4C3JG

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
309
structure length
259
Chain Sequence
NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVELGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
total genus 37
structure length 259
sequence length 309
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1060 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c3jG02
4C3JG 4C3IG 4C3HG
chains in the Genus database with same CATH superfamily
4P71A 1HNXL 1N32Q 3K58A 2JA5H 1JB7A 1GO3E 5FLXE 2UUBL 1Q8KA 4QUFA 2LXJA 1EWHA 4QUCA 3TRZA 2VUMH 1SFOH 5DM73 4K0KQ 1VQ8A 3ND8A 4EQ5A 1WTQA 3I4LA 1IHZA 4RFBA 5EQ0A 1Y1VG 1LTBD 1RODA 4KY7A 5GQOA 5DM63 1YHBA 1S5CD 2A8VA 3KFUA 3HP3A 2PCFB 2PPBC 2ASBA 2NN6H 3HOWG 1V1PA 1BKBA 1TY2A 1GKHA 3HKZG 4ZCKA 1NCVA 4J8QA 3U4ZA 1U0LA 1PFSA 1F77A 3HOZB 2EYHA 4RGTA 4G7HC 3I56A 3JAMc 4J1MA 2E2IB 3J80E 2F4VL 2AUJD 4QQBX 4J15A 3CF5A 2JA6H 2K5HA 1CKNB 2JSOA 2H4OA 2EPBA 4OEMB 3STBC 5FOBB 2HHHL 1LABA 4DKAC 3AYHB 3G7LA 3RLFA 1HPCA 3CXCA 2CWPA 3PO3H 4X62Q 1F2MA 1GUTA 3ICEA 2JYOA 3W1BA 3CMAA 4X6AH 1HUNA 4UP9A 3DUZA 3W3AA 3LNNA 5M5XB 1KRSA 1VQNA 1VQ9A 4H0LC 2UUBQ 1DCZA 2NVXB 1JR0D 1UUPA 5LMUQ 4DUYQ 2R6GA 2DN8A 2ZTEA 5CBEE 3N52A 1VQ7A 4L5TA 2E75C 2GVAA 2N3SA 1SNQA 2K50A 1TR5A 3NXWA 1JWMD 5C44B 1XMOQ 1VQ5A 3KLSX 3PO3G 1LYLA 2QCPX 3AQQA 2WP8J 4A3FH 4IOAA 1Q8IA 2QILA 5E3FA 1HTPA 4LF7L 3NELA 3RLOA 3VYUA 1E22A 2K28A 2BA1A 1LACA 2A74C 2TSSA 1SE2A 1C4QA 1EY8A 3GTQH 2KBNA 1BDOA 1YBYA 1IXRA 3NHHA 4CKCA 4DAYA 2ZJRA 1I50B 1TT2A 5EGTA 1HNWQ 5C44H 4OO1H 1W6KA 4C1NI 3PUZA 2KEDA 2ZTCA 4LFCL 4AYBB 1TQOA 2IX0A 4LF4Q 2Z6BA 5M3FB 3M4OB 1XMQQ 1G8ZD 3KDFA 1HZCA 4PMCA 3U58A 3GTOB 3BZDB 2RSOA 3PQIA 3S17H 3GTGB 2DY8A 1KABA 3VR3A 4LF8L 5D3DA 1PVOA 2Q8TA 1TS2A 4HIOA 1BBXC 1B9MA 2PNRC 3I4MH 3SXHA 4IUVA 3CD6A 1EY4A 2L0CA 2NTTA 3J80L 2YV5A 4LUVA 2K32A 2FHTA 5M5WB 3K0XA 5D65A 2XRSD 2WAQE 4JI0L 3A8IE 5FLXc 4ZQ3A 2MO0A 1XXGA 2KHIA 1MI2A 3GTOH 4C3IG 2KCCA 3U4VA 1SE8A 2I0QA 2MUYA 2BCOA 3OOCA 5C0XJ 1EQVA 2MNAA 1KRTA 1SNMA 2J7ZA 1X54A 2A6HD 1VF7A 4X66Q 1EWCA 3L3OC 5IYDH 3HKZE 4N8FA 4BWGB 4CDEC 1G51A 2NVQH 2N55A 1Y14B 1ESFA 3FP9A 3P7JA 4GKJL 5ELOA 4NMZA 5ELNA 4EQNA 3I72A 1ILPA 3MXNB 4NW2A 4A3FB 4EX5A 4C1NK 2SNSA 4QB4A 5JPNC 4BA1I 4JOIA 4KLKA 1FD7D 3KBGA 3HOVB 1VMCA 1K8GA 1CSQA 3TQYA 1A3TA 2HIVA 4X3TA 4DNIA 1MIUA 4BBRB 1KAAA 5JJZA 1G6PA 1TXYA 4IFDJ 1Z7TA 1I6HB 2YTXA 1UEBA 1L1OA 2A6ED 1V1PB 1HQRD 3F2CA 4HCEA 5EKIA 4LFAQ 3I73A 4UPAA 3BVGA 4R4TA 4I7ZC 3BS1A 3FPUB 3VR5A 5JEAG 2R92H 1KLUD 4JI3Q 2ZM6Q 1PH3A 2F0DA 4DFAA 2G5DA 2VW9A 1K9MC 2EY2A 4X3KA 2V1CC 1EY6A 1Q1BA 2NVYH 1F9PA 4PNYA 1PH7A 3OYYA 4RKLA 2MJ8A 1JC7A 1Q86C 1L0YB 2A6HC 5HY6A 5C5LA 3G6EA 5EJWA 2ZXRA 2RHQB 2VZAA 2EYMA 4WJ4A 4A3DG 1TWGH 5E4WC 4DNTB 1SDFA 2EXZA 1GUNA 2G9HD 1NE3A 3NSWA 2JEAI 4A3GH 4DNRB 4HMIA 1CHQD 4HIKA 5KGUA 3PF5A 2VS1A 4S3SA 3STBD 2OTJA 4P74A 1F2LA 4JOIC 1I94Q 2V4DA 2MQHA 4JBWA 1K8MA 1HH2P 2ES2A 1EU4A 2A69D 1Y1VB 2F0LA 4YCWA 1F2YA 3UE1A 4U673 1T5XD 3H94A 2PYKA 2B39A 3CPWA 4R4CA 3ND9A 3S14H 4XYOA 4A3IH 2A73B 1ENCA 2K01A 1R9TH 1IL2A 2PW7A 4IPGA 2QEJC 4IQZA 1IBMQ 1YHQA 1WTVA 2NZ1D 3GTGH 2KCNA 2WV6D 3CQZB 3PUVA 3J81L 4KHZA 2HCIA 3JAML 1IBKQ 4MN3A 3KF8B 4GNXC 4CDDC 1X3GA 4B3TL 1UE1A 5GAHC 4LFBL 3I4NH 3BVMA 1ESRA 4A3IB 4OXPA 2PI2E 2DGYA 1TWAB 3A54A 1QVFA 4A3DB 4KN7C 3GV3A 3Q8DA 3CAMA 2BOSA 1TVXA 3ER0A 1STNA 1G2SA 1A3UA 1V1OA 3PGZA 1VQ4A 1O7YA 4APVA 3PF4A 3RNUA 3H6MA 2HCCA 1I94L 5EBDA 1U5KA 4YY3L 1ICWA 2RHSB 1GJXA 4HJ7A 4FF4A 2FMCA 3T1YQ 3HOVG 3KLWA 2FJ2A 2JQOA 1QNKA 1SJHD 3NTIA 2K05A 2D62A 4JI7L 2MHVA 5C6AA 1Q3LA 1R4QB 3PIPA 1XTDA 5G3LF 2CH4W 5DAUA 2Z4HA 1PA6A 3DM1A 1QCBD 3D0FA 5BR8Q 3F1ZA 2RKSA 4BBSB 1Z47A 4NPSA 4I7AA 1EYAA 1SYEA 1X6OA 3E0JA 3I70A 3AFQA 3D3RA 3CCVA 1QILA 2EYOA 2IPKD 3A5ZB 3I4OA 4HR7B 3RZOB 2R7FA 4KY5A 5DNFA 2F0IA 3H0GB 1V8QA 1YNXA 1R4PB 1WOCA 5JAVA 1D8LA 4DUZQ 1U9RA 4LMQD 1I3QB 1O78A 1PFMA 1JORA 3J81E 4I65A 1J6QA 2UUCL 5JVG3 1IW7D 3MC0B 5JJKA 1E1TA 4GS3A 4JCVE 1QVGA 1H9KA 4EVOA 1EZ6A 4GOPC 3J81j 3QG1A 4PZ6A 5LL6X 2RVLA 2E8GA 2F0QA 4C3HH 1GUOA 2B8FA 1EYCA 2I07B 2E2IH 1AFPA 4LF9L 1B8AA 1PV4A 3ONAB 2A69C 5AJ3Q 1IYVA 4KD3A 4GZYC 3NP8A 2RSNA 1WCMH 2E2JB 1H9MA 3GTKH 2G9DA 4NXMQ 1XNQL 1MHWC 4WORA 3MXUA 2LFNA 3MZ5A 2EZVA 4L8JA 4MHEA 3S17B 2K5DA 5HGTA 3MXGA 4JI2L 4IUTA 1IBLQ 4JI1L 3D4WA 1S40A 2JA8H 4C3HB 4LFBQ 4ZUIA 4LUOA 4JI5L 2H5XA 4DR2Q 3NTHA 1YNJD 1RTNA 3VA5A 4G7OC 1NUCA 1BBWA 2UUCQ 1U4PA 2F0FA 1CHPD 3K7AH 2E2JH 3U9SA 1VQMA 5JPMC 3ULPA 1PRTB 1PYWD 4QIWB 5M3FG 3UDGA 1PTOH 1VQEA 4IUUA 5EBCA 1CA5A 2QDLA 4FF3A 4WRDA 3PIP3 3FKIH 2O5JC 3DMUA 3OWFA 3P75A 5FLMH 1XX8A 3SK6A 1GVPA 1SROA 3NWTA 1E24A 4A3EH 4CJ0B 2Z6KC 2DJFC 1PRTF 3WDNA 4WJ3M 1A6XA 4JBKA 3EBEA 3DLLA 1OTCA 1PDQA 3CKIB 3L0OA 3TP7A 4L5SA 5E4XA 1NMGA 2KJXA 1XNRL 3HOZG 3M7GA 1SSOA 1B4OA 1E3PA 5M5XH 1SMYD 5KEEA 1CQFA 1KTKA 1TIID 3CC7A 4HAEA 4M8AA 5FO9B 1RIPA 1SN8A 3BDCA 2Y0SG 1CZWA 5JOBA 2ALYB 4K0KL 3DWPA 3ZJYC 2RDHA 1KQSA 1HA6A 1H9JA 2L9HA 4TSSA 4K5XA 1CTMA 4DAYB 1RJTA 1WTXA 3M9BA 2XWJB 4KY6A 1JWUD 1JB3A 5KYIA 3T16A 4YWLA 1O7IA 1IW7C 2B2UC 2L11A 2PMZB 3BYYB 4GLVB 4JV5Q 3K6OA 3X3NA 5C4XH 1MKHA 3BG3A 1J8IA 1D5ZC 4LF8Q 4CDCC 2L4NA 1H9SA 3CCMA 2E5LQ 1Q46A 5IWAL 4DR4L 1FNUA 2K5VA 1DOKA 1AZQA 4G57A 1NR4A 4AQYQ 4TKOB 1OXSC 1X3FA 1F9RA 3L2PA 4OX9L 4DAVA 3S1QB 4OIJA 3CCUA 3UDFA 3O13A 4MNOA 4YIJA 1LTSD 1EEFD 2Y0SE 4B3SQ 4DA2A 5TSSA 1BO0A 1BR9A 4G4KA 4V190 1J5EL 3TEHB 2UXDQ 4HTHA 1G6ZA 3MTSA 4YHHL 3KOJA 2K52A 5IGGA 4A3KG 1IKMA 3HGBA 3FEWX 4OWTB 1WTOA 2AWNA 2TMPA 5CORA 1DJRD 1MJCA 1KDCA 3MFGA 4DR5Q 4IUPA 1E2VA 1B1ZA 3M7NA 3Q0AA 1ENFA 2IX1A 4R4OA 1E2ZA 4XQNA 1JICA 1DZ1A 1S5DD 1SYGA 5J22A 1E2WA 4LF6Q 1R9TB 1HJPA 2EY1A 3AFPA 3KF8A 4V0BA 3QWNA 3UDXA 4GLXA 1BF4A 4G7ZC 3GTQB 1SR3A 4H7BA 2I5MX 2NVYB 4DGZA 4H44C 1X55A 2E2HH 5BN4A 2F0NA 2N88A 3S16H 1E7ZA 3PIOA 4P75A 3OIPA 3SE0A 1KD1C 2ZTDA 5EKLA 5C4ZA 1LT6D 1A2UA 5F2DA 1OXUA 4Y7NB 3J7A5 1TWGB 5IGCA 3I91A 4R4IA 3SR1A 1K8AC 3F2BA 1UNSA 4QGUA 4YCUA 1TWAH 4QY7A 4A3BH 3TP8A 4JG2A 5HURA 1EU3A 3RZDB 1GUSA 1FR3A 3L9AX 2AKWB 2I46A 1C48A 4DR2L 1K73C 2WAQB 3CCEA 1HFGA 1XPRA 4RMFA 4AQYL 5LHY1 4DPGA 2JJQA 1DM0B 1TY0A 1VMPA 1IYUA 1QOHA 3SGIA 2R7DA 4C56C 5BR8L 1WI5A 3OTOQ 2O4XA 3LGJA 3PV0A 5EPKA 3S1NH 3TS0A 4RAUC 1GHKA 1DXMA 3Q6SA 5IGDA 1YVCA 5FJ8H 3RZDH 3NEMA 1RF2D 3M4PA 4RH6A 2J4XA 4PMWA 2F0TA 2HQEA 2UXBQ 3TDQA 4XYQA 5T1IA 1T9HA 1D1KA 5IP7G 3EJIA 4LW1A 1VQKA 2WKDA 1AE2A 2HQLA 5KNCA 4JI6L 4A76A 2F3IA 4LK1C 5CV9A 3S1MB 1K0RA 3NK9A 2JA8G 1PRTC 2HIXA 4FVMA 2F0JA 4RA8A 4O42A 3A55A 3HEJA 3HOYH 2MGSA 5CMDA 1JOQA 5NUCA 1HXYD 4QJFA 2EYPA 2XN9C 1PH2A 4B3SL 5IGFA 1YNND 1T5EA 5GAEC 3IKJA 2X6LA 5AJ3L 5IY0A 4DXFA 2L15A 5C3EB 2CQAA 4XTCS 1NNXA 1QZHA 2Z9HA 1KNAA 3BZCA 2F0MA 2AQ3B 4A3KB 1HHVA 2NZHA 2R61A 5DEHA 3HOXH 4GNXA 1PH1A 3CCQA 2JA9A 4LF5Q 1DYQA 4CGYB 1RD9D 2EXDA 2KCTA 2N8NA 3NENA 3UDIA 3QJYA 1Q90A 1M8AA 1WCMG 1N34Q 1PZJD 2C5CA 4UAIA 2B2UA 4DR7Q 1Y1VH 4LF4L 3A74A 1P16A 4A93B 2RDFA 5AFWA 4A93G 1NTGA 3FDTA 3N6RA 2MP1A 3PCOB 2F3WA 2VB2X 2K4KA 3D6WA 5M5YH 3EIVA 4KJOA 1LT3D 2RA4A 4K2LA 4X66L 5IT9c 3AU7A 4FO2A 5JEAH 2ZJPA 2R92G 3PUYA 5C0XH 3PO2H 2KUMA 2QDBA 2XRQD 3GDEA 5A2QL 1HR0Q 1BVSA 1CSPA 2JEBI 4R4QA 3EA6A 3DHQA 2NZOA 4JBMA 3OWEB 5IYDG 5IYCH 1H95A 3TREA 2OT2A 5M3FH 1CFMA 4PMBA 1KDAA 2EJFC 5IT9L 4IFDI 1A0IA 2F4IA 2K03A 5JJIA 4QMGA 1RTOA 4GKKL 3FKIG 4RCNA 2A68D 3H0GH 1SFOB 5ELDA 1B2TA 1XPUA 3OMGA 1LTAD 2B63H 2IX3A 1L1OB 1CKMA 2QF7A 4YWMA 3OW2A 1K3BC 1BOSA 1TS4A 1YJWA 2QEXA 5M9OA 1ASYA 2PNHA 2BA0A 2PI2A 5JEAJ 4A3EB 2IHEA 3TBIB 3TP5A 3DWQA 1STBA 3CU7A 1GM5A 2JXMB 4A3IG 2EE1A 1EY0A 4XDXA 2D2CC 1IYJB 3MHBA 2HDLA 4ZYSA 1X3EA 2Q2TA 1SNPA 2JA6B 4WJWA 1I4HA 2BE5D 4OO1I 3ULJA 1PXUA 3S24A 2E5LL 1TS5A 3H09A 4P72A 2KCMA 4BY7G 2DUDA 2IJ0A 2NBFA 3S1NB 3C1FA 3KYHC 4BY7B 1ET6A 4A3LG 4NXNQ 4K6LA 3CMEA 4A3KH 1C8CA 3S9WA 3K7UC 5H1SE 4ZRZA 4O1NA 1LTGD 3NQTA 2D0OA 3BU2A 1XNQQ 2WB1E 5T1GA 5C44G 3I4NB 2EQSA 1VS0A 2ZT9C 2UUAQ 2XGTA 1ZXTA 1ENAA 3PIO3 2JA5B 3H3VH 2IHFA 4PQXA 1Y8NB 5EKKA 1QE6A 1FNWA 4HJ8A 5IT9E 4DV4Q 3MFYA 3MAQA 5I2YA 4FXDA 1STAA 3KK7A 2B2YA 5LMNQ 4JI4L 3CPFA 2AQ1B 1EYDA 1V1QA 4KHVA 2X69A 3S2DH 3GTKB 2R7ZH 2AMCB 4CJ1B 4Y7NH 2I5HA 5JVH3 3CRKC 1OO9B 5ISRA 3KUPA 2JA6G 2VXWA 1D5XC 4ME3A 1G91A 2HHHQ 3MVVA 4KN4C 4JK1C 3T1HQ 5M3MG 1I50H 4NXNL 2L1BA 1YZ6A 1B70B 3K5LA 2JN4A 2Q8RE 3LX0A 3TS2A 4HSVA 5CR3A 2QKIC 4LAAA 4OHJA 1Q7YC 1SNDA 1QB5D 2IT1A 4XT1B 4AH6A 3R93A 1GUGA 4B3ML 3PO3B 3QO2A 1JT8A 3EQLC 2NTSA 1S5FD 3HS0C 1LM0A 3W5OA 2OXPA 1PH9A 2WACA 2A68C 2E76C 1U4MA 1QWYA 5IGEA 1ILQA 1YHAA 4DV4L 4IFDH 3PUWA 2PQEA 4ZKCB 4CBVA 3I3CA 5LMNL 4C3HG 2FFKB 1TWHB 3QOLA 5C4JH 2ENBA 3NBHA 3P20A 3PUXA 3GTJB 1YNNC 5I2XA 1QZGA 2L55A 4DV1L 1EIFA 1N32L 1MJEA 1IL8A 2HD3A 4PZ8A 2XSCA 1VCIA 1YNJC 2KENA 4JBJA 5E7NA 4A3CG 2HUGA 2Q8IB 2OCEA 1VQPA 4BY1G 4KKTA 4DV1Q 3CC2A 1LO5D 1TWCH 1L2FA 4HIDA 5M3MB 2PZUA 5J39A 2MPMA 3KBXA 1CI3M 3IRBA 5C4JB 3T1HL 4ZLTF 1VQCA 2IWHA 4KK7A 3CC4A 2R93B 3VA7A 1A63A 3F8TA 2NWGA 1S72A 3NQIA 4ZUJA 1CT1D 4TQUS 1GOZA 3OW7A 4CHTB 2JA8B 3TP6A 2JA7G 1WTRA 2UU9L 2CCZA 3FKIB 4DR6Q 3OPOA 3PMFA 4FF1A 3J7YW 3C46A 1YEZA 4FDBA 2K33A 3VYSA 5IP9H 2RF4A 2FXQA 1YIJA 1W6JA 3BDOA 1S5BD 2EYLA 3E9HA 1GUWA 2KVMA 5J1ZA 3L7ZC 5EPJA 4LF7Q 1EWIA 5C0XG 3CCRA 1Q12A 1UE6A 2AUKA 1SLJA 1A8VA 1WFQA 2X6GA 3OSOA 1YI2A 4KHPQ 1EFWA 4F8MA 1D6EC 1K0SA 1A15A 2C35B 4LF6L 2C9OA 2AWOA 1CK1A 2FINB 1SAPA 3VYRA 4POFA 3HOXG 3S1QH 3H15A 4BS9A 1OXVA 5C3XA 2PW5A 4HN7A 4K6DA 1M90C 3OTOL 3HOUH 4DV7L 3T4AC 2NVTH 5GROA 1F2ZA 5G3LD 3MEFA 4YY3Q 3U50C 4A3FG 3SK8A 3MEHA 3D4DA 1FNVA 1Q1EA 1STYA 2B2TC 1PTOC 1X32A 2EIFA 3S2HB 1HZAA 3UI2A 2CQOA 2JA7B 2M00A 4A3GB 2A19A 3NWSA 3EFXD 2KA7A 1I6VC 1JE5A 2YU9H 4OX9Q 2IL8A 3HOWB 4L63B 2Q2IA 2L5TA 1B3AA 5IWAQ 2H1EA 5CBAE 4JI0Q 4OO1G 2A5HA 1LTID 4OONA 5CV7A 3HOUG 3J81i 2NYZD 3HG9A 5ELFA 1VQDA 4NKLA 2B2VC 3KF6A 4LF5L 5K36H 3S16B 3G4SA 4L5QA 3H0GG 4C3JH 5IP7H 2A6EC 1L0WA 1CA6A 1HNZQ 4BXXH 1HA5A 4BBRH 1C0AA 1VQ6A 1X9NA 4ULLA 3I4MG 3CQZH 1XMQL 5JJLA 3MXPA 1WJJA 1AN8A 3WWVA 4A3BB 2WB1G 4XQQA 3J80i 1V43A 4HEDA 1FJGQ 3HOYB 4N9PA 1Q82C 3IFDA 3HFZB 3HOYG 2EY5A 1JQYD 2EJMA 2GA4B 4XT3B 1ML0D 1PH4A 4RGOS 5I9PA 3H91A 2B2TA 2R3ZA 4HJAA 1BXTA 4CDFC 1JOOA 1WYDA 2B29A 1EOTA 2OEOA 1WD1A 2PQAA 4KI0A 4A3GG 1N36Q 5M5YB 1EUJA 2XWBB 3T53B 1KDBA 1EYGA 3HKZB 4DR3Q 3A56A 1I4XA 2L12A 3CP0A 3CCJA 4A4IA 4O2DA 2Z4IA 3ERSX 4DV5Q 4A3MH 3SDZA 2GN5A 3SK4A 2EYFA 2ZM6L 5C4XG 4JI3L 1EL0A 5CC4A 3DWAA 5C4XB 1S5ED 4B3RL 1BCPF 4HSPA 5KNDA 4YHHQ 4GOPA 2F03A 4L5RC 3K5NA 1QUQA 3JAMi 4DK1A 4K5VA 3S15B 1FJGL 1HNXQ 4JYAQ 1SNOA 4HCSA 5C3EH 4AYBG 1EIYB 1LUZA 3WOFA 1D7QA 5IYCG 1I4PA 1B7YB 2K1BA 4K8IA 1NY4A 3G71A 1ONLA 2BDNA 4IPCA 4QIWE 2VL6A 4PG3A 4DR4Q 3D8GA 1HFNA 2YTYA 4HJ5A 1PZID 1NR2A 1I3QH 4B9XA 2B3GA 3HRZC 3K0YA 2UXCL 2KQ3A 2F0SA 1KL9A 1WD0A 2GVBA 5I9OA 1V9PA 3QB3A 4U68A 2R7ZG 2KECA 2F4VQ 4DR3L 3KJPA 1D2BA 4LUZA 5A35A 2I5LX 1STHA 3BJUA 1XNRQ 1HRJA 2K5NA 1PMRA 1EQQA 1UAPA 1SYCA 3E0EA 4DR5L 4YWKA 4IURA 2ID0A 4CJ2C 2UXCQ 3GTPH 1SJED 3TN2A 4A3CH 4GN5A 3AB9A 3S1MH 4BBSG 1QG7A 3KLRA 4KKSA 2A1AA 1O80A 1VQJA 2E2DC 4DV3L 1F9SA 1EQTA 2ATWA 1RDPD 5C4HA 1WTWA 3IAYA 2EOTA 3J81c 1LT4D 4E6IA 1W2BA 3I90A 5KIXA 3GTLB 4F87A 1K83B 4JYAL 5LMNW 2LSSA 3VR2A 4C2MH 2CH4A 4F7XA 2F3VA 3J7AF 1P8LA 1C7YA 4IFDG 3T13A 4AYBE 2HT1A 3D6CA 4A3LH 3A7AB 1XYIA 3A5UA 1JE4A 2VNUD 3T51B 3R2TA 4O0AA 1XTCD 3M3YB 3MXNA 4KHPL 5CV6A 4XXEA 4BBSH 4KV6A 1TWFH 1OXTA 3SEBA 1BCPB 4EQPA 3GTJH 3GO5A 3TMEA 2R93G 3A8JE 3RZOH 2R7ZB 4RWSC 3ZYYX 3IL8A 3D31A 1AP0A 1N36L 3AEVA 1EY7A 2WIIB 3PO2B 3I4NG 4YCVA 4P2CB 3RUZA 4JI4Q 4XQJA 1CQVA 4JW0A 2LY7A 2JA5G 4IN3A 4N9TA 1VQGA 1VF5C 3M4YA 1NMFA 5I6WA 4DV2Q 3K5OA 3ULLA 3SHLA 4OGQC 4B3RQ 4FXGC 4LWCA 1W3SA 3M4OH 5I6YA 5KNBA 2DY7A 1XJVA 3FVQA 1CKOA 1H9SB 4R8NA 5ELEA 5FKAC 4JI2Q 4K8JA 1X65A 1VDZA 2JP1A 3DXJC 1VQOA 1I6HH 1Y1WB 1D1IA 1J9OA 2XVSA 2RDGA 1Y1WG 3F2UA 2WKCA 3QOJA 2B63G 4DAPA 3Q24A 2WB1B 5M5WH 2NUCA 2E74C 2NB0A 1KAWA 3DEPA 3S14B 1BQQT 2KHSA 5L37A 5LMUL 1D5MC 2Z1CA 4LF9Q 2MFIA 1SYBA 1WTHA 5D3IB 1ZEQX 5GADC 4LNQA 1SXTA 5FO8B 3CCLA 1HR0W 2F0KA 4AIMA 1BNZA 2NN6I 1Y69U 4DV6Q 4IUNA 4FYDA 1N9WA 4XIGS 4UDUC 1EQRA 1Z6HA 4A93H 4FP5D 1Y8PB 2CFMA 1ICFB 4Q0FA 3R8BA 4B08A 3I55A 1VQHA 2ZXPA 4UP7A 2VQEQ 3J7AV 2PQAB 2WAQG 4JI8L 4C2MB 2O5IC 4DUZL 2NVXH 1U4RA 2JE6I 4GLAC 4R9WA 5KRUA 4UP8A 1UE5A 3UE0A 2DNEA 2B2VA 3Q22A 4X3UA 4BY1H 3V05A 2BE5C 1I4GA 4QCLA 1DOLA 4DV3Q 1PZKD 1FYCA 1PYBA 1FVIA 4IO9A 2BH2A 1EIGA 1G291 5ELCA 4JPBW 2CWAA 2K14A 3GQBA 1MSGA 1JJ2A 4ODGA 3HOXB 1ASZA 3GTPB 4GOPB 1GHJA 4RHSA 3KF6B 4NP5A 5C3WA 4A3BG 1CZGA 4DU9A 4DK3C 3K80C 4POGA 1X3QA 4A75A 1KLGD 1TWHH 4QF4A 4TVAB 1BUVT 4C3JG 3QR8A 4BXXG 2RCFA 1NSNS 2IW3A 2SEBD 4OIKA 1HR0L 4B9WA 4Y52H 4A3MG 3BDLA 2WINB 4RHRA 3BYTB 1LTLA 2K7VA 3K59A 4JI8Q 1EOVA 3FHWA 1IBML 2F0UA 3K7AB 1L1OC 4ILWA 2HDMA 3NPPA 4X64Q 2VUMG 4A3JB 1B9NA 1KNEA 3OIQA 1JJGA 2LKVA 5J3BA 4B3MQ 5FJ8G 3V2TA 1VQBA 1HNZL 2KHJA 2K75A 1MBYA 5M3MH 4PV1C 2WFWA 3ITPA 4BA2I 1QJOA 1YITA 2KOLA 1RKNA 4K5WA 5IODA 5C0XI 1IBLL 4X3SA 3VDYA 2Z0SA 4CKBA 1KXLA 1ZYRC 1A62A 1IBKL 2F0GA 4IJHA 1TS3A 1HUMA 2PO4A 4GKJQ 5IIFA 1HNWL 3M85A 3I4MB 3VR4A 1JJCB 1YJ9A 1B53A 2QGQA 3GP7A 4RCOA 3DEOA 1KIXA 4MTNA 1L0XB 4RGMA 1SYFA 2BH8A 3A0JA 4KJNA 4DV0L 4JI6Q 3CCSA 4ZKBB 4C3JB 3HOZH 4JC0A 2NVQB 4DR1L 5BN5A 2F0HA 1C9OA 1N33L 2F0WA 3FPPA 5IYBG 4ALPA 1PFNA 2JK8A 3RLNA 4IUQA 5D14A 3S15H 1VQLA 1TU2B 2AHOB 3EVQA 5C5MA 3URYA 1VQIA 4HMJA 1AEXA 1PLFA 3EROA 3RR5A 4A3JG 1EZ8A 3DM3A 2DNCA 3I2ZA 3C2PA 4B3TQ 1PYSB 3CRLC 2DJGC 2N49A 3K8AA 4OWXB 4OWWB 1N33Q 2SOBA 3F2DA 3K81C 2CKZB 2LMCB 2YTVA 4F88A 4JVZA 3D4RA 1PTOB 1BBUA 1FGUA 4X65Q 4NDXA 1IKLA 1CUKA 4RKBA 2K5QA 3Q23A 2Y0SB 3A7LA 1PH5A 2JA7H 3JAME 2ICEC 5A2QE 1Q81C 2YU9B 4MTKA 3R2IA 4GNXB 5FK9C 4MZ9A 1M1KC 4KTAA 4IALA 3X3MA 2R93H 3MWYW 2EJGC 2KEEA 2PZWA 4ME5A 5CGKA 2UU9Q 4IPDA 2OTLA 2F1MA 3E3XA 4DR1Q 3W2DA 5IGBA 1KC8C 1PH8A 2EY6A 4FNFA 3GTMB 1M4VA 4FXKC 2ZXOA 2Z8LA 3S2DB 2UUAL 4A3MB 1ET9A 1PTOF 1S4ZA 2O2LD 2D5DA 1LV9A 5KYLA 1MGSA 4DV7Q 1PFBA 2CW0C 4L6TB 1PTOD 2SDFA 3B6YA 2ZJQA 5DLQE 2NVTB 1SMXA 1YJNA 2VUMB 4C3IB 3GD7A 4JI7Q 1G2TA 2F52A 4M1UB 1Y1WH 1ZKOA 3LWEA 3T1YL 2Q2UA 1X56A 1TWFB 3IFTA 3FRPB 1O7ZA 1SE4A 3GTMH 3H3VC 4IZ8A 4WFN3 1LTRD 4RGNA 1RHPA 1I4QA 1LLRD 1EY9A 2PMZE 1FL0A 2NN6G 4ABNA 3HOWH 4BY7H 1IZ6A 2B8GA 1EY5A 1HQMC 3P1HA 3S1RH 4LFCQ 2F0OA 1BCPD 4X62L 3A8KE 1EIHA 1SYDA 1X3PA 3VYTA 4DV6L 2LXKA 2B2YC 5K5PA 2VY3A 3RN5A 5IP9G 2R92B 3E9IA 3AMUA 1E0BA 2ICIA 1SEBD 1RCVD 2LS01 3W1GA 1K83H 3JC66 2VQFQ 4JV5L 4KMUC 1PRTD 4Q5VA 2VQFL 1QVCA 3SK5A 1A3VA 4IOCA 2QW7A 2K04A 4P73A 3U9OA 4BBRG 3M4QA 2QA4A 5IOCA 3S1RB 2VQEL 4GKKQ 2J0TD 2D0PA 1DONA 3M3YH 3QIAA 1XMOL 1QNUA 1UE7A 5EAYA 3PO2G 5LL6S 3FMCA 2M9VA 1AW7A 4N8X1 1LTTD 3HZXA 1HTLD 4TRDA 1GD7A 3GV6A 3KLSA 1N8RC 1H9RA 5E1FA 4EQOA 2CVRA 3NTKA 4ZAIA 3LWUA 1JCKB 4R8IA 2OQKA 2F0EA 3RD4A 3HOUB 2MO1A 1Y8OB 3NUCA 1U4LA 3RN2A 1CKNA 2P5ZX 1J5EQ 3BVZA 1AZPA 1NAPA 2CW0D 2XIWA 4OL7A 4LFAL 4DK0A 1B50A 2E2HB 3WOEA 1RL2A 2EDGA 4DK6C 4DV5L 4DN4M 3K5MA 5IE8A 2UXBL 4NB3A 1NBWA 1PH6A 1GXDC 1N34L 1EEID 5FLXL 1XPOA 2XNAC 3CHBD 4FF2A 1JOKA 3PSIA 1LT5D 1B44D 4RG1A 1O7LA 2Q2HA 3H3VI 4UHVA 1NJIC 2AQ2B 4GN4B 1HZBA 1UWVA 3SVMA 2Z6KA 4DUYL 3E6ZX 3OMCA 4K14A 4C3IH 1OXXK 3MA2B 4MIUA 4Z9CB 1TKWB 4DXGA 4KKUA 4HJ9A 5K36G 5CV5A 1STEA 1I5FA 3TSSA 3NBHB 1STGA 4DF7A 2IY5B 3I7FA 2RQXA 3C1EA 1B3QA 4PZ7A 2OWOA 3R3OA 3VR6A 1K28A 1VQAA 3I8ZA 1VQFA 2B2WC 4HIMA 2OF1A 4X64L 1MSHA 4IPHA 4DR7L 1JWSD 4KD4A 1HZ9A 4JI5Q 3ERQA 2PZTA 2XTIA 5FLMG 5CV8A 1WVLA 2EVBA 1XWEA 2K6AA 4QL5A 4DV2L 4A3EG 5CYUA 3HKSA 2RBMA 3G48A 5ELBA 1WCMB 3T56B 1BCPC 1FGBD 2EYJA 4ID6A 1MD2D 4NXML 4J6HA 4LJZC 1AH9A 2N78A 4R1JA 5IYBH 1SE3A 4H13C 3NBIA 2FMMA 1I4RA 3CW2C 2VB3X 2B63B 4GN3B 1AE3A 3KJOA 5I4DA 1SMYC 2M2LA 1EFID 3KDFB 1CM9A 3J80c 3EN2A 1DD2A 5GAGC 2SNMA 5CV4A 3V96A 4BY1B 1SNCA 3G6JB 1DOMA 1A2TA 3C3LA 3GTLH 2K5WA 1JMCA 1KHIA 2RCNA 1SRUA 2F0VA 4H02A 3BZKA 3RMHA 4DV0Q 2UXDL 1Z9FA 1ZYRD 3J7ZC 1HCZA 5HGQA 1QUQB 1F9QA 1TWCB 2F0PA 1WTPA 2B2WA 2CHBD 4DR6L 5C3EG 3TZDA 4ZK9B 1SBBB 1UEAB 5COYA 1PHJA 4DAMA 4K2KA 4CKEA 4UY8C 3HOVH 5EPLA 2OQ0A 3OHXC 3E5SA 4A3DH 2D9UA 1K3RA 4X65L 5BN3A 1E1OA 4JI1Q 3NE5B 1DGSA 3TZUA 4EGVA 5FO7B 1K8OA 2YYZA 4IJLA 4A3JH 3K57A 1S3OA 2BDOA 3S2HH 4OELB 1II3A
chains in the Genus database with same CATH topology
3K58A 5FLXE 4QUFA 1EWHA 4QUCA 5DM73 3ND8A 1WTQA 3I4LA 1IHZA 4RFBA 5EQ0A 1LTBD 1RODA 4KY7A 5DM63 1S5CD 3HP3A 2PCFB 2PPBC 2NN6H 1V1PA 1TY2A 1NCVA 4J8QA 1F77A 3HOZB 2EYHA 4RGTA 4G7HC 4J1MA 2E2IB 3J80E 2AUJD 2JSOA 2H4OA 2EPBA 5FOBB 1LABA 3G7LA 3RLFA 1HPCA 1F2MA 1GUTA 2JYOA 1HUNA 3DUZA 3W3AA 3LNNA 5M5XB 4H0LC 1DCZA 2NVXB 1JR0D 1UUPA 2R6GA 2DN8A 5CBEE 3N52A 2E75C 1SNQA 1TR5A 3NXWA 1JWMD 5C44B 3KLSX 2QCPX 2WP8J 1Q8IA 2QILA 5E3FA 1HTPA 3VYUA 2K28A 2BA1A 1LACA 2A74C 2TSSA 1SE2A 1C4QA 1EY8A 1BDOA 3NHHA 4CKCA 4DAYA 1I50B 1TT2A 5EGTA 4OO1H 1W6KA 4C1NI 3PUZA 2KEDA 4AYBB 1TQOA 2IX0A 5M3FB 3M4OB 1G8ZD 4PMCA 3GTOB 3BZDB 2RSOA 3GTGB 2DY8A 1KABA 3VR3A 5D3DA 2Q8TA 1TS2A 1BBXC 1B9MA 2PNRC 3SXHA 4IUVA 1EY4A 2L0CA 2NTTA 3J80L 2K32A 2FHTA 5M5WB 5D65A 2XRSD 3A8IE 4ZQ3A 1XXGA 1MI2A 4C3IG 2KCCA 2MUYA 2BCOA 3OOCA 5C0XJ 1EQVA 1SNMA 2J7ZA 2A6HD 1VF7A 1EWCA 3L3OC 4BWGB 2N55A 1ESFA 3P7JA 4NMZA 4EQNA 3I72A 1ILPA 4NW2A 4A3FB 4C1NK 2SNSA 4QB4A 5JPNC 4BA1I 1FD7D 3KBGA 3HOVB 1VMCA 1A3TA 4X3TA 4BBRB 1KAAA 5JJZA 4IFDJ 1Z7TA 1I6HB 2A6ED 1V1PB 1HQRD 4HCEA 5EKIA 3I73A 3BVGA 4I7ZC 3BS1A 3FPUB 3VR5A 5JEAG 1KLUD 2F0DA 4DFAA 2EY2A 4X3KA 1EY6A 1Q1BA 4PNYA 1F9PA 4RKLA 2MJ8A 1JC7A 1L0YB 2A6HC 5C5LA 5EJWA 2ZXRA 2EYMA 5E4WC 4DNTB 1SDFA 2EXZA 1GUNA 2G9HD 2JEAI 3NSWA 4DNRB 4HMIA 1CHQD 5KGUA 4S3SA 1F2LA 2V4DA 4JBWA 1K8MA 1EU4A 2A69D 1Y1VB 2F0LA 1F2YA 4U673 1T5XD 3H94A 2PYKA 2B39A 3ND9A 4XYOA 2A73B 1ENCA 2K01A 2PW7A 2QEJC 4IQZA 1WTVA 2NZ1D 2KCNA 2WV6D 3CQZB 3PUVA 3J81L 4KHZA 2HCIA 3JAML 4MN3A 3BVMA 1ESRA 4A3IB 1TWAB 3A54A 4A3DB 4KN7C 3GV3A 2BOSA 1TVXA 1STNA 1G2SA 1A3UA 1V1OA 1O7YA 3H6MA 2HCCA 5EBDA 1ICWA 1GJXA 4FF4A 2FMCA 2FJ2A 1QNKA 1SJHD 3NTIA 2K05A 2D62A 2MHVA 5C6AA 1Q3LA 1R4QB 5G3LF 5DAUA 2Z4HA 3DM1A 1QCBD 2RKSA 4BBSB 1Z47A 1EYAA 1SYEA 3E0JA 3I70A 3D3RA 1QILA 2EYOA 2IPKD 3RZOB 4HR7B 4KY5A 5DNFA 2F0IA 3H0GB 1V8QA 1R4PB 5JAVA 1U9RA 4LMQD 1I3QB 1O78A 1PFMA 1JORA 3J81E 4I65A 5JVG3 1IW7D 3MC0B 1H9KA 4EVOA 1EZ6A 3QG1A 5LL6X 2RVLA 2F0QA 1GUOA 2B8FA 1EYCA 2I07B 1AFPA 3ONAB 2A69C 1IYVA 4KD3A 4GZYC 3NP8A 2RSNA 2E2JB 1H9MA 2G9DA 4WORA 3MXUA 2LFNA 3MZ5A 2EZVA 4L8JA 4MHEA 3S17B 2K5DA 5HGTA 3MXGA 4IUTA 3D4WA 4C3HB 4ZUIA 3NTHA 1YNJD 1RTNA 3VA5A 4G7OC 1NUCA 1U4PA 2F0FA 1CHPD 3U9SA 5JPMC 1PRTB 1PYWD 4QIWB 1PTOH 4IUUA 1CA5A 5EBCA 4FF3A 4WRDA 3PIP3 2O5JC 3DMUA 3OWFA 3P75A 1XX8A 3SK6A 3NWTA 4CJ0B 1PRTF 3WDNA 1A6XA 1PDQA 3CKIB 3TP7A 5E4XA 2KJXA 3M7GA 1SSOA 1B4OA 1SMYD 5KEEA 1TIID 1CQFA 1KTKA 4HAEA 4M8AA 5FO9B 3BDCA 1CZWA 5JOBA 3DWPA 2RDHA 1HA6A 1H9JA 2L9HA 4TSSA 4K5XA 1CTMA 1WTXA 1RJTA 2XWJB 4KY6A 1JWUD 1JB3A 5KYIA 3T16A 2B2UC 1IW7C 2L11A 2PMZB 3BYYB 3K6OA 3X3NA 3BG3A 1J8IA 1D5ZC 2L4NA 1H9SA 1FNUA 1DOKA 1AZQA 4G57A 1NR4A 4TKOB 1OXSC 1F9RA 4DAVA 3S1QB 4OIJA 3O13A 4YIJA 1LTSD 1EEFD 4DA2A 5TSSA 1BO0A 1BR9A 4G4KA 4V190 4HTHA 1G6ZA 3MTSA 5IGGA 1IKMA 3HGBA 3FEWX 1WTOA 2AWNA 2TMPA 5CORA 1DJRD 1KDCA 3MFGA 4IUPA 1E2VA 1B1ZA 3M7NA 3Q0AA 1ENFA 2IX1A 1E2ZA 4XQNA 1JICA 1DZ1A 1S5DD 1SYGA 5J22A 1E2WA 1R9TB 2EY1A 3KF8A 4V0BA 3QWNA 1BF4A 4G7ZC 3GTQB 4H7BA 2NVYB 4DGZA 4H44C 5BN4A 2F0NA 2N88A 3OIPA 3SE0A 5EKLA 5C4ZA 1LT6D 1A2UA 5F2DA 1OXUA 4Y7NB 1TWGB 5IGCA 3I91A 3SR1A 1UNSA 3TP8A 5HURA 1EU3A 3RZDB 1GUSA 1FR3A 3L9AX 2I46A 1C48A 2WAQB 1HFGA 5LHY1 1DM0B 1TY0A 1VMPA 1IYUA 1QOHA 4C56C 2O4XA 3PV0A 5EPKA 4RAUC 1GHKA 1DXMA 3Q6SA 5IGDA 1RF2D 4RH6A 2J4XA 4PMWA 2F0TA 2HQEA 3TDQA 4XYQA 5T1IA 1D1KA 3EJIA 2WKDA 5KNCA 4LK1C 5CV9A 3S1MB 3NK9A 1PRTC 4FVMA 2F0JA 4RA8A 4O42A 3A55A 3HEJA 2MGSA 5CMDA 1JOQA 5NUCA 1HXYD 2EYPA 2XN9C 5IGFA 1YNND 1T5EA 3IKJA 2X6LA 4DXFA 5C3EB 2CQAA 4XTCS 1KNAA 2F0MA 2AQ3B 4A3KB 1HHVA 2R61A 5DEHA 1DYQA 4CGYB 1RD9D 3QJYA 1Q90A 1M8AA 1PZJD 2C5CA 4UAIA 2B2UA 4A93B 2RDFA 5AFWA 3FDTA 3N6RA 2MP1A 2F3WA 2VB2X 3D6WA 1LT3D 4KJOA 2RA4A 4K2LA 3AU7A 4FO2A 5JEAH 3PUYA 5C0XH 2KUMA 2QDBA 2XRQD 5A2QL 2JEBI 3EA6A 3DHQA 3OWEB 2OT2A 1CFMA 4PMBA 1KDAA 2EJFC 5IT9L 4IFDI 2F4IA 2K03A 4QMGA 1RTOA 4RCNA 2A68D 1SFOB 5ELDA 1B2TA 3OMGA 1LTAD 2IX3A 2QF7A 1TS4A 1BOSA 5M9OA 2BA0A 5JEAJ 4A3EB 3TBIB 3TP5A 3DWQA 1STBA 3CU7A 2JXMB 2EE1A 1EY0A 4XDXA 2D2CC 3MHBA 2HDLA 4ZYSA 2JA6B 1SNPA 4WJWA 1I4HA 2BE5D 4OO1I 1PXUA 1TS5A 3H09A 2IJ0A 2NBFA 3S1NB 3C1FA 4BY7B 1ET6A 4K6LA 1C8CA 3S9WA 4ZRZA 4O1NA 1LTGD 3NQTA 3I4NB 5T1GA 2ZT9C 1ZXTA 1ENAA 3PIO3 2JA5B 4PQXA 1Y8NB 5EKKA 1QE6A 1FNWA 5IT9E 3MFYA 3MAQA 5I2YA 4FXDA 1STAA 3KK7A 2B2YA 2AQ1B 1EYDA 4KHVA 2X69A 3GTKB 4CJ1B 5JVH3 3CRKC 1OO9B 5ISRA 3KUPA 2VXWA 1D5XC 1G91A 3MVVA 4KN4C 4JK1C 2L1BA 3K5LA 2Q8RE 3LX0A 4HSVA 5CR3A 2QKIC 4LAAA 4OHJA 1SNDA 1QB5D 2IT1A 4XT1B 3R93A 1GUGA 3PO3B 3QO2A 3EQLC 2NTSA 1S5FD 3HS0C 2OXPA 2WACA 2A68C 2E76C 1U4MA 1QWYA 5IGEA 1ILQA 4IFDH 3PUWA 2PQEA 4ZKCB 4CBVA 3I3CA 4C3HG 2FFKB 1TWHB 3QOLA 2ENBA 3NBHA 3P20A 3PUXA 3GTJB 1YNNC 5I2XA 2L55A 1IL8A 2XSCA 1VCIA 1YNJC 2HUGA 2Q8IB 4KKTA 1LO5D 5M3MB 2PZUA 5J39A 2MPMA 3KBXA 1CI3M 5C4JB 4ZLTF 2IWHA 4KK7A 2R93B 3VA7A 2NWGA 3NQIA 4ZUJA 1CT1D 4TQUS 1GOZA 3OW7A 4CHTB 2JA8B 3TP6A 1WTRA 3FKIB 3OPOA 3PMFA 4FF1A 3J7YW 3C46A 2K33A 3VYSA 1W6JA 3BDOA 1S5BD 2EYLA 1GUWA 2KVMA 5J1ZA 3L7ZC 5EPJA 5C0XG 1Q12A 2AUKA 2X6GA 3OSOA 4F8MA 1D6EC 1A15A 2C9OA 2AWOA 1CK1A 2FINB 1SAPA 3VYRA 4BS9A 1OXVA 5C3XA 2PW5A 4HN7A 4K6DA 3T4AC 1F2ZA 5G3LD 3SK8A 3MEHA 3D4DA 1FNVA 1Q1EA 1STYA 2B2TC 1PTOC 1X32A 3S2HB 3UI2A 2JA7B 2M00A 4A3GB 3NWSA 3EFXD 2KA7A 1I6VC 2IL8A 3HOWB 4L63B 2L5TA 1B3AA 2H1EA 5CBAE 4OO1G 2A5HA 1LTID 5CV7A 2NYZD 3HG9A 5ELFA 4NKLA 2B2VC 5K36H 3S16B 2A6EC 1CA6A 1HA5A 4ULLA 3MXPA 1AN8A 4A3BB 4XQQA 1V43A 4HEDA 3HOYB 4N9PA 3IFDA 2EY5A 1JQYD 2EJMA 2GA4B 4XT3B 1ML0D 4RGOS 5I9PA 3H91A 2B2TA 2R3ZA 1BXTA 1JOOA 1EOTA 2OEOA 1WD1A 4KI0A 5M5YB 2XWBB 3T53B 1KDBA 3HKZB 3A56A 1I4XA 2L12A 2Z4IA 3SDZA 3SK4A 2EYFA 1EL0A 5CC4A 3DWAA 5C4XB 1S5ED 1BCPF 4HSPA 5KNDA 2F03A 3K5NA 4DK1A 4K5VA 3S15B 1SNOA 4HCSA 3WOFA 1I4PA 2K1BA 4K8IA 1ONLA 2BDNA 3D8GA 1HFNA 1PZID 1NR2A 4B9XA 3HRZC 3K0YA 2KQ3A 2F0SA 1WD0A 5I9OA 4U68A 3QB3A 2KECA 1D2BA 5A35A 1STHA 1HRJA 1PMRA 1UAPA 1SYCA 4IURA 2ID0A 4CJ2C 1SJED 3TN2A 3AB9A 1QG7A 3KLRA 4KKSA 1O80A 2E2DC 1F9SA 1EQTA 1RDPD 5C4HA 1WTWA 3IAYA 2EOTA 1LT4D 4E6IA 3I90A 5KIXA 3GTLB 4F87A 1K83B 3VR2A 4F7XA 2F3VA 3J7AF 4IFDG 3T13A 3D6CA 3A7AB 1XYIA 2VNUD 1JE4A 3T51B 3R2TA 1XTCD 3M3YB 3MXNA 5CV6A 4XXEA 4KV6A 1OXTA 3SEBA 1BCPB 4EQPA 3GO5A 3TMEA 3A8JE 2R7ZB 4RWSC 3ZYYX 3IL8A 3D31A 1AP0A 1EY7A 2WIIB 3PO2B 4P2CB 3RUZA 4XQJA 1CQVA 2LY7A 4IN3A 4N9TA 1VF5C 3M4YA 5I6WA 3K5OA 3SHLA 4OGQC 4FXGC 5I6YA 5KNBA 2DY7A 3FVQA 1H9SB 4R8NA 5ELEA 5FKAC 4K8JA 1VDZA 2JP1A 3DXJC 1Y1WB 1D1IA 1J9OA 2XVSA 2RDGA 3F2UA 2WKCA 3QOJA 4DAPA 3Q24A 2WB1B 2NUCA 2E74C 2NB0A 3DEPA 3S14B 1BQQT 2KHSA 1D5MC 2Z1CA 1SYBA 5D3IB 1ZEQX 1SXTA 5FO8B 2F0KA 1BNZA 2NN6I 1Y69U 4IUNA 4FYDA 4XIGS 4UDUC 1Z6HA 4FP5D 1Y8PB 4Q0FA 3R8BA 4B08A 2ZXPA 3J7AV 2O5IC 4C2MB 1U4RA 2JE6I 4R9WA 5KRUA 2DNEA 2B2VA 3Q22A 4X3UA 3V05A 2BE5C 1I4GA 4QCLA 1DOLA 1PZKD 1FYCA 1EIGA 1G291 5ELCA 3GQBA 1MSGA 4ODGA 3HOXB 3GTPB 1GHJA 4RHSA 4NP5A 5C3WA 1CZGA 4DU9A 1X3QA 1KLGD 4QF4A 1BUVT 4C3JG 1NSNS 2IW3A 2SEBD 4OIKA 4B9WA 3BDLA 2WINB 4RHRA 3BYTB 2K7VA 3K59A 2F0UA 3K7AB 4ILWA 2HDMA 3NPPA 4A3JB 1B9NA 1KNEA 3OIQA 2LKVA 3V2TA 1MBYA 4PV1C 3ITPA 4BA2I 1QJOA 2KOLA 1RKNA 4K5WA 5IODA 5C0XI 4X3SA 4CKBA 1ZYRC 2F0GA 1TS3A 1HUMA 2PO4A 5IIFA 3M85A 3I4MB 3VR4A 1B53A 3GP7A 4RCOA 3DEOA 1L0XB 4RGMA 1SYFA 4KJNA 4ZKBB 4C3JB 2NVQB 5BN5A 2F0HA 2F0WA 3FPPA 1PFNA 4IUQA 5D14A 1TU2B 3EVQA 5C5MA 3URYA 4HMJA 1AEXA 1PLFA 3EROA 1EZ8A 2DNCA 3C2PA 3CRLC 2SOBA 2LMCB 4F88A 3D4RA 1PTOB 4NDXA 1IKLA 4RKBA 2K5QA 3Q23A 2Y0SB 3A7LA 3JAME 2ICEC 5A2QE 2YU9B 3R2IA 5FK9C 4KTAA 4IALA 3X3MA 3MWYW 2EJGC 2KEEA 2PZWA 4ME5A 5CGKA 2F1MA 3W2DA 5IGBA 2EY6A 4FNFA 3GTMB 1M4VA 4FXKC 2ZXOA 2Z8LA 3S2DB 4A3MB 1ET9A 1PTOF 1S4ZA 2O2LD 2D5DA 1LV9A 5KYLA 1MGSA 1PFBA 2CW0C 4L6TB 1PTOD 2SDFA 2NVTB 2VUMB 4C3IB 3GD7A 1G2TA 4M1UB 3LWEA 1TWFB 3IFTA 3FRPB 1O7ZA 1SE4A 3H3VC 4IZ8A 4WFN3 1LTRD 4RGNA 1RHPA 1I4QA 1LLRD 1EY9A 4ABNA 2NN6G 2B8GA 1EY5A 1HQMC 3P1HA 2F0OA 1BCPD 3A8KE 1EIHA 1SYDA 1X3PA 3VYTA 2B2YC 5K5PA 2R92B 3AMUA 1E0BA 2ICIA 1SEBD 1RCVD 2LS01 4KMUC 1PRTD 4Q5VA 3SK5A 1A3VA 2K04A 3U9OA 5IOCA 3S1RB 2J0TD 1DONA 3QIAA 1QNUA 5LL6S 3FMCA 2M9VA 1AW7A 1LTTD 3HZXA 1HTLD 4TRDA 3GV6A 3KLSA 1H9RA 5E1FA 4EQOA 2CVRA 3NTKA 4ZAIA 3LWUA 1JCKB 4R8IA 3HOUB 2F0EA 3RD4A 1Y8OB 1U4LA 3NUCA 3BVZA 1AZPA 1NAPA 2CW0D 2XIWA 4OL7A 4DK0A 1B50A 2E2HB 3WOEA 2EDGA 4DN4M 3K5MA 1GXDC 1EEID 5FLXL 2XNAC 3CHBD 4FF2A 1JOKA 1LT5D 1B44D 1O7LA 2AQ2B 3SVMA 3E6ZX 3OMCA 4K14A 1OXXK 3MA2B 4MIUA 4Z9CB 1TKWB 4DXGA 4KKUA 5K36G 5CV5A 1STEA 3TSSA 1STGA 4DF7A 2RQXA 3C1EA 3R3OA 3VR6A 3I8ZA 2B2WC 2OF1A 1MSHA 1JWSD 4KD4A 3ERQA 2PZTA 5CV8A 1WVLA 2EVBA 1XWEA 2K6AA 5CYUA 2RBMA 5ELBA 1WCMB 3T56B 1BCPC 1FGBD 2EYJA 4ID6A 1MD2D 4J6HA 4LJZC 1SE3A 4H13C 3NBIA 2FMMA 1I4RA 2VB3X 2B63B 5I4DA 1SMYC 2M2LA 1EFID 1CM9A 1DD2A 4BY1B 2SNMA 5CV4A 3V96A 1SNCA 3G6JB 1DOMA 1A2TA 3C3LA 2K5WA 2F0VA 3RMHA 1ZYRD 1HCZA 1WTPA 1F9QA 1TWCB 2F0PA 2B2WA 2CHBD 3TZDA 4ZK9B 1SBBB 1UEAB 5COYA 4K2KA 4CKEA 5EPLA 3OHXC 3E5SA 2D9UA 5BN3A 3NE5B 3TZUA 4EGVA 5FO7B 1K8OA 2YYZA 3K57A 2BDOA 1ZKOA 1II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J G;  4C3I G;  4C3H G; 
#chains in the Genus database with same CATH topology
 4P71 A;  1HNX L;  1N32 Q;  3K58 A;  2JA5 H;  1JB7 A;  1GO3 E;  5FLX E;  2UUB L;  1Q8K A;  4QUF A;  2LXJ A;  1EWH A;  4QUC A;  3TRZ A;  2VUM H;  1SFO H;  5DM7 3;  4K0K Q;  1VQ8 A;  3ND8 A;  4EQ5 A;  1WTQ A;  3I4L A;  1IHZ A;  4RFB A;  5EQ0 A;  1Y1V G;  1LTB D;  1ROD A;  4KY7 A;  5GQO A;  5DM6 3;  1YHB A;  1S5C D;  2A8V A;  3KFU A;  3HP3 A;  2PCF B;  2PPB C;  2ASB A;  2NN6 H;  3HOW G;  1V1P A;  1BKB A;  1TY2 A;  1GKH A;  3HKZ G;  4ZCK A;  1NCV A;  4J8Q A;  3U4Z A;  1U0L A;  1PFS A;  1F77 A;  3HOZ B;  2EYH A;  4RGT A;  4G7H C;  3I56 A;  3JAM c;  4J1M A;  2E2I B;  3J80 E;  2F4V L;  2AUJ D;  4QQB X;  4J15 A;  3CF5 A;  2JA6 H;  2K5H A;  1CKN B;  2JSO A;  2H4O A;  2EPB A;  4OEM B;  3STB C;  5FOB B;  2HHH L;  1LAB A;  4DKA C;  3AYH B;  3G7L A;  3RLF A;  1HPC A;  3CXC A;  2CWP A;  3PO3 H;  4X62 Q;  1F2M A;  1GUT A;  3ICE A;  2JYO A;  3W1B A;  3CMA A;  4X6A H;  1HUN A;  4UP9 A;  3DUZ A;  3W3A A;  3LNN A;  5M5X B;  1KRS A;  1VQN A;  1VQ9 A;  4H0L C;  2UUB Q;  1DCZ A;  2NVX B;  1JR0 D;  1UUP A;  5LMU Q;  4DUY Q;  2R6G A;  2DN8 A;  2ZTE A;  5CBE E;  3N52 A;  1VQ7 A;  4L5T A;  2E75 C;  2GVA A;  2N3S A;  1SNQ A;  2K50 A;  1TR5 A;  3NXW A;  1JWM D;  5C44 B;  1XMO Q;  1VQ5 A;  3KLS X;  3PO3 G;  1LYL A;  2QCP X;  3AQQ A;  2WP8 J;  4A3F H;  4IOA A;  1Q8I A;  2QIL A;  5E3F A;  1HTP A;  4LF7 L;  3NEL A;  3RLO A;  3VYU A;  1E22 A;  2K28 A;  2BA1 A;  1LAC A;  2A74 C;  2TSS A;  1SE2 A;  1C4Q A;  1EY8 A;  3GTQ H;  2KBN A;  1BDO A;  1YBY A;  1IXR A;  3NHH A;  4CKC A;  4DAY A;  2ZJR A;  1I50 B;  1TT2 A;  5EGT A;  1HNW Q;  5C44 H;  4OO1 H;  1W6K A;  4C1N I;  3PUZ A;  2KED A;  2ZTC A;  4LFC L;  4AYB B;  1TQO A;  2IX0 A;  4LF4 Q;  2Z6B A;  5M3F B;  3M4O B;  1XMQ Q;  1G8Z D;  3KDF A;  1HZC A;  4PMC A;  3U58 A;  3GTO B;  3BZD B;  2RSO A;  3PQI A;  3S17 H;  3GTG B;  2DY8 A;  1KAB A;  3VR3 A;  4LF8 L;  5D3D A;  1PVO A;  2Q8T A;  1TS2 A;  4HIO A;  1BBX C;  1B9M A;  2PNR C;  3I4M H;  3SXH A;  4IUV A;  3CD6 A;  1EY4 A;  2L0C A;  2NTT A;  3J80 L;  2YV5 A;  4LUV A;  2K32 A;  2FHT A;  5M5W B;  3K0X A;  5D65 A;  2XRS D;  2WAQ E;  4JI0 L;  3A8I E;  5FLX c;  4ZQ3 A;  2MO0 A;  1XXG A;  2KHI A;  1MI2 A;  3GTO H;  4C3I G;  2KCC A;  3U4V A;  1SE8 A;  2I0Q A;  2MUY A;  2BCO A;  3OOC A;  5C0X J;  1EQV A;  2MNA A;  1KRT A;  1SNM A;  2J7Z A;  1X54 A;  2A6H D;  1VF7 A;  4X66 Q;  1EWC A;  3L3O C;  5IYD H;  3HKZ E;  4N8F A;  4BWG B;  4CDE C;  1G51 A;  2NVQ H;  2N55 A;  1Y14 B;  1ESF A;  3FP9 A;  3P7J A;  4GKJ L;  5ELO A;  4NMZ A;  5ELN A;  4EQN A;  3I72 A;  1ILP A;  3MXN B;  4NW2 A;  4A3F B;  4EX5 A;  4C1N K;  2SNS A;  4QB4 A;  5JPN C;  4BA1 I;  4JOI A;  4KLK A;  1FD7 D;  3KBG A;  3HOV B;  1VMC A;  1K8G A;  1CSQ A;  3TQY A;  1A3T A;  2HIV A;  4X3T A;  4DNI A;  1MIU A;  4BBR B;  1KAA A;  5JJZ A;  1G6P A;  1TXY A;  4IFD J;  1Z7T A;  1I6H B;  2YTX A;  1UEB A;  1L1O A;  2A6E D;  1V1P B;  1HQR D;  3F2C A;  4HCE A;  5EKI A;  4LFA Q;  3I73 A;  4UPA A;  3BVG A;  4R4T A;  4I7Z C;  3BS1 A;  3FPU B;  3VR5 A;  5JEA G;  2R92 H;  1KLU D;  4JI3 Q;  2ZM6 Q;  1PH3 A;  2F0D A;  4DFA A;  2G5D A;  2VW9 A;  1K9M C;  2EY2 A;  4X3K A;  2V1C C;  1EY6 A;  1Q1B A;  2NVY H;  1F9P A;  4PNY A;  1PH7 A;  3OYY A;  4RKL A;  2MJ8 A;  1JC7 A;  1Q86 C;  1L0Y B;  2A6H C;  5HY6 A;  5C5L A;  3G6E A;  5EJW A;  2ZXR A;  2RHQ B;  2VZA A;  2EYM A;  4WJ4 A;  4A3D G;  1TWG H;  5E4W C;  4DNT B;  1SDF A;  2EXZ A;  1GUN A;  2G9H D;  1NE3 A;  3NSW A;  2JEA I;  4A3G H;  4DNR B;  4HMI A;  1CHQ D;  4HIK A;  5KGU A;  3PF5 A;  2VS1 A;  4S3S A;  3STB D;  2OTJ A;  4P74 A;  1F2L A;  4JOI C;  1I94 Q;  2V4D A;  2MQH A;  4JBW A;  1K8M A;  1HH2 P;  2ES2 A;  1EU4 A;  2A69 D;  1Y1V B;  2F0L A;  4YCW A;  1F2Y A;  3UE1 A;  4U67 3;  1T5X D;  3H94 A;  2PYK A;  2B39 A;  3CPW A;  4R4C A;  3ND9 A;  3S14 H;  4XYO A;  4A3I H;  2A73 B;  1ENC A;  2K01 A;  1R9T H;  1IL2 A;  2PW7 A;  4IPG A;  2QEJ C;  4IQZ A;  1IBM Q;  1YHQ A;  1WTV A;  2NZ1 D;  3GTG H;  2KCN A;  2WV6 D;  3CQZ B;  3PUV A;  3J81 L;  4KHZ A;  2HCI A;  3JAM L;  1IBK Q;  4MN3 A;  3KF8 B;  4GNX C;  4CDD C;  1X3G A;  4B3T L;  1UE1 A;  5GAH C;  4LFB L;  3I4N H;  3BVM A;  1ESR A;  4A3I B;  4OXP A;  2PI2 E;  2DGY A;  1TWA B;  3A54 A;  1QVF A;  4A3D B;  4KN7 C;  3GV3 A;  3Q8D A;  3CAM A;  2BOS A;  1TVX A;  3ER0 A;  1STN A;  1G2S A;  1A3U A;  1V1O A;  3PGZ A;  1VQ4 A;  1O7Y A;  4APV A;  3PF4 A;  3RNU A;  3H6M A;  2HCC A;  1I94 L;  5EBD A;  1U5K A;  4YY3 L;  1ICW A;  2RHS B;  1GJX A;  4HJ7 A;  4FF4 A;  2FMC A;  3T1Y Q;  3HOV G;  3KLW A;  2FJ2 A;  2JQO A;  1QNK A;  1SJH D;  3NTI A;  2K05 A;  2D62 A;  4JI7 L;  2MHV A;  5C6A A;  1Q3L A;  1R4Q B;  3PIP A;  1XTD A;  5G3L F;  2CH4 W;  5DAU A;  2Z4H A;  1PA6 A;  3DM1 A;  1QCB D;  3D0F A;  5BR8 Q;  3F1Z A;  2RKS A;  4BBS B;  1Z47 A;  4NPS A;  4I7A A;  1EYA A;  1SYE A;  1X6O A;  3E0J A;  3I70 A;  3AFQ A;  3D3R A;  3CCV A;  1QIL A;  2EYO A;  2IPK D;  3A5Z B;  3I4O A;  4HR7 B;  3RZO B;  2R7F A;  4KY5 A;  5DNF A;  2F0I A;  3H0G B;  1V8Q A;  1YNX A;  1R4P B;  1WOC A;  5JAV A;  1D8L A;  4DUZ Q;  1U9R A;  4LMQ D;  1I3Q B;  1O78 A;  1PFM A;  1JOR A;  3J81 E;  4I65 A;  1J6Q A;  2UUC L;  5JVG 3;  1IW7 D;  3MC0 B;  5JJK A;  1E1T A;  4GS3 A;  4JCV E;  1QVG A;  1H9K A;  4EVO A;  1EZ6 A;  4GOP C;  3J81 j;  3QG1 A;  4PZ6 A;  5LL6 X;  2RVL A;  2E8G A;  2F0Q A;  4C3H H;  1GUO A;  2B8F A;  1EYC A;  2I07 B;  2E2I H;  1AFP A;  4LF9 L;  1B8A A;  1PV4 A;  3ONA B;  2A69 C;  5AJ3 Q;  1IYV A;  4KD3 A;  4GZY C;  3NP8 A;  2RSN A;  1WCM H;  2E2J B;  1H9M A;  3GTK H;  2G9D A;  4NXM Q;  1XNQ L;  1MHW C;  4WOR A;  3MXU A;  2LFN A;  3MZ5 A;  2EZV A;  4L8J A;  4MHE A;  3S17 B;  2K5D A;  5HGT A;  3MXG A;  4JI2 L;  4IUT A;  1IBL Q;  4JI1 L;  3D4W A;  1S40 A;  2JA8 H;  4C3H B;  4LFB Q;  4ZUI A;  4LUO A;  4JI5 L;  2H5X A;  4DR2 Q;  3NTH A;  1YNJ D;  1RTN A;  3VA5 A;  4G7O C;  1NUC A;  1BBW A;  2UUC Q;  1U4P A;  2F0F A;  1CHP D;  3K7A H;  2E2J H;  3U9S A;  1VQM A;  5JPM C;  3ULP A;  1PRT B;  1PYW D;  4QIW B;  5M3F G;  3UDG A;  1PTO H;  1VQE A;  4IUU A;  5EBC A;  1CA5 A;  2QDL A;  4FF3 A;  4WRD A;  3PIP 3;  3FKI H;  2O5J C;  3DMU A;  3OWF A;  3P75 A;  5FLM H;  1XX8 A;  3SK6 A;  1GVP A;  1SRO A;  3NWT A;  1E24 A;  4A3E H;  4CJ0 B;  2Z6K C;  2DJF C;  1PRT F;  3WDN A;  4WJ3 M;  1A6X A;  4JBK A;  3EBE A;  3DLL A;  1OTC A;  1PDQ A;  3CKI B;  3L0O A;  3TP7 A;  4L5S A;  5E4X A;  1NMG A;  2KJX A;  1XNR L;  3HOZ G;  3M7G A;  1SSO A;  1B4O A;  1E3P A;  5M5X H;  1SMY D;  5KEE A;  1CQF A;  1KTK A;  1TII D;  3CC7 A;  4HAE A;  4M8A A;  5FO9 B;  1RIP A;  1SN8 A;  3BDC A;  2Y0S G;  1CZW A;  5JOB A;  2ALY B;  4K0K L;  3DWP A;  3ZJY C;  2RDH A;  1KQS A;  1HA6 A;  1H9J A;  2L9H A;  4TSS A;  4K5X A;  1CTM A;  4DAY B;  1RJT A;  1WTX A;  3M9B A;  2XWJ B;  4KY6 A;  1JWU D;  1JB3 A;  5KYI A;  3T16 A;  4YWL A;  1O7I A;  1IW7 C;  2B2U C;  2L11 A;  2PMZ B;  3BYY B;  4GLV B;  4JV5 Q;  3K6O A;  3X3N A;  5C4X H;  1MKH A;  3BG3 A;  1J8I A;  1D5Z C;  4LF8 Q;  4CDC C;  2L4N A;  1H9S A;  3CCM A;  2E5L Q;  1Q46 A;  5IWA L;  4DR4 L;  1FNU A;  2K5V A;  1DOK A;  1AZQ A;  4G57 A;  1NR4 A;  4AQY Q;  4TKO B;  1OXS C;  1X3F A;  1F9R A;  3L2P A;  4OX9 L;  4DAV A;  3S1Q B;  4OIJ A;  3CCU A;  3UDF A;  3O13 A;  4MNO A;  4YIJ A;  1LTS D;  1EEF D;  2Y0S E;  4B3S Q;  4DA2 A;  5TSS A;  1BO0 A;  1BR9 A;  4G4K A;  4V19 0;  1J5E L;  3TEH B;  2UXD Q;  4HTH A;  1G6Z A;  3MTS A;  4YHH L;  3KOJ A;  2K52 A;  5IGG A;  4A3K G;  1IKM A;  3HGB A;  3FEW X;  4OWT B;  1WTO A;  2AWN A;  2TMP A;  5COR A;  1DJR D;  1MJC A;  1KDC A;  3MFG A;  4DR5 Q;  4IUP A;  1E2V A;  1B1Z A;  3M7N A;  3Q0A A;  1ENF A;  2IX1 A;  4R4O A;  1E2Z A;  4XQN A;  1JIC A;  1DZ1 A;  1S5D D;  1SYG A;  5J22 A;  1E2W A;  4LF6 Q;  1R9T B;  1HJP A;  2EY1 A;  3AFP A;  3KF8 A;  4V0B A;  3QWN A;  3UDX A;  4GLX A;  1BF4 A;  4G7Z C;  3GTQ B;  1SR3 A;  4H7B A;  2I5M X;  2NVY B;  4DGZ A;  4H44 C;  1X55 A;  2E2H H;  5BN4 A;  2F0N A;  2N88 A;  3S16 H;  1E7Z A;  3PIO A;  4P75 A;  3OIP A;  3SE0 A;  1KD1 C;  2ZTD A;  5EKL A;  5C4Z A;  1LT6 D;  1A2U A;  5F2D A;  1OXU A;  4Y7N B;  3J7A 5;  1TWG B;  5IGC A;  3I91 A;  4R4I A;  3SR1 A;  1K8A C;  3F2B A;  1UNS A;  4QGU A;  4YCU A;  1TWA H;  4QY7 A;  4A3B H;  3TP8 A;  4JG2 A;  5HUR A;  1EU3 A;  3RZD B;  1GUS A;  1FR3 A;  3L9A X;  2AKW B;  2I46 A;  1C48 A;  4DR2 L;  1K73 C;  2WAQ B;  3CCE A;  1HFG A;  1XPR A;  4RMF A;  4AQY L;  5LHY 1;  4DPG A;  2JJQ A;  1DM0 B;  1TY0 A;  1VMP A;  1IYU A;  1QOH A;  3SGI A;  2R7D A;  4C56 C;  5BR8 L;  1WI5 A;  3OTO Q;  2O4X A;  3LGJ A;  3PV0 A;  5EPK A;  3S1N H;  3TS0 A;  4RAU C;  1GHK A;  1DXM A;  3Q6S A;  5IGD A;  1YVC A;  5FJ8 H;  3RZD H;  3NEM A;  1RF2 D;  3M4P A;  4RH6 A;  2J4X A;  4PMW A;  2F0T A;  2HQE A;  2UXB Q;  3TDQ A;  4XYQ A;  5T1I A;  1T9H A;  1D1K A;  5IP7 G;  3EJI A;  4LW1 A;  1VQK A;  2WKD A;  1AE2 A;  2HQL A;  5KNC A;  4JI6 L;  4A76 A;  2F3I A;  4LK1 C;  5CV9 A;  3S1M B;  1K0R A;  3NK9 A;  2JA8 G;  1PRT C;  2HIX A;  4FVM A;  2F0J A;  4RA8 A;  4O42 A;  3A55 A;  3HEJ A;  3HOY H;  2MGS A;  5CMD A;  1JOQ A;  5NUC A;  1HXY D;  4QJF A;  2EYP A;  2XN9 C;  1PH2 A;  4B3S L;  5IGF A;  1YNN D;  1T5E A;  5GAE C;  3IKJ A;  2X6L A;  5AJ3 L;  5IY0 A;  4DXF A;  2L15 A;  5C3E B;  2CQA A;  4XTC S;  1NNX A;  1QZH A;  2Z9H A;  1KNA A;  3BZC A;  2F0M A;  2AQ3 B;  4A3K B;  1HHV A;  2NZH A;  2R61 A;  5DEH A;  3HOX H;  4GNX A;  1PH1 A;  3CCQ A;  2JA9 A;  4LF5 Q;  1DYQ A;  4CGY B;  1RD9 D;  2EXD A;  2KCT A;  2N8N A;  3NEN A;  3UDI A;  3QJY A;  1Q90 A;  1M8A A;  1WCM G;  1N34 Q;  1PZJ D;  2C5C A;  4UAI A;  2B2U A;  4DR7 Q;  1Y1V H;  4LF4 L;  3A74 A;  1P16 A;  4A93 B;  2RDF A;  5AFW A;  4A93 G;  1NTG A;  3FDT A;  3N6R A;  2MP1 A;  3PCO B;  2F3W A;  2VB2 X;  2K4K A;  3D6W A;  5M5Y H;  3EIV A;  4KJO A;  1LT3 D;  2RA4 A;  4K2L A;  4X66 L;  5IT9 c;  3AU7 A;  4FO2 A;  5JEA H;  2ZJP A;  2R92 G;  3PUY A;  5C0X H;  3PO2 H;  2KUM A;  2QDB A;  2XRQ D;  3GDE A;  5A2Q L;  1HR0 Q;  1BVS A;  1CSP A;  2JEB I;  4R4Q A;  3EA6 A;  3DHQ A;  2NZO A;  4JBM A;  3OWE B;  5IYD G;  5IYC H;  1H95 A;  3TRE A;  2OT2 A;  5M3F H;  1CFM A;  4PMB A;  1KDA A;  2EJF C;  5IT9 L;  4IFD I;  1A0I A;  2F4I A;  2K03 A;  5JJI A;  4QMG A;  1RTO A;  4GKK L;  3FKI G;  4RCN A;  2A68 D;  3H0G H;  1SFO B;  5ELD A;  1B2T A;  1XPU A;  3OMG A;  1LTA D;  2B63 H;  2IX3 A;  1L1O B;  1CKM A;  2QF7 A;  4YWM A;  3OW2 A;  1K3B C;  1BOS A;  1TS4 A;  1YJW A;  2QEX A;  5M9O A;  1ASY A;  2PNH A;  2BA0 A;  2PI2 A;  5JEA J;  4A3E B;  2IHE A;  3TBI B;  3TP5 A;  3DWQ A;  1STB A;  3CU7 A;  1GM5 A;  2JXM B;  4A3I G;  2EE1 A;  1EY0 A;  4XDX A;  2D2C C;  1IYJ B;  3MHB A;  2HDL A;  4ZYS A;  1X3E A;  2Q2T A;  1SNP A;  2JA6 B;  4WJW A;  1I4H A;  2BE5 D;  4OO1 I;  3ULJ A;  1PXU A;  3S24 A;  2E5L L;  1TS5 A;  3H09 A;  4P72 A;  2KCM A;  4BY7 G;  2DUD A;  2IJ0 A;  2NBF A;  3S1N B;  3C1F A;  3KYH C;  4BY7 B;  1ET6 A;  4A3L G;  4NXN Q;  4K6L A;  3CME A;  4A3K H;  1C8C A;  3S9W A;  3K7U C;  5H1S E;  4ZRZ A;  4O1N A;  1LTG D;  3NQT A;  2D0O A;  3BU2 A;  1XNQ Q;  2WB1 E;  5T1G A;  5C44 G;  3I4N B;  2EQS A;  1VS0 A;  2ZT9 C;  2UUA Q;  2XGT A;  1ZXT A;  1ENA A;  3PIO 3;  2JA5 B;  3H3V H;  2IHF A;  4PQX A;  1Y8N B;  5EKK A;  1QE6 A;  1FNW A;  4HJ8 A;  5IT9 E;  4DV4 Q;  3MFY A;  3MAQ A;  5I2Y A;  4FXD A;  1STA A;  3KK7 A;  2B2Y A;  5LMN Q;  4JI4 L;  3CPF A;  2AQ1 B;  1EYD A;  1V1Q A;  4KHV A;  2X69 A;  3S2D H;  3GTK B;  2R7Z H;  2AMC B;  4CJ1 B;  4Y7N H;  2I5H A;  5JVH 3;  3CRK C;  1OO9 B;  5ISR A;  3KUP A;  2JA6 G;  2VXW A;  1D5X C;  4ME3 A;  1G91 A;  2HHH Q;  3MVV A;  4KN4 C;  4JK1 C;  3T1H Q;  5M3M G;  1I50 H;  4NXN L;  2L1B A;  1YZ6 A;  1B70 B;  3K5L A;  2JN4 A;  2Q8R E;  3LX0 A;  3TS2 A;  4HSV A;  5CR3 A;  2QKI C;  4LAA A;  4OHJ A;  1Q7Y C;  1SND A;  1QB5 D;  2IT1 A;  4XT1 B;  4AH6 A;  3R93 A;  1GUG A;  4B3M L;  3PO3 B;  3QO2 A;  1JT8 A;  3EQL C;  2NTS A;  1S5F D;  3HS0 C;  1LM0 A;  3W5O A;  2OXP A;  1PH9 A;  2WAC A;  2A68 C;  2E76 C;  1U4M A;  1QWY A;  5IGE A;  1ILQ A;  1YHA A;  4DV4 L;  4IFD H;  3PUW A;  2PQE A;  4ZKC B;  4CBV A;  3I3C A;  5LMN L;  4C3H G;  2FFK B;  1TWH B;  3QOL A;  5C4J H;  2ENB A;  3NBH A;  3P20 A;  3PUX A;  3GTJ B;  1YNN C;  5I2X A;  1QZG A;  2L55 A;  4DV1 L;  1EIF A;  1N32 L;  1MJE A;  1IL8 A;  2HD3 A;  4PZ8 A;  2XSC A;  1VCI A;  1YNJ C;  2KEN A;  4JBJ A;  5E7N A;  4A3C G;  2HUG A;  2Q8I B;  2OCE A;  1VQP A;  4BY1 G;  4KKT A;  4DV1 Q;  3CC2 A;  1LO5 D;  1TWC H;  1L2F A;  4HID A;  5M3M B;  2PZU A;  5J39 A;  2MPM A;  3KBX A;  1CI3 M;  3IRB A;  5C4J B;  3T1H L;  4ZLT F;  1VQC A;  2IWH A;  4KK7 A;  3CC4 A;  2R93 B;  3VA7 A;  1A63 A;  3F8T A;  2NWG A;  1S72 A;  3NQI A;  4ZUJ A;  1CT1 D;  4TQU S;  1GOZ A;  3OW7 A;  4CHT B;  2JA8 B;  3TP6 A;  2JA7 G;  1WTR A;  2UU9 L;  2CCZ A;  3FKI B;  4DR6 Q;  3OPO A;  3PMF A;  4FF1 A;  3J7Y W;  3C46 A;  1YEZ A;  4FDB A;  2K33 A;  3VYS A;  5IP9 H;  2RF4 A;  2FXQ A;  1YIJ A;  1W6J A;  3BDO A;  1S5B D;  2EYL A;  3E9H A;  1GUW A;  2KVM A;  5J1Z A;  3L7Z C;  5EPJ A;  4LF7 Q;  1EWI A;  5C0X G;  3CCR A;  1Q12 A;  1UE6 A;  2AUK A;  1SLJ A;  1A8V A;  1WFQ A;  2X6G A;  3OSO A;  1YI2 A;  4KHP Q;  1EFW A;  4F8M A;  1D6E C;  1K0S A;  1A15 A;  2C35 B;  4LF6 L;  2C9O A;  2AWO A;  1CK1 A;  2FIN B;  1SAP A;  3VYR A;  4POF A;  3HOX G;  3S1Q H;  3H15 A;  4BS9 A;  1OXV A;  5C3X A;  2PW5 A;  4HN7 A;  4K6D A;  1M90 C;  3OTO L;  3HOU H;  4DV7 L;  3T4A C;  2NVT H;  5GRO A;  1F2Z A;  5G3L D;  3MEF A;  4YY3 Q;  3U50 C;  4A3F G;  3SK8 A;  3MEH A;  3D4D A;  1FNV A;  1Q1E A;  1STY A;  2B2T C;  1PTO C;  1X32 A;  2EIF A;  3S2H B;  1HZA A;  3UI2 A;  2CQO A;  2JA7 B;  2M00 A;  4A3G B;  2A19 A;  3NWS A;  3EFX D;  2KA7 A;  1I6V C;  1JE5 A;  2YU9 H;  4OX9 Q;  2IL8 A;  3HOW B;  4L63 B;  2Q2I A;  2L5T A;  1B3A A;  5IWA Q;  2H1E A;  5CBA E;  4JI0 Q;  4OO1 G;  2A5H A;  1LTI D;  4OON A;  5CV7 A;  3HOU G;  3J81 i;  2NYZ D;  3HG9 A;  5ELF A;  1VQD A;  4NKL A;  2B2V C;  3KF6 A;  4LF5 L;  5K36 H;  3S16 B;  3G4S A;  4L5Q A;  3H0G G;  4C3J H;  5IP7 H;  2A6E C;  1L0W A;  1CA6 A;  1HNZ Q;  4BXX H;  1HA5 A;  4BBR H;  1C0A A;  1VQ6 A;  1X9N A;  4ULL A;  3I4M G;  3CQZ H;  1XMQ L;  5JJL A;  3MXP A;  1WJJ A;  1AN8 A;  3WWV A;  4A3B B;  2WB1 G;  4XQQ A;  3J80 i;  1V43 A;  4HED A;  1FJG Q;  3HOY B;  4N9P A;  1Q82 C;  3IFD A;  3HFZ B;  3HOY G;  2EY5 A;  1JQY D;  2EJM A;  2GA4 B;  4XT3 B;  1ML0 D;  1PH4 A;  4RGO S;  5I9P A;  3H91 A;  2B2T A;  2R3Z A;  4HJA A;  1BXT A;  4CDF C;  1JOO A;  1WYD A;  2B29 A;  1EOT A;  2OEO A;  1WD1 A;  2PQA A;  4KI0 A;  4A3G G;  1N36 Q;  5M5Y B;  1EUJ A;  2XWB B;  3T53 B;  1KDB A;  1EYG A;  3HKZ B;  4DR3 Q;  3A56 A;  1I4X A;  2L12 A;  3CP0 A;  3CCJ A;  4A4I A;  4O2D A;  2Z4I A;  3ERS X;  4DV5 Q;  4A3M H;  3SDZ A;  2GN5 A;  3SK4 A;  2EYF A;  2ZM6 L;  5C4X G;  4JI3 L;  1EL0 A;  5CC4 A;  3DWA A;  5C4X B;  1S5E D;  4B3R L;  1BCP F;  4HSP A;  5KND A;  4YHH Q;  4GOP A;  2F03 A;  4L5R C;  3K5N A;  1QUQ A;  3JAM i;  4DK1 A;  4K5V A;  3S15 B;  1FJG L;  1HNX Q;  4JYA Q;  1SNO A;  4HCS A;  5C3E H;  4AYB G;  1EIY B;  1LUZ A;  3WOF A;  1D7Q A;  5IYC G;  1I4P A;  1B7Y B;  2K1B A;  4K8I A;  1NY4 A;  3G71 A;  1ONL A;  2BDN A;  4IPC A;  4QIW E;  2VL6 A;  4PG3 A;  4DR4 Q;  3D8G A;  1HFN A;  2YTY A;  4HJ5 A;  1PZI D;  1NR2 A;  1I3Q H;  4B9X A;  2B3G A;  3HRZ C;  3K0Y A;  2UXC L;  2KQ3 A;  2F0S A;  1KL9 A;  1WD0 A;  2GVB A;  5I9O A;  1V9P A;  3QB3 A;  4U68 A;  2R7Z G;  2KEC A;  2F4V Q;  4DR3 L;  3KJP A;  1D2B A;  4LUZ A;  5A35 A;  2I5L X;  1STH A;  3BJU A;  1XNR Q;  1HRJ A;  2K5N A;  1PMR A;  1EQQ A;  1UAP A;  1SYC A;  3E0E A;  4DR5 L;  4YWK A;  4IUR A;  2ID0 A;  4CJ2 C;  2UXC Q;  3GTP H;  1SJE D;  3TN2 A;  4A3C H;  4GN5 A;  3AB9 A;  3S1M H;  4BBS G;  1QG7 A;  3KLR A;  4KKS A;  2A1A A;  1O80 A;  1VQJ A;  2E2D C;  4DV3 L;  1F9S A;  1EQT A;  2ATW A;  1RDP D;  5C4H A;  1WTW A;  3IAY A;  2EOT A;  3J81 c;  1LT4 D;  4E6I A;  1W2B A;  3I90 A;  5KIX A;  3GTL B;  4F87 A;  1K83 B;  4JYA L;  5LMN W;  2LSS A;  3VR2 A;  4C2M H;  2CH4 A;  4F7X A;  2F3V A;  3J7A F;  1P8L A;  1C7Y A;  4IFD G;  3T13 A;  4AYB E;  2HT1 A;  3D6C A;  4A3L H;  3A7A B;  1XYI A;  3A5U A;  1JE4 A;  2VNU D;  3T51 B;  3R2T A;  4O0A A;  1XTC D;  3M3Y B;  3MXN A;  4KHP L;  5CV6 A;  4XXE A;  4BBS H;  4KV6 A;  1TWF H;  1OXT A;  3SEB A;  1BCP B;  4EQP A;  3GTJ H;  3GO5 A;  3TME A;  2R93 G;  3A8J E;  3RZO H;  2R7Z B;  4RWS C;  3ZYY X;  3IL8 A;  3D31 A;  1AP0 A;  1N36 L;  3AEV A;  1EY7 A;  2WII B;  3PO2 B;  3I4N G;  4YCV A;  4P2C B;  3RUZ A;  4JI4 Q;  4XQJ A;  1CQV A;  4JW0 A;  2LY7 A;  2JA5 G;  4IN3 A;  4N9T A;  1VQG A;  1VF5 C;  3M4Y A;  1NMF A;  5I6W A;  4DV2 Q;  3K5O A;  3ULL A;  3SHL A;  4OGQ C;  4B3R Q;  4FXG C;  4LWC A;  1W3S A;  3M4O H;  5I6Y A;  5KNB A;  2DY7 A;  1XJV A;  3FVQ A;  1CKO A;  1H9S B;  4R8N A;  5ELE A;  5FKA C;  4JI2 Q;  4K8J A;  1X65 A;  1VDZ A;  2JP1 A;  3DXJ C;  1VQO A;  1I6H H;  1Y1W B;  1D1I A;  1J9O A;  2XVS A;  2RDG A;  1Y1W G;  3F2U A;  2WKC A;  3QOJ A;  2B63 G;  4DAP A;  3Q24 A;  2WB1 B;  5M5W H;  2NUC A;  2E74 C;  2NB0 A;  1KAW A;  3DEP A;  3S14 B;  1BQQ T;  2KHS A;  5L37 A;  5LMU L;  1D5M C;  2Z1C A;  4LF9 Q;  2MFI A;  1SYB A;  1WTH A;  5D3I B;  1ZEQ X;  5GAD C;  4LNQ A;  1SXT A;  5FO8 B;  3CCL A;  1HR0 W;  2F0K A;  4AIM A;  1BNZ A;  2NN6 I;  1Y69 U;  4DV6 Q;  4IUN A;  4FYD A;  1N9W A;  4XIG S;  4UDU C;  1EQR A;  1Z6H A;  4A93 H;  4FP5 D;  1Y8P B;  2CFM A;  1ICF B;  4Q0F A;  3R8B A;  4B08 A;  3I55 A;  1VQH A;  2ZXP A;  4UP7 A;  2VQE Q;  3J7A V;  2PQA B;  2WAQ G;  4JI8 L;  4C2M B;  2O5I C;  4DUZ L;  2NVX H;  1U4R A;  2JE6 I;  4GLA C;  4R9W A;  5KRU A;  4UP8 A;  1UE5 A;  3UE0 A;  2DNE A;  2B2V A;  3Q22 A;  4X3U A;  4BY1 H;  3V05 A;  2BE5 C;  1I4G A;  4QCL A;  1DOL A;  4DV3 Q;  1PZK D;  1FYC A;  1PYB A;  1FVI A;  4IO9 A;  2BH2 A;  1EIG A;  1G29 1;  5ELC A;  4JPB W;  2CWA A;  2K14 A;  3GQB A;  1MSG A;  1JJ2 A;  4ODG A;  3HOX B;  1ASZ A;  3GTP B;  4GOP B;  1GHJ A;  4RHS A;  3KF6 B;  4NP5 A;  5C3W A;  4A3B G;  1CZG A;  4DU9 A;  4DK3 C;  3K80 C;  4POG A;  1X3Q A;  4A75 A;  1KLG D;  1TWH H;  4QF4 A;  4TVA B;  1BUV T;  4C3J G;  3QR8 A;  4BXX G;  2RCF A;  1NSN S;  2IW3 A;  2SEB D;  4OIK A;  1HR0 L;  4B9W A;  4Y52 H;  4A3M G;  3BDL A;  2WIN B;  4RHR A;  3BYT B;  1LTL A;  2K7V A;  3K59 A;  4JI8 Q;  1EOV A;  3FHW A;  1IBM L;  2F0U A;  3K7A B;  1L1O C;  4ILW A;  2HDM A;  3NPP A;  4X64 Q;  2VUM G;  4A3J B;  1B9N A;  1KNE A;  3OIQ A;  1JJG A;  2LKV A;  5J3B A;  4B3M Q;  5FJ8 G;  3V2T A;  1VQB A;  1HNZ L;  2KHJ A;  2K75 A;  1MBY A;  5M3M H;  4PV1 C;  2WFW A;  3ITP A;  4BA2 I;  1QJO A;  1YIT A;  2KOL A;  1RKN A;  4K5W A;  5IOD A;  5C0X I;  1IBL L;  4X3S A;  3VDY A;  2Z0S A;  4CKB A;  1KXL A;  1ZYR C;  1A62 A;  1IBK L;  2F0G A;  4IJH A;  1TS3 A;  1HUM A;  2PO4 A;  4GKJ Q;  5IIF A;  1HNW L;  3M85 A;  3I4M B;  3VR4 A;  1JJC B;  1YJ9 A;  1B53 A;  2QGQ A;  3GP7 A;  4RCO A;  3DEO A;  1KIX A;  4MTN A;  1L0X B;  4RGM A;  1SYF A;  2BH8 A;  3A0J A;  4KJN A;  4DV0 L;  4JI6 Q;  3CCS A;  4ZKB B;  4C3J B;  3HOZ H;  4JC0 A;  2NVQ B;  4DR1 L;  5BN5 A;  2F0H A;  1C9O A;  1N33 L;  2F0W A;  3FPP A;  5IYB G;  4ALP A;  1PFN A;  2JK8 A;  3RLN A;  4IUQ A;  5D14 A;  3S15 H;  1VQL A;  1TU2 B;  2AHO B;  3EVQ A;  5C5M A;  3URY A;  1VQI A;  4HMJ A;  1AEX A;  1PLF A;  3ERO A;  3RR5 A;  4A3J G;  1EZ8 A;  3DM3 A;  2DNC A;  3I2Z A;  3C2P A;  4B3T Q;  1PYS B;  3CRL C;  2DJG C;  2N49 A;  3K8A A;  4OWX B;  4OWW B;  1N33 Q;  2SOB A;  3F2D A;  3K81 C;  2CKZ B;  2LMC B;  2YTV A;  4F88 A;  4JVZ A;  3D4R A;  1PTO B;  1BBU A;  1FGU A;  4X65 Q;  4NDX A;  1IKL A;  1CUK A;  4RKB A;  2K5Q A;  3Q23 A;  2Y0S B;  3A7L A;  1PH5 A;  2JA7 H;  3JAM E;  2ICE C;  5A2Q E;  1Q81 C;  2YU9 B;  4MTK A;  3R2I A;  4GNX B;  5FK9 C;  4MZ9 A;  1M1K C;  4KTA A;  4IAL A;  3X3M A;  2R93 H;  3MWY W;  2EJG C;  2KEE A;  2PZW A;  4ME5 A;  5CGK A;  2UU9 Q;  4IPD A;  2OTL A;  2F1M A;  3E3X A;  4DR1 Q;  3W2D A;  5IGB A;  1KC8 C;  1PH8 A;  2EY6 A;  4FNF A;  3GTM B;  1M4V A;  4FXK C;  2ZXO A;  2Z8L A;  3S2D B;  2UUA L;  4A3M B;  1ET9 A;  1PTO F;  1S4Z A;  2O2L D;  2D5D A;  1LV9 A;  5KYL A;  1MGS A;  4DV7 Q;  1PFB A;  2CW0 C;  4L6T B;  1PTO D;  2SDF A;  3B6Y A;  2ZJQ A;  5DLQ E;  2NVT B;  1SMX A;  1YJN A;  2VUM B;  4C3I B;  3GD7 A;  4JI7 Q;  1G2T A;  2F52 A;  4M1U B;  1Y1W H;  1ZKO A;  3LWE A;  3T1Y L;  2Q2U A;  1X56 A;  1TWF B;  3IFT A;  3FRP B;  1O7Z A;  1SE4 A;  3GTM H;  3H3V C;  4IZ8 A;  4WFN 3;  1LTR D;  4RGN A;  1RHP A;  1I4Q A;  1LLR D;  1EY9 A;  2PMZ E;  1FL0 A;  2NN6 G;  4ABN A;  3HOW H;  4BY7 H;  1IZ6 A;  2B8G A;  1EY5 A;  1HQM C;  3P1H A;  3S1R H;  4LFC Q;  2F0O A;  1BCP D;  4X62 L;  3A8K E;  1EIH A;  1SYD A;  1X3P A;  3VYT A;  4DV6 L;  2LXK A;  2B2Y C;  5K5P A;  2VY3 A;  3RN5 A;  5IP9 G;  2R92 B;  3E9I A;  3AMU A;  1E0B A;  2ICI A;  1SEB D;  1RCV D;  2LS0 1;  3W1G A;  1K83 H;  3JC6 6;  2VQF Q;  4JV5 L;  4KMU C;  1PRT D;  4Q5V A;  2VQF L;  1QVC A;  3SK5 A;  1A3V A;  4IOC A;  2QW7 A;  2K04 A;  4P73 A;  3U9O A;  4BBR G;  3M4Q A;  2QA4 A;  5IOC A;  3S1R B;  2VQE L;  4GKK Q;  2J0T D;  2D0P A;  1DON A;  3M3Y H;  3QIA A;  1XMO L;  1QNU A;  1UE7 A;  5EAY A;  3PO2 G;  5LL6 S;  3FMC A;  2M9V A;  1AW7 A;  4N8X 1;  1LTT D;  3HZX A;  1HTL D;  4TRD A;  1GD7 A;  3GV6 A;  3KLS A;  1N8R C;  1H9R A;  5E1F A;  4EQO A;  2CVR A;  3NTK A;  4ZAI A;  3LWU A;  1JCK B;  4R8I A;  2OQK A;  2F0E A;  3RD4 A;  3HOU B;  2MO1 A;  1Y8O B;  3NUC A;  1U4L A;  3RN2 A;  1CKN A;  2P5Z X;  1J5E Q;  3BVZ A;  1AZP A;  1NAP A;  2CW0 D;  2XIW A;  4OL7 A;  4LFA L;  4DK0 A;  1B50 A;  2E2H B;  3WOE A;  1RL2 A;  2EDG A;  4DK6 C;  4DV5 L;  4DN4 M;  3K5M A;  5IE8 A;  2UXB L;  4NB3 A;  1NBW A;  1PH6 A;  1GXD C;  1N34 L;  1EEI D;  5FLX L;  1XPO A;  2XNA C;  3CHB D;  4FF2 A;  1JOK A;  3PSI A;  1LT5 D;  1B44 D;  4RG1 A;  1O7L A;  2Q2H A;  3H3V I;  4UHV A;  1NJI C;  2AQ2 B;  4GN4 B;  1HZB A;  1UWV A;  3SVM A;  2Z6K A;  4DUY L;  3E6Z X;  3OMC A;  4K14 A;  4C3I H;  1OXX K;  3MA2 B;  4MIU A;  4Z9C B;  1TKW B;  4DXG A;  4KKU A;  4HJ9 A;  5K36 G;  5CV5 A;  1STE A;  1I5F A;  3TSS A;  3NBH B;  1STG A;  4DF7 A;  2IY5 B;  3I7F A;  2RQX A;  3C1E A;  1B3Q A;  4PZ7 A;  2OWO A;  3R3O A;  3VR6 A;  1K28 A;  1VQA A;  3I8Z A;  1VQF A;  2B2W C;  4HIM A;  2OF1 A;  4X64 L;  1MSH A;  4IPH A;  4DR7 L;  1JWS D;  4KD4 A;  1HZ9 A;  4JI5 Q;  3ERQ A;  2PZT A;  2XTI A;  5FLM G;  5CV8 A;  1WVL A;  2EVB A;  1XWE A;  2K6A A;  4QL5 A;  4DV2 L;  4A3E G;  5CYU A;  3HKS A;  2RBM A;  3G48 A;  5ELB A;  1WCM B;  3T56 B;  1BCP C;  1FGB D;  2EYJ A;  4ID6 A;  1MD2 D;  4NXM L;  4J6H A;  4LJZ C;  1AH9 A;  2N78 A;  4R1J A;  5IYB H;  1SE3 A;  4H13 C;  3NBI A;  2FMM A;  1I4R A;  3CW2 C;  2VB3 X;  2B63 B;  4GN3 B;  1AE3 A;  3KJO A;  5I4D A;  1SMY C;  2M2L A;  1EFI D;  3KDF B;  1CM9 A;  3J80 c;  3EN2 A;  1DD2 A;  5GAG C;  2SNM A;  5CV4 A;  3V96 A;  4BY1 B;  1SNC A;  3G6J B;  1DOM A;  1A2T A;  3C3L A;  3GTL H;  2K5W A;  1JMC A;  1KHI A;  2RCN A;  1SRU A;  2F0V A;  4H02 A;  3BZK A;  3RMH A;  4DV0 Q;  2UXD L;  1Z9F A;  1ZYR D;  3J7Z C;  1HCZ A;  5HGQ A;  1QUQ B;  1F9Q A;  1TWC B;  2F0P A;  1WTP A;  2B2W A;  2CHB D;  4DR6 L;  5C3E G;  3TZD A;  4ZK9 B;  1SBB B;  1UEA B;  5COY A;  1PHJ A;  4DAM A;  4K2K A;  4CKE A;  4UY8 C;  3HOV H;  5EPL A;  2OQ0 A;  3OHX C;  3E5S A;  4A3D H;  2D9U A;  1K3R A;  4X65 L;  5BN3 A;  1E1O A;  4JI1 Q;  3NE5 B;  1DGS A;  3TZU A;  4EGV A;  5FO7 B;  1K8O A;  2YYZ A;  4IJL A;  4A3J H;  3K57 A;  1S3O A;  2BDO A;  3S2H H;  4OEL B;  1II3 A; 
#chains in the Genus database with same CATH homology
 3K58 A;  5FLX E;  4QUF A;  1EWH A;  4QUC A;  5DM7 3;  3ND8 A;  1WTQ A;  3I4L A;  1IHZ A;  4RFB A;  5EQ0 A;  1LTB D;  1ROD A;  4KY7 A;  5DM6 3;  1S5C D;  3HP3 A;  2PCF B;  2PPB C;  2NN6 H;  1V1P A;  1TY2 A;  1NCV A;  4J8Q A;  1F77 A;  3HOZ B;  2EYH A;  4RGT A;  4G7H C;  4J1M A;  2E2I B;  3J80 E;  2AUJ D;  2JSO A;  2H4O A;  2EPB A;  5FOB B;  1LAB A;  3G7L A;  3RLF A;  1HPC A;  1F2M A;  1GUT A;  2JYO A;  1HUN A;  3DUZ A;  3W3A A;  3LNN A;  5M5X B;  4H0L C;  1DCZ A;  2NVX B;  1JR0 D;  1UUP A;  2R6G A;  2DN8 A;  5CBE E;  3N52 A;  2E75 C;  1SNQ A;  1TR5 A;  3NXW A;  1JWM D;  5C44 B;  3KLS X;  2QCP X;  2WP8 J;  1Q8I A;  2QIL A;  5E3F A;  1HTP A;  3VYU A;  2K28 A;  2BA1 A;  1LAC A;  2A74 C;  2TSS A;  1SE2 A;  1C4Q A;  1EY8 A;  1BDO A;  3NHH A;  4CKC A;  4DAY A;  1I50 B;  1TT2 A;  5EGT A;  4OO1 H;  1W6K A;  4C1N I;  3PUZ A;  2KED A;  4AYB B;  1TQO A;  2IX0 A;  5M3F B;  3M4O B;  1G8Z D;  4PMC A;  3GTO B;  3BZD B;  2RSO A;  3GTG B;  2DY8 A;  1KAB A;  3VR3 A;  5D3D A;  2Q8T A;  1TS2 A;  1BBX C;  1B9M A;  2PNR C;  3SXH A;  4IUV A;  1EY4 A;  2L0C A;  2NTT A;  3J80 L;  2K32 A;  2FHT A;  5M5W B;  5D65 A;  2XRS D;  3A8I E;  4ZQ3 A;  1XXG A;  1MI2 A;  4C3I G;  2KCC A;  2MUY A;  2BCO A;  3OOC A;  5C0X J;  1EQV A;  1SNM A;  2J7Z A;  2A6H D;  1VF7 A;  1EWC A;  3L3O C;  4BWG B;  2N55 A;  1ESF A;  3P7J A;  4NMZ A;  4EQN A;  3I72 A;  1ILP A;  4NW2 A;  4A3F B;  4C1N K;  2SNS A;  4QB4 A;  5JPN C;  4BA1 I;  1FD7 D;  3KBG A;  3HOV B;  1VMC A;  1A3T A;  4X3T A;  4BBR B;  1KAA A;  5JJZ A;  4IFD J;  1Z7T A;  1I6H B;  2A6E D;  1V1P B;  1HQR D;  4HCE A;  5EKI A;  3I73 A;  3BVG A;  4I7Z C;  3BS1 A;  3FPU B;  3VR5 A;  5JEA G;  1KLU D;  2F0D A;  4DFA A;  2EY2 A;  4X3K A;  1EY6 A;  1Q1B A;  4PNY A;  1F9P A;  4RKL A;  2MJ8 A;  1JC7 A;  1L0Y B;  2A6H C;  5C5L A;  5EJW A;  2ZXR A;  2EYM A;  5E4W C;  4DNT B;  1SDF A;  2EXZ A;  1GUN A;  2G9H D;  2JEA I;  3NSW A;  4DNR B;  4HMI A;  1CHQ D;  5KGU A;  4S3S A;  1F2L A;  2V4D A;  4JBW A;  1K8M A;  1EU4 A;  2A69 D;  1Y1V B;  2F0L A;  1F2Y A;  4U67 3;  1T5X D;  3H94 A;  2PYK A;  2B39 A;  3ND9 A;  4XYO A;  2A73 B;  1ENC A;  2K01 A;  2PW7 A;  2QEJ C;  4IQZ A;  1WTV A;  2NZ1 D;  2KCN A;  2WV6 D;  3CQZ B;  3PUV A;  3J81 L;  4KHZ A;  2HCI A;  3JAM L;  4MN3 A;  3BVM A;  1ESR A;  4A3I B;  1TWA B;  3A54 A;  4A3D B;  4KN7 C;  3GV3 A;  2BOS A;  1TVX A;  1STN A;  1G2S A;  1A3U A;  1V1O A;  1O7Y A;  3H6M A;  2HCC A;  5EBD A;  1ICW A;  1GJX A;  4FF4 A;  2FMC A;  2FJ2 A;  1QNK A;  1SJH D;  3NTI A;  2K05 A;  2D62 A;  2MHV A;  5C6A A;  1Q3L A;  1R4Q B;  5G3L F;  5DAU A;  2Z4H A;  3DM1 A;  1QCB D;  2RKS A;  4BBS B;  1Z47 A;  1EYA A;  1SYE A;  3E0J A;  3I70 A;  3D3R A;  1QIL A;  2EYO A;  2IPK D;  3RZO B;  4HR7 B;  4KY5 A;  5DNF A;  2F0I A;  3H0G B;  1V8Q A;  1R4P B;  5JAV A;  1U9R A;  4LMQ D;  1I3Q B;  1O78 A;  1PFM A;  1JOR A;  3J81 E;  4I65 A;  5JVG 3;  1IW7 D;  3MC0 B;  1H9K A;  4EVO A;  1EZ6 A;  3QG1 A;  5LL6 X;  2RVL A;  2F0Q A;  1GUO A;  2B8F A;  1EYC A;  2I07 B;  1AFP A;  3ONA B;  2A69 C;  1IYV A;  4KD3 A;  4GZY C;  3NP8 A;  2RSN A;  2E2J B;  1H9M A;  2G9D A;  4WOR A;  3MXU A;  2LFN A;  3MZ5 A;  2EZV A;  4L8J A;  4MHE A;  3S17 B;  2K5D A;  5HGT A;  3MXG A;  4IUT A;  3D4W A;  4C3H B;  4ZUI A;  3NTH A;  1YNJ D;  1RTN A;  3VA5 A;  4G7O C;  1NUC A;  1U4P A;  2F0F A;  1CHP D;  3U9S A;  5JPM C;  1PRT B;  1PYW D;  4QIW B;  1PTO H;  4IUU A;  1CA5 A;  5EBC A;  4FF3 A;  4WRD A;  3PIP 3;  2O5J C;  3DMU A;  3OWF A;  3P75 A;  1XX8 A;  3SK6 A;  3NWT A;  4CJ0 B;  1PRT F;  3WDN A;  1A6X A;  1PDQ A;  3CKI B;  3TP7 A;  5E4X A;  2KJX A;  3M7G A;  1SSO A;  1B4O A;  1SMY D;  5KEE A;  1TII D;  1CQF A;  1KTK A;  4HAE A;  4M8A A;  5FO9 B;  3BDC A;  1CZW A;  5JOB A;  3DWP A;  2RDH A;  1HA6 A;  1H9J A;  2L9H A;  4TSS A;  4K5X A;  1CTM A;  1WTX A;  1RJT A;  2XWJ B;  4KY6 A;  1JWU D;  1JB3 A;  5KYI A;  3T16 A;  2B2U C;  1IW7 C;  2L11 A;  2PMZ B;  3BYY B;  3K6O A;  3X3N A;  3BG3 A;  1J8I A;  1D5Z C;  2L4N A;  1H9S A;  1FNU A;  1DOK A;  1AZQ A;  4G57 A;  1NR4 A;  4TKO B;  1OXS C;  1F9R A;  4DAV A;  3S1Q B;  4OIJ A;  3O13 A;  4YIJ A;  1LTS D;  1EEF D;  4DA2 A;  5TSS A;  1BO0 A;  1BR9 A;  4G4K A;  4V19 0;  4HTH A;  1G6Z A;  3MTS A;  5IGG A;  1IKM A;  3HGB A;  3FEW X;  1WTO A;  2AWN A;  2TMP A;  5COR A;  1DJR D;  1KDC A;  3MFG A;  4IUP A;  1E2V A;  1B1Z A;  3M7N A;  3Q0A A;  1ENF A;  2IX1 A;  1E2Z A;  4XQN A;  1JIC A;  1DZ1 A;  1S5D D;  1SYG A;  5J22 A;  1E2W A;  1R9T B;  2EY1 A;  3KF8 A;  4V0B A;  3QWN A;  1BF4 A;  4G7Z C;  3GTQ B;  4H7B A;  2NVY B;  4DGZ A;  4H44 C;  5BN4 A;  2F0N A;  2N88 A;  3OIP A;  3SE0 A;  5EKL A;  5C4Z A;  1LT6 D;  1A2U A;  5F2D A;  1OXU A;  4Y7N B;  1TWG B;  5IGC A;  3I91 A;  3SR1 A;  1UNS A;  3TP8 A;  5HUR A;  1EU3 A;  3RZD B;  1GUS A;  1FR3 A;  3L9A X;  2I46 A;  1C48 A;  2WAQ B;  1HFG A;  5LHY 1;  1DM0 B;  1TY0 A;  1VMP A;  1IYU A;  1QOH A;  4C56 C;  2O4X A;  3PV0 A;  5EPK A;  4RAU C;  1GHK A;  1DXM A;  3Q6S A;  5IGD A;  1RF2 D;  4RH6 A;  2J4X A;  4PMW A;  2F0T A;  2HQE A;  3TDQ A;  4XYQ A;  5T1I A;  1D1K A;  3EJI A;  2WKD A;  5KNC A;  4LK1 C;  5CV9 A;  3S1M B;  3NK9 A;  1PRT C;  4FVM A;  2F0J A;  4RA8 A;  4O42 A;  3A55 A;  3HEJ A;  2MGS A;  5CMD A;  1JOQ A;  5NUC A;  1HXY D;  2EYP A;  2XN9 C;  5IGF A;  1YNN D;  1T5E A;  3IKJ A;  2X6L A;  4DXF A;  5C3E B;  2CQA A;  4XTC S;  1KNA A;  2F0M A;  2AQ3 B;  4A3K B;  1HHV A;  2R61 A;  5DEH A;  1DYQ A;  4CGY B;  1RD9 D;  3QJY A;  1Q90 A;  1M8A A;  1PZJ D;  2C5C A;  4UAI A;  2B2U A;  4A93 B;  2RDF A;  5AFW A;  3FDT A;  3N6R A;  2MP1 A;  2F3W A;  2VB2 X;  3D6W A;  1LT3 D;  4KJO A;  2RA4 A;  4K2L A;  3AU7 A;  4FO2 A;  5JEA H;  3PUY A;  5C0X H;  2KUM A;  2QDB A;  2XRQ D;  5A2Q L;  2JEB I;  3EA6 A;  3DHQ A;  3OWE B;  2OT2 A;  1CFM A;  4PMB A;  1KDA A;  2EJF C;  5IT9 L;  4IFD I;  2F4I A;  2K03 A;  4QMG A;  1RTO A;  4RCN A;  2A68 D;  1SFO B;  5ELD A;  1B2T A;  3OMG A;  1LTA D;  2IX3 A;  2QF7 A;  1TS4 A;  1BOS A;  5M9O A;  2BA0 A;  5JEA J;  4A3E B;  3TBI B;  3TP5 A;  3DWQ A;  1STB A;  3CU7 A;  2JXM B;  2EE1 A;  1EY0 A;  4XDX A;  2D2C C;  3MHB A;  2HDL A;  4ZYS A;  2JA6 B;  1SNP A;  4WJW A;  1I4H A;  2BE5 D;  4OO1 I;  1PXU A;  1TS5 A;  3H09 A;  2IJ0 A;  2NBF A;  3S1N B;  3C1F A;  4BY7 B;  1ET6 A;  4K6L A;  1C8C A;  3S9W A;  4ZRZ A;  4O1N A;  1LTG D;  3NQT A;  3I4N B;  5T1G A;  2ZT9 C;  1ZXT A;  1ENA A;  3PIO 3;  2JA5 B;  4PQX A;  1Y8N B;  5EKK A;  1QE6 A;  1FNW A;  5IT9 E;  3MFY A;  3MAQ A;  5I2Y A;  4FXD A;  1STA A;  3KK7 A;  2B2Y A;  2AQ1 B;  1EYD A;  4KHV A;  2X69 A;  3GTK B;  4CJ1 B;  5JVH 3;  3CRK C;  1OO9 B;  5ISR A;  3KUP A;  2VXW A;  1D5X C;  1G91 A;  3MVV A;  4KN4 C;  4JK1 C;  2L1B A;  3K5L A;  2Q8R E;  3LX0 A;  4HSV A;  5CR3 A;  2QKI C;  4LAA A;  4OHJ A;  1SND A;  1QB5 D;  2IT1 A;  4XT1 B;  3R93 A;  1GUG A;  3PO3 B;  3QO2 A;  3EQL C;  2NTS A;  1S5F D;  3HS0 C;  2OXP A;  2WAC A;  2A68 C;  2E76 C;  1U4M A;  1QWY A;  5IGE A;  1ILQ A;  4IFD H;  3PUW A;  2PQE A;  4ZKC B;  4CBV A;  3I3C A;  4C3H G;  2FFK B;  1TWH B;  3QOL A;  2ENB A;  3NBH A;  3P20 A;  3PUX A;  3GTJ B;  1YNN C;  5I2X A;  2L55 A;  1IL8 A;  2XSC A;  1VCI A;  1YNJ C;  2HUG A;  2Q8I B;  4KKT A;  1LO5 D;  5M3M B;  2PZU A;  5J39 A;  2MPM A;  3KBX A;  1CI3 M;  5C4J B;  4ZLT F;  2IWH A;  4KK7 A;  2R93 B;  3VA7 A;  2NWG A;  3NQI A;  4ZUJ A;  1CT1 D;  4TQU S;  1GOZ A;  3OW7 A;  4CHT B;  2JA8 B;  3TP6 A;  1WTR A;  3FKI B;  3OPO A;  3PMF A;  4FF1 A;  3J7Y W;  3C46 A;  2K33 A;  3VYS A;  1W6J A;  3BDO A;  1S5B D;  2EYL A;  1GUW A;  2KVM A;  5J1Z A;  3L7Z C;  5EPJ A;  5C0X G;  1Q12 A;  2AUK A;  2X6G A;  3OSO A;  4F8M A;  1D6E C;  1A15 A;  2C9O A;  2AWO A;  1CK1 A;  2FIN B;  1SAP A;  3VYR A;  4BS9 A;  1OXV A;  5C3X A;  2PW5 A;  4HN7 A;  4K6D A;  3T4A C;  1F2Z A;  5G3L D;  3SK8 A;  3MEH A;  3D4D A;  1FNV A;  1Q1E A;  1STY A;  2B2T C;  1PTO C;  1X32 A;  3S2H B;  3UI2 A;  2JA7 B;  2M00 A;  4A3G B;  3NWS A;  3EFX D;  2KA7 A;  1I6V C;  2IL8 A;  3HOW B;  4L63 B;  2L5T A;  1B3A A;  2H1E A;  5CBA E;  4OO1 G;  2A5H A;  1LTI D;  5CV7 A;  2NYZ D;  3HG9 A;  5ELF A;  4NKL A;  2B2V C;  5K36 H;  3S16 B;  2A6E C;  1CA6 A;  1HA5 A;  4ULL A;  3MXP A;  1AN8 A;  4A3B B;  4XQQ A;  1V43 A;  4HED A;  3HOY B;  4N9P A;  3IFD A;  2EY5 A;  1JQY D;  2EJM A;  2GA4 B;  4XT3 B;  1ML0 D;  4RGO S;  5I9P A;  3H91 A;  2B2T A;  2R3Z A;  1BXT A;  1JOO A;  1EOT A;  2OEO A;  1WD1 A;  4KI0 A;  5M5Y B;  2XWB B;  3T53 B;  1KDB A;  3HKZ B;  3A56 A;  1I4X A;  2L12 A;  2Z4I A;  3SDZ A;  3SK4 A;  2EYF A;  1EL0 A;  5CC4 A;  3DWA A;  5C4X B;  1S5E D;  1BCP F;  4HSP A;  5KND A;  2F03 A;  3K5N A;  4DK1 A;  4K5V A;  3S15 B;  1SNO A;  4HCS A;  3WOF A;  1I4P A;  2K1B A;  4K8I A;  1ONL A;  2BDN A;  3D8G A;  1HFN A;  1PZI D;  1NR2 A;  4B9X A;  3HRZ C;  3K0Y A;  2KQ3 A;  2F0S A;  1WD0 A;  5I9O A;  4U68 A;  3QB3 A;  2KEC A;  1D2B A;  5A35 A;  1STH A;  1HRJ A;  1PMR A;  1UAP A;  1SYC A;  4IUR A;  2ID0 A;  4CJ2 C;  1SJE D;  3TN2 A;  3AB9 A;  1QG7 A;  3KLR A;  4KKS A;  1O80 A;  2E2D C;  1F9S A;  1EQT A;  1RDP D;  5C4H A;  1WTW A;  3IAY A;  2EOT A;  1LT4 D;  4E6I A;  3I90 A;  5KIX A;  3GTL B;  4F87 A;  1K83 B;  3VR2 A;  4F7X A;  2F3V A;  3J7A F;  4IFD G;  3T13 A;  3D6C A;  3A7A B;  1XYI A;  2VNU D;  1JE4 A;  3T51 B;  3R2T A;  1XTC D;  3M3Y B;  3MXN A;  5CV6 A;  4XXE A;  4KV6 A;  1OXT A;  3SEB A;  1BCP B;  4EQP A;  3GO5 A;  3TME A;  3A8J E;  2R7Z B;  4RWS C;  3ZYY X;  3IL8 A;  3D31 A;  1AP0 A;  1EY7 A;  2WII B;  3PO2 B;  4P2C B;  3RUZ A;  4XQJ A;  1CQV A;  2LY7 A;  4IN3 A;  4N9T A;  1VF5 C;  3M4Y A;  5I6W A;  3K5O A;  3SHL A;  4OGQ C;  4FXG C;  5I6Y A;  5KNB A;  2DY7 A;  3FVQ A;  1H9S B;  4R8N A;  5ELE A;  5FKA C;  4K8J A;  1VDZ A;  2JP1 A;  3DXJ C;  1Y1W B;  1D1I A;  1J9O A;  2XVS A;  2RDG A;  3F2U A;  2WKC A;  3QOJ A;  4DAP A;  3Q24 A;  2WB1 B;  2NUC A;  2E74 C;  2NB0 A;  3DEP A;  3S14 B;  1BQQ T;  2KHS A;  1D5M C;  2Z1C A;  1SYB A;  5D3I B;  1ZEQ X;  1SXT A;  5FO8 B;  2F0K A;  1BNZ A;  2NN6 I;  1Y69 U;  4IUN A;  4FYD A;  4XIG S;  4UDU C;  1Z6H A;  4FP5 D;  1Y8P B;  4Q0F A;  3R8B A;  4B08 A;  2ZXP A;  3J7A V;  2O5I C;  4C2M B;  1U4R A;  2JE6 I;  4R9W A;  5KRU A;  2DNE A;  2B2V A;  3Q22 A;  4X3U A;  3V05 A;  2BE5 C;  1I4G A;  4QCL A;  1DOL A;  1PZK D;  1FYC A;  1EIG A;  1G29 1;  5ELC A;  3GQB A;  1MSG A;  4ODG A;  3HOX B;  3GTP B;  1GHJ A;  4RHS A;  4NP5 A;  5C3W A;  1CZG A;  4DU9 A;  1X3Q A;  1KLG D;  4QF4 A;  1BUV T;  4C3J G;  1NSN S;  2IW3 A;  2SEB D;  4OIK A;  4B9W A;  3BDL A;  2WIN B;  4RHR A;  3BYT B;  2K7V A;  3K59 A;  2F0U A;  3K7A B;  4ILW A;  2HDM A;  3NPP A;  4A3J B;  1B9N A;  1KNE A;  3OIQ A;  2LKV A;  3V2T A;  1MBY A;  4PV1 C;  3ITP A;  4BA2 I;  1QJO A;  2KOL A;  1RKN A;  4K5W A;  5IOD A;  5C0X I;  4X3S A;  4CKB A;  1ZYR C;  2F0G A;  1TS3 A;  1HUM A;  2PO4 A;  5IIF A;  3M85 A;  3I4M B;  3VR4 A;  1B53 A;  3GP7 A;  4RCO A;  3DEO A;  1L0X B;  4RGM A;  1SYF A;  4KJN A;  4ZKB B;  4C3J B;  2NVQ B;  5BN5 A;  2F0H A;  2F0W A;  3FPP A;  1PFN A;  4IUQ A;  5D14 A;  1TU2 B;  3EVQ A;  5C5M A;  3URY A;  4HMJ A;  1AEX A;  1PLF A;  3ERO A;  1EZ8 A;  2DNC A;  3C2P A;  3CRL C;  2SOB A;  2LMC B;  4F88 A;  3D4R A;  1PTO B;  4NDX A;  1IKL A;  4RKB A;  2K5Q A;  3Q23 A;  2Y0S B;  3A7L A;  3JAM E;  2ICE C;  5A2Q E;  2YU9 B;  3R2I A;  5FK9 C;  4KTA A;  4IAL A;  3X3M A;  3MWY W;  2EJG C;  2KEE A;  2PZW A;  4ME5 A;  5CGK A;  2F1M A;  3W2D A;  5IGB A;  2EY6 A;  4FNF A;  3GTM B;  1M4V A;  4FXK C;  2ZXO A;  2Z8L A;  3S2D B;  4A3M B;  1ET9 A;  1PTO F;  1S4Z A;  2O2L D;  2D5D A;  1LV9 A;  5KYL A;  1MGS A;  1PFB A;  2CW0 C;  4L6T B;  1PTO D;  2SDF A;  2NVT B;  2VUM B;  4C3I B;  3GD7 A;  1G2T A;  4M1U B;  3LWE A;  1TWF B;  3IFT A;  3FRP B;  1O7Z A;  1SE4 A;  3H3V C;  4IZ8 A;  4WFN 3;  1LTR D;  4RGN A;  1RHP A;  1I4Q A;  1LLR D;  1EY9 A;  4ABN A;  2NN6 G;  2B8G A;  1EY5 A;  1HQM C;  3P1H A;  2F0O A;  1BCP D;  3A8K E;  1EIH A;  1SYD A;  1X3P A;  3VYT A;  2B2Y C;  5K5P A;  2R92 B;  3AMU A;  1E0B A;  2ICI A;  1SEB D;  1RCV D;  2LS0 1;  4KMU C;  1PRT D;  4Q5V A;  3SK5 A;  1A3V A;  2K04 A;  3U9O A;  5IOC A;  3S1R B;  2J0T D;  1DON A;  3QIA A;  1QNU A;  5LL6 S;  3FMC A;  2M9V A;  1AW7 A;  1LTT D;  3HZX A;  1HTL D;  4TRD A;  3GV6 A;  3KLS A;  1H9R A;  5E1F A;  4EQO A;  2CVR A;  3NTK A;  4ZAI A;  3LWU A;  1JCK B;  4R8I A;  3HOU B;  2F0E A;  3RD4 A;  1Y8O B;  1U4L A;  3NUC A;  3BVZ A;  1AZP A;  1NAP A;  2CW0 D;  2XIW A;  4OL7 A;  4DK0 A;  1B50 A;  2E2H B;  3WOE A;  2EDG A;  4DN4 M;  3K5M A;  1GXD C;  1EEI D;  5FLX L;  2XNA C;  3CHB D;  4FF2 A;  1JOK A;  1LT5 D;  1B44 D;  1O7L A;  2AQ2 B;  3SVM A;  3E6Z X;  3OMC A;  4K14 A;  1OXX K;  3MA2 B;  4MIU A;  4Z9C B;  1TKW B;  4DXG A;  4KKU A;  5K36 G;  5CV5 A;  1STE A;  3TSS A;  1STG A;  4DF7 A;  2RQX A;  3C1E A;  3R3O A;  3VR6 A;  3I8Z A;  2B2W C;  2OF1 A;  1MSH A;  1JWS D;  4KD4 A;  3ERQ A;  2PZT A;  5CV8 A;  1WVL A;  2EVB A;  1XWE A;  2K6A A;  5CYU A;  2RBM A;  5ELB A;  1WCM B;  3T56 B;  1BCP C;  1FGB D;  2EYJ A;  4ID6 A;  1MD2 D;  4J6H A;  4LJZ C;  1SE3 A;  4H13 C;  3NBI A;  2FMM A;  1I4R A;  2VB3 X;  2B63 B;  5I4D A;  1SMY C;  2M2L A;  1EFI D;  1CM9 A;  1DD2 A;  4BY1 B;  2SNM A;  5CV4 A;  3V96 A;  1SNC A;  3G6J B;  1DOM A;  1A2T A;  3C3L A;  2K5W A;  2F0V A;  3RMH A;  1ZYR D;  1HCZ A;  1WTP A;  1F9Q A;  1TWC B;  2F0P A;  2B2W A;  2CHB D;  3TZD A;  4ZK9 B;  1SBB B;  1UEA B;  5COY A;  4K2K A;  4CKE A;  5EPL A;  3OHX C;  3E5S A;  2D9U A;  5BN3 A;  3NE5 B;  3TZU A;  4EGV A;  5FO7 B;  1K8O A;  2YYZ A;  3K57 A;  2BDO A;  1ZKO A;  1II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...