5JPMC

Structure of the complex of human complement c4 with masp-2 rebuilt using imdff
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
287
structure length
287
Chain Sequence
b'VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpmC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpmC01
2E2DC 3G6JB 4FXKC 1UEAB 2WIIB 1OO9B 5FOBB 1UAPA 2I07B 1JB3A 5JPMC 4D94A 2B39A 2QKIC 2WINB 3CKIB 3HS0C 1AYOA 1BUVT 5FO7B 1GXDC 2XWBB 2A74C 3L3OC 2PN5A 5FO9B 1XWEA 3FRPB 4LNVA 2A73B 3KLSA 3V96A 4ILWA 2XWJB 1D2BA 3T4AC 5FO8B 3OHXC 5JPNC 1PXUA 2J0TD 2TMPA 3I70A 1EDYA 4FXGC 1BR9A 3CU7A 3MA2B 1JC7A 1BQQT 2ICEC 1BV8A 3HRZC
chains in the Genus database with same CATH superfamily
1TG8A 3NJNA 4G9FD 4KI5D 3RUGA 1R4QB 1S7UB 3L5IA 3NPSC 4YHKH 2OMUA 43CAB 1DFXA 4NHCH 1MCFA 4KNSA 5C1MB 3P2BA 3FU7A 5F7EL 5IW6B 4HUVB 1PFBA 3MRIA 4PJIF 2FX7L 4EI5A 4D0BA 4I3RL 1YNTB 3PRZA 3VXSB 4FZEH 2CHZA 4PGEB 3Q2VA 3TT3H 4JB9H 2J2ZA 1FE8L 2O5YH 5E8OA 2YEZB 5J12C 4PJFA 4HCSA 1UUPA 2VDNB 4LNRA 2EIBA 5I8EB 4KI5F 3VFMB 1QNZL 2BS9A 3PDOA 5IQ9A 3QO1B 3EYOB 4L05A 1QFWI 1FIGL 2SNMA 3SR1A 4R8IA 1ZK9A 3H56A 2JI1A 2EP6A 3IFPA 2YTXA 4R8NA 2I0QA 2CBTA 4JKNA 1KY6A 2PCFA 3DTUB 2ZKXA 3HC4L 5DMJB 3VXRD 4F93B 3BYTB 5FHBH 4F20A 2X4PA 2XSCA 2MCPL 2JYOA 2WB1G 3ARUA 1WFUA 1WP6A 4KY1H 4O2EB 4HEPA 2DN8A 4JKKA 5ISZD 4GQQA 3EO9L 4JI3L 3DLLA 1T04A 1YEHH 4CSPA 1UJ3B 1XIWA 2VDMH 3VB8A 3BP4A 3OKYA 4K7PX 4TXVB 4CW1A 1X56A 1T4KB 1NH6A 4YVUA 3SPCA 1CLYL 3JTTA 1OL0A 1YMMD 3NCWA 3WEBA 4ZMTA 3WU1A 3CFBB 5JW3L 1U3ZA 2VQ1A 4FNUA 1NDTA 2BFVL 3AXIA 1OOAA 1OXSC 5JOPD 3KLHD 1NBQA 2C35B 3I6SA 4HJJL 4RMVA 3H6MA 1UXMA 3SYCA 4BY7G 4GIAA 1AY1H 3OKLA 4O5LH 3ZN6A 5B4MD 5I6NA 2X1QA 2GI7A 1LTTD 4QQBX 4XMPL 2P49B 4ENEC 4HIOA 4I1PA 3W5NA 4JI5Q 3P77A 5HHNB 4LMQE 4YS4A 4JVZA 4G6ML 5ANMA 3HUJF 4TRPH 4Y2DB 5KVMC 1OAXH 4PB9L 3P0VL 1SYVA 2LMCB 3QEGH 1I8LA 4P72A 2N4IA 2VMEA 2GG1A 4CJ1A 4XC1H 4KTYA 4BFIB 5CZXC 2GEQA 4P4KD 5DT1H 4LFCQ 2VDLB 1GGIH 4OZHB 5CIPH 2IO5A 1D7BA 2FR4A 3DMMD 5ENWA 3L3IB 5D7LD 1WIOA 3FFOA 3O8XD 4KGLA 1KRSA 2EYRA 2XN9B 1EERB 1L3WA 1T4WA 2DQDL 4FFZA 4P2QB 2X4QB 2AEQL 1Y1WH 1ITBB 3R06A 4LQFL 4Y1TA 5EHFA 4U4BA 3BN3B 4ZT1A 5IMOA 1CZWA 4QOKE 4JUTA 5DD0L 1EJFA 5IBLD 4U68A 5IJDC 1TTAA 3APFA 3B9KB 4MS8D 1AGBA 1LNUB 3BAEL 5K59E 4GAJL 2VDKL 4X5QA 4LBEB 5HDOA 1Y14B 1QTSA 2PR4H 4AQZA 1G7HB 4BHUI 3HG1B 4UQAA 2EUXA 4EMZA 4ENZA 2JA9A 3QIWB 4NZ8A 2XTSA 4JFYA 5B8CA 4PMEA 3QFJD 4IBWA 4JHWL 3CXDH 1RUKH 3MOAL 1KFAH 3F7YB 5E1IA 1ZGLB 3AAZB 2GSIA 3I6LE 4GBXA 4PHZA 1RD9D 3FSAA 1QKZL 2XBTA 5I2IB 4LLQB 1QA9A 4XN4A 2ESVA 3T3PB 4H1LH 3C3LA 4P2AA 1S9WA 4WK0B 4XBGA 3UBXI 3ZUCA 3L3KB 3ARDB 3WBDA 4BFFA 2VUMH 4B3TQ 2DBLH 2XYBA 5BS0B 3WFZA 1XHHA 5CEZH 3QO0A 3VD7A 2NYZA 2WVVB 4AVKA 3W39A 3KMDA 3KJ4B 1S7WB 5BV7C 4YDKL 5HI5C 1UE1A 2JXMB 3GIZL 4DVRH 3AT8A 1LYQA 5M94B 3I75B 4DTGL 4PRDB 3L5XH 4DFIA 3T4AA 3QQ9C 5KSBB 3WN5A 3WKYA 3PUYA 3H3KA 2EQDA 3MPCA 4HPOH 3L3DA 1GZHA 5FXCH 1X54A 3VGHA 2EE6A 1D5MA 4HJEA 3ETBF 1DBBH 3BT2L 4XWGH 1JNLL 4JJHA 4C56B 4LW1A 5KRUA 1FNWA 3GP7A 4EQPA 3TWCH 4JRYA 4L9LC 2DV6A 1GS7A 1IGTA 1J5HA 2OYMA 3LHPL 2AJUL 1QP1A 4A76A 2ZXPA 4N25A 3P7JA 1AGFB 5J1AA 3VFVA 1Q46A 5DLQE 2H3NA 5F7LB 4LSSH 5FLVA 5TQ0H 5I74C 5B1JC 4FG4A 1DQVA 4N90D 2CKNA 4Q74A 3VA5A 4NN6C 3V95A 5FLUA 3D87B 1EA9C 1XSIA 1VKXA 2F7PA 5TDNB 4LHQB 2BINA 1IKFH 1CE1H 1JGDB 3KOJA 3CPUA 4KZ0A 3MRBA 4O02B 1A14H 1AD9A 3SGKA 4LCWB 2VR4A 4TV3A 1S7RA 1VQ6A 2GIXA 2P8LB 2VAJA 2I24N 4WEBL 4Z0BL 2OZ4A 3BKYH 3RWGA 5DJ6B 2N56A 1TLMA 2WOBA 3EFXD 2VXVH 4ZJ9A 2XN9E 3SGDH 3JTSA 3CQZH 3QEUB 4K0OA 4P2QE 4ILWA 5DVMA 1GYCA 1G7QB 3Q1SH 5IT2H 5E1AB 5FAAA 3G5VA 3Q8AA 2Q3XA 4GIPD 4NHUB 4U1HA 3BZFB 5IJVA 3FL7A 5IYCG 3V0WH 4HWEL 4G6KH 5LHDA 3FUKA 3U2SB 1R3IH 2YKLH 1A1OB 1PZID 1U3NA 4X42A 4EUPH 3KF8B 3G04A 2W0FA 3V5DA 1MPAH 5F6HJ 5SWZB 3RA7H 4HJ9A 2NYYD 1DFBH 3HS0C 3HG1E 3LJ3A 1SXSA 2P28B 3L9BA 2PO4A 3KBHE 2EPBA 4DFAA 4K9EL 2BSCA 4PRPE 5HHME 3VW3L 4X3SA 2ATKA 4JPIB 5JJZA 2E47A 2KCNA 4UT9A 4WW2B 4L4JA 2VB3X 1J48A 2C26A 3CFUA 3N6YA 5GRJH 5IFAL 5E7BA 4JLRB 2YMXH 1AJ7L 2A73A 4J15A 2VLRB 1V7ML 1MJUL 3T3PE 4LF4L 3C5ZD 4AX3A 4Q9RL 2M26A 2HTKC 2NSMA 4JKLA 3MV01 1KCRL 4PRNB 1U8CA 5CEYB 1MG3C 4KAQH 1PEWA 4ECNA 2ZXAA 2AABH 5C71A 1IGFL 1ETZA 2A6HC 2P24B 2XTJB 5GZOD 5H2BA 1BCIA 1FYTA 1V9PA 1ZT7B 1M4VA 3B43A 1JZGA 4YZWA 4MIUA 4WI2A 3A0JA 3SB3A 4ZQKA 5KSBE 4ELMB 4QKTA 4QR7A 3RWJB 4X3UA 1X3PA 5KYYB 2D03L 2ICWA 1PJWA 2P44B 4JFSA 3X14B 2JA6B 4YLQT 1XGRA 1GHJA 4KKBD 7FABH 2Y6SD 3GC3A 3KPMB 1S7QA 3DLQR 3UTSD 3UYPA 3G9VA 1A3VA 3GSVB 1GC1L 3EBIA 3NK4A 2WZAA 2ZCLH 3RIKA 1ZD6A 4G42A 4K6LA 4N28A 1GZPA 3MJ6A 3WDIA 1K72A 1SVZA 4I4WB 5K9OB 3TYFB 5ADOH 3MXWL 1HINH 2G2NA 3RHWK 3BFQG 3EFOA 5F1NB 3I85A 4JO4H 5IT9L 3T6VA 4RA8A 4XCCL 5ETUB 5J3HD 2QQLL 1Z5LB 2NPLX 4JVWA 3LS5L 3VGEA 4LCWE 1EXUB 1DTUA 3ARPA 4GXFA 3H3VC 3ORJA 4M1DH 3MGTB 4PJDB 5GJTL 1TJHH 4OSUH 3QDGD 2C3VB 1ZANH 3DMMC 5DC2A 5HGHA 4KZDH 3HVNA 2Z91B 5JHDA 5KVDH 4XNXL 3O8XC 1IKLA 4XOAA 1P8LA 5D2LB 5LCVL 4AKOA 5I2YA 1LK2A 5EDSA 2QR0B 1BQSA 3MUHL 5DWPA 3KWWB 4E5XB 5L2JB 2V2WA 4IRSA 3TF7C 3Q1EA 1N26A 1T5EA 2BA0A 2HLFD 3LY6A 5D1ZI 3TBVB 3EYFB 4YSEA 5J13B 2D5DA 3OWFA 4XGZB 3SDCA 4JRXD 1A3TA 4LLAA 2F74A 4CKVX 5SWZE 4DUWA 5G3LD 3QUKA 3NOIA 1TQUA 1RZFH 1IAOB 4UQ9A 1J8HD 4R9HA 2OX5B 4BH8B 2KA7A 1K8OA 4Y5YA 3I2CL 1HSAA 2GK0B 4DF7A 2L7EA 3BPOB 3DETD 4F8OA 1DVYA 4LIQL 3NWTA 4G8FB 5I15H 2FX8L 1D6EA 3IF1B 2XXGA 5FHAL 2NXYD 2VLRE 3IDMA 3KD4A 3DO3A 5FYLL 5E4WC 4NZUL 1MHEA 5T3XH 4A2GA 3SKMA 5L6YL 4Y7NH 5EEZA 4S0HA 1TQBC 2D0FA 3WLWD 1UJ3C 1X5LA 3B9EA 1FNLA 4X9YA 3WY4A 1NFDF 3MWYW 1P4UA 4HUCA 4AIMA 1F9SA 4X4XB 2XTJE 5DRXB 2DLIA 3W81A 4LLYB 1IFRA 1MHCA 1QPXA 5T5NF 4HUXB 2X05A 3MO1B 1K8DB 1H9DA 4V2CB 3Q8CA 2KJXA 1ZEAL 4AOFA 1M05B 3RY4A 4ELME 2PP8A 1NBVH 2IOIA 3UJTH 2XPGA 4EJ1C 4GMTH 1LO0H 3CZNA 2F0VA 4FJYA 2E2JB 1WE5A 4WQOA 3TGXA 4OWWB 1JMCA 1DBML 3RRQA 1YVCA 4XIGS 4D94A 3T4YB 2EZVA 2KZ1B 4OM0H 4R8WH 4J5VA 2XHNA 4ZMLA 1IYVA 1TJIL 4Y2DC 3D7PA 5LVEA 4XTRD 1XGQA 3PWJA 5F1IA 2YPLB 3S37L 2UZIL 4ZTEA 1K83H 2WMPB 4J3OD 1J8SA 2FGWL 1NSNH 1OAUH 1KDCA 2LU4A 4Z3TA 4KMUC 5KBLA 5BN3A 1SJEA 5IGFA 2MTAA 4DN4H 2P3YA 3S2HB 1PZJD 2FQFA 2JLLA 2E8GA 3CX5K 3AU7A 1P4IL 2OMWA 4TUJA 1ZSDA 4K2KA 2EJ1A 3C60A 4OGAD 4PRBA 4D9RD 5IJCC 1KDIA 4LOFA 1WTXA 1THAA 5KS9E 5MERA 2Z93B 5D7KD 4CJ0B 2QDWA 1A7NH 3N44B 2DPKA 1KLFB 5KS9F 4Y52H 3ESNA 5ICYB 4CN1A 4IFDG 4J3OF 4HJIA 1BMZA 4Z9CB 2BP8A 3B9KC 2AKRA 2YQGA 3QUYD 1QFWL 3VSQA 3KBFA 4QAWA 1J12A 1CG9A 5D2LE 2OR9H 5EUKB 1S5CD 1AACA 4M7LH 1AGDA 3IDXH 5JLZB 1QR1A 3A67H 4J6HA 4M1GL 4MJIB 1T5WA 3L4TA 2BOBA 4IEFA 3MNZB 3EJIA 4KJPC 2FHBA 2WWNA 3IMRA 1BFSA 1UCBL 5H35B 1B0RA 2N1KA 1P2CA 2MPAL 4UT6H 2EYFA 4F2MB 2CGZA 1LE5A 4P23A 5E8EB 1S5IH 1OM3H 3FO1A 1WQVT 2VXQL 1MXDA 2HAZA 2X4NB 4HUKB 3US0A 2H2SC 3LN5A 4F88A 5EO0A 1I3QH 1YJDC 2NYYC 3P40A 1X9NA 3TEWA 3ARDC 4P3WA 1NIFA 3OC8A 2BZ7A 3MV9A 4IDLA 5L9DL 4RCOA 4WI8A 1I1AA 2WQWA 4YVNA 3OF6D 3FMCA 1WEJL 3VXQB 4RGNB 4NQDD 3MV7B 4OXPA 5CU5A 5DD1H 2VYRE 3QJZA 3KLLA 3DEPA 3F6LA 4YSOA 1KCSH 5ISRA 1U8PA 4PBVC 1HX0A 2Z64C 2FBRA 3PY9A 2X69A 3ILQC 1IM9D 5C0EB 3L5HA 4CNIA 3U7AA 1MCDA 5DQDL 3D0LA 3S35H 1HFUA 4GOSA 3WGVB 5INDA 4JY4B 4AYSA 5IWLA 2CO1A 5T3ZE 1CPUA 2MO1A 4JFZL 1ZGLP 1GGCH 5GGVH 4UMSA 2K05A 4ZFFA 1CDIA 3GPSA 5FOBA 2F58L 2JV6A 4BV1A 1IIKA 2IH1B 1PYBA 5IUCA 5ITBH 2X44D 3CVDA 1KGJA 5ADPH 4HKJB 2E27H 2GK2A 1EUTA 3HHSB 1F9RA 1KYFA 5LMNW 5I82A 2NR6A 2X7LA 2GUYA 4GP8B 3GSRB 3LV3A 3D69B 4H02A 1YNJC 4POGA 1UZ8A 2Z0UA 2YPLE 1A7PL 2HVBA 3DX1A 3OMIB 2ZAIA 4I65A 3D08A 4L48A 4HYTB 4P2OC 5C09A 1KGUA 3EGDB 2YFOA 5E1HB 3BN9C 1FCGA 1OGAD 2RACA 2VLJD 3OKEB 3DOSB 3GMQA 4G9DA 4LLVA 1V5JA 3GXPA 3RLFA 5CV7A 1N10A 1GUTA 3E3XA 2NY0B 1KB9K 3G5XA 1CXIA 3J80c 4NQCD 4S11A 2A0LC 2GAZB 4HAFA 4A75A 4K9JA 3K3QA 1SNQA 2ZG2A 4NQTA 3H9SD 3RVUD 2ATWA 1KY7A 4HEME 4C3JG 4BY1H 1NAMA 1R5IB 1OF0A 4K5NA 4OUUA 1OK0A 3QJFA 5L7XH 1YYMH 4PI2A 4DXGA 1S9YA 3ME0A 1BGXH 2RR3A 4MJ4A 1LT6D 4GUPA 5JDJA 3MGOA 2H6UA 3V4VH 2P5WB 4PUBH 4HFUL 4KO5A 5AW8B 2Z6KC 32C2A 3GBEA 1DQKA 2Y25A 3LHAA 1BBWA 4H1LB 3FT3B 2K33A 4J8QA 3FZUD 2O5NA 2B2YC 1C8QA 1F45A 1MJJB 2NY3B 3VFUA 3TS8A 2VUMB 3WXWL 5CBAA 2EIZA 4P46C 1HEZA 4KRMB 4R9WA 2HLFC 4GAFB 1JWSD 1Z6JT 2B3IA 5CD5C 1V1PA 1NTDA 4NQED 5CJXC 1GIGL 4QHLB 5EOTA 2NUCA 3L9EA 4X6BB 4PV8A 4P9HL 4NPYA 2EDMA 4PJ9B 2C3XA 1ZLSL 2E75C 3N1QC 3HR5B 1SJHA 1WD1A 4QXGL 1DSYA 1HOCB 2ENJA 1JVOA 3PDDA 3U1PA 1G6RH 3PUZA 4LLUA 4WO4B 2XTJC 4XVOA 4XO4A 4Z23A 3DPBA 3GO1L 2E76C 3ZKND 3SBWC 2DQHL 3GNMH 2C9PA 2YXWA 4ILDA 1PDQA 1TZOA 3CGTA 1ASZA 5HDBF 2MP1A 1HRJA 1NC4D 4D9LH 1ZT1B 2VXUL 3WLWC 1KB5H 1KACB 1RJYA 4P5TB 1E9PB 2JELL 5DRNA 3VDBA 2EUVA 4AV5A 1X6LA 1YEIH 1RK0A 2ITDB 4HH9A 4DGYL 3C9NB 4BK8A 3WXVH 1ESRA 4M62L 5INCA 1J5OH 1MLBB 4LVNB 4HWBA 2F15A 3AYHB 1NIDA 1DJWA 3RWDB 3VR4A 1Z9LA 3ARGD 3OQRA 1QFWM 4YUEH 2E7LC 4Z8FH 4DQAA 1DJRD 1BBDH 4WHTB 3SZ6A 4WNSA 4Y9GA 2XN2A 2RALA 5FLXE 3ENEA 5F9OH 3MKKA 1PYWA 3VE0A 4AG4L 4GQ9H 3CQZB 4CVZB 5J6GB 4OCSH 2QVMA 4XVUC 4R6UA 5DUBA 3F7LA 5I26A 4XTRC 4WRDA 4XAWL 2YMOA 2WQSA 4HSVA 3SYAA 4J3OC 4G83A 1DQJB 4APQB 1JNJA 4GLRI 2YMTA 4X3TA 4ZO9A 4K94H 4UQ2B 5DTFA 1YHBA 2RQEA 5DJAB 3I4OA 1JJUA 2I5YL 1DN0B 3CF5A 4E5XG 4E41B 4N5EC 4WI0B 3CFIC 1P1ZB 2JKTM 1UKSA 3RN5A 4OGAC 4R7NB 1RY7B 1JN6B 2NY4D 2M00A 1GJUA 1NEPA 1U4EA 3CWGA 4JZJB 3OR7B 3M9BA 4FG6D 1U2HA 4DQOH 3K7AH 3IWUA 4G1EA 3KHQA 4NXMQ 2QJDA 3FU5A 4M7LT 3UTTE 2YJLA 5KVGH 4L18A 4A2EA 2P5WE 1EYAA 3VG0H 2OP4H 4DKEH 3QUYC 3ZLQC 3N9GH 2PPBC 1E30A 5JJKA 1LUZA 1WJ3A 1QRNB 2F53B 2X4OA 4F7MA 3E6FA 3SY6A 1MRFH 4W9IC 2W59A 2VNCA 1AQKL 4ZW5A 2F7QA 5CEZE 2C5DC 2RIKA 1INEH 4RRPA 5E6IA 4AVJA 3BPCA 5HYSA 2Q76B 3HRZC 1JD7A 5FUZH 2F08A 4Q6IB 2JB5H 2GSGA 1SHSA 1PZUB 3BGAA 1OO9B 1KIRA 1N6VA 2UUDH 3DI3B 1G7JB 4OWXB 4QRRB 2IQAA 3MVVA 3WIIH 3QJUB 5ALBH 4U0QB 1E6OL 1HYSC 2Q2UA 2ZUTA 4ZMQA 5T1JA 1KCUL 2D7QA 1NPNA 2AJXL 3GSOB 3G6DL 3HEIB 3H7LA 4MCYB 3X3MA 2NY2D 5DR5L 4BEIA 3D0VA 3P0YH 3N5AA 3E6HB 2F5BL 4FQHA 4L3CA 1CE6B 2HFTA 5L0QB 2BMKB 5F9JB 1E2VA 4FQLH 3ZOAA 3CNKA 1WWCA 3MRHB 4XHJD 4F8PA 3QIUA 5CFAA 3MRJB 3DX6A 1IILE 3KWTA 3MXVL 3PGDA 5DJ2A 1U8NB 2YXVA 2C9OA 5DLLA 1DVFA 1RL2A 2ZOWA 4MMZB 5F6HI 2EVIA 3S8GB 4FC3E 4XCNA 2DLFL 3LXAA 4RFEB 1NBYA 2C34A 4JHUA 5CXPA 1FAKT 4DR7L 1HWWA 1WG3A 5JYMA 3MJWA 3GSXA 4PGCB 5I8KH 4RCNA 3W3AA 1FZKA 1CT8A 1C8PA 4NQQA 1J9RA 3U7WH 2AQQA 4NQUA 3UMTA 3LPFA 2SDFA 1ZLWH 4MAYD 1PNCA 1JXGA 1CFVL 2LSSA 4AI7A 3Q6GH 3QDMB 4E41E 2WQXA 4AEEA 3ML9A 1KFGA 4WGKA 5E9AA 1V54B 3LMJH 4POFA 5JHLH 3WTVA 2WVUA 5F2FA 4PS4L 1B44D 4WEEA 3NFNB 4MA3B 1XF5A 4H20L 4GEIA 3FOLB 4XB7A 3H55A 5I1IL 4XMLH 4EQ5A 1N33Q 5HHVH 5LNGA 4MQ7A 1OWWA 1BCPD 1JERA 1PRTD 3MREB 4PD4K 3RTQD 3MJ9L 1SSOA 2RQXA 3P54A 4LSUL 4PVMA 1QRNE 3DVFA 1NGZB 4I85A 4TN9A 3VWJA 5I8CA 5EF1A 1J86A 4IMKC 3ZRFC 3FZUC 3PFUA 1RODA 1NMBL 3KPNA 4QYOB 5B3NA 3QCUH 4XP9H 2JJTC 1G6VK 3LH2L 1LWJA 3MLWL 1KTKA 4MDJA 2ADIA 3UH8A 1D5ZC 4GKJL 2XY1A 5IWAQ 2EICA 3VJ6A 1MF2L 1BCPF 2OJ1A 3IT8D 3CFDB 4XZ4A 3HKZE 1FVCA 4GKSA 1PRTF 3CVHL 4QRRE 1BECA 3X11A 1B2WH 1AE3A 4AT6A 1UWVA 3EO0B 1BVSA 4OJEH 2MNUA 5TSSA 1C16A 1AKJA 2NW3A 3ZE0B 5AVVB 4N9GB 3NSFA 2NY7H 2VERA 4YFEA 2F8OA 3S88L 1KNOB 3EADA 4MWFB 3LGJA 1FPTL 1OAQL 1MLCA 3VCLA 1F8TH 1N70A 1KNEA 3STLB 3B7SA 3H9ZA 3QRBA 3C6LB 3T2PA 1WFOA 4ME5A 1T1ZA 4U3SA 4PJBF 4K14A 5HD8C 1J8IA 3AY2A 1FNUA 4QRSB 4BSWB 1M9SA 1F2XK 2VZAA 2HVJA 1YJ9A 3EJZD 4ACPA 3L7EB 1AR1D 4XAKE 3VFSA 4AH6A 1N36L 3HMXA 1KBWA 2AK4E 4EX5A 3BDBA 1M3IA 4IPCA 4OX9Q 1DOLA 1NIBA 4G8GB 2Z7UA 6FABL 1OM9A 5I8OL 3LH8A 2EDFA 2DJSA 3RFZB 1BLNB 1FH5L 3ARGC 4WFFD 4AYBB 2XX0A 5BOPA 1WCBB 2IG2L 4N2CA 1YZ6A 4LCYA 4PRIE 1JFQL 1CFNB 2QKIC 1HR0L 3MNWA 4XMZA 5KVDE 4DR1L 4LF3B 3KVDD 2CKBH 4LSRL 5M5XB 4UTCA 3BZEB 4U0RB 4ZUJA 3LCYA 4XH2B 1KJ2A 1EO5A 3PWNA 5HJ3A 2DJGC 4GN3B 2IADB 2NTFB 2CNYA 4NKIL 5IYCH 1SYFA 4JFOA 2RHQB 4WWPA 2V5TA 3DECA 3HNVL 3QDME 4GXVL 4JFPA 5HHPA 3KUPA 5T5FL 3O41B 5GJSL 1K8AC 1S7VA 1I3QB 2AAAA 5C0RL 4KTDH 1JT8A 4XO3A 4HZAA 3PP4L 4FMKA 3QR0A 4OLZH 2FBOJ 3HR6A 4NUGH 1FNAA 3AG2B 1I1FB 3QWQB 3Q9QA 4FG6C 4ZZKA 1JGEB 3J81E 4PJ7F 4JO1L 5D3DA 1UEBA 3O6KL 1CZ8L 1RHFA 1SN0A 3ESOA 3GXFA 4PJ9C 4ZAKC 5K33A 3VMPA 3DYPA 3LZLA 2NQDA 2CK0H 1EHAA 3AS3A 3IGFA 4KKQA 3QJSB 1BFVL 2KYIA 1SMDA 3DGDA 4I1RA 1U92B 3RAJH 2L0DA 5D4JA 5EZIH 1IGCL 1YEZA 4Z78B 2H45A 2AK1H 5EU7E 2RD0A 1LEIB 2FRGP 2Y5TB 2OMXA 3O3DA 5DS8A 2V7HA 4JHVA 1QTPA 3ZHKA 2XKNB 2O30A 1VEPA 3KDMB 3A6BH 3QZOA 1MJ7L 1OF2B 2CO6B 3KDFB 3AACA 4GI6A 1GS6X 1YMMA 4P5TC 5I17A 5KSVB 3DXJC 3ZE0E 3KEDA 5TJWK 5HJDA 4DK3A 3FTSA 3HJ0A 5GRVL 1NCBL 3D5OF 3RVTD 1WC7B 4NKMA 4KKSA 4F9PA 5C07A 4F2FA 2K5VA 3IPEA 5LNDA 4KDTA 1E24A 2X9XA 1LDPH 4HSCX 4MX7A 2VDRL 3UBXG 4F80A 1PZDA 2E2IB 4GKZA 4DKTA 3HE7D 1EXHA 2R7ZH 1DQLH 2FMCA 1UB5A 3F7VA 5JVG3 4KHXL 4S1QH 2LY7A 3VFPB 1TQTA 3MV8D 4OTXH 3CUPA 4L5FH 4XHJC 3TZVB 3M7FB 1KPUA 5CUSH 2VQTA 4MAUL 4OZ4B 5DJCA 4XNQB 2J8HA 3CN0A 4ZK9B 4BQ8A 4G8GE 1G7PB 1XB8A 3DXAD 1JZ3A 1XYIA 3VO0A 1F4YH 1YDPB 3HOYB 2FT8A 3LXBA 3PWLB 4AYBE 4MNGA 4DA2A 4APQC 1S7XA 2DYPD 2IALB 1IB5A 1GVPA 1GOZA 1BOGB 2R1WA 2N59A 2P47B 1X3FA 3K6DA 4LFHD 3V4VB 3ZYZA 3I3DA 3DM3A 1KGXA 3EDFA 2AXFB 4LCIH 1QG7A 1CQYA 2NUPA 2LOEA 1U8MB 3HMWH 3KJ6L 5DFVD 2GBVA 2B2WC 4HALA 3RVVC 4YE4H 4PR5A 4R4IA 5JJIA 1X5GA 1MAKA 2ZKMX 2H9GA 3EJPA 2FFKB 4G82A 4O51A 3HI5H 5D65A 2EDDA 5LAXB 4Z3FA 3HZYA 1A3RH 2OL3L 3N0AA 4MAYC 2R7DA 1JGVH 2DIJA 3MLYL 3Q9PA 4PMWA 2X4RB 3RIAK 4B53A 1SEBA 3ZGHA 2QPUA 5FUOL 1J1XH 1IC0A 2V2XA 2WKOA 4XX1G 1G6RB 4FDBA 3QDJA 1OSPH 1Q0EA 4NZDA 3Q3GB 4L0ZA 4Q6IC 3SXHA 1ZLEA 4BKLA 4DO4A 1BCPC 1UB6B 3B7UX 1NGQL 3QEHB 3GUTB 3MBEA 8PAZA 1XGPB 2WBJA 2OSXA 3W2DA 2ZX7A 3RNUA 1MUJB 4PLJC 2B2VC 3HNSH 1BSIA 5JQIB 1Z9OA 4M7KL 5T1LA 1ILUA 2R7EB 4CL7A 1I1YB 3C75A 1I4XA 3LKSA 4WV1C 2RA4A 3GDBA 2XFGB 1Y1DA 3NG5A 5F7EH 3JYCA 4NBYB 3T13A 2EZ0D 2FX7H 3GTMH 3NRFA 5BW7C 3G5ZB 4I3RH 3QUZB 2OSLB 4A3IG 4KKAC 3FCBA 4MNHA 1IJNA 2WQVA 4LOVA 1KIUB 4IOSD 1I4FA 1FE8H 3QSKB 4ADGA 5EC2A 4K07A 2WYZA 4QNPF 1ZLUH 1BD2A 3UG5A 1QNZH 2CM5A 3BQUB 3ZDXB 4UIMA 4O2CB 3VRIB 4JMNA 3WEOA 5I6KA 1MCEA 1NANI 3V2TA 1ZV2A 3A74A 3MOBL 5CBEB 4MSWB 3VYNA 3CP0A 3HC4H 3CD4A 2K5NA 4BWTA 3WKML 1C7TA 2MCPH 3HBGA 5CHNB 2WQ8A 4FFYL 3TREA 2CJ3A 1PX8A 1TWGH 3K8MA 3CC7A 2NXZB 5FM8A 4GB9A 4MGXA 3EO9H 1FQ9C 3AB0B 4JHZA 5T1KB 5DJYA 5IGEA 2BDNL 2C3HA 3IN0A 4UQ3B 4GPVA 1NM4A 3D85A 4KY2A 3MXNA 3K91A 5TGBB 1JS4A 3NEXA 2X4UA 2WIIA 4A3LG 1CLYH 1AHWA 1PKOA 1W72L 1HHHA 2FQEA 3A47A 4PJHB 2EE2A 4XOCA 4F24A 1TT2A 5JW3H 3SDDB 2F54D 1YAIA 3QNYB 5ERWB 2BFVH 2HT3C 3SK4A 3FRUA 4DAVA 5IQ7L 2CALA 5C6WH 4JFXA 1N3NA 4HD9A 4HJJH 4APXA 1X3GA 1H6TA 4IHOB 2ERJB 4MTNA 3GTOB 2QPEB 4MAZA 2CDEA 2LW3A 4IS6B 2Q8AL 3HHRB 5L8JB 3I84A 3JWNE 3S1NH 3L3GB 3UTPE 1C1EL 2R2HB 3QC5X 3QS3A 3V6ZB 3X3FL 5EQ0A 3BUIA 4G6MH 1S3KL 4ZMOA 1B50A 3EZ8A 4PB9H 3P0VH 2F1BA 5IEKA 5IY5B 3P02A 4I0PB 5BVJA 3C5ZA 1AHKA 3I50L 3FUNA 5KBKA 2XVKA 5DZNA 1GH7A 4OIFA 2K8QA 5K9KB 3ZK0A 1AZQA 5B38A 5I0VA 5C3EH 4GAGL 2EUWA 4JO8A 4Y5VB 3IJSA 1I8MB 3PIO3 2P9RA 2DQDH 3LOWA 5FGCB 2AEQH 4U1JB 5TQ2L 4LQFH 5IREA 3QNXB 2VW4A 4LHUG 2H6PB 3PABA 4X5LA 2PPDA 3RWIB 4HSPA 4FHJA 2NBFA 5DD0H 3TC9A 5IB5A 5DF0A 3D25A 3AG1B 4KDWA 3IJHA 2QQNL 1XR9A 4KZCA 4NQXA 1LWHA 2CGYA 2DQFA 3DPDA 3IWVA 3BAEH 5JW5B 4LUZA 4GAJH 2VDKH 4JW3A 5DZOA 4AIZB 5C0NC 2ICEA 4QEGA 1ACZA 2HJLB 4TQUS 1A3ZA 2KLRA 3H9HB 4P2RD 3OGOE 3UAJD 2BP0B 2VAAA 5DI8A 1FFPB 4JHWH 4MNQA 2AERT 3MOAH 5F21B 3IDGA 1OTUC 5A2QL 1V3LA 1ZAGA 4YE0A 1QKZH 1FZMA 2PZTA 5C86A 1BP3B 3RFZC 4R5VA 4JZNA 4R1JA 3BZDB 5CBEE 5DXWA 3CSFA 5HYEA 2CDGA 3MRIB 5C0JA 2JIXA 4HFWA 1AO7B 1WD0A 1TNNA 1DDHB 2P4AB 4X0KA 1FVIA 1HH6A 4PU2A 3IYLW 1DCLA 1BG1A 4ZW8A 3VD4A 3OWEA 2J4WL 3S34L 3GKWL 2XN0A 1A64A 2FJHA 2MNAA 4RGOS 3GIZH 2EIMB 3JV4B 3GEFA 3QDGA 2HN7A 1PKQB 1QB5D 1H6UA 4LNRB 3TNMB 4F8TA 4DTGH 2IAND 3IAPA 5KVGE 1DCZA 1R3LA 3SDZA 1U33A 5E5MB 4Z7WA 1Q1BA 4U6YA 4HU2A 2XWJB 1UURA 3VI3A 4B95C 4JQVC 3BT2H 1JNLH 1URIA 3T16A 2JQOA 2UZXA 3D3VD 3G6AB 5KOVC 1BVKA 2CA3A 2VL6A 4QXTB 2GVBA 1JPGA 4DV4L 2J5LC 2JEAI 1X5XA 4MD4B 4UM9A 4GG6F 3DX0A 1Q9KA 3P1VA 4FFZL 5DFVC 5IJBC 3FU6A 2HRHA 1T1XB 2ZXQA 4AC2A 3MFFB 3LHPH 2Z92B 2AJUH 1AEXA 1RHHA 5HHOE 3M17B 2UXCL 3DIFA 4Y2OB 2CBOA 4AIOA 4O58L 2PO6C 2H41A 5C0AD 4DXFA 3FUEA 4FQQB 4BZ1A 4CDHA 2FSEB 2XG5A 5C7ZA 3S97C 1EEFD 3TNMA 3AFPA 4Z6AT 1S7TB 3AMLA 3NN8A 3JTTB 2EIEA 4R96B 1X5IA 4HX1B 5D1XD 2FBJL 1R3KA 2VM9A 15C8L 2B20A 3VI4B 4RISL 2XU9A 3MJGX 5EBLB 2Z0BA 3A4DA 4Z0BH 1FO0A 4WEBH 2XXCB 5GS2H 2VXSL 4F2EA 1EZ8A 2C9VA 1X9UA 4OO1G 3PPEA 3GFUA 5FGCE 2R39A 5FKAB 5AG9A 5DHVH 5EO1B 2YFNA 4L4VD 4AGLA 1PZCA 2DQEL 4EQOA 3AREA 2HH0L 1E1TA 2XA8L 4HWEH 3SEPA 2B3RA 4XOBA 2ATAA 5JTWA 1D3CA 5D96B 4CJ1B 1X5KA 5AOMA 1JK8A 3BP7B 3NMEA 4ZXBA 1TCMA 1PD0A 3UROR 2FR4B 3I2ZA 3QORB 3LZRA 2VLKD 5FLXc 2QZ5A 4OQ1A 4K9EH 3DEOA 3EO1A 4NERA 3VW3H 1LP9B 5ESAA 3I4MG 1N0LA 3D2UB 5MI0B 1KG0B 3G71A 4HD5A 5IFAH 1I7TB 4MZRA 1MQ8A 3R06B 2VN6A 3JAML 1AJ7H 4JO2L 1NGXB 1IAKB 1E22A 2CJUL 3C1FA 3VFNA 4PREA 4YR6A 3OLGA 2VDQL 1V7MH 5DVPA 5A40E 1MJUH 5JW4M 1FH2A 2CBQA 4Q9RH 1ZXKA 1DJGA 4TRDA 4ADIA 4DJMA 1KCRH 3QNFA 3Q2WA 3CC2A 1AO7E 2HTLD 3M45A 1GKHA 1I7ZB 2ZM6Q 1X9QA 3G7TA 4G7QB 4PP2B 5EZJA 3SDAA 1FJGQ 3PO2H 1CD1B 1IGFH 4G5AA 4KV6A 1JSYA 2WLYA 5EIVA 4HJAA 3HG0A 4JFYB 3NUCA 1E5AA 1FL5B 1JF1A 2VQFL 5HGBB 1KC5L 3BEVA 1EDQA 2WVSA 4GBXB 5D8JL 2F19L 2VABA 1JZIA 2D03H 4JFED 2PQEA 5CGBA 3T6ZA 2ESVB 1M3JA 1MAJA 1N18A 4U31A 4QO1B 2Z4HA 1STNA 2EIDA 5FYJD 3CHBD 4N0CD 1BMWA 2V9UA 2DWEA 1GC1H 4P8QA 4AQ1A 3J80i 4AQYQ 3PV7A 4OI9A 3SY0B 1PY0A 2R8SL 4N8UA 2BXYA 4UQCA 4L8BB 2YUZA 2EKSB 4NUJA 3MXWH 1G2TA 2NTSP 4WF7A 1QO3A 5GGRY 3T4AB 1KGCE 3NIFB 1B90A 4Q4EA 3ARFC 4DW2L 2NMSA 4HV8B 1D5MB 3OF6A 1F3JA 3ABKB 4XCCH 1QSFD 1T0OA 2PW1A 3QXAA 2QQLH 3KG5A 3ZTNL 2L9HA 2DQGL 1A4CA 4RMUA 4L3ED 3LS5H 4N8VB 1FFTB 4N2KA 1UEMA 3N42B 3H3PL 5C08B 4GINA 5GJTH 4S0SD 5G4MA 1A47A 2F03A 1N19A 1UUSA 4OV6F 4RDQG 2BW5A 1R5VB 3W0WD 2G9HA 3D4CA 1OD9A 4PJ5B 4XNXH 4PV9A 2NZ1D 2BK8A 4OFYA 5LCVH 1STGA 4IMLA 4ODUA 4UY8C 2F8XC 1RZIA 4OH2A 5I6XB 2EO1A 3JZ7A 2F0KA 2LTQB 3ZDYF 4GNXA 1OGTA 1DBAL 3BQUC 3MRBB 5D4HA 3VG9C 5MENE 1RFDL 1LD9B 3RWGB 4G3YL 1NBWA 2MPVA 1GKEA 1B9MA 4Y4KD 2V5MA 4JK1C 4JVUA 2E6JA 1LP9E 1OT2A 2C9QA 5ECGA 4R3SA 1AZPA 4YL9A 4K94C 5AENA 3W57A 2JCWA 2APBA 3I2CH 3JTSB 4NRYA 5AZUA 3ULUL 5J3BA 2EOTA 1CLCA 3V6OA 3QIAA 4LIQH 1YEDA 3UAJC 2AJYL 1JZHA 1JOIA 1VFUA 1WS8A 2CR0A 2C7UB 2FX8H 1KYDA 5FHAH 3O3BA 5FYLH 3VA6A 3VD5A 4NZUH 3WDHA 4Z76A 2VMJA 5L6YH 3RWEA 5KBNC 3SJVB 4KK8C 3V5DB 1EUUA 4FFWC 3OTOL 2GBUA 1WFNA 2H2PC 3SQBB 3U7YL 4TVPL 3UJIL 4HIDA 3VXPA 3DWPA 1WGOA 4F15C 2OZNA 4G71B 4Z5RB 4OCYL 3GJFA 3C6SB 1COBA 1HIML 5L4MA 4UP9A 4JQXA 1X5JA 1ZEAH 3ZT6A 4CAGA 2N3JA 5KG9B 4LF9L 3NCYS 1M7XA 3QUGA 2EXZA 4AM0A 3QUXD 4GRLD 4OLXL 1R5WA 3O4LB 1NKRA 4OAWB 3OYYA 4A3MB 1DBMH 1FLTX 4BFGA 5CLWA 2P5ZX 1MCNA 3ALXA 3CLEL 2YRLA 4Y0GA 2L7JA 4U673 1JYNA 2ADGA 4RMRA 4JRWA 1TJIH 3RNKA 2I5MX 2CXKA 3S37H 2UZIH 3SBPA 2MUYA 3QXDA 5DJXA 3TPKA 4H8PA 2FGWH 1TO5A 1VCBC 2FDBP 2UUAL 4KKUA 4PJCA 3LZFL 3K71A 5EEUA 2H32A 2FWLB 3KYNA 4JI4Q 1UADC 3F58L 5EBDA 2YD3A 1MW0A 1P4IH 4R4BA 3K5OA 3RL1A 4F87A 4A3DG 1EY8A 4AENA 2ICWB 5D6DA 2EEFA 4MZ3A 3T2LA 3Q05A 3S1QH 1SDYA 5H94A 3UYPB 3AROA 1BOSA 1JMZA 3L4WA 1Q8KA 4HP5A 3WFCL 4EEEA 1CQVA 2X0UA 1U9KA 4S1RL 4QCIA 5AOJA 1TS5A 2DN7A 4TLKA 2QSTA 2G9KA 4PJ5E 1QFWH 3H94A 3UPRA 1XT5A 2VDOL 1FL6A 2UYLA 3EUDA 3PO3G 4QRQA 2HPTA 4L5FE 1CDGA 2ZJSL 4L0PB 3VXSD 4M1GH 3DJTA 3QJQB 2FYYB 4YPGB 3TO4D 5IIEB 3WTXA 3OKDA 5LDSA 1I3RA 3MJ7A 4ZPTA 4DV0Q 5IP4A 1UCBH 3APCA 4IPHA 1JPEA 1JTOA 2MPAH 1SE2A 1TWGB 4FA7B 5KYNA 1JJ2A 5CGTA 4DV5Q 2WXNA 2VXQH 4MZ2A 3DHJA 3ZKXC 1G2SA 1XF4A 4DZ8A 3JWOL 2WKCA 2UUBQ 4HCGA 4LPUA 5ITFB 1Y1VH 3MRGB 3EOTL 2VRQA 1XH2A 4PJXB 5L9DH 3LYRA 4X8XA 4Q9BA 2C3GA 4PBXA 4H13C 1WEJH 2EE1A 4G6JL 4FVMA 1EZLA 4K6DA 1IBFA 3II3A 5SWSD 4BXSV 1DOKA 5HGQA 3SJVE 4BK5C 3OPOA 1E4JA 4KKPA 3OXRB 2WPGA 1X5YA 4HMEA 1HHKA 3FQ4A 3S17H 4FLQA 3JTBA 2CW0C 5B1CA 3FOMB 2W07B 5DQDH 4TNVF 4J7RA 4DV2Q 2RDHA 3ATAA 3S1NB 3NIDB 3CCHB 1F77A 5GSVB 4JFZH 2WXHA 5IB3A 4JS7A 4HEPG 3FW6A 3GMPB 4TTDD 2F58H 2B7DT 4CDDC 1PH2A 3D50A 1EIYB 1D6EB 5EN2B 3ZT7A 3BRDA 2UU9Q 1HDMB 3O4LE 3KGRA 3G6JB 1K5NA 4OZIB 5J1ZA 3WO4B 4X4ME 3KXFD 4P06A 3I72A 4ES9A 1XSJA 2QADB 5JPMC 3NAAL 2ZUXA 4U1LA 3T1WA 4KXZI 4HOZA 4UUJA 2QEJC 2KI6A 2W65A 4Z18A 3UCQA 5IVNA 2KMWA 5DCCA 2WW8A 1A7PH 1WF5A 1TZIA 4FE9A 5AD0B 1HWGB 3J2PA 3WY3A 5MEPA 1Q82C 5MP6L 4N9TA 2ZT9C 4F7EA 1BJ8A 2CRMA 3KPPA 2A9CA 1P6WA 1AP2A 5IHHA 3BCDA 4TULL 1L9SA 4RFNC 4MN3A 5AW0B 2K8MA 1VPOL 4ZZFA 3KVQA 1MGSA 4Z7VE 4YXKL 1M56B 5BN5A 1SDAB 2WANA 3D07A 2FCBA 4BSVA 1MSHA 4XYQA 2XN9D 5LXGL 3OB0K 4ZPVA 4C3IB 5F9WC 3NA9L 1BZ7B 4YBQD 5D96C 1NFKA 3O45B 3PJNA 2QHLA 1JL8A 4NOFA 1ZXQA 4Y88A 3SGJC 1SOXA 5CGKA 2R6GA 1DHKA 4ZUSA 4TL4A 3QORC 1KRTA 1T7YA 4G80B 4NO0A 1YHQA 1FI8C 5ALCL 1JK9A 3CLFL 5EEWA 1ILSA 3HZMA 4O1NA 5MI0C 3GMNB 4TSSA 3QA3A 4PW4A 3C60B 1I4GA 2DMBA 2VMFA 3GGWA 3P69A 3NP4A 4S1SL 1JYWA 3VGDA 4XBPB 1GIGH 1WFTA 4ISVA 4R97C 4LPWA 2PXYD 4P9HH 1VQOA 2BP8B 3QZWB 1ZLSH 3QI9D 4QHNA 4QXGH 1RJTA 1QSZA 4O4YL 4QXVA 2WY3B 4PJXE 4PJ8A 1CDBA 3DK2A 4N2OA 3D6WA 4H26B 3M4OH 3T0DA 2XRQD 3GQBA 3GO1H 2F0UA 3FPUB 1TQOA 4WJ4A 2DQHH 4P2YA 1XGYL 2HX9A 2BOBB 3MQIA 5BS0D 1ORSB 2ZTEA 2V2TA 1S5HA 4GSDL 4UPAA 2L7QA 1B0RB 5E95B 2VXUH 3HPJA 2XRAL 4KXAA 2JELH 1U93A 4NYLA 3LN5B 2A9DA 4L3AA 4MCZA 1Y6MR 4DGYH 1HPCA 3R8QA 1UAPA 4JFQA 4M62H 1M1SA 1QLEL 1JIBA 2WLKA 4HIHB 5AVWB 2FEEI 4C56D 5HYQB 4BXVA 2RBLA 4UTBA 1GOHA 2GITA 1XEUA 2ZXCA 3BCFA 1NAML 3G6JE 3IK2A 4WW1B 4AUUA 4GI8A 2CXGA 5D9SA 1TJGL 4GRLC 5EU6B 3SK6A 2IAMB 1EMTH 3T51B 1J1PL 3LB6D 2D31A 4NNYB 4U1IA 4AG4H 1CI5A 5J39A 5LWYL 1Z9NA 5INDB 3LRSA 3PL6A 2C9AA 4MD5B 3DV6A 3MV11 4XAWH 4ZDHA 3R7RA 3S5LA 3QIBB 2NW2A 1IIIA 2PETA 4ZFFB 4ZMNA 1QUNB 2N78A 4YDJB 1CN4A 1Y7VA 1CGTA 3TPUA 5FF6A 2F8VA 1FV1B 1H5BB 2EDOA 3ECBB 5KOMC 2I5YH 5JHMA 1GY2A 4HG4J 3FUHA 2JK5B 2OXGB 2V6HA 1RIHL 3J7ZC 1CDCA 3LV3B 4PM1A 5I6XC 4A3IH 5CS7A 1QHOA 1M71A 2RDFA 5ACZB 1PG7L 4BA0A 3CC4A 4URKA 5EAYA 3U6RB 2AHIA 1H9SA 5IEHB 2WAQE 4PRHE 4I9XA 2O61A 4IRJD 3ZW3A 2EDNA 4MB4A 4WGWB 1HHIA 4KC3B 5SWZD 1A9BA 1S5ED 2L1BA 4PJAB 1EJOL 2SOBA 1HCZA 2L55A 1KTLA 1AQKH 3PO2B 4X5XA 5IYBG 1KXHA 5JQ6L 3CSGA 4GKNA 1OGSA 1XD1A 2MQ3A 2D7OA 1CGYA 3MRRB 2ED6A 3BSGA 2XWBB 4KO6A 4UIKL 5HJBA 5E4EC 3RKDD 2CUMA 2OI9B 3QJFB 4DK6A 3LVTA 4HWBL 4BZYA 1AZCA 4X62Q 3ME0B 4F57L 1GY1A 2PNHA 4ORZC 4NXKA 4XXEA 2DQMA 1CFTB 2PWEA 5D2NC 1E6OH 2WWOA 3ZBMA 4A63A 4M6ML 3NCJL 4FEMA 3S35X 1KCUH 1VFBB 3U6XA 1QBLL 4AUYA 3ZL4L 4MVBD 1RZQA 1UA6L 1P9MA 2AJXH 3G6DH 1D1KA 3GTPH 1SYBA 4A3LH 1TUPA 5DR5H 1VSCA 4WW2F 4C83A 2AQSA 2BP5M 5DZJA 4FLOA 5F7FA 4G11A 4ETQA 2F5BH 2BSSB 2V37A 3OKMA 3VFGH 1BF2A 4UBDD 1KPRA 5C9JA 3S3JA 4PJEF 3CH8A 4U3XA 5HHXL 4PS3A 1WTRA 4EXKA 4OZGB 5D55A 1EHNA 2K6YA 2KBNA 4HK0A 3MXVH 4QT5B 2A19A 4HPYL 2X6LA 1WTVA 1H8NA 3LKOA 3LNDA 4Y8DC 2UXBQ 5F88B 4JYAL 1HHJA 3MCG1 3BIKA 1WO2A 5DMYA 5ICZA 1IKNC 1BX2A 2EY5A 3H7BB 2DLFH 3L1OL 5KYXA 1WOCA 2C3WA 2WZPD 5DRNB 3V2AR 3IJ9A 3U0PA 4PS8A 3U30B 1J7VR 4FF1A 3C5JA 3GK8L 1VQ8A 1BIHA 4QHKJ 1KYOJ 1VQNA 1I5FA 3IDUA 5CEXA 5CR8A 4AGNA 2EINB 3WFHA 4CKCA 1ASPA 3B2VL 4KKTA 1JQYD 1BF8A 2WNGA 3GSNA 2K03A 2PZUA 1KJMB 1ZHKA 1CFVH 3HZVA 3NPPA 2G2RA 3CU1A 1JICA 1ONLA 2OMYA 4FG2A 5CCHE 4ZI8A 1IVTA 4KVNL 3KW7A 3E0GA 4MXQD 3F1ZA 4PS4H 1PYWB 3VE0B 1DZ1A 2BH0A 1R9TB 3DBSA 4H20H 4HKZA 5C6TL 5I1IH 3N40P 2LS01 2HT2C 1FNFA 3NJHA 4I18C 2XFXA 2CQAA 3GMRA 1G6PA 2QELA 3Q6FB 4YBQC 1UGNA 4ZUWB 1AZBA 2YUVA 4P5RA 4EGVA 4RFBA 1HI6A 3MJ9H 4PJDF 4LSUH 3BP5A 2BVTA 2QV2A 2SODB 4KUCD 5IQNA 1B0GA 1I85A 4PJAE 5DTFB 2WN3A 3FQRB 1LXMA 1EEZA 1NMBH 1O7VA 2IT1A 4KV5F 3WNLA 5GIRA 2GB2A 1CUKA 4M5TA 2ZCZA 3RDTB 3LH2H 1J9QA 3L81A 2DYPA 3MLWH 1QUPA 2DY8A 3EBEA 4R90L 1DVQA 2WC7A 2Z7ZA 4GO9A 4DUYQ 1T5KA 4LFBL 3IS1X 4G1EB 2RJMA 3QWRD 1MF2H 4FRWA 2MRYA 4ZYKA 4O2FA 1GW0A 3CVHH 4M00A 2GPZA 1KXVA 1J11A 3HI1B 4IBZA 4JMXA 5I1HL 4KUCF 3GEWB 1A1NA 4JDZA 5DD6A 1ECZA 3NZUA 2HLAA 1CDJA 1G51A 2X4OB 5DZVA 5K39A 1NCUA 4D9LL 4DUZQ 3O6FB 3H42L 4FS0A 3S88H 5CLTA 3O0RL 3ZL1A 1M57B 1FPTH 5H37H 5C5MA 1OAQH 2CPCA 5E6IB 1QHPA 2A6IB 3U58A 2NZIA 2YSSA 4DKFL 5TH2A 5K36G 3OZKA 2F0IA 3B6YA 3BZCA 1MFDL 3QHZL 3WO4C 4K8RL 1HNGA 4NRZA 4FTVB 4TUKL 4YC2C 2YGQA 4MD0A 1E7UA 1W15A 2QADC 3EIVA 2IQAB 5IT9E 2MNJB 3VVVA 4RMSA 1IM3B 1ZE3H 2ADJB 4QGTA 4DOHB 4LGPB 1XL4A 1X4XA 1DQQA 3FB7A 1OE3A 5F3HA 2C1PB 4JI1Q 6FABH 5I8OH 4Y16C 5JOFB 2JSOA 1IC5L 1MI5A 1UM4L 2OXPA 3D0VB 3VQLA 3Q0AA 4BQ6A 5KZCB 3GSWA 1FH5H 3KCPA 2F0MA 4S2SB 1OZTG 2IG2H 2JP1A 1JFQH 1TS2A 2OTWA 2R56L 3PYCA 4H8HA 5IFHL 5JORB 2IDUA 5ESQA 4G5ZL 4LSRH 2ZWSA 1HE8A 3Q5OA 3TEYA 1GHFL 3IDIA 3EJYC 4GH7B 1L7IL 4M48L 5FYLD 5LO7A 4NKIH 1GGTA 3K6SB 3L2PA 1XH1A 3HNVH 4GXVH 1A9EB 4RGOL 5HGAA 3GINA 5T5FH 1E7VA 3BP6A 5GJSH 4AKQA 3S48A 4JAMA 4XN8A 5D7IB 4GOPA 5C0RH 3K0WA 3HKSA 1U58A 5C0GA 1Y1VB 3PP4H 2E9WA 4L29B 4YL4A 4MJID 3HE6A 4ZFZA 1XXFC 3QULA 2FJFA 3WDJA 2PYED 4GIOA 1ITCA 2YA2A 3LKQB 3WLBB 5E56A 4JO1H 3PIP3 3O6KH 3MUGA 1CZ8H 2P5EA 4BUGA 4HK3N 4PAZA 4QIWB 2WXPA 2EJFC 2ZSVB 1E3ZA 3OX8B 2ZSWB 5LBSA 1JWMA 4EOWL 1BFVH 1DVXA 2E7HA 2J3SA 3NZHL 3TH2T 1IQWL 3NRPA 1UWXK 2DWYA 3PWUB 3PCOB 1IGCH 2UV3A 3BJLA 3FQTA 1PIFA 2E86A 2EE9A 3LQZA 4WFHD 1DEEA 5BRZB 3GHEL 4OF6A 3RKDC 4YK4C 4EI0A 4WNQB 3Q8DA 4RGND 2ROXA 3MV7D 2EVGA 1MJ7H 1H0DA 2LXJA 3DVGA 3HPLB 1T22B 2WJ5A 2IXQB 4ZUTA 3SDXA 5B7EA 3K59A 1QVOA 3R1GL 2GUOB 3VXMD 1IW7D 4WSGA 1NCBH 1J05A 5CJ5A 5I8CB 4ZUVB 5L4FA 3DHMA 2VSDA 1G91A 1BYPA 3MLTA 2ID0A 4YSRA 1KULA 4X6DB 4XPHL 2P7TA 4E9RA 2HG5A 2B2TA 3HOZG 1EXGA 2ADIB 2VDRH 1KJ2L 3KPSD 5DQ9A 1TXKA 4R7VA 1LM0A 4L8SB 2UXTA 4UBDC 4KHXH 3MODL 4GKSB 3A3YB 1SHMA 4UINL 3V05A 3L9RB 2A1WL 4DERA 4QY7A 3DX9A 2PTTB 4G2AA 4MAUH 3FQ1A 4H2AA 3UX9B 3VDCA 5IMMA 3O11B 3BKML 1IC7L 1GSMA 1ADQA 4S1DC 4AE1A 1RP8A 1M1XB 1MCOL 2HP4A 3O2DA 1OP5K 3QZPA 1MLCB 4HDIA 5IHZB 4H0HB 4LF8Q 1L9TA 1PQZA 1KLUD 2VB2X 2FL5A 2BOSA 3OOCA 4PZ6A 1H5BC 1K8MA 3VGGA 3UDWC 3M4YA 1EZVX 2FWUA 2O6CA 3DJ9A 2NY0D 1U8IA 3D06A 3KLAA 2VZVA 2Y06L 5GHWL 4XYOA 3C5SA 2NN6G 1HH9A 3KJ6H 4TNGA 3FFDB 1Q90A 2VZTA 5C0CA 3QRFM 4I5BA 2PN5A 5DRWB 4B3ML 3AM8C 3ER0A 1EQQA 5IG7B 5GPRA 5CP7B 1NUNB 3EQLC 2H1LM 2JCCF 2OL3H 3QJHA 4B0MM 3MLYH 4R0LA 5IVXE 2BNQA 3AWFA 1F11A 4WUUB 1MVUA 5D7IE 1E27B 1NLDL 1Q9OB 5A16B 1NAPA 1SN2A 3MNWB 5FUOH 5IVXF 3VWKD 2CLVA 2ARWA 3V0FA 1G6ZA 1RZKL 1V10A 3E1F1 1IAII 1T3FA 4RBPK 2NY3D 2K6ZA 3BPLC 5HGDB 3U9UA 2N0MA 3EJUA 1ORQA 4DNTB 1W6WA 2OI9C 1NGQH 3K5LA 4QIWE 3QH3B 1ICFB 1EFXD 5ESVA 1PTOH 2RVLA 5KSAA 1KF9B 2CM6A 1DUYB 4J6IA 3V96A 1N34L 4RESB 4LKCB 4GFTB 4YNYA 1S7VB 4ZKCB 2PZWA 1JNHA 1KIPB 4M7KH 1HNXL 5TTRA 4AEIL 5BRZE 1MSPA 1PDKB 5D5MF 4IUVA 2ZTBA 2FEEL 4HKXB 3H8NA 1GC1C 2VSMB 3CZFB 4U6HA 3MA7B 1ZLVH 5B39A 2R4RL 4AYEC 4IKLA 1W0YT 2L11A 2R1YB 1E67A 4L3FA 1UVQA 3PJLA 1EH9A 4ANKA 2WNWA 5FFOA 3P9LB 1KLGA 3UTZA 4X6DE 1DEDA 1AZUA 5AVRB 3LKRB 4HHAA 1TQCC 4PHXA 2Y7LA 4L8DA 3AU1B 4MJHA 4N0YL 4X64Q 1WAAE 1SJVA 4GKLA 1GJWA 2FWOA 4GSXA 5E2TL 4KVCL 3RBGA 4GLRH 3L3JA 4IW4C 4JFDB 4OI8A 1ZJBA 4X6FA 3CCMA 3MOBH 4YHPA 3TCLA 3LPPA 2UY6B 5E9NA 5EKLA 2X3CA 4KUZL 5JIMA 5I66A 3LRKA 3WKMH 3PDGA 4QJFA 2VGLM 4A3DH 4FFYH 3TBTA 1QLRB 3PXLA 2XN1A 4NKMB 4RMWA 4LHJB 4HIJB 2K04A 3E9IA 2XACC 3UYOD 4F33A 3QZLA 1BXTA 4Y1AE 2BDNH 1KPVA 1KTDB 4GKZB 1RLWA 3ELQA 5D1QE 3W1ZA 3WEXB 5L37A 3MX0A 5BJTA 4FFTA 3V0EA 5AW1B 3MCKA 3CCJA 1W72H 4X98B 1XF2A 4PV1C 5ELBA 3W2DL 4EN3B 3PO3H 1U91B 3VXOA 5IQ7H 5DJCB 5TDPA 2R2EB 4X4YB 2B77A 1UXSB 3CSBA 1N6UA 1AIZA 4XX5A 1ZTXL 2VLKA 5FR3A 2G0KA 4WKXA 1EQTA 5DK3A 5E6YA 3MGAA 3MRNB 3O3UN 3P4LA 2MHVA 2KUTA 1S7XB 4TOYL 4WFGE 4WUUE 2Q8AH 2Z1PA 5FYKE 1RV6X 4DEPB 3WAJA 1C1EH 1SY6A 5TFSL 5C9KA 1XO8A 3X3FH 4K23L 1KYAA 5D4QA 1S3KH 5BO0D 4HJ1A 3KPRE 3S16B 2F53D 1YEEL 2EDWA 1ZK5A 1NTGA 5CZKA 3RDTC 2H8PA 5LNEA 3VXTB 4BZ2L 4B3RL 3B2UD 3I50H 4PCKA 3IJYB 5IVZB 1OT1A 4UQBA 4ZS7L 3KPLA 4ODBD 3B6SB 2LABA 4JI0L 4DR2L 2WCSA 3BWUF 4M8QA 4O51B 1NDMA 4GAGH 4P9ML 3GJFK 3HZYB 1WLHA 3VFRB 3QR1A 4F27A 3OLIA 3MRFB 4QRRD 1SEBB 5TQ2H 4RRPG 4OD2B 4B3VA 1MI2A 2QHRL 5HYSG 4BKTC 4UDTA 4R7DB 2AQ2B 4ACTA 4U1NA 5TDOB 4KX9A 2QQNH 1JCVA 2C9UA 4X6EA 5KANI 4RWYL 4YEEA 4B9ZA 4Q9CA 4MMXC 3PAZA 3CCRA 4CADA 3M3YH 2WWMC 5JXEC 4HGMA 5AOZA 3W5MA 4IYKA 1IW7C 1NOAA 4P74A 3HLAB 4KK5D 1R75A 3QWNA 3VRLE 1P7KA 5JNYA 4L9LA 5T1LB 5CO1A 5DMKB 5E9DB 5FFLA 2E3VA 1D9KA 3PXJA 1T6WA 2NVYH 4HK3J 5GAGC 1S9XA 5A1AA 2H1EA 4L1TA 4NRXB 1BF4A 1QSFA 3TFKC 1O6SB 3QEQB 5ABDE 4HS3A 1E28B 1IGIL 3L3HA 1NINA 2Z6BA 3FT9A 5EZLA 4L37A 2BIIA 4WI3A 3O9WD 1WTQA 2J4WH 3S34H 3GKWH 1I4FB 4YSSA 3RHWF 2VH5L 5LGKA 3P73A 2H1XA 5EWIL 1BOYA 1D1IA 1HNFA 2V3EA 2KVMA 4HIEA 4UIMB 2OSWA 3VXNA 3FTGB 4FXLA 4HJGB 4EDXB 2R1XA 1NFIB 1MEXH 2DTSA 4WJG3 3OW2A 2BIPA 3IAYA 4X8JA 4Q4IA 4FFZH 3R7QA 3NDYE 4X7SL 4YN3A 5ACMA 3HBPA 3V5HA 3MACL 1YUKB 3VSTA 1WBYA 1I7RA 1RTOA 2XNAC 2IBZX 4N0FA 1QI3A 5C4XB 2F0PA 2O5IC 2WNXA 3BGMA 3HS0A 4O58H 4XNAA 5HYJB 1RI8A 1DR9A 1SQMA 4MJJA 1QOHA 3Q6SA 1CK0L 5IBTL 4M3HA 4DAGL 5HSFA 2XWTB 4LLWB 3U50C 1AHWB 1QTYT 3ZYYX 2AVFA 2FBJH 3ESPA 15C8H 1YQVL 4K2LA 1LABA 4DV6L 1SYSA 2NY1C 4NDMA 4RISH 1KOAA 4UI2A 4H25B 3BUYB 4MB1A 3FDWA 4PLNC 3GD7A 2RQ8A 1U36A 2VXSH 3F64A 3HW7A 3C46A 2GEEA 3MU3A 4FI6A 2NDFA 5CZVL 1AH1A 3GTGH 2C4FU 1HNWL 4EXPX 3DYMA 3S4SA 1BNZA 2FNBA 2J6WA 4P05A 3VU2A 4BH7A 2CWRA 2MJWA 3I6KA 3HOVG 4QHKI 5LL6X 4WJ5A 2F0JA 3FQ2A 2DQEH 3TH3T 4QYAA 4WENB 2HH0H 3DTXA 4PW9A 2FLBT 2XA8H 2GI0A 4CKEA 3QW9A 1YY9C 3BVVA 1A1MB 3GIVB 1RAMA 5IYDH 4LDLB 4U1MA 3DUSA 1ZHNA 4LHUD 5L8KB 1ESOA 1CQFA 3R93A 5IW1B 2XZQL 3C6LD 4UNIA 5GZNA 1OAYL 3D2TA 1CD8A 3IJSB 3O4OB 4Z7UB 1ND0B 1J8RA 1MWAL 1ES0B 2AV7B 4KNUA 5COYA 1P6AB 5DGRA 4GT7A 4M61B 1IYUA 1PAMA 4JO2H 3WGUB 2CJUH 3PABB 1FFOA 3UOAB 3OAUL 3DURA 3PCYA 2VDQH 3RY6A 1LQBC 4HGWB 3D25B 1AZRA 1CXLA 1T89A 3QEQE 3Q8FA 1XR9B 4CRPA 1Z5YD 2APFA 2DQFB 4IK7A 4Y4HB 1JFHA 4KN7C 1H3GA 5D1QC 1HXYD 4EQ2A 2SEBB 3FPPA 4LGRB 2ICEB 5HI3C 1E7ZA 3IEAA 1TCRB 2ATPA 4QF1B 3GTLB 4B9WA 4JI3Q 2YD7A 4J6RL 1S7UA 4L1HA 2H6OA 4QOKA 43CAA 3TN2A 1TQWA 1M6UA 2R0ZL 1HZKA 1KC5H 5IW6A 4HUVA 5D8JH 3BSHA 2F19H 2CWPA 2EXWC 2QPDB 1L6ZA 1KV3A 3KYHC 3KPQB 1FO0L 1QEWB 3P0GB 1YNTA 4RVBA 4OKVB 4ORGB 4PMFA 5AFAA 2ADYA 4P9HC 4K8IA 4X50A 4A3EG 2WUBL 4HFWB 3C87A 3UACA 5GS0D 1QNIA 2YEZA 1O78A 3VTMA 3MLPA 4BM7A 2VWEE 1QQDA 3OHXB 5I8EA 3OWEB 3EFFB 2MHAB 5ELIA 5J6HA 4DR5L 2R8SH 3AGWA 5IYBH 3QO1A 3EYOA 3MRPA 1MAML 5HYJE 2BSRA 3EXJA 2CAKA 3BWUC 5I0ZA 5I16B 3NZ8B 4OWTB 4DW2H 4K3JL 3TA3B 1T6BX 3BYTA 2KHAA 3QUMB 1EHLL 2R69A 1N5YL 3ZTNH 2DQGH 2OF1A 3CCVA 4UAOB 3MXGA 5A3IC 1H9JA 1JG9A 3H3PH 4DPBX 1AIFB 1YUHA 3FYIB 4DT2A 3NQIA 2WXIA 4URTB 5BXFB 1UJ3A 1RHHB 4JI8Q 2VDRB 2K7VA 1A8ZA 3FT4B 1WZ1L 4U6XB 5JIKA 2QVIA 2VXWA 4JI2L 4XN9A 1IBKQ 4YDMA 1KTRL 3DK0A 3PIOA 1UOWA 3CFBA 2XG5B 1QPKA 2WINB 2JTDA 2KT6A 4HJ0D 4RCAA 2UXDL 5C3WA 2ED9A 1W0WB 5ID1A 2CU9A 2ZXBA 4L1LA 3AW5A 1H8SA 1R3KB 1DBAH 3QJXA 5DEHA 1RFDH 5DA4A 4G3YH 5KTEL 3BFWA 1A6UL 3S2DH 4ZMVA 5EOQL 3ULUH 4ABNA 1ONQA 2AUJD 3SDYL 3GS0A 3AWEA 4Y2DA 5IV2B 5LGJB 5J89A 2AJYH 3MUUA 1UACL 4HU8A 3ARYA 4OGQC 3WL9B 2FWSA 1JPTL 1AMYA 1CIUA 1IGJB 1Y07A 2WLLB 1ZVNA 3FDTA 1RULL 4KXDA 1DOMA 3L3IA 1Q9LB 3J81j 4LSTL 5M5YB 3U7YH 4A2DA 1FIEA 4ZXBB 1KZYA 4P59L 3UJIH 4TVPH 2XN9A 2YOCA 3SE3A 4P2QA 4C47A 4M6OL 2X4QA 4OCYH 1CICD 3KZ8A 1PSKL 5CJOL 4EN3C 4OV5B 1HIMH 4RZKA 4AL8L 1IAIL 3RURA 1VFOA 2FJGB 2KS0A 3ZVVA 3NACL 5F3BB 1GHKA 5BVPL 3LVEA 4XCEB 3RWHB 4ZCKA 3B9KA 2C1OB 3BVWA 3E8VA 3HOXH 2DY7A 1LNUA 3Q2LA 4OLXH 4PREB 4MDRA 4LBEA 1G7HA 4JPKL 4W9EC 3HG1A 3CLEH 4J3XA 5CAYB 4J8RB 3WS6A 5EZJB 3TP7A 4MXVF 1CF8L 3KPOB 4PRPA 1A7OL 2AXGB 3QIWA 1R47A 5F9AC 1N9PA 3V7MA 1MRDL 3VUAA 2VB5A 4Z3EA 3F7YA 2X89A 1ZGLA 1TU2B 4XPAL 3CRKC 4B50A 4NM4L 5C0IA 4Z3HA 4NFCA 4J2QA 3RFRA 3DSFL 4LLQA 4A67A 1JF1B 3LZFH 5AVZB 4Q14A 4G1MB 1BZQK 2PYFB 1JI1A 4QUCA 1RF2D 2E0PA 3F58H 3L3KA 1BO0A 3ARDA 4GYBA 5FDWB 1G0DA 1MNUL 3FSVA 2J7LA 3QPQC 4ZX6A 5BS0A 4KJWC 4L5TA 3LZOA 4MB3A 4NQVB 3H0TA 2WVVA 4NB3A 1S7WA 1NAKL 2O5YL 2BY0A 1DL7L 4YH6A 4X2UA 4NJ9L 2JXMA 3UAEA 3WFCH 3WKPA 1X5FA 1EBPA 2QT6A 3I75A 4FNLL 4OW6A 4S1RH 5C4JH 4PRDA 5JEAG 2JJUA 4N24A 4QIRA 3REVB 1F6AB 3ZKMC 4H0GA 3EDEA 3T0WA 2IMNA 1YPZF 3I74A 4AZ8A 4L4TE 3U9WA 4BXXH 2VDOH 1NANH 2D0OA 2ZJQA 2L15A 3OSOA 2FNWA 5K36H 2YRZA 1R34A 2J4XA 2KERA 2YWZA 3LX0A 2ZJSH 1TPXB 3QUZD 1F02I 4PN6A 5HBBA 1SFOH 3QXAB 5SX4I 3MJ8B 4CMHB 1UHVA 4O2DA 4X7FC 1AGFA 4RX4D 3QQ4A 5D1ZC 4F7XA 3MROB 5J1TC 3JWOH 4AC4A 3KVPA 1YVLA 2G9HB 3VH8B 2B39A 3IKCB 3B7TA 2F0HA 3EOTH 4RDQF 2IH9A 2LV4A 4IMLB 1JE4A 1I8IA 1JGDA 4O02A 4LF4Q 3PUXA 2B4CL 4LCWA 3IAQA 4G6JH 5DVLA 4OI7A 1YA5A 1BDYA 2P8LA 3T1FB 3TVMB 4OJAA 3JVGC 4PPTA 5DJ6A 1OGTB 2NXZD 3OZLA 5LJYH 1RZJL 1U9RA 1PTOD 1G7QA 1CFSB 1OLLA 2IF7A 1LV9A 3HOWG 5E1AA 3O13A 1AXSB 4R3SB 4J23A 3U9OA 4LPTA 5FGBC 3BZFA 1Q3LA 1LQSR 3EH4B 4HQQL 4PRAB 5GGTL 4PWGA 3PREA 2DH2A 1S3OA 3T1HQ 4AYGA 3SDDD 5C4XG 1AP0A 1EU4A 5CMDA 4XPTL 2EC8A 5SWZA 1X9RA 2XWRA 2Z4IA 3IKKA 1JZ4A 1AZNA 2ENQA 3NAAH 2B2YA 1PTOF 4JPIA 3FU9A 4N2NA 3JWDL 3R0MA 2DQUL 2AI0L 5C3TA 3VFWB 5F0MB 1PFCA 1E5UI 4P46A 4U1SB 4U49A 3H6AA 5CR1A 4YDLB 2DI7A 4JLRA 2A6ED 2EE0A 1CGXA 4JGUA 4RA3A 1AZVA 2VLRA 5D7JB 5MP6H 3V79C 4I0PD 5D6CB 1JV2B 2J8UE 3BYYA 4JG0L 1QI4A 2ID5A 1DZ0A 4TULH 2J8UF 5D93B 5CEYA 3A7LA 4PMBA 2YAEA 4IGBD 3SQOL 5GRZA 4F58L 5I24A 1VPOH 2F3VA 2YN5A 4YXKH 4JUSA 2FH8A 2J56A 5I0XA 4Q2ZB 2FHFA 1ZT7A 3SBWA 1HL5A 1II4E 1SE4A 2P52A 5LXGH 1WZKA 1ZIAA 2G2PA 4ODVL 1BXUA 1ZE3C 3RNKB 4A2FA 3UC0L 3EFDL 3NA9H 5FKPB 4ELMA 5C6PB 2LE9A 4FL4B 3QXDB 5B38G 3TN0B 2C4XA 3X2QB 5KYYA 3MA9L 1GAFL 4FADA 3NEOA 2H0PA 3HOZH 2H32B 3B1TA 2H1PL 3K8LA 1B2TA 3VA2C 5IF0A 5ALCH 3CLFH 3O4OC 1IBLQ 4AENB 5GAEC 3BKCL 3GSVA 4B9PA 3SCMB 4A2MA 5EC1B 2TAAA 4S1SH 3VACA 1IL1B 2YGVA 1A2UA 4YHZL 4N1EA 1QX1A 3KGSA 3QCVL 4XB8A 2ZYSA 2PLTA 2E7LA 2YPVL 5F97E 5AOIA 2WZPA 1NCHA 4DK5A 4CSTA 4XMVA 5F1NA 4LZKA 2X09A 3EG9B 1EAJA 4EDWL 1TWAH 2R29L 5E1GA 5F0PB 3EHBB 3PV0A 4FQ1L 4IFDJ 2KECA 4O4YH 2OPCA 5ETUA 4KFMA 1XF1A 1Z5LA 2D4FA 4QRQB 4FHKA 4EI5D 5I18L 3LTVA 1EXUA 1NCWL 1XGYH 2X5PA 1INQB 3GXTA 4ZPTB 4WVRA 2NN6H 5HVHB 1TF4A 2UZPA 1G43A 4GSDH 3TBYA 1KCWA 4N2EA 4LDEB 4M03A 2C3VA 2XRAH 5EBCA 4F3FB 4BA2I 4XZUB 3RUGF 1UOKA 5D2LA 1RPUA 4KH9A 3BDLA 3TIEB 5AVXB 2QR0A 3RNQB 3BXNB 4K7PL 3KWWA 3UG4A 5L2JA 3JQOB 1CICC 4IU3B 2AGJL 3ARWA 1QLEH 3TBVA 3I3CA 3EYFA 3OHXC 4XGZA 4KZEL 1W91A 2QV4A 3C1EA 2F4VQ 1NAMH 5F1OB 4JZOB 4ZLTF 5IGCA 4CC4A 1TJGH 4PJFF 1IAOA 4FGMA 4YXHL 2OX5A 3H2PA 1T66D 4WWKB 4ZOEA 5DUJA 3B83A 4BH8A 4ZS6D 1J1PH 3GTGB 5FK9B 2GK0A 4HA1A 4Y4FB 3TA3C 5KN5B 4XN1A 5LUMA 3CZJA 1XIWD 3L17A 4G8FA 5LWYH 1L5GB 1IEBB 3IF1A 1MCWM 3QWRA 3RZCB 2FJ2A 5IB3B 5DLML 3B56A 3CCUA 1CCZA 4LL1A 3WG7B 4A3BG 3MZGB 4NKOB 3F7PC 4X4XA 1K4CB 3KR3L 1GUOA 3KYAA 4LLYA 3W11C 1WVLA 2Q8IB 2MOVA 4OCLC 2VT0A 1LEGB 4N8FA 1RIHH 4HUXA 3ZHNA 3MO1A 2M8XA 1K8DA 3DROA 5MEOB 1ZT4B 3U4EB 1PG7H 5A2QE 1T2XA 1KYUA 4NAJA 1HH2P 2NX5B 1BM7A 4L0YA 1ZKAA 1EYCA 3KPPB 1AP2B 4PWHA 2NT1A 4KAQL 5GXBB 4KJYA 4OJYA 3ARVA 5IK3A 5FCSH 1EJOH 5JQ6H 3CDYA 4B3EA 2YPLA 2WMPA 3D2UD 1JZFA 2PP9A 4UIKH 3CRLC 1CFQB 1JDCA 4HWBH 4F57H 4JRLA 4GQZA 3Q8EA 4OFDA 4DAYB 2AQNA 2F0CA 2IMMA 2Y0SE 1BJ1J 2WOYA 4IBUA 1O5PA 4M6MH 3NCJH 2V5YA 1JK9B 3ATEA 1QBLH 1ZHLB 2Z93A 3WJLA 3ZL4H 4CJ0A 1MFCL 1UA6H 5I1CH 4HEMA 1JYXA 1KAWA 3UGUA 4TVAB 5ICYA 1H9MA 2R9HC 2ZP0T 3T0XA 3ARBC 5H1SE 2Z8RA 2HX7A 4FYDA 1TWCH 2K0RA 4GBXD 5DGQA 5EUKA 3UAAA 3FT2B 1BQQT 5HHXH 2OSYA 5JLZA 4QLWA 1SMYC 3VGAC 4QHNB 5DUPL 4ZMYA 2VSCA 2ESVD 3MNZA 3POCA 4PJ8B 4KFZC 1HL8A 5E03A 3VQ2C 4HPYH 5B3SB 5H35A 2C9XA 5EO9B 3IDYC 1FBIL 4IQHA 4F2MA 3NP8A 5DM73 1G291 1E3PA 25C8L 2NYZD 4C3HG 5LHY1 5C44B 1E9QB 2X4NA 4CDFC 4CGTA 2AP2A 2MQCA 3IMVA 3L1OH 1WFIA 2L4OA 2A83B 3ABLB 4IMKA 1R6VA 2BX5A 2CUIA 2K32A 3ZSTA 4DP4X 2W5PA 2KPNA 3GK8H 3ND9A 3BH9B 3Q06A 3VXQA 4RGNA 4V190 3ZE2B 1FNGB 1DANU 2CVRA 3B2VH 1H3WM 1O7YA 4W9FC 3C8DA 1KGWA 5C08D 4POZD 3W56A 1YHAA 4JRYD 4NI3A 4R4OA 2Y9RT 3L9AX 1FVEB 2L4NA 4X65L 4IGBC 3X1FA 3FHAA 3NIGB 5A2CA 3CCEA 4ZO8A 4JY4A 4N2GA 5IMKB 2OR7A 4KVNH 1TPXC 1WTLA 2J1YA 3NIFF 4X8GA 3COOA 4TF4A 5C6TH 3PL6B 4CMHC 3DV6B 4JCWA 2NX5E 2PTUA 5KUMA 2OCCB 2IH1A 1QJOA 2DLTA 2E4TA 3ATDA 4MKTA 4R2GB 3CLWA 3NTKA 1QE6A 5TF1L 2BVQB 4HKJA 3WFEL 3S1RB 3TPUB 3HHSA 5FF6B 2CKZB 5CD3B 5FCUL 5EPMB 3GSRA 3HG3A 3D69A 1PFSA 3EVQA 5C0BB 3ABGA 2PWFA 4B97A 1P6FA 1ZWIB 1N32L 1LM8V 3NZSA 3U82B 4ZFGL 3GRWA 3CC5B 3EGDA 1KEML 2P8MB 1U3HB 3OKEA 3KM2A 4R90H 3WY2A 1I6HH 1UJTA 3DOSA 3QO2A 3K5MA 1OALA 1S46A 2H3XC 2ZOKB 4RMQA 3WMPA 2GA4B 1NKOA 3LXUX 5HURA 2E6PA 4F7PB 3ZR5A 2UXVA 2YSTA 4NX0A 5EPLA 3HOXB 2O61B 1BZEA 5I1HH 2F0NA 2HYMA 2GAZA 2PW7A 2G4GA 3KL3A 4EKXA 4P71A 5M9OA 1B9KA 2K9FB 3NEEA 4IIQB 4U7SA 3UL4A 1OQXA 2AUKA 3IJEB 1QYGL 5CV6A 5FW8A 1R5IA 3H42H 3V0HA 3FN9A 4X5XB 3E9HA 2CNZA 3O0RH 3W82A 3WOVA 3CHOA 4DNIA 3WY1A 5F7WC 1P7HL 4ERSL 2AZUA 4YWLA 4DKFH 2F0GA 2ZUWA 2ZICA 2B1AL 3UTTA 5C97A 5I1GL 5J0BA 1MFDH 2AJ3B 3QHZH 2P5WA 3SPGA 4K8RH 1F9PA 2DEWX 4TUKH 4ZMZA 4GW5A 3GSNL 1IL2A 1GXDC 2JA7G 2AXHA 3FT3A 1VF7A 4H1LA 4H88L 1MJJA 3KLSX 1ZEQX 3S24A 5I23A 2WM0A 5JZ7C 1AH9A 1J0HA 3NSDA 2HFFB 1MREL 1L1OB 1HQ4B 3DOIA 4N8CL 4O00A 4IK6A 3T0EB 2OFQA 4QHLA 5D7JC 4TYUA 1FYTD 4PTTA 1XH3B 4X6BA 1IC5H 1JVLA 1UM4H 2Y1AA 3RIAF 5JMRA 2YEQA 1OY3B 4PJ9A 1Z5HA 1JHKL 3HR5A 1UZGA 2NCEA 1HOCA 1T66C 4HJUA 2R56H 1GKOA 4ZS6C 5IFHH 1I8AA 3KDPB 2VDOB 2FUQA 4WO4A 5AKVA 1HCVA 5EBWA 4G5ZH 3DNKA 3ZE2E 1GHFH 2F8IA 4BWGB 3V55A 3LKOB 1L7IH 4M48H 2GJ6B 1ZT1A 2IPUK 1HHJB 5CNHA 1FYHB 1T0MB 4N1HB 4P5TA 1E9PA 2G5UA 3NIGE 3LIUA 1MKHA 1XCQB 2ITDA 4K5LA 4RGOH 4F9LC 3N6RA 5BZZA 2G3ZA 2XIWA 4G6FD 1IV8A 4AVHA 5DHEA 1CO1A 3SCMC 4Q5VA 2VKWA 2BNRB 4A39A 3ULUF 1MLBA 1W6LA 5G5DA 3RWDA 1LTSD 1JB3A 2IFGA 1STHA 2WLIB 3AXLB 4UNUA 4A7GA 43C9A 1SAPA 3QPXL 4HMDA 1A3QA 2CIKB 3OB0H 4BCXA 1I8LC 2PW2A 4JFWA 1VQAA 1X5HA 4LO9A 5C0BE 3KFUA 4TVPE 4CVZA 4EOWH 5J6GA 3GSUB 3BVZA 2VDPB 1DJXA 3NCCB 3NZHH 2CSPA 3P3UA 1NEUA 1U8LB 3S3SA 3BS1A 3GHEH 4NZJA 4RAHA 3S8WA 2WXRA 5HVHC 1DQJA 4APQA 4IRSD 1T80A 4PS7A 1UZ6E 2IDSA 2CK2A 1HQRB 2VQUA 4Z7NB 5DJAA 4A66A 3SDCD 1DN0A 3R1GH 4YLBA 1TT6A 1UE6A 4E41A 1JP5A 4WI0A 1AYOA 4KXZH 3B1UA 3VVWA 4R7NA 1LT5D 5FJ8G 1JN6A 2NY6B 3BMVA 5GGSB 2B2WA 1L9PA 5JHDE 4A3EH 3OR7A 1TQSA 2P80A 4FN0A 4XPHH 2HDMA 4B9CA 1OTTD 2FO8A 2XLLA 2DL9A 2LLGA 5F0JB 1EOTA 1KJ2H 5B8CC 1TOXA 1ZV5A 3BZKA 1UT9A 4L2LA 1ZS8A 4Z7OF 3MODH 4WWKC 4HJ5A 4O2FB 5F8RC 1W80A 1JC7A 1QRNA 2F53A 2V3DA 4UINH 3ZE1B 2A1WH 5HDQL 1EY4A 3VYPA 1A1NB 2HIXA 2VL5A 1A6WL 4JDZB 1M6OB 3BKMH 1IC7H 1Z0MA 5EF0A 4FCHA 5J22A 3T0EE 3V9FA 1D5BB 4BYHA 3RZCC 3TP6A 3NIDF 1PFNA 5IP7G 1G1CA 4Q6IA 4YZFE 5HHQB 2J5WA 1MCOH 2CCZA 2VLME 3QK0A 4Z7QB 3AG4B 4M93B 3CC1A 4DR7Q 1G7JA 5AJ3L 3HKZA 2CE6A 1ZDQA 4A7VA 4QRRA 1E8XA 2HMID 4JKMA 3D31A 1EFWA 1GCFA 1R9FA 1NCTA 4K7PY 2B2VA 5LDUA 1FHNA 4YHMH 5GHWH 1XSOA 3K6OA 2Y06H 4QXUL 3RI5K 5LBSL 3WN5C 3GSOA 3PHOB 4WV1A 1BQRA 1CU4L 1TSRA 2EECA 3GTTA 3E6HA 1HZHL 1J9OA 2XT1B 1RUQL 4H0LC 2BMKA 3ZZLA 4AQEA 5F9JA 1MI5B 2OMVA 1XZWA 3MRHA 2NRDA 2C5CA 2IC2A 3LRMA 3MRJA 1TWAB 1NLDH 4LARL 1MFVA 1SJED 2BNRE 2EKJA 4RQQA 2OCJA 5EIIB 4DNLA 4RHRA 2BJML 1RZKH 5HY9A 1PVHA 3ZTCC 1U8NA 4BGDA 2M2DA 3C60D 5BZDB 2CFMA 3IDIB 4LL9A 5FPIA 2WQAA 2AJVL 4G72B 3SN6N 4DN4M 5CR3A 5IMLB 2R0LL 4PRIA 2DKUA 2NQCA 2V8MA 5ELOA 4YO0A 3UGXA 1JGIA 4PGCA 4GKOA 4G6AD 4GKJQ 4JAMB 5G2NA 3STBD 4D0CB 4UT7L 5E6ZA 3TCTA 3AQDA 3GD1C 3HE6B 4NIKB 4ZFZB 3D39B 1ADQL 4TKOB 2R4RH 2J88L 2Z8WC 3IBEA 3QULB 4LEEA 4W9GC 4HOXA 3QDMA 3FBQA 3O2DL 4FNQA 2P5EB 3LDBC 4P23D 3GJEB 2PI2E 4D9QE 3RGVC 2EDXA 4XVJL 4DPRA 5T1MB 1AVAA 4MA3A 3UP1A 1TTUA 2ZE0A 5FX3A 2YK1L 3NCEB 1ADWA 3F6IA 1X3EA 5C44G 1HFNA 2X40A 3FQTB 3LQZB 3MV9D 4E42B 1DEEB 1UWFA 4N0YH 1I1AD 4CKQA 4EF3A 1AANA 2HQEA 2XETA 3M85A 2ZONA 3BAKA 3IDJB 4KVCH 5E2TH 1JZ2A 2IEPA 2IDFA 2JA8G 1AZZC 3WEAA 1H0DB 4IPGA 2UWEB 2YR3A 1F41A 4AE0A 5EU6D 1N36Q 3ULVL 2B63G 3BLPX 4KUZH 5FO9B 2IAMD 4HETA 4PBDA 4QYOA 4DFHA 1Z32X 3NRQA 3SE9L 1E1OA 4X7CC 4BWWA 4Z7QE 1MH5B 1DLFL 4IURA 3CFDA 4UWQB 3V8OA 1U8HB 4MRCA 4DR1Q 5DQ9B 1B0WA 1MZZA 1QSEB 3EO0A 4IFDI 1PMRA 1RH8A 3BESR 4KK6D 2WTRB 3CDZA 3K2IA 1R1CA 3LSOA 4FXTA 5AW5B 5HPMB 4N9GA 3TESA 2WHVA 4GP4B 3W2DH 3WJMA 1R24B 1GGYA 2FZ3A 2JJVA 1KNOA 4D0DB 3ULUC 5CCKL 1AC0A 4MWFA 3S5LG 3PWPB 3OIPA 2NR6D 1C5CL 1UH2A 4DN3L 4IBYA 4DSYA 2QSCL 2R61A 4LAQL 1ZTXH 5KSUB 4R2GC 2BE5D 5BZWB<