5I6YA

Crystal structure of staphylococcal nuclease variant delta+phs a90e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLEYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i6yA00
1JOKA 1EZ8A 4ZUJA 1SNQA 4RKLA 3SHLA 4EQPA 5KYIA 4RKBA 3SK6A 3TP6A 2F0FA 2PQEA 2EYOA 3TMEA 3MEHA 4PMBA 1EY0A 4ZQ3A 4DGZA 5CV5A 1KAAA 2SNSA 3P75A 3S9WA 1SYFA 5IGGA 3T16A 5IODA 5M9OA 5CGKA 2EY5A 4HMJA 5CV4A 5CV6A 4K2KA 3SK5A 5ISRA 2SOBA 4IALA 3P1HA 3NK9A 5EKLA 4DU9A 2F0EA 1ENCA 5IGFA 5I9OA 5DAUA 2PW7A 3TP8A 2F0JA 4J1MA 1JORA 1EY6A 3RUZA 4HTHA 1ENAA 3QOLA 2HQEA 5IGDA 1SYDA 4NP5A 3LX0A 5E3FA 4QF4A 3NXWA 4K5XA 4J6HA 3V2TA 5C3WA 5HURA 1STAA 4K8JA 3BDCA 2F0QA 2F0TA 4KJNA 4EQOA 1A2UA 5CC4A 2PYKA 3NHHA 3QOJA 3TP5A 5KGUA 4IUNA 4F8MA 2F0MA 2LKVA 5EGTA 2F0WA 1KDBA 5I9PA 3NP8A 1RKNA 3EROA 4KY6A 2F3WA 5CV7A 1SNCA 5CV8A 3MXPA 4EQNA 5I6YA 2EYMA 5J39A 1JOQA 3MVVA 1STGA 4KV6A 2OF1A 5KIXA 1KDAA 2EYHA 1EYAA 2OEOA 2EYPA 4TRDA 5JOBA 3QB3A 1F2YA 1STHA 2OXPA 4KHVA 4R8NA 4S3SA 2M00A 3OMCA 3OWFA 4KD4A 1SNMA 1SNOA 5C5LA 3VA5A 1STYA 5KEEA 1SNPA 2RBMA 3U9OA 5HGTA 3D8GA 3OSOA 3D4WA 2F0SA 3SK8A 2EYLA 4H7BA 1SYGA 3MZ5A 1SYBA 2RKSA 4IZ8A 2KHSA 3EVQA 4DFAA 5I6WA 2NUCA 4PNYA 4K5WA 5CR3A 4ZUIA 4B9WA 5F2DA 5IGCA 1F2MA 1IHZA 1TT2A 1NSNS 1A3VA 2PZTA 2SNMA 2EY6A 3HEJA 3BDLA 4HMIA 4KTAA 5NUCA 5C4HA 3C1FA 5IGBA 1EY5A 1STNA 1KABA 4WRDA 3ITPA 4QMGA 5EKKA 4KY5A 5C5MA 4ME5A 2ENBA 1EYCA 3DMUA 4B9XA 5J22A 1TQOA 4KJOA 2F0UA 2F0HA 4N9PA 2QDBA 4KY7A 4DF7A 1EY4A 1A2TA 1SYCA 2F0OA 3HZXA 2RDFA 4K2LA 4ODGA 1EYDA 3D6CA 4WORA 5DEHA 3NUCA 4MIUA 2EYFA 4EVOA 2EXZA 2EYJA 3T13A 5KYLA 2F0DA 5KRUA 3ERQA 5IIFA 1A3TA 5JAVA 4I65A 1SNDA 1U9RA 3SXHA 4K6DA 5IGEA 2F0KA 4E6IA 2PW5A 4K8IA 1EY9A 3PMFA 2EY2A 3E5SA 4LAAA 3TP7A 5C6AA 3NQTA 5CV9A 2F0VA 1EZ6A 4NDXA 2F0LA 1EY7A 1NUCA 5C3XA 5E1FA 1EY8A 1EQVA 1KDCA 2F3VA 1II3A 2KQ3A 4N9TA 1SYEA 2O4XA 4PMCA 1JOOA 2F0PA 4NKLA 4OL7A 3OMGA 4YIJA 5C4ZA 2WACA 5K5PA 3D4DA 3SK4A 4KD3A 1AEXA 2F0NA 2F0GA 3DHQA 3EJIA 1F2ZA 2PZWA 3R3OA 3H6MA 2F0IA 4K14A 4NMZA 1STBA 1A3UA 3C1EA 4QB4A 5IOCA 2EY1A 5J1ZA 4ID6A 3SR1A 4K5VA 3MHBA 4G57A 1TR5A 2PZUA 4F7XA
chains in the Genus database with same CATH superfamily
1JOKA 2KCCA 2NVXH 4B3RL 1MJCA 3HFZB 5KYIA 2B63H 2RDGA 1CSPA 3MAQA 5C4XB 2RDHA 4M8AA 3SVMA 2Q2TA 2BH8A 2JP1A 3TZUA 4B3SQ 3KLRA 3BU2A 3W2DA 4AQYQ 4JOIA 3A8IE 4LF4Q 1E22A 2A6ED 4X3SA 3SK5A 2K6AA 4BBSB 1E2VA 2WKDA 3A7LA 3AQQA 1X9NA 1LABA 3HKZG 3M7NA 1EOVA 3GTJB 1WOCA 1NBWA 5KNDA 2JA6G 4UAIA 1IZ6A 2ES2A 3P20A 1E7ZA 5I9PA 1YNXA 3S2HB 4PZ8A 1L1OB 3J7AV 3BJUA 3CCLA 1JOQA 1NR4A 1KDAA 2GN5A 5D65A 2O5IC 5CV6A 1L0YB 3L9AX 3ZYYX 1W3SA 5JPNC 5KEEA 1A8VA 2HUGA 4DV5L 3PUZA 1NY4A 1HTLD 2EVBA 1F2MA 1PH6A 3S14H 1NE3A 2Y0SE 1BCPD 5FOBB 1L0WA 4BBRH 4WRDA 4DKAC 3HOXB 3J7AF 3ITPA 2DUDA 4GLXA 1PDQA 1J9OA 3PUXA 2YV5A 1EIGA 3WOFA 4LFBL 2NN6H 1KQSA 1A2TA 3VR6A 3RZDH 3F2BA 4BXXH 4B3ML 1IKMA 1D5ZC 3AU7A 3D31A 3FMCA 5KYLA 4DR1Q 1LM0A 2JA5G 2VQEQ 1VQKA 5IGEA 4H44C 2NN6I 3TP7A 2M2LA 5C6AA 3I8ZA 5CV9A 1HNXL 2WINB 5HGQA 3I3CA 4IURA 4WFN3 2EE1A 3F8TA 5H1SE 3TZDA 4X66L 5C3XA 1W6KA 2FMCA 2JYOA 1K8AC 1EQVA 3WDNA 2F3VA 4O0AA 1GUTA 5ELDA 1JOOA 5JEAJ 1CSQA 1TY0A 4YY3Q 4NMZA 2D62A 3J80i 2B2UC 3C1EA 4C3JB 5J1ZA 4DR5Q 2A19A 2WB1G 1YJ9A 1CZGA 2K5VA 1CTMA 4QGUA 3SHLA 1I4PA 1SMYD 3S1MH 2CFMA 2MFIA 3EN2A 1ASYA 5E7NA 1L2FA 1SSOA 1JJGA 2L15A 2QGQA 4DXFA 3RD4A 1TS5A 3G4SA 2KCNA 1JWMD 3KF6A 1AN8A 3CPWA 2H1EA 2F0EA 4YCUA 4HJ7A 5I9OA 1KLUD 2PW7A 1RCVD 5C3EH 2UUCL 4XTCS 4NP5A 1TIID 2HT1A 3VR5A 1OXTA 2HCIA 3J81i 4C1NI 5IP7G 4IUNA 1KDBA 3KDFA 2C5CA 1LTTD 4HJ5A 3HG9A 4F88A 2QCPX 4JG2A 2BDNA 4A3IH 1PFBA 3W1BA 3QO2A 2PNHA 1I3QB 2IY5B 1WFQA 2EDGA 1FYCA 1WTXA 1SNPA 2MNAA 2RBMA 5G3LF 1TWCB 2EJMA 2IJ0A 3MEFA 3Q22A 1ONLA 4DFAA 3E0EA 4WJ4A 4RCOA 4FF2A 1XNQQ 1K9MC 3H0GH 4A3DH 3K5OA 2E2DC 2QA4A 4K0KQ 2N8NA 3OPOA 1RTNA 1KAWA 1J8IA 3I2ZA 4CJ0B 2B2TC 4C3HG 5AFWA 5FLXc 1NNXA 4HSPA 1N36L 4C3HH 3GTQB 3IL8A 4PZ6A 4LWCA 2OTJA 4HJAA 1IBKL 3ULLA 2PPBC 5GAEC 5I2XA 4NKLA 1BXTA 3OMGA 1C48A 1CQFA 3DWPA 4JI5L 5L37A 5M3FB 2R3ZA 4A3FB 4C1NK 4JI6L 1AEXA 1XTCD 5T1IA 4DUYQ 1N34Q 2F0IA 2LY7A 4HR7B 1P8LA 3DM1A 5DLQE 1BCPB 3E9HA 1UWVA 3M9BA 1SFOB 4TVAB 3GV3A 1EY0A 4JI1L 5K36H 3I4NG 3NSWA 3S1QH 5K36G 1GO3E 1K73C 3W3AA 3ND8A 4X6AH 3FP9A 4JI2Q 3K5NA 3L2PA 5IT9E 3S16H 3MXNA 1WVLA 4GKKL 5C0XH 3VYTA 1M90C 4X65L 2PYKA 1QUQA 4Z9CB 1YITA 3DEOA 1SBBB 5E4WC 1Q3LA 2H5XA 1M4VA 3GTKH 5FO7B 1Q86C 1MHWC 3J81E 5CV7A 4J15A 1PRTD 3VDYA 4BY1B 3DEPA 2PQAB 1V9PA 2OF1A 2KBNA 5KIXA 1X3EA 2HD3A 4L6TB 5JOBA 3A55A 4HAEA 4R8NA 3CQZH 3CC4A 4QL5A 1STYA 3KLSA 3KFUA 4H7BA 3CP0A 2RKSA 3HOXG 5CR3A 4PNYA 3IRBA 3AFPA 1A3VA 1E1OA 4OGQC 2Q8TA 3MXGA 3IKJA 1UUPA 4R4CA 3ND9A 5J22A 4B3SL 2B2UA 1G2SA 2UUBL 4BA2I 1D1IA 4C3IB 4WJWA 3CC2A 4A3GG 1HRJA 5JJZA 4A3GH 2A6HC 1CM9A 4ODGA 3KJPA 4MTNA 4ALPA 1KHIA 1K83B 3NWSA 4MHEA 1LTID 2A68C 3UDGA 3S1QB 1NMFA 3E0JA 4GLAC 2PMZB 4K6DA 1XTDA 1EU3A 2I07B 3CRLC 4A3DG 2E2HH 4X3TA 2VQFL 4P2CB 5CBEE 1VQPA 1MI2A 3WOEA 2RHSB 3FRPB 2KQ3A 2O4XA 1FJGQ 4OL7A 4YIJA 1Q81C 4R1JA 1H9MA 3EJIA 4K14A 3E6ZX 4A3KG 3GTKB 2EY1A 2JEAI 4A3KH 2A73B 3NTHA 4YY3L 1QVGA 4HSVA 1H9SA 4DR5L 2IHFA 1XMOQ 2CKZB 5I4DA 4RHRA 3A7AB 4BWGB 4JI0Q 3T16A 3CKIB 4FF1A 4OXPA 1I94L 5FK9C 4IALA 3GV6A 4RHSA 1B4OA 4XQQA 5EQ0A 3I55A 3TP8A 1EY6A 1ET6A 1SROA 5C0XI 2A74C 5C0XJ 1S5ED 1GKHA 1SYDA 3GO5A 1QE6A 4DV1L 4GN3B 4KKSA 2WIIB 1FR3A 2LKVA 5E4XA 5I6YA 5IY0A 4HJ9A 5D3DA 4A3BG 1EUJA 2I5MX 2KOLA 4KHPL 3CXCA 1HR0Q 1Q82C 4L5RC 2NVTB 2EYPA 2E5LL 1UNSA 2BCOA 3G6JB 4GOPA 1TS2A 2WFWA 1FGUA 1X32A 1C4QA 5AJ3Q 3K80C 3D4WA 2XRQD 1Q46A 4JOIC 4DR6L 4GNXB 1TKWB 2KHSA 3PSIA 4B9WA 1YVCA 1NSNS 1HZ9A 1G8ZD 3C1FA 1X3GA 3A56A 4KY5A 1C8CA 4NXMQ 2F0UA 2F1MA 1BVSA 1SR3A 2F0HA 1O7YA 4NXNL 1DXMA 1R4QB 3M4QA 1S5DD 3NUCA 4K0KL 4RAUC 3HOUG 3K7UC 1LV9A 4Y52H 4A3BB 2ICEC 4R9WA 4AH6A 1K28A 2JK8A 5BR8Q 1CFMA 3BVMA 1VF7A 5ELNA 3HOVG 1HJPA 1Y1WB 2F0LA 5EKIA 3KJOA 1B8AA 1IW7C 1B50A 2UU9Q 4XYQA 3R3OA 4CDEC 3HOYB 1E0BA 1VQ5A 1HNWL 3D4RA 2FFKB 4ZQ3A 1FGBD 2WP8J 3RN5A 1GM5A 2I0QA 3HOVB 3S2DB 1D2BA 4A3JG 3NBHB 4P73A 3X3MA 2F0FA 4PMBA 2JA6H 4QCLA 3VYUA 1EQQA 2CWPA 1BBWA 1DOLA 2X6GA 3HRZC 4RWSC 5M9OA 1Y1VG 1Q7YC 2N78A 1CA5A 1ZKOA 5BN3A 1LTLA 3DLLA 3FDTA 4R8IA 4HIKA 1KRSA 1YJNA 3PUVA 5IGDA 2HHHQ 3PF4A 1B3AA 4BBSG 2DJGC 3T1HQ 1DYQA 4DAPA 4K6LA 5D3IB 1RODA 4I7AA 4XQJA 2Y0SG 4CKCA 1DOMA 1JE5A 2HDMA 4HJ8A 1S72A 1N36Q 2ZJPA 1WTHA 2E74C 3K81C 3I56A 1YZ6A 4GNXC 4DR3L 3RLOA 3HOUB 4L5SA 2LS01 3I4NB 1I4RA 2OQKA 2QKIC 1Q12A 4A3BH 1TWFH 2B8GA 2IX1A 1LTAD 3HOZB 3OIPA 4DUYL 1RJTA 3SGIA 3MZ5A 3NTIA 2X6LA 2CVRA 3TQYA 4DR2L 4FF3A 5IGCA 1XX8A 2B39A 3NE5B 5J39A 4DNTB 3S1RB 4KLKA 4CDFC 2ZXOA 1JJ2A 2E76C 2D5DA 1F9PA 3O13A 3S17B 4YWKA 4JCVE 5C5MA 1E2ZA 3M85A 4KJOA 4A3CH 1S4ZA 3IFDA 2EOTA 5DEHA 4DV0Q 4MIUA 3S15H 1QCBD 3ER0A 3CCQA 1OTCA 1BO0A 1LO5D 1FVIA 1XJVA 3MWYW 2FJ2A 1KXLA 2PW5A 1PH8A 3HOWH 4GKKQ 4UP9A 4HCSA 2XWJB 2UXBL 1IKLA 2RSNA 2K32A 2K7VA 1EY7A 4RGMA 2RQXA 5KNCA 3KUPA 1I4QA 4DV6Q 1XMQQ 4KHZA 1G2TA 3RZOB 1C0AA 3H6MA 1MSGA 1PXUA 2JA8G 5M5YB 1FJGL 1A3UA 1S5FD 2IX0A 1BCPC 1PTOH 3L0OA 1QWYA 4L5TA 4JBMA 1VQHA 1VQCA 5C3EG 4F7XA 2E2HB 4ZUJA 1ET9A 1F9SA 4U68A 2D0OA 3Q6SA 1QUQB 3TMEA 1A62A 3NQIA 4LW1A 1CT1D 2Z8LA 3VR2A 1AE3A 5CV4A 4HMJA 3MFGA 1K3RA 3CCSA 2RCNA 4NW2A 2B2VA 4JBWA 4IPDA 2WAQE 3KK7A 3M4OH 3L7ZC 5JVG3 2BE5D 2HQEA 2HIVA 3PCOB 1G6PA 2VUMH 3LX0A 4JI7L 5LL6X 1N32L 2X69A 1GHKA 5HURA 5D14A 4JC0A 1A2UA 3SE0A 3SEBA 1F9QA 2RSOA 3TP5A 2F0WA 5CORA 5ELBA 4OIKA 4DAYB 2Q2HA 4EQNA 3T1YQ 1SLJA 1JT8A 3GTJH 2N88A 1DONA 4KV6A 3PO2G 2K1BA 1N9WA 4IPHA 1LT6D 4S3SA 1CKNA 4DK1A 1LTSD 5A2QL 4A75A 1VQ8A 2UXDQ 1SYGA 5I6WA 2R93H 1WCMG 4K5WA 4HIDA 2K33A 4I7ZC 5EJWA 2PO4A 2A68D 4KTAA 5GROA 1M8AA 4DPGA 4RGNA 2JSOA 3A8KE 4MN3A 4DR6Q 3N52A 1EY5A 2DY8A 1JICA 1TWAH 1CKOA 2Y0SB 4IUVA 1XMOL 2DY7A 1TVXA 2Z4HA 1TQOA 4JW0A 4Y7NH 4N9PA 3HKSA 1GD7A 1CHQD 4JV5Q 2RDFA 1A63A 3S1MB 1FNUA 1PTOD 3RN2A 2LXJA 2JEBI 2VZAA 1Y1VB 1WTPA 4C2MB 4LAAA 2QEXA 2E75C 3EIVA 1V1QA 2F4VQ 1HR0W 1R9TH 4LF5L 1E3PA 2ID0A 1CA6A 1HZCA 5BR8L 1KDCA 1D5MC 3CPFA 1VQNA 2VW9A 1JC7A 4A93G 4A93H 1H9RA 2J0TD 3JAMc 2ALYB 2WACA 2BE5C 2EPBA 4A3MH 1T5XD 1YNJC 4LFCQ 1F2ZA 3TEHB 1OXSC 4QB4A 1UEAB 4CJ1B 2R7ZH 2SOBA 5LMNW 3F2DA 3VR3A 4BY7G 5FO9B 5AJ3L 1EIYB 2QDLA 4UP7A 1SMYC 4ME3A 2UUAQ 2KECA 4DGZA 2ZM6Q 5FJ8G 1W6JA 4P75A 1I5FA 5LMUQ 2NZ1D 1F9RA 4H0LC 1GJXA 1NTGA 3HKZE 2N55A 4NXML 5DAUA 2AUJD 4IUQA 1NAPA 5LMNQ 3GTOH 1OXUA 1ENAA 4HTHA 2B63G 1N33Q 5LHY1 1MGSA 2JA8H 5JJKA 3OIQA 3NXWA 3CCRA 3QJYA 3W1GA 1IL2A 1SDFA 3FKIH 3NHHA 2Z9HA 1PZID 5GAGC 2F0MA 4DV4L 2JA7H 3BYYB 4H02A 4A3GB 3GQBA 1X6OA 2F03A 4OX9Q 3RLFA 3I73A 2AUKA 1STGA 5TSSA 3EA6A 2A6HD 5FLMH 1AZPA 1WTOA 4KD4A 1KL9A 4RGTA 1GVPA 1S5CD 2VNUD 2LXKA 3H0GG 2AWOA 3BZCA 4IZ8A 2NVYH 4YWLA 4A3LG 2SEBD 1QB5D 3CC7A 1IHZA 1YI2A 5EBCA 4GKJL 3KOJA 1IBMQ 5I2YA 4DV3Q 2Z4IA 3A0JA 3NENA 3A8JE 4PMWA 2L1BA 3PIPA 1EY4A 3PO2H 3K7AH 4XYOA 2NZOA 5FLXL 2HHHL 1RDPD 1YHBA 3T1HL 1PH7A 1PTOF 4RGOS 3E5SA 2NZHA 4OHJA 3LGJA 2NN6G 3F2UA 3NQTA 3OWEB 4QJFA 4AIMA 3J7A5 1TY2A 2AMCB 4PMCA 1SYEA 2AQ1B 4LUVA 2ZTCA 1D7QA 1D5XC 4QQBX 1BUVT 2G9HD 4KD3A 3MC0B 3AEVA 2VL6A 4BA1I 1IYUA 1XMQL 4K5VA 2BDOA 1SNQA 3GTGH 3SK6A 5LL6S 4DR4Q 1CK1A 1UE7A 2PQEA 1LYLA 2D0PA 3S9WA 4DK3C 1I6HB 1GUGA 2B2WA 2KCTA 3KBGA 4DR7Q 1SJED 2F0JA 3G71A 1LLRD 3S1NH 2QF7A 5ELFA 1BQQT 1VF5C 2FINB 4J6HA 2PMZE 4DV0L 1EQRA 3H3VH 1I50B 4UY8C 1YHQA 2XRSD 4BY7H 4BY1G 4JI7Q 3I90A 1HQMC 3TS2A 2OQ0A 4JBKA 5C3EB 4LFBQ 4IUPA 3MVVA 1ESFA 5BN4A 4R4OA 4RMFA 3K5MA 2NVQH 4LF7Q 3KF8B 2V1CC 1Z9FA 1EEID 3BG3A 4DR1L 3NBHA 1JB7A 3HOXH 4A3JB 1U0LA 1YHAA 4A76A 1H9KA 1Z6HA 1BKBA 2I46A 2XGTA 2K5DA 3FVQA 1XPOA 2UXCQ 1HNXQ 3U4VA 3HOYG 2VS1A 2XVSA 5F2DA 2PZTA 5CBAE 1I3QH 1JJCB 1VQ4A 3QG1A 1KLGD 1QZHA 1UE5A 1YJWA 4DF7A 3HOVH 1X65A 4ZKCB 1EYDA 5C4XH 3E9IA 1I6HH 3LWUA 1A3TA 2KENA 5JJIA 1I4XA 1N32Q 3SDZA 4Y7NB 2CQAA 4LFAL 4KN7C 1I94Q 4IQZA 3F2CA 3PIP3 1AE2A 4BBRG 1AFPA 1F2LA 4DUZL 1S3OA 3GD7A 3PV0A 4X62L 1Z7TA 1STEA 2NBFA 4C3HB 2XIWA 3ICEA 4IN3A 1G6ZA 4XT1B 1JCKB 1BBUA 2F52A 1K0SA 4G7HC 4RKLA 1PFMA 2DJFC 2UXDL 5BN5A 3MEHA 4A3FH 5CV5A 4JPBW 3CCVA 4KHPQ 2L0CA 4H13C 3RLNA 5JJLA 2K75A 5IODA 5CGKA 3I4MH 2UUAL 4MZ9A 2R7ZB 1RF2D 4A3KB 4DU9A 1ENCA 3T56B 1JORA 1O78A 4J1MA 1TS3A 1JQYD 2A69C 1SFOH 1QZGA 4FF4A 1BF4A 2MQHA 1PZJD 2ZJQA 2Q8IB 4X64Q 4JI8L 1CKNB 3CU7A 3V2TA 3TN2A 2EXDA 3BDCA 1F77A 1Q1BA 2CH4W 2F4IA 3N6RA 3EFXD 2E2JH 2DNCA 5EGTA 4IPGA 3K8AA 1BR9A 5KNBA 1B9NA 1L0XB 1J5EL 5CV8A 1HNZL 1U5KA 4ZCKA 4JK1C 1ICFB 4DV4Q 1GXDC 2JA8B 4OEMB 1VDZA 2EYHA 1NMGA 3H0GB 4NB3A 4KHVA 3KYHC 1A15A 2M00A 2O2LD 1SNOA 2CCZA 2K4KA 2IPKD 1HHVA 4EX5A 1Y1WG 1ZXTA 4LF6L 3J80c 2QEJC 1VCIA 5IP7H 5GADC 2E8GA 3R2IA 2R7FA 4IO9A 1Y8OB 1PYWD 3W5OA 3HOYH 2L9HA 1FNWA 2UU9L 1P16A 2ENBA 1MSHA 4KKUA 2ATWA 4OO1G 5G3LD 2WB1B 4ZKBB 1A6XA 1ML0D 1DGSA 1IBML 2K04A 3S2HH 1LTGD 1V1PB 3HZXA 1FNVA 1KIXA 2JE6I 2OTLA 2QW7A 2EXZA 3U58A 1Q1EA 2IX3A 1SE3A 1VQEA 1G51A 3OYYA 1N33L 4ZRZA 3TS0A 2BA1A 1SE4A 1RHPA 1DM0B 3I4LA 2KHIA 2N3SA 1KD1C 2QILA 1U4PA 5IP9G 1B9MA 2ICIA 1D6EC 4OONA 1EZ6A 4DK6C 1B2TA 4IFDI 2E2IH 1GUSA 4B08A 5J3BA 1PH9A 2E2JB 3BS1A 1YEZA 1G291 4QUCA 4X3KA 1HUMA 5IOCA 4ID6A 5ELEA 2ZXRA 3MHBA 1BBXC 1TR5A 2Q2UA 4CJ2C 1NJIC 4A3IB 1EZ8A 4ZK9B 4RKBA 1VMCA 4DV7Q 3ZJYC 1XPRA 2KEEA 1PTOC 1ESRA 2Q2IA 4DR3Q 3HKZB 3MTSA 5FLXE 4OIJA 1R4PB 1L1OC 2HDLA 3RUZA 1I4HA 1BOSA 4K5XA 4LMQD 1CUKA 1HFNA 3H3VI 4FDBA 1VQLA 3NP8A 3KLWA 3S1NB 3JAML 3PO3H 3BDOA 4XXEA 2B29A 4FXKC 2K5WA 5DNFA 3OWFA 5C5LA 3KLSX 1SN8A 3DWAA 3U9OA 4C3IG 1AZQA 4C2MH 1YBYA 4C3IH 3D8GA 3SK8A 1WTQA 2EYLA 1R9TB 3VYRA 2A1AA 4TSSA 1H95A 5C0XG 3M3YB 2K03A 1Q8IA 2OWOA 1JB3A 4IUUA 1TT2A 2YTYA 4A3CG 2EY6A 5NUCA 1HFGA 1HZBA 5IGBA 4IFDH 1STNA 3BZDB 1MKHA 5IT9c 4IFDG 4NPSA 2ASBA 2JJQA 3L3OC 4GN5A 1N8RC 4DV2Q 2I5LX 3V05A 3CMEA 4RG1A 4WORA 3R93A 3TSSA 5DM63 3J81c 4A3EG 1HA5A 4ZYSA 2SDFA 1GUOA 3RMHA 4LUOA 4JI0L 5EPJA 5JAVA 1SNDA 2WV6D 3PIO3 1CZWA 1DJRD 2R7ZG 3M4OB 1XWEA 4IOCA 3I91A 1XNRL 2PNRC 2PCFB 4V0BA 3CW2C 2KUMA 2B2TA 3EQLC 3H3VC 4OO1H 3A74A 4DV1Q 2WAQB 1BCPF 1VS0A 2R7DA 4LF8Q 4B3TL 2JA7B 1K8GA 4CGYB 1C9OA 3SR1A 1O80A 2F0QA 4I65A 1SJHD 2BH2A 3V96A 4DAVA 3HOZG 1V43A 1X3PA 3T53B 2Z6KC 4DNRB 4EQ5A 2VXWA 4CKEA 1HZAA 2VQEL 4A3IG 3URYA 5IYDH 3UE1A 2K28A 2Z0SA 2JA7G 4L63B 1RTOA 5IWAL 1VQFA 2NWGA 4FVMA 1J6QA 5C44B 1LT3D 3M4PA 1PV4A 1Y8NB 5IYCH 3M7GA 4PZ7A 4X64L 4PQXA 4KY6A 3PO2B 2G9DA 3F1ZA 4NXNQ 1EU4A 2EIFA 4LFAQ 2HIXA 3WWVA 2VUMB 3BZKA 1YNNC 4R4IA 2OEOA 3OTOQ 3QB3A 1X3FA 4MNOA 3SK4A 3VA5A 1T9HA 4BBRB 4IOAA 1RL2A 3PUWA 4TQUS 3H09A 2B2VC 3E3XA 2YU9B 2UUCQ 2MO1A 2EZVA 1ENFA 3RZDB 1AH9A 4ZUIA 2F4VL 1AW7A 1PVOA 2ZXPA 3NEMA 4P72A 2R6GA 4HMIA 1PH1A 5C4JB 2CQOA 4JI3L 1WCMB 1B53A 2FHTA 2OT2A 1Y8PB 3I70A 2L12A 1HNWQ 2QDBA 4KY7A 3ONAB 1KNEA 1WD1A 3TRZA 4RA8A 2PQAA 4LNQA 1X54A 2XN9C 5M5XH 2M9VA 3AYHB 2XSCA 4DK0A 2JA5H 1UE1A 2EQSA 4K8IA 1EWIA 2AQ3B 1T5EA 2B63B 1XNQL 1H9JA 3BYTB 2CHBD 5K5PA 1PFSA 2A69D 1TWGH 3FKIB 1IBLQ 3CCUA 4BY7B 4GZYC 2FXQA 3TBIB 4A3EH 4GS3A 3CCMA 4LF9L 4G57A 3NTKA 2JN4A 1ZEQX 5EPLA 5JEAG 5FJ8H 2Z1CA 4DNIA 3J81j 3TP6A 4PV1C 2NVQB 5COYA 1WTVA 3HP3A 3UDFA 3P75A 2NYZD 5M5YH 1L1OA 3T4AC 4K2KA 4XIGS 5EKLA 1XPUA 4V190 5M5WB 3DXJC 2J4XA 1VQIA 2XTIA 4GNXA 4MTKA 2VUMG 4CDCC 2V4DA 4F87A 3NBIA 2JA9A 1UEBA 4TKOB 1JMCA 3UDIA 2O5JC 4XT3B 5T1GA 4JI6Q 2F0TA 3CF5A 1ZYRC 3QOJA 1A0IA 2KJXA 1WD0A 3HOZH 1EL0A 5FLMG 3EROA 4APVA 2EYMA 5IYCG 3H15A 2IT1A 4LF4L 3S14B 4BS9A 1JWSD 4TRDA 3QWNA 3K5LA 4JBJA 3S17H 4FP5D 4L5QA 1TS4A 4KK7A 2XWBB 4BBSH 2TSSA 1G91A 4JI2L 2B8FA 1SYBA 4PG3A 3PO3B 1ZYRD 2NUCA 1E24A 1VQAA 1LUZA 3HEJA 1HTPA 4KI0A 4DV6L 4X65Q 2R92G 2L55A 5CYUA 3RR5A 4ME5A 2R92H 4A3EB 3GDEA 2RCFA 1EWCA 2K14A 1Y14B 3J7ZC 4DN4M 3D6CA 1AP0A 1VQBA 1GOZA 2GA4B 2C9OA 1LT5D 5ELOA 3T13A 5KRUA 2GVBA 1WYDA 1SE2A 4GOPB 2Z6KA 2TMPA 4HIOA 2K52A 3RZOH 4LK1C 2F0KA 1Z47A 4E6IA 1QVCA 3PMFA 1GUWA 1PTOB 4HEDA 2JQOA 3G7LA 4IFDJ 2ZJRA 3OHXC 4N9TA 3P7JA 2KHJA 3KF6B 3GTLH 2F0GA 1YNND 1XNRQ 3I4MG 4FNFA 1SXTA 3G48A 1QJOA 3U9SA 1PRTC 4FYDA 3RNUA 1QVFA 4EQPA 4LF8L 1X3QA 3T1YL 4G4KA 2EYOA 1ILPA 4ILWA 4A93B 4UDUC 5A35A 1UAPA 3PGZA 2J7ZA 3P1HA 3GP7A 3NK9A 4CHTB 3QR8A 1EWHA 1RD9D 4JI4Q 1VQ6A 2MJ8A 4EGVA 1QNKA 2L4NA 3DUZA 1HH2P 1B1ZA 1D1KA 4BY1H 2UXCL 4QF4A 1DOKA 3R8BA 2L5TA 5IWAQ 4JYAQ 5C3WA 1QOHA 4K8JA 1TWHB 4YHHQ 5CC4A 2BOSA 4C3JG 3AMUA 4C3JH 1UE6A 1OXVA 2ZTEA 2NVXB 5DM73 2LFNA 4JV5L 1KC8C 4AYBG 3BVZA 1B3QA 4DA2A 1SRUA 4A4IA 2LMCB 5EBDA 2FMMA 1I50H 3PUYA 4AYBE 1HQRD 3Q8DA 1HA6A 1F2YA 1STHA 4O42A 3J81L 2K50A 3HOWB 2VY3A 1VQMA 5CMDA 1JWUD 1LTRD 3MFYA 3D3RA 3BVGA 3NWTA 4LF5Q 1O7LA 2DN8A 1KTKA 4DUZQ 3GTLB 4X62Q 3GTQH 1B70B 1EEFD 4LFCL 1EYCA 1PH3A 3KF8A 1IYJB 4QUFA 5IE8A 4POGA 3FPUB 2NVYB 4OWXB 1QNUA 4KN4C 1V1OA 3Q24A 1X56A 1EFID 4KMUC 1K0RA 1HR0L 4ZAIA 4M1UB 5C4JH 2F0DA 4ULLA 1U4LA 2ZM6L 3I4MB 4Q0FA 4XDXA 3GTPB 5FO8B 1CHPD 2EY2A 2B3GA 1NUCA 5LMNL 1JE4A 4BXXG 1EYGA 3KBXA 1YIJA 1IW7D 1OO9B 3DHQA 1WTRA 2PZWA 1MD2D 1QG7A 1WJJA 3ERSX 1QILA 4A3FG 4NDXA 1X55A 1IBLL 3C2PA 4OX9L 3GTOB 1J5EQ 4L8JA 3IAYA 3S15B 5IYBG 1PMRA 2SNSA 3K0YA 1C7YA 3PIOA 1FL0A 2WB1E 2BA0A 4UP8A 1EOTA 2WKCA 4GOPC 1HUNA 3S2DH 1IBKQ 1PYSB 4A3MG 4JI5Q 4LF6Q 1MJEA 5E3FA 1VQJA 1SE8A 1N34L 3U50C 4CBVA 1STAA 4O2DA 4GKJQ 1CQVA 3GTMB 3B6YA 3JAME 3LWEA 3VA7A 4F8MA 1DZ1A 2K01A 3C3LA 4J8QA 1NR2A 4R4TA 2AWNA 1EYAA 1S5BD 3GTPH 4QY7A 1VQ9A 2NTSA 1I4GA 1E1TA 1LACA 4YCWA 4B3RQ 1MBYA 2AHOB 3HS0C 3D0FA 4LJZC 3AB9A 3K7AB 1EQTA 3H91A 2A8VA 2VB2X 4IUTA 3HOUH 5C4HA 1K83H 1D8LA 3BDLA 2RF4A 3S16B 2CH4A 2MP1A 3OOCA 4QMGA 2YTXA 2PI2E 3DMUA 2YTVA 4DAYA 4QIWB 1LTBD 1SYCA 3ULJA 1K8MA 4EVOA 2EYJA 4DR4L 3NELA 2A5HA 3CD6A 1U9RA 4A3LH 3STBD 3SXHA 1PLFA 5M3MH 2PI2A 2C35B 1DD2A 4FO2A 1TWCH 1VQDA 2KA7A 4DR7L 4DR2Q 3J7YW 1KRTA 5C44H 4JVZA 5C4XG 5C44G 1EY8A 3KDFB 3DWQA 1V1PA 5C4ZA 2IW3A 3GTMH 2UUBQ 3JC66 5IYDG 2G5DA 3S24A 4ZLTF 2MHVA 1HPCA 5ELCA 1U4MA 4AQYL 1W2BA 4U673 4G7ZC 1KAAA 1SYFA 4LF7L 3I7FA 2EY5A 1Y1VH 2AKWB 5IYBH 2DNEA 3CHBD 3U4ZA 3PQIA 1TXYA 2UXBQ 3A5UA 4B3MQ 1BDOA 2VQFQ 4N8X1 3UE0A 3UDXA 3QOLA 1GHJA 1VMPA 4FXGC 4RCNA 2RA4A 4XQNA 4GN4B 3CRKC 4G7OC 5JVH3 2NVTH 3I4NH 1WCMH 4A3MB 5EAYA 2YYZA 4JYAL 2NTTA 4X66Q 3IFTA 1PH5A 4LUZA 4DXGA 3Q23A 4DV2L 4IJLA 2RVLA 5IT9L 1ICWA 1TWHH 4DV5Q 2OXPA 1H9SB 2D2CC 1SNMA 5M3MB 3MXUA 3G6EA 3LNNA 3OSOA 2F0SA 2H4OA 2K5QA 3OW2A 1K3BC 2D9UA 2B2YC 2EJFC 1MIUA 2SNMA 5FKAC 2AQ2B 1DCZA 2B2YA 2CW0C 1WI5A 2I5HA 2LSSA 5EKKA 3CCJA 1VQ7A 4P74A 4B9XA 1TU2B 4YCVA 1NCVA 1KNAA 3DM3A 1VQGA 4B3TQ 2F0OA 1Y1WH 3H94A 2IWHA 4K2LA 4DAMA 2EYFA 4JI4L 4WJ3M 2E5LQ 1IYVA 1Q90A 1VQOA 3X3NA 4FXDA 3FPPA 5IIFA 5GAHC 4CKBA 1TWAB 2P5ZX 2GVAA 4IJHA 3HGBA 3CQZB 1V8QA 1EY9A 4YHHL 5M5WH 1SAPA 1Y69U 2F0VA 1Q8KA 1FD7D 2EJGC 2R61A 5E1FA 1XYIA 5M3MG 1BNZA 1II3A 2MO0A 3K6OA 4KKTA 2CWAA 4OWWB 4JI8Q 2JA6B 3K57A 3D4DA 1WTWA 2F0NA 5IGGA 3I72A 2A6EC 5JPMC 1E2WA 1EIFA 3C46A 3JAMi 2CW0D 2NB0A 4POFA 1S40A 2L11A 3AFQA 3FEWX 5IP9H 4OO1I 3FKIG 1U4RA 2WAQG 4YWMA 4CDDC 1HNZQ 4RH6A 1O7IA 4RFBA 3TREA 2Z6BA 3VYSA 3QIAA 3K0XA 4A3JH 1M1KC 2IHEA 3K58A 3OTOL 5ISRA 5IGFA 1B44D 4OWTB 1IXRA 1ASZA 1EFWA 1PFNA 2ZT9C 4HN7A 2K05A 2IL8A 2XNAC 4KJNA 4EQOA 2R92B 5A2QE 5KGUA 1TWFB 4JI3Q 1CI3M 4C56C 5GQOA 1EIHA 1SMXA 1RKNA 1I6VC 5HY6A 1IL8A 2F3WA 1SNCA 2MPMA 3MXPA 3STBC 1PH2A 1PYBA 3A54A 3PO3G 2R93B 2KVMA 3A5ZB 3D6WA 4QIWE 3EBEA 3GTGB 4N8FA 5M5XB 3S1RH 2JXMB 5LMUL 1PA6A 4A3DB 3OMCA 2K5NA 1PH4A 4UPAA 5HGTA 3MXNB 2F3IA 1PHJA 3UI2A 3EVQA 4ABNA 2RHQB 2R93G 1JR0D 1O7ZA 3ULPA 1XXGA 2KCMA 1TWGB 1KABA 3FHWA 3Q0AA 2K5HA 3PF5A 1YNJD 3OW7A 2YU9H 1OXXK 1ILQA 2OCEA 2B2WC 2HCCA 3TDQA 1CKMA 4X3UA 2DGYA 3M3YH 1SEBD 3NPPA 1K8OA 4LF9Q 4HIMA 4GLVB 2E2IB 3I4OA 4OELB 4DV7L 4IPCA 4UHVA 5M3FG 3ERQA 5M3FH 2N49A 3MA2B 4Q5VA 1PRTF 2Q8RE 4O1NA 2HQLA 1LT4D 3CMAA 2KEDA 3VR4A 5EPKA 4HCEA 1RIPA 4P71A 1GUNA 3CCEA 3K59A 2MUYA 4R4QA 2MGSA 3HOWG 3J80E 1HCZA 2F0PA 1HXYD 3R2TA 5JEAH 4DV3L 2JA5B 3T51B 4AYBB 1STBA 3J80L 1PZKD 2VB3X 2ZTDA 3CAMA 3M4YA 2PZUA 1B7YB 4JI1Q 1PRTB
chains in the Genus database with same CATH topology
1JOKA 2KCCA 5KYIA 2RDGA 3MAQA 5C4XB 2RDHA 4M8AA 3SVMA 2JP1A 3TZUA 3KLRA 3W2DA 3A8IE 2A6ED 4X3SA 3SK5A 2K6AA 4BBSB 1E2VA 2WKDA 3A7LA 1LABA 3M7NA 3GTJB 5KNDA 4UAIA 3P20A 5I9PA 3S2HB 3J7AV 1JOQA 1NR4A 1KDAA 5D65A 2O5IC 5CV6A 1L0YB 3L9AX 5JPNC 3ZYYX 5KEEA 2HUGA 3PUZA 1HTLD 2EVBA 1F2MA 1BCPD 5FOBB 4WRDA 3J7AF 3HOXB 3ITPA 1PDQA 1J9OA 3PUXA 1EIGA 3WOFA 2NN6H 1A2TA 3VR6A 1IKMA 1D5ZC 3AU7A 3D31A 3FMCA 5KYLA 5IGEA 4H44C 2NN6I 3TP7A 2M2LA 5C6AA 3I8ZA 5CV9A 2WINB 4WFN3 3I3CA 4IURA 2EE1A 3TZDA 5C3XA 1W6KA 2FMCA 2JYOA 1EQVA 3WDNA 2F3VA 1GUTA 5ELDA 1JOOA 5JEAJ 1TY0A 4NMZA 2D62A 2B2UC 3C1EA 4C3JB 5J1ZA 1CZGA 1CTMA 3SHLA 1I4PA 1SMYD 1SSOA 4DXFA 3RD4A 1TS5A 2KCNA 1JWMD 1AN8A 2H1EA 2F0EA 5I9OA 1KLUD 2PW7A 1RCVD 4XTCS 4NP5A 1TIID 3VR5A 1OXTA 2HCIA 4C1NI 4IUNA 1KDBA 2C5CA 1LTTD 3HG9A 4F88A 2QCPX 2BDNA 1PFBA 3QO2A 1I3QB 2EDGA 1FYCA 1WTXA 1SNPA 2RBMA 5G3LF 1TWCB 2EJMA 2IJ0A 3Q22A 1ONLA 4DFAA 4RCOA 4FF2A 3K5OA 2E2DC 3OPOA 1RTNA 1J8IA 4CJ0B 2B2TC 4C3HG 5AFWA 4HSPA 3GTQB 3IL8A 2PPBC 5I2XA 4NKLA 5M3FB 3OMGA 1BXTA 1C48A 1CQFA 3DWPA 4A3FB 2R3ZA 4C1NK 1AEXA 1XTCD 5T1IA 2F0IA 2LY7A 4HR7B 3DM1A 1BCPB 1SFOB 3GV3A 1EY0A 5K36H 3NSWA 5K36G 3W3AA 3ND8A 3K5NA 5IT9E 3MXNA 1WVLA 5C0XH 3VYTA 2PYKA 4Z9CB 3DEOA 1SBBB 5E4WC 1Q3LA 1M4VA 5FO7B 3J81E 5CV7A 1PRTD 4BY1B 3DEPA 2OF1A 5KIXA 4L6TB 5JOBA 3A55A 4HAEA 4R8NA 1STYA 3KLSA 4H7BA 2RKSA 5CR3A 4PNYA 1A3VA 4OGQC 2Q8TA 3MXGA 3IKJA 1UUPA 3ND9A 5J22A 2B2UA 1G2SA 4BA2I 1D1IA 4C3IB 4WJWA 1HRJA 5JJZA 2A6HC 1CM9A 4ODGA 1K83B 3NWSA 4MHEA 1LTID 2A68C 3S1QB 3E0JA 2PMZB 4K6DA 1EU3A 2I07B 3CRLC 4X3TA 4P2CB 5CBEE 1MI2A 3WOEA 3FRPB 2KQ3A 2O4XA 4OL7A 4YIJA 1H9MA 3EJIA 4K14A 3E6ZX 3GTKB 2EY1A 2JEAI 2A73B 3NTHA 4HSVA 1H9SA 5I4DA 4RHRA 3A7AB 4BWGB 3T16A 3CKIB 4FF1A 5FK9C 4IALA 3GV6A 4RHSA 1B4OA 4XQQA 5EQ0A 3TP8A 1EY6A 1ET6A 5C0XI 2A74C 5C0XJ 1S5ED 1SYDA 3GO5A 1QE6A 4KKSA 2WIIB 1FR3A 2LKVA 5E4XA 5I6YA 5D3DA 2KOLA 2NVTB 2EYPA 1UNSA 2BCOA 3G6JB 1TS2A 1X32A 1C4QA 3D4WA 2XRQD 1TKWB 2KHSA 4B9WA 1NSNS 1G8ZD 3C1FA 3A56A 4KY5A 1C8CA 2F0UA 2F1MA 2F0HA 1O7YA 1DXMA 1R4QB 1S5DD 3NUCA 4RAUC 1LV9A 4A3BB 2ICEC 4R9WA 1CFMA 3BVMA 1VF7A 1Y1WB 2F0LA 5EKIA 1IW7C 1B50A 4XYQA 3R3OA 3HOYB 1E0BA 3D4RA 4ZQ3A 2FFKB 1FGBD 3HOVB 2WP8J 3S2DB 1D2BA 3X3MA 2F0FA 4PMBA 4QCLA 3VYUA 1DOLA 2X6GA 3HRZC 4RWSC 5M9OA 1CA5A 1ZKOA 5BN3A 3FDTA 4R8IA 3PUVA 5IGDA 1B3AA 1DYQA 4DAPA 4K6LA 5D3IB 1RODA 4XQJA 4CKCA 1DOMA 2HDMA 2E74C 3HOUB 2LS01 3I4NB 1I4RA 2QKIC 1Q12A 2B8GA 2IX1A 1LTAD 3HOZB 3OIPA 1RJTA 3MZ5A 3NTIA 2X6LA 2CVRA 4FF3A 5IGCA 1XX8A 2B39A 3NE5B 5J39A 4DNTB 3S1RB 2ZXOA 2E76C 2D5DA 1F9PA 3O13A 3S17B 5C5MA 1E2ZA 3M85A 4KJOA 1S4ZA 3IFDA 2EOTA 5DEHA 4MIUA 1QCBD 1BO0A 1LO5D 3MWYW 2FJ2A 2PW5A 4HCSA 2XWJB 1IKLA 2RSNA 2K32A 2K7VA 1EY7A 4RGMA 2RQXA 5KNCA 3KUPA 1I4QA 4KHZA 1G2TA 3RZOB 3H6MA 1MSGA 1PXUA 5M5YB 1A3UA 1S5FD 2IX0A 1BCPC 1PTOH 1QWYA 4F7XA 2E2HB 4ZUJA 1ET9A 1F9SA 4U68A 3Q6SA 3TMEA 3NQIA 1CT1D 2Z8LA 3VR2A 5CV4A 4HMJA 3MFGA 4NW2A 2B2VA 4JBWA 3KK7A 3L7ZC 5JVG3 2BE5D 2HQEA 3LX0A 5LL6X 2X69A 1GHKA 5HURA 5D14A 1A2UA 3SE0A 3SEBA 1F9QA 2RSOA 3TP5A 2F0WA 5CORA 5ELBA 4OIKA 4EQNA 2N88A 1DONA 4KV6A 2K1BA 1LT6D 4S3SA 4DK1A 1LTSD 5A2QL 1SYGA 5I6WA 4K5WA 2K33A 4I7ZC 5EJWA 2PO4A 2A68D 4KTAA 1M8AA 4RGNA 2JSOA 3A8KE 4MN3A 3N52A 1EY5A 2DY8A 1JICA 2Y0SB 4IUVA 2DY7A 1TVXA 2Z4HA 1TQOA 4N9PA 1CHQD 2RDFA 3S1MB 1FNUA 1PTOD 2JEBI 1Y1VB 1WTPA 4C2MB 4LAAA 2E75C 2ID0A 1CA6A 1KDCA 1D5MC 1JC7A 1H9RA 2J0TD 2WACA 2BE5C 2EPBA 1T5XD 1YNJC 1F2ZA 1OXSC 4QB4A 1UEAB 4CJ1B 2SOBA 3VR3A 5FO9B 1SMYC 2KECA 4DGZA 1W6JA 2NZ1D 1F9RA 4H0LC 1GJXA 2N55A 5DAUA 2AUJD 4IUQA 1NAPA 1OXUA 1ENAA 4HTHA 5LHY1 1MGSA 3OIQA 3NXWA 3QJYA 1SDFA 3NHHA 1PZID 2F0MA 3BYYB 4A3GB 3GQBA 2F03A 3RLFA 3I73A 2AUKA 1STGA 5TSSA 3EA6A 2A6HD 1AZPA 1WTOA 4KD4A 4RGTA 1S5CD 2VNUD 2AWOA 4IZ8A 2SEBD 1QB5D 1IHZA 5EBCA 5I2YA 2Z4IA 3A8JE 4PMWA 2L1BA 1EY4A 4XYOA 5FLXL 1RDPD 1PTOF 4RGOS 3E5SA 4OHJA 3NQTA 2NN6G 3F2UA 3OWEB 1TY2A 4PMCA 1SYEA 2AQ1B 1D5XC 1BUVT 2G9HD 3MC0B 4KD3A 4BA1I 1IYUA 4K5VA 2BDOA 1SNQA 3SK6A 5LL6S 1CK1A 2PQEA 3S9WA 1I6HB 1GUGA 2B2WA 3KBGA 1SJED 2F0JA 1LLRD 2QF7A 5ELFA 1BQQT 1VF5C 2FINB 4J6HA 1I50B 2XRSD 3I90A 1HQMC 5C3EB 4IUPA 3MVVA 1ESFA 5BN4A 3K5MA 1EEID 3BG3A 3NBHA 4A3JB 1H9KA 1Z6HA 2I46A 2K5DA 3FVQA 2XVSA 5F2DA 2PZTA 5CBAE 3QG1A 1KLGD 4DF7A 4ZKCB 1EYDA 3LWUA 1A3TA 1I4XA 3SDZA 4Y7NB 2CQAA 4KN7C 4IQZA 3PIP3 1AFPA 1F2LA 3GD7A 3PV0A 1Z7TA 1STEA 2NBFA 4C3HB 2XIWA 4IN3A 1G6ZA 4XT1B 1JCKB 4G7HC 4RKLA 1PFMA 5BN5A 3MEHA 5CV5A 2L0CA 4H13C 5IODA 5CGKA 2R7ZB 1RF2D 4A3KB 4DU9A 1ENCA 3T56B 1JORA 1O78A 4J1MA 1TS3A 1JQYD 2A69C 4FF4A 1BF4A 1PZJD 2Q8IB 3CU7A 3V2TA 3TN2A 3BDCA 1F77A 1Q1BA 2F4IA 3N6RA 3EFXD 2DNCA 5EGTA 1BR9A 5KNBA 1B9NA 1L0XB 5CV8A 4JK1C 1GXDC 2JA8B 1VDZA 2EYHA 3H0GB 4KHVA 1A15A 2M00A 2O2LD 1SNOA 2IPKD 1HHVA 1ZXTA 2QEJC 1VCIA 3R2IA 1Y8OB 1PYWD 2L9HA 1FNWA 2ENBA 1MSHA 4KKUA 4OO1G 5G3LD 2WB1B 4ZKBB 1A6XA 1ML0D 2K04A 1LTGD 1V1PB 3HZXA 1FNVA 2JE6I 2EXZA 1Q1EA 2IX3A 1SE3A 4ZRZA 2BA1A 1SE4A 1RHPA 1DM0B 3I4LA 2QILA 1U4PA 1B9MA 2ICIA 1D6EC 1EZ6A 1B2TA 4IFDI 1GUSA 4B08A 2E2JB 3BS1A 1G291 4QUCA 4X3KA 5IOCA 1HUMA 4ID6A 5ELEA 2ZXRA 3MHBA 1BBXC 1TR5A 4CJ2C 4A3IB 1EZ8A 4ZK9B 4RKBA 1VMCA 2KEEA 1PTOC 1ESRA 3HKZB 3MTSA 5FLXE 4OIJA 1R4PB 2HDLA 3RUZA 1I4HA 1BOSA 4K5XA 4LMQD 1HFNA 3NP8A 3S1NB 3JAML 3BDOA 4XXEA 4FXKC 2K5WA 5DNFA 3OWFA 5C5LA 3KLSX 3DWAA 3U9OA 4C3IG 1AZQA 3D8GA 3SK8A 1WTQA 2EYLA 1R9TB 3VYRA 4TSSA 5C0XG 3M3YB 2K03A 1Q8IA 1JB3A 1TT2A 4IUUA 2EY6A 5NUCA 1HFGA 5IGBA 4IFDH 1STNA 3BZDB 4IFDG 3L3OC 3V05A 3R93A 4WORA 3TSSA 5DM63 1HA5A 4ZYSA 2SDFA 1GUOA 3RMHA 5EPJA 5JAVA 1SNDA 2WV6D 3PIO3 1CZWA 1DJRD 3M4OB 1XWEA 3I91A 2PNRC 2PCFB 4V0BA 2KUMA 2B2TA 3EQLC 3H3VC 4OO1H 3M4YA 2WAQB 1BCPF 2JA7B 4CGYB 3SR1A 1O80A 2F0QA 4I65A 1SJHD 3V96A 4DAVA 1V43A 1X3PA 3T53B 4DNRB 2VXWA 4CKEA 3URYA 2K28A 4L63B 1RTOA 2NWGA 4FVMA 5C44B 1LT3D 1Y8NB 3M7GA 4PQXA 4KY6A 3PO2B 2G9DA 1EU4A 2VUMB 1YNNC 2OEOA 3QB3A 3SK4A 3VA5A 4BBRB 3PUWA 4TQUS 3H09A 2B2VC 2YU9B 2EZVA 1ENFA 3RZDB 4ZUIA 1AW7A 2ZXPA 2R6GA 4HMIA 5C4JB 1WCMB 1B53A 2FHTA 2OT2A 1Y8PB 3I70A 2L12A 2QDBA 4KY7A 3ONAB 1KNEA 1WD1A 4RA8A 2XN9C 2M9VA 2XSCA 4DK0A 4K8IA 2AQ3B 1T5EA 2B63B 1H9JA 3BYTB 2CHBD 5K5PA 2A69D 3FKIB 4BY7B 4GZYC 3TBIB 4G57A 3NTKA 1ZEQX 5JEAG 2Z1CA 3TP6A 4PV1C 2NVQB 5COYA 1WTVA 3HP3A 3P75A 2NYZD 3T4AC 4K2KA 4XIGS 5EKLA 4V190 5M5WB 3DXJC 2J4XA 2V4DA 4F87A 3NBIA 4TKOB 2O5JC 4XT3B 5T1GA 2F0TA 1ZYRC 3QOJA 2KJXA 1WD0A 1EL0A 3EROA 2EYMA 2IT1A 3S14B 4BS9A 1JWSD 4TRDA 3QWNA 3K5LA 4FP5D 1TS4A 4KK7A 2XWBB 2TSSA 1G91A 2B8FA 1SYBA 3PO3B 1ZYRD 2NUCA 3HEJA 1HTPA 4KI0A 2L55A 5CYUA 4ME5A 4A3EB 1EWCA 4DN4M 3D6CA 1AP0A 1GOZA 2GA4B 2C9OA 1LT5D 3T13A 5KRUA 1SE2A 2TMPA 4LK1C 2F0KA 1Z47A 4E6IA 3PMFA 1GUWA 1PTOB 4HEDA 3G7LA 4IFDJ 3OHXC 4N9TA 3P7JA 2F0GA 1YNND 4FNFA 1SXTA 1QJOA 3U9SA 1PRTC 4FYDA 4EQPA 1X3QA 4G4KA 2EYOA 1ILPA 4ILWA 4A93B 4UDUC 5A35A 1UAPA 2J7ZA 3P1HA 3GP7A 3NK9A 4CHTB 1EWHA 1RD9D 2MJ8A 4EGVA 1QNKA 2L4NA 3DUZA 1B1ZA 1D1KA 4QF4A 1DOKA 3R8BA 2L5TA 5C3WA 1QOHA 4K8JA 1TWHB 5CC4A 2BOSA 4C3JG 3AMUA 1OXVA 2NVXB 5DM73 2LFNA 3BVZA 4DA2A 2LMCB 5EBDA 2FMMA 3PUYA 1HQRD 1HA6A 1F2YA 1STHA 4O42A 3J81L 3HOWB 5CMDA 1JWUD 1PRTB 1LTRD 3MFYA 3D3RA 3BVGA 3NWTA 1O7LA 2DN8A 1KTKA 3GTLB 1EEFD 1EYCA 3KF8A 4QUFA 3FPUB 2NVYB 1QNUA 4KN4C 1V1OA 3Q24A 1EFID 4KMUC 4ZAIA 4M1UB 2F0DA 4ULLA 1U4LA 3I4MB 4Q0FA 4XDXA 3GTPB 5FO8B 1CHPD 2EY2A 1NUCA 1JE4A 3KBXA 1IW7D 1OO9B 3DHQA 2PZWA 1MD2D 1QG7A 1QILA 4NDXA 3C2PA 3GTOB 4L8JA 3IAYA 3S15B 1PMRA 2SNSA 3K0YA 2BA0A 1EOTA 2WKCA 1HUNA 5E3FA 4CBVA 1STAA 1CQVA 3GTMB 3JAME 3LWEA 3VA7A 4F8MA 1DZ1A 2K01A 3C3LA 4J8QA 1NR2A 2AWNA 1EYAA 1S5BD 2NTSA 1I4GA 1LACA 1MBYA 3HS0C 4LJZC 3AB9A 3K7AB 1EQTA 3H91A 2VB2X 4IUTA 5C4HA 3BDLA 3S16B 2MP1A 3OOCA 4QMGA 3DMUA 4DAYA 4QIWB 1LTBD 1SYCA 1K8MA 4EVOA 2EYJA 2A5HA 1U9RA 3SXHA 1PLFA 1DD2A 4FO2A 2KA7A 3J7YW 1EY8A 3DWQA 1V1PA 5C4ZA 2IW3A 4ZLTF 2MHVA 1HPCA 5ELCA 1U4MA 4U673 4G7ZC 1KAAA 1SYFA 2EY5A 2DNEA 3CHBD 1BDOA 3QOLA 1GHJA 1VMPA 4FXGC 4RCNA 2RA4A 4XQNA 3CRKC 4G7OC 5JVH3 4A3MB 2YYZA 2NTTA 3IFTA 4DXGA 3Q23A 2RVLA 5IT9L 1ICWA 2OXPA 1H9SB 2D2CC 1SNMA 5M3MB 3MXUA 3LNNA 3OSOA 2F0SA 2H4OA 2K5QA 2D9UA 2B2YC 2EJFC 2SNMA 5FKAC 2AQ2B 1DCZA 2B2YA 2CW0C 5EKKA 4B9XA 1TU2B 1NCVA 1KNAA 2F0OA 3H94A 2IWHA 4K2LA 2EYFA 1IYVA 1Q90A 4FXDA 3X3NA 3FPPA 5IIFA 4CKBA 1TWAB 3HGBA 3CQZB 1V8QA 1EY9A 1SAPA 1Y69U 2F0VA 1FD7D 2EJGC 2R61A 5E1FA 1XYIA 1BNZA 1II3A 3K6OA 4KKTA 2JA6B 3K57A 3D4DA 1WTWA 2F0NA 5IGGA 3I72A 2A6EC 5JPMC 1E2WA 3C46A 2CW0D 2NB0A 2L11A 3FEWX 4OO1I 1U4RA 4RH6A 4RFBA 3VYSA 3QIAA 3K58A 5ISRA 5IGFA 1B44D 1PFNA 2ZT9C 4HN7A 2K05A 2IL8A 2XNAC 4KJNA 4EQOA 2R92B 5A2QE 5KGUA 1TWFB 1CI3M 4C56C 1EIHA 1RKNA 1I6VC 1IL8A 2F3WA 1SNCA 2MPMA 3MXPA 3A54A 2R93B 2KVMA 3D6WA 3GTGB 5M5XB 2JXMB 4A3DB 3OMCA 5HGTA 3UI2A 3EVQA 4ABNA 1JR0D 1O7ZA 1XXGA 1TWGB 1KABA 3Q0AA 1YNJD 3OW7A 1OXXK 1ILQA 2B2WC 2HCCA 3TDQA 4X3UA 1SEBD 3NPPA 1K8OA 2E2IB 3ERQA 3MA2B 4Q5VA 1PRTF 2Q8RE 4O1NA 1LT4D 2KEDA 3VR4A 5EPKA 4HCEA 1GUNA 3K59A 2MUYA 2MGSA 3J80E 1HCZA 2F0PA 1HXYD 3R2TA 5JEAH 2JA5B 3T51B 4AYBB 1STBA 3J80L 1PZKD 2VB3X 1WTRA 2PZUA 5EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOK A;  1EZ8 A;  4ZUJ A;  1SNQ A;  4RKL A;  3SHL A;  4EQP A;  5KYI A;  4RKB A;  3SK6 A;  3TP6 A;  2F0F A;  2PQE A;  2EYO A;  3TME A;  3MEH A;  4PMB A;  1EY0 A;  4ZQ3 A;  4DGZ A;  5CV5 A;  1KAA A;  2SNS A;  3P75 A;  3S9W A;  1SYF A;  5IGG A;  3T16 A;  5IOD A;  5M9O A;  5CGK A;  2EY5 A;  4HMJ A;  5CV4 A;  5CV6 A;  4K2K A;  3SK5 A;  5ISR A;  2SOB A;  4IAL A;  3P1H A;  3NK9 A;  5EKL A;  4DU9 A;  2F0E A;  1ENC A;  5IGF A;  5I9O A;  5DAU A;  2PW7 A;  3TP8 A;  2F0J A;  4J1M A;  1JOR A;  1EY6 A;  3RUZ A;  4HTH A;  1ENA A;  3QOL A;  2HQE A;  5IGD A;  1SYD A;  4NP5 A;  3LX0 A;  5E3F A;  4QF4 A;  3NXW A;  4K5X A;  4J6H A;  3V2T A;  5C3W A;  5HUR A;  1STA A;  4K8J A;  3BDC A;  2F0Q A;  2F0T A;  4KJN A;  4EQO A;  1A2U A;  5CC4 A;  2PYK A;  3NHH A;  3QOJ A;  3TP5 A;  5KGU A;  4IUN A;  4F8M A;  2F0M A;  2LKV A;  5EGT A;  2F0W A;  1KDB A;  5I9P A;  3NP8 A;  1RKN A;  3ERO A;  4KY6 A;  2F3W A;  5CV7 A;  1SNC A;  5CV8 A;  3MXP A;  4EQN A;  5I6Y A;  2EYM A;  5J39 A;  1JOQ A;  3MVV A;  1STG A;  4KV6 A;  2OF1 A;  5KIX A;  1KDA A;  2EYH A;  1EYA A;  2OEO A;  2EYP A;  4TRD A;  5JOB A;  3QB3 A;  1F2Y A;  1STH A;  2OXP A;  4KHV A;  4R8N A;  4S3S A;  2M00 A;  3OMC A;  3OWF A;  4KD4 A;  1SNM A;  1SNO A;  5C5L A;  3VA5 A;  1STY A;  5KEE A;  1SNP A;  2RBM A;  3U9O A;  5HGT A;  3D8G A;  3OSO A;  3D4W A;  2F0S A;  3SK8 A;  2EYL A;  4H7B A;  1SYG A;  3MZ5 A;  1SYB A;  2RKS A;  4IZ8 A;  2KHS A;  3EVQ A;  4DFA A;  5I6W A;  2NUC A;  4PNY A;  4K5W A;  5CR3 A;  4ZUI A;  4B9W A;  5F2D A;  5IGC A;  1F2M A;  1IHZ A;  1TT2 A;  1NSN S;  1A3V A;  2PZT A;  2SNM A;  2EY6 A;  3HEJ A;  3BDL A;  4HMI A;  4KTA A;  5NUC A;  5C4H A;  3C1F A;  5IGB A;  1EY5 A;  1STN A;  1KAB A;  4WRD A;  3ITP A;  4QMG A;  5EKK A;  4KY5 A;  5C5M A;  4ME5 A;  2ENB A;  1EYC A;  3DMU A;  4B9X A;  5J22 A;  1TQO A;  4KJO A;  2F0U A;  2F0H A;  4N9P A;  2QDB A;  4KY7 A;  4DF7 A;  1EY4 A;  1A2T A;  1SYC A;  2F0O A;  3HZX A;  2RDF A;  4K2L A;  4ODG A;  1EYD A;  3D6C A;  4WOR A;  5DEH A;  3NUC A;  4MIU A;  2EYF A;  4EVO A;  2EXZ A;  2EYJ A;  3T13 A;  5KYL A;  2F0D A;  5KRU A;  3ERQ A;  5IIF A;  1A3T A;  5JAV A;  4I65 A;  1SND A;  1U9R A;  3SXH A;  4K6D A;  5IGE A;  2F0K A;  4E6I A;  2PW5 A;  4K8I A;  1EY9 A;  3PMF A;  2EY2 A;  3E5S A;  4LAA A;  3TP7 A;  5C6A A;  3NQT A;  5CV9 A;  2F0V A;  1EZ6 A;  4NDX A;  2F0L A;  1EY7 A;  1NUC A;  5C3X A;  5E1F A;  1EY8 A;  1EQV A;  1KDC A;  2F3V A;  1II3 A;  2KQ3 A;  4N9T A;  1SYE A;  2O4X A;  4PMC A;  1JOO A;  2F0P A;  4NKL A;  4OL7 A;  3OMG A;  4YIJ A;  5C4Z A;  2WAC A;  5K5P A;  3D4D A;  3SK4 A;  4KD3 A;  1AEX A;  2F0N A;  2F0G A;  3DHQ A;  3EJI A;  1F2Z A;  2PZW A;  3R3O A;  3H6M A;  2F0I A;  4K14 A;  4NMZ A;  1STB A;  1A3U A;  3C1E A;  4QB4 A;  5IOC A;  2EY1 A;  5J1Z A;  4ID6 A;  3SR1 A;  4K5V A;  3MHB A;  4G57 A;  1TR5 A;  2PZU A;  4F7X A; 
#chains in the Genus database with same CATH topology
 1JOK A;  2KCC A;  2NVX H;  4B3R L;  1MJC A;  3HFZ B;  5KYI A;  2B63 H;  2RDG A;  1CSP A;  3MAQ A;  5C4X B;  2RDH A;  4M8A A;  3SVM A;  2Q2T A;  2BH8 A;  2JP1 A;  3TZU A;  4B3S Q;  3KLR A;  3BU2 A;  3W2D A;  4AQY Q;  4JOI A;  3A8I E;  4LF4 Q;  1E22 A;  2A6E D;  4X3S A;  3SK5 A;  2K6A A;  4BBS B;  1E2V A;  2WKD A;  3A7L A;  3AQQ A;  1X9N A;  1LAB A;  3HKZ G;  3M7N A;  1EOV A;  3GTJ B;  1WOC A;  1NBW A;  5KND A;  2JA6 G;  4UAI A;  1IZ6 A;  2ES2 A;  3P20 A;  1E7Z A;  5I9P A;  1YNX A;  3S2H B;  4PZ8 A;  1L1O B;  3J7A V;  3BJU A;  3CCL A;  1JOQ A;  1NR4 A;  1KDA A;  2GN5 A;  5D65 A;  2O5I C;  5CV6 A;  1L0Y B;  3L9A X;  3ZYY X;  1W3S A;  5JPN C;  5KEE A;  1A8V A;  2HUG A;  4DV5 L;  3PUZ A;  1NY4 A;  1HTL D;  2EVB A;  1F2M A;  1PH6 A;  3S14 H;  1NE3 A;  2Y0S E;  1BCP D;  5FOB B;  1L0W A;  4BBR H;  4WRD A;  4DKA C;  3HOX B;  3J7A F;  3ITP A;  2DUD A;  4GLX A;  1PDQ A;  1J9O A;  3PUX A;  2YV5 A;  1EIG A;  3WOF A;  4LFB L;  2NN6 H;  1KQS A;  1A2T A;  3VR6 A;  3RZD H;  3F2B A;  4BXX H;  4B3M L;  1IKM A;  1D5Z C;  3AU7 A;  3D31 A;  3FMC A;  5KYL A;  4DR1 Q;  1LM0 A;  2JA5 G;  2VQE Q;  1VQK A;  5IGE A;  4H44 C;  2NN6 I;  3TP7 A;  2M2L A;  5C6A A;  3I8Z A;  5CV9 A;  1HNX L;  2WIN B;  5HGQ A;  3I3C A;  4IUR A;  4WFN 3;  2EE1 A;  3F8T A;  5H1S E;  3TZD A;  4X66 L;  5C3X A;  1W6K A;  2FMC A;  2JYO A;  1K8A C;  1EQV A;  3WDN A;  2F3V A;  4O0A A;  1GUT A;  5ELD A;  1JOO A;  5JEA J;  1CSQ A;  1TY0 A;  4YY3 Q;  4NMZ A;  2D62 A;  3J80 i;  2B2U C;  3C1E A;  4C3J B;  5J1Z A;  4DR5 Q;  2A19 A;  2WB1 G;  1YJ9 A;  1CZG A;  2K5V A;  1CTM A;  4QGU A;  3SHL A;  1I4P A;  1SMY D;  3S1M H;  2CFM A;  2MFI A;  3EN2 A;  1ASY A;  5E7N A;  1L2F A;  1SSO A;  1JJG A;  2L15 A;  2QGQ A;  4DXF A;  3RD4 A;  1TS5 A;  3G4S A;  2KCN A;  1JWM D;  3KF6 A;  1AN8 A;  3CPW A;  2H1E A;  2F0E A;  4YCU A;  4HJ7 A;  5I9O A;  1KLU D;  2PW7 A;  1RCV D;  5C3E H;  2UUC L;  4XTC S;  4NP5 A;  1TII D;  2HT1 A;  3VR5 A;  1OXT A;  2HCI A;  3J81 i;  4C1N I;  5IP7 G;  4IUN A;  1KDB A;  3KDF A;  2C5C A;  1LTT D;  4HJ5 A;  3HG9 A;  4F88 A;  2QCP X;  4JG2 A;  2BDN A;  4A3I H;  1PFB A;  3W1B A;  3QO2 A;  2PNH A;  1I3Q B;  2IY5 B;  1WFQ A;  2EDG A;  1FYC A;  1WTX A;  1SNP A;  2MNA A;  2RBM A;  5G3L F;  1TWC B;  2EJM A;  2IJ0 A;  3MEF A;  3Q22 A;  1ONL A;  4DFA A;  3E0E A;  4WJ4 A;  4RCO A;  4FF2 A;  1XNQ Q;  1K9M C;  3H0G H;  4A3D H;  3K5O A;  2E2D C;  2QA4 A;  4K0K Q;  2N8N A;  3OPO A;  1RTN A;  1KAW A;  1J8I A;  3I2Z A;  4CJ0 B;  2B2T C;  4C3H G;  5AFW A;  5FLX c;  1NNX A;  4HSP A;  1N36 L;  4C3H H;  3GTQ B;  3IL8 A;  4PZ6 A;  4LWC A;  2OTJ A;  4HJA A;  1IBK L;  3ULL A;  2PPB C;  5GAE C;  5I2X A;  4NKL A;  1BXT A;  3OMG A;  1C48 A;  1CQF A;  3DWP A;  4JI5 L;  5L37 A;  5M3F B;  2R3Z A;  4A3F B;  4C1N K;  4JI6 L;  1AEX A;  1XTC D;  5T1I A;  4DUY Q;  1N34 Q;  2F0I A;  2LY7 A;  4HR7 B;  1P8L A;  3DM1 A;  5DLQ E;  1BCP B;  3E9H A;  1UWV A;  3M9B A;  1SFO B;  4TVA B;  3GV3 A;  1EY0 A;  4JI1 L;  5K36 H;  3I4N G;  3NSW A;  3S1Q H;  5K36 G;  1GO3 E;  1K73 C;  3W3A A;  3ND8 A;  4X6A H;  3FP9 A;  4JI2 Q;  3K5N A;  3L2P A;  5IT9 E;  3S16 H;  3MXN A;  1WVL A;  4GKK L;  5C0X H;  3VYT A;  1M90 C;  4X65 L;  2PYK A;  1QUQ A;  4Z9C B;  1YIT A;  3DEO A;  1SBB B;  5E4W C;  1Q3L A;  2H5X A;  1M4V A;  3GTK H;  5FO7 B;  1Q86 C;  1MHW C;  3J81 E;  5CV7 A;  4J15 A;  1PRT D;  3VDY A;  4BY1 B;  3DEP A;  2PQA B;  1V9P A;  2OF1 A;  2KBN A;  5KIX A;  1X3E A;  2HD3 A;  4L6T B;  5JOB A;  3A55 A;  4HAE A;  4R8N A;  3CQZ H;  3CC4 A;  4QL5 A;  1STY A;  3KLS A;  3KFU A;  4H7B A;  3CP0 A;  2RKS A;  3HOX G;  5CR3 A;  4PNY A;  3IRB A;  3AFP A;  1A3V A;  1E1O A;  4OGQ C;  2Q8T A;  3MXG A;  3IKJ A;  1UUP A;  4R4C A;  3ND9 A;  5J22 A;  4B3S L;  2B2U A;  1G2S A;  2UUB L;  4BA2 I;  1D1I A;  4C3I B;  4WJW A;  3CC2 A;  4A3G G;  1HRJ A;  5JJZ A;  4A3G H;  2A6H C;  1CM9 A;  4ODG A;  3KJP A;  4MTN A;  4ALP A;  1KHI A;  1K83 B;  3NWS A;  4MHE A;  1LTI D;  2A68 C;  3UDG A;  3S1Q B;  1NMF A;  3E0J A;  4GLA C;  2PMZ B;  4K6D A;  1XTD A;  1EU3 A;  2I07 B;  3CRL C;  4A3D G;  2E2H H;  4X3T A;  2VQF L;  4P2C B;  5CBE E;  1VQP A;  1MI2 A;  3WOE A;  2RHS B;  3FRP B;  2KQ3 A;  2O4X A;  1FJG Q;  4OL7 A;  4YIJ A;  1Q81 C;  4R1J A;  1H9M A;  3EJI A;  4K14 A;  3E6Z X;  4A3K G;  3GTK B;  2EY1 A;  2JEA I;  4A3K H;  2A73 B;  3NTH A;  4YY3 L;  1QVG A;  4HSV A;  1H9S A;  4DR5 L;  2IHF A;  1XMO Q;  2CKZ B;  5I4D A;  4RHR A;  3A7A B;  4BWG B;  4JI0 Q;  3T16 A;  3CKI B;  4FF1 A;  4OXP A;  1I94 L;  5FK9 C;  4IAL A;  3GV6 A;  4RHS A;  1B4O A;  4XQQ A;  5EQ0 A;  3I55 A;  3TP8 A;  1EY6 A;  1ET6 A;  1SRO A;  5C0X I;  2A74 C;  5C0X J;  1S5E D;  1GKH A;  1SYD A;  3GO5 A;  1QE6 A;  4DV1 L;  4GN3 B;  4KKS A;  2WII B;  1FR3 A;  2LKV A;  5E4X A;  5I6Y A;  5IY0 A;  4HJ9 A;  5D3D A;  4A3B G;  1EUJ A;  2I5M X;  2KOL A;  4KHP L;  3CXC A;  1HR0 Q;  1Q82 C;  4L5R C;  2NVT B;  2EYP A;  2E5L L;  1UNS A;  2BCO A;  3G6J B;  4GOP A;  1TS2 A;  2WFW A;  1FGU A;  1X32 A;  1C4Q A;  5AJ3 Q;  3K80 C;  3D4W A;  2XRQ D;  1Q46 A;  4JOI C;  4DR6 L;  4GNX B;  1TKW B;  2KHS A;  3PSI A;  4B9W A;  1YVC A;  1NSN S;  1HZ9 A;  1G8Z D;  3C1F A;  1X3G A;  3A56 A;  4KY5 A;  1C8C A;  4NXM Q;  2F0U A;  2F1M A;  1BVS A;  1SR3 A;  2F0H A;  1O7Y A;  4NXN L;  1DXM A;  1R4Q B;  3M4Q A;  1S5D D;  3NUC A;  4K0K L;  4RAU C;  3HOU G;  3K7U C;  1LV9 A;  4Y52 H;  4A3B B;  2ICE C;  4R9W A;  4AH6 A;  1K28 A;  2JK8 A;  5BR8 Q;  1CFM A;  3BVM A;  1VF7 A;  5ELN A;  3HOV G;  1HJP A;  1Y1W B;  2F0L A;  5EKI A;  3KJO A;  1B8A A;  1IW7 C;  1B50 A;  2UU9 Q;  4XYQ A;  3R3O A;  4CDE C;  3HOY B;  1E0B A;  1VQ5 A;  1HNW L;  3D4R A;  2FFK B;  4ZQ3 A;  1FGB D;  2WP8 J;  3RN5 A;  1GM5 A;  2I0Q A;  3HOV B;  3S2D B;  1D2B A;  4A3J G;  3NBH B;  4P73 A;  3X3M A;  2F0F A;  4PMB A;  2JA6 H;  4QCL A;  3VYU A;  1EQQ A;  2CWP A;  1BBW A;  1DOL A;  2X6G A;  3HRZ C;  4RWS C;  5M9O A;  1Y1V G;  1Q7Y C;  2N78 A;  1CA5 A;  1ZKO A;  5BN3 A;  1LTL A;  3DLL A;  3FDT A;  4R8I A;  4HIK A;  1KRS A;  1YJN A;  3PUV A;  5IGD A;  2HHH Q;  3PF4 A;  1B3A A;  4BBS G;  2DJG C;  3T1H Q;  1DYQ A;  4DAP A;  4K6L A;  5D3I B;  1ROD A;  4I7A A;  4XQJ A;  2Y0S G;  4CKC A;  1DOM A;  1JE5 A;  2HDM A;  4HJ8 A;  1S72 A;  1N36 Q;  2ZJP A;  1WTH A;  2E74 C;  3K81 C;  3I56 A;  1YZ6 A;  4GNX C;  4DR3 L;  3RLO A;  3HOU B;  4L5S A;  2LS0 1;  3I4N B;  1I4R A;  2OQK A;  2QKI C;  1Q12 A;  4A3B H;  1TWF H;  2B8G A;  2IX1 A;  1LTA D;  3HOZ B;  3OIP A;  4DUY L;  1RJT A;  3SGI A;  3MZ5 A;  3NTI A;  2X6L A;  2CVR A;  3TQY A;  4DR2 L;  4FF3 A;  5IGC A;  1XX8 A;  2B39 A;  3NE5 B;  5J39 A;  4DNT B;  3S1R B;  4KLK A;  4CDF C;  2ZXO A;  1JJ2 A;  2E76 C;  2D5D A;  1F9P A;  3O13 A;  3S17 B;  4YWK A;  4JCV E;  5C5M A;  1E2Z A;  3M85 A;  4KJO A;  4A3C H;  1S4Z A;  3IFD A;  2EOT A;  5DEH A;  4DV0 Q;  4MIU A;  3S15 H;  1QCB D;  3ER0 A;  3CCQ A;  1OTC A;  1BO0 A;  1LO5 D;  1FVI A;  1XJV A;  3MWY W;  2FJ2 A;  1KXL A;  2PW5 A;  1PH8 A;  3HOW H;  4GKK Q;  4UP9 A;  4HCS A;  2XWJ B;  2UXB L;  1IKL A;  2RSN A;  2K32 A;  2K7V A;  1EY7 A;  4RGM A;  2RQX A;  5KNC A;  3KUP A;  1I4Q A;  4DV6 Q;  1XMQ Q;  4KHZ A;  1G2T A;  3RZO B;  1C0A A;  3H6M A;  1MSG A;  1PXU A;  2JA8 G;  5M5Y B;  1FJG L;  1A3U A;  1S5F D;  2IX0 A;  1BCP C;  1PTO H;  3L0O A;  1QWY A;  4L5T A;  4JBM A;  1VQH A;  1VQC A;  5C3E G;  4F7X A;  2E2H B;  4ZUJ A;  1ET9 A;  1F9S A;  4U68 A;  2D0O A;  3Q6S A;  1QUQ B;  3TME A;  1A62 A;  3NQI A;  4LW1 A;  1CT1 D;  2Z8L A;  3VR2 A;  1AE3 A;  5CV4 A;  4HMJ A;  3MFG A;  1K3R A;  3CCS A;  2RCN A;  4NW2 A;  2B2V A;  4JBW A;  4IPD A;  2WAQ E;  3KK7 A;  3M4O H;  3L7Z C;  5JVG 3;  2BE5 D;  2HQE A;  2HIV A;  3PCO B;  1G6P A;  2VUM H;  3LX0 A;  4JI7 L;  5LL6 X;  1N32 L;  2X69 A;  1GHK A;  5HUR A;  5D14 A;  4JC0 A;  1A2U A;  3SE0 A;  3SEB A;  1F9Q A;  2RSO A;  3TP5 A;  2F0W A;  5COR A;  5ELB A;  4OIK A;  4DAY B;  2Q2H A;  4EQN A;  3T1Y Q;  1SLJ A;  1JT8 A;  3GTJ H;  2N88 A;  1DON A;  4KV6 A;  3PO2 G;  2K1B A;  1N9W A;  4IPH A;  1LT6 D;  4S3S A;  1CKN A;  4DK1 A;  1LTS D;  5A2Q L;  4A75 A;  1VQ8 A;  2UXD Q;  1SYG A;  5I6W A;  2R93 H;  1WCM G;  4K5W A;  4HID A;  2K33 A;  4I7Z C;  5EJW A;  2PO4 A;  2A68 D;  4KTA A;  5GRO A;  1M8A A;  4DPG A;  4RGN A;  2JSO A;  3A8K E;  4MN3 A;  4DR6 Q;  3N52 A;  1EY5 A;  2DY8 A;  1JIC A;  1TWA H;  1CKO A;  2Y0S B;  4IUV A;  1XMO L;  2DY7 A;  1TVX A;  2Z4H A;  1TQO A;  4JW0 A;  4Y7N H;  4N9P A;  3HKS A;  1GD7 A;  1CHQ D;  4JV5 Q;  2RDF A;  1A63 A;  3S1M B;  1FNU A;  1PTO D;  3RN2 A;  2LXJ A;  2JEB I;  2VZA A;  1Y1V B;  1WTP A;  4C2M B;  4LAA A;  2QEX A;  2E75 C;  3EIV A;  1V1Q A;  2F4V Q;  1HR0 W;  1R9T H;  4LF5 L;  1E3P A;  2ID0 A;  1CA6 A;  1HZC A;  5BR8 L;  1KDC A;  1D5M C;  3CPF A;  1VQN A;  2VW9 A;  1JC7 A;  4A93 G;  4A93 H;  1H9R A;  2J0T D;  3JAM c;  2ALY B;  2WAC A;  2BE5 C;  2EPB A;  4A3M H;  1T5X D;  1YNJ C;  4LFC Q;  1F2Z A;  3TEH B;  1OXS C;  4QB4 A;  1UEA B;  4CJ1 B;  2R7Z H;  2SOB A;  5LMN W;  3F2D A;  3VR3 A;  4BY7 G;  5FO9 B;  5AJ3 L;  1EIY B;  2QDL A;  4UP7 A;  1SMY C;  4ME3 A;  2UUA Q;  2KEC A;  4DGZ A;  2ZM6 Q;  5FJ8 G;  1W6J A;  4P75 A;  1I5F A;  5LMU Q;  2NZ1 D;  1F9R A;  4H0L C;  1GJX A;  1NTG A;  3HKZ E;  2N55 A;  4NXM L;  5DAU A;  2AUJ D;  4IUQ A;  1NAP A;  5LMN Q;  3GTO H;  1OXU A;  1ENA A;  4HTH A;  2B63 G;  1N33 Q;  5LHY 1;  1MGS A;  2JA8 H;  5JJK A;  3OIQ A;  3NXW A;  3CCR A;  3QJY A;  3W1G A;  1IL2 A;  1SDF A;  3FKI H;  3NHH A;  2Z9H A;  1PZI D;  5GAG C;  2F0M A;  4DV4 L;  2JA7 H;  3BYY B;  4H02 A;  4A3G B;  3GQB A;  1X6O A;  2F03 A;  4OX9 Q;  3RLF A;  3I73 A;  2AUK A;  1STG A;  5TSS A;  3EA6 A;  2A6H D;  5FLM H;  1AZP A;  1WTO A;  4KD4 A;  1KL9 A;  4RGT A;  1GVP A;  1S5C D;  2VNU D;  2LXK A;  3H0G G;  2AWO A;  3BZC A;  4IZ8 A;  2NVY H;  4YWL A;  4A3L G;  2SEB D;  1QB5 D;  3CC7 A;  1IHZ A;  1YI2 A;  5EBC A;  4GKJ L;  3KOJ A;  1IBM Q;  5I2Y A;  4DV3 Q;  2Z4I A;  3A0J A;  3NEN A;  3A8J E;  4PMW A;  2L1B A;  3PIP A;  1EY4 A;  3PO2 H;  3K7A H;  4XYO A;  2NZO A;  5FLX L;  2HHH L;  1RDP D;  1YHB A;  3T1H L;  1PH7 A;  1PTO F;  4RGO S;  3E5S A;  2NZH A;  4OHJ A;  3LGJ A;  2NN6 G;  3F2U A;  3NQT A;  3OWE B;  4QJF A;  4AIM A;  3J7A 5;  1TY2 A;  2AMC B;  4PMC A;  1SYE A;  2AQ1 B;  4LUV A;  2ZTC A;  1D7Q A;  1D5X C;  4QQB X;  1BUV T;  2G9H D;  4KD3 A;  3MC0 B;  3AEV A;  2VL6 A;  4BA1 I;  1IYU A;  1XMQ L;  4K5V A;  2BDO A;  1SNQ A;  3GTG H;  3SK6 A;  5LL6 S;  4DR4 Q;  1CK1 A;  1UE7 A;  2PQE A;  1LYL A;  2D0P A;  3S9W A;  4DK3 C;  1I6H B;  1GUG A;  2B2W A;  2KCT A;  3KBG A;  4DR7 Q;  1SJE D;  2F0J A;  3G71 A;  1LLR D;  3S1N H;  2QF7 A;  5ELF A;  1BQQ T;  1VF5 C;  2FIN B;  4J6H A;  2PMZ E;  4DV0 L;  1EQR A;  3H3V H;  1I50 B;  4UY8 C;  1YHQ A;  2XRS D;  4BY7 H;  4BY1 G;  4JI7 Q;  3I90 A;  1HQM C;  3TS2 A;  2OQ0 A;  4JBK A;  5C3E B;  4LFB Q;  4IUP A;  3MVV A;  1ESF A;  5BN4 A;  4R4O A;  4RMF A;  3K5M A;  2NVQ H;  4LF7 Q;  3KF8 B;  2V1C C;  1Z9F A;  1EEI D;  3BG3 A;  4DR1 L;  3NBH A;  1JB7 A;  3HOX H;  4A3J B;  1U0L A;  1YHA A;  4A76 A;  1H9K A;  1Z6H A;  1BKB A;  2I46 A;  2XGT A;  2K5D A;  3FVQ A;  1XPO A;  2UXC Q;  1HNX Q;  3U4V A;  3HOY G;  2VS1 A;  2XVS A;  5F2D A;  2PZT A;  5CBA E;  1I3Q H;  1JJC B;  1VQ4 A;  3QG1 A;  1KLG D;  1QZH A;  1UE5 A;  1YJW A;  4DF7 A;  3HOV H;  1X65 A;  4ZKC B;  1EYD A;  5C4X H;  3E9I A;  1I6H H;  3LWU A;  1A3T A;  2KEN A;  5JJI A;  1I4X A;  1N32 Q;  3SDZ A;  4Y7N B;  2CQA A;  4LFA L;  4KN7 C;  1I94 Q;  4IQZ A;  3F2C A;  3PIP 3;  1AE2 A;  4BBR G;  1AFP A;  1F2L A;  4DUZ L;  1S3O A;  3GD7 A;  3PV0 A;  4X62 L;  1Z7T A;  1STE A;  2NBF A;  4C3H B;  2XIW A;  3ICE A;  4IN3 A;  1G6Z A;  4XT1 B;  1JCK B;  1BBU A;  2F52 A;  1K0S A;  4G7H C;  4RKL A;  1PFM A;  2DJF C;  2UXD L;  5BN5 A;  3MEH A;  4A3F H;  5CV5 A;  4JPB W;  3CCV A;  4KHP Q;  2L0C A;  4H13 C;  3RLN A;  5JJL A;  2K75 A;  5IOD A;  5CGK A;  3I4M H;  2UUA L;  4MZ9 A;  2R7Z B;  1RF2 D;  4A3K B;  4DU9 A;  1ENC A;  3T56 B;  1JOR A;  1O78 A;  4J1M A;  1TS3 A;  1JQY D;  2A69 C;  1SFO H;  1QZG A;  4FF4 A;  1BF4 A;  2MQH A;  1PZJ D;  2ZJQ A;  2Q8I B;  4X64 Q;  4JI8 L;  1CKN B;  3CU7 A;  3V2T A;  3TN2 A;  2EXD A;  3BDC A;  1F77 A;  1Q1B A;  2CH4 W;  2F4I A;  3N6R A;  3EFX D;  2E2J H;  2DNC A;  5EGT A;  4IPG A;  3K8A A;  1BR9 A;  5KNB A;  1B9N A;  1L0X B;  1J5E L;  5CV8 A;  1HNZ L;  1U5K A;  4ZCK A;  4JK1 C;  1ICF B;  4DV4 Q;  1GXD C;  2JA8 B;  4OEM B;  1VDZ A;  2EYH A;  1NMG A;  3H0G B;  4NB3 A;  4KHV A;  3KYH C;  1A15 A;  2M00 A;  2O2L D;  1SNO A;  2CCZ A;  2K4K A;  2IPK D;  1HHV A;  4EX5 A;  1Y1W G;  1ZXT A;  4LF6 L;  3J80 c;  2QEJ C;  1VCI A;  5IP7 H;  5GAD C;  2E8G A;  3R2I A;  2R7F A;  4IO9 A;  1Y8O B;  1PYW D;  3W5O A;  3HOY H;  2L9H A;  1FNW A;  2UU9 L;  1P16 A;  2ENB A;  1MSH A;  4KKU A;  2ATW A;  4OO1 G;  5G3L D;  2WB1 B;  4ZKB B;  1A6X A;  1ML0 D;  1DGS A;  1IBM L;  2K04 A;  3S2H H;  1LTG D;  1V1P B;  3HZX A;  1FNV A;  1KIX A;  2JE6 I;  2OTL A;  2QW7 A;  2EXZ A;  3U58 A;  1Q1E A;  2IX3 A;  1SE3 A;  1VQE A;  1G51 A;  3OYY A;  1N33 L;  4ZRZ A;  3TS0 A;  2BA1 A;  1SE4 A;  1RHP A;  1DM0 B;  3I4L A;  2KHI A;  2N3S A;  1KD1 C;  2QIL A;  1U4P A;  5IP9 G;  1B9M A;  2ICI A;  1D6E C;  4OON A;  1EZ6 A;  4DK6 C;  1B2T A;  4IFD I;  2E2I H;  1GUS A;  4B08 A;  5J3B A;  1PH9 A;  2E2J B;  3BS1 A;  1YEZ A;  1G29 1;  4QUC A;  4X3K A;  1HUM A;  5IOC A;  4ID6 A;  5ELE A;  2ZXR A;  3MHB A;  1BBX C;  1TR5 A;  2Q2U A;  4CJ2 C;  1NJI C;  4A3I B;  1EZ8 A;  4ZK9 B;  4RKB A;  1VMC A;  4DV7 Q;  3ZJY C;  1XPR A;  2KEE A;  1PTO C;  1ESR A;  2Q2I A;  4DR3 Q;  3HKZ B;  3MTS A;  5FLX E;  4OIJ A;  1R4P B;  1L1O C;  2HDL A;  3RUZ A;  1I4H A;  1BOS A;  4K5X A;  4LMQ D;  1CUK A;  1HFN A;  3H3V I;  4FDB A;  1VQL A;  3NP8 A;  3KLW A;  3S1N B;  3JAM L;  3PO3 H;  3BDO A;  4XXE A;  2B29 A;  4FXK C;  2K5W A;  5DNF A;  3OWF A;  5C5L A;  3KLS X;  1SN8 A;  3DWA A;  3U9O A;  4C3I G;  1AZQ A;  4C2M H;  1YBY A;  4C3I H;  3D8G A;  3SK8 A;  1WTQ A;  2EYL A;  1R9T B;  3VYR A;  2A1A A;  4TSS A;  1H95 A;  5C0X G;  3M3Y B;  2K03 A;  1Q8I A;  2OWO A;  1JB3 A;  4IUU A;  1TT2 A;  2YTY A;  4A3C G;  2EY6 A;  5NUC A;  1HFG A;  1HZB A;  5IGB A;  4IFD H;  1STN A;  3BZD B;  1MKH A;  5IT9 c;  4IFD G;  4NPS A;  2ASB A;  2JJQ A;  3L3O C;  4GN5 A;  1N8R C;  4DV2 Q;  2I5L X;  3V05 A;  3CME A;  4RG1 A;  4WOR A;  3R93 A;  3TSS A;  5DM6 3;  3J81 c;  4A3E G;  1HA5 A;  4ZYS A;  2SDF A;  1GUO A;  3RMH A;  4LUO A;  4JI0 L;  5EPJ A;  5JAV A;  1SND A;  2WV6 D;  3PIO 3;  1CZW A;  1DJR D;  2R7Z G;  3M4O B;  1XWE A;  4IOC A;  3I91 A;  1XNR L;  2PNR C;  2PCF B;  4V0B A;  3CW2 C;  2KUM A;  2B2T A;  3EQL C;  3H3V C;  4OO1 H;  3A74 A;  4DV1 Q;  2WAQ B;  1BCP F;  1VS0 A;  2R7D A;  4LF8 Q;  4B3T L;  2JA7 B;  1K8G A;  4CGY B;  1C9O A;  3SR1 A;  1O80 A;  2F0Q A;  4I65 A;  1SJH D;  2BH2 A;  3V96 A;  4DAV A;  3HOZ G;  1V43 A;  1X3P A;  3T53 B;  2Z6K C;  4DNR B;  4EQ5 A;  2VXW A;  4CKE A;  1HZA A;  2VQE L;  4A3I G;  3URY A;  5IYD H;  3UE1 A;  2K28 A;  2Z0S A;  2JA7 G;  4L63 B;  1RTO A;  5IWA L;  1VQF A;  2NWG A;  4FVM A;  1J6Q A;  5C44 B;  1LT3 D;  3M4P A;  1PV4 A;  1Y8N B;  5IYC H;  3M7G A;  4PZ7 A;  4X64 L;  4PQX A;  4KY6 A;  3PO2 B;  2G9D A;  3F1Z A;  4NXN Q;  1EU4 A;  2EIF A;  4LFA Q;  2HIX A;  3WWV A;  2VUM B;  3BZK A;  1YNN C;  4R4I A;  2OEO A;  3OTO Q;  3QB3 A;  1X3F A;  4MNO A;  3SK4 A;  3VA5 A;  1T9H A;  4BBR B;  4IOA A;  1RL2 A;  3PUW A;  4TQU S;  3H09 A;  2B2V C;  3E3X A;  2YU9 B;  2UUC Q;  2MO1 A;  2EZV A;  1ENF A;  3RZD B;  1AH9 A;  4ZUI A;  2F4V L;  1AW7 A;  1PVO A;  2ZXP A;  3NEM A;  4P72 A;  2R6G A;  4HMI A;  1PH1 A;  5C4J B;  2CQO A;  4JI3 L;  1WCM B;  1B53 A;  2FHT A;  2OT2 A;  1Y8P B;  3I70 A;  2L12 A;  1HNW Q;  2QDB A;  4KY7 A;  3ONA B;  1KNE A;  1WD1 A;  3TRZ A;  4RA8 A;  2PQA A;  4LNQ A;  1X54 A;  2XN9 C;  5M5X H;  2M9V A;  3AYH B;  2XSC A;  4DK0 A;  2JA5 H;  1UE1 A;  2EQS A;  4K8I A;  1EWI A;  2AQ3 B;  1T5E A;  2B63 B;  1XNQ L;  1H9J A;  3BYT B;  2CHB D;  5K5P A;  1PFS A;  2A69 D;  1TWG H;  3FKI B;  1IBL Q;  3CCU A;  4BY7 B;  4GZY C;  2FXQ A;  3TBI B;  4A3E H;  4GS3 A;  3CCM A;  4LF9 L;  4G57 A;  3NTK A;  2JN4 A;  1ZEQ X;  5EPL A;  5JEA G;  5FJ8 H;  2Z1C A;  4DNI A;  3J81 j;  3TP6 A;  4PV1 C;  2NVQ B;  5COY A;  1WTV A;  3HP3 A;  3UDF A;  3P75 A;  2NYZ D;  5M5Y H;  1L1O A;  3T4A C;  4K2K A;  4XIG S;  5EKL A;  1XPU A;  4V19 0;  5M5W B;  3DXJ C;  2J4X A;  1VQI A;  2XTI A;  4GNX A;  4MTK A;  2VUM G;  4CDC C;  2V4D A;  4F87 A;  3NBI A;  2JA9 A;  1UEB A;  4TKO B;  1JMC A;  3UDI A;  2O5J C;  4XT3 B;  5T1G A;  4JI6 Q;  2F0T A;  3CF5 A;  1ZYR C;  3QOJ A;  1A0I A;  2KJX A;  1WD0 A;  3HOZ H;  1EL0 A;  5FLM G;  3ERO A;  4APV A;  2EYM A;  5IYC G;  3H15 A;  2IT1 A;  4LF4 L;  3S14 B;  4BS9 A;  1JWS D;  4TRD A;  3QWN A;  3K5L A;  4JBJ A;  3S17 H;  4FP5 D;  4L5Q A;  1TS4 A;  4KK7 A;  2XWB B;  4BBS H;  2TSS A;  1G91 A;  4JI2 L;  2B8F A;  1SYB A;  4PG3 A;  3PO3 B;  1ZYR D;  2NUC A;  1E24 A;  1VQA A;  1LUZ A;  3HEJ A;  1HTP A;  4KI0 A;  4DV6 L;  4X65 Q;  2R92 G;  2L55 A;  5CYU A;  3RR5 A;  4ME5 A;  2R92 H;  4A3E B;  3GDE A;  2RCF A;  1EWC A;  2K14 A;  1Y14 B;  3J7Z C;  4DN4 M;  3D6C A;  1AP0 A;  1VQB A;  1GOZ A;  2GA4 B;  2C9O A;  1LT5 D;  5ELO A;  3T13 A;  5KRU A;  2GVB A;  1WYD A;  1SE2 A;  4GOP B;  2Z6K A;  2TMP A;  4HIO A;  2K52 A;  3RZO H;  4LK1 C;  2F0K A;  1Z47 A;  4E6I A;  1QVC A;  3PMF A;  1GUW A;  1PTO B;  4HED A;  2JQO A;  3G7L A;  4IFD J;  2ZJR A;  3OHX C;  4N9T A;  3P7J A;  2KHJ A;  3KF6 B;  3GTL H;  2F0G A;  1YNN D;  1XNR Q;  3I4M G;  4FNF A;  1SXT A;  3G48 A;  1QJO A;  3U9S A;  1PRT C;  4FYD A;  3RNU A;  1QVF A;  4EQP A;  4LF8 L;  1X3Q A;  3T1Y L;  4G4K A;  2EYO A;  1ILP A;  4ILW A;  4A93 B;  4UDU C;  5A35 A;  1UAP A;  3PGZ A;  2J7Z A;  3P1H A;  3GP7 A;  3NK9 A;  4CHT B;  3QR8 A;  1EWH A;  1RD9 D;  4JI4 Q;  1VQ6 A;  2MJ8 A;  4EGV A;  1QNK A;  2L4N A;  3DUZ A;  1HH2 P;  1B1Z A;  1D1K A;  4BY1 H;  2UXC L;  4QF4 A;  1DOK A;  3R8B A;  2L5T A;  5IWA Q;  4JYA Q;  5C3W A;  1QOH A;  4K8J A;  1TWH B;  4YHH Q;  5CC4 A;  2BOS A;  4C3J G;  3AMU A;  4C3J H;  1UE6 A;  1OXV A;  2ZTE A;  2NVX B;  5DM7 3;  2LFN A;  4JV5 L;  1KC8 C;  4AYB G;  3BVZ A;  1B3Q A;  4DA2 A;  1SRU A;  4A4I A;  2LMC B;  5EBD A;  2FMM A;  1I50 H;  3PUY A;  4AYB E;  1HQR D;  3Q8D A;  1HA6 A;  1F2Y A;  1STH A;  4O42 A;  3J81 L;  2K50 A;  3HOW B;  2VY3 A;  1VQM A;  5CMD A;  1JWU D;  1LTR D;  3MFY A;  3D3R A;  3BVG A;  3NWT A;  4LF5 Q;  1O7L A;  2DN8 A;  1KTK A;  4DUZ Q;  3GTL B;  4X62 Q;  3GTQ H;  1B70 B;  1EEF D;  4LFC L;  1EYC A;  1PH3 A;  3KF8 A;  1IYJ B;  4QUF A;  5IE8 A;  4POG A;  3FPU B;  2NVY B;  4OWX B;  1QNU A;  4KN4 C;  1V1O A;  3Q24 A;  1X56 A;  1EFI D;  4KMU C;  1K0R A;  1HR0 L;  4ZAI A;  4M1U B;  5C4J H;  2F0D A;  4ULL A;  1U4L A;  2ZM6 L;  3I4M B;  4Q0F A;  4XDX A;  3GTP B;  5FO8 B;  1CHP D;  2EY2 A;  2B3G A;  1NUC A;  5LMN L;  1JE4 A;  4BXX G;  1EYG A;  3KBX A;  1YIJ A;  1IW7 D;  1OO9 B;  3DHQ A;  1WTR A;  2PZW A;  1MD2 D;  1QG7 A;  1WJJ A;  3ERS X;  1QIL A;  4A3F G;  4NDX A;  1X55 A;  1IBL L;  3C2P A;  4OX9 L;  3GTO B;  1J5E Q;  4L8J A;  3IAY A;  3S15 B;  5IYB G;  1PMR A;  2SNS A;  3K0Y A;  1C7Y A;  3PIO A;  1FL0 A;  2WB1 E;  2BA0 A;  4UP8 A;  1EOT A;  2WKC A;  4GOP C;  1HUN A;  3S2D H;  1IBK Q;  1PYS B;  4A3M G;  4JI5 Q;  4LF6 Q;  1MJE A;  5E3F A;  1VQJ A;  1SE8 A;  1N34 L;  3U50 C;  4CBV A;  1STA A;  4O2D A;  4GKJ Q;  1CQV A;  3GTM B;  3B6Y A;  3JAM E;  3LWE A;  3VA7 A;  4F8M A;  1DZ1 A;  2K01 A;  3C3L A;  4J8Q A;  1NR2 A;  4R4T A;  2AWN A;  1EYA A;  1S5B D;  3GTP H;  4QY7 A;  1VQ9 A;  2NTS A;  1I4G A;  1E1T A;  1LAC A;  4YCW A;  4B3R Q;  1MBY A;  2AHO B;  3HS0 C;  3D0F A;  4LJZ C;  3AB9 A;  3K7A B;  1EQT A;  3H91 A;  2A8V A;  2VB2 X;  4IUT A;  3HOU H;  5C4H A;  1K83 H;  1D8L A;  3BDL A;  2RF4 A;  3S16 B;  2CH4 A;  2MP1 A;  3OOC A;  4QMG A;  2YTX A;  2PI2 E;  3DMU A;  2YTV A;  4DAY A;  4QIW B;  1LTB D;  1SYC A;  3ULJ A;  1K8M A;  4EVO A;  2EYJ A;  4DR4 L;  3NEL A;  2A5H A;  3CD6 A;  1U9R A;  4A3L H;  3STB D;  3SXH A;  1PLF A;  5M3M H;  2PI2 A;  2C35 B;  1DD2 A;  4FO2 A;  1TWC H;  1VQD A;  2KA7 A;  4DR7 L;  4DR2 Q;  3J7Y W;  1KRT A;  5C44 H;  4JVZ A;  5C4X G;  5C44 G;  1EY8 A;  3KDF B;  3DWQ A;  1V1P A;  5C4Z A;  2IW3 A;  3GTM H;  2UUB Q;  3JC6 6;  5IYD G;  2G5D A;  3S24 A;  4ZLT F;  2MHV A;  1HPC A;  5ELC A;  1U4M A;  4AQY L;  1W2B A;  4U67 3;  4G7Z C;  1KAA A;  1SYF A;  4LF7 L;  3I7F A;  2EY5 A;  1Y1V H;  2AKW B;  5IYB H;  2DNE A;  3CHB D;  3U4Z A;  3PQI A;  1TXY A;  2UXB Q;  3A5U A;  4B3M Q;  1BDO A;  2VQF Q;  4N8X 1;  3UE0 A;  3UDX A;  3QOL A;  1GHJ A;  1VMP A;  4FXG C;  4RCN A;  2RA4 A;  4XQN A;  4GN4 B;  3CRK C;  4G7O C;  5JVH 3;  2NVT H;  3I4N H;  1WCM H;  4A3M B;  5EAY A;  2YYZ A;  4JYA L;  2NTT A;  4X66 Q;  3IFT A;  1PH5 A;  4LUZ A;  4DXG A;  3Q23 A;  4DV2 L;  4IJL A;  2RVL A;  5IT9 L;  1ICW A;  1TWH H;  4DV5 Q;  2OXP A;  1H9S B;  2D2C C;  1SNM A;  5M3M B;  3MXU A;  3G6E A;  3LNN A;  3OSO A;  2F0S A;  2H4O A;  2K5Q A;  3OW2 A;  1K3B C;  2D9U A;  2B2Y C;  2EJF C;  1MIU A;  2SNM A;  5FKA C;  2AQ2 B;  1DCZ A;  2B2Y A;  2CW0 C;  1WI5 A;  2I5H A;  2LSS A;  5EKK A;  3CCJ A;  1VQ7 A;  4P74 A;  4B9X A;  1TU2 B;  4YCV A;  1NCV A;  1KNA A;  3DM3 A;  1VQG A;  4B3T Q;  2F0O A;  1Y1W H;  3H94 A;  2IWH A;  4K2L A;  4DAM A;  2EYF A;  4JI4 L;  4WJ3 M;  2E5L Q;  1IYV A;  1Q90 A;  1VQO A;  3X3N A;  4FXD A;  3FPP A;  5IIF A;  5GAH C;  4CKB A;  1TWA B;  2P5Z X;  2GVA A;  4IJH A;  3HGB A;  3CQZ B;  1V8Q A;  1EY9 A;  4YHH L;  5M5W H;  1SAP A;  1Y69 U;  2F0V A;  1Q8K A;  1FD7 D;  2EJG C;  2R61 A;  5E1F A;  1XYI A;  5M3M G;  1BNZ A;  1II3 A;  2MO0 A;  3K6O A;  4KKT A;  2CWA A;  4OWW B;  4JI8 Q;  2JA6 B;  3K57 A;  3D4D A;  1WTW A;  2F0N A;  5IGG A;  3I72 A;  2A6E C;  5JPM C;  1E2W A;  1EIF A;  3C46 A;  3JAM i;  2CW0 D;  2NB0 A;  4POF A;  1S40 A;  2L11 A;  3AFQ A;  3FEW X;  5IP9 H;  4OO1 I;  3FKI G;  1U4R A;  2WAQ G;  4YWM A;  4CDD C;  1HNZ Q;  4RH6 A;  1O7I A;  4RFB A;  3TRE A;  2Z6B A;  3VYS A;  3QIA A;  3K0X A;  4A3J H;  1M1K C;  2IHE A;  3K58 A;  3OTO L;  5ISR A;  5IGF A;  1B44 D;  4OWT B;  1IXR A;  1ASZ A;  1EFW A;  1PFN A;  2ZT9 C;  4HN7 A;  2K05 A;  2IL8 A;  2XNA C;  4KJN A;  4EQO A;  2R92 B;  5A2Q E;  5KGU A;  1TWF B;  4JI3 Q;  1CI3 M;  4C56 C;  5GQO A;  1EIH A;  1SMX A;  1RKN A;  1I6V C;  5HY6 A;  1IL8 A;  2F3W A;  1SNC A;  2MPM A;  3MXP A;  3STB C;  1PH2 A;  1PYB A;  3A54 A;  3PO3 G;  2R93 B;  2KVM A;  3A5Z B;  3D6W A;  4QIW E;  3EBE A;  3GTG B;  4N8F A;  5M5X B;  3S1R H;  2JXM B;  5LMU L;  1PA6 A;  4A3D B;  3OMC A;  2K5N A;  1PH4 A;  4UPA A;  5HGT A;  3MXN B;  2F3I A;  1PHJ A;  3UI2 A;  3EVQ A;  4ABN A;  2RHQ B;  2R93 G;  1JR0 D;  1O7Z A;  3ULP A;  1XXG A;  2KCM A;  1TWG B;  1KAB A;  3FHW A;  3Q0A A;  2K5H A;  3PF5 A;  1YNJ D;  3OW7 A;  2YU9 H;  1OXX K;  1ILQ A;  2OCE A;  2B2W C;  2HCC A;  3TDQ A;  1CKM A;  4X3U A;  2DGY A;  3M3Y H;  1SEB D;  3NPP A;  1K8O A;  4LF9 Q;  4HIM A;  4GLV B;  2E2I B;  3I4O A;  4OEL B;  4DV7 L;  4IPC A;  4UHV A;  5M3F G;  3ERQ A;  5M3F H;  2N49 A;  3MA2 B;  4Q5V A;  1PRT F;  2Q8R E;  4O1N A;  2HQL A;  1LT4 D;  3CMA A;  2KED A;  3VR4 A;  5EPK A;  4HCE A;  1RIP A;  4P71 A;  1GUN A;  3CCE A;  3K59 A;  2MUY A;  4R4Q A;  2MGS A;  3HOW G;  3J80 E;  1HCZ A;  2F0P A;  1HXY D;  3R2T A;  5JEA H;  4DV3 L;  2JA5 B;  3T51 B;  4AYB B;  1STB A;  3J80 L;  1PZK D;  2VB3 X;  2ZTD A;  3CAM A;  3M4Y A;  2PZU A;  1B7Y B;  4JI1 Q;  1PRT B; 
#chains in the Genus database with same CATH homology
 1JOK A;  2KCC A;  5KYI A;  2RDG A;  3MAQ A;  5C4X B;  2RDH A;  4M8A A;  3SVM A;  2JP1 A;  3TZU A;  3KLR A;  3W2D A;  3A8I E;  2A6E D;  4X3S A;  3SK5 A;  2K6A A;  4BBS B;  1E2V A;  2WKD A;  3A7L A;  1LAB A;  3M7N A;  3GTJ B;  5KND A;  4UAI A;  3P20 A;  5I9P A;  3S2H B;  3J7A V;  1JOQ A;  1NR4 A;  1KDA A;  5D65 A;  2O5I C;  5CV6 A;  1L0Y B;  3L9A X;  5JPN C;  3ZYY X;  5KEE A;  2HUG A;  3PUZ A;  1HTL D;  2EVB A;  1F2M A;  1BCP D;  5FOB B;  4WRD A;  3J7A F;  3HOX B;  3ITP A;  1PDQ A;  1J9O A;  3PUX A;  1EIG A;  3WOF A;  2NN6 H;  1A2T A;  3VR6 A;  1IKM A;  1D5Z C;  3AU7 A;  3D31 A;  3FMC A;  5KYL A;  5IGE A;  4H44 C;  2NN6 I;  3TP7 A;  2M2L A;  5C6A A;  3I8Z A;  5CV9 A;  2WIN B;  4WFN 3;  3I3C A;  4IUR A;  2EE1 A;  3TZD A;  5C3X A;  1W6K A;  2FMC A;  2JYO A;  1EQV A;  3WDN A;  2F3V A;  1GUT A;  5ELD A;  1JOO A;  5JEA J;  1TY0 A;  4NMZ A;  2D62 A;  2B2U C;  3C1E A;  4C3J B;  5J1Z A;  1CZG A;  1CTM A;  3SHL A;  1I4P A;  1SMY D;  1SSO A;  4DXF A;  3RD4 A;  1TS5 A;  2KCN A;  1JWM D;  1AN8 A;  2H1E A;  2F0E A;  5I9O A;  1KLU D;  2PW7 A;  1RCV D;  4XTC S;  4NP5 A;  1TII D;  3VR5 A;  1OXT A;  2HCI A;  4C1N I;  4IUN A;  1KDB A;  2C5C A;  1LTT D;  3HG9 A;  4F88 A;  2QCP X;  2BDN A;  1PFB A;  3QO2 A;  1I3Q B;  2EDG A;  1FYC A;  1WTX A;  1SNP A;  2RBM A;  5G3L F;  1TWC B;  2EJM A;  2IJ0 A;  3Q22 A;  1ONL A;  4DFA A;  4RCO A;  4FF2 A;  3K5O A;  2E2D C;  3OPO A;  1RTN A;  1J8I A;  4CJ0 B;  2B2T C;  4C3H G;  5AFW A;  4HSP A;  3GTQ B;  3IL8 A;  2PPB C;  5I2X A;  4NKL A;  5M3F B;  3OMG A;  1BXT A;  1C48 A;  1CQF A;  3DWP A;  4A3F B;  2R3Z A;  4C1N K;  1AEX A;  1XTC D;  5T1I A;  2F0I A;  2LY7 A;  4HR7 B;  3DM1 A;  1BCP B;  1SFO B;  3GV3 A;  1EY0 A;  5K36 H;  3NSW A;  5K36 G;  3W3A A;  3ND8 A;  3K5N A;  5IT9 E;  3MXN A;  1WVL A;  5C0X H;  3VYT A;  2PYK A;  4Z9C B;  3DEO A;  1SBB B;  5E4W C;  1Q3L A;  1M4V A;  5FO7 B;  3J81 E;  5CV7 A;  1PRT D;  4BY1 B;  3DEP A;  2OF1 A;  5KIX A;  4L6T B;  5JOB A;  3A55 A;  4HAE A;  4R8N A;  1STY A;  3KLS A;  4H7B A;  2RKS A;  5CR3 A;  4PNY A;  1A3V A;  4OGQ C;  2Q8T A;  3MXG A;  3IKJ A;  1UUP A;  3ND9 A;  5J22 A;  2B2U A;  1G2S A;  4BA2 I;  1D1I A;  4C3I B;  4WJW A;  1HRJ A;  5JJZ A;  2A6H C;  1CM9 A;  4ODG A;  1K83 B;  3NWS A;  4MHE A;  1LTI D;  2A68 C;  3S1Q B;  3E0J A;  2PMZ B;  4K6D A;  1EU3 A;  2I07 B;  3CRL C;  4X3T A;  4P2C B;  5CBE E;  1MI2 A;  3WOE A;  3FRP B;  2KQ3 A;  2O4X A;  4OL7 A;  4YIJ A;  1H9M A;  3EJI A;  4K14 A;  3E6Z X;  3GTK B;  2EY1 A;  2JEA I;  2A73 B;  3NTH A;  4HSV A;  1H9S A;  5I4D A;  4RHR A;  3A7A B;  4BWG B;  3T16 A;  3CKI B;  4FF1 A;  5FK9 C;  4IAL A;  3GV6 A;  4RHS A;  1B4O A;  4XQQ A;  5EQ0 A;  3TP8 A;  1EY6 A;  1ET6 A;  5C0X I;  2A74 C;  5C0X J;  1S5E D;  1SYD A;  3GO5 A;  1QE6 A;  4KKS A;  2WII B;  1FR3 A;  2LKV A;  5E4X A;  5I6Y A;  5D3D A;  2KOL A;  2NVT B;  2EYP A;  1UNS A;  2BCO A;  3G6J B;  1TS2 A;  1X32 A;  1C4Q A;  3D4W A;  2XRQ D;  1TKW B;  2KHS A;  4B9W A;  1NSN S;  1G8Z D;  3C1F A;  3A56 A;  4KY5 A;  1C8C A;  2F0U A;  2F1M A;  2F0H A;  1O7Y A;  1DXM A;  1R4Q B;  1S5D D;  3NUC A;  4RAU C;  1LV9 A;  4A3B B;  2ICE C;  4R9W A;  1CFM A;  3BVM A;  1VF7 A;  1Y1W B;  2F0L A;  5EKI A;  1IW7 C;  1B50 A;  4XYQ A;  3R3O A;  3HOY B;  1E0B A;  3D4R A;  4ZQ3 A;  2FFK B;  1FGB D;  3HOV B;  2WP8 J;  3S2D B;  1D2B A;  3X3M A;  2F0F A;  4PMB A;  4QCL A;  3VYU A;  1DOL A;  2X6G A;  3HRZ C;  4RWS C;  5M9O A;  1CA5 A;  1ZKO A;  5BN3 A;  3FDT A;  4R8I A;  3PUV A;  5IGD A;  1B3A A;  1DYQ A;  4DAP A;  4K6L A;  5D3I B;  1ROD A;  4XQJ A;  4CKC A;  1DOM A;  2HDM A;  2E74 C;  3HOU B;  2LS0 1;  3I4N B;  1I4R A;  2QKI C;  1Q12 A;  2B8G A;  2IX1 A;  1LTA D;  3HOZ B;  3OIP A;  1RJT A;  3MZ5 A;  3NTI A;  2X6L A;  2CVR A;  4FF3 A;  5IGC A;  1XX8 A;  2B39 A;  3NE5 B;  5J39 A;  4DNT B;  3S1R B;  2ZXO A;  2E76 C;  2D5D A;  1F9P A;  3O13 A;  3S17 B;  5C5M A;  1E2Z A;  3M85 A;  4KJO A;  1S4Z A;  3IFD A;  2EOT A;  5DEH A;  4MIU A;  1QCB D;  1BO0 A;  1LO5 D;  3MWY W;  2FJ2 A;  2PW5 A;  4HCS A;  2XWJ B;  1IKL A;  2RSN A;  2K32 A;  2K7V A;  1EY7 A;  4RGM A;  2RQX A;  5KNC A;  3KUP A;  1I4Q A;  4KHZ A;  1G2T A;  3RZO B;  3H6M A;  1MSG A;  1PXU A;  5M5Y B;  1A3U A;  1S5F D;  2IX0 A;  1BCP C;  1PTO H;  1QWY A;  4F7X A;  2E2H B;  4ZUJ A;  1ET9 A;  1F9S A;  4U68 A;  3Q6S A;  3TME A;  3NQI A;  1CT1 D;  2Z8L A;  3VR2 A;  5CV4 A;  4HMJ A;  3MFG A;  4NW2 A;  2B2V A;  4JBW A;  3KK7 A;  3L7Z C;  5JVG 3;  2BE5 D;  2HQE A;  3LX0 A;  5LL6 X;  2X69 A;  1GHK A;  5HUR A;  5D14 A;  1A2U A;  3SE0 A;  3SEB A;  1F9Q A;  2RSO A;  3TP5 A;  2F0W A;  5COR A;  5ELB A;  4OIK A;  4EQN A;  2N88 A;  1DON A;  4KV6 A;  2K1B A;  1LT6 D;  4S3S A;  4DK1 A;  1LTS D;  5A2Q L;  1SYG A;  5I6W A;  4K5W A;  2K33 A;  4I7Z C;  5EJW A;  2PO4 A;  2A68 D;  4KTA A;  1M8A A;  4RGN A;  2JSO A;  3A8K E;  4MN3 A;  3N52 A;  1EY5 A;  2DY8 A;  1JIC A;  2Y0S B;  4IUV A;  2DY7 A;  1TVX A;  2Z4H A;  1TQO A;  4N9P A;  1CHQ D;  2RDF A;  3S1M B;  1FNU A;  1PTO D;  2JEB I;  1Y1V B;  1WTP A;  4C2M B;  4LAA A;  2E75 C;  2ID0 A;  1CA6 A;  1KDC A;  1D5M C;  1JC7 A;  1H9R A;  2J0T D;  2WAC A;  2BE5 C;  2EPB A;  1T5X D;  1YNJ C;  1F2Z A;  1OXS C;  4QB4 A;  1UEA B;  4CJ1 B;  2SOB A;  3VR3 A;  5FO9 B;  1SMY C;  2KEC A;  4DGZ A;  1W6J A;  2NZ1 D;  1F9R A;  4H0L C;  1GJX A;  2N55 A;  5DAU A;  2AUJ D;  4IUQ A;  1NAP A;  1OXU A;  1ENA A;  4HTH A;  5LHY 1;  1MGS A;  3OIQ A;  3NXW A;  3QJY A;  1SDF A;  3NHH A;  1PZI D;  2F0M A;  3BYY B;  4A3G B;  3GQB A;  2F03 A;  3RLF A;  3I73 A;  2AUK A;  1STG A;  5TSS A;  3EA6 A;  2A6H D;  1AZP A;  1WTO A;  4KD4 A;  4RGT A;  1S5C D;  2VNU D;  2AWO A;  4IZ8 A;  2SEB D;  1QB5 D;  1IHZ A;  5EBC A;  5I2Y A;  2Z4I A;  3A8J E;  4PMW A;  2L1B A;  1EY4 A;  4XYO A;  5FLX L;  1RDP D;  1PTO F;  4RGO S;  3E5S A;  4OHJ A;  3NQT A;  2NN6 G;  3F2U A;  3OWE B;  1TY2 A;  4PMC A;  1SYE A;  2AQ1 B;  1D5X C;  1BUV T;  2G9H D;  3MC0 B;  4KD3 A;  4BA1 I;  1IYU A;  4K5V A;  2BDO A;  1SNQ A;  3SK6 A;  5LL6 S;  1CK1 A;  2PQE A;  3S9W A;  1I6H B;  1GUG A;  2B2W A;  3KBG A;  1SJE D;  2F0J A;  1LLR D;  2QF7 A;  5ELF A;  1BQQ T;  1VF5 C;  2FIN B;  4J6H A;  1I50 B;  2XRS D;  3I90 A;  1HQM C;  5C3E B;  4IUP A;  3MVV A;  1ESF A;  5BN4 A;  3K5M A;  1EEI D;  3BG3 A;  3NBH A;  4A3J B;  1H9K A;  1Z6H A;  2I46 A;  2K5D A;  3FVQ A;  2XVS A;  5F2D A;  2PZT A;  5CBA E;  3QG1 A;  1KLG D;  4DF7 A;  4ZKC B;  1EYD A;  3LWU A;  1A3T A;  1I4X A;  3SDZ A;  4Y7N B;  2CQA A;  4KN7 C;  4IQZ A;  3PIP 3;  1AFP A;  1F2L A;  3GD7 A;  3PV0 A;  1Z7T A;  1STE A;  2NBF A;  4C3H B;  2XIW A;  4IN3 A;  1G6Z A;  4XT1 B;  1JCK B;  4G7H C;  4RKL A;  1PFM A;  5BN5 A;  3MEH A;  5CV5 A;  2L0C A;  4H13 C;  5IOD A;  5CGK A;  2R7Z B;  1RF2 D;  4A3K B;  4DU9 A;  1ENC A;  3T56 B;  1JOR A;  1O78 A;  4J1M A;  1TS3 A;  1JQY D;  2A69 C;  4FF4 A;  1BF4 A;  1PZJ D;  2Q8I B;  3CU7 A;  3V2T A;  3TN2 A;  3BDC A;  1F77 A;  1Q1B A;  2F4I A;  3N6R A;  3EFX D;  2DNC A;  5EGT A;  1BR9 A;  5KNB A;  1B9N A;  1L0X B;  5CV8 A;  4JK1 C;  1GXD C;  2JA8 B;  1VDZ A;  2EYH A;  3H0G B;  4KHV A;  1A15 A;  2M00 A;  2O2L D;  1SNO A;  2IPK D;  1HHV A;  1ZXT A;  2QEJ C;  1VCI A;  3R2I A;  1Y8O B;  1PYW D;  2L9H A;  1FNW A;  2ENB A;  1MSH A;  4KKU A;  4OO1 G;  5G3L D;  2WB1 B;  4ZKB B;  1A6X A;  1ML0 D;  2K04 A;  1LTG D;  1V1P B;  3HZX A;  1FNV A;  2JE6 I;  2EXZ A;  1Q1E A;  2IX3 A;  1SE3 A;  4ZRZ A;  2BA1 A;  1SE4 A;  1RHP A;  1DM0 B;  3I4L A;  2QIL A;  1U4P A;  1B9M A;  2ICI A;  1D6E C;  1EZ6 A;  1B2T A;  4IFD I;  1GUS A;  4B08 A;  2E2J B;  3BS1 A;  1G29 1;  4QUC A;  4X3K A;  5IOC A;  1HUM A;  4ID6 A;  5ELE A;  2ZXR A;  3MHB A;  1BBX C;  1TR5 A;  4CJ2 C;  4A3I B;  1EZ8 A;  4ZK9 B;  4RKB A;  1VMC A;  2KEE A;  1PTO C;  1ESR A;  3HKZ B;  3MTS A;  5FLX E;  4OIJ A;  1R4P B;  2HDL A;  3RUZ A;  1I4H A;  1BOS A;  4K5X A;  4LMQ D;  1HFN A;  3NP8 A;  3S1N B;  3JAM L;  3BDO A;  4XXE A;  4FXK C;  2K5W A;  5DNF A;  3OWF A;  5C5L A;  3KLS X;  3DWA A;  3U9O A;  4C3I G;  1AZQ A;  3D8G A;  3SK8 A;  1WTQ A;  2EYL A;  1R9T B;  3VYR A;  4TSS A;  5C0X G;  3M3Y B;  2K03 A;  1Q8I A;  1JB3 A;  1TT2 A;  4IUU A;  2EY6 A;  5NUC A;  1HFG A;  5IGB A;  4IFD H;  1STN A;  3BZD B;  4IFD G;  3L3O C;  3V05 A;  3R93 A;  4WOR A;  3TSS A;  5DM6 3;  1HA5 A;  4ZYS A;  2SDF A;  1GUO A;  3RMH A;  5EPJ A;  5JAV A;  1SND A;  2WV6 D;  3PIO 3;  1CZW A;  1DJR D;  3M4O B;  1XWE A;  3I91 A;  2PNR C;  2PCF B;  4V0B A;  2KUM A;  2B2T A;  3EQL C;  3H3V C;  4OO1 H;  3M4Y A;  2WAQ B;  1BCP F;  2JA7 B;  4CGY B;  3SR1 A;  1O80 A;  2F0Q A;  4I65 A;  1SJH D;  3V96 A;  4DAV A;  1V43 A;  1X3P A;  3T53 B;  4DNR B;  2VXW A;  4CKE A;  3URY A;  2K28 A;  4L63 B;  1RTO A;  2NWG A;  4FVM A;  5C44 B;  1LT3 D;  1Y8N B;  3M7G A;  4PQX A;  4KY6 A;  3PO2 B;  2G9D A;  1EU4 A;  2VUM B;  1YNN C;  2OEO A;  3QB3 A;  3SK4 A;  3VA5 A;  4BBR B;  3PUW A;  4TQU S;  3H09 A;  2B2V C;  2YU9 B;  2EZV A;  1ENF A;  3RZD B;  4ZUI A;  1AW7 A;  2ZXP A;  2R6G A;  4HMI A;  5C4J B;  1WCM B;  1B53 A;  2FHT A;  2OT2 A;  1Y8P B;  3I70 A;  2L12 A;  2QDB A;  4KY7 A;  3ONA B;  1KNE A;  1WD1 A;  4RA8 A;  2XN9 C;  2M9V A;  2XSC A;  4DK0 A;  4K8I A;  2AQ3 B;  1T5E A;  2B63 B;  1H9J A;  3BYT B;  2CHB D;  5K5P A;  2A69 D;  3FKI B;  4BY7 B;  4GZY C;  3TBI B;  4G57 A;  3NTK A;  1ZEQ X;  5JEA G;  2Z1C A;  3TP6 A;  4PV1 C;  2NVQ B;  5COY A;  1WTV A;  3HP3 A;  3P75 A;  2NYZ D;  3T4A C;  4K2K A;  4XIG S;  5EKL A;  4V19 0;  5M5W B;  3DXJ C;  2J4X A;  2V4D A;  4F87 A;  3NBI A;  4TKO B;  2O5J C;  4XT3 B;  5T1G A;  2F0T A;  1ZYR C;  3QOJ A;  2KJX A;  1WD0 A;  1EL0 A;  3ERO A;  2EYM A;  2IT1 A;  3S14 B;  4BS9 A;  1JWS D;  4TRD A;  3QWN A;  3K5L A;  4FP5 D;  1TS4 A;  4KK7 A;  2XWB B;  2TSS A;  1G91 A;  2B8F A;  1SYB A;  3PO3 B;  1ZYR D;  2NUC A;  3HEJ A;  1HTP A;  4KI0 A;  2L55 A;  5CYU A;  4ME5 A;  4A3E B;  1EWC A;  4DN4 M;  3D6C A;  1AP0 A;  1GOZ A;  2GA4 B;  2C9O A;  1LT5 D;  3T13 A;  5KRU A;  1SE2 A;  2TMP A;  4LK1 C;  2F0K A;  1Z47 A;  4E6I A;  3PMF A;  1GUW A;  1PTO B;  4HED A;  3G7L A;  4IFD J;  3OHX C;  4N9T A;  3P7J A;  2F0G A;  1YNN D;  4FNF A;  1SXT A;  1QJO A;  3U9S A;  1PRT C;  4FYD A;  4EQP A;  1X3Q A;  4G4K A;  2EYO A;  1ILP A;  4ILW A;  4A93 B;  4UDU C;  5A35 A;  1UAP A;  2J7Z A;  3P1H A;  3GP7 A;  3NK9 A;  4CHT B;  1EWH A;  1RD9 D;  2MJ8 A;  4EGV A;  1QNK A;  2L4N A;  3DUZ A;  1B1Z A;  1D1K A;  4QF4 A;  1DOK A;  3R8B A;  2L5T A;  5C3W A;  1QOH A;  4K8J A;  1TWH B;  5CC4 A;  2BOS A;  4C3J G;  3AMU A;  1OXV A;  2NVX B;  5DM7 3;  2LFN A;  3BVZ A;  4DA2 A;  2LMC B;  5EBD A;  2FMM A;  3PUY A;  1HQR D;  1HA6 A;  1F2Y A;  1STH A;  4O42 A;  3J81 L;  3HOW B;  5CMD A;  1JWU D;  1PRT B;  1LTR D;  3MFY A;  3D3R A;  3BVG A;  3NWT A;  1O7L A;  2DN8 A;  1KTK A;  3GTL B;  1EEF D;  1EYC A;  3KF8 A;  4QUF A;  3FPU B;  2NVY B;  1QNU A;  4KN4 C;  1V1O A;  3Q24 A;  1EFI D;  4KMU C;  4ZAI A;  4M1U B;  2F0D A;  4ULL A;  1U4L A;  3I4M B;  4Q0F A;  4XDX A;  3GTP B;  5FO8 B;  1CHP D;  2EY2 A;  1NUC A;  1JE4 A;  3KBX A;  1IW7 D;  1OO9 B;  3DHQ A;  2PZW A;  1MD2 D;  1QG7 A;  1QIL A;  4NDX A;  3C2P A;  3GTO B;  4L8J A;  3IAY A;  3S15 B;  1PMR A;  2SNS A;  3K0Y A;  2BA0 A;  1EOT A;  2WKC A;  1HUN A;  5E3F A;  4CBV A;  1STA A;  1CQV A;  3GTM B;  3JAM E;  3LWE A;  3VA7 A;  4F8M A;  1DZ1 A;  2K01 A;  3C3L A;  4J8Q A;  1NR2 A;  2AWN A;  1EYA A;  1S5B D;  2NTS A;  1I4G A;  1LAC A;  1MBY A;  3HS0 C;  4LJZ C;  3AB9 A;  3K7A B;  1EQT A;  3H91 A;  2VB2 X;  4IUT A;  5C4H A;  3BDL A;  3S16 B;  2MP1 A;  3OOC A;  4QMG A;  3DMU A;  4DAY A;  4QIW B;  1LTB D;  1SYC A;  1K8M A;  4EVO A;  2EYJ A;  2A5H A;  1U9R A;  3SXH A;  1PLF A;  1DD2 A;  4FO2 A;  2KA7 A;  3J7Y W;  1EY8 A;  3DWQ A;  1V1P A;  5C4Z A;  2IW3 A;  4ZLT F;  2MHV A;  1HPC A;  5ELC A;  1U4M A;  4U67 3;  4G7Z C;  1KAA A;  1SYF A;  2EY5 A;  2DNE A;  3CHB D;  1BDO A;  3QOL A;  1GHJ A;  1VMP A;  4FXG C;  4RCN A;  2RA4 A;  4XQN A;  3CRK C;  4G7O C;  5JVH 3;  4A3M B;  2YYZ A;  2NTT A;  3IFT A;  4DXG A;  3Q23 A;  2RVL A;  5IT9 L;  1ICW A;  2OXP A;  1H9S B;  2D2C C;  1SNM A;  5M3M B;  3MXU A;  3LNN A;  3OSO A;  2F0S A;  2H4O A;  2K5Q A;  2D9U A;  2B2Y C;  2EJF C;  2SNM A;  5FKA C;  2AQ2 B;  1DCZ A;  2B2Y A;  2CW0 C;  5EKK A;  4B9X A;  1TU2 B;  1NCV A;  1KNA A;  2F0O A;  3H94 A;  2IWH A;  4K2L A;  2EYF A;  1IYV A;  1Q90 A;  4FXD A;  3X3N A;  3FPP A;  5IIF A;  4CKB A;  1TWA B;  3HGB A;  3CQZ B;  1V8Q A;  1EY9 A;  1SAP A;  1Y69 U;  2F0V A;  1FD7 D;  2EJG C;  2R61 A;  5E1F A;  1XYI A;  1BNZ A;  1II3 A;  3K6O A;  4KKT A;  2JA6 B;  3K57 A;  3D4D A;  1WTW A;  2F0N A;  5IGG A;  3I72 A;  2A6E C;  5JPM C;  1E2W A;  3C46 A;  2CW0 D;  2NB0 A;  2L11 A;  3FEW X;  4OO1 I;  1U4R A;  4RH6 A;  4RFB A;  3VYS A;  3QIA A;  3K58 A;  5ISR A;  5IGF A;  1B44 D;  1PFN A;  2ZT9 C;  4HN7 A;  2K05 A;  2IL8 A;  2XNA C;  4KJN A;  4EQO A;  2R92 B;  5A2Q E;  5KGU A;  1TWF B;  1CI3 M;  4C56 C;  1EIH A;  1RKN A;  1I6V C;  1IL8 A;  2F3W A;  1SNC A;  2MPM A;  3MXP A;  3A54 A;  2R93 B;  2KVM A;  3D6W A;  3GTG B;  5M5X B;  2JXM B;  4A3D B;  3OMC A;  5HGT A;  3UI2 A;  3EVQ A;  4ABN A;  1JR0 D;  1O7Z A;  1XXG A;  1TWG B;  1KAB A;  3Q0A A;  1YNJ D;  3OW7 A;  1OXX K;  1ILQ A;  2B2W C;  2HCC A;  3TDQ A;  4X3U A;  1SEB D;  3NPP A;  1K8O A;  2E2I B;  3ERQ A;  3MA2 B;  4Q5V A;  1PRT F;  2Q8R E;  4O1N A;  1LT4 D;  2KED A;  3VR4 A;  5EPK A;  4HCE A;  1GUN A;  3K59 A;  2MUY A;  2MGS A;  3J80 E;  1HCZ A;  2F0P A;  1HXY D;  3R2T A;  5JEA H;  2JA5 B;  3T51 B;  4AYB B;  1STB A;  3J80 L;  1PZK D;  2VB3 X;  1WTR A;  2PZU A;  5EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...