3TDQA

Crystal structure of a fimbrial biogenesis protein pily2 (pily2_pa4555) from pseudomonas aeruginosa pao1 at 2.10 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
EDPQTFEGAGVVFEVQVEKNLVDIDHRLYRLPNSTVRNGMPSLFQVKPGSVVSYSGTVSQPWSTITDIYIHKQMSEQELAEMIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilY2 protein
publication title Crystal structure of a fimbrial biogenesis protein PilY2 (PA4555) from Pseudomonas aeruginosa PAO1 at 2.10 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Cell adhesion
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tdqA00
2VB2X 2L55A 2QCPX 1ZEQX 3E6ZX 3TDQA 2VB3X
chains in the Genus database with same CATH superfamily
2KJXA 4DAYA 4A3DB 2WB1E 1S4ZA 1LT5D 1PH7A 2A69D 1SSOA 4QY7A 1HHVA 2MO0A 4QCLA 1TXYA 1G2TA 2JP1A 3HOYG 3NQTA 1RODA 1JJGA 4ZK9B 3I8ZA 3P7JA 4RHSA 4BBRB 3D4RA 3M4PA 3J81i 1BO0A 1C8CA 3RZDH 1OXUA 3ER0A 3NSWA 1PXUA 2K50A 1CSQA 1SNCA 1AZQA 1X3QA 5ELFA 4HIMA 1B44D 2RDGA 1H9RA 2G9HD 3TP6A 1IBMQ 1X3PA 3DM1A 1RTOA 5IGEA 1U4MA 2R6GA 3L0OA 1L0XB 2D9UA 4DV6Q 3B6YA 4A4IA 4LF6L 3E9IA 1E22A 3GO5A 1EIFA 2IJ0A 2R93B 3V96A 4RGTA 3KFUA 5DLQE 1K83B 1V9PA 3F2BA 4DV4L 1ASZA 5IP7H 2FINB 2KCNA 5KIXA 1IKLA 5EKIA 1VQCA 3ZJYC 1AFPA 4FXDA 2F52A 4KD3A 3K7UC 3I72A 3TP5A 4UY8C 1RF2D 2I5LX 1UEAB 3CCQA 1AE2A 4BBRG 5LL6X 3PO3B 4DGZA 4NXNL 4KTAA 1CZGA 2WAQE 4GNXA 1B3AA 1BXTA 1PH5A 5I4DA 1QG7A 3S1QB 1UE6A 4B3MQ 4DXFA 1LV9A 1HZ9A 1JOQA 2Q2TA 1OXSC 3LNNA 3AQQA 2ZXOA 4GOPA 3QJYA 3BYYB 2I5HA 1BDOA 3PF4A 3S15H 1DYQA 5C4JB 4V0BA 4DR7Q 4DUZL 4UP8A 2F0KA 1MD2D 2F0TA 4YY3L 4A93G 1NMFA 5M3MG 3BZDB 3LGJA 2AWOA 3HOZG 1F2MA 3ONAB 4LAAA 5IY0A 2MJ8A 1VQMA 1M1KC 2R7ZG 1PFSA 3TP7A 4X62Q 4L8JA 3HOXH 2V4DA 1K8OA 4JI8Q 5D65A 2V1CC 2L1BA 1Y1VB 1NBWA 3SE0A 4ZYSA 1I3QB 5I6YA 1EY5A 3BJUA 3H15A 2K5VA 4DU9A 4WJ3M 2KECA 3IL8A 1SE8A 4IFDJ 2GN5A 1TVXA 2B2TA 3L9AX 2LS01 1P8LA 4O0AA 4L5TA 1K28A 5CV5A 3PIO3 1H9SA 4DV1L 1X65A 1TT2A 3HOUG 3D31A 1SYBA 2E2IH 1QNKA 3MXNB 2ICEC 1K3RA 1WFQA 3I4LA 1WTOA 1HCZA 1KDAA 2A8VA 5C3EB 1EOVA 5J22A 5E7NA 2H5XA 1WTRA 1HJPA 1NCVA 1YHAA 4CDCC 5M3FB 3TP8A 1GUNA 3A0JA 1PH1A 4DR3L 1O7LA 1U9RA 4C2MH 3J81c 1WCMB 3SXHA 4R4OA 4JI5L 4A3MH 2Z4IA 5K36H 5I6WA 2ZXRA 2IX0A 1C7YA 5CV4A 1IBLL 4DR1Q 4UP7A 5CGKA 4ILWA 2RVLA 2J7ZA 3CXCA 1RIPA 3T56B 5J39A 4IOAA 3FKIG 1RCVD 4LMQD 1HR0L 3CMAA 1Q1BA 2F0DA 5EPLA 3HOVB 1JE5A 2RHSB 4DK3C 3WWVA 2Z6BA 4KJOA 2FFKB 1IBKQ 1HUNA 4Q0FA 2B2UC 4JI8L 4OHJA 5CV7A 4LUVA 5AJ3L 3S1NB 2WB1G 3PIP3 4GKKQ 1EYCA 3KK7A 5IE8A 1J6QA 4K0KQ 2EJFC 1NUCA 1Z9FA 4JYAQ 2F4VQ 1UE7A 3J7YW 4B08A 1PA6A 3HOZH 3PO2G 2E2HB 3OTOL 3GTPB 2F3IA 4P75A 1TWHH 4FF2A 1WCMG 1DOKA 1HZCA 4RA8A 1RDPD 1G6PA 4LFCL 1WD1A 1G51A 2DY8A 3HZXA 4QL5A 2K03A 1GUGA 4KK7A 2UUCQ 3C1EA 1CT1D 4YHHQ 4NW2A 2DJFC 3KJPA 4J15A 3CCRA 5E1FA 3KJOA 1LT6D 2JYOA 4L5RC 1H9SB 2RCNA 1VQ8A 4RKBA 3E9HA 1D7QA 2LMCB 3HOUH 2E2JB 3I4NB 2B8GA 4HCEA 2RKSA 1XMQQ 2E5LL 1PH6A 3GQBA 2L0CA 1PFBA 2AUKA 1ENCA 2EY1A 3OW2A 2L55A 1ET6A 5FLXc 3J80L 5JJLA 1XNRL 2YU9H 1PTOC 4JI0L 5M5WB 1IBKL 2Q8RE 1N33L 2OXPA 1EY7A 1H9KA 5C44B 4DV3Q 4HJ7A 4JI3Q 3CU7A 1DXMA 5M9OA 4GLAC 1VQEA 4A3GG 2WAQG 1BUVT 2ZTCA 1R9TB 3UE0A 4R4CA 3N52A 5LL6S 4DR4L 1B3QA 2O2LD 3G6EA 2R7FA 4GS3A 4CHTB 5CBEE 3M9BA 3SVMA 1UWVA 4DR5Q 1WVLA 4B3RL 2EZVA 4B9WA 1YHQA 1I4RA 1E2VA 1VF7A 4JW0A 1PVOA 3V05A 2UXCQ 1ZKOA 1X3EA 4OIKA 3OIPA 4A3KB 2UUCL 1EYDA 2GVBA 3U4ZA 5IWAQ 2BDNA 1EIYB 4FXKC 4L5QA 3CCMA 5HURA 4V190 2F3WA 5CORA 3MAQA 4X65L 3PO2H 1JCKB 3PGZA 1CA6A 3RZOB 1Y8NB 2OT2A 5KYLA 1QB5D 2VUMB 1E24A 2VS1A 3GTJH 4K6LA 2EYPA 2YTXA 1JORA 3K8AA 5CV6A 3FMCA 1TS2A 3K58A 3CMEA 1XMOQ 5AFWA 3RN2A 1D5XC 2B63G 2RCFA 2R92G 3KF8B 4A3IH 3TS0A 2RSNA 1YJNA 4UP9A 3FRPB 1IL8A 1OXVA 1CKMA 5D14A 1O7YA 1X3GA 1STNA 4POFA 5FJ8G 2BA1A 1VQGA 3S1MB 2JA7B 2A5HA 1PH3A 5JEAG 3HKSA 4ZUIA 1R4PB 4B3SL 4EGVA 4BXXG 2FHTA 1AH9A 5E4XA 2BCOA 1M90C 2JSOA 2X6LA 3DEPA 1HA5A 1U5KA 4KHVA 5M5YH 3FPPA 3LWUA 4CJ1B 3OHXC 1JT8A 2EOTA 5F2DA 4JOIA 3Q8DA 4M1UB 1L0WA 2B8FA 5ELEA 4DUYQ 1IW7D 1VQIA 2CQOA 3SK8A 3VR6A 4KHPL 4KD4A 4LF7L 1QILA 3CC2A 3QOJA 4G7ZC 3O13A 4OEMB 5LMNL 2PNHA 3DHQA 1VQOA 2XRSD 1SFOH 5DNFA 4IUTA 3GTGB 4WRDA 1JR0D 1SXTA 5J1ZA 2NN6I 2QF7A 4JC0A 2PO4A 2E75C 3HKZB 1MJEA 4QF4A 2K1BA 4NXMQ 5C4XG 2F03A 4PZ7A 2B2VA 3MFGA 2F0NA 1A62A 3J81j 5C5MA 2UXDL 2JQOA 2B63H 1H9JA 2B29A 3T4AC 4FF4A 1W3SA 3CCJA 3JAMi 4IPHA 2MFIA 5IYCG 2UUBL 1CFMA 2JXMB 2WV6D 2IX3A 1D1IA 3CHBD 3MA2B 4DKAC 1Q86C 2NN6G 2I5MX 3IFDA 4ZCKA 1FNUA 5FJ8H 5LMUQ 4A3BG 2EDGA 4HN7A 2N55A 1PTOD 2CCZA 4LFAL 1SYDA 5JEAH 5C0XI 1E7ZA 4G7OC 3G48A 2M00A 3S2DB 3KBGA 1LO5D 1N9WA 2LY7A 5I2YA 1PTOB 5GAGC 3NELA 1K73C 4BXXH 1LYLA 1J9OA 2ID0A 3BVMA 4P72A 4ME3A 4IN3A 4HIOA 1BBXC 5EJWA 1T5XD 1GHJA 1AW7A 2Z8LA 2VW9A 1BF4A 4X3TA 1VQ5A 2B2WA 5COYA 3AFQA 2G5DA 4JV5L 1J5EL 1I4HA 4A3CG 1I6VC 4YWKA 4XQQA 1Q7YC 1L0YB 2F0UA 5KRUA 2OWOA 3H09A 1A3TA 1PYWD 1JB3A 1HZAA 1SNMA 4C3JH 3VYUA 1EEID 1STEA 3IRBA 2UU9Q 3I91A 2EPBA 1XNQL 4C56C 2EYHA 4A3FB 1EZ6A 1ILQA 4LF9L 1LTTD 4DNIA 2F0MA 3KDFB 3R3OA 2WIIB 3NE5B 3GV6A 3K5OA 1FVIA 2PZUA 3HG9A 3H0GG 3WOFA 1W6JA 3NTHA 1GXDC 4R8IA 4DV2L 2IPKD 1WTXA 3S14H 3G7LA 1CQFA 1YEZA 3S16H 2Z6KC 1XTDA 1B7YB 4GKJL 4BY7B 4P73A 2L11A 3BDOA 2VQEL 4IPCA 2NVXB 4ALPA 2CWPA 4C3HB 1QVGA 1VQJA 3T1YL 1QNUA 1TWCH 4EQOA 4MIUA 2KEDA 1G291 3QG1A 3OWFA 1BKBA 3M4OB 5IYCH 1QE6A 2CHBD 2RDHA 3R93A 2EYLA 5E4WC 5HGQA 1EY6A 2AUJD 1YHBA 3J81L 1PH4A 1D5ZC 4A3BH 4IPDA 2BOSA 3SEBA 1XXGA 3BVZA 2PPBC 4F88A 1TWAH 4JCVE 4Z9CB 1Q82C 1ILPA 2DGYA 4A3FG 1PH8A 4GZYC 1V1QA 3CCVA 2N3SA 2PYKA 1A3VA 4IJHA 2PI2E 3T13A 4FVMA 3VYTA 1S5CD 2XNAC 2DY7A 1NAPA 3U9OA 1WI5A 4QIWB 4LF6Q 4H44C 3T51B 4JPBW 2JA5B 3H3VC 1HXYD 4LF4L 3NBHB 3J7AV 3L2PA 1Q12A 4DV4Q 4OO1H 2EYJA 4KV6A 2PQAB 4UHVA 4DPGA 4WFN3 2IL8A 4A3CH 5C0XH 4A3LH 4GNXC 2H4OA 3OMCA 1DGSA 2NVYH 3HGBA 5DM73 3S9WA 1S40A 1A6XA 4G4KA 1I4PA 4R1JA 1JE4A 1EYAA 5CBAE 3HOXB 2HCIA 1E2ZA 4YWMA 1DZ1A 4GOPC 3M3YB 4NXNQ 2B39A 3OSOA 2JA6H 1A2UA 1STHA 3TDQA 3C2PA 2QKIC 4DNRB 4FO2A 4QMGA 1NY4A 3KBXA 3HEJA 1LTSD 2Z6KA 1TQOA 3I4MB 3DUZA 3DWPA 1YIJA 1EEFD 1S3OA 4XYOA 2E2IB 4A75A 1WTVA 1R4QB 4DUZQ 5FLMG 4FYDA 2HIVA 3GDEA 3GTLH 4A3EB 4ID6A 1QUQB 1B2TA 3EIVA 1Y1WG 1CKNB 1LTRD 1SR3A 4YY3Q 3EJIA 1TKWB 3GTMH 2FMMA 5HY6A 3U4VA 5FLXL 4C2MB 4A3MB 3DMUA 5ELBA 4HCSA 2B2TC 1SNQA 2A6EC 4L6TB 3A56A 1VQ4A 4ABNA 4DF7A 2Y0SB 4A3DG 5GAHC 1B70B 3S1RH 2A68C 4XIGS 5ELOA 1GUWA 1F9SA 4O2DA 1YNND 3DEOA 3SHLA 1UEBA 1Y8PB 1CTMA 4K6DA 3BDLA 4OWWB 2OQKA 4QUCA 1KABA 3G6JB 1KRTA 4ZKCB 1KNAA 5BR8L 1UE5A 1TS3A 3M85A 4DV1Q 3HOWH 1PTOF 4JI1L 5I2XA 1S5ED 1KHIA 3OPOA 3ITPA 1D2BA 4NKLA 2D5DA 1UE1A 4IZ8A 2MP1A 1EQRA 1HTPA 5BN5A 1ENFA 1NE3A 3A8IE 3FDTA 4O1NA 3MEFA 4HIDA 1BBUA 5JJKA 3KLRA 4PNYA 3MVVA 2JEAI 4DR3Q 1KAWA 4DAYB 2R93G 4JI5Q 2K7VA 4KY7A 2HHHL 1IBLQ 1HQMC 1N8RC 5CV9A 1MIUA 3NHHA 3HOYH 2CW0C 4JVZA 3E5SA 3STBC 5KYIA 3F2DA 4DR6L 3K0XA 2ZTEA 3KF6A 3NBIA 2KBNA 1KXLA 1HR0Q 5IGDA 3P1HA 4TKOB 1TWGH 3TSSA 1CSPA 2K5QA 4BY1B 2JK8A 3CRLC 3CF5A 3PO3G 4AIMA 5C5LA 3E0JA 2RSOA 4F87A 1E1TA 5AJ3Q 1OXTA 3KOJA 4UAIA 1K9MC 1SYEA 1YNXA 2JA8B 4C1NI 1KRSA 2YTYA 1F2LA 2YU9B 4IUUA 5IT9c 2PQEA 3NTIA 4TRDA 1O7ZA 4FF1A 2IT1A 1DCZA 3CCLA 1RJTA 2F3VA 2F1MA 2O5IC 3OTOQ 2VB2X 3A5UA 4XQNA 1LLRD 3ND9A 3PCOB 1EYGA 1VQ6A 1EWIA 2K52A 3K5NA 3AMUA 4A3DH 4LFCQ 1PMRA 2AMCB 1IXRA 5JJIA 1TY0A 3A7AB 4KKUA 4AQYL 5LHY1 1A3UA 4N8X1 1HNZQ 4JI7L 3EN2A 4K8JA 4DR2L 4BBRH 4YIJA 2L12A 2EYOA 1JQYD 2K04A 3CQZB 4GNXB 1EIHA 4IUVA 2F4IA 2K5DA 1Y1VG 2E5LQ 3CP0A 1J8IA 4KY5A 1GM5A 1Q8KA 4I65A 3NEMA 4KI0A 2NVQH 1E1OA 2QDBA 3A54A 4GOPB 1X32A 2SNMA 1XNRQ 4JI0Q 1N33Q 2EYFA 3I70A 3IAYA 1CI3M 1ZYRC 5CMDA 2BDOA 2R93H 4ME5A 3SGIA 3NPPA 3FPUB 2XIWA 2PW7A 5T1GA 5JPMC 2E76C 4A3IB 3VYRA 4CJ0B 4JI6L 1IW7C 3BS1A 4A93H 4Y7NH 5M3MH 1PYBA 5GAEC 5FO7B 5C3EG 4GN5A 4C3IB 2EY5A 4KJNA 1NSNS 1U4LA 1X54A 2YV5A 4DR4Q 1H95A 5M3FG 1B8AA 4IPGA 4ZQ3A 1BCPF 2R7ZH 3GD7A 3QR8A 4O42A 5IP9G 4B3RQ 3KLSA 1WTWA 3GTQH 4LJZC 2ALYB 1V1PA 2A6ED 3TZUA 1BBWA 4B3TL 1KL9A 2XGTA 1BOSA 1AN8A 3C3LA 3SK5A 1K8GA 3S1QH 2K05A 2X69A 2A68D 5C6AA 2EJGC 1HNZL 3D0FA 2EVBA 4PQXA 1V8QA 2F0WA 3HOVG 4HEDA 4X65Q 1XPUA 3QOLA 3FP9A 4JBMA 1CHPD 5C3WA 1FJGL 5C4JH 3G71A 2XVSA 3CCEA 1EUJA 2NUCA 4AYBB 2Q2IA 1EZ8A 4JBJA 2F0GA 4OGQC 1GUTA 3D6WA 1CZWA 3VR5A 1MI2A 3HKZE 4C3IG 1TS5A 3BZCA 3D6CA 4JI4L 4HMJA 2KHJA 4JI2L 3NTKA 1I50B 2Q2HA 2B3GA 2M2LA 3V2TA 4N8FA 1AP0A 5BN3A 4NMZA 1GJXA 2MPMA 1F77A 5D3IB 2NZ1D 1SDFA 1I3QH 2NYZD 2XN9C 2N88A 3J80E 3FKIH 4FP5D 1AZPA 3UDXA 5KEEA 4B3SQ 3OIQA 1JICA 5M5XB 1SYFA 2GA4B 2UUAL 3K6OA 2KUMA 4JOIC 2K5HA 2CW0D 3STBD 4IOCA 2RBMA 3PSIA 3TBIB 2KHSA 1HNWL 3PMFA 4EQPA 3I4NG 1VQLA 3FEWX 3CPWA 5JEAJ 1MJCA 4JBWA 3MTSA 4J8QA 1IZ6A 4XT3B 1BNZA 4U68A 2SNSA 2L5TA 4DNTB 2A19A 3AYHB 5M3FH 4K2LA 3CKIB 4KHPQ 2AQ1B 3K5LA 4LF7Q 2F0IA 1WCMH 1VDZA 5C44G 2K6AA 1XWEA 3I73A 2RF4A 1SNOA 5EPKA 3PUXA 2QEJC 3W1GA 5LMNQ 4CJ2C 2B2VC 5GADC 2N8NA 1E2WA 4N9PA 1EQTA 1KD1C 4KY6A 4L63B 5LMNW 3PIOA 2ZJRA 2QEXA 2D0PA 3M4YA 3UDIA 3BZKA 2KENA 3CC4A 1S5DD 4LFBL 5CR3A 2ZJQA 3S1NH 1O80A 1LT3D 3PUYA 4A3KG 1EWHA 2UXDQ 1N34Q 4C3JB 4F8MA 1VF5C 3PV0A 3I3CA 4IO9A 3JAML 3VA5A 2UUBQ 1HH2P 4DFAA 2IHEA 4H02A 4K5WA 1GOZA 5EKKA 3QIAA 3Q22A 3K7AH 4GN3B 2VUMG 1VCIA 3VR4A 2AQ3B 1CA5A 1BVSA 4MN3A 2XWBB 4LFAQ 4FXGC 2JN4A 2WFWA 4A3GH 4DV5L 1BR9A 1X56A 1EY0A 3I55A 2B2WC 1ZYRD 4OX9L 5ELNA 1C48A 1KNEA 3U58A 4RAUC 1T9HA 1WYDA 3S14B 3OWEB 3M7NA 4ZKBB 1Q46A 3HS0C 4U673 1FNWA 4WORA 3U9SA 4EX5A 3EFXD 3PIPA 2EQSA 2JA7G 1WOCA 1TWCB 5E3FA 1NMGA 5KNCA 4JV5Q 1J5EQ 4K8IA 1PV4A 3OMGA 1BCPC 1QOHA 4L5SA 2UXBL 1C9OA 4KMUC 2EXZA 5GROA 4QIWE 1SN8A 2CFMA 5T1IA 1CQVA 1TWAB 2Q2UA 5C44H 5DAUA 2HUGA 2OCEA 4DN4M 1XNQQ 3I2ZA 5IYDG 2IWHA 4BBSB 3NUCA 1I5FA 1TWFB 1N34L 2K5WA 3RNUA 2WP8J 4LUOA 1EQQA 4LF9Q 1ML0D 2R92H 4DA2A 1BQQT 5C0XJ 1NNXA 1TIID 4RGOS 3ULPA 3R2TA 4DK0A 4BA2I 3S2HH 2F0VA 3NENA 3GTKH 4DV2Q 1D1KA 2NVTH 4A3JB 1A0IA 3ULLA 3URYA 3F2CA 4GKJQ 4KKTA 1X3FA 3CCSA 3M4QA 1X6OA 2VQEQ 2VQFL 1I94L 2NVYB 4HJ5A 2IHFA 3L3OC 4A76A 4JK1C 3T1YQ 4A3KH 4K14A 3KLSX 1HNXQ 3BYTB 3DWQA 3HKZG 3T53B 1XX8A 2JJQA 2HIXA 5I9OA 3BU2A 2JA6B 1YNNC 4X6AH 2PW5A 1VQKA 4IURA 2ASBA 3TS2A 4G7HC 2D0OA 1SNPA 4IALA 4IUNA 4BBSG 1EU3A 3TREA 2R3ZA 1FNVA 1SJED 3I56A 4HSVA 1N36L 2HDLA 3RZDB 1ZEQX 2B2YA 3MFYA 5KNBA 1B1ZA 4DV0L 3W3AA 4IUQA 4K2KA 1V43A 3AEVA 4DV7L 1SRUA 3GTLB 1JC7A 2Y0SE 4LF4Q 3S1MH 2MUYA 2JA7H 1KDBA 4BWGB 3LX0A 3GTMB 1T5EA 1HTLD 5IT9L 1CKOA 1KLGD 5CYUA 4RWSC 2DJGC 1DJRD 5FO8B 3HFZB 2OTLA 4QQBX 4X3SA 1L1OA 3HP3A 5C4XH 1XJVA 4EVOA 2QCPX 3PQIA 4RCOA 3Q0AA 3NWSA 2LFNA 1HQRD 1QJOA 2EY2A 4EQNA 1YJ9A 2OQ0A 4LF5L 1I6HH 4WJ4A 1HNXL 2HD3A 2RHQB 4WJWA 3TN2A 5ISRA 4Q5VA 2NN6H 3QO2A 1VQNA 3A7LA 3HOWB 2ES2A 1B9MA 3G4SA 3A8KE 1VQDA 1FL0A 2LXJA 4CKCA 1OXXK 1MKHA 1LTGD 4KKSA 4DAPA 2Q8TA 3KYHC 1M4VA 3OOCA 2ZM6Q 1XYIA 4X66L 2F0OA 2I0QA 4IJLA 1SAPA 4RMFA 4K5XA 4R8NA 1PYSB 1I4GA 3J81E 3S15B 3EBEA 2Z4HA 2E2DC 4DAMA 4BY7G 3K5MA 1RL2A 5IP7G 4NDXA 5A2QL 4PMBA 3HOYB 2NBFA 1E0BA 3Q24A 4C3HG 5A35A 1STAA 1UAPA 4Y52H 1GO3E 3AB9A 1CUKA 1TWGB 3GV3A 1PZID 2H1EA 4DK1A 3TEHB 1BCPD 3VR3A 1EIGA 1JWSD 1MGSA 3AU7A 4MHEA 5BR8Q 2ICIA 1BCPB 2F0PA 1ICWA 4JI1Q 4ZRZA 1A8VA 1KLUD 4FDBA 1VQ9A 4HJ9A 1WJJA 4YCVA 3CRKC 4RG1A 3H0GH 2K32A 4IQZA 2DNCA 4JBKA 1U4PA 1EY9A 4H13C 1HZBA 1WTHA 1RHPA 2JA5G 1B50A 1LM0A 5EAYA 2PMZB 2HHHQ 3T1HL 2ZJPA 1G91A 5DEHA 3RMHA 2ZM6L 3U50C 4CDEC 3TZDA 1LUZA 5IIFA 4MZ9A 2PI2A 5EPJA 2VXWA 3SK4A 3X3NA 4DR6Q 2HT1A 1F2YA 4FF3A 2F0LA 4F7XA 1N32L 4LUZA 3HOXG 5FKAC 4PV1C 5JVH3 2ZT9C 3TRZA 5FK9C 1QZGA 1YZ6A 3TMEA 3VYSA 4TQUS 2XWJB 1W2BA 4A3FH 1DM0B 2NZHA 1JOKA 2NVQB 2KCTA 3DXJC 3LWEA 5FLXE 1PLFA 2DNEA 4S3SA 3A5ZB 2KCCA 4KHZA 4RHRA 1FR3A 2NTTA 1M8AA 4X64L 2SOBA 3AFPA 3I4MG 4NB3A 5IODA 1LTLA 1SE3A 2FXQA 2R7DA 3CPFA 2A73B 1RTNA 4UDUC 4BY7H 1EL0A 2XTIA 4A93B 4Y7NB 3MXNA 5M3MB 4CKBA 2NVXH 4A3EG 3J7ZC 1YITA 1XTCD 4B9XA 2IW3A 3UDFA 4C3HH 2LSSA 1DOMA 4X3UA 1F9PA 2E8GA 3HOZB 2K01A 4AQYQ 5ELCA 1JJCB 4FNFA 3M4OH 1TWHB 1WTQA 5ELDA 2R7ZB 2XSCA 4DAVA 4JI7Q 5JJZA 4A3MG 3S17H 5K36G 4DR2Q 2A74C 3GTQB 2SEBD 4XTCS 1K8MA 2WKCA 1G2SA 5TSSA 1YNJC 1TS4A 1GD7A 1LTBD 2AWNA 2Y0SG 2YYZA 4AYBE 2F0HA 4P74A 1PRTF 1O78A 3NK9A 3RUZA 3K57A 1X55A 4YCUA 1QZHA 3GTOH 4JG2A 1UNSA 3Q6SA 3CAMA 1SE2A 2PNRC 4ODGA 3E6ZX 3HOUB 5JVG3 4NPSA 2O5JC 2N49A 1FGUA 2JA5H 1HR0W 1IBML 5FLMH 2A1AA 3EVQA 2MHVA 4PMCA 3SR1A 4DV6L 4LF8Q 4RCNA 1Y1WH 4JI6Q 4POGA 2K14A 2EE1A 4CDFC 1AE3A 3DWAA 2N78A 4XQJA 4XDXA 2K4KA 1O7IA 2CVRA 3K80C 1MBYA 1FGBD 2BH2A 5G3LD 4HTHA 3K81C 2DN8A 3M3YH 2PCFB 3FKIB 5NUCA 4B3TQ 3D8GA 1TY2A 1DD2A 2HCCA 1C0AA 5FO9B 4X3KA 1OTCA 3NWTA 2BA0A 4P71A 1FD7D 3I4OA 5KNDA 2D2CC 3I4MH 2K28A 1WD0A 3SDZA 4BY1G 3C1FA 2WB1B 2LKVA 1FJGQ 4GLXA 4IFDI 1S72A 1L2FA 4B3ML 4PG3A 4A3EH 1PFNA 1MSGA 3I7FA 4ZAIA 4XYQA 4KLKA 2JA8G 4OWTB 4AH6A 3H6MA 4CKEA 3H3VI 3PO2B 1Y69U 2O4XA 4LW1A 1MHWC 3R8BA 2QDLA 1NJIC 4DR7L 4JI4Q 3GTJB 4JI2Q 4NP5A 3BG3A 3L7ZC 4CDDC 1Y14B 1S5FD 3JC66 1F9RA 1XPRA 1LABA 2NB0A 1KIXA 4LF8L 1K83H 3CW2C 1QCBD 1LTAD 1JB7A 3MC0B 4IFDG 4H7BA 1EFID 2AKWB 1IHZA 1HUMA 3KF6B 3ICEA 1KC8C 1STGA 1UUPA 2MO1A 3KLWA 3MEHA 4QUFA 1V1OA 3UE1A 3Q23A 4RH6A 4X62L 2UUAQ 3VDYA 1C4QA 1STBA 2KVMA 3E3XA 3PO3H 2MQHA 1VQAA 3BVGA 1HNWQ 3HRZC 3H94A 1RKNA 1Z7TA 3UDGA 1SMXA 4R4IA 3R2IA 4E6IA 5H1SE 2BH8A 1B9NA 2KHIA 4QB4A 1B4OA 2KQ3A 1D6EC 3K7AB 1F9QA 5EQ0A 5M5YB 2D62A 4A3GB 1EOTA 2WAQB 2Q8IB 3MZ5A 1CK1A 3SK6A 1KQSA 3I90A 4PMWA 1PHJA 5GQOA 1CHQD 4A3IG 3KF8A 4XT1B 3OW7A 3W5OA 2I46A 5IGBA 1SBBB 2L4NA 3F1ZA 4OIJA 2PZTA 3P75A 2E74C 1SMYC 2A6HC 1Z47A 5HGTA 4RFBA 1WTPA 4DR1L 3P20A 1JWMD 4ULLA 5JPNC 2ATWA 4BY1H 2NWGA 3EA6A 1SFOB 4QJFA 4APVA 5EBCA 2HDMA 1IYUA 4LFBQ 1Y1VH 1EU4A 1GUOA 1SYCA 1IKMA 3QWNA 1VMCA 2JA8H 3NP8A 5CV8A 2CKZB 1YNJD 2KA7A 1PZKD 3MWYW 2G9DA 5C4HA 4CBVA 4MTNA 3PUWA 1PRTC 4HJ8A 1AEXA 1TU2B 3FHWA 2IY5B 4RKLA 4GKKL 1ONLA 2AHOB 1QWYA 4K0KL 1CM9A 2B63B 4JYAL 3RD4A 2F4VL 4DV5Q 2R92B 1KAAA 4DK6C 5CC4A 4AYBG 4IFDH 3UI2A 4OX9Q 4ZLTF 2ZXPA 2TMPA 5C3EH 2Z9HA 3S2HB 5IYBG 1Q1EA 3QB3A 3GTKB 2B2UA 1VS0A 5DM63 4OWXB 3J7A5 2NVTB 2CQAA 4I7ZC 3H3VH 3RLFA 2Z0SA 1A63A 3J7AF 5EKLA 5IP9H 2WKDA 2FJ2A 3CQZH 4HR7B 1V1PB 4OL7A 1F2ZA 1KTKA 2EY6A 2K5NA 4GLVB 1OO9B 4YHHL 1SE4A 3H91A 5IGFA 2WACA 2YTVA 2UXBQ 4I7AA 2M9VA 5IOCA 4LK1C 3HOVH 1II3A 2HQEA 3MHBA 1XMQL 2AQ2B 1K3BC 5L37A 1HRJA 1PDQA 4HIKA 3M7GA 4IUPA 2F0QA 5C4ZA 3J80i 4UPAA 2Z1CA 4HAEA 4C3IH 2ZTDA 1ZXTA 4DV3L 4JI3L 2JEBI 4OONA 4C1NK 2E2HH 3GTPH 2RA4A 1PFMA 1D8LA 2EXDA 2BE5C 2MNAA 4YWLA 4PZ6A 5G3LF 1HA6A 1EY4A 1A2TA 2VB3X 5JOBA 3VR2A 2QW7A 1XPOA 4CGYB 2CWAA 3EROA 3RLOA 2VQFQ 1I94Q 4R4QA 2FMCA 5I9PA 3JAME 4BA1I 4G57A 1QVCA 2C35B 4R4TA 3S16B 4DR5L 1B53A 2P5ZX 4M8AA 1Q90A 5C4XB 4OXPA 2B2YC 2KCMA 2RQXA 2IX1A 2UXCL 4N9TA 3ND8A 2E2JH 2C5CA 5K5PA 3I4NH 1ESFA 1S5BD 5IWAL 3IFTA 1I6HB 3BDCA 2OTJA 2F0JA 2CH4W 1QVFA 1VQFA 4BS9A 1LT4D 4C3JG 3A74A 5IYBH 3CCUA 3W1BA 3RR5A 1N36Q 4A3BB 3A55A 5M5WH 3F2UA 4QGUA 1I50H 1SLJA 4DV0Q 2QILA 3W2DA 1VQBA 4DV7Q 1L1OC 3ERQA 1XMOL 1X9NA 1HFGA 1YVCA 1LTID 2C9OA 2ENBA 1ESRA 1R9TH 3KDFA 1SROA 3NQIA 1KDCA 5EBDA 5C3XA 3PF5A 4HMIA 1GKHA 2MGSA 5M5XH 2A69C 3WOEA 3X3MA 2I07B 2EJMA 1W6KA 4YCWA 2HQLA 4RGNA 1SMYD 2A6HD 3GP7A 3N6RA 3ZYYX 1JOOA 2NZOA 1JMCA 5BN4A 5J3BA 3WDNA 1ET9A 1DONA 4MNOA 4LF5Q 3RN5A 1Q3LA 3D3RA 2F0EA 4J6HA 2F0SA 1YJWA 2L15A 3RZOH 1VQHA 4OO1I 4J1MA 2VUMH 5IGGA 3TQYA 3K59A 2PMZE 1PRTD 1GUSA 1PH9A 1IYVA 3H0GB 4R9WA 4DUYL 1PRTB 2K33A 1Q81C 2OEOA 2GVAA 2VNUD 4X66Q 2VZAA 4KN4C 1HFNA 4DXGA 3ERSX 2K75A 1I4QA 3NBHA 2J0TD 4A3JG 1EFWA 1U0LA 4LNQA 4OO1G 2JA9A 1K8AC 1VQPA 5C0XG 4A3LG 2PQAA 3PUZA 3J80c 3C46A 1HPCA 2F0FA 1NTGA 2DUDA 5EGTA 4EQ5A 2R61A 5D3DA 2L9HA 4NXML 1K0SA 5KGUA 3MXGA 1I4XA 1TR5A 2JA6G 3S1RB 2RDFA 4HJAA 2EYMA 5IYDH 1SJHD 1STYA 1YBYA 3MXPA 1EQVA 2X6GA 2XRQD 3EQLC 5IT9E 1Y8OB 4XXEA 5IGCA 1MSHA 3T16A 2VY3A 5LMUL 1PH2A 2KOLA 1JJ2A 2PZWA 1EY8A 4RGMA 1FYCA 1H9MA 2NTSA 1QUQA 1ENAA 3KUPA 1YI2A 2BE5D 3T1HQ 1CKNA 4P2CB 1IL2A 3GTGH 4TVAB 1GVPA 2EIFA 3PUVA 1SNDA 1IYJB 3K0YA 5JAVA 4OELB 3S17B 1K0RA 1SEBD 2SDFA 4MTKA 3DM3A 4LWCA 2CH4A 3E0EA 3CC7A 1N32Q 1NR4A 2OF1A 2TSSA 1NR2A 2LXKA 1ASYA 3GTOB 1JWUD 2WINB 1U4RA 4TSSA 4ZUJA 2QA4A 4GN4B 1A15A 4BBSH 3OYYA 1G8ZD 3NXWA 4KN7C 2JE6I 3A8JE 1TWFH 2J4XA 1DOLA 1G6ZA 2UU9L 1ICFB 4HSPA 4X64Q 1VQ7A 1PZJD 3HOWG 2KEEA 5A2QE 3DLLA 1RD9D 1EWCA 4PZ8A 4A3JH 3MXUA 4K5VA 4H0LC 5FOBB 1SYGA 1Y1WB 3S2DH 3ULJA 2VL6A 1LACA 1GHKA 1P16A 1PTOH 3S24A 1VMPA 3JAMc 3CD6A 3FVQA 1Z6HA 1Q8IA 1E3PA 3D4DA 1D5MC 3D4WA 2QGQA 3F8TA 3IKJA 1L1OB 3RLNA 3VA7A
chains in the Genus database with same CATH topology
2KJXA 4DAYA 4A3DB 1S4ZA 1LT5D 2A69D 1SSOA 1HHVA 4QCLA 1G2TA 2JP1A 3NQTA 1RODA 4ZK9B 3I8ZA 3P7JA 4RHSA 4BBRB 3D4RA 1C8CA 1BO0A 1OXUA 3NSWA 1PXUA 1SNCA 1AZQA 1X3QA 5ELFA 1B44D 2RDGA 1H9RA 2G9HD 3TP6A 1X3PA 3DM1A 1RTOA 5IGEA 1U4MA 2R6GA 1L0XB 2D9UA 3GO5A 2R93B 2IJ0A 3V96A 4RGTA 1K83B 2FINB 2KCNA 5KIXA 1IKLA 5EKIA 1AFPA 4FXDA 4KD3A 3I72A 3TP5A 1RF2D 1UEAB 5LL6X 3PO3B 4DGZA 4KTAA 1CZGA 1B3AA 1BXTA 5I4DA 1QG7A 3S1QB 4DXFA 1LV9A 1JOQA 1OXSC 3LNNA 2ZXOA 3QJYA 3BYYB 1BDOA 1DYQA 5C4JB 4V0BA 2F0KA 1MD2D 2F0TA 3BZDB 2AWOA 1F2MA 3ONAB 4LAAA 2MJ8A 3TP7A 4L8JA 2V4DA 1K8OA 5D65A 2L1BA 1Y1VB 3SE0A 4ZYSA 1I3QB 5I6YA 1EY5A 4DU9A 2KECA 3IL8A 4IFDJ 1TVXA 2B2TA 3L9AX 2LS01 5CV5A 3PIO3 1H9SA 1TT2A 3D31A 1SYBA 1QNKA 2ICEC 1WTOA 3I4LA 1HCZA 1KDAA 5C3EB 5J22A 1WTRA 1NCVA 5M3FB 3TP8A 1GUNA 1O7LA 1U9RA 1WCMB 3SXHA 5K36H 2Z4IA 5I6WA 2ZXRA 2IX0A 5CV4A 5CGKA 4ILWA 2RVLA 2J7ZA 3T56B 5J39A 1RCVD 4LMQD 1Q1BA 2F0DA 5EPLA 3HOVB 4KJOA 2FFKB 1HUNA 4Q0FA 2B2UC 4OHJA 5CV7A 3S1NB 3PIP3 1EYCA 3KK7A 2EJFC 1NUCA 3J7YW 4B08A 2E2HB 3GTPB 4FF2A 1DOKA 4RA8A 1RDPD 1WD1A 2DY8A 3HZXA 2K03A 1GUGA 4KK7A 3C1EA 1CT1D 4NW2A 5E1FA 1LT6D 2JYOA 1H9SB 4RKBA 2LMCB 2E2JB 3I4NB 2B8GA 4HCEA 2RKSA 3GQBA 2L0CA 1PFBA 2AUKA 1ENCA 2EY1A 2L55A 1ET6A 3J80L 1PTOC 5M5WB 2Q8RE 2OXPA 1EY7A 1H9KA 5C44B 3CU7A 1DXMA 5M9OA 1BUVT 1R9TB 3N52A 5LL6S 2O2LD 4CHTB 5CBEE 3SVMA 1WVLA 2EZVA 4B9WA 1I4RA 1E2VA 1VF7A 3V05A 1ZKOA 4OIKA 3OIPA 4A3KB 1EYDA 2BDNA 4FXKC 5HURA 4V190 2F3WA 5CORA 3MAQA 1JCKB 1CA6A 3RZOB 1Y8NB 2OT2A 5KYLA 1QB5D 2VUMB 4K6LA 2EYPA 1JORA 5CV6A 3FMCA 1TS2A 3K58A 5AFWA 1D5XC 2RSNA 3FRPB 1IL8A 1OXVA 5D14A 1O7YA 1STNA 2BA1A 3S1MB 2JA7B 2A5HA 5JEAG 4ZUIA 1R4PB 4EGVA 2FHTA 5E4XA 2BCOA 2JSOA 2X6LA 3DEPA 1HA5A 4KHVA 3FPPA 3LWUA 4CJ1B 3OHXC 2EOTA 5F2DA 4M1UB 2B8FA 5ELEA 1IW7D 3SK8A 3VR6A 4KD4A 1QILA 3QOJA 4G7ZC 3O13A 3DHQA 2XRSD 5DNFA 4IUTA 3GTGB 4WRDA 1JR0D 1SXTA 5J1ZA 2NN6I 2QF7A 2PO4A 2E75C 3HKZB 4QF4A 2K1BA 2F03A 2B2VA 3MFGA 2F0NA 5C5MA 1H9JA 3T4AC 4FF4A 1CFMA 2JXMB 2WV6D 2IX3A 1D1IA 3CHBD 3MA2B 2NN6G 3IFDA 1FNUA 2EDGA 4HN7A 2N55A 1PTOD 1SYDA 5JEAH 5C0XI 4G7OC 2M00A 3S2DB 3KBGA 1LO5D 2LY7A 5I2YA 1PTOB 1J9OA 2ID0A 3BVMA 4IN3A 1BBXC 5EJWA 1T5XD 1GHJA 1AW7A 2Z8LA 1BF4A 4X3TA 2B2WA 5COYA 1I4HA 1I6VC 4XQQA 1L0YB 2F0UA 5KRUA 3H09A 1A3TA 1PYWD 1JB3A 1SNMA 3VYUA 1EEID 1STEA 3I91A 2EPBA 4C56C 2EYHA 4A3FB 1EZ6A 1ILQA 1LTTD 2F0MA 3R3OA 2WIIB 3NE5B 3GV6A 3K5OA 2PZUA 3HG9A 3WOFA 1W6JA 3NTHA 1GXDC 4R8IA 2IPKD 1WTXA 3G7LA 1CQFA 4BY7B 2L11A 3BDOA 2NVXB 4C3HB 1QNUA 4EQOA 4MIUA 2KEDA 1G291 3QG1A 3OWFA 3M4OB 1QE6A 2CHBD 2RDHA 3R93A 2EYLA 5E4WC 1EY6A 2AUJD 3J81L 1D5ZC 2BOSA 3SEBA 1XXGA 3BVZA 2PPBC 4F88A 4Z9CB 1ILPA 4GZYC 2PYKA 1A3VA 3T13A 4FVMA 3VYTA 1S5CD 2XNAC 2DY7A 1NAPA 3U9OA 4QIWB 4H44C 3T51B 2JA5B 3H3VC 1HXYD 3J7AV 1Q12A 4OO1H 2EYJA 4KV6A 4WFN3 2IL8A 5C0XH 2H4OA 3OMCA 5DM73 3HGBA 3S9WA 1A6XA 4G4KA 1I4PA 1JE4A 1EYAA 5CBAE 3HOXB 2HCIA 1E2ZA 1DZ1A 3M3YB 2B39A 3OSOA 1A2UA 1STHA 3TDQA 3C2PA 2QKIC 4DNRB 4FO2A 4QMGA 3KBXA 3HEJA 1LTSD 1TQOA 3I4MB 3DUZA 3DWPA 1EEFD 4XYOA 2E2IB 1WTVA 1R4QB 4FYDA 4A3EB 4ID6A 1B2TA 1LTRD 3EJIA 1TKWB 2FMMA 5FLXL 4C2MB 4A3MB 3DMUA 5ELBA 4HCSA 2B2TC 1SNQA 2A6EC 4L6TB 3A56A 4ABNA 4DF7A 2Y0SB 2A68C 4XIGS 1GUWA 1F9SA 1YNND 3DEOA 3SHLA 1Y8PB 1CTMA 4K6DA 3BDLA 4QUCA 1KABA 3G6JB 4ZKCB 1KNAA 3M85A 1TS3A 1PTOF 5I2XA 1S5ED 3OPOA 3ITPA 1D2BA 4NKLA 2D5DA 4IZ8A 2MP1A 1HTPA 5BN5A 1ENFA 3A8IE 3FDTA 4O1NA 3KLRA 4PNYA 3MVVA 2JEAI 2K7VA 4KY7A 1HQMC 5CV9A 3NHHA 2CW0C 3E5SA 5KYIA 3NBIA 5IGDA 3P1HA 4TKOB 3TSSA 2K5QA 4BY1B 3CRLC 5C5LA 3E0JA 2RSOA 4F87A 1OXTA 4UAIA 1SYEA 2JA8B 4C1NI 1F2LA 2YU9B 4IUUA 2PQEA 3NTIA 4TRDA 1O7ZA 4FF1A 2IT1A 1DCZA 1RJTA 2F3VA 2F1MA 2O5IC 2VB2X 4XQNA 1LLRD 3ND9A 3K5NA 3AMUA 1PMRA 1TY0A 3A7AB 4KKUA 5LHY1 1A3UA 4K8JA 4YIJA 2L12A 2EYOA 1JQYD 2K04A 3CQZB 1EIHA 4IUVA 2F4IA 2K5DA 1J8IA 4KY5A 4I65A 4KI0A 2QDBA 3A54A 1X32A 2SNMA 2EYFA 3I70A 3IAYA 1CI3M 1ZYRC 5CMDA 2BDOA 4ME5A 3NPPA 3FPUB 2XIWA 2PW7A 5T1GA 5JPMC 2E76C 4A3IB 3VYRA 4CJ0B 1IW7C 3BS1A 5FO7B 4C3IB 2EY5A 4KJNA 1NSNS 1U4LA 4ZQ3A 1BCPF 3GD7A 4O42A 3KLSA 1WTWA 4LJZC 1V1PA 2A6ED 3TZUA 1BOSA 1AN8A 3C3LA 3SK5A 2K05A 2X69A 2A68D 5C6AA 2EJGC 2EVBA 4PQXA 1V8QA 2F0WA 4HEDA 3QOLA 1CHPD 5C3WA 2XVSA 2NUCA 4AYBB 1EZ8A 2F0GA 4OGQC 1GUTA 3D6WA 1CZWA 3VR5A 1MI2A 4C3IG 1TS5A 3D6CA 4HMJA 3NTKA 1I50B 2M2LA 3V2TA 1AP0A 5BN3A 4NMZA 1GJXA 2MPMA 1F77A 5D3IB 2NZ1D 1SDFA 2NYZD 2XN9C 2N88A 3J80E 4FP5D 1AZPA 5KEEA 3OIQA 1JICA 5M5XB 1SYFA 2GA4B 3K6OA 2KUMA 2CW0D 2RBMA 3TBIB 2KHSA 3PMFA 4EQPA 3FEWX 5JEAJ 4JBWA 3MTSA 4J8QA 4XT3B 1BNZA 4U68A 2SNSA 2L5TA 4DNTB 4K2LA 3CKIB 2AQ1B 3K5LA 2F0IA 1VDZA 2K6AA 1XWEA 3I73A 1SNOA 5EPKA 3PUXA 2QEJC 4CJ2C 2B2VC 1E2WA 4N9PA 1EQTA 4KY6A 4L63B 3M4YA 1S5DD 5CR3A 1O80A 1LT3D 3PUYA 1EWHA 4C3JB 4F8MA 1VF5C 3PV0A 3I3CA 3JAML 3VA5A 4DFAA 4K5WA 1GOZA 5EKKA 3QIAA 3Q22A 1VCIA 3VR4A 2AQ3B 1CA5A 4MN3A 2XWBB 4FXGC 1BR9A 1EY0A 2B2WC 1ZYRD 1C48A 1KNEA 4RAUC 3S14B 3OWEB 3M7NA 4ZKBB 3HS0C 4U673 1FNWA 4WORA 3U9SA 3EFXD 1TWCB 5E3FA 5KNCA 4K8IA 3OMGA 1BCPC 1QOHA 4KMUC 2EXZA 5T1IA 1CQVA 1TWAB 5DAUA 2HUGA 4DN4M 2IWHA 4BBSB 3NUCA 1TWFB 2K5WA 2WP8J 1ML0D 4DA2A 1BQQT 5C0XJ 1TIID 4RGOS 3R2TA 4DK0A 4BA2I 2F0VA 1D1KA 4A3JB 3URYA 4KKTA 2NVYB 3L3OC 4JK1C 4K14A 3KLSX 3BYTB 3DWQA 3T53B 1XX8A 5I9OA 2JA6B 1YNNC 2PW5A 4IURA 4G7HC 1SNPA 4IALA 4IUNA 1EU3A 2R3ZA 1FNVA 1SJED 4HSVA 2HDLA 3RZDB 1ZEQX 2B2YA 3MFYA 5KNBA 1B1ZA 3W3AA 4IUQA 4K2KA 1V43A 3GTLB 1JC7A 2MUYA 1KDBA 4BWGB 3LX0A 3GTMB 1T5EA 1HTLD 5IT9L 1KLGD 5CYUA 4RWSC 1DJRD 5FO8B 4X3SA 3HP3A 4EVOA 2QCPX 4RCOA 3Q0AA 3NWSA 2LFNA 1HQRD 1QJOA 2EY2A 4EQNA 4WJWA 3TN2A 5ISRA 4Q5VA 2NN6H 3QO2A 3A7LA 3HOWB 1B9MA 3A8KE 4CKCA 1OXXK 1LTGD 4KKSA 4DAPA 2Q8TA 1M4VA 3OOCA 1XYIA 2F0OA 1SAPA 4K5XA 4R8NA 1I4GA 3J81E 3S15B 2Z4HA 2E2DC 3K5MA 4NDXA 5A2QL 4PMBA 3HOYB 2NBFA 1E0BA 3Q24A 4C3HG 5A35A 1STAA 1UAPA 3AB9A 1TWGB 3GV3A 1PZID 4DK1A 2H1EA 1BCPD 3VR3A 1EIGA 1JWSD 1MGSA 3AU7A 4MHEA 2ICIA 1BCPB 2F0PA 1ICWA 4ZRZA 1KLUD 3CRKC 2K32A 4IQZA 2DNCA 1U4PA 1EY9A 4H13C 1RHPA 1B50A 2PMZB 1G91A 5DEHA 3RMHA 3TZDA 5IIFA 5EPJA 2VXWA 3SK4A 3X3NA 1F2YA 4FF3A 2F0LA 4F7XA 5FKAC 4PV1C 5JVH3 2ZT9C 5FK9C 3TMEA 3VYSA 4TQUS 2XWJB 1DM0B 1JOKA 2NVQB 3LWEA 3DXJC 5FLXE 1PLFA 2DNEA 4S3SA 2KCCA 4KHZA 4RHRA 1FR3A 2NTTA 1M8AA 2SOBA 5IODA 1SE3A 2A73B 1RTNA 4UDUC 1EL0A 4A93B 4Y7NB 3MXNA 5M3MB 4CKBA 1XTCD 4B9XA 2IW3A 1DOMA 4X3UA 1F9PA 3HOZB 2K01A 5ELCA 4FNFA 1TWHB 1WTQA 5ELDA 2R7ZB 2XSCA 4DAVA 5JJZA 5K36G 2A74C 3GTQB 2SEBD 4XTCS 1K8MA 2WKCA 1G2SA 5TSSA 1YNJC 1TS4A 1LTBD 2AWNA 2YYZA 2F0HA 1PRTF 1O78A 3NK9A 3RUZA 3K57A 1UNSA 3Q6SA 1SE2A 2PNRC 4ODGA 3E6ZX 3HOUB 5JVG3 2O5JC 3EVQA 2MHVA 4PMCA 3SR1A 4RCNA 2EE1A 3DWAA 4XQJA 4XDXA 2CVRA 1MBYA 1FGBD 5G3LD 4HTHA 2DN8A 2PCFB 3FKIB 5NUCA 3D8GA 1TY2A 1DD2A 2HCCA 5FO9B 4X3KA 3NWTA 2BA0A 1FD7D 5KNDA 2D2CC 2K28A 1WD0A 3SDZA 3C1FA 2WB1B 2LKVA 4IFDI 1PFNA 1MSGA 4ZAIA 4XYQA 3H6MA 4CKEA 3PO2B 1Y69U 2O4XA 3R8BA 3GTJB 4NP5A 3BG3A 3L7ZC 1S5FD 1F9RA 1LABA 2NB0A 1QCBD 1LTAD 3MC0B 4IFDG 4H7BA 1EFID 1IHZA 1HUMA 1STGA 1UUPA 3MEHA 4QUFA 1V1OA 3Q23A 4RH6A 1C4QA 1STBA 2KVMA 3BVGA 3HRZC 3H94A 1RKNA 1Z7TA 3R2IA 4E6IA 1B9NA 4QB4A 1B4OA 2KQ3A 1D6EC 3K7AB 1F9QA 5EQ0A 5M5YB 2D62A 4A3GB 1EOTA 2WAQB 2Q8IB 3MZ5A 1CK1A 3SK6A 3I90A 4PMWA 1CHQD 3KF8A 4XT1B 3OW7A 5IGBA 2I46A 1SBBB 2L4NA 4OIJA 2PZTA 3P75A 2E74C 1SMYC 2A6HC 1Z47A 5HGTA 4RFBA 1WTPA 3P20A 1JWMD 4ULLA 5JPNC 2NWGA 3EA6A 1SFOB 5EBCA 2HDMA 1IYUA 1EU4A 1GUOA 1SYCA 1IKMA 3QWNA 1VMCA 3NP8A 5CV8A 1YNJD 2KA7A 1PZKD 3MWYW 2G9DA 5C4HA 4CBVA 3PUWA 1PRTC 1AEXA 1TU2B 4RKLA 1ONLA 1QWYA 1CM9A 2B63B 3RD4A 2R92B 1KAAA 5CC4A 4IFDH 3UI2A 4ZLTF 2ZXPA 2TMPA 3S2HB 1Q1EA 3QB3A 3GTKB 2B2UA 5DM63 2NVTB 2CQAA 4I7ZC 3RLFA 3J7AF 5EKLA 2WKDA 2FJ2A 4HR7B 1V1PB 4OL7A 1F2ZA 1KTKA 2EY6A 1OO9B 1SE4A 3H91A 5IGFA 2WACA 2M9VA 5IOCA 4LK1C 1II3A 2HQEA 3MHBA 2AQ2B 1HRJA 1PDQA 3M7GA 4IUPA 5C4ZA 2F0QA 2Z1CA 4HAEA 1ZXTA 2JEBI 4C1NK 2RA4A 1PFMA 2BE5C 5G3LF 1HA6A 1EY4A 1A2TA 2VB3X 5JOBA 3VR2A 4CGYB 3EROA 2FMCA 5I9PA 3JAME 4BA1I 4G57A 3S16B 1B53A 4M8AA 1Q90A 5C4XB 2B2YC 2RQXA 2IX1A 4N9TA 3ND8A 2C5CA 5K5PA 1ESFA 1S5BD 3IFTA 1I6HB 3BDCA 2F0JA 4BS9A 1LT4D 4C3JG 4A3BB 3A55A 3F2UA 2QILA 3W2DA 3ERQA 1HFGA 1LTID 2C9OA 2ENBA 1ESRA 3NQIA 1KDCA 5EBDA 5C3XA 4HMIA 2MGSA 2A69C 3WOEA 3X3MA 2I07B 2EJMA 1W6KA 4RGNA 1SMYD 2A6HD 3GP7A 3N6RA 3ZYYX 1JOOA 5BN4A 3WDNA 1ET9A 1DONA 1Q3LA 3D3RA 2F0EA 4J6HA 2F0SA 4OO1I 4J1MA 5IGGA 3K59A 1PRTD 1GUSA 1IYVA 3H0GB 4R9WA 1PRTB 2K33A 2OEOA 2VNUD 4KN4C 1HFNA 4DXGA 1I4QA 3NBHA 2J0TD 4OO1G 5C0XG 3PUZA 3C46A 1HPCA 2F0FA 5EGTA 2R61A 5D3DA 2L9HA 5KGUA 3MXGA 1I4XA 1TR5A 3S1RB 2RDFA 2EYMA 1SJHD 1STYA 3MXPA 1EQVA 2X6GA 2XRQD 3EQLC 5IT9E 1Y8OB 4XXEA 5IGCA 1MSHA 3T16A 2KOLA 2PZWA 1EY8A 4RGMA 1FYCA 1H9MA 2NTSA 1ENAA 3KUPA 2BE5D 4P2CB 3PUVA 1SNDA 3K0YA 5JAVA 3S17B 1SEBD 2SDFA 1NR4A 2OF1A 2TSSA 1NR2A 3GTOB 1JWUD 2WINB 1U4RA 4TSSA 4ZUJA 1A15A 1G8ZD 3NXWA 4KN7C 2JE6I 3A8JE 2J4XA 1DOLA 1G6ZA 4HSPA 1PZJD 2KEEA 5A2QE 1RD9D 1EWCA 3MXUA 4K5VA 4H0LC 5FOBB 1SYGA 1Y1WB 1LACA 1GHKA 1PTOH 1VMPA 3FVQA 1Z6HA 1Q8IA 3D4DA 1D5MC 3D4WA 3IKJA 3VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB2 X;  2L55 A;  2QCP X;  1ZEQ X;  3E6Z X;  3TDQ A;  2VB3 X; 
#chains in the Genus database with same CATH topology
 2KJX A;  4DAY A;  4A3D B;  2WB1 E;  1S4Z A;  1LT5 D;  1PH7 A;  2A69 D;  1SSO A;  4QY7 A;  1HHV A;  2MO0 A;  4QCL A;  1TXY A;  1G2T A;  2JP1 A;  3HOY G;  3NQT A;  1ROD A;  1JJG A;  4ZK9 B;  3I8Z A;  3P7J A;  4RHS A;  4BBR B;  3D4R A;  3M4P A;  3J81 i;  1BO0 A;  1C8C A;  3RZD H;  1OXU A;  3ER0 A;  3NSW A;  1PXU A;  2K50 A;  1CSQ A;  1SNC A;  1AZQ A;  1X3Q A;  5ELF A;  4HIM A;  1B44 D;  2RDG A;  1H9R A;  2G9H D;  3TP6 A;  1IBM Q;  1X3P A;  3DM1 A;  1RTO A;  5IGE A;  1U4M A;  2R6G A;  3L0O A;  1L0X B;  2D9U A;  4DV6 Q;  3B6Y A;  4A4I A;  4LF6 L;  3E9I A;  1E22 A;  3GO5 A;  1EIF A;  2IJ0 A;  2R93 B;  3V96 A;  4RGT A;  3KFU A;  5DLQ E;  1K83 B;  1V9P A;  3F2B A;  4DV4 L;  1ASZ A;  5IP7 H;  2FIN B;  2KCN A;  5KIX A;  1IKL A;  5EKI A;  1VQC A;  3ZJY C;  1AFP A;  4FXD A;  2F52 A;  4KD3 A;  3K7U C;  3I72 A;  3TP5 A;  4UY8 C;  1RF2 D;  2I5L X;  1UEA B;  3CCQ A;  1AE2 A;  4BBR G;  5LL6 X;  3PO3 B;  4DGZ A;  4NXN L;  4KTA A;  1CZG A;  2WAQ E;  4GNX A;  1B3A A;  1BXT A;  1PH5 A;  5I4D A;  1QG7 A;  3S1Q B;  1UE6 A;  4B3M Q;  4DXF A;  1LV9 A;  1HZ9 A;  1JOQ A;  2Q2T A;  1OXS C;  3LNN A;  3AQQ A;  2ZXO A;  4GOP A;  3QJY A;  3BYY B;  2I5H A;  1BDO A;  3PF4 A;  3S15 H;  1DYQ A;  5C4J B;  4V0B A;  4DR7 Q;  4DUZ L;  4UP8 A;  2F0K A;  1MD2 D;  2F0T A;  4YY3 L;  4A93 G;  1NMF A;  5M3M G;  3BZD B;  3LGJ A;  2AWO A;  3HOZ G;  1F2M A;  3ONA B;  4LAA A;  5IY0 A;  2MJ8 A;  1VQM A;  1M1K C;  2R7Z G;  1PFS A;  3TP7 A;  4X62 Q;  4L8J A;  3HOX H;  2V4D A;  1K8O A;  4JI8 Q;  5D65 A;  2V1C C;  2L1B A;  1Y1V B;  1NBW A;  3SE0 A;  4ZYS A;  1I3Q B;  5I6Y A;  1EY5 A;  3BJU A;  3H15 A;  2K5V A;  4DU9 A;  4WJ3 M;  2KEC A;  3IL8 A;  1SE8 A;  4IFD J;  2GN5 A;  1TVX A;  2B2T A;  3L9A X;  2LS0 1;  1P8L A;  4O0A A;  4L5T A;  1K28 A;  5CV5 A;  3PIO 3;  1H9S A;  4DV1 L;  1X65 A;  1TT2 A;  3HOU G;  3D31 A;  1SYB A;  2E2I H;  1QNK A;  3MXN B;  2ICE C;  1K3R A;  1WFQ A;  3I4L A;  1WTO A;  1HCZ A;  1KDA A;  2A8V A;  5C3E B;  1EOV A;  5J22 A;  5E7N A;  2H5X A;  1WTR A;  1HJP A;  1NCV A;  1YHA A;  4CDC C;  5M3F B;  3TP8 A;  1GUN A;  3A0J A;  1PH1 A;  4DR3 L;  1O7L A;  1U9R A;  4C2M H;  3J81 c;  1WCM B;  3SXH A;  4R4O A;  4JI5 L;  4A3M H;  2Z4I A;  5K36 H;  5I6W A;  2ZXR A;  2IX0 A;  1C7Y A;  5CV4 A;  1IBL L;  4DR1 Q;  4UP7 A;  5CGK A;  4ILW A;  2RVL A;  2J7Z A;  3CXC A;  1RIP A;  3T56 B;  5J39 A;  4IOA A;  3FKI G;  1RCV D;  4LMQ D;  1HR0 L;  3CMA A;  1Q1B A;  2F0D A;  5EPL A;  3HOV B;  1JE5 A;  2RHS B;  4DK3 C;  3WWV A;  2Z6B A;  4KJO A;  2FFK B;  1IBK Q;  1HUN A;  4Q0F A;  2B2U C;  4JI8 L;  4OHJ A;  5CV7 A;  4LUV A;  5AJ3 L;  3S1N B;  2WB1 G;  3PIP 3;  4GKK Q;  1EYC A;  3KK7 A;  5IE8 A;  1J6Q A;  4K0K Q;  2EJF C;  1NUC A;  1Z9F A;  4JYA Q;  2F4V Q;  1UE7 A;  3J7Y W;  4B08 A;  1PA6 A;  3HOZ H;  3PO2 G;  2E2H B;  3OTO L;  3GTP B;  2F3I A;  4P75 A;  1TWH H;  4FF2 A;  1WCM G;  1DOK A;  1HZC A;  4RA8 A;  1RDP D;  1G6P A;  4LFC L;  1WD1 A;  1G51 A;  2DY8 A;  3HZX A;  4QL5 A;  2K03 A;  1GUG A;  4KK7 A;  2UUC Q;  3C1E A;  1CT1 D;  4YHH Q;  4NW2 A;  2DJF C;  3KJP A;  4J15 A;  3CCR A;  5E1F A;  3KJO A;  1LT6 D;  2JYO A;  4L5R C;  1H9S B;  2RCN A;  1VQ8 A;  4RKB A;  3E9H A;  1D7Q A;  2LMC B;  3HOU H;  2E2J B;  3I4N B;  2B8G A;  4HCE A;  2RKS A;  1XMQ Q;  2E5L L;  1PH6 A;  3GQB A;  2L0C A;  1PFB A;  2AUK A;  1ENC A;  2EY1 A;  3OW2 A;  2L55 A;  1ET6 A;  5FLX c;  3J80 L;  5JJL A;  1XNR L;  2YU9 H;  1PTO C;  4JI0 L;  5M5W B;  1IBK L;  2Q8R E;  1N33 L;  2OXP A;  1EY7 A;  1H9K A;  5C44 B;  4DV3 Q;  4HJ7 A;  4JI3 Q;  3CU7 A;  1DXM A;  5M9O A;  4GLA C;  1VQE A;  4A3G G;  2WAQ G;  1BUV T;  2ZTC A;  1R9T B;  3UE0 A;  4R4C A;  3N52 A;  5LL6 S;  4DR4 L;  1B3Q A;  2O2L D;  3G6E A;  2R7F A;  4GS3 A;  4CHT B;  5CBE E;  3M9B A;  3SVM A;  1UWV A;  4DR5 Q;  1WVL A;  4B3R L;  2EZV A;  4B9W A;  1YHQ A;  1I4R A;  1E2V A;  1VF7 A;  4JW0 A;  1PVO A;  3V05 A;  2UXC Q;  1ZKO A;  1X3E A;  4OIK A;  3OIP A;  4A3K B;  2UUC L;  1EYD A;  2GVB A;  3U4Z A;  5IWA Q;  2BDN A;  1EIY B;  4FXK C;  4L5Q A;  3CCM A;  5HUR A;  4V19 0;  2F3W A;  5COR A;  3MAQ A;  4X65 L;  3PO2 H;  1JCK B;  3PGZ A;  1CA6 A;  3RZO B;  1Y8N B;  2OT2 A;  5KYL A;  1QB5 D;  2VUM B;  1E24 A;  2VS1 A;  3GTJ H;  4K6L A;  2EYP A;  2YTX A;  1JOR A;  3K8A A;  5CV6 A;  3FMC A;  1TS2 A;  3K58 A;  3CME A;  1XMO Q;  5AFW A;  3RN2 A;  1D5X C;  2B63 G;  2RCF A;  2R92 G;  3KF8 B;  4A3I H;  3TS0 A;  2RSN A;  1YJN A;  4UP9 A;  3FRP B;  1IL8 A;  1OXV A;  1CKM A;  5D14 A;  1O7Y A;  1X3G A;  1STN A;  4POF A;  5FJ8 G;  2BA1 A;  1VQG A;  3S1M B;  2JA7 B;  2A5H A;  1PH3 A;  5JEA G;  3HKS A;  4ZUI A;  1R4P B;  4B3S L;  4EGV A;  4BXX G;  2FHT A;  1AH9 A;  5E4X A;  2BCO A;  1M90 C;  2JSO A;  2X6L A;  3DEP A;  1HA5 A;  1U5K A;  4KHV A;  5M5Y H;  3FPP A;  3LWU A;  4CJ1 B;  3OHX C;  1JT8 A;  2EOT A;  5F2D A;  4JOI A;  3Q8D A;  4M1U B;  1L0W A;  2B8F A;  5ELE A;  4DUY Q;  1IW7 D;  1VQI A;  2CQO A;  3SK8 A;  3VR6 A;  4KHP L;  4KD4 A;  4LF7 L;  1QIL A;  3CC2 A;  3QOJ A;  4G7Z C;  3O13 A;  4OEM B;  5LMN L;  2PNH A;  3DHQ A;  1VQO A;  2XRS D;  1SFO H;  5DNF A;  4IUT A;  3GTG B;  4WRD A;  1JR0 D;  1SXT A;  5J1Z A;  2NN6 I;  2QF7 A;  4JC0 A;  2PO4 A;  2E75 C;  3HKZ B;  1MJE A;  4QF4 A;  2K1B A;  4NXM Q;  5C4X G;  2F03 A;  4PZ7 A;  2B2V A;  3MFG A;  2F0N A;  1A62 A;  3J81 j;  5C5M A;  2UXD L;  2JQO A;  2B63 H;  1H9J A;  2B29 A;  3T4A C;  4FF4 A;  1W3S A;  3CCJ A;  3JAM i;  4IPH A;  2MFI A;  5IYC G;  2UUB L;  1CFM A;  2JXM B;  2WV6 D;  2IX3 A;  1D1I A;  3CHB D;  3MA2 B;  4DKA C;  1Q86 C;  2NN6 G;  2I5M X;  3IFD A;  4ZCK A;  1FNU A;  5FJ8 H;  5LMU Q;  4A3B G;  2EDG A;  4HN7 A;  2N55 A;  1PTO D;  2CCZ A;  4LFA L;  1SYD A;  5JEA H;  5C0X I;  1E7Z A;  4G7O C;  3G48 A;  2M00 A;  3S2D B;  3KBG A;  1LO5 D;  1N9W A;  2LY7 A;  5I2Y A;  1PTO B;  5GAG C;  3NEL A;  1K73 C;  4BXX H;  1LYL A;  1J9O A;  2ID0 A;  3BVM A;  4P72 A;  4ME3 A;  4IN3 A;  4HIO A;  1BBX C;  5EJW A;  1T5X D;  1GHJ A;  1AW7 A;  2Z8L A;  2VW9 A;  1BF4 A;  4X3T A;  1VQ5 A;  2B2W A;  5COY A;  3AFQ A;  2G5D A;  4JV5 L;  1J5E L;  1I4H A;  4A3C G;  1I6V C;  4YWK A;  4XQQ A;  1Q7Y C;  1L0Y B;  2F0U A;  5KRU A;  2OWO A;  3H09 A;  1A3T A;  1PYW D;  1JB3 A;  1HZA A;  1SNM A;  4C3J H;  3VYU A;  1EEI D;  1STE A;  3IRB A;  2UU9 Q;  3I91 A;  2EPB A;  1XNQ L;  4C56 C;  2EYH A;  4A3F B;  1EZ6 A;  1ILQ A;  4LF9 L;  1LTT D;  4DNI A;  2F0M A;  3KDF B;  3R3O A;  2WII B;  3NE5 B;  3GV6 A;  3K5O A;  1FVI A;  2PZU A;  3HG9 A;  3H0G G;  3WOF A;  1W6J A;  3NTH A;  1GXD C;  4R8I A;  4DV2 L;  2IPK D;  1WTX A;  3S14 H;  3G7L A;  1CQF A;  1YEZ A;  3S16 H;  2Z6K C;  1XTD A;  1B7Y B;  4GKJ L;  4BY7 B;  4P73 A;  2L11 A;  3BDO A;  2VQE L;  4IPC A;  2NVX B;  4ALP A;  2CWP A;  4C3H B;  1QVG A;  1VQJ A;  3T1Y L;  1QNU A;  1TWC H;  4EQO A;  4MIU A;  2KED A;  1G29 1;  3QG1 A;  3OWF A;  1BKB A;  3M4O B;  5IYC H;  1QE6 A;  2CHB D;  2RDH A;  3R93 A;  2EYL A;  5E4W C;  5HGQ A;  1EY6 A;  2AUJ D;  1YHB A;  3J81 L;  1PH4 A;  1D5Z C;  4A3B H;  4IPD A;  2BOS A;  3SEB A;  1XXG A;  3BVZ A;  2PPB C;  4F88 A;  1TWA H;  4JCV E;  4Z9C B;  1Q82 C;  1ILP A;  2DGY A;  4A3F G;  1PH8 A;  4GZY C;  1V1Q A;  3CCV A;  2N3S A;  2PYK A;  1A3V A;  4IJH A;  2PI2 E;  3T13 A;  4FVM A;  3VYT A;  1S5C D;  2XNA C;  2DY7 A;  1NAP A;  3U9O A;  1WI5 A;  4QIW B;  4LF6 Q;  4H44 C;  3T51 B;  4JPB W;  2JA5 B;  3H3V C;  1HXY D;  4LF4 L;  3NBH B;  3J7A V;  3L2P A;  1Q12 A;  4DV4 Q;  4OO1 H;  2EYJ A;  4KV6 A;  2PQA B;  4UHV A;  4DPG A;  4WFN 3;  2IL8 A;  4A3C H;  5C0X H;  4A3L H;  4GNX C;  2H4O A;  3OMC A;  1DGS A;  2NVY H;  3HGB A;  5DM7 3;  3S9W A;  1S40 A;  1A6X A;  4G4K A;  1I4P A;  4R1J A;  1JE4 A;  1EYA A;  5CBA E;  3HOX B;  2HCI A;  1E2Z A;  4YWM A;  1DZ1 A;  4GOP C;  3M3Y B;  4NXN Q;  2B39 A;  3OSO A;  2JA6 H;  1A2U A;  1STH A;  3TDQ A;  3C2P A;  2QKI C;  4DNR B;  4FO2 A;  4QMG A;  1NY4 A;  3KBX A;  3HEJ A;  1LTS D;  2Z6K A;  1TQO A;  3I4M B;  3DUZ A;  3DWP A;  1YIJ A;  1EEF D;  1S3O A;  4XYO A;  2E2I B;  4A75 A;  1WTV A;  1R4Q B;  4DUZ Q;  5FLM G;  4FYD A;  2HIV A;  3GDE A;  3GTL H;  4A3E B;  4ID6 A;  1QUQ B;  1B2T A;  3EIV A;  1Y1W G;  1CKN B;  1LTR D;  1SR3 A;  4YY3 Q;  3EJI A;  1TKW B;  3GTM H;  2FMM A;  5HY6 A;  3U4V A;  5FLX L;  4C2M B;  4A3M B;  3DMU A;  5ELB A;  4HCS A;  2B2T C;  1SNQ A;  2A6E C;  4L6T B;  3A56 A;  1VQ4 A;  4ABN A;  4DF7 A;  2Y0S B;  4A3D G;  5GAH C;  1B70 B;  3S1R H;  2A68 C;  4XIG S;  5ELO A;  1GUW A;  1F9S A;  4O2D A;  1YNN D;  3DEO A;  3SHL A;  1UEB A;  1Y8P B;  1CTM A;  4K6D A;  3BDL A;  4OWW B;  2OQK A;  4QUC A;  1KAB A;  3G6J B;  1KRT A;  4ZKC B;  1KNA A;  5BR8 L;  1UE5 A;  1TS3 A;  3M85 A;  4DV1 Q;  3HOW H;  1PTO F;  4JI1 L;  5I2X A;  1S5E D;  1KHI A;  3OPO A;  3ITP A;  1D2B A;  4NKL A;  2D5D A;  1UE1 A;  4IZ8 A;  2MP1 A;  1EQR A;  1HTP A;  5BN5 A;  1ENF A;  1NE3 A;  3A8I E;  3FDT A;  4O1N A;  3MEF A;  4HID A;  1BBU A;  5JJK A;  3KLR A;  4PNY A;  3MVV A;  2JEA I;  4DR3 Q;  1KAW A;  4DAY B;  2R93 G;  4JI5 Q;  2K7V A;  4KY7 A;  2HHH L;  1IBL Q;  1HQM C;  1N8R C;  5CV9 A;  1MIU A;  3NHH A;  3HOY H;  2CW0 C;  4JVZ A;  3E5S A;  3STB C;  5KYI A;  3F2D A;  4DR6 L;  3K0X A;  2ZTE A;  3KF6 A;  3NBI A;  2KBN A;  1KXL A;  1HR0 Q;  5IGD A;  3P1H A;  4TKO B;  1TWG H;  3TSS A;  1CSP A;  2K5Q A;  4BY1 B;  2JK8 A;  3CRL C;  3CF5 A;  3PO3 G;  4AIM A;  5C5L A;  3E0J A;  2RSO A;  4F87 A;  1E1T A;  5AJ3 Q;  1OXT A;  3KOJ A;  4UAI A;  1K9M C;  1SYE A;  1YNX A;  2JA8 B;  4C1N I;  1KRS A;  2YTY A;  1F2L A;  2YU9 B;  4IUU A;  5IT9 c;  2PQE A;  3NTI A;  4TRD A;  1O7Z A;  4FF1 A;  2IT1 A;  1DCZ A;  3CCL A;  1RJT A;  2F3V A;  2F1M A;  2O5I C;  3OTO Q;  2VB2 X;  3A5U A;  4XQN A;  1LLR D;  3ND9 A;  3PCO B;  1EYG A;  1VQ6 A;  1EWI A;  2K52 A;  3K5N A;  3AMU A;  4A3D H;  4LFC Q;  1PMR A;  2AMC B;  1IXR A;  5JJI A;  1TY0 A;  3A7A B;  4KKU A;  4AQY L;  5LHY 1;  1A3U A;  4N8X 1;  1HNZ Q;  4JI7 L;  3EN2 A;  4K8J A;  4DR2 L;  4BBR H;  4YIJ A;  2L12 A;  2EYO A;  1JQY D;  2K04 A;  3CQZ B;  4GNX B;  1EIH A;  4IUV A;  2F4I A;  2K5D A;  1Y1V G;  2E5L Q;  3CP0 A;  1J8I A;  4KY5 A;  1GM5 A;  1Q8K A;  4I65 A;  3NEM A;  4KI0 A;  2NVQ H;  1E1O A;  2QDB A;  3A54 A;  4GOP B;  1X32 A;  2SNM A;  1XNR Q;  4JI0 Q;  1N33 Q;  2EYF A;  3I70 A;  3IAY A;  1CI3 M;  1ZYR C;  5CMD A;  2BDO A;  2R93 H;  4ME5 A;  3SGI A;  3NPP A;  3FPU B;  2XIW A;  2PW7 A;  5T1G A;  5JPM C;  2E76 C;  4A3I B;  3VYR A;  4CJ0 B;  4JI6 L;  1IW7 C;  3BS1 A;  4A93 H;  4Y7N H;  5M3M H;  1PYB A;  5GAE C;  5FO7 B;  5C3E G;  4GN5 A;  4C3I B;  2EY5 A;  4KJN A;  1NSN S;  1U4L A;  1X54 A;  2YV5 A;  4DR4 Q;  1H95 A;  5M3F G;  1B8A A;  4IPG A;  4ZQ3 A;  1BCP F;  2R7Z H;  3GD7 A;  3QR8 A;  4O42 A;  5IP9 G;  4B3R Q;  3KLS A;  1WTW A;  3GTQ H;  4LJZ C;  2ALY B;  1V1P A;  2A6E D;  3TZU A;  1BBW A;  4B3T L;  1KL9 A;  2XGT A;  1BOS A;  1AN8 A;  3C3L A;  3SK5 A;  1K8G A;  3S1Q H;  2K05 A;  2X69 A;  2A68 D;  5C6A A;  2EJG C;  1HNZ L;  3D0F A;  2EVB A;  4PQX A;  1V8Q A;  2F0W A;  3HOV G;  4HED A;  4X65 Q;  1XPU A;  3QOL A;  3FP9 A;  4JBM A;  1CHP D;  5C3W A;  1FJG L;  5C4J H;  3G71 A;  2XVS A;  3CCE A;  1EUJ A;  2NUC A;  4AYB B;  2Q2I A;  1EZ8 A;  4JBJ A;  2F0G A;  4OGQ C;  1GUT A;  3D6W A;  1CZW A;  3VR5 A;  1MI2 A;  3HKZ E;  4C3I G;  1TS5 A;  3BZC A;  3D6C A;  4JI4 L;  4HMJ A;  2KHJ A;  4JI2 L;  3NTK A;  1I50 B;  2Q2H A;  2B3G A;  2M2L A;  3V2T A;  4N8F A;  1AP0 A;  5BN3 A;  4NMZ A;  1GJX A;  2MPM A;  1F77 A;  5D3I B;  2NZ1 D;  1SDF A;  1I3Q H;  2NYZ D;  2XN9 C;  2N88 A;  3J80 E;  3FKI H;  4FP5 D;  1AZP A;  3UDX A;  5KEE A;  4B3S Q;  3OIQ A;  1JIC A;  5M5X B;  1SYF A;  2GA4 B;  2UUA L;  3K6O A;  2KUM A;  4JOI C;  2K5H A;  2CW0 D;  3STB D;  4IOC A;  2RBM A;  3PSI A;  3TBI B;  2KHS A;  1HNW L;  3PMF A;  4EQP A;  3I4N G;  1VQL A;  3FEW X;  3CPW A;  5JEA J;  1MJC A;  4JBW A;  3MTS A;  4J8Q A;  1IZ6 A;  4XT3 B;  1BNZ A;  4U68 A;  2SNS A;  2L5T A;  4DNT B;  2A19 A;  3AYH B;  5M3F H;  4K2L A;  3CKI B;  4KHP Q;  2AQ1 B;  3K5L A;  4LF7 Q;  2F0I A;  1WCM H;  1VDZ A;  5C44 G;  2K6A A;  1XWE A;  3I73 A;  2RF4 A;  1SNO A;  5EPK A;  3PUX A;  2QEJ C;  3W1G A;  5LMN Q;  4CJ2 C;  2B2V C;  5GAD C;  2N8N A;  1E2W A;  4N9P A;  1EQT A;  1KD1 C;  4KY6 A;  4L63 B;  5LMN W;  3PIO A;  2ZJR A;  2QEX A;  2D0P A;  3M4Y A;  3UDI A;  3BZK A;  2KEN A;  3CC4 A;  1S5D D;  4LFB L;  5CR3 A;  2ZJQ A;  3S1N H;  1O80 A;  1LT3 D;  3PUY A;  4A3K G;  1EWH A;  2UXD Q;  1N34 Q;  4C3J B;  4F8M A;  1VF5 C;  3PV0 A;  3I3C A;  4IO9 A;  3JAM L;  3VA5 A;  2UUB Q;  1HH2 P;  4DFA A;  2IHE A;  4H02 A;  4K5W A;  1GOZ A;  5EKK A;  3QIA A;  3Q22 A;  3K7A H;  4GN3 B;  2VUM G;  1VCI A;  3VR4 A;  2AQ3 B;  1CA5 A;  1BVS A;  4MN3 A;  2XWB B;  4LFA Q;  4FXG C;  2JN4 A;  2WFW A;  4A3G H;  4DV5 L;  1BR9 A;  1X56 A;  1EY0 A;  3I55 A;  2B2W C;  1ZYR D;  4OX9 L;  5ELN A;  1C48 A;  1KNE A;  3U58 A;  4RAU C;  1T9H A;  1WYD A;  3S14 B;  3OWE B;  3M7N A;  4ZKB B;  1Q46 A;  3HS0 C;  4U67 3;  1FNW A;  4WOR A;  3U9S A;  4EX5 A;  3EFX D;  3PIP A;  2EQS A;  2JA7 G;  1WOC A;  1TWC B;  5E3F A;  1NMG A;  5KNC A;  4JV5 Q;  1J5E Q;  4K8I A;  1PV4 A;  3OMG A;  1BCP C;  1QOH A;  4L5S A;  2UXB L;  1C9O A;  4KMU C;  2EXZ A;  5GRO A;  4QIW E;  1SN8 A;  2CFM A;  5T1I A;  1CQV A;  1TWA B;  2Q2U A;  5C44 H;  5DAU A;  2HUG A;  2OCE A;  4DN4 M;  1XNQ Q;  3I2Z A;  5IYD G;  2IWH A;  4BBS B;  3NUC A;  1I5F A;  1TWF B;  1N34 L;  2K5W A;  3RNU A;  2WP8 J;  4LUO A;  1EQQ A;  4LF9 Q;  1ML0 D;  2R92 H;  4DA2 A;  1BQQ T;  5C0X J;  1NNX A;  1TII D;  4RGO S;  3ULP A;  3R2T A;  4DK0 A;  4BA2 I;  3S2H H;  2F0V A;  3NEN A;  3GTK H;  4DV2 Q;  1D1K A;  2NVT H;  4A3J B;  1A0I A;  3ULL A;  3URY A;  3F2C A;  4GKJ Q;  4KKT A;  1X3F A;  3CCS A;  3M4Q A;  1X6O A;  2VQE Q;  2VQF L;  1I94 L;  2NVY B;  4HJ5 A;  2IHF A;  3L3O C;  4A76 A;  4JK1 C;  3T1Y Q;  4A3K H;  4K14 A;  3KLS X;  1HNX Q;  3BYT B;  3DWQ A;  3HKZ G;  3T53 B;  1XX8 A;  2JJQ A;  2HIX A;  5I9O A;  3BU2 A;  2JA6 B;  1YNN C;  4X6A H;  2PW5 A;  1VQK A;  4IUR A;  2ASB A;  3TS2 A;  4G7H C;  2D0O A;  1SNP A;  4IAL A;  4IUN A;  4BBS G;  1EU3 A;  3TRE A;  2R3Z A;  1FNV A;  1SJE D;  3I56 A;  4HSV A;  1N36 L;  2HDL A;  3RZD B;  1ZEQ X;  2B2Y A;  3MFY A;  5KNB A;  1B1Z A;  4DV0 L;  3W3A A;  4IUQ A;  4K2K A;  1V43 A;  3AEV A;  4DV7 L;  1SRU A;  3GTL B;  1JC7 A;  2Y0S E;  4LF4 Q;  3S1M H;  2MUY A;  2JA7 H;  1KDB A;  4BWG B;  3LX0 A;  3GTM B;  1T5E A;  1HTL D;  5IT9 L;  1CKO A;  1KLG D;  5CYU A;  4RWS C;  2DJG C;  1DJR D;  5FO8 B;  3HFZ B;  2OTL A;  4QQB X;  4X3S A;  1L1O A;  3HP3 A;  5C4X H;  1XJV A;  4EVO A;  2QCP X;  3PQI A;  4RCO A;  3Q0A A;  3NWS A;  2LFN A;  1HQR D;  1QJO A;  2EY2 A;  4EQN A;  1YJ9 A;  2OQ0 A;  4LF5 L;  1I6H H;  4WJ4 A;  1HNX L;  2HD3 A;  2RHQ B;  4WJW A;  3TN2 A;  5ISR A;  4Q5V A;  2NN6 H;  3QO2 A;  1VQN A;  3A7L A;  3HOW B;  2ES2 A;  1B9M A;  3G4S A;  3A8K E;  1VQD A;  1FL0 A;  2LXJ A;  4CKC A;  1OXX K;  1MKH A;  1LTG D;  4KKS A;  4DAP A;  2Q8T A;  3KYH C;  1M4V A;  3OOC A;  2ZM6 Q;  1XYI A;  4X66 L;  2F0O A;  2I0Q A;  4IJL A;  1SAP A;  4RMF A;  4K5X A;  4R8N A;  1PYS B;  1I4G A;  3J81 E;  3S15 B;  3EBE A;  2Z4H A;  2E2D C;  4DAM A;  4BY7 G;  3K5M A;  1RL2 A;  5IP7 G;  4NDX A;  5A2Q L;  4PMB A;  3HOY B;  2NBF A;  1E0B A;  3Q24 A;  4C3H G;  5A35 A;  1STA A;  1UAP A;  4Y52 H;  1GO3 E;  3AB9 A;  1CUK A;  1TWG B;  3GV3 A;  1PZI D;  2H1E A;  4DK1 A;  3TEH B;  1BCP D;  3VR3 A;  1EIG A;  1JWS D;  1MGS A;  3AU7 A;  4MHE A;  5BR8 Q;  2ICI A;  1BCP B;  2F0P A;  1ICW A;  4JI1 Q;  4ZRZ A;  1A8V A;  1KLU D;  4FDB A;  1VQ9 A;  4HJ9 A;  1WJJ A;  4YCV A;  3CRK C;  4RG1 A;  3H0G H;  2K32 A;  4IQZ A;  2DNC A;  4JBK A;  1U4P A;  1EY9 A;  4H13 C;  1HZB A;  1WTH A;  1RHP A;  2JA5 G;  1B50 A;  1LM0 A;  5EAY A;  2PMZ B;  2HHH Q;  3T1H L;  2ZJP A;  1G91 A;  5DEH A;  3RMH A;  2ZM6 L;  3U50 C;  4CDE C;  3TZD A;  1LUZ A;  5IIF A;  4MZ9 A;  2PI2 A;  5EPJ A;  2VXW A;  3SK4 A;  3X3N A;  4DR6 Q;  2HT1 A;  1F2Y A;  4FF3 A;  2F0L A;  4F7X A;  1N32 L;  4LUZ A;  3HOX G;  5FKA C;  4PV1 C;  5JVH 3;  2ZT9 C;  3TRZ A;  5FK9 C;  1QZG A;  1YZ6 A;  3TME A;  3VYS A;  4TQU S;  2XWJ B;  1W2B A;  4A3F H;  1DM0 B;  2NZH A;  1JOK A;  2NVQ B;  2KCT A;  3DXJ C;  3LWE A;  5FLX E;  1PLF A;  2DNE A;  4S3S A;  3A5Z B;  2KCC A;  4KHZ A;  4RHR A;  1FR3 A;  2NTT A;  1M8A A;  4X64 L;  2SOB A;  3AFP A;  3I4M G;  4NB3 A;  5IOD A;  1LTL A;  1SE3 A;  2FXQ A;  2R7D A;  3CPF A;  2A73 B;  1RTN A;  4UDU C;  4BY7 H;  1EL0 A;  2XTI A;  4A93 B;  4Y7N B;  3MXN A;  5M3M B;  4CKB A;  2NVX H;  4A3E G;  3J7Z C;  1YIT A;  1XTC D;  4B9X A;  2IW3 A;  3UDF A;  4C3H H;  2LSS A;  1DOM A;  4X3U A;  1F9P A;  2E8G A;  3HOZ B;  2K01 A;  4AQY Q;  5ELC A;  1JJC B;  4FNF A;  3M4O H;  1TWH B;  1WTQ A;  5ELD A;  2R7Z B;  2XSC A;  4DAV A;  4JI7 Q;  5JJZ A;  4A3M G;  3S17 H;  5K36 G;  4DR2 Q;  2A74 C;  3GTQ B;  2SEB D;  4XTC S;  1K8M A;  2WKC A;  1G2S A;  5TSS A;  1YNJ C;  1TS4 A;  1GD7 A;  1LTB D;  2AWN A;  2Y0S G;  2YYZ A;  4AYB E;  2F0H A;  4P74 A;  1PRT F;  1O78 A;  3NK9 A;  3RUZ A;  3K57 A;  1X55 A;  4YCU A;  1QZH A;  3GTO H;  4JG2 A;  1UNS A;  3Q6S A;  3CAM A;  1SE2 A;  2PNR C;  4ODG A;  3E6Z X;  3HOU B;  5JVG 3;  4NPS A;  2O5J C;  2N49 A;  1FGU A;  2JA5 H;  1HR0 W;  1IBM L;  5FLM H;  2A1A A;  3EVQ A;  2MHV A;  4PMC A;  3SR1 A;  4DV6 L;  4LF8 Q;  4RCN A;  1Y1W H;  4JI6 Q;  4POG A;  2K14 A;  2EE1 A;  4CDF C;  1AE3 A;  3DWA A;  2N78 A;  4XQJ A;  4XDX A;  2K4K A;  1O7I A;  2CVR A;  3K80 C;  1MBY A;  1FGB D;  2BH2 A;  5G3L D;  4HTH A;  3K81 C;  2DN8 A;  3M3Y H;  2PCF B;  3FKI B;  5NUC A;  4B3T Q;  3D8G A;  1TY2 A;  1DD2 A;  2HCC A;  1C0A A;  5FO9 B;  4X3K A;  1OTC A;  3NWT A;  2BA0 A;  4P71 A;  1FD7 D;  3I4O A;  5KND A;  2D2C C;  3I4M H;  2K28 A;  1WD0 A;  3SDZ A;  4BY1 G;  3C1F A;  2WB1 B;  2LKV A;  1FJG Q;  4GLX A;  4IFD I;  1S72 A;  1L2F A;  4B3M L;  4PG3 A;  4A3E H;  1PFN A;  1MSG A;  3I7F A;  4ZAI A;  4XYQ A;  4KLK A;  2JA8 G;  4OWT B;  4AH6 A;  3H6M A;  4CKE A;  3H3V I;  3PO2 B;  1Y69 U;  2O4X A;  4LW1 A;  1MHW C;  3R8B A;  2QDL A;  1NJI C;  4DR7 L;  4JI4 Q;  3GTJ B;  4JI2 Q;  4NP5 A;  3BG3 A;  3L7Z C;  4CDD C;  1Y14 B;  1S5F D;  3JC6 6;  1F9R A;  1XPR A;  1LAB A;  2NB0 A;  1KIX A;  4LF8 L;  1K83 H;  3CW2 C;  1QCB D;  1LTA D;  1JB7 A;  3MC0 B;  4IFD G;  4H7B A;  1EFI D;  2AKW B;  1IHZ A;  1HUM A;  3KF6 B;  3ICE A;  1KC8 C;  1STG A;  1UUP A;  2MO1 A;  3KLW A;  3MEH A;  4QUF A;  1V1O A;  3UE1 A;  3Q23 A;  4RH6 A;  4X62 L;  2UUA Q;  3VDY A;  1C4Q A;  1STB A;  2KVM A;  3E3X A;  3PO3 H;  2MQH A;  1VQA A;  3BVG A;  1HNW Q;  3HRZ C;  3H94 A;  1RKN A;  1Z7T A;  3UDG A;  1SMX A;  4R4I A;  3R2I A;  4E6I A;  5H1S E;  2BH8 A;  1B9N A;  2KHI A;  4QB4 A;  1B4O A;  2KQ3 A;  1D6E C;  3K7A B;  1F9Q A;  5EQ0 A;  5M5Y B;  2D62 A;  4A3G B;  1EOT A;  2WAQ B;  2Q8I B;  3MZ5 A;  1CK1 A;  3SK6 A;  1KQS A;  3I90 A;  4PMW A;  1PHJ A;  5GQO A;  1CHQ D;  4A3I G;  3KF8 A;  4XT1 B;  3OW7 A;  3W5O A;  2I46 A;  5IGB A;  1SBB B;  2L4N A;  3F1Z A;  4OIJ A;  2PZT A;  3P75 A;  2E74 C;  1SMY C;  2A6H C;  1Z47 A;  5HGT A;  4RFB A;  1WTP A;  4DR1 L;  3P20 A;  1JWM D;  4ULL A;  5JPN C;  2ATW A;  4BY1 H;  2NWG A;  3EA6 A;  1SFO B;  4QJF A;  4APV A;  5EBC A;  2HDM A;  1IYU A;  4LFB Q;  1Y1V H;  1EU4 A;  1GUO A;  1SYC A;  1IKM A;  3QWN A;  1VMC A;  2JA8 H;  3NP8 A;  5CV8 A;  2CKZ B;  1YNJ D;  2KA7 A;  1PZK D;  3MWY W;  2G9D A;  5C4H A;  4CBV A;  4MTN A;  3PUW A;  1PRT C;  4HJ8 A;  1AEX A;  1TU2 B;  3FHW A;  2IY5 B;  4RKL A;  4GKK L;  1ONL A;  2AHO B;  1QWY A;  4K0K L;  1CM9 A;  2B63 B;  4JYA L;  3RD4 A;  2F4V L;  4DV5 Q;  2R92 B;  1KAA A;  4DK6 C;  5CC4 A;  4AYB G;  4IFD H;  3UI2 A;  4OX9 Q;  4ZLT F;  2ZXP A;  2TMP A;  5C3E H;  2Z9H A;  3S2H B;  5IYB G;  1Q1E A;  3QB3 A;  3GTK B;  2B2U A;  1VS0 A;  5DM6 3;  4OWX B;  3J7A 5;  2NVT B;  2CQA A;  4I7Z C;  3H3V H;  3RLF A;  2Z0S A;  1A63 A;  3J7A F;  5EKL A;  5IP9 H;  2WKD A;  2FJ2 A;  3CQZ H;  4HR7 B;  1V1P B;  4OL7 A;  1F2Z A;  1KTK A;  2EY6 A;  2K5N A;  4GLV B;  1OO9 B;  4YHH L;  1SE4 A;  3H91 A;  5IGF A;  2WAC A;  2YTV A;  2UXB Q;  4I7A A;  2M9V A;  5IOC A;  4LK1 C;  3HOV H;  1II3 A;  2HQE A;  3MHB A;  1XMQ L;  2AQ2 B;  1K3B C;  5L37 A;  1HRJ A;  1PDQ A;  4HIK A;  3M7G A;  4IUP A;  2F0Q A;  5C4Z A;  3J80 i;  4UPA A;  2Z1C A;  4HAE A;  4C3I H;  2ZTD A;  1ZXT A;  4DV3 L;  4JI3 L;  2JEB I;  4OON A;  4C1N K;  2E2H H;  3GTP H;  2RA4 A;  1PFM A;  1D8L A;  2EXD A;  2BE5 C;  2MNA A;  4YWL A;  4PZ6 A;  5G3L F;  1HA6 A;  1EY4 A;  1A2T A;  2VB3 X;  5JOB A;  3VR2 A;  2QW7 A;  1XPO A;  4CGY B;  2CWA A;  3ERO A;  3RLO A;  2VQF Q;  1I94 Q;  4R4Q A;  2FMC A;  5I9P A;  3JAM E;  4BA1 I;  4G57 A;  1QVC A;  2C35 B;  4R4T A;  3S16 B;  4DR5 L;  1B53 A;  2P5Z X;  4M8A A;  1Q90 A;  5C4X B;  4OXP A;  2B2Y C;  2KCM A;  2RQX A;  2IX1 A;  2UXC L;  4N9T A;  3ND8 A;  2E2J H;  2C5C A;  5K5P A;  3I4N H;  1ESF A;  1S5B D;  5IWA L;  3IFT A;  1I6H B;  3BDC A;  2OTJ A;  2F0J A;  2CH4 W;  1QVF A;  1VQF A;  4BS9 A;  1LT4 D;  4C3J G;  3A74 A;  5IYB H;  3CCU A;  3W1B A;  3RR5 A;  1N36 Q;  4A3B B;  3A55 A;  5M5W H;  3F2U A;  4QGU A;  1I50 H;  1SLJ A;  4DV0 Q;  2QIL A;  3W2D A;  1VQB A;  4DV7 Q;  1L1O C;  3ERQ A;  1XMO L;  1X9N A;  1HFG A;  1YVC A;  1LTI D;  2C9O A;  2ENB A;  1ESR A;  1R9T H;  3KDF A;  1SRO A;  3NQI A;  1KDC A;  5EBD A;  5C3X A;  3PF5 A;  4HMI A;  1GKH A;  2MGS A;  5M5X H;  2A69 C;  3WOE A;  3X3M A;  2I07 B;  2EJM A;  1W6K A;  4YCW A;  2HQL A;  4RGN A;  1SMY D;  2A6H D;  3GP7 A;  3N6R A;  3ZYY X;  1JOO A;  2NZO A;  1JMC A;  5BN4 A;  5J3B A;  3WDN A;  1ET9 A;  1DON A;  4MNO A;  4LF5 Q;  3RN5 A;  1Q3L A;  3D3R A;  2F0E A;  4J6H A;  2F0S A;  1YJW A;  2L15 A;  3RZO H;  1VQH A;  4OO1 I;  4J1M A;  2VUM H;  5IGG A;  3TQY A;  3K59 A;  2PMZ E;  1PRT D;  1GUS A;  1PH9 A;  1IYV A;  3H0G B;  4R9W A;  4DUY L;  1PRT B;  2K33 A;  1Q81 C;  2OEO A;  2GVA A;  2VNU D;  4X66 Q;  2VZA A;  4KN4 C;  1HFN A;  4DXG A;  3ERS X;  2K75 A;  1I4Q A;  3NBH A;  2J0T D;  4A3J G;  1EFW A;  1U0L A;  4LNQ A;  4OO1 G;  2JA9 A;  1K8A C;  1VQP A;  5C0X G;  4A3L G;  2PQA A;  3PUZ A;  3J80 c;  3C46 A;  1HPC A;  2F0F A;  1NTG A;  2DUD A;  5EGT A;  4EQ5 A;  2R61 A;  5D3D A;  2L9H A;  4NXM L;  1K0S A;  5KGU A;  3MXG A;  1I4X A;  1TR5 A;  2JA6 G;  3S1R B;  2RDF A;  4HJA A;  2EYM A;  5IYD H;  1SJH D;  1STY A;  1YBY A;  3MXP A;  1EQV A;  2X6G A;  2XRQ D;  3EQL C;  5IT9 E;  1Y8O B;  4XXE A;  5IGC A;  1MSH A;  3T16 A;  2VY3 A;  5LMU L;  1PH2 A;  2KOL A;  1JJ2 A;  2PZW A;  1EY8 A;  4RGM A;  1FYC A;  1H9M A;  2NTS A;  1QUQ A;  1ENA A;  3KUP A;  1YI2 A;  2BE5 D;  3T1H Q;  1CKN A;  4P2C B;  1IL2 A;  3GTG H;  4TVA B;  1GVP A;  2EIF A;  3PUV A;  1SND A;  1IYJ B;  3K0Y A;  5JAV A;  4OEL B;  3S17 B;  1K0R A;  1SEB D;  2SDF A;  4MTK A;  3DM3 A;  4LWC A;  2CH4 A;  3E0E A;  3CC7 A;  1N32 Q;  1NR4 A;  2OF1 A;  2TSS A;  1NR2 A;  2LXK A;  1ASY A;  3GTO B;  1JWU D;  2WIN B;  1U4R A;  4TSS A;  4ZUJ A;  2QA4 A;  4GN4 B;  1A15 A;  4BBS H;  3OYY A;  1G8Z D;  3NXW A;  4KN7 C;  2JE6 I;  3A8J E;  1TWF H;  2J4X A;  1DOL A;  1G6Z A;  2UU9 L;  1ICF B;  4HSP A;  4X64 Q;  1VQ7 A;  1PZJ D;  3HOW G;  2KEE A;  5A2Q E;  3DLL A;  1RD9 D;  1EWC A;  4PZ8 A;  4A3J H;  3MXU A;  4K5V A;  4H0L C;  5FOB B;  1SYG A;  1Y1W B;  3S2D H;  3ULJ A;  2VL6 A;  1LAC A;  1GHK A;  1P16 A;  1PTO H;  3S24 A;  1VMP A;  3JAM c;  3CD6 A;  3FVQ A;  1Z6H A;  1Q8I A;  1E3P A;  3D4D A;  1D5M C;  3D4W A;  2QGQ A;  3F8T A;  3IKJ A;  1L1O B;  3RLN A;  3VA7 A; 
#chains in the Genus database with same CATH homology
 2KJX A;  4DAY A;  4A3D B;  1S4Z A;  1LT5 D;  2A69 D;  1SSO A;  1HHV A;  4QCL A;  1G2T A;  2JP1 A;  3NQT A;  1ROD A;  4ZK9 B;  3I8Z A;  3P7J A;  4RHS A;  4BBR B;  3D4R A;  1C8C A;  1BO0 A;  1OXU A;  3NSW A;  1PXU A;  1SNC A;  1AZQ A;  1X3Q A;  5ELF A;  1B44 D;  2RDG A;  1H9R A;  2G9H D;  3TP6 A;  1X3P A;  3DM1 A;  1RTO A;  5IGE A;  1U4M A;  2R6G A;  1L0X B;  2D9U A;  3GO5 A;  2R93 B;  2IJ0 A;  3V96 A;  4RGT A;  1K83 B;  2FIN B;  2KCN A;  5KIX A;  1IKL A;  5EKI A;  1AFP A;  4FXD A;  4KD3 A;  3I72 A;  3TP5 A;  1RF2 D;  1UEA B;  5LL6 X;  3PO3 B;  4DGZ A;  4KTA A;  1CZG A;  1B3A A;  1BXT A;  5I4D A;  1QG7 A;  3S1Q B;  4DXF A;  1LV9 A;  1JOQ A;  1OXS C;  3LNN A;  2ZXO A;  3QJY A;  3BYY B;  1BDO A;  1DYQ A;  5C4J B;  4V0B A;  2F0K A;  1MD2 D;  2F0T A;  3BZD B;  2AWO A;  1F2M A;  3ONA B;  4LAA A;  2MJ8 A;  3TP7 A;  4L8J A;  2V4D A;  1K8O A;  5D65 A;  2L1B A;  1Y1V B;  3SE0 A;  4ZYS A;  1I3Q B;  5I6Y A;  1EY5 A;  4DU9 A;  2KEC A;  3IL8 A;  4IFD J;  1TVX A;  2B2T A;  3L9A X;  2LS0 1;  5CV5 A;  3PIO 3;  1H9S A;  1TT2 A;  3D31 A;  1SYB A;  1QNK A;  2ICE C;  1WTO A;  3I4L A;  1HCZ A;  1KDA A;  5C3E B;  5J22 A;  1WTR A;  1NCV A;  5M3F B;  3TP8 A;  1GUN A;  1O7L A;  1U9R A;  1WCM B;  3SXH A;  5K36 H;  2Z4I A;  5I6W A;  2ZXR A;  2IX0 A;  5CV4 A;  5CGK A;  4ILW A;  2RVL A;  2J7Z A;  3T56 B;  5J39 A;  1RCV D;  4LMQ D;  1Q1B A;  2F0D A;  5EPL A;  3HOV B;  4KJO A;  2FFK B;  1HUN A;  4Q0F A;  2B2U C;  4OHJ A;  5CV7 A;  3S1N B;  3PIP 3;  1EYC A;  3KK7 A;  2EJF C;  1NUC A;  3J7Y W;  4B08 A;  2E2H B;  3GTP B;  4FF2 A;  1DOK A;  4RA8 A;  1RDP D;  1WD1 A;  2DY8 A;  3HZX A;  2K03 A;  1GUG A;  4KK7 A;  3C1E A;  1CT1 D;  4NW2 A;  5E1F A;  1LT6 D;  2JYO A;  1H9S B;  4RKB A;  2LMC B;  2E2J B;  3I4N B;  2B8G A;  4HCE A;  2RKS A;  3GQB A;  2L0C A;  1PFB A;  2AUK A;  1ENC A;  2EY1 A;  2L55 A;  1ET6 A;  3J80 L;  1PTO C;  5M5W B;  2Q8R E;  2OXP A;  1EY7 A;  1H9K A;  5C44 B;  3CU7 A;  1DXM A;  5M9O A;  1BUV T;  1R9T B;  3N52 A;  5LL6 S;  2O2L D;  4CHT B;  5CBE E;  3SVM A;  1WVL A;  2EZV A;  4B9W A;  1I4R A;  1E2V A;  1VF7 A;  3V05 A;  1ZKO A;  4OIK A;  3OIP A;  4A3K B;  1EYD A;  2BDN A;  4FXK C;  5HUR A;  4V19 0;  2F3W A;  5COR A;  3MAQ A;  1JCK B;  1CA6 A;  3RZO B;  1Y8N B;  2OT2 A;  5KYL A;  1QB5 D;  2VUM B;  4K6L A;  2EYP A;  1JOR A;  5CV6 A;  3FMC A;  1TS2 A;  3K58 A;  5AFW A;  1D5X C;  2RSN A;  3FRP B;  1IL8 A;  1OXV A;  5D14 A;  1O7Y A;  1STN A;  2BA1 A;  3S1M B;  2JA7 B;  2A5H A;  5JEA G;  4ZUI A;  1R4P B;  4EGV A;  2FHT A;  5E4X A;  2BCO A;  2JSO A;  2X6L A;  3DEP A;  1HA5 A;  4KHV A;  3FPP A;  3LWU A;  4CJ1 B;  3OHX C;  2EOT A;  5F2D A;  4M1U B;  2B8F A;  5ELE A;  1IW7 D;  3SK8 A;  3VR6 A;  4KD4 A;  1QIL A;  3QOJ A;  4G7Z C;  3O13 A;  3DHQ A;  2XRS D;  5DNF A;  4IUT A;  3GTG B;  4WRD A;  1JR0 D;  1SXT A;  5J1Z A;  2NN6 I;  2QF7 A;  2PO4 A;  2E75 C;  3HKZ B;  4QF4 A;  2K1B A;  2F03 A;  2B2V A;  3MFG A;  2F0N A;  5C5M A;  1H9J A;  3T4A C;  4FF4 A;  1CFM A;  2JXM B;  2WV6 D;  2IX3 A;  1D1I A;  3CHB D;  3MA2 B;  2NN6 G;  3IFD A;  1FNU A;  2EDG A;  4HN7 A;  2N55 A;  1PTO D;  1SYD A;  5JEA H;  5C0X I;  4G7O C;  2M00 A;  3S2D B;  3KBG A;  1LO5 D;  2LY7 A;  5I2Y A;  1PTO B;  1J9O A;  2ID0 A;  3BVM A;  4IN3 A;  1BBX C;  5EJW A;  1T5X D;  1GHJ A;  1AW7 A;  2Z8L A;  1BF4 A;  4X3T A;  2B2W A;  5COY A;  1I4H A;  1I6V C;  4XQQ A;  1L0Y B;  2F0U A;  5KRU A;  3H09 A;  1A3T A;  1PYW D;  1JB3 A;  1SNM A;  3VYU A;  1EEI D;  1STE A;  3I91 A;  2EPB A;  4C56 C;  2EYH A;  4A3F B;  1EZ6 A;  1ILQ A;  1LTT D;  2F0M A;  3R3O A;  2WII B;  3NE5 B;  3GV6 A;  3K5O A;  2PZU A;  3HG9 A;  3WOF A;  1W6J A;  3NTH A;  1GXD C;  4R8I A;  2IPK D;  1WTX A;  3G7L A;  1CQF A;  4BY7 B;  2L11 A;  3BDO A;  2NVX B;  4C3H B;  1QNU A;  4EQO A;  4MIU A;  2KED A;  1G29 1;  3QG1 A;  3OWF A;  3M4O B;  1QE6 A;  2CHB D;  2RDH A;  3R93 A;  2EYL A;  5E4W C;  1EY6 A;  2AUJ D;  3J81 L;  1D5Z C;  2BOS A;  3SEB A;  1XXG A;  3BVZ A;  2PPB C;  4F88 A;  4Z9C B;  1ILP A;  4GZY C;  2PYK A;  1A3V A;  3T13 A;  4FVM A;  3VYT A;  1S5C D;  2XNA C;  2DY7 A;  1NAP A;  3U9O A;  4QIW B;  4H44 C;  3T51 B;  2JA5 B;  3H3V C;  1HXY D;  3J7A V;  1Q12 A;  4OO1 H;  2EYJ A;  4KV6 A;  4WFN 3;  2IL8 A;  5C0X H;  2H4O A;  3OMC A;  5DM7 3;  3HGB A;  3S9W A;  1A6X A;  4G4K A;  1I4P A;  1JE4 A;  1EYA A;  5CBA E;  3HOX B;  2HCI A;  1E2Z A;  1DZ1 A;  3M3Y B;  2B39 A;  3OSO A;  1A2U A;  1STH A;  3TDQ A;  3C2P A;  2QKI C;  4DNR B;  4FO2 A;  4QMG A;  3KBX A;  3HEJ A;  1LTS D;  1TQO A;  3I4M B;  3DUZ A;  3DWP A;  1EEF D;  4XYO A;  2E2I B;  1WTV A;  1R4Q B;  4FYD A;  4A3E B;  4ID6 A;  1B2T A;  1LTR D;  3EJI A;  1TKW B;  2FMM A;  5FLX L;  4C2M B;  4A3M B;  3DMU A;  5ELB A;  4HCS A;  2B2T C;  1SNQ A;  2A6E C;  4L6T B;  3A56 A;  4ABN A;  4DF7 A;  2Y0S B;  2A68 C;  4XIG S;  1GUW A;  1F9S A;  1YNN D;  3DEO A;  3SHL A;  1Y8P B;  1CTM A;  4K6D A;  3BDL A;  4QUC A;  1KAB A;  3G6J B;  4ZKC B;  1KNA A;  3M85 A;  1TS3 A;  1PTO F;  5I2X A;  1S5E D;  3OPO A;  3ITP A;  1D2B A;  4NKL A;  2D5D A;  4IZ8 A;  2MP1 A;  1HTP A;  5BN5 A;  1ENF A;  3A8I E;  3FDT A;  4O1N A;  3KLR A;  4PNY A;  3MVV A;  2JEA I;  2K7V A;  4KY7 A;  1HQM C;  5CV9 A;  3NHH A;  2CW0 C;  3E5S A;  5KYI A;  3NBI A;  5IGD A;  3P1H A;  4TKO B;  3TSS A;  2K5Q A;  4BY1 B;  3CRL C;  5C5L A;  3E0J A;  2RSO A;  4F87 A;  1OXT A;  4UAI A;  1SYE A;  2JA8 B;  4C1N I;  1F2L A;  2YU9 B;  4IUU A;  2PQE A;  3NTI A;  4TRD A;  1O7Z A;  4FF1 A;  2IT1 A;  1DCZ A;  1RJT A;  2F3V A;  2F1M A;  2O5I C;  2VB2 X;  4XQN A;  1LLR D;  3ND9 A;  3K5N A;  3AMU A;  1PMR A;  1TY0 A;  3A7A B;  4KKU A;  5LHY 1;  1A3U A;  4K8J A;  4YIJ A;  2L12 A;  2EYO A;  1JQY D;  2K04 A;  3CQZ B;  1EIH A;  4IUV A;  2F4I A;  2K5D A;  1J8I A;  4KY5 A;  4I65 A;  4KI0 A;  2QDB A;  3A54 A;  1X32 A;  2SNM A;  2EYF A;  3I70 A;  3IAY A;  1CI3 M;  1ZYR C;  5CMD A;  2BDO A;  4ME5 A;  3NPP A;  3FPU B;  2XIW A;  2PW7 A;  5T1G A;  5JPM C;  2E76 C;  4A3I B;  3VYR A;  4CJ0 B;  1IW7 C;  3BS1 A;  5FO7 B;  4C3I B;  2EY5 A;  4KJN A;  1NSN S;  1U4L A;  4ZQ3 A;  1BCP F;  3GD7 A;  4O42 A;  3KLS A;  1WTW A;  4LJZ C;  1V1P A;  2A6E D;  3TZU A;  1BOS A;  1AN8 A;  3C3L A;  3SK5 A;  2K05 A;  2X69 A;  2A68 D;  5C6A A;  2EJG C;  2EVB A;  4PQX A;  1V8Q A;  2F0W A;  4HED A;  3QOL A;  1CHP D;  5C3W A;  2XVS A;  2NUC A;  4AYB B;  1EZ8 A;  2F0G A;  4OGQ C;  1GUT A;  3D6W A;  1CZW A;  3VR5 A;  1MI2 A;  4C3I G;  1TS5 A;  3D6C A;  4HMJ A;  3NTK A;  1I50 B;  2M2L A;  3V2T A;  1AP0 A;  5BN3 A;  4NMZ A;  1GJX A;  2MPM A;  1F77 A;  5D3I B;  2NZ1 D;  1SDF A;  2NYZ D;  2XN9 C;  2N88 A;  3J80 E;  4FP5 D;  1AZP A;  5KEE A;  3OIQ A;  1JIC A;  5M5X B;  1SYF A;  2GA4 B;  3K6O A;  2KUM A;  2CW0 D;  2RBM A;  3TBI B;  2KHS A;  3PMF A;  4EQP A;  3FEW X;  5JEA J;  4JBW A;  3MTS A;  4J8Q A;  4XT3 B;  1BNZ A;  4U68 A;  2SNS A;  2L5T A;  4DNT B;  4K2L A;  3CKI B;  2AQ1 B;  3K5L A;  2F0I A;  1VDZ A;  2K6A A;  1XWE A;  3I73 A;  1SNO A;  5EPK A;  3PUX A;  2QEJ C;  4CJ2 C;  2B2V C;  1E2W A;  4N9P A;  1EQT A;  4KY6 A;  4L63 B;  3M4Y A;  1S5D D;  5CR3 A;  1O80 A;  1LT3 D;  3PUY A;  1EWH A;  4C3J B;  4F8M A;  1VF5 C;  3PV0 A;  3I3C A;  3JAM L;  3VA5 A;  4DFA A;  4K5W A;  1GOZ A;  5EKK A;  3QIA A;  3Q22 A;  1VCI A;  3VR4 A;  2AQ3 B;  1CA5 A;  4MN3 A;  2XWB B;  4FXG C;  1BR9 A;  1EY0 A;  2B2W C;  1ZYR D;  1C48 A;  1KNE A;  4RAU C;  3S14 B;  3OWE B;  3M7N A;  4ZKB B;  3HS0 C;  4U67 3;  1FNW A;  4WOR A;  3U9S A;  3EFX D;  1TWC B;  5E3F A;  5KNC A;  4K8I A;  3OMG A;  1BCP C;  1QOH A;  4KMU C;  2EXZ A;  5T1I A;  1CQV A;  1TWA B;  5DAU A;  2HUG A;  4DN4 M;  2IWH A;  4BBS B;  3NUC A;  1TWF B;  2K5W A;  2WP8 J;  1ML0 D;  4DA2 A;  1BQQ T;  5C0X J;  1TII D;  4RGO S;  3R2T A;  4DK0 A;  4BA2 I;  2F0V A;  1D1K A;  4A3J B;  3URY A;  4KKT A;  2NVY B;  3L3O C;  4JK1 C;  4K14 A;  3KLS X;  3BYT B;  3DWQ A;  3T53 B;  1XX8 A;  5I9O A;  2JA6 B;  1YNN C;  2PW5 A;  4IUR A;  4G7H C;  1SNP A;  4IAL A;  4IUN A;  1EU3 A;  2R3Z A;  1FNV A;  1SJE D;  4HSV A;  2HDL A;  3RZD B;  1ZEQ X;  2B2Y A;  3MFY A;  5KNB A;  1B1Z A;  3W3A A;  4IUQ A;  4K2K A;  1V43 A;  3GTL B;  1JC7 A;  2MUY A;  1KDB A;  4BWG B;  3LX0 A;  3GTM B;  1T5E A;  1HTL D;  5IT9 L;  1KLG D;  5CYU A;  4RWS C;  1DJR D;  5FO8 B;  4X3S A;  3HP3 A;  4EVO A;  2QCP X;  4RCO A;  3Q0A A;  3NWS A;  2LFN A;  1HQR D;  1QJO A;  2EY2 A;  4EQN A;  4WJW A;  3TN2 A;  5ISR A;  4Q5V A;  2NN6 H;  3QO2 A;  3A7L A;  3HOW B;  1B9M A;  3A8K E;  4CKC A;  1OXX K;  1LTG D;  4KKS A;  4DAP A;  2Q8T A;  1M4V A;  3OOC A;  1XYI A;  2F0O A;  1SAP A;  4K5X A;  4R8N A;  1I4G A;  3J81 E;  3S15 B;  2Z4H A;  2E2D C;  3K5M A;  4NDX A;  5A2Q L;  4PMB A;  3HOY B;  2NBF A;  1E0B A;  3Q24 A;  4C3H G;  5A35 A;  1STA A;  1UAP A;  3AB9 A;  1TWG B;  3GV3 A;  1PZI D;  4DK1 A;  2H1E A;  1BCP D;  3VR3 A;  1EIG A;  1JWS D;  1MGS A;  3AU7 A;  4MHE A;  2ICI A;  1BCP B;  2F0P A;  1ICW A;  4ZRZ A;  1KLU D;  3CRK C;  2K32 A;  4IQZ A;  2DNC A;  1U4P A;  1EY9 A;  4H13 C;  1RHP A;  1B50 A;  2PMZ B;  1G91 A;  5DEH A;  3RMH A;  3TZD A;  5IIF A;  5EPJ A;  2VXW A;  3SK4 A;  3X3N A;  1F2Y A;  4FF3 A;  2F0L A;  4F7X A;  5FKA C;  4PV1 C;  5JVH 3;  2ZT9 C;  5FK9 C;  3TME A;  3VYS A;  4TQU S;  2XWJ B;  1DM0 B;  1JOK A;  2NVQ B;  3LWE A;  3DXJ C;  5FLX E;  1PLF A;  2DNE A;  4S3S A;  2KCC A;  4KHZ A;  4RHR A;  1FR3 A;  2NTT A;  1M8A A;  2SOB A;  5IOD A;  1SE3 A;  2A73 B;  1RTN A;  4UDU C;  1EL0 A;  4A93 B;  4Y7N B;  3MXN A;  5M3M B;  4CKB A;  1XTC D;  4B9X A;  2IW3 A;  1DOM A;  4X3U A;  1F9P A;  3HOZ B;  2K01 A;  5ELC A;  4FNF A;  1TWH B;  1WTQ A;  5ELD A;  2R7Z B;  2XSC A;  4DAV A;  5JJZ A;  5K36 G;  2A74 C;  3GTQ B;  2SEB D;  4XTC S;  1K8M A;  2WKC A;  1G2S A;  5TSS A;  1YNJ C;  1TS4 A;  1LTB D;  2AWN A;  2YYZ A;  2F0H A;  1PRT F;  1O78 A;  3NK9 A;  3RUZ A;  3K57 A;  1UNS A;  3Q6S A;  1SE2 A;  2PNR C;  4ODG A;  3E6Z X;  3HOU B;  5JVG 3;  2O5J C;  3EVQ A;  2MHV A;  4PMC A;  3SR1 A;  4RCN A;  2EE1 A;  3DWA A;  4XQJ A;  4XDX A;  2CVR A;  1MBY A;  1FGB D;  5G3L D;  4HTH A;  2DN8 A;  2PCF B;  3FKI B;  5NUC A;  3D8G A;  1TY2 A;  1DD2 A;  2HCC A;  5FO9 B;  4X3K A;  3NWT A;  2BA0 A;  1FD7 D;  5KND A;  2D2C C;  2K28 A;  1WD0 A;  3SDZ A;  3C1F A;  2WB1 B;  2LKV A;  4IFD I;  1PFN A;  1MSG A;  4ZAI A;  4XYQ A;  3H6M A;  4CKE A;  3PO2 B;  1Y69 U;  2O4X A;  3R8B A;  3GTJ B;  4NP5 A;  3BG3 A;  3L7Z C;  1S5F D;  1F9R A;  1LAB A;  2NB0 A;  1QCB D;  1LTA D;  3MC0 B;  4IFD G;  4H7B A;  1EFI D;  1IHZ A;  1HUM A;  1STG A;  1UUP A;  3MEH A;  4QUF A;  1V1O A;  3Q23 A;  4RH6 A;  1C4Q A;  1STB A;  2KVM A;  3BVG A;  3HRZ C;  3H94 A;  1RKN A;  1Z7T A;  3R2I A;  4E6I A;  1B9N A;  4QB4 A;  1B4O A;  2KQ3 A;  1D6E C;  3K7A B;  1F9Q A;  5EQ0 A;  5M5Y B;  2D62 A;  4A3G B;  1EOT A;  2WAQ B;  2Q8I B;  3MZ5 A;  1CK1 A;  3SK6 A;  3I90 A;  4PMW A;  1CHQ D;  3KF8 A;  4XT1 B;  3OW7 A;  5IGB A;  2I46 A;  1SBB B;  2L4N A;  4OIJ A;  2PZT A;  3P75 A;  2E74 C;  1SMY C;  2A6H C;  1Z47 A;  5HGT A;  4RFB A;  1WTP A;  3P20 A;  1JWM D;  4ULL A;  5JPN C;  2NWG A;  3EA6 A;  1SFO B;  5EBC A;  2HDM A;  1IYU A;  1EU4 A;  1GUO A;  1SYC A;  1IKM A;  3QWN A;  1VMC A;  3NP8 A;  5CV8 A;  1YNJ D;  2KA7 A;  1PZK D;  3MWY W;  2G9D A;  5C4H A;  4CBV A;  3PUW A;  1PRT C;  1AEX A;  1TU2 B;  4RKL A;  1ONL A;  1QWY A;  1CM9 A;  2B63 B;  3RD4 A;  2R92 B;  1KAA A;  5CC4 A;  4IFD H;  3UI2 A;  4ZLT F;  2ZXP A;  2TMP A;  3S2H B;  1Q1E A;  3QB3 A;  3GTK B;  2B2U A;  5DM6 3;  2NVT B;  2CQA A;  4I7Z C;  3RLF A;  3J7A F;  5EKL A;  2WKD A;  2FJ2 A;  4HR7 B;  1V1P B;  4OL7 A;  1F2Z A;  1KTK A;  2EY6 A;  1OO9 B;  1SE4 A;  3H91 A;  5IGF A;  2WAC A;  2M9V A;  5IOC A;  4LK1 C;  1II3 A;  2HQE A;  3MHB A;  2AQ2 B;  1HRJ A;  1PDQ A;  3M7G A;  4IUP A;  5C4Z A;  2F0Q A;  2Z1C A;  4HAE A;  1ZXT A;  2JEB I;  4C1N K;  2RA4 A;  1PFM A;  2BE5 C;  5G3L F;  1HA6 A;  1EY4 A;  1A2T A;  2VB3 X;  5JOB A;  3VR2 A;  4CGY B;  3ERO A;  2FMC A;  5I9P A;  3JAM E;  4BA1 I;  4G57 A;  3S16 B;  1B53 A;  4M8A A;  1Q90 A;  5C4X B;  2B2Y C;  2RQX A;  2IX1 A;  4N9T A;  3ND8 A;  2C5C A;  5K5P A;  1ESF A;  1S5B D;  3IFT A;  1I6H B;  3BDC A;  2F0J A;  4BS9 A;  1LT4 D;  4C3J G;  4A3B B;  3A55 A;  3F2U A;  2QIL A;  3W2D A;  3ERQ A;  1HFG A;  1LTI D;  2C9O A;  2ENB A;  1ESR A;  3NQI A;  1KDC A;  5EBD A;  5C3X A;  4HMI A;  2MGS A;  2A69 C;  3WOE A;  3X3M A;  2I07 B;  2EJM A;  1W6K A;  4RGN A;  1SMY D;  2A6H D;  3GP7 A;  3N6R A;  3ZYY X;  1JOO A;  5BN4 A;  3WDN A;  1ET9 A;  1DON A;  1Q3L A;  3D3R A;  2F0E A;  4J6H A;  2F0S A;  4OO1 I;  4J1M A;  5IGG A;  3K59 A;  1PRT D;  1GUS A;  1IYV A;  3H0G B;  4R9W A;  1PRT B;  2K33 A;  2OEO A;  2VNU D;  4KN4 C;  1HFN A;  4DXG A;  1I4Q A;  3NBH A;  2J0T D;  4OO1 G;  5C0X G;  3PUZ A;  3C46 A;  1HPC A;  2F0F A;  5EGT A;  2R61 A;  5D3D A;  2L9H A;  5KGU A;  3MXG A;  1I4X A;  1TR5 A;  3S1R B;  2RDF A;  2EYM A;  1SJH D;  1STY A;  3MXP A;  1EQV A;  2X6G A;  2XRQ D;  3EQL C;  5IT9 E;  1Y8O B;  4XXE A;  5IGC A;  1MSH A;  3T16 A;  2KOL A;  2PZW A;  1EY8 A;  4RGM A;  1FYC A;  1H9M A;  2NTS A;  1ENA A;  3KUP A;  2BE5 D;  4P2C B;  3PUV A;  1SND A;  3K0Y A;  5JAV A;  3S17 B;  1SEB D;  2SDF A;  1NR4 A;  2OF1 A;  2TSS A;  1NR2 A;  3GTO B;  1JWU D;  2WIN B;  1U4R A;  4TSS A;  4ZUJ A;  1A15 A;  1G8Z D;  3NXW A;  4KN7 C;  2JE6 I;  3A8J E;  2J4X A;  1DOL A;  1G6Z A;  4HSP A;  1PZJ D;  2KEE A;  5A2Q E;  1RD9 D;  1EWC A;  3MXU A;  4K5V A;  4H0L C;  5FOB B;  1SYG A;  1Y1W B;  1LAC A;  1GHK A;  1PTO H;  1VMP A;  3FVQ A;  1Z6H A;  1Q8I A;  3D4D A;  1D5M C;  3D4W A;  3IKJ A;  3VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...