5I6YA

Crystal structure of staphylococcal nuclease variant delta+phs a90e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLEYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i6yA00
1ENCA 5DEHA 1KDAA 1EZ8A 4KY6A 2EYPA 3NP8A 3P75A 4N9PA 1SNPA 5CGKA 2PQEA 3ITPA 3BDCA 2F0UA 5HGTA 5CV5A 2PZUA 4WRDA 5EKKA 3NXWA 1A3VA 2F0LA 2PZWA 3NK9A 2NUCA 4K5VA 4YIJA 3NQTA 1F2MA 1STAA 1KDBA 1JOKA 1TT2A 1RKNA 3T13A 3QB3A 5KIXA 2KHSA 1ENAA 5K5PA 2F0DA 4NKLA 1EQVA 1SYCA 1NSNS 2F0QA 1EY5A 2LKVA 4K8IA 4R8NA 5CV8A 4S3SA 3SK8A 2SOBA 3TMEA 5C4ZA 4KY7A 1SYGA 4ZUJA 1STNA 3HEJA 3MVVA 5F2DA 2WACA 3OWFA 4DU9A 4HMIA 5IGCA 4PMCA 5IGEA 4IUNA 4KTAA 5EGTA 3SHLA 1JOQA 1SNCA 2EY1A 3P1HA 4KD3A 5KRUA 2EXZA 3D6CA 1KDCA 3H6MA 5CV9A 5IOCA 1SYFA 4QB4A 2QDBA 1KABA 2OEOA 5J1ZA 5IGFA 3MHBA 3OSOA 5I6WA 3OMGA 4NDXA 3TP7A 4EQNA 3ERQA 4H7BA 1F2YA 2KQ3A 4KJOA 1EY7A 4G57A 3HZXA 4ID6A 4K8JA 4K5XA 4RKBA 5J22A 2F0MA 4J1MA 2F0SA 2OF1A 4ZQ3A 4F8MA 3BDLA 5I6YA 2O4XA 2F0KA 3E5SA 4K2LA 4LAAA 4KJNA 4QF4A 4IALA 2SNMA 4K2KA 2OXPA 2EYOA 2F0FA 4RKLA 4B9XA 4OL7A 2RKSA 4K5WA 5IGDA 5C5MA 5CV6A 3DMUA 1KAAA 2EY2A 5KYIA 1A3TA 3MZ5A 4ODGA 5E1FA 3V2TA 1AEXA 4EQPA 5C5LA 5HURA 2F0HA 2EY5A 1NUCA 1SNDA 1STGA 3TP6A 2ENBA 1STHA 2EYJA 2F0IA 3EJIA 4KD4A 3QOJA 2F3WA 1SNQA 2F0PA 1STBA 4ZUIA 4B9WA 3C1FA 3NUCA 2PYKA 4EVOA 4WORA 5I9OA 1U9RA 2EYHA 5DAUA 4KY5A 3U9OA 2EY6A 5M9OA 3RUZA 4J6HA 5IGGA 1EYDA 1EYAA 2F0GA 3D4WA 3LX0A 3PMFA 2EYLA 5EKLA 3SK4A 5KGUA 1EY9A 3D4DA 5ISRA 3QOLA 1F2ZA 5CV4A 3SK6A 2F0TA 3TP5A 5CV7A 2RDFA 3TP8A 4K6DA 5IIFA 2EYMA 3SXHA 2PW7A 5KYLA 5IODA 5C3WA 4DF7A 5E3FA 5C6AA 3VA5A 2SNSA 1EY0A 2F3VA 3R3OA 4PMBA 5KEEA 2HQEA 3S9WA 1EYCA 1SYEA 1EY8A 5IGBA 1SNMA 2RBMA 4NMZA 5I9PA 4KHVA 4DGZA 3EVQA 3EROA 1TR5A 5J39A 2PW5A 5JOBA 5CC4A 4HMJA 4N9TA 5CR3A 1EZ6A 2EYFA 3SR1A 3T16A 2F0WA 1SYBA 4I65A 1STYA 4DFAA 5JAVA 4EQOA 3MXPA 3DHQA 1A2UA 3D8GA 4IZ8A 4NP5A 2PZTA 2F0VA 1SYDA 2F0EA 3NHHA 5C4HA 2F0JA 1II3A 3OMCA 4K14A 4QMGA 2F0NA 5NUCA 1A2TA 3SK5A 1JOOA 2F0OA 4KV6A 3C1EA 4MIUA 4PNYA 1EY6A 4E6IA 4F7XA 1A3UA 1SNOA 2M00A 3MEHA 4ME5A 1JORA 4TRDA 1EY4A 1TQOA 1IHZA 4HTHA 5C3XA
chains in the Genus database with same CATH superfamily
3CPFA 2BH2A 5T1GA 4YHHQ 2CWPA 4YHHL 4RGMA 4BBSB 1TWFH 1GUSA 5AJ3Q 1YIJA 1N33L 5AJ3L 4WRDA 1S5BD 1VQJA 1K83B 3LGJA 2F0LA 3A55A 5C4XH 3EN2A 3KUPA 2NVYB 4FVMA 4M1UB 1CZGA 4Y7NH 3URYA 3KBGA 4HAEA 4P74A 2EE1A 4PMCA 1IBLL 1JOQA 3S17H 2E74C 3ZJYC 2Q8TA 3UDFA 5KRUA 1KDCA 3M4PA 2OEOA 3PUXA 2HDMA 1WD1A 1RCVD 5CYUA 4G57A 3WOEA 2YU9B 3OOCA 2A1AA 2AUKA 4HJAA 1KQSA 3M4OB 3CW2C 4JBJA 4DR5L 2D0PA 3FEWX 2XWBB 4RKLA 2LXKA 3MC0B 1DONA 1Y1VB 1YHBA 4RGTA 1C4QA 1RL2A 3Q23A 1YJNA 1G6PA 3NTKA 3MZ5A 3I3CA 2F0HA 3ICEA 3PO3B 2F0IA 4MHEA 3QOJA 1KTKA 3TRZA 2OTJA 4R1JA 2NN6I 2NTTA 3NUCA 3Q6SA 4EVOA 2F4VQ 1G51A 2UXBQ 1JE4A 2UXBL 5LL6X 4MZ9A 2QEJC 3EIVA 1CQFA 4QUCA 4GNXA 3AU7A 3KYHC 1TY2A 4DR1Q 4DR1L 4ZCKA 2PW7A 2QA4A 4DF7A 3R3OA 1EYCA 2HHHQ 3DEPA 4LJZC 3KF6A 3QWNA 4H02A 4A76A 4PQXA 1NCVA 3BU2A 1BUVT 1E2VA 3TZDA 1TS4A 4OELB 5IYBG 3I4NB 4DV4L 4A3BB 1LTBD 2L4NA 4ZRZA 4B08A 3J81L 1BOSA 3K5NA 1VMCA 2E2IH 4XQQA 4LF5L 1PMRA 3NBHA 1FVIA 4FF4A 3GTLH 1H9KA 1IHZA 1I6HH 1EIHA 1ENCA 2R7ZG 4DXGA 4A3EH 5L37A 1OTCA 4LUOA 1SROA 2NYZD 2RQXA 4QUFA 3CXCA 2I46A 4FF1A 4A3EG 2RCNA 1VQAA 1F2MA 2PMZB 2G5DA 2ZTCA 4JK1C 3RNUA 3QB3A 2Z8LA 4C3IH 4YWMA 4PZ7A 2R61A 4IUPA 4B3RL 1FJGQ 5CV8A 1FJGL 3A5UA 4IFDJ 1Z7TA 4C3IG 4GLAC 1BVSA 3VYUA 2A6HC 4JI6L 4A3CG 1CA5A 1K8MA 2WKDA 5EGTA 5EPLA 3P1HA 2IY5B 3TS0A 2I5MX 2IW3A 2EJGC 3PIP3 3H3VC 3BYYB 4DV6Q 1OXVA 4DR7Q 1MSGA 4OX9Q 3S2HB 1X55A 3MWYW 4FXGC 4ID6A 1X65A 1L0YB 3F2UA 3A8JE 3OTOQ 4OWXB 2DNEA 1WTVA 2UUBQ 1QCBD 2UUBL 3UE1A 4IFDI 4IALA 1LTRD 4LUZA 4QY7A 1C48A 5FO8B 4JV5Q 4JV5L 4JYAL 2Y0SB 2LXJA 4BXXH 3KF8A 1KHIA 3BVMA 1R4PB 2BA0A 2E76C 4ZLTF 4BXXG 2OWOA 4OO1I 1AH9A 5I9OA 3JAMi 3D3RA 5JEAG 2OQ0A 3S15B 1ZYRD 2R93B 1UE5A 2WP8J 1LT3D 1HFGA 4KN7C 2EYMA 2B2WA 4NW2A 4KHZA 4XYQA 2XGTA 1EQQA 3AMUA 1I4RA 1SNMA 4JI2Q 2B2TC 1XNRQ 4JI2L 4BA2I 1A62A 3BVGA 3EVQA 1CZWA 1WVLA 1Q12A 1E24A 4DV1Q 1WTOA 2NN6G 3AYHB 4DV1L 4DV7L 2D2CC 3FPUB 1F9QA 5M3MG 2O2LD 3D8GA 1IXRA 2K33A 2F0EA 1AE3A 4MTNA 3PO2G 2FXQA 1II3A 1PH5A 4YY3L 1A2TA 1RD9D 4CJ2C 1RJTA 4LFBQ 4A3DH 2VXWA 4IUVA 5ELNA 1V1OA 3HGBA 3P20A 5DNFA 2NVQB 3NP8A 1XTCD 4WJ3M 1TVXA 4A3DG 5LMNL 2F3IA 2F0UA 4QIWB 2VUMG 1RF2D 2CW0C 2L15A 3P7JA 1PH2A 2B2UA 1M90C 1CI3M 2QW7A 3NK9A 4K5VA 1EFWA 3K57A 4FO2A 4A3GB 2LMCB 1PRTB 1EU3A 3H0GH 2AQ3B 3SK8A 4DR4Q 1L0XB 4DR4L 2ALYB 3HEJA 4JPBW 4FXKC 4TKOB 1TY0A 2K7VA 3H0GG 3ZYYX 3A8KE 3L3OC 4R4TA 1RHPA 1KRTA 3I70A 3HKSA 2ZJRA 1O7LA 3CCRA 2DN8A 4IJLA 3FDTA 4XT3B 1VCIA 5T1IA 2A73B 2WIIB 4X64Q 3E0EA 4RA8A 4RGOS 1UEBA 3FRPB 4BBRG 2Z9HA 2KCNA 1CFMA 2B2UC 4K2KA 2B2YA 4RGNA 2BE5D 4OHJA 1T5XD 2JA5H 4Q0FA 2DGYA 1IL2A 4RCOA 3HKZE 4Y7NB 2JA5G 3A0JA 4HEDA 1SNDA 5D3DA 3PQIA 2F0PA 1U5KA 3E6ZX 3I55A 3S17B 4NXNL 2CVRA 4HJ7A 4EGVA 4IFDH 2EY6A 2ZM6Q 1KLGD 4IFDG 2NVXH 3TP8A 1GVPA 4LF6L 3K80C 5C3WA 5IP7G 1HR0L 3UDGA 1SJHD 4JI3L 3MXGA 4WFN3 3VA7A 1CKMA 4KMUC 2JA6H 4LF8L 2DY7A 5CC4A 4POGA 5BN3A 4OO1G 1W6KA 2JA6G 5DM63 1HUMA 2UUAL 1UEAB 3SDZA 4FNFA 3T1YL 2F0NA 5CBEE 1JOOA 2XWJB 2BA1A 4KV6A 5LHY1 4BBSH 1FGUA 2R6GA 1UAPA 3R2TA 3I4MH 2WAQE 4LF9L 3CU7A 5AFWA 3S16H 4R9WA 2PZUA 4KK7A 1GXDC 5HY6A 5GADC 1D8LA 3IAYA 1LTSD 1XTDA 4K8IA 3J7ZC 2JQOA 1SYGA 2CH4W 1N34L 3DWQA 4N8FA 1AE2A 1J8IA 2WACA 3RR5A 4HMIA 1H9MA 4OIJA 4JOIC 4P2CB 1O7ZA 1S5ED 3GTKH 1HQRD 4GKKL 2L12A 5JJZA 4OONA 3DWPA 1VQ4A 2IX1A 3KLRA 2R7ZB 2E2IB 5IY0A 3OSOA 2I0QA 1FNWA 4CJ1B 3L9AX 3GTLB 1I6HB 1SAPA 2ES2A 3NPPA 4K8JA 2XSCA 4M8AA 4ZQ3A 2OF1A 4HIOA 4A3EB 1Y1VH 1PTOF 2VY3A 1W6JA 3T1HL 2PI2E 2XN9C 4LAAA 1LM0A 1E3PA 1LYLA 2OXPA 4A3KH 1B9MA 4K0KQ 4K5WA 4C3IB 4AQYL 2F4IA 1K8GA 4H0LC 4B3SL 1A3TA 1EEFD 1B2TA 1AEXA 1SE2A 1HNWL 1YNND 2PCFB 2EY5A 3AB9A 4X66Q 3J81c 3GQBA 4X66L 4DNRB 3I72A 1HNXQ 1HNXL 3DM3A 3W1BA 5EKLA 3IFDA 4RCNA 3MFYA 1EY9A 1BDOA 1IZ6A 5CV7A 1J5EQ 3H94A 1R4QB 2I07B 4ABNA 1VDZA 1SE3A 1ZYRC 3AFPA 4A3BH 4FF2A 2HIVA 2F0WA 3GV3A 2HIXA 3CHBD 1HHVA 4WJWA 1V1QA 5A35A 1X3FA 1LTTD 1Z9FA 5GAEC 4FXDA 2CHBD 3G71A 2DJFC 4L5TA 1SNOA 4IO9A 1SRUA 1CKOA 2GVBA 5DEHA 2K28A 1QVCA 1NR4A 5FJ8G 1ILPA 5EKKA 1XWEA 1QE6A 3UDXA 1G8ZD 2NUCA 3U9SA 1TWCH 2KHSA 1DOLA 4A3JH 4DK1A 2F0DA 3E0JA 1EQVA 1SYCA 4NKLA 4GNXB 3RN5A 5M3MB 2KBNA 1AP0A 1E2ZA 2Z4IA 4A3JG 3PO2B 2K5NA 2JK8A 5F2DA 1GD7A 3OWFA 4XDXA 1JE5A 4DUYL 1LTLA 3S2HH 3CCJA 2KCMA 3H6MA 2PO4A 1E22A 5CV9A 1G2TA 3DLLA 3K7UC 4NDXA 3ERQA 4A3DB 4AYBE 2VUMB 3E9IA 5JPNC 1EY7A 2VW9A 1Q7YC 4K5XA 2ZXRA 1QJOA 2F0MA 2CQOA 4LUVA 1HCZA 1GUOA 1RIPA 3CC2A 4P75A 4RHRA 2ZXPA 4A3MG 1XYIA 1VQOA 1ZEQX 3ONAB 5KNBA 3NWSA 2GN5A 1IBKQ 3DMUA 1IBKL 3H0GB 2E8GA 4R8IA 1QWYA 2PNRC 4GN4B 1LO5D 1OXUA 1SMXA 1STHA 5M5XB 4C3HG 3L0OA 5G3LD 3S14H 1GO3E 2IX0A 3IRBA 1MJCA 1B9NA 1NE3A 3BDOA 3G7LA 3J80E 1IYUA 3CQZH 4I7AA 3LX0A 3R8BA 3SK4A 3PF4A 3EQLC 4BBRB 4JI8Q 4A3FH 1JMCA 3TDQA 4R4QA 1CSQA 2C9OA 1LABA 1PHJA 2MHVA 1PDQA 2JA5B 1PYSB 3M9BA 1EU4A 4YWKA 5GQOA 2BOSA 3T16A 1B8AA 1JJ2A 3RZOB 5ELCA 2K1BA 2L0CA 3F2CA 3NENA 3NBIA 3O13A 1QVFA 5GROA 3NHHA 1D5MC 1XNQQ 2NVQH 2J7ZA 1SXTA 1EQTA 1CUKA 1KNEA 4TSSA 3A5ZB 1WCMH 1EIFA 1BXTA 2B8FA 1VMPA 2EYPA 3PSIA 1WCMG 1X54A 4U673 3RN2A 5CV5A 4A3GH 1JB7A 1CKNB 2NBFA 2JA7H 1TT2A 4LF4Q 3VR3A 4DUZL 1IW7D 4Y52H 1EOVA 2JA7G 2JA6B 2JP1A 2SOBA 2Z6KA 3MVVA 2EJFC 4AH6A 4IUNA 1HTPA 1WTXA 1JWUD 4IUUA 1I94Q 3NE5B 1U4PA 4OWWB 4BA1I 1FNUA 2HCIA 1K8OA 4KJOA 3I4MB 2WB1E 5J22A 2IPKD 2F0SA 2A6ED 3S16B 5JEAJ 1Q82C 2MQHA 4CHTB 3M4YA 4KJNA 4K6LA 2BCOA 4CDEC 1CM9A 4HJ8A 3K5OA 5IGDA 3WDNA 1KAAA 1WD0A 3KFUA 2MJ8A 1SLJA 1W2BA 2Q2UA 1SE4A 1STBA 1VQCA 1Y8PB 3GTKB 1ONLA 2VB3X 3VYRA 2YYZA 4JVZA 3RUZA 5IWAQ 5IGGA 4V190 5IWAL 4A3IG 4XYOA 3QOLA 1YNNC 4TVAB 1ZKOA 2K03A 3PUVA 4OGQC 1J6QA 3FHWA 1F9PA 2JA8G 1NAPA 3TS2A 2I5HA 3KDFB 4A3KB 4IOAA 2KHIA 3EFXD 1X3QA 2X6GA 1STYA 5ELDA 1EIGA 4XXEA 2EJMA 4OEMB 2F4VL 1L0WA 4O0AA 4B3MQ 4P73A 3SVMA 2F1MA 3C46A 2CWAA 1JCKB 1EY6A 2FMMA 4ME5A 3VR4A 4TRDA 2ZJQA 1VQPA 1GOZA 1PH6A 4G4KA 2RHSB 1HJPA 1ICWA 2HHHL 2YTXA 3MXNB 3X3MA 5IYCH 2B39A 2EXDA 4YWLA 5IYBH 4H44C 1JICA 2LSSA 5IYCG 3G4SA 5EJWA 5K5PA 1P16A 5M5YH 1HPCA 4OIKA 4GN3B 1R9TH 2K5VA 2R7ZH 1QG7A 1I4GA 1PVOA 4HIKA 1BR9A 2QEXA 2EXZA 2KJXA 4UP8A 3S1NB 4GNXC 4ME3A 2RCFA 5C44H 3HOXG 3K7AH 3H3VI 3JC66 3WOFA 3OHXC 4J8QA 4J1MA 5C44G 5LMNW 1P8LA 3BDLA 4APVA 2UU9Q 2RSNA 1ASYA 2AMCB 4A3CH 1TWCB 3S1QH 4LMQD 2IHEA 2RKSA 4A3JB 1VQ9A 3I90A 1VQNA 2YTVA 4QGUA 4JI4Q 4IUQA 1EUJA 3G48A 3PCOB 2WINB 3TP6A 2PPBC 1YVCA 4KKSA 1D7QA 4DV6L 1IYVA 4DR7L 4OX9L 1HA6A 2O5JC 3HP3A 3OTOL 1BCPD 1KRSA 1BCPB 2F0TA 4IURA 3J81j 1PTOH 1SEBD 1WJJA 1EY0A 2XIWA 1HZCA 2DY8A 4IPHA 1QVGA 1LTID 5EBDA 3KJOA 1TR5A 4DV3Q 5JOBA 5JEAH 2JJQA 4I65A 4EQOA 4C3HB 2E2DC 4GZYC 1CKNA 1GUNA 4GLVB 2B3GA 2TSSA 3OMCA 5NUCA 4DV2Q 4JI7Q 1XMQQ 3C1EA 4E6IA 3S14B 1CHQD 3CQZB 4JW0A 2DUDA 5IT9L 3K0XA 4A3FB 2NN6H 2XTIA 4Q5VA 3K81C 5HGTA 1XNRL 5M3MH 3K5LA 1HR0W 2AHOB 1H9SA 3PO2H 5LMUQ 4ZAIA 1PFBA 3A8IE 1ENAA 4P71A 3JAML 1X56A 1EFID 1JT8A 3TMEA 1PH1A 3J7AV 3OPOA 3M7GA 2E2JH 3SHLA 1D5XC 1KIXA 4LFBL 3L2PA 2VUMH 2NVTB 1GUGA 5IOCA 1I5FA 2RA4A 3HFZB 2QDBA 1KABA 2R92G 1IW7C 5J1ZA 1HUNA 4A3LG 1WCMB 5E7NA 1NJIC 3J80i 2B2WC 3ER0A 3HZXA 4JBKA 1WYDA 1WTPA 1YNXA 3KLSX 1XX8A 1KD1C 4JG2A 1NMFA 1PRTD 1NR2A 3I8ZA 2JA7B 2LFNA 1B3QA 3NSWA 1MJEA 2N78A 5M5XH 1PZKD 2EQSA 5C5MA 5CV6A 2EZVA 2KCTA 3NQIA 2OT2A 1NUCA 3H3VH 2A6EC 1E7ZA 4I7ZC 1PZID 4DK6C 3KDFA 5IE8A 4RG1A 2N88A 1H95A 4BBRH 2DJGC 4X64L 2KEDA 4IPCA 1ENFA 2EYLA 2JSOA 4CKEA 5FKAC 1HQMC 4HIDA 1XPRA 3K59A 4JI5Q 1F77A 1VQDA 4FP5D 1JQYD 3ND8A 1D1KA 1U4MA 2SNSA 4UDUC 1AN8A 2Z1CA 1KLUD 2VL6A 3S1MB 1OO9B 3RZOH 3RD4A 4C1NI 3SR1A 3BG3A 1X3PA 1JWMD 3K0YA 3MXNA 3MXPA 2XNAC 3TREA 2NB0A 2HDLA 2K50A 2ZM6L 5I4DA 5IP7H 5JVH3 2HD3A 4LFAQ 4F7XA 2AWOA 3DUZA 1EEID 1JR0D 1HNZQ 5KNCA 2M9VA 4RHSA 4X6AH 1N8RC 4JI0Q 1V1PB 1G2SA 4JI0L 2B2YC 1MBYA 1PH7A 4OO1H 3GTJB 3MTSA 2KUMA 3M3YB 1B70B 3NQTA 2QDLA 4R4CA 1IBMQ 2TMPA 2JEAI 3DXJC 3N52A 5ELBA 4KI0A 2LKVA 2X69A 1K0SA 2Q8IB 3U50C 4DAMA 1G291 2DNCA 3STBD 3C2PA 3FMCA 5IGEA 3N6RA 2K6AA 1VQFA 4AIMA 1WTWA 3D6CA 3PIPA 2G9DA 1SYFA 1EWCA 2EOTA 3X3NA 1LT5D 1VF7A 1EYGA 4HIMA 1C8CA 1K28A 3GO5A 1K3BC 2ZXOA 3J7A5 4P72A 5C4JH 2B63G 2ZTDA 1BF4A 4ALPA 4KHPQ 3K6OA 4LF7Q 3CCQA 4KHPL 4LF7L 2UUCQ 1UWVA 3MXUA 1Q8IA 5M5YB 4GOPA 5IP9G 2JXMB 4JBWA 3MAQA 5C5LA 1R9TB 2Z4HA 1STGA 4GLXA 1ET6A 2Z0SA 4HSVA 3NWTA 1ET9A 1N32Q 2UXDQ 1CT1D 1N32L 4ZUIA 4DNTB 2PYKA 1SFOH 2K04A 2PMZE 3U58A 3HOXB 1TWGH 1BO0A 3BZCA 5C44B 1BBUA 5KGUA 4B3TQ 3W1GA 3K7AB 4LFCQ 3D4DA 3A7AB 1I4XA 4B3TL 4LFCL 3HKZG 1RTNA 1LT4D 4LK1C 1O80A 5C6AA 3J81E 2JA9A 4K0KL 1T5EA 2F3VA 3GD7A 4DA2A 3E9HA 4UP7A 3S1QB 1AZQA 4XQJA 2ASBA 5D65A 1Q1BA 3K8AA 1X3GA 2RSOA 1BCPC 1MD2D 3S2DH 3UE0A 2K4KA 3F2BA 4NXMQ 1UNSA 1MGSA 4L6TB 1EIYB 4C3JH 1PA6A 2A68D 3BZDB 2F0OA 1CTMA 1A3UA 2KENA 4HCSA 3E3XA 4C3JG 5ELFA 1J5EL 4CBVA 4KTAA 2Y0SE 1MHWC 2PQEA 3ITPA 1VS0A 3PUZA 2EIFA 4OWTB 1PTOB 5FO7B 4PV1C 5BN5A 1HZ9A 4YIJA 2VNUD 4DR6Q 1JOKA 3CCLA 1JJCB 3D0FA 4DR6L 1XMOQ 3ULJA 2O5IC 4F88A 1DGSA 3S24A 2ID0A 1NSNS 2V1CC 1H9RA 2JYOA 4YCWA 3CPWA 4DK3C 1MSHA 4ZUJA 3TN2A 2SEBD 2X6LA 4BY1H 4X62Q 2WAQG 1NNXA 3S1NH 1PLFA 5FJ8H 2FFKB 4L63B 1LLRD 1FL0A 4BY1G 3T51B 1YZ6A 4J15A 3RMHA 1TIID 3CCUA 3SGIA 3MHBA 2H5XA 1ASZA 2ATWA 4EQNA 1VQ5A 3RZDH 3I4NG 3A56A 2I5LX 2J4XA 1KAWA 1YNJC 3QR8A 4BWGB 5I6YA 2O4XA 1E0BA 3I4LA 2ICIA 2CKZB 4X3SA 2B2VA 4QJFA 1NBWA 4NPSA 2HQLA 5KYIA 4ODGA 5E1FA 4EQPA 2VS1A 3DM1A 5JJLA 1Q8KA 4KD4A 4QIWE 2E2JB 4PZ6A 1PRTC 2R92B 2AWNA 5IYDG 1SE8A 4YCUA 5C0XI 4LW1A 5IT9c 4DV5Q 1U9RA 4KY5A 4A3MH 1HH2P 3TQYA 1XPUA 1Q46A 2LY7A 1YITA 1K8AC 2RDGA 5G3LF 3WWVA 4R4OA 5DLQE 1IYJB 3PGZA 5IIFA 3JAMc 1U4RA 2Q8RE 2LS01 2HQEA 1T9HA 4C3HH 1I4QA 1QZGA 1X3EA 1F9RA 1V1PA 2NWGA 1HFNA 4HN7A 3H09A 3A7LA 4IZ8A 2F0VA 1DOMA 4FYDA 2F03A 2RDHA 1EWHA 3HOYH 1GKHA 3FPPA 3FVQA 4JI8L 5K36G 1PYWD 4HR7B 2GVAA 4A75A 1F9SA 3HOYG 1EZ8A 2JEBI 1K73C 1LUZA 2Q2IA 1QUQB 4GKJQ 3VYTA 2K5WA 2L5TA 3BYTB 1PFSA 1TS2A 5EKIA 1I4PA 4JCVE 3L7ZC 4KY7A 1XNQL 1VF5C 4CJ0B 4GS3A 4JI1Q 2NVTH 1VQKA 4L5RC 3RLNA 4IPDA 4ZKBB 5KNDA 1SNCA 1LTAD 3Q8DA 1UE7A 3LNNA 4DV0Q 3OWEB 2R7DA 5FO9B 2V4DA 2F52A 2H4OA 3STBC 4F8MA 2L55A 2ZT9C 4LF4L 1RDPD 3K5MA 1N36Q 3E5SA 2A5HA 2MO1A 2KHJA 4CDCC 3GTOH 4OL7A 5M3FH 1AW7A 5FLXc 2BDNA 3I56A 5M3FG 4AYBG 1H9SB 3EJIA 4X65Q 1Q1EA 1WFQA 4RAUC 4PMWA 1I94L 1SNQA 4Z9CB 4IQZA 4O2DA 1A6XA 2RVLA 1VQ7A 3KJPA 2B63B 3S1MH 2VQFQ 3H15A 5C3EH 1XPOA 1WTHA 5E3FA 1M1KC 5C4JB 5M5WB 2NTSA 5KEEA 5C3EG 1N33Q 3PF5A 3KOJA 5GAGC 5C0XH 5I9PA 2WKCA 2Z6KC 3HG9A 4POFA 1ESFA 1WTQA 5ISRA 2C35B 1SYBA 1YEZA 5GAHC 5C0XG 4L5SA 1G91A 4A3IH 1DJRD 5C4XG 4UPAA 1NMGA 1KL9A 1A8VA 2PQAA 3MA2B 1B1ZA 3CF5A 5A2QL 1SFOB 1IBLQ 3IL8A 4UHVA 2JA8H 1IKLA 3HKZB 1TWGB 2K75A 3GTJH 2OTLA 1GHJA 2HUGA 1DOKA 1DYQA 3M3YH 2B8GA 3PUYA 4CDDC 3MEFA 2KCCA 3FP9A 3J7YW 1TWAB 3D31A 1LV9A 3M7NA 1MI2A 3UI2A 4ZKCB 3CRKC 4QCLA 1KDBA 2A68C 4DR5Q 1U4LA 1ZXTA 3NELA 4HJ5A 3R2IA 5EPJA 3RLFA 4A4IA 4IN3A 4B3ML 4LWCA 3S2DB 4JBMA 1X32A 1PTOC 4C3JB 4RWSC 5I6WA 4U68A 1F2YA 5EBCA 1PH3A 2E2HH 4CDFC 3OW7A 2D5DA 1Q81C 1EWIA 2FMCA 1IL8A 3G6JB 2N49A 1YHQA 3J81i 4K2LA 4G7OC 3NEMA 1RODA 2L9HA 3C3LA 1A63A 2A69C 2XRSD 1B44D 3V96A 1UUPA 1Y1WH 2WAQB 3HOXH 2WB1G 4BY1B 1Y1WG 4RMFA 4B9WA 2NZ1D 1VQBA 5CMDA 4DV4Q 4DKAC 1Q90A 1A15A 3D4RA 2HT1A 3W2DA 2UU9L 3PMFA 2CH4A 1I6VC 1VQGA 1YBYA 3RZDB 1JC7A 3HRZC 3PIOA 3GTPH 2VB2X 4LF5Q 1M4VA 3MFGA 4K6DA 1STEA 4PZ8A 2K5DA 3LWUA 4XQNA 3G6EA 1BCPF 3S1RH 2N55A 4BY7H 1CQVA 4JI4L 3AEVA 2AQ1B 3VR6A 1YI2A 1PZJD 2PW5A 5CGKA 4BY7G 5JAVA 3GV6A 1FD7D 2MNAA 1B50A 1QUQA 1TXYA 3DHQA 4B3RQ 1KXLA 5C4HA 1TU2B 2MO0A 4MIUA 4JI6Q 1Q3LA 4GOPB 1X6OA 1QNUA 2EPBA 2MUYA 1TQOA 4A3MB 1GM5A 4HTHA 3CD6A 2K52A 2ZJPA 4KY6A 1MIUA 4G7ZC 1VQIA 3GTGH 1A3VA 3M4QA 4DV3L 1D1IA 1QILA 1RKNA 3T13A 1OXSC 3BVZA 3F8TA 2B29A 2F0QA 2NZHA 1EQRA 2B2TA 3ERSX 3TSSA 2MPMA 1D6EC 4DV2L 1OXTA 4NB3A 5IGCA 1XMQL 1HTLD 4JI7L 1F2LA 4JYAQ 1FYCA 2JN4A 2EY1A 3GTQB 3CAMA 1AFPA 1K0RA 3HOYB 3U4ZA 1JB3A 3HOUH 4IPGA 4QB4A 4A93H 4QL5A 4FDBA 5IGFA 1I4HA 3Q22A 3CKIB 3OMGA 3TP7A 5J3BA 4DN4M 4XTCS 3H91A 3HOUG 4DAYB 4A93G 1PH9A 4IJHA 2K14A 2AQ2B 2XVSA 5LMUL 3BZKA 2CFMA 5JVG3 2F0KA 2SNMA 3VDYA 2EYOA 4KKTA 1UE1A 5H1SE 1E2WA 3T56B 1YNJD 3IKJA 4MTKA 1PRTF 2R92H 2EY2A 4A3LH 4C2MH 1VQHA 3OIPA 2ENBA 3QIAA 1ESRA 2F3WA 2R7FA 3T53B 4DV7Q 1IKMA 1GHKA 1PXUA 3C1FA 3PV0A 4WORA 3HOWH 4ZK9B 2EYHA 4V0BA 1ICFB 3K58A 3W3AA 2L11A 4IOCA 4YY3Q 3D4WA 1HXYD 3HOWG 5BR8Q 3TP5A 5BR8L 5KYLA 3NTHA 2OCEA 1Y14B 1B7YB 5FLMH 1I50H 5LMNQ 3HOVH 4N8X1 3KLWA 1SMYD 1FGBD 5FLMG 3OYYA 3GTOB 1JWSD 1HRJA 1ML0D 3EROA 5J39A 5M3FB 2Q2HA 4AYBB 3HOVG 1Z47A 5CR3A 1EZ6A 2JE6I 1MKHA 3EA6A 3J80L 1HA5A 2YV5A 1L1OB 1FNVA 2ZTEA 1B3AA 3SK5A 2BH8A 3FKIH 4KLKA 2M00A 3GTMB 4JI5L 1RTOA 5C3XA 1D5ZC 3FKIG 3V05A 3CRLC 1I3QH 1Y8OB 5C3EB 4CGYB 2K5QA 4IUTA 5KIXA 2CCZA 1TWFB 1LT6D 3F1ZA 4ULLA 4C56C 1VQ8A 5FLXL 3ND9A 4RH6A 3BJUA 5C4XB 2M2LA 2PNHA 4LFAL 4A3IB 1HZAA 1O7YA 3I73A 1BKBA 4HCEA 3U4VA 1S72A 1CHPD 3Q24A 1HNZL 3ULPA 2A8VA 2A74C 2YTYA 4CKBA 2JA8B 3HS0C 3CCEA 4NXNQ 2IJ0A 4H7BA 3HOZH 2KQ3A 1Q86C 4YCVA 1C9OA 4DR3Q 4DR3L 1PFNA 4WJ4A 4ZYSA 3T4AC 3HOZG 1IBML 1C7YA 4LF6Q 2F0FA 1DCZA 1HR0Q 2E5LQ 4B9XA 2E5LL 5A2QE 3I91A 4JI3Q 3OIQA 2K05A 4DNIA 1L2FA 4LF8Q 1TWHH 2EYJA 2K01A 2QCPX 1VQMA 5FK9C 3Q0AA 3CC4A 4TQUS 4JOIA 2B63H 2UUAQ 5DAUA 3T1YQ 3R93A 4HSPA 2WV6D 1EYDA 5M5WH 1J9OA 3SEBA 4L8JA 1VQ6A 3KLSA 1EOTA 2E2HB 2PI2A 4OXPA 2C5CA 3SXHA 1PH4A 5IP9H 1K83H 2UUCL 2WFWA 4LF9Q 2IL8A 4BBSG 4PMBA 3KBXA 2NVYH 1SYEA 3QO2A 1EY8A 4EQ5A 3I4MG 4UP9A 1E1OA 1K9MC 1SR3A 2WB1B 4O42A 1WI5A 3D6WA 1Y1WB 1B53A 2UXDL 2NZOA 1DXMA 2SDFA 4L5QA 1S40A 2ICEC 2PZTA 4ILWA 1YJ9A 4DPGA 1N34Q 2IX3A 1NTGA 1VQEA 5I2YA 1TWAH 2IHFA 2K32A 1O7IA 4GKKQ 1S5CD 2AUJD 1KDAA 5JJIA 2KVMA 4N9PA 5LL6S 4DAVA 1SNPA 2YU9H 4QQBX 3GTPB 3M4OH 3UDIA 1KC8C 4HJ9A 2EDGA 2PZWA 2Q2TA 3S1RB 3NTIA 1SDFA 4BY7B 4GOPC 3T1HQ 1V8QA 4DAYA 4NXML 5DM73 1XXGA 1QOHA 4MNOA 5EAYA 1Y1VG 2E75C 3PO3H 1STNA 4FF3A 4AQYQ 1G6ZA 4DU9A 5COYA 4B3SQ 2FHTA 4A3KG 1HNWQ 2KECA 3PO3G 3CCSA 4F87A 2J0TD 4G7HC 3GDEA 1PTOD 1EL0A 2H1EA 1PH8A 1X9NA 1WTRA 4UY8C 2HCCA 2PQAB 4MN3A 4X3TA 1XMOL 1D2BA 5D3IB 2VQEQ 3J7AF 3GTGB 4QF4A 2VQEL 2XRQD 4RFBA 5EPKA 2G9HD 2D62A 4X62L 2KEEA 4CKCA 1PYBA 2MGSA 5HURA 1K3RA 1N9WA 2Z6BA 1HZBA 3QJYA 3I4NH 3DWAA 2A69D 4A3BG 2N3SA 5C0XJ 2A19A 1KNAA 3HOUB 3U9OA 4A93B 1GUWA 5M9OA 3F2DA 1QB5D 1EYAA 2F0GA 3ULLA 1L1OA 4DK0A 2IT1A 3VR5A 1F2ZA 1VQLA 3SK6A 1S5FD 3CCVA 4X3UA 4GN5A 3IFTA 1ILQA 5IODA 1DM0B 3S9WA 2FINB 1UE6A 5IYDH 4KHVA 1BBWA 2R3ZA 2IWHA 1OXXK 5IT9E 1U0LA 4HMJA 1TS3A 3OW2A 4C2MB 1CA6A 2EVBA 1O78A 4R4IA 1SYDA 3QG1A 4DV5L 4JC0A 4X3KA 4KN4C 2F0JA 1TKWB 1SN8A 1GJXA 3JAME 4KKUA 3TBIB 1DZ1A 4DUYQ 1SMYC 2N8NA 3HOWB 3MEHA 1Y8NB 4PG3A 3CP0A 3PUWA 3KF6B 1BQQT 4H13C 4XIGS 1BNZA 1PFMA 3P75A 2K5HA 5FOBB 1L1OC 5ELOA 3BDCA 2A6HD 2MP1A 2QGQA 4BS9A 2BDOA 2B2VC 2QF7A 3NXWA 1V9PA 1I50B 3I2ZA 1JORA 1STAA 2AKWB 2QKIC 5D14A 5BN4A 3HOVB 3CMEA 1NY4A 5CBAE 1EY5A 3W5OA 4R8NA 5JJKA 3NBHB 4S3SA 3GTQH 5K36H 5C4ZA 5E4WC 2KA7A 1TS5A 2Y0SG 1SSOA 1WOCA 4DR2Q 4KD3A 3BS1A 4DR2L 4XT1B 5I2XA 3VYSA 3LWEA 3CCMA 3I4OA 1B4OA 1M8AA 3S15H 1C0AA 2L1BA 1S4ZA 2VZAA 3FKIB 1Y69U 2R93H 4DAPA 2BE5C 4RKBA 2R93G 4GKJL 1W3SA 1I3QB 3DEOA 2D0OA 2RF4A 1PV4A 1DD2A 2FJ2A 3PIO3 1GUTA 3B6YA 1Z6HA 3J80c 1YHAA 4JI1L 1FR3A 4A3FG 1QZHA 3V2TA 3CMAA 2MFIA 1QNKA 5TSSA 5HGQA 3CC7A 2KOLA 3RLOA 4DV0L 3A74A 1S5DD 3I7FA 1XJVA 3VR2A 5JPMC 4J6HA 4DXFA 1N36L 3HOZB 1A0IA 1CK1A 4C1NK 5CV4A 2GA4B 3KK7A 5FLXE 2RDFA 3M85A 3KF8B 1SBBB 4LNQA 2D9UA 3A54A 3VA5A 2P5ZX 1JJGA 4UAIA 3AQQA 4O1NA 2NVXB 1BBXC 1YJWA 5IGBA 2RBMA 4NMZA 2CQAA 5E4XA 3TEHB 5ELEA 4DGZA 2RHQB 3AFQA 4N9TA 4X65L 2EYFA 4DFAA 1H9JA 4DUZQ 4A3GG 3GP7A 1A2UA 4NP5A 3GTMH 1CSPA 1TWHB 2CW0D 2QILA 2UXCQ 5CORA 2UXCL 4K14A 4QMGA 1LTGD 1LACA 3SE0A 1AZPA 1E1TA 1SJED 2OQKA 4PNYA 1V43A 3TZUA 4EX5A 2VQFL 1S3OA 1EY4A 3EBEA 5EQ0A
chains in the Genus database with same CATH topology
5T1GA 4BBSB 4RGMA 1GUSA 4WRDA 1S5BD 1K83B 2F0LA 3A55A 3KUPA 2NVYB 4FVMA 4M1UB 1CZGA 3URYA 3KBGA 4HAEA 2EE1A 4PMCA 1JOQA 2E74C 2Q8TA 5KRUA 1KDCA 2OEOA 3PUXA 2HDMA 1WD1A 1RCVD 5CYUA 4G57A 3WOEA 2YU9B 3OOCA 2AUKA 3M4OB 3FEWX 2XWBB 4RKLA 3MC0B 1DONA 1Y1VB 4RGTA 1C4QA 3Q23A 3NTKA 3MZ5A 3I3CA 2F0HA 3PO3B 2F0IA 4MHEA 3QOJA 1KTKA 2NN6I 2NTTA 3NUCA 3Q6SA 4EVOA 1JE4A 5LL6X 2QEJC 1CQFA 4QUCA 3AU7A 1TY2A 2PW7A 4DF7A 3R3OA 1EYCA 3DEPA 4LJZC 3QWNA 4PQXA 1NCVA 1BUVT 1E2VA 3TZDA 1TS4A 3I4NB 4A3BB 1LTBD 2L4NA 4ZRZA 4B08A 3J81L 1BOSA 3K5NA 1VMCA 4XQQA 1PMRA 3NBHA 4FF4A 1H9KA 1IHZA 1EIHA 1ENCA 4DXGA 2NYZD 2RQXA 4QUFA 2I46A 4FF1A 2PMZB 1F2MA 4JK1C 3QB3A 2Z8LA 2R61A 4IUPA 5CV8A 4IFDJ 1Z7TA 4C3IG 3VYUA 2A6HC 1CA5A 1K8MA 2WKDA 5EGTA 5EPLA 3P1HA 2IW3A 2EJGC 3PIP3 3H3VC 3BYYB 1OXVA 1MSGA 3S2HB 3MWYW 4FXGC 4ID6A 1L0YB 3F2UA 3A8JE 2DNEA 1WTVA 1QCBD 4IFDI 4IALA 1LTRD 1C48A 5FO8B 2Y0SB 3KF8A 3BVMA 1R4PB 2BA0A 2E76C 4ZLTF 4OO1I 5I9OA 3D3RA 5JEAG 3S15B 1ZYRD 2R93B 2WP8J 1LT3D 1HFGA 4KN7C 2EYMA 2B2WA 4NW2A 4KHZA 4XYQA 3AMUA 1I4RA 1SNMA 2B2TC 4BA2I 3BVGA 3EVQA 1CZWA 1WVLA 1Q12A 1WTOA 2NN6G 2D2CC 3FPUB 1F9QA 2O2LD 3D8GA 2K33A 2F0EA 1II3A 1A2TA 1RD9D 4CJ2C 1RJTA 2VXWA 4IUVA 1V1OA 3HGBA 3P20A 5DNFA 2NVQB 3NP8A 1XTCD 1TVXA 2F0UA 4QIWB 1RF2D 2CW0C 3P7JA 2B2UA 1CI3M 3NK9A 4K5VA 3K57A 4FO2A 4A3GB 2LMCB 1PRTB 1EU3A 2AQ3B 3SK8A 1L0XB 3HEJA 4FXKC 4TKOB 1TY0A 2K7VA 3ZYYX 3A8KE 3L3OC 1RHPA 3I70A 1O7LA 2DN8A 3FDTA 4XT3B 1VCIA 5T1IA 2A73B 2WIIB 4RA8A 4RGOS 3FRPB 2KCNA 1CFMA 2B2UC 4K2KA 2B2YA 4RGNA 2BE5D 4OHJA 1T5XD 4Q0FA 4RCOA 4Y7NB 4HEDA 1SNDA 5D3DA 2F0PA 3E6ZX 3S17B 2CVRA 4EGVA 4IFDH 2EY6A 1KLGD 4IFDG 3TP8A 5C3WA 1SJHD 3MXGA 4WFN3 3VA7A 4KMUC 2DY7A 5CC4A 5BN3A 4OO1G 1W6KA 5DM63 1HUMA 1UEAB 3SDZA 4FNFA 2F0NA 5CBEE 1JOOA 2XWJB 2BA1A 4KV6A 5LHY1 2R6GA 1UAPA 3R2TA 3CU7A 5AFWA 4R9WA 2PZUA 4KK7A 1GXDC 3IAYA 1LTSD 4K8IA 1SYGA 3DWQA 1J8IA 2WACA 4HMIA 1H9MA 4OIJA 4P2CB 1O7ZA 1S5ED 1HQRD 2L12A 5JJZA 3DWPA 2IX1A 3KLRA 2R7ZB 2E2IB 3OSOA 1FNWA 4CJ1B 3L9AX 3GTLB 1I6HB 1SAPA 3NPPA 4K8JA 2XSCA 4M8AA 4ZQ3A 2OF1A 4A3EB 1PTOF 1W6JA 2XN9C 4LAAA 2OXPA 1B9MA 4K5WA 4C3IB 2F4IA 4H0LC 1A3TA 1EEFD 1B2TA 1AEXA 1SE2A 1YNND 2PCFB 2EY5A 3AB9A 3GQBA 4DNRB 3I72A 5EKLA 3IFDA 4RCNA 3MFYA 1EY9A 1BDOA 5CV7A 3H94A 1R4QB 2I07B 4ABNA 1VDZA 1SE3A 1ZYRC 4FF2A 2F0WA 3GV3A 3CHBD 1HHVA 4WJWA 5A35A 1LTTD 4FXDA 2CHBD 1SNOA 5DEHA 2K28A 1NR4A 1ILPA 5EKKA 1XWEA 1QE6A 1G8ZD 2NUCA 3U9SA 2KHSA 1DOLA 4DK1A 2F0DA 3E0JA 1EQVA 1SYCA 4NKLA 5M3MB 1AP0A 1E2ZA 2Z4IA 3PO2B 5F2DA 3OWFA 4XDXA 2PO4A 3H6MA 5CV9A 1G2TA 4NDXA 3ERQA 4A3DB 2VUMB 5JPNC 1EY7A 4K5XA 2ZXRA 1QJOA 2F0MA 1HCZA 1GUOA 4RHRA 2ZXPA 1XYIA 1ZEQX 3ONAB 5KNBA 3NWSA 3DMUA 3H0GB 4R8IA 1QWYA 2PNRC 1LO5D 1OXUA 1STHA 5M5XB 4C3HG 5G3LD 2IX0A 1B9NA 3BDOA 3G7LA 3J80E 1IYUA 3SK4A 3LX0A 3R8BA 3EQLC 4BBRB 3TDQA 2C9OA 1LABA 2MHVA 1PDQA 2JA5B 1EU4A 2BOSA 3T16A 3RZOB 5ELCA 2K1BA 2L0CA 3NBIA 3O13A 3NHHA 1D5MC 2J7ZA 1SXTA 1EQTA 1KNEA 4TSSA 1BXTA 2B8FA 1VMPA 2EYPA 4U673 5CV5A 2NBFA 1TT2A 3VR3A 1IW7D 2JA6B 2JP1A 2SOBA 3MVVA 2EJFC 4IUNA 1HTPA 1WTXA 1JWUD 4IUUA 3NE5B 1U4PA 4BA1I 1FNUA 2HCIA 1K8OA 4KJOA 3I4MB 5J22A 2IPKD 2F0SA 2A6ED 3S16B 5JEAJ 4CHTB 3M4YA 4KJNA 4K6LA 2BCOA 1CM9A 3K5OA 5IGDA 3WDNA 1KAAA 1WD0A 2MJ8A 1SE4A 1STBA 1Y8PB 3GTKB 1ONLA 2VB3X 3VYRA 2YYZA 3RUZA 5IGGA 4V190 4XYOA 3QOLA 1YNNC 1ZKOA 2K03A 3PUVA 4OGQC 1F9PA 1NAPA 4A3KB 3EFXD 1X3QA 2X6GA 1STYA 5ELDA 1EIGA 4XXEA 2EJMA 3SVMA 2F1MA 3C46A 1JCKB 1EY6A 2FMMA 4ME5A 3VR4A 4TRDA 1GOZA 4G4KA 1ICWA 3X3MA 2B39A 4H44C 1JICA 5EJWA 5K5PA 1HPCA 4OIKA 1QG7A 1I4GA 1BR9A 2EXZA 2KJXA 3S1NB 3WOFA 3OHXC 4J8QA 4J1MA 3BDLA 2RSNA 1TWCB 4LMQD 2RKSA 4A3JB 3I90A 4IUQA 3TP6A 2WINB 2PPBC 4KKSA 1IYVA 1HA6A 2O5JC 3HP3A 1BCPD 1BCPB 2F0TA 4IURA 1PTOH 1SEBD 1EY0A 2XIWA 2DY8A 1LTID 5EBDA 1TR5A 5JOBA 5JEAH 4I65A 4EQOA 4C3HB 2E2DC 4GZYC 1GUNA 2TSSA 3OMCA 5NUCA 3C1EA 4E6IA 3S14B 1CHQD 3CQZB 5IT9L 4A3FB 2NN6H 4Q5VA 5HGTA 3K5LA 1H9SA 4ZAIA 1PFBA 3A8IE 1ENAA 3JAML 1EFID 3TMEA 3J7AV 3OPOA 3M7GA 3SHLA 1D5XC 2NVTB 1GUGA 5IOCA 2RA4A 2QDBA 1KABA 1IW7C 5J1ZA 1HUNA 1WCMB 2B2WC 3HZXA 1WTPA 3KLSX 1XX8A 1PRTD 1NR2A 3I8ZA 2JA7B 2LFNA 3NSWA 1PZKD 5C5MA 5CV6A 2EZVA 3NQIA 2OT2A 1NUCA 2A6EC 4I7ZC 1PZID 2N88A 2KEDA 1ENFA 2EYLA 4CKEA 2JSOA 5FKAC 1HQMC 3K59A 1F77A 4FP5D 1JQYD 3ND8A 1D1KA 1U4MA 2SNSA 4UDUC 1AN8A 2Z1CA 1KLUD 3S1MB 1OO9B 3RD4A 4C1NI 3SR1A 3BG3A 1X3PA 1JWMD 3K0YA 3MXNA 3MXPA 2XNAC 2NB0A 2HDLA 5I4DA 5JVH3 4F7XA 2AWOA 3DUZA 1EEID 1JR0D 5KNCA 2M9VA 4RHSA 1V1PB 1G2SA 2B2YC 1MBYA 4OO1H 3GTJB 3MTSA 2KUMA 3M3YB 3NQTA 2TMPA 2JEAI 3DXJC 3N52A 5ELBA 4KI0A 2LKVA 2X69A 2Q8IB 1G291 2DNCA 3C2PA 3FMCA 5IGEA 3N6RA 2K6AA 1WTWA 3D6CA 2G9DA 1SYFA 1EWCA 2EOTA 3X3NA 1LT5D 1VF7A 1C8CA 3GO5A 2ZXOA 1BF4A 3K6OA 3MXUA 1Q8IA 5M5YB 2JXMB 4JBWA 3MAQA 5C5LA 1R9TB 2Z4HA 1STGA 1ET6A 4HSVA 3NWTA 1ET9A 1CT1D 4ZUIA 4DNTB 2PYKA 2K04A 3HOXB 1BO0A 5C44B 5KGUA 3K7AB 3D4DA 3A7AB 1I4XA 1RTNA 1LT4D 4LK1C 1O80A 5C6AA 3J81E 1T5EA 2F3VA 3GD7A 4DA2A 3S1QB 1AZQA 4XQJA 5D65A 1Q1BA 2RSOA 1BCPC 1MD2D 1UNSA 1MGSA 4L6TB 2A68D 3BZDB 2F0OA 1CTMA 1A3UA 4HCSA 4C3JG 5ELFA 4CBVA 4KTAA 2PQEA 3ITPA 3PUZA 5FO7B 1PTOB 4PV1C 5BN5A 4YIJA 2VNUD 1JOKA 2O5IC 4F88A 2ID0A 1NSNS 1H9RA 2JYOA 1MSHA 4ZUJA 3TN2A 2SEBD 2X6LA 1PLFA 2FFKB 4L63B 1LLRD 3T51B 3RMHA 1TIID 3MHBA 4EQNA 3A56A 2J4XA 1YNJC 4BWGB 5I6YA 2O4XA 1E0BA 3I4LA 2ICIA 4X3SA 2B2VA 5KYIA 4ODGA 5E1FA 4EQPA 3DM1A 4KD4A 2E2JB 1PRTC 2R92B 2AWNA 5C0XI 1U9RA 4KY5A 2LY7A 2RDGA 5G3LF 5IIFA 1U4RA 2Q8RE 2LS01 2HQEA 1I4QA 1F9RA 1V1PA 2NWGA 1HFNA 4HN7A 3H09A 3A7LA 4IZ8A 2F0VA 1DOMA 4FYDA 2F03A 2RDHA 1EWHA 3FPPA 3FVQA 5K36G 1PYWD 4HR7B 1F9SA 1EZ8A 2JEBI 3VYTA 2K5WA 2L5TA 3BYTB 1TS2A 5EKIA 1I4PA 3L7ZC 4KY7A 1VF5C 4CJ0B 4ZKBB 5KNDA 1SNCA 1LTAD 3LNNA 3OWEB 5FO9B 2V4DA 2H4OA 4F8MA 2L55A 2ZT9C 1RDPD 3K5MA 3E5SA 2A5HA 4OL7A 1AW7A 2BDNA 1H9SB 3EJIA 1Q1EA 4RAUC 4PMWA 1SNQA 4Z9CB 4IQZA 1A6XA 2RVLA 2B63B 5E3FA 5C4JB 5M5WB 2NTSA 5KEEA 5C0XH 5I9PA 2WKCA 3HG9A 1ESFA 1WTQA 5ISRA 1SYBA 5C0XG 1G91A 1DJRD 3MA2B 1B1ZA 5A2QL 1SFOB 3IL8A 1IKLA 3HKZB 1TWGB 1GHJA 2HUGA 1DOKA 1DYQA 2B8GA 3PUYA 2KCCA 3J7YW 1TWAB 3D31A 1LV9A 3M7NA 1MI2A 3UI2A 4ZKCB 3CRKC 4QCLA 1KDBA 2A68C 1U4LA 1ZXTA 3R2IA 5EPJA 3RLFA 4IN3A 3S2DB 1X32A 1PTOC 4C3JB 4RWSC 5I6WA 4U68A 1F2YA 5EBCA 3OW7A 2D5DA 2FMCA 1IL8A 3G6JB 4K2LA 4G7OC 1RODA 2L9HA 3C3LA 2A69C 2XRSD 1B44D 3V96A 1UUPA 2WAQB 4BY1B 4B9WA 2NZ1D 5CMDA 1Q90A 1A15A 3D4RA 3W2DA 3PMFA 1I6VC 3RZDB 1JC7A 3HRZC 2VB2X 1M4VA 3MFGA 4K6DA 1STEA 2K5DA 3LWUA 4XQNA 1BCPF 2N55A 1CQVA 2AQ1B 3VR6A 1PZJD 2PW5A 5CGKA 5JAVA 3GV6A 1FD7D 1B50A 3DHQA 5C4HA 1TU2B 4MIUA 1Q3LA 2MUYA 1QNUA 2EPBA 1TQOA 4A3MB 4HTHA 4KY6A 4G7ZC 1A3VA 1D1IA 1QILA 1RKNA 3T13A 1OXSC 3BVZA 2F0QA 2B2TA 3TSSA 2MPMA 1D6EC 1OXTA 5IGCA 1HTLD 1F2LA 1FYCA 2EY1A 3GTQB 1AFPA 3HOYB 1JB3A 4QB4A 5IGFA 1I4HA 3Q22A 3CKIB 3OMGA 3TP7A 4DN4M 4XTCS 3H91A 2AQ2B 2XVSA 5JVG3 2F0KA 2SNMA 2EYOA 4KKTA 1E2WA 3T56B 1YNJD 3IKJA 1PRTF 2EY2A 3OIPA 2ENBA 3QIAA 1ESRA 2F3WA 3T53B 1IKMA 1GHKA 1PXUA 3C1FA 3PV0A 4WORA 4ZK9B 2EYHA 4V0BA 3K58A 3W3AA 2L11A 3D4WA 1HXYD 3TP5A 5KYLA 3NTHA 1SMYD 1FGBD 3GTOB 1JWSD 1HRJA 1ML0D 3EROA 5J39A 5M3FB 4AYBB 1Z47A 5CR3A 1EZ6A 2JE6I 3EA6A 3J80L 1HA5A 1FNVA 1B3AA 3SK5A 2M00A 3GTMB 1RTOA 5C3XA 1D5ZC 3V05A 3CRLC 1Y8OB 5C3EB 4CGYB 2K5QA 4IUTA 5KIXA 1TWFB 1LT6D 4ULLA 4C56C 5FLXL 3ND9A 4RH6A 5C4XB 2M2LA 4A3IB 1O7YA 3I73A 4HCEA 1CHPD 3Q24A 2A74C 4CKBA 2JA8B 3HS0C 2IJ0A 4H7BA 2KQ3A 1PFNA 4ZYSA 3T4AC 2F0FA 1DCZA 4B9XA 5A2QE 3I91A 3OIQA 2K05A 2EYJA 2K01A 2QCPX 5FK9C 3Q0AA 4TQUS 5DAUA 3R93A 4HSPA 2WV6D 1EYDA 1J9OA 3SEBA 4L8JA 3KLSA 1EOTA 2E2HB 3SXHA 2C5CA 2IL8A 4PMBA 3KBXA 1SYEA 3QO2A 1EY8A 2WB1B 4O42A 3D6WA 1Y1WB 1B53A 1DXMA 2SDFA 2ICEC 2PZTA 4ILWA 2IX3A 5I2YA 2K32A 1S5CD 2AUJD 1KDAA 2KVMA 4N9PA 5LL6S 4DAVA 1SNPA 3GTPB 2EDGA 2PZWA 3S1RB 3NTIA 1SDFA 4BY7B 1V8QA 4DAYA 5DM73 1XXGA 1QOHA 2E75C 1STNA 4FF3A 1G6ZA 4DU9A 5COYA 2FHTA 2KECA 4F87A 2J0TD 4G7HC 1PTOD 1EL0A 2H1EA 1WTRA 2HCCA 4MN3A 4X3TA 1D2BA 5D3IB 3J7AF 3GTGB 4QF4A 2XRQD 4RFBA 5EPKA 2G9HD 2D62A 2KEEA 4CKCA 2MGSA 5HURA 3QJYA 3DWAA 2A69D 5C0XJ 1KNAA 3HOUB 3U9OA 4A93B 1GUWA 5M9OA 1QB5D 1EYAA 2F0GA 4DK0A 2IT1A 3VR5A 1F2ZA 3SK6A 1S5FD 4X3UA 3IFTA 1ILQA 5IODA 1DM0B 3S9WA 2FINB 4KHVA 2R3ZA 2IWHA 1OXXK 5IT9E 4HMJA 1TS3A 4C2MB 1CA6A 2EVBA 1O78A 1SYDA 3QG1A 4X3KA 4KN4C 2F0JA 1TKWB 1GJXA 3JAME 4KKUA 3TBIB 1DZ1A 1SMYC 3HOWB 3MEHA 1Y8NB 3PUWA 1BQQT 4H13C 4XIGS 1BNZA 1PFMA 3P75A 5FOBB 3BDCA 2A6HD 2MP1A 4BS9A 2BDOA 2B2VC 2QF7A 3NXWA 1I50B 1JORA 1STAA 2QKIC 5D14A 5BN4A 3HOVB 5CBAE 1EY5A 4R8NA 4S3SA 5K36H 5C4ZA 5E4WC 2KA7A 1TS5A 1SSOA 4KD3A 3BS1A 4XT1B 5I2XA 3VYSA 3LWEA 1B4OA 1M8AA 2L1BA 1S4ZA 3FKIB 1Y69U 4DAPA 2BE5C 4RKBA 1I3QB 3DEOA 1DD2A 2FJ2A 3PIO3 1GUTA 1Z6HA 1FR3A 3V2TA 1QNKA 5TSSA 2KOLA 1S5DD 3VR2A 5JPMC 4J6HA 4DXFA 3HOZB 1CK1A 4C1NK 5CV4A 2GA4B 3KK7A 5FLXE 2RDFA 3M85A 1SBBB 2D9UA 3A54A 3VA5A 4UAIA 4O1NA 2NVXB 1BBXC 5IGBA 2RBMA 4NMZA 2CQAA 5E4XA 5ELEA 4DGZA 4N9TA 2EYFA 4DFAA 1H9JA 3GP7A 1A2UA 4NP5A 1TWHB 2CW0D 2QILA 5CORA 4K14A 4QMGA 1LTGD 1LACA 3SE0A 1AZPA 1SJED 4PNYA 1V43A 3TZUA 1EY4A 5EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENC A;  5DEH A;  1KDA A;  1EZ8 A;  4KY6 A;  2EYP A;  3NP8 A;  3P75 A;  4N9P A;  1SNP A;  5CGK A;  2PQE A;  3ITP A;  3BDC A;  2F0U A;  5HGT A;  5CV5 A;  2PZU A;  4WRD A;  5EKK A;  3NXW A;  1A3V A;  2F0L A;  2PZW A;  3NK9 A;  2NUC A;  4K5V A;  4YIJ A;  3NQT A;  1F2M A;  1STA A;  1KDB A;  1JOK A;  1TT2 A;  1RKN A;  3T13 A;  3QB3 A;  5KIX A;  2KHS A;  1ENA A;  5K5P A;  2F0D A;  4NKL A;  1EQV A;  1SYC A;  1NSN S;  2F0Q A;  1EY5 A;  2LKV A;  4K8I A;  4R8N A;  5CV8 A;  4S3S A;  3SK8 A;  2SOB A;  3TME A;  5C4Z A;  4KY7 A;  1SYG A;  4ZUJ A;  1STN A;  3HEJ A;  3MVV A;  5F2D A;  2WAC A;  3OWF A;  4DU9 A;  4HMI A;  5IGC A;  4PMC A;  5IGE A;  4IUN A;  4KTA A;  5EGT A;  3SHL A;  1JOQ A;  1SNC A;  2EY1 A;  3P1H A;  4KD3 A;  5KRU A;  2EXZ A;  3D6C A;  1KDC A;  3H6M A;  5CV9 A;  5IOC A;  1SYF A;  4QB4 A;  2QDB A;  1KAB A;  2OEO A;  5J1Z A;  5IGF A;  3MHB A;  3OSO A;  5I6W A;  3OMG A;  4NDX A;  3TP7 A;  4EQN A;  3ERQ A;  4H7B A;  1F2Y A;  2KQ3 A;  4KJO A;  1EY7 A;  4G57 A;  3HZX A;  4ID6 A;  4K8J A;  4K5X A;  4RKB A;  5J22 A;  2F0M A;  4J1M A;  2F0S A;  2OF1 A;  4ZQ3 A;  4F8M A;  3BDL A;  5I6Y A;  2O4X A;  2F0K A;  3E5S A;  4K2L A;  4LAA A;  4KJN A;  4QF4 A;  4IAL A;  2SNM A;  4K2K A;  2OXP A;  2EYO A;  2F0F A;  4RKL A;  4B9X A;  4OL7 A;  2RKS A;  4K5W A;  5IGD A;  5C5M A;  5CV6 A;  3DMU A;  1KAA A;  2EY2 A;  5KYI A;  1A3T A;  3MZ5 A;  4ODG A;  5E1F A;  3V2T A;  1AEX A;  4EQP A;  5C5L A;  5HUR A;  2F0H A;  2EY5 A;  1NUC A;  1SND A;  1STG A;  3TP6 A;  2ENB A;  1STH A;  2EYJ A;  2F0I A;  3EJI A;  4KD4 A;  3QOJ A;  2F3W A;  1SNQ A;  2F0P A;  1STB A;  4ZUI A;  4B9W A;  3C1F A;  3NUC A;  2PYK A;  4EVO A;  4WOR A;  5I9O A;  1U9R A;  2EYH A;  5DAU A;  4KY5 A;  3U9O A;  2EY6 A;  5M9O A;  3RUZ A;  4J6H A;  5IGG A;  1EYD A;  1EYA A;  2F0G A;  3D4W A;  3LX0 A;  3PMF A;  2EYL A;  5EKL A;  3SK4 A;  5KGU A;  1EY9 A;  3D4D A;  5ISR A;  3QOL A;  1F2Z A;  5CV4 A;  3SK6 A;  2F0T A;  3TP5 A;  5CV7 A;  2RDF A;  3TP8 A;  4K6D A;  5IIF A;  2EYM A;  3SXH A;  2PW7 A;  5KYL A;  5IOD A;  5C3W A;  4DF7 A;  5E3F A;  5C6A A;  3VA5 A;  2SNS A;  1EY0 A;  2F3V A;  3R3O A;  4PMB A;  5KEE A;  2HQE A;  3S9W A;  1EYC A;  1SYE A;  1EY8 A;  5IGB A;  1SNM A;  2RBM A;  4NMZ A;  5I9P A;  4KHV A;  4DGZ A;  3EVQ A;  3ERO A;  1TR5 A;  5J39 A;  2PW5 A;  5JOB A;  5CC4 A;  4HMJ A;  4N9T A;  5CR3 A;  1EZ6 A;  2EYF A;  3SR1 A;  3T16 A;  2F0W A;  1SYB A;  4I65 A;  1STY A;  4DFA A;  5JAV A;  4EQO A;  3MXP A;  3DHQ A;  1A2U A;  3D8G A;  4IZ8 A;  4NP5 A;  2PZT A;  2F0V A;  1SYD A;  2F0E A;  3NHH A;  5C4H A;  2F0J A;  1II3 A;  3OMC A;  4K14 A;  4QMG A;  2F0N A;  5NUC A;  1A2T A;  3SK5 A;  1JOO A;  2F0O A;  4KV6 A;  3C1E A;  4MIU A;  4PNY A;  1EY6 A;  4E6I A;  4F7X A;  1A3U A;  1SNO A;  2M00 A;  3MEH A;  4ME5 A;  1JOR A;  4TRD A;  1EY4 A;  1TQO A;  1IHZ A;  4HTH A;  5C3X A; 
#chains in the Genus database with same CATH topology
 3CPF A;  2BH2 A;  5T1G A;  4YHH Q;  2CWP A;  4YHH L;  4RGM A;  4BBS B;  1TWF H;  1GUS A;  5AJ3 Q;  1YIJ A;  1N33 L;  5AJ3 L;  4WRD A;  1S5B D;  1VQJ A;  1K83 B;  3LGJ A;  2F0L A;  3A55 A;  5C4X H;  3EN2 A;  3KUP A;  2NVY B;  4FVM A;  4M1U B;  1CZG A;  4Y7N H;  3URY A;  3KBG A;  4HAE A;  4P74 A;  2EE1 A;  4PMC A;  1IBL L;  1JOQ A;  3S17 H;  2E74 C;  3ZJY C;  2Q8T A;  3UDF A;  5KRU A;  1KDC A;  3M4P A;  2OEO A;  3PUX A;  2HDM A;  1WD1 A;  1RCV D;  5CYU A;  4G57 A;  3WOE A;  2YU9 B;  3OOC A;  2A1A A;  2AUK A;  4HJA A;  1KQS A;  3M4O B;  3CW2 C;  4JBJ A;  4DR5 L;  2D0P A;  3FEW X;  2XWB B;  4RKL A;  2LXK A;  3MC0 B;  1DON A;  1Y1V B;  1YHB A;  4RGT A;  1C4Q A;  1RL2 A;  3Q23 A;  1YJN A;  1G6P A;  3NTK A;  3MZ5 A;  3I3C A;  2F0H A;  3ICE A;  3PO3 B;  2F0I A;  4MHE A;  3QOJ A;  1KTK A;  3TRZ A;  2OTJ A;  4R1J A;  2NN6 I;  2NTT A;  3NUC A;  3Q6S A;  4EVO A;  2F4V Q;  1G51 A;  2UXB Q;  1JE4 A;  2UXB L;  5LL6 X;  4MZ9 A;  2QEJ C;  3EIV A;  1CQF A;  4QUC A;  4GNX A;  3AU7 A;  3KYH C;  1TY2 A;  4DR1 Q;  4DR1 L;  4ZCK A;  2PW7 A;  2QA4 A;  4DF7 A;  3R3O A;  1EYC A;  2HHH Q;  3DEP A;  4LJZ C;  3KF6 A;  3QWN A;  4H02 A;  4A76 A;  4PQX A;  1NCV A;  3BU2 A;  1BUV T;  1E2V A;  3TZD A;  1TS4 A;  4OEL B;  5IYB G;  3I4N B;  4DV4 L;  4A3B B;  1LTB D;  2L4N A;  4ZRZ A;  4B08 A;  3J81 L;  1BOS A;  3K5N A;  1VMC A;  2E2I H;  4XQQ A;  4LF5 L;  1PMR A;  3NBH A;  1FVI A;  4FF4 A;  3GTL H;  1H9K A;  1IHZ A;  1I6H H;  1EIH A;  1ENC A;  2R7Z G;  4DXG A;  4A3E H;  5L37 A;  1OTC A;  4LUO A;  1SRO A;  2NYZ D;  2RQX A;  4QUF A;  3CXC A;  2I46 A;  4FF1 A;  4A3E G;  2RCN A;  1VQA A;  1F2M A;  2PMZ B;  2G5D A;  2ZTC A;  4JK1 C;  3RNU A;  3QB3 A;  2Z8L A;  4C3I H;  4YWM A;  4PZ7 A;  2R61 A;  4IUP A;  4B3R L;  1FJG Q;  5CV8 A;  1FJG L;  3A5U A;  4IFD J;  1Z7T A;  4C3I G;  4GLA C;  1BVS A;  3VYU A;  2A6H C;  4JI6 L;  4A3C G;  1CA5 A;  1K8M A;  2WKD A;  5EGT A;  5EPL A;  3P1H A;  2IY5 B;  3TS0 A;  2I5M X;  2IW3 A;  2EJG C;  3PIP 3;  3H3V C;  3BYY B;  4DV6 Q;  1OXV A;  4DR7 Q;  1MSG A;  4OX9 Q;  3S2H B;  1X55 A;  3MWY W;  4FXG C;  4ID6 A;  1X65 A;  1L0Y B;  3F2U A;  3A8J E;  3OTO Q;  4OWX B;  2DNE A;  1WTV A;  2UUB Q;  1QCB D;  2UUB L;  3UE1 A;  4IFD I;  4IAL A;  1LTR D;  4LUZ A;  4QY7 A;  1C48 A;  5FO8 B;  4JV5 Q;  4JV5 L;  4JYA L;  2Y0S B;  2LXJ A;  4BXX H;  3KF8 A;  1KHI A;  3BVM A;  1R4P B;  2BA0 A;  2E76 C;  4ZLT F;  4BXX G;  2OWO A;  4OO1 I;  1AH9 A;  5I9O A;  3JAM i;  3D3R A;  5JEA G;  2OQ0 A;  3S15 B;  1ZYR D;  2R93 B;  1UE5 A;  2WP8 J;  1LT3 D;  1HFG A;  4KN7 C;  2EYM A;  2B2W A;  4NW2 A;  4KHZ A;  4XYQ A;  2XGT A;  1EQQ A;  3AMU A;  1I4R A;  1SNM A;  4JI2 Q;  2B2T C;  1XNR Q;  4JI2 L;  4BA2 I;  1A62 A;  3BVG A;  3EVQ A;  1CZW A;  1WVL A;  1Q12 A;  1E24 A;  4DV1 Q;  1WTO A;  2NN6 G;  3AYH B;  4DV1 L;  4DV7 L;  2D2C C;  3FPU B;  1F9Q A;  5M3M G;  2O2L D;  3D8G A;  1IXR A;  2K33 A;  2F0E A;  1AE3 A;  4MTN A;  3PO2 G;  2FXQ A;  1II3 A;  1PH5 A;  4YY3 L;  1A2T A;  1RD9 D;  4CJ2 C;  1RJT A;  4LFB Q;  4A3D H;  2VXW A;  4IUV A;  5ELN A;  1V1O A;  3HGB A;  3P20 A;  5DNF A;  2NVQ B;  3NP8 A;  1XTC D;  4WJ3 M;  1TVX A;  4A3D G;  5LMN L;  2F3I A;  2F0U A;  4QIW B;  2VUM G;  1RF2 D;  2CW0 C;  2L15 A;  3P7J A;  1PH2 A;  2B2U A;  1M90 C;  1CI3 M;  2QW7 A;  3NK9 A;  4K5V A;  1EFW A;  3K57 A;  4FO2 A;  4A3G B;  2LMC B;  1PRT B;  1EU3 A;  3H0G H;  2AQ3 B;  3SK8 A;  4DR4 Q;  1L0X B;  4DR4 L;  2ALY B;  3HEJ A;  4JPB W;  4FXK C;  4TKO B;  1TY0 A;  2K7V A;  3H0G G;  3ZYY X;  3A8K E;  3L3O C;  4R4T A;  1RHP A;  1KRT A;  3I70 A;  3HKS A;  2ZJR A;  1O7L A;  3CCR A;  2DN8 A;  4IJL A;  3FDT A;  4XT3 B;  1VCI A;  5T1I A;  2A73 B;  2WII B;  4X64 Q;  3E0E A;  4RA8 A;  4RGO S;  1UEB A;  3FRP B;  4BBR G;  2Z9H A;  2KCN A;  1CFM A;  2B2U C;  4K2K A;  2B2Y A;  4RGN A;  2BE5 D;  4OHJ A;  1T5X D;  2JA5 H;  4Q0F A;  2DGY A;  1IL2 A;  4RCO A;  3HKZ E;  4Y7N B;  2JA5 G;  3A0J A;  4HED A;  1SND A;  5D3D A;  3PQI A;  2F0P A;  1U5K A;  3E6Z X;  3I55 A;  3S17 B;  4NXN L;  2CVR A;  4HJ7 A;  4EGV A;  4IFD H;  2EY6 A;  2ZM6 Q;  1KLG D;  4IFD G;  2NVX H;  3TP8 A;  1GVP A;  4LF6 L;  3K80 C;  5C3W A;  5IP7 G;  1HR0 L;  3UDG A;  1SJH D;  4JI3 L;  3MXG A;  4WFN 3;  3VA7 A;  1CKM A;  4KMU C;  2JA6 H;  4LF8 L;  2DY7 A;  5CC4 A;  4POG A;  5BN3 A;  4OO1 G;  1W6K A;  2JA6 G;  5DM6 3;  1HUM A;  2UUA L;  1UEA B;  3SDZ A;  4FNF A;  3T1Y L;  2F0N A;  5CBE E;  1JOO A;  2XWJ B;  2BA1 A;  4KV6 A;  5LHY 1;  4BBS H;  1FGU A;  2R6G A;  1UAP A;  3R2T A;  3I4M H;  2WAQ E;  4LF9 L;  3CU7 A;  5AFW A;  3S16 H;  4R9W A;  2PZU A;  4KK7 A;  1GXD C;  5HY6 A;  5GAD C;  1D8L A;  3IAY A;  1LTS D;  1XTD A;  4K8I A;  3J7Z C;  2JQO A;  1SYG A;  2CH4 W;  1N34 L;  3DWQ A;  4N8F A;  1AE2 A;  1J8I A;  2WAC A;  3RR5 A;  4HMI A;  1H9M A;  4OIJ A;  4JOI C;  4P2C B;  1O7Z A;  1S5E D;  3GTK H;  1HQR D;  4GKK L;  2L12 A;  5JJZ A;  4OON A;  3DWP A;  1VQ4 A;  2IX1 A;  3KLR A;  2R7Z B;  2E2I B;  5IY0 A;  3OSO A;  2I0Q A;  1FNW A;  4CJ1 B;  3L9A X;  3GTL B;  1I6H B;  1SAP A;  2ES2 A;  3NPP A;  4K8J A;  2XSC A;  4M8A A;  4ZQ3 A;  2OF1 A;  4HIO A;  4A3E B;  1Y1V H;  1PTO F;  2VY3 A;  1W6J A;  3T1H L;  2PI2 E;  2XN9 C;  4LAA A;  1LM0 A;  1E3P A;  1LYL A;  2OXP A;  4A3K H;  1B9M A;  4K0K Q;  4K5W A;  4C3I B;  4AQY L;  2F4I A;  1K8G A;  4H0L C;  4B3S L;  1A3T A;  1EEF D;  1B2T A;  1AEX A;  1SE2 A;  1HNW L;  1YNN D;  2PCF B;  2EY5 A;  3AB9 A;  4X66 Q;  3J81 c;  3GQB A;  4X66 L;  4DNR B;  3I72 A;  1HNX Q;  1HNX L;  3DM3 A;  3W1B A;  5EKL A;  3IFD A;  4RCN A;  3MFY A;  1EY9 A;  1BDO A;  1IZ6 A;  5CV7 A;  1J5E Q;  3H94 A;  1R4Q B;  2I07 B;  4ABN A;  1VDZ A;  1SE3 A;  1ZYR C;  3AFP A;  4A3B H;  4FF2 A;  2HIV A;  2F0W A;  3GV3 A;  2HIX A;  3CHB D;  1HHV A;  4WJW A;  1V1Q A;  5A35 A;  1X3F A;  1LTT D;  1Z9F A;  5GAE C;  4FXD A;  2CHB D;  3G71 A;  2DJF C;  4L5T A;  1SNO A;  4IO9 A;  1SRU A;  1CKO A;  2GVB A;  5DEH A;  2K28 A;  1QVC A;  1NR4 A;  5FJ8 G;  1ILP A;  5EKK A;  1XWE A;  1QE6 A;  3UDX A;  1G8Z D;  2NUC A;  3U9S A;  1TWC H;  2KHS A;  1DOL A;  4A3J H;  4DK1 A;  2F0D A;  3E0J A;  1EQV A;  1SYC A;  4NKL A;  4GNX B;  3RN5 A;  5M3M B;  2KBN A;  1AP0 A;  1E2Z A;  2Z4I A;  4A3J G;  3PO2 B;  2K5N A;  2JK8 A;  5F2D A;  1GD7 A;  3OWF A;  4XDX A;  1JE5 A;  4DUY L;  1LTL A;  3S2H H;  3CCJ A;  2KCM A;  3H6M A;  2PO4 A;  1E22 A;  5CV9 A;  1G2T A;  3DLL A;  3K7U C;  4NDX A;  3ERQ A;  4A3D B;  4AYB E;  2VUM B;  3E9I A;  5JPN C;  1EY7 A;  2VW9 A;  1Q7Y C;  4K5X A;  2ZXR A;  1QJO A;  2F0M A;  2CQO A;  4LUV A;  1HCZ A;  1GUO A;  1RIP A;  3CC2 A;  4P75 A;  4RHR A;  2ZXP A;  4A3M G;  1XYI A;  1VQO A;  1ZEQ X;  3ONA B;  5KNB A;  3NWS A;  2GN5 A;  1IBK Q;  3DMU A;  1IBK L;  3H0G B;  2E8G A;  4R8I A;  1QWY A;  2PNR C;  4GN4 B;  1LO5 D;  1OXU A;  1SMX A;  1STH A;  5M5X B;  4C3H G;  3L0O A;  5G3L D;  3S14 H;  1GO3 E;  2IX0 A;  3IRB A;  1MJC A;  1B9N A;  1NE3 A;  3BDO A;  3G7L A;  3J80 E;  1IYU A;  3CQZ H;  4I7A A;  3LX0 A;  3R8B A;  3SK4 A;  3PF4 A;  3EQL C;  4BBR B;  4JI8 Q;  4A3F H;  1JMC A;  3TDQ A;  4R4Q A;  1CSQ A;  2C9O A;  1LAB A;  1PHJ A;  2MHV A;  1PDQ A;  2JA5 B;  1PYS B;  3M9B A;  1EU4 A;  4YWK A;  5GQO A;  2BOS A;  3T16 A;  1B8A A;  1JJ2 A;  3RZO B;  5ELC A;  2K1B A;  2L0C A;  3F2C A;  3NEN A;  3NBI A;  3O13 A;  1QVF A;  5GRO A;  3NHH A;  1D5M C;  1XNQ Q;  2NVQ H;  2J7Z A;  1SXT A;  1EQT A;  1CUK A;  1KNE A;  4TSS A;  3A5Z B;  1WCM H;  1EIF A;  1BXT A;  2B8F A;  1VMP A;  2EYP A;  3PSI A;  1WCM G;  1X54 A;  4U67 3;  3RN2 A;  5CV5 A;  4A3G H;  1JB7 A;  1CKN B;  2NBF A;  2JA7 H;  1TT2 A;  4LF4 Q;  3VR3 A;  4DUZ L;  1IW7 D;  4Y52 H;  1EOV A;  2JA7 G;  2JA6 B;  2JP1 A;  2SOB A;  2Z6K A;  3MVV A;  2EJF C;  4AH6 A;  4IUN A;  1HTP A;  1WTX A;  1JWU D;  4IUU A;  1I94 Q;  3NE5 B;  1U4P A;  4OWW B;  4BA1 I;  1FNU A;  2HCI A;  1K8O A;  4KJO A;  3I4M B;  2WB1 E;  5J22 A;  2IPK D;  2F0S A;  2A6E D;  3S16 B;  5JEA J;  1Q82 C;  2MQH A;  4CHT B;  3M4Y A;  4KJN A;  4K6L A;  2BCO A;  4CDE C;  1CM9 A;  4HJ8 A;  3K5O A;  5IGD A;  3WDN A;  1KAA A;  1WD0 A;  3KFU A;  2MJ8 A;  1SLJ A;  1W2B A;  2Q2U A;  1SE4 A;  1STB A;  1VQC A;  1Y8P B;  3GTK B;  1ONL A;  2VB3 X;  3VYR A;  2YYZ A;  4JVZ A;  3RUZ A;  5IWA Q;  5IGG A;  4V19 0;  5IWA L;  4A3I G;  4XYO A;  3QOL A;  1YNN C;  4TVA B;  1ZKO A;  2K03 A;  3PUV A;  4OGQ C;  1J6Q A;  3FHW A;  1F9P A;  2JA8 G;  1NAP A;  3TS2 A;  2I5H A;  3KDF B;  4A3K B;  4IOA A;  2KHI A;  3EFX D;  1X3Q A;  2X6G A;  1STY A;  5ELD A;  1EIG A;  4XXE A;  2EJM A;  4OEM B;  2F4V L;  1L0W A;  4O0A A;  4B3M Q;  4P73 A;  3SVM A;  2F1M A;  3C46 A;  2CWA A;  1JCK B;  1EY6 A;  2FMM A;  4ME5 A;  3VR4 A;  4TRD A;  2ZJQ A;  1VQP A;  1GOZ A;  1PH6 A;  4G4K A;  2RHS B;  1HJP A;  1ICW A;  2HHH L;  2YTX A;  3MXN B;  3X3M A;  5IYC H;  2B39 A;  2EXD A;  4YWL A;  5IYB H;  4H44 C;  1JIC A;  2LSS A;  5IYC G;  3G4S A;  5EJW A;  5K5P A;  1P16 A;  5M5Y H;  1HPC A;  4OIK A;  4GN3 B;  1R9T H;  2K5V A;  2R7Z H;  1QG7 A;  1I4G A;  1PVO A;  4HIK A;  1BR9 A;  2QEX A;  2EXZ A;  2KJX A;  4UP8 A;  3S1N B;  4GNX C;  4ME3 A;  2RCF A;  5C44 H;  3HOX G;  3K7A H;  3H3V I;  3JC6 6;  3WOF A;  3OHX C;  4J8Q A;  4J1M A;  5C44 G;  5LMN W;  1P8L A;  3BDL A;  4APV A;  2UU9 Q;  2RSN A;  1ASY A;  2AMC B;  4A3C H;  1TWC B;  3S1Q H;  4LMQ D;  2IHE A;  2RKS A;  4A3J B;  1VQ9 A;  3I90 A;  1VQN A;  2YTV A;  4QGU A;  4JI4 Q;  4IUQ A;  1EUJ A;  3G48 A;  3PCO B;  2WIN B;  3TP6 A;  2PPB C;  1YVC A;  4KKS A;  1D7Q A;  4DV6 L;  1IYV A;  4DR7 L;  4OX9 L;  1HA6 A;  2O5J C;  3HP3 A;  3OTO L;  1BCP D;  1KRS A;  1BCP B;  2F0T A;  4IUR A;  3J81 j;  1PTO H;  1SEB D;  1WJJ A;  1EY0 A;  2XIW A;  1HZC A;  2DY8 A;  4IPH A;  1QVG A;  1LTI D;  5EBD A;  3KJO A;  1TR5 A;  4DV3 Q;  5JOB A;  5JEA H;  2JJQ A;  4I65 A;  4EQO A;  4C3H B;  2E2D C;  4GZY C;  1CKN A;  1GUN A;  4GLV B;  2B3G A;  2TSS A;  3OMC A;  5NUC A;  4DV2 Q;  4JI7 Q;  1XMQ Q;  3C1E A;  4E6I A;  3S14 B;  1CHQ D;  3CQZ B;  4JW0 A;  2DUD A;  5IT9 L;  3K0X A;  4A3F B;  2NN6 H;  2XTI A;  4Q5V A;  3K81 C;  5HGT A;  1XNR L;  5M3M H;  3K5L A;  1HR0 W;  2AHO B;  1H9S A;  3PO2 H;  5LMU Q;  4ZAI A;  1PFB A;  3A8I E;  1ENA A;  4P71 A;  3JAM L;  1X56 A;  1EFI D;  1JT8 A;  3TME A;  1PH1 A;  3J7A V;  3OPO A;  3M7G A;  2E2J H;  3SHL A;  1D5X C;  1KIX A;  4LFB L;  3L2P A;  2VUM H;  2NVT B;  1GUG A;  5IOC A;  1I5F A;  2RA4 A;  3HFZ B;  2QDB A;  1KAB A;  2R92 G;  1IW7 C;  5J1Z A;  1HUN A;  4A3L G;  1WCM B;  5E7N A;  1NJI C;  3J80 i;  2B2W C;  3ER0 A;  3HZX A;  4JBK A;  1WYD A;  1WTP A;  1YNX A;  3KLS X;  1XX8 A;  1KD1 C;  4JG2 A;  1NMF A;  1PRT D;  1NR2 A;  3I8Z A;  2JA7 B;  2LFN A;  1B3Q A;  3NSW A;  1MJE A;  2N78 A;  5M5X H;  1PZK D;  2EQS A;  5C5M A;  5CV6 A;  2EZV A;  2KCT A;  3NQI A;  2OT2 A;  1NUC A;  3H3V H;  2A6E C;  1E7Z A;  4I7Z C;  1PZI D;  4DK6 C;  3KDF A;  5IE8 A;  4RG1 A;  2N88 A;  1H95 A;  4BBR H;  2DJG C;  4X64 L;  2KED A;  4IPC A;  1ENF A;  2EYL A;  2JSO A;  4CKE A;  5FKA C;  1HQM C;  4HID A;  1XPR A;  3K59 A;  4JI5 Q;  1F77 A;  1VQD A;  4FP5 D;  1JQY D;  3ND8 A;  1D1K A;  1U4M A;  2SNS A;  4UDU C;  1AN8 A;  2Z1C A;  1KLU D;  2VL6 A;  3S1M B;  1OO9 B;  3RZO H;  3RD4 A;  4C1N I;  3SR1 A;  3BG3 A;  1X3P A;  1JWM D;  3K0Y A;  3MXN A;  3MXP A;  2XNA C;  3TRE A;  2NB0 A;  2HDL A;  2K50 A;  2ZM6 L;  5I4D A;  5IP7 H;  5JVH 3;  2HD3 A;  4LFA Q;  4F7X A;  2AWO A;  3DUZ A;  1EEI D;  1JR0 D;  1HNZ Q;  5KNC A;  2M9V A;  4RHS A;  4X6A H;  1N8R C;  4JI0 Q;  1V1P B;  1G2S A;  4JI0 L;  2B2Y C;  1MBY A;  1PH7 A;  4OO1 H;  3GTJ B;  3MTS A;  2KUM A;  3M3Y B;  1B70 B;  3NQT A;  2QDL A;  4R4C A;  1IBM Q;  2TMP A;  2JEA I;  3DXJ C;  3N52 A;  5ELB A;  4KI0 A;  2LKV A;  2X69 A;  1K0S A;  2Q8I B;  3U50 C;  4DAM A;  1G29 1;  2DNC A;  3STB D;  3C2P A;  3FMC A;  5IGE A;  3N6R A;  2K6A A;  1VQF A;  4AIM A;  1WTW A;  3D6C A;  3PIP A;  2G9D A;  1SYF A;  1EWC A;  2EOT A;  3X3N A;  1LT5 D;  1VF7 A;  1EYG A;  4HIM A;  1C8C A;  1K28 A;  3GO5 A;  1K3B C;  2ZXO A;  3J7A 5;  4P72 A;  5C4J H;  2B63 G;  2ZTD A;  1BF4 A;  4ALP A;  4KHP Q;  3K6O A;  4LF7 Q;  3CCQ A;  4KHP L;  4LF7 L;  2UUC Q;  1UWV A;  3MXU A;  1Q8I A;  5M5Y B;  4GOP A;  5IP9 G;  2JXM B;  4JBW A;  3MAQ A;  5C5L A;  1R9T B;  2Z4H A;  1STG A;  4GLX A;  1ET6 A;  2Z0S A;  4HSV A;  3NWT A;  1ET9 A;  1N32 Q;  2UXD Q;  1CT1 D;  1N32 L;  4ZUI A;  4DNT B;  2PYK A;  1SFO H;  2K04 A;  2PMZ E;  3U58 A;  3HOX B;  1TWG H;  1BO0 A;  3BZC A;  5C44 B;  1BBU A;  5KGU A;  4B3T Q;  3W1G A;  3K7A B;  4LFC Q;  3D4D A;  3A7A B;  1I4X A;  4B3T L;  4LFC L;  3HKZ G;  1RTN A;  1LT4 D;  4LK1 C;  1O80 A;  5C6A A;  3J81 E;  2JA9 A;  4K0K L;  1T5E A;  2F3V A;  3GD7 A;  4DA2 A;  3E9H A;  4UP7 A;  3S1Q B;  1AZQ A;  4XQJ A;  2ASB A;  5D65 A;  1Q1B A;  3K8A A;  1X3G A;  2RSO A;  1BCP C;  1MD2 D;  3S2D H;  3UE0 A;  2K4K A;  3F2B A;  4NXM Q;  1UNS A;  1MGS A;  4L6T B;  1EIY B;  4C3J H;  1PA6 A;  2A68 D;  3BZD B;  2F0O A;  1CTM A;  1A3U A;  2KEN A;  4HCS A;  3E3X A;  4C3J G;  5ELF A;  1J5E L;  4CBV A;  4KTA A;  2Y0S E;  1MHW C;  2PQE A;  3ITP A;  1VS0 A;  3PUZ A;  2EIF A;  4OWT B;  1PTO B;  5FO7 B;  4PV1 C;  5BN5 A;  1HZ9 A;  4YIJ A;  2VNU D;  4DR6 Q;  1JOK A;  3CCL A;  1JJC B;  3D0F A;  4DR6 L;  1XMO Q;  3ULJ A;  2O5I C;  4F88 A;  1DGS A;  3S24 A;  2ID0 A;  1NSN S;  2V1C C;  1H9R A;  2JYO A;  4YCW A;  3CPW A;  4DK3 C;  1MSH A;  4ZUJ A;  3TN2 A;  2SEB D;  2X6L A;  4BY1 H;  4X62 Q;  2WAQ G;  1NNX A;  3S1N H;  1PLF A;  5FJ8 H;  2FFK B;  4L63 B;  1LLR D;  1FL0 A;  4BY1 G;  3T51 B;  1YZ6 A;  4J15 A;  3RMH A;  1TII D;  3CCU A;  3SGI A;  3MHB A;  2H5X A;  1ASZ A;  2ATW A;  4EQN A;  1VQ5 A;  3RZD H;  3I4N G;  3A56 A;  2I5L X;  2J4X A;  1KAW A;  1YNJ C;  3QR8 A;  4BWG B;  5I6Y A;  2O4X A;  1E0B A;  3I4L A;  2ICI A;  2CKZ B;  4X3S A;  2B2V A;  4QJF A;  1NBW A;  4NPS A;  2HQL A;  5KYI A;  4ODG A;  5E1F A;  4EQP A;  2VS1 A;  3DM1 A;  5JJL A;  1Q8K A;  4KD4 A;  4QIW E;  2E2J B;  4PZ6 A;  1PRT C;  2R92 B;  2AWN A;  5IYD G;  1SE8 A;  4YCU A;  5C0X I;  4LW1 A;  5IT9 c;  4DV5 Q;  1U9R A;  4KY5 A;  4A3M H;  1HH2 P;  3TQY A;  1XPU A;  1Q46 A;  2LY7 A;  1YIT A;  1K8A C;  2RDG A;  5G3L F;  3WWV A;  4R4O A;  5DLQ E;  1IYJ B;  3PGZ A;  5IIF A;  3JAM c;  1U4R A;  2Q8R E;  2LS0 1;  2HQE A;  1T9H A;  4C3H H;  1I4Q A;  1QZG A;  1X3E A;  1F9R A;  1V1P A;  2NWG A;  1HFN A;  4HN7 A;  3H09 A;  3A7L A;  4IZ8 A;  2F0V A;  1DOM A;  4FYD A;  2F03 A;  2RDH A;  1EWH A;  3HOY H;  1GKH A;  3FPP A;  3FVQ A;  4JI8 L;  5K36 G;  1PYW D;  4HR7 B;  2GVA A;  4A75 A;  1F9S A;  3HOY G;  1EZ8 A;  2JEB I;  1K73 C;  1LUZ A;  2Q2I A;  1QUQ B;  4GKJ Q;  3VYT A;  2K5W A;  2L5T A;  3BYT B;  1PFS A;  1TS2 A;  5EKI A;  1I4P A;  4JCV E;  3L7Z C;  4KY7 A;  1XNQ L;  1VF5 C;  4CJ0 B;  4GS3 A;  4JI1 Q;  2NVT H;  1VQK A;  4L5R C;  3RLN A;  4IPD A;  4ZKB B;  5KND A;  1SNC A;  1LTA D;  3Q8D A;  1UE7 A;  3LNN A;  4DV0 Q;  3OWE B;  2R7D A;  5FO9 B;  2V4D A;  2F52 A;  2H4O A;  3STB C;  4F8M A;  2L55 A;  2ZT9 C;  4LF4 L;  1RDP D;  3K5M A;  1N36 Q;  3E5S A;  2A5H A;  2MO1 A;  2KHJ A;  4CDC C;  3GTO H;  4OL7 A;  5M3F H;  1AW7 A;  5FLX c;  2BDN A;  3I56 A;  5M3F G;  4AYB G;  1H9S B;  3EJI A;  4X65 Q;  1Q1E A;  1WFQ A;  4RAU C;  4PMW A;  1I94 L;  1SNQ A;  4Z9C B;  4IQZ A;  4O2D A;  1A6X A;  2RVL A;  1VQ7 A;  3KJP A;  2B63 B;  3S1M H;  2VQF Q;  3H15 A;  5C3E H;  1XPO A;  1WTH A;  5E3F A;  1M1K C;  5C4J B;  5M5W B;  2NTS A;  5KEE A;  5C3E G;  1N33 Q;  3PF5 A;  3KOJ A;  5GAG C;  5C0X H;  5I9P A;  2WKC A;  2Z6K C;  3HG9 A;  4POF A;  1ESF A;  1WTQ A;  5ISR A;  2C35 B;  1SYB A;  1YEZ A;  5GAH C;  5C0X G;  4L5S A;  1G91 A;  4A3I H;  1DJR D;  5C4X G;  4UPA A;  1NMG A;  1KL9 A;  1A8V A;  2PQA A;  3MA2 B;  1B1Z A;  3CF5 A;  5A2Q L;  1SFO B;  1IBL Q;  3IL8 A;  4UHV A;  2JA8 H;  1IKL A;  3HKZ B;  1TWG B;  2K75 A;  3GTJ H;  2OTL A;  1GHJ A;  2HUG A;  1DOK A;  1DYQ A;  3M3Y H;  2B8G A;  3PUY A;  4CDD C;  3MEF A;  2KCC A;  3FP9 A;  3J7Y W;  1TWA B;  3D31 A;  1LV9 A;  3M7N A;  1MI2 A;  3UI2 A;  4ZKC B;  3CRK C;  4QCL A;  1KDB A;  2A68 C;  4DR5 Q;  1U4L A;  1ZXT A;  3NEL A;  4HJ5 A;  3R2I A;  5EPJ A;  3RLF A;  4A4I A;  4IN3 A;  4B3M L;  4LWC A;  3S2D B;  4JBM A;  1X32 A;  1PTO C;  4C3J B;  4RWS C;  5I6W A;  4U68 A;  1F2Y A;  5EBC A;  1PH3 A;  2E2H H;  4CDF C;  3OW7 A;  2D5D A;  1Q81 C;  1EWI A;  2FMC A;  1IL8 A;  3G6J B;  2N49 A;  1YHQ A;  3J81 i;  4K2L A;  4G7O C;  3NEM A;  1ROD A;  2L9H A;  3C3L A;  1A63 A;  2A69 C;  2XRS D;  1B44 D;  3V96 A;  1UUP A;  1Y1W H;  2WAQ B;  3HOX H;  2WB1 G;  4BY1 B;  1Y1W G;  4RMF A;  4B9W A;  2NZ1 D;  1VQB A;  5CMD A;  4DV4 Q;  4DKA C;  1Q90 A;  1A15 A;  3D4R A;  2HT1 A;  3W2D A;  2UU9 L;  3PMF A;  2CH4 A;  1I6V C;  1VQG A;  1YBY A;  3RZD B;  1JC7 A;  3HRZ C;  3PIO A;  3GTP H;  2VB2 X;  4LF5 Q;  1M4V A;  3MFG A;  4K6D A;  1STE A;  4PZ8 A;  2K5D A;  3LWU A;  4XQN A;  3G6E A;  1BCP F;  3S1R H;  2N55 A;  4BY7 H;  1CQV A;  4JI4 L;  3AEV A;  2AQ1 B;  3VR6 A;  1YI2 A;  1PZJ D;  2PW5 A;  5CGK A;  4BY7 G;  5JAV A;  3GV6 A;  1FD7 D;  2MNA A;  1B50 A;  1QUQ A;  1TXY A;  3DHQ A;  4B3R Q;  1KXL A;  5C4H A;  1TU2 B;  2MO0 A;  4MIU A;  4JI6 Q;  1Q3L A;  4GOP B;  1X6O A;  1QNU A;  2EPB A;  2MUY A;  1TQO A;  4A3M B;  1GM5 A;  4HTH A;  3CD6 A;  2K52 A;  2ZJP A;  4KY6 A;  1MIU A;  4G7Z C;  1VQI A;  3GTG H;  1A3V A;  3M4Q A;  4DV3 L;  1D1I A;  1QIL A;  1RKN A;  3T13 A;  1OXS C;  3BVZ A;  3F8T A;  2B29 A;  2F0Q A;  2NZH A;  1EQR A;  2B2T A;  3ERS X;  3TSS A;  2MPM A;  1D6E C;  4DV2 L;  1OXT A;  4NB3 A;  5IGC A;  1XMQ L;  1HTL D;  4JI7 L;  1F2L A;  4JYA Q;  1FYC A;  2JN4 A;  2EY1 A;  3GTQ B;  3CAM A;  1AFP A;  1K0R A;  3HOY B;  3U4Z A;  1JB3 A;  3HOU H;  4IPG A;  4QB4 A;  4A93 H;  4QL5 A;  4FDB A;  5IGF A;  1I4H A;  3Q22 A;  3CKI B;  3OMG A;  3TP7 A;  5J3B A;  4DN4 M;  4XTC S;  3H91 A;  3HOU G;  4DAY B;  4A93 G;  1PH9 A;  4IJH A;  2K14 A;  2AQ2 B;  2XVS A;  5LMU L;  3BZK A;  2CFM A;  5JVG 3;  2F0K A;  2SNM A;  3VDY A;  2EYO A;  4KKT A;  1UE1 A;  5H1S E;  1E2W A;  3T56 B;  1YNJ D;  3IKJ A;  4MTK A;  1PRT F;  2R92 H;  2EY2 A;  4A3L H;  4C2M H;  1VQH A;  3OIP A;  2ENB A;  3QIA A;  1ESR A;  2F3W A;  2R7F A;  3T53 B;  4DV7 Q;  1IKM A;  1GHK A;  1PXU A;  3C1F A;  3PV0 A;  4WOR A;  3HOW H;  4ZK9 B;  2EYH A;  4V0B A;  1ICF B;  3K58 A;  3W3A A;  2L11 A;  4IOC A;  4YY3 Q;  3D4W A;  1HXY D;  3HOW G;  5BR8 Q;  3TP5 A;  5BR8 L;  5KYL A;  3NTH A;  2OCE A;  1Y14 B;  1B7Y B;  5FLM H;  1I50 H;  5LMN Q;  3HOV H;  4N8X 1;  3KLW A;  1SMY D;  1FGB D;  5FLM G;  3OYY A;  3GTO B;  1JWS D;  1HRJ A;  1ML0 D;  3ERO A;  5J39 A;  5M3F B;  2Q2H A;  4AYB B;  3HOV G;  1Z47 A;  5CR3 A;  1EZ6 A;  2JE6 I;  1MKH A;  3EA6 A;  3J80 L;  1HA5 A;  2YV5 A;  1L1O B;  1FNV A;  2ZTE A;  1B3A A;  3SK5 A;  2BH8 A;  3FKI H;  4KLK A;  2M00 A;  3GTM B;  4JI5 L;  1RTO A;  5C3X A;  1D5Z C;  3FKI G;  3V05 A;  3CRL C;  1I3Q H;  1Y8O B;  5C3E B;  4CGY B;  2K5Q A;  4IUT A;  5KIX A;  2CCZ A;  1TWF B;  1LT6 D;  3F1Z A;  4ULL A;  4C56 C;  1VQ8 A;  5FLX L;  3ND9 A;  4RH6 A;  3BJU A;  5C4X B;  2M2L A;  2PNH A;  4LFA L;  4A3I B;  1HZA A;  1O7Y A;  3I73 A;  1BKB A;  4HCE A;  3U4V A;  1S72 A;  1CHP D;  3Q24 A;  1HNZ L;  3ULP A;  2A8V A;  2A74 C;  2YTY A;  4CKB A;  2JA8 B;  3HS0 C;  3CCE A;  4NXN Q;  2IJ0 A;  4H7B A;  3HOZ H;  2KQ3 A;  1Q86 C;  4YCV A;  1C9O A;  4DR3 Q;  4DR3 L;  1PFN A;  4WJ4 A;  4ZYS A;  3T4A C;  3HOZ G;  1IBM L;  1C7Y A;  4LF6 Q;  2F0F A;  1DCZ A;  1HR0 Q;  2E5L Q;  4B9X A;  2E5L L;  5A2Q E;  3I91 A;  4JI3 Q;  3OIQ A;  2K05 A;  4DNI A;  1L2F A;  4LF8 Q;  1TWH H;  2EYJ A;  2K01 A;  2QCP X;  1VQM A;  5FK9 C;  3Q0A A;  3CC4 A;  4TQU S;  4JOI A;  2B63 H;  2UUA Q;  5DAU A;  3T1Y Q;  3R93 A;  4HSP A;  2WV6 D;  1EYD A;  5M5W H;  1J9O A;  3SEB A;  4L8J A;  1VQ6 A;  3KLS A;  1EOT A;  2E2H B;  2PI2 A;  4OXP A;  2C5C A;  3SXH A;  1PH4 A;  5IP9 H;  1K83 H;  2UUC L;  2WFW A;  4LF9 Q;  2IL8 A;  4BBS G;  4PMB A;  3KBX A;  2NVY H;  1SYE A;  3QO2 A;  1EY8 A;  4EQ5 A;  3I4M G;  4UP9 A;  1E1O A;  1K9M C;  1SR3 A;  2WB1 B;  4O42 A;  1WI5 A;  3D6W A;  1Y1W B;  1B53 A;  2UXD L;  2NZO A;  1DXM A;  2SDF A;  4L5Q A;  1S40 A;  2ICE C;  2PZT A;  4ILW A;  1YJ9 A;  4DPG A;  1N34 Q;  2IX3 A;  1NTG A;  1VQE A;  5I2Y A;  1TWA H;  2IHF A;  2K32 A;  1O7I A;  4GKK Q;  1S5C D;  2AUJ D;  1KDA A;  5JJI A;  2KVM A;  4N9P A;  5LL6 S;  4DAV A;  1SNP A;  2YU9 H;  4QQB X;  3GTP B;  3M4O H;  3UDI A;  1KC8 C;  4HJ9 A;  2EDG A;  2PZW A;  2Q2T A;  3S1R B;  3NTI A;  1SDF A;  4BY7 B;  4GOP C;  3T1H Q;  1V8Q A;  4DAY A;  4NXM L;  5DM7 3;  1XXG A;  1QOH A;  4MNO A;  5EAY A;  1Y1V G;  2E75 C;  3PO3 H;  1STN A;  4FF3 A;  4AQY Q;  1G6Z A;  4DU9 A;  5COY A;  4B3S Q;  2FHT A;  4A3K G;  1HNW Q;  2KEC A;  3PO3 G;  3CCS A;  4F87 A;  2J0T D;  4G7H C;  3GDE A;  1PTO D;  1EL0 A;  2H1E A;  1PH8 A;  1X9N A;  1WTR A;  4UY8 C;  2HCC A;  2PQA B;  4MN3 A;  4X3T A;  1XMO L;  1D2B A;  5D3I B;  2VQE Q;  3J7A F;  3GTG B;  4QF4 A;  2VQE L;  2XRQ D;  4RFB A;  5EPK A;  2G9H D;  2D62 A;  4X62 L;  2KEE A;  4CKC A;  1PYB A;  2MGS A;  5HUR A;  1K3R A;  1N9W A;  2Z6B A;  1HZB A;  3QJY A;  3I4N H;  3DWA A;  2A69 D;  4A3B G;  2N3S A;  5C0X J;  2A19 A;  1KNA A;  3HOU B;  3U9O A;  4A93 B;  1GUW A;  5M9O A;  3F2D A;  1QB5 D;  1EYA A;  2F0G A;  3ULL A;  1L1O A;  4DK0 A;  2IT1 A;  3VR5 A;  1F2Z A;  1VQL A;  3SK6 A;  1S5F D;  3CCV A;  4X3U A;  4GN5 A;  3IFT A;  1ILQ A;  5IOD A;  1DM0 B;  3S9W A;  2FIN B;  1UE6 A;  5IYD H;  4KHV A;  1BBW A;  2R3Z A;  2IWH A;  1OXX K;  5IT9 E;  1U0L A;  4HMJ A;  1TS3 A;  3OW2 A;  4C2M B;  1CA6 A;  2EVB A;  1O78 A;  4R4I A;  1SYD A;  3QG1 A;  4DV5 L;  4JC0 A;  4X3K A;  4KN4 C;  2F0J A;  1TKW B;  1SN8 A;  1GJX A;  3JAM E;  4KKU A;  3TBI B;  1DZ1 A;  4DUY Q;  1SMY C;  2N8N A;  3HOW B;  3MEH A;  1Y8N B;  4PG3 A;  3CP0 A;  3PUW A;  3KF6 B;  1BQQ T;  4H13 C;  4XIG S;  1BNZ A;  1PFM A;  3P75 A;  2K5H A;  5FOB B;  1L1O C;  5ELO A;  3BDC A;  2A6H D;  2MP1 A;  2QGQ A;  4BS9 A;  2BDO A;  2B2V C;  2QF7 A;  3NXW A;  1V9P A;  1I50 B;  3I2Z A;  1JOR A;  1STA A;  2AKW B;  2QKI C;  5D14 A;  5BN4 A;  3HOV B;  3CME A;  1NY4 A;  5CBA E;  1EY5 A;  3W5O A;  4R8N A;  5JJK A;  3NBH B;  4S3S A;  3GTQ H;  5K36 H;  5C4Z A;  5E4W C;  2KA7 A;  1TS5 A;  2Y0S G;  1SSO A;  1WOC A;  4DR2 Q;  4KD3 A;  3BS1 A;  4DR2 L;  4XT1 B;  5I2X A;  3VYS A;  3LWE A;  3CCM A;  3I4O A;  1B4O A;  1M8A A;  3S15 H;  1C0A A;  2L1B A;  1S4Z A;  2VZA A;  3FKI B;  1Y69 U;  2R93 H;  4DAP A;  2BE5 C;  4RKB A;  2R93 G;  4GKJ L;  1W3S A;  1I3Q B;  3DEO A;  2D0O A;  2RF4 A;  1PV4 A;  1DD2 A;  2FJ2 A;  3PIO 3;  1GUT A;  3B6Y A;  1Z6H A;  3J80 c;  1YHA A;  4JI1 L;  1FR3 A;  4A3F G;  1QZH A;  3V2T A;  3CMA A;  2MFI A;  1QNK A;  5TSS A;  5HGQ A;  3CC7 A;  2KOL A;  3RLO A;  4DV0 L;  3A74 A;  1S5D D;  3I7F A;  1XJV A;  3VR2 A;  5JPM C;  4J6H A;  4DXF A;  1N36 L;  3HOZ B;  1A0I A;  1CK1 A;  4C1N K;  5CV4 A;  2GA4 B;  3KK7 A;  5FLX E;  2RDF A;  3M85 A;  3KF8 B;  1SBB B;  4LNQ A;  2D9U A;  3A54 A;  3VA5 A;  2P5Z X;  1JJG A;  4UAI A;  3AQQ A;  4O1N A;  2NVX B;  1BBX C;  1YJW A;  5IGB A;  2RBM A;  4NMZ A;  2CQA A;  5E4X A;  3TEH B;  5ELE A;  4DGZ A;  2RHQ B;  3AFQ A;  4N9T A;  4X65 L;  2EYF A;  4DFA A;  1H9J A;  4DUZ Q;  4A3G G;  3GP7 A;  1A2U A;  4NP5 A;  3GTM H;  1CSP A;  1TWH B;  2CW0 D;  2QIL A;  2UXC Q;  5COR A;  2UXC L;  4K14 A;  4QMG A;  1LTG D;  1LAC A;  3SE0 A;  1AZP A;  1E1T A;  1SJE D;  2OQK A;  4PNY A;  1V43 A;  3TZU A;  4EX5 A;  2VQF L;  1S3O A;  1EY4 A;  3EBE A;  5EQ0 A; 
#chains in the Genus database with same CATH homology
 5T1G A;  4BBS B;  4RGM A;  1GUS A;  4WRD A;  1S5B D;  1K83 B;  2F0L A;  3A55 A;  3KUP A;  2NVY B;  4FVM A;  4M1U B;  1CZG A;  3URY A;  3KBG A;  4HAE A;  2EE1 A;  4PMC A;  1JOQ A;  2E74 C;  2Q8T A;  5KRU A;  1KDC A;  2OEO A;  3PUX A;  2HDM A;  1WD1 A;  1RCV D;  5CYU A;  4G57 A;  3WOE A;  2YU9 B;  3OOC A;  2AUK A;  3M4O B;  3FEW X;  2XWB B;  4RKL A;  3MC0 B;  1DON A;  1Y1V B;  4RGT A;  1C4Q A;  3Q23 A;  3NTK A;  3MZ5 A;  3I3C A;  2F0H A;  3PO3 B;  2F0I A;  4MHE A;  3QOJ A;  1KTK A;  2NN6 I;  2NTT A;  3NUC A;  3Q6S A;  4EVO A;  1JE4 A;  5LL6 X;  2QEJ C;  1CQF A;  4QUC A;  3AU7 A;  1TY2 A;  2PW7 A;  4DF7 A;  3R3O A;  1EYC A;  3DEP A;  4LJZ C;  3QWN A;  4PQX A;  1NCV A;  1BUV T;  1E2V A;  3TZD A;  1TS4 A;  3I4N B;  4A3B B;  1LTB D;  2L4N A;  4ZRZ A;  4B08 A;  3J81 L;  1BOS A;  3K5N A;  1VMC A;  4XQQ A;  1PMR A;  3NBH A;  4FF4 A;  1H9K A;  1IHZ A;  1EIH A;  1ENC A;  4DXG A;  2NYZ D;  2RQX A;  4QUF A;  2I46 A;  4FF1 A;  2PMZ B;  1F2M A;  4JK1 C;  3QB3 A;  2Z8L A;  2R61 A;  4IUP A;  5CV8 A;  4IFD J;  1Z7T A;  4C3I G;  3VYU A;  2A6H C;  1CA5 A;  1K8M A;  2WKD A;  5EGT A;  5EPL A;  3P1H A;  2IW3 A;  2EJG C;  3PIP 3;  3H3V C;  3BYY B;  1OXV A;  1MSG A;  3S2H B;  3MWY W;  4FXG C;  4ID6 A;  1L0Y B;  3F2U A;  3A8J E;  2DNE A;  1WTV A;  1QCB D;  4IFD I;  4IAL A;  1LTR D;  1C48 A;  5FO8 B;  2Y0S B;  3KF8 A;  3BVM A;  1R4P B;  2BA0 A;  2E76 C;  4ZLT F;  4OO1 I;  5I9O A;  3D3R A;  5JEA G;  3S15 B;  1ZYR D;  2R93 B;  2WP8 J;  1LT3 D;  1HFG A;  4KN7 C;  2EYM A;  2B2W A;  4NW2 A;  4KHZ A;  4XYQ A;  3AMU A;  1I4R A;  1SNM A;  2B2T C;  4BA2 I;  3BVG A;  3EVQ A;  1CZW A;  1WVL A;  1Q12 A;  1WTO A;  2NN6 G;  2D2C C;  3FPU B;  1F9Q A;  2O2L D;  3D8G A;  2K33 A;  2F0E A;  1II3 A;  1A2T A;  1RD9 D;  4CJ2 C;  1RJT A;  2VXW A;  4IUV A;  1V1O A;  3HGB A;  3P20 A;  5DNF A;  2NVQ B;  3NP8 A;  1XTC D;  1TVX A;  2F0U A;  4QIW B;  1RF2 D;  2CW0 C;  3P7J A;  2B2U A;  1CI3 M;  3NK9 A;  4K5V A;  3K57 A;  4FO2 A;  4A3G B;  2LMC B;  1PRT B;  1EU3 A;  2AQ3 B;  3SK8 A;  1L0X B;  3HEJ A;  4FXK C;  4TKO B;  1TY0 A;  2K7V A;  3ZYY X;  3A8K E;  3L3O C;  1RHP A;  3I70 A;  1O7L A;  2DN8 A;  3FDT A;  4XT3 B;  1VCI A;  5T1I A;  2A73 B;  2WII B;  4RA8 A;  4RGO S;  3FRP B;  2KCN A;  1CFM A;  2B2U C;  4K2K A;  2B2Y A;  4RGN A;  2BE5 D;  4OHJ A;  1T5X D;  4Q0F A;  4RCO A;  4Y7N B;  4HED A;  1SND A;  5D3D A;  2F0P A;  3E6Z X;  3S17 B;  2CVR A;  4EGV A;  4IFD H;  2EY6 A;  1KLG D;  4IFD G;  3TP8 A;  5C3W A;  1SJH D;  3MXG A;  4WFN 3;  3VA7 A;  4KMU C;  2DY7 A;  5CC4 A;  5BN3 A;  4OO1 G;  1W6K A;  5DM6 3;  1HUM A;  1UEA B;  3SDZ A;  4FNF A;  2F0N A;  5CBE E;  1JOO A;  2XWJ B;  2BA1 A;  4KV6 A;  5LHY 1;  2R6G A;  1UAP A;  3R2T A;  3CU7 A;  5AFW A;  4R9W A;  2PZU A;  4KK7 A;  1GXD C;  3IAY A;  1LTS D;  4K8I A;  1SYG A;  3DWQ A;  1J8I A;  2WAC A;  4HMI A;  1H9M A;  4OIJ A;  4P2C B;  1O7Z A;  1S5E D;  1HQR D;  2L12 A;  5JJZ A;  3DWP A;  2IX1 A;  3KLR A;  2R7Z B;  2E2I B;  3OSO A;  1FNW A;  4CJ1 B;  3L9A X;  3GTL B;  1I6H B;  1SAP A;  3NPP A;  4K8J A;  2XSC A;  4M8A A;  4ZQ3 A;  2OF1 A;  4A3E B;  1PTO F;  1W6J A;  2XN9 C;  4LAA A;  2OXP A;  1B9M A;  4K5W A;  4C3I B;  2F4I A;  4H0L C;  1A3T A;  1EEF D;  1B2T A;  1AEX A;  1SE2 A;  1YNN D;  2PCF B;  2EY5 A;  3AB9 A;  3GQB A;  4DNR B;  3I72 A;  5EKL A;  3IFD A;  4RCN A;  3MFY A;  1EY9 A;  1BDO A;  5CV7 A;  3H94 A;  1R4Q B;  2I07 B;  4ABN A;  1VDZ A;  1SE3 A;  1ZYR C;  4FF2 A;  2F0W A;  3GV3 A;  3CHB D;  1HHV A;  4WJW A;  5A35 A;  1LTT D;  4FXD A;  2CHB D;  1SNO A;  5DEH A;  2K28 A;  1NR4 A;  1ILP A;  5EKK A;  1XWE A;  1QE6 A;  1G8Z D;  2NUC A;  3U9S A;  2KHS A;  1DOL A;  4DK1 A;  2F0D A;  3E0J A;  1EQV A;  1SYC A;  4NKL A;  5M3M B;  1AP0 A;  1E2Z A;  2Z4I A;  3PO2 B;  5F2D A;  3OWF A;  4XDX A;  2PO4 A;  3H6M A;  5CV9 A;  1G2T A;  4NDX A;  3ERQ A;  4A3D B;  2VUM B;  5JPN C;  1EY7 A;  4K5X A;  2ZXR A;  1QJO A;  2F0M A;  1HCZ A;  1GUO A;  4RHR A;  2ZXP A;  1XYI A;  1ZEQ X;  3ONA B;  5KNB A;  3NWS A;  3DMU A;  3H0G B;  4R8I A;  1QWY A;  2PNR C;  1LO5 D;  1OXU A;  1STH A;  5M5X B;  4C3H G;  5G3L D;  2IX0 A;  1B9N A;  3BDO A;  3G7L A;  3J80 E;  1IYU A;  3SK4 A;  3LX0 A;  3R8B A;  3EQL C;  4BBR B;  3TDQ A;  2C9O A;  1LAB A;  2MHV A;  1PDQ A;  2JA5 B;  1EU4 A;  2BOS A;  3T16 A;  3RZO B;  5ELC A;  2K1B A;  2L0C A;  3NBI A;  3O13 A;  3NHH A;  1D5M C;  2J7Z A;  1SXT A;  1EQT A;  1KNE A;  4TSS A;  1BXT A;  2B8F A;  1VMP A;  2EYP A;  4U67 3;  5CV5 A;  2NBF A;  1TT2 A;  3VR3 A;  1IW7 D;  2JA6 B;  2JP1 A;  2SOB A;  3MVV A;  2EJF C;  4IUN A;  1HTP A;  1WTX A;  1JWU D;  4IUU A;  3NE5 B;  1U4P A;  4BA1 I;  1FNU A;  2HCI A;  1K8O A;  4KJO A;  3I4M B;  5J22 A;  2IPK D;  2F0S A;  2A6E D;  3S16 B;  5JEA J;  4CHT B;  3M4Y A;  4KJN A;  4K6L A;  2BCO A;  1CM9 A;  3K5O A;  5IGD A;  3WDN A;  1KAA A;  1WD0 A;  2MJ8 A;  1SE4 A;  1STB A;  1Y8P B;  3GTK B;  1ONL A;  2VB3 X;  3VYR A;  2YYZ A;  3RUZ A;  5IGG A;  4V19 0;  4XYO A;  3QOL A;  1YNN C;  1ZKO A;  2K03 A;  3PUV A;  4OGQ C;  1F9P A;  1NAP A;  4A3K B;  3EFX D;  1X3Q A;  2X6G A;  1STY A;  5ELD A;  1EIG A;  4XXE A;  2EJM A;  3SVM A;  2F1M A;  3C46 A;  1JCK B;  1EY6 A;  2FMM A;  4ME5 A;  3VR4 A;  4TRD A;  1GOZ A;  4G4K A;  1ICW A;  3X3M A;  2B39 A;  4H44 C;  1JIC A;  5EJW A;  5K5P A;  1HPC A;  4OIK A;  1QG7 A;  1I4G A;  1BR9 A;  2EXZ A;  2KJX A;  3S1N B;  3WOF A;  3OHX C;  4J8Q A;  4J1M A;  3BDL A;  2RSN A;  1TWC B;  4LMQ D;  2RKS A;  4A3J B;  3I90 A;  4IUQ A;  3TP6 A;  2WIN B;  2PPB C;  4KKS A;  1IYV A;  1HA6 A;  2O5J C;  3HP3 A;  1BCP D;  1BCP B;  2F0T A;  4IUR A;  1PTO H;  1SEB D;  1EY0 A;  2XIW A;  2DY8 A;  1LTI D;  5EBD A;  1TR5 A;  5JOB A;  5JEA H;  4I65 A;  4EQO A;  4C3H B;  2E2D C;  4GZY C;  1GUN A;  2TSS A;  3OMC A;  5NUC A;  3C1E A;  4E6I A;  3S14 B;  1CHQ D;  3CQZ B;  5IT9 L;  4A3F B;  2NN6 H;  4Q5V A;  5HGT A;  3K5L A;  1H9S A;  4ZAI A;  1PFB A;  3A8I E;  1ENA A;  3JAM L;  1EFI D;  3TME A;  3J7A V;  3OPO A;  3M7G A;  3SHL A;  1D5X C;  2NVT B;  1GUG A;  5IOC A;  2RA4 A;  2QDB A;  1KAB A;  1IW7 C;  5J1Z A;  1HUN A;  1WCM B;  2B2W C;  3HZX A;  1WTP A;  3KLS X;  1XX8 A;  1PRT D;  1NR2 A;  3I8Z A;  2JA7 B;  2LFN A;  3NSW A;  1PZK D;  5C5M A;  5CV6 A;  2EZV A;  3NQI A;  2OT2 A;  1NUC A;  2A6E C;  4I7Z C;  1PZI D;  2N88 A;  2KED A;  1ENF A;  2EYL A;  4CKE A;  2JSO A;  5FKA C;  1HQM C;  3K59 A;  1F77 A;  4FP5 D;  1JQY D;  3ND8 A;  1D1K A;  1U4M A;  2SNS A;  4UDU C;  1AN8 A;  2Z1C A;  1KLU D;  3S1M B;  1OO9 B;  3RD4 A;  4C1N I;  3SR1 A;  3BG3 A;  1X3P A;  1JWM D;  3K0Y A;  3MXN A;  3MXP A;  2XNA C;  2NB0 A;  2HDL A;  5I4D A;  5JVH 3;  4F7X A;  2AWO A;  3DUZ A;  1EEI D;  1JR0 D;  5KNC A;  2M9V A;  4RHS A;  1V1P B;  1G2S A;  2B2Y C;  1MBY A;  4OO1 H;  3GTJ B;  3MTS A;  2KUM A;  3M3Y B;  3NQT A;  2TMP A;  2JEA I;  3DXJ C;  3N52 A;  5ELB A;  4KI0 A;  2LKV A;  2X69 A;  2Q8I B;  1G29 1;  2DNC A;  3C2P A;  3FMC A;  5IGE A;  3N6R A;  2K6A A;  1WTW A;  3D6C A;  2G9D A;  1SYF A;  1EWC A;  2EOT A;  3X3N A;  1LT5 D;  1VF7 A;  1C8C A;  3GO5 A;  2ZXO A;  1BF4 A;  3K6O A;  3MXU A;  1Q8I A;  5M5Y B;  2JXM B;  4JBW A;  3MAQ A;  5C5L A;  1R9T B;  2Z4H A;  1STG A;  1ET6 A;  4HSV A;  3NWT A;  1ET9 A;  1CT1 D;  4ZUI A;  4DNT B;  2PYK A;  2K04 A;  3HOX B;  1BO0 A;  5C44 B;  5KGU A;  3K7A B;  3D4D A;  3A7A B;  1I4X A;  1RTN A;  1LT4 D;  4LK1 C;  1O80 A;  5C6A A;  3J81 E;  1T5E A;  2F3V A;  3GD7 A;  4DA2 A;  3S1Q B;  1AZQ A;  4XQJ A;  5D65 A;  1Q1B A;  2RSO A;  1BCP C;  1MD2 D;  1UNS A;  1MGS A;  4L6T B;  2A68 D;  3BZD B;  2F0O A;  1CTM A;  1A3U A;  4HCS A;  4C3J G;  5ELF A;  4CBV A;  4KTA A;  2PQE A;  3ITP A;  3PUZ A;  5FO7 B;  1PTO B;  4PV1 C;  5BN5 A;  4YIJ A;  2VNU D;  1JOK A;  2O5I C;  4F88 A;  2ID0 A;  1NSN S;  1H9R A;  2JYO A;  1MSH A;  4ZUJ A;  3TN2 A;  2SEB D;  2X6L A;  1PLF A;  2FFK B;  4L63 B;  1LLR D;  3T51 B;  3RMH A;  1TII D;  3MHB A;  4EQN A;  3A56 A;  2J4X A;  1YNJ C;  4BWG B;  5I6Y A;  2O4X A;  1E0B A;  3I4L A;  2ICI A;  4X3S A;  2B2V A;  5KYI A;  4ODG A;  5E1F A;  4EQP A;  3DM1 A;  4KD4 A;  2E2J B;  1PRT C;  2R92 B;  2AWN A;  5C0X I;  1U9R A;  4KY5 A;  2LY7 A;  2RDG A;  5G3L F;  5IIF A;  1U4R A;  2Q8R E;  2LS0 1;  2HQE A;  1I4Q A;  1F9R A;  1V1P A;  2NWG A;  1HFN A;  4HN7 A;  3H09 A;  3A7L A;  4IZ8 A;  2F0V A;  1DOM A;  4FYD A;  2F03 A;  2RDH A;  1EWH A;  3FPP A;  3FVQ A;  5K36 G;  1PYW D;  4HR7 B;  1F9S A;  1EZ8 A;  2JEB I;  3VYT A;  2K5W A;  2L5T A;  3BYT B;  1TS2 A;  5EKI A;  1I4P A;  3L7Z C;  4KY7 A;  1VF5 C;  4CJ0 B;  4ZKB B;  5KND A;  1SNC A;  1LTA D;  3LNN A;  3OWE B;  5FO9 B;  2V4D A;  2H4O A;  4F8M A;  2L55 A;  2ZT9 C;  1RDP D;  3K5M A;  3E5S A;  2A5H A;  4OL7 A;  1AW7 A;  2BDN A;  1H9S B;  3EJI A;  1Q1E A;  4RAU C;  4PMW A;  1SNQ A;  4Z9C B;  4IQZ A;  1A6X A;  2RVL A;  2B63 B;  5E3F A;  5C4J B;  5M5W B;  2NTS A;  5KEE A;  5C0X H;  5I9P A;  2WKC A;  3HG9 A;  1ESF A;  1WTQ A;  5ISR A;  1SYB A;  5C0X G;  1G91 A;  1DJR D;  3MA2 B;  1B1Z A;  5A2Q L;  1SFO B;  3IL8 A;  1IKL A;  3HKZ B;  1TWG B;  1GHJ A;  2HUG A;  1DOK A;  1DYQ A;  2B8G A;  3PUY A;  2KCC A;  3J7Y W;  1TWA B;  3D31 A;  1LV9 A;  3M7N A;  1MI2 A;  3UI2 A;  4ZKC B;  3CRK C;  4QCL A;  1KDB A;  2A68 C;  1U4L A;  1ZXT A;  3R2I A;  5EPJ A;  3RLF A;  4IN3 A;  3S2D B;  1X32 A;  1PTO C;  4C3J B;  4RWS C;  5I6W A;  4U68 A;  1F2Y A;  5EBC A;  3OW7 A;  2D5D A;  2FMC A;  1IL8 A;  3G6J B;  4K2L A;  4G7O C;  1ROD A;  2L9H A;  3C3L A;  2A69 C;  2XRS D;  1B44 D;  3V96 A;  1UUP A;  2WAQ B;  4BY1 B;  4B9W A;  2NZ1 D;  5CMD A;  1Q90 A;  1A15 A;  3D4R A;  3W2D A;  3PMF A;  1I6V C;  3RZD B;  1JC7 A;  3HRZ C;  2VB2 X;  1M4V A;  3MFG A;  4K6D A;  1STE A;  2K5D A;  3LWU A;  4XQN A;  1BCP F;  2N55 A;  1CQV A;  2AQ1 B;  3VR6 A;  1PZJ D;  2PW5 A;  5CGK A;  5JAV A;  3GV6 A;  1FD7 D;  1B50 A;  3DHQ A;  5C4H A;  1TU2 B;  4MIU A;  1Q3L A;  2MUY A;  1QNU A;  2EPB A;  1TQO A;  4A3M B;  4HTH A;  4KY6 A;  4G7Z C;  1A3V A;  1D1I A;  1QIL A;  1RKN A;  3T13 A;  1OXS C;  3BVZ A;  2F0Q A;  2B2T A;  3TSS A;  2MPM A;  1D6E C;  1OXT A;  5IGC A;  1HTL D;  1F2L A;  1FYC A;  2EY1 A;  3GTQ B;  1AFP A;  3HOY B;  1JB3 A;  4QB4 A;  5IGF A;  1I4H A;  3Q22 A;  3CKI B;  3OMG A;  3TP7 A;  4DN4 M;  4XTC S;  3H91 A;  2AQ2 B;  2XVS A;  5JVG 3;  2F0K A;  2SNM A;  2EYO A;  4KKT A;  1E2W A;  3T56 B;  1YNJ D;  3IKJ A;  1PRT F;  2EY2 A;  3OIP A;  2ENB A;  3QIA A;  1ESR A;  2F3W A;  3T53 B;  1IKM A;  1GHK A;  1PXU A;  3C1F A;  3PV0 A;  4WOR A;  4ZK9 B;  2EYH A;  4V0B A;  3K58 A;  3W3A A;  2L11 A;  3D4W A;  1HXY D;  3TP5 A;  5KYL A;  3NTH A;  1SMY D;  1FGB D;  3GTO B;  1JWS D;  1HRJ A;  1ML0 D;  3ERO A;  5J39 A;  5M3F B;  4AYB B;  1Z47 A;  5CR3 A;  1EZ6 A;  2JE6 I;  3EA6 A;  3J80 L;  1HA5 A;  1FNV A;  1B3A A;  3SK5 A;  2M00 A;  3GTM B;  1RTO A;  5C3X A;  1D5Z C;  3V05 A;  3CRL C;  1Y8O B;  5C3E B;  4CGY B;  2K5Q A;  4IUT A;  5KIX A;  1TWF B;  1LT6 D;  4ULL A;  4C56 C;  5FLX L;  3ND9 A;  4RH6 A;  5C4X B;  2M2L A;  4A3I B;  1O7Y A;  3I73 A;  4HCE A;  1CHP D;  3Q24 A;  2A74 C;  4CKB A;  2JA8 B;  3HS0 C;  2IJ0 A;  4H7B A;  2KQ3 A;  1PFN A;  4ZYS A;  3T4A C;  2F0F A;  1DCZ A;  4B9X A;  5A2Q E;  3I91 A;  3OIQ A;  2K05 A;  2EYJ A;  2K01 A;  2QCP X;  5FK9 C;  3Q0A A;  4TQU S;  5DAU A;  3R93 A;  4HSP A;  2WV6 D;  1EYD A;  1J9O A;  3SEB A;  4L8J A;  3KLS A;  1EOT A;  2E2H B;  3SXH A;  2C5C A;  2IL8 A;  4PMB A;  3KBX A;  1SYE A;  3QO2 A;  1EY8 A;  2WB1 B;  4O42 A;  3D6W A;  1Y1W B;  1B53 A;  1DXM A;  2SDF A;  2ICE C;  2PZT A;  4ILW A;  2IX3 A;  5I2Y A;  2K32 A;  1S5C D;  2AUJ D;  1KDA A;  2KVM A;  4N9P A;  5LL6 S;  4DAV A;  1SNP A;  3GTP B;  2EDG A;  2PZW A;  3S1R B;  3NTI A;  1SDF A;  4BY7 B;  1V8Q A;  4DAY A;  5DM7 3;  1XXG A;  1QOH A;  2E75 C;  1STN A;  4FF3 A;  1G6Z A;  4DU9 A;  5COY A;  2FHT A;  2KEC A;  4F87 A;  2J0T D;  4G7H C;  1PTO D;  1EL0 A;  2H1E A;  1WTR A;  2HCC A;  4MN3 A;  4X3T A;  1D2B A;  5D3I B;  3J7A F;  3GTG B;  4QF4 A;  2XRQ D;  4RFB A;  5EPK A;  2G9H D;  2D62 A;  2KEE A;  4CKC A;  2MGS A;  5HUR A;  3QJY A;  3DWA A;  2A69 D;  5C0X J;  1KNA A;  3HOU B;  3U9O A;  4A93 B;  1GUW A;  5M9O A;  1QB5 D;  1EYA A;  2F0G A;  4DK0 A;  2IT1 A;  3VR5 A;  1F2Z A;  3SK6 A;  1S5F D;  4X3U A;  3IFT A;  1ILQ A;  5IOD A;  1DM0 B;  3S9W A;  2FIN B;  4KHV A;  2R3Z A;  2IWH A;  1OXX K;  5IT9 E;  4HMJ A;  1TS3 A;  4C2M B;  1CA6 A;  2EVB A;  1O78 A;  1SYD A;  3QG1 A;  4X3K A;  4KN4 C;  2F0J A;  1TKW B;  1GJX A;  3JAM E;  4KKU A;  3TBI B;  1DZ1 A;  1SMY C;  3HOW B;  3MEH A;  1Y8N B;  3PUW A;  1BQQ T;  4H13 C;  4XIG S;  1BNZ A;  1PFM A;  3P75 A;  5FOB B;  3BDC A;  2A6H D;  2MP1 A;  4BS9 A;  2BDO A;  2B2V C;  2QF7 A;  3NXW A;  1I50 B;  1JOR A;  1STA A;  2QKI C;  5D14 A;  5BN4 A;  3HOV B;  5CBA E;  1EY5 A;  4R8N A;  4S3S A;  5K36 H;  5C4Z A;  5E4W C;  2KA7 A;  1TS5 A;  1SSO A;  4KD3 A;  3BS1 A;  4XT1 B;  5I2X A;  3VYS A;  3LWE A;  1B4O A;  1M8A A;  2L1B A;  1S4Z A;  3FKI B;  1Y69 U;  4DAP A;  2BE5 C;  4RKB A;  1I3Q B;  3DEO A;  1DD2 A;  2FJ2 A;  3PIO 3;  1GUT A;  1Z6H A;  1FR3 A;  3V2T A;  1QNK A;  5TSS A;  2KOL A;  1S5D D;  3VR2 A;  5JPM C;  4J6H A;  4DXF A;  3HOZ B;  1CK1 A;  4C1N K;  5CV4 A;  2GA4 B;  3KK7 A;  5FLX E;  2RDF A;  3M85 A;  1SBB B;  2D9U A;  3A54 A;  3VA5 A;  4UAI A;  4O1N A;  2NVX B;  1BBX C;  5IGB A;  2RBM A;  4NMZ A;  2CQA A;  5E4X A;  5ELE A;  4DGZ A;  4N9T A;  2EYF A;  4DFA A;  1H9J A;  3GP7 A;  1A2U A;  4NP5 A;  1TWH B;  2CW0 D;  2QIL A;  5COR A;  4K14 A;  4QMG A;  1LTG D;  1LAC A;  3SE0 A;  1AZP A;  1SJE D;  4PNY A;  1V43 A;  3TZU A;  1EY4 A;  5EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...