1WD1A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*AP*CP*GP*TP*AP*GP*G)-3'
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd1A00
5E4XA 4X3TA 1DOMA 1NCVA 3SVMA 1JICA 1MI2A 2KEEA 3N52A 2X6GA 2KOLA 3F2UA 1ESRA 5EJWA 4R8IA 3G7LA 4IUUA 2X6LA 1J9OA 4QUCA 2K1BA 1SAPA 1U4MA 2L1BA 1WTRA 2K28A 2XIWA 2VXWA 2FHTA 1IKLA 1XX8A 4MN3A 2NWGA 1U4RA 5DNFA 5CMDA 2CVRA 1PFMA 3DEPA 1J8IA 2RSOA 1M8AA 1EIGA 1AZPA 1ILPA 2Q8TA 1WVLA 1B53A 1PFBA 2B2UC 3IL8A 4CJ0B 2B2YC 4ZK9B 2K05A 1S4ZA 1RTOA 2MPMA 2RVLA 1EL0A 1BBXC 1EIHA 2K03A 4ZLTF 1G6ZA 3Q6SA 1MSGA 5CBEE 4QUFA 1NR4A 2MJ8A 1WTXA 2IL8A 1X32A 1RJTA 1DZ1A 1BO0A 1DOLA 2B2TA 2EE1A 3FDTA 4HCSA 4IUQA 1G91A 1GUWA 2MGSA 1B3AA 3GV6A 4OIKA 5AFWA 5CBAE 3LWEA 2BDNA 2FJ2A 4X3UA 4DN4M 5EPJA 3TN2A 5EKIA 4NW2A 1F9PA 4RA8A 1A15A 1HHVA 2N55A 2L4NA 1F9QA 1NR2A 1TVXA 3DEOA 1BF4A 1WTVA 5CORA 1HFNA 1F9RA 2D9UA 1O7YA 3I91A 1CM9A 1X3PA 2KVMA 1F9SA 3UI2A 2JYOA 3DM1A 1C8CA 2RSNA 1DOKA 1KNAA 5D65A 1U4LA 5T1GA 1LV9A 1O7ZA 1ZXTA 2M2LA 4O42A 1U4PA 1PDQA 2B2VA 3MTSA 3QO2A 1B50A 3H91A 1MSHA 4OIJA 4HEDA 5JJZA 2HDMA 1HUNA 5COYA 2B2WA 2L11A 3GV3A 2K01A 2K04A 5EPKA 1RHPA 3P7JA 4IUPA 2JP1A 3KUPA 1WTWA 3I8ZA 2RA4A 4UAIA 4X3SA 2N88A 3KBXA 1CA5A 1VMCA 1MGSA 3FPUB 1RODA 2HUGA 1F2LA 1HA6A 1WTOA 1VMPA 2KEDA 2NZ1D 1KNEA 1HUMA 2KUMA 4ZKCB 4CJ2C 2FMMA 1WD0A 5T1IA 5E4WC 2Q8RE 1ICWA 2HCCA 3I3CA 1IL8A 2B2UA 1WD1A 1NAPA 2B2WC 1PFNA 4IUVA 1E0BA 2B2YA 3ONAB 4ZAIA 2B2TC 1WTPA 1AP0A 2NYZD 3HP3A 1B2TA 3I90A 1Q3LA 4U68A 1QG7A 2DY8A 2EOTA 4R9WA 1HRJA 2L9HA 1G2TA 1JE4A 1B4OA 1XYIA 1X3QA 5EPLA 1QE6A 1HFGA 1DONA 2H1EA 1WTQA 4HAEA 4RAUC 3TZDA 4X3KA 1RTNA 3R93A 4MHEA 2SDFA 2MP1A 1SDFA 3IFDA 1PLFA 1BNZA 4IURA 2HCIA 2X69A 2FFKB 1QNKA 5EQ0A 4CJ1B 2L12A 4ZKBB 1ML0D 2FINB 1O80A 4LMQD 4IUTA 5D14A 4RWSC 4XT1B 1SSOA 1AZQA 4XT3B 2HDLA 2B2VC 4XDXA 2EPBA 1EQTA 1G2SA 1ILQA 2DY7A 1EOTA 2KECA 3D6WA 3MWYW 2J7ZA 4HSVA 1CA6A 1IKMA 2R3ZA
chains in the Genus database with same CATH superfamily
4XQNA 4KJNA 2KQ3A 2X6GA 1UEAB 1J9OA 1TIID 3NUCA 2G9DA 3GTQB 2FHTA 2F0FA 3PV0A 1ZEQX 5EKKA 4DGZA 3D3RA 4JI7L 5FLXL 4O0AA 5IWAL 1GUSA 4DR6L 3D4DA 1N33Q 4NXML 3TBIB 2TSSA 4A3KH 5IGDA 2LS01 1GO3E 3NBHB 4XXEA 4DV0Q 5HY6A 2CHBD 1DCZA 1WCMH 4G7ZC 4FF4A 1MHWC 2AWNA 3RZOB 4GLVB 2HD3A 3EA6A 3PCOB 2BDNA 2B8GA 4X3UA 2VQFL 2GA4B 2EZVA 1LO5D 2JJQA 2KCMA 3A5UA 4ABNA 2OTLA 1KRSA 1AE3A 1I4QA 1A3VA 4A3LH 1CKNB 2EIFA 1SEBD 3D4WA 2CH4A 2Z6KC 2E2IH 1IBKQ 5CV8A 2M2LA 1U4PA 4KN4C 3D31A 2K32A 4QMGA 2SNSA 2K04A 3DUZA 2O2LD 1Q82C 1O78A 4F8MA 1LTSD 2F0WA 2ZXRA 2WKDA 4ME5A 1STAA 5I2XA 2IHEA 4C3HG 3OW2A 1F2LA 4N8FA 1LLRD 4FF3A 4OWXB 5C4XB 3U58A 4X64L 1EFID 1XMQL 1ESFA 2DNCA 4DAPA 1E0BA 3TZUA 1S5DD 4UP9A 2L9HA 5CC4A 1JE4A 3PO2H 3J81E 2F52A 1E24A 1L1OB 4B9XA 1HNZL 2F0QA 1TWFH 3R93A 4EQNA 2MP1A 1XPUA 2FFKB 2XRQD 2PQAA 3RUZA 2VL6A 3HOWG 1LACA 4B3TL 4DR2Q 3PIO3 1EQTA 4A3EH 1Z9FA 1Q1EA 3QWNA 3EROA 4A3BB 2I5LX 4PMBA 3HOVG 4KHPQ 4IFDG 1BCPC 1SNCA 3QR8A 2PCFB 3SEBA 2E74C 4OWTB 4UP7A 3K58A 4H0LC 4MN3A 3KF6A 1PRTD 2NUCA 2ZJRA 5LHY1 2PZUA 3HOYG 2Q8TA 1A8VA 3H15A 1LABA 2K5NA 1GD7A 1QVGA 1B53A 3M9BA 1XTCD 1Q12A 2QF7A 3GTKH 5DEHA 3NENA 3PUYA 4EQ5A 3K57A 1EL0A 1EY0A 2Q2HA 1KD1C 4EGVA 4K14A 3CW2C 2F0LA 1HR0W 2L5TA 1GXDC 3JC66 4N9PA 3J7AV 4A75A 3J81i 5M3FH 5CV7A 3K5LA 4OWWB 2EJGC 1S40A 3U9SA 2ICEC 2JXMB 5FK9C 3J81c 1JWMD 1O7YA 2RSNA 5BN4A 4DV2L 4QB4A 3I4MH 2F4VL 4LK1C 4ZUIA 4IOAA 1PDQA 1Q46A 4PNYA 3CF5A 1EZ6A 4EVOA 1B44D 1SJHD 3SDZA 4DF7A 1KDCA 2EY5A 4LF5Q 3CAMA 2JN4A 2N78A 5C3XA 1CQFA 2OXPA 3A7AB 3GTJB 3QJYA 4TVAB 5ELFA 4FXDA 2Q2IA 2VUMH 1QB5D 1NJIC 3BYTB 2CCZA 5E4WC 1KXLA 2WKCA 2QW7A 3NXWA 1ENAA 1V1PA 4UY8C 1JJGA 2Y0SB 1KLGD 3ONAB 2EQSA 2B2TC 4PZ6A 4ILWA 3U4ZA 4C3JB 4RCOA 3QIAA 4KJOA 1ICFB 2C35B 2Z1CA 1HFGA 1SN8A 1EYAA 2D62A 3GO5A 4ZCKA 4RAUC 3S2DH 4CHTB 3J7ZC 3GTOH 1Y1WH 1PLFA 1YNND 2J4XA 1E2WA 1QCBD 2G9HD 2HDLA 2O5IC 4A3CH 1CA6A 2B63B 2J7ZA 1QZGA 1ET9A 1MI2A 3CCQA 4L5RC 1UE1A 1TWAH 4O1NA 4JI4Q 2L1BA 2K28A 1QUQB 3PGZA 5FO9B 1F2ZA 4RFBA 1CKOA 1J8IA 1L1OA 4X62Q 1VQJA 1SJED 4JPBW 2A8VA 2I07B 3PO3B 2B2UC 1EYDA 4KKSA 4CDFC 2B2YC 3C2PA 5J1ZA 2EY1A 1QJOA 4GZYC 4BBSG 4JI1Q 1MSGA 1VQPA 3AYHB 1NR4A 1PZJD 4OEMB 1DZ1A 5JJKA 1DD2A 5CV4A 5FLMG 1BCPB 5M5XH 4K5WA 2HHHQ 3ERQA 2JA7G 1F2YA 3DEOA 5NUCA 2EYHA 4M1UB 1TT2A 5JOBA 4RHRA 4L6TB 2IX0A 2JYOA 5E7NA 3R3OA 3RLNA 1U4LA 1LV9A 1O7ZA 3G4SA 2ZT9C 3Q24A 1SLJA 2KCCA 5DAUA 1VQDA 2NBFA 4FXKC 4GN4B 2HIVA 5C6AA 1BCPF 5EPKA 3I56A 2QDBA 2NTTA 1N33L 4JCVE 5E3FA 1IBMQ 2O5JC 2A5HA 4UAIA 3BS1A 4NP5A 2CFMA 5IYCG 4GLXA 4JK1C 4DV0L 4Y7NB 3ITPA 1R4PB 4ZKCB 3FKIB 5T1IA 4IJHA 1OTCA 2IX1A 1WD1A 3K7AB 3E9HA 4G57A 3I4NH 2BOSA 5C3WA 3HP3A 3J80E 1B2TA 1PH4A 3A56A 3K5MA 2HIXA 1QVCA 1NE3A 2F03A 1QE6A 2YTVA 1PYSB 1WTQA 2K5HA 4K8IA 2WB1B 1CKMA 4QY7A 1K3BC 4EX5A 1FR3A 3CCLA 1IBKL 5EQ0A 4YCVA 5KNCA 2UUCQ 2AQ2B 1JE5A 5IGGA 4XT1B 4CDDC 1LYLA 1Z47A 3HKZB 4XDXA 5A35A 1FNWA 3Q22A 2VQEQ 3VR5A 5J22A 2PPBC 2KOLA 1EY8A 2Z6KA 5ELBA 3ND9A 4C56C 3W5OA 1WTRA 4C1NK 5JVG3 2XIWA 2NB0A 5C44G 5C3EH 4HJ5A 1TXYA 2L0CA 3T51B 4B3RQ 4MZ9A 3PIOA 1Y8OB 1QVFA 1AN8A 3LWUA 3PUZA 3H0GH 3VDYA 2JA6G 1K83H 1SFOB 4RGNA 5FOBB 3IL8A 5CR3A 2JA5G 1PH8A 3HOUB 3T1HQ 2MPMA 2F0PA 4ULLA 4GNXC 3S14B 2JEAI 2BH8A 2PW7A 2K5VA 3J80i 4XYOA 3L0OA 3DWAA 4R1JA 3E0EA 1XNRQ 4A3DB 2DUDA 4C2MB 2EE1A 2Z4IA 2UXBQ 5IYDG 2JE6I 3TN2A 1QUQA 1HHVA 3J80c 2QEJC 3HOYH 1CHQD 3A7LA 4KN7C 4DR2L 1UEBA 3I2ZA 2UXDQ 1JOQA 2N49A 3K0XA 1CM9A 3ER0A 2I5MX 3KLSA 2CKZB 4KHPL 4DK0A 2AUJD 2VY3A 2CW0D 3SXHA 1ZXTA 2F4IA 2KHIA 3BG3A 4FNFA 4K0KQ 3QO2A 1B50A 2EDGA 3ND8A 4A3MB 2F0IA 1SMYD 1MKHA 3AQQA 1EY9A 3RN5A 3HOXH 2R61A 1I4GA 4A93B 2RA4A 3KBXA 1G51A 5C5MA 2A6ED 4BY7H 4J1MA 1SE2A 1K0RA 3RLFA 1WD0A 2AWOA 5KYLA 1IW7D 2D2CC 2RF4A 4A3JB 1JR0D 1EU4A 1VS0A 2EJMA 1PFSA 4HTHA 1SR3A 1YI2A 2B29A 1Q8KA 3LNNA 1HRJA 1E2VA 1E1OA 3HG9A 4H44C 3NELA 2H1EA 1CTMA 3HZXA 3BZDB 3L9AX 1V9PA 4MHEA 3IFDA 1KTKA 2BCOA 1W2BA 1OXSC 4DK3C 3LX0A 2B2VC 3T53B 2PQEA 3I4LA 3MWYW 2YTXA 3TQYA 4LF5L 1JQYD 3SVMA 1DOMA 1NCVA 2XRSD 1WCMB 4R8IA 1LTID 1JOKA 2K1BA 4NDXA 1VQLA 5LL6X 3KF8B 4POGA 1C9OA 1VQNA 5M3MG 1EUJA 5CV6A 4NXNQ 2WAQB 3STBC 1K8AC 4B3MQ 3S24A 1GOZA 1PFBA 3GTLB 1RTOA 2LMCB 3MXPA 4BA1I 3TEHB 2E2IB 1ZYRD 1Q86C 1L0WA 4BBRG 1RJTA 4HIDA 2B2TA 1G91A 2OQKA 2NVTH 4A3FH 3K80C 5I4DA 1B3AA 1Q81C 5EKIA 1SYBA 1EY7A 1UNSA 4DNTB 1GHKA 3A8JE 1F9QA 5G3LF 3GTMH 3QOJA 5EBDA 1KAAA 2A6HD 5GAEC 1HNXQ 3STBD 3DM1A 4DV5Q 4IPHA 1I6HH 4JI4L 3GD7A 1CI3M 3MFYA 1SYFA 4HEDA 3W1GA 3F2BA 1G8ZD 1VQCA 3DXJC 4X62L 5COYA 1QOHA 3PF4A 3PO2B 1JMCA 3M85A 1RHPA 4CBVA 2VNUD 5CYUA 3MEHA 3J81L 1EQQA 3ICEA 1TWFB 3OWFA 1EQVA 3CMAA 2R93G 2K7VA 4JI1L 1T5EA 2FMMA 3CC2A 2HQEA 1SBBB 2B2UA 4A3EB 4JI6Q 3X3MA 2B2YA 3EJIA 2M9VA 1LTLA 1VQAA 1QG7A 2DY8A 2HHHL 1NTGA 4OO1I 5CV5A 2ZTCA 1X3QA 5EPLA 3S15H 3K6OA 5M9OA 2Q2TA 3CPFA 5KIXA 3K5OA 4HSPA 4JI5Q 4CJ1B 2VB2X 4UDUC 3W2DA 4IJLA 3CD6A 4C3IH 2FINB 5I6WA 3GTKB 1X56A 4OXPA 4KMUC 4H7BA 4G7HC 2NWGA 4HSVA 3Q23A 2F0HA 3CC4A 4JI0Q 1ESRA 4IPGA 1IBML 4IUUA 4LFBQ 5M3FB 2A68D 1ASZA 1Z7TA 2NVQH 3BZKA 2L15A 1EY4A 4P74A 2EYLA 1RIPA 1M8AA 1PA6A 3CCVA 2VW9A 5IT9c 4FXGC 2Z0SA 4B9WA 2XWBB 2K6AA 2F3IA 3I4MB 5DLQE 2LY7A 3Q6SA 1SE8A 1C4QA 3GTGH 2MJ8A 2JA8G 4U673 2F0JA 3OYYA 2M00A 4AYBB 1EY6A 4HJ7A 2Z6BA 5IP7G 2F1MA 1FJGQ 5EPJA 5IYBG 5C0XJ 2UUCL 4FF1A 1BQQT 5C0XH 5ELCA 1TVXA 1BF4A 2VQEL 3QB3A 2MO0A 5CORA 3MXNA 2VUMB 1F9RA 3NTKA 1F9SA 3E5SA 3TP5A 1PVOA 3I7FA 3MFGA 1HTPA 2FMCA 5C0XI 5C4JH 3CPWA 1RKNA 4JYAQ 1Y1VH 3VYRA 2K4KA 3MTSA 4B3RL 1F2MA 2NN6H 1VQHA 2CH4W 3CU7A 3UE0A 3I8ZA 4TSSA 3T1HL 2NN6I 1JB7A 3S2DB 3H6MA 3GTOB 1Y1WB 4LFCQ 3J7A5 4N9TA 3MZ5A 5EBCA 1STEA 1VMPA 1WTOA 1HA6A 1KNEA 1HUMA 1EFWA 1YJNA 1XNRL 5JJIA 2B2WC 2ENBA 5GROA 2HT1A 4DV4Q 4GNXA 2UXBL 1A63A 5LMUQ 1HR0L 1TWGH 4A3IG 1MIUA 4G7OC 1H9SB 3WOEA 3CHBD 3C46A 2UXDL 4GOPC 1VQ5A 4RGOS 3NTIA 2ID0A 3TZDA 2F0GA 4GLAC 2SDFA 2QCPX 1RDPD 1W6KA 2NVXH 1B3QA 5IE8A 4K0KL 4QF4A 4TRDA 2K5WA 1TU2B 3TSSA 1QWYA 3CC7A 3UDGA 1E7ZA 1VF5C 3IAYA 1EEID 2A69C 1FD7D 4B08A 4CKCA 4NKLA 2R92H 4V190 3K59A 1MD2D 1PTOH 2KHSA 5LMNW 1B9MA 1ONLA 5M5XB 1N8RC 3DEPA 4CGYB 5BR8Q 3NPPA 4RKBA 2AKWB 1RD9D 3FP9A 3CRKC 3OMGA 1JORA 4RGTA 3RZDH 2EVBA 1HCZA 4PQXA 4ZYSA 3T1YL 1BBXC 4OONA 4ZLTF 4RG1A 1AFPA 1PH3A 1WTXA 4CKBA 2A69D 2FJ2A 1FGUA 1TR5A 1YNXA 5IOCA 3TP7A 3M3YH 4HN7A 1VQMA 1VQGA 3E0JA 1NR2A 3BVMA 3C1FA 2Q8IB 1PH2A 4IALA 1D8LA 4JOIC 4IPDA 4DAYB 3I73A 2Y0SG 3W1BA 3VA5A 1B8AA 4C3JG 4O42A 3HOZH 3I4NB 4BBRH 1VF7A 2B2VA 4OIJA 2OEOA 1PYWD 3J80L 2RDHA 4PV1C 4NXNL 1LT3D 4AIMA 3WOFA 3D4RA 1BCPD 4B3ML 1R4QB 5KYIA 4P72A 4A76A 2BH2A 1KABA 1MBYA 3C1EA 3V05A 1JWSD 2NZ1D 4DXFA 2NZHA 2WINB 1DGSA 1GVPA 2Q8RE 1DXMA 2Q2UA 1A62A 1S3OA 3RMHA 2B63G 4K2LA 5HURA 1WTPA 1EWIA 4Z9CB 1TWHH 3NBHA 2UUBQ 1N32Q 2D5DA 3IFTA 4R9WA 1YEZA 4XYQA 5I9OA 1I4XA 2PNRC 3TS2A 4HAEA 4ZQ3A 5C3EB 1SRUA 1HNXL 4DV5L 1LTBD 3AFQA 3H0GB 4KD3A 1BNZA 3PO3G 2PW5A 2UU9Q 2SOBA 1STNA 4F7XA 5D14A 2B3GA 1LUZA 4YIJA 1CKNA 3K8AA 3E6ZX 1ASYA 4JBJA 1EOTA 5JEAG 1VDZA 4TQUS 1KHIA 4I7ZC 5IGEA 3PIP3 2LKVA 3G7LA 3R8BA 1TWCH 1XX8A 2KCNA 1LTGD 1GUGA 4H13C 1IYJB 1PFMA 4GOPB 4FP5D 3HOYB 1IHZA 1XMOQ 4DUZQ 4KKTA 5KNBA 1S4ZA 4IZ8A 1EIHA 1J6QA 2MFIA 1GUOA 1PHJA 4YWLA 3VYTA 4AQYQ 1B1ZA 1A3TA 4JI5L 4KKUA 1YITA 1R9TH 4X6AH 3GV6A 3HOXB 3LWEA 4TKOB 1Q8IA 2F0MA 1HZ9A 2L4NA 3TP6A 1EEFD 4A3GH 2D0OA 4BY7B 3CCMA 4DR3Q 2D9UA 3RLOA 3ULPA 4JI0L 3BVGA 2R7ZH 4LFBL 1JB3A 2I5HA 2PZTA 3EBEA 4UP8A 4HCEA 2JA8H 1XWEA 3DWQA 4KY7A 2ZJPA 3I72A 3CQZH 2ATWA 4KHZA 4BY1G 5IYBH 3P7JA 2WB1G 4IUPA 3CCUA 1SMXA 1I94Q 3GDEA 3OHXC 2N88A 5I6YA 1RODA 1KDAA 2LXKA 3EIVA 1PH7A 1STBA 1PV4A 3VR2A 4DFAA 3HKZG 1ET6A 3PUWA 4WJ3M 3RD4A 1EQRA 2D0PA 1FJGL 4LF4Q 3DHQA 3JAME 1X3EA 5HGTA 2CQAA 1Y8NB 1V1OA 1Q1BA 5JPNC 1I50H 3URYA 3NWTA 4X3KA 4DK6C 4O2DA 1OXTA 3ZYYX 2IPKD 4IURA 2HCIA 4NPSA 5IGCA 1YJWA 5JPMC 4JYAL 3HOUG 4RWSC 2N8NA 1BKBA 2NZOA 3BDLA 3CCSA 3S1MH 4OO1G 3HEJA 2KBNA 2DY7A 3S2HH 2RHSB 1M1KC 4A3IH 1YIJA 5EJWA 4A3DG 1HNWQ 3OTOQ 2NVTB 4A3FB 2IY5B 1SAPA 4LFCL 2G5DA 1C0AA 3VYUA 1D1IA 2DGYA 1NBWA 5IODA 3L7ZC 4X66Q 1X3FA 2AQ1B 1JOOA 2EY2A 3HKSA 4C3HH 3H3VH 3GTMB 3K7UC 1CZWA 1SYEA 5LMNQ 4DV4L 4ZK9B 4XQJA 1NNXA 4K5VA 5LMUL 1FGBD 5K36G 3H3VI 1I6HB 2JQOA 2ZXPA 4DAMA 2E5LQ 5E1FA 1YZ6A 5CBEE 3JAMi 3QOLA 4A3MG 4P71A 1DOLA 1GJXA 4BXXG 4L5QA 4DKAC 1OO9B 5IT9L 1KRTA 3ULJA 3FMCA 1W3SA 4DN4M 4NW2A 1F9PA 1BDOA 4A93G 1VQBA 5FKAC 5A2QE 3I70A 3JAMc 2TMPA 5G3LD 3KFUA 1KC8C 1FYCA 1I6VC 2IW3A 4P2CB 1EOVA 3UI2A 3HOWH 1CT1D 4WRDA 1DOKA 1VQFA 3K81C 1XTDA 2B8FA 4DR6Q 4A3JG 2GN5A 5IGBA 4IFDJ 4KV6A 1SYGA 1BOSA 1PTOC 3H91A 1MSHA 3HOVH 4IFDH 2HDMA 2F0VA 3TP8A 5BR8L 3S15B 1JJCB 3C3LA 1UE7A 2JSOA 4R4QA 5J3BA 5BN3A 3KUPA 4IFDI 3DWPA 3SK8A 1WTWA 2I0QA 4OX9Q 4GN3B 2BE5C 1YHBA 1CA5A 1H9RA 4DU9A 5I2YA 4LNQA 1UAPA 4C3IB 5M5YH 3KJOA 4HJAA 1ICWA 2HCCA 4JV5Q 1PFNA 4ZAIA 4C3JH 1Y14B 3NP8A 4S3SA 4FDBA 1WCMG 1EY5A 1NMGA 2NVQB 3L3OC 1RTNA 5C5LA 4I7AA 3KDFB 2Y0SE 1SDFA 2WAQG 4KY5A 2H5XA 1XPRA 4DR5Q 1DM0B 4JI2Q 1V1QA 4PG3A 1AZQA 1E1TA 1PH5A 1K8OA 2QILA 4WORA 3I55A 4L5SA 4JOIA 1EZ8A 2RDFA 3A55A 3NBIA 4JBWA 4X64Q 3GTGB 3F2UA 4QUCA 1CZGA 3MAQA 3P20A 2E2JH 2V4DA 5IP9G 3HRZC 4DNIA 1TY2A 1BXTA 2ICIA 3T16A 1HZCA 3PIPA 1HZBA 1BUVT 2K05A 2UUBL 3IRBA 3X3NA 2RVLA 1N32L 4RGMA 4A3KB 5M5WH 5C4JB 5ELDA 2K5QA 1CSPA 1Y1VB 4QJFA 4QUFA 1K9MC 2E2HH 4H02A 1VQOA 1X32A 1I3QH 3EN2A 3KLSX 3PO2G 2EYFA 2RHQB 2XTIA 2UU9L 3A8IE 4CKEA 2CQOA 4OHJA 1WI5A 2N55A 4KY6A 5IY0A 3MEFA 3MXUA 1X54A 1YNJC 4IO9A 4GKJQ 4YY3Q 1HQRD 2E76C 3E3XA 1CK1A 2KVMA 3NSWA 3F8TA 5DM73 3LGJA 1WYDA 4A3EG 1ZKOA 2QEXA 4JVZA 4ZRZA 4F87A 1G291 3T4AC 3VR3A 2L11A 4Q0FA 1XMOL 4DUZL 2EYJA 2ZJQA 5C4HA 3NEMA 4HMJA 4RHSA 4HIMA 1VMCA 3S17H 1GM5A 3DM3A 2NVXB 2KEDA 4LUVA 4HR7B 1MJEA 1UE6A 5EKLA 2LSSA 2RQXA 1TQOA 3P75A 3I3CA 2MQHA 4AQYL 3K7AH 1X3GA 4BBSH 1FL0A 3NWSA 3OIQA 2WFWA 4DV2Q 3M4OH 4APVA 1MJCA 1VQ4A 2R92B 5FLMH 2QA4A 5LL6S 1PTOB 5M3FG 1GUNA 2E2DC 3SK6A 3AB9A 4BY1H 3R2TA 3F2CA 4DR3L 3K5NA 2JA7H 1CUKA 4XTCS 4GKKQ 5JVH3 3AFPA 3BVZA 1ML0D 3H94A 3RZDB 4FO2A 3I4MG 2OF1A 3M4QA 2KECA 4AH6A 1Y69U 1AH9A 2WB1E 4X3TA 1HQMC 2ZTDA 1AW7A 1I94L 2X6LA 4DR1Q 1N36Q 4AYBG 3NQTA 5EAYA 1PTOF 4MTNA 3BYYB 5CMDA 3M3YB 3HKZE 2SEBD 4LF7Q 1KDBA 5IYCH 1TS2A 3TRZA 1SYDA 4LF4L 2WIIB 1VQ9A 3G48A 3WDNA 4NB3A 3HOZB 3EFXD 3BDCA 4UHVA 2IL8A 4DV3Q 3IKJA 4DUYQ 2MGSA 4OIKA 2NVYH 5C4ZA 1OXVA 1STGA 1Y8PB 2F3VA 4P75A 4RH6A 3PQIA 2PQAB 1EWCA 2PO4A 5CGKA 1H9MA 1Y1WG 3ERSX 1S5ED 1WTVA 3I91A 1C8CA 1XNQQ 2ZM6Q 3CMEA 4K6LA 4G4KA 4QCLA 2F0KA 4OELB 1HNWL 3OTOL 3MA2B 3PF5A 4LF8Q 4A3MH 2OT2A 1LT5D 1TWHB 4X65Q 3J7YW 4X66L 1KLUD 2F0SA 3Q8DA 4BXXH 4J6HA 3KF6B 2F0UA 5C44H 5LMNL 1QZHA 2JP1A 2R7DA 3KF8A 3H3VC 3NHHA 4RKLA 2K14A 2JA6H 2E5LL 5KNDA 1HZAA 1IL2A 1D6EC 4CJ2C 2JA5H 2Z8LA 1HJPA 5C4XG 5FO8B 1K28A 4KHVA 3S16H 5D3IB 1TS3A 2NYZD 4DK1A 3K0YA 1IYVA 1OXXK 1LT4D 1NMFA 2IHFA 2PI2A 1T9HA 1TWCB 5IYDH 4CDEC 4LF9Q 3KOJA 5F2DA 1K8MA 5AJ3Q 3UDXA 2OWOA 2HQLA 1B7YB 2BDOA 1YHAA 2UXCQ 1U5KA 4LMQD 4IUTA 4DV6Q 3VR4A 1SSOA 4LJZC 1RCVD 2EPBA 1ILQA 1CQVA 2UUAQ 1W6JA 4LWCA 1JICA 4A3BG 4OX9L 5FO7B 2XGTA 5ISRA 1R9TB 1M90C 1U4MA 1H9KA 1TWAB 4DAVA 4L5TA 3L2PA 1AE2A 2AHOB 3E9IA 2RSOA 4A4IA 4PZ7A 3NTHA 1AZPA 4QIWE 1ILPA 4QGUA 2AMCB 2FXQA 4JV5L 3I4OA 4A3GB 2Z9HA 3GTLH 1G6PA 1V1PB 3V96A 1NSNS 4DA2A 2VZAA 1O7LA 2R7ZB 1F77A 1CFMA 3I4NG 2JA8B 1YJ9A 1FNUA 2RBMA 2SNMA 3CQZB 2WAQE 2YTYA 3G6JB 4HCSA 4IUQA 1TKWB 5IP9H 4N8X1 4DR5L 2F0EA 3NE5B 1A15A 4JI2L 3A74A 1STYA 1PH1A 1VQKA 3S1NH 3U50C 4LFAQ 1X3PA 2PI2E 1CSQA 1K73C 3SR1A 2PZWA 4LF6Q 4ODGA 2PYKA 1B70B 1K3RA 4Q5VA 1PRTC 4JBKA 1S5BD 1J5EQ 2EYPA 4RMFA 2AUKA 1SXTA 3DLLA 3JAML 5H1SE 2JA9A 4DV1Q 4KK7A 5M3MH 5C3EG 1I50B 2Z4HA 4DR7Q 3GTPH 4JI8Q 4X3SA 3EVQA 1HTLD 3M4YA 3H0GG 3HFZB 3RNUA 3R2IA 3QG1A 4K6DA 2QKIC 1VQ8A 4BS9A 5K5PA 4KTAA 5TSSA 3S1MB 1A0IA 1DYQA 2F0TA 3CKIB 1FNVA 2IWHA 4IUVA 1D1KA 3S2HB 4L8JA 3KK7A 4PMWA 3RN2A 2MUYA 5JJLA 1IXRA 4A3IB 5GAHC 1RF2D 1D2BA 1G2TA 1JT8A 2R7FA 1EYGA 3UDIA 2K75A 4B3SQ 4GKJL 2F3WA 1M4VA 2L55A 2XN9C 4YY3L 4YHHQ 2YU9H 1H95A 4C3HB 1C48A 2K52A 3S1RH 2L12A 3DMUA 1P8LA 4HJ9A 4QQBX 1O80A 4XT3B 1Q7YC 2H4OA 1E2ZA 3ZJYC 3MVVA 2KEEA 1QNUA 2RDGA 1D7QA 3B6YA 5KEEA 1SNQA 4K2KA 2ES2A 2ZTEA 4ID6A 3HOXG 4KLKA 4NMZA 3FVQA 2V1CC 5DNFA 1PH6A 5J39A 1WFQA 1EIGA 1GUTA 2DJFC 4FVMA 1XXGA 5A2QL 2R93H 1K83B 4BY7G 3S1QH 2EY6A 4DPGA 3HOWB 2BA0A 2IX3A 1JCKB 1G6ZA 1OXUA 4J8QA 3HOVB 2VS1A 3EQLC 4GKKL 1GUWA 1STHA 3GTQH 4GN5A 2GVAA 3A54A 3TMEA 1H9SA 1YNNC 1S5CD 4JI3Q 1GKHA 3PSIA 5FLXE 2RCFA 2N3SA 4FF2A 2PMZE 1L0XB 1IZ6A 1SYCA 2JK8A 3OSOA 3U9OA 1EU3A 4JI6L 2MNAA 5M5YB 1L0YB 3FRPB 3O13A 1VQIA 4R4OA 1YBYA 4AYBE 4DR1L 1N36L 2IJ0A 1SROA 1GHJA 5JJZA 3RZOH 1N34Q 4LF7L 2K33A 4IN3A 3UDFA 2K01A 1YVCA 1D5MC 3TS0A 4POFA 3T56B 4DNRB 1AEXA 1JJ2A 4LAAA 2EXZA 1TY0A 1U0LA 2XVSA 1HA5A 2OQ0A 3A0JA 3FKIG 4HJ8A 1Q90A 4DV3L 4IPCA 2KHJA 4DUYL 1BBWA 4KD4A 2EOTA 1SE4A 4A3FG 5IP7H 1PRTB 2E2JB 3PUXA 1KAWA 2CWPA 1XNQL 2ZM6L 2F0DA 1QNKA 3J7AF 1T5XD 4ZKBB 4LF8L 4X65L 1E3PA 3CP0A 4OL7A 5C4XH 1VQ7A 5FLXc 1G2SA 5M5WB 3D6WA 3HS0C 5E4XA 4DAYA 2P5ZX 1BVSA 2E2HB 4R4TA 5D3DA 4E6IA 1IBLQ 3BDOA 2A73B 1I3QB 1D5ZC 1DJRD 4Y52H 1IYUA 4HIKA 1LTRD 4WJWA 1PRTF 1II3A 4IOCA 4GS3A 2E8GA 4P73A 5KGUA 2VB3X 3FPPA 4LUOA 3GQBA 3FEWX 3HGBA 1O7IA 1PXUA 4LUZA 3OIPA 3KLRA 1BBUA 2BA1A 1V8QA 4WJ4A 4A3BH 4LF9L 1BO0A 3FDTA 5AJ3L 5DM63 5AFWA 2UXCL 3D0FA 5IGFA 4DV6L 3F1ZA 4XQQA 3VYSA 3S17B 1EYCA 1SE3A 2UUAL 1A3UA 3SK4A 5FJ8G 1HFNA 4C3IG 1LT6D 4V0BA 2A1AA 5D65A 4DV7Q 3V2TA 1LTTD 2OTJA 4DR4Q 2DNEA 4BBSB 3AU7A 2XNAC 2RCNA 3M4OB 2B2WA 4UPAA 3J81j 4BY1B 1SNPA 3OMCA 2F0NA 2YYZA 3ULLA 2JA7B 1PMRA 3U4VA 3FPUB 4GOPA 4IQZA 2NTSA 4ZUJA 4JI7Q 4XIGS 5IWAQ 1IL8A 4K5XA 4NXMQ 1ENFA 2MO1A 5GADC 2EJFC 3OOCA 3A5ZB 5JAVA 1B4OA 1LM0A 2I46A 4LFAL 1DONA 3H09A 3W3AA 1LTAD 1NUCA 1QILA 3SGIA 2RKSA 4M8AA 4JG2A 3Q0AA 5C0XG 3GTJH 3VR6A 1N9WA 2X69A 3P1HA 2VQFQ 2A74C 2CW0C 4LF6L 2EXDA 2DN8A 4A3KG 1J5EL 3AMUA 1IKMA 2KJXA 1SMYC 4DV1L 1RL2A 1Y1VG 2XSCA 4CDCC 4HMIA 4DR7L 5CV9A 4JI8L 2NN6G 4OGQC 1K8GA 3TDQA 5I9PA 3S9WA 2NVYB 1PTOD 2VXWA 3KBGA 1IKLA 3MC0B 1HR0Q 2A6EC 2CVRA 4KI0A 1HPCA 1WTHA 1IW7C 1WVLA 1I4HA 4EQPA 1KL9A 1EWHA 2BE5D 4A3LG 1HH2P 3PMFA 3D6CA 4R8NA 2B63H 2WP8J 1X55A 3BZCA 3UE1A 4YWKA 1A2TA 3KLWA 1JWUD 3A8KE 4B3SL 1SNDA 4YHHL 1XMQQ 1NY4A 4JBMA 1V43A 5C44B 1CHPD 1H9JA 2OCEA 2ALYB 1K0SA 1PYBA 1PH9A 2KA7A 5HGQA 2JA6B 3PO3H 3AEVA 1VQEA 2ASBA 2J0TD 1HNZQ 5JEAJ 2JA5B 5T1GA 1WJJA 5ELEA 5JEAH 4YWMA 3KYHC 2QDLA 3S16B 3T1YQ 5GQOA 4R4CA 3SE0A 4B3TQ 2LFNA 1HUNA 2R92G 4YCWA 2C9OA 3PUVA 1P16A 2F0OA 4JW0A 3M4PA 1SNMA 4FYDA 1UUPA 4L63B 1KIXA 1ENCA 1D5XC 1EIFA 1ZYRC 3BU2A 2KUMA 2YV5A 3WWVA 4K8JA 4QIWB 1NAPA 5EGTA 5KRUA 5ELOA 1L2FA 4U68A 1Q3LA 4JI3L 2PNHA 5GAGC 1TWGB 1TS5A 2AQ3B 4MTKA 3N6RA 2LXJA 4DXGA 4YCUA 5ELNA 2C5CA 1FVIA 2A6HC 1PZKD 1KQSA 3MXNB 1SNOA 4RCNA 4Y7NH 1X6OA 1EIYB 3FKIH 4BWGB 3BJUA 4BA2I 1YNJD 2ZXOA 2CWAA 2DJGC 3OPOA 1XJVA 1N34L 3CCRA 3SK5A 3HOZG 3MHBA 2GVBA 3N52A 4QL5A 4ALPA 2R6GA 2F4VQ 4EQOA 1VCIA 4JC0A 4I65A 2EYOA 1JC7A 1B9NA 1U4RA 3KJPA 1I5FA 3S1NB 1Z6HA 3CXCA 1VQ6A 2MHVA 4R4IA 4CJ0B 4C1NI 1XPOA 2B39A 3OWEB 2K03A 4IUNA 4GNXB 4J15A 1TS4A 2K50A 5IT9E 2WACA 2XWJB 2E75C 3RR5A 2JEBI 5CBAE 1PZID 5M3MB 4RA8A 3GTPB 3CCJA 2IT1A 3KDFA 1SFOH 1UE5A 1X65A 2VUMG 3HOUH 3S14H 4OO1H 1IBLL 1KNAA 1BR9A 3NK9A 3GP7A 5BN5A 1X9NA 2WV6D 2R3ZA 2A68C 3MXGA 4BBRB 4PZ8A 4A3DH 4C2MH 3M7GA 3NQIA 3D8GA 1L1OC 3GV3A 1A2UA 2KENA 3FHWA 2YU9B 1HXYD 1MGSA 2KCTA 2HUGA 5FJ8H 2QGQA 2K5DA 3S1RB 2EYMA 3G6EA 3VA7A 3SHLA 1U9RA 3F2DA 5K36H 3TREA 4WFN3 4A3CG 1A6XA 1S72A 4MNOA 1AP0A 3M7NA 4ME3A 4HIOA 3I90A 1I4RA 1XYIA 1WOCA 1UWVA 5L37A 3T13A 3CCEA 4A93H 3OW7A 3G71A 1C7YA 4DV7L 4LW1A 4A3GG 4F88A 2R93B 4PMCA 4DR4L 1S5FD 3S1QB 2A19A 1E22A 5IIFA 1YHQA 4MIUA 2PMZB 2R7ZG 1I4PA 4A3JH 2O4XA 3CRLC
chains in the Genus database with same CATH topology
4XQNA 4KJNA 2KQ3A 2X6GA 1UEAB 1J9OA 1TIID 3NUCA 2G9DA 3GTQB 2FHTA 2F0FA 3PV0A 1ZEQX 5EKKA 4DGZA 3D3RA 5FLXL 1GUSA 3D4DA 3TBIB 2TSSA 5IGDA 2LS01 4XXEA 2CHBD 1DCZA 4G7ZC 4FF4A 2AWNA 3RZOB 3EA6A 2BDNA 4X3UA 2B8GA 2GA4B 2EZVA 1LO5D 4ABNA 1I4QA 1A3VA 1SEBD 3D4WA 5CV8A 2M2LA 1U4PA 4KN4C 3D31A 2K32A 4QMGA 2SNSA 2K04A 3DUZA 2O2LD 1O78A 4F8MA 1LTSD 2F0WA 2ZXRA 2WKDA 4ME5A 1STAA 5I2XA 4C3HG 1F2LA 1LLRD 4FF3A 5C4XB 1EFID 1ESFA 2DNCA 4DAPA 1E0BA 3TZUA 1S5DD 2L9HA 5CC4A 1JE4A 3J81E 4B9XA 2F0QA 3R93A 4EQNA 2MP1A 2FFKB 2XRQD 3RUZA 1LACA 3PIO3 1EQTA 1Q1EA 3QWNA 3EROA 4A3BB 4PMBA 4IFDG 1BCPC 1SNCA 2PCFB 3SEBA 2E74C 3K58A 4H0LC 4MN3A 1PRTD 2NUCA 5LHY1 2PZUA 2Q8TA 1LABA 1B53A 1XTCD 1Q12A 2QF7A 5DEHA 3K57A 3PUYA 1EL0A 1EY0A 4EGVA 4K14A 2F0LA 2L5TA 1GXDC 4N9PA 3J7AV 5CV7A 3K5LA 2EJGC 3U9SA 2ICEC 2JXMB 5FK9C 1JWMD 1O7YA 2RSNA 5BN4A 4QB4A 4LK1C 4ZUIA 1PDQA 4PNYA 1EZ6A 4EVOA 1B44D 1SJHD 3SDZA 4DF7A 1KDCA 2EY5A 5C3XA 1CQFA 2OXPA 3A7AB 3GTJB 3QJYA 5ELFA 4FXDA 1QB5D 3BYTB 5E4WC 2WKCA 3NXWA 1ENAA 1V1PA 2Y0SB 1KLGD 3ONAB 2B2TC 4C3JB 4ILWA 4RCOA 3QIAA 4KJOA 2Z1CA 1HFGA 1EYAA 2D62A 3GO5A 4RAUC 4CHTB 1PLFA 1YNND 2J4XA 1E2WA 1QCBD 2G9HD 2HDLA 2O5IC 1CA6A 2B63B 2J7ZA 1ET9A 1MI2A 4O1NA 2L1BA 2K28A 5FO9B 1F2ZA 4RFBA 1J8IA 1SJED 2I07B 3PO3B 2B2UC 1EYDA 4KKSA 2B2YC 3C2PA 5J1ZA 2EY1A 1QJOA 4GZYC 1MSGA 1NR4A 1PZJD 1DZ1A 1DD2A 5CV4A 1BCPB 4K5WA 3ERQA 1F2YA 3DEOA 5NUCA 2EYHA 4M1UB 1TT2A 5JOBA 4RHRA 4L6TB 2IX0A 2JYOA 3R3OA 1U4LA 1LV9A 1O7ZA 2ZT9C 3Q24A 2KCCA 5DAUA 2NBFA 4FXKC 5C6AA 1BCPF 5EPKA 2QDBA 2NTTA 5E3FA 2O5JC 2A5HA 4UAIA 3BS1A 4NP5A 4JK1C 4Y7NB 3ITPA 1R4PB 4ZKCB 3FKIB 5T1IA 2IX1A 1WD1A 3K7AB 4G57A 2BOSA 5C3WA 3HP3A 3J80E 1B2TA 3A56A 3K5MA 2F03A 1QE6A 1WTQA 4K8IA 2WB1B 1FR3A 5EQ0A 5KNCA 2AQ2B 5IGGA 4XT1B 1Z47A 3HKZB 4XDXA 5A35A 1FNWA 3Q22A 3VR5A 5J22A 2PPBC 2KOLA 1EY8A 5ELBA 3ND9A 4C56C 1WTRA 4C1NK 5JVG3 2XIWA 2NB0A 2L0CA 3T51B 1Y8OB 1AN8A 3LWUA 3PUZA 1SFOB 4RGNA 5FOBB 3IL8A 5CR3A 3HOUB 2MPMA 2F0PA 4ULLA 3S14B 2JEAI 2PW7A 4XYOA 3DWAA 4A3DB 4C2MB 2EE1A 2Z4IA 2JE6I 3TN2A 1HHVA 2QEJC 1CHQD 3A7LA 4KN7C 1JOQA 1CM9A 3KLSA 4DK0A 2AUJD 2CW0D 3SXHA 1ZXTA 2F4IA 3BG3A 4FNFA 3QO2A 1B50A 2EDGA 3ND8A 4A3MB 2F0IA 1SMYD 1EY9A 2R61A 1I4GA 4A93B 2RA4A 3KBXA 5C5MA 2A6ED 4J1MA 1SE2A 1WD0A 3RLFA 2AWOA 5KYLA 1IW7D 2D2CC 4A3JB 1JR0D 1EU4A 2EJMA 4HTHA 3LNNA 1HRJA 1E2VA 3HG9A 4H44C 2H1EA 1CTMA 3HZXA 3BZDB 3L9AX 4MHEA 3IFDA 1KTKA 2BCOA 1OXSC 3LX0A 2B2VC 3T53B 2PQEA 3I4LA 3MWYW 1JQYD 3SVMA 1DOMA 1NCVA 2XRSD 1WCMB 4R8IA 1LTID 1JOKA 2K1BA 4NDXA 5LL6X 5CV6A 2WAQB 1GOZA 1PFBA 3GTLB 1RTOA 2LMCB 3MXPA 4BA1I 2E2IB 1ZYRD 1RJTA 2B2TA 1G91A 5I4DA 1B3AA 5EKIA 1SYBA 1EY7A 1UNSA 4DNTB 1GHKA 3A8JE 1F9QA 5G3LF 3QOJA 5EBDA 1KAAA 2A6HD 3DM1A 3GD7A 1CI3M 3MFYA 1SYFA 4HEDA 1G8ZD 3DXJC 5COYA 1QOHA 3PO2B 3M85A 1RHPA 4CBVA 2VNUD 5CYUA 3MEHA 3J81L 1TWFB 3OWFA 1EQVA 2K7VA 1T5EA 2FMMA 2HQEA 1SBBB 2B2UA 4A3EB 3X3MA 2B2YA 3EJIA 2M9VA 1QG7A 2DY8A 4OO1I 5CV5A 1X3QA 5EPLA 3K6OA 5M9OA 5KIXA 3K5OA 4HSPA 4CJ1B 2VB2X 4UDUC 3W2DA 2FINB 5I6WA 3GTKB 4KMUC 4H7BA 4G7HC 2NWGA 4HSVA 3Q23A 2F0HA 1ESRA 4IUUA 5M3FB 2A68D 1Z7TA 1EY4A 2EYLA 1M8AA 4FXGC 4B9WA 2XWBB 2K6AA 3I4MB 2LY7A 3Q6SA 1C4QA 2MJ8A 4U673 2F0JA 2M00A 4AYBB 1EY6A 2F1MA 5EPJA 5C0XJ 4FF1A 1BQQT 5C0XH 5ELCA 1TVXA 1BF4A 3QB3A 5CORA 2VUMB 3MXNA 1F9RA 3NTKA 1F9SA 3E5SA 3TP5A 3MFGA 1HTPA 2FMCA 5C0XI 1RKNA 3VYRA 3MTSA 1F2MA 2NN6H 3CU7A 3I8ZA 4TSSA 2NN6I 3S2DB 3H6MA 3GTOB 1Y1WB 4N9TA 3MZ5A 5EBCA 1STEA 1VMPA 1WTOA 1HA6A 1KNEA 1HUMA 2B2WC 2ENBA 4G7OC 1H9SB 3WOEA 3CHBD 3C46A 4RGOS 3NTIA 2ID0A 3TZDA 2F0GA 2SDFA 2QCPX 1RDPD 1W6KA 4QF4A 4TRDA 2K5WA 1TU2B 3TSSA 1QWYA 1VF5C 3IAYA 1EEID 2A69C 1FD7D 4B08A 4CKCA 4NKLA 4V190 3K59A 1MD2D 1PTOH 2KHSA 1B9MA 1ONLA 5M5XB 3DEPA 4CGYB 3NPPA 4RKBA 1RD9D 3CRKC 3OMGA 1JORA 4RGTA 2EVBA 1HCZA 4PQXA 4ZYSA 1BBXC 4ZLTF 1AFPA 1WTXA 4CKBA 2A69D 2FJ2A 1TR5A 5IOCA 3TP7A 4HN7A 3E0JA 1NR2A 3BVMA 2Q8IB 3C1FA 4IALA 3I73A 3VA5A 4C3JG 4O42A 3I4NB 1VF7A 2B2VA 4OIJA 2OEOA 1PYWD 3J80L 2RDHA 4PV1C 1LT3D 3WOFA 3D4RA 1BCPD 1R4QB 5KYIA 1KABA 1MBYA 3C1EA 3V05A 1JWSD 2NZ1D 4DXFA 2WINB 2Q8RE 1DXMA 3RMHA 4K2LA 5HURA 1WTPA 4Z9CB 3NBHA 2D5DA 3IFTA 4R9WA 4XYQA 5I9OA 1I4XA 2PNRC 4HAEA 4ZQ3A 5C3EB 1LTBD 3H0GB 4KD3A 1BNZA 2PW5A 2SOBA 1STNA 4F7XA 5D14A 4YIJA 3E6ZX 1EOTA 5JEAG 1VDZA 4TQUS 4I7ZC 5IGEA 3PIP3 2LKVA 3G7LA 3R8BA 1XX8A 2KCNA 1LTGD 1GUGA 4H13C 1PFMA 4FP5D 3HOYB 1IHZA 4KKTA 5KNBA 1S4ZA 4IZ8A 1EIHA 1GUOA 3VYTA 1B1ZA 1A3TA 4KKUA 3GV6A 3HOXB 3LWEA 4TKOB 1Q8IA 2F0MA 2L4NA 3TP6A 1EEFD 4BY7B 2D9UA 3BVGA 1JB3A 2PZTA 4HCEA 1XWEA 3DWQA 4KY7A 3I72A 4KHZA 3P7JA 4IUPA 3OHXC 2N88A 5I6YA 1RODA 1KDAA 1STBA 3VR2A 4DFAA 1ET6A 3PUWA 3RD4A 3DHQA 3JAME 5HGTA 2CQAA 1Y8NB 1V1OA 1Q1BA 5JPNC 3URYA 3NWTA 4X3KA 1OXTA 3ZYYX 2IPKD 4IURA 2HCIA 5IGCA 5JPMC 4RWSC 3BDLA 4OO1G 3HEJA 2DY7A 5EJWA 2NVTB 4A3FB 1SAPA 3VYUA 1D1IA 5IODA 3L7ZC 2AQ1B 1JOOA 2EY2A 3GTMB 1CZWA 1SYEA 4ZK9B 4XQJA 4K5VA 1FGBD 5K36G 1I6HB 2ZXPA 5E1FA 5CBEE 3QOLA 1DOLA 1GJXA 1OO9B 4DN4M 5IT9L 3FMCA 4NW2A 1F9PA 1BDOA 5FKAC 5A2QE 3I70A 2TMPA 5G3LD 1FYCA 1I6VC 2IW3A 4P2CB 3UI2A 1CT1D 4WRDA 1DOKA 2B8FA 5IGBA 4IFDJ 4KV6A 1SYGA 1BOSA 1PTOC 3H91A 1MSHA 4IFDH 2HDMA 2F0VA 3TP8A 3S15B 3C3LA 2JSOA 5BN3A 3KUPA 4IFDI 3DWPA 3SK8A 1WTWA 2BE5C 1CA5A 1H9RA 4DU9A 5I2YA 1UAPA 4C3IB 1ICWA 2HCCA 1PFNA 4ZAIA 3NP8A 4S3SA 1EY5A 2NVQB 3L3OC 1RTNA 5C5LA 4KY5A 1SDFA 1DM0B 1AZQA 1K8OA 2QILA 4WORA 1EZ8A 2RDFA 3A55A 3NBIA 4JBWA 3GTGB 3F2UA 4QUCA 1CZGA 3MAQA 3P20A 2V4DA 3HRZC 1TY2A 1BXTA 2ICIA 3T16A 1BUVT 2K05A 3X3NA 2RVLA 4RGMA 4A3KB 5C4JB 5ELDA 2K5QA 1Y1VB 4QUFA 1X32A 3KLSX 2EYFA 3A8IE 4CKEA 4OHJA 2N55A 4KY6A 3MXUA 1YNJC 1HQRD 2E76C 1CK1A 2KVMA 3NSWA 5DM73 1ZKOA 4ZRZA 4F87A 1G291 3T4AC 3VR3A 2L11A 4Q0FA 2EYJA 5C4HA 4HMJA 4RHSA 1VMCA 2NVXB 2KEDA 4HR7B 5EKLA 2RQXA 1TQOA 3P75A 3I3CA 3NWSA 3OIQA 2R92B 5LL6S 1PTOB 1GUNA 2E2DC 3SK6A 3AB9A 3R2TA 3K5NA 4XTCS 5JVH3 3BVZA 1ML0D 3H94A 3RZDB 4FO2A 2OF1A 2KECA 1Y69U 4X3TA 1HQMC 1AW7A 2X6LA 3NQTA 1PTOF 3BYYB 5CMDA 3M3YB 2SEBD 1KDBA 1TS2A 1SYDA 2WIIB 3WDNA 3HOZB 3EFXD 3BDCA 2IL8A 3IKJA 2MGSA 4OIKA 5C4ZA 1OXVA 1STGA 1Y8PB 2F3VA 4RH6A 1EWCA 2PO4A 5CGKA 1H9MA 1S5ED 1WTVA 3I91A 1C8CA 4K6LA 4G4KA 4QCLA 2F0KA 3MA2B 2OT2A 1LT5D 1TWHB 3J7YW 1KLUD 2F0SA 4J6HA 2F0UA 2JP1A 3KF8A 3H3VC 3NHHA 4RKLA 5KNDA 1D6EC 4CJ2C 2Z8LA 5FO8B 4KHVA 5D3IB 1TS3A 2NYZD 4DK1A 3K0YA 1IYVA 1OXXK 1LT4D 1TWCB 5F2DA 1K8MA 2BDOA 4LMQD 4IUTA 3VR4A 1SSOA 4LJZC 1RCVD 2EPBA 1ILQA 1CQVA 1W6JA 1JICA 5FO7B 5ISRA 1R9TB 1U4MA 1H9KA 1TWAB 4DAVA 2RSOA 3NTHA 1AZPA 1ILPA 4A3GB 1V1PB 3V96A 1NSNS 4DA2A 1O7LA 2R7ZB 1F77A 1CFMA 2JA8B 1FNUA 2RBMA 2SNMA 3CQZB 4HCSA 3G6JB 4IUQA 1TKWB 2F0EA 3NE5B 1A15A 1STYA 1X3PA 3SR1A 2PZWA 4ODGA 2PYKA 4Q5VA 1PRTC 1S5BD 2EYPA 2AUKA 1SXTA 3JAML 4KK7A 1I50B 2Z4HA 4X3SA 3EVQA 1HTLD 3M4YA 3R2IA 3QG1A 4K6DA 2QKIC 4BS9A 5K5PA 4KTAA 5TSSA 3S1MB 1DYQA 2F0TA 3CKIB 1FNVA 2IWHA 4IUVA 1D1KA 3S2HB 4L8JA 3KK7A 4PMWA 2MUYA 4A3IB 1RF2D 1D2BA 1G2TA 2F3WA 1M4VA 2L55A 2XN9C 4C3HB 1C48A 2L12A 3DMUA 1O80A 4XT3B 2H4OA 1E2ZA 3MVVA 2KEEA 1QNUA 2RDGA 5KEEA 1SNQA 4K2KA 4ID6A 4NMZA 3FVQA 5DNFA 5J39A 1EIGA 1GUTA 4FVMA 1XXGA 5A2QL 1K83B 2EY6A 3HOWB 2BA0A 2IX3A 1JCKB 1G6ZA 1OXUA 4J8QA 3HOVB 3EQLC 1GUWA 1STHA 3A54A 3TMEA 1H9SA 1YNNC 1S5CD 5FLXE 4FF2A 1L0XB 1SYCA 3OSOA 3U9OA 1EU3A 5M5YB 1L0YB 3FRPB 3O13A 2IJ0A 1GHJA 5JJZA 2K33A 4IN3A 2K01A 1D5MC 3T56B 4DNRB 1AEXA 4LAAA 2EXZA 1TY0A 2XVSA 1HA5A 1Q90A 4KD4A 2EOTA 1SE4A 1PRTB 2E2JB 3PUXA 2F0DA 1QNKA 3J7AF 1T5XD 4ZKBB 4OL7A 1G2SA 5M5WB 3D6WA 3HS0C 5E4XA 4DAYA 2E2HB 4E6IA 5D3DA 3BDOA 2A73B 1I3QB 1D5ZC 1DJRD 1IYUA 1LTRD 4WJWA 1PRTF 1II3A 5KGUA 2VB3X 3FPPA 3GQBA 3FEWX 3HGBA 1PXUA 3OIPA 3KLRA 2BA1A 1V8QA 1BO0A 3FDTA 5DM63 5AFWA 5IGFA 4XQQA 3VYSA 3S17B 1EYCA 1SE3A 1A3UA 3SK4A 1HFNA 4C3IG 1LT6D 4V0BA 5D65A 3V2TA 1LTTD 4BBSB 2DNEA 3AU7A 2XNAC 3M4OB 2B2WA 4BY1B 1SNPA 3OMCA 2F0NA 2YYZA 2JA7B 1PMRA 3FPUB 4IQZA 2NTSA 4ZUJA 4XIGS 1IL8A 4K5XA 1ENFA 2EJFC 3OOCA 5JAVA 1B4OA 2I46A 1DONA 3H09A 3W3AA 1LTAD 1NUCA 1QILA 2RKSA 4M8AA 3Q0AA 5C0XG 3VR6A 2X69A 3P1HA 2A74C 2CW0C 2DN8A 3AMUA 1IKMA 2KJXA 1SMYC 2XSCA 4HMIA 5CV9A 2NN6G 4OGQC 3TDQA 5I9PA 3S9WA 2NVYB 1PTOD 2VXWA 3KBGA 1IKLA 3MC0B 2A6EC 2CVRA 4KI0A 1HPCA 1IW7C 1WVLA 1I4HA 4EQPA 1EWHA 2BE5D 3PMFA 3D6CA 4R8NA 2WP8J 1A2TA 1JWUD 3A8KE 1SNDA 1V43A 5C44B 1CHPD 1H9JA 2KA7A 2JA6B 2J0TD 5JEAJ 2JA5B 5T1GA 5ELEA 5JEAH 3S16B 3SE0A 2LFNA 1HUNA 2C9OA 3PUVA 2F0OA 1SNMA 4FYDA 1UUPA 4L63B 1ENCA 1D5XC 1ZYRC 2KUMA 4K8JA 4QIWB 1NAPA 5EGTA 5KRUA 4U68A 1Q3LA 1TWGB 1TS5A 2AQ3B 3N6RA 4DXGA 2C5CA 2A6HC 1PZKD 1SNOA 4RCNA 4BWGB 4BA2I 1YNJD 2ZXOA 3OPOA 3SK5A 3MHBA 3N52A 2R6GA 4EQOA 1VCIA 4I65A 2EYOA 1JC7A 1B9NA 1U4RA 3S1NB 1Z6HA 2MHVA 4CJ0B 4C1NI 2B39A 3OWEB 2K03A 4IUNA 1TS4A 5IT9E 2WACA 2XWJB 2E75C 2JEBI 5CBAE 1PZID 5M3MB 4RA8A 3GTPB 2IT1A 4OO1H 1KNAA 1BR9A 3NK9A 3GP7A 5BN5A 2WV6D 2R3ZA 2A68C 3MXGA 4BBRB 3M7GA 3NQIA 3D8GA 3GV3A 1A2UA 2YU9B 1HXYD 1MGSA 2HUGA 2K5DA 3S1RB 2EYMA 3VA7A 3SHLA 1U9RA 5K36H 4WFN3 1A6XA 1AP0A 3M7NA 3I90A 1I4RA 1XYIA 3T13A 3OW7A 4F88A 2R93B 4PMCA 1S5FD 3S1QB 5IIFA 4MIUA 2PMZB 1I4PA 2O4XA 3CRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4X A;  4X3T A;  1DOM A;  1NCV A;  3SVM A;  1JIC A;  1MI2 A;  2KEE A;  3N52 A;  2X6G A;  2KOL A;  3F2U A;  1ESR A;  5EJW A;  4R8I A;  3G7L A;  4IUU A;  2X6L A;  1J9O A;  4QUC A;  2K1B A;  1SAP A;  1U4M A;  2L1B A;  1WTR A;  2K28 A;  2XIW A;  2VXW A;  2FHT A;  1IKL A;  1XX8 A;  4MN3 A;  2NWG A;  1U4R A;  5DNF A;  5CMD A;  2CVR A;  1PFM A;  3DEP A;  1J8I A;  2RSO A;  1M8A A;  1EIG A;  1AZP A;  1ILP A;  2Q8T A;  1WVL A;  1B53 A;  1PFB A;  2B2U C;  3IL8 A;  4CJ0 B;  2B2Y C;  4ZK9 B;  2K05 A;  1S4Z A;  1RTO A;  2MPM A;  2RVL A;  1EL0 A;  1BBX C;  1EIH A;  2K03 A;  4ZLT F;  1G6Z A;  3Q6S A;  1MSG A;  5CBE E;  4QUF A;  1NR4 A;  2MJ8 A;  1WTX A;  2IL8 A;  1X32 A;  1RJT A;  1DZ1 A;  1BO0 A;  1DOL A;  2B2T A;  2EE1 A;  3FDT A;  4HCS A;  4IUQ A;  1G91 A;  1GUW A;  2MGS A;  1B3A A;  3GV6 A;  4OIK A;  5AFW A;  5CBA E;  3LWE A;  2BDN A;  2FJ2 A;  4X3U A;  4DN4 M;  5EPJ A;  3TN2 A;  5EKI A;  4NW2 A;  1F9P A;  4RA8 A;  1A15 A;  1HHV A;  2N55 A;  2L4N A;  1F9Q A;  1NR2 A;  1TVX A;  3DEO A;  1BF4 A;  1WTV A;  5COR A;  1HFN A;  1F9R A;  2D9U A;  1O7Y A;  3I91 A;  1CM9 A;  1X3P A;  2KVM A;  1F9S A;  3UI2 A;  2JYO A;  3DM1 A;  1C8C A;  2RSN A;  1DOK A;  1KNA A;  5D65 A;  1U4L A;  5T1G A;  1LV9 A;  1O7Z A;  1ZXT A;  2M2L A;  4O42 A;  1U4P A;  1PDQ A;  2B2V A;  3MTS A;  3QO2 A;  1B50 A;  3H91 A;  1MSH A;  4OIJ A;  4HED A;  5JJZ A;  2HDM A;  1HUN A;  5COY A;  2B2W A;  2L11 A;  3GV3 A;  2K01 A;  2K04 A;  5EPK A;  1RHP A;  3P7J A;  4IUP A;  2JP1 A;  3KUP A;  1WTW A;  3I8Z A;  2RA4 A;  4UAI A;  4X3S A;  2N88 A;  3KBX A;  1CA5 A;  1VMC A;  1MGS A;  3FPU B;  1ROD A;  2HUG A;  1F2L A;  1HA6 A;  1WTO A;  1VMP A;  2KED A;  2NZ1 D;  1KNE A;  1HUM A;  2KUM A;  4ZKC B;  4CJ2 C;  2FMM A;  1WD0 A;  5T1I A;  5E4W C;  2Q8R E;  1ICW A;  2HCC A;  3I3C A;  1IL8 A;  2B2U A;  1WD1 A;  1NAP A;  2B2W C;  1PFN A;  4IUV A;  1E0B A;  2B2Y A;  3ONA B;  4ZAI A;  2B2T C;  1WTP A;  1AP0 A;  2NYZ D;  3HP3 A;  1B2T A;  3I90 A;  1Q3L A;  4U68 A;  1QG7 A;  2DY8 A;  2EOT A;  4R9W A;  1HRJ A;  2L9H A;  1G2T A;  1JE4 A;  1B4O A;  1XYI A;  1X3Q A;  5EPL A;  1QE6 A;  1HFG A;  1DON A;  2H1E A;  1WTQ A;  4HAE A;  4RAU C;  3TZD A;  4X3K A;  1RTN A;  3R93 A;  4MHE A;  2SDF A;  2MP1 A;  1SDF A;  3IFD A;  1PLF A;  1BNZ A;  4IUR A;  2HCI A;  2X69 A;  2FFK B;  1QNK A;  5EQ0 A;  4CJ1 B;  2L12 A;  4ZKB B;  1ML0 D;  2FIN B;  1O80 A;  4LMQ D;  4IUT A;  5D14 A;  4RWS C;  4XT1 B;  1SSO A;  1AZQ A;  4XT3 B;  2HDL A;  2B2V C;  4XDX A;  2EPB A;  1EQT A;  1G2S A;  1ILQ A;  2DY7 A;  1EOT A;  2KEC A;  3D6W A;  3MWY W;  2J7Z A;  4HSV A;  1CA6 A;  1IKM A;  2R3Z A; 
#chains in the Genus database with same CATH topology
 4XQN A;  4KJN A;  2KQ3 A;  2X6G A;  1UEA B;  1J9O A;  1TII D;  3NUC A;  2G9D A;  3GTQ B;  2FHT A;  2F0F A;  3PV0 A;  1ZEQ X;  5EKK A;  4DGZ A;  3D3R A;  4JI7 L;  5FLX L;  4O0A A;  5IWA L;  1GUS A;  4DR6 L;  3D4D A;  1N33 Q;  4NXM L;  3TBI B;  2TSS A;  4A3K H;  5IGD A;  2LS0 1;  1GO3 E;  3NBH B;  4XXE A;  4DV0 Q;  5HY6 A;  2CHB D;  1DCZ A;  1WCM H;  4G7Z C;  4FF4 A;  1MHW C;  2AWN A;  3RZO B;  4GLV B;  2HD3 A;  3EA6 A;  3PCO B;  2BDN A;  2B8G A;  4X3U A;  2VQF L;  2GA4 B;  2EZV A;  1LO5 D;  2JJQ A;  2KCM A;  3A5U A;  4ABN A;  2OTL A;  1KRS A;  1AE3 A;  1I4Q A;  1A3V A;  4A3L H;  1CKN B;  2EIF A;  1SEB D;  3D4W A;  2CH4 A;  2Z6K C;  2E2I H;  1IBK Q;  5CV8 A;  2M2L A;  1U4P A;  4KN4 C;  3D31 A;  2K32 A;  4QMG A;  2SNS A;  2K04 A;  3DUZ A;  2O2L D;  1Q82 C;  1O78 A;  4F8M A;  1LTS D;  2F0W A;  2ZXR A;  2WKD A;  4ME5 A;  1STA A;  5I2X A;  2IHE A;  4C3H G;  3OW2 A;  1F2L A;  4N8F A;  1LLR D;  4FF3 A;  4OWX B;  5C4X B;  3U58 A;  4X64 L;  1EFI D;  1XMQ L;  1ESF A;  2DNC A;  4DAP A;  1E0B A;  3TZU A;  1S5D D;  4UP9 A;  2L9H A;  5CC4 A;  1JE4 A;  3PO2 H;  3J81 E;  2F52 A;  1E24 A;  1L1O B;  4B9X A;  1HNZ L;  2F0Q A;  1TWF H;  3R93 A;  4EQN A;  2MP1 A;  1XPU A;  2FFK B;  2XRQ D;  2PQA A;  3RUZ A;  2VL6 A;  3HOW G;  1LAC A;  4B3T L;  4DR2 Q;  3PIO 3;  1EQT A;  4A3E H;  1Z9F A;  1Q1E A;  3QWN A;  3ERO A;  4A3B B;  2I5L X;  4PMB A;  3HOV G;  4KHP Q;  4IFD G;  1BCP C;  1SNC A;  3QR8 A;  2PCF B;  3SEB A;  2E74 C;  4OWT B;  4UP7 A;  3K58 A;  4H0L C;  4MN3 A;  3KF6 A;  1PRT D;  2NUC A;  2ZJR A;  5LHY 1;  2PZU A;  3HOY G;  2Q8T A;  1A8V A;  3H15 A;  1LAB A;  2K5N A;  1GD7 A;  1QVG A;  1B53 A;  3M9B A;  1XTC D;  1Q12 A;  2QF7 A;  3GTK H;  5DEH A;  3NEN A;  3PUY A;  4EQ5 A;  3K57 A;  1EL0 A;  1EY0 A;  2Q2H A;  1KD1 C;  4EGV A;  4K14 A;  3CW2 C;  2F0L A;  1HR0 W;  2L5T A;  1GXD C;  3JC6 6;  4N9P A;  3J7A V;  4A75 A;  3J81 i;  5M3F H;  5CV7 A;  3K5L A;  4OWW B;  2EJG C;  1S40 A;  3U9S A;  2ICE C;  2JXM B;  5FK9 C;  3J81 c;  1JWM D;  1O7Y A;  2RSN A;  5BN4 A;  4DV2 L;  4QB4 A;  3I4M H;  2F4V L;  4LK1 C;  4ZUI A;  4IOA A;  1PDQ A;  1Q46 A;  4PNY A;  3CF5 A;  1EZ6 A;  4EVO A;  1B44 D;  1SJH D;  3SDZ A;  4DF7 A;  1KDC A;  2EY5 A;  4LF5 Q;  3CAM A;  2JN4 A;  2N78 A;  5C3X A;  1CQF A;  2OXP A;  3A7A B;  3GTJ B;  3QJY A;  4TVA B;  5ELF A;  4FXD A;  2Q2I A;  2VUM H;  1QB5 D;  1NJI C;  3BYT B;  2CCZ A;  5E4W C;  1KXL A;  2WKC A;  2QW7 A;  3NXW A;  1ENA A;  1V1P A;  4UY8 C;  1JJG A;  2Y0S B;  1KLG D;  3ONA B;  2EQS A;  2B2T C;  4PZ6 A;  4ILW A;  3U4Z A;  4C3J B;  4RCO A;  3QIA A;  4KJO A;  1ICF B;  2C35 B;  2Z1C A;  1HFG A;  1SN8 A;  1EYA A;  2D62 A;  3GO5 A;  4ZCK A;  4RAU C;  3S2D H;  4CHT B;  3J7Z C;  3GTO H;  1Y1W H;  1PLF A;  1YNN D;  2J4X A;  1E2W A;  1QCB D;  2G9H D;  2HDL A;  2O5I C;  4A3C H;  1CA6 A;  2B63 B;  2J7Z A;  1QZG A;  1ET9 A;  1MI2 A;  3CCQ A;  4L5R C;  1UE1 A;  1TWA H;  4O1N A;  4JI4 Q;  2L1B A;  2K28 A;  1QUQ B;  3PGZ A;  5FO9 B;  1F2Z A;  4RFB A;  1CKO A;  1J8I A;  1L1O A;  4X62 Q;  1VQJ A;  1SJE D;  4JPB W;  2A8V A;  2I07 B;  3PO3 B;  2B2U C;  1EYD A;  4KKS A;  4CDF C;  2B2Y C;  3C2P A;  5J1Z A;  2EY1 A;  1QJO A;  4GZY C;  4BBS G;  4JI1 Q;  1MSG A;  1VQP A;  3AYH B;  1NR4 A;  1PZJ D;  4OEM B;  1DZ1 A;  5JJK A;  1DD2 A;  5CV4 A;  5FLM G;  1BCP B;  5M5X H;  4K5W A;  2HHH Q;  3ERQ A;  2JA7 G;  1F2Y A;  3DEO A;  5NUC A;  2EYH A;  4M1U B;  1TT2 A;  5JOB A;  4RHR A;  4L6T B;  2IX0 A;  2JYO A;  5E7N A;  3R3O A;  3RLN A;  1U4L A;  1LV9 A;  1O7Z A;  3G4S A;  2ZT9 C;  3Q24 A;  1SLJ A;  2KCC A;  5DAU A;  1VQD A;  2NBF A;  4FXK C;  4GN4 B;  2HIV A;  5C6A A;  1BCP F;  5EPK A;  3I56 A;  2QDB A;  2NTT A;  1N33 L;  4JCV E;  5E3F A;  1IBM Q;  2O5J C;  2A5H A;  4UAI A;  3BS1 A;  4NP5 A;  2CFM A;  5IYC G;  4GLX A;  4JK1 C;  4DV0 L;  4Y7N B;  3ITP A;  1R4P B;  4ZKC B;  3FKI B;  5T1I A;  4IJH A;  1OTC A;  2IX1 A;  1WD1 A;  3K7A B;  3E9H A;  4G57 A;  3I4N H;  2BOS A;  5C3W A;  3HP3 A;  3J80 E;  1B2T A;  1PH4 A;  3A56 A;  3K5M A;  2HIX A;  1QVC A;  1NE3 A;  2F03 A;  1QE6 A;  2YTV A;  1PYS B;  1WTQ A;  2K5H A;  4K8I A;  2WB1 B;  1CKM A;  4QY7 A;  1K3B C;  4EX5 A;  1FR3 A;  3CCL A;  1IBK L;  5EQ0 A;  4YCV A;  5KNC A;  2UUC Q;  2AQ2 B;  1JE5 A;  5IGG A;  4XT1 B;  4CDD C;  1LYL A;  1Z47 A;  3HKZ B;  4XDX A;  5A35 A;  1FNW A;  3Q22 A;  2VQE Q;  3VR5 A;  5J22 A;  2PPB C;  2KOL A;  1EY8 A;  2Z6K A;  5ELB A;  3ND9 A;  4C56 C;  3W5O A;  1WTR A;  4C1N K;  5JVG 3;  2XIW A;  2NB0 A;  5C44 G;  5C3E H;  4HJ5 A;  1TXY A;  2L0C A;  3T51 B;  4B3R Q;  4MZ9 A;  3PIO A;  1Y8O B;  1QVF A;  1AN8 A;  3LWU A;  3PUZ A;  3H0G H;  3VDY A;  2JA6 G;  1K83 H;  1SFO B;  4RGN A;  5FOB B;  3IL8 A;  5CR3 A;  2JA5 G;  1PH8 A;  3HOU B;  3T1H Q;  2MPM A;  2F0P A;  4ULL A;  4GNX C;  3S14 B;  2JEA I;  2BH8 A;  2PW7 A;  2K5V A;  3J80 i;  4XYO A;  3L0O A;  3DWA A;  4R1J A;  3E0E A;  1XNR Q;  4A3D B;  2DUD A;  4C2M B;  2EE1 A;  2Z4I A;  2UXB Q;  5IYD G;  2JE6 I;  3TN2 A;  1QUQ A;  1HHV A;  3J80 c;  2QEJ C;  3HOY H;  1CHQ D;  3A7L A;  4KN7 C;  4DR2 L;  1UEB A;  3I2Z A;  2UXD Q;  1JOQ A;  2N49 A;  3K0X A;  1CM9 A;  3ER0 A;  2I5M X;  3KLS A;  2CKZ B;  4KHP L;  4DK0 A;  2AUJ D;  2VY3 A;  2CW0 D;  3SXH A;  1ZXT A;  2F4I A;  2KHI A;  3BG3 A;  4FNF A;  4K0K Q;  3QO2 A;  1B50 A;  2EDG A;  3ND8 A;  4A3M B;  2F0I A;  1SMY D;  1MKH A;  3AQQ A;  1EY9 A;  3RN5 A;  3HOX H;  2R61 A;  1I4G A;  4A93 B;  2RA4 A;  3KBX A;  1G51 A;  5C5M A;  2A6E D;  4BY7 H;  4J1M A;  1SE2 A;  1K0R A;  3RLF A;  1WD0 A;  2AWO A;  5KYL A;  1IW7 D;  2D2C C;  2RF4 A;  4A3J B;  1JR0 D;  1EU4 A;  1VS0 A;  2EJM A;  1PFS A;  4HTH A;  1SR3 A;  1YI2 A;  2B29 A;  1Q8K A;  3LNN A;  1HRJ A;  1E2V A;  1E1O A;  3HG9 A;  4H44 C;  3NEL A;  2H1E A;  1CTM A;  3HZX A;  3BZD B;  3L9A X;  1V9P A;  4MHE A;  3IFD A;  1KTK A;  2BCO A;  1W2B A;  1OXS C;  4DK3 C;  3LX0 A;  2B2V C;  3T53 B;  2PQE A;  3I4L A;  3MWY W;  2YTX A;  3TQY A;  4LF5 L;  1JQY D;  3SVM A;  1DOM A;  1NCV A;  2XRS D;  1WCM B;  4R8I A;  1LTI D;  1JOK A;  2K1B A;  4NDX A;  1VQL A;  5LL6 X;  3KF8 B;  4POG A;  1C9O A;  1VQN A;  5M3M G;  1EUJ A;  5CV6 A;  4NXN Q;  2WAQ B;  3STB C;  1K8A C;  4B3M Q;  3S24 A;  1GOZ A;  1PFB A;  3GTL B;  1RTO A;  2LMC B;  3MXP A;  4BA1 I;  3TEH B;  2E2I B;  1ZYR D;  1Q86 C;  1L0W A;  4BBR G;  1RJT A;  4HID A;  2B2T A;  1G91 A;  2OQK A;  2NVT H;  4A3F H;  3K80 C;  5I4D A;  1B3A A;  1Q81 C;  5EKI A;  1SYB A;  1EY7 A;  1UNS A;  4DNT B;  1GHK A;  3A8J E;  1F9Q A;  5G3L F;  3GTM H;  3QOJ A;  5EBD A;  1KAA A;  2A6H D;  5GAE C;  1HNX Q;  3STB D;  3DM1 A;  4DV5 Q;  4IPH A;  1I6H H;  4JI4 L;  3GD7 A;  1CI3 M;  3MFY A;  1SYF A;  4HED A;  3W1G A;  3F2B A;  1G8Z D;  1VQC A;  3DXJ C;  4X62 L;  5COY A;  1QOH A;  3PF4 A;  3PO2 B;  1JMC A;  3M85 A;  1RHP A;  4CBV A;  2VNU D;  5CYU A;  3MEH A;  3J81 L;  1EQQ A;  3ICE A;  1TWF B;  3OWF A;  1EQV A;  3CMA A;  2R93 G;  2K7V A;  4JI1 L;  1T5E A;  2FMM A;  3CC2 A;  2HQE A;  1SBB B;  2B2U A;  4A3E B;  4JI6 Q;  3X3M A;  2B2Y A;  3EJI A;  2M9V A;  1LTL A;  1VQA A;  1QG7 A;  2DY8 A;  2HHH L;  1NTG A;  4OO1 I;  5CV5 A;  2ZTC A;  1X3Q A;  5EPL A;  3S15 H;  3K6O A;  5M9O A;  2Q2T A;  3CPF A;  5KIX A;  3K5O A;  4HSP A;  4JI5 Q;  4CJ1 B;  2VB2 X;  4UDU C;  3W2D A;  4IJL A;  3CD6 A;  4C3I H;  2FIN B;  5I6W A;  3GTK B;  1X56 A;  4OXP A;  4KMU C;  4H7B A;  4G7H C;  2NWG A;  4HSV A;  3Q23 A;  2F0H A;  3CC4 A;  4JI0 Q;  1ESR A;  4IPG A;  1IBM L;  4IUU A;  4LFB Q;  5M3F B;  2A68 D;  1ASZ A;  1Z7T A;  2NVQ H;  3BZK A;  2L15 A;  1EY4 A;  4P74 A;  2EYL A;  1RIP A;  1M8A A;  1PA6 A;  3CCV A;  2VW9 A;  5IT9 c;  4FXG C;  2Z0S A;  4B9W A;  2XWB B;  2K6A A;  2F3I A;  3I4M B;  5DLQ E;  2LY7 A;  3Q6S A;  1SE8 A;  1C4Q A;  3GTG H;  2MJ8 A;  2JA8 G;  4U67 3;  2F0J A;  3OYY A;  2M00 A;  4AYB B;  1EY6 A;  4HJ7 A;  2Z6B A;  5IP7 G;  2F1M A;  1FJG Q;  5EPJ A;  5IYB G;  5C0X J;  2UUC L;  4FF1 A;  1BQQ T;  5C0X H;  5ELC A;  1TVX A;  1BF4 A;  2VQE L;  3QB3 A;  2MO0 A;  5COR A;  3MXN A;  2VUM B;  1F9R A;  3NTK A;  1F9S A;  3E5S A;  3TP5 A;  1PVO A;  3I7F A;  3MFG A;  1HTP A;  2FMC A;  5C0X I;  5C4J H;  3CPW A;  1RKN A;  4JYA Q;  1Y1V H;  3VYR A;  2K4K A;  3MTS A;  4B3R L;  1F2M A;  2NN6 H;  1VQH A;  2CH4 W;  3CU7 A;  3UE0 A;  3I8Z A;  4TSS A;  3T1H L;  2NN6 I;  1JB7 A;  3S2D B;  3H6M A;  3GTO B;  1Y1W B;  4LFC Q;  3J7A 5;  4N9T A;  3MZ5 A;  5EBC A;  1STE A;  1VMP A;  1WTO A;  1HA6 A;  1KNE A;  1HUM A;  1EFW A;  1YJN A;  1XNR L;  5JJI A;  2B2W C;  2ENB A;  5GRO A;  2HT1 A;  4DV4 Q;  4GNX A;  2UXB L;  1A63 A;  5LMU Q;  1HR0 L;  1TWG H;  4A3I G;  1MIU A;  4G7O C;  1H9S B;  3WOE A;  3CHB D;  3C46 A;  2UXD L;  4GOP C;  1VQ5 A;  4RGO S;  3NTI A;  2ID0 A;  3TZD A;  2F0G A;  4GLA C;  2SDF A;  2QCP X;  1RDP D;  1W6K A;  2NVX H;  1B3Q A;  5IE8 A;  4K0K L;  4QF4 A;  4TRD A;  2K5W A;  1TU2 B;  3TSS A;  1QWY A;  3CC7 A;  3UDG A;  1E7Z A;  1VF5 C;  3IAY A;  1EEI D;  2A69 C;  1FD7 D;  4B08 A;  4CKC A;  4NKL A;  2R92 H;  4V19 0;  3K59 A;  1MD2 D;  1PTO H;  2KHS A;  5LMN W;  1B9M A;  1ONL A;  5M5X B;  1N8R C;  3DEP A;  4CGY B;  5BR8 Q;  3NPP A;  4RKB A;  2AKW B;  1RD9 D;  3FP9 A;  3CRK C;  3OMG A;  1JOR A;  4RGT A;  3RZD H;  2EVB A;  1HCZ A;  4PQX A;  4ZYS A;  3T1Y L;  1BBX C;  4OON A;  4ZLT F;  4RG1 A;  1AFP A;  1PH3 A;  1WTX A;  4CKB A;  2A69 D;  2FJ2 A;  1FGU A;  1TR5 A;  1YNX A;  5IOC A;  3TP7 A;  3M3Y H;  4HN7 A;  1VQM A;  1VQG A;  3E0J A;  1NR2 A;  3BVM A;  3C1F A;  2Q8I B;  1PH2 A;  4IAL A;  1D8L A;  4JOI C;  4IPD A;  4DAY B;  3I73 A;  2Y0S G;  3W1B A;  3VA5 A;  1B8A A;  4C3J G;  4O42 A;  3HOZ H;  3I4N B;  4BBR H;  1VF7 A;  2B2V A;  4OIJ A;  2OEO A;  1PYW D;  3J80 L;  2RDH A;  4PV1 C;  4NXN L;  1LT3 D;  4AIM A;  3WOF A;  3D4R A;  1BCP D;  4B3M L;  1R4Q B;  5KYI A;  4P72 A;  4A76 A;  2BH2 A;  1KAB A;  1MBY A;  3C1E A;  3V05 A;  1JWS D;  2NZ1 D;  4DXF A;  2NZH A;  2WIN B;  1DGS A;  1GVP A;  2Q8R E;  1DXM A;  2Q2U A;  1A62 A;  1S3O A;  3RMH A;  2B63 G;  4K2L A;  5HUR A;  1WTP A;  1EWI A;  4Z9C B;  1TWH H;  3NBH A;  2UUB Q;  1N32 Q;  2D5D A;  3IFT A;  4R9W A;  1YEZ A;  4XYQ A;  5I9O A;  1I4X A;  2PNR C;  3TS2 A;  4HAE A;  4ZQ3 A;  5C3E B;  1SRU A;  1HNX L;  4DV5 L;  1LTB D;  3AFQ A;  3H0G B;  4KD3 A;  1BNZ A;  3PO3 G;  2PW5 A;  2UU9 Q;  2SOB A;  1STN A;  4F7X A;  5D14 A;  2B3G A;  1LUZ A;  4YIJ A;  1CKN A;  3K8A A;  3E6Z X;  1ASY A;  4JBJ A;  1EOT A;  5JEA G;  1VDZ A;  4TQU S;  1KHI A;  4I7Z C;  5IGE A;  3PIP 3;  2LKV A;  3G7L A;  3R8B A;  1TWC H;  1XX8 A;  2KCN A;  1LTG D;  1GUG A;  4H13 C;  1IYJ B;  1PFM A;  4GOP B;  4FP5 D;  3HOY B;  1IHZ A;  1XMO Q;  4DUZ Q;  4KKT A;  5KNB A;  1S4Z A;  4IZ8 A;  1EIH A;  1J6Q A;  2MFI A;  1GUO A;  1PHJ A;  4YWL A;  3VYT A;  4AQY Q;  1B1Z A;  1A3T A;  4JI5 L;  4KKU A;  1YIT A;  1R9T H;  4X6A H;  3GV6 A;  3HOX B;  3LWE A;  4TKO B;  1Q8I A;  2F0M A;  1HZ9 A;  2L4N A;  3TP6 A;  1EEF D;  4A3G H;  2D0O A;  4BY7 B;  3CCM A;  4DR3 Q;  2D9U A;  3RLO A;  3ULP A;  4JI0 L;  3BVG A;  2R7Z H;  4LFB L;  1JB3 A;  2I5H A;  2PZT A;  3EBE A;  4UP8 A;  4HCE A;  2JA8 H;  1XWE A;  3DWQ A;  4KY7 A;  2ZJP A;  3I72 A;  3CQZ H;  2ATW A;  4KHZ A;  4BY1 G;  5IYB H;  3P7J A;  2WB1 G;  4IUP A;  3CCU A;  1SMX A;  1I94 Q;  3GDE A;  3OHX C;  2N88 A;  5I6Y A;  1ROD A;  1KDA A;  2LXK A;  3EIV A;  1PH7 A;  1STB A;  1PV4 A;  3VR2 A;  4DFA A;  3HKZ G;  1ET6 A;  3PUW A;  4WJ3 M;  3RD4 A;  1EQR A;  2D0P A;  1FJG L;  4LF4 Q;  3DHQ A;  3JAM E;  1X3E A;  5HGT A;  2CQA A;  1Y8N B;  1V1O A;  1Q1B A;  5JPN C;  1I50 H;  3URY A;  3NWT A;  4X3K A;  4DK6 C;  4O2D A;  1OXT A;  3ZYY X;  2IPK D;  4IUR A;  2HCI A;  4NPS A;  5IGC A;  1YJW A;  5JPM C;  4JYA L;  3HOU G;  4RWS C;  2N8N A;  1BKB A;  2NZO A;  3BDL A;  3CCS A;  3S1M H;  4OO1 G;  3HEJ A;  2KBN A;  2DY7 A;  3S2H H;  2RHS B;  1M1K C;  4A3I H;  1YIJ A;  5EJW A;  4A3D G;  1HNW Q;  3OTO Q;  2NVT B;  4A3F B;  2IY5 B;  1SAP A;  4LFC L;  2G5D A;  1C0A A;  3VYU A;  1D1I A;  2DGY A;  1NBW A;  5IOD A;  3L7Z C;  4X66 Q;  1X3F A;  2AQ1 B;  1JOO A;  2EY2 A;  3HKS A;  4C3H H;  3H3V H;  3GTM B;  3K7U C;  1CZW A;  1SYE A;  5LMN Q;  4DV4 L;  4ZK9 B;  4XQJ A;  1NNX A;  4K5V A;  5LMU L;  1FGB D;  5K36 G;  3H3V I;  1I6H B;  2JQO A;  2ZXP A;  4DAM A;  2E5L Q;  5E1F A;  1YZ6 A;  5CBE E;  3JAM i;  3QOL A;  4A3M G;  4P71 A;  1DOL A;  1GJX A;  4BXX G;  4L5Q A;  4DKA C;  1OO9 B;  5IT9 L;  1KRT A;  3ULJ A;  3FMC A;  1W3S A;  4DN4 M;  4NW2 A;  1F9P A;  1BDO A;  4A93 G;  1VQB A;  5FKA C;  5A2Q E;  3I70 A;  3JAM c;  2TMP A;  5G3L D;  3KFU A;  1KC8 C;  1FYC A;  1I6V C;  2IW3 A;  4P2C B;  1EOV A;  3UI2 A;  3HOW H;  1CT1 D;  4WRD A;  1DOK A;  1VQF A;  3K81 C;  1XTD A;  2B8F A;  4DR6 Q;  4A3J G;  2GN5 A;  5IGB A;  4IFD J;  4KV6 A;  1SYG A;  1BOS A;  1PTO C;  3H91 A;  1MSH A;  3HOV H;  4IFD H;  2HDM A;  2F0V A;  3TP8 A;  5BR8 L;  3S15 B;  1JJC B;  3C3L A;  1UE7 A;  2JSO A;  4R4Q A;  5J3B A;  5BN3 A;  3KUP A;  4IFD I;  3DWP A;  3SK8 A;  1WTW A;  2I0Q A;  4OX9 Q;  4GN3 B;  2BE5 C;  1YHB A;  1CA5 A;  1H9R A;  4DU9 A;  5I2Y A;  4LNQ A;  1UAP A;  4C3I B;  5M5Y H;  3KJO A;  4HJA A;  1ICW A;  2HCC A;  4JV5 Q;  1PFN A;  4ZAI A;  4C3J H;  1Y14 B;  3NP8 A;  4S3S A;  4FDB A;  1WCM G;  1EY5 A;  1NMG A;  2NVQ B;  3L3O C;  1RTN A;  5C5L A;  4I7A A;  3KDF B;  2Y0S E;  1SDF A;  2WAQ G;  4KY5 A;  2H5X A;  1XPR A;  4DR5 Q;  1DM0 B;  4JI2 Q;  1V1Q A;  4PG3 A;  1AZQ A;  1E1T A;  1PH5 A;  1K8O A;  2QIL A;  4WOR A;  3I55 A;  4L5S A;  4JOI A;  1EZ8 A;  2RDF A;  3A55 A;  3NBI A;  4JBW A;  4X64 Q;  3GTG B;  3F2U A;  4QUC A;  1CZG A;  3MAQ A;  3P20 A;  2E2J H;  2V4D A;  5IP9 G;  3HRZ C;  4DNI A;  1TY2 A;  1BXT A;  2ICI A;  3T16 A;  1HZC A;  3PIP A;  1HZB A;  1BUV T;  2K05 A;  2UUB L;  3IRB A;  3X3N A;  2RVL A;  1N32 L;  4RGM A;  4A3K B;  5M5W H;  5C4J B;  5ELD A;  2K5Q A;  1CSP A;  1Y1V B;  4QJF A;  4QUF A;  1K9M C;  2E2H H;  4H02 A;  1VQO A;  1X32 A;  1I3Q H;  3EN2 A;  3KLS X;  3PO2 G;  2EYF A;  2RHQ B;  2XTI A;  2UU9 L;  3A8I E;  4CKE A;  2CQO A;  4OHJ A;  1WI5 A;  2N55 A;  4KY6 A;  5IY0 A;  3MEF A;  3MXU A;  1X54 A;  1YNJ C;  4IO9 A;  4GKJ Q;  4YY3 Q;  1HQR D;  2E76 C;  3E3X A;  1CK1 A;  2KVM A;  3NSW A;  3F8T A;  5DM7 3;  3LGJ A;  1WYD A;  4A3E G;  1ZKO A;  2QEX A;  4JVZ A;  4ZRZ A;  4F87 A;  1G29 1;  3T4A C;  3VR3 A;  2L11 A;  4Q0F A;  1XMO L;  4DUZ L;  2EYJ A;  2ZJQ A;  5C4H A;  3NEM A;  4HMJ A;  4RHS A;  4HIM A;  1VMC A;  3S17 H;  1GM5 A;  3DM3 A;  2NVX B;  2KED A;  4LUV A;  4HR7 B;  1MJE A;  1UE6 A;  5EKL A;  2LSS A;  2RQX A;  1TQO A;  3P75 A;  3I3C A;  2MQH A;  4AQY L;  3K7A H;  1X3G A;  4BBS H;  1FL0 A;  3NWS A;  3OIQ A;  2WFW A;  4DV2 Q;  3M4O H;  4APV A;  1MJC A;  1VQ4 A;  2R92 B;  5FLM H;  2QA4 A;  5LL6 S;  1PTO B;  5M3F G;  1GUN A;  2E2D C;  3SK6 A;  3AB9 A;  4BY1 H;  3R2T A;  3F2C A;  4DR3 L;  3K5N A;  2JA7 H;  1CUK A;  4XTC S;  4GKK Q;  5JVH 3;  3AFP A;  3BVZ A;  1ML0 D;  3H94 A;  3RZD B;  4FO2 A;  3I4M G;  2OF1 A;  3M4Q A;  2KEC A;  4AH6 A;  1Y69 U;  1AH9 A;  2WB1 E;  4X3T A;  1HQM C;  2ZTD A;  1AW7 A;  1I94 L;  2X6L A;  4DR1 Q;  1N36 Q;  4AYB G;  3NQT A;  5EAY A;  1PTO F;  4MTN A;  3BYY B;  5CMD A;  3M3Y B;  3HKZ E;  2SEB D;  4LF7 Q;  1KDB A;  5IYC H;  1TS2 A;  3TRZ A;  1SYD A;  4LF4 L;  2WII B;  1VQ9 A;  3G48 A;  3WDN A;  4NB3 A;  3HOZ B;  3EFX D;  3BDC A;  4UHV A;  2IL8 A;  4DV3 Q;  3IKJ A;  4DUY Q;  2MGS A;  4OIK A;  2NVY H;  5C4Z A;  1OXV A;  1STG A;  1Y8P B;  2F3V A;  4P75 A;  4RH6 A;  3PQI A;  2PQA B;  1EWC A;  2PO4 A;  5CGK A;  1H9M A;  1Y1W G;  3ERS X;  1S5E D;  1WTV A;  3I91 A;  1C8C A;  1XNQ Q;  2ZM6 Q;  3CME A;  4K6L A;  4G4K A;  4QCL A;  2F0K A;  4OEL B;  1HNW L;  3OTO L;  3MA2 B;  3PF5 A;  4LF8 Q;  4A3M H;  2OT2 A;  1LT5 D;  1TWH B;  4X65 Q;  3J7Y W;  4X66 L;  1KLU D;  2F0S A;  3Q8D A;  4BXX H;  4J6H A;  3KF6 B;  2F0U A;  5C44 H;  5LMN L;  1QZH A;  2JP1 A;  2R7D A;  3KF8 A;  3H3V C;  3NHH A;  4RKL A;  2K14 A;  2JA6 H;  2E5L L;  5KND A;  1HZA A;  1IL2 A;  1D6E C;  4CJ2 C;  2JA5 H;  2Z8L A;  1HJP A;  5C4X G;  5FO8 B;  1K28 A;  4KHV A;  3S16 H;  5D3I B;  1TS3 A;  2NYZ D;  4DK1 A;  3K0Y A;  1IYV A;  1OXX K;  1LT4 D;  1NMF A;  2IHF A;  2PI2 A;  1T9H A;  1TWC B;  5IYD H;  4CDE C;  4LF9 Q;  3KOJ A;  5F2D A;  1K8M A;  5AJ3 Q;  3UDX A;  2OWO A;  2HQL A;  1B7Y B;  2BDO A;  1YHA A;  2UXC Q;  1U5K A;  4LMQ D;  4IUT A;  4DV6 Q;  3VR4 A;  1SSO A;  4LJZ C;  1RCV D;  2EPB A;  1ILQ A;  1CQV A;  2UUA Q;  1W6J A;  4LWC A;  1JIC A;  4A3B G;  4OX9 L;  5FO7 B;  2XGT A;  5ISR A;  1R9T B;  1M90 C;  1U4M A;  1H9K A;  1TWA B;  4DAV A;  4L5T A;  3L2P A;  1AE2 A;  2AHO B;  3E9I A;  2RSO A;  4A4I A;  4PZ7 A;  3NTH A;  1AZP A;  4QIW E;  1ILP A;  4QGU A;  2AMC B;  2FXQ A;  4JV5 L;  3I4O A;  4A3G B;  2Z9H A;  3GTL H;  1G6P A;  1V1P B;  3V96 A;  1NSN S;  4DA2 A;  2VZA A;  1O7L A;  2R7Z B;  1F77 A;  1CFM A;  3I4N G;  2JA8 B;  1YJ9 A;  1FNU A;  2RBM A;  2SNM A;  3CQZ B;  2WAQ E;  2YTY A;  3G6J B;  4HCS A;  4IUQ A;  1TKW B;  5IP9 H;  4N8X 1;  4DR5 L;  2F0E A;  3NE5 B;  1A15 A;  4JI2 L;  3A74 A;  1STY A;  1PH1 A;  1VQK A;  3S1N H;  3U50 C;  4LFA Q;  1X3P A;  2PI2 E;  1CSQ A;  1K73 C;  3SR1 A;  2PZW A;  4LF6 Q;  4ODG A;  2PYK A;  1B70 B;  1K3R A;  4Q5V A;  1PRT C;  4JBK A;  1S5B D;  1J5E Q;  2EYP A;  4RMF A;  2AUK A;  1SXT A;  3DLL A;  3JAM L;  5H1S E;  2JA9 A;  4DV1 Q;  4KK7 A;  5M3M H;  5C3E G;  1I50 B;  2Z4H A;  4DR7 Q;  3GTP H;  4JI8 Q;  4X3S A;  3EVQ A;  1HTL D;  3M4Y A;  3H0G G;  3HFZ B;  3RNU A;  3R2I A;  3QG1 A;  4K6D A;  2QKI C;  1VQ8 A;  4BS9 A;  5K5P A;  4KTA A;  5TSS A;  3S1M B;  1A0I A;  1DYQ A;  2F0T A;  3CKI B;  1FNV A;  2IWH A;  4IUV A;  1D1K A;  3S2H B;  4L8J A;  3KK7 A;  4PMW A;  3RN2 A;  2MUY A;  5JJL A;  1IXR A;  4A3I B;  5GAH C;  1RF2 D;  1D2B A;  1G2T A;  1JT8 A;  2R7F A;  1EYG A;  3UDI A;  2K75 A;  4B3S Q;  4GKJ L;  2F3W A;  1M4V A;  2L55 A;  2XN9 C;  4YY3 L;  4YHH Q;  2YU9 H;  1H95 A;  4C3H B;  1C48 A;  2K52 A;  3S1R H;  2L12 A;  3DMU A;  1P8L A;  4HJ9 A;  4QQB X;  1O80 A;  4XT3 B;  1Q7Y C;  2H4O A;  1E2Z A;  3ZJY C;  3MVV A;  2KEE A;  1QNU A;  2RDG A;  1D7Q A;  3B6Y A;  5KEE A;  1SNQ A;  4K2K A;  2ES2 A;  2ZTE A;  4ID6 A;  3HOX G;  4KLK A;  4NMZ A;  3FVQ A;  2V1C C;  5DNF A;  1PH6 A;  5J39 A;  1WFQ A;  1EIG A;  1GUT A;  2DJF C;  4FVM A;  1XXG A;  5A2Q L;  2R93 H;  1K83 B;  4BY7 G;  3S1Q H;  2EY6 A;  4DPG A;  3HOW B;  2BA0 A;  2IX3 A;  1JCK B;  1G6Z A;  1OXU A;  4J8Q A;  3HOV B;  2VS1 A;  3EQL C;  4GKK L;  1GUW A;  1STH A;  3GTQ H;  4GN5 A;  2GVA A;  3A54 A;  3TME A;  1H9S A;  1YNN C;  1S5C D;  4JI3 Q;  1GKH A;  3PSI A;  5FLX E;  2RCF A;  2N3S A;  4FF2 A;  2PMZ E;  1L0X B;  1IZ6 A;  1SYC A;  2JK8 A;  3OSO A;  3U9O A;  1EU3 A;  4JI6 L;  2MNA A;  5M5Y B;  1L0Y B;  3FRP B;  3O13 A;  1VQI A;  4R4O A;  1YBY A;  4AYB E;  4DR1 L;  1N36 L;  2IJ0 A;  1SRO A;  1GHJ A;  5JJZ A;  3RZO H;  1N34 Q;  4LF7 L;  2K33 A;  4IN3 A;  3UDF A;  2K01 A;  1YVC A;  1D5M C;  3TS0 A;  4POF A;  3T56 B;  4DNR B;  1AEX A;  1JJ2 A;  4LAA A;  2EXZ A;  1TY0 A;  1U0L A;  2XVS A;  1HA5 A;  2OQ0 A;  3A0J A;  3FKI G;  4HJ8 A;  1Q90 A;  4DV3 L;  4IPC A;  2KHJ A;  4DUY L;  1BBW A;  4KD4 A;  2EOT A;  1SE4 A;  4A3F G;  5IP7 H;  1PRT B;  2E2J B;  3PUX A;  1KAW A;  2CWP A;  1XNQ L;  2ZM6 L;  2F0D A;  1QNK A;  3J7A F;  1T5X D;  4ZKB B;  4LF8 L;  4X65 L;  1E3P A;  3CP0 A;  4OL7 A;  5C4X H;  1VQ7 A;  5FLX c;  1G2S A;  5M5W B;  3D6W A;  3HS0 C;  5E4X A;  4DAY A;  2P5Z X;  1BVS A;  2E2H B;  4R4T A;  5D3D A;  4E6I A;  1IBL Q;  3BDO A;  2A73 B;  1I3Q B;  1D5Z C;  1DJR D;  4Y52 H;  1IYU A;  4HIK A;  1LTR D;  4WJW A;  1PRT F;  1II3 A;  4IOC A;  4GS3 A;  2E8G A;  4P73 A;  5KGU A;  2VB3 X;  3FPP A;  4LUO A;  3GQB A;  3FEW X;  3HGB A;  1O7I A;  1PXU A;  4LUZ A;  3OIP A;  3KLR A;  1BBU A;  2BA1 A;  1V8Q A;  4WJ4 A;  4A3B H;  4LF9 L;  1BO0 A;  3FDT A;  5AJ3 L;  5DM6 3;  5AFW A;  2UXC L;  3D0F A;  5IGF A;  4DV6 L;  3F1Z A;  4XQQ A;  3VYS A;  3S17 B;  1EYC A;  1SE3 A;  2UUA L;  1A3U A;  3SK4 A;  5FJ8 G;  1HFN A;  4C3I G;  1LT6 D;  4V0B A;  2A1A A;  5D65 A;  4DV7 Q;  3V2T A;  1LTT D;  2OTJ A;  4DR4 Q;  2DNE A;  4BBS B;  3AU7 A;  2XNA C;  2RCN A;  3M4O B;  2B2W A;  4UPA A;  3J81 j;  4BY1 B;  1SNP A;  3OMC A;  2F0N A;  2YYZ A;  3ULL A;  2JA7 B;  1PMR A;  3U4V A;  3FPU B;  4GOP A;  4IQZ A;  2NTS A;  4ZUJ A;  4JI7 Q;  4XIG S;  5IWA Q;  1IL8 A;  4K5X A;  4NXM Q;  1ENF A;  2MO1 A;  5GAD C;  2EJF C;  3OOC A;  3A5Z B;  5JAV A;  1B4O A;  1LM0 A;  2I46 A;  4LFA L;  1DON A;  3H09 A;  3W3A A;  1LTA D;  1NUC A;  1QIL A;  3SGI A;  2RKS A;  4M8A A;  4JG2 A;  3Q0A A;  5C0X G;  3GTJ H;  3VR6 A;  1N9W A;  2X69 A;  3P1H A;  2VQF Q;  2A74 C;  2CW0 C;  4LF6 L;  2EXD A;  2DN8 A;  4A3K G;  1J5E L;  3AMU A;  1IKM A;  2KJX A;  1SMY C;  4DV1 L;  1RL2 A;  1Y1V G;  2XSC A;  4CDC C;  4HMI A;  4DR7 L;  5CV9 A;  4JI8 L;  2NN6 G;  4OGQ C;  1K8G A;  3TDQ A;  5I9P A;  3S9W A;  2NVY B;  1PTO D;  2VXW A;  3KBG A;  1IKL A;  3MC0 B;  1HR0 Q;  2A6E C;  2CVR A;  4KI0 A;  1HPC A;  1WTH A;  1IW7 C;  1WVL A;  1I4H A;  4EQP A;  1KL9 A;  1EWH A;  2BE5 D;  4A3L G;  1HH2 P;  3PMF A;  3D6C A;  4R8N A;  2B63 H;  2WP8 J;  1X55 A;  3BZC A;  3UE1 A;  4YWK A;  1A2T A;  3KLW A;  1JWU D;  3A8K E;  4B3S L;  1SND A;  4YHH L;  1XMQ Q;  1NY4 A;  4JBM A;  1V43 A;  5C44 B;  1CHP D;  1H9J A;  2OCE A;  2ALY B;  1K0S A;  1PYB A;  1PH9 A;  2KA7 A;  5HGQ A;  2JA6 B;  3PO3 H;  3AEV A;  1VQE A;  2ASB A;  2J0T D;  1HNZ Q;  5JEA J;  2JA5 B;  5T1G A;  1WJJ A;  5ELE A;  5JEA H;  4YWM A;  3KYH C;  2QDL A;  3S16 B;  3T1Y Q;  5GQO A;  4R4C A;  3SE0 A;  4B3T Q;  2LFN A;  1HUN A;  2R92 G;  4YCW A;  2C9O A;  3PUV A;  1P16 A;  2F0O A;  4JW0 A;  3M4P A;  1SNM A;  4FYD A;  1UUP A;  4L63 B;  1KIX A;  1ENC A;  1D5X C;  1EIF A;  1ZYR C;  3BU2 A;  2KUM A;  2YV5 A;  3WWV A;  4K8J A;  4QIW B;  1NAP A;  5EGT A;  5KRU A;  5ELO A;  1L2F A;  4U68 A;  1Q3L A;  4JI3 L;  2PNH A;  5GAG C;  1TWG B;  1TS5 A;  2AQ3 B;  4MTK A;  3N6R A;  2LXJ A;  4DXG A;  4YCU A;  5ELN A;  2C5C A;  1FVI A;  2A6H C;  1PZK D;  1KQS A;  3MXN B;  1SNO A;  4RCN A;  4Y7N H;  1X6O A;  1EIY B;  3FKI H;  4BWG B;  3BJU A;  4BA2 I;  1YNJ D;  2ZXO A;  2CWA A;  2DJG C;  3OPO A;  1XJV A;  1N34 L;  3CCR A;  3SK5 A;  3HOZ G;  3MHB A;  2GVB A;  3N52 A;  4QL5 A;  4ALP A;  2R6G A;  2F4V Q;  4EQO A;  1VCI A;  4JC0 A;  4I65 A;  2EYO A;  1JC7 A;  1B9N A;  1U4R A;  3KJP A;  1I5F A;  3S1N B;  1Z6H A;  3CXC A;  1VQ6 A;  2MHV A;  4R4I A;  4CJ0 B;  4C1N I;  1XPO A;  2B39 A;  3OWE B;  2K03 A;  4IUN A;  4GNX B;  4J15 A;  1TS4 A;  2K50 A;  5IT9 E;  2WAC A;  2XWJ B;  2E75 C;  3RR5 A;  2JEB I;  5CBA E;  1PZI D;  5M3M B;  4RA8 A;  3GTP B;  3CCJ A;  2IT1 A;  3KDF A;  1SFO H;  1UE5 A;  1X65 A;  2VUM G;  3HOU H;  3S14 H;  4OO1 H;  1IBL L;  1KNA A;  1BR9 A;  3NK9 A;  3GP7 A;  5BN5 A;  1X9N A;  2WV6 D;  2R3Z A;  2A68 C;  3MXG A;  4BBR B;  4PZ8 A;  4A3D H;  4C2M H;  3M7G A;  3NQI A;  3D8G A;  1L1O C;  3GV3 A;  1A2U A;  2KEN A;  3FHW A;  2YU9 B;  1HXY D;  1MGS A;  2KCT A;  2HUG A;  5FJ8 H;  2QGQ A;  2K5D A;  3S1R B;  2EYM A;  3G6E A;  3VA7 A;  3SHL A;  1U9R A;  3F2D A;  5K36 H;  3TRE A;  4WFN 3;  4A3C G;  1A6X A;  1S72 A;  4MNO A;  1AP0 A;  3M7N A;  4ME3 A;  4HIO A;  3I90 A;  1I4R A;  1XYI A;  1WOC A;  1UWV A;  5L37 A;  3T13 A;  3CCE A;  4A93 H;  3OW7 A;  3G71 A;  1C7Y A;  4DV7 L;  4LW1 A;  4A3G G;  4F88 A;  2R93 B;  4PMC A;  4DR4 L;  1S5F D;  3S1Q B;  2A19 A;  1E22 A;  5IIF A;  1YHQ A;  4MIU A;  2PMZ B;  2R7Z G;  1I4P A;  4A3J H;  2O4X A;  3CRL C; 
#chains in the Genus database with same CATH homology
 4XQN A;  4KJN A;  2KQ3 A;  2X6G A;  1UEA B;  1J9O A;  1TII D;  3NUC A;  2G9D A;  3GTQ B;  2FHT A;  2F0F A;  3PV0 A;  1ZEQ X;  5EKK A;  4DGZ A;  3D3R A;  5FLX L;  1GUS A;  3D4D A;  3TBI B;  2TSS A;  5IGD A;  2LS0 1;  4XXE A;  2CHB D;  1DCZ A;  4G7Z C;  4FF4 A;  2AWN A;  3RZO B;  3EA6 A;  2BDN A;  4X3U A;  2B8G A;  2GA4 B;  2EZV A;  1LO5 D;  4ABN A;  1I4Q A;  1A3V A;  1SEB D;  3D4W A;  5CV8 A;  2M2L A;  1U4P A;  4KN4 C;  3D31 A;  2K32 A;  4QMG A;  2SNS A;  2K04 A;  3DUZ A;  2O2L D;  1O78 A;  4F8M A;  1LTS D;  2F0W A;  2ZXR A;  2WKD A;  4ME5 A;  1STA A;  5I2X A;  4C3H G;  1F2L A;  1LLR D;  4FF3 A;  5C4X B;  1EFI D;  1ESF A;  2DNC A;  4DAP A;  1E0B A;  3TZU A;  1S5D D;  2L9H A;  5CC4 A;  1JE4 A;  3J81 E;  4B9X A;  2F0Q A;  3R93 A;  4EQN A;  2MP1 A;  2FFK B;  2XRQ D;  3RUZ A;  1LAC A;  3PIO 3;  1EQT A;  1Q1E A;  3QWN A;  3ERO A;  4A3B B;  4PMB A;  4IFD G;  1BCP C;  1SNC A;  2PCF B;  3SEB A;  2E74 C;  3K58 A;  4H0L C;  4MN3 A;  1PRT D;  2NUC A;  5LHY 1;  2PZU A;  2Q8T A;  1LAB A;  1B53 A;  1XTC D;  1Q12 A;  2QF7 A;  5DEH A;  3K57 A;  3PUY A;  1EL0 A;  1EY0 A;  4EGV A;  4K14 A;  2F0L A;  2L5T A;  1GXD C;  4N9P A;  3J7A V;  5CV7 A;  3K5L A;  2EJG C;  3U9S A;  2ICE C;  2JXM B;  5FK9 C;  1JWM D;  1O7Y A;  2RSN A;  5BN4 A;  4QB4 A;  4LK1 C;  4ZUI A;  1PDQ A;  4PNY A;  1EZ6 A;  4EVO A;  1B44 D;  1SJH D;  3SDZ A;  4DF7 A;  1KDC A;  2EY5 A;  5C3X A;  1CQF A;  2OXP A;  3A7A B;  3GTJ B;  3QJY A;  5ELF A;  4FXD A;  1QB5 D;  3BYT B;  5E4W C;  2WKC A;  3NXW A;  1ENA A;  1V1P A;  2Y0S B;  1KLG D;  3ONA B;  2B2T C;  4C3J B;  4ILW A;  4RCO A;  3QIA A;  4KJO A;  2Z1C A;  1HFG A;  1EYA A;  2D62 A;  3GO5 A;  4RAU C;  4CHT B;  1PLF A;  1YNN D;  2J4X A;  1E2W A;  1QCB D;  2G9H D;  2HDL A;  2O5I C;  1CA6 A;  2B63 B;  2J7Z A;  1ET9 A;  1MI2 A;  4O1N A;  2L1B A;  2K28 A;  5FO9 B;  1F2Z A;  4RFB A;  1J8I A;  1SJE D;  2I07 B;  3PO3 B;  2B2U C;  1EYD A;  4KKS A;  2B2Y C;  3C2P A;  5J1Z A;  2EY1 A;  1QJO A;  4GZY C;  1MSG A;  1NR4 A;  1PZJ D;  1DZ1 A;  1DD2 A;  5CV4 A;  1BCP B;  4K5W A;  3ERQ A;  1F2Y A;  3DEO A;  5NUC A;  2EYH A;  4M1U B;  1TT2 A;  5JOB A;  4RHR A;  4L6T B;  2IX0 A;  2JYO A;  3R3O A;  1U4L A;  1LV9 A;  1O7Z A;  2ZT9 C;  3Q24 A;  2KCC A;  5DAU A;  2NBF A;  4FXK C;  5C6A A;  1BCP F;  5EPK A;  2QDB A;  2NTT A;  5E3F A;  2O5J C;  2A5H A;  4UAI A;  3BS1 A;  4NP5 A;  4JK1 C;  4Y7N B;  3ITP A;  1R4P B;  4ZKC B;  3FKI B;  5T1I A;  2IX1 A;  1WD1 A;  3K7A B;  4G57 A;  2BOS A;  5C3W A;  3HP3 A;  3J80 E;  1B2T A;  3A56 A;  3K5M A;  2F03 A;  1QE6 A;  1WTQ A;  4K8I A;  2WB1 B;  1FR3 A;  5EQ0 A;  5KNC A;  2AQ2 B;  5IGG A;  4XT1 B;  1Z47 A;  3HKZ B;  4XDX A;  5A35 A;  1FNW A;  3Q22 A;  3VR5 A;  5J22 A;  2PPB C;  2KOL A;  1EY8 A;  5ELB A;  3ND9 A;  4C56 C;  1WTR A;  4C1N K;  5JVG 3;  2XIW A;  2NB0 A;  2L0C A;  3T51 B;  1Y8O B;  1AN8 A;  3LWU A;  3PUZ A;  1SFO B;  4RGN A;  5FOB B;  3IL8 A;  5CR3 A;  3HOU B;  2MPM A;  2F0P A;  4ULL A;  3S14 B;  2JEA I;  2PW7 A;  4XYO A;  3DWA A;  4A3D B;  4C2M B;  2EE1 A;  2Z4I A;  2JE6 I;  3TN2 A;  1HHV A;  2QEJ C;  1CHQ D;  3A7L A;  4KN7 C;  1JOQ A;  1CM9 A;  3KLS A;  4DK0 A;  2AUJ D;  2CW0 D;  3SXH A;  1ZXT A;  2F4I A;  3BG3 A;  4FNF A;  3QO2 A;  1B50 A;  2EDG A;  3ND8 A;  4A3M B;  2F0I A;  1SMY D;  1EY9 A;  2R61 A;  1I4G A;  4A93 B;  2RA4 A;  3KBX A;  5C5M A;  2A6E D;  4J1M A;  1SE2 A;  1WD0 A;  3RLF A;  2AWO A;  5KYL A;  1IW7 D;  2D2C C;  4A3J B;  1JR0 D;  1EU4 A;  2EJM A;  4HTH A;  3LNN A;  1HRJ A;  1E2V A;  3HG9 A;  4H44 C;  2H1E A;  1CTM A;  3HZX A;  3BZD B;  3L9A X;  4MHE A;  3IFD A;  1KTK A;  2BCO A;  1OXS C;  3LX0 A;  2B2V C;  3T53 B;  2PQE A;  3I4L A;  3MWY W;  1JQY D;  3SVM A;  1DOM A;  1NCV A;  2XRS D;  1WCM B;  4R8I A;  1LTI D;  1JOK A;  2K1B A;  4NDX A;  5LL6 X;  5CV6 A;  2WAQ B;  1GOZ A;  1PFB A;  3GTL B;  1RTO A;  2LMC B;  3MXP A;  4BA1 I;  2E2I B;  1ZYR D;  1RJT A;  2B2T A;  1G91 A;  5I4D A;  1B3A A;  5EKI A;  1SYB A;  1EY7 A;  1UNS A;  4DNT B;  1GHK A;  3A8J E;  1F9Q A;  5G3L F;  3QOJ A;  5EBD A;  1KAA A;  2A6H D;  3DM1 A;  3GD7 A;  1CI3 M;  3MFY A;  1SYF A;  4HED A;  1G8Z D;  3DXJ C;  5COY A;  1QOH A;  3PO2 B;  3M85 A;  1RHP A;  4CBV A;  2VNU D;  5CYU A;  3MEH A;  3J81 L;  1TWF B;  3OWF A;  1EQV A;  2K7V A;  1T5E A;  2FMM A;  2HQE A;  1SBB B;  2B2U A;  4A3E B;  3X3M A;  2B2Y A;  3EJI A;  2M9V A;  1QG7 A;  2DY8 A;  4OO1 I;  5CV5 A;  1X3Q A;  5EPL A;  3K6O A;  5M9O A;  5KIX A;  3K5O A;  4HSP A;  4CJ1 B;  2VB2 X;  4UDU C;  3W2D A;  2FIN B;  5I6W A;  3GTK B;  4KMU C;  4H7B A;  4G7H C;  2NWG A;  4HSV A;  3Q23 A;  2F0H A;  1ESR A;  4IUU A;  5M3F B;  2A68 D;  1Z7T A;  1EY4 A;  2EYL A;  1M8A A;  4FXG C;  4B9W A;  2XWB B;  2K6A A;  3I4M B;  2LY7 A;  3Q6S A;  1C4Q A;  2MJ8 A;  4U67 3;  2F0J A;  2M00 A;  4AYB B;  1EY6 A;  2F1M A;  5EPJ A;  5C0X J;  4FF1 A;  1BQQ T;  5C0X H;  5ELC A;  1TVX A;  1BF4 A;  3QB3 A;  5COR A;  2VUM B;  3MXN A;  1F9R A;  3NTK A;  1F9S A;  3E5S A;  3TP5 A;  3MFG A;  1HTP A;  2FMC A;  5C0X I;  1RKN A;  3VYR A;  3MTS A;  1F2M A;  2NN6 H;  3CU7 A;  3I8Z A;  4TSS A;  2NN6 I;  3S2D B;  3H6M A;  3GTO B;  1Y1W B;  4N9T A;  3MZ5 A;  5EBC A;  1STE A;  1VMP A;  1WTO A;  1HA6 A;  1KNE A;  1HUM A;  2B2W C;  2ENB A;  4G7O C;  1H9S B;  3WOE A;  3CHB D;  3C46 A;  4RGO S;  3NTI A;  2ID0 A;  3TZD A;  2F0G A;  2SDF A;  2QCP X;  1RDP D;  1W6K A;  4QF4 A;  4TRD A;  2K5W A;  1TU2 B;  3TSS A;  1QWY A;  1VF5 C;  3IAY A;  1EEI D;  2A69 C;  1FD7 D;  4B08 A;  4CKC A;  4NKL A;  4V19 0;  3K59 A;  1MD2 D;  1PTO H;  2KHS A;  1B9M A;  1ONL A;  5M5X B;  3DEP A;  4CGY B;  3NPP A;  4RKB A;  1RD9 D;  3CRK C;  3OMG A;  1JOR A;  4RGT A;  2EVB A;  1HCZ A;  4PQX A;  4ZYS A;  1BBX C;  4ZLT F;  1AFP A;  1WTX A;  4CKB A;  2A69 D;  2FJ2 A;  1TR5 A;  5IOC A;  3TP7 A;  4HN7 A;  3E0J A;  1NR2 A;  3BVM A;  2Q8I B;  3C1F A;  4IAL A;  3I73 A;  3VA5 A;  4C3J G;  4O42 A;  3I4N B;  1VF7 A;  2B2V A;  4OIJ A;  2OEO A;  1PYW D;  3J80 L;  2RDH A;  4PV1 C;  1LT3 D;  3WOF A;  3D4R A;  1BCP D;  1R4Q B;  5KYI A;  1KAB A;  1MBY A;  3C1E A;  3V05 A;  1JWS D;  2NZ1 D;  4DXF A;  2WIN B;  2Q8R E;  1DXM A;  3RMH A;  4K2L A;  5HUR A;  1WTP A;  4Z9C B;  3NBH A;  2D5D A;  3IFT A;  4R9W A;  4XYQ A;  5I9O A;  1I4X A;  2PNR C;  4HAE A;  4ZQ3 A;  5C3E B;  1LTB D;  3H0G B;  4KD3 A;  1BNZ A;  2PW5 A;  2SOB A;  1STN A;  4F7X A;  5D14 A;  4YIJ A;  3E6Z X;  1EOT A;  5JEA G;  1VDZ A;  4TQU S;  4I7Z C;  5IGE A;  3PIP 3;  2LKV A;  3G7L A;  3R8B A;  1XX8 A;  2KCN A;  1LTG D;  1GUG A;  4H13 C;  1PFM A;  4FP5 D;  3HOY B;  1IHZ A;  4KKT A;  5KNB A;  1S4Z A;  4IZ8 A;  1EIH A;  1GUO A;  3VYT A;  1B1Z A;  1A3T A;  4KKU A;  3GV6 A;  3HOX B;  3LWE A;  4TKO B;  1Q8I A;  2F0M A;  2L4N A;  3TP6 A;  1EEF D;  4BY7 B;  2D9U A;  3BVG A;  1JB3 A;  2PZT A;  4HCE A;  1XWE A;  3DWQ A;  4KY7 A;  3I72 A;  4KHZ A;  3P7J A;  4IUP A;  3OHX C;  2N88 A;  5I6Y A;  1ROD A;  1KDA A;  1STB A;  3VR2 A;  4DFA A;  1ET6 A;  3PUW A;  3RD4 A;  3DHQ A;  3JAM E;  5HGT A;  2CQA A;  1Y8N B;  1V1O A;  1Q1B A;  5JPN C;  3URY A;  3NWT A;  4X3K A;  1OXT A;  3ZYY X;  2IPK D;  4IUR A;  2HCI A;  5IGC A;  5JPM C;  4RWS C;  3BDL A;  4OO1 G;  3HEJ A;  2DY7 A;  5EJW A;  2NVT B;  4A3F B;  1SAP A;  3VYU A;  1D1I A;  5IOD A;  3L7Z C;  2AQ1 B;  1JOO A;  2EY2 A;  3GTM B;  1CZW A;  1SYE A;  4ZK9 B;  4XQJ A;  4K5V A;  1FGB D;  5K36 G;  1I6H B;  2ZXP A;  5E1F A;  5CBE E;  3QOL A;  1DOL A;  1GJX A;  1OO9 B;  4DN4 M;  5IT9 L;  3FMC A;  4NW2 A;  1F9P A;  1BDO A;  5FKA C;  5A2Q E;  3I70 A;  2TMP A;  5G3L D;  1FYC A;  1I6V C;  2IW3 A;  4P2C B;  3UI2 A;  1CT1 D;  4WRD A;  1DOK A;  2B8F A;  5IGB A;  4IFD J;  4KV6 A;  1SYG A;  1BOS A;  1PTO C;  3H91 A;  1MSH A;  4IFD H;  2HDM A;  2F0V A;  3TP8 A;  3S15 B;  3C3L A;  2JSO A;  5BN3 A;  3KUP A;  4IFD I;  3DWP A;  3SK8 A;  1WTW A;  2BE5 C;  1CA5 A;  1H9R A;  4DU9 A;  5I2Y A;  1UAP A;  4C3I B;  1ICW A;  2HCC A;  1PFN A;  4ZAI A;  3NP8 A;  4S3S A;  1EY5 A;  2NVQ B;  3L3O C;  1RTN A;  5C5L A;  4KY5 A;  1SDF A;  1DM0 B;  1AZQ A;  1K8O A;  2QIL A;  4WOR A;  1EZ8 A;  2RDF A;  3A55 A;  3NBI A;  4JBW A;  3GTG B;  3F2U A;  4QUC A;  1CZG A;  3MAQ A;  3P20 A;  2V4D A;  3HRZ C;  1TY2 A;  1BXT A;  2ICI A;  3T16 A;  1BUV T;  2K05 A;  3X3N A;  2RVL A;  4RGM A;  4A3K B;  5C4J B;  5ELD A;  2K5Q A;  1Y1V B;  4QUF A;  1X32 A;  3KLS X;  2EYF A;  3A8I E;  4CKE A;  4OHJ A;  2N55 A;  4KY6 A;  3MXU A;  1YNJ C;  1HQR D;  2E76 C;  1CK1 A;  2KVM A;  3NSW A;  5DM7 3;  1ZKO A;  4ZRZ A;  4F87 A;  1G29 1;  3T4A C;  3VR3 A;  2L11 A;  4Q0F A;  2EYJ A;  5C4H A;  4HMJ A;  4RHS A;  1VMC A;  2NVX B;  2KED A;  4HR7 B;  5EKL A;  2RQX A;  1TQO A;  3P75 A;  3I3C A;  3NWS A;  3OIQ A;  2R92 B;  5LL6 S;  1PTO B;  1GUN A;  2E2D C;  3SK6 A;  3AB9 A;  3R2T A;  3K5N A;  4XTC S;  5JVH 3;  3BVZ A;  1ML0 D;  3H94 A;  3RZD B;  4FO2 A;  2OF1 A;  2KEC A;  1Y69 U;  4X3T A;  1HQM C;  1AW7 A;  2X6L A;  3NQT A;  1PTO F;  3BYY B;  5CMD A;  3M3Y B;  2SEB D;  1KDB A;  1TS2 A;  1SYD A;  2WII B;  3WDN A;  3HOZ B;  3EFX D;  3BDC A;  2IL8 A;  3IKJ A;  2MGS A;  4OIK A;  5C4Z A;  1OXV A;  1STG A;  1Y8P B;  2F3V A;  4RH6 A;  1EWC A;  2PO4 A;  5CGK A;  1H9M A;  1S5E D;  1WTV A;  3I91 A;  1C8C A;  4K6L A;  4G4K A;  4QCL A;  2F0K A;  3MA2 B;  2OT2 A;  1LT5 D;  1TWH B;  3J7Y W;  1KLU D;  2F0S A;  4J6H A;  2F0U A;  2JP1 A;  3KF8 A;  3H3V C;  3NHH A;  4RKL A;  5KND A;  1D6E C;  4CJ2 C;  2Z8L A;  5FO8 B;  4KHV A;  5D3I B;  1TS3 A;  2NYZ D;  4DK1 A;  3K0Y A;  1IYV A;  1OXX K;  1LT4 D;  1TWC B;  5F2D A;  1K8M A;  2BDO A;  4LMQ D;  4IUT A;  3VR4 A;  1SSO A;  4LJZ C;  1RCV D;  2EPB A;  1ILQ A;  1CQV A;  1W6J A;  1JIC A;  5FO7 B;  5ISR A;  1R9T B;  1U4M A;  1H9K A;  1TWA B;  4DAV A;  2RSO A;  3NTH A;  1AZP A;  1ILP A;  4A3G B;  1V1P B;  3V96 A;  1NSN S;  4DA2 A;  1O7L A;  2R7Z B;  1F77 A;  1CFM A;  2JA8 B;  1FNU A;  2RBM A;  2SNM A;  3CQZ B;  4HCS A;  3G6J B;  4IUQ A;  1TKW B;  2F0E A;  3NE5 B;  1A15 A;  1STY A;  1X3P A;  3SR1 A;  2PZW A;  4ODG A;  2PYK A;  4Q5V A;  1PRT C;  1S5B D;  2EYP A;  2AUK A;  1SXT A;  3JAM L;  4KK7 A;  1I50 B;  2Z4H A;  4X3S A;  3EVQ A;  1HTL D;  3M4Y A;  3R2I A;  3QG1 A;  4K6D A;  2QKI C;  4BS9 A;  5K5P A;  4KTA A;  5TSS A;  3S1M B;  1DYQ A;  2F0T A;  3CKI B;  1FNV A;  2IWH A;  4IUV A;  1D1K A;  3S2H B;  4L8J A;  3KK7 A;  4PMW A;  2MUY A;  4A3I B;  1RF2 D;  1D2B A;  1G2T A;  2F3W A;  1M4V A;  2L55 A;  2XN9 C;  4C3H B;  1C48 A;  2L12 A;  3DMU A;  1O80 A;  4XT3 B;  2H4O A;  1E2Z A;  3MVV A;  2KEE A;  1QNU A;  2RDG A;  5KEE A;  1SNQ A;  4K2K A;  4ID6 A;  4NMZ A;  3FVQ A;  5DNF A;  5J39 A;  1EIG A;  1GUT A;  4FVM A;  1XXG A;  5A2Q L;  1K83 B;  2EY6 A;  3HOW B;  2BA0 A;  2IX3 A;  1JCK B;  1G6Z A;  1OXU A;  4J8Q A;  3HOV B;  3EQL C;  1GUW A;  1STH A;  3A54 A;  3TME A;  1H9S A;  1YNN C;  1S5C D;  5FLX E;  4FF2 A;  1L0X B;  1SYC A;  3OSO A;  3U9O A;  1EU3 A;  5M5Y B;  1L0Y B;  3FRP B;  3O13 A;  2IJ0 A;  1GHJ A;  5JJZ A;  2K33 A;  4IN3 A;  2K01 A;  1D5M C;  3T56 B;  4DNR B;  1AEX A;  4LAA A;  2EXZ A;  1TY0 A;  2XVS A;  1HA5 A;  1Q90 A;  4KD4 A;  2EOT A;  1SE4 A;  1PRT B;  2E2J B;  3PUX A;  2F0D A;  1QNK A;  3J7A F;  1T5X D;  4ZKB B;  4OL7 A;  1G2S A;  5M5W B;  3D6W A;  3HS0 C;  5E4X A;  4DAY A;  2E2H B;  4E6I A;  5D3D A;  3BDO A;  2A73 B;  1I3Q B;  1D5Z C;  1DJR D;  1IYU A;  1LTR D;  4WJW A;  1PRT F;  1II3 A;  5KGU A;  2VB3 X;  3FPP A;  3GQB A;  3FEW X;  3HGB A;  1PXU A;  3OIP A;  3KLR A;  2BA1 A;  1V8Q A;  1BO0 A;  3FDT A;  5DM6 3;  5AFW A;  5IGF A;  4XQQ A;  3VYS A;  3S17 B;  1EYC A;  1SE3 A;  1A3U A;  3SK4 A;  1HFN A;  4C3I G;  1LT6 D;  4V0B A;  5D65 A;  3V2T A;  1LTT D;  4BBS B;  2DNE A;  3AU7 A;  2XNA C;  3M4O B;  2B2W A;  4BY1 B;  1SNP A;  3OMC A;  2F0N A;  2YYZ A;  2JA7 B;  1PMR A;  3FPU B;  4IQZ A;  2NTS A;  4ZUJ A;  4XIG S;  1IL8 A;  4K5X A;  1ENF A;  2EJF C;  3OOC A;  5JAV A;  1B4O A;  2I46 A;  1DON A;  3H09 A;  3W3A A;  1LTA D;  1NUC A;  1QIL A;  2RKS A;  4M8A A;  3Q0A A;  5C0X G;  3VR6 A;  2X69 A;  3P1H A;  2A74 C;  2CW0 C;  2DN8 A;  3AMU A;  1IKM A;  2KJX A;  1SMY C;  2XSC A;  4HMI A;  5CV9 A;  2NN6 G;  4OGQ C;  3TDQ A;  5I9P A;  3S9W A;  2NVY B;  1PTO D;  2VXW A;  3KBG A;  1IKL A;  3MC0 B;  2A6E C;  2CVR A;  4KI0 A;  1HPC A;  1IW7 C;  1WVL A;  1I4H A;  4EQP A;  1EWH A;  2BE5 D;  3PMF A;  3D6C A;  4R8N A;  2WP8 J;  1A2T A;  1JWU D;  3A8K E;  1SND A;  1V43 A;  5C44 B;  1CHP D;  1H9J A;  2KA7 A;  2JA6 B;  2J0T D;  5JEA J;  2JA5 B;  5T1G A;  5ELE A;  5JEA H;  3S16 B;  3SE0 A;  2LFN A;  1HUN A;  2C9O A;  3PUV A;  2F0O A;  1SNM A;  4FYD A;  1UUP A;  4L63 B;  1ENC A;  1D5X C;  1ZYR C;  2KUM A;  4K8J A;  4QIW B;  1NAP A;  5EGT A;  5KRU A;  4U68 A;  1Q3L A;  1TWG B;  1TS5 A;  2AQ3 B;  3N6R A;  4DXG A;  2C5C A;  2A6H C;  1PZK D;  1SNO A;  4RCN A;  4BWG B;  4BA2 I;  1YNJ D;  2ZXO A;  3OPO A;  3SK5 A;  3MHB A;  3N52 A;  2R6G A;  4EQO A;  1VCI A;  4I65 A;  2EYO A;  1JC7 A;  1B9N A;  1U4R A;  3S1N B;  1Z6H A;  2MHV A;  4CJ0 B;  4C1N I;  2B39 A;  3OWE B;  2K03 A;  4IUN A;  1TS4 A;  5IT9 E;  2WAC A;  2XWJ B;  2E75 C;  2JEB I;  5CBA E;  1PZI D;  5M3M B;  4RA8 A;  3GTP B;  2IT1 A;  4OO1 H;  1KNA A;  1BR9 A;  3NK9 A;  3GP7 A;  5BN5 A;  2WV6 D;  2R3Z A;  2A68 C;  3MXG A;  4BBR B;  3M7G A;  3NQI A;  3D8G A;  3GV3 A;  1A2U A;  2YU9 B;  1HXY D;  1MGS A;  2HUG A;  2K5D A;  3S1R B;  2EYM A;  3VA7 A;  3SHL A;  1U9R A;  5K36 H;  4WFN 3;  1A6X A;  1AP0 A;  3M7N A;  3I90 A;  1I4R A;  1XYI A;  3T13 A;  3OW7 A;  4F88 A;  2R93 B;  4PMC A;  1S5F D;  3S1Q B;  5IIF A;  4MIU A;  2PMZ B;  1I4P A;  2O4X A;  3CRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...