4C3JG

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
309
structure length
259
Chain Sequence
NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVELGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
total genus 37
structure length 259
sequence length 309
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1060 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c3jG02
4C3IG 4C3JG 4C3HG
chains in the Genus database with same CATH superfamily
3LNNA 4UP8A 1K8MA 4DV3Q 5C0XH 2WIIB 4C3IG 4ODGA 5IT9L 5E7NA 1NUCA 5D14A 2EPBA 1I6HB 5BN4A 3PCOB 1SEBD 5J22A 1JOKA 2CKZB 5EKIA 1PLFA 4A4IA 1SDFA 4EVOA 4A3MB 4DR6Q 3GV3A 4LJZC 1S5DD 2OXPA 4P71A 1SXTA 4M1UB 2F0GA 4MIUA 5DEHA 4JI1Q 4FXDA 3HKZE 1C4QA 2Q2HA 5CV9A 1L1OA 3IL8A 1B4OA 1PH2A 2K5WA 4MHEA 3HOYH 2NUCA 4DV7Q 1YVCA 1CT1D 1QJOA 4K5XA 4C3JH 5C0XJ 2MFIA 2H1EA 3D4WA 1YBYA 5IYCG 1EY5A 4RGNA 4CJ0B 1HR0L 4A93B 4IOCA 4ZLTF 1JC7A 1U4PA 1X9NA 3KLWA 4N8X1 4DN4M 4JG2A 5DAUA 2QEXA 4ILWA 3K57A 1SRUA 5M3MH 4HJ8A 4NXNQ 5C44B 1SYBA 4RKLA 2JK8A 2IJ0A 3WWVA 1M1KC 1STHA 3OSOA 5IGDA 4DR7L 2F0DA 4LNQA 3S1MH 1II3A 2K6AA 3FKIH 1E2VA 4X6AH 4FVMA 1S5BD 2KUMA 4DV3L 1X3GA 3LX0A 3H0GB 4C2MH 3Q24A 1JJ2A 2FFKB 4ABNA 2B3GA 2XN9C 3D6CA 3EVQA 3SK4A 2Z1CA 1Z7TA 3X3NA 4TVAB 3C1FA 3MXNA 1X3QA 3NWSA 4DR6L 2IHEA 1MJEA 2I5LX 2E76C 5HY6A 1SJED 1EY6A 3IAYA 3KUPA 4JI1L 4POFA 3E3XA 4RCNA 1BXTA 1PYSB 1SAPA 3EBEA 2G9HD 1SJHD 2D5DA 1IHZA 2Y0SB 5D65A 1A62A 1E1TA 4DV7L 1CFMA 3KLRA 1TY0A 2A69D 5J1ZA 5I9OA 3NTKA 1YJWA 1MIUA 4G4KA 1D8LA 2HUGA 3MEFA 1RHPA 3AQQA 2B63B 3TS0A 3PO2B 1VQ7A 4ZRZA 3CXCA 4DR4Q 1HA5A 4NXNL 3HOZB 2R6GA 4YY3Q 4QUCA 4A3MG 5LHY1 5IGGA 1QZGA 4GN5A 2CFMA 2WAQE 1I4HA 1OO9B 1PTOH 3Q0AA 3KBGA 4UP9A 5CV6A 1K8AC 2D0OA 2F0OA 1TWCH 4H02A 4DAVA 2N55A 2R7ZH 1DGSA 4OELB 1QZHA 3NTIA 4HJ5A 4K14A 2CH4A 1NJIC 1QG7A 4DFAA 3VYRA 5ELNA 4A93G 1FR3A 1GKHA 3HOUH 3ERSX 1GD7A 3K6OA 3VR2A 2ZM6Q 2Z9HA 3L0OA 3WOFA 4RGOS 3T16A 1A3VA 2K4KA 3J80E 2EY6A 1BBWA 1Q82C 3DXJC 4AYBB 2N78A 1I4XA 2VXWA 4N9PA 1WCMH 4QIWE 4WORA 2RHSB 3AMUA 5EGTA 3I91A 3BDCA 2F0FA 4B3TQ 2VB3X 2K1BA 1SE2A 2E75C 2SOBA 1Q3LA 5LL6X 2O5IC 1A0IA 4DGZA 3FDTA 1TWGB 1ESFA 4JV5Q 4NP5A 3J81i 1JJGA 3TP7A 2F0SA 1LT6D 1V1PB 2M00A 2ZJQA 2YYZA 4MNOA 1A8VA 3GTOH 2RQXA 1HNZQ 2NVQB 3HZXA 3R3OA 2EY5A 4DR4L 1SSOA 4IJLA 4ULLA 3CC7A 2R93H 2UXCQ 1JE5A 4YY3L 2A68D 3EIVA 2ZT9C 2E2HH 1U0LA 3S2DB 4OWWB 2R61A 1N9WA 2PW5A 3RZOH 4POGA 2CQAA 5C4HA 1B8AA 5CBAE 4CKEA 1BBXC 1TVXA 2F0MA 1OXXK 5CBEE 1WVLA 1OXTA 4JI8Q 5C3EH 2OQKA 1B44D 3MFYA 1BKBA 1J8IA 1HHVA 2ZM6L 4DV5Q 1KLUD 2GA4B 2CCZA 1I4RA 1FNVA 3CCLA 3PIP3 1ONLA 2VUMH 3RR5A 1VQEA 1PXUA 1MKHA 4HCEA 4B3TL 1GUSA 5M3FH 4IUPA 1UE7A 4XQQA 5GADC 1HZCA 1B50A 4JV5L 3C1EA 3NBHA 4LUZA 4L5QA 1Q1EA 3TP8A 5ELEA 1HNZL 3RLFA 5C4JB 4CDCC 4NMZA 3S1NB 2UXCL 1TWHH 3CC2A 1C48A 1PH7A 4ME3A 1WFQA 2PQAB 2DN8A 3SK6A 4I65A 1LT3D 2RHQB 3J7AV 1JJCB 5IE8A 3DLLA 4HIDA 1F9RA 5EPKA 5IGCA 4AYBG 4LK1C 1KIXA 1JE4A 3OIQA 4KJOA 1HNXQ 2A73B 1Q90A 3L7ZC 2Z4HA 3HOXH 2KEEA 4GN3B 4KKSA 4X3UA 1B3QA 4JI8L 3RUZA 4Y7NB 3BVGA 3HOVG 1GVPA 3QOJA 2EYLA 5GAHC 2NVYH 1BNZA 2F3WA 3K7AH 1PRTB 3HKZB 1EYCA 4DV5L 1A2TA 2VZAA 2L4NA 5EBCA 3RLNA 3NQTA 4A3IB 1AFPA 2RCNA 1K83H 3KFUA 4P72A 4LF5Q 5IYDH 2I46A 3UI2A 2BA1A 1LTBD 4R4TA 4L5SA 4BBSH 3I8ZA 1M4VA 4RWSC 4AH6A 3TP5A 1HFGA 4A76A 3VR3A 5FO7B 4FF4A 3CMEA 2XRSD 3TZUA 2MGSA 2ZXPA 5J3BA 1GHKA 1IYUA 3JAMc 5C5LA 2JA6B 1DM0B 3V96A 5JOBA 5JVG3 1TS4A 3T1YQ 2F0KA 2NVTB 1PRTD 2WKCA 1NMGA 4A3GG 1AE2A 4KKUA 2CWAA 3JAMi 1KNEA 1BR9A 2HCCA 4UY8C 2PNHA 4P75A 4DV2Q 1T5XD 1VQPA 4LW1A 4DK0A 1OXSC 3A7AB 2AUKA 3S16B 4IPHA 3CQZB 1DJRD 1HNXL 5I6WA 1TR5A 2VY3A 2D0PA 2JE6I 1Q8KA 3H6MA 1D1KA 4X62Q 1HQMC 2KCMA 2EE1A 4XTCS 1DOKA 2DJFC 1EL0A 3GTMH 1YNJD 3R2TA 4P2CB 2UXDQ 3GTLB 2L12A 3HFZB 1CTMA 3BYYB 3S24A 3F1ZA 4DF7A 2E2IB 1UE5A 5EKLA 4LF5L 1VMCA 1V9PA 4Q0FA 4R8NA 4JBJA 3KF8B 2KCNA 1B1ZA 3AU7A 1QCBD 4A3EB 3G71A 1U4RA 2BE5C 4DR5Q 4CKCA 4A3KH 4CGYB 1TXYA 1PH9A 4LMQD 2ES2A 4BY7B 2K5VA 2M9VA 4LF7Q 4C56C 1SBBB 1WJJA 2ZTEA 4ALPA 5KNDA 3FPPA 1VQNA 1TKWB 1A3TA 1JB3A 2Z4IA 4YCWA 3T1YL 1TS5A 1CKMA 2WAQB 1DONA 2SNSA 3NP8A 1G291 2R92G 5CV4A 2LFNA 3SDZA 5HGTA 4OHJA 4BS9A 2SEBD 3NENA 2JEAI 4RMFA 4A3IG 4DV2L 3DM3A 4QJFA 2LSSA 2LY7A 4LWCA 5I4DA 2EJMA 2PW7A 1BOSA 1MSHA 3BU2A 3HG9A 3I72A 3PMFA 3NTHA 1Q1BA 1RD9D 1BCPF 1HH2P 3A0JA 4HSPA 3T1HQ 2R7ZB 1Q12A 1TWAH 4X62L 4FF2A 5C4XB 3M3YH 1SMXA 3BVZA 1STYA 1YEZA 4DAYA 3J7YW 5HURA 1WTRA 2UXDL 2L0CA 4A3FB 2JA6G 2YU9H 3PUYA 3HOWH 4OO1I 1G2SA 3NXWA 5TSSA 5JPMC 1PRTC 2RDGA 4V190 4U673 1O7YA 4QIWB 3J80i 2GN5A 1W6KA 2EY1A 4PMCA 1H9SA 1B7YB 1EY9A 1IBKQ 2ASBA 1GUNA 4QF4A 2NYZD 1E7ZA 3CCSA 4BA1I 2I5HA 1KDCA 1L2FA 4JK1C 1WCMB 4DR5L 3MXNB 1AZPA 2OF1A 5GROA 2UU9Q 3EA6A 3MZ5A 4RH6A 5C5MA 4DK6C 4LF7L 4JOIA 3RNUA 3GTQH 2OWOA 1YHQA 2YTVA 1EWIA 2A6HD 1JB7A 1I50B 4GNXC 2O4XA 5M5YH 1E22A 2XWBB 4A3DH 4PZ8A 2FXQA 4YWMA 3P1HA 3T56B 4B3RQ 1KL9A 1YNJC 1SE3A 3W1BA 2R93B 3J81L 1D1IA 3A8KE 3VYTA 1IYVA 4RCOA 1G8ZD 2D2CC 3P20A 1CUKA 4A3GH 5IP9H 1S5ED 3E9IA 4DXGA 1CM9A 4EQPA 4A3EG 1X54A 5G3LF 3NK9A 1Y1VH 3EFXD 2HD3A 4OO1H 1JORA 3S2HB 4J1MA 2PI2E 2Q8RE 3K81C 4ZYSA 3T1HL 4EQ5A 1HJPA 4BY7G 4O1NA 2MHVA 4DNRB 1O80A 3BDLA 4G57A 2FMCA 4R1JA 2KJXA 2Q8IB 3UDFA 5C3EB 3C46A 4NW2A 1NCVA 4IALA 5I9PA 2B2WC 2K05A 1VQOA 5AFWA 2WAQG 4EQNA 3S15H 2VNUD 1UE1A 4DPGA 1KQSA 5E4XA 3CP0A 1IBKL 2X6LA 5A2QE 1WTHA 3UDIA 1EY4A 3Q23A 1KDAA 5CV5A 2UU9L 3N6RA 4DUZQ 1NE3A 3KBXA 1HR0W 3O13A 3IRBA 2PZTA 3MXPA 4CDFC 1TQOA 3FRPB 1IL2A 1S3OA 4YCUA 5CV8A 2IPKD 4ME5A 2WV6D 5C4XG 3KOJA 2GVBA 2C5CA 2NN6I 3OWEB 3ULLA 2QCPX 2L1BA 2NTTA 2HQEA 4IUUA 4B3RL 2ZXOA 4CJ2C 3K80C 1L1OC 4FF3A 2PZUA 1RF2D 3J81j 4A3FG 2K01A 1LTTD 1TWHB 2JA8H 5CMDA 2UUBQ 2QW7A 1YITA 1KTKA 4PMWA 2KCCA 4EQOA 2PQEA 3L2PA 3HP3A 1N32Q 2MO1A 4DUYQ 3R2IA 2R92H 3GTPB 1FJGQ 2MNAA 5BR8Q 4YIJA 2B2UC 3PF4A 4JI7Q 1Y14B 2KHJA 3URYA 3SHLA 3I4LA 5FLXE 5EJWA 3NHHA 1PDQA 1STGA 5JAVA 3RN2A 3JC66 1IKMA 1LT4D 3P7JA 2NZOA 3H3VI 4P74A 1W2BA 4LFCQ 2QDBA 4I7AA 3I4MH 4PMBA 3PGZA 5CYUA 2ID0A 4HSVA 2K50A 2A6HC 3PO3H 3R93A 1D7QA 1XWEA 2NVYB 1EYAA 2JA7H 1EY7A 4C1NI 1GM5A 4C3HH 3L3OC 3JAME 1N34Q 1XXGA 2IT1A 3GTGH 2F0PA 5IP7G 4IFDI 1QUQA 1PFSA 4K2KA 4QB4A 4OIKA 1X65A 4GKJQ 5JEAG 2K5QA 2EYMA 2NN6H 1F9QA 4XXEA 4ID6A 3TRZA 2A74C 4DUZL 3P75A 1CKNB 3TP6A 4JI6Q 5K36G 2AQ3B 2N49A 2HDLA 3S1QH 4JCVE 3I4NH 3KLSX 3TZDA 4XIGS 4EGVA 2OT2A 2QGQA 5KNBA 4N8FA 1WOCA 2C35B 1LTSD 3GV6A 1CHQD 2DNEA 5IGFA 1EEFD 2KA7A 1PH8A 4BBRG 3PUVA 1Y69U 2UUBL 2ZXRA 2F0LA 3AEVA 2JEBI 1SR3A 3H3VH 1N32L 2WB1E 3CRLC 4DUYL 4BY1H 1FJGL 5BR8L 1VS0A 3AYHB 4JI7L 3A54A 4YHHQ 2ATWA 3JAML 3S1RH 3WDNA 2EVBA 1EEID 2XIWA 2VQEL 1JMCA 4DAMA 4LFCL 4BXXG 1Z6HA 3W3AA 1CSQA 2RSOA 4GLVB 1JOOA 4ZCKA 1F2ZA 2OQ0A 2EXZA 4IFDH 3E5SA 1DOLA 5IYBH 4HR7B 2Z0SA 2B2TC 1NNXA 2O5JC 3E0EA 4E6IA 1BVSA 1GOZA 2N8NA 4LUOA 3KYHC 2IX1A 2MUYA 5EPJA 4DR1Q 4CHTB 1N34L 4A3BH 1GUWA 1NSNS 1X56A 2IX3A 4GKJL 1LTRD 1FD7D 2QA4A 3GQBA 2F0VA 3ERQA 2Z6KA 1LV9A 4IPDA 3QO2A 4JI6L 5FLMH 3I56A 3U9SA 1EFID 2Q8TA 1H9MA 4LUVA 3TN2A 5M5XH 2EJFC 4HIKA 3BZDB 5ELCA 4RHRA 4C3IH 1E0BA 4IFDJ 4OEMB 1D5ZC 4R4OA 1XMQQ 3NELA 1SYFA 1B3AA 3LGJA 2LXKA 2OTJA 5C3XA 5C44G 4DV1Q 3BZCA 2WINB 5AJ3Q 1EIHA 3M7NA 4A3JB 2HIXA 1XMOQ 5GAGC 5EKKA 1ZKOA 1B9NA 4DR2Q 4YHHL 1R9TH 1I4PA 1D6EC 3G6JB 3SVMA 3GTKH 2IX0A 3H0GG 1F9PA 2J4XA 3F2BA 1STAA 5LMUQ 3WOEA 1SFOH 1TWAB 4LF9Q 1STBA 3QIAA 2EYFA 2HHHQ 2QKIC 5IYCH 4IO9A 4OXPA 2DY7A 1W6JA 3HOWB 4R9WA 5FO9B 4J8QA 4DR1L 1FNUA 2N3SA 5HGQA 4DNTB 1CSPA 2EYPA 2YTXA 5M5WB 1KDBA 1UEBA 3Q22A 1TWFB 1VQ9A 3KK7A 3A5UA 1JWUD 3D0FA 5J39A 2RDHA 2Y0SG 3J80L 3NBIA 4H13C 5D3IB 5FK9C 2FINB 1UAPA 3OHXC 3UDXA 2E2JH 1U4MA 2JYOA 4O2DA 5FJ8G 2BDOA 2XWJB 3A8JE 5ELBA 3NE5B 4G7ZC 3GTJB 2B63G 3PO2G 1XMQL 2F0JA 1QNKA 3J7A5 1L0XB 1NMFA 1J6QA 5KNCA 4DV1L 3HOZG 2B39A 5AJ3L 4DV0L 1M8AA 3SXHA 1CA5A 1Y1WB 1VQFA 4YCVA 1XMOL 2JA5B 4PNYA 5IT9c 3MEHA 3H91A 4DR2L 1N8RC 1V43A 3F8TA 1HZAA 4Q5VA 1RODA 1I94Q 1SNOA 1VQ5A 1VQLA 3OWFA 1UEAB 5FKAC 5LMUL 3TS2A 4PZ7A 3OOCA 2EYOA 2KQ3A 1VQ4A 3FMCA 5KEEA 4ZKCB 1YJ9A 4LF9L 1PH4A 2HHHL 4X3TA 1EZ8A 1QVFA 2QILA 2Q2TA 4MN3A 1JWSD 1G51A 1TU2B 5D3DA 3CPWA 1I6HH 4KHZA 1PZID 3QWNA 2B2YC 2A8VA 2V4DA 2BE5D 2B8GA 3RD4A 3I3CA 4A3JG 2JSOA 4A3MH 3KLSA 1KABA 1EWHA 5IOCA 3MHBA 2AKWB 5ELDA 1MI2A 1HFNA 1GO3E 1KAWA 2ZTCA 3G6EA 4K5WA 4L5RC 4NKLA 1B53A 5EQ0A 2AUJD 4N9TA 1A6XA 2HIVA 1XTDA 2H4OA 1BF4A 1DOMA 5CORA 1RDPD 3PUWA 4FP5D 1EUJA 1ZXTA 1P16A 4NB3A 1HUMA 1SE8A 1UE6A 5L37A 5FLXc 4A93H 2B8FA 3CC4A 1HNWQ 1K8OA 3TBIB 2VB2X 1OXUA 1FGBD 1DCZA 1OXVA 4HIOA 3HRZC 5IGBA 1E3PA 3I4OA 1ET9A 3T4AC 3GD7A 2EJGC 5JJLA 3HOYB 5JJKA 1SN8A 2L15A 1I94L 4JVZA 4C3JB 5EPLA 4JI3Q 3U50C 4GNXB 4F87A 1LLRD 2B2VA 1B70B 1GUGA 1STNA 1MJCA 1PFMA 2NVXH 3I4MB 1O7IA 2KENA 4JW0A 1S40A 1CA6A 4XT3B 3GO5A 5M3MB 3IKJA 3QB3A 1TT2A 1ML0D 1UWVA 1KRSA 2P5ZX 1W3SA 5IODA 3M4OH 4XDXA 1JT8A 3OW2A 4C3HB 1IBLQ 1HQRD 5E3FA 2PZWA 4FNFA 2CW0C 3X3MA 4F8MA 2SDFA 3S1MB 1Y1WG 3FKIB 3PSIA 4HAEA 2KVMA 2A19A 4A3LG 2RCFA 4AIMA 4K0KQ 2LKVA 4YWKA 4C2MB 3F2CA 1IYJB 3A56A 3FPUB 3CU7A 4BA2I 2K5NA 2EYJA 3C2PA 1V1PA 3S1QB 1SYDA 3STBC 1BCPB 4AQYQ 1F2YA 3I4NB 2XSCA 2MO0A 3A74A 1K3RA 1QNUA 3MXGA 2JXMB 2IY5B 2A1AA 4QY7A 2WB1B 4H44C 1KD1C 3CKIB 4JBWA 3QG1A 3TEHB 1HNWL 1EZ6A 2D62A 4JPBW 1CKOA 1XJVA 1PZJD 1I3QH 3K7UC 5GQOA 1K73C 3EROA 1N36Q 2NZHA 2VL6A 3BG3A 2K7VA 3K5LA 1KNAA 3V05A 3A55A 4IQZA 3S1RB 4I7ZC 4JI3L 2NZ1D 1AEXA 4OIJA 5C0XG 3U9OA 5JJZA 2D9UA 1PMRA 2NBFA 1T5EA 3K58A 2Q2UA 1FGUA 3M4PA 1L1OB 3NEMA 1BCPD 2AQ2B 2RSNA 3E0JA 3TREA 3SK8A 3PQIA 1CQVA 5LMNQ 3HKZG 4RGMA 1ENFA 4QL5A 5ELOA 4IUNA 2F0UA 2K32A 3G4SA 2BCOA 4YWLA 1IBLL 1PTOB 3DEOA 4QGUA 3ND9A 3T51B 1VQ6A 1XPRA 1X3PA 4L5TA 1VQJA 2WP8J 2IW3A 4QUFA 1TWCB 3K0YA 1KC8C 2EDGA 1FNWA 4QCLA 1RTOA 2I0QA 1V1QA 2RDFA 4OWXB 4K0KL 4Y52H 1VDZA 3A8IE 3HOYG 1V1OA 4HJ9A 1BUVT 4C3JG 4DK1A 3SEBA 1OTCA 1HA6A 4AQYL 4HMJA 3ULJA 3HOUB 3R8BA 4C3IB 2XGTA 4XT1B 4UAIA 5LMNW 1KHIA 3CCVA 1S5CD 1XTCD 2PQAA 4FYDA 4RG1A 2BDNA 3I70A 4DK3C 4X65Q 1TWGH 5M3MG 2YTYA 2PPBC 3HOVH 1HXYD 1C8CA 1PTOD 4Z9CB 4JOIC 1N36L 4KTAA 1WTOA 4J15A 5CR3A 3UE0A 3ZJYC 2RBMA 2MQHA 3BDOA 5ISRA 3U4ZA 3FKIG 1A2UA 4B9WA 2IHFA 2A6ED 1F2MA 5JVH3 3D4DA 1LTID 4R4QA 2F03A 4JYAQ 3H09A 3NWTA 3GTKB 3HGBA 1U5KA 1YJNA 4HMIA 1YNNC 3ONAB 2X69A 1ICWA 3GTOB 3ZYYX 1AZQA 2K5DA 3KJOA 5LMNL 1H9JA 2KBNA 2E2HB 1M90C 2SNMA 1K8GA 1SE4A 2WB1G 1LO5D 3CMAA 4KY6A 1QILA 1E24A 3AB9A 1VQIA 4GZYC 3DWAA 4S3SA 1B9MA 1ESRA 1ZYRC 2JJQA 4KJNA 3I73A 3BJUA 5EBDA 2F3IA 5F2DA 4GKKQ 3RZOB 4V0BA 1RIPA 5A35A 3Q8DA 1NTGA 4PG3A 2F4VQ 4HJ7A 4O42A 4OL7A 5IT9E 1BQQT 1LM0A 2KCTA 4X66Q 2R3ZA 3S9WA 4GLXA 1BCPC 3D31A 2UUCQ 5C3WA 4X65L 1X32A 2HDMA 3MC0B 4IJHA 1X3EA 2F0QA 1I5FA 1D5MC 1JWMD 1Y8NB 1GUOA 2VUMB 1NR4A 4WJ4A 3RZDH 3H3VC 2ICIA 5M3FB 1AH9A 3M4YA 4JYAL 1MBYA 3M4QA 1D5XC 1FVIA 3OIPA 3BVMA 2R7ZG 2ENBA 1GXDC 4KMUC 1TS3A 1SMYD 4GOPA 2RF4A 5FOBB 4XYOA 3VR6A 3HOUG 2NWGA 3FVQA 2DGYA 4H0LC 5JPNC 4Y7NH 4HEDA 4KLKA 3KF8A 3VDYA 1SLJA 3S17H 5ELFA 3HS0C 1QVGA 1PTOC 1XNQQ 4IUTA 4DNIA 1YHBA 4GKKL 2PO4A 1ASYA 4LAAA 2R7FA 3M85A 4A3IH 1WCMG 3S14H 4OGQC 1LT5D 2JA9A 2VQEQ 5A2QL 1VMPA 4KN4C 2A6EC 5KYLA 2F4VL 1YIJA 5JJIA 3HOXB 4JI5Q 2E8GA 2K28A 3IFTA 3KDFA 3DMUA 4X66L 5KRUA 1TS2A 1MHWC 3K7AB 4HIMA 2UUCL 1ICFB 1KRTA 3Q6SA 4XYQA 2R93G 3FP9A 1RCVD 1K83B 2F52A 2WFWA 2JP1A 2JA6H 1X6OA 2BA0A 2B2UA 1AE3A 4L8JA 3ND8A 4CDEC 3CPFA 3D4RA 4BWGB 5IGEA 2NVTH 4BBSB 1VQGA 1A3UA 2J7ZA 2C9OA 3CD6A 2J0TD 1WD0A 5IIFA 2IWHA 4LF6Q 2BH2A 2EOTA 1VQHA 1VQ8A 5FLXL 3ITPA 4IN3A 3S16H 4GS3A 4HJAA 4IZ8A 4UPAA 3CQZH 2CHBD 5C3EG 4LF4Q 2NVXB 2WKDA 2NTSA 2EY2A 1EQQA 1RJTA 5BN3A 3NBHB 1EU4A 1RTNA 3M4OB 2FJ2A 2G5DA 3GTLH 4WJWA 1XNQL 4F88A 2VUMG 2KECA 1PA6A 2DJGC 1Q86C 2E2IH 3RMHA 3N52A 1IW7C 1O7ZA 2K33A 2I07B 4FO2A 5M3FG 3V2TA 2L9HA 1VQAA 3ULPA 4JI5L 1JICA 2EZVA 4A3EH 3I55A 1XPUA 1AW7A 4K8JA 1KAAA 2IL8A 3EQLC 4KV6A 1O7LA 1F2LA 3GTMB 3RLOA 1EQTA 1LTGD 4GLAC 1SMYC 4NPSA 4BY7H 3L9AX 1EIFA 1EQRA 3D8GA 4A75A 1JR0D 1VQMA 2Z6KC 3AFQA 4CKBA 4DKAC 4IUVA 2TSSA 2M2LA 3FEWX 1B2TA 4B9XA 1E2ZA 1I3QB 3NPPA 3PIOA 3CCJA 5DLQE 2KHIA 1IZ6A 4HN7A 3QJYA 4A3KB 1A63A 4CDDC 1I4QA 1QOHA 3G7LA 4TRDA 4LF6L 2F0EA 4A3CG 3U4VA 1VCIA 3W5OA 4F7XA 3HOXG 1JOQA 2B2TA 1UUPA 3MVVA 1G91A 4RA8A 4FDBA 1E1OA 4LF4L 4KD3A 1EOVA 1NY4A 1VQDA 4H7BA 2QF7A 5C4XH 2A5HA 3BZKA 4DAPA 4DV0Q 2OTLA 2ALYB 1RKNA 1PVOA 1FL0A 3D3RA 2ICEC 2AHOB 3MA2B 1LABA 3KF6A 4A3FH 1C9OA 1CQFA 1HTPA 5IYDG 1H9RA 4DR3Q 4BBSG 1EQVA 2ZJRA 1CZWA 2V1CC 4EX5A 1PYWD 1EOTA 3DEPA 1HCZA 1HPCA 1KLGD 2F0TA 1EY0A 5I2YA 2K5HA 4XQJA 3M3YB 1T9HA 4OX9Q 4HCSA 1G6ZA 3J81c 1J9OA 3CCQA 3MAQA 4CJ1B 3PUZA 2YU9B 2KHSA 3LWUA 3W2DA 2DNCA 2L55A 5EAYA 1WTWA 1Z9FA 1I50H 4X3SA 3HOVB 4P73A 5K5PA 1UNSA 3M9BA 4KD4A 1F9SA 3DWQA 1Y8OB 4JBKA 1D2BA 1DZ1A 2LMCB 1EU3A 5IP7H 3AFPA 3OTOQ 4B3MQ 5JEAH 5C6AA 3QOLA 2ZJPA 3I2ZA 3GTQB 5M5YB 4A3DB 2XRQD 5K36H 1L0YB 2CQOA 2PMZE 3S2HH 2EXDA 1N33Q 5DM73 2A69C 2CW0D 3H94A 2XTIA 1QB5D 1PFNA 4IUQA 1STEA 4KKTA 5CGKA 1BDOA 1ZEQX 4LFBQ 1BO0A 1L0WA 4R4IA 4LF8Q 4A3GB 4BBRH 4DR3L 1A15A 1CKNA 3K8AA 4ZQ3A 4WJ3M 3UE1A 2MP1A 3CCUA 1Y1VB 3MXUA 4ZUIA 3TMEA 3TSSA 2CH4W 5JEAJ 4A3KG 4OWTB 4R4CA 3STBD 4OONA 5CC4A 4OX9L 2G9DA 1EIGA 3ER0A 2QDLA 3MFGA 1CZGA 1GJXA 1XYIA 1PV4A 4DXFA 4BXXH 1ET6A 5C4ZA 1NR2A 3TQYA 1QE6A 3A7LA 4PZ6A 3S15B 4TQUS 1FYCA 4DU9A 4IPGA 1QWYA 1K9MC 4DA2A 4MTKA 4DAYB 4ZK9B 1C7YA 2R7DA 1SNPA 1Q8IA 1P8LA 1EWCA 5I6YA 4KN7C 2K14A 1G6PA 3C3LA 3RZDB 2TMPA 5I2XA 2AMCB 3OTOL 4B3ML 2JN4A 3MWYW 2UXBQ 3T53B 1VF7A 1H9SB 2XNAC 4MZ9A 3GTPH 4K5VA 2VW9A 1Q81C 3CF5A 3VA5A 4A3CH 1AN8A 3KJPA 1N33L 1EYDA 2UUAQ 2B2YA 3MTSA 3BS1A 2EQSA 3HOWG 1PHJA 2JA8B 1HUNA 1YZ6A 4LFBL 2F3VA 1WYDA 2F4IA 1X3FA 4K6DA 3S17B 4LF8L 2B2VC 2R92B 5C44H 2ZTDA 1JQYD 1V8QA 3OYYA 4RFBA 3I90A 1XPOA 1CK1A 2E5LQ 3OMCA 1PH5A 1S5FD 1X55A 1LTAD 2A68C 4WFN3 1EYGA 3S14B 1E2WA 2X6GA 3HKSA 4UDUC 4K8IA 3SK5A 2L5TA 3SGIA 1SYCA 2VS1A 2AWOA 3H0GH 2B29A 3PV0A 3PO3B 2HQLA 1NAPA 3UDGA 3HEJA 3VYSA 4A3DG 2JA7B 3DWPA 3G48A 1EY8A 3J7AF 3M7GA 3OW7A 4U68A 4NDXA 1PH3A 5T1GA 1XX8A 1ILPA 3GTGB 2DY8A 3OMGA 4DV6Q 1PH1A 4TSSA 2PYKA 5E1FA 3K5NA 2JA5G 4G7OC 2FHTA 1SNCA 3VYUA 3CCEA 4HTHA 3NSWA 4WRDA 2E74C 5IP9G 1YNND 4M8AA 1LACA 3OPOA 1GUTA 1WD1A 2UXBL 2H5XA 1Y1VG 2CWPA 4OO1G 1MGSA 1HRJA 1WTVA 3DUZA 5H1SE 4NXMQ 2JQOA 1PZKD 1O78A 5COYA 1CHPD 4QQBX 1R4QB 5FJ8H 2AWNA 4UP7A 2UUAL 2Y0SE 3VR5A 1VQCA 3F2UA 1PRTF 1XNRQ 5DM63 4TKOB 2Z6BA 2B63H 3PO2H 1ZYRD 4JI0Q 2PCFB 4G7HC 3CCMA 4MTNA 1WTXA 1HTLD 4R8IA 1I4GA 1PH6A 4BY1B 1GHJA 3HOZH 4KHPQ 2VQFQ 1F77A 4GOPB 1ENCA 1SYEA 3QR8A 1PYBA 4ZAIA 4FF1A 1LTLA 2BH8A 5KYIA 2E5LL 4JBMA 4PQXA 1R4PB 1MD2D 4FXGC 4B3SQ 1C0AA 5FO8B 3SE0A 2WACA 1ENAA 4C1NK 2K52A 1DYQA 1VQBA 3T13A 3E6ZX 3NUCA 1H95A 4KHVA 2XVSA 2BOSA 3K0XA 3FHWA 4O0AA 2O2LD 3K59A 1Z47A 4KY5A 1RL2A 1WTPA 4KK7A 1TIID 4A3BB 2QEJC 1EFWA 4K2LA 2KOLA 1U9RA 3CAMA 2JA8G 4DV6L 2LXJA 2PI2A 1K0RA 2E2DC 4UHVA 4J6HA 3KDFB 1Q7YC 3VA7A 1EIYB 2HT1A 1S4ZA 4JI4Q 1VF5C 1QVCA 1PFBA 2OCEA 1IL8A 5KGUA 4A3JH 4L63B 1J5EQ 4B08A 3I7FA 3GP7A 2YV5A 5KIXA 5M5XB 5T1IA 2RA4A 3H15A 1QUQB 4DV4Q 3D6WA 4NXML 1WTQA 4JI2Q 4IURA 4GN4B 3I4MG 3DM1A 1K28A 1LUZA 4RKBA 4AYBE 1HZ9A 4JC0A 2F0WA 2HCIA 3PO3G 1XNRL 3NQIA 3U58A 5CV7A 3W1GA 2JA7G 2OEOA 4JI0L 3PF5A 3PIPA 2NVQH 3RN5A 1SNQA 1G2TA 3J80c 4C3HG 3J81E 3CCRA 4RHSA 1DD2A 4APVA 1YI2A 1TY2A 4KHPL 2VQFL 5E4WC 1K3BC 4LFAQ 2N88A 2PNRC 3S2DH 1VQKA 1R9TB 3B6YA 5DNFA 1NBWA 3VR4A 2NN6G 4XQNA 3PUXA 1S72A 4B3SL 2K03A 5M5WH 1CI3M 1TWFH 4X64Q 1SFOB 5G3LD 4CBVA 4KI0A 1IKLA 3K5MA 2K75A 3GDEA 2Z8LA 5IWAQ 1IBMQ 3CHBD 4K6LA 4RAUC 3PIO3 3IFDA 1U4LA 1ILQA 3I4NG 1WI5A 2DUDA 5IY0A 3F2DA 1BBUA 2GVAA 1IXRA 3J7ZC 1YNXA 2F0NA 5M9OA 3SR1A 3A5ZB 2LS01 2Q2IA 4IOAA 3CRKC 1ASZA 1SYGA 4FXKC 3GTJH 2EYHA 5C0XI 2F0HA 3EN2A 1PTOF 4BY1G 2CVRA 3BYTB 4JI4L 4GNXA 1H9KA 1Y1WH 1J5EL 2E2JB 2NB0A 1DXMA 3K5OA 3EJIA 2JA5H 2RKSA 2PMZB 4IPCA 4A3LH 1HZBA 1MSGA 2FMMA 3CW2C 4DV4L 4PV1C 4JI2L 2K04A 4IFDG 2MJ8A 2AQ1B 1SNDA 2EIFA 1Y8PB 1SROA 1LYLA 5IYBG 2F1MA 4X3KA 1HR0Q 4L6TB 2RVLA 3ICEA 1YHAA 1I6VC 4KY7A 3TDQA 5BN5A 5LL6S 5C4JH 1K0SA 4ZKBB 3S1NH 3E9HA 4RGTA 4A3BG 4QMGA 1IW7D 1KXLA 4LFAL 2F0IA 4BBRB 2I5MX 4GOPC 2KEDA 4ZUJA 1AP0A 1Q46A 2MPMA 1SNMA 5GAEC 4DR7Q 4X64L 5FLMG 2B2WA 2L11A 3LWEA 5IWAL 1IBML 5NUCA 1JCKB 3DHQA 3KF6B
chains in the Genus database with same CATH topology
3LNNA 1K8MA 5C0XH 2WIIB 4C3IG 4ODGA 5IT9L 1NUCA 5D14A 2EPBA 1I6HB 5BN4A 1SEBD 5J22A 1JOKA 5EKIA 1PLFA 1SDFA 4EVOA 4A3MB 3GV3A 4LJZC 1S5DD 2OXPA 1SXTA 4M1UB 2F0GA 4MIUA 5DEHA 4FXDA 1C4QA 5CV9A 3IL8A 1B4OA 2K5WA 4MHEA 2NUCA 1CT1D 1QJOA 4K5XA 5C0XJ 2H1EA 3D4WA 1EY5A 4RGNA 4CJ0B 4A93B 4ZLTF 1JC7A 1U4PA 4DN4M 5DAUA 4ILWA 3K57A 5C44B 1SYBA 4RKLA 2IJ0A 1STHA 3OSOA 5IGDA 2F0DA 1II3A 2K6AA 1E2VA 4FVMA 1S5BD 2KUMA 3LX0A 3H0GB 3Q24A 2FFKB 4ABNA 2XN9C 3D6CA 3EVQA 3SK4A 2Z1CA 1Z7TA 3X3NA 3C1FA 3MXNA 1X3QA 3NWSA 2E76C 1SJED 1EY6A 3IAYA 3KUPA 4RCNA 1SAPA 1BXTA 2G9HD 1SJHD 2D5DA 1IHZA 2Y0SB 5D65A 1CFMA 3KLRA 1TY0A 2A69D 5I9OA 5J1ZA 3NTKA 4G4KA 2HUGA 1RHPA 2B63B 3PO2B 4ZRZA 1HA5A 3HOZB 2R6GA 4QUCA 5LHY1 5IGGA 1I4HA 1OO9B 1PTOH 3Q0AA 3KBGA 5CV6A 2F0OA 4DAVA 2N55A 3NTIA 4K14A 1QG7A 4DFAA 3VYRA 1FR3A 3K6OA 3VR2A 3WOFA 4RGOS 3T16A 1A3VA 3J80E 2EY6A 3DXJC 4AYBB 4N9PA 1I4XA 2VXWA 4WORA 3AMUA 5EGTA 3I91A 3BDCA 2F0FA 2VB3X 2K1BA 1SE2A 2E75C 2SOBA 1Q3LA 5LL6X 2O5IC 4DGZA 3FDTA 1TWGB 1ESFA 4NP5A 3TP7A 2F0SA 1LT6D 1V1PB 2M00A 2YYZA 2NVQB 2RQXA 3HZXA 3R3OA 2EY5A 1SSOA 4ULLA 2A68D 2ZT9C 3S2DB 2R61A 2PW5A 2CQAA 5C4HA 5CBAE 4CKEA 1BBXC 1TVXA 2F0MA 1OXXK 5CBEE 1WVLA 1OXTA 1B44D 3MFYA 1J8IA 1HHVA 1KLUD 2GA4B 1I4RA 1FNVA 3PIP3 1ONLA 1PXUA 4HCEA 1GUSA 4IUPA 4XQQA 1B50A 3C1EA 3NBHA 1Q1EA 3TP8A 5ELEA 3RLFA 5C4JB 4NMZA 3S1NB 1C48A 2DN8A 3SK6A 4I65A 1LT3D 3J7AV 1F9RA 5EPKA 5IGCA 4LK1C 1JE4A 3OIQA 4KJOA 2A73B 1Q90A 3L7ZC 2Z4HA 2KEEA 4X3UA 4KKSA 3RUZA 4Y7NB 3BVGA 3QOJA 2EYLA 1BNZA 2F3WA 1PRTB 3HKZB 1EYCA 1A2TA 5EBCA 2L4NA 3NQTA 4A3IB 1AFPA 2I46A 3UI2A 2BA1A 1LTBD 3I8ZA 1M4VA 4RWSC 3TP5A 1HFGA 3VR3A 5FO7B 4FF4A 2XRSD 3TZUA 2MGSA 2ZXPA 1GHKA 1IYUA 5C5LA 2JA6B 1DM0B 3V96A 5JOBA 5JVG3 1TS4A 2F0KA 2NVTB 1PRTD 2WKCA 4KKUA 1KNEA 1BR9A 2HCCA 1T5XD 4DK0A 1OXSC 3A7AB 2AUKA 3S16B 3CQZB 1DJRD 5I6WA 1TR5A 2JE6I 3H6MA 1D1KA 1HQMC 2EE1A 4XTCS 1DOKA 1EL0A 1YNJD 3R2TA 4P2CB 3GTLB 2L12A 1CTMA 3BYYB 4DF7A 2E2IB 5EKLA 1VMCA 4Q0FA 4R8NA 2KCNA 1B1ZA 3AU7A 1QCBD 4A3EB 1U4RA 2BE5C 4CKCA 4CGYB 4LMQD 4BY7B 2M9VA 4C56C 1SBBB 5KNDA 3FPPA 1TKWB 1A3TA 1JB3A 2Z4IA 1TS5A 2WAQB 1DONA 2SNSA 3NP8A 1G291 5CV4A 2LFNA 3SDZA 5HGTA 4OHJA 4BS9A 2SEBD 2JEAI 2LY7A 5I4DA 2EJMA 2PW7A 1BOSA 1MSHA 3HG9A 3I72A 3PMFA 3NTHA 1Q1BA 1RD9D 1BCPF 4HSPA 2R7ZB 1Q12A 5C4XB 4FF2A 3BVZA 1STYA 4DAYA 3J7YW 5HURA 1WTRA 2L0CA 4A3FB 3PUYA 4OO1I 1G2SA 3NXWA 5TSSA 5JPMC 1PRTC 2RDGA 4V190 4U673 1O7YA 4QIWB 1W6KA 2EY1A 4PMCA 1H9SA 1EY9A 1GUNA 4QF4A 2NYZD 4BA1I 4JK1C 1KDCA 1WCMB 1AZPA 2OF1A 3EA6A 3MZ5A 4RH6A 5C5MA 2A6HD 1I50B 2O4XA 2XWBB 3P1HA 3T56B 1YNJC 1SE3A 2R93B 3J81L 1D1IA 3A8KE 3VYTA 1IYVA 4RCOA 1G8ZD 2D2CC 3P20A 1S5ED 4DXGA 1CM9A 4EQPA 5G3LF 3NK9A 3EFXD 4OO1H 1JORA 3S2HB 4J1MA 2Q8RE 4ZYSA 4O1NA 2MHVA 4DNRB 1O80A 3BDLA 4G57A 2FMCA 2Q8IB 2KJXA 5C3EB 3C46A 4NW2A 1NCVA 4IALA 5I9PA 2B2WC 2K05A 5AFWA 4EQNA 2VNUD 5E4XA 2X6LA 5A2QE 1EY4A 3Q23A 1KDAA 5CV5A 3N6RA 3KBXA 3O13A 2PZTA 3MXPA 1TQOA 3FRPB 5CV8A 2IPKD 4ME5A 2WV6D 2C5CA 2NN6I 3OWEB 2QCPX 2L1BA 2NTTA 2HQEA 4IUUA 2ZXOA 4CJ2C 4FF3A 2PZUA 1RF2D 2K01A 1LTTD 1TWHB 5CMDA 1KTKA 4PMWA 2KCCA 4EQOA 2PQEA 3HP3A 3R2IA 3GTPB 4YIJA 2B2UC 3URYA 3SHLA 3I4LA 5FLXE 5EJWA 3NHHA 1PDQA 1STGA 5JAVA 1IKMA 1LT4D 3P7JA 2QDBA 4PMBA 5CYUA 2ID0A 4HSVA 2A6HC 3R93A 1XWEA 2NVYB 1EYAA 1EY7A 4C1NI 3L3OC 3JAME 1XXGA 2IT1A 2F0PA 4IFDI 4K2KA 4QB4A 4OIKA 5JEAG 2K5QA 2EYMA 2NN6H 1F9QA 4XXEA 4ID6A 2A74C 3P75A 3TP6A 5K36G 2AQ3B 2HDLA 3KLSX 3TZDA 4XIGS 4EGVA 2OT2A 5KNBA 1LTSD 3GV6A 1CHQD 2DNEA 5IGFA 1EEFD 2KA7A 3PUVA 1Y69U 2ZXRA 2F0LA 2JEBI 3CRLC 3A54A 3JAML 3WDNA 2EVBA 1EEID 2XIWA 1Z6HA 3W3AA 2RSOA 1JOOA 1F2ZA 2EXZA 4IFDH 3E5SA 1DOLA 4HR7B 2B2TC 2O5JC 4E6IA 1GOZA 2IX1A 2MUYA 5EPJA 4CHTB 1GUWA 1NSNS 2IX3A 1LTRD 1FD7D 3GQBA 2F0VA 3ERQA 1LV9A 3QO2A 3U9SA 1EFID 2Q8TA 1H9MA 3TN2A 2EJFC 3BZDB 5ELCA 4RHRA 1E0BA 4IFDJ 1D5ZC 1SYFA 1B3AA 5C3XA 2WINB 1EIHA 3M7NA 4A3JB 5EKKA 1ZKOA 1B9NA 1I4PA 1D6EC 3G6JB 3SVMA 2IX0A 1F9PA 2J4XA 1STAA 3WOEA 1TWAB 1STBA 3QIAA 2EYFA 2QKIC 2DY7A 1W6JA 3HOWB 4R9WA 5FO9B 4J8QA 1FNUA 4DNTB 2EYPA 5M5WB 1KDBA 3Q22A 1TWFB 3KK7A 1JWUD 5J39A 2RDHA 3J80L 3NBIA 4H13C 5D3IB 5FK9C 2FINB 1UAPA 3OHXC 1U4MA 2JYOA 2BDOA 2XWJB 3A8JE 5ELBA 3NE5B 4G7ZC 3GTJB 2F0JA 1QNKA 1L0XB 5KNCA 2B39A 1M8AA 3SXHA 1CA5A 1Y1WB 2JA5B 4PNYA 3MEHA 3H91A 1V43A 4Q5VA 1RODA 1SNOA 3OWFA 1UEAB 5FKAC 3OOCA 2EYOA 2KQ3A 3FMCA 5KEEA 4ZKCB 4X3TA 1EZ8A 2QILA 4MN3A 1JWSD 1TU2B 5D3DA 4KHZA 1PZID 3QWNA 2B2YC 2V4DA 2BE5D 2B8GA 3RD4A 3I3CA 2JSOA 3KLSA 1KABA 1EWHA 5IOCA 3MHBA 5ELDA 1MI2A 1HFNA 4K5WA 4NKLA 1B53A 5EQ0A 2AUJD 4N9TA 1A6XA 1BF4A 2H4OA 1DOMA 5CORA 1RDPD 3PUWA 4FP5D 1ZXTA 1HUMA 2B8FA 1K8OA 3TBIB 2VB2X 1OXUA 1FGBD 1DCZA 1OXVA 3HRZC 5IGBA 1ET9A 3T4AC 3GD7A 2EJGC 3HOYB 4C3JB 5EPLA 4F87A 1LLRD 2B2VA 1GUGA 1STNA 1PFMA 3I4MB 1CA6A 4XT3B 3GO5A 5M3MB 3IKJA 3QB3A 1TT2A 1ML0D 5IODA 4XDXA 4C3HB 1HQRD 5E3FA 2PZWA 4FNFA 2CW0C 3X3MA 4F8MA 2SDFA 3S1MB 3FKIB 4HAEA 2KVMA 2LKVA 4C2MB 3A56A 3FPUB 3CU7A 4BA2I 2EYJA 3C2PA 1V1PA 3S1QB 1SYDA 1BCPB 1F2YA 3I4NB 2XSCA 1QNUA 3MXGA 2JXMB 2WB1B 4H44C 3CKIB 4JBWA 3QG1A 1EZ6A 2D62A 1PZJD 3EROA 3BG3A 2K7VA 3K5LA 1KNAA 3V05A 3A55A 4IQZA 3S1RB 4I7ZC 2NZ1D 1AEXA 4OIJA 5C0XG 3U9OA 5JJZA 2D9UA 1PMRA 2NBFA 1T5EA 3K58A 1BCPD 2AQ2B 2RSNA 3E0JA 3SK8A 1CQVA 4RGMA 1ENFA 4IUNA 2F0UA 2K32A 2BCOA 1PTOB 3DEOA 3ND9A 3T51B 1X3PA 2WP8J 2IW3A 4QUFA 1TWCB 3K0YA 4QCLA 2EDGA 1FNWA 1RTOA 2RDFA 1VDZA 3A8IE 1V1OA 1BUVT 4C3JG 4DK1A 3SEBA 1HA6A 4HMJA 3HOUB 3R8BA 4C3IB 4XT1B 4UAIA 1S5CD 1XTCD 4FYDA 2BDNA 3I70A 2PPBC 1HXYD 1C8CA 1PTOD 4Z9CB 4KTAA 1WTOA 5CR3A 2RBMA 3BDOA 5ISRA 4B9WA 1A2UA 2A6ED 1F2MA 5JVH3 3D4DA 1LTID 2F03A 3H09A 3NWTA 3GTKB 3HGBA 4HMIA 1YNNC 3ONAB 2X69A 1ICWA 3GTOB 3ZYYX 1AZQA 2K5DA 1H9JA 2E2HB 2SNMA 1SE4A 1LO5D 4KY6A 1QILA 3AB9A 4GZYC 3DWAA 4S3SA 1B9MA 1ESRA 1ZYRC 4KJNA 3I73A 5EBDA 5F2DA 3RZOB 4V0BA 5A35A 4O42A 4OL7A 5IT9E 1BQQT 2R3ZA 3S9WA 1BCPC 3D31A 5C3WA 1X32A 2HDMA 3MC0B 2F0QA 1D5MC 1JWMD 1Y8NB 1GUOA 2VUMB 1NR4A 3H3VC 2ICIA 5M3FB 3M4YA 1MBYA 1D5XC 3OIPA 3BVMA 2ENBA 1GXDC 4KMUC 1TS3A 1SMYD 5FOBB 4XYOA 3VR6A 2NWGA 3FVQA 4H0LC 5JPNC 4HEDA 3KF8A 5ELFA 3HS0C 1PTOC 4IUTA 2PO4A 4LAAA 3M85A 4OGQC 1LT5D 5A2QL 1VMPA 4KN4C 2A6EC 5KYLA 3HOXB 2K28A 3IFTA 3DMUA 5KRUA 1TS2A 3K7AB 3Q6SA 4XYQA 1RCVD 1K83B 2JP1A 2BA0A 2B2UA 4L8JA 3ND8A 3D4RA 4BWGB 5IGEA 4BBSB 1A3UA 2J7ZA 2C9OA 2J0TD 1WD0A 5IIFA 2IWHA 2EOTA 5FLXL 3ITPA 4IN3A 4IZ8A 2NVXB 2CHBD 2WKDA 2NTSA 2EY2A 1RJTA 5BN3A 1EU4A 1RTNA 3M4OB 2FJ2A 4WJWA 4F88A 2KECA 3RMHA 3N52A 1IW7C 1O7ZA 2K33A 2I07B 4FO2A 3V2TA 2L9HA 1JICA 2EZVA 1AW7A 4K8JA 1KAAA 2IL8A 3EQLC 4KV6A 1O7LA 1F2LA 3GTMB 1EQTA 1LTGD 1SMYC 3L9AX 3D8GA 1JR0D 4CKBA 4IUVA 2TSSA 2M2LA 3FEWX 1B2TA 4B9XA 1E2ZA 1I3QB 3NPPA 4HN7A 3QJYA 4A3KB 1I4QA 1QOHA 3G7LA 4TRDA 2F0EA 1VCIA 4F7XA 1JOQA 2B2TA 1UUPA 3MVVA 1G91A 4RA8A 4KD3A 4H7BA 2QF7A 2A5HA 4DAPA 1RKNA 3D3RA 2ICEC 3MA2B 1LABA 1CQFA 1HTPA 1H9RA 1EQVA 1CZWA 1PYWD 1EOTA 3DEPA 1HCZA 1HPCA 1KLGD 2F0TA 1EY0A 5I2YA 4XQJA 3M3YB 4HCSA 1G6ZA 1J9OA 3MAQA 4CJ1B 3PUZA 2YU9B 2KHSA 3LWUA 3W2DA 2DNCA 2L55A 1WTWA 4X3SA 3HOVB 5K5PA 1UNSA 4KD4A 1F9SA 3DWQA 1Y8OB 1D2BA 1DZ1A 2LMCB 1EU3A 5JEAH 5C6AA 3QOLA 3GTQB 5M5YB 4A3DB 2XRQD 5K36H 1L0YB 5DM73 2A69C 2CW0D 3H94A 1QB5D 1PFNA 4IUQA 1STEA 4KKTA 5CGKA 1BDOA 1ZEQX 1BO0A 4A3GB 1A15A 4ZQ3A 2MP1A 1Y1VB 3MXUA 4ZUIA 3TMEA 3TSSA 5JEAJ 5CC4A 2G9DA 1EIGA 3MFGA 1CZGA 1GJXA 1XYIA 4DXFA 1ET6A 5C4ZA 1NR2A 1QE6A 3A7LA 3S15B 4TQUS 1FYCA 4DU9A 1QWYA 4DA2A 4ZK9B 1SNPA 1Q8IA 1EWCA 5I6YA 4KN7C 3C3LA 3RZDB 2TMPA 5I2XA 3MWYW 3T53B 1VF7A 1H9SB 2XNAC 4K5VA 3VA5A 1AN8A 1EYDA 2B2YA 3MTSA 3BS1A 2JA8B 1HUNA 2F3VA 2F4IA 4K6DA 3S17B 2B2VC 2R92B 1JQYD 1V8QA 4RFBA 3I90A 1CK1A 3OMCA 1S5FD 1LTAD 2A68C 4WFN3 3S14B 1E2WA 2X6GA 4UDUC 4K8IA 3SK5A 2L5TA 1SYCA 2AWOA 3PV0A 3PO3B 1NAPA 3HEJA 3VYSA 2JA7B 3DWPA 1EY8A 3J7AF 3M7GA 3OW7A 4U68A 4NDXA 5T1GA 1XX8A 1ILPA 3GTGB 2DY8A 3OMGA 4TSSA 2PYKA 5E1FA 3K5NA 4G7OC 2FHTA 1SNCA 3VYUA 4HTHA 3NSWA 4WRDA 2E74C 1YNND 4M8AA 1LACA 3OPOA 1GUTA 1WD1A 4OO1G 1MGSA 1HRJA 1WTVA 3DUZA 1PZKD 1O78A 5COYA 1CHPD 1R4QB 2AWNA 3VR5A 3F2UA 1PRTF 5DM63 4TKOB 1ZYRD 2PCFB 4G7HC 1WTXA 1HTLD 4R8IA 1I4GA 4BY1B 1GHJA 1F77A 1ENCA 1SYEA 4ZAIA 4FF1A 5KYIA 4PQXA 1R4PB 1MD2D 4FXGC 5FO8B 3SE0A 2WACA 1ENAA 4C1NK 1DYQA 3T13A 3E6ZX 3NUCA 4KHVA 2XVSA 2BOSA 2O2LD 3K59A 1Z47A 4KY5A 1WTPA 4KK7A 1TIID 4A3BB 2QEJC 4K2LA 2KOLA 1U9RA 2E2DC 4J6HA 3VA7A 1S4ZA 1VF5C 1PFBA 1IL8A 5KGUA 4L63B 4B08A 3GP7A 5KIXA 5M5XB 5T1IA 2RA4A 3D6WA 1WTQA 4IURA 3DM1A 4RKBA 2F0WA 2HCIA 3NQIA 5CV7A 2OEOA 1SNQA 1G2TA 4C3HG 3J81E 4RHSA 1DD2A 1TY2A 5E4WC 2N88A 2PNRC 1R9TB 5DNFA 3VR4A 2NN6G 4XQNA 3PUXA 2K03A 1CI3M 1SFOB 5G3LD 4CBVA 4KI0A 1IKLA 3K5MA 2Z8LA 3CHBD 4K6LA 4RAUC 3PIO3 3IFDA 1U4LA 1ILQA 2F0NA 5M9OA 3SR1A 2LS01 3CRKC 1SYGA 4FXKC 2EYHA 5C0XI 2F0HA 1PTOF 2CVRA 3BYTB 1H9KA 2E2JB 2NB0A 1DXMA 3K5OA 3EJIA 2RKSA 2PMZB 1MSGA 2FMMA 4PV1C 2K04A 4IFDG 2MJ8A 2AQ1B 1SNDA 1Y8PB 2F1MA 4X3KA 4L6TB 2RVLA 1I6VC 4KY7A 3TDQA 5BN5A 5LL6S 4ZKBB 4RGTA 4QMGA 1IW7D 2F0IA 4BBRB 2KEDA 4ZUJA 1AP0A 2MPMA 1SNMA 2B2WA 2L11A 3LWEA 5NUCA 1JCKB 3DHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I G;  4C3J G;  4C3H G; 
#chains in the Genus database with same CATH topology
 3LNN A;  4UP8 A;  1K8M A;  4DV3 Q;  5C0X H;  2WII B;  4C3I G;  4ODG A;  5IT9 L;  5E7N A;  1NUC A;  5D14 A;  2EPB A;  1I6H B;  5BN4 A;  3PCO B;  1SEB D;  5J22 A;  1JOK A;  2CKZ B;  5EKI A;  1PLF A;  4A4I A;  1SDF A;  4EVO A;  4A3M B;  4DR6 Q;  3GV3 A;  4LJZ C;  1S5D D;  2OXP A;  4P71 A;  1SXT A;  4M1U B;  2F0G A;  4MIU A;  5DEH A;  4JI1 Q;  4FXD A;  3HKZ E;  1C4Q A;  2Q2H A;  5CV9 A;  1L1O A;  3IL8 A;  1B4O A;  1PH2 A;  2K5W A;  4MHE A;  3HOY H;  2NUC A;  4DV7 Q;  1YVC A;  1CT1 D;  1QJO A;  4K5X A;  4C3J H;  5C0X J;  2MFI A;  2H1E A;  3D4W A;  1YBY A;  5IYC G;  1EY5 A;  4RGN A;  4CJ0 B;  1HR0 L;  4A93 B;  4IOC A;  4ZLT F;  1JC7 A;  1U4P A;  1X9N A;  3KLW A;  4N8X 1;  4DN4 M;  4JG2 A;  5DAU A;  2QEX A;  4ILW A;  3K57 A;  1SRU A;  5M3M H;  4HJ8 A;  4NXN Q;  5C44 B;  1SYB A;  4RKL A;  2JK8 A;  2IJ0 A;  3WWV A;  1M1K C;  1STH A;  3OSO A;  5IGD A;  4DR7 L;  2F0D A;  4LNQ A;  3S1M H;  1II3 A;  2K6A A;  3FKI H;  1E2V A;  4X6A H;  4FVM A;  1S5B D;  2KUM A;  4DV3 L;  1X3G A;  3LX0 A;  3H0G B;  4C2M H;  3Q24 A;  1JJ2 A;  2FFK B;  4ABN A;  2B3G A;  2XN9 C;  3D6C A;  3EVQ A;  3SK4 A;  2Z1C A;  1Z7T A;  3X3N A;  4TVA B;  3C1F A;  3MXN A;  1X3Q A;  3NWS A;  4DR6 L;  2IHE A;  1MJE A;  2I5L X;  2E76 C;  5HY6 A;  1SJE D;  1EY6 A;  3IAY A;  3KUP A;  4JI1 L;  4POF A;  3E3X A;  4RCN A;  1BXT A;  1PYS B;  1SAP A;  3EBE A;  2G9H D;  1SJH D;  2D5D A;  1IHZ A;  2Y0S B;  5D65 A;  1A62 A;  1E1T A;  4DV7 L;  1CFM A;  3KLR A;  1TY0 A;  2A69 D;  5J1Z A;  5I9O A;  3NTK A;  1YJW A;  1MIU A;  4G4K A;  1D8L A;  2HUG A;  3MEF A;  1RHP A;  3AQQ A;  2B63 B;  3TS0 A;  3PO2 B;  1VQ7 A;  4ZRZ A;  3CXC A;  4DR4 Q;  1HA5 A;  4NXN L;  3HOZ B;  2R6G A;  4YY3 Q;  4QUC A;  4A3M G;  5LHY 1;  5IGG A;  1QZG A;  4GN5 A;  2CFM A;  2WAQ E;  1I4H A;  1OO9 B;  1PTO H;  3Q0A A;  3KBG A;  4UP9 A;  5CV6 A;  1K8A C;  2D0O A;  2F0O A;  1TWC H;  4H02 A;  4DAV A;  2N55 A;  2R7Z H;  1DGS A;  4OEL B;  1QZH A;  3NTI A;  4HJ5 A;  4K14 A;  2CH4 A;  1NJI C;  1QG7 A;  4DFA A;  3VYR A;  5ELN A;  4A93 G;  1FR3 A;  1GKH A;  3HOU H;  3ERS X;  1GD7 A;  3K6O A;  3VR2 A;  2ZM6 Q;  2Z9H A;  3L0O A;  3WOF A;  4RGO S;  3T16 A;  1A3V A;  2K4K A;  3J80 E;  2EY6 A;  1BBW A;  1Q82 C;  3DXJ C;  4AYB B;  2N78 A;  1I4X A;  2VXW A;  4N9P A;  1WCM H;  4QIW E;  4WOR A;  2RHS B;  3AMU A;  5EGT A;  3I91 A;  3BDC A;  2F0F A;  4B3T Q;  2VB3 X;  2K1B A;  1SE2 A;  2E75 C;  2SOB A;  1Q3L A;  5LL6 X;  2O5I C;  1A0I A;  4DGZ A;  3FDT A;  1TWG B;  1ESF A;  4JV5 Q;  4NP5 A;  3J81 i;  1JJG A;  3TP7 A;  2F0S A;  1LT6 D;  1V1P B;  2M00 A;  2ZJQ A;  2YYZ A;  4MNO A;  1A8V A;  3GTO H;  2RQX A;  1HNZ Q;  2NVQ B;  3HZX A;  3R3O A;  2EY5 A;  4DR4 L;  1SSO A;  4IJL A;  4ULL A;  3CC7 A;  2R93 H;  2UXC Q;  1JE5 A;  4YY3 L;  2A68 D;  3EIV A;  2ZT9 C;  2E2H H;  1U0L A;  3S2D B;  4OWW B;  2R61 A;  1N9W A;  2PW5 A;  3RZO H;  4POG A;  2CQA A;  5C4H A;  1B8A A;  5CBA E;  4CKE A;  1BBX C;  1TVX A;  2F0M A;  1OXX K;  5CBE E;  1WVL A;  1OXT A;  4JI8 Q;  5C3E H;  2OQK A;  1B44 D;  3MFY A;  1BKB A;  1J8I A;  1HHV A;  2ZM6 L;  4DV5 Q;  1KLU D;  2GA4 B;  2CCZ A;  1I4R A;  1FNV A;  3CCL A;  3PIP 3;  1ONL A;  2VUM H;  3RR5 A;  1VQE A;  1PXU A;  1MKH A;  4HCE A;  4B3T L;  1GUS A;  5M3F H;  4IUP A;  1UE7 A;  4XQQ A;  5GAD C;  1HZC A;  1B50 A;  4JV5 L;  3C1E A;  3NBH A;  4LUZ A;  4L5Q A;  1Q1E A;  3TP8 A;  5ELE A;  1HNZ L;  3RLF A;  5C4J B;  4CDC C;  4NMZ A;  3S1N B;  2UXC L;  1TWH H;  3CC2 A;  1C48 A;  1PH7 A;  4ME3 A;  1WFQ A;  2PQA B;  2DN8 A;  3SK6 A;  4I65 A;  1LT3 D;  2RHQ B;  3J7A V;  1JJC B;  5IE8 A;  3DLL A;  4HID A;  1F9R A;  5EPK A;  5IGC A;  4AYB G;  4LK1 C;  1KIX A;  1JE4 A;  3OIQ A;  4KJO A;  1HNX Q;  2A73 B;  1Q90 A;  3L7Z C;  2Z4H A;  3HOX H;  2KEE A;  4GN3 B;  4KKS A;  4X3U A;  1B3Q A;  4JI8 L;  3RUZ A;  4Y7N B;  3BVG A;  3HOV G;  1GVP A;  3QOJ A;  2EYL A;  5GAH C;  2NVY H;  1BNZ A;  2F3W A;  3K7A H;  1PRT B;  3HKZ B;  1EYC A;  4DV5 L;  1A2T A;  2VZA A;  2L4N A;  5EBC A;  3RLN A;  3NQT A;  4A3I B;  1AFP A;  2RCN A;  1K83 H;  3KFU A;  4P72 A;  4LF5 Q;  5IYD H;  2I46 A;  3UI2 A;  2BA1 A;  1LTB D;  4R4T A;  4L5S A;  4BBS H;  3I8Z A;  1M4V A;  4RWS C;  4AH6 A;  3TP5 A;  1HFG A;  4A76 A;  3VR3 A;  5FO7 B;  4FF4 A;  3CME A;  2XRS D;  3TZU A;  2MGS A;  2ZXP A;  5J3B A;  1GHK A;  1IYU A;  3JAM c;  5C5L A;  2JA6 B;  1DM0 B;  3V96 A;  5JOB A;  5JVG 3;  1TS4 A;  3T1Y Q;  2F0K A;  2NVT B;  1PRT D;  2WKC A;  1NMG A;  4A3G G;  1AE2 A;  4KKU A;  2CWA A;  3JAM i;  1KNE A;  1BR9 A;  2HCC A;  4UY8 C;  2PNH A;  4P75 A;  4DV2 Q;  1T5X D;  1VQP A;  4LW1 A;  4DK0 A;  1OXS C;  3A7A B;  2AUK A;  3S16 B;  4IPH A;  3CQZ B;  1DJR D;  1HNX L;  5I6W A;  1TR5 A;  2VY3 A;  2D0P A;  2JE6 I;  1Q8K A;  3H6M A;  1D1K A;  4X62 Q;  1HQM C;  2KCM A;  2EE1 A;  4XTC S;  1DOK A;  2DJF C;  1EL0 A;  3GTM H;  1YNJ D;  3R2T A;  4P2C B;  2UXD Q;  3GTL B;  2L12 A;  3HFZ B;  1CTM A;  3BYY B;  3S24 A;  3F1Z A;  4DF7 A;  2E2I B;  1UE5 A;  5EKL A;  4LF5 L;  1VMC A;  1V9P A;  4Q0F A;  4R8N A;  4JBJ A;  3KF8 B;  2KCN A;  1B1Z A;  3AU7 A;  1QCB D;  4A3E B;  3G71 A;  1U4R A;  2BE5 C;  4DR5 Q;  4CKC A;  4A3K H;  4CGY B;  1TXY A;  1PH9 A;  4LMQ D;  2ES2 A;  4BY7 B;  2K5V A;  2M9V A;  4LF7 Q;  4C56 C;  1SBB B;  1WJJ A;  2ZTE A;  4ALP A;  5KND A;  3FPP A;  1VQN A;  1TKW B;  1A3T A;  1JB3 A;  2Z4I A;  4YCW A;  3T1Y L;  1TS5 A;  1CKM A;  2WAQ B;  1DON A;  2SNS A;  3NP8 A;  1G29 1;  2R92 G;  5CV4 A;  2LFN A;  3SDZ A;  5HGT A;  4OHJ A;  4BS9 A;  2SEB D;  3NEN A;  2JEA I;  4RMF A;  4A3I G;  4DV2 L;  3DM3 A;  4QJF A;  2LSS A;  2LY7 A;  4LWC A;  5I4D A;  2EJM A;  2PW7 A;  1BOS A;  1MSH A;  3BU2 A;  3HG9 A;  3I72 A;  3PMF A;  3NTH A;  1Q1B A;  1RD9 D;  1BCP F;  1HH2 P;  3A0J A;  4HSP A;  3T1H Q;  2R7Z B;  1Q12 A;  1TWA H;  4X62 L;  4FF2 A;  5C4X B;  3M3Y H;  1SMX A;  3BVZ A;  1STY A;  1YEZ A;  4DAY A;  3J7Y W;  5HUR A;  1WTR A;  2UXD L;  2L0C A;  4A3F B;  2JA6 G;  2YU9 H;  3PUY A;  3HOW H;  4OO1 I;  1G2S A;  3NXW A;  5TSS A;  5JPM C;  1PRT C;  2RDG A;  4V19 0;  4U67 3;  1O7Y A;  4QIW B;  3J80 i;  2GN5 A;  1W6K A;  2EY1 A;  4PMC A;  1H9S A;  1B7Y B;  1EY9 A;  1IBK Q;  2ASB A;  1GUN A;  4QF4 A;  2NYZ D;  1E7Z A;  3CCS A;  4BA1 I;  2I5H A;  1KDC A;  1L2F A;  4JK1 C;  1WCM B;  4DR5 L;  3MXN B;  1AZP A;  2OF1 A;  5GRO A;  2UU9 Q;  3EA6 A;  3MZ5 A;  4RH6 A;  5C5M A;  4DK6 C;  4LF7 L;  4JOI A;  3RNU A;  3GTQ H;  2OWO A;  1YHQ A;  2YTV A;  1EWI A;  2A6H D;  1JB7 A;  1I50 B;  4GNX C;  2O4X A;  5M5Y H;  1E22 A;  2XWB B;  4A3D H;  4PZ8 A;  2FXQ A;  4YWM A;  3P1H A;  3T56 B;  4B3R Q;  1KL9 A;  1YNJ C;  1SE3 A;  3W1B A;  2R93 B;  3J81 L;  1D1I A;  3A8K E;  3VYT A;  1IYV A;  4RCO A;  1G8Z D;  2D2C C;  3P20 A;  1CUK A;  4A3G H;  5IP9 H;  1S5E D;  3E9I A;  4DXG A;  1CM9 A;  4EQP A;  4A3E G;  1X54 A;  5G3L F;  3NK9 A;  1Y1V H;  3EFX D;  2HD3 A;  4OO1 H;  1JOR A;  3S2H B;  4J1M A;  2PI2 E;  2Q8R E;  3K81 C;  4ZYS A;  3T1H L;  4EQ5 A;  1HJP A;  4BY7 G;  4O1N A;  2MHV A;  4DNR B;  1O80 A;  3BDL A;  4G57 A;  2FMC A;  4R1J A;  2KJX A;  2Q8I B;  3UDF A;  5C3E B;  3C46 A;  4NW2 A;  1NCV A;  4IAL A;  5I9P A;  2B2W C;  2K05 A;  1VQO A;  5AFW A;  2WAQ G;  4EQN A;  3S15 H;  2VNU D;  1UE1 A;  4DPG A;  1KQS A;  5E4X A;  3CP0 A;  1IBK L;  2X6L A;  5A2Q E;  1WTH A;  3UDI A;  1EY4 A;  3Q23 A;  1KDA A;  5CV5 A;  2UU9 L;  3N6R A;  4DUZ Q;  1NE3 A;  3KBX A;  1HR0 W;  3O13 A;  3IRB A;  2PZT A;  3MXP A;  4CDF C;  1TQO A;  3FRP B;  1IL2 A;  1S3O A;  4YCU A;  5CV8 A;  2IPK D;  4ME5 A;  2WV6 D;  5C4X G;  3KOJ A;  2GVB A;  2C5C A;  2NN6 I;  3OWE B;  3ULL A;  2QCP X;  2L1B A;  2NTT A;  2HQE A;  4IUU A;  4B3R L;  2ZXO A;  4CJ2 C;  3K80 C;  1L1O C;  4FF3 A;  2PZU A;  1RF2 D;  3J81 j;  4A3F G;  2K01 A;  1LTT D;  1TWH B;  2JA8 H;  5CMD A;  2UUB Q;  2QW7 A;  1YIT A;  1KTK A;  4PMW A;  2KCC A;  4EQO A;  2PQE A;  3L2P A;  3HP3 A;  1N32 Q;  2MO1 A;  4DUY Q;  3R2I A;  2R92 H;  3GTP B;  1FJG Q;  2MNA A;  5BR8 Q;  4YIJ A;  2B2U C;  3PF4 A;  4JI7 Q;  1Y14 B;  2KHJ A;  3URY A;  3SHL A;  3I4L A;  5FLX E;  5EJW A;  3NHH A;  1PDQ A;  1STG A;  5JAV A;  3RN2 A;  3JC6 6;  1IKM A;  1LT4 D;  3P7J A;  2NZO A;  3H3V I;  4P74 A;  1W2B A;  4LFC Q;  2QDB A;  4I7A A;  3I4M H;  4PMB A;  3PGZ A;  5CYU A;  2ID0 A;  4HSV A;  2K50 A;  2A6H C;  3PO3 H;  3R93 A;  1D7Q A;  1XWE A;  2NVY B;  1EYA A;  2JA7 H;  1EY7 A;  4C1N I;  1GM5 A;  4C3H H;  3L3O C;  3JAM E;  1N34 Q;  1XXG A;  2IT1 A;  3GTG H;  2F0P A;  5IP7 G;  4IFD I;  1QUQ A;  1PFS A;  4K2K A;  4QB4 A;  4OIK A;  1X65 A;  4GKJ Q;  5JEA G;  2K5Q A;  2EYM A;  2NN6 H;  1F9Q A;  4XXE A;  4ID6 A;  3TRZ A;  2A74 C;  4DUZ L;  3P75 A;  1CKN B;  3TP6 A;  4JI6 Q;  5K36 G;  2AQ3 B;  2N49 A;  2HDL A;  3S1Q H;  4JCV E;  3I4N H;  3KLS X;  3TZD A;  4XIG S;  4EGV A;  2OT2 A;  2QGQ A;  5KNB A;  4N8F A;  1WOC A;  2C35 B;  1LTS D;  3GV6 A;  1CHQ D;  2DNE A;  5IGF A;  1EEF D;  2KA7 A;  1PH8 A;  4BBR G;  3PUV A;  1Y69 U;  2UUB L;  2ZXR A;  2F0L A;  3AEV A;  2JEB I;  1SR3 A;  3H3V H;  1N32 L;  2WB1 E;  3CRL C;  4DUY L;  4BY1 H;  1FJG L;  5BR8 L;  1VS0 A;  3AYH B;  4JI7 L;  3A54 A;  4YHH Q;  2ATW A;  3JAM L;  3S1R H;  3WDN A;  2EVB A;  1EEI D;  2XIW A;  2VQE L;  1JMC A;  4DAM A;  4LFC L;  4BXX G;  1Z6H A;  3W3A A;  1CSQ A;  2RSO A;  4GLV B;  1JOO A;  4ZCK A;  1F2Z A;  2OQ0 A;  2EXZ A;  4IFD H;  3E5S A;  1DOL A;  5IYB H;  4HR7 B;  2Z0S A;  2B2T C;  1NNX A;  2O5J C;  3E0E A;  4E6I A;  1BVS A;  1GOZ A;  2N8N A;  4LUO A;  3KYH C;  2IX1 A;  2MUY A;  5EPJ A;  4DR1 Q;  4CHT B;  1N34 L;  4A3B H;  1GUW A;  1NSN S;  1X56 A;  2IX3 A;  4GKJ L;  1LTR D;  1FD7 D;  2QA4 A;  3GQB A;  2F0V A;  3ERQ A;  2Z6K A;  1LV9 A;  4IPD A;  3QO2 A;  4JI6 L;  5FLM H;  3I56 A;  3U9S A;  1EFI D;  2Q8T A;  1H9M A;  4LUV A;  3TN2 A;  5M5X H;  2EJF C;  4HIK A;  3BZD B;  5ELC A;  4RHR A;  4C3I H;  1E0B A;  4IFD J;  4OEM B;  1D5Z C;  4R4O A;  1XMQ Q;  3NEL A;  1SYF A;  1B3A A;  3LGJ A;  2LXK A;  2OTJ A;  5C3X A;  5C44 G;  4DV1 Q;  3BZC A;  2WIN B;  5AJ3 Q;  1EIH A;  3M7N A;  4A3J B;  2HIX A;  1XMO Q;  5GAG C;  5EKK A;  1ZKO A;  1B9N A;  4DR2 Q;  4YHH L;  1R9T H;  1I4P A;  1D6E C;  3G6J B;  3SVM A;  3GTK H;  2IX0 A;  3H0G G;  1F9P A;  2J4X A;  3F2B A;  1STA A;  5LMU Q;  3WOE A;  1SFO H;  1TWA B;  4LF9 Q;  1STB A;  3QIA A;  2EYF A;  2HHH Q;  2QKI C;  5IYC H;  4IO9 A;  4OXP A;  2DY7 A;  1W6J A;  3HOW B;  4R9W A;  5FO9 B;  4J8Q A;  4DR1 L;  1FNU A;  2N3S A;  5HGQ A;  4DNT B;  1CSP A;  2EYP A;  2YTX A;  5M5W B;  1KDB A;  1UEB A;  3Q22 A;  1TWF B;  1VQ9 A;  3KK7 A;  3A5U A;  1JWU D;  3D0F A;  5J39 A;  2RDH A;  2Y0S G;  3J80 L;  3NBI A;  4H13 C;  5D3I B;  5FK9 C;  2FIN B;  1UAP A;  3OHX C;  3UDX A;  2E2J H;  1U4M A;  2JYO A;  4O2D A;  5FJ8 G;  2BDO A;  2XWJ B;  3A8J E;  5ELB A;  3NE5 B;  4G7Z C;  3GTJ B;  2B63 G;  3PO2 G;  1XMQ L;  2F0J A;  1QNK A;  3J7A 5;  1L0X B;  1NMF A;  1J6Q A;  5KNC A;  4DV1 L;  3HOZ G;  2B39 A;  5AJ3 L;  4DV0 L;  1M8A A;  3SXH A;  1CA5 A;  1Y1W B;  1VQF A;  4YCV A;  1XMO L;  2JA5 B;  4PNY A;  5IT9 c;  3MEH A;  3H91 A;  4DR2 L;  1N8R C;  1V43 A;  3F8T A;  1HZA A;  4Q5V A;  1ROD A;  1I94 Q;  1SNO A;  1VQ5 A;  1VQL A;  3OWF A;  1UEA B;  5FKA C;  5LMU L;  3TS2 A;  4PZ7 A;  3OOC A;  2EYO A;  2KQ3 A;  1VQ4 A;  3FMC A;  5KEE A;  4ZKC B;  1YJ9 A;  4LF9 L;  1PH4 A;  2HHH L;  4X3T A;  1EZ8 A;  1QVF A;  2QIL A;  2Q2T A;  4MN3 A;  1JWS D;  1G51 A;  1TU2 B;  5D3D A;  3CPW A;  1I6H H;  4KHZ A;  1PZI D;  3QWN A;  2B2Y C;  2A8V A;  2V4D A;  2BE5 D;  2B8G A;  3RD4 A;  3I3C A;  4A3J G;  2JSO A;  4A3M H;  3KLS A;  1KAB A;  1EWH A;  5IOC A;  3MHB A;  2AKW B;  5ELD A;  1MI2 A;  1HFN A;  1GO3 E;  1KAW A;  2ZTC A;  3G6E A;  4K5W A;  4L5R C;  4NKL A;  1B53 A;  5EQ0 A;  2AUJ D;  4N9T A;  1A6X A;  2HIV A;  1XTD A;  2H4O A;  1BF4 A;  1DOM A;  5COR A;  1RDP D;  3PUW A;  4FP5 D;  1EUJ A;  1ZXT A;  1P16 A;  4NB3 A;  1HUM A;  1SE8 A;  1UE6 A;  5L37 A;  5FLX c;  4A93 H;  2B8F A;  3CC4 A;  1HNW Q;  1K8O A;  3TBI B;  2VB2 X;  1OXU A;  1FGB D;  1DCZ A;  1OXV A;  4HIO A;  3HRZ C;  5IGB A;  1E3P A;  3I4O A;  1ET9 A;  3T4A C;  3GD7 A;  2EJG C;  5JJL A;  3HOY B;  5JJK A;  1SN8 A;  2L15 A;  1I94 L;  4JVZ A;  4C3J B;  5EPL A;  4JI3 Q;  3U50 C;  4GNX B;  4F87 A;  1LLR D;  2B2V A;  1B70 B;  1GUG A;  1STN A;  1MJC A;  1PFM A;  2NVX H;  3I4M B;  1O7I A;  2KEN A;  4JW0 A;  1S40 A;  1CA6 A;  4XT3 B;  3GO5 A;  5M3M B;  3IKJ A;  3QB3 A;  1TT2 A;  1ML0 D;  1UWV A;  1KRS A;  2P5Z X;  1W3S A;  5IOD A;  3M4O H;  4XDX A;  1JT8 A;  3OW2 A;  4C3H B;  1IBL Q;  1HQR D;  5E3F A;  2PZW A;  4FNF A;  2CW0 C;  3X3M A;  4F8M A;  2SDF A;  3S1M B;  1Y1W G;  3FKI B;  3PSI A;  4HAE A;  2KVM A;  2A19 A;  4A3L G;  2RCF A;  4AIM A;  4K0K Q;  2LKV A;  4YWK A;  4C2M B;  3F2C A;  1IYJ B;  3A56 A;  3FPU B;  3CU7 A;  4BA2 I;  2K5N A;  2EYJ A;  3C2P A;  1V1P A;  3S1Q B;  1SYD A;  3STB C;  1BCP B;  4AQY Q;  1F2Y A;  3I4N B;  2XSC A;  2MO0 A;  3A74 A;  1K3R A;  1QNU A;  3MXG A;  2JXM B;  2IY5 B;  2A1A A;  4QY7 A;  2WB1 B;  4H44 C;  1KD1 C;  3CKI B;  4JBW A;  3QG1 A;  3TEH B;  1HNW L;  1EZ6 A;  2D62 A;  4JPB W;  1CKO A;  1XJV A;  1PZJ D;  1I3Q H;  3K7U C;  5GQO A;  1K73 C;  3ERO A;  1N36 Q;  2NZH A;  2VL6 A;  3BG3 A;  2K7V A;  3K5L A;  1KNA A;  3V05 A;  3A55 A;  4IQZ A;  3S1R B;  4I7Z C;  4JI3 L;  2NZ1 D;  1AEX A;  4OIJ A;  5C0X G;  3U9O A;  5JJZ A;  2D9U A;  1PMR A;  2NBF A;  1T5E A;  3K58 A;  2Q2U A;  1FGU A;  3M4P A;  1L1O B;  3NEM A;  1BCP D;  2AQ2 B;  2RSN A;  3E0J A;  3TRE A;  3SK8 A;  3PQI A;  1CQV A;  5LMN Q;  3HKZ G;  4RGM A;  1ENF A;  4QL5 A;  5ELO A;  4IUN A;  2F0U A;  2K32 A;  3G4S A;  2BCO A;  4YWL A;  1IBL L;  1PTO B;  3DEO A;  4QGU A;  3ND9 A;  3T51 B;  1VQ6 A;  1XPR A;  1X3P A;  4L5T A;  1VQJ A;  2WP8 J;  2IW3 A;  4QUF A;  1TWC B;  3K0Y A;  1KC8 C;  2EDG A;  1FNW A;  4QCL A;  1RTO A;  2I0Q A;  1V1Q A;  2RDF A;  4OWX B;  4K0K L;  4Y52 H;  1VDZ A;  3A8I E;  3HOY G;  1V1O A;  4HJ9 A;  1BUV T;  4C3J G;  4DK1 A;  3SEB A;  1OTC A;  1HA6 A;  4AQY L;  4HMJ A;  3ULJ A;  3HOU B;  3R8B A;  4C3I B;  2XGT A;  4XT1 B;  4UAI A;  5LMN W;  1KHI A;  3CCV A;  1S5C D;  1XTC D;  2PQA A;  4FYD A;  4RG1 A;  2BDN A;  3I70 A;  4DK3 C;  4X65 Q;  1TWG H;  5M3M G;  2YTY A;  2PPB C;  3HOV H;  1HXY D;  1C8C A;  1PTO D;  4Z9C B;  4JOI C;  1N36 L;  4KTA A;  1WTO A;  4J15 A;  5CR3 A;  3UE0 A;  3ZJY C;  2RBM A;  2MQH A;  3BDO A;  5ISR A;  3U4Z A;  3FKI G;  1A2U A;  4B9W A;  2IHF A;  2A6E D;  1F2M A;  5JVH 3;  3D4D A;  1LTI D;  4R4Q A;  2F03 A;  4JYA Q;  3H09 A;  3NWT A;  3GTK B;  3HGB A;  1U5K A;  1YJN A;  4HMI A;  1YNN C;  3ONA B;  2X69 A;  1ICW A;  3GTO B;  3ZYY X;  1AZQ A;  2K5D A;  3KJO A;  5LMN L;  1H9J A;  2KBN A;  2E2H B;  1M90 C;  2SNM A;  1K8G A;  1SE4 A;  2WB1 G;  1LO5 D;  3CMA A;  4KY6 A;  1QIL A;  1E24 A;  3AB9 A;  1VQI A;  4GZY C;  3DWA A;  4S3S A;  1B9M A;  1ESR A;  1ZYR C;  2JJQ A;  4KJN A;  3I73 A;  3BJU A;  5EBD A;  2F3I A;  5F2D A;  4GKK Q;  3RZO B;  4V0B A;  1RIP A;  5A35 A;  3Q8D A;  1NTG A;  4PG3 A;  2F4V Q;  4HJ7 A;  4O42 A;  4OL7 A;  5IT9 E;  1BQQ T;  1LM0 A;  2KCT A;  4X66 Q;  2R3Z A;  3S9W A;  4GLX A;  1BCP C;  3D31 A;  2UUC Q;  5C3W A;  4X65 L;  1X32 A;  2HDM A;  3MC0 B;  4IJH A;  1X3E A;  2F0Q A;  1I5F A;  1D5M C;  1JWM D;  1Y8N B;  1GUO A;  2VUM B;  1NR4 A;  4WJ4 A;  3RZD H;  3H3V C;  2ICI A;  5M3F B;  1AH9 A;  3M4Y A;  4JYA L;  1MBY A;  3M4Q A;  1D5X C;  1FVI A;  3OIP A;  3BVM A;  2R7Z G;  2ENB A;  1GXD C;  4KMU C;  1TS3 A;  1SMY D;  4GOP A;  2RF4 A;  5FOB B;  4XYO A;  3VR6 A;  3HOU G;  2NWG A;  3FVQ A;  2DGY A;  4H0L C;  5JPN C;  4Y7N H;  4HED A;  4KLK A;  3KF8 A;  3VDY A;  1SLJ A;  3S17 H;  5ELF A;  3HS0 C;  1QVG A;  1PTO C;  1XNQ Q;  4IUT A;  4DNI A;  1YHB A;  4GKK L;  2PO4 A;  1ASY A;  4LAA A;  2R7F A;  3M85 A;  4A3I H;  1WCM G;  3S14 H;  4OGQ C;  1LT5 D;  2JA9 A;  2VQE Q;  5A2Q L;  1VMP A;  4KN4 C;  2A6E C;  5KYL A;  2F4V L;  1YIJ A;  5JJI A;  3HOX B;  4JI5 Q;  2E8G A;  2K28 A;  3IFT A;  3KDF A;  3DMU A;  4X66 L;  5KRU A;  1TS2 A;  1MHW C;  3K7A B;  4HIM A;  2UUC L;  1ICF B;  1KRT A;  3Q6S A;  4XYQ A;  2R93 G;  3FP9 A;  1RCV D;  1K83 B;  2F52 A;  2WFW A;  2JP1 A;  2JA6 H;  1X6O A;  2BA0 A;  2B2U A;  1AE3 A;  4L8J A;  3ND8 A;  4CDE C;  3CPF A;  3D4R A;  4BWG B;  5IGE A;  2NVT H;  4BBS B;  1VQG A;  1A3U A;  2J7Z A;  2C9O A;  3CD6 A;  2J0T D;  1WD0 A;  5IIF A;  2IWH A;  4LF6 Q;  2BH2 A;  2EOT A;  1VQH A;  1VQ8 A;  5FLX L;  3ITP A;  4IN3 A;  3S16 H;  4GS3 A;  4HJA A;  4IZ8 A;  4UPA A;  3CQZ H;  2CHB D;  5C3E G;  4LF4 Q;  2NVX B;  2WKD A;  2NTS A;  2EY2 A;  1EQQ A;  1RJT A;  5BN3 A;  3NBH B;  1EU4 A;  1RTN A;  3M4O B;  2FJ2 A;  2G5D A;  3GTL H;  4WJW A;  1XNQ L;  4F88 A;  2VUM G;  2KEC A;  1PA6 A;  2DJG C;  1Q86 C;  2E2I H;  3RMH A;  3N52 A;  1IW7 C;  1O7Z A;  2K33 A;  2I07 B;  4FO2 A;  5M3F G;  3V2T A;  2L9H A;  1VQA A;  3ULP A;  4JI5 L;  1JIC A;  2EZV A;  4A3E H;  3I55 A;  1XPU A;  1AW7 A;  4K8J A;  1KAA A;  2IL8 A;  3EQL C;  4KV6 A;  1O7L A;  1F2L A;  3GTM B;  3RLO A;  1EQT A;  1LTG D;  4GLA C;  1SMY C;  4NPS A;  4BY7 H;  3L9A X;  1EIF A;  1EQR A;  3D8G A;  4A75 A;  1JR0 D;  1VQM A;  2Z6K C;  3AFQ A;  4CKB A;  4DKA C;  4IUV A;  2TSS A;  2M2L A;  3FEW X;  1B2T A;  4B9X A;  1E2Z A;  1I3Q B;  3NPP A;  3PIO A;  3CCJ A;  5DLQ E;  2KHI A;  1IZ6 A;  4HN7 A;  3QJY A;  4A3K B;  1A63 A;  4CDD C;  1I4Q A;  1QOH A;  3G7L A;  4TRD A;  4LF6 L;  2F0E A;  4A3C G;  3U4V A;  1VCI A;  3W5O A;  4F7X A;  3HOX G;  1JOQ A;  2B2T A;  1UUP A;  3MVV A;  1G91 A;  4RA8 A;  4FDB A;  1E1O A;  4LF4 L;  4KD3 A;  1EOV A;  1NY4 A;  1VQD A;  4H7B A;  2QF7 A;  5C4X H;  2A5H A;  3BZK A;  4DAP A;  4DV0 Q;  2OTL A;  2ALY B;  1RKN A;  1PVO A;  1FL0 A;  3D3R A;  2ICE C;  2AHO B;  3MA2 B;  1LAB A;  3KF6 A;  4A3F H;  1C9O A;  1CQF A;  1HTP A;  5IYD G;  1H9R A;  4DR3 Q;  4BBS G;  1EQV A;  2ZJR A;  1CZW A;  2V1C C;  4EX5 A;  1PYW D;  1EOT A;  3DEP A;  1HCZ A;  1HPC A;  1KLG D;  2F0T A;  1EY0 A;  5I2Y A;  2K5H A;  4XQJ A;  3M3Y B;  1T9H A;  4OX9 Q;  4HCS A;  1G6Z A;  3J81 c;  1J9O A;  3CCQ A;  3MAQ A;  4CJ1 B;  3PUZ A;  2YU9 B;  2KHS A;  3LWU A;  3W2D A;  2DNC A;  2L55 A;  5EAY A;  1WTW A;  1Z9F A;  1I50 H;  4X3S A;  3HOV B;  4P73 A;  5K5P A;  1UNS A;  3M9B A;  4KD4 A;  1F9S A;  3DWQ A;  1Y8O B;  4JBK A;  1D2B A;  1DZ1 A;  2LMC B;  1EU3 A;  5IP7 H;  3AFP A;  3OTO Q;  4B3M Q;  5JEA H;  5C6A A;  3QOL A;  2ZJP A;  3I2Z A;  3GTQ B;  5M5Y B;  4A3D B;  2XRQ D;  5K36 H;  1L0Y B;  2CQO A;  2PMZ E;  3S2H H;  2EXD A;  1N33 Q;  5DM7 3;  2A69 C;  2CW0 D;  3H94 A;  2XTI A;  1QB5 D;  1PFN A;  4IUQ A;  1STE A;  4KKT A;  5CGK A;  1BDO A;  1ZEQ X;  4LFB Q;  1BO0 A;  1L0W A;  4R4I A;  4LF8 Q;  4A3G B;  4BBR H;  4DR3 L;  1A15 A;  1CKN A;  3K8A A;  4ZQ3 A;  4WJ3 M;  3UE1 A;  2MP1 A;  3CCU A;  1Y1V B;  3MXU A;  4ZUI A;  3TME A;  3TSS A;  2CH4 W;  5JEA J;  4A3K G;  4OWT B;  4R4C A;  3STB D;  4OON A;  5CC4 A;  4OX9 L;  2G9D A;  1EIG A;  3ER0 A;  2QDL A;  3MFG A;  1CZG A;  1GJX A;  1XYI A;  1PV4 A;  4DXF A;  4BXX H;  1ET6 A;  5C4Z A;  1NR2 A;  3TQY A;  1QE6 A;  3A7L A;  4PZ6 A;  3S15 B;  4TQU S;  1FYC A;  4DU9 A;  4IPG A;  1QWY A;  1K9M C;  4DA2 A;  4MTK A;  4DAY B;  4ZK9 B;  1C7Y A;  2R7D A;  1SNP A;  1Q8I A;  1P8L A;  1EWC A;  5I6Y A;  4KN7 C;  2K14 A;  1G6P A;  3C3L A;  3RZD B;  2TMP A;  5I2X A;  2AMC B;  3OTO L;  4B3M L;  2JN4 A;  3MWY W;  2UXB Q;  3T53 B;  1VF7 A;  1H9S B;  2XNA C;  4MZ9 A;  3GTP H;  4K5V A;  2VW9 A;  1Q81 C;  3CF5 A;  3VA5 A;  4A3C H;  1AN8 A;  3KJP A;  1N33 L;  1EYD A;  2UUA Q;  2B2Y A;  3MTS A;  3BS1 A;  2EQS A;  3HOW G;  1PHJ A;  2JA8 B;  1HUN A;  1YZ6 A;  4LFB L;  2F3V A;  1WYD A;  2F4I A;  1X3F A;  4K6D A;  3S17 B;  4LF8 L;  2B2V C;  2R92 B;  5C44 H;  2ZTD A;  1JQY D;  1V8Q A;  3OYY A;  4RFB A;  3I90 A;  1XPO A;  1CK1 A;  2E5L Q;  3OMC A;  1PH5 A;  1S5F D;  1X55 A;  1LTA D;  2A68 C;  4WFN 3;  1EYG A;  3S14 B;  1E2W A;  2X6G A;  3HKS A;  4UDU C;  4K8I A;  3SK5 A;  2L5T A;  3SGI A;  1SYC A;  2VS1 A;  2AWO A;  3H0G H;  2B29 A;  3PV0 A;  3PO3 B;  2HQL A;  1NAP A;  3UDG A;  3HEJ A;  3VYS A;  4A3D G;  2JA7 B;  3DWP A;  3G48 A;  1EY8 A;  3J7A F;  3M7G A;  3OW7 A;  4U68 A;  4NDX A;  1PH3 A;  5T1G A;  1XX8 A;  1ILP A;  3GTG B;  2DY8 A;  3OMG A;  4DV6 Q;  1PH1 A;  4TSS A;  2PYK A;  5E1F A;  3K5N A;  2JA5 G;  4G7O C;  2FHT A;  1SNC A;  3VYU A;  3CCE A;  4HTH A;  3NSW A;  4WRD A;  2E74 C;  5IP9 G;  1YNN D;  4M8A A;  1LAC A;  3OPO A;  1GUT A;  1WD1 A;  2UXB L;  2H5X A;  1Y1V G;  2CWP A;  4OO1 G;  1MGS A;  1HRJ A;  1WTV A;  3DUZ A;  5H1S E;  4NXM Q;  2JQO A;  1PZK D;  1O78 A;  5COY A;  1CHP D;  4QQB X;  1R4Q B;  5FJ8 H;  2AWN A;  4UP7 A;  2UUA L;  2Y0S E;  3VR5 A;  1VQC A;  3F2U A;  1PRT F;  1XNR Q;  5DM6 3;  4TKO B;  2Z6B A;  2B63 H;  3PO2 H;  1ZYR D;  4JI0 Q;  2PCF B;  4G7H C;  3CCM A;  4MTN A;  1WTX A;  1HTL D;  4R8I A;  1I4G A;  1PH6 A;  4BY1 B;  1GHJ A;  3HOZ H;  4KHP Q;  2VQF Q;  1F77 A;  4GOP B;  1ENC A;  1SYE A;  3QR8 A;  1PYB A;  4ZAI A;  4FF1 A;  1LTL A;  2BH8 A;  5KYI A;  2E5L L;  4JBM A;  4PQX A;  1R4P B;  1MD2 D;  4FXG C;  4B3S Q;  1C0A A;  5FO8 B;  3SE0 A;  2WAC A;  1ENA A;  4C1N K;  2K52 A;  1DYQ A;  1VQB A;  3T13 A;  3E6Z X;  3NUC A;  1H95 A;  4KHV A;  2XVS A;  2BOS A;  3K0X A;  3FHW A;  4O0A A;  2O2L D;  3K59 A;  1Z47 A;  4KY5 A;  1RL2 A;  1WTP A;  4KK7 A;  1TII D;  4A3B B;  2QEJ C;  1EFW A;  4K2L A;  2KOL A;  1U9R A;  3CAM A;  2JA8 G;  4DV6 L;  2LXJ A;  2PI2 A;  1K0R A;  2E2D C;  4UHV A;  4J6H A;  3KDF B;  1Q7Y C;  3VA7 A;  1EIY B;  2HT1 A;  1S4Z A;  4JI4 Q;  1VF5 C;  1QVC A;  1PFB A;  2OCE A;  1IL8 A;  5KGU A;  4A3J H;  4L63 B;  1J5E Q;  4B08 A;  3I7F A;  3GP7 A;  2YV5 A;  5KIX A;  5M5X B;  5T1I A;  2RA4 A;  3H15 A;  1QUQ B;  4DV4 Q;  3D6W A;  4NXM L;  1WTQ A;  4JI2 Q;  4IUR A;  4GN4 B;  3I4M G;  3DM1 A;  1K28 A;  1LUZ A;  4RKB A;  4AYB E;  1HZ9 A;  4JC0 A;  2F0W A;  2HCI A;  3PO3 G;  1XNR L;  3NQI A;  3U58 A;  5CV7 A;  3W1G A;  2JA7 G;  2OEO A;  4JI0 L;  3PF5 A;  3PIP A;  2NVQ H;  3RN5 A;  1SNQ A;  1G2T A;  3J80 c;  4C3H G;  3J81 E;  3CCR A;  4RHS A;  1DD2 A;  4APV A;  1YI2 A;  1TY2 A;  4KHP L;  2VQF L;  5E4W C;  1K3B C;  4LFA Q;  2N88 A;  2PNR C;  3S2D H;  1VQK A;  1R9T B;  3B6Y A;  5DNF A;  1NBW A;  3VR4 A;  2NN6 G;  4XQN A;  3PUX A;  1S72 A;  4B3S L;  2K03 A;  5M5W H;  1CI3 M;  1TWF H;  4X64 Q;  1SFO B;  5G3L D;  4CBV A;  4KI0 A;  1IKL A;  3K5M A;  2K75 A;  3GDE A;  2Z8L A;  5IWA Q;  1IBM Q;  3CHB D;  4K6L A;  4RAU C;  3PIO 3;  3IFD A;  1U4L A;  1ILQ A;  3I4N G;  1WI5 A;  2DUD A;  5IY0 A;  3F2D A;  1BBU A;  2GVA A;  1IXR A;  3J7Z C;  1YNX A;  2F0N A;  5M9O A;  3SR1 A;  3A5Z B;  2LS0 1;  2Q2I A;  4IOA A;  3CRK C;  1ASZ A;  1SYG A;  4FXK C;  3GTJ H;  2EYH A;  5C0X I;  2F0H A;  3EN2 A;  1PTO F;  4BY1 G;  2CVR A;  3BYT B;  4JI4 L;  4GNX A;  1H9K A;  1Y1W H;  1J5E L;  2E2J B;  2NB0 A;  1DXM A;  3K5O A;  3EJI A;  2JA5 H;  2RKS A;  2PMZ B;  4IPC A;  4A3L H;  1HZB A;  1MSG A;  2FMM A;  3CW2 C;  4DV4 L;  4PV1 C;  4JI2 L;  2K04 A;  4IFD G;  2MJ8 A;  2AQ1 B;  1SND A;  2EIF A;  1Y8P B;  1SRO A;  1LYL A;  5IYB G;  2F1M A;  4X3K A;  1HR0 Q;  4L6T B;  2RVL A;  3ICE A;  1YHA A;  1I6V C;  4KY7 A;  3TDQ A;  5BN5 A;  5LL6 S;  5C4J H;  1K0S A;  4ZKB B;  3S1N H;  3E9H A;  4RGT A;  4A3B G;  4QMG A;  1IW7 D;  1KXL A;  4LFA L;  2F0I A;  4BBR B;  2I5M X;  4GOP C;  2KED A;  4ZUJ A;  1AP0 A;  1Q46 A;  2MPM A;  1SNM A;  5GAE C;  4DR7 Q;  4X64 L;  5FLM G;  2B2W A;  2L11 A;  3LWE A;  5IWA L;  1IBM L;  5NUC A;  1JCK B;  3DHQ A;  3KF6 B; 
#chains in the Genus database with same CATH homology
 3LNN A;  1K8M A;  5C0X H;  2WII B;  4C3I G;  4ODG A;  5IT9 L;  1NUC A;  5D14 A;  2EPB A;  1I6H B;  5BN4 A;  1SEB D;  5J22 A;  1JOK A;  5EKI A;  1PLF A;  1SDF A;  4EVO A;  4A3M B;  3GV3 A;  4LJZ C;  1S5D D;  2OXP A;  1SXT A;  4M1U B;  2F0G A;  4MIU A;  5DEH A;  4FXD A;  1C4Q A;  5CV9 A;  3IL8 A;  1B4O A;  2K5W A;  4MHE A;  2NUC A;  1CT1 D;  1QJO A;  4K5X A;  5C0X J;  2H1E A;  3D4W A;  1EY5 A;  4RGN A;  4CJ0 B;  4A93 B;  4ZLT F;  1JC7 A;  1U4P A;  4DN4 M;  5DAU A;  4ILW A;  3K57 A;  5C44 B;  1SYB A;  4RKL A;  2IJ0 A;  1STH A;  3OSO A;  5IGD A;  2F0D A;  1II3 A;  2K6A A;  1E2V A;  4FVM A;  1S5B D;  2KUM A;  3LX0 A;  3H0G B;  3Q24 A;  2FFK B;  4ABN A;  2XN9 C;  3D6C A;  3EVQ A;  3SK4 A;  2Z1C A;  1Z7T A;  3X3N A;  3C1F A;  3MXN A;  1X3Q A;  3NWS A;  2E76 C;  1SJE D;  1EY6 A;  3IAY A;  3KUP A;  4RCN A;  1SAP A;  1BXT A;  2G9H D;  1SJH D;  2D5D A;  1IHZ A;  2Y0S B;  5D65 A;  1CFM A;  3KLR A;  1TY0 A;  2A69 D;  5I9O A;  5J1Z A;  3NTK A;  4G4K A;  2HUG A;  1RHP A;  2B63 B;  3PO2 B;  4ZRZ A;  1HA5 A;  3HOZ B;  2R6G A;  4QUC A;  5LHY 1;  5IGG A;  1I4H A;  1OO9 B;  1PTO H;  3Q0A A;  3KBG A;  5CV6 A;  2F0O A;  4DAV A;  2N55 A;  3NTI A;  4K14 A;  1QG7 A;  4DFA A;  3VYR A;  1FR3 A;  3K6O A;  3VR2 A;  3WOF A;  4RGO S;  3T16 A;  1A3V A;  3J80 E;  2EY6 A;  3DXJ C;  4AYB B;  4N9P A;  1I4X A;  2VXW A;  4WOR A;  3AMU A;  5EGT A;  3I91 A;  3BDC A;  2F0F A;  2VB3 X;  2K1B A;  1SE2 A;  2E75 C;  2SOB A;  1Q3L A;  5LL6 X;  2O5I C;  4DGZ A;  3FDT A;  1TWG B;  1ESF A;  4NP5 A;  3TP7 A;  2F0S A;  1LT6 D;  1V1P B;  2M00 A;  2YYZ A;  2NVQ B;  2RQX A;  3HZX A;  3R3O A;  2EY5 A;  1SSO A;  4ULL A;  2A68 D;  2ZT9 C;  3S2D B;  2R61 A;  2PW5 A;  2CQA A;  5C4H A;  5CBA E;  4CKE A;  1BBX C;  1TVX A;  2F0M A;  1OXX K;  5CBE E;  1WVL A;  1OXT A;  1B44 D;  3MFY A;  1J8I A;  1HHV A;  1KLU D;  2GA4 B;  1I4R A;  1FNV A;  3PIP 3;  1ONL A;  1PXU A;  4HCE A;  1GUS A;  4IUP A;  4XQQ A;  1B50 A;  3C1E A;  3NBH A;  1Q1E A;  3TP8 A;  5ELE A;  3RLF A;  5C4J B;  4NMZ A;  3S1N B;  1C48 A;  2DN8 A;  3SK6 A;  4I65 A;  1LT3 D;  3J7A V;  1F9R A;  5EPK A;  5IGC A;  4LK1 C;  1JE4 A;  3OIQ A;  4KJO A;  2A73 B;  1Q90 A;  3L7Z C;  2Z4H A;  2KEE A;  4X3U A;  4KKS A;  3RUZ A;  4Y7N B;  3BVG A;  3QOJ A;  2EYL A;  1BNZ A;  2F3W A;  1PRT B;  3HKZ B;  1EYC A;  1A2T A;  5EBC A;  2L4N A;  3NQT A;  4A3I B;  1AFP A;  2I46 A;  3UI2 A;  2BA1 A;  1LTB D;  3I8Z A;  1M4V A;  4RWS C;  3TP5 A;  1HFG A;  3VR3 A;  5FO7 B;  4FF4 A;  2XRS D;  3TZU A;  2MGS A;  2ZXP A;  1GHK A;  1IYU A;  5C5L A;  2JA6 B;  1DM0 B;  3V96 A;  5JOB A;  5JVG 3;  1TS4 A;  2F0K A;  2NVT B;  1PRT D;  2WKC A;  4KKU A;  1KNE A;  1BR9 A;  2HCC A;  1T5X D;  4DK0 A;  1OXS C;  3A7A B;  2AUK A;  3S16 B;  3CQZ B;  1DJR D;  5I6W A;  1TR5 A;  2JE6 I;  3H6M A;  1D1K A;  1HQM C;  2EE1 A;  4XTC S;  1DOK A;  1EL0 A;  1YNJ D;  3R2T A;  4P2C B;  3GTL B;  2L12 A;  1CTM A;  3BYY B;  4DF7 A;  2E2I B;  5EKL A;  1VMC A;  4Q0F A;  4R8N A;  2KCN A;  1B1Z A;  3AU7 A;  1QCB D;  4A3E B;  1U4R A;  2BE5 C;  4CKC A;  4CGY B;  4LMQ D;  4BY7 B;  2M9V A;  4C56 C;  1SBB B;  5KND A;  3FPP A;  1TKW B;  1A3T A;  1JB3 A;  2Z4I A;  1TS5 A;  2WAQ B;  1DON A;  2SNS A;  3NP8 A;  1G29 1;  5CV4 A;  2LFN A;  3SDZ A;  5HGT A;  4OHJ A;  4BS9 A;  2SEB D;  2JEA I;  2LY7 A;  5I4D A;  2EJM A;  2PW7 A;  1BOS A;  1MSH A;  3HG9 A;  3I72 A;  3PMF A;  3NTH A;  1Q1B A;  1RD9 D;  1BCP F;  4HSP A;  2R7Z B;  1Q12 A;  5C4X B;  4FF2 A;  3BVZ A;  1STY A;  4DAY A;  3J7Y W;  5HUR A;  1WTR A;  2L0C A;  4A3F B;  3PUY A;  4OO1 I;  1G2S A;  3NXW A;  5TSS A;  5JPM C;  1PRT C;  2RDG A;  4V19 0;  4U67 3;  1O7Y A;  4QIW B;  1W6K A;  2EY1 A;  4PMC A;  1H9S A;  1EY9 A;  1GUN A;  4QF4 A;  2NYZ D;  4BA1 I;  4JK1 C;  1KDC A;  1WCM B;  1AZP A;  2OF1 A;  3EA6 A;  3MZ5 A;  4RH6 A;  5C5M A;  2A6H D;  1I50 B;  2O4X A;  2XWB B;  3P1H A;  3T56 B;  1YNJ C;  1SE3 A;  2R93 B;  3J81 L;  1D1I A;  3A8K E;  3VYT A;  1IYV A;  4RCO A;  1G8Z D;  2D2C C;  3P20 A;  1S5E D;  4DXG A;  1CM9 A;  4EQP A;  5G3L F;  3NK9 A;  3EFX D;  4OO1 H;  1JOR A;  3S2H B;  4J1M A;  2Q8R E;  4ZYS A;  4O1N A;  2MHV A;  4DNR B;  1O80 A;  3BDL A;  4G57 A;  2FMC A;  2Q8I B;  2KJX A;  5C3E B;  3C46 A;  4NW2 A;  1NCV A;  4IAL A;  5I9P A;  2B2W C;  2K05 A;  5AFW A;  4EQN A;  2VNU D;  5E4X A;  2X6L A;  5A2Q E;  1EY4 A;  3Q23 A;  1KDA A;  5CV5 A;  3N6R A;  3KBX A;  3O13 A;  2PZT A;  3MXP A;  1TQO A;  3FRP B;  5CV8 A;  2IPK D;  4ME5 A;  2WV6 D;  2C5C A;  2NN6 I;  3OWE B;  2QCP X;  2L1B A;  2NTT A;  2HQE A;  4IUU A;  2ZXO A;  4CJ2 C;  4FF3 A;  2PZU A;  1RF2 D;  2K01 A;  1LTT D;  1TWH B;  5CMD A;  1KTK A;  4PMW A;  2KCC A;  4EQO A;  2PQE A;  3HP3 A;  3R2I A;  3GTP B;  4YIJ A;  2B2U C;  3URY A;  3SHL A;  3I4L A;  5FLX E;  5EJW A;  3NHH A;  1PDQ A;  1STG A;  5JAV A;  1IKM A;  1LT4 D;  3P7J A;  2QDB A;  4PMB A;  5CYU A;  2ID0 A;  4HSV A;  2A6H C;  3R93 A;  1XWE A;  2NVY B;  1EYA A;  1EY7 A;  4C1N I;  3L3O C;  3JAM E;  1XXG A;  2IT1 A;  2F0P A;  4IFD I;  4K2K A;  4QB4 A;  4OIK A;  5JEA G;  2K5Q A;  2EYM A;  2NN6 H;  1F9Q A;  4XXE A;  4ID6 A;  2A74 C;  3P75 A;  3TP6 A;  5K36 G;  2AQ3 B;  2HDL A;  3KLS X;  3TZD A;  4XIG S;  4EGV A;  2OT2 A;  5KNB A;  1LTS D;  3GV6 A;  1CHQ D;  2DNE A;  5IGF A;  1EEF D;  2KA7 A;  3PUV A;  1Y69 U;  2ZXR A;  2F0L A;  2JEB I;  3CRL C;  3A54 A;  3JAM L;  3WDN A;  2EVB A;  1EEI D;  2XIW A;  1Z6H A;  3W3A A;  2RSO A;  1JOO A;  1F2Z A;  2EXZ A;  4IFD H;  3E5S A;  1DOL A;  4HR7 B;  2B2T C;  2O5J C;  4E6I A;  1GOZ A;  2IX1 A;  2MUY A;  5EPJ A;  4CHT B;  1GUW A;  1NSN S;  2IX3 A;  1LTR D;  1FD7 D;  3GQB A;  2F0V A;  3ERQ A;  1LV9 A;  3QO2 A;  3U9S A;  1EFI D;  2Q8T A;  1H9M A;  3TN2 A;  2EJF C;  3BZD B;  5ELC A;  4RHR A;  1E0B A;  4IFD J;  1D5Z C;  1SYF A;  1B3A A;  5C3X A;  2WIN B;  1EIH A;  3M7N A;  4A3J B;  5EKK A;  1ZKO A;  1B9N A;  1I4P A;  1D6E C;  3G6J B;  3SVM A;  2IX0 A;  1F9P A;  2J4X A;  1STA A;  3WOE A;  1TWA B;  1STB A;  3QIA A;  2EYF A;  2QKI C;  2DY7 A;  1W6J A;  3HOW B;  4R9W A;  5FO9 B;  4J8Q A;  1FNU A;  4DNT B;  2EYP A;  5M5W B;  1KDB A;  3Q22 A;  1TWF B;  3KK7 A;  1JWU D;  5J39 A;  2RDH A;  3J80 L;  3NBI A;  4H13 C;  5D3I B;  5FK9 C;  2FIN B;  1UAP A;  3OHX C;  1U4M A;  2JYO A;  2BDO A;  2XWJ B;  3A8J E;  5ELB A;  3NE5 B;  4G7Z C;  3GTJ B;  2F0J A;  1QNK A;  1L0X B;  5KNC A;  2B39 A;  1M8A A;  3SXH A;  1CA5 A;  1Y1W B;  2JA5 B;  4PNY A;  3MEH A;  3H91 A;  1V43 A;  4Q5V A;  1ROD A;  1SNO A;  3OWF A;  1UEA B;  5FKA C;  3OOC A;  2EYO A;  2KQ3 A;  3FMC A;  5KEE A;  4ZKC B;  4X3T A;  1EZ8 A;  2QIL A;  4MN3 A;  1JWS D;  1TU2 B;  5D3D A;  4KHZ A;  1PZI D;  3QWN A;  2B2Y C;  2V4D A;  2BE5 D;  2B8G A;  3RD4 A;  3I3C A;  2JSO A;  3KLS A;  1KAB A;  1EWH A;  5IOC A;  3MHB A;  5ELD A;  1MI2 A;  1HFN A;  4K5W A;  4NKL A;  1B53 A;  5EQ0 A;  2AUJ D;  4N9T A;  1A6X A;  1BF4 A;  2H4O A;  1DOM A;  5COR A;  1RDP D;  3PUW A;  4FP5 D;  1ZXT A;  1HUM A;  2B8F A;  1K8O A;  3TBI B;  2VB2 X;  1OXU A;  1FGB D;  1DCZ A;  1OXV A;  3HRZ C;  5IGB A;  1ET9 A;  3T4A C;  3GD7 A;  2EJG C;  3HOY B;  4C3J B;  5EPL A;  4F87 A;  1LLR D;  2B2V A;  1GUG A;  1STN A;  1PFM A;  3I4M B;  1CA6 A;  4XT3 B;  3GO5 A;  5M3M B;  3IKJ A;  3QB3 A;  1TT2 A;  1ML0 D;  5IOD A;  4XDX A;  4C3H B;  1HQR D;  5E3F A;  2PZW A;  4FNF A;  2CW0 C;  3X3M A;  4F8M A;  2SDF A;  3S1M B;  3FKI B;  4HAE A;  2KVM A;  2LKV A;  4C2M B;  3A56 A;  3FPU B;  3CU7 A;  4BA2 I;  2EYJ A;  3C2P A;  1V1P A;  3S1Q B;  1SYD A;  1BCP B;  1F2Y A;  3I4N B;  2XSC A;  1QNU A;  3MXG A;  2JXM B;  2WB1 B;  4H44 C;  3CKI B;  4JBW A;  3QG1 A;  1EZ6 A;  2D62 A;  1PZJ D;  3ERO A;  3BG3 A;  2K7V A;  3K5L A;  1KNA A;  3V05 A;  3A55 A;  4IQZ A;  3S1R B;  4I7Z C;  2NZ1 D;  1AEX A;  4OIJ A;  5C0X G;  3U9O A;  5JJZ A;  2D9U A;  1PMR A;  2NBF A;  1T5E A;  3K58 A;  1BCP D;  2AQ2 B;  2RSN A;  3E0J A;  3SK8 A;  1CQV A;  4RGM A;  1ENF A;  4IUN A;  2F0U A;  2K32 A;  2BCO A;  1PTO B;  3DEO A;  3ND9 A;  3T51 B;  1X3P A;  2WP8 J;  2IW3 A;  4QUF A;  1TWC B;  3K0Y A;  4QCL A;  2EDG A;  1FNW A;  1RTO A;  2RDF A;  1VDZ A;  3A8I E;  1V1O A;  1BUV T;  4C3J G;  4DK1 A;  3SEB A;  1HA6 A;  4HMJ A;  3HOU B;  3R8B A;  4C3I B;  4XT1 B;  4UAI A;  1S5C D;  1XTC D;  4FYD A;  2BDN A;  3I70 A;  2PPB C;  1HXY D;  1C8C A;  1PTO D;  4Z9C B;  4KTA A;  1WTO A;  5CR3 A;  2RBM A;  3BDO A;  5ISR A;  4B9W A;  1A2U A;  2A6E D;  1F2M A;  5JVH 3;  3D4D A;  1LTI D;  2F03 A;  3H09 A;  3NWT A;  3GTK B;  3HGB A;  4HMI A;  1YNN C;  3ONA B;  2X69 A;  1ICW A;  3GTO B;  3ZYY X;  1AZQ A;  2K5D A;  1H9J A;  2E2H B;  2SNM A;  1SE4 A;  1LO5 D;  4KY6 A;  1QIL A;  3AB9 A;  4GZY C;  3DWA A;  4S3S A;  1B9M A;  1ESR A;  1ZYR C;  4KJN A;  3I73 A;  5EBD A;  5F2D A;  3RZO B;  4V0B A;  5A35 A;  4O42 A;  4OL7 A;  5IT9 E;  1BQQ T;  2R3Z A;  3S9W A;  1BCP C;  3D31 A;  5C3W A;  1X32 A;  2HDM A;  3MC0 B;  2F0Q A;  1D5M C;  1JWM D;  1Y8N B;  1GUO A;  2VUM B;  1NR4 A;  3H3V C;  2ICI A;  5M3F B;  3M4Y A;  1MBY A;  1D5X C;  3OIP A;  3BVM A;  2ENB A;  1GXD C;  4KMU C;  1TS3 A;  1SMY D;  5FOB B;  4XYO A;  3VR6 A;  2NWG A;  3FVQ A;  4H0L C;  5JPN C;  4HED A;  3KF8 A;  5ELF A;  3HS0 C;  1PTO C;  4IUT A;  2PO4 A;  4LAA A;  3M85 A;  4OGQ C;  1LT5 D;  5A2Q L;  1VMP A;  4KN4 C;  2A6E C;  5KYL A;  3HOX B;  2K28 A;  3IFT A;  3DMU A;  5KRU A;  1TS2 A;  3K7A B;  3Q6S A;  4XYQ A;  1RCV D;  1K83 B;  2JP1 A;  2BA0 A;  2B2U A;  4L8J A;  3ND8 A;  3D4R A;  4BWG B;  5IGE A;  4BBS B;  1A3U A;  2J7Z A;  2C9O A;  2J0T D;  1WD0 A;  5IIF A;  2IWH A;  2EOT A;  5FLX L;  3ITP A;  4IN3 A;  4IZ8 A;  2NVX B;  2CHB D;  2WKD A;  2NTS A;  2EY2 A;  1RJT A;  5BN3 A;  1EU4 A;  1RTN A;  3M4O B;  2FJ2 A;  4WJW A;  4F88 A;  2KEC A;  3RMH A;  3N52 A;  1IW7 C;  1O7Z A;  2K33 A;  2I07 B;  4FO2 A;  3V2T A;  2L9H A;  1JIC A;  2EZV A;  1AW7 A;  4K8J A;  1KAA A;  2IL8 A;  3EQL C;  4KV6 A;  1O7L A;  1F2L A;  3GTM B;  1EQT A;  1LTG D;  1SMY C;  3L9A X;  3D8G A;  1JR0 D;  4CKB A;  4IUV A;  2TSS A;  2M2L A;  3FEW X;  1B2T A;  4B9X A;  1E2Z A;  1I3Q B;  3NPP A;  4HN7 A;  3QJY A;  4A3K B;  1I4Q A;  1QOH A;  3G7L A;  4TRD A;  2F0E A;  1VCI A;  4F7X A;  1JOQ A;  2B2T A;  1UUP A;  3MVV A;  1G91 A;  4RA8 A;  4KD3 A;  4H7B A;  2QF7 A;  2A5H A;  4DAP A;  1RKN A;  3D3R A;  2ICE C;  3MA2 B;  1LAB A;  1CQF A;  1HTP A;  1H9R A;  1EQV A;  1CZW A;  1PYW D;  1EOT A;  3DEP A;  1HCZ A;  1HPC A;  1KLG D;  2F0T A;  1EY0 A;  5I2Y A;  4XQJ A;  3M3Y B;  4HCS A;  1G6Z A;  1J9O A;  3MAQ A;  4CJ1 B;  3PUZ A;  2YU9 B;  2KHS A;  3LWU A;  3W2D A;  2DNC A;  2L55 A;  1WTW A;  4X3S A;  3HOV B;  5K5P A;  1UNS A;  4KD4 A;  1F9S A;  3DWQ A;  1Y8O B;  1D2B A;  1DZ1 A;  2LMC B;  1EU3 A;  5JEA H;  5C6A A;  3QOL A;  3GTQ B;  5M5Y B;  4A3D B;  2XRQ D;  5K36 H;  1L0Y B;  5DM7 3;  2A69 C;  2CW0 D;  3H94 A;  1QB5 D;  1PFN A;  4IUQ A;  1STE A;  4KKT A;  5CGK A;  1BDO A;  1ZEQ X;  1BO0 A;  4A3G B;  1A15 A;  4ZQ3 A;  2MP1 A;  1Y1V B;  3MXU A;  4ZUI A;  3TME A;  3TSS A;  5JEA J;  5CC4 A;  2G9D A;  1EIG A;  3MFG A;  1CZG A;  1GJX A;  1XYI A;  4DXF A;  1ET6 A;  5C4Z A;  1NR2 A;  1QE6 A;  3A7L A;  3S15 B;  4TQU S;  1FYC A;  4DU9 A;  1QWY A;  4DA2 A;  4ZK9 B;  1SNP A;  1Q8I A;  1EWC A;  5I6Y A;  4KN7 C;  3C3L A;  3RZD B;  2TMP A;  5I2X A;  3MWY W;  3T53 B;  1VF7 A;  1H9S B;  2XNA C;  4K5V A;  3VA5 A;  1AN8 A;  1EYD A;  2B2Y A;  3MTS A;  3BS1 A;  2JA8 B;  1HUN A;  2F3V A;  2F4I A;  4K6D A;  3S17 B;  2B2V C;  2R92 B;  1JQY D;  1V8Q A;  4RFB A;  3I90 A;  1CK1 A;  3OMC A;  1S5F D;  1LTA D;  2A68 C;  4WFN 3;  3S14 B;  1E2W A;  2X6G A;  4UDU C;  4K8I A;  3SK5 A;  2L5T A;  1SYC A;  2AWO A;  3PV0 A;  3PO3 B;  1NAP A;  3HEJ A;  3VYS A;  2JA7 B;  3DWP A;  1EY8 A;  3J7A F;  3M7G A;  3OW7 A;  4U68 A;  4NDX A;  5T1G A;  1XX8 A;  1ILP A;  3GTG B;  2DY8 A;  3OMG A;  4TSS A;  2PYK A;  5E1F A;  3K5N A;  4G7O C;  2FHT A;  1SNC A;  3VYU A;  4HTH A;  3NSW A;  4WRD A;  2E74 C;  1YNN D;  4M8A A;  1LAC A;  3OPO A;  1GUT A;  1WD1 A;  4OO1 G;  1MGS A;  1HRJ A;  1WTV A;  3DUZ A;  1PZK D;  1O78 A;  5COY A;  1CHP D;  1R4Q B;  2AWN A;  3VR5 A;  3F2U A;  1PRT F;  5DM6 3;  4TKO B;  1ZYR D;  2PCF B;  4G7H C;  1WTX A;  1HTL D;  4R8I A;  1I4G A;  4BY1 B;  1GHJ A;  1F77 A;  1ENC A;  1SYE A;  4ZAI A;  4FF1 A;  5KYI A;  4PQX A;  1R4P B;  1MD2 D;  4FXG C;  5FO8 B;  3SE0 A;  2WAC A;  1ENA A;  4C1N K;  1DYQ A;  3T13 A;  3E6Z X;  3NUC A;  4KHV A;  2XVS A;  2BOS A;  2O2L D;  3K59 A;  1Z47 A;  4KY5 A;  1WTP A;  4KK7 A;  1TII D;  4A3B B;  2QEJ C;  4K2L A;  2KOL A;  1U9R A;  2E2D C;  4J6H A;  3VA7 A;  1S4Z A;  1VF5 C;  1PFB A;  1IL8 A;  5KGU A;  4L63 B;  4B08 A;  3GP7 A;  5KIX A;  5M5X B;  5T1I A;  2RA4 A;  3D6W A;  1WTQ A;  4IUR A;  3DM1 A;  4RKB A;  2F0W A;  2HCI A;  3NQI A;  5CV7 A;  2OEO A;  1SNQ A;  1G2T A;  4C3H G;  3J81 E;  4RHS A;  1DD2 A;  1TY2 A;  5E4W C;  2N88 A;  2PNR C;  1R9T B;  5DNF A;  3VR4 A;  2NN6 G;  4XQN A;  3PUX A;  2K03 A;  1CI3 M;  1SFO B;  5G3L D;  4CBV A;  4KI0 A;  1IKL A;  3K5M A;  2Z8L A;  3CHB D;  4K6L A;  4RAU C;  3PIO 3;  3IFD A;  1U4L A;  1ILQ A;  2F0N A;  5M9O A;  3SR1 A;  2LS0 1;  3CRK C;  1SYG A;  4FXK C;  2EYH A;  5C0X I;  2F0H A;  1PTO F;  2CVR A;  3BYT B;  1H9K A;  2E2J B;  2NB0 A;  1DXM A;  3K5O A;  3EJI A;  2RKS A;  2PMZ B;  1MSG A;  2FMM A;  4PV1 C;  2K04 A;  4IFD G;  2MJ8 A;  2AQ1 B;  1SND A;  1Y8P B;  2F1M A;  4X3K A;  4L6T B;  2RVL A;  1I6V C;  4KY7 A;  3TDQ A;  5BN5 A;  5LL6 S;  4ZKB B;  4RGT A;  4QMG A;  1IW7 D;  2F0I A;  4BBR B;  2KED A;  4ZUJ A;  1AP0 A;  2MPM A;  1SNM A;  2B2W A;  2L11 A;  3LWE A;  5NUC A;  1JCK B;  3DHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...