  4QMG A;  4LUV A;  1KDA A;  1O80 A;  1Q7Y C;  4QUC A;  5BN5 A;  3KOJ A;  3QOJ A;  1GVP A;  2SDF A;  3KF6 A;  3TZD A;  1RHP A;  2F0H A;  2E75 C;  3J80 c;  3RUZ A;  2UU9 L;  5CV5 A;  2XIW A;  1S72 A;  4KJN A;  3H3V I;  4DPG A;  3NXW A;  4A3G H;  5GAE C;  4LFC Q;  2B2W C;  1X6O A;  4A3M G;  4DUY Q;  2JSO A;  3Q24 A;  1HZB A;  3GTG H;  4OO1 G;  1EU4 A;  3NWS A;  4L63 B;  1II3 A;  3HOV G;  4JBW A;  3CU7 A;  2KEE A;  4CKB A;  4LUO A;  4K0K Q;  1LV9 A;  2EQS A;  3RLO A;  2RKS A;  3HOU B;  5LL6 S;  1TWG B;  1HUM A;  3A5U A;  3FDT A;  1K73 C;  4U68 A;  1OXV A;  4RGN A;  4A3B H;  3I55 A;  3RNU A;  1XMQ L;  3KDF B;  5IYB G;  4TVA B;  1UAP A;  4L5R C;  3SR1 A;  1GM5 A;  1XNR L;  1PTO D;  3MA2 B;  1CI3 M;  2JA9 A;  4IPG A;  2N8N A;  3BZK A;  2EY2 A;  2B39 A;  4PMW A;  4HID A;  1ICF B;  3OHX C;  1Z6H A;  2JXM B;  4X6A H;  3CF5 A;  1ENA A;  2K1B A;  1O7I A;  3A8J E;  2EYM A;  1VCI A;  5C4J H;  3GTL B;  4X3T A;  1JWU D;  1EEI D;  1WI5 A;  1FJG L;  1AE2 A;  3KF8 B;  2Z4H A;  1LAC A;  4JYA Q;  3A5Z B;  3I7F A;  3W1G A;  4R4C A;  1PHJ A;  4QJF A;  1IBM L;  2UXD L;  3E6Z X;  4EQP A;  4X3K A;  2JK8 A;  1OXU A;  2NTT A;  2R92 H;  5IP7 G;  2AWO A;  4C3J G;  2EJM A;  2K5D A;  4A3E G;  3EVQ A;  3M85 A;  1A62 A;  4OL7 A;  2Z9H A;  1BUV T;  3HGB A;  2RSO A;  4RA8 A;  1HNZ Q;  1C7Y A;  4HJ8 A;  2CWA A;  4FP5 D;  1K3B C;  1KRT A;  1B53 A;  4G7Z C;  1CFM A;  1V8Q A;  1FYC A;  5HGT A;  5IGF A;  3I3C A;  5M5W H;  1KAB A;  4CJ2 C;  3H15 A;  4DN4 M;  2KQ3 A;  2EYH A;  3TQY A;  3SXH A;  1XPO A;  2A69 D;  1WD1 A;  5IGB A;  3SHL A;  1PTO F;  3ND9 A;  4KY6 A;  3U9O A;  1LYL A;  1JT8 A;  1JB3 A;  5C4X H;  1B50 A;  3JAM L;  1E7Z A;  1F9P A;  1LTG D;  1XXG A;  1LTL A;  2EYO A;  4C3H H;  1PTO B;  4EQN A;  5C5L A;  1TWC B;  1SJE D;  2ENB A;  1E24 A;  5COY A;  1EZ6 A;  1NR4 A;  1F9S A;  4R4Q A;  3E5S A;  2JA7 B;  4R8N A;  4BY7 B;  2AUJ D;  4C2M H;  2F0T A;  3J80 E;  4WJ4 A;  3J7Y W;  4X62 L;  2F4V L;  2L4N A;  4CKE A;  4ZAI A;  2IT1 A;  3KLS X;  4A3D H;  1DZ1 A;  2YTX A;  1EIH A;  3FMC A;  1CUK A;  3S1M H;  3WOE A;  2LXK A;  4P2C B;  4LNQ A;  1YNJ D;  4IQZ A;  4JG2 A;  1A15 A;  2OF1 A;  4LFA L;  4DV6 Q;  1WTX A;  1SFO H;  4JI6 Q;  1LTR D;  4OX9 L;  1MSG A;  1QG7 A;  4NXM L;  4BY1 H;  1EU3 A;  1LTB D;  3FVQ A;  5KEE A;  5IGE A;  2RSN A;  1B1Z A;  4IFD H;  4L5T A;  1Y8P B;  2PQA A;  5I4D A;  3QJY A;  2VZA A;  2HQE A;  3DEP A;  1QE6 A;  1HXY D;  3I4L A;  2F1M A;  1I94 L;  2HCI A;  3BDL A;  1E2W A;  5A35 A;  4HAE A;  4MIU A;  1LTA D;  5G3L F;  2E8G A;  5C3E G;  1T5E A;  2XSC A;  3CMA A;  3DEO A;  1EZ8 A;  3K8A A;  3U4Z A;  1SLJ A;  2VUM B;  1ESR A;  5FO9 B;  2XNA C;  4DV1 L;  4I65 A;  1C9O A;  5KYI A;  1PH5 A;  2A6H D;  4OWW B;  1YI2 A;  1JOO A;  3NWT A;  1FNU A;  4DV4 Q;  4DV3 L;  4DR3 L;  4MNO A;  3PGZ A;  1MGS A;  2UUC L;  4DR6 Q;  4A3I H;  1JR0 D;  4R9W A;  3S1N H;  4NW2 A;  4N9T A;  3HZX A;  1G2S A;  3NE5 B;  1S5C D;  1TQO A;  4RGM A;  1GUG A;  2IX0 A;  4JW0 A;  3I90 A;  2EYL A;  1HZ9 A;  2LY7 A;  2O5I C;  1SYC A;  5DM6 3;  2AUK A;  1WD0 A;  4UP7 A;  3S2H B;  4ZK9 B;  4NKL A;  2RF4 A;  1K0R A;  4B3S L;  3A56 A;  3K5L A;  4KKU A;  3M3Y B;  1KDB A;  1Q12 A;  5KNB A;  5IY0 A;  2QCP X;  4FF1 A;  1G8Z D;  1IBK L;  4CJ1 B;  3I56 A;  3MXP A;  4N8X 1;  3CP0 A;  4MN3 A;  4NXN L;  4BBR B;  2WKD A;  1TKW B;  4TQU S;  5CV4 A;  1NTG A;  1F77 A;  4X3S A;  5DM7 3;  3HOZ B;  2M00 A;  2JA8 G;  4JV5 L;  1QUQ B;  2UUA Q;  2L12 A;  1GHJ A;  5EKI A;  4PQX A;  1V1P A;  3A55 A;  2EOT A;  3H91 A;  1JWM D;  3ITP A;  2WAQ E;  4GLA C;  4ME3 A;  1KAA A;  3SK8 A;  3HOY B;  4GOP A;  1SNM A;  2NN6 H;  3RD4 A;  3TRE A;  4J15 A;  1J5E L;  2KUM A;  1EQT A;  4DV2 Q;  2ZJQ A;  2E2I B;  3MFG A;  1LM0 A;  5C4Z A;  5IWA L;  2QA4 A;  1S5F D;  2ZXP A;  1OXT A;  3S14 H;  3DXJ C;  1K28 A;  1SAP A;  4XQQ A;  1BKB A;  3CQZ B;  1C48 A;  3PF5 A;  3I4M H;  4RWS C;  1KAW A;  2C35 B;  4DR7 Q;  4B3R Q;  4DR4 Q;  2RVL A;  1L0X B;  1YVC A;  4K5W A;  2K5Q A;  3HS0 C;  4DGZ A;  2Q2U A;  4BBS H;  3PUY A;  1BF4 A;  4QIW B;  3NK9 A;  4CJ0 B;  3TN2 A;  4A3J G;  4A3G G;  4DUZ L;  4BS9 A;  2A19 A;  1YIJ A;  3RZO H;  1DON A;  4IUV A;  4A3M H;  3V05 A;  3KDF A;  5AFW A;  3RLN A;  3U4V A;  4OO1 H;  1ET6 A;  3K80 C;  4DR1 L;  3A0J A;  4GOP C;  4X3U A;  1A6X A;  3HOV H;  2K05 A;  2Z6K A;  4EQ5 A;  1MIU A;  1TT2 A;  2QKI C;  1E2Z A;  3EIV A;  4J8Q A;  1TU2 B;  3GTJ B;  2CW0 D;  2K4K A;  4O0A A;  4DAM A;  3OMG A;  3F2C A;  3T56 B;  5K5P A;  1ROD A;  4PMC A;  1Z7T A;  3UE0 A;  4DXG A;  1LT3 D;  4P74 A;  1CSP A;  2DN8 A;  1IKM A;  1HA5 A;  1K3R A;  4XT1 B;  1SE2 A;  1H9R A;  2L5T A;  1VMC A;  5IT9 E;  1AW7 A;  3J7A 5;  1AN8 A;  4ZKC B;  3HOW B;  4P71 A;  1STN A;  1U4M A;  2MFI A;  3TRZ A;  1SJH D;  2JE6 I;  1H9M A;  2UUB L;  1ENF A;  1JQY D;  2KCM A;  1N34 Q;  1UE7 A;  1GUW A;  1GXD C;  3GTQ B;  1F9Q A;  2Y0S E;  4C3I B;  3QOL A;  1SYD A;  1I6H B;  2SNS A;  5C4H A;  2R7Z G;  2B2V C;  1MI2 A;  4GKK L;  2JN4 A;  4XIG S;  1CKO A;  1HR0 Q;  1NSN S;  5E3F A;  4JI4 Q;  2FIN B;  1Q82 C;  2DY7 A;  4GN4 B;  2UU9 Q;  4NB3 A;  1SNO A;  1G91 A;  3S17 H;  5IP7 H;  2Z8L A;  4C3J H;  1LO5 D;  1LAB A;  5BN4 A;  2LS0 1;  4Y52 H;  1MJE A;  5IOC A;  1K8M A;  1JE5 A;  1N36 L;  1BO0 A;  3T13 A;  4ME5 A;  1XNQ L;  1TWF H;  3IRB A;  5I2Y A;  5M3M G;  1TS3 A;  5LL6 X;  1Z47 A;  2MUY A;  4QB4 A;  4AQY L;  1L1O A;  1CQF A;  3CCV A;  1NE3 A;  4KV6 A;  2F0M A;  2WV6 D;  3STB D;  2E5L L;  4OXP A;  3EQL C;  1EEF D;  2XN9 C;  1P16 A;  3ULJ A;  2L11 A;  3T53 B;  2H1E A;  4JPB W;  1HNX L;  2NYZ D;  1G29 1;  1Y1W H;  4A93 H;  3GV6 A;  5LMU Q;  5FO7 B;  3J7A F;  1J8I A;  1T9H A;  1SN8 A;  3ERS X;  3FPP A;  1NMF A;  1SXT A;  3A54 A;  3O13 A;  2QEJ C;  1FJG Q;  2VQF L;  5JJL A;  1IW7 C;  4HMJ A;  1RDP D;  2BA1 A;  1Y8N B;  1H9J A;  4DV7 Q;  2E74 C;  4AYB G;  2EZV A;  1UEA B;  3FKI G;  2IW3 A;  2UXD Q;  1JJG A;  4IUQ A;  2B2T A;  3KK7 A;  1ENC A;  1PLF A;  4CGY B;  4IJL A;  4FNF A;  5EAY A;  3UE1 A;  3CAM A;  3G71 A;  2UXC Q;  2OQ0 A;  3CCE A;  2MQH A;  5M5X H;  1FGU A;  1U4L A;  3OPO A;  3GTP H;  1BBX C;  4H7B A;  4ZUI A;  4ZRZ A;  3GTO B;  4IN3 A;  3T16 A;  3BVG A;  3FEW X;  4MZ9 A;  1VQG A;  4F8M A;  1EWH A;  3TDQ A;  3SE0 A;  1HFN A;  3SK4 A;  1HRJ A;  1N33 L;  1JE4 A;  1KNA A;  1X65 A;  1EY8 A;  1ILQ A;  5GAD C;  2F52 A;  3M4Y A;  1WTH A;  1EIF A;  3J81 i;  4S3S A;  2M2L A;  2BE5 D;  2A6E D;  3N6R A;  2I5H A;  3K5O A;  2B63 G;  5I9O A;  1PZJ D;  1B9M A;  3I4N G;  1A8V A;  3JAM c;  2IPK D;  1QZH A;  1PH9 A;  4LF9 L;  1WTQ A;  2YU9 H;  1I4X A;  3TEH B;  4LFB Q;  1A2U A;  3L0O A;  4ZCK A;  4OGQ C;  4DAV A;  1PV4 A;  1PXU A;  2ZJR A;  2F3I A;  5M3F G;  3VDY A;  4X62 Q;  4RHR A;  5M9O A;  4QF4 A;  1D1I A;  3NSW A;  4TRD A;  4FF2 A;  1TS5 A;  1Y1V H;  2K5H A;  4KK7 A;  5M5Y B;  2WAQ B;  1GUT A;  4CDF C;  2BDO A;  1I4G A;  5ELO A;  2HIX A;  2HHH L;  4I7Z C;  2B8F A;  4LFA Q;  1DGS A;  4KN7 C;  4NXM Q;  4OEL B;  2VNU D;  4ZUJ A;  5ELN A;  2JEA I;  1SMY D;  2WB1 B;  4HIO A;  1EIG A;  2R7F A;  2ATW A;  2F3W A;  2JA8 H;  3MXN A;  3ZYY X;  1BDO A;  4FDB A;  4UAI A;  4IFD J;  1IYV A;  1OTC A;  3H0G H;  3PO2 H;  1KTK A;  2ZXO A;  2K75 A;  2PI2 A;  4HED A;  4B3M L;  3GTG B;  3MXU A;  2F0I A;  2BH2 A;  3W5O A;  3PO3 G;  2RDF A;  4DK6 C;  2F0F A;  4DV1 Q;  2LKV A;  5NUC A;  1Z9F A;  1ONL A;  1V1O A;  2NN6 G;  3TS2 A;  1TY0 A;  2JYO A;  1M4V A;  4A3K G;  1M1K C;  3HKZ G;  2N49 A;  4DKA C;  3W3A A;  3OW2 A;  4A3B B;  2GN5 A;  2YYZ A;  5ELF A;  4YCU A;  3L2P A;  2GA4 B;  2C5C A;  3CCR A;  4O42 A;  1QOH A;  1VQ5 A;  4G4K A;  2RDH A;  2OCE A;  5CV8 A;  3TP6 A;  1WCM G;  2NZ1 D;  4POG A;  4A3F B;  3OMC A;  3KJP A;  3K58 A;  1HQM C;  1VQJ A;  3NBH B;  4MTK A;  2NVQ B;  1QCB D;  1E1O A;  3ERO A;  1DJR D;  1QB5 D;  3HKS A;  2R93 G;  1Q3L A;  1I50 H;  1BNZ A;  5GRO A;  4BBS G;  3S1R H;  2YTV A;  3ULL A;  4U67 3;  2VW9 A;  1CT1 D;  4PZ6 A;  4A3J H;  2HDL A;  2PNR C;  1IBK Q;  5C4J B;  4GLV B;  1X56 A;  1QZG A;  1JOK A;  3D4W A;  4QQB X;  4KY7 A;  3QG1 A;  3MTS A;  1F9R A;  3CPW A;  1EQR A;  1VQO A;  1VQI A;  4HMI A;  1FD7 D;  4B3T L;  5BR8 Q;  4JV5 Q;  1EYG A;  1N8R C;  5HUR A;  1VF7 A;  2R92 B;  1DOK A;  5J39 A;  1XJV A;  2Y0S B;  4V0B A;  2Z4I A;  4QIW E;  2AMC B;  4FXG C;  1E3P A;  4HCS A;  4RKL A;  3S15 H;  1HJP A;  2F3V A;  3BDC A;  3MXG A;  3JAM E;  4LW1 A;  2A68 D;  5EJW A;  2J4X A;  4PMB A;  4Q0F A;  2DY8 A;  1J5E Q;  1WTW A;  5M5W B;  2K03 A;  4XTC S;  2FMC A;  3K0X A;  4X66 Q;  1VQD A;  2M9V A;  2L9H A;  2O2L D;  3NTH A;  1JJ2 A;  4IFD I;  4JI5 L;  4DU9 A;  2NVY B;  3DUZ A;  3VR4 A;  1CZW A;  4R4T A;  2KJX A;  4UPA A;  2B2Y A;  5C3W A;  1OXX K;  4RKB A;  5C0X G;  3G48 A;  2R7Z H;  1BVS A;  4K5X A;  4TKO B;  1UWV A;  4WJ3 M;  1SBB B;  2WKC A;  4DNT B;  5C4X B;  4K8I A;  4EGV A;  3CCQ A;  4KHP Q;  4DV5 L;  4C3H B;  3ONA B;  1K83 H;  3GO5 A;  2AQ3 B;  4LF4 L;  4LF6 L;  1SNQ A;  2Z1C A;  1H9S B;  3J81 c;  5J3B A;  3C1F A;  4H0L C;  1H9K A;  5LMN L;  1B8A A;  2Q8R E;  2L15 A;  1PRT D;  5L37 A;  4DUZ Q;  3DM3 A;  1XMO L;  4L5S A;  2F0S A;  1R9T H;  4A3D B;  1NJI C;  4JI3 L;  2OTJ A;  3S1M B;  2PPB C;  4GLX A;  4K14 A;  4DR1 Q;  4JBM A;  1YHB A;  2ID0 A;  5G3L D;  2TSS A;  3J81 j;  3BDO A;  2PNH A;  2IHF A;  4X65 Q;  2E2J H;  2EPB A;  4BY1 B;  1A0I A;  3DM1 A;  5M3M H;  1AZP A;  2OTL A;  4R4I A;  3PCO B;  3M4P A;  1NAP A;  1SE3 A;  2CWP A;  1N32 L;  3R8B A;  1YHQ A;  2MPM A;  1Q1E A;  5KIX A;  2B2Y C;  2PQE A;  1CM9 A;  4N8F A;  4Z9C B;  2E2H H;  1ZYR C;  1E1T A;  3MC0 B;  4ZLT F;  5HY6 A;  3R2T A;  2AKW B;  1STE A;  4P73 A;  3W2D A;  2JA6 B;  4LF8 Q;  4DAY A;  1S40 A;  1DOM A;  2RQX A;  2K14 A;  1EOV A;  1X3E A;  1Y1W G;  4A93 G;  1VQK A;  1LLR D;  4CDE C;  1XWE A;  4KKS A;  4IUU A;  2H5X A;  3F2D A;  4A3I B;  5GAH C;  1D8L A;  3BZD B;  1KD1 C;  4Q5V A;  2XTI A;  3CCM A;  1HA6 A;  4GKK Q;  5C44 G;  4EX5 A;  1MD2 D;  2MO1 A;  2DNE A;  5EKK A;  3FKI H;  4PNY A;  4N9P A;  2DJF C;  4C1N I;  3OWE B;  1WTP A;  1AFP A;  2F0U A;  3U9S A;  4BA1 I;  3Q22 A;  1B2T A;  1UUP A;  3I73 A;  2NB0 A;  1PRT F;  1JIC A;  1O7L A;  2JP1 A;  2NN6 I;  2X6L A;  4KI0 A;  1VMP A;  2KOL A;  3C3L A;  1NR2 A;  4JOI A;  4OWT B;  3DMU A;  3E0J A;  4IJH A;  4A4I A;  4HN7 A;  1SE8 A;  4GN3 B;  4DV0 L;  2NVT H;  4UDU C;  5IIF A;  2Q2H A;  1PRT B;  1ZXT A;  1SNC A;  2LSS A;  1KHI A;  4F87 A;  1D2B A;  4C56 C;  1EYA A;  4F88 A;  1XNQ Q;  1TXY A;  1PYW D;  1LTI D;  2F0W A;  4AQY Q;  1C0A A;  2ZJP A;  4YHH L;  3WWV A;  4A3L G;  2J7Z A;  2A1A A;  2A8V A;  2E5L Q;  2B2U A;  1PDQ A;  2B63 H;  3I4N H;  5D14 A;  4JI2 Q;  1GKH A;  3S1Q H;  4LF7 L;  4OO1 I;  5FLM G;  1TVX A;  1TWC H;  2AQ1 B;  3I72 A;  4GN5 A;  3CC2 A;  5JOB A;  4BY7 H;  4CDD C;  4K6L A;  5F2D A;  2VS1 A;  3J81 E;  2G5D A;  5M3F H;  3E0E A;  3GTK H;  1KLU D;  2EVB A;  1DOL A;  2F0P A;  4JOI C;  2VQF Q;  4HTH A;  2ICE C;  1SEB D;  3M7N A;  2MJ8 A;  2FMM A;  1Y1V G;  3S14 B;  3T1H L;  2I5M X;  4H13 C;  3I4M B;  3OTO L;  3P75 A;  1K8G A;  3NEM A;  3EFX D;  2A74 C;  4HIK A;  1R4Q B;  4KHZ A;  5JJK A;  2HD3 A;  3P7J A;  1LTS D;  1G51 A;  4HR7 B;  4RGT A;  1PZK D;  3K81 C;  1S5E D;  5DEH A;  1P8L A;  5CMD A;  1CKN A;  1MKH A;  4HSP A;  2B2U C;  1EOT A;  4YCV A;  1D5Z C;  1WOC A;  4GNX B;  2ALY B;  5CGK A;  3RZO B;  4XQN A;  3H0G G;  3PO2 G;  1UE1 A;  4A3M B;  2Q8T A;  5IOD A;  3K7U C;  1VQF A;  4ZQ3 A;  4DUY L;  1XPR A;  2NTS A;  4FVM A;  1JJC B;  4RCN A;  1N33 Q;  1OXS C;  3PO3 H;  2D9U A;  3HOV B;  4A3C G;  4EQO A;  5EPK A;  1MJC A;  1D1K A;  4K0K L;  5AJ3 L;  1WTV A;  1YJN A;  1CA6 A;  3GDE A;  3MFY A;  4A3K H;  1EY9 A;  2WB1 E;  1EY7 A;  5CV6 A;  1KLG D;  3E9I A;  2JA5 G;  2Q2T A;  4RHS A;  4DK1 A;  1WCM H;  1LT6 D;  3NP8 A;  4LF9 Q;  2DNC A;  2QF7 A;  2ZTC A;  3K57 A;  3HFZ B;  1ZEQ X;  1DCZ A;  5CBA E;  2R93 H;  1A2T A;  1N9W A;  3VYU A;  1X3G A;  1EWC A;  1EUJ A;  1GUO A;  2K33 A;  1I4H A;  3J81 L;  3HOX G;  1YJ9 A;  4JI8 L;  4RH6 A;  1XTD A;  3Q0A A;  1FR3 A;  2NZO A;  4DXF A;  2EY5 A;  4M8A A;  3TP5 A;  4YY3 L;  5IGC A;  3C46 A;  1EY6 A;  4EVO A;  3RMH A;  3X3N A;  3K0Y A;  4WOR A;  2IY5 B;  3HOZ H;  3KBG A;  4DAP A;  1Q8I A;  3S17 B;  2AHO B;  1X3Q A;  3T1Y Q;  4C3J B;  2NVX H;  2VB2 X;  3BVM A;  4Y7N H;  4A3E B;  1FNV A;  2LFN A;  2H4O A;  2KBN A;  4B3M Q;  2K6A A;  1C8C A;  1AH9 A;  1HNW L;  1NY4 A;  1BCP C;  2D5D A;  3HOY H;  4L5Q A;  4QGU A;  3KF8 A;  5IGD A;  1A63 A;  2IHE A;  4DK3 C;  3Q8D A;  4JBK A;  3KF6 B;  4ZKB B;  1TWF B;  1EYD A;  4IPC A;  5D65 A;  3BS1 A;  4FXK C;  1F2Y A;  2EY1 A;  2E2I H;  2D62 A;  1QVG A;  2NUC A;  2BCO A;  4KJO A;  4OHJ A;  1EY4 A;  1RF2 D;  2QDL A;  2RA4 A;  5ELE A;  4DR2 L;  1I5F A;  4LF5 L;  4R8I A;  5C0X H;  5E1F A;  3AB9 A;  4OIK A;  3CCU A;  3RZD H;  2Z6K C;  4DNI A;  4IZ8 A;  3DWQ A;  3EA6 A;  2PYK A;  5C6A A;  4AIM A;  4IUP A;  1YNN C;  1KXL A;  3B6Y A;  3H3V C;  1ASZ A;  4O1N A;  2N78 A;  5HGQ A;  5IYC H;  3CRL C;  3KFU A;  4ALP A;  5KRU A;  5FLX c;  3PQI A;  4YCW A;  1SYF A;  4LK1 C;  4AH6 A;  2IX1 A;  3BYT B;  4G7O C;  1UEB A;  4PG3 A;  2LXJ A;  5LMN W;  1V43 A;  1W3S A;  1X55 A;  4B9X A;  1WJJ A;  4ODG A;  1STY A;  3HOU G;  5M5X B;  4O2D A;  3GTJ H;  1I4P A;  1CA5 A;  2PMZ B;  1DXM A;  1U4R A;  2X6G A;  1EFW A;  3GTP B;  2Q2I A;  1I3Q H;  1XMQ Q;  2FXQ A;  3URY A;  5DLQ E;  1X9N A;  1XNR Q;  5C3E B;  3R93 A;  3RN5 A;  4OWX B;  2NZH A;  2X69 A;  4AYB E;  2HUG A;  4KKT A;  3S16 H;  1EL0 A;  2CQO A;  5FOB B;  2I0Q A;  2E2D C;  2N88 A;  2R61 A;  4DV4 L;  1Y14 B;  1PA6 A;  1GD7 A;  1Y8O B;  3CW2 C;  3MEF A;  3J80 i;  4HIM A;  4C3I H;  3DWA A;  1VQC A;  1E2V A;  3GTM H;  3A7L A;  5D3D A;  1D5X C;  4K2K A;  2OT2 A;  3BZC A;  4UP8 A;  1GJX A;  5C44 H;  1B7Y B;  1JCK B;  1CK1 A;  1NMG A;  1DM0 B;  1IBM Q;  2KCT A;  3I2Z A;  2YU9 B;  1SRO A;  4LF6 Q;  1KQS A;  5J22 A;  4HJ7 A;  3LNN A;  3NTI A;  3P20 A;  4LAA A;  5LMN Q;  1VQ6 A;  3CC7 A;  1L1O C;  4DR5 L;  3VR2 A;  3JC6 6;  2EY6 A;  1XMO Q;  1X3F A;  3A7A B;  4JVZ A;  1TWH H;  1FL0 A;  2L0C A;  2PZW A;  2PW5 A;  1B70 B;  2F4I A;  2VB3 X;  4KLK A;  2NWG A;  3FRP B;  3D31 A;  1F2M A;  5CV7 A;  3S9W A;  4KY5 A;  1SDF A;  3LX0 A;  2IL8 A;  2PCF B;  1V9P A;  5K36 G;  1PFN A;  2RCF A;  2JA8 B;  2QW7 A;  3WDN A;  1N32 Q;  4B9W A;  4A3L H;  1WTR A;  1B9N A;  2PZT A;  1PMR A;  1CZG A;  2OQK A;  5JVH 3;  2OWO A;  4PZ7 A;  1T5X D;  3H0G B;  2JJQ A;  4NPS A;  2FHT A;  1PH3 A;  1VQL A;  5CBE E;  2B2T C;  5FLM H;  1NNX A;  1PFM A;  1PYB A;  1JWS D;  2JA7 G;  3NEL A;  4BY7 G;  2K5W A;  1D7Q A;  2F4V Q;  3HP3 A;  3NPP A;  3R3O A;  2EYJ A;  5C5M A;  1QUQ A;  1RJT A;  5JEA G;  2JQO A;  4GNX A;  5FKA C;  3U50 C;  1Q86 C;  3A8I E;  5FLX E;  1VQP A;  5DAU A;  2QDB A;  1BBW A;  4OX9 Q;  1ET9 A;  3GQB A;  2A69 C;  3K7A H;  1HQR D;  3PUV A;  4PV1 C;  5ELD A;  5I6Y A;  3PIO 3;  4B3R L;  4DR4 L;  3M4O H;  4MHE A;  2RHQ B;  1S4Z A;  1I50 B;  2F0V A;  2XWJ B;  3I8Z A;  1BCP D;  3R2I A;  3LGJ A;  2F0K A;  4I7A A;  1MSH A;  4K6D A;  2K01 A;  2QEX A;  3SK5 A;  4A3J B;  4A3G B;  1I94 Q;  2VQE L;  1EQV A;  5EPL A;  3HKZ E;  1RL2 A;  2EIF A;  4X64 L;  3BJU A;  2VUM G;  1A3U A;  2KHS A;  1B3A A;  2XWB B;  4A3C H;  2VXW A;  1DD2 A;  4ZYS A;  2ZM6 L;  4YHH Q;  1YNJ C;  4DV3 Q;  4DR3 Q;  1C4Q A;  2Z0S A;  2LMC B;  4JI7 L;  2UUC Q;  5FJ8 G;  1STB A;  4GKJ L;  2B2W A;  1R4P B;  1YBY A;  5E7N A;  2JA5 H;  4KTA A;  3BU2 A;  4J6H A;  2ZT9 C;  4QL5 A;  3S2D H;  2HQL A;  2FJ2 A;  2Z6B A;  4QUF A;  3TP7 A;  3S15 B;  4LF7 Q;  2CKZ B;  4R4O A;  1PH2 A;  4IPH A;  4BXX G;  3K5M A;  1STH A;  4WRD A;  4IAL A;  2MHV A;  4B3S Q;  3UDG A;  3PUX A;  2K50 A;  1HTL D;  3NQT A;  1STG A;  2DUD A;  3HOX H;  5FK9 C;  1S5D D;  2MP1 A;  4UP9 A;  2A6H C;  5IYD G;  4DK0 A;  3L9A X;  4GOP B;  5JJI A;  2R7Z B;  3AFQ A;  1X32 A;  1ASY A;  3MZ5 A;  1VF5 C;  5FLX L;  4NXN Q;  4BBR G;  1W2B A;  1HR0 L;  4NMZ A;  2D2C C;  1X3P A;  5CC4 A;  1K83 B;  4JI4 L;  1BCP F;  3HOZ G;  2SNM A;  3SEB A;  1BXT A;  1B3Q A;  1VQA A;  1Y69 U;  2ZTD A;  3MAQ A;  1R9T B;  5I6W A;  3GD7 A;  1BCP B;  1SR3 A;  4JI1 L;  3K5N A;  2V4D A;  2PI2 E;  4NP5 A;  4FF4 A;  2K5N A;  1QVC A;  5CYU A;  3HOY G;  1Q1B A;  2IX3 A;  1B4O A;  1CTM A;  1W6K A;  3NQI A;  4IOA A;  1TWA H;  2GVA A;  5GAG C;  5AJ3 Q;  1BQQ T;  4G57 A;  2E2J B;  3SVM A;  3QO2 A;  1IW7 D;  5M3M B;  5JAV A;  1PFS A;  1S5B D;  1LUZ A;  1RTN A;  5IWA Q;  2EYP A;  3F8T A;  1ESF A;  4YWL A;  5LHY 1;  1PVO A;  4RGO S;  2E2H B;  2O5J C;  4CDC C;  1PH6 A;  4A3F H;  4HCE A;  2F0Q A;  3SDZ A;  2NVQ H;  1ICW A;  3TBI B;  2CQA A;  3VA7 A;  2ICI A;  2F0J A;  2GVB A;  3VA5 A;  3M7G A;  5LMU L;  2K7V A;  3VYS A;  4C2M B;  2K5V A;  4JI8 Q;  1HTP A;  1XTC D;  3A74 A;  5IYC G;  4HJA A;  1LT4 D;  1WVL A;  3D4D A;  3AFP A;  2G9H D;  5JPM C;  2ES2 A;  1QJO A;  4YY3 Q;  4ILW A;  4DV7 L;  4AYB B;  3J7Z C;  4JK1 C;  2R6G A;  3FKI B;  1OO9 B;  4ID6 A;  2K04 A;  1SFO B;  2D0P A;  2DGY A;  2UXC L;  3OIQ A;  3HOU H;  1TWG H;  2WFW A;  3Q6S A;  3KLR A;  4BWG B;  5JPN C;  4LMQ D;  4KMU C;  2BOS A;  5CR3 A;  3CCL A;  4B08 A;  5IGG A;  1RIP A;  2A73 B;  5GQO A;  2NBF A;  1HNW Q;  1EQQ A;  2NVT B;  1PZI D;  3KJO A;  4OEM B;  4KN4 C;  3ULP A;  3K6O A;  3OOC A;  5COR A;  1KNE A;  2CH4 W;  3KUP A;  1VQE A;  2F0N A;  1KL9 A;  3HOW G;  2KEN A;  2AWN A;  4H02 A;  1QIL A;  3TME A;  1IBL L;  3H3V H;  2UUB Q;  3PUW A;  1VDZ A;  1Q8K A;  3H6M A;  2BH8 A;  2NVY H;  3PIP 3;  3WOF A;  2PMZ E;  1EYC A;  4C3I G;  4DR2 Q;  4LF5 Q;  3GTL H;  4LWC A;  2I07 B;  5T1I A;  3S1N B;  2B63 B;  1U5K A;  3G7L A;  3I91 A;  3G6E A;  2K32 A;  3I4N B;  3AMU A;  2CW0 C;  1V1Q A;  2L1B A;  3S1Q B;  5ISR A;  4XDX A;  5C0X J;  1VQH A;  3DWP A;  3D6W A;  4IUT A;  4ABN A;  2MGS A;  4UY8 C;  4LFB L;  1SND A;  5IP9 G;  2UXB L;  1L1O B;  3D6C A;  4A75 A;  5M3F B;  1EY5 A;  1JOQ A;  3OIP A;  2DJG C;  4FF3 A;  1PH7 A;  3GTK B;  2XRS D;  1JOR A;  4JI0 L;  1EIY B;  3CXC A;  4XQJ A;  1TR5 A;  2OXP A;  1N36 Q;  1DYQ A;  4LJZ C;  2Q8I B;  3M9B A;  3QIA A;  1K9M C;  3QB3 A;  2HIV A;  1I4R A;  1SYE A;  3UDX A;  1HPC A;  4DA2 A;  2RDG A;  3GV3 A;  5K36 H;  1CHP D;  1Q90 A;  1VQ8 A;  1CSQ A;  1PYS B;  4C1N K;  5EGT A;  3IFD A;  1JB7 A;  3C2P A;  1VQN A;  4JC0 A;  2IJ0 A;  2N3S A;  1HNX Q;  2JA6 H;  3BYY B;  3QWN A;  3PO3 B;  1K0S A;  4APV A;  1Q81 C;  3HEJ A;  3IKJ A;  1PTO H;  5KYL A;  2RBM A;  4DF7 A;  3K59 A;  3DLL A;  3CRK C;  3NBI A;  2JA7 H;  4GS3 A;  1IYU A;  4OIJ A;  1F2L A;  3TSS A;  1FVI A;  4A3K B;  3FHW A;  1U9R A;  3HKZ B;  3L7Z C;  1TS4 A;  3VYR A;  2ASB A;  5JEA H;  1STA A;  4POF A;  3CD6 A;  1O78 A;  2KA7 A;  1WCM B;  5IT9 c;  4YWK A;  1BOS A;  2PZU A;  3STB C;  1X54 A;  1IL8 A;  5H1S E;  3CCJ A;  2WAC A;  5EBC A;  2R93 B;  4DR5 Q;  3H09 A;  4BBS B;  1NCV A;  3J80 L;  3L3O C;  3MEH A;  3Q23 A;  2F0O A;  2YTY A;  2XGT A;  1TS2 A;  4LFC L;  3G4S A;  1E0B A;  2KHI A;  1IKL A;  1SYB A;  2VUM H;  5C0X I;  3PUZ A;  4WFN 3;  1PH4 A;  1A3T A;  3NBH A;  5BR8 L;  5KNC A;  2CH4 A;  2O4X A;  1I6V C;  1KIX A;  3D0F A;  2D0O A;  1IXR A;  3CME A;  2C9O A;  3ER0 A;  1O7Y A;  2I5L X;  4CBV A;  5FJ8 H;  2JEB I;  4IO9 A;  4Y7N B;  2NVX B;  3H94 A;  2K28 A;  4QCL A;  3U58 A;  2EXD A;  1HZA A;  1O7Z A;  1NUC A;  2EJG C;  3HRZ C;  2EYF A;  4BXX H;  5ELB A;  2IWH A;  3MXN B;  4HSV A;  3G6J B;  3RR5 A;  3S2H H;  2V1C C;  4L8J A; 
#chains in the Genus database with same CATH homology
 1GUN A;  5EKL A;  4TSS A;  3NHH A;  2OEO A;  1G6Z A;  1AP0 A;  3D4R A;  3D3R A;  3MHB A;  4K8J A;  3RZD B;  2KED A;  2I46 A;  2BE5 C;  2A6E C;  2F0E A;  1RTO A;  1ZYR D;  4KHV A;  3V2T A;  3TP8 A;  1I4Q A;  2XRQ D;  2SEB D;  1SE4 A;  3P1H A;  2B2V A;  1QWY A;  2CVR A;  5BN3 A;  5FO8 B;  1QNK A;  3PV0 A;  3NTK A;  3VR6 A;  4RFB A;  3F2U A;  1XX8 A;  1H9S A;  1MBY A;  1I3Q B;  5E4X A;  3IFT A;  1TII D;  2BA0 A;  3IL8 A;  1SMY C;  2KEC A;  2KVM A;  3KBX A;  2WIN B;  3CKI B;  2SOB A;  2KCN A;  1L0Y B;  1EFI D;  3S16 B;  4IUN A;  1Y1W B;  3IAY A;  4A93 B;  1EY0 A;  2EDG A;  5KGU A;  1RKN A;  4G7H C;  3D8G A;  4YIJ A;  3LWU A;  3GTM B;  3CHB D;  2EXZ A;  1FNW A;  1RD9 D;  5I2X A;  5C44 B;  3DHQ A;  3ND8 A;  4J1M A;  3VR5 A;  4CHT B;  5ELC A;  1A3V A;  2TMP A;  4FYD A;  1QNU A;  4XYO A;  1TWH B;  4DFA A;  2L55 A;  3EJI A;  1KDC A;  1U4P A;  1GOZ A;  3T4A C;  1D5M C;  5EBD A;  4KD4 A;  5A2Q E;  4RCO A;  1FGB D;  4FXD A;  5JVG 3;  2G9D A;  4FO2 A;  1CQV A;  2F03 A;  1SSO A;  3BVZ A;  3OWF A;  3ERQ A;  3LWE A;  2ZXR A;  3A8K E;  2F0L A;  3I70 A;  1HFG A;  2E76 C;  3HG9 A;  5IT9 L;  4C3H G;  3MWY W;  1IHZ A;  2AQ2 B;  1LTT D;  1PTO C;  4RAU C;  5TSS A;  5EQ0 A;  2A68 C;  1ML0 D;  1Y1V B;  2PO4 A;  4XT3 B;  1W6J A;  3OW7 A;  5DNF A;  4DNR B;  1RCV D;  1D6E C;  3K7A B;  2A5H A;  2QIL A;  3M4O B;  1AEX A;  1SYG A;  4WJW A;  4GZY C;  4IFD G;  1K8O A;  5KND A;  1BR9 A;  4KD3 A;  1PFB A;  3AU7 A;  2CHB D;  5CV9 A;  5J1Z A;  4NDX A;  4K5V A;  3PO2 B;  2EE1 A;  1ILP A;  2HCC A;  2PW7 A;  1PRT C;  3J7A V;  1AZQ A;  5A2Q L;  5D3I B;  2B8G A;  4BA2 I;  2R3Z A;  5E4W C;  1SNP A;  1HCZ A;  4XXE A;  3TZU A;  4IUR A;  2JA5 B;  2WP8 J;  1M8A A;  3RLF A;  3S2D B;  1J9O A;  4H44 C;  5EPJ A;  4ULL A;  3OSO A;  1GHK A;  2WII B;  3T51 B;  5T1G A;  1G2T A;  3S1R B;  1XYI A;  3HOX B;  3MVV A;  1F2Z A;  3FPU B;  1LT5 D;  1WTO A;  1TY2 A;  1UNS A;  4F7X A;  1HUN A;  3VR3 A;  2J0T D;  3PMF A;  4M1U B;  4E6I A;  3GP7 A;  4L6T B;  2KCC A;  3BG3 A;  3VYT A;  3SK6 A;  4XYQ A;  2HDM A;  1B44 D;  1HHV A;  1ZKO A;  3UI2 A;  2F0G A;  2F0D A;  1JC7 A;  4CKC A;  4V19 0;  2BDN A;  1YNN D;  3NUC A;  2FFK B;  1GUS A;  1TWA B;  3V96 A;  3X3M A;  2XVS A;  2N55 A;  3C1E A;  3N52 A;  5JJZ A;  1V1P B;  2EJF C;  3KLS A;  1CHQ D;  5I9P A;  5JEA J;  4K2L A;  5C3X A;  4QMG A;  1KDA A;  1O80 A;  4QUC A;  5BN5 A;  3QOJ A;  3TZD A;  2SDF A;  1RHP A;  2F0H A;  2E75 C;  3RUZ A;  5CV5 A;  2XIW A;  4KJN A;  3NXW A;  2B2W C;  2JSO A;  3Q24 A;  4OO1 G;  1EU4 A;  3NWS A;  4L63 B;  1II3 A;  4JBW A;  3CU7 A;  2KEE A;  4CKB A;  1LV9 A;  2RKS A;  3HOU B;  5LL6 S;  1TWG B;  1HUM A;  3FDT A;  4U68 A;  1OXV A;  4RGN A;  1UAP A;  3SR1 A;  1PTO D;  3MA2 B;  1CI3 M;  2EY2 A;  2B39 A;  4PMW A;  3OHX C;  1Z6H A;  2JXM B;  1ENA A;  2K1B A;  3A8J E;  2EYM A;  1VCI A;  3GTL B;  4X3T A;  1JWU D;  1EEI D;  2Z4H A;  1LAC A;  3E6Z X;  4EQP A;  4X3K A;  1OXU A;  2NTT A;  2AWO A;  4C3J G;  2EJM A;  2K5D A;  3EVQ A;  3M85 A;  4OL7 A;  1BUV T;  3HGB A;  2RSO A;  4RA8 A;  4FP5 D;  1B53 A;  4G7Z C;  1CFM A;  1V8Q A;  1FYC A;  5HGT A;  5IGF A;  3I3C A;  1KAB A;  4CJ2 C;  4DN4 M;  2KQ3 A;  2EYH A;  3SXH A;  2A69 D;  1WD1 A;  5IGB A;  3SHL A;  1PTO F;  3ND9 A;  4KY6 A;  3U9O A;  1JB3 A;  1B50 A;  3JAM L;  1F9P A;  1LTG D;  1XXG A;  2EYO A;  1PTO B;  4EQN A;  5C5L A;  1TWC B;  1SJE D;  2ENB A;  5COY A;  1EZ6 A;  1NR4 A;  1F9S A;  2JA7 B;  3E5S A;  4R8N A;  4BY7 B;  2AUJ D;  2F0T A;  3J80 E;  3J7Y W;  2L4N A;  4CKE A;  4ZAI A;  2IT1 A;  3KLS X;  1DZ1 A;  1EIH A;  3FMC A;  3WOE A;  4P2C B;  1YNJ D;  4IQZ A;  1A15 A;  2OF1 A;  1WTX A;  1LTR D;  1MSG A;  1QG7 A;  1EU3 A;  1LTB D;  3FVQ A;  5KEE A;  5IGE A;  2RSN A;  1B1Z A;  4IFD H;  1Y8P B;  5I4D A;  3QJY A;  2HQE A;  3DEP A;  1QE6 A;  1HXY D;  3I4L A;  2F1M A;  2HCI A;  3BDL A;  1E2W A;  5A35 A;  4HAE A;  4MIU A;  1LTA D;  5G3L F;  1T5E A;  2XSC A;  2VUM B;  3DEO A;  1EZ8 A;  1ESR A;  5FO9 B;  2XNA C;  4I65 A;  5KYI A;  2A6H D;  1JOO A;  3NWT A;  1FNU A;  1MGS A;  1JR0 D;  4R9W A;  4NW2 A;  4N9T A;  3HZX A;  1G2S A;  3NE5 B;  1S5C D;  1TQO A;  4RGM A;  1GUG A;  2IX0 A;  3I90 A;  2EYL A;  2LY7 A;  2O5I C;  1SYC A;  5DM6 3;  2AUK A;  1WD0 A;  3S2H B;  4ZK9 B;  4NKL A;  3A56 A;  3K5L A;  4KKU A;  3M3Y B;  1KDB A;  1Q12 A;  5KNB A;  2QCP X;  4FF1 A;  1G8Z D;  4CJ1 B;  3MXP A;  4MN3 A;  4BBR B;  2WKD A;  1TKW B;  4TQU S;  5CV4 A;  1F77 A;  4X3S A;  5DM7 3;  3HOZ B;  2M00 A;  2L12 A;  1GHJ A;  5EKI A;  4PQX A;  1V1P A;  3A55 A;  2EOT A;  3H91 A;  1JWM D;  3ITP A;  1KAA A;  3SK8 A;  3HOY B;  1SNM A;  2NN6 H;  3RD4 A;  2KUM A;  1EQT A;  2E2I B;  3MFG A;  5C4Z A;  1S5F D;  2ZXP A;  1OXT A;  3DXJ C;  1SAP A;  4XQQ A;  3CQZ B;  1C48 A;  4RWS C;  2RVL A;  1L0X B;  4K5W A;  2K5Q A;  3HS0 C;  4DGZ A;  3PUY A;  1BF4 A;  4QIW B;  3NK9 A;  4CJ0 B;  3TN2 A;  4BS9 A;  1DON A;  4IUV A;  3V05 A;  5AFW A;  4OO1 H;  1ET6 A;  4X3U A;  1A6X A;  2K05 A;  1TT2 A;  2QKI C;  1E2Z A;  4J8Q A;  1TU2 B;  3GTJ B;  2CW0 D;  3OMG A;  3T56 B;  5K5P A;  1ROD A;  4PMC A;  1Z7T A;  4DXG A;  1LT3 D;  1IKM A;  2DN8 A;  1HA5 A;  4XT1 B;  1SE2 A;  1H9R A;  2L5T A;  1VMC A;  5IT9 E;  1AW7 A;  1AN8 A;  4ZKC B;  3HOW B;  1STN A;  1U4M A;  1SJH D;  2JE6 I;  1H9M A;  1ENF A;  1JQY D;  1GUW A;  1GXD C;  3GTQ B;  1F9Q A;  4C3I B;  3QOL A;  1SYD A;  1I6H B;  2SNS A;  5C4H A;  2B2V C;  1MI2 A;  4XIG S;  1NSN S;  5E3F A;  2FIN B;  2DY7 A;  1SNO A;  1G91 A;  2Z8L A;  1LO5 D;  1LAB A;  5BN4 A;  2LS0 1;  5IOC A;  1K8M A;  1BO0 A;  3T13 A;  4ME5 A;  5I2Y A;  1TS3 A;  5LL6 X;  1Z47 A;  2MUY A;  4QB4 A;  1CQF A;  4KV6 A;  2F0M A;  2WV6 D;  3EQL C;  1EEF D;  2XN9 C;  2L11 A;  3T53 B;  2H1E A;  2NYZ D;  1G29 1;  3GV6 A;  5FO7 B;  3J7A F;  1J8I A;  3FPP A;  1SXT A;  3A54 A;  3O13 A;  2QEJ C;  1IW7 C;  4HMJ A;  1RDP D;  2BA1 A;  1Y8N B;  1H9J A;  2EZV A;  2E74 C;  1UEA B;  2IW3 A;  4IUQ A;  2B2T A;  3KK7 A;  4CGY B;  1ENC A;  1PLF A;  4FNF A;  1U4L A;  3OPO A;  1BBX C;  4H7B A;  4ZUI A;  4ZRZ A;  3GTO B;  4IN3 A;  3T16 A;  3BVG A;  3FEW X;  4F8M A;  1EWH A;  3TDQ A;  3SE0 A;  1HFN A;  3SK4 A;  1HRJ A;  1JE4 A;  1KNA A;  1EY8 A;  1ILQ A;  3M4Y A;  4S3S A;  2M2L A;  2BE5 D;  2A6E D;  3N6R A;  3K5O A;  5I9O A;  1PZJ D;  1B9M A;  2IPK D;  1WTQ A;  1I4X A;  1A2U A;  4OGQ C;  4DAV A;  1PXU A;  4RHR A;  5M9O A;  4QF4 A;  1D1I A;  3NSW A;  4TRD A;  4FF2 A;  1TS5 A;  4KK7 A;  5M5Y B;  2WAQ B;  1GUT A;  2BDO A;  1I4G A;  4I7Z C;  2B8F A;  4KN7 C;  2VNU D;  4ZUJ A;  2JEA I;  1SMY D;  2WB1 B;  1EIG A;  2F3W A;  3MXN A;  3ZYY X;  1BDO A;  1IYV A;  4UAI A;  4IFD J;  1KTK A;  2ZXO A;  4HED A;  3GTG B;  3MXU A;  2F0I A;  2RDF A;  2F0F A;  2LKV A;  5NUC A;  1ONL A;  1V1O A;  2NN6 G;  1TY0 A;  2JYO A;  1M4V A;  3W3A A;  4A3B B;  2YYZ A;  5ELF A;  2GA4 B;  2C5C A;  4O42 A;  1QOH A;  4G4K A;  2RDH A;  5CV8 A;  3TP6 A;  2NZ1 D;  4A3F B;  3OMC A;  3K58 A;  1HQM C;  2NVQ B;  1QCB D;  3ERO A;  1DJR D;  1QB5 D;  1Q3L A;  1BNZ A;  4U67 3;  1CT1 D;  2HDL A;  2PNR C;  5C4J B;  1JOK A;  3D4W A;  4KY7 A;  3QG1 A;  3MTS A;  1F9R A;  4HMI A;  1FD7 D;  5HUR A;  1VF7 A;  2R92 B;  1DOK A;  5J39 A;  2Y0S B;  4V0B A;  2Z4I A;  4FXG C;  4HCS A;  4RKL A;  2F3V A;  3BDC A;  3MXG A;  3JAM E;  2A68 D;  5EJW A;  2J4X A;  4PMB A;  4Q0F A;  2DY8 A;  1WTW A;  5M5W B;  2K03 A;  4XTC S;  2FMC A;  2M9V A;  3NTH A;  2L9H A;  2O2L D;  4IFD I;  4DU9 A;  2NVY B;  3DUZ A;  3VR4 A;  1CZW A;  2KJX A;  2B2Y A;  5C3W A;  1OXX K;  4RKB A;  5C0X G;  4K5X A;  4TKO B;  1SBB B;  2WKC A;  4DNT B;  5C4X B;  4K8I A;  4EGV A;  4C3H B;  3ONA B;  3GO5 A;  2AQ3 B;  1SNQ A;  2Z1C A;  1H9S B;  3C1F A;  4H0L C;  1H9K A;  2Q8R E;  1PRT D;  2F0S A;  4A3D B;  3S1M B;  2PPB C;  4K14 A;  2ID0 A;  5G3L D;  2TSS A;  3BDO A;  2EPB A;  4BY1 B;  3DM1 A;  1AZP A;  1NAP A;  1SE3 A;  3R8B A;  2MPM A;  1Q1E A;  5KIX A;  2B2Y C;  2PQE A;  1CM9 A;  4Z9C B;  1ZYR C;  3MC0 B;  4ZLT F;  3R2T A;  1STE A;  3W2D A;  2JA6 B;  4DAY A;  1DOM A;  2RQX A;  1LLR D;  1XWE A;  4KKS A;  4IUU A;  4A3I B;  3BZD B;  4Q5V A;  1HA6 A;  1MD2 D;  2DNE A;  5EKK A;  4PNY A;  4N9P A;  4C1N I;  3OWE B;  1WTP A;  1AFP A;  2F0U A;  3U9S A;  4BA1 I;  3Q22 A;  1B2T A;  1UUP A;  2NB0 A;  1PRT F;  3I73 A;  1JIC A;  1O7L A;  2JP1 A;  2NN6 I;  2X6L A;  4KI0 A;  1VMP A;  2KOL A;  3C3L A;  1NR2 A;  3DMU A;  3E0J A;  4HN7 A;  4UDU C;  5IIF A;  1PRT B;  1ZXT A;  1SNC A;  4F87 A;  1D2B A;  4C56 C;  1EYA A;  4F88 A;  1PYW D;  1LTI D;  2F0W A;  2J7Z A;  2B2U A;  1PDQ A;  5D14 A;  4OO1 I;  1TVX A;  2AQ1 B;  3I72 A;  5JOB A;  4K6L A;  5F2D A;  3J81 E;  1KLU D;  2EVB A;  1DOL A;  2F0P A;  4HTH A;  2ICE C;  1SEB D;  3M7N A;  2MJ8 A;  2FMM A;  3S14 B;  4H13 C;  3I4M B;  3P75 A;  3EFX D;  2A74 C;  1R4Q B;  4KHZ A;  3P7J A;  1LTS D;  4HR7 B;  5CMD A;  4RGT A;  1PZK D;  5DEH A;  1S5E D;  4HSP A;  2B2U C;  1EOT A;  1D5Z C;  5CGK A;  3RZO B;  4XQN A;  4A3M B;  2Q8T A;  5IOD A;  4ZQ3 A;  2NTS A;  4FVM A;  4RCN A;  1OXS C;  2D9U A;  3HOV B;  4EQO A;  5EPK A;  1D1K A;  1WTV A;  1CA6 A;  3MFY A;  1EY9 A;  1EY7 A;  5CV6 A;  1KLG D;  4RHS A;  4DK1 A;  1LT6 D;  3NP8 A;  2DNC A;  2QF7 A;  3K57 A;  1ZEQ X;  1DCZ A;  5CBA E;  1A2T A;  3VYU A;  1EWC A;  1GUO A;  2K33 A;  1I4H A;  3J81 L;  4RH6 A;  3Q0A A;  1FR3 A;  4DXF A;  2EY5 A;  4M8A A;  3TP5 A;  5IGC A;  3C46 A;  1EY6 A;  4EVO A;  3RMH A;  3X3N A;  3K0Y A;  4WOR A;  3KBG A;  4DAP A;  1Q8I A;  3S17 B;  1X3Q A;  4C3J B;  2VB2 X;  3BVM A;  4A3E B;  1FNV A;  2LFN A;  2H4O A;  2K6A A;  1C8C A;  1BCP C;  2D5D A;  3KF8 A;  5IGD A;  4ZKB B;  1TWF B;  1EYD A;  5D65 A;  3BS1 A;  4FXK C;  1F2Y A;  2EY1 A;  2D62 A;  2NUC A;  2BCO A;  4KJO A;  4OHJ A;  1EY4 A;  1RF2 D;  2RA4 A;  5ELE A;  4R8I A;  5C0X H;  5E1F A;  3AB9 A;  4OIK A;  4IZ8 A;  3DWQ A;  3EA6 A;  2PYK A;  5C6A A;  4IUP A;  1YNN C;  3H3V C;  4O1N A;  3CRL C;  5KRU A;  1SYF A;  4LK1 C;  2IX1 A;  3BYT B;  4G7O C;  1V43 A;  4B9X A;  4ODG A;  1STY A;  5M5X B;  1I4P A;  1CA5 A;  2PMZ B;  1DXM A;  1U4R A;  2X6G A;  3GTP B;  3URY A;  5C3E B;  3R93 A;  2X69 A;  2HUG A;  4KKT A;  1EL0 A;  5FOB B;  2E2D C;  2N88 A;  2R61 A;  1Y8O B;  3DWA A;  1E2V A;  3A7L A;  5D3D A;  1D5X C;  4K2K A;  2OT2 A;  1GJX A;  1JCK B;  1CK1 A;  1DM0 B;  2YU9 B;  5J22 A;  3LNN A;  3NTI A;  3P20 A;  4LAA A;  3VR2 A;  2EY6 A;  3A7A B;  2L0C A;  2PZW A;  2PW5 A;  2F4I A;  2VB3 X;  2NWG A;  3FRP B;  3D31 A;  1F2M A;  5CV7 A;  3S9W A;  4KY5 A;  1SDF A;  3LX0 A;  2IL8 A;  2PCF B;  5K36 G;  1PFN A;  2JA8 B;  3WDN A;  4B9W A;  1WTR A;  1B9N A;  2PZT A;  1PMR A;  1CZG A;  5JVH 3;  1T5X D;  3H0G B;  2FHT A;  5CBE E;  2B2T C;  1PFM A;  1JWS D;  2K5W A;  3HP3 A;  3NPP A;  3R3O A;  2EYJ A;  5C5M A;  1RJT A;  5JEA G;  5FKA C;  3A8I E;  5FLX E;  5DAU A;  2QDB A;  1ET9 A;  3GQB A;  2A69 C;  3PUV A;  1HQR D;  4PV1 C;  5I6Y A;  5ELD A;  3PIO 3;  4MHE A;  1S4Z A;  1I50 B;  2F0V A;  2XWJ B;  3I8Z A;  1BCP D;  3R2I A;  2F0K A;  1MSH A;  4K6D A;  2K01 A;  3SK5 A;  4A3J B;  4A3G B;  1EQV A;  5EPL A;  1A3U A;  2KHS A;  1B3A A;  2XWB B;  2VXW A;  1DD2 A;  4ZYS A;  1YNJ C;  1C4Q A;  2LMC B;  1STB A;  2B2W A;  1R4P B;  4KTA A;  4J6H A;  2ZT9 C;  4QUF A;  2FJ2 A;  3TP7 A;  3S15 B;  3K5M A;  1STH A;  4WRD A;  4IAL A;  2MHV A;  3PUX A;  1HTL D;  3NQT A;  1STG A;  5FK9 C;  1S5D D;  2MP1 A;  2A6H C;  4DK0 A;  3L9A X;  2R7Z B;  1X32 A;  3MZ5 A;  1VF5 C;  5FLX L;  4NMZ A;  2D2C C;  1X3P A;  5CC4 A;  1K83 B;  1BCP F;  2SNM A;  3SEB A;  1BXT A;  1Y69 U;  3MAQ A;  1R9T B;  5I6W A;  3GD7 A;  1BCP B;  3K5N A;  2V4D A;  4NP5 A;  4FF4 A;  5CYU A;  1Q1B A;  2IX3 A;  1B4O A;  1CTM A;  1W6K A;  3NQI A;  1BQQ T;  4G57 A;  2E2J B;  3SVM A;  3QO2 A;  1IW7 D;  5M3M B;  5JAV A;  1S5B D;  1RTN A;  2EYP A;  1ESF A;  5LHY 1;  4RGO S;  2E2H B;  2O5J C;  4HCE A;  2F0Q A;  3SDZ A;  1ICW A;  3TBI B;  2CQA A;  3VA7 A;  2ICI A;  2F0J A;  3VA5 A;  3M7G A;  2K7V A;  3VYS A;  4C2M B;  1HTP A;  1XTC D;  1LT4 D;  1WVL A;  3D4D A;  2G9H D;  5JPM C;  1QJO A;  4ILW A;  4AYB B;  4JK1 C;  2R6G A;  3FKI B;  1OO9 B;  4ID6 A;  2K04 A;  1SFO B;  3OIQ A;  3Q6S A;  3KLR A;  4BWG B;  5JPN C;  4LMQ D;  4KMU C;  2BOS A;  5CR3 A;  4B08 A;  5IGG A;  2A73 B;  2NBF A;  2NVT B;  1PZI D;  4KN4 C;  3K6O A;  3OOC A;  5COR A;  1KNE A;  3KUP A;  2F0N A;  2AWN A;  1QIL A;  3TME A;  3PUW A;  1VDZ A;  3H6M A;  3PIP 3;  3WOF A;  1EYC A;  4C3I G;  2I07 B;  5T1I A;  3S1N B;  2B63 B;  3G7L A;  3I91 A;  2K32 A;  3I4N B;  3AMU A;  2CW0 C;  2L1B A;  3S1Q B;  5ISR A;  4XDX A;  5C0X J;  3DWP A;  3D6W A;  4IUT A;  4ABN A;  2MGS A;  1SND A;  3D6C A;  5M3F B;  1EY5 A;  1JOQ A;  3OIP A;  4FF3 A;  3GTK B;  2XRS D;  1JOR A;  4XQJ A;  1TR5 A;  2OXP A;  1DYQ A;  4LJZ C;  2Q8I B;  3QIA A;  3QB3 A;  1I4R A;  1SYE A;  1HPC A;  4DA2 A;  2RDG A;  3GV3 A;  5K36 H;  1CHP D;  1Q90 A;  4C1N K;  5EGT A;  3IFD A;  3C2P A;  2IJ0 A;  3BYY B;  3QWN A;  3PO3 B;  3HEJ A;  3IKJ A;  1PTO H;  5KYL A;  2RBM A;  4DF7 A;  3K59 A;  3CRK C;  3NBI A;  1IYU A;  4OIJ A;  1F2L A;  3TSS A;  4A3K B;  1U9R A;  3HKZ B;  3L7Z C;  1TS4 A;  3VYR A;  5JEA H;  1STA A;  1O78 A;  2KA7 A;  1WCM B;  1BOS A;  2PZU A;  1IL8 A;  2WAC A;  5EBC A;  2R93 B;  3H09 A;  4BBS B;  1NCV A;  3J80 L;  3L3O C;  3MEH A;  3Q23 A;  2F0O A;  1TS2 A;  1E0B A;  1IKL A;  1SYB A;  5C0X I;  3PUZ A;  4WFN 3;  1A3T A;  3NBH A;  5KNC A;  2O4X A;  1I6V C;  2C9O A;  1O7Y A;  4CBV A;  2NVX B;  2JEB I;  4Y7N B;  3H94 A;  2K28 A;  4QCL A;  1O7Z A;  1NUC A;  2EJG C;  3HRZ C;  2EYF A;  5ELB A;  2IWH A;  4HSV A;  3G6J B;  4L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...