5JPMC

Structure of the complex of human complement c4 with masp-2 rebuilt using imdff
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpmC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpmC01
2A74C 2TMPA 2WINB 2J0TD 4D94A 1GXDC 2ICEC 2QKIC 3HS0C 3KLSA 5FOBB 1BR9A 2XWBB 3G6JB 5FO8B 1XWEA 1AYOA 1BV8A 3L3OC 2B39A 2E2DC 2I07B 5FO9B 1OO9B 1D2BA 4ILWA 2A73B 3HRZC 3I70A 3T4AC 2WIIB 1UEAB 2XWJB 1PXUA 3OHXC 5JPMC 1UAPA 1JB3A 1EDYA 3MA2B 4FXKC 4LNVA 3CKIB 3FRPB 5FO7B 4FXGC 2PN5A 1BQQT 1BUVT 1JC7A 3V96A 5JPNC 3CU7A
chains in the Genus database with same CATH superfamily
1BQKA 3QARA 4OD1H 4M62L 1M7UA 1MNUH 5ALBH 5PCYA 4KY2A 1KGCE 4XYQA 3G5VB 4BQBA 3O41B 1N34L 3Q0AA 1I7ZB 1RPKA 1HPCA 3QDJD 3F5WA 1CFBA 4KKLC 4M5YH 3ZRFC 4GMTH 4ELME 3KVQA 1U3JA 2NYZD 3GXFA 4P5RA 1OP3H 1BOGA 4AT6B 4M8QA 2B2UA 3MZGB 4PBWD 1YNND 1H6FA 4FCAA 5EZPA 3SE4A 5CJOL 5L0QC 1P4IL 3APCA 2HVBA 4ME5A 5EIIG 1C08B 2HTKC 1N59B 1EQRA 3EBEA 1MVUB 3M17A 4OZGE 3T2PA 2JXMB 3BMWA 1FZKB 3BO8B 1AJ7L 2G5RA 2H5UA 4ICWA 4PGCB 1HXMA 1NCBL 1YEJL 3UE0A 1ZPLA 2CO4A 2XTJE 3S88H 2GSGA 3DVFA 4HCGA 4HCRA 5BZWB 3KPPB 3FOMA 1LT4D 3TBSA 2E7LC 1FH2A 4WW2A 3WIIH 1NMAH 3O6KL 1ZA6A 3MCKB 2FT7A 3T6QC 4HYTB 5DQDH 1G87A 1VDGA 2K01A 3CQZH 4ZSOE 3D69A 4BFJA 5BOZG 5D7JD 1KIRA 4CU7A 2R59A 1CFMA 3H9ZA 5D7KD 4JO3H 3EJSA 3FDTA 2QFPA 4BSWA 3A7AB 3PWUB 4JRWA 2DQCL 2OL3L 3PQYB 4WEUD 1KG0A 4QRRA 4ZFFA 5L9DL 2EVGA 3NHHA 3WD5H 1J5EL 3ABLB 3WCYA 4DQOH 1MRCH 2VE6A 4R4TA 1SNPA 3MVSA 2EINB 4HOWA 3KK7A 1WCQA 2YQGA 3FW6A 5E23A 1RUPH 3CFJB 4LQ1A 2DOCA 3B2PA 4IUNA 1PHJA 4ONFL 1DQML 5FDYA 4Q74A 5ISZA 1UM5H 4LJZC 1UOKA 1F1DA 1BBJB 3L95A 4TS6A 3STBA 5IK3A 5L88L 1C8PA 2F8VA 2VNCA 2O5XH 3QZPA 4P57B 1M2VB 2QDWA 5E1IA 3MROA 3SDAC 4ZO7A 4LSSH 1TWHH 2WTOA 1NC2B 1KTKE 4JDTL 3BAYA 5DRNA 5ESVB 4CN1A 1YNTA 1W0WB 2OS7A 4YDZA 2FATL 1SVBA 2CR0A 1N64H 3MRHA 3QIWB 2UY6B 5JXED 4HBCH 5I6WA 1X9NA 5K9QI 2M8XA 3PGDB 3BVNA 4P0DA 1LDPH 3RB7A 3S3DB 4WWNA 2HJLB 2C3HA 3K46A 3V6ZB 4D8OA 4TLUA 1QQDA 4GRWH 3VYRA 2CA3A 4G8EA 4HMCA 4XZUB 5LJYH 1JNJA 4JY5L 4F24A 1IAIL 2DQGH 4HETA 5GS1A 5LGHL 3LZLA 3C8KA 3EG9B 3POCA 2L15A 1GZHC 2CG9X 3PWVA 2CUAA 1WFOA 2DM3A 2O61B 4Z3JA 5BRZB 2YHGA 4FHKA 5IEKB 4BKTC 4CVZA 4U05A 4MASA 3ZK0A 3MODH 3MOQA 1QSVA 1FPTH 3AABA 2MCMA 4XPTH 2I0QA 3PUUA 1O6VA 4POGA 4DR3Q 3HOWB 3NIGE 2CDFA 4KI5D 4UM8B 1RUQH 1S3RA 3R1GH 5K33A 3U50C 2YYZA 3WY3A 3TLRA 2DIEA 1WICA 4EUPB 4NNXB 4HWZB 2A73A 3BQVA 4NO5A 5I19H 2D9UA 1S4ZA 2NW2A 2JB6B 1UH3A 1BQ5A 4OWXB 2QGEA 2C9SA 3U2JA 3V5KA 4NQQA 4JFZH 2FXQA 2EDKA 1FZMA 2JIXD 5DQ9B 4LKXB 2JWYA 3QDGE 3VXUE 3EYOA 3D0FA 2GW5A 2UVFA 4L3EA 5FW7A 5LDUA 1K8DB 3FH5A 2BIHA 2FIRT 2W59A 4KPHL 3WENA 1IE5A 5D8JH 1RZIA 3SY6A 4OWWB 4TUKL 5EU6B 3L81A 1MAJA 2EXWD 2EO1A 4PRPA 3WE6B 2HH0H 2WVVA 1F3DH 1FYHB 1HEHC 1SFHA 4P4RB 4XP5H 1IGYA 4GRLB 1CXLA 1XMWA 4FP8L 3CFNA 4K23L 5TF1L 3TNNA 1N0XL 2YWYA 4HG4J 1AHWC 2PQAB 4X4MA 5ELFA 1KDBA 4G7VH 4XQQA 3M85A 5GGTL 2EO9A 5CGMA 1UJ3A 2YBRA 4NZTL 4NO3B 1CFTA 4DPCX 3DUZA 4FHBD 2BSBA 3QEQA 2H9GA 2K5NA 5IGEA 1L0YB 2VDRL 4UINL 1JPTH 2UUCL 1QPKA 3RJOA 4E41A 1OP5K 2YIHA 3FO2A 1BG9A 5AW8B 5I28A 1DBAH 1Q90A 2XV0A 4NPYA 3O45A 1O80A 2YJQA 4LOUD 4GMSL 4M62H 1P5UA 1TO5A 3S2CA 2ZT9C 3HE6C 3T6VA 3D39E 1RSYA 2Y0SA 2ADFL 2YN5A 2N4IA 3VA2C 4X64L 5IHZA 4GSDL 2IWEA 3GF8A 1PRTD 2RSOA 5HGAA 1ZLVK 4AWJC 4ODSL 4R97C 3MZ5A 1KTLA 2V9UA 4TNVK 4XR8C 4IJHA 3UTQA 4QHKI 4PH8A 1A0IA 4PRDA 1JFHA 3BUTA 4JJ5A 4YNYA 4QQBX 3VFWB 5CJOH 4NX0A 3W38A 4EI5B 1P4IH 3NIFB 5IP9H 4JANB 1WVZA 2ARJB 1PG7W 2XVSA 1XF3B 2JCCF 1SQMA 4G7QB 1T0MB 2ZUQB 3QQXA 5AFAA 2D5DA 5E6ID 1AJ7H 4ELMB 5KSUA 1BFVL 4A3EG 1NCBH 1YEJH 4M1DL 4P9HL 4ZS7L 1A4KA 2WBXA 2PETA 4FFZA 1Z6JT 4N25A 3MV9E 3QIBB 4OWTB 2ROYA 4XWGL 4UCFA 1CQYA 3O6KH 2D7OA 3N50A 4LMQE 4L4TE 1AHMA 1G7MB 2I5MX 4LW1A 4QRPD 4YVNA 4MXQC 1BM3L 4H4NA 4UM9D 4OKVA 2X9XA 2ATWA 2DQCH 2OL3H 3KLHC 5L9DH 4IBTA 5IMLB 4PJ7B 3TO4A 2VABB 1OSEA 2FVNA 4PD4K 4PLNC 4M6ML 1X9UA 5KTEL 4ZMVA 4F7KA 3FU9A 1K0RA 5BN3A 4JG2A 4HH9A 4G9FA 3WG7B 2WWKT 4ONFH 1DQMH 3PE9A 4JRYB 2CXKA 4BYHA 4IDJL 4CADB 2EXYD 4OCNC 2JN4A 5L88H 5IGCA 5I16A 3UTSA 4LCVA 2WLLB 1LE9B 4H20L 3KLKA 3BIBX 3TBYB 2WQSA 3MLUL 4JDTH 4BD4A 4B5ZA 3GLDA 5DJ2B 3FCUB 3CFKB 2BNQD 4M7ZC 2D0HA 2FATH 1CTOA 2K5QA 4BFRA 4HLEA 3GZKA 1BVOA 4QHNB 2XWBA 5DC9B 3CVBA 3HPJA 4GZYC 2FQEA 1T1WA 1LTTD 3CCSA 2CKNA 2G0KA 3ZTNL 1N36L 3J81i 5BPPA 3N5AA 4L8CB 2F53B 4G7OC 4JG9A 3PDGA 2F1EA 2DGYA 4WKZB 2X2UA 1OAJA 4JY5H 2E9WA 1ZLWH 3GJEA 1IAIH 4RZCB 5LGHH 2F0HA 4G7ZC 1YJNA 2ZXGA 5TK4A 4LUZA 1E5AA 2GT9A 4HK3J 5KBDA 5IIEB 5E99L 1U8IB 3MJ8B 3RPIA 3RWGA 3QJHA 4NKMA 2PCYA 5DHVA 2DI9A 5H4YA 4DZ8B 5IBLD 4IFDI 3HC0B 3I6SA 1XWVA 4KNUA 3NK4A 4EN3D 3BP5A 4H2AA 3WL9A 4K8RC 4UQBA 3RVTD 4HX1B 2VN5A 4NZJA 4ABWA 3HOUH 2UXVA 3PF2A 32C2A 5T8IA 1H6UA 3S96B 4BZ1A 2Q87A 1NBZB 1G1OA 3QC5X 4KLKA 1S7XB 5JA8B 5JW4N 3FBKA 2NTTA 3CDCA 2VXTL 2ZTEA 3PL6C 4CAGA 1WO2A 3M3YH 5EAYA 2AERT 1NUDA 3NPZB 2AF2A 4K9JA 4NBZB 4NRZA 2YGNA 1JV2B 1AZRA 1OWWA 4G6AC 5FOBA 4KPHH 2YPVA 2FLRT 1TJXA 3Q3GB 1ASPA 1B2YA 1OSYA 1Q0XL 4JOIC 3AREC 2WOYA 1DSFH 4TUKH 4CL7A 1MW0A 3LH9A 4GUCA 3PWJA 1CQFA 3EKCA 2P49B 4NQDD 2HMIC 1MXGA 1PLGL 4FP8H 1T20B 2O30A 1R4PB 4K23H 5TF1H 3OL2A 2Z31D 4HUWA 3WS6A 1N0XH 1HH2P 5DVPA 4J3BA 5GGTH 1ICWA 1GY2A 1ZKOA 2RHEA 3ISYA 4NZTH 4LIQE 3S9WA 3BE1L 2AS5M 1HRJA 3UROR 4IURA 5T5NG 3ARPA 3O2DL 2NBFA 3HOVB 2VDRH 4PHZA 3SBQA 4UINH 2GQHA 3V4VL 3T0ED 1WTRA 2PWEA 4P73A 1D5XB 1Y18B 5HHME 4KRMB 2R2CA 3TCLA 2P5EE 2YUVA 4GOPC 1S2EA 3KLAA 2CBTA 1LXMA 4FNRA 1T9HA 4K0KQ 4ZUVA 3B2VL 4GMSH 2C35B 1EXUB 1PCSA 3ZQWA 1B3AA 3CQPA 4X80L 3GTJB 1JWMB 2GJ6D 3RA7L 1EWIA 2ADFH 4KKUA 4QL5A 3EOAA 4DV0L 1HYSC 2D0OA 4GSDH 1AXSB 2W80C 1AO7E 1CLYL 4ODSH 2UXBQ 5ADPL 3NRFA 3TTYA 3D05A 5E8OB 5G55A 1J0ZA 5JPNA 3OPOA 1KEML 5FGCB 3B37A 1PY4A 2RA1A 3KL5A 2HRHA 1AQDA 4A7QA 4JN2B 1YITA 3LH2L 2EYOA 1FNEA 1I1AD 2WNKA 4X6CB 3S3BB 3HOGA 4R1JA 5J7CC 1BFVH 4UT9L 5JO5A 4M1DH 5CEYA 3E9UA 43C9B 4P9HH 4ZS7H 1J8HD 3HZYB 2NUTA 3TESA 5KYLA 1I9IL 4OZIB 2F19L 2J1KA 1DLFL 4RMBA 2JK8A 4XWGH 3SEBA 2W5PA 4YIQB 3TX4A 4NO2B 1R3JA 5INDB 1E5CA 5AB9A 1PH3A 4GI8A 4PJXE 3BQUC 1S40A 3HE7A 3V8OA 4B7IA 1KTCA 3QG6B 3ULUD 4HS6A 4UILL 2A9ML 1BM3H 2CAKA 3QW9A 4IYKA 4KHTL 3W81A 4CMMA 5I1JL 4EZMA 2XIDA 1FFPB 1IAOB 4I0PA 3N1MC 2RR3A 2JA8H 4BELD 3MV9B 4BFIA 4QT5B 4PRHE 3HUJE 5E56A 4Z7UE 1JPGB 1A6ZA 4M6MH 3S36L 1WFUA 2D2OA 4EDXB 5KTEH 2MWCA 4ES9A 5BOPA 1CT1D 3GDBA 3HOZH 2CJUL 3HI1A 5DFTA 1XCXA 1FFNA 4IDJH 1A2UA 4YMPA 2W60B 1ZEAL 1I3RA 1T5WB 5FB8A 3KLRA 4TRDA 2E2HB 3EGSA 3V0HA 1SXCA 4JFTA 4OUOA 3C46A 3Q13A 5CJQL 1HAUA 2NY0C 2AJVL 2BW4A 4H20H 2R7DA 3MLUH 3MGAA 4X8GA 3LRSB 3AM8A 2KS0A 4F8LA 5IHLB 4J39A 3I3BA 4XNDA 2KCTA 4POYA 2A1AA 5AB1A 1EOVA 3RI5F 4AZ8B 3AB0C 3RJQB 4DN4H 4JGUA 2G75B 1J8IA 3AQZA 2ZONA 3DHQA 3OMNB 1U6AL 1Z9FA 3ZKXC 4IRSD 5IROC 2Y7QA 3ZTNH 4FHJA 4W4OC 1BSIA 1FG9C 3PO2B 4XAKE 3RKDD 4GUPA 1DJSA 4RMSA 1UD5A 1QR1A 1NDGA 2XI9A 2EDGA 3W1BA 3QUML 4ELKA 3DPBB 3RVXC 1KL9A 3KUPA 1SEBD 1YEEL 3BKJL 4XBPB 3U2IA 2R2HA 3O11B 3R18A 1L5GB 2NW3B 1P4LA 2AJ3A 5E99H 3JWNG 3VRLE 3EO0B 2IPKB 5KYWA 1W6LA 1OCRB 4JKMA 1GW0A 2E8GA 3CX5J 3MRCA 3QNXB 1DM0B 1PMRA 2ID5A 3I3DA 4FKEA 1U8PA 3QQ9D 2DY7A 2JKTM 1XB3A 4PJEA 3CVHB 2ZOWA 4P46C 1B50A 1VSCA 4U3SA 5IWAQ 4C1NI 3GINA 2LGNA 3RY5A 2RBLA 1EBPA 4H8WL 3BWUF 4IS6B 4YSEA 2Y23A 1A6WL 4LCWD 1ZD6A 2GJRA 4PJ8C 4YC2B 1JXDA 4A2MA 2NB0A 1KYFA 2V2WA 1UACL 2K52A 4K5OA 2E2IH 1XQ4A 2Y1AA 1EDHA 1S5DD 3PUXA 3TZVB 4L8BA 2VXTH 2X6UA 4ZZFA 5LNEA 4L3FA 5F7MC 2P47B 4RRPM 2EOTA 4XQJA 3Q43A 4Q6IB 2NY6B 4HGKC 5IV2B 1EUJA 1VQGA 2UUBQ 2CCLA 1P4UA 4Y16B 1Q0XH 2ZYSA 5A2BA 4EI6A 3LAFA 4JZOA 2WW8A 4IEFB 5CGYD 3TH4T 3SCMC 1T89A 1CSQA 1PLGH 5HD8C 2EADA 4FVMA 3IU4L 1ANUA 2OPCA 5HGHA 1QKZL 5KSAC 2IALB 2WMPB 1RVFL 4ZMNA 4RGMB 4PLJC 4MDIA 1TTGA 3KPMA 2AKWB 3W5NA 4CJ0A 5A2QE 2XY1A 4OUUB 5C0JA 3HG9A 2R1WB 5IR1A 3BE1H 2X4OB 3OKMA 3WFHA 3HEJA 1KF9B 2Q8IB 2AJZA 3O2DH 4RGNA 5DU7A 5F96L 1IGTA 5HGDB 1M05A 3MSPA 4BSVB 3IXTB 3OQ3B 3V4VH 3VFUB 4ELMF 1FD7D 2KLSA 5I1AB 4WV1C 1QHPA 1I6HB 3IKJA 2A68C 4FQXD 1HSAB 1S7UA 3B2VH 4G8FB 3AG3B 4MJ6A 4X80H 3RA7H 1F4WL 5EIIB 1KDJA 3PWNA 4HHAA 4NKLA 2APVA 4K3JL 3N0PB 1HR0L 4OZGF 1E0OB 1CLYH 1KOAA 3M88A 4WUKL 1CWVA 2LTQC 2I24N 4RESB 3V0EA 4AYEC 3P3RA 5ADPH 1Y1DA 2P5EB 5HSFA 1XH3B 4OD3L 2YD7A 3CD4A 2UZXA 1KEMH 1FNLA 2O6CA 4NI6A 1FV1A 4M6AA 2ZP9A 4M93B 3MUJA 3FRPG 4YE4L 2W0LA 1K3BC 1KHIA 2FE0A 3H0TA 3LH2H 4Y4FB 2FSDA 2OQJA 3WNJA 2J43A 4D0CA 4P2RE 5D2LB 4QGYA 3P4NA 4UT9H 2WXJA 3VGDA 2CRIA 4E0RB 4KHZA 2AQRA 2MNWA 3AT8A 3ZE1B 5HDQL 3S17B 4QTFA 1I9IH 4X7TB 5CO1A 2F19H 3UBHA 3C5JA 2WZPD 1DLFH 2HHHL 4F7CB 1OTTD 4BH8A 5BXFA 1BQLL 1F9QA 3VFGL 1PSKL 4B9XA 1WDAA 2WCGA 2ATPA 4ZUTA 3DVGB 3I3EA 4Y7MA 5I26A 4Z9CB 2BX5A 4O00A 4UILH 4X99B 3CFCL 4YFDB 2A9MH 1SRUA 4KHTH 4MTMA 4AYFA 5I1JH 1PKQE 3FRUB 3A74A 3PHOA 1KIXA 5ACMA 3S4SG 2EYMA 1ZSDA 1UCBL 1RK1B 1B4RA 3GM0A 2R29L 1Z0MA 1T0PB 1HNZL 1OCWL 3K4DA 3S36H 4F58L 4ACPA 1CZ8L 3TT3L 2J57A 4PVLA 2CJUH 1HZAA 1MCDA 2Q7YA 2ZCZA 4Z7NE 2BWQA 3T1YQ 1H6TA 5GRZA 5IW6A 4OI8A 1I8LC 1PXUA 5C5MA 1YI2A 1ZEAH 5DJ0A 2MOVA 1EY0A 3ENEA 2BPBA 3TSSA 3EZJB 1EANA 3CCUA 4HZLA 5CJQH 4PRHB 3RTQC 2AJVH 2DJFC 3DC0A 4HUUA 1TWCB 3AG2B 4NIKB 3II1A 4DF9A 4X9HA 3IWUA 1LTAD 4TL4A 2R39A 4ZPTA 4KK9C 2AGJL 4PSPA 1F2YA 2OJ1A 1VACA 5EC1A 1L6ZA 1EIHA 4BWUA 5JW4M 3GWJA 5KS9E 1IVLA 1U6AH 2EYTB 1T3FA 2AV1A 1SJHD 3TFKC 1TCRB 3DDFA 3GMOB 2IQAA 2RB8A 2ZXWB 1EY5A 3PMFA 1G2SA 3QUMH 2PKDA 4QUFA 1WTHA 2Z6KC 3GGWB 3NIGF 4O2CA 1ASYA 1YEEH 3BKJH 5T3ZD 3QQ4A 3TIDA 4GG6B 2CGYA 3D34A 4LXFA 4L1LA 5FHBL 1G6RB 3UDXA 5B1JC 4XO9A 5BR8Q 1WAAA 3C6EA 5I23A 5JZ7C 1L1OB 1Y6KR 4PTUA 5A2KH 1PTOD 2Q8RE 3RUGA 3MDJA 1NOFA 2Z91A 5FO8B 2C4XA 2QZQA 1V1QA 2I07A 2QILA 3FC8A 1JTOA 3VWJB 3DGCR 4GS3A 3IMBA 3GIVA 4H8WH 2P8PA 2A0LC 1A6WH 3O8XC 4KKRA 4WWPA 4H25B 3IVKA 5DS8A 4JR9L 4QOKE 3N6RA 4N9TA 2LFNA 1UACH 1H3UA 4F87A 4QWWC 2VIRA 1D6EA 2QVIA 4OFYD 4XO5A 1HZHL 4XNQB 4Z18A 1IU1A 4BQ6A 5M5WB 1B9ZA 2B5IC 1DFBL 2C9RA 3AWFA 1PFSA 3LNDA 3CMAA 1E28B 5JIQA 5TGBA 2CO6B 3CFEB 3JXAA 4G7YL 2ENYA 1FAKT 5C44H 1PL3A 3DNKA 3PCYA 1AGBB 2BSRA 3CXFA 4O2DA 4GQPH 1BBUA 3V6BR 3MBEB 3CK0L 1K2DA 2FEDD 5TK2A 2UUDH 4K5NA 1PQZB 3WLBA 2DIAA 1PFOA 3F7KA 4AQ1C 4HR7B 3TBVB 3IU4H 3JUZA 2PUQT 3QIUA 1QKZH 3QI9C 5KOMC 5IWLA 2W91A 3SR1A 1U9RA 4LEXL 4IU3A 4QHMA 5LNGA 1KBGL 1WLHA 4RAVB 4U1JA 1KXTA 3QUYA 4NCC1 4Y1AE 2EY1A 3TO2A 4JV5Q 2VDOL 4I3RL 2QV4A 2VAAA 4FG2A 5CGBA 3VMNA 4M29A 1IEBA 3EH3B 2LAGB 5F96H 4JFDA 5I2IB 3PWLB 4PP2A 4F8QA 4X6CF 5TDPB 5EU3B 2MTPA 3SYQA 2DI7A 2XYCA 4C56B 2P8MA 2CHWA 4YBLC 1R5VA 1NTDA 1TVDA 4PJHB 2F58L 4V1DD 1F4WH 4ENZA 4M61A 1XT5A 1D5ZA 5I6LA 1UG9A 4K3JH 2AAAA 4RMFA 2L04A 2X9ZA 3B4NA 4WUKH 4PLKD 2Z8LA 4N5EC 4FF1A 2KDYA 4FLHA 1TWGH 1Y7VA 4AL8C 3WJJC 4BRVA 1SMXA 5D93B 2PI2E 1PYWB 4QO1A 4P59L 4A3EB 2G4GA 3RN5A 4RMTA 2ESVA 1X6OA 5FLXL 2DY2A 1BZQK 3RFZC 3EBHA 3TP7A 4YE4H 4ODWB 5DJCA 3GKWL 5SWZD 2DAVA 3UTTB 4C58B 4OVVA 1L6XA 4DJMA 3DHUA 3PP4L 2PYFB 5GSRA 2X40A 4XPFL 2HRLA 4K71C 2UXGA 1KLUA 2YKKA 4DR6L 4A3FH 1LMKA 2KT6A 3QDMB 4S0SD 1MI2A 4XTRC 5HDQH 1QBML 2G2PA 5KSAB 5IP9G 3L6FB 1JGEB 1KIUB 2V37A 2BINA 1RJLB 3QS2A 3QUZC 5H4ZA 3MXUA 1FL5A 4HCRL 2A6EC 2A3TA 1KPRB 3PDOA 1BQLH 4PGEA 2OK0L 5EZLA 1J8KA 3ZDZE 3VFGH 1PSKH 5ANHA 3UPRA 3L3DA 2OXGB 3GSUB 4TUJB 2C7UB 1JTPA 2ZD0A 3SO3B 1E8ZA 3CFCH 4LBEA 2WXGA 3IFTA 5CBAB 1I9EA 4LPXA 1WQVT 2P3YA 4MZIA 3KLHD 1UCBH 3EZ8A 4F7MA 4LSRL 3MMEB 1SLWA 2R29H 3F1ZA 1YNJC 1OCWH 2IPTL 3IU3A 4BHUA 1G94A 5FYLE 2FJ2A 4F58H 5J13C 3MXVL 3TRZA 1CZ8H 5CZKA 3TT3H 4E2OA 2FTAA 3V0WL 5JIMA 3RPBA 3ULVL 3S37L 1FO0A 1G8ZD 5KNCA 3NCWA 4TVUA 1Q9KA 1KB3A 3P9LA 1RMFL 2VR8A 5EBDA 4U1MA 2GK2A 4U6TA 5DZAA 1QRNA 4XQNA 4NI3A 2EABA 1T1YB 1XH1A 2VERA 4NHUB 4B3TL 1PD6A 2OMWA 2OMYA 4X6FB 3CUPB 4A7GA 3FT2B 3SPGA 2HT3C 4R7VA 2AGJH 2JYOA 4EGVA 3W82A 2ZXCA 1QVOB 4NNYB 1XBDA 1KLGD 2K4KA 4K94C 3WUWA 1PJWA 3CSPA 3KWUA 3B5HA 3CIQA 3T6XA 4N2KA 3LWEA 4K0OA 4MAZA 4S1QL 3UTPD 1QHQA 2PF6A 3H55A 1T0NB 4LP5A 4J4PC 3QEGL 3T3PB 3VB9A 5F97E 5KOVC 4NC0B 3LN5B 1BOSA 1CN4A 4B9KC 5F93C 2H32B 5BMFH 4DNIA 3C60A 3H9YA 4UTAA 4HOXA 4WTZA 4DXFA 4ZKBB 3QJFA 4DR5L 4K9EC 5FHBH 4GIPD 4Z0XA 3CHBD 1P1ZB 3L3KB 3QOJA 2MQ0A 3LPPA 1TUPA 2B63H 4LDCA 3UX9B 3MR9B 1UQSB 4LK1C 2NT1A 4TVPD 3EXLA 1NUNB 3IT8D 2VRAA 3F6JA 2G9HD 1U9KA 4HLZH 4PB0L 1ZIAA 2PWFA 3DX4A 4BM7A 3GD7A 2NYYD 3FO0L 4P2QE 2IPUK 4JR9H 1OOWA 1LMIA 3IBEA 2F74A 2VKXA 2AMGA 4IBYA 1Q94B 4JZNB 4QRSA 3WAKA 2MHAA 4LVNC 4Z6AT 1HZHH 3FTGA 3H3VI 4X6DB 4Q9QL 4LF7Q 1DFBH 1CG9B 2OZNA 2Z8SA 4UQ2A 3HOUG 4M02A 2WWNA 4FF3A 3B9KA 3NIDB 4G7YH 3FU8A 5E1AA 4U3HA 2D0GA 1J7VR 2ZAHA 4PPTA 2E2DC 3CK0H 4L18A 3S9DB 3HFZB 1KJ3L 3B2UD 1DANU 2JA6H 1ID5I 1V7ML 2D7MA 3B1UA 1AOZA 1WIPA 2V9RA 4N2FA 1JSYA 2ENQA 3CVCA 3QQ3A 3QDJA 1MBYA 4LEXH 2NY1C 4PYHA 5I2YA 1KBGH 5CP7B 2NYZA 4ADGA 2SNMA 2VDOH 3MNZB 2O6FA 2O5NA 4I3RH 5DI8B 3MRLB 4JFFB 2YPLB 1XNRL 3TNMB 1N12A 2M83A 4A68A 4NN7B 3H2WA 3GSXB 4N0CD 4QJFA 5HJ3A 43CAA 3EH1A 4ABVA 3D4RA 5D2LF 3T65B 5E4AA 3MJ9A 3EFXD 1SVZA 1RKRA 4TLTA 3UYOD 1JICA 1T1ZA 3ZE1F 4Q6YA 4FDWA 3RDTD 3IJYA 5DJ8B 2FMMA 3SZKC 1Q9OB 4UQ3B 4R4QA 2P8LB 5CYUA 2F58H 1P9MC 4XNMA 3DOSB 1V10A 3LIUA 4YHHL 3OKNA 4QJ5B 1CUKA 4ZFZB 3T9WA 3MA2B 4E68A 3KH4A 4P5TD 5ELNA 1CSPA 2X87A 2ZWYA 2B5IB 1X9LA 3JV4A 5D7JA 3BKCL 1CE6A 2GEEA 3ZW3A 4P59H 4ULLA 1Q38A 5F7AA 4FL4C 2R1XB 1ZLVH 4AQ8C 1UNSA 1KPVA 1QUNA 4XMPH 1HZ9A 2P5ZX 3I72A 5DDHB 1STYA 1MCFA 1EFXB 1QABA 2B59B 3GKWH 5F3HB 1JGVL 1JXKA 4K7FA 1KCWA 4PJXF 2FL5A 4JQVC 3S2DH 4MAYC 1DQTA 2VDLB 3PP4H 1SE3A 2JI2A 1T03L 4XPFH 3OMIB 5I66A 3FO1A 5ENWA 2VQTA 4G5ZL 4M8UA 3QI9B 3T2NL 1QBMH 4YL4A 2CWAA 2HT2C 4BWWA 5DMIL 1VFBB 4L8SA 4FFZL 4ZOEA 1A7QL 2DB8A 3HUJF 3M6DA 4L4VD 4Z7UF 1OARL 3O2VL 4NDMA 4NXSA 5M94B 2NSXA 2OK0H 2BOCB 4PJ9B 3QYNA 2PCPA 3BQUD 3JAML 2J21A 3OW2A 3ABGA 3CQQA 4OFIA 2GTWB 3BFQG 2WBJB 1MZYA 4MGXA 4H44C 1BD2D 5IG7A 3L8QA 3AY4A 5DD6B 5JXEA 4MNGA 5FYKU 1GGCL 5C0AA 4LSRH 3EXJA 1XDTT 2YOAA 2IPTH 2CLZA 3HW7A 3MXVH 1GJWA 2XPYA 3J2PA 3QFDA 1CFQB 1IW7C 3V0WH 3ULVH 2XQYG 3S37H 3KCPB 1ECYA 5T33L 3QGVA 1RMFH 3HLAA 2JA8G 3GTGB 4XHQA 5D2NE 3RVVD 4P23B 1MPAL 5HYQA 4GG6F 2JQAA 1W6WA 1T83A 1U91A 2CLVB 3FZUD 4J3WA 1NEPA 1BVSA 2NY0D 3VXNB 4PJDE 3SKNB 1SYDA 2XQBL 3MXNA 2AEIT 3QZWA 4WI0B 3HOZG 3V9CA 1XF5B 3Q8DA 2YSTA 2PYEB 2X2JA 5C08B 3ZYZA 5HI4D 3FB7B 1M7DA 3JTSA 2X7LA 5DHEA 1DE4A 2BC4A 3WS3A 3OHXB 4S1QH 4ZOCA 4NXML 1FFRA 3VRLF 5MEQA 1HU8A 2E9IA 4AY0A 5CN2A 3ESOA 1QO3B 1B0RB 3QEGH 2CUIA 4GINA 4U31A 3VA6A 3K7UC 3DARA 3BU2A 2IAMA 3SHSA 4N2DA 2EIDA 5EWIL 3GMNB 1XMQL 4N3TA 4NC1C 4KKAD 4Y5VA 1AGFA 3KPLB 4RGOL 3C9NA 4QTHA 2X4NA 5DD1L 1PH2A 1BYNA 3FTVA 4H88L 4MTKA 1LEGA 2BVOB 2E4TA 2GIXA 3UBXB 2LFGA 2P28B 1EJFA 3BPOC 3RGVC 2K5VA 1O7VA 3PABA 1XGUA 3SDXB 4TNWK 5IQOA 4HIIA 1HL4A 3EO1A 5LMNQ 1WPCA 1J05B 2ZXDA 4PB0H 1JZ4A 3S2HB 4HUVB 1SXSA 2VDKB 4L9LB 3FO0H 3NBHB 3CNKA 1IAKA 1I4QA 2NXYC 4PJ8D 1DBBL 2VLJB 2B1AL 3PXHA 3SGKC 4B9GA 3GSQA 1F9RA 3NPPA 1OE2A 3MUZ1 4EJ1C 3BUQA 1V3MA 2J8HA 2X2YA 3LKQA 3KYMA 2Z4QB 4IGBD 4Q9QH 4K07A 1K4DA 2HYMA 3VFPB 5T3XL 2XA8L 4DFHA 2ALYB 2A5UA 3OWRA 1I8KA 4NC1E 5C0ND 2K4WA 4XB8A 1HNWQ 4NAJA 2YPVL 1MJJB 4PJHF 1RZJL 4P3CL 4DK0A 5IY0A 1SHMA 4QKXB 4WFGD 4JYAL 1NSNL 3VXME 5KN5A 4MZ3A 1V7MH 5F9WB 4ATWA 1U8CB 3MRJA 5D5MA 1EZ8A 1XCTB 3IM1A 4FFVD 1ZLDA 5J3HC 1SMDA 1QR4A 3BSZA 3IPFA 3AQYA 3DEPA 4R9WA 5T1KB 4HULB 1ZA3A 3ZR5A 4FS0A 2Y06L 4A2GA 1E40A 1FLRL 2CW0C 2LLNA 4QF1A 4AITA 5B1KA 3L17A 5I9OA 2IAND 4IBVA 4KY7A 4FE9A 2DWYA 2CBOA 3F7YB 4IIQC 2BMKA 1PFBA 4N20A 3NN8A 2WLJA 5F7UA 1GGYA 2TSBA 1YMMD 3BGFC 1DVZA 2QELA 2ZTDA 1J9QA 1V1OA 3CD6A 3QZNA 2R8SL 2VLKB 1OT1A 2NXZB 1Q9WA 3FRPB 1CBVL 2FEEL 3D4GA 1MLBA 1FJGL 1R24B 1BQHG 4D9RD 3VB8A 1WTXA 3CN3A 1T4WA 3BKCH 3FT4B 1KRTA 1NGQL 3FBQA 3TV3L 3AFPA 4MJ5B 4UM9A 3B9DA 3VGHA 4CN4A 5IKCB 3LS5L 2EQSA 1EX0A 4QGTA 4OV6F 1JGVH 3Q8EA 2FECL 2JK5A 3I02A 2WQAA 4JI3Q 1PIGA 5IOKA 1YPZA 3GHPA 5C09B 2H5XA 1T03H 3HPLA 3AWEA 3MRIB 2DKMA 4G5ZH 5F0JB 5JPMC 3T2NH 3W39B 1WEJL 2NZ9D 5EUOE 1UA7A 3TEHB 3ZN6A 5DMIH 1JWUD 1RJCA 5FA4B 2O5IC 1PFCA 4FFZH 4F2MA 1A7QH 1OAZL 1WH0A 3QEUB 5LBSA 3S4SB 5FYJE 1OARH 2OI9C 1PH6A 3O2VH 3PWPD 4ZXBA 3CQZB 5DURD 3SJVA 5EBWB 1UZ8B 8CGTA 1N68A 4APQA 4Z7NF 4IMLA 1BYOA 2CLRB 1CHQD 3DM3A 1YY9C 3WSQL 3LQMA 4X98B 1H9RA 1GGCH 2FAUA 4XXCA 1F1GA 2ITDA 4XPAL 3AT9A 3MBWB 1OSZB 1WS8A 1I1YA 4KY5A 2UUAL 3NJHA 5D1QA 2Y2TA 4K7PY 5T33H 2O5ZL 4WO4D 4BK5A 3H9SD 1MPAH 2NN6H 3OIQA 3ME0A 1ZTXH 3T8VA 5KS9F 2EUWA 2ICWB 3E3QC 1KB5A 1JZDC 1TOXA 1TWHB 3LKOB 1BEYL 4FQJL 2XQBH 3E6HA 1LO4L 2P5WA 4KFZC 3NSCA 4RFNB 1G291 4NO0D 2XN9D 4IRJA 4NQCE 5B39G 5E3FA 3JT0A 2NX5B 4EN3A 3EJYD 3OAUL 1SRDA 2JA5H 3HC2A 1JF1A 5D2NB 1YEDB 3QR2A 2Q86A 1Z7JA 4DUYL 3ECBB 4PJFE 2CGZA 1KGUA 4XNXL 5F9DC 3L16A 3HG3A 4GRWB 3V0VB 3OQRA 3GZOA 5LVEA 1WYDA 2ZOKA 5EBLB 1WWAX 2ZWKA 4OQTA 2FH8A 2CWRA 4UNVA 1AD9B 2CJTA 1RLWA 2DD8L 1SBSL 3KPRD 5EWIH 3CDGA 4IO9A 1X7SA 4U68A 2ZYHA 1F9PA 1MCIA 2KVMA 5DM73 1BLNA 3KEHA 2WJ7A 4RGOH 3S8GB 1ILUA 3MV7D 5DD1H 4CSSA 4R26L 4O42A 4H88H 3RBSA 1N2RB 3FPYA 4FTVB 3QG1A 1IBGL 3E3QE 2QSQA 5DHVH 2KZBA 3PIQB 2HIXA 4U7MA 3QR1A 2CCWA 1WA1X 3IAPA 5T5NF 1B9KA 1CK0L 3GZQA 2CU9A 3GHEL 4I9XA 1VEPA 1JNHA 3F7VB 2WWMD 1ZHKA 2QPEB 1D9KD 1INDL 3MUHL 3NSYA 1HH6A 2ZJSL 1MKFA 3G4SA 1DBBH 2B1AH 1CXHA 4F7XA 5F1NB 2JQOA 4JCLA 2X70A 1NUGA 1U92A 5FCUL 4DEPC 3DSNA 4DPRA 1RD6A 3GNML 2IADB 2WQVA 3BFWA 1JG9A 1TMQA 5L2KD 4FQPA 3QYCA 3AZUA 5T3XH 2CCVA 2XA8H 3DSFL 3A8KE 4WSJA 1R3KA 4N9GA 3T0EA 3ULPA 4UDTA 1KULA 1GUGA 1ASOA 2YPVH 3V52L 3G6JE 4XT1B 5EUKB 3GJFB 1RZJH 3B8SA 4P3CH 4AQYL 5F0LB 2F0PA 1XX9C 1NSNH 4MVBC 2GJ6A 3U46B 1QFUL 5MERA 3NP3A 5CJXC 2GAZB 2AV7B 3O4OC 4IQZA 2BA1A 3HNSL 5IFHL 5C44G 3M1BA 5H2BB 3O3EB 3MOAL 4LVOC 2HPTA 15C8L 4X5LA 1NCOA 2Y06H 5IJVB 1EEYA 5AW6B 2CSPA 1FLRH 2LS01 5GAHC 1MJUL 3K5MA 2XCMC 4F7PA 3C5ZA 2F0DA 1ASZA 5T1MB 3C08L 4LL1A 5TF0A 3CZLA 1X5LA 1CD1B 1M1XA 4D0BB 3P7JA 1PEWA 3M7GA 1I1AA 5E00A 4AVJA 3RWDB 2NLJB 3QDAA 5IHBA 3FB5A 2Z0SA 1N7ML 4FQ2L 5JDSA 2R8SH 1JB3A 1J8HA 3DRTA 1C8CA 4Y4HB 4FXGB 4UNTA 4FFWD 4HMIA 1E22A 5I6KA 2H0JA 5INCB 3V0GA 4FMKA 1A6TB 1MJ7L 2ZF9A 2K28A 1QHOA 1NCHA 5IEHB 4UDUC 1NGQH 2LKVA 3TV3H 2VDML 2UYLB 2XIBA 5LG6A 3LS5H 1Y1WH 3QO1B 2XZAL 4NAMA 1WK0A 2XG5A 4JFEE 4OZHE 5IB5B 2J4WL 1GSKA 1B53A 3K81C 3ARGC 3VXTB 1N70A 1CL7I 4Y5YC 2EC9U 1LTSD 2DV6A 4IOFC 4KRNA 2QVMA 3FQRB 3NE5B 4DR3L 3WO4B 1WEJH 1UJTA 3R8BB 1COBA 1HXYA 4JI1Q 3RZCD 1OAZH 2G60L 1QATA 3UERA 3UZVA 4WWKD 3FULA 2CIIB 3MV8B 3O4LB 3R4DA 4QIRA 4BXVA 1ZK9A 4LT7A 3FVQA 1GW6A 4OLXL 4X7EC 1DVXA 2XBTA 3CLWA 4ILDA 1ZDQA 1CGTA 4LF3A 4A3FG 2NNFA 4JREC 1M90C 2FK9A 4HPOL 5F1IB 1JZEA 2ZJQA 2BVYA 2QSCL 4YUEL 4ANWA 2OL3B 3WSQH 4NN5C 2I69A 4HEPG 3AWGA 1T1XA 3UP1A 1Z9MA 4LNRA 4XPAH 1W6JA 1H15B 4FXKB 5LUMA 2B0SL 2D31B 3SYCA 1WIUA 3SBRA 4M7KL 3AU7A 5I16B 1R19A 2OSYA 5HYIA 5EF2A 3KWWB 1F5WA 4CVXB 2O5ZH 3HG1B 4AENA 2HTLD 2YXMA 4G9DA 3S5ZA 5F21B 2OYLA 4D8PA 2ED7A 1SEBA 1I53A 3GM8A 4EQ3A 4Z76B 2Q10A 1BEYH 2L7EA 2QBWA 4FQJH 3R2TA 1LO4H 1QTPA 1L9PA 4Y4KD 3N3EA 1W6KA 3HOXH 1NJIC 1FORL 4PG9B 3SDXF 3TPUB 4ZD3H 4AYSA 1OXXK 1E9OA 3OAUH 3LX0A 2LMCB 2BP0B 4KK6D 3GT6A 4Z7WA 5EU5A 4QYOB 1E7VA 4HKBA 4JE4B 1QLRA 4XNXH 1JOQA 2F0GA 5DA4A 3LX9A 1UCTA 4GNXB 5LL6X 5D4QA 2WM0A 4N0FB 2R83A 5D7LD 1A7RL 3TA3C 4HVBA 1U8NB 4XB3A 1E3ZA 1Y6MR 2DD8H 1SBSH 1ZJBA 5GQBA 3WIFA 1FUNA 1B90A 1KZYA 2ORBL 4XPBL 1EJ6A 3QORB 4PV9A 3FUDA 2WK2A 3MRKA 1JRHL 3UDGA 4R26H 2BVQB 5DHYB 3T4AC 1IBGH 2ERJB 3OF6D 5KWYC 1HQRB 1NKGA 5B8CB 4ELDA 3U0PA 1OXUA 1CK0H 2HQEA 3GHEH 5FLVA 3HOUB 5J11B 3ARWA 3QUXC 1INDH 1B6UA 3D87B 4N8PA 2J7ZA 4DR2Q 1S9VA 2ZJSH 2YMXL 5GADC 1OB0A 2B63G 3BPCA 3FT3B 3ECQA 3SGDI 3MXGA 4ZK9B 4Y9FA 5F72S 1GJXA 5JHDE 5FCUH 4CNIA 1KBVA 2DLIA 3GNMH 2AKRA 1EAPB 4HLZG 4FQIL 3BZEA 5AUMB 4HK3N 1MVYA 3EH2A 1VZGA 2F1MA 1EUUA 2X0UA 3C6LC 3DSFH 1CICA 3MNVB 5D1XC 5HVGB 5TE6H 3D31A 1CF1A 1EZLA 4MBOA 3W11C 2EUXA 5FCSH 5ALCL 3V52H 5EN2B 1RJTA 3L5WA 4FQXA 2VCOA 5HGGS 2OSWA 2BOSA 3M4OH 1H8SA 3AU0A 1N32Q 3LTVA 3Q48A 5KSVA 2A6JB 5J6GB 1QFUH 4DV4Q 2J7LA 4U1GB 1JNNL 3V4PA 2BNRB 5IT9c 4OD2B 1D3CA 5D3IB 5FOJA 1FNVA 3HNSH 5IFHH 3U9UA 2EH7L 2Z9HA 1R5WA 3MOAH 4B27A 5GRXG 15C8H 3HVNA 2E7BA 1G7LB 2ZOLA 5ESQB 1KB9K 3QB3A 4N0RA 4AQZA 3BUYB 1MJUH 2KERA 3L7EB 2AEWA 2NTFB 1YC8A 2JA6G 5E1HB 2VZVA 2UZIL 2X4SB 3C08H 3CU1A 2FWOB 4OW6A 3ARDD 5F3FA 4LLVA 5M7QA 4Q0FA 1FCGA 2VDRB 4RFEA 1S7RB 4RDQF 1PH4A 1EH9A 5FKAB 4ZUSB 1VGKA 2YA2A 2GC4C 4MNQB 3HI5L 1N7MH 1IGCL 3KYNB 4FQ2H 2MCG1 4MCMA 1BJ8A 1YEKL 4D9QD 1AR2A 3BRDA 3A21A 4JPQA 2J2ZA 1L9SA 3F7LA 4A3GH 3ZL1A 1HHIB 2WZPA 4RAHA 2E7LA 2DICA 2J72A 1MJ7H 4HGWA 4HJUA 4NKDB 5IMKB 5JTWA 3TIEB 1KTKA 3TP8A 5I6YA 4YHYB 3W9EA 5H37A 2DW5A 2VDMH 3GSOB 3VMOA 4ZMPA 2XZAH 3F65A 1JP5A 1FSKB 2RGSA 3FQTA 1NBYA 5C6PB 2E2JH 1Q1PA 1IE4A 4RKBA 4LHUB 5CSGA 2O1AA 4JB9L 4X6BB 1IQDA 3NYKA 5KBMA 1A6XA 2BHYA 4PY7A 4ZG1A 3S5YA 1A2YA 5GGUB 1DGSA 5KNBA 3S5LA 4LF4Q 4AIZA 5C6TL 2K4AA 2KCMA 2PPFA 4KQ4L 3UGUA 3VR3A 2G60H 5C0GA 1FVCA 1I7RB 1K3RA 3QO0A 5TQ2L 35C8L 4I2XE 4N0UE 4PI0A 3AUWB 4Y9GA 4Z77B 4TQHA 4OLXH 7CGTA 3K71B 1LO3L 1ZPUA 2I9TA 4OGAC 4JAMA 4KJPD 5ICYA 4N85A 2O5YL 2QSCH 3V05A 4YUEH 4MRCA 4MBRA 2ZCKL 4MMXC 1SF3A 1CMOA 1E6JL 2XWEA 4L3CA 1ADWA 1FZJB 4LOEA 2GA4B 2B0SH 4DW2L 1DN2A 4DP4X 3B7TA 1ZT7B 1FL6A 3OKDB 5GRJL 5GGVL 5FLMH 3ORJA 4JVWA 3HOZB 1IW7D 1NGYB 4M7KH 4W9ZA 4APXB 1C5BL 2VN7A 3QNFA 1JNLL 1DLHB 1FO0L 1XO8A 2OTJA 1HKLL 2ZNWA 1IO4C 1NMCB 5CN1A 2VC2L 2ICES 3EOYG 3C6SB 3WLWD 4JCMA 1Q4NX 2PP7A 3U58A 2PMZB 4XP1L 4PJCE 2V6HA 1KLFB 4XI5C 2K7PA 1FORH 2OMXB 3BZFB 3D8MA 5C0DB 3L9BA 5D6CB 3VYTA 1H0DB 3UZQA 4QUCA 4LLUA 3BHBB 4BZ2L 5ESAB 1ZGLB 3CE1A 4K0KL 3EVQA 3ILPA 3BVZA 4M5SA 2IH1B 2VR4A 4OJCA 5JIIA 4OFYA 1A7RH 2Y6TE 2XNAB 2H3KA 4J8RB 1ZS8B 2YAQA 2GFBB 5B7EA 2AK4E 4YDVA 4PRIE 3ETBF 2UXBL 2YEQA 1FZOA 4DU9A 2ORBH 3M46A 2R0KL 3WOFA 3H54A 4U1SA 4XPBH 3CBRA 3DK2A 1SXNA 4UTAL 3PIP3 4N6RA 4XNUL 3IJ7A 1JRHH 4HJGA 4ALAC 4Z3IA 1ZWIB 2ZX7A 5DO8A 3UZEC 1N33L 4P06A 3B6YA 4FYRA 1DVQA 1HHKB 3CC5A 4CKBA 2D7NA 4CHTB 2HKFH 1WUZA 2WLHA 3CJJA 4FYQA 1CKNA 2VZSA 2Z7YA 3CHSA 1OW0C 2YQ3A 4AJWA 2X2IA 3MJWA 1WCBB 5IP4A 2RALA 4GKNB 2PO6C 4A55A 2E7HA 2YMXH 4ANKA 1Y1UA 2VLRD 2E2IB 3BLPX 2JKNA 4NW2A 1G6ZA 1YEZA 1AHWA 3I4NH 5KVMC 3NCYP 5KVEE 5KSBE 4QD2E 4FQIH 5E5MB 5IMOA 5HPMA 3T51B 2QA4A 2EIZA 2YAHA 3PGFL 3V2TA 1FL3B 4DNLA 3K5NA 3BDOA 5ALCH 5E8NA 4HPHA 4DA2A 4KBPA 4K15A 2NY4B 3MRRB 3HNTL 4KKNA 2KH2B 3QJZA 4M8VA 3QJRB 2V7NB 4B3MQ 3LXAA 2JJQA 1JNNH 2BIIA 3ATEA 1E9PA 4GY4A 3BVDB 2QKIC 4WU5A 3J81E 3L3GA 4Y5XC 3P0VL 1BW8A 2EH7H 1EIGA 3PQYD 2WGNB 4MA3B 4DVBA 5C0CB 3CH1B 1UXWA 2V8LA 4PJ5B 4AQEB 3A4EA 3P2BA 4J27A 1A1MA 4JM4L 3DTXA 5SWZA 1RODA 5DZJA 1IZ6A 5C0BB 1ZLUK 4W4NA 2PXYC 3RNQB 3V0JA 1BQHB 2C9UA 4HUCA 2FJFB 5I73B 1JIBA 1QACA 2FSEA 3MJ9L 1AQMA 1X5JA 5A16A 3HI5H 1IGCH 3K6DA 4AKPA 2DUDA 4XYOA 3A5UA 2C9AA 3DXAE 1LE5B 3FJTA 3GRGA 2EVFA 2F54E 1AD0A 2VMCA 1QZ1A 3A24A 2DBJA 3RIAK 4HFWA 1DQJB 1U3HB 3X3NA 1O7IA 2HB0A 2YRBA 3QIWD 1S7TB 2D0FA 1XFPA 4I65A 3OB8A 5EUOF 2OSLB 1DTUA 4ZMAT 2MPVA 1O75A 3FT1A 1L9NA 3PV6B 4XC3L 2Y0SG 3Q8BA 1DYZA 4CKQA 3HLKA 3SPVA 2J1WA 1J5IA 4OZFA 1FGNL 4PNYA 2V7HA 2YXVA 3NZSA 4IW4C 4XBGA 1C16A 4XN2A 4NZFA 4C54A 2ZIDA 5CINL 4L8DB 4X0KB 2EVBA 1AEXA 1GYCA 5IWAL 3MRFB 5EG6C 5C6TH 3L1EA 5IB4B 4KQ4H 5BRZD 1QE6A 4H8VA 3PCOB 35C8H 2XU9A 5TQ2H 1K8AC 3BC9A 3RL1A 4ZUJA 2RSNA 1DZ1A 4HALA 2IJ0A 3D85A 2C34A 4IHBA 5DUML 1U0LA 2BHUA 2O5YH 4POFA 5C86A 4JM2B 5DK2B 3U9PL 1IM9D 1KLGA 4ETYA 2ZCKH 5KW9H 1B8AA 1CTNA 5E7BA 1E6JH 2V5SA 1KNOB 2UUBL 3IBOA 1KJVB 3ABMB 4DW2H 1QUPA 3E80A 5GRJH 2R2BA 5GGVH 3RP1A 3E6FA 3KF8A 4JE0A 3ZSSA 4NERA 1C5BH 4MRBA 2F8XC 2W0FA 3SYOA 1JNLH 5B39B 1FO0H 5H94B 4G3YL 4F9LC 1BIIA 1YMHB 4Q0XL 1HKLH 4G2AA 3H15A 1U4FA 3HG4A 3KXFE 2VC2H 3QFJE 3AFQA 4LL9A 1H9VA 3D12B 4NPJA 3B6SA 4XP1H 1CVSC 1LT6D 4C3IH 4U0RB 4AXWB 5DUPL 1HEJC 5IW3A 5AW4B 4J5VA 4QR7A 4V190 1UB6B 4GRLD 3IKKA 2NN6G 1FYTE 4CW1B 2OEOA 2ZAIA 3GMQB 4X3TA 2G9HA 3J80c 1YO4A 2X4TB 1HUMA 1WSST 4BZ2H 5TPWL 3T0WA 5FUCC 1I4RA 5SWQA 5I8OL 3MRBA 2H26A 1U8KA 1E5ZA 3QUMB 4ETQA 4LSQL 1DUZA 2QPSA 3HAEA 2MKLC 2EVHA 1RUML 4UU9B 2JA5G 4OFVA 5HDLA 4QLWA 4YHIB 1OPGL 4UTAH 2NSMA 2OMUB 2R0KH 2NPLX 4XNUH 2A9NL 3RWEA 1Q7YC 4XN7A 5LHDA 4DV3Q 3P9MA 3HKZG 2ZCLL 5K69A 4F15B 3NJIA 2HX9A 5DYFA 5AVQB 1G9NC 4QRQA 3POHA 1UEMA 5HDOA 2L7QA 3AREA 2KHJA 4JOIA 3NVQA 4I48B 5DCCA 3LV3A 5CN3A 3FSOA 1D1KA 2QQKL 2AK4B 3KH3A 4DGVL 1X5MA 1JN6A 3OSKA 1R5IB 3LJ3A 1WRFA 2DLEA 3VXPB 1EEZB 3N52A 4WTXA 3L3OB 5I0YA 3G6JF 1VF5C 5FUCE 1OGTB 3STLA 3STZB 3CAMA 3SSGA 1AAJA 1F6FB 5E9DE 3JV6B 1GZPB 4XMTA 2X53A 3K6SA 1I75A 4NEHB 1GZQB 1NEUA 1BXVA 4DR7Q 3PGFH 3DK0A 2NQDA 2B2UC 4ZS6C 1RLBA 1J8RA 2R7EA 2Y22A 2F0NA 3NAAL 4U1KB 4Y19E 5C44B 4PJIE 2Y7SA 3QIBD 4DKDC 3RDTA 3HNTH 1PU0A 1T4KB 4GOPA 1DJXA 3T3ME 2QPUA 2Z93A 4IOIB 4KK5C 5KSBB 3TVMB 4FF2A 1WAPA 4NP5A 4PW3A 4NENB 3V55A 4P5TA 3K72A 1R75A 1ZVSA 4DV5Q 3P0VH 1NAMA 3TL5A 3T1YL 1XVSA 4DAGL 4MB1A 1E7UA 4MXVE 2B16A 1HCYA 3BSZL 3QZLA 5K39A 3VH8A 4WW2C 3SDYL 3EGXA 1P4BL 4XHJD 2OJEA 3S1RH 3LHPL 3TN2A 3FSWA 4JM4H 3L7FB 3ALWA 3KDMB 2Z1PA 3D2UD 2FUQA 3LRMA 3PV0A 4I85A 4JRYD 3BEVB 3NDYE 3F2LA 4BFNA 3U0WL 3MJ9H 2XJKA 3FAXA 1AGCA 2E4FA 4NXNQ 5LGKA 3KDFA 1JOKA 5FLXE 5IVXA 2FQFA 5TDNB 4F37F 2YTYA 2PCFA 3VSVA 5E5RB 5AOIA 3P75A 1WD8A 1I7TA 4L4VA 3PP3H 4DNRB 2PW5A 3HHMA 4EZLA 1TWGB 3DX8A 3UC2A 4EVNB 1S7WB 2BP8A 3BQUA 1JZ3A 4WUUB 5DMGD 1IZKA 3VRJA 3SKUD 3HS8A 4XT3B 6TAAA 5GAEC 3EFDL 1BD2A 3CZKA 3N1QC 4AZUA 1C8QA 2RHQB 5AKRA 3S1MH 1UWXH 4XC3H 5AVRB 5BR8L 4UAOB 2F53D 3DX6B 2YTXA 1FGNH 5MEPB 1YAZA 2MNUA 5DZLA 3T56B 3K4ZA 1FNAA 1U8QA 4PJ6A 2H8PB 2EYRB 1PV4A 5CINH 4K55A 3MJ7A 3S1NH 2BP5M 4A3FB 1UVQB 1MFAH 5HDBB 5AG9A 1EO5A 1Y1WG 1C0AA 1CQVA 4LPCA 4UUJB 2P80D 4N2NA 4XNBA 5KIXA 2SNSA 5LBSL 3QXDA 3TU6A 5E7FA 4W1TA 4ODXA 4W6XB 1L0WA 3SK8A 5LDSA 5E8EA 4KUCD 4YSTA 5F0MB 5DUMH 5GS1C 4NAQA 1DQLL 2R1YA 4OBSA 5ISZE 1QBAA 3U9PH 2ARWA 2RACA 5EIQA 1QMUA 4X4ZA 3SQOL 3AMUA 4BBWA 1CD9B 2H3NA 1OLZA 4LMQI 1C5DB 2XVBA 3BD5A 2H6PA 4RHRA 2C4FU 1P84K 4HPYL 1J87A 3B9VA 2X1QA 5J4MA 1VQJA 5BS0D 5DWUL 4G3YH 4U673 1CHPD 4HAKA 4N2MA 1ODUA 4Q0XH 4DO4A 4ZOBA 3IFOA 3K6NA 1XR9A 1F00I 3VG9B 4WEBL 4JV5L 5DUPH 3GMRA 1KB5L 4LCUA 2WNWA 4P48A 1G6PA 5AFWA 2ENPA 5BZDB 4X8JB 1GUWA 2YARA 5AD0B 2CM6A 5J8OA 4V11A 3LRKA 4ES8A 4LFBQ 4P46A 5E95B 1BFSA 1QSZA 4JBMA 3LEYL 5I1LB 1XZ0B 2HT4C 5KG9B 4MQ7B 1LEKA 2PNHA 3FKUS 1UURA 5I8OH 2AQ1B 1HHHA 2Z92B 4PJ8A 1KC8C 4U1HB 3HOXG 4WI5A 2G5BB 4LSQH 2ADGA 4JFXA 3TA3D 1E8WA 1RUMH 3OB0H 4OQTL 1EAOA 2XWJA 3FQNA 2OR7A 4AJYV 3MXPA 1OPGH 4UIMB 1JFQL 5HJGA 2VJXA 3MNDA 4JBSA 2CCZA 5CGKA 1CT8B 2A9NH 2DWDA 1FNFA 2HJKB 1UJ3C 5C07E 4XBEL 3BDYL 4FNQA 1JWMD 2B63B 1SNMA 2BVUA 5MHSE 2OXHA 4FG6D 5GRWA 4GAAA 5AOMA 2EDQA 5J06A 1BO0A 1MSPA 1HOEA 2QQKH 3KL3A 3Q22A 4RQQA 4BFGA 4XXDA 5CHNA 4FLSA 4DGVH 4JM0A 3SCMA 3L3HA 2IWFA 1D7BA 5TDOB 5HI3C 1KNEA 4L3EE 1BV8A 4X4XA 1P5UC 2BP3A 2NY7L 2LLLA 5KBKA 3PF4A 4HUXB 4KKTA 3D7PA 4V0BA 1LD9B 4MAUL 4UMSA 1ZHNB 4B9CA 4YCVA 3A6CL 3G6AA 4KOBA 5D71L 2BE5C 4POZC 1KYUA 1UUNA 2IANA 5CV7A 3ARBB 4P2RA 4CDGC 4HJ0C 3T71A 1NANI 2XY2A 2VSMB 4ZQTA 2A5HA 2F3VA 5D1XD 1PZBA 1QRKA 3DRQA 3BW9B 3HR5A 3NAAH 4LB8A 4NQEE 1YMMA 1ECZA 1K0SA 4PCYA 2Q2TA 2FZ3B 3JTTA 4QUOA 3HZVB 4HV8B 1AS8A 1X5IA 2JA6B 4AEIL 4ZW3A 5C0RH 1JJCB 3QEQE 4B3VA 4P5KB 2VJ8A 3KJ4C 1U58B 3WELA 4I7ZC 1YHBA 4LPWA 2MCPL 2ITFA 1IKNC 4E41E 1GM5A 4DAGH 2AUKA 1PKQA 2DQMA 3BSZH 1IC5L 4PJIB 2VL6A 2VDOB 3QOLA 4X42A 1S7SB 3RLSA 3SDYH 1NQBA 1NPJA 1P4BH 3LHPH 5FUZL 1GS8A 3FYIB 3G71A 2I9LB 5I15L 5C3TA 5AYTA 4ZDHA 5J89A 4X6AH 3ROLB 3DX7B 2OX5B 1TQVA 5I9QC 3U0WH 2VZAA 1HL5A 1XEDA 2QZ5A 2DQEL 3AU1B 1I8AA 1T6VN 2VZUA 3TO4C 4KWUA 4HSVA 3UEZA 3F2DA 4P4KC 2VXQA 5C6WH 5IJKA 1JWUA 3L0OA 3ZQXA 1X9RA 2IBZY 4CBVA 4DESA 1EZVY 3APMA 1NFAA 3PWPA 4D7PA 4U1IA 2NVYH 2QV2A 3F5WB 1OAYH 1FVEA 5FGSA 1Q0YL 2A69C 1BOGB 1NGXB 5CBEB 4H1LA 3DIDA 1MFEL 2WKGA 3EFDH 4PEEA 3S14H 4A3GG 2Z35A 1P16A 5KS9A 3RZOH 1RZGA 5M3FB 1JTTA 4R8NA 2YEZA 1X3EA 3S2DB 5B4MC 1CE1L 1AQHA 3M17B 4LLQA 5F9AC 2K5WA 4A3BH 1NM4A 4Y2OB 4NZUL 3V79C 3ZHNA 3FFCE 2JTDA 1KNAA 1Q82C 4YDJB 2GSGB 3BP7A 4WO4A 3FEWX 3TS0A 3FOMB 3IDJA 3TBSB 5DMKA 1D7CA 5LBSH 4MNHA 2FGZA 1SYSB 4JPVL 1ZA6B 4BBSH 3OWEA 1G5GA 3RTQA 5KJ7E 4R8IA 4YZFE 4NUJA 1YUHA 5C0XI 4GW5A 3SGDH 4LF7L 1DQLH 1ROCA 2XN9A 4UT6A 3HG2A 5PAZA 3SQOH 2OTUA 1A8JH 2BS71 4QRRB 5HVHB 1IIIA 1KG0B 4ZFFB 3QSKB 3D0VA 2WUBL 2O5JC 3EIVA 2IG2L 3WMQA 5HYSA 3UTSE 2C5CA 4QOKA 3QHFL 3L4TA 3TZVD 4HPYH 1X65A 3IETA 2VB5A 4JG5A 4DETA 1ZE3C 2P44B 4ZMTA 2WLZA 5JQIB 1KUMA 4ZX6A 5ELIA 5DWUH 4I5BA 1W72B 3GTTA 4L1TA 2NY6D 1Y1VH 4XNZC 4F8TA 4ZAIA 3KPRA 4G70B 2Z6KA 2G2NA 3L95B 1GO3E 5IK3B 1HZLA 4Y16D 4TQUS 5DJYA 3MRGA 1JXJA 2QQQA 2OA9A 3MROB 3MV7A 4ERSL 1WBYA 5FLMG 1KB5H 3V8CA 3NSXA 1G7HA 1TO4A 5B1JA 3CMEA 1EPFA 5AJ3Q 1YNTB 3KMDA 3S36X 4LSDA 4NP4L 3CXHK 3MRHB 4OCLC 1PZJD 3LEYH 4L0ZA 3T04D 1PZ2A 4HJAA 2EXZA 1AOHA 1ZOXA 4Y1AA 3O8XA 5J5EA 2WPGA 3TWCL 1MCCA 3LZOA 4KXDA 1JZHA 2A9CA 2AP2A 4G8EB 4OQTH 1ZXQA 2ATAA 4E9XA 3WS6C 1CU4L 3WXWL 4UOZA 3G5XA 2TSAA 1XPOA 1JFQH 2VSDA 4WY7L 5F8QC 5BO0D 5L2KA 3OC5A 3CSBA 1JPSL 2KL6A 1WJJA 3KFUA 3BDYH 4FFYA 1BZ9A 2C26A 4CVZB 1Y6NR 3LKRB 4WGVB 5KSBF 1SF5A 2IGTA 2R0WL 3CLEL 4LLDA 3U1SL 4YCUA 3ISWA 3CCEA 3TTSA 5T3XE 5DNFA 4IPGA 2OBGA 3MXWL 1GTFA 2A6KB 2VR7A 2V0AA 5EZIL 4R8WL 4AQ1A 2BCMA 1PW3A 4YVUA 3MJGX 3EF7A 1GYWA 4EZJA 2NY7H 2DRUA 3FOLB 2DLFL 1NMFA 3HOYH 1WFNA 3F04A 4FULA 4NO5B 4OQ1A 3EA6A 4Z7OE 2ZXPA 4MAUH 4Y4FD 4EZKA 4DK3C 3A6CH 5D71H 2CHZA 1ESFA 3V5KB 2QJDA 4LLWB 5GHWL 5DMYA 1OVZA 1AIFA 4K6LA 1K5WA 3EYOB 3U6XS 2WKOF 5JPNC 2XOTA 3FN0L 3L4UA 4HA1A 3ARFC 3I4NG 3VR6A 2IPUG 1RZIB 2XXGA 3BPLB 3J8F7 4LASL 5TJWK 5HHQB 4IBUA 2F6AA 4AEIH 4PRPB 4QIWB 1WAEA 2DJUA 2FIKA 2WVVB 5DJDA 2H0PA 4AYID 2MCPH 4X7CC 1IGYB 4J6HA 3B9EA 3H42L 3SY0B 3V4PL 5D7IA 3TNNB 2QGBA 3A3YB 2R2EB 4H7BA 1IC5H 1MFCL 1N19A 3RL2A 4PG3A 4KXCA 5CP3A 3WJJA 3DX9A 3UCRA 2X4QA 1CFTB 4NKOA 5FUZH 2XT1B 2GITA 3VI3B 5I15H 2F7IA 5DSCA 3HE7C 3VD4A 1F97A 5A6MA 3QEQB 3RFZA 2H9GB 2L0CA 3KLQA 2FJSA 1UH2A 1AZUA 2DQEH 1X56A 3FO2B 4WFHD 3S34L 2Z8WC 4A7SA 4NPYB 4L6TB 3CC1A 4FQHB 3VCLA 1IJNA 5C2UB 3U9SA 2EE6A 3IJHA 1PAZA 3QUZA 1AGDB 2Y0SB 3EHBB 2ARJQ 3TBCA 4WHTA 1KZQA 1ES0A 1PNCA 2XPZA 3OW7A 4RCNA 4MS8C 4WCYL 4A37A 1KTLB 3HJ0A 1Q0YH 3O6FD 1VQNA 2Z8RA 3QNZA 4LFCQ 4PW4A 4GKSB 4JJ5B 1MFEH 1BCPB 4YNYB 4B50A 1BBDL 1TYJA 4PR5A 5I18H 3Q2WA 4I18B 4X8CA 3QCTL 3AM8C 3CZGA 1CE1H 2XG4A 2FWSA 4Y1TA 3ZKMD 2FO4A 5EEYA 4GUOA 3NPSB 4GEIA 4D0DA 1TZIA 5C0EA 4NZUH 3T0DA 5KSUB 3SXHA 4YHKL 3VXSB 2ZYRA 5FR3A 1EY8A 3SE3C 5IZ7A 5LMNL 1AP2B 3WHXA 3Q9PA 4PN6A 4UNIA 2MPAL 2IFGA 5EC2B 3BFOA 4IJ3C 4YXKL 2G0LA 1K6QL 2VM3A 4JG1L 4JPVH 5K59E 4AH2A 5FFLA 2Q3XA 4GBXC 4N2IA 4PIBA 4J3OC 1GS6X 2Z64C 5I76A 1KJ2A 4Y4KA 4GP5B 3VWJD 4BXSV 1V8QA 5I9QB 1M4KA 3WFCL 4DKTA 4FA7B 5I71C 1TTCA 4BKSC 5AVSB 2WUBH 2ENBA 1T80A 1W2BA 4CGYB 2IG2H 3BH4A 1HNWL 3QHFH 3SB3A 3GLZA 2FT8A 1TT2A 5DXWA 4JDZA 5J6HA 1PZKD 5D7LA 1HINL 1X7QA 4G9FB 3DO7A 4P9ML 2EIKB 4DHLA 4EPSA 3Q8AA 2E76C 4ZAKD 3TA4D 1FP5A 1VQOA 2BLFA 2ZOTA 3ECVA 3G04A 3G5YA 4PBXA 4QHKJ 1IRAY 3F7RA 3HEIB 3MBED 4JQXC 5T3ZL 4ERSH 1A66A 1L6PA 1T5KA 3OF6A 1TJGL 4IQHA 3VM5A 5E2VL 4E5XA 2CUHA 2E7DA 3N43B 4QB4A 3OM3B 4NP4H 4A04A 3D9AL 1FGUA 3MRQA 2JA5B 3T0BA 2EEAA 4ZMOA 4G71B 4NBYB 2NYKA 4C3IG 2XWXA 2C1PA 1JD9A 3HKZB 3TWCH 3IEAA 1X4XA 2AQSA 1NOLA 1T89C 3MACL 1GC1C 3WUWG 5DC0A 1CU4H 3WXWH 3GJEB 4KN7C 3FB6A 4WY7H 1UD6A 1L9RA 4AG4L 4C56D 3RLFA 2GT9B 4QNPF 1JPSH 4KH9A 3LZNA 2Q5BA 4O1NA 3RWGB 4W9HC 1LTRD 2AXHA 3QJHB 4NKMB 5DHVB 2ED8A 1IL1A 1B3QA 1M1SA 3LXBA 4RGNC 2V2TB 2JKRM 1BHGA 2R0WH 3CLEH 1UXSA 3U1SH 3BP5B 4GI9A 4HHWA 3ZT6A 4JFPA 4JI3L 1QI5A 1ACCA 4A3JH 1ETZA 1OV8A 4WTZG 3WL9B 1S9YB 2QADC 1PYWD 4N0YL 3MXWH 4FF9A 5K1NA 2JELL 4LSVL 3MC0A 4OF0A 4R8WH 3FFDA 5EZIH 32C2B 2LV4A 3TZUA 4PJIF 4PJBB 1S4IA 1EU4A 2DLFH 1U3YA 3BD4A 3NCBB 3UTTD 4OBRA 1ROWA 1ZHLA 4BFBD 1QLEL 2Y6SD 4Z95H 5GHWH 1ULVA 3OXRA 1SDDA 4RG1A 1TCMA 1KJMA 3QDMD 4FX5A 4IOSD 1GJUA 4NT6B 2O6EA 3FN0H 4TULL 5F9OL 1ORSB 4GAYB 4NRZB 4MXVF 5FOBB 3E3XA 3CCQA 3KG5A 5ITFA 4LASH 3S24A 4XVTL 1EO7A 1TWFH 1BIHA 2MCAA 3ATFA 2ZJPA 3HRPA 3PWJB 3L5IA 2DEXX 4RGNE 3FCSA 5D14A 1P9MA 3D06A 3ABZA 3V4PH 1LT5D 3H42H 1S3KL 3L1FA 4HUWB 3BUPA 4AYMC 1RP9A 1MFCH 1PZUB 1XMOQ 2VR9A 2R27A 1A7BA 1RTOA 3PHQA 3GSRA 4AQ8A 2LFEA 4HIEB 1CLVA 4XVUD 2NQ3A 4HZ1A 1IM3B 3IF1A 4ZZKA 4AVHA 5DJ6A 2LY7A 2UWEE 5D4IA 4ZMWA 3B7YA 5IT9L 4IFDJ 1UZ6E 1DEEB 5KAQF 3SDDD 1A9BA 3TCLB 4EI0A 4ZUWA 3S34H 4KXAA 3KLAB 3CCLA 2K5DA 1J5OL 4M1CD 4WW2F 3GSVA 4TXVB 4AGNA 4R4CA 3CSTA 3MNWA 3VD7A 4MJIB 1J11A 5I1EL 4PJDA 1EFQA 4LLYA 5DJZA 4R3SA 1RPUA 2R69L 4WCYH 1WD1A 2YPKB 4JGMA 4KO6A 4I1PA 5FDWA 5H37H 2PLTA 1IARB 1Y1WB 1NEZA 1BBDH 5F7LB 3MA9L 2UU9Q 2H1PL 3NBIA 2OLDA 1AQDB 2UZYA 3QCTH 2VS1A 4LCIL 3MWYW 3J80i 2WLYA 1XGQA 2W1NA 1FFQA 1FNEB 3JQOB 4QRUA 9CGTA 3QPQC 1O7SA 2YD3A 5JO5B 4OJDH 3P4OB 4YHKH 4PRAA 2R9HD 5JDJA 3PGCB 4N26A 4FG0A 2Y7MA 1R9TH 4OO1H 2MPAH 2NUTB 4MCZA 4BV1A 5D1ZB 3LQAL 2L1BA 3NZ8A 4UNUA 2RCSL 4YXKH 3KS0J 1K6QH 4JG1H 3EGDA 4JI4Q 1T7YA 1YDPA 1YNTF 5HY9A 4K8JA 1H3PL 1Y07A 1ZS2A 4HS6B 3SYPA 3H6AA 4ZO6A 4CMMB 3OKEB 4G6KL 3WFCH 5K1VA 2QL1A 4Q89A 4I0PB 4XCEA 3RFRA 5HHVL 1WHPA 1V5JA 3LYRA 4BFIB 1JI2A 3U30B 1I6VC 4HIPA 4JFOB 2EEXA 4AEHL 2XKNA 2AHIA 4JL1A 4FEIA 1HINH 4LL4A 4HIQA 5G4OA 3DUSB 3K6FA 3SD2A 3HI1B 4P9MH 4TTDD 3KAAA 5AB2A 2EXTA 2JTYA 1LJMA 1VQPA 5FB8B 3EGSB 4XCFL 5T3ZH 1D6EC 1W3SA 1I4XA 3DBXA 1ET8A 3VTAA 3VRIA 4C83B 2G3ZA 1TJGH 4G42B 2L12A 1CR9L 5E2VH 2Z34A 3VXMA 4IBSA 3RGVA 3D9AH 2GSMB 3JVGC 3V7MA 5FWQA 4HG4K 2DLTA 1NKOA 3S37X 1WGOA 1R47A 2D7PA 3OSVA 5E4EC 1TR5A 2CZNA 3EFFB 3D25A 3IPEA 4DT2A 3QRLA 2XZQL 3C2AL 1WAAE 2CQVA 1HJBC 3QZWG 2VLRA 4JFFD 4FG4A 4GW1B 2YPLD 4I13B 4GUPB 4CC1A 3RUGE 2NZOA 1NDGB 1C08A 4LIQL 3SGKA 2EVIA 3MACH 4ELKB 1MVUA 1XGTA 4O02L 5IWLC 3G6EA 3BO8A 4AG4H 4AC4A 5GIRA 3QUYC 5DGRA 5I71B 1EUTA 4M1GL 2GTZA 1GUTA 1P4LB 3FK3A 4MSWA 1YNKL 4IUTA 4FQCL 4KDTA 2EDLA 2XRQD 1A0QL 4MHEA 4K6DA 2NY3C 4JPIB 3MCKA 2X5PA 3QUGA 4PJEB 3C75A 4DNTB 2MQGA 4ZUUB 4PS4L 1YY8B 1PX3A 1GHJA 3NEMA 4N0YH 4YFLF 4GAGL 2JELH 1JPFA 4LSVH 3GD1C 4J3TA 2BWDA 3GSNA 4JI1L 1EFXD 2V2WB 4ZMQA 2VQEQ 1R46A 1D5ZC 2AMCB 1MWAB 4L8BB 1QLEH 3WY2A 2GYSA 3AXIA 3ZRSA 1VFAA 1LO5A 3CFJA 3RU8L 3OKYA 1WBXB 5F9OH 2H4EA 4IIQA 5M5YH 3IGUA 2AQPA 3LSOB 3M4OB 2NVXH 3UIYA 4XVTH 4EI6B 4YWMA 2W38A 4PJ9D 3BVGA 4EIBA 4JZOB 1NNXA 1RH8A 5C2BL 1JJ2A 2WAQG 4A75A 2WBJD 2IBBA 2ZTBA 1S3KH 3NFSL 2HRPL 3U4EA 2BIQA 1EQQA 3CV5A 3QIWA 3V95A 2UY6A 3PO3H 1NAML 2K6WA 1EHXA 3KPMB 1BCPF 2CKBA 4CJ0B 3PGDA 3V6ZA 3K57A 4UV4L 3PRZA 4Z7IA 3IMWA 1X5FA 3NJNA 2AJZB 1DN0B 1O6SA 2ZXBA 4TLKA 1KDCA 1QFOA 2QADB 4P23D 1O7YA 2RDFA 1KGWA 3EBAA 1AS7A 3EG9A 2D2CC 1X54A 2HXAA 3CMGA 1EU3A 1S7UB 1BKBA 3A22A 2I60L 3AC0A 5JPMA 1J5OH 4A3GB 4KMTL 1TQBC 1SBBA 3DECA 2Z3FA 3QVAA 4GQRA 4UZGA 5I1EH 3PWNB 1HCVA 2R4SL 4YOKA 2PYED 2R69H 2Y69B 4FQ1L 2AXGA 3I9PA 3T6WA 1OANA 5C08D 2B2YC 4A2LA 2KOLA 1ERNA 2MQCA 2GJJA 1R9FA 4A93B 2VW7A 4FXLA 2BRQA 4BY1H 1IM9A 2WQ8A 2H1PH 2WQXA 1OLLA 1FV1B 2E2JB 2XV6B 3QQDB 4IK7A 4PJFA 1H3TA 5LN4A 2AXFA 4EUPA 4LCIH 4NNXA 4JY4B 4QKTA 3H0TB 4JPSA 3P3TA 2OQJB 4OZFH 4YZFF 4D0CB 4ISVA 2E86A 1T0OA 5KYNA 3P4NB 1PZDA 4I1RA 2QVFB 4AIXA 3IRZA 1CI5A 4QMGA 4DOHE 5CFAA 3TEYA 3P0YL 1KYDA 1VEMA 3OKLA 3LQAH 5LQBL 4JO4L 4DP8X 4DR2L 2EE3A 3G9VA 4BH8B 4H5SA 3F8TA 2WINA 5EA0L 1RJYA 1WZLA 4A3BG 1CDHA 5GGVY 2ATPB 3WE6A 1H3PH 2EAEA 1JHKL 2IBZX 4AYFB 2X1OA 4G6KH 4R4IA 4GRLA 4N2OA 5E9AA 1MHPL 4P2OC 4P3DA 2VLJD 3GMLB 1ZSDB 1NANH 3MGOB 4BBSG 4AEHH 5CKAA 3P0GB 2OMTA 4E36A 1N32L 3THML 4N2AA 1LM0A 2N59A 1U4EA 1NICA 3KD4A 3SPIA 4ZYKB 4DV4L 3O3AA 2ROXA 5IREA 4O9HL 1TPXC 3NSFA 4LNVA 1HVXA 5DO2C 2ICWI 3UJIL 5DJ0B 4ADIA 4NB7A 3KJOA 4XCFH 1EVUA 4HZLB 3N44F 1BQUA 3EYUL 1YAIA 2AVFA 3R4RA 4H7VA 3FONA 4MHHG 1GVIA 3N04A 2J0TD 5IQ9B 3VFOB 4YSAA 1KXHA 4HKJA 2OMVB 1Y1VG 2P42B 4YE0A 3RKPA 3SDCC 5I17A 3GTPH 3QJXA 2L7UA 3B9KC 3P3UA 1VACB 1X9QA 5EC1B 5T1KD 3TS8A 3I70A 5JA9A 1SY6A 3INUL 2XZQH 3C2AH 3OC8A 3OLGA 3ZKND 2HDMA 1T3FB 5F2FA 4JANA 5EOTA 2IQAB 4LAAA 1KYOJ 2ARJA 3D6GA 1UWFA 3IDUA 4C3HH 4LIQH 3ISRA 5DT1L 5I8EB 3HAEH 1JYNA 4O02H 3UTZB 2A6HD 2W81C 3WTXA 2NZIA 3CBJB 4O2CB 4YXHL 5B38A 3QQ4B 5GJSL 2KCNA 3I8ZA 4LU5L 3ZMEA 1E65A 4M1GH 4FERA 4UT7L 3CFMA 3SBWC 1YNNC 2VITA 1YNKH 2VLKD 2H45A 4I77H 2NXZD 4KD4A 3RN2A 4Z7OF 4ZMXA 5EKKA 4L3AA 1NPUA 1A0QH 2ZKXA 3RUGB 4OM1L 2Z91B 3BCDA 3WHE1 4PS4H 1L3NA 5D65A 1T2JA 3KVPA 1G7MA 2TRYA 4GAGH 3GIVB 5CJXA 4NQXA 4LF4L 3FCTA 1NCTA 3I4NB 2VIRB 5IMLA 2EO7A 3W0WE 1MCNA 3W9DB 2VABA 1G9HA 1I9RL 2N0MA 2DQHL 4G59C 1WBZA 4AGLA 4YHNB 5DK0A 1MFMA 1R3LA 4OZHA 12E8L 5C09D 5D7JC 5HTSA 1EIBA 4GAJL 3RU8H 3QDJE 3D2UA 4PP1D 5FFOA 4YSRA 4JMXA 1M3IA 5J12B 4JG0L 3HOYG 4CADA 5C0XH 2BSRB 4BFEA 3ARFD 4GB9A 2QDVA 4LSTL 1K2DB 1JHLL 2WLLA 1ZVYA 3BN9D 3WLBB 3ZTCC 2XWTB 4TVSa 5C2BH 1ZYRC 5A2IH 4WTQA 3VFRB 3PNWA 3NFSH 1IFGA 2HRPH 1KPUB 3QIUB 5GQOA 4PJGE 4OFKA 3BZ4A 2DH3A 1PMYA 1IYJB 4R7NB 3TASA 4GT7A 4CJ1B 1NAMH 5E8PA 4U1JB 4UDUA 2VJ0A 4R5VA 4U6VL 1FFOA 4Y2DB 4UV4H 2VAAB 1PJ9A 2WB1B 4X62Q 2CIKB 1IEBB 2KHSA 4X3SA 2WWKO 4JFDB 2W9DL 3QCUL 5FK9C 4PP2B 4L8CA 5BO1L 2ASBA 5E4XA 4GRMA 4L5FL 1OK0A 1FVDA 1I8IA 3AY4C 4NPSA 4RZCA 1RCYA 5IYCH 5E6YA 5JXEC 2P8MB 5D7KE 5I0VA 1M7XA 3P2TA 2I60H 1R5VB 4KMTH 3BKYL 5SX5K 2VXQL 1JVOA 1U8IA 2N3JA 3MJ8A 2P80A 2OYKA 3HBPA 4KI0A 4M61B 2R4SH 3FCGA 3EJTA 1NMGA 2WVSA 3RI5K 4CDEC 2UX6A 4FQ1H 2NX5D 2CPCA 3NRQA 4NC2B 2VDQL 4QO1B 3TH3T 3VMPA 2CE6A 4NZRL 4HX1A 5CLWA 4IM8A 1O78A 2ESVB 4IPDA 1AYRA 2F7QA 3AGVA 1HJPA 4DGYL 4QXUL 2BFGA 5DJCB 1IKMA 2VNUD 1BYPA 1KTDB 1WTGT 3N41B 4OXPA 3HN3A 1UWEL 3AS3A 3MFFA 1VQBA 3ILDA 3VFVB 1KBPA 2K75A 3BAXA 1KLUB 4KI5C 1KYAA 2AANA 4FKKA 1OD9A 7PCYA 5BS0A 3DM1A 3P0YH 5C0FB 5F6IC 3FL7A 4JO4H 1JV2A 4WDIB 5LQBH 2EZ0D 4FTVD 1GGTA 3FKIH 2ZUVA 3Q3GA 4PGEB 5DJAB 5EZLB 5DGQA 3NK9A 1K5NA 1NFDA 5EA0H 3L3DB 3UPRB 2IV9A 3L4XA 3DKHA 1MI5D 3AS0A 5GS2D 1HCZA 1P84J 4ZO8A 4Z78A 1XB8A 5EKLA 1JHKH 2EJ1A 4ZW6A 3AXLB 1T20A 1F56A 1MHPH 5DAUA 5FO9A 4UT6L 2BZCA 2JJUA 2QTVA 3RX9A 2VUMH 5DWPA 3FU6A 4F7MB 1ZCRA 2YLKA 3IU3B 5JEAH 1NDTA 4R4FL 2Y4SA 2EXWC 3MGTA 4ODUB 3THMH 2QGQA 3DX3A 4B3ML 1WVLA 1FO0B 1YJ9A 3D3VD 3DVNB 4J3OF 2XXMB 1RIVL 2VL5A 3TA3A 2DPKA 3P9LB 4O9HH 4WI4A 2VYRE 1JJGA 4U1MB 2VC2B 3UJIH 1D5XA 4KI5E 1QRNB 4OF8A 2EYHA 3TF7C 3EYUH 4C3IB 1OB1A 1QOHA 3ZDYB 1JPST 5F7DB 4O51A 2OMWB 4TQIA 3T4AA 3E7JA 3R06A 4PJEF 1IB5A 3WUWB 4BE5A 3NSDA 4NZ8A 5EOQL 4HP5A 1KGIA 3T1WA 5IVZA 5E8OA 4HWBA 3W5OA 2EKSA 3INUH 3BP4B 2FNWA 4LOUC 5ELOA 5CGTA 1NJ9B 4HEME 3JZYA 4MD0B 2WTRA 5DT1H 2QEJC 1IAII 2WLIB 1FJ1B 2WXQA 3BCFA 2KQ3A 1XH2A 4HBQA 4JN2A 1MG2C 2GIYA 4N4YB 2YEVB 3EJZD 5EO0A 4BKLB 5A7BA 1VQ8A 2E9JA 4DAPA 3C60B 5I74C 4YSCA 5FXCH 4YXHH 5GJSH 3AGWA 4YR6B 3QJFB 4LU5H 2HUGA 43C9A 3VO0A 4Z0XB 1HESA 4UT7H 4Y4HD 2O6PA 5D1XA 1AYOA 3CFBB 3HBZA 5HP5A 5CV4A 3IXAB 4FFYL 3H9HA 4OM1H 3V6OA 1E0BA 4W9GC 2KZKA 4BA2I 4WNQA 1RIPA 1TVXA 5E6IC 3QG6A 4DK6C 1X4YA 5GRUL 3WEMA 2BY1A 1TPXB 4RA0C 4IU2A 2RDGA 2ZSWA 2F0IA 2PABA 2CK2A 4QT5A 1RI8A 4QRSB 1I9RH 1NC4A 2NR6C 4FJZA 1W91A 3EDDA 3FTGB 4A3JG 1NZRA 1Q9LA 4RVBA 3IGAB 12E8H 5DFAA 4UQ2B 2VXWA 2YXWA 5D5ME 1F6AB 4GAJH 5I6MA 4G8GB 5IMMB 2X41A 4Z7VE 3KPSB 4JG0H 3UMTA 1FA4A 5E1AB 4NUMA 3AADB 1QFPA 3DYMA 2OTPA 4YDMA 2AQ3B 3MV8D 1BAWA 3O4LD 3T13A 3OR6B 4LSTH 1AH1A 1JHLH 3FT9A 3UMNA 3ZJAA 1EEID 3P77B 1WIOA 3LRSA 1KQSA 1UADC 2BOBA 2EILB 4LCYA 4GH7B 3QQ3B 1KGXA 4RBPK 3ZPDA 4AZ8A 1MRDL 1VRSA 3MU3A 4J23A 5JMOC 4HW6A 1F2ZA 2EXYC 2NZ1D 4RWSC 4OLUL 4U6VH 4AL8L 3S1RB 3JSSA 3NMEA 5ICXB 3VD0A 5SWSD 4RKLA 5I75C 3VFMB 2W9DH 1T5XA 3QCUH 43CAB 5C9KA 5BO1H 2JP1A 2D3NA 4L5FH 5GRYA 3HG1D 2EY6A 4FYSA 4HH8A 3WI9A 4B9FA 1T1ZB 4QRPE 5AL0A 4XBPA 1FIGL 1T5EA 3IJYB 4XXCC 1LEIA 4LVHC 1MSHA 4PRNB 4C3JH 3BP6A 3BKYH 2NW3A 2VXQH 2PR4L 4FJ6A 4BGDA 3S0PA 3MREA 3OKNB 2KECA 4WIQA 4PJCA 3EFOB 4BK4A 2N01B 3VGAB 2QQNL 4KRPB 2VDQH 3D18A 4GLVB 1YEIL 3JV4B 4BK5C 2D62A 1CE6B 4U1NA 3OGOE 4NZRH 5EV7A 4Z7AA 2QR0B 3VQMA 4WHCA 4P04A 2LHAA 4H1LH 4YY3Q 2WXKA 4E6IA 3S1MB 3KVDD 4GKOA 4F2ME 3BYYB 4DGYH 4FF4A 3HKSA 4QXUH 4DV3L 5HYFA 8FABA 4K7FB 3VQ2C 4RH4A 2EIBA 4QDGA 2FL5B 4DWHA 2YGVA 3DOIA 4EN3C 3S1NB 1UWEH 1NCVA 5I66B 5ID0A 3FO1B 4I9WD 2BW5A 4PGBB 5H37G 3RVTC 2PZWA