2OQ0A

Crystal structure of the first hin-200 domain of interferon-inducible protein 16
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
191
structure length
189
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-interferon-inducible protein Ifi-16
publication title Crystal Structure of the First HIN-200 Domain of Interferon-Inducible Protein 16
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 189
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oq0A01
5IYCG 3I4MG 1IBKL 3GTOH 4QL5A 3RZDH 4O0AA 1KQSA 4JG2A 1IBMQ 2OTJA 2YYZA 1I94L 1VQ5A 3KFUA 2R93G 3HOUH 4LW1A 1HNXL 3STBD 4DR2Q 3KF6A 4POGA 4C3JH 1O7IA 3JAMi 5LMNQ 4GOPB 4PMWA 1OXTA 2ZTEA 1TWAH 1XMQQ 2B63H 4IOAA 3EBEA 2UUBL 3U4VA 4J15A 1LTLA 5FLXc 1M90C 2F3IA 4DV0L 1K0RA 3AFPA 2KHJA 2B3GA 2VQFQ 4B3SL 4JI0L 2IX1A 2UXDQ 1E1OA 1XNQL 1V9PA 3KJOA 1P8LA 1HR0L 2UUAQ 3GTPH 1DGSA 1YNXA 4JI8Q 4DUZQ 4HJ5A 1VQ4A 2VQEL 3J81c 2ZM6L 2CCZA 5IYDH 3PGZA 4A3CH 2D62A 3Q8DA 1SN8A 3W5OA 4EX5A 1N34L 1A0IA 4A3KG 3GTLH 3HOWG 4YCWA 1EYGA 3T1YQ 1U5KA 3CAMA 2JEAI 2ZJRA 3EIVA 1WCMH 3CC2A 1HJPA 1YZ6A 3FKIH 3A74A 3CCLA 3S1QH 3PUYA 5C4XG 1J5EQ 1NMFA 4Y52H 3CP0A 4DV6L 4B3ML 3PIOA 1Q1EA 4DAYB 1E7ZA 5JEAG 4R1JA 1HZCA 3CW2C 4YWKA 4JBKA 5M3FG 1PH2A 2YTVA 3OTOQ 1YI2A 1YEZA 1NMGA 3ULLA 1CKNB 2VL6A 3TQYA 1VS0A 2JE6I 2LXJA 1K3RA 4JV5L 2EIFA 4GKJQ 1IL2A 4LFBL 1VCIA 2PQAA 4P71A 4OWXB 1MJEA 2Y0SE 1MJCA 1Q86C 2A19A 1QZHA 3E0EA 4BY7G 3HOXH 4GN4B 3VDYA 4JI2Q 1KC8C 1HNZQ 1VQ8A 3STBC 4X65Q 2YU9H 3H15A 1Y1WG 4YCVA 1EFWA 1HZ9A 1NY4A 3S1RH 3T1HL 4GLVB 2UUCQ 3GD7A 1HNWL 2JA7G 1Z47A 3BZKA 2ES2A 4A3JH 1FL0A 4DR3L 2RHSB 4B3RL 3H0GG 2UU9L 2HT1A 3TRZA 4JYAQ 1CUKA 4O2DA 4DV4Q 4JI6L 4NXML 1CKOA 4JI3L 3S2HH 3I55A 4LF4L 4WJ3M 4KHZA 1NE3A 3PUWA 2UXBL 4DR1Q 2NZHA 2XTIA 4R4OA 1X6OA 3SGIA 3F1ZA 4DV5Q 3L7ZC 4GLXA 1TWHH 4DR5L 2JA8G 4LF7L 3I4NH 2K4KA 2D0OA 2ASBA 3S1NH 1VQ9A 1VQBA 1I50H 4IPDA 4DK6C 1XMOQ 2Q2TA 4DR7Q 1C0AA 1K8GA 2EQSA 5IP9G 4A3FG 2N3SA 4P73A 2CWAA 5IWAQ 2OWOA 4A3GG 1S40A 1QVGA 4Y7NH 4HJ9A 2JA5G 1I5FA 1Y14B 3S2DH 5JJKA 4ME3A 4DV7Q 4OXPA 1B8AA 1PYBA 4GKKQ 3J81i 3PF4A 4OX9Q 4POFA 2MO0A 2Q2HA 2JQOA 3HFZB 1JE5A 4IJHA 4GNXB 3PF5A 4DR6L 2R92G 1N8RC 1Q81C 2WFWA 1PH5A 4A3LG 4A3EH 1X3FA 1PHJA 3HOZH 5C0XG 4JI7Q 3W1GA 4LFCQ 1N32L 2B29A 2PQAB 1YITA 1Q8KA 2OCEA 4R4TA 4YHHQ 1JMCA 2E2HH 4A3DG 4R4QA 1Q12A 2MO1A 3GO5A 2Z0SA 4FDBA 4L5TA 1E1TA 5IY0A 1TWCH 5AJ3L 4A93G 1BKBA 1L1OC 4H02A 4UP8A 3I4OA 4YY3L 4APVA 4X64L 5M3MG 4BBRG 4XIGS 1QZGA 4A3BH 3W1BA 1PH6A 2E2IH 3AFQA 2OTLA 1SROA 4UP9A 3ULPA 4JI4Q 1XNRQ 3M9BA 2YTXA 4YWMA 3JC66 1L1OA 3DLLA 1H95A 2WB1G 3S15H 2K52A 2B63G 4AYBE 2F4VQ 3KYHC 2KENA 2LXKA 3PUVA 3U58A 2ZJQA 1UE6A 4A75A 1VQ6A 3HOYH 2ID0A 4LF6L 5IYBG 1BBUA 1D8LA 3M4OH 1SFOH 1PA6A 2ZTCA 1OXSC 3J81j 4BXXH 1C9OA 1KHIA 3K7UC 4DV1L 5IYDG 4HJ8A 4IFDJ 3UE1A 2ZM6Q 1IBLL 1QUQB 1YBYA 2VY3A 4UY8C 1AE3A 4DV3L 3K8AA 1KRSA 4IJLA 3RLOA 1G6PA 2UUAL 4A3MH 1IYJB 1Q1BA 4RMFA 5HGQA 5K36G 3PV0A 1Y1VG 1YHBA 2GVBA 3GTJH 1I94Q 5IYCH 3I4MH 1HNXQ 2HQLA 1B70B 4A4IA 3KDFA 2HHHL 4X62L 1FVIA 2F52A 2IX0A 3H3VI 3CCRA 2JA9A 3PIPA 1EOVA 1OTCA 2OQKA 1PH4A 3OW2A 2R93H 4TVAB 1L2FA 1X54A 2MNAA 1B7YB 3M4PA 1VQPA 2UUBQ 1SR3A 1G51A 2H5XA 5M5XH 4R4CA 1WFQA 3KOJA 3J7A5 4DV0Q 4YCUA 4B3SQ 2I5HA 1N9WA 1NBWA 5J3BA 1YHAA 4JI5L 2R7DA 3HKZE 4QIWE 3RR5A 2N8NA 3U4ZA 1OXVA 1ASYA 2NVXH 1K83H 1HR0Q 4LF8L 1XNQQ 3PO2H 5BR8L 1GD7A 4B3TL 4X6AH 1TWGH 2VQEQ 1VQKA 4JBWA 4DUZL 1N34Q 4GKJL 3GTGH 4NXNL 4JBJA 3TEHB 5IE8A 2VNUD 3LGJA 1EWIA 3F2CA 4UP7A 5LMUL 5GAGC 3M3YH 3RZOH 2AKWB 1NTGA 4DR4L 3TREA 5GAEC 1X3GA 1R9TH 3RNUA 4HIKA 3HOWH 4DV6Q 2E5LL 3BU2A 4NB3A 4A3KH 1EIFA 1YJNA 1N36L 1K8AC 4BA1I 4B3MQ 3ICEA 1AH9A 1X3EA 1IZ6A 1UE1A 5C0XI 3KF6B 3PUZA 3UDGA 1VQEA 2BH8A 2NN6G 3S24A 1S72A 3GTKH 4KHPL 3K0XA 3UE0A 5C4XH 2Y0SG 2AMCB 3CC7A 3HOVG 4QGUA 3TS2A 4IPHA 1E3PA 1VQNA 3HKSA 5C44G 1SRUA 2CFMA 4C2MH 4HIDA 1KIXA 1LYLA 4PG3A 3G48A 5M3FH 1N33L 4BBSG 1VQCA 2IHFA 2I5LX 4JV5Q 3G4SA 3KF8B 4MTNA 3TS0A 4A76A 4MZ9A 4LFAL 4LFBQ 3CF5A 1PH1A 1V1QA 1C7YA 1FGUA 3NBHB 2D0PA 3CCSA 3CD6A 4OO1G 5GQOA 4RG1A 3CXCA 2ZJPA 2WP8J 3AQQA 3J80i 1EIYB 1WI5A 4LF9L 2R7ZG 1EQQA 2JEBI 2V1CC 3KDFB 1UE5A 2R6GA 1EUJA 4A3IG 4GLAC 4YWLA 4GOPC 4BY7H 4K0KL 1JT8A 3T1HQ 5IP7G 2A8VA 5ELOA 4X66L 1HNWQ 2JA6G 1HZBA 1GKHA 2EXDA 5HY6A 1VQHA 1P16A 1UEBA 5C3EG 2I0QA 2VUMG 1VQFA 4DR3Q 4B3RQ 2CQOA 2PNHA 4JI1L 1YJ9A 5FJ8G 1Y1WH 2DGYA 3GTQH 1FJGL 4R4IA 3CMEA 4JI6Q 4L5SA 4NXMQ 3I56A 4JI3Q 2JA7H 2PI2E 4LF4Q 1GM5A 2UXBQ 2QEXA 1XPRA 4GOPA 1VQGA 5M5WH 4DUYL 2A1AA 4AQYL 3H0GH 4LF5L 3PO3G 1PH9A 3S17H 4HJ7A 1PH7A 4DR5Q 2N49A 4LF7Q 1VQMA 2VS1A 1YVCA 4GN5A 1GO3E 3RN5A 3E9HA 2UXCL 2JA8H 3FHWA 1RIPA 4DV2L 3NELA 2DUDA 2VW9A 3M4QA 1W2BA 4WJ4A 3CMAA 2WAQE 5FLMH 3HOUG 4A3FH 1XNRL 4DR6Q 4A3GH 2YTYA 2JA5H 1OXUA 2KHIA 1KL9A 2NVQH 4LNQA 2K14A 3G71A 2XGTA 1IBML 5JJIA 4AIMA 4KI0A 1G291 1N32Q 2QGQA 1T9HA 2ALYB 3ER0A 2MFIA 4DR2L 4BY1H 5IT9c 3J80c 2CKZB 2R92H 1A8VA 1VQLA 1JJCB 3KLWA 3L0OA 5AJ3Q 5LMNL 4HIMA 1K73C 4YY3Q 1CKNA 1XMQL 4X64Q 4QJFA 2AWNA 3I7FA 1VQDA 1VQIA 4AYBG 3CPWA 1Q7YC 3A5ZB 1CSQA 3D0FA 4DNIA 2IT1A 3MXNB 3AEVA 4A93H 4A3CG 2VQFL 2UXDL 2NN6I 1IBKQ 3F2BA 2HIXA 5M5YH 2PI2A 2JK8A 3UDFA 1A62A 1WCMG 2I5MX 4JI8L 4BBRH 5M3MH 3FKIG 3M85A 3G6EA 1YHQA 2E2JH 1QVCA 1CKMA 3A0JA 4GN3B 4BA2I 1KXLA 1AE2A 3T1YL 2K5VA 3I2ZA 4MNOA 2YV5A 5E7NA 1PFSA 1TWFH 2R7FA 3ZJYC 1NJIC 5JEAJ 2Q2UA 4OO1I 5H1SE 1I6HH 1J5EL 2AHOB 1WYDA 3B6YA 1GVPA 2FXQA 3J7ZC 4LF6Q 3PO2G 3GDEA 3UDIA 3L2PA 1XJVA 4KLKA 4DV1Q 2L15A 4JI0Q 3ULJA 4JCVE 1JJ2A 1IBLQ 5ELNA 1E24A 1XPOA 3OTOL 3CCQA 4DV3Q 1RL2A 5IYBH 4IFDG 1VQ7A 1BBWA 3CCVA 1Z9FA 4PZ8A 4DAMA 1MIUA 1M1KC 1QVFA 4PZ6A 1TXYA 1LM0A 3RLNA 2BH2A 3HOXG 3CCEA 1PH3A 3HKZG 1U0LA 1WOCA 4UPAA 2HHHQ 4GNXC 3F8TA 2IHEA 4X62Q 3CPFA 3WWVA 2MQHA 1Y1VH 1L1OB 4DKAC 4NPSA 4JI2L 5JJLA 1HNZL 4QQBX 2VZAA 4X65L 2BA1A 4A3JG 1IXRA 4GS3A 3K7AH 1KAWA 1WJJA 4JI5Q 1X55A 2KCMA 1PH8A 2UUCL 3CC4A 2PMZE 4LF8Q 4GNXA 1SLJA 2HIVA 3RN2A 5BR8Q 4B3TQ 3DM3A 3F2DA 2NZOA 1OXXK 2AWOA 2K5HA 2RF4A 2OQ0A 1X9NA 1V43A 2NVYH 1X65A 4IPCA 4IOCA 4L5RC 4NXNQ 4PZ7A 4JYAL 2KCTA 4DV4L 3I4NG 3AYHB 1ASZA 1UE7A 3CCMA 3KJPA 5LMUQ 3ERSX 4DR1L 4DR4Q 2C35B 1VQAA 4OONA 4DV5L 4QY7A 1LUZA 2E5LQ 1D7QA 1N36Q 4DK3C 4IO9A 3JAMc 1YJWA 1XPUA 4HJAA 1JJGA 1VQJA 2K50A 4KHPQ 4OWTB 5DLQE 2E8GA 1XMOL 1EQRA 4DR7L 3PUXA 3EN2A 3PSIA 3NEMA 1J6QA 2RCNA 5IWAL 5EAYA 3FP9A 3CQZH 1N33Q 5LMNW 1MKHA 4DV7L 4A3EG 1PV4A 3GTMH 3HOZG 2LSSA 4LUZA 3HOVH 4GKKL 2UU9Q 3BZCA 4LFAQ 1BVSA 5GAHC 4OX9L 3CCJA 2N78A 3D31A 5C44H 3S1MH 5C0XJ 4BBSH 4LF9Q 1UWVA 3K81C 4P72A 4ALPA 4JI7L 2CWPA 1E22A 1W3SA 1VQOA 4LFCL 4OWWB 4C3HH 1SMXA 4YHHL 3H3VH 4EQ5A 3MEFA 4XTCS 4A3BG 4HIOA 1QUQA 1Q82C 4DPGA 2R7ZH 5FLMG 3K80C 4JBMA 4K0KQ 2RHQB 4TQUS 3S14H 4X66Q 1A63A 2GN5A 2BA0A 4LWCA 4A3IH 1PYSB 1HH2P 1I3QH 1K9MC 4C3IH 2NVTH 4JI1Q 3S16H 3OYYA 2K5NA 1FJGQ 5IP7H 4IPGA 4JOIC 3M7NA 2Z6KC 3NENA 4P74A 5IP9H 1CSPA 2JA6H 4BY1G 1Q46A 2QA4A 4JI4L 1HZAA 5C3EH 4IFDI 2VUMH 1SE8A 2GVAA 4AH6A 1XTDA 1X56A 4DUYQ 4AQYQ 2ATWA 4LF5Q 5FJ8H 3HOYG 3CCUA 2ZTDA 2K75A 2WAQG 3U50C 3A5UA 1HR0W 2F4VL 4BXXG 4LUOA 3RLFA 1JB7A 3UDXA 1KD1C 4A3LH 3PCOB 2JJQA 3E9IA 5GADC 4JOIA 5GROA 3PO3H 2UXCQ 2Z6KA 1S3OA 1KRTA 5C4JH 1YIJA 1PVOA 2IY5B 4P75A 4LUVA 4JC0A 1L0WA 4A3MG 4DV2Q 4L5QA 4A3DH 2KBNA 2Q2IA 3BJUA 3IRBA 2WB1E
chains in the Genus database with same CATH superfamily
4G7HC 4FF3A 3HKZB 2H1EA 3GTOH 3RZDH 3OWFA 4RKBA 1KABA 1R4PB 2O5JC 3ERQA 1O7LA 3NQTA 4JG2A 2OTJA 1I94L 2R93G 1HNXL 3KBGA 2TMPA 1TY2A 2CW0C 1SMYC 3KF6A 4C3JH 1O7IA 4PMWA 1IKMA 1TWAH 1XMQQ 3EBEA 3U4VA 5FLXc 5EKKA 4ZLTF 2DNEA 1D1KA 2N88A 2L0CA 1SJHD 1V9PA 1HR0L 1YNXA 2L11A 4DNRB 1QNKA 2D62A 3Q8DA 4FXKC 3TN2A 3W5OA 4A3KG 1WVLA 2JEAI 3CAMA 3S2DB 3EIVA 5CC4A 1YZ6A 4JVZA 3CCLA 5C4XG 1H9SA 1J5EQ 1NMFA 1L0XB 3I70A 1Q1EA 1HZCA 3KUPA 3OMCA 2K03A 1ZKOA 3R8BA 5IODA 5IGCA 1ONLA 1CKNB 5G3LF 4F87A 1K3RA 4G7OC 2EIFA 1CHPD 1SAPA 3QOJA 4HN7A 2A73B 4QCLA 2CHBD 4UAIA 3VDYA 2K33A 3STBC 4K14A 3H15A 2AQ2B 4IURA 4KKUA 3S1RH 3FDTA 4A3JH 1FL0A 4B3RL 1FD7D 1STGA 2HT1A 1SFOB 3S2HH 5ELCA 4XYQA 4EQPA 4FP5D 5EPLA 3F1ZA 3L7ZC 5CORA 1DCZA 1VQ9A 4IPDA 3QWNA 4DR7Q 3MXNA 2Q2TA 5IP9G 3H91A 2CWAA 1S40A 5JJKA 4DV7Q 2R93B 1PYBA 4GKKQ 4OX9Q 1YNND 2JQOA 4GNXB 4IJHA 3PF5A 1RD9D 2Z1CA 2R92G 1N8RC 3U9OA 4DK1A 5C0XG 3A8IE 1K83B 4LFCQ 1AEXA 2PQAB 2E2HH 2ZXOA 2M00A 3GO5A 4FDBA 4L5TA 1E1TA 1BKBA 4UP8A 4YY3L 4APVA 4A3KB 3MWYW 5FOBB 2WKCA 4QIWB 5IGEA 3J7AV 1XNRQ 3VR3A 1E2ZA 3AMUA 5C4XB 3SK4A 4KMUC 3A56A 1I6VC 2K52A 2B63G 3E3XA 4YIJA 4A75A 1AFPA 3PIP3 1CZGA 3M4OH 1Q3LA 1PA6A 1OXSC 4BXXH 5IYDG 1IBLL 1YBYA 4UY8C 1MBYA 3K8AA 1KRSA 2ENBA 1EYAA 5K36G 3IFDA 1Y1VG 1EYCA 1I94Q 3J80E 4DAPA 1HNXQ 1RODA 3D4WA 3GTQB 1EOVA 3FPPA 2OQKA 1L2FA 1X54A 3M4PA 1VQPA 3A7AB 2F4IA 1SR3A 1Z6HA 2H5XA 3J7A5 1WFQA 4K5XA 1K73C 5EBDA 4QIWE 1IKLA 3PO2H 1HR0Q 1O7YA 4BWGB 4B3TL 1BCPC 4ZKBB 1D1IA 1TS5A 4IQZA 3TP5A 4NXNL 5I9OA 4IFDH 2VNUD 2NUCA 3P75A 2B2VA 4IUNA 5LMUL 4NP5A 1R9TH 4XT1B 1FYCA 3RNUA 3HOWH 2G9HD 5ISRA 3P7JA 2A68D 1UE1A 2NVQB 2BH8A 4JW0A 3GTKH 4RGMA 2Y0SG 3HOVG 4MIUA 1BDOA 3D8GA 2JXMB 5LL6S 1E3PA 4HSPA 2R92B 5C44G 4HCEA 4C2MH 4BBSG 3GP7A 1EY4A 5G3LD 2I5LX 2O5IC 3G4SA 4R9WA 4LFAL 1C7YA 4NMZA 1EWHA 1FGUA 2D0PA 4OO1G 4F8MA 1EIYB 3CXCA 4EVOA 5IT9L 3VR5A 2V1CC 1CFMA 1MSHA 5M5YB 3NPPA 5KIXA 3G7LA 3OW7A 5TSSA 1HXYD 4BY7H 5EKIA 2JA6G 5HY6A 2FMMA 1KLUD 1I6HB 3OWEB 4B3RQ 5D3IB 2PNHA 5FJ8G 2DGYA 1FJGL 2MJ8A 2Z6BA 4L5SA 3I56A 5M5WH 5M9OA 1KDAA 3TMEA 1GUGA 3SVMA 1MD2D 3E9HA 4PMCA 1DOMA 4G57A 1HA5A 5JPNC 2DUDA 1Y1VB 3I73A 4G4KA 2VW9A 5FLMH 3K5NA 4A3FH 1YNJD 4A3GH 2AQ1B 2JA5H 2KHIA 4MN3A 1SBBB 1IBML 3K5LA 2B2TC 4ME5A 4DR2L 4BY1H 4HTHA 2J7ZA 3J80c 1A8VA 1KNEA 3W2DA 4YY3Q 1CKNA 3K59A 4ILWA 3BVMA 2IT1A 1K8OA 1IBKQ 2HIXA 1STBA 2PI2A 3UDFA 1A62A 2I5MX 3WOFA 1AZQA 1J8IA 1YHQA 3FEWX 3MTSA 2F0UA 4ZQ3A 3ZJYC 1NJIC 2R7FA 5ELDA 2Y0SB 3HOVB 3B6YA 1IW7C 1GVPA 2FXQA 1I4GA 5C44B 4BBSB 5DAUA 5ELBA 4KLKA 1VMCA 2VB2X 1JJ2A 1IBLQ 2B2VC 1QB5D 3TP8A 2EYMA 1VQ7A 1GUWA 3OIPA 4PZ6A 3HOXG 3CCEA 2IHEA 5A2QL 3CPFA 2B8GA 2BCOA 4R8NA 4EQOA 1IYVA 1LTBD 4JI2L 5JJLA 3G6JB 2HDLA 1WTPA 1XX8A 1IXRA 2M9VA 1KAWA 2QEJC 2KCMA 1PH8A 4GNXA 2HIVA 4B3TQ 2A6HD 1G2SA 2NZOA 2RF4A 5IIFA 1X9NA 1U4PA 4IPCA 4JPBW 5C4JB 4U673 4NXNQ 3I4NG 3AYHB 1PRTC 5I4DA 4A3DB 1UE7A 3CCMA 5LMUQ 3ERSX 1DONA 1VQAA 3BVZA 4OHJA 1ICFB 1GUNA 1NR4A 4DK3C 3JAMc 1XPUA 2K50A 2RQXA 1JORA 3EN2A 1HQRD 1S5BD 1I4QA 5IWAL 3BYYB 1F9QA 2NTTA 4A3EG 1MKHA 3GTMH 2WB1B 4LFAQ 5GAHC 1BVSA 2WIIB 2CW0D 1SMYD 3NHHA 3D31A 3QR8A 3CCJA 1VF5C 4PV1C 4JI7L 3KBXA 1E22A 1PTOF 1W3SA 1JOKA 4C3HH 1SMXA 4YHHL 4KD3A 4EQ5A 1PTOB 4A3BG 2DJGC 4HIOA 5FLXL 4JBMA 1HA6A 1LTID 5KNDA 3A55A 4I65A 1MI2A 2BA0A 2ZXPA 1EQVA 2A68C 3S1QB 1S5ED 1MHWC 3S16H 1FJGQ 1K28A 1RTOA 4JOIC 2Z6KC 4P74A 3IAYA 3NQIA 1HZAA 5C3EH 2K75A 4HEDA 2WAQG 2RDFA 3A5UA 2OF1A 3RLFA 5IGDA 3UDXA 1ESFA 3PCOB 2JJQA 3E9IA 1SYDA 4WJ3M 1CQFA 3DM1A 4KHVA 2EYJA 4A3MG 2DNCA 3ND8A 4U68A 3BJUA 1SNOA 2WB1E 3HOXB 3I4MG 4K8IA 2KOLA 2YU9B 2F0TA 4O0AA 3N6RA 1LTAD 2BDOA 1KQSA 1S5DD 2DJFC 1NNXA 3F2UA 1IBMQ 2YYZA 3EQLC 3STBD 4DR2Q 1CT1D 3MXGA 4POGA 3JAMi 1LACA 1C48A 4OIJA 4WRDA 3QOLA 5IOCA 4IOAA 1LTLA 4IZ8A 1CHQD 2EYPA 5J22A 2KHJA 3H09A 2F0KA 3I4NB 4N9TA 1K3BC 1S4ZA 1E1OA 3V05A 3KJOA 2UUAQ 1X3PA 1I50B 1VQ4A 2CCZA 3J81c 4ZKCB 4A3CH 4FYDA 1SN8A 1N34L 1A0IA 3SDZA 1GXDC 4Y7NB 2L9HA 2NZ1D 2BDNA 4RHSA 3CKIB 3FKIH 1CZWA 4X3TA 4Y52H 4DV6L 2XWBB 2LY7A 3MXPA 5FLXE 5FO9B 4ZYSA 2MHVA 4JBKA 4A3EB 3BYTB 1Y8NB 2I07B 1SNPA 4NDXA 1YEZA 1PFMA 3ULLA 3K0YA 2J4XA 2JE6I 1QE6A 1TWCB 4GKJQ 1IL2A 4LFBL 1VCIA 4A3BB 3T51B 1JC7A 4KY7A 1EY9A 3IL8A 3SK8A 2RCFA 4JI2Q 1VQ8A 1RF2D 1QJOA 1UEAB 1FNWA 1LT5D 3NE5B 1TS3A 3ND9A 1EFID 1HZ9A 1V1PB 2F0JA 3T1HL 1HNWL 3GD7A 3OIQA 2JA7G 3URYA 4ZK9B 3BZKA 3CRKC 3RD4A 4DR3L 2NN6H 2E74C 1DD2A 2WAQB 4XT3B 3TRZA 4ZUIA 4JI6L 2K5WA 4FXDA 1CKOA 5DNFA 2BOSA 4IUPA 2QDBA 1AZPA 1B50A 2UXBL 1DZ1A 3SGIA 1A3UA 1CM9A 1UAPA 4GLXA 4A3MB 5AFWA 2K4KA 1PMRA 4C1NK 4IUVA 3AB9A 2AQ3B 4DK6C 3GTJB 3I4MB 1K8GA 1JE4A 4H0LC 1F9RA 1STEA 2N3SA 2Z4IA 5IWAQ 1QVGA 5C5LA 4HJ9A 3S2DH 1I5FA 1Y14B 5CGKA 4M1UB 2HD3A 3J81i 3PF4A 2MO0A 3CRLC 2BE5D 1JE5A 1BF4A 2K7VA 2WFWA 4A3LG 4ODGA 4LJZC 2NVXB 4JI7Q 2Q8RE 1N32L 2B29A 1Q8KA 1TWGB 4R4TA 4YHHQ 1JMCA 3OSOA 5AJ3L 2JN4A 2FFKB 4A93G 5IY0A 3GTGB 4H02A 2EYFA 2H4OA 4ID6A 3I72A 3M3YB 2F3WA 4R8IA 4BBRG 1BUVT 1ML0D 1PRTF 3A8KE 3TSSA 1AN8A 3NP8A 2OTLA 4UP9A 1PRTB 4MHEA 4C3JG 3M9BA 2YTXA 3L3OC 3JC66 4CJ2C 3DLLA 1H95A 2XRSD 2HQEA 1KAAA 5JJZA 5LL6X 1O78A 1BBUA 1SFOH 2ZTCA 4QUCA 3J81j 4XDXA 4B9XA 4KJNA 4DV1L 4HJ8A 4IFDJ 3UE1A 1QUQB 1PDQA 2VXWA 2KCNA 4IJLA 3KF8A 3T56B 4Z9CB 1G6PA 1Q90A 1Q1BA 1JQYD 5HGQA 2HCCA 3PV0A 3P20A 3HP3A 2MPMA 1A6XA 1B70B 3KDFA 2RVLA 2F52A 1B4OA 5EPKA 2JA9A 3PIPA 1WTOA 1PH4A 2R93H 4TVAB 2JA7B 2MNAA 1B7YB 3OMGA 4WORA 4KN7C 3P1HA 1GUOA 3KOJA 5C6AA 4YCUA 4JI5L 1NBWA 1BO0A 3S17B 2R7DA 3HKZE 3QJYA 3RR5A 2N8NA 1ASYA 2EY6A 1ET9A 1FR3A 1K83H 2RSOA 1ILPA 4CJ0B 1GD7A 1UUPA 3MHBA 1VMPA 1N34Q 2OXPA 3MAQA 4JBJA 1GUSA 1EWIA 5BN3A 5GAGC 3RZOH 1NTGA 4L63B 5NUCA 4DV6Q 2E5LL 4A3KH 4NB3A 1EIFA 1YJNA 1AH9A 4BA1I 1X3EA 5C0XI 3OHXC 3PUZA 3UDGA 1VQEA 1DJRD 5T1GA 5CV6A 2EY1A 2B8FA 1F2MA 5C4XH 3CC7A 1JWSD 3K57A 1VQNA 3HKSA 1N33L 4PG3A 3NK9A 5LHY1 2MUYA 2IHFA 3H94A 1STNA 2EDGA 4MTNA 4LFBQ 1AP0A 3NBHB 3CD6A 4A93B 4RG1A 4LAAA 3J80L 1EEFD 2R7ZG 2JEBI 4MTKA 5FO8B 2E2JB 1EUJA 1II3A 4BBRB 5KRUA 4YWLA 1EU4A 1VF7A 4NW2A 3T1HQ 1HNWQ 5ELOA 4ULLA 1GKHA 1PZJD 2RKSA 1P16A 1UEBA 2VUMG 4DR3Q 5COYA 5CV5A 4UDUC 4JI1L 1YJ9A 3C3LA 3GTQH 3RUZA 4L8JA 4R4IA 4JI6Q 1HTPA 3TDQA 2PI2E 1H9JA 2ICIA 1B53A 2UXBQ 2QEXA 3HRZC 4DUYL 1CK1A 2PO4A 1IW7D 3EJIA 4LF5L 3FRPB 1B2TA 4CBVA 4HJ7A 4P2CB 1YVCA 1S5CD 4GN5A 2L5TA 1SE2A 2B39A 2PNRC 2UXCL 2EE1A 3FHWA 1RIPA 1TS2A 1U4MA 2L55A 3RZOB 2Z8LA 3M4QA 1HHVA 3FMCA 3HOUG 1QNUA 5D14A 4B08A 2DY7A 1OXUA 3K7AB 4FVMA 1KL9A 2NVQH 2K14A 1WD0A 5JJIA 4Q5VA 1EY5A 4KI0A 1N32Q 1T9HA 3ER0A 2MFIA 4CKCA 2F0FA 2CKZB 4CKEA 2R92H 1JJCB 5AJ3Q 5LMNL 3BDLA 3BS1A 3SE0A 1NUCA 4AYBG 2AWNA 2LFNA 1VQDA 3I7FA 1Q7YC 5FO7B 3A5ZB 1CSQA 3D0FA 2PZWA 1BNZA 1EZ6A 1WTWA 2F0LA 3AEVA 4BS9A 2UXDL 2B2TA 1PRTD 1STHA 5JAVA 5M5YH 2MGSA 2JK8A 1TQOA 1WCMG 4JI8L 2K6AA 1RKNA 3A0JA 4KJOA 1AE2A 2EJMA 4MNOA 4ABNA 2BE5C 1PFSA 5JEAJ 2K28A 4OO1I 5H1SE 1I6HH 3KLSA 1V1PA 1X32A 3PO2G 1LTRD 4DV1Q 2PQEA 4JCVE 3ULJA 1PTOC 2CH4A 3OTOL 3CCQA 1RL2A 1T5XD 4IFDG 1BBWA 3CCVA 4DAMA 1D5XC 1B9NA 1TXYA 2R7ZB 3M4YA 1SYGA 3S14B 1PH3A 1U0LA 1WOCA 3QG1A 1I3QB 1EWCA 3C46A 2KEDA 5K36H 3WWVA 2Q8IB 1Y1VH 4DKAC 3HEJA 2A5HA 3WOEA 4NPSA 2VUMB 4X65L 2BA1A 1ENAA 4CHTB 4JI5Q 1X55A 2UUCL 3RN2A 3F2DA 2K5HA 3TZDA 1F2ZA 4IOCA 4PZ7A 4JYAL 4DV4L 4LK1C 5C4HA 1ASZA 4K2LA 4HSVA 2XVSA 2E5LQ 1D7QA 5HURA 4IO9A 3HOUB 1KLGD 2Q8TA 3N52A 3D4RA 2NTSA 1B44D 3FP9A 5EBCA 1N33Q 1FNVA 2DY8A 5LMNW 3NSWA 1PV4A 3HOZG 3HOVH 1PFBA 2B63B 2QF7A 5C44H 4BBSH 1UWVA 3X3MA 1F9SA 1G91A 4ALPA 3JAME 4FF1A 2CWPA 3GTPB 4AYBB 4C1NI 4OO1H 1I4HA 2PZUA 1NAPA 1SNMA 2F0HA 1QUQA 4DPGA 3GTLB 5FLMG 3D6CA 1B1ZA 1A63A 2GN5A 1A3TA 1H9RA 1WCMB 3O13A 1K9MC 3MEHA 1I4RA 1E2WA 3Q0AA 4JI1Q 2PYKA 1LO5D 3M7NA 2JA6H 4BY1G 3I8ZA 2QA4A 3WDNA 1W6JA 2KVMA 2GVAA 1XTDA 4DUYQ 4DK0A 3HOYG 4LF5Q 1SYEA 5FJ8H 2ZTDA 2F4VL 4LUOA 3MFYA 1JB7A 4S3SA 5GADC 4JOIA 2IY5B 2UXCQ 2Z6KA 1S3OA 3NWTA 5C4JH 1YIJA 1PVOA 4JC0A 2JYOA 3A7LA 4L5QA 4A3DH 2Q2IA 3MVVA 5IYCG 4K5VA 3S9WA 4OIKA 1TR5A 5CV7A 1SE3A 3ZYYX 1VQ5A 3KFUA 4RH6A 1QILA 5LMNQ 1OXTA 1JWMD 3PIO3 1U9RA 3V96A 5EQ0A 2UUBL 5C3WA 2KCCA 1LV9A 4HR7B 1M90C 4DV0L 1CA6A 2B2YC 1K0RA 4ZCKA 2UXDQ 2B3GA 4J6HA 4JI0L 1TWHB 4CDEC 2IX1A 2FHTA 3RMHA 5ELFA 2A6EC 1XNQL 3S1NB 4NKLA 3NBHA 4XQJA 2SDFA 4JI8Q 2E76C 1PTOH 2QW7A 2DN8A 4YCWA 2WKDA 1EYGA 1EY0A 1U5KA 2ZJRA 2SNMA 1JICA 1HJPA 3S1QH 3PUYA 3NWSA 4DAYB 1E7ZA 5JEAG 2JA6B 3CW2C 4YWKA 4XQQA 5M3FG 1PH2A 3HOZB 1CI3M 2YTVA 5HGTA 4FF2A 3OTOQ 4H7BA 2VL6A 3J81E 1VS0A 3T13A 2LXJA 4JV5L 2KA7A 1ICWA 2PQAA 4XQNA 4V0BA 2E2IB 2L1BA 2Y0SE 1MJCA 2A19A 3GV6A 4RFBA 5DM63 3HOXH 4GN4B 5KYIA 2X6GA 2L4NA 4X65Q 2YU9H 1Y1WG 2J0TD 4YCVA 3S15B 1NY4A 4GLVB 2UUCQ 4XYOA 1Y8OB 2ES2A 1ZYRD 2F3VA 4EGVA 3HOYB 2RHSB 3H0GG 2UU9L 1EEID 2LKVA 3KK7A 1RTNA 1CUKA 4O2DA 4DV4Q 4JYAQ 4JI3L 4FO2A 3I55A 4KK7A 2NZHA 4R4OA 1X6OA 1RDPD 5EPJA 4DR5L 2JA8G 4LF7L 3I4NH 2D0OA 1JWUD 1VQBA 1I50H 1QOHA 2EQSA 1BOSA 2RDGA 4P73A 2OWOA 5CV8A 4Y7NH 2ICEC 5I2XA 4ME3A 1K8MA 4OXPA 1B8AA 2NWGA 4POFA 3IFTA 4J1MA 3HFZB 3H3VC 5M5XB 5EKLA 4DR6L 3FPUB 4GZYC 1Q81C 1PH5A 2EYLA 4A3EH 1PHJA 3W1GA 5I6WA 3LWEA 1DYQA 1C8CA 1Q12A 2MO1A 3LNNA 4O42A 1TWCH 1L1OC 3I4OA 1NR2A 1IL8A 1QWYA 5M3MG 3OPOA 4A3BH 3W1BA 3Q23A 2D2CC 2SNSA 1XYIA 4YWMA 1WTQA 3BDOA 1ENFA 4L6TB 2XIWA 4I7AA 4UHVA 2KECA 3K5MA 5CV4A 3UI2A 3R93A 2F4VQ 1EZ8A 5M3FB 2KENA 2LXKA 4XXEA 1AW7A 2ZJQA 1VQ6A 3I91A 2SEBD 2ID0A 3DHQA 3DMUA 5CV9A 1D8LA 5IYBG 4KV6A 1CA5A 3CU7A 3Q6SA 1KHIA 3K7UC 2RSNA 2KEEA 1HUNA 4QB4A 1JCKB 2VY3A 1LLRD 1AE3A 4DV3L 2IJ0A 3RLOA 4A3MH 1EY7A 1LTSD 1YHBA 2GVBA 3GTJH 2O4XA 1JOOA 5C4ZA 4WFN3 3I4MH 3I3CA 2F03A 1TT2A 2HQLA 2HHHL 4X62L 2IX0A 2K32A 3H3VI 1Y1WB 1OTCA 3OW2A 5E4XA 2UUBQ 1PLFA 2VB3X 4CDDC 3BDCA 4IALA 2FMCA 3H0GB 3Q22A 4DV0Q 1N9WA 4JI0Q 3U4ZA 1YHAA 2F0WA 2I46A 3R3OA 4N8FA 2NVXH 1XNQQ 5BR8L 2FINB 2K05A 1TWGH 2TSSA 1VQKA 5CR3A 4JBWA 3GTGH 2JA8B 3TEHB 3D3RA 4OL7A 5J39A 3NUCA 2SOBA 3M3YH 2AKWB 4DR4L 2E2DC 3TREA 5GAEC 1CTMA 3BU2A 1N36L 3ICEA 1K8AC 1DM0B 3OOCA 1TU2B 1S72A 2NN6G 3S24A 3K0XA 3UE0A 2AMCB 1A2UA 4F7XA 3TS2A 4IPHA 3VYTA 1KTKA 1SRUA 1LYLA 4ZAIA 4JV5Q 3TS0A 4A76A 2EJFC 4MZ9A 1V1QA 2G5DA 3CCSA 2B2UC 3HS0C 2ZJPA 4LF9L 2WP8J 3AQQA 5KYLA 1PXUA 3DWAA 3D4DA 3SR1A 2D5DA 2LS01 1UE5A 2R6GA 5M3MB 4A3IG 4C3IG 1NCVA 1FNUA 3E5SA 4GOPC 4K0KL 1JT8A 5IP7G 4I7ZC 1HZBA 2EXDA 1RHPA 4HMIA 2I0QA 4KD4A 4X3UA 3W3AA 1PYWD 4H13C 1BXTA 2JA7H 4JI3Q 4RAUC 1GJXA 1XPRA 1VQGA 2RBMA 4AQYL 3E6ZX 1IHZA 3PO3G 3S17H 1A2TA 3V2TA 4DR5Q 2N49A 4LF7Q 1M4VA 4EQNA 1VQMA 4IUUA 1PTOD 1GO3E 2XRQD 3RN5A 5A35A 1PZKD 3ONAB 4DV2L 3NELA 3DXJC 4RCNA 1LT4D 1W2BA 2WAQE 2EY5A 2F0GA 1D2BA 3SHLA 5I9PA 1XNRL 4DR6Q 4N9PA 2YTYA 3ITPA 1J9OA 4C56C 1ZYRC 2XGTA 4H44C 1HRJA 1G291 4TRDA 2ALYB 1M8AA 3H6MA 2KHSA 2CH4W 2OEOA 3SXHA 1VQLA 3KLWA 2PW7A 2AUKA 2NVYB 1GUTA 3L0OA 2XSCA 4HIMA 4QJFA 4DAVA 4TSSA 4A93H 2R3ZA 2VQFL 4DU9A 5EGTA 3F2BA 1KDCA 3MZ5A 4DUZL 3M85A 2E2JH 4BBRH 5I6YA 1CKMA 3T53B 1KXLA 3EROA 3PMFA 3T1YL 2K5VA 3I2ZA 3CQZB 1TWFH 3SEBA 5E1FA 4QF4A 2AHOB 1WYDA 3J7ZC 1TVXA 4PMBA 3GDEA 3S1MB 2HCIA 2QDLA 3L2PA 3U9SA 1XJVA 1KNAA 5ELNA 2F0IA 4DV3Q 1HQMC 1I4PA 4K8JA 2KQ3A 4PZ8A 1M1KC 3TP7A 3RLNA 2BH2A 2B2WC 4A3IB 2HHHQ 1HFGA 3F8TA 4RCOA 4C3IB 2NVTB 4X62Q 2MQHA 1L1OB 4OELB 2M2LA 1HNZL 4QQBX 1Y69U 2VZAA 1Q8IA 4A3JG 1NSNS 4GS3A 3K7AH 1EIHA 1SYFA 4CGYB 4KY5A 3CC4A 5JOBA 2A69D 5BR8Q 4RKLA 1WTXA 1OXXK 2AWOA 3PO3B 3VYRA 1SE4A 1V43A 1A15A 1X65A 4K6DA 2KCTA 3BVGA 2PPBC 3KJPA 2IWHA 4DN4M 5EJWA 4DR1L 4DR4Q 3BZDB 1E0BA 4OONA 4QY7A 4DV5L 3GTOB 3RZDB 4KKTA 1N36Q 2MP1A 2D9UA 2R61A 1JJGA 1RCVD 4OWTB 1SNQA 1XMOL 1EQRA 3PUXA 3NEMA 1J6QA 1T5EA 4C3JB 1TWFB 2IL8A 3HZXA 1ZXTA 5DM73 2LSSA 1TWAB 3BZCA 3NTIA 5JVG3 2N78A 1S5FD 1UNSA 4LF9Q 3EVQA 1DOKA 3GV3A 4OWWB 4WJWA 3MEFA 4XTCS 3A54A 3VR6A 2R7ZH 4K0KQ 2RHQB 2A6ED 4TQUS 3S14H 1BR9A 1Y8PB 4QUFA 1HH2P 1I3QH 2A74C 2FJ2A 3OYYA 3VR2A 4IPGA 2OT2A 1F2YA 5IP9H 1Q46A 4JI4L 4IFDI 2VUMH 1ZEQX 1X56A 4AQYQ 2ATWA 2NBFA 3U50C 1HR0W 4BXXG 3C2PA 1KD1C 4KN4C 5C0XH 4P75A 4LUVA 1XTCD 4DV2Q 4ZUJA 4DA2A 1EOTA 1FGBD 3NTHA 2ZM6L 2HDMA 3TZUA 3IRBA 1U4LA 1H9MA 1IBKL 4QL5A 1IYUA 1EU3A 1LABA 4IN3A 5D3DA 4DGZA 3S1RB 3HOUH 4LW1A 1G6ZA 1EY8A 4RGNA 4A3JB 3MC0B 5ELEA 3JAML 4GOPB 5KGUA 2ZTEA 1O7ZA 3S2HB 1SNDA 2B63H 2O2LD 1VDZA 2JP1A 2LMCB 4J15A 2NB0A 2F3IA 4G7ZC 4JK1C 4B3SL 3AFPA 5E4WC 2VQFQ 3GTPH 1P8LA 4DNTB 5J1ZA 1DGSA 4DUZQ 4HJ5A 2VQEL 1EIGA 5IYDH 2F0DA 2PZTA 3PGZA 2F1MA 4EX5A 3HOWG 3GTLH 3I90A 3Q24A 3T1YQ 2EOTA 1WCMH 3CC2A 2B2YA 1STAA 3A74A 3CP0A 4B3ML 3PIOA 1PZID 4R1JA 2XN9C 3EFXD 4M8AA 4OEMB 2JSOA 1YI2A 1HUMA 5CBAE 1NMGA 2NYZD 2E2HB 1D5MC 3TQYA 2WV6D 3R2TA 4PNYA 3D6WA 2QKIC 4RWSC 4P71A 1HCZA 4OWXB 1MJEA 1Q86C 4BY7G 1QZHA 3E0EA 3PQIA 1KC8C 1Z7TA 1HNZQ 3SK5A 3NBIA 2EPBA 4KTAA 1EFWA 5E3FA 1Z47A 3MFGA 1GOZA 5IGGA 2F0PA 3M4OB 2KJXA 4NXML 1SYBA 4LF4L 1STYA 3DEOA 4KHZA 1NE3A 3PUWA 2GA4B 2K1BA 4DR1Q 3I4LA 2XTIA 1EL0A 4DV5Q 1TWHH 3FVQA 2ASBA 3BG3A 3S1NH 1F9PA 3AU7A 1XMOQ 1C0AA 4O1NA 4A3FG 4HCSA 4A3GG 1X3QA 2JA5G 1I4XA 1SEBD 5K5PA 3C1EA 3J81L 3T4AC 1QCBD 1ILQA 2Q2HA 2A69C 1X3FA 1WTHA 3HOZH 4FNFA 5CMDA 3PO2B 1YITA 4HMJA 2OCEA 4A3DG 3KLRA 4R4QA 2PCFB 2Z0SA 1O80A 1DXMA 4F88A 3L9AX 2K5QA 3VYSA 4X64L 1QZGA 4XIGS 1R9TB 1PH6A 1BBXC 1D5ZC 2E2IH 3HOWB 3AFQA 1SROA 3ULPA 4JI4Q 3GTKB 1L1OA 4FXGC 2WB1G 3S15H 3K5OA 2IX3A 4AYBE 5CYUA 4C2MB 3KYHC 4X3KA 1G2TA 2Z9HA 5JPMC 3PUVA 3U58A 1B3AA 1UE6A 5BN4A 3K58A 3HOYH 4LF6L 2EYOA 1C9OA 4DXGA 1HFNA 2ZM6Q 2RDHA 1XXGA 5C3XA 2UUAL 2K5DA 1SJED 1EYDA 1IYJB 1XWEA 4RMFA 1EY6A 2CVRA 4BY7B 2AUJD 2C5CA 5IYCH 5IT9E 2F0QA 1SDFA 4ZRZA 1YNNC 4A4IA 4E6IA 1FVIA 1LT6D 3CCRA 4CDCC 3CHBD 2IPKD 5M5WB 1G51A 5M5XH 1E2VA 4R4CA 2X6LA 4B3SQ 2I5HA 1A3VA 5J3BA 3E0JA 4LF8L 1MSGA 1OXVA 5BN5A 4KY6A 4X6AH 1F77A 2VQEQ 1U4RA 4V190 2Z4HA 4GKJL 1MGSA 1F2LA 5IE8A 3LGJA 3F2CA 4UP7A 3VYUA 4CKBA 2K01A 1X3GA 1KDBA 3NXWA 2V4DA 4HIKA 2EZVA 4B3MQ 3M7GA 4A3FB 1SNCA 4A3GB 2JA5B 1IZ6A 3KF6B 4KHPL 2P5ZX 1D6EC 1W6KA 1TIID 4QGUA 5F2DA 5JEAH 4BY1B 1KIXA 2CFMA 1LTGD 4HIDA 5M3FH 3G48A 1VQCA 1ESRA 3KF8B 4RHRA 1HTLD 3CF5A 1PH1A 4C3HG 5L37A 4N8X1 5GQOA 3J80i 1WI5A 1EQQA 2F0MA 3KDFB 3VA7A 4GLAC 2QCPX 2XWJB 1H9SB 1LT3D 2A8VA 4X66L 2N55A 4HAEA 2B2UA 1VQHA 5C3EG 1VQFA 2CQOA 1Y1WH 3LX0A 3CMEA 4NXMQ 4LF4Q 1GM5A 4OGQC 4GOPA 1OO9B 2HUGA 2A1AA 3H0GH 4QMGA 1HPCA 2X69A 1PH9A 1PH7A 2VS1A 1WTVA 5DEHA 4J8QA 3T16A 1BCPF 1EQTA 5I2YA 2JA8H 1SYCA 1BCPB 4K5WA 4X3SA 3LWUA 4WJ4A 3CMAA 1GHKA 3TP6A 4RGOS 3EA6A 3MA2B 3DUZA 4LNQA 5A2QE 1LTTD 3G71A 4AIMA 5T1IA 2QGQA 3DEPA 4PQXA 3DWPA 5IT9c 2ZT9C 3DWQA 5JVH3 1RJTA 1XMQL 4DXFA 4X64Q 1C4QA 1VQIA 3CPWA 2KUMA 3HGBA 3QB3A 4FF4A 4DNIA 4IUTA 3MXNB 4A3CG 2ZXRA 2NN6I 5IGFA 5IGBA 2PMZB 5FKAC 1JOQA 5M3MH 2CQAA 3G6EA 3FKIG 1QVCA 4GN3B 4BA2I 1QG7A 3VR4A 4K2KA 2QILA 3J7AF 2YV5A 5E7NA 5D65A 2EYHA 3GTMB 2Q2UA 1J5EL 4LF6Q 3UDIA 2L15A 2K04A 1E24A 1XPOA 4C3HB 5IYBH 4CDFC 1Z9FA 1MIUA 4KKSA 1QVFA 1TS4A 1LM0A 1DOLA 4Q0FA 3GQBA 5CBEE 3HKZG 4UPAA 4GNXC 1YNJC 2E75C 3S16B 1L0YB 2F0VA 5C3EB 1SXTA 4CJ1B 1WJJA 2B2WA 2PMZE 4LF8Q 1SLJA 3MXUA 3DM3A 3R2IA 4RA8A 1ENCA 2OQ0A 4L5RC 2NVYH 1R4QB 5FK9C 2EJGC 3A8JE 3TBIB 2F0NA 1JR0D 2C35B 2EY2A 1LUZA 2F0EA 2L12A 1YJWA 1WD1A 4HJAA 1VQJA 4KHPQ 5DLQE 2E8GA 2XNAC 4DR7L 3PSIA 3QIAA 2RCNA 3C1FA 5EAYA 4K6LA 4B9WA 2C9OA 1WTRA 3CQZH 3VA5A 4DF7A 3KLSX 4DV7L 1GHJA 1CQVA 4LUZA 4GKKL 2UU9Q 4OX9L 3K6OA 3S1MH 5C0XJ 3K81C 4P72A 3QO2A 4IUQA 1BQQT 1H9KA 1B9MA 1VQOA 4DFAA 4LFCL 1SSOA 3J7YW 3SK6A 5KNBA 2WINB 3H3VH 2IW3A 2F0OA 1Q82C 3K80C 4LMQD 4X66Q 1PFNA 4LWCA 2G9DA 3HG9A 1TY0A 4RGTA 4A3IH 1PYSB 3FKIB 4C3IH 3NTKA 2NVTH 5KEEA 2F0SA 2K5NA 5IP7H 3NENA 1CSPA 3IKJA 1SE8A 4AH6A 2A6HC 2EXZA 2WACA 3CCUA 1ET6A 3X3NA 1G8ZD 5C5MA 4DAYA 2RA4A 1V8QA 1B3QA 4TKOB 5KNCA 2PW5A 4A3LH 1V1OA 2EVBA 5GROA 3PO3H 1KRTA 1L0WA 1BCPD 1JB3A 1TKWB 2KBNA 1K0SA
chains in the Genus database with same CATH topology
5IYCG 3I4MG 1IBKL 3GTOH 4QL5A 3RZDH 4O0AA 1KQSA 4JG2A 1IBMQ 2OTJA 2YYZA 1I94L 1VQ5A 3KFUA 2R93G 3HOUH 4LW1A 1HNXL 3STBD 4DR2Q 3KF6A 4POGA 4C3JH 1O7IA 3JAMi 5LMNQ 4GOPB 4PMWA 1OXTA 2ZTEA 1TWAH 1XMQQ 2B63H 4IOAA 3EBEA 2UUBL 3U4VA 4J15A 1LTLA 5FLXc 1M90C 2F3IA 4DV0L 1K0RA 3AFPA 2KHJA 2B3GA 2VQFQ 4B3SL 4JI0L 2IX1A 2UXDQ 1E1OA 1XNQL 1V9PA 3KJOA 1P8LA 1HR0L 2UUAQ 3GTPH 1DGSA 1YNXA 4JI8Q 4DUZQ 4HJ5A 1VQ4A 2VQEL 3J81c 2ZM6L 2CCZA 5IYDH 3PGZA 4A3CH 2D62A 3Q8DA 1SN8A 3W5OA 4EX5A 1N34L 1A0IA 4A3KG 3GTLH 3HOWG 4YCWA 1EYGA 3T1YQ 1U5KA 3CAMA 2JEAI 2ZJRA 3EIVA 1WCMH 3CC2A 1HJPA 1YZ6A 3FKIH 3A74A 3CCLA 3S1QH 3PUYA 5C4XG 1J5EQ 1NMFA 4Y52H 3CP0A 4DV6L 4B3ML 3PIOA 1Q1EA 4DAYB 1E7ZA 5JEAG 4R1JA 1HZCA 3CW2C 4YWKA 4JBKA 5M3FG 1PH2A 2YTVA 3OTOQ 1YI2A 1YEZA 1NMGA 3ULLA 1CKNB 2VL6A 3TQYA 1VS0A 2JE6I 2LXJA 1K3RA 4JV5L 2EIFA 4GKJQ 1IL2A 4LFBL 1VCIA 2PQAA 4P71A 4OWXB 1MJEA 2Y0SE 1MJCA 1Q86C 2A19A 1QZHA 3E0EA 4BY7G 3HOXH 4GN4B 3VDYA 4JI2Q 1KC8C 1HNZQ 1VQ8A 3STBC 4X65Q 2YU9H 3H15A 1Y1WG 4YCVA 1EFWA 1HZ9A 1NY4A 3S1RH 3T1HL 4GLVB 2UUCQ 3GD7A 1HNWL 2JA7G 1Z47A 3BZKA 2ES2A 4A3JH 1FL0A 4DR3L 2RHSB 4B3RL 3H0GG 2UU9L 2HT1A 3TRZA 4JYAQ 1CUKA 4O2DA 4DV4Q 4JI6L 4NXML 1CKOA 4JI3L 3S2HH 3I55A 4LF4L 4WJ3M 4KHZA 1NE3A 3PUWA 2UXBL 4DR1Q 2NZHA 2XTIA 4R4OA 1X6OA 3SGIA 3F1ZA 4DV5Q 3L7ZC 4GLXA 1TWHH 4DR5L 2JA8G 4LF7L 3I4NH 2K4KA 2D0OA 2ASBA 3S1NH 1VQ9A 1VQBA 1I50H 4IPDA 4DK6C 1XMOQ 2Q2TA 4DR7Q 1C0AA 1K8GA 2EQSA 5IP9G 4A3FG 2N3SA 4P73A 2CWAA 5IWAQ 2OWOA 4A3GG 1S40A 1QVGA 4Y7NH 4HJ9A 2JA5G 1I5FA 1Y14B 3S2DH 5JJKA 4ME3A 4DV7Q 4OXPA 1B8AA 1PYBA 4GKKQ 3J81i 3PF4A 4OX9Q 4POFA 2MO0A 2Q2HA 2JQOA 3HFZB 1JE5A 4IJHA 4GNXB 3PF5A 4DR6L 2R92G 1N8RC 1Q81C 2WFWA 1PH5A 4A3LG 4A3EH 1X3FA 1PHJA 3HOZH 5C0XG 4JI7Q 3W1GA 4LFCQ 1N32L 2B29A 2PQAB 1YITA 1Q8KA 2OCEA 4R4TA 4YHHQ 1JMCA 2E2HH 4A3DG 4R4QA 1Q12A 2MO1A 3GO5A 2Z0SA 4FDBA 4L5TA 1E1TA 5IY0A 1TWCH 5AJ3L 4A93G 1BKBA 1L1OC 4H02A 4UP8A 3I4OA 4YY3L 4APVA 4X64L 5M3MG 4BBRG 4XIGS 1QZGA 4A3BH 3W1BA 1PH6A 2E2IH 3AFQA 2OTLA 1SROA 4UP9A 3ULPA 4JI4Q 1XNRQ 3M9BA 2YTXA 4YWMA 3JC66 1L1OA 3DLLA 1H95A 2WB1G 3S15H 2K52A 2B63G 4AYBE 2F4VQ 3KYHC 2KENA 2LXKA 3PUVA 3U58A 2ZJQA 1UE6A 4A75A 1VQ6A 3HOYH 2ID0A 4LF6L 5IYBG 1BBUA 1D8LA 3M4OH 1SFOH 1PA6A 2ZTCA 1OXSC 3J81j 4BXXH 1C9OA 1KHIA 3K7UC 4DV1L 5IYDG 4HJ8A 4IFDJ 3UE1A 2ZM6Q 1IBLL 1QUQB 1YBYA 2VY3A 4UY8C 1AE3A 4DV3L 3K8AA 1KRSA 4IJLA 3RLOA 1G6PA 2UUAL 4A3MH 1IYJB 1Q1BA 4RMFA 5HGQA 5K36G 3PV0A 1Y1VG 1YHBA 2GVBA 3GTJH 1I94Q 5IYCH 3I4MH 1HNXQ 2HQLA 1B70B 4A4IA 3KDFA 2HHHL 4X62L 1FVIA 2F52A 2IX0A 3H3VI 3CCRA 2JA9A 3PIPA 1EOVA 1OTCA 2OQKA 1PH4A 3OW2A 2R93H 4TVAB 1L2FA 1X54A 2MNAA 1B7YB 3M4PA 1VQPA 2UUBQ 1SR3A 1G51A 2H5XA 5M5XH 4R4CA 1WFQA 3KOJA 3J7A5 4DV0Q 4YCUA 4B3SQ 2I5HA 1N9WA 1NBWA 5J3BA 1YHAA 4JI5L 2R7DA 3HKZE 4QIWE 3RR5A 2N8NA 3U4ZA 1OXVA 1ASYA 2NVXH 1K83H 1HR0Q 4LF8L 1XNQQ 3PO2H 5BR8L 1GD7A 4B3TL 4X6AH 1TWGH 2VQEQ 1VQKA 4JBWA 4DUZL 1N34Q 4GKJL 3GTGH 4NXNL 4JBJA 3TEHB 5IE8A 2VNUD 3LGJA 1EWIA 3F2CA 4UP7A 5LMUL 5GAGC 3M3YH 3RZOH 2AKWB 1NTGA 4DR4L 3TREA 5GAEC 1X3GA 1R9TH 3RNUA 4HIKA 3HOWH 4DV6Q 2E5LL 3BU2A 4NB3A 4A3KH 1EIFA 1YJNA 1N36L 1K8AC 4BA1I 4B3MQ 3ICEA 1AH9A 1X3EA 1IZ6A 1UE1A 5C0XI 3KF6B 3PUZA 3UDGA 1VQEA 2BH8A 2NN6G 3S24A 1S72A 3GTKH 4KHPL 3K0XA 3UE0A 5C4XH 2Y0SG 2AMCB 3CC7A 3HOVG 4QGUA 3TS2A 4IPHA 1E3PA 1VQNA 3HKSA 5C44G 1SRUA 2CFMA 4C2MH 4HIDA 1KIXA 1LYLA 4PG3A 3G48A 5M3FH 1N33L 4BBSG 1VQCA 2IHFA 2I5LX 4JV5Q 3G4SA 3KF8B 4MTNA 3TS0A 4A76A 4MZ9A 4LFAL 4LFBQ 3CF5A 1PH1A 1V1QA 1C7YA 1FGUA 3NBHB 2D0PA 3CCSA 3CD6A 4OO1G 5GQOA 4RG1A 3CXCA 2ZJPA 2WP8J 3AQQA 3J80i 1EIYB 1WI5A 4LF9L 2R7ZG 1EQQA 2JEBI 2V1CC 3KDFB 1UE5A 2R6GA 1EUJA 4A3IG 4GLAC 4YWLA 4GOPC 4BY7H 4K0KL 1JT8A 3T1HQ 5IP7G 2A8VA 5ELOA 4X66L 1HNWQ 2JA6G 1HZBA 1GKHA 2EXDA 5HY6A 1VQHA 1P16A 1UEBA 5C3EG 2I0QA 2VUMG 1VQFA 4DR3Q 4B3RQ 2CQOA 2PNHA 4JI1L 1YJ9A 5FJ8G 1Y1WH 2DGYA 3GTQH 1FJGL 4R4IA 3CMEA 4JI6Q 4L5SA 4NXMQ 3I56A 4JI3Q 2JA7H 2PI2E 4LF4Q 1GM5A 2UXBQ 2QEXA 1XPRA 4GOPA 1VQGA 5M5WH 4DUYL 2A1AA 4AQYL 3H0GH 4LF5L 3PO3G 1PH9A 3S17H 4HJ7A 1PH7A 4DR5Q 2N49A 4LF7Q 1VQMA 2VS1A 1YVCA 4GN5A 1GO3E 3RN5A 3E9HA 2UXCL 2JA8H 3FHWA 1RIPA 4DV2L 3NELA 2DUDA 2VW9A 3M4QA 1W2BA 4WJ4A 3CMAA 2WAQE 5FLMH 3HOUG 4A3FH 1XNRL 4DR6Q 4A3GH 2YTYA 2JA5H 1OXUA 2KHIA 1KL9A 2NVQH 4LNQA 2K14A 3G71A 2XGTA 1IBML 5JJIA 4AIMA 4KI0A 1G291 1N32Q 2QGQA 1T9HA 2ALYB 3ER0A 2MFIA 4DR2L 4BY1H 5IT9c 3J80c 2CKZB 2R92H 1A8VA 1VQLA 1JJCB 3KLWA 3L0OA 5AJ3Q 5LMNL 4HIMA 1K73C 4YY3Q 1CKNA 1XMQL 4X64Q 4QJFA 2AWNA 3I7FA 1VQDA 1VQIA 4AYBG 3CPWA 1Q7YC 3A5ZB 1CSQA 3D0FA 4DNIA 2IT1A 3MXNB 3AEVA 4A93H 4A3CG 2VQFL 2UXDL 2NN6I 1IBKQ 3F2BA 2HIXA 5M5YH 2PI2A 2JK8A 3UDFA 1A62A 1WCMG 2I5MX 4JI8L 4BBRH 5M3MH 3FKIG 3M85A 3G6EA 1YHQA 2E2JH 1QVCA 1CKMA 3A0JA 4GN3B 4BA2I 1KXLA 1AE2A 3T1YL 2K5VA 3I2ZA 4MNOA 2YV5A 5E7NA 1PFSA 1TWFH 2R7FA 3ZJYC 1NJIC 5JEAJ 2Q2UA 4OO1I 5H1SE 1I6HH 1J5EL 2AHOB 1WYDA 3B6YA 1GVPA 2FXQA 3J7ZC 4LF6Q 3PO2G 3GDEA 3UDIA 3L2PA 1XJVA 4KLKA 4DV1Q 2L15A 4JI0Q 3ULJA 4JCVE 1JJ2A 1IBLQ 5ELNA 1E24A 1XPOA 3OTOL 3CCQA 4DV3Q 1RL2A 5IYBH 4IFDG 1VQ7A 1BBWA 3CCVA 1Z9FA 4PZ8A 4DAMA 1MIUA 1M1KC 1QVFA 4PZ6A 1TXYA 1LM0A 3RLNA 2BH2A 3HOXG 3CCEA 1PH3A 3HKZG 1U0LA 1WOCA 4UPAA 2HHHQ 4GNXC 3F8TA 2IHEA 4X62Q 3CPFA 3WWVA 2MQHA 1Y1VH 1L1OB 4DKAC 4NPSA 4JI2L 5JJLA 1HNZL 4QQBX 2VZAA 4X65L 2BA1A 4A3JG 1IXRA 4GS3A 3K7AH 1KAWA 1WJJA 4JI5Q 1X55A 2KCMA 1PH8A 2UUCL 3CC4A 2PMZE 4LF8Q 4GNXA 1SLJA 2HIVA 3RN2A 5BR8Q 4B3TQ 3DM3A 3F2DA 2NZOA 1OXXK 2AWOA 2K5HA 2RF4A 2OQ0A 1X9NA 1V43A 2NVYH 1X65A 4IPCA 4IOCA 4L5RC 4NXNQ 4PZ7A 4JYAL 2KCTA 4DV4L 3I4NG 3AYHB 1ASZA 1UE7A 3CCMA 3KJPA 5LMUQ 3ERSX 4DR1L 4DR4Q 2C35B 1VQAA 4OONA 4DV5L 4QY7A 1LUZA 2E5LQ 1D7QA 1N36Q 4DK3C 4IO9A 3JAMc 1YJWA 1XPUA 4HJAA 1JJGA 1VQJA 2K50A 4KHPQ 4OWTB 5DLQE 2E8GA 1XMOL 1EQRA 4DR7L 3PUXA 3EN2A 3PSIA 3NEMA 1J6QA 2RCNA 5IWAL 5EAYA 3FP9A 3CQZH 1N33Q 5LMNW 1MKHA 4DV7L 4A3EG 1PV4A 3GTMH 3HOZG 2LSSA 4LUZA 3HOVH 4GKKL 2UU9Q 3BZCA 4LFAQ 1BVSA 5GAHC 4OX9L 3CCJA 2N78A 3D31A 5C44H 3S1MH 5C0XJ 4BBSH 4LF9Q 1UWVA 3K81C 4P72A 4ALPA 4JI7L 2CWPA 1E22A 1W3SA 1VQOA 4LFCL 4OWWB 4C3HH 1SMXA 4YHHL 3H3VH 4EQ5A 3MEFA 4XTCS 4A3BG 4HIOA 1QUQA 1Q82C 4DPGA 2R7ZH 5FLMG 3K80C 4JBMA 4K0KQ 2RHQB 4TQUS 3S14H 4X66Q 1A63A 2GN5A 2BA0A 4LWCA 4A3IH 1PYSB 1HH2P 1I3QH 1K9MC 4C3IH 2NVTH 4JI1Q 3S16H 3OYYA 2K5NA 1FJGQ 5IP7H 4IPGA 4JOIC 3M7NA 2Z6KC 3NENA 4P74A 5IP9H 1CSPA 2JA6H 4BY1G 1Q46A 2QA4A 4JI4L 1HZAA 5C3EH 4IFDI 2VUMH 1SE8A 2GVAA 4AH6A 1XTDA 1X56A 4DUYQ 4AQYQ 2ATWA 4LF5Q 5FJ8H 3HOYG 3CCUA 2ZTDA 2K75A 2WAQG 3U50C 3A5UA 1HR0W 2F4VL 4BXXG 4LUOA 3RLFA 1JB7A 3UDXA 1KD1C 4A3LH 3PCOB 2JJQA 3E9IA 5GADC 4JOIA 5GROA 3PO3H 2UXCQ 2Z6KA 1S3OA 1KRTA 5C4JH 1YIJA 1PVOA 2IY5B 4P75A 4LUVA 4JC0A 1L0WA 4A3MG 4DV2Q 4L5QA 4A3DH 2KBNA 2Q2IA 3BJUA 3IRBA 2WB1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC G;  3I4M G;  1IBK L;  3GTO H;  4QL5 A;  3RZD H;  4O0A A;  1KQS A;  4JG2 A;  1IBM Q;  2OTJ A;  2YYZ A;  1I94 L;  1VQ5 A;  3KFU A;  2R93 G;  3HOU H;  4LW1 A;  1HNX L;  3STB D;  4DR2 Q;  3KF6 A;  4POG A;  4C3J H;  1O7I A;  3JAM i;  5LMN Q;  4GOP B;  4PMW A;  1OXT A;  2ZTE A;  1TWA H;  1XMQ Q;  2B63 H;  4IOA A;  3EBE A;  2UUB L;  3U4V A;  4J15 A;  1LTL A;  5FLX c;  1M90 C;  2F3I A;  4DV0 L;  1K0R A;  3AFP A;  2KHJ A;  2B3G A;  2VQF Q;  4B3S L;  4JI0 L;  2IX1 A;  2UXD Q;  1E1O A;  1XNQ L;  1V9P A;  3KJO A;  1P8L A;  1HR0 L;  2UUA Q;  3GTP H;  1DGS A;  1YNX A;  4JI8 Q;  4DUZ Q;  4HJ5 A;  1VQ4 A;  2VQE L;  3J81 c;  2ZM6 L;  2CCZ A;  5IYD H;  3PGZ A;  4A3C H;  2D62 A;  3Q8D A;  1SN8 A;  3W5O A;  4EX5 A;  1N34 L;  1A0I A;  4A3K G;  3GTL H;  3HOW G;  4YCW A;  1EYG A;  3T1Y Q;  1U5K A;  3CAM A;  2JEA I;  2ZJR A;  3EIV A;  1WCM H;  3CC2 A;  1HJP A;  1YZ6 A;  3FKI H;  3A74 A;  3CCL A;  3S1Q H;  3PUY A;  5C4X G;  1J5E Q;  1NMF A;  4Y52 H;  3CP0 A;  4DV6 L;  4B3M L;  3PIO A;  1Q1E A;  4DAY B;  1E7Z A;  5JEA G;  4R1J A;  1HZC A;  3CW2 C;  4YWK A;  4JBK A;  5M3F G;  1PH2 A;  2YTV A;  3OTO Q;  1YI2 A;  1YEZ A;  1NMG A;  3ULL A;  1CKN B;  2VL6 A;  3TQY A;  1VS0 A;  2JE6 I;  2LXJ A;  1K3R A;  4JV5 L;  2EIF A;  4GKJ Q;  1IL2 A;  4LFB L;  1VCI A;  2PQA A;  4P71 A;  4OWX B;  1MJE A;  2Y0S E;  1MJC A;  1Q86 C;  2A19 A;  1QZH A;  3E0E A;  4BY7 G;  3HOX H;  4GN4 B;  3VDY A;  4JI2 Q;  1KC8 C;  1HNZ Q;  1VQ8 A;  3STB C;  4X65 Q;  2YU9 H;  3H15 A;  1Y1W G;  4YCV A;  1EFW A;  1HZ9 A;  1NY4 A;  3S1R H;  3T1H L;  4GLV B;  2UUC Q;  3GD7 A;  1HNW L;  2JA7 G;  1Z47 A;  3BZK A;  2ES2 A;  4A3J H;  1FL0 A;  4DR3 L;  2RHS B;  4B3R L;  3H0G G;  2UU9 L;  2HT1 A;  3TRZ A;  4JYA Q;  1CUK A;  4O2D A;  4DV4 Q;  4JI6 L;  4NXM L;  1CKO A;  4JI3 L;  3S2H H;  3I55 A;  4LF4 L;  4WJ3 M;  4KHZ A;  1NE3 A;  3PUW A;  2UXB L;  4DR1 Q;  2NZH A;  2XTI A;  4R4O A;  1X6O A;  3SGI A;  3F1Z A;  4DV5 Q;  3L7Z C;  4GLX A;  1TWH H;  4DR5 L;  2JA8 G;  4LF7 L;  3I4N H;  2K4K A;  2D0O A;  2ASB A;  3S1N H;  1VQ9 A;  1VQB A;  1I50 H;  4IPD A;  4DK6 C;  1XMO Q;  2Q2T A;  4DR7 Q;  1C0A A;  1K8G A;  2EQS A;  5IP9 G;  4A3F G;  2N3S A;  4P73 A;  2CWA A;  5IWA Q;  2OWO A;  4A3G G;  1S40 A;  1QVG A;  4Y7N H;  4HJ9 A;  2JA5 G;  1I5F A;  1Y14 B;  3S2D H;  5JJK A;  4ME3 A;  4DV7 Q;  4OXP A;  1B8A A;  1PYB A;  4GKK Q;  3J81 i;  3PF4 A;  4OX9 Q;  4POF A;  2MO0 A;  2Q2H A;  2JQO A;  3HFZ B;  1JE5 A;  4IJH A;  4GNX B;  3PF5 A;  4DR6 L;  2R92 G;  1N8R C;  1Q81 C;  2WFW A;  1PH5 A;  4A3L G;  4A3E H;  1X3F A;  1PHJ A;  3HOZ H;  5C0X G;  4JI7 Q;  3W1G A;  4LFC Q;  1N32 L;  2B29 A;  2PQA B;  1YIT A;  1Q8K A;  2OCE A;  4R4T A;  4YHH Q;  1JMC A;  2E2H H;  4A3D G;  4R4Q A;  1Q12 A;  2MO1 A;  3GO5 A;  2Z0S A;  4FDB A;  4L5T A;  1E1T A;  5IY0 A;  1TWC H;  5AJ3 L;  4A93 G;  1BKB A;  1L1O C;  4H02 A;  4UP8 A;  3I4O A;  4YY3 L;  4APV A;  4X64 L;  5M3M G;  4BBR G;  4XIG S;  1QZG A;  4A3B H;  3W1B A;  1PH6 A;  2E2I H;  3AFQ A;  2OTL A;  1SRO A;  4UP9 A;  3ULP A;  4JI4 Q;  1XNR Q;  3M9B A;  2YTX A;  4YWM A;  3JC6 6;  1L1O A;  3DLL A;  1H95 A;  2WB1 G;  3S15 H;  2K52 A;  2B63 G;  4AYB E;  2F4V Q;  3KYH C;  2KEN A;  2LXK A;  3PUV A;  3U58 A;  2ZJQ A;  1UE6 A;  4A75 A;  1VQ6 A;  3HOY H;  2ID0 A;  4LF6 L;  5IYB G;  1BBU A;  1D8L A;  3M4O H;  1SFO H;  1PA6 A;  2ZTC A;  1OXS C;  3J81 j;  4BXX H;  1C9O A;  1KHI A;  3K7U C;  4DV1 L;  5IYD G;  4HJ8 A;  4IFD J;  3UE1 A;  2ZM6 Q;  1IBL L;  1QUQ B;  1YBY A;  2VY3 A;  4UY8 C;  1AE3 A;  4DV3 L;  3K8A A;  1KRS A;  4IJL A;  3RLO A;  1G6P A;  2UUA L;  4A3M H;  1IYJ B;  1Q1B A;  4RMF A;  5HGQ A;  5K36 G;  3PV0 A;  1Y1V G;  1YHB A;  2GVB A;  3GTJ H;  1I94 Q;  5IYC H;  3I4M H;  1HNX Q;  2HQL A;  1B70 B;  4A4I A;  3KDF A;  2HHH L;  4X62 L;  1FVI A;  2F52 A;  2IX0 A;  3H3V I;  3CCR A;  2JA9 A;  3PIP A;  1EOV A;  1OTC A;  2OQK A;  1PH4 A;  3OW2 A;  2R93 H;  4TVA B;  1L2F A;  1X54 A;  2MNA A;  1B7Y B;  3M4P A;  1VQP A;  2UUB Q;  1SR3 A;  1G51 A;  2H5X A;  5M5X H;  4R4C A;  1WFQ A;  3KOJ A;  3J7A 5;  4DV0 Q;  4YCU A;  4B3S Q;  2I5H A;  1N9W A;  1NBW A;  5J3B A;  1YHA A;  4JI5 L;  2R7D A;  3HKZ E;  4QIW E;  3RR5 A;  2N8N A;  3U4Z A;  1OXV A;  1ASY A;  2NVX H;  1K83 H;  1HR0 Q;  4LF8 L;  1XNQ Q;  3PO2 H;  5BR8 L;  1GD7 A;  4B3T L;  4X6A H;  1TWG H;  2VQE Q;  1VQK A;  4JBW A;  4DUZ L;  1N34 Q;  4GKJ L;  3GTG H;  4NXN L;  4JBJ A;  3TEH B;  5IE8 A;  2VNU D;  3LGJ A;  1EWI A;  3F2C A;  4UP7 A;  5LMU L;  5GAG C;  3M3Y H;  3RZO H;  2AKW B;  1NTG A;  4DR4 L;  3TRE A;  5GAE C;  1X3G A;  1R9T H;  3RNU A;  4HIK A;  3HOW H;  4DV6 Q;  2E5L L;  3BU2 A;  4NB3 A;  4A3K H;  1EIF A;  1YJN A;  1N36 L;  1K8A C;  4BA1 I;  4B3M Q;  3ICE A;  1AH9 A;  1X3E A;  1IZ6 A;  1UE1 A;  5C0X I;  3KF6 B;  3PUZ A;  3UDG A;  1VQE A;  2BH8 A;  2NN6 G;  3S24 A;  1S72 A;  3GTK H;  4KHP L;  3K0X A;  3UE0 A;  5C4X H;  2Y0S G;  2AMC B;  3CC7 A;  3HOV G;  4QGU A;  3TS2 A;  4IPH A;  1E3P A;  1VQN A;  3HKS A;  5C44 G;  1SRU A;  2CFM A;  4C2M H;  4HID A;  1KIX A;  1LYL A;  4PG3 A;  3G48 A;  5M3F H;  1N33 L;  4BBS G;  1VQC A;  2IHF A;  2I5L X;  4JV5 Q;  3G4S A;  3KF8 B;  4MTN A;  3TS0 A;  4A76 A;  4MZ9 A;  4LFA L;  4LFB Q;  3CF5 A;  1PH1 A;  1V1Q A;  1C7Y A;  1FGU A;  3NBH B;  2D0P A;  3CCS A;  3CD6 A;  4OO1 G;  5GQO A;  4RG1 A;  3CXC A;  2ZJP A;  2WP8 J;  3AQQ A;  3J80 i;  1EIY B;  1WI5 A;  4LF9 L;  2R7Z G;  1EQQ A;  2JEB I;  2V1C C;  3KDF B;  1UE5 A;  2R6G A;  1EUJ A;  4A3I G;  4GLA C;  4YWL A;  4GOP C;  4BY7 H;  4K0K L;  1JT8 A;  3T1H Q;  5IP7 G;  2A8V A;  5ELO A;  4X66 L;  1HNW Q;  2JA6 G;  1HZB A;  1GKH A;  2EXD A;  5HY6 A;  1VQH A;  1P16 A;  1UEB A;  5C3E G;  2I0Q A;  2VUM G;  1VQF A;  4DR3 Q;  4B3R Q;  2CQO A;  2PNH A;  4JI1 L;  1YJ9 A;  5FJ8 G;  1Y1W H;  2DGY A;  3GTQ H;  1FJG L;  4R4I A;  3CME A;  4JI6 Q;  4L5S A;  4NXM Q;  3I56 A;  4JI3 Q;  2JA7 H;  2PI2 E;  4LF4 Q;  1GM5 A;  2UXB Q;  2QEX A;  1XPR A;  4GOP A;  1VQG A;  5M5W H;  4DUY L;  2A1A A;  4AQY L;  3H0G H;  4LF5 L;  3PO3 G;  1PH9 A;  3S17 H;  4HJ7 A;  1PH7 A;  4DR5 Q;  2N49 A;  4LF7 Q;  1VQM A;  2VS1 A;  1YVC A;  4GN5 A;  1GO3 E;  3RN5 A;  3E9H A;  2UXC L;  2JA8 H;  3FHW A;  1RIP A;  4DV2 L;  3NEL A;  2DUD A;  2VW9 A;  3M4Q A;  1W2B A;  4WJ4 A;  3CMA A;  2WAQ E;  5FLM H;  3HOU G;  4A3F H;  1XNR L;  4DR6 Q;  4A3G H;  2YTY A;  2JA5 H;  1OXU A;  2KHI A;  1KL9 A;  2NVQ H;  4LNQ A;  2K14 A;  3G71 A;  2XGT A;  1IBM L;  5JJI A;  4AIM A;  4KI0 A;  1G29 1;  1N32 Q;  2QGQ A;  1T9H A;  2ALY B;  3ER0 A;  2MFI A;  4DR2 L;  4BY1 H;  5IT9 c;  3J80 c;  2CKZ B;  2R92 H;  1A8V A;  1VQL A;  1JJC B;  3KLW A;  3L0O A;  5AJ3 Q;  5LMN L;  4HIM A;  1K73 C;  4YY3 Q;  1CKN A;  1XMQ L;  4X64 Q;  4QJF A;  2AWN A;  3I7F A;  1VQD A;  1VQI A;  4AYB G;  3CPW A;  1Q7Y C;  3A5Z B;  1CSQ A;  3D0F A;  4DNI A;  2IT1 A;  3MXN B;  3AEV A;  4A93 H;  4A3C G;  2VQF L;  2UXD L;  2NN6 I;  1IBK Q;  3F2B A;  2HIX A;  5M5Y H;  2PI2 A;  2JK8 A;  3UDF A;  1A62 A;  1WCM G;  2I5M X;  4JI8 L;  4BBR H;  5M3M H;  3FKI G;  3M85 A;  3G6E A;  1YHQ A;  2E2J H;  1QVC A;  1CKM A;  3A0J A;  4GN3 B;  4BA2 I;  1KXL A;  1AE2 A;  3T1Y L;  2K5V A;  3I2Z A;  4MNO A;  2YV5 A;  5E7N A;  1PFS A;  1TWF H;  2R7F A;  3ZJY C;  1NJI C;  5JEA J;  2Q2U A;  4OO1 I;  5H1S E;  1I6H H;  1J5E L;  2AHO B;  1WYD A;  3B6Y A;  1GVP A;  2FXQ A;  3J7Z C;  4LF6 Q;  3PO2 G;  3GDE A;  3UDI A;  3L2P A;  1XJV A;  4KLK A;  4DV1 Q;  2L15 A;  4JI0 Q;  3ULJ A;  4JCV E;  1JJ2 A;  1IBL Q;  5ELN A;  1E24 A;  1XPO A;  3OTO L;  3CCQ A;  4DV3 Q;  1RL2 A;  5IYB H;  4IFD G;  1VQ7 A;  1BBW A;  3CCV A;  1Z9F A;  4PZ8 A;  4DAM A;  1MIU A;  1M1K C;  1QVF A;  4PZ6 A;  1TXY A;  1LM0 A;  3RLN A;  2BH2 A;  3HOX G;  3CCE A;  1PH3 A;  3HKZ G;  1U0L A;  1WOC A;  4UPA A;  2HHH Q;  4GNX C;  3F8T A;  2IHE A;  4X62 Q;  3CPF A;  3WWV A;  2MQH A;  1Y1V H;  1L1O B;  4DKA C;  4NPS A;  4JI2 L;  5JJL A;  1HNZ L;  4QQB X;  2VZA A;  4X65 L;  2BA1 A;  4A3J G;  1IXR A;  4GS3 A;  3K7A H;  1KAW A;  1WJJ A;  4JI5 Q;  1X55 A;  2KCM A;  1PH8 A;  2UUC L;  3CC4 A;  2PMZ E;  4LF8 Q;  4GNX A;  1SLJ A;  2HIV A;  3RN2 A;  5BR8 Q;  4B3T Q;  3DM3 A;  3F2D A;  2NZO A;  1OXX K;  2AWO A;  2K5H A;  2RF4 A;  2OQ0 A;  1X9N A;  1V43 A;  2NVY H;  1X65 A;  4IPC A;  4IOC A;  4L5R C;  4NXN Q;  4PZ7 A;  4JYA L;  2KCT A;  4DV4 L;  3I4N G;  3AYH B;  1ASZ A;  1UE7 A;  3CCM A;  3KJP A;  5LMU Q;  3ERS X;  4DR1 L;  4DR4 Q;  2C35 B;  1VQA A;  4OON A;  4DV5 L;  4QY7 A;  1LUZ A;  2E5L Q;  1D7Q A;  1N36 Q;  4DK3 C;  4IO9 A;  3JAM c;  1YJW A;  1XPU A;  4HJA A;  1JJG A;  1VQJ A;  2K50 A;  4KHP Q;  4OWT B;  5DLQ E;  2E8G A;  1XMO L;  1EQR A;  4DR7 L;  3PUX A;  3EN2 A;  3PSI A;  3NEM A;  1J6Q A;  2RCN A;  5IWA L;  5EAY A;  3FP9 A;  3CQZ H;  1N33 Q;  5LMN W;  1MKH A;  4DV7 L;  4A3E G;  1PV4 A;  3GTM H;  3HOZ G;  2LSS A;  4LUZ A;  3HOV H;  4GKK L;  2UU9 Q;  3BZC A;  4LFA Q;  1BVS A;  5GAH C;  4OX9 L;  3CCJ A;  2N78 A;  3D31 A;  5C44 H;  3S1M H;  5C0X J;  4BBS H;  4LF9 Q;  1UWV A;  3K81 C;  4P72 A;  4ALP A;  4JI7 L;  2CWP A;  1E22 A;  1W3S A;  1VQO A;  4LFC L;  4OWW B;  4C3H H;  1SMX A;  4YHH L;  3H3V H;  4EQ5 A;  3MEF A;  4XTC S;  4A3B G;  4HIO A;  1QUQ A;  1Q82 C;  4DPG A;  2R7Z H;  5FLM G;  3K80 C;  4JBM A;  4K0K Q;  2RHQ B;  4TQU S;  3S14 H;  4X66 Q;  1A63 A;  2GN5 A;  2BA0 A;  4LWC A;  4A3I H;  1PYS B;  1HH2 P;  1I3Q H;  1K9M C;  4C3I H;  2NVT H;  4JI1 Q;  3S16 H;  3OYY A;  2K5N A;  1FJG Q;  5IP7 H;  4IPG A;  4JOI C;  3M7N A;  2Z6K C;  3NEN A;  4P74 A;  5IP9 H;  1CSP A;  2JA6 H;  4BY1 G;  1Q46 A;  2QA4 A;  4JI4 L;  1HZA A;  5C3E H;  4IFD I;  2VUM H;  1SE8 A;  2GVA A;  4AH6 A;  1XTD A;  1X56 A;  4DUY Q;  4AQY Q;  2ATW A;  4LF5 Q;  5FJ8 H;  3HOY G;  3CCU A;  2ZTD A;  2K75 A;  2WAQ G;  3U50 C;  3A5U A;  1HR0 W;  2F4V L;  4BXX G;  4LUO A;  3RLF A;  1JB7 A;  3UDX A;  1KD1 C;  4A3L H;  3PCO B;  2JJQ A;  3E9I A;  5GAD C;  4JOI A;  5GRO A;  3PO3 H;  2UXC Q;  2Z6K A;  1S3O A;  1KRT A;  5C4J H;  1YIJ A;  1PVO A;  2IY5 B;  4P75 A;  4LUV A;  4JC0 A;  1L0W A;  4A3M G;  4DV2 Q;  4L5Q A;  4A3D H;  2KBN A;  2Q2I A;  3BJU A;  3IRB A;  2WB1 E; 
#chains in the Genus database with same CATH topology
 4G7H C;  4FF3 A;  3HKZ B;  2H1E A;  3GTO H;  3RZD H;  3OWF A;  4RKB A;  1KAB A;  1R4P B;  2O5J C;  3ERQ A;  1O7L A;  3NQT A;  4JG2 A;  2OTJ A;  1I94 L;  2R93 G;  1HNX L;  3KBG A;  2TMP A;  1TY2 A;  2CW0 C;  1SMY C;  3KF6 A;  4C3J H;  1O7I A;  4PMW A;  1IKM A;  1TWA H;  1XMQ Q;  3EBE A;  3U4V A;  5FLX c;  5EKK A;  4ZLT F;  2DNE A;  1D1K A;  2N88 A;  2L0C A;  1SJH D;  1V9P A;  1HR0 L;  1YNX A;  2L11 A;  4DNR B;  1QNK A;  2D62 A;  3Q8D A;  4FXK C;  3TN2 A;  3W5O A;  4A3K G;  1WVL A;  2JEA I;  3CAM A;  3S2D B;  3EIV A;  5CC4 A;  1YZ6 A;  4JVZ A;  3CCL A;  5C4X G;  1H9S A;  1J5E Q;  1NMF A;  1L0X B;  3I70 A;  1Q1E A;  1HZC A;  3KUP A;  3OMC A;  2K03 A;  1ZKO A;  3R8B A;  5IOD A;  5IGC A;  1ONL A;  1CKN B;  5G3L F;  4F87 A;  1K3R A;  4G7O C;  2EIF A;  1CHP D;  1SAP A;  3QOJ A;  4HN7 A;  2A73 B;  4QCL A;  2CHB D;  4UAI A;  3VDY A;  2K33 A;  3STB C;  4K14 A;  3H15 A;  2AQ2 B;  4IUR A;  4KKU A;  3S1R H;  3FDT A;  4A3J H;  1FL0 A;  4B3R L;  1FD7 D;  1STG A;  2HT1 A;  1SFO B;  3S2H H;  5ELC A;  4XYQ A;  4EQP A;  4FP5 D;  5EPL A;  3F1Z A;  3L7Z C;  5COR A;  1DCZ A;  1VQ9 A;  4IPD A;  3QWN A;  4DR7 Q;  3MXN A;  2Q2T A;  5IP9 G;  3H91 A;  2CWA A;  1S40 A;  5JJK A;  4DV7 Q;  2R93 B;  1PYB A;  4GKK Q;  4OX9 Q;  1YNN D;  2JQO A;  4GNX B;  4IJH A;  3PF5 A;  1RD9 D;  2Z1C A;  2R92 G;  1N8R C;  3U9O A;  4DK1 A;  5C0X G;  3A8I E;  1K83 B;  4LFC Q;  1AEX A;  2PQA B;  2E2H H;  2ZXO A;  2M00 A;  3GO5 A;  4FDB A;  4L5T A;  1E1T A;  1BKB A;  4UP8 A;  4YY3 L;  4APV A;  4A3K B;  3MWY W;  5FOB B;  2WKC A;  4QIW B;  5IGE A;  3J7A V;  1XNR Q;  3VR3 A;  1E2Z A;  3AMU A;  5C4X B;  3SK4 A;  4KMU C;  3A56 A;  1I6V C;  2K52 A;  2B63 G;  3E3X A;  4YIJ A;  4A75 A;  1AFP A;  3PIP 3;  1CZG A;  3M4O H;  1Q3L A;  1PA6 A;  1OXS C;  4BXX H;  5IYD G;  1IBL L;  1YBY A;  4UY8 C;  1MBY A;  3K8A A;  1KRS A;  2ENB A;  1EYA A;  5K36 G;  3IFD A;  1Y1V G;  1EYC A;  1I94 Q;  3J80 E;  4DAP A;  1HNX Q;  1ROD A;  3D4W A;  3GTQ B;  1EOV A;  3FPP A;  2OQK A;  1L2F A;  1X54 A;  3M4P A;  1VQP A;  3A7A B;  2F4I A;  1SR3 A;  1Z6H A;  2H5X A;  3J7A 5;  1WFQ A;  4K5X A;  1K73 C;  5EBD A;  4QIW E;  1IKL A;  3PO2 H;  1HR0 Q;  1O7Y A;  4BWG B;  4B3T L;  1BCP C;  4ZKB B;  1D1I A;  1TS5 A;  4IQZ A;  3TP5 A;  4NXN L;  5I9O A;  4IFD H;  2VNU D;  2NUC A;  3P75 A;  2B2V A;  4IUN A;  5LMU L;  4NP5 A;  1R9T H;  4XT1 B;  1FYC A;  3RNU A;  3HOW H;  2G9H D;  5ISR A;  3P7J A;  2A68 D;  1UE1 A;  2NVQ B;  2BH8 A;  4JW0 A;  3GTK H;  4RGM A;  2Y0S G;  3HOV G;  4MIU A;  1BDO A;  3D8G A;  2JXM B;  5LL6 S;  1E3P A;  4HSP A;  2R92 B;  5C44 G;  4HCE A;  4C2M H;  4BBS G;  3GP7 A;  1EY4 A;  5G3L D;  2I5L X;  2O5I C;  3G4S A;  4R9W A;  4LFA L;  1C7Y A;  4NMZ A;  1EWH A;  1FGU A;  2D0P A;  4OO1 G;  4F8M A;  1EIY B;  3CXC A;  4EVO A;  5IT9 L;  3VR5 A;  2V1C C;  1CFM A;  1MSH A;  5M5Y B;  3NPP A;  5KIX A;  3G7L A;  3OW7 A;  5TSS A;  1HXY D;  4BY7 H;  5EKI A;  2JA6 G;  5HY6 A;  2FMM A;  1KLU D;  1I6H B;  3OWE B;  4B3R Q;  5D3I B;  2PNH A;  5FJ8 G;  2DGY A;  1FJG L;  2MJ8 A;  2Z6B A;  4L5S A;  3I56 A;  5M5W H;  5M9O A;  1KDA A;  3TME A;  1GUG A;  3SVM A;  1MD2 D;  3E9H A;  4PMC A;  1DOM A;  4G57 A;  1HA5 A;  5JPN C;  2DUD A;  1Y1V B;  3I73 A;  4G4K A;  2VW9 A;  5FLM H;  3K5N A;  4A3F H;  1YNJ D;  4A3G H;  2AQ1 B;  2JA5 H;  2KHI A;  4MN3 A;  1SBB B;  1IBM L;  3K5L A;  2B2T C;  4ME5 A;  4DR2 L;  4BY1 H;  4HTH A;  2J7Z A;  3J80 c;  1A8V A;  1KNE A;  3W2D A;  4YY3 Q;  1CKN A;  3K59 A;  4ILW A;  3BVM A;  2IT1 A;  1K8O A;  1IBK Q;  2HIX A;  1STB A;  2PI2 A;  3UDF A;  1A62 A;  2I5M X;  3WOF A;  1AZQ A;  1J8I A;  1YHQ A;  3FEW X;  3MTS A;  2F0U A;  4ZQ3 A;  3ZJY C;  1NJI C;  2R7F A;  5ELD A;  2Y0S B;  3HOV B;  3B6Y A;  1IW7 C;  1GVP A;  2FXQ A;  1I4G A;  5C44 B;  4BBS B;  5DAU A;  5ELB A;  4KLK A;  1VMC A;  2VB2 X;  1JJ2 A;  1IBL Q;  2B2V C;  1QB5 D;  3TP8 A;  2EYM A;  1VQ7 A;  1GUW A;  3OIP A;  4PZ6 A;  3HOX G;  3CCE A;  2IHE A;  5A2Q L;  3CPF A;  2B8G A;  2BCO A;  4R8N A;  4EQO A;  1IYV A;  1LTB D;  4JI2 L;  5JJL A;  3G6J B;  2HDL A;  1WTP A;  1XX8 A;  1IXR A;  2M9V A;  1KAW A;  2QEJ C;  2KCM A;  1PH8 A;  4GNX A;  2HIV A;  4B3T Q;  2A6H D;  1G2S A;  2NZO A;  2RF4 A;  5IIF A;  1X9N A;  1U4P A;  4IPC A;  4JPB W;  5C4J B;  4U67 3;  4NXN Q;  3I4N G;  3AYH B;  1PRT C;  5I4D A;  4A3D B;  1UE7 A;  3CCM A;  5LMU Q;  3ERS X;  1DON A;  1VQA A;  3BVZ A;  4OHJ A;  1ICF B;  1GUN A;  1NR4 A;  4DK3 C;  3JAM c;  1XPU A;  2K50 A;  2RQX A;  1JOR A;  3EN2 A;  1HQR D;  1S5B D;  1I4Q A;  5IWA L;  3BYY B;  1F9Q A;  2NTT A;  4A3E G;  1MKH A;  3GTM H;  2WB1 B;  4LFA Q;  5GAH C;  1BVS A;  2WII B;  2CW0 D;  1SMY D;  3NHH A;  3D31 A;  3QR8 A;  3CCJ A;  1VF5 C;  4PV1 C;  4JI7 L;  3KBX A;  1E22 A;  1PTO F;  1W3S A;  1JOK A;  4C3H H;  1SMX A;  4YHH L;  4KD3 A;  4EQ5 A;  1PTO B;  4A3B G;  2DJG C;  4HIO A;  5FLX L;  4JBM A;  1HA6 A;  1LTI D;  5KND A;  3A55 A;  4I65 A;  1MI2 A;  2BA0 A;  2ZXP A;  1EQV A;  2A68 C;  3S1Q B;  1S5E D;  1MHW C;  3S16 H;  1FJG Q;  1K28 A;  1RTO A;  4JOI C;  2Z6K C;  4P74 A;  3IAY A;  3NQI A;  1HZA A;  5C3E H;  2K75 A;  4HED A;  2WAQ G;  2RDF A;  3A5U A;  2OF1 A;  3RLF A;  5IGD A;  3UDX A;  1ESF A;  3PCO B;  2JJQ A;  3E9I A;  1SYD A;  4WJ3 M;  1CQF A;  3DM1 A;  4KHV A;  2EYJ A;  4A3M G;  2DNC A;  3ND8 A;  4U68 A;  3BJU A;  1SNO A;  2WB1 E;  3HOX B;  3I4M G;  4K8I A;  2KOL A;  2YU9 B;  2F0T A;  4O0A A;  3N6R A;  1LTA D;  2BDO A;  1KQS A;  1S5D D;  2DJF C;  1NNX A;  3F2U A;  1IBM Q;  2YYZ A;  3EQL C;  3STB D;  4DR2 Q;  1CT1 D;  3MXG A;  4POG A;  3JAM i;  1LAC A;  1C48 A;  4OIJ A;  4WRD A;  3QOL A;  5IOC A;  4IOA A;  1LTL A;  4IZ8 A;  1CHQ D;  2EYP A;  5J22 A;  2KHJ A;  3H09 A;  2F0K A;  3I4N B;  4N9T A;  1K3B C;  1S4Z A;  1E1O A;  3V05 A;  3KJO A;  2UUA Q;  1X3P A;  1I50 B;  1VQ4 A;  2CCZ A;  3J81 c;  4ZKC B;  4A3C H;  4FYD A;  1SN8 A;  1N34 L;  1A0I A;  3SDZ A;  1GXD C;  4Y7N B;  2L9H A;  2NZ1 D;  2BDN A;  4RHS A;  3CKI B;  3FKI H;  1CZW A;  4X3T A;  4Y52 H;  4DV6 L;  2XWB B;  2LY7 A;  3MXP A;  5FLX E;  5FO9 B;  4ZYS A;  2MHV A;  4JBK A;  4A3E B;  3BYT B;  1Y8N B;  2I07 B;  1SNP A;  4NDX A;  1YEZ A;  1PFM A;  3ULL A;  3K0Y A;  2J4X A;  2JE6 I;  1QE6 A;  1TWC B;  4GKJ Q;  1IL2 A;  4LFB L;  1VCI A;  4A3B B;  3T51 B;  1JC7 A;  4KY7 A;  1EY9 A;  3IL8 A;  3SK8 A;  2RCF A;  4JI2 Q;  1VQ8 A;  1RF2 D;  1QJO A;  1UEA B;  1FNW A;  1LT5 D;  3NE5 B;  1TS3 A;  3ND9 A;  1EFI D;  1HZ9 A;  1V1P B;  2F0J A;  3T1H L;  1HNW L;  3GD7 A;  3OIQ A;  2JA7 G;  3URY A;  4ZK9 B;  3BZK A;  3CRK C;  3RD4 A;  4DR3 L;  2NN6 H;  2E74 C;  1DD2 A;  2WAQ B;  4XT3 B;  3TRZ A;  4ZUI A;  4JI6 L;  2K5W A;  4FXD A;  1CKO A;  5DNF A;  2BOS A;  4IUP A;  2QDB A;  1AZP A;  1B50 A;  2UXB L;  1DZ1 A;  3SGI A;  1A3U A;  1CM9 A;  1UAP A;  4GLX A;  4A3M B;  5AFW A;  2K4K A;  1PMR A;  4C1N K;  4IUV A;  3AB9 A;  2AQ3 B;  4DK6 C;  3GTJ B;  3I4M B;  1K8G A;  1JE4 A;  4H0L C;  1F9R A;  1STE A;  2N3S A;  2Z4I A;  5IWA Q;  1QVG A;  5C5L A;  4HJ9 A;  3S2D H;  1I5F A;  1Y14 B;  5CGK A;  4M1U B;  2HD3 A;  3J81 i;  3PF4 A;  2MO0 A;  3CRL C;  2BE5 D;  1JE5 A;  1BF4 A;  2K7V A;  2WFW A;  4A3L G;  4ODG A;  4LJZ C;  2NVX B;  4JI7 Q;  2Q8R E;  1N32 L;  2B29 A;  1Q8K A;  1TWG B;  4R4T A;  4YHH Q;  1JMC A;  3OSO A;  5AJ3 L;  2JN4 A;  2FFK B;  4A93 G;  5IY0 A;  3GTG B;  4H02 A;  2EYF A;  2H4O A;  4ID6 A;  3I72 A;  3M3Y B;  2F3W A;  4R8I A;  4BBR G;  1BUV T;  1ML0 D;  1PRT F;  3A8K E;  3TSS A;  1AN8 A;  3NP8 A;  2OTL A;  4UP9 A;  1PRT B;  4MHE A;  4C3J G;  3M9B A;  2YTX A;  3L3O C;  3JC6 6;  4CJ2 C;  3DLL A;  1H95 A;  2XRS D;  2HQE A;  1KAA A;  5JJZ A;  5LL6 X;  1O78 A;  1BBU A;  1SFO H;  2ZTC A;  4QUC A;  3J81 j;  4XDX A;  4B9X A;  4KJN A;  4DV1 L;  4HJ8 A;  4IFD J;  3UE1 A;  1QUQ B;  1PDQ A;  2VXW A;  2KCN A;  4IJL A;  3KF8 A;  3T56 B;  4Z9C B;  1G6P A;  1Q90 A;  1Q1B A;  1JQY D;  5HGQ A;  2HCC A;  3PV0 A;  3P20 A;  3HP3 A;  2MPM A;  1A6X A;  1B70 B;  3KDF A;  2RVL A;  2F52 A;  1B4O A;  5EPK A;  2JA9 A;  3PIP A;  1WTO A;  1PH4 A;  2R93 H;  4TVA B;  2JA7 B;  2MNA A;  1B7Y B;  3OMG A;  4WOR A;  4KN7 C;  3P1H A;  1GUO A;  3KOJ A;  5C6A A;  4YCU A;  4JI5 L;  1NBW A;  1BO0 A;  3S17 B;  2R7D A;  3HKZ E;  3QJY A;  3RR5 A;  2N8N A;  1ASY A;  2EY6 A;  1ET9 A;  1FR3 A;  1K83 H;  2RSO A;  1ILP A;  4CJ0 B;  1GD7 A;  1UUP A;  3MHB A;  1VMP A;  1N34 Q;  2OXP A;  3MAQ A;  4JBJ A;  1GUS A;  1EWI A;  5BN3 A;  5GAG C;  3RZO H;  1NTG A;  4L63 B;  5NUC A;  4DV6 Q;  2E5L L;  4A3K H;  4NB3 A;  1EIF A;  1YJN A;  1AH9 A;  4BA1 I;  1X3E A;  5C0X I;  3OHX C;  3PUZ A;  3UDG A;  1VQE A;  1DJR D;  5T1G A;  5CV6 A;  2EY1 A;  2B8F A;  1F2M A;  5C4X H;  3CC7 A;  1JWS D;  3K57 A;  1VQN A;  3HKS A;  1N33 L;  4PG3 A;  3NK9 A;  5LHY 1;  2MUY A;  2IHF A;  3H94 A;  1STN A;  2EDG A;  4MTN A;  4LFB Q;  1AP0 A;  3NBH B;  3CD6 A;  4A93 B;  4RG1 A;  4LAA A;  3J80 L;  1EEF D;  2R7Z G;  2JEB I;  4MTK A;  5FO8 B;  2E2J B;  1EUJ A;  1II3 A;  4BBR B;  5KRU A;  4YWL A;  1EU4 A;  1VF7 A;  4NW2 A;  3T1H Q;  1HNW Q;  5ELO A;  4ULL A;  1GKH A;  1PZJ D;  2RKS A;  1P16 A;  1UEB A;  2VUM G;  4DR3 Q;  5COY A;  5CV5 A;  4UDU C;  4JI1 L;  1YJ9 A;  3C3L A;  3GTQ H;  3RUZ A;  4L8J A;  4R4I A;  4JI6 Q;  1HTP A;  3TDQ A;  2PI2 E;  1H9J A;  2ICI A;  1B53 A;  2UXB Q;  2QEX A;  3HRZ C;  4DUY L;  1CK1 A;  2PO4 A;  1IW7 D;  3EJI A;  4LF5 L;  3FRP B;  1B2T A;  4CBV A;  4HJ7 A;  4P2C B;  1YVC A;  1S5C D;  4GN5 A;  2L5T A;  1SE2 A;  2B39 A;  2PNR C;  2UXC L;  2EE1 A;  3FHW A;  1RIP A;  1TS2 A;  1U4M A;  2L55 A;  3RZO B;  2Z8L A;  3M4Q A;  1HHV A;  3FMC A;  3HOU G;  1QNU A;  5D14 A;  4B08 A;  2DY7 A;  1OXU A;  3K7A B;  4FVM A;  1KL9 A;  2NVQ H;  2K14 A;  1WD0 A;  5JJI A;  4Q5V A;  1EY5 A;  4KI0 A;  1N32 Q;  1T9H A;  3ER0 A;  2MFI A;  4CKC A;  2F0F A;  2CKZ B;  4CKE A;  2R92 H;  1JJC B;  5AJ3 Q;  5LMN L;  3BDL A;  3BS1 A;  3SE0 A;  1NUC A;  4AYB G;  2AWN A;  2LFN A;  1VQD A;  3I7F A;  1Q7Y C;  5FO7 B;  3A5Z B;  1CSQ A;  3D0F A;  2PZW A;  1BNZ A;  1EZ6 A;  1WTW A;  2F0L A;  3AEV A;  4BS9 A;  2UXD L;  2B2T A;  1PRT D;  1STH A;  5JAV A;  5M5Y H;  2MGS A;  2JK8 A;  1TQO A;  1WCM G;  4JI8 L;  2K6A A;  1RKN A;  3A0J A;  4KJO A;  1AE2 A;  2EJM A;  4MNO A;  4ABN A;  2BE5 C;  1PFS A;  5JEA J;  2K28 A;  4OO1 I;  5H1S E;  1I6H H;  3KLS A;  1V1P A;  1X32 A;  3PO2 G;  1LTR D;  4DV1 Q;  2PQE A;  4JCV E;  3ULJ A;  1PTO C;  2CH4 A;  3OTO L;  3CCQ A;  1RL2 A;  1T5X D;  4IFD G;  1BBW A;  3CCV A;  4DAM A;  1D5X C;  1B9N A;  1TXY A;  2R7Z B;  3M4Y A;  1SYG A;  3S14 B;  1PH3 A;  1U0L A;  1WOC A;  3QG1 A;  1I3Q B;  1EWC A;  3C46 A;  2KED A;  5K36 H;  3WWV A;  2Q8I B;  1Y1V H;  4DKA C;  3HEJ A;  2A5H A;  3WOE A;  4NPS A;  2VUM B;  4X65 L;  2BA1 A;  1ENA A;  4CHT B;  4JI5 Q;  1X55 A;  2UUC L;  3RN2 A;  3F2D A;  2K5H A;  3TZD A;  1F2Z A;  4IOC A;  4PZ7 A;  4JYA L;  4DV4 L;  4LK1 C;  5C4H A;  1ASZ A;  4K2L A;  4HSV A;  2XVS A;  2E5L Q;  1D7Q A;  5HUR A;  4IO9 A;  3HOU B;  1KLG D;  2Q8T A;  3N52 A;  3D4R A;  2NTS A;  1B44 D;  3FP9 A;  5EBC A;  1N33 Q;  1FNV A;  2DY8 A;  5LMN W;  3NSW A;  1PV4 A;  3HOZ G;  3HOV H;  1PFB A;  2B63 B;  2QF7 A;  5C44 H;  4BBS H;  1UWV A;  3X3M A;  1F9S A;  1G91 A;  4ALP A;  3JAM E;  4FF1 A;  2CWP A;  3GTP B;  4AYB B;  4C1N I;  4OO1 H;  1I4H A;  2PZU A;  1NAP A;  1SNM A;  2F0H A;  1QUQ A;  4DPG A;  3GTL B;  5FLM G;  3D6C A;  1B1Z A;  1A63 A;  2GN5 A;  1A3T A;  1H9R A;  1WCM B;  3O13 A;  1K9M C;  3MEH A;  1I4R A;  1E2W A;  3Q0A A;  4JI1 Q;  2PYK A;  1LO5 D;  3M7N A;  2JA6 H;  4BY1 G;  3I8Z A;  2QA4 A;  3WDN A;  1W6J A;  2KVM A;  2GVA A;  1XTD A;  4DUY Q;  4DK0 A;  3HOY G;  4LF5 Q;  1SYE A;  5FJ8 H;  2ZTD A;  2F4V L;  4LUO A;  3MFY A;  1JB7 A;  4S3S A;  5GAD C;  4JOI A;  2IY5 B;  2UXC Q;  2Z6K A;  1S3O A;  3NWT A;  5C4J H;  1YIJ A;  1PVO A;  4JC0 A;  2JYO A;  3A7L A;  4L5Q A;  4A3D H;  2Q2I A;  3MVV A;  5IYC G;  4K5V A;  3S9W A;  4OIK A;  1TR5 A;  5CV7 A;  1SE3 A;  3ZYY X;  1VQ5 A;  3KFU A;  4RH6 A;  1QIL A;  5LMN Q;  1OXT A;  1JWM D;  3PIO 3;  1U9R A;  3V96 A;  5EQ0 A;  2UUB L;  5C3W A;  2KCC A;  1LV9 A;  4HR7 B;  1M90 C;  4DV0 L;  1CA6 A;  2B2Y C;  1K0R A;  4ZCK A;  2UXD Q;  2B3G A;  4J6H A;  4JI0 L;  1TWH B;  4CDE C;  2IX1 A;  2FHT A;  3RMH A;  5ELF A;  2A6E C;  1XNQ L;  3S1N B;  4NKL A;  3NBH A;  4XQJ A;  2SDF A;  4JI8 Q;  2E76 C;  1PTO H;  2QW7 A;  2DN8 A;  4YCW A;  2WKD A;  1EYG A;  1EY0 A;  1U5K A;  2ZJR A;  2SNM A;  1JIC A;  1HJP A;  3S1Q H;  3PUY A;  3NWS A;  4DAY B;  1E7Z A;  5JEA G;  2JA6 B;  3CW2 C;  4YWK A;  4XQQ A;  5M3F G;  1PH2 A;  3HOZ B;  1CI3 M;  2YTV A;  5HGT A;  4FF2 A;  3OTO Q;  4H7B A;  2VL6 A;  3J81 E;  1VS0 A;  3T13 A;  2LXJ A;  4JV5 L;  2KA7 A;  1ICW A;  2PQA A;  4XQN A;  4V0B A;  2E2I B;  2L1B A;  2Y0S E;  1MJC A;  2A19 A;  3GV6 A;  4RFB A;  5DM6 3;  3HOX H;  4GN4 B;  5KYI A;  2X6G A;  2L4N A;  4X65 Q;  2YU9 H;  1Y1W G;  2J0T D;  4YCV A;  3S15 B;  1NY4 A;  4GLV B;  2UUC Q;  4XYO A;  1Y8O B;  2ES2 A;  1ZYR D;  2F3V A;  4EGV A;  3HOY B;  2RHS B;  3H0G G;  2UU9 L;  1EEI D;  2LKV A;  3KK7 A;  1RTN A;  1CUK A;  4O2D A;  4DV4 Q;  4JYA Q;  4JI3 L;  4FO2 A;  3I55 A;  4KK7 A;  2NZH A;  4R4O A;  1X6O A;  1RDP D;  5EPJ A;  4DR5 L;  2JA8 G;  4LF7 L;  3I4N H;  2D0O A;  1JWU D;  1VQB A;  1I50 H;  1QOH A;  2EQS A;  1BOS A;  2RDG A;  4P73 A;  2OWO A;  5CV8 A;  4Y7N H;  2ICE C;  5I2X A;  4ME3 A;  1K8M A;  4OXP A;  1B8A A;  2NWG A;  4POF A;  3IFT A;  4J1M A;  3HFZ B;  3H3V C;  5M5X B;  5EKL A;  4DR6 L;  3FPU B;  4GZY C;  1Q81 C;  1PH5 A;  2EYL A;  4A3E H;  1PHJ A;  3W1G A;  5I6W A;  3LWE A;  1DYQ A;  1C8C A;  1Q12 A;  2MO1 A;  3LNN A;  4O42 A;  1TWC H;  1L1O C;  3I4O A;  1NR2 A;  1IL8 A;  1QWY A;  5M3M G;  3OPO A;  4A3B H;  3W1B A;  3Q23 A;  2D2C C;  2SNS A;  1XYI A;  4YWM A;  1WTQ A;  3BDO A;  1ENF A;  4L6T B;  2XIW A;  4I7A A;  4UHV A;  2KEC A;  3K5M A;  5CV4 A;  3UI2 A;  3R93 A;  2F4V Q;  1EZ8 A;  5M3F B;  2KEN A;  2LXK A;  4XXE A;  1AW7 A;  2ZJQ A;  1VQ6 A;  3I91 A;  2SEB D;  2ID0 A;  3DHQ A;  3DMU A;  5CV9 A;  1D8L A;  5IYB G;  4KV6 A;  1CA5 A;  3CU7 A;  3Q6S A;  1KHI A;  3K7U C;  2RSN A;  2KEE A;  1HUN A;  4QB4 A;  1JCK B;  2VY3 A;  1LLR D;  1AE3 A;  4DV3 L;  2IJ0 A;  3RLO A;  4A3M H;  1EY7 A;  1LTS D;  1YHB A;  2GVB A;  3GTJ H;  2O4X A;  1JOO A;  5C4Z A;  4WFN 3;  3I4M H;  3I3C A;  2F03 A;  1TT2 A;  2HQL A;  2HHH L;  4X62 L;  2IX0 A;  2K32 A;  3H3V I;  1Y1W B;  1OTC A;  3OW2 A;  5E4X A;  2UUB Q;  1PLF A;  2VB3 X;  4CDD C;  3BDC A;  4IAL A;  2FMC A;  3H0G B;  3Q22 A;  4DV0 Q;  1N9W A;  4JI0 Q;  3U4Z A;  1YHA A;  2F0W A;  2I46 A;  3R3O A;  4N8F A;  2NVX H;  1XNQ Q;  5BR8 L;  2FIN B;  2K05 A;  1TWG H;  2TSS A;  1VQK A;  5CR3 A;  4JBW A;  3GTG H;  2JA8 B;  3TEH B;  3D3R A;  4OL7 A;  5J39 A;  3NUC A;  2SOB A;  3M3Y H;  2AKW B;  4DR4 L;  2E2D C;  3TRE A;  5GAE C;  1CTM A;  3BU2 A;  1N36 L;  3ICE A;  1K8A C;  1DM0 B;  3OOC A;  1TU2 B;  1S72 A;  2NN6 G;  3S24 A;  3K0X A;  3UE0 A;  2AMC B;  1A2U A;  4F7X A;  3TS2 A;  4IPH A;  3VYT A;  1KTK A;  1SRU A;  1LYL A;  4ZAI A;  4JV5 Q;  3TS0 A;  4A76 A;  2EJF C;  4MZ9 A;  1V1Q A;  2G5D A;  3CCS A;  2B2U C;  3HS0 C;  2ZJP A;  4LF9 L;  2WP8 J;  3AQQ A;  5KYL A;  1PXU A;  3DWA A;  3D4D A;  3SR1 A;  2D5D A;  2LS0 1;  1UE5 A;  2R6G A;  5M3M B;  4A3I G;  4C3I G;  1NCV A;  1FNU A;  3E5S A;  4GOP C;  4K0K L;  1JT8 A;  5IP7 G;  4I7Z C;  1HZB A;  2EXD A;  1RHP A;  4HMI A;  2I0Q A;  4KD4 A;  4X3U A;  3W3A A;  1PYW D;  4H13 C;  1BXT A;  2JA7 H;  4JI3 Q;  4RAU C;  1GJX A;  1XPR A;  1VQG A;  2RBM A;  4AQY L;  3E6Z X;  1IHZ A;  3PO3 G;  3S17 H;  1A2T A;  3V2T A;  4DR5 Q;  2N49 A;  4LF7 Q;  1M4V A;  4EQN A;  1VQM A;  4IUU A;  1PTO D;  1GO3 E;  2XRQ D;  3RN5 A;  5A35 A;  1PZK D;  3ONA B;  4DV2 L;  3NEL A;  3DXJ C;  4RCN A;  1LT4 D;  1W2B A;  2WAQ E;  2EY5 A;  2F0G A;  1D2B A;  3SHL A;  5I9P A;  1XNR L;  4DR6 Q;  4N9P A;  2YTY A;  3ITP A;  1J9O A;  4C56 C;  1ZYR C;  2XGT A;  4H44 C;  1HRJ A;  1G29 1;  4TRD A;  2ALY B;  1M8A A;  3H6M A;  2KHS A;  2CH4 W;  2OEO A;  3SXH A;  1VQL A;  3KLW A;  2PW7 A;  2AUK A;  2NVY B;  1GUT A;  3L0O A;  2XSC A;  4HIM A;  4QJF A;  4DAV A;  4TSS A;  4A93 H;  2R3Z A;  2VQF L;  4DU9 A;  5EGT A;  3F2B A;  1KDC A;  3MZ5 A;  4DUZ L;  3M85 A;  2E2J H;  4BBR H;  5I6Y A;  1CKM A;  3T53 B;  1KXL A;  3ERO A;  3PMF A;  3T1Y L;  2K5V A;  3I2Z A;  3CQZ B;  1TWF H;  3SEB A;  5E1F A;  4QF4 A;  2AHO B;  1WYD A;  3J7Z C;  1TVX A;  4PMB A;  3GDE A;  3S1M B;  2HCI A;  2QDL A;  3L2P A;  3U9S A;  1XJV A;  1KNA A;  5ELN A;  2F0I A;  4DV3 Q;  1HQM C;  1I4P A;  4K8J A;  2KQ3 A;  4PZ8 A;  1M1K C;  3TP7 A;  3RLN A;  2BH2 A;  2B2W C;  4A3I B;  2HHH Q;  1HFG A;  3F8T A;  4RCO A;  4C3I B;  2NVT B;  4X62 Q;  2MQH A;  1L1O B;  4OEL B;  2M2L A;  1HNZ L;  4QQB X;  1Y69 U;  2VZA A;  1Q8I A;  4A3J G;  1NSN S;  4GS3 A;  3K7A H;  1EIH A;  1SYF A;  4CGY B;  4KY5 A;  3CC4 A;  5JOB A;  2A69 D;  5BR8 Q;  4RKL A;  1WTX A;  1OXX K;  2AWO A;  3PO3 B;  3VYR A;  1SE4 A;  1V43 A;  1A15 A;  1X65 A;  4K6D A;  2KCT A;  3BVG A;  2PPB C;  3KJP A;  2IWH A;  4DN4 M;  5EJW A;  4DR1 L;  4DR4 Q;  3BZD B;  1E0B A;  4OON A;  4QY7 A;  4DV5 L;  3GTO B;  3RZD B;  4KKT A;  1N36 Q;  2MP1 A;  2D9U A;  2R61 A;  1JJG A;  1RCV D;  4OWT B;  1SNQ A;  1XMO L;  1EQR A;  3PUX A;  3NEM A;  1J6Q A;  1T5E A;  4C3J B;  1TWF B;  2IL8 A;  3HZX A;  1ZXT A;  5DM7 3;  2LSS A;  1TWA B;  3BZC A;  3NTI A;  5JVG 3;  2N78 A;  1S5F D;  1UNS A;  4LF9 Q;  3EVQ A;  1DOK A;  3GV3 A;  4OWW B;  4WJW A;  3MEF A;  4XTC S;  3A54 A;  3VR6 A;  2R7Z H;  4K0K Q;  2RHQ B;  2A6E D;  4TQU S;  3S14 H;  1BR9 A;  1Y8P B;  4QUF A;  1HH2 P;  1I3Q H;  2A74 C;  2FJ2 A;  3OYY A;  3VR2 A;  4IPG A;  2OT2 A;  1F2Y A;  5IP9 H;  1Q46 A;  4JI4 L;  4IFD I;  2VUM H;  1ZEQ X;  1X56 A;  4AQY Q;  2ATW A;  2NBF A;  3U50 C;  1HR0 W;  4BXX G;  3C2P A;  1KD1 C;  4KN4 C;  5C0X H;  4P75 A;  4LUV A;  1XTC D;  4DV2 Q;  4ZUJ A;  4DA2 A;  1EOT A;  1FGB D;  3NTH A;  2ZM6 L;  2HDM A;  3TZU A;  3IRB A;  1U4L A;  1H9M A;  1IBK L;  4QL5 A;  1IYU A;  1EU3 A;  1LAB A;  4IN3 A;  5D3D A;  4DGZ A;  3S1R B;  3HOU H;  4LW1 A;  1G6Z A;  1EY8 A;  4RGN A;  4A3J B;  3MC0 B;  5ELE A;  3JAM L;  4GOP B;  5KGU A;  2ZTE A;  1O7Z A;  3S2H B;  1SND A;  2B63 H;  2O2L D;  1VDZ A;  2JP1 A;  2LMC B;  4J15 A;  2NB0 A;  2F3I A;  4G7Z C;  4JK1 C;  4B3S L;  3AFP A;  5E4W C;  2VQF Q;  3GTP H;  1P8L A;  4DNT B;  5J1Z A;  1DGS A;  4DUZ Q;  4HJ5 A;  2VQE L;  1EIG A;  5IYD H;  2F0D A;  2PZT A;  3PGZ A;  2F1M A;  4EX5 A;  3HOW G;  3GTL H;  3I90 A;  3Q24 A;  3T1Y Q;  2EOT A;  1WCM H;  3CC2 A;  2B2Y A;  1STA A;  3A74 A;  3CP0 A;  4B3M L;  3PIO A;  1PZI D;  4R1J A;  2XN9 C;  3EFX D;  4M8A A;  4OEM B;  2JSO A;  1YI2 A;  1HUM A;  5CBA E;  1NMG A;  2NYZ D;  2E2H B;  1D5M C;  3TQY A;  2WV6 D;  3R2T A;  4PNY A;  3D6W A;  2QKI C;  4RWS C;  4P71 A;  1HCZ A;  4OWX B;  1MJE A;  1Q86 C;  4BY7 G;  1QZH A;  3E0E A;  3PQI A;  1KC8 C;  1Z7T A;  1HNZ Q;  3SK5 A;  3NBI A;  2EPB A;  4KTA A;  1EFW A;  5E3F A;  1Z47 A;  3MFG A;  1GOZ A;  5IGG A;  2F0P A;  3M4O B;  2KJX A;  4NXM L;  1SYB A;  4LF4 L;  1STY A;  3DEO A;  4KHZ A;  1NE3 A;  3PUW A;  2GA4 B;  2K1B A;  4DR1 Q;  3I4L A;  2XTI A;  1EL0 A;  4DV5 Q;  1TWH H;  3FVQ A;  2ASB A;  3BG3 A;  3S1N H;  1F9P A;  3AU7 A;  1XMO Q;  1C0A A;  4O1N A;  4A3F G;  4HCS A;  4A3G G;  1X3Q A;  2JA5 G;  1I4X A;  1SEB D;  5K5P A;  3C1E A;  3J81 L;  3T4A C;  1QCB D;  1ILQ A;  2Q2H A;  2A69 C;  1X3F A;  1WTH A;  3HOZ H;  4FNF A;  5CMD A;  3PO2 B;  1YIT A;  4HMJ A;  2OCE A;  4A3D G;  3KLR A;  4R4Q A;  2PCF B;  2Z0S A;  1O80 A;  1DXM A;  4F88 A;  3L9A X;  2K5Q A;  3VYS A;  4X64 L;  1QZG A;  4XIG S;  1R9T B;  1PH6 A;  1BBX C;  1D5Z C;  2E2I H;  3HOW B;  3AFQ A;  1SRO A;  3ULP A;  4JI4 Q;  3GTK B;  1L1O A;  4FXG C;  2WB1 G;  3S15 H;  3K5O A;  2IX3 A;  4AYB E;  5CYU A;  4C2M B;  3KYH C;  4X3K A;  1G2T A;  2Z9H A;  5JPM C;  3PUV A;  3U58 A;  1B3A A;  1UE6 A;  5BN4 A;  3K58 A;  3HOY H;  4LF6 L;  2EYO A;  1C9O A;  4DXG A;  1HFN A;  2ZM6 Q;  2RDH A;  1XXG A;  5C3X A;  2UUA L;  2K5D A;  1SJE D;  1EYD A;  1IYJ B;  1XWE A;  4RMF A;  1EY6 A;  2CVR A;  4BY7 B;  2AUJ D;  2C5C A;  5IYC H;  5IT9 E;  2F0Q A;  1SDF A;  4ZRZ A;  1YNN C;  4A4I A;  4E6I A;  1FVI A;  1LT6 D;  3CCR A;  4CDC C;  3CHB D;  2IPK D;  5M5W B;  1G51 A;  5M5X H;  1E2V A;  4R4C A;  2X6L A;  4B3S Q;  2I5H A;  1A3V A;  5J3B A;  3E0J A;  4LF8 L;  1MSG A;  1OXV A;  5BN5 A;  4KY6 A;  4X6A H;  1F77 A;  2VQE Q;  1U4R A;  4V19 0;  2Z4H A;  4GKJ L;  1MGS A;  1F2L A;  5IE8 A;  3LGJ A;  3F2C A;  4UP7 A;  3VYU A;  4CKB A;  2K01 A;  1X3G A;  1KDB A;  3NXW A;  2V4D A;  4HIK A;  2EZV A;  4B3M Q;  3M7G A;  4A3F B;  1SNC A;  4A3G B;  2JA5 B;  1IZ6 A;  3KF6 B;  4KHP L;  2P5Z X;  1D6E C;  1W6K A;  1TII D;  4QGU A;  5F2D A;  5JEA H;  4BY1 B;  1KIX A;  2CFM A;  1LTG D;  4HID A;  5M3F H;  3G48 A;  1VQC A;  1ESR A;  3KF8 B;  4RHR A;  1HTL D;  3CF5 A;  1PH1 A;  4C3H G;  5L37 A;  4N8X 1;  5GQO A;  3J80 i;  1WI5 A;  1EQQ A;  2F0M A;  3KDF B;  3VA7 A;  4GLA C;  2QCP X;  2XWJ B;  1H9S B;  1LT3 D;  2A8V A;  4X66 L;  2N55 A;  4HAE A;  2B2U A;  1VQH A;  5C3E G;  1VQF A;  2CQO A;  1Y1W H;  3LX0 A;  3CME A;  4NXM Q;  4LF4 Q;  1GM5 A;  4OGQ C;  4GOP A;  1OO9 B;  2HUG A;  2A1A A;  3H0G H;  4QMG A;  1HPC A;  2X69 A;  1PH9 A;  1PH7 A;  2VS1 A;  1WTV A;  5DEH A;  4J8Q A;  3T16 A;  1BCP F;  1EQT A;  5I2Y A;  2JA8 H;  1SYC A;  1BCP B;  4K5W A;  4X3S A;  3LWU A;  4WJ4 A;  3CMA A;  1GHK A;  3TP6 A;  4RGO S;  3EA6 A;  3MA2 B;  3DUZ A;  4LNQ A;  5A2Q E;  1LTT D;  3G71 A;  4AIM A;  5T1I A;  2QGQ A;  3DEP A;  4PQX A;  3DWP A;  5IT9 c;  2ZT9 C;  3DWQ A;  5JVH 3;  1RJT A;  1XMQ L;  4DXF A;  4X64 Q;  1C4Q A;  1VQI A;  3CPW A;  2KUM A;  3HGB A;  3QB3 A;  4FF4 A;  4DNI A;  4IUT A;  3MXN B;  4A3C G;  2ZXR A;  2NN6 I;  5IGF A;  5IGB A;  2PMZ B;  5FKA C;  1JOQ A;  5M3M H;  2CQA A;  3G6E A;  3FKI G;  1QVC A;  4GN3 B;  4BA2 I;  1QG7 A;  3VR4 A;  4K2K A;  2QIL A;  3J7A F;  2YV5 A;  5E7N A;  5D65 A;  2EYH A;  3GTM B;  2Q2U A;  1J5E L;  4LF6 Q;  3UDI A;  2L15 A;  2K04 A;  1E24 A;  1XPO A;  4C3H B;  5IYB H;  4CDF C;  1Z9F A;  1MIU A;  4KKS A;  1QVF A;  1TS4 A;  1LM0 A;  1DOL A;  4Q0F A;  3GQB A;  5CBE E;  3HKZ G;  4UPA A;  4GNX C;  1YNJ C;  2E75 C;  3S16 B;  1L0Y B;  2F0V A;  5C3E B;  1SXT A;  4CJ1 B;  1WJJ A;  2B2W A;  2PMZ E;  4LF8 Q;  1SLJ A;  3MXU A;  3DM3 A;  3R2I A;  4RA8 A;  1ENC A;  2OQ0 A;  4L5R C;  2NVY H;  1R4Q B;  5FK9 C;  2EJG C;  3A8J E;  3TBI B;  2F0N A;  1JR0 D;  2C35 B;  2EY2 A;  1LUZ A;  2F0E A;  2L12 A;  1YJW A;  1WD1 A;  4HJA A;  1VQJ A;  4KHP Q;  5DLQ E;  2E8G A;  2XNA C;  4DR7 L;  3PSI A;  3QIA A;  2RCN A;  3C1F A;  5EAY A;  4K6L A;  4B9W A;  2C9O A;  1WTR A;  3CQZ H;  3VA5 A;  4DF7 A;  3KLS X;  4DV7 L;  1GHJ A;  1CQV A;  4LUZ A;  4GKK L;  2UU9 Q;  4OX9 L;  3K6O A;  3S1M H;  5C0X J;  3K81 C;  4P72 A;  3QO2 A;  4IUQ A;  1BQQ T;  1H9K A;  1B9M A;  1VQO A;  4DFA A;  4LFC L;  1SSO A;  3J7Y W;  3SK6 A;  5KNB A;  2WIN B;  3H3V H;  2IW3 A;  2F0O A;  1Q82 C;  3K80 C;  4LMQ D;  4X66 Q;  1PFN A;  4LWC A;  2G9D A;  3HG9 A;  1TY0 A;  4RGT A;  4A3I H;  1PYS B;  3FKI B;  4C3I H;  3NTK A;  2NVT H;  5KEE A;  2F0S A;  2K5N A;  5IP7 H;  3NEN A;  1CSP A;  3IKJ A;  1SE8 A;  4AH6 A;  2A6H C;  2EXZ A;  2WAC A;  3CCU A;  1ET6 A;  3X3N A;  1G8Z D;  5C5M A;  4DAY A;  2RA4 A;  1V8Q A;  1B3Q A;  4TKO B;  5KNC A;  2PW5 A;  4A3L H;  1V1O A;  2EVB A;  5GRO A;  3PO3 H;  1KRT A;  1L0W A;  1BCP D;  1JB3 A;  1TKW B;  2KBN A;  1K0S A; 
#chains in the Genus database with same CATH homology
 5IYC G;  3I4M G;  1IBK L;  3GTO H;  4QL5 A;  3RZD H;  4O0A A;  1KQS A;  4JG2 A;  1IBM Q;  2OTJ A;  2YYZ A;  1I94 L;  1VQ5 A;  3KFU A;  2R93 G;  3HOU H;  4LW1 A;  1HNX L;  3STB D;  4DR2 Q;  3KF6 A;  4POG A;  4C3J H;  1O7I A;  3JAM i;  5LMN Q;  4GOP B;  4PMW A;  1OXT A;  2ZTE A;  1TWA H;  1XMQ Q;  2B63 H;  4IOA A;  3EBE A;  2UUB L;  3U4V A;  4J15 A;  1LTL A;  5FLX c;  1M90 C;  2F3I A;  4DV0 L;  1K0R A;  3AFP A;  2KHJ A;  2B3G A;  2VQF Q;  4B3S L;  4JI0 L;  2IX1 A;  2UXD Q;  1E1O A;  1XNQ L;  1V9P A;  3KJO A;  1P8L A;  1HR0 L;  2UUA Q;  3GTP H;  1DGS A;  1YNX A;  4JI8 Q;  4DUZ Q;  4HJ5 A;  1VQ4 A;  2VQE L;  3J81 c;  2ZM6 L;  2CCZ A;  5IYD H;  3PGZ A;  4A3C H;  2D62 A;  3Q8D A;  1SN8 A;  3W5O A;  4EX5 A;  1N34 L;  1A0I A;  4A3K G;  3GTL H;  3HOW G;  4YCW A;  1EYG A;  3T1Y Q;  1U5K A;  3CAM A;  2JEA I;  2ZJR A;  3EIV A;  1WCM H;  3CC2 A;  1HJP A;  1YZ6 A;  3FKI H;  3A74 A;  3CCL A;  3S1Q H;  3PUY A;  5C4X G;  1J5E Q;  1NMF A;  4Y52 H;  3CP0 A;  4DV6 L;  4B3M L;  3PIO A;  1Q1E A;  4DAY B;  1E7Z A;  5JEA G;  4R1J A;  1HZC A;  3CW2 C;  4YWK A;  4JBK A;  5M3F G;  1PH2 A;  2YTV A;  3OTO Q;  1YI2 A;  1YEZ A;  1NMG A;  3ULL A;  1CKN B;  2VL6 A;  3TQY A;  1VS0 A;  2JE6 I;  2LXJ A;  1K3R A;  4JV5 L;  2EIF A;  4GKJ Q;  1IL2 A;  4LFB L;  1VCI A;  2PQA A;  4P71 A;  4OWX B;  1MJE A;  2Y0S E;  1MJC A;  1Q86 C;  2A19 A;  1QZH A;  3E0E A;  4BY7 G;  3HOX H;  4GN4 B;  3VDY A;  4JI2 Q;  1KC8 C;  1HNZ Q;  1VQ8 A;  3STB C;  4X65 Q;  2YU9 H;  3H15 A;  1Y1W G;  4YCV A;  1EFW A;  1HZ9 A;  1NY4 A;  3S1R H;  3T1H L;  4GLV B;  2UUC Q;  3GD7 A;  1HNW L;  2JA7 G;  1Z47 A;  3BZK A;  2ES2 A;  4A3J H;  1FL0 A;  4DR3 L;  2RHS B;  4B3R L;  3H0G G;  2UU9 L;  2HT1 A;  3TRZ A;  4JYA Q;  1CUK A;  4O2D A;  4DV4 Q;  4JI6 L;  4NXM L;  1CKO A;  4JI3 L;  3S2H H;  3I55 A;  4LF4 L;  4WJ3 M;  4KHZ A;  1NE3 A;  3PUW A;  2UXB L;  4DR1 Q;  2NZH A;  2XTI A;  4R4O A;  1X6O A;  3SGI A;  3F1Z A;  4DV5 Q;  3L7Z C;  4GLX A;  1TWH H;  4DR5 L;  2JA8 G;  4LF7 L;  3I4N H;  2K4K A;  2D0O A;  2ASB A;  3S1N H;  1VQ9 A;  1VQB A;  1I50 H;  4IPD A;  4DK6 C;  1XMO Q;  2Q2T A;  4DR7 Q;  1C0A A;  1K8G A;  2EQS A;  5IP9 G;  4A3F G;  2N3S A;  4P73 A;  2CWA A;  5IWA Q;  2OWO A;  4A3G G;  1S40 A;  1QVG A;  4Y7N H;  4HJ9 A;  2JA5 G;  1I5F A;  1Y14 B;  3S2D H;  5JJK A;  4ME3 A;  4DV7 Q;  4OXP A;  1B8A A;  1PYB A;  4GKK Q;  3J81 i;  3PF4 A;  4OX9 Q;  4POF A;  2MO0 A;  2Q2H A;  2JQO A;  3HFZ B;  1JE5 A;  4IJH A;  4GNX B;  3PF5 A;  4DR6 L;  2R92 G;  1N8R C;  1Q81 C;  2WFW A;  1PH5 A;  4A3L G;  4A3E H;  1X3F A;  1PHJ A;  3HOZ H;  5C0X G;  4JI7 Q;  3W1G A;  4LFC Q;  1N32 L;  2B29 A;  2PQA B;  1YIT A;  1Q8K A;  2OCE A;  4R4T A;  4YHH Q;  1JMC A;  2E2H H;  4A3D G;  4R4Q A;  1Q12 A;  2MO1 A;  3GO5 A;  2Z0S A;  4FDB A;  4L5T A;  1E1T A;  5IY0 A;  1TWC H;  5AJ3 L;  4A93 G;  1BKB A;  1L1O C;  4H02 A;  4UP8 A;  3I4O A;  4YY3 L;  4APV A;  4X64 L;  5M3M G;  4BBR G;  4XIG S;  1QZG A;  4A3B H;  3W1B A;  1PH6 A;  2E2I H;  3AFQ A;  2OTL A;  1SRO A;  4UP9 A;  3ULP A;  4JI4 Q;  1XNR Q;  3M9B A;  2YTX A;  4YWM A;  3JC6 6;  1L1O A;  3DLL A;  1H95 A;  2WB1 G;  3S15 H;  2K52 A;  2B63 G;  4AYB E;  2F4V Q;  3KYH C;  2KEN A;  2LXK A;  3PUV A;  3U58 A;  2ZJQ A;  1UE6 A;  4A75 A;  1VQ6 A;  3HOY H;  2ID0 A;  4LF6 L;  5IYB G;  1BBU A;  1D8L A;  3M4O H;  1SFO H;  1PA6 A;  2ZTC A;  1OXS C;  3J81 j;  4BXX H;  1C9O A;  1KHI A;  3K7U C;  4DV1 L;  5IYD G;  4HJ8 A;  4IFD J;  3UE1 A;  2ZM6 Q;  1IBL L;  1QUQ B;  1YBY A;  2VY3 A;  4UY8 C;  1AE3 A;  4DV3 L;  3K8A A;  1KRS A;  4IJL A;  3RLO A;  1G6P A;  2UUA L;  4A3M H;  1IYJ B;  1Q1B A;  4RMF A;  5HGQ A;  5K36 G;  3PV0 A;  1Y1V G;  1YHB A;  2GVB A;  3GTJ H;  1I94 Q;  5IYC H;  3I4M H;  1HNX Q;  2HQL A;  1B70 B;  4A4I A;  3KDF A;  2HHH L;  4X62 L;  1FVI A;  2F52 A;  2IX0 A;  3H3V I;  3CCR A;  2JA9 A;  3PIP A;  1EOV A;  1OTC A;  2OQK A;  1PH4 A;  3OW2 A;  2R93 H;  4TVA B;  1L2F A;  1X54 A;  2MNA A;  1B7Y B;  3M4P A;  1VQP A;  2UUB Q;  1SR3 A;  1G51 A;  2H5X A;  5M5X H;  4R4C A;  1WFQ A;  3KOJ A;  3J7A 5;  4DV0 Q;  4YCU A;  4B3S Q;  2I5H A;  1N9W A;  1NBW A;  5J3B A;  1YHA A;  4JI5 L;  2R7D A;  3HKZ E;  4QIW E;  3RR5 A;  2N8N A;  3U4Z A;  1OXV A;  1ASY A;  2NVX H;  1K83 H;  1HR0 Q;  4LF8 L;  1XNQ Q;  3PO2 H;  5BR8 L;  1GD7 A;  4B3T L;  4X6A H;  1TWG H;  2VQE Q;  1VQK A;  4JBW A;  4DUZ L;  1N34 Q;  4GKJ L;  3GTG H;  4NXN L;  4JBJ A;  3TEH B;  5IE8 A;  2VNU D;  3LGJ A;  1EWI A;  3F2C A;  4UP7 A;  5LMU L;  5GAG C;  3M3Y H;  3RZO H;  2AKW B;  1NTG A;  4DR4 L;  3TRE A;  5GAE C;  1X3G A;  1R9T H;  3RNU A;  4HIK A;  3HOW H;  4DV6 Q;  2E5L L;  3BU2 A;  4NB3 A;  4A3K H;  1EIF A;  1YJN A;  1N36 L;  1K8A C;  4BA1 I;  4B3M Q;  3ICE A;  1AH9 A;  1X3E A;  1IZ6 A;  1UE1 A;  5C0X I;  3KF6 B;  3PUZ A;  3UDG A;  1VQE A;  2BH8 A;  2NN6 G;  3S24 A;  1S72 A;  3GTK H;  4KHP L;  3K0X A;  3UE0 A;  5C4X H;  2Y0S G;  2AMC B;  3CC7 A;  3HOV G;  4QGU A;  3TS2 A;  4IPH A;  1E3P A;  1VQN A;  3HKS A;  5C44 G;  1SRU A;  2CFM A;  4C2M H;  4HID A;  1KIX A;  1LYL A;  4PG3 A;  3G48 A;  5M3F H;  1N33 L;  4BBS G;  1VQC A;  2IHF A;  2I5L X;  4JV5 Q;  3G4S A;  3KF8 B;  4MTN A;  3TS0 A;  4A76 A;  4MZ9 A;  4LFA L;  4LFB Q;  3CF5 A;  1PH1 A;  1V1Q A;  1C7Y A;  1FGU A;  3NBH B;  2D0P A;  3CCS A;  3CD6 A;  4OO1 G;  5GQO A;  4RG1 A;  3CXC A;  2ZJP A;  2WP8 J;  3AQQ A;  3J80 i;  1EIY B;  1WI5 A;  4LF9 L;  2R7Z G;  1EQQ A;  2JEB I;  2V1C C;  3KDF B;  1UE5 A;  2R6G A;  1EUJ A;  4A3I G;  4GLA C;  4YWL A;  4GOP C;  4BY7 H;  4K0K L;  1JT8 A;  3T1H Q;  5IP7 G;  2A8V A;  5ELO A;  4X66 L;  1HNW Q;  2JA6 G;  1HZB A;  1GKH A;  2EXD A;  5HY6 A;  1VQH A;  1P16 A;  1UEB A;  5C3E G;  2I0Q A;  2VUM G;  1VQF A;  4DR3 Q;  4B3R Q;  2CQO A;  2PNH A;  4JI1 L;  1YJ9 A;  5FJ8 G;  1Y1W H;  2DGY A;  3GTQ H;  1FJG L;  4R4I A;  3CME A;  4JI6 Q;  4L5S A;  4NXM Q;  3I56 A;  4JI3 Q;  2JA7 H;  2PI2 E;  4LF4 Q;  1GM5 A;  2UXB Q;  2QEX A;  1XPR A;  4GOP A;  1VQG A;  5M5W H;  4DUY L;  2A1A A;  4AQY L;  3H0G H;  4LF5 L;  3PO3 G;  1PH9 A;  3S17 H;  4HJ7 A;  1PH7 A;  4DR5 Q;  2N49 A;  4LF7 Q;  1VQM A;  2VS1 A;  1YVC A;  4GN5 A;  1GO3 E;  3RN5 A;  3E9H A;  2UXC L;  2JA8 H;  3FHW A;  1RIP A;  4DV2 L;  3NEL A;  2DUD A;  2VW9 A;  3M4Q A;  1W2B A;  4WJ4 A;  3CMA A;  2WAQ E;  5FLM H;  3HOU G;  4A3F H;  1XNR L;  4DR6 Q;  4A3G H;  2YTY A;  2JA5 H;  1OXU A;  2KHI A;  1KL9 A;  2NVQ H;  4LNQ A;  2K14 A;  3G71 A;  2XGT A;  1IBM L;  5JJI A;  4AIM A;  4KI0 A;  1G29 1;  1N32 Q;  2QGQ A;  1T9H A;  2ALY B;  3ER0 A;  2MFI A;  4DR2 L;  4BY1 H;  5IT9 c;  3J80 c;  2CKZ B;  2R92 H;  1A8V A;  1VQL A;  1JJC B;  3KLW A;  3L0O A;  5AJ3 Q;  5LMN L;  4HIM A;  1K73 C;  4YY3 Q;  1CKN A;  1XMQ L;  4X64 Q;  4QJF A;  2AWN A;  3I7F A;  1VQD A;  1VQI A;  4AYB G;  3CPW A;  1Q7Y C;  3A5Z B;  1CSQ A;  3D0F A;  4DNI A;  2IT1 A;  3MXN B;  3AEV A;  4A93 H;  4A3C G;  2VQF L;  2UXD L;  2NN6 I;  1IBK Q;  3F2B A;  2HIX A;  5M5Y H;  2PI2 A;  2JK8 A;  3UDF A;  1A62 A;  1WCM G;  2I5M X;  4JI8 L;  4BBR H;  5M3M H;  3FKI G;  3M85 A;  3G6E A;  1YHQ A;  2E2J H;  1QVC A;  1CKM A;  3A0J A;  4GN3 B;  4BA2 I;  1KXL A;  1AE2 A;  3T1Y L;  2K5V A;  3I2Z A;  4MNO A;  2YV5 A;  5E7N A;  1PFS A;  1TWF H;  2R7F A;  3ZJY C;  1NJI C;  5JEA J;  2Q2U A;  4OO1 I;  5H1S E;  1I6H H;  1J5E L;  2AHO B;  1WYD A;  3B6Y A;  1GVP A;  2FXQ A;  3J7Z C;  4LF6 Q;  3PO2 G;  3GDE A;  3UDI A;  3L2P A;  1XJV A;  4KLK A;  4DV1 Q;  2L15 A;  4JI0 Q;  3ULJ A;  4JCV E;  1JJ2 A;  1IBL Q;  5ELN A;  1E24 A;  1XPO A;  3OTO L;  3CCQ A;  4DV3 Q;  1RL2 A;  5IYB H;  4IFD G;  1VQ7 A;  1BBW A;  3CCV A;  1Z9F A;  4PZ8 A;  4DAM A;  1MIU A;  1M1K C;  1QVF A;  4PZ6 A;  1TXY A;  1LM0 A;  3RLN A;  2BH2 A;  3HOX G;  3CCE A;  1PH3 A;  3HKZ G;  1U0L A;  1WOC A;  4UPA A;  2HHH Q;  4GNX C;  3F8T A;  2IHE A;  4X62 Q;  3CPF A;  3WWV A;  2MQH A;  1Y1V H;  1L1O B;  4DKA C;  4NPS A;  4JI2 L;  5JJL A;  1HNZ L;  4QQB X;  2VZA A;  4X65 L;  2BA1 A;  4A3J G;  1IXR A;  4GS3 A;  3K7A H;  1KAW A;  1WJJ A;  4JI5 Q;  1X55 A;  2KCM A;  1PH8 A;  2UUC L;  3CC4 A;  2PMZ E;  4LF8 Q;  4GNX A;  1SLJ A;  2HIV A;  3RN2 A;  5BR8 Q;  4B3T Q;  3DM3 A;  3F2D A;  2NZO A;  1OXX K;  2AWO A;  2K5H A;  2RF4 A;  2OQ0 A;  1X9N A;  1V43 A;  2NVY H;  1X65 A;  4IPC A;  4IOC A;  4L5R C;  4NXN Q;  4PZ7 A;  4JYA L;  2KCT A;  4DV4 L;  3I4N G;  3AYH B;  1ASZ A;  1UE7 A;  3CCM A;  3KJP A;  5LMU Q;  3ERS X;  4DR1 L;  4DR4 Q;  2C35 B;  1VQA A;  4OON A;  4DV5 L;  4QY7 A;  1LUZ A;  2E5L Q;  1D7Q A;  1N36 Q;  4DK3 C;  4IO9 A;  3JAM c;  1YJW A;  1XPU A;  4HJA A;  1JJG A;  1VQJ A;  2K50 A;  4KHP Q;  4OWT B;  5DLQ E;  2E8G A;  1XMO L;  1EQR A;  4DR7 L;  3PUX A;  3EN2 A;  3PSI A;  3NEM A;  1J6Q A;  2RCN A;  5IWA L;  5EAY A;  3FP9 A;  3CQZ H;  1N33 Q;  5LMN W;  1MKH A;  4DV7 L;  4A3E G;  1PV4 A;  3GTM H;  3HOZ G;  2LSS A;  4LUZ A;  3HOV H;  4GKK L;  2UU9 Q;  3BZC A;  4LFA Q;  1BVS A;  5GAH C;  4OX9 L;  3CCJ A;  2N78 A;  3D31 A;  5C44 H;  3S1M H;  5C0X J;  4BBS H;  4LF9 Q;  1UWV A;  3K81 C;  4P72 A;  4ALP A;  4JI7 L;  2CWP A;  1E22 A;  1W3S A;  1VQO A;  4LFC L;  4OWW B;  4C3H H;  1SMX A;  4YHH L;  3H3V H;  4EQ5 A;  3MEF A;  4XTC S;  4A3B G;  4HIO A;  1QUQ A;  1Q82 C;  4DPG A;  2R7Z H;  5FLM G;  3K80 C;  4JBM A;  4K0K Q;  2RHQ B;  4TQU S;  3S14 H;  4X66 Q;  1A63 A;  2GN5 A;  2BA0 A;  4LWC A;  4A3I H;  1PYS B;  1HH2 P;  1I3Q H;  1K9M C;  4C3I H;  2NVT H;  4JI1 Q;  3S16 H;  3OYY A;  2K5N A;  1FJG Q;  5IP7 H;  4IPG A;  4JOI C;  3M7N A;  2Z6K C;  3NEN A;  4P74 A;  5IP9 H;  1CSP A;  2JA6 H;  4BY1 G;  1Q46 A;  2QA4 A;  4JI4 L;  1HZA A;  5C3E H;  4IFD I;  2VUM H;  1SE8 A;  2GVA A;  4AH6 A;  1XTD A;  1X56 A;  4DUY Q;  4AQY Q;  2ATW A;  4LF5 Q;  5FJ8 H;  3HOY G;  3CCU A;  2ZTD A;  2K75 A;  2WAQ G;  3U50 C;  3A5U A;  1HR0 W;  2F4V L;  4BXX G;  4LUO A;  3RLF A;  1JB7 A;  3UDX A;  1KD1 C;  4A3L H;  3PCO B;  2JJQ A;  3E9I A;  5GAD C;  4JOI A;  5GRO A;  3PO3 H;  2UXC Q;  2Z6K A;  1S3O A;  1KRT A;  5C4J H;  1YIJ A;  1PVO A;  2IY5 B;  4P75 A;  4LUV A;  4JC0 A;  1L0W A;  4A3M G;  4DV2 Q;  4L5Q A;  4A3D H;  2KBN A;  2Q2I A;  3BJU A;  3IRB A;  2WB1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...