5I6YA

Crystal structure of staphylococcal nuclease variant delta+phs a90e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLEYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i6yA00
3D4DA 1KABA 1EY7A 1EZ6A 2EXZA 4I65A 5IGFA 3MXPA 4S3SA 4B9XA 1SYDA 3SK6A 3EROA 2HQEA 4IZ8A 5E3FA 1ENCA 1NSNS 3OMGA 4EQNA 5I9OA 2SNMA 1JOQA 2PQEA 3R3OA 2F0MA 5CV9A 4QB4A 4K2LA 3NQTA 4NDXA 1A3UA 1EQVA 4WORA 2RDFA 5KYIA 2F0TA 2F0LA 1EY6A 3ITPA 1EY5A 3OMCA 5HGTA 4B9WA 3NHHA 1F2ZA 4KD4A 5K5PA 5ISRA 5KEEA 1STHA 2M00A 5IGBA 4N9TA 3MZ5A 3QB3A 4H7BA 5C4ZA 5HURA 4LAAA 2RBMA 1F2YA 4K6DA 1TT2A 3ERQA 4PMBA 1KDAA 4IUNA 1SYCA 2NUCA 5CC4A 4J1MA 5I6WA 1STYA 5IGEA 3DMUA 2PZUA 3V2TA 5C3WA 4KV6A 4K8IA 5EKKA 2F0OA 5CV4A 3NXWA 1STAA 2F0JA 5I9PA 2PW7A 3U9OA 5IODA 4KY5A 3QOJA 5IGDA 5IOCA 1JOKA 2EYMA 3BDLA 3NK9A 5KRUA 3P75A 4NMZA 2EY5A 1JOOA 3T13A 4KD3A 4N9PA 5DEHA 5C5LA 1KDBA 4EQOA 2F0SA 5CV5A 1ENAA 1U9RA 2EYHA 2F0FA 5CR3A 2KQ3A 3T16A 4DGZA 4DU9A 2LKVA 3D6CA 2EY6A 4PNYA 4DF7A 4G57A 1EY4A 1EY9A 1SNQA 1SYFA 4NKLA 3SK4A 3S9WA 3HEJA 1TQOA 3VA5A 5CV6A 2F0IA 1SYBA 3PMFA 5JOBA 1SYGA 2ENBA 1A2UA 1SNDA 3E5SA 3EVQA 2SOBA 3HZXA 2F0GA 1EYDA 3P1HA 4K5WA 2F0QA 3SK8A 3C1FA 4QMGA 1SYEA 4WRDA 5CGKA 4PMCA 3QOLA 4HMJA 5KIXA 1EZ8A 3OSOA 4K14A 3SR1A 1EY8A 4HMIA 2EYJA 2PZTA 4NP5A 4R8NA 5EKLA 2EYLA 4ZUJA 4EQPA 2EY1A 3MEHA 5IIFA 5KYLA 3SK5A 2F0PA 4KJNA 4RKLA 4KHVA 5C6AA 4DFAA 3MHBA 1EYAA 2F0WA 2F0VA 3TP7A 4K8JA 1JORA 2O4XA 3D8GA 5CV7A 4KY6A 4ZUIA 4F7XA 4KTAA 3NP8A 1NUCA 1TR5A 5CV8A 3SXHA 3RUZA 3DHQA 1RKNA 3OWFA 1EYCA 1A3VA 4K5XA 3TP6A 5C3XA 2EYPA 3H6MA 2RKSA 1IHZA 2KHSA 3NUCA 4OL7A 5DAUA 3TP5A 1F2MA 4K5VA 2EYFA 4IALA 1KAAA 3MVVA 1SNCA 2EYOA 2F0NA 2F3VA 3D4WA 2WACA 4TRDA 3TMEA 5KGUA 5C5MA 1AEXA 3BDCA 5F2DA 1SNMA 4ZQ3A 4F8MA 5C4HA 3EJIA 4MIUA 3LX0A 4KY7A 4RKBA 2PW5A 2F3WA 1SNPA 4YIJA 1II3A 5IGGA 1KDCA 2F0UA 3C1EA 5M9OA 1A3TA 2OXPA 2EY2A 1STGA 4QF4A 5E1FA 1STBA 1EY0A 4J6HA 5J22A 2F0KA 4EVOA 4KJOA 2PZWA 4HTHA 5J39A 5I6YA 2PYKA 5EGTA 2SNSA 5J1ZA 1SNOA 4ODGA 3TP8A 5IGCA 2OF1A 2QDBA 2F0DA 3SHLA 5JAVA 4K2KA 4ME5A 2F0EA 4E6IA 5NUCA 1A2TA 2OEOA 4ID6A 2F0HA 1STNA
chains in the Genus database with same CATH superfamily
1UEAB 4I65A 1LV9A 4K6LA 2N88A 3GTKH 3L9AX 2HQEA 4A3LH 1WYDA 2SNMA 1WI5A 1GVPA 1VF5C 2UUCL 1XNRL 1IBKQ 3JAML 3I90A 1Y1WG 5JEAJ 5ELCA 2UU9Q 2RSOA 1W3SA 2MPMA 3CCJA 1BOSA 2F03A 3N6RA 2NN6G 1BVSA 5HURA 2LFNA 1FVIA 1PFSA 2ZT9C 3A74A 1T5XD 3MC0B 1STYA 1NMGA 3C46A 3G6JB 4DR6L 5EKKA 2LY7A 3M85A 1WCMG 1Q12A 2K5HA 3I56A 2B63H 3ULJA 1TWGH 2CQAA 3M4YA 4DR5L 4PG3A 3H3VC 3S1NB 4LFCQ 1X55A 3K81C 5DEHA 4EQOA 3I8ZA 4DU9A 2JA6B 1J5EQ 4DGZA 2EYHA 3PF4A 2B2UC 5M5WB 4FXGC 4G7OC 3RD4A 5LMUQ 3LWUA 1SN8A 3I3CA 1PXUA 2K50A 5M3MG 5M5XB 1SSOA 1J8IA 1ZEQX 2EQSA 3HKZG 2OTJA 4HMJA 1EIGA 1PH7A 5D14A 3A8JE 1RJTA 3DWAA 3SK5A 3FKIB 1JWUD 4OHJA 2RDGA 2XVSA 3CKIB 2F0VA 3BZCA 4AQYL 2H4OA 1O7ZA 2K5VA 4XXEA 1PZID 3EIVA 1Q8IA 4XTCS 4HJAA 2KHSA 3J81j 4IALA 4JOIC 1QNKA 5JEAG 3PF5A 1KTKA 1XTCD 2BH2A 4B3SQ 3EJIA 1I94Q 4JI7L 1SE4A 3JC66 2PW5A 5JVG3 3OHXC 4JI3Q 5M9OA 3G6EA 3AFPA 1EWHA 2DY7A 3PUZA 4DA2A 3R93A 1PYSB 3TSSA 5J1ZA 2EOTA 2ZTCA 4BBSG 3A7LA 1S72A 1A2TA 1HA6A 2VUMB 1QVCA 3HGBA 4LF6L 3MXPA 3S15H 4GKKL 2EJFC 1ENCA 2HDLA 1N9WA 3PIO3 4EQNA 2E5LL 3GTGH 3W1GA 2V1CC 4L5QA 4B3TL 3KJOA 2F0LA 1CFMA 1GO3E 5IYBG 4DAYB 3ERSX 5DM73 1D5XC 3KYHC 4QIWE 4MTKA 2O2LD 2ES2A 1ZYRD 2NBFA 1JT8A 1HFGA 2F0JA 5G3LF 4JI5Q 1AW7A 4C2MB 4JI7Q 2VNUD 3URYA 1PRTD 4DV2L 1JR0D 1B53A 4DV4L 4A3GH 2WAQE 4U68A 5C4XB 2KQ3A 1Q82C 1CQVA 2NVXH 3HKSA 4YY3Q 2KCTA 5CBAE 4TQUS 1V1PB 2B2TC 3K8AA 1LTGD 1SNDA 2F3IA 3P1HA 1VQGA 1YNJC 3T1YQ 3M7NA 3L2PA 1SEBD 1DONA 3HS0C 4DV0Q 1HNWQ 1YHBA 2MNAA 1GJXA 1EEID 4JC0A 2IWHA 5GAHC 3DWPA 5JJIA 4YHHQ 1I6VC 3CPWA 4JI0Q 1X9NA 2ZTEA 2WB1B 3S17B 3CU7A 4C3JG 1TWHB 4J8QA 3AU7A 1HR0W 2B2YC 1AEXA 3GV3A 4IFDG 2UXCL 3GTJB 1Q1EA 1PFMA 4IFDI 1D7QA 1NBWA 4IQZA 1I6HB 1VQKA 1A3TA 2KCCA 1SLJA 1IBML 3I4OA 1EY0A 1S5CD 2HCCA 4IPCA 3STBC 1EL0A 5IP7H 2BDNA 2GN5A 2F0HA 2B2WA 2L0CA 4H02A 4RH6A 4LW1A 4CJ0B 1SYDA 3KJPA 4ZK9B 1MKHA 4ABNA 2RVLA 3VYUA 1B9MA 3WWVA 4LFAL 4DPGA 2NN6H 1A3UA 2E2IB 1K8OA 4X6AH 3MXNA 2B2YA 2EE1A 1RTOA 2CH4W 1VQNA 5K5PA 1SMYD 2A19A 4JVZA 4JYAL 2E5LQ 1F2YA 3H94A 1IBLQ 3CQZH 3H09A 3NE5B 2UUAL 3VYSA 1GKHA 1LUZA 5G3LD 2VQEL 5I6WA 3CHBD 2SEBD 2K52A 3G71A 3PUVA 5H1SE 3NXWA 4A3EH 1STAA 2UXDL 2AQ1B 1TS5A 4FP5D 5I9PA 1K8AC 3O13A 4LNQA 5ELNA 2YU9B 2Q8IB 4DV4Q 4NMZA 1QWYA 1V1QA 4QQBX 2F0FA 1U9RA 3BU2A 2MQHA 4N8FA 1PYBA 4PNYA 3IFTA 2BOSA 3S24A 2KENA 3I4NB 1SYGA 3M4OB 1NNXA 1IW7C 2R7DA 1ILPA 2R7ZH 1K8MA 2ZM6Q 1ENFA 4KHZA 4DK6C 1G91A 2PZTA 1HNWL 2B2VC 4X66L 3X3NA 4CKEA 2B63G 3D31A 2JA5B 1GUTA 4ALPA 1WTPA 1MSHA 4O42A 3TBIB 4ZUIA 1NUCA 1TWAH 2E75C 3QR8A 4APVA 1XJVA 1PH1A 3FKIH 3H6MA 2BE5C 4GZYC 1F2MA 4A3MB 1RD9D 4R4QA 4O2DA 2EJGC 3T51B 2A1AA 1YJ9A 3HOYG 4TRDA 1E2WA 5C4HA 3J81L 4RHRA 4IURA 1KD1C 4DV7L 1JICA 3UI2A 2B2TA 2A6HD 4PQXA 1FL0A 5IGGA 1WTRA 4LWCA 1XMOL 2B2UA 4GN3B 4GKJL 2OXPA 3E6ZX 3S2HH 3EFXD 2AQ3B 1KC8C 5FJ8G 2PYKA 1JB7A 3PGZA 5ELDA 5JAVA 1GUSA 3ZJYC 1VQIA 4RCNA 1NR4A 2RCFA 4NXMQ 4UY8C 2FJ2A 4FF3A 1HHVA 4IZ8A 2JA5G 2NVQB 1X32A 1MIUA 1BQQT 3M3YB 1VQJA 2C35B 1VQDA 2IT1A 2HUGA 1OTCA 3S1RH 2BH8A 3JAMc 5ISRA 1QZHA 4A3KH 2JK8A 1NY4A 2UUAQ 2X69A 2WV6D 3ERQA 4C3JH 1IBLL 1EOTA 2NUCA 2G5DA 4PV1C 1NAPA 3V2TA 3L0OA 1Q86C 3RLOA 4DV1Q 4X64L 4BS9A 3STBD 3GTMB 4Z9CB 3A55A 5IODA 3PO2H 5IGDA 4DN4M 3MTSA 4DXFA 1K9MC 1JOOA 2HD3A 1XMOQ 4WJ4A 1HPCA 4IPGA 1N33L 1KL9A 1LTTD 4IJLA 1BXTA 2C9OA 2ALYB 1P8LA 1TQOA 3NWTA 1IYVA 1EFWA 2N3SA 1VQ6A 3OIQA 3FMCA 1VQ9A 2R92B 4KK7A 4KN4C 2B8FA 1G8ZD 2DJFC 1PDQA 2KBNA 2Z8LA 3PUXA 1UAPA 3GTLH 2DY8A 1K83B 4BXXH 3K0YA 4OWTB 2RSNA 1V1OA 1VQOA 4C1NI 3CMAA 2DJGC 3G48A 1B7YB 1N33Q 4GKKQ 2L15A 1XXGA 1GUWA 2LMCB 5CBEE 3HFZB 2RDHA 3D4RA 3W5OA 3HOXH 3TP5A 2BCOA 4FXDA 1MD2D 4DK3C 1K3RA 1OXXK 1HUNA 3CP0A 3F2BA 2F4VL 4L5TA 5LMNW 5C44B 4GOPC 1CZGA 4RKBA 3HOZH 1HNXL 1HCZA 1V8QA 3GTLB 2E2JB 1VS0A 1A0IA 5LHY1 1HXYD 4JI4L 3J80c 1E2VA 1XNRQ 2OF1A 2QDBA 2E2HB 4CGYB 4ZYSA 5FO9B 3K7UC 4DV3Q 4A3EG 2ZXRA 2BA0A 1RODA 3D4DA 3S1RB 3AYHB 5KNBA 5E3FA 1VQHA 5I9OA 4HAEA 3PIPA 1Q3LA 3VA7A 4QJFA 4HJ7A 3A54A 4V0BA 3GTGB 1BNZA 2ZXOA 1L2FA 2QDLA 1JMCA 4LF7L 3E9IA 1TWFB 1HZBA 1BUVT 4PZ6A 1PH5A 2D62A 1S5DD 4FF2A 3J7AF 4R8IA 4JI2Q 5C3EB 4A3DG 3SEBA 2XWJB 2NYZD 3P20A 1TWAB 1ET6A 5IT9E 3FEWX 5IP7G 4A93H 2K33A 1X65A 5FO8B 2JXMB 1GOZA 4A3LG 3NENA 4B08A 3SVMA 4LF4L 5CYUA 3K58A 4OONA 3J81c 1UWVA 2YTVA 5M5WH 1OXSC 3T16A 2LXKA 2P5ZX 4UPAA 3UDIA 3HOUH 3E0JA 1FR3A 3GO5A 3T53B 1I50H 2A6EC 4JG2A 2UU9L 3SK8A 1BCPD 1I4PA 1TS4A 5BN3A 1GUNA 3S2HB 5LL6X 5ELOA 5JPNC 4GN4B 4YY3L 4P71A 4C3HG 2B3GA 4P72A 4A76A 3IRBA 2NTSA 3UE0A 1Q8KA 4QCLA 1PRTB 3BS1A 4BBSH 4JV5Q 5GQOA 4CKCA 1XNQQ 1LTRD 1VQCA 2JA9A 2IL8A 1KNAA 4A3EB 3B6YA 2PNRC 1EFID 1F9RA 2JN4A 4UP7A 3TP6A 3NUCA 4BBRG 2Q2UA 2CHBD 4A3KB 1LTLA 4LF9Q 1H9SA 5KGUA 3ND8A 2EPBA 2VL6A 1AE3A 2C5CA 3ONAB 1HNXQ 4HN7A 1JWSD 3M4QA 4DUZL 1EQRA 1II3A 3KLRA 2F4IA 3OIPA 1KLGD 4F87A 1CSPA 4H13C 5I6YA 4L5RC 2UXBQ 3I4NH 2Q8RE 1GUGA 3S1MH 2AUJD 4LF5L 4I7AA 4S3SA 4RGOS 1YIJA 4X62L 3FKIG 3GTQB 1OXUA 1JWMD 4EX5A 5IP9G 4WJ3M 2R7FA 4LFBQ 2VY3A 4HIKA 3BZDB 2NVYB 1A8VA 3ND9A 1BCPF 3A5ZB 1F2ZA 1TU2B 1ICWA 1S5ED 5FLMG 1STHA 2NWGA 4A3IB 3MFYA 4R4CA 4C3IG 4A3BH 4RHSA 3AEVA 3CCMA 4C1NK 4IUVA 1E1TA 2L1BA 5CORA 2FMCA 4DNIA 1PHJA 4HSVA 1PH4A 4KV6A 2G9DA 3PSIA 4JBMA 3F1ZA 4X62Q 2CQOA 3OTOL 2XRQD 2DNCA 1YEZA 4LF7Q 1Z47A 1CKOA 1GXDC 1CQFA 3K5OA 4A3MG 2QW7A 2A73B 4A3FB 3D6CA 2E8GA 1W6JA 1JB3A 1SNQA 4HSPA 5E7NA 4LK1C 1F9QA 5CV6A 4A3JB 1VMCA 4B3ML 5IWAL 3AMUA 1Z9FA 2HQLA 4YWMA 1BF4A 1FGUA 3J80L 1WTOA 4A3KG 1HRJA 2QA4A 2RHSB 1KRTA 1EZ8A 1VCIA 3V05A 5J39A 1GHKA 4EQPA 1I4RA 3UDFA 1LT5D 5KYLA 1TWCH 1IYJB 2F0PA 4GN5A 4RKLA 3NTHA 1X3PA 1GM5A 3NBHB 3J80E 2HHHQ 1XTDA 1SR3A 3PO3H 1G51A 4BA1I 3N52A 1I94L 3S17H 3PV0A 1WTXA 1PTOB 2EIFA 4DV2Q 1X3EA 1J5EL 2N8NA 1E7ZA 3HOZG 3MXUA 1IW7D 5M5YH 3CC7A 1SFOB 1YITA 3Q8DA 4G7HC 5LMUL 1MGSA 2JYOA 3J80i 4MIUA 1SXTA 5FO7B 1WTWA 2F3WA 3VR3A 1HNZL 2JA7B 1JQYD 1G2TA 2J0TD 3U4ZA 2NB0A 4J6HA 3AFQA 5EBCA 1NTGA 5IGCA 4JCVE 2B29A 1SJED 4B3TQ 4A3DH 4DV6L 5DLQE 2CH4A 3K5NA 1CA5A 4RCOA 2NVXB 3OWEB 3RZOB 5I2YA 5A2QL 5FK9C 2X6GA 2A6ED 2QF7A 4R1JA 4OIKA 3NQTA 3I55A 3Q24A 2R61A 4DK1A 1EY6A 1EU4A 4CKBA 1PH8A 4R4OA 4LF5Q 4IFDJ 1PTOF 5C4ZA 2JA7H 3I4NG 3KUPA 1KDAA 2QKIC 3OOCA 4IUUA 2WKCA 1STEA 1PH2A 2OWOA 1LT6D 2XN9C 1V9PA 3MXNB 5HGQA 1WJJA 1W6KA 2H1EA 3E3XA 2WP8J 5KRUA 1JE4A 1JE5A 4DV3L 3D6WA 4GS3A 2WB1G 2F1MA 2OQ0A 2YYZA 5C5LA 3UDXA 1HFNA 3W2DA 4N8X1 3FVQA 3SK4A 3JAME 2F4VQ 3R8BA 3HEJA 5C0XG 4BY7B 1S40A 1SBBB 5C44G 4H44C 1R4PB 1IKLA 2ENBA 2IPKD 1A2UA 3E5SA 4GNXA 3PO2B 2F0GA 4A3CH 4ZAIA 2F0QA 1TXYA 5EAYA 5CGKA 4C3HB 1A62A 4HMIA 2DN8A 1C0AA 1EEFD 1WTHA 2K05A 4X65L 1CKNB 2R3ZA 2RHQB 2HIVA 5LMNQ 2IX1A 4OO1I 3K5MA 2UXDQ 2VQFQ 3PQIA 2PQAA 3FP9A 3OWFA 1QG7A 2FINB 1W2BA 1EYGA 3NTKA 2DUDA 1IHZA 1LACA 1N32L 2M2LA 1BCPB 3RR5A 3F2DA 2I07B 3ULLA 4HCSA 1SMXA 3S1QB 1WD0A 1GD7A 5C5MA 1J6QA 2O5JC 5C4JB 4IN3A 3S1NH 1WFQA 2F0UA 4P75A 1K8GA 4IFDH 4JBWA 2ASBA 4IUQA 3KLSX 5E4WC 2F0KA 3F2UA 3SGIA 1IBKL 3HOZB 2GVAA 3GQBA 5NUCA 1YJWA 5FLXL 1KAWA 1K83H 1KABA 2B8GA 4KKTA 3SK6A 4QY7A 1JOQA 2WIIB 3HOXB 1C9OA 3RN2A 4JI8Q 3QIAA 1Q90A 5CV9A 3C2PA 4K2LA 1PTOD 1HA5A 4DUZQ 1B9NA 4OWXB 1ESFA 5HGTA 2WINB 1YI2A 2Z6KA 4P74A 5KEEA 1B44D 1GHJA 3MFGA 1TVXA 1Y8OB 1HTPA 2A68C 2NVTB 1IZ6A 2PQAB 4QUCA 5EBDA 3J81i 5GADC 4Y7NH 1TS3A 1VDZA 1PA6A 4BY1H 2K28A 5C3EH 4A3FG 3BDLA 4CJ1B 1EIFA 3NBHA 1ZYRC 1O7LA 1KDBA 1PLFA 3HP3A 2Y0SE 3FHWA 4R9WA 3S15B 2LKVA 2JA7G 4G57A 2VUMH 4NKLA 5IT9L 2BE5D 4QGUA 2N78A 4A3GB 5GROA 2KEDA 3CCSA 3DEOA 1Q81C 2CWAA 2XTIA 2IY5B 2I5LX 1SYEA 4WRDA 4KN7C 5E4XA 4A3IG 3HOWH 1AFPA 3T56B 3WDNA 5KIXA 1MJCA 3SR1A 1EY8A 4EGVA 2EYJA 2F52A 1HZ9A 3MEHA 1SE2A 1Y69U 3VYRA 3M7GA 4KHVA 4X65Q 3S1QH 3CRKC 3MWYW 3D3RA 2O4XA 2K5WA 2ZJQA 4KTAA 2B63B 3CCRA 2VQFL 2UXCQ 3RUZA 1RKNA 5AJ3L 2UUBL 1E1OA 5K36G 5JJZA 3TRZA 2RKSA 1C7YA 4K5VA 4TSSA 1VQAA 2PO4A 4DR1Q 4HCEA 4JV5L 1VQBA 2WACA 4ZKBB 2E74C 3RNUA 4ZQ3A 4DUYQ 1C4QA 1Y14B 3KDFA 1MI2A 1EWCA 2MGSA 3AQQA 1BDOA 1DZ1A 4LJZC 4TVAB 1WTQA 1D6EC 4A75A 3ICEA 4BBRB 1X3FA 3GTJH 1X3GA 1HQMC 2JJQA 1TS2A 3TDQA 5IGFA 1WVLA 1Y1WB 1FJGQ 3E0EA 4R4IA 4IPHA 4RWSC 1LLRD 3D0FA 3MAQA 3WOFA 4KHPQ 3J7YW 4QB4A 1D5ZC 5TSSA 3PIOA 1JJCB 1UE7A 3HKZB 4HJ8A 1EY5A 2EZVA 4DNRB 1CA6A 3F2CA 3IL8A 4LAAA 2D0OA 1U0LA 4UDUC 2PZUA 4A3GG 4GKJQ 2CFMA 2XGTA 4WJWA 1JJ2A 1PRTF 4MZ9A 1T5EA 1XNQL 4NW2A 4Y52H 1PVOA 2ICEC 3U9OA 4IUPA 4KY5A 3HOYB 4FF1A 1MBYA 2AKWB 4P73A 2E2DC 4HJ5A 4GNXB 3VR4A 4ZKCB 1M4VA 1YZ6A 3KBXA 1SROA 1SMYC 3GTQH 3V96A 2Z4HA 4DF7A 4GLAC 2JA8B 3S1MB 3HOVG 4DV6Q 2MHVA 4R4TA 3PMFA 5C3EG 4A3DB 3T1YL 2E2IH 2YU9H 2K04A 5BR8L 4IOCA 1UE6A 4BWGB 2NVQH 3BVMA 4YHHL 3OSOA 3NELA 1N36L 1UNSA 4DV7Q 1H95A 4LUZA 4PZ7A 4LFCL 1QCBD 1JCKB 2I0QA 1V1PA 1EYAA 2WKDA 3H0GB 2K01A 1QOHA 1MHWC 1RCVD 4X64Q 3HOXG 2Z1CA 2AWOA 5ELBA 3DHQA 3TZUA 4JI6L 2EYPA 1CT1D 1LTSD 3H91A 3AB9A 2O5IC 2KHJA 2EYFA 2NN6I 3CCUA 3M9BA 2CW0C 3K57A 2K5NA 2VXWA 3KF6A 2VZAA 1AP0A 2TMPA 1Y8NB 1DCZA 4YIJA 4DR4Q 4HEDA 4KKUA 3GP7A 3EBEA 4BY1B 1C48A 5LL6S 2Q8TA 2BA1A 2PZWA 4HTHA 3W3AA 1CHPD 3X3MA 5IYCG 1LO5D 2JSOA 1SNOA 4ODGA 4LFAQ 2F0DA 1VMPA 2F0EA 3TN2A 2PPBC 5A2QE 1OXTA 3K7AB 3K5LA 5K36H 5IT9c 5JJLA 4G4KA 3U4VA 4DAPA 5JJKA 4CDEC 2PMZE 3RZDB 4YWLA 1F9PA 2F0TA 3QO2A 3OMCA 4DXGA 1FNWA 1XYIA 4N9TA 1N34Q 2RBMA 3NSWA 2R92G 3NWSA 2Z6BA 3BVZA 1LM0A 2NZHA 4KKSA 4P2CB 2VUMG 3KF8A 1M8AA 1G2SA 1CKMA 5M3FH 2DNEA 2PW7A 5I2XA 4BBSB 3QOJA 1CM9A 5IOCA 4GOPA 4C3JB 1HR0Q 1YVCA 3RLNA 4KD3A 1I5FA 3IAYA 1YJNA 1TKWB 2F0SA 4KLKA 3TS2A 1DGSA 5EJWA 4ME3A 3VA5A 3HOWG 3S16H 1BR9A 2E2HH 4RGTA 5A35A 4HIDA 3IKJA 2ZTDA 2KEEA 2ZJPA 4K14A 4XQNA 4NP5A 3K7AH 4Q5VA 1K0SA 2EY1A 2Q2IA 3M4OH 4A3CG 4ILWA 4KJNA 1AN8A 4ULLA 1LTID 1L1OB 1Y1VB 4KY6A 2R93B 4F7XA 1TR5A 3I4MH 1Y1VH 1RTNA 4GLVB 4AQYQ 2R93H 2JE6I 1QZGA 3CC2A 2PI2A 1A3VA 1A15A 4RAUC 4JI8L 2IJ0A 3BZKA 2L55A 4DAMA 3CCEA 2IW3A 1TWFH 3RMHA 3MVVA 2F3VA 4F8MA 3CMEA 2M9VA 4G7ZC 4A3MH 1N8RC 3J7ZC 1VQFA 4JK1C 2SDFA 3VR2A 2B2WC 2RA4A 1R4QB 4LF4Q 4FVMA 2Q2TA 1LTBD 1YNXA 5E1FA 1JC7A 3A0JA 1SE8A 3OTOQ 2JA5H 1BCPC 5FKAC 4A3BG 4X3SA 1WCMB 5T1IA 2Q2HA 1QUQB 4FO2A 4OXPA 5FLMH 3HG9A 3EROA 1IXRA 3K0XA 1Q7YC 1AZQA 4B3SL 4OO1H 5FOBB 1M90C 4U673 1KIXA 4CHTB 3PO3G 1PFBA 2PCFB 4LF9L 3ITPA 2XIWA 3L7ZC 5DNFA 3QG1A 2L9HA 3I72A 2PMZB 3BYYB 3BDOA 2EDGA 2MO0A 3HRZC 4A3JG 2ZM6L 5IYDG 2AUKA 1HUMA 4CDCC 1HJPA 2E2JH 4RG1A 2KHIA 4I7ZC 2NVTH 3KOJA 4DK0A 3T4AC 1H9RA 2KVMA 1PYWD 4N9PA 3KF8B 1BO0A 1RIPA 1L0YB 2EY6A 4NB3A 3CRLC 4LMQD 1FNUA 1VQMA 1SYFA 1UEBA 1SYBA 2RCNA 3VR6A 2KJXA 1TWGB 3HZXA 3TZDA 3M4PA 4C3IB 3GTOB 4XT1B 2YTYA 4FNFA 1QE6A 1KNEA 1M1KC 4DR5Q 1CI3M 2CW0D 1TWCB 4X3UA 2A69D 5IIFA 1IKMA 4LFBL 5M3MB 1N32Q 5D3IB 4DR6Q 3GTMH 1PFNA 3DM1A 4QIWB 3I70A 4ZLTF 1DOLA 2KCMA 2JQOA 3R2TA 1NCVA 1EYCA 3KBGA 4CJ2C 1ONLA 4IO9A 2VQEQ 1I4HA 3ULPA 2JA6G 4HIMA 2I46A 2TSSA 1QNUA 2WFWA 1PH3A 1ML0D 4XQQA 4KY7A 3NBIA 4NXNL 2EJMA 2YTXA 5IYCH 2RF4A 3S2DB 1PMRA 3QJYA 4NPSA 3Q23A 4JI4Q 1I4XA 1YHQA 4ME5A 4JI0L 2XRSD 4DR2Q 2OEOA 3LNNA 4DAYA 1STNA 4B3RQ 4XQJA 1EY7A 1XPUA 1MJEA 1LYLA 1NSNS 1L1OC 2G9HD 3G7LA 1D5MC 4RA8A 3KLWA 4WFN3 5EQ0A 4JI6Q 2CWPA 1U4PA 3A8KE 1QILA 1HZCA 4KD4A 2I5MX 4DUYL 1GUOA 5IGBA 1ASYA 3GV6A 3MZ5A 1B4OA 1K3BC 1KHIA 3JAMi 4CBVA 2B39A 4OO1G 3CW2C 3VYTA 4J1MA 4OWWB 4B3RL 1B50A 3DMUA 1XWEA 1BBUA 1S3OA 5CV4A 4PMWA 3CCVA 4YCUA 1E0BA 1FYCA 2QEXA 3MA2B 2NZ1D 1HNZQ 5CR3A 3PUWA 1SFOH 5M5YB 2DGYA 4AH6A 1CHQD 1XPOA 1EY9A 2L4NA 2NZOA 3G4SA 1DYQA 1XMQQ 1EQQA 2NVYH 2XSCA 4QL5A 4POGA 3HOYH 5LMNL 3NPPA 3C1FA 4AYBB 3BJUA 5ELFA 4PMCA 2Y0SB 1WTVA 4JPBW 4RMFA 1H9KA 1Q1BA 1O7YA 5M3MH 2K03A 2GA4B 1E24A 1I4QA 4L5SA 3TP7A 2VW9A 4K8JA 5BR8Q 1VQ7A 3E9HA 1ICFB 1F2LA 1UE1A 1TWHH 1S4ZA 1YNND 4DV0L 3U9SA 1D2BA 2D0PA 2K5DA 3FPUB 3FRPB 3HKZE 3CXCA 3CQZB 4PZ8A 4X66Q 3VDYA 5C4JH 3HOUB 2IHFA 1SE3A 1KAAA 4A3FH 2A5HA 1SNCA 4UHVA 5F2DA 3UE1A 1F9SA 4GLXA 1HH2P 1SNPA 5KNCA 3CCLA 1U4RA 2ATWA 3ZYYX 2R6GA 4CDFC 1OO9B 2OT2A 1NMFA 1QUQA 2CCZA 3MXGA 4DNTB 1P16A 1I3QH 2SNSA 1B1ZA 1U4MA 2A74C 1JOKA 4DR2L 3I4LA 3GTKB 4B9XA 3KDFB 1TIID 1PRTC 1KLUD 3R3OA 2Z9HA 1EQVA 2RQXA 4B9WA 5IY0A 4CDDC 3NHHA 1PH9A 2CKZB 2YV5A 4H7BA 5BN5A 1O78A 1VQ8A 2MFIA 1PZJD 3DEPA 2QCPX 4KMUC 4JI1Q 4DKAC 2L5TA 1B3QA 4A93B 3U50C 3CD6A 4YCWA 3OW7A 3CF5A 1I6HH 1SRUA 1PV4A 2K14A 2KUMA 3Q0AA 1B3AA 2AMCB 2EYMA 4GNXC 1WD1A 3P75A 2AHOB 2KA7A 4XT3B 5JPMC 1B8AA 4A93G 5CV5A 2I5HA 4JBKA 1EY4A 2BDOA 2H5XA 3I7FA 4DR7L 1IL2A 1EU3A 4JI1L 1HQRD 1VF7A 5KNDA 3J81E 2SOBA 1XPRA 3OYYA 1EYDA 4XYQA 2LXJA 4DAVA 3RZOH 3CCQA 1DD2A 3C3LA 3KK7A 3QOLA 5BN4A 1E2ZA 3ER0A 5C4XH 4R8NA 1D8LA 3F8TA 2CVRA 1K28A 4H0LC 2AWNA 2VB2X 5IYDH 2D2CC 3I91A 2A6HC 5C6AA 4DFAA 1RF2D 4POFA 2OQKA 2QEJC 5HY6A 1RDPD 5FLXE 2WB1E 4FDBA 5CV7A 3PUYA 4IJHA 1EIHA 1WOCA 1ILQA 5C3XA 2ZXPA 3VR5A 2MJ8A 4M8AA 4RGNA 3WOEA 4DR4L 3S14B 1Z6HA 1YBYA 3CAMA 1DJRD 3QWNA 1NR2A 4TKOB 3LGJA 1SNMA 1U4LA 3W1BA 1G6ZA 2VS1A 1CKNA 2LS01 3GTPH 1FNVA 4A3IH 1B2TA 1X3QA 3Q6SA 1I3QB 4GOPB 3H3VI 2JP1A 3C1EA 3KFUA 5J3BA 1A6XA 5J22A 4EVOA 2FHTA 2MO1A 3DUZA 3H15A 4X3TA 1B70B 4ID6A 3LX0A 4MN3A 2EXZA 1EZ6A 2K1BA 5GAGC 2JA6H 1E3PA 1N34L 1E22A 1EOVA 2PQEA 2K7VA 2JEAI 4OX9L 3PIP3 2RDFA 4AIMA 2Y0SG 3DXJC 3BYTB 4RFBA 4HR7B 4LF8L 3K59A 1L1OA 4IPDA 4OGQC 4OIJA 1DOKA 4DV5L 1RL2A 2J7ZA 4PMBA 3HOVB 2HIXA 5CC4A 2JA8G 4OELB 2KOLA 5IGEA 2FMMA 1F77A 1D1IA 1LABA 2N55A 3L3OC 4RGMA 4DR3L 2QGQA 3BG3A 2EY5A 4K0KQ 1SDFA 1DOMA 1HTLD 2B2VA 1V43A 4IUTA 2QILA 4DV1L 1N36Q 5M5XH 2UXBL 4UP9A 1NJIC 4FXKC 5FJ8H 3CC4A 4EQ5A 3PCOB 1H9JA 1H9MA 3GDEA 1S5FD 4ZUJA 5EKLA 4J15A 1EWIA 3A7AB 1CSQA 1H9SB 4HIOA 3MHBA 1PTOH 4KI0A 3D8GA 2KECA 4MNOA 2R92H 3SXHA 2XWBB 2MP1A 1TY2A 2EXDA 5AFWA 4L6TB 4C3HH 1O7IA 4K5XA 5DAUA 1KXLA 1R9TB 1C8CA 2K75A 1CZWA 2X6LA 4LUOA 1PH6A 4BY7H 1EIYB 2WAQB 1G291 1K73C 3TMEA 3BDCA 1IYUA 4BA2I 1LTAD 5M3FB 5JVH3 3Q22A 2NTTA 3T1HQ 2EY2A 1STGA 4C3IH 2XNAC 1STBA 3GTOH 4KHPL 1QJOA 4DV5Q 2K5QA 4YWKA 1XMQL 2FXQA 4K2KA 4M1UB 4E6IA 3DM3A 3NTIA 5L37A 4BXXG 1CTMA 5I4DA 2N49A 3K6OA 3OPOA 3UDGA 4HJ9A 1Q46A 4OX9Q 3RZDH 1J9OA 1I50B 3NEMA 3I4MG 4A3BB 1SAPA 1X6OA 4AYBE 1TY0A 5IE8A 1ZXTA 1Y1WH 2K4KA 4JBJA 2VB3X 2R7ZG 4B3MQ 1KRSA 1TT2A 5COYA 5GAEC 4Q0FA 5C44H 4JW0A 4XDXA 5C3WA 4JOIA 4K8IA 2F0OA 3FPPA 1BBWA 3OW2A 4FF4A 4XYOA 3J7AV 5C4XG 3NK9A 3R2IA 4A4IA 3T13A 1OXVA 5EKIA 4JI3L 4X3KA 2GVBA 3RN5A 4O1NA 5AJ3Q 1VQEA 5JOBA 3M3YH 3EVQA 4FYDA 5DM63 4K5WA 1VQ4A 1YNNC 4L63B 2FFKB 2K32A 2A69C 1G6PA 3TQYA 2JA8H 1DXMA 3PO3B 4ZRZA 3EA6A 3LWEA 2EYLA 3DLLA 1UUPA 2V4DA 5D3DA 5T1GA 2JEBI 1Z7TA 1A63A 3A56A 1K0RA 4JI5L 2Z0SA 5EPKA 3HOWB 3MEFA 3NP8A 3I73A 5CV8A 1FGBD 1PZKD 4QUFA 2ZJRA 3KLSA 3GTPB 1EQTA 4JI2L 4OL7A 1IBMQ 1YHAA 4LF6Q 2EYOA 1ASZA 4LUVA 3H0GH 3DWQA 1D1KA 1NE3A 1WCMH 1Y8PB 1VQPA 1QVGA 5EPJA 1KDCA 4C2MH 5IYBH 1EUJA 3T1HL 3S2DH 1CUKA 4KJOA 3A8IE 2J4XA 5EGTA 3U58A 4DR7Q 4ZCKA 3TP8A 3SHLA 1O80A 2OCEA 3P7JA 3FDTA 4F88A 1PTOC 1Y1VG 2R93G 1AE2A 5C0XI 4XIGS 2E76C 1FJGL 1DM0B 2OTLA 4JYAQ 2PNHA 3OMGA 2D9UA 4UP8A 1HZAA 2UUCQ 2R7ZB 2F0MA 2IHEA 1HR0L 4NDXA 1LT4D 4WORA 5KYIA 1AH9A 3NQIA 4NXML 5C0XH 3GD7A 3I4MB 1T9HA 5C0XJ 5D65A 2M00A 3PO2G 3CPFA 3QB3A 4IOAA 4K6DA 4BY1G 1R9TH 2L12A 4IUNA 4BY7G 1SYCA 4C56C 1SJHD 2MUYA 5EPLA 2KCNA 2L11A 1IL8A 4DR1L 1MSGA 1JJGA 1X54A 2A68D 3SE0A 3HOVH 4A3JH 3HOUG 3S16B 1BKBA 1LT3D 1ZKOA 1ENAA 2Z4IA 5M3FG 3TS0A 1X56A 2HCIA 2ID0A 3S9WA 4YCVA 2UUBQ 3J7A5 2F0IA 3H3VH 1QVFA 2K6AA 3H0GG 3IFDA 2WAQG 1UE5A 3EN2A 2IX3A 1VQ5A 3BVGA 4NXNQ 4QMGA 3SDZA 4UAIA 5ELEA 5CMDA 2Z6KC 1KQSA 4K0KL 4AYBG 5IP9H 3EQLC 1CK1A 5JEAH 2F0WA 2AQ2B 1JORA 3TREA 2EVBA 4DR3Q 4MTNA 2D5DA 2HT1A 3I2ZA 1S5BD 3A5UA 1BBXC 2LSSA 4OEMB 1U5KA 3TEHB 4MHEA 3RLFA 2HHHL 3D4WA 2F0NA 1VQLA 4LF8Q 2HDMA 3S14H 4O0AA 2A8VA 1FD7D 1L0WA 1RHPA 4V190 2PI2E 1ESRA 1YNJD 3K80C 4L8JA 4QF4A 4Y7NB 1I4GA 1QB5D 2IX0A 1L0XB 5FLXc 1AZPA 5IWAQ 2ICIA 4BBRH 1XX8A 1ET9A 3KF6B
chains in the Genus database with same CATH topology
1UEAB 4I65A 1LV9A 4K6LA 2N88A 3L9AX 2HQEA 2SNMA 1VF5C 3JAML 3I90A 5JEAJ 5ELCA 2RSOA 2MPMA 1BOSA 2F03A 3N6RA 2NN6G 5HURA 2LFNA 2ZT9C 1T5XD 3MC0B 1STYA 3C46A 3G6JB 5EKKA 2LY7A 3M85A 1Q12A 2CQAA 3M4YA 3H3VC 3S1NB 5DEHA 4EQOA 3I8ZA 4DU9A 2JA6B 4DGZA 2EYHA 2B2UC 5M5WB 4FXGC 4G7OC 3RD4A 3LWUA 3I3CA 1PXUA 5M5XB 1SSOA 1J8IA 1ZEQX 4HMJA 1EIGA 5D14A 3A8JE 1RJTA 3DWAA 3SK5A 3FKIB 1JWUD 4OHJA 2RDGA 2XVSA 3CKIB 2F0VA 2H4OA 1O7ZA 4XXEA 1PZID 1Q8IA 4XTCS 2KHSA 4IALA 1QNKA 5JEAG 1KTKA 1XTCD 3EJIA 1SE4A 2PW5A 5JVG3 3OHXC 5M9OA 1EWHA 2DY7A 3PUZA 4DA2A 3R93A 3TSSA 5J1ZA 2EOTA 3A7LA 1A2TA 1HA6A 2VUMB 3HGBA 3MXPA 2EJFC 1ENCA 2HDLA 3PIO3 4EQNA 2F0LA 1CFMA 5DM73 1D5XC 2O2LD 1ZYRD 2NBFA 1HFGA 2F0JA 5G3LF 1AW7A 4C2MB 2VNUD 3URYA 1PRTD 1JR0D 1B53A 4U68A 5C4XB 2KQ3A 1CQVA 5CBAE 4TQUS 1V1PB 2B2TC 1LTGD 1SNDA 3P1HA 3M7NA 1YNJC 1SEBD 1DONA 3HS0C 1GJXA 1EEID 2IWHA 3DWPA 1I6VC 2WB1B 3S17B 3CU7A 4C3JG 1TWHB 4J8QA 3AU7A 2B2YC 1AEXA 3GV3A 4IFDG 3GTJB 1Q1EA 1PFMA 4IFDI 4IQZA 1I6HB 1A3TA 2KCCA 1EY0A 1S5CD 2HCCA 1EL0A 2BDNA 2F0HA 2B2WA 2L0CA 4RH6A 4CJ0B 1SYDA 4ZK9B 4ABNA 2RVLA 3VYUA 1B9MA 2NN6H 1A3UA 2E2IB 1K8OA 3MXNA 2B2YA 2EE1A 1RTOA 5K5PA 1SMYD 1F2YA 3H94A 3H09A 3NE5B 3VYSA 5G3LD 5I6WA 3CHBD 2SEBD 3PUVA 3NXWA 1STAA 2AQ1B 1TS5A 4FP5D 5I9PA 3O13A 2YU9B 2Q8IB 4NMZA 1QWYA 2F0FA 1U9RA 4PNYA 3IFTA 2BOSA 3I4NB 1SYGA 3M4OB 1IW7C 1ILPA 1K8MA 1ENFA 4KHZA 1G91A 2PZTA 2B2VC 3X3NA 4CKEA 3D31A 2JA5B 1GUTA 1WTPA 1MSHA 4O42A 3TBIB 4ZUIA 1NUCA 2E75C 3H6MA 2BE5C 4GZYC 1F2MA 4A3MB 1RD9D 2EJGC 3T51B 4TRDA 1E2WA 5C4HA 3J81L 4RHRA 4IURA 1JICA 3UI2A 2B2TA 2A6HD 4PQXA 5IGGA 1WTRA 2B2UA 2OXPA 3E6ZX 3EFXD 2AQ3B 2PYKA 5ELDA 5JAVA 1GUSA 4RCNA 1NR4A 2FJ2A 4FF3A 1HHVA 4IZ8A 2NVQB 1X32A 1BQQT 3M3YB 2IT1A 2HUGA 5ISRA 2X69A 2WV6D 3ERQA 1EOTA 2NUCA 4PV1C 1NAPA 3V2TA 4BS9A 3GTMB 4Z9CB 3A55A 5IODA 5IGDA 4DN4M 3MTSA 4DXFA 1JOOA 1HPCA 1LTTD 1BXTA 2C9OA 1TQOA 3NWTA 1IYVA 3OIQA 3FMCA 2R92B 4KK7A 4KN4C 2B8FA 1G8ZD 1PDQA 2Z8LA 3PUXA 1UAPA 2DY8A 1K83B 3K0YA 2RSNA 1V1OA 4C1NI 1XXGA 1GUWA 2LMCB 5CBEE 2RDHA 3D4RA 4FXDA 3TP5A 2BCOA 1MD2D 1OXXK 1HUNA 5C44B 1CZGA 4RKBA 1HCZA 1V8QA 3GTLB 2E2JB 5LHY1 1HXYD 1E2VA 2E2HB 2OF1A 2QDBA 4CGYB 4ZYSA 5FO9B 2ZXRA 2BA0A 1RODA 3D4DA 3S1RB 5KNBA 5E3FA 5I9OA 4HAEA 1Q3LA 3VA7A 3A54A 4V0BA 3GTGB 1BNZA 2ZXOA 1TWFB 1BUVT 2D62A 1S5DD 4FF2A 3J7AF 4R8IA 5C3EB 3SEBA 2XWJB 2NYZD 3P20A 1TWAB 1ET6A 5IT9E 3FEWX 2K33A 5FO8B 2JXMB 1GOZA 4B08A 3SVMA 5CYUA 3K58A 1OXSC 3T16A 3E0JA 1FR3A 3GO5A 3T53B 2A6EC 3SK8A 1BCPD 1I4PA 1TS4A 5BN3A 1GUNA 3S2HB 5LL6X 5JPNC 4C3HG 2NTSA 4QCLA 1PRTB 3BS1A 4CKCA 1LTRD 4A3EB 2IL8A 1KNAA 2PNRC 1EFID 1F9RA 3TP6A 3NUCA 2CHBD 4A3KB 1H9SA 5KGUA 3ND8A 2EPBA 2C5CA 3ONAB 4HN7A 1JWSD 1II3A 3KLRA 2F4IA 3OIPA 1KLGD 4F87A 4H13C 5I6YA 2Q8RE 1GUGA 2AUJD 4S3SA 4RGOS 3GTQB 1OXUA 1JWMD 3BZDB 2NVYB 3ND9A 1BCPF 1F2ZA 1TU2B 1ICWA 1S5ED 1STHA 2NWGA 4A3IB 3MFYA 4C3IG 4RHSA 4C1NK 4IUVA 2L1BA 5CORA 2FMCA 4HSVA 4KV6A 2G9DA 2XRQD 2DNCA 1Z47A 1GXDC 1CQFA 3K5OA 2A73B 4A3FB 3D6CA 1W6JA 1JB3A 1SNQA 4HSPA 4LK1C 1F9QA 5CV6A 4A3JB 1VMCA 3AMUA 1BF4A 3J80L 1WTOA 1HRJA 1EZ8A 1VCIA 3V05A 5J39A 1GHKA 4EQPA 1I4RA 1LT5D 5KYLA 2F0PA 4RKLA 3NTHA 1X3PA 3J80E 4BA1I 3N52A 3PV0A 1WTXA 1PTOB 3MXUA 1IW7D 1SFOB 4G7HC 1MGSA 2JYOA 4MIUA 1SXTA 5FO7B 1WTWA 2F3WA 3VR3A 2JA7B 1G2TA 1JQYD 2J0TD 2NB0A 4J6HA 5EBCA 5IGCA 1SJED 3K5NA 1CA5A 4RCOA 2NVXB 3OWEB 3RZOB 5I2YA 5A2QL 5FK9C 2X6GA 2A6ED 2QF7A 4OIKA 3NQTA 3Q24A 2R61A 4DK1A 1EY6A 1EU4A 4CKBA 4IFDJ 1PTOF 5C4ZA 3KUPA 1KDAA 2QKIC 3OOCA 4IUUA 2WKCA 1STEA 1LT6D 2XN9C 1W6KA 2H1EA 2WP8J 5KRUA 1JE4A 3D6WA 2F1MA 5C5LA 2YYZA 1HFNA 3W2DA 3FVQA 3SK4A 3JAME 4BY7B 3R8BA 3HEJA 5C0XG 1SBBB 4H44C 1R4PB 1IKLA 2ENBA 2IPKD 1A2UA 3E5SA 3PO2B 2F0GA 4ZAIA 2F0QA 5CGKA 4C3HB 4HMIA 2DN8A 1EEFD 2K05A 2R3ZA 2IX1A 4OO1I 3K5MA 3OWFA 1QG7A 2FINB 3NTKA 1IHZA 1LACA 2M2LA 1BCPB 2I07B 4HCSA 3S1QB 1WD0A 5C5MA 2O5JC 5C4JB 4IN3A 2F0UA 4IFDH 4JBWA 4IUQA 3KLSX 5E4WC 2F0KA 3F2UA 3HOZB 3GQBA 5NUCA 5FLXL 1KABA 2B8GA 4KKTA 3SK6A 1JOQA 2WIIB 3HOXB 3QIAA 1Q90A 5CV9A 3C2PA 4K2LA 1PTOD 1HA5A 1B9NA 1ESFA 5HGTA 2WINB 5KEEA 1B44D 1GHJA 3MFGA 1TVXA 1Y8OB 1HTPA 2A68C 2NVTB 4QUCA 5EBDA 1TS3A 1VDZA 2K28A 3BDLA 4CJ1B 3NBHA 1ZYRC 1O7LA 1KDBA 1PLFA 3HP3A 4R9WA 3S15B 2LKVA 4G57A 4NKLA 5IT9L 2BE5D 4A3GB 2KEDA 3DEOA 1SYEA 4WRDA 4KN7C 5E4XA 1AFPA 3T56B 5KIXA 3WDNA 3SR1A 1EY8A 4EGVA 2EYJA 3MEHA 1SE2A 1Y69U 3VYRA 3M7GA 4KHVA 3CRKC 3MWYW 3D3RA 2O4XA 2K5WA 4KTAA 2B63B 3RUZA 1RKNA 5K36G 5JJZA 2RKSA 4K5VA 4TSSA 2PO4A 4HCEA 2WACA 4ZKBB 2E74C 4ZQ3A 1C4QA 1MI2A 1EWCA 2MGSA 1BDOA 1DZ1A 4LJZC 1WTQA 1D6EC 4BBRB 1HQMC 1TS2A 3TDQA 5IGFA 1WVLA 1Y1WB 4RWSC 1LLRD 3MAQA 3WOFA 3J7YW 4QB4A 1D5ZC 5TSSA 3HKZB 1EY5A 2EZVA 4DNRB 1CA6A 3IL8A 4LAAA 4UDUC 2PZUA 4WJWA 1PRTF 1T5EA 4NW2A 2ICEC 3U9OA 4IUPA 4KY5A 3HOYB 4FF1A 1MBYA 2E2DC 3VR4A 4ZKCB 1M4VA 3KBXA 1SMYC 3V96A 2Z4HA 4DF7A 2JA8B 3S1MB 2MHVA 3PMFA 4A3DB 2K04A 4BWGB 3BVMA 3OSOA 1UNSA 1QCBD 1JCKB 1V1PA 1EYAA 2WKDA 3H0GB 2K01A 1QOHA 1RCVD 2Z1CA 2AWOA 5ELBA 3DHQA 3TZUA 2EYPA 1CT1D 1LTSD 3H91A 3AB9A 2O5IC 2EYFA 2NN6I 2CW0C 3K57A 2VXWA 1AP0A 2TMPA 1Y8NB 1DCZA 4YIJA 4HEDA 4KKUA 3GP7A 4BY1B 1C48A 5LL6S 2Q8TA 2BA1A 2PZWA 4HTHA 3W3AA 1CHPD 3X3MA 1LO5D 2JSOA 1SNOA 4ODGA 2F0DA 1VMPA 2F0EA 3TN2A 2PPBC 5A2QE 1OXTA 3K7AB 3K5LA 5K36H 4G4KA 4DAPA 3RZDB 1F9PA 2F0TA 3QO2A 3OMCA 4DXGA 1FNWA 1XYIA 4N9TA 2RBMA 3NSWA 3NWSA 3BVZA 4KKSA 4P2CB 3KF8A 1M8AA 1G2SA 2DNEA 2PW7A 5I2XA 4BBSB 3QOJA 1CM9A 5IOCA 4C3JB 4KD3A 3IAYA 1TKWB 2F0SA 5EJWA 3VA5A 1BR9A 4RGTA 5A35A 3IKJA 2KEEA 4K14A 4XQNA 4NP5A 4Q5VA 2EY1A 4ILWA 4KJNA 1AN8A 4ULLA 1LTID 1Y1VB 4KY6A 2R93B 4F7XA 1TR5A 1RTNA 2JE6I 1A3VA 1A15A 4RAUC 2IJ0A 2L55A 2IW3A 3RMHA 3MVVA 2F3VA 4F8MA 2M9VA 4G7ZC 4JK1C 2SDFA 3VR2A 2B2WC 2RA4A 1R4QB 4FVMA 1LTBD 5E1FA 1JC7A 1BCPC 5FKAC 4X3SA 1WCMB 5T1IA 4FO2A 3HG9A 3EROA 1AZQA 4OO1H 5FOBB 4U673 4CHTB 1PFBA 2PCFB 3ITPA 2XIWA 3L7ZC 5DNFA 3QG1A 2L9HA 3I72A 2PMZB 3BYYB 3BDOA 2EDGA 3HRZC 2AUKA 1HUMA 4I7ZC 4DK0A 3T4AC 1H9RA 2KVMA 1PYWD 4N9PA 1BO0A 1L0YB 2EY6A 3CRLC 4LMQD 1FNUA 1SYFA 1SYBA 3VR6A 2KJXA 1TWGB 3HZXA 3TZDA 4C3IB 3GTOB 4XT1B 4FNFA 1QE6A 1KNEA 1CI3M 2CW0D 1TWCB 4X3UA 2A69D 5IIFA 1IKMA 5M3MB 5D3IB 1PFNA 3DM1A 4QIWB 3I70A 4ZLTF 1DOLA 3R2TA 1NCVA 1EYCA 3KBGA 4CJ2C 1ONLA 1I4HA 2I46A 2TSSA 1QNUA 1ML0D 4XQQA 4KY7A 3NBIA 2EJMA 3S2DB 1PMRA 3QJYA 3Q23A 1I4XA 4ME5A 2XRSD 2OEOA 3LNNA 4DAYA 1STNA 4XQJA 1EY7A 1NSNS 2G9HD 3G7LA 1D5MC 4RA8A 4WFN3 5EQ0A 1U4PA 3A8KE 1QILA 4KD4A 1GUOA 5IGBA 3GV6A 3MZ5A 1B4OA 4CBVA 2B39A 4OO1G 3VYTA 4J1MA 1B50A 3DMUA 1XWEA 5CV4A 4PMWA 1E0BA 1FYCA 3MA2B 2NZ1D 5CR3A 3PUWA 5M5YB 1CHQD 1EY9A 2L4NA 1DYQA 2XSCA 3NPPA 3C1FA 4AYBB 5ELFA 4PMCA 2Y0SB 1WTVA 1H9KA 1Q1BA 1O7YA 2K03A 2GA4B 1I4QA 3TP7A 4K8JA 1F2LA 1S4ZA 1YNND 3U9SA 1D2BA 2K5DA 3FPUB 3FRPB 3CQZB 3HOUB 1SE3A 1KAAA 2A5HA 1SNCA 5F2DA 1F9SA 1SNPA 5KNCA 1U4RA 3ZYYX 2R6GA 1OO9B 2OT2A 3MXGA 4DNTB 2SNSA 1B1ZA 1U4MA 2A74C 1JOKA 3I4LA 3GTKB 4B9XA 1TIID 1PRTC 1KLUD 3R3OA 1EQVA 2RQXA 4B9WA 3NHHA 4H7BA 5BN5A 1O78A 1PZJD 3DEPA 2QCPX 4KMUC 2L5TA 4A93B 3OW7A 2KUMA 3Q0AA 1WD1A 1B3AA 2EYMA 3P75A 2KA7A 4XT3B 5JPMC 5CV5A 1EY4A 2BDOA 1EU3A 5KNDA 1HQRD 1VF7A 3J81E 2SOBA 1EYDA 4XYQA 4DAVA 1DD2A 3C3LA 3KK7A 3QOLA 5BN4A 1E2ZA 4R8NA 2CVRA 4H0LC 2AWNA 2VB2X 2D2CC 3I91A 2A6HC 5C6AA 4DFAA 1RF2D 2QEJC 1RDPD 5FLXE 5CV7A 3PUYA 1EIHA 1ILQA 5C3XA 2ZXPA 3VR5A 2MJ8A 4M8AA 4RGNA 3WOEA 3S14B 1Z6HA 1DJRD 3QWNA 1NR2A 4TKOB 1SNMA 1U4LA 1G6ZA 2LS01 1FNVA 1B2TA 1X3QA 3Q6SA 1I3QB 2JP1A 3C1EA 1A6XA 5J22A 4EVOA 2FHTA 3DUZA 4X3TA 4ID6A 3LX0A 4MN3A 2EXZA 1EZ6A 2K1BA 2PQEA 2K7VA 2JEAI 3PIP3 2RDFA 3DXJC 3BYTB 4RFBA 4HR7B 3K59A 4OGQC 4OIJA 1DOKA 2J7ZA 4PMBA 3HOVB 5CC4A 2KOLA 5IGEA 2FMMA 1F77A 1D1IA 1LABA 2N55A 3L3OC 4RGMA 3BG3A 2EY5A 1SDFA 1DOMA 1HTLD 2B2VA 1V43A 4IUTA 2QILA 4FXKC 1H9JA 1H9MA 1S5FD 4ZUJA 5EKLA 3A7AB 1H9SB 3MHBA 1PTOH 4KI0A 3D8GA 2KECA 3SXHA 2XWBB 2MP1A 1TY2A 5AFWA 4L6TB 4K5XA 5DAUA 1R9TB 1C8CA 1CZWA 2X6LA 2WAQB 1G291 3TMEA 3BDCA 1IYUA 4BA2I 1LTAD 5M3FB 5JVH3 3Q22A 2NTTA 2EY2A 1STGA 2XNAC 1STBA 1QJOA 2K5QA 4K2KA 4M1UB 4E6IA 3NTIA 1CTMA 5I4DA 3OPOA 3K6OA 1J9OA 1I50B 4A3BB 1SAPA 1TY0A 1ZXTA 2VB3X 1TT2A 5COYA 4Q0FA 4XDXA 5C3WA 4K8IA 2F0OA 3FPPA 4FF4A 4XYOA 3J7AV 3NK9A 3R2IA 3T13A 1OXVA 5EKIA 4X3KA 4O1NA 5JOBA 3EVQA 4FYDA 5DM63 4K5WA 1YNNC 4L63B 2FFKB 2K32A 2A69C 1DXMA 3PO3B 4ZRZA 3EA6A 3LWEA 2EYLA 1UUPA 2V4DA 5D3DA 5T1GA 2JEBI 1Z7TA 3A56A 3HOWB 5EPKA 3NP8A 3I73A 5CV8A 1FGBD 1PZKD 4QUFA 3KLSA 3GTPB 1EQTA 4OL7A 2EYOA 3DWQA 1D1KA 1Y8PB 5EPJA 1KDCA 4KJOA 3A8IE 2J4XA 5EGTA 3TP8A 3SHLA 1O80A 3P7JA 3FDTA 4F88A 1PTOC 5C0XI 4XIGS 2E76C 1DM0B 3OMGA 2D9UA 2R7ZB 2F0MA 4NDXA 1LT4D 4WORA 5KYIA 3NQIA 5C0XH 3GD7A 3I4MB 5C0XJ 5D65A 2M00A 3QB3A 4K6DA 2L12A 4IUNA 1SYCA 4C56C 1SJHD 2MUYA 5EPLA 2KCNA 2L11A 1IL8A 1MSGA 2A68D 3SE0A 3S16B 1LT3D 1ZKOA 1ENAA 2Z4IA 2HCIA 2ID0A 3S9WA 2F0IA 2K6AA 3IFDA 2IX3A 3BVGA 4QMGA 3SDZA 4UAIA 5ELEA 5CMDA 3EQLC 1CK1A 5JEAH 2F0WA 2AQ2B 1JORA 2EVBA 2D5DA 1S5BD 1BBXC 4MHEA 3RLFA 3D4WA 2F0NA 2HDMA 1FD7D 1RHPA 4V190 1ESRA 1YNJD 4L8JA 4QF4A 4Y7NB 1I4GA 1QB5D 2IX0A 1L0XB 1AZPA 2ICIA 1XX8A 1ET9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4D A;  1KAB A;  1EY7 A;  1EZ6 A;  2EXZ A;  4I65 A;  5IGF A;  3MXP A;  4S3S A;  4B9X A;  1SYD A;  3SK6 A;  3ERO A;  2HQE A;  4IZ8 A;  5E3F A;  1ENC A;  1NSN S;  3OMG A;  4EQN A;  5I9O A;  2SNM A;  1JOQ A;  2PQE A;  3R3O A;  2F0M A;  5CV9 A;  4QB4 A;  4K2L A;  3NQT A;  4NDX A;  1A3U A;  1EQV A;  4WOR A;  2RDF A;  5KYI A;  2F0T A;  2F0L A;  1EY6 A;  3ITP A;  1EY5 A;  3OMC A;  5HGT A;  4B9W A;  3NHH A;  1F2Z A;  4KD4 A;  5K5P A;  5ISR A;  5KEE A;  1STH A;  2M00 A;  5IGB A;  4N9T A;  3MZ5 A;  3QB3 A;  4H7B A;  5C4Z A;  5HUR A;  4LAA A;  2RBM A;  1F2Y A;  4K6D A;  1TT2 A;  3ERQ A;  4PMB A;  1KDA A;  4IUN A;  1SYC A;  2NUC A;  5CC4 A;  4J1M A;  5I6W A;  1STY A;  5IGE A;  3DMU A;  2PZU A;  3V2T A;  5C3W A;  4KV6 A;  4K8I A;  5EKK A;  2F0O A;  5CV4 A;  3NXW A;  1STA A;  2F0J A;  5I9P A;  2PW7 A;  3U9O A;  5IOD A;  4KY5 A;  3QOJ A;  5IGD A;  5IOC A;  1JOK A;  2EYM A;  3BDL A;  3NK9 A;  5KRU A;  3P75 A;  4NMZ A;  2EY5 A;  1JOO A;  3T13 A;  4KD3 A;  4N9P A;  5DEH A;  5C5L A;  1KDB A;  4EQO A;  2F0S A;  5CV5 A;  1ENA A;  1U9R A;  2EYH A;  2F0F A;  5CR3 A;  2KQ3 A;  3T16 A;  4DGZ A;  4DU9 A;  2LKV A;  3D6C A;  2EY6 A;  4PNY A;  4DF7 A;  4G57 A;  1EY4 A;  1EY9 A;  1SNQ A;  1SYF A;  4NKL A;  3SK4 A;  3S9W A;  3HEJ A;  1TQO A;  3VA5 A;  5CV6 A;  2F0I A;  1SYB A;  3PMF A;  5JOB A;  1SYG A;  2ENB A;  1A2U A;  1SND A;  3E5S A;  3EVQ A;  2SOB A;  3HZX A;  2F0G A;  1EYD A;  3P1H A;  4K5W A;  2F0Q A;  3SK8 A;  3C1F A;  4QMG A;  1SYE A;  4WRD A;  5CGK A;  4PMC A;  3QOL A;  4HMJ A;  5KIX A;  1EZ8 A;  3OSO A;  4K14 A;  3SR1 A;  1EY8 A;  4HMI A;  2EYJ A;  2PZT A;  4NP5 A;  4R8N A;  5EKL A;  2EYL A;  4ZUJ A;  4EQP A;  2EY1 A;  3MEH A;  5IIF A;  5KYL A;  3SK5 A;  2F0P A;  4KJN A;  4RKL A;  4KHV A;  5C6A A;  4DFA A;  3MHB A;  1EYA A;  2F0W A;  2F0V A;  3TP7 A;  4K8J A;  1JOR A;  2O4X A;  3D8G A;  5CV7 A;  4KY6 A;  4ZUI A;  4F7X A;  4KTA A;  3NP8 A;  1NUC A;  1TR5 A;  5CV8 A;  3SXH A;  3RUZ A;  3DHQ A;  1RKN A;  3OWF A;  1EYC A;  1A3V A;  4K5X A;  3TP6 A;  5C3X A;  2EYP A;  3H6M A;  2RKS A;  1IHZ A;  2KHS A;  3NUC A;  4OL7 A;  5DAU A;  3TP5 A;  1F2M A;  4K5V A;  2EYF A;  4IAL A;  1KAA A;  3MVV A;  1SNC A;  2EYO A;  2F0N A;  2F3V A;  3D4W A;  2WAC A;  4TRD A;  3TME A;  5KGU A;  5C5M A;  1AEX A;  3BDC A;  5F2D A;  1SNM A;  4ZQ3 A;  4F8M A;  5C4H A;  3EJI A;  4MIU A;  3LX0 A;  4KY7 A;  4RKB A;  2PW5 A;  2F3W A;  1SNP A;  4YIJ A;  1II3 A;  5IGG A;  1KDC A;  2F0U A;  3C1E A;  5M9O A;  1A3T A;  2OXP A;  2EY2 A;  1STG A;  4QF4 A;  5E1F A;  1STB A;  1EY0 A;  4J6H A;  5J22 A;  2F0K A;  4EVO A;  4KJO A;  2PZW A;  4HTH A;  5J39 A;  5I6Y A;  2PYK A;  5EGT A;  2SNS A;  5J1Z A;  1SNO A;  4ODG A;  3TP8 A;  5IGC A;  2OF1 A;  2QDB A;  2F0D A;  3SHL A;  5JAV A;  4K2K A;  4ME5 A;  2F0E A;  4E6I A;  5NUC A;  1A2T A;  2OEO A;  4ID6 A;  2F0H A;  1STN A; 
#chains in the Genus database with same CATH topology
 1UEA B;  4I65 A;  1LV9 A;  4K6L A;  2N88 A;  3GTK H;  3L9A X;  2HQE A;  4A3L H;  1WYD A;  2SNM A;  1WI5 A;  1GVP A;  1VF5 C;  2UUC L;  1XNR L;  1IBK Q;  3JAM L;  3I90 A;  1Y1W G;  5JEA J;  5ELC A;  2UU9 Q;  2RSO A;  1W3S A;  2MPM A;  3CCJ A;  1BOS A;  2F03 A;  3N6R A;  2NN6 G;  1BVS A;  5HUR A;  2LFN A;  1FVI A;  1PFS A;  2ZT9 C;  3A74 A;  1T5X D;  3MC0 B;  1STY A;  1NMG A;  3C46 A;  3G6J B;  4DR6 L;  5EKK A;  2LY7 A;  3M85 A;  1WCM G;  1Q12 A;  2K5H A;  3I56 A;  2B63 H;  3ULJ A;  1TWG H;  2CQA A;  3M4Y A;  4DR5 L;  4PG3 A;  3H3V C;  3S1N B;  4LFC Q;  1X55 A;  3K81 C;  5DEH A;  4EQO A;  3I8Z A;  4DU9 A;  2JA6 B;  1J5E Q;  4DGZ A;  2EYH A;  3PF4 A;  2B2U C;  5M5W B;  4FXG C;  4G7O C;  3RD4 A;  5LMU Q;  3LWU A;  1SN8 A;  3I3C A;  1PXU A;  2K50 A;  5M3M G;  5M5X B;  1SSO A;  1J8I A;  1ZEQ X;  2EQS A;  3HKZ G;  2OTJ A;  4HMJ A;  1EIG A;  1PH7 A;  5D14 A;  3A8J E;  1RJT A;  3DWA A;  3SK5 A;  3FKI B;  1JWU D;  4OHJ A;  2RDG A;  2XVS A;  3CKI B;  2F0V A;  3BZC A;  4AQY L;  2H4O A;  1O7Z A;  2K5V A;  4XXE A;  1PZI D;  3EIV A;  1Q8I A;  4XTC S;  4HJA A;  2KHS A;  3J81 j;  4IAL A;  4JOI C;  1QNK A;  5JEA G;  3PF5 A;  1KTK A;  1XTC D;  2BH2 A;  4B3S Q;  3EJI A;  1I94 Q;  4JI7 L;  1SE4 A;  3JC6 6;  2PW5 A;  5JVG 3;  3OHX C;  4JI3 Q;  5M9O A;  3G6E A;  3AFP A;  1EWH A;  2DY7 A;  3PUZ A;  4DA2 A;  3R93 A;  1PYS B;  3TSS A;  5J1Z A;  2EOT A;  2ZTC A;  4BBS G;  3A7L A;  1S72 A;  1A2T A;  1HA6 A;  2VUM B;  1QVC A;  3HGB A;  4LF6 L;  3MXP A;  3S15 H;  4GKK L;  2EJF C;  1ENC A;  2HDL A;  1N9W A;  3PIO 3;  4EQN A;  2E5L L;  3GTG H;  3W1G A;  2V1C C;  4L5Q A;  4B3T L;  3KJO A;  2F0L A;  1CFM A;  1GO3 E;  5IYB G;  4DAY B;  3ERS X;  5DM7 3;  1D5X C;  3KYH C;  4QIW E;  4MTK A;  2O2L D;  2ES2 A;  1ZYR D;  2NBF A;  1JT8 A;  1HFG A;  2F0J A;  5G3L F;  4JI5 Q;  1AW7 A;  4C2M B;  4JI7 Q;  2VNU D;  3URY A;  1PRT D;  4DV2 L;  1JR0 D;  1B53 A;  4DV4 L;  4A3G H;  2WAQ E;  4U68 A;  5C4X B;  2KQ3 A;  1Q82 C;  1CQV A;  2NVX H;  3HKS A;  4YY3 Q;  2KCT A;  5CBA E;  4TQU S;  1V1P B;  2B2T C;  3K8A A;  1LTG D;  1SND A;  2F3I A;  3P1H A;  1VQG A;  1YNJ C;  3T1Y Q;  3M7N A;  3L2P A;  1SEB D;  1DON A;  3HS0 C;  4DV0 Q;  1HNW Q;  1YHB A;  2MNA A;  1GJX A;  1EEI D;  4JC0 A;  2IWH A;  5GAH C;  3DWP A;  5JJI A;  4YHH Q;  1I6V C;  3CPW A;  4JI0 Q;  1X9N A;  2ZTE A;  2WB1 B;  3S17 B;  3CU7 A;  4C3J G;  1TWH B;  4J8Q A;  3AU7 A;  1HR0 W;  2B2Y C;  1AEX A;  3GV3 A;  4IFD G;  2UXC L;  3GTJ B;  1Q1E A;  1PFM A;  4IFD I;  1D7Q A;  1NBW A;  4IQZ A;  1I6H B;  1VQK A;  1A3T A;  2KCC A;  1SLJ A;  1IBM L;  3I4O A;  1EY0 A;  1S5C D;  2HCC A;  4IPC A;  3STB C;  1EL0 A;  5IP7 H;  2BDN A;  2GN5 A;  2F0H A;  2B2W A;  2L0C A;  4H02 A;  4RH6 A;  4LW1 A;  4CJ0 B;  1SYD A;  3KJP A;  4ZK9 B;  1MKH A;  4ABN A;  2RVL A;  3VYU A;  1B9M A;  3WWV A;  4LFA L;  4DPG A;  2NN6 H;  1A3U A;  2E2I B;  1K8O A;  4X6A H;  3MXN A;  2B2Y A;  2EE1 A;  1RTO A;  2CH4 W;  1VQN A;  5K5P A;  1SMY D;  2A19 A;  4JVZ A;  4JYA L;  2E5L Q;  1F2Y A;  3H94 A;  1IBL Q;  3CQZ H;  3H09 A;  3NE5 B;  2UUA L;  3VYS A;  1GKH A;  1LUZ A;  5G3L D;  2VQE L;  5I6W A;  3CHB D;  2SEB D;  2K52 A;  3G71 A;  3PUV A;  5H1S E;  3NXW A;  4A3E H;  1STA A;  2UXD L;  2AQ1 B;  1TS5 A;  4FP5 D;  5I9P A;  1K8A C;  3O13 A;  4LNQ A;  5ELN A;  2YU9 B;  2Q8I B;  4DV4 Q;  4NMZ A;  1QWY A;  1V1Q A;  4QQB X;  2F0F A;  1U9R A;  3BU2 A;  2MQH A;  4N8F A;  1PYB A;  4PNY A;  3IFT A;  2BOS A;  3S24 A;  2KEN A;  3I4N B;  1SYG A;  3M4O B;  1NNX A;  1IW7 C;  2R7D A;  1ILP A;  2R7Z H;  1K8M A;  2ZM6 Q;  1ENF A;  4KHZ A;  4DK6 C;  1G91 A;  2PZT A;  1HNW L;  2B2V C;  4X66 L;  3X3N A;  4CKE A;  2B63 G;  3D31 A;  2JA5 B;  1GUT A;  4ALP A;  1WTP A;  1MSH A;  4O42 A;  3TBI B;  4ZUI A;  1NUC A;  1TWA H;  2E75 C;  3QR8 A;  4APV A;  1XJV A;  1PH1 A;  3FKI H;  3H6M A;  2BE5 C;  4GZY C;  1F2M A;  4A3M B;  1RD9 D;  4R4Q A;  4O2D A;  2EJG C;  3T51 B;  2A1A A;  1YJ9 A;  3HOY G;  4TRD A;  1E2W A;  5C4H A;  3J81 L;  4RHR A;  4IUR A;  1KD1 C;  4DV7 L;  1JIC A;  3UI2 A;  2B2T A;  2A6H D;  4PQX A;  1FL0 A;  5IGG A;  1WTR A;  4LWC A;  1XMO L;  2B2U A;  4GN3 B;  4GKJ L;  2OXP A;  3E6Z X;  3S2H H;  3EFX D;  2AQ3 B;  1KC8 C;  5FJ8 G;  2PYK A;  1JB7 A;  3PGZ A;  5ELD A;  5JAV A;  1GUS A;  3ZJY C;  1VQI A;  4RCN A;  1NR4 A;  2RCF A;  4NXM Q;  4UY8 C;  2FJ2 A;  4FF3 A;  1HHV A;  4IZ8 A;  2JA5 G;  2NVQ B;  1X32 A;  1MIU A;  1BQQ T;  3M3Y B;  1VQJ A;  2C35 B;  1VQD A;  2IT1 A;  2HUG A;  1OTC A;  3S1R H;  2BH8 A;  3JAM c;  5ISR A;  1QZH A;  4A3K H;  2JK8 A;  1NY4 A;  2UUA Q;  2X69 A;  2WV6 D;  3ERQ A;  4C3J H;  1IBL L;  1EOT A;  2NUC A;  2G5D A;  4PV1 C;  1NAP A;  3V2T A;  3L0O A;  1Q86 C;  3RLO A;  4DV1 Q;  4X64 L;  4BS9 A;  3STB D;  3GTM B;  4Z9C B;  3A55 A;  5IOD A;  3PO2 H;  5IGD A;  4DN4 M;  3MTS A;  4DXF A;  1K9M C;  1JOO A;  2HD3 A;  1XMO Q;  4WJ4 A;  1HPC A;  4IPG A;  1N33 L;  1KL9 A;  1LTT D;  4IJL A;  1BXT A;  2C9O A;  2ALY B;  1P8L A;  1TQO A;  3NWT A;  1IYV A;  1EFW A;  2N3S A;  1VQ6 A;  3OIQ A;  3FMC A;  1VQ9 A;  2R92 B;  4KK7 A;  4KN4 C;  2B8F A;  1G8Z D;  2DJF C;  1PDQ A;  2KBN A;  2Z8L A;  3PUX A;  1UAP A;  3GTL H;  2DY8 A;  1K83 B;  4BXX H;  3K0Y A;  4OWT B;  2RSN A;  1V1O A;  1VQO A;  4C1N I;  3CMA A;  2DJG C;  3G48 A;  1B7Y B;  1N33 Q;  4GKK Q;  2L15 A;  1XXG A;  1GUW A;  2LMC B;  5CBE E;  3HFZ B;  2RDH A;  3D4R A;  3W5O A;  3HOX H;  3TP5 A;  2BCO A;  4FXD A;  1MD2 D;  4DK3 C;  1K3R A;  1OXX K;  1HUN A;  3CP0 A;  3F2B A;  2F4V L;  4L5T A;  5LMN W;  5C44 B;  4GOP C;  1CZG A;  4RKB A;  3HOZ H;  1HNX L;  1HCZ A;  1V8Q A;  3GTL B;  2E2J B;  1VS0 A;  1A0I A;  5LHY 1;  1HXY D;  4JI4 L;  3J80 c;  1E2V A;  1XNR Q;  2OF1 A;  2QDB A;  2E2H B;  4CGY B;  4ZYS A;  5FO9 B;  3K7U C;  4DV3 Q;  4A3E G;  2ZXR A;  2BA0 A;  1ROD A;  3D4D A;  3S1R B;  3AYH B;  5KNB A;  5E3F A;  1VQH A;  5I9O A;  4HAE A;  3PIP A;  1Q3L A;  3VA7 A;  4QJF A;  4HJ7 A;  3A54 A;  4V0B A;  3GTG B;  1BNZ A;  2ZXO A;  1L2F A;  2QDL A;  1JMC A;  4LF7 L;  3E9I A;  1TWF B;  1HZB A;  1BUV T;  4PZ6 A;  1PH5 A;  2D62 A;  1S5D D;  4FF2 A;  3J7A F;  4R8I A;  4JI2 Q;  5C3E B;  4A3D G;  3SEB A;  2XWJ B;  2NYZ D;  3P20 A;  1TWA B;  1ET6 A;  5IT9 E;  3FEW X;  5IP7 G;  4A93 H;  2K33 A;  1X65 A;  5FO8 B;  2JXM B;  1GOZ A;  4A3L G;  3NEN A;  4B08 A;  3SVM A;  4LF4 L;  5CYU A;  3K58 A;  4OON A;  3J81 c;  1UWV A;  2YTV A;  5M5W H;  1OXS C;  3T16 A;  2LXK A;  2P5Z X;  4UPA A;  3UDI A;  3HOU H;  3E0J A;  1FR3 A;  3GO5 A;  3T53 B;  1I50 H;  2A6E C;  4JG2 A;  2UU9 L;  3SK8 A;  1BCP D;  1I4P A;  1TS4 A;  5BN3 A;  1GUN A;  3S2H B;  5LL6 X;  5ELO A;  5JPN C;  4GN4 B;  4YY3 L;  4P71 A;  4C3H G;  2B3G A;  4P72 A;  4A76 A;  3IRB A;  2NTS A;  3UE0 A;  1Q8K A;  4QCL A;  1PRT B;  3BS1 A;  4BBS H;  4JV5 Q;  5GQO A;  4CKC A;  1XNQ Q;  1LTR D;  1VQC A;  2JA9 A;  2IL8 A;  1KNA A;  4A3E B;  3B6Y A;  2PNR C;  1EFI D;  1F9R A;  2JN4 A;  4UP7 A;  3TP6 A;  3NUC A;  4BBR G;  2Q2U A;  2CHB D;  4A3K B;  1LTL A;  4LF9 Q;  1H9S A;  5KGU A;  3ND8 A;  2EPB A;  2VL6 A;  1AE3 A;  2C5C A;  3ONA B;  1HNX Q;  4HN7 A;  1JWS D;  3M4Q A;  4DUZ L;  1EQR A;  1II3 A;  3KLR A;  2F4I A;  3OIP A;  1KLG D;  4F87 A;  1CSP A;  4H13 C;  5I6Y A;  4L5R C;  2UXB Q;  3I4N H;  2Q8R E;  1GUG A;  3S1M H;  2AUJ D;  4LF5 L;  4I7A A;  4S3S A;  4RGO S;  1YIJ A;  4X62 L;  3FKI G;  3GTQ B;  1OXU A;  1JWM D;  4EX5 A;  5IP9 G;  4WJ3 M;  2R7F A;  4LFB Q;  2VY3 A;  4HIK A;  3BZD B;  2NVY B;  1A8V A;  3ND9 A;  1BCP F;  3A5Z B;  1F2Z A;  1TU2 B;  1ICW A;  1S5E D;  5FLM G;  1STH A;  2NWG A;  4A3I B;  3MFY A;  4R4C A;  4C3I G;  4A3B H;  4RHS A;  3AEV A;  3CCM A;  4C1N K;  4IUV A;  1E1T A;  2L1B A;  5COR A;  2FMC A;  4DNI A;  1PHJ A;  4HSV A;  1PH4 A;  4KV6 A;  2G9D A;  3PSI A;  4JBM A;  3F1Z A;  4X62 Q;  2CQO A;  3OTO L;  2XRQ D;  2DNC A;  1YEZ A;  4LF7 Q;  1Z47 A;  1CKO A;  1GXD C;  1CQF A;  3K5O A;  4A3M G;  2QW7 A;  2A73 B;  4A3F B;  3D6C A;  2E8G A;  1W6J A;  1JB3 A;  1SNQ A;  4HSP A;  5E7N A;  4LK1 C;  1F9Q A;  5CV6 A;  4A3J B;  1VMC A;  4B3M L;  5IWA L;  3AMU A;  1Z9F A;  2HQL A;  4YWM A;  1BF4 A;  1FGU A;  3J80 L;  1WTO A;  4A3K G;  1HRJ A;  2QA4 A;  2RHS B;  1KRT A;  1EZ8 A;  1VCI A;  3V05 A;  5J39 A;  1GHK A;  4EQP A;  1I4R A;  3UDF A;  1LT5 D;  5KYL A;  1TWC H;  1IYJ B;  2F0P A;  4GN5 A;  4RKL A;  3NTH A;  1X3P A;  1GM5 A;  3NBH B;  3J80 E;  2HHH Q;  1XTD A;  1SR3 A;  3PO3 H;  1G51 A;  4BA1 I;  3N52 A;  1I94 L;  3S17 H;  3PV0 A;  1WTX A;  1PTO B;  2EIF A;  4DV2 Q;  1X3E A;  1J5E L;  2N8N A;  1E7Z A;  3HOZ G;  3MXU A;  1IW7 D;  5M5Y H;  3CC7 A;  1SFO B;  1YIT A;  3Q8D A;  4G7H C;  5LMU L;  1MGS A;  2JYO A;  3J80 i;  4MIU A;  1SXT A;  5FO7 B;  1WTW A;  2F3W A;  3VR3 A;  1HNZ L;  2JA7 B;  1JQY D;  1G2T A;  2J0T D;  3U4Z A;  2NB0 A;  4J6H A;  3AFQ A;  5EBC A;  1NTG A;  5IGC A;  4JCV E;  2B29 A;  1SJE D;  4B3T Q;  4A3D H;  4DV6 L;  5DLQ E;  2CH4 A;  3K5N A;  1CA5 A;  4RCO A;  2NVX B;  3OWE B;  3RZO B;  5I2Y A;  5A2Q L;  5FK9 C;  2X6G A;  2A6E D;  2QF7 A;  4R1J A;  4OIK A;  3NQT A;  3I55 A;  3Q24 A;  2R61 A;  4DK1 A;  1EY6 A;  1EU4 A;  4CKB A;  1PH8 A;  4R4O A;  4LF5 Q;  4IFD J;  1PTO F;  5C4Z A;  2JA7 H;  3I4N G;  3KUP A;  1KDA A;  2QKI C;  3OOC A;  4IUU A;  2WKC A;  1STE A;  1PH2 A;  2OWO A;  1LT6 D;  2XN9 C;  1V9P A;  3MXN B;  5HGQ A;  1WJJ A;  1W6K A;  2H1E A;  3E3X A;  2WP8 J;  5KRU A;  1JE4 A;  1JE5 A;  4DV3 L;  3D6W A;  4GS3 A;  2WB1 G;  2F1M A;  2OQ0 A;  2YYZ A;  5C5L A;  3UDX A;  1HFN A;  3W2D A;  4N8X 1;  3FVQ A;  3SK4 A;  3JAM E;  2F4V Q;  3R8B A;  3HEJ A;  5C0X G;  4BY7 B;  1S40 A;  1SBB B;  5C44 G;  4H44 C;  1R4P B;  1IKL A;  2ENB A;  2IPK D;  1A2U A;  3E5S A;  4GNX A;  3PO2 B;  2F0G A;  4A3C H;  4ZAI A;  2F0Q A;  1TXY A;  5EAY A;  5CGK A;  4C3H B;  1A62 A;  4HMI A;  2DN8 A;  1C0A A;  1EEF D;  1WTH A;  2K05 A;  4X65 L;  1CKN B;  2R3Z A;  2RHQ B;  2HIV A;  5LMN Q;  2IX1 A;  4OO1 I;  3K5M A;  2UXD Q;  2VQF Q;  3PQI A;  2PQA A;  3FP9 A;  3OWF A;  1QG7 A;  2FIN B;  1W2B A;  1EYG A;  3NTK A;  2DUD A;  1IHZ A;  1LAC A;  1N32 L;  2M2L A;  1BCP B;  3RR5 A;  3F2D A;  2I07 B;  3ULL A;  4HCS A;  1SMX A;  3S1Q B;  1WD0 A;  1GD7 A;  5C5M A;  1J6Q A;  2O5J C;  5C4J B;  4IN3 A;  3S1N H;  1WFQ A;  2F0U A;  4P75 A;  1K8G A;  4IFD H;  4JBW A;  2ASB A;  4IUQ A;  3KLS X;  5E4W C;  2F0K A;  3F2U A;  3SGI A;  1IBK L;  3HOZ B;  2GVA A;  3GQB A;  5NUC A;  1YJW A;  5FLX L;  1KAW A;  1K83 H;  1KAB A;  2B8G A;  4KKT A;  3SK6 A;  4QY7 A;  1JOQ A;  2WII B;  3HOX B;  1C9O A;  3RN2 A;  4JI8 Q;  3QIA A;  1Q90 A;  5CV9 A;  3C2P A;  4K2L A;  1PTO D;  1HA5 A;  4DUZ Q;  1B9N A;  4OWX B;  1ESF A;  5HGT A;  2WIN B;  1YI2 A;  2Z6K A;  4P74 A;  5KEE A;  1B44 D;  1GHJ A;  3MFG A;  1TVX A;  1Y8O B;  1HTP A;  2A68 C;  2NVT B;  1IZ6 A;  2PQA B;  4QUC A;  5EBD A;  3J81 i;  5GAD C;  4Y7N H;  1TS3 A;  1VDZ A;  1PA6 A;  4BY1 H;  2K28 A;  5C3E H;  4A3F G;  3BDL A;  4CJ1 B;  1EIF A;  3NBH A;  1ZYR C;  1O7L A;  1KDB A;  1PLF A;  3HP3 A;  2Y0S E;  3FHW A;  4R9W A;  3S15 B;  2LKV A;  2JA7 G;  4G57 A;  2VUM H;  4NKL A;  5IT9 L;  2BE5 D;  4QGU A;  2N78 A;  4A3G B;  5GRO A;  2KED A;  3CCS A;  3DEO A;  1Q81 C;  2CWA A;  2XTI A;  2IY5 B;  2I5L X;  1SYE A;  4WRD A;  4KN7 C;  5E4X A;  4A3I G;  3HOW H;  1AFP A;  3T56 B;  3WDN A;  5KIX A;  1MJC A;  3SR1 A;  1EY8 A;  4EGV A;  2EYJ A;  2F52 A;  1HZ9 A;  3MEH A;  1SE2 A;  1Y69 U;  3VYR A;  3M7G A;  4KHV A;  4X65 Q;  3S1Q H;  3CRK C;  3MWY W;  3D3R A;  2O4X A;  2K5W A;  2ZJQ A;  4KTA A;  2B63 B;  3CCR A;  2VQF L;  2UXC Q;  3RUZ A;  1RKN A;  5AJ3 L;  2UUB L;  1E1O A;  5K36 G;  5JJZ A;  3TRZ A;  2RKS A;  1C7Y A;  4K5V A;  4TSS A;  1VQA A;  2PO4 A;  4DR1 Q;  4HCE A;  4JV5 L;  1VQB A;  2WAC A;  4ZKB B;  2E74 C;  3RNU A;  4ZQ3 A;  4DUY Q;  1C4Q A;  1Y14 B;  3KDF A;  1MI2 A;  1EWC A;  2MGS A;  3AQQ A;  1BDO A;  1DZ1 A;  4LJZ C;  4TVA B;  1WTQ A;  1D6E C;  4A75 A;  3ICE A;  4BBR B;  1X3F A;  3GTJ H;  1X3G A;  1HQM C;  2JJQ A;  1TS2 A;  3TDQ A;  5IGF A;  1WVL A;  1Y1W B;  1FJG Q;  3E0E A;  4R4I A;  4IPH A;  4RWS C;  1LLR D;  3D0F A;  3MAQ A;  3WOF A;  4KHP Q;  3J7Y W;  4QB4 A;  1D5Z C;  5TSS A;  3PIO A;  1JJC B;  1UE7 A;  3HKZ B;  4HJ8 A;  1EY5 A;  2EZV A;  4DNR B;  1CA6 A;  3F2C A;  3IL8 A;  4LAA A;  2D0O A;  1U0L A;  4UDU C;  2PZU A;  4A3G G;  4GKJ Q;  2CFM A;  2XGT A;  4WJW A;  1JJ2 A;  1PRT F;  4MZ9 A;  1T5E A;  1XNQ L;  4NW2 A;  4Y52 H;  1PVO A;  2ICE C;  3U9O A;  4IUP A;  4KY5 A;  3HOY B;  4FF1 A;  1MBY A;  2AKW B;  4P73 A;  2E2D C;  4HJ5 A;  4GNX B;  3VR4 A;  4ZKC B;  1M4V A;  1YZ6 A;  3KBX A;  1SRO A;  1SMY C;  3GTQ H;  3V96 A;  2Z4H A;  4DF7 A;  4GLA C;  2JA8 B;  3S1M B;  3HOV G;  4DV6 Q;  2MHV A;  4R4T A;  3PMF A;  5C3E G;  4A3D B;  3T1Y L;  2E2I H;  2YU9 H;  2K04 A;  5BR8 L;  4IOC A;  1UE6 A;  4BWG B;  2NVQ H;  3BVM A;  4YHH L;  3OSO A;  3NEL A;  1N36 L;  1UNS A;  4DV7 Q;  1H95 A;  4LUZ A;  4PZ7 A;  4LFC L;  1QCB D;  1JCK B;  2I0Q A;  1V1P A;  1EYA A;  2WKD A;  3H0G B;  2K01 A;  1QOH A;  1MHW C;  1RCV D;  4X64 Q;  3HOX G;  2Z1C A;  2AWO A;  5ELB A;  3DHQ A;  3TZU A;  4JI6 L;  2EYP A;  1CT1 D;  1LTS D;  3H91 A;  3AB9 A;  2O5I C;  2KHJ A;  2EYF A;  2NN6 I;  3CCU A;  3M9B A;  2CW0 C;  3K57 A;  2K5N A;  2VXW A;  3KF6 A;  2VZA A;  1AP0 A;  2TMP A;  1Y8N B;  1DCZ A;  4YIJ A;  4DR4 Q;  4HED A;  4KKU A;  3GP7 A;  3EBE A;  4BY1 B;  1C48 A;  5LL6 S;  2Q8T A;  2BA1 A;  2PZW A;  4HTH A;  3W3A A;  1CHP D;  3X3M A;  5IYC G;  1LO5 D;  2JSO A;  1SNO A;  4ODG A;  4LFA Q;  2F0D A;  1VMP A;  2F0E A;  3TN2 A;  2PPB C;  5A2Q E;  1OXT A;  3K7A B;  3K5L A;  5K36 H;  5IT9 c;  5JJL A;  4G4K A;  3U4V A;  4DAP A;  5JJK A;  4CDE C;  2PMZ E;  3RZD B;  4YWL A;  1F9P A;  2F0T A;  3QO2 A;  3OMC A;  4DXG A;  1FNW A;  1XYI A;  4N9T A;  1N34 Q;  2RBM A;  3NSW A;  2R92 G;  3NWS A;  2Z6B A;  3BVZ A;  1LM0 A;  2NZH A;  4KKS A;  4P2C B;  2VUM G;  3KF8 A;  1M8A A;  1G2S A;  1CKM A;  5M3F H;  2DNE A;  2PW7 A;  5I2X A;  4BBS B;  3QOJ A;  1CM9 A;  5IOC A;  4GOP A;  4C3J B;  1HR0 Q;  1YVC A;  3RLN A;  4KD3 A;  1I5F A;  3IAY A;  1YJN A;  1TKW B;  2F0S A;  4KLK A;  3TS2 A;  1DGS A;  5EJW A;  4ME3 A;  3VA5 A;  3HOW G;  3S16 H;  1BR9 A;  2E2H H;  4RGT A;  5A35 A;  4HID A;  3IKJ A;  2ZTD A;  2KEE A;  2ZJP A;  4K14 A;  4XQN A;  4NP5 A;  3K7A H;  4Q5V A;  1K0S A;  2EY1 A;  2Q2I A;  3M4O H;  4A3C G;  4ILW A;  4KJN A;  1AN8 A;  4ULL A;  1LTI D;  1L1O B;  1Y1V B;  4KY6 A;  2R93 B;  4F7X A;  1TR5 A;  3I4M H;  1Y1V H;  1RTN A;  4GLV B;  4AQY Q;  2R93 H;  2JE6 I;  1QZG A;  3CC2 A;  2PI2 A;  1A3V A;  1A15 A;  4RAU C;  4JI8 L;  2IJ0 A;  3BZK A;  2L55 A;  4DAM A;  3CCE A;  2IW3 A;  1TWF H;  3RMH A;  3MVV A;  2F3V A;  4F8M A;  3CME A;  2M9V A;  4G7Z C;  4A3M H;  1N8R C;  3J7Z C;  1VQF A;  4JK1 C;  2SDF A;  3VR2 A;  2B2W C;  2RA4 A;  1R4Q B;  4LF4 Q;  4FVM A;  2Q2T A;  1LTB D;  1YNX A;  5E1F A;  1JC7 A;  3A0J A;  1SE8 A;  3OTO Q;  2JA5 H;  1BCP C;  5FKA C;  4A3B G;  4X3S A;  1WCM B;  5T1I A;  2Q2H A;  1QUQ B;  4FO2 A;  4OXP A;  5FLM H;  3HG9 A;  3ERO A;  1IXR A;  3K0X A;  1Q7Y C;  1AZQ A;  4B3S L;  4OO1 H;  5FOB B;  1M90 C;  4U67 3;  1KIX A;  4CHT B;  3PO3 G;  1PFB A;  2PCF B;  4LF9 L;  3ITP A;  2XIW A;  3L7Z C;  5DNF A;  3QG1 A;  2L9H A;  3I72 A;  2PMZ B;  3BYY B;  3BDO A;  2EDG A;  2MO0 A;  3HRZ C;  4A3J G;  2ZM6 L;  5IYD G;  2AUK A;  1HUM A;  4CDC C;  1HJP A;  2E2J H;  4RG1 A;  2KHI A;  4I7Z C;  2NVT H;  3KOJ A;  4DK0 A;  3T4A C;  1H9R A;  2KVM A;  1PYW D;  4N9P A;  3KF8 B;  1BO0 A;  1RIP A;  1L0Y B;  2EY6 A;  4NB3 A;  3CRL C;  4LMQ D;  1FNU A;  1VQM A;  1SYF A;  1UEB A;  1SYB A;  2RCN A;  3VR6 A;  2KJX A;  1TWG B;  3HZX A;  3TZD A;  3M4P A;  4C3I B;  3GTO B;  4XT1 B;  2YTY A;  4FNF A;  1QE6 A;  1KNE A;  1M1K C;  4DR5 Q;  1CI3 M;  2CW0 D;  1TWC B;  4X3U A;  2A69 D;  5IIF A;  1IKM A;  4LFB L;  5M3M B;  1N32 Q;  5D3I B;  4DR6 Q;  3GTM H;  1PFN A;  3DM1 A;  4QIW B;  3I70 A;  4ZLT F;  1DOL A;  2KCM A;  2JQO A;  3R2T A;  1NCV A;  1EYC A;  3KBG A;  4CJ2 C;  1ONL A;  4IO9 A;  2VQE Q;  1I4H A;  3ULP A;  2JA6 G;  4HIM A;  2I46 A;  2TSS A;  1QNU A;  2WFW A;  1PH3 A;  1ML0 D;  4XQQ A;  4KY7 A;  3NBI A;  4NXN L;  2EJM A;  2YTX A;  5IYC H;  2RF4 A;  3S2D B;  1PMR A;  3QJY A;  4NPS A;  3Q23 A;  4JI4 Q;  1I4X A;  1YHQ A;  4ME5 A;  4JI0 L;  2XRS D;  4DR2 Q;  2OEO A;  3LNN A;  4DAY A;  1STN A;  4B3R Q;  4XQJ A;  1EY7 A;  1XPU A;  1MJE A;  1LYL A;  1NSN S;  1L1O C;  2G9H D;  3G7L A;  1D5M C;  4RA8 A;  3KLW A;  4WFN 3;  5EQ0 A;  4JI6 Q;  2CWP A;  1U4P A;  3A8K E;  1QIL A;  1HZC A;  4KD4 A;  2I5M X;  4DUY L;  1GUO A;  5IGB A;  1ASY A;  3GV6 A;  3MZ5 A;  1B4O A;  1K3B C;  1KHI A;  3JAM i;  4CBV A;  2B39 A;  4OO1 G;  3CW2 C;  3VYT A;  4J1M A;  4OWW B;  4B3R L;  1B50 A;  3DMU A;  1XWE A;  1BBU A;  1S3O A;  5CV4 A;  4PMW A;  3CCV A;  4YCU A;  1E0B A;  1FYC A;  2QEX A;  3MA2 B;  2NZ1 D;  1HNZ Q;  5CR3 A;  3PUW A;  1SFO H;  5M5Y B;  2DGY A;  4AH6 A;  1CHQ D;  1XPO A;  1EY9 A;  2L4N A;  2NZO A;  3G4S A;  1DYQ A;  1XMQ Q;  1EQQ A;  2NVY H;  2XSC A;  4QL5 A;  4POG A;  3HOY H;  5LMN L;  3NPP A;  3C1F A;  4AYB B;  3BJU A;  5ELF A;  4PMC A;  2Y0S B;  1WTV A;  4JPB W;  4RMF A;  1H9K A;  1Q1B A;  1O7Y A;  5M3M H;  2K03 A;  2GA4 B;  1E24 A;  1I4Q A;  4L5S A;  3TP7 A;  2VW9 A;  4K8J A;  5BR8 Q;  1VQ7 A;  3E9H A;  1ICF B;  1F2L A;  1UE1 A;  1TWH H;  1S4Z A;  1YNN D;  4DV0 L;  3U9S A;  1D2B A;  2D0P A;  2K5D A;  3FPU B;  3FRP B;  3HKZ E;  3CXC A;  3CQZ B;  4PZ8 A;  4X66 Q;  3VDY A;  5C4J H;  3HOU B;  2IHF A;  1SE3 A;  1KAA A;  4A3F H;  2A5H A;  1SNC A;  4UHV A;  5F2D A;  3UE1 A;  1F9S A;  4GLX A;  1HH2 P;  1SNP A;  5KNC A;  3CCL A;  1U4R A;  2ATW A;  3ZYY X;  2R6G A;  4CDF C;  1OO9 B;  2OT2 A;  1NMF A;  1QUQ A;  2CCZ A;  3MXG A;  4DNT B;  1P16 A;  1I3Q H;  2SNS A;  1B1Z A;  1U4M A;  2A74 C;  1JOK A;  4DR2 L;  3I4L A;  3GTK B;  4B9X A;  3KDF B;  1TII D;  1PRT C;  1KLU D;  3R3O A;  2Z9H A;  1EQV A;  2RQX A;  4B9W A;  5IY0 A;  4CDD C;  3NHH A;  1PH9 A;  2CKZ B;  2YV5 A;  4H7B A;  5BN5 A;  1O78 A;  1VQ8 A;  2MFI A;  1PZJ D;  3DEP A;  2QCP X;  4KMU C;  4JI1 Q;  4DKA C;  2L5T A;  1B3Q A;  4A93 B;  3U50 C;  3CD6 A;  4YCW A;  3OW7 A;  3CF5 A;  1I6H H;  1SRU A;  1PV4 A;  2K14 A;  2KUM A;  3Q0A A;  1B3A A;  2AMC B;  2EYM A;  4GNX C;  1WD1 A;  3P75 A;  2AHO B;  2KA7 A;  4XT3 B;  5JPM C;  1B8A A;  4A93 G;  5CV5 A;  2I5H A;  4JBK A;  1EY4 A;  2BDO A;  2H5X A;  3I7F A;  4DR7 L;  1IL2 A;  1EU3 A;  4JI1 L;  1HQR D;  1VF7 A;  5KND A;  3J81 E;  2SOB A;  1XPR A;  3OYY A;  1EYD A;  4XYQ A;  2LXJ A;  4DAV A;  3RZO H;  3CCQ A;  1DD2 A;  3C3L A;  3KK7 A;  3QOL A;  5BN4 A;  1E2Z A;  3ER0 A;  5C4X H;  4R8N A;  1D8L A;  3F8T A;  2CVR A;  1K28 A;  4H0L C;  2AWN A;  2VB2 X;  5IYD H;  2D2C C;  3I91 A;  2A6H C;  5C6A A;  4DFA A;  1RF2 D;  4POF A;  2OQK A;  2QEJ C;  5HY6 A;  1RDP D;  5FLX E;  2WB1 E;  4FDB A;  5CV7 A;  3PUY A;  4IJH A;  1EIH A;  1WOC A;  1ILQ A;  5C3X A;  2ZXP A;  3VR5 A;  2MJ8 A;  4M8A A;  4RGN A;  3WOE A;  4DR4 L;  3S14 B;  1Z6H A;  1YBY A;  3CAM A;  1DJR D;  3QWN A;  1NR2 A;  4TKO B;  3LGJ A;  1SNM A;  1U4L A;  3W1B A;  1G6Z A;  2VS1 A;  1CKN A;  2LS0 1;  3GTP H;  1FNV A;  4A3I H;  1B2T A;  1X3Q A;  3Q6S A;  1I3Q B;  4GOP B;  3H3V I;  2JP1 A;  3C1E A;  3KFU A;  5J3B A;  1A6X A;  5J22 A;  4EVO A;  2FHT A;  2MO1 A;  3DUZ A;  3H15 A;  4X3T A;  1B70 B;  4ID6 A;  3LX0 A;  4MN3 A;  2EXZ A;  1EZ6 A;  2K1B A;  5GAG C;  2JA6 H;  1E3P A;  1N34 L;  1E22 A;  1EOV A;  2PQE A;  2K7V A;  2JEA I;  4OX9 L;  3PIP 3;  2RDF A;  4AIM A;  2Y0S G;  3DXJ C;  3BYT B;  4RFB A;  4HR7 B;  4LF8 L;  3K59 A;  1L1O A;  4IPD A;  4OGQ C;  4OIJ A;  1DOK A;  4DV5 L;  1RL2 A;  2J7Z A;  4PMB A;  3HOV B;  2HIX A;  5CC4 A;  2JA8 G;  4OEL B;  2KOL A;  5IGE A;  2FMM A;  1F77 A;  1D1I A;  1LAB A;  2N55 A;  3L3O C;  4RGM A;  4DR3 L;  2QGQ A;  3BG3 A;  2EY5 A;  4K0K Q;  1SDF A;  1DOM A;  1HTL D;  2B2V A;  1V43 A;  4IUT A;  2QIL A;  4DV1 L;  1N36 Q;  5M5X H;  2UXB L;  4UP9 A;  1NJI C;  4FXK C;  5FJ8 H;  3CC4 A;  4EQ5 A;  3PCO B;  1H9J A;  1H9M A;  3GDE A;  1S5F D;  4ZUJ A;  5EKL A;  4J15 A;  1EWI A;  3A7A B;  1CSQ A;  1H9S B;  4HIO A;  3MHB A;  1PTO H;  4KI0 A;  3D8G A;  2KEC A;  4MNO A;  2R92 H;  3SXH A;  2XWB B;  2MP1 A;  1TY2 A;  2EXD A;  5AFW A;  4L6T B;  4C3H H;  1O7I A;  4K5X A;  5DAU A;  1KXL A;  1R9T B;  1C8C A;  2K75 A;  1CZW A;  2X6L A;  4LUO A;  1PH6 A;  4BY7 H;  1EIY B;  2WAQ B;  1G29 1;  1K73 C;  3TME A;  3BDC A;  1IYU A;  4BA2 I;  1LTA D;  5M3F B;  5JVH 3;  3Q22 A;  2NTT A;  3T1H Q;  2EY2 A;  1STG A;  4C3I H;  2XNA C;  1STB A;  3GTO H;  4KHP L;  1QJO A;  4DV5 Q;  2K5Q A;  4YWK A;  1XMQ L;  2FXQ A;  4K2K A;  4M1U B;  4E6I A;  3DM3 A;  3NTI A;  5L37 A;  4BXX G;  1CTM A;  5I4D A;  2N49 A;  3K6O A;  3OPO A;  3UDG A;  4HJ9 A;  1Q46 A;  4OX9 Q;  3RZD H;  1J9O A;  1I50 B;  3NEM A;  3I4M G;  4A3B B;  1SAP A;  1X6O A;  4AYB E;  1TY0 A;  5IE8 A;  1ZXT A;  1Y1W H;  2K4K A;  4JBJ A;  2VB3 X;  2R7Z G;  4B3M Q;  1KRS A;  1TT2 A;  5COY A;  5GAE C;  4Q0F A;  5C44 H;  4JW0 A;  4XDX A;  5C3W A;  4JOI A;  4K8I A;  2F0O A;  3FPP A;  1BBW A;  3OW2 A;  4FF4 A;  4XYO A;  3J7A V;  5C4X G;  3NK9 A;  3R2I A;  4A4I A;  3T13 A;  1OXV A;  5EKI A;  4JI3 L;  4X3K A;  2GVB A;  3RN5 A;  4O1N A;  5AJ3 Q;  1VQE A;  5JOB A;  3M3Y H;  3EVQ A;  4FYD A;  5DM6 3;  4K5W A;  1VQ4 A;  1YNN C;  4L63 B;  2FFK B;  2K32 A;  2A69 C;  1G6P A;  3TQY A;  2JA8 H;  1DXM A;  3PO3 B;  4ZRZ A;  3EA6 A;  3LWE A;  2EYL A;  3DLL A;  1UUP A;  2V4D A;  5D3D A;  5T1G A;  2JEB I;  1Z7T A;  1A63 A;  3A56 A;  1K0R A;  4JI5 L;  2Z0S A;  5EPK A;  3HOW B;  3MEF A;  3NP8 A;  3I73 A;  5CV8 A;  1FGB D;  1PZK D;  4QUF A;  2ZJR A;  3KLS A;  3GTP B;  1EQT A;  4JI2 L;  4OL7 A;  1IBM Q;  1YHA A;  4LF6 Q;  2EYO A;  1ASZ A;  4LUV A;  3H0G H;  3DWQ A;  1D1K A;  1NE3 A;  1WCM H;  1Y8P B;  1VQP A;  1QVG A;  5EPJ A;  1KDC A;  4C2M H;  5IYB H;  1EUJ A;  3T1H L;  3S2D H;  1CUK A;  4KJO A;  3A8I E;  2J4X A;  5EGT A;  3U58 A;  4DR7 Q;  4ZCK A;  3TP8 A;  3SHL A;  1O80 A;  2OCE A;  3P7J A;  3FDT A;  4F88 A;  1PTO C;  1Y1V G;  2R93 G;  1AE2 A;  5C0X I;  4XIG S;  2E76 C;  1FJG L;  1DM0 B;  2OTL A;  4JYA Q;  2PNH A;  3OMG A;  2D9U A;  4UP8 A;  1HZA A;  2UUC Q;  2R7Z B;  2F0M A;  2IHE A;  1HR0 L;  4NDX A;  1LT4 D;  4WOR A;  5KYI A;  1AH9 A;  3NQI A;  4NXM L;  5C0X H;  3GD7 A;  3I4M B;  1T9H A;  5C0X J;  5D65 A;  2M00 A;  3PO2 G;  3CPF A;  3QB3 A;  4IOA A;  4K6D A;  4BY1 G;  1R9T H;  2L12 A;  4IUN A;  4BY7 G;  1SYC A;  4C56 C;  1SJH D;  2MUY A;  5EPL A;  2KCN A;  2L11 A;  1IL8 A;  4DR1 L;  1MSG A;  1JJG A;  1X54 A;  2A68 D;  3SE0 A;  3HOV H;  4A3J H;  3HOU G;  3S16 B;  1BKB A;  1LT3 D;  1ZKO A;  1ENA A;  2Z4I A;  5M3F G;  3TS0 A;  1X56 A;  2HCI A;  2ID0 A;  3S9W A;  4YCV A;  2UUB Q;  3J7A 5;  2F0I A;  3H3V H;  1QVF A;  2K6A A;  3H0G G;  3IFD A;  2WAQ G;  1UE5 A;  3EN2 A;  2IX3 A;  1VQ5 A;  3BVG A;  4NXN Q;  4QMG A;  3SDZ A;  4UAI A;  5ELE A;  5CMD A;  2Z6K C;  1KQS A;  4K0K L;  4AYB G;  5IP9 H;  3EQL C;  1CK1 A;  5JEA H;  2F0W A;  2AQ2 B;  1JOR A;  3TRE A;  2EVB A;  4DR3 Q;  4MTN A;  2D5D A;  2HT1 A;  3I2Z A;  1S5B D;  3A5U A;  1BBX C;  2LSS A;  4OEM B;  1U5K A;  3TEH B;  4MHE A;  3RLF A;  2HHH L;  3D4W A;  2F0N A;  1VQL A;  4LF8 Q;  2HDM A;  3S14 H;  4O0A A;  2A8V A;  1FD7 D;  1L0W A;  1RHP A;  4V19 0;  2PI2 E;  1ESR A;  1YNJ D;  3K80 C;  4L8J A;  4QF4 A;  4Y7N B;  1I4G A;  1QB5 D;  2IX0 A;  1L0X B;  5FLX c;  1AZP A;  5IWA Q;  2ICI A;  4BBR H;  1XX8 A;  1ET9 A;  3KF6 B; 
#chains in the Genus database with same CATH homology
 1UEA B;  4I65 A;  1LV9 A;  4K6L A;  2N88 A;  3L9A X;  2HQE A;  2SNM A;  1VF5 C;  3JAM L;  3I90 A;  5JEA J;  5ELC A;  2RSO A;  2MPM A;  1BOS A;  2F03 A;  3N6R A;  2NN6 G;  5HUR A;  2LFN A;  2ZT9 C;  1T5X D;  3MC0 B;  1STY A;  3C46 A;  3G6J B;  5EKK A;  2LY7 A;  3M85 A;  1Q12 A;  2CQA A;  3M4Y A;  3H3V C;  3S1N B;  5DEH A;  4EQO A;  3I8Z A;  4DU9 A;  2JA6 B;  4DGZ A;  2EYH A;  2B2U C;  5M5W B;  4FXG C;  4G7O C;  3RD4 A;  3LWU A;  3I3C A;  1PXU A;  5M5X B;  1SSO A;  1J8I A;  1ZEQ X;  4HMJ A;  1EIG A;  5D14 A;  3A8J E;  1RJT A;  3DWA A;  3SK5 A;  3FKI B;  1JWU D;  4OHJ A;  2RDG A;  2XVS A;  3CKI B;  2F0V A;  2H4O A;  1O7Z A;  4XXE A;  1PZI D;  1Q8I A;  4XTC S;  2KHS A;  4IAL A;  1QNK A;  5JEA G;  1KTK A;  1XTC D;  3EJI A;  1SE4 A;  2PW5 A;  5JVG 3;  3OHX C;  5M9O A;  1EWH A;  2DY7 A;  3PUZ A;  4DA2 A;  3R93 A;  3TSS A;  5J1Z A;  2EOT A;  3A7L A;  1A2T A;  1HA6 A;  2VUM B;  3HGB A;  3MXP A;  2EJF C;  1ENC A;  2HDL A;  3PIO 3;  4EQN A;  2F0L A;  1CFM A;  5DM7 3;  1D5X C;  2O2L D;  1ZYR D;  2NBF A;  1HFG A;  2F0J A;  5G3L F;  1AW7 A;  4C2M B;  2VNU D;  3URY A;  1PRT D;  1JR0 D;  1B53 A;  4U68 A;  5C4X B;  2KQ3 A;  1CQV A;  5CBA E;  4TQU S;  1V1P B;  2B2T C;  1LTG D;  1SND A;  3P1H A;  3M7N A;  1YNJ C;  1SEB D;  1DON A;  3HS0 C;  1GJX A;  1EEI D;  2IWH A;  3DWP A;  1I6V C;  2WB1 B;  3S17 B;  3CU7 A;  4C3J G;  1TWH B;  4J8Q A;  3AU7 A;  2B2Y C;  1AEX A;  3GV3 A;  4IFD G;  3GTJ B;  1Q1E A;  1PFM A;  4IFD I;  4IQZ A;  1I6H B;  1A3T A;  2KCC A;  1EY0 A;  1S5C D;  2HCC A;  1EL0 A;  2BDN A;  2F0H A;  2B2W A;  2L0C A;  4RH6 A;  4CJ0 B;  1SYD A;  4ZK9 B;  4ABN A;  2RVL A;  3VYU A;  1B9M A;  2NN6 H;  1A3U A;  2E2I B;  1K8O A;  3MXN A;  2B2Y A;  2EE1 A;  1RTO A;  5K5P A;  1SMY D;  1F2Y A;  3H94 A;  3H09 A;  3NE5 B;  3VYS A;  5G3L D;  5I6W A;  3CHB D;  2SEB D;  3PUV A;  3NXW A;  1STA A;  2AQ1 B;  1TS5 A;  4FP5 D;  5I9P A;  3O13 A;  2YU9 B;  2Q8I B;  4NMZ A;  1QWY A;  2F0F A;  1U9R A;  4PNY A;  3IFT A;  2BOS A;  3I4N B;  1SYG A;  3M4O B;  1IW7 C;  1ILP A;  1K8M A;  1ENF A;  4KHZ A;  1G91 A;  2PZT A;  2B2V C;  3X3N A;  4CKE A;  3D31 A;  2JA5 B;  1GUT A;  1WTP A;  1MSH A;  4O42 A;  3TBI B;  4ZUI A;  1NUC A;  2E75 C;  3H6M A;  2BE5 C;  4GZY C;  1F2M A;  4A3M B;  1RD9 D;  2EJG C;  3T51 B;  4TRD A;  1E2W A;  5C4H A;  3J81 L;  4RHR A;  4IUR A;  1JIC A;  3UI2 A;  2B2T A;  2A6H D;  4PQX A;  5IGG A;  1WTR A;  2B2U A;  2OXP A;  3E6Z X;  3EFX D;  2AQ3 B;  2PYK A;  5ELD A;  5JAV A;  1GUS A;  4RCN A;  1NR4 A;  2FJ2 A;  4FF3 A;  1HHV A;  4IZ8 A;  2NVQ B;  1X32 A;  1BQQ T;  3M3Y B;  2IT1 A;  2HUG A;  5ISR A;  2X69 A;  2WV6 D;  3ERQ A;  1EOT A;  2NUC A;  4PV1 C;  1NAP A;  3V2T A;  4BS9 A;  3GTM B;  4Z9C B;  3A55 A;  5IOD A;  5IGD A;  4DN4 M;  3MTS A;  4DXF A;  1JOO A;  1HPC A;  1LTT D;  1BXT A;  2C9O A;  1TQO A;  3NWT A;  1IYV A;  3OIQ A;  3FMC A;  2R92 B;  4KK7 A;  4KN4 C;  2B8F A;  1G8Z D;  1PDQ A;  2Z8L A;  3PUX A;  1UAP A;  2DY8 A;  1K83 B;  3K0Y A;  2RSN A;  1V1O A;  4C1N I;  1XXG A;  1GUW A;  2LMC B;  5CBE E;  2RDH A;  3D4R A;  4FXD A;  3TP5 A;  2BCO A;  1MD2 D;  1OXX K;  1HUN A;  5C44 B;  1CZG A;  4RKB A;  1HCZ A;  1V8Q A;  3GTL B;  2E2J B;  5LHY 1;  1HXY D;  1E2V A;  2E2H B;  2OF1 A;  2QDB A;  4CGY B;  4ZYS A;  5FO9 B;  2ZXR A;  2BA0 A;  1ROD A;  3D4D A;  3S1R B;  5KNB A;  5E3F A;  5I9O A;  4HAE A;  1Q3L A;  3VA7 A;  3A54 A;  4V0B A;  3GTG B;  1BNZ A;  2ZXO A;  1TWF B;  1BUV T;  2D62 A;  1S5D D;  4FF2 A;  3J7A F;  4R8I A;  5C3E B;  3SEB A;  2XWJ B;  2NYZ D;  3P20 A;  1TWA B;  1ET6 A;  5IT9 E;  3FEW X;  2K33 A;  5FO8 B;  2JXM B;  1GOZ A;  4B08 A;  3SVM A;  5CYU A;  3K58 A;  1OXS C;  3T16 A;  3E0J A;  1FR3 A;  3GO5 A;  3T53 B;  2A6E C;  3SK8 A;  1BCP D;  1I4P A;  1TS4 A;  5BN3 A;  1GUN A;  3S2H B;  5LL6 X;  5JPN C;  4C3H G;  2NTS A;  4QCL A;  1PRT B;  3BS1 A;  4CKC A;  1LTR D;  4A3E B;  2IL8 A;  1KNA A;  2PNR C;  1EFI D;  1F9R A;  3TP6 A;  3NUC A;  2CHB D;  4A3K B;  1H9S A;  5KGU A;  3ND8 A;  2EPB A;  2C5C A;  3ONA B;  4HN7 A;  1JWS D;  1II3 A;  3KLR A;  2F4I A;  3OIP A;  1KLG D;  4F87 A;  4H13 C;  5I6Y A;  2Q8R E;  1GUG A;  2AUJ D;  4S3S A;  4RGO S;  3GTQ B;  1OXU A;  1JWM D;  3BZD B;  2NVY B;  3ND9 A;  1BCP F;  1F2Z A;  1TU2 B;  1ICW A;  1S5E D;  1STH A;  2NWG A;  4A3I B;  3MFY A;  4C3I G;  4RHS A;  4C1N K;  4IUV A;  2L1B A;  5COR A;  2FMC A;  4HSV A;  4KV6 A;  2G9D A;  2XRQ D;  2DNC A;  1Z47 A;  1GXD C;  1CQF A;  3K5O A;  2A73 B;  4A3F B;  3D6C A;  1W6J A;  1JB3 A;  1SNQ A;  4HSP A;  4LK1 C;  1F9Q A;  5CV6 A;  4A3J B;  1VMC A;  3AMU A;  1BF4 A;  3J80 L;  1WTO A;  1HRJ A;  1EZ8 A;  1VCI A;  3V05 A;  5J39 A;  1GHK A;  4EQP A;  1I4R A;  1LT5 D;  5KYL A;  2F0P A;  4RKL A;  3NTH A;  1X3P A;  3J80 E;  4BA1 I;  3N52 A;  3PV0 A;  1WTX A;  1PTO B;  3MXU A;  1IW7 D;  1SFO B;  4G7H C;  1MGS A;  2JYO A;  4MIU A;  1SXT A;  5FO7 B;  1WTW A;  2F3W A;  3VR3 A;  2JA7 B;  1G2T A;  1JQY D;  2J0T D;  2NB0 A;  4J6H A;  5EBC A;  5IGC A;  1SJE D;  3K5N A;  1CA5 A;  4RCO A;  2NVX B;  3OWE B;  3RZO B;  5I2Y A;  5A2Q L;  5FK9 C;  2X6G A;  2A6E D;  2QF7 A;  4OIK A;  3NQT A;  3Q24 A;  2R61 A;  4DK1 A;  1EY6 A;  1EU4 A;  4CKB A;  4IFD J;  1PTO F;  5C4Z A;  3KUP A;  1KDA A;  2QKI C;  3OOC A;  4IUU A;  2WKC A;  1STE A;  1LT6 D;  2XN9 C;  1W6K A;  2H1E A;  2WP8 J;  5KRU A;  1JE4 A;  3D6W A;  2F1M A;  5C5L A;  2YYZ A;  1HFN A;  3W2D A;  3FVQ A;  3SK4 A;  3JAM E;  4BY7 B;  3R8B A;  3HEJ A;  5C0X G;  1SBB B;  4H44 C;  1R4P B;  1IKL A;  2ENB A;  2IPK D;  1A2U A;  3E5S A;  3PO2 B;  2F0G A;  4ZAI A;  2F0Q A;  5CGK A;  4C3H B;  4HMI A;  2DN8 A;  1EEF D;  2K05 A;  2R3Z A;  2IX1 A;  4OO1 I;  3K5M A;  3OWF A;  1QG7 A;  2FIN B;  3NTK A;  1IHZ A;  1LAC A;  2M2L A;  1BCP B;  2I07 B;  4HCS A;  3S1Q B;  1WD0 A;  5C5M A;  2O5J C;  5C4J B;  4IN3 A;  2F0U A;  4IFD H;  4JBW A;  4IUQ A;  3KLS X;  5E4W C;  2F0K A;  3F2U A;  3HOZ B;  3GQB A;  5NUC A;  5FLX L;  1KAB A;  2B8G A;  4KKT A;  3SK6 A;  1JOQ A;  2WII B;  3HOX B;  3QIA A;  1Q90 A;  5CV9 A;  3C2P A;  4K2L A;  1PTO D;  1HA5 A;  1B9N A;  1ESF A;  5HGT A;  2WIN B;  5KEE A;  1B44 D;  1GHJ A;  3MFG A;  1TVX A;  1Y8O B;  1HTP A;  2A68 C;  2NVT B;  4QUC A;  5EBD A;  1TS3 A;  1VDZ A;  2K28 A;  3BDL A;  4CJ1 B;  3NBH A;  1ZYR C;  1O7L A;  1KDB A;  1PLF A;  3HP3 A;  4R9W A;  3S15 B;  2LKV A;  4G57 A;  4NKL A;  5IT9 L;  2BE5 D;  4A3G B;  2KED A;  3DEO A;  1SYE A;  4WRD A;  4KN7 C;  5E4X A;  1AFP A;  3T56 B;  5KIX A;  3WDN A;  3SR1 A;  1EY8 A;  4EGV A;  2EYJ A;  3MEH A;  1SE2 A;  1Y69 U;  3VYR A;  3M7G A;  4KHV A;  3CRK C;  3MWY W;  3D3R A;  2O4X A;  2K5W A;  4KTA A;  2B63 B;  3RUZ A;  1RKN A;  5K36 G;  5JJZ A;  2RKS A;  4K5V A;  4TSS A;  2PO4 A;  4HCE A;  2WAC A;  4ZKB B;  2E74 C;  4ZQ3 A;  1C4Q A;  1MI2 A;  1EWC A;  2MGS A;  1BDO A;  1DZ1 A;  4LJZ C;  1WTQ A;  1D6E C;  4BBR B;  1HQM C;  1TS2 A;  3TDQ A;  5IGF A;  1WVL A;  1Y1W B;  4RWS C;  1LLR D;  3MAQ A;  3WOF A;  3J7Y W;  4QB4 A;  1D5Z C;  5TSS A;  3HKZ B;  1EY5 A;  2EZV A;  4DNR B;  1CA6 A;  3IL8 A;  4LAA A;  4UDU C;  2PZU A;  4WJW A;  1PRT F;  1T5E A;  4NW2 A;  2ICE C;  3U9O A;  4IUP A;  4KY5 A;  3HOY B;  4FF1 A;  1MBY A;  2E2D C;  3VR4 A;  4ZKC B;  1M4V A;  3KBX A;  1SMY C;  3V96 A;  2Z4H A;  4DF7 A;  2JA8 B;  3S1M B;  2MHV A;  3PMF A;  4A3D B;  2K04 A;  4BWG B;  3BVM A;  3OSO A;  1UNS A;  1QCB D;  1JCK B;  1V1P A;  1EYA A;  2WKD A;  3H0G B;  2K01 A;  1QOH A;  1RCV D;  2Z1C A;  2AWO A;  5ELB A;  3DHQ A;  3TZU A;  2EYP A;  1CT1 D;  1LTS D;  3H91 A;  3AB9 A;  2O5I C;  2EYF A;  2NN6 I;  2CW0 C;  3K57 A;  2VXW A;  1AP0 A;  2TMP A;  1Y8N B;  1DCZ A;  4YIJ A;  4HED A;  4KKU A;  3GP7 A;  4BY1 B;  1C48 A;  5LL6 S;  2Q8T A;  2BA1 A;  2PZW A;  4HTH A;  3W3A A;  1CHP D;  3X3M A;  1LO5 D;  2JSO A;  1SNO A;  4ODG A;  2F0D A;  1VMP A;  2F0E A;  3TN2 A;  2PPB C;  5A2Q E;  1OXT A;  3K7A B;  3K5L A;  5K36 H;  4G4K A;  4DAP A;  3RZD B;  1F9P A;  2F0T A;  3QO2 A;  3OMC A;  4DXG A;  1FNW A;  1XYI A;  4N9T A;  2RBM A;  3NSW A;  3NWS A;  3BVZ A;  4KKS A;  4P2C B;  3KF8 A;  1M8A A;  1G2S A;  2DNE A;  2PW7 A;  5I2X A;  4BBS B;  3QOJ A;  1CM9 A;  5IOC A;  4C3J B;  4KD3 A;  3IAY A;  1TKW B;  2F0S A;  5EJW A;  3VA5 A;  1BR9 A;  4RGT A;  5A35 A;  3IKJ A;  2KEE A;  4K14 A;  4XQN A;  4NP5 A;  4Q5V A;  2EY1 A;  4ILW A;  4KJN A;  1AN8 A;  4ULL A;  1LTI D;  1Y1V B;  4KY6 A;  2R93 B;  4F7X A;  1TR5 A;  1RTN A;  2JE6 I;  1A3V A;  1A15 A;  4RAU C;  2IJ0 A;  2L55 A;  2IW3 A;  3RMH A;  3MVV A;  2F3V A;  4F8M A;  2M9V A;  4G7Z C;  4JK1 C;  2SDF A;  3VR2 A;  2B2W C;  2RA4 A;  1R4Q B;  4FVM A;  1LTB D;  5E1F A;  1JC7 A;  1BCP C;  5FKA C;  4X3S A;  1WCM B;  5T1I A;  4FO2 A;  3HG9 A;  3ERO A;  1AZQ A;  4OO1 H;  5FOB B;  4U67 3;  4CHT B;  1PFB A;  2PCF B;  3ITP A;  2XIW A;  3L7Z C;  5DNF A;  3QG1 A;  2L9H A;  3I72 A;  2PMZ B;  3BYY B;  3BDO A;  2EDG A;  3HRZ C;  2AUK A;  1HUM A;  4I7Z C;  4DK0 A;  3T4A C;  1H9R A;  2KVM A;  1PYW D;  4N9P A;  1BO0 A;  1L0Y B;  2EY6 A;  3CRL C;  4LMQ D;  1FNU A;  1SYF A;  1SYB A;  3VR6 A;  2KJX A;  1TWG B;  3HZX A;  3TZD A;  4C3I B;  3GTO B;  4XT1 B;  4FNF A;  1QE6 A;  1KNE A;  1CI3 M;  2CW0 D;  1TWC B;  4X3U A;  2A69 D;  5IIF A;  1IKM A;  5M3M B;  5D3I B;  1PFN A;  3DM1 A;  4QIW B;  3I70 A;  4ZLT F;  1DOL A;  3R2T A;  1NCV A;  1EYC A;  3KBG A;  4CJ2 C;  1ONL A;  1I4H A;  2I46 A;  2TSS A;  1QNU A;  1ML0 D;  4XQQ A;  4KY7 A;  3NBI A;  2EJM A;  3S2D B;  1PMR A;  3QJY A;  3Q23 A;  1I4X A;  4ME5 A;  2XRS D;  2OEO A;  3LNN A;  4DAY A;  1STN A;  4XQJ A;  1EY7 A;  1NSN S;  2G9H D;  3G7L A;  1D5M C;  4RA8 A;  4WFN 3;  5EQ0 A;  1U4P A;  3A8K E;  1QIL A;  4KD4 A;  1GUO A;  5IGB A;  3GV6 A;  3MZ5 A;  1B4O A;  4CBV A;  2B39 A;  4OO1 G;  3VYT A;  4J1M A;  1B50 A;  3DMU A;  1XWE A;  5CV4 A;  4PMW A;  1E0B A;  1FYC A;  3MA2 B;  2NZ1 D;  5CR3 A;  3PUW A;  5M5Y B;  1CHQ D;  1EY9 A;  2L4N A;  1DYQ A;  2XSC A;  3NPP A;  3C1F A;  4AYB B;  5ELF A;  4PMC A;  2Y0S B;  1WTV A;  1H9K A;  1Q1B A;  1O7Y A;  2K03 A;  2GA4 B;  1I4Q A;  3TP7 A;  4K8J A;  1F2L A;  1S4Z A;  1YNN D;  3U9S A;  1D2B A;  2K5D A;  3FPU B;  3FRP B;  3CQZ B;  3HOU B;  1SE3 A;  1KAA A;  2A5H A;  1SNC A;  5F2D A;  1F9S A;  1SNP A;  5KNC A;  1U4R A;  3ZYY X;  2R6G A;  1OO9 B;  2OT2 A;  3MXG A;  4DNT B;  2SNS A;  1B1Z A;  1U4M A;  2A74 C;  1JOK A;  3I4L A;  3GTK B;  4B9X A;  1TII D;  1PRT C;  1KLU D;  3R3O A;  1EQV A;  2RQX A;  4B9W A;  3NHH A;  4H7B A;  5BN5 A;  1O78 A;  1PZJ D;  3DEP A;  2QCP X;  4KMU C;  2L5T A;  4A93 B;  3OW7 A;  2KUM A;  3Q0A A;  1WD1 A;  1B3A A;  2EYM A;  3P75 A;  2KA7 A;  4XT3 B;  5JPM C;  5CV5 A;  1EY4 A;  2BDO A;  1EU3 A;  5KND A;  1HQR D;  1VF7 A;  3J81 E;  2SOB A;  1EYD A;  4XYQ A;  4DAV A;  1DD2 A;  3C3L A;  3KK7 A;  3QOL A;  5BN4 A;  1E2Z A;  4R8N A;  2CVR A;  4H0L C;  2AWN A;  2VB2 X;  2D2C C;  3I91 A;  2A6H C;  5C6A A;  4DFA A;  1RF2 D;  2QEJ C;  1RDP D;  5FLX E;  5CV7 A;  3PUY A;  1EIH A;  1ILQ A;  5C3X A;  2ZXP A;  3VR5 A;  2MJ8 A;  4M8A A;  4RGN A;  3WOE A;  3S14 B;  1Z6H A;  1DJR D;  3QWN A;  1NR2 A;  4TKO B;  1SNM A;  1U4L A;  1G6Z A;  2LS0 1;  1FNV A;  1B2T A;  1X3Q A;  3Q6S A;  1I3Q B;  2JP1 A;  3C1E A;  1A6X A;  5J22 A;  4EVO A;  2FHT A;  3DUZ A;  4X3T A;  4ID6 A;  3LX0 A;  4MN3 A;  2EXZ A;  1EZ6 A;  2K1B A;  2PQE A;  2K7V A;  2JEA I;  3PIP 3;  2RDF A;  3DXJ C;  3BYT B;  4RFB A;  4HR7 B;  3K59 A;  4OGQ C;  4OIJ A;  1DOK A;  2J7Z A;  4PMB A;  3HOV B;  5CC4 A;  2KOL A;  5IGE A;  2FMM A;  1F77 A;  1D1I A;  1LAB A;  2N55 A;  3L3O C;  4RGM A;  3BG3 A;  2EY5 A;  1SDF A;  1DOM A;  1HTL D;  2B2V A;  1V43 A;  4IUT A;  2QIL A;  4FXK C;  1H9J A;  1H9M A;  1S5F D;  4ZUJ A;  5EKL A;  3A7A B;  1H9S B;  3MHB A;  1PTO H;  4KI0 A;  3D8G A;  2KEC A;  3SXH A;  2XWB B;  2MP1 A;  1TY2 A;  5AFW A;  4L6T B;  4K5X A;  5DAU A;  1R9T B;  1C8C A;  1CZW A;  2X6L A;  2WAQ B;  1G29 1;  3TME A;  3BDC A;  1IYU A;  4BA2 I;  1LTA D;  5M3F B;  5JVH 3;  3Q22 A;  2NTT A;  2EY2 A;  1STG A;  2XNA C;  1STB A;  1QJO A;  2K5Q A;  4K2K A;  4M1U B;  4E6I A;  3NTI A;  1CTM A;  5I4D A;  3OPO A;  3K6O A;  1J9O A;  1I50 B;  4A3B B;  1SAP A;  1TY0 A;  1ZXT A;  2VB3 X;  1TT2 A;  5COY A;  4Q0F A;  4XDX A;  5C3W A;  4K8I A;  2F0O A;  3FPP A;  4FF4 A;  4XYO A;  3J7A V;  3NK9 A;  3R2I A;  3T13 A;  1OXV A;  5EKI A;  4X3K A;  4O1N A;  5JOB A;  3EVQ A;  4FYD A;  5DM6 3;  4K5W A;  1YNN C;  4L63 B;  2FFK B;  2K32 A;  2A69 C;  1DXM A;  3PO3 B;  4ZRZ A;  3EA6 A;  3LWE A;  2EYL A;  1UUP A;  2V4D A;  5D3D A;  5T1G A;  2JEB I;  1Z7T A;  3A56 A;  3HOW B;  5EPK A;  3NP8 A;  3I73 A;  5CV8 A;  1FGB D;  1PZK D;  4QUF A;  3KLS A;  3GTP B;  1EQT A;  4OL7 A;  2EYO A;  3DWQ A;  1D1K A;  1Y8P B;  5EPJ A;  1KDC A;  4KJO A;  3A8I E;  2J4X A;  5EGT A;  3TP8 A;  3SHL A;  1O80 A;  3P7J A;  3FDT A;  4F88 A;  1PTO C;  5C0X I;  4XIG S;  2E76 C;  1DM0 B;  3OMG A;  2D9U A;  2R7Z B;  2F0M A;  4NDX A;  1LT4 D;  4WOR A;  5KYI A;  3NQI A;  5C0X H;  3GD7 A;  3I4M B;  5C0X J;  5D65 A;  2M00 A;  3QB3 A;  4K6D A;  2L12 A;  4IUN A;  1SYC A;  4C56 C;  1SJH D;  2MUY A;  5EPL A;  2KCN A;  2L11 A;  1IL8 A;  1MSG A;  2A68 D;  3SE0 A;  3S16 B;  1LT3 D;  1ZKO A;  1ENA A;  2Z4I A;  2HCI A;  2ID0 A;  3S9W A;  2F0I A;  2K6A A;  3IFD A;  2IX3 A;  3BVG A;  4QMG A;  3SDZ A;  4UAI A;  5ELE A;  5CMD A;  3EQL C;  1CK1 A;  5JEA H;  2F0W A;  2AQ2 B;  1JOR A;  2EVB A;  2D5D A;  1S5B D;  1BBX C;  4MHE A;  3RLF A;  3D4W A;  2F0N A;  2HDM A;  1FD7 D;  1RHP A;  4V19 0;  1ESR A;  1YNJ D;  4L8J A;  4QF4 A;  4Y7N B;  1I4G A;  1QB5 D;  2IX0 A;  1L0X B;  1AZP A;  2ICI A;  1XX8 A;  1ET9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...