1S4ZA

Hp1 chromo shadow domain in complex with pxvxl motif of caf-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
75
structure length
75
Chain Sequence
b'HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromobox protein homolog 1
publication title Structural basis of HP1/PXVXL motif peptide interactions and HP1 localisation to heterochromatin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 7
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s4zA00
1J9OA 2DY7A 4O42A 2IL8A 2L9HA 1B2TA 1XYIA 3P7JA 4CJ0B 2VXWA 1EIGA 2H1EA 3N52A 1S4ZA 1B3AA 1F9QA 2D9UA 2RA4A 1U4PA 5CMDA 1IL8A 2Q8TA 2J7ZA 2EPBA 2MP1A 1CM9A 1TVXA 4HSVA 1X32A 2HCIA 2B2TC 4UAIA 4U68A 1PFBA 5T1GA 2CVRA 2X69A 1RODA 2KEEA 4MN3A 4ZKBB 1PDQA 2HCCA 2RSNA 4NW2A 1AP0A 1SAPA 2B2YC 2K01A 4CJ2C 1BNZA 4XDXA 1U4LA 1PFMA 1ICWA 3R93A 4XT3B 1F9RA 5D65A 4LMQD 3TN2A 4DN4M 2L12A 3F2UA 5JJZA 2KUMA 1DOKA 1KNEA 2XIWA 2JYOA 1QE6A 1LV9A 1O80A 1CA6A 5E4WC 1KNAA 1XX8A 3I91A 4CJ1B 1MI2A 1EIHA 1SSOA 1RHPA 4MHEA 1X3PA 5DNFA 5CBEE 1HUNA 4RA8A 1EQTA 1SDFA 2NZ1D 1B50A 1NCVA 1QNKA 2L4NA 2MGSA 2X6LA 3KBXA 2NYZD 1F9PA 3LWEA 2Q8RE 1WD0A 4IUQA 4ZLTF 1Q3LA 1NR2A 2NWGA 2X6GA 1EL0A 5EKIA 2FFKB 2FMMA 1X3QA 1JE4A 4ZAIA 3TZDA 2RSOA 5COYA 2JP1A 5T1IA 1G2SA 2R3ZA 4IUVA 1WVLA 3DM1A 1RTOA 1WTOA 3UI2A 2B2WA 1J8IA 3MTSA 2M2LA 1BO0A 3IL8A 2MPMA 2EE1A 5E4XA 4QUFA 5EPKA 1WTWA 1C8CA 2DY8A 4X3KA 1DOMA 3SVMA 1JICA 1PLFA 5EPJA 3IFDA 4QUCA 4XT1B 2FINB 4HEDA 3ONAB 1WTRA 2B2VA 1BBXC 1HFGA 5EJWA 1HHVA 3MWYW 1E0BA 5EQ0A 1RJTA 2B2UA 2HDMA 2RVLA 1MGSA 3Q6SA 3QO2A 3I90A 1DOLA 4HAEA 2FHTA 2L11A 1O7YA 1HUMA 1IKMA 4OIJA 2K04A 4IUPA 1EOTA 2HUGA 1AZPA 1HFNA 2FJ2A 1CA5A 1U4RA 1U4MA 1AZQA 2SDFA 2K05A 1WD1A 1G6ZA 2KVMA 2L1BA 4X3UA 1IKLA 1GUWA 1VMCA 1DONA 1NAPA 3GV6A 1G91A 4RAUC 4R9WA 1ILQA 2K1BA 3GV3A 3KUPA 3DEOA 1ILPA 1MSGA 1NR4A 2B2TA 4IUUA 1HA6A 4X3TA 2B2WC 1VMPA 4IURA 2EOTA 2N55A 5CORA 1ZXTA 4ZK9B 4X3SA 1WTQA 3HP3A 1WTXA 1WTVA 2K28A 3H91A 4R8IA 1DZ1A 2MJ8A 2B2YA 5EPLA 1B4OA 1QG7A 2KEDA 3FDTA 2BDNA 2KECA 1B53A 3DEPA 5AFWA 5CBAE 1ML0D 1F2LA 3I3CA 1RTNA 1M8AA 3I8ZA 1PFNA 2B2VC 2N88A 4OIKA 1A15A 2K03A 3G7LA 4IUTA 1BF4A 1F9SA 3FPUB 4RWSC 5D14A 1G2TA 4ZKCB 4HCSA 1MSHA 2HDLA 1ESRA 3D6WA 2KOLA 1O7ZA 2B2UC 1HRJA 1WTPA
chains in the Genus database with same CATH superfamily
1J9OA 3PIO3 1AEXA 2I5LX 1HXYD 3R3OA 3N52A 5JVG3 4DNTB 3H0GG 4A3GB 5C5MA 2RHQB 1C4QA 3HOZB 1IL8A 2MP1A 4ALPA 4CDCC 1IYJB 5EAYA 5CV9A 3GTPH 4HIDA 4L6TB 1I4QA 4RH6A 4X65Q 4BBSB 3I72A 2TSSA 2CH4W 4YCWA 3MEFA 2IX0A 4IO9A 5JEAJ 1TS2A 3NBHB 1CA6A 2SNSA 1AW7A 1EIHA 1SSOA 3U4VA 4L5SA 4QQBX 3L0OA 2ENBA 2F0EA 3ERQA 4DR3L 4FO2A 3RUZA 1JMCA 4H7BA 4R1JA 4OL7A 2PQAB 3J81i 5EBCA 5GAHC 5C4JH 4P75A 5K5PA 1C8CA 1G291 1HR0Q 4K5VA 4B3TL 1JICA 3CU7A 3AMUA 4E6IA 3GTGH 1I6VC 4DFAA 2G9DA 2RDFA 3BDOA 3I73A 1HFGA 1LTBD 1PZJD 1ICFB 3L7ZC 4ABNA 3RNUA 4A3FH 1IW7C 3BU2A 1LO5D 2K5QA 5C6AA 1BXTA 3K0XA 2LY7A 2K04A 1KLGD 2EYMA 1EY5A 4CDEC 2KVMA 2JA5G 1WCMB 2LMCB 1G91A 4XYQA 4LF8L 4PQXA 1HZAA 2K5NA 2CKZB 1BDOA 4DR1Q 4CDFC 3S2DB 4KN7C 4C1NI 2AMCB 1SE8A 2WAQE 1ET6A 2F0VA 1QG7A 1QILA 1PFNA 2B2VC 1PH4A 1C9OA 2K03A 1XPRA 1H9RA 3NSWA 1M90C 2BDOA 1EYAA 1N33Q 2EYFA 4FXGC 4MTKA 4B08A 1KQSA 4LF4L 1JB7A 1A2TA 1S3OA 1QNUA 1F77A 2H1EA 2WAQB 5EGTA 3E6ZX 2F0OA 2OTJA 2OEOA 4UAIA 1CM9A 4HTHA 4LUZA 4OONA 4RHRA 2A6ED 1KL9A 3SHLA 1SAPA 5A2QL 3PO3B 3J81L 1O78A 1X54A 1BNZA 1SE2A 1L2FA 2C35B 3J7AV 4I7ZC 4LMQD 1Q46A 4LK1C 2EYHA 2JYOA 3U50C 4GNXA 3X3NA 3S1NB 1FVIA 4MHEA 4A3KH 3HGBA 1F2YA 2I5HA 2VL6A 1HUNA 1A8VA 1EQTA 4WJWA 4JI2L 1LABA 1I5FA 1TWAB 5IYDG 3EJIA 3KBXA 4X6AH 3GP7A 1UNSA 2F0UA 4YHHQ 5CV4A 1SE3A 2RF4A 5KGUA 1YITA 3OPOA 4NDXA 1WVLA 1WD1A 1FJGQ 2QEXA 4DUYL 4HN7A 4RGTA 3WOEA 5FLMG 2JJQA 3NTHA 3PO2H 1WTWA 1JJCB 2DUDA 5FO7B 5M3FG 1LT4D 4K0KL 4DV2Q 4OWWB 3H3VI 1A3TA 2QILA 2VW9A 4WJ3M 2E74C 1BBXC 2GN5A 5AJ3L 4PMBA 4C56C 1TWCH 1PXUA 1IBKQ 5EQ0A 2VQEL 2UU9L 2L11A 3A8KE 3J81c 1VQ6A 4XTCS 2WP8J 1AZPA 2UXDL 2FJ2A 2B63G 2KHIA 4F88A 2NBFA 1EY7A 2IT1A 2TMPA 4LFCQ 2PQEA 5ELOA 4FDBA 1HA6A 4DV4L 4HCEA 3A8IE 3T1HQ 1AE2A 3BS1A 3RR5A 3Q0AA 1KDBA 4C3HB 3M3YH 3G71A 2O4XA 4OWTB 2HIVA 2PI2A 2B2YA 1QJOA 1B4OA 5IY0A 3VDYA 5CBAE 3S1MB 3BZKA 1A15A 1HNWQ 2KCCA 1PV4A 2R93G 3V2TA 2N3SA 4PV1C 5C4XG 3DM3A 4AH6A 5I9OA 3F2CA 4EX5A 1EIGA 1RCVD 4OXPA 1SMYD 4A3LH 5HY6A 1PRTF 2SNMA 1CTMA 1U4PA 4DAYB 3AFPA 4LF4Q 3HOXH 1A3UA 5JAVA 1VQNA 1N32L 5FOBB 5IP7G 3M9BA 3JAMi 3KDFB 4A3GG 3CXCA 3ND9A 2HQLA 3HOZG 3AU7A 4G7ZC 5CV5A 2RKSA 3S24A 3CPWA 2K01A 1O7LA 5M3MB 1U9RA 5GAGC 4TRDA 1TY2A 1I4HA 2DGYA 1QE6A 3DWAA 1HNXL 4BBSG 3OTOL 1XX8A 4A93H 3W1GA 4DV7Q 1TQOA 5DNFA 4RA8A 3S17B 2JA9A 1NCVA 2Q2IA 1QNKA 4LF6L 1JWSD 2Z6KC 2L0CA 2Q8RE 1E1TA 4K6DA 3NWSA 1JOOA 2X6GA 1YI2A 2UUBQ 2YV5A 2RSOA 1XMQQ 1XPUA 1Y1VB 3CCLA 2MPMA 3E0EA 5LL6X 3RN2A 1EY9A 2LKVA 4DR7Q 4XXEA 1YZ6A 3J7ZC 1STHA 3QB3A 3KK7A 4R4OA 3WOFA 4OX9Q 4N9TA 3S2HH 4X66L 4X64L 1XTCD 3HOWH 1N36L 5DLQE 3H3VH 1QUQA 4G4KA 4JCVE 2VQEQ 2E5LQ 1SBBB 4JBMA 4A76A 1DONA 3W5OA 1TS3A 3GV6A 4C3JH 1QOHA 5I6WA 1Q81C 5FKAC 4KTAA 3DEOA 4FP5D 1E3PA 5GADC 3K8AA 3JC66 4JC0A 1WCMG 4X3SA 1Y1WH 1LLRD 5IOCA 3I3CA 1I94Q 4A3BH 3PUYA 1AP0A 4UP9A 3JAML 2BOSA 1F9SA 4K6LA 4A3EB 1NJIC 4QCLA 2PYKA 1TU2B 3D31A 3W2DA 1X56A 4IOCA 4GOPA 1VQ5A 4J1MA 4UP7A 1EWCA 2NVTB 3U4ZA 4QGUA 4JI7Q 3FKIB 4RCOA 3S1QH 2A6EC 4NB3A 1V43A 3MEHA 2XTIA 1TR5A 5ELDA 2WAQG 1N9WA 4MN3A 2IPKD 2HCCA 1EY8A 2E8GA 3L2PA 5E1FA 3H09A 3OIPA 3HOVG 1A6XA 2CQAA 4JOIA 3BVMA 3I2ZA 1T9HA 1D5XC 2B8FA 2K14A 3D4RA 1DOKA 1JWUD 2XIWA 3PO3G 2I5MX 1HPCA 4F87A 3SEBA 1IBLL 5CBEE 4KD4A 3NXWA 2ZJRA 1B50A 4R4TA 1PRTC 1PTOD 2MGSA 3O13A 1LT5D 1GXDC 5M5WB 5IYBH 1BCPB 1GUNA 5FLXc 3JAMc 3CD6A 1GHKA 3T1YL 1EL0A 3I4OA 3QOLA 3TZDA 4GKJL 3NBHA 2R3ZA 4IUVA 3I4MG 2V1CC 4HR7B 1V1PB 2KA7A 5KNCA 1PTOH 1TWGH 4DV6L 3KLSX 5C3EB 1SROA 2EZVA 4K14A 3K81C 5EPJA 5ISRA 2HT1A 4QUCA 5K36G 2PO4A 4KHPL 1D1KA 3CQZH 4NXNQ 2VQFL 4RG1A 1XWEA 4LUOA 3QO2A 1FNWA 5E3FA 4ZUIA 2F0JA 1GOZA 3NENA 1HUMA 2BH8A 4A3FB 4IUPA 1EOTA 4GKKL 5L37A 4L8JA 1YVCA 2K05A 3NP8A 4R4QA 3K5LA 1VMCA 2L15A 4H02A 4UY8C 4IPDA 4XQJA 1OXUA 1ILPA 2ZXOA 3NEMA 2B2TA 4NMZA 1R4QB 1UUPA 2A68C 2BCOA 2NVXH 2H5XA 2F0QA 3ZJYC 5KYLA 5CGKA 3S14H 2Z4IA 3I8ZA 1EZ8A 4C3HG 3F2DA 3P20A 1EYCA 3S1RH 1FGUA 2B8GA 2QKIC 1D8LA 5CV7A 1L0WA 1PTOF 4UHVA 4WRDA 1V8QA 3K80C 4BY1B 5IP9H 2E2IH 4EQOA 4UDUC 1CHQD 3DMUA 2B29A 5FJ8H 3CMAA 1VQAA 2NVYH 2NZOA 4NKLA 2J7ZA 2EPBA 2VB2X 4U68A 4OWXB 4A75A 4JI3Q 2X69A 2NTTA 4RCNA 4IJLA 5C44B 2RSNA 4OGQC 1BOSA 1E2WA 3RLOA 3VYRA 2UUCQ 1VDZA 2JA8H 5HGQA 1EU3A 2QW7A 3GD7A 2ZJQA 2NTSA 2KBNA 1MI2A 5M3MG 3WDNA 1HTLD 1X3EA 2IHFA 4ME3A 3LWEA 4A3IG 2NWGA 2EVBA 2EY5A 4X65L 3CCRA 4CHTB 1MJCA 3HRZC 4KN4C 3K58A 1STEA 3H3VC 1L1OB 1BUVT 2AUJD 3IL8A 2F0TA 3SVMA 2ICEC 3EA6A 1Y1VG 4A4IA 2DN8A 1K83H 2A69C 5IGDA 5ELCA 1I6HH 1PYSB 3IAYA 1Y8OB 1CUKA 1K8MA 1J5EQ 1IKMA 4OIJA 4P74A 1LTID 1HR0L 5HURA 3J80L 2OT2A 1SRUA 1IKLA 1I50H 3QG1A 4G7HC 4PZ8A 2K1BA 2MO0A 3Q24A 4L5QA 4BXXH 2EY6A 1W6KA 1E7ZA 4KJOA 3K0YA 2PNRC 3L3OC 2CCZA 2ZTCA 4HJ7A 1KDAA 4IFDJ 2R6GA 3SK6A 3M3YB 1EWIA 1EQQA 1M8AA 5A35A 1I3QH 1S5FD 2ES2A 2VUMH 1VQ9A 2R7ZB 1EYDA 1G2TA 4EQPA 3P75A 1TWFH 3KJOA 1NY4A 3H6MA 4DR1L 4IPHA 2F0LA 4QIWE 2IL8A 1VQCA 4A3EG 1XMOQ 1TWHH 5JEAG 2MUYA 1FGBD 3HEJA 1Z6HA 4KY5A 5KRUA 2RQXA 2R92B 2FXQA 1EY0A 1FD7D 1PMRA 2EJMA 4K5XA 4XQNA 3GTMB 3FKIG 3SK5A 3GTJH 1RODA 1S5ED 1N33L 3GTQB 3TZUA 4EVOA 2EDGA 4ZKBB 3J80c 3Q23A 1C48A 5H1SE 3P1HA 3W3AA 5EKLA 4QIWB 4DAYA 1AN8A 4GZYC 2NVQB 3TN2A 4GLVB 1WTHA 2KJXA 5JJZA 3QIAA 1SLJA 1PTOC 4AYBE 4Y7NH 4BBRB 3KDFA 3I91A 4CJ1B 1YHBA 2F0HA 4YCUA 1B1ZA 2CHBD 1TIID 2ICIA 3PUVA 4ZLTF 1G6PA 3CCQA 4DNIA 2FMCA 3PSIA 1SYEA 4K2LA 1U0LA 5I6YA 2E2HH 3DLLA 3K5OA 4V0BA 2B2WA 3A7LA 3I4NH 2I07B 3A5UA 3TQYA 4AYBB 2JA6H 1D5MC 5IT9E 1QB5D 3BJUA 5JJLA 1VQPA 4YHHL 1CFMA 5C3EG 1EYGA 4IZ8A 2YU9H 4XIGS 4OO1G 1RJTA 1FJGL 1K73C 1MGSA 1KTKA 1GUGA 5JVH3 3C3LA 3H0GH 4KV6A 3CMEA 1NNXA 4KD3A 3V05A 2VY3A 2HUGA 2QF7A 5M5YH 1G6ZA 3I4LA 3RMHA 4DR2Q 4DV2L 2EXZA 5FLXE 4JI6Q 4JI4L 2UXBQ 3GTKH 1LM0A 2WACA 1IBKL 4FYDA 3MXGA 4L5TA 1L0XB 4DV1Q 3NK9A 4PMCA 4R8IA 5EPLA 4BS9A 2BDNA 3A0JA 3DEPA 4KKSA 5AFWA 4B3SL 3AQQA 5LMNW 5IWAQ 4K8JA 3U9OA 4EQ5A 2IY5B 2G5DA 3OIQA 1II3A 4LFCL 1ONLA 5TSSA 3NTKA 3OW2A 3T1HL 1S5DD 2EXDA 3IRBA 4NXMQ 1OXVA 3KF6A 5C3XA 1S72A 5JPMC 2IW3A 2F0WA 1ENAA 3PQIA 5M5XH 4DA2A 1SMXA 1TXYA 3MXUA 4BY1G 5T1GA 1HNWL 2HCIA 4ID6A 1CZWA 5CYUA 3T53B 2P5ZX 1Z7TA 3M4OH 4C3IB 5IGFA 1B8AA 1EFID 3TBIB 3GDEA 5C44G 3ULJA 1Q12A 2QA4A 2JQOA 4LF5L 1LV9A 4K5WA 1RF2D 2JA5H 1VF7A 2BA0A 1BCPF 4POGA 2NZ1D 5C4HA 2L4NA 4P73A 1FYCA 3S16B 4XYOA 4ILWA 2ASBA 4Y52H 1SR3A 1QWYA 4HJ8A 2YTXA 3PUWA 3M85A 5E7NA 1R9TH 4G7OC 5E4XA 4DV7L 4X3KA 4A3MB 3IFDA 4A3JB 4PNYA 2MHVA 4XT1B 2WB1E 2FINB 2E2JH 2MNAA 2R7DA 2F3IA 2UUBL 1V1PA 3HOUB 1HR0W 1K8GA 1HNZQ 1E0BA 3Q6SA 1XMQL 4A3DB 3PCOB 5C4ZA 1PH5A 3I55A 1IZ6A 4I7AA 2WINB 4DR7L 1PRTD 3CRKC 2EYJA 1GUOA 1HQMC 4OX9L 2WB1B 3KUPA 1GO3E 2E76C 1VMPA 2WKCA 3FEWX 4YWLA 4JI4Q 3D4WA 2M9VA 3EQLC 2Z4HA 4DV0Q 1YIJA 3IFTA 2QDLA 3CP0A 2E5LL 1GKHA 1EY4A 2NVXB 2RHSB 5IYCG 2F3VA 5IYDH 1MSHA 1H9JA 3S14B 4B3SQ 3TMEA 1STGA 4DU9A 2I0QA 3GTOH 4DGZA 2R7ZG 2KENA 3NQTA 2E2DC 5I2XA 5FLMH 1MHWC 2Z8LA 3GTLB 1SFOB 1I94L 2XWJB 3SK4A 2XN9C 3UDFA 4KY6A 2Q8TA 1M1KC 5M3FH 3CCSA 3C2PA 1UE7A 1X65A 3FHWA 2K4KA 2A68D 2OF1A 1I4RA 3BVGA 3HZXA 2R92G 3AFQA 3VYSA 5G3LD 3U58A 2D0PA 1D7QA 1PFMA 4K8IA 4JI7L 3VR6A 1D6EC 5IE8A 1W6JA 1K8OA 2B63H 5C5LA 4A3CG 4WORA 1DXMA 2PCFB 1X3FA 1CQVA 2JA7B 1K28A 4LJZC 5GROA 4MTNA 2EJGC 3S15H 2DJGC 3HS0C 4LF5Q 3VYTA 4AQYL 4BBRG 2Z0SA 2SOBA 5LL6S 4TQUS 3K7UC 2FMMA 1TT2A 3HOYB 5IGCA 1UWVA 4LF7L 3RZDH 3EROA 4LFBQ 3BDCA 1CQFA 3K7AB 1G51A 2K5WA 1Z9FA 4C2MH 3J80E 1DCZA 2ALYB 2R93H 4LF9L 4GLXA 2IWHA 1MD2D 4JK1C 5C4XH 3IKJA 4AYBG 5EJWA 1BCPC 1L1OA 2B2UA 4GNXC 1BR9A 3I90A 4FNFA 3H94A 4HJ5A 3KYHC 1X3GA 3L9AX 2AKWB 1B9NA 2K5VA 2RBMA 4U673 1DYQA 2D0OA 2F4IA 1AZQA 5IP7H 1ILQA 2JEBI 4A3GH 5M9OA 3HOZH 1DJRD 1SXTA 4NXNL 1VQIA 1D5ZC 2G9HD 5CORA 1EIYB 3DWQA 5G3LF 1SNOA 4JW0A 4RHSA 4DK1A 1ESFA 4BBSH 1CZGA 4HIMA 3T16A 2K32A 2A69D 1XNRQ 1CK1A 2GVBA 1PYWD 2PMZE 4KLKA 1ESRA 3PIPA 1A0IA 1LTAD 1NUCA 2VUMB 1B70B 4KK7A 5ELBA 4O42A 4N8FA 1VCIA 4CJ0B 4BY7B 4H13C 3E9HA 4ULLA 4ZQ3A 2YTYA 3NTIA 2Z6BA 3AYHB 1PDQA 3KF6B 3LWUA 2PMZB 2J0TD 3K5MA 2B2YC 4JPBW 4XDXA 2JSOA 5J3BA 4CKCA 3UDGA 5KIXA 1BBUA 2D5DA 2JN4A 3MFGA 4C3IG 1ZEQX 4O1NA 3PF5A 1I4GA 1NSNS 1E1OA 4OEMB 3CC4A 3EN2A 5IIFA 4JI3L 4O0AA 4P71A 4Y7NB 1NE3A 4DXFA 3EBEA 2X6LA 2NYZD 2N8NA 2PZUA 2UUCL 3CCUA 5DAUA 1GHJA 3TP6A 1K3RA 1JWMD 1WCMH 1X3QA 3KF8B 5JJIA 3M4YA 1WTOA 4AQYQ 1A3VA 1L0YB 3MTSA 3GTPB 1BO0A 4MZ9A 3S2DH 4DUZQ 2A8VA 4LF7Q 2DY8A 4YIJA 5NUCA 4N9PA 4JI8Q 5C0XG 3TP8A 4HEDA 2HHHQ 3TS0A 5FO9B 4A3MG 4GS3A 4A3JG 4LF9Q 1LTLA 5DM63 2ZM6Q 1EEFD 1VQFA 4K2KA 2MFIA 3J7YW 3HOUG 4ZRZA 4IPGA 2SDFA 4A3DG 1GUWA 3S9WA 2LFNA 4DR4Q 1JJGA 3KLWA 5CV6A 1O7IA 5C4JB 2PZWA 4JV5L 2DNEA 4KMUC 1JT8A 2B3GA 4G57A 3HOVH 1AE3A 4IURA 2NN6I 1J5EL 1WTVA 4PG3A 4J8QA 2WB1G 3T4AC 4IFDI 2L55A 3FDTA 2F0NA 1YNNC 3GTGB 3PO3H 3HFZB 2CWPA 3G4SA 4KKTA 4RWSC 3V96A 1MKHA 1KRSA 2F52A 3PUXA 3S1NH 1VQKA 1IXRA 1A2UA 2CFMA 2F0GA 1XYIA 1TWAH 1ASYA 3I4MH 2UXCQ 5C0XJ 1RDPD 2ZTDA 4DV5Q 2YTVA 3Q8DA 5CMDA 3J7A5 4YY3Q 1W3SA 1X32A 1WJJA 2PNHA 5M5XB 1PH3A 4UP8A 5K36H 4L63B 2RDGA 1XMOL 2I46A 1U4LA 2L12A 2D2CC 1EFWA 5A2QE 3J81E 3GO5A 4LAAA 2AWOA 1UE6A 2NZHA 1N34Q 1ZYRD 1VQEA 4RKLA 4TKOB 4GOPC 4CGYB 1Q3LA 3NELA 4IALA 2QGQA 2JA7G 3LX0A 2A74C 1TKWB 1STBA 1J8IA 4LWCA 1BBWA 5EPKA 3HOYG 4C3HH 1FNVA 4YWKA 1I4PA 4JOIC 4DNRB 4HIKA 4RMFA 3F8TA 3S1MH 1OXXK 2NN6G 4A3KB 4WJ4A 3C1EA 4IFDG 2WIIB 1VF5C 4JVZA 1VS0A 3NWTA 1YNJC 4X3UA 3TSSA 5FO8B 5FK9C 2CH4A 1NTGA 3NE5B 3ULPA 3K6OA 1N8RC 5IGEA 3PO2B 2VNUD 2PZTA 1A62A 2AWNA 4B3MQ 4ZK9B 1RL2A 1WTQA 1WTXA 5BR8Q 1YJNA 1K9MC 4CKBA 4JV5Q 2MJ8A 4PMWA 2O5IC 4JYAQ 3A8JE 1ML0D 1PYBA 5KEEA 4DR2L 5IGGA 5M3MH 1IBMQ 1TWCB 1XPOA 4JI6L 1FNUA 4JI1Q 4JI5Q 2UXBL 1LTRD 2KOLA 5EBDA 1GVPA 4A3IH 4ZYSA 4LFAQ 2BA1A 2XVSA 3AB9A 3S17H 2L9HA 2Z9HA 3STBD 4DV1L 4B3RL 2VXWA 1E2VA 2EYLA 1C7YA 3TDQA 4OO1I 5DEHA 5IWAL 4DV3Q 2R61A 2ZXRA 4BY7G 5J1ZA 1Y1VH 2B2TC 3CW2C 4IJHA 4JBWA 1JOKA 5BN5A 4CJ2C 4BWGB 2V4DA 3R93A 4NXML 3ITPA 3H15A 4FF1A 1WOCA 4TSSA 3TS2A 3OWFA 5E4WC 3PV0A 4ZUJA 4LNQA 3OMCA 2C5CA 1BKBA 2RDHA 1SDFA 4CDDC 1UE5A 4DR6Q 3HKSA 3UE1A 1U5KA 2CW0D 4ZAIA 3MHBA 1CHPD 3QOJA 4HSPA 3HOXB 5COYA 2JP1A 1KHIA 3ICEA 3D8GA 1RTOA 2PW5A 3OSOA 4DAVA 2N78A 3M4QA 4RGNA 4CKEA 2EE1A 3UDIA 3I70A 2ID0A 3A5ZB 5LMNQ 4LW1A 1RIPA 1SNQA 4EQNA 3ONAB 2B2VA 1B44D 4DK6C 2KCNA 3MWYW 2F0MA 1CT1D 4A3EH 1JQYD 1SJHD 4A93B 5JEAH 1BQQT 2F0KA 4HAEA 3EFXD 1FL0A 1Q8IA 3CKIB 1HFNA 4IPCA 1U4MA 1X55A 3BDLA 4HJAA 3FRPB 2NVTH 2L1BA 1RD9D 3D0FA 2VZAA 1CKNB 1JR0D 3FKIH 3R2IA 3CC2A 4R9WA 2OQ0A 3RZOH 1JCKB 1HNZL 4JG2A 1Y69U 3UE0A 1HCZA 1HH2P 1SJED 1VQLA 2M00A 4F7XA 1F2LA 3J7AF 2AQ2B 3S2HB 3ULLA 3G7LA 5D14A 1LTTD 1IL2A 4ZKCB 1BCPD 3D6WA 5CC4A 3HOWB 3BG3A 2BE5C 2Y0SE 3FP9A 4F8MA 2Q2HA 3JAME 5IGBA 1AH9A 4DV0L 4A3FG 4RKBA 1LT3D 5M5WH 4C3JB 1S4ZA 1B3AA 1Q82C 1T5EA 1ENCA 1YEZA 2A19A 2KHJA 3KFUA 1NMFA 3PMFA 4B3RQ 3M7GA 3ERSX 1PVOA 3HKZE 4M8AA 4GLAC 1QVFA 2XGTA 1Y1WB 3MFYA 2ZXPA 4OELB 4JI0Q 2D62A 1OXTA 1TY0A 5C3EH 5KYIA 1SN8A 3MZ5A 1Z47A 1VQGA 1D2BA 2Y0SB 2EYPA 2NUCA 4OO1H 2A73B 1JC7A 4A3BB 4B9WA 1ZYRC 3F2UA 2RCNA 2PPBC 2KUMA 1KNEA 5LHY1 1XNQQ 1O80A 1KXLA 3OHXC 2F4VQ 3KOJA 1DD2A 1PZKD 1RHPA 4PZ6A 3NUCA 3TP7A 5KNDA 1XXGA 3HKZB 4DKAC 3S1QB 2OQKA 4QMGA 2MO1A 2AUKA 1XJVA 4DF7A 2DNCA 2XRSD 4TVAB 3NHHA 1CKOA 2GA4B 3CRLC 1KC8C 1IHZA 3CAMA 2A5HA 1UE1A 4PZ7A 2VS1A 3KF8A 4V190 1JB3A 2K75A 1QVCA 2XRQD 2F3WA 3ZYYX 3NPPA 2HDMA 4LFBL 1H95A 4RGMA 2KHSA 3F1ZA 1B9MA 2K7VA 5JPNC 3CCMA 4CBVA 2UUAL 1U4RA 2K5DA 4BY1H 5CR3A 1GUSA 1K8AC 4A3KG 1XTDA 3FVQA 5I4DA 4X62Q 1LUZA 4MNOA 3VR5A 4DAPA 4N8X1 1PTOB 1TWGB 1QZHA 2B2WC 3A55A 3HP3A 1EY6A 1FR3A 5C44H 3HOVB 3K5NA 5KNBA 1EU4A 3PO2G 4IUNA 1RTNA 3SDZA 3VR2A 1S5BD 4Q5VA 1BF4A 3CQZB 3STBC 1VQ4A 4XQQA 1Q90A 2KQ3A 3MC0B 2ZT9C 4H0LC 2WFWA 2OTLA 2Z6KA 2KCMA 1Q86C 1EWHA 1OTCA 3URYA 2QEJC 4FVMA 3BYYB 4POFA 3I4MB 1C0AA 1SYFA 2R7FA 3VYUA 2IHEA 1TVXA 1XNRL 3FMCA 3G6JB 4NW2A 1NBWA 1VQHA 4DR3Q 1X6OA 1YNND 1STYA 2YYZA 3MXNB 1EQVA 1PA6A 4XT3B 5D65A 4QL5A 3ND8A 1STAA 5JJKA 3S1RB 1Q8KA 5EKKA 4B3TQ 2CW0C 1SEBD 3EVQA 1JJ2A 1M4VA 2E2IB 3TREA 5I9PA 4I65A 1GD7A 4WFN3 2HIXA 1R4PB 2FFKB 3E5SA 3MAQA 4YCVA 2NVYB 3CF5A 2K33A 2O2LD 4FXDA 4A3LG 4KHVA 3A7AB 4QUFA 4APVA 5IYCH 3HOXG 1PLFA 4RGOS 2XNAC 4M1UB 4KY7A 2JA8B 5J39A 4LF8Q 4EGVA 3M7NA 4P2CB 1H9SB 3RLNA 1HHVA 1E2ZA 1QCBD 1HZBA 2R7ZH 1EOVA 1YHAA 4HJ9A 1KDCA 2RVLA 1SYGA 2ATWA 3BYTB 3G48A 4P72A 1KD1C 4IN3A 4DUZL 2F0DA 2QDBA 2IJ0A 2Z1CA 4A93G 3K59A 4J15A 3SGIA 2CWAA 1YJWA 4JI8L 1YHQA 1SNPA 4KJNA 2HHHL 2UUAQ 3RLFA 3DHQA 2R92H 4QF4A 1K0RA 4IQZA 1Y14B 1JE5A 3I56A 1EZ6A 3GTMH 2ZM6L 4BA1I 3GTQH 3NQIA 1DZ1A 2PW7A 3OOCA 1YNXA 2F0PA 1TS5A 4A3CH 2EY2A 1K83B 3UDXA 2NVQH 1I6HB 5JOBA 4DR4L 1HJPA 4BBRH 1O7ZA 2A1AA 4R4IA 1F2MA 3E9IA 2DY7A 2F0IA 2B39A 3KLRA 5C0XI 4A3IB 3OWEB 3HOWG 1CSPA 1I50B 1YNJD 3TRZA 4AIMA 4Z9CB 2K5HA 1F9QA 2OXPA 1VQDA 3K57A 2RA4A 4JBJA 1CI3M 1VQJA 4DAMA 4GN4B 2LS01 4C3JG 4JI2Q 2KEEA 3X3MA 2JK8A 1TS4A 3DUZA 2N49A 2CQOA 1AFPA 1W2BA 1PH6A 3QJYA 2EYOA 2IX1A 2MQHA 4OHJA 1I3QB 2UXCL 1Y1WG 3VA7A 4DV5L 4DUYQ 1YJ9A 2A6HD 1V1OA 1TWFB 1T5XD 3D4DA 3R2TA 4HMIA 2Y0SG 1UAPA 4YY3L 4A3BG 1G8ZD 2J4XA 4LUVA 1GUTA 4K0KQ 1TWHB 3G6EA 4IUQA 2EIFA 3BZCA 3BZDB 1LTGD 1MJEA 3GQBA 4DXGA 5AJ3Q 3E3XA 3DWPA 1P8LA 1JE4A 5GAEC 2E75C 5T1IA 1E22A 3SXHA 3DM1A 3HKZG 5IT9L 4KHZA 3UI2A 2QCPX 4QJFA 2UU9Q 3GTJB 3HG9A 5I2YA 1VQOA 1EUJA 1N34L 2UXDQ 3AEVA 2NB0A 3KJPA 4FF3A 1PZID 1SYBA 2LXKA 3OW7A 3CPFA 4DV4Q 3C1FA 3DXJC 1DOLA 2HQEA 1J6QA 2LSSA 1NMGA 5FLXL 2JE6I 5ELFA 3A54A 3T51B 4S3SA 1D1IA 2K50A 3PIOA 2E2HB 1ET9A 1LACA 1MSGA 3A56A 4IUUA 1KLUD 5IYBG 4X3TA 3I4NB 3CCJA 1HQRD 2EOTA 3TEHB 2JA6B 2K28A 3RZOB 2ZJPA 2OWOA 1EIFA 2JEAI 1CKNA 4C3IH 2JXMB 2KECA 1SYDA 5IT9c 4L5RC 5J22A 4IUTA 2YU9B 3FPUB 3N6RA 2AHOB 2HDLA 1L1OC 3QR8A 1PH1A 4BA2I 1N32Q 1VQBA 2B2UC 3H0GB 4B3ML 2KCTA 3ER0A 1EQRA 1HTPA 3I7FA 5M5YB 3D3RA 5BR8L 1MBYA 3P7JA 5BN4A 3SK8A 3Q22A 3S16H 4JYAL 2D9UA 3GTKB 1HNXQ 1IBML 1LTSD 3OTOQ 3CCVA 1S40A 2RCFA 4JI5L 4HSVA 4JI1L 5C0XH 3CHBD 4IOAA 4GNXB 1F2ZA 1BVSA 2CVRA 4DK0A 2L5TA 3VA5A 4UPAA 4LF6Q 1Q1BA 4FF2A 4H44C 4LFAL 1P16A 1K0SA 4A3MH 4A3JH 2Q2TA 5F2DA 5LMUL 2XSCA 4NP5A 1QZGA 4R8NA 1QVGA 1VQMA 4DN4M 1JOQA 1H9MA 1MIUA 4R4CA 3HOUH 3TP5A 1CKMA 3CC7A 4DV3L 1PH2A 4A3DH 2PQAA 4DR5L 2BE5D 3RD4A 2F1MA 5D3DA 3PUZA 1OXSC 3RN5A 5HGTA 1NR2A 3W1BA 1LT6D 4GN5A 4B9XA 3CCEA 3EIVA 4X66Q 4QY7A 1PH8A 3LGJA 3OYYA 1G2SA 1SNCA 4X64Q 2K6AA 2DJFC 1STNA 5IP9G 2F03A 3PF4A 2EJFC 1YBYA 1N36Q 1RKNA 1GJXA 5ELNA 2PI2E 5FJ8G 1DOMA 1SE4A 3M4OB 1OO9B 1CSQA 4DR6L 1HZ9A 1WTRA 1SNDA 1ZKOA 2Q8IB 2H4OA 2HD3A 1KIXA 1LYLA 1Q1EA 2JA5B 5D3IB 2FHTA 3PGZA 3M4PA 1IYUA 3VR4A 2JA8G 3WWVA 1O7YA 3E0JA 3J80i 2IX3A 1V1QA 1IW7D 1SMYC 2WV6D 1K3BC 5LMNL 4RAUC 3GTLH 5C3WA 1SFOH 3GV3A 1R9TB 3MXPA 3SR1A 1PHJA 3H91A 1WI5A 3QWNA 3SE0A 2E2JB 4FXKC 3T56B 1Y8NB 3J81j 3OMGA 2N88A 1H9KA 4O2DA 1I4XA 3A74A 2C9OA 5ELEA 1HRJA 2WKDA 2JA7H 3KBGA 1B2TA 3R8BA 1HA5A 5DM73 2AQ3B 4GN3B 3B6YA 1SYCA 2GVAA 3F2BA 5BN3A 3HOYH 2K52A 1E24A 1IBLQ 1PRTB 1PFBA 4QB4A 4DPGA 1X9NA 3K7AH 3T13A 2A6HC 4BXXG 1S5CD 1ENFA 4ODGA 2NN6H 4RFBA 3T1YQ 2EQSA 1ICWA 1F9RA 4GKJQ 4IFDH 1IYVA 3VR3A 3FPPA 5LMUQ 4DK3C 4DV6Q 1KNAA 1KRTA 3GTOB 1X3PA 2VUMG 3KLSA 3U9SA 2OCEA 4JI0L 3MXNA 1F9PA 4NPSA 1WD0A 1VQ8A 1V9PA 4DR5Q 1WFQA 4KHPQ 1DM0B 5EKIA 4ME5A 2VQFQ 1JORA 2AQ1B 3MVVA 1A63A 3MA2B 5M3FB 1PFSA 2M2LA 4HMJA 1XNQL 4JBKA 2F4VL 1DGSA 3PIP3 4GKKQ 4KI0A 4HIOA 1QUQB 2SEBD 4C1NK 2EY1A 1B7YB 5GQOA 2VB3X 2LXJA 1Y8PB 3NBIA 2B63B 2F0SA 1PH7A 2Q2UA 1UEAB 1EEID 3C46A 1UEBA 3S15B 3LNNA 1WYDA 1KAAA 1GM5A 2BH2A 1CA5A 4BY7H 1PH9A 1NAPA 1H9SA 1KABA 4YWMA 1HZCA 4KKUA 5IODA 3RZDB 2F0FA 1NR4A 3D6CA 2N55A 1ZXTA 1Q7YC 4C2MB 2ZTEA 1KAWA 5CV8A 4Q0FA 1SNMA 2R93B 2KEDA 1B53A 4GOPB 2O5JC 3I4NG 5C4XB 1ASZA 3BVZA 1B3QA 2JA6G 4OIKA 4X62L 4HCSA 4ZCKA 4FF4A 2XWBB 1VQ7A 4MIUA 1WTPA 4J6HA
chains in the Genus database with same CATH topology
1J9OA 3PIO3 1AEXA 1HXYD 3R3OA 3N52A 5JVG3 4DNTB 4A3GB 5C5MA 1C4QA 3HOZB 1IL8A 2MP1A 5CV9A 4L6TB 1I4QA 4RH6A 4BBSB 3I72A 2TSSA 2IX0A 5JEAJ 1TS2A 1CA6A 2SNSA 1AW7A 1EIHA 1SSOA 2ENBA 2F0EA 3ERQA 4FO2A 3RUZA 4H7BA 4OL7A 5EBCA 5K5PA 1C8CA 1G291 4K5VA 1JICA 3CU7A 3AMUA 4E6IA 1I6VC 4DFAA 2G9DA 2RDFA 3BDOA 3I73A 1HFGA 1LTBD 1PZJD 4ABNA 3L7ZC 1IW7C 1LO5D 2K5QA 5C6AA 1BXTA 2LY7A 2K04A 1KLGD 2EYMA 1EY5A 2KVMA 1WCMB 2LMCB 1G91A 4XYQA 4PQXA 1BDOA 3S2DB 4KN7C 4C1NI 1ET6A 2F0VA 1QG7A 1QILA 1PFNA 2B2VC 2K03A 1H9RA 3NSWA 2BDOA 1EYAA 2EYFA 4FXGC 4B08A 1A2TA 1QNUA 1F77A 2H1EA 2WAQB 5EGTA 3E6ZX 2F0OA 2OEOA 4UAIA 1CM9A 4HTHA 4RHRA 2A6ED 3SHLA 1SAPA 5A2QL 3PO3B 3J81L 1O78A 1BNZA 1SE2A 3J7AV 4I7ZC 4LMQD 4LK1C 2EYHA 2JYOA 3X3NA 3S1NB 4MHEA 3HGBA 1F2YA 1HUNA 1EQTA 4WJWA 1LABA 1TWAB 3EJIA 3KBXA 3GP7A 1UNSA 2F0UA 5CV4A 1SE3A 5KGUA 3OPOA 4NDXA 1WVLA 1WD1A 4HN7A 4RGTA 3WOEA 3NTHA 1WTWA 5FO7B 1LT4D 1A3TA 2QILA 2E74C 1BBXC 4PMBA 4C56C 1PXUA 5EQ0A 2L11A 3A8KE 4XTCS 2WP8J 1AZPA 2FJ2A 4F88A 2NBFA 1EY7A 2IT1A 2TMPA 2PQEA 1HA6A 4HCEA 3A8IE 3BS1A 3Q0AA 1KDBA 4C3HB 2O4XA 2B2YA 1QJOA 1B4OA 5CBAE 3S1MB 1A15A 2KCCA 3V2TA 4PV1C 5I9OA 1EIGA 1RCVD 1SMYD 1PRTF 2SNMA 1CTMA 1U4PA 1A3UA 5JAVA 5FOBB 3ND9A 3AU7A 4G7ZC 5CV5A 2RKSA 2K01A 1O7LA 5M3MB 1U9RA 4TRDA 1TY2A 1I4HA 3DWAA 1QE6A 1XX8A 1TQOA 5DNFA 4RA8A 3S17B 1NCVA 1QNKA 1JWSD 2L0CA 2Q8RE 4K6DA 3NWSA 1JOOA 2X6GA 2RSOA 1Y1VB 2MPMA 5LL6X 1EY9A 2LKVA 4XXEA 1STHA 3QB3A 3KK7A 3WOFA 4N9TA 1XTCD 4G4KA 1SBBB 1DONA 1TS3A 3GV6A 1QOHA 5I6WA 5FKAC 4KTAA 3DEOA 4FP5D 4X3SA 1LLRD 5IOCA 3I3CA 3PUYA 1AP0A 3JAML 2BOSA 1F9SA 4K6LA 4A3EB 4QCLA 2PYKA 1TU2B 3D31A 3W2DA 4J1MA 2NVTB 1EWCA 3FKIB 4RCOA 2A6EC 1V43A 3MEHA 1TR5A 5ELDA 4MN3A 2IPKD 2HCCA 1EY8A 5E1FA 3H09A 3OIPA 1A6XA 2CQAA 3BVMA 1D5XC 2B8FA 3D4RA 1DOKA 1JWUD 2XIWA 1HPCA 4F87A 3SEBA 5CBEE 4KD4A 3NXWA 1B50A 1PRTC 1PTOD 2MGSA 3O13A 1LT5D 1GXDC 5M5WB 1BCPB 1GUNA 1GHKA 1EL0A 3QOLA 3TZDA 3NBHA 2R3ZA 4IUVA 4HR7B 1V1PB 2KA7A 5KNCA 1PTOH 3KLSX 5C3EB 2EZVA 4K14A 5ISRA 5EPJA 4QUCA 5K36G 2PO4A 1D1KA 1XWEA 3QO2A 1FNWA 5E3FA 4ZUIA 2F0JA 1GOZA 1HUMA 4A3FB 4IUPA 1EOTA 4L8JA 2K05A 3NP8A 3K5LA 1VMCA 4XQJA 1OXUA 1ILPA 2ZXOA 2B2TA 4NMZA 1R4QB 1UUPA 2A68C 2BCOA 2F0QA 5KYLA 5CGKA 2Z4IA 3I8ZA 1EZ8A 4C3HG 3P20A 1EYCA 2B8GA 2QKIC 5CV7A 1PTOF 4WRDA 1V8QA 4BY1B 4EQOA 4UDUC 1CHQD 3DMUA 4NKLA 2J7ZA 2EPBA 2VB2X 4U68A 2X69A 2NTTA 4RCNA 5C44B 2RSNA 4OGQC 1BOSA 1E2WA 3VYRA 1VDZA 1EU3A 3GD7A 2NTSA 1MI2A 3WDNA 1HTLD 3LWEA 2NWGA 2EVBA 2EY5A 4CHTB 3HRZC 4KN4C 3K58A 1STEA 3H3VC 1BUVT 2AUJD 3IL8A 2F0TA 3SVMA 2ICEC 3EA6A 2DN8A 2A69C 5IGDA 5ELCA 3IAYA 1Y8OB 1K8MA 1IKMA 4OIJA 1LTID 5HURA 3J80L 2OT2A 1IKLA 3QG1A 4G7HC 2K1BA 3Q24A 2EY6A 1W6KA 4KJOA 3K0YA 2PNRC 3L3OC 1KDAA 4IFDJ 2R6GA 3SK6A 3M3YB 1M8AA 5A35A 1S5FD 2R7ZB 1EYDA 1G2TA 4EQPA 3P75A 3H6MA 2F0LA 2IL8A 5JEAG 2MUYA 1FGBD 3HEJA 1Z6HA 4KY5A 5KRUA 2RQXA 2R92B 1EY0A 1FD7D 1PMRA 2EJMA 4K5XA 4XQNA 3GTMB 3SK5A 1RODA 1S5ED 3GTQB 3TZUA 4EVOA 2EDGA 4ZKBB 3Q23A 1C48A 3P1HA 3W3AA 5EKLA 4QIWB 4DAYA 1AN8A 4GZYC 2NVQB 3TN2A 2KJXA 5JJZA 3QIAA 1PTOC 4BBRB 3I91A 4CJ1B 2F0HA 1B1ZA 2CHBD 1TIID 2ICIA 3PUVA 4ZLTF 2FMCA 1SYEA 4K2LA 5I6YA 3K5OA 4V0BA 2B2WA 3A7LA 2I07B 4AYBB 1D5MC 5IT9E 1QB5D 1CFMA 4IZ8A 4XIGS 4OO1G 1RJTA 1MGSA 1KTKA 1GUGA 5JVH3 3C3LA 4KV6A 4KD3A 3V05A 2HUGA 2QF7A 1G6ZA 3I4LA 3RMHA 2EXZA 5FLXE 2WACA 4FYDA 3MXGA 1L0XB 3NK9A 4PMCA 4R8IA 5EPLA 4BS9A 2BDNA 3DEPA 4KKSA 5AFWA 4K8JA 3U9OA 3OIQA 1II3A 1ONLA 5TSSA 3NTKA 1S5DD 1OXVA 5C3XA 5JPMC 2IW3A 2F0WA 1ENAA 4DA2A 3MXUA 5T1GA 2HCIA 4ID6A 1CZWA 5CYUA 3T53B 1Z7TA 4C3IB 5IGFA 1EFID 3TBIB 1Q12A 1LV9A 4K5WA 1RF2D 1VF7A 2BA0A 1BCPF 2NZ1D 5C4HA 2L4NA 1FYCA 3S16B 4XYOA 4ILWA 1QWYA 3PUWA 3M85A 4G7OC 5E4XA 4X3KA 4A3MB 3IFDA 4A3JB 4PNYA 2MHVA 4XT1B 2FINB 1V1PA 3HOUB 1E0BA 3Q6SA 4A3DB 5C4ZA 2WINB 1PRTD 3CRKC 2EYJA 1GUOA 1HQMC 2WB1B 3KUPA 2E76C 1VMPA 2WKCA 3FEWX 3D4WA 2M9VA 3EQLC 2Z4HA 3IFTA 1EY4A 2NVXB 2F3VA 1MSHA 1H9JA 3S14B 3TMEA 1STGA 4DU9A 4DGZA 3NQTA 2E2DC 5I2XA 2Z8LA 3GTLB 1SFOB 2XWJB 3SK4A 2XN9C 4KY6A 2Q8TA 3C2PA 2A68D 2OF1A 1I4RA 3BVGA 3HZXA 3VYSA 5G3LD 1PFMA 4K8IA 3VR6A 1D6EC 1W6JA 1K8OA 5C5LA 4WORA 1DXMA 2PCFB 1CQVA 2JA7B 4LJZC 2EJGC 3HS0C 3VYTA 2SOBA 5LL6S 4TQUS 3HOYB 2FMMA 1TT2A 5IGCA 3EROA 3BDCA 1CQFA 3K7AB 2K5WA 3J80E 1DCZA 2IWHA 1MD2D 4JK1C 3IKJA 5EJWA 1BCPC 2B2UA 1BR9A 3I90A 4FNFA 3H94A 3L9AX 1B9NA 2RBMA 4U673 1DYQA 2F4IA 1AZQA 1ILQA 2JEBI 5M9OA 1DJRD 1SXTA 1D5ZC 2G9HD 5CORA 3DWQA 5G3LF 1SNOA 4RHSA 4DK1A 1ESFA 1CZGA 3T16A 2K32A 2A69D 1CK1A 1PYWD 1ESRA 1LTAD 1NUCA 2VUMB 4KK7A 5ELBA 4O42A 1VCIA 4CJ0B 4BY7B 4H13C 4ULLA 4ZQ3A 3NTIA 1PDQA 3LWUA 2PMZB 2J0TD 3K5MA 2B2YC 4XDXA 2JSOA 4CKCA 5KIXA 2D5DA 3MFGA 4C3IG 1ZEQX 4O1NA 1I4GA 1NSNS 5IIFA 4Y7NB 4DXFA 2X6LA 2NYZD 2PZUA 5DAUA 1GHJA 3TP6A 1JWMD 1X3QA 3M4YA 1WTOA 1A3VA 1L0YB 3MTSA 3GTPB 1BO0A 2DY8A 4YIJA 5NUCA 4N9PA 5C0XG 3TP8A 4HEDA 5FO9B 5DM63 1EEFD 4K2KA 3J7YW 4ZRZA 2SDFA 1GUWA 3S9WA 2LFNA 5CV6A 5C4JB 2PZWA 2DNEA 4KMUC 4G57A 4IURA 2NN6I 1WTVA 4J8QA 4IFDI 3T4AC 2L55A 3FDTA 2F0NA 1YNNC 3GTGB 4KKTA 4RWSC 3V96A 3PUXA 1A2UA 2F0GA 1XYIA 5C0XJ 1RDPD 5CMDA 1X32A 5M5XB 5K36H 4L63B 2RDGA 2I46A 1U4LA 2L12A 2D2CC 5A2QE 3J81E 3GO5A 4LAAA 2AWOA 1ZYRD 4RKLA 4TKOB 4CGYB 1Q3LA 4IALA 3LX0A 2A74C 1TKWB 1STBA 1J8IA 5EPKA 1FNVA 1I4PA 4DNRB 1OXXK 2NN6G 4A3KB 3C1EA 4IFDG 2WIIB 1VF5C 3NWTA 1YNJC 4X3UA 3TSSA 5FO8B 5FK9C 3NE5B 3K6OA 5IGEA 3PO2B 2VNUD 2PZTA 2AWNA 4ZK9B 1WTQA 1WTXA 4CKBA 2MJ8A 4PMWA 2O5IC 3A8JE 1ML0D 5KEEA 5IGGA 1TWCB 1FNUA 1LTRD 2KOLA 5EBDA 2BA1A 2XVSA 3AB9A 2L9HA 2VXWA 1E2VA 2EYLA 3TDQA 4OO1I 5DEHA 2R61A 2ZXRA 5J1ZA 2B2TC 4JBWA 1JOKA 5BN5A 4CJ2C 4BWGB 2V4DA 3R93A 3ITPA 4FF1A 4TSSA 3OWFA 5E4WC 3PV0A 4ZUJA 3OMCA 2C5CA 2RDHA 1SDFA 2CW0D 4ZAIA 3MHBA 1CHPD 3QOJA 4HSPA 3HOXB 5COYA 2JP1A 3D8GA 1RTOA 2PW5A 3OSOA 4DAVA 4RGNA 4CKEA 2EE1A 3I70A 2ID0A 1SNQA 4EQNA 3ONAB 2B2VA 1B44D 2KCNA 3MWYW 2F0MA 1CT1D 1JQYD 1SJHD 4A93B 5JEAH 1BQQT 2F0KA 4HAEA 3EFXD 1Q8IA 3CKIB 1HFNA 1U4MA 3BDLA 3FRPB 2L1BA 1RD9D 1JR0D 3R2IA 4R9WA 1JCKB 1Y69U 1HCZA 1SJED 2M00A 4F7XA 1F2LA 3J7AF 2AQ2B 3S2HB 3G7LA 5D14A 1LTTD 4ZKCB 1BCPD 3D6WA 5CC4A 3HOWB 3BG3A 2BE5C 4F8MA 3JAME 5IGBA 4RKBA 1LT3D 4C3JB 1S4ZA 1B3AA 1T5EA 1ENCA 3PMFA 3M7GA 4M8AA 1Y1WB 3MFYA 2ZXPA 2D62A 1OXTA 1TY0A 5KYIA 3MZ5A 1Z47A 1D2BA 2Y0SB 2EYPA 2NUCA 4OO1H 2A73B 1JC7A 4A3BB 4B9WA 1ZYRC 3F2UA 2PPBC 2KUMA 1KNEA 5LHY1 1O80A 3OHXC 1DD2A 1PZKD 1RHPA 3NUCA 3TP7A 5KNDA 1XXGA 3HKZB 3S1QB 4QMGA 2AUKA 4DF7A 2DNCA 2XRSD 3NHHA 2GA4B 3CRLC 1IHZA 2A5HA 3KF8A 4V190 1JB3A 2XRQD 2F3WA 3ZYYX 3NPPA 2HDMA 4RGMA 2KHSA 1B9MA 2K7VA 5JPNC 4CBVA 1U4RA 2K5DA 5CR3A 1GUSA 3FVQA 5I4DA 3VR5A 4DAPA 1PTOB 1TWGB 2B2WC 3A55A 3HP3A 1EY6A 1FR3A 3HOVB 3K5NA 5KNBA 1EU4A 4IUNA 1RTNA 3SDZA 3VR2A 1S5BD 4Q5VA 1BF4A 3CQZB 4XQQA 1Q90A 2KQ3A 3MC0B 2ZT9C 4H0LC 1EWHA 3URYA 2QEJC 4FVMA 3BYYB 3I4MB 1SYFA 3VYUA 1TVXA 3FMCA 3G6JB 4NW2A 1YNND 1STYA 2YYZA 1EQVA 4XT3B 5D65A 3ND8A 1STAA 3S1RB 5EKKA 2CW0C 1SEBD 3EVQA 1M4VA 2E2IB 5I9PA 4I65A 4WFN3 1R4PB 2FFKB 3E5SA 3MAQA 2NVYB 2K33A 2O2LD 4FXDA 4KHVA 3A7AB 4QUFA 1PLFA 4RGOS 2XNAC 4M1UB 4KY7A 2JA8B 5J39A 4EGVA 3M7NA 4P2CB 1H9SB 1HHVA 1E2ZA 1QCBD 1KDCA 2RVLA 1SYGA 3BYTB 4IN3A 2F0DA 2QDBA 2IJ0A 2Z1CA 3K59A 1SNPA 4KJNA 3RLFA 3DHQA 4QF4A 4IQZA 1EZ6A 4BA1I 3NQIA 1DZ1A 2PW7A 3OOCA 2F0PA 1TS5A 2EY2A 1K83B 1I6HB 5JOBA 1O7ZA 4J6HA 1F2MA 2DY7A 2F0IA 2B39A 3KLRA 5C0XI 4A3IB 3OWEB 1I50B 1YNJD 4Z9CB 1F9QA 2OXPA 3K57A 2RA4A 1CI3M 2LS01 4C3JG 2KEEA 3X3MA 1TS4A 3DUZA 1AFPA 3QJYA 2EYOA 2IX1A 4OHJA 1I3QB 3VA7A 2A6HD 1V1OA 1TWFB 1T5XD 3D4DA 3R2TA 4HMIA 1UAPA 1G8ZD 2J4XA 1GUTA 1TWHB 4IUQA 3BZDB 1LTGD 3GQBA 4DXGA 3DWPA 1JE4A 2E75C 5T1IA 3SXHA 3DM1A 5IT9L 4KHZA 3UI2A 2QCPX 3GTJB 3HG9A 5I2YA 2NB0A 4FF3A 1PZID 1SYBA 3OW7A 3C1FA 3DXJC 1DOLA 2HQEA 5FLXL 2JE6I 5ELFA 3A54A 3T51B 4S3SA 1D1IA 2E2HB 1ET9A 1LACA 1MSGA 3A56A 4IUUA 1KLUD 4X3TA 3I4NB 1HQRD 2EOTA 2JA6B 2K28A 3RZOB 2JEAI 2JXMB 2KECA 1SYDA 5J22A 4IUTA 2YU9B 3FPUB 3N6RA 2HDLA 4BA2I 2B2UC 3H0GB 1HTPA 5M5YB 3D3RA 1MBYA 3P7JA 5BN4A 3SK8A 3Q22A 2D9UA 3GTKB 1LTSD 4HSVA 5C0XH 3CHBD 1F2ZA 2CVRA 4DK0A 2L5TA 3VA5A 1Q1BA 4FF2A 4H44C 5F2DA 2XSCA 4NP5A 4R8NA 4DN4M 1JOQA 1H9MA 3TP5A 2BE5D 3RD4A 2F1MA 5D3DA 3PUZA 1OXSC 5HGTA 1NR2A 1LT6D 4B9XA 1G2SA 1SNCA 2F03A 2K6AA 1STNA 2EJFC 1RKNA 1GJXA 1DOMA 1SE4A 3M4OB 1OO9B 1WTRA 1SNDA 1ZKOA 2Q8IB 2H4OA 1Q1EA 2JA5B 5D3IB 2FHTA 3VR4A 1IYUA 1O7YA 3E0JA 2IX3A 1IW7D 1SMYC 2WV6D 4RAUC 5C3WA 3GV3A 1R9TB 3MXPA 3SR1A 3H91A 3QWNA 3SE0A 2E2JB 4FXKC 3T56B 1Y8NB 3OMGA 2N88A 1H9KA 1I4XA 2C9OA 5ELEA 1HRJA 2WKDA 3KBGA 1B2TA 3R8BA 1HA5A 5DM73 2AQ3B 1SYCA 5BN3A 1PRTB 1PFBA 4QB4A 3T13A 2A6HC 1S5CD 1ENFA 4ODGA 2NN6H 4RFBA 1ICWA 1F9RA 4IFDH 1IYVA 3VR3A 3FPPA 1KNAA 3GTOB 1X3PA 3KLSA 3U9SA 3MXNA 1F9PA 1WD0A 1DM0B 5EKIA 4ME5A 1JORA 2AQ1B 3MVVA 3MA2B 5M3FB 2M2LA 4HMJA 3PIP3 4KI0A 2SEBD 4C1NK 2EY1A 2VB3X 1Y8PB 3NBIA 2B63B 2F0SA 1UEAB 1EEID 3C46A 3S15B 3LNNA 1KAAA 1CA5A 1NAPA 1H9SA 1KABA 4KKUA 5IODA 3RZDB 2F0FA 1NR4A 3D6CA 2N55A 1ZXTA 4C2MB 5CV8A 4Q0FA 1SNMA 2R93B 2KEDA 1B53A 2O5JC 5C4XB 3BVZA 4OIKA 4HCSA 4FF4A 2XWBB 4MIUA 1WTPA 4ZYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9O A;  2DY7 A;  4O42 A;  2IL8 A;  2L9H A;  1B2T A;  1XYI A;  3P7J A;  4CJ0 B;  2VXW A;  1EIG A;  2H1E A;  3N52 A;  1S4Z A;  1B3A A;  1F9Q A;  2D9U A;  2RA4 A;  1U4P A;  5CMD A;  1IL8 A;  2Q8T A;  2J7Z A;  2EPB A;  2MP1 A;  1CM9 A;  1TVX A;  4HSV A;  1X32 A;  2HCI A;  2B2T C;  4UAI A;  4U68 A;  1PFB A;  5T1G A;  2CVR A;  2X69 A;  1ROD A;  2KEE A;  4MN3 A;  4ZKB B;  1PDQ A;  2HCC A;  2RSN A;  4NW2 A;  1AP0 A;  1SAP A;  2B2Y C;  2K01 A;  4CJ2 C;  1BNZ A;  4XDX A;  1U4L A;  1PFM A;  1ICW A;  3R93 A;  4XT3 B;  1F9R A;  5D65 A;  4LMQ D;  3TN2 A;  4DN4 M;  2L12 A;  3F2U A;  5JJZ A;  2KUM A;  1DOK A;  1KNE A;  2XIW A;  2JYO A;  1QE6 A;  1LV9 A;  1O80 A;  1CA6 A;  5E4W C;  1KNA A;  1XX8 A;  3I91 A;  4CJ1 B;  1MI2 A;  1EIH A;  1SSO A;  1RHP A;  4MHE A;  1X3P A;  5DNF A;  5CBE E;  1HUN A;  4RA8 A;  1EQT A;  1SDF A;  2NZ1 D;  1B50 A;  1NCV A;  1QNK A;  2L4N A;  2MGS A;  2X6L A;  3KBX A;  2NYZ D;  1F9P A;  3LWE A;  2Q8R E;  1WD0 A;  4IUQ A;  4ZLT F;  1Q3L A;  1NR2 A;  2NWG A;  2X6G A;  1EL0 A;  5EKI A;  2FFK B;  2FMM A;  1X3Q A;  1JE4 A;  4ZAI A;  3TZD A;  2RSO A;  5COY A;  2JP1 A;  5T1I A;  1G2S A;  2R3Z A;  4IUV A;  1WVL A;  3DM1 A;  1RTO A;  1WTO A;  3UI2 A;  2B2W A;  1J8I A;  3MTS A;  2M2L A;  1BO0 A;  3IL8 A;  2MPM A;  2EE1 A;  5E4X A;  4QUF A;  5EPK A;  1WTW A;  1C8C A;  2DY8 A;  4X3K A;  1DOM A;  3SVM A;  1JIC A;  1PLF A;  5EPJ A;  3IFD A;  4QUC A;  4XT1 B;  2FIN B;  4HED A;  3ONA B;  1WTR A;  2B2V A;  1BBX C;  1HFG A;  5EJW A;  1HHV A;  3MWY W;  1E0B A;  5EQ0 A;  1RJT A;  2B2U A;  2HDM A;  2RVL A;  1MGS A;  3Q6S A;  3QO2 A;  3I90 A;  1DOL A;  4HAE A;  2FHT A;  2L11 A;  1O7Y A;  1HUM A;  1IKM A;  4OIJ A;  2K04 A;  4IUP A;  1EOT A;  2HUG A;  1AZP A;  1HFN A;  2FJ2 A;  1CA5 A;  1U4R A;  1U4M A;  1AZQ A;  2SDF A;  2K05 A;  1WD1 A;  1G6Z A;  2KVM A;  2L1B A;  4X3U A;  1IKL A;  1GUW A;  1VMC A;  1DON A;  1NAP A;  3GV6 A;  1G91 A;  4RAU C;  4R9W A;  1ILQ A;  2K1B A;  3GV3 A;  3KUP A;  3DEO A;  1ILP A;  1MSG A;  1NR4 A;  2B2T A;  4IUU A;  1HA6 A;  4X3T A;  2B2W C;  1VMP A;  4IUR A;  2EOT A;  2N55 A;  5COR A;  1ZXT A;  4ZK9 B;  4X3S A;  1WTQ A;  3HP3 A;  1WTX A;  1WTV A;  2K28 A;  3H91 A;  4R8I A;  1DZ1 A;  2MJ8 A;  2B2Y A;  5EPL A;  1B4O A;  1QG7 A;  2KED A;  3FDT A;  2BDN A;  2KEC A;  1B53 A;  3DEP A;  5AFW A;  5CBA E;  1ML0 D;  1F2L A;  3I3C A;  1RTN A;  1M8A A;  3I8Z A;  1PFN A;  2B2V C;  2N88 A;  4OIK A;  1A15 A;  2K03 A;  3G7L A;  4IUT A;  1BF4 A;  1F9S A;  3FPU B;  4RWS C;  5D14 A;  1G2T A;  4ZKC B;  4HCS A;  1MSH A;  2HDL A;  1ESR A;  3D6W A;  2KOL A;  1O7Z A;  2B2U C;  1HRJ A;  1WTP A; 
#chains in the Genus database with same CATH topology
 1J9O A;  3PIO 3;  1AEX A;  2I5L X;  1HXY D;  3R3O A;  3N52 A;  5JVG 3;  4DNT B;  3H0G G;  4A3G B;  5C5M A;  2RHQ B;  1C4Q A;  3HOZ B;  1IL8 A;  2MP1 A;  4ALP A;  4CDC C;  1IYJ B;  5EAY A;  5CV9 A;  3GTP H;  4HID A;  4L6T B;  1I4Q A;  4RH6 A;  4X65 Q;  4BBS B;  3I72 A;  2TSS A;  2CH4 W;  4YCW A;  3MEF A;  2IX0 A;  4IO9 A;  5JEA J;  1TS2 A;  3NBH B;  1CA6 A;  2SNS A;  1AW7 A;  1EIH A;  1SSO A;  3U4V A;  4L5S A;  4QQB X;  3L0O A;  2ENB A;  2F0E A;  3ERQ A;  4DR3 L;  4FO2 A;  3RUZ A;  1JMC A;  4H7B A;  4R1J A;  4OL7 A;  2PQA B;  3J81 i;  5EBC A;  5GAH C;  5C4J H;  4P75 A;  5K5P A;  1C8C A;  1G29 1;  1HR0 Q;  4K5V A;  4B3T L;  1JIC A;  3CU7 A;  3AMU A;  4E6I A;  3GTG H;  1I6V C;  4DFA A;  2G9D A;  2RDF A;  3BDO A;  3I73 A;  1HFG A;  1LTB D;  1PZJ D;  1ICF B;  3L7Z C;  4ABN A;  3RNU A;  4A3F H;  1IW7 C;  3BU2 A;  1LO5 D;  2K5Q A;  5C6A A;  1BXT A;  3K0X A;  2LY7 A;  2K04 A;  1KLG D;  2EYM A;  1EY5 A;  4CDE C;  2KVM A;  2JA5 G;  1WCM B;  2LMC B;  1G91 A;  4XYQ A;  4LF8 L;  4PQX A;  1HZA A;  2K5N A;  2CKZ B;  1BDO A;  4DR1 Q;  4CDF C;  3S2D B;  4KN7 C;  4C1N I;  2AMC B;  1SE8 A;  2WAQ E;  1ET6 A;  2F0V A;  1QG7 A;  1QIL A;  1PFN A;  2B2V C;  1PH4 A;  1C9O A;  2K03 A;  1XPR A;  1H9R A;  3NSW A;  1M90 C;  2BDO A;  1EYA A;  1N33 Q;  2EYF A;  4FXG C;  4MTK A;  4B08 A;  1KQS A;  4LF4 L;  1JB7 A;  1A2T A;  1S3O A;  1QNU A;  1F77 A;  2H1E A;  2WAQ B;  5EGT A;  3E6Z X;  2F0O A;  2OTJ A;  2OEO A;  4UAI A;  1CM9 A;  4HTH A;  4LUZ A;  4OON A;  4RHR A;  2A6E D;  1KL9 A;  3SHL A;  1SAP A;  5A2Q L;  3PO3 B;  3J81 L;  1O78 A;  1X54 A;  1BNZ A;  1SE2 A;  1L2F A;  2C35 B;  3J7A V;  4I7Z C;  4LMQ D;  1Q46 A;  4LK1 C;  2EYH A;  2JYO A;  3U50 C;  4GNX A;  3X3N A;  3S1N B;  1FVI A;  4MHE A;  4A3K H;  3HGB A;  1F2Y A;  2I5H A;  2VL6 A;  1HUN A;  1A8V A;  1EQT A;  4WJW A;  4JI2 L;  1LAB A;  1I5F A;  1TWA B;  5IYD G;  3EJI A;  3KBX A;  4X6A H;  3GP7 A;  1UNS A;  2F0U A;  4YHH Q;  5CV4 A;  1SE3 A;  2RF4 A;  5KGU A;  1YIT A;  3OPO A;  4NDX A;  1WVL A;  1WD1 A;  1FJG Q;  2QEX A;  4DUY L;  4HN7 A;  4RGT A;  3WOE A;  5FLM G;  2JJQ A;  3NTH A;  3PO2 H;  1WTW A;  1JJC B;  2DUD A;  5FO7 B;  5M3F G;  1LT4 D;  4K0K L;  4DV2 Q;  4OWW B;  3H3V I;  1A3T A;  2QIL A;  2VW9 A;  4WJ3 M;  2E74 C;  1BBX C;  2GN5 A;  5AJ3 L;  4PMB A;  4C56 C;  1TWC H;  1PXU A;  1IBK Q;  5EQ0 A;  2VQE L;  2UU9 L;  2L11 A;  3A8K E;  3J81 c;  1VQ6 A;  4XTC S;  2WP8 J;  1AZP A;  2UXD L;  2FJ2 A;  2B63 G;  2KHI A;  4F88 A;  2NBF A;  1EY7 A;  2IT1 A;  2TMP A;  4LFC Q;  2PQE A;  5ELO A;  4FDB A;  1HA6 A;  4DV4 L;  4HCE A;  3A8I E;  3T1H Q;  1AE2 A;  3BS1 A;  3RR5 A;  3Q0A A;  1KDB A;  4C3H B;  3M3Y H;  3G71 A;  2O4X A;  4OWT B;  2HIV A;  2PI2 A;  2B2Y A;  1QJO A;  1B4O A;  5IY0 A;  3VDY A;  5CBA E;  3S1M B;  3BZK A;  1A15 A;  1HNW Q;  2KCC A;  1PV4 A;  2R93 G;  3V2T A;  2N3S A;  4PV1 C;  5C4X G;  3DM3 A;  4AH6 A;  5I9O A;  3F2C A;  4EX5 A;  1EIG A;  1RCV D;  4OXP A;  1SMY D;  4A3L H;  5HY6 A;  1PRT F;  2SNM A;  1CTM A;  1U4P A;  4DAY B;  3AFP A;  4LF4 Q;  3HOX H;  1A3U A;  5JAV A;  1VQN A;  1N32 L;  5FOB B;  5IP7 G;  3M9B A;  3JAM i;  3KDF B;  4A3G G;  3CXC A;  3ND9 A;  2HQL A;  3HOZ G;  3AU7 A;  4G7Z C;  5CV5 A;  2RKS A;  3S24 A;  3CPW A;  2K01 A;  1O7L A;  5M3M B;  1U9R A;  5GAG C;  4TRD A;  1TY2 A;  1I4H A;  2DGY A;  1QE6 A;  3DWA A;  1HNX L;  4BBS G;  3OTO L;  1XX8 A;  4A93 H;  3W1G A;  4DV7 Q;  1TQO A;  5DNF A;  4RA8 A;  3S17 B;  2JA9 A;  1NCV A;  2Q2I A;  1QNK A;  4LF6 L;  1JWS D;  2Z6K C;  2L0C A;  2Q8R E;  1E1T A;  4K6D A;  3NWS A;  1JOO A;  2X6G A;  1YI2 A;  2UUB Q;  2YV5 A;  2RSO A;  1XMQ Q;  1XPU A;  1Y1V B;  3CCL A;  2MPM A;  3E0E A;  5LL6 X;  3RN2 A;  1EY9 A;  2LKV A;  4DR7 Q;  4XXE A;  1YZ6 A;  3J7Z C;  1STH A;  3QB3 A;  3KK7 A;  4R4O A;  3WOF A;  4OX9 Q;  4N9T A;  3S2H H;  4X66 L;  4X64 L;  1XTC D;  3HOW H;  1N36 L;  5DLQ E;  3H3V H;  1QUQ A;  4G4K A;  4JCV E;  2VQE Q;  2E5L Q;  1SBB B;  4JBM A;  4A76 A;  1DON A;  3W5O A;  1TS3 A;  3GV6 A;  4C3J H;  1QOH A;  5I6W A;  1Q81 C;  5FKA C;  4KTA A;  3DEO A;  4FP5 D;  1E3P A;  5GAD C;  3K8A A;  3JC6 6;  4JC0 A;  1WCM G;  4X3S A;  1Y1W H;  1LLR D;  5IOC A;  3I3C A;  1I94 Q;  4A3B H;  3PUY A;  1AP0 A;  4UP9 A;  3JAM L;  2BOS A;  1F9S A;  4K6L A;  4A3E B;  1NJI C;  4QCL A;  2PYK A;  1TU2 B;  3D31 A;  3W2D A;  1X56 A;  4IOC A;  4GOP A;  1VQ5 A;  4J1M A;  4UP7 A;  1EWC A;  2NVT B;  3U4Z A;  4QGU A;  4JI7 Q;  3FKI B;  4RCO A;  3S1Q H;  2A6E C;  4NB3 A;  1V43 A;  3MEH A;  2XTI A;  1TR5 A;  5ELD A;  2WAQ G;  1N9W A;  4MN3 A;  2IPK D;  2HCC A;  1EY8 A;  2E8G A;  3L2P A;  5E1F A;  3H09 A;  3OIP A;  3HOV G;  1A6X A;  2CQA A;  4JOI A;  3BVM A;  3I2Z A;  1T9H A;  1D5X C;  2B8F A;  2K14 A;  3D4R A;  1DOK A;  1JWU D;  2XIW A;  3PO3 G;  2I5M X;  1HPC A;  4F87 A;  3SEB A;  1IBL L;  5CBE E;  4KD4 A;  3NXW A;  2ZJR A;  1B50 A;  4R4T A;  1PRT C;  1PTO D;  2MGS A;  3O13 A;  1LT5 D;  1GXD C;  5M5W B;  5IYB H;  1BCP B;  1GUN A;  5FLX c;  3JAM c;  3CD6 A;  1GHK A;  3T1Y L;  1EL0 A;  3I4O A;  3QOL A;  3TZD A;  4GKJ L;  3NBH A;  2R3Z A;  4IUV A;  3I4M G;  2V1C C;  4HR7 B;  1V1P B;  2KA7 A;  5KNC A;  1PTO H;  1TWG H;  4DV6 L;  3KLS X;  5C3E B;  1SRO A;  2EZV A;  4K14 A;  3K81 C;  5EPJ A;  5ISR A;  2HT1 A;  4QUC A;  5K36 G;  2PO4 A;  4KHP L;  1D1K A;  3CQZ H;  4NXN Q;  2VQF L;  4RG1 A;  1XWE A;  4LUO A;  3QO2 A;  1FNW A;  5E3F A;  4ZUI A;  2F0J A;  1GOZ A;  3NEN A;  1HUM A;  2BH8 A;  4A3F B;  4IUP A;  1EOT A;  4GKK L;  5L37 A;  4L8J A;  1YVC A;  2K05 A;  3NP8 A;  4R4Q A;  3K5L A;  1VMC A;  2L15 A;  4H02 A;  4UY8 C;  4IPD A;  4XQJ A;  1OXU A;  1ILP A;  2ZXO A;  3NEM A;  2B2T A;  4NMZ A;  1R4Q B;  1UUP A;  2A68 C;  2BCO A;  2NVX H;  2H5X A;  2F0Q A;  3ZJY C;  5KYL A;  5CGK A;  3S14 H;  2Z4I A;  3I8Z A;  1EZ8 A;  4C3H G;  3F2D A;  3P20 A;  1EYC A;  3S1R H;  1FGU A;  2B8G A;  2QKI C;  1D8L A;  5CV7 A;  1L0W A;  1PTO F;  4UHV A;  4WRD A;  1V8Q A;  3K80 C;  4BY1 B;  5IP9 H;  2E2I H;  4EQO A;  4UDU C;  1CHQ D;  3DMU A;  2B29 A;  5FJ8 H;  3CMA A;  1VQA A;  2NVY H;  2NZO A;  4NKL A;  2J7Z A;  2EPB A;  2VB2 X;  4U68 A;  4OWX B;  4A75 A;  4JI3 Q;  2X69 A;  2NTT A;  4RCN A;  4IJL A;  5C44 B;  2RSN A;  4OGQ C;  1BOS A;  1E2W A;  3RLO A;  3VYR A;  2UUC Q;  1VDZ A;  2JA8 H;  5HGQ A;  1EU3 A;  2QW7 A;  3GD7 A;  2ZJQ A;  2NTS A;  2KBN A;  1MI2 A;  5M3M G;  3WDN A;  1HTL D;  1X3E A;  2IHF A;  4ME3 A;  3LWE A;  4A3I G;  2NWG A;  2EVB A;  2EY5 A;  4X65 L;  3CCR A;  4CHT B;  1MJC A;  3HRZ C;  4KN4 C;  3K58 A;  1STE A;  3H3V C;  1L1O B;  1BUV T;  2AUJ D;  3IL8 A;  2F0T A;  3SVM A;  2ICE C;  3EA6 A;  1Y1V G;  4A4I A;  2DN8 A;  1K83 H;  2A69 C;  5IGD A;  5ELC A;  1I6H H;  1PYS B;  3IAY A;  1Y8O B;  1CUK A;  1K8M A;  1J5E Q;  1IKM A;  4OIJ A;  4P74 A;  1LTI D;  1HR0 L;  5HUR A;  3J80 L;  2OT2 A;  1SRU A;  1IKL A;  1I50 H;  3QG1 A;  4G7H C;  4PZ8 A;  2K1B A;  2MO0 A;  3Q24 A;  4L5Q A;  4BXX H;  2EY6 A;  1W6K A;  1E7Z A;  4KJO A;  3K0Y A;  2PNR C;  3L3O C;  2CCZ A;  2ZTC A;  4HJ7 A;  1KDA A;  4IFD J;  2R6G A;  3SK6 A;  3M3Y B;  1EWI A;  1EQQ A;  1M8A A;  5A35 A;  1I3Q H;  1S5F D;  2ES2 A;  2VUM H;  1VQ9 A;  2R7Z B;  1EYD A;  1G2T A;  4EQP A;  3P75 A;  1TWF H;  3KJO A;  1NY4 A;  3H6M A;  4DR1 L;  4IPH A;  2F0L A;  4QIW E;  2IL8 A;  1VQC A;  4A3E G;  1XMO Q;  1TWH H;  5JEA G;  2MUY A;  1FGB D;  3HEJ A;  1Z6H A;  4KY5 A;  5KRU A;  2RQX A;  2R92 B;  2FXQ A;  1EY0 A;  1FD7 D;  1PMR A;  2EJM A;  4K5X A;  4XQN A;  3GTM B;  3FKI G;  3SK5 A;  3GTJ H;  1ROD A;  1S5E D;  1N33 L;  3GTQ B;  3TZU A;  4EVO A;  2EDG A;  4ZKB B;  3J80 c;  3Q23 A;  1C48 A;  5H1S E;  3P1H A;  3W3A A;  5EKL A;  4QIW B;  4DAY A;  1AN8 A;  4GZY C;  2NVQ B;  3TN2 A;  4GLV B;  1WTH A;  2KJX A;  5JJZ A;  3QIA A;  1SLJ A;  1PTO C;  4AYB E;  4Y7N H;  4BBR B;  3KDF A;  3I91 A;  4CJ1 B;  1YHB A;  2F0H A;  4YCU A;  1B1Z A;  2CHB D;  1TII D;  2ICI A;  3PUV A;  4ZLT F;  1G6P A;  3CCQ A;  4DNI A;  2FMC A;  3PSI A;  1SYE A;  4K2L A;  1U0L A;  5I6Y A;  2E2H H;  3DLL A;  3K5O A;  4V0B A;  2B2W A;  3A7L A;  3I4N H;  2I07 B;  3A5U A;  3TQY A;  4AYB B;  2JA6 H;  1D5M C;  5IT9 E;  1QB5 D;  3BJU A;  5JJL A;  1VQP A;  4YHH L;  1CFM A;  5C3E G;  1EYG A;  4IZ8 A;  2YU9 H;  4XIG S;  4OO1 G;  1RJT A;  1FJG L;  1K73 C;  1MGS A;  1KTK A;  1GUG A;  5JVH 3;  3C3L A;  3H0G H;  4KV6 A;  3CME A;  1NNX A;  4KD3 A;  3V05 A;  2VY3 A;  2HUG A;  2QF7 A;  5M5Y H;  1G6Z A;  3I4L A;  3RMH A;  4DR2 Q;  4DV2 L;  2EXZ A;  5FLX E;  4JI6 Q;  4JI4 L;  2UXB Q;  3GTK H;  1LM0 A;  2WAC A;  1IBK L;  4FYD A;  3MXG A;  4L5T A;  1L0X B;  4DV1 Q;  3NK9 A;  4PMC A;  4R8I A;  5EPL A;  4BS9 A;  2BDN A;  3A0J A;  3DEP A;  4KKS A;  5AFW A;  4B3S L;  3AQQ A;  5LMN W;  5IWA Q;  4K8J A;  3U9O A;  4EQ5 A;  2IY5 B;  2G5D A;  3OIQ A;  1II3 A;  4LFC L;  1ONL A;  5TSS A;  3NTK A;  3OW2 A;  3T1H L;  1S5D D;  2EXD A;  3IRB A;  4NXM Q;  1OXV A;  3KF6 A;  5C3X A;  1S72 A;  5JPM C;  2IW3 A;  2F0W A;  1ENA A;  3PQI A;  5M5X H;  4DA2 A;  1SMX A;  1TXY A;  3MXU A;  4BY1 G;  5T1G A;  1HNW L;  2HCI A;  4ID6 A;  1CZW A;  5CYU A;  3T53 B;  2P5Z X;  1Z7T A;  3M4O H;  4C3I B;  5IGF A;  1B8A A;  1EFI D;  3TBI B;  3GDE A;  5C44 G;  3ULJ A;  1Q12 A;  2QA4 A;  2JQO A;  4LF5 L;  1LV9 A;  4K5W A;  1RF2 D;  2JA5 H;  1VF7 A;  2BA0 A;  1BCP F;  4POG A;  2NZ1 D;  5C4H A;  2L4N A;  4P73 A;  1FYC A;  3S16 B;  4XYO A;  4ILW A;  2ASB A;  4Y52 H;  1SR3 A;  1QWY A;  4HJ8 A;  2YTX A;  3PUW A;  3M85 A;  5E7N A;  1R9T H;  4G7O C;  5E4X A;  4DV7 L;  4X3K A;  4A3M B;  3IFD A;  4A3J B;  4PNY A;  2MHV A;  4XT1 B;  2WB1 E;  2FIN B;  2E2J H;  2MNA A;  2R7D A;  2F3I A;  2UUB L;  1V1P A;  3HOU B;  1HR0 W;  1K8G A;  1HNZ Q;  1E0B A;  3Q6S A;  1XMQ L;  4A3D B;  3PCO B;  5C4Z A;  1PH5 A;  3I55 A;  1IZ6 A;  4I7A A;  2WIN B;  4DR7 L;  1PRT D;  3CRK C;  2EYJ A;  1GUO A;  1HQM C;  4OX9 L;  2WB1 B;  3KUP A;  1GO3 E;  2E76 C;  1VMP A;  2WKC A;  3FEW X;  4YWL A;  4JI4 Q;  3D4W A;  2M9V A;  3EQL C;  2Z4H A;  4DV0 Q;  1YIJ A;  3IFT A;  2QDL A;  3CP0 A;  2E5L L;  1GKH A;  1EY4 A;  2NVX B;  2RHS B;  5IYC G;  2F3V A;  5IYD H;  1MSH A;  1H9J A;  3S14 B;  4B3S Q;  3TME A;  1STG A;  4DU9 A;  2I0Q A;  3GTO H;  4DGZ A;  2R7Z G;  2KEN A;  3NQT A;  2E2D C;  5I2X A;  5FLM H;  1MHW C;  2Z8L A;  3GTL B;  1SFO B;  1I94 L;  2XWJ B;  3SK4 A;  2XN9 C;  3UDF A;  4KY6 A;  2Q8T A;  1M1K C;  5M3F H;  3CCS A;  3C2P A;  1UE7 A;  1X65 A;  3FHW A;  2K4K A;  2A68 D;  2OF1 A;  1I4R A;  3BVG A;  3HZX A;  2R92 G;  3AFQ A;  3VYS A;  5G3L D;  3U58 A;  2D0P A;  1D7Q A;  1PFM A;  4K8I A;  4JI7 L;  3VR6 A;  1D6E C;  5IE8 A;  1W6J A;  1K8O A;  2B63 H;  5C5L A;  4A3C G;  4WOR A;  1DXM A;  2PCF B;  1X3F A;  1CQV A;  2JA7 B;  1K28 A;  4LJZ C;  5GRO A;  4MTN A;  2EJG C;  3S15 H;  2DJG C;  3HS0 C;  4LF5 Q;  3VYT A;  4AQY L;  4BBR G;  2Z0S A;  2SOB A;  5LL6 S;  4TQU S;  3K7U C;  2FMM A;  1TT2 A;  3HOY B;  5IGC A;  1UWV A;  4LF7 L;  3RZD H;  3ERO A;  4LFB Q;  3BDC A;  1CQF A;  3K7A B;  1G51 A;  2K5W A;  1Z9F A;  4C2M H;  3J80 E;  1DCZ A;  2ALY B;  2R93 H;  4LF9 L;  4GLX A;  2IWH A;  1MD2 D;  4JK1 C;  5C4X H;  3IKJ A;  4AYB G;  5EJW A;  1BCP C;  1L1O A;  2B2U A;  4GNX C;  1BR9 A;  3I90 A;  4FNF A;  3H94 A;  4HJ5 A;  3KYH C;  1X3G A;  3L9A X;  2AKW B;  1B9N A;  2K5V A;  2RBM A;  4U67 3;  1DYQ A;  2D0O A;  2F4I A;  1AZQ A;  5IP7 H;  1ILQ A;  2JEB I;  4A3G H;  5M9O A;  3HOZ H;  1DJR D;  1SXT A;  4NXN L;  1VQI A;  1D5Z C;  2G9H D;  5COR A;  1EIY B;  3DWQ A;  5G3L F;  1SNO A;  4JW0 A;  4RHS A;  4DK1 A;  1ESF A;  4BBS H;  1CZG A;  4HIM A;  3T16 A;  2K32 A;  2A69 D;  1XNR Q;  1CK1 A;  2GVB A;  1PYW D;  2PMZ E;  4KLK A;  1ESR A;  3PIP A;  1A0I A;  1LTA D;  1NUC A;  2VUM B;  1B70 B;  4KK7 A;  5ELB A;  4O42 A;  4N8F A;  1VCI A;  4CJ0 B;  4BY7 B;  4H13 C;  3E9H A;  4ULL A;  4ZQ3 A;  2YTY A;  3NTI A;  2Z6B A;  3AYH B;  1PDQ A;  3KF6 B;  3LWU A;  2PMZ B;  2J0T D;  3K5M A;  2B2Y C;  4JPB W;  4XDX A;  2JSO A;  5J3B A;  4CKC A;  3UDG A;  5KIX A;  1BBU A;  2D5D A;  2JN4 A;  3MFG A;  4C3I G;  1ZEQ X;  4O1N A;  3PF5 A;  1I4G A;  1NSN S;  1E1O A;  4OEM B;  3CC4 A;  3EN2 A;  5IIF A;  4JI3 L;  4O0A A;  4P71 A;  4Y7N B;  1NE3 A;  4DXF A;  3EBE A;  2X6L A;  2NYZ D;  2N8N A;  2PZU A;  2UUC L;  3CCU A;  5DAU A;  1GHJ A;  3TP6 A;  1K3R A;  1JWM D;  1WCM H;  1X3Q A;  3KF8 B;  5JJI A;  3M4Y A;  1WTO A;  4AQY Q;  1A3V A;  1L0Y B;  3MTS A;  3GTP B;  1BO0 A;  4MZ9 A;  3S2D H;  4DUZ Q;  2A8V A;  4LF7 Q;  2DY8 A;  4YIJ A;  5NUC A;  4N9P A;  4JI8 Q;  5C0X G;  3TP8 A;  4HED A;  2HHH Q;  3TS0 A;  5FO9 B;  4A3M G;  4GS3 A;  4A3J G;  4LF9 Q;  1LTL A;  5DM6 3;  2ZM6 Q;  1EEF D;  1VQF A;  4K2K A;  2MFI A;  3J7Y W;  3HOU G;  4ZRZ A;  4IPG A;  2SDF A;  4A3D G;  1GUW A;  3S9W A;  2LFN A;  4DR4 Q;  1JJG A;  3KLW A;  5CV6 A;  1O7I A;  5C4J B;  2PZW A;  4JV5 L;  2DNE A;  4KMU C;  1JT8 A;  2B3G A;  4G57 A;  3HOV H;  1AE3 A;  4IUR A;  2NN6 I;  1J5E L;  1WTV A;  4PG3 A;  4J8Q A;  2WB1 G;  3T4A C;  4IFD I;  2L55 A;  3FDT A;  2F0N A;  1YNN C;  3GTG B;  3PO3 H;  3HFZ B;  2CWP A;  3G4S A;  4KKT A;  4RWS C;  3V96 A;  1MKH A;  1KRS A;  2F52 A;  3PUX A;  3S1N H;  1VQK A;  1IXR A;  1A2U A;  2CFM A;  2F0G A;  1XYI A;  1TWA H;  1ASY A;  3I4M H;  2UXC Q;  5C0X J;  1RDP D;  2ZTD A;  4DV5 Q;  2YTV A;  3Q8D A;  5CMD A;  3J7A 5;  4YY3 Q;  1W3S A;  1X32 A;  1WJJ A;  2PNH A;  5M5X B;  1PH3 A;  4UP8 A;  5K36 H;  4L63 B;  2RDG A;  1XMO L;  2I46 A;  1U4L A;  2L12 A;  2D2C C;  1EFW A;  5A2Q E;  3J81 E;  3GO5 A;  4LAA A;  2AWO A;  1UE6 A;  2NZH A;  1N34 Q;  1ZYR D;  1VQE A;  4RKL A;  4TKO B;  4GOP C;  4CGY B;  1Q3L A;  3NEL A;  4IAL A;  2QGQ A;  2JA7 G;  3LX0 A;  2A74 C;  1TKW B;  1STB A;  1J8I A;  4LWC A;  1BBW A;  5EPK A;  3HOY G;  4C3H H;  1FNV A;  4YWK A;  1I4P A;  4JOI C;  4DNR B;  4HIK A;  4RMF A;  3F8T A;  3S1M H;  1OXX K;  2NN6 G;  4A3K B;  4WJ4 A;  3C1E A;  4IFD G;  2WII B;  1VF5 C;  4JVZ A;  1VS0 A;  3NWT A;  1YNJ C;  4X3U A;  3TSS A;  5FO8 B;  5FK9 C;  2CH4 A;  1NTG A;  3NE5 B;  3ULP A;  3K6O A;  1N8R C;  5IGE A;  3PO2 B;  2VNU D;  2PZT A;  1A62 A;  2AWN A;  4B3M Q;  4ZK9 B;  1RL2 A;  1WTQ A;  1WTX A;  5BR8 Q;  1YJN A;  1K9M C;  4CKB A;  4JV5 Q;  2MJ8 A;  4PMW A;  2O5I C;  4JYA Q;  3A8J E;  1ML0 D;  1PYB A;  5KEE A;  4DR2 L;  5IGG A;  5M3M H;  1IBM Q;  1TWC B;  1XPO A;  4JI6 L;  1FNU A;  4JI1 Q;  4JI5 Q;  2UXB L;  1LTR D;  2KOL A;  5EBD A;  1GVP A;  4A3I H;  4ZYS A;  4LFA Q;  2BA1 A;  2XVS A;  3AB9 A;  3S17 H;  2L9H A;  2Z9H A;  3STB D;  4DV1 L;  4B3R L;  2VXW A;  1E2V A;  2EYL A;  1C7Y A;  3TDQ A;  4OO1 I;  5DEH A;  5IWA L;  4DV3 Q;  2R61 A;  2ZXR A;  4BY7 G;  5J1Z A;  1Y1V H;  2B2T C;  3CW2 C;  4IJH A;  4JBW A;  1JOK A;  5BN5 A;  4CJ2 C;  4BWG B;  2V4D A;  3R93 A;  4NXM L;  3ITP A;  3H15 A;  4FF1 A;  1WOC A;  4TSS A;  3TS2 A;  3OWF A;  5E4W C;  3PV0 A;  4ZUJ A;  4LNQ A;  3OMC A;  2C5C A;  1BKB A;  2RDH A;  1SDF A;  4CDD C;  1UE5 A;  4DR6 Q;  3HKS A;  3UE1 A;  1U5K A;  2CW0 D;  4ZAI A;  3MHB A;  1CHP D;  3QOJ A;  4HSP A;  3HOX B;  5COY A;  2JP1 A;  1KHI A;  3ICE A;  3D8G A;  1RTO A;  2PW5 A;  3OSO A;  4DAV A;  2N78 A;  3M4Q A;  4RGN A;  4CKE A;  2EE1 A;  3UDI A;  3I70 A;  2ID0 A;  3A5Z B;  5LMN Q;  4LW1 A;  1RIP A;  1SNQ A;  4EQN A;  3ONA B;  2B2V A;  1B44 D;  4DK6 C;  2KCN A;  3MWY W;  2F0M A;  1CT1 D;  4A3E H;  1JQY D;  1SJH D;  4A93 B;  5JEA H;  1BQQ T;  2F0K A;  4HAE A;  3EFX D;  1FL0 A;  1Q8I A;  3CKI B;  1HFN A;  4IPC A;  1U4M A;  1X55 A;  3BDL A;  4HJA A;  3FRP B;  2NVT H;  2L1B A;  1RD9 D;  3D0F A;  2VZA A;  1CKN B;  1JR0 D;  3FKI H;  3R2I A;  3CC2 A;  4R9W A;  2OQ0 A;  3RZO H;  1JCK B;  1HNZ L;  4JG2 A;  1Y69 U;  3UE0 A;  1HCZ A;  1HH2 P;  1SJE D;  1VQL A;  2M00 A;  4F7X A;  1F2L A;  3J7A F;  2AQ2 B;  3S2H B;  3ULL A;  3G7L A;  5D14 A;  1LTT D;  1IL2 A;  4ZKC B;  1BCP D;  3D6W A;  5CC4 A;  3HOW B;  3BG3 A;  2BE5 C;  2Y0S E;  3FP9 A;  4F8M A;  2Q2H A;  3JAM E;  5IGB A;  1AH9 A;  4DV0 L;  4A3F G;  4RKB A;  1LT3 D;  5M5W H;  4C3J B;  1S4Z A;  1B3A A;  1Q82 C;  1T5E A;  1ENC A;  1YEZ A;  2A19 A;  2KHJ A;  3KFU A;  1NMF A;  3PMF A;  4B3R Q;  3M7G A;  3ERS X;  1PVO A;  3HKZ E;  4M8A A;  4GLA C;  1QVF A;  2XGT A;  1Y1W B;  3MFY A;  2ZXP A;  4OEL B;  4JI0 Q;  2D62 A;  1OXT A;  1TY0 A;  5C3E H;  5KYI A;  1SN8 A;  3MZ5 A;  1Z47 A;  1VQG A;  1D2B A;  2Y0S B;  2EYP A;  2NUC A;  4OO1 H;  2A73 B;  1JC7 A;  4A3B B;  4B9W A;  1ZYR C;  3F2U A;  2RCN A;  2PPB C;  2KUM A;  1KNE A;  5LHY 1;  1XNQ Q;  1O80 A;  1KXL A;  3OHX C;  2F4V Q;  3KOJ A;  1DD2 A;  1PZK D;  1RHP A;  4PZ6 A;  3NUC A;  3TP7 A;  5KND A;  1XXG A;  3HKZ B;  4DKA C;  3S1Q B;  2OQK A;  4QMG A;  2MO1 A;  2AUK A;  1XJV A;  4DF7 A;  2DNC A;  2XRS D;  4TVA B;  3NHH A;  1CKO A;  2GA4 B;  3CRL C;  1KC8 C;  1IHZ A;  3CAM A;  2A5H A;  1UE1 A;  4PZ7 A;  2VS1 A;  3KF8 A;  4V19 0;  1JB3 A;  2K75 A;  1QVC A;  2XRQ D;  2F3W A;  3ZYY X;  3NPP A;  2HDM A;  4LFB L;  1H95 A;  4RGM A;  2KHS A;  3F1Z A;  1B9M A;  2K7V A;  5JPN C;  3CCM A;  4CBV A;  2UUA L;  1U4R A;  2K5D A;  4BY1 H;  5CR3 A;  1GUS A;  1K8A C;  4A3K G;  1XTD A;  3FVQ A;  5I4D A;  4X62 Q;  1LUZ A;  4MNO A;  3VR5 A;  4DAP A;  4N8X 1;  1PTO B;  1TWG B;  1QZH A;  2B2W C;  3A55 A;  3HP3 A;  1EY6 A;  1FR3 A;  5C44 H;  3HOV B;  3K5N A;  5KNB A;  1EU4 A;  3PO2 G;  4IUN A;  1RTN A;  3SDZ A;  3VR2 A;  1S5B D;  4Q5V A;  1BF4 A;  3CQZ B;  3STB C;  1VQ4 A;  4XQQ A;  1Q90 A;  2KQ3 A;  3MC0 B;  2ZT9 C;  4H0L C;  2WFW A;  2OTL A;  2Z6K A;  2KCM A;  1Q86 C;  1EWH A;  1OTC A;  3URY A;  2QEJ C;  4FVM A;  3BYY B;  4POF A;  3I4M B;  1C0A A;  1SYF A;  2R7F A;  3VYU A;  2IHE A;  1TVX A;  1XNR L;  3FMC A;  3G6J B;  4NW2 A;  1NBW A;  1VQH A;  4DR3 Q;  1X6O A;  1YNN D;  1STY A;  2YYZ A;  3MXN B;  1EQV A;  1PA6 A;  4XT3 B;  5D65 A;  4QL5 A;  3ND8 A;  1STA A;  5JJK A;  3S1R B;  1Q8K A;  5EKK A;  4B3T Q;  2CW0 C;  1SEB D;  3EVQ A;  1JJ2 A;  1M4V A;  2E2I B;  3TRE A;  5I9P A;  4I65 A;  1GD7 A;  4WFN 3;  2HIX A;  1R4P B;  2FFK B;  3E5S A;  3MAQ A;  4YCV A;  2NVY B;  3CF5 A;  2K33 A;  2O2L D;  4FXD A;  4A3L G;  4KHV A;  3A7A B;  4QUF A;  4APV A;  5IYC H;  3HOX G;  1PLF A;  4RGO S;  2XNA C;  4M1U B;  4KY7 A;  2JA8 B;  5J39 A;  4LF8 Q;  4EGV A;  3M7N A;  4P2C B;  1H9S B;  3RLN A;  1HHV A;  1E2Z A;  1QCB D;  1HZB A;  2R7Z H;  1EOV A;  1YHA A;  4HJ9 A;  1KDC A;  2RVL A;  1SYG A;  2ATW A;  3BYT B;  3G48 A;  4P72 A;  1KD1 C;  4IN3 A;  4DUZ L;  2F0D A;  2QDB A;  2IJ0 A;  2Z1C A;  4A93 G;  3K59 A;  4J15 A;  3SGI A;  2CWA A;  1YJW A;  4JI8 L;  1YHQ A;  1SNP A;  4KJN A;  2HHH L;  2UUA Q;  3RLF A;  3DHQ A;  2R92 H;  4QF4 A;  1K0R A;  4IQZ A;  1Y14 B;  1JE5 A;  3I56 A;  1EZ6 A;  3GTM H;  2ZM6 L;  4BA1 I;  3GTQ H;  3NQI A;  1DZ1 A;  2PW7 A;  3OOC A;  1YNX A;  2F0P A;  1TS5 A;  4A3C H;  2EY2 A;  1K83 B;  3UDX A;  2NVQ H;  1I6H B;  5JOB A;  4DR4 L;  1HJP A;  4BBR H;  1O7Z A;  2A1A A;  4R4I A;  1F2M A;  3E9I A;  2DY7 A;  2F0I A;  2B39 A;  3KLR A;  5C0X I;  4A3I B;  3OWE B;  3HOW G;  1CSP A;  1I50 B;  1YNJ D;  3TRZ A;  4AIM A;  4Z9C B;  2K5H A;  1F9Q A;  2OXP A;  1VQD A;  3K57 A;  2RA4 A;  4JBJ A;  1CI3 M;  1VQJ A;  4DAM A;  4GN4 B;  2LS0 1;  4C3J G;  4JI2 Q;  2KEE A;  3X3M A;  2JK8 A;  1TS4 A;  3DUZ A;  2N49 A;  2CQO A;  1AFP A;  1W2B A;  1PH6 A;  3QJY A;  2EYO A;  2IX1 A;  2MQH A;  4OHJ A;  1I3Q B;  2UXC L;  1Y1W G;  3VA7 A;  4DV5 L;  4DUY Q;  1YJ9 A;  2A6H D;  1V1O A;  1TWF B;  1T5X D;  3D4D A;  3R2T A;  4HMI A;  2Y0S G;  1UAP A;  4YY3 L;  4A3B G;  1G8Z D;  2J4X A;  4LUV A;  1GUT A;  4K0K Q;  1TWH B;  3G6E A;  4IUQ A;  2EIF A;  3BZC A;  3BZD B;  1LTG D;  1MJE A;  3GQB A;  4DXG A;  5AJ3 Q;  3E3X A;  3DWP A;  1P8L A;  1JE4 A;  5GAE C;  2E75 C;  5T1I A;  1E22 A;  3SXH A;  3DM1 A;  3HKZ G;  5IT9 L;  4KHZ A;  3UI2 A;  2QCP X;  4QJF A;  2UU9 Q;  3GTJ B;  3HG9 A;  5I2Y A;  1VQO A;  1EUJ A;  1N34 L;  2UXD Q;  3AEV A;  2NB0 A;  3KJP A;  4FF3 A;  1PZI D;  1SYB A;  2LXK A;  3OW7 A;  3CPF A;  4DV4 Q;  3C1F A;  3DXJ C;  1DOL A;  2HQE A;  1J6Q A;  2LSS A;  1NMG A;  5FLX L;  2JE6 I;  5ELF A;  3A54 A;  3T51 B;  4S3S A;  1D1I A;  2K50 A;  3PIO A;  2E2H B;  1ET9 A;  1LAC A;  1MSG A;  3A56 A;  4IUU A;  1KLU D;  5IYB G;  4X3T A;  3I4N B;  3CCJ A;  1HQR D;  2EOT A;  3TEH B;  2JA6 B;  2K28 A;  3RZO B;  2ZJP A;  2OWO A;  1EIF A;  2JEA I;  1CKN A;  4C3I H;  2JXM B;  2KEC A;  1SYD A;  5IT9 c;  4L5R C;  5J22 A;  4IUT A;  2YU9 B;  3FPU B;  3N6R A;  2AHO B;  2HDL A;  1L1O C;  3QR8 A;  1PH1 A;  4BA2 I;  1N32 Q;  1VQB A;  2B2U C;  3H0G B;  4B3M L;  2KCT A;  3ER0 A;  1EQR A;  1HTP A;  3I7F A;  5M5Y B;  3D3R A;  5BR8 L;  1MBY A;  3P7J A;  5BN4 A;  3SK8 A;  3Q22 A;  3S16 H;  4JYA L;  2D9U A;  3GTK B;  1HNX Q;  1IBM L;  1LTS D;  3OTO Q;  3CCV A;  1S40 A;  2RCF A;  4JI5 L;  4HSV A;  4JI1 L;  5C0X H;  3CHB D;  4IOA A;  4GNX B;  1F2Z A;  1BVS A;  2CVR A;  4DK0 A;  2L5T A;  3VA5 A;  4UPA A;  4LF6 Q;  1Q1B A;  4FF2 A;  4H44 C;  4LFA L;  1P16 A;  1K0S A;  4A3M H;  4A3J H;  2Q2T A;  5F2D A;  5LMU L;  2XSC A;  4NP5 A;  1QZG A;  4R8N A;  1QVG A;  1VQM A;  4DN4 M;  1JOQ A;  1H9M A;  1MIU A;  4R4C A;  3HOU H;  3TP5 A;  1CKM A;  3CC7 A;  4DV3 L;  1PH2 A;  4A3D H;  2PQA A;  4DR5 L;  2BE5 D;  3RD4 A;  2F1M A;  5D3D A;  3PUZ A;  1OXS C;  3RN5 A;  5HGT A;  1NR2 A;  3W1B A;  1LT6 D;  4GN5 A;  4B9X A;  3CCE A;  3EIV A;  4X66 Q;  4QY7 A;  1PH8 A;  3LGJ A;  3OYY A;  1G2S A;  1SNC A;  4X64 Q;  2K6A A;  2DJF C;  1STN A;  5IP9 G;  2F03 A;  3PF4 A;  2EJF C;  1YBY A;  1N36 Q;  1RKN A;  1GJX A;  5ELN A;  2PI2 E;  5FJ8 G;  1DOM A;  1SE4 A;  3M4O B;  1OO9 B;  1CSQ A;  4DR6 L;  1HZ9 A;  1WTR A;  1SND A;  1ZKO A;  2Q8I B;  2H4O A;  2HD3 A;  1KIX A;  1LYL A;  1Q1E A;  2JA5 B;  5D3I B;  2FHT A;  3PGZ A;  3M4P A;  1IYU A;  3VR4 A;  2JA8 G;  3WWV A;  1O7Y A;  3E0J A;  3J80 i;  2IX3 A;  1V1Q A;  1IW7 D;  1SMY C;  2WV6 D;  1K3B C;  5LMN L;  4RAU C;  3GTL H;  5C3W A;  1SFO H;  3GV3 A;  1R9T B;  3MXP A;  3SR1 A;  1PHJ A;  3H91 A;  1WI5 A;  3QWN A;  3SE0 A;  2E2J B;  4FXK C;  3T56 B;  1Y8N B;  3J81 j;  3OMG A;  2N88 A;  1H9K A;  4O2D A;  1I4X A;  3A74 A;  2C9O A;  5ELE A;  1HRJ A;  2WKD A;  2JA7 H;  3KBG A;  1B2T A;  3R8B A;  1HA5 A;  5DM7 3;  2AQ3 B;  4GN3 B;  3B6Y A;  1SYC A;  2GVA A;  3F2B A;  5BN3 A;  3HOY H;  2K52 A;  1E24 A;  1IBL Q;  1PRT B;  1PFB A;  4QB4 A;  4DPG A;  1X9N A;  3K7A H;  3T13 A;  2A6H C;  4BXX G;  1S5C D;  1ENF A;  4ODG A;  2NN6 H;  4RFB A;  3T1Y Q;  2EQS A;  1ICW A;  1F9R A;  4GKJ Q;  4IFD H;  1IYV A;  3VR3 A;  3FPP A;  5LMU Q;  4DK3 C;  4DV6 Q;  1KNA A;  1KRT A;  3GTO B;  1X3P A;  2VUM G;  3KLS A;  3U9S A;  2OCE A;  4JI0 L;  3MXN A;  1F9P A;  4NPS A;  1WD0 A;  1VQ8 A;  1V9P A;  4DR5 Q;  1WFQ A;  4KHP Q;  1DM0 B;  5EKI A;  4ME5 A;  2VQF Q;  1JOR A;  2AQ1 B;  3MVV A;  1A63 A;  3MA2 B;  5M3F B;  1PFS A;  2M2L A;  4HMJ A;  1XNQ L;  4JBK A;  2F4V L;  1DGS A;  3PIP 3;  4GKK Q;  4KI0 A;  4HIO A;  1QUQ B;  2SEB D;  4C1N K;  2EY1 A;  1B7Y B;  5GQO A;  2VB3 X;  2LXJ A;  1Y8P B;  3NBI A;  2B63 B;  2F0S A;  1PH7 A;  2Q2U A;  1UEA B;  1EEI D;  3C46 A;  1UEB A;  3S15 B;  3LNN A;  1WYD A;  1KAA A;  1GM5 A;  2BH2 A;  1CA5 A;  4BY7 H;  1PH9 A;  1NAP A;  1H9S A;  1KAB A;  4YWM A;  1HZC A;  4KKU A;  5IOD A;  3RZD B;  2F0F A;  1NR4 A;  3D6C A;  2N55 A;  1ZXT A;  1Q7Y C;  4C2M B;  2ZTE A;  1KAW A;  5CV8 A;  4Q0F A;  1SNM A;  2R93 B;  2KED A;  1B53 A;  4GOP B;  2O5J C;  3I4N G;  5C4X B;  1ASZ A;  3BVZ A;  1B3Q A;  2JA6 G;  4OIK A;  4X62 L;  4HCS A;  4ZCK A;  4FF4 A;  2XWB B;  1VQ7 A;  4MIU A;  1WTP A;  4J6H A; 
#chains in the Genus database with same CATH homology
 1J9O A;  3PIO 3;  1AEX A;  1HXY D;  3R3O A;  3N52 A;  5JVG 3;  4DNT B;  4A3G B;  5C5M A;  1C4Q A;  3HOZ B;  1IL8 A;  2MP1 A;  5CV9 A;  4L6T B;  1I4Q A;  4RH6 A;  4BBS B;  3I72 A;  2TSS A;  2IX0 A;  5JEA J;  1TS2 A;  1CA6 A;  2SNS A;  1AW7 A;  1EIH A;  1SSO A;  2ENB A;  2F0E A;  3ERQ A;  4FO2 A;  3RUZ A;  4H7B A;  4OL7 A;  5EBC A;  5K5P A;  1C8C A;  1G29 1;  4K5V A;  1JIC A;  3CU7 A;  3AMU A;  4E6I A;  1I6V C;  4DFA A;  2G9D A;  2RDF A;  3BDO A;  3I73 A;  1HFG A;  1LTB D;  1PZJ D;  4ABN A;  3L7Z C;  1IW7 C;  1LO5 D;  2K5Q A;  5C6A A;  1BXT A;  2LY7 A;  2K04 A;  1KLG D;  2EYM A;  1EY5 A;  2KVM A;  1WCM B;  2LMC B;  1G91 A;  4XYQ A;  4PQX A;  1BDO A;  3S2D B;  4KN7 C;  4C1N I;  1ET6 A;  2F0V A;  1QG7 A;  1QIL A;  1PFN A;  2B2V C;  2K03 A;  1H9R A;  3NSW A;  2BDO A;  1EYA A;  2EYF A;  4FXG C;  4B08 A;  1A2T A;  1QNU A;  1F77 A;  2H1E A;  2WAQ B;  5EGT A;  3E6Z X;  2F0O A;  2OEO A;  4UAI A;  1CM9 A;  4HTH A;  4RHR A;  2A6E D;  3SHL A;  1SAP A;  5A2Q L;  3PO3 B;  3J81 L;  1O78 A;  1BNZ A;  1SE2 A;  3J7A V;  4I7Z C;  4LMQ D;  4LK1 C;  2EYH A;  2JYO A;  3X3N A;  3S1N B;  4MHE A;  3HGB A;  1F2Y A;  1HUN A;  1EQT A;  4WJW A;  1LAB A;  1TWA B;  3EJI A;  3KBX A;  3GP7 A;  1UNS A;  2F0U A;  5CV4 A;  1SE3 A;  5KGU A;  3OPO A;  4NDX A;  1WVL A;  1WD1 A;  4HN7 A;  4RGT A;  3WOE A;  3NTH A;  1WTW A;  5FO7 B;  1LT4 D;  1A3T A;  2QIL A;  2E74 C;  1BBX C;  4PMB A;  4C56 C;  1PXU A;  5EQ0 A;  2L11 A;  3A8K E;  4XTC S;  2WP8 J;  1AZP A;  2FJ2 A;  4F88 A;  2NBF A;  1EY7 A;  2IT1 A;  2TMP A;  2PQE A;  1HA6 A;  4HCE A;  3A8I E;  3BS1 A;  3Q0A A;  1KDB A;  4C3H B;  2O4X A;  2B2Y A;  1QJO A;  1B4O A;  5CBA E;  3S1M B;  1A15 A;  2KCC A;  3V2T A;  4PV1 C;  5I9O A;  1EIG A;  1RCV D;  1SMY D;  1PRT F;  2SNM A;  1CTM A;  1U4P A;  1A3U A;  5JAV A;  5FOB B;  3ND9 A;  3AU7 A;  4G7Z C;  5CV5 A;  2RKS A;  2K01 A;  1O7L A;  5M3M B;  1U9R A;  4TRD A;  1TY2 A;  1I4H A;  3DWA A;  1QE6 A;  1XX8 A;  1TQO A;  5DNF A;  4RA8 A;  3S17 B;  1NCV A;  1QNK A;  1JWS D;  2L0C A;  2Q8R E;  4K6D A;  3NWS A;  1JOO A;  2X6G A;  2RSO A;  1Y1V B;  2MPM A;  5LL6 X;  1EY9 A;  2LKV A;  4XXE A;  1STH A;  3QB3 A;  3KK7 A;  3WOF A;  4N9T A;  1XTC D;  4G4K A;  1SBB B;  1DON A;  1TS3 A;  3GV6 A;  1QOH A;  5I6W A;  5FKA C;  4KTA A;  3DEO A;  4FP5 D;  4X3S A;  1LLR D;  5IOC A;  3I3C A;  3PUY A;  1AP0 A;  3JAM L;  2BOS A;  1F9S A;  4K6L A;  4A3E B;  4QCL A;  2PYK A;  1TU2 B;  3D31 A;  3W2D A;  4J1M A;  2NVT B;  1EWC A;  3FKI B;  4RCO A;  2A6E C;  1V43 A;  3MEH A;  1TR5 A;  5ELD A;  4MN3 A;  2IPK D;  2HCC A;  1EY8 A;  5E1F A;  3H09 A;  3OIP A;  1A6X A;  2CQA A;  3BVM A;  1D5X C;  2B8F A;  3D4R A;  1DOK A;  1JWU D;  2XIW A;  1HPC A;  4F87 A;  3SEB A;  5CBE E;  4KD4 A;  3NXW A;  1B50 A;  1PRT C;  1PTO D;  2MGS A;  3O13 A;  1LT5 D;  1GXD C;  5M5W B;  1BCP B;  1GUN A;  1GHK A;  1EL0 A;  3QOL A;  3TZD A;  3NBH A;  2R3Z A;  4IUV A;  4HR7 B;  1V1P B;  2KA7 A;  5KNC A;  1PTO H;  3KLS X;  5C3E B;  2EZV A;  4K14 A;  5ISR A;  5EPJ A;  4QUC A;  5K36 G;  2PO4 A;  1D1K A;  1XWE A;  3QO2 A;  1FNW A;  5E3F A;  4ZUI A;  2F0J A;  1GOZ A;  1HUM A;  4A3F B;  4IUP A;  1EOT A;  4L8J A;  2K05 A;  3NP8 A;  3K5L A;  1VMC A;  4XQJ A;  1OXU A;  1ILP A;  2ZXO A;  2B2T A;  4NMZ A;  1R4Q B;  1UUP A;  2A68 C;  2BCO A;  2F0Q A;  5KYL A;  5CGK A;  2Z4I A;  3I8Z A;  1EZ8 A;  4C3H G;  3P20 A;  1EYC A;  2B8G A;  2QKI C;  5CV7 A;  1PTO F;  4WRD A;  1V8Q A;  4BY1 B;  4EQO A;  4UDU C;  1CHQ D;  3DMU A;  4NKL A;  2J7Z A;  2EPB A;  2VB2 X;  4U68 A;  2X69 A;  2NTT A;  4RCN A;  5C44 B;  2RSN A;  4OGQ C;  1BOS A;  1E2W A;  3VYR A;  1VDZ A;  1EU3 A;  3GD7 A;  2NTS A;  1MI2 A;  3WDN A;  1HTL D;  3LWE A;  2NWG A;  2EVB A;  2EY5 A;  4CHT B;  3HRZ C;  4KN4 C;  3K58 A;  1STE A;  3H3V C;  1BUV T;  2AUJ D;  3IL8 A;  2F0T A;  3SVM A;  2ICE C;  3EA6 A;  2DN8 A;  2A69 C;  5IGD A;  5ELC A;  3IAY A;  1Y8O B;  1K8M A;  1IKM A;  4OIJ A;  1LTI D;  5HUR A;  3J80 L;  2OT2 A;  1IKL A;  3QG1 A;  4G7H C;  2K1B A;  3Q24 A;  2EY6 A;  1W6K A;  4KJO A;  3K0Y A;  2PNR C;  3L3O C;  1KDA A;  4IFD J;  2R6G A;  3SK6 A;  3M3Y B;  1M8A A;  5A35 A;  1S5F D;  2R7Z B;  1EYD A;  1G2T A;  4EQP A;  3P75 A;  3H6M A;  2F0L A;  2IL8 A;  5JEA G;  2MUY A;  1FGB D;  3HEJ A;  1Z6H A;  4KY5 A;  5KRU A;  2RQX A;  2R92 B;  1EY0 A;  1FD7 D;  1PMR A;  2EJM A;  4K5X A;  4XQN A;  3GTM B;  3SK5 A;  1ROD A;  1S5E D;  3GTQ B;  3TZU A;  4EVO A;  2EDG A;  4ZKB B;  3Q23 A;  1C48 A;  3P1H A;  3W3A A;  5EKL A;  4QIW B;  4DAY A;  1AN8 A;  4GZY C;  2NVQ B;  3TN2 A;  2KJX A;  5JJZ A;  3QIA A;  1PTO C;  4BBR B;  3I91 A;  4CJ1 B;  2F0H A;  1B1Z A;  2CHB D;  1TII D;  2ICI A;  3PUV A;  4ZLT F;  2FMC A;  1SYE A;  4K2L A;  5I6Y A;  3K5O A;  4V0B A;  2B2W A;  3A7L A;  2I07 B;  4AYB B;  1D5M C;  5IT9 E;  1QB5 D;  1CFM A;  4IZ8 A;  4XIG S;  4OO1 G;  1RJT A;  1MGS A;  1KTK A;  1GUG A;  5JVH 3;  3C3L A;  4KV6 A;  4KD3 A;  3V05 A;  2HUG A;  2QF7 A;  1G6Z A;  3I4L A;  3RMH A;  2EXZ A;  5FLX E;  2WAC A;  4FYD A;  3MXG A;  1L0X B;  3NK9 A;  4PMC A;  4R8I A;  5EPL A;  4BS9 A;  2BDN A;  3DEP A;  4KKS A;  5AFW A;  4K8J A;  3U9O A;  3OIQ A;  1II3 A;  1ONL A;  5TSS A;  3NTK A;  1S5D D;  1OXV A;  5C3X A;  5JPM C;  2IW3 A;  2F0W A;  1ENA A;  4DA2 A;  3MXU A;  5T1G A;  2HCI A;  4ID6 A;  1CZW A;  5CYU A;  3T53 B;  1Z7T A;  4C3I B;  5IGF A;  1EFI D;  3TBI B;  1Q12 A;  1LV9 A;  4K5W A;  1RF2 D;  1VF7 A;  2BA0 A;  1BCP F;  2NZ1 D;  5C4H A;  2L4N A;  1FYC A;  3S16 B;  4XYO A;  4ILW A;  1QWY A;  3PUW A;  3M85 A;  4G7O C;  5E4X A;  4X3K A;  4A3M B;  3IFD A;  4A3J B;  4PNY A;  2MHV A;  4XT1 B;  2FIN B;  1V1P A;  3HOU B;  1E0B A;  3Q6S A;  4A3D B;  5C4Z A;  2WIN B;  1PRT D;  3CRK C;  2EYJ A;  1GUO A;  1HQM C;  2WB1 B;  3KUP A;  2E76 C;  1VMP A;  2WKC A;  3FEW X;  3D4W A;  2M9V A;  3EQL C;  2Z4H A;  3IFT A;  1EY4 A;  2NVX B;  2F3V A;  1MSH A;  1H9J A;  3S14 B;  3TME A;  1STG A;  4DU9 A;  4DGZ A;  3NQT A;  2E2D C;  5I2X A;  2Z8L A;  3GTL B;  1SFO B;  2XWJ B;  3SK4 A;  2XN9 C;  4KY6 A;  2Q8T A;  3C2P A;  2A68 D;  2OF1 A;  1I4R A;  3BVG A;  3HZX A;  3VYS A;  5G3L D;  1PFM A;  4K8I A;  3VR6 A;  1D6E C;  1W6J A;  1K8O A;  5C5L A;  4WOR A;  1DXM A;  2PCF B;  1CQV A;  2JA7 B;  4LJZ C;  2EJG C;  3HS0 C;  3VYT A;  2SOB A;  5LL6 S;  4TQU S;  3HOY B;  2FMM A;  1TT2 A;  5IGC A;  3ERO A;  3BDC A;  1CQF A;  3K7A B;  2K5W A;  3J80 E;  1DCZ A;  2IWH A;  1MD2 D;  4JK1 C;  3IKJ A;  5EJW A;  1BCP C;  2B2U A;  1BR9 A;  3I90 A;  4FNF A;  3H94 A;  3L9A X;  1B9N A;  2RBM A;  4U67 3;  1DYQ A;  2F4I A;  1AZQ A;  1ILQ A;  2JEB I;  5M9O A;  1DJR D;  1SXT A;  1D5Z C;  2G9H D;  5COR A;  3DWQ A;  5G3L F;  1SNO A;  4RHS A;  4DK1 A;  1ESF A;  1CZG A;  3T16 A;  2K32 A;  2A69 D;  1CK1 A;  1PYW D;  1ESR A;  1LTA D;  1NUC A;  2VUM B;  4KK7 A;  5ELB A;  4O42 A;  1VCI A;  4CJ0 B;  4BY7 B;  4H13 C;  4ULL A;  4ZQ3 A;  3NTI A;  1PDQ A;  3LWU A;  2PMZ B;  2J0T D;  3K5M A;  2B2Y C;  4XDX A;  2JSO A;  4CKC A;  5KIX A;  2D5D A;  3MFG A;  4C3I G;  1ZEQ X;  4O1N A;  1I4G A;  1NSN S;  5IIF A;  4Y7N B;  4DXF A;  2X6L A;  2NYZ D;  2PZU A;  5DAU A;  1GHJ A;  3TP6 A;  1JWM D;  1X3Q A;  3M4Y A;  1WTO A;  1A3V A;  1L0Y B;  3MTS A;  3GTP B;  1BO0 A;  2DY8 A;  4YIJ A;  5NUC A;  4N9P A;  5C0X G;  3TP8 A;  4HED A;  5FO9 B;  5DM6 3;  1EEF D;  4K2K A;  3J7Y W;  4ZRZ A;  2SDF A;  1GUW A;  3S9W A;  2LFN A;  5CV6 A;  5C4J B;  2PZW A;  2DNE A;  4KMU C;  4G57 A;  4IUR A;  2NN6 I;  1WTV A;  4J8Q A;  4IFD I;  3T4A C;  2L55 A;  3FDT A;  2F0N A;  1YNN C;  3GTG B;  4KKT A;  4RWS C;  3V96 A;  3PUX A;  1A2U A;  2F0G A;  1XYI A;  5C0X J;  1RDP D;  5CMD A;  1X32 A;  5M5X B;  5K36 H;  4L63 B;  2RDG A;  2I46 A;  1U4L A;  2L12 A;  2D2C C;  5A2Q E;  3J81 E;  3GO5 A;  4LAA A;  2AWO A;  1ZYR D;  4RKL A;  4TKO B;  4CGY B;  1Q3L A;  4IAL A;  3LX0 A;  2A74 C;  1TKW B;  1STB A;  1J8I A;  5EPK A;  1FNV A;  1I4P A;  4DNR B;  1OXX K;  2NN6 G;  4A3K B;  3C1E A;  4IFD G;  2WII B;  1VF5 C;  3NWT A;  1YNJ C;  4X3U A;  3TSS A;  5FO8 B;  5FK9 C;  3NE5 B;  3K6O A;  5IGE A;  3PO2 B;  2VNU D;  2PZT A;  2AWN A;  4ZK9 B;  1WTQ A;  1WTX A;  4CKB A;  2MJ8 A;  4PMW A;  2O5I C;  3A8J E;  1ML0 D;  5KEE A;  5IGG A;  1TWC B;  1FNU A;  1LTR D;  2KOL A;  5EBD A;  2BA1 A;  2XVS A;  3AB9 A;  2L9H A;  2VXW A;  1E2V A;  2EYL A;  3TDQ A;  4OO1 I;  5DEH A;  2R61 A;  2ZXR A;  5J1Z A;  2B2T C;  4JBW A;  1JOK A;  5BN5 A;  4CJ2 C;  4BWG B;  2V4D A;  3R93 A;  3ITP A;  4FF1 A;  4TSS A;  3OWF A;  5E4W C;  3PV0 A;  4ZUJ A;  3OMC A;  2C5C A;  2RDH A;  1SDF A;  2CW0 D;  4ZAI A;  3MHB A;  1CHP D;  3QOJ A;  4HSP A;  3HOX B;  5COY A;  2JP1 A;  3D8G A;  1RTO A;  2PW5 A;  3OSO A;  4DAV A;  4RGN A;  4CKE A;  2EE1 A;  3I70 A;  2ID0 A;  1SNQ A;  4EQN A;  3ONA B;  2B2V A;  1B44 D;  2KCN A;  3MWY W;  2F0M A;  1CT1 D;  1JQY D;  1SJH D;  4A93 B;  5JEA H;  1BQQ T;  2F0K A;  4HAE A;  3EFX D;  1Q8I A;  3CKI B;  1HFN A;  1U4M A;  3BDL A;  3FRP B;  2L1B A;  1RD9 D;  1JR0 D;  3R2I A;  4R9W A;  1JCK B;  1Y69 U;  1HCZ A;  1SJE D;  2M00 A;  4F7X A;  1F2L A;  3J7A F;  2AQ2 B;  3S2H B;  3G7L A;  5D14 A;  1LTT D;  4ZKC B;  1BCP D;  3D6W A;  5CC4 A;  3HOW B;  3BG3 A;  2BE5 C;  4F8M A;  3JAM E;  5IGB A;  4RKB A;  1LT3 D;  4C3J B;  1S4Z A;  1B3A A;  1T5E A;  1ENC A;  3PMF A;  3M7G A;  4M8A A;  1Y1W B;  3MFY A;  2ZXP A;  2D62 A;  1OXT A;  1TY0 A;  5KYI A;  3MZ5 A;  1Z47 A;  1D2B A;  2Y0S B;  2EYP A;  2NUC A;  4OO1 H;  2A73 B;  1JC7 A;  4A3B B;  4B9W A;  1ZYR C;  3F2U A;  2PPB C;  2KUM A;  1KNE A;  5LHY 1;  1O80 A;  3OHX C;  1DD2 A;  1PZK D;  1RHP A;  3NUC A;  3TP7 A;  5KND A;  1XXG A;  3HKZ B;  3S1Q B;  4QMG A;  2AUK A;  4DF7 A;  2DNC A;  2XRS D;  3NHH A;  2GA4 B;  3CRL C;  1IHZ A;  2A5H A;  3KF8 A;  4V19 0;  1JB3 A;  2XRQ D;  2F3W A;  3ZYY X;  3NPP A;  2HDM A;  4RGM A;  2KHS A;  1B9M A;  2K7V A;  5JPN C;  4CBV A;  1U4R A;  2K5D A;  5CR3 A;  1GUS A;  3FVQ A;  5I4D A;  3VR5 A;  4DAP A;  1PTO B;  1TWG B;  2B2W C;  3A55 A;  3HP3 A;  1EY6 A;  1FR3 A;  3HOV B;  3K5N A;  5KNB A;  1EU4 A;  4IUN A;  1RTN A;  3SDZ A;  3VR2 A;  1S5B D;  4Q5V A;  1BF4 A;  3CQZ B;  4XQQ A;  1Q90 A;  2KQ3 A;  3MC0 B;  2ZT9 C;  4H0L C;  1EWH A;  3URY A;  2QEJ C;  4FVM A;  3BYY B;  3I4M B;  1SYF A;  3VYU A;  1TVX A;  3FMC A;  3G6J B;  4NW2 A;  1YNN D;  1STY A;  2YYZ A;  1EQV A;  4XT3 B;  5D65 A;  3ND8 A;  1STA A;  3S1R B;  5EKK A;  2CW0 C;  1SEB D;  3EVQ A;  1M4V A;  2E2I B;  5I9P A;  4I65 A;  4WFN 3;  1R4P B;  2FFK B;  3E5S A;  3MAQ A;  2NVY B;  2K33 A;  2O2L D;  4FXD A;  4KHV A;  3A7A B;  4QUF A;  1PLF A;  4RGO S;  2XNA C;  4M1U B;  4KY7 A;  2JA8 B;  5J39 A;  4EGV A;  3M7N A;  4P2C B;  1H9S B;  1HHV A;  1E2Z A;  1QCB D;  1KDC A;  2RVL A;  1SYG A;  3BYT B;  4IN3 A;  2F0D A;  2QDB A;  2IJ0 A;  2Z1C A;  3K59 A;  1SNP A;  4KJN A;  3RLF A;  3DHQ A;  4QF4 A;  4IQZ A;  1EZ6 A;  4BA1 I;  3NQI A;  1DZ1 A;  2PW7 A;  3OOC A;  2F0P A;  1TS5 A;  2EY2 A;  1K83 B;  1I6H B;  5JOB A;  1O7Z A;  4J6H A;  1F2M A;  2DY7 A;  2F0I A;  2B39 A;  3KLR A;  5C0X I;  4A3I B;  3OWE B;  1I50 B;  1YNJ D;  4Z9C B;  1F9Q A;  2OXP A;  3K57 A;  2RA4 A;  1CI3 M;  2LS0 1;  4C3J G;  2KEE A;  3X3M A;  1TS4 A;  3DUZ A;  1AFP A;  3QJY A;  2EYO A;  2IX1 A;  4OHJ A;  1I3Q B;  3VA7 A;  2A6H D;  1V1O A;  1TWF B;  1T5X D;  3D4D A;  3R2T A;  4HMI A;  1UAP A;  1G8Z D;  2J4X A;  1GUT A;  1TWH B;  4IUQ A;  3BZD B;  1LTG D;  3GQB A;  4DXG A;  3DWP A;  1JE4 A;  2E75 C;  5T1I A;  3SXH A;  3DM1 A;  5IT9 L;  4KHZ A;  3UI2 A;  2QCP X;  3GTJ B;  3HG9 A;  5I2Y A;  2NB0 A;  4FF3 A;  1PZI D;  1SYB A;  3OW7 A;  3C1F A;  3DXJ C;  1DOL A;  2HQE A;  5FLX L;  2JE6 I;  5ELF A;  3A54 A;  3T51 B;  4S3S A;  1D1I A;  2E2H B;  1ET9 A;  1LAC A;  1MSG A;  3A56 A;  4IUU A;  1KLU D;  4X3T A;  3I4N B;  1HQR D;  2EOT A;  2JA6 B;  2K28 A;  3RZO B;  2JEA I;  2JXM B;  2KEC A;  1SYD A;  5J22 A;  4IUT A;  2YU9 B;  3FPU B;  3N6R A;  2HDL A;  4BA2 I;  2B2U C;  3H0G B;  1HTP A;  5M5Y B;  3D3R A;  1MBY A;  3P7J A;  5BN4 A;  3SK8 A;  3Q22 A;  2D9U A;  3GTK B;  1LTS D;  4HSV A;  5C0X H;  3CHB D;  1F2Z A;  2CVR A;  4DK0 A;  2L5T A;  3VA5 A;  1Q1B A;  4FF2 A;  4H44 C;  5F2D A;  2XSC A;  4NP5 A;  4R8N A;  4DN4 M;  1JOQ A;  1H9M A;  3TP5 A;  2BE5 D;  3RD4 A;  2F1M A;  5D3D A;  3PUZ A;  1OXS C;  5HGT A;  1NR2 A;  1LT6 D;  4B9X A;  1G2S A;  1SNC A;  2F03 A;  2K6A A;  1STN A;  2EJF C;  1RKN A;  1GJX A;  1DOM A;  1SE4 A;  3M4O B;  1OO9 B;  1WTR A;  1SND A;  1ZKO A;  2Q8I B;  2H4O A;  1Q1E A;  2JA5 B;  5D3I B;  2FHT A;  3VR4 A;  1IYU A;  1O7Y A;  3E0J A;  2IX3 A;  1IW7 D;  1SMY C;  2WV6 D;  4RAU C;  5C3W A;  3GV3 A;  1R9T B;  3MXP A;  3SR1 A;  3H91 A;  3QWN A;  3SE0 A;  2E2J B;  4FXK C;  3T56 B;  1Y8N B;  3OMG A;  2N88 A;  1H9K A;  1I4X A;  2C9O A;  5ELE A;  1HRJ A;  2WKD A;  3KBG A;  1B2T A;  3R8B A;  1HA5 A;  5DM7 3;  2AQ3 B;  1SYC A;  5BN3 A;  1PRT B;  1PFB A;  4QB4 A;  3T13 A;  2A6H C;  1S5C D;  1ENF A;  4ODG A;  2NN6 H;  4RFB A;  1ICW A;  1F9R A;  4IFD H;  1IYV A;  3VR3 A;  3FPP A;  1KNA A;  3GTO B;  1X3P A;  3KLS A;  3U9S A;  3MXN A;  1F9P A;  1WD0 A;  1DM0 B;  5EKI A;  4ME5 A;  1JOR A;  2AQ1 B;  3MVV A;  3MA2 B;  5M3F B;  2M2L A;  4HMJ A;  3PIP 3;  4KI0 A;  2SEB D;  4C1N K;  2EY1 A;  2VB3 X;  1Y8P B;  3NBI A;  2B63 B;  2F0S A;  1UEA B;  1EEI D;  3C46 A;  3S15 B;  3LNN A;  1KAA A;  1CA5 A;  1NAP A;  1H9S A;  1KAB A;  4KKU A;  5IOD A;  3RZD B;  2F0F A;  1NR4 A;  3D6C A;  2N55 A;  1ZXT A;  4C2M B;  5CV8 A;  4Q0F A;  1SNM A;  2R93 B;  2KED A;  1B53 A;  2O5J C;  5C4X B;  3BVZ A;  4OIK A;  4HCS A;  4FF4 A;  2XWB B;  4MIU A;  1WTP A;  4ZYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...