2OQ0A

Crystal structure of the first hin-200 domain of interferon-inducible protein 16
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
189
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Gamma-interferon-inducible protein Ifi-16
publication title Crystal Structure of the First HIN-200 Domain of Interferon-Inducible Protein 16
rcsb
source organism Homo sapiens
total genus 35
structure length 189
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A01
1H95A 3T1HL 2MQHA 1VS0A 3CD6A 2PQAB 3PUWA 2D0PA 4JI3L 1A8VA 4KHPQ 2UUCQ 1YEZA 3M7NA 4IPHA 4MTNA 3I4NH 4DKAC 5BR8Q 3NENA 4GN4B 4APVA 2JA6G 4NXML 4A3DH 1TWFH 4IJHA 4IO9A 3E0EA 3S24A 2F4VQ 1IBLQ 1VQ6A 4GNXB 4DR2L 1CKMA 3BJUA 5FJ8G 2NZHA 4A4IA 2HQLA 4LF9Q 5C44H 3GTKH 4A3LG 4K0KL 5JJIA 1EIYB 1PYSB 3S17H 4A3JH 4JI7L 1AE2A 2MO1A 4DPGA 2VQFQ 2RHQB 2ALYB 1IBML 4JOIA 4B3SQ 1NJIC 3ERSX 1M90C 3WWVA 1J5EL 1B70B 4HJ9A 4TQUS 1UE1A 3M4QA 4DV6Q 1GM5A 1PH8A 4LFBL 4XTCS 2F52A 4C2MH 1JJCB 1NE3A 4P73A 3G71A 1PH1A 1M1KC 3NBHB 5IYDG 2Q2HA 4IFDG 4GOPA 1EQRA 1JJGA 2AMCB 4OX9Q 1I94Q 1X3EA 1GVPA 1L1OC 3L0OA 2VS1A 3NEMA 1NY4A 2OTLA 1SFOH 4DR6Q 1YIJA 2R7ZG 3PUYA 4GKJL 4XIGS 3GD7A 2K50A 2ID0A 2UUBL 5IP7H 3F2BA 5E7NA 2ZM6Q 1K83H 4GLXA 4DR3Q 2IHEA 4MNOA 4JV5L 3ZJYC 2OQ0A 3EN2A 1L1OA 3K80C 2JEBI 2AWOA 4DR4L 3PO3G 3CAMA 1U0LA 5M3MH 4A3KH 1XMOQ 3KDFA 5GROA 4A3MG 1TXYA 1Y1VG 3A5UA 2Q2UA 2ASBA 4A3CG 1S72A 3UDIA 4B3RQ 3I4MG 3M85A 3F8TA 1PFSA 2RCNA 4A75A 1TWHH 3UDXA 4R4CA 1L1OB 4DUYL 3TS0A 3GTPH 3CQZH 3PO2G 1O7IA 4IJLA 5GADC 2CCZA 4LF8L 1S40A 1MKHA 5IWAL 2K14A 4RG1A 3SGIA 4JI8L 4LUZA 2NVYH 3GTJH 1VQ9A 4A3GG 4GKKL 2CWPA 4A3IG 4LF7Q 4DR5L 2E5LQ 1VQ7A 2MFIA 1V9PA 2E2JH 1YHAA 4BY7G 4X66L 5FJ8H 4DV4Q 4JI5Q 1JE5A 1EWIA 2NN6G 1SROA 2R92G 4AYBE 3RLFA 4ALPA 3D31A 2EXDA 4GN3B 1NMFA 3FP9A 3K7AH 4X62Q 4LUOA 3H0GH 3J81i 1C0AA 5EAYA 2OTJA 4HIKA 4LWCA 3M4OH 4C3JH 1HNWQ 1YI2A 3TEHB 2RHSB 3S1MH 3STBD 4P74A 4NPSA 5FLMG 4YY3L 3M4PA 5C0XG 4JI6L 3VDYA 2F3IA 3D0FA 1E1TA 1VCIA 2UUAQ 2AWNA 4DV3Q 1OXTA 3U4ZA 5C4XH 2VY3A 5M5XH 4BXXG 2ZTEA 3W1GA 4DV1L 5IYDH 2EQSA 3PF4A 4YWLA 5IE8A 4DR7L 2XTIA 1G6PA 2D0OA 4QL5A 4GLAC 2A19A 1XJVA 2A1AA 2PNHA 4DNIA 3JC66 2Q2TA 3E9IA 4OWTB 4PZ6A 4X65Q 4X64Q 1QVCA 4LFCQ 2VL6A 2R7ZH 2I5LX 3AFPA 1GKHA 1VQ4A 2A8VA 1RIPA 5IT9c 3J81c 4A76A 1PH7A 1WI5A 5IYCG 4DV7Q 3KFUA 3CCEA 2B63H 1PA6A 3HOVG 1WYDA 3S2HH 3STBC 2R93H 1CKNA 2NVXH 2HHHL 2ZTDA 3RNUA 4JI2L 4JI0Q 1WCMG 1W3SA 4NXNL 3RR5A 2K5NA 1B8AA 4DUZL 4EX5A 3KLWA 1XPOA 2JA5G 1OTCA 3PO3H 5HY6A 4H02A 2HT1A 1Y1VH 2IT1A 1EQQA 4DV2Q 2N3SA 4QIWE 4NB3A 4JI3Q 3ICEA 1YHQA 4A3CH 2N49A 1LM0A 3RN2A 4DK3C 1UEBA 5LMUQ 1VQLA 1JT8A 3I4MH 4JOIC 1N32L 3J81j 3OTOL 1KQSA 4PZ8A 3PV0A 3JAMc 4POGA 1I6HH 4WJ3M 4KI0A 2VQEQ 2GVAA 2CFMA 1SLJA 3PO2H 1QUQB 2HIXA 2YTVA 2KBNA 1Q46A 4P72A 3UDFA 1U5KA 2UU9L 3PUXA 1Q12A 4A3GH 1OXVA 2MO0A 4A3IH 1OXUA 2JE6I 3GTGH 4IFDJ 2LXKA 4DK6C 1VQ5A 2PMZE 2XGTA 4GOPC 1N33L 1TWAH 1IBMQ 3AEVA 2IX1A 4HJ8A 4BY7H 1KRTA 1PH3A 3HOZG 1PVOA 1XNQQ 4A3BG 5M3FG 2R92H 4EQ5A 4JI4Q 2QGQA 4KHPL 2E8GA 2JJQA 5C4JH 1VQOA 1PH9A 1J5EQ 4JI0L 4LFAL 1HZAA 2Z6KA 1VQ8A 4LFBQ 4UPAA 1HR0Q 4X6AH 1VQAA 2CWAA 1TWGH 4DV0L 1AH9A 1HNXQ 3MEFA 5FLMH 4YHHQ 1IBLL 2F4VL 5GAHC 2WB1E 2JA8G 1I5FA 1I3QH 5IYBG 3I2ZA 1SN8A 3HKZE 3CCJA 4HIOA 3LGJA 1P8LA 1CSQA 1VQEA 3HKSA 2K5VA 2KCTA 3RLOA 5HGQA 1PHJA 1HH2P 2EIFA 4Y7NH 1KD1C 2OWOA 4B3TQ 2YV5A 4A3FG 4BXXH 2UXBL 1HZBA 2BA1A 2Y0SE 1LYLA 1N36L 4LF5Q 3A74A 2D62A 1Z9FA 2H5XA 4ME3A 4BBRG 1N9WA 4R4TA 2UUBQ 3FHWA 3H3VH 1EIFA 2QA4A 4LF4L 4GOPB 3AQQA 4HIMA 3TQYA 1XMQL 1X65A 2GVBA 1Y14B 4JV5Q 1C7YA 4YCVA 1YVCA 5IYCH 3HOUG 4DR1Q 4DR4Q 1FVIA 3HOVH 3PSIA 1VQNA 1K3RA 4OXPA 4HJ7A 1VQGA 3PIPA 3CXCA 1DGSA 1PH6A 1NMGA 2ZJPA 4OX9L 3ULJA 3NELA 1WCMH 5LMNQ 4JI1L 2PI2E 2WFWA 3CC2A 2JA5H 1YNXA 2FXQA 3BZKA 4P71A 4YWMA 5GQOA 1UE5A 3PUZA 4BA1I 4DAYB 2VNUD 1Q81C 4DUYQ 2UXDQ 2K4KA 5IWAQ 4IOAA 3KDFB 4GKKQ 4WJ4A 5ELOA 2ZM6L 4JG2A 2JA6H 4LF6L 3K81C 2LSSA 5M5WH 4OONA 3CC4A 3KF6A 3DM3A 1AE3A 3PGZA 2WP8J 4X66Q 3CPWA 1WFQA 1XMOL 2Z0SA 4JBWA 2BH8A 3E9HA 1I50H 3L7ZC 4A3LH 4AH6A 2I5MX 2VW9A 1A63A 1HZCA 3HOXG 1J6QA 1L0WA 1K0RA 4UY8C 1XNRL 3S1RH 3KF6B 5M3FH 1QZGA 2ZJRA 4YY3Q 4JI6Q 4AQYL 1FJGQ 3K8AA 3J80i 4JC0A 3IRBA 1PH5A 1SE8A 2OQKA 1CUKA 2R7FA 4LF7L 4C3IH 1IBKQ 2E5LL 1G51A 3HOWG 3I4OA 5GAGC 4IPGA 2JA8H 1NBWA 1LUZA 3B6YA 4R1JA 4AIMA 5IYBH 4HJ5A 3RN5A 1X55A 5JEAJ 1X56A 4DV4L 1K9MC 1C9OA 3H15A 2K75A 1VQMA 1N34Q 2ES2A 3ER0A 2WAQE 4X62L 4LW1A 4R4OA 3T1YL 4PZ7A 3UDGA 4BY1G 2N8NA 1P16A 4BBRH 1CSPA 5AJ3Q 1R9TH 1Q86C 3CCLA 3TS2A 1IL2A 1Q1BA 1EFWA 4GS3A 3ULPA 3BZCA 3W1BA 1Q1EA 1TWCH 4DUZQ 3PCOB 4DV3L 4DV5L 1BBUA 2I0QA 1T9HA 4NXNQ 3U50C 1HNZL 2MNAA 4A3MH 4C3HH 3T1HQ 2JA9A 3S1NH 3W5OA 2QEXA 1IXRA 1N8RC 2E2IH 2ZJQA 4X65L 1W2BA 3GTLH 3CCMA 1N32Q 3EIVA 3I56A 1KC8C 4LFCL 2ZTCA 4NXMQ 1CKNB 1WJJA 2GN5A 3I55A 1EUJA 1PYBA 2PQAA 5IY0A 5ELNA 1OXSC 4L5TA 2UU9Q 4DR2Q 1FL0A 1Y1WG 4A3KG 1YJWA 2Z6KC 1LTLA 1UWVA 3HOYG 4JYAL 1QVFA 2IX0A 4B3ML 4KHZA 4UP8A 4K0KQ 1SRUA 2ATWA 3RZDH 4IOCA 4JI7Q 4OWWB 5C3EG 1KIXA 4GNXA 1HR0L 4DR6L 3CCVA 3OYYA 4DV2L 3KYHC 1KAWA 5FLXc 3G4SA 5GAEC 2KHIA 4LFAQ 2UUCL 5LMUL 3GTMH 5BR8L 3HOXH 3MXNB 3KOJA 3KJOA 3GDEA 4DV0Q 4GN5A 1X9NA 2VQEL 1KRSA 2DUDA 2Q2IA 2KCMA 2OCEA 1HZ9A 5IP9G 2IY5B 3AYHB 3Q8DA 2BH2A 2YU9H 3F1ZA 3M9BA 3U4VA 2VUMG 4POFA 4LF9L 3HOWH 4O2DA 4JBJA 1IYJB 3AFQA 1A62A 2UXBQ 3K7UC 4UP9A 3DLLA 3CCUA 3H0GG 1QVGA 1N36Q 2VQFL 4IFDI 3CCRA 4FDBA 5DLQE 4GKJQ 1XNQL 4B3SL 1VQJA 1X3GA 4JCVE 1YJ9A 4LF4Q 4JI4L 2NZOA 1WOCA 1XMQQ 4BA2I 4L5QA 4TVAB 1VQKA 3TRZA 3CC7A 3FKIG 4UP7A 1S3OA 4YCWA 4BY1H 1D7QA 4MZ9A 3G6EA 4DV6L 2YTYA 4LNQA 5C4XG 4IPCA 1JB7A 1SR3A 1YHBA 3A0JA 3K0XA 3PF5A 1HNXL 4YHHL 1X54A 4LUVA 4QY7A 4QJFA 1ASYA 2JQOA 4QQBX 1JJ2A 2NVQH 1MJCA 4RMFA 4JI1Q 1CKOA 4HJAA 1I94L 3CMAA 2DGYA 1VQCA 3HFZB 2IHFA 4B3TL 3UE1A 2JA7G 1QZHA 1OXXK 2R6GA 2HIVA 2YYZA 4R4QA 5K36G 2WB1G 4LF5L 3CCQA 3HKZG 4A3EG 4LF8Q 2BA0A 2B63G 3U58A 4A93G 1L2FA 4JI8Q 2AKWB 2PI2A 4LF6Q 1UE7A 2I5HA 5C0XJ 2R93G 3L2PA 1YZ6A 3CF5A 4DR3L 4DR5Q 1XPRA 3S1QH 4BBSG 2V1CC 2Y0SG 1BVSA 4DR1L 1V43A 1Y1WH 2B29A 1HR0W 4JBMA 3M3YH 3S16H 4L5RC 4IPDA 5JJLA 3KJPA 3HOYH 1EOVA 4YCUA 1UE6A 1K73C 1K8AC 2C35B 1V1QA 2YTXA 5LMNL 4HIDA 3I4NG 2CKZB 4B3RL 2B3GA 5C3EH 1E1OA 1X6OA 1XNRQ 3HOZH 1Q8KA 2R7DA 3F2CA 1IZ6A 2KHJA 4A3BH 2JEAI 4A3DG 1B7YB 1E24A 2NN6I 4OO1I 4KLKA 3OW2A 4AQYQ 2UXDL 2K52A 1XPUA 3S14H 3RLNA 3GO5A 1BKBA 1X3FA 5C44G 1NTGA 2CQOA 4DV1Q 5JJKA 5IP9H 1Q7YC 4A3JG 4O0AA 4QGUA 5C0XI 4DR7Q 3S15H 5M5YH 1EYGA 3A5ZB 2VUMH 4P75A 3J7A5 2N78A 4JI5L 3TREA 4OO1G 1MIUA 1KHIA 3GTQH 2RF4A 2VZAA 4R4IA 4A3FH 2LXJA 3CW2C 3EBEA 1ASZA 3T1YQ 5J3BA 1VQPA 1KXLA 4DAMA 1BBWA 2AHOB 1VQHA 1SMXA 3GTOH 1HNWL 1RL2A 3PUVA 3H3VI 1FJGL 3FKIH 5H1SE 4AYBG 3PIOA 1KL9A 4DV5Q 1YJNA 1JMCA 4JI2Q 2HHHQ 1Q82C 2UUAL 4Y52H 3HOUH 2UXCQ 1XTDA 1G291 3J80c 1IBKL 1HNZQ 4YWKA 3BU2A 1GD7A 3CP0A 1A0IA 2NVTH 4OWXB 3ULLA 1K8GA 1PH2A 3RZOH 3JAMi 1E7ZA 1FGUA 1VQFA 4GLVB 5IP7G 4GNXC 2JA7H 1N34L 3J7ZC 1VQDA 3OTOQ 1D8LA 3S2DH 4X64L 1E3PA 1VQIA 2KENA 4JBKA 1Z47A 4A3EH 5AJ3L 2L15A 1MJEA 1VQBA 4A93H 4DV7L 1GO3E 2JK8A 3UE0A 5M3MG 3CMEA 1YITA 1PH4A 4PMWA 4PG3A 3I7FA 4J15A 4JYAQ 3F2DA 1PV4A 4B3MQ 4L5SA 1HJPA 4BBSH 2E2HH 1E22A 2K5HA 2WAQG 1YBYA 3G48A 3KF8B 5LMNW 3CPFA 1N33Q 3CCSA 1QUQA 2UXCL 5JEAG
chains in the Genus database with same CATH superfamily
4KKSA 4H7BA 1H95A 3V96A 2MQHA 1HFGA 3PUWA 3ONAB 3CD6A 2UUCQ 3M7NA 2F0DA 2JA6G 1B44D 2WACA 4IO9A 2QDLA 3E0EA 3S24A 4FXGC 4DR2L 1CKMA 3BZDB 2TMPA 1KTKA 2AQ3B 3HZXA 1U4PA 1Y8NB 5JJIA 4UDUC 2NYZD 2D9UA 3S17H 1IBML 3FRPB 3DUZA 4I7ZC 4J8QA 5EJWA 2HD3A 3RZOB 5KYIA 1GM5A 1PH8A 2PZWA 1NUCA 1S4ZA 1JJCB 5IGGA 2JA7B 5IYDG 1PRTD 5E1FA 4ZUJA 4FF2A 2AMCB 3L0OA 3HKZB 5I6YA 3J7AV 1NY4A 3MA2B 5CBAE 2E2HB 2Y0SB 4XIGS 2FFKB 2ID0A 3J7AF 5E7NA 1PDQA 4GLXA 2F0UA 4HSVA 2NUCA 4JV5L 3BYTB 1IYVA 3K80C 2ZXOA 4FNFA 1V1PA 3A5UA 5CBEE 4X3UA 4KJOA 4A3CG 1S72A 3A8IE 3I4MG 1RTOA 3E3XA 3F8TA 3OWEB 2EYPA 4DUYL 1O7IA 3S17B 1H9JA 2D5DA 3IAYA 4JI8L 1VQ9A 1D6EC 3P1HA 4LF7Q 2E5LQ 1DONA 2E2JH 1YHAA 3QG1A 4X66L 2K01A 4DV4Q 1SROA 2KHSA 1NMFA 4LUOA 3QOJA 3M4OH 1QWYA 2G9HD 2K5DA 3TEHB 2RHSB 5CV5A 4P74A 3V05A 4YY3L 1LO5D 2RBMA 1CA5A 4DV3Q 5C4XH 2VY3A 1EU4A 2EQSA 2K04A 4OEMB 4R8IA 3TDQA 1M4VA 2BOSA 2Q2TA 4Q0FA 2C9OA 4X65Q 1I4PA 1HQMC 4G7HC 1QVCA 3TMEA 4KJNA 1XXGA 1HHVA 2I5LX 3VR5A 2A8VA 4I65A 2N55A 2WIIB 1WYDA 2G9DA 5FO8B 2B2UA 4JI0Q 2JA5G 3KLWA 4IURA 3PO3H 5HY6A 3KLRA 3AB9A 1EQQA 4DV2Q 3ICEA 1YHQA 2B2YA 5CV9A 3IFDA 2N49A 1SYEA 3J81E 4DK3C 4FF3A 2E2JB 5LMUQ 1EIGA 1CFMA 1KQSA 1DCZA 4KI0A 4CDCC 3OWFA 2GVAA 2VQEQ 3PO2H 1H9RA 4S3SA 2HIXA 2YTVA 2KBNA 1UEAB 4A3GH 2MO0A 1BXTA 5CR3A 3GTGH 4DK6C 3NSWA 3PIP3 1VQ5A 2XGTA 3R3OA 1QOHA 1TS5A 3AEVA 4IQZA 4BY7H 1EIHA 1KRTA 4A3BG 2R92H 4Q5VA 2HCCA 3P7JA 2JJQA 5C4JH 1PH9A 4PNYA 1Y8PB 4UPAA 1AH9A 1HNXQ 4HN7A 5JAVA 5GAHC 1IKMA 1I3QH 4HIOA 1C4QA 3LGJA 1VQNA 2KCTA 1HH2P 4KD3A 4B3TQ 4CGYB 2YV5A 3Q0AA 1SNCA 1N36L 4GZYC 2D62A 4BBRG 3PO3B 4HSPA 2L4NA 4A3MB 3TQYA 2F0TA 5EBCA 2B39A 2FHTA 3HOUG 4IZ8A 1UUPA 1QJOA 2F4IA 4C3HG 1PH6A 1DGSA 1DYQA 1NMGA 3K6OA 3D4DA 3ULJA 3NELA 5EPLA 3PO2B 2PI2E 2WFWA 4P71A 5JEAH 2EJFC 4A3GB 3GTGB 2XRSD 3KLSA 4ZYSA 4K2LA 4BY7B 4GKKQ 4WJ4A 1V1PB 2OEOA 2ZM6L 4JG2A 4LF6L 2R92B 2WINB 2LSSA 5M5WH 4OONA 3CC4A 1I4QA 3KF6A 5C4JB 1HUMA 1CI3M 2BH8A 5IOCA 4AH6A 1I3QB 3HOXG 4CJ0B 5M3FH 3EJIA 4U673 3GV3A 4K5XA 3K8AA 1EYCA 4HAEA 5EKLA 3P75A 1IBKQ 3A56A 1G51A 1JB3A 1EY9A 3D4WA 3NP8A 2JA8H 1LUZA 4AIMA 2B2UC 1HRJA 2J0TD 1X56A 1C9OA 2WAQE 4LW1A 4R4OA 4PZ7A 2B2YC 3UDGA 2J4XA 1EFWA 3BZCA 3W1BA 4X3TA 5FK9C 4MTKA 3PCOB 1ZYRC 2MNAA 2ZT9C 2JA9A 3R8BA 1GUNA 3KLSX 5M5WB 4QF4A 2QW7A 1AEXA 2PQEA 4R8NA 1BOSA 3CCMA 4K8IA 1N32Q 2MJ8A 2PZTA 3QJYA 4J1MA 1Y69U 3VR3A 2ZTCA 3CU7A 1WJJA 2GN5A 3I55A 1EUJA 2PQAA 5IY0A 5I9OA 4KKTA 3J80E 1OXSC 4L5TA 4DR2Q 4NP5A 5M3FB 1A3VA 2HQEA 4KHZA 1G8ZD 1STHA 4DR6L 4GNXA 1KAWA 1LT6D 2KHIA 1SJED 2UUCL 2JA8B 3S15B 5FOBB 4GN5A 1X9NA 2Q8TA 2DUDA 3DEOA 2Q2IA 1PYWD 5IP9G 2IY5B 3CRLC 2WKCA 2BH2A 1Q90A 4KY5A 2F03A 5FKAC 3F1ZA 2SEBD 2VUMG 1C48A 2LY7A 4POFA 3GV6A 3MC0B 1ILPA 5J22A 3NBHA 3FMCA 1R4PB 4IUQA 2F0NA 3CCRA 4FDBA 4KN4C 5DLQE 1HUNA 1XNQL 3OMGA 2Z4HA 4FP5D 1X3GA 5KNBA 3J81L 1BCPF 1SJHD 1XMQQ 3LWUA 1DJRD 4RA8A 4BY1H 1VF7A 3G6EA 2CVRA 1HCZA 2YTYA 2R3ZA 3K0XA 3PF5A 4YHHL 1X54A 1ASYA 3NQIA 4CJ2C 4HJAA 1BF4A 5JOBA 2F1MA 4DNTB 1B3AA 1OXXK 3BVGA 1DXMA 5K36G 2OF1A 5K5PA 2WB1G 4HEDA 2WKDA 4A93G 4JI8Q 1STBA 3MWYW 2I5HA 2R93G 4BBSG 3PIO3 1LTTD 1V43A 1Y1WH 3S16H 1HR0W 4L5RC 5JJLA 4R9WA 1EOTA 3KJPA 4YCUA 1Z7TA 1PFNA 2YTXA 5LMNL 5LHY1 3I4NG 3WOEA 3HOZH 1WVLA 3F2CA 2KHJA 2DNCA 2UXDL 1F9RA 2A69D 1WD0A 2A6HD 5C44G 2CQOA 4ABNA 5JJKA 5C0XI 2PW7A 4BY1B 1ICFB 1EYGA 2F0WA 3TREA 3DM1A 1Y8OB 3L9AX 2VZAA 3K5OA 3ND9A 4A3FH 1DM0B 1G2SA 5J3BA 3I4LA 2AHOB 3I8ZA 1FJGL 3FKIH 4AYBG 1BQQT 4DFAA 2H1EA 1XTDA 3J80c 1HNZQ 4HCSA 4YWKA 3CP0A 1PFMA 1BUVT 1KDCA 1STGA 5IGDA 1FGUA 3S16B 1Y1WB 2KEDA 5IP7G 4GNXC 4A3KB 2H4OA 1HXYD 5AJ3L 2VXWA 3DWPA 5IIFA 1NR2A 2JK8A 1EEID 5M3MG 1YITA 1PH4A 3I7FA 4J15A 1ENFA 4KMUC 1HJPA 4G7ZC 5KYLA 1ZKOA 4JI0L 3EFXD 3CCSA 1HR0Q 2AQ1B 2NB0A 2NWGA 2PQAB 2D0PA 4QIWB 1CA6A 1U4MA 5L37A 3I91A 4GN4B 3AMUA 4NXML 3I72A 4ZRZA 4IJHA 2V4DA 3TN2A 1VQ6A 1SEBD 3TP8A 4GNXB 3BJUA 4C3JB 1RD9D 2B2TC 2NZHA 2HQLA 5JVG3 4K0KL 1EIYB 4A3JH 1AE2A 2MO1A 3FKIB 2VQFQ 2RHQB 3JAME 4JOIA 1PTOD 4B3SQ 1CZWA 3KK7A 3WWVA 4HJ9A 1MI2A 4XTCS 4C2MH 1PH1A 3QO2A 3J80L 4FF4A 1M1KC 3NBHB 1PXUA 4IFDG 2O2LD 1SSOA 4RAUC 1F2LA 2VS1A 4N8X1 1SFOH 2R7ZG 3N52A 3MFGA 1ZXTA 3NHHA 2ZM6Q 1K83H 5EPJA 2K7VA 1IW7C 4MNOA 4DN4M 3H09A 1JWUD 2ENBA 3CAMA 2G5DA 1WTOA 3NWSA 4QUFA 2L11A 3UDIA 2EYHA 1B50A 2X69A 4JK1C 3M85A 2RCNA 4R4CA 3TS0A 3GTPH 2BE5C 4A3JB 2CCZA 3SGIA 4RG1A 1LT3D 5I2YA 4GKKL 4A3IG 3NPPA 3MAQA 5CORA 4DR5L 4O42A 3DWAA 1V9PA 1HTLD 4QUCA 1EY6A 4C2MB 1JE5A 2L5TA 1EWIA 2NN6G 3PQIA 4KHVA 4RGNA 2EXDA 3FP9A 4WFN3 3K7AH 3H0GH 4RGMA 4ILWA 5EAYA 4HIKA 1HNWQ 5DNFA 1F2YA 4IUPA 1SFOB 1VCIA 2UUAQ 2AWNA 3U4ZA 2Z8LA 4BXXG 5IYDH 3PF4A 4YWLA 1BNZA 1WTQA 4CHTB 4DR7L 4QL5A 3G7LA 2A1AA 2PNHA 4RCOA 4DNIA 2O5JC 1EQVA 5JJZA 4X64Q 1WTPA 4B08A 5DM63 3AFPA 1GKHA 1FNUA 1Z6HA 1RIPA 5IT9c 3WDNA 2DN8A 1PA6A 3STBC 3GTPB 3RNUA 1F2MA 1E2ZA 1W3SA 2EY5A 2K5NA 1GHJA 1JR0D 1OTCA 2HT1A 2N3SA 4NB3A 4A3CH 2K05A 1G2TA 3OW7A 3RN2A 5M9OA 1VQLA 5CV8A 3I4MH 4JOIC 1N32L 3FDTA 3J81j 3OTOL 3QR8A 3PV0A 4HR7B 3JAMc 4POGA 4P72A 3UDFA 3K7AB 1U5KA 3H0GB 1Q12A 1OXUA 2JE6I 4IFDJ 1JORA 4RGOS 4RHRA 2PMZE 2XN9C 4RWSC 1N33L 1TWAH 2PMZB 3D3RA 1XNQQ 4EQ5A 2E8GA 4H44C 3SXHA 1EYDA 4LFBQ 1VQAA 3MEFA 2M2LA 4YHHQ 1IYUA 1IBLL 1B53A 3I2ZA 1SN8A 3HKZE 5HGQA 3RLOA 1STYA 2SNSA 1FNWA 1HZBA 2HDMA 2Y0SE 5ELEA 4ME3A 5IT9L 3D4RA 4R4TA 2UUBQ 3FHWA 3H3VH 1XMQL 2EPBA 2GVBA 1Y14B 3I70A 1C7YA 1O7ZA 3BVZA 1F9SA 3I4MB 1FVIA 1PZKD 2KCNA 4DR4Q 1JQYD 4XQQA 2C5CA 4B9XA 3PIPA 2EYOA 1KAAA 2ZJPA 4LJZC 5LMNQ 2A68C 1TIID 1PTOF 2JA5H 2RA4A 3K0YA 3PUZA 3JAML 4KY7A 5AFWA 2IPKD 3H3VC 2DY7A 2O4XA 4N9TA 5A2QL 4XDXA 2K4KA 2UXDQ 1TWAB 2M9VA 4C1NK 1VMCA 3N6RA 5ELOA 4CKBA 4EGVA 4HTHA 4WJWA 1MSHA 1AE3A 2F0MA 1GOZA 1XMOL 3J7YW 2Z0SA 4JBWA 1SNMA 5I4DA 2RQXA 1EY4A 4A3LH 3BDLA 1SNPA 4KKUA 5I9PA 2A73B 1QZGA 1Q8IA 2K6AA 3EVQA 1HFNA 2MHVA 2ZJRA 4JI6Q 1FJGQ 5KEEA 4MIUA 4V190 4ZUIA 2R7FA 1FD7D 3EA6A 4R1JA 5CGKA 4HJ5A 4K6DA 2KA7A 4J6HA 1S5FD 1K9MC 2LS01 3ER0A 3V2TA 1D2BA 4X62L 1CTMA 4BBRH 5AJ3Q 2JA5B 1V1OA 1Q86C 3CCLA 1JWMD 3NTKA 1K8MA 1LTAD 2F0KA 3OHXC 3ZYYX 2BCOA 1H9KA 1GJXA 1HNZL 5IGBA 1J9OA 1TS3A 4A3MH 4C3HH 3S1NH 4ZAIA 3W5OA 1IXRA 3KF8A 3KBGA 1PZJD 4LFCL 4NXMQ 1PYBA 1IHZA 1FYCA 3MVVA 5ELNA 1LTLA 3HOYG 4UP8A 4K0KQ 1SRUA 1YNNC 4E6IA 4IOCA 2K5QA 3U9OA 1HR0L 3CCVA 5FLXc 3G4SA 1TT2A 1WTRA 3HOXH 3VR4A 3VYTA 3Q24A 3KJOA 4DXGA 3GDEA 3GTQB 2A6ED 3C2PA 2KCMA 4NDXA 1E2VA 3AYHB 1FNVA 3Q8DA 1D5XC 4FO2A 3M9BA 2HUGA 5T1IA 4BBRB 1EL0A 2FINB 1XX8A 4O2DA 2EDGA 1TQOA 3ND8A 2VQFL 3SK5A 4B3SL 1VQJA 3R93A 1YJ9A 1F9PA 4C3HB 4TVAB 1VQKA 3S1NB 4BS9A 3TSSA 4UP7A 3Q23A 4YCWA 1D7QA 4DU9A 5BN4A 5C4XG 3IKJA 1SNQA 1SR3A 3A0JA 4QY7A 1A2TA 4QJFA 2Z4IA 1JJ2A 5C6AA 4JI1Q 2DGYA 2IHFA 3UE1A 1QZHA 2YYZA 4R4QA 3TP6A 4A3EG 1ESFA 3AU7A 2A5HA 2EYJA 1NR4A 1PRTF 3H6MA 3S1QH 4DR5Q 1DD2A 2ZXRA 1BVSA 3HOXB 3M3YH 2IX3A 3D8GA 1D1IA 1GUSA 2C35B 1RJTA 2CKZB 1H9MA 1AZPA 1IZ6A 4A3DG 2JEAI 3OOCA 1B7YB 4KLKA 2F0HA 4XXEA 3OW2A 2KEEA 4FYDA 1K28A 1TU2B 1XPUA 2MGSA 3S14H 4QCLA 1Q3LA 5C5LA 3HGBA 5IP9H 4DR7Q 2I46A 2E2DC 3S15H 2VUMH 4KD4A 4P75A 3J7A5 2Z1CA 5JPMC 1KHIA 2RF4A 3Q22A 1U4LA 3T51B 5IGCA 2RSNA 1BBWA 1VQHA 1HNWL 1KDBA 1SXTA 3SVMA 1EWHA 4KN7C 1K8OA 3PIOA 5IGFA 1KL9A 4DV5Q 1YJNA 2UUAL 1Q82C 4Y52H 1D1KA 1GD7A 2X6LA 1A0IA 2NVTH 1KDAA 4CDEC 1EY0A 3S1QB 5TSSA 1PH2A 1OO9B 2A74C 1E7ZA 1VQFA 3M3YB 1N34L 3OTOQ 3S2DH 3A8KE 1E3PA 4X64L 5K36H 2KENA 1MSGA 1Z47A 1YNJC 4A93H 1GO3E 3UE0A 4PMWA 2LFNA 4JYAQ 5ELCA 3F2DA 4B3MQ 1RCVD 4BBSH 2WAQG 3G48A 3KF8B 1GUOA 3CPFA 4V0BA 1N33Q 5JEAG 4M8AA 3S14B 1WTVA 1VS0A 1CQVA 1YEZA 4IPHA 4KV6A 3MHBA 2AQ2B 4UAIA 4DKAC 4F87A 2KVMA 3I4NH 2VUMB 2DY8A 2B8FA 1TWFH 3MEHA 1WD1A 1IBLQ 1LACA 2F0IA 5FJ8G 3VA5A 3TBIB 4LF9Q 3TP5A 1SNOA 5C44H 1QNKA 4JI7L 2KQ3A 2ALYB 1EYAA 5M5XB 3EQLC 1NJIC 2NVTB 1LV9A 4TQUS 1UE1A 3M4QA 2NBFA 4LFBL 2B2TA 3G71A 4P73A 1ET6A 1O80A 1GUTA 1LTBD 3S2DB 3KUPA 4GOPA 4G4KA 2QKIC 1JJGA 4NW2A 2WB1B 1I94Q 1L1OC 4A93B 2XIWA 5D3IB 3NEMA 3MXPA 3VYRA 2R93B 2OTLA 2NVXB 5EKIA 4BBSB 1YIJA 4GKJL 3GD7A 2UUBL 5IP7H 5F2DA 4DAYA 1IL8A 3QWNA 3ZJYC 2OQ0A 3I4NB 3EN2A 4DR4L 5M3MH 1U0LA 4A3KH 1XMOQ 5GROA 4C56C 2Q2UA 1Y1VG 5A35A 1PRTC 1TWFB 4RHSA 2OT2A 3GQBA 4B3RQ 2JYOA 3NUCA 5C44B 1TWHH 4PMBA 3UDXA 3QIAA 1L1OB 3SHLA 4IJLA 5GADC 3LWEA 1MKHA 3K5LA 1I4GA 2NVYH 4LUZA 3BG3A 1GUGA 2CWPA 5KIXA 1VQ7A 3NK9A 2HDLA 1DZ1A 5C4ZA 4OIKA 1II3A 1O78A 4AYBE 3RLFA 3D31A 1C0AA 4X62Q 1B9MA 1EWCA 4U68A 4AYBB 2EY2A 1CT1D 4LWCA 1PRTB 4C3JH 2DJFC 1EU3A 2SNMA 3E6ZX 4XQJA 1YI2A 3S1MH 5C0XG 5DEHA 4NPSA 2XVSA 5FLMG 3M4PA 4JI6L 3VDYA 1QNUA 3W2DA 3H91A 3BYYB 3VA7A 5ELFA 1LLRD 1BR9A 5CV4A 4IFDH 5IE8A 5CMDA 2VB3X 1G6PA 2D0OA 4GLAC 2A19A 4XT1B 1LTRD 3JC66 3E9IA 2NTSA 5M3MB 2EJGC 2Z9HA 3BS1A 4LFCQ 3D6WA 2VL6A 2R7ZH 4EVOA 1PH7A 1WI5A 5HGTA 4CDDC 5IYCG 4DV7Q 2B63H 3HOVG 1GUWA 3S2HH 1SYDA 1TWHB 1YNND 3HEJA 1CKNA 1LT5D 4JI2L 1STEA 1WCMG 3RR5A 2UXCQ 4EX5A 2NVYB 2AUJD 4QIWE 2K33A 4JI3Q 2F0GA 3HRZC 1HQRD 5IT9E 4G7OC 1JT8A 2KJXA 4WJ3M 1D5MC 5FO7B 1Q46A 3Q6SA 1SE3A 4A3IH 1SYBA 1STNA 2LXKA 3S1MB 4GOPC 3KBXA 1L0YB 3HOZG 1PVOA 2NN6H 3TZUA 4DAPA 5A2QE 4OO1H 2QGQA 4KHPL 1VQOA 1J5EQ 1W6JA 2Z6BA 3A7LA 1QG7A 1HZAA 2Z6KA 1VQ8A 3VYSA 2R61A 4X6AH 2CWAA 3K58A 3A7AB 4C3IG 2PW5A 5C4HA 2F4VL 4PV1C 1BCPC 5IYBG 1ZEQX 2R7ZB 3CCJA 1CSQA 3HKSA 2F0JA 2K5VA 1NAPA 4N9PA 2OWOA 4BXXH 2EIFA 4Y7NH 2B63B 5D65A 4A3FG 3S2HB 2JN4A 2BA1A 2KCCA 4K8JA 1LYLA 3A74A 1Z9FA 2H5XA 1N9WA 1EIFA 2QA4A 4GOPB 2PYKA 3AQQA 4IN3A 1X65A 1WTHA 1BBXC 1EY5A 1YVCA 3C46A 4WORA 3UI2A 3PSIA 1K3RA 3OPOA 4OXPA 4OELB 1VDZA 4HCEA 4OX9L 5ELDA 1B4OA 4JI1L 3CC2A 3A54A 2FXQA 4MN3A 3BZKA 1JOOA 3MXGA 1X3QA 1SYFA 1SAPA 4DAYB 4A3IB 1BCPB 4IALA 2VNUD 5KRUA 1RTNA 5IWAQ 4IOAA 3MXUA 2JA6H 3FPUB 3K81C 1RKNA 1EY7A 2E74C 3PGZA 2WP8J 1WFQA 1CM9A 3E9HA 2NZ1D 3L7ZC 4KK7A 2VW9A 1CHPD 1JOQA 1HZCA 1J6QA 1L0WA 5T1GA 4Y7NB 4B9WA 3RUZA 3R2IA 2F0QA 4RGTA 1A3UA 2EXZA 2NTTA 2XNAC 3IRBA 5CC4A 4I7AA 1ZYRD 4OIJA 2PPBC 3HOWG 1A15A 5D14A 3I4OA 5GAGC 1F9QA 2F0EA 3RN5A 5LL6X 1X55A 1TVXA 2K75A 1VQMA 1N34Q 1AP0A 1ILQA 1X3PA 2MPMA 4CBVA 1NNXA 5KNDA 3RD4A 1R9TH 1CSPA 3TS2A 1IL2A 1Q1BA 3ULPA 3I73A 4OL7A 2CHBD 1TWCH 4DUZQ 4DV5L 2I0QA 4NXNQ 1BBUA 1T9HA 3U50C 4G57A 3NBIA 2JA6B 2K03A 1N8RC 2ZJQA 3K5NA 3GTLH 5JVH3 1KLUD 3EIVA 3I56A 1KC8C 1GHKA 5EQ0A 1B3QA 1CKNB 1VF5C 4EQPA 1E2WA 2UU9Q 1FL0A 3SEBA 3EROA 1YJWA 2Z6KC 2L9HA 1LTGD 4JYAL 2LMCB 4IUNA 2IX0A 1S5CD 2F0SA 4B3ML 3BDCA 3NWTA 1I6VC 2RDFA 2ATWA 3RZDH 4JI7Q 4OWWB 5C3EG 3M7GA 1KIXA 3KYHC 1B1ZA 4LFAQ 3TP7A 4X3KA 2GA4B 3NQTA 4DV0Q 1KRSA 1K0SA 2OCEA 1F2ZA 1UNSA 2JXMB 1JE4A 3U4VA 1R9TB 5FLXE 4LF9L 4JBJA 3FEWX 1A62A 1PMRA 3T53B 2UXBQ 3OMCA 3K7UC 4UP9A 3DLLA 1QVGA 3H0GG 1CK1A 1TWCB 4GKJQ 3T16A 4LF4Q 4JI4L 4L63B 1WOCA 4BA2I 2N88A 4OGQC 3TRZA 2EE1A 2I07B 5C3XA 4XT3B 3GTLB 1M8AA 4IUUA 4M1UB 4QQBX 4RMFA 1I94L 3CMAA 3SE0A 1RHPA 4ME5A 2JA7G 1XWEA 5HURA 2OXPA 4LF5L 5EGTA 3CCQA 4LAAA 3HKZG 3RZDB 2BA0A 2E75C 2Q8IB 1L2FA 3U58A 2PI2A 2EZVA 3R2TA 2K1BA 3NTIA 2ICIA 5E3FA 1J8IA 2B2VA 3L2PA 1YZ6A 4CKEA 3CF5A 1XPRA 4RKBA 1HTPA 2V1CC 2Y0SG 2EYLA 4DR1L 3DWQA 1I4XA 3NXWA 4IPDA 3HOYH 1D5ZC 1UE6A 1K73C 1K8AC 3CKIB 2EY1A 1PZID 1ML0D 4B3RL 1E1OA 4DK1A 1XNRQ 1Q8KA 2R7DA 1S5BD 4A3BH 2IJ0A 4WRDA 1FR3A 4AQYQ 3SK8A 1B9NA 2K52A 3RLNA 2BDNA 1NTGA 2K32A 1Q7YC 2SDFA 5I2XA 5M5YH 3LX0A 3A5ZB 2N78A 3GTQH 1CQFA 3CW2C 1A2UA 3EBEA 1ASZA 4PQXA 3T1YQ 1R4QB 1S5DD 2IL8A 2IW3A 1VQPA 4DAMA 3GTOH 1ENCA 3PUVA 3H3VI 1EEFD 2LKVA 1MHWC 5LL6S 2Q8RE 1JMCA 4EQNA 3MZ5A 2A69C 4JI2Q 2DJGC 4XYQA 3HOUH 2F0OA 1G291 3BU2A 3MTSA 3FVQA 2A6HC 4OWXB 3ULLA 1K8GA 1ESRA 3HP3A 3TZDA 3X3MA 4QB4A 3FPPA 3HOYB 1D8LA 4ID6A 4JBKA 4A3EH 2L15A 4DV7L 2L55A 1SMYC 4A3BB 5KGUA 3DEPA 4H0LC 1XYIA 1QUQA 2UXCL 2PO4A 5COYA 1DOLA 3T1HL 5CV6A 4JI3L 1A8VA 4KHPQ 4MTNA 5BR8Q 5M5YB 3NENA 3T13A 4APVA 4JPBW 3K59A 4A3DH 1BCPD 2F4VQ 3BDOA 2QDBA 3M4OB 4A4IA 3C3LA 3GTOB 2AUKA 3GTKH 4A3LG 1PYSB 3C1EA 4DPGA 3I90A 1F77A 5C4XB 3VYUA 3HOUB 1TY0A 3ERSX 1M90C 1T5XD 1IW7D 1J5EL 1PTOH 1B70B 2F3WA 4DV6Q 2F52A 2CW0C 1NE3A 2Q2HA 4DF7A 1EQRA 1BO0A 2B2VC 3GP7A 2PZUA 3IL8A 4OX9Q 1X3EA 1GVPA 4A3EB 2RDHA 5CYUA 1TS4A 3T4AC 2BE5D 4RH6A 3PUYA 2K50A 4H13C 3L3OC 1STAA 1PTOC 3F2BA 4NMZA 1I4RA 4DR3Q 2IHEA 4OHJA 2XWJB 2K5WA 4LK1C 5E4WC 4CJ1B 1DOKA 1L1OA 2JEBI 1VMPA 2AWOA 3PO3G 1DOMA 2XSCA 1PFBA 3KDFA 4A3MG 2ASBA 1TXYA 4A3DB 5FLXL 4MHEA 2D2CC 4K5WA 5EPKA 1MD2D 4DXFA 1S5ED 1PFSA 1T5EA 4A75A 3GTKB 1UAPA 3PO2G 2X6GA 3CQZH 4LF8L 1S40A 4Z9CB 2K14A 5IWAL 3GTJH 4A3GG 1EQTA 3SK6A 2O5IC 2MFIA 1PTOB 4BY7G 4FXDA 4K2KA 5FJ8H 4K6LA 4JI5Q 1H9SA 2R92G 1I4HA 4ALPA 4TRDA 1ONLA 4GN3B 3J81i 4DA2A 2OTJA 1MBYA 1HA5A 1ET9A 3STBD 4ZK9B 2F3IA 3D0FA 1E1TA 1CZGA 4ZLTF 1OXTA 3K5MA 5M5XH 2ZTEA 4LMQD 5ISRA 3W1GA 4DV1L 3VR2A 2XTIA 1XJVA 1PLFA 1GXDC 4OWTB 4PZ6A 3BVMA 3E0JA 1X32A 2F0LA 2WAQB 1VQ4A 1LTSD 3J81c 4A76A 3KFUA 2M00A 3CCEA 4ULLA 3E5SA 5NUCA 1U4RA 2R93H 2NVXH 2HHHL 2ZTDA 3CQZB 4DUZL 4NXNL 3SDZA 1B8AA 1XPOA 1AN8A 3OIQA 2XRQD 4ZKCB 3GTJB 4H02A 3OIPA 1Y1VH 2IT1A 4ZQ3A 1NCVA 1LM0A 2RCFA 1UEBA 1KLGD 4PZ8A 5KNCA 1C8CA 1TY2A 1I6HH 2CFMA 1SLJA 1QUQB 1HPCA 2UU9L 2JSOA 3PUXA 1OXVA 1AW7A 4RKLA 3MXNA 1HA6A 1IBMQ 2MP1A 4HJ8A 2IX1A 2PNRC 5DAUA 1PH3A 2SOBA 3M4YA 5M3FG 4F88A 2MUYA 4JI4Q 2JP1A 4LFAL 1SE4A 1WTXA 4K14A 1TWGH 4DV0L 5C0XH 3MFYA 5FLMH 2DNEA 1W6KA 2WB1E 4L6TB 1I5FA 3CHBD 3ITPA 2ICEC 2JA8G 2A68D 1P8LA 1VQEA 3SR1A 3NE5B 1PHJA 5BN5A 1KD1C 1AFPA 1SBBB 2B2WA 1SE2A 4ZCKA 2UXBL 4LF5Q 3A8JE 1KXLA 1MGSA 5D3DA 1XTCD 4LF4L 1Y1VB 3G6JB 4HIMA 4JV5Q 4YCVA 1SDFA 1SYCA 5IYCH 1RF2D 4DR1Q 3HOVH 2F0PA 4HJ7A 1VQGA 3CXCA 1I6HB 2EJMA 5G3LD 1WCMH 2RKSA 1YNXA 1JWSD 5FO9B 2QCPX 2F3VA 1KABA 2FJ2A 1UE5A 5GQOA 4YWMA 2IWHA 4BA1I 2ZXPA 1Q81C 1EZ8A 3HS0C 3LNNA 5C3WA 4DUYQ 2EYFA 3DHQA 3F2UA 1TR5A 3O13A 3KDFB 5E4XA 4ODGA 4N8FA 2FMMA 1QE6A 3DM3A 3DMUA 1TS2A 2F0VA 4X66Q 3CPWA 2K28A 4C1NI 5EKKA 4KY6A 5IGEA 1LTID 1TWGB 1I50H 1L0XB 5I6WA 2I5MX 1A63A 5J1ZA 3T56B 1K0RA 4UY8C 4JW0A 1XNRL 1A6XA 3S1RH 3KF6B 3OSOA 4X3SA 4YY3Q 4AQYL 3J80i 4JC0A 1KNEA 1SE8A 2OQKA 1H9SB 1CUKA 1PH5A 4LF7L 4C3IH 2E5LL 4IPGA 1NBWA 3B6YA 5IYBH 5JEAJ 4KTAA 4DV4L 1RODA 4UHVA 4RCNA 3HOVB 3H15A 2ES2A 4TSSA 2L0CA 3T1YL 4IUTA 4BY1G 2N8NA 1WCMB 1E0BA 1P16A 1SMYD 4EQOA 4XYOA 2QILA 4GS3A 5EBDA 3SK4A 3IFTA 1Q1EA 4DV3L 5DM73 1CHQD 3CRKC 3T1HQ 2QEXA 2E2IH 2KOLA 2L12A 4DK0A 1KNAA 4X65L 1W2BA 3K57A 4NKLA 2CH4W 5ELBA 1JC7A 2EY6A 1I50B 1LABA 1U9RA 1Y1WG 4A3KG 3URYA 3HOZB 1TKWB 1UWVA 1EFID 3S1RB 3DXJC 1QVFA 4L8JA 3QB3A 2FMCA 2E76C 4DAVA 5J39A 1RDPD 3RMHA 3OYYA 2P5ZX 4DV2L 3H94A 2B2WC 4C3IB 5GAEC 2WV6D 3ERQA 5LMUL 3GTMH 4ZKBB 2CW0D 5BR8L 3MXNB 3KOJA 1G91A 4A3FB 2VQEL 2TSSA 4FF1A 1V8QA 1HZ9A 4F7XA 1JICA 2YU9H 2QF7A 2CH4A 4O1NA 2F0FA 2J7ZA 3HOWH 1IYJB 3AFQA 3CCUA 1SYGA 1N36Q 4IFDI 3I3CA 4C3JG 1NSNS 4JCVE 3P20A 2NZOA 4DNRB 4L5QA 3CC7A 2VB2X 3FKIG 3D6CA 1S3OA 4CDFC 4F8MA 2E2IB 4MZ9A 4DV6L 1AZQA 4LNQA 2BDOA 4IPCA 1JB7A 1EZ6A 1LT4D 1HNXL 1YHBA 1JCKB 4K5VA 1FGBD 2A6EC 4LUVA 2JQOA 2RSOA 4HMJA 2NVQH 1MJCA 2XWBB 4DGZA 1CKOA 4JVZA 5JPNC 1VQCA 3HFZB 4B3TL 3VR6A 1A3TA 2R6GA 2HIVA 3HG9A 2EYMA 4XQNA 1O7YA 3PMFA 5CV7A 4LF8Q 1ICWA 2B63G 2AKWB 4LF6Q 1UE7A 5C0XJ 4DR3L 1QILA 1ENAA 4TKOB 2B8GA 4YIJA 1B2TA 3GTMB 4JBMA 2B29A 4FVMA 4IUVA 1JOKA 2RDGA 3A55A 2CQAA 1EOVA 1EY8A 1V1QA 4HIDA 1O7LA 2B3GA 4RFBA 5C3EH 2YU9B 1G6ZA 1X6OA 4BWGB 2HCIA 1QB5D 3HOWB 1WTWA 1E24A 2NN6I 4OO1I 1K3BC 3C1FA 3GO5A 3S9WA 1BKBA 1X3FA 4DV1Q 5G3LF 2RVLA 4A3JG 4O0AA 4QGUA 4JI5L 3W3AA 4OO1G 5IODA 1MIUA 1SNDA 4R4IA 2LXJA 4PMCA 2PCFB 4FXKC 2EVBA 2QEJC 4QMGA 2NVQB 1YNJD 1BDOA 3U9SA 1SMXA 1RL2A 3X3NA 5H1SE 2EOTA 2HHHQ 4P2CB 1IKLA 1IBKL 1QCBD 1K83B 4HMIA 3WOFA 2KECA 3RZOH 2KUMA 3JAMi 5C5MA 4GLVB 2JA7H 3J7ZC 1VQDA 3NTHA 1VQIA 2L1BA 1MJEA 1VQBA 5C3EB 3QOLA 3CMEA 4PG3A 1PV4A 4L5SA 4CKCA 1E22A 2K5HA 2E2HH 1YBYA 5BN3A 5LMNW 4DR6Q
chains in the Genus database with same CATH topology
1H95A 3T1HL 2MQHA 1VS0A 3CD6A 2PQAB 3PUWA 2D0PA 4JI3L 1A8VA 4KHPQ 2UUCQ 1YEZA 3M7NA 4IPHA 4MTNA 3I4NH 4DKAC 5BR8Q 3NENA 4GN4B 4APVA 2JA6G 4NXML 4A3DH 1TWFH 4IJHA 4IO9A 3E0EA 3S24A 2F4VQ 1IBLQ 1VQ6A 4GNXB 4DR2L 1CKMA 3BJUA 5FJ8G 2NZHA 4A4IA 2HQLA 4LF9Q 5C44H 3GTKH 4A3LG 4K0KL 5JJIA 1EIYB 1PYSB 3S17H 4A3JH 4JI7L 1AE2A 2MO1A 4DPGA 2VQFQ 2RHQB 2ALYB 1IBML 4JOIA 4B3SQ 1NJIC 3ERSX 1M90C 3WWVA 1J5EL 1B70B 4HJ9A 4TQUS 1UE1A 3M4QA 4DV6Q 1GM5A 1PH8A 4LFBL 4XTCS 2F52A 4C2MH 1JJCB 1NE3A 4P73A 3G71A 1PH1A 1M1KC 3NBHB 5IYDG 2Q2HA 4IFDG 4GOPA 1EQRA 1JJGA 2AMCB 4OX9Q 1I94Q 1X3EA 1GVPA 1L1OC 3L0OA 2VS1A 3NEMA 1NY4A 2OTLA 1SFOH 4DR6Q 1YIJA 2R7ZG 3PUYA 4GKJL 4XIGS 3GD7A 2K50A 2ID0A 2UUBL 5IP7H 3F2BA 5E7NA 2ZM6Q 1K83H 4GLXA 4DR3Q 2IHEA 4MNOA 4JV5L 3ZJYC 2OQ0A 3EN2A 1L1OA 3K80C 2JEBI 2AWOA 4DR4L 3PO3G 3CAMA 1U0LA 5M3MH 4A3KH 1XMOQ 3KDFA 5GROA 4A3MG 1TXYA 1Y1VG 3A5UA 2Q2UA 2ASBA 4A3CG 1S72A 3UDIA 4B3RQ 3I4MG 3M85A 3F8TA 1PFSA 2RCNA 4A75A 1TWHH 3UDXA 4R4CA 1L1OB 4DUYL 3TS0A 3GTPH 3CQZH 3PO2G 1O7IA 4IJLA 5GADC 2CCZA 4LF8L 1S40A 1MKHA 5IWAL 2K14A 4RG1A 3SGIA 4JI8L 4LUZA 2NVYH 3GTJH 1VQ9A 4A3GG 4GKKL 2CWPA 4A3IG 4LF7Q 4DR5L 2E5LQ 1VQ7A 2MFIA 1V9PA 2E2JH 1YHAA 4BY7G 4X66L 5FJ8H 4DV4Q 4JI5Q 1JE5A 1EWIA 2NN6G 1SROA 2R92G 4AYBE 3RLFA 4ALPA 3D31A 2EXDA 4GN3B 1NMFA 3FP9A 3K7AH 4X62Q 4LUOA 3H0GH 3J81i 1C0AA 5EAYA 2OTJA 4HIKA 4LWCA 3M4OH 4C3JH 1HNWQ 1YI2A 3TEHB 2RHSB 3S1MH 3STBD 4P74A 4NPSA 5FLMG 4YY3L 3M4PA 5C0XG 4JI6L 3VDYA 2F3IA 3D0FA 1E1TA 1VCIA 2UUAQ 2AWNA 4DV3Q 1OXTA 3U4ZA 5C4XH 2VY3A 5M5XH 4BXXG 2ZTEA 3W1GA 4DV1L 5IYDH 2EQSA 3PF4A 4YWLA 5IE8A 4DR7L 2XTIA 1G6PA 2D0OA 4QL5A 4GLAC 2A19A 1XJVA 2A1AA 2PNHA 4DNIA 3JC66 2Q2TA 3E9IA 4OWTB 4PZ6A 4X65Q 4X64Q 1QVCA 4LFCQ 2VL6A 2R7ZH 2I5LX 3AFPA 1GKHA 1VQ4A 2A8VA 1RIPA 5IT9c 3J81c 4A76A 1PH7A 1WI5A 5IYCG 4DV7Q 3KFUA 3CCEA 2B63H 1PA6A 3HOVG 1WYDA 3S2HH 3STBC 2R93H 1CKNA 2NVXH 2HHHL 2ZTDA 3RNUA 4JI2L 4JI0Q 1WCMG 1W3SA 4NXNL 3RR5A 2K5NA 1B8AA 4DUZL 4EX5A 3KLWA 1XPOA 2JA5G 1OTCA 3PO3H 5HY6A 4H02A 2HT1A 1Y1VH 2IT1A 1EQQA 4DV2Q 2N3SA 4QIWE 4NB3A 4JI3Q 3ICEA 1YHQA 4A3CH 2N49A 1LM0A 3RN2A 4DK3C 1UEBA 5LMUQ 1VQLA 1JT8A 3I4MH 4JOIC 1N32L 3J81j 3OTOL 1KQSA 4PZ8A 3PV0A 3JAMc 4POGA 1I6HH 4WJ3M 4KI0A 2VQEQ 2GVAA 2CFMA 1SLJA 3PO2H 1QUQB 2HIXA 2YTVA 2KBNA 1Q46A 4P72A 3UDFA 1U5KA 2UU9L 3PUXA 1Q12A 4A3GH 1OXVA 2MO0A 4A3IH 1OXUA 2JE6I 3GTGH 4IFDJ 2LXKA 4DK6C 1VQ5A 2PMZE 2XGTA 4GOPC 1N33L 1TWAH 1IBMQ 3AEVA 2IX1A 4HJ8A 4BY7H 1KRTA 1PH3A 3HOZG 1PVOA 1XNQQ 4A3BG 5M3FG 2R92H 4EQ5A 4JI4Q 2QGQA 4KHPL 2E8GA 2JJQA 5C4JH 1VQOA 1PH9A 1J5EQ 4JI0L 4LFAL 1HZAA 2Z6KA 1VQ8A 4LFBQ 4UPAA 1HR0Q 4X6AH 1VQAA 2CWAA 1TWGH 4DV0L 1AH9A 1HNXQ 3MEFA 5FLMH 4YHHQ 1IBLL 2F4VL 5GAHC 2WB1E 2JA8G 1I5FA 1I3QH 5IYBG 3I2ZA 1SN8A 3HKZE 3CCJA 4HIOA 3LGJA 1P8LA 1CSQA 1VQEA 3HKSA 2K5VA 2KCTA 3RLOA 5HGQA 1PHJA 1HH2P 2EIFA 4Y7NH 1KD1C 2OWOA 4B3TQ 2YV5A 4A3FG 4BXXH 2UXBL 1HZBA 2BA1A 2Y0SE 1LYLA 1N36L 4LF5Q 3A74A 2D62A 1Z9FA 2H5XA 4ME3A 4BBRG 1N9WA 4R4TA 2UUBQ 3FHWA 3H3VH 1EIFA 2QA4A 4LF4L 4GOPB 3AQQA 4HIMA 3TQYA 1XMQL 1X65A 2GVBA 1Y14B 4JV5Q 1C7YA 4YCVA 1YVCA 5IYCH 3HOUG 4DR1Q 4DR4Q 1FVIA 3HOVH 3PSIA 1VQNA 1K3RA 4OXPA 4HJ7A 1VQGA 3PIPA 3CXCA 1DGSA 1PH6A 1NMGA 2ZJPA 4OX9L 3ULJA 3NELA 1WCMH 5LMNQ 4JI1L 2PI2E 2WFWA 3CC2A 2JA5H 1YNXA 2FXQA 3BZKA 4P71A 4YWMA 5GQOA 1UE5A 3PUZA 4BA1I 4DAYB 2VNUD 1Q81C 4DUYQ 2UXDQ 2K4KA 5IWAQ 4IOAA 3KDFB 4GKKQ 4WJ4A 5ELOA 2ZM6L 4JG2A 2JA6H 4LF6L 3K81C 2LSSA 5M5WH 4OONA 3CC4A 3KF6A 3DM3A 1AE3A 3PGZA 2WP8J 4X66Q 3CPWA 1WFQA 1XMOL 2Z0SA 4JBWA 2BH8A 3E9HA 1I50H 3L7ZC 4A3LH 4AH6A 2I5MX 2VW9A 1A63A 1HZCA 3HOXG 1J6QA 1L0WA 1K0RA 4UY8C 1XNRL 3S1RH 3KF6B 5M3FH 1QZGA 2ZJRA 4YY3Q 4JI6Q 4AQYL 1FJGQ 3K8AA 3J80i 4JC0A 3IRBA 1PH5A 1SE8A 2OQKA 1CUKA 2R7FA 4LF7L 4C3IH 1IBKQ 2E5LL 1G51A 3HOWG 3I4OA 5GAGC 4IPGA 2JA8H 1NBWA 1LUZA 3B6YA 4R1JA 4AIMA 5IYBH 4HJ5A 3RN5A 1X55A 5JEAJ 1X56A 4DV4L 1K9MC 1C9OA 3H15A 2K75A 1VQMA 1N34Q 2ES2A 3ER0A 2WAQE 4X62L 4LW1A 4R4OA 3T1YL 4PZ7A 3UDGA 4BY1G 2N8NA 1P16A 4BBRH 1CSPA 5AJ3Q 1R9TH 1Q86C 3CCLA 3TS2A 1IL2A 1Q1BA 1EFWA 4GS3A 3ULPA 3BZCA 3W1BA 1Q1EA 1TWCH 4DUZQ 3PCOB 4DV3L 4DV5L 1BBUA 2I0QA 1T9HA 4NXNQ 3U50C 1HNZL 2MNAA 4A3MH 4C3HH 3T1HQ 2JA9A 3S1NH 3W5OA 2QEXA 1IXRA 1N8RC 2E2IH 2ZJQA 4X65L 1W2BA 3GTLH 3CCMA 1N32Q 3EIVA 3I56A 1KC8C 4LFCL 2ZTCA 4NXMQ 1CKNB 1WJJA 2GN5A 3I55A 1EUJA 1PYBA 2PQAA 5IY0A 5ELNA 1OXSC 4L5TA 2UU9Q 4DR2Q 1FL0A 1Y1WG 4A3KG 1YJWA 2Z6KC 1LTLA 1UWVA 3HOYG 4JYAL 1QVFA 2IX0A 4B3ML 4KHZA 4UP8A 4K0KQ 1SRUA 2ATWA 3RZDH 4IOCA 4JI7Q 4OWWB 5C3EG 1KIXA 4GNXA 1HR0L 4DR6L 3CCVA 3OYYA 4DV2L 3KYHC 1KAWA 5FLXc 3G4SA 5GAEC 2KHIA 4LFAQ 2UUCL 5LMUL 3GTMH 5BR8L 3HOXH 3MXNB 3KOJA 3KJOA 3GDEA 4DV0Q 4GN5A 1X9NA 2VQEL 1KRSA 2DUDA 2Q2IA 2KCMA 2OCEA 1HZ9A 5IP9G 2IY5B 3AYHB 3Q8DA 2BH2A 2YU9H 3F1ZA 3M9BA 3U4VA 2VUMG 4POFA 4LF9L 3HOWH 4O2DA 4JBJA 1IYJB 3AFQA 1A62A 2UXBQ 3K7UC 4UP9A 3DLLA 3CCUA 3H0GG 1QVGA 1N36Q 2VQFL 4IFDI 3CCRA 4FDBA 5DLQE 4GKJQ 1XNQL 4B3SL 1VQJA 1X3GA 4JCVE 1YJ9A 4LF4Q 4JI4L 2NZOA 1WOCA 1XMQQ 4BA2I 4L5QA 4TVAB 1VQKA 3TRZA 3CC7A 3FKIG 4UP7A 1S3OA 4YCWA 4BY1H 1D7QA 4MZ9A 3G6EA 4DV6L 2YTYA 4LNQA 5C4XG 4IPCA 1JB7A 1SR3A 1YHBA 3A0JA 3K0XA 3PF5A 1HNXL 4YHHL 1X54A 4LUVA 4QY7A 4QJFA 1ASYA 2JQOA 4QQBX 1JJ2A 2NVQH 1MJCA 4RMFA 4JI1Q 1CKOA 4HJAA 1I94L 3CMAA 2DGYA 1VQCA 3HFZB 2IHFA 4B3TL 3UE1A 2JA7G 1QZHA 1OXXK 2R6GA 2HIVA 2YYZA 4R4QA 5K36G 2WB1G 4LF5L 3CCQA 3HKZG 4A3EG 4LF8Q 2BA0A 2B63G 3U58A 4A93G 1L2FA 4JI8Q 2AKWB 2PI2A 4LF6Q 1UE7A 2I5HA 5C0XJ 2R93G 3L2PA 1YZ6A 3CF5A 4DR3L 4DR5Q 1XPRA 3S1QH 4BBSG 2V1CC 2Y0SG 1BVSA 4DR1L 1V43A 1Y1WH 2B29A 1HR0W 4JBMA 3M3YH 3S16H 4L5RC 4IPDA 5JJLA 3KJPA 3HOYH 1EOVA 4YCUA 1UE6A 1K73C 1K8AC 2C35B 1V1QA 2YTXA 5LMNL 4HIDA 3I4NG 2CKZB 4B3RL 2B3GA 5C3EH 1E1OA 1X6OA 1XNRQ 3HOZH 1Q8KA 2R7DA 3F2CA 1IZ6A 2KHJA 4A3BH 2JEAI 4A3DG 1B7YB 1E24A 2NN6I 4OO1I 4KLKA 3OW2A 4AQYQ 2UXDL 2K52A 1XPUA 3S14H 3RLNA 3GO5A 1BKBA 1X3FA 5C44G 1NTGA 2CQOA 4DV1Q 5JJKA 5IP9H 1Q7YC 4A3JG 4O0AA 4QGUA 5C0XI 4DR7Q 3S15H 5M5YH 1EYGA 3A5ZB 2VUMH 4P75A 3J7A5 2N78A 4JI5L 3TREA 4OO1G 1MIUA 1KHIA 3GTQH 2RF4A 2VZAA 4R4IA 4A3FH 2LXJA 3CW2C 3EBEA 1ASZA 3T1YQ 5J3BA 1VQPA 1KXLA 4DAMA 1BBWA 2AHOB 1VQHA 1SMXA 3GTOH 1HNWL 1RL2A 3PUVA 3H3VI 1FJGL 3FKIH 5H1SE 4AYBG 3PIOA 1KL9A 4DV5Q 1YJNA 1JMCA 4JI2Q 2HHHQ 1Q82C 2UUAL 4Y52H 3HOUH 2UXCQ 1XTDA 1G291 3J80c 1IBKL 1HNZQ 4YWKA 3BU2A 1GD7A 3CP0A 1A0IA 2NVTH 4OWXB 3ULLA 1K8GA 1PH2A 3RZOH 3JAMi 1E7ZA 1FGUA 1VQFA 4GLVB 5IP7G 4GNXC 2JA7H 1N34L 3J7ZC 1VQDA 3OTOQ 1D8LA 3S2DH 4X64L 1E3PA 1VQIA 2KENA 4JBKA 1Z47A 4A3EH 5AJ3L 2L15A 1MJEA 1VQBA 4A93H 4DV7L 1GO3E 2JK8A 3UE0A 5M3MG 3CMEA 1YITA 1PH4A 4PMWA 4PG3A 3I7FA 4J15A 4JYAQ 3F2DA 1PV4A 4B3MQ 4L5SA 1HJPA 4BBSH 2E2HH 1E22A 2K5HA 2WAQG 1YBYA 3G48A 3KF8B 5LMNW 3CPFA 1N33Q 3CCSA 1QUQA 2UXCL 5JEAG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H95 A;  3T1H L;  2MQH A;  1VS0 A;  3CD6 A;  2PQA B;  3PUW A;  2D0P A;  4JI3 L;  1A8V A;  4KHP Q;  2UUC Q;  1YEZ A;  3M7N A;  4IPH A;  4MTN A;  3I4N H;  4DKA C;  5BR8 Q;  3NEN A;  4GN4 B;  4APV A;  2JA6 G;  4NXM L;  4A3D H;  1TWF H;  4IJH A;  4IO9 A;  3E0E A;  3S24 A;  2F4V Q;  1IBL Q;  1VQ6 A;  4GNX B;  4DR2 L;  1CKM A;  3BJU A;  5FJ8 G;  2NZH A;  4A4I A;  2HQL A;  4LF9 Q;  5C44 H;  3GTK H;  4A3L G;  4K0K L;  5JJI A;  1EIY B;  1PYS B;  3S17 H;  4A3J H;  4JI7 L;  1AE2 A;  2MO1 A;  4DPG A;  2VQF Q;  2RHQ B;  2ALY B;  1IBM L;  4JOI A;  4B3S Q;  1NJI C;  3ERS X;  1M90 C;  3WWV A;  1J5E L;  1B70 B;  4HJ9 A;  4TQU S;  1UE1 A;  3M4Q A;  4DV6 Q;  1GM5 A;  1PH8 A;  4LFB L;  4XTC S;  2F52 A;  4C2M H;  1JJC B;  1NE3 A;  4P73 A;  3G71 A;  1PH1 A;  1M1K C;  3NBH B;  5IYD G;  2Q2H A;  4IFD G;  4GOP A;  1EQR A;  1JJG A;  2AMC B;  4OX9 Q;  1I94 Q;  1X3E A;  1GVP A;  1L1O C;  3L0O A;  2VS1 A;  3NEM A;  1NY4 A;  2OTL A;  1SFO H;  4DR6 Q;  1YIJ A;  2R7Z G;  3PUY A;  4GKJ L;  4XIG S;  3GD7 A;  2K50 A;  2ID0 A;  2UUB L;  5IP7 H;  3F2B A;  5E7N A;  2ZM6 Q;  1K83 H;  4GLX A;  4DR3 Q;  2IHE A;  4MNO A;  4JV5 L;  3ZJY C;  2OQ0 A;  3EN2 A;  1L1O A;  3K80 C;  2JEB I;  2AWO A;  4DR4 L;  3PO3 G;  3CAM A;  1U0L A;  5M3M H;  4A3K H;  1XMO Q;  3KDF A;  5GRO A;  4A3M G;  1TXY A;  1Y1V G;  3A5U A;  2Q2U A;  2ASB A;  4A3C G;  1S72 A;  3UDI A;  4B3R Q;  3I4M G;  3M85 A;  3F8T A;  1PFS A;  2RCN A;  4A75 A;  1TWH H;  3UDX A;  4R4C A;  1L1O B;  4DUY L;  3TS0 A;  3GTP H;  3CQZ H;  3PO2 G;  1O7I A;  4IJL A;  5GAD C;  2CCZ A;  4LF8 L;  1S40 A;  1MKH A;  5IWA L;  2K14 A;  4RG1 A;  3SGI A;  4JI8 L;  4LUZ A;  2NVY H;  3GTJ H;  1VQ9 A;  4A3G G;  4GKK L;  2CWP A;  4A3I G;  4LF7 Q;  4DR5 L;  2E5L Q;  1VQ7 A;  2MFI A;  1V9P A;  2E2J H;  1YHA A;  4BY7 G;  4X66 L;  5FJ8 H;  4DV4 Q;  4JI5 Q;  1JE5 A;  1EWI A;  2NN6 G;  1SRO A;  2R92 G;  4AYB E;  3RLF A;  4ALP A;  3D31 A;  2EXD A;  4GN3 B;  1NMF A;  3FP9 A;  3K7A H;  4X62 Q;  4LUO A;  3H0G H;  3J81 i;  1C0A A;  5EAY A;  2OTJ A;  4HIK A;  4LWC A;  3M4O H;  4C3J H;  1HNW Q;  1YI2 A;  3TEH B;  2RHS B;  3S1M H;  3STB D;  4P74 A;  4NPS A;  5FLM G;  4YY3 L;  3M4P A;  5C0X G;  4JI6 L;  3VDY A;  2F3I A;  3D0F A;  1E1T A;  1VCI A;  2UUA Q;  2AWN A;  4DV3 Q;  1OXT A;  3U4Z A;  5C4X H;  2VY3 A;  5M5X H;  4BXX G;  2ZTE A;  3W1G A;  4DV1 L;  5IYD H;  2EQS A;  3PF4 A;  4YWL A;  5IE8 A;  4DR7 L;  2XTI A;  1G6P A;  2D0O A;  4QL5 A;  4GLA C;  2A19 A;  1XJV A;  2A1A A;  2PNH A;  4DNI A;  3JC6 6;  2Q2T A;  3E9I A;  4OWT B;  4PZ6 A;  4X65 Q;  4X64 Q;  1QVC A;  4LFC Q;  2VL6 A;  2R7Z H;  2I5L X;  3AFP A;  1GKH A;  1VQ4 A;  2A8V A;  1RIP A;  5IT9 c;  3J81 c;  4A76 A;  1PH7 A;  1WI5 A;  5IYC G;  4DV7 Q;  3KFU A;  3CCE A;  2B63 H;  1PA6 A;  3HOV G;  1WYD A;  3S2H H;  3STB C;  2R93 H;  1CKN A;  2NVX H;  2HHH L;  2ZTD A;  3RNU A;  4JI2 L;  4JI0 Q;  1WCM G;  1W3S A;  4NXN L;  3RR5 A;  2K5N A;  1B8A A;  4DUZ L;  4EX5 A;  3KLW A;  1XPO A;  2JA5 G;  1OTC A;  3PO3 H;  5HY6 A;  4H02 A;  2HT1 A;  1Y1V H;  2IT1 A;  1EQQ A;  4DV2 Q;  2N3S A;  4QIW E;  4NB3 A;  4JI3 Q;  3ICE A;  1YHQ A;  4A3C H;  2N49 A;  1LM0 A;  3RN2 A;  4DK3 C;  1UEB A;  5LMU Q;  1VQL A;  1JT8 A;  3I4M H;  4JOI C;  1N32 L;  3J81 j;  3OTO L;  1KQS A;  4PZ8 A;  3PV0 A;  3JAM c;  4POG A;  1I6H H;  4WJ3 M;  4KI0 A;  2VQE Q;  2GVA A;  2CFM A;  1SLJ A;  3PO2 H;  1QUQ B;  2HIX A;  2YTV A;  2KBN A;  1Q46 A;  4P72 A;  3UDF A;  1U5K A;  2UU9 L;  3PUX A;  1Q12 A;  4A3G H;  1OXV A;  2MO0 A;  4A3I H;  1OXU A;  2JE6 I;  3GTG H;  4IFD J;  2LXK A;  4DK6 C;  1VQ5 A;  2PMZ E;  2XGT A;  4GOP C;  1N33 L;  1TWA H;  1IBM Q;  3AEV A;  2IX1 A;  4HJ8 A;  4BY7 H;  1KRT A;  1PH3 A;  3HOZ G;  1PVO A;  1XNQ Q;  4A3B G;  5M3F G;  2R92 H;  4EQ5 A;  4JI4 Q;  2QGQ A;  4KHP L;  2E8G A;  2JJQ A;  5C4J H;  1VQO A;  1PH9 A;  1J5E Q;  4JI0 L;  4LFA L;  1HZA A;  2Z6K A;  1VQ8 A;  4LFB Q;  4UPA A;  1HR0 Q;  4X6A H;  1VQA A;  2CWA A;  1TWG H;  4DV0 L;  1AH9 A;  1HNX Q;  3MEF A;  5FLM H;  4YHH Q;  1IBL L;  2F4V L;  5GAH C;  2WB1 E;  2JA8 G;  1I5F A;  1I3Q H;  5IYB G;  3I2Z A;  1SN8 A;  3HKZ E;  3CCJ A;  4HIO A;  3LGJ A;  1P8L A;  1CSQ A;  1VQE A;  3HKS A;  2K5V A;  2KCT A;  3RLO A;  5HGQ A;  1PHJ A;  1HH2 P;  2EIF A;  4Y7N H;  1KD1 C;  2OWO A;  4B3T Q;  2YV5 A;  4A3F G;  4BXX H;  2UXB L;  1HZB A;  2BA1 A;  2Y0S E;  1LYL A;  1N36 L;  4LF5 Q;  3A74 A;  2D62 A;  1Z9F A;  2H5X A;  4ME3 A;  4BBR G;  1N9W A;  4R4T A;  2UUB Q;  3FHW A;  3H3V H;  1EIF A;  2QA4 A;  4LF4 L;  4GOP B;  3AQQ A;  4HIM A;  3TQY A;  1XMQ L;  1X65 A;  2GVB A;  1Y14 B;  4JV5 Q;  1C7Y A;  4YCV A;  1YVC A;  5IYC H;  3HOU G;  4DR1 Q;  4DR4 Q;  1FVI A;  3HOV H;  3PSI A;  1VQN A;  1K3R A;  4OXP A;  4HJ7 A;  1VQG A;  3PIP A;  3CXC A;  1DGS A;  1PH6 A;  1NMG A;  2ZJP A;  4OX9 L;  3ULJ A;  3NEL A;  1WCM H;  5LMN Q;  4JI1 L;  2PI2 E;  2WFW A;  3CC2 A;  2JA5 H;  1YNX A;  2FXQ A;  3BZK A;  4P71 A;  4YWM A;  5GQO A;  1UE5 A;  3PUZ A;  4BA1 I;  4DAY B;  2VNU D;  1Q81 C;  4DUY Q;  2UXD Q;  2K4K A;  5IWA Q;  4IOA A;  3KDF B;  4GKK Q;  4WJ4 A;  5ELO A;  2ZM6 L;  4JG2 A;  2JA6 H;  4LF6 L;  3K81 C;  2LSS A;  5M5W H;  4OON A;  3CC4 A;  3KF6 A;  3DM3 A;  1AE3 A;  3PGZ A;  2WP8 J;  4X66 Q;  3CPW A;  1WFQ A;  1XMO L;  2Z0S A;  4JBW A;  2BH8 A;  3E9H A;  1I50 H;  3L7Z C;  4A3L H;  4AH6 A;  2I5M X;  2VW9 A;  1A63 A;  1HZC A;  3HOX G;  1J6Q A;  1L0W A;  1K0R A;  4UY8 C;  1XNR L;  3S1R H;  3KF6 B;  5M3F H;  1QZG A;  2ZJR A;  4YY3 Q;  4JI6 Q;  4AQY L;  1FJG Q;  3K8A A;  3J80 i;  4JC0 A;  3IRB A;  1PH5 A;  1SE8 A;  2OQK A;  1CUK A;  2R7F A;  4LF7 L;  4C3I H;  1IBK Q;  2E5L L;  1G51 A;  3HOW G;  3I4O A;  5GAG C;  4IPG A;  2JA8 H;  1NBW A;  1LUZ A;  3B6Y A;  4R1J A;  4AIM A;  5IYB H;  4HJ5 A;  3RN5 A;  1X55 A;  5JEA J;  1X56 A;  4DV4 L;  1K9M C;  1C9O A;  3H15 A;  2K75 A;  1VQM A;  1N34 Q;  2ES2 A;  3ER0 A;  2WAQ E;  4X62 L;  4LW1 A;  4R4O A;  3T1Y L;  4PZ7 A;  3UDG A;  4BY1 G;  2N8N A;  1P16 A;  4BBR H;  1CSP A;  5AJ3 Q;  1R9T H;  1Q86 C;  3CCL A;  3TS2 A;  1IL2 A;  1Q1B A;  1EFW A;  4GS3 A;  3ULP A;  3BZC A;  3W1B A;  1Q1E A;  1TWC H;  4DUZ Q;  3PCO B;  4DV3 L;  4DV5 L;  1BBU A;  2I0Q A;  1T9H A;  4NXN Q;  3U50 C;  1HNZ L;  2MNA A;  4A3M H;  4C3H H;  3T1H Q;  2JA9 A;  3S1N H;  3W5O A;  2QEX A;  1IXR A;  1N8R C;  2E2I H;  2ZJQ A;  4X65 L;  1W2B A;  3GTL H;  3CCM A;  1N32 Q;  3EIV A;  3I56 A;  1KC8 C;  4LFC L;  2ZTC A;  4NXM Q;  1CKN B;  1WJJ A;  2GN5 A;  3I55 A;  1EUJ A;  1PYB A;  2PQA A;  5IY0 A;  5ELN A;  1OXS C;  4L5T A;  2UU9 Q;  4DR2 Q;  1FL0 A;  1Y1W G;  4A3K G;  1YJW A;  2Z6K C;  1LTL A;  1UWV A;  3HOY G;  4JYA L;  1QVF A;  2IX0 A;  4B3M L;  4KHZ A;  4UP8 A;  4K0K Q;  1SRU A;  2ATW A;  3RZD H;  4IOC A;  4JI7 Q;  4OWW B;  5C3E G;  1KIX A;  4GNX A;  1HR0 L;  4DR6 L;  3CCV A;  3OYY A;  4DV2 L;  3KYH C;  1KAW A;  5FLX c;  3G4S A;  5GAE C;  2KHI A;  4LFA Q;  2UUC L;  5LMU L;  3GTM H;  5BR8 L;  3HOX H;  3MXN B;  3KOJ A;  3KJO A;  3GDE A;  4DV0 Q;  4GN5 A;  1X9N A;  2VQE L;  1KRS A;  2DUD A;  2Q2I A;  2KCM A;  2OCE A;  1HZ9 A;  5IP9 G;  2IY5 B;  3AYH B;  3Q8D A;  2BH2 A;  2YU9 H;  3F1Z A;  3M9B A;  3U4V A;  2VUM G;  4POF A;  4LF9 L;  3HOW H;  4O2D A;  4JBJ A;  1IYJ B;  3AFQ A;  1A62 A;  2UXB Q;  3K7U C;  4UP9 A;  3DLL A;  3CCU A;  3H0G G;  1QVG A;  1N36 Q;  2VQF L;  4IFD I;  3CCR A;  4FDB A;  5DLQ E;  4GKJ Q;  1XNQ L;  4B3S L;  1VQJ A;  1X3G A;  4JCV E;  1YJ9 A;  4LF4 Q;  4JI4 L;  2NZO A;  1WOC A;  1XMQ Q;  4BA2 I;  4L5Q A;  4TVA B;  1VQK A;  3TRZ A;  3CC7 A;  3FKI G;  4UP7 A;  1S3O A;  4YCW A;  4BY1 H;  1D7Q A;  4MZ9 A;  3G6E A;  4DV6 L;  2YTY A;  4LNQ A;  5C4X G;  4IPC A;  1JB7 A;  1SR3 A;  1YHB A;  3A0J A;  3K0X A;  3PF5 A;  1HNX L;  4YHH L;  1X54 A;  4LUV A;  4QY7 A;  4QJF A;  1ASY A;  2JQO A;  4QQB X;  1JJ2 A;  2NVQ H;  1MJC A;  4RMF A;  4JI1 Q;  1CKO A;  4HJA A;  1I94 L;  3CMA A;  2DGY A;  1VQC A;  3HFZ B;  2IHF A;  4B3T L;  3UE1 A;  2JA7 G;  1QZH A;  1OXX K;  2R6G A;  2HIV A;  2YYZ A;  4R4Q A;  5K36 G;  2WB1 G;  4LF5 L;  3CCQ A;  3HKZ G;  4A3E G;  4LF8 Q;  2BA0 A;  2B63 G;  3U58 A;  4A93 G;  1L2F A;  4JI8 Q;  2AKW B;  2PI2 A;  4LF6 Q;  1UE7 A;  2I5H A;  5C0X J;  2R93 G;  3L2P A;  1YZ6 A;  3CF5 A;  4DR3 L;  4DR5 Q;  1XPR A;  3S1Q H;  4BBS G;  2V1C C;  2Y0S G;  1BVS A;  4DR1 L;  1V43 A;  1Y1W H;  2B29 A;  1HR0 W;  4JBM A;  3M3Y H;  3S16 H;  4L5R C;  4IPD A;  5JJL A;  3KJP A;  3HOY H;  1EOV A;  4YCU A;  1UE6 A;  1K73 C;  1K8A C;  2C35 B;  1V1Q A;  2YTX A;  5LMN L;  4HID A;  3I4N G;  2CKZ B;  4B3R L;  2B3G A;  5C3E H;  1E1O A;  1X6O A;  1XNR Q;  3HOZ H;  1Q8K A;  2R7D A;  3F2C A;  1IZ6 A;  2KHJ A;  4A3B H;  2JEA I;  4A3D G;  1B7Y B;  1E24 A;  2NN6 I;  4OO1 I;  4KLK A;  3OW2 A;  4AQY Q;  2UXD L;  2K52 A;  1XPU A;  3S14 H;  3RLN A;  3GO5 A;  1BKB A;  1X3F A;  5C44 G;  1NTG A;  2CQO A;  4DV1 Q;  5JJK A;  5IP9 H;  1Q7Y C;  4A3J G;  4O0A A;  4QGU A;  5C0X I;  4DR7 Q;  3S15 H;  5M5Y H;  1EYG A;  3A5Z B;  2VUM H;  4P75 A;  3J7A 5;  2N78 A;  4JI5 L;  3TRE A;  4OO1 G;  1MIU A;  1KHI A;  3GTQ H;  2RF4 A;  2VZA A;  4R4I A;  4A3F H;  2LXJ A;  3CW2 C;  3EBE A;  1ASZ A;  3T1Y Q;  5J3B A;  1VQP A;  1KXL A;  4DAM A;  1BBW A;  2AHO B;  1VQH A;  1SMX A;  3GTO H;  1HNW L;  1RL2 A;  3PUV A;  3H3V I;  1FJG L;  3FKI H;  5H1S E;  4AYB G;  3PIO A;  1KL9 A;  4DV5 Q;  1YJN A;  1JMC A;  4JI2 Q;  2HHH Q;  1Q82 C;  2UUA L;  4Y52 H;  3HOU H;  2UXC Q;  1XTD A;  1G29 1;  3J80 c;  1IBK L;  1HNZ Q;  4YWK A;  3BU2 A;  1GD7 A;  3CP0 A;  1A0I A;  2NVT H;  4OWX B;  3ULL A;  1K8G A;  1PH2 A;  3RZO H;  3JAM i;  1E7Z A;  1FGU A;  1VQF A;  4GLV B;  5IP7 G;  4GNX C;  2JA7 H;  1N34 L;  3J7Z C;  1VQD A;  3OTO Q;  1D8L A;  3S2D H;  4X64 L;  1E3P A;  1VQI A;  2KEN A;  4JBK A;  1Z47 A;  4A3E H;  5AJ3 L;  2L15 A;  1MJE A;  1VQB A;  4A93 H;  4DV7 L;  1GO3 E;  2JK8 A;  3UE0 A;  5M3M G;  3CME A;  1YIT A;  1PH4 A;  4PMW A;  4PG3 A;  3I7F A;  4J15 A;  4JYA Q;  3F2D A;  1PV4 A;  4B3M Q;  4L5S A;  1HJP A;  4BBS H;  2E2H H;  1E22 A;  2K5H A;  2WAQ G;  1YBY A;  3G48 A;  3KF8 B;  5LMN W;  3CPF A;  1N33 Q;  3CCS A;  1QUQ A;  2UXC L;  5JEA G; 
#chains in the Genus database with same CATH topology
 4KKS A;  4H7B A;  1H95 A;  3V96 A;  2MQH A;  1HFG A;  3PUW A;  3ONA B;  3CD6 A;  2UUC Q;  3M7N A;  2F0D A;  2JA6 G;  1B44 D;  2WAC A;  4IO9 A;  2QDL A;  3E0E A;  3S24 A;  4FXG C;  4DR2 L;  1CKM A;  3BZD B;  2TMP A;  1KTK A;  2AQ3 B;  3HZX A;  1U4P A;  1Y8N B;  5JJI A;  4UDU C;  2NYZ D;  2D9U A;  3S17 H;  1IBM L;  3FRP B;  3DUZ A;  4I7Z C;  4J8Q A;  5EJW A;  2HD3 A;  3RZO B;  5KYI A;  1GM5 A;  1PH8 A;  2PZW A;  1NUC A;  1S4Z A;  1JJC B;  5IGG A;  2JA7 B;  5IYD G;  1PRT D;  5E1F A;  4ZUJ A;  4FF2 A;  2AMC B;  3L0O A;  3HKZ B;  5I6Y A;  3J7A V;  1NY4 A;  3MA2 B;  5CBA E;  2E2H B;  2Y0S B;  4XIG S;  2FFK B;  2ID0 A;  3J7A F;  5E7N A;  1PDQ A;  4GLX A;  2F0U A;  4HSV A;  2NUC A;  4JV5 L;  3BYT B;  1IYV A;  3K80 C;  2ZXO A;  4FNF A;  1V1P A;  3A5U A;  5CBE E;  4X3U A;  4KJO A;  4A3C G;  1S72 A;  3A8I E;  3I4M G;  1RTO A;  3E3X A;  3F8T A;  3OWE B;  2EYP A;  4DUY L;  1O7I A;  3S17 B;  1H9J A;  2D5D A;  3IAY A;  4JI8 L;  1VQ9 A;  1D6E C;  3P1H A;  4LF7 Q;  2E5L Q;  1DON A;  2E2J H;  1YHA A;  3QG1 A;  4X66 L;  2K01 A;  4DV4 Q;  1SRO A;  2KHS A;  1NMF A;  4LUO A;  3QOJ A;  3M4O H;  1QWY A;  2G9H D;  2K5D A;  3TEH B;  2RHS B;  5CV5 A;  4P74 A;  3V05 A;  4YY3 L;  1LO5 D;  2RBM A;  1CA5 A;  4DV3 Q;  5C4X H;  2VY3 A;  1EU4 A;  2EQS A;  2K04 A;  4OEM B;  4R8I A;  3TDQ A;  1M4V A;  2BOS A;  2Q2T A;  4Q0F A;  2C9O A;  4X65 Q;  1I4P A;  1HQM C;  4G7H C;  1QVC A;  3TME A;  4KJN A;  1XXG A;  1HHV A;  2I5L X;  3VR5 A;  2A8V A;  4I65 A;  2N55 A;  2WII B;  1WYD A;  2G9D A;  5FO8 B;  2B2U A;  4JI0 Q;  2JA5 G;  3KLW A;  4IUR A;  3PO3 H;  5HY6 A;  3KLR A;  3AB9 A;  1EQQ A;  4DV2 Q;  3ICE A;  1YHQ A;  2B2Y A;  5CV9 A;  3IFD A;  2N49 A;  1SYE A;  3J81 E;  4DK3 C;  4FF3 A;  2E2J B;  5LMU Q;  1EIG A;  1CFM A;  1KQS A;  1DCZ A;  4KI0 A;  4CDC C;  3OWF A;  2GVA A;  2VQE Q;  3PO2 H;  1H9R A;  4S3S A;  2HIX A;  2YTV A;  2KBN A;  1UEA B;  4A3G H;  2MO0 A;  1BXT A;  5CR3 A;  3GTG H;  4DK6 C;  3NSW A;  3PIP 3;  1VQ5 A;  2XGT A;  3R3O A;  1QOH A;  1TS5 A;  3AEV A;  4IQZ A;  4BY7 H;  1EIH A;  1KRT A;  4A3B G;  2R92 H;  4Q5V A;  2HCC A;  3P7J A;  2JJQ A;  5C4J H;  1PH9 A;  4PNY A;  1Y8P B;  4UPA A;  1AH9 A;  1HNX Q;  4HN7 A;  5JAV A;  5GAH C;  1IKM A;  1I3Q H;  4HIO A;  1C4Q A;  3LGJ A;  1VQN A;  2KCT A;  1HH2 P;  4KD3 A;  4B3T Q;  4CGY B;  2YV5 A;  3Q0A A;  1SNC A;  1N36 L;  4GZY C;  2D62 A;  4BBR G;  3PO3 B;  4HSP A;  2L4N A;  4A3M B;  3TQY A;  2F0T A;  5EBC A;  2B39 A;  2FHT A;  3HOU G;  4IZ8 A;  1UUP A;  1QJO A;  2F4I A;  4C3H G;  1PH6 A;  1DGS A;  1DYQ A;  1NMG A;  3K6O A;  3D4D A;  3ULJ A;  3NEL A;  5EPL A;  3PO2 B;  2PI2 E;  2WFW A;  4P71 A;  5JEA H;  2EJF C;  4A3G B;  3GTG B;  2XRS D;  3KLS A;  4ZYS A;  4K2L A;  4BY7 B;  4GKK Q;  4WJ4 A;  1V1P B;  2OEO A;  2ZM6 L;  4JG2 A;  4LF6 L;  2R92 B;  2WIN B;  2LSS A;  5M5W H;  4OON A;  3CC4 A;  1I4Q A;  3KF6 A;  5C4J B;  1HUM A;  1CI3 M;  2BH8 A;  5IOC A;  4AH6 A;  1I3Q B;  3HOX G;  4CJ0 B;  5M3F H;  3EJI A;  4U67 3;  3GV3 A;  4K5X A;  3K8A A;  1EYC A;  4HAE A;  5EKL A;  3P75 A;  1IBK Q;  3A56 A;  1G51 A;  1JB3 A;  1EY9 A;  3D4W A;  3NP8 A;  2JA8 H;  1LUZ A;  4AIM A;  2B2U C;  1HRJ A;  2J0T D;  1X56 A;  1C9O A;  2WAQ E;  4LW1 A;  4R4O A;  4PZ7 A;  2B2Y C;  3UDG A;  2J4X A;  1EFW A;  3BZC A;  3W1B A;  4X3T A;  5FK9 C;  4MTK A;  3PCO B;  1ZYR C;  2MNA A;  2ZT9 C;  2JA9 A;  3R8B A;  1GUN A;  3KLS X;  5M5W B;  4QF4 A;  2QW7 A;  1AEX A;  2PQE A;  4R8N A;  1BOS A;  3CCM A;  4K8I A;  1N32 Q;  2MJ8 A;  2PZT A;  3QJY A;  4J1M A;  1Y69 U;  3VR3 A;  2ZTC A;  3CU7 A;  1WJJ A;  2GN5 A;  3I55 A;  1EUJ A;  2PQA A;  5IY0 A;  5I9O A;  4KKT A;  3J80 E;  1OXS C;  4L5T A;  4DR2 Q;  4NP5 A;  5M3F B;  1A3V A;  2HQE A;  4KHZ A;  1G8Z D;  1STH A;  4DR6 L;  4GNX A;  1KAW A;  1LT6 D;  2KHI A;  1SJE D;  2UUC L;  2JA8 B;  3S15 B;  5FOB B;  4GN5 A;  1X9N A;  2Q8T A;  2DUD A;  3DEO A;  2Q2I A;  1PYW D;  5IP9 G;  2IY5 B;  3CRL C;  2WKC A;  2BH2 A;  1Q90 A;  4KY5 A;  2F03 A;  5FKA C;  3F1Z A;  2SEB D;  2VUM G;  1C48 A;  2LY7 A;  4POF A;  3GV6 A;  3MC0 B;  1ILP A;  5J22 A;  3NBH A;  3FMC A;  1R4P B;  4IUQ A;  2F0N A;  3CCR A;  4FDB A;  4KN4 C;  5DLQ E;  1HUN A;  1XNQ L;  3OMG A;  2Z4H A;  4FP5 D;  1X3G A;  5KNB A;  3J81 L;  1BCP F;  1SJH D;  1XMQ Q;  3LWU A;  1DJR D;  4RA8 A;  4BY1 H;  1VF7 A;  3G6E A;  2CVR A;  1HCZ A;  2YTY A;  2R3Z A;  3K0X A;  3PF5 A;  4YHH L;  1X54 A;  1ASY A;  3NQI A;  4CJ2 C;  4HJA A;  1BF4 A;  5JOB A;  2F1M A;  4DNT B;  1B3A A;  1OXX K;  3BVG A;  1DXM A;  5K36 G;  2OF1 A;  5K5P A;  2WB1 G;  4HED A;  2WKD A;  4A93 G;  4JI8 Q;  1STB A;  3MWY W;  2I5H A;  2R93 G;  4BBS G;  3PIO 3;  1LTT D;  1V43 A;  1Y1W H;  3S16 H;  1HR0 W;  4L5R C;  5JJL A;  4R9W A;  1EOT A;  3KJP A;  4YCU A;  1Z7T A;  1PFN A;  2YTX A;  5LMN L;  5LHY 1;  3I4N G;  3WOE A;  3HOZ H;  1WVL A;  3F2C A;  2KHJ A;  2DNC A;  2UXD L;  1F9R A;  2A69 D;  1WD0 A;  2A6H D;  5C44 G;  2CQO A;  4ABN A;  5JJK A;  5C0X I;  2PW7 A;  4BY1 B;  1ICF B;  1EYG A;  2F0W A;  3TRE A;  3DM1 A;  1Y8O B;  3L9A X;  2VZA A;  3K5O A;  3ND9 A;  4A3F H;  1DM0 B;  1G2S A;  5J3B A;  3I4L A;  2AHO B;  3I8Z A;  1FJG L;  3FKI H;  4AYB G;  1BQQ T;  4DFA A;  2H1E A;  1XTD A;  3J80 c;  1HNZ Q;  4HCS A;  4YWK A;  3CP0 A;  1PFM A;  1BUV T;  1KDC A;  1STG A;  5IGD A;  1FGU A;  3S16 B;  1Y1W B;  2KED A;  5IP7 G;  4GNX C;  4A3K B;  2H4O A;  1HXY D;  5AJ3 L;  2VXW A;  3DWP A;  5IIF A;  1NR2 A;  2JK8 A;  1EEI D;  5M3M G;  1YIT A;  1PH4 A;  3I7F A;  4J15 A;  1ENF A;  4KMU C;  1HJP A;  4G7Z C;  5KYL A;  1ZKO A;  4JI0 L;  3EFX D;  3CCS A;  1HR0 Q;  2AQ1 B;  2NB0 A;  2NWG A;  2PQA B;  2D0P A;  4QIW B;  1CA6 A;  1U4M A;  5L37 A;  3I91 A;  4GN4 B;  3AMU A;  4NXM L;  3I72 A;  4ZRZ A;  4IJH A;  2V4D A;  3TN2 A;  1VQ6 A;  1SEB D;  3TP8 A;  4GNX B;  3BJU A;  4C3J B;  1RD9 D;  2B2T C;  2NZH A;  2HQL A;  5JVG 3;  4K0K L;  1EIY B;  4A3J H;  1AE2 A;  2MO1 A;  3FKI B;  2VQF Q;  2RHQ B;  3JAM E;  4JOI A;  1PTO D;  4B3S Q;  1CZW A;  3KK7 A;  3WWV A;  4HJ9 A;  1MI2 A;  4XTC S;  4C2M H;  1PH1 A;  3QO2 A;  3J80 L;  4FF4 A;  1M1K C;  3NBH B;  1PXU A;  4IFD G;  2O2L D;  1SSO A;  4RAU C;  1F2L A;  2VS1 A;  4N8X 1;  1SFO H;  2R7Z G;  3N52 A;  3MFG A;  1ZXT A;  3NHH A;  2ZM6 Q;  1K83 H;  5EPJ A;  2K7V A;  1IW7 C;  4MNO A;  4DN4 M;  3H09 A;  1JWU D;  2ENB A;  3CAM A;  2G5D A;  1WTO A;  3NWS A;  4QUF A;  2L11 A;  3UDI A;  2EYH A;  1B50 A;  2X69 A;  4JK1 C;  3M85 A;  2RCN A;  4R4C A;  3TS0 A;  3GTP H;  2BE5 C;  4A3J B;  2CCZ A;  3SGI A;  4RG1 A;  1LT3 D;  5I2Y A;  4GKK L;  4A3I G;  3NPP A;  3MAQ A;  5COR A;  4DR5 L;  4O42 A;  3DWA A;  1V9P A;  1HTL D;  4QUC A;  1EY6 A;  4C2M B;  1JE5 A;  2L5T A;  1EWI A;  2NN6 G;  3PQI A;  4KHV A;  4RGN A;  2EXD A;  3FP9 A;  4WFN 3;  3K7A H;  3H0G H;  4RGM A;  4ILW A;  5EAY A;  4HIK A;  1HNW Q;  5DNF A;  1F2Y A;  4IUP A;  1SFO B;  1VCI A;  2UUA Q;  2AWN A;  3U4Z A;  2Z8L A;  4BXX G;  5IYD H;  3PF4 A;  4YWL A;  1BNZ A;  1WTQ A;  4CHT B;  4DR7 L;  4QL5 A;  3G7L A;  2A1A A;  2PNH A;  4RCO A;  4DNI A;  2O5J C;  1EQV A;  5JJZ A;  4X64 Q;  1WTP A;  4B08 A;  5DM6 3;  3AFP A;  1GKH A;  1FNU A;  1Z6H A;  1RIP A;  5IT9 c;  3WDN A;  2DN8 A;  1PA6 A;  3STB C;  3GTP B;  3RNU A;  1F2M A;  1E2Z A;  1W3S A;  2EY5 A;  2K5N A;  1GHJ A;  1JR0 D;  1OTC A;  2HT1 A;  2N3S A;  4NB3 A;  4A3C H;  2K05 A;  1G2T A;  3OW7 A;  3RN2 A;  5M9O A;  1VQL A;  5CV8 A;  3I4M H;  4JOI C;  1N32 L;  3FDT A;  3J81 j;  3OTO L;  3QR8 A;  3PV0 A;  4HR7 B;  3JAM c;  4POG A;  4P72 A;  3UDF A;  3K7A B;  1U5K A;  3H0G B;  1Q12 A;  1OXU A;  2JE6 I;  4IFD J;  1JOR A;  4RGO S;  4RHR A;  2PMZ E;  2XN9 C;  4RWS C;  1N33 L;  1TWA H;  2PMZ B;  3D3R A;  1XNQ Q;  4EQ5 A;  2E8G A;  4H44 C;  3SXH A;  1EYD A;  4LFB Q;  1VQA A;  3MEF A;  2M2L A;  4YHH Q;  1IYU A;  1IBL L;  1B53 A;  3I2Z A;  1SN8 A;  3HKZ E;  5HGQ A;  3RLO A;  1STY A;  2SNS A;  1FNW A;  1HZB A;  2HDM A;  2Y0S E;  5ELE A;  4ME3 A;  5IT9 L;  3D4R A;  4R4T A;  2UUB Q;  3FHW A;  3H3V H;  1XMQ L;  2EPB A;  2GVB A;  1Y14 B;  3I70 A;  1C7Y A;  1O7Z A;  3BVZ A;  1F9S A;  3I4M B;  1FVI A;  1PZK D;  2KCN A;  4DR4 Q;  1JQY D;  4XQQ A;  2C5C A;  4B9X A;  3PIP A;  2EYO A;  1KAA A;  2ZJP A;  4LJZ C;  5LMN Q;  2A68 C;  1TII D;  1PTO F;  2JA5 H;  2RA4 A;  3K0Y A;  3PUZ A;  3JAM L;  4KY7 A;  5AFW A;  2IPK D;  3H3V C;  2DY7 A;  2O4X A;  4N9T A;  5A2Q L;  4XDX A;  2K4K A;  2UXD Q;  1TWA B;  2M9V A;  4C1N K;  1VMC A;  3N6R A;  5ELO A;  4CKB A;  4EGV A;  4HTH A;  4WJW A;  1MSH A;  1AE3 A;  2F0M A;  1GOZ A;  1XMO L;  3J7Y W;  2Z0S A;  4JBW A;  1SNM A;  5I4D A;  2RQX A;  1EY4 A;  4A3L H;  3BDL A;  1SNP A;  4KKU A;  5I9P A;  2A73 B;  1QZG A;  1Q8I A;  2K6A A;  3EVQ A;  1HFN A;  2MHV A;  2ZJR A;  4JI6 Q;  1FJG Q;  5KEE A;  4MIU A;  4V19 0;  4ZUI A;  2R7F A;  1FD7 D;  3EA6 A;  4R1J A;  5CGK A;  4HJ5 A;  4K6D A;  2KA7 A;  4J6H A;  1S5F D;  1K9M C;  2LS0 1;  3ER0 A;  3V2T A;  1D2B A;  4X62 L;  1CTM A;  4BBR H;  5AJ3 Q;  2JA5 B;  1V1O A;  1Q86 C;  3CCL A;  1JWM D;  3NTK A;  1K8M A;  1LTA D;  2F0K A;  3OHX C;  3ZYY X;  2BCO A;  1H9K A;  1GJX A;  1HNZ L;  5IGB A;  1J9O A;  1TS3 A;  4A3M H;  4C3H H;  3S1N H;  4ZAI A;  3W5O A;  1IXR A;  3KF8 A;  3KBG A;  1PZJ D;  4LFC L;  4NXM Q;  1PYB A;  1IHZ A;  1FYC A;  3MVV A;  5ELN A;  1LTL A;  3HOY G;  4UP8 A;  4K0K Q;  1SRU A;  1YNN C;  4E6I A;  4IOC A;  2K5Q A;  3U9O A;  1HR0 L;  3CCV A;  5FLX c;  3G4S A;  1TT2 A;  1WTR A;  3HOX H;  3VR4 A;  3VYT A;  3Q24 A;  3KJO A;  4DXG A;  3GDE A;  3GTQ B;  2A6E D;  3C2P A;  2KCM A;  4NDX A;  1E2V A;  3AYH B;  1FNV A;  3Q8D A;  1D5X C;  4FO2 A;  3M9B A;  2HUG A;  5T1I A;  4BBR B;  1EL0 A;  2FIN B;  1XX8 A;  4O2D A;  2EDG A;  1TQO A;  3ND8 A;  2VQF L;  3SK5 A;  4B3S L;  1VQJ A;  3R93 A;  1YJ9 A;  1F9P A;  4C3H B;  4TVA B;  1VQK A;  3S1N B;  4BS9 A;  3TSS A;  4UP7 A;  3Q23 A;  4YCW A;  1D7Q A;  4DU9 A;  5BN4 A;  5C4X G;  3IKJ A;  1SNQ A;  1SR3 A;  3A0J A;  4QY7 A;  1A2T A;  4QJF A;  2Z4I A;  1JJ2 A;  5C6A A;  4JI1 Q;  2DGY A;  2IHF A;  3UE1 A;  1QZH A;  2YYZ A;  4R4Q A;  3TP6 A;  4A3E G;  1ESF A;  3AU7 A;  2A5H A;  2EYJ A;  1NR4 A;  1PRT F;  3H6M A;  3S1Q H;  4DR5 Q;  1DD2 A;  2ZXR A;  1BVS A;  3HOX B;  3M3Y H;  2IX3 A;  3D8G A;  1D1I A;  1GUS A;  2C35 B;  1RJT A;  2CKZ B;  1H9M A;  1AZP A;  1IZ6 A;  4A3D G;  2JEA I;  3OOC A;  1B7Y B;  4KLK A;  2F0H A;  4XXE A;  3OW2 A;  2KEE A;  4FYD A;  1K28 A;  1TU2 B;  1XPU A;  2MGS A;  3S14 H;  4QCL A;  1Q3L A;  5C5L A;  3HGB A;  5IP9 H;  4DR7 Q;  2I46 A;  2E2D C;  3S15 H;  2VUM H;  4KD4 A;  4P75 A;  3J7A 5;  2Z1C A;  5JPM C;  1KHI A;  2RF4 A;  3Q22 A;  1U4L A;  3T51 B;  5IGC A;  2RSN A;  1BBW A;  1VQH A;  1HNW L;  1KDB A;  1SXT A;  3SVM A;  1EWH A;  4KN7 C;  1K8O A;  3PIO A;  5IGF A;  1KL9 A;  4DV5 Q;  1YJN A;  2UUA L;  1Q82 C;  4Y52 H;  1D1K A;  1GD7 A;  2X6L A;  1A0I A;  2NVT H;  1KDA A;  4CDE C;  1EY0 A;  3S1Q B;  5TSS A;  1PH2 A;  1OO9 B;  2A74 C;  1E7Z A;  1VQF A;  3M3Y B;  1N34 L;  3OTO Q;  3S2D H;  3A8K E;  1E3P A;  4X64 L;  5K36 H;  2KEN A;  1MSG A;  1Z47 A;  1YNJ C;  4A93 H;  1GO3 E;  3UE0 A;  4PMW A;  2LFN A;  4JYA Q;  5ELC A;  3F2D A;  4B3M Q;  1RCV D;  4BBS H;  2WAQ G;  3G48 A;  3KF8 B;  1GUO A;  3CPF A;  4V0B A;  1N33 Q;  5JEA G;  4M8A A;  3S14 B;  1WTV A;  1VS0 A;  1CQV A;  1YEZ A;  4IPH A;  4KV6 A;  3MHB A;  2AQ2 B;  4UAI A;  4DKA C;  4F87 A;  2KVM A;  3I4N H;  2VUM B;  2DY8 A;  2B8F A;  1TWF H;  3MEH A;  1WD1 A;  1IBL Q;  1LAC A;  2F0I A;  5FJ8 G;  3VA5 A;  3TBI B;  4LF9 Q;  3TP5 A;  1SNO A;  5C44 H;  1QNK A;  4JI7 L;  2KQ3 A;  2ALY B;  1EYA A;  5M5X B;  3EQL C;  1NJI C;  2NVT B;  1LV9 A;  4TQU S;  1UE1 A;  3M4Q A;  2NBF A;  4LFB L;  2B2T A;  3G71 A;  4P73 A;  1ET6 A;  1O80 A;  1GUT A;  1LTB D;  3S2D B;  3KUP A;  4GOP A;  4G4K A;  2QKI C;  1JJG A;  4NW2 A;  2WB1 B;  1I94 Q;  1L1O C;  4A93 B;  2XIW A;  5D3I B;  3NEM A;  3MXP A;  3VYR A;  2R93 B;  2OTL A;  2NVX B;  5EKI A;  4BBS B;  1YIJ A;  4GKJ L;  3GD7 A;  2UUB L;  5IP7 H;  5F2D A;  4DAY A;  1IL8 A;  3QWN A;  3ZJY C;  2OQ0 A;  3I4N B;  3EN2 A;  4DR4 L;  5M3M H;  1U0L A;  4A3K H;  1XMO Q;  5GRO A;  4C56 C;  2Q2U A;  1Y1V G;  5A35 A;  1PRT C;  1TWF B;  4RHS A;  2OT2 A;  3GQB A;  4B3R Q;  2JYO A;  3NUC A;  5C44 B;  1TWH H;  4PMB A;  3UDX A;  3QIA A;  1L1O B;  3SHL A;  4IJL A;  5GAD C;  3LWE A;  1MKH A;  3K5L A;  1I4G A;  2NVY H;  4LUZ A;  3BG3 A;  1GUG A;  2CWP A;  5KIX A;  1VQ7 A;  3NK9 A;  2HDL A;  1DZ1 A;  5C4Z A;  4OIK A;  1II3 A;  1O78 A;  4AYB E;  3RLF A;  3D31 A;  1C0A A;  4X62 Q;  1B9M A;  1EWC A;  4U68 A;  4AYB B;  2EY2 A;  1CT1 D;  4LWC A;  1PRT B;  4C3J H;  2DJF C;  1EU3 A;  2SNM A;  3E6Z X;  4XQJ A;  1YI2 A;  3S1M H;  5C0X G;  5DEH A;  4NPS A;  2XVS A;  5FLM G;  3M4P A;  4JI6 L;  3VDY A;  1QNU A;  3W2D A;  3H91 A;  3BYY B;  3VA7 A;  5ELF A;  1LLR D;  1BR9 A;  5CV4 A;  4IFD H;  5IE8 A;  5CMD A;  2VB3 X;  1G6P A;  2D0O A;  4GLA C;  2A19 A;  4XT1 B;  1LTR D;  3JC6 6;  3E9I A;  2NTS A;  5M3M B;  2EJG C;  2Z9H A;  3BS1 A;  4LFC Q;  3D6W A;  2VL6 A;  2R7Z H;  4EVO A;  1PH7 A;  1WI5 A;  5HGT A;  4CDD C;  5IYC G;  4DV7 Q;  2B63 H;  3HOV G;  1GUW A;  3S2H H;  1SYD A;  1TWH B;  1YNN D;  3HEJ A;  1CKN A;  1LT5 D;  4JI2 L;  1STE A;  1WCM G;  3RR5 A;  2UXC Q;  4EX5 A;  2NVY B;  2AUJ D;  4QIW E;  2K33 A;  4JI3 Q;  2F0G A;  3HRZ C;  1HQR D;  5IT9 E;  4G7O C;  1JT8 A;  2KJX A;  4WJ3 M;  1D5M C;  5FO7 B;  1Q46 A;  3Q6S A;  1SE3 A;  4A3I H;  1SYB A;  1STN A;  2LXK A;  3S1M B;  4GOP C;  3KBX A;  1L0Y B;  3HOZ G;  1PVO A;  2NN6 H;  3TZU A;  4DAP A;  5A2Q E;  4OO1 H;  2QGQ A;  4KHP L;  1VQO A;  1J5E Q;  1W6J A;  2Z6B A;  3A7L A;  1QG7 A;  1HZA A;  2Z6K A;  1VQ8 A;  3VYS A;  2R61 A;  4X6A H;  2CWA A;  3K58 A;  3A7A B;  4C3I G;  2PW5 A;  5C4H A;  2F4V L;  4PV1 C;  1BCP C;  5IYB G;  1ZEQ X;  2R7Z B;  3CCJ A;  1CSQ A;  3HKS A;  2F0J A;  2K5V A;  1NAP A;  4N9P A;  2OWO A;  4BXX H;  2EIF A;  4Y7N H;  2B63 B;  5D65 A;  4A3F G;  3S2H B;  2JN4 A;  2BA1 A;  2KCC A;  4K8J A;  1LYL A;  3A74 A;  1Z9F A;  2H5X A;  1N9W A;  1EIF A;  2QA4 A;  4GOP B;  2PYK A;  3AQQ A;  4IN3 A;  1X65 A;  1WTH A;  1BBX C;  1EY5 A;  1YVC A;  3C46 A;  4WOR A;  3UI2 A;  3PSI A;  1K3R A;  3OPO A;  4OXP A;  4OEL B;  1VDZ A;  4HCE A;  4OX9 L;  5ELD A;  1B4O A;  4JI1 L;  3CC2 A;  3A54 A;  2FXQ A;  4MN3 A;  3BZK A;  1JOO A;  3MXG A;  1X3Q A;  1SYF A;  1SAP A;  4DAY B;  4A3I B;  1BCP B;  4IAL A;  2VNU D;  5KRU A;  1RTN A;  5IWA Q;  4IOA A;  3MXU A;  2JA6 H;  3FPU B;  3K81 C;  1RKN A;  1EY7 A;  2E74 C;  3PGZ A;  2WP8 J;  1WFQ A;  1CM9 A;  3E9H A;  2NZ1 D;  3L7Z C;  4KK7 A;  2VW9 A;  1CHP D;  1JOQ A;  1HZC A;  1J6Q A;  1L0W A;  5T1G A;  4Y7N B;  4B9W A;  3RUZ A;  3R2I A;  2F0Q A;  4RGT A;  1A3U A;  2EXZ A;  2NTT A;  2XNA C;  3IRB A;  5CC4 A;  4I7A A;  1ZYR D;  4OIJ A;  2PPB C;  3HOW G;  1A15 A;  5D14 A;  3I4O A;  5GAG C;  1F9Q A;  2F0E A;  3RN5 A;  5LL6 X;  1X55 A;  1TVX A;  2K75 A;  1VQM A;  1N34 Q;  1AP0 A;  1ILQ A;  1X3P A;  2MPM A;  4CBV A;  1NNX A;  5KND A;  3RD4 A;  1R9T H;  1CSP A;  3TS2 A;  1IL2 A;  1Q1B A;  3ULP A;  3I73 A;  4OL7 A;  2CHB D;  1TWC H;  4DUZ Q;  4DV5 L;  2I0Q A;  4NXN Q;  1BBU A;  1T9H A;  3U50 C;  4G57 A;  3NBI A;  2JA6 B;  2K03 A;  1N8R C;  2ZJQ A;  3K5N A;  3GTL H;  5JVH 3;  1KLU D;  3EIV A;  3I56 A;  1KC8 C;  1GHK A;  5EQ0 A;  1B3Q A;  1CKN B;  1VF5 C;  4EQP A;  1E2W A;  2UU9 Q;  1FL0 A;  3SEB A;  3ERO A;  1YJW A;  2Z6K C;  2L9H A;  1LTG D;  4JYA L;  2LMC B;  4IUN A;  2IX0 A;  1S5C D;  2F0S A;  4B3M L;  3BDC A;  3NWT A;  1I6V C;  2RDF A;  2ATW A;  3RZD H;  4JI7 Q;  4OWW B;  5C3E G;  3M7G A;  1KIX A;  3KYH C;  1B1Z A;  4LFA Q;  3TP7 A;  4X3K A;  2GA4 B;  3NQT A;  4DV0 Q;  1KRS A;  1K0S A;  2OCE A;  1F2Z A;  1UNS A;  2JXM B;  1JE4 A;  3U4V A;  1R9T B;  5FLX E;  4LF9 L;  4JBJ A;  3FEW X;  1A62 A;  1PMR A;  3T53 B;  2UXB Q;  3OMC A;  3K7U C;  4UP9 A;  3DLL A;  1QVG A;  3H0G G;  1CK1 A;  1TWC B;  4GKJ Q;  3T16 A;  4LF4 Q;  4JI4 L;  4L63 B;  1WOC A;  4BA2 I;  2N88 A;  4OGQ C;  3TRZ A;  2EE1 A;  2I07 B;  5C3X A;  4XT3 B;  3GTL B;  1M8A A;  4IUU A;  4M1U B;  4QQB X;  4RMF A;  1I94 L;  3CMA A;  3SE0 A;  1RHP A;  4ME5 A;  2JA7 G;  1XWE A;  5HUR A;  2OXP A;  4LF5 L;  5EGT A;  3CCQ A;  4LAA A;  3HKZ G;  3RZD B;  2BA0 A;  2E75 C;  2Q8I B;  1L2F A;  3U58 A;  2PI2 A;  2EZV A;  3R2T A;  2K1B A;  3NTI A;  2ICI A;  5E3F A;  1J8I A;  2B2V A;  3L2P A;  1YZ6 A;  4CKE A;  3CF5 A;  1XPR A;  4RKB A;  1HTP A;  2V1C C;  2Y0S G;  2EYL A;  4DR1 L;  3DWQ A;  1I4X A;  3NXW A;  4IPD A;  3HOY H;  1D5Z C;  1UE6 A;  1K73 C;  1K8A C;  3CKI B;  2EY1 A;  1PZI D;  1ML0 D;  4B3R L;  1E1O A;  4DK1 A;  1XNR Q;  1Q8K A;  2R7D A;  1S5B D;  4A3B H;  2IJ0 A;  4WRD A;  1FR3 A;  4AQY Q;  3SK8 A;  1B9N A;  2K52 A;  3RLN A;  2BDN A;  1NTG A;  2K32 A;  1Q7Y C;  2SDF A;  5I2X A;  5M5Y H;  3LX0 A;  3A5Z B;  2N78 A;  3GTQ H;  1CQF A;  3CW2 C;  1A2U A;  3EBE A;  1ASZ A;  4PQX A;  3T1Y Q;  1R4Q B;  1S5D D;  2IL8 A;  2IW3 A;  1VQP A;  4DAM A;  3GTO H;  1ENC A;  3PUV A;  3H3V I;  1EEF D;  2LKV A;  1MHW C;  5LL6 S;  2Q8R E;  1JMC A;  4EQN A;  3MZ5 A;  2A69 C;  4JI2 Q;  2DJG C;  4XYQ A;  3HOU H;  2F0O A;  1G29 1;  3BU2 A;  3MTS A;  3FVQ A;  2A6H C;  4OWX B;  3ULL A;  1K8G A;  1ESR A;  3HP3 A;  3TZD A;  3X3M A;  4QB4 A;  3FPP A;  3HOY B;  1D8L A;  4ID6 A;  4JBK A;  4A3E H;  2L15 A;  4DV7 L;  2L55 A;  1SMY C;  4A3B B;  5KGU A;  3DEP A;  4H0L C;  1XYI A;  1QUQ A;  2UXC L;  2PO4 A;  5COY A;  1DOL A;  3T1H L;  5CV6 A;  4JI3 L;  1A8V A;  4KHP Q;  4MTN A;  5BR8 Q;  5M5Y B;  3NEN A;  3T13 A;  4APV A;  4JPB W;  3K59 A;  4A3D H;  1BCP D;  2F4V Q;  3BDO A;  2QDB A;  3M4O B;  4A4I A;  3C3L A;  3GTO B;  2AUK A;  3GTK H;  4A3L G;  1PYS B;  3C1E A;  4DPG A;  3I90 A;  1F77 A;  5C4X B;  3VYU A;  3HOU B;  1TY0 A;  3ERS X;  1M90 C;  1T5X D;  1IW7 D;  1J5E L;  1PTO H;  1B70 B;  2F3W A;  4DV6 Q;  2F52 A;  2CW0 C;  1NE3 A;  2Q2H A;  4DF7 A;  1EQR A;  1BO0 A;  2B2V C;  3GP7 A;  2PZU A;  3IL8 A;  4OX9 Q;  1X3E A;  1GVP A;  4A3E B;  2RDH A;  5CYU A;  1TS4 A;  3T4A C;  2BE5 D;  4RH6 A;  3PUY A;  2K50 A;  4H13 C;  3L3O C;  1STA A;  1PTO C;  3F2B A;  4NMZ A;  1I4R A;  4DR3 Q;  2IHE A;  4OHJ A;  2XWJ B;  2K5W A;  4LK1 C;  5E4W C;  4CJ1 B;  1DOK A;  1L1O A;  2JEB I;  1VMP A;  2AWO A;  3PO3 G;  1DOM A;  2XSC A;  1PFB A;  3KDF A;  4A3M G;  2ASB A;  1TXY A;  4A3D B;  5FLX L;  4MHE A;  2D2C C;  4K5W A;  5EPK A;  1MD2 D;  4DXF A;  1S5E D;  1PFS A;  1T5E A;  4A75 A;  3GTK B;  1UAP A;  3PO2 G;  2X6G A;  3CQZ H;  4LF8 L;  1S40 A;  4Z9C B;  2K14 A;  5IWA L;  3GTJ H;  4A3G G;  1EQT A;  3SK6 A;  2O5I C;  2MFI A;  1PTO B;  4BY7 G;  4FXD A;  4K2K A;  5FJ8 H;  4K6L A;  4JI5 Q;  1H9S A;  2R92 G;  1I4H A;  4ALP A;  4TRD A;  1ONL A;  4GN3 B;  3J81 i;  4DA2 A;  2OTJ A;  1MBY A;  1HA5 A;  1ET9 A;  3STB D;  4ZK9 B;  2F3I A;  3D0F A;  1E1T A;  1CZG A;  4ZLT F;  1OXT A;  3K5M A;  5M5X H;  2ZTE A;  4LMQ D;  5ISR A;  3W1G A;  4DV1 L;  3VR2 A;  2XTI A;  1XJV A;  1PLF A;  1GXD C;  4OWT B;  4PZ6 A;  3BVM A;  3E0J A;  1X32 A;  2F0L A;  2WAQ B;  1VQ4 A;  1LTS D;  3J81 c;  4A76 A;  3KFU A;  2M00 A;  3CCE A;  4ULL A;  3E5S A;  5NUC A;  1U4R A;  2R93 H;  2NVX H;  2HHH L;  2ZTD A;  3CQZ B;  4DUZ L;  4NXN L;  3SDZ A;  1B8A A;  1XPO A;  1AN8 A;  3OIQ A;  2XRQ D;  4ZKC B;  3GTJ B;  4H02 A;  3OIP A;  1Y1V H;  2IT1 A;  4ZQ3 A;  1NCV A;  1LM0 A;  2RCF A;  1UEB A;  1KLG D;  4PZ8 A;  5KNC A;  1C8C A;  1TY2 A;  1I6H H;  2CFM A;  1SLJ A;  1QUQ B;  1HPC A;  2UU9 L;  2JSO A;  3PUX A;  1OXV A;  1AW7 A;  4RKL A;  3MXN A;  1HA6 A;  1IBM Q;  2MP1 A;  4HJ8 A;  2IX1 A;  2PNR C;  5DAU A;  1PH3 A;  2SOB A;  3M4Y A;  5M3F G;  4F88 A;  2MUY A;  4JI4 Q;  2JP1 A;  4LFA L;  1SE4 A;  1WTX A;  4K14 A;  1TWG H;  4DV0 L;  5C0X H;  3MFY A;  5FLM H;  2DNE A;  1W6K A;  2WB1 E;  4L6T B;  1I5F A;  3CHB D;  3ITP A;  2ICE C;  2JA8 G;  2A68 D;  1P8L A;  1VQE A;  3SR1 A;  3NE5 B;  1PHJ A;  5BN5 A;  1KD1 C;  1AFP A;  1SBB B;  2B2W A;  1SE2 A;  4ZCK A;  2UXB L;  4LF5 Q;  3A8J E;  1KXL A;  1MGS A;  5D3D A;  1XTC D;  4LF4 L;  1Y1V B;  3G6J B;  4HIM A;  4JV5 Q;  4YCV A;  1SDF A;  1SYC A;  5IYC H;  1RF2 D;  4DR1 Q;  3HOV H;  2F0P A;  4HJ7 A;  1VQG A;  3CXC A;  1I6H B;  2EJM A;  5G3L D;  1WCM H;  2RKS A;  1YNX A;  1JWS D;  5FO9 B;  2QCP X;  2F3V A;  1KAB A;  2FJ2 A;  1UE5 A;  5GQO A;  4YWM A;  2IWH A;  4BA1 I;  2ZXP A;  1Q81 C;  1EZ8 A;  3HS0 C;  3LNN A;  5C3W A;  4DUY Q;  2EYF A;  3DHQ A;  3F2U A;  1TR5 A;  3O13 A;  3KDF B;  5E4X A;  4ODG A;  4N8F A;  2FMM A;  1QE6 A;  3DM3 A;  3DMU A;  1TS2 A;  2F0V A;  4X66 Q;  3CPW A;  2K28 A;  4C1N I;  5EKK A;  4KY6 A;  5IGE A;  1LTI D;  1TWG B;  1I50 H;  1L0X B;  5I6W A;  2I5M X;  1A63 A;  5J1Z A;  3T56 B;  1K0R A;  4UY8 C;  4JW0 A;  1XNR L;  1A6X A;  3S1R H;  3KF6 B;  3OSO A;  4X3S A;  4YY3 Q;  4AQY L;  3J80 i;  4JC0 A;  1KNE A;  1SE8 A;  2OQK A;  1H9S B;  1CUK A;  1PH5 A;  4LF7 L;  4C3I H;  2E5L L;  4IPG A;  1NBW A;  3B6Y A;  5IYB H;  5JEA J;  4KTA A;  4DV4 L;  1ROD A;  4UHV A;  4RCN A;  3HOV B;  3H15 A;  2ES2 A;  4TSS A;  2L0C A;  3T1Y L;  4IUT A;  4BY1 G;  2N8N A;  1WCM B;  1E0B A;  1P16 A;  1SMY D;  4EQO A;  4XYO A;  2QIL A;  4GS3 A;  5EBD A;  3SK4 A;  3IFT A;  1Q1E A;  4DV3 L;  5DM7 3;  1CHQ D;  3CRK C;  3T1H Q;  2QEX A;  2E2I H;  2KOL A;  2L12 A;  4DK0 A;  1KNA A;  4X65 L;  1W2B A;  3K57 A;  4NKL A;  2CH4 W;  5ELB A;  1JC7 A;  2EY6 A;  1I50 B;  1LAB A;  1U9R A;  1Y1W G;  4A3K G;  3URY A;  3HOZ B;  1TKW B;  1UWV A;  1EFI D;  3S1R B;  3DXJ C;  1QVF A;  4L8J A;  3QB3 A;  2FMC A;  2E76 C;  4DAV A;  5J39 A;  1RDP D;  3RMH A;  3OYY A;  2P5Z X;  4DV2 L;  3H94 A;  2B2W C;  4C3I B;  5GAE C;  2WV6 D;  3ERQ A;  5LMU L;  3GTM H;  4ZKB B;  2CW0 D;  5BR8 L;  3MXN B;  3KOJ A;  1G91 A;  4A3F B;  2VQE L;  2TSS A;  4FF1 A;  1V8Q A;  1HZ9 A;  4F7X A;  1JIC A;  2YU9 H;  2QF7 A;  2CH4 A;  4O1N A;  2F0F A;  2J7Z A;  3HOW H;  1IYJ B;  3AFQ A;  3CCU A;  1SYG A;  1N36 Q;  4IFD I;  3I3C A;  4C3J G;  1NSN S;  4JCV E;  3P20 A;  2NZO A;  4DNR B;  4L5Q A;  3CC7 A;  2VB2 X;  3FKI G;  3D6C A;  1S3O A;  4CDF C;  4F8M A;  2E2I B;  4MZ9 A;  4DV6 L;  1AZQ A;  4LNQ A;  2BDO A;  4IPC A;  1JB7 A;  1EZ6 A;  1LT4 D;  1HNX L;  1YHB A;  1JCK B;  4K5V A;  1FGB D;  2A6E C;  4LUV A;  2JQO A;  2RSO A;  4HMJ A;  2NVQ H;  1MJC A;  2XWB B;  4DGZ A;  1CKO A;  4JVZ A;  5JPN C;  1VQC A;  3HFZ B;  4B3T L;  3VR6 A;  1A3T A;  2R6G A;  2HIV A;  3HG9 A;  2EYM A;  4XQN A;  1O7Y A;  3PMF A;  5CV7 A;  4LF8 Q;  1ICW A;  2B63 G;  2AKW B;  4LF6 Q;  1UE7 A;  5C0X J;  4DR3 L;  1QIL A;  1ENA A;  4TKO B;  2B8G A;  4YIJ A;  1B2T A;  3GTM B;  4JBM A;  2B29 A;  4FVM A;  4IUV A;  1JOK A;  2RDG A;  3A55 A;  2CQA A;  1EOV A;  1EY8 A;  1V1Q A;  4HID A;  1O7L A;  2B3G A;  4RFB A;  5C3E H;  2YU9 B;  1G6Z A;  1X6O A;  4BWG B;  2HCI A;  1QB5 D;  3HOW B;  1WTW A;  1E24 A;  2NN6 I;  4OO1 I;  1K3B C;  3C1F A;  3GO5 A;  3S9W A;  1BKB A;  1X3F A;  4DV1 Q;  5G3L F;  2RVL A;  4A3J G;  4O0A A;  4QGU A;  4JI5 L;  3W3A A;  4OO1 G;  5IOD A;  1MIU A;  1SND A;  4R4I A;  2LXJ A;  4PMC A;  2PCF B;  4FXK C;  2EVB A;  2QEJ C;  4QMG A;  2NVQ B;  1YNJ D;  1BDO A;  3U9S A;  1SMX A;  1RL2 A;  3X3N A;  5H1S E;  2EOT A;  2HHH Q;  4P2C B;  1IKL A;  1IBK L;  1QCB D;  1K83 B;  4HMI A;  3WOF A;  2KEC A;  3RZO H;  2KUM A;  3JAM i;  5C5M A;  4GLV B;  2JA7 H;  3J7Z C;  1VQD A;  3NTH A;  1VQI A;  2L1B A;  1MJE A;  1VQB A;  5C3E B;  3QOL A;  3CME A;  4PG3 A;  1PV4 A;  4L5S A;  4CKC A;  1E22 A;  2K5H A;  2E2H H;  1YBY A;  5BN3 A;  5LMN W;  4DR6 Q; 
#chains in the Genus database with same CATH homology
 1H95 A;  3T1H L;  2MQH A;  1VS0 A;  3CD6 A;  2PQA B;  3PUW A;  2D0P A;  4JI3 L;  1A8V A;  4KHP Q;  2UUC Q;  1YEZ A;  3M7N A;  4IPH A;  4MTN A;  3I4N H;  4DKA C;  5BR8 Q;  3NEN A;  4GN4 B;  4APV A;  2JA6 G;  4NXM L;  4A3D H;  1TWF H;  4IJH A;  4IO9 A;  3E0E A;  3S24 A;  2F4V Q;  1IBL Q;  1VQ6 A;  4GNX B;  4DR2 L;  1CKM A;  3BJU A;  5FJ8 G;  2NZH A;  4A4I A;  2HQL A;  4LF9 Q;  5C44 H;  3GTK H;  4A3L G;  4K0K L;  5JJI A;  1EIY B;  1PYS B;  3S17 H;  4A3J H;  4JI7 L;  1AE2 A;  2MO1 A;  4DPG A;  2VQF Q;  2RHQ B;  2ALY B;  1IBM L;  4JOI A;  4B3S Q;  1NJI C;  3ERS X;  1M90 C;  3WWV A;  1J5E L;  1B70 B;  4HJ9 A;  4TQU S;  1UE1 A;  3M4Q A;  4DV6 Q;  1GM5 A;  1PH8 A;  4LFB L;  4XTC S;  2F52 A;  4C2M H;  1JJC B;  1NE3 A;  4P73 A;  3G71 A;  1PH1 A;  1M1K C;  3NBH B;  5IYD G;  2Q2H A;  4IFD G;  4GOP A;  1EQR A;  1JJG A;  2AMC B;  4OX9 Q;  1I94 Q;  1X3E A;  1GVP A;  1L1O C;  3L0O A;  2VS1 A;  3NEM A;  1NY4 A;  2OTL A;  1SFO H;  4DR6 Q;  1YIJ A;  2R7Z G;  3PUY A;  4GKJ L;  4XIG S;  3GD7 A;  2K50 A;  2ID0 A;  2UUB L;  5IP7 H;  3F2B A;  5E7N A;  2ZM6 Q;  1K83 H;  4GLX A;  4DR3 Q;  2IHE A;  4MNO A;  4JV5 L;  3ZJY C;  2OQ0 A;  3EN2 A;  1L1O A;  3K80 C;  2JEB I;  2AWO A;  4DR4 L;  3PO3 G;  3CAM A;  1U0L A;  5M3M H;  4A3K H;  1XMO Q;  3KDF A;  5GRO A;  4A3M G;  1TXY A;  1Y1V G;  3A5U A;  2Q2U A;  2ASB A;  4A3C G;  1S72 A;  3UDI A;  4B3R Q;  3I4M G;  3M85 A;  3F8T A;  1PFS A;  2RCN A;  4A75 A;  1TWH H;  3UDX A;  4R4C A;  1L1O B;  4DUY L;  3TS0 A;  3GTP H;  3CQZ H;  3PO2 G;  1O7I A;  4IJL A;  5GAD C;  2CCZ A;  4LF8 L;  1S40 A;  1MKH A;  5IWA L;  2K14 A;  4RG1 A;  3SGI A;  4JI8 L;  4LUZ A;  2NVY H;  3GTJ H;  1VQ9 A;  4A3G G;  4GKK L;  2CWP A;  4A3I G;  4LF7 Q;  4DR5 L;  2E5L Q;  1VQ7 A;  2MFI A;  1V9P A;  2E2J H;  1YHA A;  4BY7 G;  4X66 L;  5FJ8 H;  4DV4 Q;  4JI5 Q;  1JE5 A;  1EWI A;  2NN6 G;  1SRO A;  2R92 G;  4AYB E;  3RLF A;  4ALP A;  3D31 A;  2EXD A;  4GN3 B;  1NMF A;  3FP9 A;  3K7A H;  4X62 Q;  4LUO A;  3H0G H;  3J81 i;  1C0A A;  5EAY A;  2OTJ A;  4HIK A;  4LWC A;  3M4O H;  4C3J H;  1HNW Q;  1YI2 A;  3TEH B;  2RHS B;  3S1M H;  3STB D;  4P74 A;  4NPS A;  5FLM G;  4YY3 L;  3M4P A;  5C0X G;  4JI6 L;  3VDY A;  2F3I A;  3D0F A;  1E1T A;  1VCI A;  2UUA Q;  2AWN A;  4DV3 Q;  1OXT A;  3U4Z A;  5C4X H;  2VY3 A;  5M5X H;  4BXX G;  2ZTE A;  3W1G A;  4DV1 L;  5IYD H;  2EQS A;  3PF4 A;  4YWL A;  5IE8 A;  4DR7 L;  2XTI A;  1G6P A;  2D0O A;  4QL5 A;  4GLA C;  2A19 A;  1XJV A;  2A1A A;  2PNH A;  4DNI A;  3JC6 6;  2Q2T A;  3E9I A;  4OWT B;  4PZ6 A;  4X65 Q;  4X64 Q;  1QVC A;  4LFC Q;  2VL6 A;  2R7Z H;  2I5L X;  3AFP A;  1GKH A;  1VQ4 A;  2A8V A;  1RIP A;  5IT9 c;  3J81 c;  4A76 A;  1PH7 A;  1WI5 A;  5IYC G;  4DV7 Q;  3KFU A;  3CCE A;  2B63 H;  1PA6 A;  3HOV G;  1WYD A;  3S2H H;  3STB C;  2R93 H;  1CKN A;  2NVX H;  2HHH L;  2ZTD A;  3RNU A;  4JI2 L;  4JI0 Q;  1WCM G;  1W3S A;  4NXN L;  3RR5 A;  2K5N A;  1B8A A;  4DUZ L;  4EX5 A;  3KLW A;  1XPO A;  2JA5 G;  1OTC A;  3PO3 H;  5HY6 A;  4H02 A;  2HT1 A;  1Y1V H;  2IT1 A;  1EQQ A;  4DV2 Q;  2N3S A;  4QIW E;  4NB3 A;  4JI3 Q;  3ICE A;  1YHQ A;  4A3C H;  2N49 A;  1LM0 A;  3RN2 A;  4DK3 C;  1UEB A;  5LMU Q;  1VQL A;  1JT8 A;  3I4M H;  4JOI C;  1N32 L;  3J81 j;  3OTO L;  1KQS A;  4PZ8 A;  3PV0 A;  3JAM c;  4POG A;  1I6H H;  4WJ3 M;  4KI0 A;  2VQE Q;  2GVA A;  2CFM A;  1SLJ A;  3PO2 H;  1QUQ B;  2HIX A;  2YTV A;  2KBN A;  1Q46 A;  4P72 A;  3UDF A;  1U5K A;  2UU9 L;  3PUX A;  1Q12 A;  4A3G H;  1OXV A;  2MO0 A;  4A3I H;  1OXU A;  2JE6 I;  3GTG H;  4IFD J;  2LXK A;  4DK6 C;  1VQ5 A;  2PMZ E;  2XGT A;  4GOP C;  1N33 L;  1TWA H;  1IBM Q;  3AEV A;  2IX1 A;  4HJ8 A;  4BY7 H;  1KRT A;  1PH3 A;  3HOZ G;  1PVO A;  1XNQ Q;  4A3B G;  5M3F G;  2R92 H;  4EQ5 A;  4JI4 Q;  2QGQ A;  4KHP L;  2E8G A;  2JJQ A;  5C4J H;  1VQO A;  1PH9 A;  1J5E Q;  4JI0 L;  4LFA L;  1HZA A;  2Z6K A;  1VQ8 A;  4LFB Q;  4UPA A;  1HR0 Q;  4X6A H;  1VQA A;  2CWA A;  1TWG H;  4DV0 L;  1AH9 A;  1HNX Q;  3MEF A;  5FLM H;  4YHH Q;  1IBL L;  2F4V L;  5GAH C;  2WB1 E;  2JA8 G;  1I5F A;  1I3Q H;  5IYB G;  3I2Z A;  1SN8 A;  3HKZ E;  3CCJ A;  4HIO A;  3LGJ A;  1P8L A;  1CSQ A;  1VQE A;  3HKS A;  2K5V A;  2KCT A;  3RLO A;  5HGQ A;  1PHJ A;  1HH2 P;  2EIF A;  4Y7N H;  1KD1 C;  2OWO A;  4B3T Q;  2YV5 A;  4A3F G;  4BXX H;  2UXB L;  1HZB A;  2BA1 A;  2Y0S E;  1LYL A;  1N36 L;  4LF5 Q;  3A74 A;  2D62 A;  1Z9F A;  2H5X A;  4ME3 A;  4BBR G;  1N9W A;  4R4T A;  2UUB Q;  3FHW A;  3H3V H;  1EIF A;  2QA4 A;  4LF4 L;  4GOP B;  3AQQ A;  4HIM A;  3TQY A;  1XMQ L;  1X65 A;  2GVB A;  1Y14 B;  4JV5 Q;  1C7Y A;  4YCV A;  1YVC A;  5IYC H;  3HOU G;  4DR1 Q;  4DR4 Q;  1FVI A;  3HOV H;  3PSI A;  1VQN A;  1K3R A;  4OXP A;  4HJ7 A;  1VQG A;  3PIP A;  3CXC A;  1DGS A;  1PH6 A;  1NMG A;  2ZJP A;  4OX9 L;  3ULJ A;  3NEL A;  1WCM H;  5LMN Q;  4JI1 L;  2PI2 E;  2WFW A;  3CC2 A;  2JA5 H;  1YNX A;  2FXQ A;  3BZK A;  4P71 A;  4YWM A;  5GQO A;  1UE5 A;  3PUZ A;  4BA1 I;  4DAY B;  2VNU D;  1Q81 C;  4DUY Q;  2UXD Q;  2K4K A;  5IWA Q;  4IOA A;  3KDF B;  4GKK Q;  4WJ4 A;  5ELO A;  2ZM6 L;  4JG2 A;  2JA6 H;  4LF6 L;  3K81 C;  2LSS A;  5M5W H;  4OON A;  3CC4 A;  3KF6 A;  3DM3 A;  1AE3 A;  3PGZ A;  2WP8 J;  4X66 Q;  3CPW A;  1WFQ A;  1XMO L;  2Z0S A;  4JBW A;  2BH8 A;  3E9H A;  1I50 H;  3L7Z C;  4A3L H;  4AH6 A;  2I5M X;  2VW9 A;  1A63 A;  1HZC A;  3HOX G;  1J6Q A;  1L0W A;  1K0R A;  4UY8 C;  1XNR L;  3S1R H;  3KF6 B;  5M3F H;  1QZG A;  2ZJR A;  4YY3 Q;  4JI6 Q;  4AQY L;  1FJG Q;  3K8A A;  3J80 i;  4JC0 A;  3IRB A;  1PH5 A;  1SE8 A;  2OQK A;  1CUK A;  2R7F A;  4LF7 L;  4C3I H;  1IBK Q;  2E5L L;  1G51 A;  3HOW G;  3I4O A;  5GAG C;  4IPG A;  2JA8 H;  1NBW A;  1LUZ A;  3B6Y A;  4R1J A;  4AIM A;  5IYB H;  4HJ5 A;  3RN5 A;  1X55 A;  5JEA J;  1X56 A;  4DV4 L;  1K9M C;  1C9O A;  3H15 A;  2K75 A;  1VQM A;  1N34 Q;  2ES2 A;  3ER0 A;  2WAQ E;  4X62 L;  4LW1 A;  4R4O A;  3T1Y L;  4PZ7 A;  3UDG A;  4BY1 G;  2N8N A;  1P16 A;  4BBR H;  1CSP A;  5AJ3 Q;  1R9T H;  1Q86 C;  3CCL A;  3TS2 A;  1IL2 A;  1Q1B A;  1EFW A;  4GS3 A;  3ULP A;  3BZC A;  3W1B A;  1Q1E A;  1TWC H;  4DUZ Q;  3PCO B;  4DV3 L;  4DV5 L;  1BBU A;  2I0Q A;  1T9H A;  4NXN Q;  3U50 C;  1HNZ L;  2MNA A;  4A3M H;  4C3H H;  3T1H Q;  2JA9 A;  3S1N H;  3W5O A;  2QEX A;  1IXR A;  1N8R C;  2E2I H;  2ZJQ A;  4X65 L;  1W2B A;  3GTL H;  3CCM A;  1N32 Q;  3EIV A;  3I56 A;  1KC8 C;  4LFC L;  2ZTC A;  4NXM Q;  1CKN B;  1WJJ A;  2GN5 A;  3I55 A;  1EUJ A;  1PYB A;  2PQA A;  5IY0 A;  5ELN A;  1OXS C;  4L5T A;  2UU9 Q;  4DR2 Q;  1FL0 A;  1Y1W G;  4A3K G;  1YJW A;  2Z6K C;  1LTL A;  1UWV A;  3HOY G;  4JYA L;  1QVF A;  2IX0 A;  4B3M L;  4KHZ A;  4UP8 A;  4K0K Q;  1SRU A;  2ATW A;  3RZD H;  4IOC A;  4JI7 Q;  4OWW B;  5C3E G;  1KIX A;  4GNX A;  1HR0 L;  4DR6 L;  3CCV A;  3OYY A;  4DV2 L;  3KYH C;  1KAW A;  5FLX c;  3G4S A;  5GAE C;  2KHI A;  4LFA Q;  2UUC L;  5LMU L;  3GTM H;  5BR8 L;  3HOX H;  3MXN B;  3KOJ A;  3KJO A;  3GDE A;  4DV0 Q;  4GN5 A;  1X9N A;  2VQE L;  1KRS A;  2DUD A;  2Q2I A;  2KCM A;  2OCE A;  1HZ9 A;  5IP9 G;  2IY5 B;  3AYH B;  3Q8D A;  2BH2 A;  2YU9 H;  3F1Z A;  3M9B A;  3U4V A;  2VUM G;  4POF A;  4LF9 L;  3HOW H;  4O2D A;  4JBJ A;  1IYJ B;  3AFQ A;  1A62 A;  2UXB Q;  3K7U C;  4UP9 A;  3DLL A;  3CCU A;  3H0G G;  1QVG A;  1N36 Q;  2VQF L;  4IFD I;  3CCR A;  4FDB A;  5DLQ E;  4GKJ Q;  1XNQ L;  4B3S L;  1VQJ A;  1X3G A;  4JCV E;  1YJ9 A;  4LF4 Q;  4JI4 L;  2NZO A;  1WOC A;  1XMQ Q;  4BA2 I;  4L5Q A;  4TVA B;  1VQK A;  3TRZ A;  3CC7 A;  3FKI G;  4UP7 A;  1S3O A;  4YCW A;  4BY1 H;  1D7Q A;  4MZ9 A;  3G6E A;  4DV6 L;  2YTY A;  4LNQ A;  5C4X G;  4IPC A;  1JB7 A;  1SR3 A;  1YHB A;  3A0J A;  3K0X A;  3PF5 A;  1HNX L;  4YHH L;  1X54 A;  4LUV A;  4QY7 A;  4QJF A;  1ASY A;  2JQO A;  4QQB X;  1JJ2 A;  2NVQ H;  1MJC A;  4RMF A;  4JI1 Q;  1CKO A;  4HJA A;  1I94 L;  3CMA A;  2DGY A;  1VQC A;  3HFZ B;  2IHF A;  4B3T L;  3UE1 A;  2JA7 G;  1QZH A;  1OXX K;  2R6G A;  2HIV A;  2YYZ A;  4R4Q A;  5K36 G;  2WB1 G;  4LF5 L;  3CCQ A;  3HKZ G;  4A3E G;  4LF8 Q;  2BA0 A;  2B63 G;  3U58 A;  4A93 G;  1L2F A;  4JI8 Q;  2AKW B;  2PI2 A;  4LF6 Q;  1UE7 A;  2I5H A;  5C0X J;  2R93 G;  3L2P A;  1YZ6 A;  3CF5 A;  4DR3 L;  4DR5 Q;  1XPR A;  3S1Q H;  4BBS G;  2V1C C;  2Y0S G;  1BVS A;  4DR1 L;  1V43 A;  1Y1W H;  2B29 A;  1HR0 W;  4JBM A;  3M3Y H;  3S16 H;  4L5R C;  4IPD A;  5JJL A;  3KJP A;  3HOY H;  1EOV A;  4YCU A;  1UE6 A;  1K73 C;  1K8A C;  2C35 B;  1V1Q A;  2YTX A;  5LMN L;  4HID A;  3I4N G;  2CKZ B;  4B3R L;  2B3G A;  5C3E H;  1E1O A;  1X6O A;  1XNR Q;  3HOZ H;  1Q8K A;  2R7D A;  3F2C A;  1IZ6 A;  2KHJ A;  4A3B H;  2JEA I;  4A3D G;  1B7Y B;  1E24 A;  2NN6 I;  4OO1 I;  4KLK A;  3OW2 A;  4AQY Q;  2UXD L;  2K52 A;  1XPU A;  3S14 H;  3RLN A;  3GO5 A;  1BKB A;  1X3F A;  5C44 G;  1NTG A;  2CQO A;  4DV1 Q;  5JJK A;  5IP9 H;  1Q7Y C;  4A3J G;  4O0A A;  4QGU A;  5C0X I;  4DR7 Q;  3S15 H;  5M5Y H;  1EYG A;  3A5Z B;  2VUM H;  4P75 A;  3J7A 5;  2N78 A;  4JI5 L;  3TRE A;  4OO1 G;  1MIU A;  1KHI A;  3GTQ H;  2RF4 A;  2VZA A;  4R4I A;  4A3F H;  2LXJ A;  3CW2 C;  3EBE A;  1ASZ A;  3T1Y Q;  5J3B A;  1VQP A;  1KXL A;  4DAM A;  1BBW A;  2AHO B;  1VQH A;  1SMX A;  3GTO H;  1HNW L;  1RL2 A;  3PUV A;  3H3V I;  1FJG L;  3FKI H;  5H1S E;  4AYB G;  3PIO A;  1KL9 A;  4DV5 Q;  1YJN A;  1JMC A;  4JI2 Q;  2HHH Q;  1Q82 C;  2UUA L;  4Y52 H;  3HOU H;  2UXC Q;  1XTD A;  1G29 1;  3J80 c;  1IBK L;  1HNZ Q;  4YWK A;  3BU2 A;  1GD7 A;  3CP0 A;  1A0I A;  2NVT H;  4OWX B;  3ULL A;  1K8G A;  1PH2 A;  3RZO H;  3JAM i;  1E7Z A;  1FGU A;  1VQF A;  4GLV B;  5IP7 G;  4GNX C;  2JA7 H;  1N34 L;  3J7Z C;  1VQD A;  3OTO Q;  1D8L A;  3S2D H;  4X64 L;  1E3P A;  1VQI A;  2KEN A;  4JBK A;  1Z47 A;  4A3E H;  5AJ3 L;  2L15 A;  1MJE A;  1VQB A;  4A93 H;  4DV7 L;  1GO3 E;  2JK8 A;  3UE0 A;  5M3M G;  3CME A;  1YIT A;  1PH4 A;  4PMW A;  4PG3 A;  3I7F A;  4J15 A;  4JYA Q;  3F2D A;  1PV4 A;  4B3M Q;  4L5S A;  1HJP A;  4BBS H;  2E2H H;  1E22 A;  2K5H A;  2WAQ G;  1YBY A;  3G48 A;  3KF8 B;  5LMN W;  3CPF A;  1N33 Q;  3CCS A;  1QUQ A;  2UXC L;  5JEA G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...