1GKHA

Mutant k69h of gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFHVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gkhA00
4LF9L 5LMUQ 1B8AA 4KHZA 2PI2E 3U4ZA 2VQEL 3EN2A 4DV5L 1KD1C 4DV5Q 4LUOA 4C3JH 2OTLA 3S1QH 2Q2HA 4YWKA 5M3MG 3I7FA 5JJKA 4XIGS 4DV3L 4DAYB 4DV3Q 4A4IA 2IX0A 2N8NA 5GQOA 4JI1Q 3CMAA 3H0GG 3PCOB 4H02A 1V1QA 3KYHC 1E1OA 5M3MH 5IWAQ 4IPGA 5C0XJ 1YVCA 4TVAB 3H3VH 1G6PA 2R6GA 5IT9c 1O7IA 3K7AH 1MJCA 2YTVA 3BZCA 3L0OA 1Q81C 1PH4A 1HZAA 3OW2A 1JJ2A 4DR7L 1K0RA 3H0GH 2R92G 3UE1A 1UE1A 1VS0A 4DV4L 1KL9A 3AFQA 1X56A 3KJPA 3HOXH 2E5LL 3ULPA 1YHBA 2YV5A 1GKHA 1HNXQ 2Z0SA 1QUQB 3PO2G 5GROA 3CC2A 2AMCB 1YIJA 3S1NH 2OQKA 1YI2A 1CKOA 1CKNB 3PO3G 1T9HA 1VQJA 3TQYA 3CPFA 2ZTCA 3KLWA 3PO2H 4A3EG 1B70B 2EQSA 4AIMA 1Y1VH 5FJ8G 5FLXc 4DUZL 3M3YH 2UXBL 4OWTB 4DUZQ 1FJGL 1SLJA 1WCMH 2KBNA 1FJGQ 1UE7A 4A3CG 3RNUA 2CQOA 3GTQH 4DKAC 1XMQL 1SFOH 1HH2P 2VS1A 4A3EH 1XMQQ 4A3KG 1Y14B 1KC8C 1OXSC 1AE3A 3GD7A 4A3CH 3HOUH 4R4CA 1Q7YC 2ZTDA 1KAWA 5FLMH 1G51A 4A3KH 1TWGH 3RN5A 2ES2A 1QVGA 3ULJA 4OX9L 2OCEA 1XNQL 4OX9Q 4PMWA 2RHSB 4HIOA 1SR3A 1X3GA 1PYBA 3ICEA 4L5QA 1GD7A 2NZOA 3SGIA 3A5ZB 3S17H 1XJVA 1LTLA 2AHOB 2I0QA 1IXRA 3RZOH 1OXTA 2CFMA 4P74A 2N78A 3ZJYC 1LUZA 2JA9A 3ER0A 4QJFA 4DNIA 2Z6KC 2K52A 4IJHA 4LUVA 3STBC 4JI5Q 2IHEA 2IT1A 2R7DA 4DK6C 4DR6Q 4LF7Q 3CCLA 2WFWA 3CD6A 4MTNA 5LMNL 3W1GA 1EOVA 3A0JA 5LMNQ 1I5FA 3K81C 4OO1G 2MNAA 1G291 1KXLA 3NBHB 4B3RL 1W3SA 4NB3A 2EIFA 4DR1Q 1S3OA 2L15A 4FDBA 4DPGA 3M85A 1TXYA 3EBEA 2ZM6L 1Y1WG 4R4IA 2ZM6Q 4LFBL 2F52A 1V43A 4LF5L 1MIUA 1X55A 3S14H 5H1SE 4LF5Q 2NVYH 4DR2L 1D7QA 2UXCL 4DR5L 2JA6G 1JJGA 1HZ9A 2UXCQ 4DR5Q 1Y1WH 3HOZH 3M9BA 2VZAA 5M5WH 3G6EA 4HJ9A 3UDGA 5GAHC 2UUBL 2UUBQ 1N32L 1VQCA 1AE2A 4R4TA 1N32Q 2E8GA 4UY8C 1EYGA 2K50A 3KF8B 1VQDA 5M3FH 1LYLA 4DK3C 3B6YA 1PH9A 4JI0L 2JA6H 4JI0Q 4LFCQ 1E7ZA 3CP0A 3RLNA 2PQAA 3S1RH 2E2JH 1I94L 1AH9A 5IE8A 2I5LX 2PMZE 1VQ4A 1I94Q 4B3SQ 2VQFL 1RIPA 3PV0A 2GVAA 3AEVA 1CSQA 3GTOH 3CAMA 4GKKL 2VNUD 3PIPA 4JI8L 1K8GA 3MEFA 4A3GG 1L1OA 4GKKQ 4YWLA 4B3ML 4LF6Q 1J6QA 3J81c 1A8VA 3F2DA 3F1ZA 4DR3Q 1HNZL 3CCEA 3IRBA 1WOCA 2ALYB 3CCSA 1HNZQ 1PH8A 4OONA 5M5XH 3UE0A 4A3GH 4JI2L 4HJ5A 4BA2I 2ZJPA 1KHIA 3KDFA 3CPWA 1L2FA 1TWAH 2RCNA 1PH5A 2YU9H 1YJWA 4X6AH 4LF9Q 3M4PA 2VQEQ 3CCRA 5C3EG 4LF4L 2KHIA 1J5EL 4C3IH 4P71A 3PGZA 2NVTH 2LSSA 1Q46A 4IFDJ 4JG2A 2E2HH 4OO1I 4Y52H 4A93G 2RF4A 5C3EH 1X3FA 1VQNA 2A19A 4JI3L 3HKZG 3KF6A 4IFDG 3ULLA 4YY3L 4JI3Q 1HR0W 4A76A 3HOYG 3A5UA 4GNXA 3CW2C 4DR7Q 4O2DA 3LGJA 5C0XG 1PH3A 2LXKA 3A74A 1PH7A 2BH8A 4DV4Q 3FKIG 3T1HL 3HOWG 2UU9L 3F2CA 2HQLA 4IPCA 3T1HQ 1N9WA 2UU9Q 2UXDL 2E5LQ 5JJLA 3GDEA 4IPDA 2R92H 3F8TA 4IOAA 5GAGC 4KHPL 2XGTA 1W2BA 3FKIH 4DV2L 4KHPQ 1JT8A 4BXXG 1C0AA 2OTJA 5JJIA 4X64L 4GN4B 1A0IA 2Y0SG 4P72A 3CCVA 5JEAJ 2IY5B 3PO3H 2GN5A 3W5OA 5IP9G 4IO9A 2JE6I 2JQOA 2UXBQ 3NEMA 4R4OA 2XTIA 3Q8DA 5ELNA 4L5RC 3GTKH 2K75A 3CQZH 4JI6L 3M7NA 3OYYA 4YHHL 1K73C 1IBLL 4JI6Q 5FJ8H 5HGQA 2I5MX 5IY0A 1FL0A 2HIVA 2ZTEA 1LM0A 2UUCL 3I4MG 5IP9H 4O0AA 5IYDG 4JCVE 2UUCQ 3I4OA 4P75A 2CWPA 3K7UC 3D31A 4AYBE 4BBRG 4JYAL 2N3SA 4L5SA 1XNQQ 3TRZA 5C4XG 1ASYA 4JYAQ 3L7ZC 3S16H 2KENA 2H5XA 5IYDH 1L1OC 1NY4A 2AKWB 1YBYA 1X9NA 2JK8A 1SROA 1SMXA 3HKSA 1HJPA 3I56A 1WFQA 5K36G 1Z47A 4BBRH 2WAQG 1JMCA 4EX5A 2OWOA 3GTJH 1HZCA 4GN3B 2JEBI 3ERSX 1IYJB 2A8VA 1OTCA 2NN6G 1DGSA 4QGUA 1SN8A 2QEXA 2K5HA 4IFDI 4EQ5A 4OXPA 3GTLH 1E3PA 1TWHH 1K9MC 3JC66 2D0OA 5C0XI 1YJNA 1XPUA 4IOCA 2UUAL 3J7ZC 1VQOA 1S40A 2UUAQ 2DGYA 4B3RQ 2Q2IA 3UDIA 4LW1A 3M4QA 2AWOA 1U5KA 1X54A 2B63G 3CCQA 4LFBQ 4K0KL 1CSPA 4BY1G 4YWMA 4K0KQ 2ASBA 4DR2Q 1M90C 2N49A 1X3EA 2JA8G 4BY7G 3G48A 4GKJL 4LUZA 4X65L 1I3QH 4GNXC 1IBML 3TREA 4X65Q 2B63H 4WJ4A 3U4VA 4BY1H 3S15H 1CUKA 1NBWA 3FHWA 4TQUS 3F2BA 4R1JA 3PF5A 3S2DH 1YJ9A 1PV4A 4BY7H 4DR4L 5IYBG 1EIYB 1H95A 1Z9FA 3STBD 2WB1G 4DR4Q 1OXVA 4YCVA 4A3IG 4KLKA 1YITA 4RG1A 2CWAA 1VQIA 4LWCA 4DV7L 2VQFQ 3CMEA 4DV7Q 3FP9A 5IYBH 4DV0L 3KOJA 3BZKA 4A3DG 1FGUA 4JI8Q 1QZGA 2RHQB 3CXCA 4B3MQ 1P8LA 3TS2A 1PH6A 2PQAB 4HJ7A 4P73A 3I4NG 2KCMA 1PVOA 2QGQA 1WI5A 4JBWA 4JV5L 4DAMA 5ELOA 2NVXH 4JBKA 4JV5Q 2VL6A 4JI2Q 2C35B 2CKZB 5DLQE 2QA4A 1QVFA 3E9HA 1U0LA 1VQ6A 1L1OB 4X62L 4Y7NH 3I4NH 5J3BA 3PUZA 1WJJA 5BR8L 1E24A 2NN6I 3NENA 1NJIC 5BR8Q 3J80i 4WJ3M 4LF4Q 1QVCA 1J5EQ 4QQBX 3KFUA 3RR5A 5GAEC 1V9PA 2KCTA 4JI7L 1EWIA 4C3HH 1VQBA 1C9OA 3KDFB 3H15A 4A3JG 2HHHL 3RN2A 3G4SA 3CCUA 1VQ5A 4MNOA 4PZ6A 2IHFA 3RLOA 2PNHA 3CCMA 1XTDA 1C7YA 1MKHA 1BBWA 1Q12A 1X65A 2MFIA 1TWFH 1K83H 3TEHB 4JOIA 4UP9A 4YY3Q 2JJQA 1VQ7A 2JA7G 4A93H 1OXUA 4A3JH 2BA0A 3MXNB 3PIOA 1MJEA 1EFWA 3CC7A 2WP8J 3DLLA 1L0WA 3JAMi 1EQQA 1M1KC 1VQ8A 4PZ8A 1VQ9A 2JA7H 3UDFA 5LMUL 2UXDQ 3HOYH 1UEBA 2VY3A 4JBJA 1GVPA 4GN5A 4JI1L 1VQMA 1VQHA 4JBMA 4JI4L 4PG3A 3KF6B 2AWNA 3BJUA 5M5YH 3J81j 2E2IH 1B7YB 3I2ZA 4JI4Q 1BBUA 5IWAL 3HOWH 2K5VA 3S2HH 2FXQA 4GNXB 2VW9A 4DV1L 4DV2Q 2NZHA 4DV1Q 1EUJA 1QUQA 4DUYL 3L2PA 3HOXG 4DUYQ 1I6HH 1XNRL 4OWXB 3PUYA 4X64Q 4LFAL 2GVBA 2K5NA 1NE3A 1CKNA 1NMGA 2F3IA 4LFAQ 4GOPC 1VQLA 1XNRQ 3AYHB 1QZHA 3J81i 2PI2A 4AYBG 2BA1A 4BA1I 4BXXH 4LNQA 1N36L 2MO1A 3PSIA 1JB7A 1HNXL 1N36Q 4YHHQ 1YEZA 1IBLQ 3KJOA 4KI0A 5JEAG 3HKZE 1XMOL 4BBSH 1HNWL 1VQPA 2YTYA 1Y1VG 4IPHA 4QY7A 5GADC 4A3MG 1NMFA 1XMOQ 4HIDA 1VQFA 1XPRA 1PA6A 1N34L 4OWWB 1A63A 4GLVB 1N34Q 1HR0L 1WCMG 1BKBA 3TS0A 1HR0Q 3AQQA 3HFZB 2JA5G 5C4JH 2CCZA 5C44G 3I4MH 5IP7G 1TWCH 4A3MH 1VQGA 2R7FA 1S72A 5LMNW 1OXXK 1N33L 2YTXA 2JEAI 1N33Q 1SRUA 3K8AA 3WWVA 1Q1BA 1PH2A 4C2MH 3K80C 3HOUG 1BVSA 5C4XH 5FLMG 2JA5H 2D62A 5C44H 1PYSB 5EAYA 5IP7H 2F4VL 1A62A 4A75A 2HT1A 2F4VQ 1WYDA 3M4OH 4UPAA 1YHQA 1KIXA 2Y0SE 1GO3E 2A1AA 3E9IA 3GO5A 4RMFA 2DUDA 1JJCB 4X66L 3DM3A 4X66Q 3VDYA 4GLAC 4IJLA 2KHJA 1I50H 4HIKA 1X6OA 1IZ6A 1Q1EA 4APVA 1Q82C 1IBKL 4JC0A 3CCJA 1IBKQ 3NELA 3PUVA 3H3VI 1PH1A 3J7A5 4NPSA 4L5TA 1HNWQ 4NXML 2ID0A 2K14A 2YYZA 5E7NA 4POFA 3AFPA 4YCWA 4A3FG 4NXMQ 3GTPH 2BH2A 4PZ7A 3HOVG 1YNXA 4ALPA 4DR6L 4UP8A 4POGA 4DV6L 4JI5L 4JOIC 4GOPA 1KRSA 1YZ6A 5IYCG 3U50C 4DV6Q 1R9TH 4LF8L 1EIFA 1Q86C 4LF7L 4LF8Q 4GKJQ 4A3FH 2Q2UA 1IBMQ 4MZ9A 3D0FA 3J80c 4A3LG 3HOVH 1Q8KA 4YCUA 1KQSA 2WAQE 3K0XA 2JA8H 4HIMA 4DR1L 5IYCH 4HJAA 1P16A 3GTMH 1ASZA 4HJ8A 3OTOL 1RL2A 4A3BG 3OTOQ 3S24A 4AQYL 2Q2TA 3HOZG 4UP7A 4GOPB 2VUMG 1PFSA 4AQYQ 4A3LH 1K8AC 1XPOA 4ME3A 2R93G 1VQEA 2HIXA 5M3FG 1D8LA 4R4QA 5HY6A 4DV0Q 4A3IH 3GTGH 4A3BH 3PUWA 3I55A 4NXNL 2VUMH 3PF4A 1K3RA 4BBSG 4NXNQ 3JAMc 2B29A 2B3GA 4QIWE 2D0PA 2R93H 2R7ZG 1GM5A 1UWVA 3G71A 2LXJA 4LFCL 3RLFA 2ATWA 4A3DH 2ZJRA 2V1CC 4GS3A 1N8RC 1IL2A 1FVIA 1SE8A 4B3SL 3UDXA 2R7ZH 4X62Q 2MO0A 1HZBA 2I5HA 3PUXA 2K4KA 1KRTA 3T1YL 3W1BA 3RZDH 3T1YQ 4GLXA 1JE5A 1VQAA 4B3TL 2EXDA 4LF6L 4J15A 4B3TQ 1E1TA 4DR3L 1E22A 2OQ0A 3E0EA 2WB1E 1NTGA 1UE5A 1EQRA 4QL5A 5AJ3L 4JI7Q 1PHJA 2IX1A 2NVQH 5AJ3Q 3S1MH 2MQHA 4XTCS 4AH6A 2HHHQ 2ZJQA 1CKMA 1VQKA 3CC4A 3U58A 3BU2A 3CF5A 1VCIA 2Z6KA 1YHAA 1UE6A 3EIVA
chains in the Genus database with same CATH superfamily
4J6HA 3SHLA 4LF9L 4KHZA 2VQEL 1HTPA 4LUOA 3U9OA 5KGUA 2EJMA 2NVYB 3I4LA 1KNEA 3KLRA 1GJXA 1GOZA 2N8NA 5GQOA 2SNSA 5IWAQ 4IPGA 5C0XJ 2WV6D 2R6GA 3T4AC 5IT9c 1ESRA 3L0OA 4Z9CB 2QILA 2F03A 4DR7L 1K0RA 3UE1A 1EYCA 1UE1A 3OOCA 1OO9B 3MEHA 3KJPA 2J0TD 1ENAA 4KMUC 4QUFA 1QUQB 3PO2G 5GROA 5LHY1 2I46A 1BO0A 3S1NH 2EYHA 1VQJA 3QJYA 2EQSA 4AIMA 4N9TA 1Y1VH 3SK6A 1ENCA 1JWMD 2N88A 3M3YH 1F9QA 4Y7NB 2KJXA 4DK1A 2PW5A 2F0SA 2CQOA 1KDAA 2C9OA 3FPPA 2PYKA 3QOJA 3D4WA 1FNVA 1AE3A 3GD7A 4A3CH 3HOUH 4R4CA 4K5VA 2ZTDA 3L3OC 1G51A 2FINB 4K6DA 1VF5C 1F9PA 2FJ2A 4HIOA 3W2DA 1PYBA 2LY7A 2NZOA 3C1EA 4RFBA 3S17H 3HOYB 4F88A 2MPMA 3BZDB 4G7OC 2K52A 4LUVA 4DK6C 1QG7A 3CCLA 2PZTA 2XSCA 5LMNL 1W6KA 3W1GA 1KXLA 3K81C 2MNAA 1Q8IA 3NBHB 3G7LA 2L12A 3QG1A 2EIFA 4NB3A 1S3OA 4DPGA 3HP3A 1U4PA 4R4IA 4LFBL 2F3VA 4LF5L 3WOEA 5H1SE 4DR2L 2UXCL 1JJGA 2JA6G 2OT2A 2HUGA 4DR5Q 1Y1WH 5T1IA 1JORA 2UUBL 3UDGA 2DNCA 3SXHA 1N32Q 5M3FH 1VQDA 1VMCA 3B6YA 4DU9A 3K6OA 2PQAA 4NW2A 1I94L 2A74C 2C5CA 5IE8A 3VR2A 4M8AA 4BBRB 2JA5B 2RVLA 5C44B 3AEVA 1S5DD 1CSQA 3BDLA 3CAMA 2FMCA 2LS01 4GKKQ 3MEFA 1LTBD 4XQQA 4OIJA 2WAQB 1HNZL 3CCEA 3IRBA 2EY2A 3QR8A 1TWHB 3TP5A 4KJNA 3UE0A 1TR5A 4C3IG 3OHXC 4BA2I 1F2MA 4C1NI 4LF9Q 4RHSA 2VQEQ 2ICEC 5C3EG 2RQXA 2KHIA 4K8JA 4LF4L 5IGFA 4P71A 1AFPA 3TSSA 1IYUA 1Q46A 4IFDJ 4JG2A 3H3VC 2B63B 5FK9C 2NTTA 1PRTD 1VQNA 2A19A 3NUCA 4DNRB 2F0OA 4JI3Q 2BCOA 4O2DA 4DR7Q 4ZK9B 1SYGA 2BH8A 3FKIG 3HOWG 4CDFC 5JJLA 4A3IB 1WTXA 4EQPA 3MHBA 2KEEA 3F8TA 4OELB 4IOAA 1W2BA 4KHPQ 3J7AV 1JT8A 3VR5A 2L9HA 1LT4D 3AU7A 1IL8A 3K5NA 2B2VC 3BYTB 1QB5D 1A0IA 3MA2B 3A56A 3I4NB 5CV5A 4IO9A 3Q8DA 1ICWA 4L5RC 1LTSD 4JI6Q 1IBLL 3NQIA 2RKSA 4Q0FA 5IY0A 1KDCA 1FL0A 2HIVA 1II3A 1LT6D 2UUCQ 4DAPA 3I4OA 4ODGA 5E4XA 3D31A 4JYAL 5C4XG 2N55A 1ASYA 3H09A 3S16H 2H5XA 1EY7A 1L1OC 4A3JB 1YBYA 4HAEA 1SROA 4KY7A 1EFID 3H94A 4RA8A 2JXMB 2JA7B 2F0IA 3GTJH 1HZCA 2A6HC 3Q6SA 2OWOA 4GN3B 1HFNA 2A8VA 5M5YB 1X3PA 3NPPA 2K5HA 1H9RA 3OWFA 1YJNA 1FGBD 4IOCA 3J7ZC 2F0LA 1S40A 1A3TA 2WKDA 4LW1A 3OMCA 3M4QA 4LFBQ 1RDPD 4YWMA 4K0KQ 2ASBA 3Q24A 3C46A 4DR2Q 4BY7G 2X6GA 4LUZA 4RH6A 4TKOB 1CQFA 1IKLA 2KCCA 4V0BA 1CUKA 3FHWA 5BN5A 2FMMA 1EWCA 2CH4A 3F2BA 4V190 1ZYRD 1YJ9A 3S2DH 1TWCB 3CRKC 4C1NK 4DR4Q 5JJZA 1WCMB 3VR3A 1ZXTA 5FO9B 4CKBA 2F0KA 3CMEA 1PTOB 4DV0L 1V1OA 3BZKA 4A3DG 2L11A 1HRJA 2RHQB 4JK1C 3E5SA 5JVG3 1P8LA 4K14A 4HJ7A 2G9HD 2JSOA 1I50B 1UEAB 4JBWA 2PZUA 2A6ED 1WTWA 2SNMA 4JPBW 1V1PA 2L1BA 2NVXH 3NWTA 2C35B 2QA4A 3E9HA 1L1OB 4C3HG 1WJJA 2F0MA 5BR8L 2NN6I 5EPKA 5DAUA 3J80i 4LF4Q 1QVCA 2E74C 3RR5A 4JVZA 1EWIA 1BNZA 2OXPA 4LAAA 3CCUA 4PZ6A 1D5ZC 4XXEA 2F0FA 1TWFH 1K83H 2MGSA 1AEXA 3P20A 4DXGA 4CJ0B 1TIID 1XTCD 3JAML 2WP8J 2KECA 4KN7C 1WTVA 4PZ8A 1CA5A 3VA7A 1VQ9A 3E0JA 1HA5A 1LV9A 5CV6A 4JI1L 4WJ4A 2A73B 3HOZB 2NBFA 3J81j 2K7VA 1MBYA 4DF7A 3HOWH 5KIXA 3S2HH 4KKUA 2VW9A 2NZHA 4CDDC 4DV1Q 1EUJA 3HOXG 4FF2A 3Q22A 4YIJA 4DUYQ 3SR1A 4G7HC 2GVBA 2K5NA 1NE3A 1CKNA 1NMGA 1XNRQ 2MO1A 3GTOB 4GZYC 2H1EA 5ISRA 1IBLQ 1JOOA 3KJOA 2F0WA 1VQPA 2B8GA 3WDNA 1STEA 5GADC 1HNWQ 4HIDA 2A5HA 4KK7A 3R93A 5M5XB 1DM0B 1PZID 1RD9D 1PFMA 3HFZB 5M9OA 4FP5D 1LTTD 4A3MH 1VQGA 1OXXK 1FNUA 1CHPD 2JEAI 1HPCA 3VYTA 3OPOA 1Q1BA 3BG3A 4C3IB 2ZT9C 5IT9L 5C4XH 5EAYA 4R8NA 2F4VL 3KUPA 5CGKA 1KIXA 1EZ8A 1GO3E 2A1AA 5M3MB 4RMFA 4R8IA 5C3EB 4HTHA 4X66L 3DM3A 3IFTA 5ELFA 4IJLA 1ET9A 4HIKA 3MC0B 4APVA 4JC0A 3CCJA 3H0GB 1IBKQ 3NELA 5G3LD 1XYIA 3ITPA 3J7A5 5HURA 1SYFA 2NTSA 3AFPA 2D9UA 5ELBA 2MP1A 4DR6L 4JI5L 1R9TH 5IYCG 3U50C 3FKIB 3MVVA 1Q86C 4LF8Q 1AZPA 3HOVH 1Q8KA 1Y8NB 1I4QA 3K0XA 3NK9A 2QCPX 2RBMA 4HIMA 3E6ZX 1ASZA 4HJ8A 3L9AX 3S24A 3CQZB 1STBA 1WTHA 3Q23A 1D8LA 4R4QA 1U4LA 4DV0Q 1SBBB 3PUWA 3QWNA 3I55A 1K3RA 2B3GA 2D0PA 4A3KB 3MFYA 2L0CA 2R7ZG 3W3AA 2V4DA 1ILQA 4A3DH 4XT3B 1D2BA 4B3SL 2AUKA 3UDXA 1HZBA 2K4KA 3T1YL 1PRTC 1YNJC 2K05A 2F0JA 4J15A 2VB2X 1BXTA 4DR3L 2OQ0A 5CV7A 2F0PA 2KEDA 4QL5A 4LK1C 2NVQH 2O5IC 1VQKA 3K57A 2Z6KA 2PI2E 4DV5Q 3S14B 4YWKA 5IIFA 3I7FA 4IUQA 4XIGS 4FYDA 4QUCA 5AFWA 4DV3Q 4IUTA 3N6RA 1F2LA 4A4IA 2IX0A 2EYOA 2Q8TA 4JI1Q 5C4HA 1B4OA 1RODA 4TVAB 1O7IA 3K7AH 1MJCA 3BZCA 1HZAA 1TS5A 2E2JB 1GHKA 1TS2A 1VS0A 2MUYA 3AFQA 4ILWA 4B9WA 1X56A 3HOXH 2E5LL 2YV5A 2F0HA 2HQEA 1NR4A 2Z0SA 3K5OA 2AUJD 1YIJA 1YI2A 3PO3G 1T9HA 3TQYA 1TY0A 4A3GB 3CPFA 2ZTCA 3KLWA 1B70B 2K5WA 3DWPA 5FLXc 3RD4A 2UXBL 2EJFC 4DUZQ 1SLJA 3O13A 1FJGQ 4A3CG 3RNUA 4DKAC 1HH2P 2VS1A 3SK8A 1KC8C 1PRTB 2AQ2B 5C4ZA 2ENBA 1PTOD 1PYWD 5C5MA 1KAWA 3Q0AA 1TWGH 2PQEA 2G5DA 3RN5A 3ULJA 4OX9Q 4PV1C 4L8JA 4A93B 1X3GA 4L5QA 3SGIA 3A5ZB 1LTLA 1L0XB 1IXRA 2MJ8A 1LUZA 2JA9A 4QJFA 1ZYRC 1IKMA 3U9SA 1D1KA 2F0QA 4HN7A 5CV9A 1JB3A 4JI5Q 4DR6Q 2IT1A 1KNAA 1HHVA 2WFWA 1EOVA 1S5BD 3TZUA 1I5FA 1G291 2B2TA 1W3SA 1Y1WG 3M85A 3EBEA 1GUWA 1SEBD 2F52A 2NVYH 3HGBA 4DR5L 2A6EC 4J8QA 1HZ9A 2IX3A 3CU7A 4QF4A 5GAHC 1N32L 1VQCA 2LMCB 1EYGA 1PH9A 1SJHD 2RSOA 5KYIA 3S1RH 3NE5B 1VQ4A 5A2QL 4ZRZA 4B3SQ 2VQFL 3N52A 3LWUA 3OW7A 4GKKL 4IZ8A 3PIPA 3MXGA 3I70A 1STNA 1M4VA 4CKCA 3J81c 4DR3Q 4KJOA 5D65A 3GP7A 1PH8A 3V2TA 3NSWA 2ZJPA 4JW0A 2CVRA 1S5ED 1YJWA 1GHJA 2ZXOA 1J5EL 1HCZA 2NVTH 2LSSA 4ABNA 2KOLA 1JCKB 4L63B 5HGTA 4BY1B 2RF4A 1AN8A 1HUNA 3UI2A 1X3FA 4JI3L 4B08A 3HKZG 4IFDG 2B2WA 3ULLA 1G8ZD 1HR0W 4A76A 4GNXA 2EYFA 1B2TA 2LXKA 3A74A 3VR6A 1D5MC 3T1HQ 2UU9Q 2AQ3B 2M9VA 2E5LQ 2WB1B 5J1ZA 5K5PA 5C0XH 4KHPL 3OIPA 2LKVA 4DV2L 3CCVA 5JEAJ 3J7AF 3PO3H 5ELDA 2UXBQ 2JQOA 1HA6A 4R4OA 1EQTA 3P75A 4JI6L 1K73C 2K32A 2IWHA 4RGTA 5HGQA 2SEBD 2ZTEA 2UUCL 1LM0A 3I4MG 5IP9H 2EY6A 4O0AA 4NMZA 4P75A 2Z6BA 4AYBE 1J9OA 1WTOA 4FXDA 5EKLA 4L5SA 3TP7A 2KENA 5IYDH 3T16A 3I56A 4BBRH 3SK5A 1UE6A 1SNPA 1WTPA 2E2IB 1TY2A 4QGUA 5C3WA 5K36H 2CH4W 1PLFA 4OIKA 1GUSA 4OXPA 1TWHH 2B8FA 1EY5A 2UUAQ 1O78A 4EQNA 4ZYSA 4DN4M 2QKIC 4K0KL 2KVMA 1G2SA 4OEMB 2CW0C 3VR4A 4BBSB 5E1FA 1K8OA 1X3EA 4G4KA 1KLUD 2JA8G 3G48A 3S1NB 4GKJL 2M00A 4AYBB 1I3QH 4X65Q 2B63H 2HDMA 3U4VA 4DAVA 5C4JB 4R1JA 3A8JE 1EEFD 1Y1VB 4DR4L 1Z9FA 3STBD 4TSSA 3TMEA 5E3FA 4KLKA 1AZQA 2VQFQ 2K01A 4DV7Q 1EYDA 1BCPC 1L0YB 5I4DA 2D2CC 5IYBH 4EGVA 3I8ZA 1QZGA 1Y8PB 3HOUB 2PQAB 4P2CB 3X3MA 5KYLA 1PVOA 2QGQA 4KN4C 4QMGA 2OF1A 1SAPA 1G91A 1BOSA 1Z7TA 5ELOA 4DAMA 5DEHA 3ZYYX 2CKZB 4HEDA 1F77A 4X62L 3I4NH 2J4XA 3GTPB 3IFDA 1E24A 4KTAA 3NHHA 4J1MA 1J5EQ 3KFUA 4JI7L 4A3FB 2HHHL 4C3JG 4MNOA 1YNJD 4H0LC 2IHFA 1NSNS 3CCMA 1C7YA 1BBWA 1LLRD 1Q12A 1NUCA 4ZKCB 2JJQA 4WFN3 1OXUA 1H9MA 4RWSC 5I6WA 1HTLD 3PIOA 5CV8A 4A3JH 1MJEA 1EFWA 3CC7A 1X3QA 1EQQA 4EQOA 1VQ8A 5EBDA 4IFDH 2JA7H 3GTGB 1UEBA 4JBJA 4JBMA 4Y52H 1M8AA 2VUMB 5M5YH 2DJGC 1BBUA 3T51B 2K5VA 2QEJC 2RA4A 2QW7A 4DV1L 4DV2Q 5M3FB 2EY5A 4KD4A 1JC7A 2NB0A 4DUYL 2Z1CA 1I6HH 1XNRL 1C48A 3PUYA 5KNCA 4LFAQ 2F3IA 4GOPC 1E2ZA 1QZHA 2DY8A 1PTOC 3PSIA 1JB7A 5CMDA 1N36Q 3D4DA 1BCPB 3HKZE 1HNWL 5LL6X 4QY7A 4CHTB 2Q2UA 1XPRA 4A3MG 5JPNC 1PA6A 1N34Q 1STGA 3NXWA 1ONLA 4K2LA 2B39A 3BDCA 3I4MH 1CHQD 1TWCH 2R7FA 3S1QB 5LMNW 1ML0D 4PMCA 2YTXA 3J7YW 3DUZA 3K8AA 5D14A 3WWVA 2CQAA 4C2MH 2KHSA 5IP7H 1HQMC 4A75A 4CGYB 3FDTA 1X32A 3M4OH 4UPAA 4CDEC 4IALA 5TSSA 3E9IA 3GO5A 1JJCB 2R3ZA 4G7ZC 1PFNA 4DK0A 1QJOA 2KHJA 1I50H 4WORA 1IZ6A 1IBKL 4BS9A 1RKNA 4I65A 3H91A 4NPSA 4YCWA 4NXMQ 1B1ZA 5E4WC 3HOVG 1YNXA 3FPUB 4POGA 5FLXL 1SYCA 4GOPA 4LF8L 1EIFA 1EWHA 2F0NA 3J80E 4GKJQ 2XRSD 3J80c 1VDZA 4X3KA 2A68C 3PO2B 1KQSA 2JA8H 2XVSA 4HJAA 1P16A 4IQZA 4RAUC 1H9SA 3GTMH 1RL2A 3AMUA 3HRZC 4MHEA 3OTOQ 3K58A 4GOPB 4A3LH 1XPOA 4ME3A 5D3IB 1O7LA 5HY6A 1Q90A 4A3BH 3A7AB 2DN8A 4QCLA 1SE4A 3I90A 4NXNQ 5NUCA 2R93H 1SSOA 3DM1A 4ULLA 3G71A 1QNUA 2LXJA 1A6XA 5CORA 2ATWA 1BDOA 1S4ZA 4K6LA 1KABA 2EVBA 4GS3A 1N8RC 1I4GA 1KTKA 2EDGA 4XQJA 1SE8A 4KKTA 4OL7A 4X62Q 2MO0A 3GTJB 3AB9A 5FOBB 1VQAA 4LF6L 4IN3A 4B3TQ 1V1PB 1E22A 2PO4A 4JI7Q 1EQRA 1FYCA 2MQHA 2HHHQ 2EYMA 5IGEA 3CF5A 3K80C 4F87A 3S15H 5LMUQ 4DV5L 1KD1C 3EN2A 4C3JH 2Q2HA 1SDFA 1NNXA 1GUTA 4DV3L 2IPKD 2F4IA 3VYSA 1EZ6A 5M5WB 3PCOB 2NWGA 1BQQT 3KYHC 5M3MH 3IAYA 3DWQA 2SDFA 2JA6B 1SNMA 3S2DB 2YTVA 1Q81C 1JJ2A 4QB4A 2TSSA 3H0GH 4N8X1 2R92G 3J81L 2JP1A 4DV4L 4MIUA 3OSOA 1CFMA 1TU2B 1D6EC 2AMCB 4IUPA 4HCSA 2E75C 5KNBA 4OHJA 3ND9A 1CKNB 4KV6A 3MTSA 4WJWA 1CK1A 1TWAB 5FO8B 4DUZL 2YU9B 1K3BC 3TZDA 1FJGL 3R3OA 4ME5A 1UE7A 3GTQH 2OEOA 1CTMA 1RHPA 1SFOH 4A3EH 1XMQQ 1DD2A 1XXGA 4HMJA 1OXSC 5FO7B 1IYVA 3V05A 2IW3A 4A3KH 1XNQL 1LABA 4OX9L 2RHSB 2K03A 4B9XA 4NDXA 3ICEA 1GD7A 3LX0A 1EY9A 1EQVA 2AHOB 3I72A 3RZOH 2CFMA 1IHZA 4P74A 1CA6A 3ER0A 1LACA 2Z6KC 3STBC 3HOWB 3S2HB 1VF7A 4BWGB 3CD6A 4MTNA 3M4YA 4OO1G 1K28A 3KBXA 3MWYW 4B3RL 4FDBA 1D1IA 4ZQ3A 2ZM6Q 3DEOA 5ELCA 3S14H 1EU3A 1X55A 2XWBB 1DXMA 1SNQA 4RGMA 1ESFA 1MSHA 1TS4A 3DEPA 3D8GA 3QO2A 1JWSD 5I2XA 3M9BA 2VZAA 3G6EA 1AE2A 1NAPA 4KKSA 2CW0D 4UY8C 2K50A 4ID6A 4DK3C 1QWYA 4JI0Q 1E7ZA 2DY7A 3CP0A 2F0UA 2KUMA 2E2JH 1AH9A 5CC4A 5CBAE 1RIPA 3PV0A 1E0BA 2EJGC 2F0GA 5C4XB 2VNUD 4JI8L 1K8GA 2MHVA 4YWLA 4LF6Q 1B50A 1PXUA 1RCVD 3F2DA 1YNNC 1WOCA 1DOLA 3GTLB 2X69A 1BCPD 1EL0A 4X3UA 4A3GH 1U4MA 4JI2L 3CHBD 1TVXA 2WIIB 3KDFA 4UHVA 1L2FA 2RCNA 1FNWA 1GUGA 3BVMA 5T1GA 1W6JA 4HCEA 5J39A 3MXNA 1R9TB 1KDBA 3I3CA 2E2HH 4ZUIA 2B2YA 4M1UB 5IGBA 3SVMA 2EYJA 4ZUJA 4BY7B 5IODA 3KF6A 5C3XA 4YY3L 3HOYG 3A5UA 3LGJA 3NBIA 5C0XG 1PH3A 1HUMA 4DV4Q 3T1HL 2UU9L 3F2CA 2HQLA 4IPCA 1N9WA 2VB3X 4LMQD 2XIWA 3GDEA 4IPDA 2R92H 1JE4A 2B2TC 5GAGC 2HCCA 1RJTA 4CDCC 1O7ZA 4F7XA 2NZ1D 4BXXG 1C0AA 1PFBA 4A3DB 2OTJA 5JJIA 4X64L 3T56B 5EBCA 3FRPB 2Y0SG 4IURA 1XWEA 1LTID 5IP9G 3W5OA 5KNDA 2JE6I 5ELNA 2XTIA 3GTKH 3M7NA 2K75A 3OYYA 1DYQA 2XRQD 2O5JC 3P1HA 2K33A 2I5MX 2D5DA 2PZWA 4C3HB 5IYDG 4FVMA 4N8FA 2GA4B 1U4RA 2O4XA 3K7UC 1WTRA 1QE6A 3DWAA 4BBRG 1XNQQ 3TRZA 1EY6A 4I7AA 2WACA 2M2LA 1HJPA 5K36G 2EXZA 1JMCA 2WAQG 3NQTA 5F2DA 1IYJB 1OTCA 1DGSA 1I6VC 4IFDI 4FXKC 2R61A 4XYQA 4EQ5A 1E3PA 3K7AB 3C2PA 3JC66 2D0OA 2K5QA 2NN6H 2UUAL 4B3RQ 2Q2IA 3UDIA 2AWOA 1U5KA 1X54A 3M7GA 3HOXB 2B63G 4OO1H 3D3RA 2L4NA 1CSPA 5I9OA 4UAIA 1B3QA 2B2WC 2TMPA 4X65L 4GNXC 4RGOS 1O80A 1WTQA 2A69C 4BY1H 1I4RA 1NBWA 2NUCA 2XNAC 5IYBG 1NCVA 4A3IG 4YCVA 5KEEA 4RG1A 1QCBD 1VQIA 2CWAA 3IKJA 4LWCA 2A68D 4DV7L 3FP9A 3ND8A 1FGUA 4JI8Q 1R4QB 1E2VA 3R8BA 1SNDA 4IUVA 1SYEA 4FF4A 1Z6HA 4P73A 3I4NG 1F2ZA 1WI5A 4JV5Q 2VL6A 4JI2Q 1S5CD 1QVFA 4Y7NH 3PUZA 3J80L 4RKLA 2B2UA 5KRUA 4QQBX 1SYDA 2I07B 5GAEC 4PQXA 2E2DC 4C56C 4A3JG 3D6WA 1VQ5A 1QOHA 3RLOA 2PNHA 1XTDA 1PRTF 2F0EA 1MKHA 3TEHB 1X65A 2MFIA 2JA7G 1G6ZA 4JOIA 4UP9A 3I91A 4YY3Q 1VQ7A 1HQRD 4XDXA 2EYLA 1V8QA 3DXJC 3JAMi 1B3AA 3HOYH 2VY3A 4GN5A 3HEJA 5CYUA 4CKEA 3SEBA 3QIAA 4KD3A 3BJUA 4JI4Q 2E2IH 3T13A 4GNXB 5IT9E 4U68A 1QUQA 4FXGC 2PPBC 3KLSX 3EQLC 1QNKA 3BVZA 4X64Q 3S1RB 4LFAL 1SNCA 4FO2A 1VQLA 2R7ZB 3AYHB 3EFXD 3J81i 4BXXH 1K0SA 2BA1A 4BA1I 4LNQA 1N36L 1HNXL 3RZDB 1SE2A 3TBIB 1YEZA 4BBSH 3K5LA 2YTYA 1XMOQ 1VQFA 1N34L 3URYA 3S1MB 4GLVB 1WCMG 3TS0A 1HR0Q 1A2UA 4DNTB 1PZJD 3K5MA 5JEAH 3A55A 1SE3A 5C4JH 3K0YA 5IP7G 1B9MA 3FVQA 3NTKA 4U673 1N33Q 1SRUA 2K28A 3DMUA 4I7ZC 4K5XA 1BVSA 4X3TA 5FLMG 2JA5H 5C44H 2NVTB 1PYSB 1A62A 1WYDA 3OIQA 1YHQA 2Y0SE 4DGZA 1CM9A 4G57A 3VDYA 4NKLA 1X6OA 5EGTA 1SYBA 1Q82C 5DM73 2L55A 2F0TA 3PUVA 4K8IA 1PH1A 4DA2A 2JYOA 1MSGA 2WINB 4NXML 2ID0A 2K14A 3GTPH 3NBHA 1O7YA 1F9SA 4PZ7A 1EOTA 1KRSA 1YZ6A 4OGQC 4DV6Q 4LF7L 1EYAA 4CBVA 4A3FH 4MZ9A 3LWEA 5FKAC 1ZKOA 4A3LG 4YCUA 2BE5C 2WAQE 5BN4A 4DR1L 5IGDA 3M3YB 3PO3B 2HD3A 2FFKB 4EVOA 3OTOL 4A3BG 3EROA 2Q2TA 1BF4A 3HOZG 4AQYQ 1SMYC 3MZ5A 1LO5D 1K8AC 2BDNA 2R93G 3OMGA 1LT5D 2Y0SB 3KBGA 1IW7C 4A3IH 3GTGH 4NXNL 2VUMH 3PF4A 1G2TA 1NR2A 1STYA 1STAA 1DZ1A 4QIWE 3A7LA 2QDBA 1DCZA 1GM5A 4LFCL 3RLFA 3C1FA 1R4PB 2PCFB 5DM63 1IL2A 4FF1A 5EPJA 4MTKA 1CZWA 3S17B 1UAPA 2RDHA 2I5HA 3PUXA 3KLSA 3VYUA 3W1BA 4B3TL 1JE5A 2Z4IA 1E1TA 2K1BA 2EE1A 1NTGA 1CZGA 5AJ3Q 2ZJQA 4DAYA 5EKKA 3MFGA 4ZLTF 5LMUL 1YHAA 1B8AA 2IL8A 1YNND 3U4ZA 1D7QA 3S1QH 2OTLA 3NTHA 1CI3M 3PIO3 5M3MG 3PMFA 5JJKA 1HFGA 4DAYB 1Y1WB 1DOKA 1C4QA 1GUNA 4QIWB 3NTIA 1I3QB 1H9JA 2RSNA 3CMAA 3H0GG 4H02A 1V1QA 1E1OA 2XWJB 3H3VH 1G6PA 1YVCA 1TQOA 1PH4A 3OW2A 2EY1A 1CT1D 1JOQA 1KL9A 2EOTA 3T53B 2Z9HA 3KK7A 3ULPA 1YHBA 1D5XC 1GKHA 1HNXQ 4DFAA 4DXFA 3CC2A 2ICIA 4HSPA 1WVLA 2E76C 2RDGA 2OQKA 1CKOA 1B53A 1J8IA 1MI2A 2F0DA 2AQ1B 1JOKA 3PO2H 4A3EG 5FJ8G 3K59A 5JVH3 1MD2D 4OWTB 1WCMH 2KBNA 3D4RA 3ONAB 3QOLA 3RMHA 1SXTA 4L6TB 1XMQL 2K6AA 1PTOH 4A3KG 1Y14B 1Q7YC 5FLMH 4F8MA 2ES2A 1QVGA 5COYA 2OCEA 4PMWA 2QF7A 2DNEA 1SR3A 5I9PA 5G3LF 4RHRA 2JN4A 1XJVA 3HKZB 3WOFA 4WRDA 2I0QA 1OXTA 1SJED 2N78A 3ZJYC 4DNIA 5A2QE 3S9WA 4IJHA 4FF3A 2IHEA 2R7DA 4MN3A 4LF7Q 1S5FD 2KQ3A 2XN9C 3A0JA 1I6HB 3MXPA 5LMNQ 1LTRD 1PMRA 3TDQA 4DR1Q 2L15A 2WKCA 1STHA 1TXYA 2ZM6L 1JQYD 3KF8A 1V43A 2F1MA 1MIUA 5CV4A 4LF5Q 2B2VA 2UXCQ 3ERQA 3TP8A 3G6JB 3FEWX 3HOZH 3A8KE 5M5WH 2HCIA 4HJ9A 1H9SB 3EVQA 2UUBQ 2J7ZA 4R4TA 2E8GA 1A3UA 5IOCA 3KF8B 4JI0L 3TP6A 1LYLA 2JA6H 3I4MB 4LFCQ 1WD1A 3S16B 3RLNA 1A3VA 4RCOA 5EKIA 1C8CA 2I5LX 2A69D 2PMZE 1ICFB 1FD7D 3E3XA 5EQ0A 1I94Q 4C2MB 2GVAA 4UDUC 3GTOH 4A3GG 3M4OB 1L1OA 4B3ML 1EIGA 1J6QA 2HDLA 1A8VA 3F1ZA 2ALYB 3TN2A 3CCSA 1HNZQ 1BUVT 4X3SA 4OONA 1BCPF 5M5XH 3RUZA 4HJ5A 1KHIA 3CPWA 1TWAH 1PH5A 2YU9H 4X6AH 3M4PA 2BOSA 3BVGA 3CCRA 1Q3LA 4C3IH 3PGZA 2SOBA 4IUUA 4OO1I 1Y69U 4A93G 3QB3A 5C3EH 2EZVA 2Z8LA 3HZXA 1RTNA 2JA8B 4PNYA 2PMZB 1HXYD 3GTMB 1A15A 3CW2C 4ZCKA 1PH7A 5A35A 4HMIA 4PMBA 1AP0A 2UXDL 4HR7B 4A3BB 4KHVA 3VA5A 2PW7A 4TRDA 2XGTA 3FKIH 2R93B 3P7JA 2Z4HA 2NVXB 4GN4B 3A54A 4P72A 4KY6A 2IY5B 1B44D 2GN5A 3NEMA 3CQZH 4YHHL 1T5XD 3I73A 3VYRA 5FJ8H 1UNSA 4JCVE 4LJZC 1KLGD 1PTOF 2CWPA 5I2YA 1WD0A 5J22A 2N3SA 3NWSA 1TWFB 1K83B 4NP5A 4JYAQ 1ILPA 3S15B 3L7ZC 4Q5VA 1NY4A 2AKWB 2VXWA 4C3JB 1X9NA 2JK8A 1EY4A 1SMXA 3EJIA 3HKSA 1I4PA 1WFQA 1EY0A 1Z47A 2EYPA 2FHTA 2LFNA 4H13C 4EX5A 5ELEA 2JEBI 3ERSX 4RKBA 3BS1A 2NN6G 1TT2A 1ET6A 2ZXRA 1SN8A 1B9NA 1K8MA 1PZKD 2QEXA 4ZKBB 2L5TA 3GTLH 1K9MC 3CRLC 5C0XI 1XPUA 3BDOA 1U9RA 3HG9A 3HS0C 1VQOA 2DGYA 4H44C 5IGGA 2B2YC 1RF2D 2QDLA 1A2TA 2IJ0A 5D3DA 5C6AA 3CCQA 4BY1G 1MGSA 1LTAD 1DJRD 1M90C 2N49A 1QILA 1IBML 3R2IA 3TREA 3MAQA 4TQUS 3PQIA 3PF5A 1PV4A 4BY7H 4A3MB 1EIYB 2KA7A 1H95A 2WB1G 4O42A 1OXVA 2RDFA 1YITA 4ZAIA 3GTQB 4O1NA 4HSVA 1SFOB 2BE5D 1EEID 4A3EB 1CQVA 1JR0D 1MHWC 3KOJA 4XT1B 5C5LA 1GUOA 1EU4A 1Y8OB 3CXCA 4B3MQ 3TS2A 2X6LA 1PH6A 1SMYD 2KCMA 1SNOA 3CKIB 3MXUA 3GV3A 5BN3A 1IW7D 4JV5L 3NP8A 1E2WA 4H7BA 4IUNA 5LL6S 4JBKA 2EPBA 3SK4A 5IGCA 5DLQE 1VQ6A 1PDQA 1U0LA 5J3BA 3C3LA 3NENA 4WJ3M 1NJIC 5BR8Q 3RZOB 1T5EA 4S3SA 2H4OA 4RGNA 1LT3D 1V9PA 2KCTA 4C3HH 1VQBA 1C9OA 3KDFB 1JWUD 3H15A 3RN2A 3G4SA 3HOVB 1KAAA 1H9KA 4A93H 2BA0A 3MXNB 3DLLA 1AW7A 1L0WA 1M1KC 3EA6A 5I6YA 2UXDQ 3UDFA 5JPMC 1GVPA 1VQMA 4JI4L 1VQHA 4PG3A 2P5ZX 2AWNA 3KF6B 1DONA 1B7YB 3I2ZA 5IWAL 5JOBA 2FXQA 2Q8IB 3V96A 2CHBD 3L2PA 1FR3A 2K04A 4OWXB 3OWEB 4K2KA 4BBSG 5DNFA 2PI2A 4AYBG 1TKWB 1F2YA 3H6MA 4YHHQ 5JAVA 4KI0A 5CR3A 5JEAG 4N9PA 1XMOL 3F2UA 1Y1VG 4IPHA 2HT1A 1NMFA 4OWWB 2NVQB 1A63A 4KY5A 1HR0L 1BKBA 4K5WA 3AQQA 3LNNA 1ENFA 5FLXE 2JA5G 2CCZA 5C44G 1LTGD 1S72A 2RCFA 1N33L 4E6IA 1PH2A 3HOUG 3FMCA 1TS3A 2D62A 1EY8A 1VMPA 4XYOA 2K5DA 2E2HB 2F4VQ 1F9RA 2DUDA 3SE0A 4X66Q 4GLAC 4CJ1B 1BBXC 2PNRC 2B2UC 1Q1EA 3IL8A 3H3VI 4L5TA 1EIHA 3X3NA 2YYZA 5E7NA 4POFA 4A3FG 2BH2A 2DJFC 1I4XA 2KCNA 2R92B 4ALPA 4UP8A 4DV6L 1UUPA 4JOIC 5L37A 1RTOA 1BR9A 1IBMQ 3D0FA 2NYZD 2A6HD 4FNFA 4CJ2C 3GV6A 5IYCH 4AQYL 3GTKB 2ZXPA 4UP7A 2VUMG 1PFSA 5CBEE 5EPLA 1VQEA 1JICA 2HIXA 1I4HA 5M3FG 2O2LD 3JAME 3PIP3 2BDOA 3A8IE 1XX8A 1ZEQX 2B29A 3JAMc 4XQNA 1TWGB 1UWVA 3BYYB 2ZJRA 2V1CC 2Q8RE 1FVIA 3SDZA 2G9DA 2R7ZH 3R2TA 1KRTA 3RZDH 3T1YQ 4GLXA 3D6CA 2EXDA 2F3WA 3J81E 3E0EA 2WB1E 3GQBA 1UE5A 5AJ3L 1PHJA 2IX1A 3S1MH 1GXDC 4XTCS 4RCNA 4AH6A 1CKMA 3CC4A 1DOMA 5EJWA 3U58A 2F0VA 1VCIA 3DHQA 3BU2A 3EIVA 4R9WA
chains in the Genus database with same CATH topology
4LF9L 5LMUQ 1B8AA 4KHZA 2PI2E 3U4ZA 2VQEL 3EN2A 4DV5L 1KD1C 4DV5Q 4LUOA 4C3JH 2OTLA 3S1QH 2Q2HA 4YWKA 5M3MG 3I7FA 5JJKA 4XIGS 4DV3L 4DAYB 4DV3Q 4A4IA 2IX0A 2N8NA 5GQOA 4JI1Q 3CMAA 3H0GG 3PCOB 4H02A 1V1QA 3KYHC 1E1OA 5M3MH 5IWAQ 4IPGA 5C0XJ 1YVCA 4TVAB 3H3VH 1G6PA 2R6GA 5IT9c 1O7IA 3K7AH 1MJCA 2YTVA 3BZCA 3L0OA 1Q81C 1PH4A 1HZAA 3OW2A 1JJ2A 4DR7L 1K0RA 3H0GH 2R92G 3UE1A 1UE1A 1VS0A 4DV4L 1KL9A 3AFQA 1X56A 3KJPA 3HOXH 2E5LL 3ULPA 1YHBA 2YV5A 1GKHA 1HNXQ 2Z0SA 1QUQB 3PO2G 5GROA 3CC2A 2AMCB 1YIJA 3S1NH 2OQKA 1YI2A 1CKOA 1CKNB 3PO3G 1T9HA 1VQJA 3TQYA 3CPFA 2ZTCA 3KLWA 3PO2H 4A3EG 1B70B 2EQSA 4AIMA 1Y1VH 5FJ8G 5FLXc 4DUZL 3M3YH 2UXBL 4OWTB 4DUZQ 1FJGL 1SLJA 1WCMH 2KBNA 1FJGQ 1UE7A 4A3CG 3RNUA 2CQOA 3GTQH 4DKAC 1XMQL 1SFOH 1HH2P 2VS1A 4A3EH 1XMQQ 4A3KG 1Y14B 1KC8C 1OXSC 1AE3A 3GD7A 4A3CH 3HOUH 4R4CA 1Q7YC 2ZTDA 1KAWA 5FLMH 1G51A 4A3KH 1TWGH 3RN5A 2ES2A 1QVGA 3ULJA 4OX9L 2OCEA 1XNQL 4OX9Q 4PMWA 2RHSB 4HIOA 1SR3A 1X3GA 1PYBA 3ICEA 4L5QA 1GD7A 2NZOA 3SGIA 3A5ZB 3S17H 1XJVA 1LTLA 2AHOB 2I0QA 1IXRA 3RZOH 1OXTA 2CFMA 4P74A 2N78A 3ZJYC 1LUZA 2JA9A 3ER0A 4QJFA 4DNIA 2Z6KC 2K52A 4IJHA 4LUVA 3STBC 4JI5Q 2IHEA 2IT1A 2R7DA 4DK6C 4DR6Q 4LF7Q 3CCLA 2WFWA 3CD6A 4MTNA 5LMNL 3W1GA 1EOVA 3A0JA 5LMNQ 1I5FA 3K81C 4OO1G 2MNAA 1G291 1KXLA 3NBHB 4B3RL 1W3SA 4NB3A 2EIFA 4DR1Q 1S3OA 2L15A 4FDBA 4DPGA 3M85A 1TXYA 3EBEA 2ZM6L 1Y1WG 4R4IA 2ZM6Q 4LFBL 2F52A 1V43A 4LF5L 1MIUA 1X55A 3S14H 5H1SE 4LF5Q 2NVYH 4DR2L 1D7QA 2UXCL 4DR5L 2JA6G 1JJGA 1HZ9A 2UXCQ 4DR5Q 1Y1WH 3HOZH 3M9BA 2VZAA 5M5WH 3G6EA 4HJ9A 3UDGA 5GAHC 2UUBL 2UUBQ 1N32L 1VQCA 1AE2A 4R4TA 1N32Q 2E8GA 4UY8C 1EYGA 2K50A 3KF8B 1VQDA 5M3FH 1LYLA 4DK3C 3B6YA 1PH9A 4JI0L 2JA6H 4JI0Q 4LFCQ 1E7ZA 3CP0A 3RLNA 2PQAA 3S1RH 2E2JH 1I94L 1AH9A 5IE8A 2I5LX 2PMZE 1VQ4A 1I94Q 4B3SQ 2VQFL 1RIPA 3PV0A 2GVAA 3AEVA 1CSQA 3GTOH 3CAMA 4GKKL 2VNUD 3PIPA 4JI8L 1K8GA 3MEFA 4A3GG 1L1OA 4GKKQ 4YWLA 4B3ML 4LF6Q 1J6QA 3J81c 1A8VA 3F2DA 3F1ZA 4DR3Q 1HNZL 3CCEA 3IRBA 1WOCA 2ALYB 3CCSA 1HNZQ 1PH8A 4OONA 5M5XH 3UE0A 4A3GH 4JI2L 4HJ5A 4BA2I 2ZJPA 1KHIA 3KDFA 3CPWA 1L2FA 1TWAH 2RCNA 1PH5A 2YU9H 1YJWA 4X6AH 4LF9Q 3M4PA 2VQEQ 3CCRA 5C3EG 4LF4L 2KHIA 1J5EL 4C3IH 4P71A 3PGZA 2NVTH 2LSSA 1Q46A 4IFDJ 4JG2A 2E2HH 4OO1I 4Y52H 4A93G 2RF4A 5C3EH 1X3FA 1VQNA 2A19A 4JI3L 3HKZG 3KF6A 4IFDG 3ULLA 4YY3L 4JI3Q 1HR0W 4A76A 3HOYG 3A5UA 4GNXA 3CW2C 4DR7Q 4O2DA 3LGJA 5C0XG 1PH3A 2LXKA 3A74A 1PH7A 2BH8A 4DV4Q 3FKIG 3T1HL 3HOWG 2UU9L 3F2CA 2HQLA 4IPCA 3T1HQ 1N9WA 2UU9Q 2UXDL 2E5LQ 5JJLA 3GDEA 4IPDA 2R92H 3F8TA 4IOAA 5GAGC 4KHPL 2XGTA 1W2BA 3FKIH 4DV2L 4KHPQ 1JT8A 4BXXG 1C0AA 2OTJA 5JJIA 4X64L 4GN4B 1A0IA 2Y0SG 4P72A 3CCVA 5JEAJ 2IY5B 3PO3H 2GN5A 3W5OA 5IP9G 4IO9A 2JE6I 2JQOA 2UXBQ 3NEMA 4R4OA 2XTIA 3Q8DA 5ELNA 4L5RC 3GTKH 2K75A 3CQZH 4JI6L 3M7NA 3OYYA 4YHHL 1K73C 1IBLL 4JI6Q 5FJ8H 5HGQA 2I5MX 5IY0A 1FL0A 2HIVA 2ZTEA 1LM0A 2UUCL 3I4MG 5IP9H 4O0AA 5IYDG 4JCVE 2UUCQ 3I4OA 4P75A 2CWPA 3K7UC 3D31A 4AYBE 4BBRG 4JYAL 2N3SA 4L5SA 1XNQQ 3TRZA 5C4XG 1ASYA 4JYAQ 3L7ZC 3S16H 2KENA 2H5XA 5IYDH 1L1OC 1NY4A 2AKWB 1YBYA 1X9NA 2JK8A 1SROA 1SMXA 3HKSA 1HJPA 3I56A 1WFQA 5K36G 1Z47A 4BBRH 2WAQG 1JMCA 4EX5A 2OWOA 3GTJH 1HZCA 4GN3B 2JEBI 3ERSX 1IYJB 2A8VA 1OTCA 2NN6G 1DGSA 4QGUA 1SN8A 2QEXA 2K5HA 4IFDI 4EQ5A 4OXPA 3GTLH 1E3PA 1TWHH 1K9MC 3JC66 2D0OA 5C0XI 1YJNA 1XPUA 4IOCA 2UUAL 3J7ZC 1VQOA 1S40A 2UUAQ 2DGYA 4B3RQ 2Q2IA 3UDIA 4LW1A 3M4QA 2AWOA 1U5KA 1X54A 2B63G 3CCQA 4LFBQ 4K0KL 1CSPA 4BY1G 4YWMA 4K0KQ 2ASBA 4DR2Q 1M90C 2N49A 1X3EA 2JA8G 4BY7G 3G48A 4GKJL 4LUZA 4X65L 1I3QH 4GNXC 1IBML 3TREA 4X65Q 2B63H 4WJ4A 3U4VA 4BY1H 3S15H 1CUKA 1NBWA 3FHWA 4TQUS 3F2BA 4R1JA 3PF5A 3S2DH 1YJ9A 1PV4A 4BY7H 4DR4L 5IYBG 1EIYB 1H95A 1Z9FA 3STBD 2WB1G 4DR4Q 1OXVA 4YCVA 4A3IG 4KLKA 1YITA 4RG1A 2CWAA 1VQIA 4LWCA 4DV7L 2VQFQ 3CMEA 4DV7Q 3FP9A 5IYBH 4DV0L 3KOJA 3BZKA 4A3DG 1FGUA 4JI8Q 1QZGA 2RHQB 3CXCA 4B3MQ 1P8LA 3TS2A 1PH6A 2PQAB 4HJ7A 4P73A 3I4NG 2KCMA 1PVOA 2QGQA 1WI5A 4JBWA 4JV5L 4DAMA 5ELOA 2NVXH 4JBKA 4JV5Q 2VL6A 4JI2Q 2C35B 2CKZB 5DLQE 2QA4A 1QVFA 3E9HA 1U0LA 1VQ6A 1L1OB 4X62L 4Y7NH 3I4NH 5J3BA 3PUZA 1WJJA 5BR8L 1E24A 2NN6I 3NENA 1NJIC 5BR8Q 3J80i 4WJ3M 4LF4Q 1QVCA 1J5EQ 4QQBX 3KFUA 3RR5A 5GAEC 1V9PA 2KCTA 4JI7L 1EWIA 4C3HH 1VQBA 1C9OA 3KDFB 3H15A 4A3JG 2HHHL 3RN2A 3G4SA 3CCUA 1VQ5A 4MNOA 4PZ6A 2IHFA 3RLOA 2PNHA 3CCMA 1XTDA 1C7YA 1MKHA 1BBWA 1Q12A 1X65A 2MFIA 1TWFH 1K83H 3TEHB 4JOIA 4UP9A 4YY3Q 2JJQA 1VQ7A 2JA7G 4A93H 1OXUA 4A3JH 2BA0A 3MXNB 3PIOA 1MJEA 1EFWA 3CC7A 2WP8J 3DLLA 1L0WA 3JAMi 1EQQA 1M1KC 1VQ8A 4PZ8A 1VQ9A 2JA7H 3UDFA 5LMUL 2UXDQ 3HOYH 1UEBA 2VY3A 4JBJA 1GVPA 4GN5A 4JI1L 1VQMA 1VQHA 4JBMA 4JI4L 4PG3A 3KF6B 2AWNA 3BJUA 5M5YH 3J81j 2E2IH 1B7YB 3I2ZA 4JI4Q 1BBUA 5IWAL 3HOWH 2K5VA 3S2HH 2FXQA 4GNXB 2VW9A 4DV1L 4DV2Q 2NZHA 4DV1Q 1EUJA 1QUQA 4DUYL 3L2PA 3HOXG 4DUYQ 1I6HH 1XNRL 4OWXB 3PUYA 4X64Q 4LFAL 2GVBA 2K5NA 1NE3A 1CKNA 1NMGA 2F3IA 4LFAQ 4GOPC 1VQLA 1XNRQ 3AYHB 1QZHA 3J81i 2PI2A 4AYBG 2BA1A 4BA1I 4BXXH 4LNQA 1N36L 2MO1A 3PSIA 1JB7A 1HNXL 1N36Q 4YHHQ 1YEZA 1IBLQ 3KJOA 4KI0A 5JEAG 3HKZE 1XMOL 4BBSH 1HNWL 1VQPA 2YTYA 1Y1VG 4IPHA 4QY7A 5GADC 4A3MG 1NMFA 1XMOQ 4HIDA 1VQFA 1XPRA 1PA6A 1N34L 4OWWB 1A63A 4GLVB 1N34Q 1HR0L 1WCMG 1BKBA 3TS0A 1HR0Q 3AQQA 3HFZB 2JA5G 5C4JH 2CCZA 5C44G 3I4MH 5IP7G 1TWCH 4A3MH 1VQGA 2R7FA 1S72A 5LMNW 1OXXK 1N33L 2YTXA 2JEAI 1N33Q 1SRUA 3K8AA 3WWVA 1Q1BA 1PH2A 4C2MH 3K80C 3HOUG 1BVSA 5C4XH 5FLMG 2JA5H 2D62A 5C44H 1PYSB 5EAYA 5IP7H 2F4VL 1A62A 4A75A 2HT1A 2F4VQ 1WYDA 3M4OH 4UPAA 1YHQA 1KIXA 2Y0SE 1GO3E 2A1AA 3E9IA 3GO5A 4RMFA 2DUDA 1JJCB 4X66L 3DM3A 4X66Q 3VDYA 4GLAC 4IJLA 2KHJA 1I50H 4HIKA 1X6OA 1IZ6A 1Q1EA 4APVA 1Q82C 1IBKL 4JC0A 3CCJA 1IBKQ 3NELA 3PUVA 3H3VI 1PH1A 3J7A5 4NPSA 4L5TA 1HNWQ 4NXML 2ID0A 2K14A 2YYZA 5E7NA 4POFA 3AFPA 4YCWA 4A3FG 4NXMQ 3GTPH 2BH2A 4PZ7A 3HOVG 1YNXA 4ALPA 4DR6L 4UP8A 4POGA 4DV6L 4JI5L 4JOIC 4GOPA 1KRSA 1YZ6A 5IYCG 3U50C 4DV6Q 1R9TH 4LF8L 1EIFA 1Q86C 4LF7L 4LF8Q 4GKJQ 4A3FH 2Q2UA 1IBMQ 4MZ9A 3D0FA 3J80c 4A3LG 3HOVH 1Q8KA 4YCUA 1KQSA 2WAQE 3K0XA 2JA8H 4HIMA 4DR1L 5IYCH 4HJAA 1P16A 3GTMH 1ASZA 4HJ8A 3OTOL 1RL2A 4A3BG 3OTOQ 3S24A 4AQYL 2Q2TA 3HOZG 4UP7A 4GOPB 2VUMG 1PFSA 4AQYQ 4A3LH 1K8AC 1XPOA 4ME3A 2R93G 1VQEA 2HIXA 5M3FG 1D8LA 4R4QA 5HY6A 4DV0Q 4A3IH 3GTGH 4A3BH 3PUWA 3I55A 4NXNL 2VUMH 3PF4A 1K3RA 4BBSG 4NXNQ 3JAMc 2B29A 2B3GA 4QIWE 2D0PA 2R93H 2R7ZG 1GM5A 1UWVA 3G71A 2LXJA 4LFCL 3RLFA 2ATWA 4A3DH 2ZJRA 2V1CC 4GS3A 1N8RC 1IL2A 1FVIA 1SE8A 4B3SL 3UDXA 2R7ZH 4X62Q 2MO0A 1HZBA 2I5HA 3PUXA 2K4KA 1KRTA 3T1YL 3W1BA 3RZDH 3T1YQ 4GLXA 1JE5A 1VQAA 4B3TL 2EXDA 4LF6L 4J15A 4B3TQ 1E1TA 4DR3L 1E22A 2OQ0A 3E0EA 2WB1E 1NTGA 1UE5A 1EQRA 4QL5A 5AJ3L 4JI7Q 1PHJA 2IX1A 2NVQH 5AJ3Q 3S1MH 2MQHA 4XTCS 4AH6A 2HHHQ 2ZJQA 1CKMA 1VQKA 3CC4A 3U58A 3BU2A 3CF5A 1VCIA 2Z6KA 1YHAA 1UE6A 3EIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 L;  5LMU Q;  1B8A A;  4KHZ A;  2PI2 E;  3U4Z A;  2VQE L;  3EN2 A;  4DV5 L;  1KD1 C;  4DV5 Q;  4LUO A;  4C3J H;  2OTL A;  3S1Q H;  2Q2H A;  4YWK A;  5M3M G;  3I7F A;  5JJK A;  4XIG S;  4DV3 L;  4DAY B;  4DV3 Q;  4A4I A;  2IX0 A;  2N8N A;  5GQO A;  4JI1 Q;  3CMA A;  3H0G G;  3PCO B;  4H02 A;  1V1Q A;  3KYH C;  1E1O A;  5M3M H;  5IWA Q;  4IPG A;  5C0X J;  1YVC A;  4TVA B;  3H3V H;  1G6P A;  2R6G A;  5IT9 c;  1O7I A;  3K7A H;  1MJC A;  2YTV A;  3BZC A;  3L0O A;  1Q81 C;  1PH4 A;  1HZA A;  3OW2 A;  1JJ2 A;  4DR7 L;  1K0R A;  3H0G H;  2R92 G;  3UE1 A;  1UE1 A;  1VS0 A;  4DV4 L;  1KL9 A;  3AFQ A;  1X56 A;  3KJP A;  3HOX H;  2E5L L;  3ULP A;  1YHB A;  2YV5 A;  1GKH A;  1HNX Q;  2Z0S A;  1QUQ B;  3PO2 G;  5GRO A;  3CC2 A;  2AMC B;  1YIJ A;  3S1N H;  2OQK A;  1YI2 A;  1CKO A;  1CKN B;  3PO3 G;  1T9H A;  1VQJ A;  3TQY A;  3CPF A;  2ZTC A;  3KLW A;  3PO2 H;  4A3E G;  1B70 B;  2EQS A;  4AIM A;  1Y1V H;  5FJ8 G;  5FLX c;  4DUZ L;  3M3Y H;  2UXB L;  4OWT B;  4DUZ Q;  1FJG L;  1SLJ A;  1WCM H;  2KBN A;  1FJG Q;  1UE7 A;  4A3C G;  3RNU A;  2CQO A;  3GTQ H;  4DKA C;  1XMQ L;  1SFO H;  1HH2 P;  2VS1 A;  4A3E H;  1XMQ Q;  4A3K G;  1Y14 B;  1KC8 C;  1OXS C;  1AE3 A;  3GD7 A;  4A3C H;  3HOU H;  4R4C A;  1Q7Y C;  2ZTD A;  1KAW A;  5FLM H;  1G51 A;  4A3K H;  1TWG H;  3RN5 A;  2ES2 A;  1QVG A;  3ULJ A;  4OX9 L;  2OCE A;  1XNQ L;  4OX9 Q;  4PMW A;  2RHS B;  4HIO A;  1SR3 A;  1X3G A;  1PYB A;  3ICE A;  4L5Q A;  1GD7 A;  2NZO A;  3SGI A;  3A5Z B;  3S17 H;  1XJV A;  1LTL A;  2AHO B;  2I0Q A;  1IXR A;  3RZO H;  1OXT A;  2CFM A;  4P74 A;  2N78 A;  3ZJY C;  1LUZ A;  2JA9 A;  3ER0 A;  4QJF A;  4DNI A;  2Z6K C;  2K52 A;  4IJH A;  4LUV A;  3STB C;  4JI5 Q;  2IHE A;  2IT1 A;  2R7D A;  4DK6 C;  4DR6 Q;  4LF7 Q;  3CCL A;  2WFW A;  3CD6 A;  4MTN A;  5LMN L;  3W1G A;  1EOV A;  3A0J A;  5LMN Q;  1I5F A;  3K81 C;  4OO1 G;  2MNA A;  1G29 1;  1KXL A;  3NBH B;  4B3R L;  1W3S A;  4NB3 A;  2EIF A;  4DR1 Q;  1S3O A;  2L15 A;  4FDB A;  4DPG A;  3M85 A;  1TXY A;  3EBE A;  2ZM6 L;  1Y1W G;  4R4I A;  2ZM6 Q;  4LFB L;  2F52 A;  1V43 A;  4LF5 L;  1MIU A;  1X55 A;  3S14 H;  5H1S E;  4LF5 Q;  2NVY H;  4DR2 L;  1D7Q A;  2UXC L;  4DR5 L;  2JA6 G;  1JJG A;  1HZ9 A;  2UXC Q;  4DR5 Q;  1Y1W H;  3HOZ H;  3M9B A;  2VZA A;  5M5W H;  3G6E A;  4HJ9 A;  3UDG A;  5GAH C;  2UUB L;  2UUB Q;  1N32 L;  1VQC A;  1AE2 A;  4R4T A;  1N32 Q;  2E8G A;  4UY8 C;  1EYG A;  2K50 A;  3KF8 B;  1VQD A;  5M3F H;  1LYL A;  4DK3 C;  3B6Y A;  1PH9 A;  4JI0 L;  2JA6 H;  4JI0 Q;  4LFC Q;  1E7Z A;  3CP0 A;  3RLN A;  2PQA A;  3S1R H;  2E2J H;  1I94 L;  1AH9 A;  5IE8 A;  2I5L X;  2PMZ E;  1VQ4 A;  1I94 Q;  4B3S Q;  2VQF L;  1RIP A;  3PV0 A;  2GVA A;  3AEV A;  1CSQ A;  3GTO H;  3CAM A;  4GKK L;  2VNU D;  3PIP A;  4JI8 L;  1K8G A;  3MEF A;  4A3G G;  1L1O A;  4GKK Q;  4YWL A;  4B3M L;  4LF6 Q;  1J6Q A;  3J81 c;  1A8V A;  3F2D A;  3F1Z A;  4DR3 Q;  1HNZ L;  3CCE A;  3IRB A;  1WOC A;  2ALY B;  3CCS A;  1HNZ Q;  1PH8 A;  4OON A;  5M5X H;  3UE0 A;  4A3G H;  4JI2 L;  4HJ5 A;  4BA2 I;  2ZJP A;  1KHI A;  3KDF A;  3CPW A;  1L2F A;  1TWA H;  2RCN A;  1PH5 A;  2YU9 H;  1YJW A;  4X6A H;  4LF9 Q;  3M4P A;  2VQE Q;  3CCR A;  5C3E G;  4LF4 L;  2KHI A;  1J5E L;  4C3I H;  4P71 A;  3PGZ A;  2NVT H;  2LSS A;  1Q46 A;  4IFD J;  4JG2 A;  2E2H H;  4OO1 I;  4Y52 H;  4A93 G;  2RF4 A;  5C3E H;  1X3F A;  1VQN A;  2A19 A;  4JI3 L;  3HKZ G;  3KF6 A;  4IFD G;  3ULL A;  4YY3 L;  4JI3 Q;  1HR0 W;  4A76 A;  3HOY G;  3A5U A;  4GNX A;  3CW2 C;  4DR7 Q;  4O2D A;  3LGJ A;  5C0X G;  1PH3 A;  2LXK A;  3A74 A;  1PH7 A;  2BH8 A;  4DV4 Q;  3FKI G;  3T1H L;  3HOW G;  2UU9 L;  3F2C A;  2HQL A;  4IPC A;  3T1H Q;  1N9W A;  2UU9 Q;  2UXD L;  2E5L Q;  5JJL A;  3GDE A;  4IPD A;  2R92 H;  3F8T A;  4IOA A;  5GAG C;  4KHP L;  2XGT A;  1W2B A;  3FKI H;  4DV2 L;  4KHP Q;  1JT8 A;  4BXX G;  1C0A A;  2OTJ A;  5JJI A;  4X64 L;  4GN4 B;  1A0I A;  2Y0S G;  4P72 A;  3CCV A;  5JEA J;  2IY5 B;  3PO3 H;  2GN5 A;  3W5O A;  5IP9 G;  4IO9 A;  2JE6 I;  2JQO A;  2UXB Q;  3NEM A;  4R4O A;  2XTI A;  3Q8D A;  5ELN A;  4L5R C;  3GTK H;  2K75 A;  3CQZ H;  4JI6 L;  3M7N A;  3OYY A;  4YHH L;  1K73 C;  1IBL L;  4JI6 Q;  5FJ8 H;  5HGQ A;  2I5M X;  5IY0 A;  1FL0 A;  2HIV A;  2ZTE A;  1LM0 A;  2UUC L;  3I4M G;  5IP9 H;  4O0A A;  5IYD G;  4JCV E;  2UUC Q;  3I4O A;  4P75 A;  2CWP A;  3K7U C;  3D31 A;  4AYB E;  4BBR G;  4JYA L;  2N3S A;  4L5S A;  1XNQ Q;  3TRZ A;  5C4X G;  1ASY A;  4JYA Q;  3L7Z C;  3S16 H;  2KEN A;  2H5X A;  5IYD H;  1L1O C;  1NY4 A;  2AKW B;  1YBY A;  1X9N A;  2JK8 A;  1SRO A;  1SMX A;  3HKS A;  1HJP A;  3I56 A;  1WFQ A;  5K36 G;  1Z47 A;  4BBR H;  2WAQ G;  1JMC A;  4EX5 A;  2OWO A;  3GTJ H;  1HZC A;  4GN3 B;  2JEB I;  3ERS X;  1IYJ B;  2A8V A;  1OTC A;  2NN6 G;  1DGS A;  4QGU A;  1SN8 A;  2QEX A;  2K5H A;  4IFD I;  4EQ5 A;  4OXP A;  3GTL H;  1E3P A;  1TWH H;  1K9M C;  3JC6 6;  2D0O A;  5C0X I;  1YJN A;  1XPU A;  4IOC A;  2UUA L;  3J7Z C;  1VQO A;  1S40 A;  2UUA Q;  2DGY A;  4B3R Q;  2Q2I A;  3UDI A;  4LW1 A;  3M4Q A;  2AWO A;  1U5K A;  1X54 A;  2B63 G;  3CCQ A;  4LFB Q;  4K0K L;  1CSP A;  4BY1 G;  4YWM A;  4K0K Q;  2ASB A;  4DR2 Q;  1M90 C;  2N49 A;  1X3E A;  2JA8 G;  4BY7 G;  3G48 A;  4GKJ L;  4LUZ A;  4X65 L;  1I3Q H;  4GNX C;  1IBM L;  3TRE A;  4X65 Q;  2B63 H;  4WJ4 A;  3U4V A;  4BY1 H;  3S15 H;  1CUK A;  1NBW A;  3FHW A;  4TQU S;  3F2B A;  4R1J A;  3PF5 A;  3S2D H;  1YJ9 A;  1PV4 A;  4BY7 H;  4DR4 L;  5IYB G;  1EIY B;  1H95 A;  1Z9F A;  3STB D;  2WB1 G;  4DR4 Q;  1OXV A;  4YCV A;  4A3I G;  4KLK A;  1YIT A;  4RG1 A;  2CWA A;  1VQI A;  4LWC A;  4DV7 L;  2VQF Q;  3CME A;  4DV7 Q;  3FP9 A;  5IYB H;  4DV0 L;  3KOJ A;  3BZK A;  4A3D G;  1FGU A;  4JI8 Q;  1QZG A;  2RHQ B;  3CXC A;  4B3M Q;  1P8L A;  3TS2 A;  1PH6 A;  2PQA B;  4HJ7 A;  4P73 A;  3I4N G;  2KCM A;  1PVO A;  2QGQ A;  1WI5 A;  4JBW A;  4JV5 L;  4DAM A;  5ELO A;  2NVX H;  4JBK A;  4JV5 Q;  2VL6 A;  4JI2 Q;  2C35 B;  2CKZ B;  5DLQ E;  2QA4 A;  1QVF A;  3E9H A;  1U0L A;  1VQ6 A;  1L1O B;  4X62 L;  4Y7N H;  3I4N H;  5J3B A;  3PUZ A;  1WJJ A;  5BR8 L;  1E24 A;  2NN6 I;  3NEN A;  1NJI C;  5BR8 Q;  3J80 i;  4WJ3 M;  4LF4 Q;  1QVC A;  1J5E Q;  4QQB X;  3KFU A;  3RR5 A;  5GAE C;  1V9P A;  2KCT A;  4JI7 L;  1EWI A;  4C3H H;  1VQB A;  1C9O A;  3KDF B;  3H15 A;  4A3J G;  2HHH L;  3RN2 A;  3G4S A;  3CCU A;  1VQ5 A;  4MNO A;  4PZ6 A;  2IHF A;  3RLO A;  2PNH A;  3CCM A;  1XTD A;  1C7Y A;  1MKH A;  1BBW A;  1Q12 A;  1X65 A;  2MFI A;  1TWF H;  1K83 H;  3TEH B;  4JOI A;  4UP9 A;  4YY3 Q;  2JJQ A;  1VQ7 A;  2JA7 G;  4A93 H;  1OXU A;  4A3J H;  2BA0 A;  3MXN B;  3PIO A;  1MJE A;  1EFW A;  3CC7 A;  2WP8 J;  3DLL A;  1L0W A;  3JAM i;  1EQQ A;  1M1K C;  1VQ8 A;  4PZ8 A;  1VQ9 A;  2JA7 H;  3UDF A;  5LMU L;  2UXD Q;  3HOY H;  1UEB A;  2VY3 A;  4JBJ A;  1GVP A;  4GN5 A;  4JI1 L;  1VQM A;  1VQH A;  4JBM A;  4JI4 L;  4PG3 A;  3KF6 B;  2AWN A;  3BJU A;  5M5Y H;  3J81 j;  2E2I H;  1B7Y B;  3I2Z A;  4JI4 Q;  1BBU A;  5IWA L;  3HOW H;  2K5V A;  3S2H H;  2FXQ A;  4GNX B;  2VW9 A;  4DV1 L;  4DV2 Q;  2NZH A;  4DV1 Q;  1EUJ A;  1QUQ A;  4DUY L;  3L2P A;  3HOX G;  4DUY Q;  1I6H H;  1XNR L;  4OWX B;  3PUY A;  4X64 Q;  4LFA L;  2GVB A;  2K5N A;  1NE3 A;  1CKN A;  1NMG A;  2F3I A;  4LFA Q;  4GOP C;  1VQL A;  1XNR Q;  3AYH B;  1QZH A;  3J81 i;  2PI2 A;  4AYB G;  2BA1 A;  4BA1 I;  4BXX H;  4LNQ A;  1N36 L;  2MO1 A;  3PSI A;  1JB7 A;  1HNX L;  1N36 Q;  4YHH Q;  1YEZ A;  1IBL Q;  3KJO A;  4KI0 A;  5JEA G;  3HKZ E;  1XMO L;  4BBS H;  1HNW L;  1VQP A;  2YTY A;  1Y1V G;  4IPH A;  4QY7 A;  5GAD C;  4A3M G;  1NMF A;  1XMO Q;  4HID A;  1VQF A;  1XPR A;  1PA6 A;  1N34 L;  4OWW B;  1A63 A;  4GLV B;  1N34 Q;  1HR0 L;  1WCM G;  1BKB A;  3TS0 A;  1HR0 Q;  3AQQ A;  3HFZ B;  2JA5 G;  5C4J H;  2CCZ A;  5C44 G;  3I4M H;  5IP7 G;  1TWC H;  4A3M H;  1VQG A;  2R7F A;  1S72 A;  5LMN W;  1OXX K;  1N33 L;  2YTX A;  2JEA I;  1N33 Q;  1SRU A;  3K8A A;  3WWV A;  1Q1B A;  1PH2 A;  4C2M H;  3K80 C;  3HOU G;  1BVS A;  5C4X H;  5FLM G;  2JA5 H;  2D62 A;  5C44 H;  1PYS B;  5EAY A;  5IP7 H;  2F4V L;  1A62 A;  4A75 A;  2HT1 A;  2F4V Q;  1WYD A;  3M4O H;  4UPA A;  1YHQ A;  1KIX A;  2Y0S E;  1GO3 E;  2A1A A;  3E9I A;  3GO5 A;  4RMF A;  2DUD A;  1JJC B;  4X66 L;  3DM3 A;  4X66 Q;  3VDY A;  4GLA C;  4IJL A;  2KHJ A;  1I50 H;  4HIK A;  1X6O A;  1IZ6 A;  1Q1E A;  4APV A;  1Q82 C;  1IBK L;  4JC0 A;  3CCJ A;  1IBK Q;  3NEL A;  3PUV A;  3H3V I;  1PH1 A;  3J7A 5;  4NPS A;  4L5T A;  1HNW Q;  4NXM L;  2ID0 A;  2K14 A;  2YYZ A;  5E7N A;  4POF A;  3AFP A;  4YCW A;  4A3F G;  4NXM Q;  3GTP H;  2BH2 A;  4PZ7 A;  3HOV G;  1YNX A;  4ALP A;  4DR6 L;  4UP8 A;  4POG A;  4DV6 L;  4JI5 L;  4JOI C;  4GOP A;  1KRS A;  1YZ6 A;  5IYC G;  3U50 C;  4DV6 Q;  1R9T H;  4LF8 L;  1EIF A;  1Q86 C;  4LF7 L;  4LF8 Q;  4GKJ Q;  4A3F H;  2Q2U A;  1IBM Q;  4MZ9 A;  3D0F A;  3J80 c;  4A3L G;  3HOV H;  1Q8K A;  4YCU A;  1KQS A;  2WAQ E;  3K0X A;  2JA8 H;  4HIM A;  4DR1 L;  5IYC H;  4HJA A;  1P16 A;  3GTM H;  1ASZ A;  4HJ8 A;  3OTO L;  1RL2 A;  4A3B G;  3OTO Q;  3S24 A;  4AQY L;  2Q2T A;  3HOZ G;  4UP7 A;  4GOP B;  2VUM G;  1PFS A;  4AQY Q;  4A3L H;  1K8A C;  1XPO A;  4ME3 A;  2R93 G;  1VQE A;  2HIX A;  5M3F G;  1D8L A;  4R4Q A;  5HY6 A;  4DV0 Q;  4A3I H;  3GTG H;  4A3B H;  3PUW A;  3I55 A;  4NXN L;  2VUM H;  3PF4 A;  1K3R A;  4BBS G;  4NXN Q;  3JAM c;  2B29 A;  2B3G A;  4QIW E;  2D0P A;  2R93 H;  2R7Z G;  1GM5 A;  1UWV A;  3G71 A;  2LXJ A;  4LFC L;  3RLF A;  2ATW A;  4A3D H;  2ZJR A;  2V1C C;  4GS3 A;  1N8R C;  1IL2 A;  1FVI A;  1SE8 A;  4B3S L;  3UDX A;  2R7Z H;  4X62 Q;  2MO0 A;  1HZB A;  2I5H A;  3PUX A;  2K4K A;  1KRT A;  3T1Y L;  3W1B A;  3RZD H;  3T1Y Q;  4GLX A;  1JE5 A;  1VQA A;  4B3T L;  2EXD A;  4LF6 L;  4J15 A;  4B3T Q;  1E1T A;  4DR3 L;  1E22 A;  2OQ0 A;  3E0E A;  2WB1 E;  1NTG A;  1UE5 A;  1EQR A;  4QL5 A;  5AJ3 L;  4JI7 Q;  1PHJ A;  2IX1 A;  2NVQ H;  5AJ3 Q;  3S1M H;  2MQH A;  4XTC S;  4AH6 A;  2HHH Q;  2ZJQ A;  1CKM A;  1VQK A;  3CC4 A;  3U58 A;  3BU2 A;  3CF5 A;  1VCI A;  2Z6K A;  1YHA A;  1UE6 A;  3EIV A; 
#chains in the Genus database with same CATH topology
 4J6H A;  3SHL A;  4LF9 L;  4KHZ A;  2VQE L;  1HTP A;  4LUO A;  3U9O A;  5KGU A;  2EJM A;  2NVY B;  3I4L A;  1KNE A;  3KLR A;  1GJX A;  1GOZ A;  2N8N A;  5GQO A;  2SNS A;  5IWA Q;  4IPG A;  5C0X J;  2WV6 D;  2R6G A;  3T4A C;  5IT9 c;  1ESR A;  3L0O A;  4Z9C B;  2QIL A;  2F03 A;  4DR7 L;  1K0R A;  3UE1 A;  1EYC A;  1UE1 A;  3OOC A;  1OO9 B;  3MEH A;  3KJP A;  2J0T D;  1ENA A;  4KMU C;  4QUF A;  1QUQ B;  3PO2 G;  5GRO A;  5LHY 1;  2I46 A;  1BO0 A;  3S1N H;  2EYH A;  1VQJ A;  3QJY A;  2EQS A;  4AIM A;  4N9T A;  1Y1V H;  3SK6 A;  1ENC A;  1JWM D;  2N88 A;  3M3Y H;  1F9Q A;  4Y7N B;  2KJX A;  4DK1 A;  2PW5 A;  2F0S A;  2CQO A;  1KDA A;  2C9O A;  3FPP A;  2PYK A;  3QOJ A;  3D4W A;  1FNV A;  1AE3 A;  3GD7 A;  4A3C H;  3HOU H;  4R4C A;  4K5V A;  2ZTD A;  3L3O C;  1G51 A;  2FIN B;  4K6D A;  1VF5 C;  1F9P A;  2FJ2 A;  4HIO A;  3W2D A;  1PYB A;  2LY7 A;  2NZO A;  3C1E A;  4RFB A;  3S17 H;  3HOY B;  4F88 A;  2MPM A;  3BZD B;  4G7O C;  2K52 A;  4LUV A;  4DK6 C;  1QG7 A;  3CCL A;  2PZT A;  2XSC A;  5LMN L;  1W6K A;  3W1G A;  1KXL A;  3K81 C;  2MNA A;  1Q8I A;  3NBH B;  3G7L A;  2L12 A;  3QG1 A;  2EIF A;  4NB3 A;  1S3O A;  4DPG A;  3HP3 A;  1U4P A;  4R4I A;  4LFB L;  2F3V A;  4LF5 L;  3WOE A;  5H1S E;  4DR2 L;  2UXC L;  1JJG A;  2JA6 G;  2OT2 A;  2HUG A;  4DR5 Q;  1Y1W H;  5T1I A;  1JOR A;  2UUB L;  3UDG A;  2DNC A;  3SXH A;  1N32 Q;  5M3F H;  1VQD A;  1VMC A;  3B6Y A;  4DU9 A;  3K6O A;  2PQA A;  4NW2 A;  1I94 L;  2A74 C;  2C5C A;  5IE8 A;  3VR2 A;  4M8A A;  4BBR B;  2JA5 B;  2RVL A;  5C44 B;  3AEV A;  1S5D D;  1CSQ A;  3BDL A;  3CAM A;  2FMC A;  2LS0 1;  4GKK Q;  3MEF A;  1LTB D;  4XQQ A;  4OIJ A;  2WAQ B;  1HNZ L;  3CCE A;  3IRB A;  2EY2 A;  3QR8 A;  1TWH B;  3TP5 A;  4KJN A;  3UE0 A;  1TR5 A;  4C3I G;  3OHX C;  4BA2 I;  1F2M A;  4C1N I;  4LF9 Q;  4RHS A;  2VQE Q;  2ICE C;  5C3E G;  2RQX A;  2KHI A;  4K8J A;  4LF4 L;  5IGF A;  4P71 A;  1AFP A;  3TSS A;  1IYU A;  1Q46 A;  4IFD J;  4JG2 A;  3H3V C;  2B63 B;  5FK9 C;  2NTT A;  1PRT D;  1VQN A;  2A19 A;  3NUC A;  4DNR B;  2F0O A;  4JI3 Q;  2BCO A;  4O2D A;  4DR7 Q;  4ZK9 B;  1SYG A;  2BH8 A;  3FKI G;  3HOW G;  4CDF C;  5JJL A;  4A3I B;  1WTX A;  4EQP A;  3MHB A;  2KEE A;  3F8T A;  4OEL B;  4IOA A;  1W2B A;  4KHP Q;  3J7A V;  1JT8 A;  3VR5 A;  2L9H A;  1LT4 D;  3AU7 A;  1IL8 A;  3K5N A;  2B2V C;  3BYT B;  1QB5 D;  1A0I A;  3MA2 B;  3A56 A;  3I4N B;  5CV5 A;  4IO9 A;  3Q8D A;  1ICW A;  4L5R C;  1LTS D;  4JI6 Q;  1IBL L;  3NQI A;  2RKS A;  4Q0F A;  5IY0 A;  1KDC A;  1FL0 A;  2HIV A;  1II3 A;  1LT6 D;  2UUC Q;  4DAP A;  3I4O A;  4ODG A;  5E4X A;  3D31 A;  4JYA L;  5C4X G;  2N55 A;  1ASY A;  3H09 A;  3S16 H;  2H5X A;  1EY7 A;  1L1O C;  4A3J B;  1YBY A;  4HAE A;  1SRO A;  4KY7 A;  1EFI D;  3H94 A;  4RA8 A;  2JXM B;  2JA7 B;  2F0I A;  3GTJ H;  1HZC A;  2A6H C;  3Q6S A;  2OWO A;  4GN3 B;  1HFN A;  2A8V A;  5M5Y B;  1X3P A;  3NPP A;  2K5H A;  1H9R A;  3OWF A;  1YJN A;  1FGB D;  4IOC A;  3J7Z C;  2F0L A;  1S40 A;  1A3T A;  2WKD A;  4LW1 A;  3OMC A;  3M4Q A;  4LFB Q;  1RDP D;  4YWM A;  4K0K Q;  2ASB A;  3Q24 A;  3C46 A;  4DR2 Q;  4BY7 G;  2X6G A;  4LUZ A;  4RH6 A;  4TKO B;  1CQF A;  1IKL A;  2KCC A;  4V0B A;  1CUK A;  3FHW A;  5BN5 A;  2FMM A;  1EWC A;  2CH4 A;  3F2B A;  4V19 0;  1ZYR D;  1YJ9 A;  3S2D H;  1TWC B;  3CRK C;  4C1N K;  4DR4 Q;  5JJZ A;  1WCM B;  3VR3 A;  1ZXT A;  5FO9 B;  4CKB A;  2F0K A;  3CME A;  1PTO B;  4DV0 L;  1V1O A;  3BZK A;  4A3D G;  2L11 A;  1HRJ A;  2RHQ B;  4JK1 C;  3E5S A;  5JVG 3;  1P8L A;  4K14 A;  4HJ7 A;  2G9H D;  2JSO A;  1I50 B;  1UEA B;  4JBW A;  2PZU A;  2A6E D;  1WTW A;  2SNM A;  4JPB W;  1V1P A;  2L1B A;  2NVX H;  3NWT A;  2C35 B;  2QA4 A;  3E9H A;  1L1O B;  4C3H G;  1WJJ A;  2F0M A;  5BR8 L;  2NN6 I;  5EPK A;  5DAU A;  3J80 i;  4LF4 Q;  1QVC A;  2E74 C;  3RR5 A;  4JVZ A;  1EWI A;  1BNZ A;  2OXP A;  4LAA A;  3CCU A;  4PZ6 A;  1D5Z C;  4XXE A;  2F0F A;  1TWF H;  1K83 H;  2MGS A;  1AEX A;  3P20 A;  4DXG A;  4CJ0 B;  1TII D;  1XTC D;  3JAM L;  2WP8 J;  2KEC A;  4KN7 C;  1WTV A;  4PZ8 A;  1CA5 A;  3VA7 A;  1VQ9 A;  3E0J A;  1HA5 A;  1LV9 A;  5CV6 A;  4JI1 L;  4WJ4 A;  2A73 B;  3HOZ B;  2NBF A;  3J81 j;  2K7V A;  1MBY A;  4DF7 A;  3HOW H;  5KIX A;  3S2H H;  4KKU A;  2VW9 A;  2NZH A;  4CDD C;  4DV1 Q;  1EUJ A;  3HOX G;  4FF2 A;  3Q22 A;  4YIJ A;  4DUY Q;  3SR1 A;  4G7H C;  2GVB A;  2K5N A;  1NE3 A;  1CKN A;  1NMG A;  1XNR Q;  2MO1 A;  3GTO B;  4GZY C;  2H1E A;  5ISR A;  1IBL Q;  1JOO A;  3KJO A;  2F0W A;  1VQP A;  2B8G A;  3WDN A;  1STE A;  5GAD C;  1HNW Q;  4HID A;  2A5H A;  4KK7 A;  3R93 A;  5M5X B;  1DM0 B;  1PZI D;  1RD9 D;  1PFM A;  3HFZ B;  5M9O A;  4FP5 D;  1LTT D;  4A3M H;  1VQG A;  1OXX K;  1FNU A;  1CHP D;  2JEA I;  1HPC A;  3VYT A;  3OPO A;  1Q1B A;  3BG3 A;  4C3I B;  2ZT9 C;  5IT9 L;  5C4X H;  5EAY A;  4R8N A;  2F4V L;  3KUP A;  5CGK A;  1KIX A;  1EZ8 A;  1GO3 E;  2A1A A;  5M3M B;  4RMF A;  4R8I A;  5C3E B;  4HTH A;  4X66 L;  3DM3 A;  3IFT A;  5ELF A;  4IJL A;  1ET9 A;  4HIK A;  3MC0 B;  4APV A;  4JC0 A;  3CCJ A;  3H0G B;  1IBK Q;  3NEL A;  5G3L D;  1XYI A;  3ITP A;  3J7A 5;  5HUR A;  1SYF A;  2NTS A;  3AFP A;  2D9U A;  5ELB A;  2MP1 A;  4DR6 L;  4JI5 L;  1R9T H;  5IYC G;  3U50 C;  3FKI B;  3MVV A;  1Q86 C;  4LF8 Q;  1AZP A;  3HOV H;  1Q8K A;  1Y8N B;  1I4Q A;  3K0X A;  3NK9 A;  2QCP X;  2RBM A;  4HIM A;  3E6Z X;  1ASZ A;  4HJ8 A;  3L9A X;  3S24 A;  3CQZ B;  1STB A;  1WTH A;  3Q23 A;  1D8L A;  4R4Q A;  1U4L A;  4DV0 Q;  1SBB B;  3PUW A;  3QWN A;  3I55 A;  1K3R A;  2B3G A;  2D0P A;  4A3K B;  3MFY A;  2L0C A;  2R7Z G;  3W3A A;  2V4D A;  1ILQ A;  4A3D H;  4XT3 B;  1D2B A;  4B3S L;  2AUK A;  3UDX A;  1HZB A;  2K4K A;  3T1Y L;  1PRT C;  1YNJ C;  2K05 A;  2F0J A;  4J15 A;  2VB2 X;  1BXT A;  4DR3 L;  2OQ0 A;  5CV7 A;  2F0P A;  2KED A;  4QL5 A;  4LK1 C;  2NVQ H;  2O5I C;  1VQK A;  3K57 A;  2Z6K A;  2PI2 E;  4DV5 Q;  3S14 B;  4YWK A;  5IIF A;  3I7F A;  4IUQ A;  4XIG S;  4FYD A;  4QUC A;  5AFW A;  4DV3 Q;  4IUT A;  3N6R A;  1F2L A;  4A4I A;  2IX0 A;  2EYO A;  2Q8T A;  4JI1 Q;  5C4H A;  1B4O A;  1ROD A;  4TVA B;  1O7I A;  3K7A H;  1MJC A;  3BZC A;  1HZA A;  1TS5 A;  2E2J B;  1GHK A;  1TS2 A;  1VS0 A;  2MUY A;  3AFQ A;  4ILW A;  4B9W A;  1X56 A;  3HOX H;  2E5L L;  2YV5 A;  2F0H A;  2HQE A;  1NR4 A;  2Z0S A;  3K5O A;  2AUJ D;  1YIJ A;  1YI2 A;  3PO3 G;  1T9H A;  3TQY A;  1TY0 A;  4A3G B;  3CPF A;  2ZTC A;  3KLW A;  1B70 B;  2K5W A;  3DWP A;  5FLX c;  3RD4 A;  2UXB L;  2EJF C;  4DUZ Q;  1SLJ A;  3O13 A;  1FJG Q;  4A3C G;  3RNU A;  4DKA C;  1HH2 P;  2VS1 A;  3SK8 A;  1KC8 C;  1PRT B;  2AQ2 B;  5C4Z A;  2ENB A;  1PTO D;  1PYW D;  5C5M A;  1KAW A;  3Q0A A;  1TWG H;  2PQE A;  2G5D A;  3RN5 A;  3ULJ A;  4OX9 Q;  4PV1 C;  4L8J A;  4A93 B;  1X3G A;  4L5Q A;  3SGI A;  3A5Z B;  1LTL A;  1L0X B;  1IXR A;  2MJ8 A;  1LUZ A;  2JA9 A;  4QJF A;  1ZYR C;  1IKM A;  3U9S A;  1D1K A;  2F0Q A;  4HN7 A;  5CV9 A;  1JB3 A;  4JI5 Q;  4DR6 Q;  2IT1 A;  1KNA A;  1HHV A;  2WFW A;  1EOV A;  1S5B D;  3TZU A;  1I5F A;  1G29 1;  2B2T A;  1W3S A;  1Y1W G;  3M85 A;  3EBE A;  1GUW A;  1SEB D;  2F52 A;  2NVY H;  3HGB A;  4DR5 L;  2A6E C;  4J8Q A;  1HZ9 A;  2IX3 A;  3CU7 A;  4QF4 A;  5GAH C;  1N32 L;  1VQC A;  2LMC B;  1EYG A;  1PH9 A;  1SJH D;  2RSO A;  5KYI A;  3S1R H;  3NE5 B;  1VQ4 A;  5A2Q L;  4ZRZ A;  4B3S Q;  2VQF L;  3N52 A;  3LWU A;  3OW7 A;  4GKK L;  4IZ8 A;  3PIP A;  3MXG A;  3I70 A;  1STN A;  1M4V A;  4CKC A;  3J81 c;  4DR3 Q;  4KJO A;  5D65 A;  3GP7 A;  1PH8 A;  3V2T A;  3NSW A;  2ZJP A;  4JW0 A;  2CVR A;  1S5E D;  1YJW A;  1GHJ A;  2ZXO A;  1J5E L;  1HCZ A;  2NVT H;  2LSS A;  4ABN A;  2KOL A;  1JCK B;  4L63 B;  5HGT A;  4BY1 B;  2RF4 A;  1AN8 A;  1HUN A;  3UI2 A;  1X3F A;  4JI3 L;  4B08 A;  3HKZ G;  4IFD G;  2B2W A;  3ULL A;  1G8Z D;  1HR0 W;  4A76 A;  4GNX A;  2EYF A;  1B2T A;  2LXK A;  3A74 A;  3VR6 A;  1D5M C;  3T1H Q;  2UU9 Q;  2AQ3 B;  2M9V A;  2E5L Q;  2WB1 B;  5J1Z A;  5K5P A;  5C0X H;  4KHP L;  3OIP A;  2LKV A;  4DV2 L;  3CCV A;  5JEA J;  3J7A F;  3PO3 H;  5ELD A;  2UXB Q;  2JQO A;  1HA6 A;  4R4O A;  1EQT A;  3P75 A;  4JI6 L;  1K73 C;  2K32 A;  2IWH A;  4RGT A;  5HGQ A;  2SEB D;  2ZTE A;  2UUC L;  1LM0 A;  3I4M G;  5IP9 H;  2EY6 A;  4O0A A;  4NMZ A;  4P75 A;  2Z6B A;  4AYB E;  1J9O A;  1WTO A;  4FXD A;  5EKL A;  4L5S A;  3TP7 A;  2KEN A;  5IYD H;  3T16 A;  3I56 A;  4BBR H;  3SK5 A;  1UE6 A;  1SNP A;  1WTP A;  2E2I B;  1TY2 A;  4QGU A;  5C3W A;  5K36 H;  2CH4 W;  1PLF A;  4OIK A;  1GUS A;  4OXP A;  1TWH H;  2B8F A;  1EY5 A;  2UUA Q;  1O78 A;  4EQN A;  4ZYS A;  4DN4 M;  2QKI C;  4K0K L;  2KVM A;  1G2S A;  4OEM B;  2CW0 C;  3VR4 A;  4BBS B;  5E1F A;  1K8O A;  1X3E A;  4G4K A;  1KLU D;  2JA8 G;  3G48 A;  3S1N B;  4GKJ L;  2M00 A;  4AYB B;  1I3Q H;  4X65 Q;  2B63 H;  2HDM A;  3U4V A;  4DAV A;  5C4J B;  4R1J A;  3A8J E;  1EEF D;  1Y1V B;  4DR4 L;  1Z9F A;  3STB D;  4TSS A;  3TME A;  5E3F A;  4KLK A;  1AZQ A;  2VQF Q;  2K01 A;  4DV7 Q;  1EYD A;  1BCP C;  1L0Y B;  5I4D A;  2D2C C;  5IYB H;  4EGV A;  3I8Z A;  1QZG A;  1Y8P B;  3HOU B;  2PQA B;  4P2C B;  3X3M A;  5KYL A;  1PVO A;  2QGQ A;  4KN4 C;  4QMG A;  2OF1 A;  1SAP A;  1G91 A;  1BOS A;  1Z7T A;  5ELO A;  4DAM A;  5DEH A;  3ZYY X;  2CKZ B;  4HED A;  1F77 A;  4X62 L;  3I4N H;  2J4X A;  3GTP B;  3IFD A;  1E24 A;  4KTA A;  3NHH A;  4J1M A;  1J5E Q;  3KFU A;  4JI7 L;  4A3F B;  2HHH L;  4C3J G;  4MNO A;  1YNJ D;  4H0L C;  2IHF A;  1NSN S;  3CCM A;  1C7Y A;  1BBW A;  1LLR D;  1Q12 A;  1NUC A;  4ZKC B;  2JJQ A;  4WFN 3;  1OXU A;  1H9M A;  4RWS C;  5I6W A;  1HTL D;  3PIO A;  5CV8 A;  4A3J H;  1MJE A;  1EFW A;  3CC7 A;  1X3Q A;  1EQQ A;  4EQO A;  1VQ8 A;  5EBD A;  4IFD H;  2JA7 H;  3GTG B;  1UEB A;  4JBJ A;  4JBM A;  4Y52 H;  1M8A A;  2VUM B;  5M5Y H;  2DJG C;  1BBU A;  3T51 B;  2K5V A;  2QEJ C;  2RA4 A;  2QW7 A;  4DV1 L;  4DV2 Q;  5M3F B;  2EY5 A;  4KD4 A;  1JC7 A;  2NB0 A;  4DUY L;  2Z1C A;  1I6H H;  1XNR L;  1C48 A;  3PUY A;  5KNC A;  4LFA Q;  2F3I A;  4GOP C;  1E2Z A;  1QZH A;  2DY8 A;  1PTO C;  3PSI A;  1JB7 A;  5CMD A;  1N36 Q;  3D4D A;  1BCP B;  3HKZ E;  1HNW L;  5LL6 X;  4QY7 A;  4CHT B;  2Q2U A;  1XPR A;  4A3M G;  5JPN C;  1PA6 A;  1N34 Q;  1STG A;  3NXW A;  1ONL A;  4K2L A;  2B39 A;  3BDC A;  3I4M H;  1CHQ D;  1TWC H;  2R7F A;  3S1Q B;  5LMN W;  1ML0 D;  4PMC A;  2YTX A;  3J7Y W;  3DUZ A;  3K8A A;  5D14 A;  3WWV A;  2CQA A;  4C2M H;  2KHS A;  5IP7 H;  1HQM C;  4A75 A;  4CGY B;  3FDT A;  1X32 A;  3M4O H;  4UPA A;  4CDE C;  4IAL A;  5TSS A;  3E9I A;  3GO5 A;  1JJC B;  2R3Z A;  4G7Z C;  1PFN A;  4DK0 A;  1QJO A;  2KHJ A;  1I50 H;  4WOR A;  1IZ6 A;  1IBK L;  4BS9 A;  1RKN A;  4I65 A;  3H91 A;  4NPS A;  4YCW A;  4NXM Q;  1B1Z A;  5E4W C;  3HOV G;  1YNX A;  3FPU B;  4POG A;  5FLX L;  1SYC A;  4GOP A;  4LF8 L;  1EIF A;  1EWH A;  2F0N A;  3J80 E;  4GKJ Q;  2XRS D;  3J80 c;  1VDZ A;  4X3K A;  2A68 C;  3PO2 B;  1KQS A;  2JA8 H;  2XVS A;  4HJA A;  1P16 A;  4IQZ A;  4RAU C;  1H9S A;  3GTM H;  1RL2 A;  3AMU A;  3HRZ C;  4MHE A;  3OTO Q;  3K58 A;  4GOP B;  4A3L H;  1XPO A;  4ME3 A;  5D3I B;  1O7L A;  5HY6 A;  1Q90 A;  4A3B H;  3A7A B;  2DN8 A;  4QCL A;  1SE4 A;  3I90 A;  4NXN Q;  5NUC A;  2R93 H;  1SSO A;  3DM1 A;  4ULL A;  3G71 A;  1QNU A;  2LXJ A;  1A6X A;  5COR A;  2ATW A;  1BDO A;  1S4Z A;  4K6L A;  1KAB A;  2EVB A;  4GS3 A;  1N8R C;  1I4G A;  1KTK A;  2EDG A;  4XQJ A;  1SE8 A;  4KKT A;  4OL7 A;  4X62 Q;  2MO0 A;  3GTJ B;  3AB9 A;  5FOB B;  1VQA A;  4LF6 L;  4IN3 A;  4B3T Q;  1V1P B;  1E22 A;  2PO4 A;  4JI7 Q;  1EQR A;  1FYC A;  2MQH A;  2HHH Q;  2EYM A;  5IGE A;  3CF5 A;  3K80 C;  4F87 A;  3S15 H;  5LMU Q;  4DV5 L;  1KD1 C;  3EN2 A;  4C3J H;  2Q2H A;  1SDF A;  1NNX A;  1GUT A;  4DV3 L;  2IPK D;  2F4I A;  3VYS A;  1EZ6 A;  5M5W B;  3PCO B;  2NWG A;  1BQQ T;  3KYH C;  5M3M H;  3IAY A;  3DWQ A;  2SDF A;  2JA6 B;  1SNM A;  3S2D B;  2YTV A;  1Q81 C;  1JJ2 A;  4QB4 A;  2TSS A;  3H0G H;  4N8X 1;  2R92 G;  3J81 L;  2JP1 A;  4DV4 L;  4MIU A;  3OSO A;  1CFM A;  1TU2 B;  1D6E C;  2AMC B;  4IUP A;  4HCS A;  2E75 C;  5KNB A;  4OHJ A;  3ND9 A;  1CKN B;  4KV6 A;  3MTS A;  4WJW A;  1CK1 A;  1TWA B;  5FO8 B;  4DUZ L;  2YU9 B;  1K3B C;  3TZD A;  1FJG L;  3R3O A;  4ME5 A;  1UE7 A;  3GTQ H;  2OEO A;  1CTM A;  1RHP A;  1SFO H;  4A3E H;  1XMQ Q;  1DD2 A;  1XXG A;  4HMJ A;  1OXS C;  5FO7 B;  1IYV A;  3V05 A;  2IW3 A;  4A3K H;  1XNQ L;  1LAB A;  4OX9 L;  2RHS B;  2K03 A;  4B9X A;  4NDX A;  3ICE A;  1GD7 A;  3LX0 A;  1EY9 A;  1EQV A;  2AHO B;  3I72 A;  3RZO H;  2CFM A;  1IHZ A;  4P74 A;  1CA6 A;  3ER0 A;  1LAC A;  2Z6K C;  3STB C;  3HOW B;  3S2H B;  1VF7 A;  4BWG B;  3CD6 A;  4MTN A;  3M4Y A;  4OO1 G;  1K28 A;  3KBX A;  3MWY W;  4B3R L;  4FDB A;  1D1I A;  4ZQ3 A;  2ZM6 Q;  3DEO A;  5ELC A;  3S14 H;  1EU3 A;  1X55 A;  2XWB B;  1DXM A;  1SNQ A;  4RGM A;  1ESF A;  1MSH A;  1TS4 A;  3DEP A;  3D8G A;  3QO2 A;  1JWS D;  5I2X A;  3M9B A;  2VZA A;  3G6E A;  1AE2 A;  1NAP A;  4KKS A;  2CW0 D;  4UY8 C;  2K50 A;  4ID6 A;  4DK3 C;  1QWY A;  4JI0 Q;  1E7Z A;  2DY7 A;  3CP0 A;  2F0U A;  2KUM A;  2E2J H;  1AH9 A;  5CC4 A;  5CBA E;  1RIP A;  3PV0 A;  1E0B A;  2EJG C;  2F0G A;  5C4X B;  2VNU D;  4JI8 L;  1K8G A;  2MHV A;  4YWL A;  4LF6 Q;  1B50 A;  1PXU A;  1RCV D;  3F2D A;  1YNN C;  1WOC A;  1DOL A;  3GTL B;  2X69 A;  1BCP D;  1EL0 A;  4X3U A;  4A3G H;  1U4M A;  4JI2 L;  3CHB D;  1TVX A;  2WII B;  3KDF A;  4UHV A;  1L2F A;  2RCN A;  1FNW A;  1GUG A;  3BVM A;  5T1G A;  1W6J A;  4HCE A;  5J39 A;  3MXN A;  1R9T B;  1KDB A;  3I3C A;  2E2H H;  4ZUI A;  2B2Y A;  4M1U B;  5IGB A;  3SVM A;  2EYJ A;  4ZUJ A;  4BY7 B;  5IOD A;  3KF6 A;  5C3X A;  4YY3 L;  3HOY G;  3A5U A;  3LGJ A;  3NBI A;  5C0X G;  1PH3 A;  1HUM A;  4DV4 Q;  3T1H L;  2UU9 L;  3F2C A;  2HQL A;  4IPC A;  1N9W A;  2VB3 X;  4LMQ D;  2XIW A;  3GDE A;  4IPD A;  2R92 H;  1JE4 A;  2B2T C;  5GAG C;  2HCC A;  1RJT A;  4CDC C;  1O7Z A;  4F7X A;  2NZ1 D;  4BXX G;  1C0A A;  1PFB A;  4A3D B;  2OTJ A;  5JJI A;  4X64 L;  3T56 B;  5EBC A;  3FRP B;  2Y0S G;  4IUR A;  1XWE A;  1LTI D;  5IP9 G;  3W5O A;  5KND A;  2JE6 I;  5ELN A;  2XTI A;  3GTK H;  3M7N A;  2K75 A;  3OYY A;  1DYQ A;  2XRQ D;  2O5J C;  3P1H A;  2K33 A;  2I5M X;  2D5D A;  2PZW A;  4C3H B;  5IYD G;  4FVM A;  4N8F A;  2GA4 B;  1U4R A;  2O4X A;  3K7U C;  1WTR A;  1QE6 A;  3DWA A;  4BBR G;  1XNQ Q;  3TRZ A;  1EY6 A;  4I7A A;  2WAC A;  2M2L A;  1HJP A;  5K36 G;  2EXZ A;  1JMC A;  2WAQ G;  3NQT A;  5F2D A;  1IYJ B;  1OTC A;  1DGS A;  1I6V C;  4IFD I;  4FXK C;  2R61 A;  4XYQ A;  4EQ5 A;  1E3P A;  3K7A B;  3C2P A;  3JC6 6;  2D0O A;  2K5Q A;  2NN6 H;  2UUA L;  4B3R Q;  2Q2I A;  3UDI A;  2AWO A;  1U5K A;  1X54 A;  3M7G A;  3HOX B;  2B63 G;  4OO1 H;  3D3R A;  2L4N A;  1CSP A;  5I9O A;  4UAI A;  1B3Q A;  2B2W C;  2TMP A;  4X65 L;  4GNX C;  4RGO S;  1O80 A;  1WTQ A;  2A69 C;  4BY1 H;  1I4R A;  1NBW A;  2NUC A;  2XNA C;  5IYB G;  1NCV A;  4A3I G;  4YCV A;  5KEE A;  4RG1 A;  1QCB D;  1VQI A;  2CWA A;  3IKJ A;  4LWC A;  2A68 D;  4DV7 L;  3FP9 A;  3ND8 A;  1FGU A;  4JI8 Q;  1R4Q B;  1E2V A;  3R8B A;  1SND A;  4IUV A;  1SYE A;  4FF4 A;  1Z6H A;  4P73 A;  3I4N G;  1F2Z A;  1WI5 A;  4JV5 Q;  2VL6 A;  4JI2 Q;  1S5C D;  1QVF A;  4Y7N H;  3PUZ A;  3J80 L;  4RKL A;  2B2U A;  5KRU A;  4QQB X;  1SYD A;  2I07 B;  5GAE C;  4PQX A;  2E2D C;  4C56 C;  4A3J G;  3D6W A;  1VQ5 A;  1QOH A;  3RLO A;  2PNH A;  1XTD A;  1PRT F;  2F0E A;  1MKH A;  3TEH B;  1X65 A;  2MFI A;  2JA7 G;  1G6Z A;  4JOI A;  4UP9 A;  3I91 A;  4YY3 Q;  1VQ7 A;  1HQR D;  4XDX A;  2EYL A;  1V8Q A;  3DXJ C;  3JAM i;  1B3A A;  3HOY H;  2VY3 A;  4GN5 A;  3HEJ A;  5CYU A;  4CKE A;  3SEB A;  3QIA A;  4KD3 A;  3BJU A;  4JI4 Q;  2E2I H;  3T13 A;  4GNX B;  5IT9 E;  4U68 A;  1QUQ A;  4FXG C;  2PPB C;  3KLS X;  3EQL C;  1QNK A;  3BVZ A;  4X64 Q;  3S1R B;  4LFA L;  1SNC A;  4FO2 A;  1VQL A;  2R7Z B;  3AYH B;  3EFX D;  3J81 i;  4BXX H;  1K0S A;  2BA1 A;  4BA1 I;  4LNQ A;  1N36 L;  1HNX L;  3RZD B;  1SE2 A;  3TBI B;  1YEZ A;  4BBS H;  3K5L A;  2YTY A;  1XMO Q;  1VQF A;  1N34 L;  3URY A;  3S1M B;  4GLV B;  1WCM G;  3TS0 A;  1HR0 Q;  1A2U A;  4DNT B;  1PZJ D;  3K5M A;  5JEA H;  3A55 A;  1SE3 A;  5C4J H;  3K0Y A;  5IP7 G;  1B9M A;  3FVQ A;  3NTK A;  4U67 3;  1N33 Q;  1SRU A;  2K28 A;  3DMU A;  4I7Z C;  4K5X A;  1BVS A;  4X3T A;  5FLM G;  2JA5 H;  5C44 H;  2NVT B;  1PYS B;  1A62 A;  1WYD A;  3OIQ A;  1YHQ A;  2Y0S E;  4DGZ A;  1CM9 A;  4G57 A;  3VDY A;  4NKL A;  1X6O A;  5EGT A;  1SYB A;  1Q82 C;  5DM7 3;  2L55 A;  2F0T A;  3PUV A;  4K8I A;  1PH1 A;  4DA2 A;  2JYO A;  1MSG A;  2WIN B;  4NXM L;  2ID0 A;  2K14 A;  3GTP H;  3NBH A;  1O7Y A;  1F9S A;  4PZ7 A;  1EOT A;  1KRS A;  1YZ6 A;  4OGQ C;  4DV6 Q;  4LF7 L;  1EYA A;  4CBV A;  4A3F H;  4MZ9 A;  3LWE A;  5FKA C;  1ZKO A;  4A3L G;  4YCU A;  2BE5 C;  2WAQ E;  5BN4 A;  4DR1 L;  5IGD A;  3M3Y B;  3PO3 B;  2HD3 A;  2FFK B;  4EVO A;  3OTO L;  4A3B G;  3ERO A;  2Q2T A;  1BF4 A;  3HOZ G;  4AQY Q;  1SMY C;  3MZ5 A;  1LO5 D;  1K8A C;  2BDN A;  2R93 G;  3OMG A;  1LT5 D;  2Y0S B;  3KBG A;  1IW7 C;  4A3I H;  3GTG H;  4NXN L;  2VUM H;  3PF4 A;  1G2T A;  1NR2 A;  1STY A;  1STA A;  1DZ1 A;  4QIW E;  3A7L A;  2QDB A;  1DCZ A;  1GM5 A;  4LFC L;  3RLF A;  3C1F A;  1R4P B;  2PCF B;  5DM6 3;  1IL2 A;  4FF1 A;  5EPJ A;  4MTK A;  1CZW A;  3S17 B;  1UAP A;  2RDH A;  2I5H A;  3PUX A;  3KLS A;  3VYU A;  3W1B A;  4B3T L;  1JE5 A;  2Z4I A;  1E1T A;  2K1B A;  2EE1 A;  1NTG A;  1CZG A;  5AJ3 Q;  2ZJQ A;  4DAY A;  5EKK A;  3MFG A;  4ZLT F;  5LMU L;  1YHA A;  1B8A A;  2IL8 A;  1YNN D;  3U4Z A;  1D7Q A;  3S1Q H;  2OTL A;  3NTH A;  1CI3 M;  3PIO 3;  5M3M G;  3PMF A;  5JJK A;  1HFG A;  4DAY B;  1Y1W B;  1DOK A;  1C4Q A;  1GUN A;  4QIW B;  3NTI A;  1I3Q B;  1H9J A;  2RSN A;  3CMA A;  3H0G G;  4H02 A;  1V1Q A;  1E1O A;  2XWJ B;  3H3V H;  1G6P A;  1YVC A;  1TQO A;  1PH4 A;  3OW2 A;  2EY1 A;  1CT1 D;  1JOQ A;  1KL9 A;  2EOT A;  3T53 B;  2Z9H A;  3KK7 A;  3ULP A;  1YHB A;  1D5X C;  1GKH A;  1HNX Q;  4DFA A;  4DXF A;  3CC2 A;  2ICI A;  4HSP A;  1WVL A;  2E76 C;  2RDG A;  2OQK A;  1CKO A;  1B53 A;  1J8I A;  1MI2 A;  2F0D A;  2AQ1 B;  1JOK A;  3PO2 H;  4A3E G;  5FJ8 G;  3K59 A;  5JVH 3;  1MD2 D;  4OWT B;  1WCM H;  2KBN A;  3D4R A;  3ONA B;  3QOL A;  3RMH A;  1SXT A;  4L6T B;  1XMQ L;  2K6A A;  1PTO H;  4A3K G;  1Y14 B;  1Q7Y C;  5FLM H;  4F8M A;  2ES2 A;  1QVG A;  5COY A;  2OCE A;  4PMW A;  2QF7 A;  2DNE A;  1SR3 A;  5I9P A;  5G3L F;  4RHR A;  2JN4 A;  1XJV A;  3HKZ B;  3WOF A;  4WRD A;  2I0Q A;  1OXT A;  1SJE D;  2N78 A;  3ZJY C;  4DNI A;  5A2Q E;  3S9W A;  4IJH A;  4FF3 A;  2IHE A;  2R7D A;  4MN3 A;  4LF7 Q;  1S5F D;  2KQ3 A;  2XN9 C;  3A0J A;  1I6H B;  3MXP A;  5LMN Q;  1LTR D;  1PMR A;  3TDQ A;  4DR1 Q;  2L15 A;  2WKC A;  1STH A;  1TXY A;  2ZM6 L;  1JQY D;  3KF8 A;  1V43 A;  2F1M A;  1MIU A;  5CV4 A;  4LF5 Q;  2B2V A;  2UXC Q;  3ERQ A;  3TP8 A;  3G6J B;  3FEW X;  3HOZ H;  3A8K E;  5M5W H;  2HCI A;  4HJ9 A;  1H9S B;  3EVQ A;  2UUB Q;  2J7Z A;  4R4T A;  2E8G A;  1A3U A;  5IOC A;  3KF8 B;  4JI0 L;  3TP6 A;  1LYL A;  2JA6 H;  3I4M B;  4LFC Q;  1WD1 A;  3S16 B;  3RLN A;  1A3V A;  4RCO A;  5EKI A;  1C8C A;  2I5L X;  2A69 D;  2PMZ E;  1ICF B;  1FD7 D;  3E3X A;  5EQ0 A;  1I94 Q;  4C2M B;  2GVA A;  4UDU C;  3GTO H;  4A3G G;  3M4O B;  1L1O A;  4B3M L;  1EIG A;  1J6Q A;  2HDL A;  1A8V A;  3F1Z A;  2ALY B;  3TN2 A;  3CCS A;  1HNZ Q;  1BUV T;  4X3S A;  4OON A;  1BCP F;  5M5X H;  3RUZ A;  4HJ5 A;  1KHI A;  3CPW A;  1TWA H;  1PH5 A;  2YU9 H;  4X6A H;  3M4P A;  2BOS A;  3BVG A;  3CCR A;  1Q3L A;  4C3I H;  3PGZ A;  2SOB A;  4IUU A;  4OO1 I;  1Y69 U;  4A93 G;  3QB3 A;  5C3E H;  2EZV A;  2Z8L A;  3HZX A;  1RTN A;  2JA8 B;  4PNY A;  2PMZ B;  1HXY D;  3GTM B;  1A15 A;  3CW2 C;  4ZCK A;  1PH7 A;  5A35 A;  4HMI A;  4PMB A;  1AP0 A;  2UXD L;  4HR7 B;  4A3B B;  4KHV A;  3VA5 A;  2PW7 A;  4TRD A;  2XGT A;  3FKI H;  2R93 B;  3P7J A;  2Z4H A;  2NVX B;  4GN4 B;  3A54 A;  4P72 A;  4KY6 A;  2IY5 B;  1B44 D;  2GN5 A;  3NEM A;  3CQZ H;  4YHH L;  1T5X D;  3I73 A;  3VYR A;  5FJ8 H;  1UNS A;  4JCV E;  4LJZ C;  1KLG D;  1PTO F;  2CWP A;  5I2Y A;  1WD0 A;  5J22 A;  2N3S A;  3NWS A;  1TWF B;  1K83 B;  4NP5 A;  4JYA Q;  1ILP A;  3S15 B;  3L7Z C;  4Q5V A;  1NY4 A;  2AKW B;  2VXW A;  4C3J B;  1X9N A;  2JK8 A;  1EY4 A;  1SMX A;  3EJI A;  3HKS A;  1I4P A;  1WFQ A;  1EY0 A;  1Z47 A;  2EYP A;  2FHT A;  2LFN A;  4H13 C;  4EX5 A;  5ELE A;  2JEB I;  3ERS X;  4RKB A;  3BS1 A;  2NN6 G;  1TT2 A;  1ET6 A;  2ZXR A;  1SN8 A;  1B9N A;  1K8M A;  1PZK D;  2QEX A;  4ZKB B;  2L5T A;  3GTL H;  1K9M C;  3CRL C;  5C0X I;  1XPU A;  3BDO A;  1U9R A;  3HG9 A;  3HS0 C;  1VQO A;  2DGY A;  4H44 C;  5IGG A;  2B2Y C;  1RF2 D;  2QDL A;  1A2T A;  2IJ0 A;  5D3D A;  5C6A A;  3CCQ A;  4BY1 G;  1MGS A;  1LTA D;  1DJR D;  1M90 C;  2N49 A;  1QIL A;  1IBM L;  3R2I A;  3TRE A;  3MAQ A;  4TQU S;  3PQI A;  3PF5 A;  1PV4 A;  4BY7 H;  4A3M B;  1EIY B;  2KA7 A;  1H95 A;  2WB1 G;  4O42 A;  1OXV A;  2RDF A;  1YIT A;  4ZAI A;  3GTQ B;  4O1N A;  4HSV A;  1SFO B;  2BE5 D;  1EEI D;  4A3E B;  1CQV A;  1JR0 D;  1MHW C;  3KOJ A;  4XT1 B;  5C5L A;  1GUO A;  1EU4 A;  1Y8O B;  3CXC A;  4B3M Q;  3TS2 A;  2X6L A;  1PH6 A;  1SMY D;  2KCM A;  1SNO A;  3CKI B;  3MXU A;  3GV3 A;  5BN3 A;  1IW7 D;  4JV5 L;  3NP8 A;  1E2W A;  4H7B A;  4IUN A;  5LL6 S;  4JBK A;  2EPB A;  3SK4 A;  5IGC A;  5DLQ E;  1VQ6 A;  1PDQ A;  1U0L A;  5J3B A;  3C3L A;  3NEN A;  4WJ3 M;  1NJI C;  5BR8 Q;  3RZO B;  1T5E A;  4S3S A;  2H4O A;  4RGN A;  1LT3 D;  1V9P A;  2KCT A;  4C3H H;  1VQB A;  1C9O A;  3KDF B;  1JWU D;  3H15 A;  3RN2 A;  3G4S A;  3HOV B;  1KAA A;  1H9K A;  4A93 H;  2BA0 A;  3MXN B;  3DLL A;  1AW7 A;  1L0W A;  1M1K C;  3EA6 A;  5I6Y A;  2UXD Q;  3UDF A;  5JPM C;  1GVP A;  1VQM A;  4JI4 L;  1VQH A;  4PG3 A;  2P5Z X;  2AWN A;  3KF6 B;  1DON A;  1B7Y B;  3I2Z A;  5IWA L;  5JOB A;  2FXQ A;  2Q8I B;  3V96 A;  2CHB D;  3L2P A;  1FR3 A;  2K04 A;  4OWX B;  3OWE B;  4K2K A;  4BBS G;  5DNF A;  2PI2 A;  4AYB G;  1TKW B;  1F2Y A;  3H6M A;  4YHH Q;  5JAV A;  4KI0 A;  5CR3 A;  5JEA G;  4N9P A;  1XMO L;  3F2U A;  1Y1V G;  4IPH A;  2HT1 A;  1NMF A;  4OWW B;  2NVQ B;  1A63 A;  4KY5 A;  1HR0 L;  1BKB A;  4K5W A;  3AQQ A;  3LNN A;  1ENF A;  5FLX E;  2JA5 G;  2CCZ A;  5C44 G;  1LTG D;  1S72 A;  2RCF A;  1N33 L;  4E6I A;  1PH2 A;  3HOU G;  3FMC A;  1TS3 A;  2D62 A;  1EY8 A;  1VMP A;  4XYO A;  2K5D A;  2E2H B;  2F4V Q;  1F9R A;  2DUD A;  3SE0 A;  4X66 Q;  4GLA C;  4CJ1 B;  1BBX C;  2PNR C;  2B2U C;  1Q1E A;  3IL8 A;  3H3V I;  4L5T A;  1EIH A;  3X3N A;  2YYZ A;  5E7N A;  4POF A;  4A3F G;  2BH2 A;  2DJF C;  1I4X A;  2KCN A;  2R92 B;  4ALP A;  4UP8 A;  4DV6 L;  1UUP A;  4JOI C;  5L37 A;  1RTO A;  1BR9 A;  1IBM Q;  3D0F A;  2NYZ D;  2A6H D;  4FNF A;  4CJ2 C;  3GV6 A;  5IYC H;  4AQY L;  3GTK B;  2ZXP A;  4UP7 A;  2VUM G;  1PFS A;  5CBE E;  5EPL A;  1VQE A;  1JIC A;  2HIX A;  1I4H A;  5M3F G;  2O2L D;  3JAM E;  3PIP 3;  2BDO A;  3A8I E;  1XX8 A;  1ZEQ X;  2B29 A;  3JAM c;  4XQN A;  1TWG B;  1UWV A;  3BYY B;  2ZJR A;  2V1C C;  2Q8R E;  1FVI A;  3SDZ A;  2G9D A;  2R7Z H;  3R2T A;  1KRT A;  3RZD H;  3T1Y Q;  4GLX A;  3D6C A;  2EXD A;  2F3W A;  3J81 E;  3E0E A;  2WB1 E;  3GQB A;  1UE5 A;  5AJ3 L;  1PHJ A;  2IX1 A;  3S1M H;  1GXD C;  4XTC S;  4RCN A;  4AH6 A;  1CKM A;  3CC4 A;  1DOM A;  5EJW A;  3U58 A;  2F0V A;  1VCI A;  3DHQ A;  3BU2 A;  3EIV A;  4R9W A; 
#chains in the Genus database with same CATH homology
 4LF9 L;  5LMU Q;  1B8A A;  4KHZ A;  2PI2 E;  3U4Z A;  2VQE L;  3EN2 A;  4DV5 L;  1KD1 C;  4DV5 Q;  4LUO A;  4C3J H;  2OTL A;  3S1Q H;  2Q2H A;  4YWK A;  5M3M G;  3I7F A;  5JJK A;  4XIG S;  4DV3 L;  4DAY B;  4DV3 Q;  4A4I A;  2IX0 A;  2N8N A;  5GQO A;  4JI1 Q;  3CMA A;  3H0G G;  3PCO B;  4H02 A;  1V1Q A;  3KYH C;  1E1O A;  5M3M H;  5IWA Q;  4IPG A;  5C0X J;  1YVC A;  4TVA B;  3H3V H;  1G6P A;  2R6G A;  5IT9 c;  1O7I A;  3K7A H;  1MJC A;  2YTV A;  3BZC A;  3L0O A;  1Q81 C;  1PH4 A;  1HZA A;  3OW2 A;  1JJ2 A;  4DR7 L;  1K0R A;  3H0G H;  2R92 G;  3UE1 A;  1UE1 A;  1VS0 A;  4DV4 L;  1KL9 A;  3AFQ A;  1X56 A;  3KJP A;  3HOX H;  2E5L L;  3ULP A;  1YHB A;  2YV5 A;  1GKH A;  1HNX Q;  2Z0S A;  1QUQ B;  3PO2 G;  5GRO A;  3CC2 A;  2AMC B;  1YIJ A;  3S1N H;  2OQK A;  1YI2 A;  1CKO A;  1CKN B;  3PO3 G;  1T9H A;  1VQJ A;  3TQY A;  3CPF A;  2ZTC A;  3KLW A;  3PO2 H;  4A3E G;  1B70 B;  2EQS A;  4AIM A;  1Y1V H;  5FJ8 G;  5FLX c;  4DUZ L;  3M3Y H;  2UXB L;  4OWT B;  4DUZ Q;  1FJG L;  1SLJ A;  1WCM H;  2KBN A;  1FJG Q;  1UE7 A;  4A3C G;  3RNU A;  2CQO A;  3GTQ H;  4DKA C;  1XMQ L;  1SFO H;  1HH2 P;  2VS1 A;  4A3E H;  1XMQ Q;  4A3K G;  1Y14 B;  1KC8 C;  1OXS C;  1AE3 A;  3GD7 A;  4A3C H;  3HOU H;  4R4C A;  1Q7Y C;  2ZTD A;  1KAW A;  5FLM H;  1G51 A;  4A3K H;  1TWG H;  3RN5 A;  2ES2 A;  1QVG A;  3ULJ A;  4OX9 L;  2OCE A;  1XNQ L;  4OX9 Q;  4PMW A;  2RHS B;  4HIO A;  1SR3 A;  1X3G A;  1PYB A;  3ICE A;  4L5Q A;  1GD7 A;  2NZO A;  3SGI A;  3A5Z B;  3S17 H;  1XJV A;  1LTL A;  2AHO B;  2I0Q A;  1IXR A;  3RZO H;  1OXT A;  2CFM A;  4P74 A;  2N78 A;  3ZJY C;  1LUZ A;  2JA9 A;  3ER0 A;  4QJF A;  4DNI A;  2Z6K C;  2K52 A;  4IJH A;  4LUV A;  3STB C;  4JI5 Q;  2IHE A;  2IT1 A;  2R7D A;  4DK6 C;  4DR6 Q;  4LF7 Q;  3CCL A;  2WFW A;  3CD6 A;  4MTN A;  5LMN L;  3W1G A;  1EOV A;  3A0J A;  5LMN Q;  1I5F A;  3K81 C;  4OO1 G;  2MNA A;  1G29 1;  1KXL A;  3NBH B;  4B3R L;  1W3S A;  4NB3 A;  2EIF A;  4DR1 Q;  1S3O A;  2L15 A;  4FDB A;  4DPG A;  3M85 A;  1TXY A;  3EBE A;  2ZM6 L;  1Y1W G;  4R4I A;  2ZM6 Q;  4LFB L;  2F52 A;  1V43 A;  4LF5 L;  1MIU A;  1X55 A;  3S14 H;  5H1S E;  4LF5 Q;  2NVY H;  4DR2 L;  1D7Q A;  2UXC L;  4DR5 L;  2JA6 G;  1JJG A;  1HZ9 A;  2UXC Q;  4DR5 Q;  1Y1W H;  3HOZ H;  3M9B A;  2VZA A;  5M5W H;  3G6E A;  4HJ9 A;  3UDG A;  5GAH C;  2UUB L;  2UUB Q;  1N32 L;  1VQC A;  1AE2 A;  4R4T A;  1N32 Q;  2E8G A;  4UY8 C;  1EYG A;  2K50 A;  3KF8 B;  1VQD A;  5M3F H;  1LYL A;  4DK3 C;  3B6Y A;  1PH9 A;  4JI0 L;  2JA6 H;  4JI0 Q;  4LFC Q;  1E7Z A;  3CP0 A;  3RLN A;  2PQA A;  3S1R H;  2E2J H;  1I94 L;  1AH9 A;  5IE8 A;  2I5L X;  2PMZ E;  1VQ4 A;  1I94 Q;  4B3S Q;  2VQF L;  1RIP A;  3PV0 A;  2GVA A;  3AEV A;  1CSQ A;  3GTO H;  3CAM A;  4GKK L;  2VNU D;  3PIP A;  4JI8 L;  1K8G A;  3MEF A;  4A3G G;  1L1O A;  4GKK Q;  4YWL A;  4B3M L;  4LF6 Q;  1J6Q A;  3J81 c;  1A8V A;  3F2D A;  3F1Z A;  4DR3 Q;  1HNZ L;  3CCE A;  3IRB A;  1WOC A;  2ALY B;  3CCS A;  1HNZ Q;  1PH8 A;  4OON A;  5M5X H;  3UE0 A;  4A3G H;  4JI2 L;  4HJ5 A;  4BA2 I;  2ZJP A;  1KHI A;  3KDF A;  3CPW A;  1L2F A;  1TWA H;  2RCN A;  1PH5 A;  2YU9 H;  1YJW A;  4X6A H;  4LF9 Q;  3M4P A;  2VQE Q;  3CCR A;  5C3E G;  4LF4 L;  2KHI A;  1J5E L;  4C3I H;  4P71 A;  3PGZ A;  2NVT H;  2LSS A;  1Q46 A;  4IFD J;  4JG2 A;  2E2H H;  4OO1 I;  4Y52 H;  4A93 G;  2RF4 A;  5C3E H;  1X3F A;  1VQN A;  2A19 A;  4JI3 L;  3HKZ G;  3KF6 A;  4IFD G;  3ULL A;  4YY3 L;  4JI3 Q;  1HR0 W;  4A76 A;  3HOY G;  3A5U A;  4GNX A;  3CW2 C;  4DR7 Q;  4O2D A;  3LGJ A;  5C0X G;  1PH3 A;  2LXK A;  3A74 A;  1PH7 A;  2BH8 A;  4DV4 Q;  3FKI G;  3T1H L;  3HOW G;  2UU9 L;  3F2C A;  2HQL A;  4IPC A;  3T1H Q;  1N9W A;  2UU9 Q;  2UXD L;  2E5L Q;  5JJL A;  3GDE A;  4IPD A;  2R92 H;  3F8T A;  4IOA A;  5GAG C;  4KHP L;  2XGT A;  1W2B A;  3FKI H;  4DV2 L;  4KHP Q;  1JT8 A;  4BXX G;  1C0A A;  2OTJ A;  5JJI A;  4X64 L;  4GN4 B;  1A0I A;  2Y0S G;  4P72 A;  3CCV A;  5JEA J;  2IY5 B;  3PO3 H;  2GN5 A;  3W5O A;  5IP9 G;  4IO9 A;  2JE6 I;  2JQO A;  2UXB Q;  3NEM A;  4R4O A;  2XTI A;  3Q8D A;  5ELN A;  4L5R C;  3GTK H;  2K75 A;  3CQZ H;  4JI6 L;  3M7N A;  3OYY A;  4YHH L;  1K73 C;  1IBL L;  4JI6 Q;  5FJ8 H;  5HGQ A;  2I5M X;  5IY0 A;  1FL0 A;  2HIV A;  2ZTE A;  1LM0 A;  2UUC L;  3I4M G;  5IP9 H;  4O0A A;  5IYD G;  4JCV E;  2UUC Q;  3I4O A;  4P75 A;  2CWP A;  3K7U C;  3D31 A;  4AYB E;  4BBR G;  4JYA L;  2N3S A;  4L5S A;  1XNQ Q;  3TRZ A;  5C4X G;  1ASY A;  4JYA Q;  3L7Z C;  3S16 H;  2KEN A;  2H5X A;  5IYD H;  1L1O C;  1NY4 A;  2AKW B;  1YBY A;  1X9N A;  2JK8 A;  1SRO A;  1SMX A;  3HKS A;  1HJP A;  3I56 A;  1WFQ A;  5K36 G;  1Z47 A;  4BBR H;  2WAQ G;  1JMC A;  4EX5 A;  2OWO A;  3GTJ H;  1HZC A;  4GN3 B;  2JEB I;  3ERS X;  1IYJ B;  2A8V A;  1OTC A;  2NN6 G;  1DGS A;  4QGU A;  1SN8 A;  2QEX A;  2K5H A;  4IFD I;  4EQ5 A;  4OXP A;  3GTL H;  1E3P A;  1TWH H;  1K9M C;  3JC6 6;  2D0O A;  5C0X I;  1YJN A;  1XPU A;  4IOC A;  2UUA L;  3J7Z C;  1VQO A;  1S40 A;  2UUA Q;  2DGY A;  4B3R Q;  2Q2I A;  3UDI A;  4LW1 A;  3M4Q A;  2AWO A;  1U5K A;  1X54 A;  2B63 G;  3CCQ A;  4LFB Q;  4K0K L;  1CSP A;  4BY1 G;  4YWM A;  4K0K Q;  2ASB A;  4DR2 Q;  1M90 C;  2N49 A;  1X3E A;  2JA8 G;  4BY7 G;  3G48 A;  4GKJ L;  4LUZ A;  4X65 L;  1I3Q H;  4GNX C;  1IBM L;  3TRE A;  4X65 Q;  2B63 H;  4WJ4 A;  3U4V A;  4BY1 H;  3S15 H;  1CUK A;  1NBW A;  3FHW A;  4TQU S;  3F2B A;  4R1J A;  3PF5 A;  3S2D H;  1YJ9 A;  1PV4 A;  4BY7 H;  4DR4 L;  5IYB G;  1EIY B;  1H95 A;  1Z9F A;  3STB D;  2WB1 G;  4DR4 Q;  1OXV A;  4YCV A;  4A3I G;  4KLK A;  1YIT A;  4RG1 A;  2CWA A;  1VQI A;  4LWC A;  4DV7 L;  2VQF Q;  3CME A;  4DV7 Q;  3FP9 A;  5IYB H;  4DV0 L;  3KOJ A;  3BZK A;  4A3D G;  1FGU A;  4JI8 Q;  1QZG A;  2RHQ B;  3CXC A;  4B3M Q;  1P8L A;  3TS2 A;  1PH6 A;  2PQA B;  4HJ7 A;  4P73 A;  3I4N G;  2KCM A;  1PVO A;  2QGQ A;  1WI5 A;  4JBW A;  4JV5 L;  4DAM A;  5ELO A;  2NVX H;  4JBK A;  4JV5 Q;  2VL6 A;  4JI2 Q;  2C35 B;  2CKZ B;  5DLQ E;  2QA4 A;  1QVF A;  3E9H A;  1U0L A;  1VQ6 A;  1L1O B;  4X62 L;  4Y7N H;  3I4N H;  5J3B A;  3PUZ A;  1WJJ A;  5BR8 L;  1E24 A;  2NN6 I;  3NEN A;  1NJI C;  5BR8 Q;  3J80 i;  4WJ3 M;  4LF4 Q;  1QVC A;  1J5E Q;  4QQB X;  3KFU A;  3RR5 A;  5GAE C;  1V9P A;  2KCT A;  4JI7 L;  1EWI A;  4C3H H;  1VQB A;  1C9O A;  3KDF B;  3H15 A;  4A3J G;  2HHH L;  3RN2 A;  3G4S A;  3CCU A;  1VQ5 A;  4MNO A;  4PZ6 A;  2IHF A;  3RLO A;  2PNH A;  3CCM A;  1XTD A;  1C7Y A;  1MKH A;  1BBW A;  1Q12 A;  1X65 A;  2MFI A;  1TWF H;  1K83 H;  3TEH B;  4JOI A;  4UP9 A;  4YY3 Q;  2JJQ A;  1VQ7 A;  2JA7 G;  4A93 H;  1OXU A;  4A3J H;  2BA0 A;  3MXN B;  3PIO A;  1MJE A;  1EFW A;  3CC7 A;  2WP8 J;  3DLL A;  1L0W A;  3JAM i;  1EQQ A;  1M1K C;  1VQ8 A;  4PZ8 A;  1VQ9 A;  2JA7 H;  3UDF A;  5LMU L;  2UXD Q;  3HOY H;  1UEB A;  2VY3 A;  4JBJ A;  1GVP A;  4GN5 A;  4JI1 L;  1VQM A;  1VQH A;  4JBM A;  4JI4 L;  4PG3 A;  3KF6 B;  2AWN A;  3BJU A;  5M5Y H;  3J81 j;  2E2I H;  1B7Y B;  3I2Z A;  4JI4 Q;  1BBU A;  5IWA L;  3HOW H;  2K5V A;  3S2H H;  2FXQ A;  4GNX B;  2VW9 A;  4DV1 L;  4DV2 Q;  2NZH A;  4DV1 Q;  1EUJ A;  1QUQ A;  4DUY L;  3L2P A;  3HOX G;  4DUY Q;  1I6H H;  1XNR L;  4OWX B;  3PUY A;  4X64 Q;  4LFA L;  2GVB A;  2K5N A;  1NE3 A;  1CKN A;  1NMG A;  2F3I A;  4LFA Q;  4GOP C;  1VQL A;  1XNR Q;  3AYH B;  1QZH A;  3J81 i;  2PI2 A;  4AYB G;  2BA1 A;  4BA1 I;  4BXX H;  4LNQ A;  1N36 L;  2MO1 A;  3PSI A;  1JB7 A;  1HNX L;  1N36 Q;  4YHH Q;  1YEZ A;  1IBL Q;  3KJO A;  4KI0 A;  5JEA G;  3HKZ E;  1XMO L;  4BBS H;  1HNW L;  1VQP A;  2YTY A;  1Y1V G;  4IPH A;  4QY7 A;  5GAD C;  4A3M G;  1NMF A;  1XMO Q;  4HID A;  1VQF A;  1XPR A;  1PA6 A;  1N34 L;  4OWW B;  1A63 A;  4GLV B;  1N34 Q;  1HR0 L;  1WCM G;  1BKB A;  3TS0 A;  1HR0 Q;  3AQQ A;  3HFZ B;  2JA5 G;  5C4J H;  2CCZ A;  5C44 G;  3I4M H;  5IP7 G;  1TWC H;  4A3M H;  1VQG A;  2R7F A;  1S72 A;  5LMN W;  1OXX K;  1N33 L;  2YTX A;  2JEA I;  1N33 Q;  1SRU A;  3K8A A;  3WWV A;  1Q1B A;  1PH2 A;  4C2M H;  3K80 C;  3HOU G;  1BVS A;  5C4X H;  5FLM G;  2JA5 H;  2D62 A;  5C44 H;  1PYS B;  5EAY A;  5IP7 H;  2F4V L;  1A62 A;  4A75 A;  2HT1 A;  2F4V Q;  1WYD A;  3M4O H;  4UPA A;  1YHQ A;  1KIX A;  2Y0S E;  1GO3 E;  2A1A A;  3E9I A;  3GO5 A;  4RMF A;  2DUD A;  1JJC B;  4X66 L;  3DM3 A;  4X66 Q;  3VDY A;  4GLA C;  4IJL A;  2KHJ A;  1I50 H;  4HIK A;  1X6O A;  1IZ6 A;  1Q1E A;  4APV A;  1Q82 C;  1IBK L;  4JC0 A;  3CCJ A;  1IBK Q;  3NEL A;  3PUV A;  3H3V I;  1PH1 A;  3J7A 5;  4NPS A;  4L5T A;  1HNW Q;  4NXM L;  2ID0 A;  2K14 A;  2YYZ A;  5E7N A;  4POF A;  3AFP A;  4YCW A;  4A3F G;  4NXM Q;  3GTP H;  2BH2 A;  4PZ7 A;  3HOV G;  1YNX A;  4ALP A;  4DR6 L;  4UP8 A;  4POG A;  4DV6 L;  4JI5 L;  4JOI C;  4GOP A;  1KRS A;  1YZ6 A;  5IYC G;  3U50 C;  4DV6 Q;  1R9T H;  4LF8 L;  1EIF A;  1Q86 C;  4LF7 L;  4LF8 Q;  4GKJ Q;  4A3F H;  2Q2U A;  1IBM Q;  4MZ9 A;  3D0F A;  3J80 c;  4A3L G;  3HOV H;  1Q8K A;  4YCU A;  1KQS A;  2WAQ E;  3K0X A;  2JA8 H;  4HIM A;  4DR1 L;  5IYC H;  4HJA A;  1P16 A;  3GTM H;  1ASZ A;  4HJ8 A;  3OTO L;  1RL2 A;  4A3B G;  3OTO Q;  3S24 A;  4AQY L;  2Q2T A;  3HOZ G;  4UP7 A;  4GOP B;  2VUM G;  1PFS A;  4AQY Q;  4A3L H;  1K8A C;  1XPO A;  4ME3 A;  2R93 G;  1VQE A;  2HIX A;  5M3F G;  1D8L A;  4R4Q A;  5HY6 A;  4DV0 Q;  4A3I H;  3GTG H;  4A3B H;  3PUW A;  3I55 A;  4NXN L;  2VUM H;  3PF4 A;  1K3R A;  4BBS G;  4NXN Q;  3JAM c;  2B29 A;  2B3G A;  4QIW E;  2D0P A;  2R93 H;  2R7Z G;  1GM5 A;  1UWV A;  3G71 A;  2LXJ A;  4LFC L;  3RLF A;  2ATW A;  4A3D H;  2ZJR A;  2V1C C;  4GS3 A;  1N8R C;  1IL2 A;  1FVI A;  1SE8 A;  4B3S L;  3UDX A;  2R7Z H;  4X62 Q;  2MO0 A;  1HZB A;  2I5H A;  3PUX A;  2K4K A;  1KRT A;  3T1Y L;  3W1B A;  3RZD H;  3T1Y Q;  4GLX A;  1JE5 A;  1VQA A;  4B3T L;  2EXD A;  4LF6 L;  4J15 A;  4B3T Q;  1E1T A;  4DR3 L;  1E22 A;  2OQ0 A;  3E0E A;  2WB1 E;  1NTG A;  1UE5 A;  1EQR A;  4QL5 A;  5AJ3 L;  4JI7 Q;  1PHJ A;  2IX1 A;  2NVQ H;  5AJ3 Q;  3S1M H;  2MQH A;  4XTC S;  4AH6 A;  2HHH Q;  2ZJQ A;  1CKM A;  1VQK A;  3CC4 A;  3U58 A;  3BU2 A;  3CF5 A;  1VCI A;  2Z6K A;  1YHA A;  1UE6 A;  3EIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...