4DR7Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr7Q00
2WAQG 1NTGA 2I5LX 4DK3C 2JA5G 3HOUG 4A3JH 1SE8A 3AFQA 3OW2A 1I94Q 1IBLQ 2D0OA 2K52A 2JK8A 5ELNA 1JJCB 2ZJRA 1PA6A 1GD7A 1VQEA 4PG3A 4A3DH 5IYCH 4P72A 4BA1I 3CCQA 5LMUL 2E2HH 1AE2A 4B3MQ 1Q46A 3PUWA 1C0AA 3MXNB 3UE1A 2VL6A 3EIVA 4A75A 3AYHB 2JJQA 4GKJL 1VQNA 1K83H 4RMFA 3F2BA 1IBML 1IL2A 3PIOA 3L2PA 3T1YL 1OXTA 1K3RA 4DV3L 3HOWH 2E2JH 4DUYQ 4IPGA 1TWGH 3U4ZA 3E9IA 2UXDL 4DPGA 1DGSA 1HNWL 3J81c 2WFWA 4JCVE 1YBYA 4C2MH 4DK6C 1VQ8A 1N33L 1Q81C 4LF8L 5JJIA 1QZGA 3S1QH 4TVAB 3J7A5 3CPWA 4GN4B 1E1OA 4JG2A 3HOYG 3UDGA 3TEHB 4DR3L 4LF4Q 1XNQL 3RN5A 4DV4Q 2K5NA 2L15A 1L1OB 1Q1EA 3ICEA 1I94L 1VQCA 4GLXA 1IBLL 1YEZA 1GKHA 2N3SA 4OXPA 1MIUA 4AIMA 2K4KA 1KD1C 1ASYA 1EOVA 1HH2P 1LTLA 1X6OA 2CWAA 3STBD 3A5ZB 3EBEA 4BBSH 5IY0A 2K75A 2Z6KC 4GOPC 2VY3A 3CCLA 3A74A 1VQ7A 2JE6I 2JA8H 3PUXA 3H3VI 2YTXA 1YI2A 1VQLA 1HZBA 3HKZG 4HIMA 1M1KC 3BJUA 2R7ZH 1PH4A 4NXMQ 2D0PA 3OTOQ 2IT1A 3CCMA 3G4SA 3D0FA 5FJ8H 4HJAA 4ALPA 1Y1VH 3CMAA 1N8RC 4JBMA 4X65Q 1WCMG 5M5WH 2AWNA 3NELA 2NZHA 4L5SA 1EQQA 3W1BA 1X65A 3ER0A 1FJGL 2VQEQ 4YCVA 1E1TA 1A62A 4TQUS 4DUYL 3RZDH 2BA0A 2JA6H 3I2ZA 4YCWA 2Z6KA 3U4VA 3HOVG 4GOPA 3S14H 1E24A 4BXXG 3PO3G 1Y1WH 5BR8Q 3PF4A 4O2DA 2Q2UA 4IOAA 1KIXA 2R92H 5LMNQ 4DUZL 4DR5L 4A3CH 4JOIC 4QY7A 5IYDG 4RG1A 1C9OA 1IYJB 1UWVA 4YWKA 4A3EG 3HOXH 4DV4L 4OX9Q 3AEVA 5EAYA 5E7NA 3BU2A 3RZOH 3FP9A 2A1AA 2V1CC 4A3IH 3FKIG 1OXXK 4IPDA 4DV1L 1LM0A 5IWAQ 3M4PA 3I4MG 2OTLA 2IHEA 4OWWB 4LFBL 2PQAB 1PFSA 1VQFA 2OQ0A 2N78A 3JC66 3RLNA 2IY5B 5GROA 4DKAC 4A93G 4AQYQ 4JI0L 1XPOA 2ZJPA 5AJ3Q 4HJ5A 1HJPA 3KJOA 3M4OH 4H02A 3RNUA 1VQ5A 4NXML 4JOIA 3OTOL 3PF5A 1YHQA 1XNRQ 4LW1A 4A3FH 1WJJA 5IT9c 1U0LA 2AHOB 3DLLA 4J15A 1YJ9A 5IYBH 1X9NA 1E7ZA 2B3GA 3GTGH 1J5EQ 4GN5A 4LF9Q 3E9HA 3J80i 4JI6L 2DGYA 4AH6A 3I4NG 4Y52H 1A8VA 4BY1G 1NY4A 1L0WA 4DAYB 4R1JA 4NXNL 2D62A 2RF4A 1W3SA 2GVAA 1Q8KA 3S1NH 4K0KQ 4JI3Q 5BR8L 1NJIC 4BY7H 5FLMG 1K73C 3KJPA 5C4JH 2JEBI 1V1QA 1TWAH 1K8AC 1YHAA 1VQPA 1S72A 4KHPQ 2UXBL 1N32Q 2QEXA 4OX9L 3RLFA 5M3FG 1VQGA 2NN6I 3H0GH 4PZ8A 4LF7L 3TS2A 5IWAL 4IFDI 4A3BG 3E0EA 2PMZE 1HNZQ 4GS3A 2HIVA 3M9BA 5AJ3L 4X66Q 1PH1A 4DR1L 3FHWA 4LUZA 2JA5H 1XNRL 2H5XA 1WOCA 1YVCA 1IXRA 2E2IH 1L1OC 2MO0A 2IHFA 3CQZH 3LGJA 4GN3B 1CKNB 4MZ9A 4Y7NH 4P71A 1YIJA 4MTNA 1Z9FA 1XJVA 1J5EL 1IBKQ 1TWCH 4QL5A 4R4CA 3I55A 1K8GA 2ES2A 3S2HH 3K7AH 1LYLA 2K14A 1K0RA 3GDEA 1X3EA 5M5XH 3DM3A 3G71A 1W2BA 2R93H 5DLQE 3HFZB 4POGA 2K5VA 4JBWA 4BBRH 3G6EA 1PH7A 4A3DG 1VQOA 4JI4L 4IO9A 4X6AH 2UU9L 4DR7L 4OWTB 1JJGA 4B3RQ 2XGTA 2RHSB 1S40A 3U50C 3W5OA 4JBKA 1SN8A 1VQHA 1YHBA 5IP7G 5J3BA 3J81j 4KHPL 1YZ6A 1K9MC 1CKMA 2I5MX 4FDBA 4LF6Q 3CP0A 2I5HA 2PNHA 2WAQE 4LNQA 4A3GG 1Y14B 3WWVA 1P8LA 2EXDA 1QUQA 2Q2HA 3H15A 1PYSB 3S24A 1N9WA 1UEBA 3CCVA 2VUMG 2Z0SA 4GKKQ 4UP8A 3KDFA 1X54A 4P75A 2NN6G 2VW9A 1HNZL 2DUDA 4QIWE 2B63G 1NMGA 4X62Q 2UUAQ 4IFDG 3CD6A 1KXLA 2VNUD 4A3MH 1TXYA 3RN2A 4DV0Q 3CCJA 4BA2I 1CSPA 4IPHA 4YY3Q 4R4TA 1B70B 1IBKL 1OXUA 4B3ML 3F2DA 1HNXQ 3ULLA 4L5RC 2JA7G 2KENA 1HZAA 4JI1Q 4EQ5A 1SMXA 3PIPA 1FL0A 1NMFA 2C35B 3A0JA 3CPFA 3HKSA 1FGUA 4R4OA 4DV2Q 1VCIA 3F1ZA 3HOYH 4DV5Q 2CKZB 2OCEA 5IE8A 4OO1G 1BKBA 1WCMH 1H95A 2ZTEA 2R7ZG 1BVSA 2E8GA 1Q86C 2UUCQ 3M7NA 1PVOA 2MO1A 1OXSC 3S1RH 3UDIA 4LF6L 3KF6A 3UDFA 3TQYA 4KI0A 2ATWA 4MNOA 3OYYA 4DR2Q 1TWHH 1KRSA 3AQQA 4LF4L 3HOVH 1XTDA 4PMWA 4BXXH 3PO3H 3PUVA 3PV0A 2AKWB 1XMOQ 1XPUA 2YTVA 5H1SE 3IRBA 2R7FA 1A0IA 2KHIA 4P74A 1T9HA 2BH2A 1NE3A 5IYDH 1MKHA 3GTOH 1KHIA 3CCSA 4WJ4A 3HKZE 5C3EG 4X62L 5C44G 2UUAL 4GLAC 3BZCA 4IJLA 4NPSA 1MJCA 3FKIH 4LF5Q 3GTPH 3HOZH 4DV0L 4DV6Q 1SFOH 2F4VQ 4GNXB 4POFA 1A63A 4A3LH 1KQSA 3F8TA 4DAMA 1EQRA 5M3MG 4YY3L 2ZM6Q 2UUBQ 1HNXL 1SROA 2NZOA 1HR0Q 4JI1L 4X65L 4A93H 3B6YA 1OXVA 4GOPB 5HY6A 1V43A 2VQEL 2EIFA 2WP8J 4QGUA 4DV5L 1XPRA 3CC7A 3CXCA 3GTLH 3PUZA 2KCTA 3H3VH 3M3YH 3L7ZC 1VQIA 5JJKA 1RIPA 4QJFA 1B8AA 1QVCA 4KLKA 2ASBA 1EWIA 4BY1H 1VS0A 3M4QA 5LMNL 3NEMA 1IZ6A 1X3FA 3PUYA 4L5QA 4LWCA 3GTQH 3J81i 4JV5Q 1TWFH 1PV4A 4HIKA 3ERSX 3PO2G 1HNWQ 1YITA 4IFDJ 2A19A 2CQOA 1Z47A 5GAGC 2XTIA 3PGZA 2F52A 1G51A 2ZJQA 1EFWA 2B29A 4LFCQ 4C3IH 1ASZA 2LSSA 3S15H 3PSIA 1YNXA 4A3KG 4DR4Q 1UE7A 1SLJA 2OQKA 4LFAQ 4DV7Q 3EN2A 4GKJQ 2ALYB 1U5KA 1Q12A 5M3FH 2GN5A 2HQLA 5IP9G 1L2FA 4LF5L 4AQYL 1CSQA 2VQFQ 4DV6L 3ZJYC 2F4VL 5C4XH 4O0AA 2YV5A 1PH9A 1GVPA 2ZM6L 1PH8A 3HOUH 3S1MH 3K81C 2UUBL 2UXDQ 4A3BH 1HR0L 4GLVB 3CCEA 3TRZA 2CWPA 1N33Q 2JA6G 2BA1A 4LF8Q 1O7IA 4YHHQ 5K36G 1QZHA 4A3JG 4LF9L 1CKOA 1RL2A 3I4OA 5JEAG 4OO1I 4DR3Q 1MJEA 4B3TQ 3U58A 1XNQQ 4UY8C 1NBWA 1G291 2IX0A 5HGQA 3TREA 3ULJA 4NB3A 1AH9A 1PH6A 2YU9H 4K0KL 1Q1BA 1N36Q 4JI3L 3KLWA 2N49A 1I3QH 1EYGA 4WJ3M 3D31A 3GO5A 5IYCG 2E5LQ 4UP7A 1I6HH 3CC4A 1X3GA 2MNAA 1VQ4A 1L1OA 1KAWA 3CMEA 3S2DH 4JV5L 1N32L 4HJ9A 1JT8A 5C0XG 2BH8A 3KOJA 3NENA 2R93G 3J80c 2ZTDA 4IOCA 3KFUA 1E3PA 3Q8DA 5IP7H 2JA9A 4BBRG 3HOWG 4P73A 4LFCL 4DR4L 2IX1A 4A3GH 3F2CA 4DV7L 4LFAL 2HT1A 4L5TA 4JI5Q 2WB1G 1FJGQ 2KHJA 4JC0A 3I56A 1SR3A 1M90C 2VQFL 4X66L 4PZ7A 3SGIA 3CCUA 2VUMH 2YTYA 1PH2A 1VQBA 4UPAA 3VDYA 4C3HH 3UDXA 5FLXc 2F3IA 2N8NA 4YHHL 1B7YB 4HJ8A 4IPCA 2B63H 1PHJA 1CUKA 4DUZQ 2I0QA 4DR5Q 2JQOA 2LXKA 5LMNW 1JMCA 2JEAI 4B3TL 3G48A 4XTCS 4BBSG 2QA4A 4EX5A 1OTCA 2NVQH 1N34Q 1C7YA 4GNXC 4A3MG 2GVBA 2JA7H 1N36L 1LUZA 2JA8G 1QUQB 4DV1Q 2ID0A 4B3RL 4A4IA 4LUVA 2E5LL 5JJLA 3S17H 4LFBQ 1Q82C 1VQ6A 1JJ2A 5FJ8G 4PZ6A 1Y1VG 3JAMi 2UXCQ 3KDFB 2NVXH 2Q2TA 4JI0Q 1BBUA 1VQDA 4JI2Q 1YJNA 1EIYB 2PI2A 3K8AA 2HHHQ 5GAEC 3CC2A 4B3SQ 1UE5A 2AWOA 2YYZA 2WB1E 4X64Q 1D7QA 2PQAA 1VQAA 2NVTH 1WYDA 3J7ZC 2HIXA 1HR0W 2CCZA 3GTKH 4GKKL 2MFIA 2Y0SG 1P16A 4JI5L 1FVIA 2OWOA 5GQOA 4GNXA 3M85A 1KL9A 1UE1A 3ULPA 4HIOA 1Y1WG 4JI6Q 2CFMA 4YWLA 4A3EH 4A76A 4QQBX 4JBJA 4DR6Q 2K5HA 2R92G 3STBC 1HZ9A 2ZTCA 5JEAJ 4A3CG 4NXNQ 1V9PA 1Q7YC 1HZCA 1R9TH 1XMQQ 3HOXG 1GM5A 1VQ9A 5ELOA 3UE0A 4JYAQ 1UE6A 3I4MH 2R6GA 5C3EH 5C44H 3T1HQ 4A3IG 4UP9A 1AE3A 2VZAA 2OTJA 2UXBQ 4JI7Q 4AYBG 2KCMA 1KC8C 4R4IA 1PH3A 1WFQA 3I7FA 1VQJA 3MEFA 1X55A 5M3MH 3TS0A 3KF6B 1X56A 4HJ7A 4DV2L 1N34L 1JB7A 4JI8Q 3HOZG 4LF7Q 2EQSA 4ME3A 5C0XJ 4A3LG 3W1GA 3PCOB 3CW2C 1BBWA 2UUCL 4A3FG 3L0OA 2UXCL 1G6PA 2KBNA 5C0XI 4JI2L 5IYBG 3I4NH 1I5FA 2AMCB 2HHHL 1I50H 2Y0SE 2MQHA 3K80C 2LXJA 4DR1Q 4DR2L 4B3SL 2PI2E 1JE5A 1J6QA 2NVYH 4X64L 5GADC 3GTJH 5M5YH 1VQKA 1XMOL 3GTMH 5LMUQ 5FLMH 2RHQB 4YCUA 3AFPA 3CCRA 3BZKA 1EIFA 1QVFA 1E22A 4R4QA 3PO2H 4DR6L 4BY7G 1EUJA 3KF8B 2RCNA 1IBMQ 3S16H 4OONA 4XIGS 3JAMc 1SRUA 1CKNA 3T1YQ 1S3OA 3KYHC 4YWMA 1KRTA 4AYBE 4DV3Q 4HIDA 1XMQL 4JI4Q 4JYAL 2UU9Q 4DR7Q 3RLOA 2Q2IA 3T1HL 4A3KH 3H0GG 3RR5A 4KHZA 4IJHA 4APVA 1WI5A 1GO3E 4LUOA 1YJWA 1QVGA 3CF5A 4C3JH 5IP9H 4JI7L 2R7DA 3K7UC 2A8VA 3GD7A 4DNIA 2QGQA 1PH5A 3NBHB 3A5UA 5GAHC 1D8LA 3K0XA 1PYBA 1VQMA 4JI8L 2FXQA 3CAMA 4OWXB 2K50A 5C4XG 2VS1A
chains in the Genus database with same CATH superfamily
2MHVA 1NTGA 2JA5G 3OW2A 2RVLA 3NWSA 4C3JB 1KNEA 1FYCA 2D0OA 5ELNA 2JK8A 1H9RA 1KLUD 3VYSA 4DF7A 3K57A 4HCSA 3WDNA 3A8KE 4FXDA 4A3DH 1LT5D 2D5DA 4P72A 3MTSA 2K33A 5LMUL 4B3MQ 1Q46A 3D6CA 2VL6A 4A75A 4MN3A 4GKJL 1K83H 4RMFA 4RCOA 3PIOA 3L2PA 1EOTA 4OL7A 3HOWH 3KK7A 4DPGA 3J81c 4C2MH 1VQ8A 1N33L 4OIJA 4LF8L 2PZUA 1QZGA 3DEOA 4MIUA 2ZXOA 4KD3A 1E1OA 1K83B 2R93B 2A69C 4DR3L 2NYZD 4KV6A 2Z1CA 4DV4Q 2X6GA 1L1OB 3ICEA 5D3DA 4C2MB 4GLXA 1IBLL 4OXPA 2N3SA 4CDEC 4AIMA 3S1QH 3STBD 4BBSH 3EBEA 2K75A 2Z6KC 1LTGD 4M8AA 2F0UA 4IUPA 1XYIA 1VQ7A 2JA8H 2B2TC 3OMCA 3BJUA 1STEA 2N88A 4NXMQ 1LO5D 5EBCA 2IT1A 3CCMA 1ET9A 1KLGD 3G4SA 4HJAA 4JBMA 1Y1VH 3CMAA 3HOYG 5M5WH 2NZHA 4BBSB 3W1BA 1X65A 3NTKA 4HMIA 2XSCA 5C4HA 3IFTA 4IUVA 1A62A 4DUYL 2JA8B 4DA2A 5BN3A 1Y1VB 4B9XA 1Y1WH 3PF4A 2PCFB 2ZT9C 1ML0D 4DR5L 4A3CH 4JOIC 3HOYB 1CHPD 3HOXH 2LKVA 3T51B 5E7NA 1SDFA 4TSSA 3RZOH 4Q5VA 1Y1WB 4NW2A 2B8GA 2F0NA 3M4PA 3MA2B 3HP3A 4EQOA 4OWWB 2PQAB 1O7ZA 3RLNA 2N78A 3QO2A 1TU2B 2IY5B 4RKLA 5GROA 1SXTA 2F4IA 1HQRD 2BDNA 5AJ3Q 3HOXB 1STHA 3RZOB 1XNRQ 1YHQA 5KNBA 3GTOB 3DLLA 1YJ9A 1E7ZA 1L0XB 1J5EQ 1Y8OB 3D3RA 3E9HA 4OIKA 2DGYA 2Z6BA 1SNQA 4R9WA 4R1JA 4NXNL 4K6LA 2D62A 3S1NH 5KNDA 1O7LA 4BY7H 3KJPA 1V1QA 2OXPA 2PMZB 3NHHA 4J6HA 4OX9L 3RLFA 4X3KA 1VQGA 4PZ8A 3MWYW 5ELCA 3S1NB 5IWAL 1YNNC 1G8ZD 4L63B 5LHY1 1AN8A 4A3BG 3E0EA 5J39A 2D2CC 3HG9A 1IXRA 4LAAA 4C3IB 4MZ9A 1YIJA 4MTNA 4DU9A 1XJVA 1TWCH 4QL5A 3I55A 3X3NA 1W6JA 1X3EA 4EQNA 2EYOA 1VQOA 2HCCA 5T1IA 1GUTA 3P7JA 3W5OA 1TWCB 1LTSD 2QEJC 3J81j 1UEAB 5I2YA 4LF6Q 4LNQA 4ABNA 2A74C 2PNHA 2WAQE 3WWVA 2EXDA 1PYSB 1N9WA 3C2PA 3CCVA 2B2UA 2KEDA 1TIID 4UP8A 3BDOA 4P75A 2QDBA 2R61A 1HNZL 1U4PA 1X32A 1EYDA 1NMGA 4X62Q 2CH4A 3F2UA 4DV0Q 4M1UB 4BA2I 1C4QA 1TS5A 1HNXQ 3SK4A 4JI1Q 3NTIA 1FL0A 2DNCA 2WKDA 3A0JA 4HMJA 1H9SA 2RDHA 5EJWA 1JWUD 4FXKC 3CPFA 3HKSA 2PZTA 4DV2Q 1VCIA 3F1ZA 4C3HB 1ZYRC 1WTXA 5IE8A 2BE5D 1WCMH 3FMCA 2Z9HA 5IT9L 4L6TB 4G7OC 3QWNA 3AMUA 2UUCQ 2PW5A 1QWYA 4WORA 2SNSA 5EQ0A 3KLSX 2F0LA 4BXXH 3PO3H 2AKWB 1WCMB 1XPUA 5H1SE 3IRBA 1A0IA 2MUYA 3L9AX 3S17B 5IIFA 1SNMA 1FGBD 3HKZE 5C44G 1VF7A 2UUAL 3R2IA 2PW7A 3ONAB 3BZCA 4IJLA 1EY8A 1MJCA 1PYWD 2K05A 3GTPH 3T4AC 3PO3B 2EE1A 4DAMA 1EQRA 1A3TA 1LLRD 4F87A 2UUBQ 1SROA 1HR0Q 4X65L 4A93H 3J7YW 4GOPB 1XXGA 5IGDA 2VQEL 2EIFA 1PFBA 3RD4A 4ZAIA 2PNRC 5EKLA 4DV5L 1XPRA 3M4YA 1YNND 3A8JE 3M3YH 5J22A 3BVGA 4QJFA 2DY7A 2CQAA 4KLKA 3NBHA 4A93B 1GUWA 3Q22A 3DXJC 3P20A 3NEMA 3GTQH 3K59A 2EOTA 1TWFH 1ZKOA 3VR3A 1EYCA 2A19A 5GAGC 3M3YB 3PGZA 2AQ2B 3NQIA 1BUVT 1G51A 2ZJQA 3J81L 3DM1A 1JB3A 4LFCQ 1Q3LA 2OQKA 1SLJA 4GKJQ 1U5KA 5M3FH 3GTQB 1S5DD 2HQLA 5KEEA 1EQTA 4AQYL 4LF5L 1TWFB 5C4XH 4I7AA 4O0AA 2YV5A 4RAUC 1PH8A 3HOUH 3K81C 4XQNA 3TRZA 1N33Q 2JA6G 4LF8Q 3BDCA 5DAUA 1ICFB 2B2WA 1LTRD 3S16B 3MC0B 5JEAG 4HN7A 4OO1I 4DR3Q 4B3TQ 2FFKB 3SK6A 5LL6S 5DNFA 2YU9H 4K0KL 4JI3L 1I3QH 1EYGA 1I6HH 1X3GA 1VQ4A 3S2DH 1H9MA 4FNFA 2BH8A 2BCOA 3KOJA 1MHWC 3KFUA 2YU9B 2JA9A 4BBRG 4CHTB 4P73A 1I3QB 2XWJB 3KBXA 2IX1A 2DJGC 3AB9A 1AP0A 3TZUA 2HT1A 2F03A 1I6HB 4WRDA 4LMQD 1M90C 1ZYRD 2OEOA 2NBFA 1G2TA 1NCVA 1WD0A 3WOFA 3SHLA 4UDUC 3KLSA 2NN6H 4K2KA 2N8NA 4HJ8A 4DR5Q 2LXKA 1CI3M 4XTCS 2E2JB 2QA4A 3L3OC 1RODA 4A3MG 3BVZA 2K28A 3QR8A 1STYA 1PFMA 4RFBA 2K6AA 2ICIA 2KVMA 5T1GA 4B3RL 1JC7A 2DY8A 4PV1C 1VQ6A 1H9JA 4QUFA 4TKOB 2UXCQ 4KHVA 1AEXA 3M7GA 1CQVA 5CBAE 2HHHQ 2OT2A 3OPOA 2NVTH 2HIXA 3Q24A 2CCZA 3GTKH 1T5XD 3QOJA 4JI5L 2PZWA 5A2QL 3D4RA 1BO0A 3M85A 5IT9E 4QQBX 1HZ9A 4WFN3 4NXNQ 2R7ZB 1KDBA 1PFNA 4JYAQ 3GTKB 4KK7A 2GA4B 5C3EH 3LX0A 2EDGA 4A3IG 4UP9A 1RKNA 1K8MA 2IX3A 1KC8C 2TMPA 3MEFA 3TS0A 1QE6A 3KF6B 1HPCA 1X56A 1N34L 3HOZG 3CW2C 5C3EB 2RQXA 5C0XI 4JI2L 1I5FA 5EBDA 1I50H 2Y0SE 3R93A 2LXJA 1HTPA 1A15A 2NVYH 1TY0A 4X64L 5GADC 5M5YH 5C5LA 3H94A 5FLMH 3KBGA 4YCUA 3AFPA 4R4QA 3PO2H 4OELB 3KF8B 1SEBD 2MGSA 2NVYB 1I4QA 4AYBE 4DV3Q 1KRTA 1XMQL 5M5YB 1B2TA 1E2VA 1Y69U 4A3KH 2Q2IA 3T1HL 4KHZA 4HSVA 4LUOA 1GO3E 1YJWA 3CF5A 4JI7L 1EY9A 2FMMA 3CHBD 3PO2B 3Q23A 3A5UA 5JAVA 1D8LA 1VDZA 3K0XA 1PYBA 1VQMA 1QNKA 4JI8L 2FXQA 3D4WA 2K50A 2I5LX 4A3KB 1STBA 3AFQA 3DWPA 5EGTA 5JOBA 1JJCB 1PTOC 3MZ5A 5NUCA 1HA6A 2VXWA 1VQEA 5IYCH 3CCQA 4V190 1KDAA 1C0AA 1I4HA 3PUWA 3MXNB 1BF4A 4CJ1B 3AYHB 3BG3A 1EY0A 1IBML 2QF7A 5IGEA 1OXTA 3D4DA 3C1EA 4IPGA 1TWGH 2F0EA 3E9IA 2NUCA 2KCNA 4TVAB 3J7A5 4GN4B 4KMUC 3TEHB 2O5IC 2IJ0A 2K5NA 1DYQA 1TWGB 1Q1EA 1I94L 1VQCA 2JP1A 1YEZA 4NDXA 5DM63 1MIUA 2C5CA 1KD1C 2IWHA 1ASYA 1HH2P 4FVMA 4XT3B 1VQ5A 1ILQA 2ICEC 1PDQA 1YI2A 1VQLA 2O2LD 2E75C 4HIMA 1M1KC 3OW7A 1UUPA 2D0PA 3OTOQ 4RA8A 5FJ8H 1N8RC 4X65Q 2TSSA 4DN4M 1FJGL 2VQEQ 1IW7D 3A54A 3RZDH 4N8FA 1L0YB 2F0FA 3HOVG 3TP7A 1LACA 2F0JA 1DONA 3EFXD 5J1ZA 4IOAA 2JN4A 2R92H 4FF1A 5EPJA 4QY7A 5IYDG 4RG1A 1C9OA 2K1BA 1UWVA 4A3EG 2QCPX 1Q8IA 3AEVA 3A8IE 4CGYB 2Y0SB 2L4NA 3FKIG 1OXXK 1LM0A 3I4MG 2R92B 3JC66 3K0YA 2RDFA 1PZKD 4IQZA 4BWGB 4AQYQ 1R4QB 2ZJPA 4G57A 3NSWA 1DXMA 1NAPA 4F8MA 3M4OH 2X69A 3MXPA 4LW1A 1HFNA 4A3FH 5IT9c 5I4DA 2QDLA 5I6WA 1X9NA 5FO8B 1RDPD 3GTGH 3J80i 2QKIC 4N9TA 3I4NG 4Y52H 4BY1G 4DK0A 2SOBA 1RD9D 1NY4A 1SE3A 3M4OB 4XYQA 1K8OA 4K0KQ 1Q8KA 4A3FB 4JI3Q 5BR8L 3VYUA 3SXHA 1NJIC 1PTOD 1TS3A 3GTGB 1K73C 5C4JH 2UXBL 1K8AC 4KHPQ 3FVQA 2QEXA 1V8QA 1STAA 2NN6I 1EWCA 1E2ZA 5K36H 5C4JB 2PMZE 4GS3A 1DCZA 3M9BA 5LL6X 3R3OA 4NMZA 4DR1L 4LUZA 1TKWB 2N55A 2JA5H 1YVCA 2E2IH 1L1OC 4KKUA 1CKNB 1JOOA 5COYA 3S15B 2Q8RE 1IBKQ 2ES2A 1K8GA 4DNRB 2K14A 2L12A 2B2UC 1QILA 2PQEA 1IL8A 2R93H 2JA5B 2RA4A 5EKIA 2K5VA 2G9DA 4JBWA 1JOKA 4A3DG 2E2IB 1ZXTA 3U9OA 4MHEA 4X6AH 3I91A 4XXEA 4B3RQ 3U50C 5IP7G 2IL8A 4XDXA 1B3QA 3SK8A 1Y14B 1QUQA 3S24A 5JPNC 1UEBA 3FEWX 5C6AA 1SAPA 2VUMG 3E6ZX 3Q6SA 4J1MA 1BCPC 1X54A 4HEDA 2DUDA 3VR4A 2CW0C 1BOSA 4IFDG 5JVH3 2VNUD 1KXLA 1TXYA 2BDOA 4HTHA 3CCJA 1CSPA 1PMRA 4YY3Q 4R4TA 2AQ1B 3SEBA 2A68C 4EQ5A 1SMXA 2RDGA 4R8NA 1NMFA 5JJZA 5I9PA 3HOYH 1JQYD 5F2DA 4OO1G 3TZDA 1H95A 2KJXA 4RGNA 1V1PB 2E8GA 2F0MA 2MO1A 3TBIB 1LTTD 3UDFA 1JWSD 5M9OA 2F0HA 1KRSA 4DGZA 4LF4L 4PMWA 1MBYA 4PNYA 3PUVA 4UHVA 3QIAA 4WJWA 1KNAA 2KHIA 3GTOH 1KHIA 2NVXB 2BE5C 1B1ZA 2F1MA 1RTNA 2F0GA 1BNZA 4DV6Q 1SFOH 3F8TA 1LT6D 2NZOA 1NR2A 2F0VA 3NXWA 2WP8J 1RJTA 4QGUA 1SFOB 3PUZA 1JE4A 2KCTA 3ZYYX 1EY4A 2ASBA 3M4QA 4CKBA 2EYLA 1DD2A 3J81i 4KJOA 4HIKA 3K6OA 1X3QA 2EVBA 2B2WC 2F52A 1EFWA 2XN9C 2I07B 4C3IH 1ASZA 4DR4Q 5KYLA 1M8AA 1DOKA 1GUNA 4FF3A 1D2BA 2I46A 3PIP3 1WTVA 2F4VL 1F9PA 4DNTB 4S3SA 1PH9A 2ZM6L 4DXFA 4A3BH 3HS0C 3CCEA 1XWEA 4IURA 4JK1C 2D9UA 1O7IA 4YHHQ 4KY6A 3P75A 4A3JG 3GV6A 2FJ2A 1RL2A 3I4OA 2WACA 3T13A 1MJEA 3U58A 2LY7A 3ULJA 4IUUA 1BCPD 1G6ZA 4A3BB 1PH6A 1N36Q 3NUCA 4XQJA 1CFMA 2CW0D 4H13C 3BYYB 1B9NA 2H1EA 3CC4A 4ZUJA 1TR5A 2G9HD 1L1OA 4V0BA 4JV5L 1N32L 3MEHA 4TRDA 5C0XG 3TP5A 5IGFA 2DN8A 2A68D 3Q8DA 1EY6A 4PQXA 3F2CA 4DV7L 4LFAL 2B2YA 2WB1G 1FJGQ 2MPMA 1SR3A 2VQFL 1I6VC 3VA7A 3SGIA 4N8X1 2YTYA 5KIXA 2E2HB 3VDYA 4C3HH 2A5HA 5FLXc 1FD7D 3FRPB 4O1NA 1CUKA 2I0QA 5LMNW 1JMCA 2HUGA 4EX5A 2WB1B 1HCZA 2E5LL 3S17H 1Q82C 1PZID 2EJFC 3JAMi 3KDFB 1YJNA 3K8AA 5K5PA 2HQEA 4B3SQ 1ESFA 2YYZA 1I4XA 2G5DA 2WV6D 2KCCA 2PQAA 1VQAA 3BDLA 1WYDA 4X3UA 3J7ZC 1HR0W 4GKKL 5CV5A 5GQOA 1TY2A 3ULPA 4YWLA 4K6DA 2ZTCA 1GHJA 1V9PA 1HZCA 1GM5A 1VQ9A 1F9RA 5ELOA 1CT1D 1SJHD 5C44H 2VZAA 2UXBQ 2XVSA 4RWSC 4R4IA 3NBIA 4KKTA 3OSOA 4K2LA 5DM73 3PCOB 5C44B 1BBWA 3MFGA 1ENFA 3L0OA 1KDCA 5IYBG 3QOLA 2AMCB 3URYA 4DR1Q 3K80C 4DR2L 2PI2E 3O13A 1PTOF 1B44D 4JW0A 3OMGA 1AZQA 4XT1B 5LMUQ 2F0TA 2EPBA 3LNNA 1E22A 4DR6L 3X3MA 2RCNA 2SEBD 2RCFA 3S16H 2H4OA 4KJNA 3DEPA 1QCBD 1S3OA 3KYHC 4YWMA 3BS1A 4KKSA 4ZCKA 1GUSA 3H0GG 4APVA 3N6RA 2K7VA 3K7UC 3H6MA 4DNIA 2P5ZX 4C56C 3TP6A 3CAMA 2JA6H 1ZEQX 5C4XG 2VS1A 2WAQG 5CBEE 2SDFA 4FP5D 3MHBA 3HOUG 1AZPA 1IBLQ 5JEAH 1TWAB 1HQMC 1LV9A 2K52A 3QB3A 5HURA 3H0GB 3N52A 2ZJRA 1S4ZA 3PQIA 2C9OA 2JA6B 5ISRA 2RSNA 1TQOA 1AE2A 3UE1A 2RBMA 3EIVA 4I65A 1VQNA 4ZYSA 1I4GA 3F2BA 1EL0A 3T1YL 1Q90A 1MGSA 2E2JH 2AUKA 4DUYQ 2L5TA 3U4ZA 2UXDL 1HNWL 2WFWA 4JCVE 3S2HB 1SSOA 1Z6HA 1Q81C 3K7AB 3EQLC 5CYUA 5M5XB 3K5NA 3TSSA 3OHXC 4H44C 3UDGA 3NPPA 4LF4Q 3IAYA 1XNQL 4BBRB 4LJZC 3ERQA 4X3SA 5BN5A 2XIWA 1SJED 1SYGA 1RF2D 1GKHA 4EQPA 1SMYC 1AFPA 1FNUA 2K4KA 1EOVA 1QJOA 1LTLA 1X6OA 2DJFC 2WIIB 3A5ZB 4J8QA 5CV6A 5IY0A 3EVQA 4K8JA 1U4RA 2VY3A 3A74A 3HKZG 5EPKA 1PH4A 2R7ZH 2K5WA 4L5SA 3OWFA 2PPBC 1SYFA 4B9WA 1EQQA 4KTAA 1V1OA 4YCVA 4A3MB 3C3LA 2MP1A 4RGTA 1F2ZA 4TQUS 5CC4A 1B9MA 2BA0A 4CBVA 2NB0A 3I2ZA 3U4VA 3S14H 4GOPA 2HDLA 4EGVA 4C1NI 1GXDC 1KIXA 4DUZL 2E76C 4DV4L 1PLFA 4OX9Q 3FP9A 3HZXA 4A3IH 3S14B 1IW7C 3S1RB 1PRTC 5IWAQ 2L1BA 2OTLA 2IHEA 3DWQA 4LFBL 1VQFA 2OQ0A 4FF2A 1IYUA 2F3VA 4JI0L 4HJ5A 2FINB 1J8IA 3KJOA 1SBBB 5G3LD 3RNUA 1ENAA 4NXML 4A3IB 4DAPA 2E74C 2AHOB 3E3XA 2B3GA 4XYOA 4EVOA 1EFID 1GOZA 4GN5A 3HOZB 1A8VA 4IZ8A 3SVMA 1EIHA 1L0WA 4DAYB 5TSSA 1VMCA 2GVAA 2LS01 3RMHA 1SNCA 4RGOS 1HFGA 5FLMG 3EJIA 2EY5A 2JEBI 1YHAA 1S72A 1N32Q 4DAVA 2KECA 2A6ED 5FOBB 1F2MA 4B08A 3DMUA 3QJYA 4LF7L 3CKIB 5FLXL 2LFNA 4Z9CB 1T5EA 1HNZQ 2HIVA 1BCPF 5AJ3L 2PO4A 1VF5C 2J7ZA 3FHWA 4NP5A 1XNRL 1CZWA 2EYHA 3LGJA 3CQZH 4GN3B 1S5FD 1GUOA 4P71A 4Y7NH 1J5EL 1Z9FA 2XRQD 3I72A 2F0WA 1GHKA 1LYLA 1K0RA 3GDEA 1CM9A 3G71A 3S1MB 3BZDB 5ELDA 4POGA 1SMYD 2M9VA 1A2TA 4IO9A 5CR3A 3CQZB 1NR4A 4U68A 4DR7L 2RHSB 4Y7NB 1S40A 1SN8A 1VQHA 1XTCD 5J3BA 1CKMA 4A3GG 3CP0A 2I5HA 1WVLA 1P8LA 4GKKQ 4KD4A 3EA6A 4N9PA 2VW9A 1O80A 4KY7A 3BVMA 4QIWE 1NNXA 2B63G 2UUAQ 3CRLC 3RN2A 4KN7C 1NSNS 4FF4A 1HUNA 1B70B 5AFWA 3F2DA 3ULLA 4L5RC 1PTOB 2JA7G 3PIPA 2C35B 4YIJA 4I7ZC 1SYEA 1FGUA 4R4OA 4DV5Q 5D3IB 2CKZB 2OCEA 1PRTD 2QW7A 1BKBA 1JR0D 4K5XA 2VB2X 2B63B 1BVSA 1F9SA 2AQ3B 3M7NA 4CDDC 1PVOA 3UDIA 4LF6L 3KF6A 2L0CA 4HR7B 4MNOA 5CORA 4DR2Q 1KABA 3HOVH 1XTDA 4DK1A 4H0LC 1LT3D 2KA7A 2YTVA 1BXTA 2R7FA 3MVVA 2F0SA 1T9HA 2BH2A 5JPMC 5IYDH 1ET6A 2V4DA 1S5CD 3CCSA 4WJ4A 1CA6A 3K58A 4X62L 3FPUB 4GLAC 4NPSA 1KAAA 3FKIH 3EROA 5CGKA 1CA5A 3GQBA 5CV7A 4DV0L 4LF5Q 3HOVB 4GNXB 3I90A 2EYFA 1SNOA 3ND9A 4ZK9B 4A3LH 3NP8A 5M3MG 3I8ZA 5I9OA 1U4LA 1HNXL 4JI1L 3KF8A 4X3TA 3B6YA 4A3EB 3W3AA 1V43A 1A3UA 3LWEA 1WTRA 1WTHA 3FKIB 1ILPA 3PMFA 3KUPA 3CC7A 3CU7A 4ILWA 5I2XA 2B2VA 5IODA 3H3VH 3I4MB 1TS4A 2ZXRA 1HXYD 4BY1H 5LMNL 3PUYA 4P2CB 4QCLA 1K3BC 2L9HA 2ENBA 1NUCA 3ERSX 1STNA 1YITA 2A73B 1J9OA 2CQOA 1Z47A 2XTIA 1CK1A 1TS2A 1K0SA 3C46A 2B29A 1BBXC 3I4NB 3S15H 3PSIA 1YNXA 4BY1B 1UE7A 3C1FA 3EN2A 3WOEA 2ALYB 4K5WA 2GN5A 4C3JG 5IP9G 1AW7A 1CSQA 1D5MC 3ZJYC 1Z7TA 1WTQA 3MXNA 1GVPA 1OO9B 2UXDQ 4Q0FA 2UUBL 2O5JC 1HR0L 2CWPA 4BS9A 5K36G 4QF4A 4LF9L 2K5QA 2NTSA 2RKSA 5FLXE 1XNQQ 1D1IA 1G291 1NBWA 5HGQA 2L11A 3TREA 4QMGA 3E0JA 1AH9A 5EKKA 2B2YC 4F7XA 4GZYC 2EYJA 3HGBA 2HDMA 4JPBW 3D31A 3GO5A 1DM0B 3AU7A 1XX8A 2O4XA 1EU4A 4QIWB 3G6JB 3NENA 4FO2A 4CKEA 2R93G 2A6HD 5IP7H 5E1FA 3UI2A 3HOWG 4LFCL 5BN4A 1BR9A 4JI5Q 2EY1A 2KHJA 4JC0A 1W6KA 1G2SA 4PZ7A 4X66L 4A3DB 3CCUA 2VUMH 3S9WA 1PH2A 1VQBA 5KYIA 3UDXA 2Q8TA 2F3IA 2EZVA 1D1KA 4DUZQ 1PZJD 4IFDH 1CTMA 4JVZA 4B3TL 3G48A 3HOWB 4BBSG 2VUMB 1OTCA 1CHQD 3OWEB 1N34Q 2NVQH 2EY2A 1R4PB 1C7YA 1JORA 2GVBA 2JA8G 2ID0A 1WD1A 1G91A 4LUVA 4LFBQ 1IKMA 4FXGC 2ZXPA 1Y1VG 3SR1A 2NVXH 2Q2TA 4JI0Q 4JI2Q 4OO1H 1EIYB 1S5BD 1K28A 3CC2A 5GAEC 1DOLA 1UE5A 2AWOA 2NVQB 2WB1E 4X64Q 2F3WA 1EEFD 3BYTB 3S1QB 1P16A 2K32A 4R8IA 4GNXA 1Y1WG 2CFMA 1WTOA 1O78A 2K5HA 3OIQA 5ELFA 4A3CG 5JEAJ 1H9SB 1LABA 1Q7YC 3VA5A 1BCPB 1XMQQ 3HOXG 5M5WB 1O7YA 2R6GA 3T1HQ 5G3LF 4JI7Q 2KCMA 1PH3A 2F0PA 1X3PA 3I7FA 1FNWA 3I73A 1M4VA 4HJ7A 4JI8Q 4LF7Q 4ME3A 1DJRD 3NE5B 2M00A 1F9QA 1I4PA 2FMCA 1VMPA 1F77A 3I70A 2UXCL 1G6PA 4DXGA 1JWMD 5KRUA 2HHHL 2MQHA 1JE5A 1J6QA 3GTJH 2IW3A 2XNAC 1VQKA 1XMOL 4RGMA 3A56A 1EIFA 1QNUA 1B50A 4BY7G 5IOCA 1IBMQ 4OONA 3JAMc 1SRUA 1CKNA 1ESRA 1MI2A 3J80L 3TP8A 3GTJB 4JYAL 5CMDA 4DR7Q 3RR5A 2R7DA 2KUMA 4C3IG 1UNSA 3NBHB 1II3A 2KOLA 4ZUIA 4OWXB 3NK9A 2JSOA 4DK3C 4BY7B 4A3JH 3J7AF 1SE8A 2JYOA 1I94Q 2B39A 4ZLTF 2LMCB 1PA6A 1GD7A 4G4KA 4PG3A 4FYDA 4BA1I 2E2HH 4A3JB 2A69D 2RSOA 1LT4D 2JJQA 2B8FA 1I4RA 5C0XH 2EYMA 1IL2A 3P1HA 1K3RA 4DV3L 2F0QA 1DGSA 5FK9C 1YBYA 4DK6C 5JJIA 4PMBA 3CPWA 4JG2A 3NWTA 4K8IA 3GV3A 2XWBB 5FO7B 1V1PA 4QUCA 3RN5A 3R8BA 2L15A 4G7HC 5L37A 4KN4C 4C3HG 4ODGA 1B3AA 5ELEA 2CWAA 1PRTF 4GOPC 3CCLA 2JE6I 3H3VI 3PUXA 2YTXA 1HZBA 1SYCA 4ALPA 3D0FA 1WCMG 4CJ2C 2AWNA 3A7AB 3NELA 3ER0A 4F88A 3MFYA 3K5MA 1E1TA 5A35A 4YCWA 2Z6KA 4BXXG 4OHJA 1E24A 3PO3G 5BR8Q 4O2DA 2B2TA 2Q2UA 5LMNQ 3SDZA 2IPKD 2KHSA 5C3XA 1IYJB 4YWKA 5EAYA 3ITPA 3BU2A 2A1AA 3VYRA 2SNMA 2V1CC 4OEMB 4IPDA 1QB5D 4DV1L 5EPLA 3K5LA 3QG1A 1HHVA 1PFSA 5HGTA 1B4OA 2VB3X 3DWAA 2EY6A 4DKAC 4A93G 1XPOA 1HJPA 1S5ED 3R2TA 1BQQT 4H02A 1SE4A 3PIO3 2MJ8A 4JOIA 3OTOL 3PF5A 3HRZC 5CV9A 1WJJA 1U0LA 4ZKBB 4IUNA 4J15A 5IYBH 3DUZA 3IL8A 4LF9Q 1Y8PB 3D8GA 2K5DA 5IGBA 4JI6L 3GTPB 4AH6A 1MSGA 1E0BA 3T53B 1ONLA 4NKLA 3A7LA 2RF4A 1W3SA 3SK5A 3GP7A 1TWAH 1VQPA 2F0DA 3MXGA 4RHSA 1U9RA 5M3FG 1IHZA 3H0GH 3TS2A 3MAQA 4IN3A 4IFDI 3J80E 3LWUA 4ULLA 3VR6A 4X66Q 1PH1A 2XRSD 4RKBA 2EJMA 5JVG3 3TMEA 2H5XA 1WOCA 1TVXA 1MD2D 2MO0A 3IFDA 4RH6A 1WTWA 2IHFA 1EEID 2A6EC 2NZ1D 3S2HH 4R4CA 5M3FB 3K7AH 5C4XB 5M5XH 3DM3A 2WAQB 3OIPA 2OF1A 3NTHA 5DLQE 1W2BA 3HFZB 3HOUB 1A2UA 5D65A 4BBRH 3G6EA 1PH7A 4JI4L 2UU9L 1JJGA 4OWTB 2XGTA 4JBKA 4H7BA 1C48A 1YHBA 4KHPL 1YZ6A 4CJ0B 1K9MC 2I5MX 4FDBA 1UAPA 1FNVA 4K14A 2Q2HA 4ME5A 3H15A 1A6XA 1RTOA 3NQTA 1WTPA 4ZQ3A 4LK1C 2Z0SA 4ZRZA 3J7AV 3KDFA 1EIGA 3HEJA 2NN6G 4CDFC 2Z8LA 5IGCA 3S2DB 4K5VA 4XQQA 1JCKB 3CD6A 4A3MH 4IPHA 4RCNA 4B3ML 1LTBD 2R3ZA 1OXUA 3T56B 1C8CA 1IBKL 2KENA 1HZAA 1SE2A 2KEEA 1B53A 2ZTEA 1SYBA 2R7ZG 1Q86C 1D5ZC 3S1RH 1OXSC 2CHBD 3H09A 4E6IA 3TQYA 3HKZB 4KI0A 3G7LA 3OYYA 5D14A 1TWHH 2ATWA 3AQQA 3U9SA 5E3FA 3JAML 3PV0A 1XMOQ 5E4WC 1DOMA 4P74A 1NE3A 1MKHA 2B2VC 2CVRA 5C3EG 4C1NK 1HUMA 1TWHB 2FHTA 3DHQA 3HOZH 2F4VQ 4POFA 2NVTB 1A63A 4IUTA 1KQSA 3I4LA 3TDQA 1EY5A 4YY3L 2ZM6Q 5I6YA 4ZKCB 3KLRA 2DNEA 3Q0AA 1OXVA 2J4XA 5HY6A 3FDTA 1YNJC 3CXCA 3GTLH 1JICA 1EQVA 1EY7A 3H91A 3V05A 1EWHA 3L7ZC 1VQIA 3MXUA 5JJKA 1RIPA 1B8AA 2F0IA 1QVCA 2EXZA 1EWIA 1STGA 1VS0A 4L5QA 1IZ6A 1X3FA 1A3VA 4LWCA 1QOHA 4JV5Q 1PV4A 3GTLB 3PO2G 1JOQA 4IFDJ 1ICWA 1DZ1A 2Z4IA 3VYTA 5CV8A 2LSSA 4A3KG 5C5MA 4DV7Q 1I50B 5E4XA 4LFAQ 1Q12A 2AUJD 1GUGA 1L2FA 3W2DA 2VQFQ 4DV6L 5C3WA 2Q8IB 4CDCC 1PRTB 3S1MH 4GLVB 2BA1A 2K01A 4DFAA 2M2LA 1QZHA 1FR3A 1PXUA 4CKCA 1CKOA 3J81E 1F2LA 1LTAD 4UY8C 1ENCA 2IX0A 4NB3A 1EU3A 4KY5A 1Q1BA 3KLWA 2N49A 4WJ3M 5IYCG 2E5LQ 4UP7A 2X6LA 2MNAA 1KAWA 1SNPA 5DEHA 3CMEA 1JT8A 4HJ9A 2K04A 4HAEA 2NWGA 3J80c 1HRJA 2ZTDA 2BOSA 4IOCA 1E3PA 1RCVD 1EZ8A 1LTID 3VR2A 4DR4L 4A3GH 3SE0A 3A55A 4L5TA 4OGQC 1PTOH 5IGGA 4IALA 1MSHA 3I56A 2WKCA 1KTKA 4UPAA 1CZGA 1D5XC 4YHHL 1B7YB 4A3GB 3D6WA 4IPCA 2B63H 1PHJA 1U4MA 2JQOA 4HSPA 2A6HC 5KGUA 2JEAI 5FO9B 1CQFA 1Y8NB 3V96A 1EZ6A 1IKLA 2HD3A 4GNXC 2JA7H 1N36L 1GJXA 1LUZA 1QUQB 4DV1Q 1QG7A 2L55A 5JJLA 4A4IA 2K03A 1JJ2A 5FJ8G 4PZ6A 1BBUA 1VQDA 5ELBA 2PI2A 4U673 2HCIA 3VR5A 5CV4A 3T16A 2JA7B 1D7QA 1HTLD 4L8JA 2MFIA 1YNJD 2Y0SG 1D6EC 2PYKA 1FVIA 2OWOA 4HCEA 1BDOA 1KL9A 1UE1A 5C4ZA 4HIOA 1E2WA 4JI6Q 2EYPA 1IYVA 4A3EH 4A76A 4JBJA 4DR6Q 3CRKC 2R92G 3STBC 1SYDA 1EYAA 2NTTA 1R9TH 3H3VC 3UE0A 1UE6A 3I4MH 3RUZA 1AE3A 4UAIA 2OTJA 3JAME 4AYBG 4DAYA 2Z4HA 4QB4A 1WFQA 1VQJA 2KQ3A 1H9KA 1X55A 5M3MH 5A2QE 3RZDB 4DV2L 1JB7A 2EQSA 5C0XJ 1R9TB 3I3CA 4A3LG 3W1GA 3V2TA 2UUCL 3E5SA 4A3FG 3TN2A 2KBNA 3I4NH 3FPPA 2F0KA 1F2YA 5M3MB 4B3SL 1SNDA 2EJGC 2JXMB 4AYBB 3K5OA 4O42A 3GTMH 2J0TD 1HA5A 2RHQB 4MTKA 4ID6A 5KNCA 3CCRA 3BZKA 1QVFA 1EUJA 1RHPA 4XIGS 4G7ZC 3T1YQ 4HIDA 4JI4Q 2UU9Q 3RLOA 1QVGA 3OOCA 3GTMB 4IJHA 1HNWQ 1WI5A 3ND8A 2A8VA 4C3JH 5IP9H 2QILA 4RHRA 3GD7A 5FKAC 2QGQA 1PH5A 2CH4W 5GAHC 2E2DC 2F0OA 1TT2A 4PMCA 3IKJA 2WINB 4IUQA
chains in the Genus database with same CATH topology
2WAQG 1NTGA 2I5LX 4DK3C 2JA5G 3HOUG 4A3JH 1SE8A 3AFQA 3OW2A 1I94Q 1IBLQ 2D0OA 2K52A 2JK8A 5ELNA 1JJCB 2ZJRA 1PA6A 1GD7A 1VQEA 4PG3A 4A3DH 5IYCH 4P72A 4BA1I 3CCQA 5LMUL 2E2HH 1AE2A 4B3MQ 1Q46A 3PUWA 1C0AA 3MXNB 3UE1A 2VL6A 3EIVA 4A75A 3AYHB 2JJQA 4GKJL 1VQNA 1K83H 4RMFA 3F2BA 1IBML 1IL2A 3PIOA 3L2PA 3T1YL 1OXTA 1K3RA 4DV3L 3HOWH 2E2JH 4DUYQ 4IPGA 1TWGH 3U4ZA 3E9IA 2UXDL 4DPGA 1DGSA 1HNWL 3J81c 2WFWA 4JCVE 1YBYA 4C2MH 4DK6C 1VQ8A 1N33L 1Q81C 4LF8L 5JJIA 1QZGA 3S1QH 4TVAB 3J7A5 3CPWA 4GN4B 1E1OA 4JG2A 3HOYG 3UDGA 3TEHB 4DR3L 4LF4Q 1XNQL 3RN5A 4DV4Q 2K5NA 2L15A 1L1OB 1Q1EA 3ICEA 1I94L 1VQCA 4GLXA 1IBLL 1YEZA 1GKHA 2N3SA 4OXPA 1MIUA 4AIMA 2K4KA 1KD1C 1ASYA 1EOVA 1HH2P 1LTLA 1X6OA 2CWAA 3STBD 3A5ZB 3EBEA 4BBSH 5IY0A 2K75A 2Z6KC 4GOPC 2VY3A 3CCLA 3A74A 1VQ7A 2JE6I 2JA8H 3PUXA 3H3VI 2YTXA 1YI2A 1VQLA 1HZBA 3HKZG 4HIMA 1M1KC 3BJUA 2R7ZH 1PH4A 4NXMQ 2D0PA 3OTOQ 2IT1A 3CCMA 3G4SA 3D0FA 5FJ8H 4HJAA 4ALPA 1Y1VH 3CMAA 1N8RC 4JBMA 4X65Q 1WCMG 5M5WH 2AWNA 3NELA 2NZHA 4L5SA 1EQQA 3W1BA 1X65A 3ER0A 1FJGL 2VQEQ 4YCVA 1E1TA 1A62A 4TQUS 4DUYL 3RZDH 2BA0A 2JA6H 3I2ZA 4YCWA 2Z6KA 3U4VA 3HOVG 4GOPA 3S14H 1E24A 4BXXG 3PO3G 1Y1WH 5BR8Q 3PF4A 4O2DA 2Q2UA 4IOAA 1KIXA 2R92H 5LMNQ 4DUZL 4DR5L 4A3CH 4JOIC 4QY7A 5IYDG 4RG1A 1C9OA 1IYJB 1UWVA 4YWKA 4A3EG 3HOXH 4DV4L 4OX9Q 3AEVA 5EAYA 5E7NA 3BU2A 3RZOH 3FP9A 2A1AA 2V1CC 4A3IH 3FKIG 1OXXK 4IPDA 4DV1L 1LM0A 5IWAQ 3M4PA 3I4MG 2OTLA 2IHEA 4OWWB 4LFBL 2PQAB 1PFSA 1VQFA 2OQ0A 2N78A 3JC66 3RLNA 2IY5B 5GROA 4DKAC 4A93G 4AQYQ 4JI0L 1XPOA 2ZJPA 5AJ3Q 4HJ5A 1HJPA 3KJOA 3M4OH 4H02A 3RNUA 1VQ5A 4NXML 4JOIA 3OTOL 3PF5A 1YHQA 1XNRQ 4LW1A 4A3FH 1WJJA 5IT9c 1U0LA 2AHOB 3DLLA 4J15A 1YJ9A 5IYBH 1X9NA 1E7ZA 2B3GA 3GTGH 1J5EQ 4GN5A 4LF9Q 3E9HA 3J80i 4JI6L 2DGYA 4AH6A 3I4NG 4Y52H 1A8VA 4BY1G 1NY4A 1L0WA 4DAYB 4R1JA 4NXNL 2D62A 2RF4A 1W3SA 2GVAA 1Q8KA 3S1NH 4K0KQ 4JI3Q 5BR8L 1NJIC 4BY7H 5FLMG 1K73C 3KJPA 5C4JH 2JEBI 1V1QA 1TWAH 1K8AC 1YHAA 1VQPA 1S72A 4KHPQ 2UXBL 1N32Q 2QEXA 4OX9L 3RLFA 5M3FG 1VQGA 2NN6I 3H0GH 4PZ8A 4LF7L 3TS2A 5IWAL 4IFDI 4A3BG 3E0EA 2PMZE 1HNZQ 4GS3A 2HIVA 3M9BA 5AJ3L 4X66Q 1PH1A 4DR1L 3FHWA 4LUZA 2JA5H 1XNRL 2H5XA 1WOCA 1YVCA 1IXRA 2E2IH 1L1OC 2MO0A 2IHFA 3CQZH 3LGJA 4GN3B 1CKNB 4MZ9A 4Y7NH 4P71A 1YIJA 4MTNA 1Z9FA 1XJVA 1J5EL 1IBKQ 1TWCH 4QL5A 4R4CA 3I55A 1K8GA 2ES2A 3S2HH 3K7AH 1LYLA 2K14A 1K0RA 3GDEA 1X3EA 5M5XH 3DM3A 3G71A 1W2BA 2R93H 5DLQE 3HFZB 4POGA 2K5VA 4JBWA 4BBRH 3G6EA 1PH7A 4A3DG 1VQOA 4JI4L 4IO9A 4X6AH 2UU9L 4DR7L 4OWTB 1JJGA 4B3RQ 2XGTA 2RHSB 1S40A 3U50C 3W5OA 4JBKA 1SN8A 1VQHA 1YHBA 5IP7G 5J3BA 3J81j 4KHPL 1YZ6A 1K9MC 1CKMA 2I5MX 4FDBA 4LF6Q 3CP0A 2I5HA 2PNHA 2WAQE 4LNQA 4A3GG 1Y14B 3WWVA 1P8LA 2EXDA 1QUQA 2Q2HA 3H15A 1PYSB 3S24A 1N9WA 1UEBA 3CCVA 2VUMG 2Z0SA 4GKKQ 4UP8A 3KDFA 1X54A 4P75A 2NN6G 2VW9A 1HNZL 2DUDA 4QIWE 2B63G 1NMGA 4X62Q 2UUAQ 4IFDG 3CD6A 1KXLA 2VNUD 4A3MH 1TXYA 3RN2A 4DV0Q 3CCJA 4BA2I 1CSPA 4IPHA 4YY3Q 4R4TA 1B70B 1IBKL 1OXUA 4B3ML 3F2DA 1HNXQ 3ULLA 4L5RC 2JA7G 2KENA 1HZAA 4JI1Q 4EQ5A 1SMXA 3PIPA 1FL0A 1NMFA 2C35B 3A0JA 3CPFA 3HKSA 1FGUA 4R4OA 4DV2Q 1VCIA 3F1ZA 3HOYH 4DV5Q 2CKZB 2OCEA 5IE8A 4OO1G 1BKBA 1WCMH 1H95A 2ZTEA 2R7ZG 1BVSA 2E8GA 1Q86C 2UUCQ 3M7NA 1PVOA 2MO1A 1OXSC 3S1RH 3UDIA 4LF6L 3KF6A 3UDFA 3TQYA 4KI0A 2ATWA 4MNOA 3OYYA 4DR2Q 1TWHH 1KRSA 3AQQA 4LF4L 3HOVH 1XTDA 4PMWA 4BXXH 3PO3H 3PUVA 3PV0A 2AKWB 1XMOQ 1XPUA 2YTVA 5H1SE 3IRBA 2R7FA 1A0IA 2KHIA 4P74A 1T9HA 2BH2A 1NE3A 5IYDH 1MKHA 3GTOH 1KHIA 3CCSA 4WJ4A 3HKZE 5C3EG 4X62L 5C44G 2UUAL 4GLAC 3BZCA 4IJLA 4NPSA 1MJCA 3FKIH 4LF5Q 3GTPH 3HOZH 4DV0L 4DV6Q 1SFOH 2F4VQ 4GNXB 4POFA 1A63A 4A3LH 1KQSA 3F8TA 4DAMA 1EQRA 5M3MG 4YY3L 2ZM6Q 2UUBQ 1HNXL 1SROA 2NZOA 1HR0Q 4JI1L 4X65L 4A93H 3B6YA 1OXVA 4GOPB 5HY6A 1V43A 2VQEL 2EIFA 2WP8J 4QGUA 4DV5L 1XPRA 3CC7A 3CXCA 3GTLH 3PUZA 2KCTA 3H3VH 3M3YH 3L7ZC 1VQIA 5JJKA 1RIPA 4QJFA 1B8AA 1QVCA 4KLKA 2ASBA 1EWIA 4BY1H 1VS0A 3M4QA 5LMNL 3NEMA 1IZ6A 1X3FA 3PUYA 4L5QA 4LWCA 3GTQH 3J81i 4JV5Q 1TWFH 1PV4A 4HIKA 3ERSX 3PO2G 1HNWQ 1YITA 4IFDJ 2A19A 2CQOA 1Z47A 5GAGC 2XTIA 3PGZA 2F52A 1G51A 2ZJQA 1EFWA 2B29A 4LFCQ 4C3IH 1ASZA 2LSSA 3S15H 3PSIA 1YNXA 4A3KG 4DR4Q 1UE7A 1SLJA 2OQKA 4LFAQ 4DV7Q 3EN2A 4GKJQ 2ALYB 1U5KA 1Q12A 5M3FH 2GN5A 2HQLA 5IP9G 1L2FA 4LF5L 4AQYL 1CSQA 2VQFQ 4DV6L 3ZJYC 2F4VL 5C4XH 4O0AA 2YV5A 1PH9A 1GVPA 2ZM6L 1PH8A 3HOUH 3S1MH 3K81C 2UUBL 2UXDQ 4A3BH 1HR0L 4GLVB 3CCEA 3TRZA 2CWPA 1N33Q 2JA6G 2BA1A 4LF8Q 1O7IA 4YHHQ 5K36G 1QZHA 4A3JG 4LF9L 1CKOA 1RL2A 3I4OA 5JEAG 4OO1I 4DR3Q 1MJEA 4B3TQ 3U58A 1XNQQ 4UY8C 1NBWA 1G291 2IX0A 5HGQA 3TREA 3ULJA 4NB3A 1AH9A 1PH6A 2YU9H 4K0KL 1Q1BA 1N36Q 4JI3L 3KLWA 2N49A 1I3QH 1EYGA 4WJ3M 3D31A 3GO5A 5IYCG 2E5LQ 4UP7A 1I6HH 3CC4A 1X3GA 2MNAA 1VQ4A 1L1OA 1KAWA 3CMEA 3S2DH 4JV5L 1N32L 4HJ9A 1JT8A 5C0XG 2BH8A 3KOJA 3NENA 2R93G 3J80c 2ZTDA 4IOCA 3KFUA 1E3PA 3Q8DA 5IP7H 2JA9A 4BBRG 3HOWG 4P73A 4LFCL 4DR4L 2IX1A 4A3GH 3F2CA 4DV7L 4LFAL 2HT1A 4L5TA 4JI5Q 2WB1G 1FJGQ 2KHJA 4JC0A 3I56A 1SR3A 1M90C 2VQFL 4X66L 4PZ7A 3SGIA 3CCUA 2VUMH 2YTYA 1PH2A 1VQBA 4UPAA 3VDYA 4C3HH 3UDXA 5FLXc 2F3IA 2N8NA 4YHHL 1B7YB 4HJ8A 4IPCA 2B63H 1PHJA 1CUKA 4DUZQ 2I0QA 4DR5Q 2JQOA 2LXKA 5LMNW 1JMCA 2JEAI 4B3TL 3G48A 4XTCS 4BBSG 2QA4A 4EX5A 1OTCA 2NVQH 1N34Q 1C7YA 4GNXC 4A3MG 2GVBA 2JA7H 1N36L 1LUZA 2JA8G 1QUQB 4DV1Q 2ID0A 4B3RL 4A4IA 4LUVA 2E5LL 5JJLA 3S17H 4LFBQ 1Q82C 1VQ6A 1JJ2A 5FJ8G 4PZ6A 1Y1VG 3JAMi 2UXCQ 3KDFB 2NVXH 2Q2TA 4JI0Q 1BBUA 1VQDA 4JI2Q 1YJNA 1EIYB 2PI2A 3K8AA 2HHHQ 5GAEC 3CC2A 4B3SQ 1UE5A 2AWOA 2YYZA 2WB1E 4X64Q 1D7QA 2PQAA 1VQAA 2NVTH 1WYDA 3J7ZC 2HIXA 1HR0W 2CCZA 3GTKH 4GKKL 2MFIA 2Y0SG 1P16A 4JI5L 1FVIA 2OWOA 5GQOA 4GNXA 3M85A 1KL9A 1UE1A 3ULPA 4HIOA 1Y1WG 4JI6Q 2CFMA 4YWLA 4A3EH 4A76A 4QQBX 4JBJA 4DR6Q 2K5HA 2R92G 3STBC 1HZ9A 2ZTCA 5JEAJ 4A3CG 4NXNQ 1V9PA 1Q7YC 1HZCA 1R9TH 1XMQQ 3HOXG 1GM5A 1VQ9A 5ELOA 3UE0A 4JYAQ 1UE6A 3I4MH 2R6GA 5C3EH 5C44H 3T1HQ 4A3IG 4UP9A 1AE3A 2VZAA 2OTJA 2UXBQ 4JI7Q 4AYBG 2KCMA 1KC8C 4R4IA 1PH3A 1WFQA 3I7FA 1VQJA 3MEFA 1X55A 5M3MH 3TS0A 3KF6B 1X56A 4HJ7A 4DV2L 1N34L 1JB7A 4JI8Q 3HOZG 4LF7Q 2EQSA 4ME3A 5C0XJ 4A3LG 3W1GA 3PCOB 3CW2C 1BBWA 2UUCL 4A3FG 3L0OA 2UXCL 1G6PA 2KBNA 5C0XI 4JI2L 5IYBG 3I4NH 1I5FA 2AMCB 2HHHL 1I50H 2Y0SE 2MQHA 3K80C 2LXJA 4DR1Q 4DR2L 4B3SL 2PI2E 1JE5A 1J6QA 2NVYH 4X64L 5GADC 3GTJH 5M5YH 1VQKA 1XMOL 3GTMH 5LMUQ 5FLMH 2RHQB 4YCUA 3AFPA 3CCRA 3BZKA 1EIFA 1QVFA 1E22A 4R4QA 3PO2H 4DR6L 4BY7G 1EUJA 3KF8B 2RCNA 1IBMQ 3S16H 4OONA 4XIGS 3JAMc 1SRUA 1CKNA 3T1YQ 1S3OA 3KYHC 4YWMA 1KRTA 4AYBE 4DV3Q 4HIDA 1XMQL 4JI4Q 4JYAL 2UU9Q 4DR7Q 3RLOA 2Q2IA 3T1HL 4A3KH 3H0GG 3RR5A 4KHZA 4IJHA 4APVA 1WI5A 1GO3E 4LUOA 1YJWA 1QVGA 3CF5A 4C3JH 5IP9H 4JI7L 2R7DA 3K7UC 2A8VA 3GD7A 4DNIA 2QGQA 1PH5A 3NBHB 3A5UA 5GAHC 1D8LA 3K0XA 1PYBA 1VQMA 4JI8L 2FXQA 3CAMA 4OWXB 2K50A 5C4XG 2VS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ G;  1NTG A;  2I5L X;  4DK3 C;  2JA5 G;  3HOU G;  4A3J H;  1SE8 A;  3AFQ A;  3OW2 A;  1I94 Q;  1IBL Q;  2D0O A;  2K52 A;  2JK8 A;  5ELN A;  1JJC B;  2ZJR A;  1PA6 A;  1GD7 A;  1VQE A;  4PG3 A;  4A3D H;  5IYC H;  4P72 A;  4BA1 I;  3CCQ A;  5LMU L;  2E2H H;  1AE2 A;  4B3M Q;  1Q46 A;  3PUW A;  1C0A A;  3MXN B;  3UE1 A;  2VL6 A;  3EIV A;  4A75 A;  3AYH B;  2JJQ A;  4GKJ L;  1VQN A;  1K83 H;  4RMF A;  3F2B A;  1IBM L;  1IL2 A;  3PIO A;  3L2P A;  3T1Y L;  1OXT A;  1K3R A;  4DV3 L;  3HOW H;  2E2J H;  4DUY Q;  4IPG A;  1TWG H;  3U4Z A;  3E9I A;  2UXD L;  4DPG A;  1DGS A;  1HNW L;  3J81 c;  2WFW A;  4JCV E;  1YBY A;  4C2M H;  4DK6 C;  1VQ8 A;  1N33 L;  1Q81 C;  4LF8 L;  5JJI A;  1QZG A;  3S1Q H;  4TVA B;  3J7A 5;  3CPW A;  4GN4 B;  1E1O A;  4JG2 A;  3HOY G;  3UDG A;  3TEH B;  4DR3 L;  4LF4 Q;  1XNQ L;  3RN5 A;  4DV4 Q;  2K5N A;  2L15 A;  1L1O B;  1Q1E A;  3ICE A;  1I94 L;  1VQC A;  4GLX A;  1IBL L;  1YEZ A;  1GKH A;  2N3S A;  4OXP A;  1MIU A;  4AIM A;  2K4K A;  1KD1 C;  1ASY A;  1EOV A;  1HH2 P;  1LTL A;  1X6O A;  2CWA A;  3STB D;  3A5Z B;  3EBE A;  4BBS H;  5IY0 A;  2K75 A;  2Z6K C;  4GOP C;  2VY3 A;  3CCL A;  3A74 A;  1VQ7 A;  2JE6 I;  2JA8 H;  3PUX A;  3H3V I;  2YTX A;  1YI2 A;  1VQL A;  1HZB A;  3HKZ G;  4HIM A;  1M1K C;  3BJU A;  2R7Z H;  1PH4 A;  4NXM Q;  2D0P A;  3OTO Q;  2IT1 A;  3CCM A;  3G4S A;  3D0F A;  5FJ8 H;  4HJA A;  4ALP A;  1Y1V H;  3CMA A;  1N8R C;  4JBM A;  4X65 Q;  1WCM G;  5M5W H;  2AWN A;  3NEL A;  2NZH A;  4L5S A;  1EQQ A;  3W1B A;  1X65 A;  3ER0 A;  1FJG L;  2VQE Q;  4YCV A;  1E1T A;  1A62 A;  4TQU S;  4DUY L;  3RZD H;  2BA0 A;  2JA6 H;  3I2Z A;  4YCW A;  2Z6K A;  3U4V A;  3HOV G;  4GOP A;  3S14 H;  1E24 A;  4BXX G;  3PO3 G;  1Y1W H;  5BR8 Q;  3PF4 A;  4O2D A;  2Q2U A;  4IOA A;  1KIX A;  2R92 H;  5LMN Q;  4DUZ L;  4DR5 L;  4A3C H;  4JOI C;  4QY7 A;  5IYD G;  4RG1 A;  1C9O A;  1IYJ B;  1UWV A;  4YWK A;  4A3E G;  3HOX H;  4DV4 L;  4OX9 Q;  3AEV A;  5EAY A;  5E7N A;  3BU2 A;  3RZO H;  3FP9 A;  2A1A A;  2V1C C;  4A3I H;  3FKI G;  1OXX K;  4IPD A;  4DV1 L;  1LM0 A;  5IWA Q;  3M4P A;  3I4M G;  2OTL A;  2IHE A;  4OWW B;  4LFB L;  2PQA B;  1PFS A;  1VQF A;  2OQ0 A;  2N78 A;  3JC6 6;  3RLN A;  2IY5 B;  5GRO A;  4DKA C;  4A93 G;  4AQY Q;  4JI0 L;  1XPO A;  2ZJP A;  5AJ3 Q;  4HJ5 A;  1HJP A;  3KJO A;  3M4O H;  4H02 A;  3RNU A;  1VQ5 A;  4NXM L;  4JOI A;  3OTO L;  3PF5 A;  1YHQ A;  1XNR Q;  4LW1 A;  4A3F H;  1WJJ A;  5IT9 c;  1U0L A;  2AHO B;  3DLL A;  4J15 A;  1YJ9 A;  5IYB H;  1X9N A;  1E7Z A;  2B3G A;  3GTG H;  1J5E Q;  4GN5 A;  4LF9 Q;  3E9H A;  3J80 i;  4JI6 L;  2DGY A;  4AH6 A;  3I4N G;  4Y52 H;  1A8V A;  4BY1 G;  1NY4 A;  1L0W A;  4DAY B;  4R1J A;  4NXN L;  2D62 A;  2RF4 A;  1W3S A;  2GVA A;  1Q8K A;  3S1N H;  4K0K Q;  4JI3 Q;  5BR8 L;  1NJI C;  4BY7 H;  5FLM G;  1K73 C;  3KJP A;  5C4J H;  2JEB I;  1V1Q A;  1TWA H;  1K8A C;  1YHA A;  1VQP A;  1S72 A;  4KHP Q;  2UXB L;  1N32 Q;  2QEX A;  4OX9 L;  3RLF A;  5M3F G;  1VQG A;  2NN6 I;  3H0G H;  4PZ8 A;  4LF7 L;  3TS2 A;  5IWA L;  4IFD I;  4A3B G;  3E0E A;  2PMZ E;  1HNZ Q;  4GS3 A;  2HIV A;  3M9B A;  5AJ3 L;  4X66 Q;  1PH1 A;  4DR1 L;  3FHW A;  4LUZ A;  2JA5 H;  1XNR L;  2H5X A;  1WOC A;  1YVC A;  1IXR A;  2E2I H;  1L1O C;  2MO0 A;  2IHF A;  3CQZ H;  3LGJ A;  4GN3 B;  1CKN B;  4MZ9 A;  4Y7N H;  4P71 A;  1YIJ A;  4MTN A;  1Z9F A;  1XJV A;  1J5E L;  1IBK Q;  1TWC H;  4QL5 A;  4R4C A;  3I55 A;  1K8G A;  2ES2 A;  3S2H H;  3K7A H;  1LYL A;  2K14 A;  1K0R A;  3GDE A;  1X3E A;  5M5X H;  3DM3 A;  3G71 A;  1W2B A;  2R93 H;  5DLQ E;  3HFZ B;  4POG A;  2K5V A;  4JBW A;  4BBR H;  3G6E A;  1PH7 A;  4A3D G;  1VQO A;  4JI4 L;  4IO9 A;  4X6A H;  2UU9 L;  4DR7 L;  4OWT B;  1JJG A;  4B3R Q;  2XGT A;  2RHS B;  1S40 A;  3U50 C;  3W5O A;  4JBK A;  1SN8 A;  1VQH A;  1YHB A;  5IP7 G;  5J3B A;  3J81 j;  4KHP L;  1YZ6 A;  1K9M C;  1CKM A;  2I5M X;  4FDB A;  4LF6 Q;  3CP0 A;  2I5H A;  2PNH A;  2WAQ E;  4LNQ A;  4A3G G;  1Y14 B;  3WWV A;  1P8L A;  2EXD A;  1QUQ A;  2Q2H A;  3H15 A;  1PYS B;  3S24 A;  1N9W A;  1UEB A;  3CCV A;  2VUM G;  2Z0S A;  4GKK Q;  4UP8 A;  3KDF A;  1X54 A;  4P75 A;  2NN6 G;  2VW9 A;  1HNZ L;  2DUD A;  4QIW E;  2B63 G;  1NMG A;  4X62 Q;  2UUA Q;  4IFD G;  3CD6 A;  1KXL A;  2VNU D;  4A3M H;  1TXY A;  3RN2 A;  4DV0 Q;  3CCJ A;  4BA2 I;  1CSP A;  4IPH A;  4YY3 Q;  4R4T A;  1B70 B;  1IBK L;  1OXU A;  4B3M L;  3F2D A;  1HNX Q;  3ULL A;  4L5R C;  2JA7 G;  2KEN A;  1HZA A;  4JI1 Q;  4EQ5 A;  1SMX A;  3PIP A;  1FL0 A;  1NMF A;  2C35 B;  3A0J A;  3CPF A;  3HKS A;  1FGU A;  4R4O A;  4DV2 Q;  1VCI A;  3F1Z A;  3HOY H;  4DV5 Q;  2CKZ B;  2OCE A;  5IE8 A;  4OO1 G;  1BKB A;  1WCM H;  1H95 A;  2ZTE A;  2R7Z G;  1BVS A;  2E8G A;  1Q86 C;  2UUC Q;  3M7N A;  1PVO A;  2MO1 A;  1OXS C;  3S1R H;  3UDI A;  4LF6 L;  3KF6 A;  3UDF A;  3TQY A;  4KI0 A;  2ATW A;  4MNO A;  3OYY A;  4DR2 Q;  1TWH H;  1KRS A;  3AQQ A;  4LF4 L;  3HOV H;  1XTD A;  4PMW A;  4BXX H;  3PO3 H;  3PUV A;  3PV0 A;  2AKW B;  1XMO Q;  1XPU A;  2YTV A;  5H1S E;  3IRB A;  2R7F A;  1A0I A;  2KHI A;  4P74 A;  1T9H A;  2BH2 A;  1NE3 A;  5IYD H;  1MKH A;  3GTO H;  1KHI A;  3CCS A;  4WJ4 A;  3HKZ E;  5C3E G;  4X62 L;  5C44 G;  2UUA L;  4GLA C;  3BZC A;  4IJL A;  4NPS A;  1MJC A;  3FKI H;  4LF5 Q;  3GTP H;  3HOZ H;  4DV0 L;  4DV6 Q;  1SFO H;  2F4V Q;  4GNX B;  4POF A;  1A63 A;  4A3L H;  1KQS A;  3F8T A;  4DAM A;  1EQR A;  5M3M G;  4YY3 L;  2ZM6 Q;  2UUB Q;  1HNX L;  1SRO A;  2NZO A;  1HR0 Q;  4JI1 L;  4X65 L;  4A93 H;  3B6Y A;  1OXV A;  4GOP B;  5HY6 A;  1V43 A;  2VQE L;  2EIF A;  2WP8 J;  4QGU A;  4DV5 L;  1XPR A;  3CC7 A;  3CXC A;  3GTL H;  3PUZ A;  2KCT A;  3H3V H;  3M3Y H;  3L7Z C;  1VQI A;  5JJK A;  1RIP A;  4QJF A;  1B8A A;  1QVC A;  4KLK A;  2ASB A;  1EWI A;  4BY1 H;  1VS0 A;  3M4Q A;  5LMN L;  3NEM A;  1IZ6 A;  1X3F A;  3PUY A;  4L5Q A;  4LWC A;  3GTQ H;  3J81 i;  4JV5 Q;  1TWF H;  1PV4 A;  4HIK A;  3ERS X;  3PO2 G;  1HNW Q;  1YIT A;  4IFD J;  2A19 A;  2CQO A;  1Z47 A;  5GAG C;  2XTI A;  3PGZ A;  2F52 A;  1G51 A;  2ZJQ A;  1EFW A;  2B29 A;  4LFC Q;  4C3I H;  1ASZ A;  2LSS A;  3S15 H;  3PSI A;  1YNX A;  4A3K G;  4DR4 Q;  1UE7 A;  1SLJ A;  2OQK A;  4LFA Q;  4DV7 Q;  3EN2 A;  4GKJ Q;  2ALY B;  1U5K A;  1Q12 A;  5M3F H;  2GN5 A;  2HQL A;  5IP9 G;  1L2F A;  4LF5 L;  4AQY L;  1CSQ A;  2VQF Q;  4DV6 L;  3ZJY C;  2F4V L;  5C4X H;  4O0A A;  2YV5 A;  1PH9 A;  1GVP A;  2ZM6 L;  1PH8 A;  3HOU H;  3S1M H;  3K81 C;  2UUB L;  2UXD Q;  4A3B H;  1HR0 L;  4GLV B;  3CCE A;  3TRZ A;  2CWP A;  1N33 Q;  2JA6 G;  2BA1 A;  4LF8 Q;  1O7I A;  4YHH Q;  5K36 G;  1QZH A;  4A3J G;  4LF9 L;  1CKO A;  1RL2 A;  3I4O A;  5JEA G;  4OO1 I;  4DR3 Q;  1MJE A;  4B3T Q;  3U58 A;  1XNQ Q;  4UY8 C;  1NBW A;  1G29 1;  2IX0 A;  5HGQ A;  3TRE A;  3ULJ A;  4NB3 A;  1AH9 A;  1PH6 A;  2YU9 H;  4K0K L;  1Q1B A;  1N36 Q;  4JI3 L;  3KLW A;  2N49 A;  1I3Q H;  1EYG A;  4WJ3 M;  3D31 A;  3GO5 A;  5IYC G;  2E5L Q;  4UP7 A;  1I6H H;  3CC4 A;  1X3G A;  2MNA A;  1VQ4 A;  1L1O A;  1KAW A;  3CME A;  3S2D H;  4JV5 L;  1N32 L;  4HJ9 A;  1JT8 A;  5C0X G;  2BH8 A;  3KOJ A;  3NEN A;  2R93 G;  3J80 c;  2ZTD A;  4IOC A;  3KFU A;  1E3P A;  3Q8D A;  5IP7 H;  2JA9 A;  4BBR G;  3HOW G;  4P73 A;  4LFC L;  4DR4 L;  2IX1 A;  4A3G H;  3F2C A;  4DV7 L;  4LFA L;  2HT1 A;  4L5T A;  4JI5 Q;  2WB1 G;  1FJG Q;  2KHJ A;  4JC0 A;  3I56 A;  1SR3 A;  1M90 C;  2VQF L;  4X66 L;  4PZ7 A;  3SGI A;  3CCU A;  2VUM H;  2YTY A;  1PH2 A;  1VQB A;  4UPA A;  3VDY A;  4C3H H;  3UDX A;  5FLX c;  2F3I A;  2N8N A;  4YHH L;  1B7Y B;  4HJ8 A;  4IPC A;  2B63 H;  1PHJ A;  1CUK A;  4DUZ Q;  2I0Q A;  4DR5 Q;  2JQO A;  2LXK A;  5LMN W;  1JMC A;  2JEA I;  4B3T L;  3G48 A;  4XTC S;  4BBS G;  2QA4 A;  4EX5 A;  1OTC A;  2NVQ H;  1N34 Q;  1C7Y A;  4GNX C;  4A3M G;  2GVB A;  2JA7 H;  1N36 L;  1LUZ A;  2JA8 G;  1QUQ B;  4DV1 Q;  2ID0 A;  4B3R L;  4A4I A;  4LUV A;  2E5L L;  5JJL A;  3S17 H;  4LFB Q;  1Q82 C;  1VQ6 A;  1JJ2 A;  5FJ8 G;  4PZ6 A;  1Y1V G;  3JAM i;  2UXC Q;  3KDF B;  2NVX H;  2Q2T A;  4JI0 Q;  1BBU A;  1VQD A;  4JI2 Q;  1YJN A;  1EIY B;  2PI2 A;  3K8A A;  2HHH Q;  5GAE C;  3CC2 A;  4B3S Q;  1UE5 A;  2AWO A;  2YYZ A;  2WB1 E;  4X64 Q;  1D7Q A;  2PQA A;  1VQA A;  2NVT H;  1WYD A;  3J7Z C;  2HIX A;  1HR0 W;  2CCZ A;  3GTK H;  4GKK L;  2MFI A;  2Y0S G;  1P16 A;  4JI5 L;  1FVI A;  2OWO A;  5GQO A;  4GNX A;  3M85 A;  1KL9 A;  1UE1 A;  3ULP A;  4HIO A;  1Y1W G;  4JI6 Q;  2CFM A;  4YWL A;  4A3E H;  4A76 A;  4QQB X;  4JBJ A;  4DR6 Q;  2K5H A;  2R92 G;  3STB C;  1HZ9 A;  2ZTC A;  5JEA J;  4A3C G;  4NXN Q;  1V9P A;  1Q7Y C;  1HZC A;  1R9T H;  1XMQ Q;  3HOX G;  1GM5 A;  1VQ9 A;  5ELO A;  3UE0 A;  4JYA Q;  1UE6 A;  3I4M H;  2R6G A;  5C3E H;  5C44 H;  3T1H Q;  4A3I G;  4UP9 A;  1AE3 A;  2VZA A;  2OTJ A;  2UXB Q;  4JI7 Q;  4AYB G;  2KCM A;  1KC8 C;  4R4I A;  1PH3 A;  1WFQ A;  3I7F A;  1VQJ A;  3MEF A;  1X55 A;  5M3M H;  3TS0 A;  3KF6 B;  1X56 A;  4HJ7 A;  4DV2 L;  1N34 L;  1JB7 A;  4JI8 Q;  3HOZ G;  4LF7 Q;  2EQS A;  4ME3 A;  5C0X J;  4A3L G;  3W1G A;  3PCO B;  3CW2 C;  1BBW A;  2UUC L;  4A3F G;  3L0O A;  2UXC L;  1G6P A;  2KBN A;  5C0X I;  4JI2 L;  5IYB G;  3I4N H;  1I5F A;  2AMC B;  2HHH L;  1I50 H;  2Y0S E;  2MQH A;  3K80 C;  2LXJ A;  4DR1 Q;  4DR2 L;  4B3S L;  2PI2 E;  1JE5 A;  1J6Q A;  2NVY H;  4X64 L;  5GAD C;  3GTJ H;  5M5Y H;  1VQK A;  1XMO L;  3GTM H;  5LMU Q;  5FLM H;  2RHQ B;  4YCU A;  3AFP A;  3CCR A;  3BZK A;  1EIF A;  1QVF A;  1E22 A;  4R4Q A;  3PO2 H;  4DR6 L;  4BY7 G;  1EUJ A;  3KF8 B;  2RCN A;  1IBM Q;  3S16 H;  4OON A;  4XIG S;  3JAM c;  1SRU A;  1CKN A;  3T1Y Q;  1S3O A;  3KYH C;  4YWM A;  1KRT A;  4AYB E;  4DV3 Q;  4HID A;  1XMQ L;  4JI4 Q;  4JYA L;  2UU9 Q;  4DR7 Q;  3RLO A;  2Q2I A;  3T1H L;  4A3K H;  3H0G G;  3RR5 A;  4KHZ A;  4IJH A;  4APV A;  1WI5 A;  1GO3 E;  4LUO A;  1YJW A;  1QVG A;  3CF5 A;  4C3J H;  5IP9 H;  4JI7 L;  2R7D A;  3K7U C;  2A8V A;  3GD7 A;  4DNI A;  2QGQ A;  1PH5 A;  3NBH B;  3A5U A;  5GAH C;  1D8L A;  3K0X A;  1PYB A;  1VQM A;  4JI8 L;  2FXQ A;  3CAM A;  4OWX B;  2K50 A;  5C4X G;  2VS1 A; 
#chains in the Genus database with same CATH topology
 2MHV A;  1NTG A;  2JA5 G;  3OW2 A;  2RVL A;  3NWS A;  4C3J B;  1KNE A;  1FYC A;  2D0O A;  5ELN A;  2JK8 A;  1H9R A;  1KLU D;  3VYS A;  4DF7 A;  3K57 A;  4HCS A;  3WDN A;  3A8K E;  4FXD A;  4A3D H;  1LT5 D;  2D5D A;  4P72 A;  3MTS A;  2K33 A;  5LMU L;  4B3M Q;  1Q46 A;  3D6C A;  2VL6 A;  4A75 A;  4MN3 A;  4GKJ L;  1K83 H;  4RMF A;  4RCO A;  3PIO A;  3L2P A;  1EOT A;  4OL7 A;  3HOW H;  3KK7 A;  4DPG A;  3J81 c;  4C2M H;  1VQ8 A;  1N33 L;  4OIJ A;  4LF8 L;  2PZU A;  1QZG A;  3DEO A;  4MIU A;  2ZXO A;  4KD3 A;  1E1O A;  1K83 B;  2R93 B;  2A69 C;  4DR3 L;  2NYZ D;  4KV6 A;  2Z1C A;  4DV4 Q;  2X6G A;  1L1O B;  3ICE A;  5D3D A;  4C2M B;  4GLX A;  1IBL L;  4OXP A;  2N3S A;  4CDE C;  4AIM A;  3S1Q H;  3STB D;  4BBS H;  3EBE A;  2K75 A;  2Z6K C;  1LTG D;  4M8A A;  2F0U A;  4IUP A;  1XYI A;  1VQ7 A;  2JA8 H;  2B2T C;  3OMC A;  3BJU A;  1STE A;  2N88 A;  4NXM Q;  1LO5 D;  5EBC A;  2IT1 A;  3CCM A;  1ET9 A;  1KLG D;  3G4S A;  4HJA A;  4JBM A;  1Y1V H;  3CMA A;  3HOY G;  5M5W H;  2NZH A;  4BBS B;  3W1B A;  1X65 A;  3NTK A;  4HMI A;  2XSC A;  5C4H A;  3IFT A;  4IUV A;  1A62 A;  4DUY L;  2JA8 B;  4DA2 A;  5BN3 A;  1Y1V B;  4B9X A;  1Y1W H;  3PF4 A;  2PCF B;  2ZT9 C;  1ML0 D;  4DR5 L;  4A3C H;  4JOI C;  3HOY B;  1CHP D;  3HOX H;  2LKV A;  3T51 B;  5E7N A;  1SDF A;  4TSS A;  3RZO H;  4Q5V A;  1Y1W B;  4NW2 A;  2B8G A;  2F0N A;  3M4P A;  3MA2 B;  3HP3 A;  4EQO A;  4OWW B;  2PQA B;  1O7Z A;  3RLN A;  2N78 A;  3QO2 A;  1TU2 B;  2IY5 B;  4RKL A;  5GRO A;  1SXT A;  2F4I A;  1HQR D;  2BDN A;  5AJ3 Q;  3HOX B;  1STH A;  3RZO B;  1XNR Q;  1YHQ A;  5KNB A;  3GTO B;  3DLL A;  1YJ9 A;  1E7Z A;  1L0X B;  1J5E Q;  1Y8O B;  3D3R A;  3E9H A;  4OIK A;  2DGY A;  2Z6B A;  1SNQ A;  4R9W A;  4R1J A;  4NXN L;  4K6L A;  2D62 A;  3S1N H;  5KND A;  1O7L A;  4BY7 H;  3KJP A;  1V1Q A;  2OXP A;  2PMZ B;  3NHH A;  4J6H A;  4OX9 L;  3RLF A;  4X3K A;  1VQG A;  4PZ8 A;  3MWY W;  5ELC A;  3S1N B;  5IWA L;  1YNN C;  1G8Z D;  4L63 B;  5LHY 1;  1AN8 A;  4A3B G;  3E0E A;  5J39 A;  2D2C C;  3HG9 A;  1IXR A;  4LAA A;  4C3I B;  4MZ9 A;  1YIJ A;  4MTN A;  4DU9 A;  1XJV A;  1TWC H;  4QL5 A;  3I55 A;  3X3N A;  1W6J A;  1X3E A;  4EQN A;  2EYO A;  1VQO A;  2HCC A;  5T1I A;  1GUT A;  3P7J A;  3W5O A;  1TWC B;  1LTS D;  2QEJ C;  3J81 j;  1UEA B;  5I2Y A;  4LF6 Q;  4LNQ A;  4ABN A;  2A74 C;  2PNH A;  2WAQ E;  3WWV A;  2EXD A;  1PYS B;  1N9W A;  3C2P A;  3CCV A;  2B2U A;  2KED A;  1TII D;  4UP8 A;  3BDO A;  4P75 A;  2QDB A;  2R61 A;  1HNZ L;  1U4P A;  1X32 A;  1EYD A;  1NMG A;  4X62 Q;  2CH4 A;  3F2U A;  4DV0 Q;  4M1U B;  4BA2 I;  1C4Q A;  1TS5 A;  1HNX Q;  3SK4 A;  4JI1 Q;  3NTI A;  1FL0 A;  2DNC A;  2WKD A;  3A0J A;  4HMJ A;  1H9S A;  2RDH A;  5EJW A;  1JWU D;  4FXK C;  3CPF A;  3HKS A;  2PZT A;  4DV2 Q;  1VCI A;  3F1Z A;  4C3H B;  1ZYR C;  1WTX A;  5IE8 A;  2BE5 D;  1WCM H;  3FMC A;  2Z9H A;  5IT9 L;  4L6T B;  4G7O C;  3QWN A;  3AMU A;  2UUC Q;  2PW5 A;  1QWY A;  4WOR A;  2SNS A;  5EQ0 A;  3KLS X;  2F0L A;  4BXX H;  3PO3 H;  2AKW B;  1WCM B;  1XPU A;  5H1S E;  3IRB A;  1A0I A;  2MUY A;  3L9A X;  3S17 B;  5IIF A;  1SNM A;  1FGB D;  3HKZ E;  5C44 G;  1VF7 A;  2UUA L;  3R2I A;  2PW7 A;  3ONA B;  3BZC A;  4IJL A;  1EY8 A;  1MJC A;  1PYW D;  2K05 A;  3GTP H;  3T4A C;  3PO3 B;  2EE1 A;  4DAM A;  1EQR A;  1A3T A;  1LLR D;  4F87 A;  2UUB Q;  1SRO A;  1HR0 Q;  4X65 L;  4A93 H;  3J7Y W;  4GOP B;  1XXG A;  5IGD A;  2VQE L;  2EIF A;  1PFB A;  3RD4 A;  4ZAI A;  2PNR C;  5EKL A;  4DV5 L;  1XPR A;  3M4Y A;  1YNN D;  3A8J E;  3M3Y H;  5J22 A;  3BVG A;  4QJF A;  2DY7 A;  2CQA A;  4KLK A;  3NBH A;  4A93 B;  1GUW A;  3Q22 A;  3DXJ C;  3P20 A;  3NEM A;  3GTQ H;  3K59 A;  2EOT A;  1TWF H;  1ZKO A;  3VR3 A;  1EYC A;  2A19 A;  5GAG C;  3M3Y B;  3PGZ A;  2AQ2 B;  3NQI A;  1BUV T;  1G51 A;  2ZJQ A;  3J81 L;  3DM1 A;  1JB3 A;  4LFC Q;  1Q3L A;  2OQK A;  1SLJ A;  4GKJ Q;  1U5K A;  5M3F H;  3GTQ B;  1S5D D;  2HQL A;  5KEE A;  1EQT A;  4AQY L;  4LF5 L;  1TWF B;  5C4X H;  4I7A A;  4O0A A;  2YV5 A;  4RAU C;  1PH8 A;  3HOU H;  3K81 C;  4XQN A;  3TRZ A;  1N33 Q;  2JA6 G;  4LF8 Q;  3BDC A;  5DAU A;  1ICF B;  2B2W A;  1LTR D;  3S16 B;  3MC0 B;  5JEA G;  4HN7 A;  4OO1 I;  4DR3 Q;  4B3T Q;  2FFK B;  3SK6 A;  5LL6 S;  5DNF A;  2YU9 H;  4K0K L;  4JI3 L;  1I3Q H;  1EYG A;  1I6H H;  1X3G A;  1VQ4 A;  3S2D H;  1H9M A;  4FNF A;  2BH8 A;  2BCO A;  3KOJ A;  1MHW C;  3KFU A;  2YU9 B;  2JA9 A;  4BBR G;  4CHT B;  4P73 A;  1I3Q B;  2XWJ B;  3KBX A;  2IX1 A;  2DJG C;  3AB9 A;  1AP0 A;  3TZU A;  2HT1 A;  2F03 A;  1I6H B;  4WRD A;  4LMQ D;  1M90 C;  1ZYR D;  2OEO A;  2NBF A;  1G2T A;  1NCV A;  1WD0 A;  3WOF A;  3SHL A;  4UDU C;  3KLS A;  2NN6 H;  4K2K A;  2N8N A;  4HJ8 A;  4DR5 Q;  2LXK A;  1CI3 M;  4XTC S;  2E2J B;  2QA4 A;  3L3O C;  1ROD A;  4A3M G;  3BVZ A;  2K28 A;  3QR8 A;  1STY A;  1PFM A;  4RFB A;  2K6A A;  2ICI A;  2KVM A;  5T1G A;  4B3R L;  1JC7 A;  2DY8 A;  4PV1 C;  1VQ6 A;  1H9J A;  4QUF A;  4TKO B;  2UXC Q;  4KHV A;  1AEX A;  3M7G A;  1CQV A;  5CBA E;  2HHH Q;  2OT2 A;  3OPO A;  2NVT H;  2HIX A;  3Q24 A;  2CCZ A;  3GTK H;  1T5X D;  3QOJ A;  4JI5 L;  2PZW A;  5A2Q L;  3D4R A;  1BO0 A;  3M85 A;  5IT9 E;  4QQB X;  1HZ9 A;  4WFN 3;  4NXN Q;  2R7Z B;  1KDB A;  1PFN A;  4JYA Q;  3GTK B;  4KK7 A;  2GA4 B;  5C3E H;  3LX0 A;  2EDG A;  4A3I G;  4UP9 A;  1RKN A;  1K8M A;  2IX3 A;  1KC8 C;  2TMP A;  3MEF A;  3TS0 A;  1QE6 A;  3KF6 B;  1HPC A;  1X56 A;  1N34 L;  3HOZ G;  3CW2 C;  5C3E B;  2RQX A;  5C0X I;  4JI2 L;  1I5F A;  5EBD A;  1I50 H;  2Y0S E;  3R93 A;  2LXJ A;  1HTP A;  1A15 A;  2NVY H;  1TY0 A;  4X64 L;  5GAD C;  5M5Y H;  5C5L A;  3H94 A;  5FLM H;  3KBG A;  4YCU A;  3AFP A;  4R4Q A;  3PO2 H;  4OEL B;  3KF8 B;  1SEB D;  2MGS A;  2NVY B;  1I4Q A;  4AYB E;  4DV3 Q;  1KRT A;  1XMQ L;  5M5Y B;  1B2T A;  1E2V A;  1Y69 U;  4A3K H;  2Q2I A;  3T1H L;  4KHZ A;  4HSV A;  4LUO A;  1GO3 E;  1YJW A;  3CF5 A;  4JI7 L;  1EY9 A;  2FMM A;  3CHB D;  3PO2 B;  3Q23 A;  3A5U A;  5JAV A;  1D8L A;  1VDZ A;  3K0X A;  1PYB A;  1VQM A;  1QNK A;  4JI8 L;  2FXQ A;  3D4W A;  2K50 A;  2I5L X;  4A3K B;  1STB A;  3AFQ A;  3DWP A;  5EGT A;  5JOB A;  1JJC B;  1PTO C;  3MZ5 A;  5NUC A;  1HA6 A;  2VXW A;  1VQE A;  5IYC H;  3CCQ A;  4V19 0;  1KDA A;  1C0A A;  1I4H A;  3PUW A;  3MXN B;  1BF4 A;  4CJ1 B;  3AYH B;  3BG3 A;  1EY0 A;  1IBM L;  2QF7 A;  5IGE A;  1OXT A;  3D4D A;  3C1E A;  4IPG A;  1TWG H;  2F0E A;  3E9I A;  2NUC A;  2KCN A;  4TVA B;  3J7A 5;  4GN4 B;  4KMU C;  3TEH B;  2O5I C;  2IJ0 A;  2K5N A;  1DYQ A;  1TWG B;  1Q1E A;  1I94 L;  1VQC A;  2JP1 A;  1YEZ A;  4NDX A;  5DM6 3;  1MIU A;  2C5C A;  1KD1 C;  2IWH A;  1ASY A;  1HH2 P;  4FVM A;  4XT3 B;  1VQ5 A;  1ILQ A;  2ICE C;  1PDQ A;  1YI2 A;  1VQL A;  2O2L D;  2E75 C;  4HIM A;  1M1K C;  3OW7 A;  1UUP A;  2D0P A;  3OTO Q;  4RA8 A;  5FJ8 H;  1N8R C;  4X65 Q;  2TSS A;  4DN4 M;  1FJG L;  2VQE Q;  1IW7 D;  3A54 A;  3RZD H;  4N8F A;  1L0Y B;  2F0F A;  3HOV G;  3TP7 A;  1LAC A;  2F0J A;  1DON A;  3EFX D;  5J1Z A;  4IOA A;  2JN4 A;  2R92 H;  4FF1 A;  5EPJ A;  4QY7 A;  5IYD G;  4RG1 A;  1C9O A;  2K1B A;  1UWV A;  4A3E G;  2QCP X;  1Q8I A;  3AEV A;  3A8I E;  4CGY B;  2Y0S B;  2L4N A;  3FKI G;  1OXX K;  1LM0 A;  3I4M G;  2R92 B;  3JC6 6;  3K0Y A;  2RDF A;  1PZK D;  4IQZ A;  4BWG B;  4AQY Q;  1R4Q B;  2ZJP A;  4G57 A;  3NSW A;  1DXM A;  1NAP A;  4F8M A;  3M4O H;  2X69 A;  3MXP A;  4LW1 A;  1HFN A;  4A3F H;  5IT9 c;  5I4D A;  2QDL A;  5I6W A;  1X9N A;  5FO8 B;  1RDP D;  3GTG H;  3J80 i;  2QKI C;  4N9T A;  3I4N G;  4Y52 H;  4BY1 G;  4DK0 A;  2SOB A;  1RD9 D;  1NY4 A;  1SE3 A;  3M4O B;  4XYQ A;  1K8O A;  4K0K Q;  1Q8K A;  4A3F B;  4JI3 Q;  5BR8 L;  3VYU A;  3SXH A;  1NJI C;  1PTO D;  1TS3 A;  3GTG B;  1K73 C;  5C4J H;  2UXB L;  1K8A C;  4KHP Q;  3FVQ A;  2QEX A;  1V8Q A;  1STA A;  2NN6 I;  1EWC A;  1E2Z A;  5K36 H;  5C4J B;  2PMZ E;  4GS3 A;  1DCZ A;  3M9B A;  5LL6 X;  3R3O A;  4NMZ A;  4DR1 L;  4LUZ A;  1TKW B;  2N55 A;  2JA5 H;  1YVC A;  2E2I H;  1L1O C;  4KKU A;  1CKN B;  1JOO A;  5COY A;  3S15 B;  2Q8R E;  1IBK Q;  2ES2 A;  1K8G A;  4DNR B;  2K14 A;  2L12 A;  2B2U C;  1QIL A;  2PQE A;  1IL8 A;  2R93 H;  2JA5 B;  2RA4 A;  5EKI A;  2K5V A;  2G9D A;  4JBW A;  1JOK A;  4A3D G;  2E2I B;  1ZXT A;  3U9O A;  4MHE A;  4X6A H;  3I91 A;  4XXE A;  4B3R Q;  3U50 C;  5IP7 G;  2IL8 A;  4XDX A;  1B3Q A;  3SK8 A;  1Y14 B;  1QUQ A;  3S24 A;  5JPN C;  1UEB A;  3FEW X;  5C6A A;  1SAP A;  2VUM G;  3E6Z X;  3Q6S A;  4J1M A;  1BCP C;  1X54 A;  4HED A;  2DUD A;  3VR4 A;  2CW0 C;  1BOS A;  4IFD G;  5JVH 3;  2VNU D;  1KXL A;  1TXY A;  2BDO A;  4HTH A;  3CCJ A;  1CSP A;  1PMR A;  4YY3 Q;  4R4T A;  2AQ1 B;  3SEB A;  2A68 C;  4EQ5 A;  1SMX A;  2RDG A;  4R8N A;  1NMF A;  5JJZ A;  5I9P A;  3HOY H;  1JQY D;  5F2D A;  4OO1 G;  3TZD A;  1H95 A;  2KJX A;  4RGN A;  1V1P B;  2E8G A;  2F0M A;  2MO1 A;  3TBI B;  1LTT D;  3UDF A;  1JWS D;  5M9O A;  2F0H A;  1KRS A;  4DGZ A;  4LF4 L;  4PMW A;  1MBY A;  4PNY A;  3PUV A;  4UHV A;  3QIA A;  4WJW A;  1KNA A;  2KHI A;  3GTO H;  1KHI A;  2NVX B;  2BE5 C;  1B1Z A;  2F1M A;  1RTN A;  2F0G A;  1BNZ A;  4DV6 Q;  1SFO H;  3F8T A;  1LT6 D;  2NZO A;  1NR2 A;  2F0V A;  3NXW A;  2WP8 J;  1RJT A;  4QGU A;  1SFO B;  3PUZ A;  1JE4 A;  2KCT A;  3ZYY X;  1EY4 A;  2ASB A;  3M4Q A;  4CKB A;  2EYL A;  1DD2 A;  3J81 i;  4KJO A;  4HIK A;  3K6O A;  1X3Q A;  2EVB A;  2B2W C;  2F52 A;  1EFW A;  2XN9 C;  2I07 B;  4C3I H;  1ASZ A;  4DR4 Q;  5KYL A;  1M8A A;  1DOK A;  1GUN A;  4FF3 A;  1D2B A;  2I46 A;  3PIP 3;  1WTV A;  2F4V L;  1F9P A;  4DNT B;  4S3S A;  1PH9 A;  2ZM6 L;  4DXF A;  4A3B H;  3HS0 C;  3CCE A;  1XWE A;  4IUR A;  4JK1 C;  2D9U A;  1O7I A;  4YHH Q;  4KY6 A;  3P75 A;  4A3J G;  3GV6 A;  2FJ2 A;  1RL2 A;  3I4O A;  2WAC A;  3T13 A;  1MJE A;  3U58 A;  2LY7 A;  3ULJ A;  4IUU A;  1BCP D;  1G6Z A;  4A3B B;  1PH6 A;  1N36 Q;  3NUC A;  4XQJ A;  1CFM A;  2CW0 D;  4H13 C;  3BYY B;  1B9N A;  2H1E A;  3CC4 A;  4ZUJ A;  1TR5 A;  2G9H D;  1L1O A;  4V0B A;  4JV5 L;  1N32 L;  3MEH A;  4TRD A;  5C0X G;  3TP5 A;  5IGF A;  2DN8 A;  2A68 D;  3Q8D A;  1EY6 A;  4PQX A;  3F2C A;  4DV7 L;  4LFA L;  2B2Y A;  2WB1 G;  1FJG Q;  2MPM A;  1SR3 A;  2VQF L;  1I6V C;  3VA7 A;  3SGI A;  4N8X 1;  2YTY A;  5KIX A;  2E2H B;  3VDY A;  4C3H H;  2A5H A;  5FLX c;  1FD7 D;  3FRP B;  4O1N A;  1CUK A;  2I0Q A;  5LMN W;  1JMC A;  2HUG A;  4EX5 A;  2WB1 B;  1HCZ A;  2E5L L;  3S17 H;  1Q82 C;  1PZI D;  2EJF C;  3JAM i;  3KDF B;  1YJN A;  3K8A A;  5K5P A;  2HQE A;  4B3S Q;  1ESF A;  2YYZ A;  1I4X A;  2G5D A;  2WV6 D;  2KCC A;  2PQA A;  1VQA A;  3BDL A;  1WYD A;  4X3U A;  3J7Z C;  1HR0 W;  4GKK L;  5CV5 A;  5GQO A;  1TY2 A;  3ULP A;  4YWL A;  4K6D A;  2ZTC A;  1GHJ A;  1V9P A;  1HZC A;  1GM5 A;  1VQ9 A;  1F9R A;  5ELO A;  1CT1 D;  1SJH D;  5C44 H;  2VZA A;  2UXB Q;  2XVS A;  4RWS C;  4R4I A;  3NBI A;  4KKT A;  3OSO A;  4K2L A;  5DM7 3;  3PCO B;  5C44 B;  1BBW A;  3MFG A;  1ENF A;  3L0O A;  1KDC A;  5IYB G;  3QOL A;  2AMC B;  3URY A;  4DR1 Q;  3K80 C;  4DR2 L;  2PI2 E;  3O13 A;  1PTO F;  1B44 D;  4JW0 A;  3OMG A;  1AZQ A;  4XT1 B;  5LMU Q;  2F0T A;  2EPB A;  3LNN A;  1E22 A;  4DR6 L;  3X3M A;  2RCN A;  2SEB D;  2RCF A;  3S16 H;  2H4O A;  4KJN A;  3DEP A;  1QCB D;  1S3O A;  3KYH C;  4YWM A;  3BS1 A;  4KKS A;  4ZCK A;  1GUS A;  3H0G G;  4APV A;  3N6R A;  2K7V A;  3K7U C;  3H6M A;  4DNI A;  2P5Z X;  4C56 C;  3TP6 A;  3CAM A;  2JA6 H;  1ZEQ X;  5C4X G;  2VS1 A;  2WAQ G;  5CBE E;  2SDF A;  4FP5 D;  3MHB A;  3HOU G;  1AZP A;  1IBL Q;  5JEA H;  1TWA B;  1HQM C;  1LV9 A;  2K52 A;  3QB3 A;  5HUR A;  3H0G B;  3N52 A;  2ZJR A;  1S4Z A;  3PQI A;  2C9O A;  2JA6 B;  5ISR A;  2RSN A;  1TQO A;  1AE2 A;  3UE1 A;  2RBM A;  3EIV A;  4I65 A;  1VQN A;  4ZYS A;  1I4G A;  3F2B A;  1EL0 A;  3T1Y L;  1Q90 A;  1MGS A;  2E2J H;  2AUK A;  4DUY Q;  2L5T A;  3U4Z A;  2UXD L;  1HNW L;  2WFW A;  4JCV E;  3S2H B;  1SSO A;  1Z6H A;  1Q81 C;  3K7A B;  3EQL C;  5CYU A;  5M5X B;  3K5N A;  3TSS A;  3OHX C;  4H44 C;  3UDG A;  3NPP A;  4LF4 Q;  3IAY A;  1XNQ L;  4BBR B;  4LJZ C;  3ERQ A;  4X3S A;  5BN5 A;  2XIW A;  1SJE D;  1SYG A;  1RF2 D;  1GKH A;  4EQP A;  1SMY C;  1AFP A;  1FNU A;  2K4K A;  1EOV A;  1QJO A;  1LTL A;  1X6O A;  2DJF C;  2WII B;  3A5Z B;  4J8Q A;  5CV6 A;  5IY0 A;  3EVQ A;  4K8J A;  1U4R A;  2VY3 A;  3A74 A;  3HKZ G;  5EPK A;  1PH4 A;  2R7Z H;  2K5W A;  4L5S A;  3OWF A;  2PPB C;  1SYF A;  4B9W A;  1EQQ A;  4KTA A;  1V1O A;  4YCV A;  4A3M B;  3C3L A;  2MP1 A;  4RGT A;  1F2Z A;  4TQU S;  5CC4 A;  1B9M A;  2BA0 A;  4CBV A;  2NB0 A;  3I2Z A;  3U4V A;  3S14 H;  4GOP A;  2HDL A;  4EGV A;  4C1N I;  1GXD C;  1KIX A;  4DUZ L;  2E76 C;  4DV4 L;  1PLF A;  4OX9 Q;  3FP9 A;  3HZX A;  4A3I H;  3S14 B;  1IW7 C;  3S1R B;  1PRT C;  5IWA Q;  2L1B A;  2OTL A;  2IHE A;  3DWQ A;  4LFB L;  1VQF A;  2OQ0 A;  4FF2 A;  1IYU A;  2F3V A;  4JI0 L;  4HJ5 A;  2FIN B;  1J8I A;  3KJO A;  1SBB B;  5G3L D;  3RNU A;  1ENA A;  4NXM L;  4A3I B;  4DAP A;  2E74 C;  2AHO B;  3E3X A;  2B3G A;  4XYO A;  4EVO A;  1EFI D;  1GOZ A;  4GN5 A;  3HOZ B;  1A8V A;  4IZ8 A;  3SVM A;  1EIH A;  1L0W A;  4DAY B;  5TSS A;  1VMC A;  2GVA A;  2LS0 1;  3RMH A;  1SNC A;  4RGO S;  1HFG A;  5FLM G;  3EJI A;  2EY5 A;  2JEB I;  1YHA A;  1S72 A;  1N32 Q;  4DAV A;  2KEC A;  2A6E D;  5FOB B;  1F2M A;  4B08 A;  3DMU A;  3QJY A;  4LF7 L;  3CKI B;  5FLX L;  2LFN A;  4Z9C B;  1T5E A;  1HNZ Q;  2HIV A;  1BCP F;  5AJ3 L;  2PO4 A;  1VF5 C;  2J7Z A;  3FHW A;  4NP5 A;  1XNR L;  1CZW A;  2EYH A;  3LGJ A;  3CQZ H;  4GN3 B;  1S5F D;  1GUO A;  4P71 A;  4Y7N H;  1J5E L;  1Z9F A;  2XRQ D;  3I72 A;  2F0W A;  1GHK A;  1LYL A;  1K0R A;  3GDE A;  1CM9 A;  3G71 A;  3S1M B;  3BZD B;  5ELD A;  4POG A;  1SMY D;  2M9V A;  1A2T A;  4IO9 A;  5CR3 A;  3CQZ B;  1NR4 A;  4U68 A;  4DR7 L;  2RHS B;  4Y7N B;  1S40 A;  1SN8 A;  1VQH A;  1XTC D;  5J3B A;  1CKM A;  4A3G G;  3CP0 A;  2I5H A;  1WVL A;  1P8L A;  4GKK Q;  4KD4 A;  3EA6 A;  4N9P A;  2VW9 A;  1O80 A;  4KY7 A;  3BVM A;  4QIW E;  1NNX A;  2B63 G;  2UUA Q;  3CRL C;  3RN2 A;  4KN7 C;  1NSN S;  4FF4 A;  1HUN A;  1B70 B;  5AFW A;  3F2D A;  3ULL A;  4L5R C;  1PTO B;  2JA7 G;  3PIP A;  2C35 B;  4YIJ A;  4I7Z C;  1SYE A;  1FGU A;  4R4O A;  4DV5 Q;  5D3I B;  2CKZ B;  2OCE A;  1PRT D;  2QW7 A;  1BKB A;  1JR0 D;  4K5X A;  2VB2 X;  2B63 B;  1BVS A;  1F9S A;  2AQ3 B;  3M7N A;  4CDD C;  1PVO A;  3UDI A;  4LF6 L;  3KF6 A;  2L0C A;  4HR7 B;  4MNO A;  5COR A;  4DR2 Q;  1KAB A;  3HOV H;  1XTD A;  4DK1 A;  4H0L C;  1LT3 D;  2KA7 A;  2YTV A;  1BXT A;  2R7F A;  3MVV A;  2F0S A;  1T9H A;  2BH2 A;  5JPM C;  5IYD H;  1ET6 A;  2V4D A;  1S5C D;  3CCS A;  4WJ4 A;  1CA6 A;  3K58 A;  4X62 L;  3FPU B;  4GLA C;  4NPS A;  1KAA A;  3FKI H;  3ERO A;  5CGK A;  1CA5 A;  3GQB A;  5CV7 A;  4DV0 L;  4LF5 Q;  3HOV B;  4GNX B;  3I90 A;  2EYF A;  1SNO A;  3ND9 A;  4ZK9 B;  4A3L H;  3NP8 A;  5M3M G;  3I8Z A;  5I9O A;  1U4L A;  1HNX L;  4JI1 L;  3KF8 A;  4X3T A;  3B6Y A;  4A3E B;  3W3A A;  1V43 A;  1A3U A;  3LWE A;  1WTR A;  1WTH A;  3FKI B;  1ILP A;  3PMF A;  3KUP A;  3CC7 A;  3CU7 A;  4ILW A;  5I2X A;  2B2V A;  5IOD A;  3H3V H;  3I4M B;  1TS4 A;  2ZXR A;  1HXY D;  4BY1 H;  5LMN L;  3PUY A;  4P2C B;  4QCL A;  1K3B C;  2L9H A;  2ENB A;  1NUC A;  3ERS X;  1STN A;  1YIT A;  2A73 B;  1J9O A;  2CQO A;  1Z47 A;  2XTI A;  1CK1 A;  1TS2 A;  1K0S A;  3C46 A;  2B29 A;  1BBX C;  3I4N B;  3S15 H;  3PSI A;  1YNX A;  4BY1 B;  1UE7 A;  3C1F A;  3EN2 A;  3WOE A;  2ALY B;  4K5W A;  2GN5 A;  4C3J G;  5IP9 G;  1AW7 A;  1CSQ A;  1D5M C;  3ZJY C;  1Z7T A;  1WTQ A;  3MXN A;  1GVP A;  1OO9 B;  2UXD Q;  4Q0F A;  2UUB L;  2O5J C;  1HR0 L;  2CWP A;  4BS9 A;  5K36 G;  4QF4 A;  4LF9 L;  2K5Q A;  2NTS A;  2RKS A;  5FLX E;  1XNQ Q;  1D1I A;  1G29 1;  1NBW A;  5HGQ A;  2L11 A;  3TRE A;  4QMG A;  3E0J A;  1AH9 A;  5EKK A;  2B2Y C;  4F7X A;  4GZY C;  2EYJ A;  3HGB A;  2HDM A;  4JPB W;  3D31 A;  3GO5 A;  1DM0 B;  3AU7 A;  1XX8 A;  2O4X A;  1EU4 A;  4QIW B;  3G6J B;  3NEN A;  4FO2 A;  4CKE A;  2R93 G;  2A6H D;  5IP7 H;  5E1F A;  3UI2 A;  3HOW G;  4LFC L;  5BN4 A;  1BR9 A;  4JI5 Q;  2EY1 A;  2KHJ A;  4JC0 A;  1W6K A;  1G2S A;  4PZ7 A;  4X66 L;  4A3D B;  3CCU A;  2VUM H;  3S9W A;  1PH2 A;  1VQB A;  5KYI A;  3UDX A;  2Q8T A;  2F3I A;  2EZV A;  1D1K A;  4DUZ Q;  1PZJ D;  4IFD H;  1CTM A;  4JVZ A;  4B3T L;  3G48 A;  3HOW B;  4BBS G;  2VUM B;  1OTC A;  1CHQ D;  3OWE B;  1N34 Q;  2NVQ H;  2EY2 A;  1R4P B;  1C7Y A;  1JOR A;  2GVB A;  2JA8 G;  2ID0 A;  1WD1 A;  1G91 A;  4LUV A;  4LFB Q;  1IKM A;  4FXG C;  2ZXP A;  1Y1V G;  3SR1 A;  2NVX H;  2Q2T A;  4JI0 Q;  4JI2 Q;  4OO1 H;  1EIY B;  1S5B D;  1K28 A;  3CC2 A;  5GAE C;  1DOL A;  1UE5 A;  2AWO A;  2NVQ B;  2WB1 E;  4X64 Q;  2F3W A;  1EEF D;  3BYT B;  3S1Q B;  1P16 A;  2K32 A;  4R8I A;  4GNX A;  1Y1W G;  2CFM A;  1WTO A;  1O78 A;  2K5H A;  3OIQ A;  5ELF A;  4A3C G;  5JEA J;  1H9S B;  1LAB A;  1Q7Y C;  3VA5 A;  1BCP B;  1XMQ Q;  3HOX G;  5M5W B;  1O7Y A;  2R6G A;  3T1H Q;  5G3L F;  4JI7 Q;  2KCM A;  1PH3 A;  2F0P A;  1X3P A;  3I7F A;  1FNW A;  3I73 A;  1M4V A;  4HJ7 A;  4JI8 Q;  4LF7 Q;  4ME3 A;  1DJR D;  3NE5 B;  2M00 A;  1F9Q A;  1I4P A;  2FMC A;  1VMP A;  1F77 A;  3I70 A;  2UXC L;  1G6P A;  4DXG A;  1JWM D;  5KRU A;  2HHH L;  2MQH A;  1JE5 A;  1J6Q A;  3GTJ H;  2IW3 A;  2XNA C;  1VQK A;  1XMO L;  4RGM A;  3A56 A;  1EIF A;  1QNU A;  1B50 A;  4BY7 G;  5IOC A;  1IBM Q;  4OON A;  3JAM c;  1SRU A;  1CKN A;  1ESR A;  1MI2 A;  3J80 L;  3TP8 A;  3GTJ B;  4JYA L;  5CMD A;  4DR7 Q;  3RR5 A;  2R7D A;  2KUM A;  4C3I G;  1UNS A;  3NBH B;  1II3 A;  2KOL A;  4ZUI A;  4OWX B;  3NK9 A;  2JSO A;  4DK3 C;  4BY7 B;  4A3J H;  3J7A F;  1SE8 A;  2JYO A;  1I94 Q;  2B39 A;  4ZLT F;  2LMC B;  1PA6 A;  1GD7 A;  4G4K A;  4PG3 A;  4FYD A;  4BA1 I;  2E2H H;  4A3J B;  2A69 D;  2RSO A;  1LT4 D;  2JJQ A;  2B8F A;  1I4R A;  5C0X H;  2EYM A;  1IL2 A;  3P1H A;  1K3R A;  4DV3 L;  2F0Q A;  1DGS A;  5FK9 C;  1YBY A;  4DK6 C;  5JJI A;  4PMB A;  3CPW A;  4JG2 A;  3NWT A;  4K8I A;  3GV3 A;  2XWB B;  5FO7 B;  1V1P A;  4QUC A;  3RN5 A;  3R8B A;  2L15 A;  4G7H C;  5L37 A;  4KN4 C;  4C3H G;  4ODG A;  1B3A A;  5ELE A;  2CWA A;  1PRT F;  4GOP C;  3CCL A;  2JE6 I;  3H3V I;  3PUX A;  2YTX A;  1HZB A;  1SYC A;  4ALP A;  3D0F A;  1WCM G;  4CJ2 C;  2AWN A;  3A7A B;  3NEL A;  3ER0 A;  4F88 A;  3MFY A;  3K5M A;  1E1T A;  5A35 A;  4YCW A;  2Z6K A;  4BXX G;  4OHJ A;  1E24 A;  3PO3 G;  5BR8 Q;  4O2D A;  2B2T A;  2Q2U A;  5LMN Q;  3SDZ A;  2IPK D;  2KHS A;  5C3X A;  1IYJ B;  4YWK A;  5EAY A;  3ITP A;  3BU2 A;  2A1A A;  3VYR A;  2SNM A;  2V1C C;  4OEM B;  4IPD A;  1QB5 D;  4DV1 L;  5EPL A;  3K5L A;  3QG1 A;  1HHV A;  1PFS A;  5HGT A;  1B4O A;  2VB3 X;  3DWA A;  2EY6 A;  4DKA C;  4A93 G;  1XPO A;  1HJP A;  1S5E D;  3R2T A;  1BQQ T;  4H02 A;  1SE4 A;  3PIO 3;  2MJ8 A;  4JOI A;  3OTO L;  3PF5 A;  3HRZ C;  5CV9 A;  1WJJ A;  1U0L A;  4ZKB B;  4IUN A;  4J15 A;  5IYB H;  3DUZ A;  3IL8 A;  4LF9 Q;  1Y8P B;  3D8G A;  2K5D A;  5IGB A;  4JI6 L;  3GTP B;  4AH6 A;  1MSG A;  1E0B A;  3T53 B;  1ONL A;  4NKL A;  3A7L A;  2RF4 A;  1W3S A;  3SK5 A;  3GP7 A;  1TWA H;  1VQP A;  2F0D A;  3MXG A;  4RHS A;  1U9R A;  5M3F G;  1IHZ A;  3H0G H;  3TS2 A;  3MAQ A;  4IN3 A;  4IFD I;  3J80 E;  3LWU A;  4ULL A;  3VR6 A;  4X66 Q;  1PH1 A;  2XRS D;  4RKB A;  2EJM A;  5JVG 3;  3TME A;  2H5X A;  1WOC A;  1TVX A;  1MD2 D;  2MO0 A;  3IFD A;  4RH6 A;  1WTW A;  2IHF A;  1EEI D;  2A6E C;  2NZ1 D;  3S2H H;  4R4C A;  5M3F B;  3K7A H;  5C4X B;  5M5X H;  3DM3 A;  2WAQ B;  3OIP A;  2OF1 A;  3NTH A;  5DLQ E;  1W2B A;  3HFZ B;  3HOU B;  1A2U A;  5D65 A;  4BBR H;  3G6E A;  1PH7 A;  4JI4 L;  2UU9 L;  1JJG A;  4OWT B;  2XGT A;  4JBK A;  4H7B A;  1C48 A;  1YHB A;  4KHP L;  1YZ6 A;  4CJ0 B;  1K9M C;  2I5M X;  4FDB A;  1UAP A;  1FNV A;  4K14 A;  2Q2H A;  4ME5 A;  3H15 A;  1A6X A;  1RTO A;  3NQT A;  1WTP A;  4ZQ3 A;  4LK1 C;  2Z0S A;  4ZRZ A;  3J7A V;  3KDF A;  1EIG A;  3HEJ A;  2NN6 G;  4CDF C;  2Z8L A;  5IGC A;  3S2D B;  4K5V A;  4XQQ A;  1JCK B;  3CD6 A;  4A3M H;  4IPH A;  4RCN A;  4B3M L;  1LTB D;  2R3Z A;  1OXU A;  3T56 B;  1C8C A;  1IBK L;  2KEN A;  1HZA A;  1SE2 A;  2KEE A;  1B53 A;  2ZTE A;  1SYB A;  2R7Z G;  1Q86 C;  1D5Z C;  3S1R H;  1OXS C;  2CHB D;  3H09 A;  4E6I A;  3TQY A;  3HKZ B;  4KI0 A;  3G7L A;  3OYY A;  5D14 A;  1TWH H;  2ATW A;  3AQQ A;  3U9S A;  5E3F A;  3JAM L;  3PV0 A;  1XMO Q;  5E4W C;  1DOM A;  4P74 A;  1NE3 A;  1MKH A;  2B2V C;  2CVR A;  5C3E G;  4C1N K;  1HUM A;  1TWH B;  2FHT A;  3DHQ A;  3HOZ H;  2F4V Q;  4POF A;  2NVT B;  1A63 A;  4IUT A;  1KQS A;  3I4L A;  3TDQ A;  1EY5 A;  4YY3 L;  2ZM6 Q;  5I6Y A;  4ZKC B;  3KLR A;  2DNE A;  3Q0A A;  1OXV A;  2J4X A;  5HY6 A;  3FDT A;  1YNJ C;  3CXC A;  3GTL H;  1JIC A;  1EQV A;  1EY7 A;  3H91 A;  3V05 A;  1EWH A;  3L7Z C;  1VQI A;  3MXU A;  5JJK A;  1RIP A;  1B8A A;  2F0I A;  1QVC A;  2EXZ A;  1EWI A;  1STG A;  1VS0 A;  4L5Q A;  1IZ6 A;  1X3F A;  1A3V A;  4LWC A;  1QOH A;  4JV5 Q;  1PV4 A;  3GTL B;  3PO2 G;  1JOQ A;  4IFD J;  1ICW A;  1DZ1 A;  2Z4I A;  3VYT A;  5CV8 A;  2LSS A;  4A3K G;  5C5M A;  4DV7 Q;  1I50 B;  5E4X A;  4LFA Q;  1Q12 A;  2AUJ D;  1GUG A;  1L2F A;  3W2D A;  2VQF Q;  4DV6 L;  5C3W A;  2Q8I B;  4CDC C;  1PRT B;  3S1M H;  4GLV B;  2BA1 A;  2K01 A;  4DFA A;  2M2L A;  1QZH A;  1FR3 A;  1PXU A;  4CKC A;  1CKO A;  3J81 E;  1F2L A;  1LTA D;  4UY8 C;  1ENC A;  2IX0 A;  4NB3 A;  1EU3 A;  4KY5 A;  1Q1B A;  3KLW A;  2N49 A;  4WJ3 M;  5IYC G;  2E5L Q;  4UP7 A;  2X6L A;  2MNA A;  1KAW A;  1SNP A;  5DEH A;  3CME A;  1JT8 A;  4HJ9 A;  2K04 A;  4HAE A;  2NWG A;  3J80 c;  1HRJ A;  2ZTD A;  2BOS A;  4IOC A;  1E3P A;  1RCV D;  1EZ8 A;  1LTI D;  3VR2 A;  4DR4 L;  4A3G H;  3SE0 A;  3A55 A;  4L5T A;  4OGQ C;  1PTO H;  5IGG A;  4IAL A;  1MSH A;  3I56 A;  2WKC A;  1KTK A;  4UPA A;  1CZG A;  1D5X C;  4YHH L;  1B7Y B;  4A3G B;  3D6W A;  4IPC A;  2B63 H;  1PHJ A;  1U4M A;  2JQO A;  4HSP A;  2A6H C;  5KGU A;  2JEA I;  5FO9 B;  1CQF A;  1Y8N B;  3V96 A;  1EZ6 A;  1IKL A;  2HD3 A;  4GNX C;  2JA7 H;  1N36 L;  1GJX A;  1LUZ A;  1QUQ B;  4DV1 Q;  1QG7 A;  2L55 A;  5JJL A;  4A4I A;  2K03 A;  1JJ2 A;  5FJ8 G;  4PZ6 A;  1BBU A;  1VQD A;  5ELB A;  2PI2 A;  4U67 3;  2HCI A;  3VR5 A;  5CV4 A;  3T16 A;  2JA7 B;  1D7Q A;  1HTL D;  4L8J A;  2MFI A;  1YNJ D;  2Y0S G;  1D6E C;  2PYK A;  1FVI A;  2OWO A;  4HCE A;  1BDO A;  1KL9 A;  1UE1 A;  5C4Z A;  4HIO A;  1E2W A;  4JI6 Q;  2EYP A;  1IYV A;  4A3E H;  4A76 A;  4JBJ A;  4DR6 Q;  3CRK C;  2R92 G;  3STB C;  1SYD A;  1EYA A;  2NTT A;  1R9T H;  3H3V C;  3UE0 A;  1UE6 A;  3I4M H;  3RUZ A;  1AE3 A;  4UAI A;  2OTJ A;  3JAM E;  4AYB G;  4DAY A;  2Z4H A;  4QB4 A;  1WFQ A;  1VQJ A;  2KQ3 A;  1H9K A;  1X55 A;  5M3M H;  5A2Q E;  3RZD B;  4DV2 L;  1JB7 A;  2EQS A;  5C0X J;  1R9T B;  3I3C A;  4A3L G;  3W1G A;  3V2T A;  2UUC L;  3E5S A;  4A3F G;  3TN2 A;  2KBN A;  3I4N H;  3FPP A;  2F0K A;  1F2Y A;  5M3M B;  4B3S L;  1SND A;  2EJG C;  2JXM B;  4AYB B;  3K5O A;  4O42 A;  3GTM H;  2J0T D;  1HA5 A;  2RHQ B;  4MTK A;  4ID6 A;  5KNC A;  3CCR A;  3BZK A;  1QVF A;  1EUJ A;  1RHP A;  4XIG S;  4G7Z C;  3T1Y Q;  4HID A;  4JI4 Q;  2UU9 Q;  3RLO A;  1QVG A;  3OOC A;  3GTM B;  4IJH A;  1HNW Q;  1WI5 A;  3ND8 A;  2A8V A;  4C3J H;  5IP9 H;  2QIL A;  4RHR A;  3GD7 A;  5FKA C;  2QGQ A;  1PH5 A;  2CH4 W;  5GAH C;  2E2D C;  2F0O A;  1TT2 A;  4PMC A;  3IKJ A;  2WIN B;  4IUQ A; 
#chains in the Genus database with same CATH homology
 2WAQ G;  1NTG A;  2I5L X;  4DK3 C;  2JA5 G;  3HOU G;  4A3J H;  1SE8 A;  3AFQ A;  3OW2 A;  1I94 Q;  1IBL Q;  2D0O A;  2K52 A;  2JK8 A;  5ELN A;  1JJC B;  2ZJR A;  1PA6 A;  1GD7 A;  1VQE A;  4PG3 A;  4A3D H;  5IYC H;  4P72 A;  4BA1 I;  3CCQ A;  5LMU L;  2E2H H;  1AE2 A;  4B3M Q;  1Q46 A;  3PUW A;  1C0A A;  3MXN B;  3UE1 A;  2VL6 A;  3EIV A;  4A75 A;  3AYH B;  2JJQ A;  4GKJ L;  1VQN A;  1K83 H;  4RMF A;  3F2B A;  1IBM L;  1IL2 A;  3PIO A;  3L2P A;  3T1Y L;  1OXT A;  1K3R A;  4DV3 L;  3HOW H;  2E2J H;  4DUY Q;  4IPG A;  1TWG H;  3U4Z A;  3E9I A;  2UXD L;  4DPG A;  1DGS A;  1HNW L;  3J81 c;  2WFW A;  4JCV E;  1YBY A;  4C2M H;  4DK6 C;  1VQ8 A;  1N33 L;  1Q81 C;  4LF8 L;  5JJI A;  1QZG A;  3S1Q H;  4TVA B;  3J7A 5;  3CPW A;  4GN4 B;  1E1O A;  4JG2 A;  3HOY G;  3UDG A;  3TEH B;  4DR3 L;  4LF4 Q;  1XNQ L;  3RN5 A;  4DV4 Q;  2K5N A;  2L15 A;  1L1O B;  1Q1E A;  3ICE A;  1I94 L;  1VQC A;  4GLX A;  1IBL L;  1YEZ A;  1GKH A;  2N3S A;  4OXP A;  1MIU A;  4AIM A;  2K4K A;  1KD1 C;  1ASY A;  1EOV A;  1HH2 P;  1LTL A;  1X6O A;  2CWA A;  3STB D;  3A5Z B;  3EBE A;  4BBS H;  5IY0 A;  2K75 A;  2Z6K C;  4GOP C;  2VY3 A;  3CCL A;  3A74 A;  1VQ7 A;  2JE6 I;  2JA8 H;  3PUX A;  3H3V I;  2YTX A;  1YI2 A;  1VQL A;  1HZB A;  3HKZ G;  4HIM A;  1M1K C;  3BJU A;  2R7Z H;  1PH4 A;  4NXM Q;  2D0P A;  3OTO Q;  2IT1 A;  3CCM A;  3G4S A;  3D0F A;  5FJ8 H;  4HJA A;  4ALP A;  1Y1V H;  3CMA A;  1N8R C;  4JBM A;  4X65 Q;  1WCM G;  5M5W H;  2AWN A;  3NEL A;  2NZH A;  4L5S A;  1EQQ A;  3W1B A;  1X65 A;  3ER0 A;  1FJG L;  2VQE Q;  4YCV A;  1E1T A;  1A62 A;  4TQU S;  4DUY L;  3RZD H;  2BA0 A;  2JA6 H;  3I2Z A;  4YCW A;  2Z6K A;  3U4V A;  3HOV G;  4GOP A;  3S14 H;  1E24 A;  4BXX G;  3PO3 G;  1Y1W H;  5BR8 Q;  3PF4 A;  4O2D A;  2Q2U A;  4IOA A;  1KIX A;  2R92 H;  5LMN Q;  4DUZ L;  4DR5 L;  4A3C H;  4JOI C;  4QY7 A;  5IYD G;  4RG1 A;  1C9O A;  1IYJ B;  1UWV A;  4YWK A;  4A3E G;  3HOX H;  4DV4 L;  4OX9 Q;  3AEV A;  5EAY A;  5E7N A;  3BU2 A;  3RZO H;  3FP9 A;  2A1A A;  2V1C C;  4A3I H;  3FKI G;  1OXX K;  4IPD A;  4DV1 L;  1LM0 A;  5IWA Q;  3M4P A;  3I4M G;  2OTL A;  2IHE A;  4OWW B;  4LFB L;  2PQA B;  1PFS A;  1VQF A;  2OQ0 A;  2N78 A;  3JC6 6;  3RLN A;  2IY5 B;  5GRO A;  4DKA C;  4A93 G;  4AQY Q;  4JI0 L;  1XPO A;  2ZJP A;  5AJ3 Q;  4HJ5 A;  1HJP A;  3KJO A;  3M4O H;  4H02 A;  3RNU A;  1VQ5 A;  4NXM L;  4JOI A;  3OTO L;  3PF5 A;  1YHQ A;  1XNR Q;  4LW1 A;  4A3F H;  1WJJ A;  5IT9 c;  1U0L A;  2AHO B;  3DLL A;  4J15 A;  1YJ9 A;  5IYB H;  1X9N A;  1E7Z A;  2B3G A;  3GTG H;  1J5E Q;  4GN5 A;  4LF9 Q;  3E9H A;  3J80 i;  4JI6 L;  2DGY A;  4AH6 A;  3I4N G;  4Y52 H;  1A8V A;  4BY1 G;  1NY4 A;  1L0W A;  4DAY B;  4R1J A;  4NXN L;  2D62 A;  2RF4 A;  1W3S A;  2GVA A;  1Q8K A;  3S1N H;  4K0K Q;  4JI3 Q;  5BR8 L;  1NJI C;  4BY7 H;  5FLM G;  1K73 C;  3KJP A;  5C4J H;  2JEB I;  1V1Q A;  1TWA H;  1K8A C;  1YHA A;  1VQP A;  1S72 A;  4KHP Q;  2UXB L;  1N32 Q;  2QEX A;  4OX9 L;  3RLF A;  5M3F G;  1VQG A;  2NN6 I;  3H0G H;  4PZ8 A;  4LF7 L;  3TS2 A;  5IWA L;  4IFD I;  4A3B G;  3E0E A;  2PMZ E;  1HNZ Q;  4GS3 A;  2HIV A;  3M9B A;  5AJ3 L;  4X66 Q;  1PH1 A;  4DR1 L;  3FHW A;  4LUZ A;  2JA5 H;  1XNR L;  2H5X A;  1WOC A;  1YVC A;  1IXR A;  2E2I H;  1L1O C;  2MO0 A;  2IHF A;  3CQZ H;  3LGJ A;  4GN3 B;  1CKN B;  4MZ9 A;  4Y7N H;  4P71 A;  1YIJ A;  4MTN A;  1Z9F A;  1XJV A;  1J5E L;  1IBK Q;  1TWC H;  4QL5 A;  4R4C A;  3I55 A;  1K8G A;  2ES2 A;  3S2H H;  3K7A H;  1LYL A;  2K14 A;  1K0R A;  3GDE A;  1X3E A;  5M5X H;  3DM3 A;  3G71 A;  1W2B A;  2R93 H;  5DLQ E;  3HFZ B;  4POG A;  2K5V A;  4JBW A;  4BBR H;  3G6E A;  1PH7 A;  4A3D G;  1VQO A;  4JI4 L;  4IO9 A;  4X6A H;  2UU9 L;  4DR7 L;  4OWT B;  1JJG A;  4B3R Q;  2XGT A;  2RHS B;  1S40 A;  3U50 C;  3W5O A;  4JBK A;  1SN8 A;  1VQH A;  1YHB A;  5IP7 G;  5J3B A;  3J81 j;  4KHP L;  1YZ6 A;  1K9M C;  1CKM A;  2I5M X;  4FDB A;  4LF6 Q;  3CP0 A;  2I5H A;  2PNH A;  2WAQ E;  4LNQ A;  4A3G G;  1Y14 B;  3WWV A;  1P8L A;  2EXD A;  1QUQ A;  2Q2H A;  3H15 A;  1PYS B;  3S24 A;  1N9W A;  1UEB A;  3CCV A;  2VUM G;  2Z0S A;  4GKK Q;  4UP8 A;  3KDF A;  1X54 A;  4P75 A;  2NN6 G;  2VW9 A;  1HNZ L;  2DUD A;  4QIW E;  2B63 G;  1NMG A;  4X62 Q;  2UUA Q;  4IFD G;  3CD6 A;  1KXL A;  2VNU D;  4A3M H;  1TXY A;  3RN2 A;  4DV0 Q;  3CCJ A;  4BA2 I;  1CSP A;  4IPH A;  4YY3 Q;  4R4T A;  1B70 B;  1IBK L;  1OXU A;  4B3M L;  3F2D A;  1HNX Q;  3ULL A;  4L5R C;  2JA7 G;  2KEN A;  1HZA A;  4JI1 Q;  4EQ5 A;  1SMX A;  3PIP A;  1FL0 A;  1NMF A;  2C35 B;  3A0J A;  3CPF A;  3HKS A;  1FGU A;  4R4O A;  4DV2 Q;  1VCI A;  3F1Z A;  3HOY H;  4DV5 Q;  2CKZ B;  2OCE A;  5IE8 A;  4OO1 G;  1BKB A;  1WCM H;  1H95 A;  2ZTE A;  2R7Z G;  1BVS A;  2E8G A;  1Q86 C;  2UUC Q;  3M7N A;  1PVO A;  2MO1 A;  1OXS C;  3S1R H;  3UDI A;  4LF6 L;  3KF6 A;  3UDF A;  3TQY A;  4KI0 A;  2ATW A;  4MNO A;  3OYY A;  4DR2 Q;  1TWH H;  1KRS A;  3AQQ A;  4LF4 L;  3HOV H;  1XTD A;  4PMW A;  4BXX H;  3PO3 H;  3PUV A;  3PV0 A;  2AKW B;  1XMO Q;  1XPU A;  2YTV A;  5H1S E;  3IRB A;  2R7F A;  1A0I A;  2KHI A;  4P74 A;  1T9H A;  2BH2 A;  1NE3 A;  5IYD H;  1MKH A;  3GTO H;  1KHI A;  3CCS A;  4WJ4 A;  3HKZ E;  5C3E G;  4X62 L;  5C44 G;  2UUA L;  4GLA C;  3BZC A;  4IJL A;  4NPS A;  1MJC A;  3FKI H;  4LF5 Q;  3GTP H;  3HOZ H;  4DV0 L;  4DV6 Q;  1SFO H;  2F4V Q;  4GNX B;  4POF A;  1A63 A;  4A3L H;  1KQS A;  3F8T A;  4DAM A;  1EQR A;  5M3M G;  4YY3 L;  2ZM6 Q;  2UUB Q;  1HNX L;  1SRO A;  2NZO A;  1HR0 Q;  4JI1 L;  4X65 L;  4A93 H;  3B6Y A;  1OXV A;  4GOP B;  5HY6 A;  1V43 A;  2VQE L;  2EIF A;  2WP8 J;  4QGU A;  4DV5 L;  1XPR A;  3CC7 A;  3CXC A;  3GTL H;  3PUZ A;  2KCT A;  3H3V H;  3M3Y H;  3L7Z C;  1VQI A;  5JJK A;  1RIP A;  4QJF A;  1B8A A;  1QVC A;  4KLK A;  2ASB A;  1EWI A;  4BY1 H;  1VS0 A;  3M4Q A;  5LMN L;  3NEM A;  1IZ6 A;  1X3F A;  3PUY A;  4L5Q A;  4LWC A;  3GTQ H;  3J81 i;  4JV5 Q;  1TWF H;  1PV4 A;  4HIK A;  3ERS X;  3PO2 G;  1HNW Q;  1YIT A;  4IFD J;  2A19 A;  2CQO A;  1Z47 A;  5GAG C;  2XTI A;  3PGZ A;  2F52 A;  1G51 A;  2ZJQ A;  1EFW A;  2B29 A;  4LFC Q;  4C3I H;  1ASZ A;  2LSS A;  3S15 H;  3PSI A;  1YNX A;  4A3K G;  4DR4 Q;  1UE7 A;  1SLJ A;  2OQK A;  4LFA Q;  4DV7 Q;  3EN2 A;  4GKJ Q;  2ALY B;  1U5K A;  1Q12 A;  5M3F H;  2GN5 A;  2HQL A;  5IP9 G;  1L2F A;  4LF5 L;  4AQY L;  1CSQ A;  2VQF Q;  4DV6 L;  3ZJY C;  2F4V L;  5C4X H;  4O0A A;  2YV5 A;  1PH9 A;  1GVP A;  2ZM6 L;  1PH8 A;  3HOU H;  3S1M H;  3K81 C;  2UUB L;  2UXD Q;  4A3B H;  1HR0 L;  4GLV B;  3CCE A;  3TRZ A;  2CWP A;  1N33 Q;  2JA6 G;  2BA1 A;  4LF8 Q;  1O7I A;  4YHH Q;  5K36 G;  1QZH A;  4A3J G;  4LF9 L;  1CKO A;  1RL2 A;  3I4O A;  5JEA G;  4OO1 I;  4DR3 Q;  1MJE A;  4B3T Q;  3U58 A;  1XNQ Q;  4UY8 C;  1NBW A;  1G29 1;  2IX0 A;  5HGQ A;  3TRE A;  3ULJ A;  4NB3 A;  1AH9 A;  1PH6 A;  2YU9 H;  4K0K L;  1Q1B A;  1N36 Q;  4JI3 L;  3KLW A;  2N49 A;  1I3Q H;  1EYG A;  4WJ3 M;  3D31 A;  3GO5 A;  5IYC G;  2E5L Q;  4UP7 A;  1I6H H;  3CC4 A;  1X3G A;  2MNA A;  1VQ4 A;  1L1O A;  1KAW A;  3CME A;  3S2D H;  4JV5 L;  1N32 L;  4HJ9 A;  1JT8 A;  5C0X G;  2BH8 A;  3KOJ A;  3NEN A;  2R93 G;  3J80 c;  2ZTD A;  4IOC A;  3KFU A;  1E3P A;  3Q8D A;  5IP7 H;  2JA9 A;  4BBR G;  3HOW G;  4P73 A;  4LFC L;  4DR4 L;  2IX1 A;  4A3G H;  3F2C A;  4DV7 L;  4LFA L;  2HT1 A;  4L5T A;  4JI5 Q;  2WB1 G;  1FJG Q;  2KHJ A;  4JC0 A;  3I56 A;  1SR3 A;  1M90 C;  2VQF L;  4X66 L;  4PZ7 A;  3SGI A;  3CCU A;  2VUM H;  2YTY A;  1PH2 A;  1VQB A;  4UPA A;  3VDY A;  4C3H H;  3UDX A;  5FLX c;  2F3I A;  2N8N A;  4YHH L;  1B7Y B;  4HJ8 A;  4IPC A;  2B63 H;  1PHJ A;  1CUK A;  4DUZ Q;  2I0Q A;  4DR5 Q;  2JQO A;  2LXK A;  5LMN W;  1JMC A;  2JEA I;  4B3T L;  3G48 A;  4XTC S;  4BBS G;  2QA4 A;  4EX5 A;  1OTC A;  2NVQ H;  1N34 Q;  1C7Y A;  4GNX C;  4A3M G;  2GVB A;  2JA7 H;  1N36 L;  1LUZ A;  2JA8 G;  1QUQ B;  4DV1 Q;  2ID0 A;  4B3R L;  4A4I A;  4LUV A;  2E5L L;  5JJL A;  3S17 H;  4LFB Q;  1Q82 C;  1VQ6 A;  1JJ2 A;  5FJ8 G;  4PZ6 A;  1Y1V G;  3JAM i;  2UXC Q;  3KDF B;  2NVX H;  2Q2T A;  4JI0 Q;  1BBU A;  1VQD A;  4JI2 Q;  1YJN A;  1EIY B;  2PI2 A;  3K8A A;  2HHH Q;  5GAE C;  3CC2 A;  4B3S Q;  1UE5 A;  2AWO A;  2YYZ A;  2WB1 E;  4X64 Q;  1D7Q A;  2PQA A;  1VQA A;  2NVT H;  1WYD A;  3J7Z C;  2HIX A;  1HR0 W;  2CCZ A;  3GTK H;  4GKK L;  2MFI A;  2Y0S G;  1P16 A;  4JI5 L;  1FVI A;  2OWO A;  5GQO A;  4GNX A;  3M85 A;  1KL9 A;  1UE1 A;  3ULP A;  4HIO A;  1Y1W G;  4JI6 Q;  2CFM A;  4YWL A;  4A3E H;  4A76 A;  4QQB X;  4JBJ A;  4DR6 Q;  2K5H A;  2R92 G;  3STB C;  1HZ9 A;  2ZTC A;  5JEA J;  4A3C G;  4NXN Q;  1V9P A;  1Q7Y C;  1HZC A;  1R9T H;  1XMQ Q;  3HOX G;  1GM5 A;  1VQ9 A;  5ELO A;  3UE0 A;  4JYA Q;  1UE6 A;  3I4M H;  2R6G A;  5C3E H;  5C44 H;  3T1H Q;  4A3I G;  4UP9 A;  1AE3 A;  2VZA A;  2OTJ A;  2UXB Q;  4JI7 Q;  4AYB G;  2KCM A;  1KC8 C;  4R4I A;  1PH3 A;  1WFQ A;  3I7F A;  1VQJ A;  3MEF A;  1X55 A;  5M3M H;  3TS0 A;  3KF6 B;  1X56 A;  4HJ7 A;  4DV2 L;  1N34 L;  1JB7 A;  4JI8 Q;  3HOZ G;  4LF7 Q;  2EQS A;  4ME3 A;  5C0X J;  4A3L G;  3W1G A;  3PCO B;  3CW2 C;  1BBW A;  2UUC L;  4A3F G;  3L0O A;  2UXC L;  1G6P A;  2KBN A;  5C0X I;  4JI2 L;  5IYB G;  3I4N H;  1I5F A;  2AMC B;  2HHH L;  1I50 H;  2Y0S E;  2MQH A;  3K80 C;  2LXJ A;  4DR1 Q;  4DR2 L;  4B3S L;  2PI2 E;  1JE5 A;  1J6Q A;  2NVY H;  4X64 L;  5GAD C;  3GTJ H;  5M5Y H;  1VQK A;  1XMO L;  3GTM H;  5LMU Q;  5FLM H;  2RHQ B;  4YCU A;  3AFP A;  3CCR A;  3BZK A;  1EIF A;  1QVF A;  1E22 A;  4R4Q A;  3PO2 H;  4DR6 L;  4BY7 G;  1EUJ A;  3KF8 B;  2RCN A;  1IBM Q;  3S16 H;  4OON A;  4XIG S;  3JAM c;  1SRU A;  1CKN A;  3T1Y Q;  1S3O A;  3KYH C;  4YWM A;  1KRT A;  4AYB E;  4DV3 Q;  4HID A;  1XMQ L;  4JI4 Q;  4JYA L;  2UU9 Q;  4DR7 Q;  3RLO A;  2Q2I A;  3T1H L;  4A3K H;  3H0G G;  3RR5 A;  4KHZ A;  4IJH A;  4APV A;  1WI5 A;  1GO3 E;  4LUO A;  1YJW A;  1QVG A;  3CF5 A;  4C3J H;  5IP9 H;  4JI7 L;  2R7D A;  3K7U C;  2A8V A;  3GD7 A;  4DNI A;  2QGQ A;  1PH5 A;  3NBH B;  3A5U A;  5GAH C;  1D8L A;  3K0X A;  1PYB A;  1VQM A;  4JI8 L;  2FXQ A;  3CAM A;  4OWX B;  2K50 A;  5C4X G;  2VS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...