3TDQA

Crystal structure of a fimbrial biogenesis protein pily2 (pily2_pa4555) from pseudomonas aeruginosa pao1 at 2.10 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
EDPQTFEGAGVVFEVQVEKNLVDIDHRLYRLPNSTVRNGMPSLFQVKPGSVVSYSGTVSQPWSTITDIYIHKQMSEQELAEMIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords PilY2 protein
publication title Crystal structure of a fimbrial biogenesis protein PilY2 (PA4555) from Pseudomonas aeruginosa PAO1 at 2.10 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tdqA00
1ZEQX 2QCPX 2VB2X 2VB3X 3E6ZX 2L55A 3TDQA
chains in the Genus database with same CATH superfamily
2SNSA 5GAGC 1DZ1A 1TR5A 1FJGQ 2JP1A 4ID6A 2KCCA 1I4RA 3O13A 1LT5D 3E0EA 2H5XA 3LWUA 4C3JG 2CCZA 1STHA 4B3RL 1BVSA 3A5UA 5M3FG 5KYLA 2WP8J 3GV3A 5CGKA 2NZ1D 1MGSA 3L9AX 2EYOA 1LT6D 2K5NA 2PNRC 3A8JE 2IX0A 4JV5L 3MXPA 4FXGC 3VA7A 4XQNA 1MSHA 1I50H 2EYHA 2PZTA 1S3OA 1TWAH 1J5EQ 1IKLA 3P75A 4BBSH 1FGUA 5A2QE 4DV2L 4DR2Q 1FNUA 1K0RA 4R4IA 2VUMG 1XMQQ 2ICIA 4U673 2AMCB 3J7AF 5BN3A 2B63H 3GTMB 2E2DC 2OXPA 1W6KA 3T1HL 2DJGC 3ZYYX 3S1RB 2Q2TA 4YWKA 4JI6Q 4MHEA 1TS3A 3RMHA 1PH9A 3KLWA 4C2MH 4EQOA 2NN6G 1SJED 3FRPB 1CKMA 2Y0SE 2MFIA 1D5MC 4K6LA 2EJMA 4A3EB 1LT4D 1TWFB 3EA6A 3J80c 1JJGA 4KHPQ 3RLOA 2VQEL 2F0VA 3MZ5A 2UUAQ 4DR1L 1SAPA 4LF6Q 1EQTA 1R4QB 4CDDC 3RN2A 2RHQB 5K36H 3CCLA 4DXGA 3PMFA 1S5CD 5EAYA 5IIFA 2B2TA 4B3ML 4EX5A 1CQFA 1AEXA 4LFAQ 1Q86C 5LMUL 1X54A 2H1EA 1EYAA 1GO3E 1VF5C 3WOFA 4FF4A 3I73A 5BN5A 3HOYG 1BQQT 4JYAL 4KKSA 3TZUA 5JPNC 2UXDQ 3S1QB 1PRTB 1XTCD 1F2MA 4O42A 1H9MA 4B9XA 2C9OA 5FOBB 3G71A 2N49A 2I5MX 4JW0A 3OYYA 2JA7B 1YJWA 4Y7NB 4A3GG 3MTSA 1LV9A 4KLKA 5LL6S 3NUCA 2HCCA 5CV4A 4HIDA 3RZDB 1EQVA 5HGQA 5M3MB 1BR9A 3S1MH 4BY1H 1PV4A 5LMNQ 2XRQD 5L37A 1PH3A 2P5ZX 2R7ZB 1SFOB 1H9RA 3PIO3 4JI0Q 1YNXA 4JI1L 3M4QA 4K5XA 5E4XA 3PUVA 5CR3A 1N36L 1Q46A 1EQRA 5C4JH 4YY3L 1IXRA 4ODGA 3VYUA 4KY5A 2I5LX 1LTLA 4IPHA 2Q2UA 5EJWA 1A2TA 1DOLA 3HKZB 4GS3A 1EFID 2XNAC 4PV1C 5LHY1 2EYLA 3S2HB 1ZXTA 3NTKA 4DV1L 2K03A 2CVRA 1OXUA 3HOXG 2OTLA 2OF1A 1SLJA 3D4RA 3A0JA 3MFYA 1A6XA 4IO9A 4BBRB 1WVLA 3S2DH 3GTJB 5IGFA 1STAA 4MTNA 1CKOA 1HZBA 4DKAC 3H3VI 2IX3A 1H95A 1NMGA 2WV6D 2ZJQA 3K7AH 1Y1WB 1KIXA 4DUZL 2B2WA 2F0LA 2BA1A 1VQMA 4QUCA 5IYCG 1PTOD 2K50A 3PO3H 2CW0D 1N34Q 1QZHA 3HGBA 3E5SA 5C5MA 2MNAA 3HOVB 1S5DD 2FXQA 3CRLC 3STBD 1OXTA 2L0CA 4GN3B 5EBDA 2F1MA 3ERSX 1NAPA 5JJLA 1VQBA 5CYUA 3UE0A 2WAQE 4XTCS 2MJ8A 3KK7A 3OHXC 1GUOA 1NTGA 3H3VC 1B70B 2ZTDA 1ONLA 4GNXB 1N32Q 3NBIA 4ZKBB 4RKLA 3T53B 4FF2A 2AWNA 4B9WA 1CI3M 1WCMH 4CKBA 1I50B 4CDCC 1PH2A 1ZKOA 4BBSB 1W6JA 5HGTA 1V9PA 3KF6B 1SXTA 4OELB 1GUTA 1QWYA 3GTPH 5GQOA 4B3SQ 2PYKA 4PZ6A 3HOZB 2EE1A 3PIOA 2NN6I 1X55A 3PQIA 3BDLA 3W3AA 5T1IA 1HA6A 1ASZA 5FKAC 3AQQA 2ZXRA 5JJZA 4C2MB 3MVVA 5IP7G 1XTDA 1J9OA 4IUQA 2E74C 2G5DA 2K5VA 2GVBA 2D2CC 1K3BC 1V43A 2JA7G 3S15H 1EL0A 4XQJA 4RCNA 4JI4L 4DAMA 4B3RQ 2A6ED 1HNZL 4QL5A 4JOIC 1Y69U 5M3MG 3E3XA 1PH1A 1YI2A 1V1PA 4JV5Q 4LF4L 3BZKA 1ASYA 1TT2A 2NZOA 1QVGA 2R7ZG 4QJFA 2CH4W 2EIFA 2UXBL 5M9OA 3PV0A 4G7HC 3HOWG 4DV2Q 2F0IA 1QZGA 2EY2A 4FDBA 3CU7A 3IL8A 2K75A 1TWGH 1YITA 5IT9L 2K05A 3T56B 1O7YA 3HKZG 4KMUC 3K58A 3T1HQ 2CKZB 3VYRA 2R93H 3HOUH 2PQEA 1BBXC 1Q1BA 1JCKB 1DJRD 1AE2A 1SE3A 4Q0FA 5KIXA 5EQ0A 3NK9A 4ZYSA 2DGYA 4A4IA 2HQLA 1STYA 4H7BA 1VF7A 4UY8C 4BBRG 1PZKD 1U9RA 5FO8B 4U68A 3N6RA 2VQEQ 2E2IH 3EN2A 4BY1B 4YCUA 3NP8A 4DR1Q 4FYDA 3I4NH 2RSOA 1PTOF 1N8RC 1Y1WG 2ZM6L 5IYBG 4B3MQ 4FF1A 1LABA 5C4JB 5LMUQ 4OONA 1DD2A 3SVMA 2EOTA 3OMGA 1FL0A 1SBBB 3HOVG 3F2CA 3MXNA 1NY4A 4JYAQ 2X6GA 1EUJA 1EY8A 1I4XA 1CM9A 1KLUD 4RH6A 4DUYL 1LO5D 4JC0A 1Q82C 3A7LA 5DEHA 3VR6A 4A3KH 1SMYD 4JOIA 3A8IE 3KUPA 1RODA 2R3ZA 4X3KA 1IL8A 4JI5L 4NDXA 1NMFA 1HZCA 4GKKL 1QB5D 3K7AB 3VR2A 1II3A 4XQQA 2Z6KA 5ELEA 1RD9D 5AJ3L 2BCOA 2LS01 3S24A 3IAYA 5IODA 2KHIA 3PO3B 2Y0SB 4R8IA 4GOPC 3OW7A 2PPBC 5C3EB 3EFXD 3K5LA 4BBSG 5ELOA 3CKIB 4DR5L 2F3WA 4JI1Q 1TWCB 1N36Q 4AQYL 3RN5A 4YY3Q 2O5JC 2NVQH 4LFBL 1PH7A 2B63G 1DGSA 5T1GA 1K8OA 2K5HA 5KGUA 1MHWC 4C3IB 5D14A 3RLNA 1Y1VB 4DV1Q 4UDUC 4JPBW 3PGZA 3SR1A 1B7YB 5IGDA 2QGQA 2Z4HA 5M5YH 5JVG3 4XDXA 1JB3A 2K28A 1XWEA 3K6OA 3K5OA 4X3SA 1J6QA 4DPGA 1N33L 1LTTD 1I6HH 3ITPA 1GUSA 1L0WA 1IW7D 2VS1A 1QOHA 4A3MH 1WCMB 2KCNA 5EBCA 4POGA 3DHQA 2JE6I 4G7OC 2B2VC 1ET9A 5K36G 3CCEA 4IZ8A 1AP0A 2AUJD 3I55A 4DUZQ 4CJ2C 3NQTA 5C4XH 5CBEE 2I07B 4XT1B 4LWCA 5C5LA 4LF8L 2V4DA 3N52A 4WRDA 2HQEA 5JEAJ 2G9HD 3G48A 2LMCB 2XGTA 4C3HH 1SNDA 4DF7A 4QMGA 3CQZH 2D9UA 4NXML 1YNJC 2E5LL 1S4ZA 1NE3A 3I7FA 1ENFA 1A3TA 1OXXK 3HP3A 3NWSA 3ONAB 4BA1I 3VA5A 4JVZA 2IL8A 5K5PA 1VQ7A 1HJPA 2K01A 5F2DA 4APVA 1AH9A 2K5QA 2RHSB 2NB0A 2ZJPA 2OEOA 5FLXL 4ZAIA 4OXPA 1KAWA 3DWQA 1UAPA 2SOBA 4BY1G 4DV6L 4P75A 1Q8IA 3S14B 4DK1A 2EYMA 3VYTA 4BXXG 4EGVA 4X64L 1MI2A 1YHAA 1VQDA 1QNKA 1TWHH 1G8ZD 1NR4A 1VQEA 2Z4IA 4FO2A 3SK6A 1SNOA 1U4MA 4ABNA 1WTPA 3DMUA 1PFSA 2PZWA 1L2FA 3BVMA 1DM0B 3HOUB 3QG1A 1D5ZC 1RL2A 4DV4L 2JQOA 5GAEC 1GOZA 1JWSD 4FXDA 3D6CA 2CWAA 5BR8L 2F0PA 3K0YA 4OO1I 4OIKA 3OSOA 1ZYRC 1SSOA 1O7IA 1YNND 3GD7A 2E2IB 1T5XD 1LT3D 3HS0C 3F2DA 1AZQA 1C0AA 4JI4Q 2NVTH 4GZYC 5DM73 2K1BA 2DN8A 4H02A 4LFCL 3I4NB 3CAMA 1HNZQ 1EY9A 1KDAA 1K73C 3P20A 4DNRB 1G2TA 2F52A 4LF4Q 2EXDA 5C3XA 1AE3A 1YHBA 3S9WA 1BKBA 3TSSA 4IUPA 1AZPA 3PO3G 2Y0SG 2UXBQ 3HOYB 2E8GA 4X65L 3I2ZA 3FHWA 3FEWX 3X3NA 5FO7B 1WD1A 1KLGD 2LSSA 3AYHB 1IYJB 1PRTD 1WI5A 1VQOA 2LFNA 3UDIA 1PDQA 4A3KB 3RZOB 1LACA 1Q3LA 1NJIC 3URYA 4I7ZC 3NBHA 3I72A 4ALPA 3J7AV 5I2YA 1VCIA 1X3PA 2HDMA 4HAEA 4RHRA 4QF4A 1E0BA 1ENAA 1CUKA 1WCMG 3EJIA 4A3FH 1GHJA 3TRZA 1I4GA 1EWCA 1LTSD 3S1NH 2A5HA 3MEHA 3UDGA 3HG9A 1G291 4CDFC 2KJXA 2JA9A 2ZM6Q 2UUBL 3I4OA 3OTOL 2RQXA 5G3LD 1EY0A 1JJCB 1ICFB 2NVQB 4RKBA 5D3IB 4B3TL 2B2TC 3MFGA 1E2ZA 3BJUA 2QDLA 3MXGA 3SE0A 4HIKA 2R7FA 2B8GA 4GOPB 4CJ1B 1D7QA 3PUWA 5J1ZA 3TP6A 4JBMA 1B9NA 1NUCA 3M7GA 2ENBA 5IE8A 3BVZA 2F4VL 1VQ4A 3I4MH 4DUYQ 1JWMD 2BOSA 4J8QA 5E1FA 4HSVA 4JCVE 1EYCA 5CBAE 3ULJA 1HUMA 1BNZA 1RDPD 4IN3A 4R9WA 1GHKA 2R92H 5NUCA 1J8IA 1MIUA 1PFMA 4JI5Q 1BCPF 3I90A 1BCPB 1IBKL 1B53A 3AFQA 4GKKQ 1PH5A 4DA2A 1I5FA 3J81L 2RA4A 1UEAB 4JBWA 4QIWE 5AJ3Q 1X9NA 1EZ8A 1LTRD 2A68C 1L1OC 2XIWA 1WTVA 1BO0A 2NTTA 4DK3C 3CMEA 3KBGA 2N88A 1N9WA 4DR5Q 4OWTB 3OMCA 5COYA 3Q24A 1VQHA 4AQYQ 4K2LA 4UHVA 4IFDI 4LFBQ 3CQZB 5IT9E 3OIPA 2F4IA 3KJPA 4Y52H 4NMZA 2L11A 4M1UB 4JI7L 3KLRA 2PQAB 1DYQA 1KAAA 5JPMC 2R93G 3HOUG 1QUQA 5C0XI 2QDBA 4ILWA 4GLAC 1HTPA 4JI8L 2WIIB 1EOTA 3R3OA 1Z47A 3R93A 2F03A 2K32A 2R61A 1JICA 2O2LD 3A56A 1N33Q 3H94A 5CV5A 3GTLH 1OXVA 2YYZA 5JAVA 1HPCA 4GLXA 1MD2D 1MSGA 1HFNA 2YU9H 1VMPA 3GTOB 3S17H 4XT3B 4RAUC 1LYLA 2JSOA 3BVGA 3I4NG 2ZXOA 2YTYA 3DM1A 1HR0W 3H91A 3NHHA 1EEFD 2RSNA 2WAQG 2FMMA 1TWHB 4CGYB 2PMZE 4LJZC 1QCBD 5IYDG 2VW9A 2M9VA 4G57A 1A0IA 4O2DA 4LF8Q 2B2WC 1IBML 4RFBA 4KN4C 2KHSA 4ZLTF 2MPMA 1LM0A 4NKLA 2JK8A 1SE8A 1PRTF 4C1NK 4KKTA 5D65A 3JC66 4NXMQ 4IFDH 2E5LQ 1YEZA 2OCEA 2E76C 4MZ9A 1C8CA 1TS5A 5C44B 4LUZA 3F1ZA 4A3KG 4RWSC 1CKNB 2VY3A 1DOKA 1M4VA 4P74A 5C0XH 1TY2A 3QWNA 4A3CH 2VQFL 1YHQA 3PF4A 2NVTB 4N9TA 4X66L 1SE2A 1L1OA 2I5HA 3JAML 3KLSA 1C4QA 3EIVA 2B39A 4LK1C 1SNQA 2SDFA 1X3GA 4DV6Q 1ILPA 5G3LF 3VR3A 5M5XB 3HOWB 4X64Q 4HN7A 3CCMA 4IUNA 4HMIA 1F2YA 4TVAB 2KEEA 1KD1C 4QY7A 4RGTA 4HJ8A 5KRUA 1HUNA 1Z7TA 4BWGB 4DR3L 2Z1CA 4ZQ3A 1VQFA 3DM3A 1GVPA 5CMDA 4B08A 3BG3A 3GTQH 1YZ6A 4QCLA 4Q5VA 2N78A 4DV4Q 2F0UA 2KENA 2MQHA 1HXYD 2F0TA 5BR8Q 1B3AA 4UPAA 1ET6A 2SEBD 2Z0SA 4LAAA 2WACA 3AU7A 3I56A 3RLFA 3LNNA 1B3QA 1VQ6A 3P7JA 1QILA 4A3FB 4LFCQ 2WKDA 4P2CB 3Q8DA 2I46A 1T5EA 1R9TH 2K14A 2QKIC 1Z6HA 2EYJA 1EIHA 2B2UA 4DAPA 1M1KC 5C4XG 1I3QH 1O7LA 2OWOA 1UE5A 1TKWB 4KI0A 1V1QA 2UU9L 4K2KA 1HH2P 3TS0A 4DAVA 3W5OA 4X65Q 4C3HG 5CV6A 4CHTB 3KDFA 4X6AH 1EYDA 1TVXA 5ISRA 1X3QA 1IKMA 5LMNW 2XVSA 3J81i 1VQ9A 5IGBA 3I4MB 1F2LA 3D8GA 1T9HA 1XX8A 4KJOA 1JWUD 5J22A 4DV0L 1SR3A 1CA5A 1JT8A 1K0SA 2EPBA 2R92B 4DNTB 2F0DA 4OX9L 4R1JA 2ICEC 5FLXE 1G6ZA 1Q81C 1CHQD 4L5SA 1G2SA 2FJ2A 3MWYW 3W1BA 2IJ0A 3H0GH 2WINB 3J7A5 5EPJA 1TWAB 3CP0A 5E7NA 2GA4B 3UI2A 2JJQA 1STEA 5FK9C 1A3UA 2HIVA 4C56C 4PMWA 3TP7A 3V96A 4K8IA 1EZ6A 2UUBQ 2EY5A 3PUZA 3OTOQ 2AQ1B 4F88A 2B63B 3HZXA 2KVMA 4B3TQ 3I8ZA 3DWAA 3CC7A 3SK4A 2WFWA 2JEAI 3DEOA 2EY6A 3UDXA 1NCVA 1WYDA 4KHZA 2GVAA 2F4VQ 2BDNA 3DLLA 4ME5A 5FO9B 5C44G 4HMJA 1QVFA 4IURA 4YCWA 4JI3L 1YBYA 1C9OA 3VYSA 4LF9L 4DV3L 3T51B 3HKSA 3S17B 3K5MA 4YHHL 1IBKQ 2J4XA 1H9SA 2XWJB 2Z6BA 3CCUA 4L5RC 3NE5B 3M3YH 2YTVA 4JBKA 4I65A 4HSPA 3U58A 2PCFB 1E2WA 4C3JH 4CDEC 5FLMH 3ZJYC 2RDHA 2Z6KC 1X3FA 4PQXA 2A8VA 5JJKA 1M8AA 1QG7A 5IT9c 3KF8A 3QOJA 2QEJC 3JAMi 1ESFA 3P1HA 4JI7Q 3TDQA 4KN7C 3NENA 4QQBX 2DJFC 4ZUJA 4N8FA 3QO2A 2EDGA 2K5DA 3AMUA 4JI8Q 3T1YL 1W3SA 3PIPA 1PZJD 4A93H 2FMCA 1SMYC 1EY4A 1GXDC 1KABA 3NELA 3A5ZB 2A69D 3S1MB 2KQ3A 4P71A 4AIMA 1TXYA 1BOSA 4OO1G 2F0HA 3D4DA 4KTAA 1NBWA 1JR0D 3NTIA 1VQCA 3SEBA 2PO4A 5IGEA 5JJIA 2QEXA 4A3FG 1O78A 1F9SA 2N8NA 1EIGA 2ZTEA 3MC0B 3L0OA 4NW2A 4DNIA 1FYCA 1SYEA 3U4ZA 3L3OC 1M90C 4ZUIA 3R2IA 2ZJRA 2N3SA 1IBMQ 2TSSA 4RGOS 4L8JA 4YWMA 4QIWB 5I9PA 5EGTA 4DK6C 3PCOB 1SYBA 3M4PA 4AYBE 3I4MG 1SRUA 3S2DB 2VXWA 1BBWA 3CCQA 2PZUA 4WORA 1UE1A 5TSSA 3VDYA 4K8JA 4A3DH 1JOQA 2R92G 5KNBA 1HZ9A 2VQFQ 2CFMA 1KDBA 3E0JA 1EY5A 4X66Q 1D6EC 2X6LA 3J81E 3B6YA 1U4RA 2L4NA 1I3QB 4GKJL 4LF5L 1RF2D 3PUYA 4IUUA 3TP5A 1HCZA 1F9RA 2B8FA 2KBNA 1QNUA 3OWFA 2WB1E 2JA5H 4KY6A 3EBEA 4DR3Q 1WJJA 4RHSA 4F87A 1V1PB 1CSPA 2H4OA 3D6WA 1GD7A 4IPCA 3S16H 2PMZB 4OIJA 1VQIA 2JA8H 5M5WH 3KFUA 4PMBA 3OW2A 2R7DA 4RGMA 4WJ3M 1SYFA 1K28A 1KQSA 1A2UA 3GTKH 2NTSA 3H0GB 3IFDA 2KCTA 3TEHB 1PYSB 3OIQA 4DV7L 3GTPB 4XIGS 4CBVA 1HQRD 2UU9Q 3C46A 2RVLA 2X69A 1FD7D 1D1IA 1VQLA 1MJCA 3TS2A 5EKLA 1EU4A 2FHTA 3A54A 2A6HC 2FINB 4IFDG 3NPPA 4MTKA 4EVOA 2EYFA 5ELFA 1KHIA 4JK1C 3I70A 1OXSC 1XPUA 1ILQA 5ELNA 3VR5A 1RIPA 3S15B 4O1NA 3ICEA 4DV0Q 4JI2L 4KHVA 4OX9Q 1HHVA 5FLXc 5C0XG 4A3CG 4DAYA 1I94L 2M2LA 1K8GA 2KHJA 3IFTA 3MXNB 3JAME 1H9KA 4XYQA 3HRZC 2ZTCA 3M3YB 2VNUD 1BCPD 5GROA 3L7ZC 4DK0A 3WWVA 3Q23A 1XNRL 3K8AA 3R8BA 3WDNA 3PF5A 3EVQA 5I6WA 4A3EH 3QOLA 1TWFH 4CKEA 4E6IA 3Q22A 3SDZA 1I6VC 1TWGB 3K7UC 2KCMA 4A3IH 2E2JH 1RKNA 4LNQA 3G6JB 2R93B 1VQJA 1F9QA 1TY0A 1SMXA 1YJ9A 1VQGA 1WFQA 4WJ4A 1HNXL 3QB3A 4DR4L 5EKKA 1WOCA 3QJYA 4A93B 2NBFA 1UEBA 1B9MA 4DR7L 4JI3Q 2JEBI 2BA0A 1YNJD 1SEBD 1EIYB 4LF9Q 2CH4A 4DV3Q 1F2ZA 2O4XA 1Y14B 3CPFA 5IOCA 3M85A 1V1OA 3EQLC 4HR7B 4YHHQ 3G6EA 3LX0A 1SYGA 4N9PA 2Q8TA 2WAQB 1PH8A 2J0TD 2SNMA 4A3BH 4RGNA 1D1KA 3U9SA 1EY7A 2TMPA 4IJLA 5KNDA 2JN4A 2L55A 1E1OA 2OQ0A 1K8AC 4N8X1 1B1ZA 4GN5A 1KNAA 1TU2B 1EYGA 4V0BA 2L12A 1U4LA 4PZ7A 5FJ8H 1XYIA 2IX1A 2F0GA 1PH4A 3WOEA 3DEPA 5A35A 5GAHC 4KKUA 2GN5A 3T1YQ 1C7YA 4A3DB 1E1TA 4GLVB 1SN8A 2LY7A 1WTQA 2F0EA 3MAQA 2B2YA 1GUGA 5DAUA 3S2HH 3BZCA 3IKJA 5E4WC 3FKIH 1PMRA 1WTRA 3H0GG 1A3VA 1XMOL 2MO0A 5HURA 3UE1A 5KNCA 3OOCA 1JJ2A 1OTCA 3SK8A 1ZYRD 4XYOA 2IW3A 4IJHA 4HCSA 1VQPA 3GTJH 2C35B 3CXCA 2M00A 1BBUA 3A8KE 3TN2A 5JEAH 3F2BA 2L15A 2JA5B 4JBJA 3FPUB 2O5IC 4TRDA 1JORA 2ALYB 1BDOA 2ID0A 2K4KA 1ENCA 2R6GA 4KJNA 3S16B 1EIFA 1IZ6A 5EKIA 1PLFA 1KTKA 5M5YB 2RF4A 3Q0AA 5M5WB 1E2VA 1KNEA 1HRJA 1HNWL 2AQ3B 1I6HB 3HOVH 2A1AA 3DWPA 4A3MB 2HT1A 4UAIA 1MJEA 4EQNA 4OWWB 4OEMB 4POFA 4JG2A 3G7LA 3X3MA 3J81c 1FVIA 1XPOA 5E3FA 2JA6H 5C4XB 2HHHQ 1Y8OB 4A3LH 3MA2B 3CC4A 2JXMB 2DY7A 2E75C 2BE5D 3C1EA 5FLMG 4IALA 4GKJQ 4C3HB 4LF5Q 3E9IA 4X62L 3M4OH 2HIXA 1Q90A 1SYCA 4DV5L 2B29A 1QE6A 2DNEA 1IL2A 1NSNS 2K33A 3CCVA 2IY5B 1DXMA 2RCFA 1E22A 2XSCA 2J7ZA 4ME3A 5DLQE 1B8AA 1V8QA 4S3SA 1VQ5A 4WFN3 1KL9A 2EQSA 5IGGA 4A93G 2Q2HA 2WKCA 4I7AA 3HOZH 2OT2A 2FFKB 4L6TB 4L5QA 1CK1A 3K5NA 3CMAA 2KOLA 3SXHA 2PI2A 2CQOA 4V190 4AYBB 1KDCA 1CZGA 1FNWA 4OL7A 4IPDA 1YVCA 1A63A 1VS0A 4P73A 4DV7Q 4BA2I 2IT1A 1SJHD 2NVXH 2UUCL 4DFAA 3NBHB 2MO1A 2EXZA 3J80L 4A3IB 2F3VA 2E2JB 1A62A 3U4VA 2CHBD 4EQ5A 2EYPA 2B2UC 1I4HA 4LUOA 1PZID 1MKHA 3TP8A 3GTGH 3QIAA 3K0XA 4ZRZA 2B3GA 3CCSA 2A68D 3W2DA 1S72A 2K04A 1TIID 1LLRD 5D3DA 4GNXA 3T4AC 1U5KA 2Q2IA 4HJAA 4JI2Q 4K5VA 4QGUA 1F77A 4A3DG 2WB1B 3RR5A 2LXKA 3JAMc 1I94Q 2Q8IB 1O80A 1WTXA 4RCOA 3QR8A 3EROA 2KUMA 4TKOB 3BYTB 2F0NA 3KF6A 3CW2C 5KYIA 2RDGA 4LW1A 3SHLA 1XNRQ 4A3BB 1ML0D 2KECA 1S5BD 1PTOC 5IWAL 2CW0C 1EY6A 3TMEA 2LKVA 1K9MC 2F0OA 3F2UA 3C1FA 3GP7A 1X56A 2D62A 1FGBD 2A74C 2NUCA 1XNQL 2EVBA 2MGSA 2JA5G 4QB4A 1SNCA 4M8AA 3STBC 4BXXH 1PTOH 4A3JH 2IHFA 4R4OA 4BY7H 4TQUS 1NR2A 2ATWA 1A15A 2VL6A 5IP9H 3E9HA 1HNXQ 1HA5A 4DR4Q 1G6PA 2JA8G 2XN9C 1U4PA 3NXWA 3D4WA 4DR7Q 1U0LA 5J3BA 5I2XA 2V1CC 4RA8A 1S5ED 4A3MG 1I4QA 2L1BA 3FKIB 2XRSD 1RHPA 4K14A 1KC8C 5CV8A 3S1NB 3OWEB 4IOAA 3E6ZX 2F3IA 1WTOA 1L0XB 4NB3A 1JE4A 1QUQB 1CT1D 1WTWA 2PNHA 1K83H 2QW7A 1Q8KA 4FVMA 3ULLA 4K0KL 1UE6A 2EZVA 1CZWA 3W1GA 3D0FA 2PW7A 3PIP3 4CKCA 3BDOA 2DUDA 2XTIA 1CA6A 3H6MA 4DGZA 2A19A 1IHZA 3I4LA 3IRBA 2K7VA 3BYYB 1E3PA 3U50C 5C3EH 1G51A 2Z8LA 2XWBB 1TWCH 3T16A 2KEDA 1EWIA 4IUTA 4NXNL 1S5FD 4K5WA 2HD3A 2MHVA 2RCNA 4KD3A 2AKWB 2A6EC 4C3IH 2JA6B 1Y1VH 4MNOA 1XMOQ 4UP7A 4AYBG 4HCEA 1DCZA 2L9HA 2I0QA 5C4HA 3NWTA 3ND8A 5CORA 3CHBD 3HEJA 4A3EG 2F0KA 4ZKCB 3PO2H 3M4OB 1GKHA 1K8MA 1JC7A 4A3IG 2D0OA 1L1OB 3J81j 4XXEA 1UUPA 1H9JA 3H3VH 2ASBA 1RCVD 2UXCL 1ESRA 1PHJA 1S40A 1PVOA 2A73B 1K3RA 3GTLB 4O0AA 1E24A 1HNWQ 3J80i 2DY8A 3RUZA 1CFMA 4DR6L 1AW7A 1B50A 2YU9B 2WB1G 2QF7A 2A69C 1IBLL 1D8LA 1GUNA 4OGQC 1LTAD 3KYHC 2AWOA 1LTGD 1PA6A 4IUVA 2CQAA 1Z9FA 1E7ZA 4RMFA 2NVXB 2HUGA 4HJ9A 1UE7A 1BXTA 3I3CA 4A3BG 3R2TA 5M3FH 4F7XA 3FDTA 5CC4A 3SK5A 1X6OA 4X62Q 1SDFA 3GTGB 1P8LA 2E2HH 4HTHA 4CJ0B 4PZ8A 4DV5Q 3D31A 3S14H 1MBYA 4DU9A 4QUFA 5FJ8G 1JOKA 3DUZA 2VUMH 5A2QL 1X65A 3H09A 5C3WA 4DN4M 1GUWA 5C4ZA 3J7YW 4WJWA 3KDFB 2AHOB 1PFNA 5ELDA 2VB2X 1OO9B 1TS4A 4C1NI 3FKIG 2EY1A 4FF3A 2ZT9C 4LUVA 1O7ZA 2NN6H 4YCVA 3AEVA 2BH8A 2VZAA 3BS1A 5GADC 1CSQA 1KXLA 4RG1A 3G4SA 2ES2A 4EQPA 2CWPA 5BN4A 1YJNA 2UUCQ 2BH2A 3K81C 5J39A 1DOMA 1IYUA 5JEAG 1Y8NB 1B2TA 1PXUA 1SNMA 3GTQB 1LTBD 1EWHA 3C2PA 1BUVT 1PTOB 4A3JB 4BY7B 1PYBA 2D0PA 2YV5A 2PW5A 3MEFA 3I91A 4R8NA 4LF7L 3ULPA 5IYDH 1Y8PB 4J1MA 3CRKC 4GN4B 3CPWA 4MIUA 1YIJA 3HOYH 4MN3A 4TSSA 2AQ2B 2QILA 3D3RA 5EPKA 1PYWD 1IW7C 2JYOA 4X3TA 4KK7A 2IPKD 1HR0L 1R9TB 2HHHL 1FJGL 1FNVA 4A3GH 3A74A 3A55A 5LL6X 2JA6G 1HTLD 1VDZA 3RZOH 4A3LG 1K83B 1I4PA 1EU3A 1R4PB 5IWAQ 1VQAA 2N55A 1IYVA 2NVYH 4J15A 3RNUA 2VB3X 4PG3A 1VQKA 1XNQQ 3KLSX 1EEID 3NSWA 1RTNA 1J5EL 1H9SB 3MXUA 1EOVA 4DR2L 3M4YA 3K57A 1LTID 1XMQL 5JVH3 5ELCA 1A8VA 4L5TA 4H13C 1UWVA 4R4TA 3GO5A 5CV9A 3NEMA 1PH6A 3CD6A 2C5CA 1SROA 2HDLA 2KA7A 3KF8B 3HOZG 5C6AA 1XPRA 1NNXA 4JI6L 2K6AA 4YWLA 4K6DA 4HIMA 1XJVA 3HOXH 5I9OA 1JQYD 4ZK9B 1BCPC 1CHPD 1EFWA 2AUKA 3A7AB 3TBIB 3T13A 4LMQD 2RDFA 4P72A 4KHPL 3PO2B 3U9OA 2K5WA 3J80E 3UDFA 2ZXPA 2UUAL 4K0KQ 3F8TA 2Z9HA 1Q7YC 4LF6L 1STBA 3HKZE 3VR4A 4IPGA 2IHEA 1L0YB 2OTJA 5I6YA 1W2BA 4L63B 2L5TA 5DNFA 3ND9A 4LFAL 5IYCH 5HY6A 4BS9A 1F9PA 1KRSA 3GQBA 1DONA 2YTXA 1BF4A 4G7ZC 2NZHA 5IGCA 2F0MA 2MP1A 4Z9CB 4KY7A 4X3UA 1XXGA 2OQKA 3GTMH 1YNNC 4NXNQ 2UXDL 4KD4A 3PUXA 4H0LC 3S1RH 2D5DA 1SE4A 3FP9A 3OPOA 2NWGA 4OWXB 4IOCA 2QA4A 3SGIA 2PI2E 2LXJA 1GJXA 4C3JB 2B2YC 4NP5A 4HJ7A 1D2BA 4HEDA 1KRTA 4A75A 5CV7A 5M3FB 3FVQA 3M9BA 3M7NA 3FMCA 2BDOA 1AFPA 2NYZD 1Q1EA 5KEEA 5ELBA 4GOPA 3L2PA 2E2HB 3Q6SA 5LMNL 5AFWA 3TZDA 4AH6A 1VMCA 3LGJA 3GTOH 1C48A 1JE5A 1CTMA 4JI0L 1TS2A 4A3JG 4BY7G 2VUMB 3BZDB 1PRTC 1STNA 1VQ8A 4ZCKA 1ICWA 2UXCQ 1CQVA 5IP9G 1X3EA 1HZAA 4UP9A 3CCJA 4PMCA 1SNPA 5IY0A 1ZEQX 4DR6Q 1X32A 2A6HD 4IQZA 3K59A 2F0WA 5IP7H 4HJ5A 1VQNA 3S1QH 1IBLQ 1UNSA 3BU2A 3MHBA 5DM63 4YIJA 1SYDA 2F0SA 5C44H 2JA7H 2F0FA 3ER0A 3GV6A 4Y7NH 4A76A 2B2VA 3CC2A 3NQIA 1JOOA 5I4DA 3RZDH 2F0QA 3KJOA 2Q8RE 3H15A 1WD0A 3KBXA 1PFBA 5M3MH 2PQAA 3KOJA 3C3LA 4NPSA 1WTHA 1RJTA 2R7ZH 1SFOH 1N34L 2MUYA 5M5XH 3J7ZC 1Q12A 3HOWH 5C3EG 4ULLA 4G4KA 1HQMC 3CCRA 4FXKC 1QVCA 3V05A 1EQQA 1B44D 4IFDJ 4DXFA 1AN8A 2RKSA 1G91A 1D5XC 2HCIA 4C3IG 4A3GB 4FP5D 1Y1VG 3ERQA 3TREA 3V2TA 5EPLA 4F8MA 3NTHA 3CF5A 2K52A 5C0XJ 1HFGA 1N32L 4BBRH 1TQOA 2BE5C 3PSIA 4R4QA 2NVYB 3PO2G 3RD4A 5H1SE 3GDEA 4UP8A 4DAYB 4OO1H 1STGA 2G9DA 1FR3A 3AB9A 2F0JA 1Y1WH 1B4OA 3K80C 4PNYA 3LWEA 4J6HA 4R4CA 5IYBH 1JB7A 1JMCA 2RBMA 1LUZA 2EJGC 1GM5A 3DXJC 1P16A 2EJFC 2JA8B 1CKNA 4B3SL 4LF7Q 4KV6A 4H44C 3FPPA 3AFPA 3BDCA 3TQYA 1QJOA 4OHJA 3GTKB 4FNFA 4GNXC 1RTOA 4HIOA 2QCPX 3HOXB 3HFZB 2IWHA 5JOBA 2DNCA 1HR0Q
chains in the Genus database with same CATH topology
2SNSA 1DZ1A 1TR5A 2JP1A 4ID6A 2KCCA 1I4RA 3O13A 1LT5D 3LWUA 4C3JG 1STHA 5KYLA 2WP8J 3GV3A 5CGKA 2NZ1D 1MGSA 3L9AX 2EYOA 1LT6D 2PNRC 3A8JE 2IX0A 3MXPA 4FXGC 3VA7A 4XQNA 1MSHA 2EYHA 2PZTA 1IKLA 3P75A 5A2QE 1FNUA 2ICIA 4U673 3J7AF 5BN3A 3GTMB 2E2DC 2OXPA 1W6KA 3ZYYX 3S1RB 4MHEA 1TS3A 3RMHA 4EQOA 2NN6G 1SJED 3FRPB 1D5MC 4K6LA 2EJMA 4A3EB 1LT4D 1TWFB 3EA6A 2F0VA 3MZ5A 1SAPA 1EQTA 1R4QB 5K36H 4DXGA 3PMFA 1S5CD 5IIFA 2B2TA 1CQFA 1AEXA 2H1EA 1EYAA 1VF5C 3WOFA 4FF4A 3I73A 5BN5A 1BQQT 4KKSA 3TZUA 5JPNC 3S1QB 1PRTB 1XTCD 1F2MA 4O42A 1H9MA 4B9XA 2C9OA 5FOBB 2JA7B 4Y7NB 3MTSA 1LV9A 5LL6S 3NUCA 2HCCA 5CV4A 3RZDB 1EQVA 5M3MB 1BR9A 2XRQD 2R7ZB 1SFOB 1H9RA 3PIO3 4K5XA 5E4XA 3PUVA 5CR3A 4ODGA 3VYUA 4KY5A 5EJWA 1A2TA 1DOLA 3HKZB 1EFID 2XNAC 4PV1C 5LHY1 2EYLA 3S2HB 1ZXTA 3NTKA 2K03A 2CVRA 1OXUA 2OF1A 3D4RA 3MFYA 1A6XA 4BBRB 1WVLA 3GTJB 5IGFA 1STAA 2IX3A 2WV6D 1Y1WB 2B2WA 2F0LA 2BA1A 4QUCA 1PTOD 2CW0D 3HGBA 3E5SA 5C5MA 3HOVB 1S5DD 3CRLC 1OXTA 2L0CA 5EBDA 2F1MA 1NAPA 5CYUA 4XTCS 2MJ8A 3KK7A 3OHXC 1GUOA 3H3VC 1ONLA 3NBIA 4ZKBB 4RKLA 3T53B 4FF2A 2AWNA 4B9WA 1CI3M 4CKBA 1I50B 1ZKOA 4BBSB 1W6JA 5HGTA 1SXTA 1GUTA 1QWYA 2PYKA 3HOZB 2EE1A 2NN6I 3W3AA 3BDLA 5T1IA 1HA6A 5FKAC 2ZXRA 5JJZA 4C2MB 3MVVA 1J9OA 4IUQA 2E74C 2D2CC 1V43A 1EL0A 4XQJA 4RCNA 2A6ED 1Y69U 1V1PA 1TT2A 5M9OA 3PV0A 4G7HC 2F0IA 2EY2A 3CU7A 3IL8A 5IT9L 2K05A 3T56B 1O7YA 4KMUC 3K58A 3VYRA 2PQEA 1BBXC 1Q1BA 1JCKB 1DJRD 1SE3A 4Q0FA 5KIXA 5EQ0A 3NK9A 4ZYSA 1STYA 4H7BA 1VF7A 1PZKD 1U9RA 5FO8B 4U68A 3N6RA 4BY1B 3NP8A 4FYDA 2RSOA 1PTOF 4FF1A 1LABA 5C4JB 1DD2A 3SVMA 2EOTA 3OMGA 1SBBB 3MXNA 2X6GA 1EY8A 1I4XA 1CM9A 1KLUD 4RH6A 1LO5D 3A7LA 5DEHA 3VR6A 1SMYD 3A8IE 3KUPA 1RODA 2R3ZA 4X3KA 1IL8A 4NDXA 1QB5D 3K7AB 3VR2A 1II3A 4XQQA 5ELEA 1RD9D 2BCOA 2LS01 3IAYA 5IODA 3PO3B 2Y0SB 4R8IA 3OW7A 2PPBC 5C3EB 3EFXD 3K5LA 3CKIB 2F3WA 1TWCB 2O5JC 5T1GA 1K8OA 5KGUA 4C3IB 5D14A 1Y1VB 4UDUC 3SR1A 5IGDA 2Z4HA 5JVG3 4XDXA 1JB3A 2K28A 1XWEA 3K6OA 3K5OA 4X3SA 1LTTD 3ITPA 1GUSA 1IW7D 1QOHA 1WCMB 2KCNA 5EBCA 3DHQA 2JE6I 4G7OC 2B2VC 1ET9A 5K36G 4IZ8A 1AP0A 2AUJD 4CJ2C 3NQTA 5CBEE 2I07B 4XT1B 5C5LA 2V4DA 3N52A 4WRDA 2HQEA 5JEAJ 2G9HD 2LMCB 1SNDA 4DF7A 4QMGA 2D9UA 1YNJC 1S4ZA 1ENFA 1A3TA 1OXXK 3HP3A 3NWSA 3ONAB 4BA1I 3VA5A 5K5PA 2IL8A 2K01A 5F2DA 2K5QA 2NB0A 2OEOA 5FLXL 4ZAIA 3DWQA 1UAPA 2SOBA 1Q8IA 3S14B 4DK1A 2EYMA 3VYTA 4EGVA 1MI2A 1QNKA 1G8ZD 1NR4A 4FO2A 2Z4IA 3SK6A 1SNOA 1U4MA 4ABNA 1WTPA 3DMUA 2PZWA 3BVMA 1DM0B 3HOUB 3QG1A 1D5ZC 1GOZA 1JWSD 4FXDA 3D6CA 2F0PA 3K0YA 4OO1I 4OIKA 3OSOA 1ZYRC 1SSOA 1YNND 3GD7A 2E2IB 1T5XD 1LT3D 3HS0C 1AZQA 4GZYC 5DM73 2K1BA 2DN8A 3I4NB 1EY9A 1KDAA 3P20A 4DNRB 1G2TA 5C3XA 3S9WA 3TSSA 4IUPA 1AZPA 3HOYB 3FEWX 3X3NA 5FO7B 1WD1A 1KLGD 1PRTD 2LFNA 1PDQA 4A3KB 3RZOB 1LACA 1Q3LA 3URYA 4I7ZC 3NBHA 3I72A 3J7AV 5I2YA 1VCIA 1X3PA 2HDMA 4HAEA 4RHRA 4QF4A 1E0BA 1ENAA 3EJIA 1GHJA 1I4GA 1EWCA 1LTSD 2A5HA 3MEHA 3HG9A 1G291 2KJXA 2RQXA 5G3LD 1EY0A 2NVQB 4RKBA 5D3IB 2B2TC 3MFGA 1E2ZA 3MXGA 3SE0A 2B8GA 4CJ1B 3PUWA 5J1ZA 3TP6A 1B9NA 1NUCA 3M7GA 2ENBA 3BVZA 1JWMD 2BOSA 4J8QA 5E1FA 4HSVA 1EYCA 5CBAE 1HUMA 1BNZA 1RDPD 4IN3A 4R9WA 1GHKA 5NUCA 1J8IA 1PFMA 1BCPF 3I90A 1BCPB 1B53A 4DA2A 3J81L 2RA4A 1UEAB 4JBWA 1EZ8A 1LTRD 2A68C 2XIWA 1WTVA 1BO0A 2NTTA 3KBGA 2N88A 3OMCA 5COYA 3Q24A 4K2LA 4IFDI 3CQZB 5IT9E 3OIPA 2F4IA 4NMZA 2L11A 4M1UB 3KLRA 1DYQA 1KAAA 5JPMC 5C0XI 2QDBA 4ILWA 1HTPA 2WIIB 1EOTA 3R3OA 1Z47A 3R93A 2F03A 2K32A 2R61A 1JICA 2O2LD 3A56A 3H94A 5CV5A 1OXVA 2YYZA 5JAVA 1HPCA 1MD2D 1MSGA 1HFNA 1VMPA 3GTOB 4XT3B 4RAUC 2JSOA 3BVGA 2ZXOA 3DM1A 3H91A 3NHHA 1EEFD 2RSNA 2FMMA 1TWHB 4CGYB 4LJZC 1QCBD 2M9VA 4G57A 2B2WC 4RFBA 4KN4C 2KHSA 4ZLTF 2MPMA 4NKLA 1PRTF 4C1NK 4KKTA 5D65A 4IFDH 1C8CA 2E76C 1TS5A 5C44B 4RWSC 1DOKA 1M4VA 5C0XH 1TY2A 3QWNA 2NVTB 4N9TA 1SE2A 3JAML 3KLSA 1C4QA 2B39A 4LK1C 1SNQA 2SDFA 1ILPA 5G3LF 3VR3A 5M5XB 3HOWB 4HN7A 4IUNA 4HMIA 1F2YA 2KEEA 4RGTA 5KRUA 1HUNA 1Z7TA 4BWGB 2Z1CA 4ZQ3A 5CMDA 4B08A 3BG3A 4QCLA 4Q5VA 2F0UA 1HXYD 2F0TA 1B3AA 1ET6A 2SEBD 4LAAA 2WACA 3AU7A 3RLFA 3LNNA 3P7JA 1QILA 4A3FB 2WKDA 4P2CB 2I46A 1T5EA 2QKIC 1Z6HA 2EYJA 1EIHA 2B2UA 4DAPA 1O7LA 1TKWB 4KI0A 4K2KA 4DAVA 4C3HG 5CV6A 4CHTB 1EYDA 1TVXA 5ISRA 1X3QA 1IKMA 2XVSA 5IGBA 3I4MB 1F2LA 3D8GA 1XX8A 4KJOA 1JWUD 5J22A 1CA5A 2EPBA 2R92B 4DNTB 2F0DA 2ICEC 5FLXE 1G6ZA 1CHQD 1G2SA 2FJ2A 3MWYW 2IJ0A 2WINB 5EPJA 1TWAB 2GA4B 3UI2A 1STEA 5FK9C 1A3UA 4C56C 4PMWA 3TP7A 3V96A 4K8IA 1EZ6A 2EY5A 3PUZA 2AQ1B 4F88A 2B63B 3HZXA 2KVMA 3I8ZA 3DWAA 3SK4A 2JEAI 3DEOA 2EY6A 1NCVA 4KHZA 2BDNA 4ME5A 5FO9B 4HMJA 4IURA 3VYSA 3T51B 3S17B 3K5MA 2J4XA 1H9SA 2XWJB 3NE5B 4I65A 4HSPA 2PCFB 1E2WA 2RDHA 4PQXA 1M8AA 1QG7A 3KF8A 3QOJA 2QEJC 1ESFA 3P1HA 3TDQA 4KN7C 4ZUJA 3QO2A 2EDGA 2K5DA 3AMUA 1PZJD 2FMCA 1SMYC 1EY4A 1GXDC 1KABA 2A69D 3S1MB 2KQ3A 1BOSA 4OO1G 2F0HA 3D4DA 4KTAA 1JR0D 3NTIA 3SEBA 2PO4A 5IGEA 1O78A 1F9SA 1EIGA 3MC0B 4NW2A 1FYCA 1SYEA 3L3OC 4ZUIA 3R2IA 2TSSA 4RGOS 4L8JA 4QIWB 5I9PA 5EGTA 1SYBA 3S2DB 2VXWA 2PZUA 4WORA 5TSSA 4K8JA 1JOQA 5KNBA 1KDBA 3E0JA 1EY5A 1D6EC 2X6LA 3J81E 1U4RA 2L4NA 1I3QB 1RF2D 3PUYA 4IUUA 3TP5A 1HCZA 1F9RA 2B8FA 1QNUA 3OWFA 4KY6A 4F87A 4RHSA 1V1PB 2H4OA 3D6WA 2PMZB 4OIJA 4PMBA 4RGMA 1SYFA 1A2UA 2NTSA 3H0GB 3IFDA 3OIQA 3GTPB 4XIGS 4CBVA 1HQRD 3C46A 2RVLA 2X69A 1FD7D 1D1IA 5EKLA 1EU4A 2FHTA 3A54A 2A6HC 2FINB 4IFDG 3NPPA 4EVOA 2EYFA 5ELFA 4JK1C 3I70A 1OXSC 1ILQA 3VR5A 3S15B 4O1NA 4KHVA 1HHVA 5C0XG 4DAYA 2M2LA 3IFTA 3JAME 1H9KA 4XYQA 3HRZC 3M3YB 2VNUD 1BCPD 3L7ZC 4DK0A 3Q23A 3R8BA 3WDNA 3EVQA 5I6WA 3QOLA 4CKEA 4E6IA 3Q22A 3SDZA 1I6VC 1TWGB 1RKNA 3G6JB 2R93B 1F9QA 1TY0A 3QB3A 5EKKA 3QJYA 4A93B 2NBFA 1B9MA 2JEBI 2BA0A 1YNJD 1SEBD 1F2ZA 2O4XA 5IOCA 3M85A 1V1OA 3EQLC 4HR7B 3LX0A 1SYGA 4N9PA 2Q8TA 2WAQB 2J0TD 2SNMA 4RGNA 1D1KA 3U9SA 1EY7A 2TMPA 5KNDA 2L55A 1B1ZA 1KNAA 1TU2B 4V0BA 2L12A 1U4LA 1XYIA 2IX1A 2F0GA 3WOEA 3DEPA 5A35A 4KKUA 4A3DB 2LY7A 1WTQA 2F0EA 3MAQA 2B2YA 1GUGA 5DAUA 3IKJA 5E4WC 1PMRA 1WTRA 1A3VA 5HURA 5KNCA 3OOCA 3SK8A 1ZYRD 4XYOA 2IW3A 4HCSA 2M00A 3A8KE 3TN2A 5JEAH 2JA5B 3FPUB 2O5IC 4TRDA 1JORA 1BDOA 2ID0A 4KJNA 1ENCA 2R6GA 3S16B 5EKIA 1PLFA 1KTKA 5M5YB 3Q0AA 5M5WB 1E2VA 1KNEA 1HRJA 1I6HB 2AQ3B 3DWPA 4A3MB 4UAIA 4EQNA 3X3MA 3G7LA 5E3FA 5C4XB 1Y8OB 3MA2B 2JXMB 2DY7A 2E75C 2BE5D 3C1EA 4IALA 4C3HB 1Q90A 1SYCA 1QE6A 2DNEA 1NSNS 2K33A 1DXMA 2XSCA 2J7ZA 1V8QA 4S3SA 4WFN3 5IGGA 2WKCA 2OT2A 2FFKB 4L6TB 1CK1A 3K5NA 2KOLA 3SXHA 4V190 4AYBB 1KDCA 1CZGA 1FNWA 4OL7A 4BA2I 2IT1A 1SJHD 4DFAA 2EXZA 3J80L 4A3IB 2F3VA 2E2JB 2CHBD 2EYPA 2B2UC 1I4HA 1PZID 3TP8A 3QIAA 4ZRZA 2A68D 3W2DA 2K04A 1TIID 1LLRD 5D3DA 3T4AC 4K5VA 1F77A 2WB1B 2Q8IB 1O80A 1WTXA 4RCOA 3EROA 2KUMA 4TKOB 3BYTB 2F0NA 5KYIA 2RDGA 3SHLA 4A3BB 1ML0D 2KECA 1S5BD 1PTOC 2CW0C 1EY6A 3TMEA 2LKVA 2F0OA 3F2UA 3C1FA 3GP7A 2D62A 1FGBD 2A74C 2NUCA 2EVBA 2MGSA 4QB4A 1SNCA 4M8AA 1PTOH 4TQUS 1NR2A 1A15A 1HA5A 2XN9C 1U4PA 3NXWA 3D4WA 5I2XA 4RA8A 1S5ED 1I4QA 2L1BA 3FKIB 2XRSD 1RHPA 4K14A 5CV8A 3S1NB 3OWEB 3E6ZX 1WTOA 1L0XB 1JE4A 1CT1D 1WTWA 4FVMA 2EZVA 1CZWA 2PW7A 3PIP3 4CKCA 3BDOA 1CA6A 3H6MA 4DGZA 1IHZA 3I4LA 2K7VA 3BYYB 2Z8LA 2XWBB 3T16A 2KEDA 4IUTA 1S5FD 4K5WA 2MHVA 4KD3A 2A6EC 2JA6B 4HCEA 1DCZA 2L9HA 5C4HA 3NWTA 3ND8A 5CORA 3CHBD 3HEJA 2F0KA 4ZKCB 3M4OB 1K8MA 1JC7A 4XXEA 1UUPA 1H9JA 1RCVD 1ESRA 2A73B 3GTLB 2DY8A 3RUZA 1CFMA 1AW7A 1B50A 2YU9B 2QF7A 2A69C 1GUNA 4OGQC 1LTAD 2AWOA 1LTGD 4IUVA 2CQAA 2NVXB 2HUGA 1BXTA 3I3CA 3R2TA 4F7XA 3FDTA 5CC4A 3SK5A 1SDFA 3GTGB 4HTHA 4CJ0B 3D31A 1MBYA 4DU9A 4QUFA 1JOKA 3DUZA 5A2QL 3H09A 5C3WA 4DN4M 1GUWA 5C4ZA 3J7YW 4WJWA 1PFNA 5ELDA 2VB2X 1OO9B 4C1NI 1TS4A 4FF3A 2EY1A 2ZT9C 1O7ZA 2NN6H 3BS1A 4EQPA 5BN4A 5J39A 1DOMA 1IYUA 5JEAG 1Y8NB 1B2TA 1PXUA 1SNMA 3GTQB 1LTBD 1EWHA 3C2PA 1BUVT 1PTOB 4A3JB 4BY7B 2PW5A 3I91A 4R8NA 1Y8PB 4J1MA 3CRKC 4MIUA 4MN3A 4TSSA 2AQ2B 2QILA 3D3RA 5EPKA 1PYWD 1IW7C 2JYOA 4X3TA 4KK7A 2IPKD 1R9TB 1FNVA 3A55A 5LL6X 1HTLD 1VDZA 1K83B 1I4PA 1EU3A 1R4PB 2N55A 1IYVA 2VB3X 3KLSX 1EEID 3NSWA 1RTNA 1H9SB 3MXUA 3M4YA 3K57A 1LTID 5JVH3 5ELCA 4H13C 3GO5A 5CV9A 2C5CA 2HDLA 2KA7A 5C6AA 2K6AA 4K6DA 5I9OA 1JQYD 4ZK9B 1BCPC 1CHPD 2AUKA 3A7AB 3TBIB 3T13A 4LMQD 2RDFA 3PO2B 3U9OA 2K5WA 3J80E 2ZXPA 1STBA 3VR4A 1L0YB 5I6YA 4L63B 2L5TA 5DNFA 3ND9A 4BS9A 1F9PA 3GQBA 1DONA 1BF4A 4G7ZC 5IGCA 2F0MA 2MP1A 4Z9CB 4KY7A 4X3UA 1XXGA 1YNNC 4KD4A 3PUXA 4H0LC 2D5DA 1SE4A 3OPOA 2NWGA 1GJXA 4C3JB 2B2YC 4NP5A 1D2BA 4HEDA 5M3FB 5CV7A 3FVQA 3M7NA 3FMCA 2BDOA 1AFPA 2NYZD 1Q1EA 5KEEA 5ELBA 2E2HB 3Q6SA 5AFWA 3TZDA 1VMCA 1C48A 1CTMA 1TS2A 2VUMB 3BZDB 1PRTC 1STNA 1ICWA 1CQVA 4PMCA 1SNPA 1ZEQX 1X32A 2A6HD 4IQZA 3K59A 2F0WA 1UNSA 3MHBA 5DM63 4YIJA 1SYDA 2F0SA 2F0FA 3GV6A 2B2VA 3NQIA 1JOOA 5I4DA 2F0QA 2Q8RE 1WD0A 3KBXA 1PFBA 3C3LA 1RJTA 2MUYA 1Q12A 4ULLA 4G4KA 1HQMC 4FXKC 3V05A 1B44D 4IFDJ 4DXFA 1AN8A 2RKSA 1G91A 1D5XC 2HCIA 4C3IG 4A3GB 4FP5D 3ERQA 3V2TA 5EPLA 4F8MA 3NTHA 5C0XJ 1HFGA 1TQOA 2BE5C 2NVYB 3RD4A 4OO1H 1STGA 2G9DA 1FR3A 3AB9A 2F0JA 1B4OA 4PNYA 3LWEA 4J6HA 2RBMA 2EJGC 3DXJC 2EJFC 2JA8B 4KV6A 4H44C 3FPPA 3BDCA 1QJOA 4OHJA 3GTKB 4FNFA 1RTOA 2QCPX 3HOXB 2IWHA 5JOBA 2DNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEQ X;  2QCP X;  2VB2 X;  2VB3 X;  3E6Z X;  2L55 A;  3TDQ A; 
#chains in the Genus database with same CATH topology
 2SNS A;  5GAG C;  1DZ1 A;  1TR5 A;  1FJG Q;  2JP1 A;  4ID6 A;  2KCC A;  1I4R A;  3O13 A;  1LT5 D;  3E0E A;  2H5X A;  3LWU A;  4C3J G;  2CCZ A;  1STH A;  4B3R L;  1BVS A;  3A5U A;  5M3F G;  5KYL A;  2WP8 J;  3GV3 A;  5CGK A;  2NZ1 D;  1MGS A;  3L9A X;  2EYO A;  1LT6 D;  2K5N A;  2PNR C;  3A8J E;  2IX0 A;  4JV5 L;  3MXP A;  4FXG C;  3VA7 A;  4XQN A;  1MSH A;  1I50 H;  2EYH A;  2PZT A;  1S3O A;  1TWA H;  1J5E Q;  1IKL A;  3P75 A;  4BBS H;  1FGU A;  5A2Q E;  4DV2 L;  4DR2 Q;  1FNU A;  1K0R A;  4R4I A;  2VUM G;  1XMQ Q;  2ICI A;  4U67 3;  2AMC B;  3J7A F;  5BN3 A;  2B63 H;  3GTM B;  2E2D C;  2OXP A;  1W6K A;  3T1H L;  2DJG C;  3ZYY X;  3S1R B;  2Q2T A;  4YWK A;  4JI6 Q;  4MHE A;  1TS3 A;  3RMH A;  1PH9 A;  3KLW A;  4C2M H;  4EQO A;  2NN6 G;  1SJE D;  3FRP B;  1CKM A;  2Y0S E;  2MFI A;  1D5M C;  4K6L A;  2EJM A;  4A3E B;  1LT4 D;  1TWF B;  3EA6 A;  3J80 c;  1JJG A;  4KHP Q;  3RLO A;  2VQE L;  2F0V A;  3MZ5 A;  2UUA Q;  4DR1 L;  1SAP A;  4LF6 Q;  1EQT A;  1R4Q B;  4CDD C;  3RN2 A;  2RHQ B;  5K36 H;  3CCL A;  4DXG A;  3PMF A;  1S5C D;  5EAY A;  5IIF A;  2B2T A;  4B3M L;  4EX5 A;  1CQF A;  1AEX A;  4LFA Q;  1Q86 C;  5LMU L;  1X54 A;  2H1E A;  1EYA A;  1GO3 E;  1VF5 C;  3WOF A;  4FF4 A;  3I73 A;  5BN5 A;  3HOY G;  1BQQ T;  4JYA L;  4KKS A;  3TZU A;  5JPN C;  2UXD Q;  3S1Q B;  1PRT B;  1XTC D;  1F2M A;  4O42 A;  1H9M A;  4B9X A;  2C9O A;  5FOB B;  3G71 A;  2N49 A;  2I5M X;  4JW0 A;  3OYY A;  2JA7 B;  1YJW A;  4Y7N B;  4A3G G;  3MTS A;  1LV9 A;  4KLK A;  5LL6 S;  3NUC A;  2HCC A;  5CV4 A;  4HID A;  3RZD B;  1EQV A;  5HGQ A;  5M3M B;  1BR9 A;  3S1M H;  4BY1 H;  1PV4 A;  5LMN Q;  2XRQ D;  5L37 A;  1PH3 A;  2P5Z X;  2R7Z B;  1SFO B;  1H9R A;  3PIO 3;  4JI0 Q;  1YNX A;  4JI1 L;  3M4Q A;  4K5X A;  5E4X A;  3PUV A;  5CR3 A;  1N36 L;  1Q46 A;  1EQR A;  5C4J H;  4YY3 L;  1IXR A;  4ODG A;  3VYU A;  4KY5 A;  2I5L X;  1LTL A;  4IPH A;  2Q2U A;  5EJW A;  1A2T A;  1DOL A;  3HKZ B;  4GS3 A;  1EFI D;  2XNA C;  4PV1 C;  5LHY 1;  2EYL A;  3S2H B;  1ZXT A;  3NTK A;  4DV1 L;  2K03 A;  2CVR A;  1OXU A;  3HOX G;  2OTL A;  2OF1 A;  1SLJ A;  3D4R A;  3A0J A;  3MFY A;  1A6X A;  4IO9 A;  4BBR B;  1WVL A;  3S2D H;  3GTJ B;  5IGF A;  1STA A;  4MTN A;  1CKO A;  1HZB A;  4DKA C;  3H3V I;  2IX3 A;  1H95 A;  1NMG A;  2WV6 D;  2ZJQ A;  3K7A H;  1Y1W B;  1KIX A;  4DUZ L;  2B2W A;  2F0L A;  2BA1 A;  1VQM A;  4QUC A;  5IYC G;  1PTO D;  2K50 A;  3PO3 H;  2CW0 D;  1N34 Q;  1QZH A;  3HGB A;  3E5S A;  5C5M A;  2MNA A;  3HOV B;  1S5D D;  2FXQ A;  3CRL C;  3STB D;  1OXT A;  2L0C A;  4GN3 B;  5EBD A;  2F1M A;  3ERS X;  1NAP A;  5JJL A;  1VQB A;  5CYU A;  3UE0 A;  2WAQ E;  4XTC S;  2MJ8 A;  3KK7 A;  3OHX C;  1GUO A;  1NTG A;  3H3V C;  1B70 B;  2ZTD A;  1ONL A;  4GNX B;  1N32 Q;  3NBI A;  4ZKB B;  4RKL A;  3T53 B;  4FF2 A;  2AWN A;  4B9W A;  1CI3 M;  1WCM H;  4CKB A;  1I50 B;  4CDC C;  1PH2 A;  1ZKO A;  4BBS B;  1W6J A;  5HGT A;  1V9P A;  3KF6 B;  1SXT A;  4OEL B;  1GUT A;  1QWY A;  3GTP H;  5GQO A;  4B3S Q;  2PYK A;  4PZ6 A;  3HOZ B;  2EE1 A;  3PIO A;  2NN6 I;  1X55 A;  3PQI A;  3BDL A;  3W3A A;  5T1I A;  1HA6 A;  1ASZ A;  5FKA C;  3AQQ A;  2ZXR A;  5JJZ A;  4C2M B;  3MVV A;  5IP7 G;  1XTD A;  1J9O A;  4IUQ A;  2E74 C;  2G5D A;  2K5V A;  2GVB A;  2D2C C;  1K3B C;  1V43 A;  2JA7 G;  3S15 H;  1EL0 A;  4XQJ A;  4RCN A;  4JI4 L;  4DAM A;  4B3R Q;  2A6E D;  1HNZ L;  4QL5 A;  4JOI C;  1Y69 U;  5M3M G;  3E3X A;  1PH1 A;  1YI2 A;  1V1P A;  4JV5 Q;  4LF4 L;  3BZK A;  1ASY A;  1TT2 A;  2NZO A;  1QVG A;  2R7Z G;  4QJF A;  2CH4 W;  2EIF A;  2UXB L;  5M9O A;  3PV0 A;  4G7H C;  3HOW G;  4DV2 Q;  2F0I A;  1QZG A;  2EY2 A;  4FDB A;  3CU7 A;  3IL8 A;  2K75 A;  1TWG H;  1YIT A;  5IT9 L;  2K05 A;  3T56 B;  1O7Y A;  3HKZ G;  4KMU C;  3K58 A;  3T1H Q;  2CKZ B;  3VYR A;  2R93 H;  3HOU H;  2PQE A;  1BBX C;  1Q1B A;  1JCK B;  1DJR D;  1AE2 A;  1SE3 A;  4Q0F A;  5KIX A;  5EQ0 A;  3NK9 A;  4ZYS A;  2DGY A;  4A4I A;  2HQL A;  1STY A;  4H7B A;  1VF7 A;  4UY8 C;  4BBR G;  1PZK D;  1U9R A;  5FO8 B;  4U68 A;  3N6R A;  2VQE Q;  2E2I H;  3EN2 A;  4BY1 B;  4YCU A;  3NP8 A;  4DR1 Q;  4FYD A;  3I4N H;  2RSO A;  1PTO F;  1N8R C;  1Y1W G;  2ZM6 L;  5IYB G;  4B3M Q;  4FF1 A;  1LAB A;  5C4J B;  5LMU Q;  4OON A;  1DD2 A;  3SVM A;  2EOT A;  3OMG A;  1FL0 A;  1SBB B;  3HOV G;  3F2C A;  3MXN A;  1NY4 A;  4JYA Q;  2X6G A;  1EUJ A;  1EY8 A;  1I4X A;  1CM9 A;  1KLU D;  4RH6 A;  4DUY L;  1LO5 D;  4JC0 A;  1Q82 C;  3A7L A;  5DEH A;  3VR6 A;  4A3K H;  1SMY D;  4JOI A;  3A8I E;  3KUP A;  1ROD A;  2R3Z A;  4X3K A;  1IL8 A;  4JI5 L;  4NDX A;  1NMF A;  1HZC A;  4GKK L;  1QB5 D;  3K7A B;  3VR2 A;  1II3 A;  4XQQ A;  2Z6K A;  5ELE A;  1RD9 D;  5AJ3 L;  2BCO A;  2LS0 1;  3S24 A;  3IAY A;  5IOD A;  2KHI A;  3PO3 B;  2Y0S B;  4R8I A;  4GOP C;  3OW7 A;  2PPB C;  5C3E B;  3EFX D;  3K5L A;  4BBS G;  5ELO A;  3CKI B;  4DR5 L;  2F3W A;  4JI1 Q;  1TWC B;  1N36 Q;  4AQY L;  3RN5 A;  4YY3 Q;  2O5J C;  2NVQ H;  4LFB L;  1PH7 A;  2B63 G;  1DGS A;  5T1G A;  1K8O A;  2K5H A;  5KGU A;  1MHW C;  4C3I B;  5D14 A;  3RLN A;  1Y1V B;  4DV1 Q;  4UDU C;  4JPB W;  3PGZ A;  3SR1 A;  1B7Y B;  5IGD A;  2QGQ A;  2Z4H A;  5M5Y H;  5JVG 3;  4XDX A;  1JB3 A;  2K28 A;  1XWE A;  3K6O A;  3K5O A;  4X3S A;  1J6Q A;  4DPG A;  1N33 L;  1LTT D;  1I6H H;  3ITP A;  1GUS A;  1L0W A;  1IW7 D;  2VS1 A;  1QOH A;  4A3M H;  1WCM B;  2KCN A;  5EBC A;  4POG A;  3DHQ A;  2JE6 I;  4G7O C;  2B2V C;  1ET9 A;  5K36 G;  3CCE A;  4IZ8 A;  1AP0 A;  2AUJ D;  3I55 A;  4DUZ Q;  4CJ2 C;  3NQT A;  5C4X H;  5CBE E;  2I07 B;  4XT1 B;  4LWC A;  5C5L A;  4LF8 L;  2V4D A;  3N52 A;  4WRD A;  2HQE A;  5JEA J;  2G9H D;  3G48 A;  2LMC B;  2XGT A;  4C3H H;  1SND A;  4DF7 A;  4QMG A;  3CQZ H;  2D9U A;  4NXM L;  1YNJ C;  2E5L L;  1S4Z A;  1NE3 A;  3I7F A;  1ENF A;  1A3T A;  1OXX K;  3HP3 A;  3NWS A;  3ONA B;  4BA1 I;  3VA5 A;  4JVZ A;  2IL8 A;  5K5P A;  1VQ7 A;  1HJP A;  2K01 A;  5F2D A;  4APV A;  1AH9 A;  2K5Q A;  2RHS B;  2NB0 A;  2ZJP A;  2OEO A;  5FLX L;  4ZAI A;  4OXP A;  1KAW A;  3DWQ A;  1UAP A;  2SOB A;  4BY1 G;  4DV6 L;  4P75 A;  1Q8I A;  3S14 B;  4DK1 A;  2EYM A;  3VYT A;  4BXX G;  4EGV A;  4X64 L;  1MI2 A;  1YHA A;  1VQD A;  1QNK A;  1TWH H;  1G8Z D;  1NR4 A;  1VQE A;  2Z4I A;  4FO2 A;  3SK6 A;  1SNO A;  1U4M A;  4ABN A;  1WTP A;  3DMU A;  1PFS A;  2PZW A;  1L2F A;  3BVM A;  1DM0 B;  3HOU B;  3QG1 A;  1D5Z C;  1RL2 A;  4DV4 L;  2JQO A;  5GAE C;  1GOZ A;  1JWS D;  4FXD A;  3D6C A;  2CWA A;  5BR8 L;  2F0P A;  3K0Y A;  4OO1 I;  4OIK A;  3OSO A;  1ZYR C;  1SSO A;  1O7I A;  1YNN D;  3GD7 A;  2E2I B;  1T5X D;  1LT3 D;  3HS0 C;  3F2D A;  1AZQ A;  1C0A A;  4JI4 Q;  2NVT H;  4GZY C;  5DM7 3;  2K1B A;  2DN8 A;  4H02 A;  4LFC L;  3I4N B;  3CAM A;  1HNZ Q;  1EY9 A;  1KDA A;  1K73 C;  3P20 A;  4DNR B;  1G2T A;  2F52 A;  4LF4 Q;  2EXD A;  5C3X A;  1AE3 A;  1YHB A;  3S9W A;  1BKB A;  3TSS A;  4IUP A;  1AZP A;  3PO3 G;  2Y0S G;  2UXB Q;  3HOY B;  2E8G A;  4X65 L;  3I2Z A;  3FHW A;  3FEW X;  3X3N A;  5FO7 B;  1WD1 A;  1KLG D;  2LSS A;  3AYH B;  1IYJ B;  1PRT D;  1WI5 A;  1VQO A;  2LFN A;  3UDI A;  1PDQ A;  4A3K B;  3RZO B;  1LAC A;  1Q3L A;  1NJI C;  3URY A;  4I7Z C;  3NBH A;  3I72 A;  4ALP A;  3J7A V;  5I2Y A;  1VCI A;  1X3P A;  2HDM A;  4HAE A;  4RHR A;  4QF4 A;  1E0B A;  1ENA A;  1CUK A;  1WCM G;  3EJI A;  4A3F H;  1GHJ A;  3TRZ A;  1I4G A;  1EWC A;  1LTS D;  3S1N H;  2A5H A;  3MEH A;  3UDG A;  3HG9 A;  1G29 1;  4CDF C;  2KJX A;  2JA9 A;  2ZM6 Q;  2UUB L;  3I4O A;  3OTO L;  2RQX A;  5G3L D;  1EY0 A;  1JJC B;  1ICF B;  2NVQ B;  4RKB A;  5D3I B;  4B3T L;  2B2T C;  3MFG A;  1E2Z A;  3BJU A;  2QDL A;  3MXG A;  3SE0 A;  4HIK A;  2R7F A;  2B8G A;  4GOP B;  4CJ1 B;  1D7Q A;  3PUW A;  5J1Z A;  3TP6 A;  4JBM A;  1B9N A;  1NUC A;  3M7G A;  2ENB A;  5IE8 A;  3BVZ A;  2F4V L;  1VQ4 A;  3I4M H;  4DUY Q;  1JWM D;  2BOS A;  4J8Q A;  5E1F A;  4HSV A;  4JCV E;  1EYC A;  5CBA E;  3ULJ A;  1HUM A;  1BNZ A;  1RDP D;  4IN3 A;  4R9W A;  1GHK A;  2R92 H;  5NUC A;  1J8I A;  1MIU A;  1PFM A;  4JI5 Q;  1BCP F;  3I90 A;  1BCP B;  1IBK L;  1B53 A;  3AFQ A;  4GKK Q;  1PH5 A;  4DA2 A;  1I5F A;  3J81 L;  2RA4 A;  1UEA B;  4JBW A;  4QIW E;  5AJ3 Q;  1X9N A;  1EZ8 A;  1LTR D;  2A68 C;  1L1O C;  2XIW A;  1WTV A;  1BO0 A;  2NTT A;  4DK3 C;  3CME A;  3KBG A;  2N88 A;  1N9W A;  4DR5 Q;  4OWT B;  3OMC A;  5COY A;  3Q24 A;  1VQH A;  4AQY Q;  4K2L A;  4UHV A;  4IFD I;  4LFB Q;  3CQZ B;  5IT9 E;  3OIP A;  2F4I A;  3KJP A;  4Y52 H;  4NMZ A;  2L11 A;  4M1U B;  4JI7 L;  3KLR A;  2PQA B;  1DYQ A;  1KAA A;  5JPM C;  2R93 G;  3HOU G;  1QUQ A;  5C0X I;  2QDB A;  4ILW A;  4GLA C;  1HTP A;  4JI8 L;  2WII B;  1EOT A;  3R3O A;  1Z47 A;  3R93 A;  2F03 A;  2K32 A;  2R61 A;  1JIC A;  2O2L D;  3A56 A;  1N33 Q;  3H94 A;  5CV5 A;  3GTL H;  1OXV A;  2YYZ A;  5JAV A;  1HPC A;  4GLX A;  1MD2 D;  1MSG A;  1HFN A;  2YU9 H;  1VMP A;  3GTO B;  3S17 H;  4XT3 B;  4RAU C;  1LYL A;  2JSO A;  3BVG A;  3I4N G;  2ZXO A;  2YTY A;  3DM1 A;  1HR0 W;  3H91 A;  3NHH A;  1EEF D;  2RSN A;  2WAQ G;  2FMM A;  1TWH B;  4CGY B;  2PMZ E;  4LJZ C;  1QCB D;  5IYD G;  2VW9 A;  2M9V A;  4G57 A;  1A0I A;  4O2D A;  4LF8 Q;  2B2W C;  1IBM L;  4RFB A;  4KN4 C;  2KHS A;  4ZLT F;  2MPM A;  1LM0 A;  4NKL A;  2JK8 A;  1SE8 A;  1PRT F;  4C1N K;  4KKT A;  5D65 A;  3JC6 6;  4NXM Q;  4IFD H;  2E5L Q;  1YEZ A;  2OCE A;  2E76 C;  4MZ9 A;  1C8C A;  1TS5 A;  5C44 B;  4LUZ A;  3F1Z A;  4A3K G;  4RWS C;  1CKN B;  2VY3 A;  1DOK A;  1M4V A;  4P74 A;  5C0X H;  1TY2 A;  3QWN A;  4A3C H;  2VQF L;  1YHQ A;  3PF4 A;  2NVT B;  4N9T A;  4X66 L;  1SE2 A;  1L1O A;  2I5H A;  3JAM L;  3KLS A;  1C4Q A;  3EIV A;  2B39 A;  4LK1 C;  1SNQ A;  2SDF A;  1X3G A;  4DV6 Q;  1ILP A;  5G3L F;  3VR3 A;  5M5X B;  3HOW B;  4X64 Q;  4HN7 A;  3CCM A;  4IUN A;  4HMI A;  1F2Y A;  4TVA B;  2KEE A;  1KD1 C;  4QY7 A;  4RGT A;  4HJ8 A;  5KRU A;  1HUN A;  1Z7T A;  4BWG B;  4DR3 L;  2Z1C A;  4ZQ3 A;  1VQF A;  3DM3 A;  1GVP A;  5CMD A;  4B08 A;  3BG3 A;  3GTQ H;  1YZ6 A;  4QCL A;  4Q5V A;  2N78 A;  4DV4 Q;  2F0U A;  2KEN A;  2MQH A;  1HXY D;  2F0T A;  5BR8 Q;  1B3A A;  4UPA A;  1ET6 A;  2SEB D;  2Z0S A;  4LAA A;  2WAC A;  3AU7 A;  3I56 A;  3RLF A;  3LNN A;  1B3Q A;  1VQ6 A;  3P7J A;  1QIL A;  4A3F B;  4LFC Q;  2WKD A;  4P2C B;  3Q8D A;  2I46 A;  1T5E A;  1R9T H;  2K14 A;  2QKI C;  1Z6H A;  2EYJ A;  1EIH A;  2B2U A;  4DAP A;  1M1K C;  5C4X G;  1I3Q H;  1O7L A;  2OWO A;  1UE5 A;  1TKW B;  4KI0 A;  1V1Q A;  2UU9 L;  4K2K A;  1HH2 P;  3TS0 A;  4DAV A;  3W5O A;  4X65 Q;  4C3H G;  5CV6 A;  4CHT B;  3KDF A;  4X6A H;  1EYD A;  1TVX A;  5ISR A;  1X3Q A;  1IKM A;  5LMN W;  2XVS A;  3J81 i;  1VQ9 A;  5IGB A;  3I4M B;  1F2L A;  3D8G A;  1T9H A;  1XX8 A;  4KJO A;  1JWU D;  5J22 A;  4DV0 L;  1SR3 A;  1CA5 A;  1JT8 A;  1K0S A;  2EPB A;  2R92 B;  4DNT B;  2F0D A;  4OX9 L;  4R1J A;  2ICE C;  5FLX E;  1G6Z A;  1Q81 C;  1CHQ D;  4L5S A;  1G2S A;  2FJ2 A;  3MWY W;  3W1B A;  2IJ0 A;  3H0G H;  2WIN B;  3J7A 5;  5EPJ A;  1TWA B;  3CP0 A;  5E7N A;  2GA4 B;  3UI2 A;  2JJQ A;  1STE A;  5FK9 C;  1A3U A;  2HIV A;  4C56 C;  4PMW A;  3TP7 A;  3V96 A;  4K8I A;  1EZ6 A;  2UUB Q;  2EY5 A;  3PUZ A;  3OTO Q;  2AQ1 B;  4F88 A;  2B63 B;  3HZX A;  2KVM A;  4B3T Q;  3I8Z A;  3DWA A;  3CC7 A;  3SK4 A;  2WFW A;  2JEA I;  3DEO A;  2EY6 A;  3UDX A;  1NCV A;  1WYD A;  4KHZ A;  2GVA A;  2F4V Q;  2BDN A;  3DLL A;  4ME5 A;  5FO9 B;  5C44 G;  4HMJ A;  1QVF A;  4IUR A;  4YCW A;  4JI3 L;  1YBY A;  1C9O A;  3VYS A;  4LF9 L;  4DV3 L;  3T51 B;  3HKS A;  3S17 B;  3K5M A;  4YHH L;  1IBK Q;  2J4X A;  1H9S A;  2XWJ B;  2Z6B A;  3CCU A;  4L5R C;  3NE5 B;  3M3Y H;  2YTV A;  4JBK A;  4I65 A;  4HSP A;  3U58 A;  2PCF B;  1E2W A;  4C3J H;  4CDE C;  5FLM H;  3ZJY C;  2RDH A;  2Z6K C;  1X3F A;  4PQX A;  2A8V A;  5JJK A;  1M8A A;  1QG7 A;  5IT9 c;  3KF8 A;  3QOJ A;  2QEJ C;  3JAM i;  1ESF A;  3P1H A;  4JI7 Q;  3TDQ A;  4KN7 C;  3NEN A;  4QQB X;  2DJF C;  4ZUJ A;  4N8F A;  3QO2 A;  2EDG A;  2K5D A;  3AMU A;  4JI8 Q;  3T1Y L;  1W3S A;  3PIP A;  1PZJ D;  4A93 H;  2FMC A;  1SMY C;  1EY4 A;  1GXD C;  1KAB A;  3NEL A;  3A5Z B;  2A69 D;  3S1M B;  2KQ3 A;  4P71 A;  4AIM A;  1TXY A;  1BOS A;  4OO1 G;  2F0H A;  3D4D A;  4KTA A;  1NBW A;  1JR0 D;  3NTI A;  1VQC A;  3SEB A;  2PO4 A;  5IGE A;  5JJI A;  2QEX A;  4A3F G;  1O78 A;  1F9S A;  2N8N A;  1EIG A;  2ZTE A;  3MC0 B;  3L0O A;  4NW2 A;  4DNI A;  1FYC A;  1SYE A;  3U4Z A;  3L3O C;  1M90 C;  4ZUI A;  3R2I A;  2ZJR A;  2N3S A;  1IBM Q;  2TSS A;  4RGO S;  4L8J A;  4YWM A;  4QIW B;  5I9P A;  5EGT A;  4DK6 C;  3PCO B;  1SYB A;  3M4P A;  4AYB E;  3I4M G;  1SRU A;  3S2D B;  2VXW A;  1BBW A;  3CCQ A;  2PZU A;  4WOR A;  1UE1 A;  5TSS A;  3VDY A;  4K8J A;  4A3D H;  1JOQ A;  2R92 G;  5KNB A;  1HZ9 A;  2VQF Q;  2CFM A;  1KDB A;  3E0J A;  1EY5 A;  4X66 Q;  1D6E C;  2X6L A;  3J81 E;  3B6Y A;  1U4R A;  2L4N A;  1I3Q B;  4GKJ L;  4LF5 L;  1RF2 D;  3PUY A;  4IUU A;  3TP5 A;  1HCZ A;  1F9R A;  2B8F A;  2KBN A;  1QNU A;  3OWF A;  2WB1 E;  2JA5 H;  4KY6 A;  3EBE A;  4DR3 Q;  1WJJ A;  4RHS A;  4F87 A;  1V1P B;  1CSP A;  2H4O A;  3D6W A;  1GD7 A;  4IPC A;  3S16 H;  2PMZ B;  4OIJ A;  1VQI A;  2JA8 H;  5M5W H;  3KFU A;  4PMB A;  3OW2 A;  2R7D A;  4RGM A;  4WJ3 M;  1SYF A;  1K28 A;  1KQS A;  1A2U A;  3GTK H;  2NTS A;  3H0G B;  3IFD A;  2KCT A;  3TEH B;  1PYS B;  3OIQ A;  4DV7 L;  3GTP B;  4XIG S;  4CBV A;  1HQR D;  2UU9 Q;  3C46 A;  2RVL A;  2X69 A;  1FD7 D;  1D1I A;  1VQL A;  1MJC A;  3TS2 A;  5EKL A;  1EU4 A;  2FHT A;  3A54 A;  2A6H C;  2FIN B;  4IFD G;  3NPP A;  4MTK A;  4EVO A;  2EYF A;  5ELF A;  1KHI A;  4JK1 C;  3I70 A;  1OXS C;  1XPU A;  1ILQ A;  5ELN A;  3VR5 A;  1RIP A;  3S15 B;  4O1N A;  3ICE A;  4DV0 Q;  4JI2 L;  4KHV A;  4OX9 Q;  1HHV A;  5FLX c;  5C0X G;  4A3C G;  4DAY A;  1I94 L;  2M2L A;  1K8G A;  2KHJ A;  3IFT A;  3MXN B;  3JAM E;  1H9K A;  4XYQ A;  3HRZ C;  2ZTC A;  3M3Y B;  2VNU D;  1BCP D;  5GRO A;  3L7Z C;  4DK0 A;  3WWV A;  3Q23 A;  1XNR L;  3K8A A;  3R8B A;  3WDN A;  3PF5 A;  3EVQ A;  5I6W A;  4A3E H;  3QOL A;  1TWF H;  4CKE A;  4E6I A;  3Q22 A;  3SDZ A;  1I6V C;  1TWG B;  3K7U C;  2KCM A;  4A3I H;  2E2J H;  1RKN A;  4LNQ A;  3G6J B;  2R93 B;  1VQJ A;  1F9Q A;  1TY0 A;  1SMX A;  1YJ9 A;  1VQG A;  1WFQ A;  4WJ4 A;  1HNX L;  3QB3 A;  4DR4 L;  5EKK A;  1WOC A;  3QJY A;  4A93 B;  2NBF A;  1UEB A;  1B9M A;  4DR7 L;  4JI3 Q;  2JEB I;  2BA0 A;  1YNJ D;  1SEB D;  1EIY B;  4LF9 Q;  2CH4 A;  4DV3 Q;  1F2Z A;  2O4X A;  1Y14 B;  3CPF A;  5IOC A;  3M85 A;  1V1O A;  3EQL C;  4HR7 B;  4YHH Q;  3G6E A;  3LX0 A;  1SYG A;  4N9P A;  2Q8T A;  2WAQ B;  1PH8 A;  2J0T D;  2SNM A;  4A3B H;  4RGN A;  1D1K A;  3U9S A;  1EY7 A;  2TMP A;  4IJL A;  5KND A;  2JN4 A;  2L55 A;  1E1O A;  2OQ0 A;  1K8A C;  4N8X 1;  1B1Z A;  4GN5 A;  1KNA A;  1TU2 B;  1EYG A;  4V0B A;  2L12 A;  1U4L A;  4PZ7 A;  5FJ8 H;  1XYI A;  2IX1 A;  2F0G A;  1PH4 A;  3WOE A;  3DEP A;  5A35 A;  5GAH C;  4KKU A;  2GN5 A;  3T1Y Q;  1C7Y A;  4A3D B;  1E1T A;  4GLV B;  1SN8 A;  2LY7 A;  1WTQ A;  2F0E A;  3MAQ A;  2B2Y A;  1GUG A;  5DAU A;  3S2H H;  3BZC A;  3IKJ A;  5E4W C;  3FKI H;  1PMR A;  1WTR A;  3H0G G;  1A3V A;  1XMO L;  2MO0 A;  5HUR A;  3UE1 A;  5KNC A;  3OOC A;  1JJ2 A;  1OTC A;  3SK8 A;  1ZYR D;  4XYO A;  2IW3 A;  4IJH A;  4HCS A;  1VQP A;  3GTJ H;  2C35 B;  3CXC A;  2M00 A;  1BBU A;  3A8K E;  3TN2 A;  5JEA H;  3F2B A;  2L15 A;  2JA5 B;  4JBJ A;  3FPU B;  2O5I C;  4TRD A;  1JOR A;  2ALY B;  1BDO A;  2ID0 A;  2K4K A;  1ENC A;  2R6G A;  4KJN A;  3S16 B;  1EIF A;  1IZ6 A;  5EKI A;  1PLF A;  1KTK A;  5M5Y B;  2RF4 A;  3Q0A A;  5M5W B;  1E2V A;  1KNE A;  1HRJ A;  1HNW L;  2AQ3 B;  1I6H B;  3HOV H;  2A1A A;  3DWP A;  4A3M B;  2HT1 A;  4UAI A;  1MJE A;  4EQN A;  4OWW B;  4OEM B;  4POF A;  4JG2 A;  3G7L A;  3X3M A;  3J81 c;  1FVI A;  1XPO A;  5E3F A;  2JA6 H;  5C4X B;  2HHH Q;  1Y8O B;  4A3L H;  3MA2 B;  3CC4 A;  2JXM B;  2DY7 A;  2E75 C;  2BE5 D;  3C1E A;  5FLM G;  4IAL A;  4GKJ Q;  4C3H B;  4LF5 Q;  3E9I A;  4X62 L;  3M4O H;  2HIX A;  1Q90 A;  1SYC A;  4DV5 L;  2B29 A;  1QE6 A;  2DNE A;  1IL2 A;  1NSN S;  2K33 A;  3CCV A;  2IY5 B;  1DXM A;  2RCF A;  1E22 A;  2XSC A;  2J7Z A;  4ME3 A;  5DLQ E;  1B8A A;  1V8Q A;  4S3S A;  1VQ5 A;  4WFN 3;  1KL9 A;  2EQS A;  5IGG A;  4A93 G;  2Q2H A;  2WKC A;  4I7A A;  3HOZ H;  2OT2 A;  2FFK B;  4L6T B;  4L5Q A;  1CK1 A;  3K5N A;  3CMA A;  2KOL A;  3SXH A;  2PI2 A;  2CQO A;  4V19 0;  4AYB B;  1KDC A;  1CZG A;  1FNW A;  4OL7 A;  4IPD A;  1YVC A;  1A63 A;  1VS0 A;  4P73 A;  4DV7 Q;  4BA2 I;  2IT1 A;  1SJH D;  2NVX H;  2UUC L;  4DFA A;  3NBH B;  2MO1 A;  2EXZ A;  3J80 L;  4A3I B;  2F3V A;  2E2J B;  1A62 A;  3U4V A;  2CHB D;  4EQ5 A;  2EYP A;  2B2U C;  1I4H A;  4LUO A;  1PZI D;  1MKH A;  3TP8 A;  3GTG H;  3QIA A;  3K0X A;  4ZRZ A;  2B3G A;  3CCS A;  2A68 D;  3W2D A;  1S72 A;  2K04 A;  1TII D;  1LLR D;  5D3D A;  4GNX A;  3T4A C;  1U5K A;  2Q2I A;  4HJA A;  4JI2 Q;  4K5V A;  4QGU A;  1F77 A;  4A3D G;  2WB1 B;  3RR5 A;  2LXK A;  3JAM c;  1I94 Q;  2Q8I B;  1O80 A;  1WTX A;  4RCO A;  3QR8 A;  3ERO A;  2KUM A;  4TKO B;  3BYT B;  2F0N A;  3KF6 A;  3CW2 C;  5KYI A;  2RDG A;  4LW1 A;  3SHL A;  1XNR Q;  4A3B B;  1ML0 D;  2KEC A;  1S5B D;  1PTO C;  5IWA L;  2CW0 C;  1EY6 A;  3TME A;  2LKV A;  1K9M C;  2F0O A;  3F2U A;  3C1F A;  3GP7 A;  1X56 A;  2D62 A;  1FGB D;  2A74 C;  2NUC A;  1XNQ L;  2EVB A;  2MGS A;  2JA5 G;  4QB4 A;  1SNC A;  4M8A A;  3STB C;  4BXX H;  1PTO H;  4A3J H;  2IHF A;  4R4O A;  4BY7 H;  4TQU S;  1NR2 A;  2ATW A;  1A15 A;  2VL6 A;  5IP9 H;  3E9H A;  1HNX Q;  1HA5 A;  4DR4 Q;  1G6P A;  2JA8 G;  2XN9 C;  1U4P A;  3NXW A;  3D4W A;  4DR7 Q;  1U0L A;  5J3B A;  5I2X A;  2V1C C;  4RA8 A;  1S5E D;  4A3M G;  1I4Q A;  2L1B A;  3FKI B;  2XRS D;  1RHP A;  4K14 A;  1KC8 C;  5CV8 A;  3S1N B;  3OWE B;  4IOA A;  3E6Z X;  2F3I A;  1WTO A;  1L0X B;  4NB3 A;  1JE4 A;  1QUQ B;  1CT1 D;  1WTW A;  2PNH A;  1K83 H;  2QW7 A;  1Q8K A;  4FVM A;  3ULL A;  4K0K L;  1UE6 A;  2EZV A;  1CZW A;  3W1G A;  3D0F A;  2PW7 A;  3PIP 3;  4CKC A;  3BDO A;  2DUD A;  2XTI A;  1CA6 A;  3H6M A;  4DGZ A;  2A19 A;  1IHZ A;  3I4L A;  3IRB A;  2K7V A;  3BYY B;  1E3P A;  3U50 C;  5C3E H;  1G51 A;  2Z8L A;  2XWB B;  1TWC H;  3T16 A;  2KED A;  1EWI A;  4IUT A;  4NXN L;  1S5F D;  4K5W A;  2HD3 A;  2MHV A;  2RCN A;  4KD3 A;  2AKW B;  2A6E C;  4C3I H;  2JA6 B;  1Y1V H;  4MNO A;  1XMO Q;  4UP7 A;  4AYB G;  4HCE A;  1DCZ A;  2L9H A;  2I0Q A;  5C4H A;  3NWT A;  3ND8 A;  5COR A;  3CHB D;  3HEJ A;  4A3E G;  2F0K A;  4ZKC B;  3PO2 H;  3M4O B;  1GKH A;  1K8M A;  1JC7 A;  4A3I G;  2D0O A;  1L1O B;  3J81 j;  4XXE A;  1UUP A;  1H9J A;  3H3V H;  2ASB A;  1RCV D;  2UXC L;  1ESR A;  1PHJ A;  1S40 A;  1PVO A;  2A73 B;  1K3R A;  3GTL B;  4O0A A;  1E24 A;  1HNW Q;  3J80 i;  2DY8 A;  3RUZ A;  1CFM A;  4DR6 L;  1AW7 A;  1B50 A;  2YU9 B;  2WB1 G;  2QF7 A;  2A69 C;  1IBL L;  1D8L A;  1GUN A;  4OGQ C;  1LTA D;  3KYH C;  2AWO A;  1LTG D;  1PA6 A;  4IUV A;  2CQA A;  1Z9F A;  1E7Z A;  4RMF A;  2NVX B;  2HUG A;  4HJ9 A;  1UE7 A;  1BXT A;  3I3C A;  4A3B G;  3R2T A;  5M3F H;  4F7X A;  3FDT A;  5CC4 A;  3SK5 A;  1X6O A;  4X62 Q;  1SDF A;  3GTG B;  1P8L A;  2E2H H;  4HTH A;  4CJ0 B;  4PZ8 A;  4DV5 Q;  3D31 A;  3S14 H;  1MBY A;  4DU9 A;  4QUF A;  5FJ8 G;  1JOK A;  3DUZ A;  2VUM H;  5A2Q L;  1X65 A;  3H09 A;  5C3W A;  4DN4 M;  1GUW A;  5C4Z A;  3J7Y W;  4WJW A;  3KDF B;  2AHO B;  1PFN A;  5ELD A;  2VB2 X;  1OO9 B;  1TS4 A;  4C1N I;  3FKI G;  2EY1 A;  4FF3 A;  2ZT9 C;  4LUV A;  1O7Z A;  2NN6 H;  4YCV A;  3AEV A;  2BH8 A;  2VZA A;  3BS1 A;  5GAD C;  1CSQ A;  1KXL A;  4RG1 A;  3G4S A;  2ES2 A;  4EQP A;  2CWP A;  5BN4 A;  1YJN A;  2UUC Q;  2BH2 A;  3K81 C;  5J39 A;  1DOM A;  1IYU A;  5JEA G;  1Y8N B;  1B2T A;  1PXU A;  1SNM A;  3GTQ B;  1LTB D;  1EWH A;  3C2P A;  1BUV T;  1PTO B;  4A3J B;  4BY7 B;  1PYB A;  2D0P A;  2YV5 A;  2PW5 A;  3MEF A;  3I91 A;  4R8N A;  4LF7 L;  3ULP A;  5IYD H;  1Y8P B;  4J1M A;  3CRK C;  4GN4 B;  3CPW A;  4MIU A;  1YIJ A;  3HOY H;  4MN3 A;  4TSS A;  2AQ2 B;  2QIL A;  3D3R A;  5EPK A;  1PYW D;  1IW7 C;  2JYO A;  4X3T A;  4KK7 A;  2IPK D;  1HR0 L;  1R9T B;  2HHH L;  1FJG L;  1FNV A;  4A3G H;  3A74 A;  3A55 A;  5LL6 X;  2JA6 G;  1HTL D;  1VDZ A;  3RZO H;  4A3L G;  1K83 B;  1I4P A;  1EU3 A;  1R4P B;  5IWA Q;  1VQA A;  2N55 A;  1IYV A;  2NVY H;  4J15 A;  3RNU A;  2VB3 X;  4PG3 A;  1VQK A;  1XNQ Q;  3KLS X;  1EEI D;  3NSW A;  1RTN A;  1J5E L;  1H9S B;  3MXU A;  1EOV A;  4DR2 L;  3M4Y A;  3K57 A;  1LTI D;  1XMQ L;  5JVH 3;  5ELC A;  1A8V A;  4L5T A;  4H13 C;  1UWV A;  4R4T A;  3GO5 A;  5CV9 A;  3NEM A;  1PH6 A;  3CD6 A;  2C5C A;  1SRO A;  2HDL A;  2KA7 A;  3KF8 B;  3HOZ G;  5C6A A;  1XPR A;  1NNX A;  4JI6 L;  2K6A A;  4YWL A;  4K6D A;  4HIM A;  1XJV A;  3HOX H;  5I9O A;  1JQY D;  4ZK9 B;  1BCP C;  1CHP D;  1EFW A;  2AUK A;  3A7A B;  3TBI B;  3T13 A;  4LMQ D;  2RDF A;  4P72 A;  4KHP L;  3PO2 B;  3U9O A;  2K5W A;  3J80 E;  3UDF A;  2ZXP A;  2UUA L;  4K0K Q;  3F8T A;  2Z9H A;  1Q7Y C;  4LF6 L;  1STB A;  3HKZ E;  3VR4 A;  4IPG A;  2IHE A;  1L0Y B;  2OTJ A;  5I6Y A;  1W2B A;  4L63 B;  2L5T A;  5DNF A;  3ND9 A;  4LFA L;  5IYC H;  5HY6 A;  4BS9 A;  1F9P A;  1KRS A;  3GQB A;  1DON A;  2YTX A;  1BF4 A;  4G7Z C;  2NZH A;  5IGC A;  2F0M A;  2MP1 A;  4Z9C B;  4KY7 A;  4X3U A;  1XXG A;  2OQK A;  3GTM H;  1YNN C;  4NXN Q;  2UXD L;  4KD4 A;  3PUX A;  4H0L C;  3S1R H;  2D5D A;  1SE4 A;  3FP9 A;  3OPO A;  2NWG A;  4OWX B;  4IOC A;  2QA4 A;  3SGI A;  2PI2 E;  2LXJ A;  1GJX A;  4C3J B;  2B2Y C;  4NP5 A;  4HJ7 A;  1D2B A;  4HED A;  1KRT A;  4A75 A;  5CV7 A;  5M3F B;  3FVQ A;  3M9B A;  3M7N A;  3FMC A;  2BDO A;  1AFP A;  2NYZ D;  1Q1E A;  5KEE A;  5ELB A;  4GOP A;  3L2P A;  2E2H B;  3Q6S A;  5LMN L;  5AFW A;  3TZD A;  4AH6 A;  1VMC A;  3LGJ A;  3GTO H;  1C48 A;  1JE5 A;  1CTM A;  4JI0 L;  1TS2 A;  4A3J G;  4BY7 G;  2VUM B;  3BZD B;  1PRT C;  1STN A;  1VQ8 A;  4ZCK A;  1ICW A;  2UXC Q;  1CQV A;  5IP9 G;  1X3E A;  1HZA A;  4UP9 A;  3CCJ A;  4PMC A;  1SNP A;  5IY0 A;  1ZEQ X;  4DR6 Q;  1X32 A;  2A6H D;  4IQZ A;  3K59 A;  2F0W A;  5IP7 H;  4HJ5 A;  1VQN A;  3S1Q H;  1IBL Q;  1UNS A;  3BU2 A;  3MHB A;  5DM6 3;  4YIJ A;  1SYD A;  2F0S A;  5C44 H;  2JA7 H;  2F0F A;  3ER0 A;  3GV6 A;  4Y7N H;  4A76 A;  2B2V A;  3CC2 A;  3NQI A;  1JOO A;  5I4D A;  3RZD H;  2F0Q A;  3KJO A;  2Q8R E;  3H15 A;  1WD0 A;  3KBX A;  1PFB A;  5M3M H;  2PQA A;  3KOJ A;  3C3L A;  4NPS A;  1WTH A;  1RJT A;  2R7Z H;  1SFO H;  1N34 L;  2MUY A;  5M5X H;  3J7Z C;  1Q12 A;  3HOW H;  5C3E G;  4ULL A;  4G4K A;  1HQM C;  3CCR A;  4FXK C;  1QVC A;  3V05 A;  1EQQ A;  1B44 D;  4IFD J;  4DXF A;  1AN8 A;  2RKS A;  1G91 A;  1D5X C;  2HCI A;  4C3I G;  4A3G B;  4FP5 D;  1Y1V G;  3ERQ A;  3TRE A;  3V2T A;  5EPL A;  4F8M A;  3NTH A;  3CF5 A;  2K52 A;  5C0X J;  1HFG A;  1N32 L;  4BBR H;  1TQO A;  2BE5 C;  3PSI A;  4R4Q A;  2NVY B;  3PO2 G;  3RD4 A;  5H1S E;  3GDE A;  4UP8 A;  4DAY B;  4OO1 H;  1STG A;  2G9D A;  1FR3 A;  3AB9 A;  2F0J A;  1Y1W H;  1B4O A;  3K80 C;  4PNY A;  3LWE A;  4J6H A;  4R4C A;  5IYB H;  1JB7 A;  1JMC A;  2RBM A;  1LUZ A;  2EJG C;  1GM5 A;  3DXJ C;  1P16 A;  2EJF C;  2JA8 B;  1CKN A;  4B3S L;  4LF7 Q;  4KV6 A;  4H44 C;  3FPP A;  3AFP A;  3BDC A;  3TQY A;  1QJO A;  4OHJ A;  3GTK B;  4FNF A;  4GNX C;  1RTO A;  4HIO A;  2QCP X;  3HOX B;  3HFZ B;  2IWH A;  5JOB A;  2DNC A;  1HR0 Q; 
#chains in the Genus database with same CATH homology
 2SNS A;  1DZ1 A;  1TR5 A;  2JP1 A;  4ID6 A;  2KCC A;  1I4R A;  3O13 A;  1LT5 D;  3LWU A;  4C3J G;  1STH A;  5KYL A;  2WP8 J;  3GV3 A;  5CGK A;  2NZ1 D;  1MGS A;  3L9A X;  2EYO A;  1LT6 D;  2PNR C;  3A8J E;  2IX0 A;  3MXP A;  4FXG C;  3VA7 A;  4XQN A;  1MSH A;  2EYH A;  2PZT A;  1IKL A;  3P75 A;  5A2Q E;  1FNU A;  2ICI A;  4U67 3;  3J7A F;  5BN3 A;  3GTM B;  2E2D C;  2OXP A;  1W6K A;  3ZYY X;  3S1R B;  4MHE A;  1TS3 A;  3RMH A;  4EQO A;  2NN6 G;  1SJE D;  3FRP B;  1D5M C;  4K6L A;  2EJM A;  4A3E B;  1LT4 D;  1TWF B;  3EA6 A;  2F0V A;  3MZ5 A;  1SAP A;  1EQT A;  1R4Q B;  5K36 H;  4DXG A;  3PMF A;  1S5C D;  5IIF A;  2B2T A;  1CQF A;  1AEX A;  2H1E A;  1EYA A;  1VF5 C;  3WOF A;  4FF4 A;  3I73 A;  5BN5 A;  1BQQ T;  4KKS A;  3TZU A;  5JPN C;  3S1Q B;  1PRT B;  1XTC D;  1F2M A;  4O42 A;  1H9M A;  4B9X A;  2C9O A;  5FOB B;  2JA7 B;  4Y7N B;  3MTS A;  1LV9 A;  5LL6 S;  3NUC A;  2HCC A;  5CV4 A;  3RZD B;  1EQV A;  5M3M B;  1BR9 A;  2XRQ D;  2R7Z B;  1SFO B;  1H9R A;  3PIO 3;  4K5X A;  5E4X A;  3PUV A;  5CR3 A;  4ODG A;  3VYU A;  4KY5 A;  5EJW A;  1A2T A;  1DOL A;  3HKZ B;  1EFI D;  2XNA C;  4PV1 C;  5LHY 1;  2EYL A;  3S2H B;  1ZXT A;  3NTK A;  2K03 A;  2CVR A;  1OXU A;  2OF1 A;  3D4R A;  3MFY A;  1A6X A;  4BBR B;  1WVL A;  3GTJ B;  5IGF A;  1STA A;  2IX3 A;  2WV6 D;  1Y1W B;  2B2W A;  2F0L A;  2BA1 A;  4QUC A;  1PTO D;  2CW0 D;  3HGB A;  3E5S A;  5C5M A;  3HOV B;  1S5D D;  3CRL C;  1OXT A;  2L0C A;  5EBD A;  2F1M A;  1NAP A;  5CYU A;  4XTC S;  2MJ8 A;  3KK7 A;  3OHX C;  1GUO A;  3H3V C;  1ONL A;  3NBI A;  4ZKB B;  4RKL A;  3T53 B;  4FF2 A;  2AWN A;  4B9W A;  1CI3 M;  4CKB A;  1I50 B;  1ZKO A;  4BBS B;  1W6J A;  5HGT A;  1SXT A;  1GUT A;  1QWY A;  2PYK A;  3HOZ B;  2EE1 A;  2NN6 I;  3W3A A;  3BDL A;  5T1I A;  1HA6 A;  5FKA C;  2ZXR A;  5JJZ A;  4C2M B;  3MVV A;  1J9O A;  4IUQ A;  2E74 C;  2D2C C;  1V43 A;  1EL0 A;  4XQJ A;  4RCN A;  2A6E D;  1Y69 U;  1V1P A;  1TT2 A;  5M9O A;  3PV0 A;  4G7H C;  2F0I A;  2EY2 A;  3CU7 A;  3IL8 A;  5IT9 L;  2K05 A;  3T56 B;  1O7Y A;  4KMU C;  3K58 A;  3VYR A;  2PQE A;  1BBX C;  1Q1B A;  1JCK B;  1DJR D;  1SE3 A;  4Q0F A;  5KIX A;  5EQ0 A;  3NK9 A;  4ZYS A;  1STY A;  4H7B A;  1VF7 A;  1PZK D;  1U9R A;  5FO8 B;  4U68 A;  3N6R A;  4BY1 B;  3NP8 A;  4FYD A;  2RSO A;  1PTO F;  4FF1 A;  1LAB A;  5C4J B;  1DD2 A;  3SVM A;  2EOT A;  3OMG A;  1SBB B;  3MXN A;  2X6G A;  1EY8 A;  1I4X A;  1CM9 A;  1KLU D;  4RH6 A;  1LO5 D;  3A7L A;  5DEH A;  3VR6 A;  1SMY D;  3A8I E;  3KUP A;  1ROD A;  2R3Z A;  4X3K A;  1IL8 A;  4NDX A;  1QB5 D;  3K7A B;  3VR2 A;  1II3 A;  4XQQ A;  5ELE A;  1RD9 D;  2BCO A;  2LS0 1;  3IAY A;  5IOD A;  3PO3 B;  2Y0S B;  4R8I A;  3OW7 A;  2PPB C;  5C3E B;  3EFX D;  3K5L A;  3CKI B;  2F3W A;  1TWC B;  2O5J C;  5T1G A;  1K8O A;  5KGU A;  4C3I B;  5D14 A;  1Y1V B;  4UDU C;  3SR1 A;  5IGD A;  2Z4H A;  5JVG 3;  4XDX A;  1JB3 A;  2K28 A;  1XWE A;  3K6O A;  3K5O A;  4X3S A;  1LTT D;  3ITP A;  1GUS A;  1IW7 D;  1QOH A;  1WCM B;  2KCN A;  5EBC A;  3DHQ A;  2JE6 I;  4G7O C;  2B2V C;  1ET9 A;  5K36 G;  4IZ8 A;  1AP0 A;  2AUJ D;  4CJ2 C;  3NQT A;  5CBE E;  2I07 B;  4XT1 B;  5C5L A;  2V4D A;  3N52 A;  4WRD A;  2HQE A;  5JEA J;  2G9H D;  2LMC B;  1SND A;  4DF7 A;  4QMG A;  2D9U A;  1YNJ C;  1S4Z A;  1ENF A;  1A3T A;  1OXX K;  3HP3 A;  3NWS A;  3ONA B;  4BA1 I;  3VA5 A;  5K5P A;  2IL8 A;  2K01 A;  5F2D A;  2K5Q A;  2NB0 A;  2OEO A;  5FLX L;  4ZAI A;  3DWQ A;  1UAP A;  2SOB A;  1Q8I A;  3S14 B;  4DK1 A;  2EYM A;  3VYT A;  4EGV A;  1MI2 A;  1QNK A;  1G8Z D;  1NR4 A;  4FO2 A;  2Z4I A;  3SK6 A;  1SNO A;  1U4M A;  4ABN A;  1WTP A;  3DMU A;  2PZW A;  3BVM A;  1DM0 B;  3HOU B;  3QG1 A;  1D5Z C;  1GOZ A;  1JWS D;  4FXD A;  3D6C A;  2F0P A;  3K0Y A;  4OO1 I;  4OIK A;  3OSO A;  1ZYR C;  1SSO A;  1YNN D;  3GD7 A;  2E2I B;  1T5X D;  1LT3 D;  3HS0 C;  1AZQ A;  4GZY C;  5DM7 3;  2K1B A;  2DN8 A;  3I4N B;  1EY9 A;  1KDA A;  3P20 A;  4DNR B;  1G2T A;  5C3X A;  3S9W A;  3TSS A;  4IUP A;  1AZP A;  3HOY B;  3FEW X;  3X3N A;  5FO7 B;  1WD1 A;  1KLG D;  1PRT D;  2LFN A;  1PDQ A;  4A3K B;  3RZO B;  1LAC A;  1Q3L A;  3URY A;  4I7Z C;  3NBH A;  3I72 A;  3J7A V;  5I2Y A;  1VCI A;  1X3P A;  2HDM A;  4HAE A;  4RHR A;  4QF4 A;  1E0B A;  1ENA A;  3EJI A;  1GHJ A;  1I4G A;  1EWC A;  1LTS D;  2A5H A;  3MEH A;  3HG9 A;  1G29 1;  2KJX A;  2RQX A;  5G3L D;  1EY0 A;  2NVQ B;  4RKB A;  5D3I B;  2B2T C;  3MFG A;  1E2Z A;  3MXG A;  3SE0 A;  2B8G A;  4CJ1 B;  3PUW A;  5J1Z A;  3TP6 A;  1B9N A;  1NUC A;  3M7G A;  2ENB A;  3BVZ A;  1JWM D;  2BOS A;  4J8Q A;  5E1F A;  4HSV A;  1EYC A;  5CBA E;  1HUM A;  1BNZ A;  1RDP D;  4IN3 A;  4R9W A;  1GHK A;  5NUC A;  1J8I A;  1PFM A;  1BCP F;  3I90 A;  1BCP B;  1B53 A;  4DA2 A;  3J81 L;  2RA4 A;  1UEA B;  4JBW A;  1EZ8 A;  1LTR D;  2A68 C;  2XIW A;  1WTV A;  1BO0 A;  2NTT A;  3KBG A;  2N88 A;  3OMC A;  5COY A;  3Q24 A;  4K2L A;  4IFD I;  3CQZ B;  5IT9 E;  3OIP A;  2F4I A;  4NMZ A;  2L11 A;  4M1U B;  3KLR A;  1DYQ A;  1KAA A;  5JPM C;  5C0X I;  2QDB A;  4ILW A;  1HTP A;  2WII B;  1EOT A;  3R3O A;  1Z47 A;  3R93 A;  2F03 A;  2K32 A;  2R61 A;  1JIC A;  2O2L D;  3A56 A;  3H94 A;  5CV5 A;  1OXV A;  2YYZ A;  5JAV A;  1HPC A;  1MD2 D;  1MSG A;  1HFN A;  1VMP A;  3GTO B;  4XT3 B;  4RAU C;  2JSO A;  3BVG A;  2ZXO A;  3DM1 A;  3H91 A;  3NHH A;  1EEF D;  2RSN A;  2FMM A;  1TWH B;  4CGY B;  4LJZ C;  1QCB D;  2M9V A;  4G57 A;  2B2W C;  4RFB A;  4KN4 C;  2KHS A;  4ZLT F;  2MPM A;  4NKL A;  1PRT F;  4C1N K;  4KKT A;  5D65 A;  4IFD H;  1C8C A;  2E76 C;  1TS5 A;  5C44 B;  4RWS C;  1DOK A;  1M4V A;  5C0X H;  1TY2 A;  3QWN A;  2NVT B;  4N9T A;  1SE2 A;  3JAM L;  3KLS A;  1C4Q A;  2B39 A;  4LK1 C;  1SNQ A;  2SDF A;  1ILP A;  5G3L F;  3VR3 A;  5M5X B;  3HOW B;  4HN7 A;  4IUN A;  4HMI A;  1F2Y A;  2KEE A;  4RGT A;  5KRU A;  1HUN A;  1Z7T A;  4BWG B;  2Z1C A;  4ZQ3 A;  5CMD A;  4B08 A;  3BG3 A;  4QCL A;  4Q5V A;  2F0U A;  1HXY D;  2F0T A;  1B3A A;  1ET6 A;  2SEB D;  4LAA A;  2WAC A;  3AU7 A;  3RLF A;  3LNN A;  3P7J A;  1QIL A;  4A3F B;  2WKD A;  4P2C B;  2I46 A;  1T5E A;  2QKI C;  1Z6H A;  2EYJ A;  1EIH A;  2B2U A;  4DAP A;  1O7L A;  1TKW B;  4KI0 A;  4K2K A;  4DAV A;  4C3H G;  5CV6 A;  4CHT B;  1EYD A;  1TVX A;  5ISR A;  1X3Q A;  1IKM A;  2XVS A;  5IGB A;  3I4M B;  1F2L A;  3D8G A;  1XX8 A;  4KJO A;  1JWU D;  5J22 A;  1CA5 A;  2EPB A;  2R92 B;  4DNT B;  2F0D A;  2ICE C;  5FLX E;  1G6Z A;  1CHQ D;  1G2S A;  2FJ2 A;  3MWY W;  2IJ0 A;  2WIN B;  5EPJ A;  1TWA B;  2GA4 B;  3UI2 A;  1STE A;  5FK9 C;  1A3U A;  4C56 C;  4PMW A;  3TP7 A;  3V96 A;  4K8I A;  1EZ6 A;  2EY5 A;  3PUZ A;  2AQ1 B;  4F88 A;  2B63 B;  3HZX A;  2KVM A;  3I8Z A;  3DWA A;  3SK4 A;  2JEA I;  3DEO A;  2EY6 A;  1NCV A;  4KHZ A;  2BDN A;  4ME5 A;  5FO9 B;  4HMJ A;  4IUR A;  3VYS A;  3T51 B;  3S17 B;  3K5M A;  2J4X A;  1H9S A;  2XWJ B;  3NE5 B;  4I65 A;  4HSP A;  2PCF B;  1E2W A;  2RDH A;  4PQX A;  1M8A A;  1QG7 A;  3KF8 A;  3QOJ A;  2QEJ C;  1ESF A;  3P1H A;  3TDQ A;  4KN7 C;  4ZUJ A;  3QO2 A;  2EDG A;  2K5D A;  3AMU A;  1PZJ D;  2FMC A;  1SMY C;  1EY4 A;  1GXD C;  1KAB A;  2A69 D;  3S1M B;  2KQ3 A;  1BOS A;  4OO1 G;  2F0H A;  3D4D A;  4KTA A;  1JR0 D;  3NTI A;  3SEB A;  2PO4 A;  5IGE A;  1O78 A;  1F9S A;  1EIG A;  3MC0 B;  4NW2 A;  1FYC A;  1SYE A;  3L3O C;  4ZUI A;  3R2I A;  2TSS A;  4RGO S;  4L8J A;  4QIW B;  5I9P A;  5EGT A;  1SYB A;  3S2D B;  2VXW A;  2PZU A;  4WOR A;  5TSS A;  4K8J A;  1JOQ A;  5KNB A;  1KDB A;  3E0J A;  1EY5 A;  1D6E C;  2X6L A;  3J81 E;  1U4R A;  2L4N A;  1I3Q B;  1RF2 D;  3PUY A;  4IUU A;  3TP5 A;  1HCZ A;  1F9R A;  2B8F A;  1QNU A;  3OWF A;  4KY6 A;  4F87 A;  4RHS A;  1V1P B;  2H4O A;  3D6W A;  2PMZ B;  4OIJ A;  4PMB A;  4RGM A;  1SYF A;  1A2U A;  2NTS A;  3H0G B;  3IFD A;  3OIQ A;  3GTP B;  4XIG S;  4CBV A;  1HQR D;  3C46 A;  2RVL A;  2X69 A;  1FD7 D;  1D1I A;  5EKL A;  1EU4 A;  2FHT A;  3A54 A;  2A6H C;  2FIN B;  4IFD G;  3NPP A;  4EVO A;  2EYF A;  5ELF A;  4JK1 C;  3I70 A;  1OXS C;  1ILQ A;  3VR5 A;  3S15 B;  4O1N A;  4KHV A;  1HHV A;  5C0X G;  4DAY A;  2M2L A;  3IFT A;  3JAM E;  1H9K A;  4XYQ A;  3HRZ C;  3M3Y B;  2VNU D;  1BCP D;  3L7Z C;  4DK0 A;  3Q23 A;  3R8B A;  3WDN A;  3EVQ A;  5I6W A;  3QOL A;  4CKE A;  4E6I A;  3Q22 A;  3SDZ A;  1I6V C;  1TWG B;  1RKN A;  3G6J B;  2R93 B;  1F9Q A;  1TY0 A;  3QB3 A;  5EKK A;  3QJY A;  4A93 B;  2NBF A;  1B9M A;  2JEB I;  2BA0 A;  1YNJ D;  1SEB D;  1F2Z A;  2O4X A;  5IOC A;  3M85 A;  1V1O A;  3EQL C;  4HR7 B;  3LX0 A;  1SYG A;  4N9P A;  2Q8T A;  2WAQ B;  2J0T D;  2SNM A;  4RGN A;  1D1K A;  3U9S A;  1EY7 A;  2TMP A;  5KND A;  2L55 A;  1B1Z A;  1KNA A;  1TU2 B;  4V0B A;  2L12 A;  1U4L A;  1XYI A;  2IX1 A;  2F0G A;  3WOE A;  3DEP A;  5A35 A;  4KKU A;  4A3D B;  2LY7 A;  1WTQ A;  2F0E A;  3MAQ A;  2B2Y A;  1GUG A;  5DAU A;  3IKJ A;  5E4W C;  1PMR A;  1WTR A;  1A3V A;  5HUR A;  5KNC A;  3OOC A;  3SK8 A;  1ZYR D;  4XYO A;  2IW3 A;  4HCS A;  2M00 A;  3A8K E;  3TN2 A;  5JEA H;  2JA5 B;  3FPU B;  2O5I C;  4TRD A;  1JOR A;  1BDO A;  2ID0 A;  4KJN A;  1ENC A;  2R6G A;  3S16 B;  5EKI A;  1PLF A;  1KTK A;  5M5Y B;  3Q0A A;  5M5W B;  1E2V A;  1KNE A;  1HRJ A;  1I6H B;  2AQ3 B;  3DWP A;  4A3M B;  4UAI A;  4EQN A;  3X3M A;  3G7L A;  5E3F A;  5C4X B;  1Y8O B;  3MA2 B;  2JXM B;  2DY7 A;  2E75 C;  2BE5 D;  3C1E A;  4IAL A;  4C3H B;  1Q90 A;  1SYC A;  1QE6 A;  2DNE A;  1NSN S;  2K33 A;  1DXM A;  2XSC A;  2J7Z A;  1V8Q A;  4S3S A;  4WFN 3;  5IGG A;  2WKC A;  2OT2 A;  2FFK B;  4L6T B;  1CK1 A;  3K5N A;  2KOL A;  3SXH A;  4V19 0;  4AYB B;  1KDC A;  1CZG A;  1FNW A;  4OL7 A;  4BA2 I;  2IT1 A;  1SJH D;  4DFA A;  2EXZ A;  3J80 L;  4A3I B;  2F3V A;  2E2J B;  2CHB D;  2EYP A;  2B2U C;  1I4H A;  1PZI D;  3TP8 A;  3QIA A;  4ZRZ A;  2A68 D;  3W2D A;  2K04 A;  1TII D;  1LLR D;  5D3D A;  3T4A C;  4K5V A;  1F77 A;  2WB1 B;  2Q8I B;  1O80 A;  1WTX A;  4RCO A;  3ERO A;  2KUM A;  4TKO B;  3BYT B;  2F0N A;  5KYI A;  2RDG A;  3SHL A;  4A3B B;  1ML0 D;  2KEC A;  1S5B D;  1PTO C;  2CW0 C;  1EY6 A;  3TME A;  2LKV A;  2F0O A;  3F2U A;  3C1F A;  3GP7 A;  2D62 A;  1FGB D;  2A74 C;  2NUC A;  2EVB A;  2MGS A;  4QB4 A;  1SNC A;  4M8A A;  1PTO H;  4TQU S;  1NR2 A;  1A15 A;  1HA5 A;  2XN9 C;  1U4P A;  3NXW A;  3D4W A;  5I2X A;  4RA8 A;  1S5E D;  1I4Q A;  2L1B A;  3FKI B;  2XRS D;  1RHP A;  4K14 A;  5CV8 A;  3S1N B;  3OWE B;  3E6Z X;  1WTO A;  1L0X B;  1JE4 A;  1CT1 D;  1WTW A;  4FVM A;  2EZV A;  1CZW A;  2PW7 A;  3PIP 3;  4CKC A;  3BDO A;  1CA6 A;  3H6M A;  4DGZ A;  1IHZ A;  3I4L A;  2K7V A;  3BYY B;  2Z8L A;  2XWB B;  3T16 A;  2KED A;  4IUT A;  1S5F D;  4K5W A;  2MHV A;  4KD3 A;  2A6E C;  2JA6 B;  4HCE A;  1DCZ A;  2L9H A;  5C4H A;  3NWT A;  3ND8 A;  5COR A;  3CHB D;  3HEJ A;  2F0K A;  4ZKC B;  3M4O B;  1K8M A;  1JC7 A;  4XXE A;  1UUP A;  1H9J A;  1RCV D;  1ESR A;  2A73 B;  3GTL B;  2DY8 A;  3RUZ A;  1CFM A;  1AW7 A;  1B50 A;  2YU9 B;  2QF7 A;  2A69 C;  1GUN A;  4OGQ C;  1LTA D;  2AWO A;  1LTG D;  4IUV A;  2CQA A;  2NVX B;  2HUG A;  1BXT A;  3I3C A;  3R2T A;  4F7X A;  3FDT A;  5CC4 A;  3SK5 A;  1SDF A;  3GTG B;  4HTH A;  4CJ0 B;  3D31 A;  1MBY A;  4DU9 A;  4QUF A;  1JOK A;  3DUZ A;  5A2Q L;  3H09 A;  5C3W A;  4DN4 M;  1GUW A;  5C4Z A;  3J7Y W;  4WJW A;  1PFN A;  5ELD A;  2VB2 X;  1OO9 B;  4C1N I;  1TS4 A;  4FF3 A;  2EY1 A;  2ZT9 C;  1O7Z A;  2NN6 H;  3BS1 A;  4EQP A;  5BN4 A;  5J39 A;  1DOM A;  1IYU A;  5JEA G;  1Y8N B;  1B2T A;  1PXU A;  1SNM A;  3GTQ B;  1LTB D;  1EWH A;  3C2P A;  1BUV T;  1PTO B;  4A3J B;  4BY7 B;  2PW5 A;  3I91 A;  4R8N A;  1Y8P B;  4J1M A;  3CRK C;  4MIU A;  4MN3 A;  4TSS A;  2AQ2 B;  2QIL A;  3D3R A;  5EPK A;  1PYW D;  1IW7 C;  2JYO A;  4X3T A;  4KK7 A;  2IPK D;  1R9T B;  1FNV A;  3A55 A;  5LL6 X;  1HTL D;  1VDZ A;  1K83 B;  1I4P A;  1EU3 A;  1R4P B;  2N55 A;  1IYV A;  2VB3 X;  3KLS X;  1EEI D;  3NSW A;  1RTN A;  1H9S B;  3MXU A;  3M4Y A;  3K57 A;  1LTI D;  5JVH 3;  5ELC A;  4H13 C;  3GO5 A;  5CV9 A;  2C5C A;  2HDL A;  2KA7 A;  5C6A A;  2K6A A;  4K6D A;  5I9O A;  1JQY D;  4ZK9 B;  1BCP C;  1CHP D;  2AUK A;  3A7A B;  3TBI B;  3T13 A;  4LMQ D;  2RDF A;  3PO2 B;  3U9O A;  2K5W A;  3J80 E;  2ZXP A;  1STB A;  3VR4 A;  1L0Y B;  5I6Y A;  4L63 B;  2L5T A;  5DNF A;  3ND9 A;  4BS9 A;  1F9P A;  3GQB A;  1DON A;  1BF4 A;  4G7Z C;  5IGC A;  2F0M A;  2MP1 A;  4Z9C B;  4KY7 A;  4X3U A;  1XXG A;  1YNN C;  4KD4 A;  3PUX A;  4H0L C;  2D5D A;  1SE4 A;  3OPO A;  2NWG A;  1GJX A;  4C3J B;  2B2Y C;  4NP5 A;  1D2B A;  4HED A;  5M3F B;  5CV7 A;  3FVQ A;  3M7N A;  3FMC A;  2BDO A;  1AFP A;  2NYZ D;  1Q1E A;  5KEE A;  5ELB A;  2E2H B;  3Q6S A;  5AFW A;  3TZD A;  1VMC A;  1C48 A;  1CTM A;  1TS2 A;  2VUM B;  3BZD B;  1PRT C;  1STN A;  1ICW A;  1CQV A;  4PMC A;  1SNP A;  1ZEQ X;  1X32 A;  2A6H D;  4IQZ A;  3K59 A;  2F0W A;  1UNS A;  3MHB A;  5DM6 3;  4YIJ A;  1SYD A;  2F0S A;  2F0F A;  3GV6 A;  2B2V A;  3NQI A;  1JOO A;  5I4D A;  2F0Q A;  2Q8R E;  1WD0 A;  3KBX A;  1PFB A;  3C3L A;  1RJT A;  2MUY A;  1Q12 A;  4ULL A;  4G4K A;  1HQM C;  4FXK C;  3V05 A;  1B44 D;  4IFD J;  4DXF A;  1AN8 A;  2RKS A;  1G91 A;  1D5X C;  2HCI A;  4C3I G;  4A3G B;  4FP5 D;  3ERQ A;  3V2T A;  5EPL A;  4F8M A;  3NTH A;  5C0X J;  1HFG A;  1TQO A;  2BE5 C;  2NVY B;  3RD4 A;  4OO1 H;  1STG A;  2G9D A;  1FR3 A;  3AB9 A;  2F0J A;  1B4O A;  4PNY A;  3LWE A;  4J6H A;  2RBM A;  2EJG C;  3DXJ C;  2EJF C;  2JA8 B;  4KV6 A;  4H44 C;  3FPP A;  3BDC A;  1QJO A;  4OHJ A;  3GTK B;  4FNF A;  1RTO A;  2QCP X;  3HOX B;  2IWH A;  5JOB A;  2DNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...