3FRPB

Crystal structure of cobra venom factor, a co-factor for c3- and c5 convertase cvfbb
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
368
structure length
343
Chain Sequence
LNLDITIELPDREVPIRYRINRTVETKLNQDITVTASATMTILTFYNAQVCNKFHLNVSVENIHALMLKICTRYLGEVDSTMTIIDISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHFKILKHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSLNHQERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKTHQYISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEEFQKLCDDFAQFSYTLTEFGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase cofactor
molecule keywords Cobra venom factor alpha chain
publication title The Crystal Structure of Cobra Venom Factor, a Cofactor for C3- and C5-Convertase CVFBb.
pubmed doi rcsb
total genus 59
structure length 343
sequence length 368
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01759 NTR UNC-6/NTR/C345C module
B PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.210.20 Mainly Beta Single Sheet ubp-family deubiquitinating enzyme fold ubp-family deubiquitinating enzyme fold 3frpB01
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3frpB03
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3frpB02
1PXUA 2XWBB 1UEAB 1BUVT 1OO9B 1BR9A 2QKIC 2PN5A 2A73B 5FO9B 3HS0C 2I07B 2B39A 2A74C 4ILWA 3I70A 1BQQT 2WIIB 2WINB 5FO8B 4FXKC 1AYOA 1EDYA 4D94A 3HRZC 1JB3A 3G6JB 5JPMC 3KLSA 3T4AC 4LNVA 3L3OC 1JC7A 2TMPA 3MA2B 1XWEA 2ICEC 3CU7A 5JPNC 1GXDC 2XWJB 2J0TD 5FO7B 3FRPB 3OHXC 3CKIB 5FOBB 1UAPA 3V96A 1D2BA 1BV8A 4FXGC 2E2DC
chains in the Genus database with same CATH superfamily
3GBNL 3ZDYE 4N2OA 2HG0A 2R93H 2AEWA 2VQ1A 2WACA 3JWOL 5KYXB 4Q9QL 4F58H 5D4QA 4B27A 1PD0A 3HZKA 1NWOA 1S8DB 3PO2H 2ODHA 3O4LE 3HPJB 3X14B 5FB8A 3WSQH 4L1BA 2VQFQ 4E9RA 4UM9A 2YKKA 4OCSL 4ZW8A 1NR2A 4A3IB 1KCSL 3VWKB 4MCMA 1OTTC 1VQHA 4NP5A 1WPCA 2FSDA 2W9DH 4AIEA 3HUJE 2OMNA 1K8IB 2Z91A 3PAYA 4ZPTA 5C2BH 4M7KL 1C16B 2DMGA 1XHHA 4ATWA 1DM0B 4DR6Q 3JAML 2B9AA 4B3MQ 2WQSA 5INCA 4F88A 1JWUA 2ARJA 4MDRA 4G71B 1U95A 2PYFB 3SY0B 1VQPA 1U4LA 3EQLC 5EHFA 3S3JA 4APXB 1YYLL 2J21A 4PJFF 4J3OG 4X66L 1AS7A 1NLBH 5K59F 5I6PA 1DQQA 4F7TB 3RPKA 4MNQA 4CNIA 4LF9L 5L4IA 4KD4A 4JL2A 3G5XB 2CKBH 3BAXA 1K4CB 1C12B 2EXYC 3VXQA 5CV8A 3MEFA 2ESVD 4NRXA 5DD6A 1A3LL 2JF1A 2QVIA 3VJ6A 4LFCQ 4QY8A 1QTSA 4ZRGA 1WA0X 4L4VD 4OFIA 4ENED 2WXFA 3HOZH 2E7HA 5EO1A 1QRNA 4GN3B 4PJCA 4NN6B 3CH8A 5BV7L 3MAQA 2IIJA 4GP5B 1AC6A 5DA4A 2X70A 3FSWA 4KHXL 2XXFA 1EJ6A 1EHAA 4P2YA 5KBMA 2GABA 3MRMB 4JO4L 5A2LH 1BGXL 4YFLI 1KNOA 4TL5A 1XF3A 2WQXA 2Y22A 3GT6A 2LU3A 1ETJA 1JZFA 4ODUA 2QPFA 4WGVB 4A55A 1NAPA 3J80E 3DMUA 1NFDB 5LBSH 4PVBA 1TY2A 2X88A 4R5VA 5T1MB 2KT6A 3MLRL 3FT1A 4NN5C 1MCDA 1JHLL 3S36X 1BVNT 3L7EB 2FJSA 3GSXA 1BQKA 4W9EC 3ATEA 4JFWA 4JRYB 4NXNQ 2YQGA 1E6JL 3LHAA 4N2CA 5F9OH 2RHQB 3U83A 3MUZ1 4A3DH 4PUBL 1RCVD 1WS7A 4BY7H 1XB3A 1YJDC 2XG5B 5K9QI 4YGVB 1LO2H 2AQRA 3DMMC 1YC8A 3THML 3ZU8A 3ZOAA 2WLLB 3KPSE 1DLFH 5F44A 4BK5C 3CH1B 5LMNW 4KKLC 5DLMH 1MCIA 4IN3A 3T65B 4MQXC 2JXMA 3MO1A 2H47C 2O61A 4I0CC 3F85A 2DKMA 1QLRA 2IDUA 4XN4A 2CHBD 1BXVA 1CFQB 4NM8H 1G1KA 5FA4B 5I1IL 1S9KC 3B34A 5B3SB 3C12A 5I30L 4AQAA 1YECL 2GTZB 3BKJL 3C09B 1KCVH 5M5XB 1QOHA 1A7PH 2QEJC 2ZM6L 1ZSDB 1R1CA 2HFGH 3MV8D 1B3JA 4H1LG 1WWAX 3A54A 3L48A 4LO9A 1U8KB 6FABL 2JKJA 3O3EA 4JM2B 4WNSA 4NT6A 4JI3Q 5I73C 3NZUA 4I77H 2YGQA 1OGTA 1YEIH 3S2CA 4FLQA 3WFDL 1HZKA 3S17B 1I4HA 1DONA 3QSKB 4L3EE 4P4KB 5D6DC 1FWXA 4GO9A 5AVXB 3ULVH 3AQXA 4HUUA 2EQSA 3MXPA 2J55A 2G5DA 4NUJA 1EQTA 4O9HL 4YDMA 1Z6HA 4DQOH 4JFDE 4N90E 1CXHA 4JFPA 4PRBB 5I5RA 1AKJD 2BX5A 1X55A 2VXVH 4U1LB 3S48A 1T7XA 4P9HC 4XP6H 4WUUB 1KGUA 4LEBA 3OG4B 1PSKH 3QXDA 4IM8A 1O9ZA 2DQDL 2GFBA 3QORC 2MPAL 1FG2A 4HK0A 4MNGB 3FOMA 3PGCB 2FQEA 4ZTEA 4ZMLA 1MF2H 1TTCA 1SEBD 1OQOA 4IRZH 1RPKA 4ZFFA 1TEYA 5DQ9B 5D55A 1FNUA 1BD2B 3P0GB 3PUUA 1AGFA 1RPUA 4OD2A 4GW1B 5J6GB 4PJGE 1T5WA 4MCYB 3IJYB 1I4RA 1JCKB 2XTJE 2Z34A 1L0YA 1CN4A 5HHPA 3VFRA 2YJLA 3D2UB 1JE4A 5EKLA 4Z78B 4YE4L 1XNQL 1H3TA 2QT6A 5DRZB 4KTAA 5EC2A 5C0XH 3D3VA 4IKNA 4AI7A 4GO8A 3L3GA 1SYGA 2D0PA 1I8AA 4GFXA 1FRGH 5DEGA 4OKVB 1MCKA 2BSDA 1A6ZB 4PJIE 3SQOH 3VH8A 1HHJA 2DYPD 3E8UL 3EYVB 2BOBB 4R2GC 4PJFA 4IGBA 2DEYX 4LJZC 5JPMC 4JFEB 2H0JA 1FO0A 4FN0A 2ZKHH 4NWTL 1E8XA 1XGPA 4NQEB 2GSIA 3AB0C 4AL8L 2B1HH 3Q8DA 4GT7A 2AXFA 4X4YB 4P05A 2F53B 2EDRA 3PO2B 2OR9L 3EJSA 5J6HB 2X1XR 3MRKB 2K32A 1KEMH 4WORA 4GKSB 1E8WA 3W11C 4DQAA 1UE7A 4UIMB 3SK4A 3R18A 4W9ZA 3IVKA 2KL6A 4NDMB 2BSCA 1IE4A 1LK2B 1TT2A 4A93H 1HA6A 1EAPB 2ED7A 5HGDA 3I02A 3BDLA 2BOLA 3K0XA 3EBHA 4Y5XC 4DP0X 3KF8B 1U8JA 3JAMi 3GIVA 2JA7H 1HQRB 1PYSB 3U9WA 1I75A 4M6AA 4Y9FA 4OZIF 5FFLA 4KUCD 3IT8D 3ARXA 3R4RA 2WB1E 4X5XB 2P45B 5LCVA 5HPMA 2A6IB 4TPRH 4TSAH 4WV1C 4APVA 2WO3B 1C4QA 1EAOA 2B2UA 4PS7A 5DS2A 4N3UA 3ONAB 2OMYB 1SNPA 4E0RB 2CKBB 3G5ZB 5DD5H 1GM5A 4E68A 5D5MB 1ZWIB 1BUVT 4KTEL 3QULA 1SMYD 4OIIL 1PD1A 1JE6A 1H0DA 1PRTC 4ILWA 2D4FA 3Q7JA 2V9UA 3BWUC 4CKVX 4DKTA 3CIQA 5C0DA 3ZQWA 5IHBA 1IQDB 1L1OB 3KJOA 4YHHQ 1PZ3A 3GXFA 4NZJA 3FQXA 5D1XE 3SHSA 4X5PA 4DETA 2L11A 3FT2A 1LUZA 4WJ3M 3CV5A 1DOKA 5EOTB 5FECB 3NWTA 4LLQB 1HHIB 1TT6A 1U58A 3ECWA 1E4WL 2RB8A 3LZOA 3IMBA 4YHYB 4UDUC 3BN9D 2CUMA 5F7FA 1S7VA 5IFHH 2BWIA 3HFML 5JHLL 1J0HA 1IFHL 1USQA 4TKOB 4KROB 3HUJB 3QUYC 1HSBB 1OCWH 4LSTL 3RVTC 5I1EH 3SE8L 2VLJD 4APQD 3EH1A 4FS0A 3MJ7A 5ANHA 4Y2NA 2P8PA 4W93A 4F2MB 1OAKL 3EG9B 3S98A 3X3MA 2FO8A 4A3DB 3Q6FB 2Z8WC 1ILPA 2J8UE 4GNKB 1ND0B 1G7IB 1PZBA 3P2TA 4R4ND 5KVFL 3N06B 2FJ2A 4C54A 4RDQF 3MA7B 1RFDL 3JT2A 1T9HA 2VERA 3MR9A 4IRSB 4JPVL 5DFTA 3TURA 1EHLL 5K69A 5ICYB 1Y8OB 1CGTA 5INDA 4G8EB 3IN2A 5HVHC 2BINA 2F0NA 3LGJA 4ZK8A 2QPUA 1EWCA 3BH8A 1K9MC 3LNDA 4YN3A 4RCOA 2A73B 4QTFA 5JAVA 2HHHQ 2H1PH 3S5LB 1BLNA 4P9ML 5FYJU 1XR9B 3CRKC 43C9B 5I76B 5AZ2L 4JY4B 2C1PB 3EAKA 1HXMB 5GAEC 3E6HB 3FQUA 3ULSA 1A9BB 3UIYA 2B1AH 5B39A 4JI4L 4LAQH 4PRNA 5F3BB 4FQIH 1AZBA 5C0RL 1YZZA 3TV8A 3TT3H 5L8LB 4HZLA 1E9PB 2NNAA 1JZGA 2D9CA 1DZ1A 1GHFL 1QBLL 3RWCA 4OIKA 2CWAA 2NZHA 2CCWA 4CGTA 4NCDA 2MP1A 3O6FA 4UAHA 2NOYA 4Q7DA 5T5FL 4U1MB 5C07E 4GO6B 5E9DA 4KOBA 2MCAA 3RVXC 1E67A 3KM1A 1UCBH 3RWGA 2DMBA 2XPGB 1MZYA 3N40F 1EZVX 2BXZA 3MRBB 3OPOA 3PJSA 3U6RA 3M9BA 3G5YB 3NFPA 5KSVA 5CV5A 2HG5A 4HKXB 1XGZA 3IPFA 1E22A 4KZDL 3Q24A 2QADD 5CCKL 5EO0A 5EB9A 3BPOC 2C34A 4ZFOL 5I8OL 3JWNC 1S5DD 3FBKA 4A7TA 5KVGE 1IRAY 3FO0H 2W07B 3JV4B 2EDHA 2YZ8A 1FL6A 1CGSH 1Z5LA 3KPSB 4JPIA 4CRPA 3ULLA 1RIVH 3BZFB 3QG7L 2XIBA 4MA3A 1XGRB 4Q9RH 4LOEA 2BNRA 2UXTA 3UZQB 2P8MB 5JUEH 2GJ6B 3HOUB 5SX5K 2XHNA 3ZHNA 4HT1L 4DR3Q 3D0VB 2F0JA 3GMQA 1A4KB 3CQPA 3QQ3A 2B3RA 3MNVB 1TVHB 4RAVB 2KHJA 2VR3A 4JMNA 4YXKH 1HHKA 1TZGL 4OZIA 4QRRD 4UT7L 4P23C 2JNZA 3I4MH 3MXGA 2TAAA 3APNA 1J6QA 3JV6A 3BU2A 4GS7B 3S1NH 5DLLA 4YSPA 3SJVD 2EAEA 4IFDG 2E5LQ 2HH0L 5BVPL 5L8JB 3PWPE 3PREA 1WD1A 3T8XA 3ULVC 2BNQE 3URYA 3RAJH 4JHVA 4PD4J 1YNJC 4XN1A 4D0DB 1XTMA 5KYUA 2XV6B 4OCXH 2Z8LA 2OMVB 2FLMA 5CJ5A 4EXKA 5KVEE 3RVWC 2PNDA 4LUVA 4X3UA 2BHZA 2L12A 2EPBA 2Q2LA 4IFDI 1UCTA 3GYRA 4V1DA 2AABL 2Y7LA 3QO0B 4OLYH 3HE7A 2YKLH 1JRHI 3CFIC 4FRWA 4RDBA 4Z7VF 1OAUL 3JT0A 2ZKXA 4OLWL 1W0WA 4R7LA 1H9SB 3H0TA 2FEDD 4WNQB 5F1SA 4ZMWA 4OZFH 3UH8A 2EDGA 2IH8A 3K57A 4E9WA 4KK9C 5BS0A 1QUQB 4D0CB 1VCBC 2EY1A 1L9OA 3BPCB 1IBGL 1M1XA 2EDYA 1EUTA 5ES4B 1XPUA 4H26B 3NAAL 4Y8DC 4UOQA 4CW1B 2O1AA 2UUDH 5FYLD 2CDFB 5HJ3A 1H5BB 1U8IA 3NABL 2YRPA 1FC2D 4A3CH 3VXUB 1FNHA 4NHCH 3RWEB 1UD2A 2NXYD 2EJFC 4WFGD 5DC4B 4MB5A 2OZ4L 1SNMA 3BZ5A 2A99A 3QDMA 3B5HA 4YY3Q 4TULH 4XE5B 2HVKB 4NO5A 4KQ0A 4PV1C 3FUEA 2PPDA 3SOBL 4DV1Q 1GVIA 4FABL 4B3SQ 3G5VB 4ZMPA 4HH8A 3O13A 4LHUA 2ZNWA 2N7SA 3QAQA 4LP5A 2QILA 4YQXL 2N3SA 4G9FD 3ZN6A 5FGBC 3K80A 5E03A 4UP9A 3QFJA 3O8XB 5L8KB 5M3MG 4G7RB 3UG3A 2VM3A 3ZDWA 4D9LH 5JLZA 3WHE0 3ISWA 4HEPA 1IVTA 1EIYB 1YMMA 5HDBB 3HZMB 2BP0B 3M8OH 4AENB 4RWYL 4KO7A 5J5EA 2ZJSL 1YYMH 3WUWB 4J3VA 1F4HA 3LH2L 3C60B 1INEH 3GTKH 1A7NL 4HHWA 4UOZA 2Z7YA 1YJNA 3GSNA 5D7LE 2ZTEA 1ASYA 2X69A 1KUMA 4MZ9A 3P4NA 1NICA 4X6DF 1ZLVK 1HINH 4EIBA 2ALYB 4KJYB 2R3ZA 1QNZH 3M4YA 3QNYA 3OB0K 3EBEA 4GJTB 3W5OA 5L4FA 1VS0A 1A5FL 4U1HA 3DLLA 4P48A 5EQ0A 2WOBA 3BQUD 5LGHL 1DUYA 2CIKB 1NGXB 3RQ3A 3UG5A 3BE1H 1SHXA 2MHAA 1MPAH 3BGMB 3EYFA 2EO7A 3K2IA 3UDWC 4AITA 2XDHA 2UXBL 3HMXH 3T1HQ 3P3YA 5ERWB 3BVUA 3MLTA 4QHLA 5AW7B 5IESH 4LLMB 3IFOB 4DN4H 3GO1H 3SDZA 4I3GA 4ZTPH 5I0WA 2DQTL 3QXAA 1CXKA 5D1XB 3G6DH 1HI6A 5DJXB 1KN4L 3DTDA 2EO1A 3US1A 3KL0A 3ETBF 3QDJE 5HHXH 2EP6A 4RMBA 4RCAA 3NT0A 5DURD 4NKDA 4DR7Q 2CZNA 3B1TA 3HC3L 4LZKA 1J9TA 2CD0A 4LIQH 4Y0GA 1JGUL 1KT2B 2EXWC 4KXZI 5AYUL 1BG9A 1DBKH 1YDPB 2BC4A 4DK6C 3ZZQA 4AZ8A 4AUYA 3KJ6H 5DO2C 1L6ZA 2C7FA 3UYRL 5BRZE 2MWCA 5LXGH 2VAAA 1RSYA 5C9JB 5IUSA 4TL4A 1FV1A 3SKOA 5AOLA 2CLRA 3ZE0B 5HVWA 1CR9L 1MHPH 4GBXD 3ZJYC 1SEQH 1A6UL 1OGSA 1E28A 3AXLA 4PJ5E 4NKLA 3TEWA 5AUMB 1VKXA 4GNXB 1QHQA 4W4NA 5JMRA 5LJYH 4H44C 4LSDA 1BWWA 4FADA 2VNUD 4TOYH 4KRPB 1AHMA 3F2UA 3ECBB 4CMHC 2FT7A 5FW8A 4OGYL 1FVEB 1QUNA 4KFMA 2G2NA 1N64L 4FZEH 3UERA 3V0EA 2OLDA 3CQFA 4U1KB 1NAMA 3DVNB 5I0DA 3FUJA 1QBAA 3HNTL 2IAMA 3IU4H 4UUJB 5D7KE 5T5NG 5F7HA 3P30H 4JJ5B 4PV8B 4YDLB 3F83A 2W9EH 4PLOB 4LVOB 3H7BB 4D0BA 2CRYA 4MGXA 2R1XA 1OF0A 3OZ9L 3RY6C 3WLBA 5F2DA 4YK4C 2TSAA 4QXGH 3ZDXF 1YITA 2WP3O 3VGAC 4WI8A 4Z7VA 2AJXL 3OTTA 4N6QA 3U4EA 2QMJA 3M1BA 1RZGB 2A9CA 3I4MB 3BSHA 1Z9OA 1H9VA 3OLGA 4R84A 4UB0H 1BHGA 1D7BA 2H41A 3ASWA 1GXDC 4OD3H 4AC2A 4JFVA 1KLFB 4QNPE 4Z7AA 1JHTA 1FZOB 4X6CF 1A6WL 4LK4A 2WUCH 2NVQH 3H3PL 4FLRA 1HYSD 1OXUA 4M8AA 1TXKA 2NUCA 4YHKL 3NEMA 3NJVA 1JPST 4PLKC 3WDIA 4NZFA 1QABA 4Y16B 1OARL 3PDGA 4H8QA 2VC2B 2NY7H 3EO9H 7PCYA 1ESFA 2B2YA 2E2JB 4ZS6C 1LDPL 4Q58C 2X05A 1AKJB 1OOAA 1YQ2A 2PW5A 5E2UH 5KAQG 1V55B 3F6LA 1KLGD 5HY6A 2IBZX 2KQNA 4UV4H 4OZFB 3BVNB 5IW1A 4CN4A 4J3TA 1HNGA 1MFCL 5I2IB 3BDXA 3DUSA 1SEBB 1L5GB 4FG6C 2AJYH 1B4JH 1F18A 3KZ8A 2OX5A 5D14A 2CHNA 2V33A 3W9DB 5ALBH 5IJKC 3KJPA 4LFHG 2NDGA 3QQDB 3HKZG 3B8SA 3CCQA 2NLJA 1CK1A 5F7AA 1S4IA 3BVMA 2EIMB 3IRCA 3AQQA 1DUZB 4O5LH 4X6DA 1E9QA 2PZTA 5AVVB 5EO9B 3TCLA 1I4GA 1N6UA 5D1ZD 4C4UA 1JZ3A 2BVOA 2V9QA 4N0FA 4TVPD 1S9WA 3IFDA 3MBXL 2FWSA 3MLUL 3I4NG 5GQOA 1A22B 4AYGA 4UNVA 1A02N 2DQCL 1T0MB 1YEGH 3KJ4B 3NCMA 4BH7A 4WY7L 1GZHC 4I13B 1IGML 3FO9A 3N41F 2AEOA 3JVGC 1V9PA 4NJ9L 1HH9A 5T8IA 3EYUH 1ZHBA 2AK4A 2DTMH 3QFGA 5B38A 1HSAB 3S37H 4JRWA 3FQRB 4P2QB 4HF5H 4OFVA 4P2OC 1GC1H 2YD8A 1D5XB 1R3LB 4LPYA 4A6YL 2DMKA 1ZMYA 2WLKA 3ABKB 1FGVL 2ZX5A 3N85H 1GGUA 4FKHA 4R90H 1FFPB 3ARYA 2AJUL 2CJUL 2ZCHH 2F7PA 2ADIB 3BIKA 2LXKA 3B1UA 4ICWA 1JRHL 5AW3B 4HH9B 1KJ2A 2HIVA 2HCCA 4PCKA 4OUUB 2F4VQ 3IK2A 4DUZL 1LXMA 3UTSD 2F15A 2D03L 4A3KH 5EMYA 2P5EE 5JHBA 3MRIB 1EGJA 1T4KA 1PCSA 2H2PD 3AS1A 1AIFB 1IAKA 3MLWH 4IO9A 1X5GA 1Z9SB 2F7RA 2EY5A 1BJ1J 4IZ8A 4AM0A 1RPQA 3MV9E 3W0WA 1MHHA 5HDQL 1BF8A 2E2IB 3UZVB 4ABVA 5CBAB 6CGTA 5FYLH 3VTTA 3DX6B 2W60B 5ECGA 1YEKH 2JCCE 4MS8D 5IGXL 4JW3A 1CE1L 1QFUH 4MBOA 4AKQA 5K1NA 1HHVA 2B2TC 1MJ8H 2D7NA 2AGJL 3BWAB 3LVTA 5IP7G 4Z7UB 1NUGA 1NFAA 1NOFA 1XAUA 3J7AF 3K74B 3RPIB 5I1DA 3PV6B 3WFEL 1UWVA 2B39A 3IAYA 3EGDB 3UJTH 4QRPA 1JN6A 2VXSH 1UH3A 4KTDL 4AMWA 4U0QB 3V52L 4L8JA 5IYBG 1CQVA 4FD0A 3UTTA 4QCLA 3MUGB 1P9MA 3C5ZA 3WWVA 2Q5BA 5JHMA 1UT9A 2AWOA 4XMKH 5CR8A 3UYPB 2V9TA 1BCPF 5D7LB 2KQ3A 4IUUA 2EDQA 1K4DB 4NENB 3DSFL 5EA0L 1SJEA 4I48B 3ARGA 3BZ4A 3K8AA 2A6DB 4WGWB 3GUTB 4UT9A 5IMKA 4YZWA 4JFSA 3NIDF 1NBYB 3VI4E 4X6CA 5D72H 3DDFA 4XPHL 1NEZB 5TGBA 3WL9A 4HW6A 1CDCA 1WC7B 1YHBA 2XG4B 2ICES 2LVCA 3PGFL 3EN2A 4ALPA 4B9IA 3E1F1 1DBML 1PYWD 2BP3A 1MCLA 2IXQB 1M6OA 5E24E 1NJIC 4G1MA 2QDLA 5PCYA 5IREA 4FMKA 1EWHA 1UC6A 3EOTL 1FBIL 1O7LA 2NVYH 1E3XA 3BKCH 3I6LE 1QP1A 1A7QL 1TETH 5KSBE 3IMTA 5C2UB 3GI9H 5CSZA 3UEZA 4EI6B 1UVQB 4AEIH 1OM3H 2DWSA 4N0CD 4LEOB 1JDDA 5HHOA 3ECVA 3GSWB 2OULB 4PZ8A 1SMYC 3QZOA 3RDTC 4XPGL 1MNUL 1NCAH 1Q9KB 4OZGB 3QRLA 4M62H 4K55A 4ZODA 4V33A 5DR5L 1UADC 3KDPB 5IBUB 3DWAA 3QAZB 4KPHH 4NNPH 4Z76B 1CD0A 1JMZA 1LEIB 2EEXA 2Z4HA 1ZDSA 2D3LA 1A2YA 4PY7A 3MN8A 3TA3C 3S2HH 1U8NB 1AHWC 3CXDH 5BQ7B 4RZCB 5BRZB 5DHYB 3WNMA 2DDQH 4TYUA 5CMAB 5FYKD 1QFOA 4UANA 3BAIA 2YHGA 1EAQA 3BN9C 3VD5A 3ZHDA 3JAME 3AITA 4JRLA 3QWNA 1HEJC 1A3ZA 1YJWA 4G72B 1TEGA 4D9RD 5BZZA 5DUML 2XQYK 2BM3A 2ZCZA 4K2UL 1FNAA 1ZT1B 4TTDD 4CKQA 5EDXA 4GI6A 1ILQA 1KTCA 3GV6A 4Q2ZA 1RERA 3T0WA 1MSGA 4AJ0A 3KL5A 3PDOA 4APQC 4FTVE 4U3XA 1FNEA 2QADB 4G43A 4A3EB 3CLWA 3FU7B 1TVBB 2YQBA 3NSCA 3ZSSA 4R7DB 2ZCKH 5I8CB 3DRTA 1AQKL 5KWYC 4R4NC 3QRFM 5C08E 3E6FA 2L4NA 3P54A 3V0VB 4EOWH 4FEIA 4R0LA 5DK3A 5DGQA 4OZHF 1HR0W 5DZAA 1QI3A 1R3IL 2CLVA 3W37A 3I90A 4U6XA 4F1SA 1PEZA 5C09A 3BJ91 5MERB 1PV4A 5EPKA 4Y1TA 4DKEH 3R8QA 2PQAB 5FO2A 3FCTB 1S9VA 4OJDH 3UTPD 3TH4T 5C3TA 3MV7E 4HHAB 1BVOA 5F0LB 1XX9C 1SYEA 4DU9A 1EUUA 1KGCD 2J8HA 1WAAE 4OF0A 1E30A 2WLYA 2FTAA 1R3HA 3LXBA 1NMBL 1JDCA 3EGSA 3H53A 4GRMB 4JO5A 4K8RC 1DQDH 3S3CB 3RU8L 3EYQD 3SJVB 4MIUA 2HIXA 3GTLH 5LL6X 1CYXA 4O2FA 4GMSL 4XNYL 3D0LB 5ELIA 1ZV5A 3WY1A 1P7QD 4HCFA 1QLFA 4U1JB 4K2KA 1U41A 4BZ2L 4MA1C 4QYOB 3U9PH 1ASZA 1LTTD 1BZ7A 3OD3A 3S37X 5J1ZA 3TH3T 3VDBA 1KPUA 1T7VA 3EYOA 2K01A 5ANMA 2F6AA 4IKLA 5I8EA 4WGKA 4JGMA 2WBJD 3QWRA 3V0JA 2QADC 2D3JA 3ATDA 1BSIA 2MHVA 2H26B 3FCSB 5TF0A 3HC0A 3FQ1A 5HI5D 2X6UA 5IQLA 1XH3B 4EI0A 5ILTH 4IJ3B 2V1CC 1B9MA 2EE9A 3BCFA 1QVGA 1TJIL 3IMRA 4RNRA 1Q1EA 4R4BB 4UBDD 5MEPB 4GKLA 3RUGB 2UZIL 3ZW3A 2EXZA 1O78A 2Z64C 1N2RA 2JSOA 3H94A 2NSMA 3TO2A 4LF5L 4ELMF 2B59A 4E9QA 3TASA 3U36A 4G1EB 1TKWA 5H94B 1KELH 1FFRA 3BAJA 2X4UA 4ZMNA 2NXYB 4P2RB 4G8GB 4RFOH 3WNKA 5DS8B 5EIIA 1XGQB 1BZ9B 4U1NA 1MCJA 4MZ2A 4MXQC 5IBTH 1JC7A 3MCLL 3RR5A 5C0CB 5CF3A 3T56B 3R3OA 3LNEA 4NC2B 4PTUA 2LTQC 1SLVA 3DM1A 3PS6A 4TVPH 2FX9H 5DHDA 3NIGE 4XP4L 3RTQA 4YXHH 3CX5K 3OF6D 4A2LA 3L9EA 4YHLH 3GTMH 3NZ8A 4DUWA 4DK3C 4MNHA 5IF0B 3K2UL 4FAAB 4G9FB 5JXAH 4LF4L 2CGYA 4G7VL 5D2NC 2IFFH 1UZGA 2DMCA 2AJVL 2E6JA 3LSOB 5E99H 2YPLA 5SWZA 3TWCL 3QJOA 2VDQB 1KYOK 4PUBH 5L4MA 1TWCH 2V5RA 2JP1A 1MEXH 4FFYH 4X62Q 3UYOD 4IPGA 5B4MD 2F0SA 4HPOL 1OHQA 1EEZA 3LQAL 4OJFL 1X5JA 2VR9A 1A3QA 3EHBC 2VZ1A 1BW8A 1ZT4A 2YBRA 2PXYB 5E2TL 1Z47A 2HQLA 5JOBA 3BZKA 1A9EB 1U3HB 4KK7A 3WIFB 1P6FA 5CR3A 4LQFH 4ZUWA 1F11B 2PYEB 4TVAB 4UMGA 2XN9D 3NEXA 2JB6B 2PW1B 4KHZA 3EFOB 4A3JH 1RZQA 3BYTB 4WUKL 4ZX6A 2EDJA 1NCJA 2P5EB 2B29A 3D4DA 1BM3L 1IAII 2VSMB 1NIBA 1PFOA 2XRQD 1XH1A 2H2SD 2FB4L 2VQEQ 3ZXAC 3O0LA 3BQUB 1FO0L 1N5AA 4ZS7L 4KKUA 8FABB 3MV9B 3MCKB 4OKDA 1G1OA 3BPLC 4N2AA 3UDXA 2KPNA 3MUJA 3QEUB 2F3WA 2AK1L 2Q9OA 5E4AA 1UUNA 3QCUL 4B6ZA 2JA8H 1KBGH 2NXYC 2QQNH 3U2JA 2IGTA 1DSFH 4G6JL 5KOMC 4X5WA 2A4ZA 5IB5B 1OSZA 3HZVB 2Q8RE 1AZZC 4N1EA 1PKQE 1UACL 4IMLA 4NO0D 5JXEA 4OT1L 6PAZA 2FNBA 2F8XC 3SEBA 3S2HB 4OZHA 1RUKL 4MXVE 4NFDA 3UE0A 2VH5L 3VD9A 3MNWA 5LCVL 4B0MM 5EKKA 1DQJA 3LNHA 1IFRA 4RFNB 1Q8KA 1ZEAL 3VA7A 3QHZH 2GC7C 3IDNA 5LGJA 1RK1A 5IMLA 4NPYA 1CHPD 5CJOH 3UJJL 3OR7B 1QATA 5F1IA 1SZNA 1EFQA 2I07A 3QUMB 4RHSA 3L3DA 3GLDA 2CNYA 3Q22A 1XZ0A 1CFMA 3ARSA 1S9YA 4GQ9L 2QKSA 4IOFD 3NK4A 1TO4A 2APBA 4OZ4A 4ANKA 4IOSD 3ZMEA 2FH8A 2A77H 2Q8IB 1VIWA 1KEGL 2V9RA 3LXAA 1ZTXH 3HR5A 4KQ4L 3QZWB 1S3RA 3WTSA 1RJLA 4F3FB 2AV7B 4A7SA 4P73A 4MTNA 4F7PB 1BAWA 2XRAH 3R4DA 3LQZB 1OW0C 4ZUJA 3RL1B 1UWGL 1NTGA 2WXOA 4FQQA 4KKRA 4XMTA 4GXUN 3BLPX 3CX5J 5C0AB 1BAFL 4FERA 5I1CL 1F2ZA 3Q23A 1E8ZA 2RDFA 3CMEA 4IEFB 3FT4A 2VDOL 2Y7SA 5D3IB 4L48A 4NUPA 5FX3A 1CPUA 2XX1A 5HYQA 2WGNB 2DBJA 3L5WB 4Q14A 5J6SA 4CL7A 3RA7L 3WJMA 1GGIL 1GUOA 3NH7L 5CD3B 1J11A 4DW2L 1MCRA 1GAFL 4JZJB 1ZV2A 2OR9H 1PH9A 5FR3A 3ZYIA 2CFMA 3ULAB 2Q2HA 2F03A 1LLAA 2P1YA 3AG1B 4LCCB 1MJCA 2D31A 2E5EA 3RBSA 3O4LD 2FT6A 3EF4A 2UUAQ 1CVSC 5I1KH 1NLDL 2R4RL 2VSCA 4DR5L 5BZDB 5EF1A 1PG7L 2YGOA 4ELMA 4X5LA 1RJTA 3NJJA 2K7QA 4MD5A 1SFOB 1UXSB 4RRPA 4TLKA 1WRFA 1VQOA 4XCYA 4LDLB 5GS2D 3T2PA 1E6OH 1OE3A 3B2VL 1MH5A 3HN8A 5IYCH 1B4OA 4IYKA 4GBXC 3KYMA 1Z3GL 3GMOA 4HIHB 5CLZA 1ICWA 5TK4A 3M17B 5A7EA 2VUOA 4IU3B 2BHUA 5D93C 3MLVH 3ZL2A 3CFCH 4M6MH 4MYWB 3BWZA 4I4WA 3ZUNC 4F5CA 5JNYA 3VR3A 5I18H 3Q05A 5CFHA 1UJ3A 3I91A 5IIEA 5C9KA 1DVQA 1K8AC 2COVD 1LJMA 4FYQA 4TLTA 4U0RC 4BSVB 3A74A 1TZIA 5HYSG 2R69H 5BV7B 1NMCB 5E8PB 4PY8I 4NAMA 1VFAA 5EUOF 1QZ1A 1D5IL 2AJ3A 4XYQA 1HKFA 1ZXKA 4N0RA 4ERSL 2WKGA 2BFVH 4Y4FD 5ITBL 1S7WA 2E9GA 2CAKA 3B83A 3DX0A 1CZWA 1C5BH 4FC3E 3VCLB 4WWKD 1P5UA 5D1ZB 5F8QC 4DAYB 1CFTA 1ZDQA 3L5HA 5ICXB 3V5HB 3V6ZA 5BXFA 1B2WL 3HKFA 4WENB 4M7LH 4Z1PA 2MQCA 3ETSA 3QISA 1HWGB 2IV9A 4MAUH 1NSNH 4LSTH 1STHA 4MWFB 2E6PA 2LHAA 4EN3D 3UC0H 3NCJL 5JEAH 1P2CA 4JDEB 3UFIA 2NN6H 1HN1A 4J27A 4C56A 1HYSC 4FP8H 2I9LB 4WFED 3WHXA 1BWMA 5IY5B 5IT9L 4JPKH 4S3SA 2E2HH 4FXGC 4TV3A 2O6EA 3U0TA 1I9IH 4EIGB 2F2HA 5EZLB 3WKML 1SBSH 4BXVA 3CPLB 2D7MA 3L4ZA 3JZYA 2R0WH 5H35A 3I6KA 3D2TA 2NW3B 4IOAA 1CKOA 4LPTA 2OXPA 5EU4B 4ZDHB 3A3YB 4A3JB 5E1IA 4ZUVA 3ZTEA 1I3QH 3HW7A 1WA2X 4MZIA 1F3JA 2WLNA 1KBWA 2F0GA 2KA7A 3VFWA 1MFBH 4AJWA 4MJ5A 3UTSB 1Q9LB 4QRFA 3ZTDC 3HN5A 2ZF9A 1KPRB 2DEXX 1NIAA 5C3LD 5EEVA 1UWEH 3D4RA 4HS3A 4K8JA 3NN8B 4AGOA 5CEYB 1O6TA 5D1QA 1FE8L 4NWUH 2JA8B 4MD0A 5CP7A 4LT7A 3SKNA 3ZDZE 3VFUA 1CD1A 2JQZA 2P28B 4PRAB 4KI5E 1QBMH 1IW7C 2C4FU 3OW7A 1EEQA 3TL5A 1XL4A 4N1CA 4DF9A 4A68A 3GKWH 4IKIA 4QUOA 4X98A 4L3ED 4AVIA 1KJ3H 1NCHA 4I2XA 1L0WA 1ZRUA 2J7LA 1SBBA 1JZDC 4GYBA 1XF2B 4JFDD 1TZ8A 3FAXA 4M43H 4XPBH 2X53A 2VUKA 2VWEE 5EV7A 3V4UL 2EYLA 4J3SA 2P43B 3IU3B 4HCRA 4Z95L 1AR1C 1OGPA 1J8IA 3BJLA 2Q8TA 4X2UA 1G2TA 3GTJB 4X0NA 3OKNB 3SDCA 3ULUF 1U8CB 4FJYA 4Y52H 4HAGA 2JI2A 4ID6A 1OANA 3ESVF 5DJYA 1MVUB 4PB9H 4PWJA 5D9SA 5GSRA 5T3XD 4APQB 5JHDE 2DLIA 3RVVD 4P59L 4R3SA 2E6QA 2NXZD 3Q2NA 3G6JF 1W0VA 5EZPA 3WFBH 1VADA 2R7ZH 4JV5Q 2PTTA 2X1OA 3P0VH 4M93C 3QH3B 3L9AX 2XTJD 2PW2A 2XYCA 3MV11 5CUSL 5GZND 3WEXA 4L1TA 4X0KB 3SN6N 4UOW0 4HIEA 4M6NL 1N36L 2C1OB 2WXHA 4ZQTA 1ZTMA 5C3EB 1IAIL 1VQ6A 2WV6D 4R9WA 1TLMA 2G3XA 1QI5A 2A6JA 3NQTA 3KR3L 2FD6L 2IBBA 3CUPA 3QUZC 1WUNT 2EYTA 4UT7H 2H2PC 3O2WH 4NM4H 1MD2D 3BVDB 4HQQL 4WZ9A 5I19H 1SLXA 2WNGA 3CPWA 1B0RA 3KUPA 2HTLC 1E0BA 4MVBD 3MU3A 2HH0H 3GSNL 4KMQA 4QR7A 3QDGE 4PJAB 5DFAA 1BPVA 3OIPA 2X7LB 4MS8C 3BT2H 2MOVA 2FX8L 2WUBL 1RUQH 2Q6WA 4UQ2A 4IBQA 4LCWA 4C55A 4LKCB 4C4BA 2ZJRA 1UD8A 3ZO0A 3UZEA 3FT0A 3S3BB 3HG5A 3MQIA 4YHMH 4JRXE 1D7QA 5GISH 3Q2CA 1NL0H 3AGWA 2DZEA 4HIXH 1MSHA 1AJ7H 2OQKA 5EUOA 2FGWH 4EQ5A 3GNMH 3OKMA 4XNAA 3R8BA 4WHDA 3VYRA 3K6SB 4MJ6B 4HULB 5LMNL 1XGTA 4M5XA 2GI7A 2F8VA 2IH3A 1MELA 4WAFA 1VSCA 2DI7A 1MWAL 1YEJL 4NQVB 2VZ3A 3H9SE 2GBAA 3UPAA 1W72A 1KTKE 1SJHA 1S7XB 4CADB 3M45A 2HJKB 3SKJH 4XX1E 1LTID 2F4IA 1NBZB 5EUKA 1FVCB 5IWAQ 1G94A 2YOAA 1TPXC 1KGYE 2M83A 4KH2A 4TQIA 1PIGA 3K6OA 4BCXA 1ID2A 1U8LB 3QDHA 5I24A 1NFDF 1QACA 2EDOA 3DUHA 1GRWA 1I7UA 3MLSH 3J7ZC 3GJEB 4GINA 1E4KA 3ER0A 1IKNA 3SE0A 1BMZA 4ODXA 4NOBA 1DQLL 2XTSA 3MRQA 2I5MX 4JDZA 4I7AA 1OHZA 1DQTA 4FQCH 4N0CC 4Y19E 4WHTB 3FB8B 2UZXB 4Z5RB 3AREB 3P9MB 4U7MA 1AD0A 2W94A 4ONFL 4Z3TA 4NBYB 3KLKA 3MRNB 1BECA 4Y5YB 1OV8A 4YNYB 3V0FA 3L2PA 1P4IH 2FL5A 1ED3A 4KXBA 1W80A 1NAML 5I9QC 1TYEB 1T03L 1ILSA 5CFAA 2FO4A 3C2AL 2PR9A 3F62A 3I2CL 4OB5H 3UTQA 4TRPL 3ETTA 2QQQA 1XGUB 2IWKA 1P7QB 4N8VB 4LSVL 2QDWA 4G6FD 1Y1VH 4A3FH 4FL4B 5E2VL 5I8KL 5GS2H 2YU9H 1QSFA 4KVCL 2BOSA 1B90A 4JHBA 4K71B 4RQQA 5ISZE 2LLGA 1I3QB 3C1FA 2WPGA 3Q44A 2AQQA 3VFVA 5IROD 4P72A 5B8CB 3NCCB 4LFBQ 1BQSA 2YO3A 5IG7A 2ZX6A 2K5HA 3QG1A 1QUPA 4JGJA 3UPCA 4FG4A 3V0GA 4RFEB 2WN2A 1EWIA 2BS9A 3CJJA 3TJEL 3CN3A 2YWYA 2CA4A 5BMFL 4RMWA 3OVUB 4RBPH 5DJ8A 5J1TC 2IPTL 3WJJC 1CD8A 1E24A 5SWSD 3T0EE 3MRPB 4ZMVA 2DJSA 5ETUA 2QGQA 4MSWB 4XB7A 5D7HA 2O5IC 4B96A 4BDVA 5M5YH 3TM6A 5KYYA 2FBRA 3G6JA 1JGUH 2NY3D 4HSCX 4H8WC 1T2XA 5G5DA 1S7QB 2HLAA 4JDVA 4BZ1H 1JPSH 2UY7B 3MTXA 2BY2A 2ZYHA 5I16B 4MYPA 4WTXA 4DP2X 3KWVA 2XA8L 3WELA 2CCZA 2XN0A 2HJLB 4UINH 1T1YB 1EY9A 1MDTA 5KYXA 2DBLL 1S9XB 2EIDA 1JHKH 1Q8MA 5IEHB 1G8ZD 3LRMA 3X14A 5IR1B 3HPJA 1Z5HA 5DRWA 1DTUA 5EC1A 1TQCB 1C8PA 2YAMA 2C9OA 3ND9A 2H3XC 3CBJB 4A2GA 1ZD6A 2F0DA 2L7EA 3S97C 1K8IA 1JWMA 3DX7B 4YDIH 2HJFA 1B2YA 2Q7AA 1THAA 3BWUF 4IK7A 4NI6A 3HNTH 2IPKA 3BEWA 1E9OB 1RZ8B 5IB1A 3Q5YA 4P46C 5MENE 1LABA 1VZIA 1OXXK 2CHXA 5DD1L 2R7ZB 2F54B 2QBWA 3LY6A 2H3KA 2M26A 4JFOB 4HDIB 2VZSA 1NM4A 4N2BA 3HOYG 1TS5A 3RWJA 1UEMA 5DJCB 4KO5A 2XN9B 1BJ8A 2XZAH 2WBJC 4LSRL 1EQQA 4J39A 1XGYH 4O00A 1GKOA 5D7IF 2XQBH 1MIML 1WWBX 2ATPA 2BSRB 5J7CC 2X6VA 2D7PA 3KF6A 1GYVA 4B9JA 5HI5C 3KWXA 1PH3A 4LOUD 1DXMA 5DJDB 2NUTA 2FECI 3PXLA 1OSPL 3FFDA 3VQMA 4AYDC 1QO3B 1W9XA 3ZDZB 2DY2A 2O5XH 5J56B 4GEJA 1MLBA 3NFSL 4ALAL 3DXAA 1MFDH 4JI1L 5I2XA 4NKIH 5C6TL 3H3PH 2QEJA 2E8GA 3CQZH 2AS5M 5F9JA 5BO0D 1AFVL 2MO1A 3T3PF 1PH4A 3VXPB 3I70A 5GIRA 3UBGA 2APWA 2BRRL 2NNRA 3BGFC 4GAGL 4HXBL 3J81c 3PWPD 4AJVA 3B56A 2RMNA 2BNQD 1RVFH 1GHJA 1KJ2L 2PP8A 2VJ8A 3IFLL 5F6HJ 4UP7A 4R4CA 2VMEA 5D6DA 4HLZH 1QTYT 1X44A 2VW4A 4DPRA 2BPBA 3HKSA 2Z7UA 3VI3E 2R7EB 1NFDA 2F1ZA 3VB9A 4RKBA 1JZHA 3LX9A 1EGJL 5T1MA 3IKCB 3W39A 4EXPX 4F15C 1V7NL 4BBRH 5FHAL 4PCSA 4ABUA 3VFSB 5D5MF 2FJHB 3TJHD 1T66D 3C9NB 1SY6A 1WLHA 4LLDA 5JHDB 1OP5H 5I66A 4C2MB 1IGYA 4JRYA 1HZHL 1FN4B 4RGNB 5B4MC 1SHMA 3ECQA 3STZA 3TNNB 2J4WL 2LXJA 2APVA 4LB8A 1LO3L 1N8ZB 2XG5A 1IB5A 5T3XH 4LWCA 1BF4A 1XPOA 5SV4A 4HFWB 4JO2H 4Q6KA 5DQJA 2WLLA 4O51A 5L37A 1DN0A 2CNZA 4ANWA 4DNLA 2XN9C 3AQYA 4UU9B 1PZKD 4ISVA 1XXGA 4P3CH 1N10A 2WZ6A 3BPNB 4MMYA 4PMWA 2CK0L 4K9EC 5I6MA 1DZ0A 3HOWG 1FZJB 4N2DA 3T65A 3HOVH 2YEZA 3HG1D 4M48L 1YAZA 3IDGB 2K5WA 1JXDA 4Z9CB 2H2SC 2X2UA 4GAJH 4ACTA 2PQEA 4JG9A 3A67L 3SDDD 1Y1UA 1CFQA 1MUJA 4K3EL 2UUBL 4XNZB 1ZA3A 2KBGA 2QSCH 2A1WL 3F04A 3K1DA 3TPKA 2ISDA 3H3VI 3U0PB 5DYOB 1DCEA 1ZSDA 5D70H 1XCTA 4OJYA 2MSPA 3WKNA 4KUZH 4U33A 5FUZH 3KYOB 4ICXA 1I3RB 3FF7A 4UT9L 5HSFA 5JPMA 1ACXA 1AG6A 1U30A 4A2HA 1RZFL 1RUPH 5FUOL 4M61B 1XNRL 1QTPA 1R5WA 4P4KA 2ZUYA 1CG9B 1I1AD 4OGXL 2VS1A 4TQEL 3I3CA 4L4TA 5CCGE 2EDDA 2BO0A 2RHSB 1SVCP 2ATKB 2UWEF 2IMMA 4LARH 1TR7A 1K5NA 1FZKB 1P69B 2VN6A 2E7LC 5F88A 4XXCA 1ENFA 3G71A 3FU9A 1HIMH 4Y5XA 4CAGA 1Y1VB 3CN0A 1A7RH 5G3LD 3UBHA 4A3FB 1K72A 1WIOA 1WFJA 2DI9A 5EORL 2EDWA 3KGUA 2F0PA 5HDLA 3H9SB 3TEHB 1ETB1 3QJTB 4QRTA 4YL4A 4FJ6A 5IJVA 5DQ9A 5JW4R 5CJBA 3BWSA 4EBQL 2UXCL 2V2XA 1PH2A 3NCWA 4IOFC 3PWLB 4WV1A 4AZUA 1G6RH 3PWVB 3GK8H 1MRDH 3K2KA 1Q0XH 4YS4A 3IMUA 3GTPH 3CDCA 3ULVF 2DQUL 1I8UA 4IUTA 4N87A 4LVEA 1F9SA 1G0DA 1FJGQ 4DNIA 3IJSA 5D3DA 3LIZH 1GCYA 1YNLH 3AXHA 4NNXA 3M7OA 3VDYA 3L1OL 3L3JB 3T0VA 3QC5X 5M5YB 3U2SA 4ZFGH 1OOWA 4OKVA 1FFQA 5KTEH 1HNXQ 3C3LA 2HX9A 5LDSA 3GKZA 2BDOA 1D6EB 2BSTA 3RFZC 1EQRA 4XBEL 5DVNA 3PSIA 4EI5B 3VG9C 5DRXB 1H9KA 1WCMB 4JFEA 1O7DC 3KLHD 5DMKA 1PLCA 2ZYRA 4MNQE 4N25A 5D7IA 3G04A 5EA0H 4UDUA 1SQ2N 4W70A 2F53A 3JZ7A 3T9WA 1WG3A 3SDXF 4F37K 2X42A 5SWQB 1OQXA 3KWTA 3AUVA 3PP3K 3Q6GL 4N0YH 1N59B 1ZPLA 1I1FB 2VZVA 4PJ5D 3GB7A 4XOBA 5IW3A 1G7PA 4NDMA 4XPHH 3GTQB 1OAQH 3VR6A 3QUYA 4F20A 3TEZA 3CLEL 2F0HA 4WRDA 3VXSD 2V3FA 4D3CL 1QRNE 4NQDE 1OF2B 1FR3A 1LMIA 1RURL 4TSBH 4YDJB 5M3FH 5EZJA 3PGFH 3UGUA 1LEGB 3PNWA 4JJOA 4S1SH 2DY8A 1HQRA 1HEZA 3K5OA 4DR2L 3VYPA 4Z3IA 1F90L 3O6KH 4TNVK 4NIYE 1LO5A 3TEYA 3F84A 3PJLA 5CHNB 4PHXA 4W6WB 1HXYB 4O02H 2A6IA 1K8DA 4O2EB 3E0JA 1IKFH 4OV6F 1PZID 3GEWB 5HJBA 1CI5A 2X6AA 3CSTA 4HFUL 5LBGA 3TZVD 5BJTB 3BUYA 4OFPA 1IGTB 4E0RA 4XPGH 2B7DT 2C3HA 2DLGA 5D5MA 3X12B 1AS6A 4ZUTA 3ZL4H 1T2JA 5FUCE 3T16A 3LXCA 4HUXB 5IHZB 2NZIA 1G51A 1BF5A 3CQZB 3QOJA 4F87A 3KLLA 4GAYA 2O6CA 3CDGB 3ZHLA 1OT2A 4DEWA 3HOXH 1D2BA 3T0BA 4N85A 2WWOA 3TESA 4TN9A 3BKMH 4Y4FC 4OVUA 5FECA 3W9EA 3BP4B 4XVSL 1RSFA 1U6AL 3OAYH 5TQ2H 3QIUD 4WWKC 2K8QA 1Q7YC 1EU4A 3L7ZC 2FINB 2YFNA 4A7GF 5T3ZD 2C3XA 5DK0A 4LSUL 4NFBA 1FNVA 2DLFL 1AGCB 2Q2TA 4JVWA 1U0LA 1J5CA 2FHBA 3M7GA 5LBSA 1K8OA 4I1NB 3FVQA 2Y36L 4FQLL 4BBRB 5IMOA 3RPBA 2BDNA 4EN3C 4WTZG 5GADC 3NA9H 1TUPA 4HJ8A 2OTWB 5E8NB 1HSBA 4XAWL 3KBXA 3BKYH 1ZJBA 2C4XA 1WD0A 3U7WL 2Y5QA 4NS0A 4F2MA 5MENB 1TVDA 4HK3N 1Y1DA 3QPXH 5DZVA 3MGTA 1OLZA 1ROWA 4FZ8H 3K4ZA 4MTMA 4XP1H 5IOPA 4DV0L 3FQ2A 5KVGH 2BA0A 3FNKA 3O6MH 2MMXA 4UQDA 3K5NA 3BIAX 5ICYA 1VFBA 4L8DA 4D94A 2Y0SG 5AJ3Q 2R0LL 5HURA 4OTXH 2KPWA 1D5ZC 3U7YL 2UWEA 1KTDA 3H3BC 5KRUA 3HI5H 2A73A 5HDBF 3S9WA 4L37A 3SO3B 5A1AA 5L2KB 3NBIA 1FQ9C 1KXVC 2QL1A 5EOCH 2LFGA 4K5XA 5AW6B 3QO1B 5CR1A 1N34Q 5FM5M 3WDJA 7FABH 4PG9B 4RISH 2FECL 1SJXA 3A23A 4WTQA 2DWDB 4DAVA 2VDMH 3EO1B 4GIOA 5IP9H 3I3BA 4XAKD 2Y69B 4JS7A 4P23A 2W91A 3L5XH 2V2WB 1ESRA 2MGSA 1HL4A 2ZUQC 5I17A 2A83B 3L7FA 1J48A 4X9BA 4GMSH 1WIUA 4X4KA 4AH6A 4AMKH 2D62A 3FFOA 3WBDA 3LPWA 5FLXc 5L2JA 4PB0L 3BP6A 4PJ9D 3VI3B 2EDBA 1T5XA 2Z4TA 3KPRA 4DP6X 2WJ5A 2O5JC 3HFZB 3BAYA 1N4XH 3EZ8A 4RAHA 4ZSOE 1AO7E 4A3LG 2JELL 1IIIA 2FLBT 2JIXA 4ZD3L 4DV3Q 1DP0A 3WD5L 2F8OA 2P24A 4ZYKB 4JKNA 4E36A 2FHTA 5L6YH 2Y07L 3LVEA 4KKCC 3HEJA 4R7XA 3PQYD 4DVRH 3NZHH 5EOQH 3T4AB 4PJFE 4ZXBD 1KAAA 3BVWA 4I1RA 3H4FA 3TN0D 4CC0A 1F58H 4IRZA 1N3NB 2EE1A 3JTTB 2L7UA 2WQVA 3SGDI 3LPOA 3OPZH 1ES0A 3ZKMD 4UZUA 3RVVC 4CGYB 1FNGA 2NXZC 4PRHE 1BEYH 3WTVA 3BZFA 3CVCA 1XT5A 3SDXA 5JVG3 2NNFA 5FO9A 2GAZA 3GTPB 2XTJC 2G9DA 1H95A 2NY6D 3PL6B 3OKDB 1A2TA 4PWFA 3SPVA 3TP4A 2P5WE 2ICWA 3MXWH 2NX5D 3M4PA 4C1NI 3S34H 4C3HH 3HS9A 5C1MB 1BXUA 4JFFA 4JCVE 2GTWB 3U25A 3D0AA 2LAAA 3DRQB 4MA8L 2PZWA 1IGCL 3GMRA 4OCNC 3ZE0F 3O9WC 5LG6A 1BA9A 4BBSB 4OQTH 2X3AA 3ZZSA 2DQIL 3DYOA 4GSUA 3CC5A 3E2HC 5FO8B 3K2UH 4S1DD 3L4CA 4QRBA 3TQYA 3I6GB 1BXXA 1F6AA 1FUNA 4MVBC 3TWCH 5IGGA 2R2HB 3B43A 4KFZC 5FGBA 5AFAA 1XQ4A 4OFYA 2ADFH 3AT9A 3VSVA 3QZBA 5IM7B 3RKDC 3ZTJG 3CHPA 5CMDA 5KGUA 5C3XA 1NCWH 3VMPA 5J11B 2A6HD 4ES8A 1ZVNA 1KYDA 3KHQA 4PCYA 5HHVH 1HHHB 5I4DA 2XFGB 4ZKCB 1C5CL 4C3IG 2QSQA 3V0IA 4A7VA 3OYYA 1HAWA 3AS3A 1NIDA 4LLAA 3QFJD 3VGHA 4BE5A 4EIUA 5JYLA 3T0DA 1NNXA 1N0LA 3QZLA 2Z31D 5M3FB 3QO0A 3MLXL 4JPWH 5C0IB 2HD3A 3V9EA 3WE1A 1PQZB 1QW8A 1X3EA 2FB4H 1NFIA 4JG1H 4WNQA 2WIMA 1B6UA 3F6JA 2WK2A 4J4PD 3ZZLA 2Q87A 1DFBL 1E40A 3MVSA 2VQ1B 4WFFE 3OMNB 3GD7A 3MJWA 4A7GA 4D0CA 2QHLA 3HZKB 5FB8B 5KYIA 4HG4K 3TS2A 5LN8A 3QUHA 1NOAA 3RE0A 2ATWA 3UDWA 4UM9B 1FAIH 1G291 4QRUB 2FHFA 5JORA 4I85A 3VXUA 2Z91B 4ZPTB 1EYCA 3RZCD 1PX3A 4C4KO 3U4BH 1S5IL 4U1SB 3K5RA 3S4SA 4P57A 3WEBA 5INCB 4WO4D 3ZGIA 1R9TB 1JWUB 4HPYL 2R2EA 2Q8BL 2L55A 1NGPH 1ZIBA 2YQ3A 3A4FA 3R06B 5SWSB 3WUZA 2ZSVB 3DIFA 3DPBA 5E51A 4P3DA 5E00A 1RU9L 2J2ZA 1DQQB 1FIEA 3SE6A 1MHEB 4CNIB 5DD0L 3PV0A 1YI2A 2CRZA 1ET5A 4JRFA 3DPDA 3UJJH 4DK6A 1D9KD 5DK2B 3VXQB 3HZMA 2BP0A 4XXDB 4AENA 4QAWA 4HU2A 4U68A 4NRXB 4B95C 3IKKA 3VJ6B 5J3HD 4GRWB 4QY8B 2PMZB 2VDLL 4PJXE 5LMUL 5DFVD 4AG4L 1QRNB 5I1HL 1EY6A 4XT1C 3K6DA 4PJCB 1SLUA 8PAZA 2NYZD 3KCWA 4YX2H 2AI0H 1JNNL 3FOLB 2YD4A 3EVQA 2X70B 2Y2YA 4JFHD 1E5BA 1HWHB 2YUXA 5AVWB 1NGWA 3DC0A 3GZQA 4HXAH 2C9VA 2NW2A 5C08D 1KNOB 3VQ2C 4ODUB 4JC0A 1DVZA 3QUGA 3CMOH 1AE6H 4A3IG 5IMMA 4A39A 2PCPA 2EZ0C 2AUKA 1VQ4A 2H8PA 5IROC 1JGLH 5BCAA 1YQVH 2GPZA 4XH2A 2HRGA 3L4TA 4YHIB 5I6LA 1I8LC 1UD4A 1UHVA 1MCOL 3CP0A 5ERWA 5JEAJ 2XWTA 3RY6A 2W5PA 4WK4B 3ARUA 3AG2B 2PP9A 3MV7D 1ZS2A 4ZUSB 2VT0A 2VDMB 3EADA 2ZXRA 5AAMC 1EXGA 4OSUL 1J9RA 3NSWA 1DHKA 2ESVA 4MHHG 4ORZC 2AXGA 4P06A 1QJOA 3BI9X 4IKJA 1QAWA 4L4VA 1WTWA 3F01A 2NY3C 3GSVB 4LCYA 4X6BA 5EU7C 4I88A 4YIQA 2JXMB 5IT9E 1IL2A 2ADGB 2DIEA 4NQSB 3GMMB 3DGDA 3REWA 2JSFA 2OF1A 1YDPA 5G4NA 4Y7MA 4HWUA 3ILDA 2EADA 4KUCF 3U4ZA 2WXKA 5T3ZH 1T80A 1I4QA 4KGLA 5C9JA 4Z9KB 1X56A 3OAUH 4HG4J 5JR1L 4BA1I 2H6UA 1T89C 4Z77A 3K46A 5JJIA 1IZJA 2WQWA 1PTOB 4GLXA 1NCBH 1N12A 1QSEE 1F2MA 4GRLD 2P9RA 3IDJA 2VXTH 1Q4NX 1Q1PA 1F4YH 3ARBD 2WINA 4NT6B 1I1YA 5CEXB 4DV2L 1P4BL 3OTOQ 3AMLA 4UQBA 1EDQA 4DXFA 1SVZA 4NUJB 4X9YA 1U5KA 4Y7NH 1OE1A 3DLQR 4KKAD 3DVNA 4JFPB 2CWPA 1INDH 5BVJB 5IJKA 3OXRA 1E7ZA 1KY7A 4LBAA 4TVUA 2QMKA 2CQOA 4YO0A 3F8UB 4NQXA 1JZ8A 3QXDB 4GH7B 1CHQD 2N56A 2GFBB 4H0GA 2VABA 3HNSL 1FG2B 3PIO3 4HK0B 4V1DE 3QNZA 5FFOA 3FOMB 3ARDD 4HCRL 2NY5L 3QEQD 1U2HA 2DQGL 1B2WH 5E6ID 3FTZA 1TFHA 2I0QA 1EO8L 3WGUB 1RZ7H 5GPRA 1OTUD 2DH2A 3OLDA 4LOUC 3SCMD 3WIIH 2NT1A 3TONA 1UKSA 1AGFB 1OK8A 1IU1A 4OD2B 3TBIB 1UGKA 2FIKA 4K7PX 1KCWA 2YV5A 1S72A 1Y6KR 5BS0E 4WHYH 5AFWA 1DBAL 1T5WB 3GDCA 1L0YB 2FBOJ 1GOGA 5HHPB 3S5YA 1FZOA 3VFGH 1IC7H 3FQNB 3BISA 1GZHA 3MV8A 1VMPA 4RESB 4BEIA 5I1GH 3IBEA 1PY9A 3ZE2F 2LU5A 3JVGA 1QNUA 2ZXAA 5EC2B 5HGGS 1E5ZA 3D3VB 4OIBA 3RLFA 2YTXA 2DY7A 3L08A 4YC2C 4K5WA 3L3GB 3S88L 1E50A 1I1AB 3QDME 1FC1A 5JW4Q 4K94L 1TWHH 1PH5A 25C8H 3J7HA 4C47A 3VH8B 5JVH3 1AD9A 1IC4H 1HHJB 1FLTX 4J6RH 2JQAA 1LACA 5CBEE 1AKJA 2ZQKA 3V96A 3N1GC 4DP1X 3II2A 4IGBB 4PJFB 3DJRA 4DR1Q 2CBQA 2E4FA 3IDYC 3TVMD 1CLYH 1FO0B 4OX9L 2MTAA 3TJHC 4O2DA 1KXQA 1HR0L 1T66C 2OSYA 1XGPB 3BVNA 2GSIB 4TVSa 4A3MH 3RRQA 3VGFA 2Y4SA 2AXFB 1II3A 4U6VL 1SEBA 4XWGL 1L5GA 1D5BA 3V6BR 2L04A 1ZSHA 3EOYG 5C44H 3IVKB 3ZT5A 1FE8H 1FH5L 1O7VA 2PABA 3LNGA 4PJEB 1EHNA 4ZG1A 5GS0L 3J7A5 5HGDB 4Z7QB 2J0TD 3I02B 2RA4A 3IGKA 1P0SE 4JPBW 4Y88A 1SN2A 3ATAA 2IGFH 1U8JB 1DUZA 1IQWH 5J12B 1X9NA 4GUOA 1U4FA 3FUIA 2WM0A 3ND8A 4PRPD 4IRJD 1Q0YL 1WBYB 3SDDC 4S0TD 2B2TA 5DJAB 5HPMB 3FCUB 1CLZL 4A75A 3ESUF 4OONA 1WEJL 4UTAH 3BDYH 1UWFA 2WQAA 4FXKC 3GXDA 5K9JH 4PRIE 3PHOA 3V6OE 2DYPA 1U8HA 4D8OA 3DX8A 4ZTOH 4H2AA 2V5MA 4FCAA 3U6XS 1W72L 4XIGS 3FT9A 3QULB 1BVKA 1IBYA 1OB1A 1H0DB 2CDEA 1JZ2A 3DV6B 1RIHH 2GTQA 3OAZK 1I3GH 4HMDA 5C0DB 1T1WA 1I4PA 4LF6Q 4HUCA 3FQXB 5AKSA 3SXHA 3ERXA 3UTZB 1OAXL 1P53A 1ZA6A 3NFNA 1FFPA 4KHPQ 2VB2X 2EIEA 4JR9H 2CO2A 2ZUSA 2ZAGA 3PO2G 4J8QA 1U58B 1IAMA 3H0GH 4CUCA 2DQHH 1KBBA 1S7VB 2YTVA 2Y1AA 4JQXC 5EBDA 1J0ZA 5J4MA 3SEPA 4PGCA 5C4JB 2CRIA 1A0QL 3P2BA 4PGEA 1FNSL 4YCUA 3HMXA 1TYRA 4AT6B 1AIFA 4X65L 4J3UA 2DYSB 2HDMA 1AG0A 1UASA 3ABGA 3MJ7B 4LRNL 2KERA 2O5YH 2P8PB 3V8OA 3TZVB 3S16H 2YSTA 1TU2B 3UZVA 4F8LA 5CBAA 2EEAA 2FX8H 4MN3A 1GUGA 2OK0H 1BDOA 1DSYA 5DWUL 3AFQA 3RDTA 4RGMC 5DVOA 3MR9B 2DQ6A 1JPFA 3PUZA 4RAUC 1YA5A 2AXJA 1X9RA 3TBYA 3QIWD 3BH8B 3RPIA 4AYMC 3EGDA 1CDJA 4Z7WA 1Z9NA 5DEFA 3WO3B 5H37A 1IC5L 2E9IA 3QJFA 1SE3A 1VQ5A 1BLNB 4K3GA 1A3TA 3BESR 2CH8A 4Q4EA 1HH6A 3KLHC 3QIUB 2MEJB 5C0EA 1ACYL 5DFWH 1PMYA 3BUQA 3FQUB 3CLFL 4J15A 4HJJH 4JFTA 3UYPA 1CM9A 5B39B 3EFXD 2UY6A 4NENA 4I48A 2VISA 4G70B 5ID1A 4X4ZA 5L88H 3ULUL 4JBJA 1H3GA 1NBVL 1WCBA 4ZO9A 4EKXA 4OLVH 2NNAB 5HYFA 3VD1A 3GUTA 3MYZA 1E1TA 1ZHKB 5EPMB 1VLXA 2AJZA 2B1OA 2VLJA 4RGOS 2M8XA 4APQA 2Y5TA 5E7FA 2IALA 1QEXA 2F1EA 5E9DB 4Y7NB 1D6VH 5GGQH 5F7WC 2XG4A 5DXWA 2QHRL 4F9PC 1HEHC 1CVRA 3U6RB 4J3OD 3LDBC 1DL7H 3NFPB 3D39D 1PAMA 1AANA 5KSVB 4A3DG 4NKOA 2IXQA 2XIWA 1NR4A 2OYPA 5AW1B 1LO4H 4NUMA 4JI7Q 5JO5A 5EO0B 4N5ED 3BZCA 4JHAL 1N18A 1TOXA 5CKGA 5C0ND 1UA6L 1UVQA 4Q0XL 3WTTA 4G7YL 1MFUA 4M5YH 3RZOB 3GSWA 3MRFB 3QXWA 3TF7C 1IMHC 1FL6B 1Z5LB 4JPIB 5KVMC 4FF2A 2OMZA 1HZCA 1Q9KA 3NRPA 4AK2A 3NG5A 3IJ7A 4WJ5A 2HFTA 5DD3H 4MA3B 4IQHA 1N67A 1LTLA 1PTZA 3D69B 2BNRB 3S5LG 1KF9B 3UCRA 4Z76A 3K72A 4ZNEA 5KVDE 3CCHA 3IPEA 3MPCA 1O9WA 2AEPL 1M7IA 1WZKA 2CXGA 3IS1X 4N0UA 3SE9H 5F7MC 2IJ0C 2W0KA 1U91A 2H5XA 1JK8A 3FHAA 1NA8A 3GMQB 4RZCA 3UAJD 4JI5L 5J39A 3QQ3B 5DHYA 5I6XB 3V0HA 1GJXA 1MFEL 2BVQA 3I73A 4X6DE 1TQBC 1TWHB 2DB8A 2XY1A 3HC2A 4LVNC 1XXFC 2ZSWA 1HHKB 1QR4A 4GQQA 4KVCH 5I8KH 2EVJA 3BMVA 4OZIB 5CJQL 1KCUL 3QQ4A 3JV6B 2J7ZA 3RNUA 4B3RL 2VRQA 4BY1H 1RZJH 1C8QA 2MNWA 4E9TA 2B77A 4JFZH 4A3MB 3PQYB 3G48A 3N44B 5JJLA 3WFCL 5G4MA 3T8XB 3ENEA 3VXME 1CF8L 4WW2C 3QPQD 4YXLH 9CGTA 1VQJA 2RF4A 3TIDA 4OF8A 5KYUB 3SZKC 5GRYA 3V0VA 4V2CB 5BO1H 1VHPA 1G9ML 4MJIE 1KB5A 2XQYG 3S36L 2X4NB 2CBOA 1NMGA 2ZG1A 1CZ8L 1AXSA 5FGSA 5I6NA 5B3JE 3HE7B 1MLCA 3K58A 1PVHA 4RGOL 1IGIH 4JKLA 3H7LA 4W9GC 2Z4QA 4P9HL 1PGRB 3MAWA 4JDTL 4DNTB 3HPLB 5GRUH 4JI6L 3H1ZA 4FP5D 2J88L 4JI2L 2VLLA 5BS0B 12E8L 4HHAA 1SY6L 3HOUG 3BDOA 4X9GA 4KMUC 3T2NH 1M1XB 4FGMA 4LP4A 3AMKA 2X4TA 2ZG3A 4XNDA 4NZRL 3UPRB 4QRRA 1X9LA 4AV4A 5HJ3B 1CFVL 4DK3A 3NJIA 4N2FA 2CGRL 4DAGH 2VDKL 2OMTB 3SJVA 4FO2A 4JAMA 3AYHB 3R0NA 2VZAA 3W0WE 4B9GA 3QDMB 1XAKA 3H15A 4PJ9C 3FPUB 3LWUA 4NO5B 4YBLC 3QEGH 3P77A 2WXNA 3MRJB 5C0XI 4QYOA 4EUPH 1EZLA 4LHUB 4NHUA 4N2LA 4OU3A 3ZKSD 3SBRA 3DI3B 1TITA 3IJHA 4LPCA 5AVYB 1YZ6A 2NY4D 3QFJB 5E6SB 3N1MC 2P7TA 1Z0MA 2UUCL 4PSPA 5DTFA 1G9HA 3F3HA 5I0ZA 5A6IA 5JLZB 2F5BL 4GLRH 4A3BH 1YMMB 5J89A 3BSGA 4ZXBC 3FCSA 3RLOA 3TN0C 3UTTE 1N5YL 2Z1CA 4BXXH 2WAQA 1F2XK 4W9CC 2PWEA 1U4RA 4L2YA 1IJNA 5IGFA 4R4BA 3GSNB 3ZDXE 3ZKMC 5HYJE 4IUQA 3P4NB 3RILA 4N9GB 4UTCA 3S16B 3MLYH 1LTAD 5IHUH 4FVMA 2JKLA 1EJOH 2NYYD 1KC5H 2NY6C 4G1EA 3U46A 3QDGD 4OEMB 5CD5D 4ZOAA 4GG6F 2EC9U 1X3PA 4RMUA 4DGYH 1ZLWK 3RZCB 1XGQA 3S1RH 1DUYB 4H40A 2XWDA 4WO4B 4JBWA 3QJYA 3GRWH 1CU4L 1OT1A 3UEQA 1FJ1A 1I82A 2MHAB 1K0SA 1X7TA 3EYFB 3GLZA 2B2WA 1MDAA 3MACH 3I3DA 3N40P 4PGDA 1Q72L 4JW0A 4L5FL 2NSQA 2XSCA 4QT5B 1C1EH 2J5LB 4QHLB 4G9FA 5IGCA 2G75A 1OP4A 4G6ML 2DAVA 2H9GA 2K7PA 4W6XB 1W16A 2CDGA 3QXAB 1WDAA 4NQCE 4QWWC 4F80A 1HI6B 1PLAA 3WXVH 4M1DL 1KBPA 2GK0B 1GSMA 1YEHH 4FNRA 2A6HC 4QUFA 4X64L 4UTBH 5G55A 1D5MC 1H8LA 1U2YA 2YD0A 3COOA 3UADA 2SEBD 4I0KA 1A9EA 3WUWG 1H3PH 1DJWA 2RIKA 4FQXC 4U4BA 2Z31C 2PW1A 4AZ8B 1R24A 3BYTA 4HJAA 2MRYA 5JPNB 1EZUA 3FW6A 1BAGA 4J4PC 2VAAB 4DEPC 1U92B 3BQUA 1FV1B 3SKOB 2CLRB 8FABA 3JWDC 5F7DA 3AXLB 4F58L 5JHAA 3DUUB 1VKXB 3DDGA 3FO2A 4UT9H 4F37F 2RDGA 1DBBH 4IK6A 3WSQL 4WVRA 5EEYA 4Y19D 1IBBA 4N5UA 1GS8A 2DOCA 2W9DL 2ERJC 3D50A 5CZVH 5C0GB 1B4RA 3EF7A 2VN5A 5A2FA 1NAMB 2AKRA 3NHHA 1Q9OB 2WWMD 4WO4C 5AVRB 4BBWA 3HZVA 5C2BL 2IAMB 2WWKT 3CPFA 1FGNH 3KLDA 4PTTA 5FIEA 1L6PA 4DN3H 4GKNB 3MRHA 5ELOA 4PI2A 1LT3D 4BJLA 1THCA 4JHWH 4D0BB 3Q1SH 5EZIH 3IDXH 1NLBL 2R1XB 1PHJA 3WLBB 4DPAX 5FPIA 2XI9A 4G7ZC 4Z7VB 2J1KA 3U4EB 4H25B 1D9KC 3M1BB 1PVOA 1U8MA 1X9UA 1HK6A 2N4IA 1ID5I 2Q20A 3QUXD 3GSQB 2EQDA 5J3HC 4LAJH 5JOEA 3MV01 4BY1B 4I3SH 4QHPA 2A9NH 2DD8H 2B2VC 1EEID 3SBWA 5DFVC 1J8HD 1KY6A 3HB3D 3NP4A 4GBXA 4DK5A 3WOEA 1X6OA 3D09A 1J1OH 3TO4D 1NCDH 3L4VA 4CJ1B 5C6PB 1VA9A 3RB7A 3H9HA 3J27A 1BKBA 3L1OH 3AM8A 4KKZA 3OHXC 1UZ6F 3NUKA 5DZOA 2MCG1 1KIRA 5K36G 2K4AA 4OI9A 1ET9A 3RIAK 3QZPA 3T0ED 4GN4B 2N1KA 2DS4A 1EYGA 5LBSL 4J3OH 1PFMA 1K83B 3EOAA 3EH2A 3QI9D 1E3PA 3WDNA 1CK0H 3L13A 3A6OA 1LQSR 3ZRFC 1P16A 2AKWB 5JOPE 3ARDB 4KK5D 4GSQA 3PYCA 3DUSB 3ZIYA 5JZ7D 2HWZH 5ESQA 4UAOB 5CD3A 2OX5B 5HHNB 5HGBB 3NJLA 5F9OL 1O0VA 3RNKB 1YNND 2GBUA 4ORGA 2ORBH 2NLJB 3E5SA 1RD9D 2EIJB 3WI9A 1UD6A 1LO2L 2ARWA 3FUKA 1S7SB 2XSKA 3O2VH 4Q6IC 2HRLA 4X6DB 1DLFL 1E9QB 2L15A 3I4MG 3TCLB 5ABDE 2QVTA 1BZQK 3A4EA 5DLML 3RZWA 3STLA 2BVOB 4FXGA 4JO1H 1UXSA 4N0FB 1UB6A 4GG6A 4IDJH 3NIDE 1GUWA 1WFOA 1S9WB 2A74C 2CALA 2IW3A 4XOEA 4LDEB 4OFKA 4LAAA 1U4MA 2Q0ZX 5EOCJ 4NM8L 3C5XA 1WTPA 1RZJC 4BH7B 5EGTA 3NTHA 5CAYB 1KCVL 1A7PL 1AW7A 4PJAF 2O6PA 2HRPH 4GRLC 1PFSA 1HH9B 2HFGL 1CMOA 2BP8A 1S3KH 3ARBC 1ZHBB 1KLGA 2AK4B 3U82B 5B38B 1KXHA 3TF4A 3EW3B 3KW7A 5GRVL 2QDVA 5T1LD 3WIAA 1X6NA 4PJHF 4N22A 4I77L 1YEIL 3SE4A 4OH2A 3I8ZA 4R4IA 1XTDA 4KHVA 3B2MA 5DMGC 3HHRB 4KKAC 4OZFG 3ULVL 2Z8VC 4DQOL 3C5JB 2B2XH 2FJGA 5CV9A 3II3A 3IGFA 4ODWA 1IAOA 2VXVL 1GZQA 4PNYA 2NZ9D 3TS0A 4U6HA 4XP6L 3WN6A 3OKLA 1KJ2B 4JNXA 5IQ9A 4RFBA 1PSKL 2CJSA 3S1RB 2JKXA 4WI0B 2L0DA 3A8KE 5E8OA 3VCLA 5E6IC 4A3CG 3RKPA 2WWNA 3ILQD 4UAOC 4NXML 2AW2A 5D1ZA 4AQ8C 1OTUC 2MNAA 1VACA 1T4KB 3SCMC 1CS6A 4ZX5A 3GJFH 1A64A 1RXLA 4HCEA 1IAKB 1SF3A 3CFNA 4IRZL 2A69D 4AM0B 4MWFA 3W0WB 1MHHB 4XQJA 4GLAC 3Q8EA 1FYTE 2HFEA 5EU6E 5ICUA 4QTIH 4XB8A 1BVSA 1D8LA 1WGVA 2UXDQ 2ZOOA 2A4EA 4HETA 1GUSA 1G91A 5C5MA 2EUXA 4FFYA 3LZPA 4IHBA 1F4AA 2K14A 3CPLA 3WXWH 3K4AA 3ET9F 3V5DB 3NSFA 2CR0A 2DPKA 3E0GA 3T04D 2YJQA 3INUH 4JFYA 2X4PA 4CDGC 3PUXA 4ODSH 4DUYQ 1FRGL 4QRPB 4OM0H 1BVLA 1JN6B 4KZEH 1A4CA 1RUMH 5E5UB 3SQOL 4DKAC 3DYPA 2IH1A 1JAEA 3TVMC 2QPEB 5FCUL 3C5ZB 3SDCD 1A6PA 1WE5A 3U30C 5DZLA 3MJ9A 1OD7A 3A24A 1TTAA 1AZRA 2DL2A 2ZKHL 2EH8H 2X89D 3UTSA 1SJEB 2H0EA 5HHMD 2B1HL 3IGLA 1XJVA 3BZ4B 4HR7B 2F0KA 4PZ7A 5IMKB 4I9WE 3WIHH 3VFNA 2F19H 5DJ6A 1M56B 4X6CB 1MJ7H 1BBDH 1GGYA 1OPOA 5TGBB 3WL9B 5FF6A 3DO7B 5D4HA 4Y9BA 1RQ5A 1UB5A 1CT8B 2Z93B 4IRJC 4TQHA 3X3GH 3PIOA 2I7SA 4ZKBB 4KY1H 4ZD3H 1M6OB 3ICEA 1Y6NR 3QZMA 1JZ7A 1LWHA 3N1PC 3SDAC 3KBHE 1GJUA 5F72S 4TPRL 4TSAL 1S40A 5KNCA 3WTYA 3PV7A 3PGZA 3GBDA 1J5OH 4UNTA 5CSZB 4N28A 4X83A 2CQVA 5F6IC 3V2TA 5HHOB 4PJDE 1OALA 1K8GA 1EERB 4X8GA 5DD5L 3AG3B 2XNAC 4M1CD 3V5KA 1F6FB 5K1VA 1MVUA 2WVVA 3MJ6A 4NRZA 4PGJA 4LESA 3BJUA 1IFGA 3OMIB 1XMEB 2ZXOA 3TC9A 1AE3A 5KUMA 1Q1JH 4X0KA 1XF1A 2ZD0A 1X65A 4G6AD 1YY8B 3TYGH 1JI2A 3S6CA 1G6VK 2XPZA 3HAEA 5GJSH 1KDCA 1T5EA 3PUYA 2PTUA 4E41D 3F7QA 2NY0D 5IFHL 1NEZG 2X40A 4ZFZA 1PYWA 1KLUD 3M3YH 2AQNA 4Q2ZB 3ZTNH 2YAPA 2YRBA 3PDOB 1G4RA 4G43B 2ZOTA 2H6PA 2K45A 3S1QH 3CC4A 2GITA 1F77A 3PAZA 1OCWL 1DGSA 3HCVB 3B5GA 4PJAA 4FF4A 3N41B 1FG9C 1MCWM 2LR4A 3CNKA 3FUDA 5D4IA 3E6FB 3GLAA 3MLZH 2O93L 2VDPH 4GEIA 4PJHA 1I3VA 2CLVB 1C5CH 4DK0A 4U6XB 1KIUB 2H7WA 1SXCA 3R93A 4WJG3 5C09B 2WYIA 3QIWC 3MLXH 1OXTA 1S9VB 4NQDD 2NMSA 5IBUG 5BUAA 1NCUA 4ZMYA 1EFXD 1QD0A 1VPOL 4UOJA 2H1PL 3DX1A 3KYAA 4HYTB 2B63H 2D0OA 4I0PC 1KL9A 1H3WM 2J1ZA 5TE7H 4MJ4A 3ELQA 1B4LA 3MGOA 4PW4A 1R3HB 1XXDC 3CZEA 2B1AL 5SX4H 4LAQL 2FSEA 4NQVA 5DEZA 4FQIL 4JJHA 1SLWA 3TT3L 3NCXA 4HSVA 5B1JC 2WHVA 3HC4H 4O2FB 1S7XA 3CFMA 4Y4KD 2HJKA 3E9TA 2A5UA 4C56E 1QLFB 4B9PA 3RMHA 4JM4H 4DZ8A 4KKPA 4R8IA 3I9IA 1R4XA 1KFAH 2QTEA 2VKXA 4ZAKD 3QW9A 1L3WA 3UROR 2R69A 3D4WA 1U8LA 4A3EG 1UCBL 2N8NA 1BZ7B 2JK5B 4J3OC 3VXRE 2O5NA 5ANMB 1XL6A 1A47A 4YHOH 4XI5D 5I8EB 3PXJA 4PS4H 1EYAA 5IB4A 1LTRD 4GSDH 4N5EC 1YEZA 4N1HB 3BN3B 5CIPA 1A6VH 4DV5L 4H0LC 3HC0B 1CD9B 3AS2A 4M8VA 3Q2LA 2YRZA 1OP3H 5C0NC 1RUAH 4NN7B 3NEEA 3PWJA 3KYHC 3GJFB 4WHTA 4RNRB 5FYJD 1X54A 2YD5A 4BQCA 2G3NA 1JNLH 1BCPB 1RD6A 3FO0L 3PY9A 4IOIB 3A7LA 1N2RB 3RG1C 1CGSL 1FF5A 3TO2B 2V2TA 1EXUA 2B59B 1RIVL 3U36B 1JP5A 4AYEC 3T3MB 1TKWB 3KWWB 3CKIB 1LILA 1SN5A 4K5OA 4Q9RL 2FATH 2X4UB 5D1QE 1J9OA 4U1NB 4NC0B 4DR4Q 5EIIB 5JUEL 3DWTA 5FLMH 3OLEA 2ZAHA 4WKXA 5F9WC 5E9AA 1XIWD 3N50A 4PTUB 4XC1H 1P7QA 2AHOB 5E4EB 2BVTA 5DSCB 1XEDA 2FWOA 3BOVA 4P46A 2MOGA 4I2XE 2A6ED 3FTSA 3NZ8B 1V1OA 5DJZB 4YXKL 4MNHB 2APTA 2BNUA 3MLPA 3EJYD 2D73A 3S3DB 4PBXA 2NY4B 3T6ZA 2VE6A 2I5HA 2VCOA 2YPLB 5SWZB 4XO5A 2WBJA 2FFKB 3OMZA 1B8AA 5FW6A 3QPQC 3ZDYF 2IDSA 4WJ4A 2L3BA 2PPCA 5TDPA 3F1ZA 3N9GH 1EEZB 1BQ5A 4O1NA 1OGAD 3RAJL 4E2OA 1DOLA 2YBRB 4CC1A 2Y0SE 3DMMD 2WZ0A 3EFFA 3MRPA 2UXGA 4X66Q 5IT2L 1OSEA 4G3YL 1TZOA 2Z7WA 4ZUWB 5H8DA 5JQHC 2EZVA 2BERA 5FKAC 4KKLD 1CICD 4ELDA 4LF9Q 4KI5C 4TXVB 3EH3B 3N43F 2EYOA 4DV4L 4MQXD 2R56H 4OLYL 1KDJA 2F18A 3FN9A 2FIRT 3IGAA 5CZRA 3TV3L 3U4KA 5I16A 3KPMA 4PBDA 4KO9A 2ZIDA 1N5AB 2ZOWA 1GSKA 2EYFA 1WS8A 2VNCA 3PJNA 2HRHA 3AFLA 5DUPH 1AO7D 2D7TH 2CXKA 3OWEB 2K0RA 1T1YA 1S9XA 1TJMA 2BVPB 3H54A 5AZUA 3OF6A 5HPOA 5IEHA 1MAJA 5IR1A 4IJTA 4ESKA 5EN3A 2KCCA 2V4DA 3C5SA 4ZOEA 1IGJA 3ZLQC 4NHCL 1QHOA 1JZEA 4J2XA 3KCPA 2G9HD 2A6KA 2ZWLT 5FK9A 1SFHA 4O4YH 2K50A 4QMEA 3R1GH 4NB7A 3POHA 4L1LA 4HKJA 4TULL 5HVFB 5IB3A 4AY0A 2WLIB 4PRHD 3WEOA 1CB4A 1U36A 4OZHB 2WP8J 2FQGA 3U4VA 2ZP8A 3MNWB 4DAMA 1HL9A 3A8IE 3BXNA 4HDIA 1DQJB 2NY4C 1F8TH 4P5TC 1GYUA 4D9QE 4L3FA 2XN9A 1BDYA 3QORD 3GLEA 1RAMA 4M00A 2P5WD 3IDNB 5LGJB 4FI8A 1RK1B 2JKIS 4D9LL 2BSRA 2DKSA 4NPYB 5AWNH 5IMLB 4DGUA 5F1IB 5J22A 2I07B 5I15L 1H9MA 3M8OL 3BDBA 4HN7A 4OLZH 1YYML 5DJDA 1XZ0B 3TV3H 3M3YB 1IAIM 1S9YB 4U1GC 4R4OA 5ITFA 1M4KA 1QO3A 2VLRD 3IWVA 1INEL 4OZ4B 1ZLUK 3S1QB 4KJOA 3SDYH 4CVXB 1B53A 1KCRH 2EDLA 2WTPA 1GW6A 1EDHA 4AGNA 2W0LA 2NYYC 3RX5A 3FTUA 4MHEA 1DDTA 1HINL 2B5IC 3S14B 1RJLB 2VLME 5CSBA 3A55A 1QNZL 2Z3FA 5K9KA 1W6LA 1UWYA 3KFUA 2FNWA 4FQQB 4NO0A 4NQQA 2HTKD 2B14A 4AIZA 2ZM6Q 2AFNA 3FFCE 4LP8A 3BE1L 3FT4B 4XP9H 2J4XA 1JGDA 4I3RL 1MPAL 3HG9A 3IKCA 4R2GD 2QGCA 2PPAA 5DJ0B 4KITB 5HYQB 5M3MH 5IVZA 3HMXL 5FGCB 4JFXA 4BFNA 4CA4A 1CQFA 4C58B 5IESL 2B63B 4DN4L 3GO1L 5DCCA 1LT5D 3LZNA 2WNWA 4JY5L 1QVOB 3TH2T 3QQNA 4JHZA 3VM7A 1FN4A 2XC8A 5ALCH 3U9UA 2WB7A 3G6DL 4H8PA 2D31B 3EFDH 3D18A 3TNNA 1MVYA 1FI8C 3U9OA 5I9OA 5GSVA 3RNQA 4BRJA 5GS0H 3P3RA 2FJFA 1W8OA 1J8HB 5D7JD 5HHXL 2GEEA 4ELMB 4JG0H 4U3CA 1V27A 4IOSA 1KIXA 1CFNA 3EGXA 4PWEA 4MD5B 2KVMA 5F1NA 2B8FA 2EKSB 4LIQL 5ENWA 4A76A 1A1MA 1FZJA 5IGEA 4XCYB 3CZFA 4MJJA 4QOKE 1DBKL 1T2QH 3FT3A 1XD0A 3KJ6L 2F0TA 1MH5B 4HLEA 5LXGL 3QZWG 3KYMB 2P52A 3GMOB 5BZXA 2OPCA 5A2BA 2W80C 5KN5A 3U0PA 5DYOA 3PXHA 1MHPL 1MY5A 1J1PL 1SEQL 2ITEA 2YD1A 2ZOUA 5A16A 1M57B 5DI8B 4I4WB 4MXWH 1I50B 1SMOA 3KYOA 2CO4A 1XNQQ 1I3RA 1PKOA 3RFZA 4GS3A 1UJ3B 2G2RB 5EBGA 2CU9A 4TOYL 2EABA 3ZX1A 5IIEB 2VDLB 1A63A 1PRTD 1TZIB 4FZEL 5HGQA 1OAXH 5I26A 2XN2A 4PJGF 1DE4A 3ULUE 1PBYA 2XFXA 3DROB 5EEWA 3IU4L 1T22B 1MJUH 4ZAIA 3O4LA 1CUOA 2AJ3B 4FFZH 1CFSB 4LSSH 1QILA 3P30L 3P73A 1GKEA 3T71A 1S7WB 1O6SA 1T6BX 2AQSA 2W9EL 4DGZA 4I65A 3G6JE 2X2HA 4GIPD 4R7VA 3UG4A 3V7AG 1JMXA 1P5UB 2VDNH 1O9VA 1CXLA 3TT1H 1CFTB 3NP8A 2IANE 5BXFB 3W2DH 3QUXC 2D7OA 3WG7B 4G83A 1FNSH 1R3JA 3GQBA 4K3DH 1MW1A 3BH9A 3B7SA 1P2CB 2BSED 4UB0L 4KH9A 4OLUH 2WKCA 3HB3C 1I9EA 2NWGA 4L5QA 4OD3L 4L3AA 3TO4C 2TSBA 4ZYSA 3PWVA 1RJCA 2UYLA 2WUCL 3U0TB 3MJ8A 4R26H 4YSUA 4CSSA 4E6IA 1KV7A 2BHYA 2IEPA 1DFXA 4C3JB 3K0YA 5DU7A 1TJXA 2Q1EA 3I6KB 3RWFB 2XZZA 3T0EC 4AIMA 2NY7L 4H20H 1WFIA 3EO9L 1YVLA 3K7UC 3KPNB 1J9CT 4ZUVB 2NCMA 4C4KT 3QJRB 3HLAA 1TS2A