2F0PA

Crystal structure of staphylococcal nuclease mutant v66i/v99i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0pA00
2F0JA 2KQ3A 2F0QA 1ENCA 2EYMA 5C5MA 5C4HA 4WORA 2NUCA 4WRDA 2OEOA 1AEXA 1F2ZA 2SNSA 1STHA 3NP8A 4G57A 1EQVA 5CGKA 3TMEA 4EQOA 5HGTA 1SYDA 3MHBA 4QMGA 5C3XA 1EYAA 1SNDA 5E3FA 2F0NA 2PYKA 3SXHA 3E5SA 2F0DA 4OL7A 5KEEA 4N9TA 3QB3A 3EVQA 4N9PA 1F2MA 4K5XA 5E1FA 5KGUA 3V2TA 1SNPA 2KHSA 3NHHA 3BDCA 1II3A 3OWFA 2ENBA 2M00A 5IGGA 2EYPA 1STBA 2F3WA 4IUNA 4J1MA 3VA5A 2F0FA 3QOJA 4KV6A 4NMZA 3TP5A 5J22A 4ODGA 4TRDA 5EGTA 3NUCA 1F2YA 2F0IA 3T16A 1KAAA 1STGA 3OMCA 4IALA 5CV5A 2F0OA 2PZWA 3HZXA 1SYEA 2EYFA 2OXPA 4DFAA 4YIJA 4EQPA 5C4ZA 5JAVA 2F0TA 1KABA 2F0PA 2EYHA 1EY9A 2F0EA 5J1ZA 5I9OA 4KJNA 1SNCA 3SR1A 2SNMA 3MEHA 4QB4A 5F2DA 1ENAA 4K5VA 4LAAA 1EY5A 1STYA 4KD4A 1SYCA 1SYBA 1TT2A 4HTHA 2LKVA 2F0HA 5CV6A 1EZ6A 4NDXA 1IHZA 1SYGA 3EROA 4K14A 4KD3A 5CR3A 2WACA 5CV9A 3T13A 2F0WA 5HURA 5I6YA 5IGFA 4E6IA 4I65A 1A2UA 4F8MA 5EKLA 5IODA 1EZ8A 3S9WA 2F0GA 3MVVA 4NKLA 3MZ5A 3R3OA 4B9XA 5CC4A 3PMFA 3TP6A 1JOKA 1EYDA 3NXWA 4NP5A 3ITPA 4K8JA 3P1HA 4PNYA 4RKBA 4ZUJA 3SK5A 4DF7A 3QOLA 1JORA 5I9PA 3ERQA 1NUCA 1SNOA 3MXPA 1STNA 3BDLA 4HMIA 2F0MA 2PW5A 5KIXA 5M9OA 4K2KA 4J6HA 4QF4A 1U9RA 4KY6A 3SHLA 3U9OA 4ME5A 4EQNA 2EYOA 2SOBA 2PW7A 3SK6A 3TP7A 1SNQA 5IOCA 2PZUA 5K5PA 5KYIA 3EJIA 5C5LA 3P75A 1SYFA 5C3WA 5IGDA 4RKLA 5J39A 1NSNS 3C1FA 4H7BA 4KY5A 1RKNA 3DHQA 2RDFA 1A3UA 5IGEA 3OMGA 2F0UA 4F7XA 3HEJA 2PQEA 2QDBA 4R8NA 4K6DA 3RUZA 4DU9A 2HQEA 3SK8A 5CV8A 5ISRA 4K2LA 1A3TA 4KJOA 4PMCA 2EYLA 4K5WA 2EXZA 1JOQA 5I6WA 2RBMA 1TQOA 4KY7A 1A2TA 2EYJA 5IIFA 5DAUA 4K8IA 2PZTA 2F0VA 3NQTA 5C6AA 2OF1A 4IZ8A 3OSOA 3DMUA 1EYCA 4HMJA 2RKSA 4ID6A 4KHVA 4B9WA 1EY6A 1KDBA 1KDCA 5CV4A 4DGZA 4PMBA 4EVOA 5IGCA 5NUCA 2F0KA 1EY7A 2F0LA 3D8GA 4S3SA 3H6MA 3NK9A 4ZQ3A 3TP8A 5CV7A 1JOOA 2EY2A 2O4XA 2EY6A 3C1EA 2F3VA 1SNMA 1STAA 4ZUIA 2EY5A 1KDAA 3LX0A 2F0SA 1EY4A 5EKKA 5KRUA 1EY0A 3SK4A 5KYLA 5IGBA 1EY8A 1A3VA 2EY1A 3D6CA 4MIUA 5DEHA 5JOBA 1TR5A 3D4WA 4KTAA 3D4DA
chains in the Genus database with same CATH superfamily
3K81C 4DV0L 2F0JA 4ABNA 1YJWA 4QIWB 1N33Q 5C5MA 5CORA 2DGYA 2ICEC 1IBKL 1EIGA 3AQQA 1ET9A 5LMNQ 4GN4B 2IWHA 3CCVA 4DUZQ 2CWAA 2UU9Q 2RVLA 4NXMQ 5IP7H 4BBSH 2ZJPA 3BG3A 4GKJQ 2I07B 2KUMA 3KFUA 4LJZC 1EYGA 2N3SA 4OWTB 1CZWA 1TVXA 3QOJA 1E2VA 4ODGA 4ZKBB 3OIPA 4DR3L 1EFID 5IT9E 4DFAA 3FKIH 3T51B 1M1KC 3IFTA 3K5MA 4GN3B 1T5XD 1CUKA 4A3CH 3V96A 1XMQL 1G51A 1N34L 1QILA 4C56C 4C1NI 4C3IH 5IT9c 1MSHA 3BZKA 1E24A 3K0XA 2IW3A 3KOJA 1VQ5A 4DV1L 4JOIC 3JAMi 5CC4A 5D14A 1EWHA 1Y1VB 3GTPB 3CMAA 1TS5A 1HR0L 4CDCC 3FPPA 4P73A 2D5DA 3NTHA 4G7HC 2PMZB 3K80C 1ZEQX 2EE1A 3S2DH 1CZGA 4IUTA 1S5BD 4JI5L 1R9TH 1CM9A 4OWWB 1P16A 1YNND 1Q12A 1R4PB 2UXDQ 3I4MB 2HQEA 3Q24A 4K2LA 4FP5D 2EXZA 1PXUA 4NB3A 1XNQL 1Y1WH 1DYQA 1SE2A 4ALPA 4B3SL 3GD7A 4HMJA 4BY1H 2R7ZH 2F52A 1KDCA 2IJ0A 1MKHA 1YI2A 2ZTCA 2J0TD 3S2HB 4EVOA 3BYTB 4P75A 3DEOA 4DUYL 4DR5Q 5EAYA 3RLNA 4ZUIA 5C4JB 5FLXE 4Z9CB 2B2WC 1CSQA 2XN9C 3S14B 1IL2A 5DEHA 3GTJH 4AYBE 2JA5G 2R7DA 4LUVA 3HOVB 1MI2A 4JBKA 1X3PA 2IPKD 2B2VA 3MFYA 5D3DA 1AEXA 1HH2P 5L37A 4IPHA 5FLXc 4QMGA 1CFMA 3S1NH 2WKCA 1MGSA 2A6HC 3F8TA 2RA4A 3QB3A 2HHHL 1IYJB 3JAME 5G3LF 1H9KA 4RGTA 2C35B 2HCCA 3L2PA 5M3MG 2D0PA 3I70A 2Q8RE 3K58A 2ZXPA 5ELOA 4DV7Q 3VA5A 1TKWB 3HOYH 1PH3A 3VR5A 1F2YA 4HIOA 1S5CD 3SEBA 4IFDG 3JAMc 3WDNA 4A3DG 2LY7A 3BVMA 4DAPA 1ZXTA 3G7LA 2CW0D 1EFWA 4LAAA 3CC7A 4K0KL 3OOCA 3N52A 2AMCB 5CYUA 3HOXH 2K5WA 2F0WA 4L8JA 4E6IA 2KJXA 5JEAH 5FJ8G 3PCOB 4B9XA 1WTVA 2WB1B 3VR6A 5M5YB 4JI8Q 3K5NA 4DF7A 3CCQA 2CH4A 1S4ZA 4DV4L 3P7JA 4X64Q 4DNIA 4JI4Q 3BDLA 3HOWH 1Y8PB 1EEFD 4J6HA 4CKEA 2F1MA 2K01A 3J80i 1HNWQ 3GO5A 5FLMG 2RDFA 4IFDI 4MTKA 3OIQA 2F03A 4F7XA 2JJQA 2FMMA 2JN4A 4DU9A 2NVTB 3M4OH 1Q46A 3JC66 2DNEA 5IE8A 4A4IA 1B9NA 3CCRA 1QE6A 1X56A 4ME3A 1EWCA 4FXGC 2DNCA 4RMFA 1A2TA 4DAYB 4A3GB 1HJPA 4DK3C 2NVXB 3DEPA 1EYCA 2RKSA 1KDBA 2F4VL 3TRZA 4PMBA 4XQQA 5IGCA 5NUCA 3F2UA 3Q23A 4QY7A 3D8GA 1TIID 3E9HA 4QCLA 4JYAL 3TREA 4R4OA 2R92G 1KDAA 1VQ7A 3PUVA 2RCNA 4RHRA 3AB9A 1Z7TA 1N32Q 1VQLA 1MHWC 1Y8NB 4A3EG 2PMZE 4DXGA 5ELNA 3C3LA 4RGMA 3CRKC 4EQOA 1N36L 2QA4A 2MPMA 3ND9A 5C44G 1ILPA 1VQDA 1XNRL 2NVYH 3H09A 2JYOA 1QB5D 1K83H 1OXTA 4RA8A 3R2IA 2K32A 1X55A 3J80E 3H91A 4DR6Q 1JT8A 4A3FG 4LK1C 4BWGB 4FXKC 1SNCA 3TQYA 1NJIC 2BH8A 4KD4A 1VQ8A 4A3KH 2K75A 3M4PA 1J5EL 5CBEE 2JA7H 2IY5B 2UXCQ 3ONAB 2QF7A 2E74C 3J7AV 4LNQA 3CC4A 3J80c 4LF4L 1SJED 3AEVA 3VYTA 3OPOA 4H44C 1PH9A 1TY0A 1MSGA 3DWPA 4FF3A 3ICEA 3NXWA 4NP5A 4RCNA 3SK5A 1VQIA 1JORA 1HUNA 2AUJD 3K7AB 1VQCA 4DV3Q 3A0JA 1PLFA 2PZUA 1VQEA 3STBC 5C3WA 1I94L 5J39A 3C1FA 3NELA 4POGA 2R93B 4K6LA 5DNFA 5LMUL 3G71A 1I3QB 1QOHA 3SK8A 5GAHC 2K5HA 5C3EG 1Q1EA 4DK0A 2B63G 5I6WA 1YJNA 4RFBA 1RJTA 4MZ9A 4R4TA 3RZDB 4DV2L 4L5SA 3G48A 1AE3A 1BBXC 4LF5Q 2YTXA 1D1IA 4DR2L 5E7NA 4DXFA 5C0XG 1XTDA 1H95A 4BY7B 2WB1E 1M4VA 4KHPL 3ULLA 1KQSA 2VQFL 1RL2A 5IY0A 4BA2I 1IZ6A 3A8IE 4Y7NB 3I73A 1H9SA 1PYSB 3M4QA 4JI1L 1AE2A 1ZYRD 3UE1A 3URYA 4HCSA 2KQ3A 1ENCA 1VQ6A 4WORA 1VQJA 2K5DA 4IFDH 1HZAA 2QILA 4LFBQ 1KL9A 2B2UC 2A8VA 2R7FA 1EIHA 4DR1L 4C3JB 3A8JE 1TWGB 3D0FA 1SNPA 2KHSA 1OXUA 4A93G 4PZ8A 3QWNA 3HFZB 1NBWA 5FJ8H 3K59A 3DWQA 1JJCB 3T1YL 2K1BA 2NVQH 4HJAA 2N49A 1B2TA 5C0XI 1VQFA 1WD0A 1KAAA 1A0IA 3H0GB 4AQYQ 2O5IC 3J7AF 1PZID 4GS3A 5GADC 2JQOA 3G6JB 1C8CA 1IKLA 2HIVA 1SE4A 3W1GA 2NYZD 5FLMH 1X32A 1IL8A 4KD3A 2Q2UA 4OGQC 5HURA 5IYDH 1BNZA 2KHJA 5HGQA 5AJ3Q 2F0GA 3MZ5A 2ZTDA 1QUQB 3ERSX 3GTQH 2E2JB 2BCOA 1BUVT 1XYIA 3QR8A 1QZGA 3UDXA 2E5LQ 4HMIA 4KY6A 1WD1A 3HOUG 4FF1A 4P74A 1PRTF 1O7YA 4O2DA 4PV1C 3GTGB 4BBRB 3TBIB 3KLSX 3NBHB 3J81E 1EEID 1WFQA 2NZOA 1QCBD 3W5OA 1X3EA 1FJGL 2R92H 3GTMH 3CXCA 3PUWA 4R8NA 5GAGC 2Z4IA 2OTJA 1U5KA 2MHVA 4LF7Q 3UDFA 4A3EH 1PFMA 1L0YB 2A73B 3J81L 3J81c 2OF1A 3HP3A 5CBAE 1TWFH 4FXDA 2N78A 5LMNW 2A6ED 4X66Q 1EY7A 2A74C 2XWBB 1OO9B 3W1BA 3FHWA 1G91A 2O4XA 1F9SA 1FVIA 4OHJA 3DM1A 2A1AA 2ZJQA 1BCPF 2VZAA 1EUJA 4UHVA 3X3MA 5C44H 2L9HA 5EPJA 4KKTA 1PFNA 2J7ZA 4GKKQ 2AQ3B 2FFKB 4V190 3GQBA 2ATWA 1YNJD 1U4RA 1EQVA 5GQOA 2Q2TA 2Q8TA 2PYKA 2UUCL 1HNZQ 4YWKA 5FOBB 2JA8B 1SAPA 1HQRD 4BA1I 3NE5B 1Q81C 1O78A 1U4LA 4DAVA 4OX9Q 2RSNA 1PDQA 5H1SE 1EWIA 3F2CA 3GTOH 4CJ2C 4X62L 4HJ7A 1VQAA 3BZCA 3OTOQ 1CKMA 4IALA 4MTNA 3J7A5 4BBSB 2PZWA 1KLUD 1C9OA 1WTXA 4DR7Q 1EY9A 1O7IA 1EY5A 2WINB 1FGUA 4KHZA 4EGVA 2QEJC 2Z8LA 4AYBG 3CRLC 4F87A 3FKIB 4Q0FA 5KNDA 2YTVA 4UY8C 3PO3G 3S9WA 1EZ8A 1VQKA 4A3JG 3R3OA 5IWAL 2CH4W 2F4IA 1K73C 4DN4M 1D8LA 3ITPA 3BVZA 4K8JA 2N55A 5DLQE 2B63H 3E0EA 1SNOA 1OXSC 4C3IB 1K3RA 2PW5A 1WTPA 2B2TA 2WAQB 3MXNB 1JE4A 1SNQA 1LLRD 3EJIA 1B9MA 2NBFA 2RHQB 1DD2A 2V1CC 3DHQA 1B4OA 3OMGA 1I4RA 2OTLA 2IHFA 4AIMA 1PVOA 3OW2A 1J9OA 1STEA 4HR7B 1PH8A 2EVBA 1IW7D 3S2DB 1S5DD 3HG9A 1A3TA 4KJOA 1D5MC 2JSOA 1R9TB 1KRSA 2VS1A 2B2YC 3X3NA 3NQTA 1TWHB 4IZ8A 1PH2A 1BDOA 4IQZA 1PTOF 1ZKOA 2L15A 2Z1CA 4DK1A 1Y1WB 5CV7A 2EY2A 3CF5A 1FGBD 1A62A 4BY1B 2R7ZB 2N8NA 4ZAIA 2GVAA 4L5QA 4A93H 1ONLA 1VCIA 4YCVA 2KCCA 2VB3X 1VF5C 1I6VC 1FD7D 2QCPX 3A74A 4G57A 1H9SB 3PF5A 3S1MH 3IRBA 1UEBA 3GTJB 1V1QA 2VNUD 4TSSA 3M3YH 2B8FA 1ICWA 1T5EA 3E5SA 2E2HH 1BCPD 3MAQA 2MGSA 4HJ5A 3S17H 2K03A 2KBNA 4MNOA 2EYPA 2K28A 2WP8J 3S1NB 2RDHA 3KJOA 4RH6A 2Z9HA 4B3RQ 1CQVA 2UUAQ 3QG1A 5D3IB 2CWPA 2H4OA 1ENFA 1Y1VG 2K7VA 2BDNA 3HOUH 1HA6A 5F2DA 3HOYB 3K8AA 2NN6G 4JI0Q 3SE0A 5IGDA 1PH5A 4K14A 1N8RC 1JB3A 1IYUA 1VQHA 4QQBX 1QNUA 5IODA 1SJHD 4HN7A 1PRTB 1V1PA 2J4XA 2VUMH 4RGOS 1E0BA 1LUZA 3HOXB 2JK8A 3PV0A 1STNA 1F77A 2ZTEA 3TZUA 2PO4A 4QF4A 4QGUA 4U673 4R4QA 4YHHL 3I4MG 3HOZH 2ES2A 1QG7A 2EYOA 1ET6A 2PW7A 5KYIA 4LF6Q 5K5PA 1I4HA 2K50A 4RKLA 1X3GA 1UE1A 1RKNA 3ULPA 3HOWB 4N8FA 5IT9L 3HEJA 1MD2D 1SMYD 4K6DA 3WOFA 1CA5A 3E0JA 2NN6I 2R61A 4JV5L 4A3MH 1TQOA 3T1HQ 2JE6I 4O42A 1D6EC 4P72A 1WTHA 4JVZA 4DGZA 5DM63 1IBML 3M4OB 1K8GA 3HOVG 5JVH3 1BBUA 3CCMA 4ZQ3A 2B2VC 4LW1A 2UUBQ 2F3VA 2NZHA 1SNMA 4JI2L 4QL5A 2UXBQ 5EKKA 2D9UA 1CTMA 5A35A 3H3VI 1B3QA 4MHEA 4DV6Q 4MIUA 1VS0A 3HKZB 2AQ1B 3D4DA 1PTOD 3I4LA 3EBEA 1U4PA 4JI6L 2XRSD 4X3KA 4RAUC 4XDXA 3K57A 2OEOA 1F9QA 4IOCA 3MHBA 1SFOH 4YCUA 1S3OA 1WTOA 1VMPA 1WI5A 4YCWA 2LMCB 3K5LA 1KLGD 4LFCL 5IP9G 4LFAL 5IGGA 2OWOA 2H1EA 4A3JH 3CMEA 2DJGC 1EU3A 4KV6A 4NMZA 1G291 2ZM6Q 1ML0D 4O1NA 3U4ZA 4F88A 4DV0Q 2ICIA 1L2FA 2EJMA 1QZHA 2NVYB 2WB1G 1I6HH 1IBKQ 4FDBA 2SNMA 1DOKA 5FLXL 1GUNA 1U4MA 3PF4A 3VR3A 5CV6A 2EXDA 1EZ6A 4NDXA 4PG3A 1E1OA 3O13A 3CW2C 4XQNA 2CQAA 4X3TA 3PMFA 4FF2A 1S5ED 4A3KB 4GNXA 4L5TA 4DR3Q 5I9PA 3ERQA 2JA7B 2KEEA 5M5WH 1E2ZA 1RHPA 3U9OA 3JAML 3A5UA 5GROA 1L1OA 3SK6A 3QJYA 2ID0A 3KUPA 1HZ9A 4A3GG 5FO9B 3C2PA 2ASBA 1YHAA 1QUQA 2EDGA 1PYBA 1XMQQ 4FNFA 3CCJA 1N34Q 2O2LD 4HCEA 3FP9A 4YY3L 3NQIA 2QW7A 3I91A 4QIWE 4DV1Q 2Q2IA 1KNEA 2Z6BA 3EFXD 1NR2A 2EYJA 5IIFA 1HR0Q 4K8IA 2PZTA 3NBHA 4XQJA 4R1JA 3DMUA 1JWUD 3S1RH 1MJCA 1AZQA 1WTRA 1VMCA 2EJGC 1SRUA 1YHQA 1GJXA 4GZYC 4NW2A 1VQNA 5GAEC 2F0LA 4JI7L 4JI5Q 2QGQA 3LX0A 4L6TB 3GTLH 1EY0A 3M85A 5IGBA 3K5OA 2BE5D 1CHQD 5C4HA 3NSWA 3ZYYX 1XNQQ 1IXRA 1D5XC 4B3SQ 3RNUA 2XVSA 2YTYA 1VQPA 1TS2A 2HUGA 3ND8A 2PPBC 5E1FA 5KGUA 1I4PA 1Q3LA 4DUYQ 1H9JA 4IUUA 4RG1A 2Q2HA 3KF6A 2TSSA 3A55A 4O0AA 2KVMA 4OO1G 1GUWA 4J1MA 3EA6A 2E75C 1K0RA 2F0IA 1GHKA 2JEAI 2PI2E 2KHIA 4YIJA 2GA4B 1VQ4A 1CSPA 2F0PA 1DGSA 2NVQB 3H3VH 5LL6X 1QVFA 3I90A 1SYBA 2D2CC 5JJLA 4HIKA 1GVPA 3J81j 3HKZE 5M5XH 2HHHQ 1L0XB 4IO9A 1A2UA 1ESFA 1M90C 3TP6A 1XMOL 5JJZA 5T1GA 1DOLA 4R9WA 2R93G 2DY8A 5ELDA 3MXPA 2WV6D 2ALYB 4LFBL 5C4JH 3VYUA 5BR8L 1V1PB 1E2WA 1TS4A 4OO1I 3MXUA 5M3FB 3RZOB 1DM0B 4K0KQ 1A3UA 1SR3A 2L55A 2R6GA 1UE5A 2PQEA 3J80L 2IL8A 3PO2G 3MXNA 4BY7G 5FK9C 1E3PA 2EYLA 4KY7A 4LF8L 4C3HG 2AKWB 2QEXA 4DV4Q 2F0VA 2MP1A 2R92B 3GTMB 3I8ZA 4OIKA 5JPMC 1Q1BA 5CV4A 1HFGA 1PTOH 5KNBA 1CK1A 3MTSA 4L63B 3HGBA 3CCSA 3CCUA 2IHEA 2EY6A 4B3TL 1HTLD 1YBYA 1EL0A 1EY4A 3KLRA 5KYLA 5IP9H 3LNNA 5JOBA 4FO2A 1RIPA 2AUKA 4DR4L 1OTCA 3A7AB 4CDDC 3U50C 2JA5H 1CKNA 1P8LA 2DY7A 2JA9A 1LTBD 3CC2A 2EJFC 1X3FA 3AYHB 1I50B 1J6QA 1STHA 1PH4A 1KIXA 4RCOA 2F4VQ 3MA2B 2F0DA 3H0GG 1LT3D 4TQUS 3S1QH 4JYAQ 3VYSA 4ILWA 1K8AC 3U4VA 2M00A 5M3MH 1PRTC 4IUNA 4A3BG 1RCVD 4YWMA 4GLXA 5D65A 2A5HA 4LWCA 5CV5A 3P20A 4CKBA 4IUVA 2A19A 2A69C 4CHTB 1YVCA 2EYHA 3GTOB 1NMFA 4A3DH 4K5VA 1RODA 1STYA 4OELB 1N36Q 2A68C 3BVGA 4XYQA 1IHZA 2KOLA 2A6HD 1H9MA 4ZRZA 1DXMA 1PFBA 4I65A 2KCMA 2MO1A 2G5DA 3I4NG 2K5VA 1XNRQ 3CAMA 2EZVA 4BBRG 3CD6A 1K0SA 2KEDA 1EQTA 1F9PA 3VR2A 2I5LX 2BA1A 3A5ZB 3S24A 3CHBD 5M9OA 1XPUA 4EQNA 2SOBA 1YJ9A 2DUDA 1C48A 4GNXB 3DM3A 2WKDA 1PZJD 4KN4C 4GLVB 4KY5A 2B63B 1J5EQ 4OX9L 3DUZA 3T53B 1L1OB 5C4XG 5EPLA 2Y0SB 3Q6SA 4LF4Q 3BJUA 5CV8A 3PGZA 3CCEA 2MO0A 2RBMA 4FVMA 4R4CA 3ZJYC 2AWOA 1V1OA 1M8AA 3NEMA 1D2BA 3D3RA 2FMCA 1LTSD 1QVGA 1NY4A 1I94Q 2JA6G 3GP7A 1A8VA 3KYHC 3NTKA 3RD4A 5IYBG 1HNXL 1HTPA 3RLFA 5LMUQ 1NR4A 1ILQA 2X6GA 2V4DA 4DV5L 1C7YA 1Q82C 1A3VA 2IT1A 3OYYA 2JA8G 1BVSA 5EGTA 4OIJA 4JG2A 3IAYA 4APVA 4NPSA 2XSCA 2I5MX 4DV2Q 4A93B 1XJVA 4C1NK 4DR2Q 4JW0A 3F2DA 4OL7A 5IP7G 1PH1A 4P71A 1B7YB 1K9MC 1BO0A 1B8AA 1RTNA 1KXLA 4L5RC 1WCMB 3D31A 2VQFQ 3S1MB 1RTOA 3M3YB 2G9DA 3DWAA 4IJHA 4Y52H 2E2HB 2SDFA 4OWXB 4HJ9A 1NCVA 4JI1Q 2AHOB 1T9HA 3FKIG 3KF6B 5JAVA 2EYFA 3CPWA 3S17B 5EPKA 1S72A 4A3CG 2F0TA 2K5NA 4XT3B 1I4XA 1PMRA 4A3FH 1PH6A 5K36G 1TT2A 1YNNC 4HTHA 1D5ZC 3FMCA 3PQIA 4C3IG 4FF4A 5CR3A 4JPBW 2B2TC 1WOCA 2WACA 4DR1Q 3HS0C 2B3GA 4F8MA 3GTKH 1UUPA 4NKLA 3HOUB 4HAEA 4LF9L 1JOKA 5FO7B 1EYDA 3T1YQ 2VQEL 1WTQA 3PO2H 1KRTA 4BY7H 4B3ML 3QOLA 1IBLL 2L12A 1QVCA 3IL8A 4X65L 1NUCA 3R93A 4C3HH 2F0MA 3TEHB 2KA7A 1EIFA 3SHLA 3I2ZA 4ME5A 2NTSA 3D4RA 2LXJA 2M9VA 5IOCA 2XGTA 2VUMB 1YIJA 5C5LA 2K5QA 2DJFC 2HD3A 3HKSA 4DNTB 1DZ1A 4KLKA 2Q8IB 3HOZB 2D62A 1YHBA 1E7ZA 1Y1WG 5JVG3 3N6RA 4HEDA 1NTGA 1N33L 5C3EH 5DAUA 2R7ZG 1JWMD 1QNKA 1LABA 1Z6HA 4JI3Q 1E22A 4MN3A 5LMNL 1Y69U 1HQMC 1PYWD 2L4NA 2PNHA 1R4QB 2RF4A 1B70B 1Y14B 2F0KA 1JJ2A 3TP8A 4DUZL 4GOPA 1VF7A 3H6MA 4A3MB 2UU9L 3H0GH 4NXML 1FL0A 2LXKA 5C0XH 2FXQA 3STBD 4DNRB 4JBWA 4GKJL 4PQXA 4QJFA 3TS0A 5E4WC 2HDLA 1FJGQ 3SK4A 2WFWA 2K14A 3TDQA 3A56A 4A3BH 5ELBA 4IOAA 1W6JA 4PZ7A 4LMQD 3KBGA 1TWCH 4XXEA 1X9NA 2CW0C 1NAPA 1OXVA 4RGNA 3NP8A 5HGTA 4A3IG 3KDFA 3UDGA 1EIYB 1V43A 1J8IA 1EYAA 2Y0SE 2CCZA 3PUZA 1CKNB 3BDOA 2K4KA 3M9BA 4LUOA 2QDLA 2RQXA 3BDCA 3CQZH 1EOTA 3OWFA 2ENBA 1SFOB 3HOYG 2F3WA 3I4NH 2L1BA 3T1HL 3U9SA 3VDYA 2XNAC 1BKBA 3NBIA 1SROA 2F0OA 1YEZA 3AMUA 2E2IH 4AYBB 3OWEB 5FO8B 1BR9A 1GOZA 1HCZA 4A3JB 1SSOA 1A15A 3TN2A 1CA6A 1FR3A 3I7FA 1SYCA 2UUCQ 2ZJRA 1B53A 1NMGA 2QKIC 1VQMA 5LHY1 5CV9A 2UXDL 2E8GA 3K0YA 1I6HB 3MVVA 5C4XH 1TS3A 3SGIA 2NTTA 2BH2A 3WWVA 2Z4HA 4X62Q 4ZUJA 3OW7A 3UDIA 4A3LG 4EQ5A 1HR0W 2K05A 2VXWA 2O5JC 5TSSA 3BU2A 1FYCA 3CCLA 1NSNS 4HSVA 2Z6KA 4WJWA 4DR5L 5M5WB 2JA6H 3M4YA 1D1KA 3S16H 3FDTA 1W6KA 4KMUC 4C2MH 2JEBI 5IWAQ 2KECA 2ZM6L 2KCTA 4OXPA 2JA8H 4CGYB 1I4QA 3OSOA 3KF8A 4ID6A 4DK6C 3HKZG 2YU9H 2MJ8A 1YNXA 4NXNQ 5FKAC 3M7NA 2BDOA 1LTID 3KBXA 3S1RB 1SBBB 2HDMA 4DV7L 2L5TA 2EY1A 2ZXOA 3D6CA 3M7GA 3QO2A 2VW9A 1NNXA 3D4WA 2XIWA 2I46A 1D7QA 4TKOB 1KNAA 2F0QA 1S40A 2NUCA 4WRDA 3GTLB 3S15H 1F2ZA 1BCPB 1I5FA 2ZXRA 5C3XA 1I4GA 1G2TA 5E3FA 1ESRA 5K36H 1BXTA 1G8ZD 3EIVA 1JICA 3PIOA 3NHHA 5I2YA 1CT1D 4JI8L 1CI3M 2EOTA 3R8BA 1FNUA 1STBA 5BN4A 2WAQE 3NWTA 4UP7A 5JPNC 1UWVA 3T16A 4X64L 3I56A 3GV6A 4JI4L 1B1ZA 2OXPA 4DPGA 4G4KA 4J15A 2RDGA 3RMHA 1HNWL 4IUPA 4A3KG 4QB4A 4GNXC 1RD9D 3L0OA 1SN8A 3FRPB 4UP9A 4ZCKA 1LT6D 2JA7G 1LACA 2MFIA 5EBDA 2PNRC 1PFSA 3VA7A 1TWHH 1L1OC 5EQ0A 1N9WA 1HPCA 1TWAH 2LFNA 1GUGA 1LO5D 1UAPA 3PO3H 1AZPA 3MEFA 3P1HA 1W2BA 3J7YW 5M5XB 2GVBA 4JCVE 1X6OA 2YYZA 2Z0SA 1WVLA 3P75A 3LWUA 4JOIA 3I55A 1K83B 4TVAB 3RN2A 4WFN3 4H7BA 5DM73 4BXXG 5IGEA 1MBYA 2F0UA 3MWYW 3G4SA 4G7OC 3PUYA 1N32L 1ZYRC 2K52A 2IX0A 4PMCA 2CFMA 2B29A 1JC7A 4A75A 4Q5VA 5C6AA 1FNWA 3VYRA 1GO3E 4YHHQ 4B9WA 4WJ3M 3A7LA 4A3IH 1JCKB 5EBCA 5J3BA 4S3SA 2VY3A 1LT5D 4BS9A 4UDUC 4UP8A 3SVMA 3ULJA 2EY5A 5EJWA 4YWLA 1LM0A 2F0SA 4DKAC 1X54A 1YZ6A 1PTOB 4XT1B 5JEAJ 4GOPB 4POFA 3NENA 1DCZA 4JV5Q 2E76C 4QUCA 3BS1A 4DR6L 2GN5A 4HIDA 2XTIA 2G9HD 3R2TA 2VB2X 3IFDA 4J8QA 3FPUB 1SYDA 1IBMQ 2B2WA 1SEBD 2JA5B 3EVQA 4N9PA 1VQBA 1F2MA 2UXCL 3V2TA 4R8IA 2P5ZX 3KDFB 1LYLA 4JI2Q 1NE3A 4CBVA 1LTRD 4HIMA 4KKUA 2F0FA 5J22A 4PMWA 3H15A 2XWJB 1VQOA 1Z47A 4HJ8A 3S1QB 1JR0D 1SYEA 4JI6Q 4DV3L 3C46A 2ZT9C 4A3LH 4GLAC 5M3MB 2F0EA 1HXYD 5HY6A 3LGJA 4RHSA 3SR1A 1KD1C 3EQLC 1Y1VH 3OHXC 3NWSA 3GTPH 1IYVA 1G6ZA 2L11A 5IYDG 2F0HA 2N88A 2NN6H 4LUZA 4LFCQ 5M3FG 4U68A 4LFAQ 4ULLA 1EQQA 4A3DB 4IJLA 3KJPA 1K8OA 3UE0A 1SLJA 3CP0A 3T4AC 1WTWA 1JJGA 3L7ZC 2NB0A 4LF5L 3I4OA 1GM5A 1U9RA 3TS2A 2A6EC 1GKHA 4KN7C 3PIPA 3I4MH 1UE7A 4JBJA 3RLOA 1LTTD 1ASYA 4KK7A 4ZLTF 3NTIA 4KKSA 4M8AA 1F2LA 4UAIA 3F2BA 1TY2A 1Q7YC 1GD7A 3RR5A 4I7ZC 2FJ2A 1ASZA 3AFQA 2X69A 3S2HH 4H13C 3E9IA 3NPPA 1YNJC 2MQHA 1EY6A 2RSOA 1UNSA 3S14H 3GTQB 2OQ0A 4CJ0B 4EX5A 1CKOA 3HOVH 2C9OA 1JOOA 5IYCG 3GDEA 1STAA 3KF8B 3T56B 3W3AA 4I7AA 4YY3Q 1K3BC 5CMDA 3FEWX 1OXXK 1HA5A 4AQYL 3MXGA 2EQSA 2SEBD 5G3LD 3QIAA 3TMEA 1KTKA 2YV5A 1V9PA 2F0NA 4XIGS 3SXHA 4JI7Q 4A3EB 1X65A 5AJ3L 1PA6A 3MC0B 1A6XA 3A8KE 2EPBA 4IN3A 1TWFB 2PQAA 2L0CA 4TRDA 5ELEA 2PCFB 4C3JG 2OCEA 3OMCA 2E5LL 2M2LA 2FINB 4EQPA 1KABA 2LS01 5C44B 4IUQA 2OT2A 4UPAA 4IPDA 5M5YH 3F1ZA 2LKVA 3BYYB 2NZ1D 3EROA 3T13A 4BXXH 1IW7C 1GUTA 4A3FB 2AWNA 4LF7L 1Q8IA 2JXMB 4PNYA 4RKBA 5ELFA 4M1UB 2Y0SG 1WYDA 5KIXA 3GTKB 1DOMA 3PIO3 2HCIA 2X6LA 3V05A 4IFDJ 4X66L 2NVTH 3PO2B 1SYFA 2CQOA 3TSSA 4A3GH 1HFNA 1AN8A 4C3HB 4AH6A 3AFPA 1Q86C 4CDFC 2K33A 2NVXH 3J81i 1PH7A 3MFGA 4QUFA 2NWGA 4IPCA 1HZCA 5ISRA 4K5WA 1JOQA 1XMOQ 4GKKL 1VQGA 4G7ZC 1PV4A 2MUYA 2E2DC 1BCPC 1MIUA 1UE6A 5BR8Q 1CHPD 4B08A 2HQLA 4CDEC 1HNZL 1HZBA 1F9RA 5C3EB 1VQ9A 3LWEA 3E3XA 1L0WA 2VL6A 3Q8DA 1LTGD 3OTOL 2HT1A 3K6OA 4KTAA 5ELCA 1ICFB 1WCMG 1A63A 4LF8Q 4DR7L 2R3ZA 4HSPA 5CGKA 1BF4A 3DLLA 4A3BB 5KEEA 1Z9FA 2RCFA 4K5XA 1GHJA 1TWCB 1XPOA 4WJ4A 2EIFA 1G2SA 5A2QE 3CPFA 3PSIA 3VR4A 1HUMA 4B3TQ 1X3QA 5KNCA 3W2DA 1B44D 1GXDC 3H3VC 1Y8OB 1IKMA 5M3FH 3RZOH 1SMXA 4OO1H 2B2UA 4DR4Q 1STGA 4JI3L 1UEAB 3CQZB 3AU7A 5A2QL 5J1ZA 1C0AA 4KJNA 4ZK9B 1XX8A 3I4NB 5BN5A 1ENAA 2BA0A 1CQFA 2CHBD 1AP0A 3DXJC 1LT4D 4BBSG 1SYGA 1SMYC 2E2IB 2TMPA 4X3UA 5IGFA 1MJEA 4KHPQ 3L3OC 3K7AH 3Q0AA 2VUMG 4ZKCB 4DA2A 3IKJA 1TU2B 2PI2A 1FNVA 4FYDA 3SDZA 1AW7A 3HOZG 1AFPA 2R93H 4K2KA 2B8GA 5C4XB 1I3QH 2AQ2B 1RDPD 1EU4A 1QJOA 4R4IA 2CKZB 5EKIA 1JB7A 3ER0A 1AH9A 1SDFA 2WAQG 3BZDB 5IYCH 3RZDH 1VDZA 5I2XA 1I50H 1PTOC 3RUZA 4GOPC 4A3MG 1LTAD 4IPGA 2MNAA 3A54A 4IURA 3K7UC 2JA6B 5T1IA 2XRQD 3S16B 1BOSA 1G6PA 1U0LA 4KHVA 1GUOA 3D6WA 4Y7NH 4C2MB 4H0LC 1HRJA 2LSSA 2IX1A 1JQYD 4KI0A 1O7ZA 2DN8A 1PHJA 5KRUA 1B50A 4N8X1 1EY8A 2YU9B 1XPRA 3PIP3 4B3RL 2KENA 1BBWA 2JP1A 2UUAL 1KHIA 4RWSC 4C3JH 1TWGH 2EYMA 5AFWA 1Q90A 1KC8C 4BY1G 1V8QA 2SNSA 3I72A 1H9RA 1EOVA 1K28A 1SNDA 3TZDA 4JI0L 1DJRD 2RHSB 1PZKD 4N9TA 5C0XJ 1BQQT 3S15B 1W3SA 2CVRA 5COYA 4OONA 1HNXQ 1II3A 4JC0A 5LL6S 1SE3A 3CU7A 1XWEA 3J7ZC 1JMCA 3RN5A 4DV5Q 3TP5A 3WOEA 3NUCA 1WJJA 4P2CB 3G6EA 3HZXA 5C4ZA 3B6YA 4ZYSA 2PQAB 4LF6L 3GV3A 5I9OA 1C4QA 1GUSA 1Q8KA 2FHTA 3MEHA 2KCNA 4H02A 4NXNL 4CKCA 2E2JH 1S5FD 2C5CA 2BOSA 1EQRA 5I6YA 1LTLA 2IX3A 4JK1C 2HIXA 4XTCS 5EKLA 1KAWA 3E6ZX 2F3IA 1E1TA 2Z6KC 1DONA 3L9AX 3GTGH 1JE5A 1PRTD 2WIIB 4V0BA 4BBRH 1XTCD 1TXYA 4GN5A 1XXGA 3CKIB 1TWAB 2OQKA 3EN2A 1SE8A 2H5XA 3TP7A 3PO3B 2A69D 3HRZC 1QWYA 5JJIA 3HOXG 2UUBL 4XYOA 3U58A 5JEAG 3KK7A 4DAYA 4JBMA 2UXBL 2A68D 1O7LA 2I0QA 2BE5C 4DAMA 5I4DA 1RF2D 2QDBA 4DV6L 3I3CA 4CJ1B 4LF9Q 3H94A 4OEMB 4X3SA 2VQEQ 3UI2A 2I5HA 5E4XA 4X6AH 3HOWG 1K8MA 4PZ6A 1IBLQ 3Q22A 4B3MQ 4X65Q 3KLSA 1WCMH 1B3AA 5BN3A 3PUXA 1HHVA 3NK9A 3C1EA 1SXTA 3FVQA 1LV9A 2D0OA 4A76A 2B2YA 1YITA 5JJKA 2B39A 5IYBH 4A3IB 2K04A 1TR5A 1O80A 2K6AA 1JWSD 3KLWA
chains in the Genus database with same CATH topology
2F0JA 4ABNA 4QIWB 5C5MA 5CORA 2ICEC 1EIGA 1ET9A 2IWHA 2RVLA 3BG3A 2I07B 2KUMA 4LJZC 1CZWA 1TVXA 3QOJA 1E2VA 4ODGA 4ZKBB 3OIPA 1EFID 5IT9E 4DFAA 3T51B 3IFTA 3K5MA 1T5XD 3V96A 1QILA 4C56C 4C1NI 1MSHA 2IW3A 5CC4A 5D14A 1EWHA 1Y1VB 3GTPB 1TS5A 3FPPA 2D5DA 3NTHA 4G7HC 2PMZB 1ZEQX 2EE1A 1CZGA 4IUTA 1S5BD 1CM9A 1YNND 1Q12A 1R4PB 3I4MB 2HQEA 3Q24A 4K2LA 4FP5D 2EXZA 1PXUA 1DYQA 1SE2A 3GD7A 4HMJA 1KDCA 2IJ0A 2J0TD 3S2HB 4EVOA 3BYTB 3DEOA 4ZUIA 5C4JB 5FLXE 4Z9CB 2B2WC 2XN9C 3S14B 5DEHA 3HOVB 1MI2A 1X3PA 2IPKD 2B2VA 3MFYA 5D3DA 1AEXA 4QMGA 1CFMA 2WKCA 1MGSA 2A6HC 2RA4A 3QB3A 3JAME 5G3LF 1H9KA 4RGTA 2HCCA 3I70A 2Q8RE 3K58A 2ZXPA 3VA5A 1TKWB 3VR5A 1F2YA 1S5CD 3SEBA 4IFDG 3WDNA 2LY7A 3BVMA 4DAPA 1ZXTA 3G7LA 2CW0D 4LAAA 3OOCA 3N52A 5CYUA 2K5WA 2F0WA 4L8JA 4E6IA 2KJXA 5JEAH 4B9XA 1WTVA 2WB1B 3VR6A 5M5YB 3K5NA 4DF7A 1S4ZA 3P7JA 3BDLA 1Y8PB 1EEFD 4J6HA 4CKEA 2F1MA 2K01A 3GO5A 2RDFA 4IFDI 2F03A 3OIQA 4F7XA 2FMMA 4DU9A 2NVTB 2DNEA 1B9NA 1QE6A 1EWCA 4FXGC 2DNCA 4A3GB 1A2TA 2NVXB 3DEPA 1EYCA 2RKSA 1KDBA 4PMBA 4XQQA 5IGCA 5NUCA 3F2UA 3Q23A 3D8GA 1TIID 4QCLA 1KDAA 3PUVA 4RHRA 3AB9A 1Z7TA 1Y8NB 4DXGA 3C3LA 4RGMA 3CRKC 4EQOA 2MPMA 3ND9A 1ILPA 3H09A 2JYOA 1QB5D 1OXTA 4RA8A 3R2IA 2K32A 3J80E 3H91A 4LK1C 4BWGB 4FXKC 1SNCA 4KD4A 5CBEE 3ONAB 2QF7A 2E74C 3J7AV 1SJED 3VYTA 3OPOA 4H44C 1TY0A 1MSGA 3DWPA 4FF3A 3NXWA 4NP5A 4RCNA 3SK5A 1JORA 1HUNA 2AUJD 3K7AB 1PLFA 2PZUA 5C3WA 5J39A 3C1FA 2R93B 4K6LA 5DNFA 1I3QB 1QOHA 3SK8A 1Q1EA 4DK0A 5I6WA 4RFBA 1RJTA 3RZDB 1BBXC 1D1IA 4DXFA 5C0XG 4BY7B 1M4VA 4BA2I 3A8IE 4Y7NB 3I73A 1H9SA 1ZYRD 3URYA 4HCSA 2KQ3A 1ENCA 4WORA 2K5DA 4IFDH 2QILA 2B2UC 1EIHA 4C3JB 3A8JE 1TWGB 1SNPA 2KHSA 1OXUA 3QWNA 3K59A 3DWQA 2K1BA 1B2TA 5C0XI 1WD0A 1KAAA 3H0GB 2O5IC 3J7AF 1PZID 3G6JB 1C8CA 1IKLA 1SE4A 2NYZD 1X32A 1IL8A 4KD3A 4OGQC 5HURA 1BNZA 2F0GA 3MZ5A 2E2JB 2BCOA 1BUVT 1XYIA 4HMIA 4KY6A 1WD1A 4FF1A 1PRTF 1O7YA 3GTGB 4PV1C 4BBRB 3TBIB 3KLSX 3J81E 1EEID 1QCBD 3PUWA 4R8NA 2Z4IA 2MHVA 1PFMA 1L0YB 2A73B 3J81L 2OF1A 3HP3A 5CBAE 4FXDA 2A6ED 1EY7A 2A74C 2XWBB 1OO9B 1G91A 2O4XA 1F9SA 4OHJA 3DM1A 1BCPF 3X3MA 2L9HA 5EPJA 4KKTA 1PFNA 2J7ZA 2AQ3B 2FFKB 4V190 3GQBA 1YNJD 1U4RA 1EQVA 2Q8TA 2PYKA 5FOBB 2JA8B 1SAPA 1HQRD 4BA1I 3NE5B 1O78A 1U4LA 4DAVA 2RSNA 1PDQA 4CJ2C 4IALA 4BBSB 2PZWA 1KLUD 1WTXA 1EY9A 1EY5A 2WINB 4KHZA 4EGVA 2QEJC 2Z8LA 3CRLC 4F87A 3FKIB 4Q0FA 5KNDA 3S9WA 1EZ8A 3R3OA 2F4IA 4DN4M 3ITPA 3BVZA 4K8JA 2N55A 1SNOA 1OXSC 4C3IB 2PW5A 1WTPA 2B2TA 2WAQB 1JE4A 1SNQA 1LLRD 3EJIA 1B9MA 2NBFA 1DD2A 3DHQA 1B4OA 3OMGA 1I4RA 1J9OA 1STEA 4HR7B 2EVBA 1IW7D 3S2DB 1S5DD 3HG9A 1A3TA 4KJOA 1D5MC 2JSOA 1R9TB 2B2YC 3X3NA 3NQTA 1TWHB 4IZ8A 1BDOA 4IQZA 1PTOF 1ZKOA 2Z1CA 4DK1A 1Y1WB 5CV7A 2EY2A 1FGBD 4BY1B 2R7ZB 4ZAIA 1ONLA 1VCIA 2KCCA 2VB3X 1VF5C 1I6VC 1FD7D 2QCPX 4G57A 1H9SB 2VNUD 3GTJB 4TSSA 2B8FA 1ICWA 1T5EA 3E5SA 1BCPD 3MAQA 2MGSA 2K03A 2EYPA 2K28A 2WP8J 3S1NB 2RDHA 4RH6A 1CQVA 3QG1A 5D3IB 2H4OA 1ENFA 2K7VA 2BDNA 1HA6A 5F2DA 3HOYB 2NN6G 3SE0A 5IGDA 4K14A 1JB3A 1IYUA 1QNUA 5IODA 1SJHD 4HN7A 1PRTB 1V1PA 2J4XA 4RGOS 1E0BA 3HOXB 3PV0A 1STNA 1F77A 3TZUA 2PO4A 4QF4A 4U673 1QG7A 2EYOA 1ET6A 2PW7A 5KYIA 5K5PA 1I4HA 4RKLA 1RKNA 3HOWB 5IT9L 3HEJA 1MD2D 1SMYD 4K6DA 3WOFA 1CA5A 3E0JA 2NN6I 2R61A 1TQOA 2JE6I 4O42A 1D6EC 4DGZA 5DM63 3M4OB 5JVH3 4ZQ3A 2B2VC 2F3VA 1SNMA 5EKKA 2D9UA 1CTMA 5A35A 4MHEA 4MIUA 3HKZB 2AQ1B 3D4DA 1PTOD 3I4LA 1U4PA 2XRSD 4X3KA 4RAUC 4XDXA 3K57A 2OEOA 1F9QA 3MHBA 1WTOA 1VMPA 2LMCB 3K5LA 1KLGD 5IGGA 2H1EA 1EU3A 4KV6A 4NMZA 1G291 1ML0D 4O1NA 4F88A 2ICIA 2EJMA 2NVYB 2SNMA 1DOKA 5FLXL 1GUNA 1U4MA 3VR3A 5CV6A 1EZ6A 4NDXA 3O13A 4XQNA 2CQAA 4X3TA 3PMFA 4FF2A 1S5ED 4A3KB 5I9PA 3ERQA 2JA7B 2KEEA 1E2ZA 1RHPA 3U9OA 3JAML 3SK6A 3QJYA 2ID0A 3KUPA 5FO9B 3C2PA 2EDGA 4FNFA 2O2LD 4HCEA 3NQIA 3I91A 1KNEA 3EFXD 1NR2A 2EYJA 5IIFA 4K8IA 2PZTA 3NBHA 4XQJA 3DMUA 1JWUD 1AZQA 1WTRA 1VMCA 2EJGC 1GJXA 4GZYC 4NW2A 2F0LA 3LX0A 4L6TB 1EY0A 3M85A 5IGBA 3K5OA 2BE5D 1CHQD 5C4HA 3NSWA 3ZYYX 1D5XC 2XVSA 1TS2A 2HUGA 3ND8A 2PPBC 5E1FA 5KGUA 1I4PA 1Q3LA 1H9JA 4IUUA 2TSSA 3A55A 2KVMA 4OO1G 1GUWA 4J1MA 3EA6A 2E75C 2F0IA 1GHKA 2JEAI 4YIJA 2GA4B 2F0PA 2NVQB 5LL6X 3I90A 1SYBA 2D2CC 1L0XB 1A2UA 1ESFA 3TP6A 5JJZA 5T1GA 1DOLA 4R9WA 2DY8A 5ELDA 3MXPA 2WV6D 3VYUA 1V1PB 1E2WA 1TS4A 4OO1I 3MXUA 5M3FB 3RZOB 1DM0B 1A3UA 2L55A 2R6GA 2PQEA 3J80L 2IL8A 3MXNA 5FK9C 2EYLA 4KY7A 4C3HG 2F0VA 2MP1A 2R92B 3GTMB 3I8ZA 4OIKA 5JPMC 1Q1BA 5CV4A 1HFGA 1PTOH 5KNBA 1CK1A 3MTSA 4L63B 3HGBA 2EY6A 1HTLD 1EL0A 1EY4A 3KLRA 5KYLA 3LNNA 5JOBA 4FO2A 2AUKA 3A7AB 2DY7A 1LTBD 2EJFC 1I50B 1STHA 4RCOA 3MA2B 2F0DA 1LT3D 4TQUS 3VYSA 4ILWA 2M00A 1PRTC 4IUNA 1RCVD 5D65A 2A5HA 5CV5A 3P20A 4CKBA 4IUVA 2A69C 4CHTB 2EYHA 3GTOB 4K5VA 1RODA 1STYA 2A68C 3BVGA 4XYQA 1IHZA 2KOLA 2A6HD 1H9MA 4ZRZA 1DXMA 1PFBA 4I65A 2EZVA 2KEDA 1EQTA 1F9PA 3VR2A 2BA1A 3CHBD 5M9OA 4EQNA 2SOBA 1C48A 2WKDA 1PZJD 4KN4C 2B63B 4KY5A 3DUZA 3T53B 5EPLA 2Y0SB 3Q6SA 5CV8A 2RBMA 4FVMA 2AWOA 1V1OA 1M8AA 1D2BA 3D3RA 2FMCA 1LTSD 3GP7A 3NTKA 3RD4A 1HTPA 3RLFA 1NR4A 1ILQA 2X6GA 2V4DA 1A3VA 2IT1A 5EGTA 4OIJA 3IAYA 2XSCA 4A93B 4C1NK 4OL7A 1BO0A 1RTNA 1WCMB 3D31A 3S1MB 1RTOA 3M3YB 2G9DA 3DWAA 2E2HB 2SDFA 1NCVA 5JAVA 2EYFA 3S17B 5EPKA 2F0TA 4XT3B 1I4XA 1PMRA 5K36G 1TT2A 1YNNC 4HTHA 1D5ZC 3FMCA 4C3IG 4FF4A 5CR3A 2B2TC 2WACA 3HS0C 4F8MA 1UUPA 4NKLA 3HOUB 4HAEA 1JOKA 5FO7B 1EYDA 1WTQA 3QOLA 2L12A 3IL8A 1NUCA 3R93A 2F0MA 2KA7A 3SHLA 4ME5A 2NTSA 3D4RA 2M9VA 5IOCA 2VUMB 5C5LA 2K5QA 4DNTB 1DZ1A 2Q8IB 3HOZB 2D62A 5JVG3 3N6RA 4HEDA 5DAUA 1JWMD 1QNKA 1LABA 1Z6HA 4MN3A 1Y69U 1HQMC 1PYWD 2L4NA 1R4QB 2F0KA 3TP8A 4A3MB 1VF7A 3H6MA 5C0XH 4DNRB 4JBWA 4PQXA 5E4WC 2HDLA 3SK4A 3TDQA 3A56A 5ELBA 1W6JA 4LMQD 3KBGA 4XXEA 2CW0C 1NAPA 1OXVA 4RGNA 3NP8A 5HGTA 1V43A 1J8IA 1EYAA 3PUZA 3BDOA 2RQXA 3BDCA 1EOTA 3OWFA 2ENBA 1SFOB 2F3WA 2L1BA 3U9SA 2XNAC 3NBIA 2F0OA 3AMUA 4AYBB 3OWEB 5FO8B 1BR9A 1GOZA 1HCZA 4A3JB 1SSOA 1A15A 3TN2A 1CA6A 1FR3A 1SYCA 1B53A 2QKIC 5LHY1 5CV9A 3K0YA 1I6HB 3MVVA 1TS3A 2NTTA 2Z4HA 4ZUJA 3OW7A 2K05A 2VXWA 2O5JC 5TSSA 1FYCA 1NSNS 4HSVA 4WJWA 5M5WB 3M4YA 1D1KA 3FDTA 1W6KA 4KMUC 2JEBI 2KECA 4CGYB 1I4QA 3OSOA 3KF8A 4ID6A 2MJ8A 5FKAC 3M7NA 2BDOA 1LTID 3KBXA 3S1RB 1SBBB 2HDMA 2L5TA 2EY1A 2ZXOA 3D6CA 3M7GA 3QO2A 3D4WA 2XIWA 2I46A 4TKOB 1KNAA 2F0QA 2NUCA 4WRDA 3GTLB 1F2ZA 1BCPB 2ZXRA 5C3XA 1I4GA 1G2TA 5E3FA 1ESRA 5K36H 1BXTA 1G8ZD 1JICA 3NHHA 5I2YA 1CT1D 1CI3M 2EOTA 3R8BA 1FNUA 1STBA 5BN4A 3NWTA 5JPNC 3T16A 3GV6A 1B1ZA 2OXPA 4G4KA 2RDGA 3RMHA 4IUPA 4QB4A 1RD9D 3FRPB 1LT6D 1LACA 5EBDA 2PNRC 3VA7A 5EQ0A 1HPCA 2LFNA 1GUGA 1LO5D 1UAPA 1AZPA 3P1HA 3J7YW 5M5XB 2YYZA 1WVLA 3P75A 3LWUA 1K83B 4WFN3 4H7BA 5DM73 5IGEA 1MBYA 2F0UA 3MWYW 4G7OC 3PUYA 1ZYRC 2IX0A 4PMCA 1JC7A 4Q5VA 5C6AA 1FNWA 3VYRA 4B9WA 3A7LA 1JCKB 5EBCA 4S3SA 1LT5D 4BS9A 4UDUC 3SVMA 2EY5A 5EJWA 2F0SA 1PTOB 4XT1B 5JEAJ 1DCZA 2E76C 4QUCA 3BS1A 2G9HD 3R2TA 2VB2X 3IFDA 4J8QA 3FPUB 1SYDA 2B2WA 1SEBD 2JA5B 3EVQA 4N9PA 1F2MA 3V2TA 4R8IA 4CBVA 1LTRD 4KKUA 2F0FA 5J22A 4PMWA 2XWJB 1Z47A 3S1QB 1JR0D 1SYEA 3C46A 2ZT9C 5M3MB 2F0EA 1HXYD 4RHSA 3SR1A 3EQLC 3OHXC 3NWSA 1IYVA 1G6ZA 2L11A 2F0HA 2N88A 2NN6H 4U68A 4ULLA 4A3DB 1K8OA 3T4AC 1WTWA 3L7ZC 2NB0A 1U9RA 2A6EC 4KN7C 1LTTD 4KK7A 4ZLTF 3NTIA 4KKSA 4M8AA 1F2LA 4UAIA 1TY2A 4I7ZC 2FJ2A 2X69A 4H13C 3NPPA 1YNJC 1EY6A 2RSOA 1UNSA 3GTQB 4CJ0B 2C9OA 1JOOA 1STAA 3T56B 3W3AA 5CMDA 3FEWX 1OXXK 1HA5A 3MXGA 2SEBD 5G3LD 3QIAA 3TMEA 1KTKA 2F0NA 4XIGS 3SXHA 4A3EB 3MC0B 1A6XA 3A8KE 2EPBA 4IN3A 1TWFB 2L0CA 4TRDA 5ELEA 2PCFB 4C3JG 3OMCA 2M2LA 2FINB 4EQPA 1KABA 2LS01 5C44B 4IUQA 2OT2A 2LKVA 3BYYB 2NZ1D 3EROA 3T13A 1IW7C 1GUTA 4A3FB 2AWNA 1Q8IA 2JXMB 4PNYA 4RKBA 5ELFA 4M1UB 5KIXA 3GTKB 1DOMA 3PIO3 2HCIA 2X6LA 3V05A 4IFDJ 3PO2B 1SYFA 3TSSA 1HFNA 1AN8A 4C3HB 2K33A 3MFGA 4QUFA 2NWGA 5ISRA 4K5WA 1JOQA 4G7ZC 2MUYA 2E2DC 1BCPC 1CHPD 4B08A 1F9RA 5C3EB 3LWEA 1LTGD 3K6OA 4KTAA 5ELCA 2R3ZA 4HSPA 5CGKA 1BF4A 4A3BB 5KEEA 4K5XA 1GHJA 1TWCB 1G2SA 5A2QE 3VR4A 1HUMA 1X3QA 5KNCA 3W2DA 1B44D 1GXDC 3H3VC 1Y8OB 1IKMA 4OO1H 2B2UA 1STGA 1UEAB 3CQZB 3AU7A 5A2QL 5J1ZA 4KJNA 4ZK9B 1XX8A 3I4NB 5BN5A 1ENAA 2BA0A 1CQFA 2CHBD 1AP0A 3DXJC 1LT4D 1SYGA 1SMYC 2E2IB 2TMPA 4X3UA 5IGFA 3L3OC 3Q0AA 4ZKCB 4DA2A 3IKJA 1TU2B 1FNVA 4FYDA 3SDZA 1AW7A 1AFPA 4K2KA 2B8GA 5C4XB 2AQ2B 1RDPD 1EU4A 1QJOA 5EKIA 1SDFA 3BZDB 1VDZA 5I2XA 1PTOC 3RUZA 1LTAD 3A54A 4IURA 2JA6B 5T1IA 2XRQD 3S16B 1BOSA 4KHVA 1GUOA 3D6WA 4C2MB 4H0LC 1HRJA 2IX1A 1JQYD 4KI0A 1O7ZA 2DN8A 5KRUA 1B50A 1EY8A 2YU9B 3PIP3 2JP1A 4RWSC 2EYMA 5AFWA 1Q90A 1V8QA 2SNSA 3I72A 1H9RA 1SNDA 3TZDA 1DJRD 1PZKD 4N9TA 5C0XJ 1BQQT 3S15B 2CVRA 5COYA 1II3A 5LL6S 1SE3A 3CU7A 1XWEA 3TP5A 3WOEA 3NUCA 4P2CB 3HZXA 5C4ZA 4ZYSA 3GV3A 5I9OA 1C4QA 1GUSA 2FHTA 3MEHA 2KCNA 4CKCA 1S5FD 2C5CA 2BOSA 5I6YA 2IX3A 4JK1C 4XTCS 5EKLA 3E6ZX 1DONA 3L9AX 1PRTD 2WIIB 4V0BA 1XTCD 1XXGA 3CKIB 1TWAB 3PO3B 3TP7A 2A69D 3HRZC 1QWYA 4XYOA 5JEAG 3KK7A 4DAYA 2A68D 1O7LA 2BE5C 5I4DA 1RF2D 2QDBA 3I3CA 4CJ1B 3H94A 4X3SA 3UI2A 5E4XA 1K8MA 3Q22A 3KLSA 1B3AA 5BN3A 3PUXA 1HHVA 3NK9A 3C1EA 1SXTA 3FVQA 1LV9A 2B2YA 2B39A 4A3IB 2K04A 1TR5A 1O80A 2K6AA 1JWSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0J A;  2KQ3 A;  2F0Q A;  1ENC A;  2EYM A;  5C5M A;  5C4H A;  4WOR A;  2NUC A;  4WRD A;  2OEO A;  1AEX A;  1F2Z A;  2SNS A;  1STH A;  3NP8 A;  4G57 A;  1EQV A;  5CGK A;  3TME A;  4EQO A;  5HGT A;  1SYD A;  3MHB A;  4QMG A;  5C3X A;  1EYA A;  1SND A;  5E3F A;  2F0N A;  2PYK A;  3SXH A;  3E5S A;  2F0D A;  4OL7 A;  5KEE A;  4N9T A;  3QB3 A;  3EVQ A;  4N9P A;  1F2M A;  4K5X A;  5E1F A;  5KGU A;  3V2T A;  1SNP A;  2KHS A;  3NHH A;  3BDC A;  1II3 A;  3OWF A;  2ENB A;  2M00 A;  5IGG A;  2EYP A;  1STB A;  2F3W A;  4IUN A;  4J1M A;  3VA5 A;  2F0F A;  3QOJ A;  4KV6 A;  4NMZ A;  3TP5 A;  5J22 A;  4ODG A;  4TRD A;  5EGT A;  3NUC A;  1F2Y A;  2F0I A;  3T16 A;  1KAA A;  1STG A;  3OMC A;  4IAL A;  5CV5 A;  2F0O A;  2PZW A;  3HZX A;  1SYE A;  2EYF A;  2OXP A;  4DFA A;  4YIJ A;  4EQP A;  5C4Z A;  5JAV A;  2F0T A;  1KAB A;  2F0P A;  2EYH A;  1EY9 A;  2F0E A;  5J1Z A;  5I9O A;  4KJN A;  1SNC A;  3SR1 A;  2SNM A;  3MEH A;  4QB4 A;  5F2D A;  1ENA A;  4K5V A;  4LAA A;  1EY5 A;  1STY A;  4KD4 A;  1SYC A;  1SYB A;  1TT2 A;  4HTH A;  2LKV A;  2F0H A;  5CV6 A;  1EZ6 A;  4NDX A;  1IHZ A;  1SYG A;  3ERO A;  4K14 A;  4KD3 A;  5CR3 A;  2WAC A;  5CV9 A;  3T13 A;  2F0W A;  5HUR A;  5I6Y A;  5IGF A;  4E6I A;  4I65 A;  1A2U A;  4F8M A;  5EKL A;  5IOD A;  1EZ8 A;  3S9W A;  2F0G A;  3MVV A;  4NKL A;  3MZ5 A;  3R3O A;  4B9X A;  5CC4 A;  3PMF A;  3TP6 A;  1JOK A;  1EYD A;  3NXW A;  4NP5 A;  3ITP A;  4K8J A;  3P1H A;  4PNY A;  4RKB A;  4ZUJ A;  3SK5 A;  4DF7 A;  3QOL A;  1JOR A;  5I9P A;  3ERQ A;  1NUC A;  1SNO A;  3MXP A;  1STN A;  3BDL A;  4HMI A;  2F0M A;  2PW5 A;  5KIX A;  5M9O A;  4K2K A;  4J6H A;  4QF4 A;  1U9R A;  4KY6 A;  3SHL A;  3U9O A;  4ME5 A;  4EQN A;  2EYO A;  2SOB A;  2PW7 A;  3SK6 A;  3TP7 A;  1SNQ A;  5IOC A;  2PZU A;  5K5P A;  5KYI A;  3EJI A;  5C5L A;  3P75 A;  1SYF A;  5C3W A;  5IGD A;  4RKL A;  5J39 A;  1NSN S;  3C1F A;  4H7B A;  4KY5 A;  1RKN A;  3DHQ A;  2RDF A;  1A3U A;  5IGE A;  3OMG A;  2F0U A;  4F7X A;  3HEJ A;  2PQE A;  2QDB A;  4R8N A;  4K6D A;  3RUZ A;  4DU9 A;  2HQE A;  3SK8 A;  5CV8 A;  5ISR A;  4K2L A;  1A3T A;  4KJO A;  4PMC A;  2EYL A;  4K5W A;  2EXZ A;  1JOQ A;  5I6W A;  2RBM A;  1TQO A;  4KY7 A;  1A2T A;  2EYJ A;  5IIF A;  5DAU A;  4K8I A;  2PZT A;  2F0V A;  3NQT A;  5C6A A;  2OF1 A;  4IZ8 A;  3OSO A;  3DMU A;  1EYC A;  4HMJ A;  2RKS A;  4ID6 A;  4KHV A;  4B9W A;  1EY6 A;  1KDB A;  1KDC A;  5CV4 A;  4DGZ A;  4PMB A;  4EVO A;  5IGC A;  5NUC A;  2F0K A;  1EY7 A;  2F0L A;  3D8G A;  4S3S A;  3H6M A;  3NK9 A;  4ZQ3 A;  3TP8 A;  5CV7 A;  1JOO A;  2EY2 A;  2O4X A;  2EY6 A;  3C1E A;  2F3V A;  1SNM A;  1STA A;  4ZUI A;  2EY5 A;  1KDA A;  3LX0 A;  2F0S A;  1EY4 A;  5EKK A;  5KRU A;  1EY0 A;  3SK4 A;  5KYL A;  5IGB A;  1EY8 A;  1A3V A;  2EY1 A;  3D6C A;  4MIU A;  5DEH A;  5JOB A;  1TR5 A;  3D4W A;  4KTA A;  3D4D A; 
#chains in the Genus database with same CATH topology
 3K81 C;  4DV0 L;  2F0J A;  4ABN A;  1YJW A;  4QIW B;  1N33 Q;  5C5M A;  5COR A;  2DGY A;  2ICE C;  1IBK L;  1EIG A;  3AQQ A;  1ET9 A;  5LMN Q;  4GN4 B;  2IWH A;  3CCV A;  4DUZ Q;  2CWA A;  2UU9 Q;  2RVL A;  4NXM Q;  5IP7 H;  4BBS H;  2ZJP A;  3BG3 A;  4GKJ Q;  2I07 B;  2KUM A;  3KFU A;  4LJZ C;  1EYG A;  2N3S A;  4OWT B;  1CZW A;  1TVX A;  3QOJ A;  1E2V A;  4ODG A;  4ZKB B;  3OIP A;  4DR3 L;  1EFI D;  5IT9 E;  4DFA A;  3FKI H;  3T51 B;  1M1K C;  3IFT A;  3K5M A;  4GN3 B;  1T5X D;  1CUK A;  4A3C H;  3V96 A;  1XMQ L;  1G51 A;  1N34 L;  1QIL A;  4C56 C;  4C1N I;  4C3I H;  5IT9 c;  1MSH A;  3BZK A;  1E24 A;  3K0X A;  2IW3 A;  3KOJ A;  1VQ5 A;  4DV1 L;  4JOI C;  3JAM i;  5CC4 A;  5D14 A;  1EWH A;  1Y1V B;  3GTP B;  3CMA A;  1TS5 A;  1HR0 L;  4CDC C;  3FPP A;  4P73 A;  2D5D A;  3NTH A;  4G7H C;  2PMZ B;  3K80 C;  1ZEQ X;  2EE1 A;  3S2D H;  1CZG A;  4IUT A;  1S5B D;  4JI5 L;  1R9T H;  1CM9 A;  4OWW B;  1P16 A;  1YNN D;  1Q12 A;  1R4P B;  2UXD Q;  3I4M B;  2HQE A;  3Q24 A;  4K2L A;  4FP5 D;  2EXZ A;  1PXU A;  4NB3 A;  1XNQ L;  1Y1W H;  1DYQ A;  1SE2 A;  4ALP A;  4B3S L;  3GD7 A;  4HMJ A;  4BY1 H;  2R7Z H;  2F52 A;  1KDC A;  2IJ0 A;  1MKH A;  1YI2 A;  2ZTC A;  2J0T D;  3S2H B;  4EVO A;  3BYT B;  4P75 A;  3DEO A;  4DUY L;  4DR5 Q;  5EAY A;  3RLN A;  4ZUI A;  5C4J B;  5FLX E;  4Z9C B;  2B2W C;  1CSQ A;  2XN9 C;  3S14 B;  1IL2 A;  5DEH A;  3GTJ H;  4AYB E;  2JA5 G;  2R7D A;  4LUV A;  3HOV B;  1MI2 A;  4JBK A;  1X3P A;  2IPK D;  2B2V A;  3MFY A;  5D3D A;  1AEX A;  1HH2 P;  5L37 A;  4IPH A;  5FLX c;  4QMG A;  1CFM A;  3S1N H;  2WKC A;  1MGS A;  2A6H C;  3F8T A;  2RA4 A;  3QB3 A;  2HHH L;  1IYJ B;  3JAM E;  5G3L F;  1H9K A;  4RGT A;  2C35 B;  2HCC A;  3L2P A;  5M3M G;  2D0P A;  3I70 A;  2Q8R E;  3K58 A;  2ZXP A;  5ELO A;  4DV7 Q;  3VA5 A;  1TKW B;  3HOY H;  1PH3 A;  3VR5 A;  1F2Y A;  4HIO A;  1S5C D;  3SEB A;  4IFD G;  3JAM c;  3WDN A;  4A3D G;  2LY7 A;  3BVM A;  4DAP A;  1ZXT A;  3G7L A;  2CW0 D;  1EFW A;  4LAA A;  3CC7 A;  4K0K L;  3OOC A;  3N52 A;  2AMC B;  5CYU A;  3HOX H;  2K5W A;  2F0W A;  4L8J A;  4E6I A;  2KJX A;  5JEA H;  5FJ8 G;  3PCO B;  4B9X A;  1WTV A;  2WB1 B;  3VR6 A;  5M5Y B;  4JI8 Q;  3K5N A;  4DF7 A;  3CCQ A;  2CH4 A;  1S4Z A;  4DV4 L;  3P7J A;  4X64 Q;  4DNI A;  4JI4 Q;  3BDL A;  3HOW H;  1Y8P B;  1EEF D;  4J6H A;  4CKE A;  2F1M A;  2K01 A;  3J80 i;  1HNW Q;  3GO5 A;  5FLM G;  2RDF A;  4IFD I;  4MTK A;  3OIQ A;  2F03 A;  4F7X A;  2JJQ A;  2FMM A;  2JN4 A;  4DU9 A;  2NVT B;  3M4O H;  1Q46 A;  3JC6 6;  2DNE A;  5IE8 A;  4A4I A;  1B9N A;  3CCR A;  1QE6 A;  1X56 A;  4ME3 A;  1EWC A;  4FXG C;  2DNC A;  4RMF A;  1A2T A;  4DAY B;  4A3G B;  1HJP A;  4DK3 C;  2NVX B;  3DEP A;  1EYC A;  2RKS A;  1KDB A;  2F4V L;  3TRZ A;  4PMB A;  4XQQ A;  5IGC A;  5NUC A;  3F2U A;  3Q23 A;  4QY7 A;  3D8G A;  1TII D;  3E9H A;  4QCL A;  4JYA L;  3TRE A;  4R4O A;  2R92 G;  1KDA A;  1VQ7 A;  3PUV A;  2RCN A;  4RHR A;  3AB9 A;  1Z7T A;  1N32 Q;  1VQL A;  1MHW C;  1Y8N B;  4A3E G;  2PMZ E;  4DXG A;  5ELN A;  3C3L A;  4RGM A;  3CRK C;  4EQO A;  1N36 L;  2QA4 A;  2MPM A;  3ND9 A;  5C44 G;  1ILP A;  1VQD A;  1XNR L;  2NVY H;  3H09 A;  2JYO A;  1QB5 D;  1K83 H;  1OXT A;  4RA8 A;  3R2I A;  2K32 A;  1X55 A;  3J80 E;  3H91 A;  4DR6 Q;  1JT8 A;  4A3F G;  4LK1 C;  4BWG B;  4FXK C;  1SNC A;  3TQY A;  1NJI C;  2BH8 A;  4KD4 A;  1VQ8 A;  4A3K H;  2K75 A;  3M4P A;  1J5E L;  5CBE E;  2JA7 H;  2IY5 B;  2UXC Q;  3ONA B;  2QF7 A;  2E74 C;  3J7A V;  4LNQ A;  3CC4 A;  3J80 c;  4LF4 L;  1SJE D;  3AEV A;  3VYT A;  3OPO A;  4H44 C;  1PH9 A;  1TY0 A;  1MSG A;  3DWP A;  4FF3 A;  3ICE A;  3NXW A;  4NP5 A;  4RCN A;  3SK5 A;  1VQI A;  1JOR A;  1HUN A;  2AUJ D;  3K7A B;  1VQC A;  4DV3 Q;  3A0J A;  1PLF A;  2PZU A;  1VQE A;  3STB C;  5C3W A;  1I94 L;  5J39 A;  3C1F A;  3NEL A;  4POG A;  2R93 B;  4K6L A;  5DNF A;  5LMU L;  3G71 A;  1I3Q B;  1QOH A;  3SK8 A;  5GAH C;  2K5H A;  5C3E G;  1Q1E A;  4DK0 A;  2B63 G;  5I6W A;  1YJN A;  4RFB A;  1RJT A;  4MZ9 A;  4R4T A;  3RZD B;  4DV2 L;  4L5S A;  3G48 A;  1AE3 A;  1BBX C;  4LF5 Q;  2YTX A;  1D1I A;  4DR2 L;  5E7N A;  4DXF A;  5C0X G;  1XTD A;  1H95 A;  4BY7 B;  2WB1 E;  1M4V A;  4KHP L;  3ULL A;  1KQS A;  2VQF L;  1RL2 A;  5IY0 A;  4BA2 I;  1IZ6 A;  3A8I E;  4Y7N B;  3I73 A;  1H9S A;  1PYS B;  3M4Q A;  4JI1 L;  1AE2 A;  1ZYR D;  3UE1 A;  3URY A;  4HCS A;  2KQ3 A;  1ENC A;  1VQ6 A;  4WOR A;  1VQJ A;  2K5D A;  4IFD H;  1HZA A;  2QIL A;  4LFB Q;  1KL9 A;  2B2U C;  2A8V A;  2R7F A;  1EIH A;  4DR1 L;  4C3J B;  3A8J E;  1TWG B;  3D0F A;  1SNP A;  2KHS A;  1OXU A;  4A93 G;  4PZ8 A;  3QWN A;  3HFZ B;  1NBW A;  5FJ8 H;  3K59 A;  3DWQ A;  1JJC B;  3T1Y L;  2K1B A;  2NVQ H;  4HJA A;  2N49 A;  1B2T A;  5C0X I;  1VQF A;  1WD0 A;  1KAA A;  1A0I A;  3H0G B;  4AQY Q;  2O5I C;  3J7A F;  1PZI D;  4GS3 A;  5GAD C;  2JQO A;  3G6J B;  1C8C A;  1IKL A;  2HIV A;  1SE4 A;  3W1G A;  2NYZ D;  5FLM H;  1X32 A;  1IL8 A;  4KD3 A;  2Q2U A;  4OGQ C;  5HUR A;  5IYD H;  1BNZ A;  2KHJ A;  5HGQ A;  5AJ3 Q;  2F0G A;  3MZ5 A;  2ZTD A;  1QUQ B;  3ERS X;  3GTQ H;  2E2J B;  2BCO A;  1BUV T;  1XYI A;  3QR8 A;  1QZG A;  3UDX A;  2E5L Q;  4HMI A;  4KY6 A;  1WD1 A;  3HOU G;  4FF1 A;  4P74 A;  1PRT F;  1O7Y A;  4O2D A;  4PV1 C;  3GTG B;  4BBR B;  3TBI B;  3KLS X;  3NBH B;  3J81 E;  1EEI D;  1WFQ A;  2NZO A;  1QCB D;  3W5O A;  1X3E A;  1FJG L;  2R92 H;  3GTM H;  3CXC A;  3PUW A;  4R8N A;  5GAG C;  2Z4I A;  2OTJ A;  1U5K A;  2MHV A;  4LF7 Q;  3UDF A;  4A3E H;  1PFM A;  1L0Y B;  2A73 B;  3J81 L;  3J81 c;  2OF1 A;  3HP3 A;  5CBA E;  1TWF H;  4FXD A;  2N78 A;  5LMN W;  2A6E D;  4X66 Q;  1EY7 A;  2A74 C;  2XWB B;  1OO9 B;  3W1B A;  3FHW A;  1G91 A;  2O4X A;  1F9S A;  1FVI A;  4OHJ A;  3DM1 A;  2A1A A;  2ZJQ A;  1BCP F;  2VZA A;  1EUJ A;  4UHV A;  3X3M A;  5C44 H;  2L9H A;  5EPJ A;  4KKT A;  1PFN A;  2J7Z A;  4GKK Q;  2AQ3 B;  2FFK B;  4V19 0;  3GQB A;  2ATW A;  1YNJ D;  1U4R A;  1EQV A;  5GQO A;  2Q2T A;  2Q8T A;  2PYK A;  2UUC L;  1HNZ Q;  4YWK A;  5FOB B;  2JA8 B;  1SAP A;  1HQR D;  4BA1 I;  3NE5 B;  1Q81 C;  1O78 A;  1U4L A;  4DAV A;  4OX9 Q;  2RSN A;  1PDQ A;  5H1S E;  1EWI A;  3F2C A;  3GTO H;  4CJ2 C;  4X62 L;  4HJ7 A;  1VQA A;  3BZC A;  3OTO Q;  1CKM A;  4IAL A;  4MTN A;  3J7A 5;  4BBS B;  2PZW A;  1KLU D;  1C9O A;  1WTX A;  4DR7 Q;  1EY9 A;  1O7I A;  1EY5 A;  2WIN B;  1FGU A;  4KHZ A;  4EGV A;  2QEJ C;  2Z8L A;  4AYB G;  3CRL C;  4F87 A;  3FKI B;  4Q0F A;  5KND A;  2YTV A;  4UY8 C;  3PO3 G;  3S9W A;  1EZ8 A;  1VQK A;  4A3J G;  3R3O A;  5IWA L;  2CH4 W;  2F4I A;  1K73 C;  4DN4 M;  1D8L A;  3ITP A;  3BVZ A;  4K8J A;  2N55 A;  5DLQ E;  2B63 H;  3E0E A;  1SNO A;  1OXS C;  4C3I B;  1K3R A;  2PW5 A;  1WTP A;  2B2T A;  2WAQ B;  3MXN B;  1JE4 A;  1SNQ A;  1LLR D;  3EJI A;  1B9M A;  2NBF A;  2RHQ B;  1DD2 A;  2V1C C;  3DHQ A;  1B4O A;  3OMG A;  1I4R A;  2OTL A;  2IHF A;  4AIM A;  1PVO A;  3OW2 A;  1J9O A;  1STE A;  4HR7 B;  1PH8 A;  2EVB A;  1IW7 D;  3S2D B;  1S5D D;  3HG9 A;  1A3T A;  4KJO A;  1D5M C;  2JSO A;  1R9T B;  1KRS A;  2VS1 A;  2B2Y C;  3X3N A;  3NQT A;  1TWH B;  4IZ8 A;  1PH2 A;  1BDO A;  4IQZ A;  1PTO F;  1ZKO A;  2L15 A;  2Z1C A;  4DK1 A;  1Y1W B;  5CV7 A;  2EY2 A;  3CF5 A;  1FGB D;  1A62 A;  4BY1 B;  2R7Z B;  2N8N A;  4ZAI A;  2GVA A;  4L5Q A;  4A93 H;  1ONL A;  1VCI A;  4YCV A;  2KCC A;  2VB3 X;  1VF5 C;  1I6V C;  1FD7 D;  2QCP X;  3A74 A;  4G57 A;  1H9S B;  3PF5 A;  3S1M H;  3IRB A;  1UEB A;  3GTJ B;  1V1Q A;  2VNU D;  4TSS A;  3M3Y H;  2B8F A;  1ICW A;  1T5E A;  3E5S A;  2E2H H;  1BCP D;  3MAQ A;  2MGS A;  4HJ5 A;  3S17 H;  2K03 A;  2KBN A;  4MNO A;  2EYP A;  2K28 A;  2WP8 J;  3S1N B;  2RDH A;  3KJO A;  4RH6 A;  2Z9H A;  4B3R Q;  1CQV A;  2UUA Q;  3QG1 A;  5D3I B;  2CWP A;  2H4O A;  1ENF A;  1Y1V G;  2K7V A;  2BDN A;  3HOU H;  1HA6 A;  5F2D A;  3HOY B;  3K8A A;  2NN6 G;  4JI0 Q;  3SE0 A;  5IGD A;  1PH5 A;  4K14 A;  1N8R C;  1JB3 A;  1IYU A;  1VQH A;  4QQB X;  1QNU A;  5IOD A;  1SJH D;  4HN7 A;  1PRT B;  1V1P A;  2J4X A;  2VUM H;  4RGO S;  1E0B A;  1LUZ A;  3HOX B;  2JK8 A;  3PV0 A;  1STN A;  1F77 A;  2ZTE A;  3TZU A;  2PO4 A;  4QF4 A;  4QGU A;  4U67 3;  4R4Q A;  4YHH L;  3I4M G;  3HOZ H;  2ES2 A;  1QG7 A;  2EYO A;  1ET6 A;  2PW7 A;  5KYI A;  4LF6 Q;  5K5P A;  1I4H A;  2K50 A;  4RKL A;  1X3G A;  1UE1 A;  1RKN A;  3ULP A;  3HOW B;  4N8F A;  5IT9 L;  3HEJ A;  1MD2 D;  1SMY D;  4K6D A;  3WOF A;  1CA5 A;  3E0J A;  2NN6 I;  2R61 A;  4JV5 L;  4A3M H;  1TQO A;  3T1H Q;  2JE6 I;  4O42 A;  1D6E C;  4P72 A;  1WTH A;  4JVZ A;  4DGZ A;  5DM6 3;  1IBM L;  3M4O B;  1K8G A;  3HOV G;  5JVH 3;  1BBU A;  3CCM A;  4ZQ3 A;  2B2V C;  4LW1 A;  2UUB Q;  2F3V A;  2NZH A;  1SNM A;  4JI2 L;  4QL5 A;  2UXB Q;  5EKK A;  2D9U A;  1CTM A;  5A35 A;  3H3V I;  1B3Q A;  4MHE A;  4DV6 Q;  4MIU A;  1VS0 A;  3HKZ B;  2AQ1 B;  3D4D A;  1PTO D;  3I4L A;  3EBE A;  1U4P A;  4JI6 L;  2XRS D;  4X3K A;  4RAU C;  4XDX A;  3K57 A;  2OEO A;  1F9Q A;  4IOC A;  3MHB A;  1SFO H;  4YCU A;  1S3O A;  1WTO A;  1VMP A;  1WI5 A;  4YCW A;  2LMC B;  3K5L A;  1KLG D;  4LFC L;  5IP9 G;  4LFA L;  5IGG A;  2OWO A;  2H1E A;  4A3J H;  3CME A;  2DJG C;  1EU3 A;  4KV6 A;  4NMZ A;  1G29 1;  2ZM6 Q;  1ML0 D;  4O1N A;  3U4Z A;  4F88 A;  4DV0 Q;  2ICI A;  1L2F A;  2EJM A;  1QZH A;  2NVY B;  2WB1 G;  1I6H H;  1IBK Q;  4FDB A;  2SNM A;  1DOK A;  5FLX L;  1GUN A;  1U4M A;  3PF4 A;  3VR3 A;  5CV6 A;  2EXD A;  1EZ6 A;  4NDX A;  4PG3 A;  1E1O A;  3O13 A;  3CW2 C;  4XQN A;  2CQA A;  4X3T A;  3PMF A;  4FF2 A;  1S5E D;  4A3K B;  4GNX A;  4L5T A;  4DR3 Q;  5I9P A;  3ERQ A;  2JA7 B;  2KEE A;  5M5W H;  1E2Z A;  1RHP A;  3U9O A;  3JAM L;  3A5U A;  5GRO A;  1L1O A;  3SK6 A;  3QJY A;  2ID0 A;  3KUP A;  1HZ9 A;  4A3G G;  5FO9 B;  3C2P A;  2ASB A;  1YHA A;  1QUQ A;  2EDG A;  1PYB A;  1XMQ Q;  4FNF A;  3CCJ A;  1N34 Q;  2O2L D;  4HCE A;  3FP9 A;  4YY3 L;  3NQI A;  2QW7 A;  3I91 A;  4QIW E;  4DV1 Q;  2Q2I A;  1KNE A;  2Z6B A;  3EFX D;  1NR2 A;  2EYJ A;  5IIF A;  1HR0 Q;  4K8I A;  2PZT A;  3NBH A;  4XQJ A;  4R1J A;  3DMU A;  1JWU D;  3S1R H;  1MJC A;  1AZQ A;  1WTR A;  1VMC A;  2EJG C;  1SRU A;  1YHQ A;  1GJX A;  4GZY C;  4NW2 A;  1VQN A;  5GAE C;  2F0L A;  4JI7 L;  4JI5 Q;  2QGQ A;  3LX0 A;  4L6T B;  3GTL H;  1EY0 A;  3M85 A;  5IGB A;  3K5O A;  2BE5 D;  1CHQ D;  5C4H A;  3NSW A;  3ZYY X;  1XNQ Q;  1IXR A;  1D5X C;  4B3S Q;  3RNU A;  2XVS A;  2YTY A;  1VQP A;  1TS2 A;  2HUG A;  3ND8 A;  2PPB C;  5E1F A;  5KGU A;  1I4P A;  1Q3L A;  4DUY Q;  1H9J A;  4IUU A;  4RG1 A;  2Q2H A;  3KF6 A;  2TSS A;  3A55 A;  4O0A A;  2KVM A;  4OO1 G;  1GUW A;  4J1M A;  3EA6 A;  2E75 C;  1K0R A;  2F0I A;  1GHK A;  2JEA I;  2PI2 E;  2KHI A;  4YIJ A;  2GA4 B;  1VQ4 A;  1CSP A;  2F0P A;  1DGS A;  2NVQ B;  3H3V H;  5LL6 X;  1QVF A;  3I90 A;  1SYB A;  2D2C C;  5JJL A;  4HIK A;  1GVP A;  3J81 j;  3HKZ E;  5M5X H;  2HHH Q;  1L0X B;  4IO9 A;  1A2U A;  1ESF A;  1M90 C;  3TP6 A;  1XMO L;  5JJZ A;  5T1G A;  1DOL A;  4R9W A;  2R93 G;  2DY8 A;  5ELD A;  3MXP A;  2WV6 D;  2ALY B;  4LFB L;  5C4J H;  3VYU A;  5BR8 L;  1V1P B;  1E2W A;  1TS4 A;  4OO1 I;  3MXU A;  5M3F B;  3RZO B;  1DM0 B;  4K0K Q;  1A3U A;  1SR3 A;  2L55 A;  2R6G A;  1UE5 A;  2PQE A;  3J80 L;  2IL8 A;  3PO2 G;  3MXN A;  4BY7 G;  5FK9 C;  1E3P A;  2EYL A;  4KY7 A;  4LF8 L;  4C3H G;  2AKW B;  2QEX A;  4DV4 Q;  2F0V A;  2MP1 A;  2R92 B;  3GTM B;  3I8Z A;  4OIK A;  5JPM C;  1Q1B A;  5CV4 A;  1HFG A;  1PTO H;  5KNB A;  1CK1 A;  3MTS A;  4L63 B;  3HGB A;  3CCS A;  3CCU A;  2IHE A;  2EY6 A;  4B3T L;  1HTL D;  1YBY A;  1EL0 A;  1EY4 A;  3KLR A;  5KYL A;  5IP9 H;  3LNN A;  5JOB A;  4FO2 A;  1RIP A;  2AUK A;  4DR4 L;  1OTC A;  3A7A B;  4CDD C;  3U50 C;  2JA5 H;  1CKN A;  1P8L A;  2DY7 A;  2JA9 A;  1LTB D;  3CC2 A;  2EJF C;  1X3F A;  3AYH B;  1I50 B;  1J6Q A;  1STH A;  1PH4 A;  1KIX A;  4RCO A;  2F4V Q;  3MA2 B;  2F0D A;  3H0G G;  1LT3 D;  4TQU S;  3S1Q H;  4JYA Q;  3VYS A;  4ILW A;  1K8A C;  3U4V A;  2M00 A;  5M3M H;  1PRT C;  4IUN A;  4A3B G;  1RCV D;  4YWM A;  4GLX A;  5D65 A;  2A5H A;  4LWC A;  5CV5 A;  3P20 A;  4CKB A;  4IUV A;  2A19 A;  2A69 C;  4CHT B;  1YVC A;  2EYH A;  3GTO B;  1NMF A;  4A3D H;  4K5V A;  1ROD A;  1STY A;  4OEL B;  1N36 Q;  2A68 C;  3BVG A;  4XYQ A;  1IHZ A;  2KOL A;  2A6H D;  1H9M A;  4ZRZ A;  1DXM A;  1PFB A;  4I65 A;  2KCM A;  2MO1 A;  2G5D A;  3I4N G;  2K5V A;  1XNR Q;  3CAM A;  2EZV A;  4BBR G;  3CD6 A;  1K0S A;  2KED A;  1EQT A;  1F9P A;  3VR2 A;  2I5L X;  2BA1 A;  3A5Z B;  3S24 A;  3CHB D;  5M9O A;  1XPU A;  4EQN A;  2SOB A;  1YJ9 A;  2DUD A;  1C48 A;  4GNX B;  3DM3 A;  2WKD A;  1PZJ D;  4KN4 C;  4GLV B;  4KY5 A;  2B63 B;  1J5E Q;  4OX9 L;  3DUZ A;  3T53 B;  1L1O B;  5C4X G;  5EPL A;  2Y0S B;  3Q6S A;  4LF4 Q;  3BJU A;  5CV8 A;  3PGZ A;  3CCE A;  2MO0 A;  2RBM A;  4FVM A;  4R4C A;  3ZJY C;  2AWO A;  1V1O A;  1M8A A;  3NEM A;  1D2B A;  3D3R A;  2FMC A;  1LTS D;  1QVG A;  1NY4 A;  1I94 Q;  2JA6 G;  3GP7 A;  1A8V A;  3KYH C;  3NTK A;  3RD4 A;  5IYB G;  1HNX L;  1HTP A;  3RLF A;  5LMU Q;  1NR4 A;  1ILQ A;  2X6G A;  2V4D A;  4DV5 L;  1C7Y A;  1Q82 C;  1A3V A;  2IT1 A;  3OYY A;  2JA8 G;  1BVS A;  5EGT A;  4OIJ A;  4JG2 A;  3IAY A;  4APV A;  4NPS A;  2XSC A;  2I5M X;  4DV2 Q;  4A93 B;  1XJV A;  4C1N K;  4DR2 Q;  4JW0 A;  3F2D A;  4OL7 A;  5IP7 G;  1PH1 A;  4P71 A;  1B7Y B;  1K9M C;  1BO0 A;  1B8A A;  1RTN A;  1KXL A;  4L5R C;  1WCM B;  3D31 A;  2VQF Q;  3S1M B;  1RTO A;  3M3Y B;  2G9D A;  3DWA A;  4IJH A;  4Y52 H;  2E2H B;  2SDF A;  4OWX B;  4HJ9 A;  1NCV A;  4JI1 Q;  2AHO B;  1T9H A;  3FKI G;  3KF6 B;  5JAV A;  2EYF A;  3CPW A;  3S17 B;  5EPK A;  1S72 A;  4A3C G;  2F0T A;  2K5N A;  4XT3 B;  1I4X A;  1PMR A;  4A3F H;  1PH6 A;  5K36 G;  1TT2 A;  1YNN C;  4HTH A;  1D5Z C;  3FMC A;  3PQI A;  4C3I G;  4FF4 A;  5CR3 A;  4JPB W;  2B2T C;  1WOC A;  2WAC A;  4DR1 Q;  3HS0 C;  2B3G A;  4F8M A;  3GTK H;  1UUP A;  4NKL A;  3HOU B;  4HAE A;  4LF9 L;  1JOK A;  5FO7 B;  1EYD A;  3T1Y Q;  2VQE L;  1WTQ A;  3PO2 H;  1KRT A;  4BY7 H;  4B3M L;  3QOL A;  1IBL L;  2L12 A;  1QVC A;  3IL8 A;  4X65 L;  1NUC A;  3R93 A;  4C3H H;  2F0M A;  3TEH B;  2KA7 A;  1EIF A;  3SHL A;  3I2Z A;  4ME5 A;  2NTS A;  3D4R A;  2LXJ A;  2M9V A;  5IOC A;  2XGT A;  2VUM B;  1YIJ A;  5C5L A;  2K5Q A;  2DJF C;  2HD3 A;  3HKS A;  4DNT B;  1DZ1 A;  4KLK A;  2Q8I B;  3HOZ B;  2D62 A;  1YHB A;  1E7Z A;  1Y1W G;  5JVG 3;  3N6R A;  4HED A;  1NTG A;  1N33 L;  5C3E H;  5DAU A;  2R7Z G;  1JWM D;  1QNK A;  1LAB A;  1Z6H A;  4JI3 Q;  1E22 A;  4MN3 A;  5LMN L;  1Y69 U;  1HQM C;  1PYW D;  2L4N A;  2PNH A;  1R4Q B;  2RF4 A;  1B70 B;  1Y14 B;  2F0K A;  1JJ2 A;  3TP8 A;  4DUZ L;  4GOP A;  1VF7 A;  3H6M A;  4A3M B;  2UU9 L;  3H0G H;  4NXM L;  1FL0 A;  2LXK A;  5C0X H;  2FXQ A;  3STB D;  4DNR B;  4JBW A;  4GKJ L;  4PQX A;  4QJF A;  3TS0 A;  5E4W C;  2HDL A;  1FJG Q;  3SK4 A;  2WFW A;  2K14 A;  3TDQ A;  3A56 A;  4A3B H;  5ELB A;  4IOA A;  1W6J A;  4PZ7 A;  4LMQ D;  3KBG A;  1TWC H;  4XXE A;  1X9N A;  2CW0 C;  1NAP A;  1OXV A;  4RGN A;  3NP8 A;  5HGT A;  4A3I G;  3KDF A;  3UDG A;  1EIY B;  1V43 A;  1J8I A;  1EYA A;  2Y0S E;  2CCZ A;  3PUZ A;  1CKN B;  3BDO A;  2K4K A;  3M9B A;  4LUO A;  2QDL A;  2RQX A;  3BDC A;  3CQZ H;  1EOT A;  3OWF A;  2ENB A;  1SFO B;  3HOY G;  2F3W A;  3I4N H;  2L1B A;  3T1H L;  3U9S A;  3VDY A;  2XNA C;  1BKB A;  3NBI A;  1SRO A;  2F0O A;  1YEZ A;  3AMU A;  2E2I H;  4AYB B;  3OWE B;  5FO8 B;  1BR9 A;  1GOZ A;  1HCZ A;  4A3J B;  1SSO A;  1A15 A;  3TN2 A;  1CA6 A;  1FR3 A;  3I7F A;  1SYC A;  2UUC Q;  2ZJR A;  1B53 A;  1NMG A;  2QKI C;  1VQM A;  5LHY 1;  5CV9 A;  2UXD L;  2E8G A;  3K0Y A;  1I6H B;  3MVV A;  5C4X H;  1TS3 A;  3SGI A;  2NTT A;  2BH2 A;  3WWV A;  2Z4H A;  4X62 Q;  4ZUJ A;  3OW7 A;  3UDI A;  4A3L G;  4EQ5 A;  1HR0 W;  2K05 A;  2VXW A;  2O5J C;  5TSS A;  3BU2 A;  1FYC A;  3CCL A;  1NSN S;  4HSV A;  2Z6K A;  4WJW A;  4DR5 L;  5M5W B;  2JA6 H;  3M4Y A;  1D1K A;  3S16 H;  3FDT A;  1W6K A;  4KMU C;  4C2M H;  2JEB I;  5IWA Q;  2KEC A;  2ZM6 L;  2KCT A;  4OXP A;  2JA8 H;  4CGY B;  1I4Q A;  3OSO A;  3KF8 A;  4ID6 A;  4DK6 C;  3HKZ G;  2YU9 H;  2MJ8 A;  1YNX A;  4NXN Q;  5FKA C;  3M7N A;  2BDO A;  1LTI D;  3KBX A;  3S1R B;  1SBB B;  2HDM A;  4DV7 L;  2L5T A;  2EY1 A;  2ZXO A;  3D6C A;  3M7G A;  3QO2 A;  2VW9 A;  1NNX A;  3D4W A;  2XIW A;  2I46 A;  1D7Q A;  4TKO B;  1KNA A;  2F0Q A;  1S40 A;  2NUC A;  4WRD A;  3GTL B;  3S15 H;  1F2Z A;  1BCP B;  1I5F A;  2ZXR A;  5C3X A;  1I4G A;  1G2T A;  5E3F A;  1ESR A;  5K36 H;  1BXT A;  1G8Z D;  3EIV A;  1JIC A;  3PIO A;  3NHH A;  5I2Y A;  1CT1 D;  4JI8 L;  1CI3 M;  2EOT A;  3R8B A;  1FNU A;  1STB A;  5BN4 A;  2WAQ E;  3NWT A;  4UP7 A;  5JPN C;  1UWV A;  3T16 A;  4X64 L;  3I56 A;  3GV6 A;  4JI4 L;  1B1Z A;  2OXP A;  4DPG A;  4G4K A;  4J15 A;  2RDG A;  3RMH A;  1HNW L;  4IUP A;  4A3K G;  4QB4 A;  4GNX C;  1RD9 D;  3L0O A;  1SN8 A;  3FRP B;  4UP9 A;  4ZCK A;  1LT6 D;  2JA7 G;  1LAC A;  2MFI A;  5EBD A;  2PNR C;  1PFS A;  3VA7 A;  1TWH H;  1L1O C;  5EQ0 A;  1N9W A;  1HPC A;  1TWA H;  2LFN A;  1GUG A;  1LO5 D;  1UAP A;  3PO3 H;  1AZP A;  3MEF A;  3P1H A;  1W2B A;  3J7Y W;  5M5X B;  2GVB A;  4JCV E;  1X6O A;  2YYZ A;  2Z0S A;  1WVL A;  3P75 A;  3LWU A;  4JOI A;  3I55 A;  1K83 B;  4TVA B;  3RN2 A;  4WFN 3;  4H7B A;  5DM7 3;  4BXX G;  5IGE A;  1MBY A;  2F0U A;  3MWY W;  3G4S A;  4G7O C;  3PUY A;  1N32 L;  1ZYR C;  2K52 A;  2IX0 A;  4PMC A;  2CFM A;  2B29 A;  1JC7 A;  4A75 A;  4Q5V A;  5C6A A;  1FNW A;  3VYR A;  1GO3 E;  4YHH Q;  4B9W A;  4WJ3 M;  3A7L A;  4A3I H;  1JCK B;  5EBC A;  5J3B A;  4S3S A;  2VY3 A;  1LT5 D;  4BS9 A;  4UDU C;  4UP8 A;  3SVM A;  3ULJ A;  2EY5 A;  5EJW A;  4YWL A;  1LM0 A;  2F0S A;  4DKA C;  1X54 A;  1YZ6 A;  1PTO B;  4XT1 B;  5JEA J;  4GOP B;  4POF A;  3NEN A;  1DCZ A;  4JV5 Q;  2E76 C;  4QUC A;  3BS1 A;  4DR6 L;  2GN5 A;  4HID A;  2XTI A;  2G9H D;  3R2T A;  2VB2 X;  3IFD A;  4J8Q A;  3FPU B;  1SYD A;  1IBM Q;  2B2W A;  1SEB D;  2JA5 B;  3EVQ A;  4N9P A;  1VQB A;  1F2M A;  2UXC L;  3V2T A;  4R8I A;  2P5Z X;  3KDF B;  1LYL A;  4JI2 Q;  1NE3 A;  4CBV A;  1LTR D;  4HIM A;  4KKU A;  2F0F A;  5J22 A;  4PMW A;  3H15 A;  2XWJ B;  1VQO A;  1Z47 A;  4HJ8 A;  3S1Q B;  1JR0 D;  1SYE A;  4JI6 Q;  4DV3 L;  3C46 A;  2ZT9 C;  4A3L H;  4GLA C;  5M3M B;  2F0E A;  1HXY D;  5HY6 A;  3LGJ A;  4RHS A;  3SR1 A;  1KD1 C;  3EQL C;  1Y1V H;  3OHX C;  3NWS A;  3GTP H;  1IYV A;  1G6Z A;  2L11 A;  5IYD G;  2F0H A;  2N88 A;  2NN6 H;  4LUZ A;  4LFC Q;  5M3F G;  4U68 A;  4LFA Q;  4ULL A;  1EQQ A;  4A3D B;  4IJL A;  3KJP A;  1K8O A;  3UE0 A;  1SLJ A;  3CP0 A;  3T4A C;  1WTW A;  1JJG A;  3L7Z C;  2NB0 A;  4LF5 L;  3I4O A;  1GM5 A;  1U9R A;  3TS2 A;  2A6E C;  1GKH A;  4KN7 C;  3PIP A;  3I4M H;  1UE7 A;  4JBJ A;  3RLO A;  1LTT D;  1ASY A;  4KK7 A;  4ZLT F;  3NTI A;  4KKS A;  4M8A A;  1F2L A;  4UAI A;  3F2B A;  1TY2 A;  1Q7Y C;  1GD7 A;  3RR5 A;  4I7Z C;  2FJ2 A;  1ASZ A;  3AFQ A;  2X69 A;  3S2H H;  4H13 C;  3E9I A;  3NPP A;  1YNJ C;  2MQH A;  1EY6 A;  2RSO A;  1UNS A;  3S14 H;  3GTQ B;  2OQ0 A;  4CJ0 B;  4EX5 A;  1CKO A;  3HOV H;  2C9O A;  1JOO A;  5IYC G;  3GDE A;  1STA A;  3KF8 B;  3T56 B;  3W3A A;  4I7A A;  4YY3 Q;  1K3B C;  5CMD A;  3FEW X;  1OXX K;  1HA5 A;  4AQY L;  3MXG A;  2EQS A;  2SEB D;  5G3L D;  3QIA A;  3TME A;  1KTK A;  2YV5 A;  1V9P A;  2F0N A;  4XIG S;  3SXH A;  4JI7 Q;  4A3E B;  1X65 A;  5AJ3 L;  1PA6 A;  3MC0 B;  1A6X A;  3A8K E;  2EPB A;  4IN3 A;  1TWF B;  2PQA A;  2L0C A;  4TRD A;  5ELE A;  2PCF B;  4C3J G;  2OCE A;  3OMC A;  2E5L L;  2M2L A;  2FIN B;  4EQP A;  1KAB A;  2LS0 1;  5C44 B;  4IUQ A;  2OT2 A;  4UPA A;  4IPD A;  5M5Y H;  3F1Z A;  2LKV A;  3BYY B;  2NZ1 D;  3ERO A;  3T13 A;  4BXX H;  1IW7 C;  1GUT A;  4A3F B;  2AWN A;  4LF7 L;  1Q8I A;  2JXM B;  4PNY A;  4RKB A;  5ELF A;  4M1U B;  2Y0S G;  1WYD A;  5KIX A;  3GTK B;  1DOM A;  3PIO 3;  2HCI A;  2X6L A;  3V05 A;  4IFD J;  4X66 L;  2NVT H;  3PO2 B;  1SYF A;  2CQO A;  3TSS A;  4A3G H;  1HFN A;  1AN8 A;  4C3H B;  4AH6 A;  3AFP A;  1Q86 C;  4CDF C;  2K33 A;  2NVX H;  3J81 i;  1PH7 A;  3MFG A;  4QUF A;  2NWG A;  4IPC A;  1HZC A;  5ISR A;  4K5W A;  1JOQ A;  1XMO Q;  4GKK L;  1VQG A;  4G7Z C;  1PV4 A;  2MUY A;  2E2D C;  1BCP C;  1MIU A;  1UE6 A;  5BR8 Q;  1CHP D;  4B08 A;  2HQL A;  4CDE C;  1HNZ L;  1HZB A;  1F9R A;  5C3E B;  1VQ9 A;  3LWE A;  3E3X A;  1L0W A;  2VL6 A;  3Q8D A;  1LTG D;  3OTO L;  2HT1 A;  3K6O A;  4KTA A;  5ELC A;  1ICF B;  1WCM G;  1A63 A;  4LF8 Q;  4DR7 L;  2R3Z A;  4HSP A;  5CGK A;  1BF4 A;  3DLL A;  4A3B B;  5KEE A;  1Z9F A;  2RCF A;  4K5X A;  1GHJ A;  1TWC B;  1XPO A;  4WJ4 A;  2EIF A;  1G2S A;  5A2Q E;  3CPF A;  3PSI A;  3VR4 A;  1HUM A;  4B3T Q;  1X3Q A;  5KNC A;  3W2D A;  1B44 D;  1GXD C;  3H3V C;  1Y8O B;  1IKM A;  5M3F H;  3RZO H;  1SMX A;  4OO1 H;  2B2U A;  4DR4 Q;  1STG A;  4JI3 L;  1UEA B;  3CQZ B;  3AU7 A;  5A2Q L;  5J1Z A;  1C0A A;  4KJN A;  4ZK9 B;  1XX8 A;  3I4N B;  5BN5 A;  1ENA A;  2BA0 A;  1CQF A;  2CHB D;  1AP0 A;  3DXJ C;  1LT4 D;  4BBS G;  1SYG A;  1SMY C;  2E2I B;  2TMP A;  4X3U A;  5IGF A;  1MJE A;  4KHP Q;  3L3O C;  3K7A H;  3Q0A A;  2VUM G;  4ZKC B;  4DA2 A;  3IKJ A;  1TU2 B;  2PI2 A;  1FNV A;  4FYD A;  3SDZ A;  1AW7 A;  3HOZ G;  1AFP A;  2R93 H;  4K2K A;  2B8G A;  5C4X B;  1I3Q H;  2AQ2 B;  1RDP D;  1EU4 A;  1QJO A;  4R4I A;  2CKZ B;  5EKI A;  1JB7 A;  3ER0 A;  1AH9 A;  1SDF A;  2WAQ G;  3BZD B;  5IYC H;  3RZD H;  1VDZ A;  5I2X A;  1I50 H;  1PTO C;  3RUZ A;  4GOP C;  4A3M G;  1LTA D;  4IPG A;  2MNA A;  3A54 A;  4IUR A;  3K7U C;  2JA6 B;  5T1I A;  2XRQ D;  3S16 B;  1BOS A;  1G6P A;  1U0L A;  4KHV A;  1GUO A;  3D6W A;  4Y7N H;  4C2M B;  4H0L C;  1HRJ A;  2LSS A;  2IX1 A;  1JQY D;  4KI0 A;  1O7Z A;  2DN8 A;  1PHJ A;  5KRU A;  1B50 A;  4N8X 1;  1EY8 A;  2YU9 B;  1XPR A;  3PIP 3;  4B3R L;  2KEN A;  1BBW A;  2JP1 A;  2UUA L;  1KHI A;  4RWS C;  4C3J H;  1TWG H;  2EYM A;  5AFW A;  1Q90 A;  1KC8 C;  4BY1 G;  1V8Q A;  2SNS A;  3I72 A;  1H9R A;  1EOV A;  1K28 A;  1SND A;  3TZD A;  4JI0 L;  1DJR D;  2RHS B;  1PZK D;  4N9T A;  5C0X J;  1BQQ T;  3S15 B;  1W3S A;  2CVR A;  5COY A;  4OON A;  1HNX Q;  1II3 A;  4JC0 A;  5LL6 S;  1SE3 A;  3CU7 A;  1XWE A;  3J7Z C;  1JMC A;  3RN5 A;  4DV5 Q;  3TP5 A;  3WOE A;  3NUC A;  1WJJ A;  4P2C B;  3G6E A;  3HZX A;  5C4Z A;  3B6Y A;  4ZYS A;  2PQA B;  4LF6 L;  3GV3 A;  5I9O A;  1C4Q A;  1GUS A;  1Q8K A;  2FHT A;  3MEH A;  2KCN A;  4H02 A;  4NXN L;  4CKC A;  2E2J H;  1S5F D;  2C5C A;  2BOS A;  1EQR A;  5I6Y A;  1LTL A;  2IX3 A;  4JK1 C;  2HIX A;  4XTC S;  5EKL A;  1KAW A;  3E6Z X;  2F3I A;  1E1T A;  2Z6K C;  1DON A;  3L9A X;  3GTG H;  1JE5 A;  1PRT D;  2WII B;  4V0B A;  4BBR H;  1XTC D;  1TXY A;  4GN5 A;  1XXG A;  3CKI B;  1TWA B;  2OQK A;  3EN2 A;  1SE8 A;  2H5X A;  3TP7 A;  3PO3 B;  2A69 D;  3HRZ C;  1QWY A;  5JJI A;  3HOX G;  2UUB L;  4XYO A;  3U58 A;  5JEA G;  3KK7 A;  4DAY A;  4JBM A;  2UXB L;  2A68 D;  1O7L A;  2I0Q A;  2BE5 C;  4DAM A;  5I4D A;  1RF2 D;  2QDB A;  4DV6 L;  3I3C A;  4CJ1 B;  4LF9 Q;  3H94 A;  4OEM B;  4X3S A;  2VQE Q;  3UI2 A;  2I5H A;  5E4X A;  4X6A H;  3HOW G;  1K8M A;  4PZ6 A;  1IBL Q;  3Q22 A;  4B3M Q;  4X65 Q;  3KLS A;  1WCM H;  1B3A A;  5BN3 A;  3PUX A;  1HHV A;  3NK9 A;  3C1E A;  1SXT A;  3FVQ A;  1LV9 A;  2D0O A;  4A76 A;  2B2Y A;  1YIT A;  5JJK A;  2B39 A;  5IYB H;  4A3I B;  2K04 A;  1TR5 A;  1O80 A;  2K6A A;  1JWS D;  3KLW A; 
#chains in the Genus database with same CATH homology
 2F0J A;  4ABN A;  4QIW B;  5C5M A;  5COR A;  2ICE C;  1EIG A;  1ET9 A;  2IWH A;  2RVL A;  3BG3 A;  2I07 B;  2KUM A;  4LJZ C;  1CZW A;  1TVX A;  3QOJ A;  1E2V A;  4ODG A;  4ZKB B;  3OIP A;  1EFI D;  5IT9 E;  4DFA A;  3T51 B;  3IFT A;  3K5M A;  1T5X D;  3V96 A;  1QIL A;  4C56 C;  4C1N I;  1MSH A;  2IW3 A;  5CC4 A;  5D14 A;  1EWH A;  1Y1V B;  3GTP B;  1TS5 A;  3FPP A;  2D5D A;  3NTH A;  4G7H C;  2PMZ B;  1ZEQ X;  2EE1 A;  1CZG A;  4IUT A;  1S5B D;  1CM9 A;  1YNN D;  1Q12 A;  1R4P B;  3I4M B;  2HQE A;  3Q24 A;  4K2L A;  4FP5 D;  2EXZ A;  1PXU A;  1DYQ A;  1SE2 A;  3GD7 A;  4HMJ A;  1KDC A;  2IJ0 A;  2J0T D;  3S2H B;  4EVO A;  3BYT B;  3DEO A;  4ZUI A;  5C4J B;  5FLX E;  4Z9C B;  2B2W C;  2XN9 C;  3S14 B;  5DEH A;  3HOV B;  1MI2 A;  1X3P A;  2IPK D;  2B2V A;  3MFY A;  5D3D A;  1AEX A;  4QMG A;  1CFM A;  2WKC A;  1MGS A;  2A6H C;  2RA4 A;  3QB3 A;  3JAM E;  5G3L F;  1H9K A;  4RGT A;  2HCC A;  3I70 A;  2Q8R E;  3K58 A;  2ZXP A;  3VA5 A;  1TKW B;  3VR5 A;  1F2Y A;  1S5C D;  3SEB A;  4IFD G;  3WDN A;  2LY7 A;  3BVM A;  4DAP A;  1ZXT A;  3G7L A;  2CW0 D;  4LAA A;  3OOC A;  3N52 A;  5CYU A;  2K5W A;  2F0W A;  4L8J A;  4E6I A;  2KJX A;  5JEA H;  4B9X A;  1WTV A;  2WB1 B;  3VR6 A;  5M5Y B;  3K5N A;  4DF7 A;  1S4Z A;  3P7J A;  3BDL A;  1Y8P B;  1EEF D;  4J6H A;  4CKE A;  2F1M A;  2K01 A;  3GO5 A;  2RDF A;  4IFD I;  2F03 A;  3OIQ A;  4F7X A;  2FMM A;  4DU9 A;  2NVT B;  2DNE A;  1B9N A;  1QE6 A;  1EWC A;  4FXG C;  2DNC A;  4A3G B;  1A2T A;  2NVX B;  3DEP A;  1EYC A;  2RKS A;  1KDB A;  4PMB A;  4XQQ A;  5IGC A;  5NUC A;  3F2U A;  3Q23 A;  3D8G A;  1TII D;  4QCL A;  1KDA A;  3PUV A;  4RHR A;  3AB9 A;  1Z7T A;  1Y8N B;  4DXG A;  3C3L A;  4RGM A;  3CRK C;  4EQO A;  2MPM A;  3ND9 A;  1ILP A;  3H09 A;  2JYO A;  1QB5 D;  1OXT A;  4RA8 A;  3R2I A;  2K32 A;  3J80 E;  3H91 A;  4LK1 C;  4BWG B;  4FXK C;  1SNC A;  4KD4 A;  5CBE E;  3ONA B;  2QF7 A;  2E74 C;  3J7A V;  1SJE D;  3VYT A;  3OPO A;  4H44 C;  1TY0 A;  1MSG A;  3DWP A;  4FF3 A;  3NXW A;  4NP5 A;  4RCN A;  3SK5 A;  1JOR A;  1HUN A;  2AUJ D;  3K7A B;  1PLF A;  2PZU A;  5C3W A;  5J39 A;  3C1F A;  2R93 B;  4K6L A;  5DNF A;  1I3Q B;  1QOH A;  3SK8 A;  1Q1E A;  4DK0 A;  5I6W A;  4RFB A;  1RJT A;  3RZD B;  1BBX C;  1D1I A;  4DXF A;  5C0X G;  4BY7 B;  1M4V A;  4BA2 I;  3A8I E;  4Y7N B;  3I73 A;  1H9S A;  1ZYR D;  3URY A;  4HCS A;  2KQ3 A;  1ENC A;  4WOR A;  2K5D A;  4IFD H;  2QIL A;  2B2U C;  1EIH A;  4C3J B;  3A8J E;  1TWG B;  1SNP A;  2KHS A;  1OXU A;  3QWN A;  3K59 A;  3DWQ A;  2K1B A;  1B2T A;  5C0X I;  1WD0 A;  1KAA A;  3H0G B;  2O5I C;  3J7A F;  1PZI D;  3G6J B;  1C8C A;  1IKL A;  1SE4 A;  2NYZ D;  1X32 A;  1IL8 A;  4KD3 A;  4OGQ C;  5HUR A;  1BNZ A;  2F0G A;  3MZ5 A;  2E2J B;  2BCO A;  1BUV T;  1XYI A;  4HMI A;  4KY6 A;  1WD1 A;  4FF1 A;  1PRT F;  1O7Y A;  3GTG B;  4PV1 C;  4BBR B;  3TBI B;  3KLS X;  3J81 E;  1EEI D;  1QCB D;  3PUW A;  4R8N A;  2Z4I A;  2MHV A;  1PFM A;  1L0Y B;  2A73 B;  3J81 L;  2OF1 A;  3HP3 A;  5CBA E;  4FXD A;  2A6E D;  1EY7 A;  2A74 C;  2XWB B;  1OO9 B;  1G91 A;  2O4X A;  1F9S A;  4OHJ A;  3DM1 A;  1BCP F;  3X3M A;  2L9H A;  5EPJ A;  4KKT A;  1PFN A;  2J7Z A;  2AQ3 B;  2FFK B;  4V19 0;  3GQB A;  1YNJ D;  1U4R A;  1EQV A;  2Q8T A;  2PYK A;  5FOB B;  2JA8 B;  1SAP A;  1HQR D;  4BA1 I;  3NE5 B;  1O78 A;  1U4L A;  4DAV A;  2RSN A;  1PDQ A;  4CJ2 C;  4IAL A;  4BBS B;  2PZW A;  1KLU D;  1WTX A;  1EY9 A;  1EY5 A;  2WIN B;  4KHZ A;  4EGV A;  2QEJ C;  2Z8L A;  3CRL C;  4F87 A;  3FKI B;  4Q0F A;  5KND A;  3S9W A;  1EZ8 A;  3R3O A;  2F4I A;  4DN4 M;  3ITP A;  3BVZ A;  4K8J A;  2N55 A;  1SNO A;  1OXS C;  4C3I B;  2PW5 A;  1WTP A;  2B2T A;  2WAQ B;  1JE4 A;  1SNQ A;  1LLR D;  3EJI A;  1B9M A;  2NBF A;  1DD2 A;  3DHQ A;  1B4O A;  3OMG A;  1I4R A;  1J9O A;  1STE A;  4HR7 B;  2EVB A;  1IW7 D;  3S2D B;  1S5D D;  3HG9 A;  1A3T A;  4KJO A;  1D5M C;  2JSO A;  1R9T B;  2B2Y C;  3X3N A;  3NQT A;  1TWH B;  4IZ8 A;  1BDO A;  4IQZ A;  1PTO F;  1ZKO A;  2Z1C A;  4DK1 A;  1Y1W B;  5CV7 A;  2EY2 A;  1FGB D;  4BY1 B;  2R7Z B;  4ZAI A;  1ONL A;  1VCI A;  2KCC A;  2VB3 X;  1VF5 C;  1I6V C;  1FD7 D;  2QCP X;  4G57 A;  1H9S B;  2VNU D;  3GTJ B;  4TSS A;  2B8F A;  1ICW A;  1T5E A;  3E5S A;  1BCP D;  3MAQ A;  2MGS A;  2K03 A;  2EYP A;  2K28 A;  2WP8 J;  3S1N B;  2RDH A;  4RH6 A;  1CQV A;  3QG1 A;  5D3I B;  2H4O A;  1ENF A;  2K7V A;  2BDN A;  1HA6 A;  5F2D A;  3HOY B;  2NN6 G;  3SE0 A;  5IGD A;  4K14 A;  1JB3 A;  1IYU A;  1QNU A;  5IOD A;  1SJH D;  4HN7 A;  1PRT B;  1V1P A;  2J4X A;  4RGO S;  1E0B A;  3HOX B;  3PV0 A;  1STN A;  1F77 A;  3TZU A;  2PO4 A;  4QF4 A;  4U67 3;  1QG7 A;  2EYO A;  1ET6 A;  2PW7 A;  5KYI A;  5K5P A;  1I4H A;  4RKL A;  1RKN A;  3HOW B;  5IT9 L;  3HEJ A;  1MD2 D;  1SMY D;  4K6D A;  3WOF A;  1CA5 A;  3E0J A;  2NN6 I;  2R61 A;  1TQO A;  2JE6 I;  4O42 A;  1D6E C;  4DGZ A;  5DM6 3;  3M4O B;  5JVH 3;  4ZQ3 A;  2B2V C;  2F3V A;  1SNM A;  5EKK A;  2D9U A;  1CTM A;  5A35 A;  4MHE A;  4MIU A;  3HKZ B;  2AQ1 B;  3D4D A;  1PTO D;  3I4L A;  1U4P A;  2XRS D;  4X3K A;  4RAU C;  4XDX A;  3K57 A;  2OEO A;  1F9Q A;  3MHB A;  1WTO A;  1VMP A;  2LMC B;  3K5L A;  1KLG D;  5IGG A;  2H1E A;  1EU3 A;  4KV6 A;  4NMZ A;  1G29 1;  1ML0 D;  4O1N A;  4F88 A;  2ICI A;  2EJM A;  2NVY B;  2SNM A;  1DOK A;  5FLX L;  1GUN A;  1U4M A;  3VR3 A;  5CV6 A;  1EZ6 A;  4NDX A;  3O13 A;  4XQN A;  2CQA A;  4X3T A;  3PMF A;  4FF2 A;  1S5E D;  4A3K B;  5I9P A;  3ERQ A;  2JA7 B;  2KEE A;  1E2Z A;  1RHP A;  3U9O A;  3JAM L;  3SK6 A;  3QJY A;  2ID0 A;  3KUP A;  5FO9 B;  3C2P A;  2EDG A;  4FNF A;  2O2L D;  4HCE A;  3NQI A;  3I91 A;  1KNE A;  3EFX D;  1NR2 A;  2EYJ A;  5IIF A;  4K8I A;  2PZT A;  3NBH A;  4XQJ A;  3DMU A;  1JWU D;  1AZQ A;  1WTR A;  1VMC A;  2EJG C;  1GJX A;  4GZY C;  4NW2 A;  2F0L A;  3LX0 A;  4L6T B;  1EY0 A;  3M85 A;  5IGB A;  3K5O A;  2BE5 D;  1CHQ D;  5C4H A;  3NSW A;  3ZYY X;  1D5X C;  2XVS A;  1TS2 A;  2HUG A;  3ND8 A;  2PPB C;  5E1F A;  5KGU A;  1I4P A;  1Q3L A;  1H9J A;  4IUU A;  2TSS A;  3A55 A;  2KVM A;  4OO1 G;  1GUW A;  4J1M A;  3EA6 A;  2E75 C;  2F0I A;  1GHK A;  2JEA I;  4YIJ A;  2GA4 B;  2F0P A;  2NVQ B;  5LL6 X;  3I90 A;  1SYB A;  2D2C C;  1L0X B;  1A2U A;  1ESF A;  3TP6 A;  5JJZ A;  5T1G A;  1DOL A;  4R9W A;  2DY8 A;  5ELD A;  3MXP A;  2WV6 D;  3VYU A;  1V1P B;  1E2W A;  1TS4 A;  4OO1 I;  3MXU A;  5M3F B;  3RZO B;  1DM0 B;  1A3U A;  2L55 A;  2R6G A;  2PQE A;  3J80 L;  2IL8 A;  3MXN A;  5FK9 C;  2EYL A;  4KY7 A;  4C3H G;  2F0V A;  2MP1 A;  2R92 B;  3GTM B;  3I8Z A;  4OIK A;  5JPM C;  1Q1B A;  5CV4 A;  1HFG A;  1PTO H;  5KNB A;  1CK1 A;  3MTS A;  4L63 B;  3HGB A;  2EY6 A;  1HTL D;  1EL0 A;  1EY4 A;  3KLR A;  5KYL A;  3LNN A;  5JOB A;  4FO2 A;  2AUK A;  3A7A B;  2DY7 A;  1LTB D;  2EJF C;  1I50 B;  1STH A;  4RCO A;  3MA2 B;  2F0D A;  1LT3 D;  4TQU S;  3VYS A;  4ILW A;  2M00 A;  1PRT C;  4IUN A;  1RCV D;  5D65 A;  2A5H A;  5CV5 A;  3P20 A;  4CKB A;  4IUV A;  2A69 C;  4CHT B;  2EYH A;  3GTO B;  4K5V A;  1ROD A;  1STY A;  2A68 C;  3BVG A;  4XYQ A;  1IHZ A;  2KOL A;  2A6H D;  1H9M A;  4ZRZ A;  1DXM A;  1PFB A;  4I65 A;  2EZV A;  2KED A;  1EQT A;  1F9P A;  3VR2 A;  2BA1 A;  3CHB D;  5M9O A;  4EQN A;  2SOB A;  1C48 A;  2WKD A;  1PZJ D;  4KN4 C;  2B63 B;  4KY5 A;  3DUZ A;  3T53 B;  5EPL A;  2Y0S B;  3Q6S A;  5CV8 A;  2RBM A;  4FVM A;  2AWO A;  1V1O A;  1M8A A;  1D2B A;  3D3R A;  2FMC A;  1LTS D;  3GP7 A;  3NTK A;  3RD4 A;  1HTP A;  3RLF A;  1NR4 A;  1ILQ A;  2X6G A;  2V4D A;  1A3V A;  2IT1 A;  5EGT A;  4OIJ A;  3IAY A;  2XSC A;  4A93 B;  4C1N K;  4OL7 A;  1BO0 A;  1RTN A;  1WCM B;  3D31 A;  3S1M B;  1RTO A;  3M3Y B;  2G9D A;  3DWA A;  2E2H B;  2SDF A;  1NCV A;  5JAV A;  2EYF A;  3S17 B;  5EPK A;  2F0T A;  4XT3 B;  1I4X A;  1PMR A;  5K36 G;  1TT2 A;  1YNN C;  4HTH A;  1D5Z C;  3FMC A;  4C3I G;  4FF4 A;  5CR3 A;  2B2T C;  2WAC A;  3HS0 C;  4F8M A;  1UUP A;  4NKL A;  3HOU B;  4HAE A;  1JOK A;  5FO7 B;  1EYD A;  1WTQ A;  3QOL A;  2L12 A;  3IL8 A;  1NUC A;  3R93 A;  2F0M A;  2KA7 A;  3SHL A;  4ME5 A;  2NTS A;  3D4R A;  2M9V A;  5IOC A;  2VUM B;  5C5L A;  2K5Q A;  4DNT B;  1DZ1 A;  2Q8I B;  3HOZ B;  2D62 A;  5JVG 3;  3N6R A;  4HED A;  5DAU A;  1JWM D;  1QNK A;  1LAB A;  1Z6H A;  4MN3 A;  1Y69 U;  1HQM C;  1PYW D;  2L4N A;  1R4Q B;  2F0K A;  3TP8 A;  4A3M B;  1VF7 A;  3H6M A;  5C0X H;  4DNR B;  4JBW A;  4PQX A;  5E4W C;  2HDL A;  3SK4 A;  3TDQ A;  3A56 A;  5ELB A;  1W6J A;  4LMQ D;  3KBG A;  4XXE A;  2CW0 C;  1NAP A;  1OXV A;  4RGN A;  3NP8 A;  5HGT A;  1V43 A;  1J8I A;  1EYA A;  3PUZ A;  3BDO A;  2RQX A;  3BDC A;  1EOT A;  3OWF A;  2ENB A;  1SFO B;  2F3W A;  2L1B A;  3U9S A;  2XNA C;  3NBI A;  2F0O A;  3AMU A;  4AYB B;  3OWE B;  5FO8 B;  1BR9 A;  1GOZ A;  1HCZ A;  4A3J B;  1SSO A;  1A15 A;  3TN2 A;  1CA6 A;  1FR3 A;  1SYC A;  1B53 A;  2QKI C;  5LHY 1;  5CV9 A;  3K0Y A;  1I6H B;  3MVV A;  1TS3 A;  2NTT A;  2Z4H A;  4ZUJ A;  3OW7 A;  2K05 A;  2VXW A;  2O5J C;  5TSS A;  1FYC A;  1NSN S;  4HSV A;  4WJW A;  5M5W B;  3M4Y A;  1D1K A;  3FDT A;  1W6K A;  4KMU C;  2JEB I;  2KEC A;  4CGY B;  1I4Q A;  3OSO A;  3KF8 A;  4ID6 A;  2MJ8 A;  5FKA C;  3M7N A;  2BDO A;  1LTI D;  3KBX A;  3S1R B;  1SBB B;  2HDM A;  2L5T A;  2EY1 A;  2ZXO A;  3D6C A;  3M7G A;  3QO2 A;  3D4W A;  2XIW A;  2I46 A;  4TKO B;  1KNA A;  2F0Q A;  2NUC A;  4WRD A;  3GTL B;  1F2Z A;  1BCP B;  2ZXR A;  5C3X A;  1I4G A;  1G2T A;  5E3F A;  1ESR A;  5K36 H;  1BXT A;  1G8Z D;  1JIC A;  3NHH A;  5I2Y A;  1CT1 D;  1CI3 M;  2EOT A;  3R8B A;  1FNU A;  1STB A;  5BN4 A;  3NWT A;  5JPN C;  3T16 A;  3GV6 A;  1B1Z A;  2OXP A;  4G4K A;  2RDG A;  3RMH A;  4IUP A;  4QB4 A;  1RD9 D;  3FRP B;  1LT6 D;  1LAC A;  5EBD A;  2PNR C;  3VA7 A;  5EQ0 A;  1HPC A;  2LFN A;  1GUG A;  1LO5 D;  1UAP A;  1AZP A;  3P1H A;  3J7Y W;  5M5X B;  2YYZ A;  1WVL A;  3P75 A;  3LWU A;  1K83 B;  4WFN 3;  4H7B A;  5DM7 3;  5IGE A;  1MBY A;  2F0U A;  3MWY W;  4G7O C;  3PUY A;  1ZYR C;  2IX0 A;  4PMC A;  1JC7 A;  4Q5V A;  5C6A A;  1FNW A;  3VYR A;  4B9W A;  3A7L A;  1JCK B;  5EBC A;  4S3S A;  1LT5 D;  4BS9 A;  4UDU C;  3SVM A;  2EY5 A;  5EJW A;  2F0S A;  1PTO B;  4XT1 B;  5JEA J;  1DCZ A;  2E76 C;  4QUC A;  3BS1 A;  2G9H D;  3R2T A;  2VB2 X;  3IFD A;  4J8Q A;  3FPU B;  1SYD A;  2B2W A;  1SEB D;  2JA5 B;  3EVQ A;  4N9P A;  1F2M A;  3V2T A;  4R8I A;  4CBV A;  1LTR D;  4KKU A;  2F0F A;  5J22 A;  4PMW A;  2XWJ B;  1Z47 A;  3S1Q B;  1JR0 D;  1SYE A;  3C46 A;  2ZT9 C;  5M3M B;  2F0E A;  1HXY D;  4RHS A;  3SR1 A;  3EQL C;  3OHX C;  3NWS A;  1IYV A;  1G6Z A;  2L11 A;  2F0H A;  2N88 A;  2NN6 H;  4U68 A;  4ULL A;  4A3D B;  1K8O A;  3T4A C;  1WTW A;  3L7Z C;  2NB0 A;  1U9R A;  2A6E C;  4KN7 C;  1LTT D;  4KK7 A;  4ZLT F;  3NTI A;  4KKS A;  4M8A A;  1F2L A;  4UAI A;  1TY2 A;  4I7Z C;  2FJ2 A;  2X69 A;  4H13 C;  3NPP A;  1YNJ C;  1EY6 A;  2RSO A;  1UNS A;  3GTQ B;  4CJ0 B;  2C9O A;  1JOO A;  1STA A;  3T56 B;  3W3A A;  5CMD A;  3FEW X;  1OXX K;  1HA5 A;  3MXG A;  2SEB D;  5G3L D;  3QIA A;  3TME A;  1KTK A;  2F0N A;  4XIG S;  3SXH A;  4A3E B;  3MC0 B;  1A6X A;  3A8K E;  2EPB A;  4IN3 A;  1TWF B;  2L0C A;  4TRD A;  5ELE A;  2PCF B;  4C3J G;  3OMC A;  2M2L A;  2FIN B;  4EQP A;  1KAB A;  2LS0 1;  5C44 B;  4IUQ A;  2OT2 A;  2LKV A;  3BYY B;  2NZ1 D;  3ERO A;  3T13 A;  1IW7 C;  1GUT A;  4A3F B;  2AWN A;  1Q8I A;  2JXM B;  4PNY A;  4RKB A;  5ELF A;  4M1U B;  5KIX A;  3GTK B;  1DOM A;  3PIO 3;  2HCI A;  2X6L A;  3V05 A;  4IFD J;  3PO2 B;  1SYF A;  3TSS A;  1HFN A;  1AN8 A;  4C3H B;  2K33 A;  3MFG A;  4QUF A;  2NWG A;  5ISR A;  4K5W A;  1JOQ A;  4G7Z C;  2MUY A;  2E2D C;  1BCP C;  1CHP D;  4B08 A;  1F9R A;  5C3E B;  3LWE A;  1LTG D;  3K6O A;  4KTA A;  5ELC A;  2R3Z A;  4HSP A;  5CGK A;  1BF4 A;  4A3B B;  5KEE A;  4K5X A;  1GHJ A;  1TWC B;  1G2S A;  5A2Q E;  3VR4 A;  1HUM A;  1X3Q A;  5KNC A;  3W2D A;  1B44 D;  1GXD C;  3H3V C;  1Y8O B;  1IKM A;  4OO1 H;  2B2U A;  1STG A;  1UEA B;  3CQZ B;  3AU7 A;  5A2Q L;  5J1Z A;  4KJN A;  4ZK9 B;  1XX8 A;  3I4N B;  5BN5 A;  1ENA A;  2BA0 A;  1CQF A;  2CHB D;  1AP0 A;  3DXJ C;  1LT4 D;  1SYG A;  1SMY C;  2E2I B;  2TMP A;  4X3U A;  5IGF A;  3L3O C;  3Q0A A;  4ZKC B;  4DA2 A;  3IKJ A;  1TU2 B;  1FNV A;  4FYD A;  3SDZ A;  1AW7 A;  1AFP A;  4K2K A;  2B8G A;  5C4X B;  2AQ2 B;  1RDP D;  1EU4 A;  1QJO A;  5EKI A;  1SDF A;  3BZD B;  1VDZ A;  5I2X A;  1PTO C;  3RUZ A;  1LTA D;  3A54 A;  4IUR A;  2JA6 B;  5T1I A;  2XRQ D;  3S16 B;  1BOS A;  4KHV A;  1GUO A;  3D6W A;  4C2M B;  4H0L C;  1HRJ A;  2IX1 A;  1JQY D;  4KI0 A;  1O7Z A;  2DN8 A;  5KRU A;  1B50 A;  1EY8 A;  2YU9 B;  3PIP 3;  2JP1 A;  4RWS C;  2EYM A;  5AFW A;  1Q90 A;  1V8Q A;  2SNS A;  3I72 A;  1H9R A;  1SND A;  3TZD A;  1DJR D;  1PZK D;  4N9T A;  5C0X J;  1BQQ T;  3S15 B;  2CVR A;  5COY A;  1II3 A;  5LL6 S;  1SE3 A;  3CU7 A;  1XWE A;  3TP5 A;  3WOE A;  3NUC A;  4P2C B;  3HZX A;  5C4Z A;  4ZYS A;  3GV3 A;  5I9O A;  1C4Q A;  1GUS A;  2FHT A;  3MEH A;  2KCN A;  4CKC A;  1S5F D;  2C5C A;  2BOS A;  5I6Y A;  2IX3 A;  4JK1 C;  4XTC S;  5EKL A;  3E6Z X;  1DON A;  3L9A X;  1PRT D;  2WII B;  4V0B A;  1XTC D;  1XXG A;  3CKI B;  1TWA B;  3PO3 B;  3TP7 A;  2A69 D;  3HRZ C;  1QWY A;  4XYO A;  5JEA G;  3KK7 A;  4DAY A;  2A68 D;  1O7L A;  2BE5 C;  5I4D A;  1RF2 D;  2QDB A;  3I3C A;  4CJ1 B;  3H94 A;  4X3S A;  3UI2 A;  5E4X A;  1K8M A;  3Q22 A;  3KLS A;  1B3A A;  5BN3 A;  3PUX A;  1HHV A;  3NK9 A;  3C1E A;  1SXT A;  3FVQ A;  1LV9 A;  2B2Y A;  2B39 A;  4A3I B;  2K04 A;  1TR5 A;  1O80 A;  2K6A A;  1JWS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...