5JPMC

Structure of the complex of human complement c4 with masp-2 rebuilt using imdff
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpmC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpmC01
5FO7B 2TMPA 2XWJB 1BQQT 1XWEA 3KLSA 3OHXC 3CKIB 4D94A 1BV8A 1EDYA 4ILWA 2QKIC 5JPMC 3G6JB 3FRPB 1OO9B 1AYOA 2WIIB 1UAPA 1UEAB 4FXKC 1JC7A 3L3OC 4LNVA 2PN5A 3CU7A 3HS0C 5FO9B 3I70A 1D2BA 3T4AC 5FO8B 1GXDC 2A74C 3MA2B 2A73B 2XWBB 3HRZC 2ICEC 1JB3A 2I07B 1BR9A 1PXUA 2E2DC 2J0TD 2WINB 1BUVT 3V96A 5FOBB 2B39A 4FXGC 5JPNC
chains in the Genus database with same CATH superfamily
3TEWA 3PUZA 4LLYA 4MZ3A 5F7WC 1COBA 4CU7A 3DPBB 3K0YA 3NN8A 2CM5A 3QJSB 3A74A 1A1MB 1EAQA 2VYRE 1EEYA 1JUFA 4BFEA 4Z7OF 5AUMA 4Z7VB 1B0GB 4C3HH 1L1OA 2CBOA 4I3SH 3UGUA 2DTMH 2B2TA 2NR6C 3FQNB 4G5ZH 4CJ1B 4S1DC 5T5NG 3RJOA 3BZKA 3CCMA 2K4WA 3TYGL 4HS8L 5CEYB 1AP0A 3C2SA 1XGQB 4MAYD 3X3GH 4OI7A 2K45A 4HOMA 5B21A 2DEXX 3QNZB 4CRPA 2WINB 4KUCD 5F89A 1T5EA 4PNYA 3MRFB 2R7EA 1UKQA 2OA9A 4LOFA 1RZ7H 3UTPD 1L6XA 3QXWA 2R8SL 2ESVA 1MKFA 1TVBB 2X1PA 4IJTA 2XIBA 2W60A 3HZMA 5IJVB 5IB2B 1IBBA 1IC5L 2PCXA 1KJVA 1KTKA 1SROA 4O42A 4FC3E 3RB7A 2I9TA 2ZUQC 3RL1A 2C5CA 4X64L 1PZKD 3T5WA 5JOPE 3H2WA 5D7JC 1CURA 2Y2YA 1CDJA 1MWAB 4MAYB 1MXGA 4LLQB 3MTRA 2OMTA 3GS7A 3MUY1 5F44A 3ZXAC 1FDLH 2C3GA 2UWEE 2X2HA 4ZFOA 5M3MH 5D96C 2EJ1A 3GMRB 4DV0L 5EC2A 3HOVB 3QW9A 3SKNB 1SDAB 1G87A 3LH9A 2I26N 3PABA 4X99B 1JZEA 2GCYB 2X12A 3Q3GB 1MKHA 1G7JB 2YMXL 4CKQA 3KVDD 3IF1B 2UZXA 2ZCKL 4L0YA 4KY5A 4MA7L 4JKNA 3OR7A 3T2NL 4DN3L 2P43B 5B8CA 1BZ7B 2L4OA 2X09A 4X6CE 2WXMA 1NGPH 1UT9A 3UJTH 3PHQB 3SJVA 4ZAKA 4C56D 4UDUA 2WAQE 3ARTA 2CWPA 3OMGA 1P6WA 3COOA 3MYJB 4R5XA 4Y4KA 4LLVA 1DLFH 4RFOH 1YN6B 2IGFH 4ZO8A 1UXSB 3UDFA 1YY9D 2CZNA 3PRZA 2FT8A 2BDNH 2Y5EA 2XVGA 4ANWA 1TWCB 1EHLL 4F8PA 1HDMB 4RISL 2IL8A 3U7WL 2DYSB 2EUXA 4BELD 4X7FC 3KLRA 3FPYA 4GRWF 1R5VA 2MCPH 5DURD 5TDOB 1OZTG 3LPWA 1KBGH 3B8SA 5BRQA 3ZR5A 4OCLC 1Q90A 2OCEA 3QXDA 4UNUA 2NY1D 3QDJD 2X4RB 3W82A 1D9KA 4YLQT 2E7HA 3VFOA 1HAUA 1FJGL 4NJ9L 4KZDL 1KFAH 1H8SA 4DXGA 1UCBL 2ED9A 4JHZA 3SDDC 2I85A 4BDVA 3A47A 1U4RA 2IBBA 1D5IH 2VLRA 2VMEA 5F3FA 3FCBA 3RL2B 4KDWA 1U8NB 3QIBB 3SGEH 2JN4A 3ZKQD 1S9XA 1YMMD 2VDQL 2VLME 3Q23A 4R8WH 4ZFOL 1P69B 25C8L 4ZMQA 4WV1C 3RIAK 1OAUL 3VJ6B 3FO9B 5FX3A 2H8PA 5KJ7E 3VYUA 4ACPA 5AVWB 1YNLH 1HU8A 4KRPD 4TPRL 1V1PA 1JJUA 1ZVYA 2BP8B 4LF6L 5MI0C 4YHZH 3QDJB 1U93A 1BZ9A 1AGEB 3SQBA 4MXQC 2A6HC 1VQFA 4JI5Q 1RJZB 4MKMA 5LKNA 3HZVB 4HOWA 1HEZB 4HIMA 1N34L 2GSGB 3CBJB 3GEWB 3JBG7 3ZHDA 3BE1H 2H45A 4C59B 4PTTA 3B6YA 5E4EC 5I1KH 1YMMB 3OAUL 4PJEB 4XP9H 4KMLB 4N2NA 3GDCA 4QHKI 3MRLA 4MB1A 2WLIA 3KYKH 1XNQL 2CXGA 4ELDA 4HIPA 4UWQB 1NGYB 4XNAA 3ZZLA 4KRPB 4HUXA 4ODSH 3GJFA 5SWSD 2IOIA 1J8SA 1F6LL 1OK0A 4F2MB 3WMSA 5DJ2B 4KMQA 2YC1B 1EY9A 2AJVH 3ZO0A 3L5XH 4L8DA 5MEOA 2WQXA 3ND8A 1N2RB 1KPUB 4XCCL 2GTZA 5C0GB 3I2CH 3FQRB 4GO6B 2EVJA 4P2OD 1F86A 1QEXA 2KL6A 3CFKB 3VX0A 4NZTH 4JGJA 3TXAA 2FR4A 4GH7B 1ZIAA 1KV3A 3L08A 1AY1L 2KJXA 2H0PA 4PJDB 1TZGL 4FYTA 5CBEE 3IRCA 4EI6B 5EULV 1B4JH 4H8WC 5GS0L 1EYDA 2BSTB 3SO3C 5SX4H 4O02L 4RRPG 2PYKA 1MFAH 3M4OB 1RHHB 2BZCA 4CC4C 1PSKL 1EANA 3NAAH 4N5EC 3N6YA 1UB5A 1N32Q 4P2OB 5J5EA 1B1ZA 1MY5A 2H1PH 2M26A 5CLXA 2OULB 1SQ2N 5JA9A 1A3RH 5CN1A 4PJCA 2Z93B 4MA3B 5I1IH 5IF0A 2B3RA 1GSKA 1A0IA 3QOJA 3C60C 1OGAE 3HBZA 4LP4A 3BW9B 3FMGL 2ZCLL 1KF9B 1DQMH 2XX1A 3WS6A 5CR3A 2AJSH 2N56A 3ZY7A 2P5WB 3POCA 4X4KA 4HJ7A 1DQKA 2JJTC 4HIEA 1S3KL 3KPOB 4X5WA 4PS4H 3UIZA 3RWFB 1J8HA 5ACZA 3MGAA 2D9QB 5CINH 3EJYD 4YLCA 3K8LA 3FSVA 4HHGA 4M7JL 4NZDA 3PWJB 4Y8DC 4BY7H 3ZE1E 2R92B 1FN4A 3FF8A 3EJTA 3T65B 5LXGL 5EU3A 1WYJA 4FF4A 4DK3A 1VQPA 4OLVL 2F0GA 5IW1A 2ZAHA 3AACA 3GC3A 1MUJB 3PIQA 3NJXA 4L8CB 3BWSA 3KCWA 4FFVC 1BD2A 3ARZA 4FI8A 4FQIL 4JG0H 2F7IA 5E5LA 2N78A 5KSBF 2PWFA 4OJDH 1JZIA 2DQ6A 4ZMLA 1R5WB 4ZTOL 1A1OB 1RZKL 5C44B 1L9OA 3ZT6A 4PGBB 4TSCL 4P07A 4U1GB 3QG1A 1PH4A 4NLHA 4PI2A 2P9RA 1TWGH 3V8OA 5KVEL 2KCNA 5EEYA 2RSNA 1B0IA 1LE9B 4U1JB 1I6HB 1JNHB 4YBQC 4YSOA 1IX2A 1KPRA 5E6IB 3DIDA 4YGVA 2QSCL 3ALXA 4JI6L 3GT6A 4DUXA 2D3NA 4IK6A 2MPVA 3KWVA 4CGUB 4BKLB 1PZJD 4XE5B 2XPGB 2YQGA 1H9VA 4LKCA 3GTQH 2OMYA 1AO7E 1ZXTA 2F58H 3WKMH 1C48A 4OF7A 3BP5B 2F5AL 1B9ZA 2X4PA 4YPJA 4JVWA 5ESAB 3UAFA 2EQSA 3BZFB 3EFFA 2N49A 1CPUA 1ES0A 5JPMC 2Q7AA 1GAFL 1MIML 1Z5YD 3T0ED 4X80L 3TN2A 3L9BA 1MREL 4ZS7H 3ZE2B 2ID0A 3OWEA 4GIAA 4JB9H 3ER0A 4FD0A 1NLBL 4BIKA 4F1ZA 2G2PA 1GC1L 3PG2A 4JM4L 3RKDC 4B27A 1J88A 1FCCA 2XY1A 3DIVA 5GSVA 1GD7A 5IQ7L 2AS5M 1K8OA 1EJOL 4LHUG 4XPBH 1CM9A 1UB6A 2C9VA 2CKBB 1S7TB 2NZHA 3EYOB 1K4CA 3MLPA 2A77L 5HDBB 2KHJA 3J7AV 2W92A 3GD1C 3NIGE 1IC1A 5I6MA 3FNKA 2B59A 3DVFA 3TZVB 1PRTD 2BSSA 4G3YH 3T0EB 3T8MA 4CVXB 1S8DB 2VL5A 4EIBA 1XD0A 5IODA 4PG2A 1DXMA 4MCYB 3VA7A 2X9YA 5EO0A 4KZ0A 5DRNA 3DV6B 5HHVL 3VXUD 1EZ6A 2QR0B 2X89D 2XWXA 3LWUA 1A7NH 1DQJB 3QJRB 4RVBA 1JP5A 1O7DE 1MHEA 5T5NF 4L5TA 3IDNB 1ORSA 1YNJD 1IFHH 2HN7B 2Y7SA 3GSNB 3HUJE 5JHDD 3TURA 1NC4A 4XN1A 2QTVA 4AYFB 3UBXI 3TO4C 1MWAH 5IQ9A 5KUKA 1XF4B 3GBEA 1N5YL 4HYTB 2Y7MA 1CYWA 3G04B 2DZEA 1NCWH 2AJUH 1SYFA 2IQ9H 5E4IA 2RR3A 2H7WA 1RFDL 4ZUWB 1LACA 1PRTB 5FYJH 1P9MA 3RBGA 3WXWH 5F93C 3DWAA 1D6EC 3HOVH 4TUKL 2R2EB 2O72A 5E8DH 3MRNA 5DRZB 2DI7A 5AW6B 4DGVL 4MDIB 2ZXBA 2DYRB 1GTNA 1WWAX 2IBZY 2D0OA 2D0GA 2CHNA 1MNUH 4NX0A 4YVUA 1Y0LB 4KI5F 3NJIA 4ZT1A 3LHAA 3HC4H 3OJDB 5DTFA 2VXWA 4HWEH 4OL7A 1H19A 1NEUA 1NC2A 2B77A 2VZVA 1F3DJ 2DMBA 4FTVD 4ODVL 5BXFB 2ENPA 3PNWA 5F1NA 5CF3A 2ITCB 3ZIYA 2FGWL 1N59A 2YZ1A 3HKZB 2OCFD 4KQ0A 5EUOA 1AR2A 1N64L 5CCHE 5KBPA 4GQRA 3P73B 4QXGL 2Q6WB 4R2GD 1S7WA 5EU6E 2WTRB 4HBQA 1N8RC 4JBSA 2YAPA 2KYIA 3EGSA 2FFKB 4ODUA 1L7TH 1UA6H 2VXTL 1X5HA 1TWCH 2ICCA 1R24B 1XGZA 4PJIF 4XZUB 3D0FA 3EO0B 4Y7MA 2EE3A 4EN3D 4Z5RB 4P5KB 3NIFE 5L2JB 1FFQA 4WK2B 1K5NB 1UE6A 4G9FB 2OTWA 5EKLA 1WAAE 3T0VA 4A38A 2ZUQB 4DF9A 5ICYA 5GS1B 4NLAA 3MI6A 1T3FB 4PY8J 2F4IA 3QR2A 3SO5A 3S16B 4R2GB 6FABH 1XIWC 2VR6A 4ELKB 2PO6C 1QSFE 3REVB 1CK0H 3N50A 2ATWA 4K94C 4JG5A 1OPOA 2WC7A 2DQGL 3TEXA 4EN3B 1PH3A 1NY4A 1P7QB 1VQ9A 3CAFA 4JRYB 4N22A 3G6AB 5C6TL 2HLAB 3TV8A 1ZLVK 4NN7C 4HG4K 2RGSA 1Q1PA 4J3SA 1W0WB 3DRQA 4G5AA 4V2BA 3JAME 3MV8E 4RFBA 1UATA 5JEAG 1ZT7A 1W0VA 2BMKB 3BP4B 4I3RH 3QZNA 4ZKBB 2E2HB 3HI6L 5FUZH 1FPTL 5JW4R 1SHMA 3H53A 3KLAA 2P48B 1OTTC 3V4PB 4M7LL 3KJ6L 5EORL 1CXKA 3MJ8B 1TFPA 4KKZA 4M9PA 5IT9E 4F3FA 3AXIA 4AJYV 2PNRC 4N3TA 1Z3RA 4LSQH 4PD4J 2O2LD 3RQ3A 3IDXH 1KBPA 1AGDB 1XGPA 2DQEH 2FT6A 4FVMA 4UM8A 3DOHA 5BW7A 1RLBA 3LQAH 4D9QD 5DC9B 2GUYA 3M4YA 1QVFA 3DOSA 2OP4L 4ZPVA 4HC1H 5IWLA 2VMCA 1ZXQA 3QUHA 4WI4A 4U3XA 5GROA 1Y1DA 1I3VA 1MCRA 2VM4A 1YN7A 2OQJB 4RFNC 5DLMH 5CCKL 2GQHA 4N3UA 4Q2ZA 2QPSA 1EY6A 2H1EA 3WOEA 1KYDA 4GUPA 3CDGA 4S0HA 3VRIB 3MV9A 3O9WA 1RZFL 4A3EB 3KYMA 1Z5HA 3FSWA 4ALAC 1IZ6A 4Y89A 2GJZA 2JA5B 4HISA 2EP6A 2R0WH 1LEGA 1GUTA 2ZX7A 3A4AA 4PJAE 5TGBB 1I7RA 3OX8A 4UU9B 3M4OH 3HRPA 4A76A 5EBMB 4FA6A 3K7AB 3CHBD 1K8DA 1C12B 3UC0L 2KBGA 1FVDB 3H54A 2O5YH 1LVEA 5MI0B 5JQ6H 4PUBH 2JKIS 5CGYC 4WJKB 1BBDL 1KT2A 3S37L 2XBTA 1STYA 3U9SA 3B1UA 2NY4D 3FZUC 1KC5L 3O2WH 4OIBA 2DJ4A 3UTPE 5E4EB 4HQQL 5JO5B 5J0BA 5C0AB 2X1OA 1ZLSH 4N2GA 2IPKD 1MRFH 4PJHB 1OPGH 1WCQA 4AGOA 4KX9A 2X6VA 1I5FA 4MA8L 3S5LB 1KDAA 3TIDB 4A39A 4AG4L 4YQXH 1TUPA 4GUOA 1PFBA 3HMWL 2GBAA 5CM1A 2R92H 1TTUA 3I7FA 3QJOA 1OW0C 4KPHL 2P45B 4KKNA 3E80A 4NQVA 1ZTMA 1DFBL 2NT1A 5BMFL 4DSYA 4XXCA 3HG1D 3QJFB 1AZNA 4QCIB 4DZBA 2VXQH 1RULH 1OALA 4QR7A 4U2YA 2F18A 2IPKB 3BLBA 1RUKL 4QXTB 3O0RH 2H0FA 4DVBB 5ABZA 5F7AA 4P2YA 5C44H 1H8OA 3WJMB 4HEMA 1RUQL 4IU2A 4MYWB 3CCLA 1HXMB 4XMXA 4N2IA 1E67A 2HCIA 1SY6A 4K23L 3SZ6A 3VSTA 4XP5H 4C56E 1I6HH 2FDBP 1KPVB 3P9WB 3V6BR 1Z9SA 2UZIL 4KD4A 3DUUB 4E6IA 3VFSB 1TXYA 1T4KB 3IU3B 2HUEA 2NNFA 1Y8OB 1MJUH 2XKSA 1QSEB 3OVUB 3JYBA 3N85L 1KC8C 3HE6C 2DIBA 1CD9B 1C1EL 4LASL 1EDYA 4ZFFA 5I0XA 4KN4C 2NNAA 4JPVL 5FC9A 1OGTB 3MLYL 4JFWA 4DUVA 2XTLA 3TO2B 2H4EA 1Z6JT 5F71A 5K69A 5JR1L 4M00A 4KK5C 5EEWA 4XQJA 1MHPH 2EUZA 4EXPX 3L1FA 3BRFA 3QDJE 4R5VA 5TDPA 3RURA 3CXHJ 4L5FL 3R7RA 2PR9A 3J07A 3GHEL 1HILA 2IGLA 4QF1A 1T1XA 4OIJA 4P2RD 1LT5D 2F68X 1XZ0B 3MRRB 2CKBH 2AK1H 5EU4A 4YBQD 4A6YB 1YMME 4PJEE 1A7QL 2E9IA 1JNNL 1GIGH 4KVPA 5D6CB 2VMDA 4J3WA 4JHWH 3QORC 1BBUA 3QIAA 1CB4A 2O30A 1CLOH 4F2ME 4Z7QE 3QFJA 2VUKA 1IAIH 1AFVH 2FYYA 5J4MA 3BH8A 3IGKA 5LAXB 3F8TA 3UP1A 1U4FA 4EI0A 1YVLA 3GSNH 5B1JA 1GSMA 1SY6L 3DUSA 3FTVA 2CHBD 4UQ2B 4CMHC 8FABA 2NUPB 4YN3A 3RKDD 5T1LD 43CAB 5DM63 1BG1A 4RMSA 1VFUA 3TC9A 1BHGA 4MJHA 1GGCH 3ZUNC 3FRPG 2HAZA 3E3QC 4PJDE 3CCSA 4LJZC 2HJKB 5E7BA 1R4PB 3EAKA 3SGJA 5IW6B 1ZKOA 3N04A 2ZOTA 1R3KB 5KVFL 3MRBA 1ILUA 3TREA 3GZKA 1A7OL 5DUBB 2KHIA 5JPMB 5AL8A 3QNXB 4KRNA 3STLA 2Y7QB 3ZDXF 3RGVD 4OD1L 3HE7A 4GY4A 4ZMWA 1T7WA 3GJEB 1NLDH 3MCLH 4F91B 1Q0XL 1CQVA 3O6LL 4IEFB 2D8KA 5EV7A 1NQBA 2P5ED 1ZGLA 4ZAIA 3CXDH 3NTIA 3LEYH 3MCG1 2ED6A 5T1LB 5EIIG 9CGTA 2H5UA 2XYBA 4EZKA 3E8VA 4FFYL 2R93B 1SVBA 2R56H 4I85A 1FORH 2LU4A 2OR7A 2ZKMX 3ASOB 2Q2EB 1K9MC 3SDXA 3T56B 1RP8A 2XZAH 5C0NC 3HZYB 4OIKA 3QUXA 2DQCH 1BQSA 5ELNA 2OTUA 3EYVA 3RGVB 2VDPL 4K9EL 3UFIA 4NKDB 2QPFA 2L9HA 3DHMA 4HJ1A 3UZVA 1W72L 2P5EB 2V2WB 4N86A 2GC4C 1DVQA 2A1WL 2VDNL 2EZVA 3IMRA 4AYBG 1GJXA 4KXAA 3R4DA 3K80C 2KKQA 2UVEA 4XNMB 2OZ4H 2IO5A 2Z34A 4H8PA 1IBZA 4K8JA 4U1SA 4XPGH 1S4IA 4OONA 3FUFA 2VSDA 5EA0H 4OZHF 5EUKB 4BH7A 5TF0A 3S16H 5IWAQ 3IDMA 2GPZA 3P4NB 5E2TH 3SDAC 2FEJA 2VTFA 3AFQA 1QLRB 1FL6A 4E9YA 1D6EB 2R7FA 1EJFA 3SGEI 4NM8H 5F0PB 3AC0A 2HA1A 3MXPA 2YJLA 2FZ3A 4KFZC 1OEZW 4H26B 1EY4A 2LS01 4QRRD 1YEEH 2BJMH 2YBRB 2Z3FA 4RGOH 2EDDA 4BWUA 3GSRB 3H9SB 5AW2B 3FQ4A 2K9UA 4R7XA 5CJQL 2E27H 4DP6X 4UBDD 2BS8A 1EFQA 2EE9A 1DUYA 4G83A 4Z0BL 4WHYG 4LQ1A 3V4PH 1CYXA 2JTDA 4KY6A 2HQEA 1A22B 1UH3A 4HCGA 1I3GL 4JR9H 2BFVL 1RURL 2XSKA 4HTHA 5A35A 3S88L 3Q6SA 3ZE2E 1J1XL 1EWCA 2SNSA 1NGXA 1EXGA 1XCTB 3P9MB 4NUQA 4Y1AD 4PJXB 1ESFA 3EJJX 3F00A 3ILQC 3QARA 4I48A 4A67A 4AQEA 3T1YQ 1JGUL 4J3TA 4LFBQ 3ARWA 5DU7A 5LQBH 4L29A 4FXKA 4EPSA 1GJUA 1IVLA 2ZT9C 5DWUH 3LN9A 2JP1A 4WW2A 3AMKA 3ULSB 3TFKD 3MUHL 3VAEA 1ECZA 3N3EA 5IYCH 3ECUA 1XIWB 3T0EE 1KTBA 4Z7VF 1MCOL 3JV4B 4H2AA 3KLQA 2PO6B 4ZW6A 4LEOA 4A3EH 3INUL 4JFDA 3QUYD 4LHJB 2JA5H 1S7VB 2A6JB 2DOCA 2DQTL 5IHBA 3BVZA 1JFQL 4R7DA 1J12A 3WHE0 3L7FB 3QEHA 5TDNB 2H2PD 4XP1H 4XN8A 2XWBB 4EEEA 4HF5L 2EC9U 3K7AH 1OAKL 3FT3B 3ELQA 3LXBA 1OAQL 2YS4A 3UAJC 4FNUA 4NZUL 1B3AA 3FUMA 1G2TA 5KSAD 3M1OA 5E8PA 3L1OL 3M46A 1JRHH 4Q4EA 2L04A 1WRFA 5KNCA 5C97A 2SDFA 5AW3B 4N8UA 1CFVL 1RIPA 1SRUA 2IXQB 1KG0B 4NKOA 3VXUE 5D1XC 1FAIH 4YSCA 2P46B 3KE0A 5CEXA 1Q0EA 5AFWA 1K3BC 1IC0A 5HYQB 2D7NA 1FZOB 1NMGA 2UUDH 4ZNEE 3BWUF 1WZAA 3SGDH 1E7ZA 4X8GA 1HHJA 5JHDE 1X6NA 2J57A 2UUCL 1MW3A 3BP7A 5KSAB 3NEMA 4F9LA 1V7MH 4JS7A 1I50H 4UQ3A 2ALYB 1JZ8A 5DMKB 3PJLA 4X9FA 5LL6S 1XR9A 3ESUF 3MUJA 2NVQH 2VDRB 2BY0A 5B8CC 5E4WC 5F88B 4ZTEA 1CVSC 1E4KA 5DZJA 2VIRB 2F0LA 1JIBA 3MXNB 1JPFB 4ONFH 1SDFA 1M2VB 1W80A 4HMJA 1ZDSA 2KCTA 1U2CA 1WZ1H 4RFNB 4ZAKC 3QQDB 4UDUC 2ZXPA 3TNMA 3L3GA 1AH1A 3BKCL 5GPRA 3FRUA 5AFAA 1OIOA 5EKKA 4IRJA 4N2AA 4Y4KC 4P9HL 5F3HA 4DR6L 1R3IL 3FZUD 4S2SB 5HBBA 4JK0D 1I4PA 3FVQA 2HTLD 1F3DH 1MCPL 5D7SH 3VX1A 4FTVE 1K8AC 5C09B 4BYHA 4IEFA 4QXUH 2OMZB 4G9FE 1HHHB 1G9ML 3CN0A 4K55A 4PBDA 3B3IB 2PPFA 3IN0A 4A93B 1YITA 1U3JA 2JIXA 4CA4A 2A6DA 5EEZA 3E0GA 5EU7C 1D9KC 3W37A 3EUDA 3CFBB 3GMOA 4IM8A 2J1KA 1T66C 1BFVH 2X9WA 3K46A 3NESA 4PEEA 1HOCA 4PP1C 4Q5VA 4GINA 3PGFL 1U8JB 3V52L 3G6EA 1FH5L 2VN3A 1HNXQ 1IBKQ 2OJEA 1I8IB 3FYEB 3HIZA 3HC3H 1CL7H 3PWUA 3U6XS 3TVMA 3B9VA 4U3CA 2Z0SA 1KGIA 4UAOC 1HCZA 1YUHB 4P4KC 1SHWA 5EC1A 4B9GA 1QRKA 3MREA 1T7YA 2JVUA 4JQXA 2FD6L 3RPBA 4KXBA 5C5LA 2XG5B 4A6YH 1E42A 2ZTDA 3N43F 3VE0B 3H3BC 2CDEA 4Z7WA 4MMXA 3OSKA 1KLGA 2Z9TA 1PG7X 4D0CA 4U6VL 4DZ8A 3WNMA 2RD0A 3PUCA 2B2XH 1ZCRA 2KI6A 3JV6B 1T89C 2GY5A 2NYKA 1CDIA 1SOSA 3QWNA 1Z66A 2NUTB 4HJTA 4FZ8L 5B4MD 2BWIA 2WMPA 4FNTA 1F58H 3DXAA 1EXHA 4FLHA 4KK5D 4N9GB 4H20L 5KW9H 3UDXA 3PF2A 1N0XL 3C6SB 3CN1A 3N1QC 1DQLL 2VITB 2D03L 3MBXH 3O4OC 1WH0A 3MRIA 1XL4A 3BAWA 3IE4A 3CX5K 5J1ZA 1IT9L 3HE6B 4K5PA 1RZKC 3WUWB 4Y4FC 1HINL 1TU2B 5HI4C 3ZZQA 4D9QE 4HCIA 2KHSA 4DR5Q 1VQ5A 4N90D 2LLNA 4IDLA 3SBWC 2PWEA 3EUUA 3BUYA 2O6CA 1JZ5A 4N8VG 3DGCR 4HUKB 1EFWA 1RIUL 3PQYB 1BR9A 1TR7A 2V3FA 2F53B 5CO1A 5INDA 1DUZA 1D1IA 1X7QB 2WLLA 1XTCD 2BH8A 3OXRB 3PV7A 5C4JB 2CBPA 4YDJA 3FB5B 1DQQA 3LJ3A 5JA8B 4Y8AA 4PS8A 5F2FA 1HYSD 1TPXC 2R93H 1NIEA 4YZFF 4KQ4H 2OK0L 3LKNB 1I53A 5EZOH 2G5UA 1AG6A 5C0AE 3EZJB 2CH4A 3SEBA 1CE1L 1L5GB 5HHMD 4PJHE 3HOGA 1XV8A 4AENB 1X32A 4GNXC 4YDIL 3K5OA 3EIVA 3F7KA 5D7LB 3DUHA 4PGEB 3SGKA 1CDGA 1BYNA 3D39A 5IKCA 5DR5H 2XG4B 2FX8H 1YG9A 4Q9RH 3FFCD 1GC1C 5T3XD 4JV5Q 4NM4L 4E41B 4KFMA 4PWIA 1RY7B 5EBLB 5IWAL 3KPPB 4KTGA 1OE3A 2CO2A 4A3GB 4DK3C 1BREA 3EDJA 3ZOAA 3CSYA 5BO1H 3QJYA 4LRNH 4WF7A 3TESA 2WB1A 1ZGLP 3CP0A 3MOBL 1F41A 3RX8A 3SPJA 3WFEL 3KH4A 4YEFA 1X7TA 4R97C 4CMHB 4YK4C 5HHMB 3CH1B 4NUJB 1KCSL 4LF3A 2L11A 1Z5LA 4K7FB 4U3SA 5IHLB 4JO3L 4HPYL 3OAYK 2RMNA 1J0HA 4HGWB 4MB3A 3RVTD 2R1XA 3FTGB 1TLMA 4OIIH 4Z7UF 4ZFGL 2I5LX 3K6FA 1RF2D 4HS3B 1LEKA 2VR5A 3FFCB 3QAZB 2HMIC 2VDMB 5IP4A 1AZCA 3BMVA 4IUQA 1KENL 1RUMH 4CILA 1YHAA 2BXYA 3I9PA 5C0ND 4BZ1A 4ERSL 2NOYA 1UQSB 2F0KA 4IHBA 4JFZH 4LU5L 1IJ9A 5FGBC 2HVKB 3TJPA 1PYSB 3K74B 4GN4B 4NWTH 2GK0A 5EN2A 4RKLA 1QSEE 1KB5A 1I1AD 4I9WD 4NO5B 1NCHA 1ZSHA 1H6TA 2W9DH 5D2LE 4DAPA 4GMTH 1P4IH 2X7LB 4K3EH 5J22A 3MRDA 3US9A 4LAAA 2APBA 5HP5A 4PVLA 4Y9GA 4WFGD 1QBLH 2DD8H 1RIVH 3W3AA 1OP3H 2DICA 4BQ9A 1MZZA 1GXEA 2B3GA 1A7RH 3BAEH 4LGRB 4R90H 5CHNA 1FFRA 4NZJA 3SDAD 2H1LM 1K3RA 2IANA 4JQVC 1NPUA 1XMWA 4N0YL 4WUUD 2R61A 2P44B 3DWTA 1MRCH 1E9QA 2CALA 1H6UA 3CIAA 4DPCX 3PAVA 4K5MA 3ZRCC 3A3YB 5JYMA 5T1DH 2BNQD 3LKSA 3BCFA 1KDBA 4DFIA 2MWCA 4HD9A 5IREA 4MHHG 3LKPA 3KPTA 5SWZA 1VKXA 1CJYA 1RPKA 2HDLA 1Y1WB 2DQHL 1H15A 5I0ZA 1KLUA 1D2PA 1WBZB 1R17A 3IFPA 4PP2A 4M6ML 2UXBQ 3SDAB 1IYVA 2RQEA 2FUQA 3AZUA 4UT7L 5FGCB 5MERA 2WCSA 2QBWA 2WQUA 3IBEA 5EO9B 1USZA 1YEHL 4WUUB 4K94H 1ZAGA 1ONLA 4CDCC 3CK0H 4XBEH 4AQAB 3MZ5A 3W2DA 1MJ8H 1BEYH 3TNNA 2Q3AA 4J1UA 4NO3B 4PG2C 4OI8A 4P2RE 4PMEA 5HDBF 2BNQB 4JDZA 3NIDB 4JO2L 5CFHA 3GQBA 1FJ1B 1K8MA 2YUZA 1QOHA 3KYOB 2MQ3A 3SE9H 4AEHH 3KLSX 5ITFA 3GB7B 3DJRA 1JXKA 1YDPA 5TQ0L 2VZUA 3I72A 3FQTB 4BK5C 1U8HB 1J9OA 2H6PA 2TSSA 3D85D 1VFBA 4ZKCB 1NCAL 1CGSL 1K6QL 3QAQA 4BK8A 1MLCB 4XRCB 1S7XA 5LHY1 1G6VK 1ZLWK 3AWEA 1YHPA 3GSOB 3L6FA 4MD4B 5LN8A 3HJ0A 3Q6FA 1M90C 5DJYA 3UGXA 4YAQA 4DR1Q 3OTTA 2BC4A 4IGBA 5EEXA 1SYSB 1SEQH 4YXHL 5BS0A 2PTTA 2RTTA 1IBGL 3WTXA 3SK5A 3TBTA 2DJGC 4XHJC 4WKZA 3VXPA 5LGJA 3OKNA 2VDRH 4X6EB 5ILTL 3D85B 1TO5A 4N2EA 3KEDA 2Z8WC 1X5KA 4RA8A 1HHKA 4LSDA 4K6LA 2JSFA 3RNQA 3LV3B 4Y52H 2FJHB 3DARA 4N68A 1MIEL 5E8NB 4O4YH 1YAIA 4KROD 3NZSA 3REWA 1CTOA 2EIBA 1KJ2A 3KR3H 5G5DA 1V27A 4O2CA 1FBIL 1UD3A 2LW3A 2AQ2B 1XB6A 3MPCA 4ALAH 3W1ZA 2CLRB 2P5EE 5F89B 3WEAA 4M61A 2F1EA 4HHAA 3H94A 2Q2IA 3F85A 2WUBL 5DMIH 5ENWB 4G42A 1B2TA 2ESVB 3BMWA 3NTKA 2E9JA 4XH2A 3W2DL 4EUPB 3RUZA 1QD0A 1EZVX 4WW1B 3LNDA 4LCUB 3E6FA 1SYVA 3O11B 4ODBD 3RL1B 5FLMH 3DGGA 1Z3GL 4F8NA 4NPSA 1KXHA 1HNXL 1XF3A 5KAQG 2W65A 4DEPC 4P3CL 2OMTB 2VDQB 1CBVL 4ZUIA 5IHHA 1QACA 2YAMA 1UWXH 5D1XB 1KACB 5EBWA 4ZFOB 5I8KH 2UXFA 3BVGA 2VAAA 1INQA 4PRNA 5E1AA 3Q8EA 3GMNB 3PABB 1NKOA 4JPWL 3ILPA 1QTYT 3ARDA 3UJIH 1EXUA 1YYMH 3CD6A 2CK0L 4U3HA 1ZTXE 2C1OB 3TQYA 5HD8D 5FJ8H 5AVSB 5HHOA 4A68A 3MNVA 1ZEAL 4OLYL 4PRBB 2D2OA 3JV5A 5ETUA 3U58A 3X3FL 2FUTA 2OTJA 4JBWA 1L7IL 2ZTBA 3EHBD 4JDTL 4BFNA 1IM9A 2JI2A 2C5DC 4WVRA 4RETB 3C2AH 3K2MC 3QDGD 2J2ZA 4ZSOA 4ZAKB 3D2TA 3S3CB 4Z3HA 2RFXB 2KECA 4YR6A 4PLKC 5HGAB 5C0BD 1G7IA 4QRRE 2CDGA 1J0YA 3MODL 2ZCZA 4UB0H 3D2UD 3MNWA 1TQSA 2ADGB 2J12B 4PJXE 3TGXA 2ZUSA 2NPLX 4LARH 4Y4KB 3IDJA 3WL9A 4BFIB 1T66D 5GS0D 4WDIB 3NZ8A 4LK4A 2G5BA 4IK7A 4PP1D 5BW7C 2HLEB 2RIKA 2V0AA 4NNXB 5T1IA 1IAII 1VDGA 2CKNA 2DF3A 3HMXA 5BPPA 1F4YH 2R69A 1USQA 1HQRD 2JI1A 4PJGF 5H37H 3L45A 2ID5A 1SMDA 2DLGA 2ZWLT 1MI5D 1QX1A 2TRHA 3K2UH 3O6ML 4LL4A 4N8CL 3TH3T 1NMBL 3CC5A 5IWLC 1LDPH 4X7TB 2X4UA 2WXQA 3WEXB 1AIFB 3KXFD 3QDGB 4P4KD 5I1GH 3B9AA 1PZ5A 3O6KL 4KJQC 4AQ1A 4GFXA 3IFOB 4PGCA 1XGUA 4GLRH 4H40A 4K5OA 3QO2A 4Y1AE 4C47A 3H0GB 5IBUB 1GRWA 2FBJH 1I94Q 2J55A 4I2XA 5L2KA 3HZKA 5HYSB 5T1MB 5FYKD 2VLRB 3O9WC 4UM9A 1G91A 3MJ9A 3HOWG 4LFCQ 2FQGA 4O02B 3ZDZF 3ZJAA 1FVIA 3Q7JA 1R33A 2CRMA 3D4GA 2QKSA 5C6WH 1MI5B 1KYFA 5IFHL 2HT2D 1CI3M 2CDFA 4UAOB 1JTOA 3KXFB 2RQXA 4P4KB 1A7PH 3BZDA 5KBKA 5CEZL 5C4JH 4LCWD 4IKJA 5A16B 3DK0A 2MOQA 3UPRB 4YSUA 4L3CB 2J6EL 3RDTA 2B2VA 4RGNA 4MD0A 3AUWB 4PTTB 4JV5L 3A67L 3MRLB 6PAZA 2DKUA 3JSSA 3VMPA 4Y4FD 1AZVA 3V5DB 3ERSX 5DRWA 2C9QA 3J8F7 2IMNA 1M71A 1W2KT 4FLRA 3VFNA 1HZHH 1IGCL 4LCWB 2BH2A 4HXAH 4MS8C 2IDCA 4A3GH 1A15A 4BINA 2WTPA 3TOPA 3VD1A 3G5YB 5HYFA 5CJXA 3VXTA 4Y19A 4ELMB 4JJ5A 2PO4A 1NFIB 1TMQA 5TD4A 1OTSC 3O4OB 2L7EA 1OQOA 1JWUA 4BA2I 1LO4L 3KF8B 1SE8A 4JDVA 3D4WA 4H0LC 1OAXL 3CLFH 1E5BA 4H5SA 4Y4FB 1I3QB 2VDMH 5HYJB 1IGFL 1IKLA 2D2CC 4HJGB 5FO7A 5C09E 5HVHC 1MCQA 3GGWA 1U91A 4FKKA 4QHMA 5IMKA 3G7LA 3E7JA 4Z95H 2DBLL 4CHTB 1ZLDA 1J0ZA 4HKBB 2XNAA 1HHIA 2V7NA 3U36B 1W8EA 1JF1A 2HT4C 2YEZA 1IL1A 1C08A 1KULA 2AFNA 3CFJA 2JYOA 2MFIA 3SDCA 3UDWC 1ADQA 3BFWA 1ZOXA 1TPXB 2JEAI 2NY0D 1UA7A 4XXDB 3ZZ1A 5J89A 1K72A 3MXUA 1EIYB 2H3NB 3P69A 2RCNA 5IF0B 4JOIA 3ZYYX 3UCQA 5CBAB 5K9KA 2GVAA 3NFNB 2LSSA 2OR9L 3NP3A 4OZIF 3RWCB 3ONAB 5IT2L 3HOUB 4GNXB 4BWGB 2UXCQ 1DJSA 3AS3A 4NXKA 4HIEB 1L9SA 3MUZ1 1NOFA 5MEPA 1ITCA 4X5WB 4YHKL 3VFMA 3HRZB 2XZQL 2XQBL 4F8MA 4JBKA 3T77B 2EYJA 3A24A 4BUQA 4TLKA 4F93B 3U7YL 4M6NL 5IQLA 1IW7D 2UXBL 1YECL 4W6YB 4EIGB 2VZAA 4N4YB 3B9KD 3TYGH 4HS8H 4NPYA 2AQ1A 1A62A 3CCHB 1ED3A 4BS9A 1Y1WH 3BSZL 1DVYA 4YK4B 4YO0A 1BD2B 1TJMA 3J80L 3TX4A 2V9TA 4K9EC 3EBIA 3OMNB 3ULVL 3NP8A 1U3YA 3DXJC 1JMZA 2R8SH 4IUPA 5DEGB 4GW5A 4YX2L 4L5SA 1UH4A 1OGSA 4JM2F 4PWHA 3RR5A 2VY3A 4I8DA 1IC5H 2WANA 2FJ2A 3Q5OA 2E9WA 5J57B 5I2IB 3WIAA 5B1JC 1L0QA 2A9NL 5M95B 3ZTJG 2COQA 5DQ9A 3MKKA 1NKGA 1P16A 2AEQL 1G51A 4DR1L 4PJFA 2WBXA 4WFED 5ISZA 3T6XA 2OXHB 2FCBA 3MJ7B 4M1DL 4LKCB 2OMYB 4N6RB 3ZMNA 5AG8A 4ZX4A 2V33A 4ONOA 4LSPL 3SGJC 4IFDG 3K1KC 4QXVA 3WO4C 1BGXL 2FSDA 2VCOA 2YMXH 3PQYE 4A7GA 2ZCKH 3OG6B 1ES0B 3SGDI 1AE2A 1LWJA 4MA7H 5FB8A 2W8CA 1F6AB 4DN3H 3D4DA 1Z7JA 3F7YA 4YHHQ 2PYFA 5IB1B 3SK6A 4FGMA 4WTWA 2WLZA 4GOSA 2B15A 1N10A 5D7IF 1C7YA 3GSWB 3PXLA 3CCJA 1OD7A 4M93C 5E2VH 2Z8SA 2A69D 1KZYA 1PS3A 4J8RB 1PKQA 4N90E 4NEHB 4OTXL 2OM5A 5AL0A 5GRWA 3TYFB 5CIPA 2GG1A 2X6UA 4CL7A 1K4CB 3U0TA 4R9WA 3S5YA 5HGBB 4CVWA 3WTWA 4DN4M 3QUXC 4XCNB 4GXVL 1EHLH 2BSSB 3X1FA 1M53A 4RISH 3DJSA 4E41E 3U7WH 1ZPUA 2EIDA 5EO0B 4UQBA 3ZT5A 4EUPH 3NCWA 5F9WB 1U95A 3SPCA 4AT6A 3N0AA 1IRAY 1HFGA 1INDL 1YYLL 4NJ9H 5HHME 4KZDH 4NP4L 4HKJA 1UCBH 4JFXB 2JKJA 3GSVB 4Y16D 2GJ6A 1S46A 2HFFA 2QVMA 3D5OF 4GP5B 4X6FA 4JFYA 1F4WL 2JV6A 1ETZB 3E3QE 3ARFD 1JB3A 4MCNA 2VDQH 2BOBA 2DQDL 3FFCE 1AZRA 1AS8A 3MZTA 3FQ2A 3AABA 5IROC 25C8H 5T3XE 1JWSB 5LCVA 4F7TA 4KO5A 1QAWA 1JI1A 1DYQA 2LFEA 2VZOA 2XWRA 5K33A 4EX5A 4TPRH 1BQHA 1H0DB 4L8BA 4IMLA 1CL7I 3OBAA 4MJ5A 4XMKL 3HG9A 4QRPA 3UTTD 5KAQF 4GN5A 2Y3NA 1YPZA 3HR5A 4GB9A 4PY8I 4Y9EA 4J8QA 4HV8A 5IOCA 3ZDYB 4X4ZA 4NRXB 3VI4B 4DA2A 2UZPA 2FO4B 4X6DA 4TQIA 1ET8A 3ZLQC 3OAUH 4ZBJA 3SDZA 2R9HD 3PNWB 1BWWA 3LN5A 4Z77A 1TVXA 4PYHA 1I31A 4BM7A 1B9NA 4MHHI 5EIQA 2ODHA 4GG8A 2Z6FA 4ZMXA 2O5JC 3KWTA 1SE3A 4G57A 1CGVA 3E6ZX 1H3UA 1BA9A 1NOAA 4GAYA 3F7VA 3QR8A 4ODUB 3HNSH 3H3VC 1S9VA 3CCUA 4XCCH 5L8JB 1A6TB 4FXKC 3F7PC 2JCCB 3SHSA 5BR8Q 3KGSA 4WFGE 1R4XA 4H1LG 2AEWA 1I94L 4DO5A 4WW2C 1S3RA 2V5TA 3Q0HA 4C3IH 1B53A 3SVMA 4XVOA 5KBMA 2OTWB 3VFUA 3UYPA 4LFCL 5C0IA 1AY1H 1AHWC 1P53A 1QOKA 2V37A 4UT6L 4NW2A 5FGCE 1AYRA 4Z3JA 5F7UA 4P9HC 4GG6A 3H0GH 1TZGH 4MJ2A 4W4OA 4WUUE 3WCYA 1QZNA 5I76A 2R39A 1BO0A 5GS0H 1IAKA 1S9WA 2B2YC 2X6CA 2BNQE 3X2QB 3NIDE 1PSKH 4JFED 4PLKD 3EH3B 5MENA 5C07D 5D4JA 5E95B 1G9MC 3SQOL 1G7LB 2OSLB 1DVFA 2FSEB 2LTQB 4PJ8A 2ZM6L 5ISRA 2DIAA 5GRUL 2CLVA 3JT2A 2EZ0D 1I1YB 2WXGA 1F45A 2B4CL 4W9DC 3VD9A 3T4AC 2OX5A 1HZAA 1QBBA 2AVGA 2OW7A 3FMGH 4G8GD 2ZCLH 4M9OA 4BFRA 1HKLL 2AUKA 1GOHA 1PZ2A 3P3SA 1I9RL 1A0QL 1S3KH 1ZS2A 4XPAL 3P3UA 4DV4Q 2BS9A 5FOBA 4HIHA 1C9SA 5AB2A 5M3FB 2Z7WA 4OKVB 4I77L 5C07B 3G6JF 3O6FD 3CVDA 4M7JH 3RGBA 1F2LA 4ANUA 4N9TA 2X70A 3BAIA 1JYXA 5LXGH 1FI8C 1TJIL 4OLVH 4WSGA 2WLNA 1E24A 1EFXA 4KHTL 2WP3T 4NN6C 4UM8B 2PYEA 1G7PB 4TNGA 4QRFA 3C5ZD 3OHXA 5BZDA 1KCWA 2ZJQA 1L9RA 1Q9LB 1LQBC 5I82A 2H6OA 1ENFA 4ZPVB 4FQIH 4Y5VA 2D0PA 3HN8A 3LKQA 1E4KC 3KJ4B 5D3IB 1X5GA 5FLXL 2ZKHL 4FLSA 3QUML 1YN7B 4R0LB 5DT1L 3W0WD 5C3IA 2IOMA 4WO0A 4ZTOH 2APWA 4A3KG 1RZKH 3KW7A 3CW2C 4GUPB 1I3QH 4TSCH 2D5DA 3LXAA 3IGAA 4PJ7B 1JWMA 3L3JA 2ZOKA 4IRJC 2Q86B 5KVEH 3O9WB 1AS7A 4JO8A 4LOVA 4IS6B 3QDHA 1ACXA 1YSOA 3W1GA 3WAKA 3FN3A 5F1OB 1I7RB 2WWNA 3OX8B 5C2UB 2QSCH 3BDLA 1EJ6A 2XFXB 1K8DB 2QTEA 4LVOB 1JD9A 1NA8A 2XWZA 4UAHA 4H44C 5HJDA 5ICZA 5HGQA 2Z1PA 3W0WB 2Y0SA 3VRJA 2UXCL 5DHXB 2PI2A 3S15H 3A56A 1FCGA 3ZKND 2F5AH 4OCSL 4B50A 4J3OC 4KTEL 3AT0A 2BY3A 3C6LD 4DNLA 4LAQL 1CHQD 2XKNA 1TYEB 3WLWC 4AMKL 2VQFL 2VW4A 1CD1A 3LSOB 3O4LA 2E47A 1FUNA 3TU6A 1GAFH 1MIMH 3HOUH 2EC9T 3MTSA 5KGUA 5C1MB 4X80H 4JX0A 3QXVA 1HT6A 1MREH 1LP9A 5FGRA 4IKIA 1NLBH 1DBKH 1TETL 5B3JF 43C9A 5KUMA 1GC1H 4JM4H 3TVMC 5K59F 4QRUA 5IQ7H 3QZWG 1EJOH 2Y36L 2JA8B 1L0WA 3OZKA 3TBVA 2L0DA 1OF2A 3C6LB 2A77H 3EOBA 4JN1L 1DVZA 4HWNA 1GZHA 4BBSG 2CHWA 4MMXC 2YN3A 2HG5A 3RWJB 2A5HA 2ZZUT 4J2XA 5FM4A 5IFJB 5HHVH 2EDOA 1BPLB 2GI0A 2QCPX 5IUCA 3M7FB 4G6FD 3NH7L 2X10A 1F77A 2AK4A 3QWQB 4A3FG 1FVCA 5JPNA 4R4QA 1H9KA 4C3IG 3L2NA 1WICA 1HH9B 2KH2B 1N5YH 2XWCA 3QDGE 3R2TA 2A99A 3PXHA 1HRJA 3UBGA 4GW4A 1TQUA 5C0BE 4XT1B 2W81C 4HZ1A 2ALAA 4TUKH 4LNQA 1PMYA 4PGDA 4NOBA 1YZ6A 5DFAA 4WWKD 4DGVH 3RE0A 4IPHA 1KYAA 3ZKMD 4ZFFB 4G6FB 2CSPA 1G4RA 3CMGA 4XBGB 3VRLF 3N40P 4BSWB 1JGLL 1LO5A 1MI5E 3MLSL 1KCBA 2W9EL 1NEZG 3VG0L 1XGTB 2CUIA 4KKUA 2EIFA 3KXFE 2DGYA 5IEKB 1JZJA 2YPKA 3BAYA 4CU8A 1NGQL 2NSQA 5DJDB 4ODVH 2ZUTA 1QWNA 3FOMB 5FEBA 1YEJL 4QUCA 1K8IA 4ZK9B 2FGWH 4U6HA 1X6LA 5FUOL 3QFDA 3BGMA 3QCUL 1N64H 4FG6C 2WKOF 4WWKB 5FYKE 3L9EA 4QXGH 2O93L 2CGRL 2XWTB 4XI5D 4A63A 4NDMA 4X5XA 5AB1A 1K4DA 3BPNB 3PWLA 5ERWA 2J8UF 1SNCA 5J9PA 2VDPB 4GKKQ 1E40A 1TJGL 3DROB 5CWSB 4LP5A 5DUPL 2VXTH 1DJIA 3DETD 2WBJA 3SGKC 3AFPA 3X1EA 5L4JA 1JZ6A 1W72B 1PCSA 4LCWE 2VDNB 3F7RA 5HGTA 3FOLA 4M4PA 2WWKO 3CSGA 3FB7B 4OLZL 3QFJB 1SYCA 4FFZA 2XBZA 1O78A 3KCPB 4GOPA 1ETA1 1MQ8A 4ELME 4KOBA 5E9DA 5FWQA 4ME5A 4TKWA 1OCRB 4ZZFA 2MQ0A 3STBA 1OZUA 1JV2A 3DUSB 4S1QL 5DFWH 3AQYA 4K8IA 3WAJA 1YEIL 4DU9A 5C3XA 8FABB 3B43A 1VDZA 1Q4NX 1U8CA 2XWJB 2DQGH 3UBXA 3UXFA 2V9RA 5HYJE 5EFIA 5C6TH 3DJZA 4FCHA 4QKXB 1RKNA 2OBGA 3RNKB 1AZZC 3WO4B 1JDAA 1JI2A 1OLLA 2EKSA 1BP3B 4HETA 2B14A 4IOFC 1A25A 3WNLA 4O5LL 1SN2A 1J8RA 4KY1L 5ANMA 4NBXB 4QF4A 2DTSA 2VQ1A 1KEGL 3HI6H 5EPMB 4MN3A 1FPTH 4YSDA 2E7LA 4LBEA 2KZKA 3B7RL 2A68D 1NBYA 3EBGA 5JIMA 1I85A 3QQ9C 4C4KT 2O26U 4M7LH 2F0OA 4J4PD 5EORH 3BRDA 3AQQA 5CBAE 3QEUA 3D33A 3R3OA 1G7QA 4HEPG 4PREA 1QILA 3RWHB 1ZEQX 1TY2A 3OR6A 4OAWB 2VKXA 3L5WA 5E6ZA 2G3XA 1SNPA 2YOAA 2B3IA 5A7EA 5BR8L 4WENB 3Q2LA 4Z9CB 1UAPA 3DIFA 2D7TL 3EYVB 5L8LB 4HKXA 1TZIA 4ZDHB 2OP4H 5DJ0A 3F5WA 5AZ2L 1ICTA 1D8LA 3UH8A 1JXFA 1LT3D 1HZBA 4HIXL 5K1NA 2A6IB 4WI9A 5HY9A 1TZHA 3PGCA 2WSPA 5FO8A 1SJVA 4KKRA 4L3EA 2Z8LA 3V7MA 4FFZL 1HE8A 5CCKH 2A6EC 1E3XA 3E5SA 2R0ZL 4U1SB 3HS0A 5IHWA 5KN5B 3EF7A 1RZFH 1QLEL 3D07A 3FTZA 1S40A 5C86A 1AJ7H 3VD3A 4PV8A 1EY8A 1WO2A 4J12A 3V0VB 3WGVB 3OZ9L 1U8MB 3RTQD 1EIFA 2H3XC 2R3ZA 5LB1A 1JGIA 1CD0A 1BAGA 3UC0H 5IP7G 1GGTA 4O9HL 3QJHB 2WOBA 4DAYA 2RDHA 2FMCA 1OP4A 2YAFA 3FSOA 5FDWA 1DLHA 5DK0A 3WMPA 3J81L 4JRLA 3EO1B 1BXVA 4KMTL 5ES4B 1BBDH 4NO2B 3S37H 1A3UA 3GBNL 2AV7A 3RZDB 1UWYA 3PCYA 1KC5H 1PGRB 3PL6D 1C5BL 4HQQH 5EF2A 1C8CA 3MNZA 1VQJA 5IZ7A 1PV4A 5GGTA 3I50L 4QTHA 4PSPA 1Q7YC 1BYPA 1O9ZA 5J1SC 3RTQB 3ZUCA 5M3FH 1L0XA 4MA8H 4AG4H 4CJ0A 3HMWH 2XTSA 2H1XA 2DJSA 2R83A 5A2LH 1UVQB 3HCVA 1WIUA 4KPHH 3D0AA 1EZ8A 1DFBH 1T1WB 3L9RA 3WNIA 1UZ6E 1CFTA 2WBKA 4XOBA 3S17B 3WJJA 1XTDA 3PL6B 4FXKB 4DP5X 1JORA 4G8FB 4UI2A 1F11B 1WBXA 5AQ0A 4OM1L 4WW2B 2DKSA 3CX2A 3S1NB 4MZ2A 4P46D 1PH9A 3HOYG 1WAPA 1RUKH 1AHWB 1AKJD 4P05A 4TS6A 3POHA 1UEMA 2R27A 3FTXA 4XNZC 1FRGH 1NPJA 4ZK8A 5H94A 1KMGA 3D8GA 1IAOA 1RUQH 3QI9A 4M7ZC 4K23H 4LEOB 3VGEA 2BM3A 4QOKD 3VYRA 4CVZA 1EK3A 3D25B 3Q24A 2UWEA 2UZIH 3QEHB 5LBVA 4AV5A 4MYPA 4PMFA 1BZ8A 2Q7YA 5KOMC 1CHPD 1XCQA 4NRZB 3N85H 5A3ID 2I07B 4CMMA 3PGZA 4A2GA 4AGQA 1K85A 1C1EH 4LASH 3T4AB 4JPVH 1SNQA 1KY6A 1KSRA 3V5HA 5J3HD 3MLYH 4XCEB 4KVCL 1JHTA 3DYMA 3CCEA 1SXBA 5HURA 1EHNA 1UACL 5JR1H 3SHLA 3EN2A 4X6CA 5CEXB 4L8SA 1E5ZA 4HJEA 5GGTL 3FT2A 3K91A 4L5FH 1A14L 3FQ1A 5BZZA 5LXVA 2WAQA 3ZDYE 1V7NL 3GHEH 1N33L 1KCRL 3VI4E 3BP7B 1JMCA 1Q9OA 1TTCA 4NN6B 4JKMA 3E9IA 2FXQA 5FYLL 1QATA 2JA8H 4ZOEA 3G5ZA 1A7QH 3RWEA 1JNNH 2F0TA 2YARA 1E5YA 2UX7A 5IB5A 3W11C 1OF0A 1AP2B 2NW2B 2HFTA 1J6QA 1O7VA 1C9OA 3P11L 4YHYC 4AY0A 2IH1A 3DURA 4ZMZA 4NSKA 2KQMA 1DOLA 3WSQL 1F4AA 3FRUB 5E4AA 1AQDA 2J88L 4APQA 1P2CB 4HAGA 4LB8A 1V05A 1QR1A 3FUIA 3C09C 3EYFB 2YAEA 2BCMA 2J44A 5FKPA 1F9RA 4XB3A 4BXVA 4MQXC 3R0MA 2JCCE 4WWID 1SY6H 3VWKC 2K8QA 5GJSL 4AIEA 3WO3B 5IGXL 2EJMA 1TJHL 2ZX9A 4D8PB 1Q72L 3KDMB 3QWRD 3K5SA 4ISVB 4CDGC 4B3EA 1QEWA 1SUHA 5KVFH 2XU9A 2DJFC 3C8DA 3VGHA 1A7OH 3UAAA 3VNYA 6TAAA 1QTSA 1EOTA 4EI5A 4OD1H 3OJVC 2ATPA 1Q81C 3APNA 3U4KA 5DMYA 3GXIA 4U0RC 4OJEH 1Q0XH 3O6LH 4YZFE 3ME0A 2JLPA 4X7SH 2UU9L 3PWUB 5FS5A 2EVFA 3NE5B 1GGUA 4P9ML 4X0KB 4DESA 1BX2A 1PG7L 4FFYH 5GADC 2K5NA 4GKKL 4JPKL 5F0JB 3ALPA 4FQ2L 2X4SB 5JOBA 2MHAA 3IMTA 4P5TA 5L4MA 4XMVA 2FQEA 3MRPB 2OT2A 2ICEA 3RDTC 3MROA 1NUCA 1AD9A 2B2VC 2CDEB 4ZTPL 5C07E 4K9EH 1PTOF 1NMFA 1ZKAA 2GC7C 3H1ZA 4DKEL 4D0CB 2UUDK 2C9OA 2VABB 3T0XA 1CFBA 2VUMG 5KTEL 1W72H 3HW7A 4QLWA 2VDNH 2A1WH 3P9LA 1BMWA 3C5JA 5ELEA 4U49A 2FECL 4FQQB 4LF9Q 5DD6B 1B50A 4ZD3L 1G0XA 4GSDL 5JMOC 1X3FA 3L4CA 3VDAA 2R1WB 2AEOA 3DXAB 5CBEA 4L1HA 4KO7A 3CQZB 4IZ8A 1EIHA 1FQ9C 3QJZA 4GBXD 4I0KA 3ULVC 1IBLL 1ZT1A 4QRBA 4M5ZL 1EY7A 1PPIA 3NPSC 4LCCA 2XN1A 4NN5B 4PJ7E 3LNFA 2E86A 5CD3A 2IFFL 4PR5A 4KITB 1VACA 1OVZA 1BVZA 1KXVA 1VQ4A 2JK5B 2YU9B 3MLZL 1O7YA 3PO2B 1FNEA 4WJ5A 2WLKA 3BUYB 1OGAA 1GHFL 4POFA 5JORA 2P5ZX 2YFNA 1OXTA 2Z35A 1N7ML 2BY2A 1AR1D 2IDUA 5CJQH 5ALBL 2G0LA 3T2QA 4JI4Q 5DHMC 3WFCL 3W0WE 5GZOA 3EJSA 2HH0L 2EO7A 4ODXB 2WLLB 3STZA 4TUOA 4Z0BH 3SDCC 1BQLL 3MV7D 4GKZB 5E1IA 1OSZA 4JM0A 4KJYA 3SD5A 1I3GH 1F18A 1O0VA 2BFVH 4CADA 1RURH 4Q56A 4YMPA 2WXHA 3O3AA 5TFSL 3S88H 4JOIC 4UV7L 1J1XH 2CNZA 3NJGA 2F03A 1Z7TA 1WISA 1XTLA 3K2IA 4NNYB 4WAFA 1RZ8B 5FCUL 5GRJL 3G5XA 3TBWA 3VD2A 1JGUH 4PJCF 1S7UB 5AW5B 2UV3A 1SNDA 4FQXC 1RODA 2Y2WA 2YQ3A 5JDSB 3CQPA 5BUAA 5K9OA 1GS7A 1FFPB 5ECGA 2Z91B 1YQ2A 2OS7A 1CZGA 3CLWA 3K4DA 1KHIA 3QISA 3VGAC 3ULUF 2BDNA 5B39B 1U92A 2F2HA 3LOWA 3K0XA 3S8FB 5H2BA 1P84J 1MCOH 1RK0A 3INUH 3J80c 2AJ3A 3FU7A 2DQTH 4U3SB 4QUOA 1JFQH 3U0WL 2C3VA 1F6FB 4RSVA 3MBEA 2EY1A 1QO3A 2R1XB 1JYNA 1UJTA 3HBPA 3N44F 3VXNB 3DMMA 3IFNL 4HF5H 1LEKB 1OAKH 1UOKA 3LKOB 4KK7A 1OAQH 3GUFA 4NZUH 1DCZA 2DEWX 4YC2C 1AO7A 1IKFL 3L1OH 4LCIL 1ICWA 1F1AA 4PHXA 3GSUA 2X2JA 4E68A 3FB6A 2G60L 1HZ9A 3L3OA 3Q5TA 3M07A 2L3BA 5LN4A 1ZHNA 3T3PF 5HSFA 1BOGA 1CFVH 3W57A 1REIA 1G7HA 1OV8A 3RZDH 1SLXA 3BSGA 4J3UA 5GGVL 1CKOA 2NYYC 4P2CG 2NYZD 4U1IA 2P80D 4QMGA 2DLTA 2XZZA 4WFHD 3K0WA 4FQCL 3AREC 3KMDA 3MRDB 2ZOWA 4BBRG 5I26A 4YL9A 1BSIA 3FFDB 1F3JB 1C7SA 3FQUB 4YXKL 5C0JB 1EEZA 1JCKB 2F74A 1NAPA 4PRDB 5CHNB 4ZXBC 3WV0A 1LILA 2GUOA 1HPCA 5KOVC 5L9DL 3W81A 3OXSB 3QUGA 5DD0H 3ZTNL 5I1AA 3QJQB 3H3VH 5E9AA 4FI7A 1P6AB 4AXWA 3S17H 3TT1L 1I1FA 2BIIA 2IOOA 2Q2LA 1M05B 4B3SL 1MFNA 2XV3A 3KPSB 5AAMA 5CFAA 1U3HC 4HMDA 2YPLD 4BY1B 3BKCH 3S1NH 4G1EB 3M1BB 4N0UB 3KBPA 4ANKA 2CLZB 2XOTA 5JHAA 2V5YA 3LRSA 5SWZB 1YLBB 5D1ZA 4P9HH 5D5ME 1R3IH 2I0QA 3QO0A 3BUQA 1BMGA 3HUJA 4LDOB 4LPVA 4ENEC 3KJOA 1J05A 4DEUA 1KN4L 2KPWA 4H25B 15C8L 3Q8CA 4LO9A 4ZRZA 2CD0A 1QI3A 3NA4A 1D7BA 4V1DD 3MNMA 3DYOA 3VQLA 1MNNA 1ZVSA 2J4XA 3M4QA 1FP5A 2HP4A 3TNNB 1VCIA 1G9MH 1X5AA 3NCMA 2Z7YA 4M7KL 4MD5B 1UWVA 3CHSA 4POZD 2DL2A 1Q1EA 3Q0AA 5CD5C 1HSBA 1JVLA 4AW4A 3N41B 1YDPB 1B3IA 1MJJB 4CSTA 2NZ9C 2WQ8A 2A4ZA 3PGFH 3V52H 1FH5H 1NBZA 3LB6C 2F0JA 4GT0A 4Z3GA 1FNVA 2BHUA 4V1DB 1D7FA 5CJ5A 2VSCA 1DANU 3L4YA 3QCVL 1CIUA 4C3JG 4ZQTA 2AP2A 4X5RA 1NCNA 1MELA 2AVFA 3JUYA 5DJYB 2F0IA 3GLZA 4CKBA 3H9ZA 1PD0A 3GTNA 1XSKA 2D31A 2FD6H 2YLHA 1KB9K 4RNRA 3TH4T 3MLXL 4Y1SA 1MCKA 3TBTB 3X17A 5EU6A 4BFGA 3CQQA 3L7EA 3OKNB 5M7QA 2FNBA 2QHLA 5C71A 4Z7AA 4K3GA 5HYIA 3EH4B 1PA6A 1YEFL 4U6VH 4EQ2A 3RNQB 3U4ZA 2OYKA 3CTTA 3N1FC 3IT8D 5JOFA 2IADA 1HOEA 4PGJA 1KQSA 1JPSH 5C3WA 1LTAD 1MAKA 1WAAA 5EOTA 4M7ZB 2JK8A 4AK2A 2GTWB 4B3TQ 1EV2E 4OVVA 2JB5L 4OZFA 1M6OA 2NQ3A 5EUOF 4H20H 1IU1A 1QSFA 4HHAB 5IV2A 2Z6KC 1N0XH 4G42B 1DQLH 2B5IC 2D03H 2QMJA 3QZPA 1X5MA 2VH5L 1NIDA 2YRLA 3AB0C 1WWWX 2JA7B 2FWSA 2CK2A 1IT9H 2GY7B 1FNGB 3V0DA 3E6FB 4DAGL 3EO9L 1HINH 4LOUD 2MPAL 1F5WA 5F6IC 5AVUB 4TUUA 1XF3B 4J3OH 2JF1A 4OR1A 2NXYD 4W4OC 2XJKA 3IU4L 5CSBA 3MV8A 2EDXA 3VACA 3KPLB 4OJFL 2X69A 3CXHK 1RIUH 3U7AA 1FYTB 4U68A 1KNAA 1T5WA 4PRNB 2R1YA 1PZCA 3KBFA 5KS9E 4PJBE 3B7UX 1EXUB 1DYZA 2QILA 2ZPKL 4G7ZC 4I89A 1JXJA 4PJ8C 3WIHL 3PAYA 4QDGA 2P8PA 1ZLUH 1K3ZA 3D48R 2X2UA 4DV3L 2BVTA 2AWOA 3MFGB 4Z7IA 5DJZB 3MNVB 3DPBA 3QUZD 1ZMYA 1CE1H 3MRKB 5EQ0A 3VWKD 2ADFL 1BFTA 5ETUB 3U9PL 4DQAA 1A1MA 4QXWA 4YDIH 3BESR 1IM9B 2B08A 4YHYB 4ZSOB 2J2ZB 1VZGA 1CXIA 3FQNA 3FPPA 4CJ1A 3S2DB 1PEWA 1G7IB 5I1HL 4WO4D 5CEYA 3FPXA 5IUSA 1XGQA 3FW6A 1G9NL 1MJ7L 3K71A 3IDJB 2GA4B 2NQDA 3QNZA 4QNPF 1M7UA 4LT7A 3ZGHA 1SM3L 1VADB 3N1PC 3NZ8B 4TULL 5AKTA 2Q87A 1JPEA 3MOBH 3WFEH 1V10A 5GXBB 2XJLA 2MIZA 3GHBL 2NZOA 3OHXC 3MRFA 3QUZB 4XXWA 3VWKB 4UP7A 1KCSH 3CQZH 2GN5A 1TVBA 3U48A 2K32A 4JO3H 4HPYH 2X4UB 2EXZA 4Y5YB 3ASNB 5IB2A 1ET7A 4ZFGH 4NUPA 5JMRA 1PZ5B 1A3VA 1B88A 4XWGL 4YDVB 1CE6A 4PGCB 4HK3N 1XGUB 3IBOA 5H35B 1A4BA 1KENH 1MWAA 4XNBA 5F7NC 4MAYA 4JCMA 3F2BA 1A1NA 4ERSH 4ZOAA 2X53A 3HZKB 2YU9H 3IAGC 3PO2H 4LU5H 5KIXA 4AK1A 3NSCA 4U0RB 5CILL 3JAML 2EDGA 3SKNA 4ATTA 4EJ1C 2QEJA 2HRPL 3HC0B 1DBBL 3DECA 1LV9A 4NHCL 2LXKA 1LQSR 4MA1C 4W4NA 3R93A 1THCA 3Q3GA 1CTMA 5ELFA 3JVFC 1G7JA 4YE4L 1SGKA 2BS71 3A0JA 1KY7A 3IF1A 1KRSA 4IJ3C 3FTWA 5HDRA 5DJXA 2IG2L 2VW6A 4M43L 4QOKE 3K6SB 4JRWA 3RDTB 3BZ4B 2B63G 4PH8A 4N0YH 4A3LH 4LOEA 1BVNT 3CZNA 3MHZA 1EY0A 3FN0H 4BXXG 1XSIA 3EW3B 3PAUA 3MYJA 1U8OB 4HSQA 1F56A 2JLLA 2YD0A 1Y1VB 2ZJPA 4KY7A 1L3NA 2QGQA 1WTLA 2YSTA 4AQ8A 2ZQKA 1OB0A 4AYID 5EPLA 1YN6A 1UXSA 1S9KC 1PX4A 2NW3B 3DNKA 2DQHH 5FFOA 4HCSA 1TQBB 4KI0A 4M6MH 4FG0A 5IYBG 3GMLB 4UT7H 4AC2A 4JJ5B 2YGQA 4YFDB 4MTKA 3G7TA 1GZHC 5TDOA 3UO8B 1YEHH 4C56A 2FBOJ 2J20A 4FAAB 1KCVL 1JWUB 3B2MA 3VG9C 2X4RA 5CLZA 4WGKA 3LIUA 4XP6L 3QA3A 1STAA 3DX6A 4JO2H 3PO3G 2VAJA 3MRMB 3RL2A 3CCVA 5JPNC 1GYWA 2CKZB 3GXMA 2GI7A 1FC2D 3GGWB 4OO1H 1OK8A 3SYOA 2DM7A 1UM6L 5IMKB 5A2BA 5TQ0H 4AJVA 3JWOC 3V6ZB 3VJ6A 4G43B 2J43A 3FO9A 1JF1B 1KB5H 1I8LA 1NCAH 2J7ZA 1CGSH 1RLWA 2I5HA 1IL1B 1K6QH 5JIHA 3CFJB 1H3TA 1MCEA 2PXYD 3NT0A 4M8QB 3S3DB 2LLLA 2WIIA 4YHOL 3QDJA 5CP3A 1AGEA 2QSVA 3MX0B 3ZDWA 1GMEA 4Z76B 1C5CL 5EHFA 5BN5A 4ADGA 3AJ7A 1GHKA 3HZVA 4YXHH 5L7XL 1X9LA 2GSGA 2RCSL 5IVXB 4OBSA 1IBGH 3TF7C 1YMMA 4PJEA 1XX9C 1E8WA 3LMJL 2KCCA 5ILTH 1VZIA 4FQXB 5DJCB 3QYMA 4Q4IA 5AKVA 1NGYA 2YUWA 3ALWA 1QPKA 2JKXA 2OYMA 5TTRA 5AW9B 5JZ7D 1JOKA 4GSQA 4PLOB 3NZHL 4F2MA 5T1KD 5IJBC 3BUTA 5KZCD 5DJ2A 1MIEH 2YC1A 5ESVA 3VFWB 1OSYA 4P3DB 1ITBB 4XAWL 4HC1A 1FBIH 2DMKA 1N2RA 1KPUA 3X12B 1QRND 4AMXA 5C0GA 4MNHA 1IGTA 2BO0A 3GXUB 3CFKA 1U4PA 1U8LA 1EIBA 4LFAQ 2A6KB 3K2KA 4O2EA 1DJWA 4RAHA 5EPKA 1CF8L 2WUBH 3ARED 1VQBA 1K0SA 2WBJC 5HYEA 4WHTB 3W2DH 1QUPA 3PWPD 1EHKB 1ZV5A 5IBLC 4YC2B 3EJUA 5E2JA 4JLRA 4PJDA 4WSJA 1A9BB 5E2UL 4ZXBD 5T1KB 4EI6A 5KZCB 2BSTA 1VB9A 1Z3GH 5KVDE 5JLZB 1PCXA 3BDBA 4A66A 2FL5A 4P3CH 3STBC 1RHHA 2YR3A 4L4JA 3VVWA 1AD0B 4QHKJ 5DQ9B 1ZLEA 1CBVH 4P2OA 3FONB 4KGJA 1HJBC 1U3HD 2Y07L 3ARGC 3AREB 4L4TD 2JA9A 1GGBL 4JPWH 2Z93A 5HI3C 3WFHB 4EMZA 4RLDA 4QWWD 3SJVD 3CDZB 2CK0H 1PY9A 3BW9A 5HDLA 4K0KQ 4JPQA 2K1BA 5F7EL 1ASZA 1U36A 4P2QD 3IFDA 2O4EA 3KGTA 4ZXBB 4N1HB 5AVQB 4PWFA 4D9LL 4OLYH 3VWJC 5C2BL 3X3FH 3RWFA 2NSMA 3SE8L 1GYUA 1L7IH 4JDTH 3TWCL 2ZOLA 4GKJL 3ABKB 3PWJA 1VGEL 2EILB 4NI3A 2C1PB 4NCDA 5CJOL 2E7LC 3T65A 4JE0A 1U3HB 1JOOA 1SLUA 5EOCL 4A3LG 3MODH 2JWYA 3NJMA 1PKQB 4G7HC 1MUJA 3ROOA 3NACL 3Q2VA 4WRLA 2D3LA 1PH2A 1TWAB 3BVWA 1F02I 1AGCB 4RCOA 4FXLA 1PIFA 4X7DC 3K4ZA 5DZLA 4LPXA 3O41A 4XPFL 3O6MH 1CK1A 4N8CH 3MV7E 1YQVL 1NMBH 1R5WA 3SDXF 5HVWA 5GAHC 1A1OA 3D4ZA 2WB1G 2V9QA 1K83H 5I6YA 4IO9A 1M42A 3PPEA 5JW4N 5IVNA 1Y6NR 3WJLA 3O6KH 4ODTL 2JA7H 4Q9BA 4K15A 1CQYA 3BD3A 5I1CL 2QMKA 2BA1A 4U1JA 1JNHA 4HKJB 3HS0C 1B44D 1NM9A 5E6IA 3L3DB 2HT3C 4PRPD 3GPEA 3E2HC 1PTOD 3VXRD 5KVGE 2YTVA 4BKLA 1RH8A 2XPGA 5D7KD 5IFHH 5I24A 3BP5A 2AQQA 1R3HA 3VXQB 1BQQT 4MTMA 4CW1B 1E4XI 4L8BB 3EFXD 3BZFA 4KQ3H 5CEZH 4MJ5B 3E3XA 2IJ0C 5F6HI 5K9JL 4JFPB 3J81c 1H9DA 3U25A 3QPQC 1QG3A 3S1RB 4X6DB 1T5XB 2J6EH 4ZMOA 4PRPB 1CA6A 1CWVA 5HHPB 4Y2DC 2HTKC 3EYSL 3NJLA 3CCQA 5KBDA 3A67H 1MI2A 1HUNA 4GNKB 2NN6G 4NQCD 5JPMA 4DERA 3HKSA 1KYOJ 1JG9A 2VGLM 3S2DH 3H0TB 1S7TA 3WFDL 3EYOA 4AOFA 3GLDA 3V7AE 1V3LA 1IGCH 1P7HL 4XX1G 3S4SG 4RA3A 2AJZB 5T1GA 3IFLL 4DUYL 4OQ1A 1N6QL 2CPUA 4CVXA 1SNMA 3T0EA 1S8DA 1NFDB 4OJAA 3CXFA 3VDCA 4MCYA 3KUPA 2FLMA 3KPSE 5DYFA 2FHTA 4WFHE 3WJJC 2B5IB 2QR0A 4BGLA 2K78A 4N0UE 1SSOA 1DQJA 3QH3A 2N7AA 3QUMB 3VXMD 4TLTA 3AB0B 3IDNA 5L6YL 4XNYL 4LK1C 3P54A 1LO4H 3D05A 4NQCB 3VFUB 2AJXL 1OAXH 5D65A 1DTUA 3UYPB 5C0IB 4N2DA 1IGFH 4AYFA 1B3QA 1XF4A 2X2YA 4XMLL 5I76B 4JI3Q 3G04A 3QI9C 4P71A 4WW2F 5GQOA 1BJ1H 1IAKB 5I17A 4ZUWA 1Q9KB 4AGLA 2DBLH 2ZONA 1GH7A 3W39B 5E23A 3RVUD 2Z31D 3VXUA 4ZW8A 2YPLE 2X89A 4MDIA 1NTDA 1CF1A 3VXMB 4Q6YA 1DOKA 4BFOA 2SODB 3Q9PA 4FX5A 1P1ZB 4ZNEA 2CLVB 4K8RL 2YV5A 2K8MA 3GBML 4UNVA 2OEOA 5HHXL 4KLKA 1IBFA 5JHDA 4F33B 3ICEA 1HWGB 4HJ8A 1AGBB 1AHMA 1IEBA 3FKIB 2OR9H 4V1DE 3PHSA 2ICWB 5IT2H 2W59A 2ZICA 2OMVB 3WNNA 4TSAL 3DPDA 3H9HB 5BXFA 4I3GA 5FOBB 4GQZA 4YHKH 4DP8X 3HKZA 2XZQH 2XQBH 1XD1A 4L8SC 4X8CA 4MWFA 3BXNB 3P73A 2Q6WA 3U7YH 4M6NH 3VFGL 2VISB 2X70B 1Y1VH 2VN5A 1YECH 2WTRA 5IGEA 4KKCD 2Y7NA 4NZRL 2PYEB 2WSDA 1FGVL 4WTZA 3VA2C 4RIRB 1RXLA 3T3MB 1HZKA 3OHXB 3BSZH 4CNIA 1QBAA 3EO0A 4Z5RA 2DBJA 1WFUA 5K36H 3GI9L 4FTVA 4KHPQ 1I6VC 1VQGA 2VRKA 3RA7H 5L2JA 3ULVH 2BXZA 4MDRA 4FADA 1K5NA 2OPCA 4G9FA 5D14A 2E8YA 2OZ4A 3MQIA 5GS1A 3WEMA 1P4BL 1T3FA 2Q3ZA 3MCYA 3PDOB 5GJTH 3N55A 4P4RB 5BNXD 4EN2A 4JVZA 1G1OA 4APQC 4A3DB 1KBBA 2ZOKB 3L3JB 4N2OA 2B9AA 3IRZA 4U33A 4ELKA 4PJ5D 3REVA 1T9HA 4EZMA 1O6TA 3BKML 3DTXA 2A9NH 2CO6B 4EN3A 4JRYA 3SDYL 1FNWA 3G6AA 4E9SA 2AEQH 4MA1B 2JA6H 3MC0B 1T4WA 3P40A 2FWUA 3UC2A 3VRLE 4YOKA 4OX9L 2PMZB 4M1DH 4TVAB 3TEHB 1S5IL 2DQUL 4S0SD 2XVSA 1AXTL 4LSPH 3VRJB 1BZDA 3OD3A 4GW1B 3L4XA 4LL1A 5AEAA 1BGXH 4Z8FL 4MRBA 2BMKA 1E6OL 2WM0A 3TS8A 4PJ5B 2AQNA 3C08L 2DLIA 1Y07A 4XWOC 1JD7A 2VERN 3FO1A 3DGDA 3D50A 4J3OF 3NEXA 1ZK5A 5GQBA 3TBIB 3LZFL 3HZ3A 3KD4A 43C9B 3SOBL 3RY6A 1KBWA 3H3VI 2F4VQ 2R2BB 2J8UE 2OQ0A 2WVSA 1AGDA 1SBBB 3KDFB 1TOXA 1CQKA 2V3DA 3DJTA 5KYWA 5CU5A 2EDQA 3KZ8A 1BIIB 2HQLA 4OD3L 4UYPA 4LFAL 4U1MB 3TBVB 1K0RA 1UD6A 2FINB 3EOBB 1TS4A 3QEGL 4OQTL 5C0XJ 4PCYA 4UQAA 5FOJA 3AG2B 1EO8L 4B7IA 2ICEC 4GXVH 3TJHD 2F0HA 1VQDA 2ZXGA 1PTZA 1RKRA 3EOAA 3Q01A 4GT7A 1OP5H 5CS7A 4UTBL 3DHUA 3VG9B 4ZOBA 3HN3A 2GITB 3QQ4B 1Y18B 4R4BA 4W9LC 4B9XA 5D93C 4D8OA 3S9DB 4LEEA 1UM5L 2WB7A 3E9UA 2F7QA 4N85A 4Z7WF 3GJFK 1RK7A 1VPOL 2W0FB 1GKHA 3C9NB 3FBQA 3KDPB 1INDH 1YYLH 2DLEA 5I28A 4NP4H 3OWFA 5TGBA 4FXTA 4JI2Q 3VW3L 1U8QA 1EQRA 1KAAA 2YGOA 4RDBA 1F4WH 5EBMA 1OM3L 2AQSA 3FU3A 1C12A 2DQDH 3L2LA 4GW4B 4BZ2A 3ETSA 4POYA 1PZ3A 3EJQA 3LNGA 4PW3A 1FVDA 4K0KL 1DN0A 3HHMA 4EVOA 4LCCC 2CH8A 3U82B 2D62A 1DD2A 4E9VA 1FIGL 1R75A 2XTJD 3QUKA 4XMKH 2W9LA 1A6XA 3CKIB 1VCBC 3IPFA 3N5AA 3QP3A 1FNAA 5JO5A 4MJIB 5C0AA 4MMZC 1T1YB 3QHZL 4PTUB 4PJHA 1F4XL 2KLRA 5D9SB 2YPKB 4A3BB 3S5LA 3TIDA 5CV6A 1WI5A 2L12A 1HKFA 3MLWL 4DGWC 1W16A 3U1SH 3PWVA 3FTYA 3BYYA 2BY1A 1E3PA 4XO8A 1MOEA 1WTXA 5CZVL 3DX7A 1PY4A 3MYZA 1BBWA 5T1JA 2WP8J 1GYCA 3Q44A 3KLHD 4RBPH 3QJFA 3PWLB 1PH7A 4CDFC 3UJJL 4XN2A 1TWAH 4W9ZA 4B9FA 1V1QA 3CCRA 2BRRL 2W88A 1CMOA 1FL3A 1VJSA 2IPKA 3ARGD 3SY6A 2WBJB 4HULB 1DBJL 1MCBA 3NELA 1NANH 5G55A 4QXTA 1ENAA 4DVBA 3NK9A 1DHKA 2C3WA 1YZZA 4BZYA 1TQCC 3D0LB 3WJMA 4OGYL 4LXFA 4F58L 1QQDA 5IG7B 3US1A 4UT6H 5TE7L 3VWJD 5E9DB 1LL1A 3RU8L 2DWXA 3DMUA 1BPVA 2HLFC 1QLEB 2L8AA 1KPVA 4MQSB 2H32B 3MGTA 3DUUA 3VFSA 5F9JB 3V9FA 5FWRA 3CVHA 1T4KA 4Y5XA 3IU3A 1JTPA 4OT1L 3RUGE 4BZ2L 1QSEA 4OZGB 2ZSVB 2UUAQ 4D0DB 5BJTA 1LK2A 3ARGB 5CV8A 5G3LF 1LMIA 3MBEC 4XCFL 3SQOH 3Q6GL 3SEPA 2NTFA 1QWHA 3DMMC 5DD5L 4OI9A 5IP9H 1XNRL 1X5FA 1XGYL 5GRUH 2Y72A 1OGTA 4LVEA 3J27A 2JA6G 2EKSB 4QYOA 4U6TA 3TO2A 2B4CH 4OFPA 2EDEA 3VWJB 5AW7B 2VT0A 2MRYA 3L3OC 1HH2P 4F8LA 3NJNA 1HKLH 4TV3A 3S1RH 3ES6B 1I9RH 1A0QH 2AF2A 4UP9A 1G5AA 1MHHB 3RI5F 4XPAH 1CLYL 4LBEB 2DIJA 1YCSA 1NBYB 2P26A 2VM9A 3BDYL 5T5FA 3ZRFC 1BCPD 4I77H 4OB5L 3UMNA 2AQ3B 5IVXE 2XQ0A 3PLYA 1VQOA 1XZ0A 3MRRA 4PREB 4A3JG 4J3VA 4ZODA 4A6YA 1XR8B 2XN9D 4WKXA 5CKAA 2HT3D 2F8OA 2EVBA 2LFNA 4KHTH 3L5WB 5D6CA 5GS2H 1T83A 2IT1A 4YCWA 2RA4A 3FPUB 1DBAL 3DIFB 2MNUA 4LE8A 1TZIB 4IPCA 2XPZA 1O7LA 3F5WB 5AOLA 4XOAA 1G4MA 2ZKHH 5DEZA 3WNPA 3QUMH 5HY9B 1TZHB 1D5XB 5FO8B 5FYJU 1TT6A 4L3EB 5AAMC 4JI3L 5COYA 1KJMA 1MCHA 5DT1H 4P2RA 3U2SA 3VYNA 1AVAA 4DPGA 4MNQD 3FUHA 1O7DC 4NKLA 2GAZB 3D6CA 3WKPA 2R7ZH 1T04B 3L48A 1I7ZB 3E2HB 2NUPA 2WGXA 43CAA 4UOQA 1MG2C 3V4LA 3CVHL 3PUVA 2DQFB 1NUNB 1GYAA 2CQVA 3H3PL 5IW6A 2BVYA 2OWOA 3WHXA 3R7QA 5J7CC 1NCCL 1R3KA 3HBQA 4FXDA 2BK8A 5DUBA 1HA6A 1KL9A 4FOMA 5FDWB 5FYLD 4C83A 1NMCB 3QNXA 1MCSA 2BIMA 1HTPA 2VQEL 1QRNE 4OCSH 4WNQA 3SKMB 4KTEH 3GJEA 3CC7A 1DZ1A 4AMKH 5BZXA 4MZRA 2CVRA 3QJTB 2YA1A 3FKIH 4Y2DB 5B3NA 4KK6C 3RVWC 5T1LA 2CAKA 3CFQA 3PWPE 4ULLA 1NJ9A 4QTHB 4R8NA 4EIUA 2J5WA 5T5FL 4JRXD 1TETH 5B3SB 1L0XB 3FT1A 3K1DA 4CJ0B 4H8VA 4L1BA 4OFQA 1UXMA 4OD2B 2Y22A 2Y36H 4DXFA 3HFFA 3HZYA 2JKSA 2WYIA 3P4MB 2V5MA 1NH6A 4KHPL 1QFWH 4I0PD 4Q6KA 1A3TA 1ZSDA 3RGVA 3BN9D 5C6AA 3WU1A 3L9RB 2QQLL 3Q5YA 4JN1H 3GRWL 4NKDA 5E00B 3ZYZA 1CD8A 1SDDB 2FATL 1D5BB 4L4TE 2P5EA 4QJFA 4N2CA 3OOCA 1BKBA 3LH8A 1WBXB 1CIDA 9PCYA 1R0AL 2J8HA 4HSCX 3AQXA 3WYRA 3HAEG 4JRXB 4XNMA 2V2TA 3BEWA 1E0OB 4BGDA 4N2HA 4P2QE 2HD3A 4URTB 3TA3C 2VZSA 3NH7H 1G9NC 1J5EQ 4WJ3M 1EDHA 5EUKA 3DTDA 3PP3K 5ESQB 5H94B 3P4NA 4A3DH 4UP8A 4YWLA 1PJWA 1SMAA 4Y1TA 1QLRA 1BDOA 3NEEA 1HL4A 3Q22A 3K81A 2YRZA 2OTPA 1D6EA 3JUZA 2XVKA 2ISDA 4OO1I 4FNLL 3EXJA 3MOQA 1XT5A 5BOJA 4YIQB 3PWNA 4H26A 2P7TB 4OU3A 1XCQB 3B6SB 3AADB 3NWSA 1ADWA 2YBRA 3DM1A 4MXVE 2BFGA 3H9SA 3S1MB 1FF5A 2OF1A 5LL6X 1UWFA 2R4RL 1K28A 4CU6A 1JGLH 2F7OA 3MLSH 2VXSL 1BQHG 2W9EH 1SFOB 2HVBA 3VG0H 2CO1A 2F4VL 5GGSB 3ARYA 4X6CB 1RD9D 3NGBB 3OKLA 1NGQH 3SCMC 1MAML 1HK6A 3IJYB 2MKLC 5AVZB 1YEJH 4GQ9L 5ICXA 3B2UC 4YSQA 4ODGA 2QZQA 5FUOH 2X87A 4QRRA 2CJSA 3QCUH 4HWBA 4PRPE 3WOVA 1HEJC 4PJXA 3MDJA 2CGRH 3ULJA 3G5ZB 1NSNL 2YD6A 3VXRE 4YCUA 4NOFA 2F9BT 1V55B 2VQTA 1DANT 1IHZA 1TJGH 1RPUA 4PMCA 3NDZE 5DUPH 1I4FA 4M1GL 3CPWA 2SEBD 3ULSA 2RA1A 1KIPA 5KJRL 2EYSB 3FF7A 2G4EA 5ELBA 4OLZH 3ISRA 4JI2L 3S9WA 4ZPTA 5DO2C 2NVYB 3TZDA 4J3XA 3E38A 4EZJA 2NVXB 1QR1B 1NFDE 4XOCA 2QVIA 2PO6A 4MJ4A 4Y1AA 5AB9A 1EDQA 1V8QA 1S7VA 2A6JA 2WQAA 4ABQA 5DI8B 2Y06L 1HHGB 4BD4A 5GGSY 1KV7A 3L7FA 4A3MG 3HKFA 4XXWC 1SFDA 1YEIH 4UT9A 2XWBA 4NQCE 2FVNA 3FT3A 3B5HA 2HB0A 3AXHA 1QZGA 2R7ZG 3A23A 3HE7D 2CG9X 1SZNA 4OWTB 3ZJYC 2SEBB 1J48A 3SY0B 1E30A 2XX0A 3N42F 3SKJL 3I4NG 4KNUA 4YSPA 2QGBA 5A40E 1WJ3A 4LGSB 2GB2A 3RMHA 1QWUA 4MAYC 2XQYA 3OV6A 3RX7A 3P02A 2IXQA 4O5LH 5HPMA 4IKNA 3QUYA 4KY1H 4YDZA 2Z0UA 2L55A 2ATPB 3VXME 1KEGH 5HYQA 1OXSC 1XBRA 1KIXA 1PLGL 1WDAA 5CN2A 1JYVA 1YBYA 3PPSA 4A3BH 3A54A 3VI3E 1S72A 5TQ2L 5M5WB 2W38A 3V2AR 5KSAA 1X9RA 5HY6A 3L5JA 4PWGA</