2F0PA

Crystal structure of staphylococcal nuclease mutant v66i/v99i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0pA00
2F0NA 1STYA 3DHQA 3NUCA 2O4XA 1A2TA 3D6CA 5IGFA 3NK9A 4R8NA 5CV5A 3SK5A 1KDCA 5C4HA 2NUCA 4DFAA 1AEXA 4EQPA 5I6WA 2EXZA 5KYIA 4PMCA 1IHZA 4KD4A 1SNDA 4KY7A 3MXPA 4QMGA 2F0SA 4ODGA 5CGKA 4N9TA 2HQEA 3ERQA 5E1FA 3NXWA 4EVOA 5K5PA 2WACA 4QB4A 3HZXA 5E3FA 4IALA 3MZ5A 5I6YA 3T16A 1A2UA 2EY2A 4ZQ3A 4G57A 2ENBA 4N9PA 2OF1A 1EZ6A 2QDBA 1TT2A 3SXHA 2LKVA 1EY4A 3HEJA 3QOLA 4KY5A 3TMEA 1STAA 3E5SA 3V2TA 1JOOA 1SYBA 4HMIA 1ENAA 1EYAA 1JOKA 2EYMA 3MEHA 4K6DA 4KY6A 2PW5A 2EY6A 4HMJA 5C5LA 1KABA 4EQNA 3NQTA 5C4ZA 1EQVA 2F0FA 3BDCA 3D4WA 3LX0A 4WORA 3C1FA 1SYDA 1SNPA 1SYCA 4K5XA 4NDXA 4PMBA 4RKBA 1EY5A 2F0VA 2EYJA 2F3WA 3NHHA 4IZ8A 4KJNA 5IIFA 2OXPA 3EROA 3EVQA 2F0QA 2F0MA 4K5WA 4NMZA 1TQOA 3TP5A 1KDBA 3OMCA 3OWFA 3BDLA 5KEEA 2EYOA 5JAVA 1TR5A 1A3VA 4EQOA 4F7XA 2PZWA 4B9WA 1NSNS 3QB3A 1STHA 1II3A 3SK6A 3U9OA 2SNMA 2EYLA 4K2LA 4LAAA 3S9WA 5CC4A 3TP7A 1SNCA 4ID6A 5KIXA 4QF4A 4IUNA 4K14A 5CV8A 1EZ8A 4ZUIA 2F0KA 1RKNA 4DU9A 4H7BA 2KHSA 2EYHA 3ITPA 5IGGA 2EY1A 2F3VA 4KJOA 3NP8A 3R3OA 1SYEA 4S3SA 2F0WA 4TRDA 1EY6A 2F0OA 5JOBA 2F0IA 5IGDA 5KGUA 5IODA 1STBA 5DAUA 4KHVA 5J39A 4E6IA 4J1MA 5EGTA 4K8IA 5C5MA 2KQ3A 4YIJA 3SHLA 1EYCA 5CV4A 4B9XA 1F2YA 5HGTA 1JORA 2RBMA 4KD3A 5DEHA 4I65A 1SYGA 3D4DA 3SK4A 3SR1A 5IOCA 4ME5A 3QOJA 1U9RA 4NP5A 5CV9A 3TP8A 4ZUJA 4DGZA 5HURA 5M9OA 5ISRA 4KTAA 4KV6A 1F2ZA 3OSOA 1SNQA 1F2MA 2PZUA 3MHBA 4NKLA 5IGCA 2F0JA 2PZTA 5KRUA 1SNOA 2EY5A 3P75A 4RKLA 4WRDA 2F0TA 5I9PA 5CV6A 4PNYA 1NUCA 3D8GA 3VA5A 1EY8A 3SK8A 5IGEA 5C3XA 2RDFA 2RKSA 4J6HA 5CR3A 1A3TA 3TP6A 2F0GA 5KYLA 5EKLA 2F0HA 1STGA 3EJIA 1EY9A 5C3WA 2PQEA 3C1EA 1SNMA 2F0UA 5F2DA 2PW7A 3H6MA 5NUCA 3T13A 1JOQA 5J1ZA 3RUZA 2EYPA 4OL7A 5J22A 2F0PA 1KDAA 1ENCA 4MIUA 5C6AA 2OEOA 4K2KA 5EKKA 4DF7A 3PMFA 2SOBA 1EY7A 1SYFA 3P1HA 4K8JA 4F8MA 2EYFA 5CV7A 3MVVA 4HTHA 2F0DA 2M00A 1A3UA 1STNA 1KAAA 1EYDA 4K5VA 2SNSA 5I9OA 1EY0A 3DMUA 3OMGA 2F0EA 5IGBA 2PYKA 2F0LA
chains in the Genus database with same CATH superfamily
1DM0B 1A2TA 5J3BA 4R8NA 1YHQA 1C0AA 1Q90A 1DYQA 1NAPA 3PO3G 2R92B 1NTGA 4A3GH 3PIPA 2EIFA 2QEJC 1PA6A 3D31A 3J81j 5CGKA 2BA0A 4LFAL 3IFTA 5GAHC 1H9KA 3FVQA 4RGTA 1SDFA 1WTHA 2MO1A 2Q8RE 4QJFA 2MP1A 4C3HH 3KDFB 1FJGQ 1SSOA 4DAPA 2EY2A 1J5EL 1E22A 1WOCA 4DV4Q 4JI5Q 1RF2D 1O7ZA 1EWCA 3S17H 4JBWA 1ZYRC 3D6WA 2D0PA 1PH1A 1EQVA 1CZWA 1OTCA 2QA4A 4XQNA 2WAQB 2Q2TA 4JI0L 2JA5G 4A3LH 4LK1C 3NBHB 4NMZA 1MJEA 3STBD 5FJ8G 5C0XH 1WVLA 2B63B 5KEEA 4BY1H 4JI3L 2MJ8A 3SE0A 2JP1A 1JC7A 3G7LA 1CT1D 1DOLA 3S9WA 1DZ1A 1GUGA 5TSSA 2IPKD 4DA2A 1B50A 1IBLQ 1L0YB 5CV8A 1EZ8A 4ZUIA 3K8AA 2N49A 3I4NH 2ZM6L 4DU9A 1QJOA 1IKMA 3BZDB 3TBIB 1K8GA 3ULLA 4TVAB 4BBSB 4AQYQ 4B3RL 1FNWA 3A8JE 5I2YA 1KLUD 5C5MA 2QF7A 5I4DA 3NE5B 3VR2A 5IOCA 3R2TA 2JEAI 1U9RA 2D62A 1LTTD 1OO9B 4KTAA 4KV6A 3MHBA 1BDOA 1VCIA 4WRDA 5ELCA 5ELBA 3UI2A 3R93A 3Q23A 3MTSA 4H02A 1YZ6A 3PV0A 1B2TA 5IYCH 3C1EA 1PHJA 1IBKL 2HIXA 5C0XJ 4X3TA 1XMOL 2IW3A 2UXBQ 2J4XA 4AYBG 3H3VC 4GOPA 3NENA 4CHTB 5C6AA 2Z6BA 1V8QA 1D7QA 3ULJA 1K83H 2YU9B 3OMGA 2JK8A 2ICIA 1GM5A 3N52A 5T1IA 2O4XA 1X32A 1IW7D 4A3CG 2AUJD 1RCVD 2PMZE 3U4VA 3JAMi 3Q24A 5E4WC 1PH4A 1YHBA 5E1FA 1CA6A 4DR2L 3WOEA 2HQLA 5K5PA 4LF6L 5K36G 4DV6L 1WTPA 1PYWD 5JVH3 1KNAA 1A2UA 2N55A 4Q5VA 1IXRA 3HOVG 5LMNW 3KLSA 2F4VL 4A93H 4JBJA 4KI0A 3E5SA 4JBKA 1BBUA 1LACA 1FL0A 4JBMA 2VNUD 4NPSA 5ELDA 2VB2X 4B9XA 2E74C 1SYCA 3OWEB 3VYTA 5M3MH 3RZDH 3TP5A 3BDLA 3M4YA 1LM0A 1WTXA 1C9OA 1SE2A 5JVG3 2EYLA 4CKCA 1G6PA 1K83B 3KDFA 2G9HD 1L0XB 2MFIA 4GS3A 4A3JB 4Z9CB 4A3IG 3GTQB 4OWTB 1SJED 1CQFA 1EL0A 1NBWA 4OIKA 1PRTF 3HOXH 4A3IH 1STBA 4DV1Q 3M4OB 2KQ3A 1N36Q 1FNUA 2ZJRA 2VW9A 1Y1WB 2ZXOA 1PFMA 5IT9E 1HZ9A 2VL6A 5KRUA 3M7NA 2EPBA 1EY8A 2WAQG 3TN2A 3GTGH 4AYBE 3CCRA 1N34L 3ICEA 1BCPF 1ZKOA 2MPMA 2FFKB 2L55A 4BBSH 4JV5L 4DNRB 1IBKQ 1AP0A 4G7HC 2WFWA 1K73C 2ZTDA 3F2BA 5C4JH 4DV5Q 1CA5A 5HY6A 2F3IA 1VQEA 3A8IE 4CDEC 5EQ0A 1EWHA 1KRSA 3AQQA 5IGBA 3GTPB 5KNBA 3C46A 3OIPA 2O5JC 2RHQB 2H1EA 1XMQL 3K7UC 1R9TB 4RCOA 2F0SA 4DNIA 1K8AC 3HOZG 2F1MA 4QUCA 1YNJC 2B2UA 3FHWA 2KENA 4IALA 2IHEA 1TWFH 2B8FA 4A3KH 2VUMB 4BY7B 2Q2HA 2NBFA 4CGYB 2E2DC 4X66Q 3UE1A 4DNTB 1KABA 1BCPC 1L2FA 1SMYD 1D5XC 1S5DD 1IBLL 4GNXC 2JA7G 3UDIA 2KCNA 2XTIA 5LMUL 1B8AA 1MHWC 1HPCA 5CBAE 3CC2A 3MFYA 1R9TH 2B2YC 4DV4L 1FGUA 2NVXH 1LTBD 1TR5A 2BDNA 4DR2Q 4OWWB 1X55A 4N8FA 2I07B 3SK6A 2LFNA 1X6OA 4RHSA 3STBC 3H0GG 4A3KB 3EN2A 3QJYA 2L15A 1KC8C 5FLMG 4CJ0B 1K28A 1CFMA 3CQZH 3Q22A 1GUNA 2VY3A 1RTOA 1LV9A 3NP8A 1HRJA 1U4MA 4IJLA 1HXYD 5EPJA 1YNNC 5M5YH 3D4RA 1BCPD 4YIJA 2D0OA 2J0TD 3NBHA 4NXMQ 1SRUA 2CH4W 2MQHA 4X3UA 1AW7A 1I3QB 1V1QA 2C35B 1NNXA 1U0LA 4XYQA 1WCMB 5IGCA 3P75A 4DAYA 5IWAQ 5IGEA 3SVMA 1CK1A 4HJ7A 2A5HA 1A63A 1Y14B 1HQRD 1CHQD 1M1KC 2XIWA 2PQEA 3HOWH 4FDBA 4HJAA 5FOBB 3KK7A 4L5QA 3S14B 5EPKA 3F2CA 2NYZD 2Z9HA 2Z0SA 5M3FH 3CW2C 1EY7A 1O7LA 3H91A 1I3QH 5AJ3Q 3NEMA 2F4VQ 1HR0L 1L1OB 1ZXTA 2GA4B 1GOZA 1R4PB 2A73B 4IPGA 4RHRA 3AMUA 3DHQA 2YV5A 3KLRA 2NVYH 2NN6G 2WINB 2RVLA 1V43A 3H09A 1SFOB 3HRZC 2DY7A 1ILPA 4QMGA 2IX1A 2FHTA 3TDQA 2NZ1D 1CHPD 4ZRZA 4BY1G 1I4RA 3L9AX 5D3IB 3GTQH 1PH8A 1TKWB 3PQIA 4BWGB 3RN2A 3OTOL 3AU7A 5C0XI 1QG7A 2ZM6Q 1EIHA 4LFCL 4OX9Q 1WTRA 3CPWA 3HOZH 3K0YA 1HUNA 4WORA 2MO0A 1PRTC 4K5XA 1EIYB 3OHXC 1HH2P 1KDBA 1YHAA 3JC66 3DM1A 1PXUA 2XWJB 4JC0A 4L5RC 2JA6G 3GTGB 1I6HB 3MWYW 3Q8DA 1QNKA 1HFNA 2B2VA 2CFMA 3AYHB 1LLRD 1OXSC 3ULPA 2GVBA 1TS4A 1I94Q 2B63H 3S14H 2OT2A 1U4LA 4IPCA 3E0EA 1PVOA 4HJ8A 1XNQQ 1FD7D 2QDLA 1VQBA 2YTYA 3FRPB 3A54A 5HURA 1VQPA 4DV3Q 1CQVA 5AFWA 1PH6A 1G2TA 1VQHA 2HCCA 2I5MX 4BBRG 1Q3LA 4HJ9A 2I0QA 2KHIA 2JA7B 1DXMA 3X3MA 3TS2A 1BO0A 3ER0A 2E2IH 1X3PA 4LF7Q 3W3AA 4DK3C 1IYUA 1LABA 1D1IA 4GN5A 3GTMH 3HOXG 1PFBA 4HJ5A 3BZKA 1XX8A 1QVGA 1E2WA 2H5XA 2HUGA 4F8MA 4O42A 5CV7A 4HTHA 3HFZB 3I55A 3K5NA 4A3JG 2PI2A 5I9OA 2EDGA 3V05A 4R4IA 1ONLA 1N33Q 5IGFA 3PIOA 2UUCQ 3SK5A 1T5XD 4JW0A 1IHZA 4GLVB 2HDLA 2P5ZX 3I2ZA 1O78A 4OO1I 1I50H 4IOAA 2K5NA 5C44B 5COYA 3R8BA 3MZ5A 5LL6S 3SDZA 3GDEA 4N9PA 2GN5A 2HHHQ 1TT2A 3W2DA 3G4SA 1EY4A 3EBEA 1ET9A 2ID0A 4K6DA 2LSSA 1GUOA 5K36H 3A8KE 3DEOA 1BKBA 3BDCA 2F4IA 4QUFA 3LX0A 1SLJA 4FVMA 4PZ7A 3QR8A 2A1AA 4JI7L 1J9OA 3DLLA 3KJOA 3S16H 4IFDG 3EROA 1STEA 4CJ1B 2LY7A 3S24A 1TXYA 5FLXc 4A3DB 4M8AA 3H94A 4KHZA 5KNCA 2D9UA 1II3A 4BY7G 1I6HH 1QZHA 1E7ZA 1DONA 2Y0SB 1YITA 4GN4B 4A3KG 4MTNA 4RA8A 2B2TA 5JPMC 4OX9L 2EYHA 2YYZA 1E3PA 2OQ0A 5JOBA 3J80L 3M9BA 4F88A 2YTXA 4UHVA 5DEHA 1TVXA 2HDMA 1SYGA 5LHY1 1Z9FA 1V9PA 1EU4A 3O13A 1VQFA 2N8NA 1EIGA 2K52A 4NKLA 1OXUA 1S5ED 4ULLA 3M3YB 2F0JA 2ZTCA 1SNOA 4QIWE 4V0BA 5I9PA 1FGBD 3D8GA 1Y1WG 1WTOA 1O80A 4IO9A 1A3TA 4FYDA 1EY9A 1PYBA 1GHKA 5F2DA 1SNMA 2KA7A 1A62A 1K8OA 5EKIA 4LUOA 5EBDA 5M3MB 2FJ2A 3MXGA 1VQOA 1GUSA 4TSSA 1E0BA 4BS9A 4CKBA 2MNAA 4JCVE 5FLXE 1WFQA 3GTKH 1MIUA 2BH2A 3K80C 1AZPA 1WD0A 4L6TB 4LFAQ 1FYCA 1VQ8A 1E1TA 2KOLA 1EQRA 2CVRA 2A74C 2F0NA 3CXCA 3BYTB 3PGZA 1PTOD 2R3ZA 2N78A 4B3SL 2LXKA 4DXGA 4DV2Q 5CV5A 5C4HA 5IY0A 2ES2A 2K5HA 2NVTB 4CDDC 2Q2UA 4RH6A 2R93B 2PI2E 1Y1VG 2L1BA 1Q7YC 1VQGA 3FMCA 2Z6KC 3BG3A 3HZXA 5BR8Q 1FNVA 5C44H 2N88A 1I6VC 2HCIA 2ENBA 4A3BH 2EOTA 2UXDQ 3RZOH 4CDCC 3HOUH 3A74A 1ENAA 4ZK9B 2EYMA 3NWSA 3G6EA 3F2UA 4IUQA 3PO2H 1X3QA 1TWFB 1X3EA 4NDXA 2Z8LA 3S1NB 4G7OC 1VQIA 3PO2B 2EYOA 4JVZA 3TREA 4QQBX 1AH9A 3A7LA 2FMMA 2K05A 4ZYSA 1BR9A 4LAAA 3VR5A 3CCEA 4DUYQ 3TP7A 3TSSA 1SNCA 4HN7A 2Y0SE 4A93G 1E24A 4FF3A 1PFNA 2Q8IB 2QILA 4H7BA 3J7AF 3RLFA 2EXDA 1SYEA 5A2QL 1L0WA 4A3EB 3MEFA 4K6LA 1IBMQ 4FF2A 1EYCA 1K0RA 1W6KA 1BBWA 4DR5L 2QKIC 4X64Q 2K6AA 2RQXA 4K0KQ 1YJNA 1F9SA 5CV9A 2F03A 1N36L 1EFID 4TKOB 1F2MA 3CP0A 3TRZA 4HCEA 2R92G 2DUDA 3PO3B 5L37A 1UE5A 2K03A 1RODA 2AWNA 3S1QH 4JI1Q 1CTMA 4R8IA 5BN5A 5KYLA 1CKOA 2K50A 4YHHQ 3K58A 3GTKB 1UUPA 3D0FA 4C3HB 4NXNQ 4RG1A 1J8IA 4XIGS 4DKAC 2BDOA 2A6EC 3D3RA 3EQLC 3TZUA 4C3JG 4ZCKA 4K2KA 2GVAA 3WWVA 3J7ZC 4DV7L 3S2HH 1Y8OB 3CCQA 1IYJB 2F0DA 1S40A 4P75A 3HOVH 3DMUA 4I7ZC 5C4XG 3GV3A 3NK9A 3CRKC 1BCPB 3B6YA 4JK1C 1CSPA 1CUKA 2UUCL 4OIJA 2A68C 2YTVA 4A3IB 3K5MA 1ENFA 1M8AA 3ERQA 2NVYB 2XWBB 4JI0Q 1U5KA 3T1YL 4OO1H 1ZYRD 1HNXL 1A6XA 1F9QA 4OELB 4ZQ3A 2HT1A 1R4QB 1Y69U 2AWOA 2ALYB 1JOKA 2G9DA 3PUZA 1GHJA 3C1FA 4RKBA 1Y8PB 4IZ8A 3NHHA 3KF8B 3CC4A 3P20A 1TWAH 4A3JH 1UAPA 4G7ZC 4DV1L 2R6GA 1EOTA 4B9WA 3OPOA 5H1SE 3PIP3 2NN6I 3EFXD 3KOJA 4DR6L 1XPUA 1SMXA 1Q1EA 4DK0A 3M85A 3KFUA 1K9MC 1TY2A 3I4MH 2L9HA 1TS5A 1V1OA 3ERSX 2R7ZH 1EIFA 1Q8KA 1KQSA 1V1PB 4KKTA 4RGMA 4UP7A 5A35A 4S3SA 1VF5C 2OTLA 4KHVA 4ALPA 4AQYL 2IJ0A 1IW7C 5JEAH 2K33A 2QEXA 4DR1Q 5IYDG 1B70B 2K32A 4A3GG 1LYLA 4HIMA 5M9OA 5M5WH 4CBVA 1ASYA 1F2ZA 2LXJA 4LF8L 3DXJC 1VQ6A 5CV6A 2EJFC 3WDNA 3J7YW 5JPNC 1HZAA 5ELFA 3EJIA 5FJ8H 1Q12A 3SEBA 3NTKA 3H6MA 1YBYA 5CBEE 5NUCA 4YHHL 2UUAL 4OL7A 5CORA 5DM63 5C3EH 4A3DG 1B9NA 4MIUA 3I4NG 2I5HA 3H3VI 4KHPL 1K3BC 3DWQA 4R4CA 1DCZA 3S1RB 1FR3A 1XNRQ 2M00A 1STNA 1UEAB 1PRTD 1VQ5A 2CW0C 4QY7A 1IZ6A 1PTOH 3BVGA 2WB1G 1DJRD 1X56A 4HAEA 2EJGC 4H13C 1NJIC 2JA8B 5DNFA 4PMCA 2UXCQ 2KEDA 3CKIB 4HIKA 1PZJD 3OIQA 2E2IB 5KNDA 2TSSA 1VQJA 3CD6A 3GTLH 2ZJQA 3PUVA 2R7ZB 4JI8L 1X9NA 4LFCQ 2Z6KA 2CQOA 4ABNA 1N33L 4GOPC 3LGJA 1LO5D 3HEJA 2RF4A 3TMEA 2K04A 3J81c 5JJLA 3F1ZA 2QW7A 1GUTA 4RFBA 4JI7Q 1K0SA 3NQTA 4HR7B 4IOCA 1JJGA 4HSPA 3BYYB 4IN3A 1I5FA 1WD1A 3K0XA 4P2CB 3OWFA 1XTCD 5M5XH 3OW7A 4DAYB 3DM3A 4QIWB 1K3RA 2L12A 5KIXA 4MTKA 5GAEC 1L1OA 1HNWQ 1KLGD 1B44D 3F2DA 1D5ZC 5IYDH 2JJQA 4TRDA 4A3BB 5M3FB 2CWPA 5J39A 4X65L 2JA8G 3S17B 2OCEA 1OXXK 4XQQA 1S3OA 3FP9A 2RBMA 4X62Q 1JWUD 4GKJQ 1TS3A 1JQYD 2FXQA 1VQNA 3LNNA 2AQ3B 1PH9A 1XJVA 3M3YH 1PV4A 2XSCA 1RD9D 1B3AA 1GKHA 3GTOB 1VQ9A 4GLAC 4PNYA 2QGQA 1GXDC 5EKLA 2MUYA 1PH5A 3C2PA 1H9SA 2CKZB 2BE5D 4POGA 5ELNA 3S16B 3T13A 4JPBW 4AIMA 2IL8A 4BY7H 2VUMG 4GKKL 4G4KA 5IP7H 5EKKA 1EEID 3V96A 5LMNL 4H0LC 4C3IG 5FK9C 2MGSA 5IT9c 2RHSB 3SGIA 1XNRL 5GROA 2HIVA 2PO4A 1TIID 1XMOQ 2E75C 1HQMC 3E6ZX 3IRBA 3BZCA 1A8VA 3ZYYX 1Y8NB 1XYIA 1VS0A 1H9RA 4EQ5A 3HG9A 5JJKA 1O7YA 2DN8A 4EX5A 2R7ZG 1I4PA 3PUWA 4QB4A 1ET6A 1H9MA 1ZEQX 2XRQD 2M2LA 1PH7A 1HTPA 1P8LA 1PRTB 4A3MH 3J81L 1PLFA 1D2BA 2LKVA 2IWHA 3UDFA 4HSVA 3JAML 4MZ9A 4DR6Q 4KY6A 2HHHL 4C3IB 4XQJA 1N9WA 1KTKA 4DXFA 1ESFA 4KN7C 4C3JH 2JXMB 4A3EH 1LTGD 2PNRC 2JA8H 4RMFA 5IIFA 3BVMA 1HHVA 2F0QA 3K57A 4L63B 4J15A 2PNHA 2N3SA 4B3MQ 4KKUA 3JAME 3KF8A 3F8TA 4B08A 3CHBD 3QB3A 3GTLB 4DR1L 2Q2IA 3J80E 4K2LA 1B3QA 3I70A 3CAMA 4BBRB 3IKJA 3GTMB 1IKLA 3CCUA 2KCCA 2VQEQ 3I8ZA 4A3FG 5BN4A 1VMPA 4LF5L 1HCZA 1NR2A 4BBRH 4X62L 4GKJL 1PYSB 3E3XA 4YCWA 4DAMA 1SAPA 4LF7L 4GLXA 2DNCA 4FXKC 1LTSD 5EPLA 3VYRA 3A0JA 4FP5D 2B2UC 1SNQA 3ONAB 3EIVA 4WJ3M 2K5DA 3VR6A 1NE3A 4Q0FA 1Q82C 1ASZA 1F9PA 3TP6A 1LT5D 4PG3A 5JEAJ 4TQUS 2DGYA 1HNWL 4V190 4A75A 1EOVA 2EJMA 2PCFB 2X6LA 4A4IA 3OYYA 5EBCA 5J22A 1YI2A 1HNZQ 1VF7A 4IPDA 4C3HG 2UXBL 3G6JB 3KF6A 2PMZB 3DUZA 1VQDA 3Q0AA 3HOUG 4M1UB 2E5LQ 3MVVA 4Y7NB 3MFGA 3OW2A 3HKZB 2O5IC 2R92H 5ELEA 4A3BG 4O1NA 3MXUA 2JSOA 4X3SA 5E7NA 1JR0D 3PUXA 5I6WA 5KYIA 3M4OH 4A3MB 3A7AB 4KD4A 4A76A 1RTNA 3QIAA 1YNXA 1LTID 3GD7A 4LW1A 1XPOA 1XMQQ 2AMCB 3J81i 1D8LA 1E2VA 4MN3A 1HTLD 1JWMD 1WJJA 1YEZA 3T1HQ 3U50C 3ZJYC 4HIDA 2NVQB 2BA1A 3SHLA 2NN6H 1EU3A 3PCOB 4PMBA 2C9OA 1YVCA 1TWHH 4KJNA 2ZJPA 1HZBA 4DR7Q 1W6JA 2XVSA 4K5WA 1FVIA 2EQSA 4EQOA 4LNQA 1QVFA 4IFDJ 3NWTA 5G3LD 4JI8Q 4Y7NH 4GZYC 4IUNA 2WIIB 4JI2Q 4ZKCB 3NTHA 4P72A 1SE4A 2D2CC 4J8QA 4KJOA 3GQBA 2EVBA 2HD3A 1VMCA 1I4XA 5IODA 4J1MA 4L5TA 5EGTA 3T56B 4A3MG 2VXWA 5CV4A 1TWHB 2RA4A 3HOYB 4DR4Q 1JORA 3MXNB 3D4DA 2UUBQ 1TWCH 5ISRA 4BY1B 2ICEC 2K5VA 2PZTA 3NBIA 3BVZA 2RSNA 3CU7A 2F0TA 3H3VH 3VA5A 1VQLA 1SXTA 2AUKA 4X6AH 2JYOA 4J6HA 3U9SA 1KXLA 1G6ZA 1BVSA 1QUQA 2G5DA 3Q6SA 3K5LA 5FLMH 4PMWA 1Z7TA 3UDXA 2V1CC 3M4QA 1CZGA 3FPPA 4B3RQ 1PTOC 1KDAA 5GADC 4QL5A 1A3UA 4U673 1C4QA 1LT6D 1S4ZA 2F0EA 2RSOA 3PSIA 1JB7A 4LMQD 1IL8A 2UXCL 2NTSA 3M4PA 2A6HC 3H0GB 1RIPA 3QO2A 2UU9L 2EXZA 1X54A 1RJTA 1ICWA 4KY7A 1AE3A 1QNUA 1JCKB 3T1YQ 2LS01 1X65A 1X3GA 1DGSA 2J7ZA 4YWMA 4UDUC 2DJFC 2B2VC 1G291 5E3FA 3T16A 2R7FA 2QCPX 3W5OA 4JOIC 5G3LF 3V2TA 2VQEL 1BQQT 5IYBG 3A5ZB 1C8CA 5CMDA 1EQQA 4EQNA 4YY3L 5C4ZA 2VQFQ 1LT3D 1V1PA 2F0FA 1HUMA 1SYDA 4FO2A 1NR4A 2F3WA 2NTTA 2EYJA 1S5BD 2OXPA 2VB3X 1L1OC 1QZGA 3PIO3 2K75A 2OQKA 4LF9Q 1WYDA 3FKIB 1HFGA 4L8JA 3ND8A 1KD1C 4K0KL 1MKHA 3T53B 4LF4L 2E8GA 4R4QA 1D6EC 3S1MH 4O2DA 3OOCA 2JA6H 4UP9A 3ITPA 5D14A 3PF4A 4JI1L 2F3VA 2F0WA 1IYVA 4DV0L 4U68A 5IGDA 2Z4IA 2AQ1B 2NWGA 5C3EB 5DAUA 4POFA 3U58A 3J7AV 1KAWA 1AZQA 4NXNL 1QOHA 1BNZA 2L11A 4I65A 4ME5A 4C3JB 4ZUJA 3FDTA 1O7IA 3DWPA 3I4LA 2EY5A 2XRSD 5D65A 1LUZA 1UE1A 4DV5L 1N32Q 1NMFA 2RDFA 1N34Q 4UP8A 4LFBQ 5C3WA 3K81C 1SFOH 2X6GA 4A3GB 3CRLC 2FINB 4GKKQ 4WFN3 5IE8A 3KUPA 2E2JH 1F9RA 3RUZA 1JE5A 1Q1BA 2F0PA 3G48A 2B2TC 3HGBA 2FMCA 3ND9A 2SEBD 1GO3E 1TWAB 2OEOA 1YJ9A 3AEVA 3HOWB 3MC0B 2SOBA 1Q8IA 2XN9C 1NY4A 3PO3H 2C5CA 4HEDA 4X3KA 3HOZB 2PYKA 1PTOF 1VQKA 2E2HB 1ICFB 2A6HD 4JYAL 1TWGH 3NTIA 3KJPA 1KDCA 3FEWX 2AHOB 1MGSA 1C48A 3PF5A 1VQ4A 5I2XA 2HQEA 1YNND 2E5LL 3NXWA 1VQCA 1XPRA 2K1BA 4KN4C 2NZOA 5I6YA 1WCMH 1H9JA 2OF1A 4B3SQ 3HOYG 2QDBA 2IY5B 1T5EA 1UEBA 3QOLA 4A3EG 2IT1A 3MAQA 3TEHB 3I56A 3KLWA 1EYGA 3NSWA 4LF6Q 5GQOA 4KLKA 3H15A 3EVQA 1MSHA 1F77A 3MXNA 1QE6A 1I4HA 3AFQA 1RL2A 2DJGC 2R93G 1A3VA 4DK1A 4UAIA 1BBXC 3KBXA 4DR4L 1I94L 1EWIA 2RDHA 4HIOA 2K5WA 3RNUA 4ID6A 3TZDA 1XTDA 5EJWA 1B53A 3I4NB 2L5TA 1BF4A 1PZID 4LF5Q 1M4VA 4JI4L 3CCLA 1XNQL 3L7ZC 4BXXG 1N32L 2EY1A 1WTQA 4MHEA 4O0AA 5KGUA 1IBML 1E2ZA 3VA7A 4P74A 1PH3A 5FKAC 1F2YA 4C3IH 4L5SA 2JA7H 3SK4A 4RWSC 4KKSA 2PZUA 3H0GH 4DV7Q 4RKLA 2A69D 3RMHA 1YNJD 5M3FG 1A15A 2RKSA 4OWXB 3FPUB 3I4MG 3AFPA 3URYA 1PH2A 2WAQE 5J1ZA 2K5QA 2MHVA 4KHPQ 4PZ8A 2Q8TA 1N8RC 1JB3A 4IFDI 4DF7A 2OWOA 1A0IA 4IUPA 4Y52H 2LMCB 3CF5A 4GNXA 1KAAA 1HA6A 2ZXRA 2JA5H 4A3LG 3E9IA 1WCMG 3HOYH 4LF8Q 4FNFA 2A8VA 5IWAL 4YY3Q 2VQFL 3NUCA 4DR3Q 1B9MA 1E1OA 2NUCA 2JEBI 4DV2L 4JI6Q 1B4OA 1VDZA 1SNDA 3VR4A 4ODGA 5BR8L 3CPFA 1TS2A 4UPAA 3NQIA 3DWAA 3LWUA 2ZTEA 1J6QA 4MNOA 1LTAD 3HOUB 4NW2A 2PPBC 3CMEA 2A68D 1STAA 4A3FB 1UE7A 3GP7A 3D4WA 3RN5A 4GN3B 3RZDB 4NXML 3I90A 3J81E 1YJWA 4DUZQ 2F0MA 1TQOA 1HNXQ 3IAYA 2DY8A 1WTVA 5JAVA 4DPGA 4UY8C 2PQAB 1NSNS 1STHA 4PQXA 2B63G 5LL6X 4LWCA 5IYBH 2NB0A 5CC4A 3A5UA 3I7FA 4K14A 3VYUA 2ATWA 2RDGA 2ZXPA 2CH4A 3X3NA 1G2SA 2H4OA 3L2PA 1ILQA 2JA9A 3T51B 3J80c 3GTJH 2IHFA 1JWSD 2I46A 3S2DB 1EY6A 5E4XA 2NVTH 2F0IA 1SBBB 4LFBL 2F52A 4E6IA 1VQAA 1JJCB 3HP3A 4K8IA 5M3MG 3CC7A 3PUYA 2L0CA 3KBGA 3GTJB 1Q46A 3QWNA 1I4QA 2A6ED 1WI5A 1PMRA 1UNSA 1NCVA 2XNAC 3BS1A 4LF4Q 4A3DH 4B3TQ 2L4NA 2IX3A 4QGUA 4C56C 2NVQH 3SK8A 4R4OA 2M9VA 2AKWB 2F0UA 1TY0A 3QG1A 1GVPA 1BUVT 3S2DH 3S1QB 1WTWA 4CKEA 3S2HB 3CQZB 4JV5Q 5IP9H 1SN8A 4C2MB 1Y1VB 2EYFA 4BA2I 3C3LA 2B2WC 3A55A 3PO2G 1LT4D 5LMNQ 4FXDA 2RCNA 2BH8A 3S15H 4NB3A 5T1GA 2OTJA 3D6CA 1XXGA 4XTCS 4EQPA 3MA2B 1CSQA 5C4XH 4ZAIA 3HKZG 3MXPA 3BJUA 4EVOA 1I50B 4A3CH 2WACA 4AH6A 4JI5L 3I3CA 1J5EQ 4LUVA 1EQTA 1OXVA 4FXGC 3DEPA 2TMPA 4G57A 4KY5A 4ZLTF 3OTOQ 3S1NH 2CCZA 5JJZA 3MEHA 2K14A 3A56A 4C1NK 2K7VA 1BOSA 2EY6A 5C5LA 3AB9A 4CDFC 1H9SB 2A69C 4X65Q 1VQ7A 4WJ4A 2KEEA 1VQMA 1SEBD 2XGTA 4OONA 4OO1G 5IYCG 3RLOA 2KVMA 3OMCA 4QCLA 5DM73 4GNXB 1T9HA 4XXEA 2SNMA 3U9OA 2WKDA 1GD7A 1PDQA 1UWVA 4QF4A 2KUMA 2KCMA 2F0KA 4APVA 1D5MC 4KMUC 5IT9L 3G71A 1EFWA 1AFPA 1DOKA 3I72A 4RAUC 2R61A 1Y1WH 2A19A 2VUMH 3TS0A 1W2BA 2B8GA 2F0OA 4P73A 5C4XB 3K5OA 3KLSX 1BXTA 3GO5A 4DV3L 2R93H 5CYUA 3QOJA 5C4JB 4LJZC 4FF1A 4DGZA 2WP8J 1GUWA 1HZCA 4LUZA 4RGOS 2B29A 5A2QE 2PQAA 2UUBL 1U4PA 1KNEA 4RCNA 4JYAQ 5C3XA 3I4OA 2KBNA 2WB1E 4P71A 2IX0A 1SR3A 3CCJA 1DD2A 3HKZE 5ELOA 2CWAA 2SDFA 3L3OC 1D1KA 2UUAQ 1ENCA 5C44G 3S15B 1YIJA 5FO8B 1QB5D 1SYFA 3K7AH 1Y1VH 2VS1A 1EYDA 3UE0A 1SE3A 2RCFA 2SNSA 3K59A 3I4MB 4IQZA 1MJCA 2F0LA 2AQ2B 2I5LX 1KL9A 1STYA 3IFDA 1MSGA 1CI3M 3J80i 4JI6L 2WKCA 5HGQA 1H95A 1HR0W 1AEXA 1P16A 3GTOH 3RLNA 1CM9A 4BBSG 4B3ML 1SJHD 2K01A 1CKNA 4DAVA 4N9TA 1G91A 4A93B 5IP9G 3BU2A 1TWGB 1HR0Q 1QCBD 1G51A 3T1HL 1AE2A 2EZVA 4YCVA 1TWCB 5JJIA 1S5CD 2Y0SG 3HOXB 1EZ6A 1QVCA 4JI4Q 1ML0D 1SYBA 1EYAA 5C0XG 2PW5A 1SE8A 5LMUQ 2K4KA 3NELA 1MD2D 2K28A 5M5YB 1SNPA 1EY5A 2D5DA 2KCTA 1EEFD 2KJXA 3CMAA 2WB1B 2BOSA 4AYBB 4B3TL 2KECA 4HCSA 4F7XA 2PZWA 3S1MB 4PZ6A 3NPPA 4JI3Q 2EE1A 4EGVA 4H44C 4WJWA 1KRTA 4JI2L 3TQYA 2NVXB 1K8MA 3FKIH 4YWLA 5GAGC 1JE4A 2KHSA 3E9HA 2ASBA 4DUZL 3SXHA 5C3EG 1IL2A 1PFSA 4X64L 1OXTA 4GOPB 3VYSA 4A3FH 2JA6B 4DR7L 2BE5C 4F87A 4JG2A 4NP5A 3S1RH 3TP8A 4N8X1 4OEMB 3OSOA 3VDYA 5D3DA 1Q81C 1JMCA 4IFDH 1JT8A 1PTOB 4OHJA 4R4TA 5M5XB 1TU2B 2R7DA 4IJHA 4BA1I 5JEAG 3N6RA 5IP7G 3K7AB 1MI2A 1W3SA 1ESRA 3RZOB 1RHPA 4FF4A 2UU9Q 1FJGL 3EA6A 3RR5A 1DOMA 1NMGA 3PMFA 2VZAA 4XDXA 4K8JA 3P1HA 4IUVA 2JA5B 1Z6HA 4DV6Q 2V4DA 5BN3A 1B1ZA 1SMYC 4IUUA 3KF6B 2JE6I 4K5VA 4ZKBB 1MBYA 3CCMA 5DLQE 4XT3B 2Z1CA 3UDGA 4PV1C 3GTPH 4DFAA 2ZT9C 1QUQB 1Z47A 4DK6C 3U4ZA 4R9WA 1KIXA 2BCOA 4KK7A 3W1BA 3BDOA 3HKSA 1HA5A 4DR3L 2JQOA 3I73A 1JOOA 5FO9B 4HMIA 1X3FA 4C2MH 4HMJA 1B7YB 3WOFA 1CKMA 1U4RA 1LTRD 2O2LD 1UE6A 2F0VA 3K6OA 4OGQC 1PZKD 2DNEA 3LWEA 3RD4A 4CJ2C 5EAYA 3E0JA 1KHIA 4ILWA 3CCSA 4IUTA 4XT1B 4RGNA 4IURA 4DR5Q 2E76C 3P7JA 2B2WA 4BXXH 2KHJA 3HOWG 1S5FD 2UXDL 1RKNA 2B2YA 2CHBD 1RDPD 1LTLA 1I4GA 4DV0Q 1AN8A 4X66L 1JJ2A 4YCUA 3VR3A 5CR3A 5IGGA 3R3OA 4C1NI 1JICA 3HS0C 4R1JA 3HOVB 5HGTA 4KD3A 3SR1A 3FKIG 3GV6A 3KYHC 1GJXA 4DUYL 4YWKA 2Z4HA 2CW0D 2E2HH 1G8ZD 3JAMc 2B39A 3L0OA 5M5WB 5FO7B 4LF9L 1NUCA 1QILA 5AJ3L 2JN4A 1S72A 2B3GA 3CCVA 2WV6D 2F0GA 4OXPA 2F0HA 1STGA 3J7A5 1SROA 2PW7A 3I91A 4ME3A 5FLXL 1JOQA 2EYPA 2CQAA 2E2JB 1CKNB 1F2LA 2X69A 3R2IA 4JOIA 1XWEA 1HNZL 1Q86C 4IPHA 3IL8A 3T4AC 2YU9H 1HJPA 3W1GA 4DN4M 4XYOA 3M7GA 2NZHA 1C7YA 1QWYA 1EY0A 4I7AA 1EUJA 1M90C
chains in the Genus database with same CATH topology
1DM0B 1A2TA 4R8NA 1Q90A 1DYQA 1NAPA 2R92B 2QEJC 3D31A 5CGKA 2BA0A 3IFTA 1H9KA 3FVQA 4RGTA 1SDFA 2Q8RE 2MP1A 1SSOA 4DAPA 2EY2A 1RF2D 1O7ZA 1EWCA 4JBWA 1ZYRC 3D6WA 1EQVA 1CZWA 4XQNA 2WAQB 4LK1C 4NMZA 5C0XH 1WVLA 2B63B 5KEEA 2MJ8A 3SE0A 2JP1A 1JC7A 3G7LA 1CT1D 1DOLA 3S9WA 1DZ1A 1GUGA 5TSSA 2IPKD 4DA2A 1B50A 1L0YB 5CV8A 1EZ8A 4ZUIA 4DU9A 1QJOA 1IKMA 3BZDB 3TBIB 4BBSB 1FNWA 3A8JE 5I2YA 1KLUD 5C5MA 2QF7A 5I4DA 3NE5B 3VR2A 5IOCA 3R2TA 2JEAI 1U9RA 2D62A 1LTTD 1OO9B 4KTAA 4KV6A 3MHBA 1BDOA 1VCIA 4WRDA 5ELCA 5ELBA 3UI2A 3R93A 3Q23A 3MTSA 3PV0A 1B2TA 3C1EA 5C0XJ 4X3TA 2IW3A 2J4XA 3H3VC 4CHTB 5C6AA 1V8QA 2YU9B 3OMGA 2ICIA 3N52A 5T1IA 2O4XA 1X32A 1IW7D 2AUJD 1RCVD 3Q24A 5E4WC 5E1FA 1CA6A 3WOEA 5K5PA 5K36G 1WTPA 1PYWD 5JVH3 1KNAA 1A2UA 2N55A 4Q5VA 3KLSA 4KI0A 3E5SA 1LACA 2VNUD 5ELDA 2VB2X 4B9XA 2E74C 1SYCA 3OWEB 3VYTA 3TP5A 3BDLA 3M4YA 1WTXA 1SE2A 5JVG3 2EYLA 4CKCA 1K83B 2G9HD 1L0XB 4A3JB 4Z9CB 3GTQB 1SJED 1CQFA 1EL0A 4OIKA 1PRTF 1STBA 3M4OB 2KQ3A 1FNUA 1Y1WB 2ZXOA 1PFMA 5IT9E 5KRUA 3M7NA 2EPBA 1EY8A 3TN2A 1BCPF 1ZKOA 2MPMA 2FFKB 2L55A 4DNRB 1AP0A 4G7HC 1CA5A 3A8IE 5EQ0A 1EWHA 5IGBA 3GTPB 5KNBA 3C46A 3OIPA 2O5JC 2H1EA 1R9TB 4RCOA 2F0SA 2F1MA 4QUCA 1YNJC 2B2UA 4IALA 2B8FA 2VUMB 4BY7B 2NBFA 4CGYB 2E2DC 4DNTB 1KABA 1BCPC 1SMYD 1D5XC 1S5DD 2KCNA 1HPCA 5CBAE 3MFYA 2B2YC 1LTBD 1TR5A 2BDNA 2I07B 3SK6A 2LFNA 4RHSA 4A3KB 3QJYA 4CJ0B 1CFMA 3Q22A 1GUNA 1RTOA 1LV9A 3NP8A 1HRJA 1U4MA 1HXYD 5EPJA 1YNNC 3D4RA 1BCPD 4YIJA 2J0TD 3NBHA 4X3UA 1AW7A 1I3QB 4XYQA 1WCMB 5IGCA 3P75A 4DAYA 5IGEA 3SVMA 1CK1A 2A5HA 1HQRD 1CHQD 2XIWA 2PQEA 5FOBB 3KK7A 3S14B 5EPKA 2NYZD 1EY7A 1O7LA 3H91A 1ZXTA 2GA4B 1GOZA 1R4PB 2A73B 4RHRA 3AMUA 3DHQA 3KLRA 2NN6G 2WINB 2RVLA 1V43A 3H09A 1SFOB 3HRZC 2DY7A 1ILPA 4QMGA 2IX1A 2FHTA 3TDQA 2NZ1D 1CHPD 4ZRZA 1I4RA 3L9AX 5D3IB 1TKWB 4BWGB 3AU7A 5C0XI 1QG7A 1EIHA 1WTRA 3K0YA 1HUNA 4WORA 1PRTC 4K5XA 3OHXC 1KDBA 3DM1A 1PXUA 2XWJB 3GTGB 1I6HB 3MWYW 1HFNA 1QNKA 2B2VA 1LLRD 1OXSC 1TS4A 2OT2A 1U4LA 1FD7D 3FRPB 3A54A 5HURA 1CQVA 5AFWA 1G2TA 2HCCA 1Q3LA 2JA7B 1DXMA 3X3MA 1BO0A 1X3PA 3W3AA 1IYUA 1LABA 1D1IA 1PFBA 1XX8A 1E2WA 2HUGA 4F8MA 4O42A 5CV7A 4HTHA 3K5NA 5I9OA 2EDGA 3V05A 1ONLA 5IGFA 3SK5A 1T5XD 1IHZA 2HDLA 4OO1I 1O78A 5C44B 5COYA 3R8BA 3MZ5A 5LL6S 3SDZA 4N9PA 1TT2A 3W2DA 1EY4A 1ET9A 2ID0A 4K6DA 1GUOA 5K36H 3A8KE 3DEOA 3BDCA 2F4IA 4QUFA 3LX0A 4FVMA 1J9OA 4IFDG 3EROA 1STEA 4CJ1B 2LY7A 4A3DB 4M8AA 3H94A 4KHZA 5KNCA 2D9UA 1II3A 1DONA 2Y0SB 4RA8A 2B2TA 5JPMC 2EYHA 2YYZA 5JOBA 3J80L 4F88A 5DEHA 1TVXA 2HDMA 1SYGA 5LHY1 1EU4A 3O13A 1EIGA 4NKLA 1OXUA 1S5ED 4ULLA 3M3YB 2F0JA 1SNOA 4V0BA 5I9PA 1FGBD 3D8GA 1WTOA 1O80A 1A3TA 4FYDA 1EY9A 1GHKA 5F2DA 1SNMA 2KA7A 1K8OA 5EKIA 5EBDA 5M3MB 2FJ2A 3MXGA 1GUSA 4TSSA 1E0BA 4BS9A 4CKBA 5FLXE 1AZPA 1WD0A 4L6TB 1FYCA 2KOLA 2CVRA 2A74C 2F0NA 3BYTB 1PTOD 2R3ZA 4DXGA 5CV5A 5C4HA 2NVTB 4RH6A 2R93B 2L1BA 3FMCA 3BG3A 3HZXA 1FNVA 2N88A 1I6VC 2HCIA 2ENBA 2EOTA 1ENAA 4ZK9B 2EYMA 3NWSA 3F2UA 4IUQA 1X3QA 1TWFB 4NDXA 2Z8LA 3S1NB 4G7OC 3PO2B 2EYOA 3A7LA 2FMMA 2K05A 4ZYSA 1BR9A 4LAAA 3VR5A 3TP7A 3TSSA 1SNCA 4HN7A 4FF3A 1PFNA 2Q8IB 2QILA 4H7BA 3J7AF 3RLFA 1SYEA 5A2QL 4A3EB 4K6LA 4FF2A 1EYCA 1W6KA 2QKIC 2K6AA 2RQXA 1F9SA 5CV9A 2F03A 1EFID 4TKOB 1F2MA 4HCEA 3PO3B 2K03A 1RODA 2AWNA 1CTMA 4R8IA 5BN5A 5KYLA 3K58A 3GTKB 1UUPA 4C3HB 1J8IA 4XIGS 2BDOA 2A6EC 3D3RA 3EQLC 3TZUA 4C3JG 4K2KA 1Y8OB 2F0DA 3DMUA 4I7ZC 3GV3A 3NK9A 3CRKC 1BCPB 4JK1C 4OIJA 2A68C 4A3IB 3K5MA 1ENFA 1M8AA 3ERQA 2NVYB 2XWBB 4OO1H 1ZYRD 1A6XA 1F9QA 4ZQ3A 1R4QB 1Y69U 2AWOA 1JOKA 2G9DA 3PUZA 1GHJA 3C1FA 4RKBA 1Y8PB 3NHHA 4IZ8A 3P20A 1UAPA 4G7ZC 2R6GA 1EOTA 4B9WA 3OPOA 3PIP3 2NN6I 3EFXD 4DK0A 1Q1EA 3M85A 1TY2A 2L9HA 1TS5A 1V1OA 1V1PB 4KKTA 4RGMA 5A35A 4S3SA 1VF5C 4KHVA 2IJ0A 1IW7C 5JEAH 2K33A 2K32A 5M9OA 4CBVA 1F2ZA 3DXJC 5CV6A 2EJFC 3WDNA 3J7YW 5JPNC 5ELFA 3EJIA 1Q12A 3SEBA 3NTKA 3H6MA 5CBEE 5NUCA 4OL7A 5CORA 5DM63 1B9NA 4MIUA 3DWQA 1DCZA 3S1RB 1FR3A 2M00A 1STNA 1UEAB 1PRTD 2CW0C 1PTOH 3BVGA 1DJRD 4HAEA 2EJGC 4H13C 2JA8B 5DNFA 4PMCA 2KEDA 3CKIB 1PZJD 3OIQA 2E2IB 5KNDA 2TSSA 3PUVA 2R7ZB 4ABNA 1LO5D 3HEJA 3TMEA 2K04A 4RFBA 1GUTA 3NQTA 4HR7B 4HSPA 3BYYB 4IN3A 1WD1A 4P2CB 3OWFA 1XTCD 3OW7A 4QIWB 2L12A 5KIXA 1KLGD 1B44D 1D5ZC 4TRDA 4A3BB 5M3FB 5J39A 3S17B 1OXXK 4XQQA 2RBMA 1JWUD 1TS3A 1JQYD 3LNNA 2AQ3B 2XSCA 1RD9D 1B3AA 3GTOB 4PNYA 1GXDC 5EKLA 2MUYA 3C2PA 1H9SA 2BE5D 3S16B 3T13A 2IL8A 4G4KA 5EKKA 1EEID 3V96A 4H0LC 4C3IG 5FK9C 2MGSA 2PO4A 1TIID 2E75C 1HQMC 3E6ZX 3ZYYX 1Y8NB 1XYIA 1H9RA 3HG9A 1O7YA 2DN8A 1I4PA 3PUWA 4QB4A 1ET6A 1H9MA 1ZEQX 2XRQD 2M2LA 1HTPA 1PRTB 3J81L 1PLFA 1D2BA 2LKVA 2IWHA 4HSVA 3JAML 4KY6A 4C3IB 4XQJA 4DXFA 1KTKA 1ESFA 4KN7C 2JXMB 1LTGD 2PNRC 5IIFA 3BVMA 1HHVA 2F0QA 3K57A 4L63B 4KKUA 3JAME 3KF8A 4B08A 3CHBD 3QB3A 3GTLB 3J80E 4K2LA 3I70A 4BBRB 3IKJA 3GTMB 1IKLA 2KCCA 3I8ZA 5BN4A 1VMPA 1HCZA 1NR2A 1SAPA 2DNCA 4FXKC 1LTSD 5EPLA 3VYRA 4FP5D 2B2UC 1SNQA 3ONAB 2K5DA 3VR6A 4Q0FA 1F9PA 3TP6A 1LT5D 5JEAJ 4TQUS 4V190 2EJMA 2PCFB 2X6LA 5EBCA 5J22A 1VF7A 4C3HG 3G6JB 2PMZB 3DUZA 3Q0AA 4M1UB 3MVVA 4Y7NB 3MFGA 2O5IC 3HKZB 5ELEA 4O1NA 3MXUA 2JSOA 4X3SA 1JR0D 3PUXA 5I6WA 5KYIA 4A3MB 3A7AB 4KD4A 1RTNA 3QIAA 1LTID 3GD7A 1E2VA 4MN3A 1HTLD 1JWMD 2NVQB 2BA1A 3SHLA 2NN6H 1EU3A 4PMBA 2C9OA 4KJNA 1W6JA 2XVSA 4K5WA 4EQOA 4IFDJ 3NWTA 5G3LD 4GZYC 4IUNA 2WIIB 4ZKCB 3NTHA 1SE4A 2D2CC 4J8QA 4KJOA 3GQBA 2EVBA 1VMCA 1I4XA 5IODA 4J1MA 5EGTA 3T56B 2VXWA 5CV4A 1TWHB 2RA4A 3HOYB 1JORA 3D4DA 5ISRA 4BY1B 2ICEC 2PZTA 3NBIA 3BVZA 2RSNA 3CU7A 2F0TA 3VA5A 1SXTA 2AUKA 2JYOA 4J6HA 3U9SA 1G6ZA 3Q6SA 3K5LA 4PMWA 1Z7TA 1CZGA 3FPPA 1PTOC 1KDAA 1A3UA 4U673 1C4QA 1LT6D 1S4ZA 2F0EA 2RSOA 4LMQD 1IL8A 2NTSA 2A6HC 3H0GB 3QO2A 2EXZA 1RJTA 1ICWA 4KY7A 1QNUA 1JCKB 2LS01 2J7ZA 4UDUC 2B2VC 1G291 5E3FA 3T16A 2QCPX 5G3LF 3V2TA 1BQQT 1C8CA 5CMDA 4EQNA 5C4ZA 1LT3D 1V1PA 2F0FA 1HUMA 1SYDA 4FO2A 1NR4A 2F3WA 2NTTA 2EYJA 1S5BD 2OXPA 2VB3X 3PIO3 3FKIB 1HFGA 4L8JA 3ND8A 3T53B 1D6EC 3OOCA 3ITPA 5D14A 2F3VA 2F0WA 1IYVA 4U68A 5IGDA 2Z4IA 2AQ1B 2NWGA 5C3EB 5DAUA 3J7AV 1AZQA 1BNZA 1QOHA 2L11A 4I65A 4ME5A 4C3JB 4ZUJA 3FDTA 3DWPA 3I4LA 2EY5A 2XRSD 5D65A 2RDFA 5C3WA 2X6GA 4A3GB 3CRLC 2FINB 4WFN3 3KUPA 1F9RA 3RUZA 1Q1BA 2F0PA 2B2TC 3HGBA 2FMCA 3ND9A 2SEBD 1TWAB 2OEOA 3HOWB 3MC0B 2SOBA 1Q8IA 2XN9C 2C5CA 4HEDA 4X3KA 3HOZB 2PYKA 1PTOF 2E2HB 2A6HD 3NTIA 1KDCA 3FEWX 1MGSA 1C48A 5I2XA 2HQEA 1YNND 3NXWA 2K1BA 4KN4C 5I6YA 1H9JA 2OF1A 2QDBA 1T5EA 3QOLA 2IT1A 3MAQA 3NSWA 3EVQA 1MSHA 1F77A 3MXNA 1QE6A 1I4HA 1A3VA 4DK1A 4UAIA 1BBXC 3KBXA 2RDHA 2K5WA 4ID6A 3TZDA 5EJWA 3I4NB 1B53A 2L5TA 1BF4A 1PZID 1M4VA 3L7ZC 2EY1A 1WTQA 4MHEA 5KGUA 1E2ZA 3VA7A 5FKAC 1F2YA 3SK4A 4RWSC 4KKSA 2PZUA 4RKLA 2A69D 3RMHA 1YNJD 1A15A 2RKSA 3FPUB 3URYA 5J1ZA 2K5QA 2MHVA 2Q8TA 1JB3A 4IFDI 4DF7A 4IUPA 2LMCB 1KAAA 1HA6A 2ZXRA 4FNFA 3NUCA 1B9MA 2NUCA 2JEBI 1B4OA 1VDZA 1SNDA 3VR4A 4ODGA 1TS2A 3NQIA 3DWAA 3LWUA 1LTAD 3HOUB 4NW2A 2PPBC 2A68D 1STAA 4A3FB 3GP7A 3D4WA 3RZDB 3I90A 3J81E 2F0MA 1TQOA 3IAYA 2DY8A 1WTVA 5JAVA 1NSNS 1STHA 4PQXA 5LL6X 2NB0A 5CC4A 4K14A 3VYUA 2RDGA 2ZXPA 3X3NA 1G2SA 2H4OA 1ILQA 3T51B 1JWSD 2I46A 3S2DB 1EY6A 5E4XA 2F0IA 1SBBB 4E6IA 4K8IA 3HP3A 3PUYA 2L0CA 3KBGA 3GTJB 3QWNA 1I4QA 2A6ED 1PMRA 1UNSA 1NCVA 3BS1A 2XNAC 2L4NA 2IX3A 4C56C 3SK8A 2M9VA 2F0UA 1TY0A 3QG1A 1BUVT 3S1QB 1WTWA 4CKEA 3S2HB 3CQZB 4C2MB 1Y1VB 2EYFA 4BA2I 3C3LA 2B2WC 3A55A 1LT4D 4FXDA 5T1GA 3D6CA 1XXGA 4XTCS 4EQPA 3MA2B 4ZAIA 3MXPA 4EVOA 1I50B 2WACA 3I3CA 1EQTA 1OXVA 4FXGC 3DEPA 2TMPA 4G57A 4KY5A 4ZLTF 5JJZA 3MEHA 3A56A 4C1NK 2K7VA 1BOSA 2EY6A 5C5LA 3AB9A 1H9SB 2A69C 2KEEA 1SEBD 4OO1G 2KVMA 3OMCA 4QCLA 5DM73 4XXEA 2SNMA 3U9OA 2WKDA 1PDQA 4QF4A 2KUMA 2F0KA 1D5MC 4KMUC 5IT9L 1AFPA 1DOKA 3I72A 4RAUC 2R61A 2B8GA 2F0OA 5C4XB 3K5OA 3KLSX 1BXTA 3GO5A 5CYUA 3QOJA 5C4JB 4LJZC 4FF1A 4DGZA 2WP8J 1GUWA 4RGOS 5A2QE 1U4PA 1KNEA 4RCNA 5C3XA 2IX0A 1DD2A 3L3OC 2SDFA 1D1KA 1ENCA 3S15B 5FO8B 1QB5D 1SYFA 1EYDA 1SE3A 2SNSA 3K59A 3I4MB 4IQZA 2F0LA 2AQ2B 1STYA 3IFDA 1MSGA 1CI3M 2WKCA 1AEXA 1CM9A 1SJHD 2K01A 4DAVA 4N9TA 1G91A 4A93B 1TWGB 1QCBD 2EZVA 1TWCB 1S5CD 3HOXB 1EZ6A 1ML0D 1SYBA 1EYAA 5C0XG 2PW5A 1MD2D 2K28A 5M5YB 1SNPA 1EY5A 2D5DA 1EEFD 2KJXA 2WB1B 2BOSA 4AYBB 2KECA 4HCSA 4F7XA 2PZWA 3S1MB 3NPPA 2EE1A 4EGVA 4H44C 4WJWA 2NVXB 1K8MA 1JE4A 2KHSA 3SXHA 1OXTA 3VYSA 2JA6B 2BE5C 4F87A 4NP5A 3TP8A 3OSOA 5D3DA 4IFDH 1PTOB 4OHJA 5M5XB 1TU2B 4BA1I 5JEAG 3N6RA 3K7AB 1MI2A 1ESRA 3RZOB 1RHPA 4FF4A 3EA6A 1DOMA 3PMFA 4XDXA 4K8JA 3P1HA 4IUVA 2JA5B 1Z6HA 2V4DA 5BN3A 1B1ZA 1SMYC 4IUUA 2JE6I 4K5VA 4ZKBB 1MBYA 4XT3B 2Z1CA 4PV1C 4DFAA 2ZT9C 1Z47A 4R9WA 2BCOA 4KK7A 3BDOA 1HA5A 3I73A 1JOOA 5FO9B 4HMIA 4HMJA 3WOFA 1U4RA 1LTRD 2O2LD 2F0VA 3K6OA 4OGQC 1PZKD 2DNEA 3LWEA 4CJ2C 3RD4A 3E0JA 4ILWA 4IUTA 4XT1B 4RGNA 4IURA 2E76C 3P7JA 2B2WA 1S5FD 1RKNA 2B2YA 2CHBD 1RDPD 1I4GA 1AN8A 3VR3A 5CR3A 5IGGA 3R3OA 4C1NI 1JICA 3HS0C 3HOVB 5HGTA 4KD3A 3SR1A 3GV6A 1GJXA 2Z4HA 2CW0D 1G8ZD 2B39A 5M5WB 5FO7B 1NUCA 1QILA 2WV6D 2F0GA 2F0HA 1STGA 2PW7A 3I91A 5FLXL 1JOQA 2EYPA 2CQAA 2E2JB 1F2LA 2X69A 3R2IA 1XWEA 3IL8A 3T4AC 4DN4M 4XYOA 3M7GA 1QWYA 1EY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0N A;  1STY A;  3DHQ A;  3NUC A;  2O4X A;  1A2T A;  3D6C A;  5IGF A;  3NK9 A;  4R8N A;  5CV5 A;  3SK5 A;  1KDC A;  5C4H A;  2NUC A;  4DFA A;  1AEX A;  4EQP A;  5I6W A;  2EXZ A;  5KYI A;  4PMC A;  1IHZ A;  4KD4 A;  1SND A;  4KY7 A;  3MXP A;  4QMG A;  2F0S A;  4ODG A;  5CGK A;  4N9T A;  2HQE A;  3ERQ A;  5E1F A;  3NXW A;  4EVO A;  5K5P A;  2WAC A;  4QB4 A;  3HZX A;  5E3F A;  4IAL A;  3MZ5 A;  5I6Y A;  3T16 A;  1A2U A;  2EY2 A;  4ZQ3 A;  4G57 A;  2ENB A;  4N9P A;  2OF1 A;  1EZ6 A;  2QDB A;  1TT2 A;  3SXH A;  2LKV A;  1EY4 A;  3HEJ A;  3QOL A;  4KY5 A;  3TME A;  1STA A;  3E5S A;  3V2T A;  1JOO A;  1SYB A;  4HMI A;  1ENA A;  1EYA A;  1JOK A;  2EYM A;  3MEH A;  4K6D A;  4KY6 A;  2PW5 A;  2EY6 A;  4HMJ A;  5C5L A;  1KAB A;  4EQN A;  3NQT A;  5C4Z A;  1EQV A;  2F0F A;  3BDC A;  3D4W A;  3LX0 A;  4WOR A;  3C1F A;  1SYD A;  1SNP A;  1SYC A;  4K5X A;  4NDX A;  4PMB A;  4RKB A;  1EY5 A;  2F0V A;  2EYJ A;  2F3W A;  3NHH A;  4IZ8 A;  4KJN A;  5IIF A;  2OXP A;  3ERO A;  3EVQ A;  2F0Q A;  2F0M A;  4K5W A;  4NMZ A;  1TQO A;  3TP5 A;  1KDB A;  3OMC A;  3OWF A;  3BDL A;  5KEE A;  2EYO A;  5JAV A;  1TR5 A;  1A3V A;  4EQO A;  4F7X A;  2PZW A;  4B9W A;  1NSN S;  3QB3 A;  1STH A;  1II3 A;  3SK6 A;  3U9O A;  2SNM A;  2EYL A;  4K2L A;  4LAA A;  3S9W A;  5CC4 A;  3TP7 A;  1SNC A;  4ID6 A;  5KIX A;  4QF4 A;  4IUN A;  4K14 A;  5CV8 A;  1EZ8 A;  4ZUI A;  2F0K A;  1RKN A;  4DU9 A;  4H7B A;  2KHS A;  2EYH A;  3ITP A;  5IGG A;  2EY1 A;  2F3V A;  4KJO A;  3NP8 A;  3R3O A;  1SYE A;  4S3S A;  2F0W A;  4TRD A;  1EY6 A;  2F0O A;  5JOB A;  2F0I A;  5IGD A;  5KGU A;  5IOD A;  1STB A;  5DAU A;  4KHV A;  5J39 A;  4E6I A;  4J1M A;  5EGT A;  4K8I A;  5C5M A;  2KQ3 A;  4YIJ A;  3SHL A;  1EYC A;  5CV4 A;  4B9X A;  1F2Y A;  5HGT A;  1JOR A;  2RBM A;  4KD3 A;  5DEH A;  4I65 A;  1SYG A;  3D4D A;  3SK4 A;  3SR1 A;  5IOC A;  4ME5 A;  3QOJ A;  1U9R A;  4NP5 A;  5CV9 A;  3TP8 A;  4ZUJ A;  4DGZ A;  5HUR A;  5M9O A;  5ISR A;  4KTA A;  4KV6 A;  1F2Z A;  3OSO A;  1SNQ A;  1F2M A;  2PZU A;  3MHB A;  4NKL A;  5IGC A;  2F0J A;  2PZT A;  5KRU A;  1SNO A;  2EY5 A;  3P75 A;  4RKL A;  4WRD A;  2F0T A;  5I9P A;  5CV6 A;  4PNY A;  1NUC A;  3D8G A;  3VA5 A;  1EY8 A;  3SK8 A;  5IGE A;  5C3X A;  2RDF A;  2RKS A;  4J6H A;  5CR3 A;  1A3T A;  3TP6 A;  2F0G A;  5KYL A;  5EKL A;  2F0H A;  1STG A;  3EJI A;  1EY9 A;  5C3W A;  2PQE A;  3C1E A;  1SNM A;  2F0U A;  5F2D A;  2PW7 A;  3H6M A;  5NUC A;  3T13 A;  1JOQ A;  5J1Z A;  3RUZ A;  2EYP A;  4OL7 A;  5J22 A;  2F0P A;  1KDA A;  1ENC A;  4MIU A;  5C6A A;  2OEO A;  4K2K A;  5EKK A;  4DF7 A;  3PMF A;  2SOB A;  1EY7 A;  1SYF A;  3P1H A;  4K8J A;  4F8M A;  2EYF A;  5CV7 A;  3MVV A;  4HTH A;  2F0D A;  2M00 A;  1A3U A;  1STN A;  1KAA A;  1EYD A;  4K5V A;  2SNS A;  5I9O A;  1EY0 A;  3DMU A;  3OMG A;  2F0E A;  5IGB A;  2PYK A;  2F0L A; 
#chains in the Genus database with same CATH topology
 1DM0 B;  1A2T A;  5J3B A;  4R8N A;  1YHQ A;  1C0A A;  1Q90 A;  1DYQ A;  1NAP A;  3PO3 G;  2R92 B;  1NTG A;  4A3G H;  3PIP A;  2EIF A;  2QEJ C;  1PA6 A;  3D31 A;  3J81 j;  5CGK A;  2BA0 A;  4LFA L;  3IFT A;  5GAH C;  1H9K A;  3FVQ A;  4RGT A;  1SDF A;  1WTH A;  2MO1 A;  2Q8R E;  4QJF A;  2MP1 A;  4C3H H;  3KDF B;  1FJG Q;  1SSO A;  4DAP A;  2EY2 A;  1J5E L;  1E22 A;  1WOC A;  4DV4 Q;  4JI5 Q;  1RF2 D;  1O7Z A;  1EWC A;  3S17 H;  4JBW A;  1ZYR C;  3D6W A;  2D0P A;  1PH1 A;  1EQV A;  1CZW A;  1OTC A;  2QA4 A;  4XQN A;  2WAQ B;  2Q2T A;  4JI0 L;  2JA5 G;  4A3L H;  4LK1 C;  3NBH B;  4NMZ A;  1MJE A;  3STB D;  5FJ8 G;  5C0X H;  1WVL A;  2B63 B;  5KEE A;  4BY1 H;  4JI3 L;  2MJ8 A;  3SE0 A;  2JP1 A;  1JC7 A;  3G7L A;  1CT1 D;  1DOL A;  3S9W A;  1DZ1 A;  1GUG A;  5TSS A;  2IPK D;  4DA2 A;  1B50 A;  1IBL Q;  1L0Y B;  5CV8 A;  1EZ8 A;  4ZUI A;  3K8A A;  2N49 A;  3I4N H;  2ZM6 L;  4DU9 A;  1QJO A;  1IKM A;  3BZD B;  3TBI B;  1K8G A;  3ULL A;  4TVA B;  4BBS B;  4AQY Q;  4B3R L;  1FNW A;  3A8J E;  5I2Y A;  1KLU D;  5C5M A;  2QF7 A;  5I4D A;  3NE5 B;  3VR2 A;  5IOC A;  3R2T A;  2JEA I;  1U9R A;  2D62 A;  1LTT D;  1OO9 B;  4KTA A;  4KV6 A;  3MHB A;  1BDO A;  1VCI A;  4WRD A;  5ELC A;  5ELB A;  3UI2 A;  3R93 A;  3Q23 A;  3MTS A;  4H02 A;  1YZ6 A;  3PV0 A;  1B2T A;  5IYC H;  3C1E A;  1PHJ A;  1IBK L;  2HIX A;  5C0X J;  4X3T A;  1XMO L;  2IW3 A;  2UXB Q;  2J4X A;  4AYB G;  3H3V C;  4GOP A;  3NEN A;  4CHT B;  5C6A A;  2Z6B A;  1V8Q A;  1D7Q A;  3ULJ A;  1K83 H;  2YU9 B;  3OMG A;  2JK8 A;  2ICI A;  1GM5 A;  3N52 A;  5T1I A;  2O4X A;  1X32 A;  1IW7 D;  4A3C G;  2AUJ D;  1RCV D;  2PMZ E;  3U4V A;  3JAM i;  3Q24 A;  5E4W C;  1PH4 A;  1YHB A;  5E1F A;  1CA6 A;  4DR2 L;  3WOE A;  2HQL A;  5K5P A;  4LF6 L;  5K36 G;  4DV6 L;  1WTP A;  1PYW D;  5JVH 3;  1KNA A;  1A2U A;  2N55 A;  4Q5V A;  1IXR A;  3HOV G;  5LMN W;  3KLS A;  2F4V L;  4A93 H;  4JBJ A;  4KI0 A;  3E5S A;  4JBK A;  1BBU A;  1LAC A;  1FL0 A;  4JBM A;  2VNU D;  4NPS A;  5ELD A;  2VB2 X;  4B9X A;  2E74 C;  1SYC A;  3OWE B;  3VYT A;  5M3M H;  3RZD H;  3TP5 A;  3BDL A;  3M4Y A;  1LM0 A;  1WTX A;  1C9O A;  1SE2 A;  5JVG 3;  2EYL A;  4CKC A;  1G6P A;  1K83 B;  3KDF A;  2G9H D;  1L0X B;  2MFI A;  4GS3 A;  4A3J B;  4Z9C B;  4A3I G;  3GTQ B;  4OWT B;  1SJE D;  1CQF A;  1EL0 A;  1NBW A;  4OIK A;  1PRT F;  3HOX H;  4A3I H;  1STB A;  4DV1 Q;  3M4O B;  2KQ3 A;  1N36 Q;  1FNU A;  2ZJR A;  2VW9 A;  1Y1W B;  2ZXO A;  1PFM A;  5IT9 E;  1HZ9 A;  2VL6 A;  5KRU A;  3M7N A;  2EPB A;  1EY8 A;  2WAQ G;  3TN2 A;  3GTG H;  4AYB E;  3CCR A;  1N34 L;  3ICE A;  1BCP F;  1ZKO A;  2MPM A;  2FFK B;  2L55 A;  4BBS H;  4JV5 L;  4DNR B;  1IBK Q;  1AP0 A;  4G7H C;  2WFW A;  1K73 C;  2ZTD A;  3F2B A;  5C4J H;  4DV5 Q;  1CA5 A;  5HY6 A;  2F3I A;  1VQE A;  3A8I E;  4CDE C;  5EQ0 A;  1EWH A;  1KRS A;  3AQQ A;  5IGB A;  3GTP B;  5KNB A;  3C46 A;  3OIP A;  2O5J C;  2RHQ B;  2H1E A;  1XMQ L;  3K7U C;  1R9T B;  4RCO A;  2F0S A;  4DNI A;  1K8A C;  3HOZ G;  2F1M A;  4QUC A;  1YNJ C;  2B2U A;  3FHW A;  2KEN A;  4IAL A;  2IHE A;  1TWF H;  2B8F A;  4A3K H;  2VUM B;  4BY7 B;  2Q2H A;  2NBF A;  4CGY B;  2E2D C;  4X66 Q;  3UE1 A;  4DNT B;  1KAB A;  1BCP C;  1L2F A;  1SMY D;  1D5X C;  1S5D D;  1IBL L;  4GNX C;  2JA7 G;  3UDI A;  2KCN A;  2XTI A;  5LMU L;  1B8A A;  1MHW C;  1HPC A;  5CBA E;  3CC2 A;  3MFY A;  1R9T H;  2B2Y C;  4DV4 L;  1FGU A;  2NVX H;  1LTB D;  1TR5 A;  2BDN A;  4DR2 Q;  4OWW B;  1X55 A;  4N8F A;  2I07 B;  3SK6 A;  2LFN A;  1X6O A;  4RHS A;  3STB C;  3H0G G;  4A3K B;  3EN2 A;  3QJY A;  2L15 A;  1KC8 C;  5FLM G;  4CJ0 B;  1K28 A;  1CFM A;  3CQZ H;  3Q22 A;  1GUN A;  2VY3 A;  1RTO A;  1LV9 A;  3NP8 A;  1HRJ A;  1U4M A;  4IJL A;  1HXY D;  5EPJ A;  1YNN C;  5M5Y H;  3D4R A;  1BCP D;  4YIJ A;  2D0O A;  2J0T D;  3NBH A;  4NXM Q;  1SRU A;  2CH4 W;  2MQH A;  4X3U A;  1AW7 A;  1I3Q B;  1V1Q A;  2C35 B;  1NNX A;  1U0L A;  4XYQ A;  1WCM B;  5IGC A;  3P75 A;  4DAY A;  5IWA Q;  5IGE A;  3SVM A;  1CK1 A;  4HJ7 A;  2A5H A;  1A63 A;  1Y14 B;  1HQR D;  1CHQ D;  1M1K C;  2XIW A;  2PQE A;  3HOW H;  4FDB A;  4HJA A;  5FOB B;  3KK7 A;  4L5Q A;  3S14 B;  5EPK A;  3F2C A;  2NYZ D;  2Z9H A;  2Z0S A;  5M3F H;  3CW2 C;  1EY7 A;  1O7L A;  3H91 A;  1I3Q H;  5AJ3 Q;  3NEM A;  2F4V Q;  1HR0 L;  1L1O B;  1ZXT A;  2GA4 B;  1GOZ A;  1R4P B;  2A73 B;  4IPG A;  4RHR A;  3AMU A;  3DHQ A;  2YV5 A;  3KLR A;  2NVY H;  2NN6 G;  2WIN B;  2RVL A;  1V43 A;  3H09 A;  1SFO B;  3HRZ C;  2DY7 A;  1ILP A;  4QMG A;  2IX1 A;  2FHT A;  3TDQ A;  2NZ1 D;  1CHP D;  4ZRZ A;  4BY1 G;  1I4R A;  3L9A X;  5D3I B;  3GTQ H;  1PH8 A;  1TKW B;  3PQI A;  4BWG B;  3RN2 A;  3OTO L;  3AU7 A;  5C0X I;  1QG7 A;  2ZM6 Q;  1EIH A;  4LFC L;  4OX9 Q;  1WTR A;  3CPW A;  3HOZ H;  3K0Y A;  1HUN A;  4WOR A;  2MO0 A;  1PRT C;  4K5X A;  1EIY B;  3OHX C;  1HH2 P;  1KDB A;  1YHA A;  3JC6 6;  3DM1 A;  1PXU A;  2XWJ B;  4JC0 A;  4L5R C;  2JA6 G;  3GTG B;  1I6H B;  3MWY W;  3Q8D A;  1QNK A;  1HFN A;  2B2V A;  2CFM A;  3AYH B;  1LLR D;  1OXS C;  3ULP A;  2GVB A;  1TS4 A;  1I94 Q;  2B63 H;  3S14 H;  2OT2 A;  1U4L A;  4IPC A;  3E0E A;  1PVO A;  4HJ8 A;  1XNQ Q;  1FD7 D;  2QDL A;  1VQB A;  2YTY A;  3FRP B;  3A54 A;  5HUR A;  1VQP A;  4DV3 Q;  1CQV A;  5AFW A;  1PH6 A;  1G2T A;  1VQH A;  2HCC A;  2I5M X;  4BBR G;  1Q3L A;  4HJ9 A;  2I0Q A;  2KHI A;  2JA7 B;  1DXM A;  3X3M A;  3TS2 A;  1BO0 A;  3ER0 A;  2E2I H;  1X3P A;  4LF7 Q;  3W3A A;  4DK3 C;  1IYU A;  1LAB A;  1D1I A;  4GN5 A;  3GTM H;  3HOX G;  1PFB A;  4HJ5 A;  3BZK A;  1XX8 A;  1QVG A;  1E2W A;  2H5X A;  2HUG A;  4F8M A;  4O42 A;  5CV7 A;  4HTH A;  3HFZ B;  3I55 A;  3K5N A;  4A3J G;  2PI2 A;  5I9O A;  2EDG A;  3V05 A;  4R4I A;  1ONL A;  1N33 Q;  5IGF A;  3PIO A;  2UUC Q;  3SK5 A;  1T5X D;  4JW0 A;  1IHZ A;  4GLV B;  2HDL A;  2P5Z X;  3I2Z A;  1O78 A;  4OO1 I;  1I50 H;  4IOA A;  2K5N A;  5C44 B;  5COY A;  3R8B A;  3MZ5 A;  5LL6 S;  3SDZ A;  3GDE A;  4N9P A;  2GN5 A;  2HHH Q;  1TT2 A;  3W2D A;  3G4S A;  1EY4 A;  3EBE A;  1ET9 A;  2ID0 A;  4K6D A;  2LSS A;  1GUO A;  5K36 H;  3A8K E;  3DEO A;  1BKB A;  3BDC A;  2F4I A;  4QUF A;  3LX0 A;  1SLJ A;  4FVM A;  4PZ7 A;  3QR8 A;  2A1A A;  4JI7 L;  1J9O A;  3DLL A;  3KJO A;  3S16 H;  4IFD G;  3ERO A;  1STE A;  4CJ1 B;  2LY7 A;  3S24 A;  1TXY A;  5FLX c;  4A3D B;  4M8A A;  3H94 A;  4KHZ A;  5KNC A;  2D9U A;  1II3 A;  4BY7 G;  1I6H H;  1QZH A;  1E7Z A;  1DON A;  2Y0S B;  1YIT A;  4GN4 B;  4A3K G;  4MTN A;  4RA8 A;  2B2T A;  5JPM C;  4OX9 L;  2EYH A;  2YYZ A;  1E3P A;  2OQ0 A;  5JOB A;  3J80 L;  3M9B A;  4F88 A;  2YTX A;  4UHV A;  5DEH A;  1TVX A;  2HDM A;  1SYG A;  5LHY 1;  1Z9F A;  1V9P A;  1EU4 A;  3O13 A;  1VQF A;  2N8N A;  1EIG A;  2K52 A;  4NKL A;  1OXU A;  1S5E D;  4ULL A;  3M3Y B;  2F0J A;  2ZTC A;  1SNO A;  4QIW E;  4V0B A;  5I9P A;  1FGB D;  3D8G A;  1Y1W G;  1WTO A;  1O80 A;  4IO9 A;  1A3T A;  4FYD A;  1EY9 A;  1PYB A;  1GHK A;  5F2D A;  1SNM A;  2KA7 A;  1A62 A;  1K8O A;  5EKI A;  4LUO A;  5EBD A;  5M3M B;  2FJ2 A;  3MXG A;  1VQO A;  1GUS A;  4TSS A;  1E0B A;  4BS9 A;  4CKB A;  2MNA A;  4JCV E;  5FLX E;  1WFQ A;  3GTK H;  1MIU A;  2BH2 A;  3K80 C;  1AZP A;  1WD0 A;  4L6T B;  4LFA Q;  1FYC A;  1VQ8 A;  1E1T A;  2KOL A;  1EQR A;  2CVR A;  2A74 C;  2F0N A;  3CXC A;  3BYT B;  3PGZ A;  1PTO D;  2R3Z A;  2N78 A;  4B3S L;  2LXK A;  4DXG A;  4DV2 Q;  5CV5 A;  5C4H A;  5IY0 A;  2ES2 A;  2K5H A;  2NVT B;  4CDD C;  2Q2U A;  4RH6 A;  2R93 B;  2PI2 E;  1Y1V G;  2L1B A;  1Q7Y C;  1VQG A;  3FMC A;  2Z6K C;  3BG3 A;  3HZX A;  5BR8 Q;  1FNV A;  5C44 H;  2N88 A;  1I6V C;  2HCI A;  2ENB A;  4A3B H;  2EOT A;  2UXD Q;  3RZO H;  4CDC C;  3HOU H;  3A74 A;  1ENA A;  4ZK9 B;  2EYM A;  3NWS A;  3G6E A;  3F2U A;  4IUQ A;  3PO2 H;  1X3Q A;  1TWF B;  1X3E A;  4NDX A;  2Z8L A;  3S1N B;  4G7O C;  1VQI A;  3PO2 B;  2EYO A;  4JVZ A;  3TRE A;  4QQB X;  1AH9 A;  3A7L A;  2FMM A;  2K05 A;  4ZYS A;  1BR9 A;  4LAA A;  3VR5 A;  3CCE A;  4DUY Q;  3TP7 A;  3TSS A;  1SNC A;  4HN7 A;  2Y0S E;  4A93 G;  1E24 A;  4FF3 A;  1PFN A;  2Q8I B;  2QIL A;  4H7B A;  3J7A F;  3RLF A;  2EXD A;  1SYE A;  5A2Q L;  1L0W A;  4A3E B;  3MEF A;  4K6L A;  1IBM Q;  4FF2 A;  1EYC A;  1K0R A;  1W6K A;  1BBW A;  4DR5 L;  2QKI C;  4X64 Q;  2K6A A;  2RQX A;  4K0K Q;  1YJN A;  1F9S A;  5CV9 A;  2F03 A;  1N36 L;  1EFI D;  4TKO B;  1F2M A;  3CP0 A;  3TRZ A;  4HCE A;  2R92 G;  2DUD A;  3PO3 B;  5L37 A;  1UE5 A;  2K03 A;  1ROD A;  2AWN A;  3S1Q H;  4JI1 Q;  1CTM A;  4R8I A;  5BN5 A;  5KYL A;  1CKO A;  2K50 A;  4YHH Q;  3K58 A;  3GTK B;  1UUP A;  3D0F A;  4C3H B;  4NXN Q;  4RG1 A;  1J8I A;  4XIG S;  4DKA C;  2BDO A;  2A6E C;  3D3R A;  3EQL C;  3TZU A;  4C3J G;  4ZCK A;  4K2K A;  2GVA A;  3WWV A;  3J7Z C;  4DV7 L;  3S2H H;  1Y8O B;  3CCQ A;  1IYJ B;  2F0D A;  1S40 A;  4P75 A;  3HOV H;  3DMU A;  4I7Z C;  5C4X G;  3GV3 A;  3NK9 A;  3CRK C;  1BCP B;  3B6Y A;  4JK1 C;  1CSP A;  1CUK A;  2UUC L;  4OIJ A;  2A68 C;  2YTV A;  4A3I B;  3K5M A;  1ENF A;  1M8A A;  3ERQ A;  2NVY B;  2XWB B;  4JI0 Q;  1U5K A;  3T1Y L;  4OO1 H;  1ZYR D;  1HNX L;  1A6X A;  1F9Q A;  4OEL B;  4ZQ3 A;  2HT1 A;  1R4Q B;  1Y69 U;  2AWO A;  2ALY B;  1JOK A;  2G9D A;  3PUZ A;  1GHJ A;  3C1F A;  4RKB A;  1Y8P B;  4IZ8 A;  3NHH A;  3KF8 B;  3CC4 A;  3P20 A;  1TWA H;  4A3J H;  1UAP A;  4G7Z C;  4DV1 L;  2R6G A;  1EOT A;  4B9W A;  3OPO A;  5H1S E;  3PIP 3;  2NN6 I;  3EFX D;  3KOJ A;  4DR6 L;  1XPU A;  1SMX A;  1Q1E A;  4DK0 A;  3M85 A;  3KFU A;  1K9M C;  1TY2 A;  3I4M H;  2L9H A;  1TS5 A;  1V1O A;  3ERS X;  2R7Z H;  1EIF A;  1Q8K A;  1KQS A;  1V1P B;  4KKT A;  4RGM A;  4UP7 A;  5A35 A;  4S3S A;  1VF5 C;  2OTL A;  4KHV A;  4ALP A;  4AQY L;  2IJ0 A;  1IW7 C;  5JEA H;  2K33 A;  2QEX A;  4DR1 Q;  5IYD G;  1B70 B;  2K32 A;  4A3G G;  1LYL A;  4HIM A;  5M9O A;  5M5W H;  4CBV A;  1ASY A;  1F2Z A;  2LXJ A;  4LF8 L;  3DXJ C;  1VQ6 A;  5CV6 A;  2EJF C;  3WDN A;  3J7Y W;  5JPN C;  1HZA A;  5ELF A;  3EJI A;  5FJ8 H;  1Q12 A;  3SEB A;  3NTK A;  3H6M A;  1YBY A;  5CBE E;  5NUC A;  4YHH L;  2UUA L;  4OL7 A;  5COR A;  5DM6 3;  5C3E H;  4A3D G;  1B9N A;  4MIU A;  3I4N G;  2I5H A;  3H3V I;  4KHP L;  1K3B C;  3DWQ A;  4R4C A;  1DCZ A;  3S1R B;  1FR3 A;  1XNR Q;  2M00 A;  1STN A;  1UEA B;  1PRT D;  1VQ5 A;  2CW0 C;  4QY7 A;  1IZ6 A;  1PTO H;  3BVG A;  2WB1 G;  1DJR D;  1X56 A;  4HAE A;  2EJG C;  4H13 C;  1NJI C;  2JA8 B;  5DNF A;  4PMC A;  2UXC Q;  2KED A;  3CKI B;  4HIK A;  1PZJ D;  3OIQ A;  2E2I B;  5KND A;  2TSS A;  1VQJ A;  3CD6 A;  3GTL H;  2ZJQ A;  3PUV A;  2R7Z B;  4JI8 L;  1X9N A;  4LFC Q;  2Z6K A;  2CQO A;  4ABN A;  1N33 L;  4GOP C;  3LGJ A;  1LO5 D;  3HEJ A;  2RF4 A;  3TME A;  2K04 A;  3J81 c;  5JJL A;  3F1Z A;  2QW7 A;  1GUT A;  4RFB A;  4JI7 Q;  1K0S A;  3NQT A;  4HR7 B;  4IOC A;  1JJG A;  4HSP A;  3BYY B;  4IN3 A;  1I5F A;  1WD1 A;  3K0X A;  4P2C B;  3OWF A;  1XTC D;  5M5X H;  3OW7 A;  4DAY B;  3DM3 A;  4QIW B;  1K3R A;  2L12 A;  5KIX A;  4MTK A;  5GAE C;  1L1O A;  1HNW Q;  1KLG D;  1B44 D;  3F2D A;  1D5Z C;  5IYD H;  2JJQ A;  4TRD A;  4A3B B;  5M3F B;  2CWP A;  5J39 A;  4X65 L;  2JA8 G;  3S17 B;  2OCE A;  1OXX K;  4XQQ A;  1S3O A;  3FP9 A;  2RBM A;  4X62 Q;  1JWU D;  4GKJ Q;  1TS3 A;  1JQY D;  2FXQ A;  1VQN A;  3LNN A;  2AQ3 B;  1PH9 A;  1XJV A;  3M3Y H;  1PV4 A;  2XSC A;  1RD9 D;  1B3A A;  1GKH A;  3GTO B;  1VQ9 A;  4GLA C;  4PNY A;  2QGQ A;  1GXD C;  5EKL A;  2MUY A;  1PH5 A;  3C2P A;  1H9S A;  2CKZ B;  2BE5 D;  4POG A;  5ELN A;  3S16 B;  3T13 A;  4JPB W;  4AIM A;  2IL8 A;  4BY7 H;  2VUM G;  4GKK L;  4G4K A;  5IP7 H;  5EKK A;  1EEI D;  3V96 A;  5LMN L;  4H0L C;  4C3I G;  5FK9 C;  2MGS A;  5IT9 c;  2RHS B;  3SGI A;  1XNR L;  5GRO A;  2HIV A;  2PO4 A;  1TII D;  1XMO Q;  2E75 C;  1HQM C;  3E6Z X;  3IRB A;  3BZC A;  1A8V A;  3ZYY X;  1Y8N B;  1XYI A;  1VS0 A;  1H9R A;  4EQ5 A;  3HG9 A;  5JJK A;  1O7Y A;  2DN8 A;  4EX5 A;  2R7Z G;  1I4P A;  3PUW A;  4QB4 A;  1ET6 A;  1H9M A;  1ZEQ X;  2XRQ D;  2M2L A;  1PH7 A;  1HTP A;  1P8L A;  1PRT B;  4A3M H;  3J81 L;  1PLF A;  1D2B A;  2LKV A;  2IWH A;  3UDF A;  4HSV A;  3JAM L;  4MZ9 A;  4DR6 Q;  4KY6 A;  2HHH L;  4C3I B;  4XQJ A;  1N9W A;  1KTK A;  4DXF A;  1ESF A;  4KN7 C;  4C3J H;  2JXM B;  4A3E H;  1LTG D;  2PNR C;  2JA8 H;  4RMF A;  5IIF A;  3BVM A;  1HHV A;  2F0Q A;  3K57 A;  4L63 B;  4J15 A;  2PNH A;  2N3S A;  4B3M Q;  4KKU A;  3JAM E;  3KF8 A;  3F8T A;  4B08 A;  3CHB D;  3QB3 A;  3GTL B;  4DR1 L;  2Q2I A;  3J80 E;  4K2L A;  1B3Q A;  3I70 A;  3CAM A;  4BBR B;  3IKJ A;  3GTM B;  1IKL A;  3CCU A;  2KCC A;  2VQE Q;  3I8Z A;  4A3F G;  5BN4 A;  1VMP A;  4LF5 L;  1HCZ A;  1NR2 A;  4BBR H;  4X62 L;  4GKJ L;  1PYS B;  3E3X A;  4YCW A;  4DAM A;  1SAP A;  4LF7 L;  4GLX A;  2DNC A;  4FXK C;  1LTS D;  5EPL A;  3VYR A;  3A0J A;  4FP5 D;  2B2U C;  1SNQ A;  3ONA B;  3EIV A;  4WJ3 M;  2K5D A;  3VR6 A;  1NE3 A;  4Q0F A;  1Q82 C;  1ASZ A;  1F9P A;  3TP6 A;  1LT5 D;  4PG3 A;  5JEA J;  4TQU S;  2DGY A;  1HNW L;  4V19 0;  4A75 A;  1EOV A;  2EJM A;  2PCF B;  2X6L A;  4A4I A;  3OYY A;  5EBC A;  5J22 A;  1YI2 A;  1HNZ Q;  1VF7 A;  4IPD A;  4C3H G;  2UXB L;  3G6J B;  3KF6 A;  2PMZ B;  3DUZ A;  1VQD A;  3Q0A A;  3HOU G;  4M1U B;  2E5L Q;  3MVV A;  4Y7N B;  3MFG A;  3OW2 A;  3HKZ B;  2O5I C;  2R92 H;  5ELE A;  4A3B G;  4O1N A;  3MXU A;  2JSO A;  4X3S A;  5E7N A;  1JR0 D;  3PUX A;  5I6W A;  5KYI A;  3M4O H;  4A3M B;  3A7A B;  4KD4 A;  4A76 A;  1RTN A;  3QIA A;  1YNX A;  1LTI D;  3GD7 A;  4LW1 A;  1XPO A;  1XMQ Q;  2AMC B;  3J81 i;  1D8L A;  1E2V A;  4MN3 A;  1HTL D;  1JWM D;  1WJJ A;  1YEZ A;  3T1H Q;  3U50 C;  3ZJY C;  4HID A;  2NVQ B;  2BA1 A;  3SHL A;  2NN6 H;  1EU3 A;  3PCO B;  4PMB A;  2C9O A;  1YVC A;  1TWH H;  4KJN A;  2ZJP A;  1HZB A;  4DR7 Q;  1W6J A;  2XVS A;  4K5W A;  1FVI A;  2EQS A;  4EQO A;  4LNQ A;  1QVF A;  4IFD J;  3NWT A;  5G3L D;  4JI8 Q;  4Y7N H;  4GZY C;  4IUN A;  2WII B;  4JI2 Q;  4ZKC B;  3NTH A;  4P72 A;  1SE4 A;  2D2C C;  4J8Q A;  4KJO A;  3GQB A;  2EVB A;  2HD3 A;  1VMC A;  1I4X A;  5IOD A;  4J1M A;  4L5T A;  5EGT A;  3T56 B;  4A3M G;  2VXW A;  5CV4 A;  1TWH B;  2RA4 A;  3HOY B;  4DR4 Q;  1JOR A;  3MXN B;  3D4D A;  2UUB Q;  1TWC H;  5ISR A;  4BY1 B;  2ICE C;  2K5V A;  2PZT A;  3NBI A;  3BVZ A;  2RSN A;  3CU7 A;  2F0T A;  3H3V H;  3VA5 A;  1VQL A;  1SXT A;  2AUK A;  4X6A H;  2JYO A;  4J6H A;  3U9S A;  1KXL A;  1G6Z A;  1BVS A;  1QUQ A;  2G5D A;  3Q6S A;  3K5L A;  5FLM H;  4PMW A;  1Z7T A;  3UDX A;  2V1C C;  3M4Q A;  1CZG A;  3FPP A;  4B3R Q;  1PTO C;  1KDA A;  5GAD C;  4QL5 A;  1A3U A;  4U67 3;  1C4Q A;  1LT6 D;  1S4Z A;  2F0E A;  2RSO A;  3PSI A;  1JB7 A;  4LMQ D;  1IL8 A;  2UXC L;  2NTS A;  3M4P A;  2A6H C;  3H0G B;  1RIP A;  3QO2 A;  2UU9 L;  2EXZ A;  1X54 A;  1RJT A;  1ICW A;  4KY7 A;  1AE3 A;  1QNU A;  1JCK B;  3T1Y Q;  2LS0 1;  1X65 A;  1X3G A;  1DGS A;  2J7Z A;  4YWM A;  4UDU C;  2DJF C;  2B2V C;  1G29 1;  5E3F A;  3T16 A;  2R7F A;  2QCP X;  3W5O A;  4JOI C;  5G3L F;  3V2T A;  2VQE L;  1BQQ T;  5IYB G;  3A5Z B;  1C8C A;  5CMD A;  1EQQ A;  4EQN A;  4YY3 L;  5C4Z A;  2VQF Q;  1LT3 D;  1V1P A;  2F0F A;  1HUM A;  1SYD A;  4FO2 A;  1NR4 A;  2F3W A;  2NTT A;  2EYJ A;  1S5B D;  2OXP A;  2VB3 X;  1L1O C;  1QZG A;  3PIO 3;  2K75 A;  2OQK A;  4LF9 Q;  1WYD A;  3FKI B;  1HFG A;  4L8J A;  3ND8 A;  1KD1 C;  4K0K L;  1MKH A;  3T53 B;  4LF4 L;  2E8G A;  4R4Q A;  1D6E C;  3S1M H;  4O2D A;  3OOC A;  2JA6 H;  4UP9 A;  3ITP A;  5D14 A;  3PF4 A;  4JI1 L;  2F3V A;  2F0W A;  1IYV A;  4DV0 L;  4U68 A;  5IGD A;  2Z4I A;  2AQ1 B;  2NWG A;  5C3E B;  5DAU A;  4POF A;  3U58 A;  3J7A V;  1KAW A;  1AZQ A;  4NXN L;  1QOH A;  1BNZ A;  2L11 A;  4I65 A;  4ME5 A;  4C3J B;  4ZUJ A;  3FDT A;  1O7I A;  3DWP A;  3I4L A;  2EY5 A;  2XRS D;  5D65 A;  1LUZ A;  1UE1 A;  4DV5 L;  1N32 Q;  1NMF A;  2RDF A;  1N34 Q;  4UP8 A;  4LFB Q;  5C3W A;  3K81 C;  1SFO H;  2X6G A;  4A3G B;  3CRL C;  2FIN B;  4GKK Q;  4WFN 3;  5IE8 A;  3KUP A;  2E2J H;  1F9R A;  3RUZ A;  1JE5 A;  1Q1B A;  2F0P A;  3G48 A;  2B2T C;  3HGB A;  2FMC A;  3ND9 A;  2SEB D;  1GO3 E;  1TWA B;  2OEO A;  1YJ9 A;  3AEV A;  3HOW B;  3MC0 B;  2SOB A;  1Q8I A;  2XN9 C;  1NY4 A;  3PO3 H;  2C5C A;  4HED A;  4X3K A;  3HOZ B;  2PYK A;  1PTO F;  1VQK A;  2E2H B;  1ICF B;  2A6H D;  4JYA L;  1TWG H;  3NTI A;  3KJP A;  1KDC A;  3FEW X;  2AHO B;  1MGS A;  1C48 A;  3PF5 A;  1VQ4 A;  5I2X A;  2HQE A;  1YNN D;  2E5L L;  3NXW A;  1VQC A;  1XPR A;  2K1B A;  4KN4 C;  2NZO A;  5I6Y A;  1WCM H;  1H9J A;  2OF1 A;  4B3S Q;  3HOY G;  2QDB A;  2IY5 B;  1T5E A;  1UEB A;  3QOL A;  4A3E G;  2IT1 A;  3MAQ A;  3TEH B;  3I56 A;  3KLW A;  1EYG A;  3NSW A;  4LF6 Q;  5GQO A;  4KLK A;  3H15 A;  3EVQ A;  1MSH A;  1F77 A;  3MXN A;  1QE6 A;  1I4H A;  3AFQ A;  1RL2 A;  2DJG C;  2R93 G;  1A3V A;  4DK1 A;  4UAI A;  1BBX C;  3KBX A;  4DR4 L;  1I94 L;  1EWI A;  2RDH A;  4HIO A;  2K5W A;  3RNU A;  4ID6 A;  3TZD A;  1XTD A;  5EJW A;  1B53 A;  3I4N B;  2L5T A;  1BF4 A;  1PZI D;  4LF5 Q;  1M4V A;  4JI4 L;  3CCL A;  1XNQ L;  3L7Z C;  4BXX G;  1N32 L;  2EY1 A;  1WTQ A;  4MHE A;  4O0A A;  5KGU A;  1IBM L;  1E2Z A;  3VA7 A;  4P74 A;  1PH3 A;  5FKA C;  1F2Y A;  4C3I H;  4L5S A;  2JA7 H;  3SK4 A;  4RWS C;  4KKS A;  2PZU A;  3H0G H;  4DV7 Q;  4RKL A;  2A69 D;  3RMH A;  1YNJ D;  5M3F G;  1A15 A;  2RKS A;  4OWX B;  3FPU B;  3I4M G;  3AFP A;  3URY A;  1PH2 A;  2WAQ E;  5J1Z A;  2K5Q A;  2MHV A;  4KHP Q;  4PZ8 A;  2Q8T A;  1N8R C;  1JB3 A;  4IFD I;  4DF7 A;  2OWO A;  1A0I A;  4IUP A;  4Y52 H;  2LMC B;  3CF5 A;  4GNX A;  1KAA A;  1HA6 A;  2ZXR A;  2JA5 H;  4A3L G;  3E9I A;  1WCM G;  3HOY H;  4LF8 Q;  4FNF A;  2A8V A;  5IWA L;  4YY3 Q;  2VQF L;  3NUC A;  4DR3 Q;  1B9M A;  1E1O A;  2NUC A;  2JEB I;  4DV2 L;  4JI6 Q;  1B4O A;  1VDZ A;  1SND A;  3VR4 A;  4ODG A;  5BR8 L;  3CPF A;  1TS2 A;  4UPA A;  3NQI A;  3DWA A;  3LWU A;  2ZTE A;  1J6Q A;  4MNO A;  1LTA D;  3HOU B;  4NW2 A;  2PPB C;  3CME A;  2A68 D;  1STA A;  4A3F B;  1UE7 A;  3GP7 A;  3D4W A;  3RN5 A;  4GN3 B;  3RZD B;  4NXM L;  3I90 A;  3J81 E;  1YJW A;  4DUZ Q;  2F0M A;  1TQO A;  1HNX Q;  3IAY A;  2DY8 A;  1WTV A;  5JAV A;  4DPG A;  4UY8 C;  2PQA B;  1NSN S;  1STH A;  4PQX A;  2B63 G;  5LL6 X;  4LWC A;  5IYB H;  2NB0 A;  5CC4 A;  3A5U A;  3I7F A;  4K14 A;  3VYU A;  2ATW A;  2RDG A;  2ZXP A;  2CH4 A;  3X3N A;  1G2S A;  2H4O A;  3L2P A;  1ILQ A;  2JA9 A;  3T51 B;  3J80 c;  3GTJ H;  2IHF A;  1JWS D;  2I46 A;  3S2D B;  1EY6 A;  5E4X A;  2NVT H;  2F0I A;  1SBB B;  4LFB L;  2F52 A;  4E6I A;  1VQA A;  1JJC B;  3HP3 A;  4K8I A;  5M3M G;  3CC7 A;  3PUY A;  2L0C A;  3KBG A;  3GTJ B;  1Q46 A;  3QWN A;  1I4Q A;  2A6E D;  1WI5 A;  1PMR A;  1UNS A;  1NCV A;  2XNA C;  3BS1 A;  4LF4 Q;  4A3D H;  4B3T Q;  2L4N A;  2IX3 A;  4QGU A;  4C56 C;  2NVQ H;  3SK8 A;  4R4O A;  2M9V A;  2AKW B;  2F0U A;  1TY0 A;  3QG1 A;  1GVP A;  1BUV T;  3S2D H;  3S1Q B;  1WTW A;  4CKE A;  3S2H B;  3CQZ B;  4JV5 Q;  5IP9 H;  1SN8 A;  4C2M B;  1Y1V B;  2EYF A;  4BA2 I;  3C3L A;  2B2W C;  3A55 A;  3PO2 G;  1LT4 D;  5LMN Q;  4FXD A;  2RCN A;  2BH8 A;  3S15 H;  4NB3 A;  5T1G A;  2OTJ A;  3D6C A;  1XXG A;  4XTC S;  4EQP A;  3MA2 B;  1CSQ A;  5C4X H;  4ZAI A;  3HKZ G;  3MXP A;  3BJU A;  4EVO A;  1I50 B;  4A3C H;  2WAC A;  4AH6 A;  4JI5 L;  3I3C A;  1J5E Q;  4LUV A;  1EQT A;  1OXV A;  4FXG C;  3DEP A;  2TMP A;  4G57 A;  4KY5 A;  4ZLT F;  3OTO Q;  3S1N H;  2CCZ A;  5JJZ A;  3MEH A;  2K14 A;  3A56 A;  4C1N K;  2K7V A;  1BOS A;  2EY6 A;  5C5L A;  3AB9 A;  4CDF C;  1H9S B;  2A69 C;  4X65 Q;  1VQ7 A;  4WJ4 A;  2KEE A;  1VQM A;  1SEB D;  2XGT A;  4OON A;  4OO1 G;  5IYC G;  3RLO A;  2KVM A;  3OMC A;  4QCL A;  5DM7 3;  4GNX B;  1T9H A;  4XXE A;  2SNM A;  3U9O A;  2WKD A;  1GD7 A;  1PDQ A;  1UWV A;  4QF4 A;  2KUM A;  2KCM A;  2F0K A;  4APV A;  1D5M C;  4KMU C;  5IT9 L;  3G71 A;  1EFW A;  1AFP A;  1DOK A;  3I72 A;  4RAU C;  2R61 A;  1Y1W H;  2A19 A;  2VUM H;  3TS0 A;  1W2B A;  2B8G A;  2F0O A;  4P73 A;  5C4X B;  3K5O A;  3KLS X;  1BXT A;  3GO5 A;  4DV3 L;  2R93 H;  5CYU A;  3QOJ A;  5C4J B;  4LJZ C;  4FF1 A;  4DGZ A;  2WP8 J;  1GUW A;  1HZC A;  4LUZ A;  4RGO S;  2B29 A;  5A2Q E;  2PQA A;  2UUB L;  1U4P A;  1KNE A;  4RCN A;  4JYA Q;  5C3X A;  3I4O A;  2KBN A;  2WB1 E;  4P71 A;  2IX0 A;  1SR3 A;  3CCJ A;  1DD2 A;  3HKZ E;  5ELO A;  2CWA A;  2SDF A;  3L3O C;  1D1K A;  2UUA Q;  1ENC A;  5C44 G;  3S15 B;  1YIJ A;  5FO8 B;  1QB5 D;  1SYF A;  3K7A H;  1Y1V H;  2VS1 A;  1EYD A;  3UE0 A;  1SE3 A;  2RCF A;  2SNS A;  3K59 A;  3I4M B;  4IQZ A;  1MJC A;  2F0L A;  2AQ2 B;  2I5L X;  1KL9 A;  1STY A;  3IFD A;  1MSG A;  1CI3 M;  3J80 i;  4JI6 L;  2WKC A;  5HGQ A;  1H95 A;  1HR0 W;  1AEX A;  1P16 A;  3GTO H;  3RLN A;  1CM9 A;  4BBS G;  4B3M L;  1SJH D;  2K01 A;  1CKN A;  4DAV A;  4N9T A;  1G91 A;  4A93 B;  5IP9 G;  3BU2 A;  1TWG B;  1HR0 Q;  1QCB D;  1G51 A;  3T1H L;  1AE2 A;  2EZV A;  4YCV A;  1TWC B;  5JJI A;  1S5C D;  2Y0S G;  3HOX B;  1EZ6 A;  1QVC A;  4JI4 Q;  1ML0 D;  1SYB A;  1EYA A;  5C0X G;  2PW5 A;  1SE8 A;  5LMU Q;  2K4K A;  3NEL A;  1MD2 D;  2K28 A;  5M5Y B;  1SNP A;  1EY5 A;  2D5D A;  2KCT A;  1EEF D;  2KJX A;  3CMA A;  2WB1 B;  2BOS A;  4AYB B;  4B3T L;  2KEC A;  4HCS A;  4F7X A;  2PZW A;  3S1M B;  4PZ6 A;  3NPP A;  4JI3 Q;  2EE1 A;  4EGV A;  4H44 C;  4WJW A;  1KRT A;  4JI2 L;  3TQY A;  2NVX B;  1K8M A;  3FKI H;  4YWL A;  5GAG C;  1JE4 A;  2KHS A;  3E9H A;  2ASB A;  4DUZ L;  3SXH A;  5C3E G;  1IL2 A;  1PFS A;  4X64 L;  1OXT A;  4GOP B;  3VYS A;  4A3F H;  2JA6 B;  4DR7 L;  2BE5 C;  4F87 A;  4JG2 A;  4NP5 A;  3S1R H;  3TP8 A;  4N8X 1;  4OEM B;  3OSO A;  3VDY A;  5D3D A;  1Q81 C;  1JMC A;  4IFD H;  1JT8 A;  1PTO B;  4OHJ A;  4R4T A;  5M5X B;  1TU2 B;  2R7D A;  4IJH A;  4BA1 I;  5JEA G;  3N6R A;  5IP7 G;  3K7A B;  1MI2 A;  1W3S A;  1ESR A;  3RZO B;  1RHP A;  4FF4 A;  2UU9 Q;  1FJG L;  3EA6 A;  3RR5 A;  1DOM A;  1NMG A;  3PMF A;  2VZA A;  4XDX A;  4K8J A;  3P1H A;  4IUV A;  2JA5 B;  1Z6H A;  4DV6 Q;  2V4D A;  5BN3 A;  1B1Z A;  1SMY C;  4IUU A;  3KF6 B;  2JE6 I;  4K5V A;  4ZKB B;  1MBY A;  3CCM A;  5DLQ E;  4XT3 B;  2Z1C A;  3UDG A;  4PV1 C;  3GTP H;  4DFA A;  2ZT9 C;  1QUQ B;  1Z47 A;  4DK6 C;  3U4Z A;  4R9W A;  1KIX A;  2BCO A;  4KK7 A;  3W1B A;  3BDO A;  3HKS A;  1HA5 A;  4DR3 L;  2JQO A;  3I73 A;  1JOO A;  5FO9 B;  4HMI A;  1X3F A;  4C2M H;  4HMJ A;  1B7Y B;  3WOF A;  1CKM A;  1U4R A;  1LTR D;  2O2L D;  1UE6 A;  2F0V A;  3K6O A;  4OGQ C;  1PZK D;  2DNE A;  3LWE A;  3RD4 A;  4CJ2 C;  5EAY A;  3E0J A;  1KHI A;  4ILW A;  3CCS A;  4IUT A;  4XT1 B;  4RGN A;  4IUR A;  4DR5 Q;  2E76 C;  3P7J A;  2B2W A;  4BXX H;  2KHJ A;  3HOW G;  1S5F D;  2UXD L;  1RKN A;  2B2Y A;  2CHB D;  1RDP D;  1LTL A;  1I4G A;  4DV0 Q;  1AN8 A;  4X66 L;  1JJ2 A;  4YCU A;  3VR3 A;  5CR3 A;  5IGG A;  3R3O A;  4C1N I;  1JIC A;  3HS0 C;  4R1J A;  3HOV B;  5HGT A;  4KD3 A;  3SR1 A;  3FKI G;  3GV6 A;  3KYH C;  1GJX A;  4DUY L;  4YWK A;  2Z4H A;  2CW0 D;  2E2H H;  1G8Z D;  3JAM c;  2B39 A;  3L0O A;  5M5W B;  5FO7 B;  4LF9 L;  1NUC A;  1QIL A;  5AJ3 L;  2JN4 A;  1S72 A;  2B3G A;  3CCV A;  2WV6 D;  2F0G A;  4OXP A;  2F0H A;  1STG A;  3J7A 5;  1SRO A;  2PW7 A;  3I91 A;  4ME3 A;  5FLX L;  1JOQ A;  2EYP A;  2CQA A;  2E2J B;  1CKN B;  1F2L A;  2X69 A;  3R2I A;  4JOI A;  1XWE A;  1HNZ L;  1Q86 C;  4IPH A;  3IL8 A;  3T4A C;  2YU9 H;  1HJP A;  3W1G A;  4DN4 M;  4XYO A;  3M7G A;  2NZH A;  1C7Y A;  1QWY A;  1EY0 A;  4I7A A;  1EUJ A;  1M90 C; 
#chains in the Genus database with same CATH homology
 1DM0 B;  1A2T A;  4R8N A;  1Q90 A;  1DYQ A;  1NAP A;  2R92 B;  2QEJ C;  3D31 A;  5CGK A;  2BA0 A;  3IFT A;  1H9K A;  3FVQ A;  4RGT A;  1SDF A;  2Q8R E;  2MP1 A;  1SSO A;  4DAP A;  2EY2 A;  1RF2 D;  1O7Z A;  1EWC A;  4JBW A;  1ZYR C;  3D6W A;  1EQV A;  1CZW A;  4XQN A;  2WAQ B;  4LK1 C;  4NMZ A;  5C0X H;  1WVL A;  2B63 B;  5KEE A;  2MJ8 A;  3SE0 A;  2JP1 A;  1JC7 A;  3G7L A;  1CT1 D;  1DOL A;  3S9W A;  1DZ1 A;  1GUG A;  5TSS A;  2IPK D;  4DA2 A;  1B50 A;  1L0Y B;  5CV8 A;  1EZ8 A;  4ZUI A;  4DU9 A;  1QJO A;  1IKM A;  3BZD B;  3TBI B;  4BBS B;  1FNW A;  3A8J E;  5I2Y A;  1KLU D;  5C5M A;  2QF7 A;  5I4D A;  3NE5 B;  3VR2 A;  5IOC A;  3R2T A;  2JEA I;  1U9R A;  2D62 A;  1LTT D;  1OO9 B;  4KTA A;  4KV6 A;  3MHB A;  1BDO A;  1VCI A;  4WRD A;  5ELC A;  5ELB A;  3UI2 A;  3R93 A;  3Q23 A;  3MTS A;  3PV0 A;  1B2T A;  3C1E A;  5C0X J;  4X3T A;  2IW3 A;  2J4X A;  3H3V C;  4CHT B;  5C6A A;  1V8Q A;  2YU9 B;  3OMG A;  2ICI A;  3N52 A;  5T1I A;  2O4X A;  1X32 A;  1IW7 D;  2AUJ D;  1RCV D;  3Q24 A;  5E4W C;  5E1F A;  1CA6 A;  3WOE A;  5K5P A;  5K36 G;  1WTP A;  1PYW D;  5JVH 3;  1KNA A;  1A2U A;  2N55 A;  4Q5V A;  3KLS A;  4KI0 A;  3E5S A;  1LAC A;  2VNU D;  5ELD A;  2VB2 X;  4B9X A;  2E74 C;  1SYC A;  3OWE B;  3VYT A;  3TP5 A;  3BDL A;  3M4Y A;  1WTX A;  1SE2 A;  5JVG 3;  2EYL A;  4CKC A;  1K83 B;  2G9H D;  1L0X B;  4A3J B;  4Z9C B;  3GTQ B;  1SJE D;  1CQF A;  1EL0 A;  4OIK A;  1PRT F;  1STB A;  3M4O B;  2KQ3 A;  1FNU A;  1Y1W B;  2ZXO A;  1PFM A;  5IT9 E;  5KRU A;  3M7N A;  2EPB A;  1EY8 A;  3TN2 A;  1BCP F;  1ZKO A;  2MPM A;  2FFK B;  2L55 A;  4DNR B;  1AP0 A;  4G7H C;  1CA5 A;  3A8I E;  5EQ0 A;  1EWH A;  5IGB A;  3GTP B;  5KNB A;  3C46 A;  3OIP A;  2O5J C;  2H1E A;  1R9T B;  4RCO A;  2F0S A;  2F1M A;  4QUC A;  1YNJ C;  2B2U A;  4IAL A;  2B8F A;  2VUM B;  4BY7 B;  2NBF A;  4CGY B;  2E2D C;  4DNT B;  1KAB A;  1BCP C;  1SMY D;  1D5X C;  1S5D D;  2KCN A;  1HPC A;  5CBA E;  3MFY A;  2B2Y C;  1LTB D;  1TR5 A;  2BDN A;  2I07 B;  3SK6 A;  2LFN A;  4RHS A;  4A3K B;  3QJY A;  4CJ0 B;  1CFM A;  3Q22 A;  1GUN A;  1RTO A;  1LV9 A;  3NP8 A;  1HRJ A;  1U4M A;  1HXY D;  5EPJ A;  1YNN C;  3D4R A;  1BCP D;  4YIJ A;  2J0T D;  3NBH A;  4X3U A;  1AW7 A;  1I3Q B;  4XYQ A;  1WCM B;  5IGC A;  3P75 A;  4DAY A;  5IGE A;  3SVM A;  1CK1 A;  2A5H A;  1HQR D;  1CHQ D;  2XIW A;  2PQE A;  5FOB B;  3KK7 A;  3S14 B;  5EPK A;  2NYZ D;  1EY7 A;  1O7L A;  3H91 A;  1ZXT A;  2GA4 B;  1GOZ A;  1R4P B;  2A73 B;  4RHR A;  3AMU A;  3DHQ A;  3KLR A;  2NN6 G;  2WIN B;  2RVL A;  1V43 A;  3H09 A;  1SFO B;  3HRZ C;  2DY7 A;  1ILP A;  4QMG A;  2IX1 A;  2FHT A;  3TDQ A;  2NZ1 D;  1CHP D;  4ZRZ A;  1I4R A;  3L9A X;  5D3I B;  1TKW B;  4BWG B;  3AU7 A;  5C0X I;  1QG7 A;  1EIH A;  1WTR A;  3K0Y A;  1HUN A;  4WOR A;  1PRT C;  4K5X A;  3OHX C;  1KDB A;  3DM1 A;  1PXU A;  2XWJ B;  3GTG B;  1I6H B;  3MWY W;  1HFN A;  1QNK A;  2B2V A;  1LLR D;  1OXS C;  1TS4 A;  2OT2 A;  1U4L A;  1FD7 D;  3FRP B;  3A54 A;  5HUR A;  1CQV A;  5AFW A;  1G2T A;  2HCC A;  1Q3L A;  2JA7 B;  1DXM A;  3X3M A;  1BO0 A;  1X3P A;  3W3A A;  1IYU A;  1LAB A;  1D1I A;  1PFB A;  1XX8 A;  1E2W A;  2HUG A;  4F8M A;  4O42 A;  5CV7 A;  4HTH A;  3K5N A;  5I9O A;  2EDG A;  3V05 A;  1ONL A;  5IGF A;  3SK5 A;  1T5X D;  1IHZ A;  2HDL A;  4OO1 I;  1O78 A;  5C44 B;  5COY A;  3R8B A;  3MZ5 A;  5LL6 S;  3SDZ A;  4N9P A;  1TT2 A;  3W2D A;  1EY4 A;  1ET9 A;  2ID0 A;  4K6D A;  1GUO A;  5K36 H;  3A8K E;  3DEO A;  3BDC A;  2F4I A;  4QUF A;  3LX0 A;  4FVM A;  1J9O A;  4IFD G;  3ERO A;  1STE A;  4CJ1 B;  2LY7 A;  4A3D B;  4M8A A;  3H94 A;  4KHZ A;  5KNC A;  2D9U A;  1II3 A;  1DON A;  2Y0S B;  4RA8 A;  2B2T A;  5JPM C;  2EYH A;  2YYZ A;  5JOB A;  3J80 L;  4F88 A;  5DEH A;  1TVX A;  2HDM A;  1SYG A;  5LHY 1;  1EU4 A;  3O13 A;  1EIG A;  4NKL A;  1OXU A;  1S5E D;  4ULL A;  3M3Y B;  2F0J A;  1SNO A;  4V0B A;  5I9P A;  1FGB D;  3D8G A;  1WTO A;  1O80 A;  1A3T A;  4FYD A;  1EY9 A;  1GHK A;  5F2D A;  1SNM A;  2KA7 A;  1K8O A;  5EKI A;  5EBD A;  5M3M B;  2FJ2 A;  3MXG A;  1GUS A;  4TSS A;  1E0B A;  4BS9 A;  4CKB A;  5FLX E;  1AZP A;  1WD0 A;  4L6T B;  1FYC A;  2KOL A;  2CVR A;  2A74 C;  2F0N A;  3BYT B;  1PTO D;  2R3Z A;  4DXG A;  5CV5 A;  5C4H A;  2NVT B;  4RH6 A;  2R93 B;  2L1B A;  3FMC A;  3BG3 A;  3HZX A;  1FNV A;  2N88 A;  1I6V C;  2HCI A;  2ENB A;  2EOT A;  1ENA A;  4ZK9 B;  2EYM A;  3NWS A;  3F2U A;  4IUQ A;  1X3Q A;  1TWF B;  4NDX A;  2Z8L A;  3S1N B;  4G7O C;  3PO2 B;  2EYO A;  3A7L A;  2FMM A;  2K05 A;  4ZYS A;  1BR9 A;  4LAA A;  3VR5 A;  3TP7 A;  3TSS A;  1SNC A;  4HN7 A;  4FF3 A;  1PFN A;  2Q8I B;  2QIL A;  4H7B A;  3J7A F;  3RLF A;  1SYE A;  5A2Q L;  4A3E B;  4K6L A;  4FF2 A;  1EYC A;  1W6K A;  2QKI C;  2K6A A;  2RQX A;  1F9S A;  5CV9 A;  2F03 A;  1EFI D;  4TKO B;  1F2M A;  4HCE A;  3PO3 B;  2K03 A;  1ROD A;  2AWN A;  1CTM A;  4R8I A;  5BN5 A;  5KYL A;  3K58 A;  3GTK B;  1UUP A;  4C3H B;  1J8I A;  4XIG S;  2BDO A;  2A6E C;  3D3R A;  3EQL C;  3TZU A;  4C3J G;  4K2K A;  1Y8O B;  2F0D A;  3DMU A;  4I7Z C;  3GV3 A;  3NK9 A;  3CRK C;  1BCP B;  4JK1 C;  4OIJ A;  2A68 C;  4A3I B;  3K5M A;  1ENF A;  1M8A A;  3ERQ A;  2NVY B;  2XWB B;  4OO1 H;  1ZYR D;  1A6X A;  1F9Q A;  4ZQ3 A;  1R4Q B;  1Y69 U;  2AWO A;  1JOK A;  2G9D A;  3PUZ A;  1GHJ A;  3C1F A;  4RKB A;  1Y8P B;  3NHH A;  4IZ8 A;  3P20 A;  1UAP A;  4G7Z C;  2R6G A;  1EOT A;  4B9W A;  3OPO A;  3PIP 3;  2NN6 I;  3EFX D;  4DK0 A;  1Q1E A;  3M85 A;  1TY2 A;  2L9H A;  1TS5 A;  1V1O A;  1V1P B;  4KKT A;  4RGM A;  5A35 A;  4S3S A;  1VF5 C;  4KHV A;  2IJ0 A;  1IW7 C;  5JEA H;  2K33 A;  2K32 A;  5M9O A;  4CBV A;  1F2Z A;  3DXJ C;  5CV6 A;  2EJF C;  3WDN A;  3J7Y W;  5JPN C;  5ELF A;  3EJI A;  1Q12 A;  3SEB A;  3NTK A;  3H6M A;  5CBE E;  5NUC A;  4OL7 A;  5COR A;  5DM6 3;  1B9N A;  4MIU A;  3DWQ A;  1DCZ A;  3S1R B;  1FR3 A;  2M00 A;  1STN A;  1UEA B;  1PRT D;  2CW0 C;  1PTO H;  3BVG A;  1DJR D;  4HAE A;  2EJG C;  4H13 C;  2JA8 B;  5DNF A;  4PMC A;  2KED A;  3CKI B;  1PZJ D;  3OIQ A;  2E2I B;  5KND A;  2TSS A;  3PUV A;  2R7Z B;  4ABN A;  1LO5 D;  3HEJ A;  3TME A;  2K04 A;  4RFB A;  1GUT A;  3NQT A;  4HR7 B;  4HSP A;  3BYY B;  4IN3 A;  1WD1 A;  4P2C B;  3OWF A;  1XTC D;  3OW7 A;  4QIW B;  2L12 A;  5KIX A;  1KLG D;  1B44 D;  1D5Z C;  4TRD A;  4A3B B;  5M3F B;  5J39 A;  3S17 B;  1OXX K;  4XQQ A;  2RBM A;  1JWU D;  1TS3 A;  1JQY D;  3LNN A;  2AQ3 B;  2XSC A;  1RD9 D;  1B3A A;  3GTO B;  4PNY A;  1GXD C;  5EKL A;  2MUY A;  3C2P A;  1H9S A;  2BE5 D;  3S16 B;  3T13 A;  2IL8 A;  4G4K A;  5EKK A;  1EEI D;  3V96 A;  4H0L C;  4C3I G;  5FK9 C;  2MGS A;  2PO4 A;  1TII D;  2E75 C;  1HQM C;  3E6Z X;  3ZYY X;  1Y8N B;  1XYI A;  1H9R A;  3HG9 A;  1O7Y A;  2DN8 A;  1I4P A;  3PUW A;  4QB4 A;  1ET6 A;  1H9M A;  1ZEQ X;  2XRQ D;  2M2L A;  1HTP A;  1PRT B;  3J81 L;  1PLF A;  1D2B A;  2LKV A;  2IWH A;  4HSV A;  3JAM L;  4KY6 A;  4C3I B;  4XQJ A;  4DXF A;  1KTK A;  1ESF A;  4KN7 C;  2JXM B;  1LTG D;  2PNR C;  5IIF A;  3BVM A;  1HHV A;  2F0Q A;  3K57 A;  4L63 B;  4KKU A;  3JAM E;  3KF8 A;  4B08 A;  3CHB D;  3QB3 A;  3GTL B;  3J80 E;  4K2L A;  3I70 A;  4BBR B;  3IKJ A;  3GTM B;  1IKL A;  2KCC A;  3I8Z A;  5BN4 A;  1VMP A;  1HCZ A;  1NR2 A;  1SAP A;  2DNC A;  4FXK C;  1LTS D;  5EPL A;  3VYR A;  4FP5 D;  2B2U C;  1SNQ A;  3ONA B;  2K5D A;  3VR6 A;  4Q0F A;  1F9P A;  3TP6 A;  1LT5 D;  5JEA J;  4TQU S;  4V19 0;  2EJM A;  2PCF B;  2X6L A;  5EBC A;  5J22 A;  1VF7 A;  4C3H G;  3G6J B;  2PMZ B;  3DUZ A;  3Q0A A;  4M1U B;  3MVV A;  4Y7N B;  3MFG A;  2O5I C;  3HKZ B;  5ELE A;  4O1N A;  3MXU A;  2JSO A;  4X3S A;  1JR0 D;  3PUX A;  5I6W A;  5KYI A;  4A3M B;  3A7A B;  4KD4 A;  1RTN A;  3QIA A;  1LTI D;  3GD7 A;  1E2V A;  4MN3 A;  1HTL D;  1JWM D;  2NVQ B;  2BA1 A;  3SHL A;  2NN6 H;  1EU3 A;  4PMB A;  2C9O A;  4KJN A;  1W6J A;  2XVS A;  4K5W A;  4EQO A;  4IFD J;  3NWT A;  5G3L D;  4GZY C;  4IUN A;  2WII B;  4ZKC B;  3NTH A;  1SE4 A;  2D2C C;  4J8Q A;  4KJO A;  3GQB A;  2EVB A;  1VMC A;  1I4X A;  5IOD A;  4J1M A;  5EGT A;  3T56 B;  2VXW A;  5CV4 A;  1TWH B;  2RA4 A;  3HOY B;  1JOR A;  3D4D A;  5ISR A;  4BY1 B;  2ICE C;  2PZT A;  3NBI A;  3BVZ A;  2RSN A;  3CU7 A;  2F0T A;  3VA5 A;  1SXT A;  2AUK A;  2JYO A;  4J6H A;  3U9S A;  1G6Z A;  3Q6S A;  3K5L A;  4PMW A;  1Z7T A;  1CZG A;  3FPP A;  1PTO C;  1KDA A;  1A3U A;  4U67 3;  1C4Q A;  1LT6 D;  1S4Z A;  2F0E A;  2RSO A;  4LMQ D;  1IL8 A;  2NTS A;  2A6H C;  3H0G B;  3QO2 A;  2EXZ A;  1RJT A;  1ICW A;  4KY7 A;  1QNU A;  1JCK B;  2LS0 1;  2J7Z A;  4UDU C;  2B2V C;  1G29 1;  5E3F A;  3T16 A;  2QCP X;  5G3L F;  3V2T A;  1BQQ T;  1C8C A;  5CMD A;  4EQN A;  5C4Z A;  1LT3 D;  1V1P A;  2F0F A;  1HUM A;  1SYD A;  4FO2 A;  1NR4 A;  2F3W A;  2NTT A;  2EYJ A;  1S5B D;  2OXP A;  2VB3 X;  3PIO 3;  3FKI B;  1HFG A;  4L8J A;  3ND8 A;  3T53 B;  1D6E C;  3OOC A;  3ITP A;  5D14 A;  2F3V A;  2F0W A;  1IYV A;  4U68 A;  5IGD A;  2Z4I A;  2AQ1 B;  2NWG A;  5C3E B;  5DAU A;  3J7A V;  1AZQ A;  1BNZ A;  1QOH A;  2L11 A;  4I65 A;  4ME5 A;  4C3J B;  4ZUJ A;  3FDT A;  3DWP A;  3I4L A;  2EY5 A;  2XRS D;  5D65 A;  2RDF A;  5C3W A;  2X6G A;  4A3G B;  3CRL C;  2FIN B;  4WFN 3;  3KUP A;  1F9R A;  3RUZ A;  1Q1B A;  2F0P A;  2B2T C;  3HGB A;  2FMC A;  3ND9 A;  2SEB D;  1TWA B;  2OEO A;  3HOW B;  3MC0 B;  2SOB A;  1Q8I A;  2XN9 C;  2C5C A;  4HED A;  4X3K A;  3HOZ B;  2PYK A;  1PTO F;  2E2H B;  2A6H D;  3NTI A;  1KDC A;  3FEW X;  1MGS A;  1C48 A;  5I2X A;  2HQE A;  1YNN D;  3NXW A;  2K1B A;  4KN4 C;  5I6Y A;  1H9J A;  2OF1 A;  2QDB A;  1T5E A;  3QOL A;  2IT1 A;  3MAQ A;  3NSW A;  3EVQ A;  1MSH A;  1F77 A;  3MXN A;  1QE6 A;  1I4H A;  1A3V A;  4DK1 A;  4UAI A;  1BBX C;  3KBX A;  2RDH A;  2K5W A;  4ID6 A;  3TZD A;  5EJW A;  3I4N B;  1B53 A;  2L5T A;  1BF4 A;  1PZI D;  1M4V A;  3L7Z C;  2EY1 A;  1WTQ A;  4MHE A;  5KGU A;  1E2Z A;  3VA7 A;  5FKA C;  1F2Y A;  3SK4 A;  4RWS C;  4KKS A;  2PZU A;  4RKL A;  2A69 D;  3RMH A;  1YNJ D;  1A15 A;  2RKS A;  3FPU B;  3URY A;  5J1Z A;  2K5Q A;  2MHV A;  2Q8T A;  1JB3 A;  4IFD I;  4DF7 A;  4IUP A;  2LMC B;  1KAA A;  1HA6 A;  2ZXR A;  4FNF A;  3NUC A;  1B9M A;  2NUC A;  2JEB I;  1B4O A;  1VDZ A;  1SND A;  3VR4 A;  4ODG A;  1TS2 A;  3NQI A;  3DWA A;  3LWU A;  1LTA D;  3HOU B;  4NW2 A;  2PPB C;  2A68 D;  1STA A;  4A3F B;  3GP7 A;  3D4W A;  3RZD B;  3I90 A;  3J81 E;  2F0M A;  1TQO A;  3IAY A;  2DY8 A;  1WTV A;  5JAV A;  1NSN S;  1STH A;  4PQX A;  5LL6 X;  2NB0 A;  5CC4 A;  4K14 A;  3VYU A;  2RDG A;  2ZXP A;  3X3N A;  1G2S A;  2H4O A;  1ILQ A;  3T51 B;  1JWS D;  2I46 A;  3S2D B;  1EY6 A;  5E4X A;  2F0I A;  1SBB B;  4E6I A;  4K8I A;  3HP3 A;  3PUY A;  2L0C A;  3KBG A;  3GTJ B;  3QWN A;  1I4Q A;  2A6E D;  1PMR A;  1UNS A;  1NCV A;  3BS1 A;  2XNA C;  2L4N A;  2IX3 A;  4C56 C;  3SK8 A;  2M9V A;  2F0U A;  1TY0 A;  3QG1 A;  1BUV T;  3S1Q B;  1WTW A;  4CKE A;  3S2H B;  3CQZ B;  4C2M B;  1Y1V B;  2EYF A;  4BA2 I;  3C3L A;  2B2W C;  3A55 A;  1LT4 D;  4FXD A;  5T1G A;  3D6C A;  1XXG A;  4XTC S;  4EQP A;  3MA2 B;  4ZAI A;  3MXP A;  4EVO A;  1I50 B;  2WAC A;  3I3C A;  1EQT A;  1OXV A;  4FXG C;  3DEP A;  2TMP A;  4G57 A;  4KY5 A;  4ZLT F;  5JJZ A;  3MEH A;  3A56 A;  4C1N K;  2K7V A;  1BOS A;  2EY6 A;  5C5L A;  3AB9 A;  1H9S B;  2A69 C;  2KEE A;  1SEB D;  4OO1 G;  2KVM A;  3OMC A;  4QCL A;  5DM7 3;  4XXE A;  2SNM A;  3U9O A;  2WKD A;  1PDQ A;  4QF4 A;  2KUM A;  2F0K A;  1D5M C;  4KMU C;  5IT9 L;  1AFP A;  1DOK A;  3I72 A;  4RAU C;  2R61 A;  2B8G A;  2F0O A;  5C4X B;  3K5O A;  3KLS X;  1BXT A;  3GO5 A;  5CYU A;  3QOJ A;  5C4J B;  4LJZ C;  4FF1 A;  4DGZ A;  2WP8 J;  1GUW A;  4RGO S;  5A2Q E;  1U4P A;  1KNE A;  4RCN A;  5C3X A;  2IX0 A;  1DD2 A;  3L3O C;  2SDF A;  1D1K A;  1ENC A;  3S15 B;  5FO8 B;  1QB5 D;  1SYF A;  1EYD A;  1SE3 A;  2SNS A;  3K59 A;  3I4M B;  4IQZ A;  2F0L A;  2AQ2 B;  1STY A;  3IFD A;  1MSG A;  1CI3 M;  2WKC A;  1AEX A;  1CM9 A;  1SJH D;  2K01 A;  4DAV A;  4N9T A;  1G91 A;  4A93 B;  1TWG B;  1QCB D;  2EZV A;  1TWC B;  1S5C D;  3HOX B;  1EZ6 A;  1ML0 D;  1SYB A;  1EYA A;  5C0X G;  2PW5 A;  1MD2 D;  2K28 A;  5M5Y B;  1SNP A;  1EY5 A;  2D5D A;  1EEF D;  2KJX A;  2WB1 B;  2BOS A;  4AYB B;  2KEC A;  4HCS A;  4F7X A;  2PZW A;  3S1M B;  3NPP A;  2EE1 A;  4EGV A;  4H44 C;  4WJW A;  2NVX B;  1K8M A;  1JE4 A;  2KHS A;  3SXH A;  1OXT A;  3VYS A;  2JA6 B;  2BE5 C;  4F87 A;  4NP5 A;  3TP8 A;  3OSO A;  5D3D A;  4IFD H;  1PTO B;  4OHJ A;  5M5X B;  1TU2 B;  4BA1 I;  5JEA G;  3N6R A;  3K7A B;  1MI2 A;  1ESR A;  3RZO B;  1RHP A;  4FF4 A;  3EA6 A;  1DOM A;  3PMF A;  4XDX A;  4K8J A;  3P1H A;  4IUV A;  2JA5 B;  1Z6H A;  2V4D A;  5BN3 A;  1B1Z A;  1SMY C;  4IUU A;  2JE6 I;  4K5V A;  4ZKB B;  1MBY A;  4XT3 B;  2Z1C A;  4PV1 C;  4DFA A;  2ZT9 C;  1Z47 A;  4R9W A;  2BCO A;  4KK7 A;  3BDO A;  1HA5 A;  3I73 A;  1JOO A;  5FO9 B;  4HMI A;  4HMJ A;  3WOF A;  1U4R A;  1LTR D;  2O2L D;  2F0V A;  3K6O A;  4OGQ C;  1PZK D;  2DNE A;  3LWE A;  4CJ2 C;  3RD4 A;  3E0J A;  4ILW A;  4IUT A;  4XT1 B;  4RGN A;  4IUR A;  2E76 C;  3P7J A;  2B2W A;  1S5F D;  1RKN A;  2B2Y A;  2CHB D;  1RDP D;  1I4G A;  1AN8 A;  3VR3 A;  5CR3 A;  5IGG A;  3R3O A;  4C1N I;  1JIC A;  3HS0 C;  3HOV B;  5HGT A;  4KD3 A;  3SR1 A;  3GV6 A;  1GJX A;  2Z4H A;  2CW0 D;  1G8Z D;  2B39 A;  5M5W B;  5FO7 B;  1NUC A;  1QIL A;  2WV6 D;  2F0G A;  2F0H A;  1STG A;  2PW7 A;  3I91 A;  5FLX L;  1JOQ A;  2EYP A;  2CQA A;  2E2J B;  1F2L A;  2X69 A;  3R2I A;  1XWE A;  3IL8 A;  3T4A C;  4DN4 M;  4XYO A;  3M7G A;  1QWY A;  1EY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...