2OQ0A

Crystal structure of the first hin-200 domain of interferon-inducible protein 16
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
189
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the First HIN-200 Domain of Interferon-Inducible Protein 16
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Gamma-interferon-inducible protein Ifi-16
total genus 35
structure length 189
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A01
1LM0A 2YU9H 1UWVA 2MFIA 4IPHA 1N34L 1EIFA 1HR0L 4LFCL 1Q12A 2UXDQ 5HY6A 4GNXA 5C4XG 1BKBA 2VQFQ 2MO1A 1OXXK 1U5KA 2H5XA 4JI6L 4LFBQ 2GVBA 4YY3L 2JA7G 2UXDL 1VQMA 1FL0A 5C4JH 1PH2A 3RN5A 1Y1VG 3TS2A 1N36L 3G4SA 3BZCA 3KF6B 4AYBE 2BH8A 4JBMA 1PYBA 3CCMA 5LMUL 4QY7A 3KDFB 1XMQQ 3OTOL 4DV1Q 2BA1A 3M4QA 3PO3H 2RF4A 4C3HH 2AKWB 3J81i 3CMAA 1RL2A 5LMUQ 3HOUH 2D0OA 2PNHA 1EUJA 4C2MH 4DAMA 5IP9H 4HJ7A 5FJ8G 4UP9A 4LUZA 5JJKA 1X55A 2Y0SG 4A4IA 4C3IH 2XGTA 1NE3A 4PG3A 4YWLA 3AEVA 3CW2C 1IZ6A 1EOVA 4GS3A 4NXNL 2YTVA 3GDEA 3FP9A 4LF7L 1HZBA 2YTYA 3I55A 4LF5Q 2ZTCA 4A3GH 2JA5G 2E2JH 1HZCA 1Q8KA 1B7YB 5C44G 4A3EH 4BY1G 5EAYA 1CUKA 1VQEA 5FJ8H 5AJ3L 1PA6A 1PFSA 3PF5A 2IY5B 1OXVA 4YWKA 1D8LA 5GAHC 3A5UA 1R9TH 3PUXA 1IL2A 4DR4Q 3NELA 4YWMA 2ZJRA 5IYBG 1N33Q 1YHAA 1XNQQ 2PI2A 1E7ZA 1YI2A 3K7UC 3OYYA 4A3KH 5IE8A 4HIDA 1D7QA 4GLAC 4KLKA 2A1AA 3PIOA 1KHIA 1IBLQ 1Y1WH 1LUZA 2JJQA 3GTQH 1QUQA 4WJ4A 3CF5A 3HFZB 1CKOA 1N9WA 1VQHA 1QVCA 4LF9L 3PUZA 3ULLA 1FJGQ 4JBJA 5ELNA 2I0QA 3M4OH 5M3MH 5LMNL 3L7ZC 4K0KQ 4YCVA 4DR7Q 4ME3A 4JYAQ 1H95A 2R7DA 4OWTB 1VS0A 2KHIA 3S1NH 4JI0Q 4GOPC 3TEHB 1O7IA 1PYSB 1YNXA 3AYHB 1ASYA 3B6YA 2JA8G 1PVOA 4BBSH 5M3MG 5M5XH 2K75A 2JEAI 4B3RL 2N78A 3F1ZA 4GKKL 2NN6I 1VQ5A 5LMNW 2UUCL 4P74A 3KYHC 4FDBA 1P8LA 4MZ9A 3RN2A 1K73C 1JJCB 1WCMH 3K8AA 4GKKQ 1YHQA 4OX9Q 4KHPQ 2WB1G 2ZM6Q 1HNXL 1X56A 1PV4A 3FHWA 3OW2A 1PH3A 1K8GA 4JI7Q 3CCVA 2BA0A 1Y1VH 4XIGS 1VQNA 1TWHH 4X6AH 2A8VA 5IYDG 1Q82C 1IBML 4A76A 3S1RH 1HNXQ 1Q81C 3DM3A 2NVYH 4NXNQ 2LXKA 3H0GG 4IPDA 5IP7G 2I5LX 1PH7A 1IBMQ 4IOCA 2GVAA 3PUYA 4B3TQ 2K52A 4HIOA 2R92G 1U0LA 1CKMA 4RMFA 1E1TA 4UY8C 3TRZA 1CSPA 3S16H 3GD7A 3J81j 1VQ6A 4JI8Q 3J80c 3VDYA 3NEMA 2EXDA 4DV7Q 4IFDJ 3AFPA 2E2IH 2PQAB 3H3VH 4AIMA 4GOPB 1N33L 4IJLA 1XNQL 1JMCA 3PV0A 2K50A 2HT1A 2UUAQ 1VQLA 1EQQA 4HJ9A 3PF4A 2VUMH 4L5QA 1L1OA 3UDGA 1YVCA 4APVA 1LYLA 2WB1E 4JOIA 1GD7A 1BBWA 2ZJQA 2JA6G 3G48A 1HZAA 1Q46A 2MO0A 2IHEA 2VS1A 1PHJA 4AQYL 1MJCA 4NPSA 5GAGC 4A3FG 3PSIA 1I5FA 1VQFA 2K5HA 4JI3L 1Q7YC 2VUMG 1UE1A 4DR7L 1KC8C 3W1BA 1C9OA 4R4OA 3S1QH 5JJLA 1QVFA 3HKZG 5C4XH 2QA4A 3CC2A 2L15A 5C3EG 2WAQE 3JAMi 2E5LQ 3L2PA 1HR0W 2JK8A 4R1JA 4MTNA 3TS0A 3NBHB 3RLFA 1K0RA 1X9NA 3U4VA 1G6PA 4LF4L 2ID0A 3STBD 4PZ6A 1VQJA 3F8TA 2I5MX 4DV2Q 4IOAA 4GN3B 1HNWQ 1QZHA 2N3SA 4X66L 4LF4Q 1XPUA 4H02A 2B63G 4TVAB 3G71A 5IYBH 4DUYL 4DUZQ 4DV2L 5FLMH 3ULPA 3T1HQ 4L5RC 4A93H 3PO2G 3CCRA 1HH2P 2AMCB 4PZ8A 1X3GA 4R4CA 4X64L 1JT8A 1X3EA 1S3OA 2RHQB 4IO9A 1KD1C 3J81c 1UE5A 3I4MH 4WJ3M 4DV6L 1JJGA 3K0XA 1XJVA 2K5NA 4L5TA 1TWFH 3NENA 2CFMA 4OO1I 3CCQA 3KJPA 1VCIA 4UPAA 3I4OA 3PIPA 1GVPA 3HKZE 2WAQG 1N34Q 2DGYA 4DV7L 3E9HA 4JBKA 4DV5L 2IT1A 1PH1A 3PUVA 4BXXH 4LNQA 3K81C 2ASBA 3UDXA 3HOYG 2NVXH 4QL5A 4YY3Q 1K83H 4EX5A 4DV5Q 1N32L 3CD6A 4R4IA 1T9HA 1XNRQ 2UUBL 5GAEC 3CQZH 4LUVA 4GNXC 1N36Q 3CC4A 4DV3Q 4A3CH 3RNUA 4JOIC 1X3FA 3S1MH 5J3BA 4JI1L 5C0XG 1N32Q 3U58A 4NXML 4XTCS 2Z6KA 4DV1L 4A3MH 1EWIA 3KDFA 4DKAC 4BA1I 1Q1BA 4O0AA 1WOCA 2R6GA 5JEAJ 4LF8L 4A3DG 2CKZB 4A93G 3GO5A 1VQ9A 1QZGA 3CP0A 2E2HH 3CCEA 2KCTA 2V1CC 3S24A 4DAYB 1SLJA 1K8AC 1N8RC 4GLVB 3H3VI 3T1YQ 1SE8A 2NVTH 1VQDA 1C0AA 1JE5A 4DR2L 5M3FG 1VQGA 5GQOA 3T1YL 1B70B 1TWCH 4QJFA 1KRTA 3RR5A 4OWWB 2VW9A 4DNIA 2ZJPA 3S15H 1KXLA 1VQCA 3FKIH 4X66Q 3KLWA 3M9BA 4DR4L 3I7FA 3H15A 2IX0A 4BXXG 1YJ9A 3S2HH 5IP9G 3KF6A 3BZKA 3LGJA 3ZJYC 3H0GH 3GTLH 2JA6H 1HNZL 4LFAL 1FJGL 4A3JH 1KQSA 4BY1H 4A3FH 2ZTEA 2ES2A 3AQQA 3MXNB 4A3DH 1G291 4LFBL 4IJHA 1FGUA 2E8GA 2OCEA 2EIFA 4OONA 3J80i 2NVQH 3PCOB 3UE0A 2K4KA 3TQYA 1EQRA 2I5HA 2R93G 2Q2TA 4LFCQ 3CCSA 4A3LH 1XPOA 1HJPA 2KCMA 3A0JA 3PGZA 4JCVE 3I2ZA 5M3FH 1YITA 4DV3L 2CQOA 4NB3A 4HIMA 2AWOA 4JI2L 2JQOA 1NTGA 3JC66 4IFDI 1WI5A 2OQKA 3EIVA 3TREA 3HOYH 4JI2Q 2JE6I 5IP7H 4JV5L 5K36G 1E3PA 1XMQL 1Y14B 2RCNA 2NZOA 4X65L 2OTJA 4IFDG 1KIXA 4LF5L 2K14A 5BR8L 1EFWA 5IWAL 1I94L 3I4MG 3GTOH 2CWAA 4X62Q 3I56A 2VZAA 5IWAQ 4A3JG 1I94Q 2F4VQ 3UDFA 4X62L 3I4NG 4JC0A 4LF7Q 1E22A 1LTLA 1PH4A 1YJNA 1WJJA 2R7ZH 1YBYA 1WFQA 1GM5A 3PUWA 1A63A 4GNXB 5IY0A 2HQLA 2B3GA 3CCUA 5HGQA 4A3EG 3HOZG 3IRBA 1P16A 3J7A5 1PH8A 4LWCA 1IXRA 4DR6Q 1CKNB 1NMGA 1NY4A 3GTMH 4BY7H 5LMNQ 4K0KL 4R4TA 2R7ZG 1J6QA 4JI4Q 1S40A 5C3EH 3CCLA 1SR3A 1Z9FA 4JI0L 4A3BG 4GN4B 1E24A 4A3KG 1VQIA 4JI4L 3HOXG 4JI5L 3RZDH 1VQ7A 4POGA 4GOPA 3K7AH 3S2DH 4YHHQ 4B3SQ 2Q2UA 1WCMG 1VQBA 4BBRH 4PZ7A 1NBWA 3BU2A 3E0EA 1AE3A 4P75A 2NZHA 4JYAL 3JAMc 4PMWA 1VQ4A 1QVGA 4GKJL 3ER0A 4DK3C 3KOJA 1BVSA 4OX9L 4KHPL 2KBNA 4QGUA 4DV4L 1HNWL 2ALYB 4BA2I 1VQOA 2EQSA 2N49A 1YJWA 1GO3E 2UUCQ 2AWNA 2C35B 3UE1A 2JA9A 1OXTA 5M5WH 2OQ0A 4DV4Q 3T1HL 1AE2A 2CCZA 3HOVH 4A3LG 1WYDA 4JV5Q 3HOWH 2OTLA 1SN8A 1VQPA 4P72A 3Q8DA 4DV0L 1L1OB 1JB7A 5E7NA 5C0XI 2B29A 5DLQE 4JI7L 4DV6Q 3STBC 1YIJA 1E1OA 2D0PA 3PO3G 1B8AA 2A19A 2AHOB 2PMZE 2F52A 3W1GA 4B3MQ 1L0WA 1QUQB 1YEZA 2F4VL 4B3TL 5IYDH 4O2DA 1AH9A 3E9IA 2R7FA 3EBEA 2HIXA 1HZ9A 1YHBA 2VY3A 3CPWA 4B3ML 4GN5A 2LSSA 4DR1Q 2B63H 1UEBA 4Y52H 3F2CA 3CCJA 5FLMG 4JBWA 1RIPA 4JG2A 3M4PA 4P71A 5C44H 3M85A 2JA8H 3PO2H 4YCWA 4BBSG 2YV5A 2VQEL 2JA7H 4AH6A 1EIYB 3G6EA 2OWOA 3S17H 5M5YH 4C3JH 4DR5L 4DR6L 1PH9A 4HJ5A 2Z0SA 4EQ5A 2UXCL 2UUAL 1NJIC 1SROA 4LF6Q 4OXPA 3A5ZB 1X6OA 5JEAG 1MJEA 2UU9L 2UXCQ 4LUOA 3RLNA 3D31A 3HOUG 1X54A 4KI0A 3M7NA 4UP8A 5GADC 4LF6L 1YZ6A 3CC7A 4JI5Q 3GTKH 4L5SA 3KFUA 3M3YH 3WWVA 1Y1WG 2UU9Q 4YHHL 1L1OC 5H1SE 3J7ZC 1Q1EA 1I50H 4AQYQ 4B3SL 3CAMA 2PQAA 3CXCA 1JJ2A 1Z47A 2HHHL 4J15A 4B3RQ 4GKJQ 2D62A 1TWGH 1TXYA 3GTPH 1K9MC 4OWXB 4A3CG 2QGQA 3CPFA 4HJ8A 3RLOA 2HIVA 1FVIA 4Y7NH 2ZM6L 4A75A 1W2BA 1CSQA 5IYCH 1C7YA 4YCUA 3UDIA 1L2FA 2VNUD 4DV0Q 3DLLA 3HOZH 1I6HH 1X65A 1ASZA 4QQBX 1Q86C 3ERSX 5C0XJ 1SMXA 4IPGA 3L0OA 4ALPA 2UXBQ 4LFAQ 5IYCG 3S14H 2MQHA 2Q2IA 1VQ8A 1VQKA 2R93H 3U4ZA 3F2BA 1J5EQ 4DR3L 3I4NH 2XTIA 1W3SA 4JI8L 3K80C 5GROA 2JEBI 2IX1A 2UXBL 1UE6A 1HR0Q 1OXSC 2BH2A 1J5EL 2N8NA 4DR1L 2UUBQ 4POFA 4A3MG 2F3IA 4JI6Q 4GLXA 2YTXA 1A0IA 3AFQA 4IPCA 1NMFA 4RG1A 2VQEQ 2QEXA 2MNAA 1S72A 4NXMQ 4DR5Q 4BY7G 1TWAH 2FXQA 1PH5A 4DPGA 5FLXc 2Q2HA 1M90C 1VQAA 3OTOQ 1IYJB 2WFWA 4HIKA 4TQUS 1OTCA 1XNRL 4OO1G 2Z6KC 1DGSA 1V43A 3HOVG 2ATWA 4QIWE 1K3RA 1V9PA 4JI1Q 3MEFA 2DUDA 3SGIA 3ULJA 4DK6C 1PH6A 4JI3Q 3HOWG 4MNOA 5ELOA 4X65Q 4A3GG 2VL6A 5BR8Q 3BJUA 1M1KC 4BBRG 4LF8Q 2E5LL 4KHZA 1A8VA 2NN6G 2HHHQ 3GTGH 2IHFA 1SRUA 3W5OA 2YYZA 4UP7A 1IBKL 3HKSA 1I3QH 3U50C 1BBUA 1CKNA 1V1QA 3A74A 4LW1A 1A62A 1XTDA 5AJ3Q 4A3IH 5JJIA 1EYGA 4DR2Q 1KL9A 1KRSA 1XPRA 4AYBG 1IBKQ 3D0FA 4DUYQ 4DUZL 4P73A 2PI2E 3KJOA 3EN2A 2LXJA 1G51A 1KAWA 2KHJA 4X64Q 4A3BH 2KENA 3KF8B 5IT9c 1HNZQ 2RHSB 1UE7A 4A3IG 1XMOL 3ICEA 1MKHA 1OXUA 3FKIG 3HOXH 2CWPA 3CMEA 1IBLL 3RZOH 2ZTDA 3GTJH 2Y0SE 4LF9Q 2R92H 1XMOQ 3F2DA 2JA5H 2WP8J 2K5VA 1GKHA 4HJAA 2GN5A 4DR3Q 1SFOH 4R4QA 1MIUA 2VQFL
chains in the Genus database with same CATH superfamily
1UWVA 2MFIA 1N34L 1EIFA 1HR0L 2CW0C 5M3FB 5HY6A 3J80E 1BKBA 1OXXK 2H5XA 4JI6L 4YY3L 3NQTA 5DM73 2D9UA 3QOLA 4DF7A 5JVG3 1JR0D 4KK7A 5LMUL 1I4PA 3NBIA 5M9OA 2RF4A 3J81i 3HOUH 1RL2A 3V2TA 1TWFB 1EUJA 1HPCA 1DD2A 4UP9A 1X55A 5KRUA 2XGTA 5FK9C 3CW2C 1H9SA 4LF7L 3I55A 1Q8KA 4KY6A 1VQEA 3FMCA 3TBIB 2IY5B 1BUVT 3A5UA 1ML0D 2F0IA 4BY7B 2MP1A 2IWHA 1N33Q 1XNQQ 4IURA 1YI2A 4H13C 5IE8A 3A55A 3NHHA 3OPOA 1IBLQ 2K05A 1LUZA 1F2LA 1EY9A 4XDXA 1PDQA 1F2ZA 1QVCA 1FJGQ 3M4OH 4BBRB 1WTQA 1SE3A 4YCVA 4DR7Q 4ME3A 4KJNA 1I4XA 2X6GA 3I4LA 1NCVA 4RAUC 1SNDA 2JA8G 4B3RL 5M5XH 3EA6A 1QJOA 4GKKL 2F3VA 4ULLA 4XQQA 5DM63 1BDOA 1STBA 4MZ9A 3K8AA 3S2HB 2K5WA 1STYA 4OX9Q 4CJ1B 3NWSA 1IW7C 2ZM6Q 3FHWA 4V190 2IJ0A 3CCVA 3KF8A 1CA5A 4JI7Q 1Y1VH 1ESFA 4FXDA 1Q82C 4A76A 5ELCA 4O1NA 2A5HA 2XNAC 1IBMQ 1ET6A 1CKMA 4B9WA 3S16H 1LT4D 3NEMA 4IFDJ 1JE4A 4RCNA 4AIMA 1IW7D 2ENBA 1TKWB 1XNQL 1EYAA 2B8GA 4IUTA 2HCCA 4HJ9A 4L5QA 3DWAA 1L1OA 1LACA 3TZDA 4QUFA 1BBWA 2HCIA 2RDHA 3BVGA 3G48A 3MHBA 4F87A 4AQYL 1D7QA 5GAGC 1VQFA 2KOLA 1KC8C 4G7ZC 4DR7L 1C9OA 4FYDA 4L8JA 1CQFA 2SDFA 5JPMC 1BQQT 5C3EG 4R8NA 4EVOA 3JAMi 3TP8A 3T53B 4J8QA 4Y7NB 2ID0A 2K33A 3STBD 4PZ6A 3F8TA 4IOAA 2N3SA 4X66L 2EYJA 5ISRA 5CYUA 2C9OA 4H02A 2B63G 1GUNA 4TVAB 4DV2L 2XRQD 3HRZC 4HR7B 3CCRA 4PZ8A 2F03A 2RHQB 5G3LD 1TS3A 3NTIA 5C3EB 4IO9A 4MHEA 4DV6L 1KDCA 2BDNA 1V1OA 4I65A 1GUWA 4L5TA 3S2DB 1BR9A 3KJPA 5I2YA 2K1BA 4K2LA 1LTTD 1PH1A 3PUVA 2E2JB 4BXXH 1M4VA 3UDXA 2NVXH 1F9PA 4DV5Q 3M4YA 4R4IA 1N36Q 4GNXC 4DV3Q 2F0WA 5IGEA 3S1MH 5C0XG 4DV1L 3D8GA 5CMDA 4O0AA 4XYOA 1WOCA 2KCCA 2R6GA 4A93G 2L55A 3QR8A 4H0LC 3NSWA 1QZGA 1VQ9A 1ENAA 4CKCA 5C0XH 2A73B 3FPPA 2LS01 1K8AC 4GLVB 4JVZA 1DCZA 1B44D 1O7LA 3MZ5A 1C0AA 3H6MA 3Q22A 1SYEA 3T1YL 4QJFA 2JA8B 1IYVA 1SNMA 1KXLA 5CBEE 3IAYA 4FXGC 3PIP3 1RCVD 2L1BA 2F0PA 3GTJB 1WCMB 2F4IA 2G9HD 2PPBC 1QB5D 1PRTD 2OT2A 2RSOA 4KD3A 1JWSD 2SEBD 3HKZB 4A3JH 1WTVA 4ZKBB 4FF1A 4CDFC 3AQQA 4A3DH 4CBVA 1G291 3I91A 4LFBL 4OONA 2JA5B 3J80i 1MGSA 2QDLA 2MHVA 3UE0A 2I5HA 1SFOB 2R93G 2E2IB 2KCMA 3PGZA 1F2MA 5M3FH 3I2ZA 4DA2A 1YITA 1PZID 4NB3A 2CQOA 5JJLA 2AWOA 2JQOA 3JC66 4IFDI 1ILPA 2OQKA 1I6HB 3HOYH 2PYKA 2JE6I 1DZ1A 4JV5L 4C1NK 3R8BA 1E3PA 2B8FA 4ZKCB 4X65L 1H9KA 1S5DD 1KIXA 2F0MA 2CWAA 4X62Q 1YNJC 3I56A 2E76C 3CRKC 2VZAA 3F2UA 2PMZB 2O5IC 1TS2A 3OIPA 2VB2X 1YJNA 2L5TA 1NR2A 4KY5A 2R7ZH 5IOCA 3JAME 1YBYA 1Y1WB 1GM5A 5DNFA 3P20A 5C3XA 5IY0A 2HQLA 4ZK9B 1P16A 4RGNA 1IXRA 3GV3A 3GTMH 4BY7H 2B2UC 2WINB 5LMNQ 4JI4Q 2O2LD 3CCLA 1STEA 2XN9C 1SR3A 4JI0L 4KHVA 2K28A 1E24A 3RZDH 3OMGA 4YHHQ 4B3SQ 5KNBA 1WCMG 4PZ7A 3DWQA 4XT1B 4A3IB 3SK8A 2AUJD 3KOJA 1BVSA 4XQNA 1HNWL 2ALYB 3Q6SA 1F9RA 1JOKA 1VQOA 1GO3E 4IUUA 3O13A 2CCZA 2OQ0A 4WRDA 4LJZC 3T1HL 4JV5Q 3FRPB 2OTLA 1SN8A 2B2UA 4P72A 1PRTB 1JB7A 5KGUA 2QEJC 5C0XI 5DLQE 3ONAB 2A6HC 3E3XA 1YIJA 2D0PA 2HD3A 5BN5A 2RDGA 2F52A 3W1GA 2B39A 4UDUC 2NTSA 5JOBA 5C4HA 5IYDH 2SOBA 4B3ML 2HIXA 1YHBA 2B63H 1L0XB 5FO8B 4Y52H 4J1MA 5JEAH 2B2TA 3S16B 2YV5A 2JA7H 4JPBW 1AW7A 3ZYYX 1A3TA 2BE5D 3K5LA 4OXPA 5JEAG 4N8X1 4ZRZA 1A3VA 1STAA 4ZLTF 2P5ZX 3HOUG 3VR5A 3H0GB 4UP8A 1X3QA 4LF6L 3CC7A 1RDPD 4L5SA 2JN4A 3M3YH 1SMYC 1Y1WG 4P2CB 4YHHL 1LTGD 1A2UA 5H1SE 4AQYQ 4B3SL 3W2DA 3CU7A 5EBCA 4B3RQ 2D62A 1GOZA 3SEBA 3AMUA 1NNXA 4JW0A 2ZM6L 5K36H 1C7YA 4YCUA 4DAYA 1L2FA 2TMPA 3HOZH 3M4OB 1Q86C 1LTRD 3ERSX 5C0XJ 1SMXA 4IPGA 1K3BC 1HXYD 4A93B 1MI2A 1SAPA 3C2PA 1II3A 1VMCA 2EYOA 2R93H 3F2BA 2R3ZA 1J5EQ 4DR3L 1WD0A 2XTIA 5FOBB 2BH2A 3CQZB 4HCSA 5KIXA 2N8NA 4C1NI 4A3MG 3MTSA 2Q8IB 2VQEQ 1NMFA 4CKEA 4KN7C 4BY7G 2FXQA 4Q5VA 3SR1A 5K5PA 5FLXc 2Q2HA 2NVXB 4OO1G 1IYJB 2WFWA 1OTCA 3EJIA 2Z6KC 1A2TA 1V43A 4DN4M 1V9PA 4JI1Q 3HOWG 1U4RA 5C5MA 1PLFA 4TRDA 5LL6X 1M1KC 1U9RA 3K6OA 4OO1H 2TSSA 4KHZA 3FKIB 4DAPA 1SRUA 5HGTA 1IBKL 2F0JA 4LW1A 1A62A 1S5BD 2Z8LA 5JJZA 2DJGC 4AYBG 2PCFB 4CDDC 2EVBA 4P73A 1STNA 2PI2E 1EIGA 2LXJA 1IKMA 2KENA 3KF8B 5CV7A 5IT9c 4A3IG 1HNZQ 1MKHA 2F0LA 3PIO3 3HOVB 2CWPA 3T16A 4ZYSA 3D4WA 3HOWB 1D2BA 3BDLA 3C3LA 1CK1A 5D14A 2GN5A 2XVSA 1EY4A 3CCSA 1MIUA 4JBMA 1LM0A 2F0KA 2YU9H 4IPHA 4LFCL 4RWSC 3VR2A 4A3JB 5C4XG 2N55A 2OXPA 1EIHA 3P7JA 4KMUC 2MO1A 1U5KA 2XSCA 2NBFA 2GVBA 3KLSX 2JA7G 1VQMA 2NWGA 5IGFA 3BZCA 3KF6B 3L9AX 2BH8A 1PYBA 2FJ2A 1Z7TA 1L0YB 3M4QA 3E5SA 3CMAA 5FJ8G 4V0BA 3HOYB 1JQYD 3BYTB 3U9SA 1IZ6A 1EOVA 4GS3A 5CC4A 3GDEA 1FYCA 3FP9A 4KV6A 2YTYA 4A3GH 1VMPA 1F2YA 1HZCA 5C44G 4A3EH 2F3WA 5EAYA 1PA6A 1PFSA 3PF5A 1OXVA 5GAHC 1HTLD 3PUXA 1GUOA 4YWMA 5IYBG 2PI2A 2XRSD 1SNOA 3VR3A 1GHKA 1FNVA 3OYYA 2NZ1D 4BWGB 1KHIA 1RTOA 1CQVA 1J9OA 1Y1WH 1QUQA 1N9WA 3ULLA 2I0QA 3BVMA 5LMNL 3GTMB 2H1EA 1GHJA 2CH4W 4JYAQ 2R7DA 1LO5D 3S14B 1O7IA 2EJFC 5BN3A 2CHBD 2JEAI 2N78A 1VQ5A 5LMNW 2UUCL 4FDBA 1P8LA 4B9XA 1K73C 4LAAA 1X56A 3VR4A 3OW2A 1K8GA 2BA0A 5IGBA 4X6AH 5IYDG 1IBML 1HNXQ 1QILA 1MSHA 4UHVA 1AEXA 2EOTA 4NXNQ 2LXKA 5IP7G 4B3TQ 4A3DB 1G2SA 2K52A 2QILA 2R92G 2PNRC 3T51B 4UY8C 4C56C 1CSPA 3J81j 1VQ6A 4MIUA 2K6AA 4DV7Q 3VYRA 2E2IH 2PQAB 2EYMA 4ILWA 4DXFA 2RQXA 4G4KA 2Y0SB 2UUAQ 1UUPA 1EQQA 3PF4A 4OGQC 2VUMH 1SE2A 1LYLA 2WB1E 3PO2B 2B2VC 2JA6G 2ZXOA 2G9DA 3AU7A 1ONLA 4CKBA 1MJCA 4NPSA 4A3FG 2UXCQ 3PSIA 4JI3L 4PMCA 3VA5A 4R4OA 3S1QH 5J22A 1QVFA 3HKZG 5C4XH 3K5NA 2A69D 5A35A 3WDNA 2QA4A 3CC2A 2WAQE 2EJMA 2O4XA 4R1JA 4RGOS 5JVH3 4NKLA 2M00A 3TS0A 3RLFA 1K0RA 1X9NA 3U4VA 4N8FA 2I5MX 4FNFA 4DV2Q 3H3VC 1HNWQ 2L4NA 1XPUA 1TQOA 4DUZQ 3T1HQ 3ULPA 1PTOH 3QOJA 4M8AA 2AMCB 1JT8A 4OELB 3SK6A 1T5EA 2J0TD 4XT3B 3K0XA 3E0JA 4OO1I 1ZYRD 3NENA 2CFMA 3CCQA 1KLGD 3BVZA 1N34Q 2DGYA 4DV5L 2IT1A 3S9WA 1TWAB 2ASBA 2A68C 4YY3Q 3IL8A 2UUBL 3CQZH 4LUVA 2IW3A 2KA7A 4A3CH 4JOIC 4H7BA 5J3BA 2A6HD 5E1FA 5KNCA 1QWYA 2Z6KA 1KDAA 2Z4IA 2RSNA 1EWIA 3P75A 4DKAC 4BA1I 1Q1BA 2WIIB 1F9SA 3CCEA 2V1CC 3A7LA 1I3QB 1YNJD 2XWBB 1SLJA 3TZUA 1ILQA 2NVTH 2O5JC 1VQDA 4ZQ3A 1JE5A 4DR2L 1VQGA 5GQOA 1TWCH 3RR5A 3S15H 4BBSB 2J7ZA 2LKVA 1ENFA 1O7YA 1VQCA 3TDQA 3KLWA 1IKLA 3I8ZA 1UEAB 3IKJA 3I7FA 2IX0A 1LTSD 4BXXG 1YJ9A 1LV9A 3T56B 3GQBA 3A8JE 2K32A 2IPKD 3QJYA 2RKSA 5LL6S 1FJGL 2QDBA 4BY1H 2EZVA 1PXUA 1RKNA 3WOEA 4IJHA 1FGUA 2EIFA 2K4KA 3M7GA 2Q2TA 2SNMA 3CRLC 1XPOA 1HJPA 2B2VA 1SYGA 1JWUD 2JYOA 5EGTA 3H09A 3TP6A 3OWFA 3EIVA 1JORA 3SE0A 5K36G 3NQIA 4O42A 2RCNA 4HMJA 2NZOA 2OTJA 3DM1A 4FF2A 2K14A 1EFWA 5IWAL 5C5LA 2BDOA 1HFGA 3QB3A 1O78A 1I6VC 3EROA 4IZ8A 1SNQA 1D1KA 1I94Q 2NUCA 2F0SA 4C3IB 3UDFA 4X62L 3I4NG 4JC0A 3MC0B 1E22A 2AQ3B 1LTLA 1H9RA 5CGKA 4A3GB 3D6CA 3PUWA 5HGQA 1PH8A 4IUPA 2PO4A 2R7ZG 1J6QA 1S5CD 4EQOA 4K5VA 5C3EH 4K6DA 3RUZA 1TT2A 2I07B 2Q8RE 4NW2A 4A3BG 1K0SA 2JXMB 4A3KG 3HOXG 3X3MA 1VQ7A 3K7AH 1T5XD 4KTAA 2Q2UA 3BU2A 4P75A 2NZHA 4JYAL 5EQ0A 3JAMc 1CI3M 2E2DC 3ER0A 2K04A 4DK3C 3KLSA 4OX9L 3A54A 2EQSA 4G57A 3S1RB 1NAPA 2N49A 1YJWA 2UUCQ 3FDTA 2C35B 4DV4Q 4ID6A 3HS0C 3HOXB 4IUVA 3HOVH 1PFNA 2PW7A 1R4PB 3Q8DA 4DV0L 1L1OB 4U673 5E7NA 4RH6A 4DV6Q 3OHXC 4HCEA 3PO3G 1BCPF 2PZTA 3FPUB 2AHOB 2PMZE 5AFWA 1YEZA 1AH9A 4O2DA 5D3IB 3E9IA 1HZ9A 1W6KA 4WJWA 2LSSA 4JK1C 4PV1C 4JG2A 4P71A 3M85A 1SE4A 4YCWA 4BBSG 2OWOA 3G6EA 3S17H 5M5YH 4C3JH 2EY2A 4HJ5A 4HAEA 2Z0SA 5J39A 2F0VA 4LF6Q 1X6OA 4K5WA 1MJEA 2NTTA 1HUNA 1FNUA 1X54A 1SBBB 3KBXA 3KFUA 3WWVA 3J7ZC 3CXCA 1JJ2A 5TSSA 3LNNA 2QF7A 4PNYA 2HHHL 4J15A 4ZAIA 3CHBD 4GKJQ 1SEBD 3GTPH 1TWGH 4RHSA 1J8IA 4OWXB 4A3CG 2QGQA 3CPFA 3CKIB 4HJ8A 4DK0A 3Q23A 2EYLA 2HIVA 5IIFA 2L0CA 1W2BA 2WV6D 1GUTA 3MVVA 1K28A 1W6JA 4DV0Q 3DLLA 4QQBX 2G5DA 4HEDA 1D5ZC 1SSOA 1PTOB 1HFNA 2UXBQ 2X6LA 3KLRA 2Q2IA 1KTKA 3U4ZA 1A3UA 3I4NH 4WORA 4JI8L 3K80C 3GTOB 2JEBI 3OW7A 2F0HA 1HR0Q 4DR1L 5JAVA 4POFA 4JI6Q 1BF4A 2HDMA 1ET9A 4GLXA 4IPCA 3MA2B 4RG1A 1V1PB 2QEXA 3R93A 4DR5Q 1TWAH 4QMGA 1JCKB 5KEEA 3OTOQ 3A7AB 5EPKA 1LT5D 1Y8NB 4QIWE 2L12A 2NB0A 3MEFA 1PH6A 4DK6C 4JI3Q 1GUGA 4X65Q 3HG9A 1PFMA 4A3MB 3BJUA 3I90A 3NUCA 2E5LL 1A8VA 1SJHD 4RA8A 2HHHQ 2IHFA 1XXGA 1NSNS 4UP7A 2RA4A 1BBXC 1I3QH 1WD1A 1BBUA 3A74A 2QCPX 2ICEC 2ZT9C 1MSGA 2NVTB 2VUMB 1IBKQ 3D0FA 2KHJA 1XMOL 3VYTA 1OXUA 3DEOA 3FKIG 2L9HA 2OEOA 2KECA 3RZOH 5G3LF 2A69C 2ZTDA 4LF9Q 3S1QB 2JA5H 2WP8J 5E3FA 4HJAA 3K5OA 1SFOH 1B9NA 1Q12A 2UXDQ 1WVLA 4GNXA 2SNSA 1PH2A 1FL0A 5C4JH 3RN5A 1Y1VG 3TS2A 3G4SA 4AYBE 3T13A 2FFKB 3VR6A 3OTOL 2BA1A 3PO3H 2PQEA 2AKWB 3C1FA 1QCBD 2D0OA 2PNHA 2V4DA 4C2MH 2Q8TA 1A6XA 2Y0SG 2K03A 4L6TB 1PTOC 1NE3A 4PG3A 1HRJA 1AZPA 4X3UA 1I4HA 2YTVA 2ZTCA 2R7ZB 4F88A 4F8MA 4BY1G 1CUKA 5FJ8H 4DFAA 5AJ3L 4YWKA 5IGGA 3NELA 4XYQA 2ZJRA 2OF1A 1RHPA 1YHAA 1G6ZA 1E7ZA 1NR4A 3K7UC 5FLXE 4CDEC 4HIDA 4GLAC 4TSSA 3PIOA 5I2XA 2DN8A 2JJQA 1RODA 3QG1A 5EKKA 1LTBD 1DXMA 1TY0A 3HFZB 3CF5A 1VQHA 4LF9L 2E2HB 5JJIA 3PUZA 5FLXL 5M3MH 3L7ZC 1H95A 4ZCKA 3KBGA 4OWTB 3SHLA 2KHIA 2BOSA 3TEHB 1PYSB 2H4OA 2XIWA 3AYHB 1ASYA 3B6YA 1PVOA 1QNUA 3NTKA 4BBSH 5M3MG 2WKCA 2NN6I 4C3JG 3RN2A 2DY8A 1JJCB 2DNCA 1YHQA 1HNXL 4ME5A 2HUGA 4XIGS 2RVLA 1TWHH 4TKOB 1PYWD 3HEJA 3S1RH 1K8OA 1Q81C 1ZYRC 3DM3A 4RGMA 2NVYH 5NUCA 1PH7A 4IPDA 1LTAD 2I5LX 2NN6H 1KABA 5ELFA 2GVAA 4IOCA 3R3OA 4HIOA 3I3CA 4RMFA 4ABNA 5I9PA 3J80c 2EXDA 3GTGB 1O7ZA 2A68D 2Z4HA 5L37A 1SDFA 4GOPB 1N33L 4K2KA 4IJLA 1JMCA 3HGBA 5EKLA 1VQLA 1ICFB 2FHTA 4KY7A 3UDGA 1GD7A 2ZJQA 5C44B 1Q46A 5HURA 2IHEA 1PHJA 3S17B 1Q90A 3DUZA 1EWHA 2VUMG 1I5FA 2K5HA 2EDGA 3Q0AA 3SVMA 3D3RA 2L15A 3NP8A 3L2PA 1HR0W 1ENCA 2YU9B 1DJRD 1X3PA 4GN3B 1ZKOA 1LLRD 3EFXD 4LF4Q 4X3SA 3G71A 4DUYL 4L5RC 4A93H 1TY2A 3PO2G 1HH2P 1AN8A 1V1PA 4R4CA 5D3DA 1S3OA 1ZXTA 1KD1C 2FINB 3I4MH 4IALA 1WTRA 4QF4A 4K5XA 3MXPA 1JJGA 1XJVA 2K5NA 1KNEA 4FP5D 1CZGA 3LX0A 4KKUA 4S3SA 4UPAA 3PIPA 1GVPA 3E9HA 2PW5A 1STGA 5KNDA 1WTHA 1D1IA 3K81C 5IT9L 3I4NB 3HOYG 1K83H 4EX5A 1N32L 1XNRQ 1T9HA 3RNUA 1X3FA 4JI1L 4XTCS 2M2LA 2EYFA 2PZUA 1B53A 2KEDA 4LF8L 1QOHA 2CKZB 1BCPD 2KCTA 5D65A 1N8RC 3H3VI 3TMEA 2ZXPA 2PZWA 1B70B 4OWWB 1KRTA 4DGZA 2VW9A 4DNIA 4A3BB 1SXTA 5EPLA 4X66Q 4DR4L 4C3JB 1HA6A 3H15A 1SYFA 3I72A 1S4ZA 3LWUA 1EYCA 3KF6A 3BZKA 4OIJA 2IX3A 5CBAE 1XWEA 3GTLH 4I7AA 4LFAL 1VF5C 1KQSA 2M9VA 4A3FH 3NK9A 2ZTEA 2ES2A 3MXNB 2J4XA 4OHJA 1TWGB 5J1ZA 2E8GA 3NBHA 3PCOB 3TQYA 1WTPA 2F0TA 1LTID 4Q0FA 4A3LH 1BCPB 4Z9CB 3A0JA 4QUCA 4JCVE 4JI2L 4CGYB 4DV3L 4HIMA 1NTGA 4CJ0B 1WI5A 3SDZA 4FO2A 1TS4A 5C4JB 5IP7H 1EL0A 3J81E 3U9OA 4PMBA 3NE5B 2JP1A 1Y14B 4IFDG 4LF5L 2K7VA 5BR8L 4A3EB 2CW0D 1I94L 2AQ2B 3HOUB 2DJFC 1RJTA 2VXWA 4EGVA 3GTOH 1ICWA 4C2MB 5IWAQ 4A3JG 5C4XB 4B08A 3SK4A 4DNRB 1U4PA 4LF7Q 1CHPD 4A3KB 3QWNA 1WJJA 4DAVA 5CR3A 4R8IA 4UAIA 3GTQB 4U68A 5JPNC 3CCUA 1H9MA 3HOZG 3IRBA 4DR6Q 4X3TA 1CKNB 3L3OC 3MWYW 2F0QA 5I9OA 4K0KL 4DNTB 3SK5A 1S40A 1XTCD 4GN4B 4FXKC 3OOCA 3URYA 4POGA 1R4QB 3NTHA 5ELDA 2MJ8A 3UI2A 1VQBA 4BBRH 1NBWA 3R2TA 1AE3A 4K6LA 4PMWA 1VQ4A 2WAQB 1QVGA 4KHPL 2CH4A 4DV4L 4BA2I 2AWNA 3UE1A 5M5WH 4PQXA 2A74C 1WYDA 4RKLA 1B3AA 4E6IA 5C3WA 1B2TA 2B29A 3D4DA 4JI7L 3STBC 3OMCA 3C46A 1Z6HA 2F0OA 1TWHB 3D4RA 1QUQB 2F0DA 2NVYB 1I4RA 1AP0A 5IT9E 3EBEA 3CPWA 1B9MA 4GN5A 2Z1CA 1UEBA 1ESRA 4JBWA 1RIPA 3PO2H 5BN4A 3S15B 2VQEL 3PO3B 1B1ZA 2D5DA 4DR6L 1PH9A 4YIJA 1EZ6A 4EQ5A 3BDCA 2UXCL 3K5MA 1IYUA 1SROA 4HN7A 4H44C 3RLNA 4MTKA 5GADC 3GTKH 2F0FA 1DYQA 2UU9Q 2K5DA 1Q1EA 1I50H 4BY1B 3CAMA 4XXEA 1RF2D 4IUQA 1K9MC 2NVQB 1KDBA 1SJED 2GA4B 2B2YA 2B2TC 3RLOA 1FVIA 4Y7NH 3MAQA 1CSQA 5IYCH 1YNNC 4DK1A 1X65A 1ASZA 5M3MB 1CTMA 3ERQA 4ALPA 1E2ZA 5A2QL 1VQKA 4LMQD 1BO0A 1TS5A 3DMUA 1W3SA 2IX1A 2UXBL 3TP5A 1UE6A 3J80L 3TP7A 3R2IA 4LK1C 2B2WA 2UUBQ 1DOMA 2KJXA 4FVMA 2RCFA 2MUYA 2MGSA 3AFQA 1S72A 4NXMQ 1F9QA 1PH5A 3KUPA 1XNRL 2KCNA 3EVQA 1I4QA 4QIWB 3N6RA 2ATWA 1K3RA 2DUDA 3ULJA 5CORA 4BBRG 1TWCB 3PQIA 1LT6D 4LF8Q 3OIQA 1DONA 2NN6G 3GTGH 3K7AB 3ND8A 2YYZA 3PMFA 3U50C 4CDCC 1XTDA 3E6ZX 1PFBA 3NWTA 4DUYQ 2EYPA 1M8AA 2JA6B 1KAWA 5EPJA 1TIID 1STHA 4A3BH 2X69A 3ICEA 3HOXH 3CMEA 1U4MA 1KLUD 3ND9A 5FO7B 3GTJH 5EJWA 2Y0SE 3A56A 1XMOQ 3F2DA 4FF4A 2K5VA 3K0YA 4DR3Q 1PZJD 4R4QA 3W3AA 2VQFQ 4N9TA 1XX8A 2F0GA 1WTWA 2E75C 4LFBQ 2UXDL 1EOTA 1K8MA 1XYIA 4AYBB 3J7AF 4HSVA 1N36L 1QE6A 3CCMA 4QY7A 1FGBD 1Q3LA 3KDFB 1CM9A 1XMQQ 3H91A 1UNSA 4DV1Q 5M5YB 4KN4C 4QB4A 4C3HH 4I7ZC 5LMUQ 1I4GA 4WFN3 2R61A 3EQLC 1JB3A 2QKIC 4DAMA 5IP9H 4HJ7A 5JJKA 1H9SB 4LUZA 4C3IH 4A4IA 3OWEB 4YWLA 3AEVA 4NXNL 1BXTA 5T1GA 3BDOA 1HZBA 4LF5Q 2JSOA 5CV6A 4FF3A 2JA5G 2E2JH 1B7YB 1Q8IA 1HUMA 1D8LA 1R9TH 1IL2A 1JICA 3GTPB 4DR4Q 2ICIA 5LHY1 3S1MB 3D6WA 1EY0A 4A3KH 3NXWA 2VB3X 4KLKA 1BCPC 2A1AA 5FO9B 3GTQH 2D2CC 4WJ4A 1CKOA 3TN2A 1QG7A 4EQPA 3KK7A 4JBJA 5ELNA 1HCZA 1MBYA 4K0KQ 1SYDA 5ELEA 2EY5A 1VS0A 5IGDA 3S1NH 4JI0Q 4GOPC 2Z6BA 1YNXA 1RD9D 1E0BA 2N88A 1H9JA 3RZDB 2K75A 3F1ZA 4P74A 3KYHC 3IFTA 1WCMH 4GKKQ 4HSPA 4KHPQ 3DHQA 1SMYD 2K5QA 2WB1G 4BS9A 1PV4A 1PH3A 3JAML 3MXUA 1SYBA 1VQNA 3GTLB 1HHVA 2WKDA 2A8VA 1EU4A 5F2DA 5M5WB 4A3FB 1Y8PB 1LABA 3H0GG 1C8CA 2C5CA 4IN3A 3PUYA 1U0LA 1E1TA 3TRZA 2RBMA 3GD7A 1EWCA 4JI8Q 3RD4A 3VDYA 1JC7A 3AFPA 1KAAA 3IFDA 3H3VH 1EFID 3VYUA 2K50A 3AB9A 1HQRD 2HT1A 3TSSA 2B63B 5A2QE 1YVCA 4APVA 4JOIA 3V05A 3K58A 5CV9A 3FVQA 1HZAA 3GP7A 2MO0A 2VS1A 2DNEA 2F0UA 5CV4A 1UAPA 1Q7YC 1EZ8A 1UE1A 2LY7A 4IUNA 3W1BA 2R92B 5IODA 4CHTB 2E5LQ 1CFMA 2JK8A 4MTNA 3NBHB 2KQ3A 1OO9B 3GTKB 2E74C 1G6PA 4LF4L 2HDLA 2Z9HA 5I4DA 4MN3A 1I50B 1GUSA 1VQJA 1B3QA 1QZHA 3VA7A 2BE5C 5C6AA 4HTHA 1JWMD 1EY7A 1V8QA 5IYBH 1AFPA 5FLMH 1IL8A 3G7LA 4X64L 1X3GA 1X3EA 3J81c 1UE5A 3N52A 4L63B 4KD4A 4WJ3M 3SXHA 1TWFH 2DY7A 1VCIA 3I4OA 3HKZE 2WAQG 4DV7L 2EY1A 4JBKA 1KNAA 1D5XC 3DEPA 5CV5A 4F7XA 5E4XA 4LNQA 2KHSA 1X32A 4QL5A 4CJ2C 3CD6A 5GAEC 3CC4A 5KYIA 1N32Q 3U58A 4NXML 1JOQA 4A3MH 3MEHA 3KDFA 4ZUJA 1TR5A 5JEAJ 4A3DG 5DEHA 3GO5A 3CP0A 4N9PA 5IGCA 3S24A 2E2HH 4DAYB 3T1YQ 1SE8A 5I6WA 1MD2D 5M3FG 4NDXA 3FEWX 2ZJPA 3FKIH 2JA7B 3P1HA 3M9BA 1VF7A 3J7AV 1WTOA 3RZOB 2WACA 2AUKA 2XWJB 3V96A 2RDFA 2IL8A 5IP9G 3S2HH 5C4ZA 3LGJA 3ZJYC 1EQVA 1Y1VB 3H0GH 2L11A 2JA6H 3M3YB 1HNZL 1DOLA 1QNKA 3MFGA 1EQTA 3I70A 2OCEA 2NVQH 4G7OC 1ZEQX 1EQRA 1SNPA 4LFCQ 3RMHA 1EY8A 2B2WC 3BYYB 2K01A 3MFYA 4C3IG 3A8IE 3HOZB 3TREA 4JI2Q 2KVMA 3WOFA 1FD7D 1RTNA 1Y8OB 4K8JA 1CT1D 1XMQL 1NUCA 1E2VA 3I4MG 2R93B 4C3HB 1TU2B 2MPMA 1GJXA 2F4VQ 1LT3D 4IFDH 1WTXA 1PH4A 4X3KA 3HZXA 4HMIA 5CV8A 1Y69U 4XQJA 4KJOA 1VDZA 1HQMC 2KUMA 3I73A 1WFQA 4RCOA 1A63A 2A6EC 4OL7A 3K57A 2B3GA 4GNXB 5DAUA 5I6YA 4A3EG 3J7A5 4LWCA 4M1UB 1FR3A 1NMGA 1NY4A 5EBDA 4QCLA 3Q24A 1EYDA 2BCOA 4R4TA 4RHRA 2FMCA 1BNZA 1Z9FA 1YNND 3I4MB 3K59A 4G7HC 1VQIA 2LFNA 5M5XB 4JI5L 4JI4L 3S2DH 4GOPA 4K8IA 1D6EC 3GV6A 3E0EA 1TVXA 4RGTA 2I46A 4GKJL 3S1NB 1PTOF 2KBNA 4QGUA 3ITPA 1K83B 1EU3A 1HA5A 2JA9A 1OXTA 4A3LG 3QIAA 1AE2A 3HOWH 2EPBA 1VQPA 5FKAC 1FNWA 2KEEA 3J81L 2EYHA 3C1EA 1C4QA 1PMRA 3X3NA 1E1OA 2A6ED 1B8AA 4NMZA 1EEID 2A19A 1PTOD 4B3MQ 1L0WA 2F4VL 4B3TL 2R7FA 1G91A 2VY3A 2F1MA 4DR1Q 1EY6A 3F2CA 4J6HA 3CCJA 5FLMG 1PRTF 1GXDC 3M4PA 5C44H 1AZQA 2JA8H 2WB1B 3BG3A 4AH6A 1EIYB 4DXGA 4DR5L 3NPPA 2F0EA 2UUAL 1NJIC 1E2WA 3A5ZB 1O80A 2UU9L 4LUOA 3D31A 4C3HG 4KI0A 3M7NA 1BOSA 2CVRA 1YZ6A 4JI5Q 5COYA 1PRTC 1L1OC 1SYCA 4KKSA 1CA6A 2PQAA 1Z47A 1R9TB 1G8ZD 4DU9A 3BS1A 1TXYA 2F0NA 4OEMB 4OIKA 3J7YW 3BZDB 1A15A 2QW7A 2EJGC 2EXZA 4RFBA 3VYSA 4A75A 1EEFD 4K14A 3UDIA 1G2TA 2VNUD 1I6HH 2EY6A 3L0OA 4LFAQ 5IYCG 3S14H 3LWEA 2MQHA 3QO2A 1VQ8A 3DXJC 4RKBA 1D5MC 5GROA 1OXSC 1C48A 3A8KE 1J5EL 2LMCB 2F3IA 1B4OA 1CHQD 1S5FD 4EQNA 3T4AC 2YTXA 1A0IA 4IQZA 2FMMA 4GZYC 1DOKA 2MNAA 1SNCA 4DPGA 1IHZA 1M90C 1VQAA 4HIKA 1F77A 4TQUS 5T1IA 2NYZD 1DGSA 3HOVG 1EY5A 3SGIA 1PZKD 4A3GG 4MNOA 5ELOA 2VL6A 3HP3A 1B50A 5EKIA 5BR8Q 1JOOA 3MXGA 2HQEA 3W5OA 3OSOA 4R9WA 3HKSA 3MXNA 1CKNA 1V1QA 5E4WC 5AJ3Q 1S5ED 4A3IH 1EYGA 2ZXRA 4DR2Q 1KL9A 1KRSA 1XPRA 4ODGA 2AQ1B 4DUZL 1HTPA 3H94A 5ELBA 3KJOA 3EN2A 2CQAA 1G51A 4X64Q 2B2YC 2RHSB 1MHWC 1UE7A 4NP5A 1CZWA 1IBLL 5KYLA 3DWPA 3G6JB 2EE1A 1U4LA 2R92H 4ZUIA 1DM0B 1GKHA 4KKTA 3PV0A 2VQFL
chains in the Genus database with same CATH topology
1LM0A 2YU9H 1UWVA 2MFIA 4IPHA 1N34L 1EIFA 1HR0L 4LFCL 1Q12A 2UXDQ 5HY6A 4GNXA 5C4XG 1BKBA 2VQFQ 2MO1A 1OXXK 1U5KA 2H5XA 4JI6L 4LFBQ 2GVBA 4YY3L 2JA7G 2UXDL 1VQMA 1FL0A 5C4JH 1PH2A 3RN5A 1Y1VG 3TS2A 1N36L 3G4SA 3BZCA 3KF6B 4AYBE 2BH8A 4JBMA 1PYBA 3CCMA 5LMUL 4QY7A 3KDFB 1XMQQ 3OTOL 4DV1Q 2BA1A 3M4QA 3PO3H 2RF4A 4C3HH 2AKWB 3J81i 3CMAA 1RL2A 5LMUQ 3HOUH 2D0OA 2PNHA 1EUJA 4C2MH 4DAMA 5IP9H 4HJ7A 5FJ8G 4UP9A 4LUZA 5JJKA 1X55A 2Y0SG 4A4IA 4C3IH 2XGTA 1NE3A 4PG3A 4YWLA 3AEVA 3CW2C 1IZ6A 1EOVA 4GS3A 4NXNL 2YTVA 3GDEA 3FP9A 4LF7L 1HZBA 2YTYA 3I55A 4LF5Q 2ZTCA 4A3GH 2JA5G 2E2JH 1HZCA 1Q8KA 1B7YB 5C44G 4A3EH 4BY1G 5EAYA 1CUKA 1VQEA 5FJ8H 5AJ3L 1PA6A 1PFSA 3PF5A 2IY5B 1OXVA 4YWKA 1D8LA 5GAHC 3A5UA 1R9TH 3PUXA 1IL2A 4DR4Q 3NELA 4YWMA 2ZJRA 5IYBG 1N33Q 1YHAA 1XNQQ 2PI2A 1E7ZA 1YI2A 3K7UC 3OYYA 4A3KH 5IE8A 4HIDA 1D7QA 4GLAC 4KLKA 2A1AA 3PIOA 1KHIA 1IBLQ 1Y1WH 1LUZA 2JJQA 3GTQH 1QUQA 4WJ4A 3CF5A 3HFZB 1CKOA 1N9WA 1VQHA 1QVCA 4LF9L 3PUZA 3ULLA 1FJGQ 4JBJA 5ELNA 2I0QA 3M4OH 5M3MH 5LMNL 3L7ZC 4K0KQ 4YCVA 4DR7Q 4ME3A 4JYAQ 1H95A 2R7DA 4OWTB 1VS0A 2KHIA 3S1NH 4JI0Q 4GOPC 3TEHB 1O7IA 1PYSB 1YNXA 3AYHB 1ASYA 3B6YA 2JA8G 1PVOA 4BBSH 5M3MG 5M5XH 2K75A 2JEAI 4B3RL 2N78A 3F1ZA 4GKKL 2NN6I 1VQ5A 5LMNW 2UUCL 4P74A 3KYHC 4FDBA 1P8LA 4MZ9A 3RN2A 1K73C 1JJCB 1WCMH 3K8AA 4GKKQ 1YHQA 4OX9Q 4KHPQ 2WB1G 2ZM6Q 1HNXL 1X56A 1PV4A 3FHWA 3OW2A 1PH3A 1K8GA 4JI7Q 3CCVA 2BA0A 1Y1VH 4XIGS 1VQNA 1TWHH 4X6AH 2A8VA 5IYDG 1Q82C 1IBML 4A76A 3S1RH 1HNXQ 1Q81C 3DM3A 2NVYH 4NXNQ 2LXKA 3H0GG 4IPDA 5IP7G 2I5LX 1PH7A 1IBMQ 4IOCA 2GVAA 3PUYA 4B3TQ 2K52A 4HIOA 2R92G 1U0LA 1CKMA 4RMFA 1E1TA 4UY8C 3TRZA 1CSPA 3S16H 3GD7A 3J81j 1VQ6A 4JI8Q 3J80c 3VDYA 3NEMA 2EXDA 4DV7Q 4IFDJ 3AFPA 2E2IH 2PQAB 3H3VH 4AIMA 4GOPB 1N33L 4IJLA 1XNQL 1JMCA 3PV0A 2K50A 2HT1A 2UUAQ 1VQLA 1EQQA 4HJ9A 3PF4A 2VUMH 4L5QA 1L1OA 3UDGA 1YVCA 4APVA 1LYLA 2WB1E 4JOIA 1GD7A 1BBWA 2ZJQA 2JA6G 3G48A 1HZAA 1Q46A 2MO0A 2IHEA 2VS1A 1PHJA 4AQYL 1MJCA 4NPSA 5GAGC 4A3FG 3PSIA 1I5FA 1VQFA 2K5HA 4JI3L 1Q7YC 2VUMG 1UE1A 4DR7L 1KC8C 3W1BA 1C9OA 4R4OA 3S1QH 5JJLA 1QVFA 3HKZG 5C4XH 2QA4A 3CC2A 2L15A 5C3EG 2WAQE 3JAMi 2E5LQ 3L2PA 1HR0W 2JK8A 4R1JA 4MTNA 3TS0A 3NBHB 3RLFA 1K0RA 1X9NA 3U4VA 1G6PA 4LF4L 2ID0A 3STBD 4PZ6A 1VQJA 3F8TA 2I5MX 4DV2Q 4IOAA 4GN3B 1HNWQ 1QZHA 2N3SA 4X66L 4LF4Q 1XPUA 4H02A 2B63G 4TVAB 3G71A 5IYBH 4DUYL 4DUZQ 4DV2L 5FLMH 3ULPA 3T1HQ 4L5RC 4A93H 3PO2G 3CCRA 1HH2P 2AMCB 4PZ8A 1X3GA 4R4CA 4X64L 1JT8A 1X3EA 1S3OA 2RHQB 4IO9A 1KD1C 3J81c 1UE5A 3I4MH 4WJ3M 4DV6L 1JJGA 3K0XA 1XJVA 2K5NA 4L5TA 1TWFH 3NENA 2CFMA 4OO1I 3CCQA 3KJPA 1VCIA 4UPAA 3I4OA 3PIPA 1GVPA 3HKZE 2WAQG 1N34Q 2DGYA 4DV7L 3E9HA 4JBKA 4DV5L 2IT1A 1PH1A 3PUVA 4BXXH 4LNQA 3K81C 2ASBA 3UDXA 3HOYG 2NVXH 4QL5A 4YY3Q 1K83H 4EX5A 4DV5Q 1N32L 3CD6A 4R4IA 1T9HA 1XNRQ 2UUBL 5GAEC 3CQZH 4LUVA 4GNXC 1N36Q 3CC4A 4DV3Q 4A3CH 3RNUA 4JOIC 1X3FA 3S1MH 5J3BA 4JI1L 5C0XG 1N32Q 3U58A 4NXML 4XTCS 2Z6KA 4DV1L 4A3MH 1EWIA 3KDFA 4DKAC 4BA1I 1Q1BA 4O0AA 1WOCA 2R6GA 5JEAJ 4LF8L 4A3DG 2CKZB 4A93G 3GO5A 1VQ9A 1QZGA 3CP0A 2E2HH 3CCEA 2KCTA 2V1CC 3S24A 4DAYB 1SLJA 1K8AC 1N8RC 4GLVB 3H3VI 3T1YQ 1SE8A 2NVTH 1VQDA 1C0AA 1JE5A 4DR2L 5M3FG 1VQGA 5GQOA 3T1YL 1B70B 1TWCH 4QJFA 1KRTA 3RR5A 4OWWB 2VW9A 4DNIA 2ZJPA 3S15H 1KXLA 1VQCA 3FKIH 4X66Q 3KLWA 3M9BA 4DR4L 3I7FA 3H15A 2IX0A 4BXXG 1YJ9A 3S2HH 5IP9G 3KF6A 3BZKA 3LGJA 3ZJYC 3H0GH 3GTLH 2JA6H 1HNZL 4LFAL 1FJGL 4A3JH 1KQSA 4BY1H 4A3FH 2ZTEA 2ES2A 3AQQA 3MXNB 4A3DH 1G291 4LFBL 4IJHA 1FGUA 2E8GA 2OCEA 2EIFA 4OONA 3J80i 2NVQH 3PCOB 3UE0A 2K4KA 3TQYA 1EQRA 2I5HA 2R93G 2Q2TA 4LFCQ 3CCSA 4A3LH 1XPOA 1HJPA 2KCMA 3A0JA 3PGZA 4JCVE 3I2ZA 5M3FH 1YITA 4DV3L 2CQOA 4NB3A 4HIMA 2AWOA 4JI2L 2JQOA 1NTGA 3JC66 4IFDI 1WI5A 2OQKA 3EIVA 3TREA 3HOYH 4JI2Q 2JE6I 5IP7H 4JV5L 5K36G 1E3PA 1XMQL 1Y14B 2RCNA 2NZOA 4X65L 2OTJA 4IFDG 1KIXA 4LF5L 2K14A 5BR8L 1EFWA 5IWAL 1I94L 3I4MG 3GTOH 2CWAA 4X62Q 3I56A 2VZAA 5IWAQ 4A3JG 1I94Q 2F4VQ 3UDFA 4X62L 3I4NG 4JC0A 4LF7Q 1E22A 1LTLA 1PH4A 1YJNA 1WJJA 2R7ZH 1YBYA 1WFQA 1GM5A 3PUWA 1A63A 4GNXB 5IY0A 2HQLA 2B3GA 3CCUA 5HGQA 4A3EG 3HOZG 3IRBA 1P16A 3J7A5 1PH8A 4LWCA 1IXRA 4DR6Q 1CKNB 1NMGA 1NY4A 3GTMH 4BY7H 5LMNQ 4K0KL 4R4TA 2R7ZG 1J6QA 4JI4Q 1S40A 5C3EH 3CCLA 1SR3A 1Z9FA 4JI0L 4A3BG 4GN4B 1E24A 4A3KG 1VQIA 4JI4L 3HOXG 4JI5L 3RZDH 1VQ7A 4POGA 4GOPA 3K7AH 3S2DH 4YHHQ 4B3SQ 2Q2UA 1WCMG 1VQBA 4BBRH 4PZ7A 1NBWA 3BU2A 3E0EA 1AE3A 4P75A 2NZHA 4JYAL 3JAMc 4PMWA 1VQ4A 1QVGA 4GKJL 3ER0A 4DK3C 3KOJA 1BVSA 4OX9L 4KHPL 2KBNA 4QGUA 4DV4L 1HNWL 2ALYB 4BA2I 1VQOA 2EQSA 2N49A 1YJWA 1GO3E 2UUCQ 2AWNA 2C35B 3UE1A 2JA9A 1OXTA 5M5WH 2OQ0A 4DV4Q 3T1HL 1AE2A 2CCZA 3HOVH 4A3LG 1WYDA 4JV5Q 3HOWH 2OTLA 1SN8A 1VQPA 4P72A 3Q8DA 4DV0L 1L1OB 1JB7A 5E7NA 5C0XI 2B29A 5DLQE 4JI7L 4DV6Q 3STBC 1YIJA 1E1OA 2D0PA 3PO3G 1B8AA 2A19A 2AHOB 2PMZE 2F52A 3W1GA 4B3MQ 1L0WA 1QUQB 1YEZA 2F4VL 4B3TL 5IYDH 4O2DA 1AH9A 3E9IA 2R7FA 3EBEA 2HIXA 1HZ9A 1YHBA 2VY3A 3CPWA 4B3ML 4GN5A 2LSSA 4DR1Q 2B63H 1UEBA 4Y52H 3F2CA 3CCJA 5FLMG 4JBWA 1RIPA 4JG2A 3M4PA 4P71A 5C44H 3M85A 2JA8H 3PO2H 4YCWA 4BBSG 2YV5A 2VQEL 2JA7H 4AH6A 1EIYB 3G6EA 2OWOA 3S17H 5M5YH 4C3JH 4DR5L 4DR6L 1PH9A 4HJ5A 2Z0SA 4EQ5A 2UXCL 2UUAL 1NJIC 1SROA 4LF6Q 4OXPA 3A5ZB 1X6OA 5JEAG 1MJEA 2UU9L 2UXCQ 4LUOA 3RLNA 3D31A 3HOUG 1X54A 4KI0A 3M7NA 4UP8A 5GADC 4LF6L 1YZ6A 3CC7A 4JI5Q 3GTKH 4L5SA 3KFUA 3M3YH 3WWVA 1Y1WG 2UU9Q 4YHHL 1L1OC 5H1SE 3J7ZC 1Q1EA 1I50H 4AQYQ 4B3SL 3CAMA 2PQAA 3CXCA 1JJ2A 1Z47A 2HHHL 4J15A 4B3RQ 4GKJQ 2D62A 1TWGH 1TXYA 3GTPH 1K9MC 4OWXB 4A3CG 2QGQA 3CPFA 4HJ8A 3RLOA 2HIVA 1FVIA 4Y7NH 2ZM6L 4A75A 1W2BA 1CSQA 5IYCH 1C7YA 4YCUA 3UDIA 1L2FA 2VNUD 4DV0Q 3DLLA 3HOZH 1I6HH 1X65A 1ASZA 4QQBX 1Q86C 3ERSX 5C0XJ 1SMXA 4IPGA 3L0OA 4ALPA 2UXBQ 4LFAQ 5IYCG 3S14H 2MQHA 2Q2IA 1VQ8A 1VQKA 2R93H 3U4ZA 3F2BA 1J5EQ 4DR3L 3I4NH 2XTIA 1W3SA 4JI8L 3K80C 5GROA 2JEBI 2IX1A 2UXBL 1UE6A 1HR0Q 1OXSC 2BH2A 1J5EL 2N8NA 4DR1L 2UUBQ 4POFA 4A3MG 2F3IA 4JI6Q 4GLXA 2YTXA 1A0IA 3AFQA 4IPCA 1NMFA 4RG1A 2VQEQ 2QEXA 2MNAA 1S72A 4NXMQ 4DR5Q 4BY7G 1TWAH 2FXQA 1PH5A 4DPGA 5FLXc 2Q2HA 1M90C 1VQAA 3OTOQ 1IYJB 2WFWA 4HIKA 4TQUS 1OTCA 1XNRL 4OO1G 2Z6KC 1DGSA 1V43A 3HOVG 2ATWA 4QIWE 1K3RA 1V9PA 4JI1Q 3MEFA 2DUDA 3SGIA 3ULJA 4DK6C 1PH6A 4JI3Q 3HOWG 4MNOA 5ELOA 4X65Q 4A3GG 2VL6A 5BR8Q 3BJUA 1M1KC 4BBRG 4LF8Q 2E5LL 4KHZA 1A8VA 2NN6G 2HHHQ 3GTGH 2IHFA 1SRUA 3W5OA 2YYZA 4UP7A 1IBKL 3HKSA 1I3QH 3U50C 1BBUA 1CKNA 1V1QA 3A74A 4LW1A 1A62A 1XTDA 5AJ3Q 4A3IH 5JJIA 1EYGA 4DR2Q 1KL9A 1KRSA 1XPRA 4AYBG 1IBKQ 3D0FA 4DUYQ 4DUZL 4P73A 2PI2E 3KJOA 3EN2A 2LXJA 1G51A 1KAWA 2KHJA 4X64Q 4A3BH 2KENA 3KF8B 5IT9c 1HNZQ 2RHSB 1UE7A 4A3IG 1XMOL 3ICEA 1MKHA 1OXUA 3FKIG 3HOXH 2CWPA 3CMEA 1IBLL 3RZOH 2ZTDA 3GTJH 2Y0SE 4LF9Q 2R92H 1XMOQ 3F2DA 2JA5H 2WP8J 2K5VA 1GKHA 4HJAA 2GN5A 4DR3Q 1SFOH 4R4QA 1MIUA 2VQFL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  2YU9 H;  1UWV A;  2MFI A;  4IPH A;  1N34 L;  1EIF A;  1HR0 L;  4LFC L;  1Q12 A;  2UXD Q;  5HY6 A;  4GNX A;  5C4X G;  1BKB A;  2VQF Q;  2MO1 A;  1OXX K;  1U5K A;  2H5X A;  4JI6 L;  4LFB Q;  2GVB A;  4YY3 L;  2JA7 G;  2UXD L;  1VQM A;  1FL0 A;  5C4J H;  1PH2 A;  3RN5 A;  1Y1V G;  3TS2 A;  1N36 L;  3G4S A;  3BZC A;  3KF6 B;  4AYB E;  2BH8 A;  4JBM A;  1PYB A;  3CCM A;  5LMU L;  4QY7 A;  3KDF B;  1XMQ Q;  3OTO L;  4DV1 Q;  2BA1 A;  3M4Q A;  3PO3 H;  2RF4 A;  4C3H H;  2AKW B;  3J81 i;  3CMA A;  1RL2 A;  5LMU Q;  3HOU H;  2D0O A;  2PNH A;  1EUJ A;  4C2M H;  4DAM A;  5IP9 H;  4HJ7 A;  5FJ8 G;  4UP9 A;  4LUZ A;  5JJK A;  1X55 A;  2Y0S G;  4A4I A;  4C3I H;  2XGT A;  1NE3 A;  4PG3 A;  4YWL A;  3AEV A;  3CW2 C;  1IZ6 A;  1EOV A;  4GS3 A;  4NXN L;  2YTV A;  3GDE A;  3FP9 A;  4LF7 L;  1HZB A;  2YTY A;  3I55 A;  4LF5 Q;  2ZTC A;  4A3G H;  2JA5 G;  2E2J H;  1HZC A;  1Q8K A;  1B7Y B;  5C44 G;  4A3E H;  4BY1 G;  5EAY A;  1CUK A;  1VQE A;  5FJ8 H;  5AJ3 L;  1PA6 A;  1PFS A;  3PF5 A;  2IY5 B;  1OXV A;  4YWK A;  1D8L A;  5GAH C;  3A5U A;  1R9T H;  3PUX A;  1IL2 A;  4DR4 Q;  3NEL A;  4YWM A;  2ZJR A;  5IYB G;  1N33 Q;  1YHA A;  1XNQ Q;  2PI2 A;  1E7Z A;  1YI2 A;  3K7U C;  3OYY A;  4A3K H;  5IE8 A;  4HID A;  1D7Q A;  4GLA C;  4KLK A;  2A1A A;  3PIO A;  1KHI A;  1IBL Q;  1Y1W H;  1LUZ A;  2JJQ A;  3GTQ H;  1QUQ A;  4WJ4 A;  3CF5 A;  3HFZ B;  1CKO A;  1N9W A;  1VQH A;  1QVC A;  4LF9 L;  3PUZ A;  3ULL A;  1FJG Q;  4JBJ A;  5ELN A;  2I0Q A;  3M4O H;  5M3M H;  5LMN L;  3L7Z C;  4K0K Q;  4YCV A;  4DR7 Q;  4ME3 A;  4JYA Q;  1H95 A;  2R7D A;  4OWT B;  1VS0 A;  2KHI A;  3S1N H;  4JI0 Q;  4GOP C;  3TEH B;  1O7I A;  1PYS B;  1YNX A;  3AYH B;  1ASY A;  3B6Y A;  2JA8 G;  1PVO A;  4BBS H;  5M3M G;  5M5X H;  2K75 A;  2JEA I;  4B3R L;  2N78 A;  3F1Z A;  4GKK L;  2NN6 I;  1VQ5 A;  5LMN W;  2UUC L;  4P74 A;  3KYH C;  4FDB A;  1P8L A;  4MZ9 A;  3RN2 A;  1K73 C;  1JJC B;  1WCM H;  3K8A A;  4GKK Q;  1YHQ A;  4OX9 Q;  4KHP Q;  2WB1 G;  2ZM6 Q;  1HNX L;  1X56 A;  1PV4 A;  3FHW A;  3OW2 A;  1PH3 A;  1K8G A;  4JI7 Q;  3CCV A;  2BA0 A;  1Y1V H;  4XIG S;  1VQN A;  1TWH H;  4X6A H;  2A8V A;  5IYD G;  1Q82 C;  1IBM L;  4A76 A;  3S1R H;  1HNX Q;  1Q81 C;  3DM3 A;  2NVY H;  4NXN Q;  2LXK A;  3H0G G;  4IPD A;  5IP7 G;  2I5L X;  1PH7 A;  1IBM Q;  4IOC A;  2GVA A;  3PUY A;  4B3T Q;  2K52 A;  4HIO A;  2R92 G;  1U0L A;  1CKM A;  4RMF A;  1E1T A;  4UY8 C;  3TRZ A;  1CSP A;  3S16 H;  3GD7 A;  3J81 j;  1VQ6 A;  4JI8 Q;  3J80 c;  3VDY A;  3NEM A;  2EXD A;  4DV7 Q;  4IFD J;  3AFP A;  2E2I H;  2PQA B;  3H3V H;  4AIM A;  4GOP B;  1N33 L;  4IJL A;  1XNQ L;  1JMC A;  3PV0 A;  2K50 A;  2HT1 A;  2UUA Q;  1VQL A;  1EQQ A;  4HJ9 A;  3PF4 A;  2VUM H;  4L5Q A;  1L1O A;  3UDG A;  1YVC A;  4APV A;  1LYL A;  2WB1 E;  4JOI A;  1GD7 A;  1BBW A;  2ZJQ A;  2JA6 G;  3G48 A;  1HZA A;  1Q46 A;  2MO0 A;  2IHE A;  2VS1 A;  1PHJ A;  4AQY L;  1MJC A;  4NPS A;  5GAG C;  4A3F G;  3PSI A;  1I5F A;  1VQF A;  2K5H A;  4JI3 L;  1Q7Y C;  2VUM G;  1UE1 A;  4DR7 L;  1KC8 C;  3W1B A;  1C9O A;  4R4O A;  3S1Q H;  5JJL A;  1QVF A;  3HKZ G;  5C4X H;  2QA4 A;  3CC2 A;  2L15 A;  5C3E G;  2WAQ E;  3JAM i;  2E5L Q;  3L2P A;  1HR0 W;  2JK8 A;  4R1J A;  4MTN A;  3TS0 A;  3NBH B;  3RLF A;  1K0R A;  1X9N A;  3U4V A;  1G6P A;  4LF4 L;  2ID0 A;  3STB D;  4PZ6 A;  1VQJ A;  3F8T A;  2I5M X;  4DV2 Q;  4IOA A;  4GN3 B;  1HNW Q;  1QZH A;  2N3S A;  4X66 L;  4LF4 Q;  1XPU A;  4H02 A;  2B63 G;  4TVA B;  3G71 A;  5IYB H;  4DUY L;  4DUZ Q;  4DV2 L;  5FLM H;  3ULP A;  3T1H Q;  4L5R C;  4A93 H;  3PO2 G;  3CCR A;  1HH2 P;  2AMC B;  4PZ8 A;  1X3G A;  4R4C A;  4X64 L;  1JT8 A;  1X3E A;  1S3O A;  2RHQ B;  4IO9 A;  1KD1 C;  3J81 c;  1UE5 A;  3I4M H;  4WJ3 M;  4DV6 L;  1JJG A;  3K0X A;  1XJV A;  2K5N A;  4L5T A;  1TWF H;  3NEN A;  2CFM A;  4OO1 I;  3CCQ A;  3KJP A;  1VCI A;  4UPA A;  3I4O A;  3PIP A;  1GVP A;  3HKZ E;  2WAQ G;  1N34 Q;  2DGY A;  4DV7 L;  3E9H A;  4JBK A;  4DV5 L;  2IT1 A;  1PH1 A;  3PUV A;  4BXX H;  4LNQ A;  3K81 C;  2ASB A;  3UDX A;  3HOY G;  2NVX H;  4QL5 A;  4YY3 Q;  1K83 H;  4EX5 A;  4DV5 Q;  1N32 L;  3CD6 A;  4R4I A;  1T9H A;  1XNR Q;  2UUB L;  5GAE C;  3CQZ H;  4LUV A;  4GNX C;  1N36 Q;  3CC4 A;  4DV3 Q;  4A3C H;  3RNU A;  4JOI C;  1X3F A;  3S1M H;  5J3B A;  4JI1 L;  5C0X G;  1N32 Q;  3U58 A;  4NXM L;  4XTC S;  2Z6K A;  4DV1 L;  4A3M H;  1EWI A;  3KDF A;  4DKA C;  4BA1 I;  1Q1B A;  4O0A A;  1WOC A;  2R6G A;  5JEA J;  4LF8 L;  4A3D G;  2CKZ B;  4A93 G;  3GO5 A;  1VQ9 A;  1QZG A;  3CP0 A;  2E2H H;  3CCE A;  2KCT A;  2V1C C;  3S24 A;  4DAY B;  1SLJ A;  1K8A C;  1N8R C;  4GLV B;  3H3V I;  3T1Y Q;  1SE8 A;  2NVT H;  1VQD A;  1C0A A;  1JE5 A;  4DR2 L;  5M3F G;  1VQG A;  5GQO A;  3T1Y L;  1B70 B;  1TWC H;  4QJF A;  1KRT A;  3RR5 A;  4OWW B;  2VW9 A;  4DNI A;  2ZJP A;  3S15 H;  1KXL A;  1VQC A;  3FKI H;  4X66 Q;  3KLW A;  3M9B A;  4DR4 L;  3I7F A;  3H15 A;  2IX0 A;  4BXX G;  1YJ9 A;  3S2H H;  5IP9 G;  3KF6 A;  3BZK A;  3LGJ A;  3ZJY C;  3H0G H;  3GTL H;  2JA6 H;  1HNZ L;  4LFA L;  1FJG L;  4A3J H;  1KQS A;  4BY1 H;  4A3F H;  2ZTE A;  2ES2 A;  3AQQ A;  3MXN B;  4A3D H;  1G29 1;  4LFB L;  4IJH A;  1FGU A;  2E8G A;  2OCE A;  2EIF A;  4OON A;  3J80 i;  2NVQ H;  3PCO B;  3UE0 A;  2K4K A;  3TQY A;  1EQR A;  2I5H A;  2R93 G;  2Q2T A;  4LFC Q;  3CCS A;  4A3L H;  1XPO A;  1HJP A;  2KCM A;  3A0J A;  3PGZ A;  4JCV E;  3I2Z A;  5M3F H;  1YIT A;  4DV3 L;  2CQO A;  4NB3 A;  4HIM A;  2AWO A;  4JI2 L;  2JQO A;  1NTG A;  3JC6 6;  4IFD I;  1WI5 A;  2OQK A;  3EIV A;  3TRE A;  3HOY H;  4JI2 Q;  2JE6 I;  5IP7 H;  4JV5 L;  5K36 G;  1E3P A;  1XMQ L;  1Y14 B;  2RCN A;  2NZO A;  4X65 L;  2OTJ A;  4IFD G;  1KIX A;  4LF5 L;  2K14 A;  5BR8 L;  1EFW A;  5IWA L;  1I94 L;  3I4M G;  3GTO H;  2CWA A;  4X62 Q;  3I56 A;  2VZA A;  5IWA Q;  4A3J G;  1I94 Q;  2F4V Q;  3UDF A;  4X62 L;  3I4N G;  4JC0 A;  4LF7 Q;  1E22 A;  1LTL A;  1PH4 A;  1YJN A;  1WJJ A;  2R7Z H;  1YBY A;  1WFQ A;  1GM5 A;  3PUW A;  1A63 A;  4GNX B;  5IY0 A;  2HQL A;  2B3G A;  3CCU A;  5HGQ A;  4A3E G;  3HOZ G;  3IRB A;  1P16 A;  3J7A 5;  1PH8 A;  4LWC A;  1IXR A;  4DR6 Q;  1CKN B;  1NMG A;  1NY4 A;  3GTM H;  4BY7 H;  5LMN Q;  4K0K L;  4R4T A;  2R7Z G;  1J6Q A;  4JI4 Q;  1S40 A;  5C3E H;  3CCL A;  1SR3 A;  1Z9F A;  4JI0 L;  4A3B G;  4GN4 B;  1E24 A;  4A3K G;  1VQI A;  4JI4 L;  3HOX G;  4JI5 L;  3RZD H;  1VQ7 A;  4POG A;  4GOP A;  3K7A H;  3S2D H;  4YHH Q;  4B3S Q;  2Q2U A;  1WCM G;  1VQB A;  4BBR H;  4PZ7 A;  1NBW A;  3BU2 A;  3E0E A;  1AE3 A;  4P75 A;  2NZH A;  4JYA L;  3JAM c;  4PMW A;  1VQ4 A;  1QVG A;  4GKJ L;  3ER0 A;  4DK3 C;  3KOJ A;  1BVS A;  4OX9 L;  4KHP L;  2KBN A;  4QGU A;  4DV4 L;  1HNW L;  2ALY B;  4BA2 I;  1VQO A;  2EQS A;  2N49 A;  1YJW A;  1GO3 E;  2UUC Q;  2AWN A;  2C35 B;  3UE1 A;  2JA9 A;  1OXT A;  5M5W H;  2OQ0 A;  4DV4 Q;  3T1H L;  1AE2 A;  2CCZ A;  3HOV H;  4A3L G;  1WYD A;  4JV5 Q;  3HOW H;  2OTL A;  1SN8 A;  1VQP A;  4P72 A;  3Q8D A;  4DV0 L;  1L1O B;  1JB7 A;  5E7N A;  5C0X I;  2B29 A;  5DLQ E;  4JI7 L;  4DV6 Q;  3STB C;  1YIJ A;  1E1O A;  2D0P A;  3PO3 G;  1B8A A;  2A19 A;  2AHO B;  2PMZ E;  2F52 A;  3W1G A;  4B3M Q;  1L0W A;  1QUQ B;  1YEZ A;  2F4V L;  4B3T L;  5IYD H;  4O2D A;  1AH9 A;  3E9I A;  2R7F A;  3EBE A;  2HIX A;  1HZ9 A;  1YHB A;  2VY3 A;  3CPW A;  4B3M L;  4GN5 A;  2LSS A;  4DR1 Q;  2B63 H;  1UEB A;  4Y52 H;  3F2C A;  3CCJ A;  5FLM G;  4JBW A;  1RIP A;  4JG2 A;  3M4P A;  4P71 A;  5C44 H;  3M85 A;  2JA8 H;  3PO2 H;  4YCW A;  4BBS G;  2YV5 A;  2VQE L;  2JA7 H;  4AH6 A;  1EIY B;  3G6E A;  2OWO A;  3S17 H;  5M5Y H;  4C3J H;  4DR5 L;  4DR6 L;  1PH9 A;  4HJ5 A;  2Z0S A;  4EQ5 A;  2UXC L;  2UUA L;  1NJI C;  1SRO A;  4LF6 Q;  4OXP A;  3A5Z B;  1X6O A;  5JEA G;  1MJE A;  2UU9 L;  2UXC Q;  4LUO A;  3RLN A;  3D31 A;  3HOU G;  1X54 A;  4KI0 A;  3M7N A;  4UP8 A;  5GAD C;  4LF6 L;  1YZ6 A;  3CC7 A;  4JI5 Q;  3GTK H;  4L5S A;  3KFU A;  3M3Y H;  3WWV A;  1Y1W G;  2UU9 Q;  4YHH L;  1L1O C;  5H1S E;  3J7Z C;  1Q1E A;  1I50 H;  4AQY Q;  4B3S L;  3CAM A;  2PQA A;  3CXC A;  1JJ2 A;  1Z47 A;  2HHH L;  4J15 A;  4B3R Q;  4GKJ Q;  2D62 A;  1TWG H;  1TXY A;  3GTP H;  1K9M C;  4OWX B;  4A3C G;  2QGQ A;  3CPF A;  4HJ8 A;  3RLO A;  2HIV A;  1FVI A;  4Y7N H;  2ZM6 L;  4A75 A;  1W2B A;  1CSQ A;  5IYC H;  1C7Y A;  4YCU A;  3UDI A;  1L2F A;  2VNU D;  4DV0 Q;  3DLL A;  3HOZ H;  1I6H H;  1X65 A;  1ASZ A;  4QQB X;  1Q86 C;  3ERS X;  5C0X J;  1SMX A;  4IPG A;  3L0O A;  4ALP A;  2UXB Q;  4LFA Q;  5IYC G;  3S14 H;  2MQH A;  2Q2I A;  1VQ8 A;  1VQK A;  2R93 H;  3U4Z A;  3F2B A;  1J5E Q;  4DR3 L;  3I4N H;  2XTI A;  1W3S A;  4JI8 L;  3K80 C;  5GRO A;  2JEB I;  2IX1 A;  2UXB L;  1UE6 A;  1HR0 Q;  1OXS C;  2BH2 A;  1J5E L;  2N8N A;  4DR1 L;  2UUB Q;  4POF A;  4A3M G;  2F3I A;  4JI6 Q;  4GLX A;  2YTX A;  1A0I A;  3AFQ A;  4IPC A;  1NMF A;  4RG1 A;  2VQE Q;  2QEX A;  2MNA A;  1S72 A;  4NXM Q;  4DR5 Q;  4BY7 G;  1TWA H;  2FXQ A;  1PH5 A;  4DPG A;  5FLX c;  2Q2H A;  1M90 C;  1VQA A;  3OTO Q;  1IYJ B;  2WFW A;  4HIK A;  4TQU S;  1OTC A;  1XNR L;  4OO1 G;  2Z6K C;  1DGS A;  1V43 A;  3HOV G;  2ATW A;  4QIW E;  1K3R A;  1V9P A;  4JI1 Q;  3MEF A;  2DUD A;  3SGI A;  3ULJ A;  4DK6 C;  1PH6 A;  4JI3 Q;  3HOW G;  4MNO A;  5ELO A;  4X65 Q;  4A3G G;  2VL6 A;  5BR8 Q;  3BJU A;  1M1K C;  4BBR G;  4LF8 Q;  2E5L L;  4KHZ A;  1A8V A;  2NN6 G;  2HHH Q;  3GTG H;  2IHF A;  1SRU A;  3W5O A;  2YYZ A;  4UP7 A;  1IBK L;  3HKS A;  1I3Q H;  3U50 C;  1BBU A;  1CKN A;  1V1Q A;  3A74 A;  4LW1 A;  1A62 A;  1XTD A;  5AJ3 Q;  4A3I H;  5JJI A;  1EYG A;  4DR2 Q;  1KL9 A;  1KRS A;  1XPR A;  4AYB G;  1IBK Q;  3D0F A;  4DUY Q;  4DUZ L;  4P73 A;  2PI2 E;  3KJO A;  3EN2 A;  2LXJ A;  1G51 A;  1KAW A;  2KHJ A;  4X64 Q;  4A3B H;  2KEN A;  3KF8 B;  5IT9 c;  1HNZ Q;  2RHS B;  1UE7 A;  4A3I G;  1XMO L;  3ICE A;  1MKH A;  1OXU A;  3FKI G;  3HOX H;  2CWP A;  3CME A;  1IBL L;  3RZO H;  2ZTD A;  3GTJ H;  2Y0S E;  4LF9 Q;  2R92 H;  1XMO Q;  3F2D A;  2JA5 H;  2WP8 J;  2K5V A;  1GKH A;  4HJA A;  2GN5 A;  4DR3 Q;  1SFO H;  4R4Q A;  1MIU A;  2VQF L; 
#chains in the Genus database with same CATH topology
 1UWV A;  2MFI A;  1N34 L;  1EIF A;  1HR0 L;  2CW0 C;  5M3F B;  5HY6 A;  3J80 E;  1BKB A;  1OXX K;  2H5X A;  4JI6 L;  4YY3 L;  3NQT A;  5DM7 3;  2D9U A;  3QOL A;  4DF7 A;  5JVG 3;  1JR0 D;  4KK7 A;  5LMU L;  1I4P A;  3NBI A;  5M9O A;  2RF4 A;  3J81 i;  3HOU H;  1RL2 A;  3V2T A;  1TWF B;  1EUJ A;  1HPC A;  1DD2 A;  4UP9 A;  1X55 A;  5KRU A;  2XGT A;  5FK9 C;  3CW2 C;  1H9S A;  4LF7 L;  3I55 A;  1Q8K A;  4KY6 A;  1VQE A;  3FMC A;  3TBI B;  2IY5 B;  1BUV T;  3A5U A;  1ML0 D;  2F0I A;  4BY7 B;  2MP1 A;  2IWH A;  1N33 Q;  1XNQ Q;  4IUR A;  1YI2 A;  4H13 C;  5IE8 A;  3A55 A;  3NHH A;  3OPO A;  1IBL Q;  2K05 A;  1LUZ A;  1F2L A;  1EY9 A;  4XDX A;  1PDQ A;  1F2Z A;  1QVC A;  1FJG Q;  3M4O H;  4BBR B;  1WTQ A;  1SE3 A;  4YCV A;  4DR7 Q;  4ME3 A;  4KJN A;  1I4X A;  2X6G A;  3I4L A;  1NCV A;  4RAU C;  1SND A;  2JA8 G;  4B3R L;  5M5X H;  3EA6 A;  1QJO A;  4GKK L;  2F3V A;  4ULL A;  4XQQ A;  5DM6 3;  1BDO A;  1STB A;  4MZ9 A;  3K8A A;  3S2H B;  2K5W A;  1STY A;  4OX9 Q;  4CJ1 B;  3NWS A;  1IW7 C;  2ZM6 Q;  3FHW A;  4V19 0;  2IJ0 A;  3CCV A;  3KF8 A;  1CA5 A;  4JI7 Q;  1Y1V H;  1ESF A;  4FXD A;  1Q82 C;  4A76 A;  5ELC A;  4O1N A;  2A5H A;  2XNA C;  1IBM Q;  1ET6 A;  1CKM A;  4B9W A;  3S16 H;  1LT4 D;  3NEM A;  4IFD J;  1JE4 A;  4RCN A;  4AIM A;  1IW7 D;  2ENB A;  1TKW B;  1XNQ L;  1EYA A;  2B8G A;  4IUT A;  2HCC A;  4HJ9 A;  4L5Q A;  3DWA A;  1L1O A;  1LAC A;  3TZD A;  4QUF A;  1BBW A;  2HCI A;  2RDH A;  3BVG A;  3G48 A;  3MHB A;  4F87 A;  4AQY L;  1D7Q A;  5GAG C;  1VQF A;  2KOL A;  1KC8 C;  4G7Z C;  4DR7 L;  1C9O A;  4FYD A;  4L8J A;  1CQF A;  2SDF A;  5JPM C;  1BQQ T;  5C3E G;  4R8N A;  4EVO A;  3JAM i;  3TP8 A;  3T53 B;  4J8Q A;  4Y7N B;  2ID0 A;  2K33 A;  3STB D;  4PZ6 A;  3F8T A;  4IOA A;  2N3S A;  4X66 L;  2EYJ A;  5ISR A;  5CYU A;  2C9O A;  4H02 A;  2B63 G;  1GUN A;  4TVA B;  4DV2 L;  2XRQ D;  3HRZ C;  4HR7 B;  3CCR A;  4PZ8 A;  2F03 A;  2RHQ B;  5G3L D;  1TS3 A;  3NTI A;  5C3E B;  4IO9 A;  4MHE A;  4DV6 L;  1KDC A;  2BDN A;  1V1O A;  4I65 A;  1GUW A;  4L5T A;  3S2D B;  1BR9 A;  3KJP A;  5I2Y A;  2K1B A;  4K2L A;  1LTT D;  1PH1 A;  3PUV A;  2E2J B;  4BXX H;  1M4V A;  3UDX A;  2NVX H;  1F9P A;  4DV5 Q;  3M4Y A;  4R4I A;  1N36 Q;  4GNX C;  4DV3 Q;  2F0W A;  5IGE A;  3S1M H;  5C0X G;  4DV1 L;  3D8G A;  5CMD A;  4O0A A;  4XYO A;  1WOC A;  2KCC A;  2R6G A;  4A93 G;  2L55 A;  3QR8 A;  4H0L C;  3NSW A;  1QZG A;  1VQ9 A;  1ENA A;  4CKC A;  5C0X H;  2A73 B;  3FPP A;  2LS0 1;  1K8A C;  4GLV B;  4JVZ A;  1DCZ A;  1B44 D;  1O7L A;  3MZ5 A;  1C0A A;  3H6M A;  3Q22 A;  1SYE A;  3T1Y L;  4QJF A;  2JA8 B;  1IYV A;  1SNM A;  1KXL A;  5CBE E;  3IAY A;  4FXG C;  3PIP 3;  1RCV D;  2L1B A;  2F0P A;  3GTJ B;  1WCM B;  2F4I A;  2G9H D;  2PPB C;  1QB5 D;  1PRT D;  2OT2 A;  2RSO A;  4KD3 A;  1JWS D;  2SEB D;  3HKZ B;  4A3J H;  1WTV A;  4ZKB B;  4FF1 A;  4CDF C;  3AQQ A;  4A3D H;  4CBV A;  1G29 1;  3I91 A;  4LFB L;  4OON A;  2JA5 B;  3J80 i;  1MGS A;  2QDL A;  2MHV A;  3UE0 A;  2I5H A;  1SFO B;  2R93 G;  2E2I B;  2KCM A;  3PGZ A;  1F2M A;  5M3F H;  3I2Z A;  4DA2 A;  1YIT A;  1PZI D;  4NB3 A;  2CQO A;  5JJL A;  2AWO A;  2JQO A;  3JC6 6;  4IFD I;  1ILP A;  2OQK A;  1I6H B;  3HOY H;  2PYK A;  2JE6 I;  1DZ1 A;  4JV5 L;  4C1N K;  3R8B A;  1E3P A;  2B8F A;  4ZKC B;  4X65 L;  1H9K A;  1S5D D;  1KIX A;  2F0M A;  2CWA A;  4X62 Q;  1YNJ C;  3I56 A;  2E76 C;  3CRK C;  2VZA A;  3F2U A;  2PMZ B;  2O5I C;  1TS2 A;  3OIP A;  2VB2 X;  1YJN A;  2L5T A;  1NR2 A;  4KY5 A;  2R7Z H;  5IOC A;  3JAM E;  1YBY A;  1Y1W B;  1GM5 A;  5DNF A;  3P20 A;  5C3X A;  5IY0 A;  2HQL A;  4ZK9 B;  1P16 A;  4RGN A;  1IXR A;  3GV3 A;  3GTM H;  4BY7 H;  2B2U C;  2WIN B;  5LMN Q;  4JI4 Q;  2O2L D;  3CCL A;  1STE A;  2XN9 C;  1SR3 A;  4JI0 L;  4KHV A;  2K28 A;  1E24 A;  3RZD H;  3OMG A;  4YHH Q;  4B3S Q;  5KNB A;  1WCM G;  4PZ7 A;  3DWQ A;  4XT1 B;  4A3I B;  3SK8 A;  2AUJ D;  3KOJ A;  1BVS A;  4XQN A;  1HNW L;  2ALY B;  3Q6S A;  1F9R A;  1JOK A;  1VQO A;  1GO3 E;  4IUU A;  3O13 A;  2CCZ A;  2OQ0 A;  4WRD A;  4LJZ C;  3T1H L;  4JV5 Q;  3FRP B;  2OTL A;  1SN8 A;  2B2U A;  4P72 A;  1PRT B;  1JB7 A;  5KGU A;  2QEJ C;  5C0X I;  5DLQ E;  3ONA B;  2A6H C;  3E3X A;  1YIJ A;  2D0P A;  2HD3 A;  5BN5 A;  2RDG A;  2F52 A;  3W1G A;  2B39 A;  4UDU C;  2NTS A;  5JOB A;  5C4H A;  5IYD H;  2SOB A;  4B3M L;  2HIX A;  1YHB A;  2B63 H;  1L0X B;  5FO8 B;  4Y52 H;  4J1M A;  5JEA H;  2B2T A;  3S16 B;  2YV5 A;  2JA7 H;  4JPB W;  1AW7 A;  3ZYY X;  1A3T A;  2BE5 D;  3K5L A;  4OXP A;  5JEA G;  4N8X 1;  4ZRZ A;  1A3V A;  1STA A;  4ZLT F;  2P5Z X;  3HOU G;  3VR5 A;  3H0G B;  4UP8 A;  1X3Q A;  4LF6 L;  3CC7 A;  1RDP D;  4L5S A;  2JN4 A;  3M3Y H;  1SMY C;  1Y1W G;  4P2C B;  4YHH L;  1LTG D;  1A2U A;  5H1S E;  4AQY Q;  4B3S L;  3W2D A;  3CU7 A;  5EBC A;  4B3R Q;  2D62 A;  1GOZ A;  3SEB A;  3AMU A;  1NNX A;  4JW0 A;  2ZM6 L;  5K36 H;  1C7Y A;  4YCU A;  4DAY A;  1L2F A;  2TMP A;  3HOZ H;  3M4O B;  1Q86 C;  1LTR D;  3ERS X;  5C0X J;  1SMX A;  4IPG A;  1K3B C;  1HXY D;  4A93 B;  1MI2 A;  1SAP A;  3C2P A;  1II3 A;  1VMC A;  2EYO A;  2R93 H;  3F2B A;  2R3Z A;  1J5E Q;  4DR3 L;  1WD0 A;  2XTI A;  5FOB B;  2BH2 A;  3CQZ B;  4HCS A;  5KIX A;  2N8N A;  4C1N I;  4A3M G;  3MTS A;  2Q8I B;  2VQE Q;  1NMF A;  4CKE A;  4KN7 C;  4BY7 G;  2FXQ A;  4Q5V A;  3SR1 A;  5K5P A;  5FLX c;  2Q2H A;  2NVX B;  4OO1 G;  1IYJ B;  2WFW A;  1OTC A;  3EJI A;  2Z6K C;  1A2T A;  1V43 A;  4DN4 M;  1V9P A;  4JI1 Q;  3HOW G;  1U4R A;  5C5M A;  1PLF A;  4TRD A;  5LL6 X;  1M1K C;  1U9R A;  3K6O A;  4OO1 H;  2TSS A;  4KHZ A;  3FKI B;  4DAP A;  1SRU A;  5HGT A;  1IBK L;  2F0J A;  4LW1 A;  1A62 A;  1S5B D;  2Z8L A;  5JJZ A;  2DJG C;  4AYB G;  2PCF B;  4CDD C;  2EVB A;  4P73 A;  1STN A;  2PI2 E;  1EIG A;  2LXJ A;  1IKM A;  2KEN A;  3KF8 B;  5CV7 A;  5IT9 c;  4A3I G;  1HNZ Q;  1MKH A;  2F0L A;  3PIO 3;  3HOV B;  2CWP A;  3T16 A;  4ZYS A;  3D4W A;  3HOW B;  1D2B A;  3BDL A;  3C3L A;  1CK1 A;  5D14 A;  2GN5 A;  2XVS A;  1EY4 A;  3CCS A;  1MIU A;  4JBM A;  1LM0 A;  2F0K A;  2YU9 H;  4IPH A;  4LFC L;  4RWS C;  3VR2 A;  4A3J B;  5C4X G;  2N55 A;  2OXP A;  1EIH A;  3P7J A;  4KMU C;  2MO1 A;  1U5K A;  2XSC A;  2NBF A;  2GVB A;  3KLS X;  2JA7 G;  1VQM A;  2NWG A;  5IGF A;  3BZC A;  3KF6 B;  3L9A X;  2BH8 A;  1PYB A;  2FJ2 A;  1Z7T A;  1L0Y B;  3M4Q A;  3E5S A;  3CMA A;  5FJ8 G;  4V0B A;  3HOY B;  1JQY D;  3BYT B;  3U9S A;  1IZ6 A;  1EOV A;  4GS3 A;  5CC4 A;  3GDE A;  1FYC A;  3FP9 A;  4KV6 A;  2YTY A;  4A3G H;  1VMP A;  1F2Y A;  1HZC A;  5C44 G;  4A3E H;  2F3W A;  5EAY A;  1PA6 A;  1PFS A;  3PF5 A;  1OXV A;  5GAH C;  1HTL D;  3PUX A;  1GUO A;  4YWM A;  5IYB G;  2PI2 A;  2XRS D;  1SNO A;  3VR3 A;  1GHK A;  1FNV A;  3OYY A;  2NZ1 D;  4BWG B;  1KHI A;  1RTO A;  1CQV A;  1J9O A;  1Y1W H;  1QUQ A;  1N9W A;  3ULL A;  2I0Q A;  3BVM A;  5LMN L;  3GTM B;  2H1E A;  1GHJ A;  2CH4 W;  4JYA Q;  2R7D A;  1LO5 D;  3S14 B;  1O7I A;  2EJF C;  5BN3 A;  2CHB D;  2JEA I;  2N78 A;  1VQ5 A;  5LMN W;  2UUC L;  4FDB A;  1P8L A;  4B9X A;  1K73 C;  4LAA A;  1X56 A;  3VR4 A;  3OW2 A;  1K8G A;  2BA0 A;  5IGB A;  4X6A H;  5IYD G;  1IBM L;  1HNX Q;  1QIL A;  1MSH A;  4UHV A;  1AEX A;  2EOT A;  4NXN Q;  2LXK A;  5IP7 G;  4B3T Q;  4A3D B;  1G2S A;  2K52 A;  2QIL A;  2R92 G;  2PNR C;  3T51 B;  4UY8 C;  4C56 C;  1CSP A;  3J81 j;  1VQ6 A;  4MIU A;  2K6A A;  4DV7 Q;  3VYR A;  2E2I H;  2PQA B;  2EYM A;  4ILW A;  4DXF A;  2RQX A;  4G4K A;  2Y0S B;  2UUA Q;  1UUP A;  1EQQ A;  3PF4 A;  4OGQ C;  2VUM H;  1SE2 A;  1LYL A;  2WB1 E;  3PO2 B;  2B2V C;  2JA6 G;  2ZXO A;  2G9D A;  3AU7 A;  1ONL A;  4CKB A;  1MJC A;  4NPS A;  4A3F G;  2UXC Q;  3PSI A;  4JI3 L;  4PMC A;  3VA5 A;  4R4O A;  3S1Q H;  5J22 A;  1QVF A;  3HKZ G;  5C4X H;  3K5N A;  2A69 D;  5A35 A;  3WDN A;  2QA4 A;  3CC2 A;  2WAQ E;  2EJM A;  2O4X A;  4R1J A;  4RGO S;  5JVH 3;  4NKL A;  2M00 A;  3TS0 A;  3RLF A;  1K0R A;  1X9N A;  3U4V A;  4N8F A;  2I5M X;  4FNF A;  4DV2 Q;  3H3V C;  1HNW Q;  2L4N A;  1XPU A;  1TQO A;  4DUZ Q;  3T1H Q;  3ULP A;  1PTO H;  3QOJ A;  4M8A A;  2AMC B;  1JT8 A;  4OEL B;  3SK6 A;  1T5E A;  2J0T D;  4XT3 B;  3K0X A;  3E0J A;  4OO1 I;  1ZYR D;  3NEN A;  2CFM A;  3CCQ A;  1KLG D;  3BVZ A;  1N34 Q;  2DGY A;  4DV5 L;  2IT1 A;  3S9W A;  1TWA B;  2ASB A;  2A68 C;  4YY3 Q;  3IL8 A;  2UUB L;  3CQZ H;  4LUV A;  2IW3 A;  2KA7 A;  4A3C H;  4JOI C;  4H7B A;  5J3B A;  2A6H D;  5E1F A;  5KNC A;  1QWY A;  2Z6K A;  1KDA A;  2Z4I A;  2RSN A;  1EWI A;  3P75 A;  4DKA C;  4BA1 I;  1Q1B A;  2WII B;  1F9S A;  3CCE A;  2V1C C;  3A7L A;  1I3Q B;  1YNJ D;  2XWB B;  1SLJ A;  3TZU A;  1ILQ A;  2NVT H;  2O5J C;  1VQD A;  4ZQ3 A;  1JE5 A;  4DR2 L;  1VQG A;  5GQO A;  1TWC H;  3RR5 A;  3S15 H;  4BBS B;  2J7Z A;  2LKV A;  1ENF A;  1O7Y A;  1VQC A;  3TDQ A;  3KLW A;  1IKL A;  3I8Z A;  1UEA B;  3IKJ A;  3I7F A;  2IX0 A;  1LTS D;  4BXX G;  1YJ9 A;  1LV9 A;  3T56 B;  3GQB A;  3A8J E;  2K32 A;  2IPK D;  3QJY A;  2RKS A;  5LL6 S;  1FJG L;  2QDB A;  4BY1 H;  2EZV A;  1PXU A;  1RKN A;  3WOE A;  4IJH A;  1FGU A;  2EIF A;  2K4K A;  3M7G A;  2Q2T A;  2SNM A;  3CRL C;  1XPO A;  1HJP A;  2B2V A;  1SYG A;  1JWU D;  2JYO A;  5EGT A;  3H09 A;  3TP6 A;  3OWF A;  3EIV A;  1JOR A;  3SE0 A;  5K36 G;  3NQI A;  4O42 A;  2RCN A;  4HMJ A;  2NZO A;  2OTJ A;  3DM1 A;  4FF2 A;  2K14 A;  1EFW A;  5IWA L;  5C5L A;  2BDO A;  1HFG A;  3QB3 A;  1O78 A;  1I6V C;  3ERO A;  4IZ8 A;  1SNQ A;  1D1K A;  1I94 Q;  2NUC A;  2F0S A;  4C3I B;  3UDF A;  4X62 L;  3I4N G;  4JC0 A;  3MC0 B;  1E22 A;  2AQ3 B;  1LTL A;  1H9R A;  5CGK A;  4A3G B;  3D6C A;  3PUW A;  5HGQ A;  1PH8 A;  4IUP A;  2PO4 A;  2R7Z G;  1J6Q A;  1S5C D;  4EQO A;  4K5V A;  5C3E H;  4K6D A;  3RUZ A;  1TT2 A;  2I07 B;  2Q8R E;  4NW2 A;  4A3B G;  1K0S A;  2JXM B;  4A3K G;  3HOX G;  3X3M A;  1VQ7 A;  3K7A H;  1T5X D;  4KTA A;  2Q2U A;  3BU2 A;  4P75 A;  2NZH A;  4JYA L;  5EQ0 A;  3JAM c;  1CI3 M;  2E2D C;  3ER0 A;  2K04 A;  4DK3 C;  3KLS A;  4OX9 L;  3A54 A;  2EQS A;  4G57 A;  3S1R B;  1NAP A;  2N49 A;  1YJW A;  2UUC Q;  3FDT A;  2C35 B;  4DV4 Q;  4ID6 A;  3HS0 C;  3HOX B;  4IUV A;  3HOV H;  1PFN A;  2PW7 A;  1R4P B;  3Q8D A;  4DV0 L;  1L1O B;  4U67 3;  5E7N A;  4RH6 A;  4DV6 Q;  3OHX C;  4HCE A;  3PO3 G;  1BCP F;  2PZT A;  3FPU B;  2AHO B;  2PMZ E;  5AFW A;  1YEZ A;  1AH9 A;  4O2D A;  5D3I B;  3E9I A;  1HZ9 A;  1W6K A;  4WJW A;  2LSS A;  4JK1 C;  4PV1 C;  4JG2 A;  4P71 A;  3M85 A;  1SE4 A;  4YCW A;  4BBS G;  2OWO A;  3G6E A;  3S17 H;  5M5Y H;  4C3J H;  2EY2 A;  4HJ5 A;  4HAE A;  2Z0S A;  5J39 A;  2F0V A;  4LF6 Q;  1X6O A;  4K5W A;  1MJE A;  2NTT A;  1HUN A;  1FNU A;  1X54 A;  1SBB B;  3KBX A;  3KFU A;  3WWV A;  3J7Z C;  3CXC A;  1JJ2 A;  5TSS A;  3LNN A;  2QF7 A;  4PNY A;  2HHH L;  4J15 A;  4ZAI A;  3CHB D;  4GKJ Q;  1SEB D;  3GTP H;  1TWG H;  4RHS A;  1J8I A;  4OWX B;  4A3C G;  2QGQ A;  3CPF A;  3CKI B;  4HJ8 A;  4DK0 A;  3Q23 A;  2EYL A;  2HIV A;  5IIF A;  2L0C A;  1W2B A;  2WV6 D;  1GUT A;  3MVV A;  1K28 A;  1W6J A;  4DV0 Q;  3DLL A;  4QQB X;  2G5D A;  4HED A;  1D5Z C;  1SSO A;  1PTO B;  1HFN A;  2UXB Q;  2X6L A;  3KLR A;  2Q2I A;  1KTK A;  3U4Z A;  1A3U A;  3I4N H;  4WOR A;  4JI8 L;  3K80 C;  3GTO B;  2JEB I;  3OW7 A;  2F0H A;  1HR0 Q;  4DR1 L;  5JAV A;  4POF A;  4JI6 Q;  1BF4 A;  2HDM A;  1ET9 A;  4GLX A;  4IPC A;  3MA2 B;  4RG1 A;  1V1P B;  2QEX A;  3R93 A;  4DR5 Q;  1TWA H;  4QMG A;  1JCK B;  5KEE A;  3OTO Q;  3A7A B;  5EPK A;  1LT5 D;  1Y8N B;  4QIW E;  2L12 A;  2NB0 A;  3MEF A;  1PH6 A;  4DK6 C;  4JI3 Q;  1GUG A;  4X65 Q;  3HG9 A;  1PFM A;  4A3M B;  3BJU A;  3I90 A;  3NUC A;  2E5L L;  1A8V A;  1SJH D;  4RA8 A;  2HHH Q;  2IHF A;  1XXG A;  1NSN S;  4UP7 A;  2RA4 A;  1BBX C;  1I3Q H;  1WD1 A;  1BBU A;  3A74 A;  2QCP X;  2ICE C;  2ZT9 C;  1MSG A;  2NVT B;  2VUM B;  1IBK Q;  3D0F A;  2KHJ A;  1XMO L;  3VYT A;  1OXU A;  3DEO A;  3FKI G;  2L9H A;  2OEO A;  2KEC A;  3RZO H;  5G3L F;  2A69 C;  2ZTD A;  4LF9 Q;  3S1Q B;  2JA5 H;  2WP8 J;  5E3F A;  4HJA A;  3K5O A;  1SFO H;  1B9N A;  1Q12 A;  2UXD Q;  1WVL A;  4GNX A;  2SNS A;  1PH2 A;  1FL0 A;  5C4J H;  3RN5 A;  1Y1V G;  3TS2 A;  3G4S A;  4AYB E;  3T13 A;  2FFK B;  3VR6 A;  3OTO L;  2BA1 A;  3PO3 H;  2PQE A;  2AKW B;  3C1F A;  1QCB D;  2D0O A;  2PNH A;  2V4D A;  4C2M H;  2Q8T A;  1A6X A;  2Y0S G;  2K03 A;  4L6T B;  1PTO C;  1NE3 A;  4PG3 A;  1HRJ A;  1AZP A;  4X3U A;  1I4H A;  2YTV A;  2ZTC A;  2R7Z B;  4F88 A;  4F8M A;  4BY1 G;  1CUK A;  5FJ8 H;  4DFA A;  5AJ3 L;  4YWK A;  5IGG A;  3NEL A;  4XYQ A;  2ZJR A;  2OF1 A;  1RHP A;  1YHA A;  1G6Z A;  1E7Z A;  1NR4 A;  3K7U C;  5FLX E;  4CDE C;  4HID A;  4GLA C;  4TSS A;  3PIO A;  5I2X A;  2DN8 A;  2JJQ A;  1ROD A;  3QG1 A;  5EKK A;  1LTB D;  1DXM A;  1TY0 A;  3HFZ B;  3CF5 A;  1VQH A;  4LF9 L;  2E2H B;  5JJI A;  3PUZ A;  5FLX L;  5M3M H;  3L7Z C;  1H95 A;  4ZCK A;  3KBG A;  4OWT B;  3SHL A;  2KHI A;  2BOS A;  3TEH B;  1PYS B;  2H4O A;  2XIW A;  3AYH B;  1ASY A;  3B6Y A;  1PVO A;  1QNU A;  3NTK A;  4BBS H;  5M3M G;  2WKC A;  2NN6 I;  4C3J G;  3RN2 A;  2DY8 A;  1JJC B;  2DNC A;  1YHQ A;  1HNX L;  4ME5 A;  2HUG A;  4XIG S;  2RVL A;  1TWH H;  4TKO B;  1PYW D;  3HEJ A;  3S1R H;  1K8O A;  1Q81 C;  1ZYR C;  3DM3 A;  4RGM A;  2NVY H;  5NUC A;  1PH7 A;  4IPD A;  1LTA D;  2I5L X;  2NN6 H;  1KAB A;  5ELF A;  2GVA A;  4IOC A;  3R3O A;  4HIO A;  3I3C A;  4RMF A;  4ABN A;  5I9P A;  3J80 c;  2EXD A;  3GTG B;  1O7Z A;  2A68 D;  2Z4H A;  5L37 A;  1SDF A;  4GOP B;  1N33 L;  4K2K A;  4IJL A;  1JMC A;  3HGB A;  5EKL A;  1VQL A;  1ICF B;  2FHT A;  4KY7 A;  3UDG A;  1GD7 A;  2ZJQ A;  5C44 B;  1Q46 A;  5HUR A;  2IHE A;  1PHJ A;  3S17 B;  1Q90 A;  3DUZ A;  1EWH A;  2VUM G;  1I5F A;  2K5H A;  2EDG A;  3Q0A A;  3SVM A;  3D3R A;  2L15 A;  3NP8 A;  3L2P A;  1HR0 W;  1ENC A;  2YU9 B;  1DJR D;  1X3P A;  4GN3 B;  1ZKO A;  1LLR D;  3EFX D;  4LF4 Q;  4X3S A;  3G71 A;  4DUY L;  4L5R C;  4A93 H;  1TY2 A;  3PO2 G;  1HH2 P;  1AN8 A;  1V1P A;  4R4C A;  5D3D A;  1S3O A;  1ZXT A;  1KD1 C;  2FIN B;  3I4M H;  4IAL A;  1WTR A;  4QF4 A;  4K5X A;  3MXP A;  1JJG A;  1XJV A;  2K5N A;  1KNE A;  4FP5 D;  1CZG A;  3LX0 A;  4KKU A;  4S3S A;  4UPA A;  3PIP A;  1GVP A;  3E9H A;  2PW5 A;  1STG A;  5KND A;  1WTH A;  1D1I A;  3K81 C;  5IT9 L;  3I4N B;  3HOY G;  1K83 H;  4EX5 A;  1N32 L;  1XNR Q;  1T9H A;  3RNU A;  1X3F A;  4JI1 L;  4XTC S;  2M2L A;  2EYF A;  2PZU A;  1B53 A;  2KED A;  4LF8 L;  1QOH A;  2CKZ B;  1BCP D;  2KCT A;  5D65 A;  1N8R C;  3H3V I;  3TME A;  2ZXP A;  2PZW A;  1B70 B;  4OWW B;  1KRT A;  4DGZ A;  2VW9 A;  4DNI A;  4A3B B;  1SXT A;  5EPL A;  4X66 Q;  4DR4 L;  4C3J B;  1HA6 A;  3H15 A;  1SYF A;  3I72 A;  1S4Z A;  3LWU A;  1EYC A;  3KF6 A;  3BZK A;  4OIJ A;  2IX3 A;  5CBA E;  1XWE A;  3GTL H;  4I7A A;  4LFA L;  1VF5 C;  1KQS A;  2M9V A;  4A3F H;  3NK9 A;  2ZTE A;  2ES2 A;  3MXN B;  2J4X A;  4OHJ A;  1TWG B;  5J1Z A;  2E8G A;  3NBH A;  3PCO B;  3TQY A;  1WTP A;  2F0T A;  1LTI D;  4Q0F A;  4A3L H;  1BCP B;  4Z9C B;  3A0J A;  4QUC A;  4JCV E;  4JI2 L;  4CGY B;  4DV3 L;  4HIM A;  1NTG A;  4CJ0 B;  1WI5 A;  3SDZ A;  4FO2 A;  1TS4 A;  5C4J B;  5IP7 H;  1EL0 A;  3J81 E;  3U9O A;  4PMB A;  3NE5 B;  2JP1 A;  1Y14 B;  4IFD G;  4LF5 L;  2K7V A;  5BR8 L;  4A3E B;  2CW0 D;  1I94 L;  2AQ2 B;  3HOU B;  2DJF C;  1RJT A;  2VXW A;  4EGV A;  3GTO H;  1ICW A;  4C2M B;  5IWA Q;  4A3J G;  5C4X B;  4B08 A;  3SK4 A;  4DNR B;  1U4P A;  4LF7 Q;  1CHP D;  4A3K B;  3QWN A;  1WJJ A;  4DAV A;  5CR3 A;  4R8I A;  4UAI A;  3GTQ B;  4U68 A;  5JPN C;  3CCU A;  1H9M A;  3HOZ G;  3IRB A;  4DR6 Q;  4X3T A;  1CKN B;  3L3O C;  3MWY W;  2F0Q A;  5I9O A;  4K0K L;  4DNT B;  3SK5 A;  1S40 A;  1XTC D;  4GN4 B;  4FXK C;  3OOC A;  3URY A;  4POG A;  1R4Q B;  3NTH A;  5ELD A;  2MJ8 A;  3UI2 A;  1VQB A;  4BBR H;  1NBW A;  3R2T A;  1AE3 A;  4K6L A;  4PMW A;  1VQ4 A;  2WAQ B;  1QVG A;  4KHP L;  2CH4 A;  4DV4 L;  4BA2 I;  2AWN A;  3UE1 A;  5M5W H;  4PQX A;  2A74 C;  1WYD A;  4RKL A;  1B3A A;  4E6I A;  5C3W A;  1B2T A;  2B29 A;  3D4D A;  4JI7 L;  3STB C;  3OMC A;  3C46 A;  1Z6H A;  2F0O A;  1TWH B;  3D4R A;  1QUQ B;  2F0D A;  2NVY B;  1I4R A;  1AP0 A;  5IT9 E;  3EBE A;  3CPW A;  1B9M A;  4GN5 A;  2Z1C A;  1UEB A;  1ESR A;  4JBW A;  1RIP A;  3PO2 H;  5BN4 A;  3S15 B;  2VQE L;  3PO3 B;  1B1Z A;  2D5D A;  4DR6 L;  1PH9 A;  4YIJ A;  1EZ6 A;  4EQ5 A;  3BDC A;  2UXC L;  3K5M A;  1IYU A;  1SRO A;  4HN7 A;  4H44 C;  3RLN A;  4MTK A;  5GAD C;  3GTK H;  2F0F A;  1DYQ A;  2UU9 Q;  2K5D A;  1Q1E A;  1I50 H;  4BY1 B;  3CAM A;  4XXE A;  1RF2 D;  4IUQ A;  1K9M C;  2NVQ B;  1KDB A;  1SJE D;  2GA4 B;  2B2Y A;  2B2T C;  3RLO A;  1FVI A;  4Y7N H;  3MAQ A;  1CSQ A;  5IYC H;  1YNN C;  4DK1 A;  1X65 A;  1ASZ A;  5M3M B;  1CTM A;  3ERQ A;  4ALP A;  1E2Z A;  5A2Q L;  1VQK A;  4LMQ D;  1BO0 A;  1TS5 A;  3DMU A;  1W3S A;  2IX1 A;  2UXB L;  3TP5 A;  1UE6 A;  3J80 L;  3TP7 A;  3R2I A;  4LK1 C;  2B2W A;  2UUB Q;  1DOM A;  2KJX A;  4FVM A;  2RCF A;  2MUY A;  2MGS A;  3AFQ A;  1S72 A;  4NXM Q;  1F9Q A;  1PH5 A;  3KUP A;  1XNR L;  2KCN A;  3EVQ A;  1I4Q A;  4QIW B;  3N6R A;  2ATW A;  1K3R A;  2DUD A;  3ULJ A;  5COR A;  4BBR G;  1TWC B;  3PQI A;  1LT6 D;  4LF8 Q;  3OIQ A;  1DON A;  2NN6 G;  3GTG H;  3K7A B;  3ND8 A;  2YYZ A;  3PMF A;  3U50 C;  4CDC C;  1XTD A;  3E6Z X;  1PFB A;  3NWT A;  4DUY Q;  2EYP A;  1M8A A;  2JA6 B;  1KAW A;  5EPJ A;  1TII D;  1STH A;  4A3B H;  2X69 A;  3ICE A;  3HOX H;  3CME A;  1U4M A;  1KLU D;  3ND9 A;  5FO7 B;  3GTJ H;  5EJW A;  2Y0S E;  3A56 A;  1XMO Q;  3F2D A;  4FF4 A;  2K5V A;  3K0Y A;  4DR3 Q;  1PZJ D;  4R4Q A;  3W3A A;  2VQF Q;  4N9T A;  1XX8 A;  2F0G A;  1WTW A;  2E75 C;  4LFB Q;  2UXD L;  1EOT A;  1K8M A;  1XYI A;  4AYB B;  3J7A F;  4HSV A;  1N36 L;  1QE6 A;  3CCM A;  4QY7 A;  1FGB D;  1Q3L A;  3KDF B;  1CM9 A;  1XMQ Q;  3H91 A;  1UNS A;  4DV1 Q;  5M5Y B;  4KN4 C;  4QB4 A;  4C3H H;  4I7Z C;  5LMU Q;  1I4G A;  4WFN 3;  2R61 A;  3EQL C;  1JB3 A;  2QKI C;  4DAM A;  5IP9 H;  4HJ7 A;  5JJK A;  1H9S B;  4LUZ A;  4C3I H;  4A4I A;  3OWE B;  4YWL A;  3AEV A;  4NXN L;  1BXT A;  5T1G A;  3BDO A;  1HZB A;  4LF5 Q;  2JSO A;  5CV6 A;  4FF3 A;  2JA5 G;  2E2J H;  1B7Y B;  1Q8I A;  1HUM A;  1D8L A;  1R9T H;  1IL2 A;  1JIC A;  3GTP B;  4DR4 Q;  2ICI A;  5LHY 1;  3S1M B;  3D6W A;  1EY0 A;  4A3K H;  3NXW A;  2VB3 X;  4KLK A;  1BCP C;  2A1A A;  5FO9 B;  3GTQ H;  2D2C C;  4WJ4 A;  1CKO A;  3TN2 A;  1QG7 A;  4EQP A;  3KK7 A;  4JBJ A;  5ELN A;  1HCZ A;  1MBY A;  4K0K Q;  1SYD A;  5ELE A;  2EY5 A;  1VS0 A;  5IGD A;  3S1N H;  4JI0 Q;  4GOP C;  2Z6B A;  1YNX A;  1RD9 D;  1E0B A;  2N88 A;  1H9J A;  3RZD B;  2K75 A;  3F1Z A;  4P74 A;  3KYH C;  3IFT A;  1WCM H;  4GKK Q;  4HSP A;  4KHP Q;  3DHQ A;  1SMY D;  2K5Q A;  2WB1 G;  4BS9 A;  1PV4 A;  1PH3 A;  3JAM L;  3MXU A;  1SYB A;  1VQN A;  3GTL B;  1HHV A;  2WKD A;  2A8V A;  1EU4 A;  5F2D A;  5M5W B;  4A3F B;  1Y8P B;  1LAB A;  3H0G G;  1C8C A;  2C5C A;  4IN3 A;  3PUY A;  1U0L A;  1E1T A;  3TRZ A;  2RBM A;  3GD7 A;  1EWC A;  4JI8 Q;  3RD4 A;  3VDY A;  1JC7 A;  3AFP A;  1KAA A;  3IFD A;  3H3V H;  1EFI D;  3VYU A;  2K50 A;  3AB9 A;  1HQR D;  2HT1 A;  3TSS A;  2B63 B;  5A2Q E;  1YVC A;  4APV A;  4JOI A;  3V05 A;  3K58 A;  5CV9 A;  3FVQ A;  1HZA A;  3GP7 A;  2MO0 A;  2VS1 A;  2DNE A;  2F0U A;  5CV4 A;  1UAP A;  1Q7Y C;  1EZ8 A;  1UE1 A;  2LY7 A;  4IUN A;  3W1B A;  2R92 B;  5IOD A;  4CHT B;  2E5L Q;  1CFM A;  2JK8 A;  4MTN A;  3NBH B;  2KQ3 A;  1OO9 B;  3GTK B;  2E74 C;  1G6P A;  4LF4 L;  2HDL A;  2Z9H A;  5I4D A;  4MN3 A;  1I50 B;  1GUS A;  1VQJ A;  1B3Q A;  1QZH A;  3VA7 A;  2BE5 C;  5C6A A;  4HTH A;  1JWM D;  1EY7 A;  1V8Q A;  5IYB H;  1AFP A;  5FLM H;  1IL8 A;  3G7L A;  4X64 L;  1X3G A;  1X3E A;  3J81 c;  1UE5 A;  3N52 A;  4L63 B;  4KD4 A;  4WJ3 M;  3SXH A;  1TWF H;  2DY7 A;  1VCI A;  3I4O A;  3HKZ E;  2WAQ G;  4DV7 L;  2EY1 A;  4JBK A;  1KNA A;  1D5X C;  3DEP A;  5CV5 A;  4F7X A;  5E4X A;  4LNQ A;  2KHS A;  1X32 A;  4QL5 A;  4CJ2 C;  3CD6 A;  5GAE C;  3CC4 A;  5KYI A;  1N32 Q;  3U58 A;  4NXM L;  1JOQ A;  4A3M H;  3MEH A;  3KDF A;  4ZUJ A;  1TR5 A;  5JEA J;  4A3D G;  5DEH A;  3GO5 A;  3CP0 A;  4N9P A;  5IGC A;  3S24 A;  2E2H H;  4DAY B;  3T1Y Q;  1SE8 A;  5I6W A;  1MD2 D;  5M3F G;  4NDX A;  3FEW X;  2ZJP A;  3FKI H;  2JA7 B;  3P1H A;  3M9B A;  1VF7 A;  3J7A V;  1WTO A;  3RZO B;  2WAC A;  2AUK A;  2XWJ B;  3V96 A;  2RDF A;  2IL8 A;  5IP9 G;  3S2H H;  5C4Z A;  3LGJ A;  3ZJY C;  1EQV A;  1Y1V B;  3H0G H;  2L11 A;  2JA6 H;  3M3Y B;  1HNZ L;  1DOL A;  1QNK A;  3MFG A;  1EQT A;  3I70 A;  2OCE A;  2NVQ H;  4G7O C;  1ZEQ X;  1EQR A;  1SNP A;  4LFC Q;  3RMH A;  1EY8 A;  2B2W C;  3BYY B;  2K01 A;  3MFY A;  4C3I G;  3A8I E;  3HOZ B;  3TRE A;  4JI2 Q;  2KVM A;  3WOF A;  1FD7 D;  1RTN A;  1Y8O B;  4K8J A;  1CT1 D;  1XMQ L;  1NUC A;  1E2V A;  3I4M G;  2R93 B;  4C3H B;  1TU2 B;  2MPM A;  1GJX A;  2F4V Q;  1LT3 D;  4IFD H;  1WTX A;  1PH4 A;  4X3K A;  3HZX A;  4HMI A;  5CV8 A;  1Y69 U;  4XQJ A;  4KJO A;  1VDZ A;  1HQM C;  2KUM A;  3I73 A;  1WFQ A;  4RCO A;  1A63 A;  2A6E C;  4OL7 A;  3K57 A;  2B3G A;  4GNX B;  5DAU A;  5I6Y A;  4A3E G;  3J7A 5;  4LWC A;  4M1U B;  1FR3 A;  1NMG A;  1NY4 A;  5EBD A;  4QCL A;  3Q24 A;  1EYD A;  2BCO A;  4R4T A;  4RHR A;  2FMC A;  1BNZ A;  1Z9F A;  1YNN D;  3I4M B;  3K59 A;  4G7H C;  1VQI A;  2LFN A;  5M5X B;  4JI5 L;  4JI4 L;  3S2D H;  4GOP A;  4K8I A;  1D6E C;  3GV6 A;  3E0E A;  1TVX A;  4RGT A;  2I46 A;  4GKJ L;  3S1N B;  1PTO F;  2KBN A;  4QGU A;  3ITP A;  1K83 B;  1EU3 A;  1HA5 A;  2JA9 A;  1OXT A;  4A3L G;  3QIA A;  1AE2 A;  3HOW H;  2EPB A;  1VQP A;  5FKA C;  1FNW A;  2KEE A;  3J81 L;  2EYH A;  3C1E A;  1C4Q A;  1PMR A;  3X3N A;  1E1O A;  2A6E D;  1B8A A;  4NMZ A;  1EEI D;  2A19 A;  1PTO D;  4B3M Q;  1L0W A;  2F4V L;  4B3T L;  2R7F A;  1G91 A;  2VY3 A;  2F1M A;  4DR1 Q;  1EY6 A;  3F2C A;  4J6H A;  3CCJ A;  5FLM G;  1PRT F;  1GXD C;  3M4P A;  5C44 H;  1AZQ A;  2JA8 H;  2WB1 B;  3BG3 A;  4AH6 A;  1EIY B;  4DXG A;  4DR5 L;  3NPP A;  2F0E A;  2UUA L;  1NJI C;  1E2W A;  3A5Z B;  1O80 A;  2UU9 L;  4LUO A;  3D31 A;  4C3H G;  4KI0 A;  3M7N A;  1BOS A;  2CVR A;  1YZ6 A;  4JI5 Q;  5COY A;  1PRT C;  1L1O C;  1SYC A;  4KKS A;  1CA6 A;  2PQA A;  1Z47 A;  1R9T B;  1G8Z D;  4DU9 A;  3BS1 A;  1TXY A;  2F0N A;  4OEM B;  4OIK A;  3J7Y W;  3BZD B;  1A15 A;  2QW7 A;  2EJG C;  2EXZ A;  4RFB A;  3VYS A;  4A75 A;  1EEF D;  4K14 A;  3UDI A;  1G2T A;  2VNU D;  1I6H H;  2EY6 A;  3L0O A;  4LFA Q;  5IYC G;  3S14 H;  3LWE A;  2MQH A;  3QO2 A;  1VQ8 A;  3DXJ C;  4RKB A;  1D5M C;  5GRO A;  1OXS C;  1C48 A;  3A8K E;  1J5E L;  2LMC B;  2F3I A;  1B4O A;  1CHQ D;  1S5F D;  4EQN A;  3T4A C;  2YTX A;  1A0I A;  4IQZ A;  2FMM A;  4GZY C;  1DOK A;  2MNA A;  1SNC A;  4DPG A;  1IHZ A;  1M90 C;  1VQA A;  4HIK A;  1F77 A;  4TQU S;  5T1I A;  2NYZ D;  1DGS A;  3HOV G;  1EY5 A;  3SGI A;  1PZK D;  4A3G G;  4MNO A;  5ELO A;  2VL6 A;  3HP3 A;  1B50 A;  5EKI A;  5BR8 Q;  1JOO A;  3MXG A;  2HQE A;  3W5O A;  3OSO A;  4R9W A;  3HKS A;  3MXN A;  1CKN A;  1V1Q A;  5E4W C;  5AJ3 Q;  1S5E D;  4A3I H;  1EYG A;  2ZXR A;  4DR2 Q;  1KL9 A;  1KRS A;  1XPR A;  4ODG A;  2AQ1 B;  4DUZ L;  1HTP A;  3H94 A;  5ELB A;  3KJO A;  3EN2 A;  2CQA A;  1G51 A;  4X64 Q;  2B2Y C;  2RHS B;  1MHW C;  1UE7 A;  4NP5 A;  1CZW A;  1IBL L;  5KYL A;  3DWP A;  3G6J B;  2EE1 A;  1U4L A;  2R92 H;  4ZUI A;  1DM0 B;  1GKH A;  4KKT A;  3PV0 A;  2VQF L; 
#chains in the Genus database with same CATH homology
 1LM0 A;  2YU9 H;  1UWV A;  2MFI A;  4IPH A;  1N34 L;  1EIF A;  1HR0 L;  4LFC L;  1Q12 A;  2UXD Q;  5HY6 A;  4GNX A;  5C4X G;  1BKB A;  2VQF Q;  2MO1 A;  1OXX K;  1U5K A;  2H5X A;  4JI6 L;  4LFB Q;  2GVB A;  4YY3 L;  2JA7 G;  2UXD L;  1VQM A;  1FL0 A;  5C4J H;  1PH2 A;  3RN5 A;  1Y1V G;  3TS2 A;  1N36 L;  3G4S A;  3BZC A;  3KF6 B;  4AYB E;  2BH8 A;  4JBM A;  1PYB A;  3CCM A;  5LMU L;  4QY7 A;  3KDF B;  1XMQ Q;  3OTO L;  4DV1 Q;  2BA1 A;  3M4Q A;  3PO3 H;  2RF4 A;  4C3H H;  2AKW B;  3J81 i;  3CMA A;  1RL2 A;  5LMU Q;  3HOU H;  2D0O A;  2PNH A;  1EUJ A;  4C2M H;  4DAM A;  5IP9 H;  4HJ7 A;  5FJ8 G;  4UP9 A;  4LUZ A;  5JJK A;  1X55 A;  2Y0S G;  4A4I A;  4C3I H;  2XGT A;  1NE3 A;  4PG3 A;  4YWL A;  3AEV A;  3CW2 C;  1IZ6 A;  1EOV A;  4GS3 A;  4NXN L;  2YTV A;  3GDE A;  3FP9 A;  4LF7 L;  1HZB A;  2YTY A;  3I55 A;  4LF5 Q;  2ZTC A;  4A3G H;  2JA5 G;  2E2J H;  1HZC A;  1Q8K A;  1B7Y B;  5C44 G;  4A3E H;  4BY1 G;  5EAY A;  1CUK A;  1VQE A;  5FJ8 H;  5AJ3 L;  1PA6 A;  1PFS A;  3PF5 A;  2IY5 B;  1OXV A;  4YWK A;  1D8L A;  5GAH C;  3A5U A;  1R9T H;  3PUX A;  1IL2 A;  4DR4 Q;  3NEL A;  4YWM A;  2ZJR A;  5IYB G;  1N33 Q;  1YHA A;  1XNQ Q;  2PI2 A;  1E7Z A;  1YI2 A;  3K7U C;  3OYY A;  4A3K H;  5IE8 A;  4HID A;  1D7Q A;  4GLA C;  4KLK A;  2A1A A;  3PIO A;  1KHI A;  1IBL Q;  1Y1W H;  1LUZ A;  2JJQ A;  3GTQ H;  1QUQ A;  4WJ4 A;  3CF5 A;  3HFZ B;  1CKO A;  1N9W A;  1VQH A;  1QVC A;  4LF9 L;  3PUZ A;  3ULL A;  1FJG Q;  4JBJ A;  5ELN A;  2I0Q A;  3M4O H;  5M3M H;  5LMN L;  3L7Z C;  4K0K Q;  4YCV A;  4DR7 Q;  4ME3 A;  4JYA Q;  1H95 A;  2R7D A;  4OWT B;  1VS0 A;  2KHI A;  3S1N H;  4JI0 Q;  4GOP C;  3TEH B;  1O7I A;  1PYS B;  1YNX A;  3AYH B;  1ASY A;  3B6Y A;  2JA8 G;  1PVO A;  4BBS H;  5M3M G;  5M5X H;  2K75 A;  2JEA I;  4B3R L;  2N78 A;  3F1Z A;  4GKK L;  2NN6 I;  1VQ5 A;  5LMN W;  2UUC L;  4P74 A;  3KYH C;  4FDB A;  1P8L A;  4MZ9 A;  3RN2 A;  1K73 C;  1JJC B;  1WCM H;  3K8A A;  4GKK Q;  1YHQ A;  4OX9 Q;  4KHP Q;  2WB1 G;  2ZM6 Q;  1HNX L;  1X56 A;  1PV4 A;  3FHW A;  3OW2 A;  1PH3 A;  1K8G A;  4JI7 Q;  3CCV A;  2BA0 A;  1Y1V H;  4XIG S;  1VQN A;  1TWH H;  4X6A H;  2A8V A;  5IYD G;  1Q82 C;  1IBM L;  4A76 A;  3S1R H;  1HNX Q;  1Q81 C;  3DM3 A;  2NVY H;  4NXN Q;  2LXK A;  3H0G G;  4IPD A;  5IP7 G;  2I5L X;  1PH7 A;  1IBM Q;  4IOC A;  2GVA A;  3PUY A;  4B3T Q;  2K52 A;  4HIO A;  2R92 G;  1U0L A;  1CKM A;  4RMF A;  1E1T A;  4UY8 C;  3TRZ A;  1CSP A;  3S16 H;  3GD7 A;  3J81 j;  1VQ6 A;  4JI8 Q;  3J80 c;  3VDY A;  3NEM A;  2EXD A;  4DV7 Q;  4IFD J;  3AFP A;  2E2I H;  2PQA B;  3H3V H;  4AIM A;  4GOP B;  1N33 L;  4IJL A;  1XNQ L;  1JMC A;  3PV0 A;  2K50 A;  2HT1 A;  2UUA Q;  1VQL A;  1EQQ A;  4HJ9 A;  3PF4 A;  2VUM H;  4L5Q A;  1L1O A;  3UDG A;  1YVC A;  4APV A;  1LYL A;  2WB1 E;  4JOI A;  1GD7 A;  1BBW A;  2ZJQ A;  2JA6 G;  3G48 A;  1HZA A;  1Q46 A;  2MO0 A;  2IHE A;  2VS1 A;  1PHJ A;  4AQY L;  1MJC A;  4NPS A;  5GAG C;  4A3F G;  3PSI A;  1I5F A;  1VQF A;  2K5H A;  4JI3 L;  1Q7Y C;  2VUM G;  1UE1 A;  4DR7 L;  1KC8 C;  3W1B A;  1C9O A;  4R4O A;  3S1Q H;  5JJL A;  1QVF A;  3HKZ G;  5C4X H;  2QA4 A;  3CC2 A;  2L15 A;  5C3E G;  2WAQ E;  3JAM i;  2E5L Q;  3L2P A;  1HR0 W;  2JK8 A;  4R1J A;  4MTN A;  3TS0 A;  3NBH B;  3RLF A;  1K0R A;  1X9N A;  3U4V A;  1G6P A;  4LF4 L;  2ID0 A;  3STB D;  4PZ6 A;  1VQJ A;  3F8T A;  2I5M X;  4DV2 Q;  4IOA A;  4GN3 B;  1HNW Q;  1QZH A;  2N3S A;  4X66 L;  4LF4 Q;  1XPU A;  4H02 A;  2B63 G;  4TVA B;  3G71 A;  5IYB H;  4DUY L;  4DUZ Q;  4DV2 L;  5FLM H;  3ULP A;  3T1H Q;  4L5R C;  4A93 H;  3PO2 G;  3CCR A;  1HH2 P;  2AMC B;  4PZ8 A;  1X3G A;  4R4C A;  4X64 L;  1JT8 A;  1X3E A;  1S3O A;  2RHQ B;  4IO9 A;  1KD1 C;  3J81 c;  1UE5 A;  3I4M H;  4WJ3 M;  4DV6 L;  1JJG A;  3K0X A;  1XJV A;  2K5N A;  4L5T A;  1TWF H;  3NEN A;  2CFM A;  4OO1 I;  3CCQ A;  3KJP A;  1VCI A;  4UPA A;  3I4O A;  3PIP A;  1GVP A;  3HKZ E;  2WAQ G;  1N34 Q;  2DGY A;  4DV7 L;  3E9H A;  4JBK A;  4DV5 L;  2IT1 A;  1PH1 A;  3PUV A;  4BXX H;  4LNQ A;  3K81 C;  2ASB A;  3UDX A;  3HOY G;  2NVX H;  4QL5 A;  4YY3 Q;  1K83 H;  4EX5 A;  4DV5 Q;  1N32 L;  3CD6 A;  4R4I A;  1T9H A;  1XNR Q;  2UUB L;  5GAE C;  3CQZ H;  4LUV A;  4GNX C;  1N36 Q;  3CC4 A;  4DV3 Q;  4A3C H;  3RNU A;  4JOI C;  1X3F A;  3S1M H;  5J3B A;  4JI1 L;  5C0X G;  1N32 Q;  3U58 A;  4NXM L;  4XTC S;  2Z6K A;  4DV1 L;  4A3M H;  1EWI A;  3KDF A;  4DKA C;  4BA1 I;  1Q1B A;  4O0A A;  1WOC A;  2R6G A;  5JEA J;  4LF8 L;  4A3D G;  2CKZ B;  4A93 G;  3GO5 A;  1VQ9 A;  1QZG A;  3CP0 A;  2E2H H;  3CCE A;  2KCT A;  2V1C C;  3S24 A;  4DAY B;  1SLJ A;  1K8A C;  1N8R C;  4GLV B;  3H3V I;  3T1Y Q;  1SE8 A;  2NVT H;  1VQD A;  1C0A A;  1JE5 A;  4DR2 L;  5M3F G;  1VQG A;  5GQO A;  3T1Y L;  1B70 B;  1TWC H;  4QJF A;  1KRT A;  3RR5 A;  4OWW B;  2VW9 A;  4DNI A;  2ZJP A;  3S15 H;  1KXL A;  1VQC A;  3FKI H;  4X66 Q;  3KLW A;  3M9B A;  4DR4 L;  3I7F A;  3H15 A;  2IX0 A;  4BXX G;  1YJ9 A;  3S2H H;  5IP9 G;  3KF6 A;  3BZK A;  3LGJ A;  3ZJY C;  3H0G H;  3GTL H;  2JA6 H;  1HNZ L;  4LFA L;  1FJG L;  4A3J H;  1KQS A;  4BY1 H;  4A3F H;  2ZTE A;  2ES2 A;  3AQQ A;  3MXN B;  4A3D H;  1G29 1;  4LFB L;  4IJH A;  1FGU A;  2E8G A;  2OCE A;  2EIF A;  4OON A;  3J80 i;  2NVQ H;  3PCO B;  3UE0 A;  2K4K A;  3TQY A;  1EQR A;  2I5H A;  2R93 G;  2Q2T A;  4LFC Q;  3CCS A;  4A3L H;  1XPO A;  1HJP A;  2KCM A;  3A0J A;  3PGZ A;  4JCV E;  3I2Z A;  5M3F H;  1YIT A;  4DV3 L;  2CQO A;  4NB3 A;  4HIM A;  2AWO A;  4JI2 L;  2JQO A;  1NTG A;  3JC6 6;  4IFD I;  1WI5 A;  2OQK A;  3EIV A;  3TRE A;  3HOY H;  4JI2 Q;  2JE6 I;  5IP7 H;  4JV5 L;  5K36 G;  1E3P A;  1XMQ L;  1Y14 B;  2RCN A;  2NZO A;  4X65 L;  2OTJ A;  4IFD G;  1KIX A;  4LF5 L;  2K14 A;  5BR8 L;  1EFW A;  5IWA L;  1I94 L;  3I4M G;  3GTO H;  2CWA A;  4X62 Q;  3I56 A;  2VZA A;  5IWA Q;  4A3J G;  1I94 Q;  2F4V Q;  3UDF A;  4X62 L;  3I4N G;  4JC0 A;  4LF7 Q;  1E22 A;  1LTL A;  1PH4 A;  1YJN A;  1WJJ A;  2R7Z H;  1YBY A;  1WFQ A;  1GM5 A;  3PUW A;  1A63 A;  4GNX B;  5IY0 A;  2HQL A;  2B3G A;  3CCU A;  5HGQ A;  4A3E G;  3HOZ G;  3IRB A;  1P16 A;  3J7A 5;  1PH8 A;  4LWC A;  1IXR A;  4DR6 Q;  1CKN B;  1NMG A;  1NY4 A;  3GTM H;  4BY7 H;  5LMN Q;  4K0K L;  4R4T A;  2R7Z G;  1J6Q A;  4JI4 Q;  1S40 A;  5C3E H;  3CCL A;  1SR3 A;  1Z9F A;  4JI0 L;  4A3B G;  4GN4 B;  1E24 A;  4A3K G;  1VQI A;  4JI4 L;  3HOX G;  4JI5 L;  3RZD H;  1VQ7 A;  4POG A;  4GOP A;  3K7A H;  3S2D H;  4YHH Q;  4B3S Q;  2Q2U A;  1WCM G;  1VQB A;  4BBR H;  4PZ7 A;  1NBW A;  3BU2 A;  3E0E A;  1AE3 A;  4P75 A;  2NZH A;  4JYA L;  3JAM c;  4PMW A;  1VQ4 A;  1QVG A;  4GKJ L;  3ER0 A;  4DK3 C;  3KOJ A;  1BVS A;  4OX9 L;  4KHP L;  2KBN A;  4QGU A;  4DV4 L;  1HNW L;  2ALY B;  4BA2 I;  1VQO A;  2EQS A;  2N49 A;  1YJW A;  1GO3 E;  2UUC Q;  2AWN A;  2C35 B;  3UE1 A;  2JA9 A;  1OXT A;  5M5W H;  2OQ0 A;  4DV4 Q;  3T1H L;  1AE2 A;  2CCZ A;  3HOV H;  4A3L G;  1WYD A;  4JV5 Q;  3HOW H;  2OTL A;  1SN8 A;  1VQP A;  4P72 A;  3Q8D A;  4DV0 L;  1L1O B;  1JB7 A;  5E7N A;  5C0X I;  2B29 A;  5DLQ E;  4JI7 L;  4DV6 Q;  3STB C;  1YIJ A;  1E1O A;  2D0P A;  3PO3 G;  1B8A A;  2A19 A;  2AHO B;  2PMZ E;  2F52 A;  3W1G A;  4B3M Q;  1L0W A;  1QUQ B;  1YEZ A;  2F4V L;  4B3T L;  5IYD H;  4O2D A;  1AH9 A;  3E9I A;  2R7F A;  3EBE A;  2HIX A;  1HZ9 A;  1YHB A;  2VY3 A;  3CPW A;  4B3M L;  4GN5 A;  2LSS A;  4DR1 Q;  2B63 H;  1UEB A;  4Y52 H;  3F2C A;  3CCJ A;  5FLM G;  4JBW A;  1RIP A;  4JG2 A;  3M4P A;  4P71 A;  5C44 H;  3M85 A;  2JA8 H;  3PO2 H;  4YCW A;  4BBS G;  2YV5 A;  2VQE L;  2JA7 H;  4AH6 A;  1EIY B;  3G6E A;  2OWO A;  3S17 H;  5M5Y H;  4C3J H;  4DR5 L;  4DR6 L;  1PH9 A;  4HJ5 A;  2Z0S A;  4EQ5 A;  2UXC L;  2UUA L;  1NJI C;  1SRO A;  4LF6 Q;  4OXP A;  3A5Z B;  1X6O A;  5JEA G;  1MJE A;  2UU9 L;  2UXC Q;  4LUO A;  3RLN A;  3D31 A;  3HOU G;  1X54 A;  4KI0 A;  3M7N A;  4UP8 A;  5GAD C;  4LF6 L;  1YZ6 A;  3CC7 A;  4JI5 Q;  3GTK H;  4L5S A;  3KFU A;  3M3Y H;  3WWV A;  1Y1W G;  2UU9 Q;  4YHH L;  1L1O C;  5H1S E;  3J7Z C;  1Q1E A;  1I50 H;  4AQY Q;  4B3S L;  3CAM A;  2PQA A;  3CXC A;  1JJ2 A;  1Z47 A;  2HHH L;  4J15 A;  4B3R Q;  4GKJ Q;  2D62 A;  1TWG H;  1TXY A;  3GTP H;  1K9M C;  4OWX B;  4A3C G;  2QGQ A;  3CPF A;  4HJ8 A;  3RLO A;  2HIV A;  1FVI A;  4Y7N H;  2ZM6 L;  4A75 A;  1W2B A;  1CSQ A;  5IYC H;  1C7Y A;  4YCU A;  3UDI A;  1L2F A;  2VNU D;  4DV0 Q;  3DLL A;  3HOZ H;  1I6H H;  1X65 A;  1ASZ A;  4QQB X;  1Q86 C;  3ERS X;  5C0X J;  1SMX A;  4IPG A;  3L0O A;  4ALP A;  2UXB Q;  4LFA Q;  5IYC G;  3S14 H;  2MQH A;  2Q2I A;  1VQ8 A;  1VQK A;  2R93 H;  3U4Z A;  3F2B A;  1J5E Q;  4DR3 L;  3I4N H;  2XTI A;  1W3S A;  4JI8 L;  3K80 C;  5GRO A;  2JEB I;  2IX1 A;  2UXB L;  1UE6 A;  1HR0 Q;  1OXS C;  2BH2 A;  1J5E L;  2N8N A;  4DR1 L;  2UUB Q;  4POF A;  4A3M G;  2F3I A;  4JI6 Q;  4GLX A;  2YTX A;  1A0I A;  3AFQ A;  4IPC A;  1NMF A;  4RG1 A;  2VQE Q;  2QEX A;  2MNA A;  1S72 A;  4NXM Q;  4DR5 Q;  4BY7 G;  1TWA H;  2FXQ A;  1PH5 A;  4DPG A;  5FLX c;  2Q2H A;  1M90 C;  1VQA A;  3OTO Q;  1IYJ B;  2WFW A;  4HIK A;  4TQU S;  1OTC A;  1XNR L;  4OO1 G;  2Z6K C;  1DGS A;  1V43 A;  3HOV G;  2ATW A;  4QIW E;  1K3R A;  1V9P A;  4JI1 Q;  3MEF A;  2DUD A;  3SGI A;  3ULJ A;  4DK6 C;  1PH6 A;  4JI3 Q;  3HOW G;  4MNO A;  5ELO A;  4X65 Q;  4A3G G;  2VL6 A;  5BR8 Q;  3BJU A;  1M1K C;  4BBR G;  4LF8 Q;  2E5L L;  4KHZ A;  1A8V A;  2NN6 G;  2HHH Q;  3GTG H;  2IHF A;  1SRU A;  3W5O A;  2YYZ A;  4UP7 A;  1IBK L;  3HKS A;  1I3Q H;  3U50 C;  1BBU A;  1CKN A;  1V1Q A;  3A74 A;  4LW1 A;  1A62 A;  1XTD A;  5AJ3 Q;  4A3I H;  5JJI A;  1EYG A;  4DR2 Q;  1KL9 A;  1KRS A;  1XPR A;  4AYB G;  1IBK Q;  3D0F A;  4DUY Q;  4DUZ L;  4P73 A;  2PI2 E;  3KJO A;  3EN2 A;  2LXJ A;  1G51 A;  1KAW A;  2KHJ A;  4X64 Q;  4A3B H;  2KEN A;  3KF8 B;  5IT9 c;  1HNZ Q;  2RHS B;  1UE7 A;  4A3I G;  1XMO L;  3ICE A;  1MKH A;  1OXU A;  3FKI G;  3HOX H;  2CWP A;  3CME A;  1IBL L;  3RZO H;  2ZTD A;  3GTJ H;  2Y0S E;  4LF9 Q;  2R92 H;  1XMO Q;  3F2D A;  2JA5 H;  2WP8 J;  2K5V A;  1GKH A;  4HJA A;  2GN5 A;  4DR3 Q;  1SFO H;  4R4Q A;  1MIU A;  2VQF L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...