1D7QA

Human translation initiation factor eif1a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
143
structure length
143
Chain Sequence
PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PROTEIN (N-TERMINAL HISTIDINE TAG)
publication title The eIF1A solution structure reveals a large RNA-binding surface important for scanning function.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1d7qA00
1XPOA 1L0WA 3AEVA 1HR0W 1VCIA 3F1ZA 3G48A 1VQBA 4BBRH 5FLMH 2K5NA 2FXQA 3F2BA 4OWTB 4UPAA 3RN2A 4JV5Q 1TXYA 2VS1A 4A3LH 3M85A 1V9PA 2EIFA 2E5LL 1OXSC 4HJ5A 1N8RC 1A63A 2F4VL 1NE3A 1K0RA 2Q2UA 2PQAB 2UXBL 4UP8A 4LF8Q 3PUXA 5ELNA 3KJPA 3S2HH 5M3MH 3A74A 4B3SL 3HOUH 3PUWA 4HJAA 3M4PA 2ZJRA 5LMNL 3HOYH 3S2DH 5IYBG 3A5UA 1KHIA 3I2ZA 5IP9G 4GN3B 1XPUA 1X9NA 2YTXA 5IYCH 1Q46A 3PIOA 1X3GA 5LMUQ 1JJGA 1PH2A 2K75A 3U50C 3H3VI 4DK3C 4B3RQ 1HNZQ 3HOZG 2A8VA 4A3JG 5K36G 3HOWH 5GAGC 2MNAA 3I4MH 3L0OA 4J15A 4LFBL 1KC8C 2DGYA 4JI7L 1I3QH 4GOPB 1CKOA 3CAMA 3G71A 4KLKA 2R92H 3BZKA 2YTVA 5AJ3L 2IY5B 2GN5A 3CCQA 2XGTA 1XNRQ 3I7FA 4DV1Q 4GNXB 1V1QA 1N33Q 1N32L 1KXLA 4K0KL 3KJOA 1HH2P 3TS2A 1CKNB 4LNQA 3UE0A 4GOPC 3H0GG 4KI0A 3S14H 3CC2A 3BZCA 2D62A 3CCLA 4B3TQ 3S1RH 1YVCA 5GAHC 3UDIA 4TVAB 4DUZL 4GNXC 5HGQA 2B29A 2HIVA 2JE6I 1TWFH 3KF8B 2ID0A 2VQEQ 1VQIA 3CC4A 1FJGL 4NPSA 4PZ7A 2PMZE 1JE5A 2NVTH 4BBSG 5LMNW 1I94Q 1MKHA 1L1OB 1YI2A 1VQ9A 4WJ4A 1H95A 4O2DA 1EOVA 5IE8A 1JB7A 1VQLA 5C4XG 1I50H 1Q82C 1G291 1PV4A 2ZM6Q 1I5FA 1VQ7A 4YY3L 2JA8G 3M7NA 5C3EH 4A3CH 2JA7G 4IJLA 3G6EA 1QUQB 4OWWB 3NENA 4JI6Q 2VW9A 2UXCL 4NXNL 1TWGH 4A3FH 4DR7L 1EQRA 4UY8C 2Z6KC 3PO3H 3A5ZB 4NB3A 4QL5A 4LF4L 1AE3A 1Y1VG 2I5HA 2V1CC 3CPFA 2IX1A 2CKZB 5H1SE 2UUBL 3GDEA 3CMEA 3CCSA 4AYBG 3KYHC 2PQAA 5GROA 5FLXc 1VQCA 1HJPA 1VQEA 2CFMA 2K52A 3T1HQ 4DUYL 2WB1G 3RLOA 2VQFQ 1KQSA 4LF5Q 2K50A 1OTCA 1PFSA 5JEAG 1VQKA 1IBMQ 3W1GA 2UUCQ 4JI0L 3B6YA 4C3IH 2BH8A 4QJFA 4DR1L 4LF9Q 4GKKL 2R93G 3J80i 3TREA 2I0QA 3NBHB 1OXXK 4A93G 2KBNA 4GS3A 1XMOQ 2NN6G 4JBMA 1J5EQ 3WWVA 4KHPL 5IYBH 1SN8A 1YJWA 2HIXA 1GVPA 5IP9H 1IL2A 4DAYB 4LFAL 3GTGH 2UXDL 1P8LA 5JJLA 2DUDA 4JI1L 4R1JA 1U5KA 1E22A 2AWOA 2OTJA 4HJ7A 1W2BA 3HOZH 4A3JH 2VY3A 4A3GG 1PHJA 4LF6L 1CSPA 1JJCB 3CP0A 1Q7YC 2JEAI 3F8TA 4QIWE 5IYDG 1B7YB 1VQGA 4YCVA 1KAWA 3STBD 4A76A 1MJEA 2VL6A 1VQOA 1VQ5A 2HT1A 4A3DG 2ES2A 4JI3Q 4DNIA 3K7UC 3PV0A 4X65Q 3FKIG 4A3MG 1N36L 2UU9L 3STBC 3J80c 3I56A 1HNZL 3PSIA 4DV0L 3GTPH 3JAMi 2CWPA 4GN5A 3H0GH 4GKJQ 2RHSB 2QA4A 1EQQA 1K9MC 1L1OA 1C9OA 3DM3A 1PYBA 2PNHA 4IOAA 4DV2Q 1IBKQ 1E7ZA 5IWAL 4A3FG 2CCZA 3ICEA 4A3BH 1IXRA 4LFCL 3CCUA 1X6OA 3RLFA 4BBSH 3HKZE 4JG2A 3GTQH 1IYJB 2F3IA 4BA1I 2D0PA 3S1QH 1D7QA 2R7ZG 1XMQQ 3BU2A 2E2JH 2E8GA 1O7IA 1FVIA 1SROA 1E1TA 2IHEA 2YTYA 2ZTDA 1WYDA 4JOIA 5C4XH 4YHHQ 1ASZA 4OX9Q 1EIFA 4PZ8A 2JA8H 3JAMc 4AH6A 2JA7H 3CMAA 2VNUD 1LUZA 1I94L 4OO1I 2OQKA 2JEBI 2NZOA 4DR4Q 3W5OA 1PH3A 1AH9A 2L15A 1IBLQ 3RR5A 4HJ9A 4X62Q 4APVA 1Y1VH 2N78A 4L5TA 4IO9A 4X64Q 1JMCA 2I5MX 5C44G 1SR3A 1ASYA 3D31A 4X66L 1JJ2A 1KRSA 4QGUA 3H15A 1YBYA 1Q1BA 1NMFA 2RHQB 4EQ5A 2QEXA 4JC0A 4JI5L 1YIJA 2HHHQ 3I4OA 1HZAA 1PVOA 3K80C 5EAYA 3T1YQ 1Y1WG 1R9TH 1KIXA 4YWKA 4DV6Q 4XIGS 4LWCA 4DR2L 4DV5Q 1HR0Q 1MIUA 2R93H 3KFUA 1VQDA 1QVGA 1S72A 4A93H 3EN2A 3GO5A 3RLNA 2YYZA 4IPHA 4LUVA 3T1HL 2OTLA 3NELA 2IT1A 1L2FA 4JYAQ 1PH1A 2VZAA 3HFZB 1PH4A 4LF5L 5BR8L 1VQMA 3D0FA 1VQJA 5ELOA 3CXCA 2JA6G 1MJCA 1VQAA 2UUCL 1WFQA 1YEZA 1EYGA 4LF9L 4A3GH 3U4VA 1VS0A 2JK8A 4DV4Q 1XMOL 2Y0SE 4B3MQ 1VQNA 5JJIA 3S1MH 4DV7L 2HQLA 3K0XA 4A3BG 1W3SA 5IYDH 4OWXB 3UDXA 1HNWL 2MFIA 4LW1A 4R4QA 4A3DH 1C0AA 5FJ8G 3CQZH 4A3MH 3FKIH 4IFDI 4AQYQ 2D0OA 2R7FA 2LXJA 1NJIC 4JI4L 3S1NH 1PH5A 5HY6A 3PUVA 4TQUS 3J7ZC 1X54A 3CCEA 1L1OC 4P71A 2MO1A 2Q2TA 2WAQE 1K8AC 2YV5A 4PG3A 4JI3L 2F52A 4DR5L 4ME3A 2JA5G 4A75A 1A62A 1YZ6A 3RZDH 2RF4A 4JCVE 3KDFB 1UE7A 3W1BA 4GN4B 4YCUA 4JI2Q 3CCVA 1HNXL 2ZJPA 2F4VQ 2R7ZH 2UXBQ 2EXDA 1SLJA 3K8AA 3U58A 1E3PA 4DV2L 3PUZA 1PH6A 3K81C 5GAEC 2WP8J 4IPGA 2UUAL 3U4ZA 1PH8A 2B3GA 4IFDJ 1KD1C 4AIMA 2OQ0A 4GLVB 3GTKH 1M1KC 3J81i 1XMQL 1FL0A 4POFA 5C0XI 3M4OH 1J6QA 2N8NA 1K8GA 1I6HH 1SMXA 4OX9L 4P72A 1WCMG 5C44H 2H5XA 4YHHL 5DLQE 1B70B 4JI7Q 4JV5L 4MNOA 2VUMG 1BBUA 2E2HH 1QVCA 3M4QA 1K83H 2ZTEA 2WFWA 5AJ3Q 1Q81C 4BY7G 1YITA 4LF8L 2CQOA 1IBLL 3S15H 4K0KQ 3E9HA 1N32Q 1NMGA 1Y1WH 2YU9H 3PO2G 1YJNA 4JBWA 1UEBA 3ZJYC 1X3FA 3CW2C 3M3YH 1G6PA 4IJHA 1S40A 1N9WA 2GVAA 2QGQA 1UWVA 4DUZQ 5LMUL 3ER0A 1WI5A 1K3RA 1Z9FA 3AYHB 3J81c 4B3RL 3M9BA 1U0LA 1FJGQ 4DR6Q 1VQPA 2XTIA 1NY4A 2R6GA 4XTCS 5IY0A 3GD7A 1LTLA 5C0XJ 2JA6H 3I4NG 2JJQA 1X55A 1AE2A 3K7AH 4DV5L 4P75A 3BJUA 3AFQA 2OWOA 1X65A 3Q8DA 4ALPA 1XNRL 1OXUA 2LXKA 4DV1L 1N33L 4OONA 1JT8A 1N34Q 1TWAH 2A1AA 3KOJA 4HIDA 5M3FG 4YY3Q 5C4JH 3J81j 4A3KG 5FJ8H 2RCNA 2KCTA 3IRBA 1Q86C 1GM5A 4DAMA 4B3TL 2UXCQ 1LYLA 3OW2A 3CD6A 1E1OA 1CSQA 3HKZG 4NXMQ 3KDFA 3DLLA 4DV4L 4LF4Q 2VQEL 1HZBA 2AWNA 2UUBQ 3PF5A 1GKHA 2K4KA 4MZ9A 4DK6C 4L5QA 2KHJA 3MXNB 3L2PA 2JA5H 3KF6A 3RN5A 5E7NA 3PGZA 4DUYQ 3MEFA 3FHWA 2Z0SA 5M5YH 4A3EG 3H3VH 3JC66 2BH2A 1EUJA 2ZJQA 2BA0A 1TWHH 2ZM6L 4JI0Q 5M5WH 1K73C 5GADC 1X3EA 4A3IG 1CKMA 1XJVA 4JI6L 3GTLH 4UP7A 3F2CA 1C7YA 4KHPQ 4A4IA 3HKSA 3ULPA 1NTGA 3HOXG 1Q12A 4LFAQ 2UXDQ 2IHFA 4JI1Q 1IZ6A 1KL9A 2KHIA 4JI2L 3CPWA 3TS0A 3OTOQ 2AMCB 4QY7A 4C3HH 1PYSB 5JJKA 2R7DA 4QQBX 1RL2A 1EWIA 4BY1G 4LF6Q 1WCMH 1Q1EA 1VQFA 2JA9A 4PMWA 4HJ8A 1XNQQ 3TRZA 2VQFL 2VUMH 3J7A5 3G4SA 3ULJA 4EX5A 1VQ8A 2MQHA 1IBML 4BY7H 3AFPA 1T9HA 3CF5A 1N36Q 2UU9Q 1NBWA 3HOVG 1QZHA 4IPCA 4DV0Q 3PO2H 4R4OA 1J5EL 2K14A 4C3JH 2BA1A 3PCOB 2Q2HA 2C35B 3HOUG 4JI8Q 4UP9A 4HIKA 1VQ4A 4LF7Q 1UE6A 2Y0SG 2MO0A 1OXVA 4DV3Q 4X6AH 5IWAQ 1G51A 1XPRA 4LFCQ 4H02A 4OO1G 4L5RC 2PI2E 2NZHA 4DR3Q 3FP9A 3KLWA 2A19A 4HIOA 3I4NH 3ERSX 2NN6I 1VQHA 3A0JA 4O0AA 4IPDA 4P73A 2NVXH 5IP7H 4BXXG 2B63G 1VQ6A 4X65L 4LUZA 5M5XH 3PUYA 1UE5A 3AQQA 5M3FH 2WAQG 4DR6L 1Y14B 4A3KH 4MTNA 4R4IA 4GKJL 2E2IH 2E5LQ 4PZ6A 1UE1A 4GLAC 2ATWA 3PF4A 2N3SA 1IBKL 1V43A 4B3SQ 3KF6B 3GTJH 2AHOB 4JOIC 4YWMA 3CCMA 5LMNQ 1N34L 2ASBA 4BBRG 2AKWB 2CWAA 5FLMG 1LM0A 3CC7A 1OXTA 1YJ9A 3RZOH 4X66Q 3OYYA 4A3LG 4Y52H 5JEAJ 4R4TA 2PI2A 2LSSA 2ZTCA 2EQSA 4YWLA 2Q2IA 4JBKA 1XTDA 4L5SA 4AYBE 3RNUA 1BVSA 3CCRA 4JI5Q 1Z47A 1GO3E 4YCWA 5M3MG 4A3EH 4NXML 4LFBQ 1YNXA 4DR2Q 4KHZA 3GTMH 3HOYG 4LUOA 3NEMA 2WB1E 1KRTA 2JQOA 1SFOH 3GTOH 4A3IH 1S3OA 3EBEA 4DR4L 5IYCG 3UDFA 4Y7NH 4POGA 1DGSA 1PH9A 3HOXH 3UE1A 4X62L 3TEHB 3HOWG 3I4MG 1A0IA 2IX0A 3E0EA 2N49A 4RMFA 5BR8Q 4X64L 2KCMA 4IFDG 4GLXA 1EIYB 3LGJA 1YHAA 2NVQH 1M90C 1QVFA 2R92G 1TWCH 2I5LX 4BY1H 1Q8KA 4DV7Q 3TQYA 1QZGA 3ULLA 2HHHL 4P74A 4C2MH 4GOPA 3T1YL 1HNWQ 4JBJA 4IOCA 4DV6L 2OCEA 3E9IA 1HR0L 3I55A 1A8VA 1BKBA 3OTOL 4GNXA 5IP7G 4JI4Q 3HOVH 1YHQA 3CCJA 3UDGA 1CKNA 3SGIA 1PA6A 5GQOA 3EIVA 2KENA 1XNQL 4JYAL 3S24A 3S17H 3F2DA 1YHBA 1B8AA 2GVBA 2ALYB 1BBWA 1EFWA 4DR5Q 1HZ9A 1PH7A 3VDYA 4NXNQ 4DR7Q 4DKAC 1HZCA 4R4CA 1GD7A 4B3ML 4RG1A 3S16H 5C0XG 5J3BA 4OXPA 1WJJA 1SE8A 1X56A 1HNXQ 4JI8L 4WJ3M 4HIMA 1P16A 4LF7L 5C3EG 1E24A 4BXXH 2B63H 3PIPA 1WOCA 5IT9c 4A3CG 2NVYH 4DV3L 1SRUA 4AQYL 1D8LA 1FGUA 2K5HA 2Z6KA 4DPGA 4BA2I 2UUAQ 1RIPA 2K5VA 3PO3G 4DR3L 1CUKA 4GKKQ 4DR1Q 1QUQA 3L7ZC 4FDBA
chains in the Genus database with same CATH superfamily
1VF5C 1HR0W 2RDFA 3F2BA 4OWTB 2P5ZX 2RSNA 1A63A 2LMCB 1N8RC 3TZUA 1KABA 1LLRD 3S2HH 1F9SA 2A68D 2PMZB 3M4YA 1ILPA 2KCCA 2DJGC 4KV6A 2PZWA 2BCOA 5D65A 5IYBG 1Y69U 5CR3A 2IJ0A 1X9NA 3AMUA 1X3GA 1IYUA 5C4ZA 2A8VA 3D4WA 5EKLA 3DXJC 2EJGC 2F0NA 3OIQA 5C5LA 2R92H 1QE6A 4CDCC 1FNUA 5A2QE 1ET9A 1R9TB 4DF7A 4KY6A 3BZCA 3CCLA 4IUTA 3UDIA 4DUZL 2JSOA 5HGTA 2HIVA 3QG1A 4DK1A 1QOHA 1CZWA 4IURA 1VQIA 4NPSA 2NVTH 5LMNW 3PMFA 1VQ9A 4WJWA 5IE8A 2CVRA 1JB7A 2WKDA 1HQMC 3EQLC 1PV4A 4YY3L 2PZTA 2JYOA 3VR4A 1SNOA 4IJLA 1QUQB 4A3MB 4JI6Q 2UXCL 1O7LA 4DR7L 4QIWB 1L0YB 3S1NB 2F0IA 1AE3A 1Y1VG 2K32A 2V1CC 4RCNA 2UUBL 1H9MA 4AYBG 1PTOH 3TBIB 1S5FD 3BYTB 3T1HQ 3OPOA 4F7XA 4FYDA 5FO8B 3KUPA 1KQSA 2VXWA 1BQQT 1B53A 5JEAG 3W1GA 4X3KA 4GKKL 2A6HD 1H9SA 4OELB 1LTTD 3SR1A 5CV8A 3NBHB 1BCPF 3OW7A 4GS3A 4NP5A 1J5EQ 4KHPL 1SN8A 1GVPA 1IL2A 4FXDA 1B1ZA 3GTGH 1P8LA 5CMDA 2DUDA 5HURA 4F8MA 4ODGA 2AWOA 1GUSA 1XWEA 3M4OB 2VY3A 4A3GG 4A3EB 3DUZA 1JJCB 3CP0A 3GTMB 1RJTA 3F8TA 3GTOB 5KNCA 3K7UC 3PV0A 2UU9L 1BCPC 3KF8A 3STBC 3J80c 2BE5D 3JAMi 2CWPA 2RHSB 3M3YB 1K9MC 1L1OA 3HG9A 5EKIA 1PYBA 4IOAA 3GV6A 1TWCB 1RKNA 1T5XD 1E7ZA 4BY1B 2J7ZA 5JAVA 3RLFA 1Q8IA 2C5CA 3FPUB 2AQ1B 4KD3A 5JPMC 1PYWD 2R7ZG 3EVQA 2K04A 2E2JH 2CHBD 2ZTDA 1O7IA 1SROA 5C4XH 4JOIA 1WYDA 1TWAB 4PV1C 1ASZA 4PZ8A 2AQ2B 1ICWA 1LUZA 2JEBI 2NZOA 3W5OA 1YNJC 3VR2A 1EEID 5CV7A 4HJ9A 1B3QA 4APVA 1QNKA 1JMCA 4B9XA 2OT2A 1EWHA 3D31A 4X66L 5LL6X 5EQ0A 1KRSA 2AUJD 1NMFA 2RHQB 4EQ5A 2HHHQ 3T1YQ 2ZT9C 1R9TH 2F0WA 4XIGS 5JOBA 1QVGA 1S72A 4A93H 2EVBA 2K01A 3EN2A 3GO5A 5EJWA 3HS0C 4LUVA 3T1HL 1DZ1A 4XQNA 1IW7D 4JYAQ 2VZAA 3HFZB 1VQMA 3D0FA 1MJCA 2EZVA 1HUMA 1YEZA 1D1IA 3I8ZA 4CJ2C 1VS0A 2B8GA 4DV4Q 5JJIA 1CZGA 1WCMB 4DV7L 2HQLA 2BOSA 5IYDH 3UDXA 4LW1A 4A3DH 1NR2A 4LK1C 5FJ8G 4A3MH 1GHJA 4IFDI 1MBYA 3S1NH 1K8MA 2I07B 3PUVA 2LY7A 4CKBA 3J7ZC 1CQFA 2WAQE 2Q2TA 1K8AC 1TS3A 3K0YA 4IUNA 4ME3A 1J9OA 1A62A 3VR3A 5KYIA 2N55A 3VYTA 3K59A 3I4NB 1SNMA 4YCUA 3CCVA 3S14B 2UXBQ 4DXFA 1EU4A 5GAEC 2KQ3A 5M3FB 2WP8J 2UUAL 3KLSA 3KK7A 2OQ0A 1M1KC 3J81i 1ENCA 1FL0A 5C0XI 1B50A 3M4OH 2B2VA 2ICEC 3K5OA 3NTIA 3RZOB 4JV5L 4MNOA 4J1MA 1BBUA 1A2TA 5KYLA 2E2HH 5IGGA 1K83H 2ZTEA 5C3EB 1U4MA 1Q81C 4ZKCB 4LF8L 3S15H 1Y1WH 1CFMA 2QDBA 3ZJYC 4QB4A 1G6PA 3M3YH 1LO5D 1EWCA 1N9WA 4ABNA 2QGQA 5LMUL 1HTPA 5F2DA 5NUCA 1WTVA 1HA5A 3M9BA 1U0LA 1FJGQ 3H91A 4XTCS 5IY0A 1LTLA 3GQBA 2JJQA 1IKLA 3K7AH 3BJUA 1ILQA 1XNRL 2IPKD 4IN3A 1TS5A 1O7ZA 3OIPA 1N33L 1JT8A 1N34Q 1TWAH 4FF1A 2B2TC 1X32A 4ID6A 1ENAA 2F3VA 2B2WA 2OXPA 3J80E 5FLXL 4B3TL 3HOVB 4A3JB 2D5DA 4DV4L 1TS2A 4LF4Q 5CYUA 2HDMA 4IUPA 4L5QA 3Q23A 3MXNB 3RN5A 5E7NA 2R61A 3KLSX 3MFYA 3FHWA 3LWUA 3PQIA 4FO2A 4A3EG 2EDGA 3H0GB 2BH2A 1EUJA 2BA0A 1V1OA 4JI0Q 5M5WH 5CBEE 3QO2A 4L6TB 4KN4C 3HKSA 1NTGA 2RVLA 5C6AA 4BBSB 3P20A 5I2XA 3AU7A 3BDLA 1J8IA 3CRLC 1TT2A 4BY1G 3BS1A 1WCMH 2JA9A 4PMWA 1XNQQ 2VUMH 3G4SA 2A68C 4EX5A 2H1EA 1IBML 2FMCA 1VMCA 1T9HA 1N36Q 1QZHA 1XTCD 3HOUB 5E1FA 2BA1A 4X3SA 2I46A 1G2TA 4UP9A 4HIKA 3G7LA 2ZXPA 4X6AH 3C3LA 2WB1B 1XPRA 2EYJA 1SNDA 4H02A 3I4MB 4OO1G 2NZHA 1FGBD 3I4NH 1TQOA 3JAML 1PFMA 1PZJD 3LX0A 4IPDA 4O0AA 2Z9HA 5CV9A 4KJOA 3FVQA 1VQ6A 4LMQD 1IYVA 5M3FH 1Y14B 4A3KH 4R4IA 4GKJL 5KEEA 4GLAC 4CDDC 3PF4A 1GUTA 1GJXA 4B3SQ 3KF6B 3RD4A 3CCMA 1TWFB 5LMNQ 2JXMB 2PO4A 1N34L 2AKWB 2CWAA 5FLMG 3CC7A 1YJ9A 3RZOH 4A3LG 5EGTA 3BVMA 2LSSA 3FKIB 2D2CC 4AYBE 1SMYD 1B44D 4JI5Q 4YCWA 5M3MG 2O5JC 4LFBQ 1I50B 1YNXA 4XDXA 4KHZA 3HOYG 3IFTA 2V4DA 1QILA 5A2QL 5LHY1 3OMGA 1JORA 2A74C 5IYCG 3UDFA 5BN4A 3HOXH 3UE1A 3TEHB 3HOWG 3E0EA 4RMFA 2KOLA 4GLXA 1M90C 1QZGA 1DOMA 4HSPA 1HNWQ 2X69A 4JBJA 4DV6L 3E9IA 1HR0L 3HOVH 1ICFB 4HR7B 3BVZA 1F2YA 2KENA 1XNQL 2TMPA 1E2WA 1U4PA 1I4GA 2A69D 2GA4B 2L11A 4DR5Q 4UHVA 3VDYA 1LT3D 1SNQA 3AB9A 4RG1A 2BDNA 2EYFA 5J3BA 1ML0D 4OXPA 1EY8A 4WJ3M 5C3EG 2B63H 1JWMD 1O80A 1WOCA 2LKVA 5IT9c 2K7VA 2DNCA 4BA2I 2K5VA 1L0WA 1VCIA 1WVLA 3G48A 1VQBA 4EQOA 3A8KE 1EYAA 2FXQA 2MJ8A 3RN2A 2VS1A 1NNXA 3M85A 2EIFA 4HJ5A 1A2UA 1K0RA 4ZQ3A 4C3IG 4UP8A 4M1UB 3KJPA 3J81L 2M9VA 3HOUH 4B3SL 3M4PA 5LMNL 1BUVT 3S2DH 1GUNA 2K5QA 1EEFD 5IP9G 5I4DA 1XPUA 1FYCA 1Q46A 3MXGA 1H9SB 2K75A 3U50C 2JA5B 4DK3C 4B3RQ 1GOZA 4HSVA 4A3JG 5K36G 3I4MH 1KNEA 4IFDH 4LFBL 1B9NA 4JI7L 1I3QH 2ZXOA 1CKOA 3MVVA 5AJ3L 2IY5B 3OMCA 1LTSD 1C48A 3VA7A 3I7FA 1V1QA 1N32L 3TS2A 1CKNB 4PMCA 3H0GG 3MA2B 4KI0A 3H94A 1YVCA 4C3HB 4TVAB 4R9WA 5HGQA 2B29A 3KF8B 1TS4A 1TWFH 5J39A 1FNVA 2A6EC 1QCBD 4PZ7A 5G3LF 2PMZE 4BBSG 1I94Q 1L1OB 4WJ4A 4OIJA 1I50H 5C0XH 5CV5A 1I5FA 4L8JA 1EY6A 3T53B 1I4QA 3G6JB 3I90A 1EQRA 1EQVA 4UY8C 4QUCA 3PO3H 3HOUG 4UAIA 2IX1A 3CPFA 1BDOA 2CKZB 2L55A 5H1SE 4CKEA 5EPLA 3C1EA 1PTOF 5DNFA 2PQAA 3I70A 2XWBB 1VQCA 1VQEA 4ME5A 2CFMA 2K52A 5T1GA 1JWSD 1SDFA 4DUYL 5K5PA 2WB1G 3FMCA 1AP0A 1PFSA 4K8JA 1VQKA 2E2IB 1ZYRC 1S4ZA 2BH8A 4QJFA 3T56B 1I4PA 3TREA 2I0QA 1F2MA 1OXXK 1XMOQ 1R4QB 1QWYA 5IYBH 1WD1A 3W2DA 2HIXA 2NYZD 5JJLA 1DYQA 4LFAL 1HUNA 3I73A 2HCIA 3DWAA 1E22A 2OTJA 4HJ7A 1SYDA 1PHJA 4LF6L 1CSPA 2HDLA 1A15A 4RA8A 2Q8RE 4QIWE 3GTLH 4YCVA 4A76A 1ZKOA 2VL6A 2HT1A 4JVZA 4JW0A 1D1KA 2RKSA 4X65Q 3FKIG 2F0HA 4DNTB 3PSIA 1NR4A 2HD3A 3TDQA 1B2TA 2QA4A 2QW7A 2PNHA 2K5WA 4ZRZA 5IWAL 1EYCA 4HMJA 1IYJB 1AZQA 2CH4W 2DJFC 2KHSA 2NWGA 5CORA 3BU2A 1JC7A 1SYCA 2OTLA 1WTOA 1ESFA 1E1TA 1RDPD 3ND9A 4OX9Q 4YHHQ 1HRJA 1SJHD 3SXHA 1IKMA 5IT9E 1SBBB 1CQVA 1I94L 3K6OA 4OO1I 1G6ZA 4DR4Q 1IBLQ 1H9RA 1BR9A 1RD9D 4X62Q 1JCKB 1Y1VH 4IO9A 5IGCA 2RBMA 5C44G 4TSSA 3NHHA 4EGVA 1M8AA 4QGUA 1C4QA 1L0XB 2MUYA 3I4OA 2Q8TA 4DAYA 5CV4A 5EAYA 5JEAH 3T4AC 4DR2L 1MIUA 3KFUA 1VQDA 1EY9A 2YYZA 4IPHA 3J80L 1GXDC 3NELA 4XT1B 4BBRB 5COYA 1VQJA 5ELOA 4G7OC 5JPNC 2MGSA 1EYGA 1T5EA 1GUGA 4A3GH 4XYQA 3U4VA 1XMOL 4B3MQ 3K0XA 3HRZC 2MFIA 3R3OA 4OIKA 1MHWC 1B4OA 3CQZH 4FP5D 4AQYQ 4JI4L 2F0UA 1PH5A 1HA6A 4TQUS 1PXUA 3SVMA 4P71A 4CJ1B 2YV5A 4PG3A 3WOFA 2JA5G 3ZYYX 4A75A 3RZDH 1YZ6A 2RF4A 1DOLA 4K8IA 2WKCA 2Z8LA 4JI2Q 2R7ZH 2ZJPA 2F4VQ 1SLJA 1MSHA 3K81C 2HUGA 4DU9A 1F2ZA 2MPMA 1HPCA 1DM0B 2B3GA 3U4ZA 3VA5A 2XSCA 1PH8A 4IFDJ 1KD1C 2EPBA 3HP3A 4GLVB 3K5MA 1SYEA 1H9JA 3OSOA 1V8QA 4C3HG 1K8GA 3GTJB 1I6HH 4OX9L 4YHHL 2H5XA 5EBDA 4C56C 4DXGA 1B70B 5A35A 1SMYC 2B2UC 1S5DD 3M4QA 1F2LA 3OHXC 2EJMA 1TWGB 2CQOA 4ULLA 5ELFA 1IBLL 4K0KQ 1NMGA 2F4IA 3PO2G 4DA2A 4JBWA 1X3FA 4K5WA 1S40A 3TP5A 2GVAA 5C5MA 2E76C 3ER0A 3AYHB 1K3RA 1Z9FA 1D5XC 1HFNA 4RGNA 1NY4A 5ELDA 3GD7A 3TSSA 1I4HA 5C0XJ 3F2UA 1O7YA 3Q8DA 4ALPA 2Z1CA 2A1AA 3KOJA 4HIDA 1I4RA 1KDBA 3J81j 1RODA 3IRBA 5FJ8H 1GM5A 1Y8NB 3IL8A 2EY5A 3HOZB 2AWNA 3S17B 4DAPA 4DK6C 4K6LA 2KHJA 2OEOA 3PGZA 3MEFA 4KK7A 3GTPB 3S16B 3JC66 3LWEA 2WV6D 3Q0AA 2XNAC 2NBFA 4HTHA 1FR3A 5IIFA 2L12A 4JI6L 3ULPA 1YNNC 1Q12A 4X3TA 1X3PA 2UXDQ 4JI1Q 4IUVA 2KHIA 4R8NA 4JI2L 1R4PB 2KECA 3OTOQ 1HTLD 1NUCA 2AMCB 2M2LA 4JPBW 5JJKA 1RL2A 1Q1EA 1VQFA 5IGFA 3J7A5 1WTQA 2JA8B 1S5ED 2MQHA 2JA7B 3AFPA 2L5TA 3CF5A 1NBWA 5M3MB 4DV0Q 4R4OA 3BYYB 1J5EL 1UNSA 3HOYB 2Q2HA 1MGSA 4JI8Q 1CM9A 1PRTD 1SAPA 1VQ4A 2G9HD 3QIAA 1G51A 4O1NA 4LFCQ 3HOWB 1EU3A 3HEJA 3QOLA 4DR3Q 4HIOA 3T13A 3MEHA 3AQQA 2HCCA 1QB5D 1UE1A 2DY8A 3S1RB 5BN3A 2F0PA 1V43A 4CKCA 1AN8A 3GTJH 4PMBA 2AHOB 3S1MB 4BBRG 3BZDB 5JEAJ 1STGA 4R4TA 2PI2A 3ND8A 2EQSA 4YWLA 3TP6A 4JBKA 1TVXA 1BVSA 3CCRA 4A3EH 1Z6HA 4KMUC 3GTMH 1QG7A 2EYLA 2B39A 2WB1E 1KRTA 3GTOH 3E0JA 1DGSA 1KDAA 1PH9A 3C1FA 1SXTA 1A0IA 1EZ6A 5BR8Q 3I4LA 2KCMA 5IGEA 3FPPA 3CHBD 3CKIB 1PZKD 1TWCH 2I5LX 4BY1H 4FF3A 3H6MA 5D3IB 2QF7A 4V0BA 4S3SA 2HHHL 4P74A 2KJXA 3T1YL 2H4OA 4K6DA 4C3IB 3GTKB 2F0MA 3NQTA 3OTOL 1YHQA 2EYOA 3SGIA 5DM73 4KKTA 4JYAL 3A55A 5I6YA 3S17H 1JQYD 1YHBA 1B8AA 4WORA 3KBXA 3E6ZX 1B3AA 4PQXA 4NXNQ 1FNWA 4DKAC 4OO1H 1GD7A 3NK9A 3S16H 3TP7A 4MTKA 2NZ1D 1WTRA 1HNXQ 4JI8L 4HIMA 4A3CG 1E24A 3PIPA 4XXEA 1D8LA 1JOOA 1FGUA 2K6AA 3DWPA 1RIPA 4ZAIA 4DR3L 3MXUA 1QUQA 2K33A 3L7ZC 1DD2A 1NAPA 3AEVA 2FFKB 3EROA 1DJRD 5FLMH 4UPAA 4XQQA 1TXYA 5C4JB 4A3LH 3GTQB 1IHZA 3KLRA 4CBVA 1V9PA 2LS01 2UXBL 2PQAB 1AEXA 4KN7C 4P2CB 2SOBA 5M3MH 3A74A 1STYA 4HJAA 2NTSA 3HOYH 4MN3A 3A5UA 1KHIA 3I2ZA 4GN3B 5IYCH 1JJGA 1NCVA 1HNZQ 3HOZG 3HOWH 5GAGC 4QUFA 2MNAA 1EZ8A 1KAAA 4J15A 1KC8C 2DGYA 1TWHB 4GOPB 4FF4A 3SDZA 3BZKA 2GN5A 2XGTA 2NN6H 3FDTA 4F88A 4DV1Q 4GNXB 3KJOA 1G8ZD 2L9HA 4LNQA 3UE0A 4GOPC 3BVGA 3S14H 1K8OA 2D62A 3S1RH 1A3UA 5IT9L 4GNXC 3OWEB 1JOQA 3VR5A 3WOEA 3CC4A 2VQEQ 1RCVD 4ZYSA 1AW7A 2QDLA 3Q22A 1C8CA 1FJGL 1EYDA 3NSWA 4IUQA 1JE5A 4RFBA 4XT3B 1YI2A 1H95A 3A56A 4O2DA 1EOVA 3E3XA 1LT6D 2Q8IB 1PFBA 1VQLA 3R8BA 1G291 2DNEA 2ZM6Q 3R93A 1VQ7A 2RQXA 1W6JA 2F0QA 1LTID 2JA8G 1BXTA 3TMEA 5C3EH 2JA7G 2D9UA 3G6EA 4OWWB 3NENA 1STNA 4NXNL 2B2YC 2Z6KC 4LF4L 5EBCA 3I3CA 4FNFA 3GDEA 3I91A 3KYHC 5GROA 5I2YA 5FLXc 4G57A 5M5XB 4I7ZC 2VQFQ 4LF5Q 2QCPX 2CH4A 2K50A 1Y8OB 4JI0L 2R93G 3B6YA 4C3IH 3MHBA 3J80i 4O42A 3HKZB 2NN6G 1LABA 2A6HC 3WWVA 1DXMA 1YJWA 3WDNA 2PPBC 5IP9H 4DAYB 3MTSA 1H9KA 1GUOA 1E0BA 1U4LA 2SNSA 4R1JA 1U5KA 1W2BA 4A3JH 5K36H 1WD0A 2FJ2A 4DN4M 5JVG3 3DEPA 5C44B 1BCPD 1B7YB 1KAWA 3STBD 1MJEA 1VQ5A 1VQOA 4A3IB 1A3VA 4JI3Q 1CT1D 4Y7NB 3K5LA 3D4RA 1N36L 1LTRD 3MWYW 3I56A 1HNZL 2FMMA 2F0TA 3H0GH 1EQQA 2BE5C 1C9OA 3DM3A 2E75C 4H0LC 4NW2A 1IBKQ 2N88A 2CCZA 3CCUA 1CHPD 4BBSH 4JG2A 4N8FA 2F3IA 4BA1I 3GTQH 2F03A 3QOJA 2NUCA 1D7QA 3NE5B 1EY7A 2IHEA 2YTYA 4NKLA 4N9PA 1EIFA 1YNJD 2B8FA 3JAMc 1E2ZA 4ILWA 1TY2A 2Y0SB 2OQKA 4E6IA 5E4XA 2L15A 3RR5A 2DN8A 5IODA 1LTBD 4XQJA 4X64Q 4KKSA 2A73B 1SR3A 1JJ2A 3DHQA 4CGYB 1YBYA 1BNZA 2QEXA 1G2SA 1STEA 4JI5L 5M9OA 1PVOA 1HZAA 5M5YB 1RF2D 4YWKA 4NDXA 4DV5Q 3X3NA 4MHEA 4IALA 2Z6BA 2IT1A 1HCZA 1PH4A 4YIJA 4LF5L 3HGBA 4ZK9B 1IW7C 4CDFC 1VQAA 2JA6G 5KNBA 4IQZA 2PNRC 2JK8A 1VQNA 1PRTB 2B2TA 2ZXRA 1W3SA 4KJNA 1HNWL 4HEDA 1RTOA 5ISRA 4R8IA 4R4QA 1C0AA 5EPKA 3SK4A 1CA6A 3FKIH 2D0OA 3QWNA 1PRTC 1KLUD 1NJIC 3PO2B 5HY6A 4C3JB 5IOCA 1X54A 3CCEA 1L1OC 1SJED 2MHVA 2R92B 3R2IA 1W6KA 4JI3L 2PW5A 2F52A 4DR5L 1STAA 3W1BA 2JN4A 4GN4B 5FO7B 2EXDA 3Q24A 3K8AA 4DGZA 3U58A 1PH6A 2F0JA 1Y8PB 4NMZA 2EY1A 2VB2X 5KIXA 4AIMA 4OL7A 4HN7A 4POFA 3H09A 1MD2D 2WACA 2N8NA 2FHTA 1SMXA 4P72A 5C44H 3QJYA 2QKIC 5DLQE 1STHA 5FLXE 1QVCA 2SDFA 2CW0D 4EVOA 1HQRD 4BY7G 1YITA 3D6CA 3E9HA 1YJNA 1UEBA 4H44C 4L63B 3VYUA 1UWVA 4DUZQ 1WI5A 3J81c 4B3RL 2F3WA 1PDQA 1I6VC 4DR6Q 1VQPA 2R6GA 4K2LA 4Q5VA 3VYSA 1X55A 1AE2A 2L0CA 4DV5L 4P75A 3AFQA 1X65A 3V05A 3A54A 4C2MB 4YY3Q 1TR5A 3GTGB 1Q86C 2DY7A 2RA4A 4RHRA 5DAUA 3V2TA 2UXCQ 4U68A 1LYLA 1NSNS 3CD6A 2K05A 1E1OA 3HKZG 3KDFA 3DLLA 1HZBA 1QJOA 2IL8A 4XYOA 2UUBQ 5AFWA 2K4KA 2L1BA 1JOKA 3L2PA 5D3DA 2JA5H 3EA6A 3KF6A 4RWSC 2B2YA 3SK5A 1S5CD 5M5YH 2TSSA 2F0EA 2ZJQA 2RDGA 3UI2A 4J6HA 1X3EA 4A3IG 1XJVA 2E74C 3F2CA 4QF4A 4KHPQ 4A4IA 3JAME 4PNYA 5I6WA 2XRQD 5ELCA 3FEWX 1XXGA 2A5HA 1KL9A 1FD7D 2SNMA 3CPWA 4QY7A 4C3HH 1EY4A 2E2JB 2NB0A 5EPJA 1EWIA 2B2VC 5C4XB 1VDZA 1D6EC 4K5VA 3TRZA 4EQPA 3R2TA 3CRKC 1VQ8A 1F77A 3PIP3 1EFID 2UU9Q 4HCEA 3PO2H 2L4NA 4C3JH 1AZPA 4H7BA 3K58A 3P7JA 3NQIA 1UE6A 4LF7Q 2Y0SG 2MO0A 4DV3Q 2E2DC 4LJZC 3NTHA 3FP9A 2A19A 2NN6I 1VQHA 3A0JA 2M00A 2F0SA 4P73A 2Z4HA 2IWHA 3J7YW 4A93B 4BXXG 2EOTA 1D5ZC 4FXGC 4X65L 1KNAA 5FKAC 1X3QA 4DR6L 1GUWA 4MTNA 2E2IH 2E5LQ 4PZ6A 2ATWA 2B2WC 3RUZA 2EY2A 2N3SA 4I65A 1A3TA 3IFDA 2KVMA 1VF7A 3A7LA 2ASBA 2KA7A 1OXTA 4X66Q 3OYYA 4Y52H 1MSGA 4A3DB 3QB3A 3K57A 3ITPA 2Q2IA 1XTDA 2PYKA 3RNUA 3NWTA 1LT4D 1GO3E 1Z47A 1I4XA 4C1NI 5IGBA 1BF4A 1LACA 1DOKA 4LUOA 4KY5A 3MXPA 2JQOA 1S3OA 3EBEA 4DR4L 4POGA 1PLFA 2O5IC 5J22A 1LTGD 4A3FB 4X62L 2F0GA 2IX0A 4C3JG 2N49A 1RTNA 1YHAA 2R92G 4JK1C 4DV7Q 2JP1A 4C2MH 4IOCA 2OCEA 3K5NA 3NTKA 1A8VA 1BKBA 2EY6A 1V1PA 3CCJA 3UDGA 1BCPB 2F0DA 4RH6A 1CKNA 5D14A 1PA6A 3J7AV 2PCFB 5GQOA 3TZDA 1JWUD 4HAEA 2E2HB 2GVBA 1K83B 2ALYB 3J81E 1EFWA 1PH7A 2EJFC 2F0OA 4RCOA 3T16A 3E5SA 3S15B 2A69C 4QMGA 3SK8A 4C1NK 1Y1WB 4B3ML 1EL0A 3QR8A 3DM1A 2IX3A 1SE8A 1X56A 4B08A 1P16A 4LF7L 4DV3L 4AQYL 4K2KA 2EXZA 2K5HA 2UUAQ 4K5XA 3IAYA 2KUMA 1LT5D 4IUUA 4DR1Q 3K7AB 4FDBA 1XPOA 4OHJA 3F1ZA 4RGMA 4BBRH 4FF2A 2K5NA 4A3BB 3I72A 4JV5Q 2K5DA 3S9WA 2MP1A 2E5LL 1OXSC 5C4HA 3S1QB 2XN9C 4RGTA 4M8AA 1NE3A 2F4VL 3A8JE 2Q2UA 2NTTA 4LF8Q 3PUXA 5ELNA 3M7GA 1BO0A 3PUWA 3IKJA 2ZJRA 1UEAB 4ZKBB 1KTKA 3GV3A 5E4WC 3SE0A 2YTXA 3PIOA 5LMUQ 1PH2A 3H3VI 2XWJB 5CV6A 3MC0B 3L0OA 4K14A 1EIGA 4DK0A 5M5WB 3CAMA 3V96A 2WINB 4KLKA 3G71A 2YTVA 1XNRQ 3CCQA 2KEEA 3OWFA 3MZ5A 1N33Q 1SYGA 3P75A 4K0KL 1KXLA 1HH2P 5I9PA 4U673 4WRDA 3SEBA 2G5DA 2RSOA 1WTWA 2R93B 3CC2A 5FO9B 4B3TQ 5GAHC 2A6ED 2JE6I 2ID0A 2VUMB 1MKHA 5L37A 1CI3M 3N52A 5C4XG 1Q82C 2X6GA 2XIWA 1F9PA 3DWQA 3M7NA 4A3CH 2VW9A 5C3XA 1TWGH 1LV9A 5E3FA 4A3FH 5G3LD 3U9OA 1DONA 3A5ZB 4NB3A 4QL5A 2I5HA 3CMEA 3CCSA 1G91A 2PW7A 1ZEQX 1F9QA 1HJPA 1SE4A 4LAAA 5CGKA 1ZYRD 2EYHA 3RLOA 4A3KB 1OTCA 1EIHA 1IBMQ 4HMIA 1UUPA 2UUCQ 4LF9Q 4DR1L 1OO9B 4A93G 2KBNA 1MI2A 4JBMA 2EE1A 1WTPA 1PTOD 2F0LA 2UXDL 4KTAA 4JI1L 3TN2A 1XX8A 5KNDA 3HOZH 1GHKA 2CW0C 3LNNA 3NP8A 1Q7YC 4X3UA 5IYDG 2JEAI 1TKWB 1VQGA 1EY0A 4Z9CB 1UAPA 3W3AA 4A3DG 2ES2A 4G7ZC 4DNIA 1U9RA 4A3MG 4I7AA 4DV0L 3HOXB 3BG3A 3GTPH 2YU9B 4IZ8A 4GN5A 4GKJQ 3RMHA 4Q0FA 1ENFA 3A7AB 1SNPA 1TIID 3VR6A 2EYMA 3C2PA 4DV2Q 2XVSA 3URYA 2AUKA 2F0KA 4KKUA 4A3FG 3ICEA 4A3BH 1IXRA 4LFCL 5KRUA 1X6OA 3HKZE 2FINB 2JA6B 2D0PA 2RDHA 3S1QH 1II3A 3CU7A 1XMQQ 2E8GA 3L9AX 1Z7TA 1FVIA 2G9DA 4KY7A 3OOCA 2K1BA 4EQNA 2JA8H 3BDOA 4AH6A 2JA7H 3CMAA 2VNUD 5CC4A 3D8GA 2Z4IA 4ZLTF 5ELBA 1PH3A 1AH9A 4FXKC 5KGUA 2N78A 4L5TA 1CA5A 3T51B 2I5MX 4ZUJA 2B2UA 1ASYA 1K28A 1F9RA 3ONAB 4F87A 5J1ZA 4TKOB 3NBHA 3H15A 2B63B 1Q1BA 3U9SA 4H13C 4JC0A 2F0FA 2KCNA 2WAQB 5JVH3 1YIJA 1JB3A 1ZXTA 3K80C 1STBA 3VYRA 1Y1WG 1KIXA 4DV6Q 2R93H 4LWCA 1HR0Q 4RAUC 3RLNA 1ESRA 3H3VC 1L2FA 1PH1A 2OF1A 4DNRB 2R3ZA 5BR8L 1TU2B 3CXCA 3D3RA 2UUCL 4LF9L 1WFQA 2ENBA 2VB3X 3MFGA 4KD4A 1WTXA 2Y0SE 3NUCA 5DEHA 3S1MH 3D6WA 4A3BG 3S2DB 1A6XA 4OWXB 1CHQD 2WIIB 4BY7B 4J8QA 2R7FA 2LXJA 1ET6A 1RHPA 4UDUC 1EQTA 5C3WA 1PFNA 5CBAE 4G7HC 1I3QB 2MO1A 4N9TA 4BS9A 5BN5A 3GP7A 3FRPB 4QCLA 2KEDA 4HCSA 4JCVE 3KDFB 1UE7A 3SHLA 3P1HA 3NBIA 1HNXL 2O2LD 3N6RA 2NVXB 1E3PA 4DV2L 3PUZA 5T1IA 4IPGA 1U4RA 2PQEA 4CJ0B 5FOBB 3GTKH 4TRDA 4CHTB 1XMQL 1J6QA 4KHVA 3NPPA 1PZID 1PMRA 3SK6A 1WCMG 4JI7Q 2VUMG 2WFWA 5AJ3Q 1VMPA 1JICA 1N32Q 2J0TD 2QEJC 2YU9H 3PO3B 3CW2C 4G4KA 4IJHA 1SEBD 1SFOB 3O13A 1XYIA 4RHSA 4BWGB 3J7AF 1SE2A 3C46A 2XTIA 2JA6H 3I4NG 2NVQB 2OWOA 2K28A 1Q90A 1OXUA 2LXKA 4DV1L 1BOSA 4OONA 1EOTA 2EYPA 5M3FG 5C4JH 3ERQA 4A3KG 2RCNA 2KCTA 4DAMA 1D2BA 5TSSA 1HHVA 1SSOA 3OW2A 5DM63 1CSQA 1WTHA 4NXMQ 2F0VA 2LFNA 2VQEL 4DFAA 3PF5A 4MIUA 1GKHA 4MZ9A 2ICIA 3GTLB 3A8IE 2IW3A 3NWSA 3TP8A 2QILA 4ZUIA 1K0SA 4DUYQ 3KBGA 2Z0SA 5I9OA 3NXWA 1SYFA 2AQ3B 4FVMA 3H3VH 2C9OA 1TWHH 2ZM6L 1K73C 5GADC 1YNND 1CKMA 4V190 2NVYB 4UP7A 1C7YA 3HOXG 4LFAQ 4GZYC 2IHFA 1Q3LA 1IZ6A 1CTMA 1SNCA 1LTAD 3TS0A 1PYSB 1PRTF 2R7DA 3BDCA 4QQBX 4LF6Q 4HJ8A 2VQFL 1CK1A 3ULJA 1KDCA 5FK9C 4BY7H 3S2HB 3HOVG 4IPCA 1QNUA 1TY0A 1IL8A 1Y1VB 2K14A 3PCOB 2C35B 1SE3A 3L3OC 4AYBB 5LL6S 2XRSD 1OXVA 5IWAQ 4WFN3 1V1PB 3DMUA 3DEOA 4L5RC 2PI2E 3KLWA 3ERSX 2HQEA 5IP7H 3MAQA 2NVXH 2B63G 4LUZA 5M5XH 3PUYA 1M4VA 1UE5A 4RKBA 3EJIA 2SEBD 2X6LA 2WAQG 1JE4A 2K03A 3MXNA 1KLGD 3PIO3 1IBKL 4A3GB 1K3BC 1ONLA 4JOIC 4YWMA 1LM0A 2NVTB 3Q6SA 4ZCKA 2ZTCA 3CQZB 4L5SA 5IGDA 2RCFA 5ELEA 4NXML 2F1MA 4DR2Q 3NEMA 1SFOH 4A3IH 1O78A 4Y7NH 2J4XA 4CDEC 3RZDB 3X3MA 3I4MG 2PZUA 4X64L 4IFDG 4RGOS 1EIYB 3LGJA 2R7ZB 1B9MA 2NVQH 1QVFA 1PTOB 4OEMB 1Q8KA 2BDOA 1DCZA 3TQYA 3ULLA 1HXYD 4GOPA 1HFGA 1PTOC 3I55A 3D4DA 4GNXA 4JI4Q 5IP7G 1AFPA 1I6HB 5EKKA 3EIVA 1S5BD 2O4XA 3S24A 3F2DA 1D5MC 1SYBA 1BBWA 4DAVA 1HZ9A 4OGQC 4DR7Q 1HZCA 4R4CA 4N8X1 5C0XG 1WJJA 3EFXD 3HZXA 4BXXH 4B9WA 1BBXC 1EY5A 2NVYH 1SRUA 2CQAA 2Z6KA 4DPGA 1JR0D 3PO3G 1CUKA 1E2VA 5JJZA 4GKKQ 4RKLA
chains in the Genus database with same CATH topology
1XPOA 1L0WA 3AEVA 1HR0W 1VCIA 3F1ZA 3G48A 1VQBA 4BBRH 5FLMH 2K5NA 2FXQA 3F2BA 4OWTB 4UPAA 3RN2A 4JV5Q 1TXYA 2VS1A 4A3LH 3M85A 1V9PA 2EIFA 2E5LL 1OXSC 4HJ5A 1N8RC 1A63A 2F4VL 1NE3A 1K0RA 2Q2UA 2PQAB 2UXBL 4UP8A 4LF8Q 3PUXA 5ELNA 3KJPA 3S2HH 5M3MH 3A74A 4B3SL 3HOUH 3PUWA 4HJAA 3M4PA 2ZJRA 5LMNL 3HOYH 3S2DH 5IYBG 3A5UA 1KHIA 3I2ZA 5IP9G 4GN3B 1XPUA 1X9NA 2YTXA 5IYCH 1Q46A 3PIOA 1X3GA 5LMUQ 1JJGA 1PH2A 2K75A 3U50C 3H3VI 4DK3C 4B3RQ 1HNZQ 3HOZG 2A8VA 4A3JG 5K36G 3HOWH 5GAGC 2MNAA 3I4MH 3L0OA 4J15A 4LFBL 1KC8C 2DGYA 4JI7L 1I3QH 4GOPB 1CKOA 3CAMA 3G71A 4KLKA 2R92H 3BZKA 2YTVA 5AJ3L 2IY5B 2GN5A 3CCQA 2XGTA 1XNRQ 3I7FA 4DV1Q 4GNXB 1V1QA 1N33Q 1N32L 1KXLA 4K0KL 3KJOA 1HH2P 3TS2A 1CKNB 4LNQA 3UE0A 4GOPC 3H0GG 4KI0A 3S14H 3CC2A 3BZCA 2D62A 3CCLA 4B3TQ 3S1RH 1YVCA 5GAHC 3UDIA 4TVAB 4DUZL 4GNXC 5HGQA 2B29A 2HIVA 2JE6I 1TWFH 3KF8B 2ID0A 2VQEQ 1VQIA 3CC4A 1FJGL 4NPSA 4PZ7A 2PMZE 1JE5A 2NVTH 4BBSG 5LMNW 1I94Q 1MKHA 1L1OB 1YI2A 1VQ9A 4WJ4A 1H95A 4O2DA 1EOVA 5IE8A 1JB7A 1VQLA 5C4XG 1I50H 1Q82C 1G291 1PV4A 2ZM6Q 1I5FA 1VQ7A 4YY3L 2JA8G 3M7NA 5C3EH 4A3CH 2JA7G 4IJLA 3G6EA 1QUQB 4OWWB 3NENA 4JI6Q 2VW9A 2UXCL 4NXNL 1TWGH 4A3FH 4DR7L 1EQRA 4UY8C 2Z6KC 3PO3H 3A5ZB 4NB3A 4QL5A 4LF4L 1AE3A 1Y1VG 2I5HA 2V1CC 3CPFA 2IX1A 2CKZB 5H1SE 2UUBL 3GDEA 3CMEA 3CCSA 4AYBG 3KYHC 2PQAA 5GROA 5FLXc 1VQCA 1HJPA 1VQEA 2CFMA 2K52A 3T1HQ 4DUYL 2WB1G 3RLOA 2VQFQ 1KQSA 4LF5Q 2K50A 1OTCA 1PFSA 5JEAG 1VQKA 1IBMQ 3W1GA 2UUCQ 4JI0L 3B6YA 4C3IH 2BH8A 4QJFA 4DR1L 4LF9Q 4GKKL 2R93G 3J80i 3TREA 2I0QA 3NBHB 1OXXK 4A93G 2KBNA 4GS3A 1XMOQ 2NN6G 4JBMA 1J5EQ 3WWVA 4KHPL 5IYBH 1SN8A 1YJWA 2HIXA 1GVPA 5IP9H 1IL2A 4DAYB 4LFAL 3GTGH 2UXDL 1P8LA 5JJLA 2DUDA 4JI1L 4R1JA 1U5KA 1E22A 2AWOA 2OTJA 4HJ7A 1W2BA 3HOZH 4A3JH 2VY3A 4A3GG 1PHJA 4LF6L 1CSPA 1JJCB 3CP0A 1Q7YC 2JEAI 3F8TA 4QIWE 5IYDG 1B7YB 1VQGA 4YCVA 1KAWA 3STBD 4A76A 1MJEA 2VL6A 1VQOA 1VQ5A 2HT1A 4A3DG 2ES2A 4JI3Q 4DNIA 3K7UC 3PV0A 4X65Q 3FKIG 4A3MG 1N36L 2UU9L 3STBC 3J80c 3I56A 1HNZL 3PSIA 4DV0L 3GTPH 3JAMi 2CWPA 4GN5A 3H0GH 4GKJQ 2RHSB 2QA4A 1EQQA 1K9MC 1L1OA 1C9OA 3DM3A 1PYBA 2PNHA 4IOAA 4DV2Q 1IBKQ 1E7ZA 5IWAL 4A3FG 2CCZA 3ICEA 4A3BH 1IXRA 4LFCL 3CCUA 1X6OA 3RLFA 4BBSH 3HKZE 4JG2A 3GTQH 1IYJB 2F3IA 4BA1I 2D0PA 3S1QH 1D7QA 2R7ZG 1XMQQ 3BU2A 2E2JH 2E8GA 1O7IA 1FVIA 1SROA 1E1TA 2IHEA 2YTYA 2ZTDA 1WYDA 4JOIA 5C4XH 4YHHQ 1ASZA 4OX9Q 1EIFA 4PZ8A 2JA8H 3JAMc 4AH6A 2JA7H 3CMAA 2VNUD 1LUZA 1I94L 4OO1I 2OQKA 2JEBI 2NZOA 4DR4Q 3W5OA 1PH3A 1AH9A 2L15A 1IBLQ 3RR5A 4HJ9A 4X62Q 4APVA 1Y1VH 2N78A 4L5TA 4IO9A 4X64Q 1JMCA 2I5MX 5C44G 1SR3A 1ASYA 3D31A 4X66L 1JJ2A 1KRSA 4QGUA 3H15A 1YBYA 1Q1BA 1NMFA 2RHQB 4EQ5A 2QEXA 4JC0A 4JI5L 1YIJA 2HHHQ 3I4OA 1HZAA 1PVOA 3K80C 5EAYA 3T1YQ 1Y1WG 1R9TH 1KIXA 4YWKA 4DV6Q 4XIGS 4LWCA 4DR2L 4DV5Q 1HR0Q 1MIUA 2R93H 3KFUA 1VQDA 1QVGA 1S72A 4A93H 3EN2A 3GO5A 3RLNA 2YYZA 4IPHA 4LUVA 3T1HL 2OTLA 3NELA 2IT1A 1L2FA 4JYAQ 1PH1A 2VZAA 3HFZB 1PH4A 4LF5L 5BR8L 1VQMA 3D0FA 1VQJA 5ELOA 3CXCA 2JA6G 1MJCA 1VQAA 2UUCL 1WFQA 1YEZA 1EYGA 4LF9L 4A3GH 3U4VA 1VS0A 2JK8A 4DV4Q 1XMOL 2Y0SE 4B3MQ 1VQNA 5JJIA 3S1MH 4DV7L 2HQLA 3K0XA 4A3BG 1W3SA 5IYDH 4OWXB 3UDXA 1HNWL 2MFIA 4LW1A 4R4QA 4A3DH 1C0AA 5FJ8G 3CQZH 4A3MH 3FKIH 4IFDI 4AQYQ 2D0OA 2R7FA 2LXJA 1NJIC 4JI4L 3S1NH 1PH5A 5HY6A 3PUVA 4TQUS 3J7ZC 1X54A 3CCEA 1L1OC 4P71A 2MO1A 2Q2TA 2WAQE 1K8AC 2YV5A 4PG3A 4JI3L 2F52A 4DR5L 4ME3A 2JA5G 4A75A 1A62A 1YZ6A 3RZDH 2RF4A 4JCVE 3KDFB 1UE7A 3W1BA 4GN4B 4YCUA 4JI2Q 3CCVA 1HNXL 2ZJPA 2F4VQ 2R7ZH 2UXBQ 2EXDA 1SLJA 3K8AA 3U58A 1E3PA 4DV2L 3PUZA 1PH6A 3K81C 5GAEC 2WP8J 4IPGA 2UUAL 3U4ZA 1PH8A 2B3GA 4IFDJ 1KD1C 4AIMA 2OQ0A 4GLVB 3GTKH 1M1KC 3J81i 1XMQL 1FL0A 4POFA 5C0XI 3M4OH 1J6QA 2N8NA 1K8GA 1I6HH 1SMXA 4OX9L 4P72A 1WCMG 5C44H 2H5XA 4YHHL 5DLQE 1B70B 4JI7Q 4JV5L 4MNOA 2VUMG 1BBUA 2E2HH 1QVCA 3M4QA 1K83H 2ZTEA 2WFWA 5AJ3Q 1Q81C 4BY7G 1YITA 4LF8L 2CQOA 1IBLL 3S15H 4K0KQ 3E9HA 1N32Q 1NMGA 1Y1WH 2YU9H 3PO2G 1YJNA 4JBWA 1UEBA 3ZJYC 1X3FA 3CW2C 3M3YH 1G6PA 4IJHA 1S40A 1N9WA 2GVAA 2QGQA 1UWVA 4DUZQ 5LMUL 3ER0A 1WI5A 1K3RA 1Z9FA 3AYHB 3J81c 4B3RL 3M9BA 1U0LA 1FJGQ 4DR6Q 1VQPA 2XTIA 1NY4A 2R6GA 4XTCS 5IY0A 3GD7A 1LTLA 5C0XJ 2JA6H 3I4NG 2JJQA 1X55A 1AE2A 3K7AH 4DV5L 4P75A 3BJUA 3AFQA 2OWOA 1X65A 3Q8DA 4ALPA 1XNRL 1OXUA 2LXKA 4DV1L 1N33L 4OONA 1JT8A 1N34Q 1TWAH 2A1AA 3KOJA 4HIDA 5M3FG 4YY3Q 5C4JH 3J81j 4A3KG 5FJ8H 2RCNA 2KCTA 3IRBA 1Q86C 1GM5A 4DAMA 4B3TL 2UXCQ 1LYLA 3OW2A 3CD6A 1E1OA 1CSQA 3HKZG 4NXMQ 3KDFA 3DLLA 4DV4L 4LF4Q 2VQEL 1HZBA 2AWNA 2UUBQ 3PF5A 1GKHA 2K4KA 4MZ9A 4DK6C 4L5QA 2KHJA 3MXNB 3L2PA 2JA5H 3KF6A 3RN5A 5E7NA 3PGZA 4DUYQ 3MEFA 3FHWA 2Z0SA 5M5YH 4A3EG 3H3VH 3JC66 2BH2A 1EUJA 2ZJQA 2BA0A 1TWHH 2ZM6L 4JI0Q 5M5WH 1K73C 5GADC 1X3EA 4A3IG 1CKMA 1XJVA 4JI6L 3GTLH 4UP7A 3F2CA 1C7YA 4KHPQ 4A4IA 3HKSA 3ULPA 1NTGA 3HOXG 1Q12A 4LFAQ 2UXDQ 2IHFA 4JI1Q 1IZ6A 1KL9A 2KHIA 4JI2L 3CPWA 3TS0A 3OTOQ 2AMCB 4QY7A 4C3HH 1PYSB 5JJKA 2R7DA 4QQBX 1RL2A 1EWIA 4BY1G 4LF6Q 1WCMH 1Q1EA 1VQFA 2JA9A 4PMWA 4HJ8A 1XNQQ 3TRZA 2VQFL 2VUMH 3J7A5 3G4SA 3ULJA 4EX5A 1VQ8A 2MQHA 1IBML 4BY7H 3AFPA 1T9HA 3CF5A 1N36Q 2UU9Q 1NBWA 3HOVG 1QZHA 4IPCA 4DV0Q 3PO2H 4R4OA 1J5EL 2K14A 4C3JH 2BA1A 3PCOB 2Q2HA 2C35B 3HOUG 4JI8Q 4UP9A 4HIKA 1VQ4A 4LF7Q 1UE6A 2Y0SG 2MO0A 1OXVA 4DV3Q 4X6AH 5IWAQ 1G51A 1XPRA 4LFCQ 4H02A 4OO1G 4L5RC 2PI2E 2NZHA 4DR3Q 3FP9A 3KLWA 2A19A 4HIOA 3I4NH 3ERSX 2NN6I 1VQHA 3A0JA 4O0AA 4IPDA 4P73A 2NVXH 5IP7H 4BXXG 2B63G 1VQ6A 4X65L 4LUZA 5M5XH 3PUYA 1UE5A 3AQQA 5M3FH 2WAQG 4DR6L 1Y14B 4A3KH 4MTNA 4R4IA 4GKJL 2E2IH 2E5LQ 4PZ6A 1UE1A 4GLAC 2ATWA 3PF4A 2N3SA 1IBKL 1V43A 4B3SQ 3KF6B 3GTJH 2AHOB 4JOIC 4YWMA 3CCMA 5LMNQ 1N34L 2ASBA 4BBRG 2AKWB 2CWAA 5FLMG 1LM0A 3CC7A 1OXTA 1YJ9A 3RZOH 4X66Q 3OYYA 4A3LG 4Y52H 5JEAJ 4R4TA 2PI2A 2LSSA 2ZTCA 2EQSA 4YWLA 2Q2IA 4JBKA 1XTDA 4L5SA 4AYBE 3RNUA 1BVSA 3CCRA 4JI5Q 1Z47A 1GO3E 4YCWA 5M3MG 4A3EH 4NXML 4LFBQ 1YNXA 4DR2Q 4KHZA 3GTMH 3HOYG 4LUOA 3NEMA 2WB1E 1KRTA 2JQOA 1SFOH 3GTOH 4A3IH 1S3OA 3EBEA 4DR4L 5IYCG 3UDFA 4Y7NH 4POGA 1DGSA 1PH9A 3HOXH 3UE1A 4X62L 3TEHB 3HOWG 3I4MG 1A0IA 2IX0A 3E0EA 2N49A 4RMFA 5BR8Q 4X64L 2KCMA 4IFDG 4GLXA 1EIYB 3LGJA 1YHAA 2NVQH 1M90C 1QVFA 2R92G 1TWCH 2I5LX 4BY1H 1Q8KA 4DV7Q 3TQYA 1QZGA 3ULLA 2HHHL 4P74A 4C2MH 4GOPA 3T1YL 1HNWQ 4JBJA 4IOCA 4DV6L 2OCEA 3E9IA 1HR0L 3I55A 1A8VA 1BKBA 3OTOL 4GNXA 5IP7G 4JI4Q 3HOVH 1YHQA 3CCJA 3UDGA 1CKNA 3SGIA 1PA6A 5GQOA 3EIVA 2KENA 1XNQL 4JYAL 3S24A 3S17H 3F2DA 1YHBA 1B8AA 2GVBA 2ALYB 1BBWA 1EFWA 4DR5Q 1HZ9A 1PH7A 3VDYA 4NXNQ 4DR7Q 4DKAC 1HZCA 4R4CA 1GD7A 4B3ML 4RG1A 3S16H 5C0XG 5J3BA 4OXPA 1WJJA 1SE8A 1X56A 1HNXQ 4JI8L 4WJ3M 4HIMA 1P16A 4LF7L 5C3EG 1E24A 4BXXH 2B63H 3PIPA 1WOCA 5IT9c 4A3CG 2NVYH 4DV3L 1SRUA 4AQYL 1D8LA 1FGUA 2K5HA 2Z6KA 4DPGA 4BA2I 2UUAQ 1RIPA 2K5VA 3PO3G 4DR3L 1CUKA 4GKKQ 4DR1Q 1QUQA 3L7ZC 4FDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPO A;  1L0W A;  3AEV A;  1HR0 W;  1VCI A;  3F1Z A;  3G48 A;  1VQB A;  4BBR H;  5FLM H;  2K5N A;  2FXQ A;  3F2B A;  4OWT B;  4UPA A;  3RN2 A;  4JV5 Q;  1TXY A;  2VS1 A;  4A3L H;  3M85 A;  1V9P A;  2EIF A;  2E5L L;  1OXS C;  4HJ5 A;  1N8R C;  1A63 A;  2F4V L;  1NE3 A;  1K0R A;  2Q2U A;  2PQA B;  2UXB L;  4UP8 A;  4LF8 Q;  3PUX A;  5ELN A;  3KJP A;  3S2H H;  5M3M H;  3A74 A;  4B3S L;  3HOU H;  3PUW A;  4HJA A;  3M4P A;  2ZJR A;  5LMN L;  3HOY H;  3S2D H;  5IYB G;  3A5U A;  1KHI A;  3I2Z A;  5IP9 G;  4GN3 B;  1XPU A;  1X9N A;  2YTX A;  5IYC H;  1Q46 A;  3PIO A;  1X3G A;  5LMU Q;  1JJG A;  1PH2 A;  2K75 A;  3U50 C;  3H3V I;  4DK3 C;  4B3R Q;  1HNZ Q;  3HOZ G;  2A8V A;  4A3J G;  5K36 G;  3HOW H;  5GAG C;  2MNA A;  3I4M H;  3L0O A;  4J15 A;  4LFB L;  1KC8 C;  2DGY A;  4JI7 L;  1I3Q H;  4GOP B;  1CKO A;  3CAM A;  3G71 A;  4KLK A;  2R92 H;  3BZK A;  2YTV A;  5AJ3 L;  2IY5 B;  2GN5 A;  3CCQ A;  2XGT A;  1XNR Q;  3I7F A;  4DV1 Q;  4GNX B;  1V1Q A;  1N33 Q;  1N32 L;  1KXL A;  4K0K L;  3KJO A;  1HH2 P;  3TS2 A;  1CKN B;  4LNQ A;  3UE0 A;  4GOP C;  3H0G G;  4KI0 A;  3S14 H;  3CC2 A;  3BZC A;  2D62 A;  3CCL A;  4B3T Q;  3S1R H;  1YVC A;  5GAH C;  3UDI A;  4TVA B;  4DUZ L;  4GNX C;  5HGQ A;  2B29 A;  2HIV A;  2JE6 I;  1TWF H;  3KF8 B;  2ID0 A;  2VQE Q;  1VQI A;  3CC4 A;  1FJG L;  4NPS A;  4PZ7 A;  2PMZ E;  1JE5 A;  2NVT H;  4BBS G;  5LMN W;  1I94 Q;  1MKH A;  1L1O B;  1YI2 A;  1VQ9 A;  4WJ4 A;  1H95 A;  4O2D A;  1EOV A;  5IE8 A;  1JB7 A;  1VQL A;  5C4X G;  1I50 H;  1Q82 C;  1G29 1;  1PV4 A;  2ZM6 Q;  1I5F A;  1VQ7 A;  4YY3 L;  2JA8 G;  3M7N A;  5C3E H;  4A3C H;  2JA7 G;  4IJL A;  3G6E A;  1QUQ B;  4OWW B;  3NEN A;  4JI6 Q;  2VW9 A;  2UXC L;  4NXN L;  1TWG H;  4A3F H;  4DR7 L;  1EQR A;  4UY8 C;  2Z6K C;  3PO3 H;  3A5Z B;  4NB3 A;  4QL5 A;  4LF4 L;  1AE3 A;  1Y1V G;  2I5H A;  2V1C C;  3CPF A;  2IX1 A;  2CKZ B;  5H1S E;  2UUB L;  3GDE A;  3CME A;  3CCS A;  4AYB G;  3KYH C;  2PQA A;  5GRO A;  5FLX c;  1VQC A;  1HJP A;  1VQE A;  2CFM A;  2K52 A;  3T1H Q;  4DUY L;  2WB1 G;  3RLO A;  2VQF Q;  1KQS A;  4LF5 Q;  2K50 A;  1OTC A;  1PFS A;  5JEA G;  1VQK A;  1IBM Q;  3W1G A;  2UUC Q;  4JI0 L;  3B6Y A;  4C3I H;  2BH8 A;  4QJF A;  4DR1 L;  4LF9 Q;  4GKK L;  2R93 G;  3J80 i;  3TRE A;  2I0Q A;  3NBH B;  1OXX K;  4A93 G;  2KBN A;  4GS3 A;  1XMO Q;  2NN6 G;  4JBM A;  1J5E Q;  3WWV A;  4KHP L;  5IYB H;  1SN8 A;  1YJW A;  2HIX A;  1GVP A;  5IP9 H;  1IL2 A;  4DAY B;  4LFA L;  3GTG H;  2UXD L;  1P8L A;  5JJL A;  2DUD A;  4JI1 L;  4R1J A;  1U5K A;  1E22 A;  2AWO A;  2OTJ A;  4HJ7 A;  1W2B A;  3HOZ H;  4A3J H;  2VY3 A;  4A3G G;  1PHJ A;  4LF6 L;  1CSP A;  1JJC B;  3CP0 A;  1Q7Y C;  2JEA I;  3F8T A;  4QIW E;  5IYD G;  1B7Y B;  1VQG A;  4YCV A;  1KAW A;  3STB D;  4A76 A;  1MJE A;  2VL6 A;  1VQO A;  1VQ5 A;  2HT1 A;  4A3D G;  2ES2 A;  4JI3 Q;  4DNI A;  3K7U C;  3PV0 A;  4X65 Q;  3FKI G;  4A3M G;  1N36 L;  2UU9 L;  3STB C;  3J80 c;  3I56 A;  1HNZ L;  3PSI A;  4DV0 L;  3GTP H;  3JAM i;  2CWP A;  4GN5 A;  3H0G H;  4GKJ Q;  2RHS B;  2QA4 A;  1EQQ A;  1K9M C;  1L1O A;  1C9O A;  3DM3 A;  1PYB A;  2PNH A;  4IOA A;  4DV2 Q;  1IBK Q;  1E7Z A;  5IWA L;  4A3F G;  2CCZ A;  3ICE A;  4A3B H;  1IXR A;  4LFC L;  3CCU A;  1X6O A;  3RLF A;  4BBS H;  3HKZ E;  4JG2 A;  3GTQ H;  1IYJ B;  2F3I A;  4BA1 I;  2D0P A;  3S1Q H;  1D7Q A;  2R7Z G;  1XMQ Q;  3BU2 A;  2E2J H;  2E8G A;  1O7I A;  1FVI A;  1SRO A;  1E1T A;  2IHE A;  2YTY A;  2ZTD A;  1WYD A;  4JOI A;  5C4X H;  4YHH Q;  1ASZ A;  4OX9 Q;  1EIF A;  4PZ8 A;  2JA8 H;  3JAM c;  4AH6 A;  2JA7 H;  3CMA A;  2VNU D;  1LUZ A;  1I94 L;  4OO1 I;  2OQK A;  2JEB I;  2NZO A;  4DR4 Q;  3W5O A;  1PH3 A;  1AH9 A;  2L15 A;  1IBL Q;  3RR5 A;  4HJ9 A;  4X62 Q;  4APV A;  1Y1V H;  2N78 A;  4L5T A;  4IO9 A;  4X64 Q;  1JMC A;  2I5M X;  5C44 G;  1SR3 A;  1ASY A;  3D31 A;  4X66 L;  1JJ2 A;  1KRS A;  4QGU A;  3H15 A;  1YBY A;  1Q1B A;  1NMF A;  2RHQ B;  4EQ5 A;  2QEX A;  4JC0 A;  4JI5 L;  1YIJ A;  2HHH Q;  3I4O A;  1HZA A;  1PVO A;  3K80 C;  5EAY A;  3T1Y Q;  1Y1W G;  1R9T H;  1KIX A;  4YWK A;  4DV6 Q;  4XIG S;  4LWC A;  4DR2 L;  4DV5 Q;  1HR0 Q;  1MIU A;  2R93 H;  3KFU A;  1VQD A;  1QVG A;  1S72 A;  4A93 H;  3EN2 A;  3GO5 A;  3RLN A;  2YYZ A;  4IPH A;  4LUV A;  3T1H L;  2OTL A;  3NEL A;  2IT1 A;  1L2F A;  4JYA Q;  1PH1 A;  2VZA A;  3HFZ B;  1PH4 A;  4LF5 L;  5BR8 L;  1VQM A;  3D0F A;  1VQJ A;  5ELO A;  3CXC A;  2JA6 G;  1MJC A;  1VQA A;  2UUC L;  1WFQ A;  1YEZ A;  1EYG A;  4LF9 L;  4A3G H;  3U4V A;  1VS0 A;  2JK8 A;  4DV4 Q;  1XMO L;  2Y0S E;  4B3M Q;  1VQN A;  5JJI A;  3S1M H;  4DV7 L;  2HQL A;  3K0X A;  4A3B G;  1W3S A;  5IYD H;  4OWX B;  3UDX A;  1HNW L;  2MFI A;  4LW1 A;  4R4Q A;  4A3D H;  1C0A A;  5FJ8 G;  3CQZ H;  4A3M H;  3FKI H;  4IFD I;  4AQY Q;  2D0O A;  2R7F A;  2LXJ A;  1NJI C;  4JI4 L;  3S1N H;  1PH5 A;  5HY6 A;  3PUV A;  4TQU S;  3J7Z C;  1X54 A;  3CCE A;  1L1O C;  4P71 A;  2MO1 A;  2Q2T A;  2WAQ E;  1K8A C;  2YV5 A;  4PG3 A;  4JI3 L;  2F52 A;  4DR5 L;  4ME3 A;  2JA5 G;  4A75 A;  1A62 A;  1YZ6 A;  3RZD H;  2RF4 A;  4JCV E;  3KDF B;  1UE7 A;  3W1B A;  4GN4 B;  4YCU A;  4JI2 Q;  3CCV A;  1HNX L;  2ZJP A;  2F4V Q;  2R7Z H;  2UXB Q;  2EXD A;  1SLJ A;  3K8A A;  3U58 A;  1E3P A;  4DV2 L;  3PUZ A;  1PH6 A;  3K81 C;  5GAE C;  2WP8 J;  4IPG A;  2UUA L;  3U4Z A;  1PH8 A;  2B3G A;  4IFD J;  1KD1 C;  4AIM A;  2OQ0 A;  4GLV B;  3GTK H;  1M1K C;  3J81 i;  1XMQ L;  1FL0 A;  4POF A;  5C0X I;  3M4O H;  1J6Q A;  2N8N A;  1K8G A;  1I6H H;  1SMX A;  4OX9 L;  4P72 A;  1WCM G;  5C44 H;  2H5X A;  4YHH L;  5DLQ E;  1B70 B;  4JI7 Q;  4JV5 L;  4MNO A;  2VUM G;  1BBU A;  2E2H H;  1QVC A;  3M4Q A;  1K83 H;  2ZTE A;  2WFW A;  5AJ3 Q;  1Q81 C;  4BY7 G;  1YIT A;  4LF8 L;  2CQO A;  1IBL L;  3S15 H;  4K0K Q;  3E9H A;  1N32 Q;  1NMG A;  1Y1W H;  2YU9 H;  3PO2 G;  1YJN A;  4JBW A;  1UEB A;  3ZJY C;  1X3F A;  3CW2 C;  3M3Y H;  1G6P A;  4IJH A;  1S40 A;  1N9W A;  2GVA A;  2QGQ A;  1UWV A;  4DUZ Q;  5LMU L;  3ER0 A;  1WI5 A;  1K3R A;  1Z9F A;  3AYH B;  3J81 c;  4B3R L;  3M9B A;  1U0L A;  1FJG Q;  4DR6 Q;  1VQP A;  2XTI A;  1NY4 A;  2R6G A;  4XTC S;  5IY0 A;  3GD7 A;  1LTL A;  5C0X J;  2JA6 H;  3I4N G;  2JJQ A;  1X55 A;  1AE2 A;  3K7A H;  4DV5 L;  4P75 A;  3BJU A;  3AFQ A;  2OWO A;  1X65 A;  3Q8D A;  4ALP A;  1XNR L;  1OXU A;  2LXK A;  4DV1 L;  1N33 L;  4OON A;  1JT8 A;  1N34 Q;  1TWA H;  2A1A A;  3KOJ A;  4HID A;  5M3F G;  4YY3 Q;  5C4J H;  3J81 j;  4A3K G;  5FJ8 H;  2RCN A;  2KCT A;  3IRB A;  1Q86 C;  1GM5 A;  4DAM A;  4B3T L;  2UXC Q;  1LYL A;  3OW2 A;  3CD6 A;  1E1O A;  1CSQ A;  3HKZ G;  4NXM Q;  3KDF A;  3DLL A;  4DV4 L;  4LF4 Q;  2VQE L;  1HZB A;  2AWN A;  2UUB Q;  3PF5 A;  1GKH A;  2K4K A;  4MZ9 A;  4DK6 C;  4L5Q A;  2KHJ A;  3MXN B;  3L2P A;  2JA5 H;  3KF6 A;  3RN5 A;  5E7N A;  3PGZ A;  4DUY Q;  3MEF A;  3FHW A;  2Z0S A;  5M5Y H;  4A3E G;  3H3V H;  3JC6 6;  2BH2 A;  1EUJ A;  2ZJQ A;  2BA0 A;  1TWH H;  2ZM6 L;  4JI0 Q;  5M5W H;  1K73 C;  5GAD C;  1X3E A;  4A3I G;  1CKM A;  1XJV A;  4JI6 L;  3GTL H;  4UP7 A;  3F2C A;  1C7Y A;  4KHP Q;  4A4I A;  3HKS A;  3ULP A;  1NTG A;  3HOX G;  1Q12 A;  4LFA Q;  2UXD Q;  2IHF A;  4JI1 Q;  1IZ6 A;  1KL9 A;  2KHI A;  4JI2 L;  3CPW A;  3TS0 A;  3OTO Q;  2AMC B;  4QY7 A;  4C3H H;  1PYS B;  5JJK A;  2R7D A;  4QQB X;  1RL2 A;  1EWI A;  4BY1 G;  4LF6 Q;  1WCM H;  1Q1E A;  1VQF A;  2JA9 A;  4PMW A;  4HJ8 A;  1XNQ Q;  3TRZ A;  2VQF L;  2VUM H;  3J7A 5;  3G4S A;  3ULJ A;  4EX5 A;  1VQ8 A;  2MQH A;  1IBM L;  4BY7 H;  3AFP A;  1T9H A;  3CF5 A;  1N36 Q;  2UU9 Q;  1NBW A;  3HOV G;  1QZH A;  4IPC A;  4DV0 Q;  3PO2 H;  4R4O A;  1J5E L;  2K14 A;  4C3J H;  2BA1 A;  3PCO B;  2Q2H A;  2C35 B;  3HOU G;  4JI8 Q;  4UP9 A;  4HIK A;  1VQ4 A;  4LF7 Q;  1UE6 A;  2Y0S G;  2MO0 A;  1OXV A;  4DV3 Q;  4X6A H;  5IWA Q;  1G51 A;  1XPR A;  4LFC Q;  4H02 A;  4OO1 G;  4L5R C;  2PI2 E;  2NZH A;  4DR3 Q;  3FP9 A;  3KLW A;  2A19 A;  4HIO A;  3I4N H;  3ERS X;  2NN6 I;  1VQH A;  3A0J A;  4O0A A;  4IPD A;  4P73 A;  2NVX H;  5IP7 H;  4BXX G;  2B63 G;  1VQ6 A;  4X65 L;  4LUZ A;  5M5X H;  3PUY A;  1UE5 A;  3AQQ A;  5M3F H;  2WAQ G;  4DR6 L;  1Y14 B;  4A3K H;  4MTN A;  4R4I A;  4GKJ L;  2E2I H;  2E5L Q;  4PZ6 A;  1UE1 A;  4GLA C;  2ATW A;  3PF4 A;  2N3S A;  1IBK L;  1V43 A;  4B3S Q;  3KF6 B;  3GTJ H;  2AHO B;  4JOI C;  4YWM A;  3CCM A;  5LMN Q;  1N34 L;  2ASB A;  4BBR G;  2AKW B;  2CWA A;  5FLM G;  1LM0 A;  3CC7 A;  1OXT A;  1YJ9 A;  3RZO H;  4X66 Q;  3OYY A;  4A3L G;  4Y52 H;  5JEA J;  4R4T A;  2PI2 A;  2LSS A;  2ZTC A;  2EQS A;  4YWL A;  2Q2I A;  4JBK A;  1XTD A;  4L5S A;  4AYB E;  3RNU A;  1BVS A;  3CCR A;  4JI5 Q;  1Z47 A;  1GO3 E;  4YCW A;  5M3M G;  4A3E H;  4NXM L;  4LFB Q;  1YNX A;  4DR2 Q;  4KHZ A;  3GTM H;  3HOY G;  4LUO A;  3NEM A;  2WB1 E;  1KRT A;  2JQO A;  1SFO H;  3GTO H;  4A3I H;  1S3O A;  3EBE A;  4DR4 L;  5IYC G;  3UDF A;  4Y7N H;  4POG A;  1DGS A;  1PH9 A;  3HOX H;  3UE1 A;  4X62 L;  3TEH B;  3HOW G;  3I4M G;  1A0I A;  2IX0 A;  3E0E A;  2N49 A;  4RMF A;  5BR8 Q;  4X64 L;  2KCM A;  4IFD G;  4GLX A;  1EIY B;  3LGJ A;  1YHA A;  2NVQ H;  1M90 C;  1QVF A;  2R92 G;  1TWC H;  2I5L X;  4BY1 H;  1Q8K A;  4DV7 Q;  3TQY A;  1QZG A;  3ULL A;  2HHH L;  4P74 A;  4C2M H;  4GOP A;  3T1Y L;  1HNW Q;  4JBJ A;  4IOC A;  4DV6 L;  2OCE A;  3E9I A;  1HR0 L;  3I55 A;  1A8V A;  1BKB A;  3OTO L;  4GNX A;  5IP7 G;  4JI4 Q;  3HOV H;  1YHQ A;  3CCJ A;  3UDG A;  1CKN A;  3SGI A;  1PA6 A;  5GQO A;  3EIV A;  2KEN A;  1XNQ L;  4JYA L;  3S24 A;  3S17 H;  3F2D A;  1YHB A;  1B8A A;  2GVB A;  2ALY B;  1BBW A;  1EFW A;  4DR5 Q;  1HZ9 A;  1PH7 A;  3VDY A;  4NXN Q;  4DR7 Q;  4DKA C;  1HZC A;  4R4C A;  1GD7 A;  4B3M L;  4RG1 A;  3S16 H;  5C0X G;  5J3B A;  4OXP A;  1WJJ A;  1SE8 A;  1X56 A;  1HNX Q;  4JI8 L;  4WJ3 M;  4HIM A;  1P16 A;  4LF7 L;  5C3E G;  1E24 A;  4BXX H;  2B63 H;  3PIP A;  1WOC A;  5IT9 c;  4A3C G;  2NVY H;  4DV3 L;  1SRU A;  4AQY L;  1D8L A;  1FGU A;  2K5H A;  2Z6K A;  4DPG A;  4BA2 I;  2UUA Q;  1RIP A;  2K5V A;  3PO3 G;  4DR3 L;  1CUK A;  4GKK Q;  4DR1 Q;  1QUQ A;  3L7Z C;  4FDB A; 
#chains in the Genus database with same CATH topology
 1VF5 C;  1HR0 W;  2RDF A;  3F2B A;  4OWT B;  2P5Z X;  2RSN A;  1A63 A;  2LMC B;  1N8R C;  3TZU A;  1KAB A;  1LLR D;  3S2H H;  1F9S A;  2A68 D;  2PMZ B;  3M4Y A;  1ILP A;  2KCC A;  2DJG C;  4KV6 A;  2PZW A;  2BCO A;  5D65 A;  5IYB G;  1Y69 U;  5CR3 A;  2IJ0 A;  1X9N A;  3AMU A;  1X3G A;  1IYU A;  5C4Z A;  2A8V A;  3D4W A;  5EKL A;  3DXJ C;  2EJG C;  2F0N A;  3OIQ A;  5C5L A;  2R92 H;  1QE6 A;  4CDC C;  1FNU A;  5A2Q E;  1ET9 A;  1R9T B;  4DF7 A;  4KY6 A;  3BZC A;  3CCL A;  4IUT A;  3UDI A;  4DUZ L;  2JSO A;  5HGT A;  2HIV A;  3QG1 A;  4DK1 A;  1QOH A;  1CZW A;  4IUR A;  1VQI A;  4NPS A;  2NVT H;  5LMN W;  3PMF A;  1VQ9 A;  4WJW A;  5IE8 A;  2CVR A;  1JB7 A;  2WKD A;  1HQM C;  3EQL C;  1PV4 A;  4YY3 L;  2PZT A;  2JYO A;  3VR4 A;  1SNO A;  4IJL A;  1QUQ B;  4A3M B;  4JI6 Q;  2UXC L;  1O7L A;  4DR7 L;  4QIW B;  1L0Y B;  3S1N B;  2F0I A;  1AE3 A;  1Y1V G;  2K32 A;  2V1C C;  4RCN A;  2UUB L;  1H9M A;  4AYB G;  1PTO H;  3TBI B;  1S5F D;  3BYT B;  3T1H Q;  3OPO A;  4F7X A;  4FYD A;  5FO8 B;  3KUP A;  1KQS A;  2VXW A;  1BQQ T;  1B53 A;  5JEA G;  3W1G A;  4X3K A;  4GKK L;  2A6H D;  1H9S A;  4OEL B;  1LTT D;  3SR1 A;  5CV8 A;  3NBH B;  1BCP F;  3OW7 A;  4GS3 A;  4NP5 A;  1J5E Q;  4KHP L;  1SN8 A;  1GVP A;  1IL2 A;  4FXD A;  1B1Z A;  3GTG H;  1P8L A;  5CMD A;  2DUD A;  5HUR A;  4F8M A;  4ODG A;  2AWO A;  1GUS A;  1XWE A;  3M4O B;  2VY3 A;  4A3G G;  4A3E B;  3DUZ A;  1JJC B;  3CP0 A;  3GTM B;  1RJT A;  3F8T A;  3GTO B;  5KNC A;  3K7U C;  3PV0 A;  2UU9 L;  1BCP C;  3KF8 A;  3STB C;  3J80 c;  2BE5 D;  3JAM i;  2CWP A;  2RHS B;  3M3Y B;  1K9M C;  1L1O A;  3HG9 A;  5EKI A;  1PYB A;  4IOA A;  3GV6 A;  1TWC B;  1RKN A;  1T5X D;  1E7Z A;  4BY1 B;  2J7Z A;  5JAV A;  3RLF A;  1Q8I A;  2C5C A;  3FPU B;  2AQ1 B;  4KD3 A;  5JPM C;  1PYW D;  2R7Z G;  3EVQ A;  2K04 A;  2E2J H;  2CHB D;  2ZTD A;  1O7I A;  1SRO A;  5C4X H;  4JOI A;  1WYD A;  1TWA B;  4PV1 C;  1ASZ A;  4PZ8 A;  2AQ2 B;  1ICW A;  1LUZ A;  2JEB I;  2NZO A;  3W5O A;  1YNJ C;  3VR2 A;  1EEI D;  5CV7 A;  4HJ9 A;  1B3Q A;  4APV A;  1QNK A;  1JMC A;  4B9X A;  2OT2 A;  1EWH A;  3D31 A;  4X66 L;  5LL6 X;  5EQ0 A;  1KRS A;  2AUJ D;  1NMF A;  2RHQ B;  4EQ5 A;  2HHH Q;  3T1Y Q;  2ZT9 C;  1R9T H;  2F0W A;  4XIG S;  5JOB A;  1QVG A;  1S72 A;  4A93 H;  2EVB A;  2K01 A;  3EN2 A;  3GO5 A;  5EJW A;  3HS0 C;  4LUV A;  3T1H L;  1DZ1 A;  4XQN A;  1IW7 D;  4JYA Q;  2VZA A;  3HFZ B;  1VQM A;  3D0F A;  1MJC A;  2EZV A;  1HUM A;  1YEZ A;  1D1I A;  3I8Z A;  4CJ2 C;  1VS0 A;  2B8G A;  4DV4 Q;  5JJI A;  1CZG A;  1WCM B;  4DV7 L;  2HQL A;  2BOS A;  5IYD H;  3UDX A;  4LW1 A;  4A3D H;  1NR2 A;  4LK1 C;  5FJ8 G;  4A3M H;  1GHJ A;  4IFD I;  1MBY A;  3S1N H;  1K8M A;  2I07 B;  3PUV A;  2LY7 A;  4CKB A;  3J7Z C;  1CQF A;  2WAQ E;  2Q2T A;  1K8A C;  1TS3 A;  3K0Y A;  4IUN A;  4ME3 A;  1J9O A;  1A62 A;  3VR3 A;  5KYI A;  2N55 A;  3VYT A;  3K59 A;  3I4N B;  1SNM A;  4YCU A;  3CCV A;  3S14 B;  2UXB Q;  4DXF A;  1EU4 A;  5GAE C;  2KQ3 A;  5M3F B;  2WP8 J;  2UUA L;  3KLS A;  3KK7 A;  2OQ0 A;  1M1K C;  3J81 i;  1ENC A;  1FL0 A;  5C0X I;  1B50 A;  3M4O H;  2B2V A;  2ICE C;  3K5O A;  3NTI A;  3RZO B;  4JV5 L;  4MNO A;  4J1M A;  1BBU A;  1A2T A;  5KYL A;  2E2H H;  5IGG A;  1K83 H;  2ZTE A;  5C3E B;  1U4M A;  1Q81 C;  4ZKC B;  4LF8 L;  3S15 H;  1Y1W H;  1CFM A;  2QDB A;  3ZJY C;  4QB4 A;  1G6P A;  3M3Y H;  1LO5 D;  1EWC A;  1N9W A;  4ABN A;  2QGQ A;  5LMU L;  1HTP A;  5F2D A;  5NUC A;  1WTV A;  1HA5 A;  3M9B A;  1U0L A;  1FJG Q;  3H91 A;  4XTC S;  5IY0 A;  1LTL A;  3GQB A;  2JJQ A;  1IKL A;  3K7A H;  3BJU A;  1ILQ A;  1XNR L;  2IPK D;  4IN3 A;  1TS5 A;  1O7Z A;  3OIP A;  1N33 L;  1JT8 A;  1N34 Q;  1TWA H;  4FF1 A;  2B2T C;  1X32 A;  4ID6 A;  1ENA A;  2F3V A;  2B2W A;  2OXP A;  3J80 E;  5FLX L;  4B3T L;  3HOV B;  4A3J B;  2D5D A;  4DV4 L;  1TS2 A;  4LF4 Q;  5CYU A;  2HDM A;  4IUP A;  4L5Q A;  3Q23 A;  3MXN B;  3RN5 A;  5E7N A;  2R61 A;  3KLS X;  3MFY A;  3FHW A;  3LWU A;  3PQI A;  4FO2 A;  4A3E G;  2EDG A;  3H0G B;  2BH2 A;  1EUJ A;  2BA0 A;  1V1O A;  4JI0 Q;  5M5W H;  5CBE E;  3QO2 A;  4L6T B;  4KN4 C;  3HKS A;  1NTG A;  2RVL A;  5C6A A;  4BBS B;  3P20 A;  5I2X A;  3AU7 A;  3BDL A;  1J8I A;  3CRL C;  1TT2 A;  4BY1 G;  3BS1 A;  1WCM H;  2JA9 A;  4PMW A;  1XNQ Q;  2VUM H;  3G4S A;  2A68 C;  4EX5 A;  2H1E A;  1IBM L;  2FMC A;  1VMC A;  1T9H A;  1N36 Q;  1QZH A;  1XTC D;  3HOU B;  5E1F A;  2BA1 A;  4X3S A;  2I46 A;  1G2T A;  4UP9 A;  4HIK A;  3G7L A;  2ZXP A;  4X6A H;  3C3L A;  2WB1 B;  1XPR A;  2EYJ A;  1SND A;  4H02 A;  3I4M B;  4OO1 G;  2NZH A;  1FGB D;  3I4N H;  1TQO A;  3JAM L;  1PFM A;  1PZJ D;  3LX0 A;  4IPD A;  4O0A A;  2Z9H A;  5CV9 A;  4KJO A;  3FVQ A;  1VQ6 A;  4LMQ D;  1IYV A;  5M3F H;  1Y14 B;  4A3K H;  4R4I A;  4GKJ L;  5KEE A;  4GLA C;  4CDD C;  3PF4 A;  1GUT A;  1GJX A;  4B3S Q;  3KF6 B;  3RD4 A;  3CCM A;  1TWF B;  5LMN Q;  2JXM B;  2PO4 A;  1N34 L;  2AKW B;  2CWA A;  5FLM G;  3CC7 A;  1YJ9 A;  3RZO H;  4A3L G;  5EGT A;  3BVM A;  2LSS A;  3FKI B;  2D2C C;  4AYB E;  1SMY D;  1B44 D;  4JI5 Q;  4YCW A;  5M3M G;  2O5J C;  4LFB Q;  1I50 B;  1YNX A;  4XDX A;  4KHZ A;  3HOY G;  3IFT A;  2V4D A;  1QIL A;  5A2Q L;  5LHY 1;  3OMG A;  1JOR A;  2A74 C;  5IYC G;  3UDF A;  5BN4 A;  3HOX H;  3UE1 A;  3TEH B;  3HOW G;  3E0E A;  4RMF A;  2KOL A;  4GLX A;  1M90 C;  1QZG A;  1DOM A;  4HSP A;  1HNW Q;  2X69 A;  4JBJ A;  4DV6 L;  3E9I A;  1HR0 L;  3HOV H;  1ICF B;  4HR7 B;  3BVZ A;  1F2Y A;  2KEN A;  1XNQ L;  2TMP A;  1E2W A;  1U4P A;  1I4G A;  2A69 D;  2GA4 B;  2L11 A;  4DR5 Q;  4UHV A;  3VDY A;  1LT3 D;  1SNQ A;  3AB9 A;  4RG1 A;  2BDN A;  2EYF A;  5J3B A;  1ML0 D;  4OXP A;  1EY8 A;  4WJ3 M;  5C3E G;  2B63 H;  1JWM D;  1O80 A;  1WOC A;  2LKV A;  5IT9 c;  2K7V A;  2DNC A;  4BA2 I;  2K5V A;  1L0W A;  1VCI A;  1WVL A;  3G48 A;  1VQB A;  4EQO A;  3A8K E;  1EYA A;  2FXQ A;  2MJ8 A;  3RN2 A;  2VS1 A;  1NNX A;  3M85 A;  2EIF A;  4HJ5 A;  1A2U A;  1K0R A;  4ZQ3 A;  4C3I G;  4UP8 A;  4M1U B;  3KJP A;  3J81 L;  2M9V A;  3HOU H;  4B3S L;  3M4P A;  5LMN L;  1BUV T;  3S2D H;  1GUN A;  2K5Q A;  1EEF D;  5IP9 G;  5I4D A;  1XPU A;  1FYC A;  1Q46 A;  3MXG A;  1H9S B;  2K75 A;  3U50 C;  2JA5 B;  4DK3 C;  4B3R Q;  1GOZ A;  4HSV A;  4A3J G;  5K36 G;  3I4M H;  1KNE A;  4IFD H;  4LFB L;  1B9N A;  4JI7 L;  1I3Q H;  2ZXO A;  1CKO A;  3MVV A;  5AJ3 L;  2IY5 B;  3OMC A;  1LTS D;  1C48 A;  3VA7 A;  3I7F A;  1V1Q A;  1N32 L;  3TS2 A;  1CKN B;  4PMC A;  3H0G G;  3MA2 B;  4KI0 A;  3H94 A;  1YVC A;  4C3H B;  4TVA B;  4R9W A;  5HGQ A;  2B29 A;  3KF8 B;  1TS4 A;  1TWF H;  5J39 A;  1FNV A;  2A6E C;  1QCB D;  4PZ7 A;  5G3L F;  2PMZ E;  4BBS G;  1I94 Q;  1L1O B;  4WJ4 A;  4OIJ A;  1I50 H;  5C0X H;  5CV5 A;  1I5F A;  4L8J A;  1EY6 A;  3T53 B;  1I4Q A;  3G6J B;  3I90 A;  1EQR A;  1EQV A;  4UY8 C;  4QUC A;  3PO3 H;  3HOU G;  4UAI A;  2IX1 A;  3CPF A;  1BDO A;  2CKZ B;  2L55 A;  5H1S E;  4CKE A;  5EPL A;  3C1E A;  1PTO F;  5DNF A;  2PQA A;  3I70 A;  2XWB B;  1VQC A;  1VQE A;  4ME5 A;  2CFM A;  2K52 A;  5T1G A;  1JWS D;  1SDF A;  4DUY L;  5K5P A;  2WB1 G;  3FMC A;  1AP0 A;  1PFS A;  4K8J A;  1VQK A;  2E2I B;  1ZYR C;  1S4Z A;  2BH8 A;  4QJF A;  3T56 B;  1I4P A;  3TRE A;  2I0Q A;  1F2M A;  1OXX K;  1XMO Q;  1R4Q B;  1QWY A;  5IYB H;  1WD1 A;  3W2D A;  2HIX A;  2NYZ D;  5JJL A;  1DYQ A;  4LFA L;  1HUN A;  3I73 A;  2HCI A;  3DWA A;  1E22 A;  2OTJ A;  4HJ7 A;  1SYD A;  1PHJ A;  4LF6 L;  1CSP A;  2HDL A;  1A15 A;  4RA8 A;  2Q8R E;  4QIW E;  3GTL H;  4YCV A;  4A76 A;  1ZKO A;  2VL6 A;  2HT1 A;  4JVZ A;  4JW0 A;  1D1K A;  2RKS A;  4X65 Q;  3FKI G;  2F0H A;  4DNT B;  3PSI A;  1NR4 A;  2HD3 A;  3TDQ A;  1B2T A;  2QA4 A;  2QW7 A;  2PNH A;  2K5W A;  4ZRZ A;  5IWA L;  1EYC A;  4HMJ A;  1IYJ B;  1AZQ A;  2CH4 W;  2DJF C;  2KHS A;  2NWG A;  5COR A;  3BU2 A;  1JC7 A;  1SYC A;  2OTL A;  1WTO A;  1ESF A;  1E1T A;  1RDP D;  3ND9 A;  4OX9 Q;  4YHH Q;  1HRJ A;  1SJH D;  3SXH A;  1IKM A;  5IT9 E;  1SBB B;  1CQV A;  1I94 L;  3K6O A;  4OO1 I;  1G6Z A;  4DR4 Q;  1IBL Q;  1H9R A;  1BR9 A;  1RD9 D;  4X62 Q;  1JCK B;  1Y1V H;  4IO9 A;  5IGC A;  2RBM A;  5C44 G;  4TSS A;  3NHH A;  4EGV A;  1M8A A;  4QGU A;  1C4Q A;  1L0X B;  2MUY A;  3I4O A;  2Q8T A;  4DAY A;  5CV4 A;  5EAY A;  5JEA H;  3T4A C;  4DR2 L;  1MIU A;  3KFU A;  1VQD A;  1EY9 A;  2YYZ A;  4IPH A;  3J80 L;  1GXD C;  3NEL A;  4XT1 B;  4BBR B;  5COY A;  1VQJ A;  5ELO A;  4G7O C;  5JPN C;  2MGS A;  1EYG A;  1T5E A;  1GUG A;  4A3G H;  4XYQ A;  3U4V A;  1XMO L;  4B3M Q;  3K0X A;  3HRZ C;  2MFI A;  3R3O A;  4OIK A;  1MHW C;  1B4O A;  3CQZ H;  4FP5 D;  4AQY Q;  4JI4 L;  2F0U A;  1PH5 A;  1HA6 A;  4TQU S;  1PXU A;  3SVM A;  4P71 A;  4CJ1 B;  2YV5 A;  4PG3 A;  3WOF A;  2JA5 G;  3ZYY X;  4A75 A;  3RZD H;  1YZ6 A;  2RF4 A;  1DOL A;  4K8I A;  2WKC A;  2Z8L A;  4JI2 Q;  2R7Z H;  2ZJP A;  2F4V Q;  1SLJ A;  1MSH A;  3K81 C;  2HUG A;  4DU9 A;  1F2Z A;  2MPM A;  1HPC A;  1DM0 B;  2B3G A;  3U4Z A;  3VA5 A;  2XSC A;  1PH8 A;  4IFD J;  1KD1 C;  2EPB A;  3HP3 A;  4GLV B;  3K5M A;  1SYE A;  1H9J A;  3OSO A;  1V8Q A;  4C3H G;  1K8G A;  3GTJ B;  1I6H H;  4OX9 L;  4YHH L;  2H5X A;  5EBD A;  4C56 C;  4DXG A;  1B70 B;  5A35 A;  1SMY C;  2B2U C;  1S5D D;  3M4Q A;  1F2L A;  3OHX C;  2EJM A;  1TWG B;  2CQO A;  4ULL A;  5ELF A;  1IBL L;  4K0K Q;  1NMG A;  2F4I A;  3PO2 G;  4DA2 A;  4JBW A;  1X3F A;  4K5W A;  1S40 A;  3TP5 A;  2GVA A;  5C5M A;  2E76 C;  3ER0 A;  3AYH B;  1K3R A;  1Z9F A;  1D5X C;  1HFN A;  4RGN A;  1NY4 A;  5ELD A;  3GD7 A;  3TSS A;  1I4H A;  5C0X J;  3F2U A;  1O7Y A;  3Q8D A;  4ALP A;  2Z1C A;  2A1A A;  3KOJ A;  4HID A;  1I4R A;  1KDB A;  3J81 j;  1ROD A;  3IRB A;  5FJ8 H;  1GM5 A;  1Y8N B;  3IL8 A;  2EY5 A;  3HOZ B;  2AWN A;  3S17 B;  4DAP A;  4DK6 C;  4K6L A;  2KHJ A;  2OEO A;  3PGZ A;  3MEF A;  4KK7 A;  3GTP B;  3S16 B;  3JC6 6;  3LWE A;  2WV6 D;  3Q0A A;  2XNA C;  2NBF A;  4HTH A;  1FR3 A;  5IIF A;  2L12 A;  4JI6 L;  3ULP A;  1YNN C;  1Q12 A;  4X3T A;  1X3P A;  2UXD Q;  4JI1 Q;  4IUV A;  2KHI A;  4R8N A;  4JI2 L;  1R4P B;  2KEC A;  3OTO Q;  1HTL D;  1NUC A;  2AMC B;  2M2L A;  4JPB W;  5JJK A;  1RL2 A;  1Q1E A;  1VQF A;  5IGF A;  3J7A 5;  1WTQ A;  2JA8 B;  1S5E D;  2MQH A;  2JA7 B;  3AFP A;  2L5T A;  3CF5 A;  1NBW A;  5M3M B;  4DV0 Q;  4R4O A;  3BYY B;  1J5E L;  1UNS A;  3HOY B;  2Q2H A;  1MGS A;  4JI8 Q;  1CM9 A;  1PRT D;  1SAP A;  1VQ4 A;  2G9H D;  3QIA A;  1G51 A;  4O1N A;  4LFC Q;  3HOW B;  1EU3 A;  3HEJ A;  3QOL A;  4DR3 Q;  4HIO A;  3T13 A;  3MEH A;  3AQQ A;  2HCC A;  1QB5 D;  1UE1 A;  2DY8 A;  3S1R B;  5BN3 A;  2F0P A;  1V43 A;  4CKC A;  1AN8 A;  3GTJ H;  4PMB A;  2AHO B;  3S1M B;  4BBR G;  3BZD B;  5JEA J;  1STG A;  4R4T A;  2PI2 A;  3ND8 A;  2EQS A;  4YWL A;  3TP6 A;  4JBK A;  1TVX A;  1BVS A;  3CCR A;  4A3E H;  1Z6H A;  4KMU C;  3GTM H;  1QG7 A;  2EYL A;  2B39 A;  2WB1 E;  1KRT A;  3GTO H;  3E0J A;  1DGS A;  1KDA A;  1PH9 A;  3C1F A;  1SXT A;  1A0I A;  1EZ6 A;  5BR8 Q;  3I4L A;  2KCM A;  5IGE A;  3FPP A;  3CHB D;  3CKI B;  1PZK D;  1TWC H;  2I5L X;  4BY1 H;  4FF3 A;  3H6M A;  5D3I B;  2QF7 A;  4V0B A;  4S3S A;  2HHH L;  4P74 A;  2KJX A;  3T1Y L;  2H4O A;  4K6D A;  4C3I B;  3GTK B;  2F0M A;  3NQT A;  3OTO L;  1YHQ A;  2EYO A;  3SGI A;  5DM7 3;  4KKT A;  4JYA L;  3A55 A;  5I6Y A;  3S17 H;  1JQY D;  1YHB A;  1B8A A;  4WOR A;  3KBX A;  3E6Z X;  1B3A A;  4PQX A;  4NXN Q;  1FNW A;  4DKA C;  4OO1 H;  1GD7 A;  3NK9 A;  3S16 H;  3TP7 A;  4MTK A;  2NZ1 D;  1WTR A;  1HNX Q;  4JI8 L;  4HIM A;  4A3C G;  1E24 A;  3PIP A;  4XXE A;  1D8L A;  1JOO A;  1FGU A;  2K6A A;  3DWP A;  1RIP A;  4ZAI A;  4DR3 L;  3MXU A;  1QUQ A;  2K33 A;  3L7Z C;  1DD2 A;  1NAP A;  3AEV A;  2FFK B;  3ERO A;  1DJR D;  5FLM H;  4UPA A;  4XQQ A;  1TXY A;  5C4J B;  4A3L H;  3GTQ B;  1IHZ A;  3KLR A;  4CBV A;  1V9P A;  2LS0 1;  2UXB L;  2PQA B;  1AEX A;  4KN7 C;  4P2C B;  2SOB A;  5M3M H;  3A74 A;  1STY A;  4HJA A;  2NTS A;  3HOY H;  4MN3 A;  3A5U A;  1KHI A;  3I2Z A;  4GN3 B;  5IYC H;  1JJG A;  1NCV A;  1HNZ Q;  3HOZ G;  3HOW H;  5GAG C;  4QUF A;  2MNA A;  1EZ8 A;  1KAA A;  4J15 A;  1KC8 C;  2DGY A;  1TWH B;  4GOP B;  4FF4 A;  3SDZ A;  3BZK A;  2GN5 A;  2XGT A;  2NN6 H;  3FDT A;  4F88 A;  4DV1 Q;  4GNX B;  3KJO A;  1G8Z D;  2L9H A;  4LNQ A;  3UE0 A;  4GOP C;  3BVG A;  3S14 H;  1K8O A;  2D62 A;  3S1R H;  1A3U A;  5IT9 L;  4GNX C;  3OWE B;  1JOQ A;  3VR5 A;  3WOE A;  3CC4 A;  2VQE Q;  1RCV D;  4ZYS A;  1AW7 A;  2QDL A;  3Q22 A;  1C8C A;  1FJG L;  1EYD A;  3NSW A;  4IUQ A;  1JE5 A;  4RFB A;  4XT3 B;  1YI2 A;  1H95 A;  3A56 A;  4O2D A;  1EOV A;  3E3X A;  1LT6 D;  2Q8I B;  1PFB A;  1VQL A;  3R8B A;  1G29 1;  2DNE A;  2ZM6 Q;  3R93 A;  1VQ7 A;  2RQX A;  1W6J A;  2F0Q A;  1LTI D;  2JA8 G;  1BXT A;  3TME A;  5C3E H;  2JA7 G;  2D9U A;  3G6E A;  4OWW B;  3NEN A;  1STN A;  4NXN L;  2B2Y C;  2Z6K C;  4LF4 L;  5EBC A;  3I3C A;  4FNF A;  3GDE A;  3I91 A;  3KYH C;  5GRO A;  5I2Y A;  5FLX c;  4G57 A;  5M5X B;  4I7Z C;  2VQF Q;  4LF5 Q;  2QCP X;  2CH4 A;  2K50 A;  1Y8O B;  4JI0 L;  2R93 G;  3B6Y A;  4C3I H;  3MHB A;  3J80 i;  4O42 A;  3HKZ B;  2NN6 G;  1LAB A;  2A6H C;  3WWV A;  1DXM A;  1YJW A;  3WDN A;  2PPB C;  5IP9 H;  4DAY B;  3MTS A;  1H9K A;  1GUO A;  1E0B A;  1U4L A;  2SNS A;  4R1J A;  1U5K A;  1W2B A;  4A3J H;  5K36 H;  1WD0 A;  2FJ2 A;  4DN4 M;  5JVG 3;  3DEP A;  5C44 B;  1BCP D;  1B7Y B;  1KAW A;  3STB D;  1MJE A;  1VQ5 A;  1VQO A;  4A3I B;  1A3V A;  4JI3 Q;  1CT1 D;  4Y7N B;  3K5L A;  3D4R A;  1N36 L;  1LTR D;  3MWY W;  3I56 A;  1HNZ L;  2FMM A;  2F0T A;  3H0G H;  1EQQ A;  2BE5 C;  1C9O A;  3DM3 A;  2E75 C;  4H0L C;  4NW2 A;  1IBK Q;  2N88 A;  2CCZ A;  3CCU A;  1CHP D;  4BBS H;  4JG2 A;  4N8F A;  2F3I A;  4BA1 I;  3GTQ H;  2F03 A;  3QOJ A;  2NUC A;  1D7Q A;  3NE5 B;  1EY7 A;  2IHE A;  2YTY A;  4NKL A;  4N9P A;  1EIF A;  1YNJ D;  2B8F A;  3JAM c;  1E2Z A;  4ILW A;  1TY2 A;  2Y0S B;  2OQK A;  4E6I A;  5E4X A;  2L15 A;  3RR5 A;  2DN8 A;  5IOD A;  1LTB D;  4XQJ A;  4X64 Q;  4KKS A;  2A73 B;  1SR3 A;  1JJ2 A;  3DHQ A;  4CGY B;  1YBY A;  1BNZ A;  2QEX A;  1G2S A;  1STE A;  4JI5 L;  5M9O A;  1PVO A;  1HZA A;  5M5Y B;  1RF2 D;  4YWK A;  4NDX A;  4DV5 Q;  3X3N A;  4MHE A;  4IAL A;  2Z6B A;  2IT1 A;  1HCZ A;  1PH4 A;  4YIJ A;  4LF5 L;  3HGB A;  4ZK9 B;  1IW7 C;  4CDF C;  1VQA A;  2JA6 G;  5KNB A;  4IQZ A;  2PNR C;  2JK8 A;  1VQN A;  1PRT B;  2B2T A;  2ZXR A;  1W3S A;  4KJN A;  1HNW L;  4HED A;  1RTO A;  5ISR A;  4R8I A;  4R4Q A;  1C0A A;  5EPK A;  3SK4 A;  1CA6 A;  3FKI H;  2D0O A;  3QWN A;  1PRT C;  1KLU D;  1NJI C;  3PO2 B;  5HY6 A;  4C3J B;  5IOC A;  1X54 A;  3CCE A;  1L1O C;  1SJE D;  2MHV A;  2R92 B;  3R2I A;  1W6K A;  4JI3 L;  2PW5 A;  2F52 A;  4DR5 L;  1STA A;  3W1B A;  2JN4 A;  4GN4 B;  5FO7 B;  2EXD A;  3Q24 A;  3K8A A;  4DGZ A;  3U58 A;  1PH6 A;  2F0J A;  1Y8P B;  4NMZ A;  2EY1 A;  2VB2 X;  5KIX A;  4AIM A;  4OL7 A;  4HN7 A;  4POF A;  3H09 A;  1MD2 D;  2WAC A;  2N8N A;  2FHT A;  1SMX A;  4P72 A;  5C44 H;  3QJY A;  2QKI C;  5DLQ E;  1STH A;  5FLX E;  1QVC A;  2SDF A;  2CW0 D;  4EVO A;  1HQR D;  4BY7 G;  1YIT A;  3D6C A;  3E9H A;  1YJN A;  1UEB A;  4H44 C;  4L63 B;  3VYU A;  1UWV A;  4DUZ Q;  1WI5 A;  3J81 c;  4B3R L;  2F3W A;  1PDQ A;  1I6V C;  4DR6 Q;  1VQP A;  2R6G A;  4K2L A;  4Q5V A;  3VYS A;  1X55 A;  1AE2 A;  2L0C A;  4DV5 L;  4P75 A;  3AFQ A;  1X65 A;  3V05 A;  3A54 A;  4C2M B;  4YY3 Q;  1TR5 A;  3GTG B;  1Q86 C;  2DY7 A;  2RA4 A;  4RHR A;  5DAU A;  3V2T A;  2UXC Q;  4U68 A;  1LYL A;  1NSN S;  3CD6 A;  2K05 A;  1E1O A;  3HKZ G;  3KDF A;  3DLL A;  1HZB A;  1QJO A;  2IL8 A;  4XYO A;  2UUB Q;  5AFW A;  2K4K A;  2L1B A;  1JOK A;  3L2P A;  5D3D A;  2JA5 H;  3EA6 A;  3KF6 A;  4RWS C;  2B2Y A;  3SK5 A;  1S5C D;  5M5Y H;  2TSS A;  2F0E A;  2ZJQ A;  2RDG A;  3UI2 A;  4J6H A;  1X3E A;  4A3I G;  1XJV A;  2E74 C;  3F2C A;  4QF4 A;  4KHP Q;  4A4I A;  3JAM E;  4PNY A;  5I6W A;  2XRQ D;  5ELC A;  3FEW X;  1XXG A;  2A5H A;  1KL9 A;  1FD7 D;  2SNM A;  3CPW A;  4QY7 A;  4C3H H;  1EY4 A;  2E2J B;  2NB0 A;  5EPJ A;  1EWI A;  2B2V C;  5C4X B;  1VDZ A;  1D6E C;  4K5V A;  3TRZ A;  4EQP A;  3R2T A;  3CRK C;  1VQ8 A;  1F77 A;  3PIP 3;  1EFI D;  2UU9 Q;  4HCE A;  3PO2 H;  2L4N A;  4C3J H;  1AZP A;  4H7B A;  3K58 A;  3P7J A;  3NQI A;  1UE6 A;  4LF7 Q;  2Y0S G;  2MO0 A;  4DV3 Q;  2E2D C;  4LJZ C;  3NTH A;  3FP9 A;  2A19 A;  2NN6 I;  1VQH A;  3A0J A;  2M00 A;  2F0S A;  4P73 A;  2Z4H A;  2IWH A;  3J7Y W;  4A93 B;  4BXX G;  2EOT A;  1D5Z C;  4FXG C;  4X65 L;  1KNA A;  5FKA C;  1X3Q A;  4DR6 L;  1GUW A;  4MTN A;  2E2I H;  2E5L Q;  4PZ6 A;  2ATW A;  2B2W C;  3RUZ A;  2EY2 A;  2N3S A;  4I65 A;  1A3T A;  3IFD A;  2KVM A;  1VF7 A;  3A7L A;  2ASB A;  2KA7 A;  1OXT A;  4X66 Q;  3OYY A;  4Y52 H;  1MSG A;  4A3D B;  3QB3 A;  3K57 A;  3ITP A;  2Q2I A;  1XTD A;  2PYK A;  3RNU A;  3NWT A;  1LT4 D;  1GO3 E;  1Z47 A;  1I4X A;  4C1N I;  5IGB A;  1BF4 A;  1LAC A;  1DOK A;  4LUO A;  4KY5 A;  3MXP A;  2JQO A;  1S3O A;  3EBE A;  4DR4 L;  4POG A;  1PLF A;  2O5I C;  5J22 A;  1LTG D;  4A3F B;  4X62 L;  2F0G A;  2IX0 A;  4C3J G;  2N49 A;  1RTN A;  1YHA A;  2R92 G;  4JK1 C;  4DV7 Q;  2JP1 A;  4C2M H;  4IOC A;  2OCE A;  3K5N A;  3NTK A;  1A8V A;  1BKB A;  2EY6 A;  1V1P A;  3CCJ A;  3UDG A;  1BCP B;  2F0D A;  4RH6 A;  1CKN A;  5D14 A;  1PA6 A;  3J7A V;  2PCF B;  5GQO A;  3TZD A;  1JWU D;  4HAE A;  2E2H B;  2GVB A;  1K83 B;  2ALY B;  3J81 E;  1EFW A;  1PH7 A;  2EJF C;  2F0O A;  4RCO A;  3T16 A;  3E5S A;  3S15 B;  2A69 C;  4QMG A;  3SK8 A;  4C1N K;  1Y1W B;  4B3M L;  1EL0 A;  3QR8 A;  3DM1 A;  2IX3 A;  1SE8 A;  1X56 A;  4B08 A;  1P16 A;  4LF7 L;  4DV3 L;  4AQY L;  4K2K A;  2EXZ A;  2K5H A;  2UUA Q;  4K5X A;  3IAY A;  2KUM A;  1LT5 D;  4IUU A;  4DR1 Q;  3K7A B;  4FDB A;  1XPO A;  4OHJ A;  3F1Z A;  4RGM A;  4BBR H;  4FF2 A;  2K5N A;  4A3B B;  3I72 A;  4JV5 Q;  2K5D A;  3S9W A;  2MP1 A;  2E5L L;  1OXS C;  5C4H A;  3S1Q B;  2XN9 C;  4RGT A;  4M8A A;  1NE3 A;  2F4V L;  3A8J E;  2Q2U A;  2NTT A;  4LF8 Q;  3PUX A;  5ELN A;  3M7G A;  1BO0 A;  3PUW A;  3IKJ A;  2ZJR A;  1UEA B;  4ZKB B;  1KTK A;  3GV3 A;  5E4W C;  3SE0 A;  2YTX A;  3PIO A;  5LMU Q;  1PH2 A;  3H3V I;  2XWJ B;  5CV6 A;  3MC0 B;  3L0O A;  4K14 A;  1EIG A;  4DK0 A;  5M5W B;  3CAM A;  3V96 A;  2WIN B;  4KLK A;  3G71 A;  2YTV A;  1XNR Q;  3CCQ A;  2KEE A;  3OWF A;  3MZ5 A;  1N33 Q;  1SYG A;  3P75 A;  4K0K L;  1KXL A;  1HH2 P;  5I9P A;  4U67 3;  4WRD A;  3SEB A;  2G5D A;  2RSO A;  1WTW A;  2R93 B;  3CC2 A;  5FO9 B;  4B3T Q;  5GAH C;  2A6E D;  2JE6 I;  2ID0 A;  2VUM B;  1MKH A;  5L37 A;  1CI3 M;  3N52 A;  5C4X G;  1Q82 C;  2X6G A;  2XIW A;  1F9P A;  3DWQ A;  3M7N A;  4A3C H;  2VW9 A;  5C3X A;  1TWG H;  1LV9 A;  5E3F A;  4A3F H;  5G3L D;  3U9O A;  1DON A;  3A5Z B;  4NB3 A;  4QL5 A;  2I5H A;  3CME A;  3CCS A;  1G91 A;  2PW7 A;  1ZEQ X;  1F9Q A;  1HJP A;  1SE4 A;  4LAA A;  5CGK A;  1ZYR D;  2EYH A;  3RLO A;  4A3K B;  1OTC A;  1EIH A;  1IBM Q;  4HMI A;  1UUP A;  2UUC Q;  4LF9 Q;  4DR1 L;  1OO9 B;  4A93 G;  2KBN A;  1MI2 A;  4JBM A;  2EE1 A;  1WTP A;  1PTO D;  2F0L A;  2UXD L;  4KTA A;  4JI1 L;  3TN2 A;  1XX8 A;  5KND A;  3HOZ H;  1GHK A;  2CW0 C;  3LNN A;  3NP8 A;  1Q7Y C;  4X3U A;  5IYD G;  2JEA I;  1TKW B;  1VQG A;  1EY0 A;  4Z9C B;  1UAP A;  3W3A A;  4A3D G;  2ES2 A;  4G7Z C;  4DNI A;  1U9R A;  4A3M G;  4I7A A;  4DV0 L;  3HOX B;  3BG3 A;  3GTP H;  2YU9 B;  4IZ8 A;  4GN5 A;  4GKJ Q;  3RMH A;  4Q0F A;  1ENF A;  3A7A B;  1SNP A;  1TII D;  3VR6 A;  2EYM A;  3C2P A;  4DV2 Q;  2XVS A;  3URY A;  2AUK A;  2F0K A;  4KKU A;  4A3F G;  3ICE A;  4A3B H;  1IXR A;  4LFC L;  5KRU A;  1X6O A;  3HKZ E;  2FIN B;  2JA6 B;  2D0P A;  2RDH A;  3S1Q H;  1II3 A;  3CU7 A;  1XMQ Q;  2E8G A;  3L9A X;  1Z7T A;  1FVI A;  2G9D A;  4KY7 A;  3OOC A;  2K1B A;  4EQN A;  2JA8 H;  3BDO A;  4AH6 A;  2JA7 H;  3CMA A;  2VNU D;  5CC4 A;  3D8G A;  2Z4I A;  4ZLT F;  5ELB A;  1PH3 A;  1AH9 A;  4FXK C;  5KGU A;  2N78 A;  4L5T A;  1CA5 A;  3T51 B;  2I5M X;  4ZUJ A;  2B2U A;  1ASY A;  1K28 A;  1F9R A;  3ONA B;  4F87 A;  5J1Z A;  4TKO B;  3NBH A;  3H15 A;  2B63 B;  1Q1B A;  3U9S A;  4H13 C;  4JC0 A;  2F0F A;  2KCN A;  2WAQ B;  5JVH 3;  1YIJ A;  1JB3 A;  1ZXT A;  3K80 C;  1STB A;  3VYR A;  1Y1W G;  1KIX A;  4DV6 Q;  2R93 H;  4LWC A;  1HR0 Q;  4RAU C;  3RLN A;  1ESR A;  3H3V C;  1L2F A;  1PH1 A;  2OF1 A;  4DNR B;  2R3Z A;  5BR8 L;  1TU2 B;  3CXC A;  3D3R A;  2UUC L;  4LF9 L;  1WFQ A;  2ENB A;  2VB3 X;  3MFG A;  4KD4 A;  1WTX A;  2Y0S E;  3NUC A;  5DEH A;  3S1M H;  3D6W A;  4A3B G;  3S2D B;  1A6X A;  4OWX B;  1CHQ D;  2WII B;  4BY7 B;  4J8Q A;  2R7F A;  2LXJ A;  1ET6 A;  1RHP A;  4UDU C;  1EQT A;  5C3W A;  1PFN A;  5CBA E;  4G7H C;  1I3Q B;  2MO1 A;  4N9T A;  4BS9 A;  5BN5 A;  3GP7 A;  3FRP B;  4QCL A;  2KED A;  4HCS A;  4JCV E;  3KDF B;  1UE7 A;  3SHL A;  3P1H A;  3NBI A;  1HNX L;  2O2L D;  3N6R A;  2NVX B;  1E3P A;  4DV2 L;  3PUZ A;  5T1I A;  4IPG A;  1U4R A;  2PQE A;  4CJ0 B;  5FOB B;  3GTK H;  4TRD A;  4CHT B;  1XMQ L;  1J6Q A;  4KHV A;  3NPP A;  1PZI D;  1PMR A;  3SK6 A;  1WCM G;  4JI7 Q;  2VUM G;  2WFW A;  5AJ3 Q;  1VMP A;  1JIC A;  1N32 Q;  2J0T D;  2QEJ C;  2YU9 H;  3PO3 B;  3CW2 C;  4G4K A;  4IJH A;  1SEB D;  1SFO B;  3O13 A;  1XYI A;  4RHS A;  4BWG B;  3J7A F;  1SE2 A;  3C46 A;  2XTI A;  2JA6 H;  3I4N G;  2NVQ B;  2OWO A;  2K28 A;  1Q90 A;  1OXU A;  2LXK A;  4DV1 L;  1BOS A;  4OON A;  1EOT A;  2EYP A;  5M3F G;  5C4J H;  3ERQ A;  4A3K G;  2RCN A;  2KCT A;  4DAM A;  1D2B A;  5TSS A;  1HHV A;  1SSO A;  3OW2 A;  5DM6 3;  1CSQ A;  1WTH A;  4NXM Q;  2F0V A;  2LFN A;  2VQE L;  4DFA A;  3PF5 A;  4MIU A;  1GKH A;  4MZ9 A;  2ICI A;  3GTL B;  3A8I E;  2IW3 A;  3NWS A;  3TP8 A;  2QIL A;  4ZUI A;  1K0S A;  4DUY Q;  3KBG A;  2Z0S A;  5I9O A;  3NXW A;  1SYF A;  2AQ3 B;  4FVM A;  3H3V H;  2C9O A;  1TWH H;  2ZM6 L;  1K73 C;  5GAD C;  1YNN D;  1CKM A;  4V19 0;  2NVY B;  4UP7 A;  1C7Y A;  3HOX G;  4LFA Q;  4GZY C;  2IHF A;  1Q3L A;  1IZ6 A;  1CTM A;  1SNC A;  1LTA D;  3TS0 A;  1PYS B;  1PRT F;  2R7D A;  3BDC A;  4QQB X;  4LF6 Q;  4HJ8 A;  2VQF L;  1CK1 A;  3ULJ A;  1KDC A;  5FK9 C;  4BY7 H;  3S2H B;  3HOV G;  4IPC A;  1QNU A;  1TY0 A;  1IL8 A;  1Y1V B;  2K14 A;  3PCO B;  2C35 B;  1SE3 A;  3L3O C;  4AYB B;  5LL6 S;  2XRS D;  1OXV A;  5IWA Q;  4WFN 3;  1V1P B;  3DMU A;  3DEO A;  4L5R C;  2PI2 E;  3KLW A;  3ERS X;  2HQE A;  5IP7 H;  3MAQ A;  2NVX H;  2B63 G;  4LUZ A;  5M5X H;  3PUY A;  1M4V A;  1UE5 A;  4RKB A;  3EJI A;  2SEB D;  2X6L A;  2WAQ G;  1JE4 A;  2K03 A;  3MXN A;  1KLG D;  3PIO 3;  1IBK L;  4A3G B;  1K3B C;  1ONL A;  4JOI C;  4YWM A;  1LM0 A;  2NVT B;  3Q6S A;  4ZCK A;  2ZTC A;  3CQZ B;  4L5S A;  5IGD A;  2RCF A;  5ELE A;  4NXM L;  2F1M A;  4DR2 Q;  3NEM A;  1SFO H;  4A3I H;  1O78 A;  4Y7N H;  2J4X A;  4CDE C;  3RZD B;  3X3M A;  3I4M G;  2PZU A;  4X64 L;  4IFD G;  4RGO S;  1EIY B;  3LGJ A;  2R7Z B;  1B9M A;  2NVQ H;  1QVF A;  1PTO B;  4OEM B;  1Q8K A;  2BDO A;  1DCZ A;  3TQY A;  3ULL A;  1HXY D;  4GOP A;  1HFG A;  1PTO C;  3I55 A;  3D4D A;  4GNX A;  4JI4 Q;  5IP7 G;  1AFP A;  1I6H B;  5EKK A;  3EIV A;  1S5B D;  2O4X A;  3S24 A;  3F2D A;  1D5M C;  1SYB A;  1BBW A;  4DAV A;  1HZ9 A;  4OGQ C;  4DR7 Q;  1HZC A;  4R4C A;  4N8X 1;  5C0X G;  1WJJ A;  3EFX D;  3HZX A;  4BXX H;  4B9W A;  1BBX C;  1EY5 A;  2NVY H;  1SRU A;  2CQA A;  2Z6K A;  4DPG A;  1JR0 D;  3PO3 G;  1CUK A;  1E2V A;  5JJZ A;  4GKK Q;  4RKL A; 
#chains in the Genus database with same CATH homology
 1XPO A;  1L0W A;  3AEV A;  1HR0 W;  1VCI A;  3F1Z A;  3G48 A;  1VQB A;  4BBR H;  5FLM H;  2K5N A;  2FXQ A;  3F2B A;  4OWT B;  4UPA A;  3RN2 A;  4JV5 Q;  1TXY A;  2VS1 A;  4A3L H;  3M85 A;  1V9P A;  2EIF A;  2E5L L;  1OXS C;  4HJ5 A;  1N8R C;  1A63 A;  2F4V L;  1NE3 A;  1K0R A;  2Q2U A;  2PQA B;  2UXB L;  4UP8 A;  4LF8 Q;  3PUX A;  5ELN A;  3KJP A;  3S2H H;  5M3M H;  3A74 A;  4B3S L;  3HOU H;  3PUW A;  4HJA A;  3M4P A;  2ZJR A;  5LMN L;  3HOY H;  3S2D H;  5IYB G;  3A5U A;  1KHI A;  3I2Z A;  5IP9 G;  4GN3 B;  1XPU A;  1X9N A;  2YTX A;  5IYC H;  1Q46 A;  3PIO A;  1X3G A;  5LMU Q;  1JJG A;  1PH2 A;  2K75 A;  3U50 C;  3H3V I;  4DK3 C;  4B3R Q;  1HNZ Q;  3HOZ G;  2A8V A;  4A3J G;  5K36 G;  3HOW H;  5GAG C;  2MNA A;  3I4M H;  3L0O A;  4J15 A;  4LFB L;  1KC8 C;  2DGY A;  4JI7 L;  1I3Q H;  4GOP B;  1CKO A;  3CAM A;  3G71 A;  4KLK A;  2R92 H;  3BZK A;  2YTV A;  5AJ3 L;  2IY5 B;  2GN5 A;  3CCQ A;  2XGT A;  1XNR Q;  3I7F A;  4DV1 Q;  4GNX B;  1V1Q A;  1N33 Q;  1N32 L;  1KXL A;  4K0K L;  3KJO A;  1HH2 P;  3TS2 A;  1CKN B;  4LNQ A;  3UE0 A;  4GOP C;  3H0G G;  4KI0 A;  3S14 H;  3CC2 A;  3BZC A;  2D62 A;  3CCL A;  4B3T Q;  3S1R H;  1YVC A;  5GAH C;  3UDI A;  4TVA B;  4DUZ L;  4GNX C;  5HGQ A;  2B29 A;  2HIV A;  2JE6 I;  1TWF H;  3KF8 B;  2ID0 A;  2VQE Q;  1VQI A;  3CC4 A;  1FJG L;  4NPS A;  4PZ7 A;  2PMZ E;  1JE5 A;  2NVT H;  4BBS G;  5LMN W;  1I94 Q;  1MKH A;  1L1O B;  1YI2 A;  1VQ9 A;  4WJ4 A;  1H95 A;  4O2D A;  1EOV A;  5IE8 A;  1JB7 A;  1VQL A;  5C4X G;  1I50 H;  1Q82 C;  1G29 1;  1PV4 A;  2ZM6 Q;  1I5F A;  1VQ7 A;  4YY3 L;  2JA8 G;  3M7N A;  5C3E H;  4A3C H;  2JA7 G;  4IJL A;  3G6E A;  1QUQ B;  4OWW B;  3NEN A;  4JI6 Q;  2VW9 A;  2UXC L;  4NXN L;  1TWG H;  4A3F H;  4DR7 L;  1EQR A;  4UY8 C;  2Z6K C;  3PO3 H;  3A5Z B;  4NB3 A;  4QL5 A;  4LF4 L;  1AE3 A;  1Y1V G;  2I5H A;  2V1C C;  3CPF A;  2IX1 A;  2CKZ B;  5H1S E;  2UUB L;  3GDE A;  3CME A;  3CCS A;  4AYB G;  3KYH C;  2PQA A;  5GRO A;  5FLX c;  1VQC A;  1HJP A;  1VQE A;  2CFM A;  2K52 A;  3T1H Q;  4DUY L;  2WB1 G;  3RLO A;  2VQF Q;  1KQS A;  4LF5 Q;  2K50 A;  1OTC A;  1PFS A;  5JEA G;  1VQK A;  1IBM Q;  3W1G A;  2UUC Q;  4JI0 L;  3B6Y A;  4C3I H;  2BH8 A;  4QJF A;  4DR1 L;  4LF9 Q;  4GKK L;  2R93 G;  3J80 i;  3TRE A;  2I0Q A;  3NBH B;  1OXX K;  4A93 G;  2KBN A;  4GS3 A;  1XMO Q;  2NN6 G;  4JBM A;  1J5E Q;  3WWV A;  4KHP L;  5IYB H;  1SN8 A;  1YJW A;  2HIX A;  1GVP A;  5IP9 H;  1IL2 A;  4DAY B;  4LFA L;  3GTG H;  2UXD L;  1P8L A;  5JJL A;  2DUD A;  4JI1 L;  4R1J A;  1U5K A;  1E22 A;  2AWO A;  2OTJ A;  4HJ7 A;  1W2B A;  3HOZ H;  4A3J H;  2VY3 A;  4A3G G;  1PHJ A;  4LF6 L;  1CSP A;  1JJC B;  3CP0 A;  1Q7Y C;  2JEA I;  3F8T A;  4QIW E;  5IYD G;  1B7Y B;  1VQG A;  4YCV A;  1KAW A;  3STB D;  4A76 A;  1MJE A;  2VL6 A;  1VQO A;  1VQ5 A;  2HT1 A;  4A3D G;  2ES2 A;  4JI3 Q;  4DNI A;  3K7U C;  3PV0 A;  4X65 Q;  3FKI G;  4A3M G;  1N36 L;  2UU9 L;  3STB C;  3J80 c;  3I56 A;  1HNZ L;  3PSI A;  4DV0 L;  3GTP H;  3JAM i;  2CWP A;  4GN5 A;  3H0G H;  4GKJ Q;  2RHS B;  2QA4 A;  1EQQ A;  1K9M C;  1L1O A;  1C9O A;  3DM3 A;  1PYB A;  2PNH A;  4IOA A;  4DV2 Q;  1IBK Q;  1E7Z A;  5IWA L;  4A3F G;  2CCZ A;  3ICE A;  4A3B H;  1IXR A;  4LFC L;  3CCU A;  1X6O A;  3RLF A;  4BBS H;  3HKZ E;  4JG2 A;  3GTQ H;  1IYJ B;  2F3I A;  4BA1 I;  2D0P A;  3S1Q H;  1D7Q A;  2R7Z G;  1XMQ Q;  3BU2 A;  2E2J H;  2E8G A;  1O7I A;  1FVI A;  1SRO A;  1E1T A;  2IHE A;  2YTY A;  2ZTD A;  1WYD A;  4JOI A;  5C4X H;  4YHH Q;  1ASZ A;  4OX9 Q;  1EIF A;  4PZ8 A;  2JA8 H;  3JAM c;  4AH6 A;  2JA7 H;  3CMA A;  2VNU D;  1LUZ A;  1I94 L;  4OO1 I;  2OQK A;  2JEB I;  2NZO A;  4DR4 Q;  3W5O A;  1PH3 A;  1AH9 A;  2L15 A;  1IBL Q;  3RR5 A;  4HJ9 A;  4X62 Q;  4APV A;  1Y1V H;  2N78 A;  4L5T A;  4IO9 A;  4X64 Q;  1JMC A;  2I5M X;  5C44 G;  1SR3 A;  1ASY A;  3D31 A;  4X66 L;  1JJ2 A;  1KRS A;  4QGU A;  3H15 A;  1YBY A;  1Q1B A;  1NMF A;  2RHQ B;  4EQ5 A;  2QEX A;  4JC0 A;  4JI5 L;  1YIJ A;  2HHH Q;  3I4O A;  1HZA A;  1PVO A;  3K80 C;  5EAY A;  3T1Y Q;  1Y1W G;  1R9T H;  1KIX A;  4YWK A;  4DV6 Q;  4XIG S;  4LWC A;  4DR2 L;  4DV5 Q;  1HR0 Q;  1MIU A;  2R93 H;  3KFU A;  1VQD A;  1QVG A;  1S72 A;  4A93 H;  3EN2 A;  3GO5 A;  3RLN A;  2YYZ A;  4IPH A;  4LUV A;  3T1H L;  2OTL A;  3NEL A;  2IT1 A;  1L2F A;  4JYA Q;  1PH1 A;  2VZA A;  3HFZ B;  1PH4 A;  4LF5 L;  5BR8 L;  1VQM A;  3D0F A;  1VQJ A;  5ELO A;  3CXC A;  2JA6 G;  1MJC A;  1VQA A;  2UUC L;  1WFQ A;  1YEZ A;  1EYG A;  4LF9 L;  4A3G H;  3U4V A;  1VS0 A;  2JK8 A;  4DV4 Q;  1XMO L;  2Y0S E;  4B3M Q;  1VQN A;  5JJI A;  3S1M H;  4DV7 L;  2HQL A;  3K0X A;  4A3B G;  1W3S A;  5IYD H;  4OWX B;  3UDX A;  1HNW L;  2MFI A;  4LW1 A;  4R4Q A;  4A3D H;  1C0A A;  5FJ8 G;  3CQZ H;  4A3M H;  3FKI H;  4IFD I;  4AQY Q;  2D0O A;  2R7F A;  2LXJ A;  1NJI C;  4JI4 L;  3S1N H;  1PH5 A;  5HY6 A;  3PUV A;  4TQU S;  3J7Z C;  1X54 A;  3CCE A;  1L1O C;  4P71 A;  2MO1 A;  2Q2T A;  2WAQ E;  1K8A C;  2YV5 A;  4PG3 A;  4JI3 L;  2F52 A;  4DR5 L;  4ME3 A;  2JA5 G;  4A75 A;  1A62 A;  1YZ6 A;  3RZD H;  2RF4 A;  4JCV E;  3KDF B;  1UE7 A;  3W1B A;  4GN4 B;  4YCU A;  4JI2 Q;  3CCV A;  1HNX L;  2ZJP A;  2F4V Q;  2R7Z H;  2UXB Q;  2EXD A;  1SLJ A;  3K8A A;  3U58 A;  1E3P A;  4DV2 L;  3PUZ A;  1PH6 A;  3K81 C;  5GAE C;  2WP8 J;  4IPG A;  2UUA L;  3U4Z A;  1PH8 A;  2B3G A;  4IFD J;  1KD1 C;  4AIM A;  2OQ0 A;  4GLV B;  3GTK H;  1M1K C;  3J81 i;  1XMQ L;  1FL0 A;  4POF A;  5C0X I;  3M4O H;  1J6Q A;  2N8N A;  1K8G A;  1I6H H;  1SMX A;  4OX9 L;  4P72 A;  1WCM G;  5C44 H;  2H5X A;  4YHH L;  5DLQ E;  1B70 B;  4JI7 Q;  4JV5 L;  4MNO A;  2VUM G;  1BBU A;  2E2H H;  1QVC A;  3M4Q A;  1K83 H;  2ZTE A;  2WFW A;  5AJ3 Q;  1Q81 C;  4BY7 G;  1YIT A;  4LF8 L;  2CQO A;  1IBL L;  3S15 H;  4K0K Q;  3E9H A;  1N32 Q;  1NMG A;  1Y1W H;  2YU9 H;  3PO2 G;  1YJN A;  4JBW A;  1UEB A;  3ZJY C;  1X3F A;  3CW2 C;  3M3Y H;  1G6P A;  4IJH A;  1S40 A;  1N9W A;  2GVA A;  2QGQ A;  1UWV A;  4DUZ Q;  5LMU L;  3ER0 A;  1WI5 A;  1K3R A;  1Z9F A;  3AYH B;  3J81 c;  4B3R L;  3M9B A;  1U0L A;  1FJG Q;  4DR6 Q;  1VQP A;  2XTI A;  1NY4 A;  2R6G A;  4XTC S;  5IY0 A;  3GD7 A;  1LTL A;  5C0X J;  2JA6 H;  3I4N G;  2JJQ A;  1X55 A;  1AE2 A;  3K7A H;  4DV5 L;  4P75 A;  3BJU A;  3AFQ A;  2OWO A;  1X65 A;  3Q8D A;  4ALP A;  1XNR L;  1OXU A;  2LXK A;  4DV1 L;  1N33 L;  4OON A;  1JT8 A;  1N34 Q;  1TWA H;  2A1A A;  3KOJ A;  4HID A;  5M3F G;  4YY3 Q;  5C4J H;  3J81 j;  4A3K G;  5FJ8 H;  2RCN A;  2KCT A;  3IRB A;  1Q86 C;  1GM5 A;  4DAM A;  4B3T L;  2UXC Q;  1LYL A;  3OW2 A;  3CD6 A;  1E1O A;  1CSQ A;  3HKZ G;  4NXM Q;  3KDF A;  3DLL A;  4DV4 L;  4LF4 Q;  2VQE L;  1HZB A;  2AWN A;  2UUB Q;  3PF5 A;  1GKH A;  2K4K A;  4MZ9 A;  4DK6 C;  4L5Q A;  2KHJ A;  3MXN B;  3L2P A;  2JA5 H;  3KF6 A;  3RN5 A;  5E7N A;  3PGZ A;  4DUY Q;  3MEF A;  3FHW A;  2Z0S A;  5M5Y H;  4A3E G;  3H3V H;  3JC6 6;  2BH2 A;  1EUJ A;  2ZJQ A;  2BA0 A;  1TWH H;  2ZM6 L;  4JI0 Q;  5M5W H;  1K73 C;  5GAD C;  1X3E A;  4A3I G;  1CKM A;  1XJV A;  4JI6 L;  3GTL H;  4UP7 A;  3F2C A;  1C7Y A;  4KHP Q;  4A4I A;  3HKS A;  3ULP A;  1NTG A;  3HOX G;  1Q12 A;  4LFA Q;  2UXD Q;  2IHF A;  4JI1 Q;  1IZ6 A;  1KL9 A;  2KHI A;  4JI2 L;  3CPW A;  3TS0 A;  3OTO Q;  2AMC B;  4QY7 A;  4C3H H;  1PYS B;  5JJK A;  2R7D A;  4QQB X;  1RL2 A;  1EWI A;  4BY1 G;  4LF6 Q;  1WCM H;  1Q1E A;  1VQF A;  2JA9 A;  4PMW A;  4HJ8 A;  1XNQ Q;  3TRZ A;  2VQF L;  2VUM H;  3J7A 5;  3G4S A;  3ULJ A;  4EX5 A;  1VQ8 A;  2MQH A;  1IBM L;  4BY7 H;  3AFP A;  1T9H A;  3CF5 A;  1N36 Q;  2UU9 Q;  1NBW A;  3HOV G;  1QZH A;  4IPC A;  4DV0 Q;  3PO2 H;  4R4O A;  1J5E L;  2K14 A;  4C3J H;  2BA1 A;  3PCO B;  2Q2H A;  2C35 B;  3HOU G;  4JI8 Q;  4UP9 A;  4HIK A;  1VQ4 A;  4LF7 Q;  1UE6 A;  2Y0S G;  2MO0 A;  1OXV A;  4DV3 Q;  4X6A H;  5IWA Q;  1G51 A;  1XPR A;  4LFC Q;  4H02 A;  4OO1 G;  4L5R C;  2PI2 E;  2NZH A;  4DR3 Q;  3FP9 A;  3KLW A;  2A19 A;  4HIO A;  3I4N H;  3ERS X;  2NN6 I;  1VQH A;  3A0J A;  4O0A A;  4IPD A;  4P73 A;  2NVX H;  5IP7 H;  4BXX G;  2B63 G;  1VQ6 A;  4X65 L;  4LUZ A;  5M5X H;  3PUY A;  1UE5 A;  3AQQ A;  5M3F H;  2WAQ G;  4DR6 L;  1Y14 B;  4A3K H;  4MTN A;  4R4I A;  4GKJ L;  2E2I H;  2E5L Q;  4PZ6 A;  1UE1 A;  4GLA C;  2ATW A;  3PF4 A;  2N3S A;  1IBK L;  1V43 A;  4B3S Q;  3KF6 B;  3GTJ H;  2AHO B;  4JOI C;  4YWM A;  3CCM A;  5LMN Q;  1N34 L;  2ASB A;  4BBR G;  2AKW B;  2CWA A;  5FLM G;  1LM0 A;  3CC7 A;  1OXT A;  1YJ9 A;  3RZO H;  4X66 Q;  3OYY A;  4A3L G;  4Y52 H;  5JEA J;  4R4T A;  2PI2 A;  2LSS A;  2ZTC A;  2EQS A;  4YWL A;  2Q2I A;  4JBK A;  1XTD A;  4L5S A;  4AYB E;  3RNU A;  1BVS A;  3CCR A;  4JI5 Q;  1Z47 A;  1GO3 E;  4YCW A;  5M3M G;  4A3E H;  4NXM L;  4LFB Q;  1YNX A;  4DR2 Q;  4KHZ A;  3GTM H;  3HOY G;  4LUO A;  3NEM A;  2WB1 E;  1KRT A;  2JQO A;  1SFO H;  3GTO H;  4A3I H;  1S3O A;  3EBE A;  4DR4 L;  5IYC G;  3UDF A;  4Y7N H;  4POG A;  1DGS A;  1PH9 A;  3HOX H;  3UE1 A;  4X62 L;  3TEH B;  3HOW G;  3I4M G;  1A0I A;  2IX0 A;  3E0E A;  2N49 A;  4RMF A;  5BR8 Q;  4X64 L;  2KCM A;  4IFD G;  4GLX A;  1EIY B;  3LGJ A;  1YHA A;  2NVQ H;  1M90 C;  1QVF A;  2R92 G;  1TWC H;  2I5L X;  4BY1 H;  1Q8K A;  4DV7 Q;  3TQY A;  1QZG A;  3ULL A;  2HHH L;  4P74 A;  4C2M H;  4GOP A;  3T1Y L;  1HNW Q;  4JBJ A;  4IOC A;  4DV6 L;  2OCE A;  3E9I A;  1HR0 L;  3I55 A;  1A8V A;  1BKB A;  3OTO L;  4GNX A;  5IP7 G;  4JI4 Q;  3HOV H;  1YHQ A;  3CCJ A;  3UDG A;  1CKN A;  3SGI A;  1PA6 A;  5GQO A;  3EIV A;  2KEN A;  1XNQ L;  4JYA L;  3S24 A;  3S17 H;  3F2D A;  1YHB A;  1B8A A;  2GVB A;  2ALY B;  1BBW A;  1EFW A;  4DR5 Q;  1HZ9 A;  1PH7 A;  3VDY A;  4NXN Q;  4DR7 Q;  4DKA C;  1HZC A;  4R4C A;  1GD7 A;  4B3M L;  4RG1 A;  3S16 H;  5C0X G;  5J3B A;  4OXP A;  1WJJ A;  1SE8 A;  1X56 A;  1HNX Q;  4JI8 L;  4WJ3 M;  4HIM A;  1P16 A;  4LF7 L;  5C3E G;  1E24 A;  4BXX H;  2B63 H;  3PIP A;  1WOC A;  5IT9 c;  4A3C G;  2NVY H;  4DV3 L;  1SRU A;  4AQY L;  1D8L A;  1FGU A;  2K5H A;  2Z6K A;  4DPG A;  4BA2 I;  2UUA Q;  1RIP A;  2K5V A;  3PO3 G;  4DR3 L;  1CUK A;  4GKK Q;  4DR1 Q;  1QUQ A;  3L7Z C;  4FDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...