5JPMC

Structure of the complex of human complement c4 with masp-2 rebuilt using imdff
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpmC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpmC01
2WINB 3CKIB 3V96A 1UAPA 4D94A 3KLSA 1OO9B 2XWBB 3CU7A 1PXUA 5FO9B 5FOBB 4FXGC 3T4AC 5FO8B 5JPNC 2B39A 1BUVT 2J0TD 3FRPB 4FXKC 1XWEA 2WIIB 2TMPA 3I70A 3L3OC 2ICEC 5JPMC 1JC7A 3OHXC 1GXDC 2I07B 4ILWA 2PN5A 1BV8A 4LNVA 2A73B 1BR9A 2XWJB 1JB3A 5FO7B 1AYOA 1UEAB 1EDYA 2QKIC 2E2DC 3MA2B 1BQQT 1D2BA 2A74C 3HRZC 3G6JB 3HS0C
chains in the Genus database with same CATH superfamily
3IDGA 1UWEH 3TEZA 1IGFL 4YR6B 3KH4A 1I3GL 5FK9A 3ZE0F 4RCNA 2N1KA 4QUCA 3CU7A 3U6RB 3WY2A 1R33A 1ZK9A 4OSUL 3TBSB 2GPZA 2F0KA 3K0XA 1TO5A 3I6LD 4HDIB 2J4XA 5GRVK 1Q8KA 5K9QI 2J1XA 3FQNB 2ZCLH 1PLFA 4FI6A 4OFKA 1GVPA 3KF6A 1IBGL 3B5HA 2J1KA 4GBXA 5CWSA 1ZLVH 3TCXA 4OKDA 3FOMA 3S37L 4KQ4L 2OR8A 3NABL 5HHOB 4NKOA 4P5MA 2N3JA 4XGZA 4WEUD 3T3MF 1L0PA 4RFOH 4K8RD 4J8QA 1GCFA 1OSZB 3IDMA 1JTOA 1VRSA 3MUJA 4LGPB 5HHVL 4TRPH 4OZ4B 1EU4A 4L1BA 6FABH 4ANWA 4DV7L 1ICFB 4DR3Q 2XV3A 1HRJA 2IPKB 3FS9A 2ZWNA 3G5ZA 3QISA 1DL7H 2P8PB 3NJVA 2X4PA 4G9DA 3VFUA 1KDIA 3BVUA 1WCQA 5LMNW 4BQ8A 4PREA 1U58A 4WI0B 4HCFA 5A1AA 4GSXA 1H8NA 1CYWA 3FAWA 3ESPA 1LNUA 2ENPA 3T0XA 4DUYL 3F12A 3M6DA 5AZ2H 4PCYA 4A63A 1WO2A 3I4MB 1MUJA 5D6CA 3DM1A 4LUVA 1BEXA 3WY1A 4RMUA 1X32A 2X89A 3KD4A 3E0JA 1WIOA 3C1EA 3JBG7 3MRFA 5HPMB 1U8KA 2EYSB 3QWQB 3ZIMA 2QQKL 1T83C 1VQNA 3O3AA 1BXXA 1XB3A 3FPYA 4F7EB 5D14A 1JICA 4EQOA 5DEZA 4Z7WE 2F8IA 5HY9A 1RZGA 4K7PY 2BOBB 5F0MB 2HVJA 4HHWA 1XR8B 3WGVB 3OHXA 4HD5A 1OLLA 1OM3H 1E5AA 3HMWH 2OLDA 3LKRA 4X4MA 3SKOB 3U9PH 5BQ7A 3VD2A 4IK7A 1OALA 3WS3A 3JQOB 3MBED 43CAB 2K6AA 1GA2A 2ZWZA 4DR6L 5FLXE 1AP2B 1OAJA 4A93G 2QVIA 3CHSA 4OLYL 4PJ5D 2MKWA 4WWKB 4X4ZA 5F7EH 5HHOD 3B8SA 3Q6GH 1UHVA 1SNRA 3WLWD 2CWPA 1NFIA 4X4KA 2KDYA 1UB6B 3BMWA 5BV7C 5T1GA 2EAEA 1BYOA 2CA4A 2VQUA 4WUKH 4ZW8A 4XP9L 4PJGA 5JHDA 2FYYB 3U4KA 1IBLL 4HZLB 4RBPH 3N50A 1BVNP 2IPKD 3L1OL 3R8BB 4DZ8B 2R0ZL 1ROCA 2F5AL 4NO0B 3TYGH 5HGAA 3DSNB 2J1ZA 1KGIA 5DNFA 5J39A 4Q9RH 2AJZA 5JIMA 3U36B 4YDKL 1X4ZA 5AEAA 5D1XA 2A9NL 4E42B 1HQ4B 3PF4A 5I8OH 4HKZA 1NGQH 3VYNA 4EVNA 3ISYA 1NLDL 4LZKA 1MD2D 2Q2UA 2IANE 2WXIA 4PCTA 4WWOA 2SEBB 2BRQA 1RU9L 5B3JE 1N32L 3IAQA 4YHIA 2O5JC 1Y6MR 3QCUH 5E03A 3C09C 4WHYG 1DLFL 4LNRB 1G9MH 1M4KA 4NIYE 1WPCA 3F6JA 3IDGB 4I7ZC 1P4BL 1X7QA 2HUHA 1U95A 1A2UA 2Q86B 5FK9B 3B9VA 4KK6D 1MNNA 5IW3A 5C0NC 1I3VA 1E42A 1KOAA 1JNLH 2EYJA 1C12A 1HL4A 2GT9B 3F7YB 1WFJA 4JFDE 5DUMH 1N7MH 2Y6SD 4U1LA 3UTPD 3ZJYC 1VEOA 1T0MA 3KF6B 1BV8A 3N55A 2G5BB 3IJYA 3FOMB 3BSGA 1VMPA 4MXQD 2HTKD 3T1YQ 1DDHA 3L81A 4GG8A 3AAZB 3BP6B 3O3EB 4KTEL 5JUEH 3RUGA 1Q94B 3MLYL 2OMWB 3K80C 1LYLA 2NBFA 4FQ1H 3IDMB 3NIFE 3HNTL 1R5WA 4DV2L 4J3OH 3ARPA 3IGAA 4C3JG 2F1MA 3QCTH 1FJ1B 1U3JA 5LMNQ 2H1LM 4WWKD 4OTXL 6PAZA 4UP8A 1A6TA 1SEQL 1IZ6A 5HHXL 3RX8A 1NCWH 1E2WA 1SY6H 4M8AA 2OTPA 3B7RL 1L9NA 1RD6A 4G9DB 4TF4A 4WW2C 3SN6N 3VFUB 1TPXC 2HTLC 3G04B 1A47A 1E6JL 4PREB 2CLZA 1KEGH 3PP4L 1LABA 1PJ9A 3DARA 3WKNA 5IQ7H 5K9OA 3U4AA 2VY3A 5IHWA 4ODHH 3EJIA 4TULH 3UO1H 2I25N 3QRBA 4NO0D 2PWFA 4NWTL 4P2RB 1FYTE 5KVGH 1DBBL 2YA2A 5DD0L 2ZX8A 3QUKB 4LO9A 2DLHA 2F7RA 4CU8A 1MUJB 4AH6A 2AJUL 1HN1A 2L5TA 5D6CB 2QFRA 5KJRL 4M29A 3VGBA 1UURA 2XBDA 3HS0B 1ET6A 3NA9H 4W6XB 1ILPA 1QHPA 1U8KB 1RMFL 3JVGC 4GRWF 2P26A 3CAMA 1UOVA 1ZEQX 3M17A 3QUYA 4IGBD 5KVEL 3O3AB 5I8KL 1UXSA 4JG0L 4D9QD 3SJVB 2AERT 3K2KA 3CHQA 4LSRH 3PABA 2HVJB 4QXVA 5D5MF 4LF8Q 1GAFH 3MLRH 1J9RA 4FAAB 1S7WA 3APNA 4U0QB 4OFVA 3UAAA 3LKRB 4W9GC 1ZLVK 3MODH 3BUDA 2L4OA 4U05A 4BQ6A 4DEUA 5BQ7B 3MLXH 3Q9PA 4KRPB 3WS3B 4HSVA 3WKMH 1EY5A 1TKWB 1B3IA 4O0AA 1UWXH 5HHMB 2BSCA 2B1HH 1PFSA 2KCCA 2FNBA 2F0HA 3I6LE 5D1ZA 1NAPA 1KJ2H 4K8RC 2GTWA 2DTML 4FVMA 2CKBL 1EAQA 1P4LA 4PJGB 4WZ9A 1E3XA 1UCBL 2D2OA 5D93B 3LZFH 1GZHC 1UTDA 2DQFA 4UQDA 3WS6A 1FL5A 1ZHBB 2KQMA 5HGAB 4BZ1L 4JY6A 2NNAA 4N2NA 1MCCA 3FKIH 2EDEA 1M7XA 4QOKA 3B2PA 3QG7H 3UJJH 1HKLH 2J5WA 2EDGA 5D1XB 3QOLA 2BXYA 4OCYH 1IU1A 2WQWA 4H8WC 1FFPA 3TOPA 2QVFB 1ZV9A 1K3BC 3QH3A 4P2RD 1IAII 1E9QA 2WKGA 4LLQA 4BFIA 3ZMNA 1CT8B 4F9LC 1QUQA 4YHIB 1KDCA 1H3XA 2MIZA 2KQNA 3HI6L 2V4DA 5AFAA 3TNNA 1HA5A 3MLPA 3SE6A 5TE6H 1RVFL 1MI5D 1TZIA 2UY6A 3GLAA 2M2DA 3T3PF 4X8CA 2XX0A 1U95B 2WK2A 4W68A 3OMGA 5IKCB 4M1UB 1BQHB 2FWLB 4HWBA 5F7UA 1KIRB 4UQIM 3ZYOA 2ZWSA 1SXTA 2JI3A 3GI8H 5F1KC 4DNIA 1MFDL 3GSUA 3F7VB 1ZIBA 1A3LL 3RDTA 3DMUA 2OI9C 1Y1WH 1KLFA 4GXUM 4K07A 4ONFH 4U1LB 1WS8A 2KUTA 3QZPA 4NC1E 3SJVD 1T0MB 1PG7H 1C7YA 2JMRA 2R7EB 1NICA 3EIFA 4NQTA 2WXGA 4X5QA 1E7UA 1ZJBA 4G3YL 4Y16A 3DX1A 5FYKU 4WCYH 2WXLA 3V4LA 4UPAA 1PNCA 3M3YB 2RQEA 3HB3B 3RUGB 5CJBA 3O6LL 1FH2A 4HISA 1C1EL 4KRPD 1R5WB 3CFKA 1UM4L 3T6WA 3IDYB 1U4MA 4ZDHA 3CVHB 4LFAL 3S3DB 5D4QA 1ASZA 5HHMD 1Q4NX 4XZUB 1A6TB 1NWPA 2JJVA 2WUBL 5D65A 1AE6H 2DEXX 4PSRA 5HJDA 4CKCA 4QQBX 3GTJB 3WLWC 4AYBA 1Q1JL 4RBPK 1T1ZA 2ZUQB 4L1DA 5SX5H 3CFJB 2CLZB 2EXTA 3TNMA 4LSSH 5F3FA 1HQRB 4G59C 4PJ5E 4HSPA 1AGCA 1CYXA 4JYAQ 2YPVH 3FTSA 1B0WA 4DV5Q 4OO1H 4G9FA 3WUZA 4M48L 3INOA 5I6YA 1D6VL 2HJKA 1A6PA 3V96A 1INQA 3OX8A 1OP5H 2V7HA 1N8ZB 4U1HB 1AIZA 4WV1B 4FA8A 4AIZB 1JXKA 2CAKA 3Q05A 2B4CL 1LP9F 2B20A 1NUCA 4ZFFB 1ZHNB 1IIIA 4W9HC 4NQCA 5CUSL 1MFCH 5DGRA 4N8VG 4DT2A 2V5SA 1Z66A 3QUYB 3M17B 1U0QA 4Q6IA 1EWCA 2V7NA 2Q10A 1W3SA 3T04D 1A6AA 2YEZA 2DQHH 3PABB 3EROA 1J9SA 3MNVB 3VH8G 5EU3A 4KK6C 1T4KB 1CGTA 3JWNE 1DBJL 4JPVL 2A38A 3W82A 2MWCA 3WIHL 3G6JB 4NNXA 5I30H 3ZKSD 4Z3GA 5E6YA 1JN6B 2W38A 4WI3A 5BUGA 3D4RA 2Y6SC 3GSQA 1AXTL 4FKEA 4L37A 5IQNA 2DNEA 1GGIL 3Q5YA 1TDQA 4AVJA 2WIIA 2YV5A 1XH1A 1YYCA 3H1ZA 5DHYA 3SDXF 3T0EE 3MLUH 4L8SA 3DV4A 1DUYA 1PX3A 3HB3D 3DHMA 4DEPB 5D1ZB 5T3ZL 3UTPE 8FABB 1TR5A 1AZNA 2B3RA 5D2NC 4TNWF 1B7YB 1J9OA 2VJXA 1R0AL 1A64A 1EK3A 1W0WB 1EHNA 2I85A 2Y7MA 2YBGA 4LLDA 3CFUA 1CF8L 5D7LA 4WWKC 2DIBA 1OF0A 3SQBA 5IJDC 1BAWA 1FL5B 5JJZA 4QB4A 4ZUWA 3RVVD 4O9HL 4GSRA 1D5IH 2VR8A 4WRLA 5D2NE 1CPUA 1HZCA 1I31A 1I1FB 4QOKB 2RMNA 5T5NF 2BP5M 2YWZA 4HHGA 1U4FA 5HJ3B 2P24A 3ABKB 3BKYL 4UHVA 4K5XA 5GAEC 3JV4A 5EIIA 1HQRD 2X6BA 4FNSA 1PLCA 4XPFH 5DYFA 1FFPB 5JOFA 1UVQA 2IW3A 1AKJD 3HZVB 3V0VA 3CN0A 1RK0B 1JZ7A 1E9QB 2IF7A 3DYOA 1CYGA 3L3JB 4UT7L 4AM0Q 4O02L 3D39E 5IVXF 1GY1A 3HE6A 1IGIL 1DFBH 1UT2A 3GO1L 3CZKA 4AKQA 1JHKL 1MCHA 1NDMB 4RMFA 4AJ0A 4NC0B 5B39G 4IS6B 3RDTB 5GAHC 1XGYH 4L1HA 4EQNA 3BSZL 4MA1B 2N88A 3WXVH 1EGJH 1WFIA 1ESOA 1WI5A 2MFIA 1N6UA 2K8QA 4Y16B 4KJNA 1KJVB 1OOWA 2VUKA 2RFXA 4BDVA 1AVAA 5DZOA 2VAAA 2IQ9H 1JHLL 4W9DC 2ZOKB 4DR3L 2IXQB 4OGXL 2ZXBA 3TT1L 1RF2D 2B63H 3MRJB 4D9QE 3CFKB 1H95A 4XTCS 3GSXB 2JF1A 4ZDHB 1K0SA 2QQNL 3A22A 3B2UD 3J81i 1RZIB 5I6MA 2OL3H 2EDLA 1CB4A 1TS3A 1QRNB 1ZMYA 2NUPA 3GDCA 4KITB 4K14A 2QHRH 4AYBB 1IBKQ 5I1AA 1J5IA 4A2GA 1QWUA 3B56A 1S9VB 5HYJE 2VZSA 1KCUH 3L4XA 1V1QA 3NSCA 4UOW1 5CNHA 4UDTA 3NTIA 4GI8A 5EZJB 3TNMB 3Q06A 4KMTL 1AGCB 2GG1A 3BPNB 2HA1A 3LRKA 4KN7C 3NAAH 3FO2A 4TQIA 5M5WH 3DECA 1RIPA 1H0DA 3F2UA 1P6AB 3HP3A 1BX2A 1SUHA 3OGOE 4BXVA 5I6KA 1INQB 5DSCA 1ILSA 2ZOWA 2Q6WA 2DQGL 5AVYB 5FCUH 3VMPA 4FNRA 1MBYA 5DJ6A 3MRDB 1CIDA 3M8OH 1GYCA 4LXFA 5T1LB 5FLVA 4DUZQ 2VIRA 2PXYB 4QHNA 2ZAHA 3LX0A 1A8VA 4X98A 4WORA 4LESA 2HUEA 2F0CA 1PH4A 4LCVA 4Z7NE 4MJHA 1U8LA 4NN7C 4DP2X 2XA8L 4Q6IB 1AHKA 4LFBQ 4OQTL 3S2DH 2YEZB 4P2RE 4ZPTA 5SWSD 3HS0C 1OL0A 5IFHH 3Q01A 3AMLA 5EU3B 3HKZG 3D07A 3K57A 3QIUD 2HUGA 1GOHA 4NNXB 4ZMZA 5G4NA 4IBZA 3ROOB 4F2FA 1KBKA 1MI5E 4L37B 4Q7DA 3P1VA 4MQ7A 4P05A 4QRPD 2E6QA 4XQNA 3HVNA 3PCYA 2VWEC 2QCPX 4L8SB 2JP1A 3DV4B 4AGNA 1DUYB 3MRGA 3ZE2B 5C6TH 1JOKA 3OW7A 4PAZA 3VG9C 3TZDA 3KBPA 1B0IA 4O1NA 1ZS2A 4KQ0A 3SJVE 3WJMA 4KRPC 3TWYA 2HRPH 3ER0A 4LLDB 4H88H 4ZUJA 2W07A 2AZUA 4PRIB 2A74C 2F19H 3MZTA 1QRND 4AQYQ 1WWAX 3SOTA 1OSEA 4F8OA 2E74C 4N2BA 1VAHA 1N33Q 1H6EA 1SZNA 1R3JA 5TQ0H 3QQDA 2P24B 3JV4B 4ERSH 4W9CC 3CCHB 3RHWF 5HHME 5EPMA 4NSKA 5D93C 5HDBB 5JOFB 1HL9A 1X9UA 4UILL 1CM9A 5C70A 1OP5K 3I9GH 5DEFA 3V0VB 3NZSA 1W15A 4AY0A 2K6WA 3ALXA 4WHTB 1Y0LB 2Q8BL 3VRJB 4WAFA 3SGIA 3HE6B 3OKNA 2L9HA 4KNUA 2FD6H 3VSQA 1UD5A 1W6LA 5MEOB 1NIEA 1B0RA 1LEIA 4DUXA 3TO2B 3VVWA 1PJWA 1PQZB 5K59F 4DGIH 4TV3A 1ED3A 4QY7A 2XBTA 2QTVA 2W0PA 3IU3A 4G1EB 4XWGL 1SJVA 1LO5B 3TCLA 5TF1H 3T1YL 4XMKL 1SXAA 4BSWA 1KWKA 3ZL1A 4J3OD 1AANA 4HCRA 3EDJA 5D7KE 3RY6A 1B9MA 4GRWH 2VDQL 3CFBB 2RFXB 4BDVB 2X2UA 4Q9QH 3TURA 2EYRB 4YL4A 5C5LA 5LMNL 1KYOJ 1R24A 2CHNA 1QNIA 5TE7L 2DICA 4PG2C 3S8GB 2F0DA 4MVBD 1OGAA 3MRNA 2DLFL 1I8IB 2X70B 2NUPB 1UJ3C 3E2HB 5JTWA 5T33H 1NH6A 3HB3C 5I0YA 3LQAC 4LF4Q 5H94B 2GVBA 3EJZD 3BQVA 4PCKA 5JDSA 4HUCA 3FZUD 3IDYC 5IGCA 1NUNB 1LO4L 1TSHA 1OAUH 4UDTB 5HYFA 1OCCB 3HOVH 4ZXBA 3QYMA 2AEOA 2VLJA 3ALPA 4PRID 2QILA 2Q2IA 4Z7VF 2BCMA 4WY7H 5E6UB 2WQSA 1E9OA 1H0DB 1YEDB 2WANA 3RVVC 2CH4A 4K8IA 2CD0A 3X1FA 1C8PA 1K8MA 4J1MA 1MFNA 4BWWA 2Q6WB 2ZUQC 5A2CA 1CBJA 1A63A 2DRUA 4YHLH 3TWCH 4LMQD 2VIRB 2BVOA 1BVKA 4KKQA 4J4PD 1X5YA 2VO8A 4X98B 5C4HA 3WLBB 3ZT5A 4AQ8C 3HOYG 3ELQA 1CLVA 4FDBA 3BPLC 3QCVH 4R4NC 4IBTA 3U25A 4P3CH 1WIUA 35C8L 2DEWX 4LF8L 4WV1C 3LKOB 1LK2A 2P80D 1NCBH 5C2BH 4E68A 4ODVL 4PEEA 3L1EA 3RL1A 5KIXA 3V7AG 4UQ9A 3N42F 1MRFL 3OGCA 4YH6A 2Z34A 5AKRA 4OWXB 2WFWA 3S88L 4HULB 1JI1A 1LO5D 1FIGH 4BUHA 3QUYC 4Z7QF 1Z47A 4OFDA 3SK6A 4PRHD 4OD2A 1FNEB 5IROA 1DQQA 2BH0A 2XXGA 4MQ7B 1AQ8A 4XNAA 2YKLH 5FYLH 2OQKA 2JE6I 3RFRA 4DW2L 5CLWA 4PSPA 3BQUA 3NCCB 3UPCA 2GK2A 5IMLA 4Q58C 1T7ZA 4P57B 5FHBL 4ZT1A 4G7SB 2I7OA 4I18C 3P3SA 4P2OB 3CQFA 3AG3B 4P71A 3DIFA 2HKHL 5GISL 1WZAA 3N41B 1KXVC 3B3IA 3L4VA 4GP4B 1D7DA 3B2UC 1X44A 1OP4A 1DOMA 2YUWA 4I5BA 4K0KQ 3SCMA 1CQVA 3PIP3 4MHHI 2UZIL 5D1QD 3TJEL 4DEPC 5LGJA 4AJYV 3TH4T 5D3DA 1FZKA 2WBXA 5EPMB 4NSKB 1Y14B 5C7ZA 3GXPA 1UH2A 5DEFB 3WS6C 4BY7H 1SJEA 1N68A 2OMNA 2PCFA 2W9LA 4XP1L 5C09B 4AIMA 3GLDA 5EOCL 1HI6A 2H1XA 4A68A 3ZE0B 4HSAC 2OM5A 4B7LA 4AQ1C 1HNYA 3L2MA 3QORA 2YARA 2QR0B 1ZPLA 3IU3B 5AZEL 4I3RH 3TCLB 4JI7Q 1BQRA 1S7VA 3MN8A 2H45A 3BCFA 2L7EA 1RJLA 1K8AC 3MJ9H 3TFKD 1GO3E 1X5LA 4G71B 1EEQA 3O13A 3V2TA 1LO2H 1T5XA 2GBAA 3LD8C 4H1LA 1WAEA 2A4ZA 3GS4A 4JQXA 4N8FA 4LDOB 4D7PA 4M3HA 2F8XC 1PTOF 2OR7A 3QIUC 4MWFA 5DQ9A 1KDAA 4MA1C 4ORGB 3BZ5A 3EJPA 4GIAA 5SWSE 3MA2B 1EZVY 2MPMA 3D4CA 3I55A 3FQYA 5I24A 3MRNB 4LF5Q 1G1CA 1BJ1H 3WTWA 3LH8A 3RIAK 1NCIA 4JYAL 1FDLL 2XICA 3TP5A 4P2OD 1BWMA 4DV5L 2NR6A 3MRCA 5IYDG 3CSYA 5JDSB 4QRPE 3K6NA 3T2OA 2JB6A 2K7QA 3OKLB 4ZXBB 4POGA 4OX9Q 2GHWB 1BBUA 4MHEA 2VO5A 1VADA 3HOXB 4YFLF 2BS8A 1JT8A 1Z3RA 2R1XA 3QR1A 5DJYA 3L4YA 3ULVH 1KB9J 4PV9A 2O72A 25C8L 3KW7A 1PMRA 3WO3B 2XXMB 3AG1B 4H13C 1GHKA 2LKVA 1JE6A 2XRAL 1G9MC 5E8PA 4P4KB 3KPMA 1ZA6B 4H26A 2N4IA 1BVKB 3NN8A 1LACA 2V3FA 4RMRA 1TJHL 4D0DB 1BZ7A 4AVKA 1LDPL 4KVNL 3O6FD 2O5XH 5C09D 1WA0X 2OFQA 5I15L 5E7FA 5L4JA 1TCRB 3UOAB 4U1IB 1I3GH 5ABAA 2PABA 3PREA 1QILA 2R92G 3RE0A 3X3GL 3O2DA 4H2CA 4P8QA 2I9LA 5D5MA 5C0IA 2PXYC 2DY8A 2CQOA 2XGTA 1KJ3L 4OSUH 3OGCB 4TSCL 5DD1L 2E4TA 5IHZA 2QGDA 3D4GA 5LBSL 3QDJB 4QJ4B 1IBGH 1I7ZA 2W94A 3S37H 4J3OC 4KQ4H 2LT9A 3NABH 4GOSA 3QRLA 4LHJB 3M7FB 2JH2A 1HNXQ 7PAZA 2E8ZA 2GSGB 1UD2A 4FYRA 4HYTB 3UAFA 2B2WC 1H9VA 5IMLB 5EUKB 2NVYB 2VC2B 5EO0B 4YHYB 4FXDA 5FFGA 2R4RL 5HHVH 4YSAA 1FBIL 4A66A 2RHQB 1PH6A 1F1AA 4IHOB 4OO1I 1B2YA 3B3IB 3PQYD 4X6EB 4QF4A 5CAYB 3K71A 1TUPA 3W2DA 2ED8A 1VKXA 6PCYA 2X6AA 1N5YH 2R4SL 2G60L 5CHNA 1E5BA 2EEFA 3EJZC 2V1CC 3C75A 3MV8B 4OF5A 3S14H 1CZ8L 2B9BA 3MCYA 2YWYA 3FZUC 2NUTA 4L3EA 4ES8A 1SE4A 1MPAH 5DJAA 4N2LA 5KVGE 4M1GL 5LCVA 3B4NA 2CBMA 4A3FH 5FUCC 2O4XA 1SJEB 2PCFB 4I7AA 5DLLA 2BDOA 1VQ9A 1HI6B 5CFAA 3NVQA 4QGTA 4HHAB 3W37A 1OCZB 2FHFA 3O9WD 2Y0SE 5FUCE 1GZQB 1TG8A 4FHKA 3B6SA 1Q9KA 4XO4A 3KPRA 5KBNC 4PVBA 2QQKH 5JOPD 4Y8AA 2EJFC 5SWZD 2EKSA 3PUZA 4HIDA 1VQOA 2CDEB 4JEGB 3CLEL 1V7ML 3O8XA 1YHQA 5IJKA 1AZPA 1T5XB 1J1XL 1NSNL 4TUOA 4WWID 2VXQA 2EYHA 3H0TB 3QDJD 4XBGB 1QPXA 1G2TA 5D7HA 5I66A 4D2NA 2WC7A 3JV5A 4F8TA 4DR7Q 5F7AA 2ZG1A 1U8OA 2K52A 2YOCA 2DLGA 3BD4A 4OLYH 1IBKL 4WI9A 3ZDXF 2MNWA 3JZYA 1SROA 3DHPA 5DU7A 1SGKA 3GMPA 3FP9A 3QO0A 3A67L 4FMKA 5GRYA 5HGHA 4AYDC 4BH8A 5J12B 1FL0A 5LHDA 1DQJA 5DEHA 4PRHE 4XP9H 3RWGB 1KC5L 1W72B 3K1KC 5E51A 1XAUA 1FGNL 3L1OH 4K4KA 4GNXB 4PRDB 1UUNA 2F5AH 3KPQB 2XKNB 4Y19B 3F2DA 1T20A 1VADB 4JPWL 3P30L 4YDNA 2R23A 3IMWA 4DSYA 3E2HC 5ACZA 1XF3A 4UAIA 4DUZL 5DJYB 4YDKH 4PV9B 5ECJE 2A9NH 3N6RA 3MV8D 5C07E 4AUYA 2EEXA 5EAYA 1Z9NA 5GGUA 1LP9A 2F7OA 1NLDH 3IKCB 4DR2Q 4GB9A 4HJJL 5E8PB 3ARRA 3KPMB 4M7LL 4MS8D 4Z78A 1L3WA 3NN8B 4KHPQ 3BKJL 4GRWB 4JO8A 3LH9A 4LFBL 1BZ7B 3Q5OA 4L8CB 1DLFH 4XMWA 3QXAA 1P4BH 3L17A 3VFGL 2B77A 2KHAA 3EGXB 2D31B 1J5EQ 2X1WL 3DO3A 5D5MB 1N59A 4ZX3A 3FF7A 3AACA 4QKXB 2YTYA 1JPFA 5IM7B 4A3EB 3JWDC 3HI1A 1WC7A 4CADB 4C1NK 5IQLA 5IHZB 2F0GA 5DVPA 1KGXA 1G5GA 5KSUA 4XIGS 2VLMD 5F1NB 1DJZA 5I73C 1KIXA 4Z7AA 2ZZUT 3H4HA 4XH2A 4PW3A 3TFKC 4JDEA 1HQMC 1Z2KA 2PWGA 4O4YH 1II3A 5E4WC 3HOVB 2NY6D 4KTEH 4QRSB 3R8QA 3MLYH 4JY5L 3RWFB 2MQHA 4Y9GA 3HNTH 1XZ0B 4MB4A 3S24A 4UZSA 4AQYL 3MGAA 4OTXH 3DMMB 1N33L 1SEQH 2H6OA 5D1QE 5HHXH 3K71B 4YGAB 4GW1B 4HIIB 1VKXB 4OXPA 1TLMA 1O9WA 2R93H 1BF8A 1E6JH 2JB5L 1VLXA 3PP4H 2QTEA 3OKDA 4P2OC 5CHNB 2ZUTA 3BN3B 3WN6A 4ZKBB 2NUTB 4L3EB 2NB0A 5KOVC 1QE6A 2FBJL 1HSAA 3WENA 1HZKA 4Y19D 1E6OL 1DBBH 5DD0H 4NCDA 3V6ZA 1TZHA 4XB7A 2AJUH 5I6XB 5IVXA 1CDIA 2JJSC 4N90D 3W56A 3SK4A 2ZPKL 1PH2A 1BVSA 3F04A 4HX1B 5KJRH 5AKSA 3KH3A 3T3PB 2HJFA 4A3BG 1ESFA 3SDDD 3NCYP 2PYEB 3KYNA 2P5ZX 4M61A 1RUAL 3D3VB 3P54A 3B6SB 3DGGA 3PL6D 1JF1B 3KPRB 3PDGA 5C0CB 5KVEH 4HJEA 3JTTB 1JGUL 5D4JA 5I8KH 5J6HA 1XGQB 1STYA 2EKSB 4JG0H 2B1OA 4F3FA 1UZ6E 2CHBD 2MCPL 2CA3A 5AG9A 1SSOA 3CDYA 4JGMA 2VXVL 3E0EA 2L8AA 4TUOB 1H9RA 1S7TB 1HTLD 1SN8A 2KLRA 4OKVB 5I66B 1KGUA 3MRMA 2OXGA 4EUPG 5IVNA 2JA8H 1NBQA 1JRHL 3IFOB 1DJHA 1SHSA 1U8OB 3MSPA 4R84A 3CX5J 3DVIA 3TREA 4LF4L 5F7YC 3EH1A 3DETD 4J15A 1FD7D 3GMPB 3BG3A 3RY6C 2NVQB 1UC6A 2JKLA 3GKZA 5HGHB 2DTMH 1NGYA 1OXVA 1M7DA 1DQJB 2CKBH 4N28A 3SO5A 1HR0L 4Q0XL 1XF2A 1KPRB 1V3MA 1YY8A 5BVJB 4L0PB 1ZKOA 2X4OA 3QEHB 1NMFA 1KCVH 5ERWB 3ULSA 4NXMQ 1OPOA 2CUIA 4BZ1H 1UZGA 1NGWA 3UEZA 1CD8A 5L4IA 1XF3B 4JBJA 4MLSA 1ZVSA 2ATKA 4KN4C 3LZNA 1VQHA 4GFXA 3U30B 2B5IB 1DSWA 3PQYE 3QZWG 3GRWA 5I76A 1LP9B 4ZW3A 2BDNL 4CUCA 2HX9A 3TF7C 1Y6NR 5CEXA 3AW5A 2GKIA 3V0WL 1HYRC 4PB0L 5EBMA 2ZM6Q 3HI6H 4NQEA 4KROB 4BE6A 4XMZA 3L4UA 2BC4A 3QXAB 1RVFH 1IBDA 4OLWL 3FONA 1MVYA 1EU3A 4JI1Q 1E5UI 1DJXA 1OAYL 2PYED 4P4KC 5IV2A 3FSZA 5FYLD 4JI8Q 4NXKA 2WACA 3D3VD 3O9WC 2FO4A 4UQ3A 3HI1B 4XCYA 5C0CD 1MFDH 4UM9A 2P45B 1A3LH 1WC7B 5DM63 1MFEL 1IZJA 4WUUA 1TVXA 5KSUB 4MCMA 1E2ZA 4L4VD 5FM8A 3TZUA 3IJ8A 5B1CA 2F5BL 3B2XA 4BZ2L 3SDXB 4YHPB 4JDEB 3HBZA 5TK2A 4APQD 2BFVL 3URYA 5H4ZA 5JOPE 3IAGC 4NZTL 5SWZE 3O6LH 3REWA 3BISA 3S4SA 1TIID 4ZX4A 3KOJA 1C1EH 3CG8A 1UM4H 4NN5B 2B59A 4IO9A 5LDSA 4KK8D 1XV8A 4K0KL 4IJ3C 1G0DA 1WAPA 3W9DA 2NQ3A 2O4EA 2WUBH 4ZPVB 4ZMTA 3FMCA 4A2LA 4XNMA 1H5BB 2OZ4H 3PF5A 1NJIC 4E5XG 5DC9B 5AW8B 4QI3A 2R0KL 4FX5A 4WSJA 4YHYC 1F00I 1LVEA 2PCYA 3OKDB 5JLZA 4GQ9L 5DK2B 3ECUA 3EH5B 3CCMA 5AW6B 2KZWA 4M48H 3M4OB 1D6VH 5AVZB 3O2WL 2J4WL 3LHAA 4G7HC 2XQYK 4IMLA 5IVXB 3B7SA 1CKMA 5ID0A 4UAOC 2RJMA 2B4CH 1EUUA 2HJFB 3L3DB 4XB8A 4Y2OB 3LS4L 5F9JA 5KBKA 5I73B 3FCSB 4M61B 5CUSH 3C87A 4MS8C 3CLFL 2AQPA 3DGGB 3FHEA 1XF5B 2Y7NA 1YNTF 3ZE1E 3MV8E 4NRXA 2Y1AA 3QK0A 5LMUQ 1T6VN 5J6HB 3EF4A 2ADGB 4GRMA 4H7BA 2IJ0C 3PFQA 4I1RA 4NRYA 3V6FA 2A69D 4P2QD 2JIXD 1DBJH 2JLLA 4H8VA 4JPVH 4QNPF 5TQ2L 1BCPF 3VU2A 2QVTA 2J1YA 1JGVL 5IT9E 3MU3A 3SBPA 1AXTH 1PS3A 1GUNA 4WSKA 5HJBA 4A55A 1GGIH 4LF5L 4ZRZA 3CMGA 1XSOA 4P5TB 4F7PA 2ZAGA 2EDYA 5IQOA 3D51A 3QOJA 4B53A 3ZDZF 2QSQA 1Y1VH 2IAMD 2WPGA 4B7IA 5T3ZH 3EBAA 1T2QL 1NGYB 1X5JA 3CC5A 4OX9L 1PLBA 2VDNB 3ULVD 3GSOB 3ZHNA 1R0AH 1ONQA 3MUZ1 5DA4A 1EY8A 1MNUL 1CF8H 4Z7VA 4KXAA 3QFDB 5AKTA 1X6NA 5LGYA 4DP1X 1OF2A 1O7YA 1VA9A 4O9HH 4F80A 3BAXA 4EAEA 5J12C 5C08A 1HOCA 2FECL 3ZKNC 3BKYH 1CLYL 5I17B 2B0SL 3ATBA 2FSDA 3K5NA 4R7NA 3QWRA 5I76B 3QIAA 3QRGL 4LKCA 4AGPA 1LM0A 4GNXC 5A43C 2EDWA 3IFTA 3D4DA 4UT7H 3V2AR 3A3YB 2IBGA 2DV6A 4O02H 1W6KA 1P84J 4NQEB 1TZGL 3HC3L 3LTVA 5C71A 3FFDA 1IGIH 2MJWA 3ARGA 3NQTA 1TQBB 3GO1H 2ED9A 5I1CL 5KTEL 2FINB 1JHKH 3WO4B 5GJTL 3SDDC 2YBRA 3LS5L 5C3XA 3BRDA 3MREB 5LVEA 3X3MA 2BP0A 4UQ3B 4PRBB 1Q8IA 2PCPB 1NCTA 3PL6C 4XCYB 2WINB 4HCEA 1VEMA 2JCWA 3BSZH 1HNXL 3IJEB 4F5CE 1ICWA 1HNFA 4QRAA 4FG6D 4YLBA 4GLVB 1VQCA 2QV4A 3B9DA 4GRWE 1BOGB 4KKUA 3S1RH 1JHLH 1H3VA 1MAMH 4Z7OE 2CRYA 4OGXH 4CW1B 1NFDF 3S4SB 3MYJA 3TT1H 4P5TD 1PG7X 3S7GA 2B59B 1QBLL 2QQNH 4OLXL 1HEZA 3W9DB 4WWNA 4N9GA 3QP3A 5AD0A 3T56B 1GC1H 3ZYIA 3QBTB 1YYML 2Q7AA 4ANXA 4NKDB 3EFFA 1QZNA 4JFQA 3MV01 4NAMA 5C8JB 2WNGA 5JLZB 2YMOA 1OOAA 1MCPL 1I7UA 1F6AA 4G6ML 4TNVF 4D3CL 5IEKB 4AMXA 1YPZF 4PTUB 1EMTL 3DMMC 1TMQA 2CLVA 3PWNB 3P9MB 4CVZA 1BQKA 5CZVL 2BPBA 4OGQC 3UAEA 4IMLB 5DRZA 4OAWA 2V5RA 5ID0B 1K72A 1PEWA 4KJOA 4NFDA 5ICUA 1JQYD 1MF2L 4LLWB 2CO7A 1LYQA 2UXTA 4P5SA 3DBSA 5I6XC 2XA8H 4NRXB 2XWEA 3GRGA 4OQTH 2UY7B 1XPOA 1U8IB 3V6FB 3GMQA 4X8JA 2G0KA 1EIBA 2KKQA 4OL7A 3MMEA 5ESQB 4DR7L 4I1NB 5ITFA 4R2GD 1JF5A 1JXGA 5E6ZA 1NEZA 3LIZA 4UDUA 2R93B 4DQOL 3LSOA 5B21A 2X53A 4F7PB 3ZHDA 3OQ3B 5FYLE 3EW3B 3V5KB 5HHPA 1CXLA 5C0CE 7CGTA 1FGUA 1WCMG 5DVOA 5I71B 2P5EE 3GHEL 4PFEA 4IEFA 1FLRL 1LUZA 2OEOA 3CC5B 4L4VE 4AZUA 4DOHE 1D2OA 3O0LA 1ONQB 2JA6G 2MHAA 4KK8C 2WNKA 2CFMA 4M9PA 1LD9A 4MKTA 2XN2A 3DBXA 4K2UH 1FRGL 1EEUA 2HYMA 1OF2B 5D2LE 2HWZL 4DR2L 3G3LA 1BZQK 3WEXA 3ZRSA 1SXBA 2MPVA 2WUCL 2KYIA 2EO7A 4K9EH 4LSVL 4GRLD 4UYPA 5I6NA 4KHPL 2EYLA 2RSOA 1IZKA 4B9WA 1GSMA 2FQDA 3HI5L 3L5IA 2VISB 4UILH 2ZX6A 1F3JA 2Y7OA 4XODA 5E0FA 5A6MA 1T7YA 5J9PA 1WTRA 5HHNB 4IUNA 5I0ZA 1G0XA 2RCNA 4TUKH 1J5EL 1RL1A 1WWCA 2E2HH 4TMPA 2D0FA 1WK0A 2VLRB 3U30C 3DRQA 2B5IC 5LXVA 3FYEB 4HPYL 1XXGA 2VYRE 3VM7A 3TSSA 3HS8A 2JA8B 2XN0A 3N42B 1ORSA 1BQSA 3HG1A 1SMXA 4KHVA 4OWTB 4CVXB 3Q6FB 3IKKA 3GHPA 2BP0B 3TN0D 1MCDA 4GT0A 4Z7QB 5CR3A 3EGDA 2I69A 1WYDA 3O6ML 2HFEA 5M3FG 4KROC 4UBDD 4XMKH 5EZLB 3REVA 4KNTA 4E41B 2F8VA 1B4JL 4K8JA 1A7RH 2TRYA 1QZHA 3QNXB 1EO5A 2WY3B 1C7SA 2VDQH 1JWMA 2FB4L 2NCMA 2A69C 4DIXA 1CFVH 3B34A 2ATPA 4OCSL 2ZOTA 3KLKA 3OLEA 3I3CA 2G3NA 2G2RA 2DKMA 3L7FA 4K5MA 5TE7H 3H0GB 3PV0A 5TDNA 1CLCA 5J89A 1HEZB 1AZZC 4P2QE 4R9WA 1C9SA 1Z5YD 2DLFH 5A7EA 1RJYA 5AD0B 1P5UA 1UE7A 2NY5L 2YD0A 4FNLL 1HA6A 3ZK0A 1W0VB 3LQZA 4JHVA 1HCFX 4F1ZA 3BYTB 2MH4A 4S11A 3TBCA 3OR6A 4ZSOE 5IJVB 3ULVC 4PU2A 4ELMF 2CZNA 2OWOA 1YN6B 3K46A 4PHZA 1F6AB 1RHHA 5C0BB 1WBXA 2J5LB 4IRJA 4WO0A 1MIML 3LQMA 1TF4A 3SY0A 1IL1B 2CLVB 1JV2B 4CVZB 1UWGL 1H5BC 3ULVE 3CF5A 5HXMA 3EFXD 5KANI 2HHHQ 3PAUA 4M8RA 4BA8A 4LKXA 4TTDD 4K3GA 1SPDA 1QAWA 5AAMA 1MHEA 1ACYH 2EUZA 3N44F 2WAQE 1BP3B 1YIJA 4JI0Q 1E8WA 2BY0A 3NSWA 5KYUB 3NRFA 3QJZA 2H0PA 35C8H 4WI6A 2VLRD 1PKQE 3AU0A 4XNUL 4EX5A 3K5LA 4ODVH 1LLAA 3GMQB 3GNML 4G7YL 4X8JB 2CUMA 4KVPA 1TQVA 4LPTA 3VTTA 2ZYRA 2QGBA 4N0UA 2KERA 2MPAL 1URLA 3S88H 1ZDSA 1U5KA 1PTOB 3MC0A 5ITFB 1MOEA 3TXAA 4UDUB 4E41D 1DANU 1AHMA 3S6CA 5I1KL 1JUFA 4DW2H 1P6FA 4FG6C 5HHPB 4CN1A 4X6CE 1TT2A 3L6FA 3QJYA 2EVFA 2F0QA 2V6HA 4V0BA 5FHBH 2J44A 1B4LA 4LHQB 2HKHH 5GISH 1XTDA 1UA7A 4NXML 1DM0B 3I56A 4CDEC 2HFTA 4P5TC 2XWXA 4I3SL 2MHAB 1QFWL 1MLBA 4C3HG 1B9NA 4KTYA 2KHJA 3NWSA 2A7BA 3Q0AA 2FZ3A 3DBXB 2XN9A 1BFTA 2XFXA 1P7BA 4I4WB 1UOWA 1VENA 3VD1A 3TJEH 2UZIH 1J7VR 1S9YA 2JI2A 3WEXB 3L95A 2IOOA 1CS6A 1E30A 4LE8A 4HC1L 4FL4B 4F8LA 2H0EA 4MMZB 1U8MA 3C08L 3GBNL 2ZM6L 1XGPB 5C0BD 2CE6A 3BI9X 1UADC 3QDMA 5C0JA 4GI9A 5J9PB 5M7QA 3LCYA 5IB2A 4D0BA 4JI1L 1SUJA 1RULL 4XP1H 4QIWB 4JI8L 5EOCH 3EHBB 1UE5A 1WQVT 1ETB1 4FABL 3DRQB 4QHKI 1ZGLA 3FEWX 2P5PA 3GPSA 4Z7UE 1K5NA 2Q2LA 1JPGB 2KA7A 4A3IH 4KUCF 1W80A 3ZHLA 3A55A 3PHQB 3TMEA 4RAHA 5AZEH 4BQBA 1GS7A 3D2UA 5K93A 1TEGA 1QHQA 3EGDB 4A67A 3REVB 3IDNA 3GRWL 1TIUA 4ATTA 3TEHB 3FF8A 1TQBC 5F89A 2LFNA 1ZT4A 2VUMB 3LEYL 4RNRB 3DUZA 2IADA 1WWWX 1HH9B 2NX5A 5IGXL 2ATPB 1PZCA 1EUTA 4R2GC 3FB6A 2QQQA 1R19A 2AQ2B 1XAKA 3DJ9A 3L7FB 1ZT1A 3T6XA 3ZHKA 4F37K 3VX0A 1QTYT 3U46A 2BO0A 4I0KA 3DJSA 1P5UB 1BZDA 3NBHB 3KPLA 3LQZB 1LT3D 1FDLH 3HNSL 3MPCA 5IY0A 1G6RL 3OR6B 4H4NA 3D4ZA 4YVUA 2AEQL 2HFFB 4AWJC 1MJ7L 1JZGA 2R2CA 5IT2H 1RHHB 2FE0A 1WBXB 4IRJB 1FVEA 5EU5B 3R2IA 4A3LH 1DBKL 1I1AD 2ZKXA 4R7DA 3SY0B 3OD3A 4Y2NA 3Q1SL 1FZMA 1C7TA 1ZGLM 1I3QH 25C8H 4MS6A 3LXAA 2E9IA 4XAKE 3VQLA 2IHEA 4DNTB 4LKXB 4YLCA 3L4ZA 2ZXEB 4GRLC 4QRBA 1N19A 3RJDA 1MHEB 1MRCL 5LMUL 5KSBA 1HE7A 1XCWA 2PP8A 3DUUA 5EO9B 3QDGA 3PO3H 2OCCB 1LDPH 4KVNH 1Z5HA 1MVUB 2CMRL 1WITA 3GEFA 2K4KA 2EH7H 3NEXA 5EF0A 1SEBB 4F2MA 5I15H 3EHBD 4PJ7A 3T16A 1P1VA 3AY4A 3L3OA 5IQMA 4HIQA 3SE9L 1KJ3H 4TSCH 4OUUB 3SO3C 4JRYA 5EIVA 5LBSH 4JE4B 3S9WA 4P75A 1HXMA 4N6QA 3TN0C 1XCQA 3UTSB 5T3ZD 1DYQA 4UBDC 3V4PA 3QR0A 4N4YB 4LAQL 1FVIA 4IN3A 1BJMA 3ET9F 3P40A 1JUFB 3ZDXB 4JFYB 2AJVL 5JXEA 3BWUF 5I5JA 5DMKB 4IU3B 1KB5L 4B60A 4A6YL 5AW3B 3WE1A 2KQ3A 4Y7NB 1WD9A 3CFIC 1ZRUA 1GGCL 2R4RH 4MJID 3T2LA 3PIQA 1ZT7B 3FRPA 3OKMA 3HR6A 4WJ4A 1KXLA 2C5DC 1KNOB 1A7QL 1D5BB 1GPOL 5EC2A 3ZYJA 2FZ3B 1UYWL 2VKXA 4AV4A 4HIXL 2XN9B 5I71C 4LAAA 3S3CB 2R4SH 2G60H 1S9YB 3C60A 3KR3H 3L95B 2V37A 4P5RA 1CQYA 1CZ8H 1SMAA 4YFLI 1JV5A 1QBAA 2BX5A 1U8MB 4S2SA 1CLOL 4HLEA 1VACA 3DRTA 4M1GH 3M7OA 2P8MB 3DC0A 4HKBA 4M7ZB 3QUZA 4AZ8A 1KNAA 1YNXA 3MNZB 4HGWA 4D0BB 4GLAC 5IB2B 5FLMH 4Z3HA 1JZ3A 3OAYH 3OKYA 4HS8L 1IAOA 2HZHA 5J3HD 4N2FA 5JA9A 1EFXA 1QSEB 2BK8A 4TTDC 1ZGLB 2Y5QA 3VMNA 1AR1D 3OB0K 2IV9A 4QTIL 4J27A 3ZZ1A 1FZOA 4DCQA 1K5NB 1NANH 1PZID 2ITDA 4XNYL 3MJWA 4C3IH 3HPJB 5JW4R 5KVEE 3CC2A 3SGJA 4S1QL 1SEBD 1QTSA 2ZJSL 3FB5B 4PM1A 1KFAL 2AJ3B 1V7MH 2KJXA 3D0FA 3DGDA 2NDFA 3HAEH 3IDNB 4XZ4A 1I3RB 4MNGE 1JZ5A 5FIEA 1ZT4B 3S1QB 5F96L 1J1XH 4AMKL 1NSNH 4Y2DA 1OCOB 4KD4A 4ZCKA 3CQZB 3KXFB 4KKAD 2IADB 1NWOA 1X4XA 2NX5B 2VLRE 1LT4D 1JJCB 3O81A 3UTSD 1NAKL 3ZTNL 5BNXD 2QMKA 1U2HA 2IC2A 2EVBA 5GGRY 2F54B 4JRWA 3A67H 3AQXA 3PF2A 1DHKA 1KIUA 3K81A 3KPLB 1SHWA 3HKSA 3FOLA 3MLVL 4GINA 5GJSL 3WNIA 1KC5H 2C9UA 5K36H 1GGUA 1WG3A 4PJXF 2OTUA 1FGNH 5K9QG 3W3BA 2NZOA 4A3MB 1AP0A 3K7UA 2NSXA 4CSPA 3VD9A 5CP7B 4UTBA 1J0HA 3OJVC 1D9KA 2K70A 1VQAA 1FVEB 3P30H 4JPWH 4S1RH 4YDMA 4YDVB 2EDNA 2DQIL 2WQXA 3W9EA 2OMVA 2FATL 1QLEL 1EYAA 1AGDA 3STBD 4IOFD 3FUKA 1CFQA 5C0DA 3SYQA 3BXNB 4HJJH 3RFZA 4M7LH 2J5LC 4PWJA 1I1YB 3BKJH 3DUUB 2H3NA 4HCSA 3FBKA 3QDGB 1PBYA 1B3JA 3DX6A 2HDMA 2EYPA 4MAYB 5T1JA 2ARJQ 3ARDA 4FLHA 1N9WA 3CPFA 4F2MB 4XP5H 1QSED 3ZIYA 1A6XA 5C0BE 3SQOL 4NZ8A 1REIA 3GTQH 1T1XB 3OR7A 2LU3A 3V0IA 3CP0A 2M26A 4JRYB 4I77H 1HXMB 1FNWA 3HZKB 4XPAL 3ASWA 1XCQB 1KG0B 4P49A 2HLAB 3RNKB 1LE9A 1AG6A 3RPBA 4GKLA 4LPYA 3CUPA 1SYEA 4JY5H 1A62A 3KXFD 4JG1L 3D08A 2BIMA 3LAFA 2OMBA 2CNZA 4JG5A 5EWIL 3S37X 3OKMB 3ZT6A 4UDUC 2VDRB 1XIWD 3QYNA 4HS6A 1S5CD 2F54D 1VSCA 4KGJA 2ALAA 1E65A 3IYLW 5EC2B 4JI4Q 4YMPA 3L0OA 1FCCA 1IC5L 3NG5A 3QQ3A 4PJFF 2D4FA 4ZS6D 3KYAA 4NI6A 1WTWA 1YUHA 2JA5H 4X3UA 1MCKA 4ZOCA 3GB7A 1FYCA 2FBJH 1VACB 2Q8RE 2B4CC 1E6OH 4FI8A 3DVNA 3NIDF 4HKBB 1I1AC 3QUZB 4LP4A 3NBIA 1URZA 4W4OA 5AW1B 2ZPKH 5HDRA 1PH5A 2DM3A 5IBTL 1CIUA 1UH3A 5F88B 3SODB 4HUNB 4OD1L 1EFXB 4MMZC 4PRNB 4ZOAA 1D6EC 3MLWL 2LXKA 2HQEA 1RUAH 3HTLX 2ZXWB 2X4SA 5EPJA 3AXHA 5HGDB 5I1LB 1BG1A 4JKLA 2I5MX 2KHIA 4MAYD 3MR9A 1OE1A 5CIPA 3S0PA 2RH0A 2CVRA 2COQA 3WXWL 4G80A 2HXAA 3EHBC 3FU3A 3HRZA 3VB9A 2Y3AA 4XVTL 2VNCA 3JYCA 1IBYA 1YG9A 3PAYA 3M7NA 2VXVH 2Z8RA 3W1BA 1NFDA 4Y2DB 3N04A 4A2HA 3CZJA 5A2QL 4QIRA 1HPCA 3S1NH 1FGBD 3SHSA 1B44D 1JRHH 4QRUA 5DJ0B 4E2OA 3I4MG 2K3HA 4KJYA 5GGTA 2YZ8A 1T03H 3LEVL 1KFGA 4Y1SA 3MJ8A 3OLGA 4QYOA 1XGTA 3FOLB 5T3ZE 2BP8A 1R6VA 4HEPG 4Q0XH 5K5PA 3P11L 3VDAA 2OTUB 1YPZA 4FQLH 1JVKA 1AD0A 3W57A 3BP7B 2HHHL 4MJIE 3KVDD 1RLBA 1W8OA 4JDZA 5CILL 1B4TA 5GIRA 5D96B 2XQBL 1N3NB 4AL8L 4JW0A 4TSSA 5DD5L 1CFQB 5C0DB 4JI0L 4GYBA 2BDNH 5JHLA 4LB8A 1UD3A 2Y24A 3R06B 2ZXGA 4IRJC 3OAYK 1MREL 4PB0H 1FNLA 1YNTB 5FGSA 1AACA 1HH6B 1P1ZA 2AI0L 4NO3A 1OB1A 4ZMPA 4ZFGL 1FPTL 4OLWH 3RTQB 1KTKA 4K7PL 3GV6A 4FKKA 2DGYA 5ILTL 5J3HC 1OAYH 3SGKA 1SOQA 4CKEA 2QKIA 1AR1C 4B9GA 2BA0A 1L6XA 2VSDA 2VABA 3HOUG 4OZFH 4YE4L 2VSKB 4QRQA 5HVGB 4UTCA 2EIBA 3Q2WA 1S3OA 3GTNA 1PTZA 2NTFB 2Z6FA 2F5BH 4BZ2H 4A3KB 3ZDZB 5DR5L 4WW1A 3V0AC 4XMUA 1LE9B 2K1BA 3GUTB 2BFVH 4X64Q 2ENQA 4KHXL 1W91A 4R4IA 4NZTH 1GHJA 4KKAC 3H55A 3NIGE 2C9OA 2Q8TA 4YFDB 5EA0L 4KDTA 3MXWL 2PYKA 3OIPA 1G7HB 3TV3L 1RZ8A 1RCVD 1LEGB 2R0KH 2D3LA 4TYUA 3IVKB 5DZNA 5IZ7A 1YUHB 4GQ9H 2XA3A 2VZ3A 1AZCA 3PQIA 4OF7A 4JKKA 1AQHA 4UQEA 5KBPA 4ZMAT 5C0XG 2HCCA 3RN2A 4HJ0D 2DWEA 1EXUA 1QOKA 2J4WH 1UG9A 2A83A 3O2WH 4PLJD 1UH4A 2HVKA 3QJRB 2BZDA 2UVEA 2K5DA 1BW8A 1AS7A 3I6GA 5KAQG 4LOEA 5F1SA 3PIO3 1BUVT 3GMRA 4URTB 1Y69U 3VFSB 3STBC 4IOFC 3TYFA 1ZYRD 2QSTA 3FQXA 3C6LD 4RX4D 1TWGH 5I23A 2X4SB 3CLFH 1IBHA 4JZNA 1S40A 4M7ZC 2WMPA 3H9SB 1KWGA 3FQUB 3PO2H 4YBLB 5CIPB 3W81A 3RTQD 1AE2A 4G80B 4JHUA 2Q2TA 1C5CL 3VFWB 2YQ2A 3LRLA 2ZXPA 1DLHA 3V0JA 1HAWA 5TQ2H 4IBLT 2AWOA 5E9DB 1RZKC 1JGVH 3AS0A 5HVHB 3ZO9A 3IETB 3N1FC 1U2CA 3FHQA 3ATAA 4DK6C 3AC0A 4QRUB 4AM0B 4FXGB 4YGVA 1NSNS 5EUOE 1KN2L 2I07B 2W95A 4N5UA 1LO0L 4L5TA 1CE1L 1T2QH 1XGTB 4GW5B 3NDZE 3UBFA 2BP8B 2Z65C 1AIFB 3GTOH 2BVQB 4BS9A 4MXVF 3TNNB 4XXCC 1K0RA 1MNUH 1NOLA 5L2KA 1YPZB 4DV4Q 2HP4A 2XSCA 3BDXA 3BVNB 4W6YB 1AD0B 1RJCA 3FQWB 3SE8L 3BEWA 4X4ME 2E7LC 2OJZL 2W9DL 4HH9A 4JDZB 5ENWB 2KUMA 4C3IB 1CLYH 1VJSA 5LN8A 2FH6A 3JAMi 4XCNA 2B0SH 2XHNA 3IFNH 4E6IA 1GZPA 2F54E 3QRGH 3F1ZA 5KNCA 3HAEB 4E9XA 3SB3A 4R6UA 3MLTA 1E50A 1I9IL 5CD5D 4KZEL 1TZGH 1HJPA 1UKSA 3HC3H 1BXUA 2F1AA 4PJEB 4LNVA 5IW6A 5CGYD 5EOTA 5KS9F 1FNSL 5DJCB 5J6SA 5KTEH 5GJTH 2CWRA 3LS5H 3DURA 1TTUA 4XN1A 5CV9A 4IOSD 5CJQL 1HZHH 4LF7L 1KTDA 2VABB 3H9SD 3N43F 4TSBL 4XE5B 1ZLUK 4DKAC 1XMOQ 1OGTA 4MAYC 2CHDA 3C12A 4DERA 2MQ0A 3UTOA 1YQ2A 2QPFA 1KULA 2PWHA 3AY4C 1UD6A 3FT2B 1GMIA 4JM2F 3RZOH 3STZA 5E9DD 4JFED 1BD2A 5L37A 4RMSA 1J0IA 4NB7A 4WF7A 5BS0B 5C86A 4KLKA 1QBLH 4OLXH 3ZTJG 4M3JA 1EAOA 2IBZX 1DJGA 1N18A 1X5ZA 4ADGA 5C0RL 3MAQA 3NPZB 2A68D 4U49A 2ZYHA 1GHFH 3LNGA 2XG4B 1IB5A 4J3UA 3HG0A 3EJCA 4A3JB 1BQHG 2G3ZA 3HNVL 4JFZL 3S3JA 3V4PL 1MCPH 4G6MH 2F61A 4U3SA 4D3CH 4GKKL 3A4FA 2P8LA 3CV5A 1GYVA 4PY7A 1MJ8L 3QG6A 1SDFA 4BBRH 4U1SA 2VR4A 5E1IA 2JTYA 1ASPA 4MZ3A 4JHWL 5CZVH 4ESKA 4NPYB 1CVRA 2HVKB 3LZQA 3P4NA 3I6GB 5I5IA 2P5WD 2VOTA 3P2TA 2KZKA 2Y69B 3RPIA 1AGBA 3THML 3JT0A 2WZ6A 4ODXA 3UYPA 4Q89A 3ECQA 1MF2H 3BDCA 1XEDA 4JI5Q 1NC2A 4HSCX 4YO0B 1FYHB 4JVZA 2WKCA 4PJIA 4AIEA 5C4JB 1QP1A 1TQUA 1VGKA 3X11A 1EEYA 4WO4B 4MB3A 4NPJA 1MXGA 2WP3T 2E46A 4LQ1A 1Q1EA 5EKKA 4UU9B 4QO1A 2E5EA 4TTGA 3WNJA 4PW9A 1A0QL 3ESNA 3V7MA 4AQOA 5CC4A 2DWDA 1DLHB 2FXQA 3WNMA 5DA0B 5FO8B 3IB4A 3TS2A 4KXZI 3H2WA 3C2AH 1YEEH 4DQOH 1AYRA 3VA6A 5A35A 5AYTA 2JA5B 1OB0A 2WLHA 4CKVX 1WT5A 2D3VA 1YEIL 3Q8CA 4Y4HB 1JS4A 3ZDYE 3EZJB 4XX1G 5EN2A 1AG0A 3GHEH 4Z0XB 3KGSA 4Y2DC 3DEPA 1FLRH 4E0RA 3VH8A 4JGJA 4ELMB 3ML8A 3FQRA 2YN5A 5BS0D 1PFBA 1K8IA 3HE7D 1W8EA 4JFFA 4YSTA 3SKJL 1J1PH 2UZXA 2Z31A 4KY2A 3ZRFC 1FRGH 3MGOA 5FXCH 3E8UH 5K39A 5CCGE 3BDYL 4Y1AB 3GPEA 4WFGD 3GMMA 2JELL 3BEWB 2HWZH 4K23H 1CD1A 5JJIA 4HH9B 3GZKA 3VXTA 1QNUA 4LP8A 4LSVH 4XCNB 5ES4B 3OKKB 3HI5H 3SKNB 1JXJA 3OSVA 1L7TL 4IOIB 5CZRA 3RJQB 1NANI 2W0LA 3FSWA 3TZVB 3N44B 2SODB 2W92A 3C6SA 4HJ0C 4I8DA 4GG6F 4PLJC 1PAMA 1O7DC 3MLTB 4LBEA 4BUQA 2CBOA 1KRSA 2V2TA 2AQ3B 2A9CA 3F05A 1LXMA 4GO8A 4P06A 4B3RQ 3ABLB 5ID1B 5EOTB 4HPYH 3S1NB 4UM8B 5HP5A 2AK4D 2Z8SA 2FUTA 1ZYRC 2Y4SA 3CN1A 2A9AA 5AYUL 3C6LC 1SHXA 2CKZB 2HX8A 4NHUA 1KTDB 2JJUA 3EBHA 4NBYB 3KG5A 4WO4D 4LFHD 3B3BA 1CHQD 1VFAB 1MCLA 1B4JH 3WCYA 4R8IA 1EYGA 3RJOA 3FFCA 2A9ML 3F7QA 3K3QA 3RTQC 4F20A 2EY1A 2DM7A 1U92A 1J8HA 1XJVA 2FB4H 3PNWA 1P7QA 1MW0A 1SFHA 1P2CB 3ZKMD 3QXDB 2DYPA 1D3CA 2DAVA 2KLSA 4OCSH 3GTGB 3DTDA 3CFCL 4JI4L 2E9WA 5EULV 5B39A 1X7TA 5ISZD 2BSSB 4DP9X 4Y4HD 2CWAA 1JPST 3HR5A 4YY3Q 2NY5H 2E75C 4FNLH 4UF7C 1BBXC 2WXQA 4I87A 2MUYA 3OPUA 2G9HB 3KHOA 4ENZA 2CO2A 4DGZA 3NJXA 4FXKA 2FIKA 5JXAL 2QPEB 4ONHA 4U3SB 2BNQA 4PGCB 3ZR5A 2OYMA 5C1MB 1VQEA 1MIMH 3IK2A 3OC5A 2LSSA 4GAJL 4HK3N 4Y1AD 1UEBA 5C44G 1UWGH 4OY9A 1S7RB 1DZBA 1CFBA 1XCTA 3P4NB 4HETA 4NP5A 4MQTB 5ESAB 5GSRA 5EU4A 1AGBB 3IJSB 5D7IF 4TLKA 1NIDA 2ISDA 5CJXC 3TZVD 4ODXB 3TO4A 2IL8A 1NC2B 1KXHA 5FO9A 5KSAB 3ND9A 4XNXL 3T6QC 2Q1EA 2CNYA 4HF5H 4JZOA 1Z7JA 4W4OC 4QRFA 5CGYC 4RH6A 4QO1B 4AYBG 4G7YH 1Q0EA 2ZUXA 1KELL 4PRPB 5B38B 3I73A 3AM8A 2MPAH 4IRZA 2XJLA 2PCXA 3UTTB 4F27A 3MRKA 4CMMA 1OP3H 2DJMA 2XY1A 4OV5A 3G6EA 1QASA 4YBLC 5I9PA 5AL0A 5DHEA 5I1KH 1BZ9A 1OSYA 2D4DA 2PW5A 3ARXA 4NQCE 2L15A 3HC4L 5FPIA 4XDXA 1NC4A 4TPRL 5EN2B 4YDZA 1BLNB 2EY5A 4E0RB 5A16A 4B9XA 3GTMH 5HVHC 4PJXA 3RPKA 2CJTA 1Z9OA 1DN0B 3FQRB 4I3SH 4JFFB 1QO3A 2NYZD 1QFWH 1HNZQ 1PKOA 2Z31B 1F4AA 4IUQA 5EJWA 2F8OA 3SPIA 4FXGC 4X6BA 3ISRA 4RDBA 4NO2A 1ACXA 5K39B 2CIIA 2A68C 4JFEE 4J3SA 3RAJL 4DKTA 3NCYS 4FYQA 2G9HD 4LSPL 5KN5A 3MRIA 4HC1H 4DAMA 3U2JA 2N56A 1QFPA 2ICEB 3NTHA 5CYUA 1BJ1J 2N1TE 3C08H 3GBNH 4HKJA 1LTID 2JKNA 4HLJA 2YJQA 4IIQA 4S1DD 5BMFH 1QOHA 3TBBA 3KK7A 1QFOA 5CU9A 3VFPA 2BSED 1RULH 4PBXA 5CGMA 2BRRL 1U2YA 3L5HA 5LUMA 4W9LC 4FABH 2LW3A 1I8KA 5KG9A 4HALA 2BERA 3EJJX 5DMGD 1FE8L 5FOBB 5FGBA 1N2RA 4KUCD 5E5LA 5KSAD 3UBXI 5BPPA 2YXVA 4NHUB 1U6AL 1BBJA 2F53D 2P5WE 2ZWLT 2NVTB 2VXUL 2BZCA 3L5XL 1XWEA 1XQ4A 2C3WA 2V5YA 1JRHI 4PR5B 4XRCB 5KRUA 4X64L 1G7MB 3GRWH 1D5XB 3AADB 3P2DA 4U1NA 3FFCB 5EU6A 3DIDA 3WTXA 2WGNB 4PRPD 2G4EA 1V5JA 2AGJL 1P7QB 2V5MA 3LEYH 2I5HA 3PNWB 4POZD 2DYPB 4W9IC 3UTTD 3PDOA 4PJEE 3A4DA 5IGXH 2VQEQ 1PF3A 3CDCA 2IGTA 5C9KA 4FTDA 2YQ3A 4E9SA 5EQ0A 2M83A 4C83A 4BKLA 3RLNA 4OIIL 3WOVA 1EZ6A 1UWVA 3FU9A 3S5LB 2EZ0D 4B9KC 2JJTC 2G5RA 3S16H 4LCYB 1MIEL 2JKIS 2XNAC 4Z7IA 1G6RH 1ZHLA 5IYBH 5DVLA 2EYOA 2AEQH 2FIKB 1MJ7H 1Z9FA 2MEJB 3HE7C 2BNQB 3VJ6A 1MCOL 1DBKH 3GXDA 2IFGA 2Z93A 1TMCB 2JJWA 3FSAA 3Q1SH 3OWEA 3SCMD 5DHVB 3GF8A 3C2PA 1CMOA 3HHRB 4RGNA 1AZUA 4YK4C 1N0LA 4KX8A 4DKFL 3TO4B 1MRCH 3N9GL 3S2HH 1YJ9A 2WWKT 3PGDA 3R18A 4WFGE 3S97C 2CMRH 1Q72L 1N26A 4NHCH 3AG4B 3ZHFA 4JHBA 1D5MB 5C92A 1JXDA 3II1A 2UXBQ 1T04B 3DTXA 2ROXA 2GJZA 4BXSV 3SE9H 4FFYA 1INEL 3MRKB 4Q52A 3ME0A 1XR9A 2Y36L 4LDLB 4WO4C 2OAAA 4LAQH 3V4VL 1QTPA 2AK4E 2WKOF 2AJVH 4HIEA 3NPSB 1SR3A 3K74B 2VDKL 4BBRB 1KB5H 2EXYD 1NC4B 4A6YH 5H37G 3F2CA 3OKOB 1GGCH 3VFOB 4DV4L 2J73A 4KUZL 2PW1B 5E5UB 4G8FB 3T2PA 4PI0A 2JCCA 1QO3B 1A7QH 1GPOH 4ZAKB 2D7QA 1FF5A 1UYWH 4Y4HC 4HIXH 4NO2B 3GSNL 2GFBB 4HJ1A 5J5EA 3UH8A 5KN5B 2FEDD 2UVFA 3ZPDA 2NR6D 3MRIB 1G7PB 3QYCA 4YSSA 3GIVA 3LPPA 3FUFA 5ISZE 1CLOH 1UXWA 2YRPA 3LRMA 3NZHL 2Q76A 4N24A 4GUPA 1R75A 2FWOA 5HGQA 3K8KA 1ZANL 3BU2A 1L9QA 5TDPB 2KHSA 2A9DA 5IIFA 3IJHA 1EAPB 2N0KA 3BHBA 3VFPB 4EI6A 2K9FB 4HS8H 4OZIF 3QEUA 2YPLB 1UXLA 2A4CA 5D7JB 3FT1A 1I8KB 1MWAA 1BM7A 2WKLA 4QTIH 4QPEA 5IJCC 5KG9B 1X6OA 1F45A 3SPVB 1XMOL 3TZVC 4EDXA 3GM0A 1L9TA 1N2RB 2WLYA 5F3BB 4NNYA 3NMEA 4XNYH 3W5NA 1BBJB 2A0LD 3NSDA 4S1QH 2OSWA 3AVEA 4FULA 2ZJSH 1KFAH 3KPSA 3CIQA 4MSWA 4RRPM 3WFEL 3S35L 3GIZH 1IKLA 4U1NB 3E6ZX 2FLMA 4EKXA 4DA2A 5GZOD 5F96H 3LRSA 5K9JL 4QCIB 2AVFA 1OP3K 1GGYA 3SE0A 4AMKH 3ARFA 1UWFA 3WHE0 1DN2A 1XSJA 4C4KT 1YJWA 4DR4Q 4G43A 4HJ8A 3PDOB 1ECYA 4TS6A 4IKKA 2VN7A 5FC9A 3ZTNH 1NAKH 4ETYA 4P5KA 3LRGA 4UT6L 5F9OL 1X9QA 3X14B 1KD1C 4X3SA 5B4MD 1TVHB 2GBTA 2J55A 4RAUB 2GHZA 3VR4A 2FECI 1OPGL 5GJSH 4PJFB 3MLVH 3GTKH 3OAZH 3QIWB 1KPUA 3QUML 3IE4A 4C4KO 3US0A 1ZHLB 4X50A 2OP4H 2E7DA 2L7QA 4ZAKD 5ICZA 3AFQA 1YLBB 4PJAE 3LMJL 3MO1B 2KECA 1M3JA 3NIDB 2Z93B 1YYLL 2DQIH 4JRXB 4LCCC 4DPCX 4EO5A 2FATH 4CGTA 1QLEH 2OTJA 1OAKL 3QFJA 2EZVA 2EIKB 4JI5L 3FTUA 2KBNA 3TBYA 3WBDA 1NMBL 2WVUA 4X9IA 1T1YA 2DH2A 2NZ1D 1F2LA 3DUHA 3R3OA 1JWUA 4S1DC 2ODIA 1NGZB 4M5TA 2MGSA 1QA9A 2J25A 2YPLD 3EDDA 5D7JD 5TJWK 3RB7A 2JK8A 4P72A 3SQOH 2VLJE 4A3CG 1Z9SA 5DMGC 4GKJQ 1A22B 3WOFA 3FSVA 4X80L 2Q8AH 5KSAC 4PJHF 1BGXL 5MEQA 3CZUB 2GUOA 1NLBL 2VDPL 4XPAH 2CHWA 3ME0B 3M1BA 3HOXG 1GUWA 3DXAA 4HVBA 2E7HA 2ZUYA 5FS5A 1SOKA 4RWYL 5C3IA 2PR4L 4Z6AT 4QMGA 1IGML 4BD4A 2RDHA 2F53E 2XWDA 4JG1H 1OHZA 2H2PC 1A1OA 4POZC 3VCLA 1BF4A 4I2XE 3H15A 4G7ZC 4XMVA 2WD0A 4N1EA 5EWIH 4A04A 2H1PL 4UQBA 4I1PA 1QKZL 2JKSA 1J0YA 1HXYA 3EOTL 4R3SB 3RIFF 3IGKA 2LTQC 3MHZA 4KH2A 1NGXA 4A4IA 5JR1L 1IC5H 3UTZA 3PJSA 2NYKA 3QB7C 4GMTL 3L7EB 2ID5A 3QIWD 5BMFL 5LNDA 3V6OA 2CO1A 3G08A 2VXTH 5DEGA 3Q8BA 1B50A 3UL4A 5MERA 2BOLA 2DWXA 3VR3A 2H6PA 3LPGA 2Q76B 2GVYA 2FWOB 1ASQA 4JRXD 2XBZA 4B3RL 4JFUA 3R7QA 4R9HA 4O5LL 3NJIA 1KBBA 2OMUA 5AVQB 1AXSB 1J88A 3T4AA 5ICYB 1JFHA 5IBTH 3IJHB 2JA7B 2GBUA 2P9RA 2ITEA 5KS9A 4OD1H 3BE1L 3QNYA 4FADA 3L3HA 2ICEC 2FEJA 3MLWH 3D18B 1JC7A 4YCUA 1YBYA 1K8GA 1BMGA 3CXDL 2E76C 1PH1A 3FQTB 4GAGL 5DYOB 5EZOL 5HTSA 4AEHL 4UT9A 4EDXB 4NNYB 1JK8B 4BGLA 3VXUA 2VMEA 2YRBA 3DWPA 2K1MA 1FNHA 3WXWH 3CX2A 4A7TA 4LW1A 3EAKA 4XVTH 2F1BA 1J87A 2K01A 5CEYA 4JM2A 3LRSB 3NCFB 1MGSA 1TZOA 4JQIA 4KI5F 3CQPA 1U8JB 4XN8A 3BYYB 4G43B 3TJPA 5A2BA 2ATWA 4YY3L 1EY4A 2QGQA 4P9HL 2BHUA 4R7XA 1D5XC 2CIKA 1IIKA 3LEVH 3OXSA 3HHSA 3T0BA 2FLRT 2L04A 4NCC2 3J80c 4G1MA 4IQZA 2EXYC 3QZBA 4ZO6A 3U82B 2DBLL 2O1AA 3CBRA 3PS6A 1KPUB 1AMXA 3WKQA 3P11H 2RQXA 1ORQB 2UXVA 1U91A 4K5WA 3VXPA 4OJDH 3NEEA 1NR4A 1J0ZA 3RY4A 3OPZL 5CILH 2X4TA 2XQBH 1IC1A 3QFJB 4KTGA 3EYOA 1EL0A 2FEDC 4AL8H 2VZTA 5DD5H 4ZUUA 5IB5A 1DQIA 2EACA 4N1HB 1CZGA 3H6AA 2YAHA 1EZSA 1T1YB 2HN7A 4U6XB 1L2FA 3TASA 5B22A 2D8KA 1MREH 1IM3A 1JWUB 2ZG2A 2AI0H 3JC66 3U6XA 4YLQT 5JEAH 1PYWA 3FU8A 2UX7A 3ASNB 4WEBH 4ZFGH 1FPTH 3FO0L 1P7KA 2BVPA 2ZKYA 4K7PH 2VW9A 3UGEA 2XWZA 5ILTH 4KO5A 3E7JA 3BW9A 5EBGA 5I75B 5GRVL 5I6LA 1D7CA 3LNNA 4YE4H 1EEZA 4CVWA 2GUOB 1G7IA 2A0LC 5I1DA 2R6GA 3W5OA 3S16B 3WJJC 3M1BB 2BCKB 1D5MC 4MD5B 3TLRA 5DR5H 4Y9BA 3BP4B 1IFRA 4PVLA 4ZK9B 1YC8A 2AS5M 4XO5A 5GZOC 4OIJA 4HT1L 4KHXH 4IFDG 4ODUA 4M7JL 3D9AH 3SBWC 1SMYD 4JFWA 1ID5I 4QTFA 1A1OB 1STBA 2XWJA 1HNZL 5IP7H 3JAMc 2IALA 1ML0D 5EA0H 3FT4B 1JOQA 1J8RA 2NTSA 3MXWH 3VYRA 4JV5Q 4GLRH 4ZOBA 1HXYB 5AVVB 3OAZK 4UQCA 3NPSC 3TV3H 5B4MC 2L3BA 3PJSB 1WUZA 2GC4C 1O9VA 4N25A 1LM8V 5DEGB 3SOBL 4A3EG 4FLSA 3PXLA 5FM4A 2YXFA 1B9KA 5KJ4A 5MERB 3T1FB 3UROR 4AGQA 1JNNL 2H6PB 4Z7WF 4ZAKC 4GG6A 1XX9C 4HK0B 1OSPL 2VRKA 4JDVB 2XIBA 2X4UB 2BSBA 2OCEA 2OMUB 5E2TL 5GS1B 2G4GA 1RFDL 4FFZL 4Q5VA 2RBMA 3BP5A 1G6PA 1L9RA 1I9EA 2YEVB 4KVCL 3QNYB 3L3HB 4CNIA 4NQDB 1FVCA 3VXSA 5FDYA 3TBVB 5ALCL 3QR8A 1I75A 2EXWD 3B7UX 1F58H 2FK9A 2J8UE 2BH2A 2R1YA 3AABA 3Q22A 3N43B 4A6YB 2ZTEA 4C2MH 1C08B 3LN4A 3LNHA 3R93A 3VXUB 5FJ8G 3RZDH 4M4RA 4XP6L 2LLLA 1C5CH 5D7JC 4X4YA 1VPOL 4HOXA 4YQXL 2GAZB 2VGLM 2VQEL 1T9HA 1I7RA 3TP7A 1RIUL 4JM2B 1V43A 3NWTA 1AQMA 2XDHA 2OQJB 4ME3A 1XNQQ 5FGBC 2F0PA 1T7WA 2GABA 1QBML 4L0ZA 1SXNA 3WSQL 4F1SA 4WUUD 2YPLE 4CJ1B 1X9LA 4PJ9B 1QFWI 3H4FA 2FJHA 1B4RA 5CV8A 1JGIA 3QQXA 4U6HA 1F6LL 4Y5XC 4L3CA 4MA3B 2E4FA 3ZXAC 1EY7A 3BZEA 2F7QA 1KN2H 3HHSB 3OXSB 1E5CA 3GS0A 1XPUA 2BSRA 4G1MB 1CE1H 3U4ZA 3SYPA 3QUXD 2MKLC 3NJFA 2EUXA 4CBZA 3AU1A 2WVVA 3FDTA 4P23B 4YZFE 3D0VA 1VZHA 1II4E 5BRZA 1FZJB 4ZW7A 2DEYX 3E6HA 1LV9A 2D7OA 3OV6A 4PV1C 3KPOA 2FSEA 3VGAC 3C5ZA 2H3XC 4UOW0 4RIRA 3SE8H 3AT8A 4RAUC 4WFHD 2OJZH 2X4TB 4OIKA 1FO0A 1WIPA 2TSBA 4FQCL 3QIWC 4P3WA 3UIYA 3ZOAA 4KHZA 3D0AA 3PSIA 4XYQA 4FFTA 1A4KA 3AQYA 2TMPA 1NUDA 5IB5B 2IPTH 1T3FA 2G2NA 2GQHA 4JFVA 4R4CA 3BZDA 1OTCA 3PGCA 3DX7B 1I9IH 1NMCB 2UXBL 2FT7A 2ZF8A 3A4EA 4M6AA 4A3DH 1IM3B 4PJFE 2QZ5A 1G9HA 1UWYA 2X6MA 3ARYA 1OT1A 3EO0A 3EYVB 3NIFF 1MJJA 1ENAA 4QKTA 5CJQH 1EEZB 3D50A 3NHHA 2IQAB 7PCYA 1G7IB 2MJ8A 4PMEA 2VR9A 1JZEA 1HTYA 5J0BA 4N9TA 1VFOA 1PDKB 4NN6B 2NY2B 4R83A 5DS1A 4ZZKA 5IW1A 4WTXA 2FYVA 3V5HB 2NSQA 1L0YB 1CICD 4ODUB 4MJ5A 4PGBB 1QLEB 1S7XA 2IALB 4N6RA 2F0LA 1CL7L 4PJ9D 3WIIH 2AVGA 1R3LA 4NOFA 3T65B 1FAIH 5I0DA 1PRTD 5C0RH 4JK0D 4NUGL 4FF1A 5E4OA 3NCXA 1RIHL 5DLQE 2Y7LA 3HMXA 4N8PA 3HNVH 4JFZH 2EE2A 3BIKA 4JO4L 2CKNA 1NIFA 3BT2L 4P23D 4X3TA 3V4PH 4FF2A 2B3GA 3VSTA 2E9JA 3WUWB 3ERSX 3E8VA 1A6UH 4OFYA 2W0FA 1MJ8H 2VRQA 3HA0A 1RUPL 4X5XB 4GG6B 4JHWH 1AH1A 1B3QA 1KLGA 4MD0A 1HINL 3GSRA 1DZ1A 1UWEL 2OULB 4IQHA 3V0HA 4E5XA 1J5HA 4V1DD 1U3HA 2NY3B 3CAFA 5FGRA 4FQXA 4ZNCD 3A23A 4W70A 4Y4FD 5GS2H 2QELA 5I9QB 2R1YB 3QARA 3LN4B 3N40F 4H8HA 5IB3B 1FNVA 4NQDA 3W0WA 9CGTA 1R46A 4ZLTF 4DR4L 5T5NG 3E1F1 4CMHB 2FR4A 5IYCH 4FYTA 4OIAA 2X9ZA 2G0LA 3QZOA 5FFOA 1MH5A 4NKMA 1F9PA 3AG2B 4IDJL 1FGVL 2GY7B 3C46A 1HCVA 2YYZA 2WXMA 5IMKA 1ZA3B 3L7ZC 1FL6A 3LH2L 3LVTA 3Q2NA 2B15A 4OW6A 5HYEA 3AEVA 1YEIH 2NY2D 2FBOJ 3BLPX 3N6YA 3PWVB 4M6NL 1TYEB 4Y4KD 3CSBA 1KCRH 3SDCA 3G71A 5AW4B 4JANA 2BSRB 3PGFL 2VDOL 4N3UA 3QWOA 4EJ1C 4W4NA 4UV7L 3AU1B 3DV6B 2WVVB 4V190 3SKJH 3D0VB 4XBEL 5BRZB 4X4XB 3E6HB 4L29A 4ODTL 2JN4A 3H09A 3VM5A 3BDYH 3Q0HA 4X5WA 2JELH 2R69L 1QUNA 1WV7T 4DV6Q 4HJIA 1RZ7L 3NCBB 4ZMYA 4OR1A 3NT0A 5D7IB 3TBWA 4HUKB 5FECB 4KKZA 1W0YT 4XNDA 1E28A 1L7TH 2QSCL 2N7AA 3KF8B 3CMEA 5EBLA 3CHBD 2MFNA 3N85L 3PGCB 4XCCL 3CCUA 4Y89A 2CK2A 4W9EC 2M00A 1A9BB 2GJ6B 1UFUA 3LKPB 1CBVL 5HDOA 2TAAA 2JEBI 3AMKA 4UTBH 2GIMA 2XTIA 5AYUH 5FHAL 2EKJA 3EGSB 4IJLA 1CE6B 4ZUVA 2EXWC 4UV4L 2IX0A 1YAZA 1MW1A 2BIQA 4DAYA 1JTPA 1SNQA 3HMWL 1Y8NB 4ANKA 4H44C 4OCNC 2WZPD 2OMXA 2A9MH 1CDJA 1EWHA 1JSYA 2P42B 3MV7D 1Q9OB 3UBGA 2NTSP 2K14A 3Q6GL 4AUJA 1J8KA 1CI3M 4LHUD 4MJ5B 3BH9B 3CFCH 1RK7A 4GKOA 3IFLL 5KJ7E 4CC4A 3IFPA 2MCAA 2WWNA 5GZNA 1TYRA 1M6OA 4OI8A 3GTTA 3MV9A 5J8OA 5DVKA 1T0PB 4P59H 2GUYA 4YZWA 1Z3GL 4WUUE 5COYA 5JOBA 1SDDB 3MA9H 3QUXC 5E1AB 3BIKB 5IF0A 3D6GA 4EXKA 1MCJA 4GAJH 5GADC 2OPCA 4HV8A 1QI3A 2OMYA 2R9HD 4OZIA 1MY7A 4ZNEA 2NT0A 2WWKO 1JYVA 2XACC 3NUKA 2PW2A 4LSDA 4G6AD 4HKXB 4LLUA 2ZP8A 5DJ2A 1U3HB 3I75A 1HXKA 3S4SG 3Q2LA 4LSQL 2XZZA 3KLSA 4WFHE 5JW5A 1JZ2A 5MENB 4RGMA 4OCXH 5E8DL 2JEAI 4U673 1QUPA 5GS1C 3LWUA 3T8MA 1MW2A 3KWVA 2MOQA 4LLYB 1JERA 1BOSA 1DBAL 4DP5X 4UP7A 1GSKA 1MH5B 1TY0A 1YECL 4D9RD 3FPUB 3O4OB 5KANG 4CRPA 1OKEA 1M6UA 4MDIB 1LQBC 5IMKB 1X9RA 1M42A 5MEPA 3FHWA 2ID0A 3QCTL 3HC4H 4CKQA 2WB1E 4TPRH 3SDCB 2K3TA 3RI5K 4LJZC 3ES6B 2KEEA 4JM2C 2RACA 2YD9A 3MXNB 4JANB 4NX0A 4WNQA 1CICC 2VN4A 3QEGL 4OZGF 3SDAD 3VDCA 1M7UA 3QWOB 3GDEA 4PJ9C 4GOPA 4B5EA 2UU9L 3PPEA 3PCOB 4BXXG 4L29B 4HOMA 1EUJA 1PRTC 3T2QA 3EOBB 3AT0A 1IBFA 4TULL 3RAJH 2RCFA 1XB8A 1YMHB 3K7AH 1KAWA 4LSPH 3QQ9D 1OCRB 3SYOA 1PFOA 1X4YA 4C2MB 4UIMA 4P23C 4B3TQ 3TBWB 3VGDA 4GO9A 1K4CB 2K03A 5DC4B 2WV6D 3D31A 3I50L 3ERQA 4LRIA 4B41A 1X5IA 1ADQA 2BRRH 4U7KA 5AVUB 2EADA 4YNYA 1SFDA 1KLUA 5CZXD 4X6DA 4WK2B 5SWQB 4FHJA 2H1EA 1FE8H 3NP3A 3TN2A 2LE9A 3HRPA 4PLKD 4F7KA 3ZGHA 1AE3A 2DM2A 1U6AH 4PJHA 3L5XH 3SEPA 5MEND 5C08E 2VXUH 4A93H 4Y4FC 1NAMA 1OARH 4LCWA 4CU7A 4UCFA 3PWPB 3I4NB 3CTTA 2HJLB 3ILDA 4K5LA 3UIZA 3TVMA 3V10A 1HZ9A 5IE8A 2OMXB 2CO6A 4V1DE 4HOZA 4Z3FA 2CR6A 2PO6A 5E1QA 2AGJH 2PTTB 2F7PA 1TJXA 1NCUA 3UDXA 2Y5TB 1IVTA 4JV5L 1KJ2L 1IM9B 3KDFA 1W6WA 2CH8A 5HYQB 4JK1C 4XQJA 4KK5D 1ICTA 3IFPB 1TQOA 5DAUA 3H91A 1MZZA 3FVQA 2JK5A 3SE4C 4OIIH 1M6OB 4HWEH 4GI6A 2NY2C 4NKIH 3RZCA 4Y4KC 3VA7A 2X41A 2BINA 3HJ0A 2GN5A 3LN9A 3Q7JA 1HHIB 2FFKB 1MIEH 3BZ4B 3QAQA 4OCMC 3OMCA 1S4ZA 4Z7NF 1FVDA 3B7TA 1OM9A 2RB8A 3BUYA 3C5JA 4PG9B 2C3XA 1MCOH 1NA8A 1S3RA 1FAKT 3P0GB 3LXCA 2YKKA 4HV8B 1TTCA 3DJRA 1F56A 2F4IA 2OMYB 4RVBA 4OZIB 4TLUA 4YHML 1PD0A 4DETA 3I90A 3ARWA 2PETA 1NIBA 4YHZL 3IN0A 2GY5A 3N9GH 4JKPL 5DJ2B 3I75B 4F7TA 4TUJA 4X8XA 4XCEA 1NBYB 3H0GG 2Y25A 3PUCA 5I1GH 1Q72H 4X9FA 3MX0A 3EOAB 4HXAL 5IG7A 5DVMA 5KZCB 3PXHA 2ADYA 2OR9L 1E7VA 1ZVHA 3CVIH 3VU1A 5JORA 1N10A 4OGAD 4E9LA 3F58L 3RGVB 4MTMA 4C3JH 4WCYL 5DDHA 1INEH 2OTWB 2V9QA 4MNHB 2O6DA 1QPPA 2Y36H 3OXRA 4Y2LA 2J7LA 3D2UD 4MYPA 5BQDA 3PWPD 1F2YA 1R3KA 3QJXA 4GLRI 4WJ5B 3V4VH 4GAFB 4NIKB 1KGWA 4P4RA 1USZA 1EZLA 3DWAA 1OTTD 2VDKH 1AO7B 4KDVA 4CMHC 5GS0L 2F0SA 4N2KA 4X83A 1AE6L 4WNQB 2X09A 2H0FA 5I2IA 1R17A 1NKOA 1IM9D 2GCYB 2Z1KA 3BOVA 3BWAB 3LEXA 3NJMA 5C4ZA 3CH8A 4GOPB 2HG5A 3MV7E 3T0WA 4Y8DC 2YPVL 4Q6YA 2KZ1B 3GSNH 4JY4A 1AC6A 2WO2B 3CPUA 3KWWA 2Y06L 1G7LA 1SYSA 4DVBB 3K4ZA 4BRVA 5BXFB 1JZ8A 2ZJQA 3SPJA 3E38A 4ZZFA 2NY7L 2Y2TA 3NZHH 1FN4B 4HS3A 4MCYA 5CN1A 4PY8J 1ZANH 1R3HA 1GUTA 1NEZG 3CVCA 2WLZA 3FBQA 3M07A 2W80C 4NUQA 1XH3B 2NNCA 2NVXB 3C2SA 2R9HC 4HLZG 1Z7TA