1S4ZA

Hp1 chromo shadow domain in complex with pxvxl motif of caf-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
75
structure length
75
Chain Sequence
HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Chromobox protein homolog 1
publication title Structural basis of HP1/PXVXL motif peptide interactions and HP1 localisation to heterochromatin.
pubmed doi rcsb
source organism Mus musculus
total genus 7
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s4zA00
3GV3A 1BO0A 1G2SA 1SSOA 1ILPA 5EKIA 1DOLA 2B2UA 1WTVA 4IURA 1A15A 4ZAIA 2H1EA 4R8IA 2D9UA 3I91A 2X69A 4UAIA 4X3SA 1SAPA 1X3PA 1IKMA 1VMPA 1F2LA 1B4OA 4IUPA 3UI2A 1BF4A 1CA6A 1EL0A 2XIWA 1HHVA 1DONA 5E4WC 2N55A 1QNKA 4MHEA 2K03A 1XYIA 5EPLA 2B2WA 1CA5A 1B2TA 4U68A 2B2VA 1DZ1A 3ONAB 2B2YA 1ML0D 1WTWA 5CMDA 2SDFA 1ESRA 3DEOA 5JJZA 2KEEA 1G2TA 1HFNA 2K1BA 2R3ZA 1HUNA 2FINB 4X3UA 1EOTA 1AZQA 1NR2A 4NW2A 3QO2A 5DNFA 1WD1A 1AP0A 2JYOA 1ICWA 2X6GA 2NWGA 1BNZA 1WD0A 3R93A 1U4MA 4R9WA 2HCCA 2HDLA 2L11A 3MWYW 2Q8RE 4XDXA 4QUCA 1C8CA 3I3CA 1IKLA 3FDTA 3D6WA 1G91A 1G6ZA 1B50A 1U4PA 4ZK9B 2L12A 2KVMA 3SVMA 3F2UA 4ZKCB 1X32A 2DY7A 3TN2A 1RODA 1GUWA 5EPKA 2FFKB 4XT1B 3DM1A 4HAEA 1PFBA 2K05A 5EQ0A 4OIJA 2RA4A 1PDQA 2DY8A 2EOTA 2CVRA 1S4ZA 4RAUC 4CJ0B 3FPUB 3IL8A 1O80A 1XX8A 2RVLA 2KOLA 4IUUA 1U4LA 2B2WC 1DOKA 1MGSA 1KNEA 4DN4M 1JICA 1RTNA 2B2TA 2B2VC 2B2YC 3Q6SA 4QUFA 2HCIA 3N52A 1QG7A 1NAPA 1WTQA 1U4RA 2EPBA 1F9QA 2KEDA 1QE6A 2N88A 1TVXA 1F9SA 2HDMA 2BDNA 2MPMA 1MI2A 3MTSA 1B53A 1WTRA 1X3QA 2JP1A 1AZPA 1HA6A 1IL8A 5E4XA 4RA8A 1HFGA 4XT3B 2B2UC 4CJ2C 5D14A 2IL8A 2M2LA 1O7ZA 1CM9A 1J9OA 1F9RA 3LWEA 4HCSA 1VMCA 4HSVA 1ZXTA 2EE1A 2FHTA 3KUPA 4O42A 1NCVA 4HEDA 1PLFA 2L4NA 1PFMA 1NR4A 1DOMA 1BBXC 5CORA 2FMMA 2NZ1D 4IUQA 2MJ8A 3GV6A 3H91A 1EQTA 1KNAA 4IUVA 2KUMA 2NYZD 3HP3A 4MN3A 5EJWA 1RJTA 2RSNA 4LMQD 4RWSC 1HUMA 1MSGA 3TZDA 1LV9A 1M8AA 1EIHA 2K04A 1WVLA 1RTOA 2B2TC 2MP1A 3I8ZA 4CJ1B 2HUGA 1O7YA 2L9HA 4ZLTF 4IUTA 2X6LA 1RHPA 3G7LA 2FJ2A 5AFWA 1WTOA 5D65A 2K01A 1WTXA 1WTPA 3DEPA 3KBXA 1J8IA 2KECA 2K28A 5CBEE 1PFNA 1Q3LA 4X3KA 1E0BA 2MGSA 5COYA 1SDFA 5CBAE 5T1GA 5EPJA 2J7ZA 1F9PA 1MSHA 3IFDA 2Q8TA 1HRJA 4ZKBB 5T1IA 1ILQA 1EIGA 3I90A 3P7JA 2VXWA 2L1BA 1B3AA 1JE4A 2RSOA 4OIKA 4X3TA
chains in the Genus database with same CATH superfamily
2JJQA 4L8JA 1AE2A 1I4GA 4DXFA 4RGMA 4DNIA 4YWLA 2JA8H 3GDEA 3NE5B 4APVA 3L9AX 2IT1A 1Y1WG 3GTMH 2EIFA 2N55A 2B3GA 2JQOA 1PTOB 3S2HB 1ICFB 3I70A 4LF4Q 2NVXH 4DU9A 1I50B 2F03A 1DZ1A 3U58A 2R61A 3U4VA 4XQNA 1ESRA 4IPHA 4A93B 3KYHC 2WACA 2ZXRA 3BU2A 4A3EG 1ICWA 2AUKA 2ZXPA 4QQBX 5E3FA 3AFQA 4ILWA 4OO1G 4FXGC 4DR4L 1BBUA 3FVQA 1X6OA 1B50A 1U4PA 1B7YB 2EJGC 1PVOA 5CV9A 3E0JA 1PTOF 2QILA 1Q8KA 3F8TA 4KJNA 4RFBA 4JOIA 4XT1B 3S14B 4X65Q 5IYCH 4DR7L 3OMGA 2M9VA 3C3LA 1GXDC 4RAUC 1LTSD 5LMUL 1SYFA 1CKNA 2QDLA 1UE7A 4DV6L 1RL2A 1A8VA 2CW0C 1YNJC 5GQOA 1MGSA 4DN4M 1PTOH 3S2HH 3QJYA 3NWSA 4JI6Q 1SNOA 1N36L 3MZ5A 3OW7A 1I50H 1PHJA 2UU9Q 3J81L 1WTQA 1SJED 2D62A 5DAUA 4P2CB 5KEEA 4NXMQ 1TVXA 3I56A 1I6VC 1II3A 4A93H 3U4ZA 4K14A 2BE5D 2VUMG 3KF6B 1WTRA 1B44D 1X3QA 1TWCB 3DHQA 4IJLA 3RN5A 1KTKA 2WAQE 3V2TA 1Q7YC 1AE3A 2JA8G 1E3PA 1F9RA 1JORA 1RKNA 1SN8A 5FK9C 4B3RL 2UXDL 4PZ8A 1SBBB 1QNUA 2L5TA 4UY8C 2MQHA 1NR4A 2ZTDA 5KNCA 3RN2A 5CORA 1GUSA 2NZ1D 1IW7D 5FLXL 4B9XA 1FYCA 3S14H 1FL0A 4OGQC 4X64Q 3C1FA 4DK3C 3SR1A 4E6IA 2N8NA 3I8ZA 4CJ1B 4YHHL 2L9HA 2XWBB 2EJMA 3G7LA 3A7LA 3GTLB 1J8IA 3KBXA 2N49A 1NMGA 4OEMB 1TR5A 3T53B 1CFMA 1NJIC 1FNVA 3KLWA 1EIGA 2XWJB 3AU7A 3URYA 1TWCH 1JE5A 1YNND 5ELFA 3FRPB 1WYDA 1L1OC 5M5YB 5IYCG 1WTVA 3TRZA 5AJ3L 1FD7D 2K5QA 3UDXA 4L63B 1YBYA 3TZUA 4HJAA 2NB0A 4DUZQ 4HJ8A 4A3MB 3EBEA 4LF9Q 2B2YA 1BCPD 4A93G 4DAMA 5LMNQ 5JJIA 4HIMA 1SROA 1NR2A 5DNFA 4P73A 1NTGA 1L0WA 5IT9E 3GTLH 1V43A 3T51B 1GVPA 1VS0A 5M3MH 1CQVA 4JI8Q 4X62Q 4DR1Q 3J81c 3HEJA 3ZJYC 3I4OA 3P1HA 1GUWA 3MC0B 1YJWA 4BXXH 4GNXC 3S1RB 3X3MA 4LFCQ 1BXTA 4BA1I 2JA9A 3CRKC 2BCOA 4IUUA 4B3TL 1OXSC 2B2TA 1MHWC 2F0KA 4A3MH 2WKCA 4L5QA 3Q22A 3PSIA 1OTCA 3CCUA 4QCLA 4R4CA 4DV2L 1JMCA 1VDZA 4A3GB 1AZPA 5C44H 3HOUB 3AB9A 1IL8A 1C48A 2IHEA 1PXUA 3MXNA 3LWEA 4BY7B 4K6LA 4JPBW 4G7HC 5FO9B 4ABNA 1ENCA 3CMAA 4JBKA 4JYAL 4KKUA 3RLOA 1KRSA 4EVOA 4KY6A 4DR5L 4GKKQ 4RGNA 2NYZD 3S1RH 3TDQA 3TZDA 4L5RC 1HNXQ 4GNXA 2ZM6Q 2KHJA 3MFGA 3MHBA 2GVAA 3ERSX 2IPKD 1GO3E 3PMFA 3WDNA 3J7A5 2JK8A 1JB3A 2ZTEA 2ATWA 3Q8DA 2J7ZA 1E2VA 1EY5A 1HXYD 4POFA 3E9IA 4A3GH 4B3ML 1IBLL 4OELB 1IHZA 1B3AA 2PZWA 2RSOA 4BXXG 4IOCA 1NMFA 4JI4Q 4FXDA 4BY7H 4R8IA 3I91A 4KD3A 3CKIB 3Q24A 4GOPC 2JA5B 1WI5A 4DPGA 1BQQT 1B3QA 5E1FA 5BN4A 2OT2A 4A3MG 1HNZL 3BVGA 4YIJA 5IT9L 1D6EC 1X3GA 3HOWB 1CSPA 4DK1A 2R7ZB 2KEEA 3NBHB 4XXEA 1CKMA 3TP7A 3LGJA 1UNSA 4EQPA 2PNHA 4YCVA 5JPMC 1Q12A 3TBIB 5H1SE 2L11A 3MWYW 3SK8A 4DGZA 1A3UA 1L2FA 2KVMA 4MIUA 1XPUA 1PRTC 3E3XA 1H9JA 4IPGA 4A3IB 4L5TA 1HZ9A 4HAEA 3J7ZC 4OIJA 4LF7L 2OXPA 3J80E 1JB7A 2JA5H 2RHSB 4GOPA 3CF5A 1XXGA 2B2WC 2N3SA 3V05A 3BZCA 5KYLA 1XPOA 4ZCKA 3DWQA 3RZDB 1QVFA 2OTLA 3BVMA 1WTHA 2G5DA 1BCPF 4LFBL 2E76C 3MFYA 3HOWH 1SFOB 2R7ZH 2N88A 4A3GG 1FJGL 2PO4A 2EYPA 3JC66 1EFWA 1N34L 2A6EC 1C9OA 2PZUA 3QG1A 4BY7G 1F2ZA 1MD2D 3ULLA 2OEOA 1A2UA 2FHTA 4XYOA 4OO1I 1K8OA 4O42A 2E75C 4WFN3 2FMCA 2UUAL 2PQEA 2NVQB 2SEBD 4DV1Q 1YVCA 1QUQB 3CCMA 1M8AA 1EIHA 4P72A 4ZUIA 2JEBI 5AFWA 2K01A 2KECA 4K8IA 5GROA 2WINB 1IBKL 3OOCA 5IGCA 1EU3A 1KQSA 3K5NA 1H9RA 3OIQA 4FF1A 1ILQA 3GTJB 2RF4A 1VQFA 4K6DA 2Q2IA 4DR3Q 2EXZA 2D9UA 4LFAQ 2JA5G 1GHKA 1S3OA 1O7IA 3HOZH 1ET6A 2K5DA 3DWPA 2OCEA 3W5OA 3M3YH 1KDBA 1QNKA 4MHEA 1I3QB 3PIO3 2CH4A 2NVQH 3W1BA 1VQDA 2HT1A 3HOWG 1H9KA 1Z47A 2R7ZG 5CMDA 2LFNA 1EIFA 4X3UA 4HCEA 1WD1A 3P20A 5FOBB 3CC4A 3AYHB 1CHQD 2EZVA 2A69C 2Z9HA 5IP9H 2YU9B 3RUZA 3G6JB 1G6ZA 1TKWB 1LT5D 2MHVA 2DY7A 3AFPA 3I72A 5A35A 1BBWA 1TWFB 2UUCQ 4L5SA 1L1OB 3CU7A 1STAA 2I5HA 4CJ0B 1D2BA 4HR7B 2LXKA 4JI3Q 4XYQA 3WWVA 1I3QH 2G9HD 2Q2TA 3S16B 1SEBD 2H4OA 1SYEA 1VQ9A 4TQUS 4KN4C 1C0AA 2ZTCA 1S5CD 2CFMA 5E4XA 3W2DA 2M2LA 1O7ZA 2K5HA 1VQPA 2XN9C 3HOZG 2I0QA 1KLGD 3RZOB 4YCWA 4JI1Q 1G6PA 3X3NA 1NCVA 4HEDA 3E0EA 1WFQA 3S9WA 2XGTA 4IUVA 4DV5L 3PGZA 3HP3A 3M7GA 2V4DA 1EIYB 1EQVA 1WVLA 1TY2A 4AQYQ 3S2DB 1A3VA 2F0UA 2HUGA 4ZLTF 4LJZC 4JI2Q 5CV4A 3V96A 3KF6A 1RHPA 4BY1B 1EQQA 4DNTB 3S16H 5GAGC 1T5EA 4IO9A 1LTGD 4J1MA 4A3FH 1SRUA 3CAMA 5T1GA 3J7AV 4DV4L 4G7OC 2AWOA 3S1NB 2VZAA 4GN4B 4IFDH 4A3DB 1ASZA 1ILPA 1UEAB 3PF4A 4GKJL 3ND9A 1K73C 4OWXB 1EY0A 3QOLA 1GKHA 1CA6A 4HIDA 1EL0A 3J80c 3KLSA 2XTIA 5C5LA 5D3DA 3NXWA 4H7BA 1BVSA 3NTIA 1JJ2A 1VQ8A 4LUZA 4LUOA 3OW2A 1B2TA 1YHBA 2KHSA 4ZUJA 3DWAA 3K8AA 1GUOA 1GUNA 4BY1H 1HNWL 3I73A 2HCCA 5A2QE 3NTHA 5CGKA 1ENAA 1VQCA 3S1NH 1IKLA 2F4VL 1Y1WB 4A3DH 4KMUC 1NY4A 3F2BA 3UE1A 3BYYB 1EQRA 1AH9A 1HTLD 3BG3A 1A63A 5IWAQ 3BDLA 3RR5A 1EY9A 4K5WA 4A3EB 4XTCS 1CK1A 3FKIB 3RD4A 4A3FG 2BE5C 3NWTA 1Q82C 3K5OA 3OWEB 2BDNA 1SYCA 1CTMA 1MI2A 4OX9Q 4IFDG 3CRLC 1KL9A 1ZYRD 2LXJA 4I65A 2CKZB 3NQIA 1STEA 4DR6L 1Y8PB 3ULPA 4HCSA 1FR3A 4K8JA 2MNAA 1IW7C 2A73B 3UE0A 1FGBD 1X56A 2UUBQ 5EKLA 2M00A 1C4QA 3C1EA 3VR5A 3TS0A 5KGUA 1J5EQ 4MN3A 1PRTB 5ELCA 3CCVA 1HUMA 1LV9A 2F0EA 4UPAA 4TKOB 2MP1A 4BY1G 1EUJA 1RCVD 2HHHL 2F0SA 3FKIH 4A76A 1QVGA 3VR4A 1N33Q 1YNNC 2JA8B 1F9PA 1IL2A 4DV0Q 2AKWB 3CCSA 5FJ8H 4A3DG 4EQNA 2QW7A 1V1PB 4P71A 3H09A 4X3TA 1HH2P 2TSSA 3W3AA 2K52A 3TQYA 2H1EA 4RHSA 1O7LA 5IGEA 4JBJA 1X54A 2F0WA 5IGFA 3T1YL 4ME3A 3H6MA 1BCPC 2Y0SB 5FLXE 4C3JB 3CC2A 2B2VA 3D31A 4WJ4A 5A2QL 4X66Q 4IUNA 1N9WA 4HMJA 3HS0C 3KDFA 2NWGA 1UE6A 2YV5A 1TXYA 3DUZA 5HGQA 5NUCA 1DXMA 5JAVA 3BYTB 1NUCA 4QUCA 2VQEL 1I94Q 1VQ7A 2EQSA 3PIOA 4JCVE 1PH5A 2E5LQ 3D6WA 1HR0L 2Q2UA 1X32A 1WCMB 4NP5A 1K3BC 1PMRA 4GN5A 5KNDA 5EQ0A 2YTXA 4H0LC 2C35B 1MIUA 1KRTA 3TMEA 2RA4A 1S4ZA 3T1HQ 3FPUB 4R4TA 2CQAA 3NBHA 1E1OA 5J22A 4LF4L 3A8KE 4DUYQ 4C3JH 3FKIG 1Y69U 3BJUA 1U9RA 5CV5A 1R9TB 3E6ZX 3VR3A 3L0OA 4RCOA 1B9NA 2LS01 4IPDA 1S40A 1EYAA 2Z6BA 5FJ8G 1W2BA 1Q81C 3S17B 2D5DA 3K0YA 3OSOA 3DM3A 4DAVA 1J9OA 5ELNA 1VQLA 1SNMA 1D1IA 3K7AH 1H9MA 1EWCA 1CT1D 1EZ8A 4DR4Q 2XNAC 1PLFA 1PFMA 1WCMH 4N9TA 4M1UB 5C6AA 2IWHA 4H13C 4X65L 1DCZA 2NUCA 2QCPX 5EJWA 1E2WA 4GZYC 1K0SA 1A3TA 2O5IC 1TS5A 3OYYA 2CH4W 2K04A 4NMZA 1VQAA 3M7NA 1O7YA 4JI6L 1WTOA 3UDGA 3S15B 4NXML 4X3KA 2MGSA 1R9TH 4MTNA 1B9MA 1EY6A 1VQGA 5IGBA 2BOSA 3S17H 2RDFA 1U0LA 1R4QB 3TSSA 2B63B 1LACA 1TQOA 2F0HA 2LMCB 2MO0A 1RIPA 1VF7A 1JCKB 3ER0A 2JE6I 1TT2A 4BBSB 1QUQA 4B3RQ 2BA1A 3JAMi 2UXDQ 1PH3A 2EY6A 1HHVA 1JT8A 4C3JG 2Y0SG 4JI7Q 5K5PA 3T13A 4U68A 4B08A 5M3MB 3C2PA 2BA0A 1LT4D 3CMEA 1YHAA 4JI0Q 1STNA 4FYDA 2BH8A 4YHHQ 1KABA 2F3VA 3S15H 4JV5Q 3NQTA 3CCRA 1UUPA 2BDOA 4F87A 3FDTA 2JXMB 1WCMG 2L12A 3BDOA 3VA5A 2B63H 4R1JA 4KHVA 5EPKA 1DJRD 2VS1A 2Z6KC 1QILA 4BBSH 4DUZL 1PYSB 1VQEA 1RD9D 4PZ6A 1E7ZA 5G3LF 4IFDJ 2A68D 4LF9L 5C44B 3STBD 4QUFA 2WIIB 2O4XA 1LO5D 3OTOL 2I5LX 2KCCA 3GD7A 5LMNL 2A6HD 2K50A 2G9DA 2AUJD 3C46A 4JI8L 1BKBA 4X62L 1AEXA 1NE3A 3CQZB 2SOBA 3SK6A 1L1OA 1VMCA 4HSVA 1ZXTA 3EFXD 4HSPA 5C3WA 4NXNL 3T4AC 1XNRQ 4HIKA 2MO1A 2E74C 3KJPA 3U9SA 5JPNC 2QEJC 5C4JH 4MTKA 1PZID 2MJ8A 1KNAA 5FLXc 1G8ZD 3SXHA 2E2IB 2O5JC 3P75A 4G57A 2NZOA 3PO2B 1PH1A 2FJ2A 4B3TQ 2VB2X 2IW3A 3PUZA 1X55A 4P75A 3PCOB 5CBAE 3PQIA 4RHRA 1NBWA 2Z8LA 3CW2C 1YJNA 4LAAA 4GS3A 2B63G 3MXPA 2IY5B 3PIPA 4A75A 3CQZH 3A7AB 4NB3A 1PH6A 1L0YB 4BBSG 4NKLA 4FF3A 5ELEA 1B4OA 5JJLA 4GKKL 4CKEA 3GTKB 3NSWA 1KD1C 3K5LA 3FMCA 4JBWA 1EWHA 5I9PA 4JYAQ 5EPLA 1V9PA 1CA5A 1HNXL 2D2CC 5M3MG 2ZM6L 4FNFA 1VQMA 2B29A 2EYHA 1K0RA 4LF6Q 2EYFA 1PH8A 2E2IH 4A3JB 5KYIA 5FLMH 3PO2H 3I4LA 1LM0A 1OXVA 4DV7L 3KDFB 4N8FA 1WD0A 1JOKA 3KK7A 4I7ZC 3M4OH 2F1MA 2PMZB 4XDXA 1ASYA 2Y0SE 2JA6B 3D4RA 1SNCA 1DGSA 4IJHA 1CSQA 1YNXA 3AMUA 1EOVA 3EN2A 1N32Q 4N8X1 4U673 1OO9B 3GTKH 5C44G 3VYTA 4AYBB 1E2ZA 1E22A 1YHQA 4DNRB 5IYDH 5C0XH 1BCPB 4KHPQ 1VQHA 2KEDA 1QE6A 2HDMA 4IPCA 4A3JH 2JP1A 4GN3B 1SMYC 4XT3B 4HJ9A 4WJWA 3ICEA 1D8LA 1CM9A 1D7QA 1TS2A 3K80C 3KFUA 4JW0A 3R2TA 4ZQ3A 2GN5A 1PFSA 2PQAA 5BN3A 2JA6H 1EYDA 3JAML 3J81j 2K7VA 2JEAI 2KCTA 1I4RA 4NPSA 2IX3A 3GV6A 4FDBA 4B9WA 1GHJA 4TRDA 4ODGA 4B3SQ 3I4MH 4LF7Q 3M4YA 3H3VC 5FLMG 3PO2G 2A1AA 5J39A 2X6LA 3MA2B 2ICIA 4DV3Q 2ICEC 3OMCA 2KCNA 5IP7H 1E0BA 4AH6A 3A8JE 4RGOS 4J6HA 2WFWA 3HOZB 3G48A 3NK9A 4FVMA 1FJGQ 1O78A 1WOCA 4UP9A 1JE4A 3M3YB 1Z6HA 4GLXA 1SNPA 3MEFA 4J8QA 3VYRA 3HKZB 2F0VA 3NHHA 4IURA 2ES2A 4UAIA 3F2CA 1VMPA 1F2LA 1BF4A 4IUPA 1UE5A 2I07B 1QWYA 5IYDG 4G7ZC 1IXRA 4O1NA 2B2WA 5C0XG 2RKSA 5IT9c 5JJZA 4A3JG 4FO2A 1Q8IA 1I5FA 4OONA 5FO7B 2JYOA 1V1PA 3R93A 1WJJA 1PYBA 1XMOQ 2JA6G 3I3CA 2MUYA 3H0GH 2Q8IB 4QMGA 2F0MA 4DR3L 5ELBA 1Q90A 4LFAL 5DM73 4NDXA 3B6YA 3I4MG 4LUVA 4LWCA 1O80A 2RVLA 2WP8J 2KOLA 4RKBA 3HOVB 1DOKA 4AYBG 1JICA 1LTID 5IP7G 4MNOA 2RCFA 3SHLA 1TU2B 3KF8B 3PUWA 4JI5L 5I6WA 4XQJA 1AN8A 1PH9A 1ONLA 4M8AA 4F88A 5C3XA 1SMXA 3J7YW 4RA8A 1YITA 2B2UC 4CJ2C 3Q23A 1H95A 3KLRA 2DJGC 5KIXA 1YI2A 1I6HB 2RQXA 3LX0A 5I2XA 2CCZA 4LF8Q 3OIPA 3K6OA 2UUCL 4IUQA 1V1OA 1EQTA 1HPCA 2PNRC 4IALA 4LW1A 2IJ0A 5EKKA 4ID6A 2ZJQA 4JI3L 4A3FB 1UE1A 2EXDA 5CV6A 3HOVH 1VQJA 1UEBA 3GO5A 3S1MB 3EIVA 1XJVA 4DK0A 1KAWA 1J6QA 5CYUA 3BS1A 5IODA 4Z9CB 2EY5A 3IFDA 1MSHA 2Q8TA 3H0GG 3R8BA 2UXCL 1YJ9A 2EY2A 4CKCA 3I7FA 5J3BA 3D8GA 4OIKA 2Z4HA 1SXTA 3HKZG 4UP7A 1DOLA 2B2UA 2F3WA 5IGDA 2QF7A 2CWAA 4LF5L 1I6HH 1GOZA 3K59A 3CHBD 5FO8B 1XPRA 1ZEQX 2P5ZX 4DV5Q 3EVQA 4AQYL 2TMPA 3A56A 2SDFA 1HFNA 5IP9G 3S1MH 1YIJA 1GJXA 1U5KA 1XNQQ 3QR8A 1KLUD 3L7ZC 4Y52H 5TSSA 3SK4A 4FF4A 4IZ8A 1D1KA 1STBA 5KRUA 4JK1C 4OWWB 5BR8Q 3VA7A 1VQNA 1G91A 3HOXB 4K0KL 1RODA 2MFIA 4ULLA 2A74C 5D3IB 5IOCA 4A4IA 1LABA 3RMHA 2GVBA 3HOVG 3AEVA 1XX8A 2HIVA 1VQKA 3A0JA 2K5VA 2PMZE 1KNEA 3Q6SA 3N52A 3KJOA 2B8FA 4KKTA 1KHIA 5DM63 4RKLA 1YEZA 1IBMQ 1B53A 1HA6A 1JJGA 2XSCA 2J0TD 4HJ5A 1L0XB 4PQXA 2XRQD 3J81i 1D5ZC 2EE1A 3MVVA 4AYBE 4R4IA 5F2DA 1IYUA 2PQAB 4KY5A 2DUDA 3HOXH 1CZWA 3A5UA 5DEHA 2F4VQ 5HURA 1PTOD 1ZKOA 1JOQA 2RSNA 1UAPA 5M5XH 3UDIA 3A5ZB 4L6TB 3I55A 1LYLA 2N78A 1VQ5A 5IWAL 2EYOA 1G51A 2EJFC 5D65A 1XMQQ 1Y8NB 4YY3Q 3NPPA 3CP0A 4I7AA 3GTPB 5COYA 3QB3A 4JBMA 4CHTB 1HRJA 1XWEA 3MXGA 4K2LA 3I90A 2NVYH 3NP8A 1KAAA 1D5MC 1BO0A 1W6JA 5C0XJ 2VQFL 4ZAIA 1X3FA 3NELA 4S3SA 5M9OA 1H9SB 3SE0A 3PUVA 2UUBL 1IKMA 4CKBA 4DR2Q 2XIWA 5E4WC 4H02A 2V1CC 1C7YA 2RHQB 3ZYYX 4EX5A 1X65A 3D6CA 4ZRZA 2PW5A 3SEBA 3L3OC 1B1ZA 3ONAB 3A55A 4WJ3M 1F2YA 1G2TA 4G4KA 5BN5A 3HKZE 3Q0AA 4RG1A 1AP0A 4KKSA 5ELDA 2F3IA 4RH6A 2L15A 2AHOB 4DV0L 3GTPH 5EAYA 5JVG3 2E8GA 4QGUA 1A6XA 1EY7A 3HOXG 2IX0A 2E2HB 4H44C 4K5VA 1YZ6A 3NBIA 2VNUD 3TN2A 2WKDA 4KTAA 2FFKB 5HGTA 2J4XA 2DN8A 5M5WB 5LHY1 2A68C 2KQ3A 1OXXK 3STBC 3VR6A 2F0PA 2JA7B 1E1TA 3CD6A 2DNCA 3KOJA 4UDUC 1RTNA 2A6HC 2A8VA 4DXGA 5C0XI 1HZBA 1GUGA 4X66L 1U4RA 2UXBL 2K75A 3K7AB 1F9SA 4K5XA 2KENA 4DA2A 3MTSA 5I2YA 2LKVA 1I4QA 3H3VH 4DK6C 1Y1VB 4YWMA 5JEAH 2IL8A 2JN4A 1W6KA 1Y14B 4A3KB 5I9OA 3RLNA 1I94L 2E5LL 4F7XA 1HZCA 2VQEQ 2E2HH 2VUMH 3SK5A 4WORA 3GTGB 4DAYB 1MKHA 4C2MB 3T1HL 3TS2A 2KUMA 4HN7A 5M5WH 4EQ5A 3EQLC 1MSGA 1K8MA 1QOHA 2JA7H 3DMUA 4UP8A 4DUYL 4IUTA 2F0IA 1QJOA 1JC7A 2QKIC 2NN6H 3HOYB 4BS9A 4CDDC 3TP6A 1PFNA 2WV6D 3IFTA 1HZAA 1SDFA 3CXCA 1Q46A 3DLLA 3O13A 2O2LD 3IKJA 3VYUA 1SJHD 1LLRD 1STYA 4FF2A 1Y1VH 4PV1C 1LTTD 3M4QA 1G2SA 2RCNA 2F52A 2ALYB 4A3KH 1SNQA 2X69A 1KDCA 4DR7Q 3ERQA 4AIMA 4OHJA 5CV7A 5LMUQ 3PV0A 3GTGH 4DV6Q 4C2MH 2KCMA 1S5DD 2UU9L 3OPOA 2F0DA 2C9OA 1LUZA 1N36Q 5CC4A 3K7UC 1CZGA 1A2TA 2Z4IA 1K8GA 1D5XC 3S1QB 5JEAG 3K81C 3HOYH 2EVBA 1VQ6A 3FEWX 1SE2A 3RNUA 1R4PB 1SYBA 3DXJC 2VL6A 1Z7TA 1EEID 4LNQA 5M3FB 3DM1A 2K05A 3PF5A 2OQ0A 1AFPA 3NUCA 4X64L 4V0BA 1PDQA 3QIAA 3VYSA 3PUYA 4QL5A 2JA7G 3HZXA 4Q5VA 4JI7L 1OXTA 4V190 4CBVA 3QWNA 2NN6G 2B2YC 3OWFA 1QZHA 1X9NA 3K57A 2B8GA 2EYLA 3D3RA 4JI0L 1E24A 2PPBC 4QJFA 2RBMA 1Y1VG 1SYDA 4QY7A 3IAYA 3S1QH 3BZDB 4JV5L 1BDOA 2C5CA 5C4JB 5LL6X 4A3KG 1S5FD 1BOSA 4HTHA 3FHWA 2R7FA 5AJ3Q 4PZ7A 2L4NA 3M4PA 1TWHB 4A3CH 1PH2A 5HY6A 5M3FH 1VQBA 2AMCB 3KF8A 1UWVA 2DNEA 2DJFC 3A54A 5IIFA 2D0PA 5EBDA 2RDGA 2B2TC 5JVH3 1PH4A 2F0QA 3FPPA 3MEHA 1STGA 1TY0A 4BA2I 3HOYG 4DR1L 1KDAA 1Q3LA 1GM5A 4KN7C 3OTOQ 1TIID 3CCLA 5J1ZA 4C3IB 5I6YA 2OF1A 1A0IA 2RDHA 1SNDA 5EBCA 2PI2E 4R8NA 1EYGA 5EKIA 4LFCL 4QF4A 4X3SA 4DFAA 2ZJRA 1XNRL 1X3PA 2EYMA 4C3HB 1QB5D 3JAME 1OXUA 2Z6KA 4NXNQ 1JOOA 3OHXC 1TWAB 1JR0D 1K28A 1TWHH 5M5YH 1XYIA 5EGTA 2K32A 4YWKA 4PNYA 5JOBA 3G4SA 4QB4A 2DGYA 2ZJPA 5ISRA 3M4OB 4KHZA 1QCBD 5C4ZA 2H5XA 4IOAA 3WOEA 1S72A 4DV2Q 1AW7A 1EOTA 1GD7A 1AZQA 4HJ7A 3PO3B 3RLFA 5I4DA 4C1NK 4IFDI 4R9WA 4ME5A 3H94A 4OWTB 1M1KC 2QGQA 1EY4A 4C3IH 1FNWA 3CC7A 4ZK9B 3HG9A 4A3CG 1QZGA 4ZKCB 2F0OA 5M3FG 1Q1EA 4DAPA 4DR5Q 1ENFA 3J80i 3IL8A 4C3HH 2PW7A 1TWAH 4EQOA 2XVSA 2NZHA 1NAPA 4RGTA 2CW0D 1YNJD 4LF6L 1PYWD 2EPBA 3HGBA 4CDEC 5C3EB 5JJKA 3VR2A 2PYKA 4Y7NB 1KIXA 1Z9FA 4POGA 1HFGA 2F4IA 4EGVA 3VDYA 3PO3H 4B3MQ 4JI4L 3TEHB 4DV7Q 1IBLQ 2QEXA 1CUKA 2OTJA 3F2DA 2SNMA 3I4MB 1SLJA 1ESFA 2OQKA 3HOUH 2HQLA 2QDBA 3QOJA 1V1QA 3H91A 1NNXA 1HNZQ 1A62A 1N32L 1LT3D 4LMQD 3FP9A 3GTOB 3CCQA 4R4OA 2R92B 2SNSA 1VCIA 5IY0A 4OXPA 4KHPL 5CBEE 2IX1A 3K58A 3N6RA 2E2JB 1JJCB 5C3EH 2B39A 2WB1B 3AQQA 4C3IG 4Y7NH 3GQBA 1F2MA 3M85A 1HJPA 1LTAD 3ND8A 1CKOA 1EYCA 2I46A 3NEMA 4FP5D 3M9BA 1JWMD 4C3HG 2ID0A 1RDPD 2A5HA 2Q2HA 1XTDA 2PI2A 3UI2A 1DONA 2F0NA 2K03A 1MJCA 5JEAJ 3G71A 3TREA 4TSSA 4B3SL 3IRBA 3I2ZA 3GTOH 1HCZA 1CKNB 4ALPA 1T9HA 2R92H 4LFBQ 4DV3L 3BDCA 3H0GB 3PO3G 2NBFA 2PZTA 2EDGA 3CPFA 1TS3A 1N34Q 3LNNA 4KLKA 2E2JH 1H9SA 4CDCC 3HOUG 1LT6D 3D4WA 2HQEA 4DV1L 1P8LA 2CWPA 2UUAQ 1JQYD 1GUTA 5GAHC 4GLVB 3S24A 2K5WA 1HR0W 3U9OA 3D4DA 4IN3A 4WRDA 4DF7A 4A3IH 1MBYA 1STHA 2K4KA 1EFID 1QG7A 2GA4B 3PUXA 5C3EG 1HTPA 2KJXA 3SGIA 1IBKQ 3HFZB 3K5MA 3CCEA 1TS4A 2NVTB 3H3VI 4RMFA 1G291 3RZDH 2Z1CA 5D14A 3ULJA 1XMOL 3D0FA 1VQOA 1FVIA 4RCNA 1SFOH 2R7DA 4IQZA 1QVCA 1TWGB 4QIWB 3BVZA 1SE8A 2D0OA 2QA4A 1PTOC 2CHBD 3JAMc 1ET9A 3KLSX 3A74A 5C5MA 1DD2A 5CR3A 3EA6A 2VW9A 1LTBD 3CPWA 1RJTA 5K36H 2R92G 4PMWA 1ZYRC 2F0TA 3F1ZA 3A8IE 2NN6I 1WTPA 1LTLA 4A3BB 2I5MX 1MJEA 1HQRD 2WB1G 4R4QA 5EPJA 2R93B 4JI5Q 4XIGS 3P7JA 2NVTH 2VXWA 1CI3M 4DKAC 1KC8C 1M4VA 4DAYA 1M90C 1SSOA 5GAEC 4FXKC 1TWGH 4LF8L 3J80L 4MZ9A 3GTJH 1JWUD 3T16A 4A3IG 1CHPD 5CV8A 5LL6S 2AQ1B 1Q1BA 4CGYB 3TP8A 1VQIA 2ASBA 1ML0D 2L55A 2K6AA 3DEOA 3HRZC 2K1BA 3WOFA 3L2PA 2Z0SA 2FINB 1FGUA 4A3LH 4HIOA 4NW2A 1EWIA 2X6GA 2L0CA 1KXLA 1U4MA 4A3BH 1I4XA 3K0XA 2VB3X 1NSNS 4KV6A 4PG3A 2Q8RE 1BR9A 4JI1L 2R93H 2AQ3B 5GADC 3UDFA 2K33A 2UXCQ 3F2UA 3G6EA 1K83B 4C56C 3EJIA 1PA6A 3MXNB 1PZKD 5KNBA 5K36G 1SMYD 2DY8A 2CVRA 1PRTD 2YU9H 1IYVA 2WAQB 2NTTA 4LF5Q 4JI2L 1U4LA 2EYJA 2K14A 1TWFH 5C4XB 2HCIA 4JC0A 4YCUA 3KBGA 4BBRB 4GNXB 1S5ED 1XNQL 4DV4Q 1BUVT 2NTSA 1DM0B 4GLAC 5LMNW 5BR8L 1IYJB 3U50C 3I4NB 2A6ED 5M5XB 4GKJQ 1HA5A 3E9HA 3ITPA 4X6AH 1K83H 2K5NA 4JVZA 4K0KQ 2YYZA 5IE8A 4N9PA 3RZOH 4KD4A 1RTOA 3LWUA 4A3LG 2HD3A 4PMBA 3J7AF 3T56B 2NVYB 4BWGB 1IZ6A 1WTXA 4KJOA 3SDZA 5C4XH 4A3BG 1HNWQ 2K28A 2KHIA 3HKSA 2R93G 3NTKA 4BBRH 1IBML 2F0FA 4P74A 1W3SA 3S2DH 1PV4A 4HMIA 1K8AC 1SE3A 3BZKA 2CQOA 3GV3A 1PZJD 2ENBA 1A15A 1I4PA 2PCFB 1SAPA 2VY3A 4KY7A 3I4NH 2KA7A 1EU4A 4F8MA 3GP7A 2WB1E 3GTQB 4PMCA 4O2DA 4J15A 5FKAC 1SE4A 3MXUA 4O0AA 3H15A 1EEFD 1WTWA 3R2IA 1FNUA 2ZXOA 5E7NA 2YTVA 4GOPB 4OX9L 5ELOA 1X3EA 2R3ZA 5IYBH 4Q0FA 1HUNA 2HIXA 1XMQL 4YY3L 4TVAB 3QO2A 2AQ2B 2F0JA 2JSOA 1S5BD 1BNZA 1CQFA 3NENA 2OWOA 2HDLA 1K9MC 1C8CA 4DR6Q 2F0GA 4UHVA 4KI0A 1EZ6A 4K2KA 3SVMA 1VQ4A 1RF2D 1J5EL 1SYGA 2AWNA 2A69D 1N8RC 4XQQA 1PFBA 1V8QA 4DR2L 1HQMC 3TP5A 2EOTA 1XTCD 2XRSD 1T5XD 2YTYA 2WAQG 2ZT9C 2VQFQ 1JWSD 1SR3A 1DYQA 1Y1WH 2B2VC 5C4XG 3R3OA 3GTQH 1K3RA 1Q86C 2HHHQ 1N33L 4BBRG 3PIP3 4LK1C 2LSSA 1F9QA 2A19A 3EROA 2MPMA 2EY1A 1EY8A 2VUMB 4A3EH 3E5SA 3J81E 4JG2A 3I4NG 3MAQA 1B70B 5C4HA 4OO1H 2E2DC 3KUPA 4KK7A 1B8AA 3GTMB 1DOMA 1BBXC 1F77A 2FMMA 2LY7A 1LTRD 2NVXB 3T1YQ 1VF5C 2IHFA 1PRTF 4RWSC 1I4HA 5DLQE 5IYBG 4OL7A 1P16A 2FXQA 1Y8OB 3W1GA 5G3LD 4QIWE 3CCJA 3DEPA 1PH7A 5IGGA 2R6GA 4CDFC 4ZKBB 2KBNA 2UXBQ 5T1IA 4C1NI 2BH2A 4ZYSA 2L1BA 2F0LA 5L37A 1HR0Q 4JOIC
chains in the Genus database with same CATH topology
4L8JA 1I4GA 4DXFA 4RGMA 3NE5B 3L9AX 2IT1A 2N55A 1PTOB 3S2HB 3I70A 4DU9A 1I50B 2F03A 1DZ1A 2R61A 4XQNA 1ESRA 4A93B 2WACA 2ZXRA 1ICWA 2AUKA 2ZXPA 5E3FA 4ILWA 4OO1G 4FXGC 3FVQA 1B50A 1U4PA 2EJGC 5CV9A 3E0JA 1PTOF 2QILA 4KJNA 4RFBA 4XT1B 3S14B 3OMGA 2M9VA 3C3LA 1GXDC 4RAUC 1LTSD 1SYFA 2CW0C 1YNJC 1MGSA 4DN4M 1PTOH 3QJYA 3NWSA 1SNOA 3MZ5A 3OW7A 3J81L 1WTQA 1SJED 2D62A 5DAUA 4P2CB 5KEEA 1TVXA 1I6VC 1II3A 4K14A 2BE5D 1WTRA 1B44D 1X3QA 1TWCB 3DHQA 1KTKA 3V2TA 1F9RA 1JORA 1RKNA 5FK9C 1SBBB 1QNUA 2L5TA 5KNCA 1NR4A 5CORA 1GUSA 2NZ1D 1IW7D 5FLXL 4B9XA 1FYCA 4OGQC 3C1FA 3SR1A 4E6IA 3I8ZA 4CJ1B 2L9HA 2XWBB 2EJMA 3G7LA 3A7LA 3GTLB 1J8IA 3KBXA 1TR5A 3T53B 1CFMA 1FNVA 1EIGA 2XWJB 3AU7A 3URYA 1YNND 5ELFA 3FRPB 5M5YB 1WTVA 1FD7D 2K5QA 4L63B 3TZUA 2NB0A 4A3MB 2B2YA 1BCPD 1NR2A 5DNFA 5IT9E 1V43A 3T51B 1CQVA 3HEJA 3P1HA 1GUWA 3MC0B 3S1RB 3X3MA 1BXTA 4BA1I 3CRKC 2BCOA 4IUUA 1OXSC 2B2TA 2F0KA 2WKCA 3Q22A 4QCLA 1VDZA 4A3GB 1AZPA 3HOUB 3AB9A 1IL8A 1C48A 1PXUA 3MXNA 3LWEA 4BY7B 4K6LA 4G7HC 5FO9B 4ABNA 1ENCA 4KKUA 4EVOA 4KY6A 4RGNA 2NYZD 3TDQA 3TZDA 3MFGA 3MHBA 2IPKD 3PMFA 3WDNA 1JB3A 2J7ZA 1E2VA 1EY5A 1HXYD 1IHZA 1B3AA 2PZWA 2RSOA 4FXDA 4R8IA 3I91A 4KD3A 3CKIB 3Q24A 2JA5B 1BQQT 5E1FA 5BN4A 2OT2A 3BVGA 4YIJA 5IT9L 1D6EC 3HOWB 2R7ZB 4DK1A 2KEEA 4XXEA 3TP7A 1UNSA 4EQPA 5JPMC 1Q12A 3TBIB 2L11A 3MWYW 3SK8A 4DGZA 1A3UA 2KVMA 4MIUA 1PRTC 4A3IB 1H9JA 4HAEA 4OIJA 2OXPA 3J80E 1XXGA 2B2WC 3V05A 5KYLA 3DWQA 3RZDB 3BVMA 1BCPF 2E76C 3MFYA 1SFOB 2N88A 2PO4A 2EYPA 2A6EC 2PZUA 3QG1A 1F2ZA 1MD2D 2OEOA 1A2UA 2FHTA 4XYOA 4OO1I 1K8OA 4O42A 2E75C 4WFN3 2FMCA 2PQEA 2NVQB 2SEBD 1M8AA 1EIHA 4ZUIA 2JEBI 5AFWA 2K01A 2KECA 4K8IA 2WINB 3OOCA 5IGCA 1EU3A 3K5NA 1H9RA 3OIQA 4FF1A 1ILQA 3GTJB 4K6DA 2EXZA 2D9UA 1GHKA 1ET6A 2K5DA 3DWPA 1KDBA 1QNKA 4MHEA 1I3QB 3PIO3 1H9KA 1Z47A 5CMDA 2LFNA 4X3UA 4HCEA 1WD1A 3P20A 5FOBB 1CHQD 2EZVA 2A69C 2YU9B 3RUZA 3G6JB 1G6ZA 1TKWB 1LT5D 2MHVA 2DY7A 5A35A 3I72A 1TWFB 3CU7A 1STAA 4CJ0B 1D2BA 4HR7B 4XYQA 2G9HD 3S16B 1SEBD 2H4OA 1SYEA 4TQUS 4KN4C 1S5CD 5E4XA 3W2DA 2M2LA 1O7ZA 2XN9C 1KLGD 3RZOB 3X3NA 1NCVA 4HEDA 3S9WA 4IUVA 3HP3A 3M7GA 2V4DA 1EQVA 1WVLA 1TY2A 3S2DB 1A3VA 2F0UA 2HUGA 4ZLTF 4LJZC 5CV4A 3V96A 1RHPA 4BY1B 4DNTB 1T5EA 1LTGD 4J1MA 5T1GA 3J7AV 4G7OC 2AWOA 3S1NB 4IFDH 4A3DB 1ILPA 1UEAB 3ND9A 1EY0A 3QOLA 1CA6A 1EL0A 3KLSA 5C5LA 5D3DA 3NXWA 4H7BA 3NTIA 1B2TA 2KHSA 4ZUJA 3DWAA 1GUOA 1GUNA 3I73A 2HCCA 5A2QE 3NTHA 5CGKA 1ENAA 1IKLA 1Y1WB 4KMUC 3BYYB 1HTLD 3BG3A 3BDLA 1EY9A 4K5WA 4A3EB 4XTCS 1CK1A 3FKIB 3RD4A 2BE5C 3NWTA 3K5OA 3OWEB 2BDNA 1SYCA 1CTMA 1MI2A 4IFDG 3CRLC 1ZYRD 4I65A 3NQIA 1STEA 1Y8PB 4HCSA 1FR3A 4K8JA 1IW7C 2A73B 1FGBD 5EKLA 2M00A 1C4QA 3C1EA 3VR5A 5KGUA 4MN3A 1PRTB 5ELCA 1HUMA 1LV9A 2F0EA 4TKOB 2MP1A 1RCVD 2F0SA 3VR4A 1YNNC 2JA8B 1F9PA 4EQNA 1V1PB 3H09A 4X3TA 3W3AA 2TSSA 2H1EA 4RHSA 1O7LA 5IGEA 2F0WA 5IGFA 3H6MA 1BCPC 2Y0SB 5FLXE 4C3JB 2B2VA 3D31A 5A2QL 4IUNA 4HMJA 3HS0C 2NWGA 3DUZA 5NUCA 1DXMA 5JAVA 3BYTB 1NUCA 4QUCA 3D6WA 1X32A 1WCMB 4NP5A 1PMRA 5KNDA 5EQ0A 4H0LC 3TMEA 2RA4A 1S4ZA 3FPUB 2CQAA 3NBHA 5J22A 3A8KE 1Y69U 1U9RA 5CV5A 1R9TB 3E6ZX 3VR3A 4RCOA 1B9NA 2LS01 1EYAA 3S17B 2D5DA 3K0YA 3OSOA 4DAVA 1J9OA 1SNMA 1D1IA 1H9MA 1EWCA 1CT1D 1EZ8A 2XNAC 1PLFA 1PFMA 4N9TA 4M1UB 5C6AA 2IWHA 4H13C 1DCZA 2NUCA 2QCPX 5EJWA 1E2WA 4GZYC 1A3TA 2O5IC 1TS5A 2K04A 4NMZA 3M7NA 1O7YA 1WTOA 3S15B 4X3KA 2MGSA 1B9MA 1EY6A 5IGBA 2BOSA 2RDFA 1R4QB 3TSSA 2B63B 1LACA 1TQOA 2F0HA 2LMCB 1VF7A 1JCKB 2JE6I 1TT2A 4BBSB 2BA1A 2EY6A 1HHVA 4C3JG 5K5PA 3T13A 4U68A 4B08A 5M3MB 3C2PA 2BA0A 1LT4D 1STNA 4FYDA 1KABA 2F3VA 3NQTA 1UUPA 2BDOA 4F87A 3FDTA 2JXMB 2L12A 3BDOA 3VA5A 4KHVA 5EPKA 1DJRD 1QILA 1RD9D 5G3LF 4IFDJ 2A68D 5C44B 4QUFA 2WIIB 2O4XA 1LO5D 2KCCA 3GD7A 2A6HD 2G9DA 2AUJD 3C46A 1AEXA 3CQZB 2SOBA 3SK6A 1VMCA 4HSVA 1ZXTA 3EFXD 4HSPA 5C3WA 3T4AC 2E74C 3U9SA 5JPNC 2QEJC 1PZID 2MJ8A 1KNAA 1G8ZD 3SXHA 2E2IB 2O5JC 3P75A 4G57A 3PO2B 2FJ2A 2VB2X 2IW3A 3PUZA 5CBAE 4RHRA 2Z8LA 4LAAA 3MXPA 3A7AB 1L0YB 4NKLA 4FF3A 5ELEA 1B4OA 4CKEA 3GTKB 3NSWA 3K5LA 3FMCA 4JBWA 1EWHA 5I9PA 5EPLA 1CA5A 2D2CC 4FNFA 2EYHA 2EYFA 4A3JB 5KYIA 3I4LA 1OXVA 1WD0A 1JOKA 3KK7A 4I7ZC 2F1MA 2PMZB 4XDXA 2JA6B 3D4RA 1SNCA 3AMUA 4U673 1OO9B 3VYTA 4AYBB 1E2ZA 4DNRB 5C0XH 1BCPB 2KEDA 1QE6A 2HDMA 2JP1A 1SMYC 4XT3B 4WJWA 1CM9A 1TS2A 3R2TA 4ZQ3A 5BN3A 1EYDA 3JAML 2K7VA 2JEAI 1I4RA 2IX3A 3GV6A 4B9WA 1GHJA 4TRDA 4ODGA 3M4YA 3H3VC 5J39A 2X6LA 3MA2B 2ICIA 2ICEC 3OMCA 2KCNA 1E0BA 3A8JE 4RGOS 4J6HA 3HOZB 3NK9A 4FVMA 1O78A 1JE4A 3M3YB 1Z6HA 1SNPA 4J8QA 3VYRA 3HKZB 2F0VA 3NHHA 4IURA 4UAIA 1VMPA 1F2LA 1BF4A 4IUPA 2I07B 1QWYA 4G7ZC 4O1NA 5C0XG 2B2WA 2RKSA 5JJZA 4FO2A 1Q8IA 5FO7B 2JYOA 1V1PA 3R93A 3I3CA 2MUYA 2Q8IB 4QMGA 2F0MA 5ELBA 1Q90A 5DM73 4NDXA 1O80A 2RVLA 2WP8J 2KOLA 4RKBA 3HOVB 1DOKA 1JICA 1LTID 3SHLA 1TU2B 3PUWA 5I6WA 4XQJA 1AN8A 1ONLA 4M8AA 4F88A 5C3XA 3J7YW 4RA8A 2B2UC 4CJ2C 3Q23A 3KLRA 5KIXA 1I6HB 2RQXA 3LX0A 5I2XA 3OIPA 3K6OA 4IUQA 1V1OA 1EQTA 1HPCA 2PNRC 4IALA 2IJ0A 5EKKA 4ID6A 4A3FB 5CV6A 3GO5A 3S1MB 4DK0A 5CYUA 3BS1A 5IODA 4Z9CB 2EY5A 3IFDA 1MSHA 2Q8TA 3R8BA 2EY2A 4CKCA 3D8GA 4OIKA 2Z4HA 1SXTA 1DOLA 2B2UA 2F3WA 5IGDA 2QF7A 1GOZA 3K59A 3CHBD 5FO8B 1ZEQX 3EVQA 2TMPA 3A56A 2SDFA 1HFNA 1GJXA 1KLUD 3L7ZC 5TSSA 3SK4A 4FF4A 4IZ8A 1D1KA 1STBA 5KRUA 4JK1C 3VA7A 1G91A 3HOXB 1RODA 4ULLA 2A74C 5D3IB 5IOCA 1LABA 3RMHA 1XX8A 1KNEA 3Q6SA 3N52A 2B8FA 4KKTA 5DM63 4RKLA 1B53A 1HA6A 2XSCA 2J0TD 1L0XB 4PQXA 2XRQD 1D5ZC 2EE1A 3MVVA 5F2DA 1IYUA 4KY5A 1CZWA 5DEHA 5HURA 1PTOD 1ZKOA 1JOQA 2RSNA 1UAPA 4L6TB 2EYOA 2EJFC 5D65A 1Y8NB 3NPPA 3GTPB 5COYA 3QB3A 4CHTB 1HRJA 1XWEA 3MXGA 4K2LA 3I90A 3NP8A 1KAAA 1D5MC 1BO0A 1W6JA 5C0XJ 4ZAIA 4S3SA 5M9OA 1H9SB 3SE0A 3PUVA 1IKMA 4CKBA 2XIWA 5E4WC 3ZYYX 3D6CA 4ZRZA 2PW5A 3SEBA 3L3OC 1B1ZA 3ONAB 3A55A 1F2YA 1G2TA 4G4KA 5BN5A 3Q0AA 1AP0A 4KKSA 5ELDA 4RH6A 5JVG3 1A6XA 1EY7A 2IX0A 2E2HB 4H44C 4K5VA 3NBIA 2VNUD 3TN2A 2WKDA 4KTAA 2FFKB 5HGTA 2J4XA 2DN8A 5M5WB 5LHY1 2A68C 2KQ3A 1OXXK 3VR6A 2F0PA 2JA7B 2DNCA 4UDUC 1RTNA 2A6HC 4DXGA 5C0XI 1GUGA 1U4RA 3K7AB 1F9SA 4K5XA 4DA2A 5I2YA 3MTSA 2LKVA 1I4QA 1Y1VB 5JEAH 2IL8A 1W6KA 4A3KB 5I9OA 4F7XA 3SK5A 4WORA 3GTGB 4C2MB 2KUMA 4HN7A 3EQLC 1MSGA 1K8MA 1QOHA 3DMUA 4IUTA 2F0IA 1QJOA 1JC7A 2QKIC 2NN6H 3HOYB 4BS9A 3TP6A 1PFNA 2WV6D 3IFTA 1SDFA 3O13A 2O2LD 3IKJA 3VYUA 1SJHD 1LLRD 1STYA 4FF2A 4PV1C 1LTTD 1G2SA 1SNQA 2X69A 1KDCA 3ERQA 4OHJA 5CV7A 3PV0A 1S5DD 3OPOA 2F0DA 2C9OA 5CC4A 1CZGA 1A2TA 2Z4IA 1D5XC 3S1QB 5JEAG 2EVBA 3FEWX 1SE2A 1R4PB 1SYBA 3DXJC 1Z7TA 1EEID 5M3FB 3DM1A 2K05A 1AFPA 3NUCA 4V0BA 1PDQA 3QIAA 3VYSA 3PUYA 3HZXA 4Q5VA 1OXTA 4V190 4CBVA 3QWNA 2NN6G 2B2YC 3OWFA 3K57A 2B8GA 2EYLA 3D3RA 2PPBC 2RBMA 1SYDA 3IAYA 3BZDB 1BDOA 2C5CA 5C4JB 5LL6X 1S5FD 1BOSA 4HTHA 2L4NA 1TWHB 3KF8A 2DNEA 3A54A 5IIFA 5EBDA 2RDGA 2B2TC 5JVH3 2F0QA 3FPPA 3MEHA 1STGA 1TY0A 4BA2I 1KDAA 1Q3LA 4KN7C 1TIID 5J1ZA 4C3IB 5I6YA 2OF1A 2RDHA 1SNDA 5EBCA 4R8NA 5EKIA 4QF4A 4X3SA 4DFAA 1X3PA 2EYMA 4C3HB 1QB5D 3JAME 1OXUA 1JOOA 3OHXC 1TWAB 1JR0D 1XYIA 5EGTA 2K32A 4PNYA 5JOBA 4QB4A 5ISRA 3M4OB 4KHZA 1QCBD 5C4ZA 3WOEA 1AW7A 1EOTA 1AZQA 3PO3B 3RLFA 5I4DA 4C1NK 4IFDI 4R9WA 4ME5A 3H94A 1EY4A 1FNWA 4ZK9B 3HG9A 4ZKCB 2F0OA 1Q1EA 4DAPA 1ENFA 3IL8A 2PW7A 4EQOA 2XVSA 1NAPA 4RGTA 2CW0D 1YNJD 1PYWD 2EPBA 3HGBA 5C3EB 3VR2A 2PYKA 4Y7NB 1HFGA 2F4IA 4EGVA 2SNMA 3I4MB 1ESFA 2QDBA 3QOJA 3H91A 1LT3D 4LMQD 3GTOB 2R92B 2SNSA 1VCIA 5CBEE 2IX1A 3K58A 3N6RA 2E2JB 2B39A 2WB1B 4C3IG 3GQBA 1F2MA 3M85A 1LTAD 3ND8A 1EYCA 2I46A 4FP5D 1JWMD 4C3HG 2ID0A 1RDPD 2A5HA 3UI2A 1DONA 2F0NA 2K03A 5JEAJ 4TSSA 1HCZA 3BDCA 3H0GB 2NBFA 2PZTA 2EDGA 1TS3A 3LNNA 1H9SA 1LT6D 3D4WA 2HQEA 1JQYD 1GUTA 2K5WA 3U9OA 3D4DA 4IN3A 4WRDA 4DF7A 1MBYA 1STHA 1EFID 1QG7A 2GA4B 3PUXA 1HTPA 2KJXA 3K5MA 1TS4A 2NVTB 1G291 2Z1CA 5D14A 4RCNA 4IQZA 1TWGB 4QIWB 3BVZA 1PTOC 2CHBD 1ET9A 3KLSX 5C5MA 1DD2A 5CR3A 3EA6A 1LTBD 1RJTA 5K36H 4PMWA 1ZYRC 2F0TA 3A8IE 2NN6I 1WTPA 4A3BB 1HQRD 5EPJA 2R93B 4XIGS 3P7JA 2VXWA 1CI3M 4DAYA 1M4VA 1SSOA 4FXKC 3J80L 1JWUD 3T16A 1CHPD 5CV8A 5LL6S 2AQ1B 1Q1BA 4CGYB 3TP8A 1ML0D 2L55A 2K6AA 3DEOA 3HRZC 2K1BA 3WOFA 2FINB 4NW2A 2X6GA 2L0CA 1U4MA 1I4XA 2VB3X 1NSNS 4KV6A 2Q8RE 1BR9A 2AQ3B 2K33A 3F2UA 1K83B 4C56C 3EJIA 1PZKD 5KNBA 5K36G 1SMYD 2DY8A 2CVRA 1PRTD 1IYVA 2WAQB 2NTTA 1U4LA 2EYJA 5C4XB 2HCIA 3KBGA 4BBRB 1S5ED 1BUVT 2NTSA 1DM0B 3I4NB 2A6ED 5M5XB 1HA5A 3ITPA 2YYZA 4N9PA 4KD4A 1RTOA 3LWUA 4PMBA 3J7AF 3T56B 2NVYB 4BWGB 1WTXA 4KJOA 3SDZA 2K28A 3NTKA 2F0FA 4HMIA 1SE3A 3GV3A 1PZJD 2ENBA 1A15A 1I4PA 2PCFB 1SAPA 4KY7A 2KA7A 1EU4A 4F8MA 3GP7A 3GTQB 4PMCA 5FKAC 1SE4A 3MXUA 1EEFD 1WTWA 3R2IA 1FNUA 2ZXOA 2R3ZA 4Q0FA 1HUNA 3QO2A 2AQ2B 2F0JA 2JSOA 1S5BD 1BNZA 1CQFA 2HDLA 1C8CA 2F0GA 4KI0A 1EZ6A 4K2KA 3SVMA 1RF2D 1SYGA 2AWNA 2A69D 4XQQA 1PFBA 1V8QA 1HQMC 3TP5A 2EOTA 1XTCD 2XRSD 1T5XD 2ZT9C 1JWSD 1DYQA 2B2VC 3R3OA 3PIP3 4LK1C 1F9QA 3EROA 2MPMA 2EY1A 1EY8A 2VUMB 3E5SA 3J81E 3MAQA 5C4HA 4OO1H 2E2DC 3KUPA 4KK7A 3GTMB 1DOMA 1BBXC 1F77A 2FMMA 2LY7A 1LTRD 2NVXB 1VF5C 1PRTF 4RWSC 1I4HA 4OL7A 1Y8OB 5G3LD 3DEPA 5IGGA 2R6GA 4ZKBB 5T1IA 4C1NI 4ZYSA 2L1BA 2F0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV3 A;  1BO0 A;  1G2S A;  1SSO A;  1ILP A;  5EKI A;  1DOL A;  2B2U A;  1WTV A;  4IUR A;  1A15 A;  4ZAI A;  2H1E A;  4R8I A;  2D9U A;  3I91 A;  2X69 A;  4UAI A;  4X3S A;  1SAP A;  1X3P A;  1IKM A;  1VMP A;  1F2L A;  1B4O A;  4IUP A;  3UI2 A;  1BF4 A;  1CA6 A;  1EL0 A;  2XIW A;  1HHV A;  1DON A;  5E4W C;  2N55 A;  1QNK A;  4MHE A;  2K03 A;  1XYI A;  5EPL A;  2B2W A;  1CA5 A;  1B2T A;  4U68 A;  2B2V A;  1DZ1 A;  3ONA B;  2B2Y A;  1ML0 D;  1WTW A;  5CMD A;  2SDF A;  1ESR A;  3DEO A;  5JJZ A;  2KEE A;  1G2T A;  1HFN A;  2K1B A;  2R3Z A;  1HUN A;  2FIN B;  4X3U A;  1EOT A;  1AZQ A;  1NR2 A;  4NW2 A;  3QO2 A;  5DNF A;  1WD1 A;  1AP0 A;  2JYO A;  1ICW A;  2X6G A;  2NWG A;  1BNZ A;  1WD0 A;  3R93 A;  1U4M A;  4R9W A;  2HCC A;  2HDL A;  2L11 A;  3MWY W;  2Q8R E;  4XDX A;  4QUC A;  1C8C A;  3I3C A;  1IKL A;  3FDT A;  3D6W A;  1G91 A;  1G6Z A;  1B50 A;  1U4P A;  4ZK9 B;  2L12 A;  2KVM A;  3SVM A;  3F2U A;  4ZKC B;  1X32 A;  2DY7 A;  3TN2 A;  1ROD A;  1GUW A;  5EPK A;  2FFK B;  4XT1 B;  3DM1 A;  4HAE A;  1PFB A;  2K05 A;  5EQ0 A;  4OIJ A;  2RA4 A;  1PDQ A;  2DY8 A;  2EOT A;  2CVR A;  1S4Z A;  4RAU C;  4CJ0 B;  3FPU B;  3IL8 A;  1O80 A;  1XX8 A;  2RVL A;  2KOL A;  4IUU A;  1U4L A;  2B2W C;  1DOK A;  1MGS A;  1KNE A;  4DN4 M;  1JIC A;  1RTN A;  2B2T A;  2B2V C;  2B2Y C;  3Q6S A;  4QUF A;  2HCI A;  3N52 A;  1QG7 A;  1NAP A;  1WTQ A;  1U4R A;  2EPB A;  1F9Q A;  2KED A;  1QE6 A;  2N88 A;  1TVX A;  1F9S A;  2HDM A;  2BDN A;  2MPM A;  1MI2 A;  3MTS A;  1B53 A;  1WTR A;  1X3Q A;  2JP1 A;  1AZP A;  1HA6 A;  1IL8 A;  5E4X A;  4RA8 A;  1HFG A;  4XT3 B;  2B2U C;  4CJ2 C;  5D14 A;  2IL8 A;  2M2L A;  1O7Z A;  1CM9 A;  1J9O A;  1F9R A;  3LWE A;  4HCS A;  1VMC A;  4HSV A;  1ZXT A;  2EE1 A;  2FHT A;  3KUP A;  4O42 A;  1NCV A;  4HED A;  1PLF A;  2L4N A;  1PFM A;  1NR4 A;  1DOM A;  1BBX C;  5COR A;  2FMM A;  2NZ1 D;  4IUQ A;  2MJ8 A;  3GV6 A;  3H91 A;  1EQT A;  1KNA A;  4IUV A;  2KUM A;  2NYZ D;  3HP3 A;  4MN3 A;  5EJW A;  1RJT A;  2RSN A;  4LMQ D;  4RWS C;  1HUM A;  1MSG A;  3TZD A;  1LV9 A;  1M8A A;  1EIH A;  2K04 A;  1WVL A;  1RTO A;  2B2T C;  2MP1 A;  3I8Z A;  4CJ1 B;  2HUG A;  1O7Y A;  2L9H A;  4ZLT F;  4IUT A;  2X6L A;  1RHP A;  3G7L A;  2FJ2 A;  5AFW A;  1WTO A;  5D65 A;  2K01 A;  1WTX A;  1WTP A;  3DEP A;  3KBX A;  1J8I A;  2KEC A;  2K28 A;  5CBE E;  1PFN A;  1Q3L A;  4X3K A;  1E0B A;  2MGS A;  5COY A;  1SDF A;  5CBA E;  5T1G A;  5EPJ A;  2J7Z A;  1F9P A;  1MSH A;  3IFD A;  2Q8T A;  1HRJ A;  4ZKB B;  5T1I A;  1ILQ A;  1EIG A;  3I90 A;  3P7J A;  2VXW A;  2L1B A;  1B3A A;  1JE4 A;  2RSO A;  4OIK A;  4X3T A; 
#chains in the Genus database with same CATH topology
 2JJQ A;  4L8J A;  1AE2 A;  1I4G A;  4DXF A;  4RGM A;  4DNI A;  4YWL A;  2JA8 H;  3GDE A;  3NE5 B;  4APV A;  3L9A X;  2IT1 A;  1Y1W G;  3GTM H;  2EIF A;  2N55 A;  2B3G A;  2JQO A;  1PTO B;  3S2H B;  1ICF B;  3I70 A;  4LF4 Q;  2NVX H;  4DU9 A;  1I50 B;  2F03 A;  1DZ1 A;  3U58 A;  2R61 A;  3U4V A;  4XQN A;  1ESR A;  4IPH A;  4A93 B;  3KYH C;  2WAC A;  2ZXR A;  3BU2 A;  4A3E G;  1ICW A;  2AUK A;  2ZXP A;  4QQB X;  5E3F A;  3AFQ A;  4ILW A;  4OO1 G;  4FXG C;  4DR4 L;  1BBU A;  3FVQ A;  1X6O A;  1B50 A;  1U4P A;  1B7Y B;  2EJG C;  1PVO A;  5CV9 A;  3E0J A;  1PTO F;  2QIL A;  1Q8K A;  3F8T A;  4KJN A;  4RFB A;  4JOI A;  4XT1 B;  3S14 B;  4X65 Q;  5IYC H;  4DR7 L;  3OMG A;  2M9V A;  3C3L A;  1GXD C;  4RAU C;  1LTS D;  5LMU L;  1SYF A;  1CKN A;  2QDL A;  1UE7 A;  4DV6 L;  1RL2 A;  1A8V A;  2CW0 C;  1YNJ C;  5GQO A;  1MGS A;  4DN4 M;  1PTO H;  3S2H H;  3QJY A;  3NWS A;  4JI6 Q;  1SNO A;  1N36 L;  3MZ5 A;  3OW7 A;  1I50 H;  1PHJ A;  2UU9 Q;  3J81 L;  1WTQ A;  1SJE D;  2D62 A;  5DAU A;  4P2C B;  5KEE A;  4NXM Q;  1TVX A;  3I56 A;  1I6V C;  1II3 A;  4A93 H;  3U4Z A;  4K14 A;  2BE5 D;  2VUM G;  3KF6 B;  1WTR A;  1B44 D;  1X3Q A;  1TWC B;  3DHQ A;  4IJL A;  3RN5 A;  1KTK A;  2WAQ E;  3V2T A;  1Q7Y C;  1AE3 A;  2JA8 G;  1E3P A;  1F9R A;  1JOR A;  1RKN A;  1SN8 A;  5FK9 C;  4B3R L;  2UXD L;  4PZ8 A;  1SBB B;  1QNU A;  2L5T A;  4UY8 C;  2MQH A;  1NR4 A;  2ZTD A;  5KNC A;  3RN2 A;  5COR A;  1GUS A;  2NZ1 D;  1IW7 D;  5FLX L;  4B9X A;  1FYC A;  3S14 H;  1FL0 A;  4OGQ C;  4X64 Q;  3C1F A;  4DK3 C;  3SR1 A;  4E6I A;  2N8N A;  3I8Z A;  4CJ1 B;  4YHH L;  2L9H A;  2XWB B;  2EJM A;  3G7L A;  3A7L A;  3GTL B;  1J8I A;  3KBX A;  2N49 A;  1NMG A;  4OEM B;  1TR5 A;  3T53 B;  1CFM A;  1NJI C;  1FNV A;  3KLW A;  1EIG A;  2XWJ B;  3AU7 A;  3URY A;  1TWC H;  1JE5 A;  1YNN D;  5ELF A;  3FRP B;  1WYD A;  1L1O C;  5M5Y B;  5IYC G;  1WTV A;  3TRZ A;  5AJ3 L;  1FD7 D;  2K5Q A;  3UDX A;  4L63 B;  1YBY A;  3TZU A;  4HJA A;  2NB0 A;  4DUZ Q;  4HJ8 A;  4A3M B;  3EBE A;  4LF9 Q;  2B2Y A;  1BCP D;  4A93 G;  4DAM A;  5LMN Q;  5JJI A;  4HIM A;  1SRO A;  1NR2 A;  5DNF A;  4P73 A;  1NTG A;  1L0W A;  5IT9 E;  3GTL H;  1V43 A;  3T51 B;  1GVP A;  1VS0 A;  5M3M H;  1CQV A;  4JI8 Q;  4X62 Q;  4DR1 Q;  3J81 c;  3HEJ A;  3ZJY C;  3I4O A;  3P1H A;  1GUW A;  3MC0 B;  1YJW A;  4BXX H;  4GNX C;  3S1R B;  3X3M A;  4LFC Q;  1BXT A;  4BA1 I;  2JA9 A;  3CRK C;  2BCO A;  4IUU A;  4B3T L;  1OXS C;  2B2T A;  1MHW C;  2F0K A;  4A3M H;  2WKC A;  4L5Q A;  3Q22 A;  3PSI A;  1OTC A;  3CCU A;  4QCL A;  4R4C A;  4DV2 L;  1JMC A;  1VDZ A;  4A3G B;  1AZP A;  5C44 H;  3HOU B;  3AB9 A;  1IL8 A;  1C48 A;  2IHE A;  1PXU A;  3MXN A;  3LWE A;  4BY7 B;  4K6L A;  4JPB W;  4G7H C;  5FO9 B;  4ABN A;  1ENC A;  3CMA A;  4JBK A;  4JYA L;  4KKU A;  3RLO A;  1KRS A;  4EVO A;  4KY6 A;  4DR5 L;  4GKK Q;  4RGN A;  2NYZ D;  3S1R H;  3TDQ A;  3TZD A;  4L5R C;  1HNX Q;  4GNX A;  2ZM6 Q;  2KHJ A;  3MFG A;  3MHB A;  2GVA A;  3ERS X;  2IPK D;  1GO3 E;  3PMF A;  3WDN A;  3J7A 5;  2JK8 A;  1JB3 A;  2ZTE A;  2ATW A;  3Q8D A;  2J7Z A;  1E2V A;  1EY5 A;  1HXY D;  4POF A;  3E9I A;  4A3G H;  4B3M L;  1IBL L;  4OEL B;  1IHZ A;  1B3A A;  2PZW A;  2RSO A;  4BXX G;  4IOC A;  1NMF A;  4JI4 Q;  4FXD A;  4BY7 H;  4R8I A;  3I91 A;  4KD3 A;  3CKI B;  3Q24 A;  4GOP C;  2JA5 B;  1WI5 A;  4DPG A;  1BQQ T;  1B3Q A;  5E1F A;  5BN4 A;  2OT2 A;  4A3M G;  1HNZ L;  3BVG A;  4YIJ A;  5IT9 L;  1D6E C;  1X3G A;  3HOW B;  1CSP A;  4DK1 A;  2R7Z B;  2KEE A;  3NBH B;  4XXE A;  1CKM A;  3TP7 A;  3LGJ A;  1UNS A;  4EQP A;  2PNH A;  4YCV A;  5JPM C;  1Q12 A;  3TBI B;  5H1S E;  2L11 A;  3MWY W;  3SK8 A;  4DGZ A;  1A3U A;  1L2F A;  2KVM A;  4MIU A;  1XPU A;  1PRT C;  3E3X A;  1H9J A;  4IPG A;  4A3I B;  4L5T A;  1HZ9 A;  4HAE A;  3J7Z C;  4OIJ A;  4LF7 L;  2OXP A;  3J80 E;  1JB7 A;  2JA5 H;  2RHS B;  4GOP A;  3CF5 A;  1XXG A;  2B2W C;  2N3S A;  3V05 A;  3BZC A;  5KYL A;  1XPO A;  4ZCK A;  3DWQ A;  3RZD B;  1QVF A;  2OTL A;  3BVM A;  1WTH A;  2G5D A;  1BCP F;  4LFB L;  2E76 C;  3MFY A;  3HOW H;  1SFO B;  2R7Z H;  2N88 A;  4A3G G;  1FJG L;  2PO4 A;  2EYP A;  3JC6 6;  1EFW A;  1N34 L;  2A6E C;  1C9O A;  2PZU A;  3QG1 A;  4BY7 G;  1F2Z A;  1MD2 D;  3ULL A;  2OEO A;  1A2U A;  2FHT A;  4XYO A;  4OO1 I;  1K8O A;  4O42 A;  2E75 C;  4WFN 3;  2FMC A;  2UUA L;  2PQE A;  2NVQ B;  2SEB D;  4DV1 Q;  1YVC A;  1QUQ B;  3CCM A;  1M8A A;  1EIH A;  4P72 A;  4ZUI A;  2JEB I;  5AFW A;  2K01 A;  2KEC A;  4K8I A;  5GRO A;  2WIN B;  1IBK L;  3OOC A;  5IGC A;  1EU3 A;  1KQS A;  3K5N A;  1H9R A;  3OIQ A;  4FF1 A;  1ILQ A;  3GTJ B;  2RF4 A;  1VQF A;  4K6D A;  2Q2I A;  4DR3 Q;  2EXZ A;  2D9U A;  4LFA Q;  2JA5 G;  1GHK A;  1S3O A;  1O7I A;  3HOZ H;  1ET6 A;  2K5D A;  3DWP A;  2OCE A;  3W5O A;  3M3Y H;  1KDB A;  1QNK A;  4MHE A;  1I3Q B;  3PIO 3;  2CH4 A;  2NVQ H;  3W1B A;  1VQD A;  2HT1 A;  3HOW G;  1H9K A;  1Z47 A;  2R7Z G;  5CMD A;  2LFN A;  1EIF A;  4X3U A;  4HCE A;  1WD1 A;  3P20 A;  5FOB B;  3CC4 A;  3AYH B;  1CHQ D;  2EZV A;  2A69 C;  2Z9H A;  5IP9 H;  2YU9 B;  3RUZ A;  3G6J B;  1G6Z A;  1TKW B;  1LT5 D;  2MHV A;  2DY7 A;  3AFP A;  3I72 A;  5A35 A;  1BBW A;  1TWF B;  2UUC Q;  4L5S A;  1L1O B;  3CU7 A;  1STA A;  2I5H A;  4CJ0 B;  1D2B A;  4HR7 B;  2LXK A;  4JI3 Q;  4XYQ A;  3WWV A;  1I3Q H;  2G9H D;  2Q2T A;  3S16 B;  1SEB D;  2H4O A;  1SYE A;  1VQ9 A;  4TQU S;  4KN4 C;  1C0A A;  2ZTC A;  1S5C D;  2CFM A;  5E4X A;  3W2D A;  2M2L A;  1O7Z A;  2K5H A;  1VQP A;  2XN9 C;  3HOZ G;  2I0Q A;  1KLG D;  3RZO B;  4YCW A;  4JI1 Q;  1G6P A;  3X3N A;  1NCV A;  4HED A;  3E0E A;  1WFQ A;  3S9W A;  2XGT A;  4IUV A;  4DV5 L;  3PGZ A;  3HP3 A;  3M7G A;  2V4D A;  1EIY B;  1EQV A;  1WVL A;  1TY2 A;  4AQY Q;  3S2D B;  1A3V A;  2F0U A;  2HUG A;  4ZLT F;  4LJZ C;  4JI2 Q;  5CV4 A;  3V96 A;  3KF6 A;  1RHP A;  4BY1 B;  1EQQ A;  4DNT B;  3S16 H;  5GAG C;  1T5E A;  4IO9 A;  1LTG D;  4J1M A;  4A3F H;  1SRU A;  3CAM A;  5T1G A;  3J7A V;  4DV4 L;  4G7O C;  2AWO A;  3S1N B;  2VZA A;  4GN4 B;  4IFD H;  4A3D B;  1ASZ A;  1ILP A;  1UEA B;  3PF4 A;  4GKJ L;  3ND9 A;  1K73 C;  4OWX B;  1EY0 A;  3QOL A;  1GKH A;  1CA6 A;  4HID A;  1EL0 A;  3J80 c;  3KLS A;  2XTI A;  5C5L A;  5D3D A;  3NXW A;  4H7B A;  1BVS A;  3NTI A;  1JJ2 A;  1VQ8 A;  4LUZ A;  4LUO A;  3OW2 A;  1B2T A;  1YHB A;  2KHS A;  4ZUJ A;  3DWA A;  3K8A A;  1GUO A;  1GUN A;  4BY1 H;  1HNW L;  3I73 A;  2HCC A;  5A2Q E;  3NTH A;  5CGK A;  1ENA A;  1VQC A;  3S1N H;  1IKL A;  2F4V L;  1Y1W B;  4A3D H;  4KMU C;  1NY4 A;  3F2B A;  3UE1 A;  3BYY B;  1EQR A;  1AH9 A;  1HTL D;  3BG3 A;  1A63 A;  5IWA Q;  3BDL A;  3RR5 A;  1EY9 A;  4K5W A;  4A3E B;  4XTC S;  1CK1 A;  3FKI B;  3RD4 A;  4A3F G;  2BE5 C;  3NWT A;  1Q82 C;  3K5O A;  3OWE B;  2BDN A;  1SYC A;  1CTM A;  1MI2 A;  4OX9 Q;  4IFD G;  3CRL C;  1KL9 A;  1ZYR D;  2LXJ A;  4I65 A;  2CKZ B;  3NQI A;  1STE A;  4DR6 L;  1Y8P B;  3ULP A;  4HCS A;  1FR3 A;  4K8J A;  2MNA A;  1IW7 C;  2A73 B;  3UE0 A;  1FGB D;  1X56 A;  2UUB Q;  5EKL A;  2M00 A;  1C4Q A;  3C1E A;  3VR5 A;  3TS0 A;  5KGU A;  1J5E Q;  4MN3 A;  1PRT B;  5ELC A;  3CCV A;  1HUM A;  1LV9 A;  2F0E A;  4UPA A;  4TKO B;  2MP1 A;  4BY1 G;  1EUJ A;  1RCV D;  2HHH L;  2F0S A;  3FKI H;  4A76 A;  1QVG A;  3VR4 A;  1N33 Q;  1YNN C;  2JA8 B;  1F9P A;  1IL2 A;  4DV0 Q;  2AKW B;  3CCS A;  5FJ8 H;  4A3D G;  4EQN A;  2QW7 A;  1V1P B;  4P71 A;  3H09 A;  4X3T A;  1HH2 P;  2TSS A;  3W3A A;  2K52 A;  3TQY A;  2H1E A;  4RHS A;  1O7L A;  5IGE A;  4JBJ A;  1X54 A;  2F0W A;  5IGF A;  3T1Y L;  4ME3 A;  3H6M A;  1BCP C;  2Y0S B;  5FLX E;  4C3J B;  3CC2 A;  2B2V A;  3D31 A;  4WJ4 A;  5A2Q L;  4X66 Q;  4IUN A;  1N9W A;  4HMJ A;  3HS0 C;  3KDF A;  2NWG A;  1UE6 A;  2YV5 A;  1TXY A;  3DUZ A;  5HGQ A;  5NUC A;  1DXM A;  5JAV A;  3BYT B;  1NUC A;  4QUC A;  2VQE L;  1I94 Q;  1VQ7 A;  2EQS A;  3PIO A;  4JCV E;  1PH5 A;  2E5L Q;  3D6W A;  1HR0 L;  2Q2U A;  1X32 A;  1WCM B;  4NP5 A;  1K3B C;  1PMR A;  4GN5 A;  5KND A;  5EQ0 A;  2YTX A;  4H0L C;  2C35 B;  1MIU A;  1KRT A;  3TME A;  2RA4 A;  1S4Z A;  3T1H Q;  3FPU B;  4R4T A;  2CQA A;  3NBH A;  1E1O A;  5J22 A;  4LF4 L;  3A8K E;  4DUY Q;  4C3J H;  3FKI G;  1Y69 U;  3BJU A;  1U9R A;  5CV5 A;  1R9T B;  3E6Z X;  3VR3 A;  3L0O A;  4RCO A;  1B9N A;  2LS0 1;  4IPD A;  1S40 A;  1EYA A;  2Z6B A;  5FJ8 G;  1W2B A;  1Q81 C;  3S17 B;  2D5D A;  3K0Y A;  3OSO A;  3DM3 A;  4DAV A;  1J9O A;  5ELN A;  1VQL A;  1SNM A;  1D1I A;  3K7A H;  1H9M A;  1EWC A;  1CT1 D;  1EZ8 A;  4DR4 Q;  2XNA C;  1PLF A;  1PFM A;  1WCM H;  4N9T A;  4M1U B;  5C6A A;  2IWH A;  4H13 C;  4X65 L;  1DCZ A;  2NUC A;  2QCP X;  5EJW A;  1E2W A;  4GZY C;  1K0S A;  1A3T A;  2O5I C;  1TS5 A;  3OYY A;  2CH4 W;  2K04 A;  4NMZ A;  1VQA A;  3M7N A;  1O7Y A;  4JI6 L;  1WTO A;  3UDG A;  3S15 B;  4NXM L;  4X3K A;  2MGS A;  1R9T H;  4MTN A;  1B9M A;  1EY6 A;  1VQG A;  5IGB A;  2BOS A;  3S17 H;  2RDF A;  1U0L A;  1R4Q B;  3TSS A;  2B63 B;  1LAC A;  1TQO A;  2F0H A;  2LMC B;  2MO0 A;  1RIP A;  1VF7 A;  1JCK B;  3ER0 A;  2JE6 I;  1TT2 A;  4BBS B;  1QUQ A;  4B3R Q;  2BA1 A;  3JAM i;  2UXD Q;  1PH3 A;  2EY6 A;  1HHV A;  1JT8 A;  4C3J G;  2Y0S G;  4JI7 Q;  5K5P A;  3T13 A;  4U68 A;  4B08 A;  5M3M B;  3C2P A;  2BA0 A;  1LT4 D;  3CME A;  1YHA A;  4JI0 Q;  1STN A;  4FYD A;  2BH8 A;  4YHH Q;  1KAB A;  2F3V A;  3S15 H;  4JV5 Q;  3NQT A;  3CCR A;  1UUP A;  2BDO A;  4F87 A;  3FDT A;  2JXM B;  1WCM G;  2L12 A;  3BDO A;  3VA5 A;  2B63 H;  4R1J A;  4KHV A;  5EPK A;  1DJR D;  2VS1 A;  2Z6K C;  1QIL A;  4BBS H;  4DUZ L;  1PYS B;  1VQE A;  1RD9 D;  4PZ6 A;  1E7Z A;  5G3L F;  4IFD J;  2A68 D;  4LF9 L;  5C44 B;  3STB D;  4QUF A;  2WII B;  2O4X A;  1LO5 D;  3OTO L;  2I5L X;  2KCC A;  3GD7 A;  5LMN L;  2A6H D;  2K50 A;  2G9D A;  2AUJ D;  3C46 A;  4JI8 L;  1BKB A;  4X62 L;  1AEX A;  1NE3 A;  3CQZ B;  2SOB A;  3SK6 A;  1L1O A;  1VMC A;  4HSV A;  1ZXT A;  3EFX D;  4HSP A;  5C3W A;  4NXN L;  3T4A C;  1XNR Q;  4HIK A;  2MO1 A;  2E74 C;  3KJP A;  3U9S A;  5JPN C;  2QEJ C;  5C4J H;  4MTK A;  1PZI D;  2MJ8 A;  1KNA A;  5FLX c;  1G8Z D;  3SXH A;  2E2I B;  2O5J C;  3P75 A;  4G57 A;  2NZO A;  3PO2 B;  1PH1 A;  2FJ2 A;  4B3T Q;  2VB2 X;  2IW3 A;  3PUZ A;  1X55 A;  4P75 A;  3PCO B;  5CBA E;  3PQI A;  4RHR A;  1NBW A;  2Z8L A;  3CW2 C;  1YJN A;  4LAA A;  4GS3 A;  2B63 G;  3MXP A;  2IY5 B;  3PIP A;  4A75 A;  3CQZ H;  3A7A B;  4NB3 A;  1PH6 A;  1L0Y B;  4BBS G;  4NKL A;  4FF3 A;  5ELE A;  1B4O A;  5JJL A;  4GKK L;  4CKE A;  3GTK B;  3NSW A;  1KD1 C;  3K5L A;  3FMC A;  4JBW A;  1EWH A;  5I9P A;  4JYA Q;  5EPL A;  1V9P A;  1CA5 A;  1HNX L;  2D2C C;  5M3M G;  2ZM6 L;  4FNF A;  1VQM A;  2B29 A;  2EYH A;  1K0R A;  4LF6 Q;  2EYF A;  1PH8 A;  2E2I H;  4A3J B;  5KYI A;  5FLM H;  3PO2 H;  3I4L A;  1LM0 A;  1OXV A;  4DV7 L;  3KDF B;  4N8F A;  1WD0 A;  1JOK A;  3KK7 A;  4I7Z C;  3M4O H;  2F1M A;  2PMZ B;  4XDX A;  1ASY A;  2Y0S E;  2JA6 B;  3D4R A;  1SNC A;  1DGS A;  4IJH A;  1CSQ A;  1YNX A;  3AMU A;  1EOV A;  3EN2 A;  1N32 Q;  4N8X 1;  4U67 3;  1OO9 B;  3GTK H;  5C44 G;  3VYT A;  4AYB B;  1E2Z A;  1E22 A;  1YHQ A;  4DNR B;  5IYD H;  5C0X H;  1BCP B;  4KHP Q;  1VQH A;  2KED A;  1QE6 A;  2HDM A;  4IPC A;  4A3J H;  2JP1 A;  4GN3 B;  1SMY C;  4XT3 B;  4HJ9 A;  4WJW A;  3ICE A;  1D8L A;  1CM9 A;  1D7Q A;  1TS2 A;  3K80 C;  3KFU A;  4JW0 A;  3R2T A;  4ZQ3 A;  2GN5 A;  1PFS A;  2PQA A;  5BN3 A;  2JA6 H;  1EYD A;  3JAM L;  3J81 j;  2K7V A;  2JEA I;  2KCT A;  1I4R A;  4NPS A;  2IX3 A;  3GV6 A;  4FDB A;  4B9W A;  1GHJ A;  4TRD A;  4ODG A;  4B3S Q;  3I4M H;  4LF7 Q;  3M4Y A;  3H3V C;  5FLM G;  3PO2 G;  2A1A A;  5J39 A;  2X6L A;  3MA2 B;  2ICI A;  4DV3 Q;  2ICE C;  3OMC A;  2KCN A;  5IP7 H;  1E0B A;  4AH6 A;  3A8J E;  4RGO S;  4J6H A;  2WFW A;  3HOZ B;  3G48 A;  3NK9 A;  4FVM A;  1FJG Q;  1O78 A;  1WOC A;  4UP9 A;  1JE4 A;  3M3Y B;  1Z6H A;  4GLX A;  1SNP A;  3MEF A;  4J8Q A;  3VYR A;  3HKZ B;  2F0V A;  3NHH A;  4IUR A;  2ES2 A;  4UAI A;  3F2C A;  1VMP A;  1F2L A;  1BF4 A;  4IUP A;  1UE5 A;  2I07 B;  1QWY A;  5IYD G;  4G7Z C;  1IXR A;  4O1N A;  2B2W A;  5C0X G;  2RKS A;  5IT9 c;  5JJZ A;  4A3J G;  4FO2 A;  1Q8I A;  1I5F A;  4OON A;  5FO7 B;  2JYO A;  1V1P A;  3R93 A;  1WJJ A;  1PYB A;  1XMO Q;  2JA6 G;  3I3C A;  2MUY A;  3H0G H;  2Q8I B;  4QMG A;  2F0M A;  4DR3 L;  5ELB A;  1Q90 A;  4LFA L;  5DM7 3;  4NDX A;  3B6Y A;  3I4M G;  4LUV A;  4LWC A;  1O80 A;  2RVL A;  2WP8 J;  2KOL A;  4RKB A;  3HOV B;  1DOK A;  4AYB G;  1JIC A;  1LTI D;  5IP7 G;  4MNO A;  2RCF A;  3SHL A;  1TU2 B;  3KF8 B;  3PUW A;  4JI5 L;  5I6W A;  4XQJ A;  1AN8 A;  1PH9 A;  1ONL A;  4M8A A;  4F88 A;  5C3X A;  1SMX A;  3J7Y W;  4RA8 A;  1YIT A;  2B2U C;  4CJ2 C;  3Q23 A;  1H95 A;  3KLR A;  2DJG C;  5KIX A;  1YI2 A;  1I6H B;  2RQX A;  3LX0 A;  5I2X A;  2CCZ A;  4LF8 Q;  3OIP A;  3K6O A;  2UUC L;  4IUQ A;  1V1O A;  1EQT A;  1HPC A;  2PNR C;  4IAL A;  4LW1 A;  2IJ0 A;  5EKK A;  4ID6 A;  2ZJQ A;  4JI3 L;  4A3F B;  1UE1 A;  2EXD A;  5CV6 A;  3HOV H;  1VQJ A;  1UEB A;  3GO5 A;  3S1M B;  3EIV A;  1XJV A;  4DK0 A;  1KAW A;  1J6Q A;  5CYU A;  3BS1 A;  5IOD A;  4Z9C B;  2EY5 A;  3IFD A;  1MSH A;  2Q8T A;  3H0G G;  3R8B A;  2UXC L;  1YJ9 A;  2EY2 A;  4CKC A;  3I7F A;  5J3B A;  3D8G A;  4OIK A;  2Z4H A;  1SXT A;  3HKZ G;  4UP7 A;  1DOL A;  2B2U A;  2F3W A;  5IGD A;  2QF7 A;  2CWA A;  4LF5 L;  1I6H H;  1GOZ A;  3K59 A;  3CHB D;  5FO8 B;  1XPR A;  1ZEQ X;  2P5Z X;  4DV5 Q;  3EVQ A;  4AQY L;  2TMP A;  3A56 A;  2SDF A;  1HFN A;  5IP9 G;  3S1M H;  1YIJ A;  1GJX A;  1U5K A;  1XNQ Q;  3QR8 A;  1KLU D;  3L7Z C;  4Y52 H;  5TSS A;  3SK4 A;  4FF4 A;  4IZ8 A;  1D1K A;  1STB A;  5KRU A;  4JK1 C;  4OWW B;  5BR8 Q;  3VA7 A;  1VQN A;  1G91 A;  3HOX B;  4K0K L;  1ROD A;  2MFI A;  4ULL A;  2A74 C;  5D3I B;  5IOC A;  4A4I A;  1LAB A;  3RMH A;  2GVB A;  3HOV G;  3AEV A;  1XX8 A;  2HIV A;  1VQK A;  3A0J A;  2K5V A;  2PMZ E;  1KNE A;  3Q6S A;  3N52 A;  3KJO A;  2B8F A;  4KKT A;  1KHI A;  5DM6 3;  4RKL A;  1YEZ A;  1IBM Q;  1B53 A;  1HA6 A;  1JJG A;  2XSC A;  2J0T D;  4HJ5 A;  1L0X B;  4PQX A;  2XRQ D;  3J81 i;  1D5Z C;  2EE1 A;  3MVV A;  4AYB E;  4R4I A;  5F2D A;  1IYU A;  2PQA B;  4KY5 A;  2DUD A;  3HOX H;  1CZW A;  3A5U A;  5DEH A;  2F4V Q;  5HUR A;  1PTO D;  1ZKO A;  1JOQ A;  2RSN A;  1UAP A;  5M5X H;  3UDI A;  3A5Z B;  4L6T B;  3I55 A;  1LYL A;  2N78 A;  1VQ5 A;  5IWA L;  2EYO A;  1G51 A;  2EJF C;  5D65 A;  1XMQ Q;  1Y8N B;  4YY3 Q;  3NPP A;  3CP0 A;  4I7A A;  3GTP B;  5COY A;  3QB3 A;  4JBM A;  4CHT B;  1HRJ A;  1XWE A;  3MXG A;  4K2L A;  3I90 A;  2NVY H;  3NP8 A;  1KAA A;  1D5M C;  1BO0 A;  1W6J A;  5C0X J;  2VQF L;  4ZAI A;  1X3F A;  3NEL A;  4S3S A;  5M9O A;  1H9S B;  3SE0 A;  3PUV A;  2UUB L;  1IKM A;  4CKB A;  4DR2 Q;  2XIW A;  5E4W C;  4H02 A;  2V1C C;  1C7Y A;  2RHQ B;  3ZYY X;  4EX5 A;  1X65 A;  3D6C A;  4ZRZ A;  2PW5 A;  3SEB A;  3L3O C;  1B1Z A;  3ONA B;  3A55 A;  4WJ3 M;  1F2Y A;  1G2T A;  4G4K A;  5BN5 A;  3HKZ E;  3Q0A A;  4RG1 A;  1AP0 A;  4KKS A;  5ELD A;  2F3I A;  4RH6 A;  2L15 A;  2AHO B;  4DV0 L;  3GTP H;  5EAY A;  5JVG 3;  2E8G A;  4QGU A;  1A6X A;  1EY7 A;  3HOX G;  2IX0 A;  2E2H B;  4H44 C;  4K5V A;  1YZ6 A;  3NBI A;  2VNU D;  3TN2 A;  2WKD A;  4KTA A;  2FFK B;  5HGT A;  2J4X A;  2DN8 A;  5M5W B;  5LHY 1;  2A68 C;  2KQ3 A;  1OXX K;  3STB C;  3VR6 A;  2F0P A;  2JA7 B;  1E1T A;  3CD6 A;  2DNC A;  3KOJ A;  4UDU C;  1RTN A;  2A6H C;  2A8V A;  4DXG A;  5C0X I;  1HZB A;  1GUG A;  4X66 L;  1U4R A;  2UXB L;  2K75 A;  3K7A B;  1F9S A;  4K5X A;  2KEN A;  4DA2 A;  3MTS A;  5I2Y A;  2LKV A;  1I4Q A;  3H3V H;  4DK6 C;  1Y1V B;  4YWM A;  5JEA H;  2IL8 A;  2JN4 A;  1W6K A;  1Y14 B;  4A3K B;  5I9O A;  3RLN A;  1I94 L;  2E5L L;  4F7X A;  1HZC A;  2VQE Q;  2E2H H;  2VUM H;  3SK5 A;  4WOR A;  3GTG B;  4DAY B;  1MKH A;  4C2M B;  3T1H L;  3TS2 A;  2KUM A;  4HN7 A;  5M5W H;  4EQ5 A;  3EQL C;  1MSG A;  1K8M A;  1QOH A;  2JA7 H;  3DMU A;  4UP8 A;  4DUY L;  4IUT A;  2F0I A;  1QJO A;  1JC7 A;  2QKI C;  2NN6 H;  3HOY B;  4BS9 A;  4CDD C;  3TP6 A;  1PFN A;  2WV6 D;  3IFT A;  1HZA A;  1SDF A;  3CXC A;  1Q46 A;  3DLL A;  3O13 A;  2O2L D;  3IKJ A;  3VYU A;  1SJH D;  1LLR D;  1STY A;  4FF2 A;  1Y1V H;  4PV1 C;  1LTT D;  3M4Q A;  1G2S A;  2RCN A;  2F52 A;  2ALY B;  4A3K H;  1SNQ A;  2X69 A;  1KDC A;  4DR7 Q;  3ERQ A;  4AIM A;  4OHJ A;  5CV7 A;  5LMU Q;  3PV0 A;  3GTG H;  4DV6 Q;  4C2M H;  2KCM A;  1S5D D;  2UU9 L;  3OPO A;  2F0D A;  2C9O A;  1LUZ A;  1N36 Q;  5CC4 A;  3K7U C;  1CZG A;  1A2T A;  2Z4I A;  1K8G A;  1D5X C;  3S1Q B;  5JEA G;  3K81 C;  3HOY H;  2EVB A;  1VQ6 A;  3FEW X;  1SE2 A;  3RNU A;  1R4P B;  1SYB A;  3DXJ C;  2VL6 A;  1Z7T A;  1EEI D;  4LNQ A;  5M3F B;  3DM1 A;  2K05 A;  3PF5 A;  2OQ0 A;  1AFP A;  3NUC A;  4X64 L;  4V0B A;  1PDQ A;  3QIA A;  3VYS A;  3PUY A;  4QL5 A;  2JA7 G;  3HZX A;  4Q5V A;  4JI7 L;  1OXT A;  4V19 0;  4CBV A;  3QWN A;  2NN6 G;  2B2Y C;  3OWF A;  1QZH A;  1X9N A;  3K57 A;  2B8G A;  2EYL A;  3D3R A;  4JI0 L;  1E24 A;  2PPB C;  4QJF A;  2RBM A;  1Y1V G;  1SYD A;  4QY7 A;  3IAY A;  3S1Q H;  3BZD B;  4JV5 L;  1BDO A;  2C5C A;  5C4J B;  5LL6 X;  4A3K G;  1S5F D;  1BOS A;  4HTH A;  3FHW A;  2R7F A;  5AJ3 Q;  4PZ7 A;  2L4N A;  3M4P A;  1TWH B;  4A3C H;  1PH2 A;  5HY6 A;  5M3F H;  1VQB A;  2AMC B;  3KF8 A;  1UWV A;  2DNE A;  2DJF C;  3A54 A;  5IIF A;  2D0P A;  5EBD A;  2RDG A;  2B2T C;  5JVH 3;  1PH4 A;  2F0Q A;  3FPP A;  3MEH A;  1STG A;  1TY0 A;  4BA2 I;  3HOY G;  4DR1 L;  1KDA A;  1Q3L A;  1GM5 A;  4KN7 C;  3OTO Q;  1TII D;  3CCL A;  5J1Z A;  4C3I B;  5I6Y A;  2OF1 A;  1A0I A;  2RDH A;  1SND A;  5EBC A;  2PI2 E;  4R8N A;  1EYG A;  5EKI A;  4LFC L;  4QF4 A;  4X3S A;  4DFA A;  2ZJR A;  1XNR L;  1X3P A;  2EYM A;  4C3H B;  1QB5 D;  3JAM E;  1OXU A;  2Z6K A;  4NXN Q;  1JOO A;  3OHX C;  1TWA B;  1JR0 D;  1K28 A;  1TWH H;  5M5Y H;  1XYI A;  5EGT A;  2K32 A;  4YWK A;  4PNY A;  5JOB A;  3G4S A;  4QB4 A;  2DGY A;  2ZJP A;  5ISR A;  3M4O B;  4KHZ A;  1QCB D;  5C4Z A;  2H5X A;  4IOA A;  3WOE A;  1S72 A;  4DV2 Q;  1AW7 A;  1EOT A;  1GD7 A;  1AZQ A;  4HJ7 A;  3PO3 B;  3RLF A;  5I4D A;  4C1N K;  4IFD I;  4R9W A;  4ME5 A;  3H94 A;  4OWT B;  1M1K C;  2QGQ A;  1EY4 A;  4C3I H;  1FNW A;  3CC7 A;  4ZK9 B;  3HG9 A;  4A3C G;  1QZG A;  4ZKC B;  2F0O A;  5M3F G;  1Q1E A;  4DAP A;  4DR5 Q;  1ENF A;  3J80 i;  3IL8 A;  4C3H H;  2PW7 A;  1TWA H;  4EQO A;  2XVS A;  2NZH A;  1NAP A;  4RGT A;  2CW0 D;  1YNJ D;  4LF6 L;  1PYW D;  2EPB A;  3HGB A;  4CDE C;  5C3E B;  5JJK A;  3VR2 A;  2PYK A;  4Y7N B;  1KIX A;  1Z9F A;  4POG A;  1HFG A;  2F4I A;  4EGV A;  3VDY A;  3PO3 H;  4B3M Q;  4JI4 L;  3TEH B;  4DV7 Q;  1IBL Q;  2QEX A;  1CUK A;  2OTJ A;  3F2D A;  2SNM A;  3I4M B;  1SLJ A;  1ESF A;  2OQK A;  3HOU H;  2HQL A;  2QDB A;  3QOJ A;  1V1Q A;  3H91 A;  1NNX A;  1HNZ Q;  1A62 A;  1N32 L;  1LT3 D;  4LMQ D;  3FP9 A;  3GTO B;  3CCQ A;  4R4O A;  2R92 B;  2SNS A;  1VCI A;  5IY0 A;  4OXP A;  4KHP L;  5CBE E;  2IX1 A;  3K58 A;  3N6R A;  2E2J B;  1JJC B;  5C3E H;  2B39 A;  2WB1 B;  3AQQ A;  4C3I G;  4Y7N H;  3GQB A;  1F2M A;  3M85 A;  1HJP A;  1LTA D;  3ND8 A;  1CKO A;  1EYC A;  2I46 A;  3NEM A;  4FP5 D;  3M9B A;  1JWM D;  4C3H G;  2ID0 A;  1RDP D;  2A5H A;  2Q2H A;  1XTD A;  2PI2 A;  3UI2 A;  1DON A;  2F0N A;  2K03 A;  1MJC A;  5JEA J;  3G71 A;  3TRE A;  4TSS A;  4B3S L;  3IRB A;  3I2Z A;  3GTO H;  1HCZ A;  1CKN B;  4ALP A;  1T9H A;  2R92 H;  4LFB Q;  4DV3 L;  3BDC A;  3H0G B;  3PO3 G;  2NBF A;  2PZT A;  2EDG A;  3CPF A;  1TS3 A;  1N34 Q;  3LNN A;  4KLK A;  2E2J H;  1H9S A;  4CDC C;  3HOU G;  1LT6 D;  3D4W A;  2HQE A;  4DV1 L;  1P8L A;  2CWP A;  2UUA Q;  1JQY D;  1GUT A;  5GAH C;  4GLV B;  3S24 A;  2K5W A;  1HR0 W;  3U9O A;  3D4D A;  4IN3 A;  4WRD A;  4DF7 A;  4A3I H;  1MBY A;  1STH A;  2K4K A;  1EFI D;  1QG7 A;  2GA4 B;  3PUX A;  5C3E G;  1HTP A;  2KJX A;  3SGI A;  1IBK Q;  3HFZ B;  3K5M A;  3CCE A;  1TS4 A;  2NVT B;  3H3V I;  4RMF A;  1G29 1;  3RZD H;  2Z1C A;  5D14 A;  3ULJ A;  1XMO L;  3D0F A;  1VQO A;  1FVI A;  4RCN A;  1SFO H;  2R7D A;  4IQZ A;  1QVC A;  1TWG B;  4QIW B;  3BVZ A;  1SE8 A;  2D0O A;  2QA4 A;  1PTO C;  2CHB D;  3JAM c;  1ET9 A;  3KLS X;  3A74 A;  5C5M A;  1DD2 A;  5CR3 A;  3EA6 A;  2VW9 A;  1LTB D;  3CPW A;  1RJT A;  5K36 H;  2R92 G;  4PMW A;  1ZYR C;  2F0T A;  3F1Z A;  3A8I E;  2NN6 I;  1WTP A;  1LTL A;  4A3B B;  2I5M X;  1MJE A;  1HQR D;  2WB1 G;  4R4Q A;  5EPJ A;  2R93 B;  4JI5 Q;  4XIG S;  3P7J A;  2NVT H;  2VXW A;  1CI3 M;  4DKA C;  1KC8 C;  1M4V A;  4DAY A;  1M90 C;  1SSO A;  5GAE C;  4FXK C;  1TWG H;  4LF8 L;  3J80 L;  4MZ9 A;  3GTJ H;  1JWU D;  3T16 A;  4A3I G;  1CHP D;  5CV8 A;  5LL6 S;  2AQ1 B;  1Q1B A;  4CGY B;  3TP8 A;  1VQI A;  2ASB A;  1ML0 D;  2L55 A;  2K6A A;  3DEO A;  3HRZ C;  2K1B A;  3WOF A;  3L2P A;  2Z0S A;  2FIN B;  1FGU A;  4A3L H;  4HIO A;  4NW2 A;  1EWI A;  2X6G A;  2L0C A;  1KXL A;  1U4M A;  4A3B H;  1I4X A;  3K0X A;  2VB3 X;  1NSN S;  4KV6 A;  4PG3 A;  2Q8R E;  1BR9 A;  4JI1 L;  2R93 H;  2AQ3 B;  5GAD C;  3UDF A;  2K33 A;  2UXC Q;  3F2U A;  3G6E A;  1K83 B;  4C56 C;  3EJI A;  1PA6 A;  3MXN B;  1PZK D;  5KNB A;  5K36 G;  1SMY D;  2DY8 A;  2CVR A;  1PRT D;  2YU9 H;  1IYV A;  2WAQ B;  2NTT A;  4LF5 Q;  4JI2 L;  1U4L A;  2EYJ A;  2K14 A;  1TWF H;  5C4X B;  2HCI A;  4JC0 A;  4YCU A;  3KBG A;  4BBR B;  4GNX B;  1S5E D;  1XNQ L;  4DV4 Q;  1BUV T;  2NTS A;  1DM0 B;  4GLA C;  5LMN W;  5BR8 L;  1IYJ B;  3U50 C;  3I4N B;  2A6E D;  5M5X B;  4GKJ Q;  1HA5 A;  3E9H A;  3ITP A;  4X6A H;  1K83 H;  2K5N A;  4JVZ A;  4K0K Q;  2YYZ A;  5IE8 A;  4N9P A;  3RZO H;  4KD4 A;  1RTO A;  3LWU A;  4A3L G;  2HD3 A;  4PMB A;  3J7A F;  3T56 B;  2NVY B;  4BWG B;  1IZ6 A;  1WTX A;  4KJO A;  3SDZ A;  5C4X H;  4A3B G;  1HNW Q;  2K28 A;  2KHI A;  3HKS A;  2R93 G;  3NTK A;  4BBR H;  1IBM L;  2F0F A;  4P74 A;  1W3S A;  3S2D H;  1PV4 A;  4HMI A;  1K8A C;  1SE3 A;  3BZK A;  2CQO A;  3GV3 A;  1PZJ D;  2ENB A;  1A15 A;  1I4P A;  2PCF B;  1SAP A;  2VY3 A;  4KY7 A;  3I4N H;  2KA7 A;  1EU4 A;  4F8M A;  3GP7 A;  2WB1 E;  3GTQ B;  4PMC A;  4O2D A;  4J15 A;  5FKA C;  1SE4 A;  3MXU A;  4O0A A;  3H15 A;  1EEF D;  1WTW A;  3R2I A;  1FNU A;  2ZXO A;  5E7N A;  2YTV A;  4GOP B;  4OX9 L;  5ELO A;  1X3E A;  2R3Z A;  5IYB H;  4Q0F A;  1HUN A;  2HIX A;  1XMQ L;  4YY3 L;  4TVA B;  3QO2 A;  2AQ2 B;  2F0J A;  2JSO A;  1S5B D;  1BNZ A;  1CQF A;  3NEN A;  2OWO A;  2HDL A;  1K9M C;  1C8C A;  4DR6 Q;  2F0G A;  4UHV A;  4KI0 A;  1EZ6 A;  4K2K A;  3SVM A;  1VQ4 A;  1RF2 D;  1J5E L;  1SYG A;  2AWN A;  2A69 D;  1N8R C;  4XQQ A;  1PFB A;  1V8Q A;  4DR2 L;  1HQM C;  3TP5 A;  2EOT A;  1XTC D;  2XRS D;  1T5X D;  2YTY A;  2WAQ G;  2ZT9 C;  2VQF Q;  1JWS D;  1SR3 A;  1DYQ A;  1Y1W H;  2B2V C;  5C4X G;  3R3O A;  3GTQ H;  1K3R A;  1Q86 C;  2HHH Q;  1N33 L;  4BBR G;  3PIP 3;  4LK1 C;  2LSS A;  1F9Q A;  2A19 A;  3ERO A;  2MPM A;  2EY1 A;  1EY8 A;  2VUM B;  4A3E H;  3E5S A;  3J81 E;  4JG2 A;  3I4N G;  3MAQ A;  1B70 B;  5C4H A;  4OO1 H;  2E2D C;  3KUP A;  4KK7 A;  1B8A A;  3GTM B;  1DOM A;  1BBX C;  1F77 A;  2FMM A;  2LY7 A;  1LTR D;  2NVX B;  3T1Y Q;  1VF5 C;  2IHF A;  1PRT F;  4RWS C;  1I4H A;  5DLQ E;  5IYB G;  4OL7 A;  1P16 A;  2FXQ A;  1Y8O B;  3W1G A;  5G3L D;  4QIW E;  3CCJ A;  3DEP A;  1PH7 A;  5IGG A;  2R6G A;  4CDF C;  4ZKB B;  2KBN A;  2UXB Q;  5T1I A;  4C1N I;  2BH2 A;  4ZYS A;  2L1B A;  2F0L A;  5L37 A;  1HR0 Q;  4JOI C; 
#chains in the Genus database with same CATH homology
 4L8J A;  1I4G A;  4DXF A;  4RGM A;  3NE5 B;  3L9A X;  2IT1 A;  2N55 A;  1PTO B;  3S2H B;  3I70 A;  4DU9 A;  1I50 B;  2F03 A;  1DZ1 A;  2R61 A;  4XQN A;  1ESR A;  4A93 B;  2WAC A;  2ZXR A;  1ICW A;  2AUK A;  2ZXP A;  5E3F A;  4ILW A;  4OO1 G;  4FXG C;  3FVQ A;  1B50 A;  1U4P A;  2EJG C;  5CV9 A;  3E0J A;  1PTO F;  2QIL A;  4KJN A;  4RFB A;  4XT1 B;  3S14 B;  3OMG A;  2M9V A;  3C3L A;  1GXD C;  4RAU C;  1LTS D;  1SYF A;  2CW0 C;  1YNJ C;  1MGS A;  4DN4 M;  1PTO H;  3QJY A;  3NWS A;  1SNO A;  3MZ5 A;  3OW7 A;  3J81 L;  1WTQ A;  1SJE D;  2D62 A;  5DAU A;  4P2C B;  5KEE A;  1TVX A;  1I6V C;  1II3 A;  4K14 A;  2BE5 D;  1WTR A;  1B44 D;  1X3Q A;  1TWC B;  3DHQ A;  1KTK A;  3V2T A;  1F9R A;  1JOR A;  1RKN A;  5FK9 C;  1SBB B;  1QNU A;  2L5T A;  5KNC A;  1NR4 A;  5COR A;  1GUS A;  2NZ1 D;  1IW7 D;  5FLX L;  4B9X A;  1FYC A;  4OGQ C;  3C1F A;  3SR1 A;  4E6I A;  3I8Z A;  4CJ1 B;  2L9H A;  2XWB B;  2EJM A;  3G7L A;  3A7L A;  3GTL B;  1J8I A;  3KBX A;  1TR5 A;  3T53 B;  1CFM A;  1FNV A;  1EIG A;  2XWJ B;  3AU7 A;  3URY A;  1YNN D;  5ELF A;  3FRP B;  5M5Y B;  1WTV A;  1FD7 D;  2K5Q A;  4L63 B;  3TZU A;  2NB0 A;  4A3M B;  2B2Y A;  1BCP D;  1NR2 A;  5DNF A;  5IT9 E;  1V43 A;  3T51 B;  1CQV A;  3HEJ A;  3P1H A;  1GUW A;  3MC0 B;  3S1R B;  3X3M A;  1BXT A;  4BA1 I;  3CRK C;  2BCO A;  4IUU A;  1OXS C;  2B2T A;  2F0K A;  2WKC A;  3Q22 A;  4QCL A;  1VDZ A;  4A3G B;  1AZP A;  3HOU B;  3AB9 A;  1IL8 A;  1C48 A;  1PXU A;  3MXN A;  3LWE A;  4BY7 B;  4K6L A;  4G7H C;  5FO9 B;  4ABN A;  1ENC A;  4KKU A;  4EVO A;  4KY6 A;  4RGN A;  2NYZ D;  3TDQ A;  3TZD A;  3MFG A;  3MHB A;  2IPK D;  3PMF A;  3WDN A;  1JB3 A;  2J7Z A;  1E2V A;  1EY5 A;  1HXY D;  1IHZ A;  1B3A A;  2PZW A;  2RSO A;  4FXD A;  4R8I A;  3I91 A;  4KD3 A;  3CKI B;  3Q24 A;  2JA5 B;  1BQQ T;  5E1F A;  5BN4 A;  2OT2 A;  3BVG A;  4YIJ A;  5IT9 L;  1D6E C;  3HOW B;  2R7Z B;  4DK1 A;  2KEE A;  4XXE A;  3TP7 A;  1UNS A;  4EQP A;  5JPM C;  1Q12 A;  3TBI B;  2L11 A;  3MWY W;  3SK8 A;  4DGZ A;  1A3U A;  2KVM A;  4MIU A;  1PRT C;  4A3I B;  1H9J A;  4HAE A;  4OIJ A;  2OXP A;  3J80 E;  1XXG A;  2B2W C;  3V05 A;  5KYL A;  3DWQ A;  3RZD B;  3BVM A;  1BCP F;  2E76 C;  3MFY A;  1SFO B;  2N88 A;  2PO4 A;  2EYP A;  2A6E C;  2PZU A;  3QG1 A;  1F2Z A;  1MD2 D;  2OEO A;  1A2U A;  2FHT A;  4XYO A;  4OO1 I;  1K8O A;  4O42 A;  2E75 C;  4WFN 3;  2FMC A;  2PQE A;  2NVQ B;  2SEB D;  1M8A A;  1EIH A;  4ZUI A;  2JEB I;  5AFW A;  2K01 A;  2KEC A;  4K8I A;  2WIN B;  3OOC A;  5IGC A;  1EU3 A;  3K5N A;  1H9R A;  3OIQ A;  4FF1 A;  1ILQ A;  3GTJ B;  4K6D A;  2EXZ A;  2D9U A;  1GHK A;  1ET6 A;  2K5D A;  3DWP A;  1KDB A;  1QNK A;  4MHE A;  1I3Q B;  3PIO 3;  1H9K A;  1Z47 A;  5CMD A;  2LFN A;  4X3U A;  4HCE A;  1WD1 A;  3P20 A;  5FOB B;  1CHQ D;  2EZV A;  2A69 C;  2YU9 B;  3RUZ A;  3G6J B;  1G6Z A;  1TKW B;  1LT5 D;  2MHV A;  2DY7 A;  5A35 A;  3I72 A;  1TWF B;  3CU7 A;  1STA A;  4CJ0 B;  1D2B A;  4HR7 B;  4XYQ A;  2G9H D;  3S16 B;  1SEB D;  2H4O A;  1SYE A;  4TQU S;  4KN4 C;  1S5C D;  5E4X A;  3W2D A;  2M2L A;  1O7Z A;  2XN9 C;  1KLG D;  3RZO B;  3X3N A;  1NCV A;  4HED A;  3S9W A;  4IUV A;  3HP3 A;  3M7G A;  2V4D A;  1EQV A;  1WVL A;  1TY2 A;  3S2D B;  1A3V A;  2F0U A;  2HUG A;  4ZLT F;  4LJZ C;  5CV4 A;  3V96 A;  1RHP A;  4BY1 B;  4DNT B;  1T5E A;  1LTG D;  4J1M A;  5T1G A;  3J7A V;  4G7O C;  2AWO A;  3S1N B;  4IFD H;  4A3D B;  1ILP A;  1UEA B;  3ND9 A;  1EY0 A;  3QOL A;  1CA6 A;  1EL0 A;  3KLS A;  5C5L A;  5D3D A;  3NXW A;  4H7B A;  3NTI A;  1B2T A;  2KHS A;  4ZUJ A;  3DWA A;  1GUO A;  1GUN A;  3I73 A;  2HCC A;  5A2Q E;  3NTH A;  5CGK A;  1ENA A;  1IKL A;  1Y1W B;  4KMU C;  3BYY B;  1HTL D;  3BG3 A;  3BDL A;  1EY9 A;  4K5W A;  4A3E B;  4XTC S;  1CK1 A;  3FKI B;  3RD4 A;  2BE5 C;  3NWT A;  3K5O A;  3OWE B;  2BDN A;  1SYC A;  1CTM A;  1MI2 A;  4IFD G;  3CRL C;  1ZYR D;  4I65 A;  3NQI A;  1STE A;  1Y8P B;  4HCS A;  1FR3 A;  4K8J A;  1IW7 C;  2A73 B;  1FGB D;  5EKL A;  2M00 A;  1C4Q A;  3C1E A;  3VR5 A;  5KGU A;  4MN3 A;  1PRT B;  5ELC A;  1HUM A;  1LV9 A;  2F0E A;  4TKO B;  2MP1 A;  1RCV D;  2F0S A;  3VR4 A;  1YNN C;  2JA8 B;  1F9P A;  4EQN A;  1V1P B;  3H09 A;  4X3T A;  3W3A A;  2TSS A;  2H1E A;  4RHS A;  1O7L A;  5IGE A;  2F0W A;  5IGF A;  3H6M A;  1BCP C;  2Y0S B;  5FLX E;  4C3J B;  2B2V A;  3D31 A;  5A2Q L;  4IUN A;  4HMJ A;  3HS0 C;  2NWG A;  3DUZ A;  5NUC A;  1DXM A;  5JAV A;  3BYT B;  1NUC A;  4QUC A;  3D6W A;  1X32 A;  1WCM B;  4NP5 A;  1PMR A;  5KND A;  5EQ0 A;  4H0L C;  3TME A;  2RA4 A;  1S4Z A;  3FPU B;  2CQA A;  3NBH A;  5J22 A;  3A8K E;  1Y69 U;  1U9R A;  5CV5 A;  1R9T B;  3E6Z X;  3VR3 A;  4RCO A;  1B9N A;  2LS0 1;  1EYA A;  3S17 B;  2D5D A;  3K0Y A;  3OSO A;  4DAV A;  1J9O A;  1SNM A;  1D1I A;  1H9M A;  1EWC A;  1CT1 D;  1EZ8 A;  2XNA C;  1PLF A;  1PFM A;  4N9T A;  4M1U B;  5C6A A;  2IWH A;  4H13 C;  1DCZ A;  2NUC A;  2QCP X;  5EJW A;  1E2W A;  4GZY C;  1A3T A;  2O5I C;  1TS5 A;  2K04 A;  4NMZ A;  3M7N A;  1O7Y A;  1WTO A;  3S15 B;  4X3K A;  2MGS A;  1B9M A;  1EY6 A;  5IGB A;  2BOS A;  2RDF A;  1R4Q B;  3TSS A;  2B63 B;  1LAC A;  1TQO A;  2F0H A;  2LMC B;  1VF7 A;  1JCK B;  2JE6 I;  1TT2 A;  4BBS B;  2BA1 A;  2EY6 A;  1HHV A;  4C3J G;  5K5P A;  3T13 A;  4U68 A;  4B08 A;  5M3M B;  3C2P A;  2BA0 A;  1LT4 D;  1STN A;  4FYD A;  1KAB A;  2F3V A;  3NQT A;  1UUP A;  2BDO A;  4F87 A;  3FDT A;  2JXM B;  2L12 A;  3BDO A;  3VA5 A;  4KHV A;  5EPK A;  1DJR D;  1QIL A;  1RD9 D;  5G3L F;  4IFD J;  2A68 D;  5C44 B;  4QUF A;  2WII B;  2O4X A;  1LO5 D;  2KCC A;  3GD7 A;  2A6H D;  2G9D A;  2AUJ D;  3C46 A;  1AEX A;  3CQZ B;  2SOB A;  3SK6 A;  1VMC A;  4HSV A;  1ZXT A;  3EFX D;  4HSP A;  5C3W A;  3T4A C;  2E74 C;  3U9S A;  5JPN C;  2QEJ C;  1PZI D;  2MJ8 A;  1KNA A;  1G8Z D;  3SXH A;  2E2I B;  2O5J C;  3P75 A;  4G57 A;  3PO2 B;  2FJ2 A;  2VB2 X;  2IW3 A;  3PUZ A;  5CBA E;  4RHR A;  2Z8L A;  4LAA A;  3MXP A;  3A7A B;  1L0Y B;  4NKL A;  4FF3 A;  5ELE A;  1B4O A;  4CKE A;  3GTK B;  3NSW A;  3K5L A;  3FMC A;  4JBW A;  1EWH A;  5I9P A;  5EPL A;  1CA5 A;  2D2C C;  4FNF A;  2EYH A;  2EYF A;  4A3J B;  5KYI A;  3I4L A;  1OXV A;  1WD0 A;  1JOK A;  3KK7 A;  4I7Z C;  2F1M A;  2PMZ B;  4XDX A;  2JA6 B;  3D4R A;  1SNC A;  3AMU A;  4U67 3;  1OO9 B;  3VYT A;  4AYB B;  1E2Z A;  4DNR B;  5C0X H;  1BCP B;  2KED A;  1QE6 A;  2HDM A;  2JP1 A;  1SMY C;  4XT3 B;  4WJW A;  1CM9 A;  1TS2 A;  3R2T A;  4ZQ3 A;  5BN3 A;  1EYD A;  3JAM L;  2K7V A;  2JEA I;  1I4R A;  2IX3 A;  3GV6 A;  4B9W A;  1GHJ A;  4TRD A;  4ODG A;  3M4Y A;  3H3V C;  5J39 A;  2X6L A;  3MA2 B;  2ICI A;  2ICE C;  3OMC A;  2KCN A;  1E0B A;  3A8J E;  4RGO S;  4J6H A;  3HOZ B;  3NK9 A;  4FVM A;  1O78 A;  1JE4 A;  3M3Y B;  1Z6H A;  1SNP A;  4J8Q A;  3VYR A;  3HKZ B;  2F0V A;  3NHH A;  4IUR A;  4UAI A;  1VMP A;  1F2L A;  1BF4 A;  4IUP A;  2I07 B;  1QWY A;  4G7Z C;  4O1N A;  5C0X G;  2B2W A;  2RKS A;  5JJZ A;  4FO2 A;  1Q8I A;  5FO7 B;  2JYO A;  1V1P A;  3R93 A;  3I3C A;  2MUY A;  2Q8I B;  4QMG A;  2F0M A;  5ELB A;  1Q90 A;  5DM7 3;  4NDX A;  1O80 A;  2RVL A;  2WP8 J;  2KOL A;  4RKB A;  3HOV B;  1DOK A;  1JIC A;  1LTI D;  3SHL A;  1TU2 B;  3PUW A;  5I6W A;  4XQJ A;  1AN8 A;  1ONL A;  4M8A A;  4F88 A;  5C3X A;  3J7Y W;  4RA8 A;  2B2U C;  4CJ2 C;  3Q23 A;  3KLR A;  5KIX A;  1I6H B;  2RQX A;  3LX0 A;  5I2X A;  3OIP A;  3K6O A;  4IUQ A;  1V1O A;  1EQT A;  1HPC A;  2PNR C;  4IAL A;  2IJ0 A;  5EKK A;  4ID6 A;  4A3F B;  5CV6 A;  3GO5 A;  3S1M B;  4DK0 A;  5CYU A;  3BS1 A;  5IOD A;  4Z9C B;  2EY5 A;  3IFD A;  1MSH A;  2Q8T A;  3R8B A;  2EY2 A;  4CKC A;  3D8G A;  4OIK A;  2Z4H A;  1SXT A;  1DOL A;  2B2U A;  2F3W A;  5IGD A;  2QF7 A;  1GOZ A;  3K59 A;  3CHB D;  5FO8 B;  1ZEQ X;  3EVQ A;  2TMP A;  3A56 A;  2SDF A;  1HFN A;  1GJX A;  1KLU D;  3L7Z C;  5TSS A;  3SK4 A;  4FF4 A;  4IZ8 A;  1D1K A;  1STB A;  5KRU A;  4JK1 C;  3VA7 A;  1G91 A;  3HOX B;  1ROD A;  4ULL A;  2A74 C;  5D3I B;  5IOC A;  1LAB A;  3RMH A;  1XX8 A;  1KNE A;  3Q6S A;  3N52 A;  2B8F A;  4KKT A;  5DM6 3;  4RKL A;  1B53 A;  1HA6 A;  2XSC A;  2J0T D;  1L0X B;  4PQX A;  2XRQ D;  1D5Z C;  2EE1 A;  3MVV A;  5F2D A;  1IYU A;  4KY5 A;  1CZW A;  5DEH A;  5HUR A;  1PTO D;  1ZKO A;  1JOQ A;  2RSN A;  1UAP A;  4L6T B;  2EYO A;  2EJF C;  5D65 A;  1Y8N B;  3NPP A;  3GTP B;  5COY A;  3QB3 A;  4CHT B;  1HRJ A;  1XWE A;  3MXG A;  4K2L A;  3I90 A;  3NP8 A;  1KAA A;  1D5M C;  1BO0 A;  1W6J A;  5C0X J;  4ZAI A;  4S3S A;  5M9O A;  1H9S B;  3SE0 A;  3PUV A;  1IKM A;  4CKB A;  2XIW A;  5E4W C;  3ZYY X;  3D6C A;  4ZRZ A;  2PW5 A;  3SEB A;  3L3O C;  1B1Z A;  3ONA B;  3A55 A;  1F2Y A;  1G2T A;  4G4K A;  5BN5 A;  3Q0A A;  1AP0 A;  4KKS A;  5ELD A;  4RH6 A;  5JVG 3;  1A6X A;  1EY7 A;  2IX0 A;  2E2H B;  4H44 C;  4K5V A;  3NBI A;  2VNU D;  3TN2 A;  2WKD A;  4KTA A;  2FFK B;  5HGT A;  2J4X A;  2DN8 A;  5M5W B;  5LHY 1;  2A68 C;  2KQ3 A;  1OXX K;  3VR6 A;  2F0P A;  2JA7 B;  2DNC A;  4UDU C;  1RTN A;  2A6H C;  4DXG A;  5C0X I;  1GUG A;  1U4R A;  3K7A B;  1F9S A;  4K5X A;  4DA2 A;  5I2Y A;  3MTS A;  2LKV A;  1I4Q A;  1Y1V B;  5JEA H;  2IL8 A;  1W6K A;  4A3K B;  5I9O A;  4F7X A;  3SK5 A;  4WOR A;  3GTG B;  4C2M B;  2KUM A;  4HN7 A;  3EQL C;  1MSG A;  1K8M A;  1QOH A;  3DMU A;  4IUT A;  2F0I A;  1QJO A;  1JC7 A;  2QKI C;  2NN6 H;  3HOY B;  4BS9 A;  3TP6 A;  1PFN A;  2WV6 D;  3IFT A;  1SDF A;  3O13 A;  2O2L D;  3IKJ A;  3VYU A;  1SJH D;  1LLR D;  1STY A;  4FF2 A;  4PV1 C;  1LTT D;  1G2S A;  1SNQ A;  2X69 A;  1KDC A;  3ERQ A;  4OHJ A;  5CV7 A;  3PV0 A;  1S5D D;  3OPO A;  2F0D A;  2C9O A;  5CC4 A;  1CZG A;  1A2T A;  2Z4I A;  1D5X C;  3S1Q B;  5JEA G;  2EVB A;  3FEW X;  1SE2 A;  1R4P B;  1SYB A;  3DXJ C;  1Z7T A;  1EEI D;  5M3F B;  3DM1 A;  2K05 A;  1AFP A;  3NUC A;  4V0B A;  1PDQ A;  3QIA A;  3VYS A;  3PUY A;  3HZX A;  4Q5V A;  1OXT A;  4V19 0;  4CBV A;  3QWN A;  2NN6 G;  2B2Y C;  3OWF A;  3K57 A;  2B8G A;  2EYL A;  3D3R A;  2PPB C;  2RBM A;  1SYD A;  3IAY A;  3BZD B;  1BDO A;  2C5C A;  5C4J B;  5LL6 X;  1S5F D;  1BOS A;  4HTH A;  2L4N A;  1TWH B;  3KF8 A;  2DNE A;  3A54 A;  5IIF A;  5EBD A;  2RDG A;  2B2T C;  5JVH 3;  2F0Q A;  3FPP A;  3MEH A;  1STG A;  1TY0 A;  4BA2 I;  1KDA A;  1Q3L A;  4KN7 C;  1TII D;  5J1Z A;  4C3I B;  5I6Y A;  2OF1 A;  2RDH A;  1SND A;  5EBC A;  4R8N A;  5EKI A;  4QF4 A;  4X3S A;  4DFA A;  1X3P A;  2EYM A;  4C3H B;  1QB5 D;  3JAM E;  1OXU A;  1JOO A;  3OHX C;  1TWA B;  1JR0 D;  1XYI A;  5EGT A;  2K32 A;  4PNY A;  5JOB A;  4QB4 A;  5ISR A;  3M4O B;  4KHZ A;  1QCB D;  5C4Z A;  3WOE A;  1AW7 A;  1EOT A;  1AZQ A;  3PO3 B;  3RLF A;  5I4D A;  4C1N K;  4IFD I;  4R9W A;  4ME5 A;  3H94 A;  1EY4 A;  1FNW A;  4ZK9 B;  3HG9 A;  4ZKC B;  2F0O A;  1Q1E A;  4DAP A;  1ENF A;  3IL8 A;  2PW7 A;  4EQO A;  2XVS A;  1NAP A;  4RGT A;  2CW0 D;  1YNJ D;  1PYW D;  2EPB A;  3HGB A;  5C3E B;  3VR2 A;  2PYK A;  4Y7N B;  1HFG A;  2F4I A;  4EGV A;  2SNM A;  3I4M B;  1ESF A;  2QDB A;  3QOJ A;  3H91 A;  1LT3 D;  4LMQ D;  3GTO B;  2R92 B;  2SNS A;  1VCI A;  5CBE E;  2IX1 A;  3K58 A;  3N6R A;  2E2J B;  2B39 A;  2WB1 B;  4C3I G;  3GQB A;  1F2M A;  3M85 A;  1LTA D;  3ND8 A;  1EYC A;  2I46 A;  4FP5 D;  1JWM D;  4C3H G;  2ID0 A;  1RDP D;  2A5H A;  3UI2 A;  1DON A;  2F0N A;  2K03 A;  5JEA J;  4TSS A;  1HCZ A;  3BDC A;  3H0G B;  2NBF A;  2PZT A;  2EDG A;  1TS3 A;  3LNN A;  1H9S A;  1LT6 D;  3D4W A;  2HQE A;  1JQY D;  1GUT A;  2K5W A;  3U9O A;  3D4D A;  4IN3 A;  4WRD A;  4DF7 A;  1MBY A;  1STH A;  1EFI D;  1QG7 A;  2GA4 B;  3PUX A;  1HTP A;  2KJX A;  3K5M A;  1TS4 A;  2NVT B;  1G29 1;  2Z1C A;  5D14 A;  4RCN A;  4IQZ A;  1TWG B;  4QIW B;  3BVZ A;  1PTO C;  2CHB D;  1ET9 A;  3KLS X;  5C5M A;  1DD2 A;  5CR3 A;  3EA6 A;  1LTB D;  1RJT A;  5K36 H;  4PMW A;  1ZYR C;  2F0T A;  3A8I E;  2NN6 I;  1WTP A;  4A3B B;  1HQR D;  5EPJ A;  2R93 B;  4XIG S;  3P7J A;  2VXW A;  1CI3 M;  4DAY A;  1M4V A;  1SSO A;  4FXK C;  3J80 L;  1JWU D;  3T16 A;  1CHP D;  5CV8 A;  5LL6 S;  2AQ1 B;  1Q1B A;  4CGY B;  3TP8 A;  1ML0 D;  2L55 A;  2K6A A;  3DEO A;  3HRZ C;  2K1B A;  3WOF A;  2FIN B;  4NW2 A;  2X6G A;  2L0C A;  1U4M A;  1I4X A;  2VB3 X;  1NSN S;  4KV6 A;  2Q8R E;  1BR9 A;  2AQ3 B;  2K33 A;  3F2U A;  1K83 B;  4C56 C;  3EJI A;  1PZK D;  5KNB A;  5K36 G;  1SMY D;  2DY8 A;  2CVR A;  1PRT D;  1IYV A;  2WAQ B;  2NTT A;  1U4L A;  2EYJ A;  5C4X B;  2HCI A;  3KBG A;  4BBR B;  1S5E D;  1BUV T;  2NTS A;  1DM0 B;  3I4N B;  2A6E D;  5M5X B;  1HA5 A;  3ITP A;  2YYZ A;  4N9P A;  4KD4 A;  1RTO A;  3LWU A;  4PMB A;  3J7A F;  3T56 B;  2NVY B;  4BWG B;  1WTX A;  4KJO A;  3SDZ A;  2K28 A;  3NTK A;  2F0F A;  4HMI A;  1SE3 A;  3GV3 A;  1PZJ D;  2ENB A;  1A15 A;  1I4P A;  2PCF B;  1SAP A;  4KY7 A;  2KA7 A;  1EU4 A;  4F8M A;  3GP7 A;  3GTQ B;  4PMC A;  5FKA C;  1SE4 A;  3MXU A;  1EEF D;  1WTW A;  3R2I A;  1FNU A;  2ZXO A;  2R3Z A;  4Q0F A;  1HUN A;  3QO2 A;  2AQ2 B;  2F0J A;  2JSO A;  1S5B D;  1BNZ A;  1CQF A;  2HDL A;  1C8C A;  2F0G A;  4KI0 A;  1EZ6 A;  4K2K A;  3SVM A;  1RF2 D;  1SYG A;  2AWN A;  2A69 D;  4XQQ A;  1PFB A;  1V8Q A;  1HQM C;  3TP5 A;  2EOT A;  1XTC D;  2XRS D;  1T5X D;  2ZT9 C;  1JWS D;  1DYQ A;  2B2V C;  3R3O A;  3PIP 3;  4LK1 C;  1F9Q A;  3ERO A;  2MPM A;  2EY1 A;  1EY8 A;  2VUM B;  3E5S A;  3J81 E;  3MAQ A;  5C4H A;  4OO1 H;  2E2D C;  3KUP A;  4KK7 A;  3GTM B;  1DOM A;  1BBX C;  1F77 A;  2FMM A;  2LY7 A;  1LTR D;  2NVX B;  1VF5 C;  1PRT F;  4RWS C;  1I4H A;  4OL7 A;  1Y8O B;  5G3L D;  3DEP A;  5IGG A;  2R6G A;  4ZKB B;  5T1I A;  4C1N I;  4ZYS A;  2L1B A;  2F0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...