2F0PA

Crystal structure of staphylococcal nuclease mutant v66i/v99i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0pA00
4EVOA 2F0QA 5K5PA 2F0IA 2EY6A 3HEJA 4KD3A 1KAAA 2SOBA 1STYA 5M9OA 4N9TA 5KGUA 2KQ3A 4PMBA 2OF1A 5C3WA 4J6HA 4QB4A 5C3XA 1A2TA 1EY4A 3NK9A 5C5LA 1STGA 2F0GA 2NUCA 3PMFA 4QMGA 5HGTA 2F0TA 1ENCA 3DHQA 4KTAA 3NXWA 5I6YA 1KDAA 1SYEA 2RDFA 4HMIA 5CV8A 4R8NA 1A3TA 4KV6A 2PW5A 1SNCA 4HMJA 4N9PA 2F0EA 2F0PA 1EZ6A 1EY6A 5ISRA 3OMCA 4K14A 5DAUA 4J1MA 1RKNA 3R3OA 3D4WA 3D8GA 4K8IA 2EYHA 3SHLA 2EYJA 5CV9A 5KYIA 2WACA 2O4XA 1NUCA 5CC4A 4YIJA 2EYPA 5IGCA 4IZ8A 3C1FA 1STAA 4PNYA 1F2ZA 3T13A 4EQNA 5I6WA 5C4HA 4S3SA 2F0JA 4ME5A 4NMZA 5KEEA 4KY7A 2F0DA 5NUCA 3TMEA 2HQEA 5I9PA 3QOJA 1SNQA 2F3VA 4PMCA 4ZQ3A 3VA5A 1EQVA 2F0WA 3H6MA 4ID6A 4KJNA 4IALA 4K2KA 5E1FA 2F0KA 3TP7A 5C4ZA 3P75A 3E5SA 3OSOA 3OWFA 1JORA 4TRDA 4ZUIA 1KDBA 3QOLA 3V2TA 4DGZA 3S9WA 5KIXA 3BDCA 3MZ5A 1SYDA 5IOCA 5E3FA 5IGFA 1SYBA 2F0NA 3NUCA 2QDBA 4G57A 1EY8A 5KYLA 4H7BA 3ITPA 2EYOA 5JAVA 5DEHA 1STHA 2F0VA 4K5WA 5IGGA 2EYFA 1F2MA 1JOOA 1NSNS 4HTHA 3ERQA 5C5MA 3SR1A 1EYDA 1F2YA 3DMUA 1ENAA 2F0UA 3P1HA 5HURA 5J22A 2F0OA 5EGTA 5C6AA 1STBA 1A3UA 4RKBA 5IIFA 4K8JA 2OEOA 1EYAA 2F0LA 1AEXA 2F0SA 3NP8A 1SNOA 4K5VA 4K5XA 4KD4A 2ENBA 3EJIA 3MXPA 4RKLA 2PZTA 2F0FA 5IGDA 5CR3A 1U9RA 5CV7A 1EY7A 5J1ZA 3TP5A 1A2UA 2OXPA 4WORA 1EYCA 3TP6A 1TR5A 5IODA 2SNSA 2F3WA 4IUNA 1SYFA 4ODGA 1JOKA 5JOBA 4DF7A 4E6IA 3LX0A 3D4DA 3OMGA 4ZUJA 3BDLA 2EY1A 2LKVA 3MVVA 1EZ8A 1SYCA 4KHVA 1KDCA 3NQTA 1SNPA 4MIUA 3SK6A 1TT2A 3EVQA 4KJOA 2EYMA 2EY2A 2EYLA 3TP8A 4F7XA 3SXHA 4NP5A 3HZXA 5F2DA 5J39A 4LAAA 3D6CA 5KRUA 1II3A 4F8MA 4OL7A 1EY5A 2RBMA 2EY5A 4KY6A 5IGEA 4QF4A 2PZUA 5CGKA 2PW7A 2PQEA 1A3VA 1IHZA 4DFAA 4WRDA 4B9XA 4K6DA 1SYGA 2EXZA 2F0HA 5CV4A 5EKKA 3EROA 3SK4A 4B9WA 3MHBA 5CV5A 4K2LA 1STNA 2M00A 3NHHA 4I65A 3MEHA 4NKLA 1JOQA 3T16A 3QB3A 4DU9A 2KHSA 1SNDA 2F0MA 3RUZA 3SK8A 4NDXA 4KY5A 5EKLA 2SNMA 3C1EA 1KABA 5I9OA 1TQOA 5IGBA 1EY0A 4EQPA 1SNMA 2PYKA 2PZWA 2RKSA 4EQOA 1EY9A 3U9OA 5CV6A 3SK5A
chains in the Genus database with same CATH superfamily
4BBRB 4DUZL 2F0IA 2VQFQ 1STYA 1PH6A 1I3QH 1VS0A 4CKEA 3A5UA 1A2TA 3VR3A 2XWBB 3H3VH 1SSOA 4HEDA 2M9VA 3M9BA 1PV4A 4APVA 1K9MC 2MGSA 4J1MA 1Y8PB 1X6OA 2I5MX 4X62L 1HNWL 4OWTB 1VQDA 2ZTDA 3KLWA 4FXDA 4DUYQ 4CDFC 1TWCB 2MHVA 4C3JH 1CSPA 3GTMB 2DY8A 5NUCA 4Y7NH 4R4CA 3E6ZX 5C4ZA 1T9HA 2B63G 1E1OA 3S16B 2WB1E 2R7DA 1U5KA 1S4ZA 3QG1A 3A54A 2BE5C 3L9AX 1OXUA 1BXTA 3NBIA 2UU9L 2Z8LA 1LACA 1Y1WB 2QA4A 3D31A 4H0LC 1YHQA 2SDFA 5C44H 5M3FG 3CRKC 3NQIA 3HOWG 3RZDB 1PZKD 5DM63 1VQKA 1R4PB 3BVZA 3H3VI 2VQFL 2EJFC 4X3KA 4IN3A 2A6HC 1YVCA 2RA4A 3A8IE 5IODA 4IUNA 3A0JA 3KDFA 3MA2B 5JPNC 2CKZB 2V4DA 4OX9Q 4ZUJA 2JJQA 2JSOA 1KDCA 5C0XJ 1SFOB 2EYMA 4YY3Q 1D5XC 1HZBA 3D6CA 4ABNA 2FFKB 4L5TA 1IYJB 1XX8A 1L0XB 3OTOQ 5AJ3Q 2R92H 1A3VA 4DUYL 2L9HA 3W2DA 1WTRA 4LF7L 4DV6Q 3MFGA 1IXRA 1FNWA 4A3IH 3QB3A 3QR8A 3T51B 4NDXA 2A68D 4C3IH 1TQOA 4GS3A 3HOYH 4R8IA 4EVOA 4DAPA 1TWAH 4X65Q 2LXJA 2EQSA 4PMBA 5DNFA 1AE2A 4DR6L 1QWYA 1SAPA 4CDCC 2NUCA 5GAEC 3LGJA 4C2MH 1JE5A 2E2JB 4MTKA 3DM1A 3DEOA 4A93B 1JJGA 5GAGC 2UXDL 1CUKA 1JWUD 3OYYA 3CMAA 2EYJA 2JN4A 1EFID 1RTNA 1N32Q 2O2LD 5C4HA 1LT6D 3HKZB 1IBKQ 4BBSG 1F9QA 2HIVA 3CPWA 3NBHB 5FLXc 4PMCA 4OX9L 2B2TA 1HXYD 1BNZA 2L4NA 2UUCQ 3HOUH 3J7AF 4YY3L 3GTJB 1IL8A 2B29A 4JI2Q 1B3AA 5I4DA 1ILPA 3OTOL 5AJ3L 2OTLA 3I3CA 5H1SE 4GNXA 4LUVA 1KHIA 2J0TD 1ONLA 4DV6L 3S1MH 2EYFA 1J8IA 1BO0A 1L1OA 2NVTH 1ENAA 5HURA 1TS2A 1KTKA 4U68A 4XDXA 5C6AA 5HGQA 1S72A 4A3LH 1Y1VG 1HNZL 2F0SA 4K5VA 2PQAB 4X65L 4MTNA 2NB0A 3JC66 1OXVA 3KOJA 4RHRA 1BCPF 1KXLA 4DK6C 4E6IA 1CSQA 3CKIB 1PTOF 3BDLA 1XTDA 2PNRC 4IPHA 5EPJA 4KKUA 2C5CA 4BS9A 2BCOA 4DNTB 3KF6A 4CKBA 4HIDA 1HPCA 2K6AA 1ZYRC 1N32L 3E3XA 1BVSA 4NXMQ 2XTIA 1DOMA 2F4VQ 4IURA 2OQ0A 5CV4A 1CK1A 4DR7L 5A2QE 5EBDA 1PH5A 2JA7G 2L11A 3GD7A 2QEXA 2VY3A 1XJVA 4HCSA 1N33Q 5I9OA 2N88A 1NR2A 1XMOQ 2B63B 1CKMA 2KQ3A 5IWAL 3F2UA 5C3WA 4J6HA 2E76C 5C3XA 2ZJPA 4LFBQ 1W6KA 2Z6BA 4L8JA 2F0TA 3DHQA 2TMPA 2R7ZH 1TWFB 1NNXA 1VQLA 5ISRA 3OMCA 1CA6A 1LT3D 3OIQA 2UXBL 3VR2A 4X64Q 2CQAA 2PI2E 5M5YH 5I2XA 5M3FB 1Q46A 1PH4A 3HOWB 5CC4A 3E0EA 3R2IA 1GO3E 4O1NA 3PIPA 5LMUQ 1HTPA 2BA1A 4UDUC 1IYUA 4KK7A 2Q8TA 2MPMA 4FF4A 5DM73 4O2DA 3PF5A 1PMRA 1SMYD 4L63B 4LF6L 5JJIA 1EQRA 1KRTA 2QDLA 2LFNA 2LSSA 3S1QH 3VYSA 2DN8A 2QKIC 1ILQA 1KC8C 1EEID 2AWOA 1VQCA 5COYA 4NXML 2JA8H 1NR4A 2F4VL 3PO3H 1H9MA 2KEEA 3TEHB 4G7HC 2HIXA 4A3DH 2AUJD 1V9PA 1WCMG 2K33A 1XWEA 2ZTCA 5T1IA 1J5EL 3AEVA 2BDNA 3FKIG 1K28A 1SMXA 2Z4HA 5EAYA 4HAEA 4K0KL 3PUZA 2CHBD 4YWMA 2I0QA 1EYAA 3K8AA 3H15A 5CR3A 5BN4A 1PTOH 3BZKA 1O7YA 3TDQA 1FR3A 3HOVH 4DF7A 5IYCG 1NTGA 1UEAB 3I4NH 2PO4A 3VR6A 2JEBI 2E74C 4MIUA 2UXCQ 1HZCA 4X64L 5ELFA 3RLOA 3W5OA 3S1RH 5IP7G 1BBUA 2IHFA 3ULJA 3IAYA 3S24A 4U673 1LTBD 1PXUA 1MJEA 3C46A 1HA5A 1STNA 2CCZA 2EXDA 3MEHA 4DAYB 1L0YB 1EOTA 3UE1A 3J7AV 1B44D 1VQ8A 4R4IA 2PYKA 1G91A 4OELB 3FEWX 1OTCA 4A3EH 4LUZA 3QWNA 3SEBA 5M3MB 3FVQA 3C2PA 1WYDA 1YJWA 3S15B 3UI2A 3UDIA 1K8GA 3H09A 4H02A 1S5ED 3MXNA 2CH4W 2JA6G 2K5VA 1R9TH 1GUWA 3GDEA 4IUQA 3LWUA 1DGSA 2ICIA 1E0BA 4X66L 2A68C 2B2UA 2YTYA 1CI3M 5C4XH 2N55A 2WAQE 3NWSA 4XQQA 1SRUA 1NUCA 4HSPA 1H95A 1C0AA 4UP8A 4YWKA 1QILA 2N78A 2RF4A 2YTVA 1RF2D 4C3HH 5LMNW 1EQVA 1PH9A 2MUYA 3U4ZA 1EUJA 5E1FA 1OXXK 5IT9L 1TWCH 3L7ZC 4LFAL 3D6WA 4IUPA 2AQ3B 2ZJQA 1NE3A 1W2BA 3CC7A 1CA5A 2L55A 4RCOA 2B2TC 2NYZD 2KCNA 1VCIA 2R93H 1KNAA 1B9MA 3H3VC 2F0VA 1F2MA 2CQOA 1E22A 2RDHA 2SEBD 4BXXH 3A55A 4OXPA 4X3TA 3KF8A 4GNXC 2JA7B 4BBRG 1MHWC 4O0AA 3GTKH 3GTOH 1Y1WH 2MNAA 4RMFA 5J1ZA 1HNXL 2IX3A 4GLXA 1EEFD 4RCNA 3UDFA 2IX1A 1L1OC 4ZK9B 1SLJA 1VQ5A 3HGBA 5CORA 2ZXPA 1GUGA 4A3FB 1D1KA 2RSOA 2JXMB 1NMGA 2C35B 2VNUD 2DNCA 5JVH3 1BCPD 3CF5A 3CC4A 5J39A 4B3TQ 1HH2P 1PTOD 2O5IC 1IHZA 3KLSX 4QY7A 1SYGA 3MWYW 1SFOH 3AMUA 3S17H 4HJ5A 4K2LA 1RODA 4KI0A 1V43A 1SXTA 1SJED 3OW2A 1N34L 3AB9A 2RKSA 3RLFA 1B7YB 3SK5A 2ZM6L 1KAAA 1VQNA 3BVGA 3BYTB 1D6EC 2I46A 2F0GA 4P72A 1B50A 1KL9A 2LXKA 1B1ZA 3NTHA 3MEFA 4A3JH 1WI5A 4I7AA 1N36Q 1GJXA 4J8QA 2EE1A 2RHSB 1SNCA 4DR5Q 4HMJA 1WCMB 2F0PA 5HY6A 3I91A 2OQKA 3J81L 1UUPA 3CCQA 1D1IA 3R3OA 1IBMQ 1SE4A 2NVQB 2B2YA 4CBVA 4QJFA 2E2JH 1RCVD 2QGQA 4A93H 2BH8A 4IZ8A 4YCUA 4YHHL 2B2WA 2ZT9C 3RNUA 4X3UA 1PYSB 4P71A 3Q23A 1K73C 4MZ9A 4ZQ3A 1RL2A 1VQPA 3K6OA 3E5SA 1KNEA 5GQOA 4A3GH 1I94Q 3EN2A 3S9WA 1MKHA 1PH2A 3S14B 3T1HL 3K5NA 3KLSA 3PIOA 4CGYB 3DEPA 3S2DB 1STHA 4Z9CB 3U4VA 1FNVA 2ZJRA 3I4MB 3A8JE 1ASYA 4B3SL 2NN6I 3Q24A 5JJKA 1UEBA 4IUVA 1Q1EA 1STBA 2JK8A 4RKBA 4ZKCB 2OEOA 1AEXA 3GTGB 2PZTA 4FDBA 1NMFA 4DR1L 3K7UC 3PUVA 5D3DA 2HT1A 1SYFA 1M90C 2N8NA 4XYOA 4B08A 1EIFA 1JQYD 4LF8Q 3OMGA 3M7NA 4OO1G 4KHPL 4KHVA 4DR5L 5FLMH 3T1YL 3CQZB 4ILWA 5K36G 5IT9c 1Y69U 1YITA 2A1AA 2I5LX 2GVBA 3GTLH 1I6HB 1AP0A 3VYTA 4BY1G 4X62Q 1PFMA 5C0XH 1AW7A 4HJ9A 2NVYB 3RUZA 4BWGB 1GVPA 1Q82C 1WTVA 4IPCA 1UE6A 1IKMA 1CQVA 4FNFA 5LHY1 1U4PA 3RZOB 1NAPA 3JAML 5LMNL 3CCSA 1HJPA 4DXGA 2NTTA 2A19A 4KTAA 3G6JB 1VQHA 1ET6A 2A6EC 2UU9Q 3BZDB 1X54A 4N9PA 1TS3A 3NWTA 4DNIA 1QNKA 1I4PA 2KCMA 3KBGA 4POGA 5JEAG 2H4OA 2EYHA 1K3BC 1STEA 3QO2A 3QJYA 3ULPA 1WD1A 1TY2A 2R61A 2O4XA 1C4QA 2F0JA 5KEEA 1FGUA 3F2CA 1TS4A 4LF8L 3PGZA 3CCUA 3VA5A 2B2UC 1QUQA 2R7FA 4X3SA 4MHEA 1Z9FA 3I90A 2N3SA 3M85A 3HOWH 4BY7B 1KAWA 2L12A 3WOEA 4DGZA 1KDBA 3QOLA 4LJZC 5C0XI 1HFNA 1EU4A 4C1NK 2Y0SB 1SE2A 5JAVA 2FMMA 1XPUA 2QF7A 1HZ9A 2E8GA 1SROA 4IPDA 1QJOA 4CJ1B 1D8LA 5ELEA 5GROA 4LF7Q 1FYCA 3FDTA 3D4RA 4RA8A 1WOCA 2NWGA 1GOZA 4IFDI 3GO5A 2F0LA 1LO5D 2YTXA 2AKWB 3DUZA 2VB2X 4JOIA 1X32A 3K0XA 1IW7D 2OXPA 1XNRQ 1I5FA 1ICFB 3GTPH 3NBHA 3LX0A 4DR6Q 4JYAQ 1QE6A 3STBD 1TT2A 1KLGD 2FINB 4KKSA 3UE0A 4JI7Q 1EQQA 1WJJA 1B53A 1LUZA 5IT9E 4LAAA 5KRUA 2EY5A 2F52A 1MSHA 1D5MC 2UXDQ 2E2IH 3I7FA 3MHBA 2QEJC 1TWGB 4GN3B 1E7ZA 1K0RA 3K5OA 4OIJA 4TKOB 4DV3Q 2H5XA 1MSGA 1V8QA 1Q3LA 2SNMA 4RGOS 4JK1C 3U9SA 3I72A 2UUBL 3PUXA 5CMDA 2Z1CA 1BCPC 1UAPA 1Q86C 1B4OA 1ZEQX 4G4KA 3CW2C 2VZAA 2AWNA 2OF1A 1U4LA 5ELOA 1EY4A 1PTOC 2K14A 2WAQB 3NK9A 4BBSH 3OWEB 1O80A 2BDOA 1Q90A 5I6YA 2GA4B 2RDFA 3I73A 5GADC 1E24A 4NPSA 2Q8RE 3SGIA 1X9NA 4AYBG 5KNDA 2PMZB 3C3LA 1BDOA 1XNRL 2EJMA 2VB3X 1VF7A 1HNZQ 4ME5A 4KY7A 3M3YB 3AYHB 2VUMB 3TREA 3T4AC 1LTAD 1A0IA 3J80L 1K8OA 4JYAL 1IZ6A 2B2YC 4JI7L 4JBMA 2E2HB 1MJCA 1VQIA 3J81j 4C1NI 4WJ3M 1B9NA 5A35A 1Y1VH 4JI4L 1VQOA 2NTSA 2B2WC 1BUVT 1VQ4A 2VW9A 2YU9B 3M4OH 3ITPA 4OEMB 4JI1Q 3U58A 1PRTC 2XSCA 4K5WA 3CP0A 3HP3A 1CZWA 4DV3L 3P20A 3PO2H 4UP7A 3P1HA 4BY1B 1CHPD 4DR7Q 1G6PA 5J22A 3VA7A 3J81E 1HTLD 1CKNA 1UWVA 5M3MG 3CCVA 3K80C 3NP8A 4RG1A 3CCEA 2F4IA 4IJHA 1JWMD 2YV5A 5IWAQ 4PG3A 1K3RA 4L5SA 2DGYA 2HDMA 3SK6A 3EQLC 4KJOA 4UAIA 2J4XA 1Q7YC 5JJLA 3DXJC 4OIKA 4F7XA 2KCTA 3HZXA 5IYBG 1ZKOA 1ML0D 2WB1G 2IL8A 2NVXH 4HCEA 5CGKA 1I4GA 4FO2A 4DPGA 1K83H 4DNRB 2P5ZX 4A3IG 1PDQA 1EQTA 2UXBQ 3NTKA 4K6LA 2IY5B 3S1NH 1O7ZA 2F03A 5M5XH 2XNAC 1LTTD 1C8CA 2IX0A 2OTJA 2TSSA 2L1BA 1J6QA 2CW0D 4EQOA 2PZWA 4OGQC 3GTQH 2E5LL 5C3EG 2EY6A 2K5WA 2Q2UA 2WP8J 3KDFB 3RN2A 4LF4L 4A3KH 1BBXC 4LF6Q 2QILA 1KQSA 3K58A 1QVGA 2K01A 2Z9HA 1JR0D 3HOZB 4JI1L 1N9WA 1X65A 2Q2HA 3PMFA 2DNEA 1ENCA 3NXWA 4A3MB 3ERSX 3VDYA 1PYWD 5EQ0A 1V1QA 4C56C 2PW5A 1GUNA 2F0EA 1EZ6A 1OO9B 1ESFA 1J5EQ 1V1PA 4I7ZC 5BN5A 4K8IA 3GP7A 2HCIA 4K0KQ 1FVIA 1DYQA 1HZAA 1Q81C 1RDPD 4PNYA 4QIWB 1F9RA 1WCMH 3SDZA 2KEDA 2MP1A 2XRSD 2WINB 3FKIH 4IUTA 4QGUA 1TWHH 2MO0A 4DAYA 4KJNA 4A3FG 2NVQH 4DK0A 2F0KA 3FP9A 3A7LA 2VL6A 3P75A 5M5WH 1Z47A 2AHOB 3PSIA 1YIJA 1PRTF 3TQYA 2EOTA 3Q0AA 5E3FA 4ZYSA 5FOBB 3JAME 2OWOA 1WTOA 2RVLA 4JVZA 4A3LG 3SR1A 2Z6KA 4GN4B 1H9SA 5IIFA 1EFWA 4K5XA 1ENFA 1H9RA 2MFIA 1Q8IA 3KBXA 2FXQA 4MNOA 3A56A 1I3QB 5BR8Q 4NXNQ 3VYRA 3RMHA 3AQQA 1GHJA 1PH7A 1Z6HA 2EY1A 1SYCA 1LV9A 5C4JB 1G51A 1SNPA 3EVQA 4JOIC 1I4QA 4GNXB 1BR9A 1ESRA 1PLFA 4JCVE 4ME3A 1I4RA 1YBYA 4F87A 2R3ZA 2WIIB 4AYBB 2WKCA 2XIWA 2R6GA 4X66Q 4FF3A 1L2FA 1L1OB 3PV0A 3RR5A 1JJ2A 1IBLL 3IKJA 3J81i 1IW7C 1UNSA 5CV5A 2M00A 3CQZH 3V96A 4Y7NB 2JA6H 4XXEA 1T5EA 4LMQD 3SK8A 4LF5L 1KD1C 1SNMA 1D7QA 3STBC 1TS5A 3M4QA 1FJGL 4EX5A 1CZGA 5IE8A 1E3PA 3CRLC 2JA5G 4LFAQ 4IUUA 5HGTA 3I4MG 2ZTEA 3QIAA 2EVBA 4H44C 3KF6B 3F1ZA 5CV8A 5C44B 2A6ED 5CV9A 1MI2A 1PH3A 3KFUA 5BR8L 3G48A 4NXNL 3C1FA 4TVAB 4HR7B 1G291 2F0DA 4H13C 3HS0C 4DV7Q 1GD7A 1HNXQ 1H9KA 4DR4L 1F2LA 4IO9A 1Y8NB 1I50H 1MIUA 1PYBA 2K32A 3D0FA 4BBRH 4RHSA 3PO3G 4LF9Q 4A3DG 1BOSA 2F0NA 5D65A 2EYOA 3NPPA 1QZGA 2WB1B 3M4YA 2G5DA 1LT4D 1EIHA 1HQRD 3CCRA 1YJNA 1KLUD 5LL6S 3AFQA 1C9OA 1JOOA 2ZXOA 4A3IB 1IL2A 1ZXTA 2CWAA 3PCOB 1PHJA 3HOYB 4RKLA 4GN5A 3URYA 3EJIA 4CDDC 1L0WA 1JT8A 4HJAA 5IGDA 1YZ6A 1N34Q 3L0OA 3X3NA 1Y14B 3GTMH 3BU2A 5C3EB 2E2DC 1S3OA 3SE0A 3FHWA 2ZM6Q 1HR0W 1FL0A 4XTCS 4C2MB 3R93A 2LKVA 2HCCA 3J80E 3S16H 2DUDA 2UUAL 4NP5A 3JAMi 4DR2L 2EPBA 1PFSA 2BA0A 3KK7A 4OL7A 1EY5A 2J7ZA 2F3IA 1XMQL 4DFAA 5JVG3 2AQ1B 2F0HA 3A5ZB 4DV7L 1JOQA 4GOPA 1OXSC 4QQBX 1SNDA 4YHHQ 4KY5A 4A3EG 3RZDH 1LABA 1VF5C 4BY7G 3C1EA 3MXGA 2K1BA 4EQPA 1EY9A 4LF9L 5K5PA 4UHVA 1TWGH 2SOBA 1A15A 2K50A 1UE7A 2Y0SG 1PH8A 2CH4A 5E4XA 4POFA 3G4SA 4P2CB 3S1MB 1KDAA 3T1HQ 4JI5L 3GQBA 1YI2A 2I07B 3HKZE 2NVTB 2RCFA 4B3SQ 4JBWA 2YYZA 2CW0C 1X3PA 2PPBC 4A3CG 3E9IA 5KYIA 1PFNA 1TVXA 4C3HG 1OXTA 4GKJQ 3T13A 3I8ZA 4S3SA 2KA7A 3DM3A 2OT2A 5IP9H 1LM0A 1MD2D 3H91A 4DR1Q 2F0WA 4ID6A 1C48A 1QVCA 4IALA 2B39A 1S40A 4L5RC 1JC7A 1Z7TA 5ELBA 2MJ8A 5FK9C 1X56A 2DY7A 3MZ5A 4DV5Q 4KHPQ 4UP9A 5L37A 2R93G 1QB5D 3T1YQ 3NUCA 5FKAC 2D62A 5DEHA 2L0CA 3O13A 4XQJA 4OO1H 2ID0A 4BA2I 5ELCA 1PRTD 1F2YA 1HUMA 1A62A 1ET9A 1WFQA 4A3BG 2YU9H 3W1BA 4FF1A 4V190 5K36H 2BOSA 2K28A 3TZDA 1H9JA 3D3RA 3TP5A 1R4QB 1A6XA 1EYCA 3TRZA 1BKBA 2WAQG 2SNSA 4BY1H 2A69D 5ELDA 4WJWA 2Z6KC 1XYIA 4HIMA 3CPFA 2HQLA 3IRBA 4PZ6A 5FJ8G 2R7ZB 1P8LA 4A75A 3NQTA 2JA5B 1VQFA 3GTJH 5LMNQ 5F2DA 1AZPA 1D5ZC 3EA6A 3NTIA 1II3A 3NEMA 3BDOA 5BN3A 2RBMA 1QVFA 1RJTA 3UDGA 5M5YB 3BS1A 2B8FA 1RTOA 5D3IB 4GKJL 2EJGC 3K0YA 2VUMG 3GV3A 1U4RA 3NHHA 4NKLA 1F77A 3KF8B 3WWVA 2F0MA 2LMCB 2NN6G 4DV5L 3S1QB 2OCEA 5GAHC 3HEJA 1Q1BA 3I56A 5KGUA 3J80i 3BJUA 3MAQA 2JA8B 5EPKA 3PO3B 4FYDA 1STGA 1UE1A 4A3DB 1XNQQ 4DA2A 2QW7A 1S5BD 2IHEA 4ZRZA 1A3TA 2RHQB 3G7LA 4KV6A 1A63A 1BCPB 3X3MA 1HRJA 2RDGA 2AQ2B 5IGCA 2WKDA 3MXUA 4YIJA 1VQJA 1PTOB 1PFBA 5I6WA 4QUFA 1I4XA 3TMEA 3HOVB 1SNQA 1WTQA 4P75A 3H6MA 3I4NB 2K5DA 2HDLA 2IWHA 4DV4Q 3BVMA 4TRDA 1RIPA 2CWPA 1DM0B 3LWEA 2B63H 2EIFA 4GKKQ 2KUMA 1JB3A 1SYBA 3S1RB 2QDBA 3K57A 3KUPA 4H7BA 1HR0L 1ASZA 4Q5VA 2LY7A 1HHVA 3K7AB 1TWFH 4X6AH 1SE3A 4WJ4A 5C5MA 2CFMA 4KN4C 4OWXB 1U4MA 1A8VA 4AQYQ 5M3FH 4OHJA 5DLQE 5FLXL 4A3EB 4PZ7A 4JG2A 2L5TA 1U9RA 4ALPA 1EY7A 3B6YA 3BZCA 2FHTA 1VMCA 3HOZG 1YEZA 2UUBQ 3CCJA 1B3QA 1CT1D 2XRQD 5KNCA 1XNQL 4A3MG 1ICWA 4HJ7A 1Q8KA 4DK3C 3TSSA 5IYDG 5EBCA 1R9TB 4HIOA 2EY2A 1VQ7A 3H0GG 4DAVA 4B3ML 4F8MA 3MFYA 4LFCL 5C4XB 5CYUA 4EQ5A 5C0XG 4WRDA 3J81c 4K6DA 5C4JH 2X6LA 3SK4A 4C3HB 3G6EA 4DV4L 3PUWA 3HRZC 5CV6A 4KLKA 2BH2A 4KD3A 4KKTA 3HFZB 4GKKL 4IFDG 4GOPC 2ICEC 4JI4Q 3CAMA 2IT1A 2K75A 2KENA 3TBIB 2E75C 5JEAJ 2R93B 4XIGS 5LL6X 4JI6L 1GUTA 2XGTA 3VYUA 1VQEA 3R8BA 1LLRD 1SJHD 3HOXG 4QL5A 4DV2L 4AQYL 4DV0Q 3GTKB 3GTOB 3PQIA 4A3BB 1CTMA 4JBKA 1E2VA 4NB3A 1RD9D 1YHAA 5KNBA 3ULLA 1WVLA 1V1OA 5AFWA 5EJWA 4NMZA 2PQAA 2JEAI 2ATWA 1CFMA 4R4QA 3W1GA 4KN7C 3CHBD 5D14A 2NZHA 5JPMC 1XTCD 3N6RA 2MQHA 3V2TA 5M3MH 1WTWA 3J7YW 4RFBA 4ZAIA 3S15H 1Y8OB 2MO1A 1PZJD 4DXFA 1QG7A 1EY8A 4XYQA 5KYLA 1GUOA 3NENA 4C3JG 1I6VC 3DWQA 3S17B 3TN2A 4DK1A 1C7YA 1AFPA 3ERQA 2K7VA 4WFN3 1JWSD 1SBBB 1TIID 3A8KE 5IYBH 1WD0A 3PUYA 1SNOA 4WORA 4Q0FA 5FO7B 1QUQB 4IFDJ 2E5LQ 2WFWA 2XWJB 5CBEE 2KJXA 4LF4Q 1LYLA 3LNNA 2Q2TA 3S2HB 1DZ1A 4A3JB 5FO8B 5C44G 1DXMA 1GXDC 1HFGA 3JAMc 5EPLA 1HCZA 1QNUA 3Q6SA 4DV0L 4R1JA 1DCZA 5C3EH 1B70B 4KMUC 1YNNC 3CMEA 1X55A 2D0OA 2ALYB 1LTGD 1GUSA 2H1EA 4XT3B 1SEBD 2A69C 3T16A 3WDNA 3FMCA 2JP1A 4PZ8A 1GM5A 4AH6A 2JA7H 2K5QA 2NZ1D 4A3GB 4HJ8A 4R4TA 1EIGA 1E2ZA 2R92G 3DWPA 2K04A 4P73A 3FPUB 4LW1A 3W3AA 4BA1I 2Q8IB 1FNUA 4A3FH 1FD7D 4JC0A 2I5HA 1EWHA 4IQZA 4C3IG 3E9HA 4K14A 5DAUA 3HOYG 3CCLA 1X3EA 1TY0A 4FF2A 1YNJD 1T5XD 1S5DD 2WACA 3HG9A 1DONA 3HKSA 2FMCA 2NBFA 3M4PA 1GKHA 1F2ZA 3ND8A 4CJ0B 4UPAA 4NW2A 3F8TA 2Z0SA 3RLNA 1TKWB 4IOCA 3U50C 3TP7A 1MGSA 3OSOA 4DR3Q 5I2YA 1AE3A 4LNQA 1LTSD 5IOCA 2X69A 3ZJYC 3F2DA 1NJIC 1K0SA 2K5HA 2CVRA 2FJ2A 3H0GB 3GTLB 1SDFA 1RHPA 3PO2G 4LUOA 4R9WA 4JW0A 1AH9A 1IBLQ 4J15A 2F0UA 3HOUG 2LS01 4G7ZC 3FRPB 4FXGC 1IBKL 4OONA 5CV7A 4LF5Q 1A2UA 1EIYB 1TR5A 4F88A 1VQAA 2UUCL 4ODGA 1LTRD 1FJGQ 4MN3A 2NZOA 3OW7A 4JI2L 2A73B 1WTXA 1EZ8A 4CDEC 2EDGA 1G6ZA 5IYCH 2KOLA 4XQNA 2EYLA 2B2VA 1NBWA 3SXHA 1LTID 4QCLA 1VQBA 4HN7A 2QCPX 2GVAA 4DV1Q 3S14H 1NCVA 3EBEA 4M8AA 5ELNA 3K5LA 3HOXB 2EXZA 2JA5H 1VQMA 3S2DH 1QCBD 3I4MH 5IP7H 2EZVA 4IOAA 4I65A 2JQOA 1CKNB 2D2CC 4DU9A 2KHSA 1N8RC 2B8GA 1S5FD 1SN8A 4DR3L 3IFTA 4A3KG 3GTGH 1MBYA 1TU2B 4DR4Q 2C9OA 3J80c 5FLXE 5IY0A 3MC0B 1E1TA 3BG3A 4PQXA 4JI8Q 2ES2A 3UDXA 4QB4A 3EFXD 3A7AB 3NSWA 2GN5A 5G3LF 3PIP3 4JI0Q 4ULLA 4C3JB 1EL0A 1DJRD 2RQXA 3Q22A 1VQGA 3P7JA 3D4WA 2DJGC 1P16A 3CCMA 1I6HH 1G2TA 1N33L 1F9PA 3AFPA 4YCWA 2VQEQ 5I9PA 2NVYH 2R7ZG 3GTPB 4FVMA 4RWSC 2Y0SE 1XMOL 3GV6A 4AIMA 5EKIA 3ZYYX 2IJ0A 1JB7A 4LFBL 4DV1L 3I4OA 2UUAQ 3OIPA 2PCFB 3RZOH 4HIKA 4DR2Q 1SE8A 3VR5A 2E2IB 1AN8A 1XMQQ 3J7ZC 1V1PB 2K03A 1NSNS 4FP5D 3K59A 1J9OA 1YHBA 3WOFA 2KCCA 2K5NA 1A3UA 3SVMA 1WTPA 4KD4A 4GLAC 2KBNA 3K81C 3K7AH 4QUCA 5LMUL 2M2LA 3H94A 4HSVA 4JI8L 2JA8G 1BF4A 4FXKC 2AMCB 4M1UB 1YJ9A 1JOKA 4BBSB 3IL8A 3I55A 3M7GA 1F9SA 3TZUA 1X3GA 3RD4A 2R92B 1M4VA 3MVVA 4JI0L 1DOKA 5FO9B 1LTLA 1EWCA 4BY7H 2XVSA 3TP8A 2VXWA 3E0JA 4OWWB 3I70A 3T56B 1DOLA 4JI5Q 3ONAB 4KY6A 4L6TB 5IGEA 1G2SA 4QF4A 4Y52H 2PZUA 2PW7A 2PQEA 3VR4A 4C3IB 4B9XA 3TS0A 5EKKA 2VQEL 2D9UA 2HHHQ 1H9SB 3HOVG 1TWAB 3I4NG 3K5MA 2KECA 1W3SA 2KHIA 4B3RQ 1EY0A 3CU7A 4JPBW 1EWIA 1Y1VB 4A3CH 3R2TA 2HUGA 2ASBA 3I4LA 1XPOA 1LT5D 3CXCA 2X6GA 1K8AC 4RH6A 2DJFC 3M4OB 4A4IA 4LWCA 5C5LA 1M8AA 4EGVA 2UXCL 2PMZE 4YWLA 1NY4A 3EIVA 1E2WA 4N8FA 1JCKB 4N8X1 3PO2B 3CD6A 1JJCB 5CBAE 2BE5D 1RKNA 3J7A5 3SHLA 1IKLA 4ZLTF 4RAUC 3HOUB 1STAA 4EQNA 2AUKA 2RSNA 3QOJA 2F3VA 1EOVA 2WV6D 4LK1C 4A3BH 1O7IA 3G71A 2PNHA 2A6HD 4ZUIA 5KIXA 3CC2A 1CKOA 1SR3A 2KHJA 4O42A 2A74C 5C4XG 3N52A 2NVXB 3A74A 3KLRA 1AZQA 1YNJC 2D0PA 1K83B 2K4KA 2HHHL 1I4HA 3FPPA 1FGBD 3S1NB 5IGGA 3PF4A 5FJ8H 3RN5A 2L15A 3KYHC 4HTHA 5M5XB 3DMUA 2O5JC 4IJLA 4B3RL 2Z4IA 1JE4A 1PH1A 3OHXC 3GTQB 1IYVA 4TQUS 4RGNA 1S5CD 2KVMA 1GHKA 3TP6A 4CHTB 4A3KB 1XXGA 3L2PA 2F3WA 3M3YH 2K05A 2VUMH 4IPGA 3MXNB 4JI3Q 3IFDA 1TXYA 1XPRA 2PI2A 4PV1C 4DAMA 1M1KC 1KIXA 2NN6H 2E2HH 4BXXG 1EYGA 2RCNA 1PZID 1X3FA 3BYYB 4RGTA 1Y1WG 1YNND 4XT1B 2V1CC 3S2HH 1U0LA 3EROA 1JICA 2B2VC 2Q2IA 1VQ9A 3L3OC 1QOHA 3FKIB 1B8AA 1TWHB 1BBWA 5EKLA 1KABA 5M5WB 4CJ2C 1HUNA 2F0QA 2HD3A 4TSSA 3KJOA 4N9TA 1UE5A 4V0BA 3MTSA 2JE6I 2G9HD 1PVOA 1HQMC 3AU7A 2IPKD 4QMGA 2G9DA 1SYEA 4HMIA 1HR0Q 4R8NA 1VDZA 4B3TL 4QIWE 1YNXA 1VMPA 1EY6A 4DN4M 2JA9A 5J3BA 3DLLA 3OOCA 1QZHA 3D8GA 3Q8DA 2IW3A 4R4OA 5G3LD 4GOPB 1DD2A 5IP9G 2EYPA 4PMWA 5JEAH 1PA6A 2JYOA 1EU3A 4OO1I 4JI3L 2A8VA 2HQEA 5M9OA 3V05A 3PIO3 4A3JG 1SMYC 4CKCA 1HA6A 4K2KA 4RGMA 5E4WC 3OWFA 1JORA 1O78A 2B3GA 4P74A 4G7OC 4JV5Q 3BDCA 4DUZQ 4JBJA 1CQFA 1SYDA 2F1MA 5IGFA 4A93G 4UY8C 3HOZH 1N36L 2A5HA 4G57A 3NE5B 4GLVB 4B3MQ 1W6JA 5A2QL 2ZXRA 4A76A 4LFCQ 4A3MH 1IBML 4L5QA 5IYDH 2JA6B 1EYDA 4DKAC 3NELA 2F0OA 5E7NA 5EGTA 1ZYRD 3H0GH 3T53B 4A3GG 2K52A 4K8JA 1Q12A 3HKZG 3TS2A 4GZYC 2ENBA 3MXPA 2F0FA 1HNWQ 1D2BA 1X3QA 5TSSA 2XN9C 5JOBA 1I94L 3D4DA 3DWAA 1KRSA 1B2TA 4AYBE 3ICEA 1K8MA 2N49A 4YCVA 3KJPA 1G8ZD 3F2BA 1CM9A 4JI6Q 1JMCA 5JJZA 4IFDH 1O7LA 3ND9A 4ZKBB 4DV2Q 3OPOA 3ER0A 4B9WA 1WTHA 3I2ZA 1VQ6A 2VS1A 4KHZA 1PRTB 1BQQT 4ZCKA 1CHQD 5IGBA 3HOXH 5FLMG 2D5DA 4JV5L 1I50B 5T1GA 3U9OA
chains in the Genus database with same CATH topology
4BBRB 2F0IA 1STYA 4CKEA 1A2TA 3VR3A 2XWBB 1SSOA 4HEDA 2M9VA 2MGSA 4J1MA 1Y8PB 4FXDA 1TWCB 2MHVA 3GTMB 2DY8A 5NUCA 3E6ZX 5C4ZA 3S16B 1S4ZA 3QG1A 3A54A 2BE5C 3L9AX 1OXUA 1BXTA 3NBIA 2Z8LA 1LACA 1Y1WB 3D31A 4H0LC 2SDFA 3CRKC 3NQIA 3RZDB 1PZKD 5DM63 1R4PB 3BVZA 2EJFC 4X3KA 4IN3A 2A6HC 3A8IE 2RA4A 5IODA 4IUNA 3MA2B 5JPNC 2V4DA 4ZUJA 2JSOA 1KDCA 5C0XJ 1SFOB 2EYMA 1D5XC 4ABNA 3D6CA 2FFKB 1XX8A 1L0XB 1A3VA 2L9HA 3W2DA 1WTRA 3MFGA 1FNWA 3QB3A 3T51B 4NDXA 2A68D 1TQOA 4R8IA 4EVOA 4DAPA 4PMBA 5DNFA 1QWYA 1SAPA 2NUCA 2E2JB 3DM1A 3DEOA 4A93B 1JWUD 2EYJA 1EFID 1RTNA 2O2LD 5C4HA 1LT6D 3HKZB 1F9QA 4PMCA 2B2TA 1HXYD 1BNZA 2L4NA 3J7AF 3GTJB 1IL8A 1B3AA 5I4DA 1ILPA 3I3CA 2J0TD 1ONLA 2EYFA 1J8IA 1BO0A 1ENAA 5HURA 1TS2A 1KTKA 4U68A 4XDXA 5C6AA 2F0SA 4K5VA 2NB0A 1OXVA 4RHRA 1BCPF 4E6IA 3CKIB 1PTOF 3BDLA 2PNRC 5EPJA 4KKUA 2C5CA 4DNTB 2BCOA 4BS9A 4CKBA 1HPCA 2K6AA 1ZYRC 1DOMA 4IURA 5CV4A 1CK1A 5A2QE 5EBDA 2L11A 3GD7A 4HCSA 5I9OA 2N88A 1NR2A 2B63B 2KQ3A 3F2UA 5C3WA 4J6HA 2E76C 5C3XA 1W6KA 4L8JA 2F0TA 3DHQA 2TMPA 1TWFB 5ISRA 3OMCA 1CA6A 1LT3D 3OIQA 3VR2A 2CQAA 5I2XA 5M3FB 3HOWB 5CC4A 3R2IA 4O1NA 1HTPA 2BA1A 4UDUC 1IYUA 4KK7A 2Q8TA 2MPMA 4FF4A 5DM73 1PMRA 1SMYD 4L63B 2LFNA 3VYSA 2DN8A 2QKIC 1ILQA 1EEID 2AWOA 5COYA 1NR4A 1H9MA 2KEEA 4G7HC 2AUJD 2K33A 1XWEA 5T1IA 2BDNA 2Z4HA 4HAEA 3PUZA 2CHBD 1EYAA 5CR3A 5BN4A 1PTOH 1O7YA 3TDQA 1FR3A 4DF7A 1UEAB 2PO4A 3VR6A 2JEBI 2E74C 4MIUA 5ELFA 3IAYA 4U673 1LTBD 1PXUA 3C46A 1HA5A 1STNA 3MEHA 1L0YB 1EOTA 3J7AV 1B44D 2PYKA 1G91A 3FEWX 3QWNA 3SEBA 5M3MB 3FVQA 3C2PA 3S15B 3UI2A 3H09A 1S5ED 3MXNA 1GUWA 4IUQA 3LWUA 2ICIA 1E0BA 2A68C 2B2UA 1CI3M 2N55A 3NWSA 4XQQA 1NUCA 4HSPA 1QILA 1RF2D 1EQVA 2MUYA 5E1FA 1OXXK 5IT9L 3L7ZC 3D6WA 4IUPA 2AQ3B 1CA5A 2L55A 4RCOA 2B2TC 2NYZD 2KCNA 1VCIA 1KNAA 1B9MA 3H3VC 2F0VA 1F2MA 2RDHA 2SEBD 3A55A 4X3TA 3KF8A 2JA7B 5J1ZA 2IX3A 1EEFD 4RCNA 2IX1A 4ZK9B 3HGBA 5CORA 2ZXPA 1GUGA 4A3FB 1D1KA 2RSOA 2JXMB 2VNUD 2DNCA 5JVH3 1BCPD 5J39A 1PTOD 2O5IC 1IHZA 3KLSX 1SYGA 3MWYW 3AMUA 4K2LA 1RODA 4KI0A 1V43A 1SXTA 1SJED 3AB9A 2RKSA 3RLFA 3SK5A 1KAAA 3BVGA 3BYTB 1D6EC 2I46A 2F0GA 1B50A 1B1ZA 3NTHA 1GJXA 4J8QA 2EE1A 1SNCA 4HMJA 1WCMB 2F0PA 3J81L 3I91A 1UUPA 1D1IA 3R3OA 1SE4A 2NVQB 2B2YA 4CBVA 1RCVD 4IZ8A 2B2WA 2ZT9C 4X3UA 3Q23A 4ZQ3A 3K6OA 3E5SA 1KNEA 3S9WA 3S14B 3K5NA 3KLSA 4CGYB 3DEPA 3S2DB 1STHA 4Z9CB 1FNVA 3I4MB 3A8JE 2NN6I 3Q24A 4IUVA 1Q1EA 1STBA 4RKBA 4ZKCB 2OEOA 1AEXA 3GTGB 2PZTA 3PUVA 5D3DA 1SYFA 4XYOA 4B08A 1JQYD 3OMGA 3M7NA 4OO1G 4KHVA 3CQZB 4ILWA 5K36G 1Y69U 1I6HB 1AP0A 3VYTA 1PFMA 5C0XH 1AW7A 2NVYB 3RUZA 4BWGB 1WTVA 1IKMA 1CQVA 4FNFA 5LHY1 1U4PA 3RZOB 1NAPA 3JAML 4DXGA 2NTTA 4KTAA 3G6JB 1ET6A 2A6EC 3BZDB 4N9PA 1TS3A 3NWTA 1QNKA 1I4PA 3KBGA 5JEAG 2H4OA 2EYHA 1STEA 3QO2A 3QJYA 1WD1A 1TY2A 2R61A 2O4XA 1C4QA 2F0JA 5KEEA 1TS4A 3VA5A 2B2UC 4X3SA 4MHEA 3I90A 3M85A 4BY7B 2L12A 3WOEA 4DGZA 1KDBA 3QOLA 4LJZC 5C0XI 1HFNA 1EU4A 4C1NK 2Y0SB 1SE2A 5JAVA 2FMMA 2QF7A 1QJOA 4CJ1B 5ELEA 1FYCA 3FDTA 3D4RA 4RA8A 2NWGA 1GOZA 4IFDI 3GO5A 2F0LA 1LO5D 3DUZA 2VB2X 1X32A 1IW7D 2OXPA 3NBHA 3LX0A 1QE6A 1TT2A 1KLGD 2FINB 4KKSA 1B53A 5IT9E 4LAAA 5KRUA 2EY5A 1MSHA 1D5MC 3MHBA 2QEJC 1TWGB 3K5OA 4OIJA 4TKOB 1MSGA 1V8QA 1Q3LA 2SNMA 4RGOS 4JK1C 3U9SA 3I72A 3PUXA 5CMDA 2Z1CA 1BCPC 1UAPA 1B4OA 1ZEQX 4G4KA 2AWNA 2OF1A 1U4LA 1EY4A 1PTOC 2WAQB 3NK9A 3OWEB 1O80A 2BDOA 1Q90A 5I6YA 2GA4B 2RDFA 3I73A 2Q8RE 5KNDA 2PMZB 3C3LA 1BDOA 2EJMA 2VB3X 1VF7A 4ME5A 4KY7A 3M3YB 2VUMB 3T4AC 1LTAD 3J80L 1K8OA 2B2YC 2E2HB 4C1NI 1B9NA 5A35A 2NTSA 2B2WC 1BUVT 2YU9B 3ITPA 1PRTC 2XSCA 4K5WA 3HP3A 1CZWA 3P20A 4BY1B 3P1HA 1CHPD 5J22A 3VA7A 3J81E 1HTLD 3NP8A 2F4IA 1JWMD 2HDMA 3SK6A 3EQLC 4KJOA 4UAIA 2J4XA 3DXJC 4OIKA 4F7XA 3HZXA 1ZKOA 1ML0D 2IL8A 4HCEA 5CGKA 1I4GA 4FO2A 4DNRB 1PDQA 1EQTA 3NTKA 4K6LA 1O7ZA 2F03A 2XNAC 1LTTD 1C8CA 2IX0A 2TSSA 2L1BA 2CW0D 4EQOA 2PZWA 4OGQC 2EY6A 2K5WA 2WP8J 1BBXC 2QILA 3K58A 2K01A 1JR0D 3HOZB 3PMFA 2DNEA 1ENCA 3NXWA 4A3MB 1PYWD 5EQ0A 4C56C 2PW5A 1GUNA 2F0EA 1EZ6A 1OO9B 1ESFA 1V1PA 4I7ZC 5BN5A 4K8IA 3GP7A 2HCIA 1DYQA 1RDPD 4PNYA 4QIWB 1F9RA 3SDZA 2KEDA 2MP1A 2XRSD 2WINB 4IUTA 4DAYA 4KJNA 4DK0A 2F0KA 3A7LA 3P75A 1Z47A 1PRTF 2EOTA 3Q0AA 5E3FA 4ZYSA 5FOBB 3JAME 1WTOA 2RVLA 3SR1A 1H9SA 5IIFA 4K5XA 1ENFA 1H9RA 3KBXA 1Q8IA 3A56A 1I3QB 3VYRA 3RMHA 1GHJA 1Z6HA 2EY1A 1SYCA 1LV9A 5C4JB 1SNPA 3EVQA 1I4QA 1BR9A 1ESRA 1PLFA 1I4RA 4F87A 2R3ZA 2WIIB 4AYBB 2WKCA 2XIWA 2R6GA 4FF3A 3PV0A 3IKJA 1IW7C 1UNSA 5CV5A 2M00A 3V96A 4Y7NB 4XXEA 1T5EA 4LMQD 3SK8A 1SNMA 1TS5A 1CZGA 3CRLC 4IUUA 5HGTA 3QIAA 2EVBA 4H44C 5CV8A 5C44B 2A6ED 5CV9A 1MI2A 3C1FA 4HR7B 1G291 2F0DA 4H13C 3HS0C 1H9KA 1F2LA 1Y8NB 2K32A 4RHSA 1BOSA 2F0NA 5D65A 2EYOA 3NPPA 2WB1B 3M4YA 1LT4D 1EIHA 1HQRD 1KLUD 5LL6S 1JOOA 2ZXOA 4A3IB 1ZXTA 3HOYB 4RKLA 3URYA 3EJIA 5IGDA 3X3NA 5C3EB 2E2DC 3SE0A 4XTCS 4C2MB 3R93A 2LKVA 2HCCA 3J80E 4NP5A 2EPBA 2BA0A 3KK7A 4OL7A 1EY5A 2J7ZA 4DFAA 5JVG3 2AQ1B 2F0HA 1JOQA 1OXSC 1SNDA 4KY5A 1LABA 1VF5C 3C1EA 3MXGA 2K1BA 4EQPA 1EY9A 5K5PA 2SOBA 1A15A 5E4XA 4P2CB 3S1MB 1KDAA 3GQBA 2I07B 2NVTB 4JBWA 2YYZA 2CW0C 1X3PA 2PPBC 5KYIA 1PFNA 1TVXA 4C3HG 1OXTA 3T13A 3I8ZA 4S3SA 2KA7A 2OT2A 1MD2D 3H91A 2F0WA 4ID6A 1C48A 4IALA 2B39A 1JC7A 1Z7TA 5ELBA 2MJ8A 5FK9C 2DY7A 3MZ5A 1QB5D 3NUCA 5FKAC 2D62A 5DEHA 2L0CA 3O13A 4XQJA 4OO1H 2ID0A 4BA2I 5ELCA 1PRTD 1F2YA 1HUMA 1ET9A 4FF1A 4V190 5K36H 2BOSA 2K28A 3TZDA 1H9JA 3D3RA 3TP5A 1R4QB 1A6XA 1EYCA 2SNSA 2A69D 5ELDA 4WJWA 1XYIA 2R7ZB 3NQTA 2JA5B 5F2DA 1AZPA 1D5ZC 3EA6A 3NTIA 1II3A 3BDOA 5BN3A 2RBMA 1RJTA 5M5YB 3BS1A 2B8FA 1RTOA 5D3IB 2EJGC 3K0YA 3GV3A 1U4RA 3NHHA 4NKLA 1F77A 2F0MA 2LMCB 2NN6G 3S1QB 3HEJA 1Q1BA 5KGUA 3MAQA 2JA8B 5EPKA 3PO3B 4FYDA 1STGA 4A3DB 4DA2A 1S5BD 4ZRZA 1A3TA 3G7LA 4KV6A 1BCPB 3X3MA 1HRJA 2RDGA 2AQ2B 5IGCA 2WKDA 3MXUA 4YIJA 1PTOB 1PFBA 5I6WA 4QUFA 1I4XA 3TMEA 3HOVB 1SNQA 1WTQA 3I4NB 3H6MA 2K5DA 2HDLA 2IWHA 3BVMA 4TRDA 1DM0B 3LWEA 2KUMA 1JB3A 1SYBA 3S1RB 2QDBA 3K57A 3KUPA 4H7BA 4Q5VA 2LY7A 1HHVA 3K7AB 1SE3A 5C5MA 4KN4C 1U4MA 4OHJA 5FLXL 4A3EB 2L5TA 1U9RA 1EY7A 2FHTA 1VMCA 1CT1D 5KNCA 2XRQD 1ICWA 3TSSA 5EBCA 1R9TB 2EY2A 4DAVA 4F8MA 3MFYA 5C4XB 5CYUA 5C0XG 4WRDA 4K6DA 2X6LA 3SK4A 4C3HB 3PUWA 3HRZC 5CV6A 4KD3A 4KKTA 4IFDG 2ICEC 2IT1A 3TBIB 2E75C 5JEAJ 2R93B 4XIGS 5LL6X 1GUTA 3VYUA 3R8BA 1LLRD 1SJHD 3GTKB 3GTOB 4A3BB 1CTMA 1E2VA 5KNBA 1RD9D 1WVLA 1V1OA 5AFWA 5EJWA 4NMZA 2JEAI 1CFMA 4KN7C 3CHBD 5D14A 5JPMC 1XTCD 3N6RA 3V2TA 1WTWA 3J7YW 4RFBA 4ZAIA 1Y8OB 4DXFA 1PZJD 1QG7A 1EY8A 4XYQA 5KYLA 1GUOA 4C3JG 1I6VC 3DWQA 3S17B 3TN2A 4DK1A 1AFPA 3ERQA 2K7VA 4WFN3 1JWSD 1SBBB 1TIID 3A8KE 1WD0A 3PUYA 1SNOA 4WORA 4Q0FA 5FO7B 4IFDJ 2XWJB 5CBEE 2KJXA 3LNNA 3S2HB 1DZ1A 4A3JB 5FO8B 1DXMA 1GXDC 1HFGA 5EPLA 1HCZA 1QNUA 3Q6SA 1DCZA 4KMUC 1YNNC 1LTGD 1GUSA 2H1EA 4XT3B 1SEBD 2A69C 3T16A 3WDNA 3FMCA 2JP1A 2K5QA 2NZ1D 4A3GB 1EIGA 1E2ZA 3DWPA 2K04A 3FPUB 3W3AA 4BA1I 2Q8IB 1FNUA 1FD7D 1EWHA 4IQZA 4C3IG 4K14A 5DAUA 1TY0A 4FF2A 1YNJD 1T5XD 1S5DD 2WACA 3HG9A 1DONA 2FMCA 2NBFA 1F2ZA 3ND8A 4CJ0B 4NW2A 1TKWB 3TP7A 1MGSA 3OSOA 5I2YA 1LTSD 5IOCA 2X69A 2CVRA 2FJ2A 3H0GB 3GTLB 1SDFA 1RHPA 4R9WA 2F0UA 2LS01 4G7ZC 3FRPB 4FXGC 5CV7A 1A2UA 1TR5A 4F88A 4ODGA 1LTRD 4MN3A 3OW7A 2A73B 1WTXA 1EZ8A 2EDGA 1G6ZA 2KOLA 4XQNA 2EYLA 2B2VA 3SXHA 1LTID 4QCLA 4HN7A 2QCPX 1NCVA 4M8AA 3K5LA 3HOXB 2EXZA 1QCBD 2EZVA 4I65A 2D2CC 4DU9A 2KHSA 2B8GA 1S5FD 3IFTA 1MBYA 1TU2B 2C9OA 5FLXE 3MC0B 3BG3A 4PQXA 4QB4A 3EFXD 3A7AB 3NSWA 5G3LF 3PIP3 4ULLA 4C3JB 1EL0A 1DJRD 2RQXA 3Q22A 3P7JA 3D4WA 1G2TA 1F9PA 5I9PA 3GTPB 4FVMA 4RWSC 3GV6A 5EKIA 3ZYYX 2IJ0A 3OIPA 2PCFB 3VR5A 2E2IB 1AN8A 1V1PB 2K03A 1NSNS 4FP5D 3K59A 1J9OA 3WOFA 2KCCA 1A3UA 3SVMA 1WTPA 4KD4A 4QUCA 2M2LA 3H94A 4HSVA 1BF4A 4FXKC 4M1UB 1JOKA 4BBSB 3IL8A 3M7GA 1F9SA 3TZUA 3RD4A 2R92B 1M4VA 3MVVA 1DOKA 5FO9B 1EWCA 2XVSA 3TP8A 2VXWA 3E0JA 3I70A 3T56B 1DOLA 3ONAB 4KY6A 4L6TB 5IGEA 1G2SA 4QF4A 2PZUA 2PW7A 2PQEA 3VR4A 4C3IB 4B9XA 5EKKA 2D9UA 1H9SB 1TWAB 3K5MA 2KECA 1EY0A 3CU7A 1Y1VB 3R2TA 2HUGA 3I4LA 1LT5D 2X6GA 4RH6A 3M4OB 5C5LA 1M8AA 4EGVA 1E2WA 1JCKB 3PO2B 5CBAE 2BE5D 1RKNA 3SHLA 1IKLA 4ZLTF 4RAUC 3HOUB 1STAA 4EQNA 2AUKA 2RSNA 3QOJA 2F3VA 2WV6D 4LK1C 2A6HD 4ZUIA 5KIXA 4O42A 2A74C 3N52A 2NVXB 1AZQA 3KLRA 1YNJC 1K83B 1I4HA 3FPPA 1FGBD 3S1NB 5IGGA 4HTHA 5M5XB 3DMUA 2O5JC 2Z4IA 1JE4A 3OHXC 3GTQB 1IYVA 4TQUS 4RGNA 1S5CD 2KVMA 1GHKA 3TP6A 4CHTB 4A3KB 1XXGA 2F3WA 2K05A 3IFDA 4PV1C 2NN6H 1PZID 3BYYB 4RGTA 1YNND 4XT1B 3EROA 1JICA 2B2VC 3L3OC 1QOHA 3FKIB 1TWHB 5EKLA 1KABA 5M5WB 4CJ2C 1HUNA 2F0QA 4TSSA 4N9TA 4V0BA 3MTSA 2JE6I 2G9HD 1HQMC 3AU7A 2IPKD 4QMGA 2G9DA 1SYEA 4HMIA 4R8NA 1VDZA 1VMPA 1EY6A 4DN4M 3OOCA 3D8GA 2IW3A 5G3LD 1DD2A 2EYPA 4PMWA 5JEAH 2JYOA 1EU3A 4OO1I 2HQEA 5M9OA 3V05A 3PIO3 1SMYC 4CKCA 1HA6A 4K2KA 4RGMA 5E4WC 3OWFA 1JORA 1O78A 4G7OC 3BDCA 1CQFA 1SYDA 2F1MA 5IGFA 2A5HA 4G57A 3NE5B 1W6JA 5A2QL 2ZXRA 2JA6B 1EYDA 2F0OA 5EGTA 1ZYRD 3T53B 4K8JA 1Q12A 4GZYC 2ENBA 3MXPA 2F0FA 1D2BA 1X3QA 5TSSA 2XN9C 5JOBA 3D4DA 3DWAA 1B2TA 1K8MA 1G8ZD 1CM9A 5JJZA 4IFDH 1O7LA 3ND9A 4ZKBB 3OPOA 4B9WA 4KHZA 1PRTB 1BQQT 1CHQD 5IGBA 2D5DA 1I50B 5T1GA 3U9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVO A;  2F0Q A;  5K5P A;  2F0I A;  2EY6 A;  3HEJ A;  4KD3 A;  1KAA A;  2SOB A;  1STY A;  5M9O A;  4N9T A;  5KGU A;  2KQ3 A;  4PMB A;  2OF1 A;  5C3W A;  4J6H A;  4QB4 A;  5C3X A;  1A2T A;  1EY4 A;  3NK9 A;  5C5L A;  1STG A;  2F0G A;  2NUC A;  3PMF A;  4QMG A;  5HGT A;  2F0T A;  1ENC A;  3DHQ A;  4KTA A;  3NXW A;  5I6Y A;  1KDA A;  1SYE A;  2RDF A;  4HMI A;  5CV8 A;  4R8N A;  1A3T A;  4KV6 A;  2PW5 A;  1SNC A;  4HMJ A;  4N9P A;  2F0E A;  2F0P A;  1EZ6 A;  1EY6 A;  5ISR A;  3OMC A;  4K14 A;  5DAU A;  4J1M A;  1RKN A;  3R3O A;  3D4W A;  3D8G A;  4K8I A;  2EYH A;  3SHL A;  2EYJ A;  5CV9 A;  5KYI A;  2WAC A;  2O4X A;  1NUC A;  5CC4 A;  4YIJ A;  2EYP A;  5IGC A;  4IZ8 A;  3C1F A;  1STA A;  4PNY A;  1F2Z A;  3T13 A;  4EQN A;  5I6W A;  5C4H A;  4S3S A;  2F0J A;  4ME5 A;  4NMZ A;  5KEE A;  4KY7 A;  2F0D A;  5NUC A;  3TME A;  2HQE A;  5I9P A;  3QOJ A;  1SNQ A;  2F3V A;  4PMC A;  4ZQ3 A;  3VA5 A;  1EQV A;  2F0W A;  3H6M A;  4ID6 A;  4KJN A;  4IAL A;  4K2K A;  5E1F A;  2F0K A;  3TP7 A;  5C4Z A;  3P75 A;  3E5S A;  3OSO A;  3OWF A;  1JOR A;  4TRD A;  4ZUI A;  1KDB A;  3QOL A;  3V2T A;  4DGZ A;  3S9W A;  5KIX A;  3BDC A;  3MZ5 A;  1SYD A;  5IOC A;  5E3F A;  5IGF A;  1SYB A;  2F0N A;  3NUC A;  2QDB A;  4G57 A;  1EY8 A;  5KYL A;  4H7B A;  3ITP A;  2EYO A;  5JAV A;  5DEH A;  1STH A;  2F0V A;  4K5W A;  5IGG A;  2EYF A;  1F2M A;  1JOO A;  1NSN S;  4HTH A;  3ERQ A;  5C5M A;  3SR1 A;  1EYD A;  1F2Y A;  3DMU A;  1ENA A;  2F0U A;  3P1H A;  5HUR A;  5J22 A;  2F0O A;  5EGT A;  5C6A A;  1STB A;  1A3U A;  4RKB A;  5IIF A;  4K8J A;  2OEO A;  1EYA A;  2F0L A;  1AEX A;  2F0S A;  3NP8 A;  1SNO A;  4K5V A;  4K5X A;  4KD4 A;  2ENB A;  3EJI A;  3MXP A;  4RKL A;  2PZT A;  2F0F A;  5IGD A;  5CR3 A;  1U9R A;  5CV7 A;  1EY7 A;  5J1Z A;  3TP5 A;  1A2U A;  2OXP A;  4WOR A;  1EYC A;  3TP6 A;  1TR5 A;  5IOD A;  2SNS A;  2F3W A;  4IUN A;  1SYF A;  4ODG A;  1JOK A;  5JOB A;  4DF7 A;  4E6I A;  3LX0 A;  3D4D A;  3OMG A;  4ZUJ A;  3BDL A;  2EY1 A;  2LKV A;  3MVV A;  1EZ8 A;  1SYC A;  4KHV A;  1KDC A;  3NQT A;  1SNP A;  4MIU A;  3SK6 A;  1TT2 A;  3EVQ A;  4KJO A;  2EYM A;  2EY2 A;  2EYL A;  3TP8 A;  4F7X A;  3SXH A;  4NP5 A;  3HZX A;  5F2D A;  5J39 A;  4LAA A;  3D6C A;  5KRU A;  1II3 A;  4F8M A;  4OL7 A;  1EY5 A;  2RBM A;  2EY5 A;  4KY6 A;  5IGE A;  4QF4 A;  2PZU A;  5CGK A;  2PW7 A;  2PQE A;  1A3V A;  1IHZ A;  4DFA A;  4WRD A;  4B9X A;  4K6D A;  1SYG A;  2EXZ A;  2F0H A;  5CV4 A;  5EKK A;  3ERO A;  3SK4 A;  4B9W A;  3MHB A;  5CV5 A;  4K2L A;  1STN A;  2M00 A;  3NHH A;  4I65 A;  3MEH A;  4NKL A;  1JOQ A;  3T16 A;  3QB3 A;  4DU9 A;  2KHS A;  1SND A;  2F0M A;  3RUZ A;  3SK8 A;  4NDX A;  4KY5 A;  5EKL A;  2SNM A;  3C1E A;  1KAB A;  5I9O A;  1TQO A;  5IGB A;  1EY0 A;  4EQP A;  1SNM A;  2PYK A;  2PZW A;  2RKS A;  4EQO A;  1EY9 A;  3U9O A;  5CV6 A;  3SK5 A; 
#chains in the Genus database with same CATH topology
 4BBR B;  4DUZ L;  2F0I A;  2VQF Q;  1STY A;  1PH6 A;  1I3Q H;  1VS0 A;  4CKE A;  3A5U A;  1A2T A;  3VR3 A;  2XWB B;  3H3V H;  1SSO A;  4HED A;  2M9V A;  3M9B A;  1PV4 A;  4APV A;  1K9M C;  2MGS A;  4J1M A;  1Y8P B;  1X6O A;  2I5M X;  4X62 L;  1HNW L;  4OWT B;  1VQD A;  2ZTD A;  3KLW A;  4FXD A;  4DUY Q;  4CDF C;  1TWC B;  2MHV A;  4C3J H;  1CSP A;  3GTM B;  2DY8 A;  5NUC A;  4Y7N H;  4R4C A;  3E6Z X;  5C4Z A;  1T9H A;  2B63 G;  1E1O A;  3S16 B;  2WB1 E;  2R7D A;  1U5K A;  1S4Z A;  3QG1 A;  3A54 A;  2BE5 C;  3L9A X;  1OXU A;  1BXT A;  3NBI A;  2UU9 L;  2Z8L A;  1LAC A;  1Y1W B;  2QA4 A;  3D31 A;  4H0L C;  1YHQ A;  2SDF A;  5C44 H;  5M3F G;  3CRK C;  3NQI A;  3HOW G;  3RZD B;  1PZK D;  5DM6 3;  1VQK A;  1R4P B;  3BVZ A;  3H3V I;  2VQF L;  2EJF C;  4X3K A;  4IN3 A;  2A6H C;  1YVC A;  2RA4 A;  3A8I E;  5IOD A;  4IUN A;  3A0J A;  3KDF A;  3MA2 B;  5JPN C;  2CKZ B;  2V4D A;  4OX9 Q;  4ZUJ A;  2JJQ A;  2JSO A;  1KDC A;  5C0X J;  1SFO B;  2EYM A;  4YY3 Q;  1D5X C;  1HZB A;  3D6C A;  4ABN A;  2FFK B;  4L5T A;  1IYJ B;  1XX8 A;  1L0X B;  3OTO Q;  5AJ3 Q;  2R92 H;  1A3V A;  4DUY L;  2L9H A;  3W2D A;  1WTR A;  4LF7 L;  4DV6 Q;  3MFG A;  1IXR A;  1FNW A;  4A3I H;  3QB3 A;  3QR8 A;  3T51 B;  4NDX A;  2A68 D;  4C3I H;  1TQO A;  4GS3 A;  3HOY H;  4R8I A;  4EVO A;  4DAP A;  1TWA H;  4X65 Q;  2LXJ A;  2EQS A;  4PMB A;  5DNF A;  1AE2 A;  4DR6 L;  1QWY A;  1SAP A;  4CDC C;  2NUC A;  5GAE C;  3LGJ A;  4C2M H;  1JE5 A;  2E2J B;  4MTK A;  3DM1 A;  3DEO A;  4A93 B;  1JJG A;  5GAG C;  2UXD L;  1CUK A;  1JWU D;  3OYY A;  3CMA A;  2EYJ A;  2JN4 A;  1EFI D;  1RTN A;  1N32 Q;  2O2L D;  5C4H A;  1LT6 D;  3HKZ B;  1IBK Q;  4BBS G;  1F9Q A;  2HIV A;  3CPW A;  3NBH B;  5FLX c;  4PMC A;  4OX9 L;  2B2T A;  1HXY D;  1BNZ A;  2L4N A;  2UUC Q;  3HOU H;  3J7A F;  4YY3 L;  3GTJ B;  1IL8 A;  2B29 A;  4JI2 Q;  1B3A A;  5I4D A;  1ILP A;  3OTO L;  5AJ3 L;  2OTL A;  3I3C A;  5H1S E;  4GNX A;  4LUV A;  1KHI A;  2J0T D;  1ONL A;  4DV6 L;  3S1M H;  2EYF A;  1J8I A;  1BO0 A;  1L1O A;  2NVT H;  1ENA A;  5HUR A;  1TS2 A;  1KTK A;  4U68 A;  4XDX A;  5C6A A;  5HGQ A;  1S72 A;  4A3L H;  1Y1V G;  1HNZ L;  2F0S A;  4K5V A;  2PQA B;  4X65 L;  4MTN A;  2NB0 A;  3JC6 6;  1OXV A;  3KOJ A;  4RHR A;  1BCP F;  1KXL A;  4DK6 C;  4E6I A;  1CSQ A;  3CKI B;  1PTO F;  3BDL A;  1XTD A;  2PNR C;  4IPH A;  5EPJ A;  4KKU A;  2C5C A;  4BS9 A;  2BCO A;  4DNT B;  3KF6 A;  4CKB A;  4HID A;  1HPC A;  2K6A A;  1ZYR C;  1N32 L;  3E3X A;  1BVS A;  4NXM Q;  2XTI A;  1DOM A;  2F4V Q;  4IUR A;  2OQ0 A;  5CV4 A;  1CK1 A;  4DR7 L;  5A2Q E;  5EBD A;  1PH5 A;  2JA7 G;  2L11 A;  3GD7 A;  2QEX A;  2VY3 A;  1XJV A;  4HCS A;  1N33 Q;  5I9O A;  2N88 A;  1NR2 A;  1XMO Q;  2B63 B;  1CKM A;  2KQ3 A;  5IWA L;  3F2U A;  5C3W A;  4J6H A;  2E76 C;  5C3X A;  2ZJP A;  4LFB Q;  1W6K A;  2Z6B A;  4L8J A;  2F0T A;  3DHQ A;  2TMP A;  2R7Z H;  1TWF B;  1NNX A;  1VQL A;  5ISR A;  3OMC A;  1CA6 A;  1LT3 D;  3OIQ A;  2UXB L;  3VR2 A;  4X64 Q;  2CQA A;  2PI2 E;  5M5Y H;  5I2X A;  5M3F B;  1Q46 A;  1PH4 A;  3HOW B;  5CC4 A;  3E0E A;  3R2I A;  1GO3 E;  4O1N A;  3PIP A;  5LMU Q;  1HTP A;  2BA1 A;  4UDU C;  1IYU A;  4KK7 A;  2Q8T A;  2MPM A;  4FF4 A;  5DM7 3;  4O2D A;  3PF5 A;  1PMR A;  1SMY D;  4L63 B;  4LF6 L;  5JJI A;  1EQR A;  1KRT A;  2QDL A;  2LFN A;  2LSS A;  3S1Q H;  3VYS A;  2DN8 A;  2QKI C;  1ILQ A;  1KC8 C;  1EEI D;  2AWO A;  1VQC A;  5COY A;  4NXM L;  2JA8 H;  1NR4 A;  2F4V L;  3PO3 H;  1H9M A;  2KEE A;  3TEH B;  4G7H C;  2HIX A;  4A3D H;  2AUJ D;  1V9P A;  1WCM G;  2K33 A;  1XWE A;  2ZTC A;  5T1I A;  1J5E L;  3AEV A;  2BDN A;  3FKI G;  1K28 A;  1SMX A;  2Z4H A;  5EAY A;  4HAE A;  4K0K L;  3PUZ A;  2CHB D;  4YWM A;  2I0Q A;  1EYA A;  3K8A A;  3H15 A;  5CR3 A;  5BN4 A;  1PTO H;  3BZK A;  1O7Y A;  3TDQ A;  1FR3 A;  3HOV H;  4DF7 A;  5IYC G;  1NTG A;  1UEA B;  3I4N H;  2PO4 A;  3VR6 A;  2JEB I;  2E74 C;  4MIU A;  2UXC Q;  1HZC A;  4X64 L;  5ELF A;  3RLO A;  3W5O A;  3S1R H;  5IP7 G;  1BBU A;  2IHF A;  3ULJ A;  3IAY A;  3S24 A;  4U67 3;  1LTB D;  1PXU A;  1MJE A;  3C46 A;  1HA5 A;  1STN A;  2CCZ A;  2EXD A;  3MEH A;  4DAY B;  1L0Y B;  1EOT A;  3UE1 A;  3J7A V;  1B44 D;  1VQ8 A;  4R4I A;  2PYK A;  1G91 A;  4OEL B;  3FEW X;  1OTC A;  4A3E H;  4LUZ A;  3QWN A;  3SEB A;  5M3M B;  3FVQ A;  3C2P A;  1WYD A;  1YJW A;  3S15 B;  3UI2 A;  3UDI A;  1K8G A;  3H09 A;  4H02 A;  1S5E D;  3MXN A;  2CH4 W;  2JA6 G;  2K5V A;  1R9T H;  1GUW A;  3GDE A;  4IUQ A;  3LWU A;  1DGS A;  2ICI A;  1E0B A;  4X66 L;  2A68 C;  2B2U A;  2YTY A;  1CI3 M;  5C4X H;  2N55 A;  2WAQ E;  3NWS A;  4XQQ A;  1SRU A;  1NUC A;  4HSP A;  1H95 A;  1C0A A;  4UP8 A;  4YWK A;  1QIL A;  2N78 A;  2RF4 A;  2YTV A;  1RF2 D;  4C3H H;  5LMN W;  1EQV A;  1PH9 A;  2MUY A;  3U4Z A;  1EUJ A;  5E1F A;  1OXX K;  5IT9 L;  1TWC H;  3L7Z C;  4LFA L;  3D6W A;  4IUP A;  2AQ3 B;  2ZJQ A;  1NE3 A;  1W2B A;  3CC7 A;  1CA5 A;  2L55 A;  4RCO A;  2B2T C;  2NYZ D;  2KCN A;  1VCI A;  2R93 H;  1KNA A;  1B9M A;  3H3V C;  2F0V A;  1F2M A;  2CQO A;  1E22 A;  2RDH A;  2SEB D;  4BXX H;  3A55 A;  4OXP A;  4X3T A;  3KF8 A;  4GNX C;  2JA7 B;  4BBR G;  1MHW C;  4O0A A;  3GTK H;  3GTO H;  1Y1W H;  2MNA A;  4RMF A;  5J1Z A;  1HNX L;  2IX3 A;  4GLX A;  1EEF D;  4RCN A;  3UDF A;  2IX1 A;  1L1O C;  4ZK9 B;  1SLJ A;  1VQ5 A;  3HGB A;  5COR A;  2ZXP A;  1GUG A;  4A3F B;  1D1K A;  2RSO A;  2JXM B;  1NMG A;  2C35 B;  2VNU D;  2DNC A;  5JVH 3;  1BCP D;  3CF5 A;  3CC4 A;  5J39 A;  4B3T Q;  1HH2 P;  1PTO D;  2O5I C;  1IHZ A;  3KLS X;  4QY7 A;  1SYG A;  3MWY W;  1SFO H;  3AMU A;  3S17 H;  4HJ5 A;  4K2L A;  1ROD A;  4KI0 A;  1V43 A;  1SXT A;  1SJE D;  3OW2 A;  1N34 L;  3AB9 A;  2RKS A;  3RLF A;  1B7Y B;  3SK5 A;  2ZM6 L;  1KAA A;  1VQN A;  3BVG A;  3BYT B;  1D6E C;  2I46 A;  2F0G A;  4P72 A;  1B50 A;  1KL9 A;  2LXK A;  1B1Z A;  3NTH A;  3MEF A;  4A3J H;  1WI5 A;  4I7A A;  1N36 Q;  1GJX A;  4J8Q A;  2EE1 A;  2RHS B;  1SNC A;  4DR5 Q;  4HMJ A;  1WCM B;  2F0P A;  5HY6 A;  3I91 A;  2OQK A;  3J81 L;  1UUP A;  3CCQ A;  1D1I A;  3R3O A;  1IBM Q;  1SE4 A;  2NVQ B;  2B2Y A;  4CBV A;  4QJF A;  2E2J H;  1RCV D;  2QGQ A;  4A93 H;  2BH8 A;  4IZ8 A;  4YCU A;  4YHH L;  2B2W A;  2ZT9 C;  3RNU A;  4X3U A;  1PYS B;  4P71 A;  3Q23 A;  1K73 C;  4MZ9 A;  4ZQ3 A;  1RL2 A;  1VQP A;  3K6O A;  3E5S A;  1KNE A;  5GQO A;  4A3G H;  1I94 Q;  3EN2 A;  3S9W A;  1MKH A;  1PH2 A;  3S14 B;  3T1H L;  3K5N A;  3KLS A;  3PIO A;  4CGY B;  3DEP A;  3S2D B;  1STH A;  4Z9C B;  3U4V A;  1FNV A;  2ZJR A;  3I4M B;  3A8J E;  1ASY A;  4B3S L;  2NN6 I;  3Q24 A;  5JJK A;  1UEB A;  4IUV A;  1Q1E A;  1STB A;  2JK8 A;  4RKB A;  4ZKC B;  2OEO A;  1AEX A;  3GTG B;  2PZT A;  4FDB A;  1NMF A;  4DR1 L;  3K7U C;  3PUV A;  5D3D A;  2HT1 A;  1SYF A;  1M90 C;  2N8N A;  4XYO A;  4B08 A;  1EIF A;  1JQY D;  4LF8 Q;  3OMG A;  3M7N A;  4OO1 G;  4KHP L;  4KHV A;  4DR5 L;  5FLM H;  3T1Y L;  3CQZ B;  4ILW A;  5K36 G;  5IT9 c;  1Y69 U;  1YIT A;  2A1A A;  2I5L X;  2GVB A;  3GTL H;  1I6H B;  1AP0 A;  3VYT A;  4BY1 G;  4X62 Q;  1PFM A;  5C0X H;  1AW7 A;  4HJ9 A;  2NVY B;  3RUZ A;  4BWG B;  1GVP A;  1Q82 C;  1WTV A;  4IPC A;  1UE6 A;  1IKM A;  1CQV A;  4FNF A;  5LHY 1;  1U4P A;  3RZO B;  1NAP A;  3JAM L;  5LMN L;  3CCS A;  1HJP A;  4DXG A;  2NTT A;  2A19 A;  4KTA A;  3G6J B;  1VQH A;  1ET6 A;  2A6E C;  2UU9 Q;  3BZD B;  1X54 A;  4N9P A;  1TS3 A;  3NWT A;  4DNI A;  1QNK A;  1I4P A;  2KCM A;  3KBG A;  4POG A;  5JEA G;  2H4O A;  2EYH A;  1K3B C;  1STE A;  3QO2 A;  3QJY A;  3ULP A;  1WD1 A;  1TY2 A;  2R61 A;  2O4X A;  1C4Q A;  2F0J A;  5KEE A;  1FGU A;  3F2C A;  1TS4 A;  4LF8 L;  3PGZ A;  3CCU A;  3VA5 A;  2B2U C;  1QUQ A;  2R7F A;  4X3S A;  4MHE A;  1Z9F A;  3I90 A;  2N3S A;  3M85 A;  3HOW H;  4BY7 B;  1KAW A;  2L12 A;  3WOE A;  4DGZ A;  1KDB A;  3QOL A;  4LJZ C;  5C0X I;  1HFN A;  1EU4 A;  4C1N K;  2Y0S B;  1SE2 A;  5JAV A;  2FMM A;  1XPU A;  2QF7 A;  1HZ9 A;  2E8G A;  1SRO A;  4IPD A;  1QJO A;  4CJ1 B;  1D8L A;  5ELE A;  5GRO A;  4LF7 Q;  1FYC A;  3FDT A;  3D4R A;  4RA8 A;  1WOC A;  2NWG A;  1GOZ A;  4IFD I;  3GO5 A;  2F0L A;  1LO5 D;  2YTX A;  2AKW B;  3DUZ A;  2VB2 X;  4JOI A;  1X32 A;  3K0X A;  1IW7 D;  2OXP A;  1XNR Q;  1I5F A;  1ICF B;  3GTP H;  3NBH A;  3LX0 A;  4DR6 Q;  4JYA Q;  1QE6 A;  3STB D;  1TT2 A;  1KLG D;  2FIN B;  4KKS A;  3UE0 A;  4JI7 Q;  1EQQ A;  1WJJ A;  1B53 A;  1LUZ A;  5IT9 E;  4LAA A;  5KRU A;  2EY5 A;  2F52 A;  1MSH A;  1D5M C;  2UXD Q;  2E2I H;  3I7F A;  3MHB A;  2QEJ C;  1TWG B;  4GN3 B;  1E7Z A;  1K0R A;  3K5O A;  4OIJ A;  4TKO B;  4DV3 Q;  2H5X A;  1MSG A;  1V8Q A;  1Q3L A;  2SNM A;  4RGO S;  4JK1 C;  3U9S A;  3I72 A;  2UUB L;  3PUX A;  5CMD A;  2Z1C A;  1BCP C;  1UAP A;  1Q86 C;  1B4O A;  1ZEQ X;  4G4K A;  3CW2 C;  2VZA A;  2AWN A;  2OF1 A;  1U4L A;  5ELO A;  1EY4 A;  1PTO C;  2K14 A;  2WAQ B;  3NK9 A;  4BBS H;  3OWE B;  1O80 A;  2BDO A;  1Q90 A;  5I6Y A;  2GA4 B;  2RDF A;  3I73 A;  5GAD C;  1E24 A;  4NPS A;  2Q8R E;  3SGI A;  1X9N A;  4AYB G;  5KND A;  2PMZ B;  3C3L A;  1BDO A;  1XNR L;  2EJM A;  2VB3 X;  1VF7 A;  1HNZ Q;  4ME5 A;  4KY7 A;  3M3Y B;  3AYH B;  2VUM B;  3TRE A;  3T4A C;  1LTA D;  1A0I A;  3J80 L;  1K8O A;  4JYA L;  1IZ6 A;  2B2Y C;  4JI7 L;  4JBM A;  2E2H B;  1MJC A;  1VQI A;  3J81 j;  4C1N I;  4WJ3 M;  1B9N A;  5A35 A;  1Y1V H;  4JI4 L;  1VQO A;  2NTS A;  2B2W C;  1BUV T;  1VQ4 A;  2VW9 A;  2YU9 B;  3M4O H;  3ITP A;  4OEM B;  4JI1 Q;  3U58 A;  1PRT C;  2XSC A;  4K5W A;  3CP0 A;  3HP3 A;  1CZW A;  4DV3 L;  3P20 A;  3PO2 H;  4UP7 A;  3P1H A;  4BY1 B;  1CHP D;  4DR7 Q;  1G6P A;  5J22 A;  3VA7 A;  3J81 E;  1HTL D;  1CKN A;  1UWV A;  5M3M G;  3CCV A;  3K80 C;  3NP8 A;  4RG1 A;  3CCE A;  2F4I A;  4IJH A;  1JWM D;  2YV5 A;  5IWA Q;  4PG3 A;  1K3R A;  4L5S A;  2DGY A;  2HDM A;  3SK6 A;  3EQL C;  4KJO A;  4UAI A;  2J4X A;  1Q7Y C;  5JJL A;  3DXJ C;  4OIK A;  4F7X A;  2KCT A;  3HZX A;  5IYB G;  1ZKO A;  1ML0 D;  2WB1 G;  2IL8 A;  2NVX H;  4HCE A;  5CGK A;  1I4G A;  4FO2 A;  4DPG A;  1K83 H;  4DNR B;  2P5Z X;  4A3I G;  1PDQ A;  1EQT A;  2UXB Q;  3NTK A;  4K6L A;  2IY5 B;  3S1N H;  1O7Z A;  2F03 A;  5M5X H;  2XNA C;  1LTT D;  1C8C A;  2IX0 A;  2OTJ A;  2TSS A;  2L1B A;  1J6Q A;  2CW0 D;  4EQO A;  2PZW A;  4OGQ C;  3GTQ H;  2E5L L;  5C3E G;  2EY6 A;  2K5W A;  2Q2U A;  2WP8 J;  3KDF B;  3RN2 A;  4LF4 L;  4A3K H;  1BBX C;  4LF6 Q;  2QIL A;  1KQS A;  3K58 A;  1QVG A;  2K01 A;  2Z9H A;  1JR0 D;  3HOZ B;  4JI1 L;  1N9W A;  1X65 A;  2Q2H A;  3PMF A;  2DNE A;  1ENC A;  3NXW A;  4A3M B;  3ERS X;  3VDY A;  1PYW D;  5EQ0 A;  1V1Q A;  4C56 C;  2PW5 A;  1GUN A;  2F0E A;  1EZ6 A;  1OO9 B;  1ESF A;  1J5E Q;  1V1P A;  4I7Z C;  5BN5 A;  4K8I A;  3GP7 A;  2HCI A;  4K0K Q;  1FVI A;  1DYQ A;  1HZA A;  1Q81 C;  1RDP D;  4PNY A;  4QIW B;  1F9R A;  1WCM H;  3SDZ A;  2KED A;  2MP1 A;  2XRS D;  2WIN B;  3FKI H;  4IUT A;  4QGU A;  1TWH H;  2MO0 A;  4DAY A;  4KJN A;  4A3F G;  2NVQ H;  4DK0 A;  2F0K A;  3FP9 A;  3A7L A;  2VL6 A;  3P75 A;  5M5W H;  1Z47 A;  2AHO B;  3PSI A;  1YIJ A;  1PRT F;  3TQY A;  2EOT A;  3Q0A A;  5E3F A;  4ZYS A;  5FOB B;  3JAM E;  2OWO A;  1WTO A;  2RVL A;  4JVZ A;  4A3L G;  3SR1 A;  2Z6K A;  4GN4 B;  1H9S A;  5IIF A;  1EFW A;  4K5X A;  1ENF A;  1H9R A;  2MFI A;  1Q8I A;  3KBX A;  2FXQ A;  4MNO A;  3A56 A;  1I3Q B;  5BR8 Q;  4NXN Q;  3VYR A;  3RMH A;  3AQQ A;  1GHJ A;  1PH7 A;  1Z6H A;  2EY1 A;  1SYC A;  1LV9 A;  5C4J B;  1G51 A;  1SNP A;  3EVQ A;  4JOI C;  1I4Q A;  4GNX B;  1BR9 A;  1ESR A;  1PLF A;  4JCV E;  4ME3 A;  1I4R A;  1YBY A;  4F87 A;  2R3Z A;  2WII B;  4AYB B;  2WKC A;  2XIW A;  2R6G A;  4X66 Q;  4FF3 A;  1L2F A;  1L1O B;  3PV0 A;  3RR5 A;  1JJ2 A;  1IBL L;  3IKJ A;  3J81 i;  1IW7 C;  1UNS A;  5CV5 A;  2M00 A;  3CQZ H;  3V96 A;  4Y7N B;  2JA6 H;  4XXE A;  1T5E A;  4LMQ D;  3SK8 A;  4LF5 L;  1KD1 C;  1SNM A;  1D7Q A;  3STB C;  1TS5 A;  3M4Q A;  1FJG L;  4EX5 A;  1CZG A;  5IE8 A;  1E3P A;  3CRL C;  2JA5 G;  4LFA Q;  4IUU A;  5HGT A;  3I4M G;  2ZTE A;  3QIA A;  2EVB A;  4H44 C;  3KF6 B;  3F1Z A;  5CV8 A;  5C44 B;  2A6E D;  5CV9 A;  1MI2 A;  1PH3 A;  3KFU A;  5BR8 L;  3G48 A;  4NXN L;  3C1F A;  4TVA B;  4HR7 B;  1G29 1;  2F0D A;  4H13 C;  3HS0 C;  4DV7 Q;  1GD7 A;  1HNX Q;  1H9K A;  4DR4 L;  1F2L A;  4IO9 A;  1Y8N B;  1I50 H;  1MIU A;  1PYB A;  2K32 A;  3D0F A;  4BBR H;  4RHS A;  3PO3 G;  4LF9 Q;  4A3D G;  1BOS A;  2F0N A;  5D65 A;  2EYO A;  3NPP A;  1QZG A;  2WB1 B;  3M4Y A;  2G5D A;  1LT4 D;  1EIH A;  1HQR D;  3CCR A;  1YJN A;  1KLU D;  5LL6 S;  3AFQ A;  1C9O A;  1JOO A;  2ZXO A;  4A3I B;  1IL2 A;  1ZXT A;  2CWA A;  3PCO B;  1PHJ A;  3HOY B;  4RKL A;  4GN5 A;  3URY A;  3EJI A;  4CDD C;  1L0W A;  1JT8 A;  4HJA A;  5IGD A;  1YZ6 A;  1N34 Q;  3L0O A;  3X3N A;  1Y14 B;  3GTM H;  3BU2 A;  5C3E B;  2E2D C;  1S3O A;  3SE0 A;  3FHW A;  2ZM6 Q;  1HR0 W;  1FL0 A;  4XTC S;  4C2M B;  3R93 A;  2LKV A;  2HCC A;  3J80 E;  3S16 H;  2DUD A;  2UUA L;  4NP5 A;  3JAM i;  4DR2 L;  2EPB A;  1PFS A;  2BA0 A;  3KK7 A;  4OL7 A;  1EY5 A;  2J7Z A;  2F3I A;  1XMQ L;  4DFA A;  5JVG 3;  2AQ1 B;  2F0H A;  3A5Z B;  4DV7 L;  1JOQ A;  4GOP A;  1OXS C;  4QQB X;  1SND A;  4YHH Q;  4KY5 A;  4A3E G;  3RZD H;  1LAB A;  1VF5 C;  4BY7 G;  3C1E A;  3MXG A;  2K1B A;  4EQP A;  1EY9 A;  4LF9 L;  5K5P A;  4UHV A;  1TWG H;  2SOB A;  1A15 A;  2K50 A;  1UE7 A;  2Y0S G;  1PH8 A;  2CH4 A;  5E4X A;  4POF A;  3G4S A;  4P2C B;  3S1M B;  1KDA A;  3T1H Q;  4JI5 L;  3GQB A;  1YI2 A;  2I07 B;  3HKZ E;  2NVT B;  2RCF A;  4B3S Q;  4JBW A;  2YYZ A;  2CW0 C;  1X3P A;  2PPB C;  4A3C G;  3E9I A;  5KYI A;  1PFN A;  1TVX A;  4C3H G;  1OXT A;  4GKJ Q;  3T13 A;  3I8Z A;  4S3S A;  2KA7 A;  3DM3 A;  2OT2 A;  5IP9 H;  1LM0 A;  1MD2 D;  3H91 A;  4DR1 Q;  2F0W A;  4ID6 A;  1C48 A;  1QVC A;  4IAL A;  2B39 A;  1S40 A;  4L5R C;  1JC7 A;  1Z7T A;  5ELB A;  2MJ8 A;  5FK9 C;  1X56 A;  2DY7 A;  3MZ5 A;  4DV5 Q;  4KHP Q;  4UP9 A;  5L37 A;  2R93 G;  1QB5 D;  3T1Y Q;  3NUC A;  5FKA C;  2D62 A;  5DEH A;  2L0C A;  3O13 A;  4XQJ A;  4OO1 H;  2ID0 A;  4BA2 I;  5ELC A;  1PRT D;  1F2Y A;  1HUM A;  1A62 A;  1ET9 A;  1WFQ A;  4A3B G;  2YU9 H;  3W1B A;  4FF1 A;  4V19 0;  5K36 H;  2BOS A;  2K28 A;  3TZD A;  1H9J A;  3D3R A;  3TP5 A;  1R4Q B;  1A6X A;  1EYC A;  3TRZ A;  1BKB A;  2WAQ G;  2SNS A;  4BY1 H;  2A69 D;  5ELD A;  4WJW A;  2Z6K C;  1XYI A;  4HIM A;  3CPF A;  2HQL A;  3IRB A;  4PZ6 A;  5FJ8 G;  2R7Z B;  1P8L A;  4A75 A;  3NQT A;  2JA5 B;  1VQF A;  3GTJ H;  5LMN Q;  5F2D A;  1AZP A;  1D5Z C;  3EA6 A;  3NTI A;  1II3 A;  3NEM A;  3BDO A;  5BN3 A;  2RBM A;  1QVF A;  1RJT A;  3UDG A;  5M5Y B;  3BS1 A;  2B8F A;  1RTO A;  5D3I B;  4GKJ L;  2EJG C;  3K0Y A;  2VUM G;  3GV3 A;  1U4R A;  3NHH A;  4NKL A;  1F77 A;  3KF8 B;  3WWV A;  2F0M A;  2LMC B;  2NN6 G;  4DV5 L;  3S1Q B;  2OCE A;  5GAH C;  3HEJ A;  1Q1B A;  3I56 A;  5KGU A;  3J80 i;  3BJU A;  3MAQ A;  2JA8 B;  5EPK A;  3PO3 B;  4FYD A;  1STG A;  1UE1 A;  4A3D B;  1XNQ Q;  4DA2 A;  2QW7 A;  1S5B D;  2IHE A;  4ZRZ A;  1A3T A;  2RHQ B;  3G7L A;  4KV6 A;  1A63 A;  1BCP B;  3X3M A;  1HRJ A;  2RDG A;  2AQ2 B;  5IGC A;  2WKD A;  3MXU A;  4YIJ A;  1VQJ A;  1PTO B;  1PFB A;  5I6W A;  4QUF A;  1I4X A;  3TME A;  3HOV B;  1SNQ A;  1WTQ A;  4P75 A;  3H6M A;  3I4N B;  2K5D A;  2HDL A;  2IWH A;  4DV4 Q;  3BVM A;  4TRD A;  1RIP A;  2CWP A;  1DM0 B;  3LWE A;  2B63 H;  2EIF A;  4GKK Q;  2KUM A;  1JB3 A;  1SYB A;  3S1R B;  2QDB A;  3K57 A;  3KUP A;  4H7B A;  1HR0 L;  1ASZ A;  4Q5V A;  2LY7 A;  1HHV A;  3K7A B;  1TWF H;  4X6A H;  1SE3 A;  4WJ4 A;  5C5M A;  2CFM A;  4KN4 C;  4OWX B;  1U4M A;  1A8V A;  4AQY Q;  5M3F H;  4OHJ A;  5DLQ E;  5FLX L;  4A3E B;  4PZ7 A;  4JG2 A;  2L5T A;  1U9R A;  4ALP A;  1EY7 A;  3B6Y A;  3BZC A;  2FHT A;  1VMC A;  3HOZ G;  1YEZ A;  2UUB Q;  3CCJ A;  1B3Q A;  1CT1 D;  2XRQ D;  5KNC A;  1XNQ L;  4A3M G;  1ICW A;  4HJ7 A;  1Q8K A;  4DK3 C;  3TSS A;  5IYD G;  5EBC A;  1R9T B;  4HIO A;  2EY2 A;  1VQ7 A;  3H0G G;  4DAV A;  4B3M L;  4F8M A;  3MFY A;  4LFC L;  5C4X B;  5CYU A;  4EQ5 A;  5C0X G;  4WRD A;  3J81 c;  4K6D A;  5C4J H;  2X6L A;  3SK4 A;  4C3H B;  3G6E A;  4DV4 L;  3PUW A;  3HRZ C;  5CV6 A;  4KLK A;  2BH2 A;  4KD3 A;  4KKT A;  3HFZ B;  4GKK L;  4IFD G;  4GOP C;  2ICE C;  4JI4 Q;  3CAM A;  2IT1 A;  2K75 A;  2KEN A;  3TBI B;  2E75 C;  5JEA J;  2R93 B;  4XIG S;  5LL6 X;  4JI6 L;  1GUT A;  2XGT A;  3VYU A;  1VQE A;  3R8B A;  1LLR D;  1SJH D;  3HOX G;  4QL5 A;  4DV2 L;  4AQY L;  4DV0 Q;  3GTK B;  3GTO B;  3PQI A;  4A3B B;  1CTM A;  4JBK A;  1E2V A;  4NB3 A;  1RD9 D;  1YHA A;  5KNB A;  3ULL A;  1WVL A;  1V1O A;  5AFW A;  5EJW A;  4NMZ A;  2PQA A;  2JEA I;  2ATW A;  1CFM A;  4R4Q A;  3W1G A;  4KN7 C;  3CHB D;  5D14 A;  2NZH A;  5JPM C;  1XTC D;  3N6R A;  2MQH A;  3V2T A;  5M3M H;  1WTW A;  3J7Y W;  4RFB A;  4ZAI A;  3S15 H;  1Y8O B;  2MO1 A;  1PZJ D;  4DXF A;  1QG7 A;  1EY8 A;  4XYQ A;  5KYL A;  1GUO A;  3NEN A;  4C3J G;  1I6V C;  3DWQ A;  3S17 B;  3TN2 A;  4DK1 A;  1C7Y A;  1AFP A;  3ERQ A;  2K7V A;  4WFN 3;  1JWS D;  1SBB B;  1TII D;  3A8K E;  5IYB H;  1WD0 A;  3PUY A;  1SNO A;  4WOR A;  4Q0F A;  5FO7 B;  1QUQ B;  4IFD J;  2E5L Q;  2WFW A;  2XWJ B;  5CBE E;  2KJX A;  4LF4 Q;  1LYL A;  3LNN A;  2Q2T A;  3S2H B;  1DZ1 A;  4A3J B;  5FO8 B;  5C44 G;  1DXM A;  1GXD C;  1HFG A;  3JAM c;  5EPL A;  1HCZ A;  1QNU A;  3Q6S A;  4DV0 L;  4R1J A;  1DCZ A;  5C3E H;  1B70 B;  4KMU C;  1YNN C;  3CME A;  1X55 A;  2D0O A;  2ALY B;  1LTG D;  1GUS A;  2H1E A;  4XT3 B;  1SEB D;  2A69 C;  3T16 A;  3WDN A;  3FMC A;  2JP1 A;  4PZ8 A;  1GM5 A;  4AH6 A;  2JA7 H;  2K5Q A;  2NZ1 D;  4A3G B;  4HJ8 A;  4R4T A;  1EIG A;  1E2Z A;  2R92 G;  3DWP A;  2K04 A;  4P73 A;  3FPU B;  4LW1 A;  3W3A A;  4BA1 I;  2Q8I B;  1FNU A;  4A3F H;  1FD7 D;  4JC0 A;  2I5H A;  1EWH A;  4IQZ A;  4C3I G;  3E9H A;  4K14 A;  5DAU A;  3HOY G;  3CCL A;  1X3E A;  1TY0 A;  4FF2 A;  1YNJ D;  1T5X D;  1S5D D;  2WAC A;  3HG9 A;  1DON A;  3HKS A;  2FMC A;  2NBF A;  3M4P A;  1GKH A;  1F2Z A;  3ND8 A;  4CJ0 B;  4UPA A;  4NW2 A;  3F8T A;  2Z0S A;  3RLN A;  1TKW B;  4IOC A;  3U50 C;  3TP7 A;  1MGS A;  3OSO A;  4DR3 Q;  5I2Y A;  1AE3 A;  4LNQ A;  1LTS D;  5IOC A;  2X69 A;  3ZJY C;  3F2D A;  1NJI C;  1K0S A;  2K5H A;  2CVR A;  2FJ2 A;  3H0G B;  3GTL B;  1SDF A;  1RHP A;  3PO2 G;  4LUO A;  4R9W A;  4JW0 A;  1AH9 A;  1IBL Q;  4J15 A;  2F0U A;  3HOU G;  2LS0 1;  4G7Z C;  3FRP B;  4FXG C;  1IBK L;  4OON A;  5CV7 A;  4LF5 Q;  1A2U A;  1EIY B;  1TR5 A;  4F88 A;  1VQA A;  2UUC L;  4ODG A;  1LTR D;  1FJG Q;  4MN3 A;  2NZO A;  3OW7 A;  4JI2 L;  2A73 B;  1WTX A;  1EZ8 A;  4CDE C;  2EDG A;  1G6Z A;  5IYC H;  2KOL A;  4XQN A;  2EYL A;  2B2V A;  1NBW A;  3SXH A;  1LTI D;  4QCL A;  1VQB A;  4HN7 A;  2QCP X;  2GVA A;  4DV1 Q;  3S14 H;  1NCV A;  3EBE A;  4M8A A;  5ELN A;  3K5L A;  3HOX B;  2EXZ A;  2JA5 H;  1VQM A;  3S2D H;  1QCB D;  3I4M H;  5IP7 H;  2EZV A;  4IOA A;  4I65 A;  2JQO A;  1CKN B;  2D2C C;  4DU9 A;  2KHS A;  1N8R C;  2B8G A;  1S5F D;  1SN8 A;  4DR3 L;  3IFT A;  4A3K G;  3GTG H;  1MBY A;  1TU2 B;  4DR4 Q;  2C9O A;  3J80 c;  5FLX E;  5IY0 A;  3MC0 B;  1E1T A;  3BG3 A;  4PQX A;  4JI8 Q;  2ES2 A;  3UDX A;  4QB4 A;  3EFX D;  3A7A B;  3NSW A;  2GN5 A;  5G3L F;  3PIP 3;  4JI0 Q;  4ULL A;  4C3J B;  1EL0 A;  1DJR D;  2RQX A;  3Q22 A;  1VQG A;  3P7J A;  3D4W A;  2DJG C;  1P16 A;  3CCM A;  1I6H H;  1G2T A;  1N33 L;  1F9P A;  3AFP A;  4YCW A;  2VQE Q;  5I9P A;  2NVY H;  2R7Z G;  3GTP B;  4FVM A;  4RWS C;  2Y0S E;  1XMO L;  3GV6 A;  4AIM A;  5EKI A;  3ZYY X;  2IJ0 A;  1JB7 A;  4LFB L;  4DV1 L;  3I4O A;  2UUA Q;  3OIP A;  2PCF B;  3RZO H;  4HIK A;  4DR2 Q;  1SE8 A;  3VR5 A;  2E2I B;  1AN8 A;  1XMQ Q;  3J7Z C;  1V1P B;  2K03 A;  1NSN S;  4FP5 D;  3K59 A;  1J9O A;  1YHB A;  3WOF A;  2KCC A;  2K5N A;  1A3U A;  3SVM A;  1WTP A;  4KD4 A;  4GLA C;  2KBN A;  3K81 C;  3K7A H;  4QUC A;  5LMU L;  2M2L A;  3H94 A;  4HSV A;  4JI8 L;  2JA8 G;  1BF4 A;  4FXK C;  2AMC B;  4M1U B;  1YJ9 A;  1JOK A;  4BBS B;  3IL8 A;  3I55 A;  3M7G A;  1F9S A;  3TZU A;  1X3G A;  3RD4 A;  2R92 B;  1M4V A;  3MVV A;  4JI0 L;  1DOK A;  5FO9 B;  1LTL A;  1EWC A;  4BY7 H;  2XVS A;  3TP8 A;  2VXW A;  3E0J A;  4OWW B;  3I70 A;  3T56 B;  1DOL A;  4JI5 Q;  3ONA B;  4KY6 A;  4L6T B;  5IGE A;  1G2S A;  4QF4 A;  4Y52 H;  2PZU A;  2PW7 A;  2PQE A;  3VR4 A;  4C3I B;  4B9X A;  3TS0 A;  5EKK A;  2VQE L;  2D9U A;  2HHH Q;  1H9S B;  3HOV G;  1TWA B;  3I4N G;  3K5M A;  2KEC A;  1W3S A;  2KHI A;  4B3R Q;  1EY0 A;  3CU7 A;  4JPB W;  1EWI A;  1Y1V B;  4A3C H;  3R2T A;  2HUG A;  2ASB A;  3I4L A;  1XPO A;  1LT5 D;  3CXC A;  2X6G A;  1K8A C;  4RH6 A;  2DJF C;  3M4O B;  4A4I A;  4LWC A;  5C5L A;  1M8A A;  4EGV A;  2UXC L;  2PMZ E;  4YWL A;  1NY4 A;  3EIV A;  1E2W A;  4N8F A;  1JCK B;  4N8X 1;  3PO2 B;  3CD6 A;  1JJC B;  5CBA E;  2BE5 D;  1RKN A;  3J7A 5;  3SHL A;  1IKL A;  4ZLT F;  4RAU C;  3HOU B;  1STA A;  4EQN A;  2AUK A;  2RSN A;  3QOJ A;  2F3V A;  1EOV A;  2WV6 D;  4LK1 C;  4A3B H;  1O7I A;  3G71 A;  2PNH A;  2A6H D;  4ZUI A;  5KIX A;  3CC2 A;  1CKO A;  1SR3 A;  2KHJ A;  4O42 A;  2A74 C;  5C4X G;  3N52 A;  2NVX B;  3A74 A;  3KLR A;  1AZQ A;  1YNJ C;  2D0P A;  1K83 B;  2K4K A;  2HHH L;  1I4H A;  3FPP A;  1FGB D;  3S1N B;  5IGG A;  3PF4 A;  5FJ8 H;  3RN5 A;  2L15 A;  3KYH C;  4HTH A;  5M5X B;  3DMU A;  2O5J C;  4IJL A;  4B3R L;  2Z4I A;  1JE4 A;  1PH1 A;  3OHX C;  3GTQ B;  1IYV A;  4TQU S;  4RGN A;  1S5C D;  2KVM A;  1GHK A;  3TP6 A;  4CHT B;  4A3K B;  1XXG A;  3L2P A;  2F3W A;  3M3Y H;  2K05 A;  2VUM H;  4IPG A;  3MXN B;  4JI3 Q;  3IFD A;  1TXY A;  1XPR A;  2PI2 A;  4PV1 C;  4DAM A;  1M1K C;  1KIX A;  2NN6 H;  2E2H H;  4BXX G;  1EYG A;  2RCN A;  1PZI D;  1X3F A;  3BYY B;  4RGT A;  1Y1W G;  1YNN D;  4XT1 B;  2V1C C;  3S2H H;  1U0L A;  3ERO A;  1JIC A;  2B2V C;  2Q2I A;  1VQ9 A;  3L3O C;  1QOH A;  3FKI B;  1B8A A;  1TWH B;  1BBW A;  5EKL A;  1KAB A;  5M5W B;  4CJ2 C;  1HUN A;  2F0Q A;  2HD3 A;  4TSS A;  3KJO A;  4N9T A;  1UE5 A;  4V0B A;  3MTS A;  2JE6 I;  2G9H D;  1PVO A;  1HQM C;  3AU7 A;  2IPK D;  4QMG A;  2G9D A;  1SYE A;  4HMI A;  1HR0 Q;  4R8N A;  1VDZ A;  4B3T L;  4QIW E;  1YNX A;  1VMP A;  1EY6 A;  4DN4 M;  2JA9 A;  5J3B A;  3DLL A;  3OOC A;  1QZH A;  3D8G A;  3Q8D A;  2IW3 A;  4R4O A;  5G3L D;  4GOP B;  1DD2 A;  5IP9 G;  2EYP A;  4PMW A;  5JEA H;  1PA6 A;  2JYO A;  1EU3 A;  4OO1 I;  4JI3 L;  2A8V A;  2HQE A;  5M9O A;  3V05 A;  3PIO 3;  4A3J G;  1SMY C;  4CKC A;  1HA6 A;  4K2K A;  4RGM A;  5E4W C;  3OWF A;  1JOR A;  1O78 A;  2B3G A;  4P74 A;  4G7O C;  4JV5 Q;  3BDC A;  4DUZ Q;  4JBJ A;  1CQF A;  1SYD A;  2F1M A;  5IGF A;  4A93 G;  4UY8 C;  3HOZ H;  1N36 L;  2A5H A;  4G57 A;  3NE5 B;  4GLV B;  4B3M Q;  1W6J A;  5A2Q L;  2ZXR A;  4A76 A;  4LFC Q;  4A3M H;  1IBM L;  4L5Q A;  5IYD H;  2JA6 B;  1EYD A;  4DKA C;  3NEL A;  2F0O A;  5E7N A;  5EGT A;  1ZYR D;  3H0G H;  3T53 B;  4A3G G;  2K52 A;  4K8J A;  1Q12 A;  3HKZ G;  3TS2 A;  4GZY C;  2ENB A;  3MXP A;  2F0F A;  1HNW Q;  1D2B A;  1X3Q A;  5TSS A;  2XN9 C;  5JOB A;  1I94 L;  3D4D A;  3DWA A;  1KRS A;  1B2T A;  4AYB E;  3ICE A;  1K8M A;  2N49 A;  4YCV A;  3KJP A;  1G8Z D;  3F2B A;  1CM9 A;  4JI6 Q;  1JMC A;  5JJZ A;  4IFD H;  1O7L A;  3ND9 A;  4ZKB B;  4DV2 Q;  3OPO A;  3ER0 A;  4B9W A;  1WTH A;  3I2Z A;  1VQ6 A;  2VS1 A;  4KHZ A;  1PRT B;  1BQQ T;  4ZCK A;  1CHQ D;  5IGB A;  3HOX H;  5FLM G;  2D5D A;  4JV5 L;  1I50 B;  5T1G A;  3U9O A; 
#chains in the Genus database with same CATH homology
 4BBR B;  2F0I A;  1STY A;  4CKE A;  1A2T A;  3VR3 A;  2XWB B;  1SSO A;  4HED A;  2M9V A;  2MGS A;  4J1M A;  1Y8P B;  4FXD A;  1TWC B;  2MHV A;  3GTM B;  2DY8 A;  5NUC A;  3E6Z X;  5C4Z A;  3S16 B;  1S4Z A;  3QG1 A;  3A54 A;  2BE5 C;  3L9A X;  1OXU A;  1BXT A;  3NBI A;  2Z8L A;  1LAC A;  1Y1W B;  3D31 A;  4H0L C;  2SDF A;  3CRK C;  3NQI A;  3RZD B;  1PZK D;  5DM6 3;  1R4P B;  3BVZ A;  2EJF C;  4X3K A;  4IN3 A;  2A6H C;  3A8I E;  2RA4 A;  5IOD A;  4IUN A;  3MA2 B;  5JPN C;  2V4D A;  4ZUJ A;  2JSO A;  1KDC A;  5C0X J;  1SFO B;  2EYM A;  1D5X C;  4ABN A;  3D6C A;  2FFK B;  1XX8 A;  1L0X B;  1A3V A;  2L9H A;  3W2D A;  1WTR A;  3MFG A;  1FNW A;  3QB3 A;  3T51 B;  4NDX A;  2A68 D;  1TQO A;  4R8I A;  4EVO A;  4DAP A;  4PMB A;  5DNF A;  1QWY A;  1SAP A;  2NUC A;  2E2J B;  3DM1 A;  3DEO A;  4A93 B;  1JWU D;  2EYJ A;  1EFI D;  1RTN A;  2O2L D;  5C4H A;  1LT6 D;  3HKZ B;  1F9Q A;  4PMC A;  2B2T A;  1HXY D;  1BNZ A;  2L4N A;  3J7A F;  3GTJ B;  1IL8 A;  1B3A A;  5I4D A;  1ILP A;  3I3C A;  2J0T D;  1ONL A;  2EYF A;  1J8I A;  1BO0 A;  1ENA A;  5HUR A;  1TS2 A;  1KTK A;  4U68 A;  4XDX A;  5C6A A;  2F0S A;  4K5V A;  2NB0 A;  1OXV A;  4RHR A;  1BCP F;  4E6I A;  3CKI B;  1PTO F;  3BDL A;  2PNR C;  5EPJ A;  4KKU A;  2C5C A;  4DNT B;  2BCO A;  4BS9 A;  4CKB A;  1HPC A;  2K6A A;  1ZYR C;  1DOM A;  4IUR A;  5CV4 A;  1CK1 A;  5A2Q E;  5EBD A;  2L11 A;  3GD7 A;  4HCS A;  5I9O A;  2N88 A;  1NR2 A;  2B63 B;  2KQ3 A;  3F2U A;  5C3W A;  4J6H A;  2E76 C;  5C3X A;  1W6K A;  4L8J A;  2F0T A;  3DHQ A;  2TMP A;  1TWF B;  5ISR A;  3OMC A;  1CA6 A;  1LT3 D;  3OIQ A;  3VR2 A;  2CQA A;  5I2X A;  5M3F B;  3HOW B;  5CC4 A;  3R2I A;  4O1N A;  1HTP A;  2BA1 A;  4UDU C;  1IYU A;  4KK7 A;  2Q8T A;  2MPM A;  4FF4 A;  5DM7 3;  1PMR A;  1SMY D;  4L63 B;  2LFN A;  3VYS A;  2DN8 A;  2QKI C;  1ILQ A;  1EEI D;  2AWO A;  5COY A;  1NR4 A;  1H9M A;  2KEE A;  4G7H C;  2AUJ D;  2K33 A;  1XWE A;  5T1I A;  2BDN A;  2Z4H A;  4HAE A;  3PUZ A;  2CHB D;  1EYA A;  5CR3 A;  5BN4 A;  1PTO H;  1O7Y A;  3TDQ A;  1FR3 A;  4DF7 A;  1UEA B;  2PO4 A;  3VR6 A;  2JEB I;  2E74 C;  4MIU A;  5ELF A;  3IAY A;  4U67 3;  1LTB D;  1PXU A;  3C46 A;  1HA5 A;  1STN A;  3MEH A;  1L0Y B;  1EOT A;  3J7A V;  1B44 D;  2PYK A;  1G91 A;  3FEW X;  3QWN A;  3SEB A;  5M3M B;  3FVQ A;  3C2P A;  3S15 B;  3UI2 A;  3H09 A;  1S5E D;  3MXN A;  1GUW A;  4IUQ A;  3LWU A;  2ICI A;  1E0B A;  2A68 C;  2B2U A;  1CI3 M;  2N55 A;  3NWS A;  4XQQ A;  1NUC A;  4HSP A;  1QIL A;  1RF2 D;  1EQV A;  2MUY A;  5E1F A;  1OXX K;  5IT9 L;  3L7Z C;  3D6W A;  4IUP A;  2AQ3 B;  1CA5 A;  2L55 A;  4RCO A;  2B2T C;  2NYZ D;  2KCN A;  1VCI A;  1KNA A;  1B9M A;  3H3V C;  2F0V A;  1F2M A;  2RDH A;  2SEB D;  3A55 A;  4X3T A;  3KF8 A;  2JA7 B;  5J1Z A;  2IX3 A;  1EEF D;  4RCN A;  2IX1 A;  4ZK9 B;  3HGB A;  5COR A;  2ZXP A;  1GUG A;  4A3F B;  1D1K A;  2RSO A;  2JXM B;  2VNU D;  2DNC A;  5JVH 3;  1BCP D;  5J39 A;  1PTO D;  2O5I C;  1IHZ A;  3KLS X;  1SYG A;  3MWY W;  3AMU A;  4K2L A;  1ROD A;  4KI0 A;  1V43 A;  1SXT A;  1SJE D;  3AB9 A;  2RKS A;  3RLF A;  3SK5 A;  1KAA A;  3BVG A;  3BYT B;  1D6E C;  2I46 A;  2F0G A;  1B50 A;  1B1Z A;  3NTH A;  1GJX A;  4J8Q A;  2EE1 A;  1SNC A;  4HMJ A;  1WCM B;  2F0P A;  3J81 L;  3I91 A;  1UUP A;  1D1I A;  3R3O A;  1SE4 A;  2NVQ B;  2B2Y A;  4CBV A;  1RCV D;  4IZ8 A;  2B2W A;  2ZT9 C;  4X3U A;  3Q23 A;  4ZQ3 A;  3K6O A;  3E5S A;  1KNE A;  3S9W A;  3S14 B;  3K5N A;  3KLS A;  4CGY B;  3DEP A;  3S2D B;  1STH A;  4Z9C B;  1FNV A;  3I4M B;  3A8J E;  2NN6 I;  3Q24 A;  4IUV A;  1Q1E A;  1STB A;  4RKB A;  4ZKC B;  2OEO A;  1AEX A;  3GTG B;  2PZT A;  3PUV A;  5D3D A;  1SYF A;  4XYO A;  4B08 A;  1JQY D;  3OMG A;  3M7N A;  4OO1 G;  4KHV A;  3CQZ B;  4ILW A;  5K36 G;  1Y69 U;  1I6H B;  1AP0 A;  3VYT A;  1PFM A;  5C0X H;  1AW7 A;  2NVY B;  3RUZ A;  4BWG B;  1WTV A;  1IKM A;  1CQV A;  4FNF A;  5LHY 1;  1U4P A;  3RZO B;  1NAP A;  3JAM L;  4DXG A;  2NTT A;  4KTA A;  3G6J B;  1ET6 A;  2A6E C;  3BZD B;  4N9P A;  1TS3 A;  3NWT A;  1QNK A;  1I4P A;  3KBG A;  5JEA G;  2H4O A;  2EYH A;  1STE A;  3QO2 A;  3QJY A;  1WD1 A;  1TY2 A;  2R61 A;  2O4X A;  1C4Q A;  2F0J A;  5KEE A;  1TS4 A;  3VA5 A;  2B2U C;  4X3S A;  4MHE A;  3I90 A;  3M85 A;  4BY7 B;  2L12 A;  3WOE A;  4DGZ A;  1KDB A;  3QOL A;  4LJZ C;  5C0X I;  1HFN A;  1EU4 A;  4C1N K;  2Y0S B;  1SE2 A;  5JAV A;  2FMM A;  2QF7 A;  1QJO A;  4CJ1 B;  5ELE A;  1FYC A;  3FDT A;  3D4R A;  4RA8 A;  2NWG A;  1GOZ A;  4IFD I;  3GO5 A;  2F0L A;  1LO5 D;  3DUZ A;  2VB2 X;  1X32 A;  1IW7 D;  2OXP A;  3NBH A;  3LX0 A;  1QE6 A;  1TT2 A;  1KLG D;  2FIN B;  4KKS A;  1B53 A;  5IT9 E;  4LAA A;  5KRU A;  2EY5 A;  1MSH A;  1D5M C;  3MHB A;  2QEJ C;  1TWG B;  3K5O A;  4OIJ A;  4TKO B;  1MSG A;  1V8Q A;  1Q3L A;  2SNM A;  4RGO S;  4JK1 C;  3U9S A;  3I72 A;  3PUX A;  5CMD A;  2Z1C A;  1BCP C;  1UAP A;  1B4O A;  1ZEQ X;  4G4K A;  2AWN A;  2OF1 A;  1U4L A;  1EY4 A;  1PTO C;  2WAQ B;  3NK9 A;  3OWE B;  1O80 A;  2BDO A;  1Q90 A;  5I6Y A;  2GA4 B;  2RDF A;  3I73 A;  2Q8R E;  5KND A;  2PMZ B;  3C3L A;  1BDO A;  2EJM A;  2VB3 X;  1VF7 A;  4ME5 A;  4KY7 A;  3M3Y B;  2VUM B;  3T4A C;  1LTA D;  3J80 L;  1K8O A;  2B2Y C;  2E2H B;  4C1N I;  1B9N A;  5A35 A;  2NTS A;  2B2W C;  1BUV T;  2YU9 B;  3ITP A;  1PRT C;  2XSC A;  4K5W A;  3HP3 A;  1CZW A;  3P20 A;  4BY1 B;  3P1H A;  1CHP D;  5J22 A;  3VA7 A;  3J81 E;  1HTL D;  3NP8 A;  2F4I A;  1JWM D;  2HDM A;  3SK6 A;  3EQL C;  4KJO A;  4UAI A;  2J4X A;  3DXJ C;  4OIK A;  4F7X A;  3HZX A;  1ZKO A;  1ML0 D;  2IL8 A;  4HCE A;  5CGK A;  1I4G A;  4FO2 A;  4DNR B;  1PDQ A;  1EQT A;  3NTK A;  4K6L A;  1O7Z A;  2F03 A;  2XNA C;  1LTT D;  1C8C A;  2IX0 A;  2TSS A;  2L1B A;  2CW0 D;  4EQO A;  2PZW A;  4OGQ C;  2EY6 A;  2K5W A;  2WP8 J;  1BBX C;  2QIL A;  3K58 A;  2K01 A;  1JR0 D;  3HOZ B;  3PMF A;  2DNE A;  1ENC A;  3NXW A;  4A3M B;  1PYW D;  5EQ0 A;  4C56 C;  2PW5 A;  1GUN A;  2F0E A;  1EZ6 A;  1OO9 B;  1ESF A;  1V1P A;  4I7Z C;  5BN5 A;  4K8I A;  3GP7 A;  2HCI A;  1DYQ A;  1RDP D;  4PNY A;  4QIW B;  1F9R A;  3SDZ A;  2KED A;  2MP1 A;  2XRS D;  2WIN B;  4IUT A;  4DAY A;  4KJN A;  4DK0 A;  2F0K A;  3A7L A;  3P75 A;  1Z47 A;  1PRT F;  2EOT A;  3Q0A A;  5E3F A;  4ZYS A;  5FOB B;  3JAM E;  1WTO A;  2RVL A;  3SR1 A;  1H9S A;  5IIF A;  4K5X A;  1ENF A;  1H9R A;  3KBX A;  1Q8I A;  3A56 A;  1I3Q B;  3VYR A;  3RMH A;  1GHJ A;  1Z6H A;  2EY1 A;  1SYC A;  1LV9 A;  5C4J B;  1SNP A;  3EVQ A;  1I4Q A;  1BR9 A;  1ESR A;  1PLF A;  1I4R A;  4F87 A;  2R3Z A;  2WII B;  4AYB B;  2WKC A;  2XIW A;  2R6G A;  4FF3 A;  3PV0 A;  3IKJ A;  1IW7 C;  1UNS A;  5CV5 A;  2M00 A;  3V96 A;  4Y7N B;  4XXE A;  1T5E A;  4LMQ D;  3SK8 A;  1SNM A;  1TS5 A;  1CZG A;  3CRL C;  4IUU A;  5HGT A;  3QIA A;  2EVB A;  4H44 C;  5CV8 A;  5C44 B;  2A6E D;  5CV9 A;  1MI2 A;  3C1F A;  4HR7 B;  1G29 1;  2F0D A;  4H13 C;  3HS0 C;  1H9K A;  1F2L A;  1Y8N B;  2K32 A;  4RHS A;  1BOS A;  2F0N A;  5D65 A;  2EYO A;  3NPP A;  2WB1 B;  3M4Y A;  1LT4 D;  1EIH A;  1HQR D;  1KLU D;  5LL6 S;  1JOO A;  2ZXO A;  4A3I B;  1ZXT A;  3HOY B;  4RKL A;  3URY A;  3EJI A;  5IGD A;  3X3N A;  5C3E B;  2E2D C;  3SE0 A;  4XTC S;  4C2M B;  3R93 A;  2LKV A;  2HCC A;  3J80 E;  4NP5 A;  2EPB A;  2BA0 A;  3KK7 A;  4OL7 A;  1EY5 A;  2J7Z A;  4DFA A;  5JVG 3;  2AQ1 B;  2F0H A;  1JOQ A;  1OXS C;  1SND A;  4KY5 A;  1LAB A;  1VF5 C;  3C1E A;  3MXG A;  2K1B A;  4EQP A;  1EY9 A;  5K5P A;  2SOB A;  1A15 A;  5E4X A;  4P2C B;  3S1M B;  1KDA A;  3GQB A;  2I07 B;  2NVT B;  4JBW A;  2YYZ A;  2CW0 C;  1X3P A;  2PPB C;  5KYI A;  1PFN A;  1TVX A;  4C3H G;  1OXT A;  3T13 A;  3I8Z A;  4S3S A;  2KA7 A;  2OT2 A;  1MD2 D;  3H91 A;  2F0W A;  4ID6 A;  1C48 A;  4IAL A;  2B39 A;  1JC7 A;  1Z7T A;  5ELB A;  2MJ8 A;  5FK9 C;  2DY7 A;  3MZ5 A;  1QB5 D;  3NUC A;  5FKA C;  2D62 A;  5DEH A;  2L0C A;  3O13 A;  4XQJ A;  4OO1 H;  2ID0 A;  4BA2 I;  5ELC A;  1PRT D;  1F2Y A;  1HUM A;  1ET9 A;  4FF1 A;  4V19 0;  5K36 H;  2BOS A;  2K28 A;  3TZD A;  1H9J A;  3D3R A;  3TP5 A;  1R4Q B;  1A6X A;  1EYC A;  2SNS A;  2A69 D;  5ELD A;  4WJW A;  1XYI A;  2R7Z B;  3NQT A;  2JA5 B;  5F2D A;  1AZP A;  1D5Z C;  3EA6 A;  3NTI A;  1II3 A;  3BDO A;  5BN3 A;  2RBM A;  1RJT A;  5M5Y B;  3BS1 A;  2B8F A;  1RTO A;  5D3I B;  2EJG C;  3K0Y A;  3GV3 A;  1U4R A;  3NHH A;  4NKL A;  1F77 A;  2F0M A;  2LMC B;  2NN6 G;  3S1Q B;  3HEJ A;  1Q1B A;  5KGU A;  3MAQ A;  2JA8 B;  5EPK A;  3PO3 B;  4FYD A;  1STG A;  4A3D B;  4DA2 A;  1S5B D;  4ZRZ A;  1A3T A;  3G7L A;  4KV6 A;  1BCP B;  3X3M A;  1HRJ A;  2RDG A;  2AQ2 B;  5IGC A;  2WKD A;  3MXU A;  4YIJ A;  1PTO B;  1PFB A;  5I6W A;  4QUF A;  1I4X A;  3TME A;  3HOV B;  1SNQ A;  1WTQ A;  3I4N B;  3H6M A;  2K5D A;  2HDL A;  2IWH A;  3BVM A;  4TRD A;  1DM0 B;  3LWE A;  2KUM A;  1JB3 A;  1SYB A;  3S1R B;  2QDB A;  3K57 A;  3KUP A;  4H7B A;  4Q5V A;  2LY7 A;  1HHV A;  3K7A B;  1SE3 A;  5C5M A;  4KN4 C;  1U4M A;  4OHJ A;  5FLX L;  4A3E B;  2L5T A;  1U9R A;  1EY7 A;  2FHT A;  1VMC A;  1CT1 D;  5KNC A;  2XRQ D;  1ICW A;  3TSS A;  5EBC A;  1R9T B;  2EY2 A;  4DAV A;  4F8M A;  3MFY A;  5C4X B;  5CYU A;  5C0X G;  4WRD A;  4K6D A;  2X6L A;  3SK4 A;  4C3H B;  3PUW A;  3HRZ C;  5CV6 A;  4KD3 A;  4KKT A;  4IFD G;  2ICE C;  2IT1 A;  3TBI B;  2E75 C;  5JEA J;  2R93 B;  4XIG S;  5LL6 X;  1GUT A;  3VYU A;  3R8B A;  1LLR D;  1SJH D;  3GTK B;  3GTO B;  4A3B B;  1CTM A;  1E2V A;  5KNB A;  1RD9 D;  1WVL A;  1V1O A;  5AFW A;  5EJW A;  4NMZ A;  2JEA I;  1CFM A;  4KN7 C;  3CHB D;  5D14 A;  5JPM C;  1XTC D;  3N6R A;  3V2T A;  1WTW A;  3J7Y W;  4RFB A;  4ZAI A;  1Y8O B;  4DXF A;  1PZJ D;  1QG7 A;  1EY8 A;  4XYQ A;  5KYL A;  1GUO A;  4C3J G;  1I6V C;  3DWQ A;  3S17 B;  3TN2 A;  4DK1 A;  1AFP A;  3ERQ A;  2K7V A;  4WFN 3;  1JWS D;  1SBB B;  1TII D;  3A8K E;  1WD0 A;  3PUY A;  1SNO A;  4WOR A;  4Q0F A;  5FO7 B;  4IFD J;  2XWJ B;  5CBE E;  2KJX A;  3LNN A;  3S2H B;  1DZ1 A;  4A3J B;  5FO8 B;  1DXM A;  1GXD C;  1HFG A;  5EPL A;  1HCZ A;  1QNU A;  3Q6S A;  1DCZ A;  4KMU C;  1YNN C;  1LTG D;  1GUS A;  2H1E A;  4XT3 B;  1SEB D;  2A69 C;  3T16 A;  3WDN A;  3FMC A;  2JP1 A;  2K5Q A;  2NZ1 D;  4A3G B;  1EIG A;  1E2Z A;  3DWP A;  2K04 A;  3FPU B;  3W3A A;  4BA1 I;  2Q8I B;  1FNU A;  1FD7 D;  1EWH A;  4IQZ A;  4C3I G;  4K14 A;  5DAU A;  1TY0 A;  4FF2 A;  1YNJ D;  1T5X D;  1S5D D;  2WAC A;  3HG9 A;  1DON A;  2FMC A;  2NBF A;  1F2Z A;  3ND8 A;  4CJ0 B;  4NW2 A;  1TKW B;  3TP7 A;  1MGS A;  3OSO A;  5I2Y A;  1LTS D;  5IOC A;  2X69 A;  2CVR A;  2FJ2 A;  3H0G B;  3GTL B;  1SDF A;  1RHP A;  4R9W A;  2F0U A;  2LS0 1;  4G7Z C;  3FRP B;  4FXG C;  5CV7 A;  1A2U A;  1TR5 A;  4F88 A;  4ODG A;  1LTR D;  4MN3 A;  3OW7 A;  2A73 B;  1WTX A;  1EZ8 A;  2EDG A;  1G6Z A;  2KOL A;  4XQN A;  2EYL A;  2B2V A;  3SXH A;  1LTI D;  4QCL A;  4HN7 A;  2QCP X;  1NCV A;  4M8A A;  3K5L A;  3HOX B;  2EXZ A;  1QCB D;  2EZV A;  4I65 A;  2D2C C;  4DU9 A;  2KHS A;  2B8G A;  1S5F D;  3IFT A;  1MBY A;  1TU2 B;  2C9O A;  5FLX E;  3MC0 B;  3BG3 A;  4PQX A;  4QB4 A;  3EFX D;  3A7A B;  3NSW A;  5G3L F;  3PIP 3;  4ULL A;  4C3J B;  1EL0 A;  1DJR D;  2RQX A;  3Q22 A;  3P7J A;  3D4W A;  1G2T A;  1F9P A;  5I9P A;  3GTP B;  4FVM A;  4RWS C;  3GV6 A;  5EKI A;  3ZYY X;  2IJ0 A;  3OIP A;  2PCF B;  3VR5 A;  2E2I B;  1AN8 A;  1V1P B;  2K03 A;  1NSN S;  4FP5 D;  3K59 A;  1J9O A;  3WOF A;  2KCC A;  1A3U A;  3SVM A;  1WTP A;  4KD4 A;  4QUC A;  2M2L A;  3H94 A;  4HSV A;  1BF4 A;  4FXK C;  4M1U B;  1JOK A;  4BBS B;  3IL8 A;  3M7G A;  1F9S A;  3TZU A;  3RD4 A;  2R92 B;  1M4V A;  3MVV A;  1DOK A;  5FO9 B;  1EWC A;  2XVS A;  3TP8 A;  2VXW A;  3E0J A;  3I70 A;  3T56 B;  1DOL A;  3ONA B;  4KY6 A;  4L6T B;  5IGE A;  1G2S A;  4QF4 A;  2PZU A;  2PW7 A;  2PQE A;  3VR4 A;  4C3I B;  4B9X A;  5EKK A;  2D9U A;  1H9S B;  1TWA B;  3K5M A;  2KEC A;  1EY0 A;  3CU7 A;  1Y1V B;  3R2T A;  2HUG A;  3I4L A;  1LT5 D;  2X6G A;  4RH6 A;  3M4O B;  5C5L A;  1M8A A;  4EGV A;  1E2W A;  1JCK B;  3PO2 B;  5CBA E;  2BE5 D;  1RKN A;  3SHL A;  1IKL A;  4ZLT F;  4RAU C;  3HOU B;  1STA A;  4EQN A;  2AUK A;  2RSN A;  3QOJ A;  2F3V A;  2WV6 D;  4LK1 C;  2A6H D;  4ZUI A;  5KIX A;  4O42 A;  2A74 C;  3N52 A;  2NVX B;  1AZQ A;  3KLR A;  1YNJ C;  1K83 B;  1I4H A;  3FPP A;  1FGB D;  3S1N B;  5IGG A;  4HTH A;  5M5X B;  3DMU A;  2O5J C;  2Z4I A;  1JE4 A;  3OHX C;  3GTQ B;  1IYV A;  4TQU S;  4RGN A;  1S5C D;  2KVM A;  1GHK A;  3TP6 A;  4CHT B;  4A3K B;  1XXG A;  2F3W A;  2K05 A;  3IFD A;  4PV1 C;  2NN6 H;  1PZI D;  3BYY B;  4RGT A;  1YNN D;  4XT1 B;  3ERO A;  1JIC A;  2B2V C;  3L3O C;  1QOH A;  3FKI B;  1TWH B;  5EKL A;  1KAB A;  5M5W B;  4CJ2 C;  1HUN A;  2F0Q A;  4TSS A;  4N9T A;  4V0B A;  3MTS A;  2JE6 I;  2G9H D;  1HQM C;  3AU7 A;  2IPK D;  4QMG A;  2G9D A;  1SYE A;  4HMI A;  4R8N A;  1VDZ A;  1VMP A;  1EY6 A;  4DN4 M;  3OOC A;  3D8G A;  2IW3 A;  5G3L D;  1DD2 A;  2EYP A;  4PMW A;  5JEA H;  2JYO A;  1EU3 A;  4OO1 I;  2HQE A;  5M9O A;  3V05 A;  3PIO 3;  1SMY C;  4CKC A;  1HA6 A;  4K2K A;  4RGM A;  5E4W C;  3OWF A;  1JOR A;  1O78 A;  4G7O C;  3BDC A;  1CQF A;  1SYD A;  2F1M A;  5IGF A;  2A5H A;  4G57 A;  3NE5 B;  1W6J A;  5A2Q L;  2ZXR A;  2JA6 B;  1EYD A;  2F0O A;  5EGT A;  1ZYR D;  3T53 B;  4K8J A;  1Q12 A;  4GZY C;  2ENB A;  3MXP A;  2F0F A;  1D2B A;  1X3Q A;  5TSS A;  2XN9 C;  5JOB A;  3D4D A;  3DWA A;  1B2T A;  1K8M A;  1G8Z D;  1CM9 A;  5JJZ A;  4IFD H;  1O7L A;  3ND9 A;  4ZKB B;  3OPO A;  4B9W A;  4KHZ A;  1PRT B;  1BQQ T;  1CHQ D;  5IGB A;  2D5D A;  1I50 B;  5T1G A;  3U9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...