1WD1A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 5'-D(*CP*CP*TP*AP*CP*GP*TP*AP*GP*G)-3'
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd1A00
1NR2A 3DEPA 4ZK9B 1X3QA 3SVMA 2L1BA 3I90A 1SAPA 2FFKB 3QO2A 1RTOA 3G7LA 1HA6A 5EPJA 1ESRA 1SSOA 2RSOA 3Q6SA 1F9SA 2RA4A 3ONAB 4OIJA 4DN4M 1ZXTA 1XYIA 4X3KA 5EKIA 1CA6A 2KUMA 1ICWA 1NAPA 4RAUC 1HRJA 1RHPA 1U4RA 2MPMA 2BDNA 2X6LA 3FPUB 4O42A 2KECA 2HCIA 2KVMA 3I8ZA 4RWSC 2EE1A 5DNFA 4RA8A 5JJZA 2EPBA 2B2UC 3D6WA 5T1IA 4CJ2C 3KBXA 1DOKA 2KEDA 3HP3A 4UAIA 1MGSA 1PFBA 2HDLA 1X32A 4QUFA 4QUCA 1S4ZA 1HUMA 2DY7A 2HUGA 2MJ8A 3P7JA 4NW2A 2L11A 2VXWA 2CVRA 1J9OA 2B2WC 1U4MA 4HEDA 2B2YC 1F9RA 1WD1A 1HFGA 2K05A 2DY8A 2MGSA 2HCCA 2X6GA 1IKLA 1QE6A 5EPLA 4ZLTF 1WTQA 2B2TA 1BF4A 2N88A 4R9WA 1O7YA 1VMPA 3MWYW 4IUQA 1DOLA 1G91A 4XT1B 5AFWA 1WTXA 1NCVA 4CJ0B 5D14A 1VMCA 2J7ZA 4IUPA 1ILQA 2FINB 1B2TA 2D9UA 3DM1A 4MN3A 3LWEA 1KNEA 2K01A 2KOLA 2FMMA 1F9QA 2B2VC 4CJ1B 3KUPA 3MTSA 1WTVA 2NZ1D 5COYA 2KEEA 1QNKA 2L12A 4IURA 1Q3LA 3H91A 2JYOA 4HAEA 5CMDA 1BBXC 1ILPA 2MP1A 1RTNA 2NWGA 2R3ZA 1ML0D 2IL8A 1WTOA 1DZ1A 1AZPA 4XT3B 2L9HA 1F9PA 2XIWA 1EL0A 3IL8A 4OIKA 2K1BA 4IUUA 4MHEA 3IFDA 3GV3A 2K04A 4X3UA 5E4XA 1WVLA 4R8IA 2Q8RE 5T1GA 3I3CA 5CBAE 1WTRA 1MSGA 3TZDA 1IL8A 2B2UA 1LV9A 1U4PA 2RVLA 4HCSA 1B50A 1O7ZA 1MSHA 2RSNA 1A15A 3DEOA 1O80A 5E4WC 1EOTA 1MI2A 1IKMA 2K28A 1AP0A 1BO0A 1WTWA 1DONA 4X3TA 2B2WA 3F2UA 1JE4A 1PFNA 4IUVA 2B2YA 4U68A 5EPKA 1EQTA 2FHTA 3TN2A 1RJTA 2JP1A 1JICA 1WTPA 5CORA 4LMQD 1C8CA 1B53A 3I91A 1PDQA 1TVXA 1E0BA 1EIGA 1NR4A 4ZAIA 1AZQA 4X3SA 5EQ0A 1U4LA 1HHVA 4IUTA 2N55A 1QG7A 1G2TA 5D65A 2FJ2A 1XX8A 2NYZD 1RODA 2EOTA 1F2LA 2L4NA 3GV6A 1EIHA 1CA5A 1SDFA 3UI2A 5CBEE 5EJWA 1WD0A 1G2SA 2Q8TA 1DOMA 1PLFA 2B2TC 2B2VA 1G6ZA 1HFNA 2H1EA 4HSVA 2SDFA 3R93A 3N52A 1B4OA 4XDXA 1BNZA 1J8IA 3FDTA 1HUNA 4ZKCB 1CM9A 1M8AA 1X3PA 2HDMA 2K03A 1GUWA 2M2LA 1PFMA 2X69A 1B3AA 4ZKBB 1KNAA
chains in the Genus database with same CATH superfamily
4X62Q 1VDZA 4P71A 4F8MA 3CCJA 2ZXRA 3CCVA 1EFWA 1A3UA 1EWHA 4I7ZC 4LFCL 5IWAQ 2TMPA 3S2DH 3A5ZB 3S17B 5CV6A 2LMCB 3G6EA 2A5HA 3PGZA 5ISRA 2IPKD 5I9OA 1PFBA 2HDLA 1AFPA 1YJ9A 1X3GA 4XXEA 3M7NA 1JORA 5M5YH 2ZM6L 1G291 1V43A 2HCCA 4H44C 4DUZL 2JA5G 3EROA 1D2BA 3OOCA 1VMPA 4B3RQ 5DM73 1A62A 1DOLA 4RH6A 2E2HH 1E7ZA 3GTLB 1SMYC 3VYSA 1KNEA 4R4OA 3ULPA 2O4XA 4DR5Q 4X64L 3MAQA 4FO2A 2YU9H 2XRSD 5IT9L 3H15A 1CK1A 1AE3A 1TWHH 3VYUA 2IX0A 4RGOS 3MXNA 3V2TA 3BZKA 3SK5A 3GV3A 1EYDA 1EU3A 3I3CA 4IFDG 2JA8G 4G7ZC 2QA4A 4DV5Q 3V05A 1SNOA 4RGMA 1FNVA 4AYBB 3DEOA 3CKIB 4KV6A 4CDDC 4C1NI 2O5IC 1V1PB 3PUYA 3F2UA 4O0AA 3T4AC 5IODA 1E0BA 4JYAQ 2NN6I 1SE8A 2NYZD 1PFSA 3KF6A 3KJPA 2F0EA 1X9NA 2XTIA 3SE0A 4A3IB 3TP5A 5M3MB 2RDHA 3VA5A 5IY0A 3L0OA 2ZJRA 5CV9A 3QWNA 1HUNA 1UEBA 3M4OB 1MIUA 1PFMA 4N8X1 4C3IH 1NR2A 2HHHL 4PMBA 1D5MC 3MFYA 4C2MB 4JI7Q 1XYIA 5JJKA 1H9SA 3BYTB 2Z1CA 3A74A 4DA2A 1II3A 3D4WA 4P75A 3U50C 5K36H 1HNWQ 2EE1A 3RNUA 1WYDA 1VQ4A 2B63G 1ICFB 1HA5A 4XQJA 2HUGA 4GNXA 3P7JA 5IYBH 5C4JH 2EZVA 4IPHA 1PRTC 1DYQA 2SOBA 2KCTA 4HEDA 3PUVA 2J0TD 4DR3Q 1X3FA 2NVTB 2SEBD 4DF7A 3W2DA 4JI6L 4LF5Q 3H3VH 4A3BG 5CV4A 5IP9H 4JBJA 1JMCA 4R9WA 1SEBD 4ME5A 5C0XI 1CT1D 3QG1A 4B08A 4RHSA 2F3WA 4NPSA 5FLXE 5IP7H 3OW7A 2E74C 1GO3E 2YTYA 3OWFA 3PF5A 1WTVA 4K2LA 3MXPA 4PQXA 4ALPA 2KEEA 4OO1G 4POGA 5JJLA 2E5LQ 2NUCA 4CKBA 1L1OB 1OXVA 4JPBW 2UUCQ 3TMEA 2RBMA 3S15H 2F0IA 1DD2A 4TQUS 1LT3D 5JPNC 4A3JG 4DV4L 1I50B 3TDQA 1I4HA 3TZDA 4ODGA 1LV9A 4G7OC 5ELDA 3MA2B 4QF4A 5DAUA 1STEA 1LT4D 2PQAB 3QB3A 4GN5A 3SGIA 3FPPA 3QIAA 1WTWA 4DR1L 1PFNA 1JOQA 3S2HH 4DK3C 2RDGA 3PCOB 1ZEQX 1HZAA 4IJLA 1C8CA 1B53A 1PXUA 1EIGA 1PV4A 5EQ0A 3C1EA 2VUMH 5GROA 2JA7B 3F2BA 4BY1H 5D65A 4GOPB 1K28A 3GTJH 3A8KE 1FNUA 5IOCA 3J7AV 1B4OA 1FGUA 3KF8A 5M3FG 5ELBA 2Q2IA 5ELCA 1GOZA 3G4SA 3K57A 1PH7A 3K5MA 4GKKL 4LK1C 3G71A 4B3SL 1CTMA 1RTOA 1BOSA 1SNPA 1HTLD 1SSOA 1GKHA 4IPCA 2UUAL 4JC0A 2AMCB 2NVXH 1Y1VG 2MUYA 4LFBL 3CXCA 2KUMA 3OTOL 2MPMA 1BVSA 1TS3A 2OXPA 3UDGA 4K0KL 1WCMB 1VQCA 3AMUA 5JJZA 4KKSA 2F0PA 3CC2A 2Z4HA 4YHHL 2PPBC 2B2UC 3D6WA 5T1IA 3RZOB 2IJ0A 3PO3G 1B9MA 3PMFA 1I3QH 5M5XB 2R7FA 1SYCA 2WAQB 3TZUA 3C2PA 4A3GG 4DFAA 5EBCA 4DK0A 1D5ZC 2SNMA 4HIDA 4DUYL 3S14H 1F9RA 1YIJA 1HFGA 3JAMi 4HIOA 2X6GA 2MFIA 4HCEA 3V96A 3A8IE 4XYQA 3KDFA 1N34Q 1TWFH 1JWUD 3VR4A 2KCMA 2E2DC 5FLMG 1VQ7A 1NCVA 2SNSA 3A7AB 1YZ6A 4PNYA 3W1BA 4JI3L 1Q90A 1U5KA 4UPAA 3GTQB 1T5EA 1KAWA 3PIOA 1KIXA 1EQQA 1EEFD 3E0JA 4BY7H 3HOZG 2OWOA 1LTTD 1XPRA 4X66L 3ULLA 1A63A 5DM63 1KHIA 2QDBA 3R8BA 2MQHA 4RCOA 3HOUG 1MHWC 1XNRQ 1XWEA 1C7YA 2BH8A 4GLAC 3QOLA 1TT2A 1Q7YC 1VQOA 2HIVA 5C3EG 4R4TA 2ICEC 3BDOA 5JAVA 3J7ZC 2GVAA 1ENAA 4IPGA 5I2XA 1E2ZA 3CHBD 1I6HH 3AU7A 1LT5D 1O78A 5I6YA 3TREA 3PIPA 4DXFA 1YNJD 1OO9B 1QG7A 1IBKQ 1BCPB 4GZYC 1IYUA 3CCMA 3EJIA 5BN3A 2JN4A 4YCWA 1JR0D 2H1EA 3S1RH 4A3EH 1BNZA 4QQBX 1A0IA 1CM9A 1WJJA 2C9OA 5D3DA 2I07B 2F0DA 1R9TB 3NXWA 3F2CA 2UXBL 1PTOF 2FFKB 4RKBA 3G7LA 1LACA 1E3PA 4A3DG 1IXRA 2KHSA 3P20A 5FO9B 2F3VA 2Z6KA 5C6AA 5IGDA 2F0UA 2NN6G 3A54A 2F0GA 2WINB 2PQEA 1YJNA 1QILA 1PTOH 4QUFA 4KN4C 2C5CA 1CKOA 4TKOB 4NW2A 2CW0C 1XTCD 1M90C 4BBSB 4L5TA 1EY4A 3K58A 3R2TA 1Y8NB 1X3EA 5M9OA 1S72A 4OX9L 5LMUL 2F0NA 4PG3A 4XT1B 5AFWA 1L1OC 2F0SA 1Y1WG 5AJ3Q 1D6EC 1C48A 2R93B 3KUPA 3X3MA 4LF4L 3GTOH 4KKUA 3H91A 1I4QA 4P74A 4C3JB 3ICEA 4DR2Q 1ML0D 2E2JB 4HJ7A 4DV6L 1W6JA 1XMOL 3K80C 2JJQA 4A3KB 3GO5A 3SK6A 3I56A 3RR5A 5JJIA 3HOWG 4BBRG 3AFPA 2I5HA 5I6WA 3W1GA 1HZ9A 2A8VA 3HOXH 1Q8KA 4A75A 3IFTA 3DMUA 5CGKA 3A0JA 3H6MA 1VQHA 3K5OA 4RGNA 3C3LA 1QB5D 4JBKA 2B2WA 2WKDA 4GOPC 5C0XG 1ET6A 1YNND 1EQTA 3BZCA 3M7GA 4A93H 1N36Q 1HHVA 3S2DB 3I4NG 4ILWA 2EJGC 1B70B 2EOTA 4KHPL 2XGTA 2HD3A 3M4QA 1SDFA 3A5UA 4X65L 1Q1BA 3VYRA 3TBIB 1M1KC 4F7XA 3N52A 3BJUA 1Q81C 3SHLA 1PTOD 2QF7A 2KCNA 3K8AA 5J3BA 2X69A 4DAMA 2UU9Q 4L5SA 4LFAL 5M5YB 3D31A 1YJWA 3GTQH 1LTGD 2L1BA 4L8JA 2IX1A 1IHZA 1HPCA 1JC7A 4KN7C 3ONAB 1CA6A 4CDFC 4LFCQ 4K5VA 5FK9C 1DM0B 2E2HB 1RHPA 1EQRA 1U4RA 1IYJB 2BE5D 3K81C 3A8JE 2HCIA 2L55A 1PZID 1P16A 1CKNB 4NDXA 1HZCA 2G9DA 3HP3A 2YU9B 5CV8A 1QNUA 4FVMA 4KK7A 3URYA 4R4CA 2VQEL 1TWHB 3CQZH 4FF1A 2DY7A 1TS5A 4JV5L 2L11A 2B39A 5IGEA 1UE7A 4APVA 4DAYB 1K0RA 5JEAG 2ZM6Q 2JK8A 2K75A 1VS0A 2CKZB 4DR4Q 1E2WA 3NWTA 4DUZQ 1TWAH 1Z9FA 5GAHC 1HNZL 1WTQA 4UY8C 5I4DA 4LAAA 4R8NA 3I72A 3KFUA 1SLJA 5ELOA 2ZXOA 1RKNA 1VF7A 4JI5L 3KJOA 4UP9A 1SYEA 3NTHA 3UE1A 1BQQT 2FMMA 1IZ6A 2ICIA 2QCPX 4X64Q 1WTHA 1DCZA 1Q3LA 2RCFA 1CI3M 4EVOA 1K8AC 2JEBI 1HZBA 1PVOA 3K5LA 2QILA 4HSPA 5C4HA 5C44B 3IL8A 1R9TH 5CR3A 4IUUA 4AYBG 4N9PA 3QJYA 1X55A 2CH4W 4A3FG 5EGTA 5CBAE 1PZKD 2BCOA 1PH5A 5HGTA 1Q86C 2F03A 1MSHA 5LHY1 1S40A 4HMJA 4C3IB 5E4WC 1MI2A 1TY0A 1L0WA 1BCPC 1V8QA 1X65A 4C1NK 2D5DA 3NQTA 2B8GA 4A3IG 2K5WA 1N33Q 2F1MA 3OHXC 1K73C 1V1PA 5KRUA 1NSNS 3CCSA 2F0WA 4C3HH 4DV3L 1T5XD 4JI1L 3LX0A 4PMCA 1I94Q 2OCEA 4DNIA 2B2VA 5F2DA 5C4XG 3U4VA 2UXCL 3OW2A 3BS1A 3T13A 5C4JB 4DN4M 2HHHQ 2Y0SB 1VQFA 3U9SA 3CCQA 1RD9D 3N6RA 3NEMA 3DHQA 5M3FH 1S5DD 1ZXTA 2AQ2B 4X3KA 2QEXA 4A3KH 1FR3A 2NZHA 1PH4A 4WJWA 2ZTDA 2BDOA 4DR6L 4XIGS 2F0QA 1CSQA 4DV0Q 2KEDA 3A7LA 3TP6A 1Y8OB 2MJ8A 3GQBA 4H7BA 2DUDA 4DNRB 1JWSD 5D3IB 3S15B 1J9OA 1SJHD 1IBMQ 1WD1A 1QZGA 2UXDL 2XRQD 3J80c 2LXJA 4JI6Q 3T1HL 1NMGA 3NENA 1SFOB 3BVZA 2EY1A 4K6DA 2E2IH 2N3SA 3F1ZA 3ND8A 4OWTB 3KLRA 3LWUA 1QOHA 1MD2D 2EYLA 5FLXc 1MBYA 5A2QL 3S2HB 4O2DA 1PHJA 5HY6A 4OEMB 3CD6A 5FLMH 4EQOA 5CYUA 1VQDA 1ESFA 2K33A 2VUMB 4QIWB 5J1ZA 4BY1B 2A6HD 4IFDJ 4OIKA 3Q23A 3HOYH 2IW3A 1VQLA 2LSSA 3GTJB 4LNQA 4DV4Q 5E4XA 2Q8RE 4KY5A 3AYHB 3GTGH 3PO2G 3HOZH 2RVLA 1O7ZA 2OQ0A 1GXDC 2RSNA 1YHAA 3LGJA 5FJ8G 1G8ZD 4XQQA 4DV7Q 3CW2C 1XNQL 1SE2A 4DR1Q 1BKBA 1I6VC 2JA7G 2QKIC 2R92H 1JE4A 3FEWX 1YI2A 4CKCA 3KBGA 3I4MB 5IGCA 1BUVT 4BA2I 2NVXB 3QR8A 2Z4IA 1D7QA 1HNXL 1AZQA 3BDLA 4X3SA 4JI0Q 4GS3A 1YNXA 4JI8Q 4N9TA 3CMEA 1LTAD 4Q0FA 2KQ3A 2OQKA 2F0LA 3C1FA 1I3QB 4BXXG 3FDTA 2DNCA 3TP7A 1NUCA 4U673 4LJZC 4HJ5A 1DXMA 3S14B 1X56A 4GKKQ 1X3QA 4IO9A 1HCZA 4B3SQ 3I90A 3NUCA 1WCMG 2NVYH 5HGQA 2UUAQ 4PZ7A 1TWFB 1L2FA 3S9WA 4LFBQ 2Z9HA 4TRDA 2F4VQ 5C44H 3J81j 4K0KQ 5EBDA 2WAQG 4LF9Q 1O7LA 3M4PA 1GHKA 3JAME 4JOIC 4RA8A 1K83H 3HKZB 4BY7B 4B3TL 4OELB 1SXTA 1XJVA 5BR8L 4IOAA 2F0VA 3H0GB 3NBHB 4UP7A 5LMNL 3WDNA 1SE3A 3AB9A 1LLRD 3DWQA 4DUYQ 1BXTA 4J6HA 1SYFA 4FXDA 4R1JA 2PI2A 1IKLA 3MC0B 5IYCH 3U9OA 1UE1A 3BU2A 3K5NA 4IUNA 2NBFA 2K4KA 2E8GA 1O7IA 2K01A 4DR7L 3CC7A 2ZJPA 4A3CG 4FDBA 3GTMB 4JI3Q 4A3MG 1R4QB 2L12A 3CCLA 3LNNA 1I6HB 4GN3B 4A3LH 4X66Q 5GAEC 3J80E 2WB1B 1UE5A 2ALYB 3KLSA 1HQMC 3H3VI 2ID0A 4ZQ3A 1WTRA 2PZUA 4OL7A 2D2CC 3KYHC 3S1RB 2NVQB 4A3EB 1UNSA 1XMQL 1U4PA 1B50A 4CGYB 4HMIA 3FP9A 5KNCA 5FOBB 1OTCA 4NXML 1A15A 1E24A 1IKMA 1EOTA 1H95A 1VQEA 3HOWH 1KTKA 3MHBA 1QWYA 3EVQA 1STBA 2B2YA 4QMGA 2LY7A 1H9KA 2GA4B 2JA6H 1PDQA 1LTBD 1QCBD 3ND9A 4MIUA 3E0EA 5IWAL 2FJ2A 3HOVH 4I65A 2KBNA 4LUVA 1C9OA 4KD3A 2PYKA 1SFOH 1WI5A 1PTOB 1A8VA 3TQYA 3T16A 1JT8A 3KLWA 4ZKCB 3SEBA 3H3VC 4AYBE 1PH6A 1EZ8A 1PH3A 5GADC 1KNAA 2R7DA 3E5SA 1LM0A 4ZK9B 3QO2A 3K7AH 1KABA 3DXJC 2RA4A 5KNBA 2IHFA 4M8AA 3STBD 3TP8A 1GM5A 2YTVA 4WORA 1HQRD 2PZTA 1NTGA 4RWSC 3GTOB 2XWBB 4BBSG 1OXTA 1QJOA 4ID6A 2RF4A 3MXNB 4QUCA 5K5PA 1MJEA 1ZYRD 2K7VA 2H4OA 4OWWB 4RHRA 2NTTA 1JJCB 5C4ZA 4NXNL 3VR6A 3I4MH 2CFMA 1KRSA 3P75A 5EPLA 2R93G 3HOXB 2B2TA 3FKIG 4OX9Q 5LMUQ 4NKLA 4OXPA 2A74C 4C3JG 5IYDH 1P8LA 3DM1A 1DGSA 4XTCS 2CH4A 2UUBL 2VZAA 1QNKA 2JA8B 1EYAA 3Q24A 1QUQA 3HKSA 4A93B 3KF6B 5GQOA 4FF3A 2EYFA 4DV6Q 1DZ1A 4RFBA 1SE4A 1AZPA 1L0XB 4L5RC 4XT3B 2F0JA 4KY7A 2R7ZH 5LL6S 4JYAL 2IHEA 4EGVA 2D0OA 1V9PA 2EJFC 2WKCA 1STNA 4DV2Q 5M5WB 1VCIA 2EYOA 2F0TA 2RHSB 3JC66 3G48A 4POFA 3TRZA 3VYTA 4DGZA 1YNJC 2ASBA 2D62A 3T1YL 4A3FH 4DU9A 1H9SB 5EPKA 3TS2A 2QDLA 2ATWA 4LMQD 2WFWA 4JI7L 3H0GH 2C35B 2MHVA 1HJPA 3K59A 1TWCH 2F0FA 4AQYQ 1W2BA 3S1MH 4X65Q 4GNXB 4N8FA 3U4ZA 1R4PB 1S5BD 3CQZB 5ELEA 3FHWA 1IW7D 1M8AA 1QVCA 4LFAQ 1TKWB 3GTMH 4MNOA 3DEPA 3D4RA 2EIFA 3GTKH 1TWAB 4DR3L 1ESRA 5C4XH 3Q6SA 2K32A 3CPWA 1B7YB 3Q22A 2YYZA 1YHBA 3ITPA 3PUXA 4LF5L 3M3YB 1RDPD 4MTKA 4RAUC 4PV1C 4J15A 4BWGB 4O42A 1FGBD 1S5CD 2ENBA 3L9AX 4KJOA 1GUGA 2JEAI 3NSWA 1ASYA 2NVQH 4CJ2C 4A3BB 3U58A 1I4RA 4DKAC 3BVGA 1A6XA 3IKJA 4RKLA 2K6AA 3TEHB 5JVH3 2EXZA 2I0QA 2L0CA 4X6AH 2K52A 2K05A 1QVGA 2MGSA 1F2MA 2VB3X 1QE6A 3SK4A 1CUKA 1HNZQ 1YBYA 4DAYA 4TVAB 3I4OA 1O7YA 2WACA 1S3OA 1WTXA 1AH9A 4JI2L 3RZDH 2K5HA 3LWEA 2B8FA 3J81E 3T53B 5TSSA 1EIYB 5IE8A 4IURA 1K8MA 5FKAC 5CMDA 2G9HD 3D6CA 3H09A 4KMUC 4DV1L 1D1KA 1VQMA 2WAQE 2PI2E 4HJAA 1JOOA 2EJMA 2LS01 4ULLA 4JI4L 1I5FA 1SYGA 4C3HB 2OEOA 4DK6C 2HQLA 2MO0A 1EFID 4FXKC 4TSSA 2VQFQ 2WP8J 1YNNC 2AQ1B 5LMNW 4HCSA 1B1ZA 2BH2A 5C0XJ 3NHHA 3ULJA 3KK7A 4P72A 2JA5H 3PO2H 1GUTA 3S1NH 2ZJQA 5M3FB 5K36G 5CORA 1KAAA 4Y7NH 1YHQA 4IZ8A 1PTOC 4V190 1U4LA 2N55A 1G2TA 5NUCA 1K9MC 5IYBG 4KD4A 1FJGL 2WIIB 1NBWA 3EIVA 5CBEE 1D8LA 3UI2A 1W6KA 1FNWA 1F77A 2Y0SG 1HFNA 2CWAA 2UXCQ 1VQBA 2YTXA 5IP9G 3M4YA 5KNDA 3KDFB 4IFDH 3SVMA 2JA8H 5IP7G 2H5XA 1K3BC 4YY3L 2PNRC 4BXXH 3L2PA 1JQYD 3L3OC 1WOCA 2N49A 2L5TA 3CRLC 2CQOA 3BDCA 3G6JB 2E2IB 1IBLL 1NAPA 4JBMA 4PZ6A 4QJFA 2BDNA 2X6LA 3S1QB 4DR6Q 2I5LX 2GVBA 1Z7TA 1NMFA 5M5WH 3KBXA 1MGSA 1VF5C 4LF6Q 5JEAJ 1CZGA 1NE3A 5I2YA 2EQSA 3PSIA 4DAPA 3HOYB 4QB4A 3VR3A 4H0LC 3J7A5 5KYLA 3GTGB 2XWJB 3T1HQ 3HOZB 1LYLA 1QZHA 1PZJD 3PQIA 1YITA 3MWYW 3C46A 1XNRL 2PO4A 4YWKA 1B2TA 4S3SA 3SK8A 3VDYA 2RQXA 2V1CC 2VUMG 1OXUA 2K5QA 2AUKA 2OF1A 5G3LD 4BY1G 3J7YW 2R92B 1TR5A 4K5XA 1KXLA 1DJRD 2VW9A 3AQQA 1LTRD 3P1HA 4B3ML 5BN5A 4IN3A 1AN8A 1GJXA 1I4XA 4ME3A 1IBKL 1HR0L 2K04A 4E6IA 2B63H 4UDUC 3RLOA 2BOSA 4HIKA 3E6ZX 3M3YH 2B2UA 3D3RA 4KHZA 2A69D 1E1TA 2PNHA 4RG1A 4XQNA 5HURA 3OPOA 4A3BH 4K5WA 1E22A 2NVYB 5L37A 2JP1A 3Q0AA 4GNXC 1NY4A 5IGFA 1KLUD 1JB7A 3GP7A 4ZUIA 3CF5A 1KQSA 4OO1H 5C3WA 1RODA 1GUSA 1B9NA 3CCRA 3I7FA 1HH2P 1K83B 3H94A 1G2SA 2M9VA 3J80L 1STGA 2A68D 3VR5A 4HSVA 4XDXA 4A4IA 4PZ8A 2PMZE 1LT6D 3HGBA 2JA9A 3E9IA 4A3JH 2EVBA 2AQ3B 4IPDA 4ABNA 5FLXL 3Q8DA 4G4KA 1J5EL 3D4DA 4KLKA 3S16B 3CMAA 4H13C 4GKJL 5M3MG 2TSSA 3EFXD 2D0PA 3HKZG 3NQIA 4KY6A 1VQ9A 1PH2A 1TWGB 4BY7G 3FPUB 3NWSA 1KDBA 1TS4A 1EY8A 1YEZA 2GN5A 3NTIA 1DOKA 1VQJA 2DJFC 3JAMc 1CSPA 1LABA 4B3TQ 5BR8Q 1XXGA 2XVSA 5LMNQ 3CAMA 2QEJC 4QGUA 1Q82C 2EXDA 1QVFA 2OTJA 2DY8A 4H02A 4CKEA 2LXKA 4B9WA 4IALA 3BYYB 2OTLA 5D14A 2J7ZA 3X3NA 2HT1A 3HOWB 2A6HC 2AWOA 5KGUA 1GVPA 4CJ1B 4RMFA 4OWXB 1Y1VH 2WB1G 1EYCA 3FKIH 4HAEA 5A35A 2VB2X 2JA6B 4LF7L 3CP0A 1CKMA 4A3EG 1JB3A 1UE6A 3RLNA 2R61A 3HOVB 4MHEA 4KTAA 3PO3H 3IFDA 1VQKA 4JCVE 1S5ED 1STHA 2JE6I 4K8IA 1MSGA 1IL8A 1PYBA 4A3GH 4KKTA 1D1IA 3RN2A 4NXMQ 3I4NB 3MZ5A 3S1QH 2E75C 2Q8IB 1KD1C 2Q2TA 1LTID 2UU9L 2CWPA 2Q2HA 4YIJA 1X6OA 3K7AB 2I5MX 1PYWD 4NP5A 1TY2A 3F8TA 1A3TA 4OGQC 4AH6A 2PZWA 1CFMA 1UEAB 2DN8A 3GD7A 1L1OA 2L4NA 1EIHA 4WJ3M 3OYYA 4LWCA 1YVCA 1H9RA 2AHOB 1SROA 3T51B 5JPMC 1PA6A 1SNMA 2XNAC 1X54A 1MJCA 3HOUH 1SAPA 2A6ED 2PQAA 4DR4L 4OIJA 5C3EH 3E3XA 4K2KA 4FNFA 3I8ZA 1Z6HA 2Z8LA 3L7ZC 4UAIA 2DJGC 1I4GA 4GOPA 2L15A 1HUMA 2IWHA 2R7ZB 3HOXG 2K5DA 2Y0SE 1RL2A 3PUWA 3PF4A 4NXNQ 4YWMA 5EKKA 2EYPA 2EY5A 3I2ZA 3OTOQ 3NK9A 4IOCA 1A3VA 1K0SA 3KLSX 4A93G 1AEXA 3QOJA 1VMCA 4CJ0B 2BA1A 2KA7A 2FINB 3UE0A 4DPGA 1VQ8A 4YHHQ 1UUPA 4A3FB 1N32L 2UUBQ 2DNEA 4A3DH 5COYA 2LFNA 4O1NA 3J7AF 1PRTF 5KIXA 2R3ZA 1SMYD 1N33L 2EY6A 2XIWA 1F9PA 4EX5A 4OONA 1TWCB 3TS0A 4HN7A 2NN6H 1W3SA 3MXUA 1Z47A 3HZXA 3S1MB 4WRDA 1WVLA 3CC4A 3S16H 5T1GA 4LF8L 1I94L 1GHJA 1FD7D 1JJ2A 1N9WA 2CQAA 2Z6KC 1TWGH 3R3OA 3RN5A 3T1YQ 3DWPA 3GTKB 2O2LD 3D8GA 5C4XB 4HJ8A 2F0KA 2NB0A 5IIFA 3J81L 3I91A 1Y1WH 4GLXA 2VS1A 4QIWE 5IGBA 1EY6A 1ONLA 1H9JA 1Q1EA 2VNUD 3NELA 1KDCA 1U0LA 1CA5A 3W5OA 4DV0L 5IT9c 2R6GA 2HDMA 2K03A 1T9HA 4YWLA 1HR0W 3STBC 4BBRH 1LTSD 3NP8A 5KEEA 4X62L 1EWIA 3CU7A 4ZRZA 1IBML 1CZWA 3PIO3 3GTPH 1HA6A 1I4PA 3A55A 2V4DA 3EA6A 1ICWA 4IJHA 1K3RA 3K0XA 4EQPA 1ZYRC 3RZDB 1H9MA 5C0XH 4FYDA 1EOVA 2KVMA 1TQOA 1G51A 2MNAA 4LUZA 2ZTEA 3I4NH 4QCLA 1C0AA 2KHIA 2N78A 4EQNA 1OXXK 2CVRA 1XPUA 2B2WC 1PYSB 2UXBQ 2OT2A 4GN4B 4K8JA 5E3FA 1XPOA 1FL0A 4ZLTF 4F88A 2QW7A 1J6QA 2N88A 2VL6A 5FO7B 3PIP3 2G5DA 4IUQA 1F2ZA 5JOBA 4B3RL 2EDGA 4JI2Q 3OMGA 1PRTD 1D5XC 4IUPA 2ZT9C 2D9UA 4YCUA 3B6YA 3HRZC 3S17H 3VR2A 2JA5B 4RGTA 5I9PA 4DV7L 3PO2B 2NZ1D 3PUZA 2F4IA 3HKZE 4C3HG 4DR5L 3S1NB 1SBBB 3DUZA 3J81c 4DV1Q 1BBXC 1ILPA 4V0BA 4NB3A 4I7AA 2MP1A 5IGGA 1SYDA 1RTNA 3BZDB 4Y7NB 4L63B 1SJED 4JI4Q 2JXMB 2K1BA 4WFN3 4JI0L 1MKHA 3O13A 1V1OA 2AUJD 4JI8L 4CDEC 4FP5D 2HIXA 4DV5L 1STYA 5JEAH 1Y8PB 2B29A 3GTLH 1N8RC 4A3KG 4LF4Q 2K28A 1RIPA 1AP0A 3WWVA 2F0OA 2DGYA 2Z6BA 3M85A 2FHTA 4JK1C 1JICA 1WTPA 1XMOQ 1JE5A 2Q2UA 5GAGC 1TVXA 4QL5A 1NR4A 1IW7C 3W3AA 2CCZA 1B3QA 2F4VL 1SNQA 2WB1E 1XX8A 3MEFA 5A2QE 3GV6A 1FJGQ 3D0FA 1TIID 4LF9L 2JQOA 1DOMA 4BA1I 1LTLA 1OXSC 1X3PA 1HXYD 1NNXA 3NTKA 2M2LA 2RHQB 3EQLC 3SXHA 4CDCC 4ZKBB 1EY0A 2F3IA 2ZTCA 2NZOA 1B8AA 4YY3Q 1EQVA 1VQAA 1F9SA 4UHVA 3RLFA 1VQPA 1M4VA 2XSCA 1IBLQ 5ELNA 3ER0A 1HRJA 3RUZA 1ZKOA 1SRUA 4P2CB 4KHPQ 1IYVA 1BR9A 2KECA 1E2VA 3FVQA 5IT9E 5DEHA 1HNWL 4GLVB 4A3IH 1EY9A 3HOYG 5M3MH 4PMWA 2EY2A 5DLQE 1IL2A 1L0YB 3OIPA 3OSOA 3M4OH 2EYHA 2EYMA 3VA7A 1PH1A 4R4QA 4WJ4A 3A56A 4A3MB 2B63B 1ENCA 4C2MH 2A1AA 5EKLA 1BF4A 2R92G 1AE2A 2K5NA 5KYIA 4HIMA 4B9XA 1ILQA 4MN3A 2KOLA 3J80i 1F9QA 2B2VC 3MVVA 1EYGA 2AKWB 2VQEQ 2JYOA 2E5LL 4DK1A 1SNDA 4JV5Q 1CKNA 1EY5A 5CV7A 2L9HA 2UUCL 4B3MQ 1TS2A 1EL0A 5E1FA 1PH9A 4HTHA 1HR0Q 4F87A 2NVTH 1GD7A 3UDFA 4QY7A 3WOEA 4JOIA 4KI0A 2NTSA 3M9BA 2IY5B 4JI5Q 3HEJA 2O5JC 5JVG3 1BBWA 1RCVD 4A3JB 3NE5B 1O80A 1TXYA 5C5LA 3IAYA 1SN8A 5C44G 1VQGA 3TSSA 4HR7B 1EEID 4U68A 3CPFA 3RMHA 1RJTA 5J39A 1BBUA 4JVZA 5G3LF 2N8NA 1JCKB 4ZAIA 1JWMD 3ERQA 3KF8B 4K14A 1WFQA 2F0MA 4C3IG 2F52A 2Q8TA 1I50H 2XN9C 1HTPA 1PLFA 1G6ZA 3FMCA 2FXQA 3R93A 1FVIA 1LUZA 1EY7A 2AWNA 5FO8B 5H1SE 3R2IA 5IYCG 5C5MA 3SR1A 3I4LA 1KC8C 2CHBD 5C3XA 1VQ5A 3I70A 4DNTB 1JOKA 3EBEA 1J5EQ 2RSOA 4GKJQ 4KJNA 4M1UB 3UDIA 4UP8A 4A76A 5EKIA 5FJ8H 4FF4A 3DM3A 4ZYSA 4DV3Q 1Q46A 2JA7H 4R4IA 2YV5A 4KHVA 1QUQB 4JI1Q 4A3LG 1EUJA 1EZ6A 1CQFA 1ASZA 2EPBA 3CRKC 1Y1VB 2PW7A 1UAPA 3FKIB 4DAVA 4MZ9A 3BVMA 1CQVA 1VQNA 1F2YA 1S4ZA 1LO5D 3I73A 2J4XA 2FMCA 2BE5C 4IFDI 3IRBA 5EAYA 3PO3B 3BG3A 1PMRA 3S24A 4DV2L 4A3GB 1N34L 3UDXA 2IX3A 4BS9A 2CW0D 5ELFA 4JW0A 4XYOA 1G91A 1CHPD 2PMZB 5CV5A 2JA6G 1A2UA 1WCMH 1ET9A 3ZJYC 5J22A 3MEHA 4MTNA 3MTSA 3RZOH 3HOVG 1E1OA 3RD4A 1WTOA 4LF7Q 5M5XH 2A69C 3EN2A 2WV6D 2I46A 3NBIA 1XTDA 2K14A 2UXDQ 1ENFA 3K7UC 4R8IA 4AQYL 1KL9A 2HQEA 2KHJA 5E7NA 3OIQA 3WOFA 1DONA 3CCUA 3HOUB 2KENA 1BDOA 2RCNA 3HS0C 3JAML 2M00A 2VY3A 2BA0A 4J8QA 2A68C 5C3EB 1EU4A 1RF2D 2E76C 1SR3A 2Z0SA 4LW1A 4A3CH 2F0HA 4ZUJA 3K0YA 3ZYYX 3MXGA 3DWAA 1F2LA 4A3MH 1C4QA 4JG2A 1WD0A 1KLGD 3KOJA 5BN4A 3ERSX 2SDFA 3I4MG 1K8GA 3HFZB 1BCPF 4Z9CB 1EWCA 3GDEA 4FXGC 1XNQQ 1EIFA 5IYDG 1VQ6A 4LUOA 1SYBA 1CHQD 1NJIC 1PH8A 5EPJA 3SDZA 4CHTB 1HNXQ 2EYJA 2K50A 4RCNA 2KCCA 1SNCA 1FYCA 1K8OA 4OO1I 4P73A 3F2DA 2R7ZG 5DNFA 1V1QA 4A3DB 1AW7A 2PCFB 4AIMA 3K6OA 1GUNA 3HG9A 3T56B 1X32A 2PW5A 4EQ5A 2MO1A 3MFGA 4IQZA 4FF2A 1Q12A 1U9RA 4L6TB 4ZCKA 2VXWA 1S5FD 1U4MA 3AFQA 4K6LA 2B2YC 3AEVA 1SMXA 2IT1A 2RDFA 3J81i 1GUOA 2VQFL 1JJGA 1Y14B 1VQIA 1PRTB 3FRPB 2JSOA 4J1MA 5CC4A 5AJ3L 3H0GG 1N32Q 1Y69U 2ZXPA 4NMZA 3DLLA 4G7HC 2NWGA 4DR2L 2IL8A 1Y1WB 2A73B 4C56C 4DXGA 2KJXA 4BBSH 4G57A 3I55A 1STAA 2A19A 4X3UA 4L5QA 4Q5VA 4LF8Q 3NBHA 2ES2A 4OHJA 4Y52H 4BBRB 4DR7Q 2RKSA 4YCVA 1BO0A 3CCEA 4X3TA 2R93H 1A2TA 3GTPB 4IUVA 4JBWA 3TN2A 5LL6X 3OMCA 1B44D 1TU2B 4C3JH 1Q8IA 1N36L 2E2JH 3NPPA 2LKVA 4IUTA 2K5VA 3PV0A 1KDAA 4HJ9A 1BCPD 3OWEB 2B3GA 5EJWA 2B2TC 1UWVA 2A6EC 1XMQQ 2QGQA 3E9HA 1J8IA 1G6PA 2P5ZX 4CBVA 4LF6L 1GUWA 1KRTA 1B3AA
chains in the Genus database with same CATH topology
1VDZA 4F8MA 2ZXRA 1A3UA 1EWHA 4I7ZC 2TMPA 3S17B 5CV6A 2LMCB 2A5HA 5ISRA 2IPKD 5I9OA 1PFBA 2HDLA 1AFPA 4XXEA 3M7NA 1JORA 1G291 1V43A 2HCCA 4H44C 3EROA 1D2BA 3OOCA 1VMPA 5DM73 1DOLA 4RH6A 3GTLB 1SMYC 3VYSA 1KNEA 2O4XA 3MAQA 4FO2A 2XRSD 5IT9L 1CK1A 3VYUA 2IX0A 4RGOS 3MXNA 3V2TA 3SK5A 3GV3A 1EYDA 1EU3A 3I3CA 4IFDG 4G7ZC 3V05A 1SNOA 4RGMA 1FNVA 4AYBB 3DEOA 3CKIB 4KV6A 4C1NI 2O5IC 1V1PB 3PUYA 3F2UA 3T4AC 5IODA 1E0BA 2NN6I 2NYZD 2F0EA 3SE0A 4A3IB 3TP5A 5M3MB 2RDHA 3VA5A 5CV9A 3QWNA 1HUNA 3M4OB 1PFMA 1NR2A 4PMBA 1D5MC 3MFYA 4C2MB 1XYIA 1H9SA 3BYTB 2Z1CA 4DA2A 1II3A 3D4WA 5K36H 2EE1A 1HA5A 4XQJA 2HUGA 3P7JA 2EZVA 1PRTC 1DYQA 2SOBA 4HEDA 3PUVA 2J0TD 2NVTB 2SEBD 4DF7A 3W2DA 5CV4A 4R9WA 1SEBD 4ME5A 5C0XI 1CT1D 3QG1A 4B08A 5FLXE 2F3WA 4RHSA 3OW7A 2E74C 3OWFA 1WTVA 4K2LA 3MXPA 4PQXA 4OO1G 2KEEA 2NUCA 4CKBA 1OXVA 3TMEA 2RBMA 2F0IA 1DD2A 4TQUS 1LT3D 5JPNC 1I50B 3TDQA 3TZDA 1I4HA 4ODGA 1LV9A 4G7OC 5ELDA 3MA2B 4QF4A 5DAUA 1STEA 1LT4D 3QB3A 3FPPA 3QIAA 1WTWA 1PFNA 1JOQA 2RDGA 1ZEQX 1C8CA 1B53A 1PXUA 1EIGA 5EQ0A 3C1EA 2JA7B 5D65A 3A8KE 1FNUA 5IOCA 3J7AV 1B4OA 3KF8A 5ELBA 5ELCA 1GOZA 3K57A 3K5MA 4LK1C 1CTMA 1RTOA 1BOSA 1SNPA 1HTLD 1SSOA 2MUYA 2KUMA 2MPMA 1TS3A 2OXPA 1WCMB 3AMUA 5JJZA 4KKSA 2F0PA 2Z4HA 2PPBC 2B2UC 3D6WA 5T1IA 3RZOB 2IJ0A 1B9MA 3PMFA 5M5XB 1SYCA 2WAQB 3TZUA 3C2PA 4DFAA 5EBCA 4DK0A 1D5ZC 2SNMA 1F9RA 1HFGA 2X6GA 4HCEA 3V96A 3A8IE 4XYQA 1JWUD 3VR4A 2E2DC 1NCVA 2SNSA 3A7AB 4PNYA 1Q90A 3GTQB 1T5EA 1EEFD 3E0JA 1LTTD 5DM63 2QDBA 3R8BA 4RCOA 1XWEA 3QOLA 1TT2A 2ICEC 3BDOA 5JAVA 1ENAA 5I2XA 1E2ZA 3CHBD 3AU7A 1LT5D 5I6YA 1O78A 4DXFA 1YNJD 1OO9B 1QG7A 1BCPB 4GZYC 1IYUA 3EJIA 5BN3A 1JR0D 2H1EA 1BNZA 1CM9A 2C9OA 5D3DA 2I07B 2F0DA 1R9TB 3NXWA 1PTOF 2FFKB 4RKBA 3G7LA 1LACA 2KHSA 3P20A 5FO9B 2F3VA 5IGDA 5C6AA 2F0UA 2NN6G 3A54A 2F0GA 2WINB 2PQEA 1QILA 1PTOH 4QUFA 4KN4C 2C5CA 4TKOB 4NW2A 2CW0C 1XTCD 4BBSB 1EY4A 3K58A 3R2TA 1Y8NB 5M9OA 2F0NA 4XT1B 5AFWA 2F0SA 1D6EC 1C48A 2R93B 3KUPA 3X3MA 4KKUA 3H91A 1I4QA 4C3JB 1ML0D 2E2JB 1W6JA 4A3KB 3GO5A 3SK6A 5I6WA 3IFTA 3DMUA 5CGKA 3H6MA 3K5OA 4RGNA 3C3LA 1QB5D 2B2WA 2WKDA 5C0XG 1ET6A 1YNND 1EQTA 3M7GA 1HHVA 3S2DB 4ILWA 2EJGC 2EOTA 1SDFA 1Q1BA 3VYRA 3TBIB 4F7XA 3N52A 3SHLA 1PTOD 2QF7A 2KCNA 2X69A 5M5YB 3D31A 1LTGD 2L1BA 4L8JA 2IX1A 1IHZA 1HPCA 1JC7A 4KN7C 3ONAB 1CA6A 4K5VA 5FK9C 1DM0B 2E2HB 1RHPA 1U4RA 2BE5D 3A8JE 2HCIA 2L55A 1PZID 4NDXA 2G9DA 3HP3A 2YU9B 5CV8A 1QNUA 4FVMA 4KK7A 3URYA 1TWHB 4FF1A 2DY7A 1TS5A 2L11A 2B39A 5IGEA 5JEAG 1E2WA 3NWTA 1WTQA 5I4DA 4LAAA 4R8NA 3I72A 2ZXOA 1RKNA 1VF7A 1SYEA 3NTHA 1BQQT 2FMMA 2ICIA 2QCPX 1DCZA 1Q3LA 4EVOA 1CI3M 2JEBI 3K5LA 2QILA 4HSPA 5C4HA 5C44B 3IL8A 5CR3A 4IUUA 4N9PA 3QJYA 5EGTA 5CBAE 1PZKD 2BCOA 5HGTA 2F03A 1MSHA 5LHY1 4HMJA 4C3IB 5E4WC 1MI2A 1TY0A 1BCPC 1V8QA 4C1NK 2D5DA 3NQTA 2B8GA 2K5WA 2F1MA 3OHXC 1V1PA 5KRUA 1NSNS 2F0WA 1T5XD 3LX0A 4PMCA 2B2VA 5F2DA 3BS1A 3T13A 5C4JB 4DN4M 2Y0SB 3U9SA 1RD9D 3N6RA 3DHQA 1S5DD 1ZXTA 2AQ2B 4X3KA 1FR3A 4WJWA 2BDOA 4XIGS 2F0QA 2KEDA 3A7LA 3TP6A 1Y8OB 2MJ8A 3GQBA 4H7BA 4DNRB 1JWSD 5D3IB 3S15B 1J9OA 1SJHD 1WD1A 2XRQD 1SFOB 3BVZA 2EY1A 4K6DA 3ND8A 3KLRA 3LWUA 1QOHA 1MD2D 2EYLA 1MBYA 5A2QL 3S2HB 4EQOA 5CYUA 1ESFA 2K33A 2VUMB 4QIWB 5J1ZA 4BY1B 2A6HD 4IFDJ 4OIKA 3Q23A 2IW3A 3GTJB 5E4XA 2Q8RE 4KY5A 2RVLA 1O7ZA 1GXDC 2RSNA 1G8ZD 4XQQA 1SE2A 1I6VC 2QKIC 1JE4A 3FEWX 4CKCA 3KBGA 3I4MB 5IGCA 1BUVT 4BA2I 2NVXB 2Z4IA 1AZQA 3BDLA 4X3SA 4N9TA 1LTAD 4Q0FA 2KQ3A 2F0LA 3C1FA 1I3QB 3FDTA 2DNCA 3TP7A 1NUCA 4U673 4LJZC 1DXMA 3S14B 1X3QA 1HCZA 3I90A 3NUCA 1TWFB 3S9WA 4TRDA 5EBDA 1O7LA 1GHKA 3JAME 4RA8A 3HKZB 4BY7B 1SXTA 2F0VA 3H0GB 3WDNA 1SE3A 3AB9A 1LLRD 3DWQA 1BXTA 4J6HA 1SYFA 4FXDA 1IKLA 3MC0B 3U9OA 3K5NA 4IUNA 2NBFA 2K01A 3GTMB 1R4QB 2L12A 3LNNA 1I6HB 3J80E 2WB1B 3KLSA 1HQMC 2ID0A 4ZQ3A 1WTRA 2PZUA 4OL7A 2D2CC 3S1RB 2NVQB 4A3EB 1UNSA 1B50A 1U4PA 4CGYB 4HMIA 5KNCA 5FOBB 1A15A 1IKMA 1EOTA 1KTKA 3MHBA 1QWYA 3EVQA 1STBA 2B2YA 4QMGA 2LY7A 1H9KA 2GA4B 1PDQA 1LTBD 1QCBD 3ND9A 4MIUA 2FJ2A 4I65A 4KD3A 2PYKA 1PTOB 3T16A 4ZKCB 3SEBA 3H3VC 1EZ8A 1KNAA 3E5SA 4ZK9B 3QO2A 1KABA 3DXJC 2RA4A 5KNBA 4M8AA 3TP8A 4WORA 1HQRD 2PZTA 4RWSC 3GTOB 2XWBB 1OXTA 1QJOA 4ID6A 4QUCA 5K5PA 1ZYRD 2K7VA 2H4OA 4RHRA 2NTTA 5C4ZA 3VR6A 3P75A 5EPLA 3HOXB 2B2TA 4NKLA 2A74C 4C3JG 3DM1A 4XTCS 1QNKA 2JA8B 1EYAA 3Q24A 4A93B 4FF3A 2EYFA 1DZ1A 4RFBA 1SE4A 1AZPA 1L0XB 4XT3B 2F0JA 4KY7A 5LL6S 4EGVA 2EJFC 2WKCA 1STNA 5M5WB 1VCIA 2EYOA 2F0TA 3VYTA 4DGZA 1YNJC 2D62A 4DU9A 1H9SB 5EPKA 4LMQD 2MHVA 3K59A 2F0FA 1R4PB 1S5BD 3CQZB 5ELEA 1IW7D 1M8AA 1TKWB 3DEPA 3D4RA 1TWAB 1ESRA 3Q6SA 2K32A 3Q22A 2YYZA 3ITPA 3PUXA 3M3YB 1RDPD 4RAUC 4PV1C 4BWGB 4O42A 1FGBD 1S5CD 2ENBA 3L9AX 4KJOA 1GUGA 2JEAI 3NSWA 4CJ2C 4A3BB 1I4RA 3BVGA 1A6XA 3IKJA 4RKLA 2K6AA 5JVH3 2EXZA 2L0CA 2K05A 2MGSA 1F2MA 2VB3X 1QE6A 3SK4A 4DAYA 1O7YA 2WACA 1WTXA 3LWEA 2B8FA 3J81E 3T53B 5TSSA 4IURA 1K8MA 5FKAC 5CMDA 2G9HD 3D6CA 3H09A 4KMUC 1D1KA 1JOOA 2EJMA 2LS01 4ULLA 1SYGA 4C3HB 2OEOA 1EFID 4FXKC 4TSSA 2WP8J 1YNNC 2AQ1B 4HCSA 1B1ZA 5C0XJ 3NHHA 3KK7A 1GUTA 5M3FB 5K36G 5CORA 1KAAA 4IZ8A 1PTOC 4V190 1U4LA 2N55A 1G2TA 5NUCA 4KD4A 2WIIB 5CBEE 3UI2A 1W6KA 1FNWA 1F77A 1HFNA 3M4YA 5KNDA 4IFDH 3SVMA 2PNRC 1JQYD 3L3OC 3CRLC 2L5TA 3G6JB 3BDCA 2E2IB 1NAPA 2BDNA 2X6LA 3S1QB 1Z7TA 3KBXA 1MGSA 1VF5C 5JEAJ 1CZGA 5I2YA 4DAPA 3HOYB 4QB4A 3VR3A 4H0LC 5KYLA 3GTGB 2XWJB 3HOZB 1PZJD 3MWYW 3C46A 2PO4A 1B2TA 4S3SA 3SK8A 2RQXA 1OXUA 2K5QA 2AUKA 2OF1A 5G3LD 3J7YW 2R92B 1TR5A 4K5XA 1DJRD 1LTRD 3P1HA 5BN5A 4IN3A 1AN8A 1GJXA 1I4XA 2K04A 4E6IA 4UDUC 2BOSA 3E6ZX 2B2UA 3D3RA 4KHZA 2A69D 4XQNA 5HURA 3OPOA 4K5WA 2NVYB 2JP1A 3Q0AA 5IGFA 1KLUD 3GP7A 4ZUIA 4OO1H 5C3WA 1RODA 1GUSA 1B9NA 1K83B 3H94A 1G2SA 2M9VA 3J80L 1STGA 2A68D 3VR5A 4HSVA 4XDXA 1LT6D 3HGBA 2EVBA 2AQ3B 4ABNA 5FLXL 4G4KA 3D4DA 3S16B 4H13C 2TSSA 3EFXD 3NQIA 4KY6A 1TWGB 3FPUB 3NWSA 1KDBA 1TS4A 1EY8A 3NTIA 1DOKA 1LABA 1XXGA 2XVSA 2QEJC 2DY8A 4CKEA 4B9WA 4IALA 3BYYB 5D14A 2J7ZA 3X3NA 3HOWB 2A6HC 2AWOA 5KGUA 4CJ1B 1EYCA 4HAEA 5A35A 2VB2X 2JA6B 1JB3A 2R61A 3HOVB 4MHEA 4KTAA 3IFDA 1S5ED 1STHA 2JE6I 4K8IA 1MSGA 1IL8A 4KKTA 1D1IA 3I4NB 3MZ5A 2E75C 2Q8IB 1LTID 4YIJA 3K7AB 1PYWD 4NP5A 1TY2A 1A3TA 4OGQC 2PZWA 1CFMA 1UEAB 2DN8A 3GD7A 2L4NA 1EIHA 1H9RA 3T51B 5JPMC 1SNMA 2XNAC 1SAPA 2A6ED 4OIJA 4K2KA 4FNFA 3I8ZA 1Z6HA 2Z8LA 4UAIA 3L7ZC 1I4GA 1HUMA 2IWHA 2R7ZB 2K5DA 3PUWA 5EKKA 2EYPA 2EY5A 3NK9A 1A3VA 3KLSX 4CJ0B 1AEXA 3QOJA 1VMCA 2BA1A 2KA7A 2FINB 1UUPA 4A3FB 2DNEA 5COYA 2LFNA 4O1NA 3J7AF 1PRTF 5KIXA 2R3ZA 1SMYD 2EY6A 2XIWA 1F9PA 1TWCB 4HN7A 2NN6H 3MXUA 1Z47A 3HZXA 3S1MB 4WRDA 1WVLA 5T1GA 1GHJA 1FD7D 2CQAA 3R3OA 3DWPA 3GTKB 2O2LD 3D8GA 5C4XB 2F0KA 2NB0A 5IIFA 3J81L 3I91A 5IGBA 1EY6A 1ONLA 1H9JA 1Q1EA 2VNUD 1KDCA 1CA5A 2R6GA 2HDMA 2K03A 1LTSD 3NP8A 5KEEA 3CU7A 4ZRZA 1CZWA 3PIO3 1HA6A 1I4PA 3A55A 2V4DA 3EA6A 1ICWA 4EQPA 3RZDB 1ZYRC 1H9MA 5C0XH 4FYDA 2KVMA 1TQOA 4QCLA 4EQNA 1OXXK 2CVRA 2B2WC 2OT2A 4K8JA 5E3FA 4ZLTF 4F88A 2N88A 5FO7B 3PIP3 4IUQA 1F2ZA 5JOBA 2EDGA 3OMGA 1PRTD 1D5XC 4IUPA 2ZT9C 2D9UA 3HRZC 3VR2A 2JA5B 4RGTA 5I9PA 3PO2B 2NZ1D 3PUZA 2F4IA 3S1NB 4C3HG 1SBBB 3DUZA 1BBXC 1ILPA 4V0BA 2MP1A 5IGGA 1SYDA 1RTNA 3BZDB 4Y7NB 4L63B 1SJED 2JXMB 2K1BA 4WFN3 3O13A 1V1OA 2AUJD 4FP5D 1STYA 5JEAH 1Y8PB 2K28A 1AP0A 2F0OA 3M85A 2FHTA 4JK1C 1JICA 1WTPA 1TVXA 1NR4A 1IW7C 3W3AA 1SNQA 1XX8A 5A2QE 3GV6A 1TIID 1DOMA 4BA1I 1OXSC 1X3PA 1HXYD 3NTKA 2M2LA 3EQLC 4ZKBB 3SXHA 1EY0A 1EQVA 1F9SA 3RLFA 1M4VA 2XSCA 1HRJA 3RUZA 1ZKOA 4P2CB 1IYVA 1BR9A 2KECA 1E2VA 3FVQA 5IT9E 5DEHA 1EY9A 4PMWA 2EY2A 1L0YB 3OIPA 3OSOA 2EYHA 2EYMA 3VA7A 3A56A 4A3MB 2B63B 1ENCA 5EKLA 1BF4A 5KYIA 4B9XA 1ILQA 4MN3A 2KOLA 1F9QA 2B2VC 3MVVA 2JYOA 4DK1A 1SNDA 1EY5A 5CV7A 2L9HA 1EL0A 1TS2A 5E1FA 4HTHA 4F87A 3WOEA 4KI0A 2NTSA 3HEJA 2O5JC 5JVG3 1RCVD 4A3JB 3NE5B 1O80A 5C5LA 3IAYA 3TSSA 4HR7B 1EEID 4U68A 3RMHA 1RJTA 5J39A 5G3LF 1JCKB 4ZAIA 1JWMD 3ERQA 4K14A 2F0MA 4C3IG 2Q8TA 2XN9C 1HTPA 1PLFA 1G6ZA 3FMCA 3R93A 1EY7A 2AWNA 5FO8B 3R2IA 5C5MA 3SR1A 3I4LA 2CHBD 5C3XA 3I70A 4DNTB 1JOKA 2RSOA 4KJNA 4M1UB 5EKIA 4FF4A 4ZYSA 4KHVA 1EZ6A 1CQFA 2EPBA 3CRKC 1Y1VB 2PW7A 1UAPA 3FKIB 4DAVA 3BVMA 1CQVA 1F2YA 1S4ZA 1LO5D 3I73A 2J4XA 2FMCA 2BE5C 4IFDI 3PO3B 3BG3A 1PMRA 4A3GB 2IX3A 4BS9A 2CW0D 5ELFA 4XYOA 1G91A 1CHPD 2PMZB 5CV5A 1A2UA 1ET9A 5J22A 3MEHA 3MTSA 3RD4A 1WTOA 2A69C 2WV6D 2I46A 3NBIA 1ENFA 4R8IA 2HQEA 3OIQA 3WOFA 1DONA 3HOUB 1BDOA 3HS0C 3JAML 2M00A 2BA0A 4J8QA 2A68C 5C3EB 1EU4A 1RF2D 2E76C 2F0HA 4ZUJA 3K0YA 3ZYYX 3MXGA 3DWAA 1F2LA 1C4QA 1WD0A 1KLGD 5BN4A 2SDFA 1BCPF 4Z9CB 1EWCA 4FXGC 1SYBA 1CHQD 5EPJA 3SDZA 4CHTB 2EYJA 4RCNA 2KCCA 1SNCA 1FYCA 1K8OA 4OO1I 5DNFA 4A3DB 1AW7A 2PCFB 3K6OA 1GUNA 3HG9A 3T56B 1X32A 2PW5A 3MFGA 4IQZA 4FF2A 1Q12A 1U9RA 4L6TB 2VXWA 1S5FD 1U4MA 4K6LA 2B2YC 2IT1A 2RDFA 1GUOA 1PRTB 3FRPB 2JSOA 4J1MA 5CC4A 1Y69U 2ZXPA 4NMZA 4G7HC 2NWGA 2IL8A 1Y1WB 2A73B 4C56C 4DXGA 2KJXA 4G57A 1STAA 4X3UA 4Q5VA 3NBHA 4OHJA 4BBRB 2RKSA 1BO0A 4X3TA 1A2TA 3GTPB 4IUVA 4JBWA 3TN2A 5LL6X 3OMCA 1B44D 1TU2B 1Q8IA 3NPPA 2LKVA 4IUTA 3PV0A 1KDAA 1BCPD 3OWEB 5EJWA 2B2TC 2A6EC 1J8IA 4CBVA 1GUWA 1B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR2 A;  3DEP A;  4ZK9 B;  1X3Q A;  3SVM A;  2L1B A;  3I90 A;  1SAP A;  2FFK B;  3QO2 A;  1RTO A;  3G7L A;  1HA6 A;  5EPJ A;  1ESR A;  1SSO A;  2RSO A;  3Q6S A;  1F9S A;  2RA4 A;  3ONA B;  4OIJ A;  4DN4 M;  1ZXT A;  1XYI A;  4X3K A;  5EKI A;  1CA6 A;  2KUM A;  1ICW A;  1NAP A;  4RAU C;  1HRJ A;  1RHP A;  1U4R A;  2MPM A;  2BDN A;  2X6L A;  3FPU B;  4O42 A;  2KEC A;  2HCI A;  2KVM A;  3I8Z A;  4RWS C;  2EE1 A;  5DNF A;  4RA8 A;  5JJZ A;  2EPB A;  2B2U C;  3D6W A;  5T1I A;  4CJ2 C;  3KBX A;  1DOK A;  2KED A;  3HP3 A;  4UAI A;  1MGS A;  1PFB A;  2HDL A;  1X32 A;  4QUF A;  4QUC A;  1S4Z A;  1HUM A;  2DY7 A;  2HUG A;  2MJ8 A;  3P7J A;  4NW2 A;  2L11 A;  2VXW A;  2CVR A;  1J9O A;  2B2W C;  1U4M A;  4HED A;  2B2Y C;  1F9R A;  1WD1 A;  1HFG A;  2K05 A;  2DY8 A;  2MGS A;  2HCC A;  2X6G A;  1IKL A;  1QE6 A;  5EPL A;  4ZLT F;  1WTQ A;  2B2T A;  1BF4 A;  2N88 A;  4R9W A;  1O7Y A;  1VMP A;  3MWY W;  4IUQ A;  1DOL A;  1G91 A;  4XT1 B;  5AFW A;  1WTX A;  1NCV A;  4CJ0 B;  5D14 A;  1VMC A;  2J7Z A;  4IUP A;  1ILQ A;  2FIN B;  1B2T A;  2D9U A;  3DM1 A;  4MN3 A;  3LWE A;  1KNE A;  2K01 A;  2KOL A;  2FMM A;  1F9Q A;  2B2V C;  4CJ1 B;  3KUP A;  3MTS A;  1WTV A;  2NZ1 D;  5COY A;  2KEE A;  1QNK A;  2L12 A;  4IUR A;  1Q3L A;  3H91 A;  2JYO A;  4HAE A;  5CMD A;  1BBX C;  1ILP A;  2MP1 A;  1RTN A;  2NWG A;  2R3Z A;  1ML0 D;  2IL8 A;  1WTO A;  1DZ1 A;  1AZP A;  4XT3 B;  2L9H A;  1F9P A;  2XIW A;  1EL0 A;  3IL8 A;  4OIK A;  2K1B A;  4IUU A;  4MHE A;  3IFD A;  3GV3 A;  2K04 A;  4X3U A;  5E4X A;  1WVL A;  4R8I A;  2Q8R E;  5T1G A;  3I3C A;  5CBA E;  1WTR A;  1MSG A;  3TZD A;  1IL8 A;  2B2U A;  1LV9 A;  1U4P A;  2RVL A;  4HCS A;  1B50 A;  1O7Z A;  1MSH A;  2RSN A;  1A15 A;  3DEO A;  1O80 A;  5E4W C;  1EOT A;  1MI2 A;  1IKM A;  2K28 A;  1AP0 A;  1BO0 A;  1WTW A;  1DON A;  4X3T A;  2B2W A;  3F2U A;  1JE4 A;  1PFN A;  4IUV A;  2B2Y A;  4U68 A;  5EPK A;  1EQT A;  2FHT A;  3TN2 A;  1RJT A;  2JP1 A;  1JIC A;  1WTP A;  5COR A;  4LMQ D;  1C8C A;  1B53 A;  3I91 A;  1PDQ A;  1TVX A;  1E0B A;  1EIG A;  1NR4 A;  4ZAI A;  1AZQ A;  4X3S A;  5EQ0 A;  1U4L A;  1HHV A;  4IUT A;  2N55 A;  1QG7 A;  1G2T A;  5D65 A;  2FJ2 A;  1XX8 A;  2NYZ D;  1ROD A;  2EOT A;  1F2L A;  2L4N A;  3GV6 A;  1EIH A;  1CA5 A;  1SDF A;  3UI2 A;  5CBE E;  5EJW A;  1WD0 A;  1G2S A;  2Q8T A;  1DOM A;  1PLF A;  2B2T C;  2B2V A;  1G6Z A;  1HFN A;  2H1E A;  4HSV A;  2SDF A;  3R93 A;  3N52 A;  1B4O A;  4XDX A;  1BNZ A;  1J8I A;  3FDT A;  1HUN A;  4ZKC B;  1CM9 A;  1M8A A;  1X3P A;  2HDM A;  2K03 A;  1GUW A;  2M2L A;  1PFM A;  2X69 A;  1B3A A;  4ZKB B;  1KNA A; 
#chains in the Genus database with same CATH topology
 4X62 Q;  1VDZ A;  4P71 A;  4F8M A;  3CCJ A;  2ZXR A;  3CCV A;  1EFW A;  1A3U A;  1EWH A;  4I7Z C;  4LFC L;  5IWA Q;  2TMP A;  3S2D H;  3A5Z B;  3S17 B;  5CV6 A;  2LMC B;  3G6E A;  2A5H A;  3PGZ A;  5ISR A;  2IPK D;  5I9O A;  1PFB A;  2HDL A;  1AFP A;  1YJ9 A;  1X3G A;  4XXE A;  3M7N A;  1JOR A;  5M5Y H;  2ZM6 L;  1G29 1;  1V43 A;  2HCC A;  4H44 C;  4DUZ L;  2JA5 G;  3ERO A;  1D2B A;  3OOC A;  1VMP A;  4B3R Q;  5DM7 3;  1A62 A;  1DOL A;  4RH6 A;  2E2H H;  1E7Z A;  3GTL B;  1SMY C;  3VYS A;  1KNE A;  4R4O A;  3ULP A;  2O4X A;  4DR5 Q;  4X64 L;  3MAQ A;  4FO2 A;  2YU9 H;  2XRS D;  5IT9 L;  3H15 A;  1CK1 A;  1AE3 A;  1TWH H;  3VYU A;  2IX0 A;  4RGO S;  3MXN A;  3V2T A;  3BZK A;  3SK5 A;  3GV3 A;  1EYD A;  1EU3 A;  3I3C A;  4IFD G;  2JA8 G;  4G7Z C;  2QA4 A;  4DV5 Q;  3V05 A;  1SNO A;  4RGM A;  1FNV A;  4AYB B;  3DEO A;  3CKI B;  4KV6 A;  4CDD C;  4C1N I;  2O5I C;  1V1P B;  3PUY A;  3F2U A;  4O0A A;  3T4A C;  5IOD A;  1E0B A;  4JYA Q;  2NN6 I;  1SE8 A;  2NYZ D;  1PFS A;  3KF6 A;  3KJP A;  2F0E A;  1X9N A;  2XTI A;  3SE0 A;  4A3I B;  3TP5 A;  5M3M B;  2RDH A;  3VA5 A;  5IY0 A;  3L0O A;  2ZJR A;  5CV9 A;  3QWN A;  1HUN A;  1UEB A;  3M4O B;  1MIU A;  1PFM A;  4N8X 1;  4C3I H;  1NR2 A;  2HHH L;  4PMB A;  1D5M C;  3MFY A;  4C2M B;  4JI7 Q;  1XYI A;  5JJK A;  1H9S A;  3BYT B;  2Z1C A;  3A74 A;  4DA2 A;  1II3 A;  3D4W A;  4P75 A;  3U50 C;  5K36 H;  1HNW Q;  2EE1 A;  3RNU A;  1WYD A;  1VQ4 A;  2B63 G;  1ICF B;  1HA5 A;  4XQJ A;  2HUG A;  4GNX A;  3P7J A;  5IYB H;  5C4J H;  2EZV A;  4IPH A;  1PRT C;  1DYQ A;  2SOB A;  2KCT A;  4HED A;  3PUV A;  2J0T D;  4DR3 Q;  1X3F A;  2NVT B;  2SEB D;  4DF7 A;  3W2D A;  4JI6 L;  4LF5 Q;  3H3V H;  4A3B G;  5CV4 A;  5IP9 H;  4JBJ A;  1JMC A;  4R9W A;  1SEB D;  4ME5 A;  5C0X I;  1CT1 D;  3QG1 A;  4B08 A;  4RHS A;  2F3W A;  4NPS A;  5FLX E;  5IP7 H;  3OW7 A;  2E74 C;  1GO3 E;  2YTY A;  3OWF A;  3PF5 A;  1WTV A;  4K2L A;  3MXP A;  4PQX A;  4ALP A;  2KEE A;  4OO1 G;  4POG A;  5JJL A;  2E5L Q;  2NUC A;  4CKB A;  1L1O B;  1OXV A;  4JPB W;  2UUC Q;  3TME A;  2RBM A;  3S15 H;  2F0I A;  1DD2 A;  4TQU S;  1LT3 D;  5JPN C;  4A3J G;  4DV4 L;  1I50 B;  3TDQ A;  1I4H A;  3TZD A;  4ODG A;  1LV9 A;  4G7O C;  5ELD A;  3MA2 B;  4QF4 A;  5DAU A;  1STE A;  1LT4 D;  2PQA B;  3QB3 A;  4GN5 A;  3SGI A;  3FPP A;  3QIA A;  1WTW A;  4DR1 L;  1PFN A;  1JOQ A;  3S2H H;  4DK3 C;  2RDG A;  3PCO B;  1ZEQ X;  1HZA A;  4IJL A;  1C8C A;  1B53 A;  1PXU A;  1EIG A;  1PV4 A;  5EQ0 A;  3C1E A;  2VUM H;  5GRO A;  2JA7 B;  3F2B A;  4BY1 H;  5D65 A;  4GOP B;  1K28 A;  3GTJ H;  3A8K E;  1FNU A;  5IOC A;  3J7A V;  1B4O A;  1FGU A;  3KF8 A;  5M3F G;  5ELB A;  2Q2I A;  5ELC A;  1GOZ A;  3G4S A;  3K57 A;  1PH7 A;  3K5M A;  4GKK L;  4LK1 C;  3G71 A;  4B3S L;  1CTM A;  1RTO A;  1BOS A;  1SNP A;  1HTL D;  1SSO A;  1GKH A;  4IPC A;  2UUA L;  4JC0 A;  2AMC B;  2NVX H;  1Y1V G;  2MUY A;  4LFB L;  3CXC A;  2KUM A;  3OTO L;  2MPM A;  1BVS A;  1TS3 A;  2OXP A;  3UDG A;  4K0K L;  1WCM B;  1VQC A;  3AMU A;  5JJZ A;  4KKS A;  2F0P A;  3CC2 A;  2Z4H A;  4YHH L;  2PPB C;  2B2U C;  3D6W A;  5T1I A;  3RZO B;  2IJ0 A;  3PO3 G;  1B9M A;  3PMF A;  1I3Q H;  5M5X B;  2R7F A;  1SYC A;  2WAQ B;  3TZU A;  3C2P A;  4A3G G;  4DFA A;  5EBC A;  4DK0 A;  1D5Z C;  2SNM A;  4HID A;  4DUY L;  3S14 H;  1F9R A;  1YIJ A;  1HFG A;  3JAM i;  4HIO A;  2X6G A;  2MFI A;  4HCE A;  3V96 A;  3A8I E;  4XYQ A;  3KDF A;  1N34 Q;  1TWF H;  1JWU D;  3VR4 A;  2KCM A;  2E2D C;  5FLM G;  1VQ7 A;  1NCV A;  2SNS A;  3A7A B;  1YZ6 A;  4PNY A;  3W1B A;  4JI3 L;  1Q90 A;  1U5K A;  4UPA A;  3GTQ B;  1T5E A;  1KAW A;  3PIO A;  1KIX A;  1EQQ A;  1EEF D;  3E0J A;  4BY7 H;  3HOZ G;  2OWO A;  1LTT D;  1XPR A;  4X66 L;  3ULL A;  1A63 A;  5DM6 3;  1KHI A;  2QDB A;  3R8B A;  2MQH A;  4RCO A;  3HOU G;  1MHW C;  1XNR Q;  1XWE A;  1C7Y A;  2BH8 A;  4GLA C;  3QOL A;  1TT2 A;  1Q7Y C;  1VQO A;  2HIV A;  5C3E G;  4R4T A;  2ICE C;  3BDO A;  5JAV A;  3J7Z C;  2GVA A;  1ENA A;  4IPG A;  5I2X A;  1E2Z A;  3CHB D;  1I6H H;  3AU7 A;  1LT5 D;  1O78 A;  5I6Y A;  3TRE A;  3PIP A;  4DXF A;  1YNJ D;  1OO9 B;  1QG7 A;  1IBK Q;  1BCP B;  4GZY C;  1IYU A;  3CCM A;  3EJI A;  5BN3 A;  2JN4 A;  4YCW A;  1JR0 D;  2H1E A;  3S1R H;  4A3E H;  1BNZ A;  4QQB X;  1A0I A;  1CM9 A;  1WJJ A;  2C9O A;  5D3D A;  2I07 B;  2F0D A;  1R9T B;  3NXW A;  3F2C A;  2UXB L;  1PTO F;  2FFK B;  4RKB A;  3G7L A;  1LAC A;  1E3P A;  4A3D G;  1IXR A;  2KHS A;  3P20 A;  5FO9 B;  2F3V A;  2Z6K A;  5C6A A;  5IGD A;  2F0U A;  2NN6 G;  3A54 A;  2F0G A;  2WIN B;  2PQE A;  1YJN A;  1QIL A;  1PTO H;  4QUF A;  4KN4 C;  2C5C A;  1CKO A;  4TKO B;  4NW2 A;  2CW0 C;  1XTC D;  1M90 C;  4BBS B;  4L5T A;  1EY4 A;  3K58 A;  3R2T A;  1Y8N B;  1X3E A;  5M9O A;  1S72 A;  4OX9 L;  5LMU L;  2F0N A;  4PG3 A;  4XT1 B;  5AFW A;  1L1O C;  2F0S A;  1Y1W G;  5AJ3 Q;  1D6E C;  1C48 A;  2R93 B;  3KUP A;  3X3M A;  4LF4 L;  3GTO H;  4KKU A;  3H91 A;  1I4Q A;  4P74 A;  4C3J B;  3ICE A;  4DR2 Q;  1ML0 D;  2E2J B;  4HJ7 A;  4DV6 L;  1W6J A;  1XMO L;  3K80 C;  2JJQ A;  4A3K B;  3GO5 A;  3SK6 A;  3I56 A;  3RR5 A;  5JJI A;  3HOW G;  4BBR G;  3AFP A;  2I5H A;  5I6W A;  3W1G A;  1HZ9 A;  2A8V A;  3HOX H;  1Q8K A;  4A75 A;  3IFT A;  3DMU A;  5CGK A;  3A0J A;  3H6M A;  1VQH A;  3K5O A;  4RGN A;  3C3L A;  1QB5 D;  4JBK A;  2B2W A;  2WKD A;  4GOP C;  5C0X G;  1ET6 A;  1YNN D;  1EQT A;  3BZC A;  3M7G A;  4A93 H;  1N36 Q;  1HHV A;  3S2D B;  3I4N G;  4ILW A;  2EJG C;  1B70 B;  2EOT A;  4KHP L;  2XGT A;  2HD3 A;  3M4Q A;  1SDF A;  3A5U A;  4X65 L;  1Q1B A;  3VYR A;  3TBI B;  1M1K C;  4F7X A;  3N52 A;  3BJU A;  1Q81 C;  3SHL A;  1PTO D;  2QF7 A;  2KCN A;  3K8A A;  5J3B A;  2X69 A;  4DAM A;  2UU9 Q;  4L5S A;  4LFA L;  5M5Y B;  3D31 A;  1YJW A;  3GTQ H;  1LTG D;  2L1B A;  4L8J A;  2IX1 A;  1IHZ A;  1HPC A;  1JC7 A;  4KN7 C;  3ONA B;  1CA6 A;  4CDF C;  4LFC Q;  4K5V A;  5FK9 C;  1DM0 B;  2E2H B;  1RHP A;  1EQR A;  1U4R A;  1IYJ B;  2BE5 D;  3K81 C;  3A8J E;  2HCI A;  2L55 A;  1PZI D;  1P16 A;  1CKN B;  4NDX A;  1HZC A;  2G9D A;  3HP3 A;  2YU9 B;  5CV8 A;  1QNU A;  4FVM A;  4KK7 A;  3URY A;  4R4C A;  2VQE L;  1TWH B;  3CQZ H;  4FF1 A;  2DY7 A;  1TS5 A;  4JV5 L;  2L11 A;  2B39 A;  5IGE A;  1UE7 A;  4APV A;  4DAY B;  1K0R A;  5JEA G;  2ZM6 Q;  2JK8 A;  2K75 A;  1VS0 A;  2CKZ B;  4DR4 Q;  1E2W A;  3NWT A;  4DUZ Q;  1TWA H;  1Z9F A;  5GAH C;  1HNZ L;  1WTQ A;  4UY8 C;  5I4D A;  4LAA A;  4R8N A;  3I72 A;  3KFU A;  1SLJ A;  5ELO A;  2ZXO A;  1RKN A;  1VF7 A;  4JI5 L;  3KJO A;  4UP9 A;  1SYE A;  3NTH A;  3UE1 A;  1BQQ T;  2FMM A;  1IZ6 A;  2ICI A;  2QCP X;  4X64 Q;  1WTH A;  1DCZ A;  1Q3L A;  2RCF A;  1CI3 M;  4EVO A;  1K8A C;  2JEB I;  1HZB A;  1PVO A;  3K5L A;  2QIL A;  4HSP A;  5C4H A;  5C44 B;  3IL8 A;  1R9T H;  5CR3 A;  4IUU A;  4AYB G;  4N9P A;  3QJY A;  1X55 A;  2CH4 W;  4A3F G;  5EGT A;  5CBA E;  1PZK D;  2BCO A;  1PH5 A;  5HGT A;  1Q86 C;  2F03 A;  1MSH A;  5LHY 1;  1S40 A;  4HMJ A;  4C3I B;  5E4W C;  1MI2 A;  1TY0 A;  1L0W A;  1BCP C;  1V8Q A;  1X65 A;  4C1N K;  2D5D A;  3NQT A;  2B8G A;  4A3I G;  2K5W A;  1N33 Q;  2F1M A;  3OHX C;  1K73 C;  1V1P A;  5KRU A;  1NSN S;  3CCS A;  2F0W A;  4C3H H;  4DV3 L;  1T5X D;  4JI1 L;  3LX0 A;  4PMC A;  1I94 Q;  2OCE A;  4DNI A;  2B2V A;  5F2D A;  5C4X G;  3U4V A;  2UXC L;  3OW2 A;  3BS1 A;  3T13 A;  5C4J B;  4DN4 M;  2HHH Q;  2Y0S B;  1VQF A;  3U9S A;  3CCQ A;  1RD9 D;  3N6R A;  3NEM A;  3DHQ A;  5M3F H;  1S5D D;  1ZXT A;  2AQ2 B;  4X3K A;  2QEX A;  4A3K H;  1FR3 A;  2NZH A;  1PH4 A;  4WJW A;  2ZTD A;  2BDO A;  4DR6 L;  4XIG S;  2F0Q A;  1CSQ A;  4DV0 Q;  2KED A;  3A7L A;  3TP6 A;  1Y8O B;  2MJ8 A;  3GQB A;  4H7B A;  2DUD A;  4DNR B;  1JWS D;  5D3I B;  3S15 B;  1J9O A;  1SJH D;  1IBM Q;  1WD1 A;  1QZG A;  2UXD L;  2XRQ D;  3J80 c;  2LXJ A;  4JI6 Q;  3T1H L;  1NMG A;  3NEN A;  1SFO B;  3BVZ A;  2EY1 A;  4K6D A;  2E2I H;  2N3S A;  3F1Z A;  3ND8 A;  4OWT B;  3KLR A;  3LWU A;  1QOH A;  1MD2 D;  2EYL A;  5FLX c;  1MBY A;  5A2Q L;  3S2H B;  4O2D A;  1PHJ A;  5HY6 A;  4OEM B;  3CD6 A;  5FLM H;  4EQO A;  5CYU A;  1VQD A;  1ESF A;  2K33 A;  2VUM B;  4QIW B;  5J1Z A;  4BY1 B;  2A6H D;  4IFD J;  4OIK A;  3Q23 A;  3HOY H;  2IW3 A;  1VQL A;  2LSS A;  3GTJ B;  4LNQ A;  4DV4 Q;  5E4X A;  2Q8R E;  4KY5 A;  3AYH B;  3GTG H;  3PO2 G;  3HOZ H;  2RVL A;  1O7Z A;  2OQ0 A;  1GXD C;  2RSN A;  1YHA A;  3LGJ A;  5FJ8 G;  1G8Z D;  4XQQ A;  4DV7 Q;  3CW2 C;  1XNQ L;  1SE2 A;  4DR1 Q;  1BKB A;  1I6V C;  2JA7 G;  2QKI C;  2R92 H;  1JE4 A;  3FEW X;  1YI2 A;  4CKC A;  3KBG A;  3I4M B;  5IGC A;  1BUV T;  4BA2 I;  2NVX B;  3QR8 A;  2Z4I A;  1D7Q A;  1HNX L;  1AZQ A;  3BDL A;  4X3S A;  4JI0 Q;  4GS3 A;  1YNX A;  4JI8 Q;  4N9T A;  3CME A;  1LTA D;  4Q0F A;  2KQ3 A;  2OQK A;  2F0L A;  3C1F A;  1I3Q B;  4BXX G;  3FDT A;  2DNC A;  3TP7 A;  1NUC A;  4U67 3;  4LJZ C;  4HJ5 A;  1DXM A;  3S14 B;  1X56 A;  4GKK Q;  1X3Q A;  4IO9 A;  1HCZ A;  4B3S Q;  3I90 A;  3NUC A;  1WCM G;  2NVY H;  5HGQ A;  2UUA Q;  4PZ7 A;  1TWF B;  1L2F A;  3S9W A;  4LFB Q;  2Z9H A;  4TRD A;  2F4V Q;  5C44 H;  3J81 j;  4K0K Q;  5EBD A;  2WAQ G;  4LF9 Q;  1O7L A;  3M4P A;  1GHK A;  3JAM E;  4JOI C;  4RA8 A;  1K83 H;  3HKZ B;  4BY7 B;  4B3T L;  4OEL B;  1SXT A;  1XJV A;  5BR8 L;  4IOA A;  2F0V A;  3H0G B;  3NBH B;  4UP7 A;  5LMN L;  3WDN A;  1SE3 A;  3AB9 A;  1LLR D;  3DWQ A;  4DUY Q;  1BXT A;  4J6H A;  1SYF A;  4FXD A;  4R1J A;  2PI2 A;  1IKL A;  3MC0 B;  5IYC H;  3U9O A;  1UE1 A;  3BU2 A;  3K5N A;  4IUN A;  2NBF A;  2K4K A;  2E8G A;  1O7I A;  2K01 A;  4DR7 L;  3CC7 A;  2ZJP A;  4A3C G;  4FDB A;  3GTM B;  4JI3 Q;  4A3M G;  1R4Q B;  2L12 A;  3CCL A;  3LNN A;  1I6H B;  4GN3 B;  4A3L H;  4X66 Q;  5GAE C;  3J80 E;  2WB1 B;  1UE5 A;  2ALY B;  3KLS A;  1HQM C;  3H3V I;  2ID0 A;  4ZQ3 A;  1WTR A;  2PZU A;  4OL7 A;  2D2C C;  3KYH C;  3S1R B;  2NVQ B;  4A3E B;  1UNS A;  1XMQ L;  1U4P A;  1B50 A;  4CGY B;  4HMI A;  3FP9 A;  5KNC A;  5FOB B;  1OTC A;  4NXM L;  1A15 A;  1E24 A;  1IKM A;  1EOT A;  1H95 A;  1VQE A;  3HOW H;  1KTK A;  3MHB A;  1QWY A;  3EVQ A;  1STB A;  2B2Y A;  4QMG A;  2LY7 A;  1H9K A;  2GA4 B;  2JA6 H;  1PDQ A;  1LTB D;  1QCB D;  3ND9 A;  4MIU A;  3E0E A;  5IWA L;  2FJ2 A;  3HOV H;  4I65 A;  2KBN A;  4LUV A;  1C9O A;  4KD3 A;  2PYK A;  1SFO H;  1WI5 A;  1PTO B;  1A8V A;  3TQY A;  3T16 A;  1JT8 A;  3KLW A;  4ZKC B;  3SEB A;  3H3V C;  4AYB E;  1PH6 A;  1EZ8 A;  1PH3 A;  5GAD C;  1KNA A;  2R7D A;  3E5S A;  1LM0 A;  4ZK9 B;  3QO2 A;  3K7A H;  1KAB A;  3DXJ C;  2RA4 A;  5KNB A;  2IHF A;  4M8A A;  3STB D;  3TP8 A;  1GM5 A;  2YTV A;  4WOR A;  1HQR D;  2PZT A;  1NTG A;  4RWS C;  3GTO B;  2XWB B;  4BBS G;  1OXT A;  1QJO A;  4ID6 A;  2RF4 A;  3MXN B;  4QUC A;  5K5P A;  1MJE A;  1ZYR D;  2K7V A;  2H4O A;  4OWW B;  4RHR A;  2NTT A;  1JJC B;  5C4Z A;  4NXN L;  3VR6 A;  3I4M H;  2CFM A;  1KRS A;  3P75 A;  5EPL A;  2R93 G;  3HOX B;  2B2T A;  3FKI G;  4OX9 Q;  5LMU Q;  4NKL A;  4OXP A;  2A74 C;  4C3J G;  5IYD H;  1P8L A;  3DM1 A;  1DGS A;  4XTC S;  2CH4 A;  2UUB L;  2VZA A;  1QNK A;  2JA8 B;  1EYA A;  3Q24 A;  1QUQ A;  3HKS A;  4A93 B;  3KF6 B;  5GQO A;  4FF3 A;  2EYF A;  4DV6 Q;  1DZ1 A;  4RFB A;  1SE4 A;  1AZP A;  1L0X B;  4L5R C;  4XT3 B;  2F0J A;  4KY7 A;  2R7Z H;  5LL6 S;  4JYA L;  2IHE A;  4EGV A;  2D0O A;  1V9P A;  2EJF C;  2WKC A;  1STN A;  4DV2 Q;  5M5W B;  1VCI A;  2EYO A;  2F0T A;  2RHS B;  3JC6 6;  3G48 A;  4POF A;  3TRZ A;  3VYT A;  4DGZ A;  1YNJ C;  2ASB A;  2D62 A;  3T1Y L;  4A3F H;  4DU9 A;  1H9S B;  5EPK A;  3TS2 A;  2QDL A;  2ATW A;  4LMQ D;  2WFW A;  4JI7 L;  3H0G H;  2C35 B;  2MHV A;  1HJP A;  3K59 A;  1TWC H;  2F0F A;  4AQY Q;  1W2B A;  3S1M H;  4X65 Q;  4GNX B;  4N8F A;  3U4Z A;  1R4P B;  1S5B D;  3CQZ B;  5ELE A;  3FHW A;  1IW7 D;  1M8A A;  1QVC A;  4LFA Q;  1TKW B;  3GTM H;  4MNO A;  3DEP A;  3D4R A;  2EIF A;  3GTK H;  1TWA B;  4DR3 L;  1ESR A;  5C4X H;  3Q6S A;  2K32 A;  3CPW A;  1B7Y B;  3Q22 A;  2YYZ A;  1YHB A;  3ITP A;  3PUX A;  4LF5 L;  3M3Y B;  1RDP D;  4MTK A;  4RAU C;  4PV1 C;  4J15 A;  4BWG B;  4O42 A;  1FGB D;  1S5C D;  2ENB A;  3L9A X;  4KJO A;  1GUG A;  2JEA I;  3NSW A;  1ASY A;  2NVQ H;  4CJ2 C;  4A3B B;  3U58 A;  1I4R A;  4DKA C;  3BVG A;  1A6X A;  3IKJ A;  4RKL A;  2K6A A;  3TEH B;  5JVH 3;  2EXZ A;  2I0Q A;  2L0C A;  4X6A H;  2K52 A;  2K05 A;  1QVG A;  2MGS A;  1F2M A;  2VB3 X;  1QE6 A;  3SK4 A;  1CUK A;  1HNZ Q;  1YBY A;  4DAY A;  4TVA B;  3I4O A;  1O7Y A;  2WAC A;  1S3O A;  1WTX A;  1AH9 A;  4JI2 L;  3RZD H;  2K5H A;  3LWE A;  2B8F A;  3J81 E;  3T53 B;  5TSS A;  1EIY B;  5IE8 A;  4IUR A;  1K8M A;  5FKA C;  5CMD A;  2G9H D;  3D6C A;  3H09 A;  4KMU C;  4DV1 L;  1D1K A;  1VQM A;  2WAQ E;  2PI2 E;  4HJA A;  1JOO A;  2EJM A;  2LS0 1;  4ULL A;  4JI4 L;  1I5F A;  1SYG A;  4C3H B;  2OEO A;  4DK6 C;  2HQL A;  2MO0 A;  1EFI D;  4FXK C;  4TSS A;  2VQF Q;  2WP8 J;  1YNN C;  2AQ1 B;  5LMN W;  4HCS A;  1B1Z A;  2BH2 A;  5C0X J;  3NHH A;  3ULJ A;  3KK7 A;  4P72 A;  2JA5 H;  3PO2 H;  1GUT A;  3S1N H;  2ZJQ A;  5M3F B;  5K36 G;  5COR A;  1KAA A;  4Y7N H;  1YHQ A;  4IZ8 A;  1PTO C;  4V19 0;  1U4L A;  2N55 A;  1G2T A;  5NUC A;  1K9M C;  5IYB G;  4KD4 A;  1FJG L;  2WII B;  1NBW A;  3EIV A;  5CBE E;  1D8L A;  3UI2 A;  1W6K A;  1FNW A;  1F77 A;  2Y0S G;  1HFN A;  2CWA A;  2UXC Q;  1VQB A;  2YTX A;  5IP9 G;  3M4Y A;  5KND A;  3KDF B;  4IFD H;  3SVM A;  2JA8 H;  5IP7 G;  2H5X A;  1K3B C;  4YY3 L;  2PNR C;  4BXX H;  3L2P A;  1JQY D;  3L3O C;  1WOC A;  2N49 A;  2L5T A;  3CRL C;  2CQO A;  3BDC A;  3G6J B;  2E2I B;  1IBL L;  1NAP A;  4JBM A;  4PZ6 A;  4QJF A;  2BDN A;  2X6L A;  3S1Q B;  4DR6 Q;  2I5L X;  2GVB A;  1Z7T A;  1NMF A;  5M5W H;  3KBX A;  1MGS A;  1VF5 C;  4LF6 Q;  5JEA J;  1CZG A;  1NE3 A;  5I2Y A;  2EQS A;  3PSI A;  4DAP A;  3HOY B;  4QB4 A;  3VR3 A;  4H0L C;  3J7A 5;  5KYL A;  3GTG B;  2XWJ B;  3T1H Q;  3HOZ B;  1LYL A;  1QZH A;  1PZJ D;  3PQI A;  1YIT A;  3MWY W;  3C46 A;  1XNR L;  2PO4 A;  4YWK A;  1B2T A;  4S3S A;  3SK8 A;  3VDY A;  2RQX A;  2V1C C;  2VUM G;  1OXU A;  2K5Q A;  2AUK A;  2OF1 A;  5G3L D;  4BY1 G;  3J7Y W;  2R92 B;  1TR5 A;  4K5X A;  1KXL A;  1DJR D;  2VW9 A;  3AQQ A;  1LTR D;  3P1H A;  4B3M L;  5BN5 A;  4IN3 A;  1AN8 A;  1GJX A;  1I4X A;  4ME3 A;  1IBK L;  1HR0 L;  2K04 A;  4E6I A;  2B63 H;  4UDU C;  3RLO A;  2BOS A;  4HIK A;  3E6Z X;  3M3Y H;  2B2U A;  3D3R A;  4KHZ A;  2A69 D;  1E1T A;  2PNH A;  4RG1 A;  4XQN A;  5HUR A;  3OPO A;  4A3B H;  4K5W A;  1E22 A;  2NVY B;  5L37 A;  2JP1 A;  3Q0A A;  4GNX C;  1NY4 A;  5IGF A;  1KLU D;  1JB7 A;  3GP7 A;  4ZUI A;  3CF5 A;  1KQS A;  4OO1 H;  5C3W A;  1ROD A;  1GUS A;  1B9N A;  3CCR A;  3I7F A;  1HH2 P;  1K83 B;  3H94 A;  1G2S A;  2M9V A;  3J80 L;  1STG A;  2A68 D;  3VR5 A;  4HSV A;  4XDX A;  4A4I A;  4PZ8 A;  2PMZ E;  1LT6 D;  3HGB A;  2JA9 A;  3E9I A;  4A3J H;  2EVB A;  2AQ3 B;  4IPD A;  4ABN A;  5FLX L;  3Q8D A;  4G4K A;  1J5E L;  3D4D A;  4KLK A;  3S16 B;  3CMA A;  4H13 C;  4GKJ L;  5M3M G;  2TSS A;  3EFX D;  2D0P A;  3HKZ G;  3NQI A;  4KY6 A;  1VQ9 A;  1PH2 A;  1TWG B;  4BY7 G;  3FPU B;  3NWS A;  1KDB A;  1TS4 A;  1EY8 A;  1YEZ A;  2GN5 A;  3NTI A;  1DOK A;  1VQJ A;  2DJF C;  3JAM c;  1CSP A;  1LAB A;  4B3T Q;  5BR8 Q;  1XXG A;  2XVS A;  5LMN Q;  3CAM A;  2QEJ C;  4QGU A;  1Q82 C;  2EXD A;  1QVF A;  2OTJ A;  2DY8 A;  4H02 A;  4CKE A;  2LXK A;  4B9W A;  4IAL A;  3BYY B;  2OTL A;  5D14 A;  2J7Z A;  3X3N A;  2HT1 A;  3HOW B;  2A6H C;  2AWO A;  5KGU A;  1GVP A;  4CJ1 B;  4RMF A;  4OWX B;  1Y1V H;  2WB1 G;  1EYC A;  3FKI H;  4HAE A;  5A35 A;  2VB2 X;  2JA6 B;  4LF7 L;  3CP0 A;  1CKM A;  4A3E G;  1JB3 A;  1UE6 A;  3RLN A;  2R61 A;  3HOV B;  4MHE A;  4KTA A;  3PO3 H;  3IFD A;  1VQK A;  4JCV E;  1S5E D;  1STH A;  2JE6 I;  4K8I A;  1MSG A;  1IL8 A;  1PYB A;  4A3G H;  4KKT A;  1D1I A;  3RN2 A;  4NXM Q;  3I4N B;  3MZ5 A;  3S1Q H;  2E75 C;  2Q8I B;  1KD1 C;  2Q2T A;  1LTI D;  2UU9 L;  2CWP A;  2Q2H A;  4YIJ A;  1X6O A;  3K7A B;  2I5M X;  1PYW D;  4NP5 A;  1TY2 A;  3F8T A;  1A3T A;  4OGQ C;  4AH6 A;  2PZW A;  1CFM A;  1UEA B;  2DN8 A;  3GD7 A;  1L1O A;  2L4N A;  1EIH A;  4WJ3 M;  3OYY A;  4LWC A;  1YVC A;  1H9R A;  2AHO B;  1SRO A;  3T51 B;  5JPM C;  1PA6 A;  1SNM A;  2XNA C;  1X54 A;  1MJC A;  3HOU H;  1SAP A;  2A6E D;  2PQA A;  4DR4 L;  4OIJ A;  5C3E H;  3E3X A;  4K2K A;  4FNF A;  3I8Z A;  1Z6H A;  2Z8L A;  3L7Z C;  4UAI A;  2DJG C;  1I4G A;  4GOP A;  2L15 A;  1HUM A;  2IWH A;  2R7Z B;  3HOX G;  2K5D A;  2Y0S E;  1RL2 A;  3PUW A;  3PF4 A;  4NXN Q;  4YWM A;  5EKK A;  2EYP A;  2EY5 A;  3I2Z A;  3OTO Q;  3NK9 A;  4IOC A;  1A3V A;  1K0S A;  3KLS X;  4A93 G;  1AEX A;  3QOJ A;  1VMC A;  4CJ0 B;  2BA1 A;  2KA7 A;  2FIN B;  3UE0 A;  4DPG A;  1VQ8 A;  4YHH Q;  1UUP A;  4A3F B;  1N32 L;  2UUB Q;  2DNE A;  4A3D H;  5COY A;  2LFN A;  4O1N A;  3J7A F;  1PRT F;  5KIX A;  2R3Z A;  1SMY D;  1N33 L;  2EY6 A;  2XIW A;  1F9P A;  4EX5 A;  4OON A;  1TWC B;  3TS0 A;  4HN7 A;  2NN6 H;  1W3S A;  3MXU A;  1Z47 A;  3HZX A;  3S1M B;  4WRD A;  1WVL A;  3CC4 A;  3S16 H;  5T1G A;  4LF8 L;  1I94 L;  1GHJ A;  1FD7 D;  1JJ2 A;  1N9W A;  2CQA A;  2Z6K C;  1TWG H;  3R3O A;  3RN5 A;  3T1Y Q;  3DWP A;  3GTK B;  2O2L D;  3D8G A;  5C4X B;  4HJ8 A;  2F0K A;  2NB0 A;  5IIF A;  3J81 L;  3I91 A;  1Y1W H;  4GLX A;  2VS1 A;  4QIW E;  5IGB A;  1EY6 A;  1ONL A;  1H9J A;  1Q1E A;  2VNU D;  3NEL A;  1KDC A;  1U0L A;  1CA5 A;  3W5O A;  4DV0 L;  5IT9 c;  2R6G A;  2HDM A;  2K03 A;  1T9H A;  4YWL A;  1HR0 W;  3STB C;  4BBR H;  1LTS D;  3NP8 A;  5KEE A;  4X62 L;  1EWI A;  3CU7 A;  4ZRZ A;  1IBM L;  1CZW A;  3PIO 3;  3GTP H;  1HA6 A;  1I4P A;  3A55 A;  2V4D A;  3EA6 A;  1ICW A;  4IJH A;  1K3R A;  3K0X A;  4EQP A;  1ZYR C;  3RZD B;  1H9M A;  5C0X H;  4FYD A;  1EOV A;  2KVM A;  1TQO A;  1G51 A;  2MNA A;  4LUZ A;  2ZTE A;  3I4N H;  4QCL A;  1C0A A;  2KHI A;  2N78 A;  4EQN A;  1OXX K;  2CVR A;  1XPU A;  2B2W C;  1PYS B;  2UXB Q;  2OT2 A;  4GN4 B;  4K8J A;  5E3F A;  1XPO A;  1FL0 A;  4ZLT F;  4F88 A;  2QW7 A;  1J6Q A;  2N88 A;  2VL6 A;  5FO7 B;  3PIP 3;  2G5D A;  4IUQ A;  1F2Z A;  5JOB A;  4B3R L;  2EDG A;  4JI2 Q;  3OMG A;  1PRT D;  1D5X C;  4IUP A;  2ZT9 C;  2D9U A;  4YCU A;  3B6Y A;  3HRZ C;  3S17 H;  3VR2 A;  2JA5 B;  4RGT A;  5I9P A;  4DV7 L;  3PO2 B;  2NZ1 D;  3PUZ A;  2F4I A;  3HKZ E;  4C3H G;  4DR5 L;  3S1N B;  1SBB B;  3DUZ A;  3J81 c;  4DV1 Q;  1BBX C;  1ILP A;  4V0B A;  4NB3 A;  4I7A A;  2MP1 A;  5IGG A;  1SYD A;  1RTN A;  3BZD B;  4Y7N B;  4L63 B;  1SJE D;  4JI4 Q;  2JXM B;  2K1B A;  4WFN 3;  4JI0 L;  1MKH A;  3O13 A;  1V1O A;  2AUJ D;  4JI8 L;  4CDE C;  4FP5 D;  2HIX A;  4DV5 L;  1STY A;  5JEA H;  1Y8P B;  2B29 A;  3GTL H;  1N8R C;  4A3K G;  4LF4 Q;  2K28 A;  1RIP A;  1AP0 A;  3WWV A;  2F0O A;  2DGY A;  2Z6B A;  3M85 A;  2FHT A;  4JK1 C;  1JIC A;  1WTP A;  1XMO Q;  1JE5 A;  2Q2U A;  5GAG C;  1TVX A;  4QL5 A;  1NR4 A;  1IW7 C;  3W3A A;  2CCZ A;  1B3Q A;  2F4V L;  1SNQ A;  2WB1 E;  1XX8 A;  3MEF A;  5A2Q E;  3GV6 A;  1FJG Q;  3D0F A;  1TII D;  4LF9 L;  2JQO A;  1DOM A;  4BA1 I;  1LTL A;  1OXS C;  1X3P A;  1HXY D;  1NNX A;  3NTK A;  2M2L A;  2RHQ B;  3EQL C;  3SXH A;  4CDC C;  4ZKB B;  1EY0 A;  2F3I A;  2ZTC A;  2NZO A;  1B8A A;  4YY3 Q;  1EQV A;  1VQA A;  1F9S A;  4UHV A;  3RLF A;  1VQP A;  1M4V A;  2XSC A;  1IBL Q;  5ELN A;  3ER0 A;  1HRJ A;  3RUZ A;  1ZKO A;  1SRU A;  4P2C B;  4KHP Q;  1IYV A;  1BR9 A;  2KEC A;  1E2V A;  3FVQ A;  5IT9 E;  5DEH A;  1HNW L;  4GLV B;  4A3I H;  1EY9 A;  3HOY G;  5M3M H;  4PMW A;  2EY2 A;  5DLQ E;  1IL2 A;  1L0Y B;  3OIP A;  3OSO A;  3M4O H;  2EYH A;  2EYM A;  3VA7 A;  1PH1 A;  4R4Q A;  4WJ4 A;  3A56 A;  4A3M B;  2B63 B;  1ENC A;  4C2M H;  2A1A A;  5EKL A;  1BF4 A;  2R92 G;  1AE2 A;  2K5N A;  5KYI A;  4HIM A;  4B9X A;  1ILQ A;  4MN3 A;  2KOL A;  3J80 i;  1F9Q A;  2B2V C;  3MVV A;  1EYG A;  2AKW B;  2VQE Q;  2JYO A;  2E5L L;  4DK1 A;  1SND A;  4JV5 Q;  1CKN A;  1EY5 A;  5CV7 A;  2L9H A;  2UUC L;  4B3M Q;  1TS2 A;  1EL0 A;  5E1F A;  1PH9 A;  4HTH A;  1HR0 Q;  4F87 A;  2NVT H;  1GD7 A;  3UDF A;  4QY7 A;  3WOE A;  4JOI A;  4KI0 A;  2NTS A;  3M9B A;  2IY5 B;  4JI5 Q;  3HEJ A;  2O5J C;  5JVG 3;  1BBW A;  1RCV D;  4A3J B;  3NE5 B;  1O80 A;  1TXY A;  5C5L A;  3IAY A;  1SN8 A;  5C44 G;  1VQG A;  3TSS A;  4HR7 B;  1EEI D;  4U68 A;  3CPF A;  3RMH A;  1RJT A;  5J39 A;  1BBU A;  4JVZ A;  5G3L F;  2N8N A;  1JCK B;  4ZAI A;  1JWM D;  3ERQ A;  3KF8 B;  4K14 A;  1WFQ A;  2F0M A;  4C3I G;  2F52 A;  2Q8T A;  1I50 H;  2XN9 C;  1HTP A;  1PLF A;  1G6Z A;  3FMC A;  2FXQ A;  3R93 A;  1FVI A;  1LUZ A;  1EY7 A;  2AWN A;  5FO8 B;  5H1S E;  3R2I A;  5IYC G;  5C5M A;  3SR1 A;  3I4L A;  1KC8 C;  2CHB D;  5C3X A;  1VQ5 A;  3I70 A;  4DNT B;  1JOK A;  3EBE A;  1J5E Q;  2RSO A;  4GKJ Q;  4KJN A;  4M1U B;  3UDI A;  4UP8 A;  4A76 A;  5EKI A;  5FJ8 H;  4FF4 A;  3DM3 A;  4ZYS A;  4DV3 Q;  1Q46 A;  2JA7 H;  4R4I A;  2YV5 A;  4KHV A;  1QUQ B;  4JI1 Q;  4A3L G;  1EUJ A;  1EZ6 A;  1CQF A;  1ASZ A;  2EPB A;  3CRK C;  1Y1V B;  2PW7 A;  1UAP A;  3FKI B;  4DAV A;  4MZ9 A;  3BVM A;  1CQV A;  1VQN A;  1F2Y A;  1S4Z A;  1LO5 D;  3I73 A;  2J4X A;  2FMC A;  2BE5 C;  4IFD I;  3IRB A;  5EAY A;  3PO3 B;  3BG3 A;  1PMR A;  3S24 A;  4DV2 L;  4A3G B;  1N34 L;  3UDX A;  2IX3 A;  4BS9 A;  2CW0 D;  5ELF A;  4JW0 A;  4XYO A;  1G91 A;  1CHP D;  2PMZ B;  5CV5 A;  2JA6 G;  1A2U A;  1WCM H;  1ET9 A;  3ZJY C;  5J22 A;  3MEH A;  4MTN A;  3MTS A;  3RZO H;  3HOV G;  1E1O A;  3RD4 A;  1WTO A;  4LF7 Q;  5M5X H;  2A69 C;  3EN2 A;  2WV6 D;  2I46 A;  3NBI A;  1XTD A;  2K14 A;  2UXD Q;  1ENF A;  3K7U C;  4R8I A;  4AQY L;  1KL9 A;  2HQE A;  2KHJ A;  5E7N A;  3OIQ A;  3WOF A;  1DON A;  3CCU A;  3HOU B;  2KEN A;  1BDO A;  2RCN A;  3HS0 C;  3JAM L;  2M00 A;  2VY3 A;  2BA0 A;  4J8Q A;  2A68 C;  5C3E B;  1EU4 A;  1RF2 D;  2E76 C;  1SR3 A;  2Z0S A;  4LW1 A;  4A3C H;  2F0H A;  4ZUJ A;  3K0Y A;  3ZYY X;  3MXG A;  3DWA A;  1F2L A;  4A3M H;  1C4Q A;  4JG2 A;  1WD0 A;  1KLG D;  3KOJ A;  5BN4 A;  3ERS X;  2SDF A;  3I4M G;  1K8G A;  3HFZ B;  1BCP F;  4Z9C B;  1EWC A;  3GDE A;  4FXG C;  1XNQ Q;  1EIF A;  5IYD G;  1VQ6 A;  4LUO A;  1SYB A;  1CHQ D;  1NJI C;  1PH8 A;  5EPJ A;  3SDZ A;  4CHT B;  1HNX Q;  2EYJ A;  2K50 A;  4RCN A;  2KCC A;  1SNC A;  1FYC A;  1K8O A;  4OO1 I;  4P73 A;  3F2D A;  2R7Z G;  5DNF A;  1V1Q A;  4A3D B;  1AW7 A;  2PCF B;  4AIM A;  3K6O A;  1GUN A;  3HG9 A;  3T56 B;  1X32 A;  2PW5 A;  4EQ5 A;  2MO1 A;  3MFG A;  4IQZ A;  4FF2 A;  1Q12 A;  1U9R A;  4L6T B;  4ZCK A;  2VXW A;  1S5F D;  1U4M A;  3AFQ A;  4K6L A;  2B2Y C;  3AEV A;  1SMX A;  2IT1 A;  2RDF A;  3J81 i;  1GUO A;  2VQF L;  1JJG A;  1Y14 B;  1VQI A;  1PRT B;  3FRP B;  2JSO A;  4J1M A;  5CC4 A;  5AJ3 L;  3H0G G;  1N32 Q;  1Y69 U;  2ZXP A;  4NMZ A;  3DLL A;  4G7H C;  2NWG A;  4DR2 L;  2IL8 A;  1Y1W B;  2A73 B;  4C56 C;  4DXG A;  2KJX A;  4BBS H;  4G57 A;  3I55 A;  1STA A;  2A19 A;  4X3U A;  4L5Q A;  4Q5V A;  4LF8 Q;  3NBH A;  2ES2 A;  4OHJ A;  4Y52 H;  4BBR B;  4DR7 Q;  2RKS A;  4YCV A;  1BO0 A;  3CCE A;  4X3T A;  2R93 H;  1A2T A;  3GTP B;  4IUV A;  4JBW A;  3TN2 A;  5LL6 X;  3OMC A;  1B44 D;  1TU2 B;  4C3J H;  1Q8I A;  1N36 L;  2E2J H;  3NPP A;  2LKV A;  4IUT A;  2K5V A;  3PV0 A;  1KDA A;  4HJ9 A;  1BCP D;  3OWE B;  2B3G A;  5EJW A;  2B2T C;  1UWV A;  2A6E C;  1XMQ Q;  2QGQ A;  3E9H A;  1J8I A;  1G6P A;  2P5Z X;  4CBV A;  4LF6 L;  1GUW A;  1KRT A;  1B3A A; 
#chains in the Genus database with same CATH homology
 1VDZ A;  4F8M A;  2ZXR A;  1A3U A;  1EWH A;  4I7Z C;  2TMP A;  3S17 B;  5CV6 A;  2LMC B;  2A5H A;  5ISR A;  2IPK D;  5I9O A;  1PFB A;  2HDL A;  1AFP A;  4XXE A;  3M7N A;  1JOR A;  1G29 1;  1V43 A;  2HCC A;  4H44 C;  3ERO A;  1D2B A;  3OOC A;  1VMP A;  5DM7 3;  1DOL A;  4RH6 A;  3GTL B;  1SMY C;  3VYS A;  1KNE A;  2O4X A;  3MAQ A;  4FO2 A;  2XRS D;  5IT9 L;  1CK1 A;  3VYU A;  2IX0 A;  4RGO S;  3MXN A;  3V2T A;  3SK5 A;  3GV3 A;  1EYD A;  1EU3 A;  3I3C A;  4IFD G;  4G7Z C;  3V05 A;  1SNO A;  4RGM A;  1FNV A;  4AYB B;  3DEO A;  3CKI B;  4KV6 A;  4C1N I;  2O5I C;  1V1P B;  3PUY A;  3F2U A;  3T4A C;  5IOD A;  1E0B A;  2NN6 I;  2NYZ D;  2F0E A;  3SE0 A;  4A3I B;  3TP5 A;  5M3M B;  2RDH A;  3VA5 A;  5CV9 A;  3QWN A;  1HUN A;  3M4O B;  1PFM A;  1NR2 A;  4PMB A;  1D5M C;  3MFY A;  4C2M B;  1XYI A;  1H9S A;  3BYT B;  2Z1C A;  4DA2 A;  1II3 A;  3D4W A;  5K36 H;  2EE1 A;  1HA5 A;  4XQJ A;  2HUG A;  3P7J A;  2EZV A;  1PRT C;  1DYQ A;  2SOB A;  4HED A;  3PUV A;  2J0T D;  2NVT B;  2SEB D;  4DF7 A;  3W2D A;  5CV4 A;  4R9W A;  1SEB D;  4ME5 A;  5C0X I;  1CT1 D;  3QG1 A;  4B08 A;  5FLX E;  2F3W A;  4RHS A;  3OW7 A;  2E74 C;  3OWF A;  1WTV A;  4K2L A;  3MXP A;  4PQX A;  4OO1 G;  2KEE A;  2NUC A;  4CKB A;  1OXV A;  3TME A;  2RBM A;  2F0I A;  1DD2 A;  4TQU S;  1LT3 D;  5JPN C;  1I50 B;  3TDQ A;  3TZD A;  1I4H A;  4ODG A;  1LV9 A;  4G7O C;  5ELD A;  3MA2 B;  4QF4 A;  5DAU A;  1STE A;  1LT4 D;  3QB3 A;  3FPP A;  3QIA A;  1WTW A;  1PFN A;  1JOQ A;  2RDG A;  1ZEQ X;  1C8C A;  1B53 A;  1PXU A;  1EIG A;  5EQ0 A;  3C1E A;  2JA7 B;  5D65 A;  3A8K E;  1FNU A;  5IOC A;  3J7A V;  1B4O A;  3KF8 A;  5ELB A;  5ELC A;  1GOZ A;  3K57 A;  3K5M A;  4LK1 C;  1CTM A;  1RTO A;  1BOS A;  1SNP A;  1HTL D;  1SSO A;  2MUY A;  2KUM A;  2MPM A;  1TS3 A;  2OXP A;  1WCM B;  3AMU A;  5JJZ A;  4KKS A;  2F0P A;  2Z4H A;  2PPB C;  2B2U C;  3D6W A;  5T1I A;  3RZO B;  2IJ0 A;  1B9M A;  3PMF A;  5M5X B;  1SYC A;  2WAQ B;  3TZU A;  3C2P A;  4DFA A;  5EBC A;  4DK0 A;  1D5Z C;  2SNM A;  1F9R A;  1HFG A;  2X6G A;  4HCE A;  3V96 A;  3A8I E;  4XYQ A;  1JWU D;  3VR4 A;  2E2D C;  1NCV A;  2SNS A;  3A7A B;  4PNY A;  1Q90 A;  3GTQ B;  1T5E A;  1EEF D;  3E0J A;  1LTT D;  5DM6 3;  2QDB A;  3R8B A;  4RCO A;  1XWE A;  3QOL A;  1TT2 A;  2ICE C;  3BDO A;  5JAV A;  1ENA A;  5I2X A;  1E2Z A;  3CHB D;  3AU7 A;  1LT5 D;  5I6Y A;  1O78 A;  4DXF A;  1YNJ D;  1OO9 B;  1QG7 A;  1BCP B;  4GZY C;  1IYU A;  3EJI A;  5BN3 A;  1JR0 D;  2H1E A;  1BNZ A;  1CM9 A;  2C9O A;  5D3D A;  2I07 B;  2F0D A;  1R9T B;  3NXW A;  1PTO F;  2FFK B;  4RKB A;  3G7L A;  1LAC A;  2KHS A;  3P20 A;  5FO9 B;  2F3V A;  5IGD A;  5C6A A;  2F0U A;  2NN6 G;  3A54 A;  2F0G A;  2WIN B;  2PQE A;  1QIL A;  1PTO H;  4QUF A;  4KN4 C;  2C5C A;  4TKO B;  4NW2 A;  2CW0 C;  1XTC D;  4BBS B;  1EY4 A;  3K58 A;  3R2T A;  1Y8N B;  5M9O A;  2F0N A;  4XT1 B;  5AFW A;  2F0S A;  1D6E C;  1C48 A;  2R93 B;  3KUP A;  3X3M A;  4KKU A;  3H91 A;  1I4Q A;  4C3J B;  1ML0 D;  2E2J B;  1W6J A;  4A3K B;  3GO5 A;  3SK6 A;  5I6W A;  3IFT A;  3DMU A;  5CGK A;  3H6M A;  3K5O A;  4RGN A;  3C3L A;  1QB5 D;  2B2W A;  2WKD A;  5C0X G;  1ET6 A;  1YNN D;  1EQT A;  3M7G A;  1HHV A;  3S2D B;  4ILW A;  2EJG C;  2EOT A;  1SDF A;  1Q1B A;  3VYR A;  3TBI B;  4F7X A;  3N52 A;  3SHL A;  1PTO D;  2QF7 A;  2KCN A;  2X69 A;  5M5Y B;  3D31 A;  1LTG D;  2L1B A;  4L8J A;  2IX1 A;  1IHZ A;  1HPC A;  1JC7 A;  4KN7 C;  3ONA B;  1CA6 A;  4K5V A;  5FK9 C;  1DM0 B;  2E2H B;  1RHP A;  1U4R A;  2BE5 D;  3A8J E;  2HCI A;  2L55 A;  1PZI D;  4NDX A;  2G9D A;  3HP3 A;  2YU9 B;  5CV8 A;  1QNU A;  4FVM A;  4KK7 A;  3URY A;  1TWH B;  4FF1 A;  2DY7 A;  1TS5 A;  2L11 A;  2B39 A;  5IGE A;  5JEA G;  1E2W A;  3NWT A;  1WTQ A;  5I4D A;  4LAA A;  4R8N A;  3I72 A;  2ZXO A;  1RKN A;  1VF7 A;  1SYE A;  3NTH A;  1BQQ T;  2FMM A;  2ICI A;  2QCP X;  1DCZ A;  1Q3L A;  4EVO A;  1CI3 M;  2JEB I;  3K5L A;  2QIL A;  4HSP A;  5C4H A;  5C44 B;  3IL8 A;  5CR3 A;  4IUU A;  4N9P A;  3QJY A;  5EGT A;  5CBA E;  1PZK D;  2BCO A;  5HGT A;  2F03 A;  1MSH A;  5LHY 1;  4HMJ A;  4C3I B;  5E4W C;  1MI2 A;  1TY0 A;  1BCP C;  1V8Q A;  4C1N K;  2D5D A;  3NQT A;  2B8G A;  2K5W A;  2F1M A;  3OHX C;  1V1P A;  5KRU A;  1NSN S;  2F0W A;  1T5X D;  3LX0 A;  4PMC A;  2B2V A;  5F2D A;  3BS1 A;  3T13 A;  5C4J B;  4DN4 M;  2Y0S B;  3U9S A;  1RD9 D;  3N6R A;  3DHQ A;  1S5D D;  1ZXT A;  2AQ2 B;  4X3K A;  1FR3 A;  4WJW A;  2BDO A;  4XIG S;  2F0Q A;  2KED A;  3A7L A;  3TP6 A;  1Y8O B;  2MJ8 A;  3GQB A;  4H7B A;  4DNR B;  1JWS D;  5D3I B;  3S15 B;  1J9O A;  1SJH D;  1WD1 A;  2XRQ D;  1SFO B;  3BVZ A;  2EY1 A;  4K6D A;  3ND8 A;  3KLR A;  3LWU A;  1QOH A;  1MD2 D;  2EYL A;  1MBY A;  5A2Q L;  3S2H B;  4EQO A;  5CYU A;  1ESF A;  2K33 A;  2VUM B;  4QIW B;  5J1Z A;  4BY1 B;  2A6H D;  4IFD J;  4OIK A;  3Q23 A;  2IW3 A;  3GTJ B;  5E4X A;  2Q8R E;  4KY5 A;  2RVL A;  1O7Z A;  1GXD C;  2RSN A;  1G8Z D;  4XQQ A;  1SE2 A;  1I6V C;  2QKI C;  1JE4 A;  3FEW X;  4CKC A;  3KBG A;  3I4M B;  5IGC A;  1BUV T;  4BA2 I;  2NVX B;  2Z4I A;  1AZQ A;  3BDL A;  4X3S A;  4N9T A;  1LTA D;  4Q0F A;  2KQ3 A;  2F0L A;  3C1F A;  1I3Q B;  3FDT A;  2DNC A;  3TP7 A;  1NUC A;  4U67 3;  4LJZ C;  1DXM A;  3S14 B;  1X3Q A;  1HCZ A;  3I90 A;  3NUC A;  1TWF B;  3S9W A;  4TRD A;  5EBD A;  1O7L A;  1GHK A;  3JAM E;  4RA8 A;  3HKZ B;  4BY7 B;  1SXT A;  2F0V A;  3H0G B;  3WDN A;  1SE3 A;  3AB9 A;  1LLR D;  3DWQ A;  1BXT A;  4J6H A;  1SYF A;  4FXD A;  1IKL A;  3MC0 B;  3U9O A;  3K5N A;  4IUN A;  2NBF A;  2K01 A;  3GTM B;  1R4Q B;  2L12 A;  3LNN A;  1I6H B;  3J80 E;  2WB1 B;  3KLS A;  1HQM C;  2ID0 A;  4ZQ3 A;  1WTR A;  2PZU A;  4OL7 A;  2D2C C;  3S1R B;  2NVQ B;  4A3E B;  1UNS A;  1B50 A;  1U4P A;  4CGY B;  4HMI A;  5KNC A;  5FOB B;  1A15 A;  1IKM A;  1EOT A;  1KTK A;  3MHB A;  1QWY A;  3EVQ A;  1STB A;  2B2Y A;  4QMG A;  2LY7 A;  1H9K A;  2GA4 B;  1PDQ A;  1LTB D;  1QCB D;  3ND9 A;  4MIU A;  2FJ2 A;  4I65 A;  4KD3 A;  2PYK A;  1PTO B;  3T16 A;  4ZKC B;  3SEB A;  3H3V C;  1EZ8 A;  1KNA A;  3E5S A;  4ZK9 B;  3QO2 A;  1KAB A;  3DXJ C;  2RA4 A;  5KNB A;  4M8A A;  3TP8 A;  4WOR A;  1HQR D;  2PZT A;  4RWS C;  3GTO B;  2XWB B;  1OXT A;  1QJO A;  4ID6 A;  4QUC A;  5K5P A;  1ZYR D;  2K7V A;  2H4O A;  4RHR A;  2NTT A;  5C4Z A;  3VR6 A;  3P75 A;  5EPL A;  3HOX B;  2B2T A;  4NKL A;  2A74 C;  4C3J G;  3DM1 A;  4XTC S;  1QNK A;  2JA8 B;  1EYA A;  3Q24 A;  4A93 B;  4FF3 A;  2EYF A;  1DZ1 A;  4RFB A;  1SE4 A;  1AZP A;  1L0X B;  4XT3 B;  2F0J A;  4KY7 A;  5LL6 S;  4EGV A;  2EJF C;  2WKC A;  1STN A;  5M5W B;  1VCI A;  2EYO A;  2F0T A;  3VYT A;  4DGZ A;  1YNJ C;  2D62 A;  4DU9 A;  1H9S B;  5EPK A;  4LMQ D;  2MHV A;  3K59 A;  2F0F A;  1R4P B;  1S5B D;  3CQZ B;  5ELE A;  1IW7 D;  1M8A A;  1TKW B;  3DEP A;  3D4R A;  1TWA B;  1ESR A;  3Q6S A;  2K32 A;  3Q22 A;  2YYZ A;  3ITP A;  3PUX A;  3M3Y B;  1RDP D;  4RAU C;  4PV1 C;  4BWG B;  4O42 A;  1FGB D;  1S5C D;  2ENB A;  3L9A X;  4KJO A;  1GUG A;  2JEA I;  3NSW A;  4CJ2 C;  4A3B B;  1I4R A;  3BVG A;  1A6X A;  3IKJ A;  4RKL A;  2K6A A;  5JVH 3;  2EXZ A;  2L0C A;  2K05 A;  2MGS A;  1F2M A;  2VB3 X;  1QE6 A;  3SK4 A;  4DAY A;  1O7Y A;  2WAC A;  1WTX A;  3LWE A;  2B8F A;  3J81 E;  3T53 B;  5TSS A;  4IUR A;  1K8M A;  5FKA C;  5CMD A;  2G9H D;  3D6C A;  3H09 A;  4KMU C;  1D1K A;  1JOO A;  2EJM A;  2LS0 1;  4ULL A;  1SYG A;  4C3H B;  2OEO A;  1EFI D;  4FXK C;  4TSS A;  2WP8 J;  1YNN C;  2AQ1 B;  4HCS A;  1B1Z A;  5C0X J;  3NHH A;  3KK7 A;  1GUT A;  5M3F B;  5K36 G;  5COR A;  1KAA A;  4IZ8 A;  1PTO C;  4V19 0;  1U4L A;  2N55 A;  1G2T A;  5NUC A;  4KD4 A;  2WII B;  5CBE E;  3UI2 A;  1W6K A;  1FNW A;  1F77 A;  1HFN A;  3M4Y A;  5KND A;  4IFD H;  3SVM A;  2PNR C;  1JQY D;  3L3O C;  3CRL C;  2L5T A;  3G6J B;  3BDC A;  2E2I B;  1NAP A;  2BDN A;  2X6L A;  3S1Q B;  1Z7T A;  3KBX A;  1MGS A;  1VF5 C;  5JEA J;  1CZG A;  5I2Y A;  4DAP A;  3HOY B;  4QB4 A;  3VR3 A;  4H0L C;  5KYL A;  3GTG B;  2XWJ B;  3HOZ B;  1PZJ D;  3MWY W;  3C46 A;  2PO4 A;  1B2T A;  4S3S A;  3SK8 A;  2RQX A;  1OXU A;  2K5Q A;  2AUK A;  2OF1 A;  5G3L D;  3J7Y W;  2R92 B;  1TR5 A;  4K5X A;  1DJR D;  1LTR D;  3P1H A;  5BN5 A;  4IN3 A;  1AN8 A;  1GJX A;  1I4X A;  2K04 A;  4E6I A;  4UDU C;  2BOS A;  3E6Z X;  2B2U A;  3D3R A;  4KHZ A;  2A69 D;  4XQN A;  5HUR A;  3OPO A;  4K5W A;  2NVY B;  2JP1 A;  3Q0A A;  5IGF A;  1KLU D;  3GP7 A;  4ZUI A;  4OO1 H;  5C3W A;  1ROD A;  1GUS A;  1B9N A;  1K83 B;  3H94 A;  1G2S A;  2M9V A;  3J80 L;  1STG A;  2A68 D;  3VR5 A;  4HSV A;  4XDX A;  1LT6 D;  3HGB A;  2EVB A;  2AQ3 B;  4ABN A;  5FLX L;  4G4K A;  3D4D A;  3S16 B;  4H13 C;  2TSS A;  3EFX D;  3NQI A;  4KY6 A;  1TWG B;  3FPU B;  3NWS A;  1KDB A;  1TS4 A;  1EY8 A;  3NTI A;  1DOK A;  1LAB A;  1XXG A;  2XVS A;  2QEJ C;  2DY8 A;  4CKE A;  4B9W A;  4IAL A;  3BYY B;  5D14 A;  2J7Z A;  3X3N A;  3HOW B;  2A6H C;  2AWO A;  5KGU A;  4CJ1 B;  1EYC A;  4HAE A;  5A35 A;  2VB2 X;  2JA6 B;  1JB3 A;  2R61 A;  3HOV B;  4MHE A;  4KTA A;  3IFD A;  1S5E D;  1STH A;  2JE6 I;  4K8I A;  1MSG A;  1IL8 A;  4KKT A;  1D1I A;  3I4N B;  3MZ5 A;  2E75 C;  2Q8I B;  1LTI D;  4YIJ A;  3K7A B;  1PYW D;  4NP5 A;  1TY2 A;  1A3T A;  4OGQ C;  2PZW A;  1CFM A;  1UEA B;  2DN8 A;  3GD7 A;  2L4N A;  1EIH A;  1H9R A;  3T51 B;  5JPM C;  1SNM A;  2XNA C;  1SAP A;  2A6E D;  4OIJ A;  4K2K A;  4FNF A;  3I8Z A;  1Z6H A;  2Z8L A;  4UAI A;  3L7Z C;  1I4G A;  1HUM A;  2IWH A;  2R7Z B;  2K5D A;  3PUW A;  5EKK A;  2EYP A;  2EY5 A;  3NK9 A;  1A3V A;  3KLS X;  4CJ0 B;  1AEX A;  3QOJ A;  1VMC A;  2BA1 A;  2KA7 A;  2FIN B;  1UUP A;  4A3F B;  2DNE A;  5COY A;  2LFN A;  4O1N A;  3J7A F;  1PRT F;  5KIX A;  2R3Z A;  1SMY D;  2EY6 A;  2XIW A;  1F9P A;  1TWC B;  4HN7 A;  2NN6 H;  3MXU A;  1Z47 A;  3HZX A;  3S1M B;  4WRD A;  1WVL A;  5T1G A;  1GHJ A;  1FD7 D;  2CQA A;  3R3O A;  3DWP A;  3GTK B;  2O2L D;  3D8G A;  5C4X B;  2F0K A;  2NB0 A;  5IIF A;  3J81 L;  3I91 A;  5IGB A;  1EY6 A;  1ONL A;  1H9J A;  1Q1E A;  2VNU D;  1KDC A;  1CA5 A;  2R6G A;  2HDM A;  2K03 A;  1LTS D;  3NP8 A;  5KEE A;  3CU7 A;  4ZRZ A;  1CZW A;  3PIO 3;  1HA6 A;  1I4P A;  3A55 A;  2V4D A;  3EA6 A;  1ICW A;  4EQP A;  3RZD B;  1ZYR C;  1H9M A;  5C0X H;  4FYD A;  2KVM A;  1TQO A;  4QCL A;  4EQN A;  1OXX K;  2CVR A;  2B2W C;  2OT2 A;  4K8J A;  5E3F A;  4ZLT F;  4F88 A;  2N88 A;  5FO7 B;  3PIP 3;  4IUQ A;  1F2Z A;  5JOB A;  2EDG A;  3OMG A;  1PRT D;  1D5X C;  4IUP A;  2ZT9 C;  2D9U A;  3HRZ C;  3VR2 A;  2JA5 B;  4RGT A;  5I9P A;  3PO2 B;  2NZ1 D;  3PUZ A;  2F4I A;  3S1N B;  4C3H G;  1SBB B;  3DUZ A;  1BBX C;  1ILP A;  4V0B A;  2MP1 A;  5IGG A;  1SYD A;  1RTN A;  3BZD B;  4Y7N B;  4L63 B;  1SJE D;  2JXM B;  2K1B A;  4WFN 3;  3O13 A;  1V1O A;  2AUJ D;  4FP5 D;  1STY A;  5JEA H;  1Y8P B;  2K28 A;  1AP0 A;  2F0O A;  3M85 A;  2FHT A;  4JK1 C;  1JIC A;  1WTP A;  1TVX A;  1NR4 A;  1IW7 C;  3W3A A;  1SNQ A;  1XX8 A;  5A2Q E;  3GV6 A;  1TII D;  1DOM A;  4BA1 I;  1OXS C;  1X3P A;  1HXY D;  3NTK A;  2M2L A;  3EQL C;  4ZKB B;  3SXH A;  1EY0 A;  1EQV A;  1F9S A;  3RLF A;  1M4V A;  2XSC A;  1HRJ A;  3RUZ A;  1ZKO A;  4P2C B;  1IYV A;  1BR9 A;  2KEC A;  1E2V A;  3FVQ A;  5IT9 E;  5DEH A;  1EY9 A;  4PMW A;  2EY2 A;  1L0Y B;  3OIP A;  3OSO A;  2EYH A;  2EYM A;  3VA7 A;  3A56 A;  4A3M B;  2B63 B;  1ENC A;  5EKL A;  1BF4 A;  5KYI A;  4B9X A;  1ILQ A;  4MN3 A;  2KOL A;  1F9Q A;  2B2V C;  3MVV A;  2JYO A;  4DK1 A;  1SND A;  1EY5 A;  5CV7 A;  2L9H A;  1EL0 A;  1TS2 A;  5E1F A;  4HTH A;  4F87 A;  3WOE A;  4KI0 A;  2NTS A;  3HEJ A;  2O5J C;  5JVG 3;  1RCV D;  4A3J B;  3NE5 B;  1O80 A;  5C5L A;  3IAY A;  3TSS A;  4HR7 B;  1EEI D;  4U68 A;  3RMH A;  1RJT A;  5J39 A;  5G3L F;  1JCK B;  4ZAI A;  1JWM D;  3ERQ A;  4K14 A;  2F0M A;  4C3I G;  2Q8T A;  2XN9 C;  1HTP A;  1PLF A;  1G6Z A;  3FMC A;  3R93 A;  1EY7 A;  2AWN A;  5FO8 B;  3R2I A;  5C5M A;  3SR1 A;  3I4L A;  2CHB D;  5C3X A;  3I70 A;  4DNT B;  1JOK A;  2RSO A;  4KJN A;  4M1U B;  5EKI A;  4FF4 A;  4ZYS A;  4KHV A;  1EZ6 A;  1CQF A;  2EPB A;  3CRK C;  1Y1V B;  2PW7 A;  1UAP A;  3FKI B;  4DAV A;  3BVM A;  1CQV A;  1F2Y A;  1S4Z A;  1LO5 D;  3I73 A;  2J4X A;  2FMC A;  2BE5 C;  4IFD I;  3PO3 B;  3BG3 A;  1PMR A;  4A3G B;  2IX3 A;  4BS9 A;  2CW0 D;  5ELF A;  4XYO A;  1G91 A;  1CHP D;  2PMZ B;  5CV5 A;  1A2U A;  1ET9 A;  5J22 A;  3MEH A;  3MTS A;  3RD4 A;  1WTO A;  2A69 C;  2WV6 D;  2I46 A;  3NBI A;  1ENF A;  4R8I A;  2HQE A;  3OIQ A;  3WOF A;  1DON A;  3HOU B;  1BDO A;  3HS0 C;  3JAM L;  2M00 A;  2BA0 A;  4J8Q A;  2A68 C;  5C3E B;  1EU4 A;  1RF2 D;  2E76 C;  2F0H A;  4ZUJ A;  3K0Y A;  3ZYY X;  3MXG A;  3DWA A;  1F2L A;  1C4Q A;  1WD0 A;  1KLG D;  5BN4 A;  2SDF A;  1BCP F;  4Z9C B;  1EWC A;  4FXG C;  1SYB A;  1CHQ D;  5EPJ A;  3SDZ A;  4CHT B;  2EYJ A;  4RCN A;  2KCC A;  1SNC A;  1FYC A;  1K8O A;  4OO1 I;  5DNF A;  4A3D B;  1AW7 A;  2PCF B;  3K6O A;  1GUN A;  3HG9 A;  3T56 B;  1X32 A;  2PW5 A;  3MFG A;  4IQZ A;  4FF2 A;  1Q12 A;  1U9R A;  4L6T B;  2VXW A;  1S5F D;  1U4M A;  4K6L A;  2B2Y C;  2IT1 A;  2RDF A;  1GUO A;  1PRT B;  3FRP B;  2JSO A;  4J1M A;  5CC4 A;  1Y69 U;  2ZXP A;  4NMZ A;  4G7H C;  2NWG A;  2IL8 A;  1Y1W B;  2A73 B;  4C56 C;  4DXG A;  2KJX A;  4G57 A;  1STA A;  4X3U A;  4Q5V A;  3NBH A;  4OHJ A;  4BBR B;  2RKS A;  1BO0 A;  4X3T A;  1A2T A;  3GTP B;  4IUV A;  4JBW A;  3TN2 A;  5LL6 X;  3OMC A;  1B44 D;  1TU2 B;  1Q8I A;  3NPP A;  2LKV A;  4IUT A;  3PV0 A;  1KDA A;  1BCP D;  3OWE B;  5EJW A;  2B2T C;  2A6E C;  1J8I A;  4CBV A;  1GUW A;  1B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...