1GKHA

Mutant k69h of gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFHVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gkhA00
4DV7Q 3BJUA 2GVAA 1Q46A 3TRZA 5IP7G 4DR7L 4GLXA 1NMFA 1VQFA 3STBD 3RZDH 3HOXG 3K8AA 4GS3A 2UXDL 1M90C 1XMOQ 2WAQG 3HKZG 1E1OA 1N8RC 2JA7G 1YJNA 2NVXH 4L5RC 2Y0SG 3GD7A 3G4SA 1YJWA 4R4IA 4LF7L 3RR5A 1HJPA 4DV0Q 1N33L 3RZOH 4OO1G 3EN2A 3UE0A 2ZJRA 4JI1L 5IP9G 3L2PA 4HJ8A 1ASZA 5M3FH 3GTJH 4A3GG 3K80C 2A8VA 4P71A 3CCEA 1MJEA 3PUYA 4A3MH 4OWTB 1EQQA 1QZGA 1JT8A 2HIXA 1IBLL 1E3PA 2ALYB 5IYCH 4JI6L 2YU9H 1YNXA 1PH9A 4DV4L 2UXDQ 1I3QH 3PUXA 1A63A 1NJIC 1VQ8A 3GTOH 3PSIA 2LXKA 1OXTA 1XJVA 1HNXL 2CFMA 3UDIA 5E7NA 1EQRA 4BY1G 4OO1I 2EXDA 1KL9A 4UY8C 4LF7Q 3G48A 4C2MH 1GKHA 3A5ZB 2ZJPA 1VQMA 1TWHH 2KCTA 3TREA 4LFCL 3CCQA 1N33Q 5GAHC 1XMQQ 1K9MC 3A5UA 4JI1Q 2UUAL 3CQZH 3VDYA 2ZTDA 3FKIH 3U4ZA 3PV0A 5LMUL 4JI4L 1E1TA 1P16A 4LF6L 3IRBA 4BXXH 4JYAL 5LMNL 3S14H 2UXCL 3HOVG 1H95A 1Q82C 4DK6C 3HOUG 3M3YH 5GROA 3J7ZC 2QEXA 3U58A 4AIMA 1XPRA 1UE1A 1K0RA 1PH4A 4BA2I 4JI6Q 1VQKA 2PNHA 2AWOA 3U4VA 1S40A 3J81i 1GO3E 4B3SL 2VL6A 2WFWA 4DV4Q 2OTJA 3RLOA 3NELA 5C4JH 1Z47A 5JJLA 3J7A5 1HH2P 1MIUA 3FHWA 4X62L 5AJ3Q 1HNXQ 3D0FA 3NBHB 4GNXB 1RIPA 4A3JH 1S3OA 3HKSA 3ZJYC 3F1ZA 2R93H 2MFIA 4YWKA 1VQAA 1YHBA 2BA0A 2DGYA 2VW9A 1R9TH 3I55A 1TWAH 4LFCQ 1VQ6A 3RN2A 3GTMH 5M5XH 4BBSH 1YHAA 4A93G 3H0GH 3W1BA 1VQGA 5C4XH 5IWAL 1J5EL 2JA9A 2UUAQ 4GKJL 1G291 4A3KG 4JC0A 3GTQH 1KXLA 3M4PA 1PH2A 4JI2L 5ELOA 2OTLA 3AFPA 1L2FA 3HOWH 1LM0A 3KYHC 5LMUQ 3KJPA 4JI4Q 1MKHA 4LF6Q 2JA8G 3HOWG 5LMNQ 3TEHB 4BBRH 1CSPA 1D8LA 2YTVA 2NVTH 3H3VH 5JEAG 4A3EG 2ZJQA 4GLVB 3PF5A 4IPCA 1K8GA 1SLJA 3CP0A 4BY7H 4A3IG 1IXRA 4EQ5A 4B3ML 2A19A 5IE8A 1HZ9A 3ERSX 4DK3C 2N49A 2R92H 2NZHA 4DR2L 1YBYA 1PH1A 4X62Q 3F8TA 4A3BG 2K4KA 4YCWA 1BBUA 3NENA 4AQYL 2ID0A 5FLMH 4YHHL 1OXVA 3PO2H 1U5KA 2F52A 1YITA 4A76A 1B7YB 5FLXc 2Q2HA 4QQBX 5C3EG 1WI5A 2RCNA 3HFZB 2AHOB 3KLWA 4AYBG 3J81c 1VQ4A 4DUZL 1J5EQ 1VQ5A 1OTCA 5JEAJ 4GKJQ 2RF4A 4JI7L 4LF5L 4JI2Q 1QUQA 3W5OA 1PFSA 5ELNA 3UE1A 1K73C 1L1OC 4DUYL 4A3DH 3K7UC 2EIFA 1VQIA 2L15A 4B3RQ 4Y52H 2CWAA 3CC7A 2H5XA 4HIKA 1C9OA 4R4OA 4AYBE 1V9PA 1KRTA 3KDFA 4KLKA 4YCUA 1AE2A 3AQQA 1WCMG 3J80c 2E2HH 1I5FA 1PYSB 1UWVA 1WOCA 4PZ8A 4QIWE 5FJ8H 3NEMA 3AFQA 4P75A 1GM5A 2JA6H 2NVQH 4A3CG 4PMWA 4JI5L 4DR2Q 2PI2A 4A75A 2NN6I 4A4IA 2VZAA 3BU2A 4MNOA 4GNXC 4NPSA 4AQYQ 1PV4A 4WJ3M 1HZCA 2QGQA 4YHHQ 2Q2IA 4NXML 5C44G 5GQOA 1JJCB 3AEVA 1PH5A 4MTNA 5BR8L 3G6EA 1IBKQ 3STBC 2R7ZH 1E7ZA 3OYYA 3M4OH 1YI2A 2V1CC 4JI7Q 2C35B 1VQPA 2CKZB 1VQDA 4NB3A 4RG1A 2WAQE 3HKZE 4DPGA 5IP7H 4HJ5A 1KIXA 1EFWA 1Q81C 1SRUA 2Z6KC 2Y0SE 2I5HA 3HOXH 4PZ6A 4DUYQ 4LF9Q 2CQOA 3BZKA 3L7ZC 4DV2L 3I2ZA 4LUZA 1QVFA 1VQ7A 4L5QA 5J3BA 1X65A 4DR6Q 1VQJA 2XGTA 1X3FA 1O7IA 2OQKA 1M1KC 1Y1VG 4LUVA 4ALPA 3I4OA 1YEZA 4PG3A 3T1YL 1VQ9A 4DR7Q 4O0AA 2I5MX 3KOJA 4JI5Q 4IPHA 3CC4A 5IP9H 2CCZA 4UP9A 1FGUA 1Q1EA 2R6GA 4IJHA 1Q8KA 3JC66 4UP7A 4YY3L 1IL2A 3HOZG 2PI2E 3KF6A 4POFA 4DR6L 3PUVA 4A3FG 1VS0A 3RLFA 2E5LL 4A3GH 4UP8A 5BR8Q 1SE8A 3CPFA 4FDBA 1VQOA 2JK8A 3EIVA 3AYHB 3UDXA 1K8AC 2ATWA 4RMFA 5C0XG 3S2DH 4XTCS 2OQ0A 3CCUA 4QY7A 2YYZA 1N36L 1YZ6A 2UU9L 4Y7NH 1CUKA 5H1SE 3A74A 3Q8DA 4JOIC 3CW2C 3EBEA 4DV3L 2UXBQ 4IOCA 4GOPC 1JE5A 4DV2Q 4OWWB 1UEBA 1V43A 2PQAB 2UUBL 1YVCA 1BKBA 1WFQA 4JI0L 3MXNB 3T1HL 4BY1H 1JB7A 3CMAA 3I4NG 1QUQB 4JBWA 1TWGH 1QVGA 3KF8B 1VCIA 5M5WH 1UE6A 2LSSA 1IBLQ 1NBWA 3T1YQ 4A3LG 2F4VL 4IO9A 1X55A 4QL5A 3PIOA 4L5TA 1ASYA 1UE7A 3RNUA 2KBNA 3GTKH 2D0OA 4R4TA 4YY3Q 3KDFB 2KHJA 1X9NA 1VQCA 5C0XJ 2KCMA 4DV6L 4KHZA 4R4QA 1XNQL 2E5LQ 4A93H 5C0XI 4APVA 3HOVH 2NZOA 3HOUH 1KC8C 2Q2TA 5IYDG 2HHHL 3UDGA 2UU9Q 1B70B 5IYBG 4POGA 1T9HA 3J80i 3OW2A 1C0AA 4O2DA 3S1RH 4DV3Q 2AWNA 2GVBA 2NVYH 2BH2A 4UPAA 4EX5A 3S15H 2UUBQ 4HIOA 1OXSC 3PF4A 4JYAQ 2UXCQ 3T1HQ 1KAWA 3KFUA 4DV5L 3PUZA 5GADC 1Q86C 3A0JA 5M3MG 5IT9c 2Q2UA 2WB1G 2YTXA 3CCRA 1W2BA 1KQSA 1V1QA 4B3TL 2F4VQ 4JV5L 5IY0A 4DR1L 1IBML 4OX9L 5DLQE 4LFBL 3RLNA 4B3SQ 3HOYG 3GTGH 4A3KH 3M4QA 4X64L 5HY6A 3FP9A 2E8GA 2Z0SA 4DV6Q 1JMCA 1G6PA 3LGJA 3S1QH 1C7YA 1XNQQ 2HQLA 4H02A 1EOVA 4DNIA 1SMXA 1RL2A 2JQOA 2WB1E 1I94L 1HR0W 1EUJA 2NN6G 3U50C 3BZCA 2JA5G 4A3EH 3CCLA 3I4MG 1MJCA 2I5LX 2HHHQ 1G51A 2JEBI 2B63G 1Q7YC 2MNAA 3CCJA 3MEFA 4A3IH 1QVCA 5IWAQ 1XPUA 2ZTEA 3RN5A 1W3SA 4A3BH 1VQEA 1GVPA 4LF4L 4DR4L 3S17H 2R7DA 5K36G 2N3SA 2KHIA 2VY3A 1SR3A 3D31A 4C3JH 1YIJA 1CKOA 1FJGQ 1XTDA 3H3VI 4DKAC 4B3TQ 4JV5Q 2AKWB 1Y1WG 5C3EH 1IBMQ 4OX9Q 1SROA 1CKNA 3PO3H 4B3MQ 2VUMG 4LFBQ 4JBKA 1D7QA 2K5VA 1EWIA 4X64Q 2EQSA 2VNUD 1PYBA 4IJLA 1VQLA 1QZHA 1PHJA 4X6AH 1A0IA 2IHFA 4P74A 1L1OA 2K52A 1I94Q 2I0QA 4JG2A 4DR3L 4C3HH 2ZM6L 1HZBA 2GN5A 3CXCA 1PVOA 1X54A 2FXQA 4IPDA 3H15A 1WCMH 4JI3L 1IYJB 1HNZL 4GN5A 4DUZQ 1KD1C 1Y14B 4LF5Q 4A3CH 2HIVA 3K0XA 4LF4Q 4DR4Q 3TS2A 3SGIA 3CD6A 2ASBA 2YV5A 4GNXA 2JA7H 1WJJA 5C44H 3TS0A 1PH3A 1VQNA 3PCOB 5M3FG 3CCMA 4JBMA 3PGZA 4X66L 4HIDA 4LFAL 3W1GA 3CCSA 3DM3A 4BA1I 2K14A 4JCVE 2LXJA 1X6OA 3CPWA 4A3MG 1PH6A 1EIYB 2F3IA 2Z6KA 1NE3A 1P8LA 2IT1A 1LUZA 2PMZE 1IZ6A 2JJQA 3DLLA 1L0WA 1X56A 5IYCG 4MZ9A 2K5NA 4DR3Q 1XMQL 4NXMQ 1BVSA 2ZM6Q 1UE5A 1FJGL 1YHQA 4TVAB 2VQEL 4WJ4A 1KHIA 3S1MH 1Y1VH 4JI3Q 2B3GA 1HNZQ 4ME3A 2B29A 4OXPA 1YJ9A 2CWPA 3E0EA 3L0OA 2K50A 1X3GA 3HOZH 4DAYB 1TXYA 2ES2A 2UXBL 1GD7A 2MQHA 4X65L 4A3FH 1XNRL 4DR5L 2IY5B 4QJFA 3PUWA 3CF5A 4YCVA 3CCVA 2QA4A 4JI8L 4DV1L 4AH6A 2AMCB 3FKIG 1XPOA 1JJGA 5AJ3L 1HZAA 4X66Q 4P72A 4LFAQ 2MO1A 4HIMA 1J6QA 2OCEA 2RHQB 3GTLH 4BXXG 4PZ7A 4YWLA 4LW1A 1Z9FA 2K5HA 3S1NH 1BBWA 1KRSA 2VS1A 4JOIA 3CAMA 3ULJA 4YWMA 2DUDA 4GOPA 4IFDG 1CKNB 1NTGA 1NMGA 3M9BA 1EIFA 4R4CA 3CC2A 3ICEA 2VQEQ 1E22A 1HNWL 3I4NH 4GKKL 4HJ7A 1I6HH 2BA1A 1K3RA 4LWCA 1L1OB 4JBJA 4A3JG 1N34L 1N36Q 4A3LH 1N32L 5JJKA 1TWFH 4KHPL 2R93G 1SN8A 4P73A 1B8AA 1U0LA 3J81j 3PIPA 3OTOL 4DAMA 4C3IH 3M7NA 4BBSG 4X65Q 1XNRQ 3JAMi 3ULPA 3H0GG 4DR5Q 1LYLA 1WYDA 4GN4B 4HJ9A 3GTPH 2IX0A 4JI0Q 4J15A 1HR0L 4K0KL 3B6YA 4NXNL 1PH8A 4LF8L 3UDFA 1X3EA 4JI8Q 1N9WA 4DV1Q 1FVIA 3F2CA 5IYDH 2N8NA 4QGUA 4HJAA 2OWOA 4IFDJ 4IPGA 5IYBH 4BBRG 5LMNW 2UUCL 1CKMA 4IFDI 3S16H 2D62A 2YTYA 1CSQA 3ER0A 4BY7G 3E9IA 1OXUA 2R7FA 2ZTCA 4XIGS 2MO0A 1OXXK 1PA6A 2IX1A 1HNWQ 2R92G 4GKKQ 3S24A 1PH7A 1Q12A 4LUOA 1VQHA 4B3RL 3K81C 5M3MH 5FLMG 3KF6B 1N32Q 1N34Q 5C4XG 3PO2G 2JE6I 2E2JH 1E24A 4KHPQ 1FL0A 3HOYH 1A62A 3ULLA 3OTOQ 3KJOA 2VQFL 3K7AH 4OWXB 4DV7L 3E9HA 3I56A 1TWCH 4K0KQ 4R1JA 1JJ2A 1HR0Q 4LF8Q 1AE3A 1Q1BA 4NXNQ 2JA8H 2N78A 4DV5Q 2JA5H 3I4MH 2XTIA 3F2BA 5JJIA 4GN3B 5EAYA 2B63H 4A3DG 2D0PA 4TQUS 1XMOL 1LTLA 4OONA 2E2IH 2UUCQ 4DR1Q 1A8VA 2KENA 2K75A 1IBKL 2JEAI 1I50H 3M85A 3S2HH 4KI0A 2WP8J 5HGQA 5GAEC 2PQAA 3JAMc 4L5SA 2BH8A 4DV0L 3PO3G 3WWVA 5FJ8G 2RHSB 2JA6G 3GDEA 1AH9A 2A1AA 3GO5A 4LNQA 1S72A 1SFOH 3G71A 4GLAC 4LF9L 1DGSA 1K83H 5GAGC 3F2DA 3CMEA 1Y1WH 4GOPB 3I7FA 1VQBA 2VUMH 4IOAA 2IHEA 5M5YH 2VQFQ 1EYGA 2R7ZG 2HT1A 3TQYA 1NY4A
chains in the Genus database with same CATH superfamily
4DV7Q 2NTTA 3BJUA 2GVAA 1Q46A 1TWCB 1LTTD 1HA5A 2RSNA 1NMFA 3STBD 3K8AA 1F9RA 2B63B 1SNCA 4PV1C 4HCEA 1KDCA 2NVXH 1WTRA 3GD7A 4RHRA 1MI2A 1FD7D 4K5XA 4DV0Q 1N33L 2EJMA 2WINB 1QNKA 2WACA 2OT2A 4DK1A 5E4XA 3T53B 1NR4A 4A3DB 1HPCA 3VR6A 2PPBC 4IUQA 2BOSA 4DF7A 1AEXA 3K57A 1E3PA 5IYCH 3QG1A 2EE1A 3DEPA 2A68D 2O5JC 2KUMA 1F77A 1VQ8A 2FMMA 1WTQA 4PMCA 2LXKA 3O13A 4UY8C 1KL9A 3FEWX 3A5ZB 1TQOA 4CKBA 1PLFA 4LFCL 4PMBA 1K9MC 2EJGC 3EROA 4ZKCB 5C5MA 3CQZH 3C46A 2WIIB 4IZ8A 2K05A 4JI4L 3QJYA 1P16A 5LMNL 2F0KA 1C8CA 2LFNA 3M3YH 5GROA 2F0MA 4U68A 3U58A 2Q8IB 4XQQA 4XT1B 1VQKA 2PNHA 3U4VA 2YU9B 1GO3E 4B3SL 2VL6A 4DV4Q 2DN8A 2OTJA 2F0OA 1I3QB 1Z47A 1HH2P 4X62L 4NKLA 5AJ3Q 2P5ZX 1RIPA 3ZJYC 5HGTA 3F1ZA 2Z4HA 5JPNC 4G7ZC 1YHBA 1R9TH 1YHAA 3W1BA 1HCZA 1VQGA 5E1FA 2UUAQ 4GKJL 4A3KG 1DD2A 2CH4W 1KXLA 4JI2L 2DJFC 2OTLA 1L2FA 4K2LA 1GUOA 4F87A 3TEHB 2YTVA 1H9SB 4QUCA 3H3VH 2ZJQA 4GLVB 3PF5A 1I6VC 4K2KA 1QILA 3CP0A 4BY7H 2KQ3A 1IXRA 1D1KA 2CQAA 4DU9A 1WTPA 1HZ9A 4A3BG 4DR2L 1EZ8A 1FNUA 3PQIA 4I65A 4AQYL 3PO2H 1IHZA 5I6WA 4C3JG 1WTXA 4A76A 3A7LA 5FLXc 4JI7L 2RCNA 1SE2A 2WV6D 4FP5D 5C4XB 3MXNA 5JEAJ 5HURA 5LHY1 1ML0D 1AN8A 3W5OA 3ND9A 3DMUA 3EVQA 3UE1A 2F0IA 3DWPA 3K7UC 2L15A 3W3AA 5A35A 2NVTB 1C9OA 1KNEA 4XQNA 1AP0A 1EFID 1KRTA 3T13A 2A6ED 1PYSB 5FJ8H 2NVQH 4PMWA 2R92B 5I9OA 1CHPD 2B2WA 2VZAA 4NPSA 2QGQA 2G5DA 4NXML 1JWMD 4KY5A 1PH5A 3R93A 3G6EA 1MHWC 2OEOA 3M4OH 2C35B 2CKZB 3PIO3 2EXZA 2WAQE 1KIXA 1EFWA 1Q81C 2Y0SE 2BE5D 1U4LA 4DUYQ 4LF9Q 2KECA 1EY9A 4KD3A 5DM73 4LUZA 4KD4A 1HRJA 1QVFA 2DY8A 1B1ZA 1X65A 2VB2X 3E3XA 3MWYW 2L9HA 1VQJA 2XGTA 4DR6Q 3IFTA 4LUVA 4ALPA 2E2HB 3N52A 4DR7Q 2JA6B 1EY5A 2I5MX 1PRTC 3KOJA 2ZXOA 3NBIA 2PI2E 2HCCA 1NCVA 4POFA 4A3FG 4OELB 1A3TA 5BR8Q 2X6GA 1EYDA 5C0XG 2L4NA 4XTCS 4QY7A 2UU9L 3WOFA 1EEFD 5CYUA 4RKLA 4DV3L 5ELFA 4GOPC 3HKZB 2JA7B 3H3VC 2XNAC 2PQAB 1X32A 2R3ZA 2L5TA 2ZXPA 2A5HA 1JB7A 1QUQB 1TWGH 1VCIA 5J39A 5A2QE 2QKIC 2LSSA 1NBWA 2K7VA 3TBIB 3J81E 4A3LG 4QL5A 3C3LA 3GTKH 4YY3Q 2RSOA 1VQCA 4C3IG 2KCMA 2F0DA 1XNQL 1IYUA 3BDCA 4A3GB 4APVA 2VB3X 2B8FA 2NZOA 1STBA 2HHHL 3H6MA 3OIPA 4FYDA 4O2DA 2AWNA 3BZDB 4HIOA 3PF4A 1RCVD 3Q6SA 1PZKD 3IAYA 3VR2A 1KAWA 3KFUA 2EVBA 2MGSA 3A8JE 5I2YA 4FF3A 3PUZA 5M5WB 4FXGC 1W2BA 5IY0A 1IBML 4LFBL 4HSPA 4A3KH 5HY6A 2Z0SA 1JMCA 3LGJA 4OGQC 4H02A 1VQ9A 1RL2A 3NUCA 1PFBA 1V1OA 2JQOA 2NN6G 1I94L 1HR0W 5FO7B 2I5LX 2PZTA 2B63G 4DAYA 3MEFA 3MC0B 4TSSA 2NZ1D 2NVYB 4A3BH 4BS9A 5KYLA 1SNMA 3OMGA 1LT6D 1SR3A 4J1MA 3D31A 4C3JH 3H3VI 1CKOA 2R61A 1FJGQ 4FO2A 4ZRZA 1SNOA 3PO3H 1D7QA 1QE6A 4RGMA 1PYBA 1BCPF 2JA8B 1SYCA 4JG2A 3CRKC 4A3EB 3TDQA 2GN5A 2MPMA 2FXQA 3I73A 4A3IB 1IYJB 3KLRA 1HNZL 1TS5A 1CZGA 4LF5Q 2RDFA 4LF4Q 3S17B 2GA4B 3NBHA 1WJJA 1W6JA 1VQNA 4F8MA 4ABNA 3CRLC 2J0TD 2RDHA 1QWYA 3CCMA 4JBMA 1WTHA 3PGZA 2QDBA 4X66L 3CCSA 1JC7A 1V1PB 2LXJA 3CPWA 4A3MG 2F3IA 4XDXA 2IT1A 3DLLA 3BVZA 1YHQA 3K5LA 1ENCA 1CHQD 4JI3Q 1WCMB 2B3GA 5FKAC 3MEHA 3L0OA 3A7AB 5CC4A 2D2CC 4A3FH 1LT4D 2IW3A 2PW7A 3DHQA 5EQ0A 3NWSA 4DV1L 2F0GA 4AH6A 4GZYC 3KUPA 5IGEA 5C0XH 4RA8A 1HZAA 5AFWA 1D6EC 4LW1A 1HTLD 1Z9FA 4L8JA 2B2VC 2EZVA 1CT1D 2DUDA 4GOPA 4IFDG 4QMGA 1EIFA 3HGBA 3ICEA 1YNND 5I4DA 2VQEQ 2PMZB 4HJ7A 4G4KA 3S1MB 1K3RA 1N36Q 1EY0A 4A3LH 1N32L 1LO5D 4FVMA 5JJKA 3QWNA 3C1EA 1B8AA 5F2DA 3PIPA 2N88A 4C3IH 3HOZB 5JPMC 1WYDA 5C4XG 1STGA 4WJWA 1HR0L 4XQJA 1X3EA 4JI8Q 4QB4A 4QGUA 2F0WA 1FGBD 2B39A 3QO2A 4HJAA 5FO9B 2OWOA 1CA6A 3S1NB 1WTWA 2K1BA 3ER0A 2EY6A 2EY2A 2Z8LA 3G7LA 5CR3A 1HNWQ 2L55A 1PTOD 4EQPA 2R92G 4GKKQ 1PH7A 3I4NB 4LUOA 2NB0A 1YNJD 5G3LF 1CQVA 5FLMG 3KF6B 2JE6I 1AW7A 4XT3B 3OTOQ 1JCKB 4DXFA 1SYEA 3GTPB 3E9HA 3I56A 1TWCH 4K0KQ 2JSOA 2RA4A 4LF8Q 1Q1BA 4NXNQ 2NN6H 2N78A 4DV5Q 4FF2A 4KN7C 2XTIA 5JJIA 2B63H 2D0PA 1LTLA 2UUCQ 4UHVA 4C56C 1O80A 5LL6S 1IBKL 5CORA 3M85A 3D6WA 3S16B 3GTMB 2NTSA 3LWEA 2JA6G 3GDEA 3GTQB 4I7ZC 4LNQA 1S72A 3G71A 5ELEA 5M3MB 2WB1B 3LX0A 2B2YA 2E2JB 1VQBA 1S5FD 3HOYB 1EYGA 2BDNA 1ICWA 4CHTB 3TRZA 4DNTB 4WORA 1X3QA 1D1IA 1VQFA 3HOXG 1TS4A 3I4MB 1BDOA 2A6HC 2UXDL 4K6DA 1XMOQ 3HKZG 1ENFA 1E1OA 2JA7G 1RHPA 2F0TA 4X3KA 3G4SA 1I50B 3S2HB 4HSVA 4S3SA 1YJWA 4R4IA 4LF7L 3RR5A 3BDLA 4OO1G 5BN4A 1K0SA 1QG7A 4HJ8A 3FPUB 4MHEA 1Y1WB 4ZUIA 4A3GG 1DOLA 5M5YB 4A3MH 4OWTB 1QZGA 1TR5A 2HIXA 1PTOB 1IBLL 1B9MA 4IN3A 4JI6L 2YU9H 1PH9A 1UNSA 3RZDB 1O7LA 3OOCA 2XN9C 3TZUA 1I3QH 4M1UB 1NJIC 3PSIA 3WDNA 1HNXL 3ERQA 1B44D 1R4PB 4CKCA 2ZJPA 1VQMA 3NTKA 1N33Q 3RZOB 3R2TA 1ZXTA 3KLSX 1DONA 3A5UA 1PFNA 3VDYA 3MAQA 4CDEC 1BXTA 3HG9A 4JYAL 3FRPB 1Q82C 2QCPX 4AIMA 3JAME 3T4AC 1G2SA 1UE1A 2B2VA 4V0BA 4BA2I 4IFDH 4DAVA 4ZQ3A 4CGYB 2WFWA 4HMIA 3RLOA 4Z9CB 1FR3A 3X3NA 4GNXB 1BQQT 3L3OC 3HKSA 4CJ1B 1VQAA 2ZXRA 2DGYA 4LFCQ 1TWHB 1VQ6A 3I55A 3RN2A 1CTMA 4Y7NB 5C4XH 3VA7A 3IL8A 5C3XA 4RHSA 1G291 3M4PA 1PH2A 3AFPA 3FKIB 4JI4Q 3J80L 1MKHA 2JA8G 5LMNQ 3MHBA 2NVTH 1D8LA 3S14B 4N8X1 4A3EG 4UDUC 4PNYA 3TN2A 4K8IA 1SLJA 1EZ6A 3TSSA 4A3IG 1LABA 5IIFA 5IE8A 1EY7A 3ERSX 3MTSA 2R92H 2NZHA 1PH1A 1YBYA 4X62Q 3NENA 5FLMH 4CDFC 4A3JB 1U5KA 1ONLA 5ELDA 1L0YB 3BG3A 1TWAB 2IL8A 4BBSB 5M5XB 5CMDA 1WI5A 2F0LA 3H0GB 5IGFA 2LS01 1VQ5A 3J81c 4DUZL 3OW7A 3MXGA 2RF4A 4GKJQ 3G6JB 3MZ5A 4JI2Q 1PFSA 2L1BA 1K73C 4B9WA 1L1OC 5JAVA 1VQIA 2FINB 2H5XA 4HIKA 3A56A 4R4OA 3VR4A 4KKSA 4R9WA 1RF2D 1FNWA 1T5XD 1WCMG 2E2HH 1I5FA 1H9RA 1L0XB 4QIWE 3NEMA 3AFQA 2JA6H 1PRTF 3CHBD 4DR2Q 2PI2A 4PQXA 2NN6I 3BU2A 1PV4A 4AQYQ 1LTSD 5C44G 2PQEA 3AEVA 1XXGA 3STBC 3OYYA 1XX8A 1YI2A 2V1CC 4JI7Q 4FXKC 2F1MA 4RG1A 4HJ5A 3HOXH 2I5HA 1HA6A 3L7ZC 3I2ZA 1EQVA 2CH4A 2SDFA 4IUVA 3D6CA 2OQKA 1IW7D 3EA6A 1H9MA 3BDOA 5CV6A 4O1NA 3SK4A 4XYQA 4OO1H 3T1YL 4IPHA 2Z1CA 1O7ZA 1FGUA 1IL2A 3JC66 3HOZG 1GHJA 1VS0A 2E5LL 4A3GH 2A68C 1SE8A 3CPFA 1U9RA 4FDBA 2JK8A 3VA5A 3UDXA 1VQOA 1NUCA 1RKNA 1EWCA 4WFN3 2YYZA 1VF7A 5H1SE 4HN7A 4JOIC 3CW2C 1LTAD 1WVLA 3AU7A 1EYAA 1EY8A 2HUGA 2DJGC 1BKBA 1F2MA 1WFQA 3Q0AA 3MXNB 2NBFA 3I4NG 4JBWA 4DAPA 2D5DA 3OIQA 3OPOA 5M5WH 1D5MC 1KDBA 1S5BD 3PIOA 4L5TA 1ASYA 5KEEA 2XSCA 2EYOA 2D9UA 2NYZD 5C0XJ 1BF4A 2DNEA 1JB3A 3GV6A 2HDMA 2KJXA 3MFGA 2Q2TA 4ZCKA 3S2DB 3DXJC 5IODA 2A69C 2UU9Q 3OW2A 3J80i 1C0AA 4KKUA 4KY6A 4DV3Q 2NVYH 2H4OA 1A2UA 3M4YA 2UXCQ 3HP3A 2Z6BA 4C1NK 5C4ZA 4K5VA 5GADC 4QQBX 3VYSA 5M3MG 5IT9c 2VXWA 2WB1G 1KQSA 4JV5L 2RQXA 4B3TL 3C2PA 3RLNA 3NQTA 3HOYG 3M4QA 2E8GA 1G6PA 1BOSA 1S5ED 3S1QH 1C7YA 1XNQQ 3FDTA 4N8FA 2JA8H 1ILQA 2WB1E 2OF1A 4MIUA 3U50C 3HOVB 4A3EH 3I4MG 1K3BC 2HHHQ 2JEBI 2MNAA 4A3IH 1QVCA 1A3UA 5IWAQ 1SYBA 1EQTA 1CZWA 3RN5A 4DR4L 3S17H 2CW0D 3S15B 1GHKA 2EOTA 5C6AA 3R8BA 3IFDA 1YIJA 1WD1A 4DKAC 2AKWB 1Y1WG 3A54A 1IBMQ 4LFBQ 4B3MQ 2K5VA 2F4IA 1AZPA 2EQSA 5KGUA 4L63B 4IJLA 2A6EC 1QZHA 1PHJA 1A0IA 4P74A 1L1OA 1I94Q 2KA7A 3HOWB 2IWHA 2I0QA 5C5LA 2PO4A 4F88A 5L37A 1PVOA 4IPDA 3H09A 1WCMH 1QOHA 2XWBB 1TU2B 2K5QA 1Y14B 2EY1A 2E2DC 4ZKBB 2ASBA 1UUPA 3ZYYX 5C44H 4J8QA 5T1GA 4LJZC 3PCOB 2K28A 2BE5C 5EBCA 2XRQD 4DFAA 4HIDA 4LFAL 2F0FA 3DM3A 2K14A 1NE3A 1HQRD 2JJQA 1KTKA 3TZDA 4G57A 1PZJD 2Q8TA 5K5PA 1BVSA 2K5WA 3NP8A 2PCFB 3V96A 4TVAB 4RWSC 3S1MH 3QOLA 1HNZQ 4OXPA 2MUYA 1M8AA 2O2LD 1XYIA 2ENBA 2G9HD 3E0EA 3NWTA 3HOZH 4DAYB 2ES2A 2UXBL 1XNRL 3MA2B 3X3MA 3TP7A 3PUWA 4RGNA 1LV9A 1Y8NB 3FKIG 4ZYSA 5AJ3L 5C4HA 4X66Q 4V190 4BXXG 4HIMA 1J6QA 4YWLA 2K5HA 2EYHA 3S1NH 1ET9A 3F2UA 4JOIA 4CDDC 1SXTA 1NTGA 1NMGA 4JK1C 4R4CA 1E22A 3I4NH 5CBAE 2BA1A 2K32A 1RD9D 3N6RA 4JBJA 4A3JG 1N34L 5FO8B 1IL8A 1SN8A 1U0LA 3V2TA 4RGOS 1WD0A 3M7NA 4BBSG 3GTPH 3ULPA 3H0GG 1LYLA 4GN4B 4JI0Q 4J15A 4KJNA 4DV1Q 2M2LA 1W6KA 4IFDJ 2F03A 1SNPA 1NR2A 5DAUA 1VMPA 3S16H 3NPPA 2R7FA 2ZTCA 2MO0A 3E6ZX 3P75A 1IKMA 3S24A 3HRZC 1HFGA 2X6LA 5M3MH 1O78A 1N32Q 2E2JH 1TWFB 4DGZA 1A62A 2TSSA 3HOYH 3RUZA 3OWEB 5JVH3 2J4XA 1HR0Q 1LTGD 4IURA 2F0QA 4IUUA 3I4MH 3F2BA 3KBGA 1PRTB 5EAYA 1MSHA 4A3DG 4HCSA 4KMUC 2B2YC 2ZT9C 4TQUS 1Y8PB 3PMFA 4DR1Q 2I07B 2O5IC 1A8VA 2K75A 3K5OA 1I50H 3S2HH 2WP8J 5GAEC 2PQAA 3JAMc 3WWVA 2OXPA 2RKSA 3QB3A 1AH9A 1C4QA 1EU3A 4LF9L 2DY7A 1SBBB 2Q8RE 3K5MA 1Y1WH 4GOPB 4IOAA 2IHEA 4EGVA 5M5YH 2EYMA 1KAAA 4DR6L 3K7AB 5EGTA 1PTOH 4OIJA 5IP7G 4DR7L 4GLXA 3RZDH 2PNRC 2QW7A 1SNDA 4RCOA 1M90C 1N8RC 4IUTA 3CKIB 4L5RC 1LT5D 2ICEC 2KVMA 2SOBA 1G2TA 4HAEA 4KTAA 1STNA 2AQ3B 2V4DA 1HJPA 3RZOH 4DXGA 1TY2A 1S4ZA 3EN2A 3UE0A 2MP1A 1TT2A 1G8ZD 3BYYB 4JI1L 5IP9G 3L2PA 4O42A 1Z6HA 1Z7TA 3GTJH 2I46A 3K80C 2VUMB 2JYOA 5J1ZA 3CCEA 1EQQA 1SEBD 1JT8A 3FMCA 4KJOA 1Y69U 1DYQA 1B2TA 1GUNA 2UXDQ 3PUXA 4L6TB 5IGDA 3U9OA 3UDIA 1EQRA 2EXDA 1I4QA 4LF7Q 3HEJA 3RMHA 1TWHH 2KCTA 3CCQA 5GAHC 1XMQQ 4RGTA 3EFXD 5IT9L 2ZTDA 5M3FB 3FKIH 3U4ZA 1HFNA 3PV0A 5LMUL 1TS2A 1E1TA 5CBEE 4LF6L 3IRBA 4BXXH 1HUMA 3S14H 3HOVG 1H95A 1YNNC 4DK6C 1PYWD 4CJ2C 5FLXE 1DOMA 2SNSA 3J7ZC 2QEXA 1XPRA 1GUGA 2MJ8A 2FFKB 4JI6Q 1S40A 2AWOA 2DNCA 3J81i 1SYGA 1J8IA 5JJLA 5FLXL 3J7A5 3FHWA 3GTOB 2ICIA 1HNXQ 3D0FA 4A3JH 2EY5A 3GV3A 4TRDA 2EYJA 4C2MB 4FF1A 2BA0A 2VW9A 1TWAH 1B9NA 4BBSH 5M5XH 3H0GH 1J5EL 2JA9A 4OHJA 2IJ0A 1JQYD 4JC0A 1LTID 2PW5A 1LM0A 3KYHC 2JP1A 3HOWG 1PTOC 1DZ1A 1F9SA 3K58A 1DOKA 4ME5A 5C4JB 4CDCC 2K4KA 4YCWA 5C3WA 1BBUA 2ID0A 1RODA 4YHHL 2R93B 3URYA 3K59A 1YITA 1B7YB 5EKIA 2BDOA 1WTVA 4KN4C 2HDLA 3EQLC 4LF5L 5KNDA 1DXMA 3KF8A 4A3DH 4B3RQ 4Y52H 1JWSD 4BBRB 1ZYRD 2KCNA 1QCBD 3KDFA 4KLKA 5JOBA 4YCUA 2F3WA 3FPPA 3D4WA 4PZ8A 1WOCA 1LTBD 4P75A 3D8GA 4JI5L 4A75A 4A4IA 4MNOA 4GNXC 1STHA 1F2ZA 1HZCA 3AMUA 2Q2IA 5E3FA 4MTNA 1E7ZA 1MBYA 2F0JA 1STAA 1VQPA 1QB5D 4NB3A 5IP7H 3HKZE 4DPGA 5J22A 3BVGA 4A3BB 2Z6KC 2A6HD 2CQOA 4DV2L 1VQ7A 4L5QA 5J3BA 1OO9B 1X3FA 1XWEA 3SVMA 1M1KC 1BCPD 3PO3B 2F0SA 3I4OA 4PG3A 2JN4A 1S5CD 4O0AA 1Q8IA 5IP9H 1GJXA 4UP9A 1Q1EA 2R6GA 1Q8KA 3KLSA 3KF6A 5EKLA 2QDLA 3PUVA 1JE4A 3P1HA 3E5SA 1K8AC 1DJRD 2R7ZB 3EIVA 3AYHB 1M4VA 1TKWB 3S2DH 1NNXA 1N36L 5KIXA 1CUKA 2F0UA 3A74A 3Q8DA 3EBEA 5ISRA 5KRUA 4OWWB 2WAQB 1F2YA 1V43A 1EYCA 4LK1C 2UUBL 1YVCA 1KLGD 2Y0SB 3SR1A 2WKDA 3NHHA 3T1HL 1QVGA 1UE6A 4G7HC 3T1YQ 3RD4A 2F4VL 1U4RA 5CV7A 1UE7A 2KBNA 4R4TA 1PZID 4DV6L 4R4QA 2E5LQ 5C0XI 1HUNA 3HOVH 2FHTA 3J80E 5EPJA 1B70B 1UAPA 1T9HA 3NK9A 2GVBA 3S15H 1EIGA 2F0HA 5TSSA 3SK6A 4BY1B 4DV5L 2L0CA 3A0JA 3CCRA 1ENAA 4OX9L 4KKTA 5D3DA 4B3SQ 3GTLB 3NE5B 4X64L 1CQFA 3FP9A 3I72A 1D5XC 1ESFA 2HQLA 3U9SA 1EOVA 3HOWH 1I4XA 1G6ZA 1BCPB 3WOEA 3BZCA 2QF7A 1B3AA 3HOUB 1G51A 4M8AA 1EL0A 3Q24A 4HTHA 4FNFA 3S1RB 2K01A 5FOBB 1CI3M 2R7DA 2N3SA 1FYCA 2B8GA 1SMYC 1TVXA 2VY3A 4RFBA 3W2DA 5KYIA 1XTDA 1AZQA 2LY7A 4JV5Q 4B3TQ 4A93B 3SHLA 1SROA 1CKNA 2VUMG 3GTGB 1VF5C 3TP5A 4X3SA 1VQLA 5G3LD 4X6AH 1KABA 2LKVA 1SE3A 4DR3L 2JXMB 1HZBA 4LAAA 2C9OA 2ZM6L 3K5NA 1X54A 1Q90A 3H15A 1EOTA 4GN5A 3OSOA 3R2IA 2HIVA 3K0XA 4DR4Q 3SGIA 4GNXA 2JA7H 5D3IB 3TS0A 1PH3A 3NXWA 4ODGA 1JOQA 4RH6A 2QEJC 5M3FG 5C3EB 3MXPA 4AYBB 1E2ZA 3SDZA 3W1GA 4KK7A 3SXHA 2C5CA 1X6OA 1PH6A 2N55A 1IW7C 1B50A 2Z6KA 1P8LA 2G9DA 1LUZA 2PMZE 2Z9HA 4NXMQ 3T16A 1L0WA 4MZ9A 2K5NA 3I4LA 4C3HB 1UE5A 1ZKOA 4N9TA 4WJ4A 4ME3A 4LMQD 1VDZA 3K0YA 1YJ9A 1GUWA 1TXYA 4DNRB 2MQHA 3R3OA 4X65L 4DR5L 3OWFA 4QJFA 4YCVA 3CCVA 3BYTB 2QA4A 1EEID 1SYFA 3I8ZA 4LFAQ 2CVRA 1I4HA 1TIID 1BBWA 2HQEA 2VS1A 3CAMA 3ULJA 4K14A 3CC2A 1Y1VB 1JORA 2K6AA 2F0PA 3K6OA 1L1OB 4XXEA 1TWFH 4KHPL 1EIHA 4A3MB 2EPBA 4P73A 5FK9C 2R93G 3I70A 1I4GA 2UXBQ 1SJED 3H91A 1XNRQ 3JAMi 1BNZA 1VMCA 2IX0A 2QILA 3UDFA 3HS0C 1SDFA 1FVIA 1ILPA 2N8NA 2A69D 1JOKA 1TY0A 4BBRG 4IQZA 4IFDI 2D62A 2YTYA 1NAPA 1OXUA 3E9IA 4U673 1PMRA 1PA6A 3DM1A 1I6HB 2KOLA 1Q12A 1VQHA 3K81C 4NP5A 1BO0A 1N34Q 1E24A 5I6YA 3DEOA 3ULLA 3KJOA 5IGBA 2VQFL 3K7AH 1GOZA 4MTKA 4OWXB 4DV7L 3Q22A 4R1JA 1JJ2A 4JW0A 4G7OC 4H0LC 1JOOA 4GN3B 3A55A 3ITPA 2CW0C 1TS3A 5D14A 2JEAI 2NUCA 4KI0A 2J7ZA 1HTPA 4N9PA 4DV0L 3PO3G 2RHSB 1GUTA 1UEAB 2A1AA 2KEDA 3F2DA 5GAGC 4ULLA 5ELBA 2VUMH 1JWUD 3CU7A 2R7ZG 2HT1A 3TQYA 3CMAA 3A8KE 1A2TA 2K33A 3NTIA 1GXDC 1K8OA 2JA5B 3TMEA 4GS3A 2WAQG 4OEMB 1YJNA 2E2IB 3ND8A 2Y0SG 4YIJA 1HQMC 1H9SA 2FJ2A 1EU4A 2RDGA 2ZJRA 3D4RA 1SFOB 1ASZA 2SNMA 2EJFC 5M3FH 1K83B 1CA5A 5BN3A 1E2VA 1SYDA 2A8VA 1D2BA 1PRTD 3MFYA 4ZLTF 5CV4A 4P71A 1MJEA 3PUYA 2TMPA 1EY6A 2ALYB 4EVOA 1YNXA 2A74C 4DV4L 1Q3LA 1JICA 1A63A 3GTOH 1OXTA 1XJVA 2NVXB 3H94A 2CFMA 5E7NA 4NW2A 4BY1G 4KY7A 4OO1I 3G48A 4C2MH 1GKHA 3D4DA 2NWGA 3TREA 1I4PA 5JJZA 1II3A 3DWQA 4JI1Q 1HXYD 3SEBA 3HOXB 2UUAL 1A6XA 2RVLA 4XYOA 5CV8A 2UXCL 1MGSA 1PTOF 3HOUG 1B4OA 3MVVA 2XWJB 3M7GA 4R8IA 2XIWA 1Y8OB 1K0RA 1PH4A 4I7AA 4RCNA 1SJHD 3AB9A 3I3CA 3NELA 5C4JH 1K8MA 1MIUA 4CKEA 5A2QL 1JR0D 2X69A 1V8QA 3NBHB 1O7YA 3J81L 1S3OA 3IKJA 2HCIA 4EQOA 2R93H 4KHVA 4JVZA 2MFIA 4YWKA 4UAIA 3VYUA 2WKCA 3GTMH 4A93G 2PYKA 4B9XA 5IWAL 1RDPD 3CQZB 3GTQH 4K6LA 2PZUA 5ELOA 1KDAA 5LMUQ 3KJPA 2K5DA 4LF6Q 4BBRH 1CSPA 1HHVA 5JEAG 3M3YB 4IPCA 3T51B 1K8GA 4IALA 4EQ5A 4B3ML 2A19A 4WRDA 4ZAIA 4DK3C 2N49A 3QR8A 3F8TA 1OXVA 5BN5A 4R8NA 5NUCA 5DEHA 4BWGB 2F52A 2L11A 1X3PA 2Q2HA 1R9TB 4DK0A 5C3EG 1VQ4A 3DUZA 2FMCA 2AHOB 3HFZB 3KLWA 4AYBG 1J5EQ 1G91A 1OTCA 3MXUA 1QUQA 5ELNA 4NMZA 3KK7A 4DUYL 2EIFA 2AQ2B 2CWAA 3CC7A 1STEA 1J9OA 4C3HG 4AYBE 1V9PA 5T1IA 1AE2A 2XVSA 3AQQA 4BY7B 3J80c 3VYRA 4WJ3M 1UWVA 1GM5A 4A3CG 2H1EA 4IUPA 2EDGA 3S1QB 1EY4A 4YHHQ 5GQOA 1JJCB 3PO2B 5BR8L 1IBKQ 5CGKA 2R7ZH 2RBMA 3KBXA 3I90A 2M00A 1VQDA 2E75C 3J7AF 4K8JA 1SRUA 1DM0B 3GP7A 4PZ6A 3BZKA 4OL7A 4Q0FA 4X3TA 5KNCA 1LTRD 3T56B 2B2TC 3Q23A 1O7IA 4ZK9B 1Y1VG 4Q5VA 1SE4A 1YEZA 5EBDA 2NVQB 4JI5Q 4H44C 3CC4A 2CCZA 4IJHA 4UP7A 4YY3L 2MHVA 4QIWB 3S9WA 4DA2A 3RLFA 4UP8A 3HZXA 4EQNA 2IX3A 2ATWA 5IT9E 3SE0A 4RMFA 3M4OB 3CCUA 2OQ0A 2E74C 1CM9A 1YZ6A 3TP6A 4Y7NH 3GQBA 2EYLA 3A8IE 4IOCA 2B2UC 1ET6A 4QF4A 1JE5A 4DV2Q 1UEBA 5C44B 4JI0L 5D65A 4BY1H 2HD3A 3KF8B 4ID6A 5EJWA 3TP8A 1IBLQ 4IUNA 3ONAB 4IO9A 1X55A 4OIKA 1D5ZC 3RNUA 3GTLH 2D0OA 1X9NA 3KDFB 2KHJA 4ZUJA 4KHZA 1WTOA 1SNQA 4CBVA 4E6IA 2F3VA 4H7BA 3HOUH 1KC8C 1C48A 5IYDG 3UDGA 5IYBG 2SEBD 4POGA 2KCCA 3S1RH 2RCFA 3BVMA 2BH2A 4UPAA 3SK8A 4EX5A 2UUBQ 1I4RA 1OXSC 5DM63 1FNVA 4JYAQ 3T1HQ 2F0VA 1V1PA 2F0NA 1H9KA 4HMJA 1TWGB 5CV9A 3NTHA 3OMCA 1Q86C 1FJGL 4A93H 2Q2UA 2YTXA 1YNJC 5IGGA 1V1QA 2F4VQ 4DR1L 5DLQE 1PDQA 3GTGH 3GTKB 1RTOA 4DV6Q 1PXUA 4DNIA 1SMXA 1SAPA 1EUJA 2JA5G 3J7AV 5JEAH 5EKKA 3CCLA 4QCLA 1MJCA 1R4QB 1QNUA 1Q7YC 3CCJA 4CJ0B 5IGCA 1XPUA 2ZTEA 5EPKA 1W3SA 1VQEA 1B53A 1CFMA 1GVPA 5CV5A 5LL6X 4LF4L 5K36G 5KNBA 2KHIA 2KHSA 1F2LA 3NSWA 5I2XA 3FVQA 3QOJA 5C3EH 4OX9Q 2XRSD 4P2CB 1ZYRC 4JBKA 1EWIA 4X64Q 4A3KB 2VNUD 1SSOA 3C1FA 2IHFA 4DN4M 5EPLA 1F9PA 2K52A 4ILWA 4FF4A 3LWUA 1KLUD 4C3HH 3L9AX 3CXCA 4QUFA 4RAUC 4JI3L 4DUZQ 4X3UA 5E4WC 1KD1C 1H9JA 4A3CH 3TS2A 3CD6A 2YV5A 4C1NI 4F7XA 4FXDA 5IOCA 2EYFA 4MN3A 4C3JB 2M9VA 3UI2A 3V05A 3EJIA 1IKLA 3PIP3 4BA1I 4JCVE 2IPKD 1EIYB 3J7YW 2A73B 3D3RA 1BCPC 4JPBW 4HEDA 2BCOA 1IZ6A 1XMQL 5IYCG 1X56A 4DR3Q 1CK1A 2ZM6Q 2LMCB 2VQEL 1KHIA 2B2TA 2K04A 1ZEQX 1Y1VH 1U4MA 2B29A 2CWPA 1U4PA 2K50A 1X3GA 5I9PA 1GD7A 2L12A 2IY5B 2KEEA 1BBXC 2AQ1B 3CF5A 1LLRD 4JI8L 4RKBA 2AMCB 1XPOA 1JJGA 1S5DD 4P72A 2MO1A 1E0BA 2OCEA 2RHQB 3P20A 1GUSA 4PZ7A 1KRSA 2EYPA 1BUVT 4YWMA 2B2UA 1CKNB 5COYA 3M9BA 4HR7B 1HNWL 4GKKL 1I6HH 5ELCA 4K5WA 3GTJB 4LWCA 1EWHA 3E0JA 4J6HA 1A3VA 1E2WA 3J81j 3OTOL 1PFMA 4DAMA 3LNNA 4X65Q 4DR5Q 4A3FB 4HJ9A 1QJOA 4K0KL 3B6YA 4NXNL 1PH8A 4LF8L 1N9WA 1NSNS 2Z4IA 3F2CA 5IYDH 3JAML 3QIAA 1ESRA 2AUJD 1MSGA 4IPGA 5IYBH 5LMNW 2UUCL 2K03A 1CKMA 1A15A 2AUKA 3VYTA 1CSQA 1MD2D 1AFPA 4BY7G 1DCZA 2CHBD 4KV6A 4XIGS 1OXXK 4B08A 2IX1A 3NQIA 3VR3A 2F0EA 2PZWA 4B3RL 1F9QA 5M9OA 3PO2G 4NDXA 4KHPQ 1FL0A 1RJTA 1STYA 5JVG3 4C3IB 3I91A 4TKOB 3P7JA 1AE3A 1BR9A 3DWAA 2JA5H 1XMOL 4OONA 2E2IH 1K28A 2KENA 2O4XA 4H13C 3BS1A 2E76C 5HGQA 1LT3D 5K36H 4L5SA 1T5EA 2BH8A 1SMYD 5FJ8G 2B2WC 3GO5A 1SFOH 1RTNA 4GLAC 1DGSA 1K83H 3OHXC 3SK5A 1IYVA 3CMEA 3VR5A 3I7FA 1KNAA 1B3QA 1ICFB 1LACA 2VQFQ 1XTCD 5DNFA 1NY4A
chains in the Genus database with same CATH topology
4DV7Q 3BJUA 2GVAA 1Q46A 3TRZA 5IP7G 4DR7L 4GLXA 1NMFA 1VQFA 3STBD 3RZDH 3HOXG 3K8AA 4GS3A 2UXDL 1M90C 1XMOQ 2WAQG 3HKZG 1E1OA 1N8RC 2JA7G 1YJNA 2NVXH 4L5RC 2Y0SG 3GD7A 3G4SA 1YJWA 4R4IA 4LF7L 3RR5A 1HJPA 4DV0Q 1N33L 3RZOH 4OO1G 3EN2A 3UE0A 2ZJRA 4JI1L 5IP9G 3L2PA 4HJ8A 1ASZA 5M3FH 3GTJH 4A3GG 3K80C 2A8VA 4P71A 3CCEA 1MJEA 3PUYA 4A3MH 4OWTB 1EQQA 1QZGA 1JT8A 2HIXA 1IBLL 1E3PA 2ALYB 5IYCH 4JI6L 2YU9H 1YNXA 1PH9A 4DV4L 2UXDQ 1I3QH 3PUXA 1A63A 1NJIC 1VQ8A 3GTOH 3PSIA 2LXKA 1OXTA 1XJVA 1HNXL 2CFMA 3UDIA 5E7NA 1EQRA 4BY1G 4OO1I 2EXDA 1KL9A 4UY8C 4LF7Q 3G48A 4C2MH 1GKHA 3A5ZB 2ZJPA 1VQMA 1TWHH 2KCTA 3TREA 4LFCL 3CCQA 1N33Q 5GAHC 1XMQQ 1K9MC 3A5UA 4JI1Q 2UUAL 3CQZH 3VDYA 2ZTDA 3FKIH 3U4ZA 3PV0A 5LMUL 4JI4L 1E1TA 1P16A 4LF6L 3IRBA 4BXXH 4JYAL 5LMNL 3S14H 2UXCL 3HOVG 1H95A 1Q82C 4DK6C 3HOUG 3M3YH 5GROA 3J7ZC 2QEXA 3U58A 4AIMA 1XPRA 1UE1A 1K0RA 1PH4A 4BA2I 4JI6Q 1VQKA 2PNHA 2AWOA 3U4VA 1S40A 3J81i 1GO3E 4B3SL 2VL6A 2WFWA 4DV4Q 2OTJA 3RLOA 3NELA 5C4JH 1Z47A 5JJLA 3J7A5 1HH2P 1MIUA 3FHWA 4X62L 5AJ3Q 1HNXQ 3D0FA 3NBHB 4GNXB 1RIPA 4A3JH 1S3OA 3HKSA 3ZJYC 3F1ZA 2R93H 2MFIA 4YWKA 1VQAA 1YHBA 2BA0A 2DGYA 2VW9A 1R9TH 3I55A 1TWAH 4LFCQ 1VQ6A 3RN2A 3GTMH 5M5XH 4BBSH 1YHAA 4A93G 3H0GH 3W1BA 1VQGA 5C4XH 5IWAL 1J5EL 2JA9A 2UUAQ 4GKJL 1G291 4A3KG 4JC0A 3GTQH 1KXLA 3M4PA 1PH2A 4JI2L 5ELOA 2OTLA 3AFPA 1L2FA 3HOWH 1LM0A 3KYHC 5LMUQ 3KJPA 4JI4Q 1MKHA 4LF6Q 2JA8G 3HOWG 5LMNQ 3TEHB 4BBRH 1CSPA 1D8LA 2YTVA 2NVTH 3H3VH 5JEAG 4A3EG 2ZJQA 4GLVB 3PF5A 4IPCA 1K8GA 1SLJA 3CP0A 4BY7H 4A3IG 1IXRA 4EQ5A 4B3ML 2A19A 5IE8A 1HZ9A 3ERSX 4DK3C 2N49A 2R92H 2NZHA 4DR2L 1YBYA 1PH1A 4X62Q 3F8TA 4A3BG 2K4KA 4YCWA 1BBUA 3NENA 4AQYL 2ID0A 5FLMH 4YHHL 1OXVA 3PO2H 1U5KA 2F52A 1YITA 4A76A 1B7YB 5FLXc 2Q2HA 4QQBX 5C3EG 1WI5A 2RCNA 3HFZB 2AHOB 3KLWA 4AYBG 3J81c 1VQ4A 4DUZL 1J5EQ 1VQ5A 1OTCA 5JEAJ 4GKJQ 2RF4A 4JI7L 4LF5L 4JI2Q 1QUQA 3W5OA 1PFSA 5ELNA 3UE1A 1K73C 1L1OC 4DUYL 4A3DH 3K7UC 2EIFA 1VQIA 2L15A 4B3RQ 4Y52H 2CWAA 3CC7A 2H5XA 4HIKA 1C9OA 4R4OA 4AYBE 1V9PA 1KRTA 3KDFA 4KLKA 4YCUA 1AE2A 3AQQA 1WCMG 3J80c 2E2HH 1I5FA 1PYSB 1UWVA 1WOCA 4PZ8A 4QIWE 5FJ8H 3NEMA 3AFQA 4P75A 1GM5A 2JA6H 2NVQH 4A3CG 4PMWA 4JI5L 4DR2Q 2PI2A 4A75A 2NN6I 4A4IA 2VZAA 3BU2A 4MNOA 4GNXC 4NPSA 4AQYQ 1PV4A 4WJ3M 1HZCA 2QGQA 4YHHQ 2Q2IA 4NXML 5C44G 5GQOA 1JJCB 3AEVA 1PH5A 4MTNA 5BR8L 3G6EA 1IBKQ 3STBC 2R7ZH 1E7ZA 3OYYA 3M4OH 1YI2A 2V1CC 4JI7Q 2C35B 1VQPA 2CKZB 1VQDA 4NB3A 4RG1A 2WAQE 3HKZE 4DPGA 5IP7H 4HJ5A 1KIXA 1EFWA 1Q81C 1SRUA 2Z6KC 2Y0SE 2I5HA 3HOXH 4PZ6A 4DUYQ 4LF9Q 2CQOA 3BZKA 3L7ZC 4DV2L 3I2ZA 4LUZA 1QVFA 1VQ7A 4L5QA 5J3BA 1X65A 4DR6Q 1VQJA 2XGTA 1X3FA 1O7IA 2OQKA 1M1KC 1Y1VG 4LUVA 4ALPA 3I4OA 1YEZA 4PG3A 3T1YL 1VQ9A 4DR7Q 4O0AA 2I5MX 3KOJA 4JI5Q 4IPHA 3CC4A 5IP9H 2CCZA 4UP9A 1FGUA 1Q1EA 2R6GA 4IJHA 1Q8KA 3JC66 4UP7A 4YY3L 1IL2A 3HOZG 2PI2E 3KF6A 4POFA 4DR6L 3PUVA 4A3FG 1VS0A 3RLFA 2E5LL 4A3GH 4UP8A 5BR8Q 1SE8A 3CPFA 4FDBA 1VQOA 2JK8A 3EIVA 3AYHB 3UDXA 1K8AC 2ATWA 4RMFA 5C0XG 3S2DH 4XTCS 2OQ0A 3CCUA 4QY7A 2YYZA 1N36L 1YZ6A 2UU9L 4Y7NH 1CUKA 5H1SE 3A74A 3Q8DA 4JOIC 3CW2C 3EBEA 4DV3L 2UXBQ 4IOCA 4GOPC 1JE5A 4DV2Q 4OWWB 1UEBA 1V43A 2PQAB 2UUBL 1YVCA 1BKBA 1WFQA 4JI0L 3MXNB 3T1HL 4BY1H 1JB7A 3CMAA 3I4NG 1QUQB 4JBWA 1TWGH 1QVGA 3KF8B 1VCIA 5M5WH 1UE6A 2LSSA 1IBLQ 1NBWA 3T1YQ 4A3LG 2F4VL 4IO9A 1X55A 4QL5A 3PIOA 4L5TA 1ASYA 1UE7A 3RNUA 2KBNA 3GTKH 2D0OA 4R4TA 4YY3Q 3KDFB 2KHJA 1X9NA 1VQCA 5C0XJ 2KCMA 4DV6L 4KHZA 4R4QA 1XNQL 2E5LQ 4A93H 5C0XI 4APVA 3HOVH 2NZOA 3HOUH 1KC8C 2Q2TA 5IYDG 2HHHL 3UDGA 2UU9Q 1B70B 5IYBG 4POGA 1T9HA 3J80i 3OW2A 1C0AA 4O2DA 3S1RH 4DV3Q 2AWNA 2GVBA 2NVYH 2BH2A 4UPAA 4EX5A 3S15H 2UUBQ 4HIOA 1OXSC 3PF4A 4JYAQ 2UXCQ 3T1HQ 1KAWA 3KFUA 4DV5L 3PUZA 5GADC 1Q86C 3A0JA 5M3MG 5IT9c 2Q2UA 2WB1G 2YTXA 3CCRA 1W2BA 1KQSA 1V1QA 4B3TL 2F4VQ 4JV5L 5IY0A 4DR1L 1IBML 4OX9L 5DLQE 4LFBL 3RLNA 4B3SQ 3HOYG 3GTGH 4A3KH 3M4QA 4X64L 5HY6A 3FP9A 2E8GA 2Z0SA 4DV6Q 1JMCA 1G6PA 3LGJA 3S1QH 1C7YA 1XNQQ 2HQLA 4H02A 1EOVA 4DNIA 1SMXA 1RL2A 2JQOA 2WB1E 1I94L 1HR0W 1EUJA 2NN6G 3U50C 3BZCA 2JA5G 4A3EH 3CCLA 3I4MG 1MJCA 2I5LX 2HHHQ 1G51A 2JEBI 2B63G 1Q7YC 2MNAA 3CCJA 3MEFA 4A3IH 1QVCA 5IWAQ 1XPUA 2ZTEA 3RN5A 1W3SA 4A3BH 1VQEA 1GVPA 4LF4L 4DR4L 3S17H 2R7DA 5K36G 2N3SA 2KHIA 2VY3A 1SR3A 3D31A 4C3JH 1YIJA 1CKOA 1FJGQ 1XTDA 3H3VI 4DKAC 4B3TQ 4JV5Q 2AKWB 1Y1WG 5C3EH 1IBMQ 4OX9Q 1SROA 1CKNA 3PO3H 4B3MQ 2VUMG 4LFBQ 4JBKA 1D7QA 2K5VA 1EWIA 4X64Q 2EQSA 2VNUD 1PYBA 4IJLA 1VQLA 1QZHA 1PHJA 4X6AH 1A0IA 2IHFA 4P74A 1L1OA 2K52A 1I94Q 2I0QA 4JG2A 4DR3L 4C3HH 2ZM6L 1HZBA 2GN5A 3CXCA 1PVOA 1X54A 2FXQA 4IPDA 3H15A 1WCMH 4JI3L 1IYJB 1HNZL 4GN5A 4DUZQ 1KD1C 1Y14B 4LF5Q 4A3CH 2HIVA 3K0XA 4LF4Q 4DR4Q 3TS2A 3SGIA 3CD6A 2ASBA 2YV5A 4GNXA 2JA7H 1WJJA 5C44H 3TS0A 1PH3A 1VQNA 3PCOB 5M3FG 3CCMA 4JBMA 3PGZA 4X66L 4HIDA 4LFAL 3W1GA 3CCSA 3DM3A 4BA1I 2K14A 4JCVE 2LXJA 1X6OA 3CPWA 4A3MG 1PH6A 1EIYB 2F3IA 2Z6KA 1NE3A 1P8LA 2IT1A 1LUZA 2PMZE 1IZ6A 2JJQA 3DLLA 1L0WA 1X56A 5IYCG 4MZ9A 2K5NA 4DR3Q 1XMQL 4NXMQ 1BVSA 2ZM6Q 1UE5A 1FJGL 1YHQA 4TVAB 2VQEL 4WJ4A 1KHIA 3S1MH 1Y1VH 4JI3Q 2B3GA 1HNZQ 4ME3A 2B29A 4OXPA 1YJ9A 2CWPA 3E0EA 3L0OA 2K50A 1X3GA 3HOZH 4DAYB 1TXYA 2ES2A 2UXBL 1GD7A 2MQHA 4X65L 4A3FH 1XNRL 4DR5L 2IY5B 4QJFA 3PUWA 3CF5A 4YCVA 3CCVA 2QA4A 4JI8L 4DV1L 4AH6A 2AMCB 3FKIG 1XPOA 1JJGA 5AJ3L 1HZAA 4X66Q 4P72A 4LFAQ 2MO1A 4HIMA 1J6QA 2OCEA 2RHQB 3GTLH 4BXXG 4PZ7A 4YWLA 4LW1A 1Z9FA 2K5HA 3S1NH 1BBWA 1KRSA 2VS1A 4JOIA 3CAMA 3ULJA 4YWMA 2DUDA 4GOPA 4IFDG 1CKNB 1NTGA 1NMGA 3M9BA 1EIFA 4R4CA 3CC2A 3ICEA 2VQEQ 1E22A 1HNWL 3I4NH 4GKKL 4HJ7A 1I6HH 2BA1A 1K3RA 4LWCA 1L1OB 4JBJA 4A3JG 1N34L 1N36Q 4A3LH 1N32L 5JJKA 1TWFH 4KHPL 2R93G 1SN8A 4P73A 1B8AA 1U0LA 3J81j 3PIPA 3OTOL 4DAMA 4C3IH 3M7NA 4BBSG 4X65Q 1XNRQ 3JAMi 3ULPA 3H0GG 4DR5Q 1LYLA 1WYDA 4GN4B 4HJ9A 3GTPH 2IX0A 4JI0Q 4J15A 1HR0L 4K0KL 3B6YA 4NXNL 1PH8A 4LF8L 3UDFA 1X3EA 4JI8Q 1N9WA 4DV1Q 1FVIA 3F2CA 5IYDH 2N8NA 4QGUA 4HJAA 2OWOA 4IFDJ 4IPGA 5IYBH 4BBRG 5LMNW 2UUCL 1CKMA 4IFDI 3S16H 2D62A 2YTYA 1CSQA 3ER0A 4BY7G 3E9IA 1OXUA 2R7FA 2ZTCA 4XIGS 2MO0A 1OXXK 1PA6A 2IX1A 1HNWQ 2R92G 4GKKQ 3S24A 1PH7A 1Q12A 4LUOA 1VQHA 4B3RL 3K81C 5M3MH 5FLMG 3KF6B 1N32Q 1N34Q 5C4XG 3PO2G 2JE6I 2E2JH 1E24A 4KHPQ 1FL0A 3HOYH 1A62A 3ULLA 3OTOQ 3KJOA 2VQFL 3K7AH 4OWXB 4DV7L 3E9HA 3I56A 1TWCH 4K0KQ 4R1JA 1JJ2A 1HR0Q 4LF8Q 1AE3A 1Q1BA 4NXNQ 2JA8H 2N78A 4DV5Q 2JA5H 3I4MH 2XTIA 3F2BA 5JJIA 4GN3B 5EAYA 2B63H 4A3DG 2D0PA 4TQUS 1XMOL 1LTLA 4OONA 2E2IH 2UUCQ 4DR1Q 1A8VA 2KENA 2K75A 1IBKL 2JEAI 1I50H 3M85A 3S2HH 4KI0A 2WP8J 5HGQA 5GAEC 2PQAA 3JAMc 4L5SA 2BH8A 4DV0L 3PO3G 3WWVA 5FJ8G 2RHSB 2JA6G 3GDEA 1AH9A 2A1AA 3GO5A 4LNQA 1S72A 1SFOH 3G71A 4GLAC 4LF9L 1DGSA 1K83H 5GAGC 3F2DA 3CMEA 1Y1WH 4GOPB 3I7FA 1VQBA 2VUMH 4IOAA 2IHEA 5M5YH 2VQFQ 1EYGA 2R7ZG 2HT1A 3TQYA 1NY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 Q;  3BJU A;  2GVA A;  1Q46 A;  3TRZ A;  5IP7 G;  4DR7 L;  4GLX A;  1NMF A;  1VQF A;  3STB D;  3RZD H;  3HOX G;  3K8A A;  4GS3 A;  2UXD L;  1M90 C;  1XMO Q;  2WAQ G;  3HKZ G;  1E1O A;  1N8R C;  2JA7 G;  1YJN A;  2NVX H;  4L5R C;  2Y0S G;  3GD7 A;  3G4S A;  1YJW A;  4R4I A;  4LF7 L;  3RR5 A;  1HJP A;  4DV0 Q;  1N33 L;  3RZO H;  4OO1 G;  3EN2 A;  3UE0 A;  2ZJR A;  4JI1 L;  5IP9 G;  3L2P A;  4HJ8 A;  1ASZ A;  5M3F H;  3GTJ H;  4A3G G;  3K80 C;  2A8V A;  4P71 A;  3CCE A;  1MJE A;  3PUY A;  4A3M H;  4OWT B;  1EQQ A;  1QZG A;  1JT8 A;  2HIX A;  1IBL L;  1E3P A;  2ALY B;  5IYC H;  4JI6 L;  2YU9 H;  1YNX A;  1PH9 A;  4DV4 L;  2UXD Q;  1I3Q H;  3PUX A;  1A63 A;  1NJI C;  1VQ8 A;  3GTO H;  3PSI A;  2LXK A;  1OXT A;  1XJV A;  1HNX L;  2CFM A;  3UDI A;  5E7N A;  1EQR A;  4BY1 G;  4OO1 I;  2EXD A;  1KL9 A;  4UY8 C;  4LF7 Q;  3G48 A;  4C2M H;  1GKH A;  3A5Z B;  2ZJP A;  1VQM A;  1TWH H;  2KCT A;  3TRE A;  4LFC L;  3CCQ A;  1N33 Q;  5GAH C;  1XMQ Q;  1K9M C;  3A5U A;  4JI1 Q;  2UUA L;  3CQZ H;  3VDY A;  2ZTD A;  3FKI H;  3U4Z A;  3PV0 A;  5LMU L;  4JI4 L;  1E1T A;  1P16 A;  4LF6 L;  3IRB A;  4BXX H;  4JYA L;  5LMN L;  3S14 H;  2UXC L;  3HOV G;  1H95 A;  1Q82 C;  4DK6 C;  3HOU G;  3M3Y H;  5GRO A;  3J7Z C;  2QEX A;  3U58 A;  4AIM A;  1XPR A;  1UE1 A;  1K0R A;  1PH4 A;  4BA2 I;  4JI6 Q;  1VQK A;  2PNH A;  2AWO A;  3U4V A;  1S40 A;  3J81 i;  1GO3 E;  4B3S L;  2VL6 A;  2WFW A;  4DV4 Q;  2OTJ A;  3RLO A;  3NEL A;  5C4J H;  1Z47 A;  5JJL A;  3J7A 5;  1HH2 P;  1MIU A;  3FHW A;  4X62 L;  5AJ3 Q;  1HNX Q;  3D0F A;  3NBH B;  4GNX B;  1RIP A;  4A3J H;  1S3O A;  3HKS A;  3ZJY C;  3F1Z A;  2R93 H;  2MFI A;  4YWK A;  1VQA A;  1YHB A;  2BA0 A;  2DGY A;  2VW9 A;  1R9T H;  3I55 A;  1TWA H;  4LFC Q;  1VQ6 A;  3RN2 A;  3GTM H;  5M5X H;  4BBS H;  1YHA A;  4A93 G;  3H0G H;  3W1B A;  1VQG A;  5C4X H;  5IWA L;  1J5E L;  2JA9 A;  2UUA Q;  4GKJ L;  1G29 1;  4A3K G;  4JC0 A;  3GTQ H;  1KXL A;  3M4P A;  1PH2 A;  4JI2 L;  5ELO A;  2OTL A;  3AFP A;  1L2F A;  3HOW H;  1LM0 A;  3KYH C;  5LMU Q;  3KJP A;  4JI4 Q;  1MKH A;  4LF6 Q;  2JA8 G;  3HOW G;  5LMN Q;  3TEH B;  4BBR H;  1CSP A;  1D8L A;  2YTV A;  2NVT H;  3H3V H;  5JEA G;  4A3E G;  2ZJQ A;  4GLV B;  3PF5 A;  4IPC A;  1K8G A;  1SLJ A;  3CP0 A;  4BY7 H;  4A3I G;  1IXR A;  4EQ5 A;  4B3M L;  2A19 A;  5IE8 A;  1HZ9 A;  3ERS X;  4DK3 C;  2N49 A;  2R92 H;  2NZH A;  4DR2 L;  1YBY A;  1PH1 A;  4X62 Q;  3F8T A;  4A3B G;  2K4K A;  4YCW A;  1BBU A;  3NEN A;  4AQY L;  2ID0 A;  5FLM H;  4YHH L;  1OXV A;  3PO2 H;  1U5K A;  2F52 A;  1YIT A;  4A76 A;  1B7Y B;  5FLX c;  2Q2H A;  4QQB X;  5C3E G;  1WI5 A;  2RCN A;  3HFZ B;  2AHO B;  3KLW A;  4AYB G;  3J81 c;  1VQ4 A;  4DUZ L;  1J5E Q;  1VQ5 A;  1OTC A;  5JEA J;  4GKJ Q;  2RF4 A;  4JI7 L;  4LF5 L;  4JI2 Q;  1QUQ A;  3W5O A;  1PFS A;  5ELN A;  3UE1 A;  1K73 C;  1L1O C;  4DUY L;  4A3D H;  3K7U C;  2EIF A;  1VQI A;  2L15 A;  4B3R Q;  4Y52 H;  2CWA A;  3CC7 A;  2H5X A;  4HIK A;  1C9O A;  4R4O A;  4AYB E;  1V9P A;  1KRT A;  3KDF A;  4KLK A;  4YCU A;  1AE2 A;  3AQQ A;  1WCM G;  3J80 c;  2E2H H;  1I5F A;  1PYS B;  1UWV A;  1WOC A;  4PZ8 A;  4QIW E;  5FJ8 H;  3NEM A;  3AFQ A;  4P75 A;  1GM5 A;  2JA6 H;  2NVQ H;  4A3C G;  4PMW A;  4JI5 L;  4DR2 Q;  2PI2 A;  4A75 A;  2NN6 I;  4A4I A;  2VZA A;  3BU2 A;  4MNO A;  4GNX C;  4NPS A;  4AQY Q;  1PV4 A;  4WJ3 M;  1HZC A;  2QGQ A;  4YHH Q;  2Q2I A;  4NXM L;  5C44 G;  5GQO A;  1JJC B;  3AEV A;  1PH5 A;  4MTN A;  5BR8 L;  3G6E A;  1IBK Q;  3STB C;  2R7Z H;  1E7Z A;  3OYY A;  3M4O H;  1YI2 A;  2V1C C;  4JI7 Q;  2C35 B;  1VQP A;  2CKZ B;  1VQD A;  4NB3 A;  4RG1 A;  2WAQ E;  3HKZ E;  4DPG A;  5IP7 H;  4HJ5 A;  1KIX A;  1EFW A;  1Q81 C;  1SRU A;  2Z6K C;  2Y0S E;  2I5H A;  3HOX H;  4PZ6 A;  4DUY Q;  4LF9 Q;  2CQO A;  3BZK A;  3L7Z C;  4DV2 L;  3I2Z A;  4LUZ A;  1QVF A;  1VQ7 A;  4L5Q A;  5J3B A;  1X65 A;  4DR6 Q;  1VQJ A;  2XGT A;  1X3F A;  1O7I A;  2OQK A;  1M1K C;  1Y1V G;  4LUV A;  4ALP A;  3I4O A;  1YEZ A;  4PG3 A;  3T1Y L;  1VQ9 A;  4DR7 Q;  4O0A A;  2I5M X;  3KOJ A;  4JI5 Q;  4IPH A;  3CC4 A;  5IP9 H;  2CCZ A;  4UP9 A;  1FGU A;  1Q1E A;  2R6G A;  4IJH A;  1Q8K A;  3JC6 6;  4UP7 A;  4YY3 L;  1IL2 A;  3HOZ G;  2PI2 E;  3KF6 A;  4POF A;  4DR6 L;  3PUV A;  4A3F G;  1VS0 A;  3RLF A;  2E5L L;  4A3G H;  4UP8 A;  5BR8 Q;  1SE8 A;  3CPF A;  4FDB A;  1VQO A;  2JK8 A;  3EIV A;  3AYH B;  3UDX A;  1K8A C;  2ATW A;  4RMF A;  5C0X G;  3S2D H;  4XTC S;  2OQ0 A;  3CCU A;  4QY7 A;  2YYZ A;  1N36 L;  1YZ6 A;  2UU9 L;  4Y7N H;  1CUK A;  5H1S E;  3A74 A;  3Q8D A;  4JOI C;  3CW2 C;  3EBE A;  4DV3 L;  2UXB Q;  4IOC A;  4GOP C;  1JE5 A;  4DV2 Q;  4OWW B;  1UEB A;  1V43 A;  2PQA B;  2UUB L;  1YVC A;  1BKB A;  1WFQ A;  4JI0 L;  3MXN B;  3T1H L;  4BY1 H;  1JB7 A;  3CMA A;  3I4N G;  1QUQ B;  4JBW A;  1TWG H;  1QVG A;  3KF8 B;  1VCI A;  5M5W H;  1UE6 A;  2LSS A;  1IBL Q;  1NBW A;  3T1Y Q;  4A3L G;  2F4V L;  4IO9 A;  1X55 A;  4QL5 A;  3PIO A;  4L5T A;  1ASY A;  1UE7 A;  3RNU A;  2KBN A;  3GTK H;  2D0O A;  4R4T A;  4YY3 Q;  3KDF B;  2KHJ A;  1X9N A;  1VQC A;  5C0X J;  2KCM A;  4DV6 L;  4KHZ A;  4R4Q A;  1XNQ L;  2E5L Q;  4A93 H;  5C0X I;  4APV A;  3HOV H;  2NZO A;  3HOU H;  1KC8 C;  2Q2T A;  5IYD G;  2HHH L;  3UDG A;  2UU9 Q;  1B70 B;  5IYB G;  4POG A;  1T9H A;  3J80 i;  3OW2 A;  1C0A A;  4O2D A;  3S1R H;  4DV3 Q;  2AWN A;  2GVB A;  2NVY H;  2BH2 A;  4UPA A;  4EX5 A;  3S15 H;  2UUB Q;  4HIO A;  1OXS C;  3PF4 A;  4JYA Q;  2UXC Q;  3T1H Q;  1KAW A;  3KFU A;  4DV5 L;  3PUZ A;  5GAD C;  1Q86 C;  3A0J A;  5M3M G;  5IT9 c;  2Q2U A;  2WB1 G;  2YTX A;  3CCR A;  1W2B A;  1KQS A;  1V1Q A;  4B3T L;  2F4V Q;  4JV5 L;  5IY0 A;  4DR1 L;  1IBM L;  4OX9 L;  5DLQ E;  4LFB L;  3RLN A;  4B3S Q;  3HOY G;  3GTG H;  4A3K H;  3M4Q A;  4X64 L;  5HY6 A;  3FP9 A;  2E8G A;  2Z0S A;  4DV6 Q;  1JMC A;  1G6P A;  3LGJ A;  3S1Q H;  1C7Y A;  1XNQ Q;  2HQL A;  4H02 A;  1EOV A;  4DNI A;  1SMX A;  1RL2 A;  2JQO A;  2WB1 E;  1I94 L;  1HR0 W;  1EUJ A;  2NN6 G;  3U50 C;  3BZC A;  2JA5 G;  4A3E H;  3CCL A;  3I4M G;  1MJC A;  2I5L X;  2HHH Q;  1G51 A;  2JEB I;  2B63 G;  1Q7Y C;  2MNA A;  3CCJ A;  3MEF A;  4A3I H;  1QVC A;  5IWA Q;  1XPU A;  2ZTE A;  3RN5 A;  1W3S A;  4A3B H;  1VQE A;  1GVP A;  4LF4 L;  4DR4 L;  3S17 H;  2R7D A;  5K36 G;  2N3S A;  2KHI A;  2VY3 A;  1SR3 A;  3D31 A;  4C3J H;  1YIJ A;  1CKO A;  1FJG Q;  1XTD A;  3H3V I;  4DKA C;  4B3T Q;  4JV5 Q;  2AKW B;  1Y1W G;  5C3E H;  1IBM Q;  4OX9 Q;  1SRO A;  1CKN A;  3PO3 H;  4B3M Q;  2VUM G;  4LFB Q;  4JBK A;  1D7Q A;  2K5V A;  1EWI A;  4X64 Q;  2EQS A;  2VNU D;  1PYB A;  4IJL A;  1VQL A;  1QZH A;  1PHJ A;  4X6A H;  1A0I A;  2IHF A;  4P74 A;  1L1O A;  2K52 A;  1I94 Q;  2I0Q A;  4JG2 A;  4DR3 L;  4C3H H;  2ZM6 L;  1HZB A;  2GN5 A;  3CXC A;  1PVO A;  1X54 A;  2FXQ A;  4IPD A;  3H15 A;  1WCM H;  4JI3 L;  1IYJ B;  1HNZ L;  4GN5 A;  4DUZ Q;  1KD1 C;  1Y14 B;  4LF5 Q;  4A3C H;  2HIV A;  3K0X A;  4LF4 Q;  4DR4 Q;  3TS2 A;  3SGI A;  3CD6 A;  2ASB A;  2YV5 A;  4GNX A;  2JA7 H;  1WJJ A;  5C44 H;  3TS0 A;  1PH3 A;  1VQN A;  3PCO B;  5M3F G;  3CCM A;  4JBM A;  3PGZ A;  4X66 L;  4HID A;  4LFA L;  3W1G A;  3CCS A;  3DM3 A;  4BA1 I;  2K14 A;  4JCV E;  2LXJ A;  1X6O A;  3CPW A;  4A3M G;  1PH6 A;  1EIY B;  2F3I A;  2Z6K A;  1NE3 A;  1P8L A;  2IT1 A;  1LUZ A;  2PMZ E;  1IZ6 A;  2JJQ A;  3DLL A;  1L0W A;  1X56 A;  5IYC G;  4MZ9 A;  2K5N A;  4DR3 Q;  1XMQ L;  4NXM Q;  1BVS A;  2ZM6 Q;  1UE5 A;  1FJG L;  1YHQ A;  4TVA B;  2VQE L;  4WJ4 A;  1KHI A;  3S1M H;  1Y1V H;  4JI3 Q;  2B3G A;  1HNZ Q;  4ME3 A;  2B29 A;  4OXP A;  1YJ9 A;  2CWP A;  3E0E A;  3L0O A;  2K50 A;  1X3G A;  3HOZ H;  4DAY B;  1TXY A;  2ES2 A;  2UXB L;  1GD7 A;  2MQH A;  4X65 L;  4A3F H;  1XNR L;  4DR5 L;  2IY5 B;  4QJF A;  3PUW A;  3CF5 A;  4YCV A;  3CCV A;  2QA4 A;  4JI8 L;  4DV1 L;  4AH6 A;  2AMC B;  3FKI G;  1XPO A;  1JJG A;  5AJ3 L;  1HZA A;  4X66 Q;  4P72 A;  4LFA Q;  2MO1 A;  4HIM A;  1J6Q A;  2OCE A;  2RHQ B;  3GTL H;  4BXX G;  4PZ7 A;  4YWL A;  4LW1 A;  1Z9F A;  2K5H A;  3S1N H;  1BBW A;  1KRS A;  2VS1 A;  4JOI A;  3CAM A;  3ULJ A;  4YWM A;  2DUD A;  4GOP A;  4IFD G;  1CKN B;  1NTG A;  1NMG A;  3M9B A;  1EIF A;  4R4C A;  3CC2 A;  3ICE A;  2VQE Q;  1E22 A;  1HNW L;  3I4N H;  4GKK L;  4HJ7 A;  1I6H H;  2BA1 A;  1K3R A;  4LWC A;  1L1O B;  4JBJ A;  4A3J G;  1N34 L;  1N36 Q;  4A3L H;  1N32 L;  5JJK A;  1TWF H;  4KHP L;  2R93 G;  1SN8 A;  4P73 A;  1B8A A;  1U0L A;  3J81 j;  3PIP A;  3OTO L;  4DAM A;  4C3I H;  3M7N A;  4BBS G;  4X65 Q;  1XNR Q;  3JAM i;  3ULP A;  3H0G G;  4DR5 Q;  1LYL A;  1WYD A;  4GN4 B;  4HJ9 A;  3GTP H;  2IX0 A;  4JI0 Q;  4J15 A;  1HR0 L;  4K0K L;  3B6Y A;  4NXN L;  1PH8 A;  4LF8 L;  3UDF A;  1X3E A;  4JI8 Q;  1N9W A;  4DV1 Q;  1FVI A;  3F2C A;  5IYD H;  2N8N A;  4QGU A;  4HJA A;  2OWO A;  4IFD J;  4IPG A;  5IYB H;  4BBR G;  5LMN W;  2UUC L;  1CKM A;  4IFD I;  3S16 H;  2D62 A;  2YTY A;  1CSQ A;  3ER0 A;  4BY7 G;  3E9I A;  1OXU A;  2R7F A;  2ZTC A;  4XIG S;  2MO0 A;  1OXX K;  1PA6 A;  2IX1 A;  1HNW Q;  2R92 G;  4GKK Q;  3S24 A;  1PH7 A;  1Q12 A;  4LUO A;  1VQH A;  4B3R L;  3K81 C;  5M3M H;  5FLM G;  3KF6 B;  1N32 Q;  1N34 Q;  5C4X G;  3PO2 G;  2JE6 I;  2E2J H;  1E24 A;  4KHP Q;  1FL0 A;  3HOY H;  1A62 A;  3ULL A;  3OTO Q;  3KJO A;  2VQF L;  3K7A H;  4OWX B;  4DV7 L;  3E9H A;  3I56 A;  1TWC H;  4K0K Q;  4R1J A;  1JJ2 A;  1HR0 Q;  4LF8 Q;  1AE3 A;  1Q1B A;  4NXN Q;  2JA8 H;  2N78 A;  4DV5 Q;  2JA5 H;  3I4M H;  2XTI A;  3F2B A;  5JJI A;  4GN3 B;  5EAY A;  2B63 H;  4A3D G;  2D0P A;  4TQU S;  1XMO L;  1LTL A;  4OON A;  2E2I H;  2UUC Q;  4DR1 Q;  1A8V A;  2KEN A;  2K75 A;  1IBK L;  2JEA I;  1I50 H;  3M85 A;  3S2H H;  4KI0 A;  2WP8 J;  5HGQ A;  5GAE C;  2PQA A;  3JAM c;  4L5S A;  2BH8 A;  4DV0 L;  3PO3 G;  3WWV A;  5FJ8 G;  2RHS B;  2JA6 G;  3GDE A;  1AH9 A;  2A1A A;  3GO5 A;  4LNQ A;  1S72 A;  1SFO H;  3G71 A;  4GLA C;  4LF9 L;  1DGS A;  1K83 H;  5GAG C;  3F2D A;  3CME A;  1Y1W H;  4GOP B;  3I7F A;  1VQB A;  2VUM H;  4IOA A;  2IHE A;  5M5Y H;  2VQF Q;  1EYG A;  2R7Z G;  2HT1 A;  3TQY A;  1NY4 A; 
#chains in the Genus database with same CATH topology
 4DV7 Q;  2NTT A;  3BJU A;  2GVA A;  1Q46 A;  1TWC B;  1LTT D;  1HA5 A;  2RSN A;  1NMF A;  3STB D;  3K8A A;  1F9R A;  2B63 B;  1SNC A;  4PV1 C;  4HCE A;  1KDC A;  2NVX H;  1WTR A;  3GD7 A;  4RHR A;  1MI2 A;  1FD7 D;  4K5X A;  4DV0 Q;  1N33 L;  2EJM A;  2WIN B;  1QNK A;  2WAC A;  2OT2 A;  4DK1 A;  5E4X A;  3T53 B;  1NR4 A;  4A3D B;  1HPC A;  3VR6 A;  2PPB C;  4IUQ A;  2BOS A;  4DF7 A;  1AEX A;  3K57 A;  1E3P A;  5IYC H;  3QG1 A;  2EE1 A;  3DEP A;  2A68 D;  2O5J C;  2KUM A;  1F77 A;  1VQ8 A;  2FMM A;  1WTQ A;  4PMC A;  2LXK A;  3O13 A;  4UY8 C;  1KL9 A;  3FEW X;  3A5Z B;  1TQO A;  4CKB A;  1PLF A;  4LFC L;  4PMB A;  1K9M C;  2EJG C;  3ERO A;  4ZKC B;  5C5M A;  3CQZ H;  3C46 A;  2WII B;  4IZ8 A;  2K05 A;  4JI4 L;  3QJY A;  1P16 A;  5LMN L;  2F0K A;  1C8C A;  2LFN A;  3M3Y H;  5GRO A;  2F0M A;  4U68 A;  3U58 A;  2Q8I B;  4XQQ A;  4XT1 B;  1VQK A;  2PNH A;  3U4V A;  2YU9 B;  1GO3 E;  4B3S L;  2VL6 A;  4DV4 Q;  2DN8 A;  2OTJ A;  2F0O A;  1I3Q B;  1Z47 A;  1HH2 P;  4X62 L;  4NKL A;  5AJ3 Q;  2P5Z X;  1RIP A;  3ZJY C;  5HGT A;  3F1Z A;  2Z4H A;  5JPN C;  4G7Z C;  1YHB A;  1R9T H;  1YHA A;  3W1B A;  1HCZ A;  1VQG A;  5E1F A;  2UUA Q;  4GKJ L;  4A3K G;  1DD2 A;  2CH4 W;  1KXL A;  4JI2 L;  2DJF C;  2OTL A;  1L2F A;  4K2L A;  1GUO A;  4F87 A;  3TEH B;  2YTV A;  1H9S B;  4QUC A;  3H3V H;  2ZJQ A;  4GLV B;  3PF5 A;  1I6V C;  4K2K A;  1QIL A;  3CP0 A;  4BY7 H;  2KQ3 A;  1IXR A;  1D1K A;  2CQA A;  4DU9 A;  1WTP A;  1HZ9 A;  4A3B G;  4DR2 L;  1EZ8 A;  1FNU A;  3PQI A;  4I65 A;  4AQY L;  3PO2 H;  1IHZ A;  5I6W A;  4C3J G;  1WTX A;  4A76 A;  3A7L A;  5FLX c;  4JI7 L;  2RCN A;  1SE2 A;  2WV6 D;  4FP5 D;  5C4X B;  3MXN A;  5JEA J;  5HUR A;  5LHY 1;  1ML0 D;  1AN8 A;  3W5O A;  3ND9 A;  3DMU A;  3EVQ A;  3UE1 A;  2F0I A;  3DWP A;  3K7U C;  2L15 A;  3W3A A;  5A35 A;  2NVT B;  1C9O A;  1KNE A;  4XQN A;  1AP0 A;  1EFI D;  1KRT A;  3T13 A;  2A6E D;  1PYS B;  5FJ8 H;  2NVQ H;  4PMW A;  2R92 B;  5I9O A;  1CHP D;  2B2W A;  2VZA A;  4NPS A;  2QGQ A;  2G5D A;  4NXM L;  1JWM D;  4KY5 A;  1PH5 A;  3R93 A;  3G6E A;  1MHW C;  2OEO A;  3M4O H;  2C35 B;  2CKZ B;  3PIO 3;  2EXZ A;  2WAQ E;  1KIX A;  1EFW A;  1Q81 C;  2Y0S E;  2BE5 D;  1U4L A;  4DUY Q;  4LF9 Q;  2KEC A;  1EY9 A;  4KD3 A;  5DM7 3;  4LUZ A;  4KD4 A;  1HRJ A;  1QVF A;  2DY8 A;  1B1Z A;  1X65 A;  2VB2 X;  3E3X A;  3MWY W;  2L9H A;  1VQJ A;  2XGT A;  4DR6 Q;  3IFT A;  4LUV A;  4ALP A;  2E2H B;  3N52 A;  4DR7 Q;  2JA6 B;  1EY5 A;  2I5M X;  1PRT C;  3KOJ A;  2ZXO A;  3NBI A;  2PI2 E;  2HCC A;  1NCV A;  4POF A;  4A3F G;  4OEL B;  1A3T A;  5BR8 Q;  2X6G A;  1EYD A;  5C0X G;  2L4N A;  4XTC S;  4QY7 A;  2UU9 L;  3WOF A;  1EEF D;  5CYU A;  4RKL A;  4DV3 L;  5ELF A;  4GOP C;  3HKZ B;  2JA7 B;  3H3V C;  2XNA C;  2PQA B;  1X32 A;  2R3Z A;  2L5T A;  2ZXP A;  2A5H A;  1JB7 A;  1QUQ B;  1TWG H;  1VCI A;  5J39 A;  5A2Q E;  2QKI C;  2LSS A;  1NBW A;  2K7V A;  3TBI B;  3J81 E;  4A3L G;  4QL5 A;  3C3L A;  3GTK H;  4YY3 Q;  2RSO A;  1VQC A;  4C3I G;  2KCM A;  2F0D A;  1XNQ L;  1IYU A;  3BDC A;  4A3G B;  4APV A;  2VB3 X;  2B8F A;  2NZO A;  1STB A;  2HHH L;  3H6M A;  3OIP A;  4FYD A;  4O2D A;  2AWN A;  3BZD B;  4HIO A;  3PF4 A;  1RCV D;  3Q6S A;  1PZK D;  3IAY A;  3VR2 A;  1KAW A;  3KFU A;  2EVB A;  2MGS A;  3A8J E;  5I2Y A;  4FF3 A;  3PUZ A;  5M5W B;  4FXG C;  1W2B A;  5IY0 A;  1IBM L;  4LFB L;  4HSP A;  4A3K H;  5HY6 A;  2Z0S A;  1JMC A;  3LGJ A;  4OGQ C;  4H02 A;  1VQ9 A;  1RL2 A;  3NUC A;  1PFB A;  1V1O A;  2JQO A;  2NN6 G;  1I94 L;  1HR0 W;  5FO7 B;  2I5L X;  2PZT A;  2B63 G;  4DAY A;  3MEF A;  3MC0 B;  4TSS A;  2NZ1 D;  2NVY B;  4A3B H;  4BS9 A;  5KYL A;  1SNM A;  3OMG A;  1LT6 D;  1SR3 A;  4J1M A;  3D31 A;  4C3J H;  3H3V I;  1CKO A;  2R61 A;  1FJG Q;  4FO2 A;  4ZRZ A;  1SNO A;  3PO3 H;  1D7Q A;  1QE6 A;  4RGM A;  1PYB A;  1BCP F;  2JA8 B;  1SYC A;  4JG2 A;  3CRK C;  4A3E B;  3TDQ A;  2GN5 A;  2MPM A;  2FXQ A;  3I73 A;  4A3I B;  1IYJ B;  3KLR A;  1HNZ L;  1TS5 A;  1CZG A;  4LF5 Q;  2RDF A;  4LF4 Q;  3S17 B;  2GA4 B;  3NBH A;  1WJJ A;  1W6J A;  1VQN A;  4F8M A;  4ABN A;  3CRL C;  2J0T D;  2RDH A;  1QWY A;  3CCM A;  4JBM A;  1WTH A;  3PGZ A;  2QDB A;  4X66 L;  3CCS A;  1JC7 A;  1V1P B;  2LXJ A;  3CPW A;  4A3M G;  2F3I A;  4XDX A;  2IT1 A;  3DLL A;  3BVZ A;  1YHQ A;  3K5L A;  1ENC A;  1CHQ D;  4JI3 Q;  1WCM B;  2B3G A;  5FKA C;  3MEH A;  3L0O A;  3A7A B;  5CC4 A;  2D2C C;  4A3F H;  1LT4 D;  2IW3 A;  2PW7 A;  3DHQ A;  5EQ0 A;  3NWS A;  4DV1 L;  2F0G A;  4AH6 A;  4GZY C;  3KUP A;  5IGE A;  5C0X H;  4RA8 A;  1HZA A;  5AFW A;  1D6E C;  4LW1 A;  1HTL D;  1Z9F A;  4L8J A;  2B2V C;  2EZV A;  1CT1 D;  2DUD A;  4GOP A;  4IFD G;  4QMG A;  1EIF A;  3HGB A;  3ICE A;  1YNN D;  5I4D A;  2VQE Q;  2PMZ B;  4HJ7 A;  4G4K A;  3S1M B;  1K3R A;  1N36 Q;  1EY0 A;  4A3L H;  1N32 L;  1LO5 D;  4FVM A;  5JJK A;  3QWN A;  3C1E A;  1B8A A;  5F2D A;  3PIP A;  2N88 A;  4C3I H;  3HOZ B;  5JPM C;  1WYD A;  5C4X G;  1STG A;  4WJW A;  1HR0 L;  4XQJ A;  1X3E A;  4JI8 Q;  4QB4 A;  4QGU A;  2F0W A;  1FGB D;  2B39 A;  3QO2 A;  4HJA A;  5FO9 B;  2OWO A;  1CA6 A;  3S1N B;  1WTW A;  2K1B A;  3ER0 A;  2EY6 A;  2EY2 A;  2Z8L A;  3G7L A;  5CR3 A;  1HNW Q;  2L55 A;  1PTO D;  4EQP A;  2R92 G;  4GKK Q;  1PH7 A;  3I4N B;  4LUO A;  2NB0 A;  1YNJ D;  5G3L F;  1CQV A;  5FLM G;  3KF6 B;  2JE6 I;  1AW7 A;  4XT3 B;  3OTO Q;  1JCK B;  4DXF A;  1SYE A;  3GTP B;  3E9H A;  3I56 A;  1TWC H;  4K0K Q;  2JSO A;  2RA4 A;  4LF8 Q;  1Q1B A;  4NXN Q;  2NN6 H;  2N78 A;  4DV5 Q;  4FF2 A;  4KN7 C;  2XTI A;  5JJI A;  2B63 H;  2D0P A;  1LTL A;  2UUC Q;  4UHV A;  4C56 C;  1O80 A;  5LL6 S;  1IBK L;  5COR A;  3M85 A;  3D6W A;  3S16 B;  3GTM B;  2NTS A;  3LWE A;  2JA6 G;  3GDE A;  3GTQ B;  4I7Z C;  4LNQ A;  1S72 A;  3G71 A;  5ELE A;  5M3M B;  2WB1 B;  3LX0 A;  2B2Y A;  2E2J B;  1VQB A;  1S5F D;  3HOY B;  1EYG A;  2BDN A;  1ICW A;  4CHT B;  3TRZ A;  4DNT B;  4WOR A;  1X3Q A;  1D1I A;  1VQF A;  3HOX G;  1TS4 A;  3I4M B;  1BDO A;  2A6H C;  2UXD L;  4K6D A;  1XMO Q;  3HKZ G;  1ENF A;  1E1O A;  2JA7 G;  1RHP A;  2F0T A;  4X3K A;  3G4S A;  1I50 B;  3S2H B;  4HSV A;  4S3S A;  1YJW A;  4R4I A;  4LF7 L;  3RR5 A;  3BDL A;  4OO1 G;  5BN4 A;  1K0S A;  1QG7 A;  4HJ8 A;  3FPU B;  4MHE A;  1Y1W B;  4ZUI A;  4A3G G;  1DOL A;  5M5Y B;  4A3M H;  4OWT B;  1QZG A;  1TR5 A;  2HIX A;  1PTO B;  1IBL L;  1B9M A;  4IN3 A;  4JI6 L;  2YU9 H;  1PH9 A;  1UNS A;  3RZD B;  1O7L A;  3OOC A;  2XN9 C;  3TZU A;  1I3Q H;  4M1U B;  1NJI C;  3PSI A;  3WDN A;  1HNX L;  3ERQ A;  1B44 D;  1R4P B;  4CKC A;  2ZJP A;  1VQM A;  3NTK A;  1N33 Q;  3RZO B;  3R2T A;  1ZXT A;  3KLS X;  1DON A;  3A5U A;  1PFN A;  3VDY A;  3MAQ A;  4CDE C;  1BXT A;  3HG9 A;  4JYA L;  3FRP B;  1Q82 C;  2QCP X;  4AIM A;  3JAM E;  3T4A C;  1G2S A;  1UE1 A;  2B2V A;  4V0B A;  4BA2 I;  4IFD H;  4DAV A;  4ZQ3 A;  4CGY B;  2WFW A;  4HMI A;  3RLO A;  4Z9C B;  1FR3 A;  3X3N A;  4GNX B;  1BQQ T;  3L3O C;  3HKS A;  4CJ1 B;  1VQA A;  2ZXR A;  2DGY A;  4LFC Q;  1TWH B;  1VQ6 A;  3I55 A;  3RN2 A;  1CTM A;  4Y7N B;  5C4X H;  3VA7 A;  3IL8 A;  5C3X A;  4RHS A;  1G29 1;  3M4P A;  1PH2 A;  3AFP A;  3FKI B;  4JI4 Q;  3J80 L;  1MKH A;  2JA8 G;  5LMN Q;  3MHB A;  2NVT H;  1D8L A;  3S14 B;  4N8X 1;  4A3E G;  4UDU C;  4PNY A;  3TN2 A;  4K8I A;  1SLJ A;  1EZ6 A;  3TSS A;  4A3I G;  1LAB A;  5IIF A;  5IE8 A;  1EY7 A;  3ERS X;  3MTS A;  2R92 H;  2NZH A;  1PH1 A;  1YBY A;  4X62 Q;  3NEN A;  5FLM H;  4CDF C;  4A3J B;  1U5K A;  1ONL A;  5ELD A;  1L0Y B;  3BG3 A;  1TWA B;  2IL8 A;  4BBS B;  5M5X B;  5CMD A;  1WI5 A;  2F0L A;  3H0G B;  5IGF A;  2LS0 1;  1VQ5 A;  3J81 c;  4DUZ L;  3OW7 A;  3MXG A;  2RF4 A;  4GKJ Q;  3G6J B;  3MZ5 A;  4JI2 Q;  1PFS A;  2L1B A;  1K73 C;  4B9W A;  1L1O C;  5JAV A;  1VQI A;  2FIN B;  2H5X A;  4HIK A;  3A56 A;  4R4O A;  3VR4 A;  4KKS A;  4R9W A;  1RF2 D;  1FNW A;  1T5X D;  1WCM G;  2E2H H;  1I5F A;  1H9R A;  1L0X B;  4QIW E;  3NEM A;  3AFQ A;  2JA6 H;  1PRT F;  3CHB D;  4DR2 Q;  2PI2 A;  4PQX A;  2NN6 I;  3BU2 A;  1PV4 A;  4AQY Q;  1LTS D;  5C44 G;  2PQE A;  3AEV A;  1XXG A;  3STB C;  3OYY A;  1XX8 A;  1YI2 A;  2V1C C;  4JI7 Q;  4FXK C;  2F1M A;  4RG1 A;  4HJ5 A;  3HOX H;  2I5H A;  1HA6 A;  3L7Z C;  3I2Z A;  1EQV A;  2CH4 A;  2SDF A;  4IUV A;  3D6C A;  2OQK A;  1IW7 D;  3EA6 A;  1H9M A;  3BDO A;  5CV6 A;  4O1N A;  3SK4 A;  4XYQ A;  4OO1 H;  3T1Y L;  4IPH A;  2Z1C A;  1O7Z A;  1FGU A;  1IL2 A;  3JC6 6;  3HOZ G;  1GHJ A;  1VS0 A;  2E5L L;  4A3G H;  2A68 C;  1SE8 A;  3CPF A;  1U9R A;  4FDB A;  2JK8 A;  3VA5 A;  3UDX A;  1VQO A;  1NUC A;  1RKN A;  1EWC A;  4WFN 3;  2YYZ A;  1VF7 A;  5H1S E;  4HN7 A;  4JOI C;  3CW2 C;  1LTA D;  1WVL A;  3AU7 A;  1EYA A;  1EY8 A;  2HUG A;  2DJG C;  1BKB A;  1F2M A;  1WFQ A;  3Q0A A;  3MXN B;  2NBF A;  3I4N G;  4JBW A;  4DAP A;  2D5D A;  3OIQ A;  3OPO A;  5M5W H;  1D5M C;  1KDB A;  1S5B D;  3PIO A;  4L5T A;  1ASY A;  5KEE A;  2XSC A;  2EYO A;  2D9U A;  2NYZ D;  5C0X J;  1BF4 A;  2DNE A;  1JB3 A;  3GV6 A;  2HDM A;  2KJX A;  3MFG A;  2Q2T A;  4ZCK A;  3S2D B;  3DXJ C;  5IOD A;  2A69 C;  2UU9 Q;  3OW2 A;  3J80 i;  1C0A A;  4KKU A;  4KY6 A;  4DV3 Q;  2NVY H;  2H4O A;  1A2U A;  3M4Y A;  2UXC Q;  3HP3 A;  2Z6B A;  4C1N K;  5C4Z A;  4K5V A;  5GAD C;  4QQB X;  3VYS A;  5M3M G;  5IT9 c;  2VXW A;  2WB1 G;  1KQS A;  4JV5 L;  2RQX A;  4B3T L;  3C2P A;  3RLN A;  3NQT A;  3HOY G;  3M4Q A;  2E8G A;  1G6P A;  1BOS A;  1S5E D;  3S1Q H;  1C7Y A;  1XNQ Q;  3FDT A;  4N8F A;  2JA8 H;  1ILQ A;  2WB1 E;  2OF1 A;  4MIU A;  3U50 C;  3HOV B;  4A3E H;  3I4M G;  1K3B C;  2HHH Q;  2JEB I;  2MNA A;  4A3I H;  1QVC A;  1A3U A;  5IWA Q;  1SYB A;  1EQT A;  1CZW A;  3RN5 A;  4DR4 L;  3S17 H;  2CW0 D;  3S15 B;  1GHK A;  2EOT A;  5C6A A;  3R8B A;  3IFD A;  1YIJ A;  1WD1 A;  4DKA C;  2AKW B;  1Y1W G;  3A54 A;  1IBM Q;  4LFB Q;  4B3M Q;  2K5V A;  2F4I A;  1AZP A;  2EQS A;  5KGU A;  4L63 B;  4IJL A;  2A6E C;  1QZH A;  1PHJ A;  1A0I A;  4P74 A;  1L1O A;  1I94 Q;  2KA7 A;  3HOW B;  2IWH A;  2I0Q A;  5C5L A;  2PO4 A;  4F88 A;  5L37 A;  1PVO A;  4IPD A;  3H09 A;  1WCM H;  1QOH A;  2XWB B;  1TU2 B;  2K5Q A;  1Y14 B;  2EY1 A;  2E2D C;  4ZKB B;  2ASB A;  1UUP A;  3ZYY X;  5C44 H;  4J8Q A;  5T1G A;  4LJZ C;  3PCO B;  2K28 A;  2BE5 C;  5EBC A;  2XRQ D;  4DFA A;  4HID A;  4LFA L;  2F0F A;  3DM3 A;  2K14 A;  1NE3 A;  1HQR D;  2JJQ A;  1KTK A;  3TZD A;  4G57 A;  1PZJ D;  2Q8T A;  5K5P A;  1BVS A;  2K5W A;  3NP8 A;  2PCF B;  3V96 A;  4TVA B;  4RWS C;  3S1M H;  3QOL A;  1HNZ Q;  4OXP A;  2MUY A;  1M8A A;  2O2L D;  1XYI A;  2ENB A;  2G9H D;  3E0E A;  3NWT A;  3HOZ H;  4DAY B;  2ES2 A;  2UXB L;  1XNR L;  3MA2 B;  3X3M A;  3TP7 A;  3PUW A;  4RGN A;  1LV9 A;  1Y8N B;  3FKI G;  4ZYS A;  5AJ3 L;  5C4H A;  4X66 Q;  4V19 0;  4BXX G;  4HIM A;  1J6Q A;  4YWL A;  2K5H A;  2EYH A;  3S1N H;  1ET9 A;  3F2U A;  4JOI A;  4CDD C;  1SXT A;  1NTG A;  1NMG A;  4JK1 C;  4R4C A;  1E22 A;  3I4N H;  5CBA E;  2BA1 A;  2K32 A;  1RD9 D;  3N6R A;  4JBJ A;  4A3J G;  1N34 L;  5FO8 B;  1IL8 A;  1SN8 A;  1U0L A;  3V2T A;  4RGO S;  1WD0 A;  3M7N A;  4BBS G;  3GTP H;  3ULP A;  3H0G G;  1LYL A;  4GN4 B;  4JI0 Q;  4J15 A;  4KJN A;  4DV1 Q;  2M2L A;  1W6K A;  4IFD J;  2F03 A;  1SNP A;  1NR2 A;  5DAU A;  1VMP A;  3S16 H;  3NPP A;  2R7F A;  2ZTC A;  2MO0 A;  3E6Z X;  3P75 A;  1IKM A;  3S24 A;  3HRZ C;  1HFG A;  2X6L A;  5M3M H;  1O78 A;  1N32 Q;  2E2J H;  1TWF B;  4DGZ A;  1A62 A;  2TSS A;  3HOY H;  3RUZ A;  3OWE B;  5JVH 3;  2J4X A;  1HR0 Q;  1LTG D;  4IUR A;  2F0Q A;  4IUU A;  3I4M H;  3F2B A;  3KBG A;  1PRT B;  5EAY A;  1MSH A;  4A3D G;  4HCS A;  4KMU C;  2B2Y C;  2ZT9 C;  4TQU S;  1Y8P B;  3PMF A;  4DR1 Q;  2I07 B;  2O5I C;  1A8V A;  2K75 A;  3K5O A;  1I50 H;  3S2H H;  2WP8 J;  5GAE C;  2PQA A;  3JAM c;  3WWV A;  2OXP A;  2RKS A;  3QB3 A;  1AH9 A;  1C4Q A;  1EU3 A;  4LF9 L;  2DY7 A;  1SBB B;  2Q8R E;  3K5M A;  1Y1W H;  4GOP B;  4IOA A;  2IHE A;  4EGV A;  5M5Y H;  2EYM A;  1KAA A;  4DR6 L;  3K7A B;  5EGT A;  1PTO H;  4OIJ A;  5IP7 G;  4DR7 L;  4GLX A;  3RZD H;  2PNR C;  2QW7 A;  1SND A;  4RCO A;  1M90 C;  1N8R C;  4IUT A;  3CKI B;  4L5R C;  1LT5 D;  2ICE C;  2KVM A;  2SOB A;  1G2T A;  4HAE A;  4KTA A;  1STN A;  2AQ3 B;  2V4D A;  1HJP A;  3RZO H;  4DXG A;  1TY2 A;  1S4Z A;  3EN2 A;  3UE0 A;  2MP1 A;  1TT2 A;  1G8Z D;  3BYY B;  4JI1 L;  5IP9 G;  3L2P A;  4O42 A;  1Z6H A;  1Z7T A;  3GTJ H;  2I46 A;  3K80 C;  2VUM B;  2JYO A;  5J1Z A;  3CCE A;  1EQQ A;  1SEB D;  1JT8 A;  3FMC A;  4KJO A;  1Y69 U;  1DYQ A;  1B2T A;  1GUN A;  2UXD Q;  3PUX A;  4L6T B;  5IGD A;  3U9O A;  3UDI A;  1EQR A;  2EXD A;  1I4Q A;  4LF7 Q;  3HEJ A;  3RMH A;  1TWH H;  2KCT A;  3CCQ A;  5GAH C;  1XMQ Q;  4RGT A;  3EFX D;  5IT9 L;  2ZTD A;  5M3F B;  3FKI H;  3U4Z A;  1HFN A;  3PV0 A;  5LMU L;  1TS2 A;  1E1T A;  5CBE E;  4LF6 L;  3IRB A;  4BXX H;  1HUM A;  3S14 H;  3HOV G;  1H95 A;  1YNN C;  4DK6 C;  1PYW D;  4CJ2 C;  5FLX E;  1DOM A;  2SNS A;  3J7Z C;  2QEX A;  1XPR A;  1GUG A;  2MJ8 A;  2FFK B;  4JI6 Q;  1S40 A;  2AWO A;  2DNC A;  3J81 i;  1SYG A;  1J8I A;  5JJL A;  5FLX L;  3J7A 5;  3FHW A;  3GTO B;  2ICI A;  1HNX Q;  3D0F A;  4A3J H;  2EY5 A;  3GV3 A;  4TRD A;  2EYJ A;  4C2M B;  4FF1 A;  2BA0 A;  2VW9 A;  1TWA H;  1B9N A;  4BBS H;  5M5X H;  3H0G H;  1J5E L;  2JA9 A;  4OHJ A;  2IJ0 A;  1JQY D;  4JC0 A;  1LTI D;  2PW5 A;  1LM0 A;  3KYH C;  2JP1 A;  3HOW G;  1PTO C;  1DZ1 A;  1F9S A;  3K58 A;  1DOK A;  4ME5 A;  5C4J B;  4CDC C;  2K4K A;  4YCW A;  5C3W A;  1BBU A;  2ID0 A;  1ROD A;  4YHH L;  2R93 B;  3URY A;  3K59 A;  1YIT A;  1B7Y B;  5EKI A;  2BDO A;  1WTV A;  4KN4 C;  2HDL A;  3EQL C;  4LF5 L;  5KND A;  1DXM A;  3KF8 A;  4A3D H;  4B3R Q;  4Y52 H;  1JWS D;  4BBR B;  1ZYR D;  2KCN A;  1QCB D;  3KDF A;  4KLK A;  5JOB A;  4YCU A;  2F3W A;  3FPP A;  3D4W A;  4PZ8 A;  1WOC A;  1LTB D;  4P75 A;  3D8G A;  4JI5 L;  4A75 A;  4A4I A;  4MNO A;  4GNX C;  1STH A;  1F2Z A;  1HZC A;  3AMU A;  2Q2I A;  5E3F A;  4MTN A;  1E7Z A;  1MBY A;  2F0J A;  1STA A;  1VQP A;  1QB5 D;  4NB3 A;  5IP7 H;  3HKZ E;  4DPG A;  5J22 A;  3BVG A;  4A3B B;  2Z6K C;  2A6H D;  2CQO A;  4DV2 L;  1VQ7 A;  4L5Q A;  5J3B A;  1OO9 B;  1X3F A;  1XWE A;  3SVM A;  1M1K C;  1BCP D;  3PO3 B;  2F0S A;  3I4O A;  4PG3 A;  2JN4 A;  1S5C D;  4O0A A;  1Q8I A;  5IP9 H;  1GJX A;  4UP9 A;  1Q1E A;  2R6G A;  1Q8K A;  3KLS A;  3KF6 A;  5EKL A;  2QDL A;  3PUV A;  1JE4 A;  3P1H A;  3E5S A;  1K8A C;  1DJR D;  2R7Z B;  3EIV A;  3AYH B;  1M4V A;  1TKW B;  3S2D H;  1NNX A;  1N36 L;  5KIX A;  1CUK A;  2F0U A;  3A74 A;  3Q8D A;  3EBE A;  5ISR A;  5KRU A;  4OWW B;  2WAQ B;  1F2Y A;  1V43 A;  1EYC A;  4LK1 C;  2UUB L;  1YVC A;  1KLG D;  2Y0S B;  3SR1 A;  2WKD A;  3NHH A;  3T1H L;  1QVG A;  1UE6 A;  4G7H C;  3T1Y Q;  3RD4 A;  2F4V L;  1U4R A;  5CV7 A;  1UE7 A;  2KBN A;  4R4T A;  1PZI D;  4DV6 L;  4R4Q A;  2E5L Q;  5C0X I;  1HUN A;  3HOV H;  2FHT A;  3J80 E;  5EPJ A;  1B70 B;  1UAP A;  1T9H A;  3NK9 A;  2GVB A;  3S15 H;  1EIG A;  2F0H A;  5TSS A;  3SK6 A;  4BY1 B;  4DV5 L;  2L0C A;  3A0J A;  3CCR A;  1ENA A;  4OX9 L;  4KKT A;  5D3D A;  4B3S Q;  3GTL B;  3NE5 B;  4X64 L;  1CQF A;  3FP9 A;  3I72 A;  1D5X C;  1ESF A;  2HQL A;  3U9S A;  1EOV A;  3HOW H;  1I4X A;  1G6Z A;  1BCP B;  3WOE A;  3BZC A;  2QF7 A;  1B3A A;  3HOU B;  1G51 A;  4M8A A;  1EL0 A;  3Q24 A;  4HTH A;  4FNF A;  3S1R B;  2K01 A;  5FOB B;  1CI3 M;  2R7D A;  2N3S A;  1FYC A;  2B8G A;  1SMY C;  1TVX A;  2VY3 A;  4RFB A;  3W2D A;  5KYI A;  1XTD A;  1AZQ A;  2LY7 A;  4JV5 Q;  4B3T Q;  4A93 B;  3SHL A;  1SRO A;  1CKN A;  2VUM G;  3GTG B;  1VF5 C;  3TP5 A;  4X3S A;  1VQL A;  5G3L D;  4X6A H;  1KAB A;  2LKV A;  1SE3 A;  4DR3 L;  2JXM B;  1HZB A;  4LAA A;  2C9O A;  2ZM6 L;  3K5N A;  1X54 A;  1Q90 A;  3H15 A;  1EOT A;  4GN5 A;  3OSO A;  3R2I A;  2HIV A;  3K0X A;  4DR4 Q;  3SGI A;  4GNX A;  2JA7 H;  5D3I B;  3TS0 A;  1PH3 A;  3NXW A;  4ODG A;  1JOQ A;  4RH6 A;  2QEJ C;  5M3F G;  5C3E B;  3MXP A;  4AYB B;  1E2Z A;  3SDZ A;  3W1G A;  4KK7 A;  3SXH A;  2C5C A;  1X6O A;  1PH6 A;  2N55 A;  1IW7 C;  1B50 A;  2Z6K A;  1P8L A;  2G9D A;  1LUZ A;  2PMZ E;  2Z9H A;  4NXM Q;  3T16 A;  1L0W A;  4MZ9 A;  2K5N A;  3I4L A;  4C3H B;  1UE5 A;  1ZKO A;  4N9T A;  4WJ4 A;  4ME3 A;  4LMQ D;  1VDZ A;  3K0Y A;  1YJ9 A;  1GUW A;  1TXY A;  4DNR B;  2MQH A;  3R3O A;  4X65 L;  4DR5 L;  3OWF A;  4QJF A;  4YCV A;  3CCV A;  3BYT B;  2QA4 A;  1EEI D;  1SYF A;  3I8Z A;  4LFA Q;  2CVR A;  1I4H A;  1TII D;  1BBW A;  2HQE A;  2VS1 A;  3CAM A;  3ULJ A;  4K14 A;  3CC2 A;  1Y1V B;  1JOR A;  2K6A A;  2F0P A;  3K6O A;  1L1O B;  4XXE A;  1TWF H;  4KHP L;  1EIH A;  4A3M B;  2EPB A;  4P73 A;  5FK9 C;  2R93 G;  3I70 A;  1I4G A;  2UXB Q;  1SJE D;  3H91 A;  1XNR Q;  3JAM i;  1BNZ A;  1VMC A;  2IX0 A;  2QIL A;  3UDF A;  3HS0 C;  1SDF A;  1FVI A;  1ILP A;  2N8N A;  2A69 D;  1JOK A;  1TY0 A;  4BBR G;  4IQZ A;  4IFD I;  2D62 A;  2YTY A;  1NAP A;  1OXU A;  3E9I A;  4U67 3;  1PMR A;  1PA6 A;  3DM1 A;  1I6H B;  2KOL A;  1Q12 A;  1VQH A;  3K81 C;  4NP5 A;  1BO0 A;  1N34 Q;  1E24 A;  5I6Y A;  3DEO A;  3ULL A;  3KJO A;  5IGB A;  2VQF L;  3K7A H;  1GOZ A;  4MTK A;  4OWX B;  4DV7 L;  3Q22 A;  4R1J A;  1JJ2 A;  4JW0 A;  4G7O C;  4H0L C;  1JOO A;  4GN3 B;  3A55 A;  3ITP A;  2CW0 C;  1TS3 A;  5D14 A;  2JEA I;  2NUC A;  4KI0 A;  2J7Z A;  1HTP A;  4N9P A;  4DV0 L;  3PO3 G;  2RHS B;  1GUT A;  1UEA B;  2A1A A;  2KED A;  3F2D A;  5GAG C;  4ULL A;  5ELB A;  2VUM H;  1JWU D;  3CU7 A;  2R7Z G;  2HT1 A;  3TQY A;  3CMA A;  3A8K E;  1A2T A;  2K33 A;  3NTI A;  1GXD C;  1K8O A;  2JA5 B;  3TME A;  4GS3 A;  2WAQ G;  4OEM B;  1YJN A;  2E2I B;  3ND8 A;  2Y0S G;  4YIJ A;  1HQM C;  1H9S A;  2FJ2 A;  1EU4 A;  2RDG A;  2ZJR A;  3D4R A;  1SFO B;  1ASZ A;  2SNM A;  2EJF C;  5M3F H;  1K83 B;  1CA5 A;  5BN3 A;  1E2V A;  1SYD A;  2A8V A;  1D2B A;  1PRT D;  3MFY A;  4ZLT F;  5CV4 A;  4P71 A;  1MJE A;  3PUY A;  2TMP A;  1EY6 A;  2ALY B;  4EVO A;  1YNX A;  2A74 C;  4DV4 L;  1Q3L A;  1JIC A;  1A63 A;  3GTO H;  1OXT A;  1XJV A;  2NVX B;  3H94 A;  2CFM A;  5E7N A;  4NW2 A;  4BY1 G;  4KY7 A;  4OO1 I;  3G48 A;  4C2M H;  1GKH A;  3D4D A;  2NWG A;  3TRE A;  1I4P A;  5JJZ A;  1II3 A;  3DWQ A;  4JI1 Q;  1HXY D;  3SEB A;  3HOX B;  2UUA L;  1A6X A;  2RVL A;  4XYO A;  5CV8 A;  2UXC L;  1MGS A;  1PTO F;  3HOU G;  1B4O A;  3MVV A;  2XWJ B;  3M7G A;  4R8I A;  2XIW A;  1Y8O B;  1K0R A;  1PH4 A;  4I7A A;  4RCN A;  1SJH D;  3AB9 A;  3I3C A;  3NEL A;  5C4J H;  1K8M A;  1MIU A;  4CKE A;  5A2Q L;  1JR0 D;  2X69 A;  1V8Q A;  3NBH B;  1O7Y A;  3J81 L;  1S3O A;  3IKJ A;  2HCI A;  4EQO A;  2R93 H;  4KHV A;  4JVZ A;  2MFI A;  4YWK A;  4UAI A;  3VYU A;  2WKC A;  3GTM H;  4A93 G;  2PYK A;  4B9X A;  5IWA L;  1RDP D;  3CQZ B;  3GTQ H;  4K6L A;  2PZU A;  5ELO A;  1KDA A;  5LMU Q;  3KJP A;  2K5D A;  4LF6 Q;  4BBR H;  1CSP A;  1HHV A;  5JEA G;  3M3Y B;  4IPC A;  3T51 B;  1K8G A;  4IAL A;  4EQ5 A;  4B3M L;  2A19 A;  4WRD A;  4ZAI A;  4DK3 C;  2N49 A;  3QR8 A;  3F8T A;  1OXV A;  5BN5 A;  4R8N A;  5NUC A;  5DEH A;  4BWG B;  2F52 A;  2L11 A;  1X3P A;  2Q2H A;  1R9T B;  4DK0 A;  5C3E G;  1VQ4 A;  3DUZ A;  2FMC A;  2AHO B;  3HFZ B;  3KLW A;  4AYB G;  1J5E Q;  1G91 A;  1OTC A;  3MXU A;  1QUQ A;  5ELN A;  4NMZ A;  3KK7 A;  4DUY L;  2EIF A;  2AQ2 B;  2CWA A;  3CC7 A;  1STE A;  1J9O A;  4C3H G;  4AYB E;  1V9P A;  5T1I A;  1AE2 A;  2XVS A;  3AQQ A;  4BY7 B;  3J80 c;  3VYR A;  4WJ3 M;  1UWV A;  1GM5 A;  4A3C G;  2H1E A;  4IUP A;  2EDG A;  3S1Q B;  1EY4 A;  4YHH Q;  5GQO A;  1JJC B;  3PO2 B;  5BR8 L;  1IBK Q;  5CGK A;  2R7Z H;  2RBM A;  3KBX A;  3I90 A;  2M00 A;  1VQD A;  2E75 C;  3J7A F;  4K8J A;  1SRU A;  1DM0 B;  3GP7 A;  4PZ6 A;  3BZK A;  4OL7 A;  4Q0F A;  4X3T A;  5KNC A;  1LTR D;  3T56 B;  2B2T C;  3Q23 A;  1O7I A;  4ZK9 B;  1Y1V G;  4Q5V A;  1SE4 A;  1YEZ A;  5EBD A;  2NVQ B;  4JI5 Q;  4H44 C;  3CC4 A;  2CCZ A;  4IJH A;  4UP7 A;  4YY3 L;  2MHV A;  4QIW B;  3S9W A;  4DA2 A;  3RLF A;  4UP8 A;  3HZX A;  4EQN A;  2IX3 A;  2ATW A;  5IT9 E;  3SE0 A;  4RMF A;  3M4O B;  3CCU A;  2OQ0 A;  2E74 C;  1CM9 A;  1YZ6 A;  3TP6 A;  4Y7N H;  3GQB A;  2EYL A;  3A8I E;  4IOC A;  2B2U C;  1ET6 A;  4QF4 A;  1JE5 A;  4DV2 Q;  1UEB A;  5C44 B;  4JI0 L;  5D65 A;  4BY1 H;  2HD3 A;  3KF8 B;  4ID6 A;  5EJW A;  3TP8 A;  1IBL Q;  4IUN A;  3ONA B;  4IO9 A;  1X55 A;  4OIK A;  1D5Z C;  3RNU A;  3GTL H;  2D0O A;  1X9N A;  3KDF B;  2KHJ A;  4ZUJ A;  4KHZ A;  1WTO A;  1SNQ A;  4CBV A;  4E6I A;  2F3V A;  4H7B A;  3HOU H;  1KC8 C;  1C48 A;  5IYD G;  3UDG A;  5IYB G;  2SEB D;  4POG A;  2KCC A;  3S1R H;  2RCF A;  3BVM A;  2BH2 A;  4UPA A;  3SK8 A;  4EX5 A;  2UUB Q;  1I4R A;  1OXS C;  5DM6 3;  1FNV A;  4JYA Q;  3T1H Q;  2F0V A;  1V1P A;  2F0N A;  1H9K A;  4HMJ A;  1TWG B;  5CV9 A;  3NTH A;  3OMC A;  1Q86 C;  1FJG L;  4A93 H;  2Q2U A;  2YTX A;  1YNJ C;  5IGG A;  1V1Q A;  2F4V Q;  4DR1 L;  5DLQ E;  1PDQ A;  3GTG H;  3GTK B;  1RTO A;  4DV6 Q;  1PXU A;  4DNI A;  1SMX A;  1SAP A;  1EUJ A;  2JA5 G;  3J7A V;  5JEA H;  5EKK A;  3CCL A;  4QCL A;  1MJC A;  1R4Q B;  1QNU A;  1Q7Y C;  3CCJ A;  4CJ0 B;  5IGC A;  1XPU A;  2ZTE A;  5EPK A;  1W3S A;  1VQE A;  1B53 A;  1CFM A;  1GVP A;  5CV5 A;  5LL6 X;  4LF4 L;  5K36 G;  5KNB A;  2KHI A;  2KHS A;  1F2L A;  3NSW A;  5I2X A;  3FVQ A;  3QOJ A;  5C3E H;  4OX9 Q;  2XRS D;  4P2C B;  1ZYR C;  4JBK A;  1EWI A;  4X64 Q;  4A3K B;  2VNU D;  1SSO A;  3C1F A;  2IHF A;  4DN4 M;  5EPL A;  1F9P A;  2K52 A;  4ILW A;  4FF4 A;  3LWU A;  1KLU D;  4C3H H;  3L9A X;  3CXC A;  4QUF A;  4RAU C;  4JI3 L;  4DUZ Q;  4X3U A;  5E4W C;  1KD1 C;  1H9J A;  4A3C H;  3TS2 A;  3CD6 A;  2YV5 A;  4C1N I;  4F7X A;  4FXD A;  5IOC A;  2EYF A;  4MN3 A;  4C3J B;  2M9V A;  3UI2 A;  3V05 A;  3EJI A;  1IKL A;  3PIP 3;  4BA1 I;  4JCV E;  2IPK D;  1EIY B;  3J7Y W;  2A73 B;  3D3R A;  1BCP C;  4JPB W;  4HED A;  2BCO A;  1IZ6 A;  1XMQ L;  5IYC G;  1X56 A;  4DR3 Q;  1CK1 A;  2ZM6 Q;  2LMC B;  2VQE L;  1KHI A;  2B2T A;  2K04 A;  1ZEQ X;  1Y1V H;  1U4M A;  2B29 A;  2CWP A;  1U4P A;  2K50 A;  1X3G A;  5I9P A;  1GD7 A;  2L12 A;  2IY5 B;  2KEE A;  1BBX C;  2AQ1 B;  3CF5 A;  1LLR D;  4JI8 L;  4RKB A;  2AMC B;  1XPO A;  1JJG A;  1S5D D;  4P72 A;  2MO1 A;  1E0B A;  2OCE A;  2RHQ B;  3P20 A;  1GUS A;  4PZ7 A;  1KRS A;  2EYP A;  1BUV T;  4YWM A;  2B2U A;  1CKN B;  5COY A;  3M9B A;  4HR7 B;  1HNW L;  4GKK L;  1I6H H;  5ELC A;  4K5W A;  3GTJ B;  4LWC A;  1EWH A;  3E0J A;  4J6H A;  1A3V A;  1E2W A;  3J81 j;  3OTO L;  1PFM A;  4DAM A;  3LNN A;  4X65 Q;  4DR5 Q;  4A3F B;  4HJ9 A;  1QJO A;  4K0K L;  3B6Y A;  4NXN L;  1PH8 A;  4LF8 L;  1N9W A;  1NSN S;  2Z4I A;  3F2C A;  5IYD H;  3JAM L;  3QIA A;  1ESR A;  2AUJ D;  1MSG A;  4IPG A;  5IYB H;  5LMN W;  2UUC L;  2K03 A;  1CKM A;  1A15 A;  2AUK A;  3VYT A;  1CSQ A;  1MD2 D;  1AFP A;  4BY7 G;  1DCZ A;  2CHB D;  4KV6 A;  4XIG S;  1OXX K;  4B08 A;  2IX1 A;  3NQI A;  3VR3 A;  2F0E A;  2PZW A;  4B3R L;  1F9Q A;  5M9O A;  3PO2 G;  4NDX A;  4KHP Q;  1FL0 A;  1RJT A;  1STY A;  5JVG 3;  4C3I B;  3I91 A;  4TKO B;  3P7J A;  1AE3 A;  1BR9 A;  3DWA A;  2JA5 H;  1XMO L;  4OON A;  2E2I H;  1K28 A;  2KEN A;  2O4X A;  4H13 C;  3BS1 A;  2E76 C;  5HGQ A;  1LT3 D;  5K36 H;  4L5S A;  1T5E A;  2BH8 A;  1SMY D;  5FJ8 G;  2B2W C;  3GO5 A;  1SFO H;  1RTN A;  4GLA C;  1DGS A;  1K83 H;  3OHX C;  3SK5 A;  1IYV A;  3CME A;  3VR5 A;  3I7F A;  1KNA A;  1B3Q A;  1ICF B;  1LAC A;  2VQF Q;  1XTC D;  5DNF A;  1NY4 A; 
#chains in the Genus database with same CATH homology
 4DV7 Q;  3BJU A;  2GVA A;  1Q46 A;  3TRZ A;  5IP7 G;  4DR7 L;  4GLX A;  1NMF A;  1VQF A;  3STB D;  3RZD H;  3HOX G;  3K8A A;  4GS3 A;  2UXD L;  1M90 C;  1XMO Q;  2WAQ G;  3HKZ G;  1E1O A;  1N8R C;  2JA7 G;  1YJN A;  2NVX H;  4L5R C;  2Y0S G;  3GD7 A;  3G4S A;  1YJW A;  4R4I A;  4LF7 L;  3RR5 A;  1HJP A;  4DV0 Q;  1N33 L;  3RZO H;  4OO1 G;  3EN2 A;  3UE0 A;  2ZJR A;  4JI1 L;  5IP9 G;  3L2P A;  4HJ8 A;  1ASZ A;  5M3F H;  3GTJ H;  4A3G G;  3K80 C;  2A8V A;  4P71 A;  3CCE A;  1MJE A;  3PUY A;  4A3M H;  4OWT B;  1EQQ A;  1QZG A;  1JT8 A;  2HIX A;  1IBL L;  1E3P A;  2ALY B;  5IYC H;  4JI6 L;  2YU9 H;  1YNX A;  1PH9 A;  4DV4 L;  2UXD Q;  1I3Q H;  3PUX A;  1A63 A;  1NJI C;  1VQ8 A;  3GTO H;  3PSI A;  2LXK A;  1OXT A;  1XJV A;  1HNX L;  2CFM A;  3UDI A;  5E7N A;  1EQR A;  4BY1 G;  4OO1 I;  2EXD A;  1KL9 A;  4UY8 C;  4LF7 Q;  3G48 A;  4C2M H;  1GKH A;  3A5Z B;  2ZJP A;  1VQM A;  1TWH H;  2KCT A;  3TRE A;  4LFC L;  3CCQ A;  1N33 Q;  5GAH C;  1XMQ Q;  1K9M C;  3A5U A;  4JI1 Q;  2UUA L;  3CQZ H;  3VDY A;  2ZTD A;  3FKI H;  3U4Z A;  3PV0 A;  5LMU L;  4JI4 L;  1E1T A;  1P16 A;  4LF6 L;  3IRB A;  4BXX H;  4JYA L;  5LMN L;  3S14 H;  2UXC L;  3HOV G;  1H95 A;  1Q82 C;  4DK6 C;  3HOU G;  3M3Y H;  5GRO A;  3J7Z C;  2QEX A;  3U58 A;  4AIM A;  1XPR A;  1UE1 A;  1K0R A;  1PH4 A;  4BA2 I;  4JI6 Q;  1VQK A;  2PNH A;  2AWO A;  3U4V A;  1S40 A;  3J81 i;  1GO3 E;  4B3S L;  2VL6 A;  2WFW A;  4DV4 Q;  2OTJ A;  3RLO A;  3NEL A;  5C4J H;  1Z47 A;  5JJL A;  3J7A 5;  1HH2 P;  1MIU A;  3FHW A;  4X62 L;  5AJ3 Q;  1HNX Q;  3D0F A;  3NBH B;  4GNX B;  1RIP A;  4A3J H;  1S3O A;  3HKS A;  3ZJY C;  3F1Z A;  2R93 H;  2MFI A;  4YWK A;  1VQA A;  1YHB A;  2BA0 A;  2DGY A;  2VW9 A;  1R9T H;  3I55 A;  1TWA H;  4LFC Q;  1VQ6 A;  3RN2 A;  3GTM H;  5M5X H;  4BBS H;  1YHA A;  4A93 G;  3H0G H;  3W1B A;  1VQG A;  5C4X H;  5IWA L;  1J5E L;  2JA9 A;  2UUA Q;  4GKJ L;  1G29 1;  4A3K G;  4JC0 A;  3GTQ H;  1KXL A;  3M4P A;  1PH2 A;  4JI2 L;  5ELO A;  2OTL A;  3AFP A;  1L2F A;  3HOW H;  1LM0 A;  3KYH C;  5LMU Q;  3KJP A;  4JI4 Q;  1MKH A;  4LF6 Q;  2JA8 G;  3HOW G;  5LMN Q;  3TEH B;  4BBR H;  1CSP A;  1D8L A;  2YTV A;  2NVT H;  3H3V H;  5JEA G;  4A3E G;  2ZJQ A;  4GLV B;  3PF5 A;  4IPC A;  1K8G A;  1SLJ A;  3CP0 A;  4BY7 H;  4A3I G;  1IXR A;  4EQ5 A;  4B3M L;  2A19 A;  5IE8 A;  1HZ9 A;  3ERS X;  4DK3 C;  2N49 A;  2R92 H;  2NZH A;  4DR2 L;  1YBY A;  1PH1 A;  4X62 Q;  3F8T A;  4A3B G;  2K4K A;  4YCW A;  1BBU A;  3NEN A;  4AQY L;  2ID0 A;  5FLM H;  4YHH L;  1OXV A;  3PO2 H;  1U5K A;  2F52 A;  1YIT A;  4A76 A;  1B7Y B;  5FLX c;  2Q2H A;  4QQB X;  5C3E G;  1WI5 A;  2RCN A;  3HFZ B;  2AHO B;  3KLW A;  4AYB G;  3J81 c;  1VQ4 A;  4DUZ L;  1J5E Q;  1VQ5 A;  1OTC A;  5JEA J;  4GKJ Q;  2RF4 A;  4JI7 L;  4LF5 L;  4JI2 Q;  1QUQ A;  3W5O A;  1PFS A;  5ELN A;  3UE1 A;  1K73 C;  1L1O C;  4DUY L;  4A3D H;  3K7U C;  2EIF A;  1VQI A;  2L15 A;  4B3R Q;  4Y52 H;  2CWA A;  3CC7 A;  2H5X A;  4HIK A;  1C9O A;  4R4O A;  4AYB E;  1V9P A;  1KRT A;  3KDF A;  4KLK A;  4YCU A;  1AE2 A;  3AQQ A;  1WCM G;  3J80 c;  2E2H H;  1I5F A;  1PYS B;  1UWV A;  1WOC A;  4PZ8 A;  4QIW E;  5FJ8 H;  3NEM A;  3AFQ A;  4P75 A;  1GM5 A;  2JA6 H;  2NVQ H;  4A3C G;  4PMW A;  4JI5 L;  4DR2 Q;  2PI2 A;  4A75 A;  2NN6 I;  4A4I A;  2VZA A;  3BU2 A;  4MNO A;  4GNX C;  4NPS A;  4AQY Q;  1PV4 A;  4WJ3 M;  1HZC A;  2QGQ A;  4YHH Q;  2Q2I A;  4NXM L;  5C44 G;  5GQO A;  1JJC B;  3AEV A;  1PH5 A;  4MTN A;  5BR8 L;  3G6E A;  1IBK Q;  3STB C;  2R7Z H;  1E7Z A;  3OYY A;  3M4O H;  1YI2 A;  2V1C C;  4JI7 Q;  2C35 B;  1VQP A;  2CKZ B;  1VQD A;  4NB3 A;  4RG1 A;  2WAQ E;  3HKZ E;  4DPG A;  5IP7 H;  4HJ5 A;  1KIX A;  1EFW A;  1Q81 C;  1SRU A;  2Z6K C;  2Y0S E;  2I5H A;  3HOX H;  4PZ6 A;  4DUY Q;  4LF9 Q;  2CQO A;  3BZK A;  3L7Z C;  4DV2 L;  3I2Z A;  4LUZ A;  1QVF A;  1VQ7 A;  4L5Q A;  5J3B A;  1X65 A;  4DR6 Q;  1VQJ A;  2XGT A;  1X3F A;  1O7I A;  2OQK A;  1M1K C;  1Y1V G;  4LUV A;  4ALP A;  3I4O A;  1YEZ A;  4PG3 A;  3T1Y L;  1VQ9 A;  4DR7 Q;  4O0A A;  2I5M X;  3KOJ A;  4JI5 Q;  4IPH A;  3CC4 A;  5IP9 H;  2CCZ A;  4UP9 A;  1FGU A;  1Q1E A;  2R6G A;  4IJH A;  1Q8K A;  3JC6 6;  4UP7 A;  4YY3 L;  1IL2 A;  3HOZ G;  2PI2 E;  3KF6 A;  4POF A;  4DR6 L;  3PUV A;  4A3F G;  1VS0 A;  3RLF A;  2E5L L;  4A3G H;  4UP8 A;  5BR8 Q;  1SE8 A;  3CPF A;  4FDB A;  1VQO A;  2JK8 A;  3EIV A;  3AYH B;  3UDX A;  1K8A C;  2ATW A;  4RMF A;  5C0X G;  3S2D H;  4XTC S;  2OQ0 A;  3CCU A;  4QY7 A;  2YYZ A;  1N36 L;  1YZ6 A;  2UU9 L;  4Y7N H;  1CUK A;  5H1S E;  3A74 A;  3Q8D A;  4JOI C;  3CW2 C;  3EBE A;  4DV3 L;  2UXB Q;  4IOC A;  4GOP C;  1JE5 A;  4DV2 Q;  4OWW B;  1UEB A;  1V43 A;  2PQA B;  2UUB L;  1YVC A;  1BKB A;  1WFQ A;  4JI0 L;  3MXN B;  3T1H L;  4BY1 H;  1JB7 A;  3CMA A;  3I4N G;  1QUQ B;  4JBW A;  1TWG H;  1QVG A;  3KF8 B;  1VCI A;  5M5W H;  1UE6 A;  2LSS A;  1IBL Q;  1NBW A;  3T1Y Q;  4A3L G;  2F4V L;  4IO9 A;  1X55 A;  4QL5 A;  3PIO A;  4L5T A;  1ASY A;  1UE7 A;  3RNU A;  2KBN A;  3GTK H;  2D0O A;  4R4T A;  4YY3 Q;  3KDF B;  2KHJ A;  1X9N A;  1VQC A;  5C0X J;  2KCM A;  4DV6 L;  4KHZ A;  4R4Q A;  1XNQ L;  2E5L Q;  4A93 H;  5C0X I;  4APV A;  3HOV H;  2NZO A;  3HOU H;  1KC8 C;  2Q2T A;  5IYD G;  2HHH L;  3UDG A;  2UU9 Q;  1B70 B;  5IYB G;  4POG A;  1T9H A;  3J80 i;  3OW2 A;  1C0A A;  4O2D A;  3S1R H;  4DV3 Q;  2AWN A;  2GVB A;  2NVY H;  2BH2 A;  4UPA A;  4EX5 A;  3S15 H;  2UUB Q;  4HIO A;  1OXS C;  3PF4 A;  4JYA Q;  2UXC Q;  3T1H Q;  1KAW A;  3KFU A;  4DV5 L;  3PUZ A;  5GAD C;  1Q86 C;  3A0J A;  5M3M G;  5IT9 c;  2Q2U A;  2WB1 G;  2YTX A;  3CCR A;  1W2B A;  1KQS A;  1V1Q A;  4B3T L;  2F4V Q;  4JV5 L;  5IY0 A;  4DR1 L;  1IBM L;  4OX9 L;  5DLQ E;  4LFB L;  3RLN A;  4B3S Q;  3HOY G;  3GTG H;  4A3K H;  3M4Q A;  4X64 L;  5HY6 A;  3FP9 A;  2E8G A;  2Z0S A;  4DV6 Q;  1JMC A;  1G6P A;  3LGJ A;  3S1Q H;  1C7Y A;  1XNQ Q;  2HQL A;  4H02 A;  1EOV A;  4DNI A;  1SMX A;  1RL2 A;  2JQO A;  2WB1 E;  1I94 L;  1HR0 W;  1EUJ A;  2NN6 G;  3U50 C;  3BZC A;  2JA5 G;  4A3E H;  3CCL A;  3I4M G;  1MJC A;  2I5L X;  2HHH Q;  1G51 A;  2JEB I;  2B63 G;  1Q7Y C;  2MNA A;  3CCJ A;  3MEF A;  4A3I H;  1QVC A;  5IWA Q;  1XPU A;  2ZTE A;  3RN5 A;  1W3S A;  4A3B H;  1VQE A;  1GVP A;  4LF4 L;  4DR4 L;  3S17 H;  2R7D A;  5K36 G;  2N3S A;  2KHI A;  2VY3 A;  1SR3 A;  3D31 A;  4C3J H;  1YIJ A;  1CKO A;  1FJG Q;  1XTD A;  3H3V I;  4DKA C;  4B3T Q;  4JV5 Q;  2AKW B;  1Y1W G;  5C3E H;  1IBM Q;  4OX9 Q;  1SRO A;  1CKN A;  3PO3 H;  4B3M Q;  2VUM G;  4LFB Q;  4JBK A;  1D7Q A;  2K5V A;  1EWI A;  4X64 Q;  2EQS A;  2VNU D;  1PYB A;  4IJL A;  1VQL A;  1QZH A;  1PHJ A;  4X6A H;  1A0I A;  2IHF A;  4P74 A;  1L1O A;  2K52 A;  1I94 Q;  2I0Q A;  4JG2 A;  4DR3 L;  4C3H H;  2ZM6 L;  1HZB A;  2GN5 A;  3CXC A;  1PVO A;  1X54 A;  2FXQ A;  4IPD A;  3H15 A;  1WCM H;  4JI3 L;  1IYJ B;  1HNZ L;  4GN5 A;  4DUZ Q;  1KD1 C;  1Y14 B;  4LF5 Q;  4A3C H;  2HIV A;  3K0X A;  4LF4 Q;  4DR4 Q;  3TS2 A;  3SGI A;  3CD6 A;  2ASB A;  2YV5 A;  4GNX A;  2JA7 H;  1WJJ A;  5C44 H;  3TS0 A;  1PH3 A;  1VQN A;  3PCO B;  5M3F G;  3CCM A;  4JBM A;  3PGZ A;  4X66 L;  4HID A;  4LFA L;  3W1G A;  3CCS A;  3DM3 A;  4BA1 I;  2K14 A;  4JCV E;  2LXJ A;  1X6O A;  3CPW A;  4A3M G;  1PH6 A;  1EIY B;  2F3I A;  2Z6K A;  1NE3 A;  1P8L A;  2IT1 A;  1LUZ A;  2PMZ E;  1IZ6 A;  2JJQ A;  3DLL A;  1L0W A;  1X56 A;  5IYC G;  4MZ9 A;  2K5N A;  4DR3 Q;  1XMQ L;  4NXM Q;  1BVS A;  2ZM6 Q;  1UE5 A;  1FJG L;  1YHQ A;  4TVA B;  2VQE L;  4WJ4 A;  1KHI A;  3S1M H;  1Y1V H;  4JI3 Q;  2B3G A;  1HNZ Q;  4ME3 A;  2B29 A;  4OXP A;  1YJ9 A;  2CWP A;  3E0E A;  3L0O A;  2K50 A;  1X3G A;  3HOZ H;  4DAY B;  1TXY A;  2ES2 A;  2UXB L;  1GD7 A;  2MQH A;  4X65 L;  4A3F H;  1XNR L;  4DR5 L;  2IY5 B;  4QJF A;  3PUW A;  3CF5 A;  4YCV A;  3CCV A;  2QA4 A;  4JI8 L;  4DV1 L;  4AH6 A;  2AMC B;  3FKI G;  1XPO A;  1JJG A;  5AJ3 L;  1HZA A;  4X66 Q;  4P72 A;  4LFA Q;  2MO1 A;  4HIM A;  1J6Q A;  2OCE A;  2RHQ B;  3GTL H;  4BXX G;  4PZ7 A;  4YWL A;  4LW1 A;  1Z9F A;  2K5H A;  3S1N H;  1BBW A;  1KRS A;  2VS1 A;  4JOI A;  3CAM A;  3ULJ A;  4YWM A;  2DUD A;  4GOP A;  4IFD G;  1CKN B;  1NTG A;  1NMG A;  3M9B A;  1EIF A;  4R4C A;  3CC2 A;  3ICE A;  2VQE Q;  1E22 A;  1HNW L;  3I4N H;  4GKK L;  4HJ7 A;  1I6H H;  2BA1 A;  1K3R A;  4LWC A;  1L1O B;  4JBJ A;  4A3J G;  1N34 L;  1N36 Q;  4A3L H;  1N32 L;  5JJK A;  1TWF H;  4KHP L;  2R93 G;  1SN8 A;  4P73 A;  1B8A A;  1U0L A;  3J81 j;  3PIP A;  3OTO L;  4DAM A;  4C3I H;  3M7N A;  4BBS G;  4X65 Q;  1XNR Q;  3JAM i;  3ULP A;  3H0G G;  4DR5 Q;  1LYL A;  1WYD A;  4GN4 B;  4HJ9 A;  3GTP H;  2IX0 A;  4JI0 Q;  4J15 A;  1HR0 L;  4K0K L;  3B6Y A;  4NXN L;  1PH8 A;  4LF8 L;  3UDF A;  1X3E A;  4JI8 Q;  1N9W A;  4DV1 Q;  1FVI A;  3F2C A;  5IYD H;  2N8N A;  4QGU A;  4HJA A;  2OWO A;  4IFD J;  4IPG A;  5IYB H;  4BBR G;  5LMN W;  2UUC L;  1CKM A;  4IFD I;  3S16 H;  2D62 A;  2YTY A;  1CSQ A;  3ER0 A;  4BY7 G;  3E9I A;  1OXU A;  2R7F A;  2ZTC A;  4XIG S;  2MO0 A;  1OXX K;  1PA6 A;  2IX1 A;  1HNW Q;  2R92 G;  4GKK Q;  3S24 A;  1PH7 A;  1Q12 A;  4LUO A;  1VQH A;  4B3R L;  3K81 C;  5M3M H;  5FLM G;  3KF6 B;  1N32 Q;  1N34 Q;  5C4X G;  3PO2 G;  2JE6 I;  2E2J H;  1E24 A;  4KHP Q;  1FL0 A;  3HOY H;  1A62 A;  3ULL A;  3OTO Q;  3KJO A;  2VQF L;  3K7A H;  4OWX B;  4DV7 L;  3E9H A;  3I56 A;  1TWC H;  4K0K Q;  4R1J A;  1JJ2 A;  1HR0 Q;  4LF8 Q;  1AE3 A;  1Q1B A;  4NXN Q;  2JA8 H;  2N78 A;  4DV5 Q;  2JA5 H;  3I4M H;  2XTI A;  3F2B A;  5JJI A;  4GN3 B;  5EAY A;  2B63 H;  4A3D G;  2D0P A;  4TQU S;  1XMO L;  1LTL A;  4OON A;  2E2I H;  2UUC Q;  4DR1 Q;  1A8V A;  2KEN A;  2K75 A;  1IBK L;  2JEA I;  1I50 H;  3M85 A;  3S2H H;  4KI0 A;  2WP8 J;  5HGQ A;  5GAE C;  2PQA A;  3JAM c;  4L5S A;  2BH8 A;  4DV0 L;  3PO3 G;  3WWV A;  5FJ8 G;  2RHS B;  2JA6 G;  3GDE A;  1AH9 A;  2A1A A;  3GO5 A;  4LNQ A;  1S72 A;  1SFO H;  3G71 A;  4GLA C;  4LF9 L;  1DGS A;  1K83 H;  5GAG C;  3F2D A;  3CME A;  1Y1W H;  4GOP B;  3I7F A;  1VQB A;  2VUM H;  4IOA A;  2IHE A;  5M5Y H;  2VQF Q;  1EYG A;  2R7Z G;  2HT1 A;  3TQY A;  1NY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...