2OQ0A

Crystal structure of the first hin-200 domain of interferon-inducible protein 16
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
189
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the First HIN-200 Domain of Interferon-Inducible Protein 16
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Gamma-interferon-inducible protein Ifi-16
total genus 35
structure length 189
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A01
4UP7A 2JA5G 2PNHA 3CD6A 2ZTDA 4OWXB 3ER0A 4APVA 2ALYB 1X65A 2WAQG 4LFAL 2MO0A 2V1CC 3AFPA 3HOXH 3DLLA 4WJ4A 1X3FA 1HZBA 4DV1L 3PO2G 3GTGH 1SMXA 3PGZA 1K3RA 5JJIA 1KQSA 2OTJA 5C44G 1PVOA 1WI5A 1VQPA 1N36Q 3A5ZB 5GAHC 2YU9H 3W5OA 3D31A 1LM0A 3I4MG 5IT9c 1WFQA 1AH9A 1S72A 4DV7L 3CCSA 1VQOA 5GADC 3KF6B 1GKHA 5IP9H 2QA4A 4DUZQ 2R92G 1GVPA 3TREA 4A3CG 1NMGA 1TWGH 2K50A 2UXCQ 1MJCA 3U50C 4LF9Q 4NPSA 2H5XA 3UE1A 2E5LQ 4LFAQ 3HKZE 2ES2A 3PO3G 2JEAI 4QJFA 2ATWA 3CC7A 3SGIA 4Y7NH 3M3YH 4IPHA 2BA0A 4ME3A 1PH5A 1E7ZA 1IZ6A 2DUDA 3HOWH 4DR7Q 4DV5L 1KHIA 5IE8A 5M3FG 1XMOL 5IWAQ 3PUXA 1VQLA 2JA8G 1D8LA 1Q8KA 3KLWA 5FLXc 4KLKA 1X56A 4LUOA 1I5FA 4DR1Q 2UUBQ 2WP8J 1XNRL 4JI2Q 3PF4A 4LFBQ 2JA7G 3F1ZA 1TWCH 1I94Q 1KC8C 3HOXG 4IJHA 2I5MX 4HIDA 3J81j 4OONA 1P16A 5IYCG 1I6HH 5LMUQ 3G48A 4BBSG 2YTVA 2RCNA 4JI5L 5M5XH 1CUKA 1E1TA 1SE8A 3S24A 2F52A 3HFZB 4POFA 3CPWA 3H3VI 4B3TL 3ULPA 3RN5A 1PHJA 3H0GH 3GDEA 4DR2Q 3I7FA 1VQKA 2N78A 4DV2L 1Q1EA 4LF6Q 4JI5Q 3ICEA 1OXSC 4L5TA 3KF6A 4GNXC 2I0QA 3RLNA 2UUCL 4LWCA 2NN6I 3S15H 3S1QH 3RNUA 3T1HQ 5FLMH 4LF8L 3RZOH 2HIVA 4OWTB 4A3LG 1G51A 4X6AH 1VQ6A 3F2CA 2YV5A 4NXML 1JJGA 3HOWG 1T9HA 2OQKA 1VQ5A 3CCRA 4JBMA 4MTNA 4AYBG 3I56A 2PI2E 3Q8DA 4X65L 5GAGC 2NVTH 4DUYL 3I4NH 1XNQL 4DKAC 4B3TQ 2JA6G 1XNQQ 1RIPA 4DK6C 3CMAA 2JK8A 1MIUA 4KI0A 2A19A 1Q82C 1KIXA 4DR6Q 1I3QH 4R4CA 2NZHA 2IY5B 2I5HA 4IPDA 1YZ6A 4A75A 1QVGA 2GN5A 3HOUG 1L1OA 3CCUA 4A3GH 1B70B 2NVXH 4GLAC 4XIGS 4NXNL 5C44H 3PIOA 3D0FA 3CXCA 2UUBL 1CKOA 3F2BA 1VCIA 4IFDI 3I4NG 5IYBG 2NZOA 1N33Q 1VQHA 3W1GA 2K5HA 2R93H 3J7A5 1R9TH 1Y1VH 4DUYQ 4A3EH 4GLXA 1LUZA 1L0WA 2AHOB 1KD1C 2N8NA 2Q2IA 3CP0A 3TRZA 4HJ9A 1UEBA 1K9MC 3PUVA 3ZJYC 3J7ZC 4QQBX 1BKBA 1NE3A 4JI0Q 1HNZL 2HHHL 2Y0SE 2B29A 5M3MH 1XNRQ 1KRTA 4UY8C 4DV7Q 4B3SL 2FXQA 4JBKA 4ALPA 1G291 1EOVA 2BH8A 3CCVA 3K7AH 1QZHA 1J5EQ 1IBLL 5BR8Q 1NTGA 5K36G 4DV5Q 4JC0A 1G6PA 1OXVA 4A3FG 1WCMH 3KOJA 4NXMQ 5IY0A 4A93G 1O7IA 4EQ5A 4DNIA 4DV3Q 3L2PA 3KFUA 3HOVG 1V43A 4DR6L 3UE0A 4TQUS 4BA1I 5M3MG 1QZGA 1SR3A 1XPUA 1CSPA 4A3IH 3AYHB 2VS1A 4GNXA 1M90C 2UXBQ 3G4SA 3ULLA 1N8RC 4A3BG 2ZJPA 2UXDQ 1S40A 4LF4L 1TWHH 4RMFA 1JB7A 1HR0W 4LF6L 1VQFA 3KYHC 2R7DA 4L5RC 4GOPC 4A3MH 1JJ2A 4BA2I 1K83H 4JI1Q 4HIOA 3TEHB 2JEBI 4IPGA 3I2ZA 3HKZG 2JA5H 3OYYA 1HNWQ 1EWIA 3CCMA 3NENA 1VQ9A 2Q2TA 5GQOA 3NELA 1J6QA 4HJ5A 3HOUH 4A3GG 1OXUA 3T1HL 2Q2HA 4TVAB 2RHQB 3G6EA 1VQJA 3S1RH 2ZTCA 2PMZE 2BA1A 1FGUA 5M5WH 5AJ3L 4GOPB 1PH2A 4LNQA 5C4XG 4JI6L 1A0IA 2EXDA 5IP7H 1OXTA 4YCUA 2LXKA 4YY3Q 1PA6A 1TWAH 4AYBE 3K7UC 4YY3L 3I4MH 3HOZG 4EX5A 4NXNQ 2MO1A 2MNAA 4P75A 1M1KC 3WWVA 2IHEA 2E2IH 1XMOQ 4AQYL 2JA7H 3PO2H 3CCJA 1YBYA 1VQMA 4B3SQ 1N36L 2K4KA 4DV0Q 4JOIC 1D7QA 4DR3Q 3CQZH 3M7NA 1B8AA 2RHSB 1JE5A 4HIKA 3PO3H 2UUAL 3BZCA 3HOVH 3AFQA 4HJ7A 4LFBL 1BBUA 3CPFA 4UP8A 4IO9A 1HJPA 1OXXK 2QEXA 4A3IG 4JI7Q 3HKSA 5IP7G 4DPGA 2JJQA 3OTOL 4DR5Q 1PYSB 1Z9FA 3PCOB 3K8AA 3A74A 4BBSH 2UXCL 1X55A 4IFDJ 2VY3A 4DAYB 1KAWA 1UE1A 4A93H 4Y52H 5IYDH 4LUZA 4JI7L 2IT1A 1SRUA 4A3KH 1PH1A 1Y14B 4PG3A 1J5EL 4A3MG 1IBLQ 3PSIA 2I5LX 1YVCA 2LSSA 3KDFB 2E2HH 3UDFA 3JAMc 1E22A 1GD7A 1UE6A 2GVBA 2YTXA 3RLFA 1YJNA 4OO1G 5C0XJ 1I50H 4X66L 1PV4A 4JYAL 3RR5A 2QGQA 2B63H 1Y1WH 2JQOA 3AEVA 4H02A 1EQQA 4DUZL 1CSQA 2VUMG 1Q12A 4FDBA 4X64Q 5JEAG 4A76A 2F4VL 1WOCA 1MKHA 3M4QA 1HH2P 4OXPA 1HNXQ 3S14H 2B3GA 1B7YB 1QVFA 4X62Q 3CCQA 1N34Q 4JI4L 1VQAA 4KHPL 4K0KQ 2EIFA 1L2FA 5C0XI 2E2JH 2HT1A 1QVCA 1ASZA 4AH6A 3VDYA 1X6OA 1YEZA 4R4IA 1XMQQ 2EQSA 1Z47A 3RZDH 2Z0SA 3H3VH 5JJLA 2WFWA 2VQEL 4A4IA 1NBWA 1V9PA 1YITA 3HOYG 2D0OA 2CKZB 4AQYQ 4A3JG 4C3IH 3PV0A 2D0PA 3UDIA 4BY7H 5H1SE 1A8VA 5EAYA 1N32Q 1E24A 3CC4A 4IOAA 1SLJA 4B3ML 3K80C 1EUJA 1X3EA 2VQFQ 2R7FA 2VL6A 3S17H 1IYJB 3KDFA 4OX9Q 1EIFA 4LF8Q 4YHHQ 1QUQB 3KF8B 1PH7A 1MJEA 4R1JA 5LMNW 4LFCL 3PUZA 2AWOA 4DV1Q 4DV0L 1VQNA 2E8GA 3L0OA 1Y1WG 4JI3L 2RF4A 4GN5A 2VNUD 1IXRA 4UPAA 1HR0Q 3M4OH 2XTIA 1PH4A 1K8AC 1HR0L 5IP9G 2R92H 4A3FH 1W3SA 1QUQA 1WCMG 4GN3B 5DLQE 5C0XG 3J81i 3E0EA 4X66Q 1KRSA 3GTOH 3T1YQ 4LUVA 2CCZA 5LMNQ 2C35B 3F2DA 4C3HH 1H95A 4DV4L 1YJ9A 2IHFA 3STBD 4BY1H 3NBHB 1LYLA 3EBEA 2AMCB 2MQHA 4JBWA 4L5QA 1U5KA 1XPOA 1SFOH 1C7YA 3RN2A 4A3LH 1C0AA 1YHAA 4YCVA 4DV3L 2VUMH 5IYBH 4DV4Q 1YI2A 3CC2A 1Y1VG 4O0AA 4OO1I 2D62A 1VQEA 2A8VA 1L1OC 2R7ZH 3PIPA 3U58A 5GROA 2KHIA 4JI0L 4BY7G 1FL0A 2BH2A 2UXDL 5IWAL 4DV6L 1JT8A 3G71A 1PH3A 4OWWB 3BU2A 1CKNB 1Q46A 2ZJRA 3GTQH 2UUAQ 2WB1E 1PFSA 1NMFA 2OCEA 3ERSX 3I55A 1I94L 4X62L 3EIVA 3TQYA 3MEFA 1GM5A 3S2DH 1PH8A 3L7ZC 1Q7YC 3S1MH 4JCVE 3W1BA 1OTCA 4B3RQ 4A3DG 4OX9L 1FJGL 3H0GG 5C3EG 1FJGQ 1CKNA 5AJ3Q 4X64L 1CKMA 3JAMi 3GTLH 1P8LA 2YTYA 2AKWB 2NVYH 4DR7L 2GVAA 2UXBL 1VQDA 1PH6A 5FLMG 3CW2C 3TS2A 1RL2A 2XGTA 3ULJA 4LF7L 1JJCB 2MFIA 3M4PA 1NJIC 3B6YA 3PF5A 1N34L 2YYZA 1VQGA 3A0JA 2PQAA 4MNOA 4NB3A 4HIMA 1Q1BA 3JC66 4BXXH 2Z6KC 4QGUA 1K0RA 4POGA 1YNXA 2N3SA 5FJ8G 4GN4B 5GAEC 3KJOA 3FKIG 3KJPA 5ELNA 4PMWA 3M85A 3HOYH 4PZ7A 5C4JH 3CF5A 2UUCQ 1YHQA 4P73A 2E5LL 2UU9L 2HIXA 3OTOQ 4HJ8A 2LXJA 1EFWA 1Q81C 3GTJH 4YWLA 4R4QA 1W2BA 1HZ9A 1VQBA 1U0LA 3M9BA 1XTDA 4IPCA 3H15A 5JEAJ 2F3IA 4LW1A 4R4TA 1UE5A 1IL2A 1X3GA 1Q86C 3BZKA 2ASBA 4BXXG 4IJLA 1SN8A 4MZ9A 1HNWL 1BBWA 1N32L 1LTLA 4GLVB 5JJKA 3CMEA 2CWPA 3S16H 5ELOA 3DM3A 2VQFL 4JI8Q 2R7ZG 4GKJQ 2R93G 1ASYA 4YWMA 4DR2L 4X65Q 1K8GA 1VQCA 4JI2L 4DK3C 3T1YL 1A62A 4QY7A 3J80i 1XPRA 2K5VA 3I4OA 4RG1A 2R6GA 4KHZA 1YJWA 3A5UA 5M5YH 1A63A 4QL5A 4WJ3M 3LGJA 4A3KG 1UWVA 3E9HA 5LMUL 3TS0A 1S3OA 2KENA 4YHHL 4B3RL 2K52A 4JI3Q 4IFDG 2CFMA 2N49A 1VQ4A 3CCLA 2ID0A 3K0XA 1WJJA 1EQRA 1DGSA 4LFCQ 1N9WA 5E7NA 4R4OA 1UE7A 2CWAA 2K14A 5C3EH 1TWFH 2CQOA 3CAMA 2HQLA 3K81C 3STBC 4C2MH 5C4XH 1IBKQ 5J3BA 1E1OA 5IYDG 2ZJQA 4JV5Q 4JI6Q 3FHWA 3FKIH 4JV5L 4O2DA 4JI8L 3GTKH 2KCTA 4GKJL 1FVIA 1AE3A 4JYAQ 4LF5L 2JE6I 4LF9L 4IOCA 2K75A 4DAMA 3J81c 2ZTEA 2OWOA 4GOPA 2VZAA 3UDGA 3U4ZA 3E9IA 1PYBA 1YHBA 2B63G 2Y0SG 1EIYB 2IX1A 4L5SA 4J15A 1NY4A 4LF5Q 4DR1L 4A3BH 1VS0A 1VQIA 1PH9A 4JOIA 2JA9A 2KHJA 4BBRG 3F8TA 1HZAA 4YCWA 2KCMA 3UDXA 3IRBA 2ZM6Q 4DR5L 1EYGA 1VQ7A 3MXNB 4A3DH 4A3JH 3PUYA 5BR8L 3GTPH 4JBJA 1X9NA 3S1NH 2NVQH 2AWNA 1X54A 4AIMA 4LF4Q 1E3PA 2WAQE 4BY1G 4GKKQ 3FP9A 4JG2A 4A3CH 3AQQA 3J80c 3RLOA 1JMCA 3S2HH 1K73C 1HNXL 4LF7Q 3CCEA 4P74A 2L15A 2OTLA 1V1QA 2F4VQ 3PUWA 4JI4Q 4KHPQ 4K0KL 4DR4Q 3BJUA 1KXLA 4JI1L 1HZCA 1TXYA 5FJ8H 4XTCS 4HJAA 2UU9Q 4P72A 1XJVA 3HOZH 1C9OA 2Q2UA 2VW9A 5M3FH 1L1OB 2A1AA 4PZ8A 3EN2A 2ZM6L 4DR4L 2NN6G 1YIJA 2JA8H 2PI2A 3GTMH 2KBNA 4P71A 1HNZQ 2HHHQ 4A3EG 1XMQL 1IBMQ 3U4VA 1KL9A 2WB1G 1IBML 2VQEQ 5LMNL 3NEMA 4GKKL 1BVSA 2OQ0A 1AE2A 4YWKA 1GO3E 4DV6Q 1SROA 5HY6A 1IBKL 1N33L 3GO5A 2K5NA 4PZ6A 4C3JH 4GNXB 3OW2A 4DV2Q 4DR3L 4B3MQ 4GS3A 5IYCH 2PQAB 1WYDA 3GD7A 4UP9A 2Z6KA 1VQ8A 2IX0A 4BBRH 5HGQA 4QIWE 2DGYA 2JA6H
chains in the Genus database with same CATH superfamily
4MHEA 4UP7A 2PNHA 2V4DA 3MXNA 2PZTA 2F0KA 2XRSD 3PQIA 2MO0A 3AFPA 3HOXH 4IUPA 4DF7A 3GTGH 1FNVA 1K3RA 1KLGD 5FO7B 5JJIA 3BS1A 2EVBA 5GAHC 3D31A 2JXMB 3I4LA 1NUCA 1WFQA 4YIJA 4A3MB 1S72A 1ESFA 2WACA 1ZYRC 2R3ZA 4C1NK 5T1GA 1HQRD 3U50C 4NPSA 2E5LQ 1EZ8A 1PRTC 4A3IB 1TS4A 4EQOA 1GUTA 1JE4A 4FP5D 3M3YB 1BO0A 1PH5A 1E7ZA 1IZ6A 5IE8A 5M9OA 5D3DA 3FVQA 3MZ5A 3FPUB 1D8LA 3KLWA 1D6EC 3IFDA 5FLXE 1GJXA 1K0SA 1MGSA 1XNRL 2WP8J 4LFBQ 2JA7G 1QB5D 4RHSA 1YNND 2JP1A 3HZXA 4HIDA 4QMGA 3J81j 1JOOA 4K5WA 2VB3X 4KTAA 1ML0D 1I6HH 2YTVA 3Q0AA 1MI2A 1E1TA 4DAPA 3SR1A 2FHTA 3ULPA 1TVXA 3OIQA 3NXWA 4DR2Q 2HD3A 2N78A 1B9MA 1O7LA 4JI5Q 3QWNA 1ET9A 3RNUA 3RZOH 3P1HA 3EA6A 2RKSA 1VQ6A 2YV5A 1T9HA 1VQ5A 3CCRA 1BCPB 1HCZA 2PI2E 3FDTA 2Q8RE 1RD9D 4DUYL 4OIJA 1SNMA 4QUCA 3BDLA 4MIUA 2F0PA 1KIXA 1X32A 2EOTA 2WINB 3IFTA 2NZHA 1A15A 3D4RA 2I5HA 4C3HG 2IY5B 3SK5A 2GN5A 3HOUG 1EY6A 1B70B 1F2LA 1CT1D 5CV6A 5C44H 1CKOA 3P7JA 1DYQA 5IYBG 2NZOA 1XX8A 1R9TH 1Y1VH 2RDFA 1LUZA 1KD1C 2JA7B 2N8NA 2Q2IA 3CP0A 1UEBA 3PUVA 3ZJYC 3J7ZC 1E0BA 1BCPF 3MVVA 2Y0SE 2B29A 4R8NA 1XNRQ 3C1FA 1QOHA 4JBKA 3KUPA 1QZHA 1IBLL 3BVGA 1LT3D 1SNOA 5EPLA 3A8IE 3ND8A 1WCMH 2L1BA 1O7IA 5A35A 3KLRA 4DV3Q 5J22A 5CC4A 3KFUA 3GTKB 1TWHB 1XPUA 1CHQD 1G6ZA 3ULLA 1STHA 1F9SA 2UXDQ 4G57A 4G7HC 1JJ2A 1TS5A 4IPGA 4RGTA 1LTAD 1EWIA 1HNWQ 4XYQA 3NENA 1JWUD 1J6QA 4HJ5A 5J39A 1OXUA 2E76C 3G6EA 2RHQB 4ZK9B 1VQJA 2B2UC 2PMZE 1JWMD 1FGUA 5M5WH 4GOPB 1DOLA 5C4XG 3Q6SA 1CZWA 2EXDA 5IP7H 1OXTA 3R3OA 1TWAH 1PTOF 3HKZB 3KLSA 1BCPD 1IYUA 2A6HD 4IUVA 5FKAC 2MNAA 1BBXC 2IHEA 3CCJA 3RUZA 3EVQA 4K2LA 1NR4A 4DV0Q 4JOIC 1D7QA 4RWSC 4B9WA 3A8KE 2UUAL 3BZCA 4X3TA 1BBUA 3CPFA 4IO9A 2QEXA 4A3IG 4JI7Q 1STNA 3S1MB 4H0LC 5IP7G 4H7BA 5M5WB 2JJQA 3OTOL 4X3UA 2RA4A 1SRUA 4A3KH 1IBLQ 4A3MG 2M9VA 4HMIA 5LL6S 3KDFB 2E2HH 1E22A 3TZUA 1UE6A 3FKIB 1A3TA 4OO1G 1JWSD 5JVH3 1I50H 1BF4A 1EQQA 1Q12A 4X64Q 2HQEA 3NHHA 4RKBA 5M3MB 1HH2P 3C2PA 3OSOA 5CV5A 1HNXQ 3S14H 2LFNA 2AUKA 4S3SA 3CCQA 1VQAA 1L2FA 5C0XI 3PIO3 1QVCA 4KY5A 1SYEA 3VDYA 4R4IA 3IAYA 3RZDH 2Z0SA 1I50B 2VQEL 1NBWA 3K5OA 2D0OA 2Z4IA 2RCFA 3AU7A 5CORA 4C3IH 4M8AA 4JPBW 2WB1B 3TP7A 5C3WA 5H1SE 1SLJA 4B3ML 3K80C 1EUJA 1R4QB 4LF8Q 1KLUD 4X3SA 1C8CA 4AYBB 1H9RA 4LK1C 3DHQA 1GHKA 1QNKA 4LFCL 3I72A 1MBYA 4DV1Q 4DV0L 4HR7B 1Y1WG 4JI3L 2NTTA 2VNUD 4K2KA 1EIHA 1GUNA 3M4OH 1CK1A 3HOUB 2XTIA 4A3FH 4GN3B 2CH4W 1SNPA 3E0EA 3M4YA 1EL0A 4UHVA 3STBD 3NBHB 5JPNC 2MQHA 4L5QA 1K3BC 2B2TC 1SFOH 1C7YA 1C0AA 3N52A 1YHAA 2SNSA 4DV3L 2OXPA 1YI2A 4LAAA 1IYVA 2P5ZX 4O0AA 2A8VA 1L1OC 3GTQB 2R7ZH 5GROA 2KHIA 2Z4HA 1FL0A 2KECA 4OHJA 3VYRA 2UXDL 1NNXA 5CMDA 3MWYW 3BU2A 3V2TA 2ZJRA 1Q46A 3GTJB 1NMFA 3ERSX 3R93A 4ZUJA 1GM5A 4B3RQ 1Q7YC 1DXMA 3W3AA 1FJGL 3QO2A 4X64L 1CKMA 3ERQA 2PCFB 2F0WA 1L0YB 1P8LA 3GTLH 2YTYA 2NVYH 4DR7L 2PW5A 3BVMA 5FLMG 3CW2C 3TS2A 2XGTA 4LF7L 1R9TB 1WTHA 4B9XA 2YYZA 3MXGA 4HIMA 4P2CB 4RA8A 3DWAA 4N8X1 2N3SA 5GAEC 5ELNA 4KN4C 4PMWA 1CFMA 1CHPD 3CF5A 1KNAA 1VMCA 2QDLA 3OTOQ 1Q81C 3GTJH 1W2BA 4K8IA 3H15A 4LMQD 1TWAB 1VF5C 2F3IA 1X3GA 2H4OA 3KBXA 2HUGA 1S4ZA 4FO2A 2EZVA 4N9TA 4NP5A 2CWPA 1WVLA 5ELOA 3S16H 4JI8Q 1SJHD 1EYDA 4DR2L 4X65Q 2XN9C 3J80i 2X6GA 1NCVA 2R6GA 4KHZA 5M5YH 4WJ3M 1SMYC 4A3KG 2K52A 1SYDA 2CFMA 3CCLA 1KABA 5IGFA 4UAIA 5E7NA 2BCOA 1BDOA 5C3EH 1SYCA 3K81C 5K36H 3O13A 2ZJQA 5IYDG 3X3MA 3NQIA 3FKIH 3MA2B 4JV5L 3GTKH 2KCTA 3AB9A 1O7ZA 2F0EA 4LF5L 4IOCA 2K75A 4DAMA 3J81c 3TBIB 2L5TA 4GOPA 3J7AF 5I9OA 2Y0SG 4L5SA 4LF5Q 4DR1L 1VS0A 3BDOA 2EYLA 1DONA 1VQIA 1PH9A 2VUMB 4JOIA 2A5HA 4HCSA 3UDXA 3IRBA 4A3DH 1D1IA 1ZXTA 3PUYA 4C3IG 4JBJA 3RZDB 2NVQH 2AWNA 4A3CH 4C56C 3AQQA 4KD4A 1QILA 4IN3A 2K32A 2EE1A 2L12A 2J4XA 3PUWA 5CV4A 4JI4Q 2E2HB 5BN5A 1KXLA 2XIWA 4BS9A 1TXYA 4OL7A 3A54A 5FJ8H 2UU9Q 4P72A 1AN8A 1XJVA 3HOZH 5E4XA 3J7YW 5M3FH 1L1OB 4JK1C 4L8JA 1STBA 2JA8H 1ENAA 2PI2A 4XQNA 3GTMH 2HHHQ 1BNZA 2F0MA 1KL9A 4IURA 3NBHA 5LMNL 2YU9B 1CA5A 2RSNA 3AMUA 4HN7A 4GKKL 4ID6A 4DFAA 4PMBA 4DV6Q 1GO3E 3HOWG 1N33L 3VYUA 3UI2A 4KKTA 2HCCA 4TSSA 4DR3L 4B3MQ 4GS3A 5IYCH 1VQ8A 5HGQA 3NTIA 1G2SA 4J8QA 2ZTDA 4OWXB 2K7VA 2WAQG 3I90A 2A68C 3DLLA 4CKCA 1SMXA 3R2TA 1KQSA 5C44G 3A5ZB 4HSPA 3URYA 1I6HB 3I4MG 1LM0A 2K01A 1BR9A 3KF6B 2QA4A 5IP9H 3T16A 3TREA 5EQ0A 2ES2A 3HKZE 4FVMA 3K6OA 1NSNS 3QOLA 3CC7A 4HSVA 5E4WC 2A6HC 4IPHA 2SNMA 2DUDA 2EPBA 3MXPA 1KHIA 1XMOL 3I73A 4PMCA 1Q8KA 4LUOA 1I5FA 2UUBQ 2LS01 1I94Q 1KC8C 1S5DD 3HOXG 4N8FA 1FNWA 5CGKA 4OONA 1P16A 5LMUQ 1V1OA 4JI5L 4A3GB 4POFA 3HFZB 1F2YA 4B3TL 3RN5A 3GDEA 1B50A 4LF6Q 1CZGA 1C48A 4LWCA 1LACA 5I9PA 1PTOD 1HA6A 4LF8L 4OWTB 3VR6A 1G51A 2L55A 1JJGA 4KMUC 1A2TA 1JQYD 2C5CA 4MTNA 1ONLA 4AYBG 5JPMC 3Q8DA 2VB2X 3I4NH 4B3TQ 1RCVD 2NWGA 1RIPA 4DK6C 5CV7A 5TSSA 1STEA 1PZKD 3NQTA 4Q5VA 1DM0B 1I3QH 1YZ6A 4A75A 4A3GH 1PTOB 1EY8A 3FEWX 1JB3A 3D0FA 2UUBL 3HP3A 1VCIA 1SE3A 3I4NG 4IFDI 2WV6D 1LTID 1VQHA 1JOQA 2R93H 2ICIA 1AZQA 1E2VA 3R8BA 1H9JA 3NWTA 4HJ9A 1K9MC 1PRTB 4QQBX 1BKBA 4U68A 4A3DB 4JI0Q 4CJ1B 3J81L 5ELBA 4DV7Q 2FXQA 1G2TA 4CGYB 1G291 1D1KA 3K7AH 2F0FA 1J5EQ 5ELEA 4DV5Q 2EYJA 4A3FG 2LMCB 5IY0A 2M00A 1W6KA 4DK0A 1V43A 4RGMA 4TQUS 5E3FA 5T1IA 3AYHB 4GNXA 1M90C 2UXBQ 4EGVA 4A3BG 1UUPA 3K58A 4FF1A 1B44D 5CV8A 2ZJPA 3DEPA 1S40A 1RKNA 1TWHH 4RMFA 1JB7A 3PMFA 3S14B 3KYHC 4GOPC 4BA2I 1JR0D 2J7ZA 5A2QL 4IALA 1XTCD 3HKZG 3I2ZA 3OYYA 3CCMA 1ILPA 1U4PA 1RJTA 2KA7A 5G3LD 5C4XB 3S1RH 2OF1A 2ZTCA 3QOJA 1PH2A 2F0GA 1K8MA 4JI6L 4G7ZC 3S1QB 1JOKA 4YCUA 3HOWB 3EJIA 1PA6A 4YY3L 4A3KB 3I4MH 4EX5A 1M1KC 3WWVA 4AQYL 3SK4A 5L37A 1YBYA 1SBBB 3H6MA 4A3EB 1VQMA 5M3FB 2XWJB 2RHSB 1Q8IA 1K83B 3WOFA 3K5NA 2L9HA 4LFBL 4HJ7A 2PW7A 1HJPA 1SYFA 1SXTA 3BYYB 2PQEA 3HKSA 4DPGA 5DM63 4DR5Q 2UXCL 1PYSB 1LTSD 1Z9FA 2QCPX 3A74A 3K8AA 3PCOB 1X55A 1UE1A 2KHSA 4A93H 1CI3M 4LUZA 4CDDC 3EROA 1PH1A 2ZXRA 1Y14B 4I7ZC 4K5XA 2I5LX 1YVCA 2LSSA 1JCKB 5DM73 3JAMc 1GD7A 2YTXA 1YJNA 5C0XJ 1QCBD 2B63H 4CKEA 3AEVA 5IGCA 3KK7A 4DN4M 3E3XA 4RCNA 4FDBA 5JEAG 4KN7C 4A76A 2MP1A 5G3LF 2WAQB 1T5EA 2JA5B 2L0CA 5D14A 1GUOA 4X62Q 4JI4L 3A7AB 2AQ3B 2RDHA 1PTOC 1SE4A 1MSHA 3OWFA 3OW7A 5JJLA 4XQJA 3GV6A 3DWQA 1V9PA 1YITA 5AFWA 4A3JG 3MFGA 1RODA 1PTOH 5EAYA 1N32Q 4IOAA 2BE5C 1X3EA 3PO2B 3S17H 2VL6A 1CQVA 3KDFA 2DY8A 2SEBD 4YHHQ 3KF8B 2QW7A 2A69C 1MJEA 2D2CC 5LMNW 3PUZA 1VQNA 3L0OA 1VMPA 3H94A 1C4QA 4BY1B 4QCLA 3TP5A 1PH4A 2R92H 4LUVA 2E2DC 3F2DA 4C3HH 4DV4L 1LYLA 5EKKA 2B2WC 2AMCB 2K5QA 1UNSA 1HTPA 1I4PA 4A3BB 1QJOA 1D5MC 3RN2A 3SEBA 2VUMH 1DOMA 1II3A 1SAPA 5IYBH 3Q23A 2F0LA 4DV4Q 3S2HB 1O7YA 1Y1VG 1DJRD 3GTLB 1SFOB 1S5FD 2BH2A 5M5YB 3BVZA 5IWAL 2NVTB 4DV6L 3A56A 4OWWB 1PRTD 2UUAQ 2WB1E 2OCEA 3EIVA 2DY7A 3CRKC 1PH8A 4JCVE 1OTCA 4A3DG 3H0GG 5CYUA 1R4PB 1SEBD 1CKNA 3Q22A 2QKIC 3JAMi 4RFBA 1RTNA 4I65A 3VYSA 2B2TA 1ZEQX 1VQDA 5ELDA 1PH6A 3VR4A 2R7ZB 1G91A 3M4PA 1NJIC 3PF5A 1HQMC 1VQGA 4NB3A 3JC66 3D8GA 1YNXA 5FJ8G 4Q0FA 5CR3A 2KEEA 3HOYH 3I70A 5D65A 1BXTA 2UU9L 2Z9HA 1UAPA 3T51B 3R2IA 1EQTA 4R4QA 4YWLA 5IGDA 4R4TA 2EY2A 4QUFA 2ASBA 4IJLA 4MZ9A 3VA7A 1LTLA 3GV3A 2JYOA 1PFMA 1EWCA 1AZPA 2F0NA 1NR2A 2K5DA 2L4NA 1ET6A 4CHTB 1PRTF 4TRDA 1VQCA 4CJ2C 4DK3C 3T1YL 1A62A 4QY7A 3A55A 3I4OA 4KKSA 4DXGA 4IUUA 2RVLA 2B39A 1D5XC 2KENA 2EYFA 3HGBA 1Y8PB 4IFDG 1SDFA 1GUSA 1DGSA 5I2YA 4CDEC 5C6AA 1H9MA 2E5LL 3CAMA 4C2MH 5C4XH 1PDQA 4JV5Q 4JI6Q 4DAVA 4O2DA 4JI8L 5JEAH 5EPKA 4JYAQ 2EJGC 4LF9L 4PQXA 4FNFA 3J81E 3GTMB 3H3VC 4HAEA 1YHBA 5CV9A 3OOCA 4MN3A 1EIYB 1GHJA 1A3VA 2JA9A 2NZ1D 3TSSA 1HZAA 3NBIA 2KCMA 3HG9A 4RGNA 5COYA 3TN2A 2ZM6Q 1EYGA 1VQ7A 4A3JH 5BR8L 3LWEA 4OELB 3GTPH 3S1NH 4XXEA 2B8FA 2EJFC 3G7LA 5ELCA 1GUWA 1E3PA 4GKKQ 3FP9A 2E2JB 4NMZA 2XWBB 2F0TA 3QG1A 4K8JA 2CVRA 3CCEA 4LF7Q 4P74A 3K59A 2OTLA 1V1QA 5C44B 1V8QA 3BJUA 4JI1L 1HZCA 4XTCS 4HJAA 2X69A 3NSWA 2Q2UA 1HUMA 2VW9A 2A1AA 4KHVA 4PZ8A 3EN2A 4F8MA 2ZM6L 2NN6G 1YIJA 1RDPD 2KBNA 5JAVA 2B2UA 4G7OC 1IBMQ 3U4VA 2L11A 2WB1G 5C4ZA 3M7GA 3N6RA 3NEMA 1K28A 1KTKA 4EVOA 1BVSA 2K03A 3IKJA 1Z6HA 1I4GA 1EY4A 4YWKA 5HY6A 3VR3A 1IBKL 2K5NA 1O80A 4DV2Q 1IL8A 4BBSB 2CW0D 3GD7A 5F2DA 2B2VA 1BCPC 2IX0A 3C3LA 3HRZC 1HFNA 4L63B 3ER0A 2ALYB 4G4KA 2M2LA 2V1CC 3RD4A 1HZBA 3PO2G 5FLXL 3SE0A 2JA8B 4ZAIA 1V1PB 3ONAB 2OTJA 1PVOA 1SMYD 1WI5A 2YU9H 3W5OA 5IT9c 1AH9A 3LX0A 3C46A 1O78A 3CQZB 1LT6D 1LTBD 5GADC 4DUZQ 3HOVB 1GVPA 1FGBD 1NMGA 2UXCQ 3L9AX 4XT1B 4E6IA 5EKLA 2R92B 3PO3G 1U4RA 2WKDA 2JEAI 3MFYA 2ATWA 3SGIA 1TIID 2BA0A 2MGSA 3HOWH 1LT4D 3PUXA 1XWEA 1VQLA 1X56A 4DR1Q 3PF4A 3F1ZA 1OO9B 4IJHA 3SDZA 2F0JA 4BWGB 3D4DA 3J80L 5IGGA 3G48A 2RCNA 2G5DA 4RH6A 1CUKA 3NUCA 1SE8A 3CPWA 3H3VI 3TDQA 5C0XH 3I7FA 4DV2L 3ICEA 1OXSC 2K5WA 3S15H 4GNXC 4KY6A 2I0QA 3H91A 5FLMH 4A3LG 4X6AH 3F2CA 4KJOA 2OQKA 1STGA 3I56A 1B2TA 4X65L 3SK6A 5GAGC 2NVTH 1Y8OB 3RZOB 1XNQL 4DKAC 2JA6G 1B1ZA 1XNQQ 4Z9CB 2K6AA 5IOCA 1YNJD 1ZKOA 3GTPB 2RDGA 4R4CA 2O5JC 4KK7A 1QVGA 1L1OA 3CCUA 2FJ2A 3DEOA 4XIGS 3PIOA 3CXCA 2K04A 3NK9A 1STYA 3F2BA 2RQXA 2K5HA 2QDBA 1TU2B 4QB4A 4DUYQ 2DJFC 4A3EH 4GLXA 1A6XA 1L0WA 3TRZA 5IT9E 1MD2D 3CHBD 1NE3A 5A2QE 2HHHL 5M3MH 3NTKA 4C1NI 2F0VA 2NBFA 3D6WA 4ALPA 2BH8A 4DA2A 3CCVA 1NTGA 3D3RA 5M5XB 5K36G 3T13A 1X3QA 4JC0A 1SNDA 1OXVA 2LY7A 1A2UA 2NVQB 3KOJA 3S9WA 4ME5A 3NWSA 4NXMQ 1WTPA 2NN6H 5FO8B 5I4DA 3L2PA 1PYWD 4HMJA 3MEHA 3HOVG 2SDFA 3TZDA 3UE0A 2A6ED 1U9RA 4BA1I 5M3MG 1QZGA 1SR3A 1CSPA 2H1EA 4ULLA 3G4SA 1N8RC 1F2ZA 1Q90A 2KEDA 4O42A 1STAA 4LF6L 1EYAA 4DGZA 4IUTA 1VQFA 4HIOA 1VDZA 1AW7A 2A74C 1LO5D 1VQ9A 3NELA 3HOUH 1HXYD 3T1HL 2Q2HA 4TVAB 1CA6A 3S1NB 3DM1A 1EEID 3PIP3 5EBCA 4FYDA 4CKBA 2LXKA 4YY3Q 4AYBE 1H9KA 3HOZG 3E0JA 2HCIA 2PZWA 2XSCA 5HGTA 2E2IH 1XMOQ 2K4KA 2A6EC 3M7NA 3CQZH 4CJ0B 1SJED 2E75C 4HIKA 3PO3H 2MJ8A 3AFQA 1ZYRD 2KUMA 1QNUA 1OXXK 3TP6A 1KAWA 4A93B 3X3NA 4JI7L 4IQZA 2F3WA 4ODGA 5KEEA 2CW0C 3UDFA 2GVBA 2EYMA 3RLFA 4V190 1PV4A 4JYAL 2QGQA 3V96A 2JQOA 2IW3A 4H02A 3EFXD 2Z1CA 1W6JA 5K5PA 1WOCA 1MKHA 1QWYA 3M4QA 1B3AA 4CDCC 2N88A 2B3GA 3CKIB 1B7YB 4OIKA 5KIXA 4KHPL 4K0KQ 2NYZD 2HT1A 1ASZA 1YEZA 2ICEC 1XMQQ 3VYTA 1FNUA 2WFWA 4XYOA 5I2XA 1Y1WB 4FF3A 3HOYG 3EQLC 3ND9A 3BZDB 1DOKA 2ZXOA 2Z8LA 2AQ2B 4WFN3 1WD0A 2FMMA 2IWHA 3UDIA 4BY7H 1HRJA 3JAML 1E24A 1TQOA 1EZ6A 3NP8A 1NAPA 3D6CA 5C4HA 1X3PA 1EY9A 1U4MA 4N9PA 1IYJB 1EIFA 2D9UA 1QUQB 1TS2A 1PH7A 4R1JA 1LTGD 3QJYA 3HOYB 2E8GA 1A3UA 4C3JG 1IXRA 2EDGA 1HR0Q 5HURA 4HTHA 1HR0L 1CTMA 1IBKQ 1W3SA 1QUQA 3J81i 4ABNA 4X66Q 2FFKB 2TMPA 2ENBA 3T1YQ 3ITPA 2CCZA 1HTLD 1H95A 1YJ9A 1E2ZA 2IHFA 3TP8A 3EBEA 4JBWA 2JA6B 1U5KA 1XPOA 4YCVA 4RCOA 5EBDA 3MXUA 3CC2A 2EXZA 4OO1I 3OPOA 2BOSA 1VQEA 3PIPA 1T5XD 1FD7D 3QB3A 1YNJC 1JT8A 3G71A 1PH3A 2G9DA 1Y69U 3GTQH 1AEXA 3I55A 4FXGC 3H0GB 1I94L 3MEFA 4K6DA 5C3EG 4RGOS 1S5ED 2QEJC 4TKOB 5AJ3Q 2NVXB 1XYIA 2AKWB 4K5VA 2GVAA 3T56B 2UXBL 1RL2A 3L3OC 4KKUA 3ULJA 2MFIA 3S16B 3HOZB 2PQAA 4MNOA 2K1BA 1WTXA 2Z6KC 1K0RA 4POGA 1HHVA 3KJOA 1TWCB 1F9QA 3KJPA 1IW7C 4PZ7A 5C4JH 2UUCQ 1SYGA 1V1PA 3E5SA 3SK8A 2BDOA 3W2DA 1SYBA 2HIXA 3WDNA 4HJ8A 2LXJA 2HDMA 3U9SA 2R61A 1HPCA 4O1NA 1VQBA 2K05A 1XTDA 3TMEA 2KQ3A 3K0YA 1UE5A 1IL2A 1SN8A 4RAUC 2PMZB 1TWFB 1N32L 4XDXA 5JJKA 3CMEA 2VQFL 1ENFA 2R7ZG 4GKJQ 5DEHA 4YWMA 1K8GA 4JI2L 3HEJA 2JN4A 1I4QA 1B3QA 2K5VA 4RG1A 4DAYA 4PNYA 5KRUA 1EOTA 1MHWC 2ZT9C 5E1FA 4QL5A 3V05A 1UWVA 4B3RL 3TS0A 4YHHL 1EU3A 2N49A 2ID0A 1WJJA 5KYIA 1I4RA 2WKCA 5I6YA 4ZQ3A 2K14A 1TWFH 2CQOA 2HQLA 1E1OA 3JAME 1B4OA 3MC0B 1FVIA 1AFPA 1LLRD 3UDGA 4ZUIA 3E9IA 2B63G 2IX1A 4V0BA 2F0UA 2KHJA 2Y0SB 4BBRG 4NDXA 1ESRA 1S5CD 2AQ1B 3PO3B 4DR5L 4I7AA 2O4XA 4C3HB 3C1EA 1I4XA 4A3FB 1WCMB 3SVMA 1PFBA 4BY1G 4CBVA 1DCZA 3RLOA 2IJ0A 3S2HH 1K73C 1HNXL 3OMGA 1KNEA 4IFDH 2L15A 2N55A 1PFNA 3DMUA 1JICA 2K33A 4ILWA 4KJNA 3GTGB 1BOSA 4DR4L 1TY2A 4P71A 1CM9A 2NVYB 4B08A 4DK1A 4A3EG 1XMQL 3SHLA 1SNCA 1IBML 2VQEQ 4A3JB 4QIWB 4FXKC 2RSOA 1SROA 4J1MA 3GO5A 3OW2A 4GNXB 4C3JB 5LHY1 5ELFA 5BN4A 2PQAB 1WYDA 3FRPB 2Z6KA 4UP9A 2DGYA 2JA6H 2JA5G 3MAQA 2RBMA 5KNCA 3CD6A 4APVA 1X65A 5C5MA 4LFAL 4WJ4A 4DNRB 1X3FA 2IL8A 4DV1L 3T4AC 4OO1H 3CU7A 4ZRZA 3PGZA 3KBGA 1VQPA 1N36Q 3GP7A 1TKWB 5C3XA 5EGTA 1L0XB 1EU4A 3DXJC 1EY7A 4OEMB 4DV7L 3CCSA 1VQOA 1GKHA 4DU9A 2R92G 1RHPA 3BDCA 4A3CG 1TWGB 1TWGH 2K50A 5C3EB 1MJCA 2B8GA 1I6VC 4LF9Q 3UE1A 2H5XA 1HUNA 4LFAQ 5KNBA 1TS3A 4QJFA 3VA5A 1LT5D 1TR5A 2MHVA 4Y7NB 4Y7NH 3M3YH 4DR7Q 4ME3A 1TY0A 4DV5L 4F7XA 1WTWA 4PV1C 5M3FG 1MSGA 5IWAQ 2JA8G 2KCCA 5FLXc 4KLKA 3CRLC 4JI2Q 1TWCH 2NB0A 5IIFA 4DNTB 2BDNA 5IGBA 1Q3LA 2I5MX 2DJGC 1Z7TA 3I4NB 5IYCG 4BBSG 5M5XH 3S24A 2F52A 2E74C 1Y8NB 1PHJA 3H0GH 1LTTD 4R8IA 1VQKA 1Q1EA 3S15B 4L5TA 3KF6A 2J0TD 3RLNA 2UUCL 3G6JB 2NN6I 3S1QH 3T1HQ 5CBAE 2HIVA 3NPPA 1BQQT 4NXML 1Y1VB 1GUGA 2BE5D 2XVSA 4HEDA 2OT2A 2A73B 5D3IB 3VR2A 3Q24A 4JBMA 1EY0A 1KDAA 5J1ZA 4DXFA 3MHBA 2AUJD 2PNRC 2O5IC 3OHXC 1KDCA 3CMAA 2JK8A 1MIUA 4KI0A 2A19A 1Q82C 3BYTB 4C2MB 4XQQA 3SXHA 4DR6Q 3K7AB 1WTVA 3K5MA 4IPDA 1E2WA 3I8ZA 2F0SA 2NVXH 4GLAC 4NXNL 1QE6A 1GXDC 2XNAC 3W1GA 3J7A5 2O2LD 4XT3B 1FYCA 3P20A 2AHOB 5I6WA 2E2IB 2KJXA 4KV6A 2KVMA 1TT2A 1HNZL 2K28A 4F88A 1KRTA 4FXDA 4UY8C 4B3SL 3MTSA 1IW7D 1EOVA 2A68D 1I3QB 1JORA 5BR8Q 1LTRD 4IZ8A 1G6PA 2FINB 3S17B 4A93G 2PYKA 4EQ5A 4DNIA 4RKLA 1F77A 1PZJD 4EQPA 4A3IH 2VS1A 2EYPA 2EYHA 2I07B 4LF4L 1H9SA 5EPJA 1HR0W 4L5RC 2R7DA 4A3MH 1K83H 4JI1Q 3TEHB 2JEBI 2JA5H 2Q8TA 4CDFC 5JJZA 2Q2TA 1XXGA 5GQOA 4A3GG 3FPPA 1K8OA 2BA1A 5AJ3L 2PPBC 4LNQA 3HOXB 1A0IA 1WD1A 1EEFD 1DD2A 3K7UC 3S1RB 1ICWA 4NXNQ 2MO1A 4P75A 2JA7H 3PO2H 4B3SQ 1N36L 2EY5A 1J9OA 1VF7A 2PO4A 4DR3Q 4NW2A 3DWPA 1B8AA 5LL6X 1HFGA 1JE5A 3HOVH 4UP8A 1U4LA 2KCNA 2Q8IB 4KY7A 2EJMA 3U9OA 4IFDJ 2VY3A 4DAYB 5IYDH 4Y52H 2IT1A 4IUQA 4J6HA 1PLFA 2XRQD 1EQVA 4PG3A 2MUYA 1J5EL 3PSIA 2B2YC 3I4MB 2F4IA 4C3IB 2NTSA 4X66L 4ZKCB 3RR5A 1Y1WH 1F2MA 1QG7A 4DUZL 1CSQA 2KOLA 2VUMG 1DZ1A 2CH4A 2F0OA 4JVZA 2F4VL 1M8AA 2F0DA 2B63B 1EY5A 4OXPA 2D5DA 1QVFA 1N34Q 5DNFA 3E6ZX 2EIFA 2E2JH 1WTQA 4FF4A 4AH6A 1X6OA 4F87A 1SE2A 2EQSA 3HS0C 1Z47A 3S2DB 2F3VA 3H3VH 5CBEE 2X6LA 2F0HA 4A4IA 4GZYC 4AQYQ 2CKZB 3PV0A 2DN8A 1PZID 2D0PA 1CQFA 1A8VA 2A69D 3CC4A 2LKVA 1S5BD 2VQFQ 2R7FA 4OX9Q 1D2BA 3QR8A 2EY6A 5IODA 2QF7A 2F0QA 3M4OB 4RHRA 1KAAA 3KLSX 2CHBD 3OMCA 4EQNA 2AWOA 4UDUC 5FO9B 3NE5B 5EKIA 2RF4A 4GN5A 2IPKD 4UPAA 2FMCA 1K8AC 5IP9G 1N33Q 5DLQE 1WCMG 3KF8A 4QF4A 5C0XG 1KRSA 3GTOH 3GTOB 3A7LA 2GA4B 3NTHA 4H44C 5LMNQ 2JSOA 2C35B 3I91A 4BY1H 1IKLA 1I4HA 2F1MA 4A3LH 4NKLA 4K6LA 2Z6BA 3FMCA 1IKMA 4H13C 1WTOA 2C9OA 1EIGA 5JVG3 1JC7A 2CQAA 2D62A 3VR5A 3U58A 4ZCKA 4JI0L 2F0IA 4BY7G 2G9HD 1D5ZC 3DUZA 1RF2D 5C5LA 2EYOA 1CKNB 4IUNA 1PFSA 2B2WA 5BN3A 5KGUA 4X62L 3TQYA 3S2DH 3S1MH 3L7ZC 3W1BA 4OX9L 3J80E 1EFID 1FJGQ 1SSOA 1ICFB 2VXWA 2DNCA 3D4WA 1JJCB 3BG3A 3RMHA 1N34L 3B6YA 1YNNC 4L6TB 3A0JA 1Q1BA 5DAUA 4BXXH 4QGUA 1EYCA 4GN4B 5JOBA 5IT9L 3FKIG 3M85A 5FK9C 1YHQA 4P73A 4R9WA 4WORA 2EY1A 1LABA 1WTRA 4X3KA 3WOEA 4FF2A 1EFWA 1UEAB 4DR6L 1HZ9A 4IPCA 4M1UB 1U0LA 3M9BA 5JEAJ 5C4JB 4LW1A 2DNEA 1RTOA 3BZKA 1Q86C 4BXXG 2OEOA 1HNWL 1BBWA 2MPMA 4GLVB 1HA5A 3DM3A 2R93G 1ASYA 3OIPA 2B2VC 2QILA 5ISRA 1XPRA 3GQBA 3LWUA 4ZKBB 1YJWA 3A5UA 1A63A 4KD3A 3LGJA 3E9HA 5LMUL 1GOZA 1S3OA 3T53B 3QIAA 4JI3Q 2IX3A 1VQ4A 3K0XA 1EQRA 5NUCA 3LNNA 4LFCQ 1N9WA 4K14A 4R4OA 2WIIB 1UE7A 2CWAA 1PXUA 3STBC 4BBSH 3P75A 5J3BA 3J7AV 3FHWA 4GKJL 2F03A 1AE3A 2I46A 4ZLTF 2JE6I 3A8JE 4JW0A 1B9NA 2ZTEA 2SOBA 2HDLA 2VZAA 2OWOA 3U4ZA 1PYBA 4OGQC 1AP0A 4J15A 2ZXPA 1NY4A 1BUVT 4A3BH 3F8TA 4YCWA 5KNDA 3MXNB 1X9NA 2B2YA 4WJWA 1X54A 4AIMA 4LF4Q 3IL8A 2WAQE 1IHZA 3F2UA 1PMRA 4JG2A 2NUCA 3J80c 3H09A 4U673 1B53A 4WRDA 1JMCA 4BY7B 5IGEA 1EWHA 5EJWA 2F4VQ 5KYLA 4KHPQ 4ZYSA 4K0KL 4DR4Q 1M4VA 4BBRB 1ENCA 1C9OA 1SNQA 3I3CA 3K57A 1FR3A 1LV9A 3K5LA 4HCEA 1KDBA 1HNZQ 1J8IA 4MTKA 1F9PA 2TSSA 2R93B 3OWEB 1F9RA 2OQ0A 1AE2A 2PZUA 4PZ6A 4C3JH 1ILQA 4LJZC 3ZYYX 1H9SB 1G8ZD 4BBRH 5FOBB 4QIWE
chains in the Genus database with same CATH topology
4UP7A 2JA5G 2PNHA 3CD6A 2ZTDA 4OWXB 3ER0A 4APVA 2ALYB 1X65A 2WAQG 4LFAL 2MO0A 2V1CC 3AFPA 3HOXH 3DLLA 4WJ4A 1X3FA 1HZBA 4DV1L 3PO2G 3GTGH 1SMXA 3PGZA 1K3RA 5JJIA 1KQSA 2OTJA 5C44G 1PVOA 1WI5A 1VQPA 1N36Q 3A5ZB 5GAHC 2YU9H 3W5OA 3D31A 1LM0A 3I4MG 5IT9c 1WFQA 1AH9A 1S72A 4DV7L 3CCSA 1VQOA 5GADC 3KF6B 1GKHA 5IP9H 2QA4A 4DUZQ 2R92G 1GVPA 3TREA 4A3CG 1NMGA 1TWGH 2K50A 2UXCQ 1MJCA 3U50C 4LF9Q 4NPSA 2H5XA 3UE1A 2E5LQ 4LFAQ 3HKZE 2ES2A 3PO3G 2JEAI 4QJFA 2ATWA 3CC7A 3SGIA 4Y7NH 3M3YH 4IPHA 2BA0A 4ME3A 1PH5A 1E7ZA 1IZ6A 2DUDA 3HOWH 4DR7Q 4DV5L 1KHIA 5IE8A 5M3FG 1XMOL 5IWAQ 3PUXA 1VQLA 2JA8G 1D8LA 1Q8KA 3KLWA 5FLXc 4KLKA 1X56A 4LUOA 1I5FA 4DR1Q 2UUBQ 2WP8J 1XNRL 4JI2Q 3PF4A 4LFBQ 2JA7G 3F1ZA 1TWCH 1I94Q 1KC8C 3HOXG 4IJHA 2I5MX 4HIDA 3J81j 4OONA 1P16A 5IYCG 1I6HH 5LMUQ 3G48A 4BBSG 2YTVA 2RCNA 4JI5L 5M5XH 1CUKA 1E1TA 1SE8A 3S24A 2F52A 3HFZB 4POFA 3CPWA 3H3VI 4B3TL 3ULPA 3RN5A 1PHJA 3H0GH 3GDEA 4DR2Q 3I7FA 1VQKA 2N78A 4DV2L 1Q1EA 4LF6Q 4JI5Q 3ICEA 1OXSC 4L5TA 3KF6A 4GNXC 2I0QA 3RLNA 2UUCL 4LWCA 2NN6I 3S15H 3S1QH 3RNUA 3T1HQ 5FLMH 4LF8L 3RZOH 2HIVA 4OWTB 4A3LG 1G51A 4X6AH 1VQ6A 3F2CA 2YV5A 4NXML 1JJGA 3HOWG 1T9HA 2OQKA 1VQ5A 3CCRA 4JBMA 4MTNA 4AYBG 3I56A 2PI2E 3Q8DA 4X65L 5GAGC 2NVTH 4DUYL 3I4NH 1XNQL 4DKAC 4B3TQ 2JA6G 1XNQQ 1RIPA 4DK6C 3CMAA 2JK8A 1MIUA 4KI0A 2A19A 1Q82C 1KIXA 4DR6Q 1I3QH 4R4CA 2NZHA 2IY5B 2I5HA 4IPDA 1YZ6A 4A75A 1QVGA 2GN5A 3HOUG 1L1OA 3CCUA 4A3GH 1B70B 2NVXH 4GLAC 4XIGS 4NXNL 5C44H 3PIOA 3D0FA 3CXCA 2UUBL 1CKOA 3F2BA 1VCIA 4IFDI 3I4NG 5IYBG 2NZOA 1N33Q 1VQHA 3W1GA 2K5HA 2R93H 3J7A5 1R9TH 1Y1VH 4DUYQ 4A3EH 4GLXA 1LUZA 1L0WA 2AHOB 1KD1C 2N8NA 2Q2IA 3CP0A 3TRZA 4HJ9A 1UEBA 1K9MC 3PUVA 3ZJYC 3J7ZC 4QQBX 1BKBA 1NE3A 4JI0Q 1HNZL 2HHHL 2Y0SE 2B29A 5M3MH 1XNRQ 1KRTA 4UY8C 4DV7Q 4B3SL 2FXQA 4JBKA 4ALPA 1G291 1EOVA 2BH8A 3CCVA 3K7AH 1QZHA 1J5EQ 1IBLL 5BR8Q 1NTGA 5K36G 4DV5Q 4JC0A 1G6PA 1OXVA 4A3FG 1WCMH 3KOJA 4NXMQ 5IY0A 4A93G 1O7IA 4EQ5A 4DNIA 4DV3Q 3L2PA 3KFUA 3HOVG 1V43A 4DR6L 3UE0A 4TQUS 4BA1I 5M3MG 1QZGA 1SR3A 1XPUA 1CSPA 4A3IH 3AYHB 2VS1A 4GNXA 1M90C 2UXBQ 3G4SA 3ULLA 1N8RC 4A3BG 2ZJPA 2UXDQ 1S40A 4LF4L 1TWHH 4RMFA 1JB7A 1HR0W 4LF6L 1VQFA 3KYHC 2R7DA 4L5RC 4GOPC 4A3MH 1JJ2A 4BA2I 1K83H 4JI1Q 4HIOA 3TEHB 2JEBI 4IPGA 3I2ZA 3HKZG 2JA5H 3OYYA 1HNWQ 1EWIA 3CCMA 3NENA 1VQ9A 2Q2TA 5GQOA 3NELA 1J6QA 4HJ5A 3HOUH 4A3GG 1OXUA 3T1HL 2Q2HA 4TVAB 2RHQB 3G6EA 1VQJA 3S1RH 2ZTCA 2PMZE 2BA1A 1FGUA 5M5WH 5AJ3L 4GOPB 1PH2A 4LNQA 5C4XG 4JI6L 1A0IA 2EXDA 5IP7H 1OXTA 4YCUA 2LXKA 4YY3Q 1PA6A 1TWAH 4AYBE 3K7UC 4YY3L 3I4MH 3HOZG 4EX5A 4NXNQ 2MO1A 2MNAA 4P75A 1M1KC 3WWVA 2IHEA 2E2IH 1XMOQ 4AQYL 2JA7H 3PO2H 3CCJA 1YBYA 1VQMA 4B3SQ 1N36L 2K4KA 4DV0Q 4JOIC 1D7QA 4DR3Q 3CQZH 3M7NA 1B8AA 2RHSB 1JE5A 4HIKA 3PO3H 2UUAL 3BZCA 3HOVH 3AFQA 4HJ7A 4LFBL 1BBUA 3CPFA 4UP8A 4IO9A 1HJPA 1OXXK 2QEXA 4A3IG 4JI7Q 3HKSA 5IP7G 4DPGA 2JJQA 3OTOL 4DR5Q 1PYSB 1Z9FA 3PCOB 3K8AA 3A74A 4BBSH 2UXCL 1X55A 4IFDJ 2VY3A 4DAYB 1KAWA 1UE1A 4A93H 4Y52H 5IYDH 4LUZA 4JI7L 2IT1A 1SRUA 4A3KH 1PH1A 1Y14B 4PG3A 1J5EL 4A3MG 1IBLQ 3PSIA 2I5LX 1YVCA 2LSSA 3KDFB 2E2HH 3UDFA 3JAMc 1E22A 1GD7A 1UE6A 2GVBA 2YTXA 3RLFA 1YJNA 4OO1G 5C0XJ 1I50H 4X66L 1PV4A 4JYAL 3RR5A 2QGQA 2B63H 1Y1WH 2JQOA 3AEVA 4H02A 1EQQA 4DUZL 1CSQA 2VUMG 1Q12A 4FDBA 4X64Q 5JEAG 4A76A 2F4VL 1WOCA 1MKHA 3M4QA 1HH2P 4OXPA 1HNXQ 3S14H 2B3GA 1B7YB 1QVFA 4X62Q 3CCQA 1N34Q 4JI4L 1VQAA 4KHPL 4K0KQ 2EIFA 1L2FA 5C0XI 2E2JH 2HT1A 1QVCA 1ASZA 4AH6A 3VDYA 1X6OA 1YEZA 4R4IA 1XMQQ 2EQSA 1Z47A 3RZDH 2Z0SA 3H3VH 5JJLA 2WFWA 2VQEL 4A4IA 1NBWA 1V9PA 1YITA 3HOYG 2D0OA 2CKZB 4AQYQ 4A3JG 4C3IH 3PV0A 2D0PA 3UDIA 4BY7H 5H1SE 1A8VA 5EAYA 1N32Q 1E24A 3CC4A 4IOAA 1SLJA 4B3ML 3K80C 1EUJA 1X3EA 2VQFQ 2R7FA 2VL6A 3S17H 1IYJB 3KDFA 4OX9Q 1EIFA 4LF8Q 4YHHQ 1QUQB 3KF8B 1PH7A 1MJEA 4R1JA 5LMNW 4LFCL 3PUZA 2AWOA 4DV1Q 4DV0L 1VQNA 2E8GA 3L0OA 1Y1WG 4JI3L 2RF4A 4GN5A 2VNUD 1IXRA 4UPAA 1HR0Q 3M4OH 2XTIA 1PH4A 1K8AC 1HR0L 5IP9G 2R92H 4A3FH 1W3SA 1QUQA 1WCMG 4GN3B 5DLQE 5C0XG 3J81i 3E0EA 4X66Q 1KRSA 3GTOH 3T1YQ 4LUVA 2CCZA 5LMNQ 2C35B 3F2DA 4C3HH 1H95A 4DV4L 1YJ9A 2IHFA 3STBD 4BY1H 3NBHB 1LYLA 3EBEA 2AMCB 2MQHA 4JBWA 4L5QA 1U5KA 1XPOA 1SFOH 1C7YA 3RN2A 4A3LH 1C0AA 1YHAA 4YCVA 4DV3L 2VUMH 5IYBH 4DV4Q 1YI2A 3CC2A 1Y1VG 4O0AA 4OO1I 2D62A 1VQEA 2A8VA 1L1OC 2R7ZH 3PIPA 3U58A 5GROA 2KHIA 4JI0L 4BY7G 1FL0A 2BH2A 2UXDL 5IWAL 4DV6L 1JT8A 3G71A 1PH3A 4OWWB 3BU2A 1CKNB 1Q46A 2ZJRA 3GTQH 2UUAQ 2WB1E 1PFSA 1NMFA 2OCEA 3ERSX 3I55A 1I94L 4X62L 3EIVA 3TQYA 3MEFA 1GM5A 3S2DH 1PH8A 3L7ZC 1Q7YC 3S1MH 4JCVE 3W1BA 1OTCA 4B3RQ 4A3DG 4OX9L 1FJGL 3H0GG 5C3EG 1FJGQ 1CKNA 5AJ3Q 4X64L 1CKMA 3JAMi 3GTLH 1P8LA 2YTYA 2AKWB 2NVYH 4DR7L 2GVAA 2UXBL 1VQDA 1PH6A 5FLMG 3CW2C 3TS2A 1RL2A 2XGTA 3ULJA 4LF7L 1JJCB 2MFIA 3M4PA 1NJIC 3B6YA 3PF5A 1N34L 2YYZA 1VQGA 3A0JA 2PQAA 4MNOA 4NB3A 4HIMA 1Q1BA 3JC66 4BXXH 2Z6KC 4QGUA 1K0RA 4POGA 1YNXA 2N3SA 5FJ8G 4GN4B 5GAEC 3KJOA 3FKIG 3KJPA 5ELNA 4PMWA 3M85A 3HOYH 4PZ7A 5C4JH 3CF5A 2UUCQ 1YHQA 4P73A 2E5LL 2UU9L 2HIXA 3OTOQ 4HJ8A 2LXJA 1EFWA 1Q81C 3GTJH 4YWLA 4R4QA 1W2BA 1HZ9A 1VQBA 1U0LA 3M9BA 1XTDA 4IPCA 3H15A 5JEAJ 2F3IA 4LW1A 4R4TA 1UE5A 1IL2A 1X3GA 1Q86C 3BZKA 2ASBA 4BXXG 4IJLA 1SN8A 4MZ9A 1HNWL 1BBWA 1N32L 1LTLA 4GLVB 5JJKA 3CMEA 2CWPA 3S16H 5ELOA 3DM3A 2VQFL 4JI8Q 2R7ZG 4GKJQ 2R93G 1ASYA 4YWMA 4DR2L 4X65Q 1K8GA 1VQCA 4JI2L 4DK3C 3T1YL 1A62A 4QY7A 3J80i 1XPRA 2K5VA 3I4OA 4RG1A 2R6GA 4KHZA 1YJWA 3A5UA 5M5YH 1A63A 4QL5A 4WJ3M 3LGJA 4A3KG 1UWVA 3E9HA 5LMUL 3TS0A 1S3OA 2KENA 4YHHL 4B3RL 2K52A 4JI3Q 4IFDG 2CFMA 2N49A 1VQ4A 3CCLA 2ID0A 3K0XA 1WJJA 1EQRA 1DGSA 4LFCQ 1N9WA 5E7NA 4R4OA 1UE7A 2CWAA 2K14A 5C3EH 1TWFH 2CQOA 3CAMA 2HQLA 3K81C 3STBC 4C2MH 5C4XH 1IBKQ 5J3BA 1E1OA 5IYDG 2ZJQA 4JV5Q 4JI6Q 3FHWA 3FKIH 4JV5L 4O2DA 4JI8L 3GTKH 2KCTA 4GKJL 1FVIA 1AE3A 4JYAQ 4LF5L 2JE6I 4LF9L 4IOCA 2K75A 4DAMA 3J81c 2ZTEA 2OWOA 4GOPA 2VZAA 3UDGA 3U4ZA 3E9IA 1PYBA 1YHBA 2B63G 2Y0SG 1EIYB 2IX1A 4L5SA 4J15A 1NY4A 4LF5Q 4DR1L 4A3BH 1VS0A 1VQIA 1PH9A 4JOIA 2JA9A 2KHJA 4BBRG 3F8TA 1HZAA 4YCWA 2KCMA 3UDXA 3IRBA 2ZM6Q 4DR5L 1EYGA 1VQ7A 3MXNB 4A3DH 4A3JH 3PUYA 5BR8L 3GTPH 4JBJA 1X9NA 3S1NH 2NVQH 2AWNA 1X54A 4AIMA 4LF4Q 1E3PA 2WAQE 4BY1G 4GKKQ 3FP9A 4JG2A 4A3CH 3AQQA 3J80c 3RLOA 1JMCA 3S2HH 1K73C 1HNXL 4LF7Q 3CCEA 4P74A 2L15A 2OTLA 1V1QA 2F4VQ 3PUWA 4JI4Q 4KHPQ 4K0KL 4DR4Q 3BJUA 1KXLA 4JI1L 1HZCA 1TXYA 5FJ8H 4XTCS 4HJAA 2UU9Q 4P72A 1XJVA 3HOZH 1C9OA 2Q2UA 2VW9A 5M3FH 1L1OB 2A1AA 4PZ8A 3EN2A 2ZM6L 4DR4L 2NN6G 1YIJA 2JA8H 2PI2A 3GTMH 2KBNA 4P71A 1HNZQ 2HHHQ 4A3EG 1XMQL 1IBMQ 3U4VA 1KL9A 2WB1G 1IBML 2VQEQ 5LMNL 3NEMA 4GKKL 1BVSA 2OQ0A 1AE2A 4YWKA 1GO3E 4DV6Q 1SROA 5HY6A 1IBKL 1N33L 3GO5A 2K5NA 4PZ6A 4C3JH 4GNXB 3OW2A 4DV2Q 4DR3L 4B3MQ 4GS3A 5IYCH 2PQAB 1WYDA 3GD7A 4UP9A 2Z6KA 1VQ8A 2IX0A 4BBRH 5HGQA 4QIWE 2DGYA 2JA6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP7 A;  2JA5 G;  2PNH A;  3CD6 A;  2ZTD A;  4OWX B;  3ER0 A;  4APV A;  2ALY B;  1X65 A;  2WAQ G;  4LFA L;  2MO0 A;  2V1C C;  3AFP A;  3HOX H;  3DLL A;  4WJ4 A;  1X3F A;  1HZB A;  4DV1 L;  3PO2 G;  3GTG H;  1SMX A;  3PGZ A;  1K3R A;  5JJI A;  1KQS A;  2OTJ A;  5C44 G;  1PVO A;  1WI5 A;  1VQP A;  1N36 Q;  3A5Z B;  5GAH C;  2YU9 H;  3W5O A;  3D31 A;  1LM0 A;  3I4M G;  5IT9 c;  1WFQ A;  1AH9 A;  1S72 A;  4DV7 L;  3CCS A;  1VQO A;  5GAD C;  3KF6 B;  1GKH A;  5IP9 H;  2QA4 A;  4DUZ Q;  2R92 G;  1GVP A;  3TRE A;  4A3C G;  1NMG A;  1TWG H;  2K50 A;  2UXC Q;  1MJC A;  3U50 C;  4LF9 Q;  4NPS A;  2H5X A;  3UE1 A;  2E5L Q;  4LFA Q;  3HKZ E;  2ES2 A;  3PO3 G;  2JEA I;  4QJF A;  2ATW A;  3CC7 A;  3SGI A;  4Y7N H;  3M3Y H;  4IPH A;  2BA0 A;  4ME3 A;  1PH5 A;  1E7Z A;  1IZ6 A;  2DUD A;  3HOW H;  4DR7 Q;  4DV5 L;  1KHI A;  5IE8 A;  5M3F G;  1XMO L;  5IWA Q;  3PUX A;  1VQL A;  2JA8 G;  1D8L A;  1Q8K A;  3KLW A;  5FLX c;  4KLK A;  1X56 A;  4LUO A;  1I5F A;  4DR1 Q;  2UUB Q;  2WP8 J;  1XNR L;  4JI2 Q;  3PF4 A;  4LFB Q;  2JA7 G;  3F1Z A;  1TWC H;  1I94 Q;  1KC8 C;  3HOX G;  4IJH A;  2I5M X;  4HID A;  3J81 j;  4OON A;  1P16 A;  5IYC G;  1I6H H;  5LMU Q;  3G48 A;  4BBS G;  2YTV A;  2RCN A;  4JI5 L;  5M5X H;  1CUK A;  1E1T A;  1SE8 A;  3S24 A;  2F52 A;  3HFZ B;  4POF A;  3CPW A;  3H3V I;  4B3T L;  3ULP A;  3RN5 A;  1PHJ A;  3H0G H;  3GDE A;  4DR2 Q;  3I7F A;  1VQK A;  2N78 A;  4DV2 L;  1Q1E A;  4LF6 Q;  4JI5 Q;  3ICE A;  1OXS C;  4L5T A;  3KF6 A;  4GNX C;  2I0Q A;  3RLN A;  2UUC L;  4LWC A;  2NN6 I;  3S15 H;  3S1Q H;  3RNU A;  3T1H Q;  5FLM H;  4LF8 L;  3RZO H;  2HIV A;  4OWT B;  4A3L G;  1G51 A;  4X6A H;  1VQ6 A;  3F2C A;  2YV5 A;  4NXM L;  1JJG A;  3HOW G;  1T9H A;  2OQK A;  1VQ5 A;  3CCR A;  4JBM A;  4MTN A;  4AYB G;  3I56 A;  2PI2 E;  3Q8D A;  4X65 L;  5GAG C;  2NVT H;  4DUY L;  3I4N H;  1XNQ L;  4DKA C;  4B3T Q;  2JA6 G;  1XNQ Q;  1RIP A;  4DK6 C;  3CMA A;  2JK8 A;  1MIU A;  4KI0 A;  2A19 A;  1Q82 C;  1KIX A;  4DR6 Q;  1I3Q H;  4R4C A;  2NZH A;  2IY5 B;  2I5H A;  4IPD A;  1YZ6 A;  4A75 A;  1QVG A;  2GN5 A;  3HOU G;  1L1O A;  3CCU A;  4A3G H;  1B70 B;  2NVX H;  4GLA C;  4XIG S;  4NXN L;  5C44 H;  3PIO A;  3D0F A;  3CXC A;  2UUB L;  1CKO A;  3F2B A;  1VCI A;  4IFD I;  3I4N G;  5IYB G;  2NZO A;  1N33 Q;  1VQH A;  3W1G A;  2K5H A;  2R93 H;  3J7A 5;  1R9T H;  1Y1V H;  4DUY Q;  4A3E H;  4GLX A;  1LUZ A;  1L0W A;  2AHO B;  1KD1 C;  2N8N A;  2Q2I A;  3CP0 A;  3TRZ A;  4HJ9 A;  1UEB A;  1K9M C;  3PUV A;  3ZJY C;  3J7Z C;  4QQB X;  1BKB A;  1NE3 A;  4JI0 Q;  1HNZ L;  2HHH L;  2Y0S E;  2B29 A;  5M3M H;  1XNR Q;  1KRT A;  4UY8 C;  4DV7 Q;  4B3S L;  2FXQ A;  4JBK A;  4ALP A;  1G29 1;  1EOV A;  2BH8 A;  3CCV A;  3K7A H;  1QZH A;  1J5E Q;  1IBL L;  5BR8 Q;  1NTG A;  5K36 G;  4DV5 Q;  4JC0 A;  1G6P A;  1OXV A;  4A3F G;  1WCM H;  3KOJ A;  4NXM Q;  5IY0 A;  4A93 G;  1O7I A;  4EQ5 A;  4DNI A;  4DV3 Q;  3L2P A;  3KFU A;  3HOV G;  1V43 A;  4DR6 L;  3UE0 A;  4TQU S;  4BA1 I;  5M3M G;  1QZG A;  1SR3 A;  1XPU A;  1CSP A;  4A3I H;  3AYH B;  2VS1 A;  4GNX A;  1M90 C;  2UXB Q;  3G4S A;  3ULL A;  1N8R C;  4A3B G;  2ZJP A;  2UXD Q;  1S40 A;  4LF4 L;  1TWH H;  4RMF A;  1JB7 A;  1HR0 W;  4LF6 L;  1VQF A;  3KYH C;  2R7D A;  4L5R C;  4GOP C;  4A3M H;  1JJ2 A;  4BA2 I;  1K83 H;  4JI1 Q;  4HIO A;  3TEH B;  2JEB I;  4IPG A;  3I2Z A;  3HKZ G;  2JA5 H;  3OYY A;  1HNW Q;  1EWI A;  3CCM A;  3NEN A;  1VQ9 A;  2Q2T A;  5GQO A;  3NEL A;  1J6Q A;  4HJ5 A;  3HOU H;  4A3G G;  1OXU A;  3T1H L;  2Q2H A;  4TVA B;  2RHQ B;  3G6E A;  1VQJ A;  3S1R H;  2ZTC A;  2PMZ E;  2BA1 A;  1FGU A;  5M5W H;  5AJ3 L;  4GOP B;  1PH2 A;  4LNQ A;  5C4X G;  4JI6 L;  1A0I A;  2EXD A;  5IP7 H;  1OXT A;  4YCU A;  2LXK A;  4YY3 Q;  1PA6 A;  1TWA H;  4AYB E;  3K7U C;  4YY3 L;  3I4M H;  3HOZ G;  4EX5 A;  4NXN Q;  2MO1 A;  2MNA A;  4P75 A;  1M1K C;  3WWV A;  2IHE A;  2E2I H;  1XMO Q;  4AQY L;  2JA7 H;  3PO2 H;  3CCJ A;  1YBY A;  1VQM A;  4B3S Q;  1N36 L;  2K4K A;  4DV0 Q;  4JOI C;  1D7Q A;  4DR3 Q;  3CQZ H;  3M7N A;  1B8A A;  2RHS B;  1JE5 A;  4HIK A;  3PO3 H;  2UUA L;  3BZC A;  3HOV H;  3AFQ A;  4HJ7 A;  4LFB L;  1BBU A;  3CPF A;  4UP8 A;  4IO9 A;  1HJP A;  1OXX K;  2QEX A;  4A3I G;  4JI7 Q;  3HKS A;  5IP7 G;  4DPG A;  2JJQ A;  3OTO L;  4DR5 Q;  1PYS B;  1Z9F A;  3PCO B;  3K8A A;  3A74 A;  4BBS H;  2UXC L;  1X55 A;  4IFD J;  2VY3 A;  4DAY B;  1KAW A;  1UE1 A;  4A93 H;  4Y52 H;  5IYD H;  4LUZ A;  4JI7 L;  2IT1 A;  1SRU A;  4A3K H;  1PH1 A;  1Y14 B;  4PG3 A;  1J5E L;  4A3M G;  1IBL Q;  3PSI A;  2I5L X;  1YVC A;  2LSS A;  3KDF B;  2E2H H;  3UDF A;  3JAM c;  1E22 A;  1GD7 A;  1UE6 A;  2GVB A;  2YTX A;  3RLF A;  1YJN A;  4OO1 G;  5C0X J;  1I50 H;  4X66 L;  1PV4 A;  4JYA L;  3RR5 A;  2QGQ A;  2B63 H;  1Y1W H;  2JQO A;  3AEV A;  4H02 A;  1EQQ A;  4DUZ L;  1CSQ A;  2VUM G;  1Q12 A;  4FDB A;  4X64 Q;  5JEA G;  4A76 A;  2F4V L;  1WOC A;  1MKH A;  3M4Q A;  1HH2 P;  4OXP A;  1HNX Q;  3S14 H;  2B3G A;  1B7Y B;  1QVF A;  4X62 Q;  3CCQ A;  1N34 Q;  4JI4 L;  1VQA A;  4KHP L;  4K0K Q;  2EIF A;  1L2F A;  5C0X I;  2E2J H;  2HT1 A;  1QVC A;  1ASZ A;  4AH6 A;  3VDY A;  1X6O A;  1YEZ A;  4R4I A;  1XMQ Q;  2EQS A;  1Z47 A;  3RZD H;  2Z0S A;  3H3V H;  5JJL A;  2WFW A;  2VQE L;  4A4I A;  1NBW A;  1V9P A;  1YIT A;  3HOY G;  2D0O A;  2CKZ B;  4AQY Q;  4A3J G;  4C3I H;  3PV0 A;  2D0P A;  3UDI A;  4BY7 H;  5H1S E;  1A8V A;  5EAY A;  1N32 Q;  1E24 A;  3CC4 A;  4IOA A;  1SLJ A;  4B3M L;  3K80 C;  1EUJ A;  1X3E A;  2VQF Q;  2R7F A;  2VL6 A;  3S17 H;  1IYJ B;  3KDF A;  4OX9 Q;  1EIF A;  4LF8 Q;  4YHH Q;  1QUQ B;  3KF8 B;  1PH7 A;  1MJE A;  4R1J A;  5LMN W;  4LFC L;  3PUZ A;  2AWO A;  4DV1 Q;  4DV0 L;  1VQN A;  2E8G A;  3L0O A;  1Y1W G;  4JI3 L;  2RF4 A;  4GN5 A;  2VNU D;  1IXR A;  4UPA A;  1HR0 Q;  3M4O H;  2XTI A;  1PH4 A;  1K8A C;  1HR0 L;  5IP9 G;  2R92 H;  4A3F H;  1W3S A;  1QUQ A;  1WCM G;  4GN3 B;  5DLQ E;  5C0X G;  3J81 i;  3E0E A;  4X66 Q;  1KRS A;  3GTO H;  3T1Y Q;  4LUV A;  2CCZ A;  5LMN Q;  2C35 B;  3F2D A;  4C3H H;  1H95 A;  4DV4 L;  1YJ9 A;  2IHF A;  3STB D;  4BY1 H;  3NBH B;  1LYL A;  3EBE A;  2AMC B;  2MQH A;  4JBW A;  4L5Q A;  1U5K A;  1XPO A;  1SFO H;  1C7Y A;  3RN2 A;  4A3L H;  1C0A A;  1YHA A;  4YCV A;  4DV3 L;  2VUM H;  5IYB H;  4DV4 Q;  1YI2 A;  3CC2 A;  1Y1V G;  4O0A A;  4OO1 I;  2D62 A;  1VQE A;  2A8V A;  1L1O C;  2R7Z H;  3PIP A;  3U58 A;  5GRO A;  2KHI A;  4JI0 L;  4BY7 G;  1FL0 A;  2BH2 A;  2UXD L;  5IWA L;  4DV6 L;  1JT8 A;  3G71 A;  1PH3 A;  4OWW B;  3BU2 A;  1CKN B;  1Q46 A;  2ZJR A;  3GTQ H;  2UUA Q;  2WB1 E;  1PFS A;  1NMF A;  2OCE A;  3ERS X;  3I55 A;  1I94 L;  4X62 L;  3EIV A;  3TQY A;  3MEF A;  1GM5 A;  3S2D H;  1PH8 A;  3L7Z C;  1Q7Y C;  3S1M H;  4JCV E;  3W1B A;  1OTC A;  4B3R Q;  4A3D G;  4OX9 L;  1FJG L;  3H0G G;  5C3E G;  1FJG Q;  1CKN A;  5AJ3 Q;  4X64 L;  1CKM A;  3JAM i;  3GTL H;  1P8L A;  2YTY A;  2AKW B;  2NVY H;  4DR7 L;  2GVA A;  2UXB L;  1VQD A;  1PH6 A;  5FLM G;  3CW2 C;  3TS2 A;  1RL2 A;  2XGT A;  3ULJ A;  4LF7 L;  1JJC B;  2MFI A;  3M4P A;  1NJI C;  3B6Y A;  3PF5 A;  1N34 L;  2YYZ A;  1VQG A;  3A0J A;  2PQA A;  4MNO A;  4NB3 A;  4HIM A;  1Q1B A;  3JC6 6;  4BXX H;  2Z6K C;  4QGU A;  1K0R A;  4POG A;  1YNX A;  2N3S A;  5FJ8 G;  4GN4 B;  5GAE C;  3KJO A;  3FKI G;  3KJP A;  5ELN A;  4PMW A;  3M85 A;  3HOY H;  4PZ7 A;  5C4J H;  3CF5 A;  2UUC Q;  1YHQ A;  4P73 A;  2E5L L;  2UU9 L;  2HIX A;  3OTO Q;  4HJ8 A;  2LXJ A;  1EFW A;  1Q81 C;  3GTJ H;  4YWL A;  4R4Q A;  1W2B A;  1HZ9 A;  1VQB A;  1U0L A;  3M9B A;  1XTD A;  4IPC A;  3H15 A;  5JEA J;  2F3I A;  4LW1 A;  4R4T A;  1UE5 A;  1IL2 A;  1X3G A;  1Q86 C;  3BZK A;  2ASB A;  4BXX G;  4IJL A;  1SN8 A;  4MZ9 A;  1HNW L;  1BBW A;  1N32 L;  1LTL A;  4GLV B;  5JJK A;  3CME A;  2CWP A;  3S16 H;  5ELO A;  3DM3 A;  2VQF L;  4JI8 Q;  2R7Z G;  4GKJ Q;  2R93 G;  1ASY A;  4YWM A;  4DR2 L;  4X65 Q;  1K8G A;  1VQC A;  4JI2 L;  4DK3 C;  3T1Y L;  1A62 A;  4QY7 A;  3J80 i;  1XPR A;  2K5V A;  3I4O A;  4RG1 A;  2R6G A;  4KHZ A;  1YJW A;  3A5U A;  5M5Y H;  1A63 A;  4QL5 A;  4WJ3 M;  3LGJ A;  4A3K G;  1UWV A;  3E9H A;  5LMU L;  3TS0 A;  1S3O A;  2KEN A;  4YHH L;  4B3R L;  2K52 A;  4JI3 Q;  4IFD G;  2CFM A;  2N49 A;  1VQ4 A;  3CCL A;  2ID0 A;  3K0X A;  1WJJ A;  1EQR A;  1DGS A;  4LFC Q;  1N9W A;  5E7N A;  4R4O A;  1UE7 A;  2CWA A;  2K14 A;  5C3E H;  1TWF H;  2CQO A;  3CAM A;  2HQL A;  3K81 C;  3STB C;  4C2M H;  5C4X H;  1IBK Q;  5J3B A;  1E1O A;  5IYD G;  2ZJQ A;  4JV5 Q;  4JI6 Q;  3FHW A;  3FKI H;  4JV5 L;  4O2D A;  4JI8 L;  3GTK H;  2KCT A;  4GKJ L;  1FVI A;  1AE3 A;  4JYA Q;  4LF5 L;  2JE6 I;  4LF9 L;  4IOC A;  2K75 A;  4DAM A;  3J81 c;  2ZTE A;  2OWO A;  4GOP A;  2VZA A;  3UDG A;  3U4Z A;  3E9I A;  1PYB A;  1YHB A;  2B63 G;  2Y0S G;  1EIY B;  2IX1 A;  4L5S A;  4J15 A;  1NY4 A;  4LF5 Q;  4DR1 L;  4A3B H;  1VS0 A;  1VQI A;  1PH9 A;  4JOI A;  2JA9 A;  2KHJ A;  4BBR G;  3F8T A;  1HZA A;  4YCW A;  2KCM A;  3UDX A;  3IRB A;  2ZM6 Q;  4DR5 L;  1EYG A;  1VQ7 A;  3MXN B;  4A3D H;  4A3J H;  3PUY A;  5BR8 L;  3GTP H;  4JBJ A;  1X9N A;  3S1N H;  2NVQ H;  2AWN A;  1X54 A;  4AIM A;  4LF4 Q;  1E3P A;  2WAQ E;  4BY1 G;  4GKK Q;  3FP9 A;  4JG2 A;  4A3C H;  3AQQ A;  3J80 c;  3RLO A;  1JMC A;  3S2H H;  1K73 C;  1HNX L;  4LF7 Q;  3CCE A;  4P74 A;  2L15 A;  2OTL A;  1V1Q A;  2F4V Q;  3PUW A;  4JI4 Q;  4KHP Q;  4K0K L;  4DR4 Q;  3BJU A;  1KXL A;  4JI1 L;  1HZC A;  1TXY A;  5FJ8 H;  4XTC S;  4HJA A;  2UU9 Q;  4P72 A;  1XJV A;  3HOZ H;  1C9O A;  2Q2U A;  2VW9 A;  5M3F H;  1L1O B;  2A1A A;  4PZ8 A;  3EN2 A;  2ZM6 L;  4DR4 L;  2NN6 G;  1YIJ A;  2JA8 H;  2PI2 A;  3GTM H;  2KBN A;  4P71 A;  1HNZ Q;  2HHH Q;  4A3E G;  1XMQ L;  1IBM Q;  3U4V A;  1KL9 A;  2WB1 G;  1IBM L;  2VQE Q;  5LMN L;  3NEM A;  4GKK L;  1BVS A;  2OQ0 A;  1AE2 A;  4YWK A;  1GO3 E;  4DV6 Q;  1SRO A;  5HY6 A;  1IBK L;  1N33 L;  3GO5 A;  2K5N A;  4PZ6 A;  4C3J H;  4GNX B;  3OW2 A;  4DV2 Q;  4DR3 L;  4B3M Q;  4GS3 A;  5IYC H;  2PQA B;  1WYD A;  3GD7 A;  4UP9 A;  2Z6K A;  1VQ8 A;  2IX0 A;  4BBR H;  5HGQ A;  4QIW E;  2DGY A;  2JA6 H; 
#chains in the Genus database with same CATH topology
 4MHE A;  4UP7 A;  2PNH A;  2V4D A;  3MXN A;  2PZT A;  2F0K A;  2XRS D;  3PQI A;  2MO0 A;  3AFP A;  3HOX H;  4IUP A;  4DF7 A;  3GTG H;  1FNV A;  1K3R A;  1KLG D;  5FO7 B;  5JJI A;  3BS1 A;  2EVB A;  5GAH C;  3D31 A;  2JXM B;  3I4L A;  1NUC A;  1WFQ A;  4YIJ A;  4A3M B;  1S72 A;  1ESF A;  2WAC A;  1ZYR C;  2R3Z A;  4C1N K;  5T1G A;  1HQR D;  3U50 C;  4NPS A;  2E5L Q;  1EZ8 A;  1PRT C;  4A3I B;  1TS4 A;  4EQO A;  1GUT A;  1JE4 A;  4FP5 D;  3M3Y B;  1BO0 A;  1PH5 A;  1E7Z A;  1IZ6 A;  5IE8 A;  5M9O A;  5D3D A;  3FVQ A;  3MZ5 A;  3FPU B;  1D8L A;  3KLW A;  1D6E C;  3IFD A;  5FLX E;  1GJX A;  1K0S A;  1MGS A;  1XNR L;  2WP8 J;  4LFB Q;  2JA7 G;  1QB5 D;  4RHS A;  1YNN D;  2JP1 A;  3HZX A;  4HID A;  4QMG A;  3J81 j;  1JOO A;  4K5W A;  2VB3 X;  4KTA A;  1ML0 D;  1I6H H;  2YTV A;  3Q0A A;  1MI2 A;  1E1T A;  4DAP A;  3SR1 A;  2FHT A;  3ULP A;  1TVX A;  3OIQ A;  3NXW A;  4DR2 Q;  2HD3 A;  2N78 A;  1B9M A;  1O7L A;  4JI5 Q;  3QWN A;  1ET9 A;  3RNU A;  3RZO H;  3P1H A;  3EA6 A;  2RKS A;  1VQ6 A;  2YV5 A;  1T9H A;  1VQ5 A;  3CCR A;  1BCP B;  1HCZ A;  2PI2 E;  3FDT A;  2Q8R E;  1RD9 D;  4DUY L;  4OIJ A;  1SNM A;  4QUC A;  3BDL A;  4MIU A;  2F0P A;  1KIX A;  1X32 A;  2EOT A;  2WIN B;  3IFT A;  2NZH A;  1A15 A;  3D4R A;  2I5H A;  4C3H G;  2IY5 B;  3SK5 A;  2GN5 A;  3HOU G;  1EY6 A;  1B70 B;  1F2L A;  1CT1 D;  5CV6 A;  5C44 H;  1CKO A;  3P7J A;  1DYQ A;  5IYB G;  2NZO A;  1XX8 A;  1R9T H;  1Y1V H;  2RDF A;  1LUZ A;  1KD1 C;  2JA7 B;  2N8N A;  2Q2I A;  3CP0 A;  1UEB A;  3PUV A;  3ZJY C;  3J7Z C;  1E0B A;  1BCP F;  3MVV A;  2Y0S E;  2B29 A;  4R8N A;  1XNR Q;  3C1F A;  1QOH A;  4JBK A;  3KUP A;  1QZH A;  1IBL L;  3BVG A;  1LT3 D;  1SNO A;  5EPL A;  3A8I E;  3ND8 A;  1WCM H;  2L1B A;  1O7I A;  5A35 A;  3KLR A;  4DV3 Q;  5J22 A;  5CC4 A;  3KFU A;  3GTK B;  1TWH B;  1XPU A;  1CHQ D;  1G6Z A;  3ULL A;  1STH A;  1F9S A;  2UXD Q;  4G57 A;  4G7H C;  1JJ2 A;  1TS5 A;  4IPG A;  4RGT A;  1LTA D;  1EWI A;  1HNW Q;  4XYQ A;  3NEN A;  1JWU D;  1J6Q A;  4HJ5 A;  5J39 A;  1OXU A;  2E76 C;  3G6E A;  2RHQ B;  4ZK9 B;  1VQJ A;  2B2U C;  2PMZ E;  1JWM D;  1FGU A;  5M5W H;  4GOP B;  1DOL A;  5C4X G;  3Q6S A;  1CZW A;  2EXD A;  5IP7 H;  1OXT A;  3R3O A;  1TWA H;  1PTO F;  3HKZ B;  3KLS A;  1BCP D;  1IYU A;  2A6H D;  4IUV A;  5FKA C;  2MNA A;  1BBX C;  2IHE A;  3CCJ A;  3RUZ A;  3EVQ A;  4K2L A;  1NR4 A;  4DV0 Q;  4JOI C;  1D7Q A;  4RWS C;  4B9W A;  3A8K E;  2UUA L;  3BZC A;  4X3T A;  1BBU A;  3CPF A;  4IO9 A;  2QEX A;  4A3I G;  4JI7 Q;  1STN A;  3S1M B;  4H0L C;  5IP7 G;  4H7B A;  5M5W B;  2JJQ A;  3OTO L;  4X3U A;  2RA4 A;  1SRU A;  4A3K H;  1IBL Q;  4A3M G;  2M9V A;  4HMI A;  5LL6 S;  3KDF B;  2E2H H;  1E22 A;  3TZU A;  1UE6 A;  3FKI B;  1A3T A;  4OO1 G;  1JWS D;  5JVH 3;  1I50 H;  1BF4 A;  1EQQ A;  1Q12 A;  4X64 Q;  2HQE A;  3NHH A;  4RKB A;  5M3M B;  1HH2 P;  3C2P A;  3OSO A;  5CV5 A;  1HNX Q;  3S14 H;  2LFN A;  2AUK A;  4S3S A;  3CCQ A;  1VQA A;  1L2F A;  5C0X I;  3PIO 3;  1QVC A;  4KY5 A;  1SYE A;  3VDY A;  4R4I A;  3IAY A;  3RZD H;  2Z0S A;  1I50 B;  2VQE L;  1NBW A;  3K5O A;  2D0O A;  2Z4I A;  2RCF A;  3AU7 A;  5COR A;  4C3I H;  4M8A A;  4JPB W;  2WB1 B;  3TP7 A;  5C3W A;  5H1S E;  1SLJ A;  4B3M L;  3K80 C;  1EUJ A;  1R4Q B;  4LF8 Q;  1KLU D;  4X3S A;  1C8C A;  4AYB B;  1H9R A;  4LK1 C;  3DHQ A;  1GHK A;  1QNK A;  4LFC L;  3I72 A;  1MBY A;  4DV1 Q;  4DV0 L;  4HR7 B;  1Y1W G;  4JI3 L;  2NTT A;  2VNU D;  4K2K A;  1EIH A;  1GUN A;  3M4O H;  1CK1 A;  3HOU B;  2XTI A;  4A3F H;  4GN3 B;  2CH4 W;  1SNP A;  3E0E A;  3M4Y A;  1EL0 A;  4UHV A;  3STB D;  3NBH B;  5JPN C;  2MQH A;  4L5Q A;  1K3B C;  2B2T C;  1SFO H;  1C7Y A;  1C0A A;  3N52 A;  1YHA A;  2SNS A;  4DV3 L;  2OXP A;  1YI2 A;  4LAA A;  1IYV A;  2P5Z X;  4O0A A;  2A8V A;  1L1O C;  3GTQ B;  2R7Z H;  5GRO A;  2KHI A;  2Z4H A;  1FL0 A;  2KEC A;  4OHJ A;  3VYR A;  2UXD L;  1NNX A;  5CMD A;  3MWY W;  3BU2 A;  3V2T A;  2ZJR A;  1Q46 A;  3GTJ B;  1NMF A;  3ERS X;  3R93 A;  4ZUJ A;  1GM5 A;  4B3R Q;  1Q7Y C;  1DXM A;  3W3A A;  1FJG L;  3QO2 A;  4X64 L;  1CKM A;  3ERQ A;  2PCF B;  2F0W A;  1L0Y B;  1P8L A;  3GTL H;  2YTY A;  2NVY H;  4DR7 L;  2PW5 A;  3BVM A;  5FLM G;  3CW2 C;  3TS2 A;  2XGT A;  4LF7 L;  1R9T B;  1WTH A;  4B9X A;  2YYZ A;  3MXG A;  4HIM A;  4P2C B;  4RA8 A;  3DWA A;  4N8X 1;  2N3S A;  5GAE C;  5ELN A;  4KN4 C;  4PMW A;  1CFM A;  1CHP D;  3CF5 A;  1KNA A;  1VMC A;  2QDL A;  3OTO Q;  1Q81 C;  3GTJ H;  1W2B A;  4K8I A;  3H15 A;  4LMQ D;  1TWA B;  1VF5 C;  2F3I A;  1X3G A;  2H4O A;  3KBX A;  2HUG A;  1S4Z A;  4FO2 A;  2EZV A;  4N9T A;  4NP5 A;  2CWP A;  1WVL A;  5ELO A;  3S16 H;  4JI8 Q;  1SJH D;  1EYD A;  4DR2 L;  4X65 Q;  2XN9 C;  3J80 i;  2X6G A;  1NCV A;  2R6G A;  4KHZ A;  5M5Y H;  4WJ3 M;  1SMY C;  4A3K G;  2K52 A;  1SYD A;  2CFM A;  3CCL A;  1KAB A;  5IGF A;  4UAI A;  5E7N A;  2BCO A;  1BDO A;  5C3E H;  1SYC A;  3K81 C;  5K36 H;  3O13 A;  2ZJQ A;  5IYD G;  3X3M A;  3NQI A;  3FKI H;  3MA2 B;  4JV5 L;  3GTK H;  2KCT A;  3AB9 A;  1O7Z A;  2F0E A;  4LF5 L;  4IOC A;  2K75 A;  4DAM A;  3J81 c;  3TBI B;  2L5T A;  4GOP A;  3J7A F;  5I9O A;  2Y0S G;  4L5S A;  4LF5 Q;  4DR1 L;  1VS0 A;  3BDO A;  2EYL A;  1DON A;  1VQI A;  1PH9 A;  2VUM B;  4JOI A;  2A5H A;  4HCS A;  3UDX A;  3IRB A;  4A3D H;  1D1I A;  1ZXT A;  3PUY A;  4C3I G;  4JBJ A;  3RZD B;  2NVQ H;  2AWN A;  4A3C H;  4C56 C;  3AQQ A;  4KD4 A;  1QIL A;  4IN3 A;  2K32 A;  2EE1 A;  2L12 A;  2J4X A;  3PUW A;  5CV4 A;  4JI4 Q;  2E2H B;  5BN5 A;  1KXL A;  2XIW A;  4BS9 A;  1TXY A;  4OL7 A;  3A54 A;  5FJ8 H;  2UU9 Q;  4P72 A;  1AN8 A;  1XJV A;  3HOZ H;  5E4X A;  3J7Y W;  5M3F H;  1L1O B;  4JK1 C;  4L8J A;  1STB A;  2JA8 H;  1ENA A;  2PI2 A;  4XQN A;  3GTM H;  2HHH Q;  1BNZ A;  2F0M A;  1KL9 A;  4IUR A;  3NBH A;  5LMN L;  2YU9 B;  1CA5 A;  2RSN A;  3AMU A;  4HN7 A;  4GKK L;  4ID6 A;  4DFA A;  4PMB A;  4DV6 Q;  1GO3 E;  3HOW G;  1N33 L;  3VYU A;  3UI2 A;  4KKT A;  2HCC A;  4TSS A;  4DR3 L;  4B3M Q;  4GS3 A;  5IYC H;  1VQ8 A;  5HGQ A;  3NTI A;  1G2S A;  4J8Q A;  2ZTD A;  4OWX B;  2K7V A;  2WAQ G;  3I90 A;  2A68 C;  3DLL A;  4CKC A;  1SMX A;  3R2T A;  1KQS A;  5C44 G;  3A5Z B;  4HSP A;  3URY A;  1I6H B;  3I4M G;  1LM0 A;  2K01 A;  1BR9 A;  3KF6 B;  2QA4 A;  5IP9 H;  3T16 A;  3TRE A;  5EQ0 A;  2ES2 A;  3HKZ E;  4FVM A;  3K6O A;  1NSN S;  3QOL A;  3CC7 A;  4HSV A;  5E4W C;  2A6H C;  4IPH A;  2SNM A;  2DUD A;  2EPB A;  3MXP A;  1KHI A;  1XMO L;  3I73 A;  4PMC A;  1Q8K A;  4LUO A;  1I5F A;  2UUB Q;  2LS0 1;  1I94 Q;  1KC8 C;  1S5D D;  3HOX G;  4N8F A;  1FNW A;  5CGK A;  4OON A;  1P16 A;  5LMU Q;  1V1O A;  4JI5 L;  4A3G B;  4POF A;  3HFZ B;  1F2Y A;  4B3T L;  3RN5 A;  3GDE A;  1B50 A;  4LF6 Q;  1CZG A;  1C48 A;  4LWC A;  1LAC A;  5I9P A;  1PTO D;  1HA6 A;  4LF8 L;  4OWT B;  3VR6 A;  1G51 A;  2L55 A;  1JJG A;  4KMU C;  1A2T A;  1JQY D;  2C5C A;  4MTN A;  1ONL A;  4AYB G;  5JPM C;  3Q8D A;  2VB2 X;  3I4N H;  4B3T Q;  1RCV D;  2NWG A;  1RIP A;  4DK6 C;  5CV7 A;  5TSS A;  1STE A;  1PZK D;  3NQT A;  4Q5V A;  1DM0 B;  1I3Q H;  1YZ6 A;  4A75 A;  4A3G H;  1PTO B;  1EY8 A;  3FEW X;  1JB3 A;  3D0F A;  2UUB L;  3HP3 A;  1VCI A;  1SE3 A;  3I4N G;  4IFD I;  2WV6 D;  1LTI D;  1VQH A;  1JOQ A;  2R93 H;  2ICI A;  1AZQ A;  1E2V A;  3R8B A;  1H9J A;  3NWT A;  4HJ9 A;  1K9M C;  1PRT B;  4QQB X;  1BKB A;  4U68 A;  4A3D B;  4JI0 Q;  4CJ1 B;  3J81 L;  5ELB A;  4DV7 Q;  2FXQ A;  1G2T A;  4CGY B;  1G29 1;  1D1K A;  3K7A H;  2F0F A;  1J5E Q;  5ELE A;  4DV5 Q;  2EYJ A;  4A3F G;  2LMC B;  5IY0 A;  2M00 A;  1W6K A;  4DK0 A;  1V43 A;  4RGM A;  4TQU S;  5E3F A;  5T1I A;  3AYH B;  4GNX A;  1M90 C;  2UXB Q;  4EGV A;  4A3B G;  1UUP A;  3K58 A;  4FF1 A;  1B44 D;  5CV8 A;  2ZJP A;  3DEP A;  1S40 A;  1RKN A;  1TWH H;  4RMF A;  1JB7 A;  3PMF A;  3S14 B;  3KYH C;  4GOP C;  4BA2 I;  1JR0 D;  2J7Z A;  5A2Q L;  4IAL A;  1XTC D;  3HKZ G;  3I2Z A;  3OYY A;  3CCM A;  1ILP A;  1U4P A;  1RJT A;  2KA7 A;  5G3L D;  5C4X B;  3S1R H;  2OF1 A;  2ZTC A;  3QOJ A;  1PH2 A;  2F0G A;  1K8M A;  4JI6 L;  4G7Z C;  3S1Q B;  1JOK A;  4YCU A;  3HOW B;  3EJI A;  1PA6 A;  4YY3 L;  4A3K B;  3I4M H;  4EX5 A;  1M1K C;  3WWV A;  4AQY L;  3SK4 A;  5L37 A;  1YBY A;  1SBB B;  3H6M A;  4A3E B;  1VQM A;  5M3F B;  2XWJ B;  2RHS B;  1Q8I A;  1K83 B;  3WOF A;  3K5N A;  2L9H A;  4LFB L;  4HJ7 A;  2PW7 A;  1HJP A;  1SYF A;  1SXT A;  3BYY B;  2PQE A;  3HKS A;  4DPG A;  5DM6 3;  4DR5 Q;  2UXC L;  1PYS B;  1LTS D;  1Z9F A;  2QCP X;  3A74 A;  3K8A A;  3PCO B;  1X55 A;  1UE1 A;  2KHS A;  4A93 H;  1CI3 M;  4LUZ A;  4CDD C;  3ERO A;  1PH1 A;  2ZXR A;  1Y14 B;  4I7Z C;  4K5X A;  2I5L X;  1YVC A;  2LSS A;  1JCK B;  5DM7 3;  3JAM c;  1GD7 A;  2YTX A;  1YJN A;  5C0X J;  1QCB D;  2B63 H;  4CKE A;  3AEV A;  5IGC A;  3KK7 A;  4DN4 M;  3E3X A;  4RCN A;  4FDB A;  5JEA G;  4KN7 C;  4A76 A;  2MP1 A;  5G3L F;  2WAQ B;  1T5E A;  2JA5 B;  2L0C A;  5D14 A;  1GUO A;  4X62 Q;  4JI4 L;  3A7A B;  2AQ3 B;  2RDH A;  1PTO C;  1SE4 A;  1MSH A;  3OWF A;  3OW7 A;  5JJL A;  4XQJ A;  3GV6 A;  3DWQ A;  1V9P A;  1YIT A;  5AFW A;  4A3J G;  3MFG A;  1ROD A;  1PTO H;  5EAY A;  1N32 Q;  4IOA A;  2BE5 C;  1X3E A;  3PO2 B;  3S17 H;  2VL6 A;  1CQV A;  3KDF A;  2DY8 A;  2SEB D;  4YHH Q;  3KF8 B;  2QW7 A;  2A69 C;  1MJE A;  2D2C C;  5LMN W;  3PUZ A;  1VQN A;  3L0O A;  1VMP A;  3H94 A;  1C4Q A;  4BY1 B;  4QCL A;  3TP5 A;  1PH4 A;  2R92 H;  4LUV A;  2E2D C;  3F2D A;  4C3H H;  4DV4 L;  1LYL A;  5EKK A;  2B2W C;  2AMC B;  2K5Q A;  1UNS A;  1HTP A;  1I4P A;  4A3B B;  1QJO A;  1D5M C;  3RN2 A;  3SEB A;  2VUM H;  1DOM A;  1II3 A;  1SAP A;  5IYB H;  3Q23 A;  2F0L A;  4DV4 Q;  3S2H B;  1O7Y A;  1Y1V G;  1DJR D;  3GTL B;  1SFO B;  1S5F D;  2BH2 A;  5M5Y B;  3BVZ A;  5IWA L;  2NVT B;  4DV6 L;  3A56 A;  4OWW B;  1PRT D;  2UUA Q;  2WB1 E;  2OCE A;  3EIV A;  2DY7 A;  3CRK C;  1PH8 A;  4JCV E;  1OTC A;  4A3D G;  3H0G G;  5CYU A;  1R4P B;  1SEB D;  1CKN A;  3Q22 A;  2QKI C;  3JAM i;  4RFB A;  1RTN A;  4I65 A;  3VYS A;  2B2T A;  1ZEQ X;  1VQD A;  5ELD A;  1PH6 A;  3VR4 A;  2R7Z B;  1G91 A;  3M4P A;  1NJI C;  3PF5 A;  1HQM C;  1VQG A;  4NB3 A;  3JC6 6;  3D8G A;  1YNX A;  5FJ8 G;  4Q0F A;  5CR3 A;  2KEE A;  3HOY H;  3I70 A;  5D65 A;  1BXT A;  2UU9 L;  2Z9H A;  1UAP A;  3T51 B;  3R2I A;  1EQT A;  4R4Q A;  4YWL A;  5IGD A;  4R4T A;  2EY2 A;  4QUF A;  2ASB A;  4IJL A;  4MZ9 A;  3VA7 A;  1LTL A;  3GV3 A;  2JYO A;  1PFM A;  1EWC A;  1AZP A;  2F0N A;  1NR2 A;  2K5D A;  2L4N A;  1ET6 A;  4CHT B;  1PRT F;  4TRD A;  1VQC A;  4CJ2 C;  4DK3 C;  3T1Y L;  1A62 A;  4QY7 A;  3A55 A;  3I4O A;  4KKS A;  4DXG A;  4IUU A;  2RVL A;  2B39 A;  1D5X C;  2KEN A;  2EYF A;  3HGB A;  1Y8P B;  4IFD G;  1SDF A;  1GUS A;  1DGS A;  5I2Y A;  4CDE C;  5C6A A;  1H9M A;  2E5L L;  3CAM A;  4C2M H;  5C4X H;  1PDQ A;  4JV5 Q;  4JI6 Q;  4DAV A;  4O2D A;  4JI8 L;  5JEA H;  5EPK A;  4JYA Q;  2EJG C;  4LF9 L;  4PQX A;  4FNF A;  3J81 E;  3GTM B;  3H3V C;  4HAE A;  1YHB A;  5CV9 A;  3OOC A;  4MN3 A;  1EIY B;  1GHJ A;  1A3V A;  2JA9 A;  2NZ1 D;  3TSS A;  1HZA A;  3NBI A;  2KCM A;  3HG9 A;  4RGN A;  5COY A;  3TN2 A;  2ZM6 Q;  1EYG A;  1VQ7 A;  4A3J H;  5BR8 L;  3LWE A;  4OEL B;  3GTP H;  3S1N H;  4XXE A;  2B8F A;  2EJF C;  3G7L A;  5ELC A;  1GUW A;  1E3P A;  4GKK Q;  3FP9 A;  2E2J B;  4NMZ A;  2XWB B;  2F0T A;  3QG1 A;  4K8J A;  2CVR A;  3CCE A;  4LF7 Q;  4P74 A;  3K59 A;  2OTL A;  1V1Q A;  5C44 B;  1V8Q A;  3BJU A;  4JI1 L;  1HZC A;  4XTC S;  4HJA A;  2X69 A;  3NSW A;  2Q2U A;  1HUM A;  2VW9 A;  2A1A A;  4KHV A;  4PZ8 A;  3EN2 A;  4F8M A;  2ZM6 L;  2NN6 G;  1YIJ A;  1RDP D;  2KBN A;  5JAV A;  2B2U A;  4G7O C;  1IBM Q;  3U4V A;  2L11 A;  2WB1 G;  5C4Z A;  3M7G A;  3N6R A;  3NEM A;  1K28 A;  1KTK A;  4EVO A;  1BVS A;  2K03 A;  3IKJ A;  1Z6H A;  1I4G A;  1EY4 A;  4YWK A;  5HY6 A;  3VR3 A;  1IBK L;  2K5N A;  1O80 A;  4DV2 Q;  1IL8 A;  4BBS B;  2CW0 D;  3GD7 A;  5F2D A;  2B2V A;  1BCP C;  2IX0 A;  3C3L A;  3HRZ C;  1HFN A;  4L63 B;  3ER0 A;  2ALY B;  4G4K A;  2M2L A;  2V1C C;  3RD4 A;  1HZB A;  3PO2 G;  5FLX L;  3SE0 A;  2JA8 B;  4ZAI A;  1V1P B;  3ONA B;  2OTJ A;  1PVO A;  1SMY D;  1WI5 A;  2YU9 H;  3W5O A;  5IT9 c;  1AH9 A;  3LX0 A;  3C46 A;  1O78 A;  3CQZ B;  1LT6 D;  1LTB D;  5GAD C;  4DUZ Q;  3HOV B;  1GVP A;  1FGB D;  1NMG A;  2UXC Q;  3L9A X;  4XT1 B;  4E6I A;  5EKL A;  2R92 B;  3PO3 G;  1U4R A;  2WKD A;  2JEA I;  3MFY A;  2ATW A;  3SGI A;  1TII D;  2BA0 A;  2MGS A;  3HOW H;  1LT4 D;  3PUX A;  1XWE A;  1VQL A;  1X56 A;  4DR1 Q;  3PF4 A;  3F1Z A;  1OO9 B;  4IJH A;  3SDZ A;  2F0J A;  4BWG B;  3D4D A;  3J80 L;  5IGG A;  3G48 A;  2RCN A;  2G5D A;  4RH6 A;  1CUK A;  3NUC A;  1SE8 A;  3CPW A;  3H3V I;  3TDQ A;  5C0X H;  3I7F A;  4DV2 L;  3ICE A;  1OXS C;  2K5W A;  3S15 H;  4GNX C;  4KY6 A;  2I0Q A;  3H91 A;  5FLM H;  4A3L G;  4X6A H;  3F2C A;  4KJO A;  2OQK A;  1STG A;  3I56 A;  1B2T A;  4X65 L;  3SK6 A;  5GAG C;  2NVT H;  1Y8O B;  3RZO B;  1XNQ L;  4DKA C;  2JA6 G;  1B1Z A;  1XNQ Q;  4Z9C B;  2K6A A;  5IOC A;  1YNJ D;  1ZKO A;  3GTP B;  2RDG A;  4R4C A;  2O5J C;  4KK7 A;  1QVG A;  1L1O A;  3CCU A;  2FJ2 A;  3DEO A;  4XIG S;  3PIO A;  3CXC A;  2K04 A;  3NK9 A;  1STY A;  3F2B A;  2RQX A;  2K5H A;  2QDB A;  1TU2 B;  4QB4 A;  4DUY Q;  2DJF C;  4A3E H;  4GLX A;  1A6X A;  1L0W A;  3TRZ A;  5IT9 E;  1MD2 D;  3CHB D;  1NE3 A;  5A2Q E;  2HHH L;  5M3M H;  3NTK A;  4C1N I;  2F0V A;  2NBF A;  3D6W A;  4ALP A;  2BH8 A;  4DA2 A;  3CCV A;  1NTG A;  3D3R A;  5M5X B;  5K36 G;  3T13 A;  1X3Q A;  4JC0 A;  1SND A;  1OXV A;  2LY7 A;  1A2U A;  2NVQ B;  3KOJ A;  3S9W A;  4ME5 A;  3NWS A;  4NXM Q;  1WTP A;  2NN6 H;  5FO8 B;  5I4D A;  3L2P A;  1PYW D;  4HMJ A;  3MEH A;  3HOV G;  2SDF A;  3TZD A;  3UE0 A;  2A6E D;  1U9R A;  4BA1 I;  5M3M G;  1QZG A;  1SR3 A;  1CSP A;  2H1E A;  4ULL A;  3G4S A;  1N8R C;  1F2Z A;  1Q90 A;  2KED A;  4O42 A;  1STA A;  4LF6 L;  1EYA A;  4DGZ A;  4IUT A;  1VQF A;  4HIO A;  1VDZ A;  1AW7 A;  2A74 C;  1LO5 D;  1VQ9 A;  3NEL A;  3HOU H;  1HXY D;  3T1H L;  2Q2H A;  4TVA B;  1CA6 A;  3S1N B;  3DM1 A;  1EEI D;  3PIP 3;  5EBC A;  4FYD A;  4CKB A;  2LXK A;  4YY3 Q;  4AYB E;  1H9K A;  3HOZ G;  3E0J A;  2HCI A;  2PZW A;  2XSC A;  5HGT A;  2E2I H;  1XMO Q;  2K4K A;  2A6E C;  3M7N A;  3CQZ H;  4CJ0 B;  1SJE D;  2E75 C;  4HIK A;  3PO3 H;  2MJ8 A;  3AFQ A;  1ZYR D;  2KUM A;  1QNU A;  1OXX K;  3TP6 A;  1KAW A;  4A93 B;  3X3N A;  4JI7 L;  4IQZ A;  2F3W A;  4ODG A;  5KEE A;  2CW0 C;  3UDF A;  2GVB A;  2EYM A;  3RLF A;  4V19 0;  1PV4 A;  4JYA L;  2QGQ A;  3V96 A;  2JQO A;  2IW3 A;  4H02 A;  3EFX D;  2Z1C A;  1W6J A;  5K5P A;  1WOC A;  1MKH A;  1QWY A;  3M4Q A;  1B3A A;  4CDC C;  2N88 A;  2B3G A;  3CKI B;  1B7Y B;  4OIK A;  5KIX A;  4KHP L;  4K0K Q;  2NYZ D;  2HT1 A;  1ASZ A;  1YEZ A;  2ICE C;  1XMQ Q;  3VYT A;  1FNU A;  2WFW A;  4XYO A;  5I2X A;  1Y1W B;  4FF3 A;  3HOY G;  3EQL C;  3ND9 A;  3BZD B;  1DOK A;  2ZXO A;  2Z8L A;  2AQ2 B;  4WFN 3;  1WD0 A;  2FMM A;  2IWH A;  3UDI A;  4BY7 H;  1HRJ A;  3JAM L;  1E24 A;  1TQO A;  1EZ6 A;  3NP8 A;  1NAP A;  3D6C A;  5C4H A;  1X3P A;  1EY9 A;  1U4M A;  4N9P A;  1IYJ B;  1EIF A;  2D9U A;  1QUQ B;  1TS2 A;  1PH7 A;  4R1J A;  1LTG D;  3QJY A;  3HOY B;  2E8G A;  1A3U A;  4C3J G;  1IXR A;  2EDG A;  1HR0 Q;  5HUR A;  4HTH A;  1HR0 L;  1CTM A;  1IBK Q;  1W3S A;  1QUQ A;  3J81 i;  4ABN A;  4X66 Q;  2FFK B;  2TMP A;  2ENB A;  3T1Y Q;  3ITP A;  2CCZ A;  1HTL D;  1H95 A;  1YJ9 A;  1E2Z A;  2IHF A;  3TP8 A;  3EBE A;  4JBW A;  2JA6 B;  1U5K A;  1XPO A;  4YCV A;  4RCO A;  5EBD A;  3MXU A;  3CC2 A;  2EXZ A;  4OO1 I;  3OPO A;  2BOS A;  1VQE A;  3PIP A;  1T5X D;  1FD7 D;  3QB3 A;  1YNJ C;  1JT8 A;  3G71 A;  1PH3 A;  2G9D A;  1Y69 U;  3GTQ H;  1AEX A;  3I55 A;  4FXG C;  3H0G B;  1I94 L;  3MEF A;  4K6D A;  5C3E G;  4RGO S;  1S5E D;  2QEJ C;  4TKO B;  5AJ3 Q;  2NVX B;  1XYI A;  2AKW B;  4K5V A;  2GVA A;  3T56 B;  2UXB L;  1RL2 A;  3L3O C;  4KKU A;  3ULJ A;  2MFI A;  3S16 B;  3HOZ B;  2PQA A;  4MNO A;  2K1B A;  1WTX A;  2Z6K C;  1K0R A;  4POG A;  1HHV A;  3KJO A;  1TWC B;  1F9Q A;  3KJP A;  1IW7 C;  4PZ7 A;  5C4J H;  2UUC Q;  1SYG A;  1V1P A;  3E5S A;  3SK8 A;  2BDO A;  3W2D A;  1SYB A;  2HIX A;  3WDN A;  4HJ8 A;  2LXJ A;  2HDM A;  3U9S A;  2R61 A;  1HPC A;  4O1N A;  1VQB A;  2K05 A;  1XTD A;  3TME A;  2KQ3 A;  3K0Y A;  1UE5 A;  1IL2 A;  1SN8 A;  4RAU C;  2PMZ B;  1TWF B;  1N32 L;  4XDX A;  5JJK A;  3CME A;  2VQF L;  1ENF A;  2R7Z G;  4GKJ Q;  5DEH A;  4YWM A;  1K8G A;  4JI2 L;  3HEJ A;  2JN4 A;  1I4Q A;  1B3Q A;  2K5V A;  4RG1 A;  4DAY A;  4PNY A;  5KRU A;  1EOT A;  1MHW C;  2ZT9 C;  5E1F A;  4QL5 A;  3V05 A;  1UWV A;  4B3R L;  3TS0 A;  4YHH L;  1EU3 A;  2N49 A;  2ID0 A;  1WJJ A;  5KYI A;  1I4R A;  2WKC A;  5I6Y A;  4ZQ3 A;  2K14 A;  1TWF H;  2CQO A;  2HQL A;  1E1O A;  3JAM E;  1B4O A;  3MC0 B;  1FVI A;  1AFP A;  1LLR D;  3UDG A;  4ZUI A;  3E9I A;  2B63 G;  2IX1 A;  4V0B A;  2F0U A;  2KHJ A;  2Y0S B;  4BBR G;  4NDX A;  1ESR A;  1S5C D;  2AQ1 B;  3PO3 B;  4DR5 L;  4I7A A;  2O4X A;  4C3H B;  3C1E A;  1I4X A;  4A3F B;  1WCM B;  3SVM A;  1PFB A;  4BY1 G;  4CBV A;  1DCZ A;  3RLO A;  2IJ0 A;  3S2H H;  1K73 C;  1HNX L;  3OMG A;  1KNE A;  4IFD H;  2L15 A;  2N55 A;  1PFN A;  3DMU A;  1JIC A;  2K33 A;  4ILW A;  4KJN A;  3GTG B;  1BOS A;  4DR4 L;  1TY2 A;  4P71 A;  1CM9 A;  2NVY B;  4B08 A;  4DK1 A;  4A3E G;  1XMQ L;  3SHL A;  1SNC A;  1IBM L;  2VQE Q;  4A3J B;  4QIW B;  4FXK C;  2RSO A;  1SRO A;  4J1M A;  3GO5 A;  3OW2 A;  4GNX B;  4C3J B;  5LHY 1;  5ELF A;  5BN4 A;  2PQA B;  1WYD A;  3FRP B;  2Z6K A;  4UP9 A;  2DGY A;  2JA6 H;  2JA5 G;  3MAQ A;  2RBM A;  5KNC A;  3CD6 A;  4APV A;  1X65 A;  5C5M A;  4LFA L;  4WJ4 A;  4DNR B;  1X3F A;  2IL8 A;  4DV1 L;  3T4A C;  4OO1 H;  3CU7 A;  4ZRZ A;  3PGZ A;  3KBG A;  1VQP A;  1N36 Q;  3GP7 A;  1TKW B;  5C3X A;  5EGT A;  1L0X B;  1EU4 A;  3DXJ C;  1EY7 A;  4OEM B;  4DV7 L;  3CCS A;  1VQO A;  1GKH A;  4DU9 A;  2R92 G;  1RHP A;  3BDC A;  4A3C G;  1TWG B;  1TWG H;  2K50 A;  5C3E B;  1MJC A;  2B8G A;  1I6V C;  4LF9 Q;  3UE1 A;  2H5X A;  1HUN A;  4LFA Q;  5KNB A;  1TS3 A;  4QJF A;  3VA5 A;  1LT5 D;  1TR5 A;  2MHV A;  4Y7N B;  4Y7N H;  3M3Y H;  4DR7 Q;  4ME3 A;  1TY0 A;  4DV5 L;  4F7X A;  1WTW A;  4PV1 C;  5M3F G;  1MSG A;  5IWA Q;  2JA8 G;  2KCC A;  5FLX c;  4KLK A;  3CRL C;  4JI2 Q;  1TWC H;  2NB0 A;  5IIF A;  4DNT B;  2BDN A;  5IGB A;  1Q3L A;  2I5M X;  2DJG C;  1Z7T A;  3I4N B;  5IYC G;  4BBS G;  5M5X H;  3S24 A;  2F52 A;  2E74 C;  1Y8N B;  1PHJ A;  3H0G H;  1LTT D;  4R8I A;  1VQK A;  1Q1E A;  3S15 B;  4L5T A;  3KF6 A;  2J0T D;  3RLN A;  2UUC L;  3G6J B;  2NN6 I;  3S1Q H;  3T1H Q;  5CBA E;  2HIV A;  3NPP A;  1BQQ T;  4NXM L;  1Y1V B;  1GUG A;  2BE5 D;  2XVS A;  4HED A;  2OT2 A;  2A73 B;  5D3I B;  3VR2 A;  3Q24 A;  4JBM A;  1EY0 A;  1KDA A;  5J1Z A;  4DXF A;  3MHB A;  2AUJ D;  2PNR C;  2O5I C;  3OHX C;  1KDC A;  3CMA A;  2JK8 A;  1MIU A;  4KI0 A;  2A19 A;  1Q82 C;  3BYT B;  4C2M B;  4XQQ A;  3SXH A;  4DR6 Q;  3K7A B;  1WTV A;  3K5M A;  4IPD A;  1E2W A;  3I8Z A;  2F0S A;  2NVX H;  4GLA C;  4NXN L;  1QE6 A;  1GXD C;  2XNA C;  3W1G A;  3J7A 5;  2O2L D;  4XT3 B;  1FYC A;  3P20 A;  2AHO B;  5I6W A;  2E2I B;  2KJX A;  4KV6 A;  2KVM A;  1TT2 A;  1HNZ L;  2K28 A;  4F88 A;  1KRT A;  4FXD A;  4UY8 C;  4B3S L;  3MTS A;  1IW7 D;  1EOV A;  2A68 D;  1I3Q B;  1JOR A;  5BR8 Q;  1LTR D;  4IZ8 A;  1G6P A;  2FIN B;  3S17 B;  4A93 G;  2PYK A;  4EQ5 A;  4DNI A;  4RKL A;  1F77 A;  1PZJ D;  4EQP A;  4A3I H;  2VS1 A;  2EYP A;  2EYH A;  2I07 B;  4LF4 L;  1H9S A;  5EPJ A;  1HR0 W;  4L5R C;  2R7D A;  4A3M H;  1K83 H;  4JI1 Q;  3TEH B;  2JEB I;  2JA5 H;  2Q8T A;  4CDF C;  5JJZ A;  2Q2T A;  1XXG A;  5GQO A;  4A3G G;  3FPP A;  1K8O A;  2BA1 A;  5AJ3 L;  2PPB C;  4LNQ A;  3HOX B;  1A0I A;  1WD1 A;  1EEF D;  1DD2 A;  3K7U C;  3S1R B;  1ICW A;  4NXN Q;  2MO1 A;  4P75 A;  2JA7 H;  3PO2 H;  4B3S Q;  1N36 L;  2EY5 A;  1J9O A;  1VF7 A;  2PO4 A;  4DR3 Q;  4NW2 A;  3DWP A;  1B8A A;  5LL6 X;  1HFG A;  1JE5 A;  3HOV H;  4UP8 A;  1U4L A;  2KCN A;  2Q8I B;  4KY7 A;  2EJM A;  3U9O A;  4IFD J;  2VY3 A;  4DAY B;  5IYD H;  4Y52 H;  2IT1 A;  4IUQ A;  4J6H A;  1PLF A;  2XRQ D;  1EQV A;  4PG3 A;  2MUY A;  1J5E L;  3PSI A;  2B2Y C;  3I4M B;  2F4I A;  4C3I B;  2NTS A;  4X66 L;  4ZKC B;  3RR5 A;  1Y1W H;  1F2M A;  1QG7 A;  4DUZ L;  1CSQ A;  2KOL A;  2VUM G;  1DZ1 A;  2CH4 A;  2F0O A;  4JVZ A;  2F4V L;  1M8A A;  2F0D A;  2B63 B;  1EY5 A;  4OXP A;  2D5D A;  1QVF A;  1N34 Q;  5DNF A;  3E6Z X;  2EIF A;  2E2J H;  1WTQ A;  4FF4 A;  4AH6 A;  1X6O A;  4F87 A;  1SE2 A;  2EQS A;  3HS0 C;  1Z47 A;  3S2D B;  2F3V A;  3H3V H;  5CBE E;  2X6L A;  2F0H A;  4A4I A;  4GZY C;  4AQY Q;  2CKZ B;  3PV0 A;  2DN8 A;  1PZI D;  2D0P A;  1CQF A;  1A8V A;  2A69 D;  3CC4 A;  2LKV A;  1S5B D;  2VQF Q;  2R7F A;  4OX9 Q;  1D2B A;  3QR8 A;  2EY6 A;  5IOD A;  2QF7 A;  2F0Q A;  3M4O B;  4RHR A;  1KAA A;  3KLS X;  2CHB D;  3OMC A;  4EQN A;  2AWO A;  4UDU C;  5FO9 B;  3NE5 B;  5EKI A;  2RF4 A;  4GN5 A;  2IPK D;  4UPA A;  2FMC A;  1K8A C;  5IP9 G;  1N33 Q;  5DLQ E;  1WCM G;  3KF8 A;  4QF4 A;  5C0X G;  1KRS A;  3GTO H;  3GTO B;  3A7L A;  2GA4 B;  3NTH A;  4H44 C;  5LMN Q;  2JSO A;  2C35 B;  3I91 A;  4BY1 H;  1IKL A;  1I4H A;  2F1M A;  4A3L H;  4NKL A;  4K6L A;  2Z6B A;  3FMC A;  1IKM A;  4H13 C;  1WTO A;  2C9O A;  1EIG A;  5JVG 3;  1JC7 A;  2CQA A;  2D62 A;  3VR5 A;  3U58 A;  4ZCK A;  4JI0 L;  2F0I A;  4BY7 G;  2G9H D;  1D5Z C;  3DUZ A;  1RF2 D;  5C5L A;  2EYO A;  1CKN B;  4IUN A;  1PFS A;  2B2W A;  5BN3 A;  5KGU A;  4X62 L;  3TQY A;  3S2D H;  3S1M H;  3L7Z C;  3W1B A;  4OX9 L;  3J80 E;  1EFI D;  1FJG Q;  1SSO A;  1ICF B;  2VXW A;  2DNC A;  3D4W A;  1JJC B;  3BG3 A;  3RMH A;  1N34 L;  3B6Y A;  1YNN C;  4L6T B;  3A0J A;  1Q1B A;  5DAU A;  4BXX H;  4QGU A;  1EYC A;  4GN4 B;  5JOB A;  5IT9 L;  3FKI G;  3M85 A;  5FK9 C;  1YHQ A;  4P73 A;  4R9W A;  4WOR A;  2EY1 A;  1LAB A;  1WTR A;  4X3K A;  3WOE A;  4FF2 A;  1EFW A;  1UEA B;  4DR6 L;  1HZ9 A;  4IPC A;  4M1U B;  1U0L A;  3M9B A;  5JEA J;  5C4J B;  4LW1 A;  2DNE A;  1RTO A;  3BZK A;  1Q86 C;  4BXX G;  2OEO A;  1HNW L;  1BBW A;  2MPM A;  4GLV B;  1HA5 A;  3DM3 A;  2R93 G;  1ASY A;  3OIP A;  2B2V C;  2QIL A;  5ISR A;  1XPR A;  3GQB A;  3LWU A;  4ZKB B;  1YJW A;  3A5U A;  1A63 A;  4KD3 A;  3LGJ A;  3E9H A;  5LMU L;  1GOZ A;  1S3O A;  3T53 B;  3QIA A;  4JI3 Q;  2IX3 A;  1VQ4 A;  3K0X A;  1EQR A;  5NUC A;  3LNN A;  4LFC Q;  1N9W A;  4K14 A;  4R4O A;  2WII B;  1UE7 A;  2CWA A;  1PXU A;  3STB C;  4BBS H;  3P75 A;  5J3B A;  3J7A V;  3FHW A;  4GKJ L;  2F03 A;  1AE3 A;  2I46 A;  4ZLT F;  2JE6 I;  3A8J E;  4JW0 A;  1B9N A;  2ZTE A;  2SOB A;  2HDL A;  2VZA A;  2OWO A;  3U4Z A;  1PYB A;  4OGQ C;  1AP0 A;  4J15 A;  2ZXP A;  1NY4 A;  1BUV T;  4A3B H;  3F8T A;  4YCW A;  5KND A;  3MXN B;  1X9N A;  2B2Y A;  4WJW A;  1X54 A;  4AIM A;  4LF4 Q;  3IL8 A;  2WAQ E;  1IHZ A;  3F2U A;  1PMR A;  4JG2 A;  2NUC A;  3J80 c;  3H09 A;  4U67 3;  1B53 A;  4WRD A;  1JMC A;  4BY7 B;  5IGE A;  1EWH A;  5EJW A;  2F4V Q;  5KYL A;  4KHP Q;  4ZYS A;  4K0K L;  4DR4 Q;  1M4V A;  4BBR B;  1ENC A;  1C9O A;  1SNQ A;  3I3C A;  3K57 A;  1FR3 A;  1LV9 A;  3K5L A;  4HCE A;  1KDB A;  1HNZ Q;  1J8I A;  4MTK A;  1F9P A;  2TSS A;  2R93 B;  3OWE B;  1F9R A;  2OQ0 A;  1AE2 A;  2PZU A;  4PZ6 A;  4C3J H;  1ILQ A;  4LJZ C;  3ZYY X;  1H9S B;  1G8Z D;  4BBR H;  5FOB B;  4QIW E; 
#chains in the Genus database with same CATH homology
 4UP7 A;  2JA5 G;  2PNH A;  3CD6 A;  2ZTD A;  4OWX B;  3ER0 A;  4APV A;  2ALY B;  1X65 A;  2WAQ G;  4LFA L;  2MO0 A;  2V1C C;  3AFP A;  3HOX H;  3DLL A;  4WJ4 A;  1X3F A;  1HZB A;  4DV1 L;  3PO2 G;  3GTG H;  1SMX A;  3PGZ A;  1K3R A;  5JJI A;  1KQS A;  2OTJ A;  5C44 G;  1PVO A;  1WI5 A;  1VQP A;  1N36 Q;  3A5Z B;  5GAH C;  2YU9 H;  3W5O A;  3D31 A;  1LM0 A;  3I4M G;  5IT9 c;  1WFQ A;  1AH9 A;  1S72 A;  4DV7 L;  3CCS A;  1VQO A;  5GAD C;  3KF6 B;  1GKH A;  5IP9 H;  2QA4 A;  4DUZ Q;  2R92 G;  1GVP A;  3TRE A;  4A3C G;  1NMG A;  1TWG H;  2K50 A;  2UXC Q;  1MJC A;  3U50 C;  4LF9 Q;  4NPS A;  2H5X A;  3UE1 A;  2E5L Q;  4LFA Q;  3HKZ E;  2ES2 A;  3PO3 G;  2JEA I;  4QJF A;  2ATW A;  3CC7 A;  3SGI A;  4Y7N H;  3M3Y H;  4IPH A;  2BA0 A;  4ME3 A;  1PH5 A;  1E7Z A;  1IZ6 A;  2DUD A;  3HOW H;  4DR7 Q;  4DV5 L;  1KHI A;  5IE8 A;  5M3F G;  1XMO L;  5IWA Q;  3PUX A;  1VQL A;  2JA8 G;  1D8L A;  1Q8K A;  3KLW A;  5FLX c;  4KLK A;  1X56 A;  4LUO A;  1I5F A;  4DR1 Q;  2UUB Q;  2WP8 J;  1XNR L;  4JI2 Q;  3PF4 A;  4LFB Q;  2JA7 G;  3F1Z A;  1TWC H;  1I94 Q;  1KC8 C;  3HOX G;  4IJH A;  2I5M X;  4HID A;  3J81 j;  4OON A;  1P16 A;  5IYC G;  1I6H H;  5LMU Q;  3G48 A;  4BBS G;  2YTV A;  2RCN A;  4JI5 L;  5M5X H;  1CUK A;  1E1T A;  1SE8 A;  3S24 A;  2F52 A;  3HFZ B;  4POF A;  3CPW A;  3H3V I;  4B3T L;  3ULP A;  3RN5 A;  1PHJ A;  3H0G H;  3GDE A;  4DR2 Q;  3I7F A;  1VQK A;  2N78 A;  4DV2 L;  1Q1E A;  4LF6 Q;  4JI5 Q;  3ICE A;  1OXS C;  4L5T A;  3KF6 A;  4GNX C;  2I0Q A;  3RLN A;  2UUC L;  4LWC A;  2NN6 I;  3S15 H;  3S1Q H;  3RNU A;  3T1H Q;  5FLM H;  4LF8 L;  3RZO H;  2HIV A;  4OWT B;  4A3L G;  1G51 A;  4X6A H;  1VQ6 A;  3F2C A;  2YV5 A;  4NXM L;  1JJG A;  3HOW G;  1T9H A;  2OQK A;  1VQ5 A;  3CCR A;  4JBM A;  4MTN A;  4AYB G;  3I56 A;  2PI2 E;  3Q8D A;  4X65 L;  5GAG C;  2NVT H;  4DUY L;  3I4N H;  1XNQ L;  4DKA C;  4B3T Q;  2JA6 G;  1XNQ Q;  1RIP A;  4DK6 C;  3CMA A;  2JK8 A;  1MIU A;  4KI0 A;  2A19 A;  1Q82 C;  1KIX A;  4DR6 Q;  1I3Q H;  4R4C A;  2NZH A;  2IY5 B;  2I5H A;  4IPD A;  1YZ6 A;  4A75 A;  1QVG A;  2GN5 A;  3HOU G;  1L1O A;  3CCU A;  4A3G H;  1B70 B;  2NVX H;  4GLA C;  4XIG S;  4NXN L;  5C44 H;  3PIO A;  3D0F A;  3CXC A;  2UUB L;  1CKO A;  3F2B A;  1VCI A;  4IFD I;  3I4N G;  5IYB G;  2NZO A;  1N33 Q;  1VQH A;  3W1G A;  2K5H A;  2R93 H;  3J7A 5;  1R9T H;  1Y1V H;  4DUY Q;  4A3E H;  4GLX A;  1LUZ A;  1L0W A;  2AHO B;  1KD1 C;  2N8N A;  2Q2I A;  3CP0 A;  3TRZ A;  4HJ9 A;  1UEB A;  1K9M C;  3PUV A;  3ZJY C;  3J7Z C;  4QQB X;  1BKB A;  1NE3 A;  4JI0 Q;  1HNZ L;  2HHH L;  2Y0S E;  2B29 A;  5M3M H;  1XNR Q;  1KRT A;  4UY8 C;  4DV7 Q;  4B3S L;  2FXQ A;  4JBK A;  4ALP A;  1G29 1;  1EOV A;  2BH8 A;  3CCV A;  3K7A H;  1QZH A;  1J5E Q;  1IBL L;  5BR8 Q;  1NTG A;  5K36 G;  4DV5 Q;  4JC0 A;  1G6P A;  1OXV A;  4A3F G;  1WCM H;  3KOJ A;  4NXM Q;  5IY0 A;  4A93 G;  1O7I A;  4EQ5 A;  4DNI A;  4DV3 Q;  3L2P A;  3KFU A;  3HOV G;  1V43 A;  4DR6 L;  3UE0 A;  4TQU S;  4BA1 I;  5M3M G;  1QZG A;  1SR3 A;  1XPU A;  1CSP A;  4A3I H;  3AYH B;  2VS1 A;  4GNX A;  1M90 C;  2UXB Q;  3G4S A;  3ULL A;  1N8R C;  4A3B G;  2ZJP A;  2UXD Q;  1S40 A;  4LF4 L;  1TWH H;  4RMF A;  1JB7 A;  1HR0 W;  4LF6 L;  1VQF A;  3KYH C;  2R7D A;  4L5R C;  4GOP C;  4A3M H;  1JJ2 A;  4BA2 I;  1K83 H;  4JI1 Q;  4HIO A;  3TEH B;  2JEB I;  4IPG A;  3I2Z A;  3HKZ G;  2JA5 H;  3OYY A;  1HNW Q;  1EWI A;  3CCM A;  3NEN A;  1VQ9 A;  2Q2T A;  5GQO A;  3NEL A;  1J6Q A;  4HJ5 A;  3HOU H;  4A3G G;  1OXU A;  3T1H L;  2Q2H A;  4TVA B;  2RHQ B;  3G6E A;  1VQJ A;  3S1R H;  2ZTC A;  2PMZ E;  2BA1 A;  1FGU A;  5M5W H;  5AJ3 L;  4GOP B;  1PH2 A;  4LNQ A;  5C4X G;  4JI6 L;  1A0I A;  2EXD A;  5IP7 H;  1OXT A;  4YCU A;  2LXK A;  4YY3 Q;  1PA6 A;  1TWA H;  4AYB E;  3K7U C;  4YY3 L;  3I4M H;  3HOZ G;  4EX5 A;  4NXN Q;  2MO1 A;  2MNA A;  4P75 A;  1M1K C;  3WWV A;  2IHE A;  2E2I H;  1XMO Q;  4AQY L;  2JA7 H;  3PO2 H;  3CCJ A;  1YBY A;  1VQM A;  4B3S Q;  1N36 L;  2K4K A;  4DV0 Q;  4JOI C;  1D7Q A;  4DR3 Q;  3CQZ H;  3M7N A;  1B8A A;  2RHS B;  1JE5 A;  4HIK A;  3PO3 H;  2UUA L;  3BZC A;  3HOV H;  3AFQ A;  4HJ7 A;  4LFB L;  1BBU A;  3CPF A;  4UP8 A;  4IO9 A;  1HJP A;  1OXX K;  2QEX A;  4A3I G;  4JI7 Q;  3HKS A;  5IP7 G;  4DPG A;  2JJQ A;  3OTO L;  4DR5 Q;  1PYS B;  1Z9F A;  3PCO B;  3K8A A;  3A74 A;  4BBS H;  2UXC L;  1X55 A;  4IFD J;  2VY3 A;  4DAY B;  1KAW A;  1UE1 A;  4A93 H;  4Y52 H;  5IYD H;  4LUZ A;  4JI7 L;  2IT1 A;  1SRU A;  4A3K H;  1PH1 A;  1Y14 B;  4PG3 A;  1J5E L;  4A3M G;  1IBL Q;  3PSI A;  2I5L X;  1YVC A;  2LSS A;  3KDF B;  2E2H H;  3UDF A;  3JAM c;  1E22 A;  1GD7 A;  1UE6 A;  2GVB A;  2YTX A;  3RLF A;  1YJN A;  4OO1 G;  5C0X J;  1I50 H;  4X66 L;  1PV4 A;  4JYA L;  3RR5 A;  2QGQ A;  2B63 H;  1Y1W H;  2JQO A;  3AEV A;  4H02 A;  1EQQ A;  4DUZ L;  1CSQ A;  2VUM G;  1Q12 A;  4FDB A;  4X64 Q;  5JEA G;  4A76 A;  2F4V L;  1WOC A;  1MKH A;  3M4Q A;  1HH2 P;  4OXP A;  1HNX Q;  3S14 H;  2B3G A;  1B7Y B;  1QVF A;  4X62 Q;  3CCQ A;  1N34 Q;  4JI4 L;  1VQA A;  4KHP L;  4K0K Q;  2EIF A;  1L2F A;  5C0X I;  2E2J H;  2HT1 A;  1QVC A;  1ASZ A;  4AH6 A;  3VDY A;  1X6O A;  1YEZ A;  4R4I A;  1XMQ Q;  2EQS A;  1Z47 A;  3RZD H;  2Z0S A;  3H3V H;  5JJL A;  2WFW A;  2VQE L;  4A4I A;  1NBW A;  1V9P A;  1YIT A;  3HOY G;  2D0O A;  2CKZ B;  4AQY Q;  4A3J G;  4C3I H;  3PV0 A;  2D0P A;  3UDI A;  4BY7 H;  5H1S E;  1A8V A;  5EAY A;  1N32 Q;  1E24 A;  3CC4 A;  4IOA A;  1SLJ A;  4B3M L;  3K80 C;  1EUJ A;  1X3E A;  2VQF Q;  2R7F A;  2VL6 A;  3S17 H;  1IYJ B;  3KDF A;  4OX9 Q;  1EIF A;  4LF8 Q;  4YHH Q;  1QUQ B;  3KF8 B;  1PH7 A;  1MJE A;  4R1J A;  5LMN W;  4LFC L;  3PUZ A;  2AWO A;  4DV1 Q;  4DV0 L;  1VQN A;  2E8G A;  3L0O A;  1Y1W G;  4JI3 L;  2RF4 A;  4GN5 A;  2VNU D;  1IXR A;  4UPA A;  1HR0 Q;  3M4O H;  2XTI A;  1PH4 A;  1K8A C;  1HR0 L;  5IP9 G;  2R92 H;  4A3F H;  1W3S A;  1QUQ A;  1WCM G;  4GN3 B;  5DLQ E;  5C0X G;  3J81 i;  3E0E A;  4X66 Q;  1KRS A;  3GTO H;  3T1Y Q;  4LUV A;  2CCZ A;  5LMN Q;  2C35 B;  3F2D A;  4C3H H;  1H95 A;  4DV4 L;  1YJ9 A;  2IHF A;  3STB D;  4BY1 H;  3NBH B;  1LYL A;  3EBE A;  2AMC B;  2MQH A;  4JBW A;  4L5Q A;  1U5K A;  1XPO A;  1SFO H;  1C7Y A;  3RN2 A;  4A3L H;  1C0A A;  1YHA A;  4YCV A;  4DV3 L;  2VUM H;  5IYB H;  4DV4 Q;  1YI2 A;  3CC2 A;  1Y1V G;  4O0A A;  4OO1 I;  2D62 A;  1VQE A;  2A8V A;  1L1O C;  2R7Z H;  3PIP A;  3U58 A;  5GRO A;  2KHI A;  4JI0 L;  4BY7 G;  1FL0 A;  2BH2 A;  2UXD L;  5IWA L;  4DV6 L;  1JT8 A;  3G71 A;  1PH3 A;  4OWW B;  3BU2 A;  1CKN B;  1Q46 A;  2ZJR A;  3GTQ H;  2UUA Q;  2WB1 E;  1PFS A;  1NMF A;  2OCE A;  3ERS X;  3I55 A;  1I94 L;  4X62 L;  3EIV A;  3TQY A;  3MEF A;  1GM5 A;  3S2D H;  1PH8 A;  3L7Z C;  1Q7Y C;  3S1M H;  4JCV E;  3W1B A;  1OTC A;  4B3R Q;  4A3D G;  4OX9 L;  1FJG L;  3H0G G;  5C3E G;  1FJG Q;  1CKN A;  5AJ3 Q;  4X64 L;  1CKM A;  3JAM i;  3GTL H;  1P8L A;  2YTY A;  2AKW B;  2NVY H;  4DR7 L;  2GVA A;  2UXB L;  1VQD A;  1PH6 A;  5FLM G;  3CW2 C;  3TS2 A;  1RL2 A;  2XGT A;  3ULJ A;  4LF7 L;  1JJC B;  2MFI A;  3M4P A;  1NJI C;  3B6Y A;  3PF5 A;  1N34 L;  2YYZ A;  1VQG A;  3A0J A;  2PQA A;  4MNO A;  4NB3 A;  4HIM A;  1Q1B A;  3JC6 6;  4BXX H;  2Z6K C;  4QGU A;  1K0R A;  4POG A;  1YNX A;  2N3S A;  5FJ8 G;  4GN4 B;  5GAE C;  3KJO A;  3FKI G;  3KJP A;  5ELN A;  4PMW A;  3M85 A;  3HOY H;  4PZ7 A;  5C4J H;  3CF5 A;  2UUC Q;  1YHQ A;  4P73 A;  2E5L L;  2UU9 L;  2HIX A;  3OTO Q;  4HJ8 A;  2LXJ A;  1EFW A;  1Q81 C;  3GTJ H;  4YWL A;  4R4Q A;  1W2B A;  1HZ9 A;  1VQB A;  1U0L A;  3M9B A;  1XTD A;  4IPC A;  3H15 A;  5JEA J;  2F3I A;  4LW1 A;  4R4T A;  1UE5 A;  1IL2 A;  1X3G A;  1Q86 C;  3BZK A;  2ASB A;  4BXX G;  4IJL A;  1SN8 A;  4MZ9 A;  1HNW L;  1BBW A;  1N32 L;  1LTL A;  4GLV B;  5JJK A;  3CME A;  2CWP A;  3S16 H;  5ELO A;  3DM3 A;  2VQF L;  4JI8 Q;  2R7Z G;  4GKJ Q;  2R93 G;  1ASY A;  4YWM A;  4DR2 L;  4X65 Q;  1K8G A;  1VQC A;  4JI2 L;  4DK3 C;  3T1Y L;  1A62 A;  4QY7 A;  3J80 i;  1XPR A;  2K5V A;  3I4O A;  4RG1 A;  2R6G A;  4KHZ A;  1YJW A;  3A5U A;  5M5Y H;  1A63 A;  4QL5 A;  4WJ3 M;  3LGJ A;  4A3K G;  1UWV A;  3E9H A;  5LMU L;  3TS0 A;  1S3O A;  2KEN A;  4YHH L;  4B3R L;  2K52 A;  4JI3 Q;  4IFD G;  2CFM A;  2N49 A;  1VQ4 A;  3CCL A;  2ID0 A;  3K0X A;  1WJJ A;  1EQR A;  1DGS A;  4LFC Q;  1N9W A;  5E7N A;  4R4O A;  1UE7 A;  2CWA A;  2K14 A;  5C3E H;  1TWF H;  2CQO A;  3CAM A;  2HQL A;  3K81 C;  3STB C;  4C2M H;  5C4X H;  1IBK Q;  5J3B A;  1E1O A;  5IYD G;  2ZJQ A;  4JV5 Q;  4JI6 Q;  3FHW A;  3FKI H;  4JV5 L;  4O2D A;  4JI8 L;  3GTK H;  2KCT A;  4GKJ L;  1FVI A;  1AE3 A;  4JYA Q;  4LF5 L;  2JE6 I;  4LF9 L;  4IOC A;  2K75 A;  4DAM A;  3J81 c;  2ZTE A;  2OWO A;  4GOP A;  2VZA A;  3UDG A;  3U4Z A;  3E9I A;  1PYB A;  1YHB A;  2B63 G;  2Y0S G;  1EIY B;  2IX1 A;  4L5S A;  4J15 A;  1NY4 A;  4LF5 Q;  4DR1 L;  4A3B H;  1VS0 A;  1VQI A;  1PH9 A;  4JOI A;  2JA9 A;  2KHJ A;  4BBR G;  3F8T A;  1HZA A;  4YCW A;  2KCM A;  3UDX A;  3IRB A;  2ZM6 Q;  4DR5 L;  1EYG A;  1VQ7 A;  3MXN B;  4A3D H;  4A3J H;  3PUY A;  5BR8 L;  3GTP H;  4JBJ A;  1X9N A;  3S1N H;  2NVQ H;  2AWN A;  1X54 A;  4AIM A;  4LF4 Q;  1E3P A;  2WAQ E;  4BY1 G;  4GKK Q;  3FP9 A;  4JG2 A;  4A3C H;  3AQQ A;  3J80 c;  3RLO A;  1JMC A;  3S2H H;  1K73 C;  1HNX L;  4LF7 Q;  3CCE A;  4P74 A;  2L15 A;  2OTL A;  1V1Q A;  2F4V Q;  3PUW A;  4JI4 Q;  4KHP Q;  4K0K L;  4DR4 Q;  3BJU A;  1KXL A;  4JI1 L;  1HZC A;  1TXY A;  5FJ8 H;  4XTC S;  4HJA A;  2UU9 Q;  4P72 A;  1XJV A;  3HOZ H;  1C9O A;  2Q2U A;  2VW9 A;  5M3F H;  1L1O B;  2A1A A;  4PZ8 A;  3EN2 A;  2ZM6 L;  4DR4 L;  2NN6 G;  1YIJ A;  2JA8 H;  2PI2 A;  3GTM H;  2KBN A;  4P71 A;  1HNZ Q;  2HHH Q;  4A3E G;  1XMQ L;  1IBM Q;  3U4V A;  1KL9 A;  2WB1 G;  1IBM L;  2VQE Q;  5LMN L;  3NEM A;  4GKK L;  1BVS A;  2OQ0 A;  1AE2 A;  4YWK A;  1GO3 E;  4DV6 Q;  1SRO A;  5HY6 A;  1IBK L;  1N33 L;  3GO5 A;  2K5N A;  4PZ6 A;  4C3J H;  4GNX B;  3OW2 A;  4DV2 Q;  4DR3 L;  4B3M Q;  4GS3 A;  5IYC H;  2PQA B;  1WYD A;  3GD7 A;  4UP9 A;  2Z6K A;  1VQ8 A;  2IX0 A;  4BBR H;  5HGQ A;  4QIW E;  2DGY A;  2JA6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...