1D7QA

Human translation initiation factor eif1a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
143
structure length
143
Chain Sequence
b'PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (N-TERMINAL HISTIDINE TAG)
publication title The eIF1A solution structure reveals a large RNA-binding surface important for scanning function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 8
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1d7qA00
1XNQL 3BZKA 1E1OA 4YCUA 1HZCA 1VQGA 2ID0A 1Z9FA 3K80C 3J7ZC 2ASBA 4B3MQ 5IYBG 1OXUA 1OTCA 1TWAH 1MJEA 4JI6L 3I56A 3CPFA 3AYHB 2F4VL 3BJUA 3L0OA 3I4NG 3I55A 4C3JH 5IYBH 3I2ZA 3PF4A 4A3MG 1Y1WG 5IE8A 1V9PA 5LMUL 1XNRL 3F2CA 1Q82C 1IL2A 1E22A 3U4ZA 3GTMH 4JBMA 3I4NH 2AWOA 2UXDQ 5C4XG 1RIPA 4C3IH 4POFA 5IYCG 4A3MH 4GOPB 1W3SA 1Y1WH 2K5VA 1CKNB 3JC66 1PH4A 2UUAL 2NZHA 3KJOA 4HJ8A 4BY7G 1VQIA 5C4XH 1YEZA 1OXXK 4LF5L 1H95A 1A8VA 2IT1A 2I5HA 3FHWA 2Q2HA 4LUVA 5IYCH 2E2HH 3KF8B 5M5YH 5IWAL 4A93G 1U0LA 4Y52H 4JYAQ 3S1MH 4BY7H 1YHBA 4A4IA 1X55A 4DV5Q 3S14H 1YVCA 3RLNA 1GO3E 1VS0A 2JQOA 4AH6A 1J5EQ 4A93H 2JA6G 3K81C 2E8GA 4PZ6A 4GNXC 3CMEA 2IHEA 3CCMA 2VQFL 4X64L 5C0XG 4DV2L 4P71A 2R92G 3A5UA 1WFQA 4QGUA 4DV4L 4YY3L 2UUBL 1IXRA 3OTOL 2K50A 2ZJQA 3J81j 4LF7L 2JA6H 3S17H 1YHQA 4RMFA 1CKMA 2JEBI 3DM3A 5J3BA 3CCLA 2R92H 3CD6A 1W2BA 4BXXH 1QUQA 2B3GA 2BH8A 1BBUA 3I4OA 4IPHA 3U58A 1J6QA 2B29A 1HZAA 3PGZA 1GM5A 1KIXA 4APVA 2HT1A 3BU2A 4YHHL 4JI3Q 3Q8DA 4IOAA 1N8RC 1B70B 4KLKA 1UE7A 3W1GA 3J81c 1PH5A 2UU9L 1UEBA 2I5LX 4JI5Q 4B3TL 3CCEA 4DV0Q 2LXKA 4A3KG 2R7FA 2QGQA 1LTLA 1PYBA 2ZJRA 3CQZH 3TRZA 4JV5L 1NMGA 1YHAA 2KHJA 2VUMG 4C2MH 4LWCA 3UDGA 1HR0L 3OYYA 3K7AH 4LUZA 4A3KH 2NVQH 1XMOL 1XMQQ 1ASZA 3CPWA 1A63A 4GLXA 2QA4A 3PUWA 2R7ZG 4LF9Q 4R4TA 2VUMH 1EQRA 3D31A 2E5LL 4JI1L 1Q81C 1I50H 2N78A 3EIVA 4MTNA 1JMCA 3T1HL 4UP8A 1HNWL 1Q46A 1HNXQ 4DUZQ 4DR4L 4DR1L 5JJIA 5E7NA 2RCNA 2XGTA 2BA0A 4A3LG 5AJ3Q 4K0KL 4KHPQ 3UE0A 3PO3G 2MO0A 5JEAJ 3AFQA 2XTIA 4IPGA 4WJ4A 4QIWE 1D8LA 3HOXG 2NN6I 4A3LH 3CC4A 1PYSB 1DGSA 4JI8L 1L1OC 3M9BA 4A3DG 4LF8Q 1AH9A 1FL0A 1KRTA 1JJCB 5C44G 4GN3B 4DR6Q 3UDIA 4DR3L 5H1SE 2JE6I 1QZHA 4DK3C 2CCZA 4A3DH 1CSQA 3S24A 4QY7A 4JBJA 1PH8A 1HR0W 1YJ9A 4DNIA 5C4JH 1QVCA 5C44H 1A62A 3HFZB 1VQJA 2PQAA 2B63G 1TWHH 3WWVA 5IP9G 1N32Q 4DR2L 3RN2A 1T9HA 2D0PA 2V1CC 3PUXA 2NVXH 2VY3A 3CCJA 1ASYA 3F1ZA 4JI0Q 4JI7Q 4O2DA 3LGJA 4GKKL 3A0JA 2B63H 1EWIA 1FVIA 4OONA 5IP9H 3ZJYC 2A8VA 1IBML 3GD7A 4A3FG 1K73C 1I5FA 1WYDA 1YNXA 1N36L 4OO1G 2HHHL 4IFDJ 2YTVA 5BR8L 1VQ4A 3F2BA 5IT9c 4A76A 5FJ8G 4A3JG 4A3FH 3UDFA 3I7FA 5LMNQ 2JA7G 1VQ8A 2UUCQ 4J15A 3JAMc 3RNUA 1IBKQ 1N33Q 4UP7A 4OO1I 1RL2A 2LSSA 1TWFH 3CP0A 5FJ8H 4A3JH 3TS2A 3NEMA 1VQOA 4OX9L 1HNZQ 2JA7H 1E3PA 4LF4L 1VQ9A 4NXNQ 1EOVA 4JI2Q 4X62L 4GOPC 1K3RA 1K0RA 2QEXA 3CF5A 1VQDA 4GLAC 4LFAQ 1M90C 4DR7L 1KHIA 4LF6L 4P75A 4AQYL 1A0IA 1BVSA 4KHZA 3BZCA 1JB7A 4P74A 2KENA 3ULPA 3EBEA 2PI2E 2UXCQ 2EQSA 4MNOA 4DV1Q 1KD1C 2CFMA 4ALPA 4PZ7A 1HNXL 1I94L 4JBWA 3KF6B 4X65Q 4GNXA 3PUZA 1VQLA 3S1NH 3RZDH 1VQEA 2PNHA 2VQEQ 2FXQA 1E24A 1VQAA 2ZTDA 4EX5A 4A3CG 5M5WH 1X3GA 2YU9H 1E7ZA 2Q2UA 2KCMA 3KDFA 1N34Q 1TWGH 3AQQA 1IBLL 1MIUA 4LUOA 4NXMQ 1C0AA 4B3SQ 2K14A 5IP7G 2E2JH 4LF8L 4A3CH 5IY0A 4P72A 1L2FA 4DR5Q 4DV6Q 4XTCS 4R4OA 4HJAA 3S2HH 4LFBQ 1FJGQ 4BXXG 4UP9A 1UE1A 3UE1A 5IP7H 1L0WA 4JI4L 2UXBQ 3NELA 2YV5A 1JJGA 3M85A 2HQLA 4DV3L 4HIMA 4X66Q 5C0XI 1WOCA 2K75A 4B3RQ 1IYJB 2AMCB 5GAGC 4R4CA 1NMFA 2WB1E 4BBSG 2GN5A 4HJ5A 3NBHB 3RZOH 2WB1G 3ICEA 2A1AA 1VQPA 4L5TA 3F2DA 1E1TA 4OWTB 2IX1A 4O0AA 1V43A 4HJ9A 1KRSA 4BBSH 1X3FA 3EN2A 3J80i 1FGUA 2AWNA 2CKZB 4PMWA 2JA5G 3PF5A 3GTKH 4HIKA 5JJLA 1YJWA 1EUJA 3PUYA 2ES2A 3A74A 5FLMG 2MNAA 3H3VH 2R6GA 3S2DH 2JEAI 2VNUD 4GLVB 3ER0A 4GKJQ 4JG2A 2JA5H 2N8NA 3CCSA 5GAHC 3CCQA 1XNQQ 4IJHA 5FLMH 3TS0A 1C9OA 4AYBE 4B3ML 1PA6A 1HNZL 4AYBG 1AE3A 3CCVA 1NTGA 1L1OA 2R7ZH 1MKHA 3KLWA 1JT8A 4JI6Q 3GTLH 3G6EA 3CXCA 4LFAL 3FP9A 2F4VQ 2OTJA 1XJVA 1SLJA 3M4PA 4EQ5A 1VQ6A 3GTGH 2K5HA 2WAQE 1Z47A 3B6YA 2UXDL 4DV7Q 1VQKA 2VZAA 4DK6C 5LMUQ 1LUZA 2WAQG 1TXYA 4IOCA 1XNRQ 3HOZG 3RR5A 3J7A5 2UXCL 1CUKA 4LFCQ 2Z0SA 1XPUA 4XIGS 2NZOA 1QVGA 3HOXH 3OW2A 1PH1A 1VQFA 1Y1VG 3NENA 4BA1I 1KL9A 2GVAA 2UUAQ 1PH2A 1OXVA 1Q86C 1JJ2A 3HOZH 3PO3H 4LF5Q 3PUVA 4L5QA 3ULLA 1QZGA 4JYAL 1O7IA 3S1QH 1Y1VH 4DV5L 5IWAQ 4YCVA 1SROA 4IJLA 2IHFA 5EAYA 2ALYB 3TREA 1J5EL 1YIJA 1D7QA 2D62A 1SR3A 1EFWA 2VS1A 2RF4A 1XPOA 4JBKA 1YITA 1M1KC 1HH2P 2JA9A 1EQQA 2VQFQ 1YBYA 3M3YH 4X64Q 2E2IH 3GTJH 4DV2Q 1TWCH 4YWKA 4YY3Q 4JC0A 3OTOQ 4DV4Q 4LF7Q 5HGQA 1C7YA 5JJKA 1QVFA 1UWVA 4NB3A 4P73A 3CC2A 2JA8G 1PFSA 4X66L 2N3SA 1KXLA 4JOIC 3PIPA 2KHIA 1HZBA 2YYZA 4GOPA 3KYHC 1CKNA 3FKIG 3KOJA 5FLXc 1Y14B 4DUYQ 1AE2A 3K8AA 4JI3L 3IRBA 1K83H 2JA8H 3AEVA 1G6PA 1NE3A 3MEFA 4YHHQ 4JI5L 5HY6A 1V1QA 3FKIH 4IPCA 1G51A 1KQSA 4DV0L 4NPSA 2UU9Q 3E0EA 1PHJA 5C0XJ 5GROA 2NVYH 2Q2TA 4GN5A 4B3TQ 4A3IG 1WCMG 3F8TA 5JEAG 1K9MC 3TQYA 3CC7A 1SMXA 4HIOA 2MQHA 4JV5Q 4GN4B 1XMQL 1S40A 2K4KA 4R4QA 2NVTH 4RG1A 1GD7A 1HR0Q 3HOVG 4A3IH 1WCMH 2K52A 4A3GG 4LF9L 5M5XH 2PQAB 4DAYB 3T1YQ 2Z6KC 1UE6A 2GVBA 2ZM6Q 1PH9A 4FDBA 1GKHA 4TVAB 4X6AH 4DUZL 1G291 4JI1Q 2E5LQ 3HOVH 4A3GH 1U5KA 3GTQH 3T1HQ 1HNWQ 1X3EA 3RLOA 4DR4Q 2K5NA 1EIFA 5AJ3L 4DR1Q 1LYLA 2H5XA 4KHPL 2YTXA 1NBWA 3K0XA 3PSIA 4LNQA 4K0KQ 3MXNB 4BA2I 3PO2G 3J81i 4DV7L 2WFWA 4PG3A 1PV4A 2L15A 2C35B 2AKWB 1X6OA 1XTDA 4LFCL 3W5OA 4JI8Q 3CMAA 1Q1EA 2KCTA 2Q2IA 4A75A 4DR6L 3PO2H 2OQKA 4IFDG 2YTYA 5K36G 4LW1A 3CCUA 2A19A 3K7UC 1X56A 4DR3Q 3GTOH 2MFIA 3HOWG 4BY1G 3KFUA 4R4IA 4WJ3M 1PH3A 1PH7A 3HKZE 3CW2C 3G48A 1CSPA 3HKZG 4Y7NH 1N32L 2LXJA 3HOWH 4IFDI 2VW9A 4HIDA 5GADC 4BY1H 4JI0L 4JI7L 2F3IA 1LM0A 4DR2Q 5C3EG 2EIFA 1Q1BA 2R7DA 5ELOA 4OWXB 4AIMA 4GKKQ 4HJ7A 4BBRG 1SN8A 4OXPA 4IPDA 1B7YB 4OWWB 2JJQA 2I5MX 4GS3A 5C3EH 1IBMQ 2D0OA 3S1RH 1S72A 2PMZE 4BBRH 3L2PA 1PH6A 1N36Q 2HHHQ 1KAWA 1OXTA 4QJFA 3GDEA 4GNXB 3A5ZB 3HKSA 5BR8Q 3G4SA 5LMNL 3H3VI 2UUCL 1WI5A 2BA1A 1B8AA 1IBKL 1N33L 3PV0A 3AFPA 4KI0A 4DUYL 1P16A 1BKBA 1VQCA 1N9WA 1VQ5A 3KDFB 1K8AC 1JE5A 2R93G 2HIVA 1IZ6A 3KJPA 1YJNA 4QQBX 1NJIC 3SGIA 3GTPH 1WJJA 2EXDA 4QL5A 3CAMA 4NXNL 2WP8J 4JI2L 1X9NA 4OX9Q 4UY8C 1OXSC 4LF4Q 3U50C 4ME3A 2KBNA 3DLLA 4YWLA 5GAEC 2R93H 4X62Q 1HZ9A 1VQNA 2DUDA 1K8GA 1HJPA 1SRUA 4UPAA 4JCVE 4LF6Q 4DR7Q 4A3EG 3ERSX 4AQYQ 1YI2A 4DKAC 2HIXA 3T1YL 1QUQB 3H0GG 4A3BG 2ZM6L 3HOYG 4DV1L 1VQMA 4POGA 2F52A 4IO9A 2N49A 2ZTEA 4C3HH 4A3EH 1Q7YC 1BBWA 3TEHB 1R9TH 4X65L 2NN6G 4A3BH 2RHSB 3H0GH 1I94Q 2ZTCA 3ULJA 2VQEL 5LMNW 3HOYH 3M7NA 4R1JA 5ELNA 1VCIA 2IX0A 3JAMi 3HOUG 5DLQE 4DPGA 1KC8C 5M3FG 3H15A 1NY4A 1VQBA 3J80c 2OTLA 3UDXA 4DAMA 2Y0SE 5M3MG 1N34L 4NXML 2DGYA 4B3SL 2Y0SG 1X54A 1IBLQ 3STBC 3S15H 3M4OH 3HOUH 1PVOA 1MJCA 2MO1A 5M3FH 4DR5L 4DV6L 2CQOA 4JOIA 2CWAA 1P8LA 5M3MH 4LFBL 1FJGL 1VQ7A 5IYDG 3GO5A 1Q12A 1EIYB 1EYGA 3PIOA 2BH2A 2UUBQ 2UXBL 3D0FA 3E9IA 2AHOB 2OQ0A 2I0QA 4YCWA 3CCRA 4JI4Q 1Q8KA 1SE8A 2ZJPA 1L1OB 3U4VA 5IYDH 3PCOB 4B3RL 3M4QA 4L5SA 4DV3Q 1S3OA 3I4MG 1X65A 1CKOA 3VDYA 3W1BA 2JK8A 3KF6A 3STBD 1SFOH 3I4MH 4L5RC 2IY5B 3RLFA 2Z6KA 2PI2A 1VQHA 3RN5A 1I3QH 2OCEA 1I6HH 4YWMA 2ATWA 2RHQB 3L7ZC 4H02A 3E9HA 5GQOA 3S16H 1XPRA 4GKJL 1GVPA 3G71A 2CWPA 4MZ9A 1YZ6A 4TQUS 4PZ8A 2OWOA 2VL6A 1UE5A 1XMOQ
chains in the Genus database with same CATH superfamily
4L63B 3OHXC 1PTOH 3DXJC 4Q0FA 1RD9D 1Z9FA 1PTOB 5KYIA 4B3MQ 3SVMA 5IYBG 3D4RA 3FVQA 1OTCA 3HOVB 3V2TA 3I56A 3GTQB 2D2CC 3BJUA 3I2ZA 2FMMA 5CV4A 1JCKB 1Q82C 1KNAA 3U4ZA 2IPKD 1BCPC 3I4NH 2UXDQ 1QG7A 3KUPA 3MA2B 4C3IH 3I4NB 2F0SA 2K5VA 1PH4A 1S5BD 2NZHA 4C3IB 3KJOA 4DNRB 5C4XH 4LUVA 1U4RA 4Y52H 5D3DA 1YVCA 1SYFA 3BS1A 1CFMA 4PQXA 1GO3E 1VS0A 1JWUD 1TR5A 3OMCA 2JA6G 3CRLC 4GNXC 2IX3A 2Z4IA 4P71A 3A5UA 4QGUA 3SK4A 4BXXG 4LF7L 2UUBL 2ZJQA 4ODGA 4RAUC 3J81j 3CRKC 1YHQA 1BCPF 1CKMA 3A7LA 5J3BA 5CC4A 2R92H 3T56B 4BBRB 1W2BA 4CDFC 2R92B 3I4OA 2F0JA 4IPHA 3PGZA 4JI3Q 3Q8DA 3TN2A 1B70B 3SK8A 3W1GA 2SEBD 3QWNA 1HUMA 4DV0Q 2F3WA 2HCCA 3HZXA 4DK1A 1YHAA 5CBAE 3UDGA 2ZXRA 4A3KH 2DNCA 1W6KA 1ILQA 3U9OA 1XMQQ 2HQEA 1D5XC 3CPWA 1A63A 2JP1A 4GLXA 2R7ZG 3KLRA 4R4TA 4FNFA 2VUMH 1EQRA 5G3LD 1Q81C 3EIVA 2A6ED 1Q46A 4DR4L 2F03A 4DR1L 5JJIA 2Q8TA 5E7NA 5C5MA 3J80L 3Q0AA 4KHPQ 1TIID 4K5VA 2E75C 1I4XA 2XTIA 4IPGA 2KEDA 4WJ4A 1FNUA 2CH4W 1JOQA 3FMCA 1L1OC 1KLGD 1IL8A 1FL0A 1WTXA 5C44G 3OWEB 3UDIA 3CKIB 3H09A 1QZHA 4A3DH 2QW7A 1PH8A 4KY5A 1YJ9A 2K1BA 1QVCA 4DK0A 1TWHH 3PUXA 1TWHB 3F1ZA 3LGJA 1SYEA 4G57A 3I4MB 2NTSA 1N36L 3HGBA 1TS5A 2EE1A 3F2BA 2G9HD 3I7FA 4OO1H 1JE4A 5E4WC 1N33Q 4UP7A 1WTPA 1TWFH 5FJ8H 4A3JH 1HNZQ 1TWFB 4A3JB 4ZKCB 1VQ9A 4NXNQ 1RF2D 4X62L 1TS3A 3E3XA 1M90C 2B39A 2RDFA 1XWEA 4LFAQ 1PTOD 2N88A 4LF6L 1BVSA 3SEBA 1ZYRC 2PI2E 3MXGA 2UXCQ 3EFXD 2EQSA 5FOBB 4K2KA 1BDOA 1TY0A 2KECA 1FNWA 1VQAA 2E2HB 3PMFA 5M5YB 1X3GA 2YU9H 2OEOA 2KCMA 4NXMQ 1C0AA 2YU9B 4B3SQ 3KK7A 4RWSC 4P72A 1JC7A 4DV6Q 4HJAA 3HP3A 3QIAA 4CDCC 1GUTA 1L0WA 4F8MA 4JI4L 3NELA 1D1KA 5T1IA 4ME5A 3D6CA 3K6OA 4HIMA 3WOFA 2I46A 4B3RQ 5HGTA 1ILPA 1IYJB 2FFKB 2WB1E 4BBSG 2GN5A 1RODA 4HJ5A 3TZUA 1VQPA 1EIHA 4OWTB 2IX1A 1V43A 3EN2A 4PMWA 2AWNA 2CKZB 2B2YA 1EUJA 3PUYA 2ES2A 2MNAA 2R6GA 1TU2B 1SYDA 1X32A 2EYFA 2EYMA 4JG2A 2N8NA 3I4LA 5GAHC 1XXGA 5FLMH 1C9OA 3VA7A 4RGOS 1DCZA 4CKEA 1HNZL 2PPBC 4KJOA 2B8GA 1NTGA 1UEAB 2OF1A 4OELB 5EBDA 5G3LF 1CI3M 1FGBD 4CJ1B 4LFAL 3FP9A 2OTJA 1VMPA 2ZXPA 3K59A 4EQ5A 1YNNC 2K5HA 4HMIA 3SK6A 2VZAA 1XNRQ 1LUZA 2UXCL 2O5JC 2Z0SA 2A69D 2NZOA 2AQ3B 3NENA 1JJ2A 3HOZH 4TSSA 4LF5Q 4L5QA 4JYAL 1O7IA 3S1QH 5C4ZA 4G7ZC 4DV5L 3OW7A 4NDXA 3S1QB 5FLXE 2L5TA 3H6MA 1JWMD 4JBKA 1KDCA 4IN3A 2P5ZX 1YITA 2BOSA 2JA9A 2TMPA 1CA5A 2B63B 2E2IH 2IJ0A 1RTOA 5EQ0A 4K14A 5HGQA 1STHA 1QVFA 1LT6D 1UWVA 1I4GA 1KTKA 1HRJA 2KHIA 1CT1D 1HZBA 4GOPA 2LKVA 1CKNA 4IUNA 4KMUC 3TP7A 2JA8H 1G6PA 1NE3A 3RUZA 5CGKA 4IPCA 2B2TC 3A56A 2MJ8A 3W3AA 3E0EA 4NPSA 1PHJA 2UU9Q 2KEEA 1JICA 1E2WA 4QF4A 2KVMA 3D8GA 2EYPA 4R4QA 1GUSA 2K32A 1GD7A 3HOVG 1WCMH 5JEAH 2K52A 1RCVD 4A3GG 4LF9L 2PQAB 3BG3A 2GVBA 1WCMB 1GKHA 3K57A 4TVAB 4X6AH 4DXGA 3BYYB 4DUZL 1PVOA 1HNWQ 1X3EA 1UAPA 1CK1A 5CV9A 3RLOA 1JR0D 5ELDA 1NBWA 3PSIA 4KY7A 1F9PA 1VF7A 4RHRA 3PO2G 1EY9A 1VF5C 4PG3A 1PV4A 2BE5D 4GZYC 2AKWB 3R2TA 3WDNA 2KCTA 3I8ZA 1LTTD 4DR3Q 3TP5A 1SJHD 1Y8NB 1PH3A 2NTTA 1BCPB 1R4PB 4K5XA 1RJTA 1MBYA 3HKZG 1S4ZA 5KRUA 4BY1H 4DR2Q 5KGUA 1H9RA 1Q1BA 2R7DA 5ELOA 4BBRG 4OXPA 4OWWB 3ITPA 3IFDA 2IW3A 2I5MX 1IBMQ 3NP8A 3CHBD 3GTKB 4GNXB 3A5ZB 5CORA 3G4SA 2WACA 4ZQ3A 1AEXA 1IBKL 4FVMA 2MHVA 3PV0A 1CA6A 5D14A 1N9WA 2JA5B 1CTMA 2KUMA 4CJ0B 1IZ6A 1NJIC 1STEA 1DM0B 3CAMA 3A54A 4JI2L 2EJMA 1OXSC 1YNJC 2KBNA 1QNKA 2DUDA 2K6AA 4UPAA 4JCVE 4QUFA 1LACA 4DR7Q 5CR3A 4X3SA 5J22A 1YI2A 2XNAC 5A35A 2F52A 3VYUA 1Q7YC 4A3EH 1GJXA 1TY2A 2NN6G 4RKLA 4A3BH 3H0GH 1I94Q 2ZTCA 3ULJA 5LMNW 1VCIA 4A3BB 3JAMi 5BN3A 4DPGA 4FF2A 1S5FD 3HOUG 1L0YB 2DGYA 2Y0SG 1IBLQ 3STBC 1MJCA 5M3FH 4DR5L 2CQOA 2CWAA 1S5DD 2K33A 5I6YA 1Q12A 5M3FB 1H9MA 2I0QA 1L1OB 3HG9A 5IYDH 3QG1A 3I4MG 1CKOA 3IFTA 1MGSA 1K83B 1VQHA 3T13A 1QB5D 1I6HH 5GQOA 3E9HA 1I6HB 1SNCA 4GKJL 1U9RA 3MTSA 3M4YA 3J7AF 4MZ9A 1XMOQ 1XNQL 1DONA 4A3IB 2RSOA 3J7ZC 2JSOA 4C3JG 1OXUA 2EYJA 1HUNA 2R3ZA 4CDDC 1Y8PB 1B1ZA 3PIO3 4A3MG 1Y1WG 4ZCKA 2LY7A 1V9PA 5IE8A 1PFNA 3F2CA 5LMUL 4G7HC 1IL2A 1E22A 2AWOA 3ND8A 5IYCG 4POFA 1GHKA 4DNTB 4IUVA 4WJWA 4HJ8A 2J7ZA 4KKUA 1YEZA 1H95A 2F0MA 1GUNA 2Q2HA 3S1MH 4BY7H 4A4IA 3S14H 4HEDA 2F0KA 4TRDA 1V1PA 4AH6A 4BY7B 4Y7NB 3S14B 1J5EQ 3LX0A 3HOWB 4A93H 1EY0A 2E8GA 1BCPD 3J81E 2IHEA 2VQFL 1AP0A 5C0XG 1M8AA 1IXRA 5C3EB 1T5EA 2SOBA 1EFID 1RHPA 4J6HA 2EY6A 2WIIB 5C3WA 1QUQA 2B3GA 5JVG3 3Q22A 1Y69U 2B29A 1EWCA 4EQPA 2AQ2B 3X3NA 4KLKA 1PH5A 1UEBA 4JI5Q 3VR5A 2LXKA 1PYBA 3CQZH 3IKJA 1XYIA 2F3VA 2R93B 1NMGA 3CQZB 5DEHA 2KHJA 3E0JA 1HR0L 3OYYA 3K7AH 1D1IA 4KD4A 1XMOL 4PMBA 3K7AB 2RQXA 3D31A 2B2YC 4HR7B 2QCPX 4MTNA 4A3LG 2XGTA 4FF4A 4K0KL 1QE6A 4KHVA 1HFGA 2L1BA 2CHBD 3A8IE 3AFQA 5LHY1 1D5ZC 3CC4A 4R8IA 2K7VA 3M9BA 4I7ZC 3C2PA 1KRTA 4WORA 4IUUA 2KOLA 5IGFA 5H1SE 2LS01 1CSQA 1K28A 4DNIA 2Z6BA 5KYLA 5C4JH 2HUGA 1A62A 1VQJA 2B63G 1ENFA 3WWVA 5C4JB 1N32Q 1QILA 1T9HA 2F0PA 2V1CC 2VY3A 1ENAA 2PQEA 4O2DA 2EY5A 2KA7A 4LJZC 5C6AA 1EWIA 5IP9H 4OONA 4Z9CB 5J39A 3ZJYC 4OEMB 3GV3A 1K73C 5BN4A 2WKDA 3P1HA 1EY7A 2C9OA 1U4LA 3SXHA 5IT9c 3NUCA 4A3FH 2DY8A 5LMNQ 3C46A 2JA7G 2E76C 3JAMc 3MFYA 4A3FB 1RL2A 3CP0A 2PZUA 3NEMA 4OX9L 1GUWA 4L8JA 1E3PA 4OHJA 1EIGA 4GOPC 4HN7A 5A2QL 1KHIA 5ELFA 4P75A 5ELBA 1SNMA 4JVZA 2BDNA 3ND9A 2F0WA 3OIPA 3ULPA 3J7YW 4C1NI 4FYDA 1GXDC 4WRDA 1KD1C 3KLSX 4PZ7A 1LT3D 1X3QA 4X65Q 3PUZA 1VQLA 5KNCA 5C4XB 4XYQA 5M5WH 3KDFA 4ZLTF 1N34Q 3AQQA 4LUOA 2K14A 5IP7G 2AUJD 4A3CH 1ZYRD 4OGQC 1L2FA 4XTCS 3S2HH 2HDMA 1SYBA 3NPPA 1FJGQ 2PCFB 3A8JE 1UE1A 2UXBQ 1I4RA 2YV5A 3M85A 1HTLD 2WKCA 3VYTA 4DV3L 3I3CA 1STBA 1WOCA 4U68A 1B44D 4RH6A 1BXTA 3J7AV 4O1NA 5FO7B 1C4QA 3BZDB 2RVLA 3E6ZX 1EOTA 1LO5D 2JA5G 1YJWA 3A74A 4GLVB 3MZ5A 4A3KB 1STYA 4B3ML 1PA6A 1EY4A 4AYBG 3OSOA 2VUMB 4FXDA 3FEWX 3UI2A 4DN4M 1PLFA 3KLWA 4JI6Q 3GTLH 2Q8RE 2F4VQ 1QOHA 3P75A 4DF7A 4QCLA 3GTLB 2WAQE 1Z47A 3B6YA 5JPNC 2UXDL 4DK6C 1JWSD 1TXYA 3RR5A 2Z4HA 1PH1A 5D65A 1NAPA 2GVAA 4KK7A 2EJFC 2UUAQ 3PO3H 5I2XA 4ULLA 1QZGA 4A3DB 1Y1VH 5IWAQ 4I7AA 2WINB 4HMJA 2IHFA 4IALA 4C1NK 1YNND 2NYZD 2RF4A 1I4PA 4BWGB 4XQJA 5COYA 1Z6HA 3VR4A 3NE5B 1F2LA 1YBYA 4X64Q 2VL6A 4DV2Q 5JAVA 4YWKA 4YY3Q 4DV4Q 3OTOQ 1C7YA 3SE0A 3QOJA 1JORA 3JAML 2N3SA 3VR3A 3PIPA 3KOJA 1KDBA 5KNDA 3IL8A 1NNXA 1AE2A 4JI3L 4DUYQ 3MEFA 4YHHQ 3KF8A 2PZWA 3FKIH 4DV0L 2HD3A 5NUCA 1EY8A 2A74C 5C0XJ 1A3UA 2NVYH 5GROA 2Q2TA 4B3TQ 3K0YA 4A3IG 1K9MC 3TQYA 1ONLA 3GP7A 2Z1CA 4JV5Q 4GN4B 1XMQL 1S40A 4H7BA 1H9KA 1HPCA 1S5ED 3T1YQ 1ESRA 1UE6A 2ZM6Q 4FDBA 3Q23A 4N8X1 2E5LQ 4XDXA 4JI1Q 3T1HQ 1SMYC 3I72A 2E2DC 4KHPL 2YTXA 4UHVA 1QJOA 3GV6A 1G6ZA 3W5OA 4ABNA 1X6OA 1XTDA 4JI8Q 4KV6A 1E2ZA 1ICFB 2DJGC 2PYKA 4IFDG 1CQVA 3HOWG 3GTOH 3KFUA 4KJNA 1STNA 4WJ3M 1U4PA 2G9DA 3NHHA 4K5WA 3CW2C 5K36H 1CSPA 4IFDI 5GADC 3VYSA 3BDCA 1LM0A 2EOTA 5C3EG 2EIFA 1SNDA 4GKKQ 1MSGA 3NWTA 3H3VC 2PZTA 3RMHA 3TZDA 2RDGA 5EPJA 5HURA 5IGDA 3S1RH 1PH6A 1AFPA 2HHHQ 2WB1B 3S1RB 3HKSA 5BR8Q 3H3VI 3G7LA 2KCCA 4RA8A 3NQIA 4KKTA 1N33L 2JYOA 3HRZC 5K5PA 4DUYL 1P16A 2F4IA 1X3PA 2JXMB 2R93G 2HIVA 4QQBX 1YJNA 1SNPA 1AN8A 3GTPH 1EYDA 1WJJA 2EXDA 4QL5A 4UAIA 4NXNL 4UY8C 1B9NA 2NB0A 4LF4Q 4HCSA 3DLLA 1DOLA 5I2YA 3S9WA 1EL0A 3J80E 1HJPA 4C3HG 4AQYQ 3T1YL 2ZM6L 3HOYG 3DEOA 1B3AA 4POGA 1JQYD 2N49A 1TS2A 1BBWA 1R9TH 3L3OC 2K03A 1ESFA 3SK5A 3I91A 2RHSB 2V4DA 3HOZB 5ELNA 4NKLA 4TKOB 2PW5A 5DLQE 1YNJD 1VQBA 4NXML 4UDUC 4B3SL 1DOKA 3K5OA 3M4OH 3NTKA 4L6TB 1AZPA 5FK9C 2DJFC 1OO9B 4DV6L 5M3MH 4XXEA 2BH2A 5TSSA 4N8FA 2E2IB 3D0FA 2MGSA 4HSPA 4LK1C 1EYAA 3KLSA 5IIFA 1Q8KA 1DZ1A 1B2TA 3PCOB 4B3RL 1S3OA 4IUTA 3K58A 1F9QA 3STBD 3KF6A 1SFOH 1IW7C 2IWHA 5IGCA 2JA8B 2DN8A 4L5RC 3RLFA 2Z6KA 3MFGA 1I3QH 2OCEA 2EDGA 2R61A 2RHQB 4H02A 3S16H 1I3QB 3D4DA 2CWPA 4TQUS 4PZ8A 3S16B 3FPUB 4C56C 1BO0A 3BZKA 3QB3A 1HZCA 1VQGA 2ID0A 5ELEA 1G2TA 1BOSA 4CGYB 4X3KA 2H4OA 2QDLA 2KJXA 1TWAH 5ISRA 1MJEA 1ENCA 4MN3A 1EQTA 4XT3B 5BN5A 3CPFA 2RKSA 3I4NG 4OL7A 1TWAB 5IYBH 3PF4A 4C3IG 4K8JA 3NBHA 1HQRD 1XNRL 3GTMH 5C4XG 4JBMA 1LTAD 4RFBA 3DEPA 3SDZA 4GOPB 1W3SA 4KTAA 1UNSA 1CKNB 3JC66 3EROA 4LF5L 1FNVA 2IT1A 2I5HA 1PFMA 1V8QA 5AFWA 3OPOA 5IGGA 4DFAA 5T1GA 4BY1B 4PZ6A 3CMEA 1A6XA 1MSHA 2R92G 3TP8A 2JA6H 2K50A 3S17H 4RMFA 2JEBI 2B2VC 4DAPA 1Y8OB 2JA6B 3CCLA 2RSNA 4BXXH 4FXGC 2BH8A 5JPMC 4EQNA 4DAVA 1GM5A 1KIXA 2HT1A 1N8RC 4FO2A 2UU9L 2EY2A 2I5LX 1IHZA 5L37A 4A3KG 1LTLA 2EY1A 2QILA 1JB3A 4XYOA 5KEEA 4FF1A 2VUMG 4C2MH 4LWCA 1ZXTA 4LUZA 2VXWA 1HA6A 3BYTB 1ASZA 4C2MB 2QA4A 3PUWA 5IOCA 5I9OA 2EPBA 2QKIC 4CBVA 1I50H 2N78A 2XIWA 1JMCA 1SAPA 4UP8A 4A3EB 1HNXQ 1HNWL 1FR3A 2SNSA 5LL6X 2FMCA 5EGTA 3H0GB 5AJ3Q 3UE0A 2BCOA 1IKMA 1WD1A 1IYUA 4QUCA 2NN6I 2AQ1B 1DGSA 4ZYSA 4KN7C 1B4OA 4A3DG 4LF8Q 4RGTA 1AH9A 3DM1A 4DR6Q 4DR3L 4KKSA 3DMUA 2JE6I 4DK3C 4HCEA 4NW2A 4JBJA 4QY7A 5C44H 3HFZB 4XQNA 4DAYA 4FP5D 1LT5D 5C44B 4N9PA 4DR2L 2EYOA 2NVXH 4JI0Q 1A2TA 4JI7Q 2NVXB 4HSVA 5CYUA 1FVIA 4HTHA 2A8VA 1IBML 1PXUA 4JW0A 3GD7A 1I5FA 1WYDA 4OO1G 4IFDJ 3QJYA 1Q3LA 4ZUIA 1VQ4A 3H91A 1I6VC 5JOBA 4A76A 1O7ZA 5FJ8G 4A3JG 4G4KA 2UUCQ 1PYWD 4J15A 1SYGA 4OO1I 5EBCA 3TS2A 1U4MA 4OIJA 1CHPD 4KN4C 4NMZA 2ZT9C 1EOVA 1K3RA 4ID6A 2B2WA 3O13A 1VQDA 3CF5A 4DR7L 4ZUJA 3TDQA 4P74A 3EBEA 1QNUA 2ICIA 3RD4A 4MNOA 4DV1Q 5F2DA 2CFMA 2ZXOA 4ALPA 5IODA 4XT1B 1I94L 1HNXL 3NTHA 3S1NH 4R8NA 3RZDH 3IAYA 1VQEA 2VQEQ 2FXQA 1SJED 3R8BA 2ZTDA 3S1NB 3RZDB 1A15A 2CH4A 1TQOA 1ML0D 3S1MB 1D2BA 1IBLL 1HQMC 2F0EA 1MIUA 3PQIA 2E2JH 1MHWC 2L55A 5CBEE 4LF8L 1Z7TA 4A93B 3NSWA 4R4OA 2E2JB 4LFBQ 1JJGA 3FRPB 2J4XA 2HQLA 4X66Q 5C0XI 3D6WA 2AMCB 1NMFA 3QR8A 4RGNA 3RZOH 1LTGD 2WB1G 3ICEA 4L5TA 3F2DA 1E1TA 4MIUA 4DGZA 2IL8A 3L9AX 1KRSA 5I9PA 4H44C 1X3FA 4BBSH 3GQBA 3PF5A 4HIKA 4BBSB 1M4VA 4ZRZA 5FLMG 2FINB 1WTOA 3H3VH 3S2DH 2VNUD 4F87A 3ER0A 3CCSA 3SHLA 3D4WA 4HAEA 4IJHA 2RBMA 3TS0A 1V1PB 1AE3A 3CCVA 3OWFA 3MWYW 4B9XA 4ZK9B 3G6EA 3CXCA 2PO4A 2HCIA 1XJVA 1SLJA 3M4PA 1VQ6A 3GTGH 2F1MA 2CW0C 3R3OA 1VQKA 1B53A 4IOCA 3HOZG 1CUKA 1I4QA 4XIGS 3MHBA 3HOXH 2XRQD 4BA1I 1KL9A 1DJRD 1DD2A 1PH2A 1OXVA 3R2IA 2SNMA 3HOXB 1CHQD 3PUVA 1D5MC 2SDFA 1H9SB 2B2UA 4H13C 4YCVA 1SROA 2K5WA 2ALYB 2X6GA 3TREA 1J5EL 1YIJA 1EFWA 1SR3A 5J1ZA 2VS1A 1J8IA 1WD0A 5DM63 1XX8A 1F9RA 3AU7A 5ELCA 1SYCA 3GTJH 4CHTB 1F2ZA 1TWCH 4LF7Q 1EZ6A 1TWCB 4P73A 2F0DA 2JA8G 4X66L 1KXLA 3K5NA 4EQOA 4DA2A 1GUGA 2YYZA 3KYHC 5FLXc 2A6HC 2L0CA 2EYLA 4ZAIA 3K8AA 3AEVA 2OT2A 5IGEA 2M00A 2NUCA 2MUYA 5HY6A 4JI5L 1G51A 1KQSA 4GN5A 4E6IA 1WCMG 3F8TA 3HS0C 5JEAG 1PZJD 3MVVA 3CC7A 1SMXA 4HIOA 4JPBW 2K4KA 4RG1A 2K28A 5M5XH 2Z6KC 3Q24A 1PH9A 2XWBB 3I73A 1B9MA 4V190 5M5XB 3HOVH 1G291 2EJGC 1PZID 4RGMA 1U5KA 4RCOA 3GTQH 4A3GH 4DR4Q 2K5NA 4DR1Q 4A3GB 5DAUA 4LNQA 3MXNB 4BA2I 3QO2A 1SE3A 3MC0B 2B2VA 1C8CA 1PFBA 5M5WB 2A68C 3J81i 2RCFA 2WFWA 1Q90A 4R9WA 1EQVA 1V1OA 5KNBA 1PRTC 4X3TA 1ZKOA 3PO2H 2OQKA 3CCUA 2A19A 3S2HB 3PO2B 1X56A 3N6RA 1IKLA 2MFIA 4BY1G 1BBXC 1SMYD 2XWJB 3HKZE 3X3MA 5CMDA 4KD3A 1IYVA 3G48A 1N32L 2VW9A 4HIDA 2F3IA 1EEID 3A55A 3R93A 4ZKBB 2XSCA 3FDTA 4AIMA 4HJ7A 4FXKC 4IPDA 1SEBD 1B7YB 3C1FA 4KY6A 3HKZB 1WTHA 2JJQA 4GS3A 5FKAC 1LTRD 2D0OA 3K5LA 2PMZE 4BBRH 3L2PA 3NK9A 1N36Q 1GUOA 1PRTF 2JN4A 5EPLA 1K8MA 2E74C 5LMNL 3I70A 3Q6SA 1EZ8A 1B8AA 5EPKA 1F9SA 4CJ2C 3AFPA 4KI0A 2XN9C 3KDFB 1K8AC 1JE5A 2PMZB 2Z9HA 3SGIA 3OMGA 2VB2X 4EVOA 1X9NA 4ME3A 5GAEC 2PW7A 4X62Q 1VQNA 2WV6D 3N52A 1VMCA 4LF6Q 2O4XA 4A3EG 1BF4A 1KABA 3ERSX 2F0GA 1HA5A 2HIXA 4A3BG 3H0GG 5E1FA 1EWHA 1VQMA 2MPMA 2ZTEA 4J1MA 1BUVT 3TEHB 4XQQA 4X65L 4CKCA 1CM9A 1MI2A 2LMCB 3PO3B 2WAQB 2IX0A 2DY7A 3M7GA 1KC8C 5M3FG 2NN6H 2OTLA 1N34L 1Y1VB 2Y0SE 5DNFA 3NXWA 1X54A 3S15H 3HOUH 2MO1A 3I90A 4JOIA 3S15B 1FJGL 2B8FA 3HOUB 5IYDG 3GO5A 1EYGA 1PMRA 3PIOA 5IT9L 2UXBL 5D3IB 3E9IA 2OQ0A 2Y0SB 4YCWA 2F0TA 4F7XA 3VYRA 5M9OA 3CCRA 4JI4Q 2L12A 1SE8A 1TVXA 5FLXL 2Z8LA 3BDOA 2F0FA 1X65A 4LMQD 2MP1A 1D6EC 3BVMA 3I4MH 2PI2A 3FKIB 3RN5A 4YWMA 2ATWA 5C4HA 2NVYB 3L7ZC 1XPRA 1GVPA 3URYA 3G71A 5A2QE 1YZ6A 1QWYA 3SR1A 1UE5A 1LTID 4BS9A 1KNEA 1E1OA 3V96A 3MEHA 3LWUA 4YCUA 3BVZA 5FO8B 3K80C 1DYQA 2ASBA 1AW7A 1IW7D 5CV6A 1F77A 4JI6L 2F4VL 3AYHB 3L0OA 2N55A 3I55A 1CZWA 4C3JH 4DXFA 1HTPA 4C3JB 4G7OC 1WTWA 4X3UA 1NSNS 1RIPA 4A3MH 3A8KE 1Y1WH 4MTKA 2UUAL 4BY7G 2B2WC 1VQIA 4A3MB 1Y1WB 1OXXK 1A8VA 3FHWA 1EY6A 5IYCH 2E2HH 3KF8B 5M5YH 5IWAL 3GTOB 1U0LA 4A93G 4JYAQ 2XRSD 1YHBA 1X55A 4DV5Q 3EVQA 3RLNA 1LTSD 4Q5VA 2F0IA 2JQOA 2A73B 2I07B 2K05A 2RDHA 3K81C 3D3RA 3CCMA 5FO9B 4X64L 1A2UA 4DV2L 1GHJA 1WFQA 4DV4L 4YY3L 1LTBD 3OTOL 4M1UB 3DM3A 2NZ1D 1A3TA 5C0XH 1E0BA 1FYCA 3CD6A 1R4QB 4YIJA 3H94A 4QMGA 1BBUA 3U58A 1J6QA 1HZAA 4IURA 4APVA 1L0XB 3BU2A 4YHHL 1HHVA 4IOAA 1UE7A 3J81c 2A6EC 4K6DA 1II3A 4B3TL 2KQ3A 4PMCA 3CCEA 3GTPB 2R7FA 2QGQA 2ZJRA 3TRZA 4JV5L 3VR6A 4PNYA 1STGA 1EU4A 2GA4B 4U673 1K0SA 2NVQH 3VA5A 2NVQB 4B08A 4LF9Q 1PZKD 3ONAB 4JI1L 2E5LL 4PV1C 3T1HL 4DUZQ 1R9TB 2KCNA 1JOOA 5IGBA 2RCNA 2BA0A 2C5CA 1F2YA 3F2UA 2MO0A 5JEAJ 1GOZA 1D8LA 2QEJC 3LNNA 2QF7A 4QIWE 3HOXG 4A3LH 1PYSB 4JI8L 3M4OB 5EJWA 1JJCB 4RKBA 4GN3B 2EVBA 4O42A 5M3MB 2CCZA 3S24A 4QIWB 1HR0W 5IT9E 4N9TA 1B3QA 5CV8A 3KBXA 2PQAA 1ZEQX 3T53B 5IP9G 3JAME 3RN2A 3VR2A 4NP5A 2D0PA 2F0LA 3CCJA 1ASYA 4GKKL 3HEJA 3A0JA 1SSOA 2B63H 4WFN3 1NR4A 1STAA 1SFOB 2B2UC 4A3FG 1YNXA 2HHHL 2YTVA 1PTOC 3EQLC 5BR8L 3DWPA 3T16A 3UDFA 1VQ8A 3RNUA 1IBKQ 2LSSA 1EY5A 1VQOA 2JA7H 1SBBB 4LF4L 1LT4D 2Q8IB 2JA7B 4JI2Q 1E2VA 1ET6A 1K0RA 2QEXA 4GLAC 2XVSA 5E3FA 4AQYL 4K2LA 1A0IA 4KHZA 3BZCA 3P20A 1JB7A 2KENA 2H1EA 3GTMB 1PTOF 5EKLA 3NTIA 2RA4A 2L4NA 4JBWA 3KF6B 4GNXA 4QB4A 3EJIA 2PNHA 1E24A 1K8OA 1ET9A 4EX5A 4A3CG 1FD7D 1E7ZA 1ICWA 2Q2UA 1TWGH 1W6JA 1TWGB 5IY0A 2G5DA 4DR5Q 5KIXA 3FPPA 4UP9A 3UE1A 4ILWA 5IP7H 1LV9A 1SNQA 2CVRA 2O5IC 3S17B 1PRTB 1DOMA 2EYHA 2K75A 1B50A 1EU3A 2F0UA 5GAGC 4R4CA 2K5DA 3J81L 3NBHB 2A1AA 1F2MA 2BDOA 5CV5A 4O0AA 4S3SA 4HJ9A 3J80i 1FGUA 2EXZA 1O7LA 3GTKH 5JJLA 5EKIA 2JEAI 3AB9A 4JK1C 4GKJQ 4F88A 2HDLA 3C3LA 5I4DA 2JA5H 3CCQA 2A69C 1XNQQ 4V0BA 3AMUA 3TP6A 3ZYYX 4AYBE 3W2DA 1BQQT 2L11A 2L9HA 1G2SA 1L1OA 1I50B 1G8ZD 2R7ZH 1MKHA 3G6JB 2NBFA 1BNZA 3DUZA 5C5LA 3MXPA 2F0NA 3T51B 1JT8A 2R7ZB 3EA6A 2A5HA 4MHEA 1O80A 2DNEA 4H0LC 4AYBB 4DV7Q 2EZVA 5LMUQ 3PO3G 2WAQG 3J7A5 3V05A 4LFCQ 1XPUA 2QDBA 1DXMA 1QVGA 3OW2A 1VQFA 1Y1VG 3C1EA 1Q86C 5JVH3 3E5SA 3ULLA 4CDEC 5DM73 4IJLA 4RCNA 5EAYA 1RKNA 2K5QA 3MAQA 1D7QA 2D62A 2CW0D 1XPOA 2F0HA 1M1KC 1HH2P 1EQQA 4EGVA 2VQFQ 3M3YH 4IZ8A 4JC0A 3M3YB 5JJKA 2D9UA 3DHQA 1CQFA 4NB3A 3CC2A 1PFSA 4JOIC 5CV7A 3CU7A 1AZQA 3FKIG 1Y14B 1WVLA 1MD2D 3IRBA 1K83H 2KHSA 1LLRD 2F0QA 4CKBA 1V1QA 1JOKA 2M9VA 5JJZA 2MQHA 2ICEC 2K04A 1C48A 2O2LD 4K6LA 2BE5C 2NVTH 1HR0Q 1QCBD 4A3IH 3P7JA 1S5CD 1I4HA 1KLUD 2F0OA 4DAYB 2NVTB 1KAAA 2A6HD 1EYCA 3DWAA 4K8IA 3ERQA 4I65A 1WTRA 5AJ3L 1EIFA 1LYLA 2H5XA 2AUKA 4K0KQ 3K0XA 1XTCD 3TBIB 2LFNA 4DV7L 2L15A 5EKKA 2C35B 1SDFA 1SE4A 2M2LA 4LFCL 3CMAA 5I6WA 4IUQA 1Q1EA 2Q2IA 4A75A 4DR6L 3PIP3 3U9SA 2YTYA 5K36G 4LW1A 3NBIA 3K7UC 4R4IA 3NWSA 1WTVA 1PH7A 4P2CB 4IFDH 4Y7NH 1VDZA 2LXJA 3HOWH 4OIKA 4JI0L 4JI7L 2PNRC 2A68D 1SNOA 3K5MA 1NUCA 4OWXB 3LWEA 1SN8A 3MXUA 2FHTA 1PRTD 3RZOB 2FJ2A 5C3EH 1O78A 1S72A 4IUPA 1KAWA 1OXTA 4QJFA 3GDEA 1Q8IA 3S2DB 2VB3X 2UUCL 3OOCA 2X69A 1WI5A 2BA1A 4LAAA 1BKBA 1VQCA 1H9JA 1RDPD 2NWGA 1VQ5A 2ENBA 3KJPA 1O7YA 4OX9Q 2WP8J 1A3VA 1H9SA 1UUPA 3U50C 2D5DA 2K01A 4YWLA 2R93H 1HZ9A 3TMEA 4IQZA 1K8GA 1SRUA 3NQTA 5E4XA 1PDQA 3GTGB 4DKAC 1CZGA 1J9OA 1QUQB 1NR2A 4DV1L 3A7AB 4IO9A 4C3HH 1RTNA 5C3XA 1G91A 3BDLA 4C3HB 2J0TD 3WOEA 2VQEL 3M7NA 3HOYH 4R1JA 1HFNA 4M8AA 1SE2A 3HOYB 3H15A 1NY4A 3J80c 3OIQA 3UDXA 3T4AC 4DAMA 5M3MG 4J8QA 1HXYD 3TSSA 1P8LA 4LFBL 1VQ7A 1EIYB 3DWQA 5LL6S 2UUBQ 2AHOB 3GTJB 2CQAA 1T5XD 4DU9A 2ZJPA 1HCZA 1TT2A 2B2TA 3U4VA 1K3BC 3M4QA 4L5SA 4DV3Q 4FF3A 3VDYA 3W1BA 2JK8A 1KDAA 2F0VA 1WTQA 2IY5B 1SXTA 3BVGA 1BR9A 1TKWB 1EEFD 3MXNA 1TS4A 2X6LA 1NCVA 1LABA 3KBGA 2OXPA 4RHSA 2OWOA 3QOLA 4B9WA 2TSSA
chains in the Genus database with same CATH topology
1XNQL 3BZKA 1E1OA 4YCUA 1HZCA 1VQGA 2ID0A 1Z9FA 3K80C 3J7ZC 2ASBA 4B3MQ 5IYBG 1OXUA 1OTCA 1TWAH 1MJEA 4JI6L 3I56A 3CPFA 3AYHB 2F4VL 3BJUA 3L0OA 3I4NG 3I55A 4C3JH 5IYBH 3I2ZA 3PF4A 4A3MG 1Y1WG 5IE8A 1V9PA 5LMUL 1XNRL 3F2CA 1Q82C 1IL2A 1E22A 3U4ZA 3GTMH 4JBMA 3I4NH 2AWOA 2UXDQ 5C4XG 1RIPA 4C3IH 4POFA 5IYCG 4A3MH 4GOPB 1W3SA 1Y1WH 2K5VA 1CKNB 3JC66 1PH4A 2UUAL 2NZHA 3KJOA 4HJ8A 4BY7G 1VQIA 5C4XH 1YEZA 1OXXK 4LF5L 1H95A 1A8VA 2IT1A 2I5HA 3FHWA 2Q2HA 4LUVA 5IYCH 2E2HH 3KF8B 5M5YH 5IWAL 4A93G 1U0LA 4Y52H 4JYAQ 3S1MH 4BY7H 1YHBA 4A4IA 1X55A 4DV5Q 3S14H 1YVCA 3RLNA 1GO3E 1VS0A 2JQOA 4AH6A 1J5EQ 4A93H 2JA6G 3K81C 2E8GA 4PZ6A 4GNXC 3CMEA 2IHEA 3CCMA 2VQFL 4X64L 5C0XG 4DV2L 4P71A 2R92G 3A5UA 1WFQA 4QGUA 4DV4L 4YY3L 2UUBL 1IXRA 3OTOL 2K50A 2ZJQA 3J81j 4LF7L 2JA6H 3S17H 1YHQA 4RMFA 1CKMA 2JEBI 3DM3A 5J3BA 3CCLA 2R92H 3CD6A 1W2BA 4BXXH 1QUQA 2B3GA 2BH8A 1BBUA 3I4OA 4IPHA 3U58A 1J6QA 2B29A 1HZAA 3PGZA 1GM5A 1KIXA 4APVA 2HT1A 3BU2A 4YHHL 4JI3Q 3Q8DA 4IOAA 1N8RC 1B70B 4KLKA 1UE7A 3W1GA 3J81c 1PH5A 2UU9L 1UEBA 2I5LX 4JI5Q 4B3TL 3CCEA 4DV0Q 2LXKA 4A3KG 2R7FA 2QGQA 1LTLA 1PYBA 2ZJRA 3CQZH 3TRZA 4JV5L 1NMGA 1YHAA 2KHJA 2VUMG 4C2MH 4LWCA 3UDGA 1HR0L 3OYYA 3K7AH 4LUZA 4A3KH 2NVQH 1XMOL 1XMQQ 1ASZA 3CPWA 1A63A 4GLXA 2QA4A 3PUWA 2R7ZG 4LF9Q 4R4TA 2VUMH 1EQRA 3D31A 2E5LL 4JI1L 1Q81C 1I50H 2N78A 3EIVA 4MTNA 1JMCA 3T1HL 4UP8A 1HNWL 1Q46A 1HNXQ 4DUZQ 4DR4L 4DR1L 5JJIA 5E7NA 2RCNA 2XGTA 2BA0A 4A3LG 5AJ3Q 4K0KL 4KHPQ 3UE0A 3PO3G 2MO0A 5JEAJ 3AFQA 2XTIA 4IPGA 4WJ4A 4QIWE 1D8LA 3HOXG 2NN6I 4A3LH 3CC4A 1PYSB 1DGSA 4JI8L 1L1OC 3M9BA 4A3DG 4LF8Q 1AH9A 1FL0A 1KRTA 1JJCB 5C44G 4GN3B 4DR6Q 3UDIA 4DR3L 5H1SE 2JE6I 1QZHA 4DK3C 2CCZA 4A3DH 1CSQA 3S24A 4QY7A 4JBJA 1PH8A 1HR0W 1YJ9A 4DNIA 5C4JH 1QVCA 5C44H 1A62A 3HFZB 1VQJA 2PQAA 2B63G 1TWHH 3WWVA 5IP9G 1N32Q 4DR2L 3RN2A 1T9HA 2D0PA 2V1CC 3PUXA 2NVXH 2VY3A 3CCJA 1ASYA 3F1ZA 4JI0Q 4JI7Q 4O2DA 3LGJA 4GKKL 3A0JA 2B63H 1EWIA 1FVIA 4OONA 5IP9H 3ZJYC 2A8VA 1IBML 3GD7A 4A3FG 1K73C 1I5FA 1WYDA 1YNXA 1N36L 4OO1G 2HHHL 4IFDJ 2YTVA 5BR8L 1VQ4A 3F2BA 5IT9c 4A76A 5FJ8G 4A3JG 4A3FH 3UDFA 3I7FA 5LMNQ 2JA7G 1VQ8A 2UUCQ 4J15A 3JAMc 3RNUA 1IBKQ 1N33Q 4UP7A 4OO1I 1RL2A 2LSSA 1TWFH 3CP0A 5FJ8H 4A3JH 3TS2A 3NEMA 1VQOA 4OX9L 1HNZQ 2JA7H 1E3PA 4LF4L 1VQ9A 4NXNQ 1EOVA 4JI2Q 4X62L 4GOPC 1K3RA 1K0RA 2QEXA 3CF5A 1VQDA 4GLAC 4LFAQ 1M90C 4DR7L 1KHIA 4LF6L 4P75A 4AQYL 1A0IA 1BVSA 4KHZA 3BZCA 1JB7A 4P74A 2KENA 3ULPA 3EBEA 2PI2E 2UXCQ 2EQSA 4MNOA 4DV1Q 1KD1C 2CFMA 4ALPA 4PZ7A 1HNXL 1I94L 4JBWA 3KF6B 4X65Q 4GNXA 3PUZA 1VQLA 3S1NH 3RZDH 1VQEA 2PNHA 2VQEQ 2FXQA 1E24A 1VQAA 2ZTDA 4EX5A 4A3CG 5M5WH 1X3GA 2YU9H 1E7ZA 2Q2UA 2KCMA 3KDFA 1N34Q 1TWGH 3AQQA 1IBLL 1MIUA 4LUOA 4NXMQ 1C0AA 4B3SQ 2K14A 5IP7G 2E2JH 4LF8L 4A3CH 5IY0A 4P72A 1L2FA 4DR5Q 4DV6Q 4XTCS 4R4OA 4HJAA 3S2HH 4LFBQ 1FJGQ 4BXXG 4UP9A 1UE1A 3UE1A 5IP7H 1L0WA 4JI4L 2UXBQ 3NELA 2YV5A 1JJGA 3M85A 2HQLA 4DV3L 4HIMA 4X66Q 5C0XI 1WOCA 2K75A 4B3RQ 1IYJB 2AMCB 5GAGC 4R4CA 1NMFA 2WB1E 4BBSG 2GN5A 4HJ5A 3NBHB 3RZOH 2WB1G 3ICEA 2A1AA 1VQPA 4L5TA 3F2DA 1E1TA 4OWTB 2IX1A 4O0AA 1V43A 4HJ9A 1KRSA 4BBSH 1X3FA 3EN2A 3J80i 1FGUA 2AWNA 2CKZB 4PMWA 2JA5G 3PF5A 3GTKH 4HIKA 5JJLA 1YJWA 1EUJA 3PUYA 2ES2A 3A74A 5FLMG 2MNAA 3H3VH 2R6GA 3S2DH 2JEAI 2VNUD 4GLVB 3ER0A 4GKJQ 4JG2A 2JA5H 2N8NA 3CCSA 5GAHC 3CCQA 1XNQQ 4IJHA 5FLMH 3TS0A 1C9OA 4AYBE 4B3ML 1PA6A 1HNZL 4AYBG 1AE3A 3CCVA 1NTGA 1L1OA 2R7ZH 1MKHA 3KLWA 1JT8A 4JI6Q 3GTLH 3G6EA 3CXCA 4LFAL 3FP9A 2F4VQ 2OTJA 1XJVA 1SLJA 3M4PA 4EQ5A 1VQ6A 3GTGH 2K5HA 2WAQE 1Z47A 3B6YA 2UXDL 4DV7Q 1VQKA 2VZAA 4DK6C 5LMUQ 1LUZA 2WAQG 1TXYA 4IOCA 1XNRQ 3HOZG 3RR5A 3J7A5 2UXCL 1CUKA 4LFCQ 2Z0SA 1XPUA 4XIGS 2NZOA 1QVGA 3HOXH 3OW2A 1PH1A 1VQFA 1Y1VG 3NENA 4BA1I 1KL9A 2GVAA 2UUAQ 1PH2A 1OXVA 1Q86C 1JJ2A 3HOZH 3PO3H 4LF5Q 3PUVA 4L5QA 3ULLA 1QZGA 4JYAL 1O7IA 3S1QH 1Y1VH 4DV5L 5IWAQ 4YCVA 1SROA 4IJLA 2IHFA 5EAYA 2ALYB 3TREA 1J5EL 1YIJA 1D7QA 2D62A 1SR3A 1EFWA 2VS1A 2RF4A 1XPOA 4JBKA 1YITA 1M1KC 1HH2P 2JA9A 1EQQA 2VQFQ 1YBYA 3M3YH 4X64Q 2E2IH 3GTJH 4DV2Q 1TWCH 4YWKA 4YY3Q 4JC0A 3OTOQ 4DV4Q 4LF7Q 5HGQA 1C7YA 5JJKA 1QVFA 1UWVA 4NB3A 4P73A 3CC2A 2JA8G 1PFSA 4X66L 2N3SA 1KXLA 4JOIC 3PIPA 2KHIA 1HZBA 2YYZA 4GOPA 3KYHC 1CKNA 3FKIG 3KOJA 5FLXc 1Y14B 4DUYQ 1AE2A 3K8AA 4JI3L 3IRBA 1K83H 2JA8H 3AEVA 1G6PA 1NE3A 3MEFA 4YHHQ 4JI5L 5HY6A 1V1QA 3FKIH 4IPCA 1G51A 1KQSA 4DV0L 4NPSA 2UU9Q 3E0EA 1PHJA 5C0XJ 5GROA 2NVYH 2Q2TA 4GN5A 4B3TQ 4A3IG 1WCMG 3F8TA 5JEAG 1K9MC 3TQYA 3CC7A 1SMXA 4HIOA 2MQHA 4JV5Q 4GN4B 1XMQL 1S40A 2K4KA 4R4QA 2NVTH 4RG1A 1GD7A 1HR0Q 3HOVG 4A3IH 1WCMH 2K52A 4A3GG 4LF9L 5M5XH 2PQAB 4DAYB 3T1YQ 2Z6KC 1UE6A 2GVBA 2ZM6Q 1PH9A 4FDBA 1GKHA 4TVAB 4X6AH 4DUZL 1G291 4JI1Q 2E5LQ 3HOVH 4A3GH 1U5KA 3GTQH 3T1HQ 1HNWQ 1X3EA 3RLOA 4DR4Q 2K5NA 1EIFA 5AJ3L 4DR1Q 1LYLA 2H5XA 4KHPL 2YTXA 1NBWA 3K0XA 3PSIA 4LNQA 4K0KQ 3MXNB 4BA2I 3PO2G 3J81i 4DV7L 2WFWA 4PG3A 1PV4A 2L15A 2C35B 2AKWB 1X6OA 1XTDA 4LFCL 3W5OA 4JI8Q 3CMAA 1Q1EA 2KCTA 2Q2IA 4A75A 4DR6L 3PO2H 2OQKA 4IFDG 2YTYA 5K36G 4LW1A 3CCUA 2A19A 3K7UC 1X56A 4DR3Q 3GTOH 2MFIA 3HOWG 4BY1G 3KFUA 4R4IA 4WJ3M 1PH3A 1PH7A 3HKZE 3CW2C 3G48A 1CSPA 3HKZG 4Y7NH 1N32L 2LXJA 3HOWH 4IFDI 2VW9A 4HIDA 5GADC 4BY1H 4JI0L 4JI7L 2F3IA 1LM0A 4DR2Q 5C3EG 2EIFA 1Q1BA 2R7DA 5ELOA 4OWXB 4AIMA 4GKKQ 4HJ7A 4BBRG 1SN8A 4OXPA 4IPDA 1B7YB 4OWWB 2JJQA 2I5MX 4GS3A 5C3EH 1IBMQ 2D0OA 3S1RH 1S72A 2PMZE 4BBRH 3L2PA 1PH6A 1N36Q 2HHHQ 1KAWA 1OXTA 4QJFA 3GDEA 4GNXB 3A5ZB 3HKSA 5BR8Q 3G4SA 5LMNL 3H3VI 2UUCL 1WI5A 2BA1A 1B8AA 1IBKL 1N33L 3PV0A 3AFPA 4KI0A 4DUYL 1P16A 1BKBA 1VQCA 1N9WA 1VQ5A 3KDFB 1K8AC 1JE5A 2R93G 2HIVA 1IZ6A 3KJPA 1YJNA 4QQBX 1NJIC 3SGIA 3GTPH 1WJJA 2EXDA 4QL5A 3CAMA 4NXNL 2WP8J 4JI2L 1X9NA 4OX9Q 4UY8C 1OXSC 4LF4Q 3U50C 4ME3A 2KBNA 3DLLA 4YWLA 5GAEC 2R93H 4X62Q 1HZ9A 1VQNA 2DUDA 1K8GA 1HJPA 1SRUA 4UPAA 4JCVE 4LF6Q 4DR7Q 4A3EG 3ERSX 4AQYQ 1YI2A 4DKAC 2HIXA 3T1YL 1QUQB 3H0GG 4A3BG 2ZM6L 3HOYG 4DV1L 1VQMA 4POGA 2F52A 4IO9A 2N49A 2ZTEA 4C3HH 4A3EH 1Q7YC 1BBWA 3TEHB 1R9TH 4X65L 2NN6G 4A3BH 2RHSB 3H0GH 1I94Q 2ZTCA 3ULJA 2VQEL 5LMNW 3HOYH 3M7NA 4R1JA 5ELNA 1VCIA 2IX0A 3JAMi 3HOUG 5DLQE 4DPGA 1KC8C 5M3FG 3H15A 1NY4A 1VQBA 3J80c 2OTLA 3UDXA 4DAMA 2Y0SE 5M3MG 1N34L 4NXML 2DGYA 4B3SL 2Y0SG 1X54A 1IBLQ 3STBC 3S15H 3M4OH 3HOUH 1PVOA 1MJCA 2MO1A 5M3FH 4DR5L 4DV6L 2CQOA 4JOIA 2CWAA 1P8LA 5M3MH 4LFBL 1FJGL 1VQ7A 5IYDG 3GO5A 1Q12A 1EIYB 1EYGA 3PIOA 2BH2A 2UUBQ 2UXBL 3D0FA 3E9IA 2AHOB 2OQ0A 2I0QA 4YCWA 3CCRA 4JI4Q 1Q8KA 1SE8A 2ZJPA 1L1OB 3U4VA 5IYDH 3PCOB 4B3RL 3M4QA 4L5SA 4DV3Q 1S3OA 3I4MG 1X65A 1CKOA 3VDYA 3W1BA 2JK8A 3KF6A 3STBD 1SFOH 3I4MH 4L5RC 2IY5B 3RLFA 2Z6KA 2PI2A 1VQHA 3RN5A 1I3QH 2OCEA 1I6HH 4YWMA 2ATWA 2RHQB 3L7ZC 4H02A 3E9HA 5GQOA 3S16H 1XPRA 4GKJL 1GVPA 3G71A 2CWPA 4MZ9A 1YZ6A 4TQUS 4PZ8A 2OWOA 2VL6A 1UE5A 1XMOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ L;  3BZK A;  1E1O A;  4YCU A;  1HZC A;  1VQG A;  2ID0 A;  1Z9F A;  3K80 C;  3J7Z C;  2ASB A;  4B3M Q;  5IYB G;  1OXU A;  1OTC A;  1TWA H;  1MJE A;  4JI6 L;  3I56 A;  3CPF A;  3AYH B;  2F4V L;  3BJU A;  3L0O A;  3I4N G;  3I55 A;  4C3J H;  5IYB H;  3I2Z A;  3PF4 A;  4A3M G;  1Y1W G;  5IE8 A;  1V9P A;  5LMU L;  1XNR L;  3F2C A;  1Q82 C;  1IL2 A;  1E22 A;  3U4Z A;  3GTM H;  4JBM A;  3I4N H;  2AWO A;  2UXD Q;  5C4X G;  1RIP A;  4C3I H;  4POF A;  5IYC G;  4A3M H;  4GOP B;  1W3S A;  1Y1W H;  2K5V A;  1CKN B;  3JC6 6;  1PH4 A;  2UUA L;  2NZH A;  3KJO A;  4HJ8 A;  4BY7 G;  1VQI A;  5C4X H;  1YEZ A;  1OXX K;  4LF5 L;  1H95 A;  1A8V A;  2IT1 A;  2I5H A;  3FHW A;  2Q2H A;  4LUV A;  5IYC H;  2E2H H;  3KF8 B;  5M5Y H;  5IWA L;  4A93 G;  1U0L A;  4Y52 H;  4JYA Q;  3S1M H;  4BY7 H;  1YHB A;  4A4I A;  1X55 A;  4DV5 Q;  3S14 H;  1YVC A;  3RLN A;  1GO3 E;  1VS0 A;  2JQO A;  4AH6 A;  1J5E Q;  4A93 H;  2JA6 G;  3K81 C;  2E8G A;  4PZ6 A;  4GNX C;  3CME A;  2IHE A;  3CCM A;  2VQF L;  4X64 L;  5C0X G;  4DV2 L;  4P71 A;  2R92 G;  3A5U A;  1WFQ A;  4QGU A;  4DV4 L;  4YY3 L;  2UUB L;  1IXR A;  3OTO L;  2K50 A;  2ZJQ A;  3J81 j;  4LF7 L;  2JA6 H;  3S17 H;  1YHQ A;  4RMF A;  1CKM A;  2JEB I;  3DM3 A;  5J3B A;  3CCL A;  2R92 H;  3CD6 A;  1W2B A;  4BXX H;  1QUQ A;  2B3G A;  2BH8 A;  1BBU A;  3I4O A;  4IPH A;  3U58 A;  1J6Q A;  2B29 A;  1HZA A;  3PGZ A;  1GM5 A;  1KIX A;  4APV A;  2HT1 A;  3BU2 A;  4YHH L;  4JI3 Q;  3Q8D A;  4IOA A;  1N8R C;  1B70 B;  4KLK A;  1UE7 A;  3W1G A;  3J81 c;  1PH5 A;  2UU9 L;  1UEB A;  2I5L X;  4JI5 Q;  4B3T L;  3CCE A;  4DV0 Q;  2LXK A;  4A3K G;  2R7F A;  2QGQ A;  1LTL A;  1PYB A;  2ZJR A;  3CQZ H;  3TRZ A;  4JV5 L;  1NMG A;  1YHA A;  2KHJ A;  2VUM G;  4C2M H;  4LWC A;  3UDG A;  1HR0 L;  3OYY A;  3K7A H;  4LUZ A;  4A3K H;  2NVQ H;  1XMO L;  1XMQ Q;  1ASZ A;  3CPW A;  1A63 A;  4GLX A;  2QA4 A;  3PUW A;  2R7Z G;  4LF9 Q;  4R4T A;  2VUM H;  1EQR A;  3D31 A;  2E5L L;  4JI1 L;  1Q81 C;  1I50 H;  2N78 A;  3EIV A;  4MTN A;  1JMC A;  3T1H L;  4UP8 A;  1HNW L;  1Q46 A;  1HNX Q;  4DUZ Q;  4DR4 L;  4DR1 L;  5JJI A;  5E7N A;  2RCN A;  2XGT A;  2BA0 A;  4A3L G;  5AJ3 Q;  4K0K L;  4KHP Q;  3UE0 A;  3PO3 G;  2MO0 A;  5JEA J;  3AFQ A;  2XTI A;  4IPG A;  4WJ4 A;  4QIW E;  1D8L A;  3HOX G;  2NN6 I;  4A3L H;  3CC4 A;  1PYS B;  1DGS A;  4JI8 L;  1L1O C;  3M9B A;  4A3D G;  4LF8 Q;  1AH9 A;  1FL0 A;  1KRT A;  1JJC B;  5C44 G;  4GN3 B;  4DR6 Q;  3UDI A;  4DR3 L;  5H1S E;  2JE6 I;  1QZH A;  4DK3 C;  2CCZ A;  4A3D H;  1CSQ A;  3S24 A;  4QY7 A;  4JBJ A;  1PH8 A;  1HR0 W;  1YJ9 A;  4DNI A;  5C4J H;  1QVC A;  5C44 H;  1A62 A;  3HFZ B;  1VQJ A;  2PQA A;  2B63 G;  1TWH H;  3WWV A;  5IP9 G;  1N32 Q;  4DR2 L;  3RN2 A;  1T9H A;  2D0P A;  2V1C C;  3PUX A;  2NVX H;  2VY3 A;  3CCJ A;  1ASY A;  3F1Z A;  4JI0 Q;  4JI7 Q;  4O2D A;  3LGJ A;  4GKK L;  3A0J A;  2B63 H;  1EWI A;  1FVI A;  4OON A;  5IP9 H;  3ZJY C;  2A8V A;  1IBM L;  3GD7 A;  4A3F G;  1K73 C;  1I5F A;  1WYD A;  1YNX A;  1N36 L;  4OO1 G;  2HHH L;  4IFD J;  2YTV A;  5BR8 L;  1VQ4 A;  3F2B A;  5IT9 c;  4A76 A;  5FJ8 G;  4A3J G;  4A3F H;  3UDF A;  3I7F A;  5LMN Q;  2JA7 G;  1VQ8 A;  2UUC Q;  4J15 A;  3JAM c;  3RNU A;  1IBK Q;  1N33 Q;  4UP7 A;  4OO1 I;  1RL2 A;  2LSS A;  1TWF H;  3CP0 A;  5FJ8 H;  4A3J H;  3TS2 A;  3NEM A;  1VQO A;  4OX9 L;  1HNZ Q;  2JA7 H;  1E3P A;  4LF4 L;  1VQ9 A;  4NXN Q;  1EOV A;  4JI2 Q;  4X62 L;  4GOP C;  1K3R A;  1K0R A;  2QEX A;  3CF5 A;  1VQD A;  4GLA C;  4LFA Q;  1M90 C;  4DR7 L;  1KHI A;  4LF6 L;  4P75 A;  4AQY L;  1A0I A;  1BVS A;  4KHZ A;  3BZC A;  1JB7 A;  4P74 A;  2KEN A;  3ULP A;  3EBE A;  2PI2 E;  2UXC Q;  2EQS A;  4MNO A;  4DV1 Q;  1KD1 C;  2CFM A;  4ALP A;  4PZ7 A;  1HNX L;  1I94 L;  4JBW A;  3KF6 B;  4X65 Q;  4GNX A;  3PUZ A;  1VQL A;  3S1N H;  3RZD H;  1VQE A;  2PNH A;  2VQE Q;  2FXQ A;  1E24 A;  1VQA A;  2ZTD A;  4EX5 A;  4A3C G;  5M5W H;  1X3G A;  2YU9 H;  1E7Z A;  2Q2U A;  2KCM A;  3KDF A;  1N34 Q;  1TWG H;  3AQQ A;  1IBL L;  1MIU A;  4LUO A;  4NXM Q;  1C0A A;  4B3S Q;  2K14 A;  5IP7 G;  2E2J H;  4LF8 L;  4A3C H;  5IY0 A;  4P72 A;  1L2F A;  4DR5 Q;  4DV6 Q;  4XTC S;  4R4O A;  4HJA A;  3S2H H;  4LFB Q;  1FJG Q;  4BXX G;  4UP9 A;  1UE1 A;  3UE1 A;  5IP7 H;  1L0W A;  4JI4 L;  2UXB Q;  3NEL A;  2YV5 A;  1JJG A;  3M85 A;  2HQL A;  4DV3 L;  4HIM A;  4X66 Q;  5C0X I;  1WOC A;  2K75 A;  4B3R Q;  1IYJ B;  2AMC B;  5GAG C;  4R4C A;  1NMF A;  2WB1 E;  4BBS G;  2GN5 A;  4HJ5 A;  3NBH B;  3RZO H;  2WB1 G;  3ICE A;  2A1A A;  1VQP A;  4L5T A;  3F2D A;  1E1T A;  4OWT B;  2IX1 A;  4O0A A;  1V43 A;  4HJ9 A;  1KRS A;  4BBS H;  1X3F A;  3EN2 A;  3J80 i;  1FGU A;  2AWN A;  2CKZ B;  4PMW A;  2JA5 G;  3PF5 A;  3GTK H;  4HIK A;  5JJL A;  1YJW A;  1EUJ A;  3PUY A;  2ES2 A;  3A74 A;  5FLM G;  2MNA A;  3H3V H;  2R6G A;  3S2D H;  2JEA I;  2VNU D;  4GLV B;  3ER0 A;  4GKJ Q;  4JG2 A;  2JA5 H;  2N8N A;  3CCS A;  5GAH C;  3CCQ A;  1XNQ Q;  4IJH A;  5FLM H;  3TS0 A;  1C9O A;  4AYB E;  4B3M L;  1PA6 A;  1HNZ L;  4AYB G;  1AE3 A;  3CCV A;  1NTG A;  1L1O A;  2R7Z H;  1MKH A;  3KLW A;  1JT8 A;  4JI6 Q;  3GTL H;  3G6E A;  3CXC A;  4LFA L;  3FP9 A;  2F4V Q;  2OTJ A;  1XJV A;  1SLJ A;  3M4P A;  4EQ5 A;  1VQ6 A;  3GTG H;  2K5H A;  2WAQ E;  1Z47 A;  3B6Y A;  2UXD L;  4DV7 Q;  1VQK A;  2VZA A;  4DK6 C;  5LMU Q;  1LUZ A;  2WAQ G;  1TXY A;  4IOC A;  1XNR Q;  3HOZ G;  3RR5 A;  3J7A 5;  2UXC L;  1CUK A;  4LFC Q;  2Z0S A;  1XPU A;  4XIG S;  2NZO A;  1QVG A;  3HOX H;  3OW2 A;  1PH1 A;  1VQF A;  1Y1V G;  3NEN A;  4BA1 I;  1KL9 A;  2GVA A;  2UUA Q;  1PH2 A;  1OXV A;  1Q86 C;  1JJ2 A;  3HOZ H;  3PO3 H;  4LF5 Q;  3PUV A;  4L5Q A;  3ULL A;  1QZG A;  4JYA L;  1O7I A;  3S1Q H;  1Y1V H;  4DV5 L;  5IWA Q;  4YCV A;  1SRO A;  4IJL A;  2IHF A;  5EAY A;  2ALY B;  3TRE A;  1J5E L;  1YIJ A;  1D7Q A;  2D62 A;  1SR3 A;  1EFW A;  2VS1 A;  2RF4 A;  1XPO A;  4JBK A;  1YIT A;  1M1K C;  1HH2 P;  2JA9 A;  1EQQ A;  2VQF Q;  1YBY A;  3M3Y H;  4X64 Q;  2E2I H;  3GTJ H;  4DV2 Q;  1TWC H;  4YWK A;  4YY3 Q;  4JC0 A;  3OTO Q;  4DV4 Q;  4LF7 Q;  5HGQ A;  1C7Y A;  5JJK A;  1QVF A;  1UWV A;  4NB3 A;  4P73 A;  3CC2 A;  2JA8 G;  1PFS A;  4X66 L;  2N3S A;  1KXL A;  4JOI C;  3PIP A;  2KHI A;  1HZB A;  2YYZ A;  4GOP A;  3KYH C;  1CKN A;  3FKI G;  3KOJ A;  5FLX c;  1Y14 B;  4DUY Q;  1AE2 A;  3K8A A;  4JI3 L;  3IRB A;  1K83 H;  2JA8 H;  3AEV A;  1G6P A;  1NE3 A;  3MEF A;  4YHH Q;  4JI5 L;  5HY6 A;  1V1Q A;  3FKI H;  4IPC A;  1G51 A;  1KQS A;  4DV0 L;  4NPS A;  2UU9 Q;  3E0E A;  1PHJ A;  5C0X J;  5GRO A;  2NVY H;  2Q2T A;  4GN5 A;  4B3T Q;  4A3I G;  1WCM G;  3F8T A;  5JEA G;  1K9M C;  3TQY A;  3CC7 A;  1SMX A;  4HIO A;  2MQH A;  4JV5 Q;  4GN4 B;  1XMQ L;  1S40 A;  2K4K A;  4R4Q A;  2NVT H;  4RG1 A;  1GD7 A;  1HR0 Q;  3HOV G;  4A3I H;  1WCM H;  2K52 A;  4A3G G;  4LF9 L;  5M5X H;  2PQA B;  4DAY B;  3T1Y Q;  2Z6K C;  1UE6 A;  2GVB A;  2ZM6 Q;  1PH9 A;  4FDB A;  1GKH A;  4TVA B;  4X6A H;  4DUZ L;  1G29 1;  4JI1 Q;  2E5L Q;  3HOV H;  4A3G H;  1U5K A;  3GTQ H;  3T1H Q;  1HNW Q;  1X3E A;  3RLO A;  4DR4 Q;  2K5N A;  1EIF A;  5AJ3 L;  4DR1 Q;  1LYL A;  2H5X A;  4KHP L;  2YTX A;  1NBW A;  3K0X A;  3PSI A;  4LNQ A;  4K0K Q;  3MXN B;  4BA2 I;  3PO2 G;  3J81 i;  4DV7 L;  2WFW A;  4PG3 A;  1PV4 A;  2L15 A;  2C35 B;  2AKW B;  1X6O A;  1XTD A;  4LFC L;  3W5O A;  4JI8 Q;  3CMA A;  1Q1E A;  2KCT A;  2Q2I A;  4A75 A;  4DR6 L;  3PO2 H;  2OQK A;  4IFD G;  2YTY A;  5K36 G;  4LW1 A;  3CCU A;  2A19 A;  3K7U C;  1X56 A;  4DR3 Q;  3GTO H;  2MFI A;  3HOW G;  4BY1 G;  3KFU A;  4R4I A;  4WJ3 M;  1PH3 A;  1PH7 A;  3HKZ E;  3CW2 C;  3G48 A;  1CSP A;  3HKZ G;  4Y7N H;  1N32 L;  2LXJ A;  3HOW H;  4IFD I;  2VW9 A;  4HID A;  5GAD C;  4BY1 H;  4JI0 L;  4JI7 L;  2F3I A;  1LM0 A;  4DR2 Q;  5C3E G;  2EIF A;  1Q1B A;  2R7D A;  5ELO A;  4OWX B;  4AIM A;  4GKK Q;  4HJ7 A;  4BBR G;  1SN8 A;  4OXP A;  4IPD A;  1B7Y B;  4OWW B;  2JJQ A;  2I5M X;  4GS3 A;  5C3E H;  1IBM Q;  2D0O A;  3S1R H;  1S72 A;  2PMZ E;  4BBR H;  3L2P A;  1PH6 A;  1N36 Q;  2HHH Q;  1KAW A;  1OXT A;  4QJF A;  3GDE A;  4GNX B;  3A5Z B;  3HKS A;  5BR8 Q;  3G4S A;  5LMN L;  3H3V I;  2UUC L;  1WI5 A;  2BA1 A;  1B8A A;  1IBK L;  1N33 L;  3PV0 A;  3AFP A;  4KI0 A;  4DUY L;  1P16 A;  1BKB A;  1VQC A;  1N9W A;  1VQ5 A;  3KDF B;  1K8A C;  1JE5 A;  2R93 G;  2HIV A;  1IZ6 A;  3KJP A;  1YJN A;  4QQB X;  1NJI C;  3SGI A;  3GTP H;  1WJJ A;  2EXD A;  4QL5 A;  3CAM A;  4NXN L;  2WP8 J;  4JI2 L;  1X9N A;  4OX9 Q;  4UY8 C;  1OXS C;  4LF4 Q;  3U50 C;  4ME3 A;  2KBN A;  3DLL A;  4YWL A;  5GAE C;  2R93 H;  4X62 Q;  1HZ9 A;  1VQN A;  2DUD A;  1K8G A;  1HJP A;  1SRU A;  4UPA A;  4JCV E;  4LF6 Q;  4DR7 Q;  4A3E G;  3ERS X;  4AQY Q;  1YI2 A;  4DKA C;  2HIX A;  3T1Y L;  1QUQ B;  3H0G G;  4A3B G;  2ZM6 L;  3HOY G;  4DV1 L;  1VQM A;  4POG A;  2F52 A;  4IO9 A;  2N49 A;  2ZTE A;  4C3H H;  4A3E H;  1Q7Y C;  1BBW A;  3TEH B;  1R9T H;  4X65 L;  2NN6 G;  4A3B H;  2RHS B;  3H0G H;  1I94 Q;  2ZTC A;  3ULJ A;  2VQE L;  5LMN W;  3HOY H;  3M7N A;  4R1J A;  5ELN A;  1VCI A;  2IX0 A;  3JAM i;  3HOU G;  5DLQ E;  4DPG A;  1KC8 C;  5M3F G;  3H15 A;  1NY4 A;  1VQB A;  3J80 c;  2OTL A;  3UDX A;  4DAM A;  2Y0S E;  5M3M G;  1N34 L;  4NXM L;  2DGY A;  4B3S L;  2Y0S G;  1X54 A;  1IBL Q;  3STB C;  3S15 H;  3M4O H;  3HOU H;  1PVO A;  1MJC A;  2MO1 A;  5M3F H;  4DR5 L;  4DV6 L;  2CQO A;  4JOI A;  2CWA A;  1P8L A;  5M3M H;  4LFB L;  1FJG L;  1VQ7 A;  5IYD G;  3GO5 A;  1Q12 A;  1EIY B;  1EYG A;  3PIO A;  2BH2 A;  2UUB Q;  2UXB L;  3D0F A;  3E9I A;  2AHO B;  2OQ0 A;  2I0Q A;  4YCW A;  3CCR A;  4JI4 Q;  1Q8K A;  1SE8 A;  2ZJP A;  1L1O B;  3U4V A;  5IYD H;  3PCO B;  4B3R L;  3M4Q A;  4L5S A;  4DV3 Q;  1S3O A;  3I4M G;  1X65 A;  1CKO A;  3VDY A;  3W1B A;  2JK8 A;  3KF6 A;  3STB D;  1SFO H;  3I4M H;  4L5R C;  2IY5 B;  3RLF A;  2Z6K A;  2PI2 A;  1VQH A;  3RN5 A;  1I3Q H;  2OCE A;  1I6H H;  4YWM A;  2ATW A;  2RHQ B;  3L7Z C;  4H02 A;  3E9H A;  5GQO A;  3S16 H;  1XPR A;  4GKJ L;  1GVP A;  3G71 A;  2CWP A;  4MZ9 A;  1YZ6 A;  4TQU S;  4PZ8 A;  2OWO A;  2VL6 A;  1UE5 A;  1XMO Q; 
#chains in the Genus database with same CATH topology
 4L63 B;  3OHX C;  1PTO H;  3DXJ C;  4Q0F A;  1RD9 D;  1Z9F A;  1PTO B;  5KYI A;  4B3M Q;  3SVM A;  5IYB G;  3D4R A;  3FVQ A;  1OTC A;  3HOV B;  3V2T A;  3I56 A;  3GTQ B;  2D2C C;  3BJU A;  3I2Z A;  2FMM A;  5CV4 A;  1JCK B;  1Q82 C;  1KNA A;  3U4Z A;  2IPK D;  1BCP C;  3I4N H;  2UXD Q;  1QG7 A;  3KUP A;  3MA2 B;  4C3I H;  3I4N B;  2F0S A;  2K5V A;  1PH4 A;  1S5B D;  2NZH A;  4C3I B;  3KJO A;  4DNR B;  5C4X H;  4LUV A;  1U4R A;  4Y52 H;  5D3D A;  1YVC A;  1SYF A;  3BS1 A;  1CFM A;  4PQX A;  1GO3 E;  1VS0 A;  1JWU D;  1TR5 A;  3OMC A;  2JA6 G;  3CRL C;  4GNX C;  2IX3 A;  2Z4I A;  4P71 A;  3A5U A;  4QGU A;  3SK4 A;  4BXX G;  4LF7 L;  2UUB L;  2ZJQ A;  4ODG A;  4RAU C;  3J81 j;  3CRK C;  1YHQ A;  1BCP F;  1CKM A;  3A7L A;  5J3B A;  5CC4 A;  2R92 H;  3T56 B;  4BBR B;  1W2B A;  4CDF C;  2R92 B;  3I4O A;  2F0J A;  4IPH A;  3PGZ A;  4JI3 Q;  3Q8D A;  3TN2 A;  1B70 B;  3SK8 A;  3W1G A;  2SEB D;  3QWN A;  1HUM A;  4DV0 Q;  2F3W A;  2HCC A;  3HZX A;  4DK1 A;  1YHA A;  5CBA E;  3UDG A;  2ZXR A;  4A3K H;  2DNC A;  1W6K A;  1ILQ A;  3U9O A;  1XMQ Q;  2HQE A;  1D5X C;  3CPW A;  1A63 A;  2JP1 A;  4GLX A;  2R7Z G;  3KLR A;  4R4T A;  4FNF A;  2VUM H;  1EQR A;  5G3L D;  1Q81 C;  3EIV A;  2A6E D;  1Q46 A;  4DR4 L;  2F03 A;  4DR1 L;  5JJI A;  2Q8T A;  5E7N A;  5C5M A;  3J80 L;  3Q0A A;  4KHP Q;  1TII D;  4K5V A;  2E75 C;  1I4X A;  2XTI A;  4IPG A;  2KED A;  4WJ4 A;  1FNU A;  2CH4 W;  1JOQ A;  3FMC A;  1L1O C;  1KLG D;  1IL8 A;  1FL0 A;  1WTX A;  5C44 G;  3OWE B;  3UDI A;  3CKI B;  3H09 A;  1QZH A;  4A3D H;  2QW7 A;  1PH8 A;  4KY5 A;  1YJ9 A;  2K1B A;  1QVC A;  4DK0 A;  1TWH H;  3PUX A;  1TWH B;  3F1Z A;  3LGJ A;  1SYE A;  4G57 A;  3I4M B;  2NTS A;  1N36 L;  3HGB A;  1TS5 A;  2EE1 A;  3F2B A;  2G9H D;  3I7F A;  4OO1 H;  1JE4 A;  5E4W C;  1N33 Q;  4UP7 A;  1WTP A;  1TWF H;  5FJ8 H;  4A3J H;  1HNZ Q;  1TWF B;  4A3J B;  4ZKC B;  1VQ9 A;  4NXN Q;  1RF2 D;  4X62 L;  1TS3 A;  3E3X A;  1M90 C;  2B39 A;  2RDF A;  1XWE A;  4LFA Q;  1PTO D;  2N88 A;  4LF6 L;  1BVS A;  3SEB A;  1ZYR C;  2PI2 E;  3MXG A;  2UXC Q;  3EFX D;  2EQS A;  5FOB B;  4K2K A;  1BDO A;  1TY0 A;  2KEC A;  1FNW A;  1VQA A;  2E2H B;  3PMF A;  5M5Y B;  1X3G A;  2YU9 H;  2OEO A;  2KCM A;  4NXM Q;  1C0A A;  2YU9 B;  4B3S Q;  3KK7 A;  4RWS C;  4P72 A;  1JC7 A;  4DV6 Q;  4HJA A;  3HP3 A;  3QIA A;  4CDC C;  1GUT A;  1L0W A;  4F8M A;  4JI4 L;  3NEL A;  1D1K A;  5T1I A;  4ME5 A;  3D6C A;  3K6O A;  4HIM A;  3WOF A;  2I46 A;  4B3R Q;  5HGT A;  1ILP A;  1IYJ B;  2FFK B;  2WB1 E;  4BBS G;  2GN5 A;  1ROD A;  4HJ5 A;  3TZU A;  1VQP A;  1EIH A;  4OWT B;  2IX1 A;  1V43 A;  3EN2 A;  4PMW A;  2AWN A;  2CKZ B;  2B2Y A;  1EUJ A;  3PUY A;  2ES2 A;  2MNA A;  2R6G A;  1TU2 B;  1SYD A;  1X32 A;  2EYF A;  2EYM A;  4JG2 A;  2N8N A;  3I4L A;  5GAH C;  1XXG A;  5FLM H;  1C9O A;  3VA7 A;  4RGO S;  1DCZ A;  4CKE A;  1HNZ L;  2PPB C;  4KJO A;  2B8G A;  1NTG A;  1UEA B;  2OF1 A;  4OEL B;  5EBD A;  5G3L F;  1CI3 M;  1FGB D;  4CJ1 B;  4LFA L;  3FP9 A;  2OTJ A;  1VMP A;  2ZXP A;  3K59 A;  4EQ5 A;  1YNN C;  2K5H A;  4HMI A;  3SK6 A;  2VZA A;  1XNR Q;  1LUZ A;  2UXC L;  2O5J C;  2Z0S A;  2A69 D;  2NZO A;  2AQ3 B;  3NEN A;  1JJ2 A;  3HOZ H;  4TSS A;  4LF5 Q;  4L5Q A;  4JYA L;  1O7I A;  3S1Q H;  5C4Z A;  4G7Z C;  4DV5 L;  3OW7 A;  4NDX A;  3S1Q B;  5FLX E;  2L5T A;  3H6M A;  1JWM D;  4JBK A;  1KDC A;  4IN3 A;  2P5Z X;  1YIT A;  2BOS A;  2JA9 A;  2TMP A;  1CA5 A;  2B63 B;  2E2I H;  2IJ0 A;  1RTO A;  5EQ0 A;  4K14 A;  5HGQ A;  1STH A;  1QVF A;  1LT6 D;  1UWV A;  1I4G A;  1KTK A;  1HRJ A;  2KHI A;  1CT1 D;  1HZB A;  4GOP A;  2LKV A;  1CKN A;  4IUN A;  4KMU C;  3TP7 A;  2JA8 H;  1G6P A;  1NE3 A;  3RUZ A;  5CGK A;  4IPC A;  2B2T C;  3A56 A;  2MJ8 A;  3W3A A;  3E0E A;  4NPS A;  1PHJ A;  2UU9 Q;  2KEE A;  1JIC A;  1E2W A;  4QF4 A;  2KVM A;  3D8G A;  2EYP A;  4R4Q A;  1GUS A;  2K32 A;  1GD7 A;  3HOV G;  1WCM H;  5JEA H;  2K52 A;  1RCV D;  4A3G G;  4LF9 L;  2PQA B;  3BG3 A;  2GVB A;  1WCM B;  1GKH A;  3K57 A;  4TVA B;  4X6A H;  4DXG A;  3BYY B;  4DUZ L;  1PVO A;  1HNW Q;  1X3E A;  1UAP A;  1CK1 A;  5CV9 A;  3RLO A;  1JR0 D;  5ELD A;  1NBW A;  3PSI A;  4KY7 A;  1F9P A;  1VF7 A;  4RHR A;  3PO2 G;  1EY9 A;  1VF5 C;  4PG3 A;  1PV4 A;  2BE5 D;  4GZY C;  2AKW B;  3R2T A;  3WDN A;  2KCT A;  3I8Z A;  1LTT D;  4DR3 Q;  3TP5 A;  1SJH D;  1Y8N B;  1PH3 A;  2NTT A;  1BCP B;  1R4P B;  4K5X A;  1RJT A;  1MBY A;  3HKZ G;  1S4Z A;  5KRU A;  4BY1 H;  4DR2 Q;  5KGU A;  1H9R A;  1Q1B A;  2R7D A;  5ELO A;  4BBR G;  4OXP A;  4OWW B;  3ITP A;  3IFD A;  2IW3 A;  2I5M X;  1IBM Q;  3NP8 A;  3CHB D;  3GTK B;  4GNX B;  3A5Z B;  5COR A;  3G4S A;  2WAC A;  4ZQ3 A;  1AEX A;  1IBK L;  4FVM A;  2MHV A;  3PV0 A;  1CA6 A;  5D14 A;  1N9W A;  2JA5 B;  1CTM A;  2KUM A;  4CJ0 B;  1IZ6 A;  1NJI C;  1STE A;  1DM0 B;  3CAM A;  3A54 A;  4JI2 L;  2EJM A;  1OXS C;  1YNJ C;  2KBN A;  1QNK A;  2DUD A;  2K6A A;  4UPA A;  4JCV E;  4QUF A;  1LAC A;  4DR7 Q;  5CR3 A;  4X3S A;  5J22 A;  1YI2 A;  2XNA C;  5A35 A;  2F52 A;  3VYU A;  1Q7Y C;  4A3E H;  1GJX A;  1TY2 A;  2NN6 G;  4RKL A;  4A3B H;  3H0G H;  1I94 Q;  2ZTC A;  3ULJ A;  5LMN W;  1VCI A;  4A3B B;  3JAM i;  5BN3 A;  4DPG A;  4FF2 A;  1S5F D;  3HOU G;  1L0Y B;  2DGY A;  2Y0S G;  1IBL Q;  3STB C;  1MJC A;  5M3F H;  4DR5 L;  2CQO A;  2CWA A;  1S5D D;  2K33 A;  5I6Y A;  1Q12 A;  5M3F B;  1H9M A;  2I0Q A;  1L1O B;  3HG9 A;  5IYD H;  3QG1 A;  3I4M G;  1CKO A;  3IFT A;  1MGS A;  1K83 B;  1VQH A;  3T13 A;  1QB5 D;  1I6H H;  5GQO A;  3E9H A;  1I6H B;  1SNC A;  4GKJ L;  1U9R A;  3MTS A;  3M4Y A;  3J7A F;  4MZ9 A;  1XMO Q;  1XNQ L;  1DON A;  4A3I B;  2RSO A;  3J7Z C;  2JSO A;  4C3J G;  1OXU A;  2EYJ A;  1HUN A;  2R3Z A;  4CDD C;  1Y8P B;  1B1Z A;  3PIO 3;  4A3M G;  1Y1W G;  4ZCK A;  2LY7 A;  1V9P A;  5IE8 A;  1PFN A;  3F2C A;  5LMU L;  4G7H C;  1IL2 A;  1E22 A;  2AWO A;  3ND8 A;  5IYC G;  4POF A;  1GHK A;  4DNT B;  4IUV A;  4WJW A;  4HJ8 A;  2J7Z A;  4KKU A;  1YEZ A;  1H95 A;  2F0M A;  1GUN A;  2Q2H A;  3S1M H;  4BY7 H;  4A4I A;  3S14 H;  4HED A;  2F0K A;  4TRD A;  1V1P A;  4AH6 A;  4BY7 B;  4Y7N B;  3S14 B;  1J5E Q;  3LX0 A;  3HOW B;  4A93 H;  1EY0 A;  2E8G A;  1BCP D;  3J81 E;  2IHE A;  2VQF L;  1AP0 A;  5C0X G;  1M8A A;  1IXR A;  5C3E B;  1T5E A;  2SOB A;  1EFI D;  1RHP A;  4J6H A;  2EY6 A;  2WII B;  5C3W A;  1QUQ A;  2B3G A;  5JVG 3;  3Q22 A;  1Y69 U;  2B29 A;  1EWC A;  4EQP A;  2AQ2 B;  3X3N A;  4KLK A;  1PH5 A;  1UEB A;  4JI5 Q;  3VR5 A;  2LXK A;  1PYB A;  3CQZ H;  3IKJ A;  1XYI A;  2F3V A;  2R93 B;  1NMG A;  3CQZ B;  5DEH A;  2KHJ A;  3E0J A;  1HR0 L;  3OYY A;  3K7A H;  1D1I A;  4KD4 A;  1XMO L;  4PMB A;  3K7A B;  2RQX A;  3D31 A;  2B2Y C;  4HR7 B;  2QCP X;  4MTN A;  4A3L G;  2XGT A;  4FF4 A;  4K0K L;  1QE6 A;  4KHV A;  1HFG A;  2L1B A;  2CHB D;  3A8I E;  3AFQ A;  5LHY 1;  1D5Z C;  3CC4 A;  4R8I A;  2K7V A;  3M9B A;  4I7Z C;  3C2P A;  1KRT A;  4WOR A;  4IUU A;  2KOL A;  5IGF A;  5H1S E;  2LS0 1;  1CSQ A;  1K28 A;  4DNI A;  2Z6B A;  5KYL A;  5C4J H;  2HUG A;  1A62 A;  1VQJ A;  2B63 G;  1ENF A;  3WWV A;  5C4J B;  1N32 Q;  1QIL A;  1T9H A;  2F0P A;  2V1C C;  2VY3 A;  1ENA A;  2PQE A;  4O2D A;  2EY5 A;  2KA7 A;  4LJZ C;  5C6A A;  1EWI A;  5IP9 H;  4OON A;  4Z9C B;  5J39 A;  3ZJY C;  4OEM B;  3GV3 A;  1K73 C;  5BN4 A;  2WKD A;  3P1H A;  1EY7 A;  2C9O A;  1U4L A;  3SXH A;  5IT9 c;  3NUC A;  4A3F H;  2DY8 A;  5LMN Q;  3C46 A;  2JA7 G;  2E76 C;  3JAM c;  3MFY A;  4A3F B;  1RL2 A;  3CP0 A;  2PZU A;  3NEM A;  4OX9 L;  1GUW A;  4L8J A;  1E3P A;  4OHJ A;  1EIG A;  4GOP C;  4HN7 A;  5A2Q L;  1KHI A;  5ELF A;  4P75 A;  5ELB A;  1SNM A;  4JVZ A;  2BDN A;  3ND9 A;  2F0W A;  3OIP A;  3ULP A;  3J7Y W;  4C1N I;  4FYD A;  1GXD C;  4WRD A;  1KD1 C;  3KLS X;  4PZ7 A;  1LT3 D;  1X3Q A;  4X65 Q;  3PUZ A;  1VQL A;  5KNC A;  5C4X B;  4XYQ A;  5M5W H;  3KDF A;  4ZLT F;  1N34 Q;  3AQQ A;  4LUO A;  2K14 A;  5IP7 G;  2AUJ D;  4A3C H;  1ZYR D;  4OGQ C;  1L2F A;  4XTC S;  3S2H H;  2HDM A;  1SYB A;  3NPP A;  1FJG Q;  2PCF B;  3A8J E;  1UE1 A;  2UXB Q;  1I4R A;  2YV5 A;  3M85 A;  1HTL D;  2WKC A;  3VYT A;  4DV3 L;  3I3C A;  1STB A;  1WOC A;  4U68 A;  1B44 D;  4RH6 A;  1BXT A;  3J7A V;  4O1N A;  5FO7 B;  1C4Q A;  3BZD B;  2RVL A;  3E6Z X;  1EOT A;  1LO5 D;  2JA5 G;  1YJW A;  3A74 A;  4GLV B;  3MZ5 A;  4A3K B;  1STY A;  4B3M L;  1PA6 A;  1EY4 A;  4AYB G;  3OSO A;  2VUM B;  4FXD A;  3FEW X;  3UI2 A;  4DN4 M;  1PLF A;  3KLW A;  4JI6 Q;  3GTL H;  2Q8R E;  2F4V Q;  1QOH A;  3P75 A;  4DF7 A;  4QCL A;  3GTL B;  2WAQ E;  1Z47 A;  3B6Y A;  5JPN C;  2UXD L;  4DK6 C;  1JWS D;  1TXY A;  3RR5 A;  2Z4H A;  1PH1 A;  5D65 A;  1NAP A;  2GVA A;  4KK7 A;  2EJF C;  2UUA Q;  3PO3 H;  5I2X A;  4ULL A;  1QZG A;  4A3D B;  1Y1V H;  5IWA Q;  4I7A A;  2WIN B;  4HMJ A;  2IHF A;  4IAL A;  4C1N K;  1YNN D;  2NYZ D;  2RF4 A;  1I4P A;  4BWG B;  4XQJ A;  5COY A;  1Z6H A;  3VR4 A;  3NE5 B;  1F2L A;  1YBY A;  4X64 Q;  2VL6 A;  4DV2 Q;  5JAV A;  4YWK A;  4YY3 Q;  4DV4 Q;  3OTO Q;  1C7Y A;  3SE0 A;  3QOJ A;  1JOR A;  3JAM L;  2N3S A;  3VR3 A;  3PIP A;  3KOJ A;  1KDB A;  5KND A;  3IL8 A;  1NNX A;  1AE2 A;  4JI3 L;  4DUY Q;  3MEF A;  4YHH Q;  3KF8 A;  2PZW A;  3FKI H;  4DV0 L;  2HD3 A;  5NUC A;  1EY8 A;  2A74 C;  5C0X J;  1A3U A;  2NVY H;  5GRO A;  2Q2T A;  4B3T Q;  3K0Y A;  4A3I G;  1K9M C;  3TQY A;  1ONL A;  3GP7 A;  2Z1C A;  4JV5 Q;  4GN4 B;  1XMQ L;  1S40 A;  4H7B A;  1H9K A;  1HPC A;  1S5E D;  3T1Y Q;  1ESR A;  1UE6 A;  2ZM6 Q;  4FDB A;  3Q23 A;  4N8X 1;  2E5L Q;  4XDX A;  4JI1 Q;  3T1H Q;  1SMY C;  3I72 A;  2E2D C;  4KHP L;  2YTX A;  4UHV A;  1QJO A;  3GV6 A;  1G6Z A;  3W5O A;  4ABN A;  1X6O A;  1XTD A;  4JI8 Q;  4KV6 A;  1E2Z A;  1ICF B;  2DJG C;  2PYK A;  4IFD G;  1CQV A;  3HOW G;  3GTO H;  3KFU A;  4KJN A;  1STN A;  4WJ3 M;  1U4P A;  2G9D A;  3NHH A;  4K5W A;  3CW2 C;  5K36 H;  1CSP A;  4IFD I;  5GAD C;  3VYS A;  3BDC A;  1LM0 A;  2EOT A;  5C3E G;  2EIF A;  1SND A;  4GKK Q;  1MSG A;  3NWT A;  3H3V C;  2PZT A;  3RMH A;  3TZD A;  2RDG A;  5EPJ A;  5HUR A;  5IGD A;  3S1R H;  1PH6 A;  1AFP A;  2HHH Q;  2WB1 B;  3S1R B;  3HKS A;  5BR8 Q;  3H3V I;  3G7L A;  2KCC A;  4RA8 A;  3NQI A;  4KKT A;  1N33 L;  2JYO A;  3HRZ C;  5K5P A;  4DUY L;  1P16 A;  2F4I A;  1X3P A;  2JXM B;  2R93 G;  2HIV A;  4QQB X;  1YJN A;  1SNP A;  1AN8 A;  3GTP H;  1EYD A;  1WJJ A;  2EXD A;  4QL5 A;  4UAI A;  4NXN L;  4UY8 C;  1B9N A;  2NB0 A;  4LF4 Q;  4HCS A;  3DLL A;  1DOL A;  5I2Y A;  3S9W A;  1EL0 A;  3J80 E;  1HJP A;  4C3H G;  4AQY Q;  3T1Y L;  2ZM6 L;  3HOY G;  3DEO A;  1B3A A;  4POG A;  1JQY D;  2N49 A;  1TS2 A;  1BBW A;  1R9T H;  3L3O C;  2K03 A;  1ESF A;  3SK5 A;  3I91 A;  2RHS B;  2V4D A;  3HOZ B;  5ELN A;  4NKL A;  4TKO B;  2PW5 A;  5DLQ E;  1YNJ D;  1VQB A;  4NXM L;  4UDU C;  4B3S L;  1DOK A;  3K5O A;  3M4O H;  3NTK A;  4L6T B;  1AZP A;  5FK9 C;  2DJF C;  1OO9 B;  4DV6 L;  5M3M H;  4XXE A;  2BH2 A;  5TSS A;  4N8F A;  2E2I B;  3D0F A;  2MGS A;  4HSP A;  4LK1 C;  1EYA A;  3KLS A;  5IIF A;  1Q8K A;  1DZ1 A;  1B2T A;  3PCO B;  4B3R L;  1S3O A;  4IUT A;  3K58 A;  1F9Q A;  3STB D;  3KF6 A;  1SFO H;  1IW7 C;  2IWH A;  5IGC A;  2JA8 B;  2DN8 A;  4L5R C;  3RLF A;  2Z6K A;  3MFG A;  1I3Q H;  2OCE A;  2EDG A;  2R61 A;  2RHQ B;  4H02 A;  3S16 H;  1I3Q B;  3D4D A;  2CWP A;  4TQU S;  4PZ8 A;  3S16 B;  3FPU B;  4C56 C;  1BO0 A;  3BZK A;  3QB3 A;  1HZC A;  1VQG A;  2ID0 A;  5ELE A;  1G2T A;  1BOS A;  4CGY B;  4X3K A;  2H4O A;  2QDL A;  2KJX A;  1TWA H;  5ISR A;  1MJE A;  1ENC A;  4MN3 A;  1EQT A;  4XT3 B;  5BN5 A;  3CPF A;  2RKS A;  3I4N G;  4OL7 A;  1TWA B;  5IYB H;  3PF4 A;  4C3I G;  4K8J A;  3NBH A;  1HQR D;  1XNR L;  3GTM H;  5C4X G;  4JBM A;  1LTA D;  4RFB A;  3DEP A;  3SDZ A;  4GOP B;  1W3S A;  4KTA A;  1UNS A;  1CKN B;  3JC6 6;  3ERO A;  4LF5 L;  1FNV A;  2IT1 A;  2I5H A;  1PFM A;  1V8Q A;  5AFW A;  3OPO A;  5IGG A;  4DFA A;  5T1G A;  4BY1 B;  4PZ6 A;  3CME A;  1A6X A;  1MSH A;  2R92 G;  3TP8 A;  2JA6 H;  2K50 A;  3S17 H;  4RMF A;  2JEB I;  2B2V C;  4DAP A;  1Y8O B;  2JA6 B;  3CCL A;  2RSN A;  4BXX H;  4FXG C;  2BH8 A;  5JPM C;  4EQN A;  4DAV A;  1GM5 A;  1KIX A;  2HT1 A;  1N8R C;  4FO2 A;  2UU9 L;  2EY2 A;  2I5L X;  1IHZ A;  5L37 A;  4A3K G;  1LTL A;  2EY1 A;  2QIL A;  1JB3 A;  4XYO A;  5KEE A;  4FF1 A;  2VUM G;  4C2M H;  4LWC A;  1ZXT A;  4LUZ A;  2VXW A;  1HA6 A;  3BYT B;  1ASZ A;  4C2M B;  2QA4 A;  3PUW A;  5IOC A;  5I9O A;  2EPB A;  2QKI C;  4CBV A;  1I50 H;  2N78 A;  2XIW A;  1JMC A;  1SAP A;  4UP8 A;  4A3E B;  1HNX Q;  1HNW L;  1FR3 A;  2SNS A;  5LL6 X;  2FMC A;  5EGT A;  3H0G B;  5AJ3 Q;  3UE0 A;  2BCO A;  1IKM A;  1WD1 A;  1IYU A;  4QUC A;  2NN6 I;  2AQ1 B;  1DGS A;  4ZYS A;  4KN7 C;  1B4O A;  4A3D G;  4LF8 Q;  4RGT A;  1AH9 A;  3DM1 A;  4DR6 Q;  4DR3 L;  4KKS A;  3DMU A;  2JE6 I;  4DK3 C;  4HCE A;  4NW2 A;  4JBJ A;  4QY7 A;  5C44 H;  3HFZ B;  4XQN A;  4DAY A;  4FP5 D;  1LT5 D;  5C44 B;  4N9P A;  4DR2 L;  2EYO A;  2NVX H;  4JI0 Q;  1A2T A;  4JI7 Q;  2NVX B;  4HSV A;  5CYU A;  1FVI A;  4HTH A;  2A8V A;  1IBM L;  1PXU A;  4JW0 A;  3GD7 A;  1I5F A;  1WYD A;  4OO1 G;  4IFD J;  3QJY A;  1Q3L A;  4ZUI A;  1VQ4 A;  3H91 A;  1I6V C;  5JOB A;  4A76 A;  1O7Z A;  5FJ8 G;  4A3J G;  4G4K A;  2UUC Q;  1PYW D;  4J15 A;  1SYG A;  4OO1 I;  5EBC A;  3TS2 A;  1U4M A;  4OIJ A;  1CHP D;  4KN4 C;  4NMZ A;  2ZT9 C;  1EOV A;  1K3R A;  4ID6 A;  2B2W A;  3O13 A;  1VQD A;  3CF5 A;  4DR7 L;  4ZUJ A;  3TDQ A;  4P74 A;  3EBE A;  1QNU A;  2ICI A;  3RD4 A;  4MNO A;  4DV1 Q;  5F2D A;  2CFM A;  2ZXO A;  4ALP A;  5IOD A;  4XT1 B;  1I94 L;  1HNX L;  3NTH A;  3S1N H;  4R8N A;  3RZD H;  3IAY A;  1VQE A;  2VQE Q;  2FXQ A;  1SJE D;  3R8B A;  2ZTD A;  3S1N B;  3RZD B;  1A15 A;  2CH4 A;  1TQO A;  1ML0 D;  3S1M B;  1D2B A;  1IBL L;  1HQM C;  2F0E A;  1MIU A;  3PQI A;  2E2J H;  1MHW C;  2L55 A;  5CBE E;  4LF8 L;  1Z7T A;  4A93 B;  3NSW A;  4R4O A;  2E2J B;  4LFB Q;  1JJG A;  3FRP B;  2J4X A;  2HQL A;  4X66 Q;  5C0X I;  3D6W A;  2AMC B;  1NMF A;  3QR8 A;  4RGN A;  3RZO H;  1LTG D;  2WB1 G;  3ICE A;  4L5T A;  3F2D A;  1E1T A;  4MIU A;  4DGZ A;  2IL8 A;  3L9A X;  1KRS A;  5I9P A;  4H44 C;  1X3F A;  4BBS H;  3GQB A;  3PF5 A;  4HIK A;  4BBS B;  1M4V A;  4ZRZ A;  5FLM G;  2FIN B;  1WTO A;  3H3V H;  3S2D H;  2VNU D;  4F87 A;  3ER0 A;  3CCS A;  3SHL A;  3D4W A;  4HAE A;  4IJH A;  2RBM A;  3TS0 A;  1V1P B;  1AE3 A;  3CCV A;  3OWF A;  3MWY W;  4B9X A;  4ZK9 B;  3G6E A;  3CXC A;  2PO4 A;  2HCI A;  1XJV A;  1SLJ A;  3M4P A;  1VQ6 A;  3GTG H;  2F1M A;  2CW0 C;  3R3O A;  1VQK A;  1B53 A;  4IOC A;  3HOZ G;  1CUK A;  1I4Q A;  4XIG S;  3MHB A;  3HOX H;  2XRQ D;  4BA1 I;  1KL9 A;  1DJR D;  1DD2 A;  1PH2 A;  1OXV A;  3R2I A;  2SNM A;  3HOX B;  1CHQ D;  3PUV A;  1D5M C;  2SDF A;  1H9S B;  2B2U A;  4H13 C;  4YCV A;  1SRO A;  2K5W A;  2ALY B;  2X6G A;  3TRE A;  1J5E L;  1YIJ A;  1EFW A;  1SR3 A;  5J1Z A;  2VS1 A;  1J8I A;  1WD0 A;  5DM6 3;  1XX8 A;  1F9R A;  3AU7 A;  5ELC A;  1SYC A;  3GTJ H;  4CHT B;  1F2Z A;  1TWC H;  4LF7 Q;  1EZ6 A;  1TWC B;  4P73 A;  2F0D A;  2JA8 G;  4X66 L;  1KXL A;  3K5N A;  4EQO A;  4DA2 A;  1GUG A;  2YYZ A;  3KYH C;  5FLX c;  2A6H C;  2L0C A;  2EYL A;  4ZAI A;  3K8A A;  3AEV A;  2OT2 A;  5IGE A;  2M00 A;  2NUC A;  2MUY A;  5HY6 A;  4JI5 L;  1G51 A;  1KQS A;  4GN5 A;  4E6I A;  1WCM G;  3F8T A;  3HS0 C;  5JEA G;  1PZJ D;  3MVV A;  3CC7 A;  1SMX A;  4HIO A;  4JPB W;  2K4K A;  4RG1 A;  2K28 A;  5M5X H;  2Z6K C;  3Q24 A;  1PH9 A;  2XWB B;  3I73 A;  1B9M A;  4V19 0;  5M5X B;  3HOV H;  1G29 1;  2EJG C;  1PZI D;  4RGM A;  1U5K A;  4RCO A;  3GTQ H;  4A3G H;  4DR4 Q;  2K5N A;  4DR1 Q;  4A3G B;  5DAU A;  4LNQ A;  3MXN B;  4BA2 I;  3QO2 A;  1SE3 A;  3MC0 B;  2B2V A;  1C8C A;  1PFB A;  5M5W B;  2A68 C;  3J81 i;  2RCF A;  2WFW A;  1Q90 A;  4R9W A;  1EQV A;  1V1O A;  5KNB A;  1PRT C;  4X3T A;  1ZKO A;  3PO2 H;  2OQK A;  3CCU A;  2A19 A;  3S2H B;  3PO2 B;  1X56 A;  3N6R A;  1IKL A;  2MFI A;  4BY1 G;  1BBX C;  1SMY D;  2XWJ B;  3HKZ E;  3X3M A;  5CMD A;  4KD3 A;  1IYV A;  3G48 A;  1N32 L;  2VW9 A;  4HID A;  2F3I A;  1EEI D;  3A55 A;  3R93 A;  4ZKB B;  2XSC A;  3FDT A;  4AIM A;  4HJ7 A;  4FXK C;  4IPD A;  1SEB D;  1B7Y B;  3C1F A;  4KY6 A;  3HKZ B;  1WTH A;  2JJQ A;  4GS3 A;  5FKA C;  1LTR D;  2D0O A;  3K5L A;  2PMZ E;  4BBR H;  3L2P A;  3NK9 A;  1N36 Q;  1GUO A;  1PRT F;  2JN4 A;  5EPL A;  1K8M A;  2E74 C;  5LMN L;  3I70 A;  3Q6S A;  1EZ8 A;  1B8A A;  5EPK A;  1F9S A;  4CJ2 C;  3AFP A;  4KI0 A;  2XN9 C;  3KDF B;  1K8A C;  1JE5 A;  2PMZ B;  2Z9H A;  3SGI A;  3OMG A;  2VB2 X;  4EVO A;  1X9N A;  4ME3 A;  5GAE C;  2PW7 A;  4X62 Q;  1VQN A;  2WV6 D;  3N52 A;  1VMC A;  4LF6 Q;  2O4X A;  4A3E G;  1BF4 A;  1KAB A;  3ERS X;  2F0G A;  1HA5 A;  2HIX A;  4A3B G;  3H0G G;  5E1F A;  1EWH A;  1VQM A;  2MPM A;  2ZTE A;  4J1M A;  1BUV T;  3TEH B;  4XQQ A;  4X65 L;  4CKC A;  1CM9 A;  1MI2 A;  2LMC B;  3PO3 B;  2WAQ B;  2IX0 A;  2DY7 A;  3M7G A;  1KC8 C;  5M3F G;  2NN6 H;  2OTL A;  1N34 L;  1Y1V B;  2Y0S E;  5DNF A;  3NXW A;  1X54 A;  3S15 H;  3HOU H;  2MO1 A;  3I90 A;  4JOI A;  3S15 B;  1FJG L;  2B8F A;  3HOU B;  5IYD G;  3GO5 A;  1EYG A;  1PMR A;  3PIO A;  5IT9 L;  2UXB L;  5D3I B;  3E9I A;  2OQ0 A;  2Y0S B;  4YCW A;  2F0T A;  4F7X A;  3VYR A;  5M9O A;  3CCR A;  4JI4 Q;  2L12 A;  1SE8 A;  1TVX A;  5FLX L;  2Z8L A;  3BDO A;  2F0F A;  1X65 A;  4LMQ D;  2MP1 A;  1D6E C;  3BVM A;  3I4M H;  2PI2 A;  3FKI B;  3RN5 A;  4YWM A;  2ATW A;  5C4H A;  2NVY B;  3L7Z C;  1XPR A;  1GVP A;  3URY A;  3G71 A;  5A2Q E;  1YZ6 A;  1QWY A;  3SR1 A;  1UE5 A;  1LTI D;  4BS9 A;  1KNE A;  1E1O A;  3V96 A;  3MEH A;  3LWU A;  4YCU A;  3BVZ A;  5FO8 B;  3K80 C;  1DYQ A;  2ASB A;  1AW7 A;  1IW7 D;  5CV6 A;  1F77 A;  4JI6 L;  2F4V L;  3AYH B;  3L0O A;  2N55 A;  3I55 A;  1CZW A;  4C3J H;  4DXF A;  1HTP A;  4C3J B;  4G7O C;  1WTW A;  4X3U A;  1NSN S;  1RIP A;  4A3M H;  3A8K E;  1Y1W H;  4MTK A;  2UUA L;  4BY7 G;  2B2W C;  1VQI A;  4A3M B;  1Y1W B;  1OXX K;  1A8V A;  3FHW A;  1EY6 A;  5IYC H;  2E2H H;  3KF8 B;  5M5Y H;  5IWA L;  3GTO B;  1U0L A;  4A93 G;  4JYA Q;  2XRS D;  1YHB A;  1X55 A;  4DV5 Q;  3EVQ A;  3RLN A;  1LTS D;  4Q5V A;  2F0I A;  2JQO A;  2A73 B;  2I07 B;  2K05 A;  2RDH A;  3K81 C;  3D3R A;  3CCM A;  5FO9 B;  4X64 L;  1A2U A;  4DV2 L;  1GHJ A;  1WFQ A;  4DV4 L;  4YY3 L;  1LTB D;  3OTO L;  4M1U B;  3DM3 A;  2NZ1 D;  1A3T A;  5C0X H;  1E0B A;  1FYC A;  3CD6 A;  1R4Q B;  4YIJ A;  3H94 A;  4QMG A;  1BBU A;  3U58 A;  1J6Q A;  1HZA A;  4IUR A;  4APV A;  1L0X B;  3BU2 A;  4YHH L;  1HHV A;  4IOA A;  1UE7 A;  3J81 c;  2A6E C;  4K6D A;  1II3 A;  4B3T L;  2KQ3 A;  4PMC A;  3CCE A;  3GTP B;  2R7F A;  2QGQ A;  2ZJR A;  3TRZ A;  4JV5 L;  3VR6 A;  4PNY A;  1STG A;  1EU4 A;  2GA4 B;  4U67 3;  1K0S A;  2NVQ H;  3VA5 A;  2NVQ B;  4B08 A;  4LF9 Q;  1PZK D;  3ONA B;  4JI1 L;  2E5L L;  4PV1 C;  3T1H L;  4DUZ Q;  1R9T B;  2KCN A;  1JOO A;  5IGB A;  2RCN A;  2BA0 A;  2C5C A;  1F2Y A;  3F2U A;  2MO0 A;  5JEA J;  1GOZ A;  1D8L A;  2QEJ C;  3LNN A;  2QF7 A;  4QIW E;  3HOX G;  4A3L H;  1PYS B;  4JI8 L;  3M4O B;  5EJW A;  1JJC B;  4RKB A;  4GN3 B;  2EVB A;  4O42 A;  5M3M B;  2CCZ A;  3S24 A;  4QIW B;  1HR0 W;  5IT9 E;  4N9T A;  1B3Q A;  5CV8 A;  3KBX A;  2PQA A;  1ZEQ X;  3T53 B;  5IP9 G;  3JAM E;  3RN2 A;  3VR2 A;  4NP5 A;  2D0P A;  2F0L A;  3CCJ A;  1ASY A;  4GKK L;  3HEJ A;  3A0J A;  1SSO A;  2B63 H;  4WFN 3;  1NR4 A;  1STA A;  1SFO B;  2B2U C;  4A3F G;  1YNX A;  2HHH L;  2YTV A;  1PTO C;  3EQL C;  5BR8 L;  3DWP A;  3T16 A;  3UDF A;  1VQ8 A;  3RNU A;  1IBK Q;  2LSS A;  1EY5 A;  1VQO A;  2JA7 H;  1SBB B;  4LF4 L;  1LT4 D;  2Q8I B;  2JA7 B;  4JI2 Q;  1E2V A;  1ET6 A;  1K0R A;  2QEX A;  4GLA C;  2XVS A;  5E3F A;  4AQY L;  4K2L A;  1A0I A;  4KHZ A;  3BZC A;  3P20 A;  1JB7 A;  2KEN A;  2H1E A;  3GTM B;  1PTO F;  5EKL A;  3NTI A;  2RA4 A;  2L4N A;  4JBW A;  3KF6 B;  4GNX A;  4QB4 A;  3EJI A;  2PNH A;  1E24 A;  1K8O A;  1ET9 A;  4EX5 A;  4A3C G;  1FD7 D;  1E7Z A;  1ICW A;  2Q2U A;  1TWG H;  1W6J A;  1TWG B;  5IY0 A;  2G5D A;  4DR5 Q;  5KIX A;  3FPP A;  4UP9 A;  3UE1 A;  4ILW A;  5IP7 H;  1LV9 A;  1SNQ A;  2CVR A;  2O5I C;  3S17 B;  1PRT B;  1DOM A;  2EYH A;  2K75 A;  1B50 A;  1EU3 A;  2F0U A;  5GAG C;  4R4C A;  2K5D A;  3J81 L;  3NBH B;  2A1A A;  1F2M A;  2BDO A;  5CV5 A;  4O0A A;  4S3S A;  4HJ9 A;  3J80 i;  1FGU A;  2EXZ A;  1O7L A;  3GTK H;  5JJL A;  5EKI A;  2JEA I;  3AB9 A;  4JK1 C;  4GKJ Q;  4F88 A;  2HDL A;  3C3L A;  5I4D A;  2JA5 H;  3CCQ A;  2A69 C;  1XNQ Q;  4V0B A;  3AMU A;  3TP6 A;  3ZYY X;  4AYB E;  3W2D A;  1BQQ T;  2L11 A;  2L9H A;  1G2S A;  1L1O A;  1I50 B;  1G8Z D;  2R7Z H;  1MKH A;  3G6J B;  2NBF A;  1BNZ A;  3DUZ A;  5C5L A;  3MXP A;  2F0N A;  3T51 B;  1JT8 A;  2R7Z B;  3EA6 A;  2A5H A;  4MHE A;  1O80 A;  2DNE A;  4H0L C;  4AYB B;  4DV7 Q;  2EZV A;  5LMU Q;  3PO3 G;  2WAQ G;  3J7A 5;  3V05 A;  4LFC Q;  1XPU A;  2QDB A;  1DXM A;  1QVG A;  3OW2 A;  1VQF A;  1Y1V G;  3C1E A;  1Q86 C;  5JVH 3;  3E5S A;  3ULL A;  4CDE C;  5DM7 3;  4IJL A;  4RCN A;  5EAY A;  1RKN A;  2K5Q A;  3MAQ A;  1D7Q A;  2D62 A;  2CW0 D;  1XPO A;  2F0H A;  1M1K C;  1HH2 P;  1EQQ A;  4EGV A;  2VQF Q;  3M3Y H;  4IZ8 A;  4JC0 A;  3M3Y B;  5JJK A;  2D9U A;  3DHQ A;  1CQF A;  4NB3 A;  3CC2 A;  1PFS A;  4JOI C;  5CV7 A;  3CU7 A;  1AZQ A;  3FKI G;  1Y14 B;  1WVL A;  1MD2 D;  3IRB A;  1K83 H;  2KHS A;  1LLR D;  2F0Q A;  4CKB A;  1V1Q A;  1JOK A;  2M9V A;  5JJZ A;  2MQH A;  2ICE C;  2K04 A;  1C48 A;  2O2L D;  4K6L A;  2BE5 C;  2NVT H;  1HR0 Q;  1QCB D;  4A3I H;  3P7J A;  1S5C D;  1I4H A;  1KLU D;  2F0O A;  4DAY B;  2NVT B;  1KAA A;  2A6H D;  1EYC A;  3DWA A;  4K8I A;  3ERQ A;  4I65 A;  1WTR A;  5AJ3 L;  1EIF A;  1LYL A;  2H5X A;  2AUK A;  4K0K Q;  3K0X A;  1XTC D;  3TBI B;  2LFN A;  4DV7 L;  2L15 A;  5EKK A;  2C35 B;  1SDF A;  1SE4 A;  2M2L A;  4LFC L;  3CMA A;  5I6W A;  4IUQ A;  1Q1E A;  2Q2I A;  4A75 A;  4DR6 L;  3PIP 3;  3U9S A;  2YTY A;  5K36 G;  4LW1 A;  3NBI A;  3K7U C;  4R4I A;  3NWS A;  1WTV A;  1PH7 A;  4P2C B;  4IFD H;  4Y7N H;  1VDZ A;  2LXJ A;  3HOW H;  4OIK A;  4JI0 L;  4JI7 L;  2PNR C;  2A68 D;  1SNO A;  3K5M A;  1NUC A;  4OWX B;  3LWE A;  1SN8 A;  3MXU A;  2FHT A;  1PRT D;  3RZO B;  2FJ2 A;  5C3E H;  1O78 A;  1S72 A;  4IUP A;  1KAW A;  1OXT A;  4QJF A;  3GDE A;  1Q8I A;  3S2D B;  2VB3 X;  2UUC L;  3OOC A;  2X69 A;  1WI5 A;  2BA1 A;  4LAA A;  1BKB A;  1VQC A;  1H9J A;  1RDP D;  2NWG A;  1VQ5 A;  2ENB A;  3KJP A;  1O7Y A;  4OX9 Q;  2WP8 J;  1A3V A;  1H9S A;  1UUP A;  3U50 C;  2D5D A;  2K01 A;  4YWL A;  2R93 H;  1HZ9 A;  3TME A;  4IQZ A;  1K8G A;  1SRU A;  3NQT A;  5E4X A;  1PDQ A;  3GTG B;  4DKA C;  1CZG A;  1J9O A;  1QUQ B;  1NR2 A;  4DV1 L;  3A7A B;  4IO9 A;  4C3H H;  1RTN A;  5C3X A;  1G91 A;  3BDL A;  4C3H B;  2J0T D;  3WOE A;  2VQE L;  3M7N A;  3HOY H;  4R1J A;  1HFN A;  4M8A A;  1SE2 A;  3HOY B;  3H15 A;  1NY4 A;  3J80 c;  3OIQ A;  3UDX A;  3T4A C;  4DAM A;  5M3M G;  4J8Q A;  1HXY D;  3TSS A;  1P8L A;  4LFB L;  1VQ7 A;  1EIY B;  3DWQ A;  5LL6 S;  2UUB Q;  2AHO B;  3GTJ B;  2CQA A;  1T5X D;  4DU9 A;  2ZJP A;  1HCZ A;  1TT2 A;  2B2T A;  3U4V A;  1K3B C;  3M4Q A;  4L5S A;  4DV3 Q;  4FF3 A;  3VDY A;  3W1B A;  2JK8 A;  1KDA A;  2F0V A;  1WTQ A;  2IY5 B;  1SXT A;  3BVG A;  1BR9 A;  1TKW B;  1EEF D;  3MXN A;  1TS4 A;  2X6L A;  1NCV A;  1LAB A;  3KBG A;  2OXP A;  4RHS A;  2OWO A;  3QOL A;  4B9W A;  2TSS A; 
#chains in the Genus database with same CATH homology
 1XNQ L;  3BZK A;  1E1O A;  4YCU A;  1HZC A;  1VQG A;  2ID0 A;  1Z9F A;  3K80 C;  3J7Z C;  2ASB A;  4B3M Q;  5IYB G;  1OXU A;  1OTC A;  1TWA H;  1MJE A;  4JI6 L;  3I56 A;  3CPF A;  3AYH B;  2F4V L;  3BJU A;  3L0O A;  3I4N G;  3I55 A;  4C3J H;  5IYB H;  3I2Z A;  3PF4 A;  4A3M G;  1Y1W G;  5IE8 A;  1V9P A;  5LMU L;  1XNR L;  3F2C A;  1Q82 C;  1IL2 A;  1E22 A;  3U4Z A;  3GTM H;  4JBM A;  3I4N H;  2AWO A;  2UXD Q;  5C4X G;  1RIP A;  4C3I H;  4POF A;  5IYC G;  4A3M H;  4GOP B;  1W3S A;  1Y1W H;  2K5V A;  1CKN B;  3JC6 6;  1PH4 A;  2UUA L;  2NZH A;  3KJO A;  4HJ8 A;  4BY7 G;  1VQI A;  5C4X H;  1YEZ A;  1OXX K;  4LF5 L;  1H95 A;  1A8V A;  2IT1 A;  2I5H A;  3FHW A;  2Q2H A;  4LUV A;  5IYC H;  2E2H H;  3KF8 B;  5M5Y H;  5IWA L;  4A93 G;  1U0L A;  4Y52 H;  4JYA Q;  3S1M H;  4BY7 H;  1YHB A;  4A4I A;  1X55 A;  4DV5 Q;  3S14 H;  1YVC A;  3RLN A;  1GO3 E;  1VS0 A;  2JQO A;  4AH6 A;  1J5E Q;  4A93 H;  2JA6 G;  3K81 C;  2E8G A;  4PZ6 A;  4GNX C;  3CME A;  2IHE A;  3CCM A;  2VQF L;  4X64 L;  5C0X G;  4DV2 L;  4P71 A;  2R92 G;  3A5U A;  1WFQ A;  4QGU A;  4DV4 L;  4YY3 L;  2UUB L;  1IXR A;  3OTO L;  2K50 A;  2ZJQ A;  3J81 j;  4LF7 L;  2JA6 H;  3S17 H;  1YHQ A;  4RMF A;  1CKM A;  2JEB I;  3DM3 A;  5J3B A;  3CCL A;  2R92 H;  3CD6 A;  1W2B A;  4BXX H;  1QUQ A;  2B3G A;  2BH8 A;  1BBU A;  3I4O A;  4IPH A;  3U58 A;  1J6Q A;  2B29 A;  1HZA A;  3PGZ A;  1GM5 A;  1KIX A;  4APV A;  2HT1 A;  3BU2 A;  4YHH L;  4JI3 Q;  3Q8D A;  4IOA A;  1N8R C;  1B70 B;  4KLK A;  1UE7 A;  3W1G A;  3J81 c;  1PH5 A;  2UU9 L;  1UEB A;  2I5L X;  4JI5 Q;  4B3T L;  3CCE A;  4DV0 Q;  2LXK A;  4A3K G;  2R7F A;  2QGQ A;  1LTL A;  1PYB A;  2ZJR A;  3CQZ H;  3TRZ A;  4JV5 L;  1NMG A;  1YHA A;  2KHJ A;  2VUM G;  4C2M H;  4LWC A;  3UDG A;  1HR0 L;  3OYY A;  3K7A H;  4LUZ A;  4A3K H;  2NVQ H;  1XMO L;  1XMQ Q;  1ASZ A;  3CPW A;  1A63 A;  4GLX A;  2QA4 A;  3PUW A;  2R7Z G;  4LF9 Q;  4R4T A;  2VUM H;  1EQR A;  3D31 A;  2E5L L;  4JI1 L;  1Q81 C;  1I50 H;  2N78 A;  3EIV A;  4MTN A;  1JMC A;  3T1H L;  4UP8 A;  1HNW L;  1Q46 A;  1HNX Q;  4DUZ Q;  4DR4 L;  4DR1 L;  5JJI A;  5E7N A;  2RCN A;  2XGT A;  2BA0 A;  4A3L G;  5AJ3 Q;  4K0K L;  4KHP Q;  3UE0 A;  3PO3 G;  2MO0 A;  5JEA J;  3AFQ A;  2XTI A;  4IPG A;  4WJ4 A;  4QIW E;  1D8L A;  3HOX G;  2NN6 I;  4A3L H;  3CC4 A;  1PYS B;  1DGS A;  4JI8 L;  1L1O C;  3M9B A;  4A3D G;  4LF8 Q;  1AH9 A;  1FL0 A;  1KRT A;  1JJC B;  5C44 G;  4GN3 B;  4DR6 Q;  3UDI A;  4DR3 L;  5H1S E;  2JE6 I;  1QZH A;  4DK3 C;  2CCZ A;  4A3D H;  1CSQ A;  3S24 A;  4QY7 A;  4JBJ A;  1PH8 A;  1HR0 W;  1YJ9 A;  4DNI A;  5C4J H;  1QVC A;  5C44 H;  1A62 A;  3HFZ B;  1VQJ A;  2PQA A;  2B63 G;  1TWH H;  3WWV A;  5IP9 G;  1N32 Q;  4DR2 L;  3RN2 A;  1T9H A;  2D0P A;  2V1C C;  3PUX A;  2NVX H;  2VY3 A;  3CCJ A;  1ASY A;  3F1Z A;  4JI0 Q;  4JI7 Q;  4O2D A;  3LGJ A;  4GKK L;  3A0J A;  2B63 H;  1EWI A;  1FVI A;  4OON A;  5IP9 H;  3ZJY C;  2A8V A;  1IBM L;  3GD7 A;  4A3F G;  1K73 C;  1I5F A;  1WYD A;  1YNX A;  1N36 L;  4OO1 G;  2HHH L;  4IFD J;  2YTV A;  5BR8 L;  1VQ4 A;  3F2B A;  5IT9 c;  4A76 A;  5FJ8 G;  4A3J G;  4A3F H;  3UDF A;  3I7F A;  5LMN Q;  2JA7 G;  1VQ8 A;  2UUC Q;  4J15 A;  3JAM c;  3RNU A;  1IBK Q;  1N33 Q;  4UP7 A;  4OO1 I;  1RL2 A;  2LSS A;  1TWF H;  3CP0 A;  5FJ8 H;  4A3J H;  3TS2 A;  3NEM A;  1VQO A;  4OX9 L;  1HNZ Q;  2JA7 H;  1E3P A;  4LF4 L;  1VQ9 A;  4NXN Q;  1EOV A;  4JI2 Q;  4X62 L;  4GOP C;  1K3R A;  1K0R A;  2QEX A;  3CF5 A;  1VQD A;  4GLA C;  4LFA Q;  1M90 C;  4DR7 L;  1KHI A;  4LF6 L;  4P75 A;  4AQY L;  1A0I A;  1BVS A;  4KHZ A;  3BZC A;  1JB7 A;  4P74 A;  2KEN A;  3ULP A;  3EBE A;  2PI2 E;  2UXC Q;  2EQS A;  4MNO A;  4DV1 Q;  1KD1 C;  2CFM A;  4ALP A;  4PZ7 A;  1HNX L;  1I94 L;  4JBW A;  3KF6 B;  4X65 Q;  4GNX A;  3PUZ A;  1VQL A;  3S1N H;  3RZD H;  1VQE A;  2PNH A;  2VQE Q;  2FXQ A;  1E24 A;  1VQA A;  2ZTD A;  4EX5 A;  4A3C G;  5M5W H;  1X3G A;  2YU9 H;  1E7Z A;  2Q2U A;  2KCM A;  3KDF A;  1N34 Q;  1TWG H;  3AQQ A;  1IBL L;  1MIU A;  4LUO A;  4NXM Q;  1C0A A;  4B3S Q;  2K14 A;  5IP7 G;  2E2J H;  4LF8 L;  4A3C H;  5IY0 A;  4P72 A;  1L2F A;  4DR5 Q;  4DV6 Q;  4XTC S;  4R4O A;  4HJA A;  3S2H H;  4LFB Q;  1FJG Q;  4BXX G;  4UP9 A;  1UE1 A;  3UE1 A;  5IP7 H;  1L0W A;  4JI4 L;  2UXB Q;  3NEL A;  2YV5 A;  1JJG A;  3M85 A;  2HQL A;  4DV3 L;  4HIM A;  4X66 Q;  5C0X I;  1WOC A;  2K75 A;  4B3R Q;  1IYJ B;  2AMC B;  5GAG C;  4R4C A;  1NMF A;  2WB1 E;  4BBS G;  2GN5 A;  4HJ5 A;  3NBH B;  3RZO H;  2WB1 G;  3ICE A;  2A1A A;  1VQP A;  4L5T A;  3F2D A;  1E1T A;  4OWT B;  2IX1 A;  4O0A A;  1V43 A;  4HJ9 A;  1KRS A;  4BBS H;  1X3F A;  3EN2 A;  3J80 i;  1FGU A;  2AWN A;  2CKZ B;  4PMW A;  2JA5 G;  3PF5 A;  3GTK H;  4HIK A;  5JJL A;  1YJW A;  1EUJ A;  3PUY A;  2ES2 A;  3A74 A;  5FLM G;  2MNA A;  3H3V H;  2R6G A;  3S2D H;  2JEA I;  2VNU D;  4GLV B;  3ER0 A;  4GKJ Q;  4JG2 A;  2JA5 H;  2N8N A;  3CCS A;  5GAH C;  3CCQ A;  1XNQ Q;  4IJH A;  5FLM H;  3TS0 A;  1C9O A;  4AYB E;  4B3M L;  1PA6 A;  1HNZ L;  4AYB G;  1AE3 A;  3CCV A;  1NTG A;  1L1O A;  2R7Z H;  1MKH A;  3KLW A;  1JT8 A;  4JI6 Q;  3GTL H;  3G6E A;  3CXC A;  4LFA L;  3FP9 A;  2F4V Q;  2OTJ A;  1XJV A;  1SLJ A;  3M4P A;  4EQ5 A;  1VQ6 A;  3GTG H;  2K5H A;  2WAQ E;  1Z47 A;  3B6Y A;  2UXD L;  4DV7 Q;  1VQK A;  2VZA A;  4DK6 C;  5LMU Q;  1LUZ A;  2WAQ G;  1TXY A;  4IOC A;  1XNR Q;  3HOZ G;  3RR5 A;  3J7A 5;  2UXC L;  1CUK A;  4LFC Q;  2Z0S A;  1XPU A;  4XIG S;  2NZO A;  1QVG A;  3HOX H;  3OW2 A;  1PH1 A;  1VQF A;  1Y1V G;  3NEN A;  4BA1 I;  1KL9 A;  2GVA A;  2UUA Q;  1PH2 A;  1OXV A;  1Q86 C;  1JJ2 A;  3HOZ H;  3PO3 H;  4LF5 Q;  3PUV A;  4L5Q A;  3ULL A;  1QZG A;  4JYA L;  1O7I A;  3S1Q H;  1Y1V H;  4DV5 L;  5IWA Q;  4YCV A;  1SRO A;  4IJL A;  2IHF A;  5EAY A;  2ALY B;  3TRE A;  1J5E L;  1YIJ A;  1D7Q A;  2D62 A;  1SR3 A;  1EFW A;  2VS1 A;  2RF4 A;  1XPO A;  4JBK A;  1YIT A;  1M1K C;  1HH2 P;  2JA9 A;  1EQQ A;  2VQF Q;  1YBY A;  3M3Y H;  4X64 Q;  2E2I H;  3GTJ H;  4DV2 Q;  1TWC H;  4YWK A;  4YY3 Q;  4JC0 A;  3OTO Q;  4DV4 Q;  4LF7 Q;  5HGQ A;  1C7Y A;  5JJK A;  1QVF A;  1UWV A;  4NB3 A;  4P73 A;  3CC2 A;  2JA8 G;  1PFS A;  4X66 L;  2N3S A;  1KXL A;  4JOI C;  3PIP A;  2KHI A;  1HZB A;  2YYZ A;  4GOP A;  3KYH C;  1CKN A;  3FKI G;  3KOJ A;  5FLX c;  1Y14 B;  4DUY Q;  1AE2 A;  3K8A A;  4JI3 L;  3IRB A;  1K83 H;  2JA8 H;  3AEV A;  1G6P A;  1NE3 A;  3MEF A;  4YHH Q;  4JI5 L;  5HY6 A;  1V1Q A;  3FKI H;  4IPC A;  1G51 A;  1KQS A;  4DV0 L;  4NPS A;  2UU9 Q;  3E0E A;  1PHJ A;  5C0X J;  5GRO A;  2NVY H;  2Q2T A;  4GN5 A;  4B3T Q;  4A3I G;  1WCM G;  3F8T A;  5JEA G;  1K9M C;  3TQY A;  3CC7 A;  1SMX A;  4HIO A;  2MQH A;  4JV5 Q;  4GN4 B;  1XMQ L;  1S40 A;  2K4K A;  4R4Q A;  2NVT H;  4RG1 A;  1GD7 A;  1HR0 Q;  3HOV G;  4A3I H;  1WCM H;  2K52 A;  4A3G G;  4LF9 L;  5M5X H;  2PQA B;  4DAY B;  3T1Y Q;  2Z6K C;  1UE6 A;  2GVB A;  2ZM6 Q;  1PH9 A;  4FDB A;  1GKH A;  4TVA B;  4X6A H;  4DUZ L;  1G29 1;  4JI1 Q;  2E5L Q;  3HOV H;  4A3G H;  1U5K A;  3GTQ H;  3T1H Q;  1HNW Q;  1X3E A;  3RLO A;  4DR4 Q;  2K5N A;  1EIF A;  5AJ3 L;  4DR1 Q;  1LYL A;  2H5X A;  4KHP L;  2YTX A;  1NBW A;  3K0X A;  3PSI A;  4LNQ A;  4K0K Q;  3MXN B;  4BA2 I;  3PO2 G;  3J81 i;  4DV7 L;  2WFW A;  4PG3 A;  1PV4 A;  2L15 A;  2C35 B;  2AKW B;  1X6O A;  1XTD A;  4LFC L;  3W5O A;  4JI8 Q;  3CMA A;  1Q1E A;  2KCT A;  2Q2I A;  4A75 A;  4DR6 L;  3PO2 H;  2OQK A;  4IFD G;  2YTY A;  5K36 G;  4LW1 A;  3CCU A;  2A19 A;  3K7U C;  1X56 A;  4DR3 Q;  3GTO H;  2MFI A;  3HOW G;  4BY1 G;  3KFU A;  4R4I A;  4WJ3 M;  1PH3 A;  1PH7 A;  3HKZ E;  3CW2 C;  3G48 A;  1CSP A;  3HKZ G;  4Y7N H;  1N32 L;  2LXJ A;  3HOW H;  4IFD I;  2VW9 A;  4HID A;  5GAD C;  4BY1 H;  4JI0 L;  4JI7 L;  2F3I A;  1LM0 A;  4DR2 Q;  5C3E G;  2EIF A;  1Q1B A;  2R7D A;  5ELO A;  4OWX B;  4AIM A;  4GKK Q;  4HJ7 A;  4BBR G;  1SN8 A;  4OXP A;  4IPD A;  1B7Y B;  4OWW B;  2JJQ A;  2I5M X;  4GS3 A;  5C3E H;  1IBM Q;  2D0O A;  3S1R H;  1S72 A;  2PMZ E;  4BBR H;  3L2P A;  1PH6 A;  1N36 Q;  2HHH Q;  1KAW A;  1OXT A;  4QJF A;  3GDE A;  4GNX B;  3A5Z B;  3HKS A;  5BR8 Q;  3G4S A;  5LMN L;  3H3V I;  2UUC L;  1WI5 A;  2BA1 A;  1B8A A;  1IBK L;  1N33 L;  3PV0 A;  3AFP A;  4KI0 A;  4DUY L;  1P16 A;  1BKB A;  1VQC A;  1N9W A;  1VQ5 A;  3KDF B;  1K8A C;  1JE5 A;  2R93 G;  2HIV A;  1IZ6 A;  3KJP A;  1YJN A;  4QQB X;  1NJI C;  3SGI A;  3GTP H;  1WJJ A;  2EXD A;  4QL5 A;  3CAM A;  4NXN L;  2WP8 J;  4JI2 L;  1X9N A;  4OX9 Q;  4UY8 C;  1OXS C;  4LF4 Q;  3U50 C;  4ME3 A;  2KBN A;  3DLL A;  4YWL A;  5GAE C;  2R93 H;  4X62 Q;  1HZ9 A;  1VQN A;  2DUD A;  1K8G A;  1HJP A;  1SRU A;  4UPA A;  4JCV E;  4LF6 Q;  4DR7 Q;  4A3E G;  3ERS X;  4AQY Q;  1YI2 A;  4DKA C;  2HIX A;  3T1Y L;  1QUQ B;  3H0G G;  4A3B G;  2ZM6 L;  3HOY G;  4DV1 L;  1VQM A;  4POG A;  2F52 A;  4IO9 A;  2N49 A;  2ZTE A;  4C3H H;  4A3E H;  1Q7Y C;  1BBW A;  3TEH B;  1R9T H;  4X65 L;  2NN6 G;  4A3B H;  2RHS B;  3H0G H;  1I94 Q;  2ZTC A;  3ULJ A;  2VQE L;  5LMN W;  3HOY H;  3M7N A;  4R1J A;  5ELN A;  1VCI A;  2IX0 A;  3JAM i;  3HOU G;  5DLQ E;  4DPG A;  1KC8 C;  5M3F G;  3H15 A;  1NY4 A;  1VQB A;  3J80 c;  2OTL A;  3UDX A;  4DAM A;  2Y0S E;  5M3M G;  1N34 L;  4NXM L;  2DGY A;  4B3S L;  2Y0S G;  1X54 A;  1IBL Q;  3STB C;  3S15 H;  3M4O H;  3HOU H;  1PVO A;  1MJC A;  2MO1 A;  5M3F H;  4DR5 L;  4DV6 L;  2CQO A;  4JOI A;  2CWA A;  1P8L A;  5M3M H;  4LFB L;  1FJG L;  1VQ7 A;  5IYD G;  3GO5 A;  1Q12 A;  1EIY B;  1EYG A;  3PIO A;  2BH2 A;  2UUB Q;  2UXB L;  3D0F A;  3E9I A;  2AHO B;  2OQ0 A;  2I0Q A;  4YCW A;  3CCR A;  4JI4 Q;  1Q8K A;  1SE8 A;  2ZJP A;  1L1O B;  3U4V A;  5IYD H;  3PCO B;  4B3R L;  3M4Q A;  4L5S A;  4DV3 Q;  1S3O A;  3I4M G;  1X65 A;  1CKO A;  3VDY A;  3W1B A;  2JK8 A;  3KF6 A;  3STB D;  1SFO H;  3I4M H;  4L5R C;  2IY5 B;  3RLF A;  2Z6K A;  2PI2 A;  1VQH A;  3RN5 A;  1I3Q H;  2OCE A;  1I6H H;  4YWM A;  2ATW A;  2RHQ B;  3L7Z C;  4H02 A;  3E9H A;  5GQO A;  3S16 H;  1XPR A;  4GKJ L;  1GVP A;  3G71 A;  2CWP A;  4MZ9 A;  1YZ6 A;  4TQU S;  4PZ8 A;  2OWO A;  2VL6 A;  1UE5 A;  1XMO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...