3TDQA

Crystal structure of a fimbrial biogenesis protein pily2 (pily2_pa4555) from pseudomonas aeruginosa pao1 at 2.10 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
b'EDPQTFEGAGVVFEVQVEKNLVDIDHRLYRLPNSTVRNGMPSLFQVKPGSVVSYSGTVSQPWSTITDIYIHKQMSEQELAEMIEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilY2 protein
publication title Crystal structure of a fimbrial biogenesis protein PilY2 (PA4555) from Pseudomonas aeruginosa PAO1 at 2.10 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Cell adhesion
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tdqA00
2VB2X 2QCPX 2VB3X 3E6ZX 3TDQA 1ZEQX 2L55A
chains in the Genus database with same CATH superfamily
5JVG3 2DY7A 2G9HD 3I4OA 2EJMA 4GNXB 3CCEA 1BCPB 4PG3A 2ZT9C 4ZUIA 2VQEQ 4OIKA 2RDGA 2JE6I 3JC66 2XWJB 2WFWA 3R93A 5M3MH 2OXPA 4XDXA 5C3XA 2ASBA 2F0WA 2EDGA 1ZEQX 5LMNL 1I6HB 3KDFA 2EY2A 4F88A 5IGFA 1HNWL 1TU2B 3H0GB 1GM5A 1ENFA 2F0FA 2F4VQ 3KYHC 1UNSA 4BY1H 5IT9L 4IUVA 3TMEA 2AUKA 2EYMA 3HOYG 3V96A 4EX5A 4N9TA 1UUPA 4UDUC 4PQXA 3K7AH 2B8FA 5NUCA 1QUQB 1JOKA 2EY1A 3SK6A 4A3FB 2E2IB 5CV5A 2R93G 2OQ0A 2JA6G 3S9WA 4BBSG 2IHFA 1SJED 3JAML 1EZ6A 1WFQA 1TS5A 2EXZA 3A5ZB 4FVMA 3VA5A 5GAEC 3A54A 3KOJA 2LY7A 1B7YB 1C4QA 3OHXC 3HOWH 3BZCA 1SNDA 3WDNA 4HJ5A 2N8NA 3CHBD 3HOXH 1JR0D 3FKIG 3PO3B 5HURA 1NE3A 3EFXD 4JI6Q 4DV7Q 2PI2E 4OL7A 3F2CA 1VQNA 3H3VC 3EJIA 4A3DG 1TY0A 2X6LA 3FPPA 2TMPA 5FOBB 5FO9B 4A3IH 4GKJL 2PMZE 3S2HH 3CC4A 4A3LH 1HR0Q 1AE3A 5FJ8H 5IT9E 5C4XG 2VB3X 3ZYYX 4F8MA 2PZUA 3I2ZA 4PMBA 4QIWB 1X3QA 3RLOA 1EIHA 1Z9FA 1YNJC 1QVGA 1LT4D 3NELA 2F03A 2HHHL 2B2UA 3MXGA 4J8QA 4YY3Q 4OXPA 1PTOD 3GTMH 4GOPB 2K5WA 2YTYA 4KK7A 4CDEC 2VUMG 3NPPA 4ZKCB 5IODA 2Q2IA 2EE1A 2RDFA 2XRQD 4GZYC 4Z9CB 1KDBA 4JI2Q 2IX0A 4G57A 1A3TA 4OWXB 3DM3A 3JAME 2QILA 3J81j 2JQOA 4IUPA 5IYCH 4FO2A 3FP9A 3W3AA 2CW0C 2WP8J 1ZYRD 5C3EG 1I4QA 3A55A 4XQNA 2M00A 1IL2A 4XXEA 3DMUA 2J0TD 5IGBA 5AJ3Q 4U68A 3U4VA 4GKKL 3SK5A 1D7QA 5M5XH 3CD6A 3AYHB 4G7OC 1HZBA 1AFPA 4RHSA 1XNQQ 3OTOQ 1S5CD 3FVQA 1TWAH 4DNRB 1VQBA 3E5SA 1STAA 3BVGA 1QZGA 2FXQA 1UE7A 3OW2A 3S1QB 5JAVA 3C1EA 1GUWA 3HOYB 4Y52H 3OYYA 4J6HA 1VQ6A 5H1SE 3VR5A 5DNFA 2K5QA 1NR4A 2E2JH 4AIMA 3K0XA 1CQVA 4B9WA 2R93B 1J5EQ 2JA6B 3HFZB 4BBSB 1CKNB 4XTCS 2KENA 1STHA 2ES2A 1F77A 3CC2A 4BBRH 5LL6X 2NN6G 2MGSA 3K59A 3CCQA 4QUFA 2HQEA 5EPKA 4CDDC 4DV0L 5ELOA 1BQQT 1ENAA 4C3JH 1BCPD 3NUCA 1Y1VB 1PYBA 1MSGA 1U9RA 4TSSA 1KAAA 3G71A 2WB1G 2PW5A 1CM9A 4K5WA 3I4MB 3OW7A 1KNEA 1MHWC 1DJRD 2DJFC 4HIDA 1FYCA 2DNCA 2IJ0A 3FKIB 4HJ9A 4Y7NB 2EJFC 4DN4M 4LF8Q 2C9OA 5JJZA 3M85A 4A3DB 3CRKC 5EJWA 2LXKA 1I50B 1XNRQ 4E6IA 1LLRD 4S3SA 5M3FH 1H9MA 3KBXA 4M8AA 5GADC 5M5YB 1PH9A 3NBIA 2IWHA 3S1MH 3B6YA 1EYDA 1PFSA 1OXVA 5FO8B 3D4DA 4POFA 1SE3A 3LX0A 3Q6SA 2L5TA 4ME5A 5CV8A 1IW7C 1DYQA 4IURA 2EYFA 2AQ2B 2RSOA 2EYOA 2Q8TA 1SSOA 1BOSA 2RHQB 3C2PA 1TWGB 3NQIA 2VUMB 1KTKA 4HJ7A 3UI2A 4JC0A 3LWEA 1STBA 3M7NA 1N36Q 4B3ML 5BN4A 4JCVE 3RLNA 5FLMH 1O78A 5I2YA 3PSIA 1UE6A 3CU7A 1PTOH 5CORA 4ULLA 2EXDA 3J80E 4R4QA 5JPMC 5LMUL 4LF5Q 1VS0A 5C4JB 2KVMA 2L55A 1BF4A 1LTBD 5E7NA 3S15B 4LFBL 1D1IA 2KCNA 3OIPA 2Z4IA 3S16H 1SE2A 1A3VA 2O4XA 3L2PA 4WRDA 3TBIB 1S4ZA 3RNUA 3GTLB 1LT5D 4K6LA 4ZUJA 3T1HQ 3HOVB 1XX8A 3NK9A 1LTRD 2CWAA 3V2TA 4C56C 1X9NA 4A3MH 3D3RA 2UXCQ 3RD4A 1GHJA 1K8GA 2OF1A 4LW1A 3UE1A 2E5LL 4LMQD 2RA4A 3ULLA 5E3FA 3S1RH 5CBAE 3GTJH 2DGYA 2EZVA 1X55A 1HNXL 4KY6A 1J6QA 1SEBD 3KUPA 4IOCA 4DR7Q 4H0LC 1HNZL 2XWBB 3V05A 4A3BH 2AKWB 3OMGA 2MFIA 2K5HA 2A6HC 1VQGA 1Y1WH 1TR5A 1VQHA 3J7ZC 2UXDL 2Z6BA 3OWFA 4A3EB 4IFDJ 3S17B 5LMNQ 1RTNA 2BCOA 3T53B 1SYGA 2YTVA 1HNWQ 2DN8A 1GVPA 3P7JA 1SYFA 3JAMi 3C3LA 1X56A 1PV4A 1DZ1A 1G2TA 3MEHA 4YCUA 5GQOA 5C44G 3MFGA 1M4VA 5I9PA 1G6ZA 1CHPD 2PPBC 2ZXRA 3QWNA 1IBML 1NJIC 3R2IA 1Q81C 4DGZA 2JXMB 4N9PA 3TEHB 3R2TA 3DLLA 1YJNA 2RBMA 3K5MA 3S14B 1IYVA 1ET6A 3HOUG 1SRUA 3Q0AA 4NXNL 1G291 1LV9A 1I6HH 2VS1A 4QQBX 2EJGC 3U58A 4DR3L 2JYOA 3FPUB 2R61A 2RDHA 3KLSX 1KABA 2BOSA 3TN2A 1K0RA 1CT1D 2A5HA 1L0WA 4N8FA 1JB7A 3EA6A 3UDIA 1Z7TA 2I5LX 3ER0A 4RGNA 4IZ8A 1KC8C 1SE4A 4DV6Q 4RHRA 4HAEA 1KHIA 2UUCL 2NZ1D 1B4OA 5CMDA 5DAUA 1AZPA 4JG2A 1T9HA 3PV0A 4CKEA 4A3FH 2F0UA 2NBFA 3IKJA 4KLKA 3T1YQ 1R4QB 2L1BA 2F0EA 4OWTB 4GKJQ 2Z4HA 4DAYA 3M3YH 3D6WA 2A68D 1KQSA 2F0PA 1JQYD 1LTID 1SROA 1KAWA 4A3JH 5C4ZA 2C5CA 1VQPA 2PQAB 4HIKA 4KN7C 5BN3A 1HR0W 2VY3A 2AWOA 3S1NB 2QGQA 4IJHA 4Q0FA 2CHBD 1PH3A 3MXNA 1YNJD 4RKLA 3PO3H 3K5NA 4KY5A 2VB2X 1S5FD 2F4IA 2O2LD 1PFNA 2CQAA 1M8AA 4OELB 2F0QA 1C8CA 4OX9L 4DR1L 3DUZA 2WAQE 2IX3A 1I6VC 1SE8A 4UP9A 2QA4A 1CSQA 1VQ9A 1QNKA 1DD2A 5GAHC 4DV2L 4B3SL 1CHQD 2PI2A 3NTKA 3J7AV 2KA7A 2CW0D 4RGOS 5ELNA 3H09A 2Q2TA 1TKWB 4DR5L 1QVFA 4FXKC 1ILPA 1JC7A 3X3MA 3NWTA 5ELFA 1BUVT 3KJPA 4P75A 3PUXA 3Q24A 1HH2P 2N55A 2VZAA 3BU2A 5C44B 3J80i 1H9JA 5IE8A 2R7FA 1W6JA 1EU3A 3SK8A 2G9DA 2XTIA 2NWGA 4A93G 1QILA 3I90A 4L5QA 1OXSC 4A3KB 2L0CA 3C1FA 3IRBA 3TP7A 4CBVA 3DWAA 3PO2G 2CFMA 3HOUB 4DF7A 3IL8A 4QL5A 3LGJA 3J80c 1JORA 1B44D 5EPLA 5HGQA 1K73C 3QOLA 1LABA 3S1QH 4LUZA 1HQMC 3PUYA 4H44C 3HOYH 2ZJQA 1XMOL 1GOZA 4RGMA 2F0DA 5CGKA 1WCMB 3MHBA 4JI3L 3BG3A 4OO1G 2HQLA 3GTOB 3H0GG 2DNEA 2R93H 2K4KA 3RN2A 2JA6H 4JOIA 4EQ5A 4JI8L 1HZCA 4BBSH 1HA6A 3D4WA 1B70B 4TVAB 3IFDA 1EY8A 2B29A 3D4RA 1PRTB 5K36G 2NVYH 2YU9B 4BXXG 2HUGA 1F2LA 4GLXA 2IT1A 2DY8A 4HJ8A 1H9SA 3HS0C 1M1KC 1YNXA 4I65A 1L0YB 4HMIA 5LL6S 1EFWA 3AMUA 3FKIH 2GA4B 3D8GA 4Y7NH 5JJIA 5AFWA 1Y14B 4B3RL 4X6AH 3KF8A 4A3DH 3PF5A 1V8QA 3I72A 1ESRA 3CCRA 4DUYL 4B3MQ 5JOBA 4BA1I 3D31A 4UAIA 3BYYB 2B2UC 5M5YH 4O1NA 1MJEA 5IIFA 4QY7A 5LMUQ 4KD3A 1DCZA 2WKCA 4JI0Q 1MBYA 2E2DC 5C4XH 1KRTA 4JYAQ 1BBUA 2ICEC 2GVAA 2D2CC 1VQAA 2UXBQ 4LF9Q 1Q1EA 1KL9A 3T16A 4H13C 1PH6A 4HJAA 2VUMH 1F9SA 1RHPA 1IL8A 5BN5A 2UU9L 2KUMA 4J1MA 3STBD 4O0AA 1S5BD 4XYQA 3MXUA 1ONLA 2CCZA 1GJXA 4R8NA 2JA5B 3KDFB 2E5LQ 3C46A 3G6EA 3P20A 1STEA 1W6KA 2P5ZX 5C3EH 5C4JH 1O80A 1WD0A 4DAPA 5JEAJ 3S15H 4A93B 1CK1A 5HGTA 3CQZB 1HNXQ 2D62A 5C5LA 3PO2B 1TWFB 4IPGA 4X65L 3GTLH 4H7BA 2ZXPA 2D9UA 1BKBA 2ID0A 5CV9A 2E2HB 1VCIA 1PH2A 4GN3B 2EY5A 2JA9A 1C9OA 2N49A 2UXDQ 1JWMD 1IYUA 1F9RA 1U4PA 1X65A 4DFAA 2VQFL 2A6HD 3S2DB 1DXMA 4NXMQ 4DKAC 3G4SA 1IBLQ 2F0TA 1VMPA 3ICEA 3DHQA 5LMNW 2N78A 1S40A 3L0OA 1TXYA 1O7ZA 3NXWA 1FL0A 2M2LA 3LNNA 2BA1A 1IBMQ 3TZUA 2NN6H 2WB1E 1VQ7A 3BS1A 3T4AC 2AQ3B 3KFUA 2L15A 2JA7G 4K8JA 2KCCA 3AEVA 3K57A 4NXNQ 1E7ZA 1K83B 3S17H 3T56B 1GUNA 1N32Q 4DR3Q 2OCEA 4DAVA 3L3OC 3QB3A 1B50A 1JWSD 4R4OA 1YEZA 2QKIC 1PMRA 1YITA 5C0XG 3I56A 3DXJC 3MA2B 3ULJA 3BVMA 1EUJA 1ESFA 4DR4L 1PLFA 1Q7YC 2RQXA 4HCEA 4GNXA 4CKBA 1Y1VG 3KLRA 5IP7G 2UUCQ 1U4MA 3Q8DA 2HDMA 3K8AA 5T1GA 4JPBW 3I4MG 2PNHA 1K3RA 1ILQA 4I7ZC 2I5HA 4KTAA 3S14H 3AFPA 1DOKA 5DLQE 1K3BC 4RG1A 4K0KL 3LWUA 3VYRA 4JI5Q 2NVTB 1QZHA 5E1FA 3GO5A 1SYCA 1KRSA 3KLWA 1A0IA 5DM73 1CKMA 4DV5L 3GTGB 1TQOA 3CMEA 3TS0A 1SXTA 4X64L 1RODA 1P8LA 4B08A 4X3SA 4KHZA 5IGGA 1PRTD 1JE5A 1V43A 4PZ7A 4K14A 4JI7Q 1OXUA 2R7DA 1SNPA 1HRJA 2FMMA 2D5DA 1IBKQ 4OX9Q 4NW2A 2KBNA 4HSVA 2B3GA 2FHTA 1ZXTA 1SMYD 2B2YA 3GV3A 1QG7A 3M4QA 1R9TB 2L12A 3NSWA 5A2QL 2SDFA 4B3SQ 3M9BA 4K8IA 3EROA 3HKZG 3F1ZA 4C2MB 2SNSA 4R8IA 1C7YA 3HKSA 3OWEB 4EGVA 1VQOA 2IX1A 2K04A 2ZM6L 4DNIA 3PIP3 4AQYL 1JJCB 4R4IA 4RWSC 2B2VA 1I4RA 3HOVG 3SXHA 2VW9A 1N9WA 1CFMA 4IUQA 1BXTA 1D8LA 4K5XA 5ELCA 3I3CA 4CGYB 1TS2A 1QOHA 4RKBA 2LFNA 4C3HG 2R92G 2MO0A 4X66L 5E4XA 2JA7B 2ATWA 4R9WA 4EQOA 1VMCA 1SLJA 1OXTA 4JK1C 1EWHA 1L1OA 3A8KE 3VR6A 4DXGA 2A8VA 1ET9A 3AFQA 5EQ0A 5CV4A 2Q2HA 4FNFA 4ID6A 3K7UC 4UHVA 2JA8B 1MD2D 1GUOA 3H15A 4L6TB 1FVIA 4ZKBB 1AE2A 3CC7A 5C44H 3J80L 5A2QE 3OIQA 2KHSA 4BS9A 2ZTCA 4DR6L 5EBDA 1CA6A 1XMOQ 2A69C 3U9OA 5KIXA 1ICFB 4A3EG 3SDZA 3I55A 3I4NB 4QUCA 1NNXA 4P74A 4DU9A 4JI1L 3BDCA 5M9OA 1U5KA 1AZQA 1VF5C 4HCSA 1OTCA 5FLXc 4I7AA 4JI8Q 1X3FA 3HOUH 4X62L 3PF4A 1PVOA 1SNQA 4LJZC 2BDOA 4KD4A 4MHEA 2JEBI 4LFCQ 1OXXK 1HCZA 1B8AA 2R7ZB 2H4OA 4BWGB 1K8AC 3WWVA 5C5MA 3QIAA 2MPMA 1C48A 4AYBG 2AMCB 1LT3D 1DOLA 1Z47A 4RMFA 3M4PA 1I4GA 2G5DA 1NMGA 1FNWA 3NTIA 4IQZA 1WJJA 5LHY1 1SNOA 1X54A 2IHEA 4NPSA 2Y0SB 1Y8NB 4L63B 2M9VA 3IAYA 3FMCA 1A2TA 1YHAA 2YU9H 1B9NA 5BR8L 3NBHB 2CKZB 2NTTA 2PCFB 2F3VA 1HA5A 2QCPX 1PYSB 1JOOA 3HKZB 2KQ3A 1EY5A 4UPAA 1E1TA 4CKCA 2VXWA 4LAAA 1VQMA 4GS3A 2EVBA 3GV6A 1SDFA 5D65A 2UU9Q 1IKMA 4LF4Q 1PFBA 2CQOA 2ZXOA 3TDQA 3BDLA 4LUOA 3TRZA 2F0GA 5IWAL 1N33L 4LF7L 4DV3Q 2MHVA 1RCVD 1GHKA 2Z9HA 2O5IC 1K0SA 5F2DA 3F2DA 3D0FA 1WOCA 1VDZA 4A3CG 4KV6A 1R4PB 2L4NA 4C3HB 5KGUA 1WTVA 2R92B 1TS4A 4JW0A 1SFOH 1ML0D 2TSSA 2UUBL 2E75C 3J7AF 1N34L 1B3QA 4X65Q 2EPBA 3EQLC 4RCNA 3RZOH 1UAPA 4KKUA 1V1PA 5I6YA 1VQ4A 2MO1A 3O13A 2H5XA 1JCKB 3HGBA 5JPNC 1Z6HA 2VQFQ 3QJYA 2H1EA 5M3MB 4CJ1B 1CZGA 4M1UB 2A73B 1XPUA 1A2UA 2B2WA 2NN6I 1PZKD 1X6OA 2FINB 4A93H 5KYIA 1W2BA 1YJ9A 3CQZH 4NMZA 3AU7A 1CI3M 3PO2H 1FNUA 1TWFH 2E74C 4DV4L 5ISRA 2JN4A 3ERQA 3NENA 1K9MC 3K7AB 5IYBG 1U0LA 2E2HH 2CWPA 2VQEL 3AQQA 4K5VA 4F7XA 2AQ1B 2WIIB 3TZDA 4A3KG 3S2DH 4DAYB 2E76C 4AYBB 3CCSA 4JOIC 1VQDA 4OHJA 1EFID 2Z0SA 4OO1H 2IPKD 1BDOA 3VYTA 1G2SA 3H0GH 2F4VL 1EY9A 4DR4Q 2HIXA 3QO2A 5I2XA 3MXNB 2F3WA 2KECA 3KF6B 4GN4B 1I94L 2KEDA 1V1OA 1SJHD 5EKLA 5K36H 2DJGC 2PYKA 4BXXH 1WCMG 5K5PA 2V4DA 1CTMA 2E2IH 3GD7A 2IW3A 1BBWA 2NVXB 2K28A 5CR3A 2X6GA 3G6JB 2ZTEA 4DV5Q 2A6EC 1KDCA 3GDEA 4NDXA 1NUCA 2B63G 3PUVA 4UP7A 2MNAA 2AUJD 2PMZB 1CSPA 4IALA 4DK3C 2RKSA 2HHHQ 4DPGA 3CW2C 4HN7A 3A56A 1KD1C 4RGTA 4DR2L 3VR4A 1BO0A 4FF3A 2NZOA 1SAPA 3SE0A 4DV1L 1GKHA 4QIWE 3MXPA 2EYJA 3VR2A 1VF7A 1TT2A 3CPWA 1BVSA 3HOZG 1ASZA 4JI4L 4LNQA 3CCLA 4NP5A 3GQBA 4P72A 2LS01 1LT6D 2KEEA 1PTOC 3K6OA 2SNMA 4BY7G 4NB3A 4JBMA 1MKHA 1V1QA 2UUAL 3SEBA 2BDNA 4GKKQ 1XWEA 1O7YA 2CH4A 2ZM6Q 1MGSA 1G91A 2ICIA 2Z6KA 3I91A 3M4OB 4YCVA 4AQYQ 1NBWA 5ELEA 3UDGA 2EYHA 4IFDG 1YHBA 3CKIB 1LYLA 1VQLA 3CCUA 1R9TH 4LF6L 4ZQ3A 3K5LA 1ZYRC 2I07B 1EYCA 4MNOA 1PDQA 2JA5G 1H9KA 1XPRA 5EKKA 1WTQA 1EL0A 1F2ZA 1AH9A 5IP9G 4C2MH 4X66Q 3AB9A 1X32A 4BA2I 4JBJA 3F2UA 4JBKA 2F0NA 2RF4A 1Q86C 3TSSA 1WI5A 1EQQA 3MEFA 4ZAIA 1EU4A 5I6WA 3I8ZA 3OTOL 1PHJA 2PNRC 3KLSA 2YYZA 1YI2A 1L2FA 4RH6A 3QG1A 1E24A 4DV0Q 1H9SB 2CVRA 4DR6Q 1SYEA 1I5FA 1X3GA 1D6EC 3N52A 4IUTA 2HT1A 1I3QB 2A69D 3CRLC 3CCJA 3D6CA 2KCMA 3KF8B 4C1NI 3PUZA 4O2DA 2JA7H 3BVZA 3K5OA 1WTWA 4Q5VA 2K5NA 3RR5A 1UWVA 4X62Q 3SR1A 1J5EL 1VQJA 1MI2A 3OOCA 4PZ6A 4GNXC 4HIMA 1RIPA 5ELBA 1EIYB 5IY0A 2Z8LA 3PIO3 1Q46A 5C0XH 1EOTA 4IUUA 2AWNA 3S1MB 4C1NK 2K50A 4H02A 3J7A5 5CBEE 2B63B 1SR3A 1HUNA 5IYDG 5JJKA 1HPCA 1Y1VH 5IP7H 3CCMA 5IGCA 3OMCA 5J1ZA 3I4MH 5TSSA 5C3WA 4CJ2C 3H3VH 1IW7D 4K6DA 5CYUA 1JE4A 1IKLA 2F3IA 3FDTA 4LF8L 2F0OA 1HFGA 3H91A 2A19A 4QB4A 1XNRL 1I50H 2KCTA 4WJWA 3RN5A 3HOZB 3CPFA 4ZK9B 2XVSA 4APVA 1QWYA 1JICA 3TQYA 1XYIA 4BY7B 4LFBQ 4MTKA 3BZDB 5E4WC 3I73A 2B2YC 5KNCA 3HRZC 1TWGH 3T51B 3ITPA 1DOMA 4B3TL 2K33A 2QW7A 1N33Q 5L37A 1P16A 4LFAL 3U50C 4V190 1N36L 1MIUA 4X3UA 5I4DA 3PUWA 5FLXE 2Z1CA 5GROA 4WFN3 1S3OA 4QF4A 4XIGS 3KK7A 1E2ZA 1FNVA 4LF5L 2EOTA 4PV1C 1F9PA 2ALYB 2BH2A 2RVLA 3MFYA 1Q82C 4X3KA 3MC0B 1RDPD 4DK6C 2B2VC 1N34Q 1PA6A 4TRDA 1VQ5A 1E3PA 5G3LF 3J7YW 3N6RA 3WOFA 3J81E 4GLAC 2WAQG 1HNZQ 3E9IA 2K75A 3Q22A 2PQEA 3HOVH 1PH5A 1NY4A 3PCOB 2L11A 2K32A 3KBGA 4EQPA 2UXCL 1L1OC 4A3GG 3EVQA 3A74A 4C3HH 2R92H 3W1BA 2LXJA 2N88A 3E3XA 2JSOA 1WD1A 1ICWA 2CH4W 5HY6A 4QCLA 4V0BA 3WOEA 4DV4Q 1K28A 1PH7A 5CC4A 1J9OA 2I0QA 5CV6A 4YWKA 3F8TA 1LACA 4DR7L 4POGA 4OO1I 4G4KA 4ZRZA 1JJ2A 1RF2D 5KRUA 3RUZA 4ME3A 3SVMA 3EBEA 2BA0A 3T13A 4A3EH 1CKOA 1EY0A 3A0JA 1D1KA 1GO3E 2K03A 3QOJA 1HTPA 2K7VA 2QEXA 2MUYA 2OT2A 2SEBD 4FF2A 2JA8G 1CUKA 4ILWA 1EY7A 5A35A 4U673 4ABNA 4AYBE 1I94Q 1PH1A 3CAMA 1AP0A 1YJWA 4G7ZC 1EEID 4FP5D 3I4NG 4P2CB 2OTJA 2B2TC 3MAQA 1OO9B 1H9RA 4HMJA 1GUSA 1TWCB 1B2TA 3RLFA 3CP0A 1X3EA 1XXGA 2N3SA 4KHPL 2BH8A 3IFTA 1U4RA 1EQTA 2F1MA 1HZAA 3M3YB 2F0LA 5KEEA 1G51A 1E2WA 4A3JB 2A6ED 1JMCA 2R7ZG 4RA8A 1O7IA 3EN2A 4HIOA 3NHHA 2E8GA 4DV6L 4MTNA 2RCNA 1LUZA 2MP1A 2DUDA 4HR7B 4JV5L 4OEMB 4DR2Q 2F52A 2K5VA 2HD3A 5FO7B 3DM1A 5C4HA 1KLGD 3T1YL 3HP3A 2A68C 1TVXA 1QUQA 4DV1Q 2NVXH 4DR1Q 4FXDA 4IJLA 4PNYA 2Y0SG 1EY6A 4YWLA 2ZTDA 1PRTF 1Q3LA 5JEAG 2K6AA 3MZ5A 4PMCA 4JI4Q 2ZJRA 3M7GA 3QR8A 1PTOF 4DV2Q 1E1OA 2KHJA 2WAQB 2KHIA 2UUAQ 3S1NH 1A62A 3ERSX 1A3UA 1WTOA 2ENBA 5D3IB 1L1OB 3URYA 4DR5Q 4P73A 4R1JA 4DA2A 4X3TA 3HZXA 1H95A 1IZ6A 2RSNA 4A3GB 1C0AA 2PZTA 4A3CH 1BBXC 1M90C 4LF6Q 2L9HA 2F0JA 3CXCA 3NE5B 1D5XC 1NSNS 2F0IA 2WACA 1YVCA 2OTLA 4C3IG 4KN4C 1E2VA 2D0OA 4OWWB 5D3DA 2QDLA 2JEAI 1LO5D 2B2WC 1WTXA 4FXGC 1XTDA 4NKLA 4DUZL 3GTQB 3A7AB 4IO9A 2K52A 3I7FA 1Q1BA 4IPDA 3M4OH 4EVOA 2NVQB 4GOPA 1AN8A 4JBWA 5JJLA 4ZYSA 1PFMA 4L8JA 3I4LA 3GTPB 2O5JC 4LK1C 5M3MG 2KJXA 3A7LA 1WVLA 1IHZA 5IYBH 1HZ9A 4JVZA 3GTKB 5C0XI 4KJOA 4JI3Q 2MQHA 2FMCA 4A3KH 2RHSB 1QVCA 3CCVA 4BY1G 3ND8A 2F0KA 1HUMA 5M5WB 4DAMA 1BCPF 1DONA 4IUNA 3ZJYC 3J81i 3RZDB 3R8BA 4PZ8A 1XTCD 2BE5C 3H3VI 4KKTA 3TP5A 5J22A 2NVYB 1NMFA 2HIVA 1F2MA 1YNNC 4OIJA 1KNAA 1T5XD 2OQKA 4WORA 1I3QH 4DNTB 4LWCA 1RJTA 3J81c 1WCMH 4CDCC 2B2TA 3GTOH 1NCVA 1BNZA 2EYLA 2WV6D 4B3RQ 4DK0A 1AW7A 4FDBA 1VQCA 3EIVA 3G7LA 4AH6A 3HOWG 3UDXA 4DUYQ 3U4ZA 3X3NA 5J3BA 5EPJA 1LM0A 2K5DA 1Q8IA 1CKNA 3HOXG 2IL8A 4A75A 2QDBA 1A6XA 2B63H 5C4XB 5IGEA 4LUVA 2LSSA 1EYGA 3VYSA 1SNCA 4A3IG 1LTLA 1SN8A 1V1PB 4A3LG 1K8OA 2J4XA 1PYWD 2EYPA 3UDFA 4K2KA 5IOCA 1EZ8A 3DWQA 4B3TQ 1Q12A 2F0VA 1S72A 2JJQA 4LFAQ 5FJ8G 3L9AX 4FYDA 2Q8RE 1LTAD 1VQKA 3PGZA 5T1IA 3W2DA 4C3IB 4RAUC 1S5DD 1STGA 2FJ2A 4JI0L 3HOZH 2Z6KC 5C3EB 1J8IA 2ZJPA 3VA7A 4JYAL 4BY7H 1XJVA 1TWHB 2UXBL 4LF9L 3MTSA 1G8ZD 3BDOA 1HTLD 3K0YA 2A74C 3STBC 2WINB 4RFBA 1XMQL 3NQTA 5IYCG 1GXDC 3BZKA 5CV7A 1VQIA 1KIXA 4IFDH 1NAPA 1Q8KA 3GP7A 4YIJA 5GAGC 4YHHL 2VNUD 4J15A 1A63A 4HTHA 1RTOA 3K81C 4N8X1 2KOLA 2F0MA 4WJ4A 2OEOA 5DM63 2EQSA 2JA5H 2LKVA 2IY5B 4FF4A 1X3PA 3ONAB 1EEFD 3NBHA 3ND9A 5IP9H 1ENCA 3TP8A 3K80C 1FJGL 1SYBA 3DEPA 2I5MX 2MJ8A 4BY1B 1QB5D 2D0PA 3PIOA 1ASYA 5EGTA 3Q23A 1FGBD 1K8MA 5EAYA 4A76A 4YCWA 1FGUA 3NEMA 3BYTB 3FEWX 2WB1B 2HDLA 3TS2A 1UEAB 4R4TA 5I9OA 5IT9c 4NXML 1GUGA 4WJ3M 4BBRG 4DK1A 1IBLL 2B8GA 1SBBB 2PW7A 3SK4A 2JK8A 5C6AA 3PMFA 3H94A 1TS3A 2QEJC 1WYDA 1DGSA 2PZWA 4C3JG 2QF7A 1KLUD 3DEOA 2X69A 3HOWB 4IN3A 1I4PA 4UP8A 2OWOA 1TY2A 1RL2A 3FRPB 4TQUS 1D2BA 4L5RC 2K14A 3HOXB 3JAMc 1CQFA 4KHPQ 5IYDH 4K0KQ 3KJOA 1Y8OB 1K83H 3E9HA 1N32L 1W3SA 1FR3A 2R3ZA 2LMCB 1E0BA 4A3IB 2K01A 5M3FG 3S2HB 1GUTA 2XIWA 2RCFA 1VQ8A 1JOQA 4X64Q 2Q2UA 4CHTB 4KHVA 3FHWA 4HEDA 5EBCA 4JV5Q 1UE5A 1DM0B 4ODGA 3GTMB 1TWCH 1HJPA 1A8VA 3U9SA 4JI6L 4DV7L 2K05A 1TIID 2AHOB 3R3OA 4JI5L 1RD9D 3H6MA 2NVTH 1LTSD 1IXRA 1S5ED 2GVBA 3RMHA 5FLMG 4CJ0B 2NYZD 4R4CA 1WTPA 1HR0L 3GTGH 2XGTA 3OPOA 1PRTC 2PO4A 1EYAA 1Y69U 1Y8PB 3NP8A 2F0SA 3L7ZC 1Q90A 3KF6A 4QMGA 5JVH3 2XNAC 1YBYA 1JT8A 4JI7L 1N8RC 3VR3A 4YY3L 1PZJD 2B39A 1F9QA 5M5XB 3M4YA 4QJFA 1IYJB 1IBKL 1NR2A 1SMYC 1U4LA 4B9XA 1CZWA 1TWAB 1E22A 2NZHA 4ALPA 1BR9A 1I4XA 2JP1A 4KKSA 1EIGA 3NWSA 4JI2L 4UY8C 1B1ZA 4GN5A 3UE0A 1STYA 4A3MG 1UE1A 3DWPA 1WTRA 4DUZQ 1YZ6A 1RKNA 4KMUC 1WTHA 1A15A 3K58A 4P71A 1EIFA 2PQAA 2J7ZA 5AJ3L 2E2JB 4HSPA 4A4IA 3F2BA 4A3GH 3P75A 1EQRA 4PMWA 1F2YA 5KNDA 1XNQL 4BBRB 4MIUA 1MSHA 1PZID 3MWYW 4XT3B 4A3BG 1YIJA 4MN3A 2GN5A 5DEHA 5FKAC 4C3JB 5D14A 1QNUA 1Y1WG 1NTGA 4F87A 1QJOA 3P1HA 2NB0A 1HQRD 1KDAA 3E0EA 4KJNA 4XYOA 3GTQH 4JI1Q 2YTXA 1JWUD 3SGIA 3HEJA 1II3A 4XQQA 1HFNA 1STNA 4GLVB 3A5UA 1PH4A 4EQNA 2V1CC 4MZ9A 5J39A 2XSCA 1LTGD 3ULPA 1HXYD 2C35B 2NVQH 3SHLA 2A1AA 1EWCA 1T5EA 5FLXL 1BCPC 3HG9A 5M3FB 2JA8H 2BE5D 3MVVA 5IGDA 1ZKOA 2NUCA 3GTPH 2SOBA 4TKOB 1LTTD 1XPOA 5COYA 3GTKH 1YNND 3I4NH 5ELDA 4KI0A 2Q8IB 3NTHA 2K1BA 1KXLA 3S24A 4IPHA 5M5WH 1QE6A 1FD7D 1V9PA 3BJUA 3J81L 1G6PA 2I46A 4O42A 1B53A 1SYDA 3RZDH 5EKIA 4G7HC 1B9MA 4IOAA 4LFCL 3A8JE 1D5MC 2EIFA 2VL6A 3VYUA 1L0XB 5BR8Q 1EOVA 1B3AA 1JJGA 4OGQC 3G48A 1MJCA 2R7ZH 4CDFC 4A3FG 1PTOB 3CMAA 5KNBA 4FF1A 2HCIA 2F0HA 4ZLTF 2Y0SE 5C0XJ 4L5SA 1PH8A 2NTSA 3OSOA 2FFKB 2YV5A 1EY4A 3E6ZX 4QGUA 4XT1B 4ZCKA 3W5OA 3PQIA 3S16B 2WKDA 3TP6A 4A3JG 4RCOA 5FK9C 3I70A 3PIPA 2EY6A 5IWAQ 4LF7Q 2XRSD 5JEAH 3HKZE 1D5ZC 3PO3G 4XQJA 4A3MB 3E0JA 3CF5A 4IFDI 1CA5A 4IPCA 1YHQA 1SNMA 1HHVA 3S1RB 1O7LA 4DXFA 1SFOB 3GTJB 3W1GA 1XMQQ 1GD7A 2UUBQ 1VQFA 4LF4L 3VDYA 3RZOB 1PXUA 3TREA 2HCCA 4YHHQ 4K2LA 1I4HA 2XN9C 4YWMA 1JB3A 1UEBA 5G3LD 3T1HL 4DV3L 1QCBD 4A3BB 1SMXA 1AEXA 4C3IH 5KYLA 1VQEA 4L5TA 1Y1WB 2R6GA 1EWIA 3A8IE 4KY7A 1FJGQ 4GOPC 1TWHH 1EQVA 4OONA
chains in the Genus database with same CATH topology
5JVG3 2DY7A 2G9HD 2EJMA 1BCPB 2ZT9C 4ZUIA 4OIKA 2RDGA 2JE6I 2XWJB 3R93A 2OXPA 4XDXA 5C3XA 2F0WA 2EDGA 1ZEQX 1I6HB 2EY2A 4F88A 5IGFA 1TU2B 3H0GB 1ENFA 2F0FA 1UNSA 5IT9L 4IUVA 3TMEA 2AUKA 2EYMA 3V96A 4N9TA 1UUPA 4UDUC 4PQXA 2B8FA 5NUCA 1JOKA 2EY1A 3SK6A 4A3FB 2E2IB 5CV5A 3S9WA 1SJED 3JAML 1EZ6A 2EXZA 1TS5A 4FVMA 3VA5A 3A54A 2LY7A 1C4QA 3OHXC 1SNDA 3WDNA 3CHBD 1JR0D 3PO3B 5HURA 3EFXD 4OL7A 3H3VC 3EJIA 1TY0A 2X6LA 3FPPA 2TMPA 5FOBB 5FO9B 5IT9E 2VB3X 3ZYYX 4F8MA 2PZUA 4PMBA 4QIWB 1X3QA 1EIHA 1YNJC 1LT4D 2F03A 2B2UA 3MXGA 4J8QA 1PTOD 2K5WA 4KK7A 3NPPA 4ZKCB 5IODA 2EE1A 2RDFA 2XRQD 4GZYC 4Z9CB 1KDBA 2IX0A 4G57A 1A3TA 3JAME 2QILA 4IUPA 4FO2A 3W3AA 2CW0C 2WP8J 1ZYRD 1I4QA 3A55A 4XQNA 2M00A 4XXEA 3DMUA 2J0TD 5IGBA 4U68A 3SK5A 4G7OC 1AFPA 4RHSA 1S5CD 3FVQA 4DNRB 3E5SA 1STAA 3BVGA 3S1QB 5JAVA 3C1EA 1GUWA 3HOYB 4J6HA 3VR5A 5DNFA 2K5QA 1NR4A 1CQVA 4B9WA 2R93B 2JA6B 4BBSB 4XTCS 1STHA 1F77A 5LL6X 2NN6G 2MGSA 3K59A 4QUFA 2HQEA 5EPKA 1BQQT 1ENAA 1BCPD 3NUCA 1Y1VB 1MSGA 1U9RA 4TSSA 1KAAA 2PW5A 1CM9A 4K5WA 3I4MB 3OW7A 1KNEA 1DJRD 1FYCA 2DNCA 2IJ0A 3FKIB 4Y7NB 2EJFC 4DN4M 2C9OA 5JJZA 3M85A 4A3DB 3CRKC 5EJWA 1I50B 4E6IA 1LLRD 4S3SA 1H9MA 3KBXA 4M8AA 5M5YB 3NBIA 2IWHA 1EYDA 1OXVA 5FO8B 3D4DA 1SE3A 3LX0A 3Q6SA 2L5TA 4ME5A 5CV8A 1IW7C 1DYQA 4IURA 2EYFA 2AQ2B 2RSOA 2EYOA 2Q8TA 1SSOA 1BOSA 3C2PA 1TWGB 3NQIA 2VUMB 1KTKA 3UI2A 3LWEA 1STBA 3M7NA 5BN4A 1O78A 5I2YA 3J80E 3CU7A 1PTOH 5CORA 4ULLA 5JPMC 5C4JB 2KVMA 2L55A 1BF4A 1LTBD 3S15B 1D1IA 2KCNA 3OIPA 2Z4IA 1SE2A 1A3VA 2O4XA 4WRDA 3TBIB 1S4ZA 3GTLB 1LT5D 4K6LA 4ZUJA 3HOVB 4C56C 1XX8A 1LTRD 3NK9A 3V2TA 3D3RA 3RD4A 1GHJA 2OF1A 4LMQD 2RA4A 5E3FA 5CBAE 2EZVA 4KY6A 1SEBD 3KUPA 4H0LC 2XWBB 3V05A 3OMGA 2A6HC 1TR5A 3OWFA 4A3EB 4IFDJ 3S17B 1RTNA 2BCOA 3T53B 1SYGA 2DN8A 3P7JA 1SYFA 3C3LA 1DZ1A 1G2TA 3MEHA 3MFGA 1M4VA 5I9PA 1G6ZA 1CHPD 2PPBC 2ZXRA 3QWNA 3R2IA 4DGZA 2JXMB 4N9PA 3R2TA 2RBMA 3K5MA 3S14B 1IYVA 1ET6A 3Q0AA 1G291 1LV9A 2EJGC 2JYOA 3FPUB 2R61A 2RDHA 3KLSX 1KABA 2BOSA 3TN2A 1CT1D 2A5HA 3EA6A 1Z7TA 4RGNA 4IZ8A 1SE4A 4RHRA 4HAEA 2NZ1D 1B4OA 5CMDA 5DAUA 1AZPA 4CKEA 3PV0A 2F0UA 2NBFA 3IKJA 1R4QB 2L1BA 2F0EA 2Z4HA 4DAYA 3D6WA 2A68D 2F0PA 1JQYD 1LTID 5C4ZA 2C5CA 4KN7C 5BN3A 2AWOA 3S1NB 4Q0FA 2CHBD 3MXNA 1YNJD 4RKLA 3K5NA 4KY5A 2VB2X 1S5FD 2F4IA 2O2LD 1PFNA 2CQAA 1M8AA 2F0QA 1C8CA 3DUZA 2IX3A 1I6VC 1QNKA 1DD2A 1CHQD 3NTKA 3J7AV 2KA7A 2CW0D 4RGOS 3H09A 1TKWB 4FXKC 1ILPA 1JC7A 3X3MA 3NWTA 5ELFA 1BUVT 3PUXA 3Q24A 2N55A 5C44B 1H9JA 1W6JA 1EU3A 3SK8A 2G9DA 2NWGA 1QILA 3I90A 1OXSC 4A3KB 2L0CA 3C1FA 3TP7A 4CBVA 3DWAA 3HOUB 4DF7A 3IL8A 1JORA 1B44D 5EPLA 3QOLA 1LABA 1HQMC 3PUYA 4H44C 1GOZA 4RGMA 2F0DA 5CGKA 1WCMB 3MHBA 3BG3A 4OO1G 3GTOB 2DNEA 1HA6A 3D4WA 3IFDA 1EY8A 3D4RA 1PRTB 5K36G 2YU9B 2HUGA 1F2LA 2IT1A 2DY8A 1H9SA 3HS0C 4I65A 1L0YB 4HMIA 5LL6S 3AMUA 2GA4B 3D8GA 5AFWA 3KF8A 1V8QA 3I72A 1ESRA 5JOBA 4BA1I 3D31A 4UAIA 3BYYB 2B2UC 4O1NA 5IIFA 4KD3A 1DCZA 2WKCA 1MBYA 2E2DC 2ICEC 2D2CC 1Q1EA 3T16A 4H13C 1F9SA 1RHPA 1IL8A 5BN5A 2KUMA 4J1MA 1S5BD 4XYQA 3MXUA 1ONLA 1GJXA 4R8NA 2JA5B 3C46A 3P20A 1STEA 1W6KA 1O80A 1WD0A 4DAPA 5JEAJ 4A93B 1CK1A 5HGTA 3CQZB 2D62A 5C5LA 3PO2B 1TWFB 4H7BA 2ZXPA 2D9UA 2ID0A 5CV9A 2E2HB 1VCIA 2EY5A 1JWMD 1IYUA 1F9RA 1U4PA 4DFAA 2A6HD 3S2DB 1DXMA 2F0TA 1VMPA 3DHQA 1O7ZA 3NXWA 2M2LA 3LNNA 2BA1A 3TZUA 2NN6H 3BS1A 3T4AC 2AQ3B 4K8JA 2KCCA 3K57A 1K83B 3T56B 1GUNA 4DAVA 3L3OC 3QB3A 1B50A 1JWSD 2QKIC 1PMRA 5C0XG 3DXJC 3MA2B 3BVMA 1ESFA 1PLFA 2RQXA 4HCEA 4CKBA 3KLRA 1U4MA 2HDMA 5T1GA 1ILQA 4I7ZC 4KTAA 1DOKA 3LWUA 3VYRA 2NVTB 5E1FA 3GO5A 1SYCA 5DM73 3GTGB 1TQOA 1SXTA 1RODA 4B08A 4X3SA 4KHZA 5IGGA 1PRTD 1V43A 4K14A 1OXUA 1SNPA 1HRJA 2FMMA 2D5DA 4NW2A 4HSVA 2FHTA 1ZXTA 1SMYD 2B2YA 3GV3A 1QG7A 1R9TB 2L12A 3NSWA 5A2QL 2SDFA 4K8IA 3EROA 4C2MB 2SNSA 4R8IA 3OWEB 4EGVA 2IX1A 2K04A 3PIP3 4RWSC 2B2VA 1I4RA 3SXHA 1CFMA 4IUQA 1BXTA 4K5XA 5ELCA 3I3CA 4CGYB 1TS2A 1QOHA 4RKBA 2LFNA 4C3HG 5E4XA 2JA7B 4R9WA 4EQOA 1VMCA 1OXTA 4JK1C 1EWHA 3A8KE 3VR6A 4DXGA 1ET9A 5EQ0A 5CV4A 4FNFA 4ID6A 2JA8B 1MD2D 1GUOA 4L6TB 4ZKBB 3J80L 5A2QE 3OIQA 2KHSA 4BS9A 5EBDA 1CA6A 3U9OA 2A69C 5KIXA 3SDZA 3I4NB 4QUCA 4DU9A 3BDCA 5M9OA 1AZQA 1VF5C 4HCSA 1SNQA 4LJZC 2BDOA 4KD4A 4MHEA 2JEBI 1OXXK 1HCZA 2R7ZB 2H4OA 4BWGB 5C5MA 3QIAA 2MPMA 1C48A 1LT3D 1DOLA 1Z47A 1I4GA 1FNWA 3NTIA 4IQZA 5LHY1 1SNOA 2Y0SB 1Y8NB 4L63B 2M9VA 3IAYA 3FMCA 1A2TA 1B9NA 2NTTA 2PCFB 2F3VA 1HA5A 2QCPX 1JOOA 3HKZB 2KQ3A 1EY5A 4CKCA 2VXWA 4LAAA 2EVBA 3GV6A 1SDFA 5D65A 1IKMA 1PFBA 2ZXOA 3TDQA 3BDLA 2F0GA 2MHVA 1RCVD 1GHKA 2O5IC 5F2DA 1VDZA 4C3HB 1R4PB 2L4NA 4KV6A 5KGUA 1WTVA 2R92B 1TS4A 1ML0D 2TSSA 2E75C 3J7AF 2EPBA 3EQLC 4RCNA 1UAPA 4KKUA 1V1PA 5I6YA 3O13A 1JCKB 3HGBA 5JPNC 1Z6HA 3QJYA 2H1EA 5M3MB 4CJ1B 1CZGA 4M1UB 2A73B 1A2UA 2B2WA 2NN6I 1PZKD 2FINB 5KYIA 4NMZA 3AU7A 1CI3M 1FNUA 2E74C 5ISRA 3ERQA 3K7AB 4K5VA 4F7XA 2AQ1B 2WIIB 3TZDA 2E76C 4AYBB 4OHJA 1EFID 4OO1H 2IPKD 1BDOA 3VYTA 1G2SA 1EY9A 3QO2A 5I2XA 2F3WA 2KECA 2KEDA 1V1OA 1SJHD 5EKLA 5K36H 2PYKA 5K5PA 2V4DA 1CTMA 3GD7A 2IW3A 2NVXB 2K28A 5CR3A 2X6GA 3G6JB 2A6EC 1KDCA 4NDXA 1NUCA 3PUVA 2AUJD 2PMZB 4IALA 2RKSA 4HN7A 3A56A 4RGTA 3VR4A 1BO0A 4FF3A 3SE0A 1SAPA 3MXPA 2EYJA 3VR2A 1VF7A 1TT2A 4NP5A 3GQBA 2LS01 1LT6D 2KEEA 1PTOC 3K6OA 2SNMA 3SEBA 2BDNA 1XWEA 1O7YA 1G91A 1MGSA 2ICIA 3I91A 3M4OB 5ELEA 2EYHA 4IFDG 3CKIB 4ZQ3A 3K5LA 1ZYRC 2I07B 1EYCA 1PDQA 1H9KA 5EKKA 1WTQA 1EL0A 1F2ZA 3AB9A 1X32A 4BA2I 3F2UA 2F0NA 3TSSA 4ZAIA 1EU4A 5I6WA 3I8ZA 2PNRC 3KLSA 2YYZA 4RH6A 3QG1A 1H9SB 2CVRA 1SYEA 1D6EC 3N52A 4IUTA 1I3QB 2A69D 3CRLC 3D6CA 4C1NI 3PUZA 3BVZA 3K5OA 1WTWA 4Q5VA 3SR1A 1MI2A 3OOCA 5ELBA 2Z8LA 3PIO3 5C0XH 1EOTA 4IUUA 2AWNA 3S1MB 4C1NK 5CBEE 2B63B 1HUNA 1HPCA 5IGCA 3OMCA 5J1ZA 5TSSA 5C3WA 4CJ2C 1IW7D 4K6DA 5CYUA 1JE4A 1IKLA 3FDTA 2F0OA 1HFGA 3H91A 4QB4A 4WJWA 3HOZB 4ZK9B 2XVSA 1QWYA 1JICA 1XYIA 4BY7B 3BZDB 5E4WC 3I73A 2B2YC 5KNCA 3HRZC 3T51B 3ITPA 1DOMA 2K33A 4V190 4X3UA 5I4DA 3PUWA 5FLXE 2Z1CA 4WFN3 4QF4A 4XIGS 3KK7A 1E2ZA 1FNVA 2EOTA 4PV1C 1F9PA 2RVLA 3MFYA 4X3KA 1RDPD 3MC0B 2B2VC 4TRDA 5G3LF 3J7YW 3N6RA 3WOFA 3J81E 3Q22A 2PQEA 2L11A 2K32A 3KBGA 4EQPA 3EVQA 2N88A 2JSOA 1WD1A 1ICWA 4QCLA 4V0BA 3WOEA 5CC4A 1J9OA 5CV6A 1LACA 4OO1I 4G4KA 4ZRZA 1RF2D 5KRUA 3RUZA 3SVMA 2BA0A 3T13A 1EY0A 1D1KA 2K03A 3QOJA 1HTPA 2K7VA 2MUYA 2OT2A 2SEBD 4FF2A 4ILWA 1EY7A 5A35A 4U673 4ABNA 1AP0A 4G7ZC 1EEID 4FP5D 4P2CB 2B2TC 3MAQA 1OO9B 1H9RA 4HMJA 1GUSA 1TWCB 1B2TA 3RLFA 1XXGA 3IFTA 1U4RA 1EQTA 2F1MA 3M3YB 2F0LA 5KEEA 1E2WA 4A3JB 2A6ED 4RA8A 3NHHA 2MP1A 4HR7B 5FO7B 3DM1A 5C4HA 1KLGD 3HP3A 2A68C 1TVXA 4FXDA 4PNYA 1EY6A 1PRTF 1Q3LA 5JEAG 2K6AA 3MZ5A 4PMCA 3M7GA 1PTOF 2WAQB 1WTOA 1A3UA 2ENBA 5D3IB 3URYA 4DA2A 4X3TA 3HZXA 2RSNA 4A3GB 2PZTA 1BBXC 2L9HA 2F0JA 3NE5B 1D5XC 1NSNS 2F0IA 2WACA 4C3IG 4KN4C 1E2VA 5D3DA 2JEAI 1LO5D 2B2WC 1WTXA 4FXGC 4NKLA 3GTQB 3A7AB 1Q1BA 4EVOA 2NVQB 1AN8A 4JBWA 4ZYSA 1PFMA 4L8JA 3I4LA 3GTPB 2O5JC 4LK1C 2KJXA 3A7LA 1WVLA 1IHZA 3GTKB 5C0XI 4KJOA 2FMCA 3ND8A 2F0KA 1HUMA 5M5WB 1BCPF 1DONA 4IUNA 3RZDB 3R8BA 1XTCD 2BE5C 4KKTA 3TP5A 5J22A 2NVYB 1F2MA 1YNNC 4OIJA 1KNAA 1T5XD 4WORA 4DNTB 1RJTA 2B2TA 1NCVA 1BNZA 2EYLA 2WV6D 4DK0A 1AW7A 3G7LA 3X3NA 5EPJA 2K5DA 1Q8IA 2IL8A 2QDBA 1A6XA 5C4XB 5IGEA 3VYSA 1SNCA 1V1PB 1K8OA 2J4XA 1PYWD 2EYPA 4K2KA 5IOCA 1EZ8A 3DWQA 1Q12A 2F0VA 3L9AX 4FYDA 2Q8RE 1LTAD 5T1IA 3W2DA 4C3IB 4RAUC 1S5DD 1STGA 2FJ2A 5C3EB 1J8IA 3VA7A 1TWHB 3MTSA 1G8ZD 3BDOA 1HTLD 3K0YA 2A74C 2WINB 4RFBA 3NQTA 1GXDC 5CV7A 4IFDH 1NAPA 3GP7A 4YIJA 2VNUD 4HTHA 1RTOA 2KOLA 2F0MA 2OEOA 5DM63 2LKVA 4FF4A 1X3PA 3ONAB 1EEFD 3NBHA 3ND9A 1ENCA 3TP8A 1SYBA 3DEPA 2MJ8A 4BY1B 1QB5D 5EGTA 3Q23A 1FGBD 1K8MA 3BYTB 3FEWX 2WB1B 2HDLA 5I9OA 1UEAB 1GUGA 4DK1A 2B8GA 1SBBB 2PW7A 3SK4A 5C6AA 3PMFA 3H94A 1TS3A 2QEJC 2PZWA 4C3JG 2QF7A 1KLUD 3DEOA 2X69A 3HOWB 4IN3A 1I4PA 1TY2A 3FRPB 4TQUS 1D2BA 3HOXB 1CQFA 1Y8OB 1FR3A 2R3ZA 2LMCB 1E0BA 4A3IB 2K01A 3S2HB 1GUTA 2XIWA 1JOQA 4CHTB 4KHVA 5EBCA 4HEDA 1DM0B 4ODGA 3GTMB 3U9SA 2K05A 1TIID 3R3OA 1RD9D 3H6MA 1LTSD 1S5ED 3RMHA 4CJ0B 2NYZD 1WTPA 3OPOA 1PRTC 2PO4A 1EYAA 1Y69U 1Y8PB 3NP8A 2F0SA 3L7ZC 1Q90A 4QMGA 5JVH3 2XNAC 3VR3A 1PZJD 2B39A 1F9QA 5M5XB 3M4YA 1NR2A 1SMYC 1U4LA 4B9XA 1CZWA 1TWAB 1BR9A 1I4XA 2JP1A 4KKSA 1EIGA 3NWSA 1B1ZA 1STYA 3DWPA 1WTRA 1RKNA 4KMUC 1A15A 3K58A 2J7ZA 2E2JB 4HSPA 3P75A 4PMWA 1F2YA 5KNDA 4BBRB 4MIUA 1MSHA 1PZID 3MWYW 4XT3B 4MN3A 5DEHA 5FKAC 4C3JB 5D14A 1QNUA 4F87A 1QJOA 3P1HA 2NB0A 1HQRD 1KDAA 4KJNA 4XYOA 1JWUD 3HEJA 1II3A 4XQQA 1HFNA 1STNA 4EQNA 5J39A 2XSCA 1LTGD 1HXYD 3SHLA 1EWCA 1T5EA 5FLXL 1BCPC 3HG9A 5M3FB 2BE5D 3MVVA 5IGDA 1ZKOA 2NUCA 2SOBA 4TKOB 1LTTD 5COYA 1YNND 5ELDA 4KI0A 2Q8IB 3NTHA 2K1BA 1QE6A 1FD7D 3J81L 4O42A 2I46A 1B53A 1SYDA 5EKIA 4G7HC 1B9MA 3A8JE 1D5MC 3VYUA 1L0XB 1B3AA 4OGQC 1PTOB 5KNBA 4FF1A 2HCIA 2F0HA 4ZLTF 5C0XJ 2NTSA 3OSOA 2FFKB 1EY4A 3E6ZX 4XT1B 3S16B 2WKDA 3TP6A 4RCOA 5FK9C 3I70A 2EY6A 2XRSD 5JEAH 1D5ZC 4XQJA 4A3MB 3E0JA 4IFDI 1CA5A 1SNMA 1HHVA 3S1RB 1O7LA 4DXFA 1SFOB 3GTJB 3RZOB 1PXUA 2HCCA 4K2LA 1I4HA 2XN9C 1JB3A 5G3LD 1QCBD 4A3BB 1AEXA 5KYLA 1Y1WB 2R6GA 3A8IE 4KY7A 1EQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB2 X;  2QCP X;  2VB3 X;  3E6Z X;  3TDQ A;  1ZEQ X;  2L55 A; 
#chains in the Genus database with same CATH topology
 5JVG 3;  2DY7 A;  2G9H D;  3I4O A;  2EJM A;  4GNX B;  3CCE A;  1BCP B;  4PG3 A;  2ZT9 C;  4ZUI A;  2VQE Q;  4OIK A;  2RDG A;  2JE6 I;  3JC6 6;  2XWJ B;  2WFW A;  3R93 A;  5M3M H;  2OXP A;  4XDX A;  5C3X A;  2ASB A;  2F0W A;  2EDG A;  1ZEQ X;  5LMN L;  1I6H B;  3KDF A;  2EY2 A;  4F88 A;  5IGF A;  1HNW L;  1TU2 B;  3H0G B;  1GM5 A;  1ENF A;  2F0F A;  2F4V Q;  3KYH C;  1UNS A;  4BY1 H;  5IT9 L;  4IUV A;  3TME A;  2AUK A;  2EYM A;  3HOY G;  3V96 A;  4EX5 A;  4N9T A;  1UUP A;  4UDU C;  4PQX A;  3K7A H;  2B8F A;  5NUC A;  1QUQ B;  1JOK A;  2EY1 A;  3SK6 A;  4A3F B;  2E2I B;  5CV5 A;  2R93 G;  2OQ0 A;  2JA6 G;  3S9W A;  4BBS G;  2IHF A;  1SJE D;  3JAM L;  1EZ6 A;  1WFQ A;  1TS5 A;  2EXZ A;  3A5Z B;  4FVM A;  3VA5 A;  5GAE C;  3A54 A;  3KOJ A;  2LY7 A;  1B7Y B;  1C4Q A;  3OHX C;  3HOW H;  3BZC A;  1SND A;  3WDN A;  4HJ5 A;  2N8N A;  3CHB D;  3HOX H;  1JR0 D;  3FKI G;  3PO3 B;  5HUR A;  1NE3 A;  3EFX D;  4JI6 Q;  4DV7 Q;  2PI2 E;  4OL7 A;  3F2C A;  1VQN A;  3H3V C;  3EJI A;  4A3D G;  1TY0 A;  2X6L A;  3FPP A;  2TMP A;  5FOB B;  5FO9 B;  4A3I H;  4GKJ L;  2PMZ E;  3S2H H;  3CC4 A;  4A3L H;  1HR0 Q;  1AE3 A;  5FJ8 H;  5IT9 E;  5C4X G;  2VB3 X;  3ZYY X;  4F8M A;  2PZU A;  3I2Z A;  4PMB A;  4QIW B;  1X3Q A;  3RLO A;  1EIH A;  1Z9F A;  1YNJ C;  1QVG A;  1LT4 D;  3NEL A;  2F03 A;  2HHH L;  2B2U A;  3MXG A;  4J8Q A;  4YY3 Q;  4OXP A;  1PTO D;  3GTM H;  4GOP B;  2K5W A;  2YTY A;  4KK7 A;  4CDE C;  2VUM G;  3NPP A;  4ZKC B;  5IOD A;  2Q2I A;  2EE1 A;  2RDF A;  2XRQ D;  4GZY C;  4Z9C B;  1KDB A;  4JI2 Q;  2IX0 A;  4G57 A;  1A3T A;  4OWX B;  3DM3 A;  3JAM E;  2QIL A;  3J81 j;  2JQO A;  4IUP A;  5IYC H;  4FO2 A;  3FP9 A;  3W3A A;  2CW0 C;  2WP8 J;  1ZYR D;  5C3E G;  1I4Q A;  3A55 A;  4XQN A;  2M00 A;  1IL2 A;  4XXE A;  3DMU A;  2J0T D;  5IGB A;  5AJ3 Q;  4U68 A;  3U4V A;  4GKK L;  3SK5 A;  1D7Q A;  5M5X H;  3CD6 A;  3AYH B;  4G7O C;  1HZB A;  1AFP A;  4RHS A;  1XNQ Q;  3OTO Q;  1S5C D;  3FVQ A;  1TWA H;  4DNR B;  1VQB A;  3E5S A;  1STA A;  3BVG A;  1QZG A;  2FXQ A;  1UE7 A;  3OW2 A;  3S1Q B;  5JAV A;  3C1E A;  1GUW A;  3HOY B;  4Y52 H;  3OYY A;  4J6H A;  1VQ6 A;  5H1S E;  3VR5 A;  5DNF A;  2K5Q A;  1NR4 A;  2E2J H;  4AIM A;  3K0X A;  1CQV A;  4B9W A;  2R93 B;  1J5E Q;  2JA6 B;  3HFZ B;  4BBS B;  1CKN B;  4XTC S;  2KEN A;  1STH A;  2ES2 A;  1F77 A;  3CC2 A;  4BBR H;  5LL6 X;  2NN6 G;  2MGS A;  3K59 A;  3CCQ A;  4QUF A;  2HQE A;  5EPK A;  4CDD C;  4DV0 L;  5ELO A;  1BQQ T;  1ENA A;  4C3J H;  1BCP D;  3NUC A;  1Y1V B;  1PYB A;  1MSG A;  1U9R A;  4TSS A;  1KAA A;  3G71 A;  2WB1 G;  2PW5 A;  1CM9 A;  4K5W A;  3I4M B;  3OW7 A;  1KNE A;  1MHW C;  1DJR D;  2DJF C;  4HID A;  1FYC A;  2DNC A;  2IJ0 A;  3FKI B;  4HJ9 A;  4Y7N B;  2EJF C;  4DN4 M;  4LF8 Q;  2C9O A;  5JJZ A;  3M85 A;  4A3D B;  3CRK C;  5EJW A;  2LXK A;  1I50 B;  1XNR Q;  4E6I A;  1LLR D;  4S3S A;  5M3F H;  1H9M A;  3KBX A;  4M8A A;  5GAD C;  5M5Y B;  1PH9 A;  3NBI A;  2IWH A;  3S1M H;  3B6Y A;  1EYD A;  1PFS A;  1OXV A;  5FO8 B;  3D4D A;  4POF A;  1SE3 A;  3LX0 A;  3Q6S A;  2L5T A;  4ME5 A;  5CV8 A;  1IW7 C;  1DYQ A;  4IUR A;  2EYF A;  2AQ2 B;  2RSO A;  2EYO A;  2Q8T A;  1SSO A;  1BOS A;  2RHQ B;  3C2P A;  1TWG B;  3NQI A;  2VUM B;  1KTK A;  4HJ7 A;  3UI2 A;  4JC0 A;  3LWE A;  1STB A;  3M7N A;  1N36 Q;  4B3M L;  5BN4 A;  4JCV E;  3RLN A;  5FLM H;  1O78 A;  5I2Y A;  3PSI A;  1UE6 A;  3CU7 A;  1PTO H;  5COR A;  4ULL A;  2EXD A;  3J80 E;  4R4Q A;  5JPM C;  5LMU L;  4LF5 Q;  1VS0 A;  5C4J B;  2KVM A;  2L55 A;  1BF4 A;  1LTB D;  5E7N A;  3S15 B;  4LFB L;  1D1I A;  2KCN A;  3OIP A;  2Z4I A;  3S16 H;  1SE2 A;  1A3V A;  2O4X A;  3L2P A;  4WRD A;  3TBI B;  1S4Z A;  3RNU A;  3GTL B;  1LT5 D;  4K6L A;  4ZUJ A;  3T1H Q;  3HOV B;  1XX8 A;  3NK9 A;  1LTR D;  2CWA A;  3V2T A;  4C56 C;  1X9N A;  4A3M H;  3D3R A;  2UXC Q;  3RD4 A;  1GHJ A;  1K8G A;  2OF1 A;  4LW1 A;  3UE1 A;  2E5L L;  4LMQ D;  2RA4 A;  3ULL A;  5E3F A;  3S1R H;  5CBA E;  3GTJ H;  2DGY A;  2EZV A;  1X55 A;  1HNX L;  4KY6 A;  1J6Q A;  1SEB D;  3KUP A;  4IOC A;  4DR7 Q;  4H0L C;  1HNZ L;  2XWB B;  3V05 A;  4A3B H;  2AKW B;  3OMG A;  2MFI A;  2K5H A;  2A6H C;  1VQG A;  1Y1W H;  1TR5 A;  1VQH A;  3J7Z C;  2UXD L;  2Z6B A;  3OWF A;  4A3E B;  4IFD J;  3S17 B;  5LMN Q;  1RTN A;  2BCO A;  3T53 B;  1SYG A;  2YTV A;  1HNW Q;  2DN8 A;  1GVP A;  3P7J A;  1SYF A;  3JAM i;  3C3L A;  1X56 A;  1PV4 A;  1DZ1 A;  1G2T A;  3MEH A;  4YCU A;  5GQO A;  5C44 G;  3MFG A;  1M4V A;  5I9P A;  1G6Z A;  1CHP D;  2PPB C;  2ZXR A;  3QWN A;  1IBM L;  1NJI C;  3R2I A;  1Q81 C;  4DGZ A;  2JXM B;  4N9P A;  3TEH B;  3R2T A;  3DLL A;  1YJN A;  2RBM A;  3K5M A;  3S14 B;  1IYV A;  1ET6 A;  3HOU G;  1SRU A;  3Q0A A;  4NXN L;  1G29 1;  1LV9 A;  1I6H H;  2VS1 A;  4QQB X;  2EJG C;  3U58 A;  4DR3 L;  2JYO A;  3FPU B;  2R61 A;  2RDH A;  3KLS X;  1KAB A;  2BOS A;  3TN2 A;  1K0R A;  1CT1 D;  2A5H A;  1L0W A;  4N8F A;  1JB7 A;  3EA6 A;  3UDI A;  1Z7T A;  2I5L X;  3ER0 A;  4RGN A;  4IZ8 A;  1KC8 C;  1SE4 A;  4DV6 Q;  4RHR A;  4HAE A;  1KHI A;  2UUC L;  2NZ1 D;  1B4O A;  5CMD A;  5DAU A;  1AZP A;  4JG2 A;  1T9H A;  3PV0 A;  4CKE A;  4A3F H;  2F0U A;  2NBF A;  3IKJ A;  4KLK A;  3T1Y Q;  1R4Q B;  2L1B A;  2F0E A;  4OWT B;  4GKJ Q;  2Z4H A;  4DAY A;  3M3Y H;  3D6W A;  2A68 D;  1KQS A;  2F0P A;  1JQY D;  1LTI D;  1SRO A;  1KAW A;  4A3J H;  5C4Z A;  2C5C A;  1VQP A;  2PQA B;  4HIK A;  4KN7 C;  5BN3 A;  1HR0 W;  2VY3 A;  2AWO A;  3S1N B;  2QGQ A;  4IJH A;  4Q0F A;  2CHB D;  1PH3 A;  3MXN A;  1YNJ D;  4RKL A;  3PO3 H;  3K5N A;  4KY5 A;  2VB2 X;  1S5F D;  2F4I A;  2O2L D;  1PFN A;  2CQA A;  1M8A A;  4OEL B;  2F0Q A;  1C8C A;  4OX9 L;  4DR1 L;  3DUZ A;  2WAQ E;  2IX3 A;  1I6V C;  1SE8 A;  4UP9 A;  2QA4 A;  1CSQ A;  1VQ9 A;  1QNK A;  1DD2 A;  5GAH C;  4DV2 L;  4B3S L;  1CHQ D;  2PI2 A;  3NTK A;  3J7A V;  2KA7 A;  2CW0 D;  4RGO S;  5ELN A;  3H09 A;  2Q2T A;  1TKW B;  4DR5 L;  1QVF A;  4FXK C;  1ILP A;  1JC7 A;  3X3M A;  3NWT A;  5ELF A;  1BUV T;  3KJP A;  4P75 A;  3PUX A;  3Q24 A;  1HH2 P;  2N55 A;  2VZA A;  3BU2 A;  5C44 B;  3J80 i;  1H9J A;  5IE8 A;  2R7F A;  1W6J A;  1EU3 A;  3SK8 A;  2G9D A;  2XTI A;  2NWG A;  4A93 G;  1QIL A;  3I90 A;  4L5Q A;  1OXS C;  4A3K B;  2L0C A;  3C1F A;  3IRB A;  3TP7 A;  4CBV A;  3DWA A;  3PO2 G;  2CFM A;  3HOU B;  4DF7 A;  3IL8 A;  4QL5 A;  3LGJ A;  3J80 c;  1JOR A;  1B44 D;  5EPL A;  5HGQ A;  1K73 C;  3QOL A;  1LAB A;  3S1Q H;  4LUZ A;  1HQM C;  3PUY A;  4H44 C;  3HOY H;  2ZJQ A;  1XMO L;  1GOZ A;  4RGM A;  2F0D A;  5CGK A;  1WCM B;  3MHB A;  4JI3 L;  3BG3 A;  4OO1 G;  2HQL A;  3GTO B;  3H0G G;  2DNE A;  2R93 H;  2K4K A;  3RN2 A;  2JA6 H;  4JOI A;  4EQ5 A;  4JI8 L;  1HZC A;  4BBS H;  1HA6 A;  3D4W A;  1B70 B;  4TVA B;  3IFD A;  1EY8 A;  2B29 A;  3D4R A;  1PRT B;  5K36 G;  2NVY H;  2YU9 B;  4BXX G;  2HUG A;  1F2L A;  4GLX A;  2IT1 A;  2DY8 A;  4HJ8 A;  1H9S A;  3HS0 C;  1M1K C;  1YNX A;  4I65 A;  1L0Y B;  4HMI A;  5LL6 S;  1EFW A;  3AMU A;  3FKI H;  2GA4 B;  3D8G A;  4Y7N H;  5JJI A;  5AFW A;  1Y14 B;  4B3R L;  4X6A H;  3KF8 A;  4A3D H;  3PF5 A;  1V8Q A;  3I72 A;  1ESR A;  3CCR A;  4DUY L;  4B3M Q;  5JOB A;  4BA1 I;  3D31 A;  4UAI A;  3BYY B;  2B2U C;  5M5Y H;  4O1N A;  1MJE A;  5IIF A;  4QY7 A;  5LMU Q;  4KD3 A;  1DCZ A;  2WKC A;  4JI0 Q;  1MBY A;  2E2D C;  5C4X H;  1KRT A;  4JYA Q;  1BBU A;  2ICE C;  2GVA A;  2D2C C;  1VQA A;  2UXB Q;  4LF9 Q;  1Q1E A;  1KL9 A;  3T16 A;  4H13 C;  1PH6 A;  4HJA A;  2VUM H;  1F9S A;  1RHP A;  1IL8 A;  5BN5 A;  2UU9 L;  2KUM A;  4J1M A;  3STB D;  4O0A A;  1S5B D;  4XYQ A;  3MXU A;  1ONL A;  2CCZ A;  1GJX A;  4R8N A;  2JA5 B;  3KDF B;  2E5L Q;  3C46 A;  3G6E A;  3P20 A;  1STE A;  1W6K A;  2P5Z X;  5C3E H;  5C4J H;  1O80 A;  1WD0 A;  4DAP A;  5JEA J;  3S15 H;  4A93 B;  1CK1 A;  5HGT A;  3CQZ B;  1HNX Q;  2D62 A;  5C5L A;  3PO2 B;  1TWF B;  4IPG A;  4X65 L;  3GTL H;  4H7B A;  2ZXP A;  2D9U A;  1BKB A;  2ID0 A;  5CV9 A;  2E2H B;  1VCI A;  1PH2 A;  4GN3 B;  2EY5 A;  2JA9 A;  1C9O A;  2N49 A;  2UXD Q;  1JWM D;  1IYU A;  1F9R A;  1U4P A;  1X65 A;  4DFA A;  2VQF L;  2A6H D;  3S2D B;  1DXM A;  4NXM Q;  4DKA C;  3G4S A;  1IBL Q;  2F0T A;  1VMP A;  3ICE A;  3DHQ A;  5LMN W;  2N78 A;  1S40 A;  3L0O A;  1TXY A;  1O7Z A;  3NXW A;  1FL0 A;  2M2L A;  3LNN A;  2BA1 A;  1IBM Q;  3TZU A;  2NN6 H;  2WB1 E;  1VQ7 A;  3BS1 A;  3T4A C;  2AQ3 B;  3KFU A;  2L15 A;  2JA7 G;  4K8J A;  2KCC A;  3AEV A;  3K57 A;  4NXN Q;  1E7Z A;  1K83 B;  3S17 H;  3T56 B;  1GUN A;  1N32 Q;  4DR3 Q;  2OCE A;  4DAV A;  3L3O C;  3QB3 A;  1B50 A;  1JWS D;  4R4O A;  1YEZ A;  2QKI C;  1PMR A;  1YIT A;  5C0X G;  3I56 A;  3DXJ C;  3MA2 B;  3ULJ A;  3BVM A;  1EUJ A;  1ESF A;  4DR4 L;  1PLF A;  1Q7Y C;  2RQX A;  4HCE A;  4GNX A;  4CKB A;  1Y1V G;  3KLR A;  5IP7 G;  2UUC Q;  1U4M A;  3Q8D A;  2HDM A;  3K8A A;  5T1G A;  4JPB W;  3I4M G;  2PNH A;  1K3R A;  1ILQ A;  4I7Z C;  2I5H A;  4KTA A;  3S14 H;  3AFP A;  1DOK A;  5DLQ E;  1K3B C;  4RG1 A;  4K0K L;  3LWU A;  3VYR A;  4JI5 Q;  2NVT B;  1QZH A;  5E1F A;  3GO5 A;  1SYC A;  1KRS A;  3KLW A;  1A0I A;  5DM7 3;  1CKM A;  4DV5 L;  3GTG B;  1TQO A;  3CME A;  3TS0 A;  1SXT A;  4X64 L;  1ROD A;  1P8L A;  4B08 A;  4X3S A;  4KHZ A;  5IGG A;  1PRT D;  1JE5 A;  1V43 A;  4PZ7 A;  4K14 A;  4JI7 Q;  1OXU A;  2R7D A;  1SNP A;  1HRJ A;  2FMM A;  2D5D A;  1IBK Q;  4OX9 Q;  4NW2 A;  2KBN A;  4HSV A;  2B3G A;  2FHT A;  1ZXT A;  1SMY D;  2B2Y A;  3GV3 A;  1QG7 A;  3M4Q A;  1R9T B;  2L12 A;  3NSW A;  5A2Q L;  2SDF A;  4B3S Q;  3M9B A;  4K8I A;  3ERO A;  3HKZ G;  3F1Z A;  4C2M B;  2SNS A;  4R8I A;  1C7Y A;  3HKS A;  3OWE B;  4EGV A;  1VQO A;  2IX1 A;  2K04 A;  2ZM6 L;  4DNI A;  3PIP 3;  4AQY L;  1JJC B;  4R4I A;  4RWS C;  2B2V A;  1I4R A;  3HOV G;  3SXH A;  2VW9 A;  1N9W A;  1CFM A;  4IUQ A;  1BXT A;  1D8L A;  4K5X A;  5ELC A;  3I3C A;  4CGY B;  1TS2 A;  1QOH A;  4RKB A;  2LFN A;  4C3H G;  2R92 G;  2MO0 A;  4X66 L;  5E4X A;  2JA7 B;  2ATW A;  4R9W A;  4EQO A;  1VMC A;  1SLJ A;  1OXT A;  4JK1 C;  1EWH A;  1L1O A;  3A8K E;  3VR6 A;  4DXG A;  2A8V A;  1ET9 A;  3AFQ A;  5EQ0 A;  5CV4 A;  2Q2H A;  4FNF A;  4ID6 A;  3K7U C;  4UHV A;  2JA8 B;  1MD2 D;  1GUO A;  3H15 A;  4L6T B;  1FVI A;  4ZKB B;  1AE2 A;  3CC7 A;  5C44 H;  3J80 L;  5A2Q E;  3OIQ A;  2KHS A;  4BS9 A;  2ZTC A;  4DR6 L;  5EBD A;  1CA6 A;  1XMO Q;  2A69 C;  3U9O A;  5KIX A;  1ICF B;  4A3E G;  3SDZ A;  3I55 A;  3I4N B;  4QUC A;  1NNX A;  4P74 A;  4DU9 A;  4JI1 L;  3BDC A;  5M9O A;  1U5K A;  1AZQ A;  1VF5 C;  4HCS A;  1OTC A;  5FLX c;  4I7A A;  4JI8 Q;  1X3F A;  3HOU H;  4X62 L;  3PF4 A;  1PVO A;  1SNQ A;  4LJZ C;  2BDO A;  4KD4 A;  4MHE A;  2JEB I;  4LFC Q;  1OXX K;  1HCZ A;  1B8A A;  2R7Z B;  2H4O A;  4BWG B;  1K8A C;  3WWV A;  5C5M A;  3QIA A;  2MPM A;  1C48 A;  4AYB G;  2AMC B;  1LT3 D;  1DOL A;  1Z47 A;  4RMF A;  3M4P A;  1I4G A;  2G5D A;  1NMG A;  1FNW A;  3NTI A;  4IQZ A;  1WJJ A;  5LHY 1;  1SNO A;  1X54 A;  2IHE A;  4NPS A;  2Y0S B;  1Y8N B;  4L63 B;  2M9V A;  3IAY A;  3FMC A;  1A2T A;  1YHA A;  2YU9 H;  1B9N A;  5BR8 L;  3NBH B;  2CKZ B;  2NTT A;  2PCF B;  2F3V A;  1HA5 A;  2QCP X;  1PYS B;  1JOO A;  3HKZ B;  2KQ3 A;  1EY5 A;  4UPA A;  1E1T A;  4CKC A;  2VXW A;  4LAA A;  1VQM A;  4GS3 A;  2EVB A;  3GV6 A;  1SDF A;  5D65 A;  2UU9 Q;  1IKM A;  4LF4 Q;  1PFB A;  2CQO A;  2ZXO A;  3TDQ A;  3BDL A;  4LUO A;  3TRZ A;  2F0G A;  5IWA L;  1N33 L;  4LF7 L;  4DV3 Q;  2MHV A;  1RCV D;  1GHK A;  2Z9H A;  2O5I C;  1K0S A;  5F2D A;  3F2D A;  3D0F A;  1WOC A;  1VDZ A;  4A3C G;  4KV6 A;  1R4P B;  2L4N A;  4C3H B;  5KGU A;  1WTV A;  2R92 B;  1TS4 A;  4JW0 A;  1SFO H;  1ML0 D;  2TSS A;  2UUB L;  2E75 C;  3J7A F;  1N34 L;  1B3Q A;  4X65 Q;  2EPB A;  3EQL C;  4RCN A;  3RZO H;  1UAP A;  4KKU A;  1V1P A;  5I6Y A;  1VQ4 A;  2MO1 A;  3O13 A;  2H5X A;  1JCK B;  3HGB A;  5JPN C;  1Z6H A;  2VQF Q;  3QJY A;  2H1E A;  5M3M B;  4CJ1 B;  1CZG A;  4M1U B;  2A73 B;  1XPU A;  1A2U A;  2B2W A;  2NN6 I;  1PZK D;  1X6O A;  2FIN B;  4A93 H;  5KYI A;  1W2B A;  1YJ9 A;  3CQZ H;  4NMZ A;  3AU7 A;  1CI3 M;  3PO2 H;  1FNU A;  1TWF H;  2E74 C;  4DV4 L;  5ISR A;  2JN4 A;  3ERQ A;  3NEN A;  1K9M C;  3K7A B;  5IYB G;  1U0L A;  2E2H H;  2CWP A;  2VQE L;  3AQQ A;  4K5V A;  4F7X A;  2AQ1 B;  2WII B;  3TZD A;  4A3K G;  3S2D H;  4DAY B;  2E76 C;  4AYB B;  3CCS A;  4JOI C;  1VQD A;  4OHJ A;  1EFI D;  2Z0S A;  4OO1 H;  2IPK D;  1BDO A;  3VYT A;  1G2S A;  3H0G H;  2F4V L;  1EY9 A;  4DR4 Q;  2HIX A;  3QO2 A;  5I2X A;  3MXN B;  2F3W A;  2KEC A;  3KF6 B;  4GN4 B;  1I94 L;  2KED A;  1V1O A;  1SJH D;  5EKL A;  5K36 H;  2DJG C;  2PYK A;  4BXX H;  1WCM G;  5K5P A;  2V4D A;  1CTM A;  2E2I H;  3GD7 A;  2IW3 A;  1BBW A;  2NVX B;  2K28 A;  5CR3 A;  2X6G A;  3G6J B;  2ZTE A;  4DV5 Q;  2A6E C;  1KDC A;  3GDE A;  4NDX A;  1NUC A;  2B63 G;  3PUV A;  4UP7 A;  2MNA A;  2AUJ D;  2PMZ B;  1CSP A;  4IAL A;  4DK3 C;  2RKS A;  2HHH Q;  4DPG A;  3CW2 C;  4HN7 A;  3A56 A;  1KD1 C;  4RGT A;  4DR2 L;  3VR4 A;  1BO0 A;  4FF3 A;  2NZO A;  1SAP A;  3SE0 A;  4DV1 L;  1GKH A;  4QIW E;  3MXP A;  2EYJ A;  3VR2 A;  1VF7 A;  1TT2 A;  3CPW A;  1BVS A;  3HOZ G;  1ASZ A;  4JI4 L;  4LNQ A;  3CCL A;  4NP5 A;  3GQB A;  4P72 A;  2LS0 1;  1LT6 D;  2KEE A;  1PTO C;  3K6O A;  2SNM A;  4BY7 G;  4NB3 A;  4JBM A;  1MKH A;  1V1Q A;  2UUA L;  3SEB A;  2BDN A;  4GKK Q;  1XWE A;  1O7Y A;  2CH4 A;  2ZM6 Q;  1MGS A;  1G91 A;  2ICI A;  2Z6K A;  3I91 A;  3M4O B;  4YCV A;  4AQY Q;  1NBW A;  5ELE A;  3UDG A;  2EYH A;  4IFD G;  1YHB A;  3CKI B;  1LYL A;  1VQL A;  3CCU A;  1R9T H;  4LF6 L;  4ZQ3 A;  3K5L A;  1ZYR C;  2I07 B;  1EYC A;  4MNO A;  1PDQ A;  2JA5 G;  1H9K A;  1XPR A;  5EKK A;  1WTQ A;  1EL0 A;  1F2Z A;  1AH9 A;  5IP9 G;  4C2M H;  4X66 Q;  3AB9 A;  1X32 A;  4BA2 I;  4JBJ A;  3F2U A;  4JBK A;  2F0N A;  2RF4 A;  1Q86 C;  3TSS A;  1WI5 A;  1EQQ A;  3MEF A;  4ZAI A;  1EU4 A;  5I6W A;  3I8Z A;  3OTO L;  1PHJ A;  2PNR C;  3KLS A;  2YYZ A;  1YI2 A;  1L2F A;  4RH6 A;  3QG1 A;  1E24 A;  4DV0 Q;  1H9S B;  2CVR A;  4DR6 Q;  1SYE A;  1I5F A;  1X3G A;  1D6E C;  3N52 A;  4IUT A;  2HT1 A;  1I3Q B;  2A69 D;  3CRL C;  3CCJ A;  3D6C A;  2KCM A;  3KF8 B;  4C1N I;  3PUZ A;  4O2D A;  2JA7 H;  3BVZ A;  3K5O A;  1WTW A;  4Q5V A;  2K5N A;  3RR5 A;  1UWV A;  4X62 Q;  3SR1 A;  1J5E L;  1VQJ A;  1MI2 A;  3OOC A;  4PZ6 A;  4GNX C;  4HIM A;  1RIP A;  5ELB A;  1EIY B;  5IY0 A;  2Z8L A;  3PIO 3;  1Q46 A;  5C0X H;  1EOT A;  4IUU A;  2AWN A;  3S1M B;  4C1N K;  2K50 A;  4H02 A;  3J7A 5;  5CBE E;  2B63 B;  1SR3 A;  1HUN A;  5IYD G;  5JJK A;  1HPC A;  1Y1V H;  5IP7 H;  3CCM A;  5IGC A;  3OMC A;  5J1Z A;  3I4M H;  5TSS A;  5C3W A;  4CJ2 C;  3H3V H;  1IW7 D;  4K6D A;  5CYU A;  1JE4 A;  1IKL A;  2F3I A;  3FDT A;  4LF8 L;  2F0O A;  1HFG A;  3H91 A;  2A19 A;  4QB4 A;  1XNR L;  1I50 H;  2KCT A;  4WJW A;  3RN5 A;  3HOZ B;  3CPF A;  4ZK9 B;  2XVS A;  4APV A;  1QWY A;  1JIC A;  3TQY A;  1XYI A;  4BY7 B;  4LFB Q;  4MTK A;  3BZD B;  5E4W C;  3I73 A;  2B2Y C;  5KNC A;  3HRZ C;  1TWG H;  3T51 B;  3ITP A;  1DOM A;  4B3T L;  2K33 A;  2QW7 A;  1N33 Q;  5L37 A;  1P16 A;  4LFA L;  3U50 C;  4V19 0;  1N36 L;  1MIU A;  4X3U A;  5I4D A;  3PUW A;  5FLX E;  2Z1C A;  5GRO A;  4WFN 3;  1S3O A;  4QF4 A;  4XIG S;  3KK7 A;  1E2Z A;  1FNV A;  4LF5 L;  2EOT A;  4PV1 C;  1F9P A;  2ALY B;  2BH2 A;  2RVL A;  3MFY A;  1Q82 C;  4X3K A;  3MC0 B;  1RDP D;  4DK6 C;  2B2V C;  1N34 Q;  1PA6 A;  4TRD A;  1VQ5 A;  1E3P A;  5G3L F;  3J7Y W;  3N6R A;  3WOF A;  3J81 E;  4GLA C;  2WAQ G;  1HNZ Q;  3E9I A;  2K75 A;  3Q22 A;  2PQE A;  3HOV H;  1PH5 A;  1NY4 A;  3PCO B;  2L11 A;  2K32 A;  3KBG A;  4EQP A;  2UXC L;  1L1O C;  4A3G G;  3EVQ A;  3A74 A;  4C3H H;  2R92 H;  3W1B A;  2LXJ A;  2N88 A;  3E3X A;  2JSO A;  1WD1 A;  1ICW A;  2CH4 W;  5HY6 A;  4QCL A;  4V0B A;  3WOE A;  4DV4 Q;  1K28 A;  1PH7 A;  5CC4 A;  1J9O A;  2I0Q A;  5CV6 A;  4YWK A;  3F8T A;  1LAC A;  4DR7 L;  4POG A;  4OO1 I;  4G4K A;  4ZRZ A;  1JJ2 A;  1RF2 D;  5KRU A;  3RUZ A;  4ME3 A;  3SVM A;  3EBE A;  2BA0 A;  3T13 A;  4A3E H;  1CKO A;  1EY0 A;  3A0J A;  1D1K A;  1GO3 E;  2K03 A;  3QOJ A;  1HTP A;  2K7V A;  2QEX A;  2MUY A;  2OT2 A;  2SEB D;  4FF2 A;  2JA8 G;  1CUK A;  4ILW A;  1EY7 A;  5A35 A;  4U67 3;  4ABN A;  4AYB E;  1I94 Q;  1PH1 A;  3CAM A;  1AP0 A;  1YJW A;  4G7Z C;  1EEI D;  4FP5 D;  3I4N G;  4P2C B;  2OTJ A;  2B2T C;  3MAQ A;  1OO9 B;  1H9R A;  4HMJ A;  1GUS A;  1TWC B;  1B2T A;  3RLF A;  3CP0 A;  1X3E A;  1XXG A;  2N3S A;  4KHP L;  2BH8 A;  3IFT A;  1U4R A;  1EQT A;  2F1M A;  1HZA A;  3M3Y B;  2F0L A;  5KEE A;  1G51 A;  1E2W A;  4A3J B;  2A6E D;  1JMC A;  2R7Z G;  4RA8 A;  1O7I A;  3EN2 A;  4HIO A;  3NHH A;  2E8G A;  4DV6 L;  4MTN A;  2RCN A;  1LUZ A;  2MP1 A;  2DUD A;  4HR7 B;  4JV5 L;  4OEM B;  4DR2 Q;  2F52 A;  2K5V A;  2HD3 A;  5FO7 B;  3DM1 A;  5C4H A;  1KLG D;  3T1Y L;  3HP3 A;  2A68 C;  1TVX A;  1QUQ A;  4DV1 Q;  2NVX H;  4DR1 Q;  4FXD A;  4IJL A;  4PNY A;  2Y0S G;  1EY6 A;  4YWL A;  2ZTD A;  1PRT F;  1Q3L A;  5JEA G;  2K6A A;  3MZ5 A;  4PMC A;  4JI4 Q;  2ZJR A;  3M7G A;  3QR8 A;  1PTO F;  4DV2 Q;  1E1O A;  2KHJ A;  2WAQ B;  2KHI A;  2UUA Q;  3S1N H;  1A62 A;  3ERS X;  1A3U A;  1WTO A;  2ENB A;  5D3I B;  1L1O B;  3URY A;  4DR5 Q;  4P73 A;  4R1J A;  4DA2 A;  4X3T A;  3HZX A;  1H95 A;  1IZ6 A;  2RSN A;  4A3G B;  1C0A A;  2PZT A;  4A3C H;  1BBX C;  1M90 C;  4LF6 Q;  2L9H A;  2F0J A;  3CXC A;  3NE5 B;  1D5X C;  1NSN S;  2F0I A;  2WAC A;  1YVC A;  2OTL A;  4C3I G;  4KN4 C;  1E2V A;  2D0O A;  4OWW B;  5D3D A;  2QDL A;  2JEA I;  1LO5 D;  2B2W C;  1WTX A;  4FXG C;  1XTD A;  4NKL A;  4DUZ L;  3GTQ B;  3A7A B;  4IO9 A;  2K52 A;  3I7F A;  1Q1B A;  4IPD A;  3M4O H;  4EVO A;  2NVQ B;  4GOP A;  1AN8 A;  4JBW A;  5JJL A;  4ZYS A;  1PFM A;  4L8J A;  3I4L A;  3GTP B;  2O5J C;  4LK1 C;  5M3M G;  2KJX A;  3A7L A;  1WVL A;  1IHZ A;  5IYB H;  1HZ9 A;  4JVZ A;  3GTK B;  5C0X I;  4KJO A;  4JI3 Q;  2MQH A;  2FMC A;  4A3K H;  2RHS B;  1QVC A;  3CCV A;  4BY1 G;  3ND8 A;  2F0K A;  1HUM A;  5M5W B;  4DAM A;  1BCP F;  1DON A;  4IUN A;  3ZJY C;  3J81 i;  3RZD B;  3R8B A;  4PZ8 A;  1XTC D;  2BE5 C;  3H3V I;  4KKT A;  3TP5 A;  5J22 A;  2NVY B;  1NMF A;  2HIV A;  1F2M A;  1YNN C;  4OIJ A;  1KNA A;  1T5X D;  2OQK A;  4WOR A;  1I3Q H;  4DNT B;  4LWC A;  1RJT A;  3J81 c;  1WCM H;  4CDC C;  2B2T A;  3GTO H;  1NCV A;  1BNZ A;  2EYL A;  2WV6 D;  4B3R Q;  4DK0 A;  1AW7 A;  4FDB A;  1VQC A;  3EIV A;  3G7L A;  4AH6 A;  3HOW G;  3UDX A;  4DUY Q;  3U4Z A;  3X3N A;  5J3B A;  5EPJ A;  1LM0 A;  2K5D A;  1Q8I A;  1CKN A;  3HOX G;  2IL8 A;  4A75 A;  2QDB A;  1A6X A;  2B63 H;  5C4X B;  5IGE A;  4LUV A;  2LSS A;  1EYG A;  3VYS A;  1SNC A;  4A3I G;  1LTL A;  1SN8 A;  1V1P B;  4A3L G;  1K8O A;  2J4X A;  1PYW D;  2EYP A;  3UDF A;  4K2K A;  5IOC A;  1EZ8 A;  3DWQ A;  4B3T Q;  1Q12 A;  2F0V A;  1S72 A;  2JJQ A;  4LFA Q;  5FJ8 G;  3L9A X;  4FYD A;  2Q8R E;  1LTA D;  1VQK A;  3PGZ A;  5T1I A;  3W2D A;  4C3I B;  4RAU C;  1S5D D;  1STG A;  2FJ2 A;  4JI0 L;  3HOZ H;  2Z6K C;  5C3E B;  1J8I A;  2ZJP A;  3VA7 A;  4JYA L;  4BY7 H;  1XJV A;  1TWH B;  2UXB L;  4LF9 L;  3MTS A;  1G8Z D;  3BDO A;  1HTL D;  3K0Y A;  2A74 C;  3STB C;  2WIN B;  4RFB A;  1XMQ L;  3NQT A;  5IYC G;  1GXD C;  3BZK A;  5CV7 A;  1VQI A;  1KIX A;  4IFD H;  1NAP A;  1Q8K A;  3GP7 A;  4YIJ A;  5GAG C;  4YHH L;  2VNU D;  4J15 A;  1A63 A;  4HTH A;  1RTO A;  3K81 C;  4N8X 1;  2KOL A;  2F0M A;  4WJ4 A;  2OEO A;  5DM6 3;  2EQS A;  2JA5 H;  2LKV A;  2IY5 B;  4FF4 A;  1X3P A;  3ONA B;  1EEF D;  3NBH A;  3ND9 A;  5IP9 H;  1ENC A;  3TP8 A;  3K80 C;  1FJG L;  1SYB A;  3DEP A;  2I5M X;  2MJ8 A;  4BY1 B;  1QB5 D;  2D0P A;  3PIO A;  1ASY A;  5EGT A;  3Q23 A;  1FGB D;  1K8M A;  5EAY A;  4A76 A;  4YCW A;  1FGU A;  3NEM A;  3BYT B;  3FEW X;  2WB1 B;  2HDL A;  3TS2 A;  1UEA B;  4R4T A;  5I9O A;  5IT9 c;  4NXM L;  1GUG A;  4WJ3 M;  4BBR G;  4DK1 A;  1IBL L;  2B8G A;  1SBB B;  2PW7 A;  3SK4 A;  2JK8 A;  5C6A A;  3PMF A;  3H94 A;  1TS3 A;  2QEJ C;  1WYD A;  1DGS A;  2PZW A;  4C3J G;  2QF7 A;  1KLU D;  3DEO A;  2X69 A;  3HOW B;  4IN3 A;  1I4P A;  4UP8 A;  2OWO A;  1TY2 A;  1RL2 A;  3FRP B;  4TQU S;  1D2B A;  4L5R C;  2K14 A;  3HOX B;  3JAM c;  1CQF A;  4KHP Q;  5IYD H;  4K0K Q;  3KJO A;  1Y8O B;  1K83 H;  3E9H A;  1N32 L;  1W3S A;  1FR3 A;  2R3Z A;  2LMC B;  1E0B A;  4A3I B;  2K01 A;  5M3F G;  3S2H B;  1GUT A;  2XIW A;  2RCF A;  1VQ8 A;  1JOQ A;  4X64 Q;  2Q2U A;  4CHT B;  4KHV A;  3FHW A;  4HED A;  5EBC A;  4JV5 Q;  1UE5 A;  1DM0 B;  4ODG A;  3GTM B;  1TWC H;  1HJP A;  1A8V A;  3U9S A;  4JI6 L;  4DV7 L;  2K05 A;  1TII D;  2AHO B;  3R3O A;  4JI5 L;  1RD9 D;  3H6M A;  2NVT H;  1LTS D;  1IXR A;  1S5E D;  2GVB A;  3RMH A;  5FLM G;  4CJ0 B;  2NYZ D;  4R4C A;  1WTP A;  1HR0 L;  3GTG H;  2XGT A;  3OPO A;  1PRT C;  2PO4 A;  1EYA A;  1Y69 U;  1Y8P B;  3NP8 A;  2F0S A;  3L7Z C;  1Q90 A;  3KF6 A;  4QMG A;  5JVH 3;  2XNA C;  1YBY A;  1JT8 A;  4JI7 L;  1N8R C;  3VR3 A;  4YY3 L;  1PZJ D;  2B39 A;  1F9Q A;  5M5X B;  3M4Y A;  4QJF A;  1IYJ B;  1IBK L;  1NR2 A;  1SMY C;  1U4L A;  4B9X A;  1CZW A;  1TWA B;  1E22 A;  2NZH A;  4ALP A;  1BR9 A;  1I4X A;  2JP1 A;  4KKS A;  1EIG A;  3NWS A;  4JI2 L;  4UY8 C;  1B1Z A;  4GN5 A;  3UE0 A;  1STY A;  4A3M G;  1UE1 A;  3DWP A;  1WTR A;  4DUZ Q;  1YZ6 A;  1RKN A;  4KMU C;  1WTH A;  1A15 A;  3K58 A;  4P71 A;  1EIF A;  2PQA A;  2J7Z A;  5AJ3 L;  2E2J B;  4HSP A;  4A4I A;  3F2B A;  4A3G H;  3P75 A;  1EQR A;  4PMW A;  1F2Y A;  5KND A;  1XNQ L;  4BBR B;  4MIU A;  1MSH A;  1PZI D;  3MWY W;  4XT3 B;  4A3B G;  1YIJ A;  4MN3 A;  2GN5 A;  5DEH A;  5FKA C;  4C3J B;  5D14 A;  1QNU A;  1Y1W G;  1NTG A;  4F87 A;  1QJO A;  3P1H A;  2NB0 A;  1HQR D;  1KDA A;  3E0E A;  4KJN A;  4XYO A;  3GTQ H;  4JI1 Q;  2YTX A;  1JWU D;  3SGI A;  3HEJ A;  1II3 A;  4XQQ A;  1HFN A;  1STN A;  4GLV B;  3A5U A;  1PH4 A;  4EQN A;  2V1C C;  4MZ9 A;  5J39 A;  2XSC A;  1LTG D;  3ULP A;  1HXY D;  2C35 B;  2NVQ H;  3SHL A;  2A1A A;  1EWC A;  1T5E A;  5FLX L;  1BCP C;  3HG9 A;  5M3F B;  2JA8 H;  2BE5 D;  3MVV A;  5IGD A;  1ZKO A;  2NUC A;  3GTP H;  2SOB A;  4TKO B;  1LTT D;  1XPO A;  5COY A;  3GTK H;  1YNN D;  3I4N H;  5ELD A;  4KI0 A;  2Q8I B;  3NTH A;  2K1B A;  1KXL A;  3S24 A;  4IPH A;  5M5W H;  1QE6 A;  1FD7 D;  1V9P A;  3BJU A;  3J81 L;  1G6P A;  2I46 A;  4O42 A;  1B53 A;  1SYD A;  3RZD H;  5EKI A;  4G7H C;  1B9M A;  4IOA A;  4LFC L;  3A8J E;  1D5M C;  2EIF A;  2VL6 A;  3VYU A;  1L0X B;  5BR8 Q;  1EOV A;  1B3A A;  1JJG A;  4OGQ C;  3G48 A;  1MJC A;  2R7Z H;  4CDF C;  4A3F G;  1PTO B;  3CMA A;  5KNB A;  4FF1 A;  2HCI A;  2F0H A;  4ZLT F;  2Y0S E;  5C0X J;  4L5S A;  1PH8 A;  2NTS A;  3OSO A;  2FFK B;  2YV5 A;  1EY4 A;  3E6Z X;  4QGU A;  4XT1 B;  4ZCK A;  3W5O A;  3PQI A;  3S16 B;  2WKD A;  3TP6 A;  4A3J G;  4RCO A;  5FK9 C;  3I70 A;  3PIP A;  2EY6 A;  5IWA Q;  4LF7 Q;  2XRS D;  5JEA H;  3HKZ E;  1D5Z C;  3PO3 G;  4XQJ A;  4A3M B;  3E0J A;  3CF5 A;  4IFD I;  1CA5 A;  4IPC A;  1YHQ A;  1SNM A;  1HHV A;  3S1R B;  1O7L A;  4DXF A;  1SFO B;  3GTJ B;  3W1G A;  1XMQ Q;  1GD7 A;  2UUB Q;  1VQF A;  4LF4 L;  3VDY A;  3RZO B;  1PXU A;  3TRE A;  2HCC A;  4YHH Q;  4K2L A;  1I4H A;  2XN9 C;  4YWM A;  1JB3 A;  1UEB A;  5G3L D;  3T1H L;  4DV3 L;  1QCB D;  4A3B B;  1SMX A;  1AEX A;  4C3I H;  5KYL A;  1VQE A;  4L5T A;  1Y1W B;  2R6G A;  1EWI A;  3A8I E;  4KY7 A;  1FJG Q;  4GOP C;  1TWH H;  1EQV A;  4OON A; 
#chains in the Genus database with same CATH homology
 5JVG 3;  2DY7 A;  2G9H D;  2EJM A;  1BCP B;  2ZT9 C;  4ZUI A;  4OIK A;  2RDG A;  2JE6 I;  2XWJ B;  3R93 A;  2OXP A;  4XDX A;  5C3X A;  2F0W A;  2EDG A;  1ZEQ X;  1I6H B;  2EY2 A;  4F88 A;  5IGF A;  1TU2 B;  3H0G B;  1ENF A;  2F0F A;  1UNS A;  5IT9 L;  4IUV A;  3TME A;  2AUK A;  2EYM A;  3V96 A;  4N9T A;  1UUP A;  4UDU C;  4PQX A;  2B8F A;  5NUC A;  1JOK A;  2EY1 A;  3SK6 A;  4A3F B;  2E2I B;  5CV5 A;  3S9W A;  1SJE D;  3JAM L;  1EZ6 A;  2EXZ A;  1TS5 A;  4FVM A;  3VA5 A;  3A54 A;  2LY7 A;  1C4Q A;  3OHX C;  1SND A;  3WDN A;  3CHB D;  1JR0 D;  3PO3 B;  5HUR A;  3EFX D;  4OL7 A;  3H3V C;  3EJI A;  1TY0 A;  2X6L A;  3FPP A;  2TMP A;  5FOB B;  5FO9 B;  5IT9 E;  2VB3 X;  3ZYY X;  4F8M A;  2PZU A;  4PMB A;  4QIW B;  1X3Q A;  1EIH A;  1YNJ C;  1LT4 D;  2F03 A;  2B2U A;  3MXG A;  4J8Q A;  1PTO D;  2K5W A;  4KK7 A;  3NPP A;  4ZKC B;  5IOD A;  2EE1 A;  2RDF A;  2XRQ D;  4GZY C;  4Z9C B;  1KDB A;  2IX0 A;  4G57 A;  1A3T A;  3JAM E;  2QIL A;  4IUP A;  4FO2 A;  3W3A A;  2CW0 C;  2WP8 J;  1ZYR D;  1I4Q A;  3A55 A;  4XQN A;  2M00 A;  4XXE A;  3DMU A;  2J0T D;  5IGB A;  4U68 A;  3SK5 A;  4G7O C;  1AFP A;  4RHS A;  1S5C D;  3FVQ A;  4DNR B;  3E5S A;  1STA A;  3BVG A;  3S1Q B;  5JAV A;  3C1E A;  1GUW A;  3HOY B;  4J6H A;  3VR5 A;  5DNF A;  2K5Q A;  1NR4 A;  1CQV A;  4B9W A;  2R93 B;  2JA6 B;  4BBS B;  4XTC S;  1STH A;  1F77 A;  5LL6 X;  2NN6 G;  2MGS A;  3K59 A;  4QUF A;  2HQE A;  5EPK A;  1BQQ T;  1ENA A;  1BCP D;  3NUC A;  1Y1V B;  1MSG A;  1U9R A;  4TSS A;  1KAA A;  2PW5 A;  1CM9 A;  4K5W A;  3I4M B;  3OW7 A;  1KNE A;  1DJR D;  1FYC A;  2DNC A;  2IJ0 A;  3FKI B;  4Y7N B;  2EJF C;  4DN4 M;  2C9O A;  5JJZ A;  3M85 A;  4A3D B;  3CRK C;  5EJW A;  1I50 B;  4E6I A;  1LLR D;  4S3S A;  1H9M A;  3KBX A;  4M8A A;  5M5Y B;  3NBI A;  2IWH A;  1EYD A;  1OXV A;  5FO8 B;  3D4D A;  1SE3 A;  3LX0 A;  3Q6S A;  2L5T A;  4ME5 A;  5CV8 A;  1IW7 C;  1DYQ A;  4IUR A;  2EYF A;  2AQ2 B;  2RSO A;  2EYO A;  2Q8T A;  1SSO A;  1BOS A;  3C2P A;  1TWG B;  3NQI A;  2VUM B;  1KTK A;  3UI2 A;  3LWE A;  1STB A;  3M7N A;  5BN4 A;  1O78 A;  5I2Y A;  3J80 E;  3CU7 A;  1PTO H;  5COR A;  4ULL A;  5JPM C;  5C4J B;  2KVM A;  2L55 A;  1BF4 A;  1LTB D;  3S15 B;  1D1I A;  2KCN A;  3OIP A;  2Z4I A;  1SE2 A;  1A3V A;  2O4X A;  4WRD A;  3TBI B;  1S4Z A;  3GTL B;  1LT5 D;  4K6L A;  4ZUJ A;  3HOV B;  4C56 C;  1XX8 A;  1LTR D;  3NK9 A;  3V2T A;  3D3R A;  3RD4 A;  1GHJ A;  2OF1 A;  4LMQ D;  2RA4 A;  5E3F A;  5CBA E;  2EZV A;  4KY6 A;  1SEB D;  3KUP A;  4H0L C;  2XWB B;  3V05 A;  3OMG A;  2A6H C;  1TR5 A;  3OWF A;  4A3E B;  4IFD J;  3S17 B;  1RTN A;  2BCO A;  3T53 B;  1SYG A;  2DN8 A;  3P7J A;  1SYF A;  3C3L A;  1DZ1 A;  1G2T A;  3MEH A;  3MFG A;  1M4V A;  5I9P A;  1G6Z A;  1CHP D;  2PPB C;  2ZXR A;  3QWN A;  3R2I A;  4DGZ A;  2JXM B;  4N9P A;  3R2T A;  2RBM A;  3K5M A;  3S14 B;  1IYV A;  1ET6 A;  3Q0A A;  1G29 1;  1LV9 A;  2EJG C;  2JYO A;  3FPU B;  2R61 A;  2RDH A;  3KLS X;  1KAB A;  2BOS A;  3TN2 A;  1CT1 D;  2A5H A;  3EA6 A;  1Z7T A;  4RGN A;  4IZ8 A;  1SE4 A;  4RHR A;  4HAE A;  2NZ1 D;  1B4O A;  5CMD A;  5DAU A;  1AZP A;  4CKE A;  3PV0 A;  2F0U A;  2NBF A;  3IKJ A;  1R4Q B;  2L1B A;  2F0E A;  2Z4H A;  4DAY A;  3D6W A;  2A68 D;  2F0P A;  1JQY D;  1LTI D;  5C4Z A;  2C5C A;  4KN7 C;  5BN3 A;  2AWO A;  3S1N B;  4Q0F A;  2CHB D;  3MXN A;  1YNJ D;  4RKL A;  3K5N A;  4KY5 A;  2VB2 X;  1S5F D;  2F4I A;  2O2L D;  1PFN A;  2CQA A;  1M8A A;  2F0Q A;  1C8C A;  3DUZ A;  2IX3 A;  1I6V C;  1QNK A;  1DD2 A;  1CHQ D;  3NTK A;  3J7A V;  2KA7 A;  2CW0 D;  4RGO S;  3H09 A;  1TKW B;  4FXK C;  1ILP A;  1JC7 A;  3X3M A;  3NWT A;  5ELF A;  1BUV T;  3PUX A;  3Q24 A;  2N55 A;  5C44 B;  1H9J A;  1W6J A;  1EU3 A;  3SK8 A;  2G9D A;  2NWG A;  1QIL A;  3I90 A;  1OXS C;  4A3K B;  2L0C A;  3C1F A;  3TP7 A;  4CBV A;  3DWA A;  3HOU B;  4DF7 A;  3IL8 A;  1JOR A;  1B44 D;  5EPL A;  3QOL A;  1LAB A;  1HQM C;  3PUY A;  4H44 C;  1GOZ A;  4RGM A;  2F0D A;  5CGK A;  1WCM B;  3MHB A;  3BG3 A;  4OO1 G;  3GTO B;  2DNE A;  1HA6 A;  3D4W A;  3IFD A;  1EY8 A;  3D4R A;  1PRT B;  5K36 G;  2YU9 B;  2HUG A;  1F2L A;  2IT1 A;  2DY8 A;  1H9S A;  3HS0 C;  4I65 A;  1L0Y B;  4HMI A;  5LL6 S;  3AMU A;  2GA4 B;  3D8G A;  5AFW A;  3KF8 A;  1V8Q A;  3I72 A;  1ESR A;  5JOB A;  4BA1 I;  3D31 A;  4UAI A;  3BYY B;  2B2U C;  4O1N A;  5IIF A;  4KD3 A;  1DCZ A;  2WKC A;  1MBY A;  2E2D C;  2ICE C;  2D2C C;  1Q1E A;  3T16 A;  4H13 C;  1F9S A;  1RHP A;  1IL8 A;  5BN5 A;  2KUM A;  4J1M A;  1S5B D;  4XYQ A;  3MXU A;  1ONL A;  1GJX A;  4R8N A;  2JA5 B;  3C46 A;  3P20 A;  1STE A;  1W6K A;  1O80 A;  1WD0 A;  4DAP A;  5JEA J;  4A93 B;  1CK1 A;  5HGT A;  3CQZ B;  2D62 A;  5C5L A;  3PO2 B;  1TWF B;  4H7B A;  2ZXP A;  2D9U A;  2ID0 A;  5CV9 A;  2E2H B;  1VCI A;  2EY5 A;  1JWM D;  1IYU A;  1F9R A;  1U4P A;  4DFA A;  2A6H D;  3S2D B;  1DXM A;  2F0T A;  1VMP A;  3DHQ A;  1O7Z A;  3NXW A;  2M2L A;  3LNN A;  2BA1 A;  3TZU A;  2NN6 H;  3BS1 A;  3T4A C;  2AQ3 B;  4K8J A;  2KCC A;  3K57 A;  1K83 B;  3T56 B;  1GUN A;  4DAV A;  3L3O C;  3QB3 A;  1B50 A;  1JWS D;  2QKI C;  1PMR A;  5C0X G;  3DXJ C;  3MA2 B;  3BVM A;  1ESF A;  1PLF A;  2RQX A;  4HCE A;  4CKB A;  3KLR A;  1U4M A;  2HDM A;  5T1G A;  1ILQ A;  4I7Z C;  4KTA A;  1DOK A;  3LWU A;  3VYR A;  2NVT B;  5E1F A;  3GO5 A;  1SYC A;  5DM7 3;  3GTG B;  1TQO A;  1SXT A;  1ROD A;  4B08 A;  4X3S A;  4KHZ A;  5IGG A;  1PRT D;  1V43 A;  4K14 A;  1OXU A;  1SNP A;  1HRJ A;  2FMM A;  2D5D A;  4NW2 A;  4HSV A;  2FHT A;  1ZXT A;  1SMY D;  2B2Y A;  3GV3 A;  1QG7 A;  1R9T B;  2L12 A;  3NSW A;  5A2Q L;  2SDF A;  4K8I A;  3ERO A;  4C2M B;  2SNS A;  4R8I A;  3OWE B;  4EGV A;  2IX1 A;  2K04 A;  3PIP 3;  4RWS C;  2B2V A;  1I4R A;  3SXH A;  1CFM A;  4IUQ A;  1BXT A;  4K5X A;  5ELC A;  3I3C A;  4CGY B;  1TS2 A;  1QOH A;  4RKB A;  2LFN A;  4C3H G;  5E4X A;  2JA7 B;  4R9W A;  4EQO A;  1VMC A;  1OXT A;  4JK1 C;  1EWH A;  3A8K E;  3VR6 A;  4DXG A;  1ET9 A;  5EQ0 A;  5CV4 A;  4FNF A;  4ID6 A;  2JA8 B;  1MD2 D;  1GUO A;  4L6T B;  4ZKB B;  3J80 L;  5A2Q E;  3OIQ A;  2KHS A;  4BS9 A;  5EBD A;  1CA6 A;  3U9O A;  2A69 C;  5KIX A;  3SDZ A;  3I4N B;  4QUC A;  4DU9 A;  3BDC A;  5M9O A;  1AZQ A;  1VF5 C;  4HCS A;  1SNQ A;  4LJZ C;  2BDO A;  4KD4 A;  4MHE A;  2JEB I;  1OXX K;  1HCZ A;  2R7Z B;  2H4O A;  4BWG B;  5C5M A;  3QIA A;  2MPM A;  1C48 A;  1LT3 D;  1DOL A;  1Z47 A;  1I4G A;  1FNW A;  3NTI A;  4IQZ A;  5LHY 1;  1SNO A;  2Y0S B;  1Y8N B;  4L63 B;  2M9V A;  3IAY A;  3FMC A;  1A2T A;  1B9N A;  2NTT A;  2PCF B;  2F3V A;  1HA5 A;  2QCP X;  1JOO A;  3HKZ B;  2KQ3 A;  1EY5 A;  4CKC A;  2VXW A;  4LAA A;  2EVB A;  3GV6 A;  1SDF A;  5D65 A;  1IKM A;  1PFB A;  2ZXO A;  3TDQ A;  3BDL A;  2F0G A;  2MHV A;  1RCV D;  1GHK A;  2O5I C;  5F2D A;  1VDZ A;  4C3H B;  1R4P B;  2L4N A;  4KV6 A;  5KGU A;  1WTV A;  2R92 B;  1TS4 A;  1ML0 D;  2TSS A;  2E75 C;  3J7A F;  2EPB A;  3EQL C;  4RCN A;  1UAP A;  4KKU A;  1V1P A;  5I6Y A;  3O13 A;  1JCK B;  3HGB A;  5JPN C;  1Z6H A;  3QJY A;  2H1E A;  5M3M B;  4CJ1 B;  1CZG A;  4M1U B;  2A73 B;  1A2U A;  2B2W A;  2NN6 I;  1PZK D;  2FIN B;  5KYI A;  4NMZ A;  3AU7 A;  1CI3 M;  1FNU A;  2E74 C;  5ISR A;  3ERQ A;  3K7A B;  4K5V A;  4F7X A;  2AQ1 B;  2WII B;  3TZD A;  2E76 C;  4AYB B;  4OHJ A;  1EFI D;  4OO1 H;  2IPK D;  1BDO A;  3VYT A;  1G2S A;  1EY9 A;  3QO2 A;  5I2X A;  2F3W A;  2KEC A;  2KED A;  1V1O A;  1SJH D;  5EKL A;  5K36 H;  2PYK A;  5K5P A;  2V4D A;  1CTM A;  3GD7 A;  2IW3 A;  2NVX B;  2K28 A;  5CR3 A;  2X6G A;  3G6J B;  2A6E C;  1KDC A;  4NDX A;  1NUC A;  3PUV A;  2AUJ D;  2PMZ B;  4IAL A;  2RKS A;  4HN7 A;  3A56 A;  4RGT A;  3VR4 A;  1BO0 A;  4FF3 A;  3SE0 A;  1SAP A;  3MXP A;  2EYJ A;  3VR2 A;  1VF7 A;  1TT2 A;  4NP5 A;  3GQB A;  2LS0 1;  1LT6 D;  2KEE A;  1PTO C;  3K6O A;  2SNM A;  3SEB A;  2BDN A;  1XWE A;  1O7Y A;  1G91 A;  1MGS A;  2ICI A;  3I91 A;  3M4O B;  5ELE A;  2EYH A;  4IFD G;  3CKI B;  4ZQ3 A;  3K5L A;  1ZYR C;  2I07 B;  1EYC A;  1PDQ A;  1H9K A;  5EKK A;  1WTQ A;  1EL0 A;  1F2Z A;  3AB9 A;  1X32 A;  4BA2 I;  3F2U A;  2F0N A;  3TSS A;  4ZAI A;  1EU4 A;  5I6W A;  3I8Z A;  2PNR C;  3KLS A;  2YYZ A;  4RH6 A;  3QG1 A;  1H9S B;  2CVR A;  1SYE A;  1D6E C;  3N52 A;  4IUT A;  1I3Q B;  2A69 D;  3CRL C;  3D6C A;  4C1N I;  3PUZ A;  3BVZ A;  3K5O A;  1WTW A;  4Q5V A;  3SR1 A;  1MI2 A;  3OOC A;  5ELB A;  2Z8L A;  3PIO 3;  5C0X H;  1EOT A;  4IUU A;  2AWN A;  3S1M B;  4C1N K;  5CBE E;  2B63 B;  1HUN A;  1HPC A;  5IGC A;  3OMC A;  5J1Z A;  5TSS A;  5C3W A;  4CJ2 C;  1IW7 D;  4K6D A;  5CYU A;  1JE4 A;  1IKL A;  3FDT A;  2F0O A;  1HFG A;  3H91 A;  4QB4 A;  4WJW A;  3HOZ B;  4ZK9 B;  2XVS A;  1QWY A;  1JIC A;  1XYI A;  4BY7 B;  3BZD B;  5E4W C;  3I73 A;  2B2Y C;  5KNC A;  3HRZ C;  3T51 B;  3ITP A;  1DOM A;  2K33 A;  4V19 0;  4X3U A;  5I4D A;  3PUW A;  5FLX E;  2Z1C A;  4WFN 3;  4QF4 A;  4XIG S;  3KK7 A;  1E2Z A;  1FNV A;  2EOT A;  4PV1 C;  1F9P A;  2RVL A;  3MFY A;  4X3K A;  1RDP D;  3MC0 B;  2B2V C;  4TRD A;  5G3L F;  3J7Y W;  3N6R A;  3WOF A;  3J81 E;  3Q22 A;  2PQE A;  2L11 A;  2K32 A;  3KBG A;  4EQP A;  3EVQ A;  2N88 A;  2JSO A;  1WD1 A;  1ICW A;  4QCL A;  4V0B A;  3WOE A;  5CC4 A;  1J9O A;  5CV6 A;  1LAC A;  4OO1 I;  4G4K A;  4ZRZ A;  1RF2 D;  5KRU A;  3RUZ A;  3SVM A;  2BA0 A;  3T13 A;  1EY0 A;  1D1K A;  2K03 A;  3QOJ A;  1HTP A;  2K7V A;  2MUY A;  2OT2 A;  2SEB D;  4FF2 A;  4ILW A;  1EY7 A;  5A35 A;  4U67 3;  4ABN A;  1AP0 A;  4G7Z C;  1EEI D;  4FP5 D;  4P2C B;  2B2T C;  3MAQ A;  1OO9 B;  1H9R A;  4HMJ A;  1GUS A;  1TWC B;  1B2T A;  3RLF A;  1XXG A;  3IFT A;  1U4R A;  1EQT A;  2F1M A;  3M3Y B;  2F0L A;  5KEE A;  1E2W A;  4A3J B;  2A6E D;  4RA8 A;  3NHH A;  2MP1 A;  4HR7 B;  5FO7 B;  3DM1 A;  5C4H A;  1KLG D;  3HP3 A;  2A68 C;  1TVX A;  4FXD A;  4PNY A;  1EY6 A;  1PRT F;  1Q3L A;  5JEA G;  2K6A A;  3MZ5 A;  4PMC A;  3M7G A;  1PTO F;  2WAQ B;  1WTO A;  1A3U A;  2ENB A;  5D3I B;  3URY A;  4DA2 A;  4X3T A;  3HZX A;  2RSN A;  4A3G B;  2PZT A;  1BBX C;  2L9H A;  2F0J A;  3NE5 B;  1D5X C;  1NSN S;  2F0I A;  2WAC A;  4C3I G;  4KN4 C;  1E2V A;  5D3D A;  2JEA I;  1LO5 D;  2B2W C;  1WTX A;  4FXG C;  4NKL A;  3GTQ B;  3A7A B;  1Q1B A;  4EVO A;  2NVQ B;  1AN8 A;  4JBW A;  4ZYS A;  1PFM A;  4L8J A;  3I4L A;  3GTP B;  2O5J C;  4LK1 C;  2KJX A;  3A7L A;  1WVL A;  1IHZ A;  3GTK B;  5C0X I;  4KJO A;  2FMC A;  3ND8 A;  2F0K A;  1HUM A;  5M5W B;  1BCP F;  1DON A;  4IUN A;  3RZD B;  3R8B A;  1XTC D;  2BE5 C;  4KKT A;  3TP5 A;  5J22 A;  2NVY B;  1F2M A;  1YNN C;  4OIJ A;  1KNA A;  1T5X D;  4WOR A;  4DNT B;  1RJT A;  2B2T A;  1NCV A;  1BNZ A;  2EYL A;  2WV6 D;  4DK0 A;  1AW7 A;  3G7L A;  3X3N A;  5EPJ A;  2K5D A;  1Q8I A;  2IL8 A;  2QDB A;  1A6X A;  5C4X B;  5IGE A;  3VYS A;  1SNC A;  1V1P B;  1K8O A;  2J4X A;  1PYW D;  2EYP A;  4K2K A;  5IOC A;  1EZ8 A;  3DWQ A;  1Q12 A;  2F0V A;  3L9A X;  4FYD A;  2Q8R E;  1LTA D;  5T1I A;  3W2D A;  4C3I B;  4RAU C;  1S5D D;  1STG A;  2FJ2 A;  5C3E B;  1J8I A;  3VA7 A;  1TWH B;  3MTS A;  1G8Z D;  3BDO A;  1HTL D;  3K0Y A;  2A74 C;  2WIN B;  4RFB A;  3NQT A;  1GXD C;  5CV7 A;  4IFD H;  1NAP A;  3GP7 A;  4YIJ A;  2VNU D;  4HTH A;  1RTO A;  2KOL A;  2F0M A;  2OEO A;  5DM6 3;  2LKV A;  4FF4 A;  1X3P A;  3ONA B;  1EEF D;  3NBH A;  3ND9 A;  1ENC A;  3TP8 A;  1SYB A;  3DEP A;  2MJ8 A;  4BY1 B;  1QB5 D;  5EGT A;  3Q23 A;  1FGB D;  1K8M A;  3BYT B;  3FEW X;  2WB1 B;  2HDL A;  5I9O A;  1UEA B;  1GUG A;  4DK1 A;  2B8G A;  1SBB B;  2PW7 A;  3SK4 A;  5C6A A;  3PMF A;  3H94 A;  1TS3 A;  2QEJ C;  2PZW A;  4C3J G;  2QF7 A;  1KLU D;  3DEO A;  2X69 A;  3HOW B;  4IN3 A;  1I4P A;  1TY2 A;  3FRP B;  4TQU S;  1D2B A;  3HOX B;  1CQF A;  1Y8O B;  1FR3 A;  2R3Z A;  2LMC B;  1E0B A;  4A3I B;  2K01 A;  3S2H B;  1GUT A;  2XIW A;  1JOQ A;  4CHT B;  4KHV A;  5EBC A;  4HED A;  1DM0 B;  4ODG A;  3GTM B;  3U9S A;  2K05 A;  1TII D;  3R3O A;  1RD9 D;  3H6M A;  1LTS D;  1S5E D;  3RMH A;  4CJ0 B;  2NYZ D;  1WTP A;  3OPO A;  1PRT C;  2PO4 A;  1EYA A;  1Y69 U;  1Y8P B;  3NP8 A;  2F0S A;  3L7Z C;  1Q90 A;  4QMG A;  5JVH 3;  2XNA C;  3VR3 A;  1PZJ D;  2B39 A;  1F9Q A;  5M5X B;  3M4Y A;  1NR2 A;  1SMY C;  1U4L A;  4B9X A;  1CZW A;  1TWA B;  1BR9 A;  1I4X A;  2JP1 A;  4KKS A;  1EIG A;  3NWS A;  1B1Z A;  1STY A;  3DWP A;  1WTR A;  1RKN A;  4KMU C;  1A15 A;  3K58 A;  2J7Z A;  2E2J B;  4HSP A;  3P75 A;  4PMW A;  1F2Y A;  5KND A;  4BBR B;  4MIU A;  1MSH A;  1PZI D;  3MWY W;  4XT3 B;  4MN3 A;  5DEH A;  5FKA C;  4C3J B;  5D14 A;  1QNU A;  4F87 A;  1QJO A;  3P1H A;  2NB0 A;  1HQR D;  1KDA A;  4KJN A;  4XYO A;  1JWU D;  3HEJ A;  1II3 A;  4XQQ A;  1HFN A;  1STN A;  4EQN A;  5J39 A;  2XSC A;  1LTG D;  1HXY D;  3SHL A;  1EWC A;  1T5E A;  5FLX L;  1BCP C;  3HG9 A;  5M3F B;  2BE5 D;  3MVV A;  5IGD A;  1ZKO A;  2NUC A;  2SOB A;  4TKO B;  1LTT D;  5COY A;  1YNN D;  5ELD A;  4KI0 A;  2Q8I B;  3NTH A;  2K1B A;  1QE6 A;  1FD7 D;  3J81 L;  4O42 A;  2I46 A;  1B53 A;  1SYD A;  5EKI A;  4G7H C;  1B9M A;  3A8J E;  1D5M C;  3VYU A;  1L0X B;  1B3A A;  4OGQ C;  1PTO B;  5KNB A;  4FF1 A;  2HCI A;  2F0H A;  4ZLT F;  5C0X J;  2NTS A;  3OSO A;  2FFK B;  1EY4 A;  3E6Z X;  4XT1 B;  3S16 B;  2WKD A;  3TP6 A;  4RCO A;  5FK9 C;  3I70 A;  2EY6 A;  2XRS D;  5JEA H;  1D5Z C;  4XQJ A;  4A3M B;  3E0J A;  4IFD I;  1CA5 A;  1SNM A;  1HHV A;  3S1R B;  1O7L A;  4DXF A;  1SFO B;  3GTJ B;  3RZO B;  1PXU A;  2HCC A;  4K2L A;  1I4H A;  2XN9 C;  1JB3 A;  5G3L D;  1QCB D;  4A3B B;  1AEX A;  5KYL A;  1Y1W B;  2R6G A;  3A8I E;  4KY7 A;  1EQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...