5I6YA

Crystal structure of staphylococcal nuclease variant delta+phs a90e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLEYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A90E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i6yA00
3OMGA 1SNPA 4WRDA 2LKVA 4K8JA 5F2DA 4EQNA 3QOJA 3P1HA 1EY9A 3OWFA 2F0MA 2F0UA 4YIJA 5IGEA 1STHA 1STYA 2NUCA 3P75A 5ISRA 4HMIA 2F0JA 3C1EA 4WORA 5CV5A 5IGGA 1STAA 4K2LA 5JOBA 2EYMA 1A3UA 5M9OA 5HURA 3DMUA 5CR3A 4NMZA 5K5PA 4EQOA 4KJOA 4MIUA 1SNQA 4K5WA 1A2UA 1STBA 2F0LA 3HEJA 2HQEA 5C4HA 3LX0A 1A3VA 2SNSA 3BDCA 3NUCA 1SYEA 4OL7A 3T13A 4IALA 1NSNS 4KV6A 3RUZA 5IOCA 1TR5A 4K14A 3DHQA 3QB3A 4H7BA 3EVQA 3EROA 2F0VA 2F3WA 1AEXA 3R3OA 4NDXA 4R8NA 1SYCA 2F0FA 5DAUA 4ZQ3A 1KDAA 4K8IA 3T16A 1EZ6A 5KYLA 4KTAA 1U9RA 3S9WA 4F7XA 5I6WA 2EY1A 3PMFA 2F0WA 1SNOA 2EXZA 3NXWA 4EQPA 1KDBA 4J6HA 5J22A 4DF7A 5EKKA 2KHSA 3NP8A 3MHBA 3D6CA 3NHHA 5CC4A 4ME5A 5KYIA 1SYGA 2F0DA 2F3VA 1SYDA 1EY5A 3ERQA 4K2KA 5CV7A 1JOQA 5CV4A 5IGDA 5C3WA 4KY5A 1STNA 3OSOA 2RKSA 5CV6A 4ZUJA 3SK5A 2EYLA 3H6MA 5C3XA 5IIFA 2M00A 5E1FA 1EYDA 1NUCA 1F2YA 5CGKA 5IGBA 1EY7A 5J1ZA 2O4XA 4TRDA 3V2TA 2KQ3A 4HTHA 4IZ8A 3NK9A 4ODGA 4PMCA 3SK8A 1KAAA 2EYPA 5EKLA 5C6AA 4E6IA 3TP6A 2F0PA 4KY6A 5NUCA 3MVVA 3D4WA 5C5LA 2SOBA 4B9XA 2SNMA 2ENBA 5IGCA 4KY7A 3SR1A 3OMCA 1A3TA 3BDLA 1STGA 1EYCA 4KHVA 3SHLA 4QMGA 2F0TA 5CV8A 5HGTA 2QDBA 3HZXA 2WACA 1SNDA 3MXPA 4IUNA 3SK4A 2PW5A 1EY8A 5E3FA 3TP5A 2EYOA 4QB4A 3SK6A 4N9PA 3QOLA 2F0KA 1SNMA 1EY4A 1IHZA 1RKNA 5IGFA 2EYFA 1TQOA 2PZTA 2PZWA 3VA5A 5KIXA 4I65A 2PW7A 4KJNA 2F0SA 2F0NA 2RDFA 5EGTA 4DGZA 1EZ8A 1EYAA 2PQEA 4LAAA 4S3SA 2PYKA 4PMBA 1ENCA 5KEEA 1KDCA 3D8GA 2EY5A 4J1MA 2RBMA 2EYHA 3U9OA 1SYFA 3TP7A 5IODA 5J39A 2F0GA 4NP5A 2OF1A 1JOKA 3TMEA 5KRUA 4DU9A 3D4DA 5CV9A 4B9WA 2F0QA 5C4ZA 2EY2A 4F8MA 3MEHA 1A2TA 3E5SA 3ITPA 3MZ5A 3NQTA 5DEHA 3TP8A 2F0OA 1EY0A 4EVOA 2OXPA 4QF4A 5I9OA 2EY6A 4HMJA 4ID6A 4PNYA 4RKBA 4N9TA 5C5MA 1JORA 1SYBA 4RKLA 2F0EA 2EYJA 1SNCA 4K6DA 5I9PA 1II3A 4K5XA 3C1FA 4K5VA 5I6YA 1F2MA 3SXHA 2F0HA 1JOOA 4NKLA 2PZUA 1EY6A 3EJIA 4DFAA 1F2ZA 4G57A 4KD3A 4KD4A 5KGUA 1ENAA 1EQVA 1KABA 5JAVA 2OEOA 4ZUIA 2F0IA 1TT2A
chains in the Genus database with same CATH superfamily
4X3TA 1LTGD 3I4LA 2N78A 1XX8A 3Q8DA 4B3MQ 3SGIA 4DR4Q 2AQ3B 5ELBA 4DNIA 4O0AA 1CHPD 4LFAQ 3P75A 4C3IH 1S40A 4LF5L 4KMUC 4A3IB 3C1EA 3HOVG 1Q8KA 1EOTA 3UDXA 1Q90A 2KHJA 3DMUA 4FF2A 3S1QH 3LGJA 3EFXD 1PA6A 4BBSB 1EWHA 1B1ZA 3TZUA 3FKIB 2SNSA 2XWJB 2NN6I 4KV6A 1PZKD 5IOCA 1Q8IA 2F0VA 2UUBQ 2O5IC 1FJGQ 4BY1G 3I55A 2NVTH 2R92B 1V1QA 2B2TA 4XDXA 2CWPA 2IT1A 1AE2A 1ONLA 2Y0SG 3IFDA 1J5EQ 1VQJA 3HOVH 5K36H 1VS0A 4KY5A 2CVRA 2N49A 5E1FA 1KNAA 5CGKA 3GTOH 2VNUD 3KLWA 4JVZA 5BN5A 4O42A 2EPBA 2KBNA 4QIWB 5I4DA 2R7FA 5EKLA 1OXTA 2QA4A 2UU9L 4L5QA 4OGQC 5GQOA 4DR6Q 1IW7C 2WAQB 4H44C 1EWCA 3GTPB 1QE6A 1DM0B 1SFOH 1YI2A 3J81E 1EY8A 4NXNQ 2WINB 5JPMC 3DLLA 5E7NA 1L0YB 5AJ3L 5K36G 4JOIC 4Z9CB 1M8AA 2K5HA 1I4PA 5IYCG 4RCOA 1AFPA 4H13C 4KKUA 4LAAA 4L8JA 5D14A 1XWEA 1I4QA 3RZOH 1HNWQ 3A5UA 3HS0C 4CHTB 4DR5L 1HQRD 3PIOA 4DV2L 1N36Q 5C3EB 2C9OA 4ULLA 4EVOA 2MO1A 4YHHL 3M4PA 3K0XA 1OXVA 2UUAL 1HXYD 3RNUA 3GTKH 1ENFA 3C1FA 5IYCH 3PO3B 1EY6A 1X3FA 3BVZA 4LF4L 4G57A 1I94L 1MKHA 3RMHA 5C4XB 1ENAA 1KABA 3DWQA 1X55A 4IPCA 4R4CA 4XIGS 1KQSA 2UUCQ 1TWGH 5GADC 1JB3A 3CCVA 5LMNQ 4LNQA 1DOLA 1STHA 4WJ4A 4LF7Q 2WP8J 3FHWA 3SVMA 1KRTA 1UEAB 4DR5Q 4CJ1B 3S2HB 2I5LX 4K2LA 4JI1L 1MHWC 4DA2A 1M1KC 5C0XI 1VCIA 5M3FB 1VQMA 2KENA 3NENA 4A93H 3CPWA 5C4HA 1BF4A 1Z47A 1HNZL 3I73A 4H0LC 1E1OA 3RLNA 1BNZA 3S1MB 3QJYA 1H9MA 4A3DB 3NSWA 5JJLA 1PDQA 1STEA 3M9BA 1LTRD 5CC4A 4G7OC 1X3EA 4P72A 3VR4A 4BA1I 5LMUL 1ET6A 3TZDA 2EZVA 1YJNA 1LM0A 4A93G 4FXKC 2WV6D 1I6VC 1EIHA 2IY5B 2NWGA 2LXKA 3GTJB 1U5KA 2RSNA 3GP7A 3BVGA 4LF9L 1X54A 4KHVA 1XMOQ 3HOYG 4KHPQ 4GOPA 5H1SE 4UDUC 3KK7A 4A3KB 4BXXG 3CCSA 1PTOF 1WTWA 3K80C 2O5JC 2EJGC 1X3QA 3AFQA 4UP9A 3E0EA 3S2DB 4I65A 5DNFA 3M4QA 4S3SA 2ASBA 4A3GH 2Q8IB 2EY5A 1UE6A 2VUMB 4A3CG 4MNOA 1JOKA 3D4DA 1B3AA 1IZ6A 3D31A 3CCQA 3E0JA 3CXCA 1SROA 2JJQA 2XTIA 4BXXH 3GDEA 1A8VA 4RA8A 5BR8Q 1XYIA 5I9PA 4A3JH 4K5VA 4HCEA 4DXGA 2YU9H 4X64Q 3FDTA 5ELNA 4RGTA 1D1KA 5F2DA 3J80i 1KD1C 4AQYQ 4EQNA 1C4QA 4JW0A 3STBC 3OWFA 2L4NA 2F0UA 1Q81C 1TWHH 3TN2A 3PF4A 2OCEA 4GKJQ 1U4LA 2RCNA 1C0AA 2TMPA 1A3UA 3A8JE 4C3JB 5M9OA 2G9HD 1GOZA 4AH6A 2K75A 1SFOB 5D3IB 4FDBA 5LHY1 4A3JG 3NUCA 1A3VA 2K05A 1QB5D 1HA6A 4JBJA 4TKOB 5DAUA 4A3MB 3CCJA 1QUQA 3D6WA 2KEEA 3S24A 1YBYA 3W1GA 4JI2Q 2RSOA 4A3KG 5C4JH 1G2SA 1KDBA 4HAEA 4P71A 3BG3A 4AQYL 1UWVA 4GS3A 1CKNB 1EEFD 3NHHA 3E3XA 2NVXH 3SEBA 1EY5A 4QCLA 4KN7C 1CA5A 1SR3A 1ILQA 1BCPD 2UXDQ 1EYDA 1W2BA 2XN9C 2Z6KC 2E5LQ 2UXCL 4KI0A 4P74A 4BY7G 3HOXH 1XMOL 3MVVA 5FJ8H 5C5LA 4B3RL 2NVQB 2FFKB 2ENBA 5C0XJ 1TWFH 4A76A 2A73B 4LMQD 2KJXA 4GZYC 4A3KH 2SDFA 3GO5A 1X3GA 2QILA 4B3SQ 3WDNA 2QF7A 1ZYRD 2B39A 5CORA 4CKEA 4Y7NH 2JA7G 3Q24A 1KIXA 3GTLH 2N8NA 2UXBL 1CFMA 3DXJC 1SE4A 1UAPA 2X6LA 4X3KA 4IPHA 4A3GB 4F87A 4PMBA 1XMQL 1IBLQ 2NVYH 3J7AV 3HOXG 4IN3A 3WWVA 1V8QA 2JEBI 2OT2A 1GD7A 1J9OA 2EY2A 3IL8A 4C3JG 2K4KA 4L6TB 3TP8A 3L7ZC 2RA4A 4ABNA 2A6HD 1SN8A 3HKZB 3GTMB 2F0EA 5CBAE 3ND9A 1WTOA 2A19A 4LUVA 4JYAQ 2YU9B 2PZUA 1UE5A 4KD4A 1AN8A 2ZXPA 1YNNC 2B2WC 3PO2B 2Z9HA 4DPGA 4TSSA 1GM5A 1IKMA 4XYOA 3AYHB 3KF8B 4XTCS 3UE1A 5D65A 3BU2A 3S14B 1JQYD 4C3JH 1A0IA 4DAYA 3HKSA 2KUMA 1EFID 2K14A 3T53B 2Z1CA 1P16A 1SNQA 1TS4A 1KXLA 1JCKB 4K6LA 2DNCA 3K0YA 1V9PA 3RUZA 4DV7L 2NYZD 2F3WA 2HIXA 2F0FA 3U9SA 1EZ6A 1GKHA 2PI2E 1GUNA 3VDYA 1MD2D 1FNUA 2ZTEA 5I6WA 3I4MH 5DM63 3I4OA 1HR0Q 1BCPC 1WFQA 1DOKA 1PFSA 2N55A 2NZOA 3G71A 3ERQA 4JI6Q 4DR6L 3KF8A 1E1TA 2LFNA 2FXQA 1X6OA 5C3WA 3Q22A 1W3SA 1JT8A 2F3IA 3CF5A 5J1ZA 2MFIA 3Q23A 1R4QB 2FJ2A 2EYPA 4OHJA 1HNWL 2BA0A 4NB3A 2KEDA 5J3BA 2XVSA 3CCRA 2SOBA 4R4OA 1KRSA 3S17B 2VQFL 1N36L 4OEMB 4A75A 2FHTA 3GTJH 3JC66 1BCPF 2ZXRA 5FO8B 5GROA 1DGSA 1SRUA 4G4KA 5CV8A 1U4PA 2MNAA 5C44G 5JJZA 4BWGB 1Y1WH 2GVBA 4UP7A 4DAMA 1XMQQ 5JVG3 1KL9A 1ASYA 2PI2A 1LACA 2DNEA 3FEWX 2Y0SE 3TSSA 3E9HA 1PH8A 1K8AC 4JI2L 4FYDA 1B53A 2A6HC 5IODA 1O7ZA 4P2CB 3PUVA 1TVXA 2QW7A 3MEFA 4XYQA 4F8MA 2NZHA 2ZM6Q 4FNFA 1EQTA 1JWUD 1EY0A 1TWAH 2OXPA 3CCMA 4PNYA 1G291 2JE6I 4X62Q 5C44H 5G3LF 1YNND 1SNCA 3HKZE 1K3RA 1Y1WG 4PZ8A 1Z7TA 1F9RA 4FO2A 4OWTB 2XRSD 1UUPA 3PF5A 4TVAB 2Z8LA 1EFWA 2B63B 1LT4D 2XRQD 4HCSA 3J81c 2AKWB 4DUZL 4OX9Q 1H9RA 3NTKA 1PYBA 1D1IA 2NBFA 4I7AA 2LXJA 3VYSA 2JA6B 4NMZA 4LF5Q 4HN7A 4KJOA 1H95A 2BOSA 2F0LA 1J8IA 1NTGA 3J80L 1SYEA 4XQJA 3EIVA 4IALA 3HOWH 1ZEQX 3K7UC 3P20A 4OO1I 3CCEA 1LO5D 4GNXB 2XNAC 3T16A 3VA7A 2A8VA 4K8IA 3GTLB 1E0BA 3I4MB 5FLXE 4IFDG 3PGZA 1GVPA 3KLRA 3HOYH 1YVCA 4GKKL 4IJHA 2P5ZX 1NNXA 3DWPA 2EXZA 3MAQA 2I0QA 3KFUA 5T1IA 5EKKA 3VR2A 5CV7A 1BBXC 1PYSB 1BO0A 3HOZH 2XWBB 4LW1A 1NUCA 3KUPA 3ERSX 1NR2A 1T5EA 4HTHA 5M5WB 4PZ6A 3VYRA 4A3GG 3HOWG 3KF6B 3NQIA 1PMRA 1WTHA 1VDZA 2G5DA 2Z4IA 1STGA 2UXDL 1BKBA 5I2YA 4H02A 1SNDA 1I50B 5FK9C 3SK4A 1H9SB 3NPPA 4N9PA 3HOZG 2QEXA 1HNXQ 3PIO3 3NE5B 2F0SA 2EQSA 4HIDA 2F03A 4OONA 4CDEC 1CQVA 3VYTA 4DK1A 3RR5A 2ZTDA 3BDOA 1N32Q 3OOCA 4GKJL 2Q2TA 2AHOB 1PH1A 3NELA 2PPBC 4HJ9A 3MZ5A 4IUVA 1TKWB 1SMYC 3U4VA 5I9OA 2EY6A 4LJZC 1K73C 4CKCA 1I94Q 1VQIA 4Q5VA 3K6OA 1VQ6A 1II3A 2EXDA 1JOOA 2B8GA 3NBHA 4Y52H 1QG7A 1Z6HA 5JPNC 1Y8PB 1LTBD 4ZUIA 1TT2A 3SDZA 4MZ9A 4QY7A 4DK0A 1GXDC 1I5FA 4YIJA 4RCNA 2AMCB 3RN2A 3A8KE 4R8IA 1F2LA 4O2DA 1T9HA 3GTPH 2AWOA 1CI3M 4B3TL 3HOWB 4IFDI 4ZYSA 1W6JA 4DAVA 1KC8C 4YY3Q 1NSNS 4O1NA 4DR3L 5FJ8G 4C1NK 1A62A 1JORA 4HSPA 2AUJD 1SYCA 2CKZB 4KTAA 3M7GA 1N9WA 1U4RA 2B2TC 1F9PA 3MFGA 2A6EC 1Y8OB 3K57A 4OIKA 1QVFA 2EDGA 2RQXA 3K81C 2D0OA 5T1GA 3H6MA 5C3XA 1OTCA 4RHSA 3CC4A 4QQBX 1PTOB 1RIPA 1D5XC 5C44B 5ELCA 4JC0A 1F9SA 5ELOA 4FXGC 1MSHA 2QEJC 1J5EL 4B9XA 4DR1Q 2RHSB 4ZK9B 5IGCA 4A3BG 1XNQL 3S17H 3CMAA 1J6QA 3KF6A 4F88A 2OQKA 1VQFA 5M3MB 4A3IG 3HOVB 1XTDA 3GTQB 1G6ZA 3BVMA 2CQOA 3J81j 2B3GA 1VQEA 1VMPA 3CRLC 3UDFA 4CJ0B 1SJHD 5JJKA 1N32L 3GV6A 3GV3A 4QIWE 4V0BA 1QCBD 1HFGA 4LK1C 1I6HB 3JAME 3PUZA 4A3BH 4GNXA 1QVGA 5CV9A 2CWAA 1HH2P 2JQOA 2BH2A 3Q0AA 2Z6BA 1E24A 4CJ2C 3J7ZC 4CKBA 2KA7A 1N8RC 4GLAC 4K5XA 5I6YA 1DOMA 4P75A 1LTAD 1BCPB 5KGUA 1EQVA 2E75C 2F0IA 2VB2X 3OMGA 2KHIA 4X3SA 4YHHQ 3I4MG 2K01A 1S5DD 2OTJA 5C3EH 4ILWA 2UUAQ 4DV3Q 4JI5L 1GJXA 4OO1G 3L2PA 3SE0A 3T4AC 3QIAA 3W5OA 5K5PA 1KHIA 1I50H 5IT9L 3E6ZX 1O7LA 3KJOA 1YHAA 1PH4A 2VQFQ 1YEZA 3QB3A 3EVQA 4KN4C 2VQEQ 1YHQA 5A35A 3C46A 1CSPA 3S2DH 4PMWA 4X65Q 2DY8A 1RODA 1MSGA 5C3EG 1SE2A 4JK1C 4JOIA 3ND8A 1SYGA 1SYDA 4JPBW 5M3FH 3DM3A 5M5YB 1VQ5A 3QR8A 3UDGA 4ZKCB 3OSOA 5IIFA 4JI7L 2EYLA 3DWAA 3HOZB 5IGBA 5EAYA 1EY7A 2O4XA 4TRDA 3PO3G 4DR7L 4IZ8A 2N3SA 1B7YB 3D0FA 1BR9A 3CQZB 4IPGA 3M85A 1I4RA 2K5NA 1WD1A 1F77A 4A3JB 3K5LA 1T5XD 1ILPA 3TEHB 4A3MG 2B2UC 4U673 3MXUA 1IBKQ 2QDBA 2I5HA 3MXPA 4Q0FA 4PZ7A 1QNKA 2G9DA 1V43A 3SK6A 1RJTA 5M3FG 2I5MX 2JA5B 1YIJA 3G48A 4IURA 2GVAA 4YCVA 3BJUA 1TWFB 2RDFA 2UUBL 1I4GA 1KLUD 1C48A 3HOUB 2ATWA 1KDCA 1R9TH 4C56C 2OTLA 3FPUB 1S5FD 1PFBA 2BDOA 2YTXA 4U68A 4DUYL 1A63A 1PRTB 4A3MH 3I4NH 2DGYA 1AW7A 2ID0A 1HTPA 1IBKL 2NZ1D 1L0WA 4GLXA 2KVMA 4X66L 3CCUA 3M3YH 2PQAA 3TREA 4LF8Q 1EEID 1VQLA 1FVIA 1HZBA 4IFDH 2F52A 2WB1E 3K8AA 2E74C 3MWYW 4RGNA 1CK1A 1YITA 3QOJA 2JA7B 1FGUA 2F0MA 5FKAC 1HUNA 1JWMD 3I4NG 1Q3LA 3IKJA 4HJ5A 3CHBD 3I7FA 4K5WA 2HQEA 1AH9A 2XGTA 4FP5D 4Y7NB 1WTRA 4OELB 3DHQA 1I3QB 3TS0A 5CV6A 2FMMA 4DV4Q 3F1ZA 4GOPB 5KNBA 2EY1A 2Z6KA 3HKZG 3RD4A 4IUTA 2MPMA 1AP0A 2IPKD 4J6HA 4RG1A 1SEBD 2YYZA 2VY3A 4ME5A 4RH6A 1VQAA 5CV4A 2F4IA 1TS3A 2RKSA 4WJ3M 4UHVA 4C3HB 5IE8A 3E9IA 4JI0Q 2B8FA 4JBMA 2YV5A 2PCFB 4DXFA 1HCZA 2K33A 3HOUG 1FNWA 3BZCA 2E2IB 4PMCA 3K58A 5EPKA 3H15A 3H3VH 2K28A 5NUCA 1PZID 1GHJA 4KY7A 3KOJA 3OMCA 3SR1A 3OWEB 1B70B 2D5DA 5L37A 4G7ZC 2N88A 4ZAIA 2JA8G 4R1JA 1LABA 2Q2IA 3PSIA 5DM73 4FF4A 1LYLA 1RTNA 1O7YA 2WAQE 1RKNA 4AIMA 1QZGA 2BH8A 4GN3B 5ELFA 1KAWA 1KTKA 2WIIB 4CGYB 4A3LG 3ICEA 3HOUH 1CQFA 2DN8A 4TQUS 1DXMA 2UXCQ 1X32A 3TMEA 3CW2C 1JE4A 5TSSA 3QO2A 1UE7A 1VQ7A 5C4ZA 2DUDA 3LWUA 1TS5A 3ITPA 5DEHA 1DD2A 4JV5L 3P7JA 2L11A 2JA8H 1Q82C 1VQ9A 5EKIA 1D2BA 1SYBA 2IJ0A 1RL2A 2B29A 4NW2A 1X9NA 1IL2A 5A2QE 1F2ZA 2BDNA 2L0CA 4A3LH 2JXMB 4N8FA 3T1HQ 1G51A 1Y69U 3OHXC 4IJLA 2EJFC 4KHPL 2NVTB 1E22A 2QDLA 4B08A 4LF9Q 4QUFA 1OXUA 3K5NA 5LMNL 4BBSG 4RGOS 1Y8NB 2LSSA 3TQYA 3UE0A 1D8LA 2A69D 2JSOA 3J7YW 2GA4B 4R4TA 5CMDA 1PH3A 1JB7A 1JJGA 1LTLA 3NWTA 1GUWA 3S2HH 4YWKA 1N33Q 2OWOA 5HY6A 4BY1B 4A3IH 3M4YA 4HIOA 5J22A 4A93B 1C9OA 5KYIA 4DR4L 1K8OA 5EBDA 3S1RH 2D0PA 3NWSA 2L15A 4XQQA 1C7YA 4BBSH 3G6JB 4X6AH 2JA5G 1F2YA 3DEOA 2YTYA 3V2TA 2PMZB 4RHRA 4ODGA 5IYDG 3JAMc 2A5HA 1JMCA 1D5ZC 2SNMA 1D5MC 3CMEA 1LLRD 1PFNA 4RFBA 3WOEA 3M3YB 5IWAQ 5LMNW 3DM1A 5M5XB 2F0TA 2E2JH 2R7ZG 2GN5A 3GTOB 4MN3A 3RN5A 5IGFA 1KNEA 3NTHA 1LV9A 5ELEA 1WOCA 4A3FG 3I2ZA 2JA5H 4JI4L 2ICEC 1FNVA 1LT3D 1RCVD 1EYAA 4ALPA 1IBMQ 3BYYB 2LY7A 3DEPA 1EQQA 3QG1A 4J1MA 3MA2B 3TP7A 1R9TB 3J80c 4IOCA 1WD0A 1ESRA 4OO1H 3MEHA 4DV0L 4K0KL 1BVSA 4RKBA 3J7AF 1CKMA 3J81i 1WTQA 4HSVA 2R7ZH 1NE3A 4OIJA 3MXNB 5AJ3Q 1HPCA 3MXGA 4V190 4QUCA 4DUYQ 4JI8L 1PRTF 1SNPA 1TU2B 1RF2D 3HG9A 4CBVA 4LUOA 1EY9A 2RVLA 1QUQB 4A3DH 4FVMA 3C2PA 4KHZA 5E4WC 5FOBB 1IYVA 5JVH3 2VQEL 2D9UA 3CKIB 2A68C 4QJFA 1ICWA 2R92H 5JOBA 2MHVA 2CCZA 4DR3Q 5IP9G 3PO3H 5EPLA 1O7IA 2B2UA 4CDDC 5C0XG 3L0OA 3LX0A 1PFMA 4HEDA 2HDMA 3PV0A 1H9KA 3S16H 5FO9B 1CSQA 4DUZQ 1WTXA 4OX9L 2HCCA 1U4MA 1ET9A 1AEXA 2K5WA 3CAMA 4LF4Q 1CKNA 1I4XA 1QZHA 1NCVA 3PQIA 3S9WA 2K32A 3PUWA 2F0WA 1YNXA 4EQPA 2F1MA 4DF7A 3S1RB 5GAEC 2JYOA 3NP8A 3MHBA 1PXUA 1LT6D 2R3ZA 3R8BA 1G2TA 1S5ED 2LS01 3BZKA 1JOQA 3B6YA 1JJ2A 2JA6H 2D62A 2R92G 4HR7B 2F4VL 4KKSA 4OWXB 4DR1L 2QCPX 1A6XA 4JYAL 5C0XH 4L5SA 2JA8B 3K7AB 3S1MH 4AYBG 3JAML 4APVA 4J8QA 5G3LD 3HOYB 3R2TA 2PQAB 4GLVB 1ASZA 2ZXOA 1Q1EA 3SHLA 2XSCA 3EQLC 2IX0A 2Z4HA 1ML0D 1PH2A 2CQAA 2EYOA 1PTOH 1MJCA 1EY4A 2JA6G 1IHZA 1IBML 3W3AA 2PZTA 1EOVA 2CHBD 2E2HH 3J80E 2A69C 1VF5C 1NMGA 3F2DA 3MXNA 2LMCB 3QWNA 1HA5A 1SYFA 1FJGL 3PUYA 1VQBA 4IOAA 4XT1B 2CH4A 1HRJA 1HR0L 1DZ1A 2KOLA 3D3RA 3HP3A 3GTGH 2CW0D 1I6HH 1VMCA 4HIKA 3VR6A 1TXYA 4IUUA 1B4OA 1B2TA 4DN4M 3IRBA 2OEOA 1VQDA 1XPRA 2Q8TA 3GTMH 2Q8RE 1H9SA 2NUCA 3OYYA 1VQPA 1PRTC 1G8ZD 1K28A 2F0JA 4WORA 1MBYA 2NN6G 2NVXB 2EYMA 2MGSA 2HHHL 1AZPA 4EQOA 1OXXK 3S16B 1NJIC 4B3ML 1HTLD 5IT9c 4LFBL 3GTQH 1K0RA 1L2FA 1NY4A 3EROA 1W6KA 1GHKA 2HCIA 1AZQA 3A54A 1B50A 2BE5D 1HR0W 5FO7B 1M4VA 4DV2Q 4B3SL 1RD9D 3NXWA 4IQZA 2L55A 4YCUA 3IFTA 1L1OC 4X62L 2F3VA 4GN4B 3KLSA 1PH5A 3CU7A 2ZM6L 1Q12A 4EX5A 2NN6H 2WB1G 3A5ZB 1EQRA 2B2YA 2M2LA 1D6EC 5FLXL 1YNJC 3V05A 3NK9A 4DR2L 1X3PA 2H5XA 1PV4A 5GAGC 2IX1A 4YY3L 2UUCL 1EYGA 3TS2A 1NR4A 5M5YH 2I46A 3ULLA 1HZ9A 3FRPB 1Y14B 3RZDB 4L5RC 2JEAI 3HZXA 1JICA 1BOSA 2PW5A 1ZYRC 2V4DA 1OO9B 2F0KA 2K5QA 2RDGA 1BBWA 2AUKA 1LTSD 3AQQA 4LFCL 1CZGA 5BN3A 5KIXA 2F0NA 3HOXB 3S1NH 3GD7A 1YJ9A 4YWLA 1I4HA 2B2VC 1Y1VB 5LL6S 2EYHA 1NMFA 2F0GA 2E76C 4CDFC 3ULPA 2DY7A 1A2TA 3FP9A 3NQTA 4BBRG 1BXTA 3TRZA 2DJGC 5C5MA 1K9MC 2QKIC 2WKCA 2IL8A 4K6DA 3G7LA 3CD6A 3STBD 4DAYB 2ZJPA 1K3BC 1SE3A 1IW7D 2ES2A 2ALYB 4ME3A 2DJFC 3BS1A 3W2DA 1A15A 2LKVA 4FXDA 4IUPA 4UAIA 1PVOA 2WAQG 2NTSA 2MP1A 1VQGA 4HIMA 2EVBA 3A7AB 3HGBA 1XNRL 2HUGA 4LF8L 5KNCA 5M3MG 3T51B 2RHQB 5CV5A 3BZDB 5IGGA 3O13A 2MQHA 4BBRH 4LFBQ 2PMZE 5CR3A 2K03A 4FF3A 3I90A 2ZJRA 1STBA 1JE5A 3HEJA 2B2YC 1HNXL 4GNXC 1IXRA 3BDCA 4JG2A 3RLOA 5IYDH 1TWCH 1ZXTA 4DV3L 1SDFA 3S15H 1QWYA 3R3OA 5KYLA 2HD3A 3LNNA 3X3MA 1CUKA 3RLFA 5AFWA 5BN4A 5A2QL 2A1AA 2KHSA 3VR3A 1WTVA 2F0DA 5CYUA 2EJMA 3LWEA 2B2WA 1B3QA 1RDPD 4A3FH 1S3OA 2L12A 5GAHC 2IX3A 3M4OB 1S72A 2IHEA 3I4NB 1PTOC 1HUMA 4I7ZC 2VZAA 4E6IA 3URYA 3T1YL 5C4XG 2F0PA 2E8GA 5JEAH 3OPOA 1GUOA 5EQ0A 1LTTD 1CKOA 3U58A 3RZDH 1EWIA 2Q2UA 5LMUQ 4HJAA 1Z9FA 4IUQA 3U4ZA 2JA9A 4BY7B 1EIGA 3FKIH 5E3FA 5EPJA 3TP5A 2X6GA 5EBCA 2HT1A 1TQOA 2XIWA 1GO3E 2SEBD 1O78A 4QL5A 4JI3Q 3I91A 1SXTA 5EGTA 2J0TD 4B3TQ 1PYWD 2AWNA 1PLFA 3UDIA 4CDCC 1OXSC 3HRZC 1S4ZA 1WCMH 3K5MA 5IYBH 4DR7Q 4PV1C 5C4XH 5JEAG 3KYHC 4A3DG 2A6ED 4JV5Q 5KRUA 5JJIA 2C5CA 1I3QH 1F9QA 3E5SA 5D3DA 4QF4A 1Y1WB 2EIFA 3K59A 1O80A 2AQ1B 1BBUA 3FKIG 3EA6A 4IPDA 4R4IA 5IP9H 4RKLA 1PRTD 3A74A 3SXHA 1HHVA 3VYUA 3DUZA 3H09A 4DFAA 1XNRQ 4JI1Q 4LFAL 4WRDA 5IYBG 1DJRD 1ICFB 1V1OA 3R2IA 3MC0B 4RAUC 2E2IH 4L5TA 3H3VI 3T1HL 1Q1BA 3AB9A 4HMIA 3V96A 3PUXA 3EBEA 4FF1A 1JR0D 1LUZA 4ZCKA 3AEVA 2WB1B 4MIUA 4HJ7A 3I3CA 1TWCB 2H1EA 3T13A 3I72A 3ULJA 3WOFA 1PHJA 1TR5A 2ZTCA 4X66Q 1NAPA 4R8NA 1E2WA 4NDXA 3IAYA 1D7QA 1WI5A 1U9RA 4JI6L 2VUMG 4F7XA 1CTMA 1C8CA 1XJVA 3FVQA 1K8MA 2H4OA 1HZCA 4RWSC 3A8IE 1ZKOA 2EE1A 1JJCB 1K83B 2VW9A 2B2VA 3X3NA 5KNDA 4MTNA 3EN2A 3U50C 4DV6L 1U0LA 2QGQA 1L0XB 5COYA 3KDFA 4LWCA 5FLXc 4A3EG 4KK7A 1LT5D 4KY6A 4YWMA 4L63B 2J7ZA 4MHEA 4NXNL 2VUMH 3G4SA 3F2UA 1ESFA 2KCTA 3AU7A 4JBKA 3N6RA 5E4XA 3ZJYC 2PZWA 4NXMQ 3F8TA 2CFMA 3BYTB 1S5BD 1MIUA 4OWWB 1GUSA 1WCMB 4BBRB 4HJ8A 1ENCA 4M1UB 2NB0A 3GTKB 3F2CA 4DV0Q 4XXEA 2E2JB 3OW2A 4K0KQ 4KKTA 4GOPC 4NP5A 1Q86C 4LF6L 2X69A 4NPSA 1KLGD 1B9NA 1TWGB 4AYBE 4N9TA 3I70A 1FD7D 2B63H 1IBLL 4J15A 1UEBA 4JI8Q 1VQOA 1F2MA 3NTIA 4KD3A 1VQ8A 4C2MH 4DAPA 4ID6A 4A3FB 2K52A 4K8JA 3A7LA 4X3UA 1CT1D 2D2CC 1AE3A 2R7ZB 3CCLA 1STYA 3AMUA 4JBWA 5C4JB 1BDOA 1M90C 1L1OB 4PQXA 1RHPA 5EJWA 3AFPA 3HFZB 2RCFA 1SJED 2K04A 2R6GA 4BS9A 4G7HC 2R93G 4B3RQ 1B44D 1RTOA 4H7BA 4BA2I 2K50A 4ZQ3A 4DV1Q 2EOTA 3OW7A 1PTOD 1UNSA 1IKLA 2OQ0A 2NVQH 2E5LL 1SNOA 2JP1A 4IFDJ 3KDFB 3FMCA 1IL8A 3H0GB 1TY2A 4C3IG 4X65L 3A0JA 4N8X1 5IGDA 2A68D 4XT3B 3SK5A 1K0SA 5FLMH 3FPPA 4OXPA 5CBEE 1KAAA 3JAMi 3M4OH 1YHBA 1TWHB 2R61A 1XPOA 2F4VQ 1FGBD 3ER0A 3CC2A 4LFCQ 1QILA 4BY1H 2BCOA 1EYCA 4DV5L 5IY0A 5HGTA 2K1BA 4IUNA 3H3VC 3L3OC 2FMCA 1N34L 2TSSA 1Q7YC 4QB4A 4R4QA 1VQKA 3QOLA 3CQZH 1SNMA 3TBIB 4XQNA 2EYFA 3VA5A 4ZLTF 2PW7A 1WJJA 2JK8A 2VB3X 2YTVA 4DV4L 5FLMG 2L5TA 1PH9A 3I8ZA 1MI2A 1SE8A 4UP8A 3NBHB 4POGA 2JN4A 2KECA 1VQCA 4DU9A 4MTKA 5M3MH 4AYBB 3KJPA 5JEAJ 5BR8L 1VQHA 1SMXA 1GUTA 5IWAL 3KLSX 4YCWA 3NBIA 1G6PA 3KBXA 2ZT9C 4X64L 1N34Q 5LL6X 1HQMC 1FL0A 1K83H 1QVCA 4NKLA 1XTCD 4IO9A 1PH6A 5DLQE 2F0OA 1EL0A 2R7DA 1TS2A 3C3LA 1HFNA 4EQ5A 3P1HA 2Q2HA 3H0GG 5IGEA 1EU4A 3PIP3 2A74C 3GTGB 2HHHQ 2KCCA 4DV7Q 1MGSA 2IHFA 4C1NI 3NEMA 5I2XA 4JI7Q 5HGQA 3F2BA 3S1QB 1N33L 2IWHA 3J7A5 4NXML 3G6EA 2NVYB 2PNHA 1A2UA 2V1CC 2RF4A 5ELDA 1FR3A 4OL7A 4A3EB 1HJPA 1WYDA 1XXGA 4LF7L 1P8LA 4KLKA 2NTTA 4A4IA 1UE1A 3L9AX 3OTOQ 1K8GA 4C3HG 1CM9A 3H0GH 2L1BA 4LF6Q 1E2ZA 2K5DA 3KBGA 4PG3A 3N52A 2M9VA 2J4XA 2M00A 4M8AA 4QGUA 1B8AA 1QNUA 2AQ2B 1YNJD 3PIPA 2KQ3A 4WJWA 1WCMG 5C6AA 2Y0SB 4POFA 3TP6A 2K6AA 3D4WA 1JC7A 3I56A 5IT9E 1Q46A 4JI3L 1IYJB 3UI2A 1DYQA 3GQBA 1CHQD 2PO4A 2K5VA 4C3HH 3PO2G 4QMGA 1SBBB 2BA1A 2UXBQ 3PCOB 2IW3A 4A3BB 3K7AH 4DGZA 2PYKA 3RZOB 1V1PA 1QOHA 2RBMA 4ZRZA 2PNRC 4DV1L 2OF1A 3H94A 3A55A 2F0QA 1SAPA 1QJOA 3PO2H 3VR5A 1WVLA 3CRKC 1DONA 4HMJA 1DCZA 3D4RA 2ICIA 4EGVA 3ONAB 1SSOA 2E2HB 1Y1VH 3S14H 2F0HA 1E7ZA 1VQ4A 3CC7A 2R93B 1CZWA 5JAVA 1PH7A 3Q6SA 2UU9Q 4GKKQ 1XNQQ 1EIFA 4C2MB 2HQLA 1SMYD 3OIQA 1V1PB 4A3CH 4DKAC 1X65A 2KCMA 5ISRA 4RGMA 1E3PA 2HIVA 4C3IB 1STAA 1TY0A 3OIPA 4P73A 5HURA 2K7VA 1EU3A 4A3EH 1GUGA 3OTOL 2I07B 1Y1VG 3ZYYX 2MJ8A 3CPFA 4K14A 4DV6Q 1EIYB 2CH4W 1TIID 1KDAA 1NBWA 2RDHA 3T56B 3PMFA 3S1NB 3J81L 1BQQT 1R4PB 1FYCA 4ZKBB 3D6CA 1MJEA 4K2KA 2L9HA 2MUYA 1B9MA 1STNA 4JCVE 4ZUJA 2KCNA 4UY8C 1L1OA 3T1YQ 4R9WA 3R93A 2CW0C 2VL6A 1YJWA 3M7NA 3SK8A 1H9JA 2VXWA 1SLJA 2E2DC 1VQNA 2C35B 1E2VA 2VS1A 3MFYA 2Z0SA 1A3TA 3BDLA 4JI5Q 4DNRB 3TDQA 4DK6C 2WACA 1CA6A 1BUVT 2FINB 4GN5A 5IP7H 2B63G 1S5CD 4WFN3 1XPUA 3CP0A 1HZAA 3H91A 1VF7A 4KJNA 1WTPA 1TWAB 1EZ8A 4RMFA 4JI0L 2PQEA 4UPAA 4DV5Q 5M5XH 1EUJA 1HNZQ 2ZJQA 5KEEA 3D8GA 4BY7H 2O2LD 4DR2Q 1PZJD 3U9OA 4JI4Q 4DNTB 5J39A 1IYUA 3MTSA 1JWSD 4B9WA 3S15B 1X56A 2BE5C 2HDLA 1G91A 2WFWA 5M5WH 3W1BA 2WKDA 5IP7G 2MO0A 2JA7H 2EYJA 3K5OA 2R93H 1LTID 3EJIA 3A56A 1YZ6A 4LUZA 4DK3C
chains in the Genus database with same CATH topology
4X3TA 1LTGD 3I4LA 1XX8A 2AQ3B 5ELBA 1CHPD 3P75A 4KMUC 4A3IB 3C1EA 1EOTA 1Q90A 3DMUA 4FF2A 3EFXD 4BBSB 1EWHA 1B1ZA 3TZUA 3FKIB 2SNSA 2XWJB 2NN6I 4KV6A 1PZKD 5IOCA 1Q8IA 2F0VA 2O5IC 2R92B 2B2TA 4XDXA 2IT1A 1ONLA 3IFDA 5K36H 4KY5A 2CVRA 5E1FA 1KNAA 5CGKA 2VNUD 5BN5A 4O42A 2EPBA 4QIWB 5I4DA 5EKLA 1OXTA 4OGQC 1IW7C 2WAQB 4H44C 1EWCA 3GTPB 1QE6A 1DM0B 3J81E 1EY8A 2WINB 5JPMC 1L0YB 5K36G 4Z9CB 1M8AA 1I4PA 4RCOA 1AFPA 4H13C 4KKUA 4LAAA 4L8JA 5D14A 1XWEA 1I4QA 3HS0C 4CHTB 1HQRD 5C3EB 2C9OA 4ULLA 4EVOA 1OXVA 1HXYD 1ENFA 3C1FA 3PO3B 1EY6A 3BVZA 4G57A 3RMHA 5C4XB 1ENAA 1KABA 3DWQA 4XIGS 1JB3A 1DOLA 1STHA 2WP8J 3SVMA 1UEAB 4CJ1B 3S2HB 4K2LA 4DA2A 5C0XI 1VCIA 5M3FB 5C4HA 1BF4A 1Z47A 3I73A 4H0LC 3S1MB 1BNZA 3QJYA 1H9MA 4A3DB 3NSWA 1PDQA 1STEA 1LTRD 5CC4A 4G7OC 3VR4A 4BA1I 1ET6A 3TZDA 2EZVA 4FXKC 2WV6D 1I6VC 1EIHA 2NWGA 3GTJB 2RSNA 3GP7A 3BVGA 4KHVA 4UDUC 3KK7A 4A3KB 1PTOF 1WTWA 2O5JC 2EJGC 1X3QA 3S2DB 4I65A 5DNFA 4S3SA 2Q8IB 2EY5A 2VUMB 1JOKA 3D4DA 1B3AA 3D31A 3E0JA 4RA8A 1XYIA 5I9PA 4K5VA 4HCEA 4DXGA 3FDTA 4RGTA 1D1KA 5F2DA 4EQNA 1C4QA 3OWFA 2L4NA 2F0UA 3TN2A 1U4LA 2TMPA 1A3UA 3A8JE 4C3JB 5M9OA 2G9HD 1GOZA 1SFOB 5D3IB 5LHY1 3NUCA 1A3VA 2K05A 1QB5D 1HA6A 4TKOB 5DAUA 4A3MB 3D6WA 2KEEA 2RSOA 1G2SA 1KDBA 4HAEA 3BG3A 1EEFD 3NHHA 3SEBA 1EY5A 4QCLA 4KN7C 1CA5A 1ILQA 1BCPD 1EYDA 2XN9C 4KI0A 3MVVA 5C5LA 2NVQB 2FFKB 2ENBA 5C0XJ 2A73B 4LMQD 2KJXA 4GZYC 2SDFA 3GO5A 2QILA 3WDNA 2QF7A 1ZYRD 2B39A 5CORA 4CKEA 3Q24A 1CFMA 3DXJC 1SE4A 1UAPA 2X6LA 4X3KA 4A3GB 4F87A 4PMBA 3J7AV 4IN3A 1V8QA 2JEBI 2OT2A 1J9OA 2EY2A 3IL8A 4C3JG 4L6TB 3TP8A 3L7ZC 2RA4A 4ABNA 2A6HD 3HKZB 3GTMB 2F0EA 5CBAE 3ND9A 1WTOA 2YU9B 2PZUA 4KD4A 1AN8A 2ZXPA 1YNNC 2B2WC 3PO2B 4TSSA 1IKMA 4XYOA 4XTCS 5D65A 3S14B 1JQYD 4DAYA 2KUMA 1EFID 3T53B 2Z1CA 1SNQA 1TS4A 1JCKB 4K6LA 2DNCA 3K0YA 3RUZA 2NYZD 2F3WA 2F0FA 3U9SA 1EZ6A 1GUNA 1MD2D 1FNUA 5I6WA 5DM63 1BCPC 1DOKA 2N55A 3ERQA 3KF8A 2LFNA 3Q22A 5C3WA 5J1ZA 3Q23A 1R4QB 2FJ2A 2EYPA 4OHJA 2BA0A 2KEDA 2XVSA 2SOBA 3S17B 2FHTA 1BCPF 2ZXRA 5FO8B 4G4KA 5CV8A 1U4PA 5JJZA 4BWGB 5JVG3 1LACA 2DNEA 3FEWX 3TSSA 4FYDA 1B53A 2A6HC 5IODA 1O7ZA 4P2CB 3PUVA 1TVXA 4XYQA 4F8MA 4FNFA 1EQTA 1JWUD 1EY0A 2OXPA 4PNYA 1G291 2JE6I 5G3LF 1YNND 1SNCA 1Z7TA 1F9RA 4FO2A 2XRSD 1UUPA 2Z8LA 2B63B 1LT4D 2XRQD 4HCSA 1H9RA 3NTKA 1D1IA 2NBFA 3VYSA 2JA6B 4NMZA 4HN7A 4KJOA 2BOSA 2F0LA 1J8IA 3J80L 1SYEA 4XQJA 4IALA 1ZEQX 3P20A 4OO1I 1LO5D 2XNAC 3T16A 3VA7A 3GTLB 4K8IA 3I4MB 1E0BA 5FLXE 4IFDG 3KLRA 3DWPA 3MAQA 2EXZA 5T1IA 5EKKA 3VR2A 5CV7A 1BBXC 1BO0A 2XWBB 1NUCA 3KUPA 1NR2A 1T5EA 4HTHA 5M5WB 3VYRA 3NQIA 1PMRA 1VDZA 2Z4IA 1STGA 5I2YA 1SNDA 1I50B 5FK9C 3SK4A 1H9SB 3NPPA 4N9PA 3PIO3 3NE5B 2F0SA 2F03A 1CQVA 3VYTA 4DK1A 3BDOA 3OOCA 2PPBC 3MZ5A 4IUVA 1TKWB 1SMYC 5I9OA 2EY6A 4LJZC 4CKCA 4Q5VA 3K6OA 1II3A 1JOOA 2B8GA 3NBHA 1QG7A 1Z6HA 5JPNC 1Y8PB 1LTBD 4ZUIA 1TT2A 3SDZA 4DK0A 1GXDC 4YIJA 4RCNA 3A8KE 4R8IA 1F2LA 2AWOA 1CI3M 3HOWB 4IFDI 4ZYSA 1W6JA 4DAVA 1NSNS 4O1NA 4C1NK 1JORA 4HSPA 2AUJD 1SYCA 4KTAA 3M7GA 1U4RA 2B2TC 1F9PA 3MFGA 2A6EC 1Y8OB 3K57A 4OIKA 2EDGA 2RQXA 5T1GA 3H6MA 5C3XA 4RHSA 1PTOB 5C44B 1D5XC 5ELCA 1F9SA 4FXGC 1MSHA 2QEJC 4B9XA 4ZK9B 5IGCA 4F88A 5M3MB 3HOVB 3GTQB 1G6ZA 3BVMA 1VMPA 3CRLC 4CJ0B 1SJHD 3GV6A 3GV3A 4V0BA 1QCBD 1HFGA 4LK1C 1I6HB 3JAME 3PUZA 5CV9A 3Q0AA 4CJ2C 4CKBA 2KA7A 4K5XA 5I6YA 1DOMA 1LTAD 1BCPB 5KGUA 1EQVA 2E75C 2F0IA 2VB2X 3OMGA 4X3SA 2K01A 1S5DD 4ILWA 1GJXA 4OO1G 3SE0A 3T4AC 3QIAA 5K5PA 5IT9L 3E6ZX 1O7LA 3QB3A 3EVQA 4KN4C 5A35A 3C46A 4PMWA 2DY8A 1RODA 1MSGA 1SE2A 4JK1C 3ND8A 1SYGA 1SYDA 5M5YB 4ZKCB 3OSOA 5IIFA 2EYLA 3DWAA 3HOZB 5IGBA 1EY7A 2O4XA 4TRDA 4IZ8A 1BR9A 3CQZB 3M85A 1I4RA 1WD1A 1F77A 4A3JB 3K5LA 1T5XD 1ILPA 2B2UC 4U673 3MXUA 2QDBA 3MXPA 4Q0FA 1QNKA 2G9DA 1V43A 3SK6A 1RJTA 2JA5B 4IURA 1TWFB 2RDFA 1I4GA 1KLUD 1C48A 3HOUB 1KDCA 4C56C 3FPUB 1S5FD 1PFBA 2BDOA 4U68A 1PRTB 1AW7A 2ID0A 1HTPA 2NZ1D 2KVMA 1EEID 4IFDH 4RGNA 2E74C 3MWYW 1CK1A 3QOJA 2JA7B 2F0MA 5FKAC 1HUNA 1JWMD 1Q3LA 3IKJA 3CHBD 4K5WA 2HQEA 4FP5D 4Y7NB 1WTRA 3DHQA 1I3QB 5CV6A 2FMMA 5KNBA 2EY1A 3RD4A 4IUTA 2MPMA 1AP0A 2IPKD 4J6HA 1SEBD 2YYZA 4ME5A 4RH6A 5CV4A 2F4IA 1TS3A 2RKSA 4C3HB 2B8FA 4DXFA 2PCFB 1HCZA 2K33A 1FNWA 2E2IB 4PMCA 3K58A 5EPKA 2K28A 5NUCA 1PZID 1GHJA 4KY7A 3SR1A 3OMCA 3OWEB 2D5DA 4G7ZC 2N88A 4ZAIA 1LABA 4FF4A 5DM73 1RTNA 1O7YA 1RKNA 5ELFA 1KTKA 2WIIB 4CGYB 1CQFA 2DN8A 4TQUS 1DXMA 1X32A 3TMEA 1JE4A 5TSSA 3QO2A 5C4ZA 3LWUA 1TS5A 3ITPA 5DEHA 1DD2A 3P7JA 2L11A 5EKIA 1D2BA 1SYBA 2IJ0A 4NW2A 5A2QE 1F2ZA 2BDNA 2L0CA 2JXMB 1Y69U 3OHXC 2EJFC 2NVTB 4B08A 4QUFA 1OXUA 3K5NA 4RGOS 1Y8NB 2A69D 2JSOA 3J7YW 2GA4B 5CMDA 3NWTA 1GUWA 4BY1B 3M4YA 5J22A 4A93B 5KYIA 1K8OA 5EBDA 3NWSA 4XQQA 3G6JB 1F2YA 3DEOA 3V2TA 2PMZB 4RHRA 4ODGA 2A5HA 1D5ZC 2SNMA 1D5MC 1LLRD 1PFNA 4RFBA 3WOEA 3M3YB 3DM1A 5M5XB 2F0TA 3GTOB 4MN3A 5IGFA 1KNEA 3NTHA 1LV9A 5ELEA 2ICEC 1FNVA 1LT3D 1RCVD 1EYAA 3BYYB 2LY7A 3DEPA 3QG1A 4J1MA 3MA2B 3TP7A 1R9TB 1WD0A 1ESRA 4OO1H 3MEHA 4RKBA 3J7AF 1WTQA 4HSVA 4OIJA 1HPCA 3MXGA 4V190 4QUCA 1PRTF 1SNPA 1TU2B 1RF2D 3HG9A 4CBVA 1EY9A 2RVLA 4FVMA 3C2PA 4KHZA 5E4WC 5FOBB 1IYVA 5JVH3 2D9UA 3CKIB 2A68C 1ICWA 5JOBA 2MHVA 5EPLA 2B2UA 5C0XG 3LX0A 1PFMA 4HEDA 2HDMA 3PV0A 1H9KA 5FO9B 1WTXA 2HCCA 1U4MA 1ET9A 1AEXA 2K5WA 1I4XA 1NCVA 3S9WA 2K32A 3PUWA 2F0WA 4EQPA 2F1MA 4DF7A 3S1RB 2JYOA 3NP8A 3MHBA 1PXUA 1LT6D 2R3ZA 3R8BA 1G2TA 1S5ED 2LS01 1JOQA 2D62A 4HR7B 4KKSA 2QCPX 1A6XA 5C0XH 2JA8B 3K7AB 3JAML 4J8QA 5G3LD 3HOYB 3R2TA 2ZXOA 1Q1EA 3SHLA 2XSCA 3EQLC 2IX0A 2Z4HA 1ML0D 2CQAA 2EYOA 1PTOH 1EY4A 1IHZA 3W3AA 2PZTA 2CHBD 3J80E 2A69C 1VF5C 3MXNA 2LMCB 3QWNA 1HA5A 1SYFA 3PUYA 4XT1B 1HRJA 1DZ1A 2KOLA 3D3RA 3HP3A 2CW0D 1VMCA 3VR6A 4IUUA 1B4OA 1B2TA 4DN4M 2OEOA 2Q8TA 2Q8RE 1H9SA 2NUCA 1PRTC 1G8ZD 2F0JA 4WORA 1MBYA 2NN6G 2NVXB 2EYMA 2MGSA 1AZPA 4EQOA 1OXXK 3S16B 1HTLD 3EROA 1W6KA 1GHKA 2HCIA 1AZQA 3A54A 1B50A 2BE5D 5FO7B 1M4VA 1RD9D 3NXWA 4IQZA 2L55A 3IFTA 2F3VA 3KLSA 3CU7A 1Q12A 2NN6H 2B2YA 2M2LA 1D6EC 5FLXL 1YNJC 3V05A 3NK9A 1X3PA 2IX1A 1NR4A 2I46A 3FRPB 3RZDB 2JEAI 3HZXA 1JICA 1BOSA 2PW5A 1ZYRC 2V4DA 1OO9B 2F0KA 2K5QA 2RDGA 2AUKA 1LTSD 1CZGA 5BN3A 5KIXA 2F0NA 3HOXB 3GD7A 1I4HA 2B2VC 1Y1VB 5LL6S 2EYHA 2F0GA 2E76C 2DY7A 1A2TA 3NQTA 1BXTA 5C5MA 2QKIC 2WKCA 2IL8A 4K6DA 3G7LA 1SE3A 1IW7D 3BS1A 3W2DA 1A15A 2LKVA 4FXDA 4IUPA 4UAIA 2NTSA 2MP1A 2EVBA 3A7AB 3HGBA 2HUGA 5KNCA 3T51B 5CV5A 3BZDB 5IGGA 3O13A 5CR3A 2K03A 4FF3A 3I90A 1STBA 3HEJA 2B2YC 3BDCA 1ZXTA 1SDFA 1QWYA 3R3OA 5KYLA 3LNNA 3X3MA 3RLFA 5AFWA 5BN4A 5A2QL 2KHSA 1WTVA 3VR3A 2F0DA 5CYUA 2EJMA 3LWEA 2B2WA 1RDPD 2L12A 2IX3A 3M4OB 3I4NB 1PTOC 1HUMA 4I7ZC 4E6IA 3URYA 2F0PA 5JEAH 3OPOA 1GUOA 5EQ0A 1LTTD 4IUQA 4BY7B 1EIGA 5E3FA 5EPJA 3TP5A 2X6GA 5EBCA 1TQOA 2XIWA 2SEBD 1O78A 3I91A 1SXTA 5EGTA 2J0TD 1PYWD 2AWNA 1PLFA 1OXSC 3HRZC 1S4ZA 3K5MA 4PV1C 5JEAG 2A6ED 5KRUA 2C5CA 1F9QA 3E5SA 5D3DA 4QF4A 1Y1WB 3K59A 1O80A 2AQ1B 3EA6A 4RKLA 1PRTD 3SXHA 1HHVA 3VYUA 3DUZA 3H09A 4DFAA 4WRDA 1DJRD 3R2IA 1V1OA 4RAUC 3MC0B 1Q1BA 3AB9A 4HMIA 3V96A 3PUXA 4FF1A 1JR0D 2WB1B 4MIUA 3I3CA 1TWCB 2H1EA 3T13A 3I72A 3WOFA 1TR5A 1NAPA 4R8NA 1E2WA 4NDXA 3IAYA 1U9RA 4F7XA 1CTMA 1C8CA 3FVQA 1K8MA 2H4OA 4RWSC 3A8IE 1ZKOA 2EE1A 1K83B 2B2VA 3X3NA 5KNDA 1L0XB 5COYA 4KK7A 1LT5D 4KY6A 4L63B 2J7ZA 4MHEA 3F2UA 1ESFA 3AU7A 3N6RA 5E4XA 2PZWA 3BYTB 1S5BD 1GUSA 1WCMB 4BBRB 1ENCA 4M1UB 2NB0A 3GTKB 4XXEA 2E2JB 4KKTA 4NP5A 2X69A 1KLGD 1B9NA 1TWGB 4N9TA 3I70A 1FD7D 1F2MA 3NTIA 4KD3A 4DAPA 4ID6A 4A3FB 4K8JA 3A7LA 4X3UA 1CT1D 2D2CC 2R7ZB 1STYA 3AMUA 5C4JB 4JBWA 1BDOA 4PQXA 1RHPA 5EJWA 1SJED 2K04A 2R6GA 4BS9A 4G7HC 1B44D 1RTOA 4H7BA 4BA2I 4ZQ3A 2EOTA 3OW7A 1PTOD 1UNSA 1IKLA 1SNOA 2JP1A 4IFDJ 3FMCA 1IL8A 3H0GB 1TY2A 4C3IG 5IGDA 2A68D 4XT3B 3SK5A 3FPPA 5CBEE 1KAAA 1TWHB 2R61A 1FGBD 1QILA 2BCOA 1EYCA 5HGTA 2K1BA 4IUNA 3H3VC 3L3OC 2FMCA 2TSSA 4QB4A 3QOLA 1SNMA 3TBIB 4XQNA 2EYFA 3VA5A 4ZLTF 2PW7A 2VB3X 2L5TA 3I8ZA 1MI2A 2KECA 4DU9A 4AYBB 5JEAJ 1GUTA 3KLSX 3NBIA 3KBXA 2ZT9C 5LL6X 1HQMC 4NKLA 1XTCD 2F0OA 1EL0A 1TS2A 3C3LA 1HFNA 3PIP3 3P1HA 5IGEA 1EU4A 2A74C 3GTGB 2KCCA 1MGSA 4C1NI 5I2XA 3S1QB 2IWHA 2NVYB 1A2UA 5ELDA 1FR3A 4OL7A 4A3EB 1XXGA 2NTTA 3L9AX 4C3HG 1CM9A 2L1BA 1E2ZA 2K5DA 3KBGA 3N52A 2M9VA 2J4XA 2M00A 4M8AA 1QNUA 2AQ2B 1YNJD 2KQ3A 4WJWA 5C6AA 2Y0SB 3TP6A 2K6AA 3D4WA 1JC7A 5IT9E 3UI2A 1DYQA 3GQBA 1CHQD 2PO4A 4QMGA 1SBBB 2BA1A 2IW3A 4A3BB 4DGZA 2PYKA 3RZOB 1V1PA 1QOHA 2RBMA 4ZRZA 2PNRC 2OF1A 3H94A 3A55A 2F0QA 1SAPA 1QJOA 3VR5A 1WVLA 3CRKC 1DONA 4HMJA 1DCZA 3D4RA 2ICIA 4EGVA 3ONAB 1SSOA 2E2HB 2F0HA 2R93B 1CZWA 5JAVA 3Q6SA 4C2MB 1SMYD 3OIQA 1V1PB 5ISRA 4RGMA 4C3IB 1STAA 1TY0A 3OIPA 5HURA 2K7VA 1EU3A 1GUGA 2I07B 3ZYYX 2MJ8A 4K14A 1TIID 1KDAA 2RDHA 3T56B 3PMFA 3S1NB 3J81L 1BQQT 1R4PB 1FYCA 4ZKBB 3D6CA 4K2KA 2L9HA 2MUYA 1B9MA 1STNA 4ZUJA 2KCNA 4R9WA 3R93A 2CW0C 3M7NA 3SK8A 1H9JA 2VXWA 2E2DC 1E2VA 3MFYA 1A3TA 3BDLA 4DNRB 3TDQA 2WACA 1CA6A 1BUVT 2FINB 1S5CD 4WFN3 3H91A 1VF7A 4KJNA 1WTPA 1TWAB 1EZ8A 2PQEA 5KEEA 3D8GA 2O2LD 1PZJD 3U9OA 4DNTB 5J39A 1IYUA 3MTSA 1JWSD 4B9WA 3S15B 2BE5C 2HDLA 1G91A 2WKDA 2EYJA 3K5OA 1LTID 3EJIA 3A56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  1SNP A;  4WRD A;  2LKV A;  4K8J A;  5F2D A;  4EQN A;  3QOJ A;  3P1H A;  1EY9 A;  3OWF A;  2F0M A;  2F0U A;  4YIJ A;  5IGE A;  1STH A;  1STY A;  2NUC A;  3P75 A;  5ISR A;  4HMI A;  2F0J A;  3C1E A;  4WOR A;  5CV5 A;  5IGG A;  1STA A;  4K2L A;  5JOB A;  2EYM A;  1A3U A;  5M9O A;  5HUR A;  3DMU A;  5CR3 A;  4NMZ A;  5K5P A;  4EQO A;  4KJO A;  4MIU A;  1SNQ A;  4K5W A;  1A2U A;  1STB A;  2F0L A;  3HEJ A;  2HQE A;  5C4H A;  3LX0 A;  1A3V A;  2SNS A;  3BDC A;  3NUC A;  1SYE A;  4OL7 A;  3T13 A;  4IAL A;  1NSN S;  4KV6 A;  3RUZ A;  5IOC A;  1TR5 A;  4K14 A;  3DHQ A;  3QB3 A;  4H7B A;  3EVQ A;  3ERO A;  2F0V A;  2F3W A;  1AEX A;  3R3O A;  4NDX A;  4R8N A;  1SYC A;  2F0F A;  5DAU A;  4ZQ3 A;  1KDA A;  4K8I A;  3T16 A;  1EZ6 A;  5KYL A;  4KTA A;  1U9R A;  3S9W A;  4F7X A;  5I6W A;  2EY1 A;  3PMF A;  2F0W A;  1SNO A;  2EXZ A;  3NXW A;  4EQP A;  1KDB A;  4J6H A;  5J22 A;  4DF7 A;  5EKK A;  2KHS A;  3NP8 A;  3MHB A;  3D6C A;  3NHH A;  5CC4 A;  4ME5 A;  5KYI A;  1SYG A;  2F0D A;  2F3V A;  1SYD A;  1EY5 A;  3ERQ A;  4K2K A;  5CV7 A;  1JOQ A;  5CV4 A;  5IGD A;  5C3W A;  4KY5 A;  1STN A;  3OSO A;  2RKS A;  5CV6 A;  4ZUJ A;  3SK5 A;  2EYL A;  3H6M A;  5C3X A;  5IIF A;  2M00 A;  5E1F A;  1EYD A;  1NUC A;  1F2Y A;  5CGK A;  5IGB A;  1EY7 A;  5J1Z A;  2O4X A;  4TRD A;  3V2T A;  2KQ3 A;  4HTH A;  4IZ8 A;  3NK9 A;  4ODG A;  4PMC A;  3SK8 A;  1KAA A;  2EYP A;  5EKL A;  5C6A A;  4E6I A;  3TP6 A;  2F0P A;  4KY6 A;  5NUC A;  3MVV A;  3D4W A;  5C5L A;  2SOB A;  4B9X A;  2SNM A;  2ENB A;  5IGC A;  4KY7 A;  3SR1 A;  3OMC A;  1A3T A;  3BDL A;  1STG A;  1EYC A;  4KHV A;  3SHL A;  4QMG A;  2F0T A;  5CV8 A;  5HGT A;  2QDB A;  3HZX A;  2WAC A;  1SND A;  3MXP A;  4IUN A;  3SK4 A;  2PW5 A;  1EY8 A;  5E3F A;  3TP5 A;  2EYO A;  4QB4 A;  3SK6 A;  4N9P A;  3QOL A;  2F0K A;  1SNM A;  1EY4 A;  1IHZ A;  1RKN A;  5IGF A;  2EYF A;  1TQO A;  2PZT A;  2PZW A;  3VA5 A;  5KIX A;  4I65 A;  2PW7 A;  4KJN A;  2F0S A;  2F0N A;  2RDF A;  5EGT A;  4DGZ A;  1EZ8 A;  1EYA A;  2PQE A;  4LAA A;  4S3S A;  2PYK A;  4PMB A;  1ENC A;  5KEE A;  1KDC A;  3D8G A;  2EY5 A;  4J1M A;  2RBM A;  2EYH A;  3U9O A;  1SYF A;  3TP7 A;  5IOD A;  5J39 A;  2F0G A;  4NP5 A;  2OF1 A;  1JOK A;  3TME A;  5KRU A;  4DU9 A;  3D4D A;  5CV9 A;  4B9W A;  2F0Q A;  5C4Z A;  2EY2 A;  4F8M A;  3MEH A;  1A2T A;  3E5S A;  3ITP A;  3MZ5 A;  3NQT A;  5DEH A;  3TP8 A;  2F0O A;  1EY0 A;  4EVO A;  2OXP A;  4QF4 A;  5I9O A;  2EY6 A;  4HMJ A;  4ID6 A;  4PNY A;  4RKB A;  4N9T A;  5C5M A;  1JOR A;  1SYB A;  4RKL A;  2F0E A;  2EYJ A;  1SNC A;  4K6D A;  5I9P A;  1II3 A;  4K5X A;  3C1F A;  4K5V A;  5I6Y A;  1F2M A;  3SXH A;  2F0H A;  1JOO A;  4NKL A;  2PZU A;  1EY6 A;  3EJI A;  4DFA A;  1F2Z A;  4G57 A;  4KD3 A;  4KD4 A;  5KGU A;  1ENA A;  1EQV A;  1KAB A;  5JAV A;  2OEO A;  4ZUI A;  2F0I A;  1TT2 A; 
#chains in the Genus database with same CATH topology
 4X3T A;  1LTG D;  3I4L A;  2N78 A;  1XX8 A;  3Q8D A;  4B3M Q;  3SGI A;  4DR4 Q;  2AQ3 B;  5ELB A;  4DNI A;  4O0A A;  1CHP D;  4LFA Q;  3P75 A;  4C3I H;  1S40 A;  4LF5 L;  4KMU C;  4A3I B;  3C1E A;  3HOV G;  1Q8K A;  1EOT A;  3UDX A;  1Q90 A;  2KHJ A;  3DMU A;  4FF2 A;  3S1Q H;  3LGJ A;  3EFX D;  1PA6 A;  4BBS B;  1EWH A;  1B1Z A;  3TZU A;  3FKI B;  2SNS A;  2XWJ B;  2NN6 I;  4KV6 A;  1PZK D;  5IOC A;  1Q8I A;  2F0V A;  2UUB Q;  2O5I C;  1FJG Q;  4BY1 G;  3I55 A;  2NVT H;  2R92 B;  1V1Q A;  2B2T A;  4XDX A;  2CWP A;  2IT1 A;  1AE2 A;  1ONL A;  2Y0S G;  3IFD A;  1J5E Q;  1VQJ A;  3HOV H;  5K36 H;  1VS0 A;  4KY5 A;  2CVR A;  2N49 A;  5E1F A;  1KNA A;  5CGK A;  3GTO H;  2VNU D;  3KLW A;  4JVZ A;  5BN5 A;  4O42 A;  2EPB A;  2KBN A;  4QIW B;  5I4D A;  2R7F A;  5EKL A;  1OXT A;  2QA4 A;  2UU9 L;  4L5Q A;  4OGQ C;  5GQO A;  4DR6 Q;  1IW7 C;  2WAQ B;  4H44 C;  1EWC A;  3GTP B;  1QE6 A;  1DM0 B;  1SFO H;  1YI2 A;  3J81 E;  1EY8 A;  4NXN Q;  2WIN B;  5JPM C;  3DLL A;  5E7N A;  1L0Y B;  5AJ3 L;  5K36 G;  4JOI C;  4Z9C B;  1M8A A;  2K5H A;  1I4P A;  5IYC G;  4RCO A;  1AFP A;  4H13 C;  4KKU A;  4LAA A;  4L8J A;  5D14 A;  1XWE A;  1I4Q A;  3RZO H;  1HNW Q;  3A5U A;  3HS0 C;  4CHT B;  4DR5 L;  1HQR D;  3PIO A;  4DV2 L;  1N36 Q;  5C3E B;  2C9O A;  4ULL A;  4EVO A;  2MO1 A;  4YHH L;  3M4P A;  3K0X A;  1OXV A;  2UUA L;  1HXY D;  3RNU A;  3GTK H;  1ENF A;  3C1F A;  5IYC H;  3PO3 B;  1EY6 A;  1X3F A;  3BVZ A;  4LF4 L;  4G57 A;  1I94 L;  1MKH A;  3RMH A;  5C4X B;  1ENA A;  1KAB A;  3DWQ A;  1X55 A;  4IPC A;  4R4C A;  4XIG S;  1KQS A;  2UUC Q;  1TWG H;  5GAD C;  1JB3 A;  3CCV A;  5LMN Q;  4LNQ A;  1DOL A;  1STH A;  4WJ4 A;  4LF7 Q;  2WP8 J;  3FHW A;  3SVM A;  1KRT A;  1UEA B;  4DR5 Q;  4CJ1 B;  3S2H B;  2I5L X;  4K2L A;  4JI1 L;  1MHW C;  4DA2 A;  1M1K C;  5C0X I;  1VCI A;  5M3F B;  1VQM A;  2KEN A;  3NEN A;  4A93 H;  3CPW A;  5C4H A;  1BF4 A;  1Z47 A;  1HNZ L;  3I73 A;  4H0L C;  1E1O A;  3RLN A;  1BNZ A;  3S1M B;  3QJY A;  1H9M A;  4A3D B;  3NSW A;  5JJL A;  1PDQ A;  1STE A;  3M9B A;  1LTR D;  5CC4 A;  4G7O C;  1X3E A;  4P72 A;  3VR4 A;  4BA1 I;  5LMU L;  1ET6 A;  3TZD A;  2EZV A;  1YJN A;  1LM0 A;  4A93 G;  4FXK C;  2WV6 D;  1I6V C;  1EIH A;  2IY5 B;  2NWG A;  2LXK A;  3GTJ B;  1U5K A;  2RSN A;  3GP7 A;  3BVG A;  4LF9 L;  1X54 A;  4KHV A;  1XMO Q;  3HOY G;  4KHP Q;  4GOP A;  5H1S E;  4UDU C;  3KK7 A;  4A3K B;  4BXX G;  3CCS A;  1PTO F;  1WTW A;  3K80 C;  2O5J C;  2EJG C;  1X3Q A;  3AFQ A;  4UP9 A;  3E0E A;  3S2D B;  4I65 A;  5DNF A;  3M4Q A;  4S3S A;  2ASB A;  4A3G H;  2Q8I B;  2EY5 A;  1UE6 A;  2VUM B;  4A3C G;  4MNO A;  1JOK A;  3D4D A;  1B3A A;  1IZ6 A;  3D31 A;  3CCQ A;  3E0J A;  3CXC A;  1SRO A;  2JJQ A;  2XTI A;  4BXX H;  3GDE A;  1A8V A;  4RA8 A;  5BR8 Q;  1XYI A;  5I9P A;  4A3J H;  4K5V A;  4HCE A;  4DXG A;  2YU9 H;  4X64 Q;  3FDT A;  5ELN A;  4RGT A;  1D1K A;  5F2D A;  3J80 i;  1KD1 C;  4AQY Q;  4EQN A;  1C4Q A;  4JW0 A;  3STB C;  3OWF A;  2L4N A;  2F0U A;  1Q81 C;  1TWH H;  3TN2 A;  3PF4 A;  2OCE A;  4GKJ Q;  1U4L A;  2RCN A;  1C0A A;  2TMP A;  1A3U A;  3A8J E;  4C3J B;  5M9O A;  2G9H D;  1GOZ A;  4AH6 A;  2K75 A;  1SFO B;  5D3I B;  4FDB A;  5LHY 1;  4A3J G;  3NUC A;  1A3V A;  2K05 A;  1QB5 D;  1HA6 A;  4JBJ A;  4TKO B;  5DAU A;  4A3M B;  3CCJ A;  1QUQ A;  3D6W A;  2KEE A;  3S24 A;  1YBY A;  3W1G A;  4JI2 Q;  2RSO A;  4A3K G;  5C4J H;  1G2S A;  1KDB A;  4HAE A;  4P71 A;  3BG3 A;  4AQY L;  1UWV A;  4GS3 A;  1CKN B;  1EEF D;  3NHH A;  3E3X A;  2NVX H;  3SEB A;  1EY5 A;  4QCL A;  4KN7 C;  1CA5 A;  1SR3 A;  1ILQ A;  1BCP D;  2UXD Q;  1EYD A;  1W2B A;  2XN9 C;  2Z6K C;  2E5L Q;  2UXC L;  4KI0 A;  4P74 A;  4BY7 G;  3HOX H;  1XMO L;  3MVV A;  5FJ8 H;  5C5L A;  4B3R L;  2NVQ B;  2FFK B;  2ENB A;  5C0X J;  1TWF H;  4A76 A;  2A73 B;  4LMQ D;  2KJX A;  4GZY C;  4A3K H;  2SDF A;  3GO5 A;  1X3G A;  2QIL A;  4B3S Q;  3WDN A;  2QF7 A;  1ZYR D;  2B39 A;  5COR A;  4CKE A;  4Y7N H;  2JA7 G;  3Q24 A;  1KIX A;  3GTL H;  2N8N A;  2UXB L;  1CFM A;  3DXJ C;  1SE4 A;  1UAP A;  2X6L A;  4X3K A;  4IPH A;  4A3G B;  4F87 A;  4PMB A;  1XMQ L;  1IBL Q;  2NVY H;  3J7A V;  3HOX G;  4IN3 A;  3WWV A;  1V8Q A;  2JEB I;  2OT2 A;  1GD7 A;  1J9O A;  2EY2 A;  3IL8 A;  4C3J G;  2K4K A;  4L6T B;  3TP8 A;  3L7Z C;  2RA4 A;  4ABN A;  2A6H D;  1SN8 A;  3HKZ B;  3GTM B;  2F0E A;  5CBA E;  3ND9 A;  1WTO A;  2A19 A;  4LUV A;  4JYA Q;  2YU9 B;  2PZU A;  1UE5 A;  4KD4 A;  1AN8 A;  2ZXP A;  1YNN C;  2B2W C;  3PO2 B;  2Z9H A;  4DPG A;  4TSS A;  1GM5 A;  1IKM A;  4XYO A;  3AYH B;  3KF8 B;  4XTC S;  3UE1 A;  5D65 A;  3BU2 A;  3S14 B;  1JQY D;  4C3J H;  1A0I A;  4DAY A;  3HKS A;  2KUM A;  1EFI D;  2K14 A;  3T53 B;  2Z1C A;  1P16 A;  1SNQ A;  1TS4 A;  1KXL A;  1JCK B;  4K6L A;  2DNC A;  3K0Y A;  1V9P A;  3RUZ A;  4DV7 L;  2NYZ D;  2F3W A;  2HIX A;  2F0F A;  3U9S A;  1EZ6 A;  1GKH A;  2PI2 E;  1GUN A;  3VDY A;  1MD2 D;  1FNU A;  2ZTE A;  5I6W A;  3I4M H;  5DM6 3;  3I4O A;  1HR0 Q;  1BCP C;  1WFQ A;  1DOK A;  1PFS A;  2N55 A;  2NZO A;  3G71 A;  3ERQ A;  4JI6 Q;  4DR6 L;  3KF8 A;  1E1T A;  2LFN A;  2FXQ A;  1X6O A;  5C3W A;  3Q22 A;  1W3S A;  1JT8 A;  2F3I A;  3CF5 A;  5J1Z A;  2MFI A;  3Q23 A;  1R4Q B;  2FJ2 A;  2EYP A;  4OHJ A;  1HNW L;  2BA0 A;  4NB3 A;  2KED A;  5J3B A;  2XVS A;  3CCR A;  2SOB A;  4R4O A;  1KRS A;  3S17 B;  2VQF L;  1N36 L;  4OEM B;  4A75 A;  2FHT A;  3GTJ H;  3JC6 6;  1BCP F;  2ZXR A;  5FO8 B;  5GRO A;  1DGS A;  1SRU A;  4G4K A;  5CV8 A;  1U4P A;  2MNA A;  5C44 G;  5JJZ A;  4BWG B;  1Y1W H;  2GVB A;  4UP7 A;  4DAM A;  1XMQ Q;  5JVG 3;  1KL9 A;  1ASY A;  2PI2 A;  1LAC A;  2DNE A;  3FEW X;  2Y0S E;  3TSS A;  3E9H A;  1PH8 A;  1K8A C;  4JI2 L;  4FYD A;  1B53 A;  2A6H C;  5IOD A;  1O7Z A;  4P2C B;  3PUV A;  1TVX A;  2QW7 A;  3MEF A;  4XYQ A;  4F8M A;  2NZH A;  2ZM6 Q;  4FNF A;  1EQT A;  1JWU D;  1EY0 A;  1TWA H;  2OXP A;  3CCM A;  4PNY A;  1G29 1;  2JE6 I;  4X62 Q;  5C44 H;  5G3L F;  1YNN D;  1SNC A;  3HKZ E;  1K3R A;  1Y1W G;  4PZ8 A;  1Z7T A;  1F9R A;  4FO2 A;  4OWT B;  2XRS D;  1UUP A;  3PF5 A;  4TVA B;  2Z8L A;  1EFW A;  2B63 B;  1LT4 D;  2XRQ D;  4HCS A;  3J81 c;  2AKW B;  4DUZ L;  4OX9 Q;  1H9R A;  3NTK A;  1PYB A;  1D1I A;  2NBF A;  4I7A A;  2LXJ A;  3VYS A;  2JA6 B;  4NMZ A;  4LF5 Q;  4HN7 A;  4KJO A;  1H95 A;  2BOS A;  2F0L A;  1J8I A;  1NTG A;  3J80 L;  1SYE A;  4XQJ A;  3EIV A;  4IAL A;  3HOW H;  1ZEQ X;  3K7U C;  3P20 A;  4OO1 I;  3CCE A;  1LO5 D;  4GNX B;  2XNA C;  3T16 A;  3VA7 A;  2A8V A;  4K8I A;  3GTL B;  1E0B A;  3I4M B;  5FLX E;  4IFD G;  3PGZ A;  1GVP A;  3KLR A;  3HOY H;  1YVC A;  4GKK L;  4IJH A;  2P5Z X;  1NNX A;  3DWP A;  2EXZ A;  3MAQ A;  2I0Q A;  3KFU A;  5T1I A;  5EKK A;  3VR2 A;  5CV7 A;  1BBX C;  1PYS B;  1BO0 A;  3HOZ H;  2XWB B;  4LW1 A;  1NUC A;  3KUP A;  3ERS X;  1NR2 A;  1T5E A;  4HTH A;  5M5W B;  4PZ6 A;  3VYR A;  4A3G G;  3HOW G;  3KF6 B;  3NQI A;  1PMR A;  1WTH A;  1VDZ A;  2G5D A;  2Z4I A;  1STG A;  2UXD L;  1BKB A;  5I2Y A;  4H02 A;  1SND A;  1I50 B;  5FK9 C;  3SK4 A;  1H9S B;  3NPP A;  4N9P A;  3HOZ G;  2QEX A;  1HNX Q;  3PIO 3;  3NE5 B;  2F0S A;  2EQS A;  4HID A;  2F03 A;  4OON A;  4CDE C;  1CQV A;  3VYT A;  4DK1 A;  3RR5 A;  2ZTD A;  3BDO A;  1N32 Q;  3OOC A;  4GKJ L;  2Q2T A;  2AHO B;  1PH1 A;  3NEL A;  2PPB C;  4HJ9 A;  3MZ5 A;  4IUV A;  1TKW B;  1SMY C;  3U4V A;  5I9O A;  2EY6 A;  4LJZ C;  1K73 C;  4CKC A;  1I94 Q;  1VQI A;  4Q5V A;  3K6O A;  1VQ6 A;  1II3 A;  2EXD A;  1JOO A;  2B8G A;  3NBH A;  4Y52 H;  1QG7 A;  1Z6H A;  5JPN C;  1Y8P B;  1LTB D;  4ZUI A;  1TT2 A;  3SDZ A;  4MZ9 A;  4QY7 A;  4DK0 A;  1GXD C;  1I5F A;  4YIJ A;  4RCN A;  2AMC B;  3RN2 A;  3A8K E;  4R8I A;  1F2L A;  4O2D A;  1T9H A;  3GTP H;  2AWO A;  1CI3 M;  4B3T L;  3HOW B;  4IFD I;  4ZYS A;  1W6J A;  4DAV A;  1KC8 C;  4YY3 Q;  1NSN S;  4O1N A;  4DR3 L;  5FJ8 G;  4C1N K;  1A62 A;  1JOR A;  4HSP A;  2AUJ D;  1SYC A;  2CKZ B;  4KTA A;  3M7G A;  1N9W A;  1U4R A;  2B2T C;  1F9P A;  3MFG A;  2A6E C;  1Y8O B;  3K57 A;  4OIK A;  1QVF A;  2EDG A;  2RQX A;  3K81 C;  2D0O A;  5T1G A;  3H6M A;  5C3X A;  1OTC A;  4RHS A;  3CC4 A;  4QQB X;  1PTO B;  1RIP A;  1D5X C;  5C44 B;  5ELC A;  4JC0 A;  1F9S A;  5ELO A;  4FXG C;  1MSH A;  2QEJ C;  1J5E L;  4B9X A;  4DR1 Q;  2RHS B;  4ZK9 B;  5IGC A;  4A3B G;  1XNQ L;  3S17 H;  3CMA A;  1J6Q A;  3KF6 A;  4F88 A;  2OQK A;  1VQF A;  5M3M B;  4A3I G;  3HOV B;  1XTD A;  3GTQ B;  1G6Z A;  3BVM A;  2CQO A;  3J81 j;  2B3G A;  1VQE A;  1VMP A;  3CRL C;  3UDF A;  4CJ0 B;  1SJH D;  5JJK A;  1N32 L;  3GV6 A;  3GV3 A;  4QIW E;  4V0B A;  1QCB D;  1HFG A;  4LK1 C;  1I6H B;  3JAM E;  3PUZ A;  4A3B H;  4GNX A;  1QVG A;  5CV9 A;  2CWA A;  1HH2 P;  2JQO A;  2BH2 A;  3Q0A A;  2Z6B A;  1E24 A;  4CJ2 C;  3J7Z C;  4CKB A;  2KA7 A;  1N8R C;  4GLA C;  4K5X A;  5I6Y A;  1DOM A;  4P75 A;  1LTA D;  1BCP B;  5KGU A;  1EQV A;  2E75 C;  2F0I A;  2VB2 X;  3OMG A;  2KHI A;  4X3S A;  4YHH Q;  3I4M G;  2K01 A;  1S5D D;  2OTJ A;  5C3E H;  4ILW A;  2UUA Q;  4DV3 Q;  4JI5 L;  1GJX A;  4OO1 G;  3L2P A;  3SE0 A;  3T4A C;  3QIA A;  3W5O A;  5K5P A;  1KHI A;  1I50 H;  5IT9 L;  3E6Z X;  1O7L A;  3KJO A;  1YHA A;  1PH4 A;  2VQF Q;  1YEZ A;  3QB3 A;  3EVQ A;  4KN4 C;  2VQE Q;  1YHQ A;  5A35 A;  3C46 A;  1CSP A;  3S2D H;  4PMW A;  4X65 Q;  2DY8 A;  1ROD A;  1MSG A;  5C3E G;  1SE2 A;  4JK1 C;  4JOI A;  3ND8 A;  1SYG A;  1SYD A;  4JPB W;  5M3F H;  3DM3 A;  5M5Y B;  1VQ5 A;  3QR8 A;  3UDG A;  4ZKC B;  3OSO A;  5IIF A;  4JI7 L;  2EYL A;  3DWA A;  3HOZ B;  5IGB A;  5EAY A;  1EY7 A;  2O4X A;  4TRD A;  3PO3 G;  4DR7 L;  4IZ8 A;  2N3S A;  1B7Y B;  3D0F A;  1BR9 A;  3CQZ B;  4IPG A;  3M85 A;  1I4R A;  2K5N A;  1WD1 A;  1F77 A;  4A3J B;  3K5L A;  1T5X D;  1ILP A;  3TEH B;  4A3M G;  2B2U C;  4U67 3;  3MXU A;  1IBK Q;  2QDB A;  2I5H A;  3MXP A;  4Q0F A;  4PZ7 A;  1QNK A;  2G9D A;  1V43 A;  3SK6 A;  1RJT A;  5M3F G;  2I5M X;  2JA5 B;  1YIJ A;  3G48 A;  4IUR A;  2GVA A;  4YCV A;  3BJU A;  1TWF B;  2RDF A;  2UUB L;  1I4G A;  1KLU D;  1C48 A;  3HOU B;  2ATW A;  1KDC A;  1R9T H;  4C56 C;  2OTL A;  3FPU B;  1S5F D;  1PFB A;  2BDO A;  2YTX A;  4U68 A;  4DUY L;  1A63 A;  1PRT B;  4A3M H;  3I4N H;  2DGY A;  1AW7 A;  2ID0 A;  1HTP A;  1IBK L;  2NZ1 D;  1L0W A;  4GLX A;  2KVM A;  4X66 L;  3CCU A;  3M3Y H;  2PQA A;  3TRE A;  4LF8 Q;  1EEI D;  1VQL A;  1FVI A;  1HZB A;  4IFD H;  2F52 A;  2WB1 E;  3K8A A;  2E74 C;  3MWY W;  4RGN A;  1CK1 A;  1YIT A;  3QOJ A;  2JA7 B;  1FGU A;  2F0M A;  5FKA C;  1HUN A;  1JWM D;  3I4N G;  1Q3L A;  3IKJ A;  4HJ5 A;  3CHB D;  3I7F A;  4K5W A;  2HQE A;  1AH9 A;  2XGT A;  4FP5 D;  4Y7N B;  1WTR A;  4OEL B;  3DHQ A;  1I3Q B;  3TS0 A;  5CV6 A;  2FMM A;  4DV4 Q;  3F1Z A;  4GOP B;  5KNB A;  2EY1 A;  2Z6K A;  3HKZ G;  3RD4 A;  4IUT A;  2MPM A;  1AP0 A;  2IPK D;  4J6H A;  4RG1 A;  1SEB D;  2YYZ A;  2VY3 A;  4ME5 A;  4RH6 A;  1VQA A;  5CV4 A;  2F4I A;  1TS3 A;  2RKS A;  4WJ3 M;  4UHV A;  4C3H B;  5IE8 A;  3E9I A;  4JI0 Q;  2B8F A;  4JBM A;  2YV5 A;  2PCF B;  4DXF A;  1HCZ A;  2K33 A;  3HOU G;  1FNW A;  3BZC A;  2E2I B;  4PMC A;  3K58 A;  5EPK A;  3H15 A;  3H3V H;  2K28 A;  5NUC A;  1PZI D;  1GHJ A;  4KY7 A;  3KOJ A;  3OMC A;  3SR1 A;  3OWE B;  1B70 B;  2D5D A;  5L37 A;  4G7Z C;  2N88 A;  4ZAI A;  2JA8 G;  4R1J A;  1LAB A;  2Q2I A;  3PSI A;  5DM7 3;  4FF4 A;  1LYL A;  1RTN A;  1O7Y A;  2WAQ E;  1RKN A;  4AIM A;  1QZG A;  2BH8 A;  4GN3 B;  5ELF A;  1KAW A;  1KTK A;  2WII B;  4CGY B;  4A3L G;  3ICE A;  3HOU H;  1CQF A;  2DN8 A;  4TQU S;  1DXM A;  2UXC Q;  1X32 A;  3TME A;  3CW2 C;  1JE4 A;  5TSS A;  3QO2 A;  1UE7 A;  1VQ7 A;  5C4Z A;  2DUD A;  3LWU A;  1TS5 A;  3ITP A;  5DEH A;  1DD2 A;  4JV5 L;  3P7J A;  2L11 A;  2JA8 H;  1Q82 C;  1VQ9 A;  5EKI A;  1D2B A;  1SYB A;  2IJ0 A;  1RL2 A;  2B29 A;  4NW2 A;  1X9N A;  1IL2 A;  5A2Q E;  1F2Z A;  2BDN A;  2L0C A;  4A3L H;  2JXM B;  4N8F A;  3T1H Q;  1G51 A;  1Y69 U;  3OHX C;  4IJL A;  2EJF C;  4KHP L;  2NVT B;  1E22 A;  2QDL A;  4B08 A;  4LF9 Q;  4QUF A;  1OXU A;  3K5N A;  5LMN L;  4BBS G;  4RGO S;  1Y8N B;  2LSS A;  3TQY A;  3UE0 A;  1D8L A;  2A69 D;  2JSO A;  3J7Y W;  2GA4 B;  4R4T A;  5CMD A;  1PH3 A;  1JB7 A;  1JJG A;  1LTL A;  3NWT A;  1GUW A;  3S2H H;  4YWK A;  1N33 Q;  2OWO A;  5HY6 A;  4BY1 B;  4A3I H;  3M4Y A;  4HIO A;  5J22 A;  4A93 B;  1C9O A;  5KYI A;  4DR4 L;  1K8O A;  5EBD A;  3S1R H;  2D0P A;  3NWS A;  2L15 A;  4XQQ A;  1C7Y A;  4BBS H;  3G6J B;  4X6A H;  2JA5 G;  1F2Y A;  3DEO A;  2YTY A;  3V2T A;  2PMZ B;  4RHR A;  4ODG A;  5IYD G;  3JAM c;  2A5H A;  1JMC A;  1D5Z C;  2SNM A;  1D5M C;  3CME A;  1LLR D;  1PFN A;  4RFB A;  3WOE A;  3M3Y B;  5IWA Q;  5LMN W;  3DM1 A;  5M5X B;  2F0T A;  2E2J H;  2R7Z G;  2GN5 A;  3GTO B;  4MN3 A;  3RN5 A;  5IGF A;  1KNE A;  3NTH A;  1LV9 A;  5ELE A;  1WOC A;  4A3F G;  3I2Z A;  2JA5 H;  4JI4 L;  2ICE C;  1FNV A;  1LT3 D;  1RCV D;  1EYA A;  4ALP A;  1IBM Q;  3BYY B;  2LY7 A;  3DEP A;  1EQQ A;  3QG1 A;  4J1M A;  3MA2 B;  3TP7 A;  1R9T B;  3J80 c;  4IOC A;  1WD0 A;  1ESR A;  4OO1 H;  3MEH A;  4DV0 L;  4K0K L;  1BVS A;  4RKB A;  3J7A F;  1CKM A;  3J81 i;  1WTQ A;  4HSV A;  2R7Z H;  1NE3 A;  4OIJ A;  3MXN B;  5AJ3 Q;  1HPC A;  3MXG A;  4V19 0;  4QUC A;  4DUY Q;  4JI8 L;  1PRT F;  1SNP A;  1TU2 B;  1RF2 D;  3HG9 A;  4CBV A;  4LUO A;  1EY9 A;  2RVL A;  1QUQ B;  4A3D H;  4FVM A;  3C2P A;  4KHZ A;  5E4W C;  5FOB B;  1IYV A;  5JVH 3;  2VQE L;  2D9U A;  3CKI B;  2A68 C;  4QJF A;  1ICW A;  2R92 H;  5JOB A;  2MHV A;  2CCZ A;  4DR3 Q;  5IP9 G;  3PO3 H;  5EPL A;  1O7I A;  2B2U A;  4CDD C;  5C0X G;  3L0O A;  3LX0 A;  1PFM A;  4HED A;  2HDM A;  3PV0 A;  1H9K A;  3S16 H;  5FO9 B;  1CSQ A;  4DUZ Q;  1WTX A;  4OX9 L;  2HCC A;  1U4M A;  1ET9 A;  1AEX A;  2K5W A;  3CAM A;  4LF4 Q;  1CKN A;  1I4X A;  1QZH A;  1NCV A;  3PQI A;  3S9W A;  2K32 A;  3PUW A;  2F0W A;  1YNX A;  4EQP A;  2F1M A;  4DF7 A;  3S1R B;  5GAE C;  2JYO A;  3NP8 A;  3MHB A;  1PXU A;  1LT6 D;  2R3Z A;  3R8B A;  1G2T A;  1S5E D;  2LS0 1;  3BZK A;  1JOQ A;  3B6Y A;  1JJ2 A;  2JA6 H;  2D62 A;  2R92 G;  4HR7 B;  2F4V L;  4KKS A;  4OWX B;  4DR1 L;  2QCP X;  1A6X A;  4JYA L;  5C0X H;  4L5S A;  2JA8 B;  3K7A B;  3S1M H;  4AYB G;  3JAM L;  4APV A;  4J8Q A;  5G3L D;  3HOY B;  3R2T A;  2PQA B;  4GLV B;  1ASZ A;  2ZXO A;  1Q1E A;  3SHL A;  2XSC A;  3EQL C;  2IX0 A;  2Z4H A;  1ML0 D;  1PH2 A;  2CQA A;  2EYO A;  1PTO H;  1MJC A;  1EY4 A;  2JA6 G;  1IHZ A;  1IBM L;  3W3A A;  2PZT A;  1EOV A;  2CHB D;  2E2H H;  3J80 E;  2A69 C;  1VF5 C;  1NMG A;  3F2D A;  3MXN A;  2LMC B;  3QWN A;  1HA5 A;  1SYF A;  1FJG L;  3PUY A;  1VQB A;  4IOA A;  4XT1 B;  2CH4 A;  1HRJ A;  1HR0 L;  1DZ1 A;  2KOL A;  3D3R A;  3HP3 A;  3GTG H;  2CW0 D;  1I6H H;  1VMC A;  4HIK A;  3VR6 A;  1TXY A;  4IUU A;  1B4O A;  1B2T A;  4DN4 M;  3IRB A;  2OEO A;  1VQD A;  1XPR A;  2Q8T A;  3GTM H;  2Q8R E;  1H9S A;  2NUC A;  3OYY A;  1VQP A;  1PRT C;  1G8Z D;  1K28 A;  2F0J A;  4WOR A;  1MBY A;  2NN6 G;  2NVX B;  2EYM A;  2MGS A;  2HHH L;  1AZP A;  4EQO A;  1OXX K;  3S16 B;  1NJI C;  4B3M L;  1HTL D;  5IT9 c;  4LFB L;  3GTQ H;  1K0R A;  1L2F A;  1NY4 A;  3ERO A;  1W6K A;  1GHK A;  2HCI A;  1AZQ A;  3A54 A;  1B50 A;  2BE5 D;  1HR0 W;  5FO7 B;  1M4V A;  4DV2 Q;  4B3S L;  1RD9 D;  3NXW A;  4IQZ A;  2L55 A;  4YCU A;  3IFT A;  1L1O C;  4X62 L;  2F3V A;  4GN4 B;  3KLS A;  1PH5 A;  3CU7 A;  2ZM6 L;  1Q12 A;  4EX5 A;  2NN6 H;  2WB1 G;  3A5Z B;  1EQR A;  2B2Y A;  2M2L A;  1D6E C;  5FLX L;  1YNJ C;  3V05 A;  3NK9 A;  4DR2 L;  1X3P A;  2H5X A;  1PV4 A;  5GAG C;  2IX1 A;  4YY3 L;  2UUC L;  1EYG A;  3TS2 A;  1NR4 A;  5M5Y H;  2I46 A;  3ULL A;  1HZ9 A;  3FRP B;  1Y14 B;  3RZD B;  4L5R C;  2JEA I;  3HZX A;  1JIC A;  1BOS A;  2PW5 A;  1ZYR C;  2V4D A;  1OO9 B;  2F0K A;  2K5Q A;  2RDG A;  1BBW A;  2AUK A;  1LTS D;  3AQQ A;  4LFC L;  1CZG A;  5BN3 A;  5KIX A;  2F0N A;  3HOX B;  3S1N H;  3GD7 A;  1YJ9 A;  4YWL A;  1I4H A;  2B2V C;  1Y1V B;  5LL6 S;  2EYH A;  1NMF A;  2F0G A;  2E76 C;  4CDF C;  3ULP A;  2DY7 A;  1A2T A;  3FP9 A;  3NQT A;  4BBR G;  1BXT A;  3TRZ A;  2DJG C;  5C5M A;  1K9M C;  2QKI C;  2WKC A;  2IL8 A;  4K6D A;  3G7L A;  3CD6 A;  3STB D;  4DAY B;  2ZJP A;  1K3B C;  1SE3 A;  1IW7 D;  2ES2 A;  2ALY B;  4ME3 A;  2DJF C;  3BS1 A;  3W2D A;  1A15 A;  2LKV A;  4FXD A;  4IUP A;  4UAI A;  1PVO A;  2WAQ G;  2NTS A;  2MP1 A;  1VQG A;  4HIM A;  2EVB A;  3A7A B;  3HGB A;  1XNR L;  2HUG A;  4LF8 L;  5KNC A;  5M3M G;  3T51 B;  2RHQ B;  5CV5 A;  3BZD B;  5IGG A;  3O13 A;  2MQH A;  4BBR H;  4LFB Q;  2PMZ E;  5CR3 A;  2K03 A;  4FF3 A;  3I90 A;  2ZJR A;  1STB A;  1JE5 A;  3HEJ A;  2B2Y C;  1HNX L;  4GNX C;  1IXR A;  3BDC A;  4JG2 A;  3RLO A;  5IYD H;  1TWC H;  1ZXT A;  4DV3 L;  1SDF A;  3S15 H;  1QWY A;  3R3O A;  5KYL A;  2HD3 A;  3LNN A;  3X3M A;  1CUK A;  3RLF A;  5AFW A;  5BN4 A;  5A2Q L;  2A1A A;  2KHS A;  3VR3 A;  1WTV A;  2F0D A;  5CYU A;  2EJM A;  3LWE A;  2B2W A;  1B3Q A;  1RDP D;  4A3F H;  1S3O A;  2L12 A;  5GAH C;  2IX3 A;  3M4O B;  1S72 A;  2IHE A;  3I4N B;  1PTO C;  1HUM A;  4I7Z C;  2VZA A;  4E6I A;  3URY A;  3T1Y L;  5C4X G;  2F0P A;  2E8G A;  5JEA H;  3OPO A;  1GUO A;  5EQ0 A;  1LTT D;  1CKO A;  3U58 A;  3RZD H;  1EWI A;  2Q2U A;  5LMU Q;  4HJA A;  1Z9F A;  4IUQ A;  3U4Z A;  2JA9 A;  4BY7 B;  1EIG A;  3FKI H;  5E3F A;  5EPJ A;  3TP5 A;  2X6G A;  5EBC A;  2HT1 A;  1TQO A;  2XIW A;  1GO3 E;  2SEB D;  1O78 A;  4QL5 A;  4JI3 Q;  3I91 A;  1SXT A;  5EGT A;  2J0T D;  4B3T Q;  1PYW D;  2AWN A;  1PLF A;  3UDI A;  4CDC C;  1OXS C;  3HRZ C;  1S4Z A;  1WCM H;  3K5M A;  5IYB H;  4DR7 Q;  4PV1 C;  5C4X H;  5JEA G;  3KYH C;  4A3D G;  2A6E D;  4JV5 Q;  5KRU A;  5JJI A;  2C5C A;  1I3Q H;  1F9Q A;  3E5S A;  5D3D A;  4QF4 A;  1Y1W B;  2EIF A;  3K59 A;  1O80 A;  2AQ1 B;  1BBU A;  3FKI G;  3EA6 A;  4IPD A;  4R4I A;  5IP9 H;  4RKL A;  1PRT D;  3A74 A;  3SXH A;  1HHV A;  3VYU A;  3DUZ A;  3H09 A;  4DFA A;  1XNR Q;  4JI1 Q;  4LFA L;  4WRD A;  5IYB G;  1DJR D;  1ICF B;  1V1O A;  3R2I A;  3MC0 B;  4RAU C;  2E2I H;  4L5T A;  3H3V I;  3T1H L;  1Q1B A;  3AB9 A;  4HMI A;  3V96 A;  3PUX A;  3EBE A;  4FF1 A;  1JR0 D;  1LUZ A;  4ZCK A;  3AEV A;  2WB1 B;  4MIU A;  4HJ7 A;  3I3C A;  1TWC B;  2H1E A;  3T13 A;  3I72 A;  3ULJ A;  3WOF A;  1PHJ A;  1TR5 A;  2ZTC A;  4X66 Q;  1NAP A;  4R8N A;  1E2W A;  4NDX A;  3IAY A;  1D7Q A;  1WI5 A;  1U9R A;  4JI6 L;  2VUM G;  4F7X A;  1CTM A;  1C8C A;  1XJV A;  3FVQ A;  1K8M A;  2H4O A;  1HZC A;  4RWS C;  3A8I E;  1ZKO A;  2EE1 A;  1JJC B;  1K83 B;  2VW9 A;  2B2V A;  3X3N A;  5KND A;  4MTN A;  3EN2 A;  3U50 C;  4DV6 L;  1U0L A;  2QGQ A;  1L0X B;  5COY A;  3KDF A;  4LWC A;  5FLX c;  4A3E G;  4KK7 A;  1LT5 D;  4KY6 A;  4YWM A;  4L63 B;  2J7Z A;  4MHE A;  4NXN L;  2VUM H;  3G4S A;  3F2U A;  1ESF A;  2KCT A;  3AU7 A;  4JBK A;  3N6R A;  5E4X A;  3ZJY C;  2PZW A;  4NXM Q;  3F8T A;  2CFM A;  3BYT B;  1S5B D;  1MIU A;  4OWW B;  1GUS A;  1WCM B;  4BBR B;  4HJ8 A;  1ENC A;  4M1U B;  2NB0 A;  3GTK B;  3F2C A;  4DV0 Q;  4XXE A;  2E2J B;  3OW2 A;  4K0K Q;  4KKT A;  4GOP C;  4NP5 A;  1Q86 C;  4LF6 L;  2X69 A;  4NPS A;  1KLG D;  1B9N A;  1TWG B;  4AYB E;  4N9T A;  3I70 A;  1FD7 D;  2B63 H;  1IBL L;  4J15 A;  1UEB A;  4JI8 Q;  1VQO A;  1F2M A;  3NTI A;  4KD3 A;  1VQ8 A;  4C2M H;  4DAP A;  4ID6 A;  4A3F B;  2K52 A;  4K8J A;  3A7L A;  4X3U A;  1CT1 D;  2D2C C;  1AE3 A;  2R7Z B;  3CCL A;  1STY A;  3AMU A;  4JBW A;  5C4J B;  1BDO A;  1M90 C;  1L1O B;  4PQX A;  1RHP A;  5EJW A;  3AFP A;  3HFZ B;  2RCF A;  1SJE D;  2K04 A;  2R6G A;  4BS9 A;  4G7H C;  2R93 G;  4B3R Q;  1B44 D;  1RTO A;  4H7B A;  4BA2 I;  2K50 A;  4ZQ3 A;  4DV1 Q;  2EOT A;  3OW7 A;  1PTO D;  1UNS A;  1IKL A;  2OQ0 A;  2NVQ H;  2E5L L;  1SNO A;  2JP1 A;  4IFD J;  3KDF B;  3FMC A;  1IL8 A;  3H0G B;  1TY2 A;  4C3I G;  4X65 L;  3A0J A;  4N8X 1;  5IGD A;  2A68 D;  4XT3 B;  3SK5 A;  1K0S A;  5FLM H;  3FPP A;  4OXP A;  5CBE E;  1KAA A;  3JAM i;  3M4O H;  1YHB A;  1TWH B;  2R61 A;  1XPO A;  2F4V Q;  1FGB D;  3ER0 A;  3CC2 A;  4LFC Q;  1QIL A;  4BY1 H;  2BCO A;  1EYC A;  4DV5 L;  5IY0 A;  5HGT A;  2K1B A;  4IUN A;  3H3V C;  3L3O C;  2FMC A;  1N34 L;  2TSS A;  1Q7Y C;  4QB4 A;  4R4Q A;  1VQK A;  3QOL A;  3CQZ H;  1SNM A;  3TBI B;  4XQN A;  2EYF A;  3VA5 A;  4ZLT F;  2PW7 A;  1WJJ A;  2JK8 A;  2VB3 X;  2YTV A;  4DV4 L;  5FLM G;  2L5T A;  1PH9 A;  3I8Z A;  1MI2 A;  1SE8 A;  4UP8 A;  3NBH B;  4POG A;  2JN4 A;  2KEC A;  1VQC A;  4DU9 A;  4MTK A;  5M3M H;  4AYB B;  3KJP A;  5JEA J;  5BR8 L;  1VQH A;  1SMX A;  1GUT A;  5IWA L;  3KLS X;  4YCW A;  3NBI A;  1G6P A;  3KBX A;  2ZT9 C;  4X64 L;  1N34 Q;  5LL6 X;  1HQM C;  1FL0 A;  1K83 H;  1QVC A;  4NKL A;  1XTC D;  4IO9 A;  1PH6 A;  5DLQ E;  2F0O A;  1EL0 A;  2R7D A;  1TS2 A;  3C3L A;  1HFN A;  4EQ5 A;  3P1H A;  2Q2H A;  3H0G G;  5IGE A;  1EU4 A;  3PIP 3;  2A74 C;  3GTG B;  2HHH Q;  2KCC A;  4DV7 Q;  1MGS A;  2IHF A;  4C1N I;  3NEM A;  5I2X A;  4JI7 Q;  5HGQ A;  3F2B A;  3S1Q B;  1N33 L;  2IWH A;  3J7A 5;  4NXM L;  3G6E A;  2NVY B;  2PNH A;  1A2U A;  2V1C C;  2RF4 A;  5ELD A;  1FR3 A;  4OL7 A;  4A3E B;  1HJP A;  1WYD A;  1XXG A;  4LF7 L;  1P8L A;  4KLK A;  2NTT A;  4A4I A;  1UE1 A;  3L9A X;  3OTO Q;  1K8G A;  4C3H G;  1CM9 A;  3H0G H;  2L1B A;  4LF6 Q;  1E2Z A;  2K5D A;  3KBG A;  4PG3 A;  3N52 A;  2M9V A;  2J4X A;  2M00 A;  4M8A A;  4QGU A;  1B8A A;  1QNU A;  2AQ2 B;  1YNJ D;  3PIP A;  2KQ3 A;  4WJW A;  1WCM G;  5C6A A;  2Y0S B;  4POF A;  3TP6 A;  2K6A A;  3D4W A;  1JC7 A;  3I56 A;  5IT9 E;  1Q46 A;  4JI3 L;  1IYJ B;  3UI2 A;  1DYQ A;  3GQB A;  1CHQ D;  2PO4 A;  2K5V A;  4C3H H;  3PO2 G;  4QMG A;  1SBB B;  2BA1 A;  2UXB Q;  3PCO B;  2IW3 A;  4A3B B;  3K7A H;  4DGZ A;  2PYK A;  3RZO B;  1V1P A;  1QOH A;  2RBM A;  4ZRZ A;  2PNR C;  4DV1 L;  2OF1 A;  3H94 A;  3A55 A;  2F0Q A;  1SAP A;  1QJO A;  3PO2 H;  3VR5 A;  1WVL A;  3CRK C;  1DON A;  4HMJ A;  1DCZ A;  3D4R A;  2ICI A;  4EGV A;  3ONA B;  1SSO A;  2E2H B;  1Y1V H;  3S14 H;  2F0H A;  1E7Z A;  1VQ4 A;  3CC7 A;  2R93 B;  1CZW A;  5JAV A;  1PH7 A;  3Q6S A;  2UU9 Q;  4GKK Q;  1XNQ Q;  1EIF A;  4C2M B;  2HQL A;  1SMY D;  3OIQ A;  1V1P B;  4A3C H;  4DKA C;  1X65 A;  2KCM A;  5ISR A;  4RGM A;  1E3P A;  2HIV A;  4C3I B;  1STA A;  1TY0 A;  3OIP A;  4P73 A;  5HUR A;  2K7V A;  1EU3 A;  4A3E H;  1GUG A;  3OTO L;  2I07 B;  1Y1V G;  3ZYY X;  2MJ8 A;  3CPF A;  4K14 A;  4DV6 Q;  1EIY B;  2CH4 W;  1TII D;  1KDA A;  1NBW A;  2RDH A;  3T56 B;  3PMF A;  3S1N B;  3J81 L;  1BQQ T;  1R4P B;  1FYC A;  4ZKB B;  3D6C A;  1MJE A;  4K2K A;  2L9H A;  2MUY A;  1B9M A;  1STN A;  4JCV E;  4ZUJ A;  2KCN A;  4UY8 C;  1L1O A;  3T1Y Q;  4R9W A;  3R93 A;  2CW0 C;  2VL6 A;  1YJW A;  3M7N A;  3SK8 A;  1H9J A;  2VXW A;  1SLJ A;  2E2D C;  1VQN A;  2C35 B;  1E2V A;  2VS1 A;  3MFY A;  2Z0S A;  1A3T A;  3BDL A;  4JI5 Q;  4DNR B;  3TDQ A;  4DK6 C;  2WAC A;  1CA6 A;  1BUV T;  2FIN B;  4GN5 A;  5IP7 H;  2B63 G;  1S5C D;  4WFN 3;  1XPU A;  3CP0 A;  1HZA A;  3H91 A;  1VF7 A;  4KJN A;  1WTP A;  1TWA B;  1EZ8 A;  4RMF A;  4JI0 L;  2PQE A;  4UPA A;  4DV5 Q;  5M5X H;  1EUJ A;  1HNZ Q;  2ZJQ A;  5KEE A;  3D8G A;  4BY7 H;  2O2L D;  4DR2 Q;  1PZJ D;  3U9O A;  4JI4 Q;  4DNT B;  5J39 A;  1IYU A;  3MTS A;  1JWS D;  4B9W A;  3S15 B;  1X56 A;  2BE5 C;  2HDL A;  1G91 A;  2WFW A;  5M5W H;  3W1B A;  2WKD A;  5IP7 G;  2MO0 A;  2JA7 H;  2EYJ A;  3K5O A;  2R93 H;  1LTI D;  3EJI A;  3A56 A;  1YZ6 A;  4LUZ A;  4DK3 C; 
#chains in the Genus database with same CATH homology
 4X3T A;  1LTG D;  3I4L A;  1XX8 A;  2AQ3 B;  5ELB A;  1CHP D;  3P75 A;  4KMU C;  4A3I B;  3C1E A;  1EOT A;  1Q90 A;  3DMU A;  4FF2 A;  3EFX D;  4BBS B;  1EWH A;  1B1Z A;  3TZU A;  3FKI B;  2SNS A;  2XWJ B;  2NN6 I;  4KV6 A;  1PZK D;  5IOC A;  1Q8I A;  2F0V A;  2O5I C;  2R92 B;  2B2T A;  4XDX A;  2IT1 A;  1ONL A;  3IFD A;  5K36 H;  4KY5 A;  2CVR A;  5E1F A;  1KNA A;  5CGK A;  2VNU D;  5BN5 A;  4O42 A;  2EPB A;  4QIW B;  5I4D A;  5EKL A;  1OXT A;  4OGQ C;  1IW7 C;  2WAQ B;  4H44 C;  1EWC A;  3GTP B;  1QE6 A;  1DM0 B;  3J81 E;  1EY8 A;  2WIN B;  5JPM C;  1L0Y B;  5K36 G;  4Z9C B;  1M8A A;  1I4P A;  4RCO A;  1AFP A;  4H13 C;  4KKU A;  4LAA A;  4L8J A;  5D14 A;  1XWE A;  1I4Q A;  3HS0 C;  4CHT B;  1HQR D;  5C3E B;  2C9O A;  4ULL A;  4EVO A;  1OXV A;  1HXY D;  1ENF A;  3C1F A;  3PO3 B;  1EY6 A;  3BVZ A;  4G57 A;  3RMH A;  5C4X B;  1ENA A;  1KAB A;  3DWQ A;  4XIG S;  1JB3 A;  1DOL A;  1STH A;  2WP8 J;  3SVM A;  1UEA B;  4CJ1 B;  3S2H B;  4K2L A;  4DA2 A;  5C0X I;  1VCI A;  5M3F B;  5C4H A;  1BF4 A;  1Z47 A;  3I73 A;  4H0L C;  3S1M B;  1BNZ A;  3QJY A;  1H9M A;  4A3D B;  3NSW A;  1PDQ A;  1STE A;  1LTR D;  5CC4 A;  4G7O C;  3VR4 A;  4BA1 I;  1ET6 A;  3TZD A;  2EZV A;  4FXK C;  2WV6 D;  1I6V C;  1EIH A;  2NWG A;  3GTJ B;  2RSN A;  3GP7 A;  3BVG A;  4KHV A;  4UDU C;  3KK7 A;  4A3K B;  1PTO F;  1WTW A;  2O5J C;  2EJG C;  1X3Q A;  3S2D B;  4I65 A;  5DNF A;  4S3S A;  2Q8I B;  2EY5 A;  2VUM B;  1JOK A;  3D4D A;  1B3A A;  3D31 A;  3E0J A;  4RA8 A;  1XYI A;  5I9P A;  4K5V A;  4HCE A;  4DXG A;  3FDT A;  4RGT A;  1D1K A;  5F2D A;  4EQN A;  1C4Q A;  3OWF A;  2L4N A;  2F0U A;  3TN2 A;  1U4L A;  2TMP A;  1A3U A;  3A8J E;  4C3J B;  5M9O A;  2G9H D;  1GOZ A;  1SFO B;  5D3I B;  5LHY 1;  3NUC A;  1A3V A;  2K05 A;  1QB5 D;  1HA6 A;  4TKO B;  5DAU A;  4A3M B;  3D6W A;  2KEE A;  2RSO A;  1G2S A;  1KDB A;  4HAE A;  3BG3 A;  1EEF D;  3NHH A;  3SEB A;  1EY5 A;  4QCL A;  4KN7 C;  1CA5 A;  1ILQ A;  1BCP D;  1EYD A;  2XN9 C;  4KI0 A;  3MVV A;  5C5L A;  2NVQ B;  2FFK B;  2ENB A;  5C0X J;  2A73 B;  4LMQ D;  2KJX A;  4GZY C;  2SDF A;  3GO5 A;  2QIL A;  3WDN A;  2QF7 A;  1ZYR D;  2B39 A;  5COR A;  4CKE A;  3Q24 A;  1CFM A;  3DXJ C;  1SE4 A;  1UAP A;  2X6L A;  4X3K A;  4A3G B;  4F87 A;  4PMB A;  3J7A V;  4IN3 A;  1V8Q A;  2JEB I;  2OT2 A;  1J9O A;  2EY2 A;  3IL8 A;  4C3J G;  4L6T B;  3TP8 A;  3L7Z C;  2RA4 A;  4ABN A;  2A6H D;  3HKZ B;  3GTM B;  2F0E A;  5CBA E;  3ND9 A;  1WTO A;  2YU9 B;  2PZU A;  4KD4 A;  1AN8 A;  2ZXP A;  1YNN C;  2B2W C;  3PO2 B;  4TSS A;  1IKM A;  4XYO A;  4XTC S;  5D65 A;  3S14 B;  1JQY D;  4DAY A;  2KUM A;  1EFI D;  3T53 B;  2Z1C A;  1SNQ A;  1TS4 A;  1JCK B;  4K6L A;  2DNC A;  3K0Y A;  3RUZ A;  2NYZ D;  2F3W A;  2F0F A;  3U9S A;  1EZ6 A;  1GUN A;  1MD2 D;  1FNU A;  5I6W A;  5DM6 3;  1BCP C;  1DOK A;  2N55 A;  3ERQ A;  3KF8 A;  2LFN A;  3Q22 A;  5C3W A;  5J1Z A;  3Q23 A;  1R4Q B;  2FJ2 A;  2EYP A;  4OHJ A;  2BA0 A;  2KED A;  2XVS A;  2SOB A;  3S17 B;  2FHT A;  1BCP F;  2ZXR A;  5FO8 B;  4G4K A;  5CV8 A;  1U4P A;  5JJZ A;  4BWG B;  5JVG 3;  1LAC A;  2DNE A;  3FEW X;  3TSS A;  4FYD A;  1B53 A;  2A6H C;  5IOD A;  1O7Z A;  4P2C B;  3PUV A;  1TVX A;  4XYQ A;  4F8M A;  4FNF A;  1EQT A;  1JWU D;  1EY0 A;  2OXP A;  4PNY A;  1G29 1;  2JE6 I;  5G3L F;  1YNN D;  1SNC A;  1Z7T A;  1F9R A;  4FO2 A;  2XRS D;  1UUP A;  2Z8L A;  2B63 B;  1LT4 D;  2XRQ D;  4HCS A;  1H9R A;  3NTK A;  1D1I A;  2NBF A;  3VYS A;  2JA6 B;  4NMZ A;  4HN7 A;  4KJO A;  2BOS A;  2F0L A;  1J8I A;  3J80 L;  1SYE A;  4XQJ A;  4IAL A;  1ZEQ X;  3P20 A;  4OO1 I;  1LO5 D;  2XNA C;  3T16 A;  3VA7 A;  3GTL B;  4K8I A;  3I4M B;  1E0B A;  5FLX E;  4IFD G;  3KLR A;  3DWP A;  3MAQ A;  2EXZ A;  5T1I A;  5EKK A;  3VR2 A;  5CV7 A;  1BBX C;  1BO0 A;  2XWB B;  1NUC A;  3KUP A;  1NR2 A;  1T5E A;  4HTH A;  5M5W B;  3VYR A;  3NQI A;  1PMR A;  1VDZ A;  2Z4I A;  1STG A;  5I2Y A;  1SND A;  1I50 B;  5FK9 C;  3SK4 A;  1H9S B;  3NPP A;  4N9P A;  3PIO 3;  3NE5 B;  2F0S A;  2F03 A;  1CQV A;  3VYT A;  4DK1 A;  3BDO A;  3OOC A;  2PPB C;  3MZ5 A;  4IUV A;  1TKW B;  1SMY C;  5I9O A;  2EY6 A;  4LJZ C;  4CKC A;  4Q5V A;  3K6O A;  1II3 A;  1JOO A;  2B8G A;  3NBH A;  1QG7 A;  1Z6H A;  5JPN C;  1Y8P B;  1LTB D;  4ZUI A;  1TT2 A;  3SDZ A;  4DK0 A;  1GXD C;  4YIJ A;  4RCN A;  3A8K E;  4R8I A;  1F2L A;  2AWO A;  1CI3 M;  3HOW B;  4IFD I;  4ZYS A;  1W6J A;  4DAV A;  1NSN S;  4O1N A;  4C1N K;  1JOR A;  4HSP A;  2AUJ D;  1SYC A;  4KTA A;  3M7G A;  1U4R A;  2B2T C;  1F9P A;  3MFG A;  2A6E C;  1Y8O B;  3K57 A;  4OIK A;  2EDG A;  2RQX A;  5T1G A;  3H6M A;  5C3X A;  4RHS A;  1PTO B;  5C44 B;  1D5X C;  5ELC A;  1F9S A;  4FXG C;  1MSH A;  2QEJ C;  4B9X A;  4ZK9 B;  5IGC A;  4F88 A;  5M3M B;  3HOV B;  3GTQ B;  1G6Z A;  3BVM A;  1VMP A;  3CRL C;  4CJ0 B;  1SJH D;  3GV6 A;  3GV3 A;  4V0B A;  1QCB D;  1HFG A;  4LK1 C;  1I6H B;  3JAM E;  3PUZ A;  5CV9 A;  3Q0A A;  4CJ2 C;  4CKB A;  2KA7 A;  4K5X A;  5I6Y A;  1DOM A;  1LTA D;  1BCP B;  5KGU A;  1EQV A;  2E75 C;  2F0I A;  2VB2 X;  3OMG A;  4X3S A;  2K01 A;  1S5D D;  4ILW A;  1GJX A;  4OO1 G;  3SE0 A;  3T4A C;  3QIA A;  5K5P A;  5IT9 L;  3E6Z X;  1O7L A;  3QB3 A;  3EVQ A;  4KN4 C;  5A35 A;  3C46 A;  4PMW A;  2DY8 A;  1ROD A;  1MSG A;  1SE2 A;  4JK1 C;  3ND8 A;  1SYG A;  1SYD A;  5M5Y B;  4ZKC B;  3OSO A;  5IIF A;  2EYL A;  3DWA A;  3HOZ B;  5IGB A;  1EY7 A;  2O4X A;  4TRD A;  4IZ8 A;  1BR9 A;  3CQZ B;  3M85 A;  1I4R A;  1WD1 A;  1F77 A;  4A3J B;  3K5L A;  1T5X D;  1ILP A;  2B2U C;  4U67 3;  3MXU A;  2QDB A;  3MXP A;  4Q0F A;  1QNK A;  2G9D A;  1V43 A;  3SK6 A;  1RJT A;  2JA5 B;  4IUR A;  1TWF B;  2RDF A;  1I4G A;  1KLU D;  1C48 A;  3HOU B;  1KDC A;  4C56 C;  3FPU B;  1S5F D;  1PFB A;  2BDO A;  4U68 A;  1PRT B;  1AW7 A;  2ID0 A;  1HTP A;  2NZ1 D;  2KVM A;  1EEI D;  4IFD H;  4RGN A;  2E74 C;  3MWY W;  1CK1 A;  3QOJ A;  2JA7 B;  2F0M A;  5FKA C;  1HUN A;  1JWM D;  1Q3L A;  3IKJ A;  3CHB D;  4K5W A;  2HQE A;  4FP5 D;  4Y7N B;  1WTR A;  3DHQ A;  1I3Q B;  5CV6 A;  2FMM A;  5KNB A;  2EY1 A;  3RD4 A;  4IUT A;  2MPM A;  1AP0 A;  2IPK D;  4J6H A;  1SEB D;  2YYZ A;  4ME5 A;  4RH6 A;  5CV4 A;  2F4I A;  1TS3 A;  2RKS A;  4C3H B;  2B8F A;  4DXF A;  2PCF B;  1HCZ A;  2K33 A;  1FNW A;  2E2I B;  4PMC A;  3K58 A;  5EPK A;  2K28 A;  5NUC A;  1PZI D;  1GHJ A;  4KY7 A;  3SR1 A;  3OMC A;  3OWE B;  2D5D A;  4G7Z C;  2N88 A;  4ZAI A;  1LAB A;  4FF4 A;  5DM7 3;  1RTN A;  1O7Y A;  1RKN A;  5ELF A;  1KTK A;  2WII B;  4CGY B;  1CQF A;  2DN8 A;  4TQU S;  1DXM A;  1X32 A;  3TME A;  1JE4 A;  5TSS A;  3QO2 A;  5C4Z A;  3LWU A;  1TS5 A;  3ITP A;  5DEH A;  1DD2 A;  3P7J A;  2L11 A;  5EKI A;  1D2B A;  1SYB A;  2IJ0 A;  4NW2 A;  5A2Q E;  1F2Z A;  2BDN A;  2L0C A;  2JXM B;  1Y69 U;  3OHX C;  2EJF C;  2NVT B;  4B08 A;  4QUF A;  1OXU A;  3K5N A;  4RGO S;  1Y8N B;  2A69 D;  2JSO A;  3J7Y W;  2GA4 B;  5CMD A;  3NWT A;  1GUW A;  4BY1 B;  3M4Y A;  5J22 A;  4A93 B;  5KYI A;  1K8O A;  5EBD A;  3NWS A;  4XQQ A;  3G6J B;  1F2Y A;  3DEO A;  3V2T A;  2PMZ B;  4RHR A;  4ODG A;  2A5H A;  1D5Z C;  2SNM A;  1D5M C;  1LLR D;  1PFN A;  4RFB A;  3WOE A;  3M3Y B;  3DM1 A;  5M5X B;  2F0T A;  3GTO B;  4MN3 A;  5IGF A;  1KNE A;  3NTH A;  1LV9 A;  5ELE A;  2ICE C;  1FNV A;  1LT3 D;  1RCV D;  1EYA A;  3BYY B;  2LY7 A;  3DEP A;  3QG1 A;  4J1M A;  3MA2 B;  3TP7 A;  1R9T B;  1WD0 A;  1ESR A;  4OO1 H;  3MEH A;  4RKB A;  3J7A F;  1WTQ A;  4HSV A;  4OIJ A;  1HPC A;  3MXG A;  4V19 0;  4QUC A;  1PRT F;  1SNP A;  1TU2 B;  1RF2 D;  3HG9 A;  4CBV A;  1EY9 A;  2RVL A;  4FVM A;  3C2P A;  4KHZ A;  5E4W C;  5FOB B;  1IYV A;  5JVH 3;  2D9U A;  3CKI B;  2A68 C;  1ICW A;  5JOB A;  2MHV A;  5EPL A;  2B2U A;  5C0X G;  3LX0 A;  1PFM A;  4HED A;  2HDM A;  3PV0 A;  1H9K A;  5FO9 B;  1WTX A;  2HCC A;  1U4M A;  1ET9 A;  1AEX A;  2K5W A;  1I4X A;  1NCV A;  3S9W A;  2K32 A;  3PUW A;  2F0W A;  4EQP A;  2F1M A;  4DF7 A;  3S1R B;  2JYO A;  3NP8 A;  3MHB A;  1PXU A;  1LT6 D;  2R3Z A;  3R8B A;  1G2T A;  1S5E D;  2LS0 1;  1JOQ A;  2D62 A;  4HR7 B;  4KKS A;  2QCP X;  1A6X A;  5C0X H;  2JA8 B;  3K7A B;  3JAM L;  4J8Q A;  5G3L D;  3HOY B;  3R2T A;  2ZXO A;  1Q1E A;  3SHL A;  2XSC A;  3EQL C;  2IX0 A;  2Z4H A;  1ML0 D;  2CQA A;  2EYO A;  1PTO H;  1EY4 A;  1IHZ A;  3W3A A;  2PZT A;  2CHB D;  3J80 E;  2A69 C;  1VF5 C;  3MXN A;  2LMC B;  3QWN A;  1HA5 A;  1SYF A;  3PUY A;  4XT1 B;  1HRJ A;  1DZ1 A;  2KOL A;  3D3R A;  3HP3 A;  2CW0 D;  1VMC A;  3VR6 A;  4IUU A;  1B4O A;  1B2T A;  4DN4 M;  2OEO A;  2Q8T A;  2Q8R E;  1H9S A;  2NUC A;  1PRT C;  1G8Z D;  2F0J A;  4WOR A;  1MBY A;  2NN6 G;  2NVX B;  2EYM A;  2MGS A;  1AZP A;  4EQO A;  1OXX K;  3S16 B;  1HTL D;  3ERO A;  1W6K A;  1GHK A;  2HCI A;  1AZQ A;  3A54 A;  1B50 A;  2BE5 D;  5FO7 B;  1M4V A;  1RD9 D;  3NXW A;  4IQZ A;  2L55 A;  3IFT A;  2F3V A;  3KLS A;  3CU7 A;  1Q12 A;  2NN6 H;  2B2Y A;  2M2L A;  1D6E C;  5FLX L;  1YNJ C;  3V05 A;  3NK9 A;  1X3P A;  2IX1 A;  1NR4 A;  2I46 A;  3FRP B;  3RZD B;  2JEA I;  3HZX A;  1JIC A;  1BOS A;  2PW5 A;  1ZYR C;  2V4D A;  1OO9 B;  2F0K A;  2K5Q A;  2RDG A;  2AUK A;  1LTS D;  1CZG A;  5BN3 A;  5KIX A;  2F0N A;  3HOX B;  3GD7 A;  1I4H A;  2B2V C;  1Y1V B;  5LL6 S;  2EYH A;  2F0G A;  2E76 C;  2DY7 A;  1A2T A;  3NQT A;  1BXT A;  5C5M A;  2QKI C;  2WKC A;  2IL8 A;  4K6D A;  3G7L A;  1SE3 A;  1IW7 D;  3BS1 A;  3W2D A;  1A15 A;  2LKV A;  4FXD A;  4IUP A;  4UAI A;  2NTS A;  2MP1 A;  2EVB A;  3A7A B;  3HGB A;  2HUG A;  5KNC A;  3T51 B;  5CV5 A;  3BZD B;  5IGG A;  3O13 A;  5CR3 A;  2K03 A;  4FF3 A;  3I90 A;  1STB A;  3HEJ A;  2B2Y C;  3BDC A;  1ZXT A;  1SDF A;  1QWY A;  3R3O A;  5KYL A;  3LNN A;  3X3M A;  3RLF A;  5AFW A;  5BN4 A;  5A2Q L;  2KHS A;  1WTV A;  3VR3 A;  2F0D A;  5CYU A;  2EJM A;  3LWE A;  2B2W A;  1RDP D;  2L12 A;  2IX3 A;  3M4O B;  3I4N B;  1PTO C;  1HUM A;  4I7Z C;  4E6I A;  3URY A;  2F0P A;  5JEA H;  3OPO A;  1GUO A;  5EQ0 A;  1LTT D;  4IUQ A;  4BY7 B;  1EIG A;  5E3F A;  5EPJ A;  3TP5 A;  2X6G A;  5EBC A;  1TQO A;  2XIW A;  2SEB D;  1O78 A;  3I91 A;  1SXT A;  5EGT A;  2J0T D;  1PYW D;  2AWN A;  1PLF A;  1OXS C;  3HRZ C;  1S4Z A;  3K5M A;  4PV1 C;  5JEA G;  2A6E D;  5KRU A;  2C5C A;  1F9Q A;  3E5S A;  5D3D A;  4QF4 A;  1Y1W B;  3K59 A;  1O80 A;  2AQ1 B;  3EA6 A;  4RKL A;  1PRT D;  3SXH A;  1HHV A;  3VYU A;  3DUZ A;  3H09 A;  4DFA A;  4WRD A;  1DJR D;  3R2I A;  1V1O A;  4RAU C;  3MC0 B;  1Q1B A;  3AB9 A;  4HMI A;  3V96 A;  3PUX A;  4FF1 A;  1JR0 D;  2WB1 B;  4MIU A;  3I3C A;  1TWC B;  2H1E A;  3T13 A;  3I72 A;  3WOF A;  1TR5 A;  1NAP A;  4R8N A;  1E2W A;  4NDX A;  3IAY A;  1U9R A;  4F7X A;  1CTM A;  1C8C A;  3FVQ A;  1K8M A;  2H4O A;  4RWS C;  3A8I E;  1ZKO A;  2EE1 A;  1K83 B;  2B2V A;  3X3N A;  5KND A;  1L0X B;  5COY A;  4KK7 A;  1LT5 D;  4KY6 A;  4L63 B;  2J7Z A;  4MHE A;  3F2U A;  1ESF A;  3AU7 A;  3N6R A;  5E4X A;  2PZW A;  3BYT B;  1S5B D;  1GUS A;  1WCM B;  4BBR B;  1ENC A;  4M1U B;  2NB0 A;  3GTK B;  4XXE A;  2E2J B;  4KKT A;  4NP5 A;  2X69 A;  1KLG D;  1B9N A;  1TWG B;  4N9T A;  3I70 A;  1FD7 D;  1F2M A;  3NTI A;  4KD3 A;  4DAP A;  4ID6 A;  4A3F B;  4K8J A;  3A7L A;  4X3U A;  1CT1 D;  2D2C C;  2R7Z B;  1STY A;  3AMU A;  5C4J B;  4JBW A;  1BDO A;  4PQX A;  1RHP A;  5EJW A;  1SJE D;  2K04 A;  2R6G A;  4BS9 A;  4G7H C;  1B44 D;  1RTO A;  4H7B A;  4BA2 I;  4ZQ3 A;  2EOT A;  3OW7 A;  1PTO D;  1UNS A;  1IKL A;  1SNO A;  2JP1 A;  4IFD J;  3FMC A;  1IL8 A;  3H0G B;  1TY2 A;  4C3I G;  5IGD A;  2A68 D;  4XT3 B;  3SK5 A;  3FPP A;  5CBE E;  1KAA A;  1TWH B;  2R61 A;  1FGB D;  1QIL A;  2BCO A;  1EYC A;  5HGT A;  2K1B A;  4IUN A;  3H3V C;  3L3O C;  2FMC A;  2TSS A;  4QB4 A;  3QOL A;  1SNM A;  3TBI B;  4XQN A;  2EYF A;  3VA5 A;  4ZLT F;  2PW7 A;  2VB3 X;  2L5T A;  3I8Z A;  1MI2 A;  2KEC A;  4DU9 A;  4AYB B;  5JEA J;  1GUT A;  3KLS X;  3NBI A;  3KBX A;  2ZT9 C;  5LL6 X;  1HQM C;  4NKL A;  1XTC D;  2F0O A;  1EL0 A;  1TS2 A;  3C3L A;  1HFN A;  3PIP 3;  3P1H A;  5IGE A;  1EU4 A;  2A74 C;  3GTG B;  2KCC A;  1MGS A;  4C1N I;  5I2X A;  3S1Q B;  2IWH A;  2NVY B;  1A2U A;  5ELD A;  1FR3 A;  4OL7 A;  4A3E B;  1XXG A;  2NTT A;  3L9A X;  4C3H G;  1CM9 A;  2L1B A;  1E2Z A;  2K5D A;  3KBG A;  3N52 A;  2M9V A;  2J4X A;  2M00 A;  4M8A A;  1QNU A;  2AQ2 B;  1YNJ D;  2KQ3 A;  4WJW A;  5C6A A;  2Y0S B;  3TP6 A;  2K6A A;  3D4W A;  1JC7 A;  5IT9 E;  3UI2 A;  1DYQ A;  3GQB A;  1CHQ D;  2PO4 A;  4QMG A;  1SBB B;  2BA1 A;  2IW3 A;  4A3B B;  4DGZ A;  2PYK A;  3RZO B;  1V1P A;  1QOH A;  2RBM A;  4ZRZ A;  2PNR C;  2OF1 A;  3H94 A;  3A55 A;  2F0Q A;  1SAP A;  1QJO A;  3VR5 A;  1WVL A;  3CRK C;  1DON A;  4HMJ A;  1DCZ A;  3D4R A;  2ICI A;  4EGV A;  3ONA B;  1SSO A;  2E2H B;  2F0H A;  2R93 B;  1CZW A;  5JAV A;  3Q6S A;  4C2M B;  1SMY D;  3OIQ A;  1V1P B;  5ISR A;  4RGM A;  4C3I B;  1STA A;  1TY0 A;  3OIP A;  5HUR A;  2K7V A;  1EU3 A;  1GUG A;  2I07 B;  3ZYY X;  2MJ8 A;  4K14 A;  1TII D;  1KDA A;  2RDH A;  3T56 B;  3PMF A;  3S1N B;  3J81 L;  1BQQ T;  1R4P B;  1FYC A;  4ZKB B;  3D6C A;  4K2K A;  2L9H A;  2MUY A;  1B9M A;  1STN A;  4ZUJ A;  2KCN A;  4R9W A;  3R93 A;  2CW0 C;  3M7N A;  3SK8 A;  1H9J A;  2VXW A;  2E2D C;  1E2V A;  3MFY A;  1A3T A;  3BDL A;  4DNR B;  3TDQ A;  2WAC A;  1CA6 A;  1BUV T;  2FIN B;  1S5C D;  4WFN 3;  3H91 A;  1VF7 A;  4KJN A;  1WTP A;  1TWA B;  1EZ8 A;  2PQE A;  5KEE A;  3D8G A;  2O2L D;  1PZJ D;  3U9O A;  4DNT B;  5J39 A;  1IYU A;  3MTS A;  1JWS D;  4B9W A;  3S15 B;  2BE5 C;  2HDL A;  1G91 A;  2WKD A;  2EYJ A;  3K5O A;  1LTI D;  3EJI A;  3A56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...