1LACA

Three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (acyltransferase)
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE
publication title Three-dimensional structure of the lipoyl domain from Bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 8
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lacA00
1V8QA 2JEAI 2K32A 2KA7A 1A6XA 1Q1EA 3N6RA 1IW7D 4H0LC 4IFDG 2L5TA 1GUGA 1O78A 2BA1A 1E2WA 2Q8IB 4JBWA 1GUSA 4KHZA 1OXTA 4KMUC 1HQMC 3A7AB 3PUYA 2EJFC 3T53B 4G7HC 3A7LA 4LJZC 1IW7C 3AB9A 2PPBC 3KLRA 1DCZA 1E2ZA 1H9SA 4RCNA 3OW7A 2DNEA 1Y69U 2LMCB 4BA2I 3LNNA 4OGQC 2QF7A 3I4LA 4DK1A 1OXSC 5K36H 2K7VA 1VF7A 2NN6H 3IFTA 4TQUS 3IKJA 2D5DA 2A6ED 1DXMA 1LACA 2B8GA 2R6GA 2BE5D 5BN5A 2JEBI 1DD2A 5KNBA 1TKWB 1Y8PB 2A69D 4GZYC 1Q12A 1K8OA 5A35A 1GHKA 4OO1H 4DNRB 2CW0C 1FYCA 3U9SA 2EDGA 1Z7TA 2AUKA 2A6EC 1VDZA 2D62A 4DNTB 1VCIA 2BE5C 3VR3A 3L7ZC 5C0XH 3T56B 2A69C 1Y8NB 2KCCA 2EJMA 4KN7C 1GUOA 2PNRC 3CRLC 5BN4A 1K8MA 4KKTA 3BDOA 1H9RA 2O5IC 1HCZA 3VR4A 2JE6I 3VA7A 2V4DA 1E2VA 3ND9A 2D2CC 2E76C 3M4YA 5JEAH 3GQBA 4PV1C 2A6HD 3FMCA 1T5EA 3LWUA 3RLFA 1V43A 3CRKC 1CTMA 1OXXK 2PCFB 1H9SB 1G291 1HTPA 2AWOA 3I72A 3PUXA 3HGBA 3D31A 1Y8OB 2NN6G 4TKOB 2A6HC 3WDNA 3PV0A 2YYZA 3PUWA 1H9JA 1LABA 4BA1I 1ONLA 1TU2B 3M85A 1Q90A 3MXUA 3PUZA 1B9NA 3H94A 2BA0A 3DXJC 3D4RA 4OO1G 1ZYRC 1CI3M 1GUNA 1IYVA 2ZT9C 4H44C 1IYUA 3ND8A 2DNCA 1OXUA 3OOCA 4L8JA 2E74C 3FPPA 4IQZA 1YNNC 5KNDA 4G7ZC 3P20A 4IFDH 2O5JC 3T51B 1GHJA 1O7LA 2EJGC 2JXMB 4LK1C 3A8JE 3SDZA 1FR3A 4DK0A 1QJOA 1OXVA 1BDOA 2A68D 3QJYA 3A8KE 2DN8A 3A8IE 1EWHA 1H9MA 3EQLC 3PUVA 4HR7B 3VR2A 1Z6HA 1GUTA 2NN6I 2BDOA 5JEAG 4JK1C 4H13C 4KKSA 3BG3A 5K36G 3I73A 1PMRA 4I7ZC 4XIGS 2A68C 2E75C 2IT1A 3MFYA 4KN4C 3GD7A 1HPCA 3SE0A 2EVBA 1ZKOA 2F1MA 3NE5B 1VF5C 2AUJD 3M7NA 3VR6A 1SMYC 1B9MA 1I6VC 4KKUA 3TZUA 1Q1BA 5C0XG 1CFMA 1YNJC 2B8FA 3QG1A 4XTCS 3VR5A 5KNCA 3QIAA 2K33A 3W3AA 1GJXA 4G7OC 1H9KA 4KI0A 5BN3A 3OPOA
chains in the Genus database with same CATH superfamily
1HNZL 1WTWA 5D3IB 1A3TA 2JEAI 1XTCD 3CPFA 1QCBD 2EY2A 3U4VA 1GUSA 1W3SA 2Z4HA 2K5VA 2EJFC 1U5KA 2B2VA 4L63B 2JA5B 4J15A 2LXKA 2QGQA 5C44B 1OXSC 4QMGA 4DV0L 4JI0Q 3K5MA 1VMCA 1SNMA 1N34Q 1PRTB 2F0IA 2EOTA 2PW7A 4DR1Q 2L1BA 2B8GA 2R93H 1AEXA 1EYDA 1F9RA 1GHKA 2NTSA 2KCNA 1PZID 1TWAH 4KHVA 4DAPA 4A3IH 5GAEC 2NWGA 3KOJA 1MD2D 2BE5C 3PO3H 2MGSA 4U68A 4YHHQ 1SBBB 2OQ0A 3RR5A 1TY2A 3HRZC 2R92G 4KV6A 2D0OA 1RL2A 2NVYB 5C3XA 4RH6A 1VQ8A 4DR4Q 4X62L 1HRJA 4DV5Q 1U9RA 1V43A 2CKZB 3WOFA 1WD1A 5IYCG 1CTMA 5FOBB 5KIXA 1F2ZA 2QW7A 1ET6A 3GTLB 5JVG3 4RKBA 3URYA 4EQNA 4B3ML 3PUZA 2WAQE 2CQOA 1WCMB 1IYVA 1CI3M 1UE7A 3G7LA 5E1FA 4IQZA 3PO2G 3HOXB 1ZXTA 3M7GA 4DKAC 1K73C 1SNDA 1BR9A 4LW1A 1OXVA 1I4GA 1ILPA 1ENAA 3OIQA 4JI8Q 4HN7A 3OHXC 2WV6D 3KLWA 4AYBE 3HOWG 3OTOL 2A68C 5T1GA 2M2LA 4WORA 4KHPL 1JICA 5A2QL 4CHTB 1SYBA 1UEAB 4J6HA 1T9HA 5EKKA 4XTCS 1STEA 2VB3X 2NYZD 5CV6A 3VR5A 1PZJD 4BY7G 1SAPA 2WP8J 2QDBA 3ITPA 1EZ8A 1MI2A 1WYDA 1F9QA 1CZGA 1EIFA 1DGSA 1PFBA 2B2WC 2Z6KC 3PGZA 1E2WA 2WB1B 3J81i 1I50B 5JVH3 2CWAA 4A3DH 1XNRQ 1DCZA 1PVOA 3TS0A 2LMCB 3I4LA 2XRSD 4XQNA 2CW0D 2VNUD 3M9BA 1X32A 1Y1WG 2F0HA 4BWGB 1LACA 1KDBA 2EYJA 1XTDA 4A3BG 1BO0A 2B2WA 2Z6KA 4OO1H 2F0EA 4G57A 1SYEA 5I4DA 5ELNA 1WI5A 2EJMA 2KCMA 3AEVA 1SE4A 2JA8B 2RQXA 1J5EL 1AE3A 3M3YB 1KTKA 2VQFQ 2V4DA 2VXWA 4ABNA 2IHFA 3DWQA 5M3MB 1HZAA 2F0NA 4R4QA 1NR2A 1TT2A 1IYJB 4FF2A 2WINB 1BCPC 2JA5H 5H1SE 4DV4L 4YIJA 3PUWA 1S5ED 3STBD 5C44H 2JYOA 4GLAC 2HUGA 5GAGC 5IGEA 1YNNC 2IX0A 1D7QA 2OQKA 3RNUA 2HDLA 2KCTA 3T51B 4CKBA 2OTLA 2RDFA 2I5HA 1PFSA 2F0UA 4HR7B 4ID6A 4X66Q 2I0QA 2ZTCA 4LF6L 1GUTA 2AQ1B 2EYOA 3KLSX 2KBNA 2AWNA 1TWCB 5K36G 1PZKD 3KK7A 2K5HA 4LFAL 2HIVA 3H09A 3G4SA 3MTSA 3CHBD 3CC7A 2NVYH 5M5WB 1B4OA 1WOCA 1D5ZC 3TP6A 1U4RA 1AE2A 5J22A 3VR6A 4XQJA 5FO7B 4HJ7A 1HNXL 1BOSA 1K8AC 5I9OA 3GTLH 1H95A 3JC66 2K5QA 2NUCA 3I70A 3LX0A 3EA6A 4B3RQ 4A3KB 4B9WA 1K28A 4EQPA 5F2DA 4HAEA 3AQQA 1WCMH 1EQVA 5JPMC 1EOVA 4JBWA 3ER0A 4UY8C 1Q8IA 4FYDA 3HOXH 3TN2A 2I46A 1A62A 4X3UA 1PA6A 5C4XB 1AW7A 2PZWA 4YWMA 3AU7A 3HOVB 1F2YA 3QB3A 4DF7A 2IL8A 2G5DA 4IUPA 2NBFA 5IWAL 1DXMA 2B63B 1SJHD 5COYA 3A54A 4K8JA 1VQMA 1G2SA 4V0BA 4DNRB 3GV6A 1JORA 1FYCA 4ZUJA 1TS5A 3CQZB 2Y0SB 3T56B 3DLLA 2L0CA 3OWEB 4A4IA 4LF4L 2HT1A 3ULLA 4FXKC 4DFAA 3S24A 3J80c 3SHLA 3VYRA 1STBA 1VMPA 2OCEA 3CCMA 3A5UA 3OMCA 4ZKCB 1I50H 2F4VL 2K03A 4AYBB 5D14A 2E5LQ 4LF5Q 3UDGA 1HTPA 4XYQA 1GXDC 5J39A 3C46A 3PV0A 5DM73 1VQPA 4B3TQ 1FL0A 1YNJD 2R7FA 3MXNB 1RTOA 3J80E 4IJLA 2HHHL 4DV7L 1XX8A 4JI1L 1G8ZD 2DNCA 3K7AB 2K5NA 2MPMA 1STYA 2R3ZA 4GNXC 2K4KA 4WRDA 1HJPA 1DONA 2VZAA 4O1NA 1FNUA 1KABA 2BDOA 2JA8H 3J7AV 3M3YH 1Y1VB 5IGGA 4JI3Q 1PH3A 1SEBD 1EQRA 4HCEA 2F0FA 1ASZA 2EE1A 2VS1A 5IGDA 4CDFC 5EKLA 5M3MH 2ID0A 1X55A 3BJUA 4JYAQ 3L2PA 5M3FG 1FGUA 3WOEA 5C0XG 2Q8RE 1VQBA 1D1IA 3CD6A 4GNXA 3QOJA 4DXGA 4L5RC 2K75A 3IRBA 3TP8A 1X65A 1FNVA 4OL7A 2K32A 1MSHA 1V1OA 1KRTA 4P75A 4QF4A 2X6LA 2Q8IB 5CC4A 2EYPA 4ME5A 5D65A 2FMMA 1CUKA 5AJ3Q 2XWBB 2OEOA 3LNNA 4N9PA 4OGQC 5CV7A 3A5ZB 1PRTF 4GKKQ 4IOCA 1TWCH 1HQRD 1NNXA 3HOZB 4GZYC 4DUZL 1KLUD 5M5WH 3FHWA 4ZRZA 4LAAA 2UUCL 3I4NG 1C48A 4LFCQ 2Q2TA 2Z4IA 3CKIB 4PMWA 2UUBQ 3RZOB 1ET9A 3CMAA 4DUYL 3QWNA 2PI2A 4PZ7A 3NENA 4RMFA 4FF3A 4IZ8A 1E24A 3I91A 3K0XA 2QDLA 4GOPB 3DWPA 4A3KH 4I65A 4RCOA 5JEAH 1HH2P 5IT9c 4PV1C 1E1OA 5CORA 4N8X1 1A15A 2FJ2A 1JWMD 3K7UC 1CKMA 2M00A 5C4XH 4K2KA 2VQEQ 3UI2A 2XNAC 2VY3A 3HOVH 1PH8A 4X64L 2RA4A 3H91A 5CV9A 3F2UA 4JBMA 3H94A 1TQOA 3I4MG 1TWGB 3D4RA 3M4OB 4JV5L 4RAUC 1X3EA 4NB3A 1J8IA 4G7ZC 2O5JC 2H5XA 2G9DA 4DR5Q 3GO5A 5IYBH 1QJOA 1YZ6A 4BY1G 3CQZH 3EROA 1Q46A 1S5BD 3EN2A 4JK1C 4FP5D 4P72A 3J80L 1PH6A 1N36Q 3DUZA 2NZ1D 3SE0A 2L15A 4P2CB 1DZ1A 1ZKOA 1UE6A 1JC7A 1SNOA 3S1NB 3TZUA 2QEXA 1CZWA 1TS4A 2MJ8A 1D5MC 4LF9L 4G7OC 3R2TA 1H9KA 1MIUA 1PDQA 2C9OA 2WACA 5IYDG 1EEFD 1IW7D 4H0LC 3T16A 2I5LX 3J7ZC 4GS3A 4IFDG 2UXBL 5JJKA 4OX9Q 2R7ZG 4RHRA 3K57A 3K7AH 3NBIA 1PH1A 1U4MA 3A7AB 5G3LD 1TY0A 5ELEA 4Q0FA 4DV6L 4DR6L 3Q8DA 3MAQA 3CC2A 1AP0A 4HJ5A 1FJGL 2F0WA 3E5SA 1XJVA 4NXNL 4A3CG 1RCVD 4YY3Q 3FPUB 4YWKA 3SGIA 1Y1VH 2K6AA 1SE8A 3T1HQ 2FHTA 2NZOA 4LUVA 5CV4A 4EQOA 4OHJA 3U9SA 3NPPA 4UHVA 1N33L 1KIXA 1LTGD 2AQ2B 1ESFA 2XRQD 1PYSB 1RJTA 3BVMA 3QOLA 1UUPA 4JI2Q 3VR4A 5IGCA 4R8IA 1XMOL 3AMUA 3VA7A 3E0EA 1X3QA 3M4YA 3ULJA 5ELFA 1Q7YC 2A6HD 3LWUA 1BKBA 4R4CA 4RG1A 4KK7A 2JJQA 3BVGA 2PW5A 1A8VA 1PH9A 1JCKB 5DAUA 1JOOA 2OWOA 4CBVA 4RA8A 2ZXOA 3CF5A 4OWTB 2YYZA 1ICFB 5IOCA 3H0GG 2RKSA 3K6OA 4APVA 4DNIA 1QE6A 1X3FA 1VQ9A 2R7DA 2WB1E 2I07B 4H44C 3PO2B 3PIOA 1OXUA 3S15B 1SNCA 2JP1A 3HOZH 2ZXRA 3FKIB 1M1KC 1HZBA 1YJWA 5C3WA 2QCPX 2F0QA 3RZOH 1D1KA 2VB2X 5J3BA 1IHZA 2AQ3B 2SNSA 1LM0A 4X3KA 3E6ZX 4YHHL 3T1YL 1LTTD 1EYAA 2IT1A 3OWFA 3GV3A 3CP0A 3SEBA 1VF5C 3DWAA 3L0OA 2L12A 4YWLA 1ENFA 2JK8A 1EZ6A 1VQ7A 2YU9B 4IUVA 2HDMA 3D8GA 4JVZA 3CCSA 4A3EG 4BY7B 2K33A 1G2TA 3MXUA 3TEHB 1B3AA 3SK5A 1TWGH 2L5TA 1OO9B 1CKOA 1CHQD 1UE5A 2NB0A 3HFZB 3M4OH 4JI6Q 1C8CA 1O7ZA 1W6JA 1LLRD 1EU4A 4H7BA 3E3XA 3P1HA 1JOKA 2N8NA 2DUDA 3CAMA 4LJZC 1Y69U 4RCNA 1LTSD 1VQ5A 1HR0Q 5C0XJ 4ODGA 3OSOA 4R1JA 1VF7A 4HMJA 2PYKA 3EFXD 1XMQQ 2WKDA 4ZYSA 1Q12A 2B2TA 3TDQA 5A35A 2CW0C 3K58A 3NBHB 3PMFA 4OIKA 4AQYQ 3S1NH 4A3GG 1QWYA 3MEHA 1J6QA 1CA5A 1YVCA 2EPBA 1EEID 4BXXH 3D4WA 3VDYA 4A3FB 3CXCA 3S2DB 4M1UB 1NSNS 4DA2A 4KLKA 3HGBA 3VYUA 2C5CA 3VYSA 3Q24A 2RVLA 4R4TA 2R93G 1HUNA 4BA1I 3M85A 4NP5A 1CQFA 1XNRL 2KEEA 1MJEA 5J1ZA 2J4XA 4A3IG 2A74C 3STBC 3PO3G 3U58A 4Q5VA 5CBAE 1JE4A 3GP7A 5LMUQ 2K01A 3AFPA 1YNXA 1FVIA 3NTKA 1XWEA 3KF6B 2K04A 1YJNA 1B2TA 3E9IA 1V1PA 4L6TB 4WJ4A 3HP3A 1HZ9A 1G51A 2MNAA 1E7ZA 4CKEA 4C2MB 5JJIA 1CK1A 3CU7A 2Y0SE 1K0RA 1HR0W 5IYCH 2QKIC 3C2PA 3Q22A 4QQBX 2LKVA 2ICEC 2JQOA 1EOTA 1W2BA 3NSWA 1EY8A 1EIYB 4EGVA 2FFKB 4GLXA 3FRPB 4TVAB 2K28A 4C3IG 4GN5A 4FF1A 4A3JG 2KHSA 2F0OA 1N9WA 3OW2A 4QGUA 3HKSA 3RLNA 2HCCA 5I9PA 3PO2H 4DR3L 3S15H 3RZDB 4DV1Q 2NVTB 3FKIH 1HNWL 1H9SA 1E2ZA 4BA2I 5EPJA 3VYTA 2UXCQ 3MWYW 4XT3B 5LL6X 1L0WA 3TREA 4XDXA 1SJED 3IKJA 2A6ED 1U4LA 3HOYG 4X66L 4LFBL 1HNZQ 1NR4A 3F2BA 2K05A 1KAAA 4K5VA 4IFDJ 1S40A 2LS01 1VDZA 2YV5A 1EQQA 1YIJA 2YU9H 2EY6A 2KCCA 2E8GA 1PTOB 5KEEA 4BY7H 2XWJB 2F52A 2ZXPA 1G91A 4QCLA 2CH4A 1EFID 2D0PA 2QILA 4DV0Q 4EQ5A 1YI2A 2Z6BA 3SVMA 1AH9A 4JI5L 1SROA 1JB3A 2PCFB 3PUXA 2MHVA 4K0KQ 2XTIA 1ZYRD 1CT1D 1MGSA 2HQEA 2RSOA 4CKCA 1LABA 1L1OC 3W1GA 1B9NA 1XPRA 4OO1G 1QUQA 3S17B 1U0LA 4P74A 3T13A 5BR8L 4PG3A 5EKIA 1VQGA 5KNDA 4JC0A 3FPPA 5C5LA 1CA6A 4FDBA 2JXMB 5CGKA 3SDZA 1K9MC 4BBRG 4GLVB 3C3LA 3NQTA 3A8IE 1EYGA 5EPLA 5IIFA 1DM0B 2NN6I 1WD0A 3NXWA 5C4JB 1AZQA 3BZDB 1L1OA 5EAYA 4RGOS 3I7FA 2EY1A 1HPCA 1BBXC 4B3MQ 2EY5A 3FDTA 2K52A 3G6JB 4A3FH 4JCVE 3S2DH 4K6LA 2JA5G 3TSSA 3KJPA 4I7AA 3IAYA 3TBIB 4DR7L 2B8FA 4RKLA 3I2ZA 4ZQ3A 1B44D 4N8FA 4HEDA 4YCWA 5C5MA 4LF5L 1SE2A 5EBCA 1M4VA 3S9WA 1EYCA 2IWHA 4QJFA 4KHZA 3CCQA 1ENCA 3OTOQ 3PUYA 1KXLA 4MHEA 4KHPQ 3A7LA 5TSSA 3KLRA 4CGYB 4UAIA 2UXDL 2QF7A 3HKZG 2Q2UA 5K36H 4WJWA 3ZYYX 2UUAQ 3A74A 2F0LA 4MNOA 1K3RA 4FF4A 2PO4A 1JOQA 3I4NB 3BYYB 1BBUA 2EDGA 4C2MH 2BCOA 1BBWA 2BDNA 2J0TD 3MXGA 3DEPA 3NQIA 3KYHC 1K0SA 2XGTA 1WCMG 4A3MG 1HCZA 2O5IC 2AHOB 1SNQA 1IZ6A 4A3LG 3ERSX 1WTXA 3TRZA 2CQAA 3HOXG 3G6EA 2LFNA 2KECA 4JG2A 3K5NA 3RZDH 1TS2A 2NVTH 5IP7H 3LWEA 3EJIA 2JA6G 3CCUA 4F7XA 1VQ6A 2RSNA 5D3DA 3U4ZA 3FVQA 2HCIA 1H9JA 2N88A 5ELBA 1X6OA 1J5EQ 1E3PA 2B29A 4FNFA 1QZHA 1IBKL 2E74C 5CMDA 4KY5A 1EY9A 1HUMA 1PH2A 3FEWX 3UDXA 4BY1B 3A8JE 4DK0A 1SNPA 2Q2IA 3H3VH 4S3SA 3OYYA 3M4PA 3VR2A 3PUVA 3UE1A 1PTOH 4B3SL 4H13C 1NTGA 3Q6SA 1VQFA 2WB1G 1VQNA 5AFWA 5ELCA 1P16A 1G6PA 2AUJD 1P8LA 2WIIB 4GKJQ 1QVGA 3UDIA 1CFMA 2Z9HA 1DYQA 1G6ZA 1TR5A 4TQUS 3TQYA 4OXPA 4PZ6A 4LF6Q 2VQEL 2R7ZB 5M9OA 3S1RH 2OXPA 1PFNA 5G3LF 4ZCKA 1GUGA 2Z8LA 3S17H 1SLJA 4LFAQ 2F3VA 1UWVA 5JPNC 3P7JA 1RDPD 4DAMA 1IW7C 2CHBD 3H15A 4ZUIA 3JAMc 2QA4A 1HNXQ 2KHIA 1STNA 4DR5L 5C4JH 3DEOA 5M3MG 5BN5A 4BS9A 2I5MX 3QO2A 2EYMA 1PH4A 1JJCB 1I4HA 4YCUA 1K8OA 3DHQA 4PZ8A 2GN5A 4JI7L 4YCVA 3CCRA 4X65L 2D62A 5C0XH 2O4XA 3JAME 1KDCA 1FD7D 2JSOA 4OWWB 5BN4A 1HTLD 1V9PA 4B08A 3F1ZA 1Q81C 2A8VA 3I3CA 2EXDA 4LF8L 3FMCA 4DPGA 2EXZA 2LXJA 3QR8A 4M8AA 4HCSA 4DK6C 1IBLL 3HZXA 4OX9L 4IUQA 2A6HC 1GVPA 4OWXB 1I4XA 3A56A 2F0GA 3H0GB 1KQSA 1XNQQ 3S1QB 2E2DC 1TU2B 3F2CA 3C1EA 1PRTC 3MFGA 5IP9G 3S16H 1UAPA 3NBHA 5LMNL 4LF4Q 1CM9A 2NVQB 4YY3L 4AIMA 3I4NH 1SSOA 1I94L 3K59A 4ULLA 2EJGC 2C35B 1WTOA 1S4ZA 2G9HD 5JAVA 1LT3D 5E4XA 3CCLA 1K83B 1EWHA 2F4VQ 1Z6HA 3OMGA 5JEAG 2CVRA 2F03A 1N32L 2UU9L 5FKAC 4PQXA 1IBML 2HHHQ 5IT9E 3NE5B 4DN4M 4P71A 4DV7Q 3SK6A 5C4XG 4JI1Q 2PMZB 1R4PB 1MSGA 1IL8A 4A3EB 5FLMH 3S14B 3ONAB 2F0TA 2Q8TA 1VQLA 3SK8A 1V1QA 2JN4A 4UPAA 4C3HG 4IUNA 2B63G 1DOMA 2IX3A 5DNFA 4NXML 1F9SA 1EY0A 2ZM6L 1CSPA 2F0DA 4JI4L 1O78A 4OELB 3PF4A 2WAQG 1GOZA 4KMUC 4C1NI 1Z9FA 1JQYD 2Y0SG 3KF6A 4BY1H 1GD7A 4DV2Q 2DNEA 1BCPB 2GVAA 4L5TA 3R8BA 3SXHA 1JMCA 4A93G 4PMBA 4MIUA 2VUMB 4K5XA 1JB7A 2NN6H 3P75A 4QUFA 1VQIA 1SE3A 4AYBG 3RLOA 2F0KA 2A1AA 4UP7A 1IXRA 1BNZA 1Z7TA 1KRSA 5KYLA 5NUCA 3J80i 2E2IB 1VQOA 5GAHC 3V05A 2D9UA 4JW0A 1F2LA 3WWVA 1O7IA 2JE6I 5IYDH 2BH8A 4DR2Q 4LF7L 2Z0SA 2R7ZH 5EGTA 1NUCA 4R8NA 4C3JG 4DUZQ 2VL6A 4IPGA 1X3PA 2UUCQ 3BS1A 3JAML 1Y1VG 4Y52H 2NVXB 2ZJRA 5FJ8H 4A3CH 4HIMA 3CCJA 3ERQA 4KY6A 4WFN3 1A2UA 1TIID 1HR0L 1GUNA 2R92B 1IYUA 3ND8A 3EIVA 3NTHA 4TSSA 2A73B 2F0SA 1PFMA 5JJLA 3CMEA 1GHJA 1SYDA 1O7LA 3IFDA 1E22A 2SOBA 1RODA 4XYOA 1T5XD 3QJYA 3A8KE 3HOUG 1I6HB 1S5FD 4KKSA 3I73A 1KNEA 3R3OA 3MFYA 4O2DA 2FXQA 2DY7A 4X64Q 2MQHA 2NTTA 3KJOA 4V190 2PQAB 4DV3Q 3E0JA 2KUMA 1PYWD 4C1NK 4JV5Q 4JI0L 5IODA 1N34L 1JR0D 2JA7G 1NE3A 5I2YA 4QUCA 4DR1L 2BOSA 4LK1C 1SR3A 4C3IB 4IURA 3H0GH 3OPOA 4Y7NB 3NWSA 4A3JB 3S1QH 5E3FA 1LV9A 1F9PA 4PNYA 5M5XB 1VS0A 3HOWB 4BBSG 3TMEA 1YBYA 2F4IA 2NVQH 2F3WA 1OXTA 5IT9L 2CWPA 3KBGA 1NAPA 2K14A 3I8ZA 1K83H 4XT1B 3HEJA 3J81c 4DR4L 3HOYB 2D5DA 4DV5L 4POFA 4LF9Q 4MTNA 1STHA 1Y8PB 3T4AC 3ICEA 3VA5A 5C3EG 3GTOB 2A6EC 1PYBA 2UXBQ 2B2TC 3VR3A 1F77A 4CDEC 4X3SA 4A3EH 3PIO3 2BH2A 2ASBA 3S14H 3J81E 4DV6Q 1MJCA 3MA2B 4DR6Q 3K8AA 1K8GA 1D8LA 1S5DD 1TWHB 3J7A5 1FJGQ 3CW2C 1C9OA 2B39A 4DU9A 1Y1WB 1QILA 4A3BB 4IN3A 3R93A 3GTMB 1HA5A 4TRDA 4J8QA 3I72A 2JA9A 4NDXA 4JI8L 5DM63 2AKWB 3H3VI 4K8IA 1N33Q 1Q90A 2VUMH 3DXJC 1ZYRC 1A3VA 2ES2A 2RCNA 2K5DA 1HA6A 1XMOQ 1NBWA 5EBDA 1PTOD 3I4OA 3P20A 1Q8KA 1B1ZA 4IUTA 4BBRB 1YHQA 1ASYA 1QVFA 1E0BA 2E2IH 1H9MA 3EQLC 4LMQD 2GA4B 2DY8A 2EZVA 4BXXG 4R4IA 3BG3A 5M5YB 1SDFA 1SMYD 1EY4A 2E75C 3GD7A 5HY6A 2EVBA 1BXTA 1CSQA 2LY7A 3AFQA 4DXFA 3M7NA 1ZEQX 1GKHA 3NELA 4KKUA 3RMHA 1SYFA 1PH5A 2YTVA 3I55A 4HJ8A 4NMZA 1M8AA 2N49A 5DLQE 1JJGA 2NVXH 1XYIA 5C4ZA 1UE1A 5CV5A 1CHPD 5KGUA 4K0KL 3H6MA 5JEAJ 3R2IA 1CKNB 2Z1CA 1LO5D 5CR3A 1PV4A 2R92H 2BA1A 1SYGA 3G71A 3T1YQ 3KUPA 4POGA 1WJJA 4G7HC 3GTPB 2HIXA 5ELDA 1RHPA 2B2YC 3HKZB 1VQEA 3S2HB 2XN9C 5C0XI 2VQFL 5ISRA 4FO2A 1I6HH 2K7VA 4MZ9A 3BZCA 3MXNA 1KNAA 1HXYD 1TS3A 4CDCC 3BDLA 1D6EC 1EQTA 3S1MB 1TKWB 2A69D 5EJWA 1U4PA 1R9TB 2RDGA 2IPKD 1S72A 2AUKA 2KJXA 4MTKA 2MO1A 1SXTA 1F2MA 2SDFA 4A76A 1TWFB 1A0IA 2B2YA 1STGA 4A3MB 1I4RA 3ULPA 1IKLA 1NMFA 1B3QA 4C3IH 4L5QA 1SFOB 4Y7NH 4A3JH 1KAWA 2HD3A 3NK9A 2E76C 2F0PA 3GQBA 5M5XH 1NY4A 3FKIG 3HOWH 1T5EA 1XXGA 1YEZA 2JA6B 2EYHA 1LYLA 4NPSA 2N55A 1C7YA 1SN8A 5GQOA 2B3GA 3D31A 3I90A 4L5SA 1DJRD 4RFBA 3J81L 3X3MA 1PH7A 4C56C 4JBKA 1VQJA 3HOYH 3B6YA 4QIWB 4A75A 2X6GA 1UNSA 2UUAL 3I56A 3GTOH 5CBEE 4IJHA 4A3DG 4NW2A 3SK4A 5IGBA 3GDEA 1VQDA 4B3RL 3BYTB 2F0VA 3F8TA 3N52A 2PZTA 5CV8A 1KL9A 4U673 2F0JA 4I7ZC 1TWHH 5DEHA 3J7YW 4KJOA 1FNWA 4GOPC 3NWTA 5FK9C 1WVLA 2OT2A 2DGYA 3D6CA 4KD3A 1Y1WH 1EL0A 3S1RB 2N78A 1EWCA 1R4QB 4A3BH 1Q1BA 4HSPA 3GTMH 1MBYA 4RHSA 3LGJA 1YNJC 1QOHA 2J7ZA 2K1BA 5KNCA 5E7NA 3U9OA 4DAYB 4X62Q 5BN3A 2E2JB 3HG9A 2DJGC 1Y14B 3KF8B 5HURA 4GOPA 5CYUA 4XQQA 3BU2A 3NTIA 5E4WC 2QEJC 1A2TA 3MVVA 3GTQB 4BBRH 1B7YB 1O80A 1BCPF 3OW7A 1D5XC 5M3FB 5JJZA 3HS0C 2PNHA 4ZAIA 2Q2HA 5C44G 4ME3A 2XIWA 4RGNA 1X56A 5M5YH 1TVXA 4A3FG 2R6GA 2BE5D 2E5LL 4IFDI 3AYHB 1YHAA 2XVSA 3KDFB 5LL6S 1EIHA 4B3TL 4DR3Q 1Y8NB 2PNRC 1GO3E 3A0JA 3CRLC 1K8MA 5K5PA 1PHJA 1HNWQ 4QL5A 2VW9A 3FP9A 4GKJL 4ZKBB 1JWSD 2H1EA 1WTQA 4KY7A 3V96A 3L3OC 3W1BA 3PCOB 2KOLA 3S16B 1QG7A 2PMZE 2IHEA 4LFBQ 1G291 2ATWA 4UDUC 3GTPH 3V2TA 1Y8OB 4JI3L 4TKOB 3S2HH 4P73A 1I4PA 3K0YA 3G48A 2BA0A 1QB5D 2MUYA 3NUCA 4IPDA 2OF1A 4X3TA 4JYAL 4HTHA 4L8JA 3S1MH 4KJNA 2A5HA 1HFNA 5L37A 3UDFA 1RD9D 1R9TH 1DOLA 4LWCA 1FR3A 1VQKA 4JI5Q 1SMXA 1LT6D 1LTBD 2A68D 2TMPA 1GUWA 2DN8A 4LUOA 4OONA 1RTNA 1TWFH 2R61A 4O42A 3K80C 4A3MH 5FLXc 4B9XA 1JE5A 1QVCA 1TXYA 1SFOH 4A3LH 3GTKB 1KLGD 2KQ3A 3I4MB 3X3NA 1YHBA 5IP7G 5AJ3L 4CJ2C 1L0XB 3U50C 1WTRA 3A55A 1PLFA 1RF2D 1RKNA 5BR8Q 2JA6H 2B2UC 3KLSA 1VQCA 5FLXE 4C3HB 4GKKL 3BDCA 3ZJYC 4KI0A 2X69A 1M90C 1YJ9A 1IL2A 1LTID 1LUZA 2ZTDA 2EQSA 2KA7A 3NEMA 2F3IA 1Q86C 4LFCL 2WAQB 2SEBD 1XNQL 4FXDA 2UUBL 2FMCA 4DV4Q 1HQMC 1EWIA 4H02A 2RBMA 2YTYA 3AB9A 2PPBC 1I4QA 4A93B 2B2UA 4DK1A 4O0AA 2K5WA 1NMGA 1S3OA 4DR7Q 1V1PB 4JBJA 5FO8B 1B70B 2PQAA 3NHHA 4RWSC 4K6DA 4PMCA 5EQ0A 5C4HA 1CQVA 2KVMA 1YITA 2O2LD 1L0YB 3C1FA 2ENBA 2ZJPA 2RHSB 3UE0A 1GUOA 1X9NA 1DOKA 1FGBD 3CPWA 3CCVA 3K5OA 2JA8G 2E2JH 2LSSA 1BQQT 3BVZA 2UXDQ 1I3QB 3J7AF 4QY7A 1BCPD 1EFWA 1RIPA 4C3JB 4R4OA 1STAA 1OXXK 1H9SB 3GTQH 2PZUA 2V1CC 1LT5D 5M3FH 2E2HB 1N36L 1YNND 1X3GA 3K5LA 2HQLA 1IKMA 4MN3A 4DV2L 4RGMA 1EY7A 4HSVA 3EVQA 1MHWC 5IGFA 3RUZA 3TP7A 3BZKA 3W2DA 4AH6A 3L9AX 3HOUB 5T1IA 5IWAQ 2SNMA 4UP8A 3GTJB 2IX1A 2ZTEA 2MP1A 4ILWA 1B50A 2L9HA 3RN2A 1JT8A 4XIGS 1PXUA 4OEMB 2F1MA 1JJ2A 3CCEA 2M9VA 1LT4D 2IJ0A 4DR2L 1ICWA 2JA7B 1IBKQ 5JOBA 2XSCA 2FINB 3QIAA 3TS2A 3T1HL 4F87A 2RDHA 1V8QA 4K5WA 5IP9H 1L2FA 1QUQB 1BF4A 1A6XA 1Q1EA 1I5FA 3N6RA 4BBSB 3D0FA 4A3KG 4B3SQ 3DM1A 3T53B 2CCZA 5ELOA 4JI2L 2ZJQA 4R9WA 2KHJA 5FLXL 2L4NA 3HOVG 4KTAA 1ESRA 3PF5A 1L1OB 3IFTA 4F88A 2IW3A 3GTKH 5C3EB 3GTGB 4UP9A 4IO9A 3CC4A 2EYFA 3I4MH 5FLMG 2MO0A 5LHY1 4IPCA 1LTLA 2MFIA 1XPOA 2PI2E 1VCIA 4K2LA 5IYBG 3RN5A 4X6AH 4C3HH 4DV3L 4HIOA 2B63H 4KKTA 1W6KA 1CKNA 5C6AA 4Z9CB 5I2XA 1E2VA 3Q0AA 1SYCA 1Q3LA 4WJ3M 3RLFA 1JWUD 3CRKC 3K81C 4JI7Q 1AFPA 2NN6G 4X65Q 2GVBA 3WDNA 5I6WA 4A93H 4A3GB 1BVSA 5KYIA 1N8RC 3DM3A 1AZPA 2F0MA 1GM5A 4DGZA 1PTOF 4OIJA 2WFWA 3KFUA 4IALA 2IY5B 4LF8Q 4IFDH 3HKZE 4DK3C 3H3VC 4GN3B 2A19A 2RCFA 2KEDA 1S5CD 1PTOC 1LTRD 1IBLQ 1X54A 4KD4A 1VQ4A 1HHVA 4CDDC 4JI6L 1PMRA 3F2DA 2R93B 5GADC 1ML0D 4OO1I 1NCVA 2NZHA 1EUJA 4CJ1B 1I3QH 2L11A 3TP5A 2DJFC 4DUYQ 1C0AA 1TWAB 2CH4W 4LUZA 4A3IB 1Q82C 3OIPA 1KHIA 1SMYC 4C3JH 5LMNQ 1B9MA 1AN8A 3PO3B 4ALPA 1C4QA 5FJ8G 1J9OA 3QG1A 1I94Q 1XMQL 3W3AA 2OTJA 1QNKA 2E2HH 1WTPA 3EBEA 3KBXA 4CJ0B 1K3BC 4DAVA 1VQHA 3MC0B 3JAMi 4AQYL 5FO9B 1B8AA 1N32Q 4QB4A 1LTAD 2UU9Q 1IBMQ 2P5ZX 3MXPA 3PSIA 3HOUH 4HIKA 2CFMA 3RD4A 3IL8A 3GTJH 4QIWE 2AMCB 2JEBI 1DD2A 1B53A 5HGQA 5KNBA 4NXMQ 1PRTD 4XXEA 1WTVA 5IY0A 3M4QA 4N9TA 2ZM6Q 3HOZG 3Q23A 1A3UA 4IOAA 4EX5A 5HGTA 4JI4Q 4ZLTF 1UEBA 4DNTB 1MKHA 3L7ZC 4DAYA 2JA7H 2A69C 4ZK9B 4KN7C 3KF8A 4HJ9A 3BDOA 1H9RA 3PIPA 2TSSA 3O13A 1WFQA 2ALYB 1E1TA 3ND9A 3J81j 1EY6A 2D2CC 4BBSH 5LMUL 5IE8A 3SR1A 4K14A 2EIFA 4JOIC 4F8MA 1WTHA 2EYLA 2AWOA 1SRUA 1A63A 4HMIA 3MZ5A 2ICIA 1D2BA 1O7YA 3D3RA 5KRUA 5I6YA 1ONLA 4GNXB 3D4DA 3E9HA 2K50A 5EPKA 3KDFA 1ILQA 2ZT9C 5A2QE 3OOCA 5LMNW 3PQIA 5C3EH 3GTGH 4EVOA 2N3SA 1QNUA 1QZGA 3NP8A 4GN4B 4HJAA 1NJIC 4LF7Q 1BUVT 4NXNQ 2YTXA 4A3DB 3W5OA 3D6WA 3DMUA 3MHBA 1OTCA 4JOIA 1KDAA 1BDOA 1VQAA 4IUUA 2L55A 3TZDA 1HFGA 1KC8C 3PIP3 1XPUA 4E6IA 4DV1L 4KN4C 4HIDA 3MEFA 4NKLA 2KENA 1EIGA 4FVMA 2RHQB 2WKCA 2B2VC 2PQEA 2UXCL 4IPHA 4LNQA 4J1MA 1I6VC 1Z47A 1EU3A 1HZCA 1II3A 5GROA 2RF4A 4G4KA 1EY5A 2VUMG 1GJXA 4JPBW 1KD1C 2H4OA 4RGTA 4A3GH 4FXGC
chains in the Genus database with same CATH topology
1WTWA 5D3IB 1A3TA 2JEAI 1XTCD 1QCBD 2EY2A 1GUSA 2Z4HA 2EJFC 2B2VA 4L63B 2JA5B 5C44B 1OXSC 4QMGA 3K5MA 1VMCA 1SNMA 1PRTB 2F0IA 2EOTA 2PW7A 2L1BA 2B8GA 1AEXA 1EYDA 1F9RA 1GHKA 2NTSA 2KCNA 1PZID 4KHVA 4DAPA 2NWGA 1MD2D 2BE5C 2MGSA 4U68A 1SBBB 1TY2A 3HRZC 4KV6A 2NVYB 5C3XA 4RH6A 1HRJA 1U9RA 1V43A 3WOFA 1WD1A 1CTMA 5FOBB 5KIXA 1F2ZA 1ET6A 3GTLB 5JVG3 4RKBA 3URYA 4EQNA 3PUZA 1WCMB 1IYVA 1CI3M 3G7LA 5E1FA 4IQZA 3HOXB 1ZXTA 3M7GA 1SNDA 1BR9A 1OXVA 1I4GA 1ILPA 1ENAA 3OIQA 4HN7A 3OHXC 2WV6D 2A68C 5T1GA 2M2LA 4WORA 1JICA 5A2QL 4CHTB 1SYBA 1UEAB 4J6HA 5EKKA 4XTCS 1STEA 2VB3X 2NYZD 5CV6A 3VR5A 1PZJD 1SAPA 2WP8J 2QDBA 1EZ8A 1MI2A 3ITPA 1F9QA 1CZGA 1PFBA 2B2WC 1E2WA 2WB1B 1I50B 5JVH3 1DCZA 2LMCB 3I4LA 2XRSD 4XQNA 2CW0D 2VNUD 1X32A 2F0HA 4BWGB 1LACA 1KDBA 2EYJA 1BO0A 2B2WA 4OO1H 2F0EA 4G57A 1SYEA 5I4DA 2EJMA 1SE4A 2JA8B 2RQXA 3M3YB 1KTKA 2V4DA 2VXWA 4ABNA 4RGTA 3DWQA 5M3MB 2F0NA 1NR2A 1TT2A 4FF2A 2WINB 1BCPC 4YIJA 3PUWA 1S5ED 2JYOA 2HUGA 5IGEA 1YNNC 2IX0A 2HDLA 3T51B 4CKBA 2RDFA 2F0UA 4HR7B 4ID6A 1GUTA 2AQ1B 2EYOA 3KLSX 2AWNA 1TWCB 5K36G 1PZKD 3KK7A 3H09A 3MTSA 3CHBD 5M5WB 1B4OA 1D5ZC 3TP6A 1U4RA 5J22A 3VR6A 4XQJA 5FO7B 1BOSA 5I9OA 2K5QA 2NUCA 3I70A 3LX0A 3EA6A 4A3KB 4B9WA 4EQPA 5F2DA 4HAEA 1EQVA 5JPMC 4JBWA 1Q8IA 4FYDA 3TN2A 2I46A 4X3UA 5C4XB 1AW7A 2PZWA 3AU7A 3HOVB 1F2YA 3QB3A 4DF7A 2IL8A 4IUPA 2NBFA 1DXMA 2B63B 1SJHD 5COYA 3A54A 4K8JA 1G2SA 4V0BA 4DNRB 3GV6A 1JORA 1FYCA 4ZUJA 1TS5A 3CQZB 2Y0SB 3T56B 2L0CA 3OWEB 4FXKC 4DFAA 3SHLA 3VYRA 1STBA 1VMPA 3OMCA 4ZKCB 2K03A 4AYBB 5D14A 1HTPA 4XYQA 1GXDC 5J39A 3C46A 3PV0A 5DM73 1YNJD 1RTOA 3J80E 1XX8A 1G8ZD 2DNCA 3K7AB 2MPMA 1STYA 2R3ZA 4WRDA 1DONA 4O1NA 1FNUA 1KABA 2BDOA 3J7AV 1Y1VB 5IGGA 1SEBD 4HCEA 2F0FA 2EE1A 5IGDA 5EKLA 2ID0A 3WOEA 5C0XG 2Q8RE 1D1IA 3QOJA 4DXGA 3TP8A 1FNVA 4OL7A 2K32A 1MSHA 1V1OA 4QF4A 2X6LA 2Q8IB 5CC4A 2EYPA 4ME5A 5D65A 2FMMA 2XWBB 2OEOA 3LNNA 4N9PA 4OGQC 5CV7A 1PRTF 1HQRD 3HOZB 4GZYC 1KLUD 4ZRZA 4LAAA 1C48A 2Z4IA 3CKIB 4PMWA 3RZOB 1ET9A 3QWNA 4FF3A 4IZ8A 3I91A 3DWPA 4I65A 4RCOA 5JEAH 4PV1C 5CORA 1A15A 2FJ2A 1JWMD 2M00A 4K2KA 3UI2A 2XNAC 2RA4A 3H91A 5CV9A 3F2UA 3H94A 1TQOA 1TWGB 3D4RA 3M4OB 4RAUC 1J8IA 4G7ZC 2O5JC 2G9DA 3GO5A 1QJOA 3EROA 1S5BD 4JK1C 4FP5D 3J80L 3DUZA 2NZ1D 3SE0A 1DZ1A 4P2CB 1ZKOA 1JC7A 1SNOA 3S1NB 3TZUA 1CZWA 1TS4A 2MJ8A 1D5MC 4G7OC 3R2TA 1H9KA 1PDQA 2C9OA 2WACA 1EEFD 1IW7D 4H0LC 3T16A 4IFDG 4RHRA 3K57A 3NBIA 1U4MA 3A7AB 5G3LD 1TY0A 5ELEA 4Q0FA 3MAQA 1AP0A 2F0WA 3E5SA 1RCVD 3FPUB 2K6AA 2FHTA 5CV4A 4EQOA 4OHJA 3U9SA 3NPPA 1LTGD 2AQ2B 1ESFA 2XRQD 1RJTA 3BVMA 3QOLA 1UUPA 3VR4A 5IGCA 4R8IA 3AMUA 3VA7A 1X3QA 3M4YA 5ELFA 2A6HD 3LWUA 4KK7A 3BVGA 2PW5A 1JCKB 5DAUA 1JOOA 4CBVA 4RA8A 2ZXOA 2YYZA 5IOCA 3K6OA 2RKSA 1QE6A 2I07B 4H44C 3PO2B 1OXUA 3S15B 1SNCA 2JP1A 2ZXRA 3FKIB 5C3WA 2QCPX 2F0QA 1D1KA 2VB2X 1IHZA 2AQ3B 2SNSA 4X3KA 3E6ZX 1LTTD 1EYAA 2IT1A 3OWFA 3GV3A 3SEBA 1VF5C 3DWAA 2L12A 1ENFA 1EZ6A 2YU9B 4IUVA 2HDMA 3D8GA 4BY7B 2K33A 1G2TA 3MXUA 1B3AA 3SK5A 2L5TA 1OO9B 1CHQD 2NB0A 1C8CA 1O7ZA 1W6JA 1LLRD 1EU4A 4H7BA 3P1HA 1JOKA 4LJZC 1Y69U 4RCNA 1LTSD 5C0XJ 4ODGA 3OSOA 1VF7A 4HMJA 2PYKA 3EFXD 2WKDA 4ZYSA 1Q12A 2B2TA 3TDQA 5A35A 2CW0C 3K58A 3PMFA 4OIKA 1QWYA 3MEHA 1CA5A 2EPBA 1EEID 3D4WA 4A3FB 3S2DB 4M1UB 1NSNS 4DA2A 3HGBA 3VYUA 2C5CA 3VYSA 3Q24A 2RVLA 1HUNA 4BA1I 3M85A 4NP5A 1CQFA 2KEEA 5J1ZA 2J4XA 2A74C 4Q5VA 5CBAE 1JE4A 3GP7A 2K01A 3NTKA 1XWEA 2K04A 1B2TA 1V1PA 4L6TB 3HP3A 4CKEA 4C2MB 1CK1A 3CU7A 2QKIC 3C2PA 3Q22A 2LKVA 2ICEC 1EOTA 3NSWA 1EY8A 4EGVA 2FFKB 3FRPB 2K28A 4C3IG 4FF1A 2KHSA 2F0OA 5I9PA 2HCCA 3RZDB 2NVTB 1H9SA 1E2ZA 4BA2I 5EPJA 3VYTA 3MWYW 4XT3B 5LL6X 4XDXA 1SJED 3IKJA 2A6ED 1U4LA 1NR4A 2K05A 1KAAA 4K5VA 4IFDJ 2LS01 1VDZA 2EY6A 2KCCA 1PTOB 5KEEA 2XWJB 2ZXPA 1G91A 4QCLA 1EFID 2QILA 3SVMA 1JB3A 2PCFB 3PUXA 2MHVA 1ZYRD 1CT1D 1MGSA 2HQEA 2RSOA 4CKCA 1LABA 1B9NA 4OO1G 3S17B 3T13A 5EKIA 5KNDA 3FPPA 5C5LA 1CA6A 2JXMB 5CGKA 3SDZA 3C3LA 3NQTA 3A8IE 5EPLA 5IIFA 1DM0B 2NN6I 1WD0A 3NXWA 5C4JB 1AZQA 3BZDB 4RGOS 2EY1A 1HPCA 1BBXC 2EY5A 3FDTA 3G6JB 4K6LA 3TSSA 3IAYA 3TBIB 2B8FA 4RKLA 4ZQ3A 1B44D 4HEDA 5C5MA 1SE2A 5EBCA 1M4VA 3S9WA 1EYCA 2IWHA 4KHZA 1ENCA 3PUYA 4MHEA 3A7LA 5TSSA 3KLRA 4CGYB 4UAIA 2QF7A 5K36H 4WJWA 3ZYYX 2F0LA 4FF4A 2PO4A 1JOQA 3I4NB 3BYYB 2EDGA 2BCOA 2BDNA 2J0TD 3DEPA 3MXGA 3NQIA 2O5IC 1HCZA 1SNQA 1WTXA 2CQAA 2LFNA 2KECA 3K5NA 1TS2A 3LWEA 3EJIA 4F7XA 2RSNA 5D3DA 3FVQA 2HCIA 1H9JA 2N88A 5ELBA 4FNFA 2E74C 5CMDA 4KY5A 1EY9A 1HUMA 3FEWX 4BY1B 3A8JE 4DK0A 1SNPA 4S3SA 3VR2A 3PUVA 1PTOH 4H13C 3Q6SA 5AFWA 5ELCA 2AUJD 2WIIB 1CFMA 1DYQA 1G6ZA 1TR5A 4TQUS 2R7ZB 5M9OA 2OXPA 1PFNA 5G3LF 1GUGA 2Z8LA 2F3VA 5JPNC 3P7JA 1RDPD 1IW7C 2CHBD 4ZUIA 1STNA 3DEOA 5BN5A 4BS9A 3QO2A 2EYMA 1I4HA 1K8OA 3DHQA 2D62A 5C0XH 2O4XA 3JAME 1KDCA 1FD7D 2JSOA 5BN4A 1HTLD 4B08A 3I3CA 3FMCA 2EXZA 4M8AA 4HCSA 3HZXA 4IUQA 2A6HC 1I4XA 3A56A 2F0GA 3H0GB 3S1QB 2E2DC 1TU2B 3C1EA 1PRTC 3MFGA 1UAPA 3NBHA 1CM9A 2NVQB 1SSOA 3K59A 4ULLA 2EJGC 1WTOA 1S4ZA 2G9HD 5JAVA 1LT3D 5E4XA 1K83B 1EWHA 1Z6HA 3OMGA 5JEAG 2CVRA 2F03A 5FKAC 4PQXA 5IT9E 3NE5B 4DN4M 3SK6A 2PMZB 1R4PB 1MSGA 1IL8A 4A3EB 3S14B 3ONAB 2F0TA 2Q8TA 4C3HG 4IUNA 1DOMA 2IX3A 5DNFA 1F9SA 1EY0A 2F0DA 1O78A 1GOZA 4KMUC 4C1NI 1JQYD 2DNEA 1BCPB 3R8BA 3SXHA 4PMBA 4MIUA 2VUMB 4K5XA 2NN6H 3P75A 4QUFA 1SE3A 2F0KA 1BNZA 1Z7TA 5KYLA 5NUCA 2E2IB 3V05A 2D9UA 1F2LA 2JE6I 5EGTA 1NUCA 4R8NA 4C3JG 1X3PA 3BS1A 3JAML 2NVXB 3ERQA 4KY6A 4WFN3 1A2UA 1TIID 1GUNA 2R92B 1IYUA 3ND8A 3NTHA 4TSSA 2A73B 2F0SA 1PFMA 1GHJA 1SYDA 1O7LA 3IFDA 2SOBA 1RODA 4XYOA 1T5XD 3QJYA 3A8KE 1I6HB 1S5FD 4KKSA 3I73A 1KNEA 3R3OA 3MFYA 2DY7A 2NTTA 4V190 3E0JA 2KUMA 1PYWD 4C1NK 5IODA 1JR0D 5I2YA 4QUCA 2BOSA 4LK1C 4C3IB 4IURA 3OPOA 4Y7NB 3NWSA 4A3JB 5E3FA 1LV9A 1F9PA 4PNYA 5M5XB 3HOWB 3TMEA 2F4IA 2F3WA 1OXTA 5IT9L 3KBGA 1NAPA 3I8ZA 4XT1B 3HEJA 3HOYB 2D5DA 1STHA 1Y8PB 3T4AC 3VA5A 3GTOB 2A6EC 2B2TC 3VR3A 1F77A 4X3SA 3PIO3 3J81E 3MA2B 1S5DD 1TWHB 2B39A 4DU9A 1Y1WB 1QILA 4A3BB 4IN3A 3R93A 3GTMB 1HA5A 4TRDA 4J8QA 3I72A 4NDXA 5DM63 4K8IA 1Q90A 3DXJC 1ZYRC 1A3VA 2K5DA 1HA6A 5EBDA 1PTOD 3P20A 1B1ZA 4IUTA 4BBRB 1E0BA 1H9MA 3EQLC 4LMQD 2GA4B 2DY8A 2EZVA 3BG3A 5M5YB 1SDFA 1SMYD 1EY4A 2E75C 3GD7A 2EVBA 1BXTA 2LY7A 4DXFA 3M7NA 1ZEQX 4KKUA 3RMHA 1SYFA 4NMZA 1M8AA 1XYIA 5C4ZA 5CV5A 1CHPD 5KGUA 3H6MA 5JEAJ 3R2IA 2Z1CA 1LO5D 5CR3A 2BA1A 1SYGA 3KUPA 4G7HC 3GTPB 5ELDA 1RHPA 2B2YC 3HKZB 3S2HB 2XN9C 5C0XI 5ISRA 4FO2A 2K7VA 3MXNA 1KNAA 1HXYD 1TS3A 3S1MB 1D6EC 1EQTA 3BDLA 1TKWB 2A69D 5EJWA 1U4PA 1R9TB 2RDGA 2IPKD 2AUKA 2KJXA 1SXTA 1F2MA 2SDFA 1TWFB 2B2YA 1STGA 4A3MB 1I4RA 1IKLA 1SFOB 2E76C 3NK9A 2F0PA 3GQBA 1T5EA 1XXGA 2JA6B 2EYHA 2N55A 3D31A 3I90A 1DJRD 4RFBA 3J81L 3X3MA 4C56C 4QIWB 2X6GA 1UNSA 5CBEE 4NW2A 3SK4A 5IGBA 3BYTB 2F0VA 3N52A 2PZTA 5CV8A 4U673 2F0JA 4I7ZC 5DEHA 3J7YW 4KJOA 1FNWA 3NWTA 5FK9C 1WVLA 2OT2A 3D6CA 4KD3A 1EL0A 3S1RB 1R4QB 1EWCA 1Q1BA 4HSPA 1MBYA 4RHSA 1YNJC 1QOHA 2J7ZA 2K1BA 5KNCA 3U9OA 5BN3A 2E2JB 3HG9A 5HURA 5CYUA 4XQQA 5E4WC 3NTIA 2QEJC 1A2TA 3MVVA 3GTQB 1O80A 1BCPF 3OW7A 1D5XC 5M3FB 5JJZA 3HS0C 4ZAIA 2XIWA 4RGNA 1TVXA 2R6GA 2BE5D 4IFDI 2XVSA 5LL6S 1EIHA 1Y8NB 2PNRC 3CRLC 1K8MA 5K5PA 4ZKBB 1JWSD 2H1EA 1WTQA 4KY7A 3V96A 3L3OC 2KOLA 3S16B 1QG7A 1G291 4UDUC 3V2TA 1Y8OB 4TKOB 1I4PA 3K0YA 2BA0A 1QB5D 2MUYA 3NUCA 2OF1A 4X3TA 1HFNA 4HTHA 4L8JA 4KJNA 2A5HA 1RD9D 1DOLA 1FR3A 1GUWA 1LT6D 1LTBD 2A68D 2TMPA 2DN8A 1RTNA 4O42A 2R61A 4B9XA 3GTKB 1KLGD 2KQ3A 3I4MB 3X3NA 4CJ2C 1L0XB 1WTRA 3A55A 1PLFA 1RF2D 1RKNA 2B2UC 3KLSA 5FLXE 4C3HB 3BDCA 4KI0A 2X69A 1LTID 2KA7A 2WAQB 2SEBD 4FXDA 2FMCA 1HQMC 2RBMA 3AB9A 2PPBC 1I4QA 4A93B 2B2UA 4DK1A 2K5WA 1V1PB 5FO8B 3NHHA 4RWSC 4K6DA 4PMCA 5EQ0A 5C4HA 1CQVA 2KVMA 2O2LD 1L0YB 3C1FA 2ENBA 1GUOA 1DOKA 1FGBD 3K5OA 1BQQT 3BVZA 1I3QB 3J7AF 1BCPD 4C3JB 1STAA 1OXXK 1H9SB 2PZUA 1LT5D 2E2HB 1YNND 3K5LA 1IKMA 4MN3A 4RGMA 1EY7A 4HSVA 3EVQA 5IGFA 3RUZA 3TP7A 3W2DA 3L9AX 3HOUB 5T1IA 2SNMA 3GTJB 2IX1A 1B50A 2MP1A 4ILWA 2L9HA 4XIGS 1PXUA 2F1MA 2M9VA 1LT4D 2IJ0A 1ICWA 2JA7B 5JOBA 2XSCA 2FINB 3QIAA 4F87A 2RDHA 1V8QA 4K5WA 1BF4A 1A6XA 1Q1EA 3N6RA 4BBSB 3DM1A 3T53B 4R9WA 5FLXL 2L4NA 4KTAA 1ESRA 3IFTA 4F88A 2IW3A 5C3EB 3GTGB 2EYFA 5LHY1 1VCIA 4K2LA 4KKTA 1W6KA 5C6AA 4Z9CB 5I2XA 1E2VA 3Q0AA 1SYCA 1Q3LA 3RLFA 1JWUD 3CRKC 1AFPA 2NN6G 5I6WA 3WDNA 4A3GB 5KYIA 1AZPA 2F0MA 4DGZA 1PTOF 4OIJA 4IALA 4IFDH 3H3VC 2KEDA 1S5CD 1PTOC 1LTRD 4KD4A 1HHVA 1PMRA 2R93B 1ML0D 4OO1I 1NCVA 4CJ1B 2L11A 3TP5A 1TWAB 4A3IB 3OIPA 1SMYC 1B9MA 1AN8A 3PO3B 1C4QA 1J9OA 3QG1A 3W3AA 1QNKA 1WTPA 3KBXA 4CJ0B 4DAVA 3MC0B 5FO9B 4QB4A 1LTAD 3MXPA 3RD4A 3IL8A 2JEBI 1DD2A 1B53A 5KNBA 1PRTD 4XXEA 1WTVA 4N9TA 3Q23A 1A3UA 5HGTA 4ZLTF 4DNTB 3L7ZC 4DAYA 2A69C 4ZK9B 4KN7C 3KF8A 3BDOA 1H9RA 2TSSA 3O13A 3ND9A 1EY6A 2D2CC 3SR1A 4K14A 4F8MA 2EYLA 2AWOA 4HMIA 3MZ5A 2ICIA 1D2BA 1O7YA 3D3RA 5KRUA 5I6YA 1ONLA 3D4DA 5EPKA 1ILQA 2ZT9C 5A2QE 3OOCA 4EVOA 1QNUA 3NP8A 1BUVT 4A3DB 3D6WA 3DMUA 3MHBA 1KDAA 1BDOA 4IUUA 2L55A 3TZDA 1HFGA 3PIP3 4E6IA 4KN4C 4NKLA 1EIGA 4FVMA 2WKCA 2B2VC 2PQEA 4J1MA 1I6VC 1Z47A 1EU3A 1II3A 4G4KA 1EY5A 1GJXA 2H4OA 3SK8A 4FXGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8Q A;  2JEA I;  2K32 A;  2KA7 A;  1A6X A;  1Q1E A;  3N6R A;  1IW7 D;  4H0L C;  4IFD G;  2L5T A;  1GUG A;  1O78 A;  2BA1 A;  1E2W A;  2Q8I B;  4JBW A;  1GUS A;  4KHZ A;  1OXT A;  4KMU C;  1HQM C;  3A7A B;  3PUY A;  2EJF C;  3T53 B;  4G7H C;  3A7L A;  4LJZ C;  1IW7 C;  3AB9 A;  2PPB C;  3KLR A;  1DCZ A;  1E2Z A;  1H9S A;  4RCN A;  3OW7 A;  2DNE A;  1Y69 U;  2LMC B;  4BA2 I;  3LNN A;  4OGQ C;  2QF7 A;  3I4L A;  4DK1 A;  1OXS C;  5K36 H;  2K7V A;  1VF7 A;  2NN6 H;  3IFT A;  4TQU S;  3IKJ A;  2D5D A;  2A6E D;  1DXM A;  1LAC A;  2B8G A;  2R6G A;  2BE5 D;  5BN5 A;  2JEB I;  1DD2 A;  5KNB A;  1TKW B;  1Y8P B;  2A69 D;  4GZY C;  1Q12 A;  1K8O A;  5A35 A;  1GHK A;  4OO1 H;  4DNR B;  2CW0 C;  1FYC A;  3U9S A;  2EDG A;  1Z7T A;  2AUK A;  2A6E C;  1VDZ A;  2D62 A;  4DNT B;  1VCI A;  2BE5 C;  3VR3 A;  3L7Z C;  5C0X H;  3T56 B;  2A69 C;  1Y8N B;  2KCC A;  2EJM A;  4KN7 C;  1GUO A;  2PNR C;  3CRL C;  5BN4 A;  1K8M A;  4KKT A;  3BDO A;  1H9R A;  2O5I C;  1HCZ A;  3VR4 A;  2JE6 I;  3VA7 A;  2V4D A;  1E2V A;  3ND9 A;  2D2C C;  2E76 C;  3M4Y A;  5JEA H;  3GQB A;  4PV1 C;  2A6H D;  3FMC A;  1T5E A;  3LWU A;  3RLF A;  1V43 A;  3CRK C;  1CTM A;  1OXX K;  2PCF B;  1H9S B;  1G29 1;  1HTP A;  2AWO A;  3I72 A;  3PUX A;  3HGB A;  3D31 A;  1Y8O B;  2NN6 G;  4TKO B;  2A6H C;  3WDN A;  3PV0 A;  2YYZ A;  3PUW A;  1H9J A;  1LAB A;  4BA1 I;  1ONL A;  1TU2 B;  3M85 A;  1Q90 A;  3MXU A;  3PUZ A;  1B9N A;  3H94 A;  2BA0 A;  3DXJ C;  3D4R A;  4OO1 G;  1ZYR C;  1CI3 M;  1GUN A;  1IYV A;  2ZT9 C;  4H44 C;  1IYU A;  3ND8 A;  2DNC A;  1OXU A;  3OOC A;  4L8J A;  2E74 C;  3FPP A;  4IQZ A;  1YNN C;  5KND A;  4G7Z C;  3P20 A;  4IFD H;  2O5J C;  3T51 B;  1GHJ A;  1O7L A;  2EJG C;  2JXM B;  4LK1 C;  3A8J E;  3SDZ A;  1FR3 A;  4DK0 A;  1QJO A;  1OXV A;  1BDO A;  2A68 D;  3QJY A;  3A8K E;  2DN8 A;  3A8I E;  1EWH A;  1H9M A;  3EQL C;  3PUV A;  4HR7 B;  3VR2 A;  1Z6H A;  1GUT A;  2NN6 I;  2BDO A;  5JEA G;  4JK1 C;  4H13 C;  4KKS A;  3BG3 A;  5K36 G;  3I73 A;  1PMR A;  4I7Z C;  4XIG S;  2A68 C;  2E75 C;  2IT1 A;  3MFY A;  4KN4 C;  3GD7 A;  1HPC A;  3SE0 A;  2EVB A;  1ZKO A;  2F1M A;  3NE5 B;  1VF5 C;  2AUJ D;  3M7N A;  3VR6 A;  1SMY C;  1B9M A;  1I6V C;  4KKU A;  3TZU A;  1Q1B A;  5C0X G;  1CFM A;  1YNJ C;  2B8F A;  3QG1 A;  4XTC S;  3VR5 A;  5KNC A;  3QIA A;  2K33 A;  3W3A A;  1GJX A;  4G7O C;  1H9K A;  4KI0 A;  5BN3 A;  3OPO A; 
#chains in the Genus database with same CATH topology
 1HNZ L;  1WTW A;  5D3I B;  1A3T A;  2JEA I;  1XTC D;  3CPF A;  1QCB D;  2EY2 A;  3U4V A;  1GUS A;  1W3S A;  2Z4H A;  2K5V A;  2EJF C;  1U5K A;  2B2V A;  4L63 B;  2JA5 B;  4J15 A;  2LXK A;  2QGQ A;  5C44 B;  1OXS C;  4QMG A;  4DV0 L;  4JI0 Q;  3K5M A;  1VMC A;  1SNM A;  1N34 Q;  1PRT B;  2F0I A;  2EOT A;  2PW7 A;  4DR1 Q;  2L1B A;  2B8G A;  2R93 H;  1AEX A;  1EYD A;  1F9R A;  1GHK A;  2NTS A;  2KCN A;  1PZI D;  1TWA H;  4KHV A;  4DAP A;  4A3I H;  5GAE C;  2NWG A;  3KOJ A;  1MD2 D;  2BE5 C;  3PO3 H;  2MGS A;  4U68 A;  4YHH Q;  1SBB B;  2OQ0 A;  3RR5 A;  1TY2 A;  3HRZ C;  2R92 G;  4KV6 A;  2D0O A;  1RL2 A;  2NVY B;  5C3X A;  4RH6 A;  1VQ8 A;  4DR4 Q;  4X62 L;  1HRJ A;  4DV5 Q;  1U9R A;  1V43 A;  2CKZ B;  3WOF A;  1WD1 A;  5IYC G;  1CTM A;  5FOB B;  5KIX A;  1F2Z A;  2QW7 A;  1ET6 A;  3GTL B;  5JVG 3;  4RKB A;  3URY A;  4EQN A;  4B3M L;  3PUZ A;  2WAQ E;  2CQO A;  1WCM B;  1IYV A;  1CI3 M;  1UE7 A;  3G7L A;  5E1F A;  4IQZ A;  3PO2 G;  3HOX B;  1ZXT A;  3M7G A;  4DKA C;  1K73 C;  1SND A;  1BR9 A;  4LW1 A;  1OXV A;  1I4G A;  1ILP A;  1ENA A;  3OIQ A;  4JI8 Q;  4HN7 A;  3OHX C;  2WV6 D;  3KLW A;  4AYB E;  3HOW G;  3OTO L;  2A68 C;  5T1G A;  2M2L A;  4WOR A;  4KHP L;  1JIC A;  5A2Q L;  4CHT B;  1SYB A;  1UEA B;  4J6H A;  1T9H A;  5EKK A;  4XTC S;  1STE A;  2VB3 X;  2NYZ D;  5CV6 A;  3VR5 A;  1PZJ D;  4BY7 G;  1SAP A;  2WP8 J;  2QDB A;  3ITP A;  1EZ8 A;  1MI2 A;  1WYD A;  1F9Q A;  1CZG A;  1EIF A;  1DGS A;  1PFB A;  2B2W C;  2Z6K C;  3PGZ A;  1E2W A;  2WB1 B;  3J81 i;  1I50 B;  5JVH 3;  2CWA A;  4A3D H;  1XNR Q;  1DCZ A;  1PVO A;  3TS0 A;  2LMC B;  3I4L A;  2XRS D;  4XQN A;  2CW0 D;  2VNU D;  3M9B A;  1X32 A;  1Y1W G;  2F0H A;  4BWG B;  1LAC A;  1KDB A;  2EYJ A;  1XTD A;  4A3B G;  1BO0 A;  2B2W A;  2Z6K A;  4OO1 H;  2F0E A;  4G57 A;  1SYE A;  5I4D A;  5ELN A;  1WI5 A;  2EJM A;  2KCM A;  3AEV A;  1SE4 A;  2JA8 B;  2RQX A;  1J5E L;  1AE3 A;  3M3Y B;  1KTK A;  2VQF Q;  2V4D A;  2VXW A;  4ABN A;  2IHF A;  3DWQ A;  5M3M B;  1HZA A;  2F0N A;  4R4Q A;  1NR2 A;  1TT2 A;  1IYJ B;  4FF2 A;  2WIN B;  1BCP C;  2JA5 H;  5H1S E;  4DV4 L;  4YIJ A;  3PUW A;  1S5E D;  3STB D;  5C44 H;  2JYO A;  4GLA C;  2HUG A;  5GAG C;  5IGE A;  1YNN C;  2IX0 A;  1D7Q A;  2OQK A;  3RNU A;  2HDL A;  2KCT A;  3T51 B;  4CKB A;  2OTL A;  2RDF A;  2I5H A;  1PFS A;  2F0U A;  4HR7 B;  4ID6 A;  4X66 Q;  2I0Q A;  2ZTC A;  4LF6 L;  1GUT A;  2AQ1 B;  2EYO A;  3KLS X;  2KBN A;  2AWN A;  1TWC B;  5K36 G;  1PZK D;  3KK7 A;  2K5H A;  4LFA L;  2HIV A;  3H09 A;  3G4S A;  3MTS A;  3CHB D;  3CC7 A;  2NVY H;  5M5W B;  1B4O A;  1WOC A;  1D5Z C;  3TP6 A;  1U4R A;  1AE2 A;  5J22 A;  3VR6 A;  4XQJ A;  5FO7 B;  4HJ7 A;  1HNX L;  1BOS A;  1K8A C;  5I9O A;  3GTL H;  1H95 A;  3JC6 6;  2K5Q A;  2NUC A;  3I70 A;  3LX0 A;  3EA6 A;  4B3R Q;  4A3K B;  4B9W A;  1K28 A;  4EQP A;  5F2D A;  4HAE A;  3AQQ A;  1WCM H;  1EQV A;  5JPM C;  1EOV A;  4JBW A;  3ER0 A;  4UY8 C;  1Q8I A;  4FYD A;  3HOX H;  3TN2 A;  2I46 A;  1A62 A;  4X3U A;  1PA6 A;  5C4X B;  1AW7 A;  2PZW A;  4YWM A;  3AU7 A;  3HOV B;  1F2Y A;  3QB3 A;  4DF7 A;  2IL8 A;  2G5D A;  4IUP A;  2NBF A;  5IWA L;  1DXM A;  2B63 B;  1SJH D;  5COY A;  3A54 A;  4K8J A;  1VQM A;  1G2S A;  4V0B A;  4DNR B;  3GV6 A;  1JOR A;  1FYC A;  4ZUJ A;  1TS5 A;  3CQZ B;  2Y0S B;  3T56 B;  3DLL A;  2L0C A;  3OWE B;  4A4I A;  4LF4 L;  2HT1 A;  3ULL A;  4FXK C;  4DFA A;  3S24 A;  3J80 c;  3SHL A;  3VYR A;  1STB A;  1VMP A;  2OCE A;  3CCM A;  3A5U A;  3OMC A;  4ZKC B;  1I50 H;  2F4V L;  2K03 A;  4AYB B;  5D14 A;  2E5L Q;  4LF5 Q;  3UDG A;  1HTP A;  4XYQ A;  1GXD C;  5J39 A;  3C46 A;  3PV0 A;  5DM7 3;  1VQP A;  4B3T Q;  1FL0 A;  1YNJ D;  2R7F A;  3MXN B;  1RTO A;  3J80 E;  4IJL A;  2HHH L;  4DV7 L;  1XX8 A;  4JI1 L;  1G8Z D;  2DNC A;  3K7A B;  2K5N A;  2MPM A;  1STY A;  2R3Z A;  4GNX C;  2K4K A;  4WRD A;  1HJP A;  1DON A;  2VZA A;  4O1N A;  1FNU A;  1KAB A;  2BDO A;  2JA8 H;  3J7A V;  3M3Y H;  1Y1V B;  5IGG A;  4JI3 Q;  1PH3 A;  1SEB D;  1EQR A;  4HCE A;  2F0F A;  1ASZ A;  2EE1 A;  2VS1 A;  5IGD A;  4CDF C;  5EKL A;  5M3M H;  2ID0 A;  1X55 A;  3BJU A;  4JYA Q;  3L2P A;  5M3F G;  1FGU A;  3WOE A;  5C0X G;  2Q8R E;  1VQB A;  1D1I A;  3CD6 A;  4GNX A;  3QOJ A;  4DXG A;  4L5R C;  2K75 A;  3IRB A;  3TP8 A;  1X65 A;  1FNV A;  4OL7 A;  2K32 A;  1MSH A;  1V1O A;  1KRT A;  4P75 A;  4QF4 A;  2X6L A;  2Q8I B;  5CC4 A;  2EYP A;  4ME5 A;  5D65 A;  2FMM A;  1CUK A;  5AJ3 Q;  2XWB B;  2OEO A;  3LNN A;  4N9P A;  4OGQ C;  5CV7 A;  3A5Z B;  1PRT F;  4GKK Q;  4IOC A;  1TWC H;  1HQR D;  1NNX A;  3HOZ B;  4GZY C;  4DUZ L;  1KLU D;  5M5W H;  3FHW A;  4ZRZ A;  4LAA A;  2UUC L;  3I4N G;  1C48 A;  4LFC Q;  2Q2T A;  2Z4I A;  3CKI B;  4PMW A;  2UUB Q;  3RZO B;  1ET9 A;  3CMA A;  4DUY L;  3QWN A;  2PI2 A;  4PZ7 A;  3NEN A;  4RMF A;  4FF3 A;  4IZ8 A;  1E24 A;  3I91 A;  3K0X A;  2QDL A;  4GOP B;  3DWP A;  4A3K H;  4I65 A;  4RCO A;  5JEA H;  1HH2 P;  5IT9 c;  4PV1 C;  1E1O A;  5COR A;  4N8X 1;  1A15 A;  2FJ2 A;  1JWM D;  3K7U C;  1CKM A;  2M00 A;  5C4X H;  4K2K A;  2VQE Q;  3UI2 A;  2XNA C;  2VY3 A;  3HOV H;  1PH8 A;  4X64 L;  2RA4 A;  3H91 A;  5CV9 A;  3F2U A;  4JBM A;  3H94 A;  1TQO A;  3I4M G;  1TWG B;  3D4R A;  3M4O B;  4JV5 L;  4RAU C;  1X3E A;  4NB3 A;  1J8I A;  4G7Z C;  2O5J C;  2H5X A;  2G9D A;  4DR5 Q;  3GO5 A;  5IYB H;  1QJO A;  1YZ6 A;  4BY1 G;  3CQZ H;  3ERO A;  1Q46 A;  1S5B D;  3EN2 A;  4JK1 C;  4FP5 D;  4P72 A;  3J80 L;  1PH6 A;  1N36 Q;  3DUZ A;  2NZ1 D;  3SE0 A;  2L15 A;  4P2C B;  1DZ1 A;  1ZKO A;  1UE6 A;  1JC7 A;  1SNO A;  3S1N B;  3TZU A;  2QEX A;  1CZW A;  1TS4 A;  2MJ8 A;  1D5M C;  4LF9 L;  4G7O C;  3R2T A;  1H9K A;  1MIU A;  1PDQ A;  2C9O A;  2WAC A;  5IYD G;  1EEF D;  1IW7 D;  4H0L C;  3T16 A;  2I5L X;  3J7Z C;  4GS3 A;  4IFD G;  2UXB L;  5JJK A;  4OX9 Q;  2R7Z G;  4RHR A;  3K57 A;  3K7A H;  3NBI A;  1PH1 A;  1U4M A;  3A7A B;  5G3L D;  1TY0 A;  5ELE A;  4Q0F A;  4DV6 L;  4DR6 L;  3Q8D A;  3MAQ A;  3CC2 A;  1AP0 A;  4HJ5 A;  1FJG L;  2F0W A;  3E5S A;  1XJV A;  4NXN L;  4A3C G;  1RCV D;  4YY3 Q;  3FPU B;  4YWK A;  3SGI A;  1Y1V H;  2K6A A;  1SE8 A;  3T1H Q;  2FHT A;  2NZO A;  4LUV A;  5CV4 A;  4EQO A;  4OHJ A;  3U9S A;  3NPP A;  4UHV A;  1N33 L;  1KIX A;  1LTG D;  2AQ2 B;  1ESF A;  2XRQ D;  1PYS B;  1RJT A;  3BVM A;  3QOL A;  1UUP A;  4JI2 Q;  3VR4 A;  5IGC A;  4R8I A;  1XMO L;  3AMU A;  3VA7 A;  3E0E A;  1X3Q A;  3M4Y A;  3ULJ A;  5ELF A;  1Q7Y C;  2A6H D;  3LWU A;  1BKB A;  4R4C A;  4RG1 A;  4KK7 A;  2JJQ A;  3BVG A;  2PW5 A;  1A8V A;  1PH9 A;  1JCK B;  5DAU A;  1JOO A;  2OWO A;  4CBV A;  4RA8 A;  2ZXO A;  3CF5 A;  4OWT B;  2YYZ A;  1ICF B;  5IOC A;  3H0G G;  2RKS A;  3K6O A;  4APV A;  4DNI A;  1QE6 A;  1X3F A;  1VQ9 A;  2R7D A;  2WB1 E;  2I07 B;  4H44 C;  3PO2 B;  3PIO A;  1OXU A;  3S15 B;  1SNC A;  2JP1 A;  3HOZ H;  2ZXR A;  3FKI B;  1M1K C;  1HZB A;  1YJW A;  5C3W A;  2QCP X;  2F0Q A;  3RZO H;  1D1K A;  2VB2 X;  5J3B A;  1IHZ A;  2AQ3 B;  2SNS A;  1LM0 A;  4X3K A;  3E6Z X;  4YHH L;  3T1Y L;  1LTT D;  1EYA A;  2IT1 A;  3OWF A;  3GV3 A;  3CP0 A;  3SEB A;  1VF5 C;  3DWA A;  3L0O A;  2L12 A;  4YWL A;  1ENF A;  2JK8 A;  1EZ6 A;  1VQ7 A;  2YU9 B;  4IUV A;  2HDM A;  3D8G A;  4JVZ A;  3CCS A;  4A3E G;  4BY7 B;  2K33 A;  1G2T A;  3MXU A;  3TEH B;  1B3A A;  3SK5 A;  1TWG H;  2L5T A;  1OO9 B;  1CKO A;  1CHQ D;  1UE5 A;  2NB0 A;  3HFZ B;  3M4O H;  4JI6 Q;  1C8C A;  1O7Z A;  1W6J A;  1LLR D;  1EU4 A;  4H7B A;  3E3X A;  3P1H A;  1JOK A;  2N8N A;  2DUD A;  3CAM A;  4LJZ C;  1Y69 U;  4RCN A;  1LTS D;  1VQ5 A;  1HR0 Q;  5C0X J;  4ODG A;  3OSO A;  4R1J A;  1VF7 A;  4HMJ A;  2PYK A;  3EFX D;  1XMQ Q;  2WKD A;  4ZYS A;  1Q12 A;  2B2T A;  3TDQ A;  5A35 A;  2CW0 C;  3K58 A;  3NBH B;  3PMF A;  4OIK A;  4AQY Q;  3S1N H;  4A3G G;  1QWY A;  3MEH A;  1J6Q A;  1CA5 A;  1YVC A;  2EPB A;  1EEI D;  4BXX H;  3D4W A;  3VDY A;  4A3F B;  3CXC A;  3S2D B;  4M1U B;  1NSN S;  4DA2 A;  4KLK A;  3HGB A;  3VYU A;  2C5C A;  3VYS A;  3Q24 A;  2RVL A;  4R4T A;  2R93 G;  1HUN A;  4BA1 I;  3M85 A;  4NP5 A;  1CQF A;  1XNR L;  2KEE A;  1MJE A;  5J1Z A;  2J4X A;  4A3I G;  2A74 C;  3STB C;  3PO3 G;  3U58 A;  4Q5V A;  5CBA E;  1JE4 A;  3GP7 A;  5LMU Q;  2K01 A;  3AFP A;  1YNX A;  1FVI A;  3NTK A;  1XWE A;  3KF6 B;  2K04 A;  1YJN A;  1B2T A;  3E9I A;  1V1P A;  4L6T B;  4WJ4 A;  3HP3 A;  1HZ9 A;  1G51 A;  2MNA A;  1E7Z A;  4CKE A;  4C2M B;  5JJI A;  1CK1 A;  3CU7 A;  2Y0S E;  1K0R A;  1HR0 W;  5IYC H;  2QKI C;  3C2P A;  3Q22 A;  4QQB X;  2LKV A;  2ICE C;  2JQO A;  1EOT A;  1W2B A;  3NSW A;  1EY8 A;  1EIY B;  4EGV A;  2FFK B;  4GLX A;  3FRP B;  4TVA B;  2K28 A;  4C3I G;  4GN5 A;  4FF1 A;  4A3J G;  2KHS A;  2F0O A;  1N9W A;  3OW2 A;  4QGU A;  3HKS A;  3RLN A;  2HCC A;  5I9P A;  3PO2 H;  4DR3 L;  3S15 H;  3RZD B;  4DV1 Q;  2NVT B;  3FKI H;  1HNW L;  1H9S A;  1E2Z A;  4BA2 I;  5EPJ A;  3VYT A;  2UXC Q;  3MWY W;  4XT3 B;  5LL6 X;  1L0W A;  3TRE A;  4XDX A;  1SJE D;  3IKJ A;  2A6E D;  1U4L A;  3HOY G;  4X66 L;  4LFB L;  1HNZ Q;  1NR4 A;  3F2B A;  2K05 A;  1KAA A;  4K5V A;  4IFD J;  1S40 A;  2LS0 1;  1VDZ A;  2YV5 A;  1EQQ A;  1YIJ A;  2YU9 H;  2EY6 A;  2KCC A;  2E8G A;  1PTO B;  5KEE A;  4BY7 H;  2XWJ B;  2F52 A;  2ZXP A;  1G91 A;  4QCL A;  2CH4 A;  1EFI D;  2D0P A;  2QIL A;  4DV0 Q;  4EQ5 A;  1YI2 A;  2Z6B A;  3SVM A;  1AH9 A;  4JI5 L;  1SRO A;  1JB3 A;  2PCF B;  3PUX A;  2MHV A;  4K0K Q;  2XTI A;  1ZYR D;  1CT1 D;  1MGS A;  2HQE A;  2RSO A;  4CKC A;  1LAB A;  1L1O C;  3W1G A;  1B9N A;  1XPR A;  4OO1 G;  1QUQ A;  3S17 B;  1U0L A;  4P74 A;  3T13 A;  5BR8 L;  4PG3 A;  5EKI A;  1VQG A;  5KND A;  4JC0 A;  3FPP A;  5C5L A;  1CA6 A;  4FDB A;  2JXM B;  5CGK A;  3SDZ A;  1K9M C;  4BBR G;  4GLV B;  3C3L A;  3NQT A;  3A8I E;  1EYG A;  5EPL A;  5IIF A;  1DM0 B;  2NN6 I;  1WD0 A;  3NXW A;  5C4J B;  1AZQ A;  3BZD B;  1L1O A;  5EAY A;  4RGO S;  3I7F A;  2EY1 A;  1HPC A;  1BBX C;  4B3M Q;  2EY5 A;  3FDT A;  2K52 A;  3G6J B;  4A3F H;  4JCV E;  3S2D H;  4K6L A;  2JA5 G;  3TSS A;  3KJP A;  4I7A A;  3IAY A;  3TBI B;  4DR7 L;  2B8F A;  4RKL A;  3I2Z A;  4ZQ3 A;  1B44 D;  4N8F A;  4HED A;  4YCW A;  5C5M A;  4LF5 L;  1SE2 A;  5EBC A;  1M4V A;  3S9W A;  1EYC A;  2IWH A;  4QJF A;  4KHZ A;  3CCQ A;  1ENC A;  3OTO Q;  3PUY A;  1KXL A;  4MHE A;  4KHP Q;  3A7L A;  5TSS A;  3KLR A;  4CGY B;  4UAI A;  2UXD L;  2QF7 A;  3HKZ G;  2Q2U A;  5K36 H;  4WJW A;  3ZYY X;  2UUA Q;  3A74 A;  2F0L A;  4MNO A;  1K3R A;  4FF4 A;  2PO4 A;  1JOQ A;  3I4N B;  3BYY B;  1BBU A;  2EDG A;  4C2M H;  2BCO A;  1BBW A;  2BDN A;  2J0T D;  3MXG A;  3DEP A;  3NQI A;  3KYH C;  1K0S A;  2XGT A;  1WCM G;  4A3M G;  1HCZ A;  2O5I C;  2AHO B;  1SNQ A;  1IZ6 A;  4A3L G;  3ERS X;  1WTX A;  3TRZ A;  2CQA A;  3HOX G;  3G6E A;  2LFN A;  2KEC A;  4JG2 A;  3K5N A;  3RZD H;  1TS2 A;  2NVT H;  5IP7 H;  3LWE A;  3EJI A;  2JA6 G;  3CCU A;  4F7X A;  1VQ6 A;  2RSN A;  5D3D A;  3U4Z A;  3FVQ A;  2HCI A;  1H9J A;  2N88 A;  5ELB A;  1X6O A;  1J5E Q;  1E3P A;  2B29 A;  4FNF A;  1QZH A;  1IBK L;  2E74 C;  5CMD A;  4KY5 A;  1EY9 A;  1HUM A;  1PH2 A;  3FEW X;  3UDX A;  4BY1 B;  3A8J E;  4DK0 A;  1SNP A;  2Q2I A;  3H3V H;  4S3S A;  3OYY A;  3M4P A;  3VR2 A;  3PUV A;  3UE1 A;  1PTO H;  4B3S L;  4H13 C;  1NTG A;  3Q6S A;  1VQF A;  2WB1 G;  1VQN A;  5AFW A;  5ELC A;  1P16 A;  1G6P A;  2AUJ D;  1P8L A;  2WII B;  4GKJ Q;  1QVG A;  3UDI A;  1CFM A;  2Z9H A;  1DYQ A;  1G6Z A;  1TR5 A;  4TQU S;  3TQY A;  4OXP A;  4PZ6 A;  4LF6 Q;  2VQE L;  2R7Z B;  5M9O A;  3S1R H;  2OXP A;  1PFN A;  5G3L F;  4ZCK A;  1GUG A;  2Z8L A;  3S17 H;  1SLJ A;  4LFA Q;  2F3V A;  1UWV A;  5JPN C;  3P7J A;  1RDP D;  4DAM A;  1IW7 C;  2CHB D;  3H15 A;  4ZUI A;  3JAM c;  2QA4 A;  1HNX Q;  2KHI A;  1STN A;  4DR5 L;  5C4J H;  3DEO A;  5M3M G;  5BN5 A;  4BS9 A;  2I5M X;  3QO2 A;  2EYM A;  1PH4 A;  1JJC B;  1I4H A;  4YCU A;  1K8O A;  3DHQ A;  4PZ8 A;  2GN5 A;  4JI7 L;  4YCV A;  3CCR A;  4X65 L;  2D62 A;  5C0X H;  2O4X A;  3JAM E;  1KDC A;  1FD7 D;  2JSO A;  4OWW B;  5BN4 A;  1HTL D;  1V9P A;  4B08 A;  3F1Z A;  1Q81 C;  2A8V A;  3I3C A;  2EXD A;  4LF8 L;  3FMC A;  4DPG A;  2EXZ A;  2LXJ A;  3QR8 A;  4M8A A;  4HCS A;  4DK6 C;  1IBL L;  3HZX A;  4OX9 L;  4IUQ A;  2A6H C;  1GVP A;  4OWX B;  1I4X A;  3A56 A;  2F0G A;  3H0G B;  1KQS A;  1XNQ Q;  3S1Q B;  2E2D C;  1TU2 B;  3F2C A;  3C1E A;  1PRT C;  3MFG A;  5IP9 G;  3S16 H;  1UAP A;  3NBH A;  5LMN L;  4LF4 Q;  1CM9 A;  2NVQ B;  4YY3 L;  4AIM A;  3I4N H;  1SSO A;  1I94 L;  3K59 A;  4ULL A;  2EJG C;  2C35 B;  1WTO A;  1S4Z A;  2G9H D;  5JAV A;  1LT3 D;  5E4X A;  3CCL A;  1K83 B;  1EWH A;  2F4V Q;  1Z6H A;  3OMG A;  5JEA G;  2CVR A;  2F03 A;  1N32 L;  2UU9 L;  5FKA C;  4PQX A;  1IBM L;  2HHH Q;  5IT9 E;  3NE5 B;  4DN4 M;  4P71 A;  4DV7 Q;  3SK6 A;  5C4X G;  4JI1 Q;  2PMZ B;  1R4P B;  1MSG A;  1IL8 A;  4A3E B;  5FLM H;  3S14 B;  3ONA B;  2F0T A;  2Q8T A;  1VQL A;  3SK8 A;  1V1Q A;  2JN4 A;  4UPA A;  4C3H G;  4IUN A;  2B63 G;  1DOM A;  2IX3 A;  5DNF A;  4NXM L;  1F9S A;  1EY0 A;  2ZM6 L;  1CSP A;  2F0D A;  4JI4 L;  1O78 A;  4OEL B;  3PF4 A;  2WAQ G;  1GOZ A;  4KMU C;  4C1N I;  1Z9F A;  1JQY D;  2Y0S G;  3KF6 A;  4BY1 H;  1GD7 A;  4DV2 Q;  2DNE A;  1BCP B;  2GVA A;  4L5T A;  3R8B A;  3SXH A;  1JMC A;  4A93 G;  4PMB A;  4MIU A;  2VUM B;  4K5X A;  1JB7 A;  2NN6 H;  3P75 A;  4QUF A;  1VQI A;  1SE3 A;  4AYB G;  3RLO A;  2F0K A;  2A1A A;  4UP7 A;  1IXR A;  1BNZ A;  1Z7T A;  1KRS A;  5KYL A;  5NUC A;  3J80 i;  2E2I B;  1VQO A;  5GAH C;  3V05 A;  2D9U A;  4JW0 A;  1F2L A;  3WWV A;  1O7I A;  2JE6 I;  5IYD H;  2BH8 A;  4DR2 Q;  4LF7 L;  2Z0S A;  2R7Z H;  5EGT A;  1NUC A;  4R8N A;  4C3J G;  4DUZ Q;  2VL6 A;  4IPG A;  1X3P A;  2UUC Q;  3BS1 A;  3JAM L;  1Y1V G;  4Y52 H;  2NVX B;  2ZJR A;  5FJ8 H;  4A3C H;  4HIM A;  3CCJ A;  3ERQ A;  4KY6 A;  4WFN 3;  1A2U A;  1TII D;  1HR0 L;  1GUN A;  2R92 B;  1IYU A;  3ND8 A;  3EIV A;  3NTH A;  4TSS A;  2A73 B;  2F0S A;  1PFM A;  5JJL A;  3CME A;  1GHJ A;  1SYD A;  1O7L A;  3IFD A;  1E22 A;  2SOB A;  1ROD A;  4XYO A;  1T5X D;  3QJY A;  3A8K E;  3HOU G;  1I6H B;  1S5F D;  4KKS A;  3I73 A;  1KNE A;  3R3O A;  3MFY A;  4O2D A;  2FXQ A;  2DY7 A;  4X64 Q;  2MQH A;  2NTT A;  3KJO A;  4V19 0;  2PQA B;  4DV3 Q;  3E0J A;  2KUM A;  1PYW D;  4C1N K;  4JV5 Q;  4JI0 L;  5IOD A;  1N34 L;  1JR0 D;  2JA7 G;  1NE3 A;  5I2Y A;  4QUC A;  4DR1 L;  2BOS A;  4LK1 C;  1SR3 A;  4C3I B;  4IUR A;  3H0G H;  3OPO A;  4Y7N B;  3NWS A;  4A3J B;  3S1Q H;  5E3F A;  1LV9 A;  1F9P A;  4PNY A;  5M5X B;  1VS0 A;  3HOW B;  4BBS G;  3TME A;  1YBY A;  2F4I A;  2NVQ H;  2F3W A;  1OXT A;  5IT9 L;  2CWP A;  3KBG A;  1NAP A;  2K14 A;  3I8Z A;  1K83 H;  4XT1 B;  3HEJ A;  3J81 c;  4DR4 L;  3HOY B;  2D5D A;  4DV5 L;  4POF A;  4LF9 Q;  4MTN A;  1STH A;  1Y8P B;  3T4A C;  3ICE A;  3VA5 A;  5C3E G;  3GTO B;  2A6E C;  1PYB A;  2UXB Q;  2B2T C;  3VR3 A;  1F77 A;  4CDE C;  4X3S A;  4A3E H;  3PIO 3;  2BH2 A;  2ASB A;  3S14 H;  3J81 E;  4DV6 Q;  1MJC A;  3MA2 B;  4DR6 Q;  3K8A A;  1K8G A;  1D8L A;  1S5D D;  1TWH B;  3J7A 5;  1FJG Q;  3CW2 C;  1C9O A;  2B39 A;  4DU9 A;  1Y1W B;  1QIL A;  4A3B B;  4IN3 A;  3R93 A;  3GTM B;  1HA5 A;  4TRD A;  4J8Q A;  3I72 A;  2JA9 A;  4NDX A;  4JI8 L;  5DM6 3;  2AKW B;  3H3V I;  4K8I A;  1N33 Q;  1Q90 A;  2VUM H;  3DXJ C;  1ZYR C;  1A3V A;  2ES2 A;  2RCN A;  2K5D A;  1HA6 A;  1XMO Q;  1NBW A;  5EBD A;  1PTO D;  3I4O A;  3P20 A;  1Q8K A;  1B1Z A;  4IUT A;  4BBR B;  1YHQ A;  1ASY A;  1QVF A;  1E0B A;  2E2I H;  1H9M A;  3EQL C;  4LMQ D;  2GA4 B;  2DY8 A;  2EZV A;  4BXX G;  4R4I A;  3BG3 A;  5M5Y B;  1SDF A;  1SMY D;  1EY4 A;  2E75 C;  3GD7 A;  5HY6 A;  2EVB A;  1BXT A;  1CSQ A;  2LY7 A;  3AFQ A;  4DXF A;  3M7N A;  1ZEQ X;  1GKH A;  3NEL A;  4KKU A;  3RMH A;  1SYF A;  1PH5 A;  2YTV A;  3I55 A;  4HJ8 A;  4NMZ A;  1M8A A;  2N49 A;  5DLQ E;  1JJG A;  2NVX H;  1XYI A;  5C4Z A;  1UE1 A;  5CV5 A;  1CHP D;  5KGU A;  4K0K L;  3H6M A;  5JEA J;  3R2I A;  1CKN B;  2Z1C A;  1LO5 D;  5CR3 A;  1PV4 A;  2R92 H;  2BA1 A;  1SYG A;  3G71 A;  3T1Y Q;  3KUP A;  4POG A;  1WJJ A;  4G7H C;  3GTP B;  2HIX A;  5ELD A;  1RHP A;  2B2Y C;  3HKZ B;  1VQE A;  3S2H B;  2XN9 C;  5C0X I;  2VQF L;  5ISR A;  4FO2 A;  1I6H H;  2K7V A;  4MZ9 A;  3BZC A;  3MXN A;  1KNA A;  1HXY D;  1TS3 A;  4CDC C;  3BDL A;  1D6E C;  1EQT A;  3S1M B;  1TKW B;  2A69 D;  5EJW A;  1U4P A;  1R9T B;  2RDG A;  2IPK D;  1S72 A;  2AUK A;  2KJX A;  4MTK A;  2MO1 A;  1SXT A;  1F2M A;  2SDF A;  4A76 A;  1TWF B;  1A0I A;  2B2Y A;  1STG A;  4A3M B;  1I4R A;  3ULP A;  1IKL A;  1NMF A;  1B3Q A;  4C3I H;  4L5Q A;  1SFO B;  4Y7N H;  4A3J H;  1KAW A;  2HD3 A;  3NK9 A;  2E76 C;  2F0P A;  3GQB A;  5M5X H;  1NY4 A;  3FKI G;  3HOW H;  1T5E A;  1XXG A;  1YEZ A;  2JA6 B;  2EYH A;  1LYL A;  4NPS A;  2N55 A;  1C7Y A;  1SN8 A;  5GQO A;  2B3G A;  3D31 A;  3I90 A;  4L5S A;  1DJR D;  4RFB A;  3J81 L;  3X3M A;  1PH7 A;  4C56 C;  4JBK A;  1VQJ A;  3HOY H;  3B6Y A;  4QIW B;  4A75 A;  2X6G A;  1UNS A;  2UUA L;  3I56 A;  3GTO H;  5CBE E;  4IJH A;  4A3D G;  4NW2 A;  3SK4 A;  5IGB A;  3GDE A;  1VQD A;  4B3R L;  3BYT B;  2F0V A;  3F8T A;  3N52 A;  2PZT A;  5CV8 A;  1KL9 A;  4U67 3;  2F0J A;  4I7Z C;  1TWH H;  5DEH A;  3J7Y W;  4KJO A;  1FNW A;  4GOP C;  3NWT A;  5FK9 C;  1WVL A;  2OT2 A;  2DGY A;  3D6C A;  4KD3 A;  1Y1W H;  1EL0 A;  3S1R B;  2N78 A;  1EWC A;  1R4Q B;  4A3B H;  1Q1B A;  4HSP A;  3GTM H;  1MBY A;  4RHS A;  3LGJ A;  1YNJ C;  1QOH A;  2J7Z A;  2K1B A;  5KNC A;  5E7N A;  3U9O A;  4DAY B;  4X62 Q;  5BN3 A;  2E2J B;  3HG9 A;  2DJG C;  1Y14 B;  3KF8 B;  5HUR A;  4GOP A;  5CYU A;  4XQQ A;  3BU2 A;  3NTI A;  5E4W C;  2QEJ C;  1A2T A;  3MVV A;  3GTQ B;  4BBR H;  1B7Y B;  1O80 A;  1BCP F;  3OW7 A;  1D5X C;  5M3F B;  5JJZ A;  3HS0 C;  2PNH A;  4ZAI A;  2Q2H A;  5C44 G;  4ME3 A;  2XIW A;  4RGN A;  1X56 A;  5M5Y H;  1TVX A;  4A3F G;  2R6G A;  2BE5 D;  2E5L L;  4IFD I;  3AYH B;  1YHA A;  2XVS A;  3KDF B;  5LL6 S;  1EIH A;  4B3T L;  4DR3 Q;  1Y8N B;  2PNR C;  1GO3 E;  3A0J A;  3CRL C;  1K8M A;  5K5P A;  1PHJ A;  1HNW Q;  4QL5 A;  2VW9 A;  3FP9 A;  4GKJ L;  4ZKB B;  1JWS D;  2H1E A;  1WTQ A;  4KY7 A;  3V96 A;  3L3O C;  3W1B A;  3PCO B;  2KOL A;  3S16 B;  1QG7 A;  2PMZ E;  2IHE A;  4LFB Q;  1G29 1;  2ATW A;  4UDU C;  3GTP H;  3V2T A;  1Y8O B;  4JI3 L;  4TKO B;  3S2H H;  4P73 A;  1I4P A;  3K0Y A;  3G48 A;  2BA0 A;  1QB5 D;  2MUY A;  3NUC A;  4IPD A;  2OF1 A;  4X3T A;  4JYA L;  4HTH A;  4L8J A;  3S1M H;  4KJN A;  2A5H A;  1HFN A;  5L37 A;  3UDF A;  1RD9 D;  1R9T H;  1DOL A;  4LWC A;  1FR3 A;  1VQK A;  4JI5 Q;  1SMX A;  1LT6 D;  1LTB D;  2A68 D;  2TMP A;  1GUW A;  2DN8 A;  4LUO A;  4OON A;  1RTN A;  1TWF H;  2R61 A;  4O42 A;  3K80 C;  4A3M H;  5FLX c;  4B9X A;  1JE5 A;  1QVC A;  1TXY A;  1SFO H;  4A3L H;  3GTK B;  1KLG D;  2KQ3 A;  3I4M B;  3X3N A;  1YHB A;  5IP7 G;  5AJ3 L;  4CJ2 C;  1L0X B;  3U50 C;  1WTR A;  3A55 A;  1PLF A;  1RF2 D;  1RKN A;  5BR8 Q;  2JA6 H;  2B2U C;  3KLS A;  1VQC A;  5FLX E;  4C3H B;  4GKK L;  3BDC A;  3ZJY C;  4KI0 A;  2X69 A;  1M90 C;  1YJ9 A;  1IL2 A;  1LTI D;  1LUZ A;  2ZTD A;  2EQS A;  2KA7 A;  3NEM A;  2F3I A;  1Q86 C;  4LFC L;  2WAQ B;  2SEB D;  1XNQ L;  4FXD A;  2UUB L;  2FMC A;  4DV4 Q;  1HQM C;  1EWI A;  4H02 A;  2RBM A;  2YTY A;  3AB9 A;  2PPB C;  1I4Q A;  4A93 B;  2B2U A;  4DK1 A;  4O0A A;  2K5W A;  1NMG A;  1S3O A;  4DR7 Q;  1V1P B;  4JBJ A;  5FO8 B;  1B70 B;  2PQA A;  3NHH A;  4RWS C;  4K6D A;  4PMC A;  5EQ0 A;  5C4H A;  1CQV A;  2KVM A;  1YIT A;  2O2L D;  1L0Y B;  3C1F A;  2ENB A;  2ZJP A;  2RHS B;  3UE0 A;  1GUO A;  1X9N A;  1DOK A;  1FGB D;  3CPW A;  3CCV A;  3K5O A;  2JA8 G;  2E2J H;  2LSS A;  1BQQ T;  3BVZ A;  2UXD Q;  1I3Q B;  3J7A F;  4QY7 A;  1BCP D;  1EFW A;  1RIP A;  4C3J B;  4R4O A;  1STA A;  1OXX K;  1H9S B;  3GTQ H;  2PZU A;  2V1C C;  1LT5 D;  5M3F H;  2E2H B;  1N36 L;  1YNN D;  1X3G A;  3K5L A;  2HQL A;  1IKM A;  4MN3 A;  4DV2 L;  4RGM A;  1EY7 A;  4HSV A;  3EVQ A;  1MHW C;  5IGF A;  3RUZ A;  3TP7 A;  3BZK A;  3W2D A;  4AH6 A;  3L9A X;  3HOU B;  5T1I A;  5IWA Q;  2SNM A;  4UP8 A;  3GTJ B;  2IX1 A;  2ZTE A;  2MP1 A;  4ILW A;  1B50 A;  2L9H A;  3RN2 A;  1JT8 A;  4XIG S;  1PXU A;  4OEM B;  2F1M A;  1JJ2 A;  3CCE A;  2M9V A;  1LT4 D;  2IJ0 A;  4DR2 L;  1ICW A;  2JA7 B;  1IBK Q;  5JOB A;  2XSC A;  2FIN B;  3QIA A;  3TS2 A;  3T1H L;  4F87 A;  2RDH A;  1V8Q A;  4K5W A;  5IP9 H;  1L2F A;  1QUQ B;  1BF4 A;  1A6X A;  1Q1E A;  1I5F A;  3N6R A;  4BBS B;  3D0F A;  4A3K G;  4B3S Q;  3DM1 A;  3T53 B;  2CCZ A;  5ELO A;  4JI2 L;  2ZJQ A;  4R9W A;  2KHJ A;  5FLX L;  2L4N A;  3HOV G;  4KTA A;  1ESR A;  3PF5 A;  1L1O B;  3IFT A;  4F88 A;  2IW3 A;  3GTK H;  5C3E B;  3GTG B;  4UP9 A;  4IO9 A;  3CC4 A;  2EYF A;  3I4M H;  5FLM G;  2MO0 A;  5LHY 1;  4IPC A;  1LTL A;  2MFI A;  1XPO A;  2PI2 E;  1VCI A;  4K2L A;  5IYB G;  3RN5 A;  4X6A H;  4C3H H;  4DV3 L;  4HIO A;  2B63 H;  4KKT A;  1W6K A;  1CKN A;  5C6A A;  4Z9C B;  5I2X A;  1E2V A;  3Q0A A;  1SYC A;  1Q3L A;  4WJ3 M;  3RLF A;  1JWU D;  3CRK C;  3K81 C;  4JI7 Q;  1AFP A;  2NN6 G;  4X65 Q;  2GVB A;  3WDN A;  5I6W A;  4A93 H;  4A3G B;  1BVS A;  5KYI A;  1N8R C;  3DM3 A;  1AZP A;  2F0M A;  1GM5 A;  4DGZ A;  1PTO F;  4OIJ A;  2WFW A;  3KFU A;  4IAL A;  2IY5 B;  4LF8 Q;  4IFD H;  3HKZ E;  4DK3 C;  3H3V C;  4GN3 B;  2A19 A;  2RCF A;  2KED A;  1S5C D;  1PTO C;  1LTR D;  1IBL Q;  1X54 A;  4KD4 A;  1VQ4 A;  1HHV A;  4CDD C;  4JI6 L;  1PMR A;  3F2D A;  2R93 B;  5GAD C;  1ML0 D;  4OO1 I;  1NCV A;  2NZH A;  1EUJ A;  4CJ1 B;  1I3Q H;  2L11 A;  3TP5 A;  2DJF C;  4DUY Q;  1C0A A;  1TWA B;  2CH4 W;  4LUZ A;  4A3I B;  1Q82 C;  3OIP A;  1KHI A;  1SMY C;  4C3J H;  5LMN Q;  1B9M A;  1AN8 A;  3PO3 B;  4ALP A;  1C4Q A;  5FJ8 G;  1J9O A;  3QG1 A;  1I94 Q;  1XMQ L;  3W3A A;  2OTJ A;  1QNK A;  2E2H H;  1WTP A;  3EBE A;  3KBX A;  4CJ0 B;  1K3B C;  4DAV A;  1VQH A;  3MC0 B;  3JAM i;  4AQY L;  5FO9 B;  1B8A A;  1N32 Q;  4QB4 A;  1LTA D;  2UU9 Q;  1IBM Q;  2P5Z X;  3MXP A;  3PSI A;  3HOU H;  4HIK A;  2CFM A;  3RD4 A;  3IL8 A;  3GTJ H;  4QIW E;  2AMC B;  2JEB I;  1DD2 A;  1B53 A;  5HGQ A;  5KNB A;  4NXM Q;  1PRT D;  4XXE A;  1WTV A;  5IY0 A;  3M4Q A;  4N9T A;  2ZM6 Q;  3HOZ G;  3Q23 A;  1A3U A;  4IOA A;  4EX5 A;  5HGT A;  4JI4 Q;  4ZLT F;  1UEB A;  4DNT B;  1MKH A;  3L7Z C;  4DAY A;  2JA7 H;  2A69 C;  4ZK9 B;  4KN7 C;  3KF8 A;  4HJ9 A;  3BDO A;  1H9R A;  3PIP A;  2TSS A;  3O13 A;  1WFQ A;  2ALY B;  1E1T A;  3ND9 A;  3J81 j;  1EY6 A;  2D2C C;  4BBS H;  5LMU L;  5IE8 A;  3SR1 A;  4K14 A;  2EIF A;  4JOI C;  4F8M A;  1WTH A;  2EYL A;  2AWO A;  1SRU A;  1A63 A;  4HMI A;  3MZ5 A;  2ICI A;  1D2B A;  1O7Y A;  3D3R A;  5KRU A;  5I6Y A;  1ONL A;  4GNX B;  3D4D A;  3E9H A;  2K50 A;  5EPK A;  3KDF A;  1ILQ A;  2ZT9 C;  5A2Q E;  3OOC A;  5LMN W;  3PQI A;  5C3E H;  3GTG H;  4EVO A;  2N3S A;  1QNU A;  1QZG A;  3NP8 A;  4GN4 B;  4HJA A;  1NJI C;  4LF7 Q;  1BUV T;  4NXN Q;  2YTX A;  4A3D B;  3W5O A;  3D6W A;  3DMU A;  3MHB A;  1OTC A;  4JOI A;  1KDA A;  1BDO A;  1VQA A;  4IUU A;  2L55 A;  3TZD A;  1HFG A;  1KC8 C;  3PIP 3;  1XPU A;  4E6I A;  4DV1 L;  4KN4 C;  4HID A;  3MEF A;  4NKL A;  2KEN A;  1EIG A;  4FVM A;  2RHQ B;  2WKC A;  2B2V C;  2PQE A;  2UXC L;  4IPH A;  4LNQ A;  4J1M A;  1I6V C;  1Z47 A;  1EU3 A;  1HZC A;  1II3 A;  5GRO A;  2RF4 A;  4G4K A;  1EY5 A;  2VUM G;  1GJX A;  4JPB W;  1KD1 C;  2H4O A;  4RGT A;  4A3G H;  4FXG C; 
#chains in the Genus database with same CATH homology
 1WTW A;  5D3I B;  1A3T A;  2JEA I;  1XTC D;  1QCB D;  2EY2 A;  1GUS A;  2Z4H A;  2EJF C;  2B2V A;  4L63 B;  2JA5 B;  5C44 B;  1OXS C;  4QMG A;  3K5M A;  1VMC A;  1SNM A;  1PRT B;  2F0I A;  2EOT A;  2PW7 A;  2L1B A;  2B8G A;  1AEX A;  1EYD A;  1F9R A;  1GHK A;  2NTS A;  2KCN A;  1PZI D;  4KHV A;  4DAP A;  2NWG A;  1MD2 D;  2BE5 C;  2MGS A;  4U68 A;  1SBB B;  1TY2 A;  3HRZ C;  4KV6 A;  2NVY B;  5C3X A;  4RH6 A;  1HRJ A;  1U9R A;  1V43 A;  3WOF A;  1WD1 A;  1CTM A;  5FOB B;  5KIX A;  1F2Z A;  1ET6 A;  3GTL B;  5JVG 3;  4RKB A;  3URY A;  4EQN A;  3PUZ A;  1WCM B;  1IYV A;  1CI3 M;  3G7L A;  5E1F A;  4IQZ A;  3HOX B;  1ZXT A;  3M7G A;  1SND A;  1BR9 A;  1OXV A;  1I4G A;  1ILP A;  1ENA A;  3OIQ A;  4HN7 A;  3OHX C;  2WV6 D;  2A68 C;  5T1G A;  2M2L A;  4WOR A;  1JIC A;  5A2Q L;  4CHT B;  1SYB A;  1UEA B;  4J6H A;  5EKK A;  4XTC S;  1STE A;  2VB3 X;  2NYZ D;  5CV6 A;  3VR5 A;  1PZJ D;  1SAP A;  2WP8 J;  2QDB A;  1EZ8 A;  1MI2 A;  3ITP A;  1F9Q A;  1CZG A;  1PFB A;  2B2W C;  1E2W A;  2WB1 B;  1I50 B;  5JVH 3;  1DCZ A;  2LMC B;  3I4L A;  2XRS D;  4XQN A;  2CW0 D;  2VNU D;  1X32 A;  2F0H A;  4BWG B;  1LAC A;  1KDB A;  2EYJ A;  1BO0 A;  2B2W A;  4OO1 H;  2F0E A;  4G57 A;  1SYE A;  5I4D A;  2EJM A;  1SE4 A;  2JA8 B;  2RQX A;  3M3Y B;  1KTK A;  2V4D A;  2VXW A;  4ABN A;  4RGT A;  3DWQ A;  5M3M B;  2F0N A;  1NR2 A;  1TT2 A;  4FF2 A;  2WIN B;  1BCP C;  4YIJ A;  3PUW A;  1S5E D;  2JYO A;  2HUG A;  5IGE A;  1YNN C;  2IX0 A;  2HDL A;  3T51 B;  4CKB A;  2RDF A;  2F0U A;  4HR7 B;  4ID6 A;  1GUT A;  2AQ1 B;  2EYO A;  3KLS X;  2AWN A;  1TWC B;  5K36 G;  1PZK D;  3KK7 A;  3H09 A;  3MTS A;  3CHB D;  5M5W B;  1B4O A;  1D5Z C;  3TP6 A;  1U4R A;  5J22 A;  3VR6 A;  4XQJ A;  5FO7 B;  1BOS A;  5I9O A;  2K5Q A;  2NUC A;  3I70 A;  3LX0 A;  3EA6 A;  4A3K B;  4B9W A;  4EQP A;  5F2D A;  4HAE A;  1EQV A;  5JPM C;  4JBW A;  1Q8I A;  4FYD A;  3TN2 A;  2I46 A;  4X3U A;  5C4X B;  1AW7 A;  2PZW A;  3AU7 A;  3HOV B;  1F2Y A;  3QB3 A;  4DF7 A;  2IL8 A;  4IUP A;  2NBF A;  1DXM A;  2B63 B;  1SJH D;  5COY A;  3A54 A;  4K8J A;  1G2S A;  4V0B A;  4DNR B;  3GV6 A;  1JOR A;  1FYC A;  4ZUJ A;  1TS5 A;  3CQZ B;  2Y0S B;  3T56 B;  2L0C A;  3OWE B;  4FXK C;  4DFA A;  3SHL A;  3VYR A;  1STB A;  1VMP A;  3OMC A;  4ZKC B;  2K03 A;  4AYB B;  5D14 A;  1HTP A;  4XYQ A;  1GXD C;  5J39 A;  3C46 A;  3PV0 A;  5DM7 3;  1YNJ D;  1RTO A;  3J80 E;  1XX8 A;  1G8Z D;  2DNC A;  3K7A B;  2MPM A;  1STY A;  2R3Z A;  4WRD A;  1DON A;  4O1N A;  1FNU A;  1KAB A;  2BDO A;  3J7A V;  1Y1V B;  5IGG A;  1SEB D;  4HCE A;  2F0F A;  2EE1 A;  5IGD A;  5EKL A;  2ID0 A;  3WOE A;  5C0X G;  2Q8R E;  1D1I A;  3QOJ A;  4DXG A;  3TP8 A;  1FNV A;  4OL7 A;  2K32 A;  1MSH A;  1V1O A;  4QF4 A;  2X6L A;  2Q8I B;  5CC4 A;  2EYP A;  4ME5 A;  5D65 A;  2FMM A;  2XWB B;  2OEO A;  3LNN A;  4N9P A;  4OGQ C;  5CV7 A;  1PRT F;  1HQR D;  3HOZ B;  4GZY C;  1KLU D;  4ZRZ A;  4LAA A;  1C48 A;  2Z4I A;  3CKI B;  4PMW A;  3RZO B;  1ET9 A;  3QWN A;  4FF3 A;  4IZ8 A;  3I91 A;  3DWP A;  4I65 A;  4RCO A;  5JEA H;  4PV1 C;  5COR A;  1A15 A;  2FJ2 A;  1JWM D;  2M00 A;  4K2K A;  3UI2 A;  2XNA C;  2RA4 A;  3H91 A;  5CV9 A;  3F2U A;  3H94 A;  1TQO A;  1TWG B;  3D4R A;  3M4O B;  4RAU C;  1J8I A;  4G7Z C;  2O5J C;  2G9D A;  3GO5 A;  1QJO A;  3ERO A;  1S5B D;  4JK1 C;  4FP5 D;  3J80 L;  3DUZ A;  2NZ1 D;  3SE0 A;  1DZ1 A;  4P2C B;  1ZKO A;  1JC7 A;  1SNO A;  3S1N B;  3TZU A;  1CZW A;  1TS4 A;  2MJ8 A;  1D5M C;  4G7O C;  3R2T A;  1H9K A;  1PDQ A;  2C9O A;  2WAC A;  1EEF D;  1IW7 D;  4H0L C;  3T16 A;  4IFD G;  4RHR A;  3K57 A;  3NBI A;  1U4M A;  3A7A B;  5G3L D;  1TY0 A;  5ELE A;  4Q0F A;  3MAQ A;  1AP0 A;  2F0W A;  3E5S A;  1RCV D;  3FPU B;  2K6A A;  2FHT A;  5CV4 A;  4EQO A;  4OHJ A;  3U9S A;  3NPP A;  1LTG D;  2AQ2 B;  1ESF A;  2XRQ D;  1RJT A;  3BVM A;  3QOL A;  1UUP A;  3VR4 A;  5IGC A;  4R8I A;  3AMU A;  3VA7 A;  1X3Q A;  3M4Y A;  5ELF A;  2A6H D;  3LWU A;  4KK7 A;  3BVG A;  2PW5 A;  1JCK B;  5DAU A;  1JOO A;  4CBV A;  4RA8 A;  2ZXO A;  2YYZ A;  5IOC A;  3K6O A;  2RKS A;  1QE6 A;  2I07 B;  4H44 C;  3PO2 B;  1OXU A;  3S15 B;  1SNC A;  2JP1 A;  2ZXR A;  3FKI B;  5C3W A;  2QCP X;  2F0Q A;  1D1K A;  2VB2 X;  1IHZ A;  2AQ3 B;  2SNS A;  4X3K A;  3E6Z X;  1LTT D;  1EYA A;  2IT1 A;  3OWF A;  3GV3 A;  3SEB A;  1VF5 C;  3DWA A;  2L12 A;  1ENF A;  1EZ6 A;  2YU9 B;  4IUV A;  2HDM A;  3D8G A;  4BY7 B;  2K33 A;  1G2T A;  3MXU A;  1B3A A;  3SK5 A;  2L5T A;  1OO9 B;  1CHQ D;  2NB0 A;  1C8C A;  1O7Z A;  1W6J A;  1LLR D;  1EU4 A;  4H7B A;  3P1H A;  1JOK A;  4LJZ C;  1Y69 U;  4RCN A;  1LTS D;  5C0X J;  4ODG A;  3OSO A;  1VF7 A;  4HMJ A;  2PYK A;  3EFX D;  2WKD A;  4ZYS A;  1Q12 A;  2B2T A;  3TDQ A;  5A35 A;  2CW0 C;  3K58 A;  3PMF A;  4OIK A;  1QWY A;  3MEH A;  1CA5 A;  2EPB A;  1EEI D;  3D4W A;  4A3F B;  3S2D B;  4M1U B;  1NSN S;  4DA2 A;  3HGB A;  3VYU A;  2C5C A;  3VYS A;  3Q24 A;  2RVL A;  1HUN A;  4BA1 I;  3M85 A;  4NP5 A;  1CQF A;  2KEE A;  5J1Z A;  2J4X A;  2A74 C;  4Q5V A;  5CBA E;  1JE4 A;  3GP7 A;  2K01 A;  3NTK A;  1XWE A;  2K04 A;  1B2T A;  1V1P A;  4L6T B;  3HP3 A;  4CKE A;  4C2M B;  1CK1 A;  3CU7 A;  2QKI C;  3C2P A;  3Q22 A;  2LKV A;  2ICE C;  1EOT A;  3NSW A;  1EY8 A;  4EGV A;  2FFK B;  3FRP B;  2K28 A;  4C3I G;  4FF1 A;  2KHS A;  2F0O A;  5I9P A;  2HCC A;  3RZD B;  2NVT B;  1H9S A;  1E2Z A;  4BA2 I;  5EPJ A;  3VYT A;  3MWY W;  4XT3 B;  5LL6 X;  4XDX A;  1SJE D;  3IKJ A;  2A6E D;  1U4L A;  1NR4 A;  2K05 A;  1KAA A;  4K5V A;  4IFD J;  2LS0 1;  1VDZ A;  2EY6 A;  2KCC A;  1PTO B;  5KEE A;  2XWJ B;  2ZXP A;  1G91 A;  4QCL A;  1EFI D;  2QIL A;  3SVM A;  1JB3 A;  2PCF B;  3PUX A;  2MHV A;  1ZYR D;  1CT1 D;  1MGS A;  2HQE A;  2RSO A;  4CKC A;  1LAB A;  1B9N A;  4OO1 G;  3S17 B;  3T13 A;  5EKI A;  5KND A;  3FPP A;  5C5L A;  1CA6 A;  2JXM B;  5CGK A;  3SDZ A;  3C3L A;  3NQT A;  3A8I E;  5EPL A;  5IIF A;  1DM0 B;  2NN6 I;  1WD0 A;  3NXW A;  5C4J B;  1AZQ A;  3BZD B;  4RGO S;  2EY1 A;  1HPC A;  1BBX C;  2EY5 A;  3FDT A;  3G6J B;  4K6L A;  3TSS A;  3IAY A;  3TBI B;  2B8F A;  4RKL A;  4ZQ3 A;  1B44 D;  4HED A;  5C5M A;  1SE2 A;  5EBC A;  1M4V A;  3S9W A;  1EYC A;  2IWH A;  4KHZ A;  1ENC A;  3PUY A;  4MHE A;  3A7L A;  5TSS A;  3KLR A;  4CGY B;  4UAI A;  2QF7 A;  5K36 H;  4WJW A;  3ZYY X;  2F0L A;  4FF4 A;  2PO4 A;  1JOQ A;  3I4N B;  3BYY B;  2EDG A;  2BCO A;  2BDN A;  2J0T D;  3DEP A;  3MXG A;  3NQI A;  2O5I C;  1HCZ A;  1SNQ A;  1WTX A;  2CQA A;  2LFN A;  2KEC A;  3K5N A;  1TS2 A;  3LWE A;  3EJI A;  4F7X A;  2RSN A;  5D3D A;  3FVQ A;  2HCI A;  1H9J A;  2N88 A;  5ELB A;  4FNF A;  2E74 C;  5CMD A;  4KY5 A;  1EY9 A;  1HUM A;  3FEW X;  4BY1 B;  3A8J E;  4DK0 A;  1SNP A;  4S3S A;  3VR2 A;  3PUV A;  1PTO H;  4H13 C;  3Q6S A;  5AFW A;  5ELC A;  2AUJ D;  2WII B;  1CFM A;  1DYQ A;  1G6Z A;  1TR5 A;  4TQU S;  2R7Z B;  5M9O A;  2OXP A;  1PFN A;  5G3L F;  1GUG A;  2Z8L A;  2F3V A;  5JPN C;  3P7J A;  1RDP D;  1IW7 C;  2CHB D;  4ZUI A;  1STN A;  3DEO A;  5BN5 A;  4BS9 A;  3QO2 A;  2EYM A;  1I4H A;  1K8O A;  3DHQ A;  2D62 A;  5C0X H;  2O4X A;  3JAM E;  1KDC A;  1FD7 D;  2JSO A;  5BN4 A;  1HTL D;  4B08 A;  3I3C A;  3FMC A;  2EXZ A;  4M8A A;  4HCS A;  3HZX A;  4IUQ A;  2A6H C;  1I4X A;  3A56 A;  2F0G A;  3H0G B;  3S1Q B;  2E2D C;  1TU2 B;  3C1E A;  1PRT C;  3MFG A;  1UAP A;  3NBH A;  1CM9 A;  2NVQ B;  1SSO A;  3K59 A;  4ULL A;  2EJG C;  1WTO A;  1S4Z A;  2G9H D;  5JAV A;  1LT3 D;  5E4X A;  1K83 B;  1EWH A;  1Z6H A;  3OMG A;  5JEA G;  2CVR A;  2F03 A;  5FKA C;  4PQX A;  5IT9 E;  3NE5 B;  4DN4 M;  3SK6 A;  2PMZ B;  1R4P B;  1MSG A;  1IL8 A;  4A3E B;  3S14 B;  3ONA B;  2F0T A;  2Q8T A;  4C3H G;  4IUN A;  1DOM A;  2IX3 A;  5DNF A;  1F9S A;  1EY0 A;  2F0D A;  1O78 A;  1GOZ A;  4KMU C;  4C1N I;  1JQY D;  2DNE A;  1BCP B;  3R8B A;  3SXH A;  4PMB A;  4MIU A;  2VUM B;  4K5X A;  2NN6 H;  3P75 A;  4QUF A;  1SE3 A;  2F0K A;  1BNZ A;  1Z7T A;  5KYL A;  5NUC A;  2E2I B;  3V05 A;  2D9U A;  1F2L A;  2JE6 I;  5EGT A;  1NUC A;  4R8N A;  4C3J G;  1X3P A;  3BS1 A;  3JAM L;  2NVX B;  3ERQ A;  4KY6 A;  4WFN 3;  1A2U A;  1TII D;  1GUN A;  2R92 B;  1IYU A;  3ND8 A;  3NTH A;  4TSS A;  2A73 B;  2F0S A;  1PFM A;  1GHJ A;  1SYD A;  1O7L A;  3IFD A;  2SOB A;  1ROD A;  4XYO A;  1T5X D;  3QJY A;  3A8K E;  1I6H B;  1S5F D;  4KKS A;  3I73 A;  1KNE A;  3R3O A;  3MFY A;  2DY7 A;  2NTT A;  4V19 0;  3E0J A;  2KUM A;  1PYW D;  4C1N K;  5IOD A;  1JR0 D;  5I2Y A;  4QUC A;  2BOS A;  4LK1 C;  4C3I B;  4IUR A;  3OPO A;  4Y7N B;  3NWS A;  4A3J B;  5E3F A;  1LV9 A;  1F9P A;  4PNY A;  5M5X B;  3HOW B;  3TME A;  2F4I A;  2F3W A;  1OXT A;  5IT9 L;  3KBG A;  1NAP A;  3I8Z A;  4XT1 B;  3HEJ A;  3HOY B;  2D5D A;  1STH A;  1Y8P B;  3T4A C;  3VA5 A;  3GTO B;  2A6E C;  2B2T C;  3VR3 A;  1F77 A;  4X3S A;  3PIO 3;  3J81 E;  3MA2 B;  1S5D D;  1TWH B;  2B39 A;  4DU9 A;  1Y1W B;  1QIL A;  4A3B B;  4IN3 A;  3R93 A;  3GTM B;  1HA5 A;  4TRD A;  4J8Q A;  3I72 A;  4NDX A;  5DM6 3;  4K8I A;  1Q90 A;  3DXJ C;  1ZYR C;  1A3V A;  2K5D A;  1HA6 A;  5EBD A;  1PTO D;  3P20 A;  1B1Z A;  4IUT A;  4BBR B;  1E0B A;  1H9M A;  3EQL C;  4LMQ D;  2GA4 B;  2DY8 A;  2EZV A;  3BG3 A;  5M5Y B;  1SDF A;  1SMY D;  1EY4 A;  2E75 C;  3GD7 A;  2EVB A;  1BXT A;  2LY7 A;  4DXF A;  3M7N A;  1ZEQ X;  4KKU A;  3RMH A;  1SYF A;  4NMZ A;  1M8A A;  1XYI A;  5C4Z A;  5CV5 A;  1CHP D;  5KGU A;  3H6M A;  5JEA J;  3R2I A;  2Z1C A;  1LO5 D;  5CR3 A;  2BA1 A;  1SYG A;  3KUP A;  4G7H C;  3GTP B;  5ELD A;  1RHP A;  2B2Y C;  3HKZ B;  3S2H B;  2XN9 C;  5C0X I;  5ISR A;  4FO2 A;  2K7V A;  3MXN A;  1KNA A;  1HXY D;  1TS3 A;  3S1M B;  1D6E C;  1EQT A;  3BDL A;  1TKW B;  2A69 D;  5EJW A;  1U4P A;  1R9T B;  2RDG A;  2IPK D;  2AUK A;  2KJX A;  1SXT A;  1F2M A;  2SDF A;  1TWF B;  2B2Y A;  1STG A;  4A3M B;  1I4R A;  1IKL A;  1SFO B;  2E76 C;  3NK9 A;  2F0P A;  3GQB A;  1T5E A;  1XXG A;  2JA6 B;  2EYH A;  2N55 A;  3D31 A;  3I90 A;  1DJR D;  4RFB A;  3J81 L;  3X3M A;  4C56 C;  4QIW B;  2X6G A;  1UNS A;  5CBE E;  4NW2 A;  3SK4 A;  5IGB A;  3BYT B;  2F0V A;  3N52 A;  2PZT A;  5CV8 A;  4U67 3;  2F0J A;  4I7Z C;  5DEH A;  3J7Y W;  4KJO A;  1FNW A;  3NWT A;  5FK9 C;  1WVL A;  2OT2 A;  3D6C A;  4KD3 A;  1EL0 A;  3S1R B;  1R4Q B;  1EWC A;  1Q1B A;  4HSP A;  1MBY A;  4RHS A;  1YNJ C;  1QOH A;  2J7Z A;  2K1B A;  5KNC A;  3U9O A;  5BN3 A;  2E2J B;  3HG9 A;  5HUR A;  5CYU A;  4XQQ A;  5E4W C;  3NTI A;  2QEJ C;  1A2T A;  3MVV A;  3GTQ B;  1O80 A;  1BCP F;  3OW7 A;  1D5X C;  5M3F B;  5JJZ A;  3HS0 C;  4ZAI A;  2XIW A;  4RGN A;  1TVX A;  2R6G A;  2BE5 D;  4IFD I;  2XVS A;  5LL6 S;  1EIH A;  1Y8N B;  2PNR C;  3CRL C;  1K8M A;  5K5P A;  4ZKB B;  1JWS D;  2H1E A;  1WTQ A;  4KY7 A;  3V96 A;  3L3O C;  2KOL A;  3S16 B;  1QG7 A;  1G29 1;  4UDU C;  3V2T A;  1Y8O B;  4TKO B;  1I4P A;  3K0Y A;  2BA0 A;  1QB5 D;  2MUY A;  3NUC A;  2OF1 A;  4X3T A;  1HFN A;  4HTH A;  4L8J A;  4KJN A;  2A5H A;  1RD9 D;  1DOL A;  1FR3 A;  1GUW A;  1LT6 D;  1LTB D;  2A68 D;  2TMP A;  2DN8 A;  1RTN A;  4O42 A;  2R61 A;  4B9X A;  3GTK B;  1KLG D;  2KQ3 A;  3I4M B;  3X3N A;  4CJ2 C;  1L0X B;  1WTR A;  3A55 A;  1PLF A;  1RF2 D;  1RKN A;  2B2U C;  3KLS A;  5FLX E;  4C3H B;  3BDC A;  4KI0 A;  2X69 A;  1LTI D;  2KA7 A;  2WAQ B;  2SEB D;  4FXD A;  2FMC A;  1HQM C;  2RBM A;  3AB9 A;  2PPB C;  1I4Q A;  4A93 B;  2B2U A;  4DK1 A;  2K5W A;  1V1P B;  5FO8 B;  3NHH A;  4RWS C;  4K6D A;  4PMC A;  5EQ0 A;  5C4H A;  1CQV A;  2KVM A;  2O2L D;  1L0Y B;  3C1F A;  2ENB A;  1GUO A;  1DOK A;  1FGB D;  3K5O A;  1BQQ T;  3BVZ A;  1I3Q B;  3J7A F;  1BCP D;  4C3J B;  1STA A;  1OXX K;  1H9S B;  2PZU A;  1LT5 D;  2E2H B;  1YNN D;  3K5L A;  1IKM A;  4MN3 A;  4RGM A;  1EY7 A;  4HSV A;  3EVQ A;  5IGF A;  3RUZ A;  3TP7 A;  3W2D A;  3L9A X;  3HOU B;  5T1I A;  2SNM A;  3GTJ B;  2IX1 A;  1B50 A;  2MP1 A;  4ILW A;  2L9H A;  4XIG S;  1PXU A;  2F1M A;  2M9V A;  1LT4 D;  2IJ0 A;  1ICW A;  2JA7 B;  5JOB A;  2XSC A;  2FIN B;  3QIA A;  4F87 A;  2RDH A;  1V8Q A;  4K5W A;  1BF4 A;  1A6X A;  1Q1E A;  3N6R A;  4BBS B;  3DM1 A;  3T53 B;  4R9W A;  5FLX L;  2L4N A;  4KTA A;  1ESR A;  3IFT A;  4F88 A;  2IW3 A;  5C3E B;  3GTG B;  2EYF A;  5LHY 1;  1VCI A;  4K2L A;  4KKT A;  1W6K A;  5C6A A;  4Z9C B;  5I2X A;  1E2V A;  3Q0A A;  1SYC A;  1Q3L A;  3RLF A;  1JWU D;  3CRK C;  1AFP A;  2NN6 G;  5I6W A;  3WDN A;  4A3G B;  5KYI A;  1AZP A;  2F0M A;  4DGZ A;  1PTO F;  4OIJ A;  4IAL A;  4IFD H;  3H3V C;  2KED A;  1S5C D;  1PTO C;  1LTR D;  4KD4 A;  1HHV A;  1PMR A;  2R93 B;  1ML0 D;  4OO1 I;  1NCV A;  4CJ1 B;  2L11 A;  3TP5 A;  1TWA B;  4A3I B;  3OIP A;  1SMY C;  1B9M A;  1AN8 A;  3PO3 B;  1C4Q A;  1J9O A;  3QG1 A;  3W3A A;  1QNK A;  1WTP A;  3KBX A;  4CJ0 B;  4DAV A;  3MC0 B;  5FO9 B;  4QB4 A;  1LTA D;  3MXP A;  3RD4 A;  3IL8 A;  2JEB I;  1DD2 A;  1B53 A;  5KNB A;  1PRT D;  4XXE A;  1WTV A;  4N9T A;  3Q23 A;  1A3U A;  5HGT A;  4ZLT F;  4DNT B;  3L7Z C;  4DAY A;  2A69 C;  4ZK9 B;  4KN7 C;  3KF8 A;  3BDO A;  1H9R A;  2TSS A;  3O13 A;  3ND9 A;  1EY6 A;  2D2C C;  3SR1 A;  4K14 A;  4F8M A;  2EYL A;  2AWO A;  4HMI A;  3MZ5 A;  2ICI A;  1D2B A;  1O7Y A;  3D3R A;  5KRU A;  5I6Y A;  1ONL A;  3D4D A;  5EPK A;  1ILQ A;  2ZT9 C;  5A2Q E;  3OOC A;  4EVO A;  1QNU A;  3NP8 A;  1BUV T;  4A3D B;  3D6W A;  3DMU A;  3MHB A;  1KDA A;  1BDO A;  4IUU A;  2L55 A;  3TZD A;  1HFG A;  3PIP 3;  4E6I A;  4KN4 C;  4NKL A;  1EIG A;  4FVM A;  2WKC A;  2B2V C;  2PQE A;  4J1M A;  1I6V C;  1Z47 A;  1EU3 A;  1II3 A;  4G4K A;  1EY5 A;  1GJX A;  2H4O A;  3SK8 A;  4FXG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...