1SR3A

Solution structure of the heme chaperone ccme of escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
LRSNIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEKGNHILAKEVLAKHDENYTPPEVEKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Heme Chaperone Ccme Reveals a Novel Functional Motif
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords APO-CCME
total genus 14
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sr3A00
1KAWA 1SROA 3A0JA 3KYHC 1J5EL 1GM5A 2NZHA 4BBSH 4B3SQ 4JI7Q 4BXXG 2KCMA 1MIUA 2NZOA 1PH3A 5LMNL 1N32L 4NPSA 1TWFH 2ZTEA 1PH1A 3ICEA 3RNUA 3MXNB 1HR0L 4A4IA 4EQ5A 3FHWA 5FLMG 1EQRA 1EQQA 5GAGC 1HNZL 3F1ZA 2XTIA 4AIMA 2R92G 4GOPC 1YVCA 1Q8KA 1K73C 1YJNA 4JI3L 2BH2A 2AWOA 3AFQA 4GN5A 4GNXB 3HFZB 1OXXK 1TXYA 4JBJA 1L1OB 3K7UC 4R1JA 4HJ8A 4DR5Q 1I94Q 3PF4A 4DV6L 3S15H 4UPAA 4DKAC 4C3HH 3M4OH 4GKKL 4L5TA 3UDXA 3KLWA 1E3PA 3K0XA 2RCNA 3HOVG 1Q81C 2N3SA 3D31A 2K52A 4NB3A 3W1GA 4JI4Q 1XNQQ 3H3VI 3HOVH 3HOZH 3LGJA 2UUAL 4B3SL 5LMNW 1AH9A 3F2BA 3I4NH 3PO3H 5C4JH 3L2PA 2E5LQ 3CQZH 4BBSG 1D8LA 2UXBL 1SLJA 1JB7A 1RL2A 3KJPA 5JEAG 2ID0A 4YCVA 3KDFA 3RLOA 2WP8J 2PQAB 1VQLA 2UUAQ 4JBWA 2B63G 4WJ3M 5AJ3L 5JEAJ 3T1HQ 5C3EG 1OXVA 4JI0L 4NXMQ 3PUZA 4QQBX 1WI5A 4GLAC 3CCEA 2HIXA 4ALPA 1SR3A 1QVCA 4DV0Q 2HQLA 1GVPA 5IP7G 1G291 1Y14B 2JEAI 2H5XA 1HZBA 1K8GA 3S24A 2BA1A 4HJ7A 2K50A 4OWTB 1W2BA 4JBMA 2BH8A 2PNHA 2YU9H 4A3MH 1CSPA 1L1OC 3CP0A 4PZ6A 1V9PA 5M3MG 4X66Q 2MNAA 4IOCA 1MJCA 1HNXQ 4AQYL 1IBML 3G48A 1IL2A 2ASBA 4LFBQ 4IFDG 3STBD 3K81C 1BBWA 1TWCH 4QJFA 1EIYB 2UUCL 1HNXL 3KOJA 3HKZE 4BBRG 4LFAL 4P71A 1JJGA 2Y0SG 4DNIA 3AQQA 4OO1G 5IYCG 3S2DH 3OTOQ 4GKKQ 2R93H 1GKHA 1WYDA 5ELNA 2LXKA 1A8VA 1KL9A 2ZJRA 1S72A 4BY7H 1XPUA 4X64L 2B29A 4DR5L 2R7ZH 4TVAB 1VQ6A 1LTLA 3TEHB 4DK3C 1HNWL 2D62A 1N36L 1K83H 1VQEA 2VUMH 3ULLA 4LF6L 3NELA 2R7DA 2B3GA 4LFCL 3JAMi 3GDEA 4OO1I 4A3LH 4YWMA 2L15A 4RMFA 1UE5A 2JA7G 1TWAH 2KCTA 3VDYA 1PH9A 5LMUQ 2Z6KA 3RN5A 1N33L 1UE7A 5J3BA 4JC0A 4LNQA 3J81c 5C44G 4HJAA 1L0WA 4A3FH 1YI2A 1X3EA 4GNXC 1VQFA 2UU9L 2RHSB 2VL6A 3PIOA 1XPRA 2HT1A 3CCRA 3M9BA 3KDFB 5EAYA 2E8GA 5C0XJ 3NENA 3CCSA 2JEBI 4JI7L 4LF7Q 1K3RA 1HNWQ 2IHFA 3F2CA 4DUZQ 1VQGA 3D0FA 1QVFA 3J80c 3M4PA 1HZAA 3EN2A 4DV6Q 2R7FA 2VUMG 4A93G 3AFPA 1XMQQ 1EOVA 3DLLA 1WCMG 5M5YH 3RLFA 3L7ZC 4K0KQ 1UWVA 1NBWA 2PI2E 1NE3A 3M4QA 3PCOB 4JYAQ 1KXLA 2IX0A 2CCZA 1VQDA 1VCIA 2GN5A 4DR7Q 3CMAA 2N8NA 2B63H 4XIGS 1QZHA 2Y0SE 4X6AH 3J7ZC 5BR8Q 3UDIA 4LF7L 3HKZG 1YBYA 1VQ5A 1YEZA 4YY3Q 4BBRH 1PVOA 1WCMH 2UU9Q 4PG3A 4DR1Q 5HGQA 1AE3A 1Q7YC 2UUBQ 4B3TQ 5E7NA 2AMCB 2A19A 1QZGA 4GKJQ 3ERSX 1IXRA 2EIFA 4J15A 4AQYQ 1FVIA 2KENA 4A3IH 1N33Q 3CPWA 2YV5A 2DGYA 5M3MH 2VQFQ 2R6GA 3FKIH 4GN3B 1YNXA 4P73A 1IBKQ 1XNRL 2PQAA 3FP9A 1RIPA 2WB1E 1WFQA 1VQCA 4AH6A 1X3FA 1XJVA 1G51A 4JI5Q 4A3LG 4OONA 4DV1L 1G6PA 2OQKA 2CQOA 1I94L 4DR7L 1HH2P 2Q2TA 3HOXH 5C0XI 4LF9Q 4R4TA 4B3RL 4PZ8A 5H1SE 3G71A 3AEVA 1UEBA 3F8TA 2VQFL 1XMQL 1P8LA 2JA5H 2F3IA 2OTJA 3I4MH 4IO9A 4IPGA 1JJCB 1SMXA 1KQSA 1CKNB 4DR6Q 1HR0Q 4B3TL 2JA8G 4DR1L 1FGUA 2MO1A 4IJLA 1XMOL 4DV4L 2ES2A 5BR8L 4YWKA 4BA2I 1Y1VG 4OX9L 1VQPA 4YHHQ 4QGUA 4A3BH 4JBKA 3A5ZB 1Q1BA 2NVQH 4DV5L 4OWWB 4QL5A 2OTLA 1BBUA 5LMUL 4LF5L 1QUQB 2BA0A 3HOUG 4DV0L 5ELOA 4JI5L 4P75A 3CPFA 4UP9A 4DR2L 1EIFA 3NEMA 2RHQB 1N34L 4WJ4A 3J81i 4JOIA 2R92H 5FJ8G 3RLNA 2VNUD 1N36Q 5JJLA 4MNOA 2K5HA 2HHHQ 3PUYA 4DV7L 4JI6Q 5M3FG 2E2JH 2E5LL 1VQBA 1CKOA 4MTNA 1JMCA 4A3CH 4LUOA 2VW9A 2NVYH 4BXXH 5IWAL 2ZM6L 3K80C 1N9WA 3GTQH 3PUVA 1NY4A 1BKBA 3CMEA 4LFAQ 3TRZA 3S2HH 3H0GG 1XMOQ 2JE6I 2WB1G 1LYLA 3CD6A 1PV4A 1YHBA 2F52A 4O2DA 3GTJH 4HJ9A 3ER0A 1XTDA 1IBMQ 2KHJA 1YJWA 1EYGA 4R4CA 1TWGH 2HHHL 3STBC 2RF4A 2D0OA 4A76A 1E22A 1OXUA 2C35B 1C9OA 4JV5L 2XGTA 4NXNL 5IE8A 5IP9H 4LF9L 1PH4A 1KHIA 1ASYA 4X62L 4UP8A 1VS0A 3EIVA 2WFWA 2IHEA 4KHPQ 1X65A 1XPOA 1S3OA 3K7AH 4ME3A 3TS2A 5C3EH 4YHHL 2YYZA 4LW1A 1IZ6A 3PO2G 2F4VL 1V43A 2K5NA 3CCJA 4DUYL 5HY6A 1KRSA 4DR3L 3A74A 3T1HL 1IBKL 4JI0Q 1IYJB 5C4XG 1X56A 1Z47A 1VQ8A 1FJGQ 4OXPA 2HIVA 1PYSB 2JA6G 4A3GG 1NJIC 2E2IH 1SFOH 3RZOH 3KFUA 2CWAA 3S17H 2I5MX 1WOCA 2OWOA 1X54A 4A3IG 4TQUS 1K0RA 4JI2L 5LMNQ 4A3KH 1PH5A 1UE1A 3M85A 2JA5G 1VQJA 5IT9c 1N32Q 3E9HA 1I50H 3PO2H 1NTGA 2VY3A 1R9TH 4DR4Q 1JJ2A 1PYBA 1L2FA 4LUVA 4IFDI 3OYYA 2WAQE 2MQHA 1JE5A 2Q2IA 4AYBE 2I5LX 1H95A 1FL0A 2JA9A 3HOXG 1NMFA 5M5WH 3CXCA 4HIMA 1KIXA 3BZKA 2EQSA 4DV3Q 1PH6A 1K8AC 5AJ3Q 1VQNA 4DR2Q 1VQOA 1X6OA 1XNRQ 1D7QA 1A0IA 2JJQA 2VQEL 4A3JG 4GNXA 2I0QA 3DM3A 1VQ4A 2UXBQ 4LWCA 1PH8A 2NN6G 5IYBG 3GO5A 1OTCA 4OX9Q 3EBEA 2UUBL 1LM0A 4A93H 2AKWB 2NVXH 2QA4A 3J7A5 4APVA 3W1BA 4DV2L 4UY8C 2UXDL 3BZCA 4MZ9A 4A3MG 1SN8A 4A75A 2QGQA 2JK8A 3GTKH 4LFBL 4XTCS 4HJ5A 1FJGL 4KHPL 3RZDH 3PSIA 3RR5A 2YTVA 4H02A 4A3DG 1MKHA 4BY1G 4LF8Q 3H15A 2Z6KC 4JI3Q 4LF6Q 3GTOH 4NXML 1L1OA 1U5KA 1N34Q 2LXJA 2K4KA 1PH7A 3S1MH 4YCWA 1CUKA 2YTXA 2Q2UA 3UE1A 4R4OA 4BA1I 2UXCL 3JAMc 4YCUA 1Y1VH 5DLQE 5GAEC 3T1YL 2YTYA 2K14A 5IP9G 3I2ZA 3CCVA 3I4OA 1BVSA 1VQHA 3CCMA 1HZCA 4JI2Q 4C3IH 1B70B 4DK6C 3KJOA 3B6YA 4A3KG 3PUWA 4IFDJ 1IBLL 4C2MH 2VZAA 1OXTA 3PV0A 4PZ7A 2IX1A 3L0OA 4L5QA 1IBLQ 4GOPA 4DV7Q 1VQ7A 1OXSC 4JI6L 2QEXA 4X65Q 2VQEQ 3GD7A 3J81j 4C3JH 2JA7H 4JI4L 3PGZA 1C7YA 3TS0A 2F4VQ 4R4QA 1P16A 2CFMA 3CC7A 3BU2A 4LF4Q 3T1YQ 1AE2A 2GVBA 3CCQA 3UDGA 5JJKA 1Q12A 3WWVA 5M5XH 2MFIA 2MO0A 4IPCA 4EX5A 4A3EH 3S14H 4BY7G 2OCEA 4X62Q 4LF4L 4LUZA 4B3ML 1V1QA 5GROA 1LUZA 1DGSA 1A63A 1B7YB 2ALYB 3GTMH 2OQ0A 4JV5Q 1Y1WG 3CCUA 3I55A 3E9IA 1HNZQ 3TREA 3HOYH 3U58A 2IY5B 5FJ8H 1VQAA 1Q1EA 4DUZL 4DR6L 4A3GH 1Q46A 2EXDA 2N49A 4GLVB 1K9MC 1EWIA 3CAMA 5C44H 1PH2A 4DAYB 3MEFA 1VQ9A 4QY7A 4RG1A 5C0XG 3HOWG 1NMGA 1XNQL 2KBNA 4R4IA 2JQOA 3UDFA 4DV4Q 4DUYQ 3GTGH 5IWAQ 2ZM6Q 2I5HA 3S16H 3U4ZA 3OW2A 1VQMA 3KF6B 1YZ6A 1KD1C 4P72A 5C4XH 1Q86C 3CCLA 2UXCQ 3M7NA 2K5VA 3CF5A 3G4SA 1QVGA 1Y1WH 1YHQA 4JI8L 2ATWA 1VQIA 3JC66 1UE6A 1W3SA 1O7IA 3FKIG 3KF8B 2ZTCA 3W5OA 4X65L 2A8VA 1PFSA 1CKNA 3NBHB 4Y52H 1B8AA 4KHZA 3ULJA 2KHIA 4JG2A 3HOWH 2R7ZG 1T9HA 4GKJL 3I7FA 4BY1H 5K36G 2LSSA 2V1CC 4DR4L 3CW2C 2FXQA 2IT1A 3A5UA 4HIOA 1HZ9A 3IRBA 1SRUA 4JI1Q 1E24A 2DUDA 4YWLA 4KLKA 4GOPB 2A1AA 4L5SA 2AHOB 2Z0SA 3PUXA 3S1RH 3ZJYC 5IYDH 1JT8A 3PO3G 5IYDG 3RN2A 5M3FH 1J5EQ 4DAMA 3S1QH 4HIDA 4PMWA 4IPDA 3U50C 2WAQG 2N78A 4AYBG 1I6HH 4A3JH 1GD7A 1J6QA 3SGIA 4X66L 4YY3L 2VS1A 5IYBH 2D0PA 4LFCQ 4GN4B 3GTPH 1CSQA 4K0KL 2PMZE 1PA6A 4P74A 4O0AA 4JI8Q 1QUQA 4JCVE 4FDBA 2CKZB 5IP7H 4IPHA 2E2HH 3J80i 1CKMA 1N8RC 1E1TA 2R93G 4QIWE 2ZJPA 3AYHB 3S1NH 4HIKA 5IYCH 4A3BG 4IOAA 4JYAL 1C0AA 1I5FA 3E0EA 4IJHA 4OWXB 2GVAA 4JOIC 4UP7A 1YITA 3HOUH 3BJUA 3HOYG 3G6EA 3I56A 3ULPA 1M1KC 3H0GH 4DPGA 5JJIA 1GO3E 1WJJA 5GQOA 1ASZA 1X3GA 5IY0A 1TWHH 1A62A 1Z9FA 3Q8DA 1U0LA 2JA8H 5FLXc 3I4MG 4POGA 4GS3A 4DV2Q 1X9NA 2UXDQ 2ZJQA 4KI0A 3HOZG 2NN6I 1S40A 1Q82C 1E7ZA 4B3RQ 4DR3Q 1YIJA 1YJ9A 2JA6H 3KF6A 1HR0W 4JI1L 4POFA 4A3CG 4B3MQ 3F2DA 4GLXA 2ZTDA 1I3QH 3PIPA 1X55A 4A3FG 1KC8C 1YHAA 3K8AA 1SE8A 5GAHC 4DV1Q 1E1OA 3PF5A 4A3DH 2PI2A 2K75A 3HKSA 3U4VA 4A3EG 3M3YH 3CC4A 1MJEA 2CWPA 5FLMH 3OTOL 1PHJA 2Q2HA 4L5RC 4Y7NH 4DV3L 1HJPA 4NXNQ 2NVTH 3H3VH 1EUJA 4LF8L 3UE0A 1EFWA 1VQKA 2AWNA 4X64Q 4LF5Q 3TQYA 2UUCQ 3CC2A 5GADC 4DV5Q 1M90C 3GTLH 3I4NG 1KRTA
chains in the Genus database with same CATH superfamily
1KAWA 3A0JA 1J5EL 2B8GA 4BXXG 5E1FA 1MIUA 5I2YA 2ZTEA 3MXNB 4EQ5A 2M9VA 1EQRA 2SNSA 1EQQA 2R92G 5I4DA 1DJRD 1RTOA 2L55A 3MA2B 2CVRA 1CHPD 3SXHA 5HGTA 3HEJA 3AMUA 4JI3L 2AWOA 3AFQA 2R93B 1Y69U 1TXYA 4JBJA 3K7UC 1I94Q 2LKVA 3DWAA 1K0SA 3PF4A 1PTOF 4UPAA 2WACA 2HD3A 1S5CD 3UDXA 1K83B 1F2YA 1Q81C 4A93G 3BVMA 1XNQQ 4DAVA 1CZGA 4B3SL 3V96A 3MVVA 5C4JH 3FEWX 1HFGA 3QIAA 1JB7A 3M3YB 5KNCA 5AJ3L 5C3EG 3MXUA 1WI5A 4GLAC 4EGVA 2PMZB 1T5EA 2HIXA 1SR3A 1F9QA 1G91A 2VXWA 3GTJB 3LX0A 2JN4A 3S24A 4A3GB 3MXPA 3TP6A 1ENAA 3DM1A 4PZ6A 5M5WB 3KUPA 4AQYL 5C4ZA 3G48A 1HRJA 3T56B 4IFDG 3I90A 4EQPA 3Q0AA 2SDFA 1EZ8A 3ONAB 2OT2A 3S2DH 3DEPA 3HZXA 2R93H 1GKHA 1WYDA 3DXJC 3OWFA 4L6TB 3CKIB 5IIFA 2ZJRA 4DR5L 4QCLA 4K5VA 1LTLA 4DK3C 1HNWL 1K83H 2VUMH 2NYZD 4LFCL 3GDEA 3OOCA 1KNEA 1UE5A 4RMFA 3VDYA 1I4QA 5CBAE 4JC0A 5DAUA 3J81c 4PMBA 1L0WA 4OL7A 2OF1A 4QUCA 2VB2X 1BR9A 3PIOA 1XPRA 3DWPA 1QE6A 1J8IA 5C4XB 3QJYA 4JI7L 2JEBI 2ZXOA 3F2CA 2F3WA 1VQGA 1QVFA 3MXNA 2VUMG 1PTOC 3AFPA 1EOVA 4Q0FA 3RLFA 3L7ZC 1NE3A 1LT3D 1RTNA 2O4XA 2IX0A 3FPUB 5ELFA 3M4OB 1VCIA 2GN5A 1SE4A 2EJFC 3CMAA 2NB0A 2B63H 2B2VC 4XIGS 1QZHA 1TWCB 4X6AH 1LLRD 1DOLA 1YEZA 3AB9A 4BBRH 2XN9C 1Q7YC 4B3TQ 5AFWA 2QF7A 1QZGA 2F1MA 2MPMA 3GQBA 1FVIA 2E74C 2SNMA 3ND8A 1EY7A 2X6LA 3FP9A 3S17B 4AH6A 1KTKA 1G6PA 2Q2TA 1MD2D 3OMCA 5I6YA 1HPCA 2MHVA 5LL6S 5I6WA 2B8FA 4RFBA 3QB3A 1UEBA 1XMQL 1P8LA 2JA5H 5C5LA 2F3IA 1VF7A 4IO9A 1JJCB 2KA7A 4R9WA 4O1NA 2J7ZA 1D5MC 1CQVA 1K8OA 1EEID 1HCZA 2Q8TA 2ES2A 1E2ZA 3A7LA 1JWUD 1Y1VG 3H09A 4OX9L 1PZID 1NSNS 4QGUA 4N9TA 1F2ZA 4DV5L 4QL5A 1VDZA 1QUQB 4LK1C 4RA8A 3PQIA 3TP8A 1STGA 4IN3A 4WJ4A 2VNUD 1N36Q 5JJLA 4MNOA 4IURA 1DZ1A 2K5HA 4BBSB 3HS0C 3I91A 3VYTA 1VQBA 3Q22A 4A3CH 1JMCA 3PIP3 3RZDB 2ZM6L 1N9WA 3GTQH 2F03A 3PUVA 3CMEA 4ILWA 4LFAQ 5BN4A 3H0GG 1LYLA 1S5BD 3U9SA 1SYCA 3GTJH 4B08A 3D4DA 1YJWA 2A69D 2EY2A 3NBIA 4CDFC 2RF4A 2B2UA 2D0OA 1E22A 2C35B 4OELB 1C9OA 1V1PB 4JV5L 2XGTA 4NXNL 1GHKA 1PH4A 4X3UA 2AQ1B 3K57A 2IHEA 4NP5A 2K28A 4ME3A 1QNUA 2D2CC 1IZ6A 1V43A 2K5NA 5E4WC 4DR3L 3T1HL 1KRSA 1X56A 1Z47A 1VQ8A 1FJGQ 1H9KA 1B50A 2HIVA 1PYSB 4A3GG 1RF2D 1HFNA 1HA6A 5IT9L 2E2IH 4XT3B 2RA4A 1O7YA 3U9OA 1MGSA 1STAA 3WOFA 1X54A 4A3IG 5LMNQ 1UE1A 1ZEQX 3NXWA 5IGBA 3PO2H 1NTGA 2VY3A 2K5QA 4DR4Q 3VYUA 3OYYA 2Z4IA 2MQHA 2JA6B 3CXCA 3K5OA 1PH6A 2QW7A 4XYOA 3OPOA 3KBGA 4DR2Q 2JJQA 4A3JG 2A6ED 3DM3A 1R4PB 1GHJA 2NVXH 2CW0C 2QA4A 3FVQA 2UXDL 3BZCA 4MZ9A 3KBXA 4OIJA 4A75A 4LFBL 2JK8A 1GUOA 4XTCS 4HJ5A 1FJGL 4KHPL 3RZDH 3PSIA 2YTVA 1M8AA 2F4IA 2Z6KC 1L1OA 2N55A 3MFYA 3S1MH 2Q2UA 1ZXTA 2YTXA 5C4HA 2JYOA 4R4OA 3UE1A 2VUMB 2CQAA 3KF8A 1SEBD 2EDGA 4C3JG 2E2DC 5CORA 1Y1VH 2JSOA 5GAEC 1L0XB 4JW0A 1VQHA 1K3BC 3CCMA 5FLXE 1B70B 2A6HC 4CGYB 2WINB 4FO2A 4C2MH 4KY7A 1I6VC 1OXTA 2IX1A 4L5QA 4C1NI 1VQ7A 2AUKA 1U9RA 3GTPB 2DNCA 3BDOA 3CC7A 4LF4Q 2GVBA 3CRLC 1Q12A 5JJKA 3WWVA 2MFIA 4UHVA 4A3EH 3BVZA 2OCEA 4LF4L 3M4YA 1V8QA 3NPPA 1SXTA 4TRDA 2PYKA 5C6AA 3HOYH 1H9RA 5FJ8H 1Q1EA 1OO9B 1Q90A 1UAPA 2B2VA 5C0XG 5I9PA 1NMGA 2K1BA 2F0KA 4DAYA 2JQOA 1SJHD 2E76C 3N52A 5A2QE 2L4NA 3CCLA 1VMCA 3GV6A 1YHQA 2ATWA 1C8CA 1UE6A 2E2JB 4CDDC 1ENCA 1U4LA 1L0YB 3FKIG 4G7HC 2ZTCA 2RSNA 2OXPA 1CKNA 4C2MB 1B8AA 4K8JA 4GKJL 5K36G 4DR4L 4HIOA 4OEMB 1SRUA 4YWLA 2A1AA 2Z0SA 3PO3G 2QKIC 5M3FH 3RN2A 1J5EQ 3GP7A 4PMWA 4B9WA 4IPDA 3U50C 2WAQG 4AYBG 1FNVA 3P1HA 4A3JH 1GD7A 4KN7C 4X66L 4LFCQ 1LTTD 2D0PA 3FRPB 4PNYA 4K0KL 2K01A 5EKKA 5IP7H 2CKZB 2BCOA 2E2HH 1G2SA 1E1TA 4QIWE 2EYLA 2PZWA 3SDZA 3W2DA 4OWXB 2GVAA 5KNBA 1M1KC 5GQOA 1JOQA 1X3GA 5IY0A 1TWHH 2JA8H 1I50B 2L9HA 4POGA 1IYUA 4KI0A 2NVTB 1Q82C 4ULLA 4WFN3 1FD7D 4B3RQ 2F0TA 2PZTA 3F2DA 4A3IB 4A3FG 4IUVA 3X3NA 3PF5A 4DV1Q 3A54A 4FXKC 1NR4A 2K32A 4L5RC 4DV3L 3H3VH 4NXNQ 1SFOB 5D3DA 4DV5Q 2QCPX 3KYHC 1I6HB 1JICA 2KCMA 1LV9A 3GTKB 4NPSA 1TWFH 4Y7NB 2AQ2B 2PPBC 1HR0L 4A4IA 3FHWA 5GAGC 4F8MA 3F1ZA 2RKSA 4AIMA 5JJZA 4GOPC 1H9SA 2KQ3A 2B2WA 5EKLA 4DA2A 4XDXA 1CHQD 5M3FB 2BH2A 2KEEA 4GNXB 3E0JA 1JWSD 1ET9A 3KLSA 1WTRA 4R1JA 3J81L 1KLGD 4DV6L 2M00A 5C44B 2WB1B 3K0XA 4J1MA 3D31A 2K52A 4NB3A 3W1GA 4JI4Q 3HOZH 2F0SA 3LGJA 4O42A 3J7AF 5FO9B 4I7AA 5A35A 3L2PA 4BBSG 1SDFA 1D8LA 4A3KB 5JEAG 4YCVA 2UUAQ 5DEHA 1HQMC 2EJMA 1CK1A 5JEAJ 1OXVA 1O7ZA 3HGBA 2NN6H 3FKIB 4QB4A 4BS9A 1QVCA 4DV0Q 4ZAIA 2HQLA 1SMYC 3T51B 1K8GA 4CJ2C 2BA1A 4HJ7A 1PTOD 2K50A 5CV9A 4JBMA 2PNHA 1CSPA 1L1OC 3CP0A 1BUVT 5M3MG 3R3OA 4X66Q 2MNAA 4IOCA 3L9AX 1MJCA 4OHJA 4BY7B 4LFBQ 4KHVA 4G57A 4DF7A 1CI3M 3NHHA 3K81C 1F9RA 1EIYB 2UUCL 1SJED 4P71A 4ZCKA 2Y0SG 1IW7C 4DNIA 4EQNA 3QO2A 3S14B 2BDOA 5DM63 5ELBA 1EY8A 4GKKQ 1ILPA 2A68C 1A15A 1K8MA 4X64L 2B29A 3JAME 1KABA 3TEHB 1V1OA 1SSOA 2LFNA 2F0VA 3PO3B 2ZXPA 4LF6L 2R7DA 2B3GA 2JA7G 1Y8OB 1TWAH 2KCTA 1N33L 5LMUQ 5CYUA 3C2PA 1IKMA 2BDNA 4LNQA 2FMCA 1QNKA 1YI2A 1ICWA 4A3FH 1WTQA 3IKJA 1AN8A 4BY1B 3NENA 4LF7Q 2ZT9C 2PZUA 2IHFA 4K2LA 1EY5A 1LTAD 1EYDA 1KDBA 2EPBA 3EN2A 4DV6Q 5HURA 4H7BA 4I7ZC 1MHWC 1HTLD 1ZYRC 2NWGA 1NBWA 2PI2E 4JYAQ 2NBFA 5LL6X 3SVMA 4G4KA 1YNNC 3DWQA 2L1BA 1PRTC 5BR8Q 3UDIA 1YBYA 1VQ5A 4YY3Q 1PVOA 1WCMH 3P75A 2UU9Q 4PG3A 2F0JA 5HGQA 2UUBQ 5E7NA 2AMCB 2A19A 1GUSA 3BZDB 4EQOA 3QWNA 5EJWA 1STYA 2EIFA 5CV6A 4AQYQ 2KENA 2YV5A 4P73A 1YNXA 2RQXA 1DYQA 2WB1E 4WORA 3DHQA 3I4MB 2WIIB 4A3LG 4J8QA 4DV1L 2OQKA 4DR7L 1I94L 3I8ZA 5J22A 2E2HB 3HOXH 5C0XI 4LF9Q 4ZKBB 4R4TA 4V190 5H1SE 3AEVA 3S2HB 2F0WA 3W3AA 2XRQD 1D1IA 2OTJA 4IPGA 2B39A 1CKNB 1I4RA 2CH4W 1HR0Q 4B3TL 2F0LA 4IJLA 1XMOL 5C3EB 5JOBA 1AEXA 5J1ZA 5BR8L 4ABNA 4CBVA 5T1IA 1SNDA 3VYSA 4L63B 4NDXA 4A3BH 1XTCD 1Q1BA 5LMUL 2BA0A 4KV6A 3BS1A 3K58A 4JI5L 1H9MA 4DR2L 3PIO3 1PYWD 3C1EA 4JOIA 3RLNA 3GTLB 1A3UA 1S5FD 2Z8LA 1B2TA 3RUZA 4B9XA 4JI6Q 5M3FG 4UAIA 1PFNA 2E5LL 4IUNA 5M5YB 1SMYD 4IZ8A 2NTSA 4MTNA 4LUOA 2VW9A 2NVYH 5IWAL 1TU2B 3K80C 4FYDA 1ZKOA 1NY4A 1GUWA 3S2HH 3E6ZX 1YNND 2JE6I 1SNQA 5J39A 2EYPA 3CD6A 3ER0A 3MAQA 1IBMQ 2KHJA 2HHHL 1TWGH 4A93B 3STBC 4A76A 1OXUA 2RSOA 1DD2A 2B2TA 5IE8A 3VA5A 1KHIA 1ASYA 4X62L 4UP8A 2WFWA 4A3BB 1R9TB 1PDQA 2DJGC 3NE5B 4E6IA 5KRUA 1S3OA 1XPOA 3TS2A 1QCBD 3PO2G 3VR4A 1B1ZA 2R92H 4C56C 4JI0Q 5BN5A 5KEEA 5C4XG 4ZUJA 5CC4A 1WTOA 2PNRC 1EIGA 5CV4A 2OWOA 4TQUS 1K0RA 3VR6A 2TMPA 4JI2L 4A3KH 1N32Q 3A8IE 3EJIA 3EVQA 1LT6D 2KCNA 2SOBA 1R9TH 1I4PA 1PYBA 1F2MA 1L2FA 5IODA 1H95A 4X3SA 2I5LX 1FL0A 1KIXA 5FO7B 2EQSA 2L0CA 1K8AC 1MSHA 4HN7A 5AJ3Q 1VQOA 1VQNA 1X6OA 1D7QA 4GNXA 2I0QA 1PFBA 3HRZC 3R8BA 4A93H 3A8JE 4UDUC 4K5XA 2A5HA 3KLSX 3SEBA 3W1BA 1O78A 2FINB 4FP5D 1SN8A 3J81E 2QGQA 2NVYB 3NWTA 4A3DG 3TDQA 4CKBA 4BY1G 4JI3Q 1V1PA 4NXML 1U5KA 1T5XD 1D1KA 5EPJA 2KCCA 4BA1I 2UXCL 4DXFA 5CV8A 5C3WA 4A3EB 5G3LF 5CGKA 5IP9G 3CCVA 3I4OA 1G8ZD 1BVSA 2A6HD 4F7XA 5C0XH 3KJOA 3LNNA 4IFDJ 3B6YA 3PUWA 1U4PA 4TKOB 3K6OA 3PMFA 4IFDH 1IBLQ 4DV7Q 1OXSC 2EY6A 3PGZA 2XWJB 1ESFA 5EPKA 3BU2A 1SNPA 3CCQA 4RHSA 4DNRB 2MO0A 4EX5A 3S14H 2F0MA 1WD1A 4B3ML 1A63A 4L8JA 3CCUA 3I55A 4KY5A 1PMRA 3BDLA 2CW0D 4BBRB 2IY5B 4A3GH 5FOBB 4DAYB 1AP0A 3T13A 3BYYB 3MHBA 3HOWG 1UEAB 4DV4Q 3GTGH 2KOLA 3SK4A 2I5HA 4J6HA 1PFMA 1VQMA 4P72A 4DU9A 5C4XH 1JB3A 3M7NA 1C48A 4JPBW 4KY6A 5COYA 4JI8L 2MP1A 1IHZA 2V4DA 4CKEA 1MSGA 2A8VA 3K7AB 4X65L 1ILQA 4Y52H 3ULJA 3HOWH 1STEA 1PXUA 3CW2C 3NTHA 4RGMA 1TQOA 3IRBA 5FO8B 2NUCA 1D5XC 4RGOS 3C3LA 4KLKA 2EJGC 2F0OA 1A2UA 2AHOB 3S1RH 5IYDH 1JT8A 5IYDG 2PW5A 4DAMA 1GUGA 1SAPA 3S2DB 2J4XA 2E75C 1WVLA 1AW7A 3D4RA 2D5DA 4GN4B 2F0QA 1CSQA 1PRTB 2C5CA 3P7JA 4P74A 4DK0A 2F3VA 4JCVE 4CDCC 1F9PA 3K5LA 2AQ3B 5L37A 3T4AC 1CKMA 1N8RC 2X69A 2Z6BA 1II3A 2ZJPA 1GOZA 3AYHB 1CA5A 1A6XA 1F9SA 1CA6A 3BJUA 3G6EA 2MJ8A 3MC0B 1ESRA 3ULPA 1GO3E 3C1FA 3G6JB 2C9OA 3C46A 1Z9FA 1A62A 5FLXc 3PO2B 4DV2Q 2LY7A 1S40A 1PTOB 5T1GA 1YIJA 4A3CG 3KF6A 2E2IB 1EQTA 1CFMA 1HA5A 2ZTDA 4V0BA 3PIPA 1X55A 4GLXA 1KC8C 4NKLA 4A3DH 3VR3A 1O80A 2PI2A 3HKSA 3U4VA 4A3EG 1MJEA 4HTHA 3OTOL 1XXGA 2NVTH 1HJPA 3TSSA 1K28A 2A74C 2AWNA 2F0HA 3TQYA 3CC2A 1TVXA 3GTLH 5FJ8G 1NR2A 1GM5A 2NZHA 2EYHA 4B3SQ 4BBSH 1DM0B 1BXTA 2NZOA 2IWHA 2XSCA 1PH3A 1N32L 5ISRA 1PH1A 2F0FA 2ZXRA 3ICEA 1QJOA 3RNUA 3K0YA 3ZYYX 4LJZC 1GJXA 2NVQB 1PRTF 4Z9CB 1G2TA 3E3XA 1Q8KA 1K73C 4CHTB 4HJ8A 1WD0A 3A56A 3IFDA 3S15H 4C3HH 1EY4A 1X3QA 5D14A 3MEHA 4GKKL 4L5TA 1BO0A 4HCEA 2ICIA 2RCNA 3E5SA 3H3VI 3HOYB 1EL0A 4MIUA 1AH9A 3F2BA 3PO3H 5K5PA 1B53A 2E5LQ 3CQZH 1AFPA 2ENBA 3NWSA 3RMHA 1BCPB 1SLJA 1RL2A 3KJPA 2ID0A 3KDFA 3RLOA 2WP8J 2PQAB 3MFGA 2EYOA 2B63G 4K5WA 4JI0L 2L11A 2G9HD 3CCEA 4ALPA 1Y8PB 5IP7G 2H5XA 3HOUB 1ML0D 4FXDA 3Q24A 2B2YA 1W2BA 3F2UA 1B4OA 2BH8A 2XRSD 3SR1A 4A3MH 3QG1A 4HR7B 4ZK9B 5IT9E 4ZUIA 1IBML 1IL2A 2ASBA 5JPMC 2EY5A 1BBWA 4QJFA 5EGTA 4N9PA 4RCOA 2B2UC 3HKZE 3TBIB 4BBRG 4LFAL 1RODA 1TS4A 5CMDA 4OO1G 3OTOQ 1U4MA 3J7AV 4R8NA 4RCNA 3R2IA 1VF5C 1KL9A 4BY7H 1BDOA 4EVOA 4C3HB 2R7ZH 1VQ6A 2D62A 4OIKA 1VQEA 1A3TA 3TN2A 1H9SB 4OO1I 1HNWQ 2L15A 1IKLA 2Z6KA 2NZ1D 4FF2A 4FNFA 1CTMA 5C44G 4HJAA 1JCKB 4GNXC 3IAYA 1VQFA 2UU9L 2VL6A 3EQLC 1UUPA 5FK9C 1KDCA 3M9BA 3Q23A 5EAYA 1LABA 5I2XA 1BCPD 2DJFC 1WTVA 1ONLA 1K3RA 4DFAA 3GTOB 2NVXB 4F88A 3M4PA 1EYCA 4N8FA 2R7FA 3DLLA 1WCMG 2L5TA 5M5YH 4KKTA 3MTSA 2KVMA 1UWVA 3TZUA 1KXLA 1SYGA 2QILA 1VQDA 1SYBA 4DR7Q 2XIWA 3ERQA 5M3MB 1M4VA 2KECA 2CHBD 4LF7L 3HKZG 2JP1A 2F0NA 5JAVA 1DONA 1AE3A 3OMGA 3ERSX 1IXRA 4J15A 2XNAC 3CPWA 3I3CA 2DGYA 1IL8A 2R6GA 4GN3B 4CDEC 1IBKQ 4HCSA 2PQAA 2Y0SB 1BOSA 1WFQA 5JVH3 4HMJA 1XJVA 1X3FA 2HDLA 4OONA 5C5MA 1HH2P 1RDPD 1BF4A 4NMZA 3I70A 4B3RL 1SNOA 3G71A 2VQFL 5JEAH 3DEOA 3I4MH 3G7LA 1JOKA 2EYMA 1XX8A 3SE0A 1KQSA 1S5ED 4DR6Q 1QOHA 1FGUA 2MO1A 4LMQD 3CRKC 4DAPA 5CR3A 4QIWB 4IUPA 4BA2I 4XYQA 1VQPA 4JBKA 3A5ZB 2NVQH 1BBUA 4H44C 4LF5L 3HOUG 3X3MA 4DV0L 1S4ZA 4P75A 4UP9A 1EIFA 1N34L 2RHQB 2MGSA 4K14A 2HHHQ 2QDLA 3PUYA 3GTGB 1Z6HA 2E2JH 1PZJD 2Z9HA 4BXXH 2B2YC 4C3IG 1BKBA 2BE5D 3TRZA 1XMOQ 2WB1G 1DOMA 2GA4B 2F52A 4O2DA 1EYGA 4R4CA 1TY0A 1EY9A 4LF9L 4S3SA 5JVG3 2IL8A 3EIVA 1CM9A 1R4QB 1I4GA 1RJTA 4KKSA 1XYIA 2DNEA 3CCJA 4G7OC 4DUYL 5HY6A 3A74A 3NTKA 1IBKL 2SEBD 1IYJB 4KJNA 4PMCA 3EFXD 3DMUA 3RZOH 1SNCA 1SYDA 1SFOH 2CWAA 3KFUA 3H6MA 4FF1A 3A8KE 3S17H 2I5MX 1WOCA 1PH5A 2JA5G 3M85A 4A3JB 1VQJA 5IT9c 5KNDA 3VYRA 1KAAA 1SBBB 1JJ2A 2N88A 2YU9B 1JE5A 2Q2IA 2RCFA 4FXGC 1EU4A 2JA9A 3HOXG 5M5WH 3BZKA 4JVZA 4DV3Q 1A0IA 1HTPA 2R3ZA 4LWCA 5IGGA 2NN6G 5C3XA 3J80E 1YNJD 4PQXA 4OX9Q 3EBEA 2UUBL 1WTXA 5E3FA 3GTQB 2AKWB 3NQIA 3TZDA 4DV2L 4I65A 4WRDA 5K36H 1EU3A 4LF6Q 2PCFB 3NK9A 3S16B 2LXJA 2K4KA 4YCWA 1LACA 1CUKA 3JAMc 2PW7A 1HQRD 3K5MA 4YCUA 3T1YL 2YTYA 2LMCB 3I2ZA 4H0LC 1U4RA 3ND9A 4RHRA 1FGBD 3OHXC 1HZCA 4JI2Q 4DK6C 1B3QA 3GTMB 2A73B 4HAEA 2F0EA 1TIID 1BQQT 3PV0A 4PZ7A 3L0OA 4GOPA 5IGDA 1LTBD 4X65Q 3P20A 2VQEQ 1C7YA 3TS0A 4R4QA 1P16A 2F0UA 4WJWA 5G3LD 3UDGA 1RD9D 5M5XH 4IPCA 1W6KA 4X62Q 3FDTA 4LUZA 3CQZB 1NUCA 1E0BA 1V1QA 4R8IA 5CV7A 4C3IB 1PLFA 3H3VC 1FNUA 3GTMH 2OQ0A 4JV5Q 1Y1WG 3SK5A 3Q6SA 2VB3X 3E9IA 1HNZQ 3U58A 4OO1H 1VQAA 4DUZL 4DR6L 2EXDA 2N49A 4K2KA 3MEFA 1BCPC 4C3JB 4RG1A 2DY8A 2KBNA 4R4IA 3UDFA 1B3AA 1PTOH 4ME5A 5IWAQ 4ZYSA 3S16H 3U4ZA 3OW2A 1EYAA 3KF6B 1YZ6A 1KD1C 5C4JB 2HCCA 1Q86C 2UXCQ 3G4SA 1QVGA 1Y1WH 1VQIA 3JC66 1A2TA 5D65A 3D6WA 4H13C 1MBYA 2IPKD 1I4XA 1PFSA 1YNJC 3W5OA 3NBHB 3H91A 2R7ZG 3SK6A 1NAPA 1T9HA 1JORA 2LSSA 3D4WA 2FXQA 4JI1Q 1E24A 3BDCA 1SNMA 2DUDA 2G5DA 4KKUA 4L5SA 3PUXA 5CV5A 3ZJYC 1CQFA 2DN8A 3BYTB 4XQQA 5LHY1 3L3OC 2WKCA 1LTGD 4HIDA 4M8AA 2N78A 2B2TC 3D3RA 1J6QA 3SGIA 2Q8RE 5IGFA 2O5IC 1Z7TA 5DNFA 2PMZE 1PA6A 4O0AA 1JC7A 4GZYC 2K05A 4FDBA 3OW7A 4IPHA 2R93G 4HIKA 5IYCH 2FMMA 4A3BG 4JYAL 2H4OA 1I5FA 3E0EA 4UP7A 3KLRA 3NBHA 1SYFA 2HCIA 3I56A 3H0GH 1WJJA 1ASZA 2R61A 1U0LA 2JXMB 4GS3A 4IUUA 2ZJQA 3HOZG 4HEDA 2WV6D 1NNXA 4OGQC 2JA6H 1LTSD 4JI1L 4POFA 1C4QA 3I4NB 1YHAA 5GAHC 1E1OA 1ET6A 5TSSA 1S5DD 5JPNC 2DY7A 2JA5B 2CWPA 5FLMH 2Q2HA 3NTIA 4Y7NH 2KHSA 4LF8L 3UE0A 3S1RB 4X64Q 2HUGA 4LF5Q 2F0IA 1J9OA 3JAML 1M90C 1KRTA 1SROA 4JI7Q 5DM73 5LMNL 4XXEA 3OIPA 1JE4A 5FLMG 1HNZL 2XTIA 3A7AB 3I72A 5ELCA 1YVCA 1O7LA 1YJNA 4GN5A 3HFZB 1JWMD 1OXXK 3IFTA 4DR5Q 1L1OB 1BCPF 1TWAB 4DKAC 1TS2A 3M4OH 3KLWA 1E3PA 1QB5D 3HOVG 2N3SA 1NCVA 3HOVH 2A69C 2UUAL 2Z1CA 1EWCA 4U68A 5LMNW 3I4NH 4X3KA 1QILA 1AZPA 1B44D 2UXBL 1GXDC 1D2BA 3VR5A 1VQLA 4JBWA 4WJ3M 1Y8NB 3T1HQ 4QQBX 4NXMQ 3PUZA 4P2CB 5KYIA 5IGCA 3TP7A 2Q8IB 2KUMA 1QG7A 1B9NA 4HMIA 1TWGB 3SK8A 1GVPA 1G291 1Y14B 2XVSA 2JEAI 1HZBA 2FHTA 2XWBB 1B9MA 1DCZA 2EOTA 4OWTB 1JR0D 2WKDA 2YU9H 1TWHB 1V9PA 1HNXQ 4KD4A 4M1UB 3NQTA 4IALA 3STBD 1TWCH 1HNXL 1EY6A 3KOJA 1EZ6A 1D5ZC 1JJGA 2RBMA 3AQQA 5IYCG 1EOTA 1EQVA 3BVGA 5ELNA 2LXKA 1A8VA 1S72A 4ODGA 1XPUA 4RKLA 4TVAB 1N36L 4XT1B 3ULLA 3NELA 1SYEA 3JAMi 4A3LH 4YWMA 3CU7A 1F2LA 1PH9A 3RN5A 2F0DA 1FR3A 1UE7A 5J3BA 3BG3A 1X3EA 2R7ZB 2RHSB 2HT1A 3CCRA 4ID6A 3KDFB 5KYLA 2E8GA 5C0XJ 3S1QB 3CCSA 4FF4A 4DUZQ 4FF3A 4U673 3D0FA 3J80c 1HZAA 2I07B 2FFKB 1XMQQ 3RD4A 1KLUD 3D8GA 2A68D 4K0KQ 3PCOB 3M4QA 2HQEA 2CCZA 4LAAA 1FNWA 3R93A 4IUQA 3H94A 4CKCA 2N8NA 4QUFA 2Y0SE 2A6EC 2K04A 3J7ZC 4RGNA 4IQZA 3NUCA 2K5WA 2EY1A 3H0GB 4DR1Q 3LWEA 1TT2A 4DK1A 1STBA 4CJ0B 4GKJQ 5D3IB 4A3IH 4HSPA 4Q5VA 1N33Q 1RCVD 5M3MH 2VQFQ 3FKIH 2K7VA 1XNRL 3N6RA 1RIPA 3O13A 4YIJA 1VQCA 4C3HG 1G51A 2BOSA 4JI5Q 1GUTA 3V2TA 1WTWA 4F87A 4RGTA 3VA7A 2CQOA 4C1NK 1WTPA 1Y1VB 3HOVB 1TKWB 4IUTA 4PZ8A 2NTTA 3S15B 3F8TA 1UNSA 5CBEE 3TMEA 1TR5A 5KIXA 3WDNA 1SMXA 2IW3A 5IGEA 1HXYD 2JA8G 4DR1L 4FVMA 2EYJA 4DV4L 3LWUA 2ICEC 4KK7A 3ITPA 4YWKA 3KK7A 4YHHQ 1KDAA 4OWWB 2RDGA 2OTLA 2EE1A 5ELOA 1PZKD 1WCMB 3CPFA 3EA6A 5I9OA 3NEMA 3MZ5A 3J81i 4RAUC 3IL8A 4MHEA 5EBCA 1X32A 2F0PA 4DV7L 2PQEA 3QOLA 2K03A 1CKOA 1TWFB 1IYVA 3OWEB 5E4XA 5IOCA 3OSOA 1STHA 1KNAA 3TP5A 2I46A 5ELDA 1PV4A 1YHBA 4HJ9A 3HOXB 1XTDA 1ENFA 3HOYG 2LS01 1FYCA 1DOKA 4RKBA 4N8X1 4DGZA 3I73A 4DXGA 4JK1C 5IP9H 1E2VA 1VS0A 4QMGA 1SE3A 4KHPQ 1X65A 2RDFA 3K7AH 3QOJA 5C3EH 4YHHL 4K6DA 2YYZA 2L12A 4LW1A 3S1NB 2F4VL 1WTHA 1PRTD 3DUZA 4OXPA 2JA6G 3MWYW 1NJIC 3NSWA 1MI2A 5FLXL 5EKIA 3S9WA 1TS5A 3K5NA 3J7YW 1D6EC 3E9HA 1I50H 1HUNA 4ZRZA 1EIHA 1X3PA 2EXZA 1TS3A 4G7ZC 4LUVA 1I3QB 2WAQB 4KTAA 4AYBB 4IFDI 2PO4A 2G9DA 2WAQE 4AYBE 4HIMA 1NMFA 2EZVA 4RWSC 2J0TD 2TSSA 1XNRQ 2D9UA 2VQEL 4KJOA 3AU7A 1VQ4A 3M7GA 2UXBQ 2B2WC 1PH8A 5IYBG 3GO5A 4TSSA 5NUCA 1OTCA 2RVLA 1QWYA 1LM0A 1ICFB 3HOWB 1E2WA 3J7A5 4APVA 2X6GA 1I4HA 4UY8C 2M2LA 4NW2A 2K5DA 4A3MG 1CZWA 1A3VA 1LT4D 5EPLA 3GTKH 4MTKA 3RR5A 4H02A 1MKHA 2AUJD 5M9OA 1Q3LA 4LF8Q 2O2LD 3H15A 1Y1WB 3GTOH 1N34Q 1PH7A 4A3FB 3UI2A 1W6JA 3T16A 3R2TA 5DLQE 1EY0A 1EFID 2K14A 1BNZA 1Q8IA 3URYA 4C3IH 4A3KG 1TY2A 3VR2A 1IBLL 2VZAA 4QF4A 3K59A 2K33A 3HKZB 1IW7D 4JI6L 3J80L 1RKNA 2QEXA 5EBDA 2MUYA 3GD7A 5BN3A 4C3JH 3J81j 4JI4L 2JA7H 2IJ0A 4PV1C 2F4VQ 1EEFD 2CFMA 4KN4C 3T1YQ 2Z4HA 1AE2A 2QEJC 4ZKCB 3D6CA 2R92B 1SE2A 2BE5C 1AZQA 4BY7G 1LO5D 2P5ZX 5GROA 1LUZA 1DGSA 4A3DB 1B7YB 2ALYB 2QDBA 4KD3A 3T53B 3GV3A 1GUNA 1F77A 3TREA 2RDHA 1LTID 2EVBA 1Q46A 4GLVB 1H9JA 1K9MC 2O5JC 1EWIA 2H1EA 3CAMA 4K8IA 5C44H 1PH2A 1HHVA 1VQ9A 4QY7A 5ELEA 1G6ZA 3S1MB 1XNQL 1HUMA 4DUYQ 2KEDA 2ZM6Q 4XQNA 2JA8B 5EQ0A 1EWHA 3HP3A 2K5VA 3CF5A 2JA7B 3I4LA 3V05A 1W3SA 1STNA 5F2DA 1O7IA 3KF8B 4KHZA 2KHIA 4JG2A 2EYFA 3I7FA 4BY1H 2V1CC 2K6AA 2IT1A 3A5UA 1HZ9A 3WOEA 2F0GA 4GOPB 1LT5D 4X3TA 4DN4M 3S1QH 3A55A 5KGUA 1VMPA 4K6LA 5M5XB 1I6HH 3MXGA 4YY3L 2VS1A 5IYBH 3GTPH 2OEOA 2HDMA 3FPPA 3FMCA 3OIQA 3SHLA 4JI8Q 1RHPA 1QUQA 4DNTB 3J80i 4BWGB 1XWEA 3S1NH 3NP8A 4IOAA 1C0AA 1BBXC 2FJ2A 4IJHA 1JOOA 4JOIC 1YITA 3HOUH 4ZLTF 5FKAC 5JJIA 4DPGA 2IX3A 3EROA 4A3MB 3I4MG 4RH6A 3Q8DA 1X9NA 1LTRD 2UXDQ 4HSVA 2NN6I 1E7ZA 2B63B 1JQYD 4ZQ3A 4DR3Q 1YJ9A 4XQJA 1HR0W 3RZOB 4B3MQ 3QR8A 1I3QH 3K8AA 4CJ1B 1SE8A 1CT1D 2K75A 3M3YH 3CC4A 1PHJA 3CHBD 5A2QL 3HG9A 1EUJA 1DXMA 3HOZB 4KMUC 1EFWA 1VQKA 1ZYRD 2CH4A 2UUCQ 5GADC 4MN3A 2KJXA 3I4NG
chains in the Genus database with same CATH topology
1KAWA 1SROA 3A0JA 3KYHC 1J5EL 1GM5A 2NZHA 4BBSH 4B3SQ 4JI7Q 4BXXG 2KCMA 1MIUA 2NZOA 1PH3A 5LMNL 1N32L 4NPSA 1TWFH 2ZTEA 1PH1A 3ICEA 3RNUA 3MXNB 1HR0L 4A4IA 4EQ5A 3FHWA 5FLMG 1EQRA 1EQQA 5GAGC 1HNZL 3F1ZA 2XTIA 4AIMA 2R92G 4GOPC 1YVCA 1Q8KA 1K73C 1YJNA 4JI3L 2BH2A 2AWOA 3AFQA 4GN5A 4GNXB 3HFZB 1OXXK 1TXYA 4JBJA 1L1OB 3K7UC 4R1JA 4HJ8A 4DR5Q 1I94Q 3PF4A 4DV6L 3S15H 4UPAA 4DKAC 4C3HH 3M4OH 4GKKL 4L5TA 3UDXA 3KLWA 1E3PA 3K0XA 2RCNA 3HOVG 1Q81C 2N3SA 3D31A 2K52A 4NB3A 3W1GA 4JI4Q 1XNQQ 3H3VI 3HOVH 3HOZH 3LGJA 2UUAL 4B3SL 5LMNW 1AH9A 3F2BA 3I4NH 3PO3H 5C4JH 3L2PA 2E5LQ 3CQZH 4BBSG 1D8LA 2UXBL 1SLJA 1JB7A 1RL2A 3KJPA 5JEAG 2ID0A 4YCVA 3KDFA 3RLOA 2WP8J 2PQAB 1VQLA 2UUAQ 4JBWA 2B63G 4WJ3M 5AJ3L 5JEAJ 3T1HQ 5C3EG 1OXVA 4JI0L 4NXMQ 3PUZA 4QQBX 1WI5A 4GLAC 3CCEA 2HIXA 4ALPA 1SR3A 1QVCA 4DV0Q 2HQLA 1GVPA 5IP7G 1G291 1Y14B 2JEAI 2H5XA 1HZBA 1K8GA 3S24A 2BA1A 4HJ7A 2K50A 4OWTB 1W2BA 4JBMA 2BH8A 2PNHA 2YU9H 4A3MH 1CSPA 1L1OC 3CP0A 4PZ6A 1V9PA 5M3MG 4X66Q 2MNAA 4IOCA 1MJCA 1HNXQ 4AQYL 1IBML 3G48A 1IL2A 2ASBA 4LFBQ 4IFDG 3STBD 3K81C 1BBWA 1TWCH 4QJFA 1EIYB 2UUCL 1HNXL 3KOJA 3HKZE 4BBRG 4LFAL 4P71A 1JJGA 2Y0SG 4DNIA 3AQQA 4OO1G 5IYCG 3S2DH 3OTOQ 4GKKQ 2R93H 1GKHA 1WYDA 5ELNA 2LXKA 1A8VA 1KL9A 2ZJRA 1S72A 4BY7H 1XPUA 4X64L 2B29A 4DR5L 2R7ZH 4TVAB 1VQ6A 1LTLA 3TEHB 4DK3C 1HNWL 2D62A 1N36L 1K83H 1VQEA 2VUMH 3ULLA 4LF6L 3NELA 2R7DA 2B3GA 4LFCL 3JAMi 3GDEA 4OO1I 4A3LH 4YWMA 2L15A 4RMFA 1UE5A 2JA7G 1TWAH 2KCTA 3VDYA 1PH9A 5LMUQ 2Z6KA 3RN5A 1N33L 1UE7A 5J3BA 4JC0A 4LNQA 3J81c 5C44G 4HJAA 1L0WA 4A3FH 1YI2A 1X3EA 4GNXC 1VQFA 2UU9L 2RHSB 2VL6A 3PIOA 1XPRA 2HT1A 3CCRA 3M9BA 3KDFB 5EAYA 2E8GA 5C0XJ 3NENA 3CCSA 2JEBI 4JI7L 4LF7Q 1K3RA 1HNWQ 2IHFA 3F2CA 4DUZQ 1VQGA 3D0FA 1QVFA 3J80c 3M4PA 1HZAA 3EN2A 4DV6Q 2R7FA 2VUMG 4A93G 3AFPA 1XMQQ 1EOVA 3DLLA 1WCMG 5M5YH 3RLFA 3L7ZC 4K0KQ 1UWVA 1NBWA 2PI2E 1NE3A 3M4QA 3PCOB 4JYAQ 1KXLA 2IX0A 2CCZA 1VQDA 1VCIA 2GN5A 4DR7Q 3CMAA 2N8NA 2B63H 4XIGS 1QZHA 2Y0SE 4X6AH 3J7ZC 5BR8Q 3UDIA 4LF7L 3HKZG 1YBYA 1VQ5A 1YEZA 4YY3Q 4BBRH 1PVOA 1WCMH 2UU9Q 4PG3A 4DR1Q 5HGQA 1AE3A 1Q7YC 2UUBQ 4B3TQ 5E7NA 2AMCB 2A19A 1QZGA 4GKJQ 3ERSX 1IXRA 2EIFA 4J15A 4AQYQ 1FVIA 2KENA 4A3IH 1N33Q 3CPWA 2YV5A 2DGYA 5M3MH 2VQFQ 2R6GA 3FKIH 4GN3B 1YNXA 4P73A 1IBKQ 1XNRL 2PQAA 3FP9A 1RIPA 2WB1E 1WFQA 1VQCA 4AH6A 1X3FA 1XJVA 1G51A 4JI5Q 4A3LG 4OONA 4DV1L 1G6PA 2OQKA 2CQOA 1I94L 4DR7L 1HH2P 2Q2TA 3HOXH 5C0XI 4LF9Q 4R4TA 4B3RL 4PZ8A 5H1SE 3G71A 3AEVA 1UEBA 3F8TA 2VQFL 1XMQL 1P8LA 2JA5H 2F3IA 2OTJA 3I4MH 4IO9A 4IPGA 1JJCB 1SMXA 1KQSA 1CKNB 4DR6Q 1HR0Q 4B3TL 2JA8G 4DR1L 1FGUA 2MO1A 4IJLA 1XMOL 4DV4L 2ES2A 5BR8L 4YWKA 4BA2I 1Y1VG 4OX9L 1VQPA 4YHHQ 4QGUA 4A3BH 4JBKA 3A5ZB 1Q1BA 2NVQH 4DV5L 4OWWB 4QL5A 2OTLA 1BBUA 5LMUL 4LF5L 1QUQB 2BA0A 3HOUG 4DV0L 5ELOA 4JI5L 4P75A 3CPFA 4UP9A 4DR2L 1EIFA 3NEMA 2RHQB 1N34L 4WJ4A 3J81i 4JOIA 2R92H 5FJ8G 3RLNA 2VNUD 1N36Q 5JJLA 4MNOA 2K5HA 2HHHQ 3PUYA 4DV7L 4JI6Q 5M3FG 2E2JH 2E5LL 1VQBA 1CKOA 4MTNA 1JMCA 4A3CH 4LUOA 2VW9A 2NVYH 4BXXH 5IWAL 2ZM6L 3K80C 1N9WA 3GTQH 3PUVA 1NY4A 1BKBA 3CMEA 4LFAQ 3TRZA 3S2HH 3H0GG 1XMOQ 2JE6I 2WB1G 1LYLA 3CD6A 1PV4A 1YHBA 2F52A 4O2DA 3GTJH 4HJ9A 3ER0A 1XTDA 1IBMQ 2KHJA 1YJWA 1EYGA 4R4CA 1TWGH 2HHHL 3STBC 2RF4A 2D0OA 4A76A 1E22A 1OXUA 2C35B 1C9OA 4JV5L 2XGTA 4NXNL 5IE8A 5IP9H 4LF9L 1PH4A 1KHIA 1ASYA 4X62L 4UP8A 1VS0A 3EIVA 2WFWA 2IHEA 4KHPQ 1X65A 1XPOA 1S3OA 3K7AH 4ME3A 3TS2A 5C3EH 4YHHL 2YYZA 4LW1A 1IZ6A 3PO2G 2F4VL 1V43A 2K5NA 3CCJA 4DUYL 5HY6A 1KRSA 4DR3L 3A74A 3T1HL 1IBKL 4JI0Q 1IYJB 5C4XG 1X56A 1Z47A 1VQ8A 1FJGQ 4OXPA 2HIVA 1PYSB 2JA6G 4A3GG 1NJIC 2E2IH 1SFOH 3RZOH 3KFUA 2CWAA 3S17H 2I5MX 1WOCA 2OWOA 1X54A 4A3IG 4TQUS 1K0RA 4JI2L 5LMNQ 4A3KH 1PH5A 1UE1A 3M85A 2JA5G 1VQJA 5IT9c 1N32Q 3E9HA 1I50H 3PO2H 1NTGA 2VY3A 1R9TH 4DR4Q 1JJ2A 1PYBA 1L2FA 4LUVA 4IFDI 3OYYA 2WAQE 2MQHA 1JE5A 2Q2IA 4AYBE 2I5LX 1H95A 1FL0A 2JA9A 3HOXG 1NMFA 5M5WH 3CXCA 4HIMA 1KIXA 3BZKA 2EQSA 4DV3Q 1PH6A 1K8AC 5AJ3Q 1VQNA 4DR2Q 1VQOA 1X6OA 1XNRQ 1D7QA 1A0IA 2JJQA 2VQEL 4A3JG 4GNXA 2I0QA 3DM3A 1VQ4A 2UXBQ 4LWCA 1PH8A 2NN6G 5IYBG 3GO5A 1OTCA 4OX9Q 3EBEA 2UUBL 1LM0A 4A93H 2AKWB 2NVXH 2QA4A 3J7A5 4APVA 3W1BA 4DV2L 4UY8C 2UXDL 3BZCA 4MZ9A 4A3MG 1SN8A 4A75A 2QGQA 2JK8A 3GTKH 4LFBL 4XTCS 4HJ5A 1FJGL 4KHPL 3RZDH 3PSIA 3RR5A 2YTVA 4H02A 4A3DG 1MKHA 4BY1G 4LF8Q 3H15A 2Z6KC 4JI3Q 4LF6Q 3GTOH 4NXML 1L1OA 1U5KA 1N34Q 2LXJA 2K4KA 1PH7A 3S1MH 4YCWA 1CUKA 2YTXA 2Q2UA 3UE1A 4R4OA 4BA1I 2UXCL 3JAMc 4YCUA 1Y1VH 5DLQE 5GAEC 3T1YL 2YTYA 2K14A 5IP9G 3I2ZA 3CCVA 3I4OA 1BVSA 1VQHA 3CCMA 1HZCA 4JI2Q 4C3IH 1B70B 4DK6C 3KJOA 3B6YA 4A3KG 3PUWA 4IFDJ 1IBLL 4C2MH 2VZAA 1OXTA 3PV0A 4PZ7A 2IX1A 3L0OA 4L5QA 1IBLQ 4GOPA 4DV7Q 1VQ7A 1OXSC 4JI6L 2QEXA 4X65Q 2VQEQ 3GD7A 3J81j 4C3JH 2JA7H 4JI4L 3PGZA 1C7YA 3TS0A 2F4VQ 4R4QA 1P16A 2CFMA 3CC7A 3BU2A 4LF4Q 3T1YQ 1AE2A 2GVBA 3CCQA 3UDGA 5JJKA 1Q12A 3WWVA 5M5XH 2MFIA 2MO0A 4IPCA 4EX5A 4A3EH 3S14H 4BY7G 2OCEA 4X62Q 4LF4L 4LUZA 4B3ML 1V1QA 5GROA 1LUZA 1DGSA 1A63A 1B7YB 2ALYB 3GTMH 2OQ0A 4JV5Q 1Y1WG 3CCUA 3I55A 3E9IA 1HNZQ 3TREA 3HOYH 3U58A 2IY5B 5FJ8H 1VQAA 1Q1EA 4DUZL 4DR6L 4A3GH 1Q46A 2EXDA 2N49A 4GLVB 1K9MC 1EWIA 3CAMA 5C44H 1PH2A 4DAYB 3MEFA 1VQ9A 4QY7A 4RG1A 5C0XG 3HOWG 1NMGA 1XNQL 2KBNA 4R4IA 2JQOA 3UDFA 4DV4Q 4DUYQ 3GTGH 5IWAQ 2ZM6Q 2I5HA 3S16H 3U4ZA 3OW2A 1VQMA 3KF6B 1YZ6A 1KD1C 4P72A 5C4XH 1Q86C 3CCLA 2UXCQ 3M7NA 2K5VA 3CF5A 3G4SA 1QVGA 1Y1WH 1YHQA 4JI8L 2ATWA 1VQIA 3JC66 1UE6A 1W3SA 1O7IA 3FKIG 3KF8B 2ZTCA 3W5OA 4X65L 2A8VA 1PFSA 1CKNA 3NBHB 4Y52H 1B8AA 4KHZA 3ULJA 2KHIA 4JG2A 3HOWH 2R7ZG 1T9HA 4GKJL 3I7FA 4BY1H 5K36G 2LSSA 2V1CC 4DR4L 3CW2C 2FXQA 2IT1A 3A5UA 4HIOA 1HZ9A 3IRBA 1SRUA 4JI1Q 1E24A 2DUDA 4YWLA 4KLKA 4GOPB 2A1AA 4L5SA 2AHOB 2Z0SA 3PUXA 3S1RH 3ZJYC 5IYDH 1JT8A 3PO3G 5IYDG 3RN2A 5M3FH 1J5EQ 4DAMA 3S1QH 4HIDA 4PMWA 4IPDA 3U50C 2WAQG 2N78A 4AYBG 1I6HH 4A3JH 1GD7A 1J6QA 3SGIA 4X66L 4YY3L 2VS1A 5IYBH 2D0PA 4LFCQ 4GN4B 3GTPH 1CSQA 4K0KL 2PMZE 1PA6A 4P74A 4O0AA 4JI8Q 1QUQA 4JCVE 4FDBA 2CKZB 5IP7H 4IPHA 2E2HH 3J80i 1CKMA 1N8RC 1E1TA 2R93G 4QIWE 2ZJPA 3AYHB 3S1NH 4HIKA 5IYCH 4A3BG 4IOAA 4JYAL 1C0AA 1I5FA 3E0EA 4IJHA 4OWXB 2GVAA 4JOIC 4UP7A 1YITA 3HOUH 3BJUA 3HOYG 3G6EA 3I56A 3ULPA 1M1KC 3H0GH 4DPGA 5JJIA 1GO3E 1WJJA 5GQOA 1ASZA 1X3GA 5IY0A 1TWHH 1A62A 1Z9FA 3Q8DA 1U0LA 2JA8H 5FLXc 3I4MG 4POGA 4GS3A 4DV2Q 1X9NA 2UXDQ 2ZJQA 4KI0A 3HOZG 2NN6I 1S40A 1Q82C 1E7ZA 4B3RQ 4DR3Q 1YIJA 1YJ9A 2JA6H 3KF6A 1HR0W 4JI1L 4POFA 4A3CG 4B3MQ 3F2DA 4GLXA 2ZTDA 1I3QH 3PIPA 1X55A 4A3FG 1KC8C 1YHAA 3K8AA 1SE8A 5GAHC 4DV1Q 1E1OA 3PF5A 4A3DH 2PI2A 2K75A 3HKSA 3U4VA 4A3EG 3M3YH 3CC4A 1MJEA 2CWPA 5FLMH 3OTOL 1PHJA 2Q2HA 4L5RC 4Y7NH 4DV3L 1HJPA 4NXNQ 2NVTH 3H3VH 1EUJA 4LF8L 3UE0A 1EFWA 1VQKA 2AWNA 4X64Q 4LF5Q 3TQYA 2UUCQ 3CC2A 5GADC 4DV5Q 1M90C 3GTLH 3I4NG 1KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAW A;  1SRO A;  3A0J A;  3KYH C;  1J5E L;  1GM5 A;  2NZH A;  4BBS H;  4B3S Q;  4JI7 Q;  4BXX G;  2KCM A;  1MIU A;  2NZO A;  1PH3 A;  5LMN L;  1N32 L;  4NPS A;  1TWF H;  2ZTE A;  1PH1 A;  3ICE A;  3RNU A;  3MXN B;  1HR0 L;  4A4I A;  4EQ5 A;  3FHW A;  5FLM G;  1EQR A;  1EQQ A;  5GAG C;  1HNZ L;  3F1Z A;  2XTI A;  4AIM A;  2R92 G;  4GOP C;  1YVC A;  1Q8K A;  1K73 C;  1YJN A;  4JI3 L;  2BH2 A;  2AWO A;  3AFQ A;  4GN5 A;  4GNX B;  3HFZ B;  1OXX K;  1TXY A;  4JBJ A;  1L1O B;  3K7U C;  4R1J A;  4HJ8 A;  4DR5 Q;  1I94 Q;  3PF4 A;  4DV6 L;  3S15 H;  4UPA A;  4DKA C;  4C3H H;  3M4O H;  4GKK L;  4L5T A;  3UDX A;  3KLW A;  1E3P A;  3K0X A;  2RCN A;  3HOV G;  1Q81 C;  2N3S A;  3D31 A;  2K52 A;  4NB3 A;  3W1G A;  4JI4 Q;  1XNQ Q;  3H3V I;  3HOV H;  3HOZ H;  3LGJ A;  2UUA L;  4B3S L;  5LMN W;  1AH9 A;  3F2B A;  3I4N H;  3PO3 H;  5C4J H;  3L2P A;  2E5L Q;  3CQZ H;  4BBS G;  1D8L A;  2UXB L;  1SLJ A;  1JB7 A;  1RL2 A;  3KJP A;  5JEA G;  2ID0 A;  4YCV A;  3KDF A;  3RLO A;  2WP8 J;  2PQA B;  1VQL A;  2UUA Q;  4JBW A;  2B63 G;  4WJ3 M;  5AJ3 L;  5JEA J;  3T1H Q;  5C3E G;  1OXV A;  4JI0 L;  4NXM Q;  3PUZ A;  4QQB X;  1WI5 A;  4GLA C;  3CCE A;  2HIX A;  4ALP A;  1SR3 A;  1QVC A;  4DV0 Q;  2HQL A;  1GVP A;  5IP7 G;  1G29 1;  1Y14 B;  2JEA I;  2H5X A;  1HZB A;  1K8G A;  3S24 A;  2BA1 A;  4HJ7 A;  2K50 A;  4OWT B;  1W2B A;  4JBM A;  2BH8 A;  2PNH A;  2YU9 H;  4A3M H;  1CSP A;  1L1O C;  3CP0 A;  4PZ6 A;  1V9P A;  5M3M G;  4X66 Q;  2MNA A;  4IOC A;  1MJC A;  1HNX Q;  4AQY L;  1IBM L;  3G48 A;  1IL2 A;  2ASB A;  4LFB Q;  4IFD G;  3STB D;  3K81 C;  1BBW A;  1TWC H;  4QJF A;  1EIY B;  2UUC L;  1HNX L;  3KOJ A;  3HKZ E;  4BBR G;  4LFA L;  4P71 A;  1JJG A;  2Y0S G;  4DNI A;  3AQQ A;  4OO1 G;  5IYC G;  3S2D H;  3OTO Q;  4GKK Q;  2R93 H;  1GKH A;  1WYD A;  5ELN A;  2LXK A;  1A8V A;  1KL9 A;  2ZJR A;  1S72 A;  4BY7 H;  1XPU A;  4X64 L;  2B29 A;  4DR5 L;  2R7Z H;  4TVA B;  1VQ6 A;  1LTL A;  3TEH B;  4DK3 C;  1HNW L;  2D62 A;  1N36 L;  1K83 H;  1VQE A;  2VUM H;  3ULL A;  4LF6 L;  3NEL A;  2R7D A;  2B3G A;  4LFC L;  3JAM i;  3GDE A;  4OO1 I;  4A3L H;  4YWM A;  2L15 A;  4RMF A;  1UE5 A;  2JA7 G;  1TWA H;  2KCT A;  3VDY A;  1PH9 A;  5LMU Q;  2Z6K A;  3RN5 A;  1N33 L;  1UE7 A;  5J3B A;  4JC0 A;  4LNQ A;  3J81 c;  5C44 G;  4HJA A;  1L0W A;  4A3F H;  1YI2 A;  1X3E A;  4GNX C;  1VQF A;  2UU9 L;  2RHS B;  2VL6 A;  3PIO A;  1XPR A;  2HT1 A;  3CCR A;  3M9B A;  3KDF B;  5EAY A;  2E8G A;  5C0X J;  3NEN A;  3CCS A;  2JEB I;  4JI7 L;  4LF7 Q;  1K3R A;  1HNW Q;  2IHF A;  3F2C A;  4DUZ Q;  1VQG A;  3D0F A;  1QVF A;  3J80 c;  3M4P A;  1HZA A;  3EN2 A;  4DV6 Q;  2R7F A;  2VUM G;  4A93 G;  3AFP A;  1XMQ Q;  1EOV A;  3DLL A;  1WCM G;  5M5Y H;  3RLF A;  3L7Z C;  4K0K Q;  1UWV A;  1NBW A;  2PI2 E;  1NE3 A;  3M4Q A;  3PCO B;  4JYA Q;  1KXL A;  2IX0 A;  2CCZ A;  1VQD A;  1VCI A;  2GN5 A;  4DR7 Q;  3CMA A;  2N8N A;  2B63 H;  4XIG S;  1QZH A;  2Y0S E;  4X6A H;  3J7Z C;  5BR8 Q;  3UDI A;  4LF7 L;  3HKZ G;  1YBY A;  1VQ5 A;  1YEZ A;  4YY3 Q;  4BBR H;  1PVO A;  1WCM H;  2UU9 Q;  4PG3 A;  4DR1 Q;  5HGQ A;  1AE3 A;  1Q7Y C;  2UUB Q;  4B3T Q;  5E7N A;  2AMC B;  2A19 A;  1QZG A;  4GKJ Q;  3ERS X;  1IXR A;  2EIF A;  4J15 A;  4AQY Q;  1FVI A;  2KEN A;  4A3I H;  1N33 Q;  3CPW A;  2YV5 A;  2DGY A;  5M3M H;  2VQF Q;  2R6G A;  3FKI H;  4GN3 B;  1YNX A;  4P73 A;  1IBK Q;  1XNR L;  2PQA A;  3FP9 A;  1RIP A;  2WB1 E;  1WFQ A;  1VQC A;  4AH6 A;  1X3F A;  1XJV A;  1G51 A;  4JI5 Q;  4A3L G;  4OON A;  4DV1 L;  1G6P A;  2OQK A;  2CQO A;  1I94 L;  4DR7 L;  1HH2 P;  2Q2T A;  3HOX H;  5C0X I;  4LF9 Q;  4R4T A;  4B3R L;  4PZ8 A;  5H1S E;  3G71 A;  3AEV A;  1UEB A;  3F8T A;  2VQF L;  1XMQ L;  1P8L A;  2JA5 H;  2F3I A;  2OTJ A;  3I4M H;  4IO9 A;  4IPG A;  1JJC B;  1SMX A;  1KQS A;  1CKN B;  4DR6 Q;  1HR0 Q;  4B3T L;  2JA8 G;  4DR1 L;  1FGU A;  2MO1 A;  4IJL A;  1XMO L;  4DV4 L;  2ES2 A;  5BR8 L;  4YWK A;  4BA2 I;  1Y1V G;  4OX9 L;  1VQP A;  4YHH Q;  4QGU A;  4A3B H;  4JBK A;  3A5Z B;  1Q1B A;  2NVQ H;  4DV5 L;  4OWW B;  4QL5 A;  2OTL A;  1BBU A;  5LMU L;  4LF5 L;  1QUQ B;  2BA0 A;  3HOU G;  4DV0 L;  5ELO A;  4JI5 L;  4P75 A;  3CPF A;  4UP9 A;  4DR2 L;  1EIF A;  3NEM A;  2RHQ B;  1N34 L;  4WJ4 A;  3J81 i;  4JOI A;  2R92 H;  5FJ8 G;  3RLN A;  2VNU D;  1N36 Q;  5JJL A;  4MNO A;  2K5H A;  2HHH Q;  3PUY A;  4DV7 L;  4JI6 Q;  5M3F G;  2E2J H;  2E5L L;  1VQB A;  1CKO A;  4MTN A;  1JMC A;  4A3C H;  4LUO A;  2VW9 A;  2NVY H;  4BXX H;  5IWA L;  2ZM6 L;  3K80 C;  1N9W A;  3GTQ H;  3PUV A;  1NY4 A;  1BKB A;  3CME A;  4LFA Q;  3TRZ A;  3S2H H;  3H0G G;  1XMO Q;  2JE6 I;  2WB1 G;  1LYL A;  3CD6 A;  1PV4 A;  1YHB A;  2F52 A;  4O2D A;  3GTJ H;  4HJ9 A;  3ER0 A;  1XTD A;  1IBM Q;  2KHJ A;  1YJW A;  1EYG A;  4R4C A;  1TWG H;  2HHH L;  3STB C;  2RF4 A;  2D0O A;  4A76 A;  1E22 A;  1OXU A;  2C35 B;  1C9O A;  4JV5 L;  2XGT A;  4NXN L;  5IE8 A;  5IP9 H;  4LF9 L;  1PH4 A;  1KHI A;  1ASY A;  4X62 L;  4UP8 A;  1VS0 A;  3EIV A;  2WFW A;  2IHE A;  4KHP Q;  1X65 A;  1XPO A;  1S3O A;  3K7A H;  4ME3 A;  3TS2 A;  5C3E H;  4YHH L;  2YYZ A;  4LW1 A;  1IZ6 A;  3PO2 G;  2F4V L;  1V43 A;  2K5N A;  3CCJ A;  4DUY L;  5HY6 A;  1KRS A;  4DR3 L;  3A74 A;  3T1H L;  1IBK L;  4JI0 Q;  1IYJ B;  5C4X G;  1X56 A;  1Z47 A;  1VQ8 A;  1FJG Q;  4OXP A;  2HIV A;  1PYS B;  2JA6 G;  4A3G G;  1NJI C;  2E2I H;  1SFO H;  3RZO H;  3KFU A;  2CWA A;  3S17 H;  2I5M X;  1WOC A;  2OWO A;  1X54 A;  4A3I G;  4TQU S;  1K0R A;  4JI2 L;  5LMN Q;  4A3K H;  1PH5 A;  1UE1 A;  3M85 A;  2JA5 G;  1VQJ A;  5IT9 c;  1N32 Q;  3E9H A;  1I50 H;  3PO2 H;  1NTG A;  2VY3 A;  1R9T H;  4DR4 Q;  1JJ2 A;  1PYB A;  1L2F A;  4LUV A;  4IFD I;  3OYY A;  2WAQ E;  2MQH A;  1JE5 A;  2Q2I A;  4AYB E;  2I5L X;  1H95 A;  1FL0 A;  2JA9 A;  3HOX G;  1NMF A;  5M5W H;  3CXC A;  4HIM A;  1KIX A;  3BZK A;  2EQS A;  4DV3 Q;  1PH6 A;  1K8A C;  5AJ3 Q;  1VQN A;  4DR2 Q;  1VQO A;  1X6O A;  1XNR Q;  1D7Q A;  1A0I A;  2JJQ A;  2VQE L;  4A3J G;  4GNX A;  2I0Q A;  3DM3 A;  1VQ4 A;  2UXB Q;  4LWC A;  1PH8 A;  2NN6 G;  5IYB G;  3GO5 A;  1OTC A;  4OX9 Q;  3EBE A;  2UUB L;  1LM0 A;  4A93 H;  2AKW B;  2NVX H;  2QA4 A;  3J7A 5;  4APV A;  3W1B A;  4DV2 L;  4UY8 C;  2UXD L;  3BZC A;  4MZ9 A;  4A3M G;  1SN8 A;  4A75 A;  2QGQ A;  2JK8 A;  3GTK H;  4LFB L;  4XTC S;  4HJ5 A;  1FJG L;  4KHP L;  3RZD H;  3PSI A;  3RR5 A;  2YTV A;  4H02 A;  4A3D G;  1MKH A;  4BY1 G;  4LF8 Q;  3H15 A;  2Z6K C;  4JI3 Q;  4LF6 Q;  3GTO H;  4NXM L;  1L1O A;  1U5K A;  1N34 Q;  2LXJ A;  2K4K A;  1PH7 A;  3S1M H;  4YCW A;  1CUK A;  2YTX A;  2Q2U A;  3UE1 A;  4R4O A;  4BA1 I;  2UXC L;  3JAM c;  4YCU A;  1Y1V H;  5DLQ E;  5GAE C;  3T1Y L;  2YTY A;  2K14 A;  5IP9 G;  3I2Z A;  3CCV A;  3I4O A;  1BVS A;  1VQH A;  3CCM A;  1HZC A;  4JI2 Q;  4C3I H;  1B70 B;  4DK6 C;  3KJO A;  3B6Y A;  4A3K G;  3PUW A;  4IFD J;  1IBL L;  4C2M H;  2VZA A;  1OXT A;  3PV0 A;  4PZ7 A;  2IX1 A;  3L0O A;  4L5Q A;  1IBL Q;  4GOP A;  4DV7 Q;  1VQ7 A;  1OXS C;  4JI6 L;  2QEX A;  4X65 Q;  2VQE Q;  3GD7 A;  3J81 j;  4C3J H;  2JA7 H;  4JI4 L;  3PGZ A;  1C7Y A;  3TS0 A;  2F4V Q;  4R4Q A;  1P16 A;  2CFM A;  3CC7 A;  3BU2 A;  4LF4 Q;  3T1Y Q;  1AE2 A;  2GVB A;  3CCQ A;  3UDG A;  5JJK A;  1Q12 A;  3WWV A;  5M5X H;  2MFI A;  2MO0 A;  4IPC A;  4EX5 A;  4A3E H;  3S14 H;  4BY7 G;  2OCE A;  4X62 Q;  4LF4 L;  4LUZ A;  4B3M L;  1V1Q A;  5GRO A;  1LUZ A;  1DGS A;  1A63 A;  1B7Y B;  2ALY B;  3GTM H;  2OQ0 A;  4JV5 Q;  1Y1W G;  3CCU A;  3I55 A;  3E9I A;  1HNZ Q;  3TRE A;  3HOY H;  3U58 A;  2IY5 B;  5FJ8 H;  1VQA A;  1Q1E A;  4DUZ L;  4DR6 L;  4A3G H;  1Q46 A;  2EXD A;  2N49 A;  4GLV B;  1K9M C;  1EWI A;  3CAM A;  5C44 H;  1PH2 A;  4DAY B;  3MEF A;  1VQ9 A;  4QY7 A;  4RG1 A;  5C0X G;  3HOW G;  1NMG A;  1XNQ L;  2KBN A;  4R4I A;  2JQO A;  3UDF A;  4DV4 Q;  4DUY Q;  3GTG H;  5IWA Q;  2ZM6 Q;  2I5H A;  3S16 H;  3U4Z A;  3OW2 A;  1VQM A;  3KF6 B;  1YZ6 A;  1KD1 C;  4P72 A;  5C4X H;  1Q86 C;  3CCL A;  2UXC Q;  3M7N A;  2K5V A;  3CF5 A;  3G4S A;  1QVG A;  1Y1W H;  1YHQ A;  4JI8 L;  2ATW A;  1VQI A;  3JC6 6;  1UE6 A;  1W3S A;  1O7I A;  3FKI G;  3KF8 B;  2ZTC A;  3W5O A;  4X65 L;  2A8V A;  1PFS A;  1CKN A;  3NBH B;  4Y52 H;  1B8A A;  4KHZ A;  3ULJ A;  2KHI A;  4JG2 A;  3HOW H;  2R7Z G;  1T9H A;  4GKJ L;  3I7F A;  4BY1 H;  5K36 G;  2LSS A;  2V1C C;  4DR4 L;  3CW2 C;  2FXQ A;  2IT1 A;  3A5U A;  4HIO A;  1HZ9 A;  3IRB A;  1SRU A;  4JI1 Q;  1E24 A;  2DUD A;  4YWL A;  4KLK A;  4GOP B;  2A1A A;  4L5S A;  2AHO B;  2Z0S A;  3PUX A;  3S1R H;  3ZJY C;  5IYD H;  1JT8 A;  3PO3 G;  5IYD G;  3RN2 A;  5M3F H;  1J5E Q;  4DAM A;  3S1Q H;  4HID A;  4PMW A;  4IPD A;  3U50 C;  2WAQ G;  2N78 A;  4AYB G;  1I6H H;  4A3J H;  1GD7 A;  1J6Q A;  3SGI A;  4X66 L;  4YY3 L;  2VS1 A;  5IYB H;  2D0P A;  4LFC Q;  4GN4 B;  3GTP H;  1CSQ A;  4K0K L;  2PMZ E;  1PA6 A;  4P74 A;  4O0A A;  4JI8 Q;  1QUQ A;  4JCV E;  4FDB A;  2CKZ B;  5IP7 H;  4IPH A;  2E2H H;  3J80 i;  1CKM A;  1N8R C;  1E1T A;  2R93 G;  4QIW E;  2ZJP A;  3AYH B;  3S1N H;  4HIK A;  5IYC H;  4A3B G;  4IOA A;  4JYA L;  1C0A A;  1I5F A;  3E0E A;  4IJH A;  4OWX B;  2GVA A;  4JOI C;  4UP7 A;  1YIT A;  3HOU H;  3BJU A;  3HOY G;  3G6E A;  3I56 A;  3ULP A;  1M1K C;  3H0G H;  4DPG A;  5JJI A;  1GO3 E;  1WJJ A;  5GQO A;  1ASZ A;  1X3G A;  5IY0 A;  1TWH H;  1A62 A;  1Z9F A;  3Q8D A;  1U0L A;  2JA8 H;  5FLX c;  3I4M G;  4POG A;  4GS3 A;  4DV2 Q;  1X9N A;  2UXD Q;  2ZJQ A;  4KI0 A;  3HOZ G;  2NN6 I;  1S40 A;  1Q82 C;  1E7Z A;  4B3R Q;  4DR3 Q;  1YIJ A;  1YJ9 A;  2JA6 H;  3KF6 A;  1HR0 W;  4JI1 L;  4POF A;  4A3C G;  4B3M Q;  3F2D A;  4GLX A;  2ZTD A;  1I3Q H;  3PIP A;  1X55 A;  4A3F G;  1KC8 C;  1YHA A;  3K8A A;  1SE8 A;  5GAH C;  4DV1 Q;  1E1O A;  3PF5 A;  4A3D H;  2PI2 A;  2K75 A;  3HKS A;  3U4V A;  4A3E G;  3M3Y H;  3CC4 A;  1MJE A;  2CWP A;  5FLM H;  3OTO L;  1PHJ A;  2Q2H A;  4L5R C;  4Y7N H;  4DV3 L;  1HJP A;  4NXN Q;  2NVT H;  3H3V H;  1EUJ A;  4LF8 L;  3UE0 A;  1EFW A;  1VQK A;  2AWN A;  4X64 Q;  4LF5 Q;  3TQY A;  2UUC Q;  3CC2 A;  5GAD C;  4DV5 Q;  1M90 C;  3GTL H;  3I4N G;  1KRT A; 
#chains in the Genus database with same CATH topology
 1KAW A;  3A0J A;  1J5E L;  2B8G A;  4BXX G;  5E1F A;  1MIU A;  5I2Y A;  2ZTE A;  3MXN B;  4EQ5 A;  2M9V A;  1EQR A;  2SNS A;  1EQQ A;  2R92 G;  5I4D A;  1DJR D;  1RTO A;  2L55 A;  3MA2 B;  2CVR A;  1CHP D;  3SXH A;  5HGT A;  3HEJ A;  3AMU A;  4JI3 L;  2AWO A;  3AFQ A;  2R93 B;  1Y69 U;  1TXY A;  4JBJ A;  3K7U C;  1I94 Q;  2LKV A;  3DWA A;  1K0S A;  3PF4 A;  1PTO F;  4UPA A;  2WAC A;  2HD3 A;  1S5C D;  3UDX A;  1K83 B;  1F2Y A;  1Q81 C;  4A93 G;  3BVM A;  1XNQ Q;  4DAV A;  1CZG A;  4B3S L;  3V96 A;  3MVV A;  5C4J H;  3FEW X;  1HFG A;  3QIA A;  1JB7 A;  3M3Y B;  5KNC A;  5AJ3 L;  5C3E G;  3MXU A;  1WI5 A;  4GLA C;  4EGV A;  2PMZ B;  1T5E A;  2HIX A;  1SR3 A;  1F9Q A;  1G91 A;  2VXW A;  3GTJ B;  3LX0 A;  2JN4 A;  3S24 A;  4A3G B;  3MXP A;  3TP6 A;  1ENA A;  3DM1 A;  4PZ6 A;  5M5W B;  3KUP A;  4AQY L;  5C4Z A;  3G48 A;  1HRJ A;  3T56 B;  4IFD G;  3I90 A;  4EQP A;  3Q0A A;  2SDF A;  1EZ8 A;  3ONA B;  2OT2 A;  3S2D H;  3DEP A;  3HZX A;  2R93 H;  1GKH A;  1WYD A;  3DXJ C;  3OWF A;  4L6T B;  3CKI B;  5IIF A;  2ZJR A;  4DR5 L;  4QCL A;  4K5V A;  1LTL A;  4DK3 C;  1HNW L;  1K83 H;  2VUM H;  2NYZ D;  4LFC L;  3GDE A;  3OOC A;  1KNE A;  1UE5 A;  4RMF A;  3VDY A;  1I4Q A;  5CBA E;  4JC0 A;  5DAU A;  3J81 c;  4PMB A;  1L0W A;  4OL7 A;  2OF1 A;  4QUC A;  2VB2 X;  1BR9 A;  3PIO A;  1XPR A;  3DWP A;  1QE6 A;  1J8I A;  5C4X B;  3QJY A;  4JI7 L;  2JEB I;  2ZXO A;  3F2C A;  2F3W A;  1VQG A;  1QVF A;  3MXN A;  2VUM G;  1PTO C;  3AFP A;  1EOV A;  4Q0F A;  3RLF A;  3L7Z C;  1NE3 A;  1LT3 D;  1RTN A;  2O4X A;  2IX0 A;  3FPU B;  5ELF A;  3M4O B;  1VCI A;  2GN5 A;  1SE4 A;  2EJF C;  3CMA A;  2NB0 A;  2B63 H;  2B2V C;  4XIG S;  1QZH A;  1TWC B;  4X6A H;  1LLR D;  1DOL A;  1YEZ A;  3AB9 A;  4BBR H;  2XN9 C;  1Q7Y C;  4B3T Q;  5AFW A;  2QF7 A;  1QZG A;  2F1M A;  2MPM A;  3GQB A;  1FVI A;  2E74 C;  2SNM A;  3ND8 A;  1EY7 A;  2X6L A;  3FP9 A;  3S17 B;  4AH6 A;  1KTK A;  1G6P A;  2Q2T A;  1MD2 D;  3OMC A;  5I6Y A;  1HPC A;  2MHV A;  5LL6 S;  5I6W A;  2B8F A;  4RFB A;  3QB3 A;  1UEB A;  1XMQ L;  1P8L A;  2JA5 H;  5C5L A;  2F3I A;  1VF7 A;  4IO9 A;  1JJC B;  2KA7 A;  4R9W A;  4O1N A;  2J7Z A;  1D5M C;  1CQV A;  1K8O A;  1EEI D;  1HCZ A;  2Q8T A;  2ES2 A;  1E2Z A;  3A7L A;  1JWU D;  1Y1V G;  3H09 A;  4OX9 L;  1PZI D;  1NSN S;  4QGU A;  4N9T A;  1F2Z A;  4DV5 L;  4QL5 A;  1VDZ A;  1QUQ B;  4LK1 C;  4RA8 A;  3PQI A;  3TP8 A;  1STG A;  4IN3 A;  4WJ4 A;  2VNU D;  1N36 Q;  5JJL A;  4MNO A;  4IUR A;  1DZ1 A;  2K5H A;  4BBS B;  3HS0 C;  3I91 A;  3VYT A;  1VQB A;  3Q22 A;  4A3C H;  1JMC A;  3PIP 3;  3RZD B;  2ZM6 L;  1N9W A;  3GTQ H;  2F03 A;  3PUV A;  3CME A;  4ILW A;  4LFA Q;  5BN4 A;  3H0G G;  1LYL A;  1S5B D;  3U9S A;  1SYC A;  3GTJ H;  4B08 A;  3D4D A;  1YJW A;  2A69 D;  2EY2 A;  3NBI A;  4CDF C;  2RF4 A;  2B2U A;  2D0O A;  1E22 A;  2C35 B;  4OEL B;  1C9O A;  1V1P B;  4JV5 L;  2XGT A;  4NXN L;  1GHK A;  1PH4 A;  4X3U A;  2AQ1 B;  3K57 A;  2IHE A;  4NP5 A;  2K28 A;  4ME3 A;  1QNU A;  2D2C C;  1IZ6 A;  1V43 A;  2K5N A;  5E4W C;  4DR3 L;  3T1H L;  1KRS A;  1X56 A;  1Z47 A;  1VQ8 A;  1FJG Q;  1H9K A;  1B50 A;  2HIV A;  1PYS B;  4A3G G;  1RF2 D;  1HFN A;  1HA6 A;  5IT9 L;  2E2I H;  4XT3 B;  2RA4 A;  1O7Y A;  3U9O A;  1MGS A;  1STA A;  3WOF A;  1X54 A;  4A3I G;  5LMN Q;  1UE1 A;  1ZEQ X;  3NXW A;  5IGB A;  3PO2 H;  1NTG A;  2VY3 A;  2K5Q A;  4DR4 Q;  3VYU A;  3OYY A;  2Z4I A;  2MQH A;  2JA6 B;  3CXC A;  3K5O A;  1PH6 A;  2QW7 A;  4XYO A;  3OPO A;  3KBG A;  4DR2 Q;  2JJQ A;  4A3J G;  2A6E D;  3DM3 A;  1R4P B;  1GHJ A;  2NVX H;  2CW0 C;  2QA4 A;  3FVQ A;  2UXD L;  3BZC A;  4MZ9 A;  3KBX A;  4OIJ A;  4A75 A;  4LFB L;  2JK8 A;  1GUO A;  4XTC S;  4HJ5 A;  1FJG L;  4KHP L;  3RZD H;  3PSI A;  2YTV A;  1M8A A;  2F4I A;  2Z6K C;  1L1O A;  2N55 A;  3MFY A;  3S1M H;  2Q2U A;  1ZXT A;  2YTX A;  5C4H A;  2JYO A;  4R4O A;  3UE1 A;  2VUM B;  2CQA A;  3KF8 A;  1SEB D;  2EDG A;  4C3J G;  2E2D C;  5COR A;  1Y1V H;  2JSO A;  5GAE C;  1L0X B;  4JW0 A;  1VQH A;  1K3B C;  3CCM A;  5FLX E;  1B70 B;  2A6H C;  4CGY B;  2WIN B;  4FO2 A;  4C2M H;  4KY7 A;  1I6V C;  1OXT A;  2IX1 A;  4L5Q A;  4C1N I;  1VQ7 A;  2AUK A;  1U9R A;  3GTP B;  2DNC A;  3BDO A;  3CC7 A;  4LF4 Q;  2GVB A;  3CRL C;  1Q12 A;  5JJK A;  3WWV A;  2MFI A;  4UHV A;  4A3E H;  3BVZ A;  2OCE A;  4LF4 L;  3M4Y A;  1V8Q A;  3NPP A;  1SXT A;  4TRD A;  2PYK A;  5C6A A;  3HOY H;  1H9R A;  5FJ8 H;  1Q1E A;  1OO9 B;  1Q90 A;  1UAP A;  2B2V A;  5C0X G;  5I9P A;  1NMG A;  2K1B A;  2F0K A;  4DAY A;  2JQO A;  1SJH D;  2E76 C;  3N52 A;  5A2Q E;  2L4N A;  3CCL A;  1VMC A;  3GV6 A;  1YHQ A;  2ATW A;  1C8C A;  1UE6 A;  2E2J B;  4CDD C;  1ENC A;  1U4L A;  1L0Y B;  3FKI G;  4G7H C;  2ZTC A;  2RSN A;  2OXP A;  1CKN A;  4C2M B;  1B8A A;  4K8J A;  4GKJ L;  5K36 G;  4DR4 L;  4HIO A;  4OEM B;  1SRU A;  4YWL A;  2A1A A;  2Z0S A;  3PO3 G;  2QKI C;  5M3F H;  3RN2 A;  1J5E Q;  3GP7 A;  4PMW A;  4B9W A;  4IPD A;  3U50 C;  2WAQ G;  4AYB G;  1FNV A;  3P1H A;  4A3J H;  1GD7 A;  4KN7 C;  4X66 L;  4LFC Q;  1LTT D;  2D0P A;  3FRP B;  4PNY A;  4K0K L;  2K01 A;  5EKK A;  5IP7 H;  2CKZ B;  2BCO A;  2E2H H;  1G2S A;  1E1T A;  4QIW E;  2EYL A;  2PZW A;  3SDZ A;  3W2D A;  4OWX B;  2GVA A;  5KNB A;  1M1K C;  5GQO A;  1JOQ A;  1X3G A;  5IY0 A;  1TWH H;  2JA8 H;  1I50 B;  2L9H A;  4POG A;  1IYU A;  4KI0 A;  2NVT B;  1Q82 C;  4ULL A;  4WFN 3;  1FD7 D;  4B3R Q;  2F0T A;  2PZT A;  3F2D A;  4A3I B;  4A3F G;  4IUV A;  3X3N A;  3PF5 A;  4DV1 Q;  3A54 A;  4FXK C;  1NR4 A;  2K32 A;  4L5R C;  4DV3 L;  3H3V H;  4NXN Q;  1SFO B;  5D3D A;  4DV5 Q;  2QCP X;  3KYH C;  1I6H B;  1JIC A;  2KCM A;  1LV9 A;  3GTK B;  4NPS A;  1TWF H;  4Y7N B;  2AQ2 B;  2PPB C;  1HR0 L;  4A4I A;  3FHW A;  5GAG C;  4F8M A;  3F1Z A;  2RKS A;  4AIM A;  5JJZ A;  4GOP C;  1H9S A;  2KQ3 A;  2B2W A;  5EKL A;  4DA2 A;  4XDX A;  1CHQ D;  5M3F B;  2BH2 A;  2KEE A;  4GNX B;  3E0J A;  1JWS D;  1ET9 A;  3KLS A;  1WTR A;  4R1J A;  3J81 L;  1KLG D;  4DV6 L;  2M00 A;  5C44 B;  2WB1 B;  3K0X A;  4J1M A;  3D31 A;  2K52 A;  4NB3 A;  3W1G A;  4JI4 Q;  3HOZ H;  2F0S A;  3LGJ A;  4O42 A;  3J7A F;  5FO9 B;  4I7A A;  5A35 A;  3L2P A;  4BBS G;  1SDF A;  1D8L A;  4A3K B;  5JEA G;  4YCV A;  2UUA Q;  5DEH A;  1HQM C;  2EJM A;  1CK1 A;  5JEA J;  1OXV A;  1O7Z A;  3HGB A;  2NN6 H;  3FKI B;  4QB4 A;  4BS9 A;  1QVC A;  4DV0 Q;  4ZAI A;  2HQL A;  1SMY C;  3T51 B;  1K8G A;  4CJ2 C;  2BA1 A;  4HJ7 A;  1PTO D;  2K50 A;  5CV9 A;  4JBM A;  2PNH A;  1CSP A;  1L1O C;  3CP0 A;  1BUV T;  5M3M G;  3R3O A;  4X66 Q;  2MNA A;  4IOC A;  3L9A X;  1MJC A;  4OHJ A;  4BY7 B;  4LFB Q;  4KHV A;  4G57 A;  4DF7 A;  1CI3 M;  3NHH A;  3K81 C;  1F9R A;  1EIY B;  2UUC L;  1SJE D;  4P71 A;  4ZCK A;  2Y0S G;  1IW7 C;  4DNI A;  4EQN A;  3QO2 A;  3S14 B;  2BDO A;  5DM6 3;  5ELB A;  1EY8 A;  4GKK Q;  1ILP A;  2A68 C;  1A15 A;  1K8M A;  4X64 L;  2B29 A;  3JAM E;  1KAB A;  3TEH B;  1V1O A;  1SSO A;  2LFN A;  2F0V A;  3PO3 B;  2ZXP A;  4LF6 L;  2R7D A;  2B3G A;  2JA7 G;  1Y8O B;  1TWA H;  2KCT A;  1N33 L;  5LMU Q;  5CYU A;  3C2P A;  1IKM A;  2BDN A;  4LNQ A;  2FMC A;  1QNK A;  1YI2 A;  1ICW A;  4A3F H;  1WTQ A;  3IKJ A;  1AN8 A;  4BY1 B;  3NEN A;  4LF7 Q;  2ZT9 C;  2PZU A;  2IHF A;  4K2L A;  1EY5 A;  1LTA D;  1EYD A;  1KDB A;  2EPB A;  3EN2 A;  4DV6 Q;  5HUR A;  4H7B A;  4I7Z C;  1MHW C;  1HTL D;  1ZYR C;  2NWG A;  1NBW A;  2PI2 E;  4JYA Q;  2NBF A;  5LL6 X;  3SVM A;  4G4K A;  1YNN C;  3DWQ A;  2L1B A;  1PRT C;  5BR8 Q;  3UDI A;  1YBY A;  1VQ5 A;  4YY3 Q;  1PVO A;  1WCM H;  3P75 A;  2UU9 Q;  4PG3 A;  2F0J A;  5HGQ A;  2UUB Q;  5E7N A;  2AMC B;  2A19 A;  1GUS A;  3BZD B;  4EQO A;  3QWN A;  5EJW A;  1STY A;  2EIF A;  5CV6 A;  4AQY Q;  2KEN A;  2YV5 A;  4P73 A;  1YNX A;  2RQX A;  1DYQ A;  2WB1 E;  4WOR A;  3DHQ A;  3I4M B;  2WII B;  4A3L G;  4J8Q A;  4DV1 L;  2OQK A;  4DR7 L;  1I94 L;  3I8Z A;  5J22 A;  2E2H B;  3HOX H;  5C0X I;  4LF9 Q;  4ZKB B;  4R4T A;  4V19 0;  5H1S E;  3AEV A;  3S2H B;  2F0W A;  3W3A A;  2XRQ D;  1D1I A;  2OTJ A;  4IPG A;  2B39 A;  1CKN B;  1I4R A;  2CH4 W;  1HR0 Q;  4B3T L;  2F0L A;  4IJL A;  1XMO L;  5C3E B;  5JOB A;  1AEX A;  5J1Z A;  5BR8 L;  4ABN A;  4CBV A;  5T1I A;  1SND A;  3VYS A;  4L63 B;  4NDX A;  4A3B H;  1XTC D;  1Q1B A;  5LMU L;  2BA0 A;  4KV6 A;  3BS1 A;  3K58 A;  4JI5 L;  1H9M A;  4DR2 L;  3PIO 3;  1PYW D;  3C1E A;  4JOI A;  3RLN A;  3GTL B;  1A3U A;  1S5F D;  2Z8L A;  1B2T A;  3RUZ A;  4B9X A;  4JI6 Q;  5M3F G;  4UAI A;  1PFN A;  2E5L L;  4IUN A;  5M5Y B;  1SMY D;  4IZ8 A;  2NTS A;  4MTN A;  4LUO A;  2VW9 A;  2NVY H;  5IWA L;  1TU2 B;  3K80 C;  4FYD A;  1ZKO A;  1NY4 A;  1GUW A;  3S2H H;  3E6Z X;  1YNN D;  2JE6 I;  1SNQ A;  5J39 A;  2EYP A;  3CD6 A;  3ER0 A;  3MAQ A;  1IBM Q;  2KHJ A;  2HHH L;  1TWG H;  4A93 B;  3STB C;  4A76 A;  1OXU A;  2RSO A;  1DD2 A;  2B2T A;  5IE8 A;  3VA5 A;  1KHI A;  1ASY A;  4X62 L;  4UP8 A;  2WFW A;  4A3B B;  1R9T B;  1PDQ A;  2DJG C;  3NE5 B;  4E6I A;  5KRU A;  1S3O A;  1XPO A;  3TS2 A;  1QCB D;  3PO2 G;  3VR4 A;  1B1Z A;  2R92 H;  4C56 C;  4JI0 Q;  5BN5 A;  5KEE A;  5C4X G;  4ZUJ A;  5CC4 A;  1WTO A;  2PNR C;  1EIG A;  5CV4 A;  2OWO A;  4TQU S;  1K0R A;  3VR6 A;  2TMP A;  4JI2 L;  4A3K H;  1N32 Q;  3A8I E;  3EJI A;  3EVQ A;  1LT6 D;  2KCN A;  2SOB A;  1R9T H;  1I4P A;  1PYB A;  1F2M A;  1L2F A;  5IOD A;  1H95 A;  4X3S A;  2I5L X;  1FL0 A;  1KIX A;  5FO7 B;  2EQS A;  2L0C A;  1K8A C;  1MSH A;  4HN7 A;  5AJ3 Q;  1VQO A;  1VQN A;  1X6O A;  1D7Q A;  4GNX A;  2I0Q A;  1PFB A;  3HRZ C;  3R8B A;  4A93 H;  3A8J E;  4UDU C;  4K5X A;  2A5H A;  3KLS X;  3SEB A;  3W1B A;  1O78 A;  2FIN B;  4FP5 D;  1SN8 A;  3J81 E;  2QGQ A;  2NVY B;  3NWT A;  4A3D G;  3TDQ A;  4CKB A;  4BY1 G;  4JI3 Q;  1V1P A;  4NXM L;  1U5K A;  1T5X D;  1D1K A;  5EPJ A;  2KCC A;  4BA1 I;  2UXC L;  4DXF A;  5CV8 A;  5C3W A;  4A3E B;  5G3L F;  5CGK A;  5IP9 G;  3CCV A;  3I4O A;  1G8Z D;  1BVS A;  2A6H D;  4F7X A;  5C0X H;  3KJO A;  3LNN A;  4IFD J;  3B6Y A;  3PUW A;  1U4P A;  4TKO B;  3K6O A;  3PMF A;  4IFD H;  1IBL Q;  4DV7 Q;  1OXS C;  2EY6 A;  3PGZ A;  2XWJ B;  1ESF A;  5EPK A;  3BU2 A;  1SNP A;  3CCQ A;  4RHS A;  4DNR B;  2MO0 A;  4EX5 A;  3S14 H;  2F0M A;  1WD1 A;  4B3M L;  1A63 A;  4L8J A;  3CCU A;  3I55 A;  4KY5 A;  1PMR A;  3BDL A;  2CW0 D;  4BBR B;  2IY5 B;  4A3G H;  5FOB B;  4DAY B;  1AP0 A;  3T13 A;  3BYY B;  3MHB A;  3HOW G;  1UEA B;  4DV4 Q;  3GTG H;  2KOL A;  3SK4 A;  2I5H A;  4J6H A;  1PFM A;  1VQM A;  4P72 A;  4DU9 A;  5C4X H;  1JB3 A;  3M7N A;  1C48 A;  4JPB W;  4KY6 A;  5COY A;  4JI8 L;  2MP1 A;  1IHZ A;  2V4D A;  4CKE A;  1MSG A;  2A8V A;  3K7A B;  4X65 L;  1ILQ A;  4Y52 H;  3ULJ A;  3HOW H;  1STE A;  1PXU A;  3CW2 C;  3NTH A;  4RGM A;  1TQO A;  3IRB A;  5FO8 B;  2NUC A;  1D5X C;  4RGO S;  3C3L A;  4KLK A;  2EJG C;  2F0O A;  1A2U A;  2AHO B;  3S1R H;  5IYD H;  1JT8 A;  5IYD G;  2PW5 A;  4DAM A;  1GUG A;  1SAP A;  3S2D B;  2J4X A;  2E75 C;  1WVL A;  1AW7 A;  3D4R A;  2D5D A;  4GN4 B;  2F0Q A;  1CSQ A;  1PRT B;  2C5C A;  3P7J A;  4P74 A;  4DK0 A;  2F3V A;  4JCV E;  4CDC C;  1F9P A;  3K5L A;  2AQ3 B;  5L37 A;  3T4A C;  1CKM A;  1N8R C;  2X69 A;  2Z6B A;  1II3 A;  2ZJP A;  1GOZ A;  3AYH B;  1CA5 A;  1A6X A;  1F9S A;  1CA6 A;  3BJU A;  3G6E A;  2MJ8 A;  3MC0 B;  1ESR A;  3ULP A;  1GO3 E;  3C1F A;  3G6J B;  2C9O A;  3C46 A;  1Z9F A;  1A62 A;  5FLX c;  3PO2 B;  4DV2 Q;  2LY7 A;  1S40 A;  1PTO B;  5T1G A;  1YIJ A;  4A3C G;  3KF6 A;  2E2I B;  1EQT A;  1CFM A;  1HA5 A;  2ZTD A;  4V0B A;  3PIP A;  1X55 A;  4GLX A;  1KC8 C;  4NKL A;  4A3D H;  3VR3 A;  1O80 A;  2PI2 A;  3HKS A;  3U4V A;  4A3E G;  1MJE A;  4HTH A;  3OTO L;  1XXG A;  2NVT H;  1HJP A;  3TSS A;  1K28 A;  2A74 C;  2AWN A;  2F0H A;  3TQY A;  3CC2 A;  1TVX A;  3GTL H;  5FJ8 G;  1NR2 A;  1GM5 A;  2NZH A;  2EYH A;  4B3S Q;  4BBS H;  1DM0 B;  1BXT A;  2NZO A;  2IWH A;  2XSC A;  1PH3 A;  1N32 L;  5ISR A;  1PH1 A;  2F0F A;  2ZXR A;  3ICE A;  1QJO A;  3RNU A;  3K0Y A;  3ZYY X;  4LJZ C;  1GJX A;  2NVQ B;  1PRT F;  4Z9C B;  1G2T A;  3E3X A;  1Q8K A;  1K73 C;  4CHT B;  4HJ8 A;  1WD0 A;  3A56 A;  3IFD A;  3S15 H;  4C3H H;  1EY4 A;  1X3Q A;  5D14 A;  3MEH A;  4GKK L;  4L5T A;  1BO0 A;  4HCE A;  2ICI A;  2RCN A;  3E5S A;  3H3V I;  3HOY B;  1EL0 A;  4MIU A;  1AH9 A;  3F2B A;  3PO3 H;  5K5P A;  1B53 A;  2E5L Q;  3CQZ H;  1AFP A;  2ENB A;  3NWS A;  3RMH A;  1BCP B;  1SLJ A;  1RL2 A;  3KJP A;  2ID0 A;  3KDF A;  3RLO A;  2WP8 J;  2PQA B;  3MFG A;  2EYO A;  2B63 G;  4K5W A;  4JI0 L;  2L11 A;  2G9H D;  3CCE A;  4ALP A;  1Y8P B;  5IP7 G;  2H5X A;  3HOU B;  1ML0 D;  4FXD A;  3Q24 A;  2B2Y A;  1W2B A;  3F2U A;  1B4O A;  2BH8 A;  2XRS D;  3SR1 A;  4A3M H;  3QG1 A;  4HR7 B;  4ZK9 B;  5IT9 E;  4ZUI A;  1IBM L;  1IL2 A;  2ASB A;  5JPM C;  2EY5 A;  1BBW A;  4QJF A;  5EGT A;  4N9P A;  4RCO A;  2B2U C;  3HKZ E;  3TBI B;  4BBR G;  4LFA L;  1ROD A;  1TS4 A;  5CMD A;  4OO1 G;  3OTO Q;  1U4M A;  3J7A V;  4R8N A;  4RCN A;  3R2I A;  1VF5 C;  1KL9 A;  4BY7 H;  1BDO A;  4EVO A;  4C3H B;  2R7Z H;  1VQ6 A;  2D62 A;  4OIK A;  1VQE A;  1A3T A;  3TN2 A;  1H9S B;  4OO1 I;  1HNW Q;  2L15 A;  1IKL A;  2Z6K A;  2NZ1 D;  4FF2 A;  4FNF A;  1CTM A;  5C44 G;  4HJA A;  1JCK B;  4GNX C;  3IAY A;  1VQF A;  2UU9 L;  2VL6 A;  3EQL C;  1UUP A;  5FK9 C;  1KDC A;  3M9B A;  3Q23 A;  5EAY A;  1LAB A;  5I2X A;  1BCP D;  2DJF C;  1WTV A;  1ONL A;  1K3R A;  4DFA A;  3GTO B;  2NVX B;  4F88 A;  3M4P A;  1EYC A;  4N8F A;  2R7F A;  3DLL A;  1WCM G;  2L5T A;  5M5Y H;  4KKT A;  3MTS A;  2KVM A;  1UWV A;  3TZU A;  1KXL A;  1SYG A;  2QIL A;  1VQD A;  1SYB A;  4DR7 Q;  2XIW A;  3ERQ A;  5M3M B;  1M4V A;  2KEC A;  2CHB D;  4LF7 L;  3HKZ G;  2JP1 A;  2F0N A;  5JAV A;  1DON A;  1AE3 A;  3OMG A;  3ERS X;  1IXR A;  4J15 A;  2XNA C;  3CPW A;  3I3C A;  2DGY A;  1IL8 A;  2R6G A;  4GN3 B;  4CDE C;  1IBK Q;  4HCS A;  2PQA A;  2Y0S B;  1BOS A;  1WFQ A;  5JVH 3;  4HMJ A;  1XJV A;  1X3F A;  2HDL A;  4OON A;  5C5M A;  1HH2 P;  1RDP D;  1BF4 A;  4NMZ A;  3I70 A;  4B3R L;  1SNO A;  3G71 A;  2VQF L;  5JEA H;  3DEO A;  3I4M H;  3G7L A;  1JOK A;  2EYM A;  1XX8 A;  3SE0 A;  1KQS A;  1S5E D;  4DR6 Q;  1QOH A;  1FGU A;  2MO1 A;  4LMQ D;  3CRK C;  4DAP A;  5CR3 A;  4QIW B;  4IUP A;  4BA2 I;  4XYQ A;  1VQP A;  4JBK A;  3A5Z B;  2NVQ H;  1BBU A;  4H44 C;  4LF5 L;  3HOU G;  3X3M A;  4DV0 L;  1S4Z A;  4P75 A;  4UP9 A;  1EIF A;  1N34 L;  2RHQ B;  2MGS A;  4K14 A;  2HHH Q;  2QDL A;  3PUY A;  3GTG B;  1Z6H A;  2E2J H;  1PZJ D;  2Z9H A;  4BXX H;  2B2Y C;  4C3I G;  1BKB A;  2BE5 D;  3TRZ A;  1XMO Q;  2WB1 G;  1DOM A;  2GA4 B;  2F52 A;  4O2D A;  1EYG A;  4R4C A;  1TY0 A;  1EY9 A;  4LF9 L;  4S3S A;  5JVG 3;  2IL8 A;  3EIV A;  1CM9 A;  1R4Q B;  1I4G A;  1RJT A;  4KKS A;  1XYI A;  2DNE A;  3CCJ A;  4G7O C;  4DUY L;  5HY6 A;  3A74 A;  3NTK A;  1IBK L;  2SEB D;  1IYJ B;  4KJN A;  4PMC A;  3EFX D;  3DMU A;  3RZO H;  1SNC A;  1SYD A;  1SFO H;  2CWA A;  3KFU A;  3H6M A;  4FF1 A;  3A8K E;  3S17 H;  2I5M X;  1WOC A;  1PH5 A;  2JA5 G;  3M85 A;  4A3J B;  1VQJ A;  5IT9 c;  5KND A;  3VYR A;  1KAA A;  1SBB B;  1JJ2 A;  2N88 A;  2YU9 B;  1JE5 A;  2Q2I A;  2RCF A;  4FXG C;  1EU4 A;  2JA9 A;  3HOX G;  5M5W H;  3BZK A;  4JVZ A;  4DV3 Q;  1A0I A;  1HTP A;  2R3Z A;  4LWC A;  5IGG A;  2NN6 G;  5C3X A;  3J80 E;  1YNJ D;  4PQX A;  4OX9 Q;  3EBE A;  2UUB L;  1WTX A;  5E3F A;  3GTQ B;  2AKW B;  3NQI A;  3TZD A;  4DV2 L;  4I65 A;  4WRD A;  5K36 H;  1EU3 A;  4LF6 Q;  2PCF B;  3NK9 A;  3S16 B;  2LXJ A;  2K4K A;  4YCW A;  1LAC A;  1CUK A;  3JAM c;  2PW7 A;  1HQR D;  3K5M A;  4YCU A;  3T1Y L;  2YTY A;  2LMC B;  3I2Z A;  4H0L C;  1U4R A;  3ND9 A;  4RHR A;  1FGB D;  3OHX C;  1HZC A;  4JI2 Q;  4DK6 C;  1B3Q A;  3GTM B;  2A73 B;  4HAE A;  2F0E A;  1TII D;  1BQQ T;  3PV0 A;  4PZ7 A;  3L0O A;  4GOP A;  5IGD A;  1LTB D;  4X65 Q;  3P20 A;  2VQE Q;  1C7Y A;  3TS0 A;  4R4Q A;  1P16 A;  2F0U A;  4WJW A;  5G3L D;  3UDG A;  1RD9 D;  5M5X H;  4IPC A;  1W6K A;  4X62 Q;  3FDT A;  4LUZ A;  3CQZ B;  1NUC A;  1E0B A;  1V1Q A;  4R8I A;  5CV7 A;  4C3I B;  1PLF A;  3H3V C;  1FNU A;  3GTM H;  2OQ0 A;  4JV5 Q;  1Y1W G;  3SK5 A;  3Q6S A;  2VB3 X;  3E9I A;  1HNZ Q;  3U58 A;  4OO1 H;  1VQA A;  4DUZ L;  4DR6 L;  2EXD A;  2N49 A;  4K2K A;  3MEF A;  1BCP C;  4C3J B;  4RG1 A;  2DY8 A;  2KBN A;  4R4I A;  3UDF A;  1B3A A;  1PTO H;  4ME5 A;  5IWA Q;  4ZYS A;  3S16 H;  3U4Z A;  3OW2 A;  1EYA A;  3KF6 B;  1YZ6 A;  1KD1 C;  5C4J B;  2HCC A;  1Q86 C;  2UXC Q;  3G4S A;  1QVG A;  1Y1W H;  1VQI A;  3JC6 6;  1A2T A;  5D65 A;  3D6W A;  4H13 C;  1MBY A;  2IPK D;  1I4X A;  1PFS A;  1YNJ C;  3W5O A;  3NBH B;  3H91 A;  2R7Z G;  3SK6 A;  1NAP A;  1T9H A;  1JOR A;  2LSS A;  3D4W A;  2FXQ A;  4JI1 Q;  1E24 A;  3BDC A;  1SNM A;  2DUD A;  2G5D A;  4KKU A;  4L5S A;  3PUX A;  5CV5 A;  3ZJY C;  1CQF A;  2DN8 A;  3BYT B;  4XQQ A;  5LHY 1;  3L3O C;  2WKC A;  1LTG D;  4HID A;  4M8A A;  2N78 A;  2B2T C;  3D3R A;  1J6Q A;  3SGI A;  2Q8R E;  5IGF A;  2O5I C;  1Z7T A;  5DNF A;  2PMZ E;  1PA6 A;  4O0A A;  1JC7 A;  4GZY C;  2K05 A;  4FDB A;  3OW7 A;  4IPH A;  2R93 G;  4HIK A;  5IYC H;  2FMM A;  4A3B G;  4JYA L;  2H4O A;  1I5F A;  3E0E A;  4UP7 A;  3KLR A;  3NBH A;  1SYF A;  2HCI A;  3I56 A;  3H0G H;  1WJJ A;  1ASZ A;  2R61 A;  1U0L A;  2JXM B;  4GS3 A;  4IUU A;  2ZJQ A;  3HOZ G;  4HED A;  2WV6 D;  1NNX A;  4OGQ C;  2JA6 H;  1LTS D;  4JI1 L;  4POF A;  1C4Q A;  3I4N B;  1YHA A;  5GAH C;  1E1O A;  1ET6 A;  5TSS A;  1S5D D;  5JPN C;  2DY7 A;  2JA5 B;  2CWP A;  5FLM H;  2Q2H A;  3NTI A;  4Y7N H;  2KHS A;  4LF8 L;  3UE0 A;  3S1R B;  4X64 Q;  2HUG A;  4LF5 Q;  2F0I A;  1J9O A;  3JAM L;  1M90 C;  1KRT A;  1SRO A;  4JI7 Q;  5DM7 3;  5LMN L;  4XXE A;  3OIP A;  1JE4 A;  5FLM G;  1HNZ L;  2XTI A;  3A7A B;  3I72 A;  5ELC A;  1YVC A;  1O7L A;  1YJN A;  4GN5 A;  3HFZ B;  1JWM D;  1OXX K;  3IFT A;  4DR5 Q;  1L1O B;  1BCP F;  1TWA B;  4DKA C;  1TS2 A;  3M4O H;  3KLW A;  1E3P A;  1QB5 D;  3HOV G;  2N3S A;  1NCV A;  3HOV H;  2A69 C;  2UUA L;  2Z1C A;  1EWC A;  4U68 A;  5LMN W;  3I4N H;  4X3K A;  1QIL A;  1AZP A;  1B44 D;  2UXB L;  1GXD C;  1D2B A;  3VR5 A;  1VQL A;  4JBW A;  4WJ3 M;  1Y8N B;  3T1H Q;  4QQB X;  4NXM Q;  3PUZ A;  4P2C B;  5KYI A;  5IGC A;  3TP7 A;  2Q8I B;  2KUM A;  1QG7 A;  1B9N A;  4HMI A;  1TWG B;  3SK8 A;  1GVP A;  1G29 1;  1Y14 B;  2XVS A;  2JEA I;  1HZB A;  2FHT A;  2XWB B;  1B9M A;  1DCZ A;  2EOT A;  4OWT B;  1JR0 D;  2WKD A;  2YU9 H;  1TWH B;  1V9P A;  1HNX Q;  4KD4 A;  4M1U B;  3NQT A;  4IAL A;  3STB D;  1TWC H;  1HNX L;  1EY6 A;  3KOJ A;  1EZ6 A;  1D5Z C;  1JJG A;  2RBM A;  3AQQ A;  5IYC G;  1EOT A;  1EQV A;  3BVG A;  5ELN A;  2LXK A;  1A8V A;  1S72 A;  4ODG A;  1XPU A;  4RKL A;  4TVA B;  1N36 L;  4XT1 B;  3ULL A;  3NEL A;  1SYE A;  3JAM i;  4A3L H;  4YWM A;  3CU7 A;  1F2L A;  1PH9 A;  3RN5 A;  2F0D A;  1FR3 A;  1UE7 A;  5J3B A;  3BG3 A;  1X3E A;  2R7Z B;  2RHS B;  2HT1 A;  3CCR A;  4ID6 A;  3KDF B;  5KYL A;  2E8G A;  5C0X J;  3S1Q B;  3CCS A;  4FF4 A;  4DUZ Q;  4FF3 A;  4U67 3;  3D0F A;  3J80 c;  1HZA A;  2I07 B;  2FFK B;  1XMQ Q;  3RD4 A;  1KLU D;  3D8G A;  2A68 D;  4K0K Q;  3PCO B;  3M4Q A;  2HQE A;  2CCZ A;  4LAA A;  1FNW A;  3R93 A;  4IUQ A;  3H94 A;  4CKC A;  2N8N A;  4QUF A;  2Y0S E;  2A6E C;  2K04 A;  3J7Z C;  4RGN A;  4IQZ A;  3NUC A;  2K5W A;  2EY1 A;  3H0G B;  4DR1 Q;  3LWE A;  1TT2 A;  4DK1 A;  1STB A;  4CJ0 B;  4GKJ Q;  5D3I B;  4A3I H;  4HSP A;  4Q5V A;  1N33 Q;  1RCV D;  5M3M H;  2VQF Q;  3FKI H;  2K7V A;  1XNR L;  3N6R A;  1RIP A;  3O13 A;  4YIJ A;  1VQC A;  4C3H G;  1G51 A;  2BOS A;  4JI5 Q;  1GUT A;  3V2T A;  1WTW A;  4F87 A;  4RGT A;  3VA7 A;  2CQO A;  4C1N K;  1WTP A;  1Y1V B;  3HOV B;  1TKW B;  4IUT A;  4PZ8 A;  2NTT A;  3S15 B;  3F8T A;  1UNS A;  5CBE E;  3TME A;  1TR5 A;  5KIX A;  3WDN A;  1SMX A;  2IW3 A;  5IGE A;  1HXY D;  2JA8 G;  4DR1 L;  4FVM A;  2EYJ A;  4DV4 L;  3LWU A;  2ICE C;  4KK7 A;  3ITP A;  4YWK A;  3KK7 A;  4YHH Q;  1KDA A;  4OWW B;  2RDG A;  2OTL A;  2EE1 A;  5ELO A;  1PZK D;  1WCM B;  3CPF A;  3EA6 A;  5I9O A;  3NEM A;  3MZ5 A;  3J81 i;  4RAU C;  3IL8 A;  4MHE A;  5EBC A;  1X32 A;  2F0P A;  4DV7 L;  2PQE A;  3QOL A;  2K03 A;  1CKO A;  1TWF B;  1IYV A;  3OWE B;  5E4X A;  5IOC A;  3OSO A;  1STH A;  1KNA A;  3TP5 A;  2I46 A;  5ELD A;  1PV4 A;  1YHB A;  4HJ9 A;  3HOX B;  1XTD A;  1ENF A;  3HOY G;  2LS0 1;  1FYC A;  1DOK A;  4RKB A;  4N8X 1;  4DGZ A;  3I73 A;  4DXG A;  4JK1 C;  5IP9 H;  1E2V A;  1VS0 A;  4QMG A;  1SE3 A;  4KHP Q;  1X65 A;  2RDF A;  3K7A H;  3QOJ A;  5C3E H;  4YHH L;  4K6D A;  2YYZ A;  2L12 A;  4LW1 A;  3S1N B;  2F4V L;  1WTH A;  1PRT D;  3DUZ A;  4OXP A;  2JA6 G;  3MWY W;  1NJI C;  3NSW A;  1MI2 A;  5FLX L;  5EKI A;  3S9W A;  1TS5 A;  3K5N A;  3J7Y W;  1D6E C;  3E9H A;  1I50 H;  1HUN A;  4ZRZ A;  1EIH A;  1X3P A;  2EXZ A;  1TS3 A;  4G7Z C;  4LUV A;  1I3Q B;  2WAQ B;  4KTA A;  4AYB B;  4IFD I;  2PO4 A;  2G9D A;  2WAQ E;  4AYB E;  4HIM A;  1NMF A;  2EZV A;  4RWS C;  2J0T D;  2TSS A;  1XNR Q;  2D9U A;  2VQE L;  4KJO A;  3AU7 A;  1VQ4 A;  3M7G A;  2UXB Q;  2B2W C;  1PH8 A;  5IYB G;  3GO5 A;  4TSS A;  5NUC A;  1OTC A;  2RVL A;  1QWY A;  1LM0 A;  1ICF B;  3HOW B;  1E2W A;  3J7A 5;  4APV A;  2X6G A;  1I4H A;  4UY8 C;  2M2L A;  4NW2 A;  2K5D A;  4A3M G;  1CZW A;  1A3V A;  1LT4 D;  5EPL A;  3GTK H;  4MTK A;  3RR5 A;  4H02 A;  1MKH A;  2AUJ D;  5M9O A;  1Q3L A;  4LF8 Q;  2O2L D;  3H15 A;  1Y1W B;  3GTO H;  1N34 Q;  1PH7 A;  4A3F B;  3UI2 A;  1W6J A;  3T16 A;  3R2T A;  5DLQ E;  1EY0 A;  1EFI D;  2K14 A;  1BNZ A;  1Q8I A;  3URY A;  4C3I H;  4A3K G;  1TY2 A;  3VR2 A;  1IBL L;  2VZA A;  4QF4 A;  3K59 A;  2K33 A;  3HKZ B;  1IW7 D;  4JI6 L;  3J80 L;  1RKN A;  2QEX A;  5EBD A;  2MUY A;  3GD7 A;  5BN3 A;  4C3J H;  3J81 j;  4JI4 L;  2JA7 H;  2IJ0 A;  4PV1 C;  2F4V Q;  1EEF D;  2CFM A;  4KN4 C;  3T1Y Q;  2Z4H A;  1AE2 A;  2QEJ C;  4ZKC B;  3D6C A;  2R92 B;  1SE2 A;  2BE5 C;  1AZQ A;  4BY7 G;  1LO5 D;  2P5Z X;  5GRO A;  1LUZ A;  1DGS A;  4A3D B;  1B7Y B;  2ALY B;  2QDB A;  4KD3 A;  3T53 B;  3GV3 A;  1GUN A;  1F77 A;  3TRE A;  2RDH A;  1LTI D;  2EVB A;  1Q46 A;  4GLV B;  1H9J A;  1K9M C;  2O5J C;  1EWI A;  2H1E A;  3CAM A;  4K8I A;  5C44 H;  1PH2 A;  1HHV A;  1VQ9 A;  4QY7 A;  5ELE A;  1G6Z A;  3S1M B;  1XNQ L;  1HUM A;  4DUY Q;  2KED A;  2ZM6 Q;  4XQN A;  2JA8 B;  5EQ0 A;  1EWH A;  3HP3 A;  2K5V A;  3CF5 A;  2JA7 B;  3I4L A;  3V05 A;  1W3S A;  1STN A;  5F2D A;  1O7I A;  3KF8 B;  4KHZ A;  2KHI A;  4JG2 A;  2EYF A;  3I7F A;  4BY1 H;  2V1C C;  2K6A A;  2IT1 A;  3A5U A;  1HZ9 A;  3WOE A;  2F0G A;  4GOP B;  1LT5 D;  4X3T A;  4DN4 M;  3S1Q H;  3A55 A;  5KGU A;  1VMP A;  4K6L A;  5M5X B;  1I6H H;  3MXG A;  4YY3 L;  2VS1 A;  5IYB H;  3GTP H;  2OEO A;  2HDM A;  3FPP A;  3FMC A;  3OIQ A;  3SHL A;  4JI8 Q;  1RHP A;  1QUQ A;  4DNT B;  3J80 i;  4BWG B;  1XWE A;  3S1N H;  3NP8 A;  4IOA A;  1C0A A;  1BBX C;  2FJ2 A;  4IJH A;  1JOO A;  4JOI C;  1YIT A;  3HOU H;  4ZLT F;  5FKA C;  5JJI A;  4DPG A;  2IX3 A;  3ERO A;  4A3M B;  3I4M G;  4RH6 A;  3Q8D A;  1X9N A;  1LTR D;  2UXD Q;  4HSV A;  2NN6 I;  1E7Z A;  2B63 B;  1JQY D;  4ZQ3 A;  4DR3 Q;  1YJ9 A;  4XQJ A;  1HR0 W;  3RZO B;  4B3M Q;  3QR8 A;  1I3Q H;  3K8A A;  4CJ1 B;  1SE8 A;  1CT1 D;  2K75 A;  3M3Y H;  3CC4 A;  1PHJ A;  3CHB D;  5A2Q L;  3HG9 A;  1EUJ A;  1DXM A;  3HOZ B;  4KMU C;  1EFW A;  1VQK A;  1ZYR D;  2CH4 A;  2UUC Q;  5GAD C;  4MN3 A;  2KJX A;  3I4N G; 
#chains in the Genus database with same CATH homology
 1KAW A;  1SRO A;  3A0J A;  3KYH C;  1J5E L;  1GM5 A;  2NZH A;  4BBS H;  4B3S Q;  4JI7 Q;  4BXX G;  2KCM A;  1MIU A;  2NZO A;  1PH3 A;  5LMN L;  1N32 L;  4NPS A;  1TWF H;  2ZTE A;  1PH1 A;  3ICE A;  3RNU A;  3MXN B;  1HR0 L;  4A4I A;  4EQ5 A;  3FHW A;  5FLM G;  1EQR A;  1EQQ A;  5GAG C;  1HNZ L;  3F1Z A;  2XTI A;  4AIM A;  2R92 G;  4GOP C;  1YVC A;  1Q8K A;  1K73 C;  1YJN A;  4JI3 L;  2BH2 A;  2AWO A;  3AFQ A;  4GN5 A;  4GNX B;  3HFZ B;  1OXX K;  1TXY A;  4JBJ A;  1L1O B;  3K7U C;  4R1J A;  4HJ8 A;  4DR5 Q;  1I94 Q;  3PF4 A;  4DV6 L;  3S15 H;  4UPA A;  4DKA C;  4C3H H;  3M4O H;  4GKK L;  4L5T A;  3UDX A;  3KLW A;  1E3P A;  3K0X A;  2RCN A;  3HOV G;  1Q81 C;  2N3S A;  3D31 A;  2K52 A;  4NB3 A;  3W1G A;  4JI4 Q;  1XNQ Q;  3H3V I;  3HOV H;  3HOZ H;  3LGJ A;  2UUA L;  4B3S L;  5LMN W;  1AH9 A;  3F2B A;  3I4N H;  3PO3 H;  5C4J H;  3L2P A;  2E5L Q;  3CQZ H;  4BBS G;  1D8L A;  2UXB L;  1SLJ A;  1JB7 A;  1RL2 A;  3KJP A;  5JEA G;  2ID0 A;  4YCV A;  3KDF A;  3RLO A;  2WP8 J;  2PQA B;  1VQL A;  2UUA Q;  4JBW A;  2B63 G;  4WJ3 M;  5AJ3 L;  5JEA J;  3T1H Q;  5C3E G;  1OXV A;  4JI0 L;  4NXM Q;  3PUZ A;  4QQB X;  1WI5 A;  4GLA C;  3CCE A;  2HIX A;  4ALP A;  1SR3 A;  1QVC A;  4DV0 Q;  2HQL A;  1GVP A;  5IP7 G;  1G29 1;  1Y14 B;  2JEA I;  2H5X A;  1HZB A;  1K8G A;  3S24 A;  2BA1 A;  4HJ7 A;  2K50 A;  4OWT B;  1W2B A;  4JBM A;  2BH8 A;  2PNH A;  2YU9 H;  4A3M H;  1CSP A;  1L1O C;  3CP0 A;  4PZ6 A;  1V9P A;  5M3M G;  4X66 Q;  2MNA A;  4IOC A;  1MJC A;  1HNX Q;  4AQY L;  1IBM L;  3G48 A;  1IL2 A;  2ASB A;  4LFB Q;  4IFD G;  3STB D;  3K81 C;  1BBW A;  1TWC H;  4QJF A;  1EIY B;  2UUC L;  1HNX L;  3KOJ A;  3HKZ E;  4BBR G;  4LFA L;  4P71 A;  1JJG A;  2Y0S G;  4DNI A;  3AQQ A;  4OO1 G;  5IYC G;  3S2D H;  3OTO Q;  4GKK Q;  2R93 H;  1GKH A;  1WYD A;  5ELN A;  2LXK A;  1A8V A;  1KL9 A;  2ZJR A;  1S72 A;  4BY7 H;  1XPU A;  4X64 L;  2B29 A;  4DR5 L;  2R7Z H;  4TVA B;  1VQ6 A;  1LTL A;  3TEH B;  4DK3 C;  1HNW L;  2D62 A;  1N36 L;  1K83 H;  1VQE A;  2VUM H;  3ULL A;  4LF6 L;  3NEL A;  2R7D A;  2B3G A;  4LFC L;  3JAM i;  3GDE A;  4OO1 I;  4A3L H;  4YWM A;  2L15 A;  4RMF A;  1UE5 A;  2JA7 G;  1TWA H;  2KCT A;  3VDY A;  1PH9 A;  5LMU Q;  2Z6K A;  3RN5 A;  1N33 L;  1UE7 A;  5J3B A;  4JC0 A;  4LNQ A;  3J81 c;  5C44 G;  4HJA A;  1L0W A;  4A3F H;  1YI2 A;  1X3E A;  4GNX C;  1VQF A;  2UU9 L;  2RHS B;  2VL6 A;  3PIO A;  1XPR A;  2HT1 A;  3CCR A;  3M9B A;  3KDF B;  5EAY A;  2E8G A;  5C0X J;  3NEN A;  3CCS A;  2JEB I;  4JI7 L;  4LF7 Q;  1K3R A;  1HNW Q;  2IHF A;  3F2C A;  4DUZ Q;  1VQG A;  3D0F A;  1QVF A;  3J80 c;  3M4P A;  1HZA A;  3EN2 A;  4DV6 Q;  2R7F A;  2VUM G;  4A93 G;  3AFP A;  1XMQ Q;  1EOV A;  3DLL A;  1WCM G;  5M5Y H;  3RLF A;  3L7Z C;  4K0K Q;  1UWV A;  1NBW A;  2PI2 E;  1NE3 A;  3M4Q A;  3PCO B;  4JYA Q;  1KXL A;  2IX0 A;  2CCZ A;  1VQD A;  1VCI A;  2GN5 A;  4DR7 Q;  3CMA A;  2N8N A;  2B63 H;  4XIG S;  1QZH A;  2Y0S E;  4X6A H;  3J7Z C;  5BR8 Q;  3UDI A;  4LF7 L;  3HKZ G;  1YBY A;  1VQ5 A;  1YEZ A;  4YY3 Q;  4BBR H;  1PVO A;  1WCM H;  2UU9 Q;  4PG3 A;  4DR1 Q;  5HGQ A;  1AE3 A;  1Q7Y C;  2UUB Q;  4B3T Q;  5E7N A;  2AMC B;  2A19 A;  1QZG A;  4GKJ Q;  3ERS X;  1IXR A;  2EIF A;  4J15 A;  4AQY Q;  1FVI A;  2KEN A;  4A3I H;  1N33 Q;  3CPW A;  2YV5 A;  2DGY A;  5M3M H;  2VQF Q;  2R6G A;  3FKI H;  4GN3 B;  1YNX A;  4P73 A;  1IBK Q;  1XNR L;  2PQA A;  3FP9 A;  1RIP A;  2WB1 E;  1WFQ A;  1VQC A;  4AH6 A;  1X3F A;  1XJV A;  1G51 A;  4JI5 Q;  4A3L G;  4OON A;  4DV1 L;  1G6P A;  2OQK A;  2CQO A;  1I94 L;  4DR7 L;  1HH2 P;  2Q2T A;  3HOX H;  5C0X I;  4LF9 Q;  4R4T A;  4B3R L;  4PZ8 A;  5H1S E;  3G71 A;  3AEV A;  1UEB A;  3F8T A;  2VQF L;  1XMQ L;  1P8L A;  2JA5 H;  2F3I A;  2OTJ A;  3I4M H;  4IO9 A;  4IPG A;  1JJC B;  1SMX A;  1KQS A;  1CKN B;  4DR6 Q;  1HR0 Q;  4B3T L;  2JA8 G;  4DR1 L;  1FGU A;  2MO1 A;  4IJL A;  1XMO L;  4DV4 L;  2ES2 A;  5BR8 L;  4YWK A;  4BA2 I;  1Y1V G;  4OX9 L;  1VQP A;  4YHH Q;  4QGU A;  4A3B H;  4JBK A;  3A5Z B;  1Q1B A;  2NVQ H;  4DV5 L;  4OWW B;  4QL5 A;  2OTL A;  1BBU A;  5LMU L;  4LF5 L;  1QUQ B;  2BA0 A;  3HOU G;  4DV0 L;  5ELO A;  4JI5 L;  4P75 A;  3CPF A;  4UP9 A;  4DR2 L;  1EIF A;  3NEM A;  2RHQ B;  1N34 L;  4WJ4 A;  3J81 i;  4JOI A;  2R92 H;  5FJ8 G;  3RLN A;  2VNU D;  1N36 Q;  5JJL A;  4MNO A;  2K5H A;  2HHH Q;  3PUY A;  4DV7 L;  4JI6 Q;  5M3F G;  2E2J H;  2E5L L;  1VQB A;  1CKO A;  4MTN A;  1JMC A;  4A3C H;  4LUO A;  2VW9 A;  2NVY H;  4BXX H;  5IWA L;  2ZM6 L;  3K80 C;  1N9W A;  3GTQ H;  3PUV A;  1NY4 A;  1BKB A;  3CME A;  4LFA Q;  3TRZ A;  3S2H H;  3H0G G;  1XMO Q;  2JE6 I;  2WB1 G;  1LYL A;  3CD6 A;  1PV4 A;  1YHB A;  2F52 A;  4O2D A;  3GTJ H;  4HJ9 A;  3ER0 A;  1XTD A;  1IBM Q;  2KHJ A;  1YJW A;  1EYG A;  4R4C A;  1TWG H;  2HHH L;  3STB C;  2RF4 A;  2D0O A;  4A76 A;  1E22 A;  1OXU A;  2C35 B;  1C9O A;  4JV5 L;  2XGT A;  4NXN L;  5IE8 A;  5IP9 H;  4LF9 L;  1PH4 A;  1KHI A;  1ASY A;  4X62 L;  4UP8 A;  1VS0 A;  3EIV A;  2WFW A;  2IHE A;  4KHP Q;  1X65 A;  1XPO A;  1S3O A;  3K7A H;  4ME3 A;  3TS2 A;  5C3E H;  4YHH L;  2YYZ A;  4LW1 A;  1IZ6 A;  3PO2 G;  2F4V L;  1V43 A;  2K5N A;  3CCJ A;  4DUY L;  5HY6 A;  1KRS A;  4DR3 L;  3A74 A;  3T1H L;  1IBK L;  4JI0 Q;  1IYJ B;  5C4X G;  1X56 A;  1Z47 A;  1VQ8 A;  1FJG Q;  4OXP A;  2HIV A;  1PYS B;  2JA6 G;  4A3G G;  1NJI C;  2E2I H;  1SFO H;  3RZO H;  3KFU A;  2CWA A;  3S17 H;  2I5M X;  1WOC A;  2OWO A;  1X54 A;  4A3I G;  4TQU S;  1K0R A;  4JI2 L;  5LMN Q;  4A3K H;  1PH5 A;  1UE1 A;  3M85 A;  2JA5 G;  1VQJ A;  5IT9 c;  1N32 Q;  3E9H A;  1I50 H;  3PO2 H;  1NTG A;  2VY3 A;  1R9T H;  4DR4 Q;  1JJ2 A;  1PYB A;  1L2F A;  4LUV A;  4IFD I;  3OYY A;  2WAQ E;  2MQH A;  1JE5 A;  2Q2I A;  4AYB E;  2I5L X;  1H95 A;  1FL0 A;  2JA9 A;  3HOX G;  1NMF A;  5M5W H;  3CXC A;  4HIM A;  1KIX A;  3BZK A;  2EQS A;  4DV3 Q;  1PH6 A;  1K8A C;  5AJ3 Q;  1VQN A;  4DR2 Q;  1VQO A;  1X6O A;  1XNR Q;  1D7Q A;  1A0I A;  2JJQ A;  2VQE L;  4A3J G;  4GNX A;  2I0Q A;  3DM3 A;  1VQ4 A;  2UXB Q;  4LWC A;  1PH8 A;  2NN6 G;  5IYB G;  3GO5 A;  1OTC A;  4OX9 Q;  3EBE A;  2UUB L;  1LM0 A;  4A93 H;  2AKW B;  2NVX H;  2QA4 A;  3J7A 5;  4APV A;  3W1B A;  4DV2 L;  4UY8 C;  2UXD L;  3BZC A;  4MZ9 A;  4A3M G;  1SN8 A;  4A75 A;  2QGQ A;  2JK8 A;  3GTK H;  4LFB L;  4XTC S;  4HJ5 A;  1FJG L;  4KHP L;  3RZD H;  3PSI A;  3RR5 A;  2YTV A;  4H02 A;  4A3D G;  1MKH A;  4BY1 G;  4LF8 Q;  3H15 A;  2Z6K C;  4JI3 Q;  4LF6 Q;  3GTO H;  4NXM L;  1L1O A;  1U5K A;  1N34 Q;  2LXJ A;  2K4K A;  1PH7 A;  3S1M H;  4YCW A;  1CUK A;  2YTX A;  2Q2U A;  3UE1 A;  4R4O A;  4BA1 I;  2UXC L;  3JAM c;  4YCU A;  1Y1V H;  5DLQ E;  5GAE C;  3T1Y L;  2YTY A;  2K14 A;  5IP9 G;  3I2Z A;  3CCV A;  3I4O A;  1BVS A;  1VQH A;  3CCM A;  1HZC A;  4JI2 Q;  4C3I H;  1B70 B;  4DK6 C;  3KJO A;  3B6Y A;  4A3K G;  3PUW A;  4IFD J;  1IBL L;  4C2M H;  2VZA A;  1OXT A;  3PV0 A;  4PZ7 A;  2IX1 A;  3L0O A;  4L5Q A;  1IBL Q;  4GOP A;  4DV7 Q;  1VQ7 A;  1OXS C;  4JI6 L;  2QEX A;  4X65 Q;  2VQE Q;  3GD7 A;  3J81 j;  4C3J H;  2JA7 H;  4JI4 L;  3PGZ A;  1C7Y A;  3TS0 A;  2F4V Q;  4R4Q A;  1P16 A;  2CFM A;  3CC7 A;  3BU2 A;  4LF4 Q;  3T1Y Q;  1AE2 A;  2GVB A;  3CCQ A;  3UDG A;  5JJK A;  1Q12 A;  3WWV A;  5M5X H;  2MFI A;  2MO0 A;  4IPC A;  4EX5 A;  4A3E H;  3S14 H;  4BY7 G;  2OCE A;  4X62 Q;  4LF4 L;  4LUZ A;  4B3M L;  1V1Q A;  5GRO A;  1LUZ A;  1DGS A;  1A63 A;  1B7Y B;  2ALY B;  3GTM H;  2OQ0 A;  4JV5 Q;  1Y1W G;  3CCU A;  3I55 A;  3E9I A;  1HNZ Q;  3TRE A;  3HOY H;  3U58 A;  2IY5 B;  5FJ8 H;  1VQA A;  1Q1E A;  4DUZ L;  4DR6 L;  4A3G H;  1Q46 A;  2EXD A;  2N49 A;  4GLV B;  1K9M C;  1EWI A;  3CAM A;  5C44 H;  1PH2 A;  4DAY B;  3MEF A;  1VQ9 A;  4QY7 A;  4RG1 A;  5C0X G;  3HOW G;  1NMG A;  1XNQ L;  2KBN A;  4R4I A;  2JQO A;  3UDF A;  4DV4 Q;  4DUY Q;  3GTG H;  5IWA Q;  2ZM6 Q;  2I5H A;  3S16 H;  3U4Z A;  3OW2 A;  1VQM A;  3KF6 B;  1YZ6 A;  1KD1 C;  4P72 A;  5C4X H;  1Q86 C;  3CCL A;  2UXC Q;  3M7N A;  2K5V A;  3CF5 A;  3G4S A;  1QVG A;  1Y1W H;  1YHQ A;  4JI8 L;  2ATW A;  1VQI A;  3JC6 6;  1UE6 A;  1W3S A;  1O7I A;  3FKI G;  3KF8 B;  2ZTC A;  3W5O A;  4X65 L;  2A8V A;  1PFS A;  1CKN A;  3NBH B;  4Y52 H;  1B8A A;  4KHZ A;  3ULJ A;  2KHI A;  4JG2 A;  3HOW H;  2R7Z G;  1T9H A;  4GKJ L;  3I7F A;  4BY1 H;  5K36 G;  2LSS A;  2V1C C;  4DR4 L;  3CW2 C;  2FXQ A;  2IT1 A;  3A5U A;  4HIO A;  1HZ9 A;  3IRB A;  1SRU A;  4JI1 Q;  1E24 A;  2DUD A;  4YWL A;  4KLK A;  4GOP B;  2A1A A;  4L5S A;  2AHO B;  2Z0S A;  3PUX A;  3S1R H;  3ZJY C;  5IYD H;  1JT8 A;  3PO3 G;  5IYD G;  3RN2 A;  5M3F H;  1J5E Q;  4DAM A;  3S1Q H;  4HID A;  4PMW A;  4IPD A;  3U50 C;  2WAQ G;  2N78 A;  4AYB G;  1I6H H;  4A3J H;  1GD7 A;  1J6Q A;  3SGI A;  4X66 L;  4YY3 L;  2VS1 A;  5IYB H;  2D0P A;  4LFC Q;  4GN4 B;  3GTP H;  1CSQ A;  4K0K L;  2PMZ E;  1PA6 A;  4P74 A;  4O0A A;  4JI8 Q;  1QUQ A;  4JCV E;  4FDB A;  2CKZ B;  5IP7 H;  4IPH A;  2E2H H;  3J80 i;  1CKM A;  1N8R C;  1E1T A;  2R93 G;  4QIW E;  2ZJP A;  3AYH B;  3S1N H;  4HIK A;  5IYC H;  4A3B G;  4IOA A;  4JYA L;  1C0A A;  1I5F A;  3E0E A;  4IJH A;  4OWX B;  2GVA A;  4JOI C;  4UP7 A;  1YIT A;  3HOU H;  3BJU A;  3HOY G;  3G6E A;  3I56 A;  3ULP A;  1M1K C;  3H0G H;  4DPG A;  5JJI A;  1GO3 E;  1WJJ A;  5GQO A;  1ASZ A;  1X3G A;  5IY0 A;  1TWH H;  1A62 A;  1Z9F A;  3Q8D A;  1U0L A;  2JA8 H;  5FLX c;  3I4M G;  4POG A;  4GS3 A;  4DV2 Q;  1X9N A;  2UXD Q;  2ZJQ A;  4KI0 A;  3HOZ G;  2NN6 I;  1S40 A;  1Q82 C;  1E7Z A;  4B3R Q;  4DR3 Q;  1YIJ A;  1YJ9 A;  2JA6 H;  3KF6 A;  1HR0 W;  4JI1 L;  4POF A;  4A3C G;  4B3M Q;  3F2D A;  4GLX A;  2ZTD A;  1I3Q H;  3PIP A;  1X55 A;  4A3F G;  1KC8 C;  1YHA A;  3K8A A;  1SE8 A;  5GAH C;  4DV1 Q;  1E1O A;  3PF5 A;  4A3D H;  2PI2 A;  2K75 A;  3HKS A;  3U4V A;  4A3E G;  3M3Y H;  3CC4 A;  1MJE A;  2CWP A;  5FLM H;  3OTO L;  1PHJ A;  2Q2H A;  4L5R C;  4Y7N H;  4DV3 L;  1HJP A;  4NXN Q;  2NVT H;  3H3V H;  1EUJ A;  4LF8 L;  3UE0 A;  1EFW A;  1VQK A;  2AWN A;  4X64 Q;  4LF5 Q;  3TQY A;  2UUC Q;  3CC2 A;  5GAD C;  4DV5 Q;  1M90 C;  3GTL H;  3I4N G;  1KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...