1SR3A

Solution structure of the heme chaperone ccme of escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
b'LRSNIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEKGNHILAKEVLAKHDENYTPPEVEKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APO-CCME
publication title NMR Structure of the Heme Chaperone Ccme Reveals a Novel Functional Motif
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 14
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sr3A00
1NMGA 4KHZA 4OWXB 1Z47A 5LMNW 3CC7A 4JI7Q 1HJPA 3NENA 4RG1A 1YHAA 3WWVA 4DV6L 3J81i 4R4CA 2N78A 2K75A 1B7YB 5C3EH 2VQEQ 3RNUA 1IBKQ 2OTJA 1I50H 3JAMi 1IBLQ 5JJLA 2R92H 1DGSA 4BXXH 2PI2A 1Q86C 4YCVA 4DV4Q 1L0WA 2I5HA 3H0GG 1HNXQ 4A93G 3F2CA 4PZ6A 3UE0A 3ICEA 4LFCL 4A3DG 1Z9FA 4A3CG 3DLLA 2YV5A 4DR7Q 1NY4A 5LMUQ 1PV4A 2D0PA 4OWWB 4P74A 5JEAJ 1TWAH 3F2DA 1V9PA 4A3BH 2RHSB 3CPWA 3G48A 1X3GA 2HIXA 3PUZA 4LWCA 1RIPA 4DUYQ 5E7NA 2JA5H 1GD7A 1Q1EA 4A3GH 3ULJA 4KHPQ 3KFUA 3CC4A 1R9TH 5FJ8H 5C4XG 4RMFA 5IT9c 3CP0A 3K0XA 2H5XA 1CSQA 2AKWB 3HOWG 4QIWE 2UU9Q 1HR0W 4R1JA 4JI5Q 3CAMA 3U50C 3U4VA 5M5XH 4BY7G 4JBJA 4NB3A 5M3FG 4DUZL 4TVAB 1HNZL 3F1ZA 1Q46A 4APVA 3I2ZA 4ALPA 4LF6Q 4HIKA 3A5UA 3Q8DA 3CF5A 3HOVH 1SMXA 5C44G 2Z0SA 1QZGA 3S2HH 1TWFH 1W3SA 5C0XJ 3J7A5 4DAYB 4A3EH 4IO9A 4JI3L 1XMOQ 3PO3G 2LXKA 1WOCA 1NJIC 1J5EQ 5HY6A 3A5ZB 3GTPH 1C0AA 3PV0A 1Y1WG 1HR0L 4YCUA 2MNAA 2NZOA 4PZ8A 5IY0A 4DK3C 4MTNA 5FLMG 2ES2A 4X65Q 1CKMA 2CQOA 3PUXA 4LF9Q 2ATWA 2UXCQ 4UY8C 1LTLA 2NN6I 1N36Q 4R4OA 5BR8Q 4YCWA 4GOPB 1TWHH 1PH1A 2IX0A 2YU9H 4LUOA 2A8VA 3ZJYC 4EX5A 1IBKL 2VQEL 3CCLA 3GTLH 4DR5Q 4UP7A 4HJ7A 1IBLL 2FXQA 1VQKA 1KRSA 2JE6I 1QVGA 4DV4L 1G291 1UE7A 1TXYA 1HNXL 2CKZB 1E7ZA 1TWGH 2ZTEA 1XPOA 4GLXA 1WFQA 1WCMG 1Y1VH 5M3MH 4OWTB 4NPSA 4X64Q 1CKOA 1EUJA 2BA1A 1NE3A 1VQGA 1B8AA 1X3EA 2DGYA 5LMUL 3HKZG 4GOPA 3T1HQ 1VQJA 1IXRA 4GOPC 1E1TA 4YY3L 3I4MH 4LFBQ 5C0XI 4A76A 1N34Q 2K5HA 1XMQQ 4H02A 1M90C 2Q2TA 2RCNA 1K8AC 2EIFA 2R93H 1PH5A 4DR6Q 3E9IA 1X56A 2UXBQ 4DUYL 5DLQE 2XTIA 5J3BA 2HHHQ 5GAEC 2KENA 4KHPL 4HJ8A 1CKNB 4A3LH 1AH9A 4JBWA 3HOXG 1OTCA 1EOVA 3KJOA 1JB7A 5GROA 5GADC 1S3OA 4L5QA 4JI5L 2E2JH 2UU9L 3CCQA 1XPRA 2WFWA 1Q81C 1PVOA 1XNRL 2I5LX 1VQ7A 3CCMA 4YWLA 3NEMA 4DV3Q 1CSPA 1A62A 3RLFA 1SE8A 4HJ9A 2NVQH 1H95A 3I56A 2I0QA 3K81C 1KL9A 4X62Q 2IY5B 5IYBH 4A3IG 1XMOL 2ZJRA 1JT8A 1J5EL 5IE8A 3RN5A 5IYDH 2VL6A 1EQQA 4A3FH 4GKJQ 5JEAG 1C7YA 2OQKA 1VQIA 4X65L 4JI1Q 3GTMH 3I4NH 4LF9L 2UXCL 3D0FA 1N32L 2JK8A 2NN6G 4AIMA 4ME3A 4JG2A 3I4OA 3OTOQ 1KD1C 1N36L 3S2DH 5BR8L 2KCMA 3RLNA 1NTGA 2JJQA 3CQZH 3M9BA 2E2HH 4IOCA 4DR5L 4K0KQ 4AQYQ 1G6PA 1C9OA 4YHHQ 2VNUD 2AWOA 2CFMA 3A74A 5IP7H 4GLAC 1A0IA 2F3IA 3BJUA 2N49A 2JQOA 3FHWA 4X66L 4B3RQ 4KI0A 1FGUA 3M7NA 3I55A 1UEBA 4PG3A 1KQSA 1N33L 2WB1E 2K14A 4GKKQ 3K8AA 4C3IH 4X64L 2B63G 1EQRA 3KDFB 2A19A 4MNOA 3T1HL 5C0XG 4LFBL 4IPDA 1YNXA 2YYZA 1SFOH 1N34L 1XMQL 3HOUH 1PH9A 4R4TA 2ZJQA 4DR6L 1VQNA 2UXBL 1N9WA 4NXMQ 2MFIA 3TQYA 3STBC 2HHHL 1KHIA 1YI2A 2JA6G 3NBHB 4POGA 2K50A 5IP9H 1I6HH 4A3MH 3PIOA 3GTKH 1N8RC 2UUAQ 3KDFA 3GTJH 3S1MH 4Y7NH 4HJAA 3J80c 1IL2A 1YVCA 1HZ9A 3AFPA 2B29A 1OXTA 2HQLA 1GVPA 5AJ3Q 3AEVA 2KBNA 3U58A 4JV5Q 3PUVA 3RN2A 2JA7H 1EFWA 3HOWH 1VQ9A 2BH8A 5C3EG 3CCRA 1GM5A 2ID0A 1D8LA 4DV3L 3AYHB 4X6AH 1IBMQ 2R92G 1BKBA 3D31A 4X62L 2N3SA 3KF6B 4LW1A 3PF4A 3TS2A 4L5TA 4LF7Q 3EBEA 2NVTH 2VQFQ 1EIYB 1XJVA 1VQFA 1HZAA 2LXJA 3K7AH 4JC0A 3RZDH 3PUYA 1PH6A 4BY1H 2NVYH 4JBMA 4GKJL 2PMZE 3TRZA 1V43A 1A63A 4QJFA 1KRTA 1VQLA 1SLJA 1YZ6A 4IPGA 4C2MH 1VQ4A 1Q1BA 3PF5A 2OQ0A 1YJWA 3OTOL 3S16H 4C3HH 4L5RC 3HOYH 2UUBQ 2OTLA 1L1OB 4JYAQ 4DV1Q 4P73A 3KF6A 3LGJA 4QY7A 4AQYL 4K0KL 1YITA 2JA5G 1VQBA 3PO2H 2Y0SE 2AWNA 4YHHL 2R7ZG 4A3GG 5IYCH 1S40A 1VQ5A 1HH2P 1OXUA 4B3RL 1K8GA 4LNQA 3ERSX 4GLVB 2ASBA 2L15A 3S24A 4DR4Q 4JI8Q 1YJNA 4GKKL 1LUZA 1PH7A 2UUCQ 1XNQQ 1PFSA 1PA6A 4IFDG 4BBRG 2N8NA 3L7ZC 4QQBX 5JJIA 2GN5A 1K0RA 3NELA 1L1OA 1SR3A 2JA8H 3HOVG 3J81j 1L1OC 3TREA 1P8LA 1SN8A 1QVFA 3I7FA 2DUDA 4DR1Q 3CD6A 5ELNA 4DR3Q 2QGQA 4A3EG 4NXML 1E24A 1MIUA 4DR7L 4IPHA 1FJGQ 3HOZH 4DV0Q 3BU2A 2LSSA 2MO0A 2ZM6Q 4GN4B 3UDIA 2UUAL 3EIVA 3H15A 1K73C 4WJ3M 3A0JA 3BZCA 3CCUA 2JEAI 5AJ3L 4DV2Q 3TEHB 1NMFA 2F4VQ 1EIFA 1OXVA 4JV5L 1RL2A 2RHQB 1YBYA 1Q8KA 3MEFA 2NZHA 1KIXA 1IZ6A 3CMEA 4A3JG 4YWMA 3AQQA 1IBML 3CCSA 3E0EA 4A3KH 3H3VI 3EN2A 2WAQE 2EQSA 3JAMc 1MJEA 3G6EA 1KC8C 4LF7L 1XPUA 2D62A 2VQFL 1JMCA 4LF6L 1VQOA 4O2DA 4JI4Q 1Q7YC 3FKIH 1Y1VG 5M3MG 4IPCA 1U0LA 4DNIA 1CUKA 1K83H 3PSIA 4IFDJ 1HNWQ 4AH6A 2K5NA 1T9HA 1P16A 4GN5A 3KJPA 4PMWA 1CKNA 1OXSC 4OONA 4UPAA 5FLXc 2BH2A 2VUMG 4DV7Q 1ASYA 3RR5A 2Q2UA 3CCVA 2UUBL 3GTGH 5M5YH 4QGUA 4JYAL 5LMNQ 4DV1L 1VQHA 3STBD 2K4KA 3AFQA 2YTXA 4UP9A 4NXNQ 1QUQB 2I5MX 4JI6Q 1PYBA 4A3LG 2UXDQ 3W1GA 4IJHA 4GN3B 1A8VA 4LFAQ 4J15A 4AYBE 5H1SE 1PH2A 4LF4Q 1E22A 2ZJPA 3T1YQ 3M4OH 4BBSH 4DR4L 4DKAC 4JI8L 3S17H 1L2FA 4JOIA 2UUCL 1XNQL 1S72A 4BA2I 1G51A 2PQAB 1X55A 4JOIC 2HT1A 1JJCB 2GVBA 3F8TA 1IYJB 4LF8Q 3JC66 2OCEA 4DV5Q 1VQ8A 1VS0A 2Q2HA 4DR1L 3PGZA 4DR3L 5IYBG 4L5SA 1MKHA 1BVSA 2GVAA 3H0GH 2ALYB 3F2BA 4A93H 4LUVA 4HIDA 3VDYA 1VQAA 4DV0L 4IFDI 1VQCA 2KHJA 1X9NA 5IYDG 1YHQA 3K80C 1QVCA 3E9HA 4A3FG 3KYHC 4A3DH 4A3CH 4JI3Q 1NBWA 2PQAA 2VZAA 3ULPA 3ULLA 4OO1I 4B3SQ 3GD7A 4DV2L 2F4VL 4OX9Q 2CWAA 2IHFA 3GTOH 1WYDA 4YWKA 4JBKA 4IOAA 1UE1A 3PIPA 1VQPA 5IP7G 1JJ2A 2HIVA 1J6QA 1YIJA 1FVIA 2RF4A 4LUZA 5C4XH 4JI4L 2MQHA 1X6OA 3KOJA 3IRBA 2PI2E 4BY7H 2CWPA 5M3FH 1HNWL 4BXXG 1PH3A 3HOUG 2B3GA 2R7DA 5EAYA 4AYBG 2VY3A 4DV7L 5C44H 2VS1A 4XTCS 4HIMA 5LMNL 2YTYA 5HGQA 1V1QA 3W1BA 1TWCH 4P75A 4NXNL 4YY3Q 3PO3H 4A4IA 4DK6C 3TS0A 4JI6L 2EXDA 4JI1L 4P72A 3S14H 2UXDL 1JE5A 3UDFA 1UE6A 5IP9G 3OW2A 3FP9A 4A3MG 1Y1WH 4LF4L 3B6YA 2E5LQ 4LFAL 3T1YL 3GTQH 4R4QA 1BBWA 1X3FA 1YHBA 2R7ZH 4LF5Q 1PYSB 4A3BG 5FLMH 2WB1G 1Y14B 3HKZE 2CCZA 1PHJA 2F52A 3UDGA 5JJKA 4P71A 1E1OA 2KHIA 2NVXH 3KF8B 5K36G 4B3MQ 4JCVE 2OWOA 4JI0Q 5C4JH 3CCJA 2JA7G 5FJ8G 3S1NH 4IJLA 4UP8A 4LF8L 1XNRQ 3GO5A 4BBRH 1I94Q 3L2PA 3RLOA 4DV5L 3U4ZA 3HFZB 4JI7L 3OYYA 4JI2Q 3SGIA 5M5WH 4DR2Q 1Q82C 1I5FA 1UWVA 1PH4A 4BY1G 1E3PA 5IWAQ 1VQEA 3GDEA 1VQDA 4R4IA 1WCMH 2AHOB 3PUWA 2K5VA 4C3JH 1AE2A 3S1RH 4OO1G 2QA4A 4B3SL 1I3QH 5GAHC 1ASZA 1X65A 2YTVA 4OX9L 1KXLA 1O7IA 1MJCA 2IX1A 3HOYG 1UE5A 2ZTDA 1GO3E 5GAGC 3J7ZC 2QEXA 2IHEA 3CPFA 4QL5A 3S1QH 1W2BA 3CC2A 1N32Q 3UE1A 3PO2G 3W5OA 5IYCG 2A1AA 2VW9A 4TQUS 2D0OA 4B3TQ 3J80i 4DAMA 3HOXH 4A3JH 3CW2C 1XTDA 4Y52H 3PCOB 4BA1I 4O0AA 4MZ9A 4X66Q 4HJ5A 2AMCB 2MO1A 1VQMA 1AE3A 3J81c 1N33Q 1VCIA 4DV6Q 2KCTA 2JA8G 1HZCA 1SROA 1BBUA 1HZBA 4EQ5A 3RZOH 5ELOA 1OXXK 2ZTCA 3S15H 3BZKA 2VUMH 3L0OA 1U5KA 4A3IH 3M3YH 2V1CC 2Y0SG 4HIOA 4WJ4A 3HOZG 4LFCQ 2WP8J 4DPGA 1YJ9A 3I4MG 1KAWA 1YEZA 2Q2IA 3DM3A 4GNXB 2E5LL 1VQ6A 4LF5L 2R93G 2JA9A 2K52A 2BA0A 2E2IH 1K3RA 4OXPA 4PZ7A 1GKHA 1M1KC 4B3ML 1PH8A 4JI0L 3CXCA 3UDXA 4POFA 3CCEA 4A75A 5GQOA 1I94L 1LYLA 2C35B 3M85A 4A3KG 1SRUA 1JJGA 3ER0A 3MXNB 2XGTA 3HKSA 4JI2L 2R7FA 3M4QA 4DR2L 4GNXA 3CMAA 2IT1A 4GNXC 1WI5A 3FKIG 5IWAL 2JEBI 2B63H 4DUZQ 1B70B 1EWIA 1QUQA 1HNZQ 2PNHA 1FL0A 4GS3A 1FJGL 1LM0A 3G4SA 3M4PA 2R6GA 3G71A 1Q12A 2ZM6L 1X54A 2Z6KA 4XIGS 3KLWA 1WJJA 2E8GA 2Z6KC 3I4NG 2WAQG 2JA6H 1QZHA 4B3TL 1K9MC 1HR0Q 3K7UC 4BBSG 3H3VH 1EYGA 1D7QA 4KLKA 4FDBA
chains in the Genus database with same CATH superfamily
1NMGA 3CC7A 4B9XA 1QOHA 3NENA 3URYA 4Q5VA 4R4CA 4NMZA 1B7YB 1EY7A 2OTJA 3JAMi 5JJLA 2KA7A 4ZCKA 2PI2A 1Q86C 4YCVA 2K5WA 3H0GG 4A93G 1BCPB 4N8FA 4KV6A 4LFCL 1AZQA 4DXGA 3HOZB 1Z9FA 3KBXA 1AW7A 3FPUB 1CI3M 2JXMB 2J0TD 1NY4A 1PV4A 3F2DA 3CPWA 1TIID 2HIXA 1FD7D 5FJ8H 3KLRA 2F4IA 1S5BD 1H9KA 2IW3A 4BY7G 4NB3A 4IFDH 1GUOA 2FFKB 1EY9A 3OW7A 5G3LD 3HOVH 2K33A 1KNAA 4K2LA 3D3RA 3ERQA 1QNUA 4A3EH 1U4RA 1J5EQ 1NJIC 3A5ZB 3DEPA 1CZGA 5CV5A 2F0UA 1HXYD 4LAAA 5IY0A 4MTNA 3M4OB 4IZ8A 5AFWA 5CR3A 3UI2A 1LTLA 2NN6I 2YU9H 4R4OA 4YCWA 3GTLH 4UP7A 4HJ7A 4IQZA 2JE6I 4DV4L 1G291 1TXYA 2ZTEA 5E4WC 1KLUD 1WFQA 1EQTA 1WCMG 1VF7A 1Y1VH 1CKOA 3DHQA 2BA1A 1B8AA 3N6RA 4YY3L 5C0XI 4H02A 3PIP3 3E9IA 3JAME 5J3BA 2HHHQ 2FMCA 3BZDB 2AUJD 1WTQA 4KHPL 1AH9A 4JBWA 3ONAB 1OTCA 3KJOA 1JB7A 5C4XB 1S3OA 2CVRA 5D3IB 2UU9L 3QB3A 4KY7A 1XPRA 3D4DA 3EA6A 2PNRC 5ELFA 1VF5C 2B2VA 1BQQT 1CSPA 4HMIA 4HJ9A 2F0QA 2NVQH 2ZXOA 2F0SA 2OT2A 2F0KA 1K3BC 1QILA 5IYBH 4A3IG 1XMOL 2ZJRA 1JT8A 1TWCB 1I4QA 1EZ6A 3NTHA 5ELDA 2A73B 4A3FH 3GTQB 1Y1WB 3DWPA 2OQKA 4JI1Q 2UXCL 2HCCA 2JK8A 3FPPA 3S2DH 1N36L 2KCMA 5CYUA 1EYAA 1ZYRD 3CRKC 3MFGA 3S1NB 2E75C 3K58A 2VNUD 2PZUA 4ME5A 1EY5A 3MWYW 2JQOA 1F2ZA 2J7ZA 1U4LA 4BS9A 3HEJA 2WB1E 4GKKQ 4QUFA 3NQTA 2B63G 3K0YA 2A19A 4FF2A 4MNOA 4F8MA 1PDQA 4C3JB 1HTPA 4LFBL 1CM9A 4RA8A 1SFOH 1O7ZA 1SNCA 3GP7A 3HRZC 2K1BA 3QG1A 4QIWB 4XYOA 3S1QB 2ZT9C 2PQEA 3VA7A 1Q3LA 3NSWA 4UAIA 2K50A 2LS01 4HMJA 4A3MH 2DY8A 2GA4B 3W2DA 4HJAA 5CORA 3OWFA 1YVCA 4HCSA 1HZ9A 2HQLA 3AFPA 1GVPA 3PUVA 1JOQA 3E6ZX 5C3EG 4X6AH 3RZOB 1FNVA 5KNDA 4LW1A 3PF4A 1DOMA 1TQOA 2DY7A 4L5TA 1XJVA 1HZAA 4LF6Q 4JC0A 2NVYH 1JWSD 1RD9D 4P2CB 4V190 4IPGA 2L0CA 1YJWA 5K5PA 3PF5A 4Q0FA 2UUBQ 2PPBC 1L1OB 2L11A 4P73A 3LGJA 2KQ3A 2JA5G 1B2TA 2Y0SE 4YHHL 3P7JA 5CGKA 2R7ZG 1S40A 2B2WA 3E3XA 4B3RL 2F0HA 4L63B 3ERSX 4GLVB 1LT5D 1GUTA 1PRTC 2UUCQ 4BBRG 1D1KA 5IGDA 4BWGB 4QQBX 1K0RA 3NELA 1L1OA 1SR3A 3NTIA 1P8LA 1SN8A 2KEDA 3SEBA 4DN4M 1QVFA 3HZXA 3I90A 2O4XA 4NXML 2FJ2A 4HSVA 3BU2A 4FNFA 1EOTA 2JA6B 4GN4B 3AMUA 1TS4A 2UUAL 3EIVA 3J81E 2IL8A 4H13C 2Q8RE 4DV2Q 2F4VQ 3C2PA 3CMEA 4A3JG 5KYIA 3H3VI 1W6JA 2EQSA 4LF7L 4OEMB 3G6EA 2TSSA 5IGCA 3EQLC 1BF4A 3V96A 1Q7YC 1HUMA 3FKIH 5KRUA 4IPCA 3EFXD 2QF7A 4IFDJ 1HNWQ 3NQIA 2K5NA 4GN5A 2G9DA 1CKNA 2VUMG 2Q2UA 3GTGH 1TWAB 5M5YH 1SNPA 4KJNA 4JYAL 1VQHA 3MAQA 1PTOC 2Z8LA 3STBD 2YTXA 3VYSA 2I5MX 4A3GB 2A68D 1IHZA 1PH2A 1E22A 3S17H 2A5HA 4S3SA 5EPJA 5BN4A 4JOIA 1XNQL 1S72A 3E0JA 2HT1A 2AQ3B 1JJCB 2NZ1D 3F8TA 1QJOA 4LF8Q 3LWUA 4RH6A 2QDLA 3K5NA 5A2QE 1VS0A 4NDXA 4DR1L 4L5SA 1L0YB 3H0GH 4A93H 2F0NA 3EVQA 4DV0L 1VQCA 3GTPB 1B50A 5JPMC 1G6ZA 4YIJA 1SNQA 4B3SQ 2CWAA 2IHFA 1IW7D 1CHPD 4YWKA 4IOAA 2NBFA 3PIPA 5IP7G 2RF4A 1PTOH 4U673 3F2UA 4OIKA 1K0SA 1X6OA 3KOJA 4PMCA 4BY7H 4FVMA 4CBVA 2WINB 5EBDA 2FINB 3J81L 4RGMA 3I4MB 5E1FA 1STGA 2VS1A 4XTCS 4RWSC 2F3WA 2YTYA 1TVXA 5HGQA 4P75A 2A69D 4NXNL 1F9RA 4XYQA 4JI6L 1PTOF 2EXDA 4JI1L 3S14H 3UDFA 1UE6A 5J22A 4LF4L 1UAPA 3B6YA 2Z9HA 2WB1G 3FRPB 3UDGA 2K32A 5ELBA 2SOBA 2NVXH 1M8AA 5M9OA 4DA2A 5C4JH 3CCJA 5FJ8G 3AU7A 4UP8A 4FF4A 1I94Q 4DV5L 3RLOA 2MPMA 1PYWD 3SE0A 1EY8A 3CHBD 1H9RA 1Q8IA 1WCMH 2G9HD 3S1RH 1ZXTA 1ASZA 1D1IA 5EPKA 2L4NA 4OX9L 2IX1A 3HOYG 1UE5A 1GO3E 4QL5A 3V2TA 3FVQA 3S17B 2EJGC 1F9QA 1GHJA 4TQUS 2D0OA 4K8JA 3CW2C 3CU7A 4Y52H 4BA1I 1MD2D 4O0AA 4PV1C 4G57A 1AFPA 3BG3A 4A93B 1VCIA 3X3NA 2KCTA 4IUVA 2JA8G 3FMCA 1SROA 1EY0A 5ELOA 2LFNA 2ZTCA 4A3IH 3PIO3 2PZWA 2Y0SG 1TT2A 4WJ4A 2NUCA 4LFCQ 2WP8J 1A2UA 3EJIA 2Q2IA 4GNXB 3BDOA 1UUPA 1DCZA 1I6HB 2F0DA 1K3RA 4OXPA 2WKCA 4PZ7A 3BYTB 5KIXA 1WTVA 1TS5A 1ENAA 3UDXA 1LYLA 4A3KG 4M8AA 1JJGA 3C3LA 3ER0A 3MXNB 4N8X1 4C1NK 4GNXA 3CMAA 2IT1A 2NVTB 4BY1B 2B63H 1LT3D 2PNHA 3OOCA 2KEEA 5EPLA 2K01A 3G4SA 5CV4A 1BO0A 3D4RA 2Z6KA 2E8GA 4OGQC 2NVXB 2PZTA 5BN5A 3TZDA 2LMCB 5EKKA 1B4OA 4KLKA 4H7BA 2AQ2B 4RFBA 5BN3A 2K04A 4TRDA 1DZ1A 4DAVA 2N78A 2F0MA 5C4HA 5C3EH 1I50H 2QILA 3KLSX 4DV4Q 2EY2A 5G3LF 3RMHA 3F2CA 1QCBD 4PZ6A 3ICEA 3I8ZA 1TY2A 4A3DG 3DWQA 2YV5A 4RCNA 1GUNA 4OWWB 1TS3A 1WTPA 3NWSA 1SJED 5JEAJ 1O7LA 4OELB 1MGSA 3TP8A 3G48A 3OMGA 1ZYRC 1R4PB 2NYZD 4LWCA 4PNYA 2JA5H 1Q1EA 2K05A 3ULJA 4KHPQ 2OEOA 3KFUA 1TU2B 5IT9c 3K0XA 2H4OA 1CSQA 2AKWB 3C1FA 2UU9Q 1HR0W 1JOKA 5CBAE 3CAMA 3U4VA 5M5XH 1O78A 4JBJA 5M3FG 2K5QA 3G6JB 4ID6A 4DUZL 4A3IB 1HNZL 2DJFC 1K83B 3F1ZA 4APVA 3RUZA 1XXGA 1SMXA 2BDNA 4CDDC 5C44G 2Z0SA 3J7A5 5CC4A 4IO9A 1XMOQ 1RHPA 3PV0A 2M9VA 4J1MA 2UXCQ 4UY8C 4JI7L 3LNNA 1N36Q 1PH1A 5LL6X 1IKLA 2A8VA 2ENBA 3ZJYC 1IBKL 1IBLL 2FXQA 2B63B 4O42A 3OIQA 1UE7A 2CKZB 5JVG3 4CDFC 1ICWA 2MJ8A 3SK4A 4OWTB 4B08A 1VQGA 1SSOA 1IXRA 2V4DA 1E1TA 4LFBQ 1ZKOA 2K5HA 2SNSA 2R93H 3K5OA 1X56A 2B2TA 4DUYL 2HUGA 5JOBA 3MXUA 2Z4IA 1DM0B 2FMMA 4JI5L 3M4YA 1DOLA 2EYFA 1VQ7A 1H9JA 5I6WA 5T1IA 3CCMA 2B2VC 1S4ZA 1STHA 3RLFA 1FNUA 3EROA 5IT9L 2DNCA 4X3SA 3SR1A 1SBBB 1KL9A 2IY5B 2X69A 4QCLA 4H44C 3RN5A 1NAPA 1MI2A 5JEAG 1B9NA 2XN9C 4J6HA 2JA5B 1VQIA 4X65L 1XX8A 4LF9L 3D0FA 2R7ZB 4AIMA 1KD1C 4ME3A 3I4OA 3P75A 5BR8L 1MSGA 2XSCA 3T16A 3MHBA 4M1UB 2E2HH 4RGOS 1ESFA 4DR5L 1WTHA 1C9OA 4YHHQ 2CFMA 1SNOA 3A74A 4K6LA 4BBRB 5IP7H 4B3RQ 3BJUA 2F0FA 4KI0A 4L8JA 1KQSA 2K14A 3RD4A 5HURA 4X64L 3KDFB 3T1HL 1LABA 3BDLA 5DM73 1I3QB 1N34L 1XMQL 2F0JA 4R4TA 5I6YA 3H09A 2EPBA 3QJYA 1VQNA 2UXBL 4FXDA 1A2TA 1N9WA 4NXMQ 3TQYA 3STBC 4PMBA 1KHIA 1ET6A 4POGA 1SYCA 2A68C 4EGVA 3PIOA 1RDPD 3GTKH 1N8RC 3HOXB 4A3JB 2UUAQ 3KDFA 1W6KA 3GTJH 4Y7NH 3K5LA 4K5VA 1O80A 3QOLA 3HOWH 3GV3A 1GM5A 2D5DA 4DXFA 2ID0A 2R92G 3D31A 4X62L 2N3SA 5C5MA 4EQPA 4LF7Q 1BOSA 2VUMB 1EIYB 3K7AH 4GKJL 1V43A 3TP6A 1A63A 1KRTA 1VQLA 1SLJA 1ICFB 4FP5D 2E2IB 3HOYH 3FDTA 4L5RC 2OTLA 1JB3A 2R3ZA 4JYAQ 1IW7C 1VQBA 1OO9B 1HH2P 1LTBD 2B2WC 4ZKCB 4WJWA 2ASBA 1LUZA 1XNQQ 3AB9A 1PA6A 1LV9A 2N8NA 5JJIA 2GN5A 5IGFA 2JA8H 1WD1A 1L1OC 3TREA 3DWAA 1D6EC 1E2VA 4CDCC 1NSNS 4DR1Q 3WOFA 2WKDA 1E24A 2A69C 4DV0Q 2LSSA 2MO0A 3SK8A 3H6MA 3A0JA 4ODGA 2JEAI 1BDOA 5AJ3L 3TEHB 1NMFA 1OXVA 1RL2A 3MEFA 1IZ6A 3SK6A 2RCFA 2Z6BA 1PMRA 3D6CA 4YWMA 2AQ1B 3E0EA 4A3KH 2WAQE 3JAMc 1A6XA 1KC8C 2D62A 2VQFL 3A8IE 1VQOA 2WIIB 2O2LD 5M3MG 1U0LA 5E4XA 3ITPA 1CUKA 1NR4A 3VYRA 4AH6A 1EU3A 4PMWA 2BH2A 4K5WA 1ASYA 3RR5A 3CCVA 4HTHA 4DV1L 2E76C 2WB1B 3OMCA 4NXNQ 1QUQB 2PW5A 2ICEC 4JI6Q 3W1GA 2VXWA 4IJHA 1SNMA 5H1SE 4LF4Q 1ML0D 2HDMA 2ZJPA 4DR4L 4BA2I 4JOIC 1BCPD 4KTAA 1T5XD 2B2UA 1H9MA 2JP1A 1IYJB 4QUCA 3HOVB 2B2YA 3JC66 4DV5Q 2Q2HA 4DR3L 3PGZA 1BVSA 2BE5D 2ALYB 4A3EB 4HIDA 3HOYB 1WTWA 5IYDG 4A3DH 1QVCA 3E9HA 3NPPA 1EZ8A 3OIPA 4EQOA 2VZAA 3ULPA 2RDHA 1HQRD 4OO1I 1XWEA 4IALA 4OX9Q 2NB0A 3GTOH 1G2SA 1XYIA 2YU9B 5D14A 3MA2B 1UE1A 1SYGA 2EY5A 3GTLB 2EYJA 1VQPA 2HIVA 1FVIA 4LUZA 2IX3A 2E2DC 2RQXA 1A3VA 3DUZA 1Y1VB 5M3FH 1TS2A 1VMCA 2KCCA 1QB5D 1SJHD 3HOUG 4AYBG 4DV7L 1E2ZA 5KNBA 3JAML 5C44H 4HIMA 4ZKBB 1F2MA 3R2TA 4A4IA 3M7GA 4P72A 1B9MA 3OW2A 4LFAL 2QKIC 3T1YL 5DNFA 1BBWA 1PYSB 2CCZA 3HKZE 5JJKA 1PXUA 1E1OA 2KHIA 1DOKA 3KF8B 4N9PA 2JA7G 5K36G 2WV6D 1A3UA 1S5CD 2DNEA 4IJLA 5CV6A 3L2PA 4LJZC 2NVQB 3HFZB 4I65A 1Q82C 5M5WH 1NR2A 3BVGA 1LLRD 1UWVA 1PH4A 1E3PA 1VQEA 1R4QB 2F0VA 4A3FB 2LKVA 1LTGD 2QA4A 3KF8A 1X65A 4RKBA 1MJCA 4C3HG 4LK1C 3S2DB 2QEXA 4GZYC 1I4PA 3CC2A 3PO2G 4K2KA 5IYCG 2PCFB 3J80i 3VR4A 4UHVA 4MZ9A 4X66Q 1Q90A 2MO1A 1N33Q 1Y8PB 3J81c 1HZCA 3VR3A 1SFOB 3S15H 2F0TA 4QF4A 3H3VC 1U5KA 2V1CC 4HIOA 2MHVA 3GTOB 3HOZG 4DPGA 1YJ9A 3HG9A 5JEAH 4A3MB 3T13A 4LF5L 2R93G 4KKSA 2K52A 5D65A 1GKHA 4HN7A 2M2LA 1PH8A 2RKSA 2C9OA 3CXCA 2K7VA 3CCEA 4KJOA 2D9UA 4JI2L 2R7FA 3M4QA 2OXPA 4DR2L 4HCEA 1PRTF 5C44B 4GNXC 1D5MC 1WI5A 2NVYB 1GUGA 4DUZQ 1B70B 1HNZQ 4RCOA 3IL8A 1KDAA 2PYKA 2R6GA 3G71A 5CV7A 4U68A 4XIGS 2Z6KC 3FEWX 2WAQG 2CW0D 1QZHA 4B3TL 1JCKB 4CHTB 1JR0D 3H3VH 3HP3A 2RVLA 4C2MH 1WD0A 4KD3A 2QCPX 4KHZA 3TP7A 4OWXB 5J39A 2F0IA 1Z47A 4DNRB 4JI7Q 2R61A 1HJPA 1I4XA 4RG1A 3WWVA 4ZYSA 1HFNA 1AN8A 1IBKQ 1IBLQ 2R92H 1DGSA 2L1BA 4BXXH 2IWHA 1L0WA 2I5HA 2AUKA 3UE0A 3J80E 4A3CG 3DLLA 1Z7TA 2D0PA 2H1EA 1WTRA 3OSOA 3L3OC 3Q22A 1V9PA 4A3BH 2RHSB 1X3GA 4DUYQ 1RIPA 1GD7A 1EU4A 5KGUA 1IYVA 1R9TH 5C4XG 4RMFA 3D8GA 2H5XA 3HOWG 4JI5Q 4R1JA 3DEOA 1QG7A 3U50C 3FKIB 2XRSD 4TVAB 4ALPA 4HIKA 3A5UA 3CF5A 5C6AA 2EJMA 1V8QA 2NTTA 3V05A 2I46A 1RTOA 4HSPA 1QZGA 3GTGB 1TWFH 3H94A 5C0XJ 3S2HH 5M5YB 3K6OA 3O13A 4KN4C 5IOCA 2RSOA 1C0AA 4KKTA 1Y1WG 1HR0L 1B53A 4YCUA 2MNAA 2NZOA 1U9RA 4X65Q 1CKMA 3PUXA 3NUCA 4LF9Q 1ET9A 4WFN3 3TN2A 5BR8Q 4GOPB 1TWHH 2IX0A 2F0EA 2RA4A 4EX5A 3E5SA 5A2QL 2VQEL 1ENCA 4L6TB 4DR5Q 1LT6D 2BCOA 1BBXC 2XWJB 2XNAC 5ELEA 1HNXL 1G2TA 2F0LA 3H0GB 1TWGH 1XPOA 3I3CA 4DU9A 5M3MH 4NPSA 4X64Q 4C3JG 1EUJA 4CJ0B 1NE3A 4GOPA 3T1HQ 5LMUL 3HKZG 4IUTA 5EKIA 1N34Q 1RF2D 4A76A 1XMQQ 1M90C 4K6DA 2RCNA 3I91A 1K8AC 2EIFA 2UXBQ 2ZXRA 4C2MB 5DLQE 2XTIA 4H0LC 2B2TC 3A54A 1SNDA 1TY0A 2DN8A 1SXTA 1PTOB 3P1HA 5GADC 4L5QA 2E2JH 5FLXE 1BNZA 2I5LX 4BY7B 1DYQA 3TZUA 3NEMA 4NKLA 1A62A 1S5FD 3K59A 3I56A 4X62Q 1JWUD 1K28A 1XTCD 2JN4A 4ZLTF 1EEFD 1II3A 1SDFA 3S14B 5IYDH 4GKJQ 1SE2A 2PW7A 1L0XB 2B8FA 3I4NH 3GTMH 2NN6G 1R9TB 3MXNA 4OIJA 3CQZH 3M9BA 3OHXC 1WVLA 1V1PB 4IOCA 4QB4A 5C4JB 1DD2A 1Y8OB 3GV6A 2AWOA 4C1NI 3MZ5A 3HGBA 1A0IA 3FHWA 2A6HD 1IL8A 4X66L 5ELCA 1FGUA 1N33L 4PG3A 1GHKA 2KUMA 2F3VA 2XVSA 1TWFB 3K8AA 1EQRA 1WCMB 3S1RB 5C0XG 4IPDA 3SVMA 1V1PA 1YNXA 2YYZA 3HOUH 3A8KE 3DM1A 1UEAB 4MN3A 4DR6L 1GXDC 2F0WA 1YI2A 3BVMA 2JA6G 3NBHB 1TWHB 2O5JC 1SE4A 4EQNA 1PFNA 4FXKC 3S1MH 1PZKD 2L55A 1HHVA 2KECA 3S9WA 2C5CA 1OXTA 5AJ3Q 3AEVA 2KBNA 3VR5A 5JVH3 3RN2A 2JA7H 5K36H 1BCPC 5L37A 1VQ9A 2F0PA 1GJXA 1D8LA 4DV3L 2NWGA 1SYFA 1BKBA 1ZEQX 1EYDA 3KF6B 3TS2A 2N55A 3NBHA 4RAUC 3EBEA 2VQFQ 2BE5C 1VQFA 3RZDH 1FYCA 1PH6A 4JBMA 2PMZE 3TRZA 4RGNA 4XT3B 4IUNA 1EIGA 2EYMA 4QJFA 1RJTA 1YZ6A 1VQ4A 1Q1BA 5EGTA 3OTOL 3S16H 4C3HH 2E2JB 4DV1Q 3KF6A 4K0KL 4AQYL 1YITA 3PO2H 4A3GG 2AWNA 5HGTA 5IYCH 1VQ5A 4CDEC 2J4XA 2MGSA 4LNQA 3CRLC 5FOBB 3S24A 1YNJC 4DR4Q 3SHLA 1YJNA 5DEHA 1PH7A 2VB3X 2XRQD 1PFSA 3K5MA 2A6ED 3L7ZC 3J81j 2FHTA 3I7FA 3CD6A 4DR3Q 3GTMB 4ZQ3A 4IPHA 1STBA 1FJGQ 3HOZH 2LY7A 4KD4A 4CKEA 2ZM6Q 2D2CC 2XIWA 3QO2A 4WRDA 3NHHA 4WJ3M 1K73C 4KY6A 4EVOA 5EJWA 4JV5L 1YBYA 1Q8KA 2CHBD 1KIXA 2F1MA 3AQQA 4DFAA 5KEEA 5C3EB 1BCPF 1IBML 1I50B 1RTNA 3EN2A 1S5ED 1MJEA 1XPUA 5I9OA 3HOUB 1JMCA 1S5DD 2KHSA 3VR2A 1LT4D 4DNIA 4ZUJA 3PSIA 5I2XA 1T9HA 1P16A 3L9AX 4OONA 1OXSC 4UPAA 2Q8IB 4DV7Q 4JPBW 1CQVA 1KTKA 4QGUA 1C8CA 1AZPA 2K4KA 3AFQA 4UP9A 1PYBA 4A3LG 2JA7B 1MHWC 4GN3B 1A8VA 4LFAQ 4J15A 1BR9A 4AYBE 3T1YQ 3M4OH 5DAUA 4KHVA 1WTXA 4JI8L 3MEHA 1U4PA 3BVZA 2PQAB 4OHJA 1X55A 2OF1A 3NWTA 5M5XB 2EZVA 3VYUA 3VYTA 2B2UC 2RDGA 4NW2A 5JAVA 2OCEA 1VQ8A 4WORA 2B2YC 2P5ZX 4V0BA 1GUWA 1MKHA 1STAA 3VR6A 3F2BA 3S16B 3A8JE 3A56A 1VQAA 4C3HB 4IFDI 1X9NA 3NK9A 1YHQA 4XQJA 3KYHC 4A3CH 4JI3Q 2PQAA 3Q23A 3A7LA 5I4DA 1TKWB 2HD3A 2F03A 3A7AB 1PLFA 1J6QA 4K14A 1YIJA 5C4XH 1D5ZC 4JI4L 2MQHA 4JK1C 4C3IG 2PI2E 4BXXG 2SEBD 1PH3A 1T5EA 2R7DA 3MC0B 1SYDA 2VY3A 4ZRZA 5LMNL 2R93B 2WACA 3W1BA 1C48A 1TWCH 2EE1A 3Q0AA 3I73A 3A55A 2UXDL 1JE5A 5IP9G 3GTQH 3FP9A 2CW0C 2X6LA 3ND8A 1Y1WH 1X3FA 1RCVD 1YHBA 4A3BG 4LF5Q 5LHY1 1CHQD 1PHJA 2F52A 1CZWA 3D6WA 3HS0C 2SNMA 3MXGA 4JCVE 4O1NA 2K5DA 4IUUA 3S1NH 3QR8A 3ND9A 1G91A 1XNRQ 3U4ZA 4JI2Q 4PQXA 3SGIA 4DR2Q 5JJZA 1I5FA 5F2DA 5KYLA 3R93A 4CGYB 4BY1G 1VQDA 2KVMA 3PUWA 5FKAC 4RGTA 1QNKA 1EY6A 1AE2A 4C3JH 1HQMC 2XWBB 3C1EA 1LTID 2YTVA 1KXLA 2WAQB 1O7IA 1H9SB 2ZTDA 5GAGC 3J7ZC 3CPFA 3S1QH 1N32Q 5EQ0A 2E2HB 3UE1A 5EKLA 3BYYB 4XQQA 5JPNC 2VW9A 4B3TQ 4DAMA 4DNTB 3DXJC 4DGZA 4DF7A 2IJ0A 4HJ5A 4KN7C 1ILPA 1H9SA 1SMYD 4DK0A 1A15A 1AE3A 1VQMA 2E74C 1EEID 2A74C 3RZOH 5CV9A 1OXXK 3BS1A 1Y69U 3BZKA 3U9SA 3L0OA 3M3YH 1KAWA 2E5LL 4CJ2C 5NUCA 3GTKB 2EY1A 3GTJB 4JW0A 4Y7NB 2NN6H 2NTSA 1Z6HA 1M1KC 4X3TA 2Z1CA 2EY6A 4B3ML 4JI0L 3HOWB 4POFA 4HR7B 4A75A 1JQYD 1JICA 3M85A 2C35B 1SRUA 1F77A 2XGTA 3HKSA 1EWCA 1I4RA 2ICIA 5IWAL 3K7AB 3P20A 1IYUA 1EWIA 1QUQA 3U9OA 4GS3A 5C0XH 5T1GA 1PZJD 1FJGL 3MVVA 3M4PA 1Q12A 5FO7B 4ZK9B 2ZM6L 5J1ZA 1GOZA 1X54A 1FR3A 4FO2A 4I7ZC 3KLWA 3I4NG 2Q8TA 2JA6H 2HQEA 1K9MC 2ZXPA 1HR0Q 4BBSG 3QOJA 2KJXA 4FDBA 1GUSA 5LMNW 2JYOA 1YHAA 4DV6L 3J81i 3RNUA 2K75A 2VQEQ 2JA8B 1YNJD 1FGBD 3R2IA 1QWYA 3W3AA 3Q6SA 1HNXQ 3HKZB 2CH4W 2Y0SB 4HEDA 1MSHA 4DR7Q 1K8OA 5LMUQ 1HCZA 3KLSA 4P74A 3J7YW 1TWAH 5IGEA 5C3WA 2HCIA 3PUZA 1ONLA 4OL7A 5E7NA 3R8BA 4A3GH 3G7LA 3CC4A 4A3KB 3CP0A 2A6HC 1ENFA 4QIWE 1AP0A 1G8ZD 3QIAA 3KK7A 1DJRD 3M3YB 1Q46A 1STEA 3I2ZA 4G7ZC 3Q8DA 1B3AA 3ZYYX 5KNCA 3CKIB 4OO1H 3WOEA 1W3SA 4JVZA 4DAYB 1NUCA 1HRJA 3X3MA 4JI3L 3PO3G 3TP5A 2LXKA 5FO8B 1JC7A 1WOCA 2L9HA 3SK5A 5HY6A 3GTPH 1KLGD 4PZ8A 4FF3A 4UDUC 4DK3C 5FLMG 2ES2A 2CQOA 2ATWA 4X3KA 1KNEA 4LUOA 3CCLA 4DAYA 2HDLA 3OPOA 1VQKA 1KRSA 1QVGA 2TMPA 3SXHA 1E7ZA 5D3DA 1M4VA 3WDNA 5DM63 1HA6A 1KABA 4GLXA 2BDOA 4A3DB 2O5IC 1YNND 2KOLA 1X3EA 2DGYA 1VQJA 4CJ1B 4GOPC 5TSSA 3I4MH 2Q2TA 3LWEA 3NP8A 5CMDA 1PH5A 4DR6Q 1F2LA 3I4LA 1HUNA 4Z9CB 1RODA 5GAEC 2CQAA 2KENA 4HJ8A 1I4GA 1CKNB 1PFBA 4A3LH 4ZAIA 3HOXG 1EOVA 1HFGA 5GROA 3CCQA 2L12A 2WFWA 1Q81C 1PVOA 1XNRL 4ILWA 4F87A 5M3FB 4I7AA 2A6EC 4YWLA 5EBCA 1X32A 1HPCA 5LL6S 4DV3Q 1SE8A 1H95A 2I0QA 3K81C 1TR5A 3R3OA 1J5EL 5IE8A 2MUYA 1EY4A 2VL6A 1EQQA 4MIUA 1C7YA 4XT1B 2EDGA 2VB2X 1F9PA 1N32L 3OTOQ 4IN3A 4JG2A 3RLNA 1NTGA 2JJQA 4J8QA 5C5LA 4K0KQ 4AQYQ 1G6PA 3NE5B 4GLAC 2DJGC 2F3IA 1CQFA 2N49A 5M5WB 3M7NA 4E6IA 3I55A 1UEBA 4C3IH 1SE3A 1STYA 2EXZA 1PH9A 2ZJQA 1ILQA 1SYBA 2MFIA 2F0OA 2HHHL 1JORA 4K5XA 5IP9H 3OWEB 1I6HH 1D2BA 3LX0A 5IGGA 3J80c 1IL2A 3IKJA 2B29A 3TDQA 1CTMA 3U58A 4FF1A 4JV5Q 1EFWA 1LTAD 2BH8A 3CCRA 3AYHB 1IBMQ 4KY5A 3S15B 1B3QA 2N88A 2NVTH 2LXJA 1SAPA 3PUYA 4FXGC 4BY1H 4XXEA 2PO4A 5I9PA 3PMFA 1PRTB 1UNSA 5ISRA 2OQ0A 4ZUIA 2G5DA 1LTTD 4QY7A 3J7AV 1BUVT 1QE6A 4NP5A 3J7AF 1OXUA 4RHRA 1K8GA 2M00A 2L15A 4R8IA 2QDBA 4JI8Q 4GKKL 2BOSA 5FK9C 4IFDG 3D4WA 3HOVG 3TMEA 2DUDA 5ELNA 4A3EG 2QGQA 1MIUA 4DR7L 4CKCA 1NNXA 2EVBA 5CV8A 4G7HC 1PZID 5FO9B 3UDIA 3H15A 3BZCA 1PFMA 3IAYA 3CCUA 5CBEE 1EIFA 1E2WA 2RHQB 4IUQA 4CKBA 2NZHA 1CA6A 1JE4A 4C3IB 3CCSA 4MTKA 2R92B 3NBIA 2EJFC 3J80L 1VMPA 4LF6L 1NCVA 4O2DA 1MBYA 3NXWA 4JI4Q 4B9WA 1Y1VG 4DAPA 1SYEA 1K83H 4G4KA 3KJPA 1F9SA 4XQNA 5FLXc 2UUBL 1LACA 5LMNQ 4A3BB 3MXPA 1EFID 4KKUA 1EWHA 1CFMA 4N9TA 1ESRA 2UXDQ 4HAEA 1DONA 2QEJC 4BBSH 3C46A 2B8GA 4DKAC 2RBMA 1L2FA 2MP1A 2UUCL 1G51A 2K6AA 3VA5A 1JWMD 4TKOB 1SMYC 3KUPA 2GVBA 1K8MA 5IIFA 1E0BA 3T56B 1X3QA 1LTSD 1B44D 1I4HA 5IYBG 3S2HB 2GVAA 1EQVA 4LUVA 3T53B 3VDYA 2KHJA 3K80C 4A3FG 1AEXA 1DXMA 1NBWA 3ULLA 4K8IA 3GD7A 4XDXA 4DV2L 2F4VL 2EOTA 1WYDA 4JBKA 1O7YA 1C4QA 2PMZB 3Q24A 1JJ2A 2F0GA 5C3XA 1STNA 2X6GA 1EL0A 2EYHA 1PRTD 2RSNA 1TWGB 3IRBA 2CWPA 3I72A 3N52A 5M3MB 1HNWL 3T51B 1LTRD 1VDZA 1Y8NB 1HA5A 2B3GA 5EAYA 3H91A 1CT1D 1V1QA 1SEBD 1V1OA 2EYOA 4YY3Q 5IT9E 2SDFA 3PO3H 4DK6C 3TS0A 1CK1A 5C4ZA 3T4AC 4A3MG 4X3UA 2E5LQ 3MFYA 5FLXL 2Z4HA 4R4QA 2R7ZH 5FLMH 1Y14B 4P71A 5IODA 1J9OA 3PQIA 4B3MQ 2OWOA 4JI0Q 4LF8L 3DMUA 3GO5A 3IFDA 4BBRH 1IKMA 2KCNA 4IUPA 1BXTA 3OYYA 3KBGA 2EYPA 4KMUC 1F2YA 3GDEA 5IWAQ 4R4IA 2AHOB 1LO5D 2K5VA 3GQBA 4OO1G 4B3SL 1I3QH 4RKLA 5GAHC 3I4NB 1FNWA 3IFTA 3QWNA 2B39A 5A35A 2IHEA 1PTOD 4BBSB 1W2BA 4C56C 5IGBA 3CQZB 3W5OA 2A1AA 4QMGA 3MTSA 4ULLA 3HOXH 4A3JH 1XTDA 3PCOB 3SDZA 4R9WA 4KK7A 3NTKA 4G7OC 1WTOA 2K28A 2AMCB 2CH4A 4DV6Q 1BBUA 1HZBA 4EQ5A 2EYLA 4AYBB 1I6VC 1J8IA 2VUMH 4RHSA 1KDBA 5E3FA 3I4MG 1YEZA 2I07B 3DM3A 1RKNA 1VQ6A 5COYA 1EIHA 2JA9A 3S1MB 2BA0A 2E2IH 2QW7A 4TSSA 1X3PA 5I2YA 2IPKD 1U4MA 1D5XC 3TBIB 2L5TA 1B1ZA 5GQOA 1I94L 4LMQD 1KDCA 4MHEA 3BDCA 1A3TA 1KAAA 2K03A 4DK1A 3FKIG 3RZDB 2JEBI 4R8NA 4F88A 1HTLD 2JSOA 3PO3B 1YNNC 4FYDA 1FL0A 3TSSA 1LM0A 2RDFA 1JOOA 1CA5A 1WJJA 4F7XA 3K57A 4ABNA 3PO2B 4IURA 3K7UC 3I70A 1EYGA 1D7QA 1EYCA
chains in the Genus database with same CATH topology
1NMGA 4KHZA 4OWXB 1Z47A 5LMNW 3CC7A 4JI7Q 1HJPA 3NENA 4RG1A 1YHAA 3WWVA 4DV6L 3J81i 4R4CA 2N78A 2K75A 1B7YB 5C3EH 2VQEQ 3RNUA 1IBKQ 2OTJA 1I50H 3JAMi 1IBLQ 5JJLA 2R92H 1DGSA 4BXXH 2PI2A 1Q86C 4YCVA 4DV4Q 1L0WA 2I5HA 3H0GG 1HNXQ 4A93G 3F2CA 4PZ6A 3UE0A 3ICEA 4LFCL 4A3DG 1Z9FA 4A3CG 3DLLA 2YV5A 4DR7Q 1NY4A 5LMUQ 1PV4A 2D0PA 4OWWB 4P74A 5JEAJ 1TWAH 3F2DA 1V9PA 4A3BH 2RHSB 3CPWA 3G48A 1X3GA 2HIXA 3PUZA 4LWCA 1RIPA 4DUYQ 5E7NA 2JA5H 1GD7A 1Q1EA 4A3GH 3ULJA 4KHPQ 3KFUA 3CC4A 1R9TH 5FJ8H 5C4XG 4RMFA 5IT9c 3CP0A 3K0XA 2H5XA 1CSQA 2AKWB 3HOWG 4QIWE 2UU9Q 1HR0W 4R1JA 4JI5Q 3CAMA 3U50C 3U4VA 5M5XH 4BY7G 4JBJA 4NB3A 5M3FG 4DUZL 4TVAB 1HNZL 3F1ZA 1Q46A 4APVA 3I2ZA 4ALPA 4LF6Q 4HIKA 3A5UA 3Q8DA 3CF5A 3HOVH 1SMXA 5C44G 2Z0SA 1QZGA 3S2HH 1TWFH 1W3SA 5C0XJ 3J7A5 4DAYB 4A3EH 4IO9A 4JI3L 1XMOQ 3PO3G 2LXKA 1WOCA 1NJIC 1J5EQ 5HY6A 3A5ZB 3GTPH 1C0AA 3PV0A 1Y1WG 1HR0L 4YCUA 2MNAA 2NZOA 4PZ8A 5IY0A 4DK3C 4MTNA 5FLMG 2ES2A 4X65Q 1CKMA 2CQOA 3PUXA 4LF9Q 2ATWA 2UXCQ 4UY8C 1LTLA 2NN6I 1N36Q 4R4OA 5BR8Q 4YCWA 4GOPB 1TWHH 1PH1A 2IX0A 2YU9H 4LUOA 2A8VA 3ZJYC 4EX5A 1IBKL 2VQEL 3CCLA 3GTLH 4DR5Q 4UP7A 4HJ7A 1IBLL 2FXQA 1VQKA 1KRSA 2JE6I 1QVGA 4DV4L 1G291 1UE7A 1TXYA 1HNXL 2CKZB 1E7ZA 1TWGH 2ZTEA 1XPOA 4GLXA 1WFQA 1WCMG 1Y1VH 5M3MH 4OWTB 4NPSA 4X64Q 1CKOA 1EUJA 2BA1A 1NE3A 1VQGA 1B8AA 1X3EA 2DGYA 5LMUL 3HKZG 4GOPA 3T1HQ 1VQJA 1IXRA 4GOPC 1E1TA 4YY3L 3I4MH 4LFBQ 5C0XI 4A76A 1N34Q 2K5HA 1XMQQ 4H02A 1M90C 2Q2TA 2RCNA 1K8AC 2EIFA 2R93H 1PH5A 4DR6Q 3E9IA 1X56A 2UXBQ 4DUYL 5DLQE 2XTIA 5J3BA 2HHHQ 5GAEC 2KENA 4KHPL 4HJ8A 1CKNB 4A3LH 1AH9A 4JBWA 3HOXG 1OTCA 1EOVA 3KJOA 1JB7A 5GROA 5GADC 1S3OA 4L5QA 4JI5L 2E2JH 2UU9L 3CCQA 1XPRA 2WFWA 1Q81C 1PVOA 1XNRL 2I5LX 1VQ7A 3CCMA 4YWLA 3NEMA 4DV3Q 1CSPA 1A62A 3RLFA 1SE8A 4HJ9A 2NVQH 1H95A 3I56A 2I0QA 3K81C 1KL9A 4X62Q 2IY5B 5IYBH 4A3IG 1XMOL 2ZJRA 1JT8A 1J5EL 5IE8A 3RN5A 5IYDH 2VL6A 1EQQA 4A3FH 4GKJQ 5JEAG 1C7YA 2OQKA 1VQIA 4X65L 4JI1Q 3GTMH 3I4NH 4LF9L 2UXCL 3D0FA 1N32L 2JK8A 2NN6G 4AIMA 4ME3A 4JG2A 3I4OA 3OTOQ 1KD1C 1N36L 3S2DH 5BR8L 2KCMA 3RLNA 1NTGA 2JJQA 3CQZH 3M9BA 2E2HH 4IOCA 4DR5L 4K0KQ 4AQYQ 1G6PA 1C9OA 4YHHQ 2VNUD 2AWOA 2CFMA 3A74A 5IP7H 4GLAC 1A0IA 2F3IA 3BJUA 2N49A 2JQOA 3FHWA 4X66L 4B3RQ 4KI0A 1FGUA 3M7NA 3I55A 1UEBA 4PG3A 1KQSA 1N33L 2WB1E 2K14A 4GKKQ 3K8AA 4C3IH 4X64L 2B63G 1EQRA 3KDFB 2A19A 4MNOA 3T1HL 5C0XG 4LFBL 4IPDA 1YNXA 2YYZA 1SFOH 1N34L 1XMQL 3HOUH 1PH9A 4R4TA 2ZJQA 4DR6L 1VQNA 2UXBL 1N9WA 4NXMQ 2MFIA 3TQYA 3STBC 2HHHL 1KHIA 1YI2A 2JA6G 3NBHB 4POGA 2K50A 5IP9H 1I6HH 4A3MH 3PIOA 3GTKH 1N8RC 2UUAQ 3KDFA 3GTJH 3S1MH 4Y7NH 4HJAA 3J80c 1IL2A 1YVCA 1HZ9A 3AFPA 2B29A 1OXTA 2HQLA 1GVPA 5AJ3Q 3AEVA 2KBNA 3U58A 4JV5Q 3PUVA 3RN2A 2JA7H 1EFWA 3HOWH 1VQ9A 2BH8A 5C3EG 3CCRA 1GM5A 2ID0A 1D8LA 4DV3L 3AYHB 4X6AH 1IBMQ 2R92G 1BKBA 3D31A 4X62L 2N3SA 3KF6B 4LW1A 3PF4A 3TS2A 4L5TA 4LF7Q 3EBEA 2NVTH 2VQFQ 1EIYB 1XJVA 1VQFA 1HZAA 2LXJA 3K7AH 4JC0A 3RZDH 3PUYA 1PH6A 4BY1H 2NVYH 4JBMA 4GKJL 2PMZE 3TRZA 1V43A 1A63A 4QJFA 1KRTA 1VQLA 1SLJA 1YZ6A 4IPGA 4C2MH 1VQ4A 1Q1BA 3PF5A 2OQ0A 1YJWA 3OTOL 3S16H 4C3HH 4L5RC 3HOYH 2UUBQ 2OTLA 1L1OB 4JYAQ 4DV1Q 4P73A 3KF6A 3LGJA 4QY7A 4AQYL 4K0KL 1YITA 2JA5G 1VQBA 3PO2H 2Y0SE 2AWNA 4YHHL 2R7ZG 4A3GG 5IYCH 1S40A 1VQ5A 1HH2P 1OXUA 4B3RL 1K8GA 4LNQA 3ERSX 4GLVB 2ASBA 2L15A 3S24A 4DR4Q 4JI8Q 1YJNA 4GKKL 1LUZA 1PH7A 2UUCQ 1XNQQ 1PFSA 1PA6A 4IFDG 4BBRG 2N8NA 3L7ZC 4QQBX 5JJIA 2GN5A 1K0RA 3NELA 1L1OA 1SR3A 2JA8H 3HOVG 3J81j 1L1OC 3TREA 1P8LA 1SN8A 1QVFA 3I7FA 2DUDA 4DR1Q 3CD6A 5ELNA 4DR3Q 2QGQA 4A3EG 4NXML 1E24A 1MIUA 4DR7L 4IPHA 1FJGQ 3HOZH 4DV0Q 3BU2A 2LSSA 2MO0A 2ZM6Q 4GN4B 3UDIA 2UUAL 3EIVA 3H15A 1K73C 4WJ3M 3A0JA 3BZCA 3CCUA 2JEAI 5AJ3L 4DV2Q 3TEHB 1NMFA 2F4VQ 1EIFA 1OXVA 4JV5L 1RL2A 2RHQB 1YBYA 1Q8KA 3MEFA 2NZHA 1KIXA 1IZ6A 3CMEA 4A3JG 4YWMA 3AQQA 1IBML 3CCSA 3E0EA 4A3KH 3H3VI 3EN2A 2WAQE 2EQSA 3JAMc 1MJEA 3G6EA 1KC8C 4LF7L 1XPUA 2D62A 2VQFL 1JMCA 4LF6L 1VQOA 4O2DA 4JI4Q 1Q7YC 3FKIH 1Y1VG 5M3MG 4IPCA 1U0LA 4DNIA 1CUKA 1K83H 3PSIA 4IFDJ 1HNWQ 4AH6A 2K5NA 1T9HA 1P16A 4GN5A 3KJPA 4PMWA 1CKNA 1OXSC 4OONA 4UPAA 5FLXc 2BH2A 2VUMG 4DV7Q 1ASYA 3RR5A 2Q2UA 3CCVA 2UUBL 3GTGH 5M5YH 4QGUA 4JYAL 5LMNQ 4DV1L 1VQHA 3STBD 2K4KA 3AFQA 2YTXA 4UP9A 4NXNQ 1QUQB 2I5MX 4JI6Q 1PYBA 4A3LG 2UXDQ 3W1GA 4IJHA 4GN3B 1A8VA 4LFAQ 4J15A 4AYBE 5H1SE 1PH2A 4LF4Q 1E22A 2ZJPA 3T1YQ 3M4OH 4BBSH 4DR4L 4DKAC 4JI8L 3S17H 1L2FA 4JOIA 2UUCL 1XNQL 1S72A 4BA2I 1G51A 2PQAB 1X55A 4JOIC 2HT1A 1JJCB 2GVBA 3F8TA 1IYJB 4LF8Q 3JC66 2OCEA 4DV5Q 1VQ8A 1VS0A 2Q2HA 4DR1L 3PGZA 4DR3L 5IYBG 4L5SA 1MKHA 1BVSA 2GVAA 3H0GH 2ALYB 3F2BA 4A93H 4LUVA 4HIDA 3VDYA 1VQAA 4DV0L 4IFDI 1VQCA 2KHJA 1X9NA 5IYDG 1YHQA 3K80C 1QVCA 3E9HA 4A3FG 3KYHC 4A3DH 4A3CH 4JI3Q 1NBWA 2PQAA 2VZAA 3ULPA 3ULLA 4OO1I 4B3SQ 3GD7A 4DV2L 2F4VL 4OX9Q 2CWAA 2IHFA 3GTOH 1WYDA 4YWKA 4JBKA 4IOAA 1UE1A 3PIPA 1VQPA 5IP7G 1JJ2A 2HIVA 1J6QA 1YIJA 1FVIA 2RF4A 4LUZA 5C4XH 4JI4L 2MQHA 1X6OA 3KOJA 3IRBA 2PI2E 4BY7H 2CWPA 5M3FH 1HNWL 4BXXG 1PH3A 3HOUG 2B3GA 2R7DA 5EAYA 4AYBG 2VY3A 4DV7L 5C44H 2VS1A 4XTCS 4HIMA 5LMNL 2YTYA 5HGQA 1V1QA 3W1BA 1TWCH 4P75A 4NXNL 4YY3Q 3PO3H 4A4IA 4DK6C 3TS0A 4JI6L 2EXDA 4JI1L 4P72A 3S14H 2UXDL 1JE5A 3UDFA 1UE6A 5IP9G 3OW2A 3FP9A 4A3MG 1Y1WH 4LF4L 3B6YA 2E5LQ 4LFAL 3T1YL 3GTQH 4R4QA 1BBWA 1X3FA 1YHBA 2R7ZH 4LF5Q 1PYSB 4A3BG 5FLMH 2WB1G 1Y14B 3HKZE 2CCZA 1PHJA 2F52A 3UDGA 5JJKA 4P71A 1E1OA 2KHIA 2NVXH 3KF8B 5K36G 4B3MQ 4JCVE 2OWOA 4JI0Q 5C4JH 3CCJA 2JA7G 5FJ8G 3S1NH 4IJLA 4UP8A 4LF8L 1XNRQ 3GO5A 4BBRH 1I94Q 3L2PA 3RLOA 4DV5L 3U4ZA 3HFZB 4JI7L 3OYYA 4JI2Q 3SGIA 5M5WH 4DR2Q 1Q82C 1I5FA 1UWVA 1PH4A 4BY1G 1E3PA 5IWAQ 1VQEA 3GDEA 1VQDA 4R4IA 1WCMH 2AHOB 3PUWA 2K5VA 4C3JH 1AE2A 3S1RH 4OO1G 2QA4A 4B3SL 1I3QH 5GAHC 1ASZA 1X65A 2YTVA 4OX9L 1KXLA 1O7IA 1MJCA 2IX1A 3HOYG 1UE5A 2ZTDA 1GO3E 5GAGC 3J7ZC 2QEXA 2IHEA 3CPFA 4QL5A 3S1QH 1W2BA 3CC2A 1N32Q 3UE1A 3PO2G 3W5OA 5IYCG 2A1AA 2VW9A 4TQUS 2D0OA 4B3TQ 3J80i 4DAMA 3HOXH 4A3JH 3CW2C 1XTDA 4Y52H 3PCOB 4BA1I 4O0AA 4MZ9A 4X66Q 4HJ5A 2AMCB 2MO1A 1VQMA 1AE3A 3J81c 1N33Q 1VCIA 4DV6Q 2KCTA 2JA8G 1HZCA 1SROA 1BBUA 1HZBA 4EQ5A 3RZOH 5ELOA 1OXXK 2ZTCA 3S15H 3BZKA 2VUMH 3L0OA 1U5KA 4A3IH 3M3YH 2V1CC 2Y0SG 4HIOA 4WJ4A 3HOZG 4LFCQ 2WP8J 4DPGA 1YJ9A 3I4MG 1KAWA 1YEZA 2Q2IA 3DM3A 4GNXB 2E5LL 1VQ6A 4LF5L 2R93G 2JA9A 2K52A 2BA0A 2E2IH 1K3RA 4OXPA 4PZ7A 1GKHA 1M1KC 4B3ML 1PH8A 4JI0L 3CXCA 3UDXA 4POFA 3CCEA 4A75A 5GQOA 1I94L 1LYLA 2C35B 3M85A 4A3KG 1SRUA 1JJGA 3ER0A 3MXNB 2XGTA 3HKSA 4JI2L 2R7FA 3M4QA 4DR2L 4GNXA 3CMAA 2IT1A 4GNXC 1WI5A 3FKIG 5IWAL 2JEBI 2B63H 4DUZQ 1B70B 1EWIA 1QUQA 1HNZQ 2PNHA 1FL0A 4GS3A 1FJGL 1LM0A 3G4SA 3M4PA 2R6GA 3G71A 1Q12A 2ZM6L 1X54A 2Z6KA 4XIGS 3KLWA 1WJJA 2E8GA 2Z6KC 3I4NG 2WAQG 2JA6H 1QZHA 4B3TL 1K9MC 1HR0Q 3K7UC 4BBSG 3H3VH 1EYGA 1D7QA 4KLKA 4FDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMG A;  4KHZ A;  4OWX B;  1Z47 A;  5LMN W;  3CC7 A;  4JI7 Q;  1HJP A;  3NEN A;  4RG1 A;  1YHA A;  3WWV A;  4DV6 L;  3J81 i;  4R4C A;  2N78 A;  2K75 A;  1B7Y B;  5C3E H;  2VQE Q;  3RNU A;  1IBK Q;  2OTJ A;  1I50 H;  3JAM i;  1IBL Q;  5JJL A;  2R92 H;  1DGS A;  4BXX H;  2PI2 A;  1Q86 C;  4YCV A;  4DV4 Q;  1L0W A;  2I5H A;  3H0G G;  1HNX Q;  4A93 G;  3F2C A;  4PZ6 A;  3UE0 A;  3ICE A;  4LFC L;  4A3D G;  1Z9F A;  4A3C G;  3DLL A;  2YV5 A;  4DR7 Q;  1NY4 A;  5LMU Q;  1PV4 A;  2D0P A;  4OWW B;  4P74 A;  5JEA J;  1TWA H;  3F2D A;  1V9P A;  4A3B H;  2RHS B;  3CPW A;  3G48 A;  1X3G A;  2HIX A;  3PUZ A;  4LWC A;  1RIP A;  4DUY Q;  5E7N A;  2JA5 H;  1GD7 A;  1Q1E A;  4A3G H;  3ULJ A;  4KHP Q;  3KFU A;  3CC4 A;  1R9T H;  5FJ8 H;  5C4X G;  4RMF A;  5IT9 c;  3CP0 A;  3K0X A;  2H5X A;  1CSQ A;  2AKW B;  3HOW G;  4QIW E;  2UU9 Q;  1HR0 W;  4R1J A;  4JI5 Q;  3CAM A;  3U50 C;  3U4V A;  5M5X H;  4BY7 G;  4JBJ A;  4NB3 A;  5M3F G;  4DUZ L;  4TVA B;  1HNZ L;  3F1Z A;  1Q46 A;  4APV A;  3I2Z A;  4ALP A;  4LF6 Q;  4HIK A;  3A5U A;  3Q8D A;  3CF5 A;  3HOV H;  1SMX A;  5C44 G;  2Z0S A;  1QZG A;  3S2H H;  1TWF H;  1W3S A;  5C0X J;  3J7A 5;  4DAY B;  4A3E H;  4IO9 A;  4JI3 L;  1XMO Q;  3PO3 G;  2LXK A;  1WOC A;  1NJI C;  1J5E Q;  5HY6 A;  3A5Z B;  3GTP H;  1C0A A;  3PV0 A;  1Y1W G;  1HR0 L;  4YCU A;  2MNA A;  2NZO A;  4PZ8 A;  5IY0 A;  4DK3 C;  4MTN A;  5FLM G;  2ES2 A;  4X65 Q;  1CKM A;  2CQO A;  3PUX A;  4LF9 Q;  2ATW A;  2UXC Q;  4UY8 C;  1LTL A;  2NN6 I;  1N36 Q;  4R4O A;  5BR8 Q;  4YCW A;  4GOP B;  1TWH H;  1PH1 A;  2IX0 A;  2YU9 H;  4LUO A;  2A8V A;  3ZJY C;  4EX5 A;  1IBK L;  2VQE L;  3CCL A;  3GTL H;  4DR5 Q;  4UP7 A;  4HJ7 A;  1IBL L;  2FXQ A;  1VQK A;  1KRS A;  2JE6 I;  1QVG A;  4DV4 L;  1G29 1;  1UE7 A;  1TXY A;  1HNX L;  2CKZ B;  1E7Z A;  1TWG H;  2ZTE A;  1XPO A;  4GLX A;  1WFQ A;  1WCM G;  1Y1V H;  5M3M H;  4OWT B;  4NPS A;  4X64 Q;  1CKO A;  1EUJ A;  2BA1 A;  1NE3 A;  1VQG A;  1B8A A;  1X3E A;  2DGY A;  5LMU L;  3HKZ G;  4GOP A;  3T1H Q;  1VQJ A;  1IXR A;  4GOP C;  1E1T A;  4YY3 L;  3I4M H;  4LFB Q;  5C0X I;  4A76 A;  1N34 Q;  2K5H A;  1XMQ Q;  4H02 A;  1M90 C;  2Q2T A;  2RCN A;  1K8A C;  2EIF A;  2R93 H;  1PH5 A;  4DR6 Q;  3E9I A;  1X56 A;  2UXB Q;  4DUY L;  5DLQ E;  2XTI A;  5J3B A;  2HHH Q;  5GAE C;  2KEN A;  4KHP L;  4HJ8 A;  1CKN B;  4A3L H;  1AH9 A;  4JBW A;  3HOX G;  1OTC A;  1EOV A;  3KJO A;  1JB7 A;  5GRO A;  5GAD C;  1S3O A;  4L5Q A;  4JI5 L;  2E2J H;  2UU9 L;  3CCQ A;  1XPR A;  2WFW A;  1Q81 C;  1PVO A;  1XNR L;  2I5L X;  1VQ7 A;  3CCM A;  4YWL A;  3NEM A;  4DV3 Q;  1CSP A;  1A62 A;  3RLF A;  1SE8 A;  4HJ9 A;  2NVQ H;  1H95 A;  3I56 A;  2I0Q A;  3K81 C;  1KL9 A;  4X62 Q;  2IY5 B;  5IYB H;  4A3I G;  1XMO L;  2ZJR A;  1JT8 A;  1J5E L;  5IE8 A;  3RN5 A;  5IYD H;  2VL6 A;  1EQQ A;  4A3F H;  4GKJ Q;  5JEA G;  1C7Y A;  2OQK A;  1VQI A;  4X65 L;  4JI1 Q;  3GTM H;  3I4N H;  4LF9 L;  2UXC L;  3D0F A;  1N32 L;  2JK8 A;  2NN6 G;  4AIM A;  4ME3 A;  4JG2 A;  3I4O A;  3OTO Q;  1KD1 C;  1N36 L;  3S2D H;  5BR8 L;  2KCM A;  3RLN A;  1NTG A;  2JJQ A;  3CQZ H;  3M9B A;  2E2H H;  4IOC A;  4DR5 L;  4K0K Q;  4AQY Q;  1G6P A;  1C9O A;  4YHH Q;  2VNU D;  2AWO A;  2CFM A;  3A74 A;  5IP7 H;  4GLA C;  1A0I A;  2F3I A;  3BJU A;  2N49 A;  2JQO A;  3FHW A;  4X66 L;  4B3R Q;  4KI0 A;  1FGU A;  3M7N A;  3I55 A;  1UEB A;  4PG3 A;  1KQS A;  1N33 L;  2WB1 E;  2K14 A;  4GKK Q;  3K8A A;  4C3I H;  4X64 L;  2B63 G;  1EQR A;  3KDF B;  2A19 A;  4MNO A;  3T1H L;  5C0X G;  4LFB L;  4IPD A;  1YNX A;  2YYZ A;  1SFO H;  1N34 L;  1XMQ L;  3HOU H;  1PH9 A;  4R4T A;  2ZJQ A;  4DR6 L;  1VQN A;  2UXB L;  1N9W A;  4NXM Q;  2MFI A;  3TQY A;  3STB C;  2HHH L;  1KHI A;  1YI2 A;  2JA6 G;  3NBH B;  4POG A;  2K50 A;  5IP9 H;  1I6H H;  4A3M H;  3PIO A;  3GTK H;  1N8R C;  2UUA Q;  3KDF A;  3GTJ H;  3S1M H;  4Y7N H;  4HJA A;  3J80 c;  1IL2 A;  1YVC A;  1HZ9 A;  3AFP A;  2B29 A;  1OXT A;  2HQL A;  1GVP A;  5AJ3 Q;  3AEV A;  2KBN A;  3U58 A;  4JV5 Q;  3PUV A;  3RN2 A;  2JA7 H;  1EFW A;  3HOW H;  1VQ9 A;  2BH8 A;  5C3E G;  3CCR A;  1GM5 A;  2ID0 A;  1D8L A;  4DV3 L;  3AYH B;  4X6A H;  1IBM Q;  2R92 G;  1BKB A;  3D31 A;  4X62 L;  2N3S A;  3KF6 B;  4LW1 A;  3PF4 A;  3TS2 A;  4L5T A;  4LF7 Q;  3EBE A;  2NVT H;  2VQF Q;  1EIY B;  1XJV A;  1VQF A;  1HZA A;  2LXJ A;  3K7A H;  4JC0 A;  3RZD H;  3PUY A;  1PH6 A;  4BY1 H;  2NVY H;  4JBM A;  4GKJ L;  2PMZ E;  3TRZ A;  1V43 A;  1A63 A;  4QJF A;  1KRT A;  1VQL A;  1SLJ A;  1YZ6 A;  4IPG A;  4C2M H;  1VQ4 A;  1Q1B A;  3PF5 A;  2OQ0 A;  1YJW A;  3OTO L;  3S16 H;  4C3H H;  4L5R C;  3HOY H;  2UUB Q;  2OTL A;  1L1O B;  4JYA Q;  4DV1 Q;  4P73 A;  3KF6 A;  3LGJ A;  4QY7 A;  4AQY L;  4K0K L;  1YIT A;  2JA5 G;  1VQB A;  3PO2 H;  2Y0S E;  2AWN A;  4YHH L;  2R7Z G;  4A3G G;  5IYC H;  1S40 A;  1VQ5 A;  1HH2 P;  1OXU A;  4B3R L;  1K8G A;  4LNQ A;  3ERS X;  4GLV B;  2ASB A;  2L15 A;  3S24 A;  4DR4 Q;  4JI8 Q;  1YJN A;  4GKK L;  1LUZ A;  1PH7 A;  2UUC Q;  1XNQ Q;  1PFS A;  1PA6 A;  4IFD G;  4BBR G;  2N8N A;  3L7Z C;  4QQB X;  5JJI A;  2GN5 A;  1K0R A;  3NEL A;  1L1O A;  1SR3 A;  2JA8 H;  3HOV G;  3J81 j;  1L1O C;  3TRE A;  1P8L A;  1SN8 A;  1QVF A;  3I7F A;  2DUD A;  4DR1 Q;  3CD6 A;  5ELN A;  4DR3 Q;  2QGQ A;  4A3E G;  4NXM L;  1E24 A;  1MIU A;  4DR7 L;  4IPH A;  1FJG Q;  3HOZ H;  4DV0 Q;  3BU2 A;  2LSS A;  2MO0 A;  2ZM6 Q;  4GN4 B;  3UDI A;  2UUA L;  3EIV A;  3H15 A;  1K73 C;  4WJ3 M;  3A0J A;  3BZC A;  3CCU A;  2JEA I;  5AJ3 L;  4DV2 Q;  3TEH B;  1NMF A;  2F4V Q;  1EIF A;  1OXV A;  4JV5 L;  1RL2 A;  2RHQ B;  1YBY A;  1Q8K A;  3MEF A;  2NZH A;  1KIX A;  1IZ6 A;  3CME A;  4A3J G;  4YWM A;  3AQQ A;  1IBM L;  3CCS A;  3E0E A;  4A3K H;  3H3V I;  3EN2 A;  2WAQ E;  2EQS A;  3JAM c;  1MJE A;  3G6E A;  1KC8 C;  4LF7 L;  1XPU A;  2D62 A;  2VQF L;  1JMC A;  4LF6 L;  1VQO A;  4O2D A;  4JI4 Q;  1Q7Y C;  3FKI H;  1Y1V G;  5M3M G;  4IPC A;  1U0L A;  4DNI A;  1CUK A;  1K83 H;  3PSI A;  4IFD J;  1HNW Q;  4AH6 A;  2K5N A;  1T9H A;  1P16 A;  4GN5 A;  3KJP A;  4PMW A;  1CKN A;  1OXS C;  4OON A;  4UPA A;  5FLX c;  2BH2 A;  2VUM G;  4DV7 Q;  1ASY A;  3RR5 A;  2Q2U A;  3CCV A;  2UUB L;  3GTG H;  5M5Y H;  4QGU A;  4JYA L;  5LMN Q;  4DV1 L;  1VQH A;  3STB D;  2K4K A;  3AFQ A;  2YTX A;  4UP9 A;  4NXN Q;  1QUQ B;  2I5M X;  4JI6 Q;  1PYB A;  4A3L G;  2UXD Q;  3W1G A;  4IJH A;  4GN3 B;  1A8V A;  4LFA Q;  4J15 A;  4AYB E;  5H1S E;  1PH2 A;  4LF4 Q;  1E22 A;  2ZJP A;  3T1Y Q;  3M4O H;  4BBS H;  4DR4 L;  4DKA C;  4JI8 L;  3S17 H;  1L2F A;  4JOI A;  2UUC L;  1XNQ L;  1S72 A;  4BA2 I;  1G51 A;  2PQA B;  1X55 A;  4JOI C;  2HT1 A;  1JJC B;  2GVB A;  3F8T A;  1IYJ B;  4LF8 Q;  3JC6 6;  2OCE A;  4DV5 Q;  1VQ8 A;  1VS0 A;  2Q2H A;  4DR1 L;  3PGZ A;  4DR3 L;  5IYB G;  4L5S A;  1MKH A;  1BVS A;  2GVA A;  3H0G H;  2ALY B;  3F2B A;  4A93 H;  4LUV A;  4HID A;  3VDY A;  1VQA A;  4DV0 L;  4IFD I;  1VQC A;  2KHJ A;  1X9N A;  5IYD G;  1YHQ A;  3K80 C;  1QVC A;  3E9H A;  4A3F G;  3KYH C;  4A3D H;  4A3C H;  4JI3 Q;  1NBW A;  2PQA A;  2VZA A;  3ULP A;  3ULL A;  4OO1 I;  4B3S Q;  3GD7 A;  4DV2 L;  2F4V L;  4OX9 Q;  2CWA A;  2IHF A;  3GTO H;  1WYD A;  4YWK A;  4JBK A;  4IOA A;  1UE1 A;  3PIP A;  1VQP A;  5IP7 G;  1JJ2 A;  2HIV A;  1J6Q A;  1YIJ A;  1FVI A;  2RF4 A;  4LUZ A;  5C4X H;  4JI4 L;  2MQH A;  1X6O A;  3KOJ A;  3IRB A;  2PI2 E;  4BY7 H;  2CWP A;  5M3F H;  1HNW L;  4BXX G;  1PH3 A;  3HOU G;  2B3G A;  2R7D A;  5EAY A;  4AYB G;  2VY3 A;  4DV7 L;  5C44 H;  2VS1 A;  4XTC S;  4HIM A;  5LMN L;  2YTY A;  5HGQ A;  1V1Q A;  3W1B A;  1TWC H;  4P75 A;  4NXN L;  4YY3 Q;  3PO3 H;  4A4I A;  4DK6 C;  3TS0 A;  4JI6 L;  2EXD A;  4JI1 L;  4P72 A;  3S14 H;  2UXD L;  1JE5 A;  3UDF A;  1UE6 A;  5IP9 G;  3OW2 A;  3FP9 A;  4A3M G;  1Y1W H;  4LF4 L;  3B6Y A;  2E5L Q;  4LFA L;  3T1Y L;  3GTQ H;  4R4Q A;  1BBW A;  1X3F A;  1YHB A;  2R7Z H;  4LF5 Q;  1PYS B;  4A3B G;  5FLM H;  2WB1 G;  1Y14 B;  3HKZ E;  2CCZ A;  1PHJ A;  2F52 A;  3UDG A;  5JJK A;  4P71 A;  1E1O A;  2KHI A;  2NVX H;  3KF8 B;  5K36 G;  4B3M Q;  4JCV E;  2OWO A;  4JI0 Q;  5C4J H;  3CCJ A;  2JA7 G;  5FJ8 G;  3S1N H;  4IJL A;  4UP8 A;  4LF8 L;  1XNR Q;  3GO5 A;  4BBR H;  1I94 Q;  3L2P A;  3RLO A;  4DV5 L;  3U4Z A;  3HFZ B;  4JI7 L;  3OYY A;  4JI2 Q;  3SGI A;  5M5W H;  4DR2 Q;  1Q82 C;  1I5F A;  1UWV A;  1PH4 A;  4BY1 G;  1E3P A;  5IWA Q;  1VQE A;  3GDE A;  1VQD A;  4R4I A;  1WCM H;  2AHO B;  3PUW A;  2K5V A;  4C3J H;  1AE2 A;  3S1R H;  4OO1 G;  2QA4 A;  4B3S L;  1I3Q H;  5GAH C;  1ASZ A;  1X65 A;  2YTV A;  4OX9 L;  1KXL A;  1O7I A;  1MJC A;  2IX1 A;  3HOY G;  1UE5 A;  2ZTD A;  1GO3 E;  5GAG C;  3J7Z C;  2QEX A;  2IHE A;  3CPF A;  4QL5 A;  3S1Q H;  1W2B A;  3CC2 A;  1N32 Q;  3UE1 A;  3PO2 G;  3W5O A;  5IYC G;  2A1A A;  2VW9 A;  4TQU S;  2D0O A;  4B3T Q;  3J80 i;  4DAM A;  3HOX H;  4A3J H;  3CW2 C;  1XTD A;  4Y52 H;  3PCO B;  4BA1 I;  4O0A A;  4MZ9 A;  4X66 Q;  4HJ5 A;  2AMC B;  2MO1 A;  1VQM A;  1AE3 A;  3J81 c;  1N33 Q;  1VCI A;  4DV6 Q;  2KCT A;  2JA8 G;  1HZC A;  1SRO A;  1BBU A;  1HZB A;  4EQ5 A;  3RZO H;  5ELO A;  1OXX K;  2ZTC A;  3S15 H;  3BZK A;  2VUM H;  3L0O A;  1U5K A;  4A3I H;  3M3Y H;  2V1C C;  2Y0S G;  4HIO A;  4WJ4 A;  3HOZ G;  4LFC Q;  2WP8 J;  4DPG A;  1YJ9 A;  3I4M G;  1KAW A;  1YEZ A;  2Q2I A;  3DM3 A;  4GNX B;  2E5L L;  1VQ6 A;  4LF5 L;  2R93 G;  2JA9 A;  2K52 A;  2BA0 A;  2E2I H;  1K3R A;  4OXP A;  4PZ7 A;  1GKH A;  1M1K C;  4B3M L;  1PH8 A;  4JI0 L;  3CXC A;  3UDX A;  4POF A;  3CCE A;  4A75 A;  5GQO A;  1I94 L;  1LYL A;  2C35 B;  3M85 A;  4A3K G;  1SRU A;  1JJG A;  3ER0 A;  3MXN B;  2XGT A;  3HKS A;  4JI2 L;  2R7F A;  3M4Q A;  4DR2 L;  4GNX A;  3CMA A;  2IT1 A;  4GNX C;  1WI5 A;  3FKI G;  5IWA L;  2JEB I;  2B63 H;  4DUZ Q;  1B70 B;  1EWI A;  1QUQ A;  1HNZ Q;  2PNH A;  1FL0 A;  4GS3 A;  1FJG L;  1LM0 A;  3G4S A;  3M4P A;  2R6G A;  3G71 A;  1Q12 A;  2ZM6 L;  1X54 A;  2Z6K A;  4XIG S;  3KLW A;  1WJJ A;  2E8G A;  2Z6K C;  3I4N G;  2WAQ G;  2JA6 H;  1QZH A;  4B3T L;  1K9M C;  1HR0 Q;  3K7U C;  4BBS G;  3H3V H;  1EYG A;  1D7Q A;  4KLK A;  4FDB A; 
#chains in the Genus database with same CATH topology
 1NMG A;  3CC7 A;  4B9X A;  1QOH A;  3NEN A;  3URY A;  4Q5V A;  4R4C A;  4NMZ A;  1B7Y B;  1EY7 A;  2OTJ A;  3JAM i;  5JJL A;  2KA7 A;  4ZCK A;  2PI2 A;  1Q86 C;  4YCV A;  2K5W A;  3H0G G;  4A93 G;  1BCP B;  4N8F A;  4KV6 A;  4LFC L;  1AZQ A;  4DXG A;  3HOZ B;  1Z9F A;  3KBX A;  1AW7 A;  3FPU B;  1CI3 M;  2JXM B;  2J0T D;  1NY4 A;  1PV4 A;  3F2D A;  3CPW A;  1TII D;  2HIX A;  1FD7 D;  5FJ8 H;  3KLR A;  2F4I A;  1S5B D;  1H9K A;  2IW3 A;  4BY7 G;  4NB3 A;  4IFD H;  1GUO A;  2FFK B;  1EY9 A;  3OW7 A;  5G3L D;  3HOV H;  2K33 A;  1KNA A;  4K2L A;  3D3R A;  3ERQ A;  1QNU A;  4A3E H;  1U4R A;  1J5E Q;  1NJI C;  3A5Z B;  3DEP A;  1CZG A;  5CV5 A;  2F0U A;  1HXY D;  4LAA A;  5IY0 A;  4MTN A;  3M4O B;  4IZ8 A;  5AFW A;  5CR3 A;  3UI2 A;  1LTL A;  2NN6 I;  2YU9 H;  4R4O A;  4YCW A;  3GTL H;  4UP7 A;  4HJ7 A;  4IQZ A;  2JE6 I;  4DV4 L;  1G29 1;  1TXY A;  2ZTE A;  5E4W C;  1KLU D;  1WFQ A;  1EQT A;  1WCM G;  1VF7 A;  1Y1V H;  1CKO A;  3DHQ A;  2BA1 A;  1B8A A;  3N6R A;  4YY3 L;  5C0X I;  4H02 A;  3PIP 3;  3E9I A;  3JAM E;  5J3B A;  2HHH Q;  2FMC A;  3BZD B;  2AUJ D;  1WTQ A;  4KHP L;  1AH9 A;  4JBW A;  3ONA B;  1OTC A;  3KJO A;  1JB7 A;  5C4X B;  1S3O A;  2CVR A;  5D3I B;  2UU9 L;  3QB3 A;  4KY7 A;  1XPR A;  3D4D A;  3EA6 A;  2PNR C;  5ELF A;  1VF5 C;  2B2V A;  1BQQ T;  1CSP A;  4HMI A;  4HJ9 A;  2F0Q A;  2NVQ H;  2ZXO A;  2F0S A;  2OT2 A;  2F0K A;  1K3B C;  1QIL A;  5IYB H;  4A3I G;  1XMO L;  2ZJR A;  1JT8 A;  1TWC B;  1I4Q A;  1EZ6 A;  3NTH A;  5ELD A;  2A73 B;  4A3F H;  3GTQ B;  1Y1W B;  3DWP A;  2OQK A;  4JI1 Q;  2UXC L;  2HCC A;  2JK8 A;  3FPP A;  3S2D H;  1N36 L;  2KCM A;  5CYU A;  1EYA A;  1ZYR D;  3CRK C;  3MFG A;  3S1N B;  2E75 C;  3K58 A;  2VNU D;  2PZU A;  4ME5 A;  1EY5 A;  3MWY W;  2JQO A;  1F2Z A;  2J7Z A;  1U4L A;  4BS9 A;  3HEJ A;  2WB1 E;  4GKK Q;  4QUF A;  3NQT A;  2B63 G;  3K0Y A;  2A19 A;  4FF2 A;  4MNO A;  4F8M A;  1PDQ A;  4C3J B;  1HTP A;  4LFB L;  1CM9 A;  4RA8 A;  1SFO H;  1O7Z A;  1SNC A;  3GP7 A;  3HRZ C;  2K1B A;  3QG1 A;  4QIW B;  4XYO A;  3S1Q B;  2ZT9 C;  2PQE A;  3VA7 A;  1Q3L A;  3NSW A;  4UAI A;  2K50 A;  2LS0 1;  4HMJ A;  4A3M H;  2DY8 A;  2GA4 B;  3W2D A;  4HJA A;  5COR A;  3OWF A;  1YVC A;  4HCS A;  1HZ9 A;  2HQL A;  3AFP A;  1GVP A;  3PUV A;  1JOQ A;  3E6Z X;  5C3E G;  4X6A H;  3RZO B;  1FNV A;  5KND A;  4LW1 A;  3PF4 A;  1DOM A;  1TQO A;  2DY7 A;  4L5T A;  1XJV A;  1HZA A;  4LF6 Q;  4JC0 A;  2NVY H;  1JWS D;  1RD9 D;  4P2C B;  4V19 0;  4IPG A;  2L0C A;  1YJW A;  5K5P A;  3PF5 A;  4Q0F A;  2UUB Q;  2PPB C;  1L1O B;  2L11 A;  4P73 A;  3LGJ A;  2KQ3 A;  2JA5 G;  1B2T A;  2Y0S E;  4YHH L;  3P7J A;  5CGK A;  2R7Z G;  1S40 A;  2B2W A;  3E3X A;  4B3R L;  2F0H A;  4L63 B;  3ERS X;  4GLV B;  1LT5 D;  1GUT A;  1PRT C;  2UUC Q;  4BBR G;  1D1K A;  5IGD A;  4BWG B;  4QQB X;  1K0R A;  3NEL A;  1L1O A;  1SR3 A;  3NTI A;  1P8L A;  1SN8 A;  2KED A;  3SEB A;  4DN4 M;  1QVF A;  3HZX A;  3I90 A;  2O4X A;  4NXM L;  2FJ2 A;  4HSV A;  3BU2 A;  4FNF A;  1EOT A;  2JA6 B;  4GN4 B;  3AMU A;  1TS4 A;  2UUA L;  3EIV A;  3J81 E;  2IL8 A;  4H13 C;  2Q8R E;  4DV2 Q;  2F4V Q;  3C2P A;  3CME A;  4A3J G;  5KYI A;  3H3V I;  1W6J A;  2EQS A;  4LF7 L;  4OEM B;  3G6E A;  2TSS A;  5IGC A;  3EQL C;  1BF4 A;  3V96 A;  1Q7Y C;  1HUM A;  3FKI H;  5KRU A;  4IPC A;  3EFX D;  2QF7 A;  4IFD J;  1HNW Q;  3NQI A;  2K5N A;  4GN5 A;  2G9D A;  1CKN A;  2VUM G;  2Q2U A;  3GTG H;  1TWA B;  5M5Y H;  1SNP A;  4KJN A;  4JYA L;  1VQH A;  3MAQ A;  1PTO C;  2Z8L A;  3STB D;  2YTX A;  3VYS A;  2I5M X;  4A3G B;  2A68 D;  1IHZ A;  1PH2 A;  1E22 A;  3S17 H;  2A5H A;  4S3S A;  5EPJ A;  5BN4 A;  4JOI A;  1XNQ L;  1S72 A;  3E0J A;  2HT1 A;  2AQ3 B;  1JJC B;  2NZ1 D;  3F8T A;  1QJO A;  4LF8 Q;  3LWU A;  4RH6 A;  2QDL A;  3K5N A;  5A2Q E;  1VS0 A;  4NDX A;  4DR1 L;  4L5S A;  1L0Y B;  3H0G H;  4A93 H;  2F0N A;  3EVQ A;  4DV0 L;  1VQC A;  3GTP B;  1B50 A;  5JPM C;  1G6Z A;  4YIJ A;  1SNQ A;  4B3S Q;  2CWA A;  2IHF A;  1IW7 D;  1CHP D;  4YWK A;  4IOA A;  2NBF A;  3PIP A;  5IP7 G;  2RF4 A;  1PTO H;  4U67 3;  3F2U A;  4OIK A;  1K0S A;  1X6O A;  3KOJ A;  4PMC A;  4BY7 H;  4FVM A;  4CBV A;  2WIN B;  5EBD A;  2FIN B;  3J81 L;  4RGM A;  3I4M B;  5E1F A;  1STG A;  2VS1 A;  4XTC S;  4RWS C;  2F3W A;  2YTY A;  1TVX A;  5HGQ A;  4P75 A;  2A69 D;  4NXN L;  1F9R A;  4XYQ A;  4JI6 L;  1PTO F;  2EXD A;  4JI1 L;  3S14 H;  3UDF A;  1UE6 A;  5J22 A;  4LF4 L;  1UAP A;  3B6Y A;  2Z9H A;  2WB1 G;  3FRP B;  3UDG A;  2K32 A;  5ELB A;  2SOB A;  2NVX H;  1M8A A;  5M9O A;  4DA2 A;  5C4J H;  3CCJ A;  5FJ8 G;  3AU7 A;  4UP8 A;  4FF4 A;  1I94 Q;  4DV5 L;  3RLO A;  2MPM A;  1PYW D;  3SE0 A;  1EY8 A;  3CHB D;  1H9R A;  1Q8I A;  1WCM H;  2G9H D;  3S1R H;  1ZXT A;  1ASZ A;  1D1I A;  5EPK A;  2L4N A;  4OX9 L;  2IX1 A;  3HOY G;  1UE5 A;  1GO3 E;  4QL5 A;  3V2T A;  3FVQ A;  3S17 B;  2EJG C;  1F9Q A;  1GHJ A;  4TQU S;  2D0O A;  4K8J A;  3CW2 C;  3CU7 A;  4Y52 H;  4BA1 I;  1MD2 D;  4O0A A;  4PV1 C;  4G57 A;  1AFP A;  3BG3 A;  4A93 B;  1VCI A;  3X3N A;  2KCT A;  4IUV A;  2JA8 G;  3FMC A;  1SRO A;  1EY0 A;  5ELO A;  2LFN A;  2ZTC A;  4A3I H;  3PIO 3;  2PZW A;  2Y0S G;  1TT2 A;  4WJ4 A;  2NUC A;  4LFC Q;  2WP8 J;  1A2U A;  3EJI A;  2Q2I A;  4GNX B;  3BDO A;  1UUP A;  1DCZ A;  1I6H B;  2F0D A;  1K3R A;  4OXP A;  2WKC A;  4PZ7 A;  3BYT B;  5KIX A;  1WTV A;  1TS5 A;  1ENA A;  3UDX A;  1LYL A;  4A3K G;  4M8A A;  1JJG A;  3C3L A;  3ER0 A;  3MXN B;  4N8X 1;  4C1N K;  4GNX A;  3CMA A;  2IT1 A;  2NVT B;  4BY1 B;  2B63 H;  1LT3 D;  2PNH A;  3OOC A;  2KEE A;  5EPL A;  2K01 A;  3G4S A;  5CV4 A;  1BO0 A;  3D4R A;  2Z6K A;  2E8G A;  4OGQ C;  2NVX B;  2PZT A;  5BN5 A;  3TZD A;  2LMC B;  5EKK A;  1B4O A;  4KLK A;  4H7B A;  2AQ2 B;  4RFB A;  5BN3 A;  2K04 A;  4TRD A;  1DZ1 A;  4DAV A;  2N78 A;  2F0M A;  5C4H A;  5C3E H;  1I50 H;  2QIL A;  3KLS X;  4DV4 Q;  2EY2 A;  5G3L F;  3RMH A;  3F2C A;  1QCB D;  4PZ6 A;  3ICE A;  3I8Z A;  1TY2 A;  4A3D G;  3DWQ A;  2YV5 A;  4RCN A;  1GUN A;  4OWW B;  1TS3 A;  1WTP A;  3NWS A;  1SJE D;  5JEA J;  1O7L A;  4OEL B;  1MGS A;  3TP8 A;  3G48 A;  3OMG A;  1ZYR C;  1R4P B;  2NYZ D;  4LWC A;  4PNY A;  2JA5 H;  1Q1E A;  2K05 A;  3ULJ A;  4KHP Q;  2OEO A;  3KFU A;  1TU2 B;  5IT9 c;  3K0X A;  2H4O A;  1CSQ A;  2AKW B;  3C1F A;  2UU9 Q;  1HR0 W;  1JOK A;  5CBA E;  3CAM A;  3U4V A;  5M5X H;  1O78 A;  4JBJ A;  5M3F G;  2K5Q A;  3G6J B;  4ID6 A;  4DUZ L;  4A3I B;  1HNZ L;  2DJF C;  1K83 B;  3F1Z A;  4APV A;  3RUZ A;  1XXG A;  1SMX A;  2BDN A;  4CDD C;  5C44 G;  2Z0S A;  3J7A 5;  5CC4 A;  4IO9 A;  1XMO Q;  1RHP A;  3PV0 A;  2M9V A;  4J1M A;  2UXC Q;  4UY8 C;  4JI7 L;  3LNN A;  1N36 Q;  1PH1 A;  5LL6 X;  1IKL A;  2A8V A;  2ENB A;  3ZJY C;  1IBK L;  1IBL L;  2FXQ A;  2B63 B;  4O42 A;  3OIQ A;  1UE7 A;  2CKZ B;  5JVG 3;  4CDF C;  1ICW A;  2MJ8 A;  3SK4 A;  4OWT B;  4B08 A;  1VQG A;  1SSO A;  1IXR A;  2V4D A;  1E1T A;  4LFB Q;  1ZKO A;  2K5H A;  2SNS A;  2R93 H;  3K5O A;  1X56 A;  2B2T A;  4DUY L;  2HUG A;  5JOB A;  3MXU A;  2Z4I A;  1DM0 B;  2FMM A;  4JI5 L;  3M4Y A;  1DOL A;  2EYF A;  1VQ7 A;  1H9J A;  5I6W A;  5T1I A;  3CCM A;  2B2V C;  1S4Z A;  1STH A;  3RLF A;  1FNU A;  3ERO A;  5IT9 L;  2DNC A;  4X3S A;  3SR1 A;  1SBB B;  1KL9 A;  2IY5 B;  2X69 A;  4QCL A;  4H44 C;  3RN5 A;  1NAP A;  1MI2 A;  5JEA G;  1B9N A;  2XN9 C;  4J6H A;  2JA5 B;  1VQI A;  4X65 L;  1XX8 A;  4LF9 L;  3D0F A;  2R7Z B;  4AIM A;  1KD1 C;  4ME3 A;  3I4O A;  3P75 A;  5BR8 L;  1MSG A;  2XSC A;  3T16 A;  3MHB A;  4M1U B;  2E2H H;  4RGO S;  1ESF A;  4DR5 L;  1WTH A;  1C9O A;  4YHH Q;  2CFM A;  1SNO A;  3A74 A;  4K6L A;  4BBR B;  5IP7 H;  4B3R Q;  3BJU A;  2F0F A;  4KI0 A;  4L8J A;  1KQS A;  2K14 A;  3RD4 A;  5HUR A;  4X64 L;  3KDF B;  3T1H L;  1LAB A;  3BDL A;  5DM7 3;  1I3Q B;  1N34 L;  1XMQ L;  2F0J A;  4R4T A;  5I6Y A;  3H09 A;  2EPB A;  3QJY A;  1VQN A;  2UXB L;  4FXD A;  1A2T A;  1N9W A;  4NXM Q;  3TQY A;  3STB C;  4PMB A;  1KHI A;  1ET6 A;  4POG A;  1SYC A;  2A68 C;  4EGV A;  3PIO A;  1RDP D;  3GTK H;  1N8R C;  3HOX B;  4A3J B;  2UUA Q;  3KDF A;  1W6K A;  3GTJ H;  4Y7N H;  3K5L A;  4K5V A;  1O80 A;  3QOL A;  3HOW H;  3GV3 A;  1GM5 A;  2D5D A;  4DXF A;  2ID0 A;  2R92 G;  3D31 A;  4X62 L;  2N3S A;  5C5M A;  4EQP A;  4LF7 Q;  1BOS A;  2VUM B;  1EIY B;  3K7A H;  4GKJ L;  1V43 A;  3TP6 A;  1A63 A;  1KRT A;  1VQL A;  1SLJ A;  1ICF B;  4FP5 D;  2E2I B;  3HOY H;  3FDT A;  4L5R C;  2OTL A;  1JB3 A;  2R3Z A;  4JYA Q;  1IW7 C;  1VQB A;  1OO9 B;  1HH2 P;  1LTB D;  2B2W C;  4ZKC B;  4WJW A;  2ASB A;  1LUZ A;  1XNQ Q;  3AB9 A;  1PA6 A;  1LV9 A;  2N8N A;  5JJI A;  2GN5 A;  5IGF A;  2JA8 H;  1WD1 A;  1L1O C;  3TRE A;  3DWA A;  1D6E C;  1E2V A;  4CDC C;  1NSN S;  4DR1 Q;  3WOF A;  2WKD A;  1E24 A;  2A69 C;  4DV0 Q;  2LSS A;  2MO0 A;  3SK8 A;  3H6M A;  3A0J A;  4ODG A;  2JEA I;  1BDO A;  5AJ3 L;  3TEH B;  1NMF A;  1OXV A;  1RL2 A;  3MEF A;  1IZ6 A;  3SK6 A;  2RCF A;  2Z6B A;  1PMR A;  3D6C A;  4YWM A;  2AQ1 B;  3E0E A;  4A3K H;  2WAQ E;  3JAM c;  1A6X A;  1KC8 C;  2D62 A;  2VQF L;  3A8I E;  1VQO A;  2WII B;  2O2L D;  5M3M G;  1U0L A;  5E4X A;  3ITP A;  1CUK A;  1NR4 A;  3VYR A;  4AH6 A;  1EU3 A;  4PMW A;  2BH2 A;  4K5W A;  1ASY A;  3RR5 A;  3CCV A;  4HTH A;  4DV1 L;  2E76 C;  2WB1 B;  3OMC A;  4NXN Q;  1QUQ B;  2PW5 A;  2ICE C;  4JI6 Q;  3W1G A;  2VXW A;  4IJH A;  1SNM A;  5H1S E;  4LF4 Q;  1ML0 D;  2HDM A;  2ZJP A;  4DR4 L;  4BA2 I;  4JOI C;  1BCP D;  4KTA A;  1T5X D;  2B2U A;  1H9M A;  2JP1 A;  1IYJ B;  4QUC A;  3HOV B;  2B2Y A;  3JC6 6;  4DV5 Q;  2Q2H A;  4DR3 L;  3PGZ A;  1BVS A;  2BE5 D;  2ALY B;  4A3E B;  4HID A;  3HOY B;  1WTW A;  5IYD G;  4A3D H;  1QVC A;  3E9H A;  3NPP A;  1EZ8 A;  3OIP A;  4EQO A;  2VZA A;  3ULP A;  2RDH A;  1HQR D;  4OO1 I;  1XWE A;  4IAL A;  4OX9 Q;  2NB0 A;  3GTO H;  1G2S A;  1XYI A;  2YU9 B;  5D14 A;  3MA2 B;  1UE1 A;  1SYG A;  2EY5 A;  3GTL B;  2EYJ A;  1VQP A;  2HIV A;  1FVI A;  4LUZ A;  2IX3 A;  2E2D C;  2RQX A;  1A3V A;  3DUZ A;  1Y1V B;  5M3F H;  1TS2 A;  1VMC A;  2KCC A;  1QB5 D;  1SJH D;  3HOU G;  4AYB G;  4DV7 L;  1E2Z A;  5KNB A;  3JAM L;  5C44 H;  4HIM A;  4ZKB B;  1F2M A;  3R2T A;  4A4I A;  3M7G A;  4P72 A;  1B9M A;  3OW2 A;  4LFA L;  2QKI C;  3T1Y L;  5DNF A;  1BBW A;  1PYS B;  2CCZ A;  3HKZ E;  5JJK A;  1PXU A;  1E1O A;  2KHI A;  1DOK A;  3KF8 B;  4N9P A;  2JA7 G;  5K36 G;  2WV6 D;  1A3U A;  1S5C D;  2DNE A;  4IJL A;  5CV6 A;  3L2P A;  4LJZ C;  2NVQ B;  3HFZ B;  4I65 A;  1Q82 C;  5M5W H;  1NR2 A;  3BVG A;  1LLR D;  1UWV A;  1PH4 A;  1E3P A;  1VQE A;  1R4Q B;  2F0V A;  4A3F B;  2LKV A;  1LTG D;  2QA4 A;  3KF8 A;  1X65 A;  4RKB A;  1MJC A;  4C3H G;  4LK1 C;  3S2D B;  2QEX A;  4GZY C;  1I4P A;  3CC2 A;  3PO2 G;  4K2K A;  5IYC G;  2PCF B;  3J80 i;  3VR4 A;  4UHV A;  4MZ9 A;  4X66 Q;  1Q90 A;  2MO1 A;  1N33 Q;  1Y8P B;  3J81 c;  1HZC A;  3VR3 A;  1SFO B;  3S15 H;  2F0T A;  4QF4 A;  3H3V C;  1U5K A;  2V1C C;  4HIO A;  2MHV A;  3GTO B;  3HOZ G;  4DPG A;  1YJ9 A;  3HG9 A;  5JEA H;  4A3M B;  3T13 A;  4LF5 L;  2R93 G;  4KKS A;  2K52 A;  5D65 A;  1GKH A;  4HN7 A;  2M2L A;  1PH8 A;  2RKS A;  2C9O A;  3CXC A;  2K7V A;  3CCE A;  4KJO A;  2D9U A;  4JI2 L;  2R7F A;  3M4Q A;  2OXP A;  4DR2 L;  4HCE A;  1PRT F;  5C44 B;  4GNX C;  1D5M C;  1WI5 A;  2NVY B;  1GUG A;  4DUZ Q;  1B70 B;  1HNZ Q;  4RCO A;  3IL8 A;  1KDA A;  2PYK A;  2R6G A;  3G71 A;  5CV7 A;  4U68 A;  4XIG S;  2Z6K C;  3FEW X;  2WAQ G;  2CW0 D;  1QZH A;  4B3T L;  1JCK B;  4CHT B;  1JR0 D;  3H3V H;  3HP3 A;  2RVL A;  4C2M H;  1WD0 A;  4KD3 A;  2QCP X;  4KHZ A;  3TP7 A;  4OWX B;  5J39 A;  2F0I A;  1Z47 A;  4DNR B;  4JI7 Q;  2R61 A;  1HJP A;  1I4X A;  4RG1 A;  3WWV A;  4ZYS A;  1HFN A;  1AN8 A;  1IBK Q;  1IBL Q;  2R92 H;  1DGS A;  2L1B A;  4BXX H;  2IWH A;  1L0W A;  2I5H A;  2AUK A;  3UE0 A;  3J80 E;  4A3C G;  3DLL A;  1Z7T A;  2D0P A;  2H1E A;  1WTR A;  3OSO A;  3L3O C;  3Q22 A;  1V9P A;  4A3B H;  2RHS B;  1X3G A;  4DUY Q;  1RIP A;  1GD7 A;  1EU4 A;  5KGU A;  1IYV A;  1R9T H;  5C4X G;  4RMF A;  3D8G A;  2H5X A;  3HOW G;  4JI5 Q;  4R1J A;  3DEO A;  1QG7 A;  3U50 C;  3FKI B;  2XRS D;  4TVA B;  4ALP A;  4HIK A;  3A5U A;  3CF5 A;  5C6A A;  2EJM A;  1V8Q A;  2NTT A;  3V05 A;  2I46 A;  1RTO A;  4HSP A;  1QZG A;  3GTG B;  1TWF H;  3H94 A;  5C0X J;  3S2H H;  5M5Y B;  3K6O A;  3O13 A;  4KN4 C;  5IOC A;  2RSO A;  1C0A A;  4KKT A;  1Y1W G;  1HR0 L;  1B53 A;  4YCU A;  2MNA A;  2NZO A;  1U9R A;  4X65 Q;  1CKM A;  3PUX A;  3NUC A;  4LF9 Q;  1ET9 A;  4WFN 3;  3TN2 A;  5BR8 Q;  4GOP B;  1TWH H;  2IX0 A;  2F0E A;  2RA4 A;  4EX5 A;  3E5S A;  5A2Q L;  2VQE L;  1ENC A;  4L6T B;  4DR5 Q;  1LT6 D;  2BCO A;  1BBX C;  2XWJ B;  2XNA C;  5ELE A;  1HNX L;  1G2T A;  2F0L A;  3H0G B;  1TWG H;  1XPO A;  3I3C A;  4DU9 A;  5M3M H;  4NPS A;  4X64 Q;  4C3J G;  1EUJ A;  4CJ0 B;  1NE3 A;  4GOP A;  3T1H Q;  5LMU L;  3HKZ G;  4IUT A;  5EKI A;  1N34 Q;  1RF2 D;  4A76 A;  1XMQ Q;  1M90 C;  4K6D A;  2RCN A;  3I91 A;  1K8A C;  2EIF A;  2UXB Q;  2ZXR A;  4C2M B;  5DLQ E;  2XTI A;  4H0L C;  2B2T C;  3A54 A;  1SND A;  1TY0 A;  2DN8 A;  1SXT A;  1PTO B;  3P1H A;  5GAD C;  4L5Q A;  2E2J H;  5FLX E;  1BNZ A;  2I5L X;  4BY7 B;  1DYQ A;  3TZU A;  3NEM A;  4NKL A;  1A62 A;  1S5F D;  3K59 A;  3I56 A;  4X62 Q;  1JWU D;  1K28 A;  1XTC D;  2JN4 A;  4ZLT F;  1EEF D;  1II3 A;  1SDF A;  3S14 B;  5IYD H;  4GKJ Q;  1SE2 A;  2PW7 A;  1L0X B;  2B8F A;  3I4N H;  3GTM H;  2NN6 G;  1R9T B;  3MXN A;  4OIJ A;  3CQZ H;  3M9B A;  3OHX C;  1WVL A;  1V1P B;  4IOC A;  4QB4 A;  5C4J B;  1DD2 A;  1Y8O B;  3GV6 A;  2AWO A;  4C1N I;  3MZ5 A;  3HGB A;  1A0I A;  3FHW A;  2A6H D;  1IL8 A;  4X66 L;  5ELC A;  1FGU A;  1N33 L;  4PG3 A;  1GHK A;  2KUM A;  2F3V A;  2XVS A;  1TWF B;  3K8A A;  1EQR A;  1WCM B;  3S1R B;  5C0X G;  4IPD A;  3SVM A;  1V1P A;  1YNX A;  2YYZ A;  3HOU H;  3A8K E;  3DM1 A;  1UEA B;  4MN3 A;  4DR6 L;  1GXD C;  2F0W A;  1YI2 A;  3BVM A;  2JA6 G;  3NBH B;  1TWH B;  2O5J C;  1SE4 A;  4EQN A;  1PFN A;  4FXK C;  3S1M H;  1PZK D;  2L55 A;  1HHV A;  2KEC A;  3S9W A;  2C5C A;  1OXT A;  5AJ3 Q;  3AEV A;  2KBN A;  3VR5 A;  5JVH 3;  3RN2 A;  2JA7 H;  5K36 H;  1BCP C;  5L37 A;  1VQ9 A;  2F0P A;  1GJX A;  1D8L A;  4DV3 L;  2NWG A;  1SYF A;  1BKB A;  1ZEQ X;  1EYD A;  3KF6 B;  3TS2 A;  2N55 A;  3NBH A;  4RAU C;  3EBE A;  2VQF Q;  2BE5 C;  1VQF A;  3RZD H;  1FYC A;  1PH6 A;  4JBM A;  2PMZ E;  3TRZ A;  4RGN A;  4XT3 B;  4IUN A;  1EIG A;  2EYM A;  4QJF A;  1RJT A;  1YZ6 A;  1VQ4 A;  1Q1B A;  5EGT A;  3OTO L;  3S16 H;  4C3H H;  2E2J B;  4DV1 Q;  3KF6 A;  4K0K L;  4AQY L;  1YIT A;  3PO2 H;  4A3G G;  2AWN A;  5HGT A;  5IYC H;  1VQ5 A;  4CDE C;  2J4X A;  2MGS A;  4LNQ A;  3CRL C;  5FOB B;  3S24 A;  1YNJ C;  4DR4 Q;  3SHL A;  1YJN A;  5DEH A;  1PH7 A;  2VB3 X;  2XRQ D;  1PFS A;  3K5M A;  2A6E D;  3L7Z C;  3J81 j;  2FHT A;  3I7F A;  3CD6 A;  4DR3 Q;  3GTM B;  4ZQ3 A;  4IPH A;  1STB A;  1FJG Q;  3HOZ H;  2LY7 A;  4KD4 A;  4CKE A;  2ZM6 Q;  2D2C C;  2XIW A;  3QO2 A;  4WRD A;  3NHH A;  4WJ3 M;  1K73 C;  4KY6 A;  4EVO A;  5EJW A;  4JV5 L;  1YBY A;  1Q8K A;  2CHB D;  1KIX A;  2F1M A;  3AQQ A;  4DFA A;  5KEE A;  5C3E B;  1BCP F;  1IBM L;  1I50 B;  1RTN A;  3EN2 A;  1S5E D;  1MJE A;  1XPU A;  5I9O A;  3HOU B;  1JMC A;  1S5D D;  2KHS A;  3VR2 A;  1LT4 D;  4DNI A;  4ZUJ A;  3PSI A;  5I2X A;  1T9H A;  1P16 A;  3L9A X;  4OON A;  1OXS C;  4UPA A;  2Q8I B;  4DV7 Q;  4JPB W;  1CQV A;  1KTK A;  4QGU A;  1C8C A;  1AZP A;  2K4K A;  3AFQ A;  4UP9 A;  1PYB A;  4A3L G;  2JA7 B;  1MHW C;  4GN3 B;  1A8V A;  4LFA Q;  4J15 A;  1BR9 A;  4AYB E;  3T1Y Q;  3M4O H;  5DAU A;  4KHV A;  1WTX A;  4JI8 L;  3MEH A;  1U4P A;  3BVZ A;  2PQA B;  4OHJ A;  1X55 A;  2OF1 A;  3NWT A;  5M5X B;  2EZV A;  3VYU A;  3VYT A;  2B2U C;  2RDG A;  4NW2 A;  5JAV A;  2OCE A;  1VQ8 A;  4WOR A;  2B2Y C;  2P5Z X;  4V0B A;  1GUW A;  1MKH A;  1STA A;  3VR6 A;  3F2B A;  3S16 B;  3A8J E;  3A56 A;  1VQA A;  4C3H B;  4IFD I;  1X9N A;  3NK9 A;  1YHQ A;  4XQJ A;  3KYH C;  4A3C H;  4JI3 Q;  2PQA A;  3Q23 A;  3A7L A;  5I4D A;  1TKW B;  2HD3 A;  2F03 A;  3A7A B;  1PLF A;  1J6Q A;  4K14 A;  1YIJ A;  5C4X H;  1D5Z C;  4JI4 L;  2MQH A;  4JK1 C;  4C3I G;  2PI2 E;  4BXX G;  2SEB D;  1PH3 A;  1T5E A;  2R7D A;  3MC0 B;  1SYD A;  2VY3 A;  4ZRZ A;  5LMN L;  2R93 B;  2WAC A;  3W1B A;  1C48 A;  1TWC H;  2EE1 A;  3Q0A A;  3I73 A;  3A55 A;  2UXD L;  1JE5 A;  5IP9 G;  3GTQ H;  3FP9 A;  2CW0 C;  2X6L A;  3ND8 A;  1Y1W H;  1X3F A;  1RCV D;  1YHB A;  4A3B G;  4LF5 Q;  5LHY 1;  1CHQ D;  1PHJ A;  2F52 A;  1CZW A;  3D6W A;  3HS0 C;  2SNM A;  3MXG A;  4JCV E;  4O1N A;  2K5D A;  4IUU A;  3S1N H;  3QR8 A;  3ND9 A;  1G91 A;  1XNR Q;  3U4Z A;  4JI2 Q;  4PQX A;  3SGI A;  4DR2 Q;  5JJZ A;  1I5F A;  5F2D A;  5KYL A;  3R93 A;  4CGY B;  4BY1 G;  1VQD A;  2KVM A;  3PUW A;  5FKA C;  4RGT A;  1QNK A;  1EY6 A;  1AE2 A;  4C3J H;  1HQM C;  2XWB B;  3C1E A;  1LTI D;  2YTV A;  1KXL A;  2WAQ B;  1O7I A;  1H9S B;  2ZTD A;  5GAG C;  3J7Z C;  3CPF A;  3S1Q H;  1N32 Q;  5EQ0 A;  2E2H B;  3UE1 A;  5EKL A;  3BYY B;  4XQQ A;  5JPN C;  2VW9 A;  4B3T Q;  4DAM A;  4DNT B;  3DXJ C;  4DGZ A;  4DF7 A;  2IJ0 A;  4HJ5 A;  4KN7 C;  1ILP A;  1H9S A;  1SMY D;  4DK0 A;  1A15 A;  1AE3 A;  1VQM A;  2E74 C;  1EEI D;  2A74 C;  3RZO H;  5CV9 A;  1OXX K;  3BS1 A;  1Y69 U;  3BZK A;  3U9S A;  3L0O A;  3M3Y H;  1KAW A;  2E5L L;  4CJ2 C;  5NUC A;  3GTK B;  2EY1 A;  3GTJ B;  4JW0 A;  4Y7N B;  2NN6 H;  2NTS A;  1Z6H A;  1M1K C;  4X3T A;  2Z1C A;  2EY6 A;  4B3M L;  4JI0 L;  3HOW B;  4POF A;  4HR7 B;  4A75 A;  1JQY D;  1JIC A;  3M85 A;  2C35 B;  1SRU A;  1F77 A;  2XGT A;  3HKS A;  1EWC A;  1I4R A;  2ICI A;  5IWA L;  3K7A B;  3P20 A;  1IYU A;  1EWI A;  1QUQ A;  3U9O A;  4GS3 A;  5C0X H;  5T1G A;  1PZJ D;  1FJG L;  3MVV A;  3M4P A;  1Q12 A;  5FO7 B;  4ZK9 B;  2ZM6 L;  5J1Z A;  1GOZ A;  1X54 A;  1FR3 A;  4FO2 A;  4I7Z C;  3KLW A;  3I4N G;  2Q8T A;  2JA6 H;  2HQE A;  1K9M C;  2ZXP A;  1HR0 Q;  4BBS G;  3QOJ A;  2KJX A;  4FDB A;  1GUS A;  5LMN W;  2JYO A;  1YHA A;  4DV6 L;  3J81 i;  3RNU A;  2K75 A;  2VQE Q;  2JA8 B;  1YNJ D;  1FGB D;  3R2I A;  1QWY A;  3W3A A;  3Q6S A;  1HNX Q;  3HKZ B;  2CH4 W;  2Y0S B;  4HED A;  1MSH A;  4DR7 Q;  1K8O A;  5LMU Q;  1HCZ A;  3KLS A;  4P74 A;  3J7Y W;  1TWA H;  5IGE A;  5C3W A;  2HCI A;  3PUZ A;  1ONL A;  4OL7 A;  5E7N A;  3R8B A;  4A3G H;  3G7L A;  3CC4 A;  4A3K B;  3CP0 A;  2A6H C;  1ENF A;  4QIW E;  1AP0 A;  1G8Z D;  3QIA A;  3KK7 A;  1DJR D;  3M3Y B;  1Q46 A;  1STE A;  3I2Z A;  4G7Z C;  3Q8D A;  1B3A A;  3ZYY X;  5KNC A;  3CKI B;  4OO1 H;  3WOE A;  1W3S A;  4JVZ A;  4DAY B;  1NUC A;  1HRJ A;  3X3M A;  4JI3 L;  3PO3 G;  3TP5 A;  2LXK A;  5FO8 B;  1JC7 A;  1WOC A;  2L9H A;  3SK5 A;  5HY6 A;  3GTP H;  1KLG D;  4PZ8 A;  4FF3 A;  4UDU C;  4DK3 C;  5FLM G;  2ES2 A;  2CQO A;  2ATW A;  4X3K A;  1KNE A;  4LUO A;  3CCL A;  4DAY A;  2HDL A;  3OPO A;  1VQK A;  1KRS A;  1QVG A;  2TMP A;  3SXH A;  1E7Z A;  5D3D A;  1M4V A;  3WDN A;  5DM6 3;  1HA6 A;  1KAB A;  4GLX A;  2BDO A;  4A3D B;  2O5I C;  1YNN D;  2KOL A;  1X3E A;  2DGY A;  1VQJ A;  4CJ1 B;  4GOP C;  5TSS A;  3I4M H;  2Q2T A;  3LWE A;  3NP8 A;  5CMD A;  1PH5 A;  4DR6 Q;  1F2L A;  3I4L A;  1HUN A;  4Z9C B;  1ROD A;  5GAE C;  2CQA A;  2KEN A;  4HJ8 A;  1I4G A;  1CKN B;  1PFB A;  4A3L H;  4ZAI A;  3HOX G;  1EOV A;  1HFG A;  5GRO A;  3CCQ A;  2L12 A;  2WFW A;  1Q81 C;  1PVO A;  1XNR L;  4ILW A;  4F87 A;  5M3F B;  4I7A A;  2A6E C;  4YWL A;  5EBC A;  1X32 A;  1HPC A;  5LL6 S;  4DV3 Q;  1SE8 A;  1H95 A;  2I0Q A;  3K81 C;  1TR5 A;  3R3O A;  1J5E L;  5IE8 A;  2MUY A;  1EY4 A;  2VL6 A;  1EQQ A;  4MIU A;  1C7Y A;  4XT1 B;  2EDG A;  2VB2 X;  1F9P A;  1N32 L;  3OTO Q;  4IN3 A;  4JG2 A;  3RLN A;  1NTG A;  2JJQ A;  4J8Q A;  5C5L A;  4K0K Q;  4AQY Q;  1G6P A;  3NE5 B;  4GLA C;  2DJG C;  2F3I A;  1CQF A;  2N49 A;  5M5W B;  3M7N A;  4E6I A;  3I55 A;  1UEB A;  4C3I H;  1SE3 A;  1STY A;  2EXZ A;  1PH9 A;  2ZJQ A;  1ILQ A;  1SYB A;  2MFI A;  2F0O A;  2HHH L;  1JOR A;  4K5X A;  5IP9 H;  3OWE B;  1I6H H;  1D2B A;  3LX0 A;  5IGG A;  3J80 c;  1IL2 A;  3IKJ A;  2B29 A;  3TDQ A;  1CTM A;  3U58 A;  4FF1 A;  4JV5 Q;  1EFW A;  1LTA D;  2BH8 A;  3CCR A;  3AYH B;  1IBM Q;  4KY5 A;  3S15 B;  1B3Q A;  2N88 A;  2NVT H;  2LXJ A;  1SAP A;  3PUY A;  4FXG C;  4BY1 H;  4XXE A;  2PO4 A;  5I9P A;  3PMF A;  1PRT B;  1UNS A;  5ISR A;  2OQ0 A;  4ZUI A;  2G5D A;  1LTT D;  4QY7 A;  3J7A V;  1BUV T;  1QE6 A;  4NP5 A;  3J7A F;  1OXU A;  4RHR A;  1K8G A;  2M00 A;  2L15 A;  4R8I A;  2QDB A;  4JI8 Q;  4GKK L;  2BOS A;  5FK9 C;  4IFD G;  3D4W A;  3HOV G;  3TME A;  2DUD A;  5ELN A;  4A3E G;  2QGQ A;  1MIU A;  4DR7 L;  4CKC A;  1NNX A;  2EVB A;  5CV8 A;  4G7H C;  1PZI D;  5FO9 B;  3UDI A;  3H15 A;  3BZC A;  1PFM A;  3IAY A;  3CCU A;  5CBE E;  1EIF A;  1E2W A;  2RHQ B;  4IUQ A;  4CKB A;  2NZH A;  1CA6 A;  1JE4 A;  4C3I B;  3CCS A;  4MTK A;  2R92 B;  3NBI A;  2EJF C;  3J80 L;  1VMP A;  4LF6 L;  1NCV A;  4O2D A;  1MBY A;  3NXW A;  4JI4 Q;  4B9W A;  1Y1V G;  4DAP A;  1SYE A;  1K83 H;  4G4K A;  3KJP A;  1F9S A;  4XQN A;  5FLX c;  2UUB L;  1LAC A;  5LMN Q;  4A3B B;  3MXP A;  1EFI D;  4KKU A;  1EWH A;  1CFM A;  4N9T A;  1ESR A;  2UXD Q;  4HAE A;  1DON A;  2QEJ C;  4BBS H;  3C46 A;  2B8G A;  4DKA C;  2RBM A;  1L2F A;  2MP1 A;  2UUC L;  1G51 A;  2K6A A;  3VA5 A;  1JWM D;  4TKO B;  1SMY C;  3KUP A;  2GVB A;  1K8M A;  5IIF A;  1E0B A;  3T56 B;  1X3Q A;  1LTS D;  1B44 D;  1I4H A;  5IYB G;  3S2H B;  2GVA A;  1EQV A;  4LUV A;  3T53 B;  3VDY A;  2KHJ A;  3K80 C;  4A3F G;  1AEX A;  1DXM A;  1NBW A;  3ULL A;  4K8I A;  3GD7 A;  4XDX A;  4DV2 L;  2F4V L;  2EOT A;  1WYD A;  4JBK A;  1O7Y A;  1C4Q A;  2PMZ B;  3Q24 A;  1JJ2 A;  2F0G A;  5C3X A;  1STN A;  2X6G A;  1EL0 A;  2EYH A;  1PRT D;  2RSN A;  1TWG B;  3IRB A;  2CWP A;  3I72 A;  3N52 A;  5M3M B;  1HNW L;  3T51 B;  1LTR D;  1VDZ A;  1Y8N B;  1HA5 A;  2B3G A;  5EAY A;  3H91 A;  1CT1 D;  1V1Q A;  1SEB D;  1V1O A;  2EYO A;  4YY3 Q;  5IT9 E;  2SDF A;  3PO3 H;  4DK6 C;  3TS0 A;  1CK1 A;  5C4Z A;  3T4A C;  4A3M G;  4X3U A;  2E5L Q;  3MFY A;  5FLX L;  2Z4H A;  4R4Q A;  2R7Z H;  5FLM H;  1Y14 B;  4P71 A;  5IOD A;  1J9O A;  3PQI A;  4B3M Q;  2OWO A;  4JI0 Q;  4LF8 L;  3DMU A;  3GO5 A;  3IFD A;  4BBR H;  1IKM A;  2KCN A;  4IUP A;  1BXT A;  3OYY A;  3KBG A;  2EYP A;  4KMU C;  1F2Y A;  3GDE A;  5IWA Q;  4R4I A;  2AHO B;  1LO5 D;  2K5V A;  3GQB A;  4OO1 G;  4B3S L;  1I3Q H;  4RKL A;  5GAH C;  3I4N B;  1FNW A;  3IFT A;  3QWN A;  2B39 A;  5A35 A;  2IHE A;  1PTO D;  4BBS B;  1W2B A;  4C56 C;  5IGB A;  3CQZ B;  3W5O A;  2A1A A;  4QMG A;  3MTS A;  4ULL A;  3HOX H;  4A3J H;  1XTD A;  3PCO B;  3SDZ A;  4R9W A;  4KK7 A;  3NTK A;  4G7O C;  1WTO A;  2K28 A;  2AMC B;  2CH4 A;  4DV6 Q;  1BBU A;  1HZB A;  4EQ5 A;  2EYL A;  4AYB B;  1I6V C;  1J8I A;  2VUM H;  4RHS A;  1KDB A;  5E3F A;  3I4M G;  1YEZ A;  2I07 B;  3DM3 A;  1RKN A;  1VQ6 A;  5COY A;  1EIH A;  2JA9 A;  3S1M B;  2BA0 A;  2E2I H;  2QW7 A;  4TSS A;  1X3P A;  5I2Y A;  2IPK D;  1U4M A;  1D5X C;  3TBI B;  2L5T A;  1B1Z A;  5GQO A;  1I94 L;  4LMQ D;  1KDC A;  4MHE A;  3BDC A;  1A3T A;  1KAA A;  2K03 A;  4DK1 A;  3FKI G;  3RZD B;  2JEB I;  4R8N A;  4F88 A;  1HTL D;  2JSO A;  3PO3 B;  1YNN C;  4FYD A;  1FL0 A;  3TSS A;  1LM0 A;  2RDF A;  1JOO A;  1CA5 A;  1WJJ A;  4F7X A;  3K57 A;  4ABN A;  3PO2 B;  4IUR A;  3K7U C;  3I70 A;  1EYG A;  1D7Q A;  1EYC A; 
#chains in the Genus database with same CATH homology
 1NMG A;  4KHZ A;  4OWX B;  1Z47 A;  5LMN W;  3CC7 A;  4JI7 Q;  1HJP A;  3NEN A;  4RG1 A;  1YHA A;  3WWV A;  4DV6 L;  3J81 i;  4R4C A;  2N78 A;  2K75 A;  1B7Y B;  5C3E H;  2VQE Q;  3RNU A;  1IBK Q;  2OTJ A;  1I50 H;  3JAM i;  1IBL Q;  5JJL A;  2R92 H;  1DGS A;  4BXX H;  2PI2 A;  1Q86 C;  4YCV A;  4DV4 Q;  1L0W A;  2I5H A;  3H0G G;  1HNX Q;  4A93 G;  3F2C A;  4PZ6 A;  3UE0 A;  3ICE A;  4LFC L;  4A3D G;  1Z9F A;  4A3C G;  3DLL A;  2YV5 A;  4DR7 Q;  1NY4 A;  5LMU Q;  1PV4 A;  2D0P A;  4OWW B;  4P74 A;  5JEA J;  1TWA H;  3F2D A;  1V9P A;  4A3B H;  2RHS B;  3CPW A;  3G48 A;  1X3G A;  2HIX A;  3PUZ A;  4LWC A;  1RIP A;  4DUY Q;  5E7N A;  2JA5 H;  1GD7 A;  1Q1E A;  4A3G H;  3ULJ A;  4KHP Q;  3KFU A;  3CC4 A;  1R9T H;  5FJ8 H;  5C4X G;  4RMF A;  5IT9 c;  3CP0 A;  3K0X A;  2H5X A;  1CSQ A;  2AKW B;  3HOW G;  4QIW E;  2UU9 Q;  1HR0 W;  4R1J A;  4JI5 Q;  3CAM A;  3U50 C;  3U4V A;  5M5X H;  4BY7 G;  4JBJ A;  4NB3 A;  5M3F G;  4DUZ L;  4TVA B;  1HNZ L;  3F1Z A;  1Q46 A;  4APV A;  3I2Z A;  4ALP A;  4LF6 Q;  4HIK A;  3A5U A;  3Q8D A;  3CF5 A;  3HOV H;  1SMX A;  5C44 G;  2Z0S A;  1QZG A;  3S2H H;  1TWF H;  1W3S A;  5C0X J;  3J7A 5;  4DAY B;  4A3E H;  4IO9 A;  4JI3 L;  1XMO Q;  3PO3 G;  2LXK A;  1WOC A;  1NJI C;  1J5E Q;  5HY6 A;  3A5Z B;  3GTP H;  1C0A A;  3PV0 A;  1Y1W G;  1HR0 L;  4YCU A;  2MNA A;  2NZO A;  4PZ8 A;  5IY0 A;  4DK3 C;  4MTN A;  5FLM G;  2ES2 A;  4X65 Q;  1CKM A;  2CQO A;  3PUX A;  4LF9 Q;  2ATW A;  2UXC Q;  4UY8 C;  1LTL A;  2NN6 I;  1N36 Q;  4R4O A;  5BR8 Q;  4YCW A;  4GOP B;  1TWH H;  1PH1 A;  2IX0 A;  2YU9 H;  4LUO A;  2A8V A;  3ZJY C;  4EX5 A;  1IBK L;  2VQE L;  3CCL A;  3GTL H;  4DR5 Q;  4UP7 A;  4HJ7 A;  1IBL L;  2FXQ A;  1VQK A;  1KRS A;  2JE6 I;  1QVG A;  4DV4 L;  1G29 1;  1UE7 A;  1TXY A;  1HNX L;  2CKZ B;  1E7Z A;  1TWG H;  2ZTE A;  1XPO A;  4GLX A;  1WFQ A;  1WCM G;  1Y1V H;  5M3M H;  4OWT B;  4NPS A;  4X64 Q;  1CKO A;  1EUJ A;  2BA1 A;  1NE3 A;  1VQG A;  1B8A A;  1X3E A;  2DGY A;  5LMU L;  3HKZ G;  4GOP A;  3T1H Q;  1VQJ A;  1IXR A;  4GOP C;  1E1T A;  4YY3 L;  3I4M H;  4LFB Q;  5C0X I;  4A76 A;  1N34 Q;  2K5H A;  1XMQ Q;  4H02 A;  1M90 C;  2Q2T A;  2RCN A;  1K8A C;  2EIF A;  2R93 H;  1PH5 A;  4DR6 Q;  3E9I A;  1X56 A;  2UXB Q;  4DUY L;  5DLQ E;  2XTI A;  5J3B A;  2HHH Q;  5GAE C;  2KEN A;  4KHP L;  4HJ8 A;  1CKN B;  4A3L H;  1AH9 A;  4JBW A;  3HOX G;  1OTC A;  1EOV A;  3KJO A;  1JB7 A;  5GRO A;  5GAD C;  1S3O A;  4L5Q A;  4JI5 L;  2E2J H;  2UU9 L;  3CCQ A;  1XPR A;  2WFW A;  1Q81 C;  1PVO A;  1XNR L;  2I5L X;  1VQ7 A;  3CCM A;  4YWL A;  3NEM A;  4DV3 Q;  1CSP A;  1A62 A;  3RLF A;  1SE8 A;  4HJ9 A;  2NVQ H;  1H95 A;  3I56 A;  2I0Q A;  3K81 C;  1KL9 A;  4X62 Q;  2IY5 B;  5IYB H;  4A3I G;  1XMO L;  2ZJR A;  1JT8 A;  1J5E L;  5IE8 A;  3RN5 A;  5IYD H;  2VL6 A;  1EQQ A;  4A3F H;  4GKJ Q;  5JEA G;  1C7Y A;  2OQK A;  1VQI A;  4X65 L;  4JI1 Q;  3GTM H;  3I4N H;  4LF9 L;  2UXC L;  3D0F A;  1N32 L;  2JK8 A;  2NN6 G;  4AIM A;  4ME3 A;  4JG2 A;  3I4O A;  3OTO Q;  1KD1 C;  1N36 L;  3S2D H;  5BR8 L;  2KCM A;  3RLN A;  1NTG A;  2JJQ A;  3CQZ H;  3M9B A;  2E2H H;  4IOC A;  4DR5 L;  4K0K Q;  4AQY Q;  1G6P A;  1C9O A;  4YHH Q;  2VNU D;  2AWO A;  2CFM A;  3A74 A;  5IP7 H;  4GLA C;  1A0I A;  2F3I A;  3BJU A;  2N49 A;  2JQO A;  3FHW A;  4X66 L;  4B3R Q;  4KI0 A;  1FGU A;  3M7N A;  3I55 A;  1UEB A;  4PG3 A;  1KQS A;  1N33 L;  2WB1 E;  2K14 A;  4GKK Q;  3K8A A;  4C3I H;  4X64 L;  2B63 G;  1EQR A;  3KDF B;  2A19 A;  4MNO A;  3T1H L;  5C0X G;  4LFB L;  4IPD A;  1YNX A;  2YYZ A;  1SFO H;  1N34 L;  1XMQ L;  3HOU H;  1PH9 A;  4R4T A;  2ZJQ A;  4DR6 L;  1VQN A;  2UXB L;  1N9W A;  4NXM Q;  2MFI A;  3TQY A;  3STB C;  2HHH L;  1KHI A;  1YI2 A;  2JA6 G;  3NBH B;  4POG A;  2K50 A;  5IP9 H;  1I6H H;  4A3M H;  3PIO A;  3GTK H;  1N8R C;  2UUA Q;  3KDF A;  3GTJ H;  3S1M H;  4Y7N H;  4HJA A;  3J80 c;  1IL2 A;  1YVC A;  1HZ9 A;  3AFP A;  2B29 A;  1OXT A;  2HQL A;  1GVP A;  5AJ3 Q;  3AEV A;  2KBN A;  3U58 A;  4JV5 Q;  3PUV A;  3RN2 A;  2JA7 H;  1EFW A;  3HOW H;  1VQ9 A;  2BH8 A;  5C3E G;  3CCR A;  1GM5 A;  2ID0 A;  1D8L A;  4DV3 L;  3AYH B;  4X6A H;  1IBM Q;  2R92 G;  1BKB A;  3D31 A;  4X62 L;  2N3S A;  3KF6 B;  4LW1 A;  3PF4 A;  3TS2 A;  4L5T A;  4LF7 Q;  3EBE A;  2NVT H;  2VQF Q;  1EIY B;  1XJV A;  1VQF A;  1HZA A;  2LXJ A;  3K7A H;  4JC0 A;  3RZD H;  3PUY A;  1PH6 A;  4BY1 H;  2NVY H;  4JBM A;  4GKJ L;  2PMZ E;  3TRZ A;  1V43 A;  1A63 A;  4QJF A;  1KRT A;  1VQL A;  1SLJ A;  1YZ6 A;  4IPG A;  4C2M H;  1VQ4 A;  1Q1B A;  3PF5 A;  2OQ0 A;  1YJW A;  3OTO L;  3S16 H;  4C3H H;  4L5R C;  3HOY H;  2UUB Q;  2OTL A;  1L1O B;  4JYA Q;  4DV1 Q;  4P73 A;  3KF6 A;  3LGJ A;  4QY7 A;  4AQY L;  4K0K L;  1YIT A;  2JA5 G;  1VQB A;  3PO2 H;  2Y0S E;  2AWN A;  4YHH L;  2R7Z G;  4A3G G;  5IYC H;  1S40 A;  1VQ5 A;  1HH2 P;  1OXU A;  4B3R L;  1K8G A;  4LNQ A;  3ERS X;  4GLV B;  2ASB A;  2L15 A;  3S24 A;  4DR4 Q;  4JI8 Q;  1YJN A;  4GKK L;  1LUZ A;  1PH7 A;  2UUC Q;  1XNQ Q;  1PFS A;  1PA6 A;  4IFD G;  4BBR G;  2N8N A;  3L7Z C;  4QQB X;  5JJI A;  2GN5 A;  1K0R A;  3NEL A;  1L1O A;  1SR3 A;  2JA8 H;  3HOV G;  3J81 j;  1L1O C;  3TRE A;  1P8L A;  1SN8 A;  1QVF A;  3I7F A;  2DUD A;  4DR1 Q;  3CD6 A;  5ELN A;  4DR3 Q;  2QGQ A;  4A3E G;  4NXM L;  1E24 A;  1MIU A;  4DR7 L;  4IPH A;  1FJG Q;  3HOZ H;  4DV0 Q;  3BU2 A;  2LSS A;  2MO0 A;  2ZM6 Q;  4GN4 B;  3UDI A;  2UUA L;  3EIV A;  3H15 A;  1K73 C;  4WJ3 M;  3A0J A;  3BZC A;  3CCU A;  2JEA I;  5AJ3 L;  4DV2 Q;  3TEH B;  1NMF A;  2F4V Q;  1EIF A;  1OXV A;  4JV5 L;  1RL2 A;  2RHQ B;  1YBY A;  1Q8K A;  3MEF A;  2NZH A;  1KIX A;  1IZ6 A;  3CME A;  4A3J G;  4YWM A;  3AQQ A;  1IBM L;  3CCS A;  3E0E A;  4A3K H;  3H3V I;  3EN2 A;  2WAQ E;  2EQS A;  3JAM c;  1MJE A;  3G6E A;  1KC8 C;  4LF7 L;  1XPU A;  2D62 A;  2VQF L;  1JMC A;  4LF6 L;  1VQO A;  4O2D A;  4JI4 Q;  1Q7Y C;  3FKI H;  1Y1V G;  5M3M G;  4IPC A;  1U0L A;  4DNI A;  1CUK A;  1K83 H;  3PSI A;  4IFD J;  1HNW Q;  4AH6 A;  2K5N A;  1T9H A;  1P16 A;  4GN5 A;  3KJP A;  4PMW A;  1CKN A;  1OXS C;  4OON A;  4UPA A;  5FLX c;  2BH2 A;  2VUM G;  4DV7 Q;  1ASY A;  3RR5 A;  2Q2U A;  3CCV A;  2UUB L;  3GTG H;  5M5Y H;  4QGU A;  4JYA L;  5LMN Q;  4DV1 L;  1VQH A;  3STB D;  2K4K A;  3AFQ A;  2YTX A;  4UP9 A;  4NXN Q;  1QUQ B;  2I5M X;  4JI6 Q;  1PYB A;  4A3L G;  2UXD Q;  3W1G A;  4IJH A;  4GN3 B;  1A8V A;  4LFA Q;  4J15 A;  4AYB E;  5H1S E;  1PH2 A;  4LF4 Q;  1E22 A;  2ZJP A;  3T1Y Q;  3M4O H;  4BBS H;  4DR4 L;  4DKA C;  4JI8 L;  3S17 H;  1L2F A;  4JOI A;  2UUC L;  1XNQ L;  1S72 A;  4BA2 I;  1G51 A;  2PQA B;  1X55 A;  4JOI C;  2HT1 A;  1JJC B;  2GVB A;  3F8T A;  1IYJ B;  4LF8 Q;  3JC6 6;  2OCE A;  4DV5 Q;  1VQ8 A;  1VS0 A;  2Q2H A;  4DR1 L;  3PGZ A;  4DR3 L;  5IYB G;  4L5S A;  1MKH A;  1BVS A;  2GVA A;  3H0G H;  2ALY B;  3F2B A;  4A93 H;  4LUV A;  4HID A;  3VDY A;  1VQA A;  4DV0 L;  4IFD I;  1VQC A;  2KHJ A;  1X9N A;  5IYD G;  1YHQ A;  3K80 C;  1QVC A;  3E9H A;  4A3F G;  3KYH C;  4A3D H;  4A3C H;  4JI3 Q;  1NBW A;  2PQA A;  2VZA A;  3ULP A;  3ULL A;  4OO1 I;  4B3S Q;  3GD7 A;  4DV2 L;  2F4V L;  4OX9 Q;  2CWA A;  2IHF A;  3GTO H;  1WYD A;  4YWK A;  4JBK A;  4IOA A;  1UE1 A;  3PIP A;  1VQP A;  5IP7 G;  1JJ2 A;  2HIV A;  1J6Q A;  1YIJ A;  1FVI A;  2RF4 A;  4LUZ A;  5C4X H;  4JI4 L;  2MQH A;  1X6O A;  3KOJ A;  3IRB A;  2PI2 E;  4BY7 H;  2CWP A;  5M3F H;  1HNW L;  4BXX G;  1PH3 A;  3HOU G;  2B3G A;  2R7D A;  5EAY A;  4AYB G;  2VY3 A;  4DV7 L;  5C44 H;  2VS1 A;  4XTC S;  4HIM A;  5LMN L;  2YTY A;  5HGQ A;  1V1Q A;  3W1B A;  1TWC H;  4P75 A;  4NXN L;  4YY3 Q;  3PO3 H;  4A4I A;  4DK6 C;  3TS0 A;  4JI6 L;  2EXD A;  4JI1 L;  4P72 A;  3S14 H;  2UXD L;  1JE5 A;  3UDF A;  1UE6 A;  5IP9 G;  3OW2 A;  3FP9 A;  4A3M G;  1Y1W H;  4LF4 L;  3B6Y A;  2E5L Q;  4LFA L;  3T1Y L;  3GTQ H;  4R4Q A;  1BBW A;  1X3F A;  1YHB A;  2R7Z H;  4LF5 Q;  1PYS B;  4A3B G;  5FLM H;  2WB1 G;  1Y14 B;  3HKZ E;  2CCZ A;  1PHJ A;  2F52 A;  3UDG A;  5JJK A;  4P71 A;  1E1O A;  2KHI A;  2NVX H;  3KF8 B;  5K36 G;  4B3M Q;  4JCV E;  2OWO A;  4JI0 Q;  5C4J H;  3CCJ A;  2JA7 G;  5FJ8 G;  3S1N H;  4IJL A;  4UP8 A;  4LF8 L;  1XNR Q;  3GO5 A;  4BBR H;  1I94 Q;  3L2P A;  3RLO A;  4DV5 L;  3U4Z A;  3HFZ B;  4JI7 L;  3OYY A;  4JI2 Q;  3SGI A;  5M5W H;  4DR2 Q;  1Q82 C;  1I5F A;  1UWV A;  1PH4 A;  4BY1 G;  1E3P A;  5IWA Q;  1VQE A;  3GDE A;  1VQD A;  4R4I A;  1WCM H;  2AHO B;  3PUW A;  2K5V A;  4C3J H;  1AE2 A;  3S1R H;  4OO1 G;  2QA4 A;  4B3S L;  1I3Q H;  5GAH C;  1ASZ A;  1X65 A;  2YTV A;  4OX9 L;  1KXL A;  1O7I A;  1MJC A;  2IX1 A;  3HOY G;  1UE5 A;  2ZTD A;  1GO3 E;  5GAG C;  3J7Z C;  2QEX A;  2IHE A;  3CPF A;  4QL5 A;  3S1Q H;  1W2B A;  3CC2 A;  1N32 Q;  3UE1 A;  3PO2 G;  3W5O A;  5IYC G;  2A1A A;  2VW9 A;  4TQU S;  2D0O A;  4B3T Q;  3J80 i;  4DAM A;  3HOX H;  4A3J H;  3CW2 C;  1XTD A;  4Y52 H;  3PCO B;  4BA1 I;  4O0A A;  4MZ9 A;  4X66 Q;  4HJ5 A;  2AMC B;  2MO1 A;  1VQM A;  1AE3 A;  3J81 c;  1N33 Q;  1VCI A;  4DV6 Q;  2KCT A;  2JA8 G;  1HZC A;  1SRO A;  1BBU A;  1HZB A;  4EQ5 A;  3RZO H;  5ELO A;  1OXX K;  2ZTC A;  3S15 H;  3BZK A;  2VUM H;  3L0O A;  1U5K A;  4A3I H;  3M3Y H;  2V1C C;  2Y0S G;  4HIO A;  4WJ4 A;  3HOZ G;  4LFC Q;  2WP8 J;  4DPG A;  1YJ9 A;  3I4M G;  1KAW A;  1YEZ A;  2Q2I A;  3DM3 A;  4GNX B;  2E5L L;  1VQ6 A;  4LF5 L;  2R93 G;  2JA9 A;  2K52 A;  2BA0 A;  2E2I H;  1K3R A;  4OXP A;  4PZ7 A;  1GKH A;  1M1K C;  4B3M L;  1PH8 A;  4JI0 L;  3CXC A;  3UDX A;  4POF A;  3CCE A;  4A75 A;  5GQO A;  1I94 L;  1LYL A;  2C35 B;  3M85 A;  4A3K G;  1SRU A;  1JJG A;  3ER0 A;  3MXN B;  2XGT A;  3HKS A;  4JI2 L;  2R7F A;  3M4Q A;  4DR2 L;  4GNX A;  3CMA A;  2IT1 A;  4GNX C;  1WI5 A;  3FKI G;  5IWA L;  2JEB I;  2B63 H;  4DUZ Q;  1B70 B;  1EWI A;  1QUQ A;  1HNZ Q;  2PNH A;  1FL0 A;  4GS3 A;  1FJG L;  1LM0 A;  3G4S A;  3M4P A;  2R6G A;  3G71 A;  1Q12 A;  2ZM6 L;  1X54 A;  2Z6K A;  4XIG S;  3KLW A;  1WJJ A;  2E8G A;  2Z6K C;  3I4N G;  2WAQ G;  2JA6 H;  1QZH A;  4B3T L;  1K9M C;  1HR0 Q;  3K7U C;  4BBS G;  3H3V H;  1EYG A;  1D7Q A;  4KLK A;  4FDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...