2OQ0A

Crystal structure of the first hin-200 domain of interferon-inducible protein 16
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
189
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-interferon-inducible protein Ifi-16
publication title Crystal Structure of the First HIN-200 Domain of Interferon-Inducible Protein 16
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 189
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A01
3CC4A 4HJ9A 5GADC 4LWCA 4X66Q 4LFAQ 4A4IA 2V1CC 5LMNW 5IP7G 4A3CG 1SN8A 1VQFA 1BBWA 2CFMA 5IWAQ 4UP8A 2MFIA 3K0XA 4GLAC 2I5HA 2JEBI 1QZHA 1QUQB 1OXXK 2DUDA 4UPAA 4BBSG 1I50H 3KJOA 4JI6L 1HNZL 3ERSX 3HOUG 2XGTA 2R6GA 5C4XG 1YHBA 1Z9FA 3I4OA 2AWOA 5EAYA 1QVCA 2CQOA 5LMNQ 4A3MH 1PH4A 2NN6G 4PG3A 4DUZQ 4L5QA 5AJ3L 3PCOB 1SFOH 3HOVG 1L0WA 4B3TL 4DUYL 3CW2C 2JA9A 4DK6C 4DV5L 4Y7NH 3HOXG 1B70B 4B3RL 1J6QA 1HJPA 4DV6Q 1N34Q 4X62Q 1NY4A 2KBNA 2ZTEA 5IYCG 2YTXA 4DK3C 3PV0A 5ELOA 3J80c 4NB3A 4X65L 2D0OA 2UU9Q 4IPDA 3J80i 2VW9A 1J5EL 3EIVA 3E9IA 2OCEA 3U58A 4HJ7A 2IY5B 1L1OA 4TVAB 1JT8A 2KENA 4OXPA 1WCMH 1NBWA 1YZ6A 4GN3B 4AQYQ 3ULPA 1A63A 4UP7A 3PUVA 4BBRH 4LF6L 3NEMA 3F8TA 3W1BA 2N8NA 4A76A 4LFBQ 1O7IA 1X9NA 1YEZA 3TREA 3TS2A 3BZCA 1QZGA 4GLXA 1KQSA 3I4MG 1VQLA 2ES2A 4LUOA 2Q2IA 1KHIA 2N49A 4LFAL 2D62A 4A3JG 1JJGA 5IWAL 3K7AH 3RNUA 3VDYA 1Q82C 1EYGA 2KCMA 3K80C 1TWHH 1XPRA 3GDEA 4MNOA 3GO5A 5LMNL 4A3GG 2LXJA 3KJPA 3PGZA 4KLKA 4YWKA 1Y14B 3M4OH 4DUZL 1C0AA 2JK8A 4L5TA 2JJQA 3CCSA 2ID0A 4P75A 3CCUA 5J3BA 1X56A 1Q8KA 1C7YA 3L0OA 4JBKA 1I6HH 3SGIA 4FDBA 3L7ZC 1OXTA 1P8LA 2IT1A 1WI5A 2VUMH 4DV6L 1E24A 1HH2P 4LF9Q 3CMEA 1R9TH 2R93G 2Z0SA 4OO1G 4J15A 1V43A 4C2MH 5IT9c 2UU9L 1WFQA 4DR4Q 1S40A 1GO3E 1Q1BA 4JBWA 4LNQA 2JA7H 4X6AH 1G51A 5GAGC 4AQYL 3HOVH 1L2FA 4APVA 3HKSA 1YJ9A 1IBKQ 4R4CA 1E7ZA 3I7FA 5IY0A 4LFBL 5M3MG 3HOXH 4LF4Q 3KOJA 3ICEA 4NXNQ 4A3BG 1YHAA 1HNXQ 5IP9G 4A3BH 1X3GA 4A3DH 3AEVA 5IYCH 1RIPA 3HKZG 2PMZE 2BA0A 1YHQA 4LF7Q 1OTCA 1EIYB 1TWGH 2FXQA 4A3EG 4P72A 1IXRA 3IRBA 4KHZA 2NZHA 1B7YB 2GVBA 3UDGA 1PA6A 2UUCQ 3PO3G 1CUKA 1CKOA 2B3GA 3CCLA 4JYAQ 4R1JA 2Q2HA 1P16A 3GTQH 4XIGS 5C44G 2AWNA 1EQRA 1UEBA 1VQ4A 5JJIA 1HR0W 1VQNA 3H3VI 3S1QH 4JOIA 4DUYQ 5M5YH 4HJ8A 4B3SQ 2KCTA 4EQ5A 1LM0A 3W1GA 4LF9L 4B3RQ 4P71A 2HQLA 1X3FA 2I5MX 1FGUA 1VS0A 1HR0Q 2OQKA 3CF5A 1UWVA 1E1OA 1VQEA 4DR7Q 4JV5Q 1SROA 3I4NG 4DR4L 4A3IH 4XTCS 5JJKA 1X3EA 2R7DA 1U0LA 1VQCA 1VQJA 3S14H 1VCIA 4IFDI 3D0FA 3U4VA 2YTVA 2IHFA 3Q8DA 3CCVA 1IBKL 2K5VA 4YCVA 1IBLQ 2VZAA 1BVSA 4LF4L 4GN4B 3DLLA 3B6YA 4NXNL 3S1NH 1JE5A 4GOPC 3RZDH 2CWAA 2JE6I 1QVGA 1Y1VH 5IYBH 1VQAA 4DAMA 4LF7L 2R93H 3E0EA 3GTPH 2K14A 4JG2A 4C3IH 3F2BA 2Y0SG 3ZJYC 1Q86C 3KFUA 3A0JA 3D31A 1PH2A 2PNHA 4JCVE 2WAQG 4RG1A 3A5ZB 2UUCL 4A3LH 4JI4Q 4DV4Q 1X6OA 3G48A 3KF6A 4L5SA 4A93G 3G71A 1YJNA 4JYAL 3H0GH 2MNAA 1DGSA 1T9HA 3T1HQ 2DGYA 1WOCA 3I56A 4AYBE 5M3MH 3PO2H 1SE8A 2R92G 5C3EG 1KIXA 5GQOA 3UDXA 3J7A5 3F1ZA 4B3SL 2WFWA 1YBYA 4A3FG 4RMFA 1I3QH 3GTMH 2R7ZH 2UXBQ 3CP0A 1HR0L 2UXDQ 3FKIH 4JV5L 4DR7L 4OWWB 3HOYG 1S3OA 1A8VA 5M5XH 2F3IA 5FLXc 1KXLA 4C3JH 1E22A 1N32Q 2YV5A 3GTKH 1SMXA 3BU2A 4P73A 4GOPA 2A1AA 1GM5A 2A19A 1L1OB 1I5FA 1IBLL 1G6PA 1Q46A 2B63H 3PSIA 4JI1Q 2N3SA 5IYDG 2NVXH 4JI7Q 2EXDA 1SR3A 3BJUA 3CCMA 4LUVA 4ME3A 2NZOA 5HGQA 4OO1I 1MIUA 1YNXA 2WB1E 1VQMA 2VQEQ 3MEFA 4R4TA 3S2DH 4YY3L 4DR1Q 1CKNA 4QY7A 1Q12A 3KYHC 4DV4L 1N9WA 4JI4L 3PF5A 2UXCQ 1VQ8A 4JC0A 3HOWH 1NMGA 3T1HL 4DNIA 1Y1WH 2PQAB 3LGJA 4A3KH 5M3FG 3ER0A 2ALYB 1XJVA 1PVOA 1HZAA 4UY8C 2VS1A 1EFWA 3CC2A 3KF8B 4JI8Q 1PH1A 2JA6G 1D8LA 2N78A 4DV1Q 4AH6A 3J7ZC 2Z6KC 2MO0A 2RHSB 5DLQE 1EOVA 1PYSB 4AIMA 3M4PA 5E7NA 2ZM6Q 2UXBL 4A3CH 2UXDL 5IP7H 4DR5Q 1MJEA 4BY7G 2JA5G 3HOZG 1XMOQ 2UUBQ 5C0XJ 4BBSH 1W3SA 1A62A 3UE0A 5FJ8G 4K0KL 4HIOA 2JA8G 1H95A 5C4XH 3PIPA 3HOUH 1AH9A 2VY3A 1N32L 4JI5L 3G4SA 1N8RC 3GTGH 4IFDJ 1K8GA 4P74A 3CAMA 1JB7A 2C35B 4HIDA 4GNXC 4JI1L 3PIOA 2CCZA 4JI7L 1ASYA 4YCUA 3PUWA 1KRTA 1KAWA 2K75A 4BXXG 3RLNA 4MTNA 4GKJQ 2GVAA 1TWAH 2VQEL 3GTLH 1XPUA 3HOYH 2K52A 3S17H 4DR1L 4PZ7A 1UE7A 3DM3A 1YITA 4KI0A 1PH8A 3S2HH 1AE2A 1SLJA 1SRUA 1N36Q 2LSSA 3STBC 3CCEA 2KHIA 3J81j 1OXUA 1XTDA 3BZKA 2ZTDA 3GTOH 1D7QA 2UUAQ 1VQHA 5FLMG 2KHJA 2NVTH 4DKAC 2Z6KA 1FL0A 3S15H 2D0PA 4JI2L 4JI8L 5IYDH 4DV1L 1HZCA 4O2DA 3M9BA 5JEAG 2E5LQ 2QGQA 4MZ9A 3I4MH 1VQ5A 2ZM6L 2K50A 4A3JH 4DR5L 1JMCA 3M3YH 1XMOL 2UUBL 1IYJB 3AFPA 4DR3L 3TEHB 3NELA 5ELNA 1XNQQ 3PUZA 4H02A 2F4VQ 4A3GH 3RR5A 2ATWA 5LMUQ 4GNXA 1VQOA 3UDFA 2NN6I 5M3FH 3RN2A 1WYDA 1VQBA 4DV7Q 1NJIC 2OWOA 3CMAA 4L5RC 1UE5A 2E8GA 3KDFA 4X64Q 4DV2Q 2IX0A 4IOAA 4HIMA 3RLOA 3PUXA 3HKZE 3RLFA 1WCMG 3OYYA 4OWTB 4GKJL 4AYBG 3HOZH 2MO1A 3U4ZA 1VQ9A 2JA8H 1VQDA 1N36L 4YY3Q 4HIKA 3CD6A 2PI2E 3EBEA 1OXSC 3RN5A 4YWMA 1MJCA 4IJLA 1JJ2A 5BR8Q 2Q2TA 1TXYA 1VQ6A 1VQGA 1MKHA 3CPFA 4JI3Q 2UUAL 3KF6B 3NENA 4R4OA 2VQFQ 3TS0A 4QGUA 1I94Q 5JEAJ 3CPWA 1M1KC 4DAYB 1XNRQ 4OX9Q 2HT1A 3WWVA 2YU9H 3JC66 2NVQH 2E5LL 1L1OC 5IP9H 4OONA 4QIWE 5H1SE 2QA4A 4KHPQ 4ALPA 1LUZA 3A5UA 3H15A 1HNWQ 1UE1A 4R4IA 2EQSA 3M85A 2VUMG 2MQHA 1XNQL 4PZ6A 1EWIA 4A3EH 3F2DA 2RHQB 1QUQA 3OTOQ 2F4VL 3PO3H 4DV3Q 3AYHB 1YVCA 5C0XG 5LMUL 4K0KQ 2WB1G 4NXML 1LTLA 4GKKQ 3HFZB 5FLMH 4DV7L 4JI5Q 1GD7A 2RCNA 4X64L 4DV2L 4DR6L 5C44H 3CCQA 2JA7G 4IFDG 2I0QA 3CC7A 2ZTCA 3CQZH 4GOPB 3E9HA 4DV0Q 1PV4A 4HJAA 2Y0SE 5GROA 1XPOA 1VQPA 1YJWA 4PZ8A 2WAQE 2ASBA 1K3RA 1FJGQ 4A3DG 3A74A 1CSPA 3OW2A 1IZ6A 1PH9A 4LW1A 4QL5A 3I4NH 3AQQA 4JBMA 5BR8L 3CXCA 1PYBA 4POFA 4OWXB 3FHWA 1CKNB 3I2ZA 3ULLA 1S72A 1PH6A 4JI3L 2PI2A 2VL6A 1EIFA 1QVFA 2CKZB 4TQUS 4NPSA 5C4JH 4YHHL 2VQFL 1I94L 1XNRL 1LYLA 1G291 1XMQQ 1X65A 3T1YQ 4OX9L 2UXCL 2LXKA 2QEXA 2AHOB 2RF4A 4KHPL 4JI2Q 1N33Q 1GKHA 2ZJPA 4QJFA 1HNWL 4LF5Q 3S16H 3NBHB 1EQQA 1TWFH 4X66L 4GS3A 3OTOL 5M5WH 3UE1A 1Q81C 1U5KA 1E3PA 4DV3L 4DR3Q 1PH3A 1VQKA 2K5NA 4YWLA 4A93H 3GD7A 4WJ4A 4B3MQ 4GKKL 1V9PA 4BY1G 1CKMA 3CCJA 2PQAA 2R7FA 2BH8A 4A3IG 4POGA 2OTJA 2EIFA 5GAHC 3TQYA 4EX5A 4IPCA 1VQ7A 3S1MH 4BA2I 2R92H 5C3EH 4DV0L 1BBUA 1OXVA 3AFQA 4A75A 1B8AA 2AMCB 1X54A 4A3FH 5K36G 3H3VH 1HZBA 3PF4A 2E2IH 1N34L 1K0RA 3I55A 1FJGL 4X62L 5JJLA 1RL2A 1Y1VG 5IYBG 2YTYA 3ULJA 4LF8Q 3W5OA 3KLWA 3FP9A 4IJHA 4JOIC 1A0IA 2OQ0A 3EN2A 1IBMQ 4GLVB 3JAMc 1IL2A 3MXNB 4LUZA 4O0AA 1EUJA 3JAMi 4A3LG 4DPGA 5HY6A 4JI0Q 4LFCQ 1XMQL 3T1YL 3UDIA 3H0GG 4A3MG 1Q7YC 3S1RH 1N33L 1Z47A 2I5LX 1KD1C 1K8AC 3PO2G 1KL9A 4DR2Q 2HHHQ 2AKWB 1WJJA 4LF5L 2JQOA 3TRZA 4HJ5A 2YYZA 3STBD 2GN5A 4IPGA 2NVYH 2OTLA 1PH5A 1NTGA 1NE3A 5GAEC 2R7ZG 3K81C 2ZJRA 3FKIG 3PUYA 4JBJA 4B3ML 4R4QA 1NMFA 1YIJA 1PHJA 1FVIA 3K7UC 2JEAI 3RZOH 4UP9A 3L2PA 4JI6Q 4IPHA 4NXMQ 4GNXB 1HNZQ 4IOCA 4BA1I 2JA6H 1C9OA 2IX1A 4DR6Q 1HZ9A 1YI2A 2Q2UA 1PH7A 1VQIA 3K8AA 2F52A 3KDFB 2WP8J 5AJ3Q 2K4KA 3GTJH 4BBRG 2B63G 1K83H 2ZJQA 4B3TQ 3S24A 2A8VA 2HIXA 1W2BA 1PFSA 1ASZA 4BY7H 2JA5H 4DV5Q 4Y52H 1UE6A 1M90C 4LF8L 4YCWA 5FJ8H 1X55A 5C0XI 2VNUD 1IBML 1JJCB 4IO9A 4PMWA 3M7NA 2HIVA 4BY1H 1AE3A 3F2CA 3J81c 1TWCH 2BA1A 3U50C 4C3HH 1KC8C 4X65Q 1K9MC 1BKBA 4JI0L 4LFCL 3J81i 1J5EQ 3HOWG 2L15A 4QQBX 4YHHQ 2CWPA 1GVPA 3CCRA 1V1QA 3G6EA 1Y1WG 2K5HA 4A3KG 2E2HH 2H5XA 3M4QA 4BXXH 2HHHL 4DR2L 4LF6Q 1K73C 2IHEA 1HNXL 1E1TA 4GN5A 1Q1EA 2B29A 4WJ3M 2XTIA 1KRSA 2E2JH 5IE8A 1CSQA 2BH2A
chains in the Genus database with same CATH superfamily
5KYLA 3GTPB 3KBXA 1ENFA 1SN8A 2CFMA 1BBWA 4B08A 5IWAQ 1STAA 2MFIA 3K0XA 1QZHA 2I5HA 1F9SA 2K5QA 1OXXK 3IL8A 1HNZL 3ERSX 2R6GA 5LMNQ 3SHLA 5EAYA 2K1BA 1F9RA 5JVH3 4H0LC 4L5QA 2IX3A 2EJMA 3HOVG 1KLGD 3PO2B 1C8CA 3A55A 4DUYL 2JA9A 2M00A 2Z4IA 4DV6Q 1NY4A 4IUTA 1JOKA 1E2VA 3PV0A 1EZ6A 3MHBA 3J80c 1BXTA 3D3RA 4NB3A 2F0DA 1TS4A 1J5EL 3H91A 1XYIA 4TVAB 1M8AA 3GTKB 4OXPA 1ILPA 2O2LD 4AQYQ 2F0WA 3NEMA 3W1BA 4LFBQ 1O7IA 1X9NA 1YEZA 3TREA 3TS2A 2WV6D 3BZCA 3I4MG 3H09A 2F0UA 5IWAL 3DWQA 2KCMA 3K80C 3GDEA 2LS01 3K0YA 5LMNL 4KY5A 3KJPA 3PGZA 4L5TA 4X3SA 3CCUA 1BDOA 5J3BA 3OWFA 4CJ2C 1C7YA 1I6HH 1WD1A 1B50A 2JN4A 2EY1A 3L7ZC 4ODGA 1WI5A 4KTAA 4DV6L 1HH2P 1RJTA 4LF9Q 1R9TH 4OO1G 1FGBD 1V43A 2WAQB 5IT9c 1WFQA 2B8FA 1GO3E 3GTGB 2EYPA 1JE4A 3D8GA 4AQYL 3A54A 3HOVH 5DNFA 4R4CA 5C4HA 3CKIB 3NXWA 3S1MB 4LFBL 3ICEA 1U9RA 3U9SA 1HNXQ 1CZWA 2DJFC 4QF4A 4LF7Q 2F0SA 3S17B 1TIID 4G7OC 4P72A 1CI3M 2UUCQ 1PDQA 2F0QA 2CHBD 1CUKA 1F2MA 4U673 2QILA 2PQEA 1P16A 2KEDA 4XIGS 1EQRA 3IKJA 2EPBA 4FF2A 4JOIA 2F1MA 3MFGA 5K5PA 1SMYD 4EQ5A 5ELEA 4LF9L 2NBFA 4B3RQ 1DZ1A 2HQLA 1ET6A 1STYA 1FGUA 2I5MX 1HR0Q 1VQEA 4JV5Q 4DR7Q 2K5DA 4K5XA 5JJKA 1D1KA 2Z6BA 1SNCA 1VQJA 3S14H 1VCIA 4HSPA 3QOLA 4KMUC 1LT6D 4DK0A 3CCVA 1RKNA 2D2CC 3Q8DA 2CVRA 2JA6B 1BVSA 2L55A 4GN4B 4DK1A 3B6YA 2JE6I 1K83B 4LF7L 4OO1H 3GTPH 3HOZB 1VDZA 1LTSD 1Q86C 3KFUA 2JA8B 4JCVE 5IGFA 1WTVA 2WAQG 4A3LH 3A5ZB 2UUCL 3DWPA 2Q8IB 3G71A 1YJNA 2MNAA 2NB0A 4DAYA 4ZCKA 1WOCA 2R61A 4K14A 3PO2H 1CZGA 3MA2B 1T5EA 5C3EG 2YU9B 5EPJA 2K6AA 1DCZA 1JOQA 2E75C 2UXBQ 2K01A 1HR0L 4JV5L 4DR7L 1A8VA 3EVQA 2SEBD 2C9OA 2BE5D 4MHEA 1PFBA 3GTKH 4E6IA 1R4PB 4P73A 1KDBA 4DU9A 3NP8A 5C44B 4G4KA 1Q46A 1U4RA 2IJ0A 4BS9A 3RUZA 2FINB 2NZOA 5HGQA 1MIUA 1YNXA 3S2DH 1IW7C 2Q8RE 3MEFA 1LTID 5IODA 5L37A 4DR1Q 1MHWC 2IW3A 3MAQA 3MEHA 3BYTB 2PQAB 3QO2A 2ALYB 3VR3A 2XNAC 2HD3A 2JA6G 1QWYA 1LO5D 1CQVA 1SXTA 4AH6A 1YNJC 1EYCA 3NBHA 5CV9A 3J81L 2RHSB 4KK7A 2UXBL 2ZM6Q 1BOSA 3EQLC 1XX8A 1YNNC 3SK5A 5IP7H 4DR5Q 4A3CH 1TWFB 1LTTD 2E76C 3HOZG 5C0XJ 3UE0A 2OEOA 4QB4A 2JA8G 1SNDA 3PIPA 1AH9A 1C4QA 4OEMB 4JI5L 5I4DA 1N8RC 3GTGH 2IPKD 1K8GA 3M4YA 3CAMA 4P74A 2KEEA 1SYBA 4C3HG 4L8JA 2SNSA 5KNCA 1U4PA 5CV5A 2C35B 2P5ZX 1ASYA 3PUWA 1PLFA 1KAWA 2K75A 2G9DA 2GA4B 2J4XA 1LT5D 2JXMB 4IUUA 1FNUA 1NUCA 3S17H 2VUMB 4DR1L 1A2UA 3IAYA 1UE7A 3URYA 4H44C 1K3BC 3DEOA 1SRUA 5EKLA 4CBVA 1N36Q 1QJOA 1CA5A 1XTDA 1B44D 4KD4A 1D7QA 2I46A 2UUAQ 4FF4A 2BDNA 3V2TA 4FF3A 2D0PA 5C3XA 1F9PA 3M9BA 4IUPA 1ONLA 3X3NA 4NMZA 4MZ9A 4ZKBB 5J39A 2ZM6L 4A3JH 4DR5L 4Q5VA 4KN7C 3OOCA 4Z9CB 3H94A 2F4VQ 4GNXA 1ZKOA 4HCEA 1O7YA 1GHKA 3RN2A 3RZOB 1VQBA 4K8IA 4DV7Q 1IHZA 3SDZA 1NJIC 2A74C 1UE5A 4IOAA 2B2VC 2A6EC 3RLFA 3OYYA 3QOJA 1EOTA 3I73A 2G9HD 1A3TA 4DGZA 4AYBG 3HOZH 3S1QB 4BY7B 1QG7A 3BDLA 2JA8H 1VQDA 1N36L 1CHQD 4HIKA 4OL7A 3HS0C 3RN5A 1H9JA 5BR8Q 1BR9A 1MKHA 1B3QA 4JI3Q 2N88A 2UUAL 2VQFQ 3TS0A 4G57A 1B1ZA 3VA7A 4QGUA 4DAYB 2ENBA 3WWVA 1L0XB 3EFXD 2YU9H 5IP9H 2AUJD 5H1SE 4OIKA 3A5UA 4GZYC 1HNWQ 1UE1A 1Z6HA 3F2UA 4R4IA 3M85A 2VUMG 2DY8A 2KCNA 1A2TA 2SOBA 3PO3H 2F4VL 3LWUA 5C0XG 4K0KQ 1EY6A 1LTLA 4GKKQ 4DV7L 1I50B 5A35A 5EBDA 5C44H 3H0GB 4X3TA 2EJFC 1SAPA 3KK7A 4DV0Q 1PV4A 1SFOB 1HFNA 1O80A 5GROA 3AMUA 1FJGQ 3A74A 1PH9A 4C56C 4BWGB 5KEEA 4LW1A 1UNSA 5BR8L 1O7ZA 3I2ZA 3ULLA 3E3XA 4JI3L 2CKZB 4TQUS 4NPSA 2VQFL 4KN4C 1DJRD 2LXKA 2QEXA 1GKHA 3K5NA 2B63B 3C3LA 1HNWL 1HRJA 3NBHB 1TWFH 4X66L 2X6LA 5EKIA 2J7ZA 4V190 1VQKA 1E3PA 2OF1A 5A2QL 2CW0D 1H9RA 4WJ4A 1Y8OB 3NTIA 4GKKL 5TSSA 1X3QA 1TS3A 1PTOD 2EIFA 3OWEB 1PXUA 3T13A 4DV0L 1X54A 5K36G 3H3VH 1N34L 4X3UA 2Z1CA 1FJGL 3ULJA 5C0XH 4JOIC 1IBMQ 4C3IG 2KOLA 4MIUA 2EY2A 4C2MB 4LUZA 3JAMi 2MUYA 3VYSA 3NPPA 4KY6A 1H9MA 2JA7B 4KY7A 3H0GG 1Q7YC 1MBYA 1TS2A 1K8AC 4DR2Q 2AKWB 4HJ5A 4N8X1 2EYHA 1PH5A 3GTLB 2R7ZG 2ZJRA 4ZLTF 1TU2B 3RZOH 5FLXE 2DJGC 4KKTA 3C46A 1F77A 4GNXB 4IOCA 3MFYA 2ZXOA 1EWHA 3GTOB 2IX1A 4DR6Q 2Q2UA 1PH7A 1AZPA 5AJ3Q 3GTQB 2K4KA 2B63G 2ZJQA 5DAUA 2DN8A 5CV6A 1ASZA 4BY7H 2JA5H 4DV5Q 4Y52H 5M5YB 1UE6A 4YCWA 5FJ8H 2M9VA 1IBML 1S5FD 2L4NA 4M8AA 1AE3A 1EFID 3F2CA 3J81c 2BA1A 5ISRA 1Q90A 2A6HD 5COYA 1WTHA 4YHHQ 2CWPA 1GVPA 4A3KG 4BXXH 3SR1A 4DR2L 1S5BD 2IHEA 3MVVA 2QEJC 3S1NB 1HUNA 1KRSA 1IL8A 1DOMA 4M1UB 3PIO3 4JW0A 4HJ9A 4LWCA 2RQXA 2KCCA 3UI2A 5CYUA 4LFAQ 2R93B 1VQFA 4UP8A 4GLAC 1I50H 3HOUG 3GV6A 3RD4A 3T53B 1Z9FA 2AWOA 1PH4A 2BE5C 5AJ3L 2QDBA 3PCOB 4R8IA 1SFOH 5M3MB 3CW2C 3PQIA 4DV5L 4QCLA 1PMRA 3K5LA 1TVXA 3NHHA 1HTLD 5IGGA 4DK3C 3GTMB 2D0OA 5M5XB 3J80i 3CU7A 3ULPA 1YZ6A 1A63A 4UP7A 2B2WC 3CQZB 4A76A 5CC4A 1JORA 4ZKCB 1QZGA 4GLXA 1TS5A 2JYOA 2Q2IA 4LFAL 2PO4A 3QG1A 2L1BA 3E0JA 1SYFA 1Q82C 2K28A 1J8IA 1XPRA 4MNOA 1MI2A 4A3GG 2LXJA 5I2YA 1C0AA 2JK8A 1A15A 2JJQA 5IGCA 2ID0A 2PZUA 3L0OA 3SGIA 1JWUD 4FDBA 1P8LA 1PZJD 1R4QB 2PPBC 1II3A 3CMEA 1K8OA 2R93G 3FMCA 4C2MH 2HQEA 4LNQA 4JBWA 2JA7H 1WTXA 5GAGC 2RSNA 1L2FA 1YJ9A 3HKSA 4FXDA 2L12A 4KV6A 5IY0A 3K5OA 5M3MG 4LF4Q 3KOJA 4ID6A 5D14A 5JOBA 1YHAA 4A3FB 4WFN3 4A3DH 4I65A 2F0FA 1OTCA 3P1HA 2KQ3A 3TZDA 1AEXA 4K2KA 3S2HB 3VYRA 1IXRA 4CDCC 1F2YA 5KYIA 2GVBA 3NUCA 5EQ0A 2NTTA 1CKOA 3A7AB 2EVBA 3ERQA 1KNAA 3GTQH 5NUCA 3S1RB 1VQ4A 3H3VI 2XRSD 4DUYQ 5M5YH 4B3SQ 3I4MB 1LM0A 4K5WA 1ZYRD 2FJ2A 3CF5A 3D6WA 2F0IA 3S9WA 2B2UC 3J80E 1VQCA 1QOHA 3MC0B 3U4VA 5M3FB 2IHFA 2K05A 3TP7A 2VZAA 4LF4L 1UAPA 3S1NH 5J22A 4GOPC 2R93H 2K14A 2QF7A 1JQYD 2M2LA 1PH2A 2IL8A 3CRKC 1X6OA 4A93G 3KF6A 1XWEA 1HPCA 4TRDA 4AYBE 5M3MH 3E6ZX 1VF7A 1RD9D 4RKLA 3UDXA 3J7A5 4B3SL 2WFWA 4A3FG 1U4LA 2A73B 4RMFA 3GTMH 1EYDA 3CP0A 2NZ1D 4OWWB 2F0HA 5M5XH 2EYLA 5IT9E 5DM63 4RH6A 1KXLA 1MSHA 1NSNS 3NWSA 2YV5A 1SMXA 2L0CA 2A19A 1I5FA 1ET9A 2N3SA 4JI7Q 1BCPD 3CCMA 5D65A 4ME3A 4R4TA 4YY3L 2F0KA 2WACA 4HN7A 3PF5A 2EOTA 2ZXPA 1VQ8A 3P7JA 5M3FG 4NDXA 4L6TB 4RKBA 1PVOA 4EGVA 2PNRC 2VS1A 3CC2A 1S5CD 2MO0A 4XXEA 5DLQE 4AIMA 3M4PA 1CFMA 2B8GA 4NW2A 4ZRZA 5FKAC 1XMOQ 1A62A 5M5WB 1H95A 5KRUA 3G4SA 4IFDJ 1B53A 2EYMA 3J7YW 4JI7L 4YCUA 5C3EB 4IUNA 4MTNA 1PRTB 1WD0A 1XPUA 1YITA 3MXNA 3S2HH 1SLJA 3A8JE 1FR3A 2RDGA 3VR6A 3BZKA 1CA6A 4RAUC 2NVTH 4DKAC 2Z6KA 3S15H 1FNWA 2HDLA 1EWCA 4O2DA 1ENAA 5JEAG 1TY2A 2RCFA 3I4MH 1B2TA 3MTSA 2K50A 1JMCA 1XMOL 1IYJB 4O42A 3CHBD 3K6OA 4CKEA 1ESFA 1E0BA 1TQOA 2ICIA 5LMUQ 5M3FH 4I7AA 3HZXA 1WYDA 2PZWA 3V96A 3KDFA 1SDFA 3QB3A 3TZUA 1WCMG 1WTRA 2EY6A 3NQIA 4RHRA 2MO1A 1EU3A 3U4ZA 1JR0D 2ZXRA 2L9HA 2DNEA 3N52A 2PI2E 1MJCA 4IJLA 2QDLA 3SK8A 1VQGA 3CPFA 4C3HB 1SBBB 5G3LF 3KF6B 3NENA 4HCSA 1KDAA 1I94Q 2HT1A 4OX9Q 5D3IB 1BF4A 4KHPQ 4O1NA 1LUZA 3RZDB 2EQSA 4UAIA 2MQHA 4PZ6A 3F2DA 2RHQB 1QUQA 1DD2A 3IFTA 5LMUL 1YVCA 2WINB 2WB1G 4NXML 1IKLA 4JI5Q 2RCNA 3SK6A 2XVSA 4IFDG 3E9HA 4HJAA 2Y0SE 2C5CA 1XPOA 1VQPA 2D5DA 1YJWA 4Y7NB 2G5DA 1IZ6A 4G7HC 4FYDA 3CXCA 4POFA 2PI2A 4IZ8A 2RBMA 3X3MA 4P2CB 4RGMA 1SYGA 1VF5C 3LX0A 4QUFA 1I94L 5BN3A 1LYLA 2Q8TA 1X65A 1PZKD 2WIIB 4OX9L 4KHPL 1N33Q 2B2YA 4BBRB 3BG3A 1NCVA 4QJFA 4AYBB 2XN9C 1SYCA 1BCPB 1C48A 1DYQA 1HUMA 1PRTC 5M5WH 3UE1A 3C1FA 2CQAA 1CT1D 1I4PA 2MJ8A 3K7AB 4FXGC 4XQJA 1F2ZA 3BVGA 3CCJA 4A3IG 1TWHB 2TMPA 1LV9A 2SNMA 3HOWB 1Y1WB 3M4OB 4XT3B 3S1MH 2A69D 1I4XA 5C3EH 1BBUA 1OXVA 1BO0A 1G91A 4RWSC 1Q3LA 3I55A 4X62L 3NWTA 5LHY1 5JJLA 1RL2A 1D1IA 1Y1VG 5E4WC 5IYBG 3BDCA 4LF8Q 1MSGA 5FO8B 2L11A 3W5OA 4IJHA 3FP9A 3VR2A 1A0IA 2I07B 1XTCD 3MXNB 4DPGA 2F3WA 3NTHA 5HY6A 4IFDH 4LFCQ 4XQQA 1S4ZA 1V8QA 1N33L 1IYVA 5T1GA 4S3SA 1KD1C 1B4OA 1KL9A 2HHHQ 4K6DA 5FLXL 2F0EA 3HOXB 4IPGA 2VB2X 4LK1C 1NTGA 2O5JC 2E74C 1V1PA 3SVMA 3FKIG 3TSSA 4JBJA 1ESRA 4R4QA 1YIJA 1ZYRC 2B39A 2R3ZA 4IPHA 4C3JG 1SSOA 1X32A 2BCOA 2O4XA 1JB3A 2K33A 2JA6H 1C9OA 3BZDB 4RGTA 3KDFB 3AU7A 2WP8J 4ZK9B 3NTKA 5CBAE 3NK9A 4BBRG 1K83H 1AN8A 1LTBD 1PFSA 2EJGC 4LF8L 1W6KA 1D5ZC 1K9MC 4MTKA 4C3HH 1BKBA 4LFCL 3T56B 3J81i 3K57A 2PW5A 3HOWG 2L15A 3LNNA 3CCRA 1Y1WG 4RHSA 3G6JB 2HHHL 5JAVA 3KUPA 4LF6Q 1E1TA 4PNYA 3OSOA 1RDPD 1CSQA 4OHJA 2BH2A 3CC4A 2RVLA 4X66Q 2F0MA 2NYZD 4A4IA 5LMNW 1DM0B 4C3IB 4BBSG 1QUQB 2DUDA 3KJOA 1EQVA 5C4XG 2XGTA 1YHBA 2XIWA 1QVCA 3R2IA 4EVOA 2NN6G 4PG3A 4DUZQ 2EY5A 1Y69U 4YIJA 2BOSA 2V4DA 1L0WA 4K8JA 5E4XA 4A3BB 4FNFA 4Y7NH 3HOXG 3LWEA 1J6QA 1SNPA 1N34Q 4DAPA 1RHPA 5IYCG 2ZTEA 1NAPA 2YTXA 2R7ZB 1BCPC 3HRZC 1B9NA 3OIPA 4ME5A 4TKOB 3QWNA 2UU9Q 4KHVA 2VW9A 3EIVA 3E9IA 5I9OA 3ZYYX 4HJ7A 1L1OA 2KENA 3PUVA 3I70A 4BBRH 3MXGA 5KNBA 4LF6L 3F8TA 2N8NA 4NKLA 2NUCA 1HFGA 1KQSA 1VQLA 2ES2A 1KHIA 1ZXTA 2D62A 2RDHA 3H3VC 1F2LA 3K7AH 1EIHA 4ZUIA 3VDYA 1EYGA 1TWHH 4OIJA 3EROA 4KLKA 1Y14B 2MGSA 1HA5A 3R2TA 4DUZL 3M4OH 2FHTA 3KF8A 4TSSA 4A3KB 1X56A 4RA8A 1CHPD 1Q8KA 2F0LA 2IT1A 2KVMA 2VUMH 1E24A 2Y0SB 1EY4A 3Q23A 1QB5D 2Z0SA 2F0PA 3I3CA 2UU9L 2O5IC 1PFNA 4UHVA 3HOUB 5JVG3 1G51A 1GOZA 4APVA 1IBKQ 3EJIA 5JPMC 3HOXH 4NXNQ 4A3BG 3AB9A 5IYCH 1YHQA 1TWAB 1EIYB 2FXQA 4X3KA 1V1PB 4A3EG 1SMYC 5LL6X 5ELFA 3IRBA 4KHZA 3UDGA 1B7YB 1PA6A 1G6ZA 3CCLA 4JYAQ 4R1JA 3A8KE 1UEBA 2F03A 1DONA 3J80L 1HR0W 5JJIA 5EJWA 3WDNA 3S1QH 4HJ8A 2KCTA 1KABA 3W1GA 4QUCA 2PYKA 4P71A 1X3FA 1VS0A 2OQKA 5M9OA 1E1OA 3I4NG 3GP7A 4FO2A 1X3EA 4A3GB 4IFDI 3HG9A 3D0FA 2J0TD 2YTVA 3T51B 1IBKL 2HDMA 2K5VA 4DXFA 1JICA 1IBLQ 5K36H 2RA4A 3DLLA 4NXNL 1KLUD 5CV4A 2FFKB 1J9OA 1VQAA 1M4VA 3DM1A 3E0EA 4DAVA 2B2TA 4JG2A 4C3IH 2Y0SG 3ZJYC 1KAAA 1GXDC 3D31A 4RG1A 5BN4A 3G48A 1H9KA 4JYAL 1A3VA 3H0GH 1DGSA 4N9PA 3I56A 3OW7A 3HP3A 1WTWA 1SE8A 2BDOA 2NWGA 1LT3D 2KA7A 4F87A 5IT9L 2R92G 2NVQB 3F1ZA 3FPUB 1X3PA 3A7LA 2R7ZH 1KTKA 1SNOA 1WTPA 3QJYA 3I8ZA 3JAME 5FLXc 2RKSA 4XYOA 1LTGD 3BU2A 1GM5A 1IBLL 1L1OB 4C1NI 2B63H 1NR2A 3PSIA 4JI1Q 5IYDG 4DXGA 1G2SA 1SR3A 2WB1E 2WKCA 4PMCA 3OMCA 4QY7A 1Q12A 3KYHC 1N9WA 3FDTA 2MHVA 1B3AA 2XSCA 4JC0A 3FPPA 4KD3A 1NMGA 3LGJA 4C1NK 4A3KH 3ER0A 3TMEA 1HHVA 1SNMA 5EGTA 4V0BA 2AQ3B 1KNEA 4UY8C 1EFWA 4HMJA 3KF8B 4JI8Q 3BVMA 1PH1A 1D8LA 5HURA 3D4RA 4KJNA 1EOVA 2PCFB 5E7NA 3S16B 1MJEA 2UUBQ 1GJXA 1AP0A 1DOKA 1JCKB 3HOUH 4A93B 4DF7A 4K5VA 1PRTF 3NQTA 2K04A 1YNJD 4PMBA 1JB7A 1RF2D 1PTOB 2XWJB 4U68A 4GNXC 4JI1L 1LT4D 3PIOA 2CCZA 4IUVA 1KRTA 3BS1A 4GKJQ 3VR4A 1CK1A 4ZYSA 2GVAA 2E2IB 1TWAH 3GTLH 3I90A 3J7AF 1CQFA 2RSOA 3DM3A 1VMPA 4KI0A 2E2DC 1PH8A 1AE2A 1NNXA 5IGBA 3CCEA 2SDFA 3J81j 1OXUA 4HTHA 1OO9B 3DMUA 1PYWD 3GTOH 1LTRD 1VQHA 3CRLC 4IUQA 4OGQC 1CM9A 3OHXC 2H4OA 4JI8L 4JI2L 5IYDH 2VXWA 1HZCA 3KLRA 2QW7A 4RGOS 5ELDA 2E5LQ 3MZ5A 2QGQA 3VYUA 3J7AV 1VQ5A 2UUBL 4FF1A 3AFPA 4DR3L 3NELA 5ELNA 1XNQQ 2A68D 5D3DA 4RGNA 4A3GH 1VQOA 3UDFA 2KECA 2NN6I 1CTMA 2L5TA 4WJWA 1L0YB 4L5RC 2E8GA 4DV2Q 2IX0A 4HIMA 3P75A 3A56A 3PUXA 3HKZE 1Y8PB 4OWTB 4GKJL 3GTJB 1BBXC 3I4LA 5JJZA 2EDGA 2F0JA 1VQ9A 3W2DA 1STBA 4YY3Q 3BVZA 3CD6A 3WOEA 1OXSC 2Q2TA 1SYDA 1TXYA 1RODA 1VQ6A 2HCCA 2LY7A 3S14B 2K03A 4R4OA 3SEBA 5FOBB 1UUPA 5JEAJ 1XNRQ 1M1KC 2E2HB 2NVQH 3JC66 2E5LL 1ENCA 1L1OC 1Y8NB 4QIWE 2QA4A 5IGDA 1HQRD 3Q22A 1SE4A 5EBCA 2E2JB 3BYYB 3M3YB 2PW7A 1XNQL 4EQPA 3OTOQ 4DV3Q 3AYHB 4PQXA 2B2VA 1S5ED 2H1EA 5C4ZA 1GD7A 5IOCA 4DV2L 3CCQA 4CKBA 4A3MB 3CC7A 5KGUA 2ZTCA 3CQZH 4HR7B 2HUGA 2K32A 1FNVA 1ILQA 3NSWA 1K3RA 2AQ2B 4CJ1B 4QL5A 3TN2A 3AQQA 3SE0A 4OWXB 2LMCB 4FXKC 1QVFA 1BCPF 4EQNA 3K59A 2CW0C 2Z9HA 1XNRL 1G291 1XMQQ 3T1YQ 1WCMB 2RF4A 2X6GA 1PTOC 2ZJPA 5E1FA 3M7GA 4IALA 4LF5Q 3S16H 1HTPA 4RFBA 4ZUJA 3OTOL 3S2DB 1U5KA 1V1OA 4DV3L 3O13A 4ABNA 2K5NA 1GUTA 4A93H 3GD7A 5BN5A 1V9PA 2PQAA 2R7FA 2BH8A 4POGA 5GAHC 3TQYA 1PTOH 4DA2A 4EX5A 3FRPB 3R93A 3T4AC 4A75A 4CJ0B 2AMCB 4A3FH 1HZBA 3G7LA 1HQMC 4ILWA 2E2IH 1K0RA 4XYQA 1EYAA 1TT2A 4K6LA 4FP5D 1IL2A 2WB1B 4O0AA 4H7BA 4A3LG 2EE1A 1XMQL 3T1YL 3UDIA 4A3MG 5IIFA 3S1RH 1Z47A 2I5LX 1DXMA 3PO2G 3PMFA 4DFAA 4LF5L 1SJHD 1I4QA 2JQOA 5T1IA 5J1ZA 4DNTB 3STBD 1RTOA 2HCIA 2CH4A 1NE3A 5GAEC 3PUYA 3Q0AA 1TWGB 1NMFA 1AW7A 2PZTA 2JSOA 1FVIA 2B2TC 2JEAI 1O7LA 4JI6Q 4NXMQ 1G2TA 4XQNA 3D4WA 4BA1I 2MPMA 1LABA 3K8AA 2F52A 1W6JA 2KUMA 2A6HC 3GTJH 4B3TQ 2HIXA 4HAEA 4A3JB 4DNRB 1EZ8A 1X55A 3NBIA 4J1MA 2VNUD 2CH4W 1JJCB 1QILA 4PMWA 2HIVA 1GUSA 1GUOA 4A3IB 4X65Q 4JVZA 3KBGA 3ONAB 1QNKA 3PIP3 2N55A 4QQBX 5KIXA 2E2HH 3G6EA 4F7XA 2K5HA 5KNDA 2H5XA 2JP1A 1HNXL 5DEHA 4GN5A 5G3LD 1Q1EA 1SJED 3E5SA 2XTIA 2E2JH 1DOLA 5IE8A 3M3YH 1Y1VB 3SXHA 5ELBA 5GADC 4N8FA 4Q0FA 4CDDC 2V1CC 4A3CG 5IP7G 3I91A 1TR5A 4LAAA 2Z8LA 2JEBI 4UPAA 4JI6L 1QCBD 1MGSA 3I4OA 4A3MH 2CQOA 1I6VC 5JEAH 1EY5A 4B3TL 5JPNC 3ND9A 4DK6C 1B70B 1D6EC 3HKZB 4B3RL 1HJPA 5CORA 2AUKA 1I3QB 4R8NA 2KBNA 4X62Q 3FKIB 5ELOA 4R9WA 4CDEC 4JPBW 3PO3B 1LACA 4X65L 4IPDA 2OCEA 1EY7A 3U58A 4C3JB 2IY5B 1JT8A 1WCMH 1NBWA 2F0OA 4GN3B 5CV7A 5EPKA 2F0GA 4XT1B 3GQBA 2NVXB 2ICEC 4LUOA 2N49A 4QIWB 5I9PA 4A3JG 1JJGA 1EEID 1NR4A 3ND8A 1STGA 4J6HA 3RNUA 3W3AA 1JC7A 2X69A 3GO5A 1WTQA 5C5LA 4YWKA 3V05A 2D9UA 3CCSA 4P75A 4EQOA 1D5XC 1K0SA 3D6CA 4JBKA 1OXTA 4QMGA 2NTSA 4J15A 4BBSB 4DR4Q 1S40A 2B2WA 5C4XB 5FO7B 1Q1BA 4X6AH 4N9TA 3N6RA 1JOOA 3R8BA 1E7ZA 3I7FA 2FMMA 3Q24A 3C1EA 3TDQA 5IP9G 1X3GA 2F3VA 3AEVA 1RIPA 3BDOA 2PMZE 2BA0A 3HKZG 5CR3A 3HOYB 4KKUA 1TWGH 3L3OC 3PO3G 1Q8IA 2NZHA 1ICWA 2B3GA 2A68C 2Q2HA 4CGYB 2FMCA 5C44G 2AWNA 3MWYW 5E3FA 4IURA 1VQNA 3TBIB 1Z7TA 1WVLA 4KJOA 1UWVA 1SROA 4DR4L 5IGEA 4A3IH 4XTCS 2R7DA 1U0LA 4PV1C 3DXJC 3Q6SA 2KJXA 5DM73 2AQ1B 3MXUA 4I7ZC 4WRDA 4YCVA 1B9MA 4G7ZC 2DY7A 2EYFA 1MD2D 4H13C 1JE5A 3RZDH 2CWAA 4LMQD 1QVGA 1Y1VH 5C6AA 5IYBH 1AZQA 4DAMA 2JA5B 3F2BA 1S5DD 3A0JA 1VMCA 2PNHA 1ML0D 4JI4Q 4DV4Q 4L5SA 2K7VA 5FK9C 4IN3A 3MXPA 1T9HA 3T1HQ 2DGYA 1BQQT 3JAML 5GQOA 1E2WA 2VB3X 5CV8A 4B9XA 1YBYA 4ZAIA 4MN3A 2ZT9C 1I3QH 4CHTB 3EA6A 2B2UA 4OELB 2UXDQ 3FKIH 3HOYG 2OT2A 1S3OA 5AFWA 4A3EB 3TP6A 2F3IA 4UDUC 1K28A 4C3JH 2RDFA 1E22A 1F9QA 1N32Q 4KKSA 3VYTA 4GOPA 2A1AA 2Z4HA 1G6PA 3L9AX 3VA5A 1RTNA 2NVXH 2MP1A 2A5HA 2EXDA 3OIQA 3BJUA 5CGKA 4LUVA 1EQTA 1SE3A 4OO1I 1VQMA 1EIGA 1FYCA 5FO9B 2VQEQ 1SEBD 1I4RA 1CKNA 3I4NB 4JI4L 4DV4L 4HEDA 4K2LA 4XDXA 3HOWH 3T1HL 4DNIA 1Y1WH 5HGTA 1XJVA 3VR5A 5C4JB 1RCVD 1HZAA 3TRZA 4DV1Q 2N78A 3J7ZC 2Z6KC 2EYOA 1PYSB 1EY0A 2UXDL 1PTOF 4BY7G 1BUVT 2F4IA 4NP5A 2JA5G 4B9WA 4BBSH 1W3SA 5FJ8G 4K0KL 4HIOA 2QKIC 3ITPA 5C4XH 2VY3A 1N32L 3J81E 1U4MA 2NN6H 1KDCA 1PFMA 4HIDA 2R92B 1GUWA 1JWSD 4BXXG 3RLNA 1EEFD 2VQEL 3HOYH 2K52A 3DWAA 4PZ7A 2LSSA 3STBC 1EY8A 2KHIA 1GUGA 2ZTDA 3C2PA 1STHA 2LKVA 2KHJA 3FVQA 5FLMG 1FL0A 2EYJA 1QNUA 4DV1L 1AFPA 2TSSA 5LL6S 1LLRD 1HCZA 3TP8A 3DUZA 4A3DB 2XWBB 2DNCA 2NVYB 3TEHB 4J8QA 3PUZA 4LJZC 4H02A 3RR5A 2KHSA 2ATWA 1HA6A 2OWOA 2XRQD 3CMAA 4X64Q 3OPOA 3RLOA 2F0NA 5EKKA 4WORA 1A6XA 3QIAA 4RCOA 3KLSX 3K58A 2F0VA 1JJ2A 3EBEA 4YWMA 2PMZB 4BY1B 1IYUA 1E2ZA 1H9SA 1TWCB 1TKWB 1IKMA 1G8ZD 3NE5B 2F0TA 3CPWA 2UXCQ 4A3BH 1A3UA 4OONA 4ALPA 3OMGA 3WOFA 3H15A 1LTAD 5I6YA 2B2YC 1EWIA 4A3EH 1EY9A 1PZID 1GHJA 3T16A 5I6WA 3HFZB 5FLMH 4X64L 4DR6L 2JA7G 5EPLA 2I0QA 3HGBA 4GOPB 1I4HA 4PZ8A 2WAQE 2QCPX 3I72A 2ASBA 4A3DG 3OW2A 1CSPA 3I4NH 2K5WA 1XXGA 4JBMA 4CDFC 1PYBA 1S72A 1PH6A 3FHWA 1CKNB 3DEPA 2LFNA 1EIFA 1GUNA 2VL6A 3RMHA 5C4JH 4YHHL 5F2DA 1QE6A 1SNQA 3K5MA 2UXCL 2AHOB 4JI2Q 1IW7D 2OXPA 4ULLA 4F8MA 2A69C 1EQQA 1JWMD 4HSVA 4JK1C 4HMIA 4GS3A 3IFDA 2IWHA 1Q81C 4DR3Q 3QR8A 1PH3A 1UEAB 4YWLA 5CBEE 1T5XD 4B3MQ 4BY1G 1CKMA 2OTJA 3D4DA 1ZEQX 4IPCA 5C3WA 1STNA 1VQ7A 4BA2I 2R92H 5A2QE 1STEA 1YNND 3AFQA 1B8AA 1PRTD 1SYEA 3PF4A 2EXZA 1I6HB 5ELCA 1D5MC 4L63B 2YTYA 3KLWA 5CMDA 3EN2A 2OQ0A 1R9TB 4GLVB 3JAMc 1EUJA 4JI0Q 3H6MA 4IQZA 3HOVB 1EU4A 5C5MA 4FVMA 3KLSA 1WJJA 1TY0A 3GV3A 2YYZA 2OTLA 2GN5A 2NVYH 1I4GA 3DHQA 3K81C 1D2BA 4B3ML 5I2XA 1FD7D 3K7UC 1PHJA 4UP9A 3L2PA 1HNZQ 3SK4A 4RCNA 1HZ9A 1YI2A 1HXYD 2NVTB 1VQIA 4CKCA 3P20A 3S15B 4F88A 3U9OA 2A8VA 3R3OA 3S24A 1K8MA 1BNZA 1W2BA 1M90C 3FEWX 5C0XI 3TP5A 4IO9A 3M7NA 4BY1H 1TWCH 2A6ED 3U50C 1KC8C 4JI0L 1J5EQ 1EL0A 1ICFB 1H9SB 1V1QA 2EZVA 3M4QA 4DN4M 1SE2A 1K73C 3A8IE 1O78A 2B29A 4WJ3M 3HEJA 1WTOA 1KIXA 4ZQ3A 2WKDA
chains in the Genus database with same CATH topology
3CC4A 4HJ9A 5GADC 4LWCA 4X66Q 4LFAQ 4A4IA 2V1CC 5LMNW 5IP7G 4A3CG 1SN8A 1VQFA 1BBWA 2CFMA 5IWAQ 4UP8A 2MFIA 3K0XA 4GLAC 2I5HA 2JEBI 1QZHA 1QUQB 1OXXK 2DUDA 4UPAA 4BBSG 1I50H 3KJOA 4JI6L 1HNZL 3ERSX 3HOUG 2XGTA 2R6GA 5C4XG 1YHBA 1Z9FA 3I4OA 2AWOA 5EAYA 1QVCA 2CQOA 5LMNQ 4A3MH 1PH4A 2NN6G 4PG3A 4DUZQ 4L5QA 5AJ3L 3PCOB 1SFOH 3HOVG 1L0WA 4B3TL 4DUYL 3CW2C 2JA9A 4DK6C 4DV5L 4Y7NH 3HOXG 1B70B 4B3RL 1J6QA 1HJPA 4DV6Q 1N34Q 4X62Q 1NY4A 2KBNA 2ZTEA 5IYCG 2YTXA 4DK3C 3PV0A 5ELOA 3J80c 4NB3A 4X65L 2D0OA 2UU9Q 4IPDA 3J80i 2VW9A 1J5EL 3EIVA 3E9IA 2OCEA 3U58A 4HJ7A 2IY5B 1L1OA 4TVAB 1JT8A 2KENA 4OXPA 1WCMH 1NBWA 1YZ6A 4GN3B 4AQYQ 3ULPA 1A63A 4UP7A 3PUVA 4BBRH 4LF6L 3NEMA 3F8TA 3W1BA 2N8NA 4A76A 4LFBQ 1O7IA 1X9NA 1YEZA 3TREA 3TS2A 3BZCA 1QZGA 4GLXA 1KQSA 3I4MG 1VQLA 2ES2A 4LUOA 2Q2IA 1KHIA 2N49A 4LFAL 2D62A 4A3JG 1JJGA 5IWAL 3K7AH 3RNUA 3VDYA 1Q82C 1EYGA 2KCMA 3K80C 1TWHH 1XPRA 3GDEA 4MNOA 3GO5A 5LMNL 4A3GG 2LXJA 3KJPA 3PGZA 4KLKA 4YWKA 1Y14B 3M4OH 4DUZL 1C0AA 2JK8A 4L5TA 2JJQA 3CCSA 2ID0A 4P75A 3CCUA 5J3BA 1X56A 1Q8KA 1C7YA 3L0OA 4JBKA 1I6HH 3SGIA 4FDBA 3L7ZC 1OXTA 1P8LA 2IT1A 1WI5A 2VUMH 4DV6L 1E24A 1HH2P 4LF9Q 3CMEA 1R9TH 2R93G 2Z0SA 4OO1G 4J15A 1V43A 4C2MH 5IT9c 2UU9L 1WFQA 4DR4Q 1S40A 1GO3E 1Q1BA 4JBWA 4LNQA 2JA7H 4X6AH 1G51A 5GAGC 4AQYL 3HOVH 1L2FA 4APVA 3HKSA 1YJ9A 1IBKQ 4R4CA 1E7ZA 3I7FA 5IY0A 4LFBL 5M3MG 3HOXH 4LF4Q 3KOJA 3ICEA 4NXNQ 4A3BG 1YHAA 1HNXQ 5IP9G 4A3BH 1X3GA 4A3DH 3AEVA 5IYCH 1RIPA 3HKZG 2PMZE 2BA0A 1YHQA 4LF7Q 1OTCA 1EIYB 1TWGH 2FXQA 4A3EG 4P72A 1IXRA 3IRBA 4KHZA 2NZHA 1B7YB 2GVBA 3UDGA 1PA6A 2UUCQ 3PO3G 1CUKA 1CKOA 2B3GA 3CCLA 4JYAQ 4R1JA 2Q2HA 1P16A 3GTQH 4XIGS 5C44G 2AWNA 1EQRA 1UEBA 1VQ4A 5JJIA 1HR0W 1VQNA 3H3VI 3S1QH 4JOIA 4DUYQ 5M5YH 4HJ8A 4B3SQ 2KCTA 4EQ5A 1LM0A 3W1GA 4LF9L 4B3RQ 4P71A 2HQLA 1X3FA 2I5MX 1FGUA 1VS0A 1HR0Q 2OQKA 3CF5A 1UWVA 1E1OA 1VQEA 4DR7Q 4JV5Q 1SROA 3I4NG 4DR4L 4A3IH 4XTCS 5JJKA 1X3EA 2R7DA 1U0LA 1VQCA 1VQJA 3S14H 1VCIA 4IFDI 3D0FA 3U4VA 2YTVA 2IHFA 3Q8DA 3CCVA 1IBKL 2K5VA 4YCVA 1IBLQ 2VZAA 1BVSA 4LF4L 4GN4B 3DLLA 3B6YA 4NXNL 3S1NH 1JE5A 4GOPC 3RZDH 2CWAA 2JE6I 1QVGA 1Y1VH 5IYBH 1VQAA 4DAMA 4LF7L 2R93H 3E0EA 3GTPH 2K14A 4JG2A 4C3IH 3F2BA 2Y0SG 3ZJYC 1Q86C 3KFUA 3A0JA 3D31A 1PH2A 2PNHA 4JCVE 2WAQG 4RG1A 3A5ZB 2UUCL 4A3LH 4JI4Q 4DV4Q 1X6OA 3G48A 3KF6A 4L5SA 4A93G 3G71A 1YJNA 4JYAL 3H0GH 2MNAA 1DGSA 1T9HA 3T1HQ 2DGYA 1WOCA 3I56A 4AYBE 5M3MH 3PO2H 1SE8A 2R92G 5C3EG 1KIXA 5GQOA 3UDXA 3J7A5 3F1ZA 4B3SL 2WFWA 1YBYA 4A3FG 4RMFA 1I3QH 3GTMH 2R7ZH 2UXBQ 3CP0A 1HR0L 2UXDQ 3FKIH 4JV5L 4DR7L 4OWWB 3HOYG 1S3OA 1A8VA 5M5XH 2F3IA 5FLXc 1KXLA 4C3JH 1E22A 1N32Q 2YV5A 3GTKH 1SMXA 3BU2A 4P73A 4GOPA 2A1AA 1GM5A 2A19A 1L1OB 1I5FA 1IBLL 1G6PA 1Q46A 2B63H 3PSIA 4JI1Q 2N3SA 5IYDG 2NVXH 4JI7Q 2EXDA 1SR3A 3BJUA 3CCMA 4LUVA 4ME3A 2NZOA 5HGQA 4OO1I 1MIUA 1YNXA 2WB1E 1VQMA 2VQEQ 3MEFA 4R4TA 3S2DH 4YY3L 4DR1Q 1CKNA 4QY7A 1Q12A 3KYHC 4DV4L 1N9WA 4JI4L 3PF5A 2UXCQ 1VQ8A 4JC0A 3HOWH 1NMGA 3T1HL 4DNIA 1Y1WH 2PQAB 3LGJA 4A3KH 5M3FG 3ER0A 2ALYB 1XJVA 1PVOA 1HZAA 4UY8C 2VS1A 1EFWA 3CC2A 3KF8B 4JI8Q 1PH1A 2JA6G 1D8LA 2N78A 4DV1Q 4AH6A 3J7ZC 2Z6KC 2MO0A 2RHSB 5DLQE 1EOVA 1PYSB 4AIMA 3M4PA 5E7NA 2ZM6Q 2UXBL 4A3CH 2UXDL 5IP7H 4DR5Q 1MJEA 4BY7G 2JA5G 3HOZG 1XMOQ 2UUBQ 5C0XJ 4BBSH 1W3SA 1A62A 3UE0A 5FJ8G 4K0KL 4HIOA 2JA8G 1H95A 5C4XH 3PIPA 3HOUH 1AH9A 2VY3A 1N32L 4JI5L 3G4SA 1N8RC 3GTGH 4IFDJ 1K8GA 4P74A 3CAMA 1JB7A 2C35B 4HIDA 4GNXC 4JI1L 3PIOA 2CCZA 4JI7L 1ASYA 4YCUA 3PUWA 1KRTA 1KAWA 2K75A 4BXXG 3RLNA 4MTNA 4GKJQ 2GVAA 1TWAH 2VQEL 3GTLH 1XPUA 3HOYH 2K52A 3S17H 4DR1L 4PZ7A 1UE7A 3DM3A 1YITA 4KI0A 1PH8A 3S2HH 1AE2A 1SLJA 1SRUA 1N36Q 2LSSA 3STBC 3CCEA 2KHIA 3J81j 1OXUA 1XTDA 3BZKA 2ZTDA 3GTOH 1D7QA 2UUAQ 1VQHA 5FLMG 2KHJA 2NVTH 4DKAC 2Z6KA 1FL0A 3S15H 2D0PA 4JI2L 4JI8L 5IYDH 4DV1L 1HZCA 4O2DA 3M9BA 5JEAG 2E5LQ 2QGQA 4MZ9A 3I4MH 1VQ5A 2ZM6L 2K50A 4A3JH 4DR5L 1JMCA 3M3YH 1XMOL 2UUBL 1IYJB 3AFPA 4DR3L 3TEHB 3NELA 5ELNA 1XNQQ 3PUZA 4H02A 2F4VQ 4A3GH 3RR5A 2ATWA 5LMUQ 4GNXA 1VQOA 3UDFA 2NN6I 5M3FH 3RN2A 1WYDA 1VQBA 4DV7Q 1NJIC 2OWOA 3CMAA 4L5RC 1UE5A 2E8GA 3KDFA 4X64Q 4DV2Q 2IX0A 4IOAA 4HIMA 3RLOA 3PUXA 3HKZE 3RLFA 1WCMG 3OYYA 4OWTB 4GKJL 4AYBG 3HOZH 2MO1A 3U4ZA 1VQ9A 2JA8H 1VQDA 1N36L 4YY3Q 4HIKA 3CD6A 2PI2E 3EBEA 1OXSC 3RN5A 4YWMA 1MJCA 4IJLA 1JJ2A 5BR8Q 2Q2TA 1TXYA 1VQ6A 1VQGA 1MKHA 3CPFA 4JI3Q 2UUAL 3KF6B 3NENA 4R4OA 2VQFQ 3TS0A 4QGUA 1I94Q 5JEAJ 3CPWA 1M1KC 4DAYB 1XNRQ 4OX9Q 2HT1A 3WWVA 2YU9H 3JC66 2NVQH 2E5LL 1L1OC 5IP9H 4OONA 4QIWE 5H1SE 2QA4A 4KHPQ 4ALPA 1LUZA 3A5UA 3H15A 1HNWQ 1UE1A 4R4IA 2EQSA 3M85A 2VUMG 2MQHA 1XNQL 4PZ6A 1EWIA 4A3EH 3F2DA 2RHQB 1QUQA 3OTOQ 2F4VL 3PO3H 4DV3Q 3AYHB 1YVCA 5C0XG 5LMUL 4K0KQ 2WB1G 4NXML 1LTLA 4GKKQ 3HFZB 5FLMH 4DV7L 4JI5Q 1GD7A 2RCNA 4X64L 4DV2L 4DR6L 5C44H 3CCQA 2JA7G 4IFDG 2I0QA 3CC7A 2ZTCA 3CQZH 4GOPB 3E9HA 4DV0Q 1PV4A 4HJAA 2Y0SE 5GROA 1XPOA 1VQPA 1YJWA 4PZ8A 2WAQE 2ASBA 1K3RA 1FJGQ 4A3DG 3A74A 1CSPA 3OW2A 1IZ6A 1PH9A 4LW1A 4QL5A 3I4NH 3AQQA 4JBMA 5BR8L 3CXCA 1PYBA 4POFA 4OWXB 3FHWA 1CKNB 3I2ZA 3ULLA 1S72A 1PH6A 4JI3L 2PI2A 2VL6A 1EIFA 1QVFA 2CKZB 4TQUS 4NPSA 5C4JH 4YHHL 2VQFL 1I94L 1XNRL 1LYLA 1G291 1XMQQ 1X65A 3T1YQ 4OX9L 2UXCL 2LXKA 2QEXA 2AHOB 2RF4A 4KHPL 4JI2Q 1N33Q 1GKHA 2ZJPA 4QJFA 1HNWL 4LF5Q 3S16H 3NBHB 1EQQA 1TWFH 4X66L 4GS3A 3OTOL 5M5WH 3UE1A 1Q81C 1U5KA 1E3PA 4DV3L 4DR3Q 1PH3A 1VQKA 2K5NA 4YWLA 4A93H 3GD7A 4WJ4A 4B3MQ 4GKKL 1V9PA 4BY1G 1CKMA 3CCJA 2PQAA 2R7FA 2BH8A 4A3IG 4POGA 2OTJA 2EIFA 5GAHC 3TQYA 4EX5A 4IPCA 1VQ7A 3S1MH 4BA2I 2R92H 5C3EH 4DV0L 1BBUA 1OXVA 3AFQA 4A75A 1B8AA 2AMCB 1X54A 4A3FH 5K36G 3H3VH 1HZBA 3PF4A 2E2IH 1N34L 1K0RA 3I55A 1FJGL 4X62L 5JJLA 1RL2A 1Y1VG 5IYBG 2YTYA 3ULJA 4LF8Q 3W5OA 3KLWA 3FP9A 4IJHA 4JOIC 1A0IA 2OQ0A 3EN2A 1IBMQ 4GLVB 3JAMc 1IL2A 3MXNB 4LUZA 4O0AA 1EUJA 3JAMi 4A3LG 4DPGA 5HY6A 4JI0Q 4LFCQ 1XMQL 3T1YL 3UDIA 3H0GG 4A3MG 1Q7YC 3S1RH 1N33L 1Z47A 2I5LX 1KD1C 1K8AC 3PO2G 1KL9A 4DR2Q 2HHHQ 2AKWB 1WJJA 4LF5L 2JQOA 3TRZA 4HJ5A 2YYZA 3STBD 2GN5A 4IPGA 2NVYH 2OTLA 1PH5A 1NTGA 1NE3A 5GAEC 2R7ZG 3K81C 2ZJRA 3FKIG 3PUYA 4JBJA 4B3ML 4R4QA 1NMFA 1YIJA 1PHJA 1FVIA 3K7UC 2JEAI 3RZOH 4UP9A 3L2PA 4JI6Q 4IPHA 4NXMQ 4GNXB 1HNZQ 4IOCA 4BA1I 2JA6H 1C9OA 2IX1A 4DR6Q 1HZ9A 1YI2A 2Q2UA 1PH7A 1VQIA 3K8AA 2F52A 3KDFB 2WP8J 5AJ3Q 2K4KA 3GTJH 4BBRG 2B63G 1K83H 2ZJQA 4B3TQ 3S24A 2A8VA 2HIXA 1W2BA 1PFSA 1ASZA 4BY7H 2JA5H 4DV5Q 4Y52H 1UE6A 1M90C 4LF8L 4YCWA 5FJ8H 1X55A 5C0XI 2VNUD 1IBML 1JJCB 4IO9A 4PMWA 3M7NA 2HIVA 4BY1H 1AE3A 3F2CA 3J81c 1TWCH 2BA1A 3U50C 4C3HH 1KC8C 4X65Q 1K9MC 1BKBA 4JI0L 4LFCL 3J81i 1J5EQ 3HOWG 2L15A 4QQBX 4YHHQ 2CWPA 1GVPA 3CCRA 1V1QA 3G6EA 1Y1WG 2K5HA 4A3KG 2E2HH 2H5XA 3M4QA 4BXXH 2HHHL 4DR2L 4LF6Q 1K73C 2IHEA 1HNXL 1E1TA 4GN5A 1Q1EA 2B29A 4WJ3M 2XTIA 1KRSA 2E2JH 5IE8A 1CSQA 2BH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 A;  4HJ9 A;  5GAD C;  4LWC A;  4X66 Q;  4LFA Q;  4A4I A;  2V1C C;  5LMN W;  5IP7 G;  4A3C G;  1SN8 A;  1VQF A;  1BBW A;  2CFM A;  5IWA Q;  4UP8 A;  2MFI A;  3K0X A;  4GLA C;  2I5H A;  2JEB I;  1QZH A;  1QUQ B;  1OXX K;  2DUD A;  4UPA A;  4BBS G;  1I50 H;  3KJO A;  4JI6 L;  1HNZ L;  3ERS X;  3HOU G;  2XGT A;  2R6G A;  5C4X G;  1YHB A;  1Z9F A;  3I4O A;  2AWO A;  5EAY A;  1QVC A;  2CQO A;  5LMN Q;  4A3M H;  1PH4 A;  2NN6 G;  4PG3 A;  4DUZ Q;  4L5Q A;  5AJ3 L;  3PCO B;  1SFO H;  3HOV G;  1L0W A;  4B3T L;  4DUY L;  3CW2 C;  2JA9 A;  4DK6 C;  4DV5 L;  4Y7N H;  3HOX G;  1B70 B;  4B3R L;  1J6Q A;  1HJP A;  4DV6 Q;  1N34 Q;  4X62 Q;  1NY4 A;  2KBN A;  2ZTE A;  5IYC G;  2YTX A;  4DK3 C;  3PV0 A;  5ELO A;  3J80 c;  4NB3 A;  4X65 L;  2D0O A;  2UU9 Q;  4IPD A;  3J80 i;  2VW9 A;  1J5E L;  3EIV A;  3E9I A;  2OCE A;  3U58 A;  4HJ7 A;  2IY5 B;  1L1O A;  4TVA B;  1JT8 A;  2KEN A;  4OXP A;  1WCM H;  1NBW A;  1YZ6 A;  4GN3 B;  4AQY Q;  3ULP A;  1A63 A;  4UP7 A;  3PUV A;  4BBR H;  4LF6 L;  3NEM A;  3F8T A;  3W1B A;  2N8N A;  4A76 A;  4LFB Q;  1O7I A;  1X9N A;  1YEZ A;  3TRE A;  3TS2 A;  3BZC A;  1QZG A;  4GLX A;  1KQS A;  3I4M G;  1VQL A;  2ES2 A;  4LUO A;  2Q2I A;  1KHI A;  2N49 A;  4LFA L;  2D62 A;  4A3J G;  1JJG A;  5IWA L;  3K7A H;  3RNU A;  3VDY A;  1Q82 C;  1EYG A;  2KCM A;  3K80 C;  1TWH H;  1XPR A;  3GDE A;  4MNO A;  3GO5 A;  5LMN L;  4A3G G;  2LXJ A;  3KJP A;  3PGZ A;  4KLK A;  4YWK A;  1Y14 B;  3M4O H;  4DUZ L;  1C0A A;  2JK8 A;  4L5T A;  2JJQ A;  3CCS A;  2ID0 A;  4P75 A;  3CCU A;  5J3B A;  1X56 A;  1Q8K A;  1C7Y A;  3L0O A;  4JBK A;  1I6H H;  3SGI A;  4FDB A;  3L7Z C;  1OXT A;  1P8L A;  2IT1 A;  1WI5 A;  2VUM H;  4DV6 L;  1E24 A;  1HH2 P;  4LF9 Q;  3CME A;  1R9T H;  2R93 G;  2Z0S A;  4OO1 G;  4J15 A;  1V43 A;  4C2M H;  5IT9 c;  2UU9 L;  1WFQ A;  4DR4 Q;  1S40 A;  1GO3 E;  1Q1B A;  4JBW A;  4LNQ A;  2JA7 H;  4X6A H;  1G51 A;  5GAG C;  4AQY L;  3HOV H;  1L2F A;  4APV A;  3HKS A;  1YJ9 A;  1IBK Q;  4R4C A;  1E7Z A;  3I7F A;  5IY0 A;  4LFB L;  5M3M G;  3HOX H;  4LF4 Q;  3KOJ A;  3ICE A;  4NXN Q;  4A3B G;  1YHA A;  1HNX Q;  5IP9 G;  4A3B H;  1X3G A;  4A3D H;  3AEV A;  5IYC H;  1RIP A;  3HKZ G;  2PMZ E;  2BA0 A;  1YHQ A;  4LF7 Q;  1OTC A;  1EIY B;  1TWG H;  2FXQ A;  4A3E G;  4P72 A;  1IXR A;  3IRB A;  4KHZ A;  2NZH A;  1B7Y B;  2GVB A;  3UDG A;  1PA6 A;  2UUC Q;  3PO3 G;  1CUK A;  1CKO A;  2B3G A;  3CCL A;  4JYA Q;  4R1J A;  2Q2H A;  1P16 A;  3GTQ H;  4XIG S;  5C44 G;  2AWN A;  1EQR A;  1UEB A;  1VQ4 A;  5JJI A;  1HR0 W;  1VQN A;  3H3V I;  3S1Q H;  4JOI A;  4DUY Q;  5M5Y H;  4HJ8 A;  4B3S Q;  2KCT A;  4EQ5 A;  1LM0 A;  3W1G A;  4LF9 L;  4B3R Q;  4P71 A;  2HQL A;  1X3F A;  2I5M X;  1FGU A;  1VS0 A;  1HR0 Q;  2OQK A;  3CF5 A;  1UWV A;  1E1O A;  1VQE A;  4DR7 Q;  4JV5 Q;  1SRO A;  3I4N G;  4DR4 L;  4A3I H;  4XTC S;  5JJK A;  1X3E A;  2R7D A;  1U0L A;  1VQC A;  1VQJ A;  3S14 H;  1VCI A;  4IFD I;  3D0F A;  3U4V A;  2YTV A;  2IHF A;  3Q8D A;  3CCV A;  1IBK L;  2K5V A;  4YCV A;  1IBL Q;  2VZA A;  1BVS A;  4LF4 L;  4GN4 B;  3DLL A;  3B6Y A;  4NXN L;  3S1N H;  1JE5 A;  4GOP C;  3RZD H;  2CWA A;  2JE6 I;  1QVG A;  1Y1V H;  5IYB H;  1VQA A;  4DAM A;  4LF7 L;  2R93 H;  3E0E A;  3GTP H;  2K14 A;  4JG2 A;  4C3I H;  3F2B A;  2Y0S G;  3ZJY C;  1Q86 C;  3KFU A;  3A0J A;  3D31 A;  1PH2 A;  2PNH A;  4JCV E;  2WAQ G;  4RG1 A;  3A5Z B;  2UUC L;  4A3L H;  4JI4 Q;  4DV4 Q;  1X6O A;  3G48 A;  3KF6 A;  4L5S A;  4A93 G;  3G71 A;  1YJN A;  4JYA L;  3H0G H;  2MNA A;  1DGS A;  1T9H A;  3T1H Q;  2DGY A;  1WOC A;  3I56 A;  4AYB E;  5M3M H;  3PO2 H;  1SE8 A;  2R92 G;  5C3E G;  1KIX A;  5GQO A;  3UDX A;  3J7A 5;  3F1Z A;  4B3S L;  2WFW A;  1YBY A;  4A3F G;  4RMF A;  1I3Q H;  3GTM H;  2R7Z H;  2UXB Q;  3CP0 A;  1HR0 L;  2UXD Q;  3FKI H;  4JV5 L;  4DR7 L;  4OWW B;  3HOY G;  1S3O A;  1A8V A;  5M5X H;  2F3I A;  5FLX c;  1KXL A;  4C3J H;  1E22 A;  1N32 Q;  2YV5 A;  3GTK H;  1SMX A;  3BU2 A;  4P73 A;  4GOP A;  2A1A A;  1GM5 A;  2A19 A;  1L1O B;  1I5F A;  1IBL L;  1G6P A;  1Q46 A;  2B63 H;  3PSI A;  4JI1 Q;  2N3S A;  5IYD G;  2NVX H;  4JI7 Q;  2EXD A;  1SR3 A;  3BJU A;  3CCM A;  4LUV A;  4ME3 A;  2NZO A;  5HGQ A;  4OO1 I;  1MIU A;  1YNX A;  2WB1 E;  1VQM A;  2VQE Q;  3MEF A;  4R4T A;  3S2D H;  4YY3 L;  4DR1 Q;  1CKN A;  4QY7 A;  1Q12 A;  3KYH C;  4DV4 L;  1N9W A;  4JI4 L;  3PF5 A;  2UXC Q;  1VQ8 A;  4JC0 A;  3HOW H;  1NMG A;  3T1H L;  4DNI A;  1Y1W H;  2PQA B;  3LGJ A;  4A3K H;  5M3F G;  3ER0 A;  2ALY B;  1XJV A;  1PVO A;  1HZA A;  4UY8 C;  2VS1 A;  1EFW A;  3CC2 A;  3KF8 B;  4JI8 Q;  1PH1 A;  2JA6 G;  1D8L A;  2N78 A;  4DV1 Q;  4AH6 A;  3J7Z C;  2Z6K C;  2MO0 A;  2RHS B;  5DLQ E;  1EOV A;  1PYS B;  4AIM A;  3M4P A;  5E7N A;  2ZM6 Q;  2UXB L;  4A3C H;  2UXD L;  5IP7 H;  4DR5 Q;  1MJE A;  4BY7 G;  2JA5 G;  3HOZ G;  1XMO Q;  2UUB Q;  5C0X J;  4BBS H;  1W3S A;  1A62 A;  3UE0 A;  5FJ8 G;  4K0K L;  4HIO A;  2JA8 G;  1H95 A;  5C4X H;  3PIP A;  3HOU H;  1AH9 A;  2VY3 A;  1N32 L;  4JI5 L;  3G4S A;  1N8R C;  3GTG H;  4IFD J;  1K8G A;  4P74 A;  3CAM A;  1JB7 A;  2C35 B;  4HID A;  4GNX C;  4JI1 L;  3PIO A;  2CCZ A;  4JI7 L;  1ASY A;  4YCU A;  3PUW A;  1KRT A;  1KAW A;  2K75 A;  4BXX G;  3RLN A;  4MTN A;  4GKJ Q;  2GVA A;  1TWA H;  2VQE L;  3GTL H;  1XPU A;  3HOY H;  2K52 A;  3S17 H;  4DR1 L;  4PZ7 A;  1UE7 A;  3DM3 A;  1YIT A;  4KI0 A;  1PH8 A;  3S2H H;  1AE2 A;  1SLJ A;  1SRU A;  1N36 Q;  2LSS A;  3STB C;  3CCE A;  2KHI A;  3J81 j;  1OXU A;  1XTD A;  3BZK A;  2ZTD A;  3GTO H;  1D7Q A;  2UUA Q;  1VQH A;  5FLM G;  2KHJ A;  2NVT H;  4DKA C;  2Z6K A;  1FL0 A;  3S15 H;  2D0P A;  4JI2 L;  4JI8 L;  5IYD H;  4DV1 L;  1HZC A;  4O2D A;  3M9B A;  5JEA G;  2E5L Q;  2QGQ A;  4MZ9 A;  3I4M H;  1VQ5 A;  2ZM6 L;  2K50 A;  4A3J H;  4DR5 L;  1JMC A;  3M3Y H;  1XMO L;  2UUB L;  1IYJ B;  3AFP A;  4DR3 L;  3TEH B;  3NEL A;  5ELN A;  1XNQ Q;  3PUZ A;  4H02 A;  2F4V Q;  4A3G H;  3RR5 A;  2ATW A;  5LMU Q;  4GNX A;  1VQO A;  3UDF A;  2NN6 I;  5M3F H;  3RN2 A;  1WYD A;  1VQB A;  4DV7 Q;  1NJI C;  2OWO A;  3CMA A;  4L5R C;  1UE5 A;  2E8G A;  3KDF A;  4X64 Q;  4DV2 Q;  2IX0 A;  4IOA A;  4HIM A;  3RLO A;  3PUX A;  3HKZ E;  3RLF A;  1WCM G;  3OYY A;  4OWT B;  4GKJ L;  4AYB G;  3HOZ H;  2MO1 A;  3U4Z A;  1VQ9 A;  2JA8 H;  1VQD A;  1N36 L;  4YY3 Q;  4HIK A;  3CD6 A;  2PI2 E;  3EBE A;  1OXS C;  3RN5 A;  4YWM A;  1MJC A;  4IJL A;  1JJ2 A;  5BR8 Q;  2Q2T A;  1TXY A;  1VQ6 A;  1VQG A;  1MKH A;  3CPF A;  4JI3 Q;  2UUA L;  3KF6 B;  3NEN A;  4R4O A;  2VQF Q;  3TS0 A;  4QGU A;  1I94 Q;  5JEA J;  3CPW A;  1M1K C;  4DAY B;  1XNR Q;  4OX9 Q;  2HT1 A;  3WWV A;  2YU9 H;  3JC6 6;  2NVQ H;  2E5L L;  1L1O C;  5IP9 H;  4OON A;  4QIW E;  5H1S E;  2QA4 A;  4KHP Q;  4ALP A;  1LUZ A;  3A5U A;  3H15 A;  1HNW Q;  1UE1 A;  4R4I A;  2EQS A;  3M85 A;  2VUM G;  2MQH A;  1XNQ L;  4PZ6 A;  1EWI A;  4A3E H;  3F2D A;  2RHQ B;  1QUQ A;  3OTO Q;  2F4V L;  3PO3 H;  4DV3 Q;  3AYH B;  1YVC A;  5C0X G;  5LMU L;  4K0K Q;  2WB1 G;  4NXM L;  1LTL A;  4GKK Q;  3HFZ B;  5FLM H;  4DV7 L;  4JI5 Q;  1GD7 A;  2RCN A;  4X64 L;  4DV2 L;  4DR6 L;  5C44 H;  3CCQ A;  2JA7 G;  4IFD G;  2I0Q A;  3CC7 A;  2ZTC A;  3CQZ H;  4GOP B;  3E9H A;  4DV0 Q;  1PV4 A;  4HJA A;  2Y0S E;  5GRO A;  1XPO A;  1VQP A;  1YJW A;  4PZ8 A;  2WAQ E;  2ASB A;  1K3R A;  1FJG Q;  4A3D G;  3A74 A;  1CSP A;  3OW2 A;  1IZ6 A;  1PH9 A;  4LW1 A;  4QL5 A;  3I4N H;  3AQQ A;  4JBM A;  5BR8 L;  3CXC A;  1PYB A;  4POF A;  4OWX B;  3FHW A;  1CKN B;  3I2Z A;  3ULL A;  1S72 A;  1PH6 A;  4JI3 L;  2PI2 A;  2VL6 A;  1EIF A;  1QVF A;  2CKZ B;  4TQU S;  4NPS A;  5C4J H;  4YHH L;  2VQF L;  1I94 L;  1XNR L;  1LYL A;  1G29 1;  1XMQ Q;  1X65 A;  3T1Y Q;  4OX9 L;  2UXC L;  2LXK A;  2QEX A;  2AHO B;  2RF4 A;  4KHP L;  4JI2 Q;  1N33 Q;  1GKH A;  2ZJP A;  4QJF A;  1HNW L;  4LF5 Q;  3S16 H;  3NBH B;  1EQQ A;  1TWF H;  4X66 L;  4GS3 A;  3OTO L;  5M5W H;  3UE1 A;  1Q81 C;  1U5K A;  1E3P A;  4DV3 L;  4DR3 Q;  1PH3 A;  1VQK A;  2K5N A;  4YWL A;  4A93 H;  3GD7 A;  4WJ4 A;  4B3M Q;  4GKK L;  1V9P A;  4BY1 G;  1CKM A;  3CCJ A;  2PQA A;  2R7F A;  2BH8 A;  4A3I G;  4POG A;  2OTJ A;  2EIF A;  5GAH C;  3TQY A;  4EX5 A;  4IPC A;  1VQ7 A;  3S1M H;  4BA2 I;  2R92 H;  5C3E H;  4DV0 L;  1BBU A;  1OXV A;  3AFQ A;  4A75 A;  1B8A A;  2AMC B;  1X54 A;  4A3F H;  5K36 G;  3H3V H;  1HZB A;  3PF4 A;  2E2I H;  1N34 L;  1K0R A;  3I55 A;  1FJG L;  4X62 L;  5JJL A;  1RL2 A;  1Y1V G;  5IYB G;  2YTY A;  3ULJ A;  4LF8 Q;  3W5O A;  3KLW A;  3FP9 A;  4IJH A;  4JOI C;  1A0I A;  2OQ0 A;  3EN2 A;  1IBM Q;  4GLV B;  3JAM c;  1IL2 A;  3MXN B;  4LUZ A;  4O0A A;  1EUJ A;  3JAM i;  4A3L G;  4DPG A;  5HY6 A;  4JI0 Q;  4LFC Q;  1XMQ L;  3T1Y L;  3UDI A;  3H0G G;  4A3M G;  1Q7Y C;  3S1R H;  1N33 L;  1Z47 A;  2I5L X;  1KD1 C;  1K8A C;  3PO2 G;  1KL9 A;  4DR2 Q;  2HHH Q;  2AKW B;  1WJJ A;  4LF5 L;  2JQO A;  3TRZ A;  4HJ5 A;  2YYZ A;  3STB D;  2GN5 A;  4IPG A;  2NVY H;  2OTL A;  1PH5 A;  1NTG A;  1NE3 A;  5GAE C;  2R7Z G;  3K81 C;  2ZJR A;  3FKI G;  3PUY A;  4JBJ A;  4B3M L;  4R4Q A;  1NMF A;  1YIJ A;  1PHJ A;  1FVI A;  3K7U C;  2JEA I;  3RZO H;  4UP9 A;  3L2P A;  4JI6 Q;  4IPH A;  4NXM Q;  4GNX B;  1HNZ Q;  4IOC A;  4BA1 I;  2JA6 H;  1C9O A;  2IX1 A;  4DR6 Q;  1HZ9 A;  1YI2 A;  2Q2U A;  1PH7 A;  1VQI A;  3K8A A;  2F52 A;  3KDF B;  2WP8 J;  5AJ3 Q;  2K4K A;  3GTJ H;  4BBR G;  2B63 G;  1K83 H;  2ZJQ A;  4B3T Q;  3S24 A;  2A8V A;  2HIX A;  1W2B A;  1PFS A;  1ASZ A;  4BY7 H;  2JA5 H;  4DV5 Q;  4Y52 H;  1UE6 A;  1M90 C;  4LF8 L;  4YCW A;  5FJ8 H;  1X55 A;  5C0X I;  2VNU D;  1IBM L;  1JJC B;  4IO9 A;  4PMW A;  3M7N A;  2HIV A;  4BY1 H;  1AE3 A;  3F2C A;  3J81 c;  1TWC H;  2BA1 A;  3U50 C;  4C3H H;  1KC8 C;  4X65 Q;  1K9M C;  1BKB A;  4JI0 L;  4LFC L;  3J81 i;  1J5E Q;  3HOW G;  2L15 A;  4QQB X;  4YHH Q;  2CWP A;  1GVP A;  3CCR A;  1V1Q A;  3G6E A;  1Y1W G;  2K5H A;  4A3K G;  2E2H H;  2H5X A;  3M4Q A;  4BXX H;  2HHH L;  4DR2 L;  4LF6 Q;  1K73 C;  2IHE A;  1HNX L;  1E1T A;  4GN5 A;  1Q1E A;  2B29 A;  4WJ3 M;  2XTI A;  1KRS A;  2E2J H;  5IE8 A;  1CSQ A;  2BH2 A; 
#chains in the Genus database with same CATH topology
 5KYL A;  3GTP B;  3KBX A;  1ENF A;  1SN8 A;  2CFM A;  1BBW A;  4B08 A;  5IWA Q;  1STA A;  2MFI A;  3K0X A;  1QZH A;  2I5H A;  1F9S A;  2K5Q A;  1OXX K;  3IL8 A;  1HNZ L;  3ERS X;  2R6G A;  5LMN Q;  3SHL A;  5EAY A;  2K1B A;  1F9R A;  5JVH 3;  4H0L C;  4L5Q A;  2IX3 A;  2EJM A;  3HOV G;  1KLG D;  3PO2 B;  1C8C A;  3A55 A;  4DUY L;  2JA9 A;  2M00 A;  2Z4I A;  4DV6 Q;  1NY4 A;  4IUT A;  1JOK A;  1E2V A;  3PV0 A;  1EZ6 A;  3MHB A;  3J80 c;  1BXT A;  3D3R A;  4NB3 A;  2F0D A;  1TS4 A;  1J5E L;  3H91 A;  1XYI A;  4TVA B;  1M8A A;  3GTK B;  4OXP A;  1ILP A;  2O2L D;  4AQY Q;  2F0W A;  3NEM A;  3W1B A;  4LFB Q;  1O7I A;  1X9N A;  1YEZ A;  3TRE A;  3TS2 A;  2WV6 D;  3BZC A;  3I4M G;  3H09 A;  2F0U A;  5IWA L;  3DWQ A;  2KCM A;  3K80 C;  3GDE A;  2LS0 1;  3K0Y A;  5LMN L;  4KY5 A;  3KJP A;  3PGZ A;  4L5T A;  4X3S A;  3CCU A;  1BDO A;  5J3B A;  3OWF A;  4CJ2 C;  1C7Y A;  1I6H H;  1WD1 A;  1B50 A;  2JN4 A;  2EY1 A;  3L7Z C;  4ODG A;  1WI5 A;  4KTA A;  4DV6 L;  1HH2 P;  1RJT A;  4LF9 Q;  1R9T H;  4OO1 G;  1FGB D;  1V43 A;  2WAQ B;  5IT9 c;  1WFQ A;  2B8F A;  1GO3 E;  3GTG B;  2EYP A;  1JE4 A;  3D8G A;  4AQY L;  3A54 A;  3HOV H;  5DNF A;  4R4C A;  5C4H A;  3CKI B;  3NXW A;  3S1M B;  4LFB L;  3ICE A;  1U9R A;  3U9S A;  1HNX Q;  1CZW A;  2DJF C;  4QF4 A;  4LF7 Q;  2F0S A;  3S17 B;  1TII D;  4G7O C;  4P72 A;  1CI3 M;  2UUC Q;  1PDQ A;  2F0Q A;  2CHB D;  1CUK A;  1F2M A;  4U67 3;  2QIL A;  2PQE A;  1P16 A;  2KED A;  4XIG S;  1EQR A;  3IKJ A;  2EPB A;  4FF2 A;  4JOI A;  2F1M A;  3MFG A;  5K5P A;  1SMY D;  4EQ5 A;  5ELE A;  4LF9 L;  2NBF A;  4B3R Q;  1DZ1 A;  2HQL A;  1ET6 A;  1STY A;  1FGU A;  2I5M X;  1HR0 Q;  1VQE A;  4JV5 Q;  4DR7 Q;  2K5D A;  4K5X A;  5JJK A;  1D1K A;  2Z6B A;  1SNC A;  1VQJ A;  3S14 H;  1VCI A;  4HSP A;  3QOL A;  4KMU C;  1LT6 D;  4DK0 A;  3CCV A;  1RKN A;  2D2C C;  3Q8D A;  2CVR A;  2JA6 B;  1BVS A;  2L55 A;  4GN4 B;  4DK1 A;  3B6Y A;  2JE6 I;  1K83 B;  4LF7 L;  4OO1 H;  3GTP H;  3HOZ B;  1VDZ A;  1LTS D;  1Q86 C;  3KFU A;  2JA8 B;  4JCV E;  5IGF A;  1WTV A;  2WAQ G;  4A3L H;  3A5Z B;  2UUC L;  3DWP A;  2Q8I B;  3G71 A;  1YJN A;  2MNA A;  2NB0 A;  4DAY A;  4ZCK A;  1WOC A;  2R61 A;  4K14 A;  3PO2 H;  1CZG A;  3MA2 B;  1T5E A;  5C3E G;  2YU9 B;  5EPJ A;  2K6A A;  1DCZ A;  1JOQ A;  2E75 C;  2UXB Q;  2K01 A;  1HR0 L;  4JV5 L;  4DR7 L;  1A8V A;  3EVQ A;  2SEB D;  2C9O A;  2BE5 D;  4MHE A;  1PFB A;  3GTK H;  4E6I A;  1R4P B;  4P73 A;  1KDB A;  4DU9 A;  3NP8 A;  5C44 B;  4G4K A;  1Q46 A;  1U4R A;  2IJ0 A;  4BS9 A;  3RUZ A;  2FIN B;  2NZO A;  5HGQ A;  1MIU A;  1YNX A;  3S2D H;  1IW7 C;  2Q8R E;  3MEF A;  1LTI D;  5IOD A;  5L37 A;  4DR1 Q;  1MHW C;  2IW3 A;  3MAQ A;  3MEH A;  3BYT B;  2PQA B;  3QO2 A;  2ALY B;  3VR3 A;  2XNA C;  2HD3 A;  2JA6 G;  1QWY A;  1LO5 D;  1CQV A;  1SXT A;  4AH6 A;  1YNJ C;  1EYC A;  3NBH A;  5CV9 A;  3J81 L;  2RHS B;  4KK7 A;  2UXB L;  2ZM6 Q;  1BOS A;  3EQL C;  1XX8 A;  1YNN C;  3SK5 A;  5IP7 H;  4DR5 Q;  4A3C H;  1TWF B;  1LTT D;  2E76 C;  3HOZ G;  5C0X J;  3UE0 A;  2OEO A;  4QB4 A;  2JA8 G;  1SND A;  3PIP A;  1AH9 A;  1C4Q A;  4OEM B;  4JI5 L;  5I4D A;  1N8R C;  3GTG H;  2IPK D;  1K8G A;  3M4Y A;  3CAM A;  4P74 A;  2KEE A;  1SYB A;  4C3H G;  4L8J A;  2SNS A;  5KNC A;  1U4P A;  5CV5 A;  2C35 B;  2P5Z X;  1ASY A;  3PUW A;  1PLF A;  1KAW A;  2K75 A;  2G9D A;  2GA4 B;  2J4X A;  1LT5 D;  2JXM B;  4IUU A;  1FNU A;  1NUC A;  3S17 H;  2VUM B;  4DR1 L;  1A2U A;  3IAY A;  1UE7 A;  3URY A;  4H44 C;  1K3B C;  3DEO A;  1SRU A;  5EKL A;  4CBV A;  1N36 Q;  1QJO A;  1CA5 A;  1XTD A;  1B44 D;  4KD4 A;  1D7Q A;  2I46 A;  2UUA Q;  4FF4 A;  2BDN A;  3V2T A;  4FF3 A;  2D0P A;  5C3X A;  1F9P A;  3M9B A;  4IUP A;  1ONL A;  3X3N A;  4NMZ A;  4MZ9 A;  4ZKB B;  5J39 A;  2ZM6 L;  4A3J H;  4DR5 L;  4Q5V A;  4KN7 C;  3OOC A;  4Z9C B;  3H94 A;  2F4V Q;  4GNX A;  1ZKO A;  4HCE A;  1O7Y A;  1GHK A;  3RN2 A;  3RZO B;  1VQB A;  4K8I A;  4DV7 Q;  1IHZ A;  3SDZ A;  1NJI C;  2A74 C;  1UE5 A;  4IOA A;  2B2V C;  2A6E C;  3RLF A;  3OYY A;  3QOJ A;  1EOT A;  3I73 A;  2G9H D;  1A3T A;  4DGZ A;  4AYB G;  3HOZ H;  3S1Q B;  4BY7 B;  1QG7 A;  3BDL A;  2JA8 H;  1VQD A;  1N36 L;  1CHQ D;  4HIK A;  4OL7 A;  3HS0 C;  3RN5 A;  1H9J A;  5BR8 Q;  1BR9 A;  1MKH A;  1B3Q A;  4JI3 Q;  2N88 A;  2UUA L;  2VQF Q;  3TS0 A;  4G57 A;  1B1Z A;  3VA7 A;  4QGU A;  4DAY B;  2ENB A;  3WWV A;  1L0X B;  3EFX D;  2YU9 H;  5IP9 H;  2AUJ D;  5H1S E;  4OIK A;  3A5U A;  4GZY C;  1HNW Q;  1UE1 A;  1Z6H A;  3F2U A;  4R4I A;  3M85 A;  2VUM G;  2DY8 A;  2KCN A;  1A2T A;  2SOB A;  3PO3 H;  2F4V L;  3LWU A;  5C0X G;  4K0K Q;  1EY6 A;  1LTL A;  4GKK Q;  4DV7 L;  1I50 B;  5A35 A;  5EBD A;  5C44 H;  3H0G B;  4X3T A;  2EJF C;  1SAP A;  3KK7 A;  4DV0 Q;  1PV4 A;  1SFO B;  1HFN A;  1O80 A;  5GRO A;  3AMU A;  1FJG Q;  3A74 A;  1PH9 A;  4C56 C;  4BWG B;  5KEE A;  4LW1 A;  1UNS A;  5BR8 L;  1O7Z A;  3I2Z A;  3ULL A;  3E3X A;  4JI3 L;  2CKZ B;  4TQU S;  4NPS A;  2VQF L;  4KN4 C;  1DJR D;  2LXK A;  2QEX A;  1GKH A;  3K5N A;  2B63 B;  3C3L A;  1HNW L;  1HRJ A;  3NBH B;  1TWF H;  4X66 L;  2X6L A;  5EKI A;  2J7Z A;  4V19 0;  1VQK A;  1E3P A;  2OF1 A;  5A2Q L;  2CW0 D;  1H9R A;  4WJ4 A;  1Y8O B;  3NTI A;  4GKK L;  5TSS A;  1X3Q A;  1TS3 A;  1PTO D;  2EIF A;  3OWE B;  1PXU A;  3T13 A;  4DV0 L;  1X54 A;  5K36 G;  3H3V H;  1N34 L;  4X3U A;  2Z1C A;  1FJG L;  3ULJ A;  5C0X H;  4JOI C;  1IBM Q;  4C3I G;  2KOL A;  4MIU A;  2EY2 A;  4C2M B;  4LUZ A;  3JAM i;  2MUY A;  3VYS A;  3NPP A;  4KY6 A;  1H9M A;  2JA7 B;  4KY7 A;  3H0G G;  1Q7Y C;  1MBY A;  1TS2 A;  1K8A C;  4DR2 Q;  2AKW B;  4HJ5 A;  4N8X 1;  2EYH A;  1PH5 A;  3GTL B;  2R7Z G;  2ZJR A;  4ZLT F;  1TU2 B;  3RZO H;  5FLX E;  2DJG C;  4KKT A;  3C46 A;  1F77 A;  4GNX B;  4IOC A;  3MFY A;  2ZXO A;  1EWH A;  3GTO B;  2IX1 A;  4DR6 Q;  2Q2U A;  1PH7 A;  1AZP A;  5AJ3 Q;  3GTQ B;  2K4K A;  2B63 G;  2ZJQ A;  5DAU A;  2DN8 A;  5CV6 A;  1ASZ A;  4BY7 H;  2JA5 H;  4DV5 Q;  4Y52 H;  5M5Y B;  1UE6 A;  4YCW A;  5FJ8 H;  2M9V A;  1IBM L;  1S5F D;  2L4N A;  4M8A A;  1AE3 A;  1EFI D;  3F2C A;  3J81 c;  2BA1 A;  5ISR A;  1Q90 A;  2A6H D;  5COY A;  1WTH A;  4YHH Q;  2CWP A;  1GVP A;  4A3K G;  4BXX H;  3SR1 A;  4DR2 L;  1S5B D;  2IHE A;  3MVV A;  2QEJ C;  3S1N B;  1HUN A;  1KRS A;  1IL8 A;  1DOM A;  4M1U B;  3PIO 3;  4JW0 A;  4HJ9 A;  4LWC A;  2RQX A;  2KCC A;  3UI2 A;  5CYU A;  4LFA Q;  2R93 B;  1VQF A;  4UP8 A;  4GLA C;  1I50 H;  3HOU G;  3GV6 A;  3RD4 A;  3T53 B;  1Z9F A;  2AWO A;  1PH4 A;  2BE5 C;  5AJ3 L;  2QDB A;  3PCO B;  4R8I A;  1SFO H;  5M3M B;  3CW2 C;  3PQI A;  4DV5 L;  4QCL A;  1PMR A;  3K5L A;  1TVX A;  3NHH A;  1HTL D;  5IGG A;  4DK3 C;  3GTM B;  2D0O A;  5M5X B;  3J80 i;  3CU7 A;  3ULP A;  1YZ6 A;  1A63 A;  4UP7 A;  2B2W C;  3CQZ B;  4A76 A;  5CC4 A;  1JOR A;  4ZKC B;  1QZG A;  4GLX A;  1TS5 A;  2JYO A;  2Q2I A;  4LFA L;  2PO4 A;  3QG1 A;  2L1B A;  3E0J A;  1SYF A;  1Q82 C;  2K28 A;  1J8I A;  1XPR A;  4MNO A;  1MI2 A;  4A3G G;  2LXJ A;  5I2Y A;  1C0A A;  2JK8 A;  1A15 A;  2JJQ A;  5IGC A;  2ID0 A;  2PZU A;  3L0O A;  3SGI A;  1JWU D;  4FDB A;  1P8L A;  1PZJ D;  1R4Q B;  2PPB C;  1II3 A;  3CME A;  1K8O A;  2R93 G;  3FMC A;  4C2M H;  2HQE A;  4LNQ A;  4JBW A;  2JA7 H;  1WTX A;  5GAG C;  2RSN A;  1L2F A;  1YJ9 A;  3HKS A;  4FXD A;  2L12 A;  4KV6 A;  5IY0 A;  3K5O A;  5M3M G;  4LF4 Q;  3KOJ A;  4ID6 A;  5D14 A;  5JOB A;  1YHA A;  4A3F B;  4WFN 3;  4A3D H;  4I65 A;  2F0F A;  1OTC A;  3P1H A;  2KQ3 A;  3TZD A;  1AEX A;  4K2K A;  3S2H B;  3VYR A;  1IXR A;  4CDC C;  1F2Y A;  5KYI A;  2GVB A;  3NUC A;  5EQ0 A;  2NTT A;  1CKO A;  3A7A B;  2EVB A;  3ERQ A;  1KNA A;  3GTQ H;  5NUC A;  3S1R B;  1VQ4 A;  3H3V I;  2XRS D;  4DUY Q;  5M5Y H;  4B3S Q;  3I4M B;  1LM0 A;  4K5W A;  1ZYR D;  2FJ2 A;  3CF5 A;  3D6W A;  2F0I A;  3S9W A;  2B2U C;  3J80 E;  1VQC A;  1QOH A;  3MC0 B;  3U4V A;  5M3F B;  2IHF A;  2K05 A;  3TP7 A;  2VZA A;  4LF4 L;  1UAP A;  3S1N H;  5J22 A;  4GOP C;  2R93 H;  2K14 A;  2QF7 A;  1JQY D;  2M2L A;  1PH2 A;  2IL8 A;  3CRK C;  1X6O A;  4A93 G;  3KF6 A;  1XWE A;  1HPC A;  4TRD A;  4AYB E;  5M3M H;  3E6Z X;  1VF7 A;  1RD9 D;  4RKL A;  3UDX A;  3J7A 5;  4B3S L;  2WFW A;  4A3F G;  1U4L A;  2A73 B;  4RMF A;  3GTM H;  1EYD A;  3CP0 A;  2NZ1 D;  4OWW B;  2F0H A;  5M5X H;  2EYL A;  5IT9 E;  5DM6 3;  4RH6 A;  1KXL A;  1MSH A;  1NSN S;  3NWS A;  2YV5 A;  1SMX A;  2L0C A;  2A19 A;  1I5F A;  1ET9 A;  2N3S A;  4JI7 Q;  1BCP D;  3CCM A;  5D65 A;  4ME3 A;  4R4T A;  4YY3 L;  2F0K A;  2WAC A;  4HN7 A;  3PF5 A;  2EOT A;  2ZXP A;  1VQ8 A;  3P7J A;  5M3F G;  4NDX A;  4L6T B;  4RKB A;  1PVO A;  4EGV A;  2PNR C;  2VS1 A;  3CC2 A;  1S5C D;  2MO0 A;  4XXE A;  5DLQ E;  4AIM A;  3M4P A;  1CFM A;  2B8G A;  4NW2 A;  4ZRZ A;  5FKA C;  1XMO Q;  1A62 A;  5M5W B;  1H95 A;  5KRU A;  3G4S A;  4IFD J;  1B53 A;  2EYM A;  3J7Y W;  4JI7 L;  4YCU A;  5C3E B;  4IUN A;  4MTN A;  1PRT B;  1WD0 A;  1XPU A;  1YIT A;  3MXN A;  3S2H H;  1SLJ A;  3A8J E;  1FR3 A;  2RDG A;  3VR6 A;  3BZK A;  1CA6 A;  4RAU C;  2NVT H;  4DKA C;  2Z6K A;  3S15 H;  1FNW A;  2HDL A;  1EWC A;  4O2D A;  1ENA A;  5JEA G;  1TY2 A;  2RCF A;  3I4M H;  1B2T A;  3MTS A;  2K50 A;  1JMC A;  1XMO L;  1IYJ B;  4O42 A;  3CHB D;  3K6O A;  4CKE A;  1ESF A;  1E0B A;  1TQO A;  2ICI A;  5LMU Q;  5M3F H;  4I7A A;  3HZX A;  1WYD A;  2PZW A;  3V96 A;  3KDF A;  1SDF A;  3QB3 A;  3TZU A;  1WCM G;  1WTR A;  2EY6 A;  3NQI A;  4RHR A;  2MO1 A;  1EU3 A;  3U4Z A;  1JR0 D;  2ZXR A;  2L9H A;  2DNE A;  3N52 A;  2PI2 E;  1MJC A;  4IJL A;  2QDL A;  3SK8 A;  1VQG A;  3CPF A;  4C3H B;  1SBB B;  5G3L F;  3KF6 B;  3NEN A;  4HCS A;  1KDA A;  1I94 Q;  2HT1 A;  4OX9 Q;  5D3I B;  1BF4 A;  4KHP Q;  4O1N A;  1LUZ A;  3RZD B;  2EQS A;  4UAI A;  2MQH A;  4PZ6 A;  3F2D A;  2RHQ B;  1QUQ A;  1DD2 A;  3IFT A;  5LMU L;  1YVC A;  2WIN B;  2WB1 G;  4NXM L;  1IKL A;  4JI5 Q;  2RCN A;  3SK6 A;  2XVS A;  4IFD G;  3E9H A;  4HJA A;  2Y0S E;  2C5C A;  1XPO A;  1VQP A;  2D5D A;  1YJW A;  4Y7N B;  2G5D A;  1IZ6 A;  4G7H C;  4FYD A;  3CXC A;  4POF A;  2PI2 A;  4IZ8 A;  2RBM A;  3X3M A;  4P2C B;  4RGM A;  1SYG A;  1VF5 C;  3LX0 A;  4QUF A;  1I94 L;  5BN3 A;  1LYL A;  2Q8T A;  1X65 A;  1PZK D;  2WII B;  4OX9 L;  4KHP L;  1N33 Q;  2B2Y A;  4BBR B;  3BG3 A;  1NCV A;  4QJF A;  4AYB B;  2XN9 C;  1SYC A;  1BCP B;  1C48 A;  1DYQ A;  1HUM A;  1PRT C;  5M5W H;  3UE1 A;  3C1F A;  2CQA A;  1CT1 D;  1I4P A;  2MJ8 A;  3K7A B;  4FXG C;  4XQJ A;  1F2Z A;  3BVG A;  3CCJ A;  4A3I G;  1TWH B;  2TMP A;  1LV9 A;  2SNM A;  3HOW B;  1Y1W B;  3M4O B;  4XT3 B;  3S1M H;  2A69 D;  1I4X A;  5C3E H;  1BBU A;  1OXV A;  1BO0 A;  1G91 A;  4RWS C;  1Q3L A;  3I55 A;  4X62 L;  3NWT A;  5LHY 1;  5JJL A;  1RL2 A;  1D1I A;  1Y1V G;  5E4W C;  5IYB G;  3BDC A;  4LF8 Q;  1MSG A;  5FO8 B;  2L11 A;  3W5O A;  4IJH A;  3FP9 A;  3VR2 A;  1A0I A;  2I07 B;  1XTC D;  3MXN B;  4DPG A;  2F3W A;  3NTH A;  5HY6 A;  4IFD H;  4LFC Q;  4XQQ A;  1S4Z A;  1V8Q A;  1N33 L;  1IYV A;  5T1G A;  4S3S A;  1KD1 C;  1B4O A;  1KL9 A;  2HHH Q;  4K6D A;  5FLX L;  2F0E A;  3HOX B;  4IPG A;  2VB2 X;  4LK1 C;  1NTG A;  2O5J C;  2E74 C;  1V1P A;  3SVM A;  3FKI G;  3TSS A;  4JBJ A;  1ESR A;  4R4Q A;  1YIJ A;  1ZYR C;  2B39 A;  2R3Z A;  4IPH A;  4C3J G;  1SSO A;  1X32 A;  2BCO A;  2O4X A;  1JB3 A;  2K33 A;  2JA6 H;  1C9O A;  3BZD B;  4RGT A;  3KDF B;  3AU7 A;  2WP8 J;  4ZK9 B;  3NTK A;  5CBA E;  3NK9 A;  4BBR G;  1K83 H;  1AN8 A;  1LTB D;  1PFS A;  2EJG C;  4LF8 L;  1W6K A;  1D5Z C;  1K9M C;  4MTK A;  4C3H H;  1BKB A;  4LFC L;  3T56 B;  3J81 i;  3K57 A;  2PW5 A;  3HOW G;  2L15 A;  3LNN A;  3CCR A;  1Y1W G;  4RHS A;  3G6J B;  2HHH L;  5JAV A;  3KUP A;  4LF6 Q;  1E1T A;  4PNY A;  3OSO A;  1RDP D;  1CSQ A;  4OHJ A;  2BH2 A;  3CC4 A;  2RVL A;  4X66 Q;  2F0M A;  2NYZ D;  4A4I A;  5LMN W;  1DM0 B;  4C3I B;  4BBS G;  1QUQ B;  2DUD A;  3KJO A;  1EQV A;  5C4X G;  2XGT A;  1YHB A;  2XIW A;  1QVC A;  3R2I A;  4EVO A;  2NN6 G;  4PG3 A;  4DUZ Q;  2EY5 A;  1Y69 U;  4YIJ A;  2BOS A;  2V4D A;  1L0W A;  4K8J A;  5E4X A;  4A3B B;  4FNF A;  4Y7N H;  3HOX G;  3LWE A;  1J6Q A;  1SNP A;  1N34 Q;  4DAP A;  1RHP A;  5IYC G;  2ZTE A;  1NAP A;  2YTX A;  2R7Z B;  1BCP C;  3HRZ C;  1B9N A;  3OIP A;  4ME5 A;  4TKO B;  3QWN A;  2UU9 Q;  4KHV A;  2VW9 A;  3EIV A;  3E9I A;  5I9O A;  3ZYY X;  4HJ7 A;  1L1O A;  2KEN A;  3PUV A;  3I70 A;  4BBR H;  3MXG A;  5KNB A;  4LF6 L;  3F8T A;  2N8N A;  4NKL A;  2NUC A;  1HFG A;  1KQS A;  1VQL A;  2ES2 A;  1KHI A;  1ZXT A;  2D62 A;  2RDH A;  3H3V C;  1F2L A;  3K7A H;  1EIH A;  4ZUI A;  3VDY A;  1EYG A;  1TWH H;  4OIJ A;  3ERO A;  4KLK A;  1Y14 B;  2MGS A;  1HA5 A;  3R2T A;  4DUZ L;  3M4O H;  2FHT A;  3KF8 A;  4TSS A;  4A3K B;  1X56 A;  4RA8 A;  1CHP D;  1Q8K A;  2F0L A;  2IT1 A;  2KVM A;  2VUM H;  1E24 A;  2Y0S B;  1EY4 A;  3Q23 A;  1QB5 D;  2Z0S A;  2F0P A;  3I3C A;  2UU9 L;  2O5I C;  1PFN A;  4UHV A;  3HOU B;  5JVG 3;  1G51 A;  1GOZ A;  4APV A;  1IBK Q;  3EJI A;  5JPM C;  3HOX H;  4NXN Q;  4A3B G;  3AB9 A;  5IYC H;  1YHQ A;  1TWA B;  1EIY B;  2FXQ A;  4X3K A;  1V1P B;  4A3E G;  1SMY C;  5LL6 X;  5ELF A;  3IRB A;  4KHZ A;  3UDG A;  1B7Y B;  1PA6 A;  1G6Z A;  3CCL A;  4JYA Q;  4R1J A;  3A8K E;  1UEB A;  2F03 A;  1DON A;  3J80 L;  1HR0 W;  5JJI A;  5EJW A;  3WDN A;  3S1Q H;  4HJ8 A;  2KCT A;  1KAB A;  3W1G A;  4QUC A;  2PYK A;  4P71 A;  1X3F A;  1VS0 A;  2OQK A;  5M9O A;  1E1O A;  3I4N G;  3GP7 A;  4FO2 A;  1X3E A;  4A3G B;  4IFD I;  3HG9 A;  3D0F A;  2J0T D;  2YTV A;  3T51 B;  1IBK L;  2HDM A;  2K5V A;  4DXF A;  1JIC A;  1IBL Q;  5K36 H;  2RA4 A;  3DLL A;  4NXN L;  1KLU D;  5CV4 A;  2FFK B;  1J9O A;  1VQA A;  1M4V A;  3DM1 A;  3E0E A;  4DAV A;  2B2T A;  4JG2 A;  4C3I H;  2Y0S G;  3ZJY C;  1KAA A;  1GXD C;  3D31 A;  4RG1 A;  5BN4 A;  3G48 A;  1H9K A;  4JYA L;  1A3V A;  3H0G H;  1DGS A;  4N9P A;  3I56 A;  3OW7 A;  3HP3 A;  1WTW A;  1SE8 A;  2BDO A;  2NWG A;  1LT3 D;  2KA7 A;  4F87 A;  5IT9 L;  2R92 G;  2NVQ B;  3F1Z A;  3FPU B;  1X3P A;  3A7L A;  2R7Z H;  1KTK A;  1SNO A;  1WTP A;  3QJY A;  3I8Z A;  3JAM E;  5FLX c;  2RKS A;  4XYO A;  1LTG D;  3BU2 A;  1GM5 A;  1IBL L;  1L1O B;  4C1N I;  2B63 H;  1NR2 A;  3PSI A;  4JI1 Q;  5IYD G;  4DXG A;  1G2S A;  1SR3 A;  2WB1 E;  2WKC A;  4PMC A;  3OMC A;  4QY7 A;  1Q12 A;  3KYH C;  1N9W A;  3FDT A;  2MHV A;  1B3A A;  2XSC A;  4JC0 A;  3FPP A;  4KD3 A;  1NMG A;  3LGJ A;  4C1N K;  4A3K H;  3ER0 A;  3TME A;  1HHV A;  1SNM A;  5EGT A;  4V0B A;  2AQ3 B;  1KNE A;  4UY8 C;  1EFW A;  4HMJ A;  3KF8 B;  4JI8 Q;  3BVM A;  1PH1 A;  1D8L A;  5HUR A;  3D4R A;  4KJN A;  1EOV A;  2PCF B;  5E7N A;  3S16 B;  1MJE A;  2UUB Q;  1GJX A;  1AP0 A;  1DOK A;  1JCK B;  3HOU H;  4A93 B;  4DF7 A;  4K5V A;  1PRT F;  3NQT A;  2K04 A;  1YNJ D;  4PMB A;  1JB7 A;  1RF2 D;  1PTO B;  2XWJ B;  4U68 A;  4GNX C;  4JI1 L;  1LT4 D;  3PIO A;  2CCZ A;  4IUV A;  1KRT A;  3BS1 A;  4GKJ Q;  3VR4 A;  1CK1 A;  4ZYS A;  2GVA A;  2E2I B;  1TWA H;  3GTL H;  3I90 A;  3J7A F;  1CQF A;  2RSO A;  3DM3 A;  1VMP A;  4KI0 A;  2E2D C;  1PH8 A;  1AE2 A;  1NNX A;  5IGB A;  3CCE A;  2SDF A;  3J81 j;  1OXU A;  4HTH A;  1OO9 B;  3DMU A;  1PYW D;  3GTO H;  1LTR D;  1VQH A;  3CRL C;  4IUQ A;  4OGQ C;  1CM9 A;  3OHX C;  2H4O A;  4JI8 L;  4JI2 L;  5IYD H;  2VXW A;  1HZC A;  3KLR A;  2QW7 A;  4RGO S;  5ELD A;  2E5L Q;  3MZ5 A;  2QGQ A;  3VYU A;  3J7A V;  1VQ5 A;  2UUB L;  4FF1 A;  3AFP A;  4DR3 L;  3NEL A;  5ELN A;  1XNQ Q;  2A68 D;  5D3D A;  4RGN A;  4A3G H;  1VQO A;  3UDF A;  2KEC A;  2NN6 I;  1CTM A;  2L5T A;  4WJW A;  1L0Y B;  4L5R C;  2E8G A;  4DV2 Q;  2IX0 A;  4HIM A;  3P75 A;  3A56 A;  3PUX A;  3HKZ E;  1Y8P B;  4OWT B;  4GKJ L;  3GTJ B;  1BBX C;  3I4L A;  5JJZ A;  2EDG A;  2F0J A;  1VQ9 A;  3W2D A;  1STB A;  4YY3 Q;  3BVZ A;  3CD6 A;  3WOE A;  1OXS C;  2Q2T A;  1SYD A;  1TXY A;  1ROD A;  1VQ6 A;  2HCC A;  2LY7 A;  3S14 B;  2K03 A;  4R4O A;  3SEB A;  5FOB B;  1UUP A;  5JEA J;  1XNR Q;  1M1K C;  2E2H B;  2NVQ H;  3JC6 6;  2E5L L;  1ENC A;  1L1O C;  1Y8N B;  4QIW E;  2QA4 A;  5IGD A;  1HQR D;  3Q22 A;  1SE4 A;  5EBC A;  2E2J B;  3BYY B;  3M3Y B;  2PW7 A;  1XNQ L;  4EQP A;  3OTO Q;  4DV3 Q;  3AYH B;  4PQX A;  2B2V A;  1S5E D;  2H1E A;  5C4Z A;  1GD7 A;  5IOC A;  4DV2 L;  3CCQ A;  4CKB A;  4A3M B;  3CC7 A;  5KGU A;  2ZTC A;  3CQZ H;  4HR7 B;  2HUG A;  2K32 A;  1FNV A;  1ILQ A;  3NSW A;  1K3R A;  2AQ2 B;  4CJ1 B;  4QL5 A;  3TN2 A;  3AQQ A;  3SE0 A;  4OWX B;  2LMC B;  4FXK C;  1QVF A;  1BCP F;  4EQN A;  3K59 A;  2CW0 C;  2Z9H A;  1XNR L;  1G29 1;  1XMQ Q;  3T1Y Q;  1WCM B;  2RF4 A;  2X6G A;  1PTO C;  2ZJP A;  5E1F A;  3M7G A;  4IAL A;  4LF5 Q;  3S16 H;  1HTP A;  4RFB A;  4ZUJ A;  3OTO L;  3S2D B;  1U5K A;  1V1O A;  4DV3 L;  3O13 A;  4ABN A;  2K5N A;  1GUT A;  4A93 H;  3GD7 A;  5BN5 A;  1V9P A;  2PQA A;  2R7F A;  2BH8 A;  4POG A;  5GAH C;  3TQY A;  1PTO H;  4DA2 A;  4EX5 A;  3FRP B;  3R93 A;  3T4A C;  4A75 A;  4CJ0 B;  2AMC B;  4A3F H;  1HZB A;  3G7L A;  1HQM C;  4ILW A;  2E2I H;  1K0R A;  4XYQ A;  1EYA A;  1TT2 A;  4K6L A;  4FP5 D;  1IL2 A;  2WB1 B;  4O0A A;  4H7B A;  4A3L G;  2EE1 A;  1XMQ L;  3T1Y L;  3UDI A;  4A3M G;  5IIF A;  3S1R H;  1Z47 A;  2I5L X;  1DXM A;  3PO2 G;  3PMF A;  4DFA A;  4LF5 L;  1SJH D;  1I4Q A;  2JQO A;  5T1I A;  5J1Z A;  4DNT B;  3STB D;  1RTO A;  2HCI A;  2CH4 A;  1NE3 A;  5GAE C;  3PUY A;  3Q0A A;  1TWG B;  1NMF A;  1AW7 A;  2PZT A;  2JSO A;  1FVI A;  2B2T C;  2JEA I;  1O7L A;  4JI6 Q;  4NXM Q;  1G2T A;  4XQN A;  3D4W A;  4BA1 I;  2MPM A;  1LAB A;  3K8A A;  2F52 A;  1W6J A;  2KUM A;  2A6H C;  3GTJ H;  4B3T Q;  2HIX A;  4HAE A;  4A3J B;  4DNR B;  1EZ8 A;  1X55 A;  3NBI A;  4J1M A;  2VNU D;  2CH4 W;  1JJC B;  1QIL A;  4PMW A;  2HIV A;  1GUS A;  1GUO A;  4A3I B;  4X65 Q;  4JVZ A;  3KBG A;  3ONA B;  1QNK A;  3PIP 3;  2N55 A;  4QQB X;  5KIX A;  2E2H H;  3G6E A;  4F7X A;  2K5H A;  5KND A;  2H5X A;  2JP1 A;  1HNX L;  5DEH A;  4GN5 A;  5G3L D;  1Q1E A;  1SJE D;  3E5S A;  2XTI A;  2E2J H;  1DOL A;  5IE8 A;  3M3Y H;  1Y1V B;  3SXH A;  5ELB A;  5GAD C;  4N8F A;  4Q0F A;  4CDD C;  2V1C C;  4A3C G;  5IP7 G;  3I91 A;  1TR5 A;  4LAA A;  2Z8L A;  2JEB I;  4UPA A;  4JI6 L;  1QCB D;  1MGS A;  3I4O A;  4A3M H;  2CQO A;  1I6V C;  5JEA H;  1EY5 A;  4B3T L;  5JPN C;  3ND9 A;  4DK6 C;  1B70 B;  1D6E C;  3HKZ B;  4B3R L;  1HJP A;  5COR A;  2AUK A;  1I3Q B;  4R8N A;  2KBN A;  4X62 Q;  3FKI B;  5ELO A;  4R9W A;  4CDE C;  4JPB W;  3PO3 B;  1LAC A;  4X65 L;  4IPD A;  2OCE A;  1EY7 A;  3U58 A;  4C3J B;  2IY5 B;  1JT8 A;  1WCM H;  1NBW A;  2F0O A;  4GN3 B;  5CV7 A;  5EPK A;  2F0G A;  4XT1 B;  3GQB A;  2NVX B;  2ICE C;  4LUO A;  2N49 A;  4QIW B;  5I9P A;  4A3J G;  1JJG A;  1EEI D;  1NR4 A;  3ND8 A;  1STG A;  4J6H A;  3RNU A;  3W3A A;  1JC7 A;  2X69 A;  3GO5 A;  1WTQ A;  5C5L A;  4YWK A;  3V05 A;  2D9U A;  3CCS A;  4P75 A;  4EQO A;  1D5X C;  1K0S A;  3D6C A;  4JBK A;  1OXT A;  4QMG A;  2NTS A;  4J15 A;  4BBS B;  4DR4 Q;  1S40 A;  2B2W A;  5C4X B;  5FO7 B;  1Q1B A;  4X6A H;  4N9T A;  3N6R A;  1JOO A;  3R8B A;  1E7Z A;  3I7F A;  2FMM A;  3Q24 A;  3C1E A;  3TDQ A;  5IP9 G;  1X3G A;  2F3V A;  3AEV A;  1RIP A;  3BDO A;  2PMZ E;  2BA0 A;  3HKZ G;  5CR3 A;  3HOY B;  4KKU A;  1TWG H;  3L3O C;  3PO3 G;  1Q8I A;  2NZH A;  1ICW A;  2B3G A;  2A68 C;  2Q2H A;  4CGY B;  2FMC A;  5C44 G;  2AWN A;  3MWY W;  5E3F A;  4IUR A;  1VQN A;  3TBI B;  1Z7T A;  1WVL A;  4KJO A;  1UWV A;  1SRO A;  4DR4 L;  5IGE A;  4A3I H;  4XTC S;  2R7D A;  1U0L A;  4PV1 C;  3DXJ C;  3Q6S A;  2KJX A;  5DM7 3;  2AQ1 B;  3MXU A;  4I7Z C;  4WRD A;  4YCV A;  1B9M A;  4G7Z C;  2DY7 A;  2EYF A;  1MD2 D;  4H13 C;  1JE5 A;  3RZD H;  2CWA A;  4LMQ D;  1QVG A;  1Y1V H;  5C6A A;  5IYB H;  1AZQ A;  4DAM A;  2JA5 B;  3F2B A;  1S5D D;  3A0J A;  1VMC A;  2PNH A;  1ML0 D;  4JI4 Q;  4DV4 Q;  4L5S A;  2K7V A;  5FK9 C;  4IN3 A;  3MXP A;  1T9H A;  3T1H Q;  2DGY A;  1BQQ T;  3JAM L;  5GQO A;  1E2W A;  2VB3 X;  5CV8 A;  4B9X A;  1YBY A;  4ZAI A;  4MN3 A;  2ZT9 C;  1I3Q H;  4CHT B;  3EA6 A;  2B2U A;  4OEL B;  2UXD Q;  3FKI H;  3HOY G;  2OT2 A;  1S3O A;  5AFW A;  4A3E B;  3TP6 A;  2F3I A;  4UDU C;  1K28 A;  4C3J H;  2RDF A;  1E22 A;  1F9Q A;  1N32 Q;  4KKS A;  3VYT A;  4GOP A;  2A1A A;  2Z4H A;  1G6P A;  3L9A X;  3VA5 A;  1RTN A;  2NVX H;  2MP1 A;  2A5H A;  2EXD A;  3OIQ A;  3BJU A;  5CGK A;  4LUV A;  1EQT A;  1SE3 A;  4OO1 I;  1VQM A;  1EIG A;  1FYC A;  5FO9 B;  2VQE Q;  1SEB D;  1I4R A;  1CKN A;  3I4N B;  4JI4 L;  4DV4 L;  4HED A;  4K2L A;  4XDX A;  3HOW H;  3T1H L;  4DNI A;  1Y1W H;  5HGT A;  1XJV A;  3VR5 A;  5C4J B;  1RCV D;  1HZA A;  3TRZ A;  4DV1 Q;  2N78 A;  3J7Z C;  2Z6K C;  2EYO A;  1PYS B;  1EY0 A;  2UXD L;  1PTO F;  4BY7 G;  1BUV T;  2F4I A;  4NP5 A;  2JA5 G;  4B9W A;  4BBS H;  1W3S A;  5FJ8 G;  4K0K L;  4HIO A;  2QKI C;  3ITP A;  5C4X H;  2VY3 A;  1N32 L;  3J81 E;  1U4M A;  2NN6 H;  1KDC A;  1PFM A;  4HID A;  2R92 B;  1GUW A;  1JWS D;  4BXX G;  3RLN A;  1EEF D;  2VQE L;  3HOY H;  2K52 A;  3DWA A;  4PZ7 A;  2LSS A;  3STB C;  1EY8 A;  2KHI A;  1GUG A;  2ZTD A;  3C2P A;  1STH A;  2LKV A;  2KHJ A;  3FVQ A;  5FLM G;  1FL0 A;  2EYJ A;  1QNU A;  4DV1 L;  1AFP A;  2TSS A;  5LL6 S;  1LLR D;  1HCZ A;  3TP8 A;  3DUZ A;  4A3D B;  2XWB B;  2DNC A;  2NVY B;  3TEH B;  4J8Q A;  3PUZ A;  4LJZ C;  4H02 A;  3RR5 A;  2KHS A;  2ATW A;  1HA6 A;  2OWO A;  2XRQ D;  3CMA A;  4X64 Q;  3OPO A;  3RLO A;  2F0N A;  5EKK A;  4WOR A;  1A6X A;  3QIA A;  4RCO A;  3KLS X;  3K58 A;  2F0V A;  1JJ2 A;  3EBE A;  4YWM A;  2PMZ B;  4BY1 B;  1IYU A;  1E2Z A;  1H9S A;  1TWC B;  1TKW B;  1IKM A;  1G8Z D;  3NE5 B;  2F0T A;  3CPW A;  2UXC Q;  4A3B H;  1A3U A;  4OON A;  4ALP A;  3OMG A;  3WOF A;  3H15 A;  1LTA D;  5I6Y A;  2B2Y C;  1EWI A;  4A3E H;  1EY9 A;  1PZI D;  1GHJ A;  3T16 A;  5I6W A;  3HFZ B;  5FLM H;  4X64 L;  4DR6 L;  2JA7 G;  5EPL A;  2I0Q A;  3HGB A;  4GOP B;  1I4H A;  4PZ8 A;  2WAQ E;  2QCP X;  3I72 A;  2ASB A;  4A3D G;  3OW2 A;  1CSP A;  3I4N H;  2K5W A;  1XXG A;  4JBM A;  4CDF C;  1PYB A;  1S72 A;  1PH6 A;  3FHW A;  1CKN B;  3DEP A;  2LFN A;  1EIF A;  1GUN A;  2VL6 A;  3RMH A;  5C4J H;  4YHH L;  5F2D A;  1QE6 A;  1SNQ A;  3K5M A;  2UXC L;  2AHO B;  4JI2 Q;  1IW7 D;  2OXP A;  4ULL A;  4F8M A;  2A69 C;  1EQQ A;  1JWM D;  4HSV A;  4JK1 C;  4HMI A;  4GS3 A;  3IFD A;  2IWH A;  1Q81 C;  4DR3 Q;  3QR8 A;  1PH3 A;  1UEA B;  4YWL A;  5CBE E;  1T5X D;  4B3M Q;  4BY1 G;  1CKM A;  2OTJ A;  3D4D A;  1ZEQ X;  4IPC A;  5C3W A;  1STN A;  1VQ7 A;  4BA2 I;  2R92 H;  5A2Q E;  1STE A;  1YNN D;  3AFQ A;  1B8A A;  1PRT D;  1SYE A;  3PF4 A;  2EXZ A;  1I6H B;  5ELC A;  1D5M C;  4L63 B;  2YTY A;  3KLW A;  5CMD A;  3EN2 A;  2OQ0 A;  1R9T B;  4GLV B;  3JAM c;  1EUJ A;  4JI0 Q;  3H6M A;  4IQZ A;  3HOV B;  1EU4 A;  5C5M A;  4FVM A;  3KLS A;  1WJJ A;  1TY0 A;  3GV3 A;  2YYZ A;  2OTL A;  2GN5 A;  2NVY H;  1I4G A;  3DHQ A;  3K81 C;  1D2B A;  4B3M L;  5I2X A;  1FD7 D;  3K7U C;  1PHJ A;  4UP9 A;  3L2P A;  1HNZ Q;  3SK4 A;  4RCN A;  1HZ9 A;  1YI2 A;  1HXY D;  2NVT B;  1VQI A;  4CKC A;  3P20 A;  3S15 B;  4F88 A;  3U9O A;  2A8V A;  3R3O A;  3S24 A;  1K8M A;  1BNZ A;  1W2B A;  1M90 C;  3FEW X;  5C0X I;  3TP5 A;  4IO9 A;  3M7N A;  4BY1 H;  1TWC H;  2A6E D;  3U50 C;  1KC8 C;  4JI0 L;  1J5E Q;  1EL0 A;  1ICF B;  1H9S B;  1V1Q A;  2EZV A;  3M4Q A;  4DN4 M;  1SE2 A;  1K73 C;  3A8I E;  1O78 A;  2B29 A;  4WJ3 M;  3HEJ A;  1WTO A;  1KIX A;  4ZQ3 A;  2WKD A; 
#chains in the Genus database with same CATH homology
 3CC4 A;  4HJ9 A;  5GAD C;  4LWC A;  4X66 Q;  4LFA Q;  4A4I A;  2V1C C;  5LMN W;  5IP7 G;  4A3C G;  1SN8 A;  1VQF A;  1BBW A;  2CFM A;  5IWA Q;  4UP8 A;  2MFI A;  3K0X A;  4GLA C;  2I5H A;  2JEB I;  1QZH A;  1QUQ B;  1OXX K;  2DUD A;  4UPA A;  4BBS G;  1I50 H;  3KJO A;  4JI6 L;  1HNZ L;  3ERS X;  3HOU G;  2XGT A;  2R6G A;  5C4X G;  1YHB A;  1Z9F A;  3I4O A;  2AWO A;  5EAY A;  1QVC A;  2CQO A;  5LMN Q;  4A3M H;  1PH4 A;  2NN6 G;  4PG3 A;  4DUZ Q;  4L5Q A;  5AJ3 L;  3PCO B;  1SFO H;  3HOV G;  1L0W A;  4B3T L;  4DUY L;  3CW2 C;  2JA9 A;  4DK6 C;  4DV5 L;  4Y7N H;  3HOX G;  1B70 B;  4B3R L;  1J6Q A;  1HJP A;  4DV6 Q;  1N34 Q;  4X62 Q;  1NY4 A;  2KBN A;  2ZTE A;  5IYC G;  2YTX A;  4DK3 C;  3PV0 A;  5ELO A;  3J80 c;  4NB3 A;  4X65 L;  2D0O A;  2UU9 Q;  4IPD A;  3J80 i;  2VW9 A;  1J5E L;  3EIV A;  3E9I A;  2OCE A;  3U58 A;  4HJ7 A;  2IY5 B;  1L1O A;  4TVA B;  1JT8 A;  2KEN A;  4OXP A;  1WCM H;  1NBW A;  1YZ6 A;  4GN3 B;  4AQY Q;  3ULP A;  1A63 A;  4UP7 A;  3PUV A;  4BBR H;  4LF6 L;  3NEM A;  3F8T A;  3W1B A;  2N8N A;  4A76 A;  4LFB Q;  1O7I A;  1X9N A;  1YEZ A;  3TRE A;  3TS2 A;  3BZC A;  1QZG A;  4GLX A;  1KQS A;  3I4M G;  1VQL A;  2ES2 A;  4LUO A;  2Q2I A;  1KHI A;  2N49 A;  4LFA L;  2D62 A;  4A3J G;  1JJG A;  5IWA L;  3K7A H;  3RNU A;  3VDY A;  1Q82 C;  1EYG A;  2KCM A;  3K80 C;  1TWH H;  1XPR A;  3GDE A;  4MNO A;  3GO5 A;  5LMN L;  4A3G G;  2LXJ A;  3KJP A;  3PGZ A;  4KLK A;  4YWK A;  1Y14 B;  3M4O H;  4DUZ L;  1C0A A;  2JK8 A;  4L5T A;  2JJQ A;  3CCS A;  2ID0 A;  4P75 A;  3CCU A;  5J3B A;  1X56 A;  1Q8K A;  1C7Y A;  3L0O A;  4JBK A;  1I6H H;  3SGI A;  4FDB A;  3L7Z C;  1OXT A;  1P8L A;  2IT1 A;  1WI5 A;  2VUM H;  4DV6 L;  1E24 A;  1HH2 P;  4LF9 Q;  3CME A;  1R9T H;  2R93 G;  2Z0S A;  4OO1 G;  4J15 A;  1V43 A;  4C2M H;  5IT9 c;  2UU9 L;  1WFQ A;  4DR4 Q;  1S40 A;  1GO3 E;  1Q1B A;  4JBW A;  4LNQ A;  2JA7 H;  4X6A H;  1G51 A;  5GAG C;  4AQY L;  3HOV H;  1L2F A;  4APV A;  3HKS A;  1YJ9 A;  1IBK Q;  4R4C A;  1E7Z A;  3I7F A;  5IY0 A;  4LFB L;  5M3M G;  3HOX H;  4LF4 Q;  3KOJ A;  3ICE A;  4NXN Q;  4A3B G;  1YHA A;  1HNX Q;  5IP9 G;  4A3B H;  1X3G A;  4A3D H;  3AEV A;  5IYC H;  1RIP A;  3HKZ G;  2PMZ E;  2BA0 A;  1YHQ A;  4LF7 Q;  1OTC A;  1EIY B;  1TWG H;  2FXQ A;  4A3E G;  4P72 A;  1IXR A;  3IRB A;  4KHZ A;  2NZH A;  1B7Y B;  2GVB A;  3UDG A;  1PA6 A;  2UUC Q;  3PO3 G;  1CUK A;  1CKO A;  2B3G A;  3CCL A;  4JYA Q;  4R1J A;  2Q2H A;  1P16 A;  3GTQ H;  4XIG S;  5C44 G;  2AWN A;  1EQR A;  1UEB A;  1VQ4 A;  5JJI A;  1HR0 W;  1VQN A;  3H3V I;  3S1Q H;  4JOI A;  4DUY Q;  5M5Y H;  4HJ8 A;  4B3S Q;  2KCT A;  4EQ5 A;  1LM0 A;  3W1G A;  4LF9 L;  4B3R Q;  4P71 A;  2HQL A;  1X3F A;  2I5M X;  1FGU A;  1VS0 A;  1HR0 Q;  2OQK A;  3CF5 A;  1UWV A;  1E1O A;  1VQE A;  4DR7 Q;  4JV5 Q;  1SRO A;  3I4N G;  4DR4 L;  4A3I H;  4XTC S;  5JJK A;  1X3E A;  2R7D A;  1U0L A;  1VQC A;  1VQJ A;  3S14 H;  1VCI A;  4IFD I;  3D0F A;  3U4V A;  2YTV A;  2IHF A;  3Q8D A;  3CCV A;  1IBK L;  2K5V A;  4YCV A;  1IBL Q;  2VZA A;  1BVS A;  4LF4 L;  4GN4 B;  3DLL A;  3B6Y A;  4NXN L;  3S1N H;  1JE5 A;  4GOP C;  3RZD H;  2CWA A;  2JE6 I;  1QVG A;  1Y1V H;  5IYB H;  1VQA A;  4DAM A;  4LF7 L;  2R93 H;  3E0E A;  3GTP H;  2K14 A;  4JG2 A;  4C3I H;  3F2B A;  2Y0S G;  3ZJY C;  1Q86 C;  3KFU A;  3A0J A;  3D31 A;  1PH2 A;  2PNH A;  4JCV E;  2WAQ G;  4RG1 A;  3A5Z B;  2UUC L;  4A3L H;  4JI4 Q;  4DV4 Q;  1X6O A;  3G48 A;  3KF6 A;  4L5S A;  4A93 G;  3G71 A;  1YJN A;  4JYA L;  3H0G H;  2MNA A;  1DGS A;  1T9H A;  3T1H Q;  2DGY A;  1WOC A;  3I56 A;  4AYB E;  5M3M H;  3PO2 H;  1SE8 A;  2R92 G;  5C3E G;  1KIX A;  5GQO A;  3UDX A;  3J7A 5;  3F1Z A;  4B3S L;  2WFW A;  1YBY A;  4A3F G;  4RMF A;  1I3Q H;  3GTM H;  2R7Z H;  2UXB Q;  3CP0 A;  1HR0 L;  2UXD Q;  3FKI H;  4JV5 L;  4DR7 L;  4OWW B;  3HOY G;  1S3O A;  1A8V A;  5M5X H;  2F3I A;  5FLX c;  1KXL A;  4C3J H;  1E22 A;  1N32 Q;  2YV5 A;  3GTK H;  1SMX A;  3BU2 A;  4P73 A;  4GOP A;  2A1A A;  1GM5 A;  2A19 A;  1L1O B;  1I5F A;  1IBL L;  1G6P A;  1Q46 A;  2B63 H;  3PSI A;  4JI1 Q;  2N3S A;  5IYD G;  2NVX H;  4JI7 Q;  2EXD A;  1SR3 A;  3BJU A;  3CCM A;  4LUV A;  4ME3 A;  2NZO A;  5HGQ A;  4OO1 I;  1MIU A;  1YNX A;  2WB1 E;  1VQM A;  2VQE Q;  3MEF A;  4R4T A;  3S2D H;  4YY3 L;  4DR1 Q;  1CKN A;  4QY7 A;  1Q12 A;  3KYH C;  4DV4 L;  1N9W A;  4JI4 L;  3PF5 A;  2UXC Q;  1VQ8 A;  4JC0 A;  3HOW H;  1NMG A;  3T1H L;  4DNI A;  1Y1W H;  2PQA B;  3LGJ A;  4A3K H;  5M3F G;  3ER0 A;  2ALY B;  1XJV A;  1PVO A;  1HZA A;  4UY8 C;  2VS1 A;  1EFW A;  3CC2 A;  3KF8 B;  4JI8 Q;  1PH1 A;  2JA6 G;  1D8L A;  2N78 A;  4DV1 Q;  4AH6 A;  3J7Z C;  2Z6K C;  2MO0 A;  2RHS B;  5DLQ E;  1EOV A;  1PYS B;  4AIM A;  3M4P A;  5E7N A;  2ZM6 Q;  2UXB L;  4A3C H;  2UXD L;  5IP7 H;  4DR5 Q;  1MJE A;  4BY7 G;  2JA5 G;  3HOZ G;  1XMO Q;  2UUB Q;  5C0X J;  4BBS H;  1W3S A;  1A62 A;  3UE0 A;  5FJ8 G;  4K0K L;  4HIO A;  2JA8 G;  1H95 A;  5C4X H;  3PIP A;  3HOU H;  1AH9 A;  2VY3 A;  1N32 L;  4JI5 L;  3G4S A;  1N8R C;  3GTG H;  4IFD J;  1K8G A;  4P74 A;  3CAM A;  1JB7 A;  2C35 B;  4HID A;  4GNX C;  4JI1 L;  3PIO A;  2CCZ A;  4JI7 L;  1ASY A;  4YCU A;  3PUW A;  1KRT A;  1KAW A;  2K75 A;  4BXX G;  3RLN A;  4MTN A;  4GKJ Q;  2GVA A;  1TWA H;  2VQE L;  3GTL H;  1XPU A;  3HOY H;  2K52 A;  3S17 H;  4DR1 L;  4PZ7 A;  1UE7 A;  3DM3 A;  1YIT A;  4KI0 A;  1PH8 A;  3S2H H;  1AE2 A;  1SLJ A;  1SRU A;  1N36 Q;  2LSS A;  3STB C;  3CCE A;  2KHI A;  3J81 j;  1OXU A;  1XTD A;  3BZK A;  2ZTD A;  3GTO H;  1D7Q A;  2UUA Q;  1VQH A;  5FLM G;  2KHJ A;  2NVT H;  4DKA C;  2Z6K A;  1FL0 A;  3S15 H;  2D0P A;  4JI2 L;  4JI8 L;  5IYD H;  4DV1 L;  1HZC A;  4O2D A;  3M9B A;  5JEA G;  2E5L Q;  2QGQ A;  4MZ9 A;  3I4M H;  1VQ5 A;  2ZM6 L;  2K50 A;  4A3J H;  4DR5 L;  1JMC A;  3M3Y H;  1XMO L;  2UUB L;  1IYJ B;  3AFP A;  4DR3 L;  3TEH B;  3NEL A;  5ELN A;  1XNQ Q;  3PUZ A;  4H02 A;  2F4V Q;  4A3G H;  3RR5 A;  2ATW A;  5LMU Q;  4GNX A;  1VQO A;  3UDF A;  2NN6 I;  5M3F H;  3RN2 A;  1WYD A;  1VQB A;  4DV7 Q;  1NJI C;  2OWO A;  3CMA A;  4L5R C;  1UE5 A;  2E8G A;  3KDF A;  4X64 Q;  4DV2 Q;  2IX0 A;  4IOA A;  4HIM A;  3RLO A;  3PUX A;  3HKZ E;  3RLF A;  1WCM G;  3OYY A;  4OWT B;  4GKJ L;  4AYB G;  3HOZ H;  2MO1 A;  3U4Z A;  1VQ9 A;  2JA8 H;  1VQD A;  1N36 L;  4YY3 Q;  4HIK A;  3CD6 A;  2PI2 E;  3EBE A;  1OXS C;  3RN5 A;  4YWM A;  1MJC A;  4IJL A;  1JJ2 A;  5BR8 Q;  2Q2T A;  1TXY A;  1VQ6 A;  1VQG A;  1MKH A;  3CPF A;  4JI3 Q;  2UUA L;  3KF6 B;  3NEN A;  4R4O A;  2VQF Q;  3TS0 A;  4QGU A;  1I94 Q;  5JEA J;  3CPW A;  1M1K C;  4DAY B;  1XNR Q;  4OX9 Q;  2HT1 A;  3WWV A;  2YU9 H;  3JC6 6;  2NVQ H;  2E5L L;  1L1O C;  5IP9 H;  4OON A;  4QIW E;  5H1S E;  2QA4 A;  4KHP Q;  4ALP A;  1LUZ A;  3A5U A;  3H15 A;  1HNW Q;  1UE1 A;  4R4I A;  2EQS A;  3M85 A;  2VUM G;  2MQH A;  1XNQ L;  4PZ6 A;  1EWI A;  4A3E H;  3F2D A;  2RHQ B;  1QUQ A;  3OTO Q;  2F4V L;  3PO3 H;  4DV3 Q;  3AYH B;  1YVC A;  5C0X G;  5LMU L;  4K0K Q;  2WB1 G;  4NXM L;  1LTL A;  4GKK Q;  3HFZ B;  5FLM H;  4DV7 L;  4JI5 Q;  1GD7 A;  2RCN A;  4X64 L;  4DV2 L;  4DR6 L;  5C44 H;  3CCQ A;  2JA7 G;  4IFD G;  2I0Q A;  3CC7 A;  2ZTC A;  3CQZ H;  4GOP B;  3E9H A;  4DV0 Q;  1PV4 A;  4HJA A;  2Y0S E;  5GRO A;  1XPO A;  1VQP A;  1YJW A;  4PZ8 A;  2WAQ E;  2ASB A;  1K3R A;  1FJG Q;  4A3D G;  3A74 A;  1CSP A;  3OW2 A;  1IZ6 A;  1PH9 A;  4LW1 A;  4QL5 A;  3I4N H;  3AQQ A;  4JBM A;  5BR8 L;  3CXC A;  1PYB A;  4POF A;  4OWX B;  3FHW A;  1CKN B;  3I2Z A;  3ULL A;  1S72 A;  1PH6 A;  4JI3 L;  2PI2 A;  2VL6 A;  1EIF A;  1QVF A;  2CKZ B;  4TQU S;  4NPS A;  5C4J H;  4YHH L;  2VQF L;  1I94 L;  1XNR L;  1LYL A;  1G29 1;  1XMQ Q;  1X65 A;  3T1Y Q;  4OX9 L;  2UXC L;  2LXK A;  2QEX A;  2AHO B;  2RF4 A;  4KHP L;  4JI2 Q;  1N33 Q;  1GKH A;  2ZJP A;  4QJF A;  1HNW L;  4LF5 Q;  3S16 H;  3NBH B;  1EQQ A;  1TWF H;  4X66 L;  4GS3 A;  3OTO L;  5M5W H;  3UE1 A;  1Q81 C;  1U5K A;  1E3P A;  4DV3 L;  4DR3 Q;  1PH3 A;  1VQK A;  2K5N A;  4YWL A;  4A93 H;  3GD7 A;  4WJ4 A;  4B3M Q;  4GKK L;  1V9P A;  4BY1 G;  1CKM A;  3CCJ A;  2PQA A;  2R7F A;  2BH8 A;  4A3I G;  4POG A;  2OTJ A;  2EIF A;  5GAH C;  3TQY A;  4EX5 A;  4IPC A;  1VQ7 A;  3S1M H;  4BA2 I;  2R92 H;  5C3E H;  4DV0 L;  1BBU A;  1OXV A;  3AFQ A;  4A75 A;  1B8A A;  2AMC B;  1X54 A;  4A3F H;  5K36 G;  3H3V H;  1HZB A;  3PF4 A;  2E2I H;  1N34 L;  1K0R A;  3I55 A;  1FJG L;  4X62 L;  5JJL A;  1RL2 A;  1Y1V G;  5IYB G;  2YTY A;  3ULJ A;  4LF8 Q;  3W5O A;  3KLW A;  3FP9 A;  4IJH A;  4JOI C;  1A0I A;  2OQ0 A;  3EN2 A;  1IBM Q;  4GLV B;  3JAM c;  1IL2 A;  3MXN B;  4LUZ A;  4O0A A;  1EUJ A;  3JAM i;  4A3L G;  4DPG A;  5HY6 A;  4JI0 Q;  4LFC Q;  1XMQ L;  3T1Y L;  3UDI A;  3H0G G;  4A3M G;  1Q7Y C;  3S1R H;  1N33 L;  1Z47 A;  2I5L X;  1KD1 C;  1K8A C;  3PO2 G;  1KL9 A;  4DR2 Q;  2HHH Q;  2AKW B;  1WJJ A;  4LF5 L;  2JQO A;  3TRZ A;  4HJ5 A;  2YYZ A;  3STB D;  2GN5 A;  4IPG A;  2NVY H;  2OTL A;  1PH5 A;  1NTG A;  1NE3 A;  5GAE C;  2R7Z G;  3K81 C;  2ZJR A;  3FKI G;  3PUY A;  4JBJ A;  4B3M L;  4R4Q A;  1NMF A;  1YIJ A;  1PHJ A;  1FVI A;  3K7U C;  2JEA I;  3RZO H;  4UP9 A;  3L2P A;  4JI6 Q;  4IPH A;  4NXM Q;  4GNX B;  1HNZ Q;  4IOC A;  4BA1 I;  2JA6 H;  1C9O A;  2IX1 A;  4DR6 Q;  1HZ9 A;  1YI2 A;  2Q2U A;  1PH7 A;  1VQI A;  3K8A A;  2F52 A;  3KDF B;  2WP8 J;  5AJ3 Q;  2K4K A;  3GTJ H;  4BBR G;  2B63 G;  1K83 H;  2ZJQ A;  4B3T Q;  3S24 A;  2A8V A;  2HIX A;  1W2B A;  1PFS A;  1ASZ A;  4BY7 H;  2JA5 H;  4DV5 Q;  4Y52 H;  1UE6 A;  1M90 C;  4LF8 L;  4YCW A;  5FJ8 H;  1X55 A;  5C0X I;  2VNU D;  1IBM L;  1JJC B;  4IO9 A;  4PMW A;  3M7N A;  2HIV A;  4BY1 H;  1AE3 A;  3F2C A;  3J81 c;  1TWC H;  2BA1 A;  3U50 C;  4C3H H;  1KC8 C;  4X65 Q;  1K9M C;  1BKB A;  4JI0 L;  4LFC L;  3J81 i;  1J5E Q;  3HOW G;  2L15 A;  4QQB X;  4YHH Q;  2CWP A;  1GVP A;  3CCR A;  1V1Q A;  3G6E A;  1Y1W G;  2K5H A;  4A3K G;  2E2H H;  2H5X A;  3M4Q A;  4BXX H;  2HHH L;  4DR2 L;  4LF6 Q;  1K73 C;  2IHE A;  1HNX L;  1E1T A;  4GN5 A;  1Q1E A;  2B29 A;  4WJ3 M;  2XTI A;  1KRS A;  2E2J H;  5IE8 A;  1CSQ A;  2BH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...