1WD1A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*AP*CP*GP*TP*AP*GP*G)-3'
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd1A00
3DEOA 1EL0A 2DY7A 4X3TA 1J9OA 4IUQA 5E4XA 5CBAE 2X6LA 1BF4A 1S4ZA 2FMMA 2RVLA 1IKMA 1KNEA 1JICA 2SDFA 4RWSC 1SSOA 1F9PA 1CM9A 2B2VC 1MGSA 5EJWA 1ICWA 2B2WC 2JYOA 3MWYW 3I90A 3SVMA 2K1BA 2RA4A 1B53A 3F2UA 1G91A 4R9WA 3I8ZA 4ZAIA 5CBEE 1LV9A 1XX8A 5D65A 2L12A 5EPJA 4CJ0B 4R8IA 3H91A 1B50A 4IUPA 1X3QA 1BO0A 4IUTA 2EOTA 4ZK9B 1Q3LA 1WTRA 4DN4M 2JP1A 4CJ2C 2X6GA 3P7JA 5D14A 4ZKBB 2DY8A 2K05A 3TN2A 2FHTA 1IKLA 3IFDA 5COYA 1AP0A 4IURA 5EQ0A 4ZLTF 3I3CA 1DONA 1HRJA 3GV3A 3HP3A 5AFWA 5E4WC 1HUNA 1RTOA 5EPLA 1O80A 4LMQD 3I91A 4HEDA 5JJZA 1PFBA 4NW2A 1RTNA 1SDFA 4XT1B 1C8CA 1IL8A 1VMPA 3FDTA 1U4LA 1B3AA 4MHEA 4CJ1B 1WTPA 1HFNA 1DOKA 1VMCA 1DOLA 3DM1A 2FFKB 4OIJA 2KEDA 5CORA 4HSVA 2Q8TA 1WTXA 1JE4A 1EQTA 2NYZD 3IL8A 3QO2A 1BNZA 2L4NA 3UI2A 1O7YA 4UAIA 1NR4A 2B2UA 2BDNA 4HAEA 2H1EA 2HDMA 1ILPA 1MSGA 1ESRA 2RSOA 1G2TA 2HCIA 1X32A 1U4MA 2L1BA 4ZKCB 2KECA 1WD0A 3G7LA 2CVRA 2KEEA 2KOLA 1RODA 1ILQA 1MSHA 2MJ8A 4X3SA 3TZDA 1AZQA 1HHVA 1KNAA 1A15A 2M2LA 1HUMA 2B2YA 1U4PA 2X69A 3R93A 1G6ZA 1M8AA 3ONAB 2L9HA 1ML0D 5T1IA 1CA5A 1QG7A 1QNKA 1O7ZA 3LWEA 2K01A 1HA6A 3KBXA 2B2TA 2RSNA 1E0BA 1RJTA 2VXWA 1DOMA 1EIHA 2N88A 4X3UA 1MI2A 2HCCA 1J8IA 1PFNA 1DZ1A 4O42A 2K28A 2HDLA 1BBXC 1HFGA 1CA6A 1NCVA 1WTVA 5EPKA 2KVMA 3MTSA 3GV6A 4IUVA 1WTQA 2B2VA 2EE1A 1PLFA 1WTOA 3FPUB 2K03A 1G2SA 3N52A 1RHPA 3KUPA 1NR2A 4QUCA 5DNFA 1WVLA 4IUUA 1AZPA 2B2WA 2FINB 2L11A 1F9SA 4MN3A 5CMDA 2B2UC 1EIGA 1F2LA 2NWGA 4QUFA 2NZ1D 2Q8RE 3D6WA 1GUWA 2IL8A 1U4RA 2J7ZA 4XDXA 3DEPA 2XIWA 1ZXTA 3Q6SA 2FJ2A 4U68A 1QE6A 4RAUC 4X3KA 1F9RA 4RA8A 4XT3B 1NAPA 1WTWA 2EPBA 1PFMA 2D9UA 1XYIA 2B2YC 2K04A 1WD1A 1SAPA 2HUGA 2MP1A 2R3ZA 1B2TA 1B4OA 2MGSA 5T1GA 5EKIA 1F9QA 1EOTA 2MPMA 1X3PA 4OIKA 2N55A 2B2TC 1PDQA 2KUMA 4HCSA 1TVXA
chains in the Genus database with same CATH superfamily
4B08A 4C3JB 4RHRA 1S4ZA 2XWBB 1BBUA 3SDZA 2RF4A 4DK1A 2ZJPA 3C3LA 1MGSA 4DUYQ 3K8AA 1N33L 3HKZG 4KY6A 3SVMA 3L3OC 4IFDG 1FJGL 4DK0A 4LF9L 1YITA 1SE8A 1XWEA 2EOTA 2JP1A 3U4ZA 3KBGA 2HQEA 2K05A 3CP0A 1EY0A 2I5HA 4QF4A 1FL0A 4OEMB 5JVH3 5LMUL 3CQZH 1K73C 4PZ7A 3QIAA 1HPCA 5HY6A 3OMGA 1IL8A 3K81C 2QGQA 4MHEA 3HRZC 4QIWB 3H0GH 4A3FH 2NVYH 2RBMA 2A19A 1HTPA 2PCFB 4F87A 4QJFA 2E2HB 1TR5A 4DV0L 3BG3A 3PUVA 3IKJA 1F2ZA 5KNCA 3GTKB 3OPOA 2RSOA 1S5CD 2JE6I 1LT4D 2VL6A 2AHOB 1BOSA 1GUGA 1S5DD 3HOXG 3MXNA 1HUMA 2X69A 4IQZA 2NZHA 4X65L 5K36H 3HOWH 2R92B 4Y7NH 4KHVA 4BA2I 2UUCQ 3F1ZA 4KK7A 3V96A 3VDYA 1I4XA 4DV4Q 1VQJA 3T56B 5I2XA 1IL2A 3A8JE 2CFMA 1E3PA 1CSQA 4R4OA 4JPBW 1I94L 2K75A 5JJLA 1CTMA 2JEAI 1YHAA 1WVLA 2VQFL 3FKIG 1GXDC 2FINB 4MN3A 3UDFA 2D5DA 2F1MA 2N8NA 2NWGA 2NZ1D 5IP9H 1XMQL 4G7OC 3C46A 1ZXTA 2FJ2A 1QE6A 4DV7Q 4A3EH 4X66L 3GTGH 2ALYB 4ME5A 4KMUC 4A4IA 1S3OA 4KHPQ 2F0HA 2HUGA 5IT9c 4G7HC 1JJ2A 4NPSA 2B63G 1D5MC 4BBSH 1TVXA 4CBVA 3MA2B 2PMZE 4B3SL 3A7AB 2ZM6Q 2F0UA 2OT2A 3KJPA 2R92G 4BY1H 2VW9A 2TMPA 1IBMQ 1I3QH 1STNA 4B3RQ 3D0FA 1XJVA 4DAYB 2D0PA 4IFDJ 2PQAA 3H09A 2R93G 1ICWA 3KYHC 4L5QA 1B53A 4LNQA 4YY3L 4QY7A 1HTLD 1LV9A 1TWAB 1DXMA 1W6KA 5C4XG 1QUQB 5DAUA 5FLMH 1TWGH 1LYLA 4DV3L 1HNXL 4OWTB 1MD2D 4QMGA 3QOJA 4K6DA 4LF8Q 4DAMA 3KOJA 1L2FA 4K2KA 1SE2A 2ZXPA 3FDTA 3E0JA 1EU4A 4WRDA 1NTGA 4CJ1B 1MIUA 3HOVH 4OIJA 3HKZE 3CAMA 2CWAA 2FFKB 1TQOA 4RG1A 1JE4A 2XWJB 3PUXA 3M7NA 3F2DA 2K50A 4A3IG 3HOZB 4MZ9A 3CRKC 1MSGA 4N8X1 2PW7A 1ESFA 3G71A 1EUJA 2KECA 3A5UA 1H9SB 1RODA 4HSPA 2EYFA 1STAA 4DF7A 1R9TB 4PV1C 4JG2A 3E0EA 1KAWA 3SK4A 1PYBA 3S1MH 2WINB 4UP7A 4ABNA 1EIHA 5CC4A 4X3UA 3I4MG 1GD7A 2K28A 3KLWA 3T1HQ 1HFGA 4YCUA 1E22A 2KVMA 2KA7A 2R61A 1FGBD 3PMFA 4IUNA 4LFAQ 4HMIA 5A35A 4RCOA 3PF4A 3OWEB 5M3FH 1JWMD 4R1JA 2XIWA 1O78A 2UU9Q 3S15B 4G7ZC 3NTIA 1TU2B 1QZGA 1YHQA 2WB1G 4IPDA 4TRDA 1XYIA 3WOFA 4X64Q 3Q8DA 4X62Q 5LL6X 2MGSA 1F2YA 1SEBD 3FHWA 4B9XA 1I6HH 2DY7A 2ZXRA 1BUVT 1J9OA 2QW7A 3SGIA 2X6LA 2A73B 1IBKQ 4HCEA 2NN6I 4QIWE 3PGZA 2MHVA 1CZWA 1JMCA 1CM9A 3M7GA 2E2IB 2XN9C 4LF7Q 1WJJA 3M3YH 4A3BH 2PW5A 1E2VA 1FR3A 4V190 4OELB 2L12A 2PYKA 1B50A 3N6RA 1OO9B 3NTKA 4G4KA 2X6GA 3P7JA 2HIXA 2F0FA 3TP5A 3TN2A 4A93B 2CKZB 1ZEQX 4R4CA 3VR6A 3V05A 3CCQA 2UUAQ 1A63A 5E4WC 2P5ZX 2GN5A 1O80A 3J80i 1SNOA 4NW2A 3OOCA 4UP9A 1ASZA 1A62A 1VMPA 2NN6G 3S1NH 3D3RA 1B3AA 1HFNA 5DM63 1Q1BA 2WAQG 2E75C 3K59A 2D62A 1JWUD 1BNZA 4DR7Q 2RHSB 5AJ3Q 3RLNA 2F0EA 4OWWB 1JOQA 4GNXC 1ET9A 3PO3H 5C0XH 4DR1L 2I0QA 1YNNC 2MJ8A 2WP8J 3Q22A 1MJCA 2ICEC 1Z47A 3RZOH 4Q5VA 4BXXG 1R4QB 1D7QA 5JPNC 4A93G 4POFA 3BJUA 3I55A 1EIFA 3VA5A 5M5YH 2JA5H 3B6YA 3QR8A 2NUCA 2EE1A 1TY0A 4RFBA 1NR2A 2E2JH 2Z1CA 1A0IA 1IBLL 3TP8A 4ZCKA 4GKKQ 4DR5Q 4C1NK 2HIVA 3JAMc 2DUDA 4JI4L 2AQ3B 4HTHA 4OO1H 1LTSD 1SROA 4LK1C 2XTIA 3OIQA 2SEBD 1UAPA 2KJXA 4JBMA 2B2YC 4MNOA 3GTPB 1WD1A 1M1KC 2R3ZA 3FP9A 4C3IG 3K58A 4IJHA 3U9OA 4DV1Q 4KHZA 3ITPA 1YVCA 5J22A 2H5XA 5I6WA 1Y1WH 4OX9L 3J7YW 4HJAA 1K3BC 3MXGA 1C48A 2NBFA 2K5DA 3PQIA 4P75A 1K28A 1AE2A 4R8IA 1XX8A 2WB1E 2ZXOA 2UUBQ 3A55A 2Z6BA 4DN4M 2A6EC 3OW2A 4MTKA 3UDXA 3Q23A 1N36Q 4NXNL 5CV8A 1IKLA 1LT3D 4GZYC 4ZLTF 3U4VA 5EPLA 3KFUA 4BBRB 3RNUA 2JA6B 5JJZA 4XXEA 3CU7A 4LF4L 2OWOA 3S14B 1DOKA 3NSWA 1TS4A 5I9PA 4HSVA 1W3SA 4DAPA 4JI1Q 4A3DB 4AIMA 4LFCQ 1ENFA 2C5CA 2RCNA 4A3MH 1BCPC 5FK9C 1DM0B 4KJNA 2VUMG 3DXJC 3W1GA 2PZWA 5M5WB 4F7XA 4A3KB 3K5LA 1N9WA 4DR6Q 4B3TQ 3TSSA 4JC0A 1EOVA 5IGBA 1CA5A 1CZGA 2K01A 3BYYB 4DK6C 1NBWA 2B2TA 1Y8PB 1MHWC 1I50H 5IYCH 1J5EL 4LWCA 4YIJA 2ENBA 5DNFA 4C2MB 2PI2A 1AZPA 1V9PA 2YV5A 3NEMA 5M3MB 3D6WA 1UEAB 3GTJH 4DAYA 2WKDA 1TWCH 1KRSA 1ONLA 2CW0C 4X3KA 3W2DA 4JYAQ 1VS0A 5FJ8H 2CCZA 1GUTA 2MO1A 3A5ZB 1PTOH 2JA7H 2XVSA 1PRTC 4IJLA 1SYGA 1OXVA 5IY0A 1QUQA 2KUMA 1YNJC 2QEXA 1Z7TA 3LX0A 5E4XA 2HD3A 3W3AA 1U0LA 1EWIA 1I4GA 1FYCA 3HOUB 4QL5A 4DV2L 1KL9A 3UE1A 1S5ED 3K7AB 2KBNA 3P75A 2JYOA 2RA4A 1PH1A 4JK1C 4A3JG 3F8TA 5IGCA 3S2DB 3A8KE 5M9OA 4EX5A 4E6IA 4JI0Q 3PIO3 2JXMB 4DK3C 1Y1VB 5IYBH 4AYBB 5IP7G 2JK8A 1NNXA 4NKLA 4EGVA 5M5XH 2R7ZB 1HRJA 3BZCA 1VQOA 4KKTA 1LT6D 5C44G 1H9SA 3I91A 4AQYL 2J0TD 1MKHA 1KTKA 1X55A 1EWCA 3J7AV 1I4HA 2NVXB 4JOIA 3NQTA 5I2YA 4BA1I 2KEDA 3KDFB 1D1IA 3HOYH 4C3HH 3PV0A 4RKLA 3I4LA 4F88A 3GTLH 3M9BA 3DWPA 2IW3A 1K83H 1VQ6A 4P2CB 2WFWA 3BVZA 3MFGA 3J7ZC 2HCIA 2L1BA 2RKSA 5FO8B 1L0YB 3TZDA 2PMZB 1JC7A 4KN4C 3TZUA 4K6LA 3S16H 2F0OA 1GOZA 1S5BD 4Y7NB 3BU2A 1O7ZA 2UXDQ 5ELCA 2EJFC 4KKUA 4EQ5A 3HGBA 4HIKA 4WJ3M 1RKNA 2R7ZG 4LFBQ 2Z8LA 3BS1A 1SMXA 1HH2P 4GLAC 1EQVA 2L11A 1G51A 4ILWA 4A3FG 3H0GG 1EYGA 3S1QH 1SFOB 3DEPA 3Q6SA 5EAYA 4A3GH 1HR0Q 1BXTA 1KDCA 1WCMH 4JI6Q 5C4HA 2MNAA 3A0JA 1VQDA 4LF6Q 4B9WA 3STBC 4IALA 1LT5D 1GO3E 2ES2A 4OHJA 1CQVA 2GA4B 5FOBB 1N32Q 1DGSA 1EOTA 4KJOA 5E3FA 1PDQA 4BBSB 1WTHA 2OTJA 5C3WA 4DUZL 2Q2HA 1WYDA 2DGYA 5LL6S 1IKMA 5K36G 3HOWG 5A2QL 4K0KQ 1PVOA 2K5WA 1SYFA 2RDHA 1X3EA 4BY7H 1TWHB 5CV4A 2JEBI 2K4KA 1BDOA 4DUYL 2B29A 4CGYB 2UXCL 3SR1A 5C5MA 1FNUA 1WTRA 5JEAH 2AWOA 4DR3Q 2DY8A 3KLSA 2EYOA 1K8MA 1Q86C 3P1HA 5C3EH 5IP9G 5D3IB 1K8OA 4LMQD 3ULLA 1K3RA 1EZ8A 3CCJA 4O1NA 3EQLC 4HJ9A 1U4LA 1AH9A 1WTPA 1Q1EA 4EQPA 1SXTA 3J80c 4QQBX 3QOLA 1DOLA 3HOVB 3M4OH 3E6ZX 4BBSG 3HOXB 1X3FA 4N9TA 4DKAC 1FD7D 3RZDH 1XPRA 3OW7A 4DU9A 5KNBA 4BY1G 1Y14B 1XMOL 1U4MA 1STYA 1ILQA 4X3SA 3BVGA 5E7NA 2A74C 4RGNA 2G9DA 1O7LA 4A75A 3I7FA 4P73A 1D5ZC 3FKIB 2L9HA 5A2QE 1QNKA 3K7UC 1SE3A 3ICEA 3C2PA 4C56C 2SNMA 5FLMG 1HZAA 2M9VA 4DV6Q 1V8QA 2K5HA 4H02A 4LAAA 1NCVA 3M4YA 3NE5B 5IYDH 5G3LD 1WTQA 2E74C 2B2VA 2EQSA 4KY5A 3TMEA 1G6ZA 4OWXB 1OXSC 1BQQT 2B2UC 2XRSD 3BYTB 2JA8H 2B63B 1N33Q 3HOVG 4QCLA 2UXBL 3BDCA 3SK8A 2IL8A 1QVFA 4LF9Q 2IX3A 1V1PB 4UY8C 4F8MA 2A6ED 4RA8A 1CT1D 1A3UA 3AU7A 4LUOA 3E9IA 4RGTA 2N3SA 1XTDA 2K04A 4WJ4A 5JJIA 1CUKA 1JB7A 2R93B 4OGQC 4AYBE 5EKIA 2R6GA 5ELFA 5LMUQ 4KHPL 5IWAQ 1X65A 3PO2H 3GTMH 5C4XB 2K7VA 1PMRA 3CHBD 1NMGA 2M00A 3CCUA 3KJOA 1PH2A 4CDFC 3KLSX 1RD9D 2E5LL 3PUYA 2GVAA 4OXPA 2K1BA 4HN7A 3S9WA 4DV0Q 3X3NA 1BCPD 4ZAIA 2A1AA 4CDCC 4IUTA 4A3LH 1TWFB 4UHVA 1BCPF 2N78A 4POGA 5M3FG 1HQRD 1PZKD 4UDUC 3TRZA 1H9RA 1T5EA 4JI7L 1SN8A 2EY1A 4B3MQ 1SRUA 4A3IB 1RIPA 1UEBA 5GAHC 4XT1B 5EGTA 1STHA 2FMCA 2F0MA 4ZUJA 1D1KA 2QDLA 4PMBA 2BCOA 5I9OA 2EZVA 1VF5C 3LWUA 3CKIB 4JCVE 2LXKA 2J4XA 4GOPC 1JR0D 2RDFA 2Q8IB 2A68C 2E76C 2VQFQ 5LMNW 3M4PA 4RCNA 2QEJC 3IFTA 3PO3B 3I4MB 2CW0D 1KRTA 2BDOA 1M90C 4A3BG 1JORA 5GROA 1ZKOA 3SE0A 1JJGA 1PH7A 2F0WA 3NWSA 1PRTD 2K5NA 4JVZA 4PMWA 5C0XI 4KD3A 1YNJD 1L1OA 1SE4A 4HJ5A 2K6AA 3LNNA 3U9SA 1SYEA 5M5YB 2WB1B 2ZJQA 4C3JH 2ID0A 1H9KA 1G2SA 3N52A 1RHPA 5IODA 5C4JB 1GHKA 3BDLA 2OCEA 3SK5A 4LFAL 1U4RA 2OTLA 4YY3Q 4CDEC 1WTWA 2UU9L 1Q82C 1RDPD 3MHBA 2F0VA 3A54A 3URYA 1UE6A 2FXQA 4DV3Q 1HNXQ 2XSCA 3PO3G 3CPWA 5C0XG 1AE3A 2WKCA 3I72A 1B8AA 2DJFC 4X64L 4R4TA 1TXYA 3UDIA 2RCFA 3VR3A 3MVVA 4X62L 1TS2A 2F4VQ 1LO5D 2EIFA 4OO1I 1A2TA 2H4OA 2ZTEA 4DV5L 1TT2A 2EYHA 3H3VH 3QJYA 1K9MC 2NVQB 1IBKL 3SK6A 3I73A 1MBYA 4KD4A 1CK1A 1PZID 1B1ZA 3I90A 4AH6A 2A69D 3KF6B 2E2HH 3KDFA 1VCIA 3OMCA 5D65A 4IN3A 2JA5G 1SNCA 4G57A 3GTKH 2WAQB 2B3GA 5HGTA 3EN2A 1XPOA 1PH3A 4JI3L 2B39A 2PO4A 3EBEA 1U9RA 4HEDA 4DFAA 3K0YA 4OO1G 3VR4A 3TBIB 3T51B 1V1OA 3OWFA 1GJXA 2JJQA 5LMNL 4GNXB 2EY5A 1WTXA 1HJPA 5C5LA 5JPMC 2RHQB 1PH8A 4KY7A 4FXGC 2YTYA 1Y1WG 2RDGA 1CFMA 4HAEA 1S5FD 1HNWL 1X9NA 1EY8A 1I4RA 3PIPA 1ZYRC 1WD0A 3K5NA 1YJWA 1B9MA 2KEEA 3I4NH 2KOLA 4YHHQ 1J6QA 3CD6A 2Z6KC 1KNAA 3STBD 1CQFA 3TP6A 4TVAB 1M8AA 4NP5A 2EDGA 1PH5A 3GQBA 3OHXC 4IO9A 4FF2A 2BE5C 2ZTCA 1MI2A 4RKBA 1A3VA 1DZ1A 3V2TA 4XQQA 1CA6A 3H6MA 3MTSA 3DUZA 1EY7A 4HJ7A 5CR3A 3GTOH 4J15A 3T16A 2NVTB 4C3IB 3BVMA 2NTTA 4C1NI 5C3XA 1WI5A 1F2LA 1CHPD 3RN5A 1IW7C 4I7ZC 4IOAA 3AQQA 4U68A 2K5QA 2C9OA 2IWHA 4JI5L 1X54A 4GKKL 4DR5L 3PSIA 4FVMA 1CKOA 1TWAH 5EKKA 4QGUA 1AN8A 3E5SA 5C0XJ 4A3MG 3CXCA 3S2HB 1EYAA 2B8FA 2F0LA 1IYUA 5FKAC 1CKMA 2L0CA 5F2DA 2EXZA 4GS3A 2D2CC 4HIDA 4GKJL 5EPKA 4ME3A 5IOCA 2VQEL 3R2TA 1BF4A 1Q8KA 3NELA 5FLXL 2BH8A 1ENAA 1ET6A 1TS5A 3K57A 1BVSA 2B2WC 2O4XA 1VQNA 3D4WA 5IYCG 1XNRQ 3Q24A 5L37A 3K6OA 4Z9CB 3SEBA 3HOZH 5HGQA 5D14A 2BA1A 2Y0SG 4RH6A 2F0NA 3K80C 5BN3A 3T53B 4PMCA 3MAQA 5JAVA 3CCEA 1EFWA 5I6YA 1PTOC 1GUSA 1KLGD 1D8LA 1R9TH 5FJ8G 3T1YL 2VUMB 2V4DA 1JQYD 2JA7G 1BCPB 1VMCA 3U50C 1UWVA 2Q8TA 2TSSA 2SNSA 1E7ZA 5IT9L 3M4QA 2XRQD 4KN7C 1RL2A 2PNRC 2ZTDA 1LTRD 1UE1A 2AWNA 4JI1L 2BDNA 1EWHA 2IHFA 3CC7A 2I46A 2HDMA 1P8LA 2JQOA 1Q12A 4LFCL 1IBLQ 1Q46A 4QB4A 5IE8A 4ZKCB 5KGUA 4JI4Q 1HHVA 2IHEA 4JBJA 1V1QA 3S15H 4XYQA 1VQAA 2F0QA 2OXPA 1K0RA 5T1IA 1JWSD 2Q2IA 4DR6L 4B3TL 5JJKA 4MIUA 5FLXE 4LUZA 3G48A 5IYBG 3CCRA 2ZJRA 5KRUA 1TKWB 2AQ1B 1FGUA 4PQXA 1SJHD 1KC8C 3GV6A 4OX9Q 5NUCA 3QB3A 5BR8Q 1QJOA 1R4PB 3W1BA 1DYQA 1NY4A 4DNIA 2Q2UA 4ZYSA 3HOYG 4K2LA 2E2IH 4C3HG 1PRTB 3MEHA 2PZUA 4RAUC 3VYSA 1JOOA 1WCMB 3BZDB 4YWMA 1GKHA 2WAQE 1PFMA 2PQEA 5H1SE 4EQOA 2HHHL 1YHBA 4KV6A 3WWVA 1JE5A 3G6EA 1F9QA 3L9AX 1E1TA 4A3JB 1HR0W 3R8BA 3DEOA 3F2CA 1T5XD 2IX0A 5IT9E 3FRPB 4X3TA 4IUQA 4LF4Q 1JICA 3NTHA 1XNQL 5KYIA 3GTQB 3KF8B 1RF2D 2EYPA 5ELEA 3S1RB 5EJWA 4JV5Q 2KCNA 5IGGA 2EVBA 3CW2C 3EVQA 5CV9A 2A68D 5C44B 4L63B 3CCSA 1C4QA 5EPJA 5GAEC 4ZK9B 3TS0A 1Y69U 4GN3B 3RLOA 3VR5A 4A3CH 2MQHA 5COYA 5IGFA 4N8FA 4JI0L 4DR4Q 2F52A 1K8AC 4A3GG 1X6OA 1HA5A 1WCMG 1PXUA 1VQ8A 1N34Q 2EYLA 3L0OA 4GLXA 3S17H 3NQIA 2PZTA 3IL8A 3S24A 2F4IA 1LABA 3OTOL 5BN4A 5FO7B 4NXMQ 2Y0SE 2RQXA 3X3MA 1G2TA 2VB3X 4BY7G 5DEHA 1OXUA 2CVRA 3VYUA 4O0AA 3CQZB 3J81L 4GN4B 2QCPX 1VQKA 2KHIA 1UE7A 3G6JB 4HIMA 3ER0A 3NK9A 3CCVA 3LWEA 4A3FB 5JEAG 3H0GB 4CDDC 2NVYB 3GTPH 3IRBA 3FPPA 1BKBA 3NUCA 5IGEA 2UXDL 1PV4A 5TSSA 2HCCA 2OQKA 2K5VA 5C3EG 4LUVA 4IPGA 1FNVA 1WTVA 1LTBD 2XNAC 2A69C 1VQMA 2I5LX 1YEZA 4TKOB 4DV2Q 1VQGA 3TQYA 3SHLA 1EYCA 2WACA 1X3GA 4LJZC 2VY3A 1HQMC 1XTCD 4DR2Q 1XXGA 1JCKB 3ULPA 3HOWB 1HR0L 3KF6A 4JI6L 1A6XA 3LGJA 4BS9A 5ELOA 4FXKC 4WFN3 1PH4A 2MPMA 3DWAA 1VQ7A 1QVCA 1NSNS 1RTOA 5FO9B 4ZRZA 1N32L 4HJ8A 4AQYQ 1EU3A 4BBRH 2JA6H 1H9JA 1TIID 1SMYD 4LF5L 3AFQA 5E1FA 1EY5A 4JI2L 2Z9HA 1DD2A 4K0KL 3S14H 3K0XA 2BOSA 3GO5A 2CWPA 3F2UA 4A3EB 4K5VA 1F77A 3GTGB 3J81E 3I8ZA 2K52A 5IYDG 1UE5A 4A3DH 4GNXA 1QWYA 2VB2X 2F0KA 3H91A 4KI0A 2OQ0A 1Q3LA 1ZYRD 1VQ9A 2WIIB 4XIGS 1WOCA 3TS2A 3GDEA 2JA8G 3VA7A 4NMZA 4IURA 5M5WH 3A8IE 4K5WA 4H44C 4A3KH 1JB3A 4X6AH 4R4QA 5IGDA 3JAML 4BY1B 1IYVA 3VYTA 1RTNA 1I3QB 3AEVA 3CCMA 1P16A 1NJIC 2BE5D 4J1MA 2KHJA 4BWGB 2F03A 4IOCA 2R7DA 2V1CC 4J6HA 3NBIA 2R7FA 3H15A 2AUKA 3VYRA 3ERQA 2KCCA 3PO2G 3NENA 5CGKA 1NR4A 2EY2A 3I56A 3L2PA 2N49A 3J7A5 1ILPA 1IW7D 1TWGB 4C2MH 4NDXA 4L6TB 2O2LD 5M3MH 4K5XA 4ZUIA 4U673 1QCBD 2LFNA 4ID6A 5ELBA 4PNYA 4A3EG 3I70A 5JEAJ 3D8GA 2B2YA 1U4PA 3R93A 1B70B 3ONAB 4A3LG 3KK7A 3KBXA 5CV7A 2VXWA 1DOMA 1EIYB 1I4PA 1OTCA 4O42A 1EY9A 4PZ8A 1HNZQ 5ISRA 3K5MA 3HOUH 2KCTA 1IZ6A 3Q0AA 3K7AH 4P71A 2UXCQ 3I4OA 4M8AA 2CH4W 3TEHB 1BBWA 4JI8Q 1NAPA 3JAME 1VQ5A 3S1MB 3S2DH 2OEOA 3IAYA 1YIJA 1SAPA 3FEWX 2UUCL 4YCVA 1PTOD 1Y1VH 4EVOA 2Z4IA 1Q81C 4DV4L 3NBHB 2R7ZH 4JBKA 3EFXD 5IWAL 1PTOF 1BR9A 1L0WA 2ATWA 3BZKA 2AQ2B 5G3LF 5M3FB 2ASBA 5CYUA 2NVXH 1FJGQ 1CKNB 5C4ZA 1G8ZD 1STBA 3E3XA 1G91A 4R9WA 1VQBA 3MXPA 2EYMA 4DV7L 4J8QA 4DNTB 2LXJA 3RUZA 2NTSA 3ND8A 4IUPA 4C3JG 1PH9A 3H3VI 4RGMA 4CJ2C 1XMOQ 2CQOA 5HURA 2YU9H 1EQRA 3MFYA 2HQLA 3CMAA 1EFID 1STEA 1I6HB 5AFWA 1SYDA 3GD7A 1KIXA 3NP8A 2ZM6L 1Q7YC 4B3ML 1SDFA 4GOPB 3ULJA 5FLXc 1KHIA 1DJRD 3R3OA 1IBML 4B3RL 3DM1A 2EY6A 3D31A 5CORA 3M3YB 5DM73 4A3BB 3QO2A 3H3VC 2L55A 2A6HC 1U5KA 5GADC 1S72A 2EJMA 4TQUS 3DLLA 2Z0SA 2H1EA 2PPBC 4LW1A 2UXBQ 3RR5A 3I4NB 4M1UB 4X65Q 2LS01 1SFOH 3RN2A 2HT1A 4H0LC 1SNPA 2M2LA 1YNXA 2XGTA 4O2DA 1AFPA 1W2BA 4LF8L 1SBBB 4P74A 1ML0D 2K33A 3S1NB 1QG7A 5BN5A 3NHHA 1GVPA 2F0TA 1I94Q 1J8IA 4IFDH 2MUYA 2F0JA 2HDLA 4WORA 1QNUA 3D4RA 3ND9A 1EYDA 1Q8IA 2LSSA 3EROA 3GTOB 1XMQQ 4IUUA 1F9SA 1VQEA 2E5LQ 1PZJD 4X66Q 2LY7A 1TWHH 1VF7A 4XDXA 5KNDA 3KF8A 3I2ZA 5KEEA 1N8RC 1KABA 2F3VA 3K5OA 3AB9A 3RZOB 4K8JA 5ELNA 4MTNA 1EZ6A 1PRTF 4B3SQ 2B8GA 1SNDA 3FMCA 4OIKA 4JI7Q 2B2TC 1YJNA 3I4NG 4ODGA 2JA5B 3T1HL 3C1FA 4FF3A 1IXRA 3VR2A 3AFPA 2F4VL 1KNEA 2E2JB 1H95A 1SSOA 2F0IA 2EXDA 3CRLC 1QB5D 4A76A 3RMHA 3G4SA 3HOXH 1LTTD 4L8JA 1EEFD 4YCWA 1C0AA 2F0GA 2G9HD 1BO0A 3PUZA 2DNEA 1VQ4A 1B44D 4HMJA 3AMUA 4H13C 4EQNA 1II3A 1NE3A 3TP7A 3L7ZC 5GAGC 3GV3A 1IHZA 2JN4A 1G6PA 1Y1WB 3KLRA 1PFBA 1C8CA 4HIOA 3FKIH 2K14A 2L15A 4XQJA 1C7YA 3QG1A 4XYOA 4L5SA 2AMCB 4LF7L 3DHQA 4FO2A 1GUOA 4N9PA 1JJCB 2SOBA 1B3QA 1VQCA 2B63H 3G7LA 5DLQE 1AW7A 1YZ6A 2UUAL 4KLKA 4YHHL 4YWKA 1QOHA 2R92H 5EBDA 2CHBD 1IYJB 3HOZG 1HA6A 4APVA 1SMYC 2L5TA 3NXWA 5EKLA 1TY2A 4RHSA 2R93H 1GUNA 1PFNA 4JOIC 1LUZA 1QILA 3OSOA 1K8GA 1BBXC 4DV5Q 4OONA 1YJ9A 4A3MB 4DR7L 2IY5B 1WTOA 5C4XH 1MJEA 4QUCA 5AJ3L 4ALPA 2A8VA 3TDQA 2IPKD 4I65A 3J81c 1D5XC 2QF7A 3J80L 3MC0B 4Y52H 1A3TA 1F9RA 5J3BA 2D9UA 4K8IA 4V0BA 1B7YB 1TWFH 1I50B 4DXGA 3D6CA 1KLUD 2N55A 4JI3Q 1I4QA 1VQHA 4DPGA 4A3IH 2DN8A 2RVLA 4PZ6A 2Y0SB 4RWSC 3PIP3 2AKWB 4FNFA 5LMNQ 4PG3A 5KIXA 3GTJB 3MWYW 1TWCB 2E2DC 1KAAA 5J1ZA 4CJ0B 3RD4A 1K0SA 1HNWQ 1X3QA 1XNRL 1PTOB 2OF1A 2JA7B 2GVBA 1ICFB 2NZOA 1V43A 2FHTA 3I4MH 5EQ0A 4GLVB 4DV1L 2A5HA 1EY4A 1HXYD 4CKBA 2AUJD 1STGA 3O13A 1I5FA 4JBWA 4CKEA 1ASYA 1KDAA 3S17B 1SNQA 1W6JA 1AEXA 4DXFA 3J80E 2CH4A 2LMCB 3ZJYC 2PI2E 2K32A 2F3IA 1LM0A 2JSOA 4CKCA 2B2UA 2CQAA 4DR1Q 5K5PA 2UUBL 3H94A 4FXDA 5C4JH 1SYCA 2BH2A 1N36L 1SJED 1AZQA 5M5XB 4JI5Q 2D0OA 3J81j 4IZ8A 1A2UA 4DAVA 4FYDA 1VQLA 1LTGD 1ENCA 3HZXA 4FP5D 2RSNA 1RJTA 3NPPA 5LHY1 3HOYB 4C3HB 4A3CG 4GKJQ 2VQEQ 3GTLB 1XPUA 3J7AF 4IUVA 1K83B 2O5IC 1PLFA 3FPUB 3NBHA 1SLJA 1FVIA 2IX1A 2NVQH 5BR8L 4UPAA 3MXNB 4FF1A 1C9OA 3HFZB 4FF4A 3S16B 1DCZA 2I07B 1CKNA 1V1PA 1UNSA 2O5JC 1LTID 2NN6H 1O7IA 2VNUD 4DGZA 5JVG3 2MP1A 1B4OA 5T1GA 3HKSA 1F2MA 4DNRB 1X3PA 3OYYA 2NYZD 3ZYYX 1EL0A 1Y8NB 1HZBA 3T1YQ 2FMMA 3GP7A 1HZ9A 2F0SA 4KTAA 3EA6A 3U58A 4K14A 3A74A 1F9PA 2QKIC 2B2VC 3TREA 2KHSA 4GOPA 3T13A 1OXTA 1E24A 2F0DA 3S1QB 1LACA 1M4VA 2A6HD 4A3GB 3A56A 4JV5L 4L5RC 5CBEE 3C1EA 2VZAA 1PYWD 4JYAL 5CV5A 4NXNQ 2QDBA 1PA6A 4ZKBB 4BXXH 2KCMA 4A93H 2KQ3A 2E8GA 4WJWA 3OIPA 2IT1A 1E1OA 3IFDA 1AP0A 1I6VC 4NB3A 2EYJA 1HUNA 1VQFA 4ZQ3A 1UUPA 1GM5A 4DR4L 3EIVA 1Z9FA 2PQAB 4OL7A 1HZCA 5EBCA 1EY6A 4CHTB 2MO0A 4BY7B 1PFSA 5IIFA 1QVGA 1N34L 3HEJA 1PYSB 1Y8OB 3UI2A 3DMUA 3AYHB 3T4AC 4BBRG 5ELDA 2JA6G 4XQNA 2ZT9C 2NVTH 4IPCA 3RLFA 4C3IH 1PHJA 4L5TA 4NXML 4H7BA 1X32A 5C3EB 3DWQA 1MSHA 3D4DA 5GQOA 2C35B 4A3DG 3UDGA 4R4IA 1L1OB 3ERSX 2HHHQ 3S2HH 4HR7B 1NUCA 1E0BA 3PIOA 1J5EQ 3M4OB 2PNHA 3W5OA 2EJGC 1JT8A 3RZDB 4A3KG 4DA2A 4KKSA 5J39A 1QZHA 2K03A 4FDBA 1XNQQ 2VS1A 1LLRD 1S40A 1EIGA 4QUFA 3PCOB 1E2ZA 2Q8RE 3E9HA 1X56A 1EQQA 1G291 3UE0A 3SXHA 2LKVA 3A7LA 4XT3B 4Q0FA 2DJGC 1CHQD 1GHJA 1JOKA 1VDZA 4RGOS 3WOEA 3QWNA 4DR2L 1KQSA 2QA4A 1D6EC 5M3MG 2F0PA 1YI2A 2YYZA 4HCSA 2Q2TA 1L1OC 3MEFA 5CV6A 5D3DA 5CBAE 4LFBL 4P72A 5C6AA 1L0XB 5I4DA 3J81i 2I5MX 1LTAD 2SDFA 3FVQA 2VUMH 2JA8B 1CSPA 3CC2A 3M85A 3CC4A 1Z6HA 3OTOQ 4R8NA 3MXUA 2DNCA 3PF5A 3PUWA 4IPHA 4LF6L 3MZ5A 2YU9B 3HOUG 1SYBA 2QILA 2Z6KA 1A8VA 1Q90A 1CI3M 2NB0A 3I3CA 1DONA 1KDBA 3PO2B 3HP3A 3CPFA 3GTMB 3CMEA 4TSSA 2YTVA 3P20A 1H9MA 3DM3A 5JOBA 4RMFA 1B9NA 2IJ0A 1Y1VG 4ULLA 1VQIA 1EQTA 1WFQA 2WV6D 4AYBG 2L4NA 1TS3A 1O7YA 1FNWA 4UAIA 1NMFA 1EEID 2YTXA 1ESRA 2ICIA 4DR3L 1KD1C 3HG9A 1SR3A 3CF5A 2MFIA 3JC66 3WDNA 3CCLA 1A15A 3NWTA 1LTLA 1D2BA 1YBYA 3HS0C 5KYLA 2N88A 3F2BA 3HKZB 4A3JH 2Z4HA 4GN5A 1VQPA 3EJIA 4S3SA 2G5DA 4LF5Q 3BDOA 1E2WA 1RCVD 3KUPA 4JI2Q 3JAMi 1SNMA 2B2WA 5CMDA 1HCZA 1HNZL 1OXXK 3GTQH 3S1RH 5IP7H 1GUWA 4JW0A 4IFDI 2J7ZA 4UP8A 5C44H 4YWLA 2KENA 2EPBA 2BA0A 3R2IA 4JI8L 1T9HA 2F3WA 2JA9A 1B2TA 1YNND 4I7AA 1KXLA 1PH6A 4XTCS 4DUZQ 4DV6L
chains in the Genus database with same CATH topology
4B08A 4C3JB 4RHRA 1S4ZA 2XWBB 3SDZA 4DK1A 3C3LA 1MGSA 4KY6A 3SVMA 3L3OC 4IFDG 4DK0A 1XWEA 2EOTA 2JP1A 3KBGA 2HQEA 2K05A 1EY0A 4QF4A 5JVH3 3QIAA 1HPCA 3OMGA 1IL8A 4MHEA 3HRZC 4QIWB 2RBMA 1HTPA 2PCFB 4F87A 2E2HB 1TR5A 3BG3A 3PUVA 3IKJA 1F2ZA 5KNCA 3GTKB 3OPOA 2RSOA 1S5CD 2JE6I 1LT4D 1BOSA 1GUGA 1S5DD 3MXNA 1HUMA 2X69A 4IQZA 5K36H 2R92B 4KHVA 4BA2I 4KK7A 3V96A 1I4XA 3T56B 5I2XA 3A8JE 1CTMA 2JEAI 1WVLA 1GXDC 2FINB 4MN3A 2D5DA 2F1MA 2NWGA 2NZ1D 4G7OC 3C46A 1ZXTA 2FJ2A 1QE6A 4ME5A 4KMUC 2F0HA 2HUGA 4G7HC 1D5MC 1TVXA 4CBVA 3MA2B 3A7AB 2F0UA 2OT2A 2TMPA 1STNA 4IFDJ 3H09A 1ICWA 1B53A 1HTLD 1LV9A 1TWAB 1DXMA 1W6KA 5DAUA 1MD2D 4QMGA 3QOJA 4K6DA 4K2KA 1SE2A 2ZXPA 3FDTA 3E0JA 1EU4A 4WRDA 4CJ1B 4OIJA 2FFKB 1TQOA 1JE4A 2XWJB 3PUXA 3M7NA 3HOZB 3CRKC 1MSGA 2PW7A 1ESFA 2KECA 1H9SB 1RODA 4HSPA 2EYFA 1STAA 4DF7A 1R9TB 4PV1C 3SK4A 2WINB 4ABNA 1EIHA 5CC4A 4X3UA 2K28A 1HFGA 2KVMA 4IUNA 2KA7A 1FGBD 2R61A 3PMFA 4HMIA 5A35A 4RCOA 3OWEB 1JWMD 2XIWA 1O78A 3S15B 4G7ZC 3NTIA 1TU2B 4TRDA 1XYIA 3WOFA 5LL6X 2MGSA 1F2YA 1SEBD 4B9XA 2DY7A 2ZXRA 1BUVT 1J9OA 2X6LA 2A73B 4HCEA 2NN6I 2MHVA 1CZWA 1CM9A 3M7GA 2E2IB 2XN9C 2PW5A 1E2VA 1FR3A 4V190 2L12A 2PYKA 1B50A 3N6RA 1OO9B 3NTKA 4G4KA 2X6GA 3P7JA 2F0FA 3TP5A 3TN2A 4A93B 1ZEQX 3VR6A 3V05A 5E4WC 1O80A 1SNOA 4NW2A 3OOCA 1VMPA 2NN6G 3D3RA 1B3AA 1HFNA 5DM63 1Q1BA 2E75C 3K59A 2D62A 1JWUD 1BNZA 2F0EA 1JOQA 1ET9A 5C0XH 1YNNC 2MJ8A 2WP8J 3Q22A 2ICEC 1Z47A 4Q5VA 1R4QB 5JPNC 3VA5A 2NUCA 2EE1A 1TY0A 4RFBA 1NR2A 2Z1CA 3TP8A 4C1NK 2AQ3B 4HTHA 4OO1H 1LTSD 4LK1C 3OIQA 2SEBD 1UAPA 2KJXA 2B2YC 3GTPB 1WD1A 2R3ZA 4C3IG 3K58A 3U9OA 4KHZA 3ITPA 5J22A 5I6WA 3J7YW 3MXGA 1C48A 2NBFA 2K5DA 4R8IA 1XX8A 2ZXOA 3A55A 4DN4M 2A6EC 3Q23A 5CV8A 1IKLA 1LT3D 4GZYC 4ZLTF 5EPLA 4BBRB 2JA6B 5JJZA 4XXEA 3CU7A 3S14B 1DOKA 3NSWA 1TS4A 5I9PA 4HSVA 4DAPA 4A3DB 1ENFA 2C5CA 1BCPC 5FK9C 1DM0B 4KJNA 3DXJC 2PZWA 5M5WB 4F7XA 4A3KB 3K5LA 3TSSA 5IGBA 1CA5A 1CZGA 2K01A 3BYYB 2B2TA 1Y8PB 4YIJA 2ENBA 4C2MB 5DNFA 1AZPA 5M3MB 3D6WA 1UEAB 4DAYA 2WKDA 1ONLA 2CW0C 4X3KA 3W2DA 1GUTA 1PTOH 2XVSA 1PRTC 1SYGA 1OXVA 2KUMA 1YNJC 1Z7TA 3LX0A 5E4XA 3W3AA 1I4GA 1FYCA 3HOUB 1S5ED 3K7AB 3P75A 2JYOA 2RA4A 4JK1C 5IGCA 3S2DB 3A8KE 5M9OA 4E6IA 3PIO3 2JXMB 1Y1VB 4AYBB 4NKLA 4EGVA 1HRJA 2R7ZB 4KKTA 1LT6D 1H9SA 3I91A 2J0TD 1KTKA 1EWCA 3J7AV 1I4HA 2NVXB 3NQTA 5I2YA 4BA1I 2KEDA 1D1IA 3PV0A 4RKLA 3I4LA 4F88A 3DWPA 2IW3A 4P2CB 3BVZA 3MFGA 2HCIA 2L1BA 2RKSA 5FO8B 1L0YB 3TZDA 2PMZB 1JC7A 4KN4C 3TZUA 4K6LA 2F0OA 1GOZA 1S5BD 4Y7NB 1O7ZA 5ELCA 2EJFC 4KKUA 3HGBA 1RKNA 2Z8LA 3BS1A 1EQVA 2L11A 4ILWA 1SFOB 3DEPA 3Q6SA 1BXTA 1KDCA 5C4HA 4B9WA 4IALA 1LT5D 4OHJA 1CQVA 2GA4B 5FOBB 1EOTA 4KJOA 5E3FA 1PDQA 4BBSB 5C3WA 5LL6S 1IKMA 5K36G 5A2QL 2K5WA 1SYFA 2RDHA 1TWHB 5CV4A 2JEBI 1BDOA 4CGYB 3SR1A 5C5MA 1FNUA 1WTRA 5JEAH 2AWOA 2DY8A 3KLSA 2EYOA 1K8MA 3P1HA 5D3IB 1K8OA 4LMQD 1EZ8A 4O1NA 3EQLC 1U4LA 1WTPA 1Q1EA 4EQPA 1SXTA 3QOLA 1DOLA 3HOVB 3E6ZX 3HOXB 4N9TA 1FD7D 3OW7A 4DU9A 5KNBA 1U4MA 1STYA 1ILQA 4X3SA 3BVGA 2A74C 4RGNA 2G9DA 1O7LA 1D5ZC 3FKIB 2L9HA 5A2QE 1QNKA 1SE3A 3C2PA 4C56C 2SNMA 2M9VA 1V8QA 4LAAA 1NCVA 3M4YA 3NE5B 5G3LD 1WTQA 2E74C 2B2VA 4KY5A 3TMEA 1G6ZA 1OXSC 1BQQT 2B2UC 2XRSD 3BYTB 2B63B 4QCLA 3BDCA 3SK8A 2IL8A 2IX3A 1V1PB 4F8MA 2A6ED 4RA8A 1CT1D 1A3UA 3AU7A 4RGTA 2K04A 2R93B 4OGQC 5EKIA 2R6GA 5ELFA 5C4XB 2K7VA 1PMRA 3CHBD 2M00A 3KLSX 1RD9D 3PUYA 2K1BA 4HN7A 3S9WA 3X3NA 1BCPD 4ZAIA 4IUTA 1TWFB 1BCPF 1HQRD 1PZKD 4UDUC 1H9RA 1T5EA 2EY1A 4A3IB 4XT1B 5EGTA 1STHA 2FMCA 2F0MA 4ZUJA 1D1KA 4PMBA 2BCOA 5I9OA 2EZVA 1VF5C 3LWUA 3CKIB 2J4XA 1JR0D 2RDFA 2Q8IB 2A68C 2E76C 4RCNA 2QEJC 3IFTA 3PO3B 3I4MB 2CW0D 2BDOA 1JORA 1ZKOA 3SE0A 2F0WA 3NWSA 1PRTD 4PMWA 5C0XI 4KD3A 1YNJD 1SE4A 2K6AA 3LNNA 3U9SA 1SYEA 5M5YB 2WB1B 2ID0A 1H9KA 1G2SA 3N52A 1RHPA 5IODA 5C4JB 1GHKA 3BDLA 3SK5A 1U4RA 1WTWA 1RDPD 3MHBA 2F0VA 3A54A 3URYA 2XSCA 5C0XG 2WKCA 3I72A 3VR3A 3MVVA 1TS2A 1LO5D 4OO1I 1A2TA 2H4OA 1TT2A 2EYHA 3QJYA 2NVQB 3SK6A 3I73A 1MBYA 4KD4A 1CK1A 1PZID 1B1ZA 3I90A 2A69D 1VCIA 3OMCA 5D65A 4IN3A 1SNCA 4G57A 2WAQB 5HGTA 2B39A 2PO4A 1U9RA 4HEDA 4DFAA 3K0YA 4OO1G 3VR4A 3TBIB 3T51B 1V1OA 3OWFA 1GJXA 2EY5A 1WTXA 5C5LA 5JPMC 4KY7A 4FXGC 2RDGA 1CFMA 4HAEA 1S5FD 1EY8A 1I4RA 1ZYRC 1WD0A 3K5NA 1B9MA 2KEEA 2KOLA 1KNAA 1CQFA 3TP6A 1M8AA 4NP5A 2EDGA 3GQBA 3OHXC 4FF2A 2BE5C 1MI2A 4RKBA 1A3VA 1DZ1A 3V2TA 4XQQA 1CA6A 3H6MA 3MTSA 3DUZA 1EY7A 5CR3A 3T16A 2NVTB 4C3IB 3BVMA 2NTTA 4C1NI 5C3XA 1F2LA 1CHPD 1IW7C 4I7ZC 4U68A 2K5QA 2C9OA 2IWHA 4FVMA 5EKKA 5C0XJ 1AN8A 3E5SA 3S2HB 1EYAA 2B8FA 2F0LA 1IYUA 5FKAC 2L0CA 5F2DA 2EXZA 2D2CC 5EPKA 5IOCA 3R2TA 1BF4A 5FLXL 1ENAA 1ET6A 1TS5A 3K57A 2B2WC 2O4XA 3D4WA 3Q24A 3K6OA 4Z9CB 3SEBA 5D14A 2BA1A 4RH6A 2F0NA 5BN3A 3T53B 4PMCA 3MAQA 5JAVA 5I6YA 1PTOC 1GUSA 1KLGD 2VUMB 2V4DA 1JQYD 1BCPB 1VMCA 2Q8TA 2TSSA 2SNSA 5IT9L 2XRQD 4KN7C 2PNRC 1LTRD 2AWNA 2BDNA 1EWHA 2I46A 2HDMA 1Q12A 4QB4A 4ZKCB 5KGUA 1HHVA 4XYQA 2F0QA 2OXPA 5T1IA 1JWSD 4MIUA 5FLXE 5KRUA 1TKWB 2AQ1B 4PQXA 1SJHD 3GV6A 5NUCA 3QB3A 1QJOA 1R4PB 1DYQA 4ZYSA 4K2LA 4C3HG 1PRTB 3MEHA 2PZUA 4RAUC 3VYSA 1JOOA 1WCMB 3BZDB 1PFMA 2PQEA 4EQOA 4KV6A 1F9QA 3L9AX 4A3JB 3R8BA 3DEOA 1T5XD 2IX0A 5IT9E 3FRPB 4X3TA 4IUQA 1JICA 3NTHA 5KYIA 3GTQB 3S1RB 1RF2D 2EYPA 5ELEA 5EJWA 2KCNA 5IGGA 2EVBA 3EVQA 5CV9A 2A68D 5C44B 4L63B 1C4QA 5EPJA 4ZK9B 1Y69U 3VR5A 5COYA 5IGFA 1HA5A 1PXUA 2EYLA 3NQIA 2PZTA 3IL8A 2F4IA 1LABA 5BN4A 5FO7B 2RQXA 3X3MA 1G2TA 2VB3X 5DEHA 1OXUA 2CVRA 3VYUA 3CQZB 3J81L 2QCPX 3G6JB 3NK9A 3LWEA 4A3FB 5JEAG 3H0GB 2NVYB 3FPPA 5IGEA 3NUCA 5TSSA 2HCCA 1FNVA 1WTVA 1LTBD 2XNAC 2A69C 4TKOB 3SHLA 1EYCA 2WACA 4LJZC 1HQMC 1XTCD 3HOWB 1XXGA 1JCKB 1A6XA 4BS9A 4FXKC 4WFN3 2MPMA 3DWAA 1RTOA 1NSNS 5FO9B 4ZRZA 1EU3A 1H9JA 1TIID 1SMYD 5E1FA 1EY5A 1DD2A 2BOSA 3GO5A 3F2UA 4A3EB 4K5VA 1F77A 3GTGB 3J81E 3I8ZA 1QWYA 2VB2X 2F0KA 3H91A 4KI0A 1Q3LA 1ZYRD 2WIIB 4XIGS 3VA7A 4NMZA 4IURA 3A8IE 4K5WA 4H44C 1JB3A 5IGDA 3JAML 4BY1B 1IYVA 3VYTA 1RTNA 1I3QB 2BE5D 4J1MA 4BWGB 2F03A 4J6HA 3NBIA 2AUKA 3VYRA 3ERQA 2KCCA 5CGKA 1NR4A 2EY2A 1ILPA 1IW7D 1TWGB 4NDXA 4L6TB 2O2LD 4K5XA 4ZUIA 4U673 1QCBD 2LFNA 4ID6A 5ELBA 4PNYA 3I70A 5JEAJ 3D8GA 2B2YA 1U4PA 3R93A 3ONAB 3KK7A 3KBXA 5CV7A 2VXWA 1DOMA 1I4PA 4O42A 1EY9A 5ISRA 3K5MA 3Q0AA 4M8AA 1NAPA 3JAME 3S1MB 2OEOA 3IAYA 1SAPA 3FEWX 1PTOD 4EVOA 2Z4IA 3EFXD 1PTOF 1BR9A 2AQ2B 5G3LF 5M3FB 5CYUA 5C4ZA 1G8ZD 1STBA 1G91A 4R9WA 3MXPA 2EYMA 4DNTB 4J8QA 3RUZA 2NTSA 3ND8A 4IUPA 4C3JG 4RGMA 4CJ2C 5HURA 3MFYA 1EFID 1STEA 1I6HB 5AFWA 1SYDA 3GD7A 3NP8A 1SDFA 1DJRD 3R3OA 3DM1A 2EY6A 3D31A 5CORA 3M3YB 5DM73 4A3BB 3QO2A 3H3VC 2L55A 2A6HC 2EJMA 4TQUS 2H1EA 2PPBC 3I4NB 4M1UB 2LS01 4H0LC 1SNPA 2M2LA 1AFPA 1SBBB 1ML0D 2K33A 3S1NB 1QG7A 5BN5A 3NHHA 2F0TA 1J8IA 4IFDH 2MUYA 2F0JA 2HDLA 4WORA 1QNUA 3D4RA 1EYDA 1Q8IA 3ND9A 3EROA 3GTOB 4IUUA 1F9SA 1PZJD 2LY7A 1VF7A 4XDXA 5KNDA 3KF8A 5KEEA 1KABA 2F3VA 3K5OA 3AB9A 3RZOB 4K8JA 1EZ6A 1PRTF 2B8GA 1SNDA 3FMCA 4OIKA 2B2TC 4ODGA 2JA5B 3C1FA 4FF3A 3VR2A 1KNEA 2E2JB 1SSOA 2F0IA 3CRLC 1QB5D 3RMHA 1LTTD 4L8JA 1EEFD 2F0GA 2G9HD 1BO0A 3PUZA 2DNEA 1B44D 4HMJA 3AMUA 4H13C 4EQNA 1II3A 3TP7A 3L7ZC 3GV3A 1IHZA 1Y1WB 3KLRA 1PFBA 1C8CA 4XQJA 3QG1A 4XYOA 3DHQA 4FO2A 1GUOA 4N9PA 2SOBA 3G7LA 1AW7A 1QOHA 5EBDA 2CHBD 1HA6A 1SMYC 2L5TA 3NXWA 5EKLA 1TY2A 4RHSA 1GUNA 1PFNA 1QILA 3OSOA 1BBXC 4A3MB 1WTOA 4QUCA 3TDQA 2IPKD 4I65A 1D5XC 2QF7A 3J80L 3MC0B 1A3TA 1F9RA 2D9UA 4K8IA 4V0BA 1I50B 4DXGA 3D6CA 1KLUD 2N55A 1I4QA 2DN8A 2RVLA 2Y0SB 4RWSC 3PIP3 4FNFA 5KIXA 3GTJB 3MWYW 1TWCB 2E2DC 1KAAA 5J1ZA 4CJ0B 3RD4A 1X3QA 1PTOB 2OF1A 2JA7B 1V43A 2FHTA 5EQ0A 2A5HA 1EY4A 1HXYD 4CKBA 2AUJD 1STGA 3O13A 4JBWA 4CKEA 1KDAA 3S17B 1SNQA 1W6JA 1AEXA 4DXFA 3J80E 2LMCB 2K32A 2JSOA 4CKCA 2B2UA 2CQAA 5K5PA 3H94A 4FXDA 1SYCA 1SJED 1AZQA 5M5XB 4IZ8A 1A2UA 4DAVA 4FYDA 1LTGD 1ENCA 3HZXA 4FP5D 2RSNA 1RJTA 3NPPA 5LHY1 3HOYB 4C3HB 3GTLB 3J7AF 4IUVA 1K83B 2O5IC 1PLFA 3FPUB 3NBHA 2IX1A 4FF1A 4FF4A 3S16B 1DCZA 2I07B 1V1PA 1UNSA 2O5JC 1LTID 2NN6H 2VNUD 4DGZA 5JVG3 2MP1A 1B4OA 5T1GA 1F2MA 4DNRB 1X3PA 2NYZD 3ZYYX 1EL0A 1Y8NB 2FMMA 3GP7A 2F0SA 4KTAA 3EA6A 4K14A 1F9PA 2QKIC 2B2VC 2KHSA 3T13A 1OXTA 3S1QB 2F0DA 1LACA 1M4VA 2A6HD 4A3GB 3A56A 5CBEE 3C1EA 1PYWD 5CV5A 2QDBA 4ZKBB 2KQ3A 4WJWA 3OIPA 2IT1A 3IFDA 1AP0A 1I6VC 2EYJA 1HUNA 4ZQ3A 1UUPA 4OL7A 5EBCA 1EY6A 4CHTB 4BY7B 5IIFA 3HEJA 1Y8OB 3UI2A 3DMUA 3T4AC 5ELDA 4XQNA 2ZT9C 3RLFA 4H7BA 1X32A 5C3EB 3DWQA 1MSHA 3D4DA 4HR7B 1NUCA 1E0BA 3M4OB 2EJGC 3RZDB 4DA2A 4KKSA 5J39A 2K03A 1LLRD 1EIGA 4QUFA 1E2ZA 2Q8RE 1G291 3SXHA 2LKVA 3A7LA 4XT3B 4Q0FA 1CHQD 1GHJA 1JOKA 1VDZA 4RGOS 3WOEA 3QWNA 1D6EC 2F0PA 2YYZA 4HCSA 5CV6A 5D3DA 5CBAE 5C6AA 1L0XB 5I4DA 1LTAD 2SDFA 3FVQA 2JA8B 3M85A 1Z6HA 4R8NA 3MXUA 2DNCA 3PUWA 3MZ5A 2YU9B 1SYBA 2QILA 1Q90A 1CI3M 2NB0A 3I3CA 1DONA 1KDBA 3PO2B 3HP3A 3GTMB 4TSSA 3P20A 1H9MA 5JOBA 1B9NA 2IJ0A 4ULLA 1EQTA 2WV6D 2L4NA 1TS3A 1O7YA 4UAIA 1FNWA 1EEID 1ESRA 2ICIA 3HG9A 3WDNA 1A15A 3NWTA 1D2BA 3HS0C 5KYLA 2N88A 3HKZB 2Z4HA 3EJIA 4S3SA 3BDOA 1E2WA 1RCVD 3KUPA 1SNMA 2B2WA 5CMDA 1HCZA 1OXXK 1GUWA 4IFDI 2J7ZA 2EPBA 2BA0A 3R2IA 2F3WA 1B2TA 1YNND 4XTCS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEO A;  1EL0 A;  2DY7 A;  4X3T A;  1J9O A;  4IUQ A;  5E4X A;  5CBA E;  2X6L A;  1BF4 A;  1S4Z A;  2FMM A;  2RVL A;  1IKM A;  1KNE A;  1JIC A;  2SDF A;  4RWS C;  1SSO A;  1F9P A;  1CM9 A;  2B2V C;  1MGS A;  5EJW A;  1ICW A;  2B2W C;  2JYO A;  3MWY W;  3I90 A;  3SVM A;  2K1B A;  2RA4 A;  1B53 A;  3F2U A;  1G91 A;  4R9W A;  3I8Z A;  4ZAI A;  5CBE E;  1LV9 A;  1XX8 A;  5D65 A;  2L12 A;  5EPJ A;  4CJ0 B;  4R8I A;  3H91 A;  1B50 A;  4IUP A;  1X3Q A;  1BO0 A;  4IUT A;  2EOT A;  4ZK9 B;  1Q3L A;  1WTR A;  4DN4 M;  2JP1 A;  4CJ2 C;  2X6G A;  3P7J A;  5D14 A;  4ZKB B;  2DY8 A;  2K05 A;  3TN2 A;  2FHT A;  1IKL A;  3IFD A;  5COY A;  1AP0 A;  4IUR A;  5EQ0 A;  4ZLT F;  3I3C A;  1DON A;  1HRJ A;  3GV3 A;  3HP3 A;  5AFW A;  5E4W C;  1HUN A;  1RTO A;  5EPL A;  1O80 A;  4LMQ D;  3I91 A;  4HED A;  5JJZ A;  1PFB A;  4NW2 A;  1RTN A;  1SDF A;  4XT1 B;  1C8C A;  1IL8 A;  1VMP A;  3FDT A;  1U4L A;  1B3A A;  4MHE A;  4CJ1 B;  1WTP A;  1HFN A;  1DOK A;  1VMC A;  1DOL A;  3DM1 A;  2FFK B;  4OIJ A;  2KED A;  5COR A;  4HSV A;  2Q8T A;  1WTX A;  1JE4 A;  1EQT A;  2NYZ D;  3IL8 A;  3QO2 A;  1BNZ A;  2L4N A;  3UI2 A;  1O7Y A;  4UAI A;  1NR4 A;  2B2U A;  2BDN A;  4HAE A;  2H1E A;  2HDM A;  1ILP A;  1MSG A;  1ESR A;  2RSO A;  1G2T A;  2HCI A;  1X32 A;  1U4M A;  2L1B A;  4ZKC B;  2KEC A;  1WD0 A;  3G7L A;  2CVR A;  2KEE A;  2KOL A;  1ROD A;  1ILQ A;  1MSH A;  2MJ8 A;  4X3S A;  3TZD A;  1AZQ A;  1HHV A;  1KNA A;  1A15 A;  2M2L A;  1HUM A;  2B2Y A;  1U4P A;  2X69 A;  3R93 A;  1G6Z A;  1M8A A;  3ONA B;  2L9H A;  1ML0 D;  5T1I A;  1CA5 A;  1QG7 A;  1QNK A;  1O7Z A;  3LWE A;  2K01 A;  1HA6 A;  3KBX A;  2B2T A;  2RSN A;  1E0B A;  1RJT A;  2VXW A;  1DOM A;  1EIH A;  2N88 A;  4X3U A;  1MI2 A;  2HCC A;  1J8I A;  1PFN A;  1DZ1 A;  4O42 A;  2K28 A;  2HDL A;  1BBX C;  1HFG A;  1CA6 A;  1NCV A;  1WTV A;  5EPK A;  2KVM A;  3MTS A;  3GV6 A;  4IUV A;  1WTQ A;  2B2V A;  2EE1 A;  1PLF A;  1WTO A;  3FPU B;  2K03 A;  1G2S A;  3N52 A;  1RHP A;  3KUP A;  1NR2 A;  4QUC A;  5DNF A;  1WVL A;  4IUU A;  1AZP A;  2B2W A;  2FIN B;  2L11 A;  1F9S A;  4MN3 A;  5CMD A;  2B2U C;  1EIG A;  1F2L A;  2NWG A;  4QUF A;  2NZ1 D;  2Q8R E;  3D6W A;  1GUW A;  2IL8 A;  1U4R A;  2J7Z A;  4XDX A;  3DEP A;  2XIW A;  1ZXT A;  3Q6S A;  2FJ2 A;  4U68 A;  1QE6 A;  4RAU C;  4X3K A;  1F9R A;  4RA8 A;  4XT3 B;  1NAP A;  1WTW A;  2EPB A;  1PFM A;  2D9U A;  1XYI A;  2B2Y C;  2K04 A;  1WD1 A;  1SAP A;  2HUG A;  2MP1 A;  2R3Z A;  1B2T A;  1B4O A;  2MGS A;  5T1G A;  5EKI A;  1F9Q A;  1EOT A;  2MPM A;  1X3P A;  4OIK A;  2N55 A;  2B2T C;  1PDQ A;  2KUM A;  4HCS A;  1TVX A; 
#chains in the Genus database with same CATH topology
 4B08 A;  4C3J B;  4RHR A;  1S4Z A;  2XWB B;  1BBU A;  3SDZ A;  2RF4 A;  4DK1 A;  2ZJP A;  3C3L A;  1MGS A;  4DUY Q;  3K8A A;  1N33 L;  3HKZ G;  4KY6 A;  3SVM A;  3L3O C;  4IFD G;  1FJG L;  4DK0 A;  4LF9 L;  1YIT A;  1SE8 A;  1XWE A;  2EOT A;  2JP1 A;  3U4Z A;  3KBG A;  2HQE A;  2K05 A;  3CP0 A;  1EY0 A;  2I5H A;  4QF4 A;  1FL0 A;  4OEM B;  5JVH 3;  5LMU L;  3CQZ H;  1K73 C;  4PZ7 A;  3QIA A;  1HPC A;  5HY6 A;  3OMG A;  1IL8 A;  3K81 C;  2QGQ A;  4MHE A;  3HRZ C;  4QIW B;  3H0G H;  4A3F H;  2NVY H;  2RBM A;  2A19 A;  1HTP A;  2PCF B;  4F87 A;  4QJF A;  2E2H B;  1TR5 A;  4DV0 L;  3BG3 A;  3PUV A;  3IKJ A;  1F2Z A;  5KNC A;  3GTK B;  3OPO A;  2RSO A;  1S5C D;  2JE6 I;  1LT4 D;  2VL6 A;  2AHO B;  1BOS A;  1GUG A;  1S5D D;  3HOX G;  3MXN A;  1HUM A;  2X69 A;  4IQZ A;  2NZH A;  4X65 L;  5K36 H;  3HOW H;  2R92 B;  4Y7N H;  4KHV A;  4BA2 I;  2UUC Q;  3F1Z A;  4KK7 A;  3V96 A;  3VDY A;  1I4X A;  4DV4 Q;  1VQJ A;  3T56 B;  5I2X A;  1IL2 A;  3A8J E;  2CFM A;  1E3P A;  1CSQ A;  4R4O A;  4JPB W;  1I94 L;  2K75 A;  5JJL A;  1CTM A;  2JEA I;  1YHA A;  1WVL A;  2VQF L;  3FKI G;  1GXD C;  2FIN B;  4MN3 A;  3UDF A;  2D5D A;  2F1M A;  2N8N A;  2NWG A;  2NZ1 D;  5IP9 H;  1XMQ L;  4G7O C;  3C46 A;  1ZXT A;  2FJ2 A;  1QE6 A;  4DV7 Q;  4A3E H;  4X66 L;  3GTG H;  2ALY B;  4ME5 A;  4KMU C;  4A4I A;  1S3O A;  4KHP Q;  2F0H A;  2HUG A;  5IT9 c;  4G7H C;  1JJ2 A;  4NPS A;  2B63 G;  1D5M C;  4BBS H;  1TVX A;  4CBV A;  3MA2 B;  2PMZ E;  4B3S L;  3A7A B;  2ZM6 Q;  2F0U A;  2OT2 A;  3KJP A;  2R92 G;  4BY1 H;  2VW9 A;  2TMP A;  1IBM Q;  1I3Q H;  1STN A;  4B3R Q;  3D0F A;  1XJV A;  4DAY B;  2D0P A;  4IFD J;  2PQA A;  3H09 A;  2R93 G;  1ICW A;  3KYH C;  4L5Q A;  1B53 A;  4LNQ A;  4YY3 L;  4QY7 A;  1HTL D;  1LV9 A;  1TWA B;  1DXM A;  1W6K A;  5C4X G;  1QUQ B;  5DAU A;  5FLM H;  1TWG H;  1LYL A;  4DV3 L;  1HNX L;  4OWT B;  1MD2 D;  4QMG A;  3QOJ A;  4K6D A;  4LF8 Q;  4DAM A;  3KOJ A;  1L2F A;  4K2K A;  1SE2 A;  2ZXP A;  3FDT A;  3E0J A;  1EU4 A;  4WRD A;  1NTG A;  4CJ1 B;  1MIU A;  3HOV H;  4OIJ A;  3HKZ E;  3CAM A;  2CWA A;  2FFK B;  1TQO A;  4RG1 A;  1JE4 A;  2XWJ B;  3PUX A;  3M7N A;  3F2D A;  2K50 A;  4A3I G;  3HOZ B;  4MZ9 A;  3CRK C;  1MSG A;  4N8X 1;  2PW7 A;  1ESF A;  3G71 A;  1EUJ A;  2KEC A;  3A5U A;  1H9S B;  1ROD A;  4HSP A;  2EYF A;  1STA A;  4DF7 A;  1R9T B;  4PV1 C;  4JG2 A;  3E0E A;  1KAW A;  3SK4 A;  1PYB A;  3S1M H;  2WIN B;  4UP7 A;  4ABN A;  1EIH A;  5CC4 A;  4X3U A;  3I4M G;  1GD7 A;  2K28 A;  3KLW A;  3T1H Q;  1HFG A;  4YCU A;  1E22 A;  2KVM A;  2KA7 A;  2R61 A;  1FGB D;  3PMF A;  4IUN A;  4LFA Q;  4HMI A;  5A35 A;  4RCO A;  3PF4 A;  3OWE B;  5M3F H;  1JWM D;  4R1J A;  2XIW A;  1O78 A;  2UU9 Q;  3S15 B;  4G7Z C;  3NTI A;  1TU2 B;  1QZG A;  1YHQ A;  2WB1 G;  4IPD A;  4TRD A;  1XYI A;  3WOF A;  4X64 Q;  3Q8D A;  4X62 Q;  5LL6 X;  2MGS A;  1F2Y A;  1SEB D;  3FHW A;  4B9X A;  1I6H H;  2DY7 A;  2ZXR A;  1BUV T;  1J9O A;  2QW7 A;  3SGI A;  2X6L A;  2A73 B;  1IBK Q;  4HCE A;  2NN6 I;  4QIW E;  3PGZ A;  2MHV A;  1CZW A;  1JMC A;  1CM9 A;  3M7G A;  2E2I B;  2XN9 C;  4LF7 Q;  1WJJ A;  3M3Y H;  4A3B H;  2PW5 A;  1E2V A;  1FR3 A;  4V19 0;  4OEL B;  2L12 A;  2PYK A;  1B50 A;  3N6R A;  1OO9 B;  3NTK A;  4G4K A;  2X6G A;  3P7J A;  2HIX A;  2F0F A;  3TP5 A;  3TN2 A;  4A93 B;  2CKZ B;  1ZEQ X;  4R4C A;  3VR6 A;  3V05 A;  3CCQ A;  2UUA Q;  1A63 A;  5E4W C;  2P5Z X;  2GN5 A;  1O80 A;  3J80 i;  1SNO A;  4NW2 A;  3OOC A;  4UP9 A;  1ASZ A;  1A62 A;  1VMP A;  2NN6 G;  3S1N H;  3D3R A;  1B3A A;  1HFN A;  5DM6 3;  1Q1B A;  2WAQ G;  2E75 C;  3K59 A;  2D62 A;  1JWU D;  1BNZ A;  4DR7 Q;  2RHS B;  5AJ3 Q;  3RLN A;  2F0E A;  4OWW B;  1JOQ A;  4GNX C;  1ET9 A;  3PO3 H;  5C0X H;  4DR1 L;  2I0Q A;  1YNN C;  2MJ8 A;  2WP8 J;  3Q22 A;  1MJC A;  2ICE C;  1Z47 A;  3RZO H;  4Q5V A;  4BXX G;  1R4Q B;  1D7Q A;  5JPN C;  4A93 G;  4POF A;  3BJU A;  3I55 A;  1EIF A;  3VA5 A;  5M5Y H;  2JA5 H;  3B6Y A;  3QR8 A;  2NUC A;  2EE1 A;  1TY0 A;  4RFB A;  1NR2 A;  2E2J H;  2Z1C A;  1A0I A;  1IBL L;  3TP8 A;  4ZCK A;  4GKK Q;  4DR5 Q;  4C1N K;  2HIV A;  3JAM c;  2DUD A;  4JI4 L;  2AQ3 B;  4HTH A;  4OO1 H;  1LTS D;  1SRO A;  4LK1 C;  2XTI A;  3OIQ A;  2SEB D;  1UAP A;  2KJX A;  4JBM A;  2B2Y C;  4MNO A;  3GTP B;  1WD1 A;  1M1K C;  2R3Z A;  3FP9 A;  4C3I G;  3K58 A;  4IJH A;  3U9O A;  4DV1 Q;  4KHZ A;  3ITP A;  1YVC A;  5J22 A;  2H5X A;  5I6W A;  1Y1W H;  4OX9 L;  3J7Y W;  4HJA A;  1K3B C;  3MXG A;  1C48 A;  2NBF A;  2K5D A;  3PQI A;  4P75 A;  1K28 A;  1AE2 A;  4R8I A;  1XX8 A;  2WB1 E;  2ZXO A;  2UUB Q;  3A55 A;  2Z6B A;  4DN4 M;  2A6E C;  3OW2 A;  4MTK A;  3UDX A;  3Q23 A;  1N36 Q;  4NXN L;  5CV8 A;  1IKL A;  1LT3 D;  4GZY C;  4ZLT F;  3U4V A;  5EPL A;  3KFU A;  4BBR B;  3RNU A;  2JA6 B;  5JJZ A;  4XXE A;  3CU7 A;  4LF4 L;  2OWO A;  3S14 B;  1DOK A;  3NSW A;  1TS4 A;  5I9P A;  4HSV A;  1W3S A;  4DAP A;  4JI1 Q;  4A3D B;  4AIM A;  4LFC Q;  1ENF A;  2C5C A;  2RCN A;  4A3M H;  1BCP C;  5FK9 C;  1DM0 B;  4KJN A;  2VUM G;  3DXJ C;  3W1G A;  2PZW A;  5M5W B;  4F7X A;  4A3K B;  3K5L A;  1N9W A;  4DR6 Q;  4B3T Q;  3TSS A;  4JC0 A;  1EOV A;  5IGB A;  1CA5 A;  1CZG A;  2K01 A;  3BYY B;  4DK6 C;  1NBW A;  2B2T A;  1Y8P B;  1MHW C;  1I50 H;  5IYC H;  1J5E L;  4LWC A;  4YIJ A;  2ENB A;  5DNF A;  4C2M B;  2PI2 A;  1AZP A;  1V9P A;  2YV5 A;  3NEM A;  5M3M B;  3D6W A;  1UEA B;  3GTJ H;  4DAY A;  2WKD A;  1TWC H;  1KRS A;  1ONL A;  2CW0 C;  4X3K A;  3W2D A;  4JYA Q;  1VS0 A;  5FJ8 H;  2CCZ A;  1GUT A;  2MO1 A;  3A5Z B;  1PTO H;  2JA7 H;  2XVS A;  1PRT C;  4IJL A;  1SYG A;  1OXV A;  5IY0 A;  1QUQ A;  2KUM A;  1YNJ C;  2QEX A;  1Z7T A;  3LX0 A;  5E4X A;  2HD3 A;  3W3A A;  1U0L A;  1EWI A;  1I4G A;  1FYC A;  3HOU B;  4QL5 A;  4DV2 L;  1KL9 A;  3UE1 A;  1S5E D;  3K7A B;  2KBN A;  3P75 A;  2JYO A;  2RA4 A;  1PH1 A;  4JK1 C;  4A3J G;  3F8T A;  5IGC A;  3S2D B;  3A8K E;  5M9O A;  4EX5 A;  4E6I A;  4JI0 Q;  3PIO 3;  2JXM B;  4DK3 C;  1Y1V B;  5IYB H;  4AYB B;  5IP7 G;  2JK8 A;  1NNX A;  4NKL A;  4EGV A;  5M5X H;  2R7Z B;  1HRJ A;  3BZC A;  1VQO A;  4KKT A;  1LT6 D;  5C44 G;  1H9S A;  3I91 A;  4AQY L;  2J0T D;  1MKH A;  1KTK A;  1X55 A;  1EWC A;  3J7A V;  1I4H A;  2NVX B;  4JOI A;  3NQT A;  5I2Y A;  4BA1 I;  2KED A;  3KDF B;  1D1I A;  3HOY H;  4C3H H;  3PV0 A;  4RKL A;  3I4L A;  4F88 A;  3GTL H;  3M9B A;  3DWP A;  2IW3 A;  1K83 H;  1VQ6 A;  4P2C B;  2WFW A;  3BVZ A;  3MFG A;  3J7Z C;  2HCI A;  2L1B A;  2RKS A;  5FO8 B;  1L0Y B;  3TZD A;  2PMZ B;  1JC7 A;  4KN4 C;  3TZU A;  4K6L A;  3S16 H;  2F0O A;  1GOZ A;  1S5B D;  4Y7N B;  3BU2 A;  1O7Z A;  2UXD Q;  5ELC A;  2EJF C;  4KKU A;  4EQ5 A;  3HGB A;  4HIK A;  4WJ3 M;  1RKN A;  2R7Z G;  4LFB Q;  2Z8L A;  3BS1 A;  1SMX A;  1HH2 P;  4GLA C;  1EQV A;  2L11 A;  1G51 A;  4ILW A;  4A3F G;  3H0G G;  1EYG A;  3S1Q H;  1SFO B;  3DEP A;  3Q6S A;  5EAY A;  4A3G H;  1HR0 Q;  1BXT A;  1KDC A;  1WCM H;  4JI6 Q;  5C4H A;  2MNA A;  3A0J A;  1VQD A;  4LF6 Q;  4B9W A;  3STB C;  4IAL A;  1LT5 D;  1GO3 E;  2ES2 A;  4OHJ A;  1CQV A;  2GA4 B;  5FOB B;  1N32 Q;  1DGS A;  1EOT A;  4KJO A;  5E3F A;  1PDQ A;  4BBS B;  1WTH A;  2OTJ A;  5C3W A;  4DUZ L;  2Q2H A;  1WYD A;  2DGY A;  5LL6 S;  1IKM A;  5K36 G;  3HOW G;  5A2Q L;  4K0K Q;  1PVO A;  2K5W A;  1SYF A;  2RDH A;  1X3E A;  4BY7 H;  1TWH B;  5CV4 A;  2JEB I;  2K4K A;  1BDO A;  4DUY L;  2B29 A;  4CGY B;  2UXC L;  3SR1 A;  5C5M A;  1FNU A;  1WTR A;  5JEA H;  2AWO A;  4DR3 Q;  2DY8 A;  3KLS A;  2EYO A;  1K8M A;  1Q86 C;  3P1H A;  5C3E H;  5IP9 G;  5D3I B;  1K8O A;  4LMQ D;  3ULL A;  1K3R A;  1EZ8 A;  3CCJ A;  4O1N A;  3EQL C;  4HJ9 A;  1U4L A;  1AH9 A;  1WTP A;  1Q1E A;  4EQP A;  1SXT A;  3J80 c;  4QQB X;  3QOL A;  1DOL A;  3HOV B;  3M4O H;  3E6Z X;  4BBS G;  3HOX B;  1X3F A;  4N9T A;  4DKA C;  1FD7 D;  3RZD H;  1XPR A;  3OW7 A;  4DU9 A;  5KNB A;  4BY1 G;  1Y14 B;  1XMO L;  1U4M A;  1STY A;  1ILQ A;  4X3S A;  3BVG A;  5E7N A;  2A74 C;  4RGN A;  2G9D A;  1O7L A;  4A75 A;  3I7F A;  4P73 A;  1D5Z C;  3FKI B;  2L9H A;  5A2Q E;  1QNK A;  3K7U C;  1SE3 A;  3ICE A;  3C2P A;  4C56 C;  2SNM A;  5FLM G;  1HZA A;  2M9V A;  4DV6 Q;  1V8Q A;  2K5H A;  4H02 A;  4LAA A;  1NCV A;  3M4Y A;  3NE5 B;  5IYD H;  5G3L D;  1WTQ A;  2E74 C;  2B2V A;  2EQS A;  4KY5 A;  3TME A;  1G6Z A;  4OWX B;  1OXS C;  1BQQ T;  2B2U C;  2XRS D;  3BYT B;  2JA8 H;  2B63 B;  1N33 Q;  3HOV G;  4QCL A;  2UXB L;  3BDC A;  3SK8 A;  2IL8 A;  1QVF A;  4LF9 Q;  2IX3 A;  1V1P B;  4UY8 C;  4F8M A;  2A6E D;  4RA8 A;  1CT1 D;  1A3U A;  3AU7 A;  4LUO A;  3E9I A;  4RGT A;  2N3S A;  1XTD A;  2K04 A;  4WJ4 A;  5JJI A;  1CUK A;  1JB7 A;  2R93 B;  4OGQ C;  4AYB E;  5EKI A;  2R6G A;  5ELF A;  5LMU Q;  4KHP L;  5IWA Q;  1X65 A;  3PO2 H;  3GTM H;  5C4X B;  2K7V A;  1PMR A;  3CHB D;  1NMG A;  2M00 A;  3CCU A;  3KJO A;  1PH2 A;  4CDF C;  3KLS X;  1RD9 D;  2E5L L;  3PUY A;  2GVA A;  4OXP A;  2K1B A;  4HN7 A;  3S9W A;  4DV0 Q;  3X3N A;  1BCP D;  4ZAI A;  2A1A A;  4CDC C;  4IUT A;  4A3L H;  1TWF B;  4UHV A;  1BCP F;  2N78 A;  4POG A;  5M3F G;  1HQR D;  1PZK D;  4UDU C;  3TRZ A;  1H9R A;  1T5E A;  4JI7 L;  1SN8 A;  2EY1 A;  4B3M Q;  1SRU A;  4A3I B;  1RIP A;  1UEB A;  5GAH C;  4XT1 B;  5EGT A;  1STH A;  2FMC A;  2F0M A;  4ZUJ A;  1D1K A;  2QDL A;  4PMB A;  2BCO A;  5I9O A;  2EZV A;  1VF5 C;  3LWU A;  3CKI B;  4JCV E;  2LXK A;  2J4X A;  4GOP C;  1JR0 D;  2RDF A;  2Q8I B;  2A68 C;  2E76 C;  2VQF Q;  5LMN W;  3M4P A;  4RCN A;  2QEJ C;  3IFT A;  3PO3 B;  3I4M B;  2CW0 D;  1KRT A;  2BDO A;  1M90 C;  4A3B G;  1JOR A;  5GRO A;  1ZKO A;  3SE0 A;  1JJG A;  1PH7 A;  2F0W A;  3NWS A;  1PRT D;  2K5N A;  4JVZ A;  4PMW A;  5C0X I;  4KD3 A;  1YNJ D;  1L1O A;  1SE4 A;  4HJ5 A;  2K6A A;  3LNN A;  3U9S A;  1SYE A;  5M5Y B;  2WB1 B;  2ZJQ A;  4C3J H;  2ID0 A;  1H9K A;  1G2S A;  3N52 A;  1RHP A;  5IOD A;  5C4J B;  1GHK A;  3BDL A;  2OCE A;  3SK5 A;  4LFA L;  1U4R A;  2OTL A;  4YY3 Q;  4CDE C;  1WTW A;  2UU9 L;  1Q82 C;  1RDP D;  3MHB A;  2F0V A;  3A54 A;  3URY A;  1UE6 A;  2FXQ A;  4DV3 Q;  1HNX Q;  2XSC A;  3PO3 G;  3CPW A;  5C0X G;  1AE3 A;  2WKC A;  3I72 A;  1B8A A;  2DJF C;  4X64 L;  4R4T A;  1TXY A;  3UDI A;  2RCF A;  3VR3 A;  3MVV A;  4X62 L;  1TS2 A;  2F4V Q;  1LO5 D;  2EIF A;  4OO1 I;  1A2T A;  2H4O A;  2ZTE A;  4DV5 L;  1TT2 A;  2EYH A;  3H3V H;  3QJY A;  1K9M C;  2NVQ B;  1IBK L;  3SK6 A;  3I73 A;  1MBY A;  4KD4 A;  1CK1 A;  1PZI D;  1B1Z A;  3I90 A;  4AH6 A;  2A69 D;  3KF6 B;  2E2H H;  3KDF A;  1VCI A;  3OMC A;  5D65 A;  4IN3 A;  2JA5 G;  1SNC A;  4G57 A;  3GTK H;  2WAQ B;  2B3G A;  5HGT A;  3EN2 A;  1XPO A;  1PH3 A;  4JI3 L;  2B39 A;  2PO4 A;  3EBE A;  1U9R A;  4HED A;  4DFA A;  3K0Y A;  4OO1 G;  3VR4 A;  3TBI B;  3T51 B;  1V1O A;  3OWF A;  1GJX A;  2JJQ A;  5LMN L;  4GNX B;  2EY5 A;  1WTX A;  1HJP A;  5C5L A;  5JPM C;  2RHQ B;  1PH8 A;  4KY7 A;  4FXG C;  2YTY A;  1Y1W G;  2RDG A;  1CFM A;  4HAE A;  1S5F D;  1HNW L;  1X9N A;  1EY8 A;  1I4R A;  3PIP A;  1ZYR C;  1WD0 A;  3K5N A;  1YJW A;  1B9M A;  2KEE A;  3I4N H;  2KOL A;  4YHH Q;  1J6Q A;  3CD6 A;  2Z6K C;  1KNA A;  3STB D;  1CQF A;  3TP6 A;  4TVA B;  1M8A A;  4NP5 A;  2EDG A;  1PH5 A;  3GQB A;  3OHX C;  4IO9 A;  4FF2 A;  2BE5 C;  2ZTC A;  1MI2 A;  4RKB A;  1A3V A;  1DZ1 A;  3V2T A;  4XQQ A;  1CA6 A;  3H6M A;  3MTS A;  3DUZ A;  1EY7 A;  4HJ7 A;  5CR3 A;  3GTO H;  4J15 A;  3T16 A;  2NVT B;  4C3I B;  3BVM A;  2NTT A;  4C1N I;  5C3X A;  1WI5 A;  1F2L A;  1CHP D;  3RN5 A;  1IW7 C;  4I7Z C;  4IOA A;  3AQQ A;  4U68 A;  2K5Q A;  2C9O A;  2IWH A;  4JI5 L;  1X54 A;  4GKK L;  4DR5 L;  3PSI A;  4FVM A;  1CKO A;  1TWA H;  5EKK A;  4QGU A;  1AN8 A;  3E5S A;  5C0X J;  4A3M G;  3CXC A;  3S2H B;  1EYA A;  2B8F A;  2F0L A;  1IYU A;  5FKA C;  1CKM A;  2L0C A;  5F2D A;  2EXZ A;  4GS3 A;  2D2C C;  4HID A;  4GKJ L;  5EPK A;  4ME3 A;  5IOC A;  2VQE L;  3R2T A;  1BF4 A;  1Q8K A;  3NEL A;  5FLX L;  2BH8 A;  1ENA A;  1ET6 A;  1TS5 A;  3K57 A;  1BVS A;  2B2W C;  2O4X A;  1VQN A;  3D4W A;  5IYC G;  1XNR Q;  3Q24 A;  5L37 A;  3K6O A;  4Z9C B;  3SEB A;  3HOZ H;  5HGQ A;  5D14 A;  2BA1 A;  2Y0S G;  4RH6 A;  2F0N A;  3K80 C;  5BN3 A;  3T53 B;  4PMC A;  3MAQ A;  5JAV A;  3CCE A;  1EFW A;  5I6Y A;  1PTO C;  1GUS A;  1KLG D;  1D8L A;  1R9T H;  5FJ8 G;  3T1Y L;  2VUM B;  2V4D A;  1JQY D;  2JA7 G;  1BCP B;  1VMC A;  3U50 C;  1UWV A;  2Q8T A;  2TSS A;  2SNS A;  1E7Z A;  5IT9 L;  3M4Q A;  2XRQ D;  4KN7 C;  1RL2 A;  2PNR C;  2ZTD A;  1LTR D;  1UE1 A;  2AWN A;  4JI1 L;  2BDN A;  1EWH A;  2IHF A;  3CC7 A;  2I46 A;  2HDM A;  1P8L A;  2JQO A;  1Q12 A;  4LFC L;  1IBL Q;  1Q46 A;  4QB4 A;  5IE8 A;  4ZKC B;  5KGU A;  4JI4 Q;  1HHV A;  2IHE A;  4JBJ A;  1V1Q A;  3S15 H;  4XYQ A;  1VQA A;  2F0Q A;  2OXP A;  1K0R A;  5T1I A;  1JWS D;  2Q2I A;  4DR6 L;  4B3T L;  5JJK A;  4MIU A;  5FLX E;  4LUZ A;  3G48 A;  5IYB G;  3CCR A;  2ZJR A;  5KRU A;  1TKW B;  2AQ1 B;  1FGU A;  4PQX A;  1SJH D;  1KC8 C;  3GV6 A;  4OX9 Q;  5NUC A;  3QB3 A;  5BR8 Q;  1QJO A;  1R4P B;  3W1B A;  1DYQ A;  1NY4 A;  4DNI A;  2Q2U A;  4ZYS A;  3HOY G;  4K2L A;  2E2I H;  4C3H G;  1PRT B;  3MEH A;  2PZU A;  4RAU C;  3VYS A;  1JOO A;  1WCM B;  3BZD B;  4YWM A;  1GKH A;  2WAQ E;  1PFM A;  2PQE A;  5H1S E;  4EQO A;  2HHH L;  1YHB A;  4KV6 A;  3WWV A;  1JE5 A;  3G6E A;  1F9Q A;  3L9A X;  1E1T A;  4A3J B;  1HR0 W;  3R8B A;  3DEO A;  3F2C A;  1T5X D;  2IX0 A;  5IT9 E;  3FRP B;  4X3T A;  4IUQ A;  4LF4 Q;  1JIC A;  3NTH A;  1XNQ L;  5KYI A;  3GTQ B;  3KF8 B;  1RF2 D;  2EYP A;  5ELE A;  3S1R B;  5EJW A;  4JV5 Q;  2KCN A;  5IGG A;  2EVB A;  3CW2 C;  3EVQ A;  5CV9 A;  2A68 D;  5C44 B;  4L63 B;  3CCS A;  1C4Q A;  5EPJ A;  5GAE C;  4ZK9 B;  3TS0 A;  1Y69 U;  4GN3 B;  3RLO A;  3VR5 A;  4A3C H;  2MQH A;  5COY A;  5IGF A;  4N8F A;  4JI0 L;  4DR4 Q;  2F52 A;  1K8A C;  4A3G G;  1X6O A;  1HA5 A;  1WCM G;  1PXU A;  1VQ8 A;  1N34 Q;  2EYL A;  3L0O A;  4GLX A;  3S17 H;  3NQI A;  2PZT A;  3IL8 A;  3S24 A;  2F4I A;  1LAB A;  3OTO L;  5BN4 A;  5FO7 B;  4NXM Q;  2Y0S E;  2RQX A;  3X3M A;  1G2T A;  2VB3 X;  4BY7 G;  5DEH A;  1OXU A;  2CVR A;  3VYU A;  4O0A A;  3CQZ B;  3J81 L;  4GN4 B;  2QCP X;  1VQK A;  2KHI A;  1UE7 A;  3G6J B;  4HIM A;  3ER0 A;  3NK9 A;  3CCV A;  3LWE A;  4A3F B;  5JEA G;  3H0G B;  4CDD C;  2NVY B;  3GTP H;  3IRB A;  3FPP A;  1BKB A;  3NUC A;  5IGE A;  2UXD L;  1PV4 A;  5TSS A;  2HCC A;  2OQK A;  2K5V A;  5C3E G;  4LUV A;  4IPG A;  1FNV A;  1WTV A;  1LTB D;  2XNA C;  2A69 C;  1VQM A;  2I5L X;  1YEZ A;  4TKO B;  4DV2 Q;  1VQG A;  3TQY A;  3SHL A;  1EYC A;  2WAC A;  1X3G A;  4LJZ C;  2VY3 A;  1HQM C;  1XTC D;  4DR2 Q;  1XXG A;  1JCK B;  3ULP A;  3HOW B;  1HR0 L;  3KF6 A;  4JI6 L;  1A6X A;  3LGJ A;  4BS9 A;  5ELO A;  4FXK C;  4WFN 3;  1PH4 A;  2MPM A;  3DWA A;  1VQ7 A;  1QVC A;  1NSN S;  1RTO A;  5FO9 B;  4ZRZ A;  1N32 L;  4HJ8 A;  4AQY Q;  1EU3 A;  4BBR H;  2JA6 H;  1H9J A;  1TII D;  1SMY D;  4LF5 L;  3AFQ A;  5E1F A;  1EY5 A;  4JI2 L;  2Z9H A;  1DD2 A;  4K0K L;  3S14 H;  3K0X A;  2BOS A;  3GO5 A;  2CWP A;  3F2U A;  4A3E B;  4K5V A;  1F77 A;  3GTG B;  3J81 E;  3I8Z A;  2K52 A;  5IYD G;  1UE5 A;  4A3D H;  4GNX A;  1QWY A;  2VB2 X;  2F0K A;  3H91 A;  4KI0 A;  2OQ0 A;  1Q3L A;  1ZYR D;  1VQ9 A;  2WII B;  4XIG S;  1WOC A;  3TS2 A;  3GDE A;  2JA8 G;  3VA7 A;  4NMZ A;  4IUR A;  5M5W H;  3A8I E;  4K5W A;  4H44 C;  4A3K H;  1JB3 A;  4X6A H;  4R4Q A;  5IGD A;  3JAM L;  4BY1 B;  1IYV A;  3VYT A;  1RTN A;  1I3Q B;  3AEV A;  3CCM A;  1P16 A;  1NJI C;  2BE5 D;  4J1M A;  2KHJ A;  4BWG B;  2F03 A;  4IOC A;  2R7D A;  2V1C C;  4J6H A;  3NBI A;  2R7F A;  3H15 A;  2AUK A;  3VYR A;  3ERQ A;  2KCC A;  3PO2 G;  3NEN A;  5CGK A;  1NR4 A;  2EY2 A;  3I56 A;  3L2P A;  2N49 A;  3J7A 5;  1ILP A;  1IW7 D;  1TWG B;  4C2M H;  4NDX A;  4L6T B;  2O2L D;  5M3M H;  4K5X A;  4ZUI A;  4U67 3;  1QCB D;  2LFN A;  4ID6 A;  5ELB A;  4PNY A;  4A3E G;  3I70 A;  5JEA J;  3D8G A;  2B2Y A;  1U4P A;  3R93 A;  1B70 B;  3ONA B;  4A3L G;  3KK7 A;  3KBX A;  5CV7 A;  2VXW A;  1DOM A;  1EIY B;  1I4P A;  1OTC A;  4O42 A;  1EY9 A;  4PZ8 A;  1HNZ Q;  5ISR A;  3K5M A;  3HOU H;  2KCT A;  1IZ6 A;  3Q0A A;  3K7A H;  4P71 A;  2UXC Q;  3I4O A;  4M8A A;  2CH4 W;  3TEH B;  1BBW A;  4JI8 Q;  1NAP A;  3JAM E;  1VQ5 A;  3S1M B;  3S2D H;  2OEO A;  3IAY A;  1YIJ A;  1SAP A;  3FEW X;  2UUC L;  4YCV A;  1PTO D;  1Y1V H;  4EVO A;  2Z4I A;  1Q81 C;  4DV4 L;  3NBH B;  2R7Z H;  4JBK A;  3EFX D;  5IWA L;  1PTO F;  1BR9 A;  1L0W A;  2ATW A;  3BZK A;  2AQ2 B;  5G3L F;  5M3F B;  2ASB A;  5CYU A;  2NVX H;  1FJG Q;  1CKN B;  5C4Z A;  1G8Z D;  1STB A;  3E3X A;  1G91 A;  4R9W A;  1VQB A;  3MXP A;  2EYM A;  4DV7 L;  4J8Q A;  4DNT B;  2LXJ A;  3RUZ A;  2NTS A;  3ND8 A;  4IUP A;  4C3J G;  1PH9 A;  3H3V I;  4RGM A;  4CJ2 C;  1XMO Q;  2CQO A;  5HUR A;  2YU9 H;  1EQR A;  3MFY A;  2HQL A;  3CMA A;  1EFI D;  1STE A;  1I6H B;  5AFW A;  1SYD A;  3GD7 A;  1KIX A;  3NP8 A;  2ZM6 L;  1Q7Y C;  4B3M L;  1SDF A;  4GOP B;  3ULJ A;  5FLX c;  1KHI A;  1DJR D;  3R3O A;  1IBM L;  4B3R L;  3DM1 A;  2EY6 A;  3D31 A;  5COR A;  3M3Y B;  5DM7 3;  4A3B B;  3QO2 A;  3H3V C;  2L55 A;  2A6H C;  1U5K A;  5GAD C;  1S72 A;  2EJM A;  4TQU S;  3DLL A;  2Z0S A;  2H1E A;  2PPB C;  4LW1 A;  2UXB Q;  3RR5 A;  3I4N B;  4M1U B;  4X65 Q;  2LS0 1;  1SFO H;  3RN2 A;  2HT1 A;  4H0L C;  1SNP A;  2M2L A;  1YNX A;  2XGT A;  4O2D A;  1AFP A;  1W2B A;  4LF8 L;  1SBB B;  4P74 A;  1ML0 D;  2K33 A;  3S1N B;  1QG7 A;  5BN5 A;  3NHH A;  1GVP A;  2F0T A;  1I94 Q;  1J8I A;  4IFD H;  2MUY A;  2F0J A;  2HDL A;  4WOR A;  1QNU A;  3D4R A;  3ND9 A;  1EYD A;  1Q8I A;  2LSS A;  3ERO A;  3GTO B;  1XMQ Q;  4IUU A;  1F9S A;  1VQE A;  2E5L Q;  1PZJ D;  4X66 Q;  2LY7 A;  1TWH H;  1VF7 A;  4XDX A;  5KND A;  3KF8 A;  3I2Z A;  5KEE A;  1N8R C;  1KAB A;  2F3V A;  3K5O A;  3AB9 A;  3RZO B;  4K8J A;  5ELN A;  4MTN A;  1EZ6 A;  1PRT F;  4B3S Q;  2B8G A;  1SND A;  3FMC A;  4OIK A;  4JI7 Q;  2B2T C;  1YJN A;  3I4N G;  4ODG A;  2JA5 B;  3T1H L;  3C1F A;  4FF3 A;  1IXR A;  3VR2 A;  3AFP A;  2F4V L;  1KNE A;  2E2J B;  1H95 A;  1SSO A;  2F0I A;  2EXD A;  3CRL C;  1QB5 D;  4A76 A;  3RMH A;  3G4S A;  3HOX H;  1LTT D;  4L8J A;  1EEF D;  4YCW A;  1C0A A;  2F0G A;  2G9H D;  1BO0 A;  3PUZ A;  2DNE A;  1VQ4 A;  1B44 D;  4HMJ A;  3AMU A;  4H13 C;  4EQN A;  1II3 A;  1NE3 A;  3TP7 A;  3L7Z C;  5GAG C;  3GV3 A;  1IHZ A;  2JN4 A;  1G6P A;  1Y1W B;  3KLR A;  1PFB A;  1C8C A;  4HIO A;  3FKI H;  2K14 A;  2L15 A;  4XQJ A;  1C7Y A;  3QG1 A;  4XYO A;  4L5S A;  2AMC B;  4LF7 L;  3DHQ A;  4FO2 A;  1GUO A;  4N9P A;  1JJC B;  2SOB A;  1B3Q A;  1VQC A;  2B63 H;  3G7L A;  5DLQ E;  1AW7 A;  1YZ6 A;  2UUA L;  4KLK A;  4YHH L;  4YWK A;  1QOH A;  2R92 H;  5EBD A;  2CHB D;  1IYJ B;  3HOZ G;  1HA6 A;  4APV A;  1SMY C;  2L5T A;  3NXW A;  5EKL A;  1TY2 A;  4RHS A;  2R93 H;  1GUN A;  1PFN A;  4JOI C;  1LUZ A;  1QIL A;  3OSO A;  1K8G A;  1BBX C;  4DV5 Q;  4OON A;  1YJ9 A;  4A3M B;  4DR7 L;  2IY5 B;  1WTO A;  5C4X H;  1MJE A;  4QUC A;  5AJ3 L;  4ALP A;  2A8V A;  3TDQ A;  2IPK D;  4I65 A;  3J81 c;  1D5X C;  2QF7 A;  3J80 L;  3MC0 B;  4Y52 H;  1A3T A;  1F9R A;  5J3B A;  2D9U A;  4K8I A;  4V0B A;  1B7Y B;  1TWF H;  1I50 B;  4DXG A;  3D6C A;  1KLU D;  2N55 A;  4JI3 Q;  1I4Q A;  1VQH A;  4DPG A;  4A3I H;  2DN8 A;  2RVL A;  4PZ6 A;  2Y0S B;  4RWS C;  3PIP 3;  2AKW B;  4FNF A;  5LMN Q;  4PG3 A;  5KIX A;  3GTJ B;  3MWY W;  1TWC B;  2E2D C;  1KAA A;  5J1Z A;  4CJ0 B;  3RD4 A;  1K0S A;  1HNW Q;  1X3Q A;  1XNR L;  1PTO B;  2OF1 A;  2JA7 B;  2GVB A;  1ICF B;  2NZO A;  1V43 A;  2FHT A;  3I4M H;  5EQ0 A;  4GLV B;  4DV1 L;  2A5H A;  1EY4 A;  1HXY D;  4CKB A;  2AUJ D;  1STG A;  3O13 A;  1I5F A;  4JBW A;  4CKE A;  1ASY A;  1KDA A;  3S17 B;  1SNQ A;  1W6J A;  1AEX A;  4DXF A;  3J80 E;  2CH4 A;  2LMC B;  3ZJY C;  2PI2 E;  2K32 A;  2F3I A;  1LM0 A;  2JSO A;  4CKC A;  2B2U A;  2CQA A;  4DR1 Q;  5K5P A;  2UUB L;  3H94 A;  4FXD A;  5C4J H;  1SYC A;  2BH2 A;  1N36 L;  1SJE D;  1AZQ A;  5M5X B;  4JI5 Q;  2D0O A;  3J81 j;  4IZ8 A;  1A2U A;  4DAV A;  4FYD A;  1VQL A;  1LTG D;  1ENC A;  3HZX A;  4FP5 D;  2RSN A;  1RJT A;  3NPP A;  5LHY 1;  3HOY B;  4C3H B;  4A3C G;  4GKJ Q;  2VQE Q;  3GTL B;  1XPU A;  3J7A F;  4IUV A;  1K83 B;  2O5I C;  1PLF A;  3FPU B;  3NBH A;  1SLJ A;  1FVI A;  2IX1 A;  2NVQ H;  5BR8 L;  4UPA A;  3MXN B;  4FF1 A;  1C9O A;  3HFZ B;  4FF4 A;  3S16 B;  1DCZ A;  2I07 B;  1CKN A;  1V1P A;  1UNS A;  2O5J C;  1LTI D;  2NN6 H;  1O7I A;  2VNU D;  4DGZ A;  5JVG 3;  2MP1 A;  1B4O A;  5T1G A;  3HKS A;  1F2M A;  4DNR B;  1X3P A;  3OYY A;  2NYZ D;  3ZYY X;  1EL0 A;  1Y8N B;  1HZB A;  3T1Y Q;  2FMM A;  3GP7 A;  1HZ9 A;  2F0S A;  4KTA A;  3EA6 A;  3U58 A;  4K14 A;  3A74 A;  1F9P A;  2QKI C;  2B2V C;  3TRE A;  2KHS A;  4GOP A;  3T13 A;  1OXT A;  1E24 A;  2F0D A;  3S1Q B;  1LAC A;  1M4V A;  2A6H D;  4A3G B;  3A56 A;  4JV5 L;  4L5R C;  5CBE E;  3C1E A;  2VZA A;  1PYW D;  4JYA L;  5CV5 A;  4NXN Q;  2QDB A;  1PA6 A;  4ZKB B;  4BXX H;  2KCM A;  4A93 H;  2KQ3 A;  2E8G A;  4WJW A;  3OIP A;  2IT1 A;  1E1O A;  3IFD A;  1AP0 A;  1I6V C;  4NB3 A;  2EYJ A;  1HUN A;  1VQF A;  4ZQ3 A;  1UUP A;  1GM5 A;  4DR4 L;  3EIV A;  1Z9F A;  2PQA B;  4OL7 A;  1HZC A;  5EBC A;  1EY6 A;  4CHT B;  2MO0 A;  4BY7 B;  1PFS A;  5IIF A;  1QVG A;  1N34 L;  3HEJ A;  1PYS B;  1Y8O B;  3UI2 A;  3DMU A;  3AYH B;  3T4A C;  4BBR G;  5ELD A;  2JA6 G;  4XQN A;  2ZT9 C;  2NVT H;  4IPC A;  3RLF A;  4C3I H;  1PHJ A;  4L5T A;  4NXM L;  4H7B A;  1X32 A;  5C3E B;  3DWQ A;  1MSH A;  3D4D A;  5GQO A;  2C35 B;  4A3D G;  3UDG A;  4R4I A;  1L1O B;  3ERS X;  2HHH Q;  3S2H H;  4HR7 B;  1NUC A;  1E0B A;  3PIO A;  1J5E Q;  3M4O B;  2PNH A;  3W5O A;  2EJG C;  1JT8 A;  3RZD B;  4A3K G;  4DA2 A;  4KKS A;  5J39 A;  1QZH A;  2K03 A;  4FDB A;  1XNQ Q;  2VS1 A;  1LLR D;  1S40 A;  1EIG A;  4QUF A;  3PCO B;  1E2Z A;  2Q8R E;  3E9H A;  1X56 A;  1EQQ A;  1G29 1;  3UE0 A;  3SXH A;  2LKV A;  3A7L A;  4XT3 B;  4Q0F A;  2DJG C;  1CHQ D;  1GHJ A;  1JOK A;  1VDZ A;  4RGO S;  3WOE A;  3QWN A;  4DR2 L;  1KQS A;  2QA4 A;  1D6E C;  5M3M G;  2F0P A;  1YI2 A;  2YYZ A;  4HCS A;  2Q2T A;  1L1O C;  3MEF A;  5CV6 A;  5D3D A;  5CBA E;  4LFB L;  4P72 A;  5C6A A;  1L0X B;  5I4D A;  3J81 i;  2I5M X;  1LTA D;  2SDF A;  3FVQ A;  2VUM H;  2JA8 B;  1CSP A;  3CC2 A;  3M85 A;  3CC4 A;  1Z6H A;  3OTO Q;  4R8N A;  3MXU A;  2DNC A;  3PF5 A;  3PUW A;  4IPH A;  4LF6 L;  3MZ5 A;  2YU9 B;  3HOU G;  1SYB A;  2QIL A;  2Z6K A;  1A8V A;  1Q90 A;  1CI3 M;  2NB0 A;  3I3C A;  1DON A;  1KDB A;  3PO2 B;  3HP3 A;  3CPF A;  3GTM B;  3CME A;  4TSS A;  2YTV A;  3P20 A;  1H9M A;  3DM3 A;  5JOB A;  4RMF A;  1B9N A;  2IJ0 A;  1Y1V G;  4ULL A;  1VQI A;  1EQT A;  1WFQ A;  2WV6 D;  4AYB G;  2L4N A;  1TS3 A;  1O7Y A;  1FNW A;  4UAI A;  1NMF A;  1EEI D;  2YTX A;  1ESR A;  2ICI A;  4DR3 L;  1KD1 C;  3HG9 A;  1SR3 A;  3CF5 A;  2MFI A;  3JC6 6;  3WDN A;  3CCL A;  1A15 A;  3NWT A;  1LTL A;  1D2B A;  1YBY A;  3HS0 C;  5KYL A;  2N88 A;  3F2B A;  3HKZ B;  4A3J H;  2Z4H A;  4GN5 A;  1VQP A;  3EJI A;  4S3S A;  2G5D A;  4LF5 Q;  3BDO A;  1E2W A;  1RCV D;  3KUP A;  4JI2 Q;  3JAM i;  1SNM A;  2B2W A;  5CMD A;  1HCZ A;  1HNZ L;  1OXX K;  3GTQ H;  3S1R H;  5IP7 H;  1GUW A;  4JW0 A;  4IFD I;  2J7Z A;  4UP8 A;  5C44 H;  4YWL A;  2KEN A;  2EPB A;  2BA0 A;  3R2I A;  4JI8 L;  1T9H A;  2F3W A;  2JA9 A;  1B2T A;  1YNN D;  4I7A A;  1KXL A;  1PH6 A;  4XTC S;  4DUZ Q;  4DV6 L; 
#chains in the Genus database with same CATH homology
 4B08 A;  4C3J B;  4RHR A;  1S4Z A;  2XWB B;  3SDZ A;  4DK1 A;  3C3L A;  1MGS A;  4KY6 A;  3SVM A;  3L3O C;  4IFD G;  4DK0 A;  1XWE A;  2EOT A;  2JP1 A;  3KBG A;  2HQE A;  2K05 A;  1EY0 A;  4QF4 A;  5JVH 3;  3QIA A;  1HPC A;  3OMG A;  1IL8 A;  4MHE A;  3HRZ C;  4QIW B;  2RBM A;  1HTP A;  2PCF B;  4F87 A;  2E2H B;  1TR5 A;  3BG3 A;  3PUV A;  3IKJ A;  1F2Z A;  5KNC A;  3GTK B;  3OPO A;  2RSO A;  1S5C D;  2JE6 I;  1LT4 D;  1BOS A;  1GUG A;  1S5D D;  3MXN A;  1HUM A;  2X69 A;  4IQZ A;  5K36 H;  2R92 B;  4KHV A;  4BA2 I;  4KK7 A;  3V96 A;  1I4X A;  3T56 B;  5I2X A;  3A8J E;  1CTM A;  2JEA I;  1WVL A;  1GXD C;  2FIN B;  4MN3 A;  2D5D A;  2F1M A;  2NWG A;  2NZ1 D;  4G7O C;  3C46 A;  1ZXT A;  2FJ2 A;  1QE6 A;  4ME5 A;  4KMU C;  2F0H A;  2HUG A;  4G7H C;  1D5M C;  1TVX A;  4CBV A;  3MA2 B;  3A7A B;  2F0U A;  2OT2 A;  2TMP A;  1STN A;  4IFD J;  3H09 A;  1ICW A;  1B53 A;  1HTL D;  1LV9 A;  1TWA B;  1DXM A;  1W6K A;  5DAU A;  1MD2 D;  4QMG A;  3QOJ A;  4K6D A;  4K2K A;  1SE2 A;  2ZXP A;  3FDT A;  3E0J A;  1EU4 A;  4WRD A;  4CJ1 B;  4OIJ A;  2FFK B;  1TQO A;  1JE4 A;  2XWJ B;  3PUX A;  3M7N A;  3HOZ B;  3CRK C;  1MSG A;  2PW7 A;  1ESF A;  2KEC A;  1H9S B;  1ROD A;  4HSP A;  2EYF A;  1STA A;  4DF7 A;  1R9T B;  4PV1 C;  3SK4 A;  2WIN B;  4ABN A;  1EIH A;  5CC4 A;  4X3U A;  2K28 A;  1HFG A;  2KVM A;  4IUN A;  2KA7 A;  1FGB D;  2R61 A;  3PMF A;  4HMI A;  5A35 A;  4RCO A;  3OWE B;  1JWM D;  2XIW A;  1O78 A;  3S15 B;  4G7Z C;  3NTI A;  1TU2 B;  4TRD A;  1XYI A;  3WOF A;  5LL6 X;  2MGS A;  1F2Y A;  1SEB D;  4B9X A;  2DY7 A;  2ZXR A;  1BUV T;  1J9O A;  2X6L A;  2A73 B;  4HCE A;  2NN6 I;  2MHV A;  1CZW A;  1CM9 A;  3M7G A;  2E2I B;  2XN9 C;  2PW5 A;  1E2V A;  1FR3 A;  4V19 0;  2L12 A;  2PYK A;  1B50 A;  3N6R A;  1OO9 B;  3NTK A;  4G4K A;  2X6G A;  3P7J A;  2F0F A;  3TP5 A;  3TN2 A;  4A93 B;  1ZEQ X;  3VR6 A;  3V05 A;  5E4W C;  1O80 A;  1SNO A;  4NW2 A;  3OOC A;  1VMP A;  2NN6 G;  3D3R A;  1B3A A;  1HFN A;  5DM6 3;  1Q1B A;  2E75 C;  3K59 A;  2D62 A;  1JWU D;  1BNZ A;  2F0E A;  1JOQ A;  1ET9 A;  5C0X H;  1YNN C;  2MJ8 A;  2WP8 J;  3Q22 A;  2ICE C;  1Z47 A;  4Q5V A;  1R4Q B;  5JPN C;  3VA5 A;  2NUC A;  2EE1 A;  1TY0 A;  4RFB A;  1NR2 A;  2Z1C A;  3TP8 A;  4C1N K;  2AQ3 B;  4HTH A;  4OO1 H;  1LTS D;  4LK1 C;  3OIQ A;  2SEB D;  1UAP A;  2KJX A;  2B2Y C;  3GTP B;  1WD1 A;  2R3Z A;  4C3I G;  3K58 A;  3U9O A;  4KHZ A;  3ITP A;  5J22 A;  5I6W A;  3J7Y W;  3MXG A;  1C48 A;  2NBF A;  2K5D A;  4R8I A;  1XX8 A;  2ZXO A;  3A55 A;  4DN4 M;  2A6E C;  3Q23 A;  5CV8 A;  1IKL A;  1LT3 D;  4GZY C;  4ZLT F;  5EPL A;  4BBR B;  2JA6 B;  5JJZ A;  4XXE A;  3CU7 A;  3S14 B;  1DOK A;  3NSW A;  1TS4 A;  5I9P A;  4HSV A;  4DAP A;  4A3D B;  1ENF A;  2C5C A;  1BCP C;  5FK9 C;  1DM0 B;  4KJN A;  3DXJ C;  2PZW A;  5M5W B;  4F7X A;  4A3K B;  3K5L A;  3TSS A;  5IGB A;  1CA5 A;  1CZG A;  2K01 A;  3BYY B;  2B2T A;  1Y8P B;  4YIJ A;  2ENB A;  4C2M B;  5DNF A;  1AZP A;  5M3M B;  3D6W A;  1UEA B;  4DAY A;  2WKD A;  1ONL A;  2CW0 C;  4X3K A;  3W2D A;  1GUT A;  1PTO H;  2XVS A;  1PRT C;  1SYG A;  1OXV A;  2KUM A;  1YNJ C;  1Z7T A;  3LX0 A;  5E4X A;  3W3A A;  1I4G A;  1FYC A;  3HOU B;  1S5E D;  3K7A B;  3P75 A;  2JYO A;  2RA4 A;  4JK1 C;  5IGC A;  3S2D B;  3A8K E;  5M9O A;  4E6I A;  3PIO 3;  2JXM B;  1Y1V B;  4AYB B;  4NKL A;  4EGV A;  1HRJ A;  2R7Z B;  4KKT A;  1LT6 D;  1H9S A;  3I91 A;  2J0T D;  1KTK A;  1EWC A;  3J7A V;  1I4H A;  2NVX B;  3NQT A;  5I2Y A;  4BA1 I;  2KED A;  1D1I A;  3PV0 A;  4RKL A;  3I4L A;  4F88 A;  3DWP A;  2IW3 A;  4P2C B;  3BVZ A;  3MFG A;  2HCI A;  2L1B A;  2RKS A;  5FO8 B;  1L0Y B;  3TZD A;  2PMZ B;  1JC7 A;  4KN4 C;  3TZU A;  4K6L A;  2F0O A;  1GOZ A;  1S5B D;  4Y7N B;  1O7Z A;  5ELC A;  2EJF C;  4KKU A;  3HGB A;  1RKN A;  2Z8L A;  3BS1 A;  1EQV A;  2L11 A;  4ILW A;  1SFO B;  3DEP A;  3Q6S A;  1BXT A;  1KDC A;  5C4H A;  4B9W A;  4IAL A;  1LT5 D;  4OHJ A;  1CQV A;  2GA4 B;  5FOB B;  1EOT A;  4KJO A;  5E3F A;  1PDQ A;  4BBS B;  5C3W A;  5LL6 S;  1IKM A;  5K36 G;  5A2Q L;  2K5W A;  1SYF A;  2RDH A;  1TWH B;  5CV4 A;  2JEB I;  1BDO A;  4CGY B;  3SR1 A;  5C5M A;  1FNU A;  1WTR A;  5JEA H;  2AWO A;  2DY8 A;  3KLS A;  2EYO A;  1K8M A;  3P1H A;  5D3I B;  1K8O A;  4LMQ D;  1EZ8 A;  4O1N A;  3EQL C;  1U4L A;  1WTP A;  1Q1E A;  4EQP A;  1SXT A;  3QOL A;  1DOL A;  3HOV B;  3E6Z X;  3HOX B;  4N9T A;  1FD7 D;  3OW7 A;  4DU9 A;  5KNB A;  1U4M A;  1STY A;  1ILQ A;  4X3S A;  3BVG A;  2A74 C;  4RGN A;  2G9D A;  1O7L A;  1D5Z C;  3FKI B;  2L9H A;  5A2Q E;  1QNK A;  1SE3 A;  3C2P A;  4C56 C;  2SNM A;  2M9V A;  1V8Q A;  4LAA A;  1NCV A;  3M4Y A;  3NE5 B;  5G3L D;  1WTQ A;  2E74 C;  2B2V A;  4KY5 A;  3TME A;  1G6Z A;  1OXS C;  1BQQ T;  2B2U C;  2XRS D;  3BYT B;  2B63 B;  4QCL A;  3BDC A;  3SK8 A;  2IL8 A;  2IX3 A;  1V1P B;  4F8M A;  2A6E D;  4RA8 A;  1CT1 D;  1A3U A;  3AU7 A;  4RGT A;  2K04 A;  2R93 B;  4OGQ C;  5EKI A;  2R6G A;  5ELF A;  5C4X B;  2K7V A;  1PMR A;  3CHB D;  2M00 A;  3KLS X;  1RD9 D;  3PUY A;  2K1B A;  4HN7 A;  3S9W A;  3X3N A;  1BCP D;  4ZAI A;  4IUT A;  1TWF B;  1BCP F;  1HQR D;  1PZK D;  4UDU C;  1H9R A;  1T5E A;  2EY1 A;  4A3I B;  4XT1 B;  5EGT A;  1STH A;  2FMC A;  2F0M A;  4ZUJ A;  1D1K A;  4PMB A;  2BCO A;  5I9O A;  2EZV A;  1VF5 C;  3LWU A;  3CKI B;  2J4X A;  1JR0 D;  2RDF A;  2Q8I B;  2A68 C;  2E76 C;  4RCN A;  2QEJ C;  3IFT A;  3PO3 B;  3I4M B;  2CW0 D;  2BDO A;  1JOR A;  1ZKO A;  3SE0 A;  2F0W A;  3NWS A;  1PRT D;  4PMW A;  5C0X I;  4KD3 A;  1YNJ D;  1SE4 A;  2K6A A;  3LNN A;  3U9S A;  1SYE A;  5M5Y B;  2WB1 B;  2ID0 A;  1H9K A;  1G2S A;  3N52 A;  1RHP A;  5IOD A;  5C4J B;  1GHK A;  3BDL A;  3SK5 A;  1U4R A;  1WTW A;  1RDP D;  3MHB A;  2F0V A;  3A54 A;  3URY A;  2XSC A;  5C0X G;  2WKC A;  3I72 A;  3VR3 A;  3MVV A;  1TS2 A;  1LO5 D;  4OO1 I;  1A2T A;  2H4O A;  1TT2 A;  2EYH A;  3QJY A;  2NVQ B;  3SK6 A;  3I73 A;  1MBY A;  4KD4 A;  1CK1 A;  1PZI D;  1B1Z A;  3I90 A;  2A69 D;  1VCI A;  3OMC A;  5D65 A;  4IN3 A;  1SNC A;  4G57 A;  2WAQ B;  5HGT A;  2B39 A;  2PO4 A;  1U9R A;  4HED A;  4DFA A;  3K0Y A;  4OO1 G;  3VR4 A;  3TBI B;  3T51 B;  1V1O A;  3OWF A;  1GJX A;  2EY5 A;  1WTX A;  5C5L A;  5JPM C;  4KY7 A;  4FXG C;  2RDG A;  1CFM A;  4HAE A;  1S5F D;  1EY8 A;  1I4R A;  1ZYR C;  1WD0 A;  3K5N A;  1B9M A;  2KEE A;  2KOL A;  1KNA A;  1CQF A;  3TP6 A;  1M8A A;  4NP5 A;  2EDG A;  3GQB A;  3OHX C;  4FF2 A;  2BE5 C;  1MI2 A;  4RKB A;  1A3V A;  1DZ1 A;  3V2T A;  4XQQ A;  1CA6 A;  3H6M A;  3MTS A;  3DUZ A;  1EY7 A;  5CR3 A;  3T16 A;  2NVT B;  4C3I B;  3BVM A;  2NTT A;  4C1N I;  5C3X A;  1F2L A;  1CHP D;  1IW7 C;  4I7Z C;  4U68 A;  2K5Q A;  2C9O A;  2IWH A;  4FVM A;  5EKK A;  5C0X J;  1AN8 A;  3E5S A;  3S2H B;  1EYA A;  2B8F A;  2F0L A;  1IYU A;  5FKA C;  2L0C A;  5F2D A;  2EXZ A;  2D2C C;  5EPK A;  5IOC A;  3R2T A;  1BF4 A;  5FLX L;  1ENA A;  1ET6 A;  1TS5 A;  3K57 A;  2B2W C;  2O4X A;  3D4W A;  3Q24 A;  3K6O A;  4Z9C B;  3SEB A;  5D14 A;  2BA1 A;  4RH6 A;  2F0N A;  5BN3 A;  3T53 B;  4PMC A;  3MAQ A;  5JAV A;  5I6Y A;  1PTO C;  1GUS A;  1KLG D;  2VUM B;  2V4D A;  1JQY D;  1BCP B;  1VMC A;  2Q8T A;  2TSS A;  2SNS A;  5IT9 L;  2XRQ D;  4KN7 C;  2PNR C;  1LTR D;  2AWN A;  2BDN A;  1EWH A;  2I46 A;  2HDM A;  1Q12 A;  4QB4 A;  4ZKC B;  5KGU A;  1HHV A;  4XYQ A;  2F0Q A;  2OXP A;  5T1I A;  1JWS D;  4MIU A;  5FLX E;  5KRU A;  1TKW B;  2AQ1 B;  4PQX A;  1SJH D;  3GV6 A;  5NUC A;  3QB3 A;  1QJO A;  1R4P B;  1DYQ A;  4ZYS A;  4K2L A;  4C3H G;  1PRT B;  3MEH A;  2PZU A;  4RAU C;  3VYS A;  1JOO A;  1WCM B;  3BZD B;  1PFM A;  2PQE A;  4EQO A;  4KV6 A;  1F9Q A;  3L9A X;  4A3J B;  3R8B A;  3DEO A;  1T5X D;  2IX0 A;  5IT9 E;  3FRP B;  4X3T A;  4IUQ A;  1JIC A;  3NTH A;  5KYI A;  3GTQ B;  3S1R B;  1RF2 D;  2EYP A;  5ELE A;  5EJW A;  2KCN A;  5IGG A;  2EVB A;  3EVQ A;  5CV9 A;  2A68 D;  5C44 B;  4L63 B;  1C4Q A;  5EPJ A;  4ZK9 B;  1Y69 U;  3VR5 A;  5COY A;  5IGF A;  1HA5 A;  1PXU A;  2EYL A;  3NQI A;  2PZT A;  3IL8 A;  2F4I A;  1LAB A;  5BN4 A;  5FO7 B;  2RQX A;  3X3M A;  1G2T A;  2VB3 X;  5DEH A;  1OXU A;  2CVR A;  3VYU A;  3CQZ B;  3J81 L;  2QCP X;  3G6J B;  3NK9 A;  3LWE A;  4A3F B;  5JEA G;  3H0G B;  2NVY B;  3FPP A;  5IGE A;  3NUC A;  5TSS A;  2HCC A;  1FNV A;  1WTV A;  1LTB D;  2XNA C;  2A69 C;  4TKO B;  3SHL A;  1EYC A;  2WAC A;  4LJZ C;  1HQM C;  1XTC D;  3HOW B;  1XXG A;  1JCK B;  1A6X A;  4BS9 A;  4FXK C;  4WFN 3;  2MPM A;  3DWA A;  1RTO A;  1NSN S;  5FO9 B;  4ZRZ A;  1EU3 A;  1H9J A;  1TII D;  1SMY D;  5E1F A;  1EY5 A;  1DD2 A;  2BOS A;  3GO5 A;  3F2U A;  4A3E B;  4K5V A;  1F77 A;  3GTG B;  3J81 E;  3I8Z A;  1QWY A;  2VB2 X;  2F0K A;  3H91 A;  4KI0 A;  1Q3L A;  1ZYR D;  2WII B;  4XIG S;  3VA7 A;  4NMZ A;  4IUR A;  3A8I E;  4K5W A;  4H44 C;  1JB3 A;  5IGD A;  3JAM L;  4BY1 B;  1IYV A;  3VYT A;  1RTN A;  1I3Q B;  2BE5 D;  4J1M A;  4BWG B;  2F03 A;  4J6H A;  3NBI A;  2AUK A;  3VYR A;  3ERQ A;  2KCC A;  5CGK A;  1NR4 A;  2EY2 A;  1ILP A;  1IW7 D;  1TWG B;  4NDX A;  4L6T B;  2O2L D;  4K5X A;  4ZUI A;  4U67 3;  1QCB D;  2LFN A;  4ID6 A;  5ELB A;  4PNY A;  3I70 A;  5JEA J;  3D8G A;  2B2Y A;  1U4P A;  3R93 A;  3ONA B;  3KK7 A;  3KBX A;  5CV7 A;  2VXW A;  1DOM A;  1I4P A;  4O42 A;  1EY9 A;  5ISR A;  3K5M A;  3Q0A A;  4M8A A;  1NAP A;  3JAM E;  3S1M B;  2OEO A;  3IAY A;  1SAP A;  3FEW X;  1PTO D;  4EVO A;  2Z4I A;  3EFX D;  1PTO F;  1BR9 A;  2AQ2 B;  5G3L F;  5M3F B;  5CYU A;  5C4Z A;  1G8Z D;  1STB A;  1G91 A;  4R9W A;  3MXP A;  2EYM A;  4DNT B;  4J8Q A;  3RUZ A;  2NTS A;  3ND8 A;  4IUP A;  4C3J G;  4RGM A;  4CJ2 C;  5HUR A;  3MFY A;  1EFI D;  1STE A;  1I6H B;  5AFW A;  1SYD A;  3GD7 A;  3NP8 A;  1SDF A;  1DJR D;  3R3O A;  3DM1 A;  2EY6 A;  3D31 A;  5COR A;  3M3Y B;  5DM7 3;  4A3B B;  3QO2 A;  3H3V C;  2L55 A;  2A6H C;  2EJM A;  4TQU S;  2H1E A;  2PPB C;  3I4N B;  4M1U B;  2LS0 1;  4H0L C;  1SNP A;  2M2L A;  1AFP A;  1SBB B;  1ML0 D;  2K33 A;  3S1N B;  1QG7 A;  5BN5 A;  3NHH A;  2F0T A;  1J8I A;  4IFD H;  2MUY A;  2F0J A;  2HDL A;  4WOR A;  1QNU A;  3D4R A;  1EYD A;  1Q8I A;  3ND9 A;  3ERO A;  3GTO B;  4IUU A;  1F9S A;  1PZJ D;  2LY7 A;  1VF7 A;  4XDX A;  5KND A;  3KF8 A;  5KEE A;  1KAB A;  2F3V A;  3K5O A;  3AB9 A;  3RZO B;  4K8J A;  1EZ6 A;  1PRT F;  2B8G A;  1SND A;  3FMC A;  4OIK A;  2B2T C;  4ODG A;  2JA5 B;  3C1F A;  4FF3 A;  3VR2 A;  1KNE A;  2E2J B;  1SSO A;  2F0I A;  3CRL C;  1QB5 D;  3RMH A;  1LTT D;  4L8J A;  1EEF D;  2F0G A;  2G9H D;  1BO0 A;  3PUZ A;  2DNE A;  1B44 D;  4HMJ A;  3AMU A;  4H13 C;  4EQN A;  1II3 A;  3TP7 A;  3L7Z C;  3GV3 A;  1IHZ A;  1Y1W B;  3KLR A;  1PFB A;  1C8C A;  4XQJ A;  3QG1 A;  4XYO A;  3DHQ A;  4FO2 A;  1GUO A;  4N9P A;  2SOB A;  3G7L A;  1AW7 A;  1QOH A;  5EBD A;  2CHB D;  1HA6 A;  1SMY C;  2L5T A;  3NXW A;  5EKL A;  1TY2 A;  4RHS A;  1GUN A;  1PFN A;  1QIL A;  3OSO A;  1BBX C;  4A3M B;  1WTO A;  4QUC A;  3TDQ A;  2IPK D;  4I65 A;  1D5X C;  2QF7 A;  3J80 L;  3MC0 B;  1A3T A;  1F9R A;  2D9U A;  4K8I A;  4V0B A;  1I50 B;  4DXG A;  3D6C A;  1KLU D;  2N55 A;  1I4Q A;  2DN8 A;  2RVL A;  2Y0S B;  4RWS C;  3PIP 3;  4FNF A;  5KIX A;  3GTJ B;  3MWY W;  1TWC B;  2E2D C;  1KAA A;  5J1Z A;  4CJ0 B;  3RD4 A;  1X3Q A;  1PTO B;  2OF1 A;  2JA7 B;  1V43 A;  2FHT A;  5EQ0 A;  2A5H A;  1EY4 A;  1HXY D;  4CKB A;  2AUJ D;  1STG A;  3O13 A;  4JBW A;  4CKE A;  1KDA A;  3S17 B;  1SNQ A;  1W6J A;  1AEX A;  4DXF A;  3J80 E;  2LMC B;  2K32 A;  2JSO A;  4CKC A;  2B2U A;  2CQA A;  5K5P A;  3H94 A;  4FXD A;  1SYC A;  1SJE D;  1AZQ A;  5M5X B;  4IZ8 A;  1A2U A;  4DAV A;  4FYD A;  1LTG D;  1ENC A;  3HZX A;  4FP5 D;  2RSN A;  1RJT A;  3NPP A;  5LHY 1;  3HOY B;  4C3H B;  3GTL B;  3J7A F;  4IUV A;  1K83 B;  2O5I C;  1PLF A;  3FPU B;  3NBH A;  2IX1 A;  4FF1 A;  4FF4 A;  3S16 B;  1DCZ A;  2I07 B;  1V1P A;  1UNS A;  2O5J C;  1LTI D;  2NN6 H;  2VNU D;  4DGZ A;  5JVG 3;  2MP1 A;  1B4O A;  5T1G A;  1F2M A;  4DNR B;  1X3P A;  2NYZ D;  3ZYY X;  1EL0 A;  1Y8N B;  2FMM A;  3GP7 A;  2F0S A;  4KTA A;  3EA6 A;  4K14 A;  1F9P A;  2QKI C;  2B2V C;  2KHS A;  3T13 A;  1OXT A;  3S1Q B;  2F0D A;  1LAC A;  1M4V A;  2A6H D;  4A3G B;  3A56 A;  5CBE E;  3C1E A;  1PYW D;  5CV5 A;  2QDB A;  4ZKB B;  2KQ3 A;  4WJW A;  3OIP A;  2IT1 A;  3IFD A;  1AP0 A;  1I6V C;  2EYJ A;  1HUN A;  4ZQ3 A;  1UUP A;  4OL7 A;  5EBC A;  1EY6 A;  4CHT B;  4BY7 B;  5IIF A;  3HEJ A;  1Y8O B;  3UI2 A;  3DMU A;  3T4A C;  5ELD A;  4XQN A;  2ZT9 C;  3RLF A;  4H7B A;  1X32 A;  5C3E B;  3DWQ A;  1MSH A;  3D4D A;  4HR7 B;  1NUC A;  1E0B A;  3M4O B;  2EJG C;  3RZD B;  4DA2 A;  4KKS A;  5J39 A;  2K03 A;  1LLR D;  1EIG A;  4QUF A;  1E2Z A;  2Q8R E;  1G29 1;  3SXH A;  2LKV A;  3A7L A;  4XT3 B;  4Q0F A;  1CHQ D;  1GHJ A;  1JOK A;  1VDZ A;  4RGO S;  3WOE A;  3QWN A;  1D6E C;  2F0P A;  2YYZ A;  4HCS A;  5CV6 A;  5D3D A;  5CBA E;  5C6A A;  1L0X B;  5I4D A;  1LTA D;  2SDF A;  3FVQ A;  2JA8 B;  3M85 A;  1Z6H A;  4R8N A;  3MXU A;  2DNC A;  3PUW A;  3MZ5 A;  2YU9 B;  1SYB A;  2QIL A;  1Q90 A;  1CI3 M;  2NB0 A;  3I3C A;  1DON A;  1KDB A;  3PO2 B;  3HP3 A;  3GTM B;  4TSS A;  3P20 A;  1H9M A;  5JOB A;  1B9N A;  2IJ0 A;  4ULL A;  1EQT A;  2WV6 D;  2L4N A;  1TS3 A;  1O7Y A;  4UAI A;  1FNW A;  1EEI D;  1ESR A;  2ICI A;  3HG9 A;  3WDN A;  1A15 A;  3NWT A;  1D2B A;  3HS0 C;  5KYL A;  2N88 A;  3HKZ B;  2Z4H A;  3EJI A;  4S3S A;  3BDO A;  1E2W A;  1RCV D;  3KUP A;  1SNM A;  2B2W A;  5CMD A;  1HCZ A;  1OXX K;  1GUW A;  4IFD I;  2J7Z A;  2EPB A;  2BA0 A;  3R2I A;  2F3W A;  1B2T A;  1YNN D;  4XTC S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...