1SR3A

Solution structure of the heme chaperone ccme of escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
LRSNIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEKGNHILAKEVLAKHDENYTPPEVEKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APO-CCME
publication title NMR Structure of the Heme Chaperone Ccme Reveals a Novel Functional Motif
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 14
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sr3A00
1L1OB 2AMCB 1L1OA 1OXXK 1IXRA 3KF8B 2IX1A 1L0WA 2ZTCA 4DR7Q 3I4MH 1KRSA 4GS3A 3GTKH 4QQBX 3S17H 4A3LH 3M85A 2HIVA 1YBYA 3S24A 4Y7NH 4LF7L 2B63G 2OTJA 3K7UC 3PO2G 1IYJB 4LF9Q 4GLAC 2NVYH 4UP7A 1E3PA 5LMUL 2HT1A 1Y1WG 1K73C 5IT9c 1J5EL 1UE6A 3I4NG 4RMFA 3PIPA 2UU9Q 2K5VA 1FL0A 4B3RL 1IBMQ 2F4VQ 4OO1G 1WI5A 5IYCH 4GKKQ 4X65L 3TS0A 3I7FA 3AYHB 4LF5L 3OW2A 2CWAA 4GOPC 1XTDA 4XIGS 4LF4Q 1KHIA 3FP9A 2R92H 5IYDH 3M9BA 4IO9A 3L0OA 3JAMc 2JEBI 4A3EH 3H15A 2JA6G 5M3MH 4P74A 1OTCA 2K75A 4JC0A 5IP7H 4NXNL 1PFSA 3ER0A 4DR5L 1TWFH 3HOXH 2LSSA 3GTPH 4TQUS 1Q7YC 2R93H 3BJUA 5LMUQ 1VQKA 4LFBL 1VQLA 1V43A 1JT8A 1VQHA 4DK6C 2WB1G 4UP9A 1J5EQ 1K83H 3CF5A 4ME3A 2BH8A 4B3RQ 2OWOA 4O2DA 4DV3Q 2K5HA 2ZTEA 1PH9A 1KIXA 3DM3A 4DV4L 3DLLA 1VQBA 4DV6L 1YITA 1TXYA 1A62A 2NVXH 4LF5Q 5C44G 3Q8DA 1HZBA 2PI2A 4PMWA 1W2BA 3CQZH 1FJGL 3GTQH 4WJ4A 1LTLA 1PHJA 4DUYL 2R7ZG 2K52A 5GAGC 2KCMA 2JA7G 2E2IH 3GTOH 2N49A 1EFWA 1PYBA 4A75A 3PF5A 4O0AA 5BR8L 4LUVA 4NXNQ 4BY7G 1V9PA 5IP9G 5FJ8G 4DR5Q 5DLQE 3CPWA 2Q2IA 4JI4L 2E5LL 3HOZH 2PI2E 5IY0A 4HJ7A 3J81i 1XPUA 4IJLA 4LFBQ 2MO0A 1BKBA 2GN5A 3STBD 1D8LA 1VQJA 3PUWA 5C4XG 1XMOL 4DK3C 4AYBE 4KI0A 3T1YL 3EBEA 1SROA 3CCQA 3L7ZC 3PGZA 4DV4Q 1Q81C 2D0OA 2I5MX 2YV5A 3D0FA 2LXJA 4OX9L 3NENA 3CCVA 1SR3A 5FLMH 1NMFA 4DR6L 2LXKA 4P73A 1M1KC 1FJGQ 2K4KA 1X3FA 3PF4A 4DUYQ 4A3FG 1TWCH 1I6HH 1YEZA 1K0RA 1XPRA 4A3GG 2HIXA 1EUJA 5BR8Q 1S3OA 2NN6G 5AJ3L 3EIVA 2JA9A 2VL6A 4JI4Q 3HKZE 3JC66 2E5LQ 2B3GA 4UP8A 1GD7A 4X66L 4GKJL 1PYSB 2WAQE 3CPFA 2KHJA 3AFQA 4JI8Q 1GM5A 3A0JA 2ASBA 1G291 5J3BA 4AIMA 1Y1VG 1WJJA 4A3JH 1XMOQ 3A5ZB 4GN5A 4A3CG 1JJCB 4DR3L 3T1YQ 1Q46A 1SE8A 5M5YH 3CC4A 2Z6KA 4P72A 1VS0A 4OX9Q 3L2PA 3U50C 3KYHC 2K5NA 3KJPA 4A3KH 2YTVA 3CCRA 3A74A 4YCWA 5GAHC 1YJ9A 2ZJQA 4RG1A 4BXXG 3CC2A 3KLWA 3D31A 4OO1I 2JE6I 4JCVE 4P75A 2IX0A 5AJ3Q 3RNUA 2CCZA 5JJKA 2WP8J 4GN4B 4IPGA 1N33Q 4WJ3M 3CXCA 2IT1A 1CKNB 2OQKA 1CKNA 4FDBA 2KENA 4IPHA 1HNZL 1GKHA 4L5RC 4GKJQ 1KXLA 5IYBH 4YHHL 1X56A 4A3DH 1VQPA 1X9NA 2VY3A 3PIOA 4HIOA 4BBSG 2H5XA 1VQ6A 3K80C 4DR3Q 1SFOH 1NMGA 1AH9A 1MIUA 3PV0A 3E9HA 3S1RH 1M90C 4JI3L 3K7AH 4HJ5A 1X6OA 4BBRH 1PVOA 4A3LG 1UE5A 4DPGA 3OTOL 4IJHA 2ES2A 2ZJRA 1HZ9A 1Q12A 5E7NA 4A3BG 2E8GA 2DGYA 3CMEA 3G71A 2UXBL 3K8AA 4UPAA 4A3MH 2HQLA 2AHOB 1T9HA 2JA8H 2Z6KC 4HIDA 3GTLH 4JG2A 1N36L 1PH6A 2PQAB 2PQAA 4PZ6A 1GVPA 4DV3L 3HOYH 2N78A 3M3YH 2KHIA 1HNZQ 2CWPA 2A19A 4YHHQ 1JJ2A 1N32L 1P16A 3ERSX 2OQ0A 1QVCA 3ULJA 4JV5L 2PNHA 4DV5L 1WOCA 2B63H 3G48A 1CSPA 2KCTA 3GTGH 1EQRA 2I0QA 4C3JH 1S40A 4JI3Q 5M5XH 4LUOA 1VQFA 4MTNA 3AFPA 3B6YA 4PZ7A 1Y1WH 4B3TL 3OTOQ 1QZGA 3I4NH 4A4IA 3F2DA 3H0GG 2V1CC 1G6PA 1Z9FA 2R93G 2UXBQ 2QA4A 3CAMA 2Q2UA 1HR0L 3E0EA 4A93G 1L1OC 3TS2A 4PZ8A 1UEBA 4GNXB 4GNXA 3NBHB 1VQMA 1N36Q 2Y0SE 1BBUA 1HJPA 2DUDA 1K9MC 1YHAA 4JI5L 3W1BA 1EIYB 2HHHL 1N32Q 4DNIA 1VQCA 5IWAL 4JBKA 4JV5Q 1X65A 4DV5Q 2JA6H 1IL2A 3ICEA 4TVAB 1OXTA 1QUQB 1QUQA 4JOIA 3BZCA 4JBWA 3KDFB 4EX5A 2A1AA 3KDFA 1QZHA 4LUZA 1XNQL 2R7ZH 5LMNW 2YTYA 2NN6I 3RLNA 3K81C 4YWKA 1MKHA 5GAEC 5JEAJ 3STBC 2A8VA 4IFDG 1E7ZA 1CKMA 3VDYA 2BA0A 4B3TQ 2VW9A 5EAYA 1UE1A 1VQEA 3G4SA 4Y52H 1ASYA 5GADC 3HOZG 1VQ8A 1PV4A 1HR0Q 1YIJA 4JI8L 3G6EA 2RCNA 4OWXB 1PH8A 3S15H 5C44H 2AWOA 3J80i 1FVIA 3FKIH 3ULPA 1VQ4A 1HZAA 1Q86C 1DGSA 3PUXA 2I5HA 3I4OA 3PO3G 4JI5Q 5C0XG 2NVQH 1N34L 1XPOA 2HHHQ 3F2CA 5M3FG 5IWAQ 1WCMG 1XJVA 3I2ZA 4BY1G 3UE0A 1J6QA 4UY8C 4X62L 5ELOA 4C3IH 2JA5G 2UUCL 1XNQQ 4BY7H 4R4OA 2CFMA 2WFWA 3RZOH 4POGA 4XTCS 4DR4L 4OWWB 2BA1A 2EQSA 4HJ8A 1PH5A 1K8AC 3J7ZC 1OXSC 1B70B 1JMCA 1A0IA 1N33L 1EYGA 1UWVA 1JE5A 2MQHA 3NEMA 2CQOA 2VQEL 2VQFL 2WB1E 1L2FA 5C3EG 4HIMA 1MJEA 3GTMH 1EWIA 4DAYB 4LFCL 4JOIC 1I5FA 4GN3B 4LWCA 1VQIA 2QGQA 3HOWG 2FXQA 1HNXL 1I50H 1Y14B 4LFAL 1O7IA 2C35B 1NTGA 2GVBA 3HFZB 4JI1L 3RR5A 1R9TH 2BH2A 1E1TA 1X3EA 3S1NH 4A3FH 1E22A 4NXML 1N34Q 2OTLA 3UDFA 2B29A 4X62Q 4A3GH 2VNUD 1PH4A 4LNQA 1N9WA 1PH1A 2UUCQ 3FHWA 4P71A 1I3QH 1UE7A 4IFDJ 4QL5A 3CMAA 3HOUH 1CKOA 4DR4Q 3W5OA 1YZ6A 2D62A 1Q8KA 3CP0A 3M7NA 3HOVG 1SLJA 4KHZA 3RLOA 3KJOA 4JI2Q 2VS1A 1Y1VH 4PG3A 1YJWA 1KRTA 3UDGA 4A3CH 2VQEQ 2VQFQ 2AWNA 4DV2L 4LFCQ 4GLXA 5IYBG 2VUMG 5K36G 4NB3A 2N8NA 1B7YB 4DR1L 3GO5A 3CCJA 1S72A 4LFAQ 5C0XJ 1HNXQ 1JJGA 2UXCQ 2F52A 4JI1Q 2I5LX 1QVFA 1X3GA 3I4MG 2ZTDA 1VQAA 4L5TA 1KC8C 2UUBL 4NXMQ 2YU9H 4A3IH 1WYDA 4BXXH 2AKWB 4YWLA 1MJCA 4DV0Q 3S2HH 2F3IA 4QIWE 1XNRL 5JEAG 1PH3A 2R7FA 4KHPL 1XMQL 1C7YA 1LUZA 1VQ5A 5GROA 1NJIC 2ATWA 1N8RC 4IPCA 3CCMA 1YVCA 4POFA 1Z47A 1I94L 3F8TA 2JA8G 4R4CA 3S16H 4BBSH 2NZHA 4DV7Q 5IYCG 5C4JH 1X54A 4DV2Q 4K0KL 4X64L 2ZM6L 1HNWL 4DR1Q 1LM0A 1OXUA 3J81j 3M4PA 4EQ5A 3EN2A 3I55A 1D7QA 3KF6B 2PMZE 3KF6A 1CSQA 2E2JH 3A5UA 2R92G 4KLKA 5IYDG 4OXPA 4C2MH 2UUBQ 3PO2H 4A3BH 2ZJPA 4IFDI 1VQNA 4IPDA 4A3EG 3CCEA 3PUVA 5M3MG 3OYYA 1E1OA 2XTIA 5IP7G 4IOAA 3TEHB 1XNRQ 2QEXA 3BU2A 4QGUA 3HOXG 4KHPQ 2EIFA 1QVGA 1XMQQ 3LGJA 3GD7A 4APVA 4AQYL 4B3ML 4AYBG 1G51A 4QY7A 3CCUA 3E9IA 4HJ9A 4YY3L 3S1QH 1I94Q 4L5SA 3H3VI 5JJLA 4L5QA 4DR2L 3TQYA 5C0XI 4HJAA 1KAWA 1PA6A 1H95A 1U5KA 5HGQA 2RF4A 3TRZA 1HR0W 4K0KQ 1IZ6A 3I56A 4X64Q 2ZM6Q 1HNWQ 2IHEA 4BA1I 4DUZL 3CCLA 4JI0L 1RL2A 2Z0SA 2YYZA 3AQQA 3RN5A 4LF7Q 2CKZB 4ALPA 2K14A 2UXDL 2JQOA 3J81c 3BZKA 3H0GH 3HKZG 3JAMi 3PSIA 3S14H 2MFIA 2N3SA 1K8GA 4A93H 1NE3A 2WAQG 1VQGA 3J80c 3UDXA 3J7A5 2L15A 4OWTB 3T1HL 3ZJYC 1Q82C 3KFUA 1PH2A 1VQDA 4AQYQ 4B3MQ 4X65Q 2JEAI 3S2DH 1TWGH 1KL9A 1PH7A 4YY3Q 5LMNL 5GQOA 1P8LA 1IBKL 4YWMA 3HKSA 3F2BA 4DR2Q 3FKIG 2XGTA 2Q2TA 4HIKA 1KD1C 4JI6L 4X6AH 3U4ZA 4DV1L 1X55A 2JA7H 4DUZQ 4JI0Q 2GVAA 5M5WH 5FLMG 4A76A 1TWHH 3AEVA 3TREA 5FJ8H 5IP9H 2UXDQ 4JYAL 5JJIA 4GNXC 1HZCA 4DKAC 3M4QA 3PUZA 1SN8A 5FLXc 4R4IA 2YTXA 5C4XH 1NY4A 4JI2L 3T1HQ 2UUAL 5IE8A 3GDEA 1YI2A 2IY5B 3RN2A 1AE3A 4NPSA 4JI7L 3MEFA 4LW1A 2RHQB 3H3VH 1IBLL 3PO3H 2JK8A 3U4VA 3CCSA 1OXVA 4DV6Q 5LMNQ 3IRBA 1AE2A 5M3FH 4A3JG 1WCMH 1IBKQ 1LYLA 4BY1H 2RHSB 2VZAA 1ASZA 2UXCL 3M4OH 5H1SE 4R4QA 2JA5H 1JB7A 4MZ9A 4IOCA 4JI6Q 3PCOB 4DV1Q 1C9OA 3ULLA 3U58A 1VCIA 3UDIA 3GTJH 2IHFA 4DV0L 1Q1BA 2EXDA 4QJFA 4DAMA 4A3KG 3W1GA 1KQSA 1BBWA 2MO1A 1VQOA 4B3SL 1RIPA 2ALYB 4MNOA 4JYAQ 2D0PA 3HOUG 4LF8L 2JJQA 2K50A 1VQ9A 1A8VA 4C3HH 3K0XA 1TWAH 5C3EH 2MNAA 2ID0A 1GO3E 4LF6L 2E2HH 5HY6A 2OCEA 1FGUA 4H02A 1YHQA 2UUAQ 1SMXA 1EOVA 3RLFA 4DV7L 4JI7Q 3HOWH 2R7DA 1Q1EA 1WFQA 4J15A 1IBLQ 1V1QA 4BA2I 4DR7L 4A3DG 3F1ZA 3CC7A 1K3RA 1SRUA 3UE1A 1CUKA 2KBNA 1B8AA 4DR6Q 4YCVA 1EIFA 4R1JA 1W3SA 4GOPB 4GOPA 1C0AA 3MXNB 3KOJA 4AH6A 4GLVB 3PUYA 4A3IG 4BBRG 1YJNA 3CW2C 4LF9L 1NBWA 3CD6A 1YHBA 3HOVH 1E24A 3S1MH 2NZOA 4YCUA 1VQ7A 2UU9L 4B3SQ 3SGIA 5ELNA 3WWVA 2R6GA 2Q2HA 1IBML 2F4VL 4LF8Q 4GKKL 4JBMA 4A3MG 1HH2P 2Y0SG 1YNXA 4X66Q 2NVTH 1A63A 1U0LA 3RZDH 3NELA 4LF6Q 2VUMH 1EQQA 4LF4L 1BVSA 3HOYG 4R4TA 4OONA 4JBJA
chains in the Genus database with same CATH superfamily
2AMCB 2IX1A 4X3KA 3I4MH 4GS3A 1L0YB 3GTKH 3S17H 3QB3A 2HIVA 4LF7L 1PFBA 1UEAB 3PO2G 2O2LD 1SYEA 4LF9Q 2NVYH 2HT1A 1CT1D 1PTOH 3BS1A 4RMFA 1CQFA 1FL0A 1IBMQ 2J0TD 1AZPA 4X65L 1EWHA 3TS0A 5DM63 2NWGA 4U673 3S1RB 3OW2A 1CFMA 3K59A 2K03A 1PXUA 3R3OA 4L63B 5HGTA 4Y7NB 1YNNC 2SNMA 3NP8A 1ZYRD 5IYDH 4IO9A 3L0OA 5AFWA 3TP5A 1XWEA 4NXNL 2JSOA 2JA8B 1CM9A 1LT6D 1ESRA 2I07B 3DWAA 1PMRA 2R93H 3FMCA 2VXWA 1VQKA 4LFBL 1F2YA 4DK6C 2WB1G 2VB3X 4UP9A 4ZKBB 1J5EQ 3CF5A 4ME3A 2OWOA 4XQNA 4DV3Q 2K5HA 1PH9A 1KIXA 4LF5Q 1FGBD 1VQBA 4PNYA 4DV6L 1TXYA 1YITA 5C44G 5M3MB 2PI2A 3SDZA 1EEID 3NPPA 4DUYL 1S5BD 3HOXB 5GAGC 2KCMA 1TQOA 3GTOH 4AYBB 4LJZC 2N49A 1EFWA 1RKNA 4BY7G 1V9PA 5DLQE 1TY2A 2Q2IA 1UAPA 2Z4HA 2E5LL 4JI4L 4HJ7A 1XPUA 1IKMA 2NVXB 3PUWA 3U9OA 4DK3C 1XTCD 1O7LA 2JYOA 1PTOC 4C1NK 2E2IB 2YV5A 3CCVA 5T1IA 1NMFA 1STYA 2EYMA 1FJGQ 2N88A 5ELDA 5FK9C 1TWCH 4G7HC 1I6HH 1XPRA 2Q8IB 3I72A 2QDLA 1SMYC 2HIXA 2F0LA 3LWUA 5C44B 2VL6A 3HKZE 2B3GA 4UP8A 3FKIB 4KKTA 2DY8A 3P1HA 1VDZA 2M2LA 2KHJA 3AFQA 4JI8Q 1ICFB 3A0JA 4A3JH 1V1OA 3A5ZB 1JJCB 2IX3A 3T1YQ 1YNJD 3RUZA 1ET6A 4OX9Q 2EOTA 3T56B 2K33A 4A3KH 2V4DA 3A74A 1YJ9A 2RA4A 3CC2A 2RDHA 4OO1I 1WTXA 4NW2A 2JE6I 3RNUA 4WJ3M 3CXCA 1R9TB 3PMFA 5CC4A 4IPHA 3SXHA 2KENA 3RD4A 5K36H 1CZWA 1X9NA 1QOHA 2DNCA 1SFOH 3HRZC 4RHRA 4DAVA 3S1RH 1Q90A 5E4WC 3FPUB 1PVOA 3TZDA 4A3LG 1PLFA 1UE5A 4DPGA 3KLSA 2XRQD 4A3BG 2K32A 4RGMA 1H9SB 1TS5A 1H9SA 2UXBL 3NTIA 3S9WA 4A3MH 3A8JE 2JA8H 2Z6KC 1H9JA 5KNDA 1N36L 1PH6A 4ZUJA 4L8JA 2K7VA 1DCZA 3EJIA 2CWPA 1HPCA 1N32L 1P16A 3ULJA 3MTSA 4DV5L 2B2YA 1EY7A 4J8QA 4BWGB 1CSPA 2KCTA 1EQRA 4KMUC 2KOLA 4FXDA 2CH4A 1Z6HA 3AFPA 4PZ7A 1I4PA 3A54A 3Q0AA 3H6MA 3F2DA 3ZYYX 2V1CC 1G6PA 1Z9FA 5C4JB 3HS0C 3E0EA 1QCBD 3D4WA 2F03A 3KLSX 4R9WA 1STAA 2B63B 1K9MC 2XVSA 4JI5L 3W1BA 5M5XB 1GUOA 4JV5Q 3H91A 3I4NB 3BZCA 4TSSA 4LUZA 4YWKA 2MUYA 3STBC 1E7ZA 2CHBD 4Y52H 3G4SA 1KDBA 4ID6A 1SNQA 5GADC 3HOZG 5FO8B 3WOEA 1HR0Q 2R3ZA 5C44H 1H9RA 3FKIH 2EDGA 2I5HA 3I4OA 2K5QA 5C0XG 2NVQH 1KDAA 3VR3A 4L6TB 5M3FG 5IWAQ 2ICIA 4K2LA 4TRDA 4X62L 5ELOA 2JA5G 4BY7H 1LTID 4DR4L 4OWWB 1PH5A 2FFKB 2K1BA 3QOJA 1PRTC 1JMCA 1A0IA 1CK1A 4G7OC 1UWVA 1EYAA 1D1KA 2VQEL 3T53B 5E3FA 4HIMA 2NUCA 3GV6A 1PRTD 2FXQA 3Q22A 1R9TH 4K5VA 3T4AC 4C56C 4FP5D 1X3EA 1E22A 4NXML 3URYA 2L4NA 1SE2A 1N9WA 2KJXA 1BCPC 5C4XB 4QL5A 3VYUA 3CMAA 1EYDA 1YZ6A 4RGTA 5IGEA 3HOVG 3RLOA 1A3TA 2VS1A 2F0GA 2KEDA 2AUKA 3S1NB 1CA6A 4LFCQ 1U9RA 5A2QL 1ENFA 3GTJB 2B8FA 4LFAQ 4MN3A 1SYGA 1S72A 4JI1Q 1I3QB 4O42A 1KC8C 3V05A 4KKUA 2YU9H 1WYDA 3MXGA 4YWLA 4DV0Q 1ILPA 1BXTA 3DM1A 5JEAG 4KHPL 2N55A 1C7YA 1LUZA 5GROA 1NJIC 5BN5A 1PTOF 1PZJD 2EY1A 3EROA 4POFA 3F8TA 5C4JH 1EQVA 1DZ1A 4X64L 1HNWL 4QCLA 1OXUA 1ZEQX 3M4PA 4EQ5A 3I55A 2CW0C 2NTTA 1CSQA 4CGYB 3A5UA 2E2JH 2R92G 3S1MB 4A3BH 4IPDA 4A3EG 3G7LA 4HCEA 1QB5D 1E1OA 2XTIA 2WKDA 3D6CA 3I70A 1STBA 4APVA 3SVMA 1EFID 1D5ZC 4M8AA 4L5SA 4L5QA 2JXMB 4HJAA 1KAWA 1U5KA 2RF4A 2DNEA 1SE3A 4BA1I 3CCLA 1F9SA 1K8OA 4JI0L 2YYZA 3AQQA 4LF7Q 1IKLA 2A68C 1AEXA 2WAQG 1VQGA 1GUSA 5K5PA 3UDXA 3J7A5 3S1QB 3KFUA 4B3MQ 3MA2B 4X65Q 1VMCA 1EIHA 1KL9A 1X3PA 3K5LA 4OL7A 5LMNL 4YWMA 4CJ0B 4F8MA 1LTRD 4HIKA 1KD1C 4X6AH 1JWMD 2XIWA 4XQQA 4DV1L 1KNEA 5M5WH 5FLMG 3AEVA 5IGCA 2UXDQ 3BVZA 2RVLA 5A35A 4XT1B 3VR5A 1F9QA 5C4XH 2YTXA 1NY4A 4HMIA 3VYRA 2UUAL 4M1UB 3MFGA 1SNCA 5KIXA 4JI2L 3RN2A 1AE3A 1W6KA 2ICEC 1IBLL 1RTOA 2JK8A 3OPOA 3U4VA 5C0XH 4DV6Q 5M3FH 2KECA 2VZAA 1E2WA 2MGSA 1M4VA 2A6HD 2JA5H 4J6HA 5ELEA 4IOCA 2L0CA 4JI6Q 3PQIA 3GTJH 1S5DD 2IHFA 1Q1BA 3W1GA 3PIO3 2ALYB 2CVRA 4JYAQ 3PO3B 2RCFA 4B9XA 3VR4A 2OCEA 2IJ0A 1STGA 3M4OB 1WFQA 1EZ6A 2HQEA 4BA2I 4A3DG 3MWYW 1K3RA 1SRUA 4EGVA 1CUKA 4DA2A 4R1JA 3D8GA 1DONA 5C3XA 4AH6A 1JWSD 1ZXTA 3TP6A 4BBRG 5C3EB 4KHVA 3HOVH 3S1MH 2IW3A 4YCUA 3SGIA 1CZGA 2KQ3A 3QWNA 1D1IA 1JR0D 2Y0SG 1YNXA 5CMDA 1U0LA 4V190 2KVMA 1Y8OB 4JBJA 3KF8B 1IXRA 3KF8A 4ZQ3A 2ZTCA 2RSOA 2M9VA 4KN7C 4K6LA 4MIUA 5JVG3 2L55A 4IURA 1PRTF 2A5HA 5JEAH 3H94A 3K7UC 4C3JG 3NHHA 1E3PA 1K73C 2VUMB 3PIPA 4B08A 2F4VQ 4KY6A 1D2BA 4GKKQ 4XYQA 3I7FA 1A15A 4DN4M 1EY0A 2QF7A 2F0FA 5CGKA 1BCPF 5I2YA 2R92H 4EQPA 1SEBD 4A3EH 2LMCB 5CORA 2JA6G 1PTOB 4ABNA 1OTCA 1LT5D 1I4GA 3QOLA 4FF3A 3BVGA 4DR5L 1II3A 2F0SA 1Q7YC 3BJUA 3L9AX 5LMUQ 1V43A 1JT8A 1VQHA 2QDBA 4B3RQ 2EY2A 1E2ZA 3DM3A 4DV4L 1A62A 1HA6A 1PZID 1HZBA 1WTRA 1W2BA 3A56A 1PHJA 2R7ZG 2K52A 3V2TA 4X3TA 2JA7G 3FVQA 4O0AA 5BR8L 4LUVA 1MBYA 3OWEB 3FPPA 4HR7B 4XT3B 1GUGA 2PI2E 3AU7A 1SYFA 4IJLA 3BDCA 1EQTA 1XMOL 2SDFA 4AYBE 5FO7B 2B8GA 5I2XA 4DNTB 1Q81C 2D0OA 1JORA 4GZYC 2RDFA 3D6WA 3BG3A 3BVMA 5FLMH 1NCVA 3MEHA 5EKIA 1M1KC 2K4KA 5FO9B 2EYLA 4A3FG 5JPMC 4LAAA 5AJ3L 1HCZA 2JA9A 1GD7A 4C3HG 1PYSB 3CPFA 2LS01 1GM5A 2E2DC 3TDQA 1WJJA 4DR3L 4K6DA 1Q46A 2Z6KA 4K8JA 1TWCB 3RZOB 2AQ2B 4H44C 4PMCA 3U50C 3KYHC 4KKSA 1FYCA 1I4QA 2YTVA 3Q23A 4YCWA 1ZKOA 3CCRA 1HHVA 4WFN3 2F0JA 2BE5D 3KLRA 3I73A 2K01A 2NYZD 4I7AA 2CCZA 2IX0A 1SSOA 4A3JB 4GN4B 4WJWA 2IT1A 4GKJQ 1GKHA 1Q3LA 2EYFA 3NE5B 5IYBH 4A3DH 4BBSG 2OF1A 3K80C 2J4XA 3DXJC 3LWEA 3QJYA 4A3KB 1AH9A 1EIGA 3PV0A 3E9HA 2XSCA 1M90C 1HQRD 3HOUB 4H0LC 4BBRH 4DK1A 3CHBD 3MVVA 1LTBD 1C48A 1Q12A 2D9UA 3P75A 3G71A 3CMEA 2PQEA 1ESFA 2WIIB 3SHLA 1TS4A 3VA5A 1IYVA 4HIDA 2PQAB 1SFOB 2PQAA 1ZYRC 3VYSA 1X32A 2N78A 3M3YH 1HNZQ 1IHZA 3VR2A 4YHHQ 3ERSX 3Q6SA 1WOCA 1A2TA 2KUMA 3G48A 4IN3A 2G9HD 4C3JH 1EOTA 4JI3Q 1VQFA 4A3MB 4ULLA 4B3TL 3OTOQ 4K5WA 2F0KA 4OIKA 3CAMA 5C5LA 4A93G 4HCSA 1IW7D 1B53A 1UEBA 5EKLA 1MHWC 3NBHB 3NBHA 1VQMA 4DF7A 3C3LA 1RCVD 1PRTB 1BBUA 2DUDA 4JK1C 1KABA 2EJFC 3PO2B 2HHHL 2F4IA 4DNIA 4MHEA 4JBKA 1E2VA 3CRLC 2JA6H 3R93A 4JBWA 1XNQL 2A1AA 1QZHA 2O5IC 1TU2B 2A8VA 3P20A 3FEWX 2VW9A 1LO5D 1VQEA 4F88A 3K6OA 3E3XA 2A69D 1SNPA 2RSNA 4MTKA 4CHTB 1BCPB 1VQ8A 3C1FA 1PV4A 5C5MA 3Q24A 2AWOA 2D2CC 4ZKCB 3ULPA 1Q86C 3A8IE 2R7ZH 1N34L 1WCMG 3HGBA 4WORA 5T1GA 4BY1G 1XJVA 1A2UA 3OOCA 2WB1B 3GQBA 2UUCL 1DM0B 3RZOH 4POGA 4HTHA 3NTHA 2EQSA 4K5XA 4PV1C 4CDEC 1G6ZA 4QF4A 1N33L 1LT3D 1YNJC 3M7GA 1EYGA 3NEMA 1RODA 1MI2A 3KBGA 4JOIC 2NVQB 4LWCA 3HOWG 1SNDA 1HNXL 1I50H 2XNAC 2C35B 2BH2A 4N9TA 3RR5A 4BY7B 1BF4A 1GJXA 4A3FH 3X3MA 2OTLA 4K14A 1GUWA 4CKCA 1STNA 1TVXA 4K8IA 1UE7A 4IFDJ 5M9OA 3HOUH 2D62A 1NSNS 3CP0A 1M8AA 1SLJA 2F1MA 2X69A 1K8MA 4JI2Q 1YJWA 1KRTA 2VQFQ 2FJ2A 2HDLA 2AWNA 4DV2L 3NUCA 4UDUC 1TT2A 4QIWB 2N8NA 1B7YB 4LK1C 3GO5A 3CCJA 1JJGA 4IUTA 4JVZA 2F52A 5EPJA 1G91A 4L5TA 1VQAA 2UUBL 3J7AV 3SE0A 1C4QA 1MJCA 2F3WA 2FHTA 3S2HH 1K0SA 2I46A 3DEPA 4IPCA 3RMHA 1YVCA 3S16H 4BBSH 4R4CA 4RCOA 5IYCG 1HUMA 4R8IA 2PZUA 2WINB 3NK9A 2YU9B 3ND8A 1JE4A 4DR1Q 3EVQA 1CQVA 4KLKA 3PO2H 3KUPA 1VQNA 4QB4A 1J8IA 5IP7G 1XNRQ 1XMQQ 3LGJA 5ELBA 4AQYL 3MZ5A 1G51A 4QY7A 3E9IA 1H9KA 4YY3L 1I94Q 4DGZA 4DR2L 3TQYA 1E0BA 5C0XI 1PA6A 1H95A 5HGQA 5EJWA 2E2JB 2EY5A 4K0KQ 4A3BB 2ZM6Q 1SNMA 1TR5A 4ALPA 2A73B 2K14A 2PYKA 3HKZG 1T5XD 1K8GA 1X3QA 4A93H 2X6LA 1LABA 2L15A 3T1HL 2PCFB 3ZJYC 1WTQA 1KLUD 1Q82C 2A74C 4DXGA 2JEAI 1TWGH 4CJ1B 5ELFA 4DAPA 1IBKL 3HKSA 4H7BA 1BDOA 3U4ZA 3BYYB 3D4DA 1X55A 5LL6X 3GTPB 4DUZQ 2K04A 1BUVT 2B2TC 2GVAA 1SYBA 1I4RA 3TREA 5BN3A 1G2TA 3H09A 4N8X1 5JJIA 1B1ZA 5KYLA 3M4QA 3PUZA 1SN8A 4HMJA 5D3IB 2IY5B 5IE8A 1FNWA 3NQIA 2RHQB 2F0NA 1SDFA 1OXVA 2F0MA 1JOKA 2Z8LA 1WCMH 1LYLA 2HCIA 2RHSB 5CV4A 3G6JB 2P5ZX 3TZUA 5M5WB 4BY1H 1JB7A 3PCOB 3C1EA 3ULLA 1A6XA 3HOZB 1VCIA 5EPKA 2EXDA 4QJFA 1KQSA 2MO1A 1J9OA 5HURA 5FOBB 2JJQA 2K50A 1LTTD 3QIAA 3K0XA 2MNAA 2ID0A 1GO3E 4LF6L 5M3FB 5EGTA 3HOWH 4DV7L 4JI7Q 5IGFA 2JA5B 2R7DA 1V1QA 2BOSA 3UE1A 2B2WC 1CHQD 4LF9L 4A3IG 2NZOA 4B3SQ 1DXMA 1B9NA 3WWVA 2R6GA 1IBML 4LF8Q 4JBMA 3DWPA 1HH2P 1ML0D 1TIID 5LHY1 1A63A 2QILA 3RZDH 2FMMA 3DMUA 1LTAD 2F0UA 3BYTB 3HOYG 4R4TA 2Z1CA 1AN8A 1OXXK 4DR7Q 2ZT9C 1KRSA 1AP0A 3IL8A 1JWUD 4QQBX 1PZKD 3M85A 4A3LH 2DY7A 3HOVB 4FO2A 1B2TA 1IYJB 1BOSA 1S5ED 4GLAC 5G3LD 1Y1WG 5IT9c 1J5EL 1UE6A 2SEBD 2UU9Q 2K5VA 5IYCH 2KCNA 3MXPA 3T16A 1JOOA 4LF5L 2XWJB 1XTDA 4G57A 4XIGS 4LF4Q 1KHIA 3FP9A 1R4PB 3M9BA 2XRSD 2J7ZA 5D65A 3JAMc 3J81L 3H15A 1DOMA 4P74A 2K75A 4JC0A 5IP7H 1I4HA 5CYUA 1I4XA 1TWFH 4WRDA 1TY0A 2SOBA 3TP7A 3GTPH 4TQUS 4QMGA 3HEJA 1WD1A 2BH8A 5IGDA 4O2DA 4V0BA 1LTGD 2ZTEA 2R92B 3A7LA 3IFTA 2XN9C 4A3EB 1FJGL 3GTQH 1LTLA 3E5SA 4G7ZC 1HUNA 2ZXOA 2BCOA 4F7XA 5A2QE 1PYBA 4C3IG 5BN4A 4NXNQ 4RKBA 1F9RA 5FLXL 4PMBA 5IP9G 5FJ8G 5IOCA 3HOZH 5IY0A 3J81i 4FXKC 4LFBQ 4BS9A 1U4RA 4ZUIA 4I65A 5JPNC 1S4ZA 2GN5A 1XX8A 2Z4IA 2A6HC 1QILA 3T1YL 4EQNA 3NBIA 4IZ8A 5EBDA 3CCQA 3PGZA 1B44D 2I5MX 3T51B 2LXJA 4OX9L 3NENA 3J7AF 1SR3A 1KNAA 1B3QA 2LXKA 2HDMA 2WAQB 1GUTA 2DN8A 4DUYQ 3TMEA 2E74C 1GUNA 4KD3A 1YEZA 1K0RA 5I6YA 4A3GG 1EUJA 1S3OA 2NN6G 1XYIA 1S5CD 3EIVA 3S15B 4JI4Q 1D6EC 2E5LQ 4FXGC 2PZWA 4X66L 1RHPA 4RCNA 1AFPA 1DOLA 1L0XB 1H9MA 1Y1VG 4GN5A 4A3CG 1SE8A 5M5YH 1A3VA 4P72A 3CC4A 5KEEA 5J1ZA 1VS0A 1HTLD 1HFGA 2G9DA 4YIJA 2JN4A 1MGSA 2ZJQA 5GAHC 4KTAA 3FDTA 3OW7A 2M00A 2B2UC 3KLWA 4P75A 3D3RA 5KYIA 2WP8J 1N33Q 1RD9D 1CKNB 4FDBA 1CKNA 4N9PA 2QW7A 1X56A 1VQPA 1EWCA 3PIOA 4HIOA 2F3VA 2H5XA 1JB3A 1VQ6A 1NMGA 2OEOA 5C3WA 4RKLA 1BR9A 1NR2A 2ES2A 4IJHA 4UAIA 4OHJA 2ZJRA 4RWSC 5KGUA 2DGYA 2PZTA 4UPAA 4A3DB 2AHOB 5FKAC 1T9HA 1GHKA 1Y8NB 4JG2A 3GTLH 1SNOA 3HOYH 2LFNA 4XDXA 2B2VA 2KHIA 2A19A 1JJ2A 4UHVA 2OQ0A 1QVCA 4BBRB 4JV5L 1CI3M 3SK5A 2I0QA 1S40A 4FF2A 4MTNA 4CJ2C 3B6YA 3EQLC 2Y0SB 1Y1WH 2KCCA 4A4IA 3H0GG 1R4QB 5COYA 2R93G 2UXBQ 3SK6A 3M3YB 1BO0A 1HR0L 2Q2UA 1JOQA 4GNXB 4GNXA 2Q8RE 1N36Q 5CV7A 2A6ED 3IAYA 1ILQA 4C2MB 4C3JB 1EIYB 1N32Q 5IWAL 3MFYA 4DV5Q 4B9WA 1IL2A 3ICEA 4TVAB 1OXTA 4JOIA 3KDFB 2TMPA 3KDFA 4XQJA 2YTYA 4RA8A 3RLNA 3K81C 1MKHA 5GAEC 5JEAJ 3GV3A 4IFDG 1CKMA 3VDYA 2BA0A 2L9HA 3SR1A 2Z6BA 3G6EA 4F87A 2RCNA 4OWXB 1PH8A 3S15H 5D3DA 4KN4C 2JA6B 1Y69U 2EZVA 3PUXA 3X3NA 1QJOA 4JI5Q 5CV8A 3F2CA 1K3BC 1J6QA 3S14B 2FMCA 2TSSA 2EY6A 4C3IH 4ILWA 4R4OA 2CFMA 2WFWA 4Q0FA 1EU4A 4XTCS 3S2DB 3NSWA 4HJ8A 3J7ZC 4ME5A 1B70B 2LKVA 4S3SA 2EPBA 1O7ZA 2MQHA 4KV6A 2F0IA 1ENCA 2WB1E 1MJEA 3GTMH 2IL8A 1EWIA 2CH4W 4LFCL 4DAYA 4DAYB 1I5FA 4GN3B 2R7ZB 2JA7B 5EPLA 1VQIA 2QGQA 4OIJA 4RH6A 2E76C 4LFAL 1O7IA 1NTGA 4JI1L 1TWHB 4CBVA 3LX0A 2BE5C 2EYPA 3QR8A 2L12A 3UDFA 5I9OA 5IIFA 1RDPD 4Z9CB 4X62Q 4A3GH 2VNUD 4LNQA 2OT2A 1PH1A 4P71A 3MC0B 5KRUA 2R61A 3VA7A 1JCKB 1NAPA 2RQXA 4DR4Q 3TSSA 1DOKA 3IFDA 3SK8A 3C46A 2L5TA 3EFXD 1Y1VH 4PG3A 1I50B 3UDGA 4A3CH 2VQEQ 3OSOA 2MHVA 2G5DA 4A3FB 1U4PA 4GLXA 5K36G 1RTNA 4PQXA 3TBIB 2OXPA 5J39A 3DEOA 1X3GA 2ZTDA 3CKIB 4NXMQ 1D5MC 2AKWB 4C3HB 1WTHA 3BDLA 4OGQC 3I91A 4X3SA 2EXZA 2F3IA 4QIWE 5IT9L 2L11A 2E2HB 5CBEE 2R7FA 1T5EA 3EA6A 1VQ5A 2ATWA 1WVLA 2PMZB 4KY7A 3UI2A 1FNVA 1Z47A 2JA8G 1EL0A 2NZHA 4DV7Q 1SBBB 5E4XA 1X54A 2F0QA 4DK0A 4DNRB 3K57A 1LM0A 3JAML 3J81j 3O13A 1D7QA 3S2HB 3KF6B 3KF6A 1EY4A 4NMZA 1WTVA 4OXPA 1B3AA 3QO2A 4C2MH 2ZJPA 2L1BA 2MJ8A 3CCEA 1F2ZA 3PUVA 4IUQA 1IW7C 2PNRC 5M3MG 4IOAA 1EEFD 3TEHB 3BU2A 3S16B 4BBSB 3HOXG 4KHPQ 2EIFA 2B2TA 3K0YA 4B3ML 4AYBG 5D14A 3CCUA 1TS3A 5EBCA 5I6WA 3TRZA 1IZ6A 4X64Q 1HNWQ 1RL2A 2Z0SA 2A69C 3RN5A 3WDNA 2UXDL 1YNND 3J81c 1SYDA 3BZKA 3H0GH 5CV9A 3JAMi 3PSIA 3S14H 2B2VC 3J80c 1FD7D 2EE1A 5F2DA 1SAPA 3S2DH 1MSGA 2KA7A 5CV6A 1A3UA 4RAUC 2EJGC 2QKIC 4I7ZC 1P8LA 1ONLA 2F0EA 3FKIG 4JI6L 4RGNA 5IODA 2JA7H 1JC7A 4JI0Q 4IFDH 1LT4D 5L37A 4A76A 1TWHH 3MXUA 4A93B 1K83B 4JYAL 1LLRD 4GNXC 1HZCA 1TWGB 1U4MA 2B2WA 4IUPA 5FLXc 5JJZA 1YI2A 5JVH3 1LACA 4NPSA 5IT9E 4FYDA 3MEFA 1STEA 3CQZB 3H3VH 2AQ1B 3CCSA 3NWSA 1SJED 5LMNQ 3IRBA 1AE2A 1ASZA 2UXCL 4MZ9A 2MP1A 4DV1Q 4OELB 1C9OA 1PTOD 1STHA 3UDIA 4H13C 4DAMA 3JAME 1ENAA 1BBWA 2EYOA 1RIPA 4MNOA 2D0PA 1FR3A 3ONAB 4C3HH 2D5DA 1TWAH 2E2HH 2Q8TA 1SMYD 1WCMB 4H02A 2UUAQ 2RDGA 1YHQA 1SMXA 1EOVA 4BY1B 4DXFA 1PFNA 1Q1EA 1VMPA 1QNKA 1RF2D 1IBLQ 3A7AB 4O1NA 3CC7A 2X6GA 4ZCKA 4YCVA 1W3SA 2K05A 5I4DA 3MXNB 3KOJA 3MXNA 1YJNA 3W2DA 1AW7A 3CD6A 2H1EA 3HOWB 2ENBA 1BNZA 4NKLA 2Q2HA 2F4VL 4GKKL 3NTKA 4X66Q 3NELA 1F9PA 3ERQA 1EQQA 3J7YW 4JW0A 4OONA 1L1OB 1L1OA 1L0WA 2BDOA 5EQ0A 3I3CA 2KHSA 4K2KA 1G2SA 1YBYA 3S24A 4Y7NH 2B63G 1HRJA 3H3VC 2OTJA 5I9PA 4UP7A 5LMUL 3RZDB 3I4NG 4B3RL 4OO1G 1WI5A 2ZXRA 1FNUA 3AYHB 2CWAA 4GOPC 3K7AB 5LL6S 4HSPA 1LTSD 2BDNA 1V8QA 3NXWA 1EY6A 2JEBI 5M3MH 5C6AA 1PFSA 3ER0A 3HOXH 2LSSA 4FF1A 3V96A 1VQLA 5E1FA 5KNCA 1K83H 1ET9A 1C8CA 1CA5A 2C9OA 3DUZA 3GTGB 3DLLA 2NVXH 1HA5A 3Q8DA 3K5MA 2WKCA 4PMWA 2AUJD 3CQZH 4WJ4A 3DHQA 2WACA 1TWFB 2E2IH 1XXGA 4RFBA 3PF5A 4A75A 1WTOA 2KEEA 2NB0A 4KJNA 4CKEA 3LNNA 3K58A 3CPWA 3HZXA 4DR5Q 4IQZA 3C2PA 4CKBA 2MO0A 1VF7A 1BKBA 2NTSA 3STBD 1D8LA 1VQJA 5C4XG 2IWHA 2B2UA 4KI0A 3EBEA 2HUGA 1SROA 3GTQB 3L7ZC 4DV4Q 3D0FA 4QUCA 3HKZB 1NR4A 1K28A 4DR6L 4P73A 1HXYD 5ELCA 1X3FA 4Q5VA 3PF4A 1Q8IA 4R8NA 2DJGC 2ZXPA 2NBFA 5BR8Q 3JC66 1EY9A 1PDQA 4GKJL 2WAQE 2EYJA 3QG1A 1G291 5J3BA 4AIMA 1XMOQ 2PPBC 2ASBA 3I8ZA 4KK7A 3L2PA 2K5NA 2IPKD 3KJPA 2F0TA 4RG1A 4BXXG 3D31A 1KAAA 4JCVE 5AJ3Q 5JJKA 1S5FD 4IPGA 2JP1A 3P7JA 1BCPD 1PYWD 1JQYD 2OQKA 5M5YB 4L5RC 1HNZL 3CU7A 1KXLA 1QWYA 5DNFA 5DEHA 4YHHL 1DJRD 2VY3A 2FINB 2PW7A 5KNBA 4DR3Q 2F0HA 1MIUA 2SNSA 1IL8A 3L3OC 3TP8A 4JI3L 3K7AH 4HJ5A 1NNXA 1X6OA 3HG9A 5C4ZA 4EVOA 4XXEA 3OTOL 1HZ9A 1I6VC 5E7NA 2K28A 2E8GA 3OHXC 3K8AA 2HQLA 3BZDB 5CR3A 2C5CA 4PZ6A 3NWTA 1GVPA 4DV3L 1JICA 2AQ3B 4CDDC 3OMGA 4A3IB 3I4LA 2PNHA 3R8BA 2B63H 3E6ZX 3GTGH 1O78A 5M5XH 1GOZA 4LUOA 4CDCC 4NDXA 4C1NI 1QZGA 3I4NH 2EYHA 2CW0D 3J80L 3GTLB 4OO1H 3HOYB 2QA4A 3WOFA 2MPMA 5DM73 1L1OC 3TS2A 4PZ8A 2Y0SE 4HSVA 1HJPA 2XWBB 4CDFC 1YHAA 2HD3A 1VQCA 1X65A 1Y1WB 1QUQB 5TSSA 1QUQA 3M4YA 4EX5A 5LMNW 2NN6I 3OIPA 2HCCA 1CHPD 5CBAE 4B3TQ 5EAYA 1UE1A 3ND9A 4ZRZA 1ASYA 1G8ZD 1Z7TA 2B2YC 2A68D 1YIJA 1UNSA 4JI8L 3IKJA 3J80i 1FVIA 1VQ4A 1HZAA 1PFMA 1DGSA 3R2IA 3PO3G 2HHHQ 1XPOA 3I2ZA 3UE0A 4UY8C 1EYCA 1NUCA 1XNQQ 2BA1A 3HP3A 1K8AC 1SYCA 3VYTA 3OIQA 1OXSC 2F0OA 1JE5A 5NUCA 2CQOA 2VQFL 5C3EG 1L2FA 4KJOA 1Y14B 4C3IB 1OO9B 1Y8PB 2GVBA 3HFZB 4QUFA 1E1TA 1TKWB 3KBXA 2B39A 3S1NH 1N34Q 2H4OA 4JPBW 1EZ8A 2B29A 3N52A 3D4RA 1PH4A 2UUCQ 3FHWA 1I3QH 3AB9A 1QNUA 3OMCA 1CKOA 1ICWA 4HEDA 3W5OA 1Q8KA 3OWFA 3GTMB 3J81E 3M7NA 4KHZA 3KJOA 3A55A 3FRPB 3K5OA 2K6AA 1F77A 2O4XA 3J80E 2NZ1D 4NP5A 5IYBG 2VUMG 4NB3A 4ZYSA 4DR1L 5C0XJ 1HNXQ 4A3GB 3PIP3 3MAQA 2UXCQ 1SE4A 2I5LX 1QVFA 3I4MG 4BXXH 4A3IH 1LV9A 3BDOA 1XNRL 2GA4B 4XYOA 1Y1VB 1PH3A 1XMQL 4IUNA 1SJHD 2EVBA 1N8RC 5EKKA 1F2MA 3NQTA 3DWQA 4HN7A 3CCMA 5C4HA 1I94L 2F0WA 5FLXE 4DFAA 2EJMA 4DV2Q 4K0KL 4G4KA 1U4LA 4OEMB 2ZM6L 4IUVA 2PW5A 3EN2A 2F0DA 1O7YA 1VF5C 1CTMA 2PMZE 5JOBA 2DJFC 4N8FA 5IYDG 2PO4A 4IFDI 1B4OA 2UUBQ 3VR6A 1WD0A 3GP7A 3OYYA 2NVTB 3K5NA 2QEXA 4QGUA 4RHSA 5DAUA 1W6JA 2A6EC 2CQAA 4E6IA 1QVGA 3GD7A 3I90A 4TKOB 1HTPA 4P2CB 4HJ9A 1MSHA 3I4MB 2Z9HA 3W3AA 3S1QH 3GTKB 3F2UA 2QCPX 3H3VI 5JJLA 3S17B 4X3UA 1B50A 1HR0W 3I56A 2F0PA 2IHEA 4DUZL 2NVYB 3U9SA 2F0VA 2CKZB 2JQOA 3A8KE 2MFIA 2N3SA 1O80A 5ISRA 1F2LA 1EU3A 1NE3A 1KLGD 3MHBA 4OWTB 1BQQT 2E75C 2K5DA 1VQDA 4AQYQ 1PH2A 3SEBA 4DU9A 1DYQA 3E0JA 1PH7A 4YY3Q 5G3LF 5GQOA 1EY8A 1B9MA 3F2BA 4DR2Q 1IYUA 2XGTA 2Q2TA 1DD2A 5JAVA 1WTWA 2RBMA 3H0GB 4ZK9B 1TS2A 2R93B 4KY5A 2O5JC 2LY7A 3CRKC 4HAEA 4KD4A 4J1MA 5FJ8H 5IP9H 1HFNA 4FNFA 1EY5A 4DKAC 4R4IA 4EQOA 4LMQD 3T1HQ 3GDEA 5CV5A 4JI7L 4LW1A 1GXDC 2QEJC 3PO3H 4FF4A 4A3JG 3GTOB 5IGGA 1IBKQ 1KDCA 3M4OH 5H1SE 4R4QA 1RJTA 3SK4A 3KK7A 2WV6D 3T13A 5IGBA 1HQMC 3U58A 3R2TA 4DV0L 1KTKA 2NN6H 4A3KG 4ZLTF 3TN2A 1VQOA 4B3SL 2RKSA 1D5XC 2K5WA 3HOUG 4LF8L 1VQ9A 1A8VA 5C3EH 1MD2D 1GHJA 1UUPA 4ZAIA 1QG7A 5HY6A 1FGUA 3RLFA 1WTPA 4J15A 1V1PB 1V1PA 4DR7L 3F1ZA 4ODGA 1I6HB 2KBNA 1B8AA 4DR6Q 1EIFA 4U68A 4GOPB 2VB2X 4GOPA 1BBXC 1C0AA 4GLVB 3PUYA 3CW2C 1TWAB 4RGOS 5J22A 1NBWA 3ITPA 1YHBA 1E24A 1SXTA 1VQ7A 2UU9L 4IUUA 5ELNA 3AMUA 4IALA 1AZQA 4A3MG 2NVTH 4FVMA 4LF6Q 3N6RA 2VUMH 4LF4L 1BVSA 1QE6A
chains in the Genus database with same CATH topology
1L1OB 2AMCB 1L1OA 1OXXK 1IXRA 3KF8B 2IX1A 1L0WA 2ZTCA 4DR7Q 3I4MH 1KRSA 4GS3A 3GTKH 4QQBX 3S17H 4A3LH 3M85A 2HIVA 1YBYA 3S24A 4Y7NH 4LF7L 2B63G 2OTJA 3K7UC 3PO2G 1IYJB 4LF9Q 4GLAC 2NVYH 4UP7A 1E3PA 5LMUL 2HT1A 1Y1WG 1K73C 5IT9c 1J5EL 1UE6A 3I4NG 4RMFA 3PIPA 2UU9Q 2K5VA 1FL0A 4B3RL 1IBMQ 2F4VQ 4OO1G 1WI5A 5IYCH 4GKKQ 4X65L 3TS0A 3I7FA 3AYHB 4LF5L 3OW2A 2CWAA 4GOPC 1XTDA 4XIGS 4LF4Q 1KHIA 3FP9A 2R92H 5IYDH 3M9BA 4IO9A 3L0OA 3JAMc 2JEBI 4A3EH 3H15A 2JA6G 5M3MH 4P74A 1OTCA 2K75A 4JC0A 5IP7H 4NXNL 1PFSA 3ER0A 4DR5L 1TWFH 3HOXH 2LSSA 3GTPH 4TQUS 1Q7YC 2R93H 3BJUA 5LMUQ 1VQKA 4LFBL 1VQLA 1V43A 1JT8A 1VQHA 4DK6C 2WB1G 4UP9A 1J5EQ 1K83H 3CF5A 4ME3A 2BH8A 4B3RQ 2OWOA 4O2DA 4DV3Q 2K5HA 2ZTEA 1PH9A 1KIXA 3DM3A 4DV4L 3DLLA 1VQBA 4DV6L 1YITA 1TXYA 1A62A 2NVXH 4LF5Q 5C44G 3Q8DA 1HZBA 2PI2A 4PMWA 1W2BA 3CQZH 1FJGL 3GTQH 4WJ4A 1LTLA 1PHJA 4DUYL 2R7ZG 2K52A 5GAGC 2KCMA 2JA7G 2E2IH 3GTOH 2N49A 1EFWA 1PYBA 4A75A 3PF5A 4O0AA 5BR8L 4LUVA 4NXNQ 4BY7G 1V9PA 5IP9G 5FJ8G 4DR5Q 5DLQE 3CPWA 2Q2IA 4JI4L 2E5LL 3HOZH 2PI2E 5IY0A 4HJ7A 3J81i 1XPUA 4IJLA 4LFBQ 2MO0A 1BKBA 2GN5A 3STBD 1D8LA 1VQJA 3PUWA 5C4XG 1XMOL 4DK3C 4AYBE 4KI0A 3T1YL 3EBEA 1SROA 3CCQA 3L7ZC 3PGZA 4DV4Q 1Q81C 2D0OA 2I5MX 2YV5A 3D0FA 2LXJA 4OX9L 3NENA 3CCVA 1SR3A 5FLMH 1NMFA 4DR6L 2LXKA 4P73A 1M1KC 1FJGQ 2K4KA 1X3FA 3PF4A 4DUYQ 4A3FG 1TWCH 1I6HH 1YEZA 1K0RA 1XPRA 4A3GG 2HIXA 1EUJA 5BR8Q 1S3OA 2NN6G 5AJ3L 3EIVA 2JA9A 2VL6A 4JI4Q 3HKZE 3JC66 2E5LQ 2B3GA 4UP8A 1GD7A 4X66L 4GKJL 1PYSB 2WAQE 3CPFA 2KHJA 3AFQA 4JI8Q 1GM5A 3A0JA 2ASBA 1G291 5J3BA 4AIMA 1Y1VG 1WJJA 4A3JH 1XMOQ 3A5ZB 4GN5A 4A3CG 1JJCB 4DR3L 3T1YQ 1Q46A 1SE8A 5M5YH 3CC4A 2Z6KA 4P72A 1VS0A 4OX9Q 3L2PA 3U50C 3KYHC 2K5NA 3KJPA 4A3KH 2YTVA 3CCRA 3A74A 4YCWA 5GAHC 1YJ9A 2ZJQA 4RG1A 4BXXG 3CC2A 3KLWA 3D31A 4OO1I 2JE6I 4JCVE 4P75A 2IX0A 5AJ3Q 3RNUA 2CCZA 5JJKA 2WP8J 4GN4B 4IPGA 1N33Q 4WJ3M 3CXCA 2IT1A 1CKNB 2OQKA 1CKNA 4FDBA 2KENA 4IPHA 1HNZL 1GKHA 4L5RC 4GKJQ 1KXLA 5IYBH 4YHHL 1X56A 4A3DH 1VQPA 1X9NA 2VY3A 3PIOA 4HIOA 4BBSG 2H5XA 1VQ6A 3K80C 4DR3Q 1SFOH 1NMGA 1AH9A 1MIUA 3PV0A 3E9HA 3S1RH 1M90C 4JI3L 3K7AH 4HJ5A 1X6OA 4BBRH 1PVOA 4A3LG 1UE5A 4DPGA 3OTOL 4IJHA 2ES2A 2ZJRA 1HZ9A 1Q12A 5E7NA 4A3BG 2E8GA 2DGYA 3CMEA 3G71A 2UXBL 3K8AA 4UPAA 4A3MH 2HQLA 2AHOB 1T9HA 2JA8H 2Z6KC 4HIDA 3GTLH 4JG2A 1N36L 1PH6A 2PQAB 2PQAA 4PZ6A 1GVPA 4DV3L 3HOYH 2N78A 3M3YH 2KHIA 1HNZQ 2CWPA 2A19A 4YHHQ 1JJ2A 1N32L 1P16A 3ERSX 2OQ0A 1QVCA 3ULJA 4JV5L 2PNHA 4DV5L 1WOCA 2B63H 3G48A 1CSPA 2KCTA 3GTGH 1EQRA 2I0QA 4C3JH 1S40A 4JI3Q 5M5XH 4LUOA 1VQFA 4MTNA 3AFPA 3B6YA 4PZ7A 1Y1WH 4B3TL 3OTOQ 1QZGA 3I4NH 4A4IA 3F2DA 3H0GG 2V1CC 1G6PA 1Z9FA 2R93G 2UXBQ 2QA4A 3CAMA 2Q2UA 1HR0L 3E0EA 4A93G 1L1OC 3TS2A 4PZ8A 1UEBA 4GNXB 4GNXA 3NBHB 1VQMA 1N36Q 2Y0SE 1BBUA 1HJPA 2DUDA 1K9MC 1YHAA 4JI5L 3W1BA 1EIYB 2HHHL 1N32Q 4DNIA 1VQCA 5IWAL 4JBKA 4JV5Q 1X65A 4DV5Q 2JA6H 1IL2A 3ICEA 4TVAB 1OXTA 1QUQB 1QUQA 4JOIA 3BZCA 4JBWA 3KDFB 4EX5A 2A1AA 3KDFA 1QZHA 4LUZA 1XNQL 2R7ZH 5LMNW 2YTYA 2NN6I 3RLNA 3K81C 4YWKA 1MKHA 5GAEC 5JEAJ 3STBC 2A8VA 4IFDG 1E7ZA 1CKMA 3VDYA 2BA0A 4B3TQ 2VW9A 5EAYA 1UE1A 1VQEA 3G4SA 4Y52H 1ASYA 5GADC 3HOZG 1VQ8A 1PV4A 1HR0Q 1YIJA 4JI8L 3G6EA 2RCNA 4OWXB 1PH8A 3S15H 5C44H 2AWOA 3J80i 1FVIA 3FKIH 3ULPA 1VQ4A 1HZAA 1Q86C 1DGSA 3PUXA 2I5HA 3I4OA 3PO3G 4JI5Q 5C0XG 2NVQH 1N34L 1XPOA 2HHHQ 3F2CA 5M3FG 5IWAQ 1WCMG 1XJVA 3I2ZA 4BY1G 3UE0A 1J6QA 4UY8C 4X62L 5ELOA 4C3IH 2JA5G 2UUCL 1XNQQ 4BY7H 4R4OA 2CFMA 2WFWA 3RZOH 4POGA 4XTCS 4DR4L 4OWWB 2BA1A 2EQSA 4HJ8A 1PH5A 1K8AC 3J7ZC 1OXSC 1B70B 1JMCA 1A0IA 1N33L 1EYGA 1UWVA 1JE5A 2MQHA 3NEMA 2CQOA 2VQEL 2VQFL 2WB1E 1L2FA 5C3EG 4HIMA 1MJEA 3GTMH 1EWIA 4DAYB 4LFCL 4JOIC 1I5FA 4GN3B 4LWCA 1VQIA 2QGQA 3HOWG 2FXQA 1HNXL 1I50H 1Y14B 4LFAL 1O7IA 2C35B 1NTGA 2GVBA 3HFZB 4JI1L 3RR5A 1R9TH 2BH2A 1E1TA 1X3EA 3S1NH 4A3FH 1E22A 4NXML 1N34Q 2OTLA 3UDFA 2B29A 4X62Q 4A3GH 2VNUD 1PH4A 4LNQA 1N9WA 1PH1A 2UUCQ 3FHWA 4P71A 1I3QH 1UE7A 4IFDJ 4QL5A 3CMAA 3HOUH 1CKOA 4DR4Q 3W5OA 1YZ6A 2D62A 1Q8KA 3CP0A 3M7NA 3HOVG 1SLJA 4KHZA 3RLOA 3KJOA 4JI2Q 2VS1A 1Y1VH 4PG3A 1YJWA 1KRTA 3UDGA 4A3CH 2VQEQ 2VQFQ 2AWNA 4DV2L 4LFCQ 4GLXA 5IYBG 2VUMG 5K36G 4NB3A 2N8NA 1B7YB 4DR1L 3GO5A 3CCJA 1S72A 4LFAQ 5C0XJ 1HNXQ 1JJGA 2UXCQ 2F52A 4JI1Q 2I5LX 1QVFA 1X3GA 3I4MG 2ZTDA 1VQAA 4L5TA 1KC8C 2UUBL 4NXMQ 2YU9H 4A3IH 1WYDA 4BXXH 2AKWB 4YWLA 1MJCA 4DV0Q 3S2HH 2F3IA 4QIWE 1XNRL 5JEAG 1PH3A 2R7FA 4KHPL 1XMQL 1C7YA 1LUZA 1VQ5A 5GROA 1NJIC 2ATWA 1N8RC 4IPCA 3CCMA 1YVCA 4POFA 1Z47A 1I94L 3F8TA 2JA8G 4R4CA 3S16H 4BBSH 2NZHA 4DV7Q 5IYCG 5C4JH 1X54A 4DV2Q 4K0KL 4X64L 2ZM6L 1HNWL 4DR1Q 1LM0A 1OXUA 3J81j 3M4PA 4EQ5A 3EN2A 3I55A 1D7QA 3KF6B 2PMZE 3KF6A 1CSQA 2E2JH 3A5UA 2R92G 4KLKA 5IYDG 4OXPA 4C2MH 2UUBQ 3PO2H 4A3BH 2ZJPA 4IFDI 1VQNA 4IPDA 4A3EG 3CCEA 3PUVA 5M3MG 3OYYA 1E1OA 2XTIA 5IP7G 4IOAA 3TEHB 1XNRQ 2QEXA 3BU2A 4QGUA 3HOXG 4KHPQ 2EIFA 1QVGA 1XMQQ 3LGJA 3GD7A 4APVA 4AQYL 4B3ML 4AYBG 1G51A 4QY7A 3CCUA 3E9IA 4HJ9A 4YY3L 3S1QH 1I94Q 4L5SA 3H3VI 5JJLA 4L5QA 4DR2L 3TQYA 5C0XI 4HJAA 1KAWA 1PA6A 1H95A 1U5KA 5HGQA 2RF4A 3TRZA 1HR0W 4K0KQ 1IZ6A 3I56A 4X64Q 2ZM6Q 1HNWQ 2IHEA 4BA1I 4DUZL 3CCLA 4JI0L 1RL2A 2Z0SA 2YYZA 3AQQA 3RN5A 4LF7Q 2CKZB 4ALPA 2K14A 2UXDL 2JQOA 3J81c 3BZKA 3H0GH 3HKZG 3JAMi 3PSIA 3S14H 2MFIA 2N3SA 1K8GA 4A93H 1NE3A 2WAQG 1VQGA 3J80c 3UDXA 3J7A5 2L15A 4OWTB 3T1HL 3ZJYC 1Q82C 3KFUA 1PH2A 1VQDA 4AQYQ 4B3MQ 4X65Q 2JEAI 3S2DH 1TWGH 1KL9A 1PH7A 4YY3Q 5LMNL 5GQOA 1P8LA 1IBKL 4YWMA 3HKSA 3F2BA 4DR2Q 3FKIG 2XGTA 2Q2TA 4HIKA 1KD1C 4JI6L 4X6AH 3U4ZA 4DV1L 1X55A 2JA7H 4DUZQ 4JI0Q 2GVAA 5M5WH 5FLMG 4A76A 1TWHH 3AEVA 3TREA 5FJ8H 5IP9H 2UXDQ 4JYAL 5JJIA 4GNXC 1HZCA 4DKAC 3M4QA 3PUZA 1SN8A 5FLXc 4R4IA 2YTXA 5C4XH 1NY4A 4JI2L 3T1HQ 2UUAL 5IE8A 3GDEA 1YI2A 2IY5B 3RN2A 1AE3A 4NPSA 4JI7L 3MEFA 4LW1A 2RHQB 3H3VH 1IBLL 3PO3H 2JK8A 3U4VA 3CCSA 1OXVA 4DV6Q 5LMNQ 3IRBA 1AE2A 5M3FH 4A3JG 1WCMH 1IBKQ 1LYLA 4BY1H 2RHSB 2VZAA 1ASZA 2UXCL 3M4OH 5H1SE 4R4QA 2JA5H 1JB7A 4MZ9A 4IOCA 4JI6Q 3PCOB 4DV1Q 1C9OA 3ULLA 3U58A 1VCIA 3UDIA 3GTJH 2IHFA 4DV0L 1Q1BA 2EXDA 4QJFA 4DAMA 4A3KG 3W1GA 1KQSA 1BBWA 2MO1A 1VQOA 4B3SL 1RIPA 2ALYB 4MNOA 4JYAQ 2D0PA 3HOUG 4LF8L 2JJQA 2K50A 1VQ9A 1A8VA 4C3HH 3K0XA 1TWAH 5C3EH 2MNAA 2ID0A 1GO3E 4LF6L 2E2HH 5HY6A 2OCEA 1FGUA 4H02A 1YHQA 2UUAQ 1SMXA 1EOVA 3RLFA 4DV7L 4JI7Q 3HOWH 2R7DA 1Q1EA 1WFQA 4J15A 1IBLQ 1V1QA 4BA2I 4DR7L 4A3DG 3F1ZA 3CC7A 1K3RA 1SRUA 3UE1A 1CUKA 2KBNA 1B8AA 4DR6Q 4YCVA 1EIFA 4R1JA 1W3SA 4GOPB 4GOPA 1C0AA 3MXNB 3KOJA 4AH6A 4GLVB 3PUYA 4A3IG 4BBRG 1YJNA 3CW2C 4LF9L 1NBWA 3CD6A 1YHBA 3HOVH 1E24A 3S1MH 2NZOA 4YCUA 1VQ7A 2UU9L 4B3SQ 3SGIA 5ELNA 3WWVA 2R6GA 2Q2HA 1IBML 2F4VL 4LF8Q 4GKKL 4JBMA 4A3MG 1HH2P 2Y0SG 1YNXA 4X66Q 2NVTH 1A63A 1U0LA 3RZDH 3NELA 4LF6Q 2VUMH 1EQQA 4LF4L 1BVSA 3HOYG 4R4TA 4OONA 4JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O B;  2AMC B;  1L1O A;  1OXX K;  1IXR A;  3KF8 B;  2IX1 A;  1L0W A;  2ZTC A;  4DR7 Q;  3I4M H;  1KRS A;  4GS3 A;  3GTK H;  4QQB X;  3S17 H;  4A3L H;  3M85 A;  2HIV A;  1YBY A;  3S24 A;  4Y7N H;  4LF7 L;  2B63 G;  2OTJ A;  3K7U C;  3PO2 G;  1IYJ B;  4LF9 Q;  4GLA C;  2NVY H;  4UP7 A;  1E3P A;  5LMU L;  2HT1 A;  1Y1W G;  1K73 C;  5IT9 c;  1J5E L;  1UE6 A;  3I4N G;  4RMF A;  3PIP A;  2UU9 Q;  2K5V A;  1FL0 A;  4B3R L;  1IBM Q;  2F4V Q;  4OO1 G;  1WI5 A;  5IYC H;  4GKK Q;  4X65 L;  3TS0 A;  3I7F A;  3AYH B;  4LF5 L;  3OW2 A;  2CWA A;  4GOP C;  1XTD A;  4XIG S;  4LF4 Q;  1KHI A;  3FP9 A;  2R92 H;  5IYD H;  3M9B A;  4IO9 A;  3L0O A;  3JAM c;  2JEB I;  4A3E H;  3H15 A;  2JA6 G;  5M3M H;  4P74 A;  1OTC A;  2K75 A;  4JC0 A;  5IP7 H;  4NXN L;  1PFS A;  3ER0 A;  4DR5 L;  1TWF H;  3HOX H;  2LSS A;  3GTP H;  4TQU S;  1Q7Y C;  2R93 H;  3BJU A;  5LMU Q;  1VQK A;  4LFB L;  1VQL A;  1V43 A;  1JT8 A;  1VQH A;  4DK6 C;  2WB1 G;  4UP9 A;  1J5E Q;  1K83 H;  3CF5 A;  4ME3 A;  2BH8 A;  4B3R Q;  2OWO A;  4O2D A;  4DV3 Q;  2K5H A;  2ZTE A;  1PH9 A;  1KIX A;  3DM3 A;  4DV4 L;  3DLL A;  1VQB A;  4DV6 L;  1YIT A;  1TXY A;  1A62 A;  2NVX H;  4LF5 Q;  5C44 G;  3Q8D A;  1HZB A;  2PI2 A;  4PMW A;  1W2B A;  3CQZ H;  1FJG L;  3GTQ H;  4WJ4 A;  1LTL A;  1PHJ A;  4DUY L;  2R7Z G;  2K52 A;  5GAG C;  2KCM A;  2JA7 G;  2E2I H;  3GTO H;  2N49 A;  1EFW A;  1PYB A;  4A75 A;  3PF5 A;  4O0A A;  5BR8 L;  4LUV A;  4NXN Q;  4BY7 G;  1V9P A;  5IP9 G;  5FJ8 G;  4DR5 Q;  5DLQ E;  3CPW A;  2Q2I A;  4JI4 L;  2E5L L;  3HOZ H;  2PI2 E;  5IY0 A;  4HJ7 A;  3J81 i;  1XPU A;  4IJL A;  4LFB Q;  2MO0 A;  1BKB A;  2GN5 A;  3STB D;  1D8L A;  1VQJ A;  3PUW A;  5C4X G;  1XMO L;  4DK3 C;  4AYB E;  4KI0 A;  3T1Y L;  3EBE A;  1SRO A;  3CCQ A;  3L7Z C;  3PGZ A;  4DV4 Q;  1Q81 C;  2D0O A;  2I5M X;  2YV5 A;  3D0F A;  2LXJ A;  4OX9 L;  3NEN A;  3CCV A;  1SR3 A;  5FLM H;  1NMF A;  4DR6 L;  2LXK A;  4P73 A;  1M1K C;  1FJG Q;  2K4K A;  1X3F A;  3PF4 A;  4DUY Q;  4A3F G;  1TWC H;  1I6H H;  1YEZ A;  1K0R A;  1XPR A;  4A3G G;  2HIX A;  1EUJ A;  5BR8 Q;  1S3O A;  2NN6 G;  5AJ3 L;  3EIV A;  2JA9 A;  2VL6 A;  4JI4 Q;  3HKZ E;  3JC6 6;  2E5L Q;  2B3G A;  4UP8 A;  1GD7 A;  4X66 L;  4GKJ L;  1PYS B;  2WAQ E;  3CPF A;  2KHJ A;  3AFQ A;  4JI8 Q;  1GM5 A;  3A0J A;  2ASB A;  1G29 1;  5J3B A;  4AIM A;  1Y1V G;  1WJJ A;  4A3J H;  1XMO Q;  3A5Z B;  4GN5 A;  4A3C G;  1JJC B;  4DR3 L;  3T1Y Q;  1Q46 A;  1SE8 A;  5M5Y H;  3CC4 A;  2Z6K A;  4P72 A;  1VS0 A;  4OX9 Q;  3L2P A;  3U50 C;  3KYH C;  2K5N A;  3KJP A;  4A3K H;  2YTV A;  3CCR A;  3A74 A;  4YCW A;  5GAH C;  1YJ9 A;  2ZJQ A;  4RG1 A;  4BXX G;  3CC2 A;  3KLW A;  3D31 A;  4OO1 I;  2JE6 I;  4JCV E;  4P75 A;  2IX0 A;  5AJ3 Q;  3RNU A;  2CCZ A;  5JJK A;  2WP8 J;  4GN4 B;  4IPG A;  1N33 Q;  4WJ3 M;  3CXC A;  2IT1 A;  1CKN B;  2OQK A;  1CKN A;  4FDB A;  2KEN A;  4IPH A;  1HNZ L;  1GKH A;  4L5R C;  4GKJ Q;  1KXL A;  5IYB H;  4YHH L;  1X56 A;  4A3D H;  1VQP A;  1X9N A;  2VY3 A;  3PIO A;  4HIO A;  4BBS G;  2H5X A;  1VQ6 A;  3K80 C;  4DR3 Q;  1SFO H;  1NMG A;  1AH9 A;  1MIU A;  3PV0 A;  3E9H A;  3S1R H;  1M90 C;  4JI3 L;  3K7A H;  4HJ5 A;  1X6O A;  4BBR H;  1PVO A;  4A3L G;  1UE5 A;  4DPG A;  3OTO L;  4IJH A;  2ES2 A;  2ZJR A;  1HZ9 A;  1Q12 A;  5E7N A;  4A3B G;  2E8G A;  2DGY A;  3CME A;  3G71 A;  2UXB L;  3K8A A;  4UPA A;  4A3M H;  2HQL A;  2AHO B;  1T9H A;  2JA8 H;  2Z6K C;  4HID A;  3GTL H;  4JG2 A;  1N36 L;  1PH6 A;  2PQA B;  2PQA A;  4PZ6 A;  1GVP A;  4DV3 L;  3HOY H;  2N78 A;  3M3Y H;  2KHI A;  1HNZ Q;  2CWP A;  2A19 A;  4YHH Q;  1JJ2 A;  1N32 L;  1P16 A;  3ERS X;  2OQ0 A;  1QVC A;  3ULJ A;  4JV5 L;  2PNH A;  4DV5 L;  1WOC A;  2B63 H;  3G48 A;  1CSP A;  2KCT A;  3GTG H;  1EQR A;  2I0Q A;  4C3J H;  1S40 A;  4JI3 Q;  5M5X H;  4LUO A;  1VQF A;  4MTN A;  3AFP A;  3B6Y A;  4PZ7 A;  1Y1W H;  4B3T L;  3OTO Q;  1QZG A;  3I4N H;  4A4I A;  3F2D A;  3H0G G;  2V1C C;  1G6P A;  1Z9F A;  2R93 G;  2UXB Q;  2QA4 A;  3CAM A;  2Q2U A;  1HR0 L;  3E0E A;  4A93 G;  1L1O C;  3TS2 A;  4PZ8 A;  1UEB A;  4GNX B;  4GNX A;  3NBH B;  1VQM A;  1N36 Q;  2Y0S E;  1BBU A;  1HJP A;  2DUD A;  1K9M C;  1YHA A;  4JI5 L;  3W1B A;  1EIY B;  2HHH L;  1N32 Q;  4DNI A;  1VQC A;  5IWA L;  4JBK A;  4JV5 Q;  1X65 A;  4DV5 Q;  2JA6 H;  1IL2 A;  3ICE A;  4TVA B;  1OXT A;  1QUQ B;  1QUQ A;  4JOI A;  3BZC A;  4JBW A;  3KDF B;  4EX5 A;  2A1A A;  3KDF A;  1QZH A;  4LUZ A;  1XNQ L;  2R7Z H;  5LMN W;  2YTY A;  2NN6 I;  3RLN A;  3K81 C;  4YWK A;  1MKH A;  5GAE C;  5JEA J;  3STB C;  2A8V A;  4IFD G;  1E7Z A;  1CKM A;  3VDY A;  2BA0 A;  4B3T Q;  2VW9 A;  5EAY A;  1UE1 A;  1VQE A;  3G4S A;  4Y52 H;  1ASY A;  5GAD C;  3HOZ G;  1VQ8 A;  1PV4 A;  1HR0 Q;  1YIJ A;  4JI8 L;  3G6E A;  2RCN A;  4OWX B;  1PH8 A;  3S15 H;  5C44 H;  2AWO A;  3J80 i;  1FVI A;  3FKI H;  3ULP A;  1VQ4 A;  1HZA A;  1Q86 C;  1DGS A;  3PUX A;  2I5H A;  3I4O A;  3PO3 G;  4JI5 Q;  5C0X G;  2NVQ H;  1N34 L;  1XPO A;  2HHH Q;  3F2C A;  5M3F G;  5IWA Q;  1WCM G;  1XJV A;  3I2Z A;  4BY1 G;  3UE0 A;  1J6Q A;  4UY8 C;  4X62 L;  5ELO A;  4C3I H;  2JA5 G;  2UUC L;  1XNQ Q;  4BY7 H;  4R4O A;  2CFM A;  2WFW A;  3RZO H;  4POG A;  4XTC S;  4DR4 L;  4OWW B;  2BA1 A;  2EQS A;  4HJ8 A;  1PH5 A;  1K8A C;  3J7Z C;  1OXS C;  1B70 B;  1JMC A;  1A0I A;  1N33 L;  1EYG A;  1UWV A;  1JE5 A;  2MQH A;  3NEM A;  2CQO A;  2VQE L;  2VQF L;  2WB1 E;  1L2F A;  5C3E G;  4HIM A;  1MJE A;  3GTM H;  1EWI A;  4DAY B;  4LFC L;  4JOI C;  1I5F A;  4GN3 B;  4LWC A;  1VQI A;  2QGQ A;  3HOW G;  2FXQ A;  1HNX L;  1I50 H;  1Y14 B;  4LFA L;  1O7I A;  2C35 B;  1NTG A;  2GVB A;  3HFZ B;  4JI1 L;  3RR5 A;  1R9T H;  2BH2 A;  1E1T A;  1X3E A;  3S1N H;  4A3F H;  1E22 A;  4NXM L;  1N34 Q;  2OTL A;  3UDF A;  2B29 A;  4X62 Q;  4A3G H;  2VNU D;  1PH4 A;  4LNQ A;  1N9W A;  1PH1 A;  2UUC Q;  3FHW A;  4P71 A;  1I3Q H;  1UE7 A;  4IFD J;  4QL5 A;  3CMA A;  3HOU H;  1CKO A;  4DR4 Q;  3W5O A;  1YZ6 A;  2D62 A;  1Q8K A;  3CP0 A;  3M7N A;  3HOV G;  1SLJ A;  4KHZ A;  3RLO A;  3KJO A;  4JI2 Q;  2VS1 A;  1Y1V H;  4PG3 A;  1YJW A;  1KRT A;  3UDG A;  4A3C H;  2VQE Q;  2VQF Q;  2AWN A;  4DV2 L;  4LFC Q;  4GLX A;  5IYB G;  2VUM G;  5K36 G;  4NB3 A;  2N8N A;  1B7Y B;  4DR1 L;  3GO5 A;  3CCJ A;  1S72 A;  4LFA Q;  5C0X J;  1HNX Q;  1JJG A;  2UXC Q;  2F52 A;  4JI1 Q;  2I5L X;  1QVF A;  1X3G A;  3I4M G;  2ZTD A;  1VQA A;  4L5T A;  1KC8 C;  2UUB L;  4NXM Q;  2YU9 H;  4A3I H;  1WYD A;  4BXX H;  2AKW B;  4YWL A;  1MJC A;  4DV0 Q;  3S2H H;  2F3I A;  4QIW E;  1XNR L;  5JEA G;  1PH3 A;  2R7F A;  4KHP L;  1XMQ L;  1C7Y A;  1LUZ A;  1VQ5 A;  5GRO A;  1NJI C;  2ATW A;  1N8R C;  4IPC A;  3CCM A;  1YVC A;  4POF A;  1Z47 A;  1I94 L;  3F8T A;  2JA8 G;  4R4C A;  3S16 H;  4BBS H;  2NZH A;  4DV7 Q;  5IYC G;  5C4J H;  1X54 A;  4DV2 Q;  4K0K L;  4X64 L;  2ZM6 L;  1HNW L;  4DR1 Q;  1LM0 A;  1OXU A;  3J81 j;  3M4P A;  4EQ5 A;  3EN2 A;  3I55 A;  1D7Q A;  3KF6 B;  2PMZ E;  3KF6 A;  1CSQ A;  2E2J H;  3A5U A;  2R92 G;  4KLK A;  5IYD G;  4OXP A;  4C2M H;  2UUB Q;  3PO2 H;  4A3B H;  2ZJP A;  4IFD I;  1VQN A;  4IPD A;  4A3E G;  3CCE A;  3PUV A;  5M3M G;  3OYY A;  1E1O A;  2XTI A;  5IP7 G;  4IOA A;  3TEH B;  1XNR Q;  2QEX A;  3BU2 A;  4QGU A;  3HOX G;  4KHP Q;  2EIF A;  1QVG A;  1XMQ Q;  3LGJ A;  3GD7 A;  4APV A;  4AQY L;  4B3M L;  4AYB G;  1G51 A;  4QY7 A;  3CCU A;  3E9I A;  4HJ9 A;  4YY3 L;  3S1Q H;  1I94 Q;  4L5S A;  3H3V I;  5JJL A;  4L5Q A;  4DR2 L;  3TQY A;  5C0X I;  4HJA A;  1KAW A;  1PA6 A;  1H95 A;  1U5K A;  5HGQ A;  2RF4 A;  3TRZ A;  1HR0 W;  4K0K Q;  1IZ6 A;  3I56 A;  4X64 Q;  2ZM6 Q;  1HNW Q;  2IHE A;  4BA1 I;  4DUZ L;  3CCL A;  4JI0 L;  1RL2 A;  2Z0S A;  2YYZ A;  3AQQ A;  3RN5 A;  4LF7 Q;  2CKZ B;  4ALP A;  2K14 A;  2UXD L;  2JQO A;  3J81 c;  3BZK A;  3H0G H;  3HKZ G;  3JAM i;  3PSI A;  3S14 H;  2MFI A;  2N3S A;  1K8G A;  4A93 H;  1NE3 A;  2WAQ G;  1VQG A;  3J80 c;  3UDX A;  3J7A 5;  2L15 A;  4OWT B;  3T1H L;  3ZJY C;  1Q82 C;  3KFU A;  1PH2 A;  1VQD A;  4AQY Q;  4B3M Q;  4X65 Q;  2JEA I;  3S2D H;  1TWG H;  1KL9 A;  1PH7 A;  4YY3 Q;  5LMN L;  5GQO A;  1P8L A;  1IBK L;  4YWM A;  3HKS A;  3F2B A;  4DR2 Q;  3FKI G;  2XGT A;  2Q2T A;  4HIK A;  1KD1 C;  4JI6 L;  4X6A H;  3U4Z A;  4DV1 L;  1X55 A;  2JA7 H;  4DUZ Q;  4JI0 Q;  2GVA A;  5M5W H;  5FLM G;  4A76 A;  1TWH H;  3AEV A;  3TRE A;  5FJ8 H;  5IP9 H;  2UXD Q;  4JYA L;  5JJI A;  4GNX C;  1HZC A;  4DKA C;  3M4Q A;  3PUZ A;  1SN8 A;  5FLX c;  4R4I A;  2YTX A;  5C4X H;  1NY4 A;  4JI2 L;  3T1H Q;  2UUA L;  5IE8 A;  3GDE A;  1YI2 A;  2IY5 B;  3RN2 A;  1AE3 A;  4NPS A;  4JI7 L;  3MEF A;  4LW1 A;  2RHQ B;  3H3V H;  1IBL L;  3PO3 H;  2JK8 A;  3U4V A;  3CCS A;  1OXV A;  4DV6 Q;  5LMN Q;  3IRB A;  1AE2 A;  5M3F H;  4A3J G;  1WCM H;  1IBK Q;  1LYL A;  4BY1 H;  2RHS B;  2VZA A;  1ASZ A;  2UXC L;  3M4O H;  5H1S E;  4R4Q A;  2JA5 H;  1JB7 A;  4MZ9 A;  4IOC A;  4JI6 Q;  3PCO B;  4DV1 Q;  1C9O A;  3ULL A;  3U58 A;  1VCI A;  3UDI A;  3GTJ H;  2IHF A;  4DV0 L;  1Q1B A;  2EXD A;  4QJF A;  4DAM A;  4A3K G;  3W1G A;  1KQS A;  1BBW A;  2MO1 A;  1VQO A;  4B3S L;  1RIP A;  2ALY B;  4MNO A;  4JYA Q;  2D0P A;  3HOU G;  4LF8 L;  2JJQ A;  2K50 A;  1VQ9 A;  1A8V A;  4C3H H;  3K0X A;  1TWA H;  5C3E H;  2MNA A;  2ID0 A;  1GO3 E;  4LF6 L;  2E2H H;  5HY6 A;  2OCE A;  1FGU A;  4H02 A;  1YHQ A;  2UUA Q;  1SMX A;  1EOV A;  3RLF A;  4DV7 L;  4JI7 Q;  3HOW H;  2R7D A;  1Q1E A;  1WFQ A;  4J15 A;  1IBL Q;  1V1Q A;  4BA2 I;  4DR7 L;  4A3D G;  3F1Z A;  3CC7 A;  1K3R A;  1SRU A;  3UE1 A;  1CUK A;  2KBN A;  1B8A A;  4DR6 Q;  4YCV A;  1EIF A;  4R1J A;  1W3S A;  4GOP B;  4GOP A;  1C0A A;  3MXN B;  3KOJ A;  4AH6 A;  4GLV B;  3PUY A;  4A3I G;  4BBR G;  1YJN A;  3CW2 C;  4LF9 L;  1NBW A;  3CD6 A;  1YHB A;  3HOV H;  1E24 A;  3S1M H;  2NZO A;  4YCU A;  1VQ7 A;  2UU9 L;  4B3S Q;  3SGI A;  5ELN A;  3WWV A;  2R6G A;  2Q2H A;  1IBM L;  2F4V L;  4LF8 Q;  4GKK L;  4JBM A;  4A3M G;  1HH2 P;  2Y0S G;  1YNX A;  4X66 Q;  2NVT H;  1A63 A;  1U0L A;  3RZD H;  3NEL A;  4LF6 Q;  2VUM H;  1EQQ A;  4LF4 L;  1BVS A;  3HOY G;  4R4T A;  4OON A;  4JBJ A; 
#chains in the Genus database with same CATH topology
 2AMC B;  2IX1 A;  4X3K A;  3I4M H;  4GS3 A;  1L0Y B;  3GTK H;  3S17 H;  3QB3 A;  2HIV A;  4LF7 L;  1PFB A;  1UEA B;  3PO2 G;  2O2L D;  1SYE A;  4LF9 Q;  2NVY H;  2HT1 A;  1CT1 D;  1PTO H;  3BS1 A;  4RMF A;  1CQF A;  1FL0 A;  1IBM Q;  2J0T D;  1AZP A;  4X65 L;  1EWH A;  3TS0 A;  5DM6 3;  2NWG A;  4U67 3;  3S1R B;  3OW2 A;  1CFM A;  3K59 A;  2K03 A;  1PXU A;  3R3O A;  4L63 B;  5HGT A;  4Y7N B;  1YNN C;  2SNM A;  3NP8 A;  1ZYR D;  5IYD H;  4IO9 A;  3L0O A;  5AFW A;  3TP5 A;  1XWE A;  4NXN L;  2JSO A;  2JA8 B;  1CM9 A;  1LT6 D;  1ESR A;  2I07 B;  3DWA A;  1PMR A;  2R93 H;  3FMC A;  2VXW A;  1VQK A;  4LFB L;  1F2Y A;  4DK6 C;  2WB1 G;  2VB3 X;  4UP9 A;  4ZKB B;  1J5E Q;  3CF5 A;  4ME3 A;  2OWO A;  4XQN A;  4DV3 Q;  2K5H A;  1PH9 A;  1KIX A;  4LF5 Q;  1FGB D;  1VQB A;  4PNY A;  4DV6 L;  1TXY A;  1YIT A;  5C44 G;  5M3M B;  2PI2 A;  3SDZ A;  1EEI D;  3NPP A;  4DUY L;  1S5B D;  3HOX B;  5GAG C;  2KCM A;  1TQO A;  3GTO H;  4AYB B;  4LJZ C;  2N49 A;  1EFW A;  1RKN A;  4BY7 G;  1V9P A;  5DLQ E;  1TY2 A;  2Q2I A;  1UAP A;  2Z4H A;  2E5L L;  4JI4 L;  4HJ7 A;  1XPU A;  1IKM A;  2NVX B;  3PUW A;  3U9O A;  4DK3 C;  1XTC D;  1O7L A;  2JYO A;  1PTO C;  4C1N K;  2E2I B;  2YV5 A;  3CCV A;  5T1I A;  1NMF A;  1STY A;  2EYM A;  1FJG Q;  2N88 A;  5ELD A;  5FK9 C;  1TWC H;  4G7H C;  1I6H H;  1XPR A;  2Q8I B;  3I72 A;  2QDL A;  1SMY C;  2HIX A;  2F0L A;  3LWU A;  5C44 B;  2VL6 A;  3HKZ E;  2B3G A;  4UP8 A;  3FKI B;  4KKT A;  2DY8 A;  3P1H A;  1VDZ A;  2M2L A;  2KHJ A;  3AFQ A;  4JI8 Q;  1ICF B;  3A0J A;  4A3J H;  1V1O A;  3A5Z B;  1JJC B;  2IX3 A;  3T1Y Q;  1YNJ D;  3RUZ A;  1ET6 A;  4OX9 Q;  2EOT A;  3T56 B;  2K33 A;  4A3K H;  2V4D A;  3A74 A;  1YJ9 A;  2RA4 A;  3CC2 A;  2RDH A;  4OO1 I;  1WTX A;  4NW2 A;  2JE6 I;  3RNU A;  4WJ3 M;  3CXC A;  1R9T B;  3PMF A;  5CC4 A;  4IPH A;  3SXH A;  2KEN A;  3RD4 A;  5K36 H;  1CZW A;  1X9N A;  1QOH A;  2DNC A;  1SFO H;  3HRZ C;  4RHR A;  4DAV A;  3S1R H;  1Q90 A;  5E4W C;  3FPU B;  1PVO A;  3TZD A;  4A3L G;  1PLF A;  1UE5 A;  4DPG A;  3KLS A;  2XRQ D;  4A3B G;  2K32 A;  4RGM A;  1H9S B;  1TS5 A;  1H9S A;  2UXB L;  3NTI A;  3S9W A;  4A3M H;  3A8J E;  2JA8 H;  2Z6K C;  1H9J A;  5KND A;  1N36 L;  1PH6 A;  4ZUJ A;  4L8J A;  2K7V A;  1DCZ A;  3EJI A;  2CWP A;  1HPC A;  1N32 L;  1P16 A;  3ULJ A;  3MTS A;  4DV5 L;  2B2Y A;  1EY7 A;  4J8Q A;  4BWG B;  1CSP A;  2KCT A;  1EQR A;  4KMU C;  2KOL A;  4FXD A;  2CH4 A;  1Z6H A;  3AFP A;  4PZ7 A;  1I4P A;  3A54 A;  3Q0A A;  3H6M A;  3F2D A;  3ZYY X;  2V1C C;  1G6P A;  1Z9F A;  5C4J B;  3HS0 C;  3E0E A;  1QCB D;  3D4W A;  2F03 A;  3KLS X;  4R9W A;  1STA A;  2B63 B;  1K9M C;  2XVS A;  4JI5 L;  3W1B A;  5M5X B;  1GUO A;  4JV5 Q;  3H91 A;  3I4N B;  3BZC A;  4TSS A;  4LUZ A;  4YWK A;  2MUY A;  3STB C;  1E7Z A;  2CHB D;  4Y52 H;  3G4S A;  1KDB A;  4ID6 A;  1SNQ A;  5GAD C;  3HOZ G;  5FO8 B;  3WOE A;  1HR0 Q;  2R3Z A;  5C44 H;  1H9R A;  3FKI H;  2EDG A;  2I5H A;  3I4O A;  2K5Q A;  5C0X G;  2NVQ H;  1KDA A;  3VR3 A;  4L6T B;  5M3F G;  5IWA Q;  2ICI A;  4K2L A;  4TRD A;  4X62 L;  5ELO A;  2JA5 G;  4BY7 H;  1LTI D;  4DR4 L;  4OWW B;  1PH5 A;  2FFK B;  2K1B A;  3QOJ A;  1PRT C;  1JMC A;  1A0I A;  1CK1 A;  4G7O C;  1UWV A;  1EYA A;  1D1K A;  2VQE L;  3T53 B;  5E3F A;  4HIM A;  2NUC A;  3GV6 A;  1PRT D;  2FXQ A;  3Q22 A;  1R9T H;  4K5V A;  3T4A C;  4C56 C;  4FP5 D;  1X3E A;  1E22 A;  4NXM L;  3URY A;  2L4N A;  1SE2 A;  1N9W A;  2KJX A;  1BCP C;  5C4X B;  4QL5 A;  3VYU A;  3CMA A;  1EYD A;  1YZ6 A;  4RGT A;  5IGE A;  3HOV G;  3RLO A;  1A3T A;  2VS1 A;  2F0G A;  2KED A;  2AUK A;  3S1N B;  1CA6 A;  4LFC Q;  1U9R A;  5A2Q L;  1ENF A;  3GTJ B;  2B8F A;  4LFA Q;  4MN3 A;  1SYG A;  1S72 A;  4JI1 Q;  1I3Q B;  4O42 A;  1KC8 C;  3V05 A;  4KKU A;  2YU9 H;  1WYD A;  3MXG A;  4YWL A;  4DV0 Q;  1ILP A;  1BXT A;  3DM1 A;  5JEA G;  4KHP L;  2N55 A;  1C7Y A;  1LUZ A;  5GRO A;  1NJI C;  5BN5 A;  1PTO F;  1PZJ D;  2EY1 A;  3ERO A;  4POF A;  3F8T A;  5C4J H;  1EQV A;  1DZ1 A;  4X64 L;  1HNW L;  4QCL A;  1OXU A;  1ZEQ X;  3M4P A;  4EQ5 A;  3I55 A;  2CW0 C;  2NTT A;  1CSQ A;  4CGY B;  3A5U A;  2E2J H;  2R92 G;  3S1M B;  4A3B H;  4IPD A;  4A3E G;  3G7L A;  4HCE A;  1QB5 D;  1E1O A;  2XTI A;  2WKD A;  3D6C A;  3I70 A;  1STB A;  4APV A;  3SVM A;  1EFI D;  1D5Z C;  4M8A A;  4L5S A;  4L5Q A;  2JXM B;  4HJA A;  1KAW A;  1U5K A;  2RF4 A;  2DNE A;  1SE3 A;  4BA1 I;  3CCL A;  1F9S A;  1K8O A;  4JI0 L;  2YYZ A;  3AQQ A;  4LF7 Q;  1IKL A;  2A68 C;  1AEX A;  2WAQ G;  1VQG A;  1GUS A;  5K5P A;  3UDX A;  3J7A 5;  3S1Q B;  3KFU A;  4B3M Q;  3MA2 B;  4X65 Q;  1VMC A;  1EIH A;  1KL9 A;  1X3P A;  3K5L A;  4OL7 A;  5LMN L;  4YWM A;  4CJ0 B;  4F8M A;  1LTR D;  4HIK A;  1KD1 C;  4X6A H;  1JWM D;  2XIW A;  4XQQ A;  4DV1 L;  1KNE A;  5M5W H;  5FLM G;  3AEV A;  5IGC A;  2UXD Q;  3BVZ A;  2RVL A;  5A35 A;  4XT1 B;  3VR5 A;  1F9Q A;  5C4X H;  2YTX A;  1NY4 A;  4HMI A;  3VYR A;  2UUA L;  4M1U B;  3MFG A;  1SNC A;  5KIX A;  4JI2 L;  3RN2 A;  1AE3 A;  1W6K A;  2ICE C;  1IBL L;  1RTO A;  2JK8 A;  3OPO A;  3U4V A;  5C0X H;  4DV6 Q;  5M3F H;  2KEC A;  2VZA A;  1E2W A;  2MGS A;  1M4V A;  2A6H D;  2JA5 H;  4J6H A;  5ELE A;  4IOC A;  2L0C A;  4JI6 Q;  3PQI A;  3GTJ H;  1S5D D;  2IHF A;  1Q1B A;  3W1G A;  3PIO 3;  2ALY B;  2CVR A;  4JYA Q;  3PO3 B;  2RCF A;  4B9X A;  3VR4 A;  2OCE A;  2IJ0 A;  1STG A;  3M4O B;  1WFQ A;  1EZ6 A;  2HQE A;  4BA2 I;  4A3D G;  3MWY W;  1K3R A;  1SRU A;  4EGV A;  1CUK A;  4DA2 A;  4R1J A;  3D8G A;  1DON A;  5C3X A;  4AH6 A;  1JWS D;  1ZXT A;  3TP6 A;  4BBR G;  5C3E B;  4KHV A;  3HOV H;  3S1M H;  2IW3 A;  4YCU A;  3SGI A;  1CZG A;  2KQ3 A;  3QWN A;  1D1I A;  1JR0 D;  2Y0S G;  1YNX A;  5CMD A;  1U0L A;  4V19 0;  2KVM A;  1Y8O B;  4JBJ A;  3KF8 B;  1IXR A;  3KF8 A;  4ZQ3 A;  2ZTC A;  2RSO A;  2M9V A;  4KN7 C;  4K6L A;  4MIU A;  5JVG 3;  2L55 A;  4IUR A;  1PRT F;  2A5H A;  5JEA H;  3H94 A;  3K7U C;  4C3J G;  3NHH A;  1E3P A;  1K73 C;  2VUM B;  3PIP A;  4B08 A;  2F4V Q;  4KY6 A;  1D2B A;  4GKK Q;  4XYQ A;  3I7F A;  1A15 A;  4DN4 M;  1EY0 A;  2QF7 A;  2F0F A;  5CGK A;  1BCP F;  5I2Y A;  2R92 H;  4EQP A;  1SEB D;  4A3E H;  2LMC B;  5COR A;  2JA6 G;  1PTO B;  4ABN A;  1OTC A;  1LT5 D;  1I4G A;  3QOL A;  4FF3 A;  3BVG A;  4DR5 L;  1II3 A;  2F0S A;  1Q7Y C;  3BJU A;  3L9A X;  5LMU Q;  1V43 A;  1JT8 A;  1VQH A;  2QDB A;  4B3R Q;  2EY2 A;  1E2Z A;  3DM3 A;  4DV4 L;  1A62 A;  1HA6 A;  1PZI D;  1HZB A;  1WTR A;  1W2B A;  3A56 A;  1PHJ A;  2R7Z G;  2K52 A;  3V2T A;  4X3T A;  2JA7 G;  3FVQ A;  4O0A A;  5BR8 L;  4LUV A;  1MBY A;  3OWE B;  3FPP A;  4HR7 B;  4XT3 B;  1GUG A;  2PI2 E;  3AU7 A;  1SYF A;  4IJL A;  3BDC A;  1EQT A;  1XMO L;  2SDF A;  4AYB E;  5FO7 B;  2B8G A;  5I2X A;  4DNT B;  1Q81 C;  2D0O A;  1JOR A;  4GZY C;  2RDF A;  3D6W A;  3BG3 A;  3BVM A;  5FLM H;  1NCV A;  3MEH A;  5EKI A;  1M1K C;  2K4K A;  5FO9 B;  2EYL A;  4A3F G;  5JPM C;  4LAA A;  5AJ3 L;  1HCZ A;  2JA9 A;  1GD7 A;  4C3H G;  1PYS B;  3CPF A;  2LS0 1;  1GM5 A;  2E2D C;  3TDQ A;  1WJJ A;  4DR3 L;  4K6D A;  1Q46 A;  2Z6K A;  4K8J A;  1TWC B;  3RZO B;  2AQ2 B;  4H44 C;  4PMC A;  3U50 C;  3KYH C;  4KKS A;  1FYC A;  1I4Q A;  2YTV A;  3Q23 A;  4YCW A;  1ZKO A;  3CCR A;  1HHV A;  4WFN 3;  2F0J A;  2BE5 D;  3KLR A;  3I73 A;  2K01 A;  2NYZ D;  4I7A A;  2CCZ A;  2IX0 A;  1SSO A;  4A3J B;  4GN4 B;  4WJW A;  2IT1 A;  4GKJ Q;  1GKH A;  1Q3L A;  2EYF A;  3NE5 B;  5IYB H;  4A3D H;  4BBS G;  2OF1 A;  3K80 C;  2J4X A;  3DXJ C;  3LWE A;  3QJY A;  4A3K B;  1AH9 A;  1EIG A;  3PV0 A;  3E9H A;  2XSC A;  1M90 C;  1HQR D;  3HOU B;  4H0L C;  4BBR H;  4DK1 A;  3CHB D;  3MVV A;  1LTB D;  1C48 A;  1Q12 A;  2D9U A;  3P75 A;  3G71 A;  3CME A;  2PQE A;  1ESF A;  2WII B;  3SHL A;  1TS4 A;  3VA5 A;  1IYV A;  4HID A;  2PQA B;  1SFO B;  2PQA A;  1ZYR C;  3VYS A;  1X32 A;  2N78 A;  3M3Y H;  1HNZ Q;  1IHZ A;  3VR2 A;  4YHH Q;  3ERS X;  3Q6S A;  1WOC A;  1A2T A;  2KUM A;  3G48 A;  4IN3 A;  2G9H D;  4C3J H;  1EOT A;  4JI3 Q;  1VQF A;  4A3M B;  4ULL A;  4B3T L;  3OTO Q;  4K5W A;  2F0K A;  4OIK A;  3CAM A;  5C5L A;  4A93 G;  4HCS A;  1IW7 D;  1B53 A;  1UEB A;  5EKL A;  1MHW C;  3NBH B;  3NBH A;  1VQM A;  4DF7 A;  3C3L A;  1RCV D;  1PRT B;  1BBU A;  2DUD A;  4JK1 C;  1KAB A;  2EJF C;  3PO2 B;  2HHH L;  2F4I A;  4DNI A;  4MHE A;  4JBK A;  1E2V A;  3CRL C;  2JA6 H;  3R93 A;  4JBW A;  1XNQ L;  2A1A A;  1QZH A;  2O5I C;  1TU2 B;  2A8V A;  3P20 A;  3FEW X;  2VW9 A;  1LO5 D;  1VQE A;  4F88 A;  3K6O A;  3E3X A;  2A69 D;  1SNP A;  2RSN A;  4MTK A;  4CHT B;  1BCP B;  1VQ8 A;  3C1F A;  1PV4 A;  5C5M A;  3Q24 A;  2AWO A;  2D2C C;  4ZKC B;  3ULP A;  1Q86 C;  3A8I E;  2R7Z H;  1N34 L;  1WCM G;  3HGB A;  4WOR A;  5T1G A;  4BY1 G;  1XJV A;  1A2U A;  3OOC A;  2WB1 B;  3GQB A;  2UUC L;  1DM0 B;  3RZO H;  4POG A;  4HTH A;  3NTH A;  2EQS A;  4K5X A;  4PV1 C;  4CDE C;  1G6Z A;  4QF4 A;  1N33 L;  1LT3 D;  1YNJ C;  3M7G A;  1EYG A;  3NEM A;  1ROD A;  1MI2 A;  3KBG A;  4JOI C;  2NVQ B;  4LWC A;  3HOW G;  1SND A;  1HNX L;  1I50 H;  2XNA C;  2C35 B;  2BH2 A;  4N9T A;  3RR5 A;  4BY7 B;  1BF4 A;  1GJX A;  4A3F H;  3X3M A;  2OTL A;  4K14 A;  1GUW A;  4CKC A;  1STN A;  1TVX A;  4K8I A;  1UE7 A;  4IFD J;  5M9O A;  3HOU H;  2D62 A;  1NSN S;  3CP0 A;  1M8A A;  1SLJ A;  2F1M A;  2X69 A;  1K8M A;  4JI2 Q;  1YJW A;  1KRT A;  2VQF Q;  2FJ2 A;  2HDL A;  2AWN A;  4DV2 L;  3NUC A;  4UDU C;  1TT2 A;  4QIW B;  2N8N A;  1B7Y B;  4LK1 C;  3GO5 A;  3CCJ A;  1JJG A;  4IUT A;  4JVZ A;  2F52 A;  5EPJ A;  1G91 A;  4L5T A;  1VQA A;  2UUB L;  3J7A V;  3SE0 A;  1C4Q A;  1MJC A;  2F3W A;  2FHT A;  3S2H H;  1K0S A;  2I46 A;  3DEP A;  4IPC A;  3RMH A;  1YVC A;  3S16 H;  4BBS H;  4R4C A;  4RCO A;  5IYC G;  1HUM A;  4R8I A;  2PZU A;  2WIN B;  3NK9 A;  2YU9 B;  3ND8 A;  1JE4 A;  4DR1 Q;  3EVQ A;  1CQV A;  4KLK A;  3PO2 H;  3KUP A;  1VQN A;  4QB4 A;  1J8I A;  5IP7 G;  1XNR Q;  1XMQ Q;  3LGJ A;  5ELB A;  4AQY L;  3MZ5 A;  1G51 A;  4QY7 A;  3E9I A;  1H9K A;  4YY3 L;  1I94 Q;  4DGZ A;  4DR2 L;  3TQY A;  1E0B A;  5C0X I;  1PA6 A;  1H95 A;  5HGQ A;  5EJW A;  2E2J B;  2EY5 A;  4K0K Q;  4A3B B;  2ZM6 Q;  1SNM A;  1TR5 A;  4ALP A;  2A73 B;  2K14 A;  2PYK A;  3HKZ G;  1T5X D;  1K8G A;  1X3Q A;  4A93 H;  2X6L A;  1LAB A;  2L15 A;  3T1H L;  2PCF B;  3ZJY C;  1WTQ A;  1KLU D;  1Q82 C;  2A74 C;  4DXG A;  2JEA I;  1TWG H;  4CJ1 B;  5ELF A;  4DAP A;  1IBK L;  3HKS A;  4H7B A;  1BDO A;  3U4Z A;  3BYY B;  3D4D A;  1X55 A;  5LL6 X;  3GTP B;  4DUZ Q;  2K04 A;  1BUV T;  2B2T C;  2GVA A;  1SYB A;  1I4R A;  3TRE A;  5BN3 A;  1G2T A;  3H09 A;  4N8X 1;  5JJI A;  1B1Z A;  5KYL A;  3M4Q A;  3PUZ A;  1SN8 A;  4HMJ A;  5D3I B;  2IY5 B;  5IE8 A;  1FNW A;  3NQI A;  2RHQ B;  2F0N A;  1SDF A;  1OXV A;  2F0M A;  1JOK A;  2Z8L A;  1WCM H;  1LYL A;  2HCI A;  2RHS B;  5CV4 A;  3G6J B;  2P5Z X;  3TZU A;  5M5W B;  4BY1 H;  1JB7 A;  3PCO B;  3C1E A;  3ULL A;  1A6X A;  3HOZ B;  1VCI A;  5EPK A;  2EXD A;  4QJF A;  1KQS A;  2MO1 A;  1J9O A;  5HUR A;  5FOB B;  2JJQ A;  2K50 A;  1LTT D;  3QIA A;  3K0X A;  2MNA A;  2ID0 A;  1GO3 E;  4LF6 L;  5M3F B;  5EGT A;  3HOW H;  4DV7 L;  4JI7 Q;  5IGF A;  2JA5 B;  2R7D A;  1V1Q A;  2BOS A;  3UE1 A;  2B2W C;  1CHQ D;  4LF9 L;  4A3I G;  2NZO A;  4B3S Q;  1DXM A;  1B9N A;  3WWV A;  2R6G A;  1IBM L;  4LF8 Q;  4JBM A;  3DWP A;  1HH2 P;  1ML0 D;  1TII D;  5LHY 1;  1A63 A;  2QIL A;  3RZD H;  2FMM A;  3DMU A;  1LTA D;  2F0U A;  3BYT B;  3HOY G;  4R4T A;  2Z1C A;  1AN8 A;  1OXX K;  4DR7 Q;  2ZT9 C;  1KRS A;  1AP0 A;  3IL8 A;  1JWU D;  4QQB X;  1PZK D;  3M85 A;  4A3L H;  2DY7 A;  3HOV B;  4FO2 A;  1B2T A;  1IYJ B;  1BOS A;  1S5E D;  4GLA C;  5G3L D;  1Y1W G;  5IT9 c;  1J5E L;  1UE6 A;  2SEB D;  2UU9 Q;  2K5V A;  5IYC H;  2KCN A;  3MXP A;  3T16 A;  1JOO A;  4LF5 L;  2XWJ B;  1XTD A;  4G57 A;  4XIG S;  4LF4 Q;  1KHI A;  3FP9 A;  1R4P B;  3M9B A;  2XRS D;  2J7Z A;  5D65 A;  3JAM c;  3J81 L;  3H15 A;  1DOM A;  4P74 A;  2K75 A;  4JC0 A;  5IP7 H;  1I4H A;  5CYU A;  1I4X A;  1TWF H;  4WRD A;  1TY0 A;  2SOB A;  3TP7 A;  3GTP H;  4TQU S;  4QMG A;  3HEJ A;  1WD1 A;  2BH8 A;  5IGD A;  4O2D A;  4V0B A;  1LTG D;  2ZTE A;  2R92 B;  3A7L A;  3IFT A;  2XN9 C;  4A3E B;  1FJG L;  3GTQ H;  1LTL A;  3E5S A;  4G7Z C;  1HUN A;  2ZXO A;  2BCO A;  4F7X A;  5A2Q E;  1PYB A;  4C3I G;  5BN4 A;  4NXN Q;  4RKB A;  1F9R A;  5FLX L;  4PMB A;  5IP9 G;  5FJ8 G;  5IOC A;  3HOZ H;  5IY0 A;  3J81 i;  4FXK C;  4LFB Q;  4BS9 A;  1U4R A;  4ZUI A;  4I65 A;  5JPN C;  1S4Z A;  2GN5 A;  1XX8 A;  2Z4I A;  2A6H C;  1QIL A;  3T1Y L;  4EQN A;  3NBI A;  4IZ8 A;  5EBD A;  3CCQ A;  3PGZ A;  1B44 D;  2I5M X;  3T51 B;  2LXJ A;  4OX9 L;  3NEN A;  3J7A F;  1SR3 A;  1KNA A;  1B3Q A;  2LXK A;  2HDM A;  2WAQ B;  1GUT A;  2DN8 A;  4DUY Q;  3TME A;  2E74 C;  1GUN A;  4KD3 A;  1YEZ A;  1K0R A;  5I6Y A;  4A3G G;  1EUJ A;  1S3O A;  2NN6 G;  1XYI A;  1S5C D;  3EIV A;  3S15 B;  4JI4 Q;  1D6E C;  2E5L Q;  4FXG C;  2PZW A;  4X66 L;  1RHP A;  4RCN A;  1AFP A;  1DOL A;  1L0X B;  1H9M A;  1Y1V G;  4GN5 A;  4A3C G;  1SE8 A;  5M5Y H;  1A3V A;  4P72 A;  3CC4 A;  5KEE A;  5J1Z A;  1VS0 A;  1HTL D;  1HFG A;  2G9D A;  4YIJ A;  2JN4 A;  1MGS A;  2ZJQ A;  5GAH C;  4KTA A;  3FDT A;  3OW7 A;  2M00 A;  2B2U C;  3KLW A;  4P75 A;  3D3R A;  5KYI A;  2WP8 J;  1N33 Q;  1RD9 D;  1CKN B;  4FDB A;  1CKN A;  4N9P A;  2QW7 A;  1X56 A;  1VQP A;  1EWC A;  3PIO A;  4HIO A;  2F3V A;  2H5X A;  1JB3 A;  1VQ6 A;  1NMG A;  2OEO A;  5C3W A;  4RKL A;  1BR9 A;  1NR2 A;  2ES2 A;  4IJH A;  4UAI A;  4OHJ A;  2ZJR A;  4RWS C;  5KGU A;  2DGY A;  2PZT A;  4UPA A;  4A3D B;  2AHO B;  5FKA C;  1T9H A;  1GHK A;  1Y8N B;  4JG2 A;  3GTL H;  1SNO A;  3HOY H;  2LFN A;  4XDX A;  2B2V A;  2KHI A;  2A19 A;  1JJ2 A;  4UHV A;  2OQ0 A;  1QVC A;  4BBR B;  4JV5 L;  1CI3 M;  3SK5 A;  2I0Q A;  1S40 A;  4FF2 A;  4MTN A;  4CJ2 C;  3B6Y A;  3EQL C;  2Y0S B;  1Y1W H;  2KCC A;  4A4I A;  3H0G G;  1R4Q B;  5COY A;  2R93 G;  2UXB Q;  3SK6 A;  3M3Y B;  1BO0 A;  1HR0 L;  2Q2U A;  1JOQ A;  4GNX B;  4GNX A;  2Q8R E;  1N36 Q;  5CV7 A;  2A6E D;  3IAY A;  1ILQ A;  4C2M B;  4C3J B;  1EIY B;  1N32 Q;  5IWA L;  3MFY A;  4DV5 Q;  4B9W A;  1IL2 A;  3ICE A;  4TVA B;  1OXT A;  4JOI A;  3KDF B;  2TMP A;  3KDF A;  4XQJ A;  2YTY A;  4RA8 A;  3RLN A;  3K81 C;  1MKH A;  5GAE C;  5JEA J;  3GV3 A;  4IFD G;  1CKM A;  3VDY A;  2BA0 A;  2L9H A;  3SR1 A;  2Z6B A;  3G6E A;  4F87 A;  2RCN A;  4OWX B;  1PH8 A;  3S15 H;  5D3D A;  4KN4 C;  2JA6 B;  1Y69 U;  2EZV A;  3PUX A;  3X3N A;  1QJO A;  4JI5 Q;  5CV8 A;  3F2C A;  1K3B C;  1J6Q A;  3S14 B;  2FMC A;  2TSS A;  2EY6 A;  4C3I H;  4ILW A;  4R4O A;  2CFM A;  2WFW A;  4Q0F A;  1EU4 A;  4XTC S;  3S2D B;  3NSW A;  4HJ8 A;  3J7Z C;  4ME5 A;  1B70 B;  2LKV A;  4S3S A;  2EPB A;  1O7Z A;  2MQH A;  4KV6 A;  2F0I A;  1ENC A;  2WB1 E;  1MJE A;  3GTM H;  2IL8 A;  1EWI A;  2CH4 W;  4LFC L;  4DAY A;  4DAY B;  1I5F A;  4GN3 B;  2R7Z B;  2JA7 B;  5EPL A;  1VQI A;  2QGQ A;  4OIJ A;  4RH6 A;  2E76 C;  4LFA L;  1O7I A;  1NTG A;  4JI1 L;  1TWH B;  4CBV A;  3LX0 A;  2BE5 C;  2EYP A;  3QR8 A;  2L12 A;  3UDF A;  5I9O A;  5IIF A;  1RDP D;  4Z9C B;  4X62 Q;  4A3G H;  2VNU D;  4LNQ A;  2OT2 A;  1PH1 A;  4P71 A;  3MC0 B;  5KRU A;  2R61 A;  3VA7 A;  1JCK B;  1NAP A;  2RQX A;  4DR4 Q;  3TSS A;  1DOK A;  3IFD A;  3SK8 A;  3C46 A;  2L5T A;  3EFX D;  1Y1V H;  4PG3 A;  1I50 B;  3UDG A;  4A3C H;  2VQE Q;  3OSO A;  2MHV A;  2G5D A;  4A3F B;  1U4P A;  4GLX A;  5K36 G;  1RTN A;  4PQX A;  3TBI B;  2OXP A;  5J39 A;  3DEO A;  1X3G A;  2ZTD A;  3CKI B;  4NXM Q;  1D5M C;  2AKW B;  4C3H B;  1WTH A;  3BDL A;  4OGQ C;  3I91 A;  4X3S A;  2EXZ A;  2F3I A;  4QIW E;  5IT9 L;  2L11 A;  2E2H B;  5CBE E;  2R7F A;  1T5E A;  3EA6 A;  1VQ5 A;  2ATW A;  1WVL A;  2PMZ B;  4KY7 A;  3UI2 A;  1FNV A;  1Z47 A;  2JA8 G;  1EL0 A;  2NZH A;  4DV7 Q;  1SBB B;  5E4X A;  1X54 A;  2F0Q A;  4DK0 A;  4DNR B;  3K57 A;  1LM0 A;  3JAM L;  3J81 j;  3O13 A;  1D7Q A;  3S2H B;  3KF6 B;  3KF6 A;  1EY4 A;  4NMZ A;  1WTV A;  4OXP A;  1B3A A;  3QO2 A;  4C2M H;  2ZJP A;  2L1B A;  2MJ8 A;  3CCE A;  1F2Z A;  3PUV A;  4IUQ A;  1IW7 C;  2PNR C;  5M3M G;  4IOA A;  1EEF D;  3TEH B;  3BU2 A;  3S16 B;  4BBS B;  3HOX G;  4KHP Q;  2EIF A;  2B2T A;  3K0Y A;  4B3M L;  4AYB G;  5D14 A;  3CCU A;  1TS3 A;  5EBC A;  5I6W A;  3TRZ A;  1IZ6 A;  4X64 Q;  1HNW Q;  1RL2 A;  2Z0S A;  2A69 C;  3RN5 A;  3WDN A;  2UXD L;  1YNN D;  3J81 c;  1SYD A;  3BZK A;  3H0G H;  5CV9 A;  3JAM i;  3PSI A;  3S14 H;  2B2V C;  3J80 c;  1FD7 D;  2EE1 A;  5F2D A;  1SAP A;  3S2D H;  1MSG A;  2KA7 A;  5CV6 A;  1A3U A;  4RAU C;  2EJG C;  2QKI C;  4I7Z C;  1P8L A;  1ONL A;  2F0E A;  3FKI G;  4JI6 L;  4RGN A;  5IOD A;  2JA7 H;  1JC7 A;  4JI0 Q;  4IFD H;  1LT4 D;  5L37 A;  4A76 A;  1TWH H;  3MXU A;  4A93 B;  1K83 B;  4JYA L;  1LLR D;  4GNX C;  1HZC A;  1TWG B;  1U4M A;  2B2W A;  4IUP A;  5FLX c;  5JJZ A;  1YI2 A;  5JVH 3;  1LAC A;  4NPS A;  5IT9 E;  4FYD A;  3MEF A;  1STE A;  3CQZ B;  3H3V H;  2AQ1 B;  3CCS A;  3NWS A;  1SJE D;  5LMN Q;  3IRB A;  1AE2 A;  1ASZ A;  2UXC L;  4MZ9 A;  2MP1 A;  4DV1 Q;  4OEL B;  1C9O A;  1PTO D;  1STH A;  3UDI A;  4H13 C;  4DAM A;  3JAM E;  1ENA A;  1BBW A;  2EYO A;  1RIP A;  4MNO A;  2D0P A;  1FR3 A;  3ONA B;  4C3H H;  2D5D A;  1TWA H;  2E2H H;  2Q8T A;  1SMY D;  1WCM B;  4H02 A;  2UUA Q;  2RDG A;  1YHQ A;  1SMX A;  1EOV A;  4BY1 B;  4DXF A;  1PFN A;  1Q1E A;  1VMP A;  1QNK A;  1RF2 D;  1IBL Q;  3A7A B;  4O1N A;  3CC7 A;  2X6G A;  4ZCK A;  4YCV A;  1W3S A;  2K05 A;  5I4D A;  3MXN B;  3KOJ A;  3MXN A;  1YJN A;  3W2D A;  1AW7 A;  3CD6 A;  2H1E A;  3HOW B;  2ENB A;  1BNZ A;  4NKL A;  2Q2H A;  2F4V L;  4GKK L;  3NTK A;  4X66 Q;  3NEL A;  1F9P A;  3ERQ A;  1EQQ A;  3J7Y W;  4JW0 A;  4OON A;  1L1O B;  1L1O A;  1L0W A;  2BDO A;  5EQ0 A;  3I3C A;  2KHS A;  4K2K A;  1G2S A;  1YBY A;  3S24 A;  4Y7N H;  2B63 G;  1HRJ A;  3H3V C;  2OTJ A;  5I9P A;  4UP7 A;  5LMU L;  3RZD B;  3I4N G;  4B3R L;  4OO1 G;  1WI5 A;  2ZXR A;  1FNU A;  3AYH B;  2CWA A;  4GOP C;  3K7A B;  5LL6 S;  4HSP A;  1LTS D;  2BDN A;  1V8Q A;  3NXW A;  1EY6 A;  2JEB I;  5M3M H;  5C6A A;  1PFS A;  3ER0 A;  3HOX H;  2LSS A;  4FF1 A;  3V96 A;  1VQL A;  5E1F A;  5KNC A;  1K83 H;  1ET9 A;  1C8C A;  1CA5 A;  2C9O A;  3DUZ A;  3GTG B;  3DLL A;  2NVX H;  1HA5 A;  3Q8D A;  3K5M A;  2WKC A;  4PMW A;  2AUJ D;  3CQZ H;  4WJ4 A;  3DHQ A;  2WAC A;  1TWF B;  2E2I H;  1XXG A;  4RFB A;  3PF5 A;  4A75 A;  1WTO A;  2KEE A;  2NB0 A;  4KJN A;  4CKE A;  3LNN A;  3K58 A;  3CPW A;  3HZX A;  4DR5 Q;  4IQZ A;  3C2P A;  4CKB A;  2MO0 A;  1VF7 A;  1BKB A;  2NTS A;  3STB D;  1D8L A;  1VQJ A;  5C4X G;  2IWH A;  2B2U A;  4KI0 A;  3EBE A;  2HUG A;  1SRO A;  3GTQ B;  3L7Z C;  4DV4 Q;  3D0F A;  4QUC A;  3HKZ B;  1NR4 A;  1K28 A;  4DR6 L;  4P73 A;  1HXY D;  5ELC A;  1X3F A;  4Q5V A;  3PF4 A;  1Q8I A;  4R8N A;  2DJG C;  2ZXP A;  2NBF A;  5BR8 Q;  3JC6 6;  1EY9 A;  1PDQ A;  4GKJ L;  2WAQ E;  2EYJ A;  3QG1 A;  1G29 1;  5J3B A;  4AIM A;  1XMO Q;  2PPB C;  2ASB A;  3I8Z A;  4KK7 A;  3L2P A;  2K5N A;  2IPK D;  3KJP A;  2F0T A;  4RG1 A;  4BXX G;  3D31 A;  1KAA A;  4JCV E;  5AJ3 Q;  5JJK A;  1S5F D;  4IPG A;  2JP1 A;  3P7J A;  1BCP D;  1PYW D;  1JQY D;  2OQK A;  5M5Y B;  4L5R C;  1HNZ L;  3CU7 A;  1KXL A;  1QWY A;  5DNF A;  5DEH A;  4YHH L;  1DJR D;  2VY3 A;  2FIN B;  2PW7 A;  5KNB A;  4DR3 Q;  2F0H A;  1MIU A;  2SNS A;  1IL8 A;  3L3O C;  3TP8 A;  4JI3 L;  3K7A H;  4HJ5 A;  1NNX A;  1X6O A;  3HG9 A;  5C4Z A;  4EVO A;  4XXE A;  3OTO L;  1HZ9 A;  1I6V C;  5E7N A;  2K28 A;  2E8G A;  3OHX C;  3K8A A;  2HQL A;  3BZD B;  5CR3 A;  2C5C A;  4PZ6 A;  3NWT A;  1GVP A;  4DV3 L;  1JIC A;  2AQ3 B;  4CDD C;  3OMG A;  4A3I B;  3I4L A;  2PNH A;  3R8B A;  2B63 H;  3E6Z X;  3GTG H;  1O78 A;  5M5X H;  1GOZ A;  4LUO A;  4CDC C;  4NDX A;  4C1N I;  1QZG A;  3I4N H;  2EYH A;  2CW0 D;  3J80 L;  3GTL B;  4OO1 H;  3HOY B;  2QA4 A;  3WOF A;  2MPM A;  5DM7 3;  1L1O C;  3TS2 A;  4PZ8 A;  2Y0S E;  4HSV A;  1HJP A;  2XWB B;  4CDF C;  1YHA A;  2HD3 A;  1VQC A;  1X65 A;  1Y1W B;  1QUQ B;  5TSS A;  1QUQ A;  3M4Y A;  4EX5 A;  5LMN W;  2NN6 I;  3OIP A;  2HCC A;  1CHP D;  5CBA E;  4B3T Q;  5EAY A;  1UE1 A;  3ND9 A;  4ZRZ A;  1ASY A;  1G8Z D;  1Z7T A;  2B2Y C;  2A68 D;  1YIJ A;  1UNS A;  4JI8 L;  3IKJ A;  3J80 i;  1FVI A;  1VQ4 A;  1HZA A;  1PFM A;  1DGS A;  3R2I A;  3PO3 G;  2HHH Q;  1XPO A;  3I2Z A;  3UE0 A;  4UY8 C;  1EYC A;  1NUC A;  1XNQ Q;  2BA1 A;  3HP3 A;  1K8A C;  1SYC A;  3VYT A;  3OIQ A;  1OXS C;  2F0O A;  1JE5 A;  5NUC A;  2CQO A;  2VQF L;  5C3E G;  1L2F A;  4KJO A;  1Y14 B;  4C3I B;  1OO9 B;  1Y8P B;  2GVB A;  3HFZ B;  4QUF A;  1E1T A;  1TKW B;  3KBX A;  2B39 A;  3S1N H;  1N34 Q;  2H4O A;  4JPB W;  1EZ8 A;  2B29 A;  3N52 A;  3D4R A;  1PH4 A;  2UUC Q;  3FHW A;  1I3Q H;  3AB9 A;  1QNU A;  3OMC A;  1CKO A;  1ICW A;  4HED A;  3W5O A;  1Q8K A;  3OWF A;  3GTM B;  3J81 E;  3M7N A;  4KHZ A;  3KJO A;  3A55 A;  3FRP B;  3K5O A;  2K6A A;  1F77 A;  2O4X A;  3J80 E;  2NZ1 D;  4NP5 A;  5IYB G;  2VUM G;  4NB3 A;  4ZYS A;  4DR1 L;  5C0X J;  1HNX Q;  4A3G B;  3PIP 3;  3MAQ A;  2UXC Q;  1SE4 A;  2I5L X;  1QVF A;  3I4M G;  4BXX H;  4A3I H;  1LV9 A;  3BDO A;  1XNR L;  2GA4 B;  4XYO A;  1Y1V B;  1PH3 A;  1XMQ L;  4IUN A;  1SJH D;  2EVB A;  1N8R C;  5EKK A;  1F2M A;  3NQT A;  3DWQ A;  4HN7 A;  3CCM A;  5C4H A;  1I94 L;  2F0W A;  5FLX E;  4DFA A;  2EJM A;  4DV2 Q;  4K0K L;  4G4K A;  1U4L A;  4OEM B;  2ZM6 L;  4IUV A;  2PW5 A;  3EN2 A;  2F0D A;  1O7Y A;  1VF5 C;  1CTM A;  2PMZ E;  5JOB A;  2DJF C;  4N8F A;  5IYD G;  2PO4 A;  4IFD I;  1B4O A;  2UUB Q;  3VR6 A;  1WD0 A;  3GP7 A;  3OYY A;  2NVT B;  3K5N A;  2QEX A;  4QGU A;  4RHS A;  5DAU A;  1W6J A;  2A6E C;  2CQA A;  4E6I A;  1QVG A;  3GD7 A;  3I90 A;  4TKO B;  1HTP A;  4P2C B;  4HJ9 A;  1MSH A;  3I4M B;  2Z9H A;  3W3A A;  3S1Q H;  3GTK B;  3F2U A;  2QCP X;  3H3V I;  5JJL A;  3S17 B;  4X3U A;  1B50 A;  1HR0 W;  3I56 A;  2F0P A;  2IHE A;  4DUZ L;  2NVY B;  3U9S A;  2F0V A;  2CKZ B;  2JQO A;  3A8K E;  2MFI A;  2N3S A;  1O80 A;  5ISR A;  1F2L A;  1EU3 A;  1NE3 A;  1KLG D;  3MHB A;  4OWT B;  1BQQ T;  2E75 C;  2K5D A;  1VQD A;  4AQY Q;  1PH2 A;  3SEB A;  4DU9 A;  1DYQ A;  3E0J A;  1PH7 A;  4YY3 Q;  5G3L F;  5GQO A;  1EY8 A;  1B9M A;  3F2B A;  4DR2 Q;  1IYU A;  2XGT A;  2Q2T A;  1DD2 A;  5JAV A;  1WTW A;  2RBM A;  3H0G B;  4ZK9 B;  1TS2 A;  2R93 B;  4KY5 A;  2O5J C;  2LY7 A;  3CRK C;  4HAE A;  4KD4 A;  4J1M A;  5FJ8 H;  5IP9 H;  1HFN A;  4FNF A;  1EY5 A;  4DKA C;  4R4I A;  4EQO A;  4LMQ D;  3T1H Q;  3GDE A;  5CV5 A;  4JI7 L;  4LW1 A;  1GXD C;  2QEJ C;  3PO3 H;  4FF4 A;  4A3J G;  3GTO B;  5IGG A;  1IBK Q;  1KDC A;  3M4O H;  5H1S E;  4R4Q A;  1RJT A;  3SK4 A;  3KK7 A;  2WV6 D;  3T13 A;  5IGB A;  1HQM C;  3U58 A;  3R2T A;  4DV0 L;  1KTK A;  2NN6 H;  4A3K G;  4ZLT F;  3TN2 A;  1VQO A;  4B3S L;  2RKS A;  1D5X C;  2K5W A;  3HOU G;  4LF8 L;  1VQ9 A;  1A8V A;  5C3E H;  1MD2 D;  1GHJ A;  1UUP A;  4ZAI A;  1QG7 A;  5HY6 A;  1FGU A;  3RLF A;  1WTP A;  4J15 A;  1V1P B;  1V1P A;  4DR7 L;  3F1Z A;  4ODG A;  1I6H B;  2KBN A;  1B8A A;  4DR6 Q;  1EIF A;  4U68 A;  4GOP B;  2VB2 X;  4GOP A;  1BBX C;  1C0A A;  4GLV B;  3PUY A;  3CW2 C;  1TWA B;  4RGO S;  5J22 A;  1NBW A;  3ITP A;  1YHB A;  1E24 A;  1SXT A;  1VQ7 A;  2UU9 L;  4IUU A;  5ELN A;  3AMU A;  4IAL A;  1AZQ A;  4A3M G;  2NVT H;  4FVM A;  4LF6 Q;  3N6R A;  2VUM H;  4LF4 L;  1BVS A;  1QE6 A; 
#chains in the Genus database with same CATH homology
 1L1O B;  2AMC B;  1L1O A;  1OXX K;  1IXR A;  3KF8 B;  2IX1 A;  1L0W A;  2ZTC A;  4DR7 Q;  3I4M H;  1KRS A;  4GS3 A;  3GTK H;  4QQB X;  3S17 H;  4A3L H;  3M85 A;  2HIV A;  1YBY A;  3S24 A;  4Y7N H;  4LF7 L;  2B63 G;  2OTJ A;  3K7U C;  3PO2 G;  1IYJ B;  4LF9 Q;  4GLA C;  2NVY H;  4UP7 A;  1E3P A;  5LMU L;  2HT1 A;  1Y1W G;  1K73 C;  5IT9 c;  1J5E L;  1UE6 A;  3I4N G;  4RMF A;  3PIP A;  2UU9 Q;  2K5V A;  1FL0 A;  4B3R L;  1IBM Q;  2F4V Q;  4OO1 G;  1WI5 A;  5IYC H;  4GKK Q;  4X65 L;  3TS0 A;  3I7F A;  3AYH B;  4LF5 L;  3OW2 A;  2CWA A;  4GOP C;  1XTD A;  4XIG S;  4LF4 Q;  1KHI A;  3FP9 A;  2R92 H;  5IYD H;  3M9B A;  4IO9 A;  3L0O A;  3JAM c;  2JEB I;  4A3E H;  3H15 A;  2JA6 G;  5M3M H;  4P74 A;  1OTC A;  2K75 A;  4JC0 A;  5IP7 H;  4NXN L;  1PFS A;  3ER0 A;  4DR5 L;  1TWF H;  3HOX H;  2LSS A;  3GTP H;  4TQU S;  1Q7Y C;  2R93 H;  3BJU A;  5LMU Q;  1VQK A;  4LFB L;  1VQL A;  1V43 A;  1JT8 A;  1VQH A;  4DK6 C;  2WB1 G;  4UP9 A;  1J5E Q;  1K83 H;  3CF5 A;  4ME3 A;  2BH8 A;  4B3R Q;  2OWO A;  4O2D A;  4DV3 Q;  2K5H A;  2ZTE A;  1PH9 A;  1KIX A;  3DM3 A;  4DV4 L;  3DLL A;  1VQB A;  4DV6 L;  1YIT A;  1TXY A;  1A62 A;  2NVX H;  4LF5 Q;  5C44 G;  3Q8D A;  1HZB A;  2PI2 A;  4PMW A;  1W2B A;  3CQZ H;  1FJG L;  3GTQ H;  4WJ4 A;  1LTL A;  1PHJ A;  4DUY L;  2R7Z G;  2K52 A;  5GAG C;  2KCM A;  2JA7 G;  2E2I H;  3GTO H;  2N49 A;  1EFW A;  1PYB A;  4A75 A;  3PF5 A;  4O0A A;  5BR8 L;  4LUV A;  4NXN Q;  4BY7 G;  1V9P A;  5IP9 G;  5FJ8 G;  4DR5 Q;  5DLQ E;  3CPW A;  2Q2I A;  4JI4 L;  2E5L L;  3HOZ H;  2PI2 E;  5IY0 A;  4HJ7 A;  3J81 i;  1XPU A;  4IJL A;  4LFB Q;  2MO0 A;  1BKB A;  2GN5 A;  3STB D;  1D8L A;  1VQJ A;  3PUW A;  5C4X G;  1XMO L;  4DK3 C;  4AYB E;  4KI0 A;  3T1Y L;  3EBE A;  1SRO A;  3CCQ A;  3L7Z C;  3PGZ A;  4DV4 Q;  1Q81 C;  2D0O A;  2I5M X;  2YV5 A;  3D0F A;  2LXJ A;  4OX9 L;  3NEN A;  3CCV A;  1SR3 A;  5FLM H;  1NMF A;  4DR6 L;  2LXK A;  4P73 A;  1M1K C;  1FJG Q;  2K4K A;  1X3F A;  3PF4 A;  4DUY Q;  4A3F G;  1TWC H;  1I6H H;  1YEZ A;  1K0R A;  1XPR A;  4A3G G;  2HIX A;  1EUJ A;  5BR8 Q;  1S3O A;  2NN6 G;  5AJ3 L;  3EIV A;  2JA9 A;  2VL6 A;  4JI4 Q;  3HKZ E;  3JC6 6;  2E5L Q;  2B3G A;  4UP8 A;  1GD7 A;  4X66 L;  4GKJ L;  1PYS B;  2WAQ E;  3CPF A;  2KHJ A;  3AFQ A;  4JI8 Q;  1GM5 A;  3A0J A;  2ASB A;  1G29 1;  5J3B A;  4AIM A;  1Y1V G;  1WJJ A;  4A3J H;  1XMO Q;  3A5Z B;  4GN5 A;  4A3C G;  1JJC B;  4DR3 L;  3T1Y Q;  1Q46 A;  1SE8 A;  5M5Y H;  3CC4 A;  2Z6K A;  4P72 A;  1VS0 A;  4OX9 Q;  3L2P A;  3U50 C;  3KYH C;  2K5N A;  3KJP A;  4A3K H;  2YTV A;  3CCR A;  3A74 A;  4YCW A;  5GAH C;  1YJ9 A;  2ZJQ A;  4RG1 A;  4BXX G;  3CC2 A;  3KLW A;  3D31 A;  4OO1 I;  2JE6 I;  4JCV E;  4P75 A;  2IX0 A;  5AJ3 Q;  3RNU A;  2CCZ A;  5JJK A;  2WP8 J;  4GN4 B;  4IPG A;  1N33 Q;  4WJ3 M;  3CXC A;  2IT1 A;  1CKN B;  2OQK A;  1CKN A;  4FDB A;  2KEN A;  4IPH A;  1HNZ L;  1GKH A;  4L5R C;  4GKJ Q;  1KXL A;  5IYB H;  4YHH L;  1X56 A;  4A3D H;  1VQP A;  1X9N A;  2VY3 A;  3PIO A;  4HIO A;  4BBS G;  2H5X A;  1VQ6 A;  3K80 C;  4DR3 Q;  1SFO H;  1NMG A;  1AH9 A;  1MIU A;  3PV0 A;  3E9H A;  3S1R H;  1M90 C;  4JI3 L;  3K7A H;  4HJ5 A;  1X6O A;  4BBR H;  1PVO A;  4A3L G;  1UE5 A;  4DPG A;  3OTO L;  4IJH A;  2ES2 A;  2ZJR A;  1HZ9 A;  1Q12 A;  5E7N A;  4A3B G;  2E8G A;  2DGY A;  3CME A;  3G71 A;  2UXB L;  3K8A A;  4UPA A;  4A3M H;  2HQL A;  2AHO B;  1T9H A;  2JA8 H;  2Z6K C;  4HID A;  3GTL H;  4JG2 A;  1N36 L;  1PH6 A;  2PQA B;  2PQA A;  4PZ6 A;  1GVP A;  4DV3 L;  3HOY H;  2N78 A;  3M3Y H;  2KHI A;  1HNZ Q;  2CWP A;  2A19 A;  4YHH Q;  1JJ2 A;  1N32 L;  1P16 A;  3ERS X;  2OQ0 A;  1QVC A;  3ULJ A;  4JV5 L;  2PNH A;  4DV5 L;  1WOC A;  2B63 H;  3G48 A;  1CSP A;  2KCT A;  3GTG H;  1EQR A;  2I0Q A;  4C3J H;  1S40 A;  4JI3 Q;  5M5X H;  4LUO A;  1VQF A;  4MTN A;  3AFP A;  3B6Y A;  4PZ7 A;  1Y1W H;  4B3T L;  3OTO Q;  1QZG A;  3I4N H;  4A4I A;  3F2D A;  3H0G G;  2V1C C;  1G6P A;  1Z9F A;  2R93 G;  2UXB Q;  2QA4 A;  3CAM A;  2Q2U A;  1HR0 L;  3E0E A;  4A93 G;  1L1O C;  3TS2 A;  4PZ8 A;  1UEB A;  4GNX B;  4GNX A;  3NBH B;  1VQM A;  1N36 Q;  2Y0S E;  1BBU A;  1HJP A;  2DUD A;  1K9M C;  1YHA A;  4JI5 L;  3W1B A;  1EIY B;  2HHH L;  1N32 Q;  4DNI A;  1VQC A;  5IWA L;  4JBK A;  4JV5 Q;  1X65 A;  4DV5 Q;  2JA6 H;  1IL2 A;  3ICE A;  4TVA B;  1OXT A;  1QUQ B;  1QUQ A;  4JOI A;  3BZC A;  4JBW A;  3KDF B;  4EX5 A;  2A1A A;  3KDF A;  1QZH A;  4LUZ A;  1XNQ L;  2R7Z H;  5LMN W;  2YTY A;  2NN6 I;  3RLN A;  3K81 C;  4YWK A;  1MKH A;  5GAE C;  5JEA J;  3STB C;  2A8V A;  4IFD G;  1E7Z A;  1CKM A;  3VDY A;  2BA0 A;  4B3T Q;  2VW9 A;  5EAY A;  1UE1 A;  1VQE A;  3G4S A;  4Y52 H;  1ASY A;  5GAD C;  3HOZ G;  1VQ8 A;  1PV4 A;  1HR0 Q;  1YIJ A;  4JI8 L;  3G6E A;  2RCN A;  4OWX B;  1PH8 A;  3S15 H;  5C44 H;  2AWO A;  3J80 i;  1FVI A;  3FKI H;  3ULP A;  1VQ4 A;  1HZA A;  1Q86 C;  1DGS A;  3PUX A;  2I5H A;  3I4O A;  3PO3 G;  4JI5 Q;  5C0X G;  2NVQ H;  1N34 L;  1XPO A;  2HHH Q;  3F2C A;  5M3F G;  5IWA Q;  1WCM G;  1XJV A;  3I2Z A;  4BY1 G;  3UE0 A;  1J6Q A;  4UY8 C;  4X62 L;  5ELO A;  4C3I H;  2JA5 G;  2UUC L;  1XNQ Q;  4BY7 H;  4R4O A;  2CFM A;  2WFW A;  3RZO H;  4POG A;  4XTC S;  4DR4 L;  4OWW B;  2BA1 A;  2EQS A;  4HJ8 A;  1PH5 A;  1K8A C;  3J7Z C;  1OXS C;  1B70 B;  1JMC A;  1A0I A;  1N33 L;  1EYG A;  1UWV A;  1JE5 A;  2MQH A;  3NEM A;  2CQO A;  2VQE L;  2VQF L;  2WB1 E;  1L2F A;  5C3E G;  4HIM A;  1MJE A;  3GTM H;  1EWI A;  4DAY B;  4LFC L;  4JOI C;  1I5F A;  4GN3 B;  4LWC A;  1VQI A;  2QGQ A;  3HOW G;  2FXQ A;  1HNX L;  1I50 H;  1Y14 B;  4LFA L;  1O7I A;  2C35 B;  1NTG A;  2GVB A;  3HFZ B;  4JI1 L;  3RR5 A;  1R9T H;  2BH2 A;  1E1T A;  1X3E A;  3S1N H;  4A3F H;  1E22 A;  4NXM L;  1N34 Q;  2OTL A;  3UDF A;  2B29 A;  4X62 Q;  4A3G H;  2VNU D;  1PH4 A;  4LNQ A;  1N9W A;  1PH1 A;  2UUC Q;  3FHW A;  4P71 A;  1I3Q H;  1UE7 A;  4IFD J;  4QL5 A;  3CMA A;  3HOU H;  1CKO A;  4DR4 Q;  3W5O A;  1YZ6 A;  2D62 A;  1Q8K A;  3CP0 A;  3M7N A;  3HOV G;  1SLJ A;  4KHZ A;  3RLO A;  3KJO A;  4JI2 Q;  2VS1 A;  1Y1V H;  4PG3 A;  1YJW A;  1KRT A;  3UDG A;  4A3C H;  2VQE Q;  2VQF Q;  2AWN A;  4DV2 L;  4LFC Q;  4GLX A;  5IYB G;  2VUM G;  5K36 G;  4NB3 A;  2N8N A;  1B7Y B;  4DR1 L;  3GO5 A;  3CCJ A;  1S72 A;  4LFA Q;  5C0X J;  1HNX Q;  1JJG A;  2UXC Q;  2F52 A;  4JI1 Q;  2I5L X;  1QVF A;  1X3G A;  3I4M G;  2ZTD A;  1VQA A;  4L5T A;  1KC8 C;  2UUB L;  4NXM Q;  2YU9 H;  4A3I H;  1WYD A;  4BXX H;  2AKW B;  4YWL A;  1MJC A;  4DV0 Q;  3S2H H;  2F3I A;  4QIW E;  1XNR L;  5JEA G;  1PH3 A;  2R7F A;  4KHP L;  1XMQ L;  1C7Y A;  1LUZ A;  1VQ5 A;  5GRO A;  1NJI C;  2ATW A;  1N8R C;  4IPC A;  3CCM A;  1YVC A;  4POF A;  1Z47 A;  1I94 L;  3F8T A;  2JA8 G;  4R4C A;  3S16 H;  4BBS H;  2NZH A;  4DV7 Q;  5IYC G;  5C4J H;  1X54 A;  4DV2 Q;  4K0K L;  4X64 L;  2ZM6 L;  1HNW L;  4DR1 Q;  1LM0 A;  1OXU A;  3J81 j;  3M4P A;  4EQ5 A;  3EN2 A;  3I55 A;  1D7Q A;  3KF6 B;  2PMZ E;  3KF6 A;  1CSQ A;  2E2J H;  3A5U A;  2R92 G;  4KLK A;  5IYD G;  4OXP A;  4C2M H;  2UUB Q;  3PO2 H;  4A3B H;  2ZJP A;  4IFD I;  1VQN A;  4IPD A;  4A3E G;  3CCE A;  3PUV A;  5M3M G;  3OYY A;  1E1O A;  2XTI A;  5IP7 G;  4IOA A;  3TEH B;  1XNR Q;  2QEX A;  3BU2 A;  4QGU A;  3HOX G;  4KHP Q;  2EIF A;  1QVG A;  1XMQ Q;  3LGJ A;  3GD7 A;  4APV A;  4AQY L;  4B3M L;  4AYB G;  1G51 A;  4QY7 A;  3CCU A;  3E9I A;  4HJ9 A;  4YY3 L;  3S1Q H;  1I94 Q;  4L5S A;  3H3V I;  5JJL A;  4L5Q A;  4DR2 L;  3TQY A;  5C0X I;  4HJA A;  1KAW A;  1PA6 A;  1H95 A;  1U5K A;  5HGQ A;  2RF4 A;  3TRZ A;  1HR0 W;  4K0K Q;  1IZ6 A;  3I56 A;  4X64 Q;  2ZM6 Q;  1HNW Q;  2IHE A;  4BA1 I;  4DUZ L;  3CCL A;  4JI0 L;  1RL2 A;  2Z0S A;  2YYZ A;  3AQQ A;  3RN5 A;  4LF7 Q;  2CKZ B;  4ALP A;  2K14 A;  2UXD L;  2JQO A;  3J81 c;  3BZK A;  3H0G H;  3HKZ G;  3JAM i;  3PSI A;  3S14 H;  2MFI A;  2N3S A;  1K8G A;  4A93 H;  1NE3 A;  2WAQ G;  1VQG A;  3J80 c;  3UDX A;  3J7A 5;  2L15 A;  4OWT B;  3T1H L;  3ZJY C;  1Q82 C;  3KFU A;  1PH2 A;  1VQD A;  4AQY Q;  4B3M Q;  4X65 Q;  2JEA I;  3S2D H;  1TWG H;  1KL9 A;  1PH7 A;  4YY3 Q;  5LMN L;  5GQO A;  1P8L A;  1IBK L;  4YWM A;  3HKS A;  3F2B A;  4DR2 Q;  3FKI G;  2XGT A;  2Q2T A;  4HIK A;  1KD1 C;  4JI6 L;  4X6A H;  3U4Z A;  4DV1 L;  1X55 A;  2JA7 H;  4DUZ Q;  4JI0 Q;  2GVA A;  5M5W H;  5FLM G;  4A76 A;  1TWH H;  3AEV A;  3TRE A;  5FJ8 H;  5IP9 H;  2UXD Q;  4JYA L;  5JJI A;  4GNX C;  1HZC A;  4DKA C;  3M4Q A;  3PUZ A;  1SN8 A;  5FLX c;  4R4I A;  2YTX A;  5C4X H;  1NY4 A;  4JI2 L;  3T1H Q;  2UUA L;  5IE8 A;  3GDE A;  1YI2 A;  2IY5 B;  3RN2 A;  1AE3 A;  4NPS A;  4JI7 L;  3MEF A;  4LW1 A;  2RHQ B;  3H3V H;  1IBL L;  3PO3 H;  2JK8 A;  3U4V A;  3CCS A;  1OXV A;  4DV6 Q;  5LMN Q;  3IRB A;  1AE2 A;  5M3F H;  4A3J G;  1WCM H;  1IBK Q;  1LYL A;  4BY1 H;  2RHS B;  2VZA A;  1ASZ A;  2UXC L;  3M4O H;  5H1S E;  4R4Q A;  2JA5 H;  1JB7 A;  4MZ9 A;  4IOC A;  4JI6 Q;  3PCO B;  4DV1 Q;  1C9O A;  3ULL A;  3U58 A;  1VCI A;  3UDI A;  3GTJ H;  2IHF A;  4DV0 L;  1Q1B A;  2EXD A;  4QJF A;  4DAM A;  4A3K G;  3W1G A;  1KQS A;  1BBW A;  2MO1 A;  1VQO A;  4B3S L;  1RIP A;  2ALY B;  4MNO A;  4JYA Q;  2D0P A;  3HOU G;  4LF8 L;  2JJQ A;  2K50 A;  1VQ9 A;  1A8V A;  4C3H H;  3K0X A;  1TWA H;  5C3E H;  2MNA A;  2ID0 A;  1GO3 E;  4LF6 L;  2E2H H;  5HY6 A;  2OCE A;  1FGU A;  4H02 A;  1YHQ A;  2UUA Q;  1SMX A;  1EOV A;  3RLF A;  4DV7 L;  4JI7 Q;  3HOW H;  2R7D A;  1Q1E A;  1WFQ A;  4J15 A;  1IBL Q;  1V1Q A;  4BA2 I;  4DR7 L;  4A3D G;  3F1Z A;  3CC7 A;  1K3R A;  1SRU A;  3UE1 A;  1CUK A;  2KBN A;  1B8A A;  4DR6 Q;  4YCV A;  1EIF A;  4R1J A;  1W3S A;  4GOP B;  4GOP A;  1C0A A;  3MXN B;  3KOJ A;  4AH6 A;  4GLV B;  3PUY A;  4A3I G;  4BBR G;  1YJN A;  3CW2 C;  4LF9 L;  1NBW A;  3CD6 A;  1YHB A;  3HOV H;  1E24 A;  3S1M H;  2NZO A;  4YCU A;  1VQ7 A;  2UU9 L;  4B3S Q;  3SGI A;  5ELN A;  3WWV A;  2R6G A;  2Q2H A;  1IBM L;  2F4V L;  4LF8 Q;  4GKK L;  4JBM A;  4A3M G;  1HH2 P;  2Y0S G;  1YNX A;  4X66 Q;  2NVT H;  1A63 A;  1U0L A;  3RZD H;  3NEL A;  4LF6 Q;  2VUM H;  1EQQ A;  4LF4 L;  1BVS A;  3HOY G;  4R4T A;  4OON A;  4JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...