1GKHA

Mutant k69h of gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFHVGQFGSLMIDRLRLVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gkhA00
1Z9FA 5FJ8H 1P8LA 3G71A 4JI3L 3CCRA 3HOVH 1HZ9A 3NENA 3UDGA 4HIOA 3UE0A 2JA9A 5GADC 3T1YL 4EQ5A 4KHPQ 1V9PA 1I6HH 3HOXG 3AYHB 4IO9A 4YCVA 2I5HA 3KJPA 4GNXB 2B63H 4DR4Q 5IYCH 2NVXH 4B3SL 2JA6G 4A3DH 4O0AA 5M5WH 4DR2Q 1LYLA 1FJGQ 4APVA 5LMNW 1YJWA 4LF4L 1HZBA 5ELOA 4UPAA 3H3VH 2N78A 1J5EQ 3B6YA 4TVAB 1VQDA 2N8NA 4Y7NH 3M85A 4GNXC 2Q2TA 2OTJA 3E9IA 3CCMA 1XPRA 2E2IH 1LM0A 2VW9A 1W2BA 3PUYA 3KF8B 2V1CC 3CQZH 2QA4A 1X3FA 3A0JA 4PZ8A 3AFPA 2VY3A 1VQMA 3S16H 2JQOA 1WCMG 1X54A 1YEZA 2KHIA 3M4PA 4KLKA 3J81c 1VQKA 4JV5L 1X3GA 2VUMG 4LUOA 3CMEA 1WI5A 5C0XG 4DV0L 3HOWG 3PIOA 3PSIA 1MKHA 1GKHA 2CWPA 3NELA 4UY8C 2R92G 3RLOA 1BBUA 3E0EA 2MNAA 4Y52H 5J3BA 1QUQA 4EX5A 4OO1I 2QGQA 4X62Q 4DV3Q 1HNXL 3GTOH 1PHJA 4R4QA 2CFMA 4B3TL 3JC66 3HOXH 4BA1I 4L5RC 4DV6Q 4NXNQ 4OX9L 1OXUA 1IL2A 1HNWQ 5GAEC 1XPOA 2AKWB 3M4QA 4X66Q 2JA6H 1VQNA 3MEFA 3KDFA 4A93G 3UDFA 2YYZA 4LUZA 1HR0L 3FKIH 2HIVA 3PGZA 4C2MH 4HJ5A 4UP7A 2F4VL 2JA7G 4BXXG 3HKZG 1U5KA 4A75A 1SFOH 3J81j 2UXCL 4DK6C 2B3GA 1S3OA 2PNHA 4LFBQ 4HJ8A 5IYDG 1AE2A 1YI2A 3ULPA 1PH4A 1D7QA 1KXLA 3W1BA 1N34L 5LMNQ 1VQOA 4YY3Q 3I55A 4LF9L 4JI1Q 2R92H 3UDIA 3ULJA 2ZM6L 3A74A 4LF7Q 2AWNA 4DR6L 4ME3A 2BH2A 3S1RH 4DR3L 1EQRA 4BY7H 2E2JH 3I4NG 2KCMA 2K5VA 4GLVB 2FXQA 3T1HL 1MJCA 1I94L 1EIYB 4JI2Q 2JK8A 1CUKA 1JJCB 4A3MG 1HNZL 3PO3G 5JJIA 3HOUG 1PV4A 5H1SE 4DPGA 2VNUD 2R7FA 2IX1A 3S15H 2K75A 1G51A 2MO0A 2WAQE 4PZ6A 4NXMQ 4A3GG 2HHHL 4OO1G 5LMUQ 4A3EG 3ZJYC 1C7YA 3CC7A 5IWAQ 1UE5A 2CWAA 2JA7H 4BXXH 1L1OB 3STBD 1ASYA 1V1QA 4GNXA 2R7ZH 4LF5L 4DV4L 2A8VA 4DV5Q 3S17H 1PYSB 2PMZE 3FP9A 1CSPA 2UXDL 1L1OC 2YTXA 2Z0SA 1Q86C 1IBLQ 4XIGS 3BZCA 4GKJL 1U0LA 1CSQA 3LGJA 4P71A 1GM5A 5AJ3L 3CC4A 1QVFA 4FDBA 4IJHA 3CD6A 5IE8A 3JAMc 4JI7Q 2JEBI 3I4NH 3HOZH 1SROA 1I5FA 5M3FG 2UU9L 1FL0A 4O2DA 2IHEA 4GOPB 4JYAQ 1XNQQ 1AE3A 4R4TA 3GTJH 3PO3H 2WFWA 3TQYA 4NB3A 1OXVA 5FLXc 4BA2I 2JJQA 1GD7A 2NZOA 4MZ9A 4JI8Q 2K52A 4BY1G 2H5XA 3J81i 1Q1EA 4X64L 2DGYA 4A3EH 3PO2H 1IZ6A 1CKNB 1N36Q 2EQSA 2WB1G 4P73A 3G48A 5ELNA 3L2PA 1VQ5A 2IT1A 1UWVA 2RHSB 4LNQA 1JT8A 3BJUA 1BBWA 2ZJPA 4A3IG 2ZTDA 4A76A 4JOIA 3WWVA 1IBMQ 2Q2IA 3UE1A 4B3SQ 2Z6KA 1PH6A 1KAWA 3CW2C 4LW1A 4LFAL 3S2DH 4MTNA 4P75A 2JEAI 1Q8KA 1OXXK 2NN6I 4PZ7A 5IP7G 1YITA 1VQJA 4LF4Q 1Y1WG 1T9HA 1WJJA 4HJ9A 2Y0SG 2JE6I 2A19A 3J7ZC 4DV7L 2D0OA 1EFWA 2NVQH 1NMGA 4WJ3M 2WB1E 3NEMA 4A3CG 1CKMA 3L0OA 3GTGH 2MFIA 5M3MG 3OTOQ 2YTYA 4A3FH 1PH9A 2UXBL 1HJPA 1TWCH 2JA8H 2DUDA 2B29A 1B70B 3I56A 1XJVA 4BBRG 1NTGA 3GTQH 2VL6A 1PVOA 3EBEA 4BY1H 4DV0Q 2EXDA 4DV1L 1VQGA 1Y14B 5GQOA 2ZJQA 1A8VA 2OWOA 3IRBA 3PCOB 5HY6A 5C4XG 2UUCQ 3TRZA 1N32Q 2XGTA 3F1ZA 1X9NA 2RHQB 3S1NH 4JCVE 2Y0SE 1QZGA 4QIWE 4JI6Q 4B3TQ 4A3LG 4JC0A 1M90C 4A3IH 1E1TA 4JI5Q 4X65Q 1SRUA 3I4MG 4K0KL 4DR5L 1KHIA 5FLMG 1PH5A 3KF6B 4IFDJ 3I2ZA 4GN5A 4DR2L 2A1AA 1FJGL 1K8AC 3KFUA 1L1OA 2OCEA 1Y1WH 1UE7A 4DR7L 3G4SA 4GKKQ 1PFSA 1J5EL 1VQHA 3CPFA 3HFZB 2F4VQ 3STBC 4A3CH 4PMWA 1FVIA 3DM3A 5M3MH 1KL9A 1K73C 3CC2A 2E5LL 3W1GA 4LF8Q 1E24A 3ICEA 1C0AA 4QJFA 4BBRH 2NN6G 1K0RA 1SE8A 5K36G 2HQLA 4AQYQ 2I5LX 1YHQA 1TXYA 2D0PA 3I4OA 1UE6A 4AH6A 5M5XH 4LF9Q 2VQEQ 1YHAA 1WCMH 3PF5A 3S2HH 2ZM6Q 1B7YB 4JI0L 1TWAH 2WAQG 5C4XH 2VUMH 4GN4B 4GOPA 2AWOA 1N33Q 1OTCA 3HOWH 4X62L 4DV3L 1YHBA 3H0GG 3JAMi 1NE3A 1B8AA 4LFCL 3CMAA 1DGSA 2ALYB 3T1HQ 2E2HH 1KIXA 4A3LH 2KHJA 1HNZQ 5IYBG 4NXNL 5FLMH 3MXNB 1EWIA 4C3JH 4B3RQ 1HNWL 1YJNA 2K5HA 1Y1VG 4X66L 3A5UA 4OWWB 1XMQL 1CKNA 4A3KG 1YVCA 2HHHQ 3AEVA 4H02A 1C9OA 5C3EG 1YBYA 1YNXA 1IYJB 2ZTCA 3KJOA 3K7AH 4POGA 1VQBA 4A93H 2RCNA 1XNRQ 2K50A 3K0XA 1CKOA 1SN8A 3CCUA 2I0QA 2LXJA 3NBHB 3CP0A 1QVCA 2ZTEA 2AHOB 4LF5Q 2ASBA 4DV2Q 3TS2A 1HH2P 4JBWA 4LFBL 3AFQA 2R93G 3I7FA 4JI4Q 4P72A 4GN3B 1N8RC 3GTLH 4A3BG 4DNIA 2LSSA 5BR8Q 4YY3L 3GTMH 5AJ3Q 4JI1L 4B3ML 5IYDH 4KHZA 1VQIA 2MQHA 5IY0A 3FHWA 1E22A 2KCTA 1HZCA 3GDEA 3M9BA 4AYBG 2D62A 1GO3E 1IBKQ 2PI2A 3F2BA 4HJAA 4YHHQ 4HJ7A 3TS0A 4DUZQ 1YIJA 4YWLA 5IYBH 4L5TA 4ALPA 1XMOL 1BKBA 3EN2A 2UUAQ 2NVTH 3CCEA 2E8GA 4QGUA 1Y1VH 4IPDA 4BBSG 4JG2A 1AH9A 1HZAA 4R4CA 3M4OH 1X3EA 5JJLA 3ULLA 1Q46A 4A3KH 1VQ4A 1M1KC 4A3MH 2OQKA 5C3EH 1KQSA 1XTDA 5IP9G 1VQPA 1X55A 3HOUH 3KYHC 2QEXA 2Q2HA 4LF6Q 3GTKH 5JEAJ 1G6PA 4IFDI 4A4IA 3HOYG 1YJ9A 1UE1A 2UUBQ 4A3GH 4WJ4A 1TWHH 3RN2A 1SLJA 1PH7A 4GLAC 4DAMA 4AYBE 2IY5B 3PUXA 3KF6A 4LUVA 3CCQA 1HR0W 3L7ZC 2YU9H 2R93H 3Q8DA 4DV5L 4JI3Q 2VS1A 1PH3A 3K81C 3J7A5 1K8GA 1S72A 1VQ7A 1NY4A 1IBLL 2BA1A 5IYCG 4LFAQ 3T1YQ 2K14A 4A3DG 1VQCA 4IJLA 1VS0A 2VQFL 1QVGA 2R7DA 4A3JG 1JB7A 1LUZA 4IOCA 4JI7L 3TREA 4R4OA 2R6GA 3GD7A 2N3SA 1N36L 3W5OA 2JA5G 4C3HH 3CAMA 1I50H 4JYAL 3BU2A 3RZOH 3F2CA 1XNQL 3RNUA 3DLLA 1E7ZA 1K83H 4DUYL 5M3FH 2I5MX 3ERSX 4IOAA 3RN5A 3VDYA 1VQ8A 4JBKA 4HIDA 1W3SA 3HKSA 4JI8L 3S1QH 1MIUA 4MNOA 3F2DA 4JBJA 1GVPA 4JV5Q 3M3YH 1VQ9A 2F52A 4RMFA 4P74A 1D8LA 1H95A 1A62A 1E1OA 2GVBA 3E9HA 4HIMA 4DR1L 2CCZA 3S14H 5GAHC 3CCLA 4POFA 5IT9c 1P16A 2K5NA 4TQUS 4K0KQ 3PIPA 4DR5Q 1KC8C 1O7IA 1WOCA 1IBML 1HNXQ 2L15A 1KRTA 4HIKA 1X56A 4IFDG 3U4VA 1JMCA 1FGUA 2ID0A 3RLNA 4KHPL 4OX9Q 4YCWA 4A3JH 1PA6A 1VQAA 4DR7Q 3FKIG 3RR5A 4DR4L 2IX0A 1N9WA 4IPGA 2JA5H 3J80c 3D31A 5IP7H 1HR0Q 2E5LQ 4OWTB 1EUJA 3K80C 3OTOL 1LTLA 1X6OA 4UP9A 1Z47A 5GROA 3CCVA 3PUWA 4R1JA 3CXCA 3CF5A 2Q2UA 2PQAB 3PUZA 5EAYA 2UXCQ 1VQFA 1TWGH 1VCIA 2PI2E 4JBMA 4C3IH 3GTPH 1BVSA 2BH8A 4JI0Q 4OWXB 2OTLA 3K8AA 2YV5A 3F8TA 5C0XJ 1KRSA 1N34Q 2UUCL 1N32L 4BY7G 1E3PA 1VQ6A 4LFCQ 4JI6L 2LXKA 4DR6Q 3CPWA 4DR3Q 4JI5L 2HIXA 4QL5A 4X65L 4R4IA 2IHFA 1G291 3GO5A 1K3RA 3KLWA 4YWKA 1K9MC 1XMQQ 1I94Q 1SR3A 2CQOA 3I4MH 3PF4A 3S1MH 2KBNA 4DV6L 1R9TH 1OXSC 1PH8A 1EYGA 4GKKL 1SMXA 1RL2A 4QY7A 1Q12A 2CKZB 2GN5A 3PUVA 2YTVA 1EOVA 1X65A 1Q7YC 4JOIC 1Q81C 1J6QA 4DKAC 2WP8J 4LF8L 2Z6KC 1WYDA 2R7ZG 4OXPA 1WFQA 1UEBA 3ER0A 2XTIA 3M7NA 2GVAA 3H3VI 5HGQA 4AQYL 1PH2A 4DV4Q 2BA0A 1TWFH 1V43A 2EIFA 1MJEA 2VQEL 5DLQE 4B3MQ 5GAGC 5C44G 2UXDQ 2HT1A 4L5QA 4GKJQ 2ES2A 4X6AH 1N33L 1L2FA 3U4ZA 5LMNL 3HOZG 5C4JH 4YCUA 2C35B 1NMFA 3RZDH 4UP8A 4LF7L 4QQBX 3HKZE 4OONA 1XMOQ 4B3RL 3H0GH 1A0IA 2UU9Q 1A63A 1QUQB 2AMCB 1JJGA 3CCSA 1S40A 4JI2L 1PYBA 2VZAA 1EIFA 1IXRA 1XPUA 3PO2G 3UDXA 1Q1BA 4LWCA 3A5ZB 3U50C 5JEAG 3K7UC 2F3IA 4NXML 2K4KA 1XNRL 4YWMA 3EIVA 4X64Q 1ASZA 5LMUL 5JJKA 3KDFB 2OQ0A 4GS3A 3KOJA 4DV2L 5E7NA 5IWAL 2MO1A 1OXTA 5FJ8G 3HOVG 1QZHA 4JI4L 3PV0A 4J15A 1Q82C 1PH1A 5BR8L 3TEHB 5C44H 2NVYH 1NJIC 1JJ2A 1L0WA 2VQFQ 2ATWA 2RF4A 4DK3C 4L5SA 3D0FA 3S24A 4IPHA 4A3BH 1JE5A 2B63G 3AQQA 4AIMA 4PG3A 4RG1A 4XTCS 1IBKL 1VQEA 4YHHL 4DUZL 5M5YH 2PQAA 4A3FG 5C0XI 3J80i 4IPCA 4DUYQ 3G6EA 2UUAL 4GLXA 4DV7Q 4DAYB 2N49A 2JA8G 3OW2A 4NPSA 1YZ6A 3U58A 2UXBQ 4GOPC 2NZHA 3CCJA 1NBWA 3OYYA 4BBSH 1EQQA 4LF6L 2UUBL 1RIPA 4DV1Q 4KI0A 2KENA 5IP9H 3BZKA 4DR1Q 1I3QH 3RLFA 3SGIA 1VQLA 3H15A 1KD1C 3HOYH 2ZJRA
chains in the Genus database with same CATH superfamily
1Z9FA 3CCRA 1YNND 2MUYA 4C3IB 1V9PA 4BBRB 2PW5A 5CV5A 5M5WH 2E2DC 3S2HB 2F0LA 4APVA 1YJWA 4LF4L 3H3VH 3G7LA 2VUMB 1JQYD 3M85A 2N8NA 1DJRD 2L0CA 3E9IA 1T5XD 2F3VA 1EU3A 2E2HB 3PUYA 2V1CC 3CQZH 1X3FA 3AFPA 3I4MB 1X54A 1YEZA 3M4PA 2KHIA 1XWEA 4DU9A 3J81c 2VUMG 1PYWD 3NTKA 1I4PA 3PIOA 3PSIA 1SXTA 2AQ3B 1SE4A 2CWPA 4KK7A 4R8NA 2R92G 3RLOA 2MNAA 1QUQA 1II3A 2F1MA 4OO1I 1HNXL 3KBGA 3GTOH 2F0VA 2KVMA 4BA1I 2XSCA 4DV6Q 4NXNQ 4OX9L 1CQFA 5GAEC 1XPOA 2ZXRA 3EROA 1VQNA 3MEFA 4A93G 3UDFA 2MJ8A 1EL0A 1Y69U 4HJ5A 2N55A 4G7OC 3HKZG 1U5KA 1SFOH 1LT4D 3NSWA 1HA6A 2B2UA 5IYDG 1YI2A 2PMZB 4HMJA 5DNFA 4KY7A 5LMNQ 1VQOA 4YY3Q 3I55A 2R92H 3H91A 2KOLA 4ZKCB 2F3WA 4A3GB 4KMUC 3SE0A 2XWBB 5CBEE 5I6WA 1CUKA 1Y8PB 1PV4A 1H9KA 1G51A 2MO0A 4A3GG 2B2YC 2HHHL 1LTID 3ZJYC 4I7ZC 5EBCA 4XQNA 4IALA 4B9WA 2A8VA 4L6TB 1L1OC 4U673 2HCCA 5TSSA 4HAEA 4P71A 1HA5A 3CC4A 1D2BA 1PLFA 1QVFA 3D8GA 4IJHA 2IJ0A 5IE8A 3C46A 1ENAA 1WTRA 1I5FA 3VA7A 1FL0A 1PRTF 3DWQA 4GOPB 3VR4A 4KY6A 4K14A 4R4TA 5JAVA 5FO8B 2WFWA 2X6LA 2L5TA 2A74C 4OELB 5DM73 2NVXB 2NZOA 4BY1G 3TZDA 1SNMA 5DM63 3SK5A 5LHY1 3J81i 2DGYA 1N36Q 5CV6A 3MFYA 4P73A 4Y7NB 1VQ5A 2JA5B 2IT1A 1RTNA 4LNQA 2F0PA 2PO4A 3BJUA 3CRKC 4A3IG 5A35A 5IODA 2Q2IA 4LFAL 4MTNA 2NN6I 1YITA 2B8GA 1T9HA 1WJJA 2RDFA 5EQ0A 2JE6I 2A19A 3J7ZC 1I4RA 2D0OA 2HQEA 3K59A 2NVQH 1G91A 2WB1E 3L0OA 2H4OA 4QMGA 3I56A 1RCVD 1SJHD 4BY1H 4DV0Q 4PQXA 3FKIB 3IRBA 3TRZA 4JVZA 2XGTA 5CORA 2Q8IB 3S1NH 4JCVE 3IAYA 2Y0SE 4JI6Q 5BN5A 4JC0A 3A56A 4A3IH 3MEHA 4X65Q 1PH5A 5FLMG 3R8BA 2XN9C 1ET9A 1IL8A 2A1AA 2A69C 3G4SA 1PFSA 1J5EL 3CPFA 5CV4A 3S1RB 4XT3B 4BY7B 4HEDA 3DM3A 1KL9A 1BDOA 2E5LL 1U4LA 3SHLA 3W1GA 4LF8Q 3OPOA 4FF1A 5K36G 2HQLA 1YHQA 1TXYA 5M5XH 5C3WA 3PF5A 4M1UB 2F0OA 1RF2D 3E0JA 4K8IA 2EYHA 4GN4B 1SYBA 4GOPA 1OTCA 1N33Q 1NE3A 5AFWA 4LFCL 3AU7A 1KDAA 2KHJA 5FLMH 3MXNB 1HNWL 3O13A 1CFMA 2K5HA 1Y1VG 2GA4B 1PTOB 4H02A 1C9OA 5KNDA 1CTMA 1YBYA 3PMFA 1IYJB 1KAAA 1SYCA 1GUOA 1XNRQ 2KECA 1CKOA 3K0XA 4K5WA 2HD3A 3CCUA 2I0QA 3CP0A 4WRDA 4LF5Q 1B2TA 1Y8OB 4HR7B 3TS2A 4AYBB 3AFQA 3NQTA 3I3CA 3I7FA 4P72A 5K36H 4A3BG 5AJ3Q 4KHZA 3PO2B 1H9JA 4L63B 2PZUA 5E1FA 2KCTA 4AYBG 1IBKQ 2OT2A 2PI2A 4U68A 4HJ7A 3TS0A 1J8IA 1DOMA 1BKBA 3EN2A 3KF8A 2NVTH 1STHA 3HOVB 1Y1VH 1BXTA 1HZAA 4I7AA 3ULLA 1Q46A 4YIJA 1XTDA 1D5ZC 3KYHC 4LF6Q 3J80E 1ILPA 5JEAJ 4A4IA 3HOYG 1DYQA 4RHSA 2EVBA 1TWHH 2F03A 1SLJA 4DAMA 1CZWA 4A3FB 3L7ZC 5E4WC 2VS1A 2E2IB 1D5XC 4A3DG 2PYKA 1VS0A 2WIIB 3S16B 2M9VA 1QVGA 1JCKB 4A3JG 4JI7L 2B2UC 1I50H 3BU2A 1RKNA 1XNQL 3DLLA 1K83H 3RN5A 5IGFA 2EYJA 4JI8L 1KDCA 3RD4A 5T1GA 4PMBA 1I4GA 5JPNC 3TN2A 2JA6B 1VQ9A 3NUCA 3MXNA 3DHQA 1BQQT 3LWUA 3CCLA 2Z8LA 5LL6X 1HRJA 1KNEA 4K0KQ 4DR5Q 3DXJC 4CKCA 1IBML 1HNXQ 2L15A 4HIKA 2ID0A 1DOLA 4OX9Q 1JICA 4A3JH 4DR7Q 4C56C 3J80c 3VYRA 1JWSD 3K80C 4ZYSA 2HDMA 4C1NI 3CCVA 2Q2UA 1S5ED 2PQAB 3PUZA 2PPBC 4LMQD 1IYVA 3GTPH 4IZ8A 1BVSA 4IUNA 4CJ0B 1CHPD 3I72A 2K05A 1N32L 1H9MA 2FJ2A 3TP6A 1G2SA 2LXKA 3VR2A 5CV9A 1X32A 1V1OA 1G291 4YWKA 3KLWA 2PZTA 4QUFA 3PF4A 2EYMA 4DV6L 1O80A 1R9TH 1SEBD 4ODGA 4GKKL 1YNJC 2KCNA 1Q12A 3CHBD 1I6VC 1E2WA 5KEEA 1X65A 3HG9A 1L0YB 2JP1A 3BS1A 1WFQA 1UEBA 2MP1A 4ZUJA 2PZWA 3M7NA 1C48A 3M4OB 4AQYL 3V96A 1TWFH 3GQBA 1WTHA 4B3MQ 5DLQE 3HOUB 3GTKB 2ES2A 4X6AH 5LMNL 2K32A 3QJYA 1DM0B 4QQBX 3BVGA 1K8MA 1XMOQ 2YU9B 4B3RL 3H0GH 3H6MA 5CV8A 2F0IA 1FD7D 3OMGA 3HEJA 4XT1B 2AMCB 1JJGA 4LJZC 2O2LD 1Q1BA 3A5ZB 3U50C 1EY9A 4RKLA 1ASZA 5JJKA 4GS3A 1PXUA 4HCSA 1Q3LA 4DV2L 1BCPB 1S5CD 5FJ8G 1OO9B 3BDOA 4KV6A 2FINB 1Q82C 4E6IA 1NJIC 1JJ2A 1L0WA 4DK3C 3S24A 4J8QA 4PG3A 2F4IA 1JB3A 1S5FD 3DEPA 2PQAA 5C0XI 3J80i 1EWCA 4DUYQ 1QNUA 4X3UA 4GOPC 3CCJA 5J1ZA 4BBSH 4LAAA 1CQVA 1I4HA 1RIPA 5L37A 3T13A 5IP9H 4DR1Q 1VQLA 5IGBA 3H15A 1KD1C 1N36L 4QIWB 5FJ8H 2E74C 3G71A 1DONA 1HZ9A 1EYDA 5M3MB 1U4RA 2JA9A 3T1YL 1NAPA 5I2YA 1I6HH 1JE4A 4YCVA 5G3LD 2I5HA 4GNXB 4DR4Q 1W6JA 5IYCH 3OW7A 4O0AA 4G7HC 4UDUC 1LYLA 4HN7A 1EQTA 5LMNW 1LTBD 5EPLA 1TWAB 1J5EQ 1VQDA 3HOWB 5CV7A 2PCFB 2AQ2B 3NP8A 3A0JA 2VY3A 3TP8A 1K3BC 1IHZA 3VA5A 1WCMG 4KLKA 4JV5L 1XXGA 5EGTA 1WTWA 4DV0L 3HOWG 3KUPA 2PQEA 1ML0D 1LT5D 2QGQA 4QB4A 3FMCA 1B1ZA 2F0UA 3J7AV 2QKIC 4L5RC 1HNWQ 4QCLA 2AKWB 5EKIA 2XIWA 2EXZA 4LUZA 2WAQB 2O5IC 2HIVA 1G2TA 2EJFC 1TR5A 3BYTB 3J81j 2UXCL 4DK6C 5FLXE 3M7GA 1HXYD 1S3OA 3BYYB 1CM9A 5C5MA 3SK6A 1O78A 1N34L 4A3KB 5C3EB 1XYIA 3UDIA 4DK0A 3IFTA 5IT9L 3A74A 1B9MA 4DR6L 1EQRA 4CHTB 2FXQA 4QF4A 1MJCA 3QIAA 2F0QA 4JI2Q 1RDPD 1JJCB 4N9PA 2R93B 5JJIA 5BN4A 1HTPA 4PNYA 4DPGA 3D4WA 2R7FA 4ZAIA 5I2XA 3S15H 1EU4A 4N8X1 4PZ6A 4J6HA 1ESRA 3Q22A 2B2WC 1PTOC 1CI3M 4ULLA 3E6ZX 2A69D 4A3EG 3TDQA 1UE5A 2CWAA 1ASYA 5FK9C 4GNXA 4MIUA 2R7ZH 4LF5L 1KTKA 2NBFA 1B44D 3S17H 2PMZE 2UXDL 2YTXA 4XIGS 3BZCA 4GKJL 1U0LA 1G6ZA 5J39A 3DEOA 1BCPF 5AJ3L 1PRTB 4ZQ3A 4FDBA 1I3QB 2MHVA 1MI2A 4JI7Q 3QOLA 1EOTA 3HOZH 1PFNA 5M3FG 3BDCA 2IHEA 2PW7A 1XNQQ 1AE3A 1RHPA 3GTJH 1FR3A 3FDTA 3V05A 5FLXc 2JJQA 1E0BA 3R3OA 4JI8Q 2K52A 1FGBD 2K1BA 4A3EH 2EDGA 1IZ6A 2EQSA 2KEDA 2RHSB 4WORA 3CRLC 2Q8TA 3CQZB 1BBXC 2ZJPA 2DNEA 2ZTDA 4JOIA 4ZRZA 1IBMQ 4B3SQ 3S2DH 1NCVA 2B2VC 1XX8A 4P75A 5ELFA 1Q8KA 4PZ7A 5IP7G 3SK4A 1Y1WG 1WD0A 3KBXA 2DY8A 2VB3X 4KD3A 4DV7L 1EFWA 1IW7C 2MFIA 2X6GA 2YTYA 2UXBL 4C3IG 2JA8H 1B70B 4BBRG 1NTGA 3GTQH 1NNXA 2VL6A 1E2VA 3EBEA 3T51B 3NQIA 3S1MB 5FO7B 4IUPA 2AUJD 3PCOB 1N32Q 3F1ZA 1ZYRC 2WV6D 1SJED 4B3TQ 1M90C 3I4MG 4K0KL 4DR5L 1KHIA 5CBAE 1HCZA 2B39A 3I2ZA 5I6YA 4BWGB 5CGKA 4DR2L 3P75A 2OCEA 1Y1WH 1UE7A 5FO9B 4DR7L 3TZUA 4GKKQ 3HFZB 4FVMA 2QILA 2XNAC 4CGYB 5KNCA 1LTAD 3STBC 2Q8RE 2F0KA 2BDOA 1K73C 2O4XA 2KCCA 4BBRH 4C1NK 1K0RA 1SE8A 4AQYQ 2D0PA 4LF9Q 3S2HH 1EYAA 2C5CA 2QEJC 2VUMH 2AWOA 1FNWA 1M8AA 4X62L 4DNRB 3VYSA 1TS2A 2RBMA 2E2HH 3T1HQ 4NKLA 2ALYB 5EBDA 4B3RQ 4X66L 3A5UA 1SNDA 4QUCA 4OWWB 3AEVA 1VMCA 2ZXPA 4KTAA 2F0HA 1YNXA 1EY7A 3K7AH 4NW2A 4A93H 2RCNA 1SN8A 3NBHB 1HTLD 3I4LA 1QVCA 2BOSA 2ZTEA 4DV2Q 1LACA 3J81L 2A6EC 1N8RC 4DNIA 3D4DA 3IFDA 2VB2X 4B3ML 5IYDH 1K28A 1STNA 2C9OA 5IY0A 1HZCA 5EPKA 2Z6BA 2N88A 2RA4A 3AMUA 1AFPA 2CH4A 4L5TA 3EVQA 1XMOL 2E8GA 4JG2A 1U9RA 4R4CA 2D9UA 5JJLA 2B2TA 3QG1A 3M4YA 2O5JC 1IKLA 1X55A 2B63B 3BG3A 2F0JA 4IFDI 1YNJD 1SYGA 1YJ9A 4A3GH 2ZXOA 1A15A 4AYBE 2NTSA 3PUXA 4LUVA 3HP3A 1PH3A 3K81C 3ND8A 1K8GA 1SNCA 1IBLL 3T1YQ 1JOOA 2NUCA 2WKCA 1LUZA 1U4MA 2F0MA 4ILWA 5KYLA 4IOCA 5ELDA 2R6GA 3W5OA 2JA5G 3S1NB 4I65A 2KA7A 5COYA 3RNUA 3P1HA 3D4RA 1E7ZA 4DUYL 3VDYA 4JBKA 1R4QB 3HKSA 3J7AF 3S1QH 2ICEC 3HOXB 3NTHA 1EYCA 3KLRA 2IPKD 4JV5Q 4EQOA 4P74A 3TSSA 1D8LA 1A62A 2FMMA 3E9HA 4HIMA 4DR1L 1ENFA 2CCZA 5GAHC 2K5NA 4C2MB 2OF1A 4X3SA 1KC8C 3MZ5A 1KDBA 5I9PA 2QDBA 1X56A 1STEA 3U9SA 1PA6A 3FKIG 1LTTD 4DR4L 3NBHA 3A55A 2JA5H 3D31A 1B4OA 4ZK9B 1JWUD 1A3VA 4OWTB 3C2PA 2NTTA 1LTLA 1X6OA 4UP9A 1HUMA 2E2JB 3OIQA 4G4KA 2UXCQ 2K5WA 1VQFA 1KLUD 4JI0Q 1N34Q 5C0XJ 4BY7G 2EPBA 4DR6Q 4RHRA 4HCEA 2JA7B 4JI5L 4QL5A 4R4IA 1F9QA 1XMQQ 2SDFA 3BDLA 4KY5A 5D65A 1EYGA 1SMXA 2G9DA 4QY7A 1RODA 5IGCA 1DD2A 3PUVA 3MXGA 2VXWA 1Q7YC 4JOIC 2NZ1D 2WP8J 2K6AA 1BUVT 3I4NB 4P2CB 2XTIA 3W2DA 1DOKA 3H3VI 1E2ZA 3AB9A 1VQ6A 1V43A 3PO3B 1MJEA 2VQEL 1TS5A 1AW7A 2UXDQ 2F0WA 3I90A 4L5QA 4GKJQ 5A2QL 4UAIA 3T4AC 1PZID 3KLSX 1NMFA 3RZDH 4UP8A 2Z4HA 4OIJA 4OIKA 1LABA 3BVMA 1A63A 4ZCKA 2NWGA 3OWFA 4JI2L 4H13C 3PO2G 4LWCA 1GUGA 4X3TA 5JEAG 1JWMD 2F3IA 2K4KA 4JK1C 1PDQA 3KDFB 2OQ0A 1X3QA 1UNSA 1WTPA 2MO1A 1F2MA 3E3XA 3HOVG 1QZHA 1SNOA 4JI4L 3PV0A 5ELCA 3GTGB 2RDGA 1PTOH 2R61A 3A8IE 3TEHB 5BR8L 1PH1A 2ATWA 3MXUA 4L5SA 1EIHA 3D0FA 4F87A 4RCOA 4RKBA 1B9NA 4CKBA 4A3BH 5M9OA 4O1NA 4RG1A 4XTCS 2XRQD 1LTSD 4YHHL 5BN3A 1PRTC 4HTHA 4DUZL 2WB1B 3SEBA 4A3FG 4IPCA 4EQNA 4DV7Q 4XQQA 4NPSA 2UXBQ 1NBWA 3PIO3 3MC0B 1Z6HA 1H9RA 5JEAH 2A5HA 2KENA 1SNPA 3BZKA 1PTOD 3FRPB 5F2DA 3HOYH 2Y0SB 3HOVH 4JI3L 3NENA 3UDGA 2JSOA 1EIGA 5GADC 4EQ5A 4IO9A 1SBBB 2RVLA 3KJPA 3T16A 4IUVA 4B3SL 2JA6G 3V2TA 4A3DH 4DR2Q 3QB3A 3Q23A 1HZBA 4UPAA 2N78A 5C4XB 3B6YA 1KNAA 2OTJA 3CCMA 2E2IH 1XPRA 1LM0A 1GHJA 2VW9A 4PZ8A 2QW7A 3S16H 1DZ1A 2JQOA 3QO2A 4C3JB 2DN8A 5C6AA 1VQKA 1X3GA 4R8IA 5EKLA 3CMEA 3J7YW 1MKHA 1GKHA 4OEMB 3F2UA 3NELA 1AN8A 1BBUA 3E0EA 4Y52H 4IUUA 2B2TC 2NB0A 5J3BA 4EX5A 2Z1CA 4X62Q 1KLGD 4DA2A 1CA5A 4B3TL 3JC66 1TWFB 2K5DA 1CT1D 1OXUA 1SE3A 3M4QA 4X66Q 1BNZA 2JA6H 1GUWA 1RD9D 2IL8A 3KDFA 3C1EA 2F0TA 3JAME 4JW0A 1HR0L 3PGZA 4UP7A 3FPUB 3H0GB 1WTVA 2H1EA 2RCFA 1EQVA 4JPBW 1D1KA 4A75A 1IW7D 3MA2B 3K58A 1AZQA 3L9AX 1AE2A 1TQOA 3ULPA 2A68C 4A3MB 4LF9L 4DK1A 4RGTA 2L1BA 4CDEC 4K5VA 4LF7Q 4ME3A 4ME5A 4DR3L 3HGBA 4H0LC 2KCMA 1QWYA 1ZYRD 1SDFA 4GLVB 1T5EA 5KRUA 3T1HL 1VF7A 4ID6A 1EIYB 4A3MG 5KIXA 1JR0D 3HOUG 3MVVA 5H1SE 2IX1A 3J80L 2WAQE 4IUQA 4OO1G 4KD4A 3DUZA 5ELBA 3K5LA 3CC7A 1L1OB 1F9PA 3STBD 2DY7A 4C3HB 3ND9A 1V1QA 1ONLA 4DV4L 1EY4A 3A8JE 4BBSB 5I9OA 4N8FA 1Q86C 1IBLQ 1CSQA 1RJTA 1GXDC 3A7LA 4CDDC 1GM5A 4EGVA 1TIID 2K33A 3E5SA 3S9WA 3CD6A 3JAMc 2CW0D 3M3YB 5D14A 2V4DA 2UU9L 2WINB 4O2DA 3S14B 1LTRD 3IL8A 4NB3A 1OXVA 1STGA 4BA2I 1TKWB 2FHTA 4LK1C 5CC4A 4OO1H 1K0SA 3GP7A 3GV3A 3EQLC 3TBIB 3G48A 5ELNA 3L2PA 2F0DA 3WOEA 4FF2A 3U9OA 2EY5A 3NWTA 4IURA 1JT8A 5J22A 1BBWA 4A76A 2LS01 3C1FA 2A6ED 1LT3D 3D6WA 3HRZC 1PH6A 4LW1A 1TWGB 4F88A 2MGSA 2JEAI 4ABNA 1OXXK 3I91A 1VQJA 3OSOA 2EJMA 1QE6A 4WJ3M 1TY0A 2L11A 3NEMA 4A3CG 5M3MG 1PH9A 2EY2A 4UHVA 1HJPA 1TWCH 1DCZA 2IW3A 1VQGA 5ISRA 5GQOA 2ZJQA 5HY6A 1ESFA 1WTQA 4CDCC 1E1TA 4JI5Q 1JORA 5CMDA 2FMCA 1SNQA 4IFDJ 3OIPA 5EPJA 1FJGL 1K8AC 1TS4A 1L1OA 2Z9HA 3KFUA 4O42A 4TSSA 2RKSA 1VQHA 3LNNA 2F4VQ 5CR3A 1ZKOA 2A6HC 5C4JB 1UAPA 4A3CH 4DFAA 5M3MH 3CC2A 1HFGA 1E24A 3ICEA 2RSOA 3R2TA 2NN6G 4OL7A 4CJ1B 3S15B 4AH6A 3I4OA 2VQEQ 1YHAA 1WCMH 5JPMC 2ZM6Q 1B7YB 2DJFC 4JI0L 1TWAH 2WAQG 3HOWH 5C3XA 4ZUIA 1PZKD 2LKVA 3MFGA 4DV3L 4DF7A 1GUSA 1O7ZA 3JAMi 3CMAA 1DGSA 4FF3A 2R7ZB 1BO0A 1KABA 1HNZQ 5IYBG 1EWIA 5JOBA 3S17B 2CQAA 3RMHA 1YJNA 2WKDA 1XMQL 4A3KG 1YVCA 3NHHA 2NVYB 5C44B 5C3EG 4XYOA 3URYA 3KJOA 1F2ZA 4POGA 1VQBA 1C4QA 3HOZB 3X3NA 4Q0FA 2F0NA 1ENCA 4KJNA 1AEXA 4MHEA 5M5YB 2ASBA 4EVOA 4LFBL 4TKOB 2NN6H 1ICWA 2R93G 1SMYC 3PQIA 3R2IA 4JI4Q 4GN3B 3GTLH 5E4XA 3QOJA 5BR8Q 3I8ZA 5G3LF 3GTMH 4JI1L 1HQRD 1TT2A 1PFMA 1EZ8A 2MQHA 3FHWA 1E22A 5KNBA 2WACA 1TVXA 2D62A 1GO3E 1C8CA 4HJAA 3F2BA 1SYDA 2RSNA 4YHHQ 4DUZQ 4YWLA 5IYBH 4ALPA 3A7AB 3CCEA 4QGUA 4IPDA 1X3EA 3K5NA 1VDZA 4A3KH 1M1KC 3OWEB 5C3EH 1VQPA 2QEXA 5IIFA 4KKSA 3MTSA 5M5WB 3RN2A 4GLAC 4FO2A 2IY5B 2R93H 3Q8DA 4DV5L 4JI3Q 3G6JB 2JA8B 1S72A 1VQ7A 1NY4A 4FNFA 4RWSC 2BA1A 2HDLA 3NXWA 2K14A 3VYUA 4IJLA 4RH6A 1ILQA 2R7DA 2EY6A 4R4OA 1H9SB 3GD7A 2LFNA 1WTOA 2LY7A 2BE5C 1J9OA 1PMRA 3CAMA 4NP5A 4JYAL 2L55A 3RZOH 4WFN3 3MWYW 2XRSD 1CA6A 5M3FH 1NR2A 2I5MX 1JC7A 1VQ8A 1NSNS 4RGOS 1W3SA 3GTOB 1BOSA 2NYZD 4KKUA 4JBJA 4DAPA 4FXGC 2KEEA 2F52A 1H95A 1E1OA 4DXFA 1W6KA 1G8ZD 4POFA 4K2KA 1P16A 2QF7A 4TQUS 4Z9CB 3PIPA 1O7IA 2EZVA 1SFOB 1KRTA 1ZEQX 5HURA 1A6XA 1JMCA 1FGUA 2KJXA 4YCWA 1VQAA 2F0EA 1STAA 2IX0A 1N9WA 4IPGA 3Q0AA 3A54A 5IP7H 2R92B 1HR0Q 2ICIA 3D6CA 3OTOL 1PRTD 2KHSA 1S4ZA 1M4VA 1ZXTA 5FLXL 1Z47A 5GROA 4R1JA 3CF5A 4IUTA 2K5QA 5EAYA 3NK9A 2PI2E 4JBMA 4ZKBB 4C3IH 2JYOA 3HZXA 2BH8A 3NWSA 3TP5A 3VR6A 3K7AB 2JN4A 2UUCL 4A93B 1O7LA 1SE2A 2DJGC 1E3PA 2CW0C 4K5XA 1CHQD 3CPWA 4DR3Q 2HIXA 1Z7TA 4KKTA 3HKZB 1K9MC 4DGZA 2CQOA 4KN7C 3I4MH 3S1MH 1D6EC 4MN3A 1PH8A 3ZYYX 5JVG3 1RL2A 1QJOA 2CKZB 1EOVA 1J6QA 4DKAC 1WYDA 5JVH3 2TSSA 2GVAA 5HGQA 1PH2A 1WD1A 4DV4Q 3CKIB 2EIFA 1H9SA 2HT1A 1L2FA 3U4ZA 2CH4W 5D3DA 4YCUA 2C35B 4LF7L 4OONA 1B50A 1A0IA 2UU9Q 4FYDA 1V1PB 3CCSA 4DXGA 4NMZA 1IXRA 1XPUA 2EYPA 3UDXA 2CHBD 3EIVA 4ZLTF 1B53A 5I4DA 1D5MC 1OXTA 2NVQB 4J1MA 2L12A 3S1QB 1UEAB 1MD2D 1HHVA 2VQFQ 1MGSA 2AQ1B 2RF4A 5A2QE 1BCPC 2B8FA 3TP7A 1ET6A 1Q90A 2B63G 3NTIA 4AIMA 2L9HA 4BY1B 2A68D 1VQEA 3X3MA 1IKMA 1EEID 1EY0A 4XQJA 3G6EA 2UUAL 1PZJD 4V0BA 4DAYB 2N49A 3OW2A 3I70A 4FF4A 3U58A 1MSHA 2NZHA 4A3IB 1EEFD 3OOCA 3OYYA 1XTCD 4OHJA 3R93A 5KGUA 2UUBL 4KHVA 3SGIA 5FOBB 1A3TA 1P8LA 5DEHA 4B9XA 4HIOA 3UE0A 4KHPQ 1GUTA 4FXDA 3HOXG 3AYHB 2B63H 3RUZA 4H44C 2NVXH 2XWJB 5M5XB 4IQZA 1FJGQ 2EJGC 5ELOA 5ELEA 2EOTA 4TVAB 4GNXC 4Y7NH 2Q2TA 4M8AA 2K7VA 3NBIA 1F2LA 2E76C 1W2BA 1LTGD 3KF8B 1VQMA 2QA4A 4Q5VA 2EYLA 1WTXA 4LUOA 2J0TD 1WI5A 5C0XG 2J4XA 2IWHA 4UY8C 1V1PA 3T56B 4DV3Q 3K5OA 1PHJA 4K6DA 2CFMA 4R4QA 3HOXH 2OXPA 1IL2A 1NUCA 3LWEA 4DNTB 1GOZA 4F7XA 2YYZA 3FKIH 1S5DD 3RZDB 3NPPA 4C2MH 2JA7G 2F4VL 4BXXG 1LT6D 3VR3A 1GUNA 2B3GA 4XXEA 2PNHA 1QILA 4LFBQ 1ICFB 2NVTB 4HJ8A 1Y1VB 1MHWC 1PH4A 1D7QA 5C0XH 1KXLA 3W1BA 4FXKC 4JI1Q 5E3FA 3ULJA 4DAYA 2ZM6L 2AWNA 4G57A 2G5DA 4XDXA 2BH2A 3TMEA 3S1RH 1WVLA 2IX3A 4BY7H 2X69A 2E2JH 1TWHB 3I4NG 2K5VA 1A2TA 3GV6A 1I94L 2JK8A 1HNZL 3PO3G 2VNUD 4A3BB 2EY1A 4R9WA 2K75A 3Q24A 4NXMQ 4GZYC 5LMUQ 2D5DA 3FVQA 4FP5D 1C7YA 5IWAQ 2JA7H 4BXXH 5IGDA 2I07B 1YNNC 2A6HD 4RAUC 1I50B 4RFBA 1K83B 3P7JA 4DV5Q 1PYSB 3FP9A 1CSPA 2L4NA 2Z0SA 3DM1A 3LGJA 4K6LA 3HOYB 2JEBI 3I4NH 1SROA 2G9HD 4JYAQ 1MBYA 3EJIA 3KLSA 3PO3H 1QB5D 3TQYA 4RGMA 2QDLA 3SXHA 1GD7A 5K5PA 1K8OA 1HQMC 4MZ9A 4X3KA 4A3DB 4B08A 3PIP3 2H5XA 1SAPA 2EE1A 1VF5C 1Q1EA 3EFXD 5NUCA 4X64L 4A3JB 1STYA 3PO2H 5T1IA 1GHKA 1CKNB 2WB1G 3EA6A 1UWVA 1UUPA 1HFNA 4WJWA 3H3VC 2K28A 4N9TA 1LV9A 1SMYD 3WWVA 3UE1A 3VYTA 2Z6KA 1KAWA 3CW2C 1EWHA 1F77A 4CBVA 3GTPB 4LF4Q 2MPMA 4K2LA 4HJ9A 2Y0SG 1NMGA 1F2YA 1LO5D 1CKMA 2HCIA 3SK8A 3GTGH 4A3FH 3OHXC 3OTOQ 1I4XA 4L8JA 2DUDA 2B29A 2EYOA 1XJVA 1IYUA 1PVOA 1L0XB 5IGEA 2EXDA 4DV1L 1Y14B 4V190 2BCOA 1R9TB 1A8VA 2OWOA 1SYEA 5C4XG 2UUCQ 1HPCA 2B2WA 1TS3A 5C5LA 1X9NA 2RHQB 1QZGA 4QIWE 2XVSA 4A3LG 1PFBA 2EYFA 4S3SA 1FNVA 1SRUA 3MAQA 4C3JG 3KF6B 2QCPX 2F0SA 4GN5A 1BR9A 4KN4C 1VMPA 5HGTA 3W3AA 1O7YA 2SNSA 2BE5D 1FVIA 4PMWA 1V8QA 1SSOA 1C0AA 4QJFA 1JOQA 2I5LX 1UE6A 1QNKA 5EJWA 5C4XH 2TMPA 2BDNA 2K03A 1YHBA 3H0GG 4CKEA 1B8AA 4A3LH 3KK7A 2RDHA 2J7ZA 2F0GA 1KIXA 4NXNL 4C3JH 1MSGA 2A73B 2I46A 1CZGA 1CKNA 2HHHQ 2HUGA 2ZTCA 2B2VA 1PTOF 2K50A 2LXJA 4HMIA 2AHOB 4XYQA 1EY8A 1HH2P 4JBWA 3HS0C 5CYUA 2AUKA 1D1IA 5D3IB 2KUMA 2SOBA 2LSSA 3H09A 4YY3L 2ZT9C 2D2CC 1VQIA 1A3UA 1FYCA 3GDEA 3M9BA 3WOFA 5IT9E 4C3HG 4MTKA 1YIJA 2UUAQ 5EKKA 1AH9A 4BBSG 5DAUA 3M4OH 1VQ4A 5LL6S 4A3MH 2OQKA 1I6HB 1KQSA 5IP9G 3HOUH 3ONAB 3GTKH 2Q2HA 1G6PA 2UUBQ 1STBA 1UE1A 4WJ4A 2K01A 1PH7A 4RA8A 5KYIA 3SDZA 3DMUA 3KF6A 3CCQA 3C3LA 1TWCB 1HR0W 2YU9H 3J7A5 2JXMB 4K8JA 3CU7A 5IYCG 4LFAQ 1VQCA 1TY2A 2VQFL 3ITPA 1JB7A 3TREA 3UI2A 2N3SA 4C3HH 3F2CA 2K04A 3K0YA 1Q8IA 4NDXA 3ERSX 4IOAA 3WDNA 4HIDA 1MIUA 2SNMA 4MNOA 2M2LA 3F2DA 1GVPA 2Z4IA 3M3YH 3OMCA 3DWAA 3SR1A 4DN4M 4RMFA 3NE5B 4HSVA 4TRDA 2GVBA 3S14H 1S5BD 5IT9c 1B3AA 3QWNA 1EY6A 3L3OC 2B2YA 1WOCA 3MHBA 1QG7A 4RGNA 1JOKA 3U4VA 4IFDG 4KHPL 1A2UA 3RLNA 1LLRD 1WCMB 2DNCA 2ENBA 3JAML 1EY5A 1BCPD 3D3RA 3RR5A 1B3QA 3BVZA 1R4PB 1AZPA 2E5LQ 1EUJA 2RQXA 2LMCB 1U4PA 1QCBD 1NR4A 3PUWA 3CXCA 2E75C 1EFID 1TWGH 1VCIA 3N52A 3Q6SA 3H94A 4OWXB 2OTLA 3K8AA 3FPPA 2YV5A 3F8TA 1KRSA 1GJXA 4LFCQ 4JI6L 4CJ2C 3A8KE 4IN3A 2P5ZX 3VR5A 4X65L 2IHFA 3GO5A 1K3RA 3GTLB 4IFDH 1I94Q 5IOCA 1SR3A 3GTMB 2KBNA 2PNRC 1OXSC 1HUNA 3MXPA 4PV1C 4OGQC 1QOHA 2GN5A 2YTVA 1Q81C 1RTOA 4LF8L 1F9RA 2Z6KC 1X3PA 2R7ZG 4OXPA 1Y8NB 2OEOA 1F9SA 3ER0A 5C4HA 1DXMA 1AP0A 2BA0A 5JJZA 3GTJB 5GAGC 5C44G 2M00A 3QR8A 1N33L 4RCNA 3T53B 3HOZG 5C4JH 4A3EB 5FKAC 3LX0A 3HKZE 3K6OA 5IGGA 1CK1A 1FNUA 1QUQB 4KJOA 4G7ZC 3P20A 4EQPA 1S40A 1PYBA 3I73A 4F8MA 1TU2B 2VZAA 1EIFA 2KQ3A 3S2DB 3K7UC 4DAVA 4NXML 1XNRL 4HSPA 4YWMA 4X64Q 1SYFA 5LMUL 3RZOB 3KOJA 5E7NA 5IWAL 5M3FB 3ERQA 5C4ZA 4J15A 4H7BA 3J81E 3FEWX 5C44H 2NVYH 3N6RA 3GTQB 2CVRA 4IPHA 2F0FA 1JE5A 3AQQA 2R3ZA 1IBKL 5M5YH 2SEBD 4GLXA 1EZ6A 2JA8G 3SVMA 4PMCA 1YZ6A 3K5MA 1BF4A 3BZDB 1EQQA 4LF6L 4BS9A 1I4QA 3DWPA 4CDFC 4DV1Q 4KI0A 3IKJA 1I3QH 3RLFA 3K57A 1Y1WB 2FFKB 2ZJRA
chains in the Genus database with same CATH topology
1Z9FA 5FJ8H 1P8LA 3G71A 4JI3L 3CCRA 3HOVH 1HZ9A 3NENA 3UDGA 4HIOA 3UE0A 2JA9A 5GADC 3T1YL 4EQ5A 4KHPQ 1V9PA 1I6HH 3HOXG 3AYHB 4IO9A 4YCVA 2I5HA 3KJPA 4GNXB 2B63H 4DR4Q 5IYCH 2NVXH 4B3SL 2JA6G 4A3DH 4O0AA 5M5WH 4DR2Q 1LYLA 1FJGQ 4APVA 5LMNW 1YJWA 4LF4L 1HZBA 5ELOA 4UPAA 3H3VH 2N78A 1J5EQ 3B6YA 4TVAB 1VQDA 2N8NA 4Y7NH 3M85A 4GNXC 2Q2TA 2OTJA 3E9IA 3CCMA 1XPRA 2E2IH 1LM0A 2VW9A 1W2BA 3PUYA 3KF8B 2V1CC 3CQZH 2QA4A 1X3FA 3A0JA 4PZ8A 3AFPA 2VY3A 1VQMA 3S16H 2JQOA 1WCMG 1X54A 1YEZA 2KHIA 3M4PA 4KLKA 3J81c 1VQKA 4JV5L 1X3GA 2VUMG 4LUOA 3CMEA 1WI5A 5C0XG 4DV0L 3HOWG 3PIOA 3PSIA 1MKHA 1GKHA 2CWPA 3NELA 4UY8C 2R92G 3RLOA 1BBUA 3E0EA 2MNAA 4Y52H 5J3BA 1QUQA 4EX5A 4OO1I 2QGQA 4X62Q 4DV3Q 1HNXL 3GTOH 1PHJA 4R4QA 2CFMA 4B3TL 3JC66 3HOXH 4BA1I 4L5RC 4DV6Q 4NXNQ 4OX9L 1OXUA 1IL2A 1HNWQ 5GAEC 1XPOA 2AKWB 3M4QA 4X66Q 2JA6H 1VQNA 3MEFA 3KDFA 4A93G 3UDFA 2YYZA 4LUZA 1HR0L 3FKIH 2HIVA 3PGZA 4C2MH 4HJ5A 4UP7A 2F4VL 2JA7G 4BXXG 3HKZG 1U5KA 4A75A 1SFOH 3J81j 2UXCL 4DK6C 2B3GA 1S3OA 2PNHA 4LFBQ 4HJ8A 5IYDG 1AE2A 1YI2A 3ULPA 1PH4A 1D7QA 1KXLA 3W1BA 1N34L 5LMNQ 1VQOA 4YY3Q 3I55A 4LF9L 4JI1Q 2R92H 3UDIA 3ULJA 2ZM6L 3A74A 4LF7Q 2AWNA 4DR6L 4ME3A 2BH2A 3S1RH 4DR3L 1EQRA 4BY7H 2E2JH 3I4NG 2KCMA 2K5VA 4GLVB 2FXQA 3T1HL 1MJCA 1I94L 1EIYB 4JI2Q 2JK8A 1CUKA 1JJCB 4A3MG 1HNZL 3PO3G 5JJIA 3HOUG 1PV4A 5H1SE 4DPGA 2VNUD 2R7FA 2IX1A 3S15H 2K75A 1G51A 2MO0A 2WAQE 4PZ6A 4NXMQ 4A3GG 2HHHL 4OO1G 5LMUQ 4A3EG 3ZJYC 1C7YA 3CC7A 5IWAQ 1UE5A 2CWAA 2JA7H 4BXXH 1L1OB 3STBD 1ASYA 1V1QA 4GNXA 2R7ZH 4LF5L 4DV4L 2A8VA 4DV5Q 3S17H 1PYSB 2PMZE 3FP9A 1CSPA 2UXDL 1L1OC 2YTXA 2Z0SA 1Q86C 1IBLQ 4XIGS 3BZCA 4GKJL 1U0LA 1CSQA 3LGJA 4P71A 1GM5A 5AJ3L 3CC4A 1QVFA 4FDBA 4IJHA 3CD6A 5IE8A 3JAMc 4JI7Q 2JEBI 3I4NH 3HOZH 1SROA 1I5FA 5M3FG 2UU9L 1FL0A 4O2DA 2IHEA 4GOPB 4JYAQ 1XNQQ 1AE3A 4R4TA 3GTJH 3PO3H 2WFWA 3TQYA 4NB3A 1OXVA 5FLXc 4BA2I 2JJQA 1GD7A 2NZOA 4MZ9A 4JI8Q 2K52A 4BY1G 2H5XA 3J81i 1Q1EA 4X64L 2DGYA 4A3EH 3PO2H 1IZ6A 1CKNB 1N36Q 2EQSA 2WB1G 4P73A 3G48A 5ELNA 3L2PA 1VQ5A 2IT1A 1UWVA 2RHSB 4LNQA 1JT8A 3BJUA 1BBWA 2ZJPA 4A3IG 2ZTDA 4A76A 4JOIA 3WWVA 1IBMQ 2Q2IA 3UE1A 4B3SQ 2Z6KA 1PH6A 1KAWA 3CW2C 4LW1A 4LFAL 3S2DH 4MTNA 4P75A 2JEAI 1Q8KA 1OXXK 2NN6I 4PZ7A 5IP7G 1YITA 1VQJA 4LF4Q 1Y1WG 1T9HA 1WJJA 4HJ9A 2Y0SG 2JE6I 2A19A 3J7ZC 4DV7L 2D0OA 1EFWA 2NVQH 1NMGA 4WJ3M 2WB1E 3NEMA 4A3CG 1CKMA 3L0OA 3GTGH 2MFIA 5M3MG 3OTOQ 2YTYA 4A3FH 1PH9A 2UXBL 1HJPA 1TWCH 2JA8H 2DUDA 2B29A 1B70B 3I56A 1XJVA 4BBRG 1NTGA 3GTQH 2VL6A 1PVOA 3EBEA 4BY1H 4DV0Q 2EXDA 4DV1L 1VQGA 1Y14B 5GQOA 2ZJQA 1A8VA 2OWOA 3IRBA 3PCOB 5HY6A 5C4XG 2UUCQ 3TRZA 1N32Q 2XGTA 3F1ZA 1X9NA 2RHQB 3S1NH 4JCVE 2Y0SE 1QZGA 4QIWE 4JI6Q 4B3TQ 4A3LG 4JC0A 1M90C 4A3IH 1E1TA 4JI5Q 4X65Q 1SRUA 3I4MG 4K0KL 4DR5L 1KHIA 5FLMG 1PH5A 3KF6B 4IFDJ 3I2ZA 4GN5A 4DR2L 2A1AA 1FJGL 1K8AC 3KFUA 1L1OA 2OCEA 1Y1WH 1UE7A 4DR7L 3G4SA 4GKKQ 1PFSA 1J5EL 1VQHA 3CPFA 3HFZB 2F4VQ 3STBC 4A3CH 4PMWA 1FVIA 3DM3A 5M3MH 1KL9A 1K73C 3CC2A 2E5LL 3W1GA 4LF8Q 1E24A 3ICEA 1C0AA 4QJFA 4BBRH 2NN6G 1K0RA 1SE8A 5K36G 2HQLA 4AQYQ 2I5LX 1YHQA 1TXYA 2D0PA 3I4OA 1UE6A 4AH6A 5M5XH 4LF9Q 2VQEQ 1YHAA 1WCMH 3PF5A 3S2HH 2ZM6Q 1B7YB 4JI0L 1TWAH 2WAQG 5C4XH 2VUMH 4GN4B 4GOPA 2AWOA 1N33Q 1OTCA 3HOWH 4X62L 4DV3L 1YHBA 3H0GG 3JAMi 1NE3A 1B8AA 4LFCL 3CMAA 1DGSA 2ALYB 3T1HQ 2E2HH 1KIXA 4A3LH 2KHJA 1HNZQ 5IYBG 4NXNL 5FLMH 3MXNB 1EWIA 4C3JH 4B3RQ 1HNWL 1YJNA 2K5HA 1Y1VG 4X66L 3A5UA 4OWWB 1XMQL 1CKNA 4A3KG 1YVCA 2HHHQ 3AEVA 4H02A 1C9OA 5C3EG 1YBYA 1YNXA 1IYJB 2ZTCA 3KJOA 3K7AH 4POGA 1VQBA 4A93H 2RCNA 1XNRQ 2K50A 3K0XA 1CKOA 1SN8A 3CCUA 2I0QA 2LXJA 3NBHB 3CP0A 1QVCA 2ZTEA 2AHOB 4LF5Q 2ASBA 4DV2Q 3TS2A 1HH2P 4JBWA 4LFBL 3AFQA 2R93G 3I7FA 4JI4Q 4P72A 4GN3B 1N8RC 3GTLH 4A3BG 4DNIA 2LSSA 5BR8Q 4YY3L 3GTMH 5AJ3Q 4JI1L 4B3ML 5IYDH 4KHZA 1VQIA 2MQHA 5IY0A 3FHWA 1E22A 2KCTA 1HZCA 3GDEA 3M9BA 4AYBG 2D62A 1GO3E 1IBKQ 2PI2A 3F2BA 4HJAA 4YHHQ 4HJ7A 3TS0A 4DUZQ 1YIJA 4YWLA 5IYBH 4L5TA 4ALPA 1XMOL 1BKBA 3EN2A 2UUAQ 2NVTH 3CCEA 2E8GA 4QGUA 1Y1VH 4IPDA 4BBSG 4JG2A 1AH9A 1HZAA 4R4CA 3M4OH 1X3EA 5JJLA 3ULLA 1Q46A 4A3KH 1VQ4A 1M1KC 4A3MH 2OQKA 5C3EH 1KQSA 1XTDA 5IP9G 1VQPA 1X55A 3HOUH 3KYHC 2QEXA 2Q2HA 4LF6Q 3GTKH 5JEAJ 1G6PA 4IFDI 4A4IA 3HOYG 1YJ9A 1UE1A 2UUBQ 4A3GH 4WJ4A 1TWHH 3RN2A 1SLJA 1PH7A 4GLAC 4DAMA 4AYBE 2IY5B 3PUXA 3KF6A 4LUVA 3CCQA 1HR0W 3L7ZC 2YU9H 2R93H 3Q8DA 4DV5L 4JI3Q 2VS1A 1PH3A 3K81C 3J7A5 1K8GA 1S72A 1VQ7A 1NY4A 1IBLL 2BA1A 5IYCG 4LFAQ 3T1YQ 2K14A 4A3DG 1VQCA 4IJLA 1VS0A 2VQFL 1QVGA 2R7DA 4A3JG 1JB7A 1LUZA 4IOCA 4JI7L 3TREA 4R4OA 2R6GA 3GD7A 2N3SA 1N36L 3W5OA 2JA5G 4C3HH 3CAMA 1I50H 4JYAL 3BU2A 3RZOH 3F2CA 1XNQL 3RNUA 3DLLA 1E7ZA 1K83H 4DUYL 5M3FH 2I5MX 3ERSX 4IOAA 3RN5A 3VDYA 1VQ8A 4JBKA 4HIDA 1W3SA 3HKSA 4JI8L 3S1QH 1MIUA 4MNOA 3F2DA 4JBJA 1GVPA 4JV5Q 3M3YH 1VQ9A 2F52A 4RMFA 4P74A 1D8LA 1H95A 1A62A 1E1OA 2GVBA 3E9HA 4HIMA 4DR1L 2CCZA 3S14H 5GAHC 3CCLA 4POFA 5IT9c 1P16A 2K5NA 4TQUS 4K0KQ 3PIPA 4DR5Q 1KC8C 1O7IA 1WOCA 1IBML 1HNXQ 2L15A 1KRTA 4HIKA 1X56A 4IFDG 3U4VA 1JMCA 1FGUA 2ID0A 3RLNA 4KHPL 4OX9Q 4YCWA 4A3JH 1PA6A 1VQAA 4DR7Q 3FKIG 3RR5A 4DR4L 2IX0A 1N9WA 4IPGA 2JA5H 3J80c 3D31A 5IP7H 1HR0Q 2E5LQ 4OWTB 1EUJA 3K80C 3OTOL 1LTLA 1X6OA 4UP9A 1Z47A 5GROA 3CCVA 3PUWA 4R1JA 3CXCA 3CF5A 2Q2UA 2PQAB 3PUZA 5EAYA 2UXCQ 1VQFA 1TWGH 1VCIA 2PI2E 4JBMA 4C3IH 3GTPH 1BVSA 2BH8A 4JI0Q 4OWXB 2OTLA 3K8AA 2YV5A 3F8TA 5C0XJ 1KRSA 1N34Q 2UUCL 1N32L 4BY7G 1E3PA 1VQ6A 4LFCQ 4JI6L 2LXKA 4DR6Q 3CPWA 4DR3Q 4JI5L 2HIXA 4QL5A 4X65L 4R4IA 2IHFA 1G291 3GO5A 1K3RA 3KLWA 4YWKA 1K9MC 1XMQQ 1I94Q 1SR3A 2CQOA 3I4MH 3PF4A 3S1MH 2KBNA 4DV6L 1R9TH 1OXSC 1PH8A 1EYGA 4GKKL 1SMXA 1RL2A 4QY7A 1Q12A 2CKZB 2GN5A 3PUVA 2YTVA 1EOVA 1X65A 1Q7YC 4JOIC 1Q81C 1J6QA 4DKAC 2WP8J 4LF8L 2Z6KC 1WYDA 2R7ZG 4OXPA 1WFQA 1UEBA 3ER0A 2XTIA 3M7NA 2GVAA 3H3VI 5HGQA 4AQYL 1PH2A 4DV4Q 2BA0A 1TWFH 1V43A 2EIFA 1MJEA 2VQEL 5DLQE 4B3MQ 5GAGC 5C44G 2UXDQ 2HT1A 4L5QA 4GKJQ 2ES2A 4X6AH 1N33L 1L2FA 3U4ZA 5LMNL 3HOZG 5C4JH 4YCUA 2C35B 1NMFA 3RZDH 4UP8A 4LF7L 4QQBX 3HKZE 4OONA 1XMOQ 4B3RL 3H0GH 1A0IA 2UU9Q 1A63A 1QUQB 2AMCB 1JJGA 3CCSA 1S40A 4JI2L 1PYBA 2VZAA 1EIFA 1IXRA 1XPUA 3PO2G 3UDXA 1Q1BA 4LWCA 3A5ZB 3U50C 5JEAG 3K7UC 2F3IA 4NXML 2K4KA 1XNRL 4YWMA 3EIVA 4X64Q 1ASZA 5LMUL 5JJKA 3KDFB 2OQ0A 4GS3A 3KOJA 4DV2L 5E7NA 5IWAL 2MO1A 1OXTA 5FJ8G 3HOVG 1QZHA 4JI4L 3PV0A 4J15A 1Q82C 1PH1A 5BR8L 3TEHB 5C44H 2NVYH 1NJIC 1JJ2A 1L0WA 2VQFQ 2ATWA 2RF4A 4DK3C 4L5SA 3D0FA 3S24A 4IPHA 4A3BH 1JE5A 2B63G 3AQQA 4AIMA 4PG3A 4RG1A 4XTCS 1IBKL 1VQEA 4YHHL 4DUZL 5M5YH 2PQAA 4A3FG 5C0XI 3J80i 4IPCA 4DUYQ 3G6EA 2UUAL 4GLXA 4DV7Q 4DAYB 2N49A 2JA8G 3OW2A 4NPSA 1YZ6A 3U58A 2UXBQ 4GOPC 2NZHA 3CCJA 1NBWA 3OYYA 4BBSH 1EQQA 4LF6L 2UUBL 1RIPA 4DV1Q 4KI0A 2KENA 5IP9H 3BZKA 4DR1Q 1I3QH 3RLFA 3SGIA 1VQLA 3H15A 1KD1C 3HOYH 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9F A;  5FJ8 H;  1P8L A;  3G71 A;  4JI3 L;  3CCR A;  3HOV H;  1HZ9 A;  3NEN A;  3UDG A;  4HIO A;  3UE0 A;  2JA9 A;  5GAD C;  3T1Y L;  4EQ5 A;  4KHP Q;  1V9P A;  1I6H H;  3HOX G;  3AYH B;  4IO9 A;  4YCV A;  2I5H A;  3KJP A;  4GNX B;  2B63 H;  4DR4 Q;  5IYC H;  2NVX H;  4B3S L;  2JA6 G;  4A3D H;  4O0A A;  5M5W H;  4DR2 Q;  1LYL A;  1FJG Q;  4APV A;  5LMN W;  1YJW A;  4LF4 L;  1HZB A;  5ELO A;  4UPA A;  3H3V H;  2N78 A;  1J5E Q;  3B6Y A;  4TVA B;  1VQD A;  2N8N A;  4Y7N H;  3M85 A;  4GNX C;  2Q2T A;  2OTJ A;  3E9I A;  3CCM A;  1XPR A;  2E2I H;  1LM0 A;  2VW9 A;  1W2B A;  3PUY A;  3KF8 B;  2V1C C;  3CQZ H;  2QA4 A;  1X3F A;  3A0J A;  4PZ8 A;  3AFP A;  2VY3 A;  1VQM A;  3S16 H;  2JQO A;  1WCM G;  1X54 A;  1YEZ A;  2KHI A;  3M4P A;  4KLK A;  3J81 c;  1VQK A;  4JV5 L;  1X3G A;  2VUM G;  4LUO A;  3CME A;  1WI5 A;  5C0X G;  4DV0 L;  3HOW G;  3PIO A;  3PSI A;  1MKH A;  1GKH A;  2CWP A;  3NEL A;  4UY8 C;  2R92 G;  3RLO A;  1BBU A;  3E0E A;  2MNA A;  4Y52 H;  5J3B A;  1QUQ A;  4EX5 A;  4OO1 I;  2QGQ A;  4X62 Q;  4DV3 Q;  1HNX L;  3GTO H;  1PHJ A;  4R4Q A;  2CFM A;  4B3T L;  3JC6 6;  3HOX H;  4BA1 I;  4L5R C;  4DV6 Q;  4NXN Q;  4OX9 L;  1OXU A;  1IL2 A;  1HNW Q;  5GAE C;  1XPO A;  2AKW B;  3M4Q A;  4X66 Q;  2JA6 H;  1VQN A;  3MEF A;  3KDF A;  4A93 G;  3UDF A;  2YYZ A;  4LUZ A;  1HR0 L;  3FKI H;  2HIV A;  3PGZ A;  4C2M H;  4HJ5 A;  4UP7 A;  2F4V L;  2JA7 G;  4BXX G;  3HKZ G;  1U5K A;  4A75 A;  1SFO H;  3J81 j;  2UXC L;  4DK6 C;  2B3G A;  1S3O A;  2PNH A;  4LFB Q;  4HJ8 A;  5IYD G;  1AE2 A;  1YI2 A;  3ULP A;  1PH4 A;  1D7Q A;  1KXL A;  3W1B A;  1N34 L;  5LMN Q;  1VQO A;  4YY3 Q;  3I55 A;  4LF9 L;  4JI1 Q;  2R92 H;  3UDI A;  3ULJ A;  2ZM6 L;  3A74 A;  4LF7 Q;  2AWN A;  4DR6 L;  4ME3 A;  2BH2 A;  3S1R H;  4DR3 L;  1EQR A;  4BY7 H;  2E2J H;  3I4N G;  2KCM A;  2K5V A;  4GLV B;  2FXQ A;  3T1H L;  1MJC A;  1I94 L;  1EIY B;  4JI2 Q;  2JK8 A;  1CUK A;  1JJC B;  4A3M G;  1HNZ L;  3PO3 G;  5JJI A;  3HOU G;  1PV4 A;  5H1S E;  4DPG A;  2VNU D;  2R7F A;  2IX1 A;  3S15 H;  2K75 A;  1G51 A;  2MO0 A;  2WAQ E;  4PZ6 A;  4NXM Q;  4A3G G;  2HHH L;  4OO1 G;  5LMU Q;  4A3E G;  3ZJY C;  1C7Y A;  3CC7 A;  5IWA Q;  1UE5 A;  2CWA A;  2JA7 H;  4BXX H;  1L1O B;  3STB D;  1ASY A;  1V1Q A;  4GNX A;  2R7Z H;  4LF5 L;  4DV4 L;  2A8V A;  4DV5 Q;  3S17 H;  1PYS B;  2PMZ E;  3FP9 A;  1CSP A;  2UXD L;  1L1O C;  2YTX A;  2Z0S A;  1Q86 C;  1IBL Q;  4XIG S;  3BZC A;  4GKJ L;  1U0L A;  1CSQ A;  3LGJ A;  4P71 A;  1GM5 A;  5AJ3 L;  3CC4 A;  1QVF A;  4FDB A;  4IJH A;  3CD6 A;  5IE8 A;  3JAM c;  4JI7 Q;  2JEB I;  3I4N H;  3HOZ H;  1SRO A;  1I5F A;  5M3F G;  2UU9 L;  1FL0 A;  4O2D A;  2IHE A;  4GOP B;  4JYA Q;  1XNQ Q;  1AE3 A;  4R4T A;  3GTJ H;  3PO3 H;  2WFW A;  3TQY A;  4NB3 A;  1OXV A;  5FLX c;  4BA2 I;  2JJQ A;  1GD7 A;  2NZO A;  4MZ9 A;  4JI8 Q;  2K52 A;  4BY1 G;  2H5X A;  3J81 i;  1Q1E A;  4X64 L;  2DGY A;  4A3E H;  3PO2 H;  1IZ6 A;  1CKN B;  1N36 Q;  2EQS A;  2WB1 G;  4P73 A;  3G48 A;  5ELN A;  3L2P A;  1VQ5 A;  2IT1 A;  1UWV A;  2RHS B;  4LNQ A;  1JT8 A;  3BJU A;  1BBW A;  2ZJP A;  4A3I G;  2ZTD A;  4A76 A;  4JOI A;  3WWV A;  1IBM Q;  2Q2I A;  3UE1 A;  4B3S Q;  2Z6K A;  1PH6 A;  1KAW A;  3CW2 C;  4LW1 A;  4LFA L;  3S2D H;  4MTN A;  4P75 A;  2JEA I;  1Q8K A;  1OXX K;  2NN6 I;  4PZ7 A;  5IP7 G;  1YIT A;  1VQJ A;  4LF4 Q;  1Y1W G;  1T9H A;  1WJJ A;  4HJ9 A;  2Y0S G;  2JE6 I;  2A19 A;  3J7Z C;  4DV7 L;  2D0O A;  1EFW A;  2NVQ H;  1NMG A;  4WJ3 M;  2WB1 E;  3NEM A;  4A3C G;  1CKM A;  3L0O A;  3GTG H;  2MFI A;  5M3M G;  3OTO Q;  2YTY A;  4A3F H;  1PH9 A;  2UXB L;  1HJP A;  1TWC H;  2JA8 H;  2DUD A;  2B29 A;  1B70 B;  3I56 A;  1XJV A;  4BBR G;  1NTG A;  3GTQ H;  2VL6 A;  1PVO A;  3EBE A;  4BY1 H;  4DV0 Q;  2EXD A;  4DV1 L;  1VQG A;  1Y14 B;  5GQO A;  2ZJQ A;  1A8V A;  2OWO A;  3IRB A;  3PCO B;  5HY6 A;  5C4X G;  2UUC Q;  3TRZ A;  1N32 Q;  2XGT A;  3F1Z A;  1X9N A;  2RHQ B;  3S1N H;  4JCV E;  2Y0S E;  1QZG A;  4QIW E;  4JI6 Q;  4B3T Q;  4A3L G;  4JC0 A;  1M90 C;  4A3I H;  1E1T A;  4JI5 Q;  4X65 Q;  1SRU A;  3I4M G;  4K0K L;  4DR5 L;  1KHI A;  5FLM G;  1PH5 A;  3KF6 B;  4IFD J;  3I2Z A;  4GN5 A;  4DR2 L;  2A1A A;  1FJG L;  1K8A C;  3KFU A;  1L1O A;  2OCE A;  1Y1W H;  1UE7 A;  4DR7 L;  3G4S A;  4GKK Q;  1PFS A;  1J5E L;  1VQH A;  3CPF A;  3HFZ B;  2F4V Q;  3STB C;  4A3C H;  4PMW A;  1FVI A;  3DM3 A;  5M3M H;  1KL9 A;  1K73 C;  3CC2 A;  2E5L L;  3W1G A;  4LF8 Q;  1E24 A;  3ICE A;  1C0A A;  4QJF A;  4BBR H;  2NN6 G;  1K0R A;  1SE8 A;  5K36 G;  2HQL A;  4AQY Q;  2I5L X;  1YHQ A;  1TXY A;  2D0P A;  3I4O A;  1UE6 A;  4AH6 A;  5M5X H;  4LF9 Q;  2VQE Q;  1YHA A;  1WCM H;  3PF5 A;  3S2H H;  2ZM6 Q;  1B7Y B;  4JI0 L;  1TWA H;  2WAQ G;  5C4X H;  2VUM H;  4GN4 B;  4GOP A;  2AWO A;  1N33 Q;  1OTC A;  3HOW H;  4X62 L;  4DV3 L;  1YHB A;  3H0G G;  3JAM i;  1NE3 A;  1B8A A;  4LFC L;  3CMA A;  1DGS A;  2ALY B;  3T1H Q;  2E2H H;  1KIX A;  4A3L H;  2KHJ A;  1HNZ Q;  5IYB G;  4NXN L;  5FLM H;  3MXN B;  1EWI A;  4C3J H;  4B3R Q;  1HNW L;  1YJN A;  2K5H A;  1Y1V G;  4X66 L;  3A5U A;  4OWW B;  1XMQ L;  1CKN A;  4A3K G;  1YVC A;  2HHH Q;  3AEV A;  4H02 A;  1C9O A;  5C3E G;  1YBY A;  1YNX A;  1IYJ B;  2ZTC A;  3KJO A;  3K7A H;  4POG A;  1VQB A;  4A93 H;  2RCN A;  1XNR Q;  2K50 A;  3K0X A;  1CKO A;  1SN8 A;  3CCU A;  2I0Q A;  2LXJ A;  3NBH B;  3CP0 A;  1QVC A;  2ZTE A;  2AHO B;  4LF5 Q;  2ASB A;  4DV2 Q;  3TS2 A;  1HH2 P;  4JBW A;  4LFB L;  3AFQ A;  2R93 G;  3I7F A;  4JI4 Q;  4P72 A;  4GN3 B;  1N8R C;  3GTL H;  4A3B G;  4DNI A;  2LSS A;  5BR8 Q;  4YY3 L;  3GTM H;  5AJ3 Q;  4JI1 L;  4B3M L;  5IYD H;  4KHZ A;  1VQI A;  2MQH A;  5IY0 A;  3FHW A;  1E22 A;  2KCT A;  1HZC A;  3GDE A;  3M9B A;  4AYB G;  2D62 A;  1GO3 E;  1IBK Q;  2PI2 A;  3F2B A;  4HJA A;  4YHH Q;  4HJ7 A;  3TS0 A;  4DUZ Q;  1YIJ A;  4YWL A;  5IYB H;  4L5T A;  4ALP A;  1XMO L;  1BKB A;  3EN2 A;  2UUA Q;  2NVT H;  3CCE A;  2E8G A;  4QGU A;  1Y1V H;  4IPD A;  4BBS G;  4JG2 A;  1AH9 A;  1HZA A;  4R4C A;  3M4O H;  1X3E A;  5JJL A;  3ULL A;  1Q46 A;  4A3K H;  1VQ4 A;  1M1K C;  4A3M H;  2OQK A;  5C3E H;  1KQS A;  1XTD A;  5IP9 G;  1VQP A;  1X55 A;  3HOU H;  3KYH C;  2QEX A;  2Q2H A;  4LF6 Q;  3GTK H;  5JEA J;  1G6P A;  4IFD I;  4A4I A;  3HOY G;  1YJ9 A;  1UE1 A;  2UUB Q;  4A3G H;  4WJ4 A;  1TWH H;  3RN2 A;  1SLJ A;  1PH7 A;  4GLA C;  4DAM A;  4AYB E;  2IY5 B;  3PUX A;  3KF6 A;  4LUV A;  3CCQ A;  1HR0 W;  3L7Z C;  2YU9 H;  2R93 H;  3Q8D A;  4DV5 L;  4JI3 Q;  2VS1 A;  1PH3 A;  3K81 C;  3J7A 5;  1K8G A;  1S72 A;  1VQ7 A;  1NY4 A;  1IBL L;  2BA1 A;  5IYC G;  4LFA Q;  3T1Y Q;  2K14 A;  4A3D G;  1VQC A;  4IJL A;  1VS0 A;  2VQF L;  1QVG A;  2R7D A;  4A3J G;  1JB7 A;  1LUZ A;  4IOC A;  4JI7 L;  3TRE A;  4R4O A;  2R6G A;  3GD7 A;  2N3S A;  1N36 L;  3W5O A;  2JA5 G;  4C3H H;  3CAM A;  1I50 H;  4JYA L;  3BU2 A;  3RZO H;  3F2C A;  1XNQ L;  3RNU A;  3DLL A;  1E7Z A;  1K83 H;  4DUY L;  5M3F H;  2I5M X;  3ERS X;  4IOA A;  3RN5 A;  3VDY A;  1VQ8 A;  4JBK A;  4HID A;  1W3S A;  3HKS A;  4JI8 L;  3S1Q H;  1MIU A;  4MNO A;  3F2D A;  4JBJ A;  1GVP A;  4JV5 Q;  3M3Y H;  1VQ9 A;  2F52 A;  4RMF A;  4P74 A;  1D8L A;  1H95 A;  1A62 A;  1E1O A;  2GVB A;  3E9H A;  4HIM A;  4DR1 L;  2CCZ A;  3S14 H;  5GAH C;  3CCL A;  4POF A;  5IT9 c;  1P16 A;  2K5N A;  4TQU S;  4K0K Q;  3PIP A;  4DR5 Q;  1KC8 C;  1O7I A;  1WOC A;  1IBM L;  1HNX Q;  2L15 A;  1KRT A;  4HIK A;  1X56 A;  4IFD G;  3U4V A;  1JMC A;  1FGU A;  2ID0 A;  3RLN A;  4KHP L;  4OX9 Q;  4YCW A;  4A3J H;  1PA6 A;  1VQA A;  4DR7 Q;  3FKI G;  3RR5 A;  4DR4 L;  2IX0 A;  1N9W A;  4IPG A;  2JA5 H;  3J80 c;  3D31 A;  5IP7 H;  1HR0 Q;  2E5L Q;  4OWT B;  1EUJ A;  3K80 C;  3OTO L;  1LTL A;  1X6O A;  4UP9 A;  1Z47 A;  5GRO A;  3CCV A;  3PUW A;  4R1J A;  3CXC A;  3CF5 A;  2Q2U A;  2PQA B;  3PUZ A;  5EAY A;  2UXC Q;  1VQF A;  1TWG H;  1VCI A;  2PI2 E;  4JBM A;  4C3I H;  3GTP H;  1BVS A;  2BH8 A;  4JI0 Q;  4OWX B;  2OTL A;  3K8A A;  2YV5 A;  3F8T A;  5C0X J;  1KRS A;  1N34 Q;  2UUC L;  1N32 L;  4BY7 G;  1E3P A;  1VQ6 A;  4LFC Q;  4JI6 L;  2LXK A;  4DR6 Q;  3CPW A;  4DR3 Q;  4JI5 L;  2HIX A;  4QL5 A;  4X65 L;  4R4I A;  2IHF A;  1G29 1;  3GO5 A;  1K3R A;  3KLW A;  4YWK A;  1K9M C;  1XMQ Q;  1I94 Q;  1SR3 A;  2CQO A;  3I4M H;  3PF4 A;  3S1M H;  2KBN A;  4DV6 L;  1R9T H;  1OXS C;  1PH8 A;  1EYG A;  4GKK L;  1SMX A;  1RL2 A;  4QY7 A;  1Q12 A;  2CKZ B;  2GN5 A;  3PUV A;  2YTV A;  1EOV A;  1X65 A;  1Q7Y C;  4JOI C;  1Q81 C;  1J6Q A;  4DKA C;  2WP8 J;  4LF8 L;  2Z6K C;  1WYD A;  2R7Z G;  4OXP A;  1WFQ A;  1UEB A;  3ER0 A;  2XTI A;  3M7N A;  2GVA A;  3H3V I;  5HGQ A;  4AQY L;  1PH2 A;  4DV4 Q;  2BA0 A;  1TWF H;  1V43 A;  2EIF A;  1MJE A;  2VQE L;  5DLQ E;  4B3M Q;  5GAG C;  5C44 G;  2UXD Q;  2HT1 A;  4L5Q A;  4GKJ Q;  2ES2 A;  4X6A H;  1N33 L;  1L2F A;  3U4Z A;  5LMN L;  3HOZ G;  5C4J H;  4YCU A;  2C35 B;  1NMF A;  3RZD H;  4UP8 A;  4LF7 L;  4QQB X;  3HKZ E;  4OON A;  1XMO Q;  4B3R L;  3H0G H;  1A0I A;  2UU9 Q;  1A63 A;  1QUQ B;  2AMC B;  1JJG A;  3CCS A;  1S40 A;  4JI2 L;  1PYB A;  2VZA A;  1EIF A;  1IXR A;  1XPU A;  3PO2 G;  3UDX A;  1Q1B A;  4LWC A;  3A5Z B;  3U50 C;  5JEA G;  3K7U C;  2F3I A;  4NXM L;  2K4K A;  1XNR L;  4YWM A;  3EIV A;  4X64 Q;  1ASZ A;  5LMU L;  5JJK A;  3KDF B;  2OQ0 A;  4GS3 A;  3KOJ A;  4DV2 L;  5E7N A;  5IWA L;  2MO1 A;  1OXT A;  5FJ8 G;  3HOV G;  1QZH A;  4JI4 L;  3PV0 A;  4J15 A;  1Q82 C;  1PH1 A;  5BR8 L;  3TEH B;  5C44 H;  2NVY H;  1NJI C;  1JJ2 A;  1L0W A;  2VQF Q;  2ATW A;  2RF4 A;  4DK3 C;  4L5S A;  3D0F A;  3S24 A;  4IPH A;  4A3B H;  1JE5 A;  2B63 G;  3AQQ A;  4AIM A;  4PG3 A;  4RG1 A;  4XTC S;  1IBK L;  1VQE A;  4YHH L;  4DUZ L;  5M5Y H;  2PQA A;  4A3F G;  5C0X I;  3J80 i;  4IPC A;  4DUY Q;  3G6E A;  2UUA L;  4GLX A;  4DV7 Q;  4DAY B;  2N49 A;  2JA8 G;  3OW2 A;  4NPS A;  1YZ6 A;  3U58 A;  2UXB Q;  4GOP C;  2NZH A;  3CCJ A;  1NBW A;  3OYY A;  4BBS H;  1EQQ A;  4LF6 L;  2UUB L;  1RIP A;  4DV1 Q;  4KI0 A;  2KEN A;  5IP9 H;  3BZK A;  4DR1 Q;  1I3Q H;  3RLF A;  3SGI A;  1VQL A;  3H15 A;  1KD1 C;  3HOY H;  2ZJR A; 
#chains in the Genus database with same CATH topology
 1Z9F A;  3CCR A;  1YNN D;  2MUY A;  4C3I B;  1V9P A;  4BBR B;  2PW5 A;  5CV5 A;  5M5W H;  2E2D C;  3S2H B;  2F0L A;  4APV A;  1YJW A;  4LF4 L;  3H3V H;  3G7L A;  2VUM B;  1JQY D;  3M85 A;  2N8N A;  1DJR D;  2L0C A;  3E9I A;  1T5X D;  2F3V A;  1EU3 A;  2E2H B;  3PUY A;  2V1C C;  3CQZ H;  1X3F A;  3AFP A;  3I4M B;  1X54 A;  1YEZ A;  3M4P A;  2KHI A;  1XWE A;  4DU9 A;  3J81 c;  2VUM G;  1PYW D;  3NTK A;  1I4P A;  3PIO A;  3PSI A;  1SXT A;  2AQ3 B;  1SE4 A;  2CWP A;  4KK7 A;  4R8N A;  2R92 G;  3RLO A;  2MNA A;  1QUQ A;  1II3 A;  2F1M A;  4OO1 I;  1HNX L;  3KBG A;  3GTO H;  2F0V A;  2KVM A;  4BA1 I;  2XSC A;  4DV6 Q;  4NXN Q;  4OX9 L;  1CQF A;  5GAE C;  1XPO A;  2ZXR A;  3ERO A;  1VQN A;  3MEF A;  4A93 G;  3UDF A;  2MJ8 A;  1EL0 A;  1Y69 U;  4HJ5 A;  2N55 A;  4G7O C;  3HKZ G;  1U5K A;  1SFO H;  1LT4 D;  3NSW A;  1HA6 A;  2B2U A;  5IYD G;  1YI2 A;  2PMZ B;  4HMJ A;  5DNF A;  4KY7 A;  5LMN Q;  1VQO A;  4YY3 Q;  3I55 A;  2R92 H;  3H91 A;  2KOL A;  4ZKC B;  2F3W A;  4A3G B;  4KMU C;  3SE0 A;  2XWB B;  5CBE E;  5I6W A;  1CUK A;  1Y8P B;  1PV4 A;  1H9K A;  1G51 A;  2MO0 A;  4A3G G;  2B2Y C;  2HHH L;  1LTI D;  3ZJY C;  4I7Z C;  5EBC A;  4XQN A;  4IAL A;  4B9W A;  2A8V A;  4L6T B;  1L1O C;  4U67 3;  2HCC A;  5TSS A;  4HAE A;  4P71 A;  1HA5 A;  3CC4 A;  1D2B A;  1PLF A;  1QVF A;  3D8G A;  4IJH A;  2IJ0 A;  5IE8 A;  3C46 A;  1ENA A;  1WTR A;  1I5F A;  3VA7 A;  1FL0 A;  1PRT F;  3DWQ A;  4GOP B;  3VR4 A;  4KY6 A;  4K14 A;  4R4T A;  5JAV A;  5FO8 B;  2WFW A;  2X6L A;  2L5T A;  2A74 C;  4OEL B;  5DM7 3;  2NVX B;  2NZO A;  4BY1 G;  3TZD A;  1SNM A;  5DM6 3;  3SK5 A;  5LHY 1;  3J81 i;  2DGY A;  1N36 Q;  5CV6 A;  3MFY A;  4P73 A;  4Y7N B;  1VQ5 A;  2JA5 B;  2IT1 A;  1RTN A;  4LNQ A;  2F0P A;  2PO4 A;  3BJU A;  3CRK C;  4A3I G;  5A35 A;  5IOD A;  2Q2I A;  4LFA L;  4MTN A;  2NN6 I;  1YIT A;  2B8G A;  1T9H A;  1WJJ A;  2RDF A;  5EQ0 A;  2JE6 I;  2A19 A;  3J7Z C;  1I4R A;  2D0O A;  2HQE A;  3K59 A;  2NVQ H;  1G91 A;  2WB1 E;  3L0O A;  2H4O A;  4QMG A;  3I56 A;  1RCV D;  1SJH D;  4BY1 H;  4DV0 Q;  4PQX A;  3FKI B;  3IRB A;  3TRZ A;  4JVZ A;  2XGT A;  5COR A;  2Q8I B;  3S1N H;  4JCV E;  3IAY A;  2Y0S E;  4JI6 Q;  5BN5 A;  4JC0 A;  3A56 A;  4A3I H;  3MEH A;  4X65 Q;  1PH5 A;  5FLM G;  3R8B A;  2XN9 C;  1ET9 A;  1IL8 A;  2A1A A;  2A69 C;  3G4S A;  1PFS A;  1J5E L;  3CPF A;  5CV4 A;  3S1R B;  4XT3 B;  4BY7 B;  4HED A;  3DM3 A;  1KL9 A;  1BDO A;  2E5L L;  1U4L A;  3SHL A;  3W1G A;  4LF8 Q;  3OPO A;  4FF1 A;  5K36 G;  2HQL A;  1YHQ A;  1TXY A;  5M5X H;  5C3W A;  3PF5 A;  4M1U B;  2F0O A;  1RF2 D;  3E0J A;  4K8I A;  2EYH A;  4GN4 B;  1SYB A;  4GOP A;  1OTC A;  1N33 Q;  1NE3 A;  5AFW A;  4LFC L;  3AU7 A;  1KDA A;  2KHJ A;  5FLM H;  3MXN B;  1HNW L;  3O13 A;  1CFM A;  2K5H A;  1Y1V G;  2GA4 B;  1PTO B;  4H02 A;  1C9O A;  5KND A;  1CTM A;  1YBY A;  3PMF A;  1IYJ B;  1KAA A;  1SYC A;  1GUO A;  1XNR Q;  2KEC A;  1CKO A;  3K0X A;  4K5W A;  2HD3 A;  3CCU A;  2I0Q A;  3CP0 A;  4WRD A;  4LF5 Q;  1B2T A;  1Y8O B;  4HR7 B;  3TS2 A;  4AYB B;  3AFQ A;  3NQT A;  3I3C A;  3I7F A;  4P72 A;  5K36 H;  4A3B G;  5AJ3 Q;  4KHZ A;  3PO2 B;  1H9J A;  4L63 B;  2PZU A;  5E1F A;  2KCT A;  4AYB G;  1IBK Q;  2OT2 A;  2PI2 A;  4U68 A;  4HJ7 A;  3TS0 A;  1J8I A;  1DOM A;  1BKB A;  3EN2 A;  3KF8 A;  2NVT H;  1STH A;  3HOV B;  1Y1V H;  1BXT A;  1HZA A;  4I7A A;  3ULL A;  1Q46 A;  4YIJ A;  1XTD A;  1D5Z C;  3KYH C;  4LF6 Q;  3J80 E;  1ILP A;  5JEA J;  4A4I A;  3HOY G;  1DYQ A;  4RHS A;  2EVB A;  1TWH H;  2F03 A;  1SLJ A;  4DAM A;  1CZW A;  4A3F B;  3L7Z C;  5E4W C;  2VS1 A;  2E2I B;  1D5X C;  4A3D G;  2PYK A;  1VS0 A;  2WII B;  3S16 B;  2M9V A;  1QVG A;  1JCK B;  4A3J G;  4JI7 L;  2B2U C;  1I50 H;  3BU2 A;  1RKN A;  1XNQ L;  3DLL A;  1K83 H;  3RN5 A;  5IGF A;  2EYJ A;  4JI8 L;  1KDC A;  3RD4 A;  5T1G A;  4PMB A;  1I4G A;  5JPN C;  3TN2 A;  2JA6 B;  1VQ9 A;  3NUC A;  3MXN A;  3DHQ A;  1BQQ T;  3LWU A;  3CCL A;  2Z8L A;  5LL6 X;  1HRJ A;  1KNE A;  4K0K Q;  4DR5 Q;  3DXJ C;  4CKC A;  1IBM L;  1HNX Q;  2L15 A;  4HIK A;  2ID0 A;  1DOL A;  4OX9 Q;  1JIC A;  4A3J H;  4DR7 Q;  4C56 C;  3J80 c;  3VYR A;  1JWS D;  3K80 C;  4ZYS A;  2HDM A;  4C1N I;  3CCV A;  2Q2U A;  1S5E D;  2PQA B;  3PUZ A;  2PPB C;  4LMQ D;  1IYV A;  3GTP H;  4IZ8 A;  1BVS A;  4IUN A;  4CJ0 B;  1CHP D;  3I72 A;  2K05 A;  1N32 L;  1H9M A;  2FJ2 A;  3TP6 A;  1G2S A;  2LXK A;  3VR2 A;  5CV9 A;  1X32 A;  1V1O A;  1G29 1;  4YWK A;  3KLW A;  2PZT A;  4QUF A;  3PF4 A;  2EYM A;  4DV6 L;  1O80 A;  1R9T H;  1SEB D;  4ODG A;  4GKK L;  1YNJ C;  2KCN A;  1Q12 A;  3CHB D;  1I6V C;  1E2W A;  5KEE A;  1X65 A;  3HG9 A;  1L0Y B;  2JP1 A;  3BS1 A;  1WFQ A;  1UEB A;  2MP1 A;  4ZUJ A;  2PZW A;  3M7N A;  1C48 A;  3M4O B;  4AQY L;  3V96 A;  1TWF H;  3GQB A;  1WTH A;  4B3M Q;  5DLQ E;  3HOU B;  3GTK B;  2ES2 A;  4X6A H;  5LMN L;  2K32 A;  3QJY A;  1DM0 B;  4QQB X;  3BVG A;  1K8M A;  1XMO Q;  2YU9 B;  4B3R L;  3H0G H;  3H6M A;  5CV8 A;  2F0I A;  1FD7 D;  3OMG A;  3HEJ A;  4XT1 B;  2AMC B;  1JJG A;  4LJZ C;  2O2L D;  1Q1B A;  3A5Z B;  3U50 C;  1EY9 A;  4RKL A;  1ASZ A;  5JJK A;  4GS3 A;  1PXU A;  4HCS A;  1Q3L A;  4DV2 L;  1BCP B;  1S5C D;  5FJ8 G;  1OO9 B;  3BDO A;  4KV6 A;  2FIN B;  1Q82 C;  4E6I A;  1NJI C;  1JJ2 A;  1L0W A;  4DK3 C;  3S24 A;  4J8Q A;  4PG3 A;  2F4I A;  1JB3 A;  1S5F D;  3DEP A;  2PQA A;  5C0X I;  3J80 i;  1EWC A;  4DUY Q;  1QNU A;  4X3U A;  4GOP C;  3CCJ A;  5J1Z A;  4BBS H;  4LAA A;  1CQV A;  1I4H A;  1RIP A;  5L37 A;  3T13 A;  5IP9 H;  4DR1 Q;  1VQL A;  5IGB A;  3H15 A;  1KD1 C;  1N36 L;  4QIW B;  5FJ8 H;  2E74 C;  3G71 A;  1DON A;  1HZ9 A;  1EYD A;  5M3M B;  1U4R A;  2JA9 A;  3T1Y L;  1NAP A;  5I2Y A;  1I6H H;  1JE4 A;  4YCV A;  5G3L D;  2I5H A;  4GNX B;  4DR4 Q;  1W6J A;  5IYC H;  3OW7 A;  4O0A A;  4G7H C;  4UDU C;  1LYL A;  4HN7 A;  1EQT A;  5LMN W;  1LTB D;  5EPL A;  1TWA B;  1J5E Q;  1VQD A;  3HOW B;  5CV7 A;  2PCF B;  2AQ2 B;  3NP8 A;  3A0J A;  2VY3 A;  3TP8 A;  1K3B C;  1IHZ A;  3VA5 A;  1WCM G;  4KLK A;  4JV5 L;  1XXG A;  5EGT A;  1WTW A;  4DV0 L;  3HOW G;  3KUP A;  2PQE A;  1ML0 D;  1LT5 D;  2QGQ A;  4QB4 A;  3FMC A;  1B1Z A;  2F0U A;  3J7A V;  2QKI C;  4L5R C;  1HNW Q;  4QCL A;  2AKW B;  5EKI A;  2XIW A;  2EXZ A;  4LUZ A;  2WAQ B;  2O5I C;  2HIV A;  1G2T A;  2EJF C;  1TR5 A;  3BYT B;  3J81 j;  2UXC L;  4DK6 C;  5FLX E;  3M7G A;  1HXY D;  1S3O A;  3BYY B;  1CM9 A;  5C5M A;  3SK6 A;  1O78 A;  1N34 L;  4A3K B;  5C3E B;  1XYI A;  3UDI A;  4DK0 A;  3IFT A;  5IT9 L;  3A74 A;  1B9M A;  4DR6 L;  1EQR A;  4CHT B;  2FXQ A;  4QF4 A;  1MJC A;  3QIA A;  2F0Q A;  4JI2 Q;  1RDP D;  1JJC B;  4N9P A;  2R93 B;  5JJI A;  5BN4 A;  1HTP A;  4PNY A;  4DPG A;  3D4W A;  2R7F A;  4ZAI A;  5I2X A;  3S15 H;  1EU4 A;  4N8X 1;  4PZ6 A;  4J6H A;  1ESR A;  3Q22 A;  2B2W C;  1PTO C;  1CI3 M;  4ULL A;  3E6Z X;  2A69 D;  4A3E G;  3TDQ A;  1UE5 A;  2CWA A;  1ASY A;  5FK9 C;  4GNX A;  4MIU A;  2R7Z H;  4LF5 L;  1KTK A;  2NBF A;  1B44 D;  3S17 H;  2PMZ E;  2UXD L;  2YTX A;  4XIG S;  3BZC A;  4GKJ L;  1U0L A;  1G6Z A;  5J39 A;  3DEO A;  1BCP F;  5AJ3 L;  1PRT B;  4ZQ3 A;  4FDB A;  1I3Q B;  2MHV A;  1MI2 A;  4JI7 Q;  3QOL A;  1EOT A;  3HOZ H;  1PFN A;  5M3F G;  3BDC A;  2IHE A;  2PW7 A;  1XNQ Q;  1AE3 A;  1RHP A;  3GTJ H;  1FR3 A;  3FDT A;  3V05 A;  5FLX c;  2JJQ A;  1E0B A;  3R3O A;  4JI8 Q;  2K52 A;  1FGB D;  2K1B A;  4A3E H;  2EDG A;  1IZ6 A;  2EQS A;  2KED A;  2RHS B;  4WOR A;  3CRL C;  2Q8T A;  3CQZ B;  1BBX C;  2ZJP A;  2DNE A;  2ZTD A;  4JOI A;  4ZRZ A;  1IBM Q;  4B3S Q;  3S2D H;  1NCV A;  2B2V C;  1XX8 A;  4P75 A;  5ELF A;  1Q8K A;  4PZ7 A;  5IP7 G;  3SK4 A;  1Y1W G;  1WD0 A;  3KBX A;  2DY8 A;  2VB3 X;  4KD3 A;  4DV7 L;  1EFW A;  1IW7 C;  2MFI A;  2X6G A;  2YTY A;  2UXB L;  4C3I G;  2JA8 H;  1B70 B;  4BBR G;  1NTG A;  3GTQ H;  1NNX A;  2VL6 A;  1E2V A;  3EBE A;  3T51 B;  3NQI A;  3S1M B;  5FO7 B;  4IUP A;  2AUJ D;  3PCO B;  1N32 Q;  3F1Z A;  1ZYR C;  2WV6 D;  1SJE D;  4B3T Q;  1M90 C;  3I4M G;  4K0K L;  4DR5 L;  1KHI A;  5CBA E;  1HCZ A;  2B39 A;  3I2Z A;  5I6Y A;  4BWG B;  5CGK A;  4DR2 L;  3P75 A;  2OCE A;  1Y1W H;  1UE7 A;  5FO9 B;  4DR7 L;  3TZU A;  4GKK Q;  3HFZ B;  4FVM A;  2QIL A;  2XNA C;  4CGY B;  5KNC A;  1LTA D;  3STB C;  2Q8R E;  2F0K A;  2BDO A;  1K73 C;  2O4X A;  2KCC A;  4BBR H;  4C1N K;  1K0R A;  1SE8 A;  4AQY Q;  2D0P A;  4LF9 Q;  3S2H H;  1EYA A;  2C5C A;  2QEJ C;  2VUM H;  2AWO A;  1FNW A;  1M8A A;  4X62 L;  4DNR B;  3VYS A;  1TS2 A;  2RBM A;  2E2H H;  3T1H Q;  4NKL A;  2ALY B;  5EBD A;  4B3R Q;  4X66 L;  3A5U A;  1SND A;  4QUC A;  4OWW B;  3AEV A;  1VMC A;  2ZXP A;  4KTA A;  2F0H A;  1YNX A;  1EY7 A;  3K7A H;  4NW2 A;  4A93 H;  2RCN A;  1SN8 A;  3NBH B;  1HTL D;  3I4L A;  1QVC A;  2BOS A;  2ZTE A;  4DV2 Q;  1LAC A;  3J81 L;  2A6E C;  1N8R C;  4DNI A;  3D4D A;  3IFD A;  2VB2 X;  4B3M L;  5IYD H;  1K28 A;  1STN A;  2C9O A;  5IY0 A;  1HZC A;  5EPK A;  2Z6B A;  2N88 A;  2RA4 A;  3AMU A;  1AFP A;  2CH4 A;  4L5T A;  3EVQ A;  1XMO L;  2E8G A;  4JG2 A;  1U9R A;  4R4C A;  2D9U A;  5JJL A;  2B2T A;  3QG1 A;  3M4Y A;  2O5J C;  1IKL A;  1X55 A;  2B63 B;  3BG3 A;  2F0J A;  4IFD I;  1YNJ D;  1SYG A;  1YJ9 A;  4A3G H;  2ZXO A;  1A15 A;  4AYB E;  2NTS A;  3PUX A;  4LUV A;  3HP3 A;  1PH3 A;  3K81 C;  3ND8 A;  1K8G A;  1SNC A;  1IBL L;  3T1Y Q;  1JOO A;  2NUC A;  2WKC A;  1LUZ A;  1U4M A;  2F0M A;  4ILW A;  5KYL A;  4IOC A;  5ELD A;  2R6G A;  3W5O A;  2JA5 G;  3S1N B;  4I65 A;  2KA7 A;  5COY A;  3RNU A;  3P1H A;  3D4R A;  1E7Z A;  4DUY L;  3VDY A;  4JBK A;  1R4Q B;  3HKS A;  3J7A F;  3S1Q H;  2ICE C;  3HOX B;  3NTH A;  1EYC A;  3KLR A;  2IPK D;  4JV5 Q;  4EQO A;  4P74 A;  3TSS A;  1D8L A;  1A62 A;  2FMM A;  3E9H A;  4HIM A;  4DR1 L;  1ENF A;  2CCZ A;  5GAH C;  2K5N A;  4C2M B;  2OF1 A;  4X3S A;  1KC8 C;  3MZ5 A;  1KDB A;  5I9P A;  2QDB A;  1X56 A;  1STE A;  3U9S A;  1PA6 A;  3FKI G;  1LTT D;  4DR4 L;  3NBH A;  3A55 A;  2JA5 H;  3D31 A;  1B4O A;  4ZK9 B;  1JWU D;  1A3V A;  4OWT B;  3C2P A;  2NTT A;  1LTL A;  1X6O A;  4UP9 A;  1HUM A;  2E2J B;  3OIQ A;  4G4K A;  2UXC Q;  2K5W A;  1VQF A;  1KLU D;  4JI0 Q;  1N34 Q;  5C0X J;  4BY7 G;  2EPB A;  4DR6 Q;  4RHR A;  4HCE A;  2JA7 B;  4JI5 L;  4QL5 A;  4R4I A;  1F9Q A;  1XMQ Q;  2SDF A;  3BDL A;  4KY5 A;  5D65 A;  1EYG A;  1SMX A;  2G9D A;  4QY7 A;  1ROD A;  5IGC A;  1DD2 A;  3PUV A;  3MXG A;  2VXW A;  1Q7Y C;  4JOI C;  2NZ1 D;  2WP8 J;  2K6A A;  1BUV T;  3I4N B;  4P2C B;  2XTI A;  3W2D A;  1DOK A;  3H3V I;  1E2Z A;  3AB9 A;  1VQ6 A;  1V43 A;  3PO3 B;  1MJE A;  2VQE L;  1TS5 A;  1AW7 A;  2UXD Q;  2F0W A;  3I90 A;  4L5Q A;  4GKJ Q;  5A2Q L;  4UAI A;  3T4A C;  1PZI D;  3KLS X;  1NMF A;  3RZD H;  4UP8 A;  2Z4H A;  4OIJ A;  4OIK A;  1LAB A;  3BVM A;  1A63 A;  4ZCK A;  2NWG A;  3OWF A;  4JI2 L;  4H13 C;  3PO2 G;  4LWC A;  1GUG A;  4X3T A;  5JEA G;  1JWM D;  2F3I A;  2K4K A;  4JK1 C;  1PDQ A;  3KDF B;  2OQ0 A;  1X3Q A;  1UNS A;  1WTP A;  2MO1 A;  1F2M A;  3E3X A;  3HOV G;  1QZH A;  1SNO A;  4JI4 L;  3PV0 A;  5ELC A;  3GTG B;  2RDG A;  1PTO H;  2R61 A;  3A8I E;  3TEH B;  5BR8 L;  1PH1 A;  2ATW A;  3MXU A;  4L5S A;  1EIH A;  3D0F A;  4F87 A;  4RCO A;  4RKB A;  1B9N A;  4CKB A;  4A3B H;  5M9O A;  4O1N A;  4RG1 A;  4XTC S;  2XRQ D;  1LTS D;  4YHH L;  5BN3 A;  1PRT C;  4HTH A;  4DUZ L;  2WB1 B;  3SEB A;  4A3F G;  4IPC A;  4EQN A;  4DV7 Q;  4XQQ A;  4NPS A;  2UXB Q;  1NBW A;  3PIO 3;  3MC0 B;  1Z6H A;  1H9R A;  5JEA H;  2A5H A;  2KEN A;  1SNP A;  3BZK A;  1PTO D;  3FRP B;  5F2D A;  3HOY H;  2Y0S B;  3HOV H;  4JI3 L;  3NEN A;  3UDG A;  2JSO A;  1EIG A;  5GAD C;  4EQ5 A;  4IO9 A;  1SBB B;  2RVL A;  3KJP A;  3T16 A;  4IUV A;  4B3S L;  2JA6 G;  3V2T A;  4A3D H;  4DR2 Q;  3QB3 A;  3Q23 A;  1HZB A;  4UPA A;  2N78 A;  5C4X B;  3B6Y A;  1KNA A;  2OTJ A;  3CCM A;  2E2I H;  1XPR A;  1LM0 A;  1GHJ A;  2VW9 A;  4PZ8 A;  2QW7 A;  3S16 H;  1DZ1 A;  2JQO A;  3QO2 A;  4C3J B;  2DN8 A;  5C6A A;  1VQK A;  1X3G A;  4R8I A;  5EKL A;  3CME A;  3J7Y W;  1MKH A;  1GKH A;  4OEM B;  3F2U A;  3NEL A;  1AN8 A;  1BBU A;  3E0E A;  4Y52 H;  4IUU A;  2B2T C;  2NB0 A;  5J3B A;  4EX5 A;  2Z1C A;  4X62 Q;  1KLG D;  4DA2 A;  1CA5 A;  4B3T L;  3JC6 6;  1TWF B;  2K5D A;  1CT1 D;  1OXU A;  1SE3 A;  3M4Q A;  4X66 Q;  1BNZ A;  2JA6 H;  1GUW A;  1RD9 D;  2IL8 A;  3KDF A;  3C1E A;  2F0T A;  3JAM E;  4JW0 A;  1HR0 L;  3PGZ A;  4UP7 A;  3FPU B;  3H0G B;  1WTV A;  2H1E A;  2RCF A;  1EQV A;  4JPB W;  1D1K A;  4A75 A;  1IW7 D;  3MA2 B;  3K58 A;  1AZQ A;  3L9A X;  1AE2 A;  1TQO A;  3ULP A;  2A68 C;  4A3M B;  4LF9 L;  4DK1 A;  4RGT A;  2L1B A;  4CDE C;  4K5V A;  4LF7 Q;  4ME3 A;  4ME5 A;  4DR3 L;  3HGB A;  4H0L C;  2KCM A;  1QWY A;  1ZYR D;  1SDF A;  4GLV B;  1T5E A;  5KRU A;  3T1H L;  1VF7 A;  4ID6 A;  1EIY B;  4A3M G;  5KIX A;  1JR0 D;  3HOU G;  3MVV A;  5H1S E;  2IX1 A;  3J80 L;  2WAQ E;  4IUQ A;  4OO1 G;  4KD4 A;  3DUZ A;  5ELB A;  3K5L A;  3CC7 A;  1L1O B;  1F9P A;  3STB D;  2DY7 A;  4C3H B;  3ND9 A;  1V1Q A;  1ONL A;  4DV4 L;  1EY4 A;  3A8J E;  4BBS B;  5I9O A;  4N8F A;  1Q86 C;  1IBL Q;  1CSQ A;  1RJT A;  1GXD C;  3A7L A;  4CDD C;  1GM5 A;  4EGV A;  1TII D;  2K33 A;  3E5S A;  3S9W A;  3CD6 A;  3JAM c;  2CW0 D;  3M3Y B;  5D14 A;  2V4D A;  2UU9 L;  2WIN B;  4O2D A;  3S14 B;  1LTR D;  3IL8 A;  4NB3 A;  1OXV A;  1STG A;  4BA2 I;  1TKW B;  2FHT A;  4LK1 C;  5CC4 A;  4OO1 H;  1K0S A;  3GP7 A;  3GV3 A;  3EQL C;  3TBI B;  3G48 A;  5ELN A;  3L2P A;  2F0D A;  3WOE A;  4FF2 A;  3U9O A;  2EY5 A;  3NWT A;  4IUR A;  1JT8 A;  5J22 A;  1BBW A;  4A76 A;  2LS0 1;  3C1F A;  2A6E D;  1LT3 D;  3D6W A;  3HRZ C;  1PH6 A;  4LW1 A;  1TWG B;  4F88 A;  2MGS A;  2JEA I;  4ABN A;  1OXX K;  3I91 A;  1VQJ A;  3OSO A;  2EJM A;  1QE6 A;  4WJ3 M;  1TY0 A;  2L11 A;  3NEM A;  4A3C G;  5M3M G;  1PH9 A;  2EY2 A;  4UHV A;  1HJP A;  1TWC H;  1DCZ A;  2IW3 A;  1VQG A;  5ISR A;  5GQO A;  2ZJQ A;  5HY6 A;  1ESF A;  1WTQ A;  4CDC C;  1E1T A;  4JI5 Q;  1JOR A;  5CMD A;  2FMC A;  1SNQ A;  4IFD J;  3OIP A;  5EPJ A;  1FJG L;  1K8A C;  1TS4 A;  1L1O A;  2Z9H A;  3KFU A;  4O42 A;  4TSS A;  2RKS A;  1VQH A;  3LNN A;  2F4V Q;  5CR3 A;  1ZKO A;  2A6H C;  5C4J B;  1UAP A;  4A3C H;  4DFA A;  5M3M H;  3CC2 A;  1HFG A;  1E24 A;  3ICE A;  2RSO A;  3R2T A;  2NN6 G;  4OL7 A;  4CJ1 B;  3S15 B;  4AH6 A;  3I4O A;  2VQE Q;  1YHA A;  1WCM H;  5JPM C;  2ZM6 Q;  1B7Y B;  2DJF C;  4JI0 L;  1TWA H;  2WAQ G;  3HOW H;  5C3X A;  4ZUI A;  1PZK D;  2LKV A;  3MFG A;  4DV3 L;  4DF7 A;  1GUS A;  1O7Z A;  3JAM i;  3CMA A;  1DGS A;  4FF3 A;  2R7Z B;  1BO0 A;  1KAB A;  1HNZ Q;  5IYB G;  1EWI A;  5JOB A;  3S17 B;  2CQA A;  3RMH A;  1YJN A;  2WKD A;  1XMQ L;  4A3K G;  1YVC A;  3NHH A;  2NVY B;  5C44 B;  5C3E G;  4XYO A;  3URY A;  3KJO A;  1F2Z A;  4POG A;  1VQB A;  1C4Q A;  3HOZ B;  3X3N A;  4Q0F A;  2F0N A;  1ENC A;  4KJN A;  1AEX A;  4MHE A;  5M5Y B;  2ASB A;  4EVO A;  4LFB L;  4TKO B;  2NN6 H;  1ICW A;  2R93 G;  1SMY C;  3PQI A;  3R2I A;  4JI4 Q;  4GN3 B;  3GTL H;  5E4X A;  3QOJ A;  5BR8 Q;  3I8Z A;  5G3L F;  3GTM H;  4JI1 L;  1HQR D;  1TT2 A;  1PFM A;  1EZ8 A;  2MQH A;  3FHW A;  1E22 A;  5KNB A;  2WAC A;  1TVX A;  2D62 A;  1GO3 E;  1C8C A;  4HJA A;  3F2B A;  1SYD A;  2RSN A;  4YHH Q;  4DUZ Q;  4YWL A;  5IYB H;  4ALP A;  3A7A B;  3CCE A;  4QGU A;  4IPD A;  1X3E A;  3K5N A;  1VDZ A;  4A3K H;  1M1K C;  3OWE B;  5C3E H;  1VQP A;  2QEX A;  5IIF A;  4KKS A;  3MTS A;  5M5W B;  3RN2 A;  4GLA C;  4FO2 A;  2IY5 B;  2R93 H;  3Q8D A;  4DV5 L;  4JI3 Q;  3G6J B;  2JA8 B;  1S72 A;  1VQ7 A;  1NY4 A;  4FNF A;  4RWS C;  2BA1 A;  2HDL A;  3NXW A;  2K14 A;  3VYU A;  4IJL A;  4RH6 A;  1ILQ A;  2R7D A;  2EY6 A;  4R4O A;  1H9S B;  3GD7 A;  2LFN A;  1WTO A;  2LY7 A;  2BE5 C;  1J9O A;  1PMR A;  3CAM A;  4NP5 A;  4JYA L;  2L55 A;  3RZO H;  4WFN 3;  3MWY W;  2XRS D;  1CA6 A;  5M3F H;  1NR2 A;  2I5M X;  1JC7 A;  1VQ8 A;  1NSN S;  4RGO S;  1W3S A;  3GTO B;  1BOS A;  2NYZ D;  4KKU A;  4JBJ A;  4DAP A;  4FXG C;  2KEE A;  2F52 A;  1H95 A;  1E1O A;  4DXF A;  1W6K A;  1G8Z D;  4POF A;  4K2K A;  1P16 A;  2QF7 A;  4TQU S;  4Z9C B;  3PIP A;  1O7I A;  2EZV A;  1SFO B;  1KRT A;  1ZEQ X;  5HUR A;  1A6X A;  1JMC A;  1FGU A;  2KJX A;  4YCW A;  1VQA A;  2F0E A;  1STA A;  2IX0 A;  1N9W A;  4IPG A;  3Q0A A;  3A54 A;  5IP7 H;  2R92 B;  1HR0 Q;  2ICI A;  3D6C A;  3OTO L;  1PRT D;  2KHS A;  1S4Z A;  1M4V A;  1ZXT A;  5FLX L;  1Z47 A;  5GRO A;  4R1J A;  3CF5 A;  4IUT A;  2K5Q A;  5EAY A;  3NK9 A;  2PI2 E;  4JBM A;  4ZKB B;  4C3I H;  2JYO A;  3HZX A;  2BH8 A;  3NWS A;  3TP5 A;  3VR6 A;  3K7A B;  2JN4 A;  2UUC L;  4A93 B;  1O7L A;  1SE2 A;  2DJG C;  1E3P A;  2CW0 C;  4K5X A;  1CHQ D;  3CPW A;  4DR3 Q;  2HIX A;  1Z7T A;  4KKT A;  3HKZ B;  1K9M C;  4DGZ A;  2CQO A;  4KN7 C;  3I4M H;  3S1M H;  1D6E C;  4MN3 A;  1PH8 A;  3ZYY X;  5JVG 3;  1RL2 A;  1QJO A;  2CKZ B;  1EOV A;  1J6Q A;  4DKA C;  1WYD A;  5JVH 3;  2TSS A;  2GVA A;  5HGQ A;  1PH2 A;  1WD1 A;  4DV4 Q;  3CKI B;  2EIF A;  1H9S A;  2HT1 A;  1L2F A;  3U4Z A;  2CH4 W;  5D3D A;  4YCU A;  2C35 B;  4LF7 L;  4OON A;  1B50 A;  1A0I A;  2UU9 Q;  4FYD A;  1V1P B;  3CCS A;  4DXG A;  4NMZ A;  1IXR A;  1XPU A;  2EYP A;  3UDX A;  2CHB D;  3EIV A;  4ZLT F;  1B53 A;  5I4D A;  1D5M C;  1OXT A;  2NVQ B;  4J1M A;  2L12 A;  3S1Q B;  1UEA B;  1MD2 D;  1HHV A;  2VQF Q;  1MGS A;  2AQ1 B;  2RF4 A;  5A2Q E;  1BCP C;  2B8F A;  3TP7 A;  1ET6 A;  1Q90 A;  2B63 G;  3NTI A;  4AIM A;  2L9H A;  4BY1 B;  2A68 D;  1VQE A;  3X3M A;  1IKM A;  1EEI D;  1EY0 A;  4XQJ A;  3G6E A;  2UUA L;  1PZJ D;  4V0B A;  4DAY B;  2N49 A;  3OW2 A;  3I70 A;  4FF4 A;  3U58 A;  1MSH A;  2NZH A;  4A3I B;  1EEF D;  3OOC A;  3OYY A;  1XTC D;  4OHJ A;  3R93 A;  5KGU A;  2UUB L;  4KHV A;  3SGI A;  5FOB B;  1A3T A;  1P8L A;  5DEH A;  4B9X A;  4HIO A;  3UE0 A;  4KHP Q;  1GUT A;  4FXD A;  3HOX G;  3AYH B;  2B63 H;  3RUZ A;  4H44 C;  2NVX H;  2XWJ B;  5M5X B;  4IQZ A;  1FJG Q;  2EJG C;  5ELO A;  5ELE A;  2EOT A;  4TVA B;  4GNX C;  4Y7N H;  2Q2T A;  4M8A A;  2K7V A;  3NBI A;  1F2L A;  2E76 C;  1W2B A;  1LTG D;  3KF8 B;  1VQM A;  2QA4 A;  4Q5V A;  2EYL A;  1WTX A;  4LUO A;  2J0T D;  1WI5 A;  5C0X G;  2J4X A;  2IWH A;  4UY8 C;  1V1P A;  3T56 B;  4DV3 Q;  3K5O A;  1PHJ A;  4K6D A;  2CFM A;  4R4Q A;  3HOX H;  2OXP A;  1IL2 A;  1NUC A;  3LWE A;  4DNT B;  1GOZ A;  4F7X A;  2YYZ A;  3FKI H;  1S5D D;  3RZD B;  3NPP A;  4C2M H;  2JA7 G;  2F4V L;  4BXX G;  1LT6 D;  3VR3 A;  1GUN A;  2B3G A;  4XXE A;  2PNH A;  1QIL A;  4LFB Q;  1ICF B;  2NVT B;  4HJ8 A;  1Y1V B;  1MHW C;  1PH4 A;  1D7Q A;  5C0X H;  1KXL A;  3W1B A;  4FXK C;  4JI1 Q;  5E3F A;  3ULJ A;  4DAY A;  2ZM6 L;  2AWN A;  4G57 A;  2G5D A;  4XDX A;  2BH2 A;  3TME A;  3S1R H;  1WVL A;  2IX3 A;  4BY7 H;  2X69 A;  2E2J H;  1TWH B;  3I4N G;  2K5V A;  1A2T A;  3GV6 A;  1I94 L;  2JK8 A;  1HNZ L;  3PO3 G;  2VNU D;  4A3B B;  2EY1 A;  4R9W A;  2K75 A;  3Q24 A;  4NXM Q;  4GZY C;  5LMU Q;  2D5D A;  3FVQ A;  4FP5 D;  1C7Y A;  5IWA Q;  2JA7 H;  4BXX H;  5IGD A;  2I07 B;  1YNN C;  2A6H D;  4RAU C;  1I50 B;  4RFB A;  1K83 B;  3P7J A;  4DV5 Q;  1PYS B;  3FP9 A;  1CSP A;  2L4N A;  2Z0S A;  3DM1 A;  3LGJ A;  4K6L A;  3HOY B;  2JEB I;  3I4N H;  1SRO A;  2G9H D;  4JYA Q;  1MBY A;  3EJI A;  3KLS A;  3PO3 H;  1QB5 D;  3TQY A;  4RGM A;  2QDL A;  3SXH A;  1GD7 A;  5K5P A;  1K8O A;  1HQM C;  4MZ9 A;  4X3K A;  4A3D B;  4B08 A;  3PIP 3;  2H5X A;  1SAP A;  2EE1 A;  1VF5 C;  1Q1E A;  3EFX D;  5NUC A;  4X64 L;  4A3J B;  1STY A;  3PO2 H;  5T1I A;  1GHK A;  1CKN B;  2WB1 G;  3EA6 A;  1UWV A;  1UUP A;  1HFN A;  4WJW A;  3H3V C;  2K28 A;  4N9T A;  1LV9 A;  1SMY D;  3WWV A;  3UE1 A;  3VYT A;  2Z6K A;  1KAW A;  3CW2 C;  1EWH A;  1F77 A;  4CBV A;  3GTP B;  4LF4 Q;  2MPM A;  4K2L A;  4HJ9 A;  2Y0S G;  1NMG A;  1F2Y A;  1LO5 D;  1CKM A;  2HCI A;  3SK8 A;  3GTG H;  4A3F H;  3OHX C;  3OTO Q;  1I4X A;  4L8J A;  2DUD A;  2B29 A;  2EYO A;  1XJV A;  1IYU A;  1PVO A;  1L0X B;  5IGE A;  2EXD A;  4DV1 L;  1Y14 B;  4V19 0;  2BCO A;  1R9T B;  1A8V A;  2OWO A;  1SYE A;  5C4X G;  2UUC Q;  1HPC A;  2B2W A;  1TS3 A;  5C5L A;  1X9N A;  2RHQ B;  1QZG A;  4QIW E;  2XVS A;  4A3L G;  1PFB A;  2EYF A;  4S3S A;  1FNV A;  1SRU A;  3MAQ A;  4C3J G;  3KF6 B;  2QCP X;  2F0S A;  4GN5 A;  1BR9 A;  4KN4 C;  1VMP A;  5HGT A;  3W3A A;  1O7Y A;  2SNS A;  2BE5 D;  1FVI A;  4PMW A;  1V8Q A;  1SSO A;  1C0A A;  4QJF A;  1JOQ A;  2I5L X;  1UE6 A;  1QNK A;  5EJW A;  5C4X H;  2TMP A;  2BDN A;  2K03 A;  1YHB A;  3H0G G;  4CKE A;  1B8A A;  4A3L H;  3KK7 A;  2RDH A;  2J7Z A;  2F0G A;  1KIX A;  4NXN L;  4C3J H;  1MSG A;  2A73 B;  2I46 A;  1CZG A;  1CKN A;  2HHH Q;  2HUG A;  2ZTC A;  2B2V A;  1PTO F;  2K50 A;  2LXJ A;  4HMI A;  2AHO B;  4XYQ A;  1EY8 A;  1HH2 P;  4JBW A;  3HS0 C;  5CYU A;  2AUK A;  1D1I A;  5D3I B;  2KUM A;  2SOB A;  2LSS A;  3H09 A;  4YY3 L;  2ZT9 C;  2D2C C;  1VQI A;  1A3U A;  1FYC A;  3GDE A;  3M9B A;  3WOF A;  5IT9 E;  4C3H G;  4MTK A;  1YIJ A;  2UUA Q;  5EKK A;  1AH9 A;  4BBS G;  5DAU A;  3M4O H;  1VQ4 A;  5LL6 S;  4A3M H;  2OQK A;  1I6H B;  1KQS A;  5IP9 G;  3HOU H;  3ONA B;  3GTK H;  2Q2H A;  1G6P A;  2UUB Q;  1STB A;  1UE1 A;  4WJ4 A;  2K01 A;  1PH7 A;  4RA8 A;  5KYI A;  3SDZ A;  3DMU A;  3KF6 A;  3CCQ A;  3C3L A;  1TWC B;  1HR0 W;  2YU9 H;  3J7A 5;  2JXM B;  4K8J A;  3CU7 A;  5IYC G;  4LFA Q;  1VQC A;  1TY2 A;  2VQF L;  3ITP A;  1JB7 A;  3TRE A;  3UI2 A;  2N3S A;  4C3H H;  3F2C A;  2K04 A;  3K0Y A;  1Q8I A;  4NDX A;  3ERS X;  4IOA A;  3WDN A;  4HID A;  1MIU A;  2SNM A;  4MNO A;  2M2L A;  3F2D A;  1GVP A;  2Z4I A;  3M3Y H;  3OMC A;  3DWA A;  3SR1 A;  4DN4 M;  4RMF A;  3NE5 B;  4HSV A;  4TRD A;  2GVB A;  3S14 H;  1S5B D;  5IT9 c;  1B3A A;  3QWN A;  1EY6 A;  3L3O C;  2B2Y A;  1WOC A;  3MHB A;  1QG7 A;  4RGN A;  1JOK A;  3U4V A;  4IFD G;  4KHP L;  1A2U A;  3RLN A;  1LLR D;  1WCM B;  2DNC A;  2ENB A;  3JAM L;  1EY5 A;  1BCP D;  3D3R A;  3RR5 A;  1B3Q A;  3BVZ A;  1R4P B;  1AZP A;  2E5L Q;  1EUJ A;  2RQX A;  2LMC B;  1U4P A;  1QCB D;  1NR4 A;  3PUW A;  3CXC A;  2E75 C;  1EFI D;  1TWG H;  1VCI A;  3N52 A;  3Q6S A;  3H94 A;  4OWX B;  2OTL A;  3K8A A;  3FPP A;  2YV5 A;  3F8T A;  1KRS A;  1GJX A;  4LFC Q;  4JI6 L;  4CJ2 C;  3A8K E;  4IN3 A;  2P5Z X;  3VR5 A;  4X65 L;  2IHF A;  3GO5 A;  1K3R A;  3GTL B;  4IFD H;  1I94 Q;  5IOC A;  1SR3 A;  3GTM B;  2KBN A;  2PNR C;  1OXS C;  1HUN A;  3MXP A;  4PV1 C;  4OGQ C;  1QOH A;  2GN5 A;  2YTV A;  1Q81 C;  1RTO A;  4LF8 L;  1F9R A;  2Z6K C;  1X3P A;  2R7Z G;  4OXP A;  1Y8N B;  2OEO A;  1F9S A;  3ER0 A;  5C4H A;  1DXM A;  1AP0 A;  2BA0 A;  5JJZ A;  3GTJ B;  5GAG C;  5C44 G;  2M00 A;  3QR8 A;  1N33 L;  4RCN A;  3T53 B;  3HOZ G;  5C4J H;  4A3E B;  5FKA C;  3LX0 A;  3HKZ E;  3K6O A;  5IGG A;  1CK1 A;  1FNU A;  1QUQ B;  4KJO A;  4G7Z C;  3P20 A;  4EQP A;  1S40 A;  1PYB A;  3I73 A;  4F8M A;  1TU2 B;  2VZA A;  1EIF A;  2KQ3 A;  3S2D B;  3K7U C;  4DAV A;  4NXM L;  1XNR L;  4HSP A;  4YWM A;  4X64 Q;  1SYF A;  5LMU L;  3RZO B;  3KOJ A;  5E7N A;  5IWA L;  5M3F B;  3ERQ A;  5C4Z A;  4J15 A;  4H7B A;  3J81 E;  3FEW X;  5C44 H;  2NVY H;  3N6R A;  3GTQ B;  2CVR A;  4IPH A;  2F0F A;  1JE5 A;  3AQQ A;  2R3Z A;  1IBK L;  5M5Y H;  2SEB D;  4GLX A;  1EZ6 A;  2JA8 G;  3SVM A;  4PMC A;  1YZ6 A;  3K5M A;  1BF4 A;  3BZD B;  1EQQ A;  4LF6 L;  4BS9 A;  1I4Q A;  3DWP A;  4CDF C;  4DV1 Q;  4KI0 A;  3IKJ A;  1I3Q H;  3RLF A;  3K57 A;  1Y1W B;  2FFK B;  2ZJR A; 
#chains in the Genus database with same CATH homology
 1Z9F A;  5FJ8 H;  1P8L A;  3G71 A;  4JI3 L;  3CCR A;  3HOV H;  1HZ9 A;  3NEN A;  3UDG A;  4HIO A;  3UE0 A;  2JA9 A;  5GAD C;  3T1Y L;  4EQ5 A;  4KHP Q;  1V9P A;  1I6H H;  3HOX G;  3AYH B;  4IO9 A;  4YCV A;  2I5H A;  3KJP A;  4GNX B;  2B63 H;  4DR4 Q;  5IYC H;  2NVX H;  4B3S L;  2JA6 G;  4A3D H;  4O0A A;  5M5W H;  4DR2 Q;  1LYL A;  1FJG Q;  4APV A;  5LMN W;  1YJW A;  4LF4 L;  1HZB A;  5ELO A;  4UPA A;  3H3V H;  2N78 A;  1J5E Q;  3B6Y A;  4TVA B;  1VQD A;  2N8N A;  4Y7N H;  3M85 A;  4GNX C;  2Q2T A;  2OTJ A;  3E9I A;  3CCM A;  1XPR A;  2E2I H;  1LM0 A;  2VW9 A;  1W2B A;  3PUY A;  3KF8 B;  2V1C C;  3CQZ H;  2QA4 A;  1X3F A;  3A0J A;  4PZ8 A;  3AFP A;  2VY3 A;  1VQM A;  3S16 H;  2JQO A;  1WCM G;  1X54 A;  1YEZ A;  2KHI A;  3M4P A;  4KLK A;  3J81 c;  1VQK A;  4JV5 L;  1X3G A;  2VUM G;  4LUO A;  3CME A;  1WI5 A;  5C0X G;  4DV0 L;  3HOW G;  3PIO A;  3PSI A;  1MKH A;  1GKH A;  2CWP A;  3NEL A;  4UY8 C;  2R92 G;  3RLO A;  1BBU A;  3E0E A;  2MNA A;  4Y52 H;  5J3B A;  1QUQ A;  4EX5 A;  4OO1 I;  2QGQ A;  4X62 Q;  4DV3 Q;  1HNX L;  3GTO H;  1PHJ A;  4R4Q A;  2CFM A;  4B3T L;  3JC6 6;  3HOX H;  4BA1 I;  4L5R C;  4DV6 Q;  4NXN Q;  4OX9 L;  1OXU A;  1IL2 A;  1HNW Q;  5GAE C;  1XPO A;  2AKW B;  3M4Q A;  4X66 Q;  2JA6 H;  1VQN A;  3MEF A;  3KDF A;  4A93 G;  3UDF A;  2YYZ A;  4LUZ A;  1HR0 L;  3FKI H;  2HIV A;  3PGZ A;  4C2M H;  4HJ5 A;  4UP7 A;  2F4V L;  2JA7 G;  4BXX G;  3HKZ G;  1U5K A;  4A75 A;  1SFO H;  3J81 j;  2UXC L;  4DK6 C;  2B3G A;  1S3O A;  2PNH A;  4LFB Q;  4HJ8 A;  5IYD G;  1AE2 A;  1YI2 A;  3ULP A;  1PH4 A;  1D7Q A;  1KXL A;  3W1B A;  1N34 L;  5LMN Q;  1VQO A;  4YY3 Q;  3I55 A;  4LF9 L;  4JI1 Q;  2R92 H;  3UDI A;  3ULJ A;  2ZM6 L;  3A74 A;  4LF7 Q;  2AWN A;  4DR6 L;  4ME3 A;  2BH2 A;  3S1R H;  4DR3 L;  1EQR A;  4BY7 H;  2E2J H;  3I4N G;  2KCM A;  2K5V A;  4GLV B;  2FXQ A;  3T1H L;  1MJC A;  1I94 L;  1EIY B;  4JI2 Q;  2JK8 A;  1CUK A;  1JJC B;  4A3M G;  1HNZ L;  3PO3 G;  5JJI A;  3HOU G;  1PV4 A;  5H1S E;  4DPG A;  2VNU D;  2R7F A;  2IX1 A;  3S15 H;  2K75 A;  1G51 A;  2MO0 A;  2WAQ E;  4PZ6 A;  4NXM Q;  4A3G G;  2HHH L;  4OO1 G;  5LMU Q;  4A3E G;  3ZJY C;  1C7Y A;  3CC7 A;  5IWA Q;  1UE5 A;  2CWA A;  2JA7 H;  4BXX H;  1L1O B;  3STB D;  1ASY A;  1V1Q A;  4GNX A;  2R7Z H;  4LF5 L;  4DV4 L;  2A8V A;  4DV5 Q;  3S17 H;  1PYS B;  2PMZ E;  3FP9 A;  1CSP A;  2UXD L;  1L1O C;  2YTX A;  2Z0S A;  1Q86 C;  1IBL Q;  4XIG S;  3BZC A;  4GKJ L;  1U0L A;  1CSQ A;  3LGJ A;  4P71 A;  1GM5 A;  5AJ3 L;  3CC4 A;  1QVF A;  4FDB A;  4IJH A;  3CD6 A;  5IE8 A;  3JAM c;  4JI7 Q;  2JEB I;  3I4N H;  3HOZ H;  1SRO A;  1I5F A;  5M3F G;  2UU9 L;  1FL0 A;  4O2D A;  2IHE A;  4GOP B;  4JYA Q;  1XNQ Q;  1AE3 A;  4R4T A;  3GTJ H;  3PO3 H;  2WFW A;  3TQY A;  4NB3 A;  1OXV A;  5FLX c;  4BA2 I;  2JJQ A;  1GD7 A;  2NZO A;  4MZ9 A;  4JI8 Q;  2K52 A;  4BY1 G;  2H5X A;  3J81 i;  1Q1E A;  4X64 L;  2DGY A;  4A3E H;  3PO2 H;  1IZ6 A;  1CKN B;  1N36 Q;  2EQS A;  2WB1 G;  4P73 A;  3G48 A;  5ELN A;  3L2P A;  1VQ5 A;  2IT1 A;  1UWV A;  2RHS B;  4LNQ A;  1JT8 A;  3BJU A;  1BBW A;  2ZJP A;  4A3I G;  2ZTD A;  4A76 A;  4JOI A;  3WWV A;  1IBM Q;  2Q2I A;  3UE1 A;  4B3S Q;  2Z6K A;  1PH6 A;  1KAW A;  3CW2 C;  4LW1 A;  4LFA L;  3S2D H;  4MTN A;  4P75 A;  2JEA I;  1Q8K A;  1OXX K;  2NN6 I;  4PZ7 A;  5IP7 G;  1YIT A;  1VQJ A;  4LF4 Q;  1Y1W G;  1T9H A;  1WJJ A;  4HJ9 A;  2Y0S G;  2JE6 I;  2A19 A;  3J7Z C;  4DV7 L;  2D0O A;  1EFW A;  2NVQ H;  1NMG A;  4WJ3 M;  2WB1 E;  3NEM A;  4A3C G;  1CKM A;  3L0O A;  3GTG H;  2MFI A;  5M3M G;  3OTO Q;  2YTY A;  4A3F H;  1PH9 A;  2UXB L;  1HJP A;  1TWC H;  2JA8 H;  2DUD A;  2B29 A;  1B70 B;  3I56 A;  1XJV A;  4BBR G;  1NTG A;  3GTQ H;  2VL6 A;  1PVO A;  3EBE A;  4BY1 H;  4DV0 Q;  2EXD A;  4DV1 L;  1VQG A;  1Y14 B;  5GQO A;  2ZJQ A;  1A8V A;  2OWO A;  3IRB A;  3PCO B;  5HY6 A;  5C4X G;  2UUC Q;  3TRZ A;  1N32 Q;  2XGT A;  3F1Z A;  1X9N A;  2RHQ B;  3S1N H;  4JCV E;  2Y0S E;  1QZG A;  4QIW E;  4JI6 Q;  4B3T Q;  4A3L G;  4JC0 A;  1M90 C;  4A3I H;  1E1T A;  4JI5 Q;  4X65 Q;  1SRU A;  3I4M G;  4K0K L;  4DR5 L;  1KHI A;  5FLM G;  1PH5 A;  3KF6 B;  4IFD J;  3I2Z A;  4GN5 A;  4DR2 L;  2A1A A;  1FJG L;  1K8A C;  3KFU A;  1L1O A;  2OCE A;  1Y1W H;  1UE7 A;  4DR7 L;  3G4S A;  4GKK Q;  1PFS A;  1J5E L;  1VQH A;  3CPF A;  3HFZ B;  2F4V Q;  3STB C;  4A3C H;  4PMW A;  1FVI A;  3DM3 A;  5M3M H;  1KL9 A;  1K73 C;  3CC2 A;  2E5L L;  3W1G A;  4LF8 Q;  1E24 A;  3ICE A;  1C0A A;  4QJF A;  4BBR H;  2NN6 G;  1K0R A;  1SE8 A;  5K36 G;  2HQL A;  4AQY Q;  2I5L X;  1YHQ A;  1TXY A;  2D0P A;  3I4O A;  1UE6 A;  4AH6 A;  5M5X H;  4LF9 Q;  2VQE Q;  1YHA A;  1WCM H;  3PF5 A;  3S2H H;  2ZM6 Q;  1B7Y B;  4JI0 L;  1TWA H;  2WAQ G;  5C4X H;  2VUM H;  4GN4 B;  4GOP A;  2AWO A;  1N33 Q;  1OTC A;  3HOW H;  4X62 L;  4DV3 L;  1YHB A;  3H0G G;  3JAM i;  1NE3 A;  1B8A A;  4LFC L;  3CMA A;  1DGS A;  2ALY B;  3T1H Q;  2E2H H;  1KIX A;  4A3L H;  2KHJ A;  1HNZ Q;  5IYB G;  4NXN L;  5FLM H;  3MXN B;  1EWI A;  4C3J H;  4B3R Q;  1HNW L;  1YJN A;  2K5H A;  1Y1V G;  4X66 L;  3A5U A;  4OWW B;  1XMQ L;  1CKN A;  4A3K G;  1YVC A;  2HHH Q;  3AEV A;  4H02 A;  1C9O A;  5C3E G;  1YBY A;  1YNX A;  1IYJ B;  2ZTC A;  3KJO A;  3K7A H;  4POG A;  1VQB A;  4A93 H;  2RCN A;  1XNR Q;  2K50 A;  3K0X A;  1CKO A;  1SN8 A;  3CCU A;  2I0Q A;  2LXJ A;  3NBH B;  3CP0 A;  1QVC A;  2ZTE A;  2AHO B;  4LF5 Q;  2ASB A;  4DV2 Q;  3TS2 A;  1HH2 P;  4JBW A;  4LFB L;  3AFQ A;  2R93 G;  3I7F A;  4JI4 Q;  4P72 A;  4GN3 B;  1N8R C;  3GTL H;  4A3B G;  4DNI A;  2LSS A;  5BR8 Q;  4YY3 L;  3GTM H;  5AJ3 Q;  4JI1 L;  4B3M L;  5IYD H;  4KHZ A;  1VQI A;  2MQH A;  5IY0 A;  3FHW A;  1E22 A;  2KCT A;  1HZC A;  3GDE A;  3M9B A;  4AYB G;  2D62 A;  1GO3 E;  1IBK Q;  2PI2 A;  3F2B A;  4HJA A;  4YHH Q;  4HJ7 A;  3TS0 A;  4DUZ Q;  1YIJ A;  4YWL A;  5IYB H;  4L5T A;  4ALP A;  1XMO L;  1BKB A;  3EN2 A;  2UUA Q;  2NVT H;  3CCE A;  2E8G A;  4QGU A;  1Y1V H;  4IPD A;  4BBS G;  4JG2 A;  1AH9 A;  1HZA A;  4R4C A;  3M4O H;  1X3E A;  5JJL A;  3ULL A;  1Q46 A;  4A3K H;  1VQ4 A;  1M1K C;  4A3M H;  2OQK A;  5C3E H;  1KQS A;  1XTD A;  5IP9 G;  1VQP A;  1X55 A;  3HOU H;  3KYH C;  2QEX A;  2Q2H A;  4LF6 Q;  3GTK H;  5JEA J;  1G6P A;  4IFD I;  4A4I A;  3HOY G;  1YJ9 A;  1UE1 A;  2UUB Q;  4A3G H;  4WJ4 A;  1TWH H;  3RN2 A;  1SLJ A;  1PH7 A;  4GLA C;  4DAM A;  4AYB E;  2IY5 B;  3PUX A;  3KF6 A;  4LUV A;  3CCQ A;  1HR0 W;  3L7Z C;  2YU9 H;  2R93 H;  3Q8D A;  4DV5 L;  4JI3 Q;  2VS1 A;  1PH3 A;  3K81 C;  3J7A 5;  1K8G A;  1S72 A;  1VQ7 A;  1NY4 A;  1IBL L;  2BA1 A;  5IYC G;  4LFA Q;  3T1Y Q;  2K14 A;  4A3D G;  1VQC A;  4IJL A;  1VS0 A;  2VQF L;  1QVG A;  2R7D A;  4A3J G;  1JB7 A;  1LUZ A;  4IOC A;  4JI7 L;  3TRE A;  4R4O A;  2R6G A;  3GD7 A;  2N3S A;  1N36 L;  3W5O A;  2JA5 G;  4C3H H;  3CAM A;  1I50 H;  4JYA L;  3BU2 A;  3RZO H;  3F2C A;  1XNQ L;  3RNU A;  3DLL A;  1E7Z A;  1K83 H;  4DUY L;  5M3F H;  2I5M X;  3ERS X;  4IOA A;  3RN5 A;  3VDY A;  1VQ8 A;  4JBK A;  4HID A;  1W3S A;  3HKS A;  4JI8 L;  3S1Q H;  1MIU A;  4MNO A;  3F2D A;  4JBJ A;  1GVP A;  4JV5 Q;  3M3Y H;  1VQ9 A;  2F52 A;  4RMF A;  4P74 A;  1D8L A;  1H95 A;  1A62 A;  1E1O A;  2GVB A;  3E9H A;  4HIM A;  4DR1 L;  2CCZ A;  3S14 H;  5GAH C;  3CCL A;  4POF A;  5IT9 c;  1P16 A;  2K5N A;  4TQU S;  4K0K Q;  3PIP A;  4DR5 Q;  1KC8 C;  1O7I A;  1WOC A;  1IBM L;  1HNX Q;  2L15 A;  1KRT A;  4HIK A;  1X56 A;  4IFD G;  3U4V A;  1JMC A;  1FGU A;  2ID0 A;  3RLN A;  4KHP L;  4OX9 Q;  4YCW A;  4A3J H;  1PA6 A;  1VQA A;  4DR7 Q;  3FKI G;  3RR5 A;  4DR4 L;  2IX0 A;  1N9W A;  4IPG A;  2JA5 H;  3J80 c;  3D31 A;  5IP7 H;  1HR0 Q;  2E5L Q;  4OWT B;  1EUJ A;  3K80 C;  3OTO L;  1LTL A;  1X6O A;  4UP9 A;  1Z47 A;  5GRO A;  3CCV A;  3PUW A;  4R1J A;  3CXC A;  3CF5 A;  2Q2U A;  2PQA B;  3PUZ A;  5EAY A;  2UXC Q;  1VQF A;  1TWG H;  1VCI A;  2PI2 E;  4JBM A;  4C3I H;  3GTP H;  1BVS A;  2BH8 A;  4JI0 Q;  4OWX B;  2OTL A;  3K8A A;  2YV5 A;  3F8T A;  5C0X J;  1KRS A;  1N34 Q;  2UUC L;  1N32 L;  4BY7 G;  1E3P A;  1VQ6 A;  4LFC Q;  4JI6 L;  2LXK A;  4DR6 Q;  3CPW A;  4DR3 Q;  4JI5 L;  2HIX A;  4QL5 A;  4X65 L;  4R4I A;  2IHF A;  1G29 1;  3GO5 A;  1K3R A;  3KLW A;  4YWK A;  1K9M C;  1XMQ Q;  1I94 Q;  1SR3 A;  2CQO A;  3I4M H;  3PF4 A;  3S1M H;  2KBN A;  4DV6 L;  1R9T H;  1OXS C;  1PH8 A;  1EYG A;  4GKK L;  1SMX A;  1RL2 A;  4QY7 A;  1Q12 A;  2CKZ B;  2GN5 A;  3PUV A;  2YTV A;  1EOV A;  1X65 A;  1Q7Y C;  4JOI C;  1Q81 C;  1J6Q A;  4DKA C;  2WP8 J;  4LF8 L;  2Z6K C;  1WYD A;  2R7Z G;  4OXP A;  1WFQ A;  1UEB A;  3ER0 A;  2XTI A;  3M7N A;  2GVA A;  3H3V I;  5HGQ A;  4AQY L;  1PH2 A;  4DV4 Q;  2BA0 A;  1TWF H;  1V43 A;  2EIF A;  1MJE A;  2VQE L;  5DLQ E;  4B3M Q;  5GAG C;  5C44 G;  2UXD Q;  2HT1 A;  4L5Q A;  4GKJ Q;  2ES2 A;  4X6A H;  1N33 L;  1L2F A;  3U4Z A;  5LMN L;  3HOZ G;  5C4J H;  4YCU A;  2C35 B;  1NMF A;  3RZD H;  4UP8 A;  4LF7 L;  4QQB X;  3HKZ E;  4OON A;  1XMO Q;  4B3R L;  3H0G H;  1A0I A;  2UU9 Q;  1A63 A;  1QUQ B;  2AMC B;  1JJG A;  3CCS A;  1S40 A;  4JI2 L;  1PYB A;  2VZA A;  1EIF A;  1IXR A;  1XPU A;  3PO2 G;  3UDX A;  1Q1B A;  4LWC A;  3A5Z B;  3U50 C;  5JEA G;  3K7U C;  2F3I A;  4NXM L;  2K4K A;  1XNR L;  4YWM A;  3EIV A;  4X64 Q;  1ASZ A;  5LMU L;  5JJK A;  3KDF B;  2OQ0 A;  4GS3 A;  3KOJ A;  4DV2 L;  5E7N A;  5IWA L;  2MO1 A;  1OXT A;  5FJ8 G;  3HOV G;  1QZH A;  4JI4 L;  3PV0 A;  4J15 A;  1Q82 C;  1PH1 A;  5BR8 L;  3TEH B;  5C44 H;  2NVY H;  1NJI C;  1JJ2 A;  1L0W A;  2VQF Q;  2ATW A;  2RF4 A;  4DK3 C;  4L5S A;  3D0F A;  3S24 A;  4IPH A;  4A3B H;  1JE5 A;  2B63 G;  3AQQ A;  4AIM A;  4PG3 A;  4RG1 A;  4XTC S;  1IBK L;  1VQE A;  4YHH L;  4DUZ L;  5M5Y H;  2PQA A;  4A3F G;  5C0X I;  3J80 i;  4IPC A;  4DUY Q;  3G6E A;  2UUA L;  4GLX A;  4DV7 Q;  4DAY B;  2N49 A;  2JA8 G;  3OW2 A;  4NPS A;  1YZ6 A;  3U58 A;  2UXB Q;  4GOP C;  2NZH A;  3CCJ A;  1NBW A;  3OYY A;  4BBS H;  1EQQ A;  4LF6 L;  2UUB L;  1RIP A;  4DV1 Q;  4KI0 A;  2KEN A;  5IP9 H;  3BZK A;  4DR1 Q;  1I3Q H;  3RLF A;  3SGI A;  1VQL A;  3H15 A;  1KD1 C;  3HOY H;  2ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...