3FRPB

Crystal structure of cobra venom factor, a co-factor for c3- and c5 convertase cvfbb
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
368
structure length
343
Chain Sequence
LNLDITIELPDREVPIRYRINRTVETKLNQDITVTASATMTILTFYNAQVCNKFHLNVSVENIHALMLKICTRYLGEVDSTMTIIDISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHFKILKHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSLNHQERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKTHQYISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEEFQKLCDDFAQFSYTLTEFGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cobra venom factor alpha chain
publication title The Crystal Structure of Cobra Venom Factor, a Cofactor for C3- and C5-Convertase CVFBb.
pubmed doi rcsb
molecule tags Hydrolase cofactor
total genus 59
structure length 343
sequence length 368
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01759 NTR UNC-6/NTR/C345C module
B PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.210.20 Mainly Beta Single Sheet ubp-family deubiquitinating enzyme fold ubp-family deubiquitinating enzyme fold 3frpB01
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3frpB03
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3frpB02
1BQQT 3I70A 2A73B 4FXKC 1JC7A 5FO7B 2WINB 2B39A 3CU7A 2XWJB 5FO8B 3KLSA 3HS0C 1D2BA 2QKIC 2WIIB 2XWBB 2ICEC 1AYOA 3HRZC 1UEAB 2E2DC 1BR9A 1BUVT 1JB3A 2J0TD 3T4AC 1BV8A 3OHXC 2A74C 2PN5A 4D94A 3MA2B 5JPNC 1XWEA 3CKIB 1EDYA 3L3OC 3V96A 1OO9B 5FO9B 1UAPA 4ILWA 5JPMC 3FRPB 2TMPA 5FOBB 3G6JB 2I07B 4LNVA 4FXGC 1PXUA 1GXDC
chains in the Genus database with same CATH superfamily
1OAJA 1XX9C 5CCHE 4FNSA 3GRGA 3VWKC 1MOEA 2RALA 5MEQA 1I7ZB 5CIPB 4BRVA 3E8UL 4PB9H 1E2VA 4YH6A 1KPUB 4XPBL 4X6FA 3PDGA 1NCBH 3HPLA 4OZGA 4Y2OB 3LPFA 5DK2B 4PJEF 3ELQA 3AT0A 2FSEA 3OG6B 3L3GA 4AKPA 4AVJA 4HJEA 4AENA 4DGYH 3NA9L 4PV9B 5E5RB 3X11B 1KCSL 4DGUA 3HPJB 3L16A 2W65B 3CHQA 4JHVA 4ZOCA 3MYJB 5KYWB 3OJVC 2OW7A 4ZPVB 1W72A 1KEML 2IG2L 3OXRB 4HJ1A 1D6EA 3RVXC 3VB8A 1OAQL 4XT1C 4TNWK 5MEOB 5IZ7A 3EO1B 1SMDA 1JFHA 4K3EH 4TTDD 4AZ8B 1PHJA 3O4LA 4MJ6A 1D2BA 2F8VA 3S1NB 1Z5HA 4IU3B 5ACMA 4PRHD 3S35X 1NMCB 4ZQKB 4BSVA 3CHSA 3D34A 3IFDA 1UXSB 3O81A 3QPKA 4NCDA 4OVUA 5DQDL 1DVQA 4MJ2A 1SLXA 4NT6A 4XVJH 3VJ6A 4U05A 4A66A 1AP0A 5FV2A 1EUUA 5SWQB 2ZJSH 3W3AA 3DBXA 3GXUB 1N6QL 1DBBH 3J81i 5F9JA 4L8SC 1HHHB 2QZQA 3WDJA 5HI4D 1G7LA 4P23A 4A6YL 5M3FH 1DVFA 1DQVA 1DL7L 3K7AB 3A5UA 3V0GA 5JR1H 4WIQA 4E9VA 1DOKA 3LEXA 3VQ2C 3CDZA 1SDDA 2WWMC 4X6CB 4KAQL 4X6EB 3TCXA 5C0FB 2J6WA 3BPNC 4MWFA 4YDLC 3BKML 5JPNC 1PMYA 4PRHB 2N7SA 3UBXA 2ARJA 2VO8A 1KJ3H 3ZKNC 4DAYB 3VGBA 3W2DL 3EO0A 4D7PA 3GIVA 4M5XA 1CLVA 4MXWL 5HDQH 4WJ5B 2H41A 2V6HA 4HDIB 5I6YA 3N43B 3FSAA 3MJ8A 2NX5E 3BAKA 1RJZB 4H26A 1JGVL 2X2JA 4NOFA 3MA7A 1A7RH 2Q76B 3TBYB 5MENE 1XPUA 1X9LA 5C0JA 5E1IA 2I9TB 5E70A 4Y9FA 2X6VA 3CC2A 2X5PA 4L3AA 4PJFF 5EZJB 4I4WA 1RZGA 2K4KA 4O4YH 1HZHL 3V7MA 1KL9A 2FD6H 3WNJA 3KPLB 3CPWA 2ICWA 2P5ED 3BVMA 3BIKA 3CSFA 1BAWA 4X8JA 4CAGA 1TY2A 5CBEB 1EH9A 2QPEB 4U0QB 3D8MA 3NE5B 4PQXA 5BJTB 1NR4A 1MHHB 3NPSC 1A4JB 4NZ8A 3DMMD 4AYDC 4H5SB 1LHZA 1CLOH 4WFFD 5J1SC 4A3CG 4HH8A 3SE3C 4RA8A 4AYFA 4PGCA 2PUQT 5EZLA 1T2JA 2R92B 3K2IA 2UZPA 5A2KH 4A3LH 1HNXL 4U1IA 1AXSA 5DEZA 3PIQA 3TESA 1J8HE 4NQQA 4P04A 3TP4A 4BHUI 2CVRA 1AZBA 1LTTD 2OQJA 3FU5A 3JYBA 2VN3A 1N0LB 1JYXA 1L2FA 1AGEA 3KEHA 2HPTA 1LK2B 4RFNC 1KWKA 1I50H 2BVTA 2P5EB 5GGUA 1YEIH 4KMTH 4Q9RH 2OMZA 1X54A 1F2XK 4XVJL 1HNXQ 5K36G 1SOXA 5IWLA 5DJZB 1MFEH 5DVOA 2BOCB 2OKMA 1WTXA 4TVUA 4HEDA 1EY0A 2CO7A 2ZJSL 3OBAA 5EF2A 2F0DA 4N85A 4V0BA 1JQYD 2SNMA 1ZVNA 2EIZA 1QUNA 5IB4B 3MKKA 1LQSR 1N19A 2NYKA 1P7BA 2AGJH 1JR0D 2A74C 2PYFA 4QL5A 5JR1L 1JJUA 4GAJH 3RDTC 1B4LA 1RV6X 4CJ1A 2X1PA 1JWUD 1HU8A 1LNUA 4EEEA 3B6YA 1MRFH 4PJ8C 2Q8AH 4Y9EA 5IUCA 5J5EA 3U36A 2AZUA 1OSZB 2KH2B 2HTKC 3LRMA 3RDTA 3ULVF 5HDBF 1KJ3L 5AYQA 5KYNA 1BBUA 3ARWA 4N1HB 3GSUA 3RQ3A 3SY0A 3W0WA 2VLRE 4TVSa 3S2HH 1UCTA 1DVUA 1R24B 4GS7B 2WYTA 4WKZB 1NAMH 5JIIA 1PRTB 4FJZA 5IOKA 1HILA 2EDXA 2Z8VC 5E1QA 5GSRB 2PTUA 3UBHA 4A3JG 1ED3A 2DMBA 2MHAB 3BGAA 4LUOA 1JGUL 4IOCA 3RVUD 4LF5L 3MRNA 4FI6A 1R46A 4JPIA 1JWUB 2DGYA 5I4DA 3AVEA 1E27B 1YZ6A 4DNTB 3LDBC 2BE5D 4Y4HD 5INCB 2QELA 2WC7A 4JZJC 2OMYB 1FFOB 2IMMA 1F77A 2NY6D 3G6EA 1W6KA 2L04A 2X4TA 3UO1H 2CAKA 5D3DA 3O6FD 1P1VA 4K3JH 2MJWA 4LT7A 1I4QA 4WNQA 3FT0A 3UAFA 3RX5A 15C8H 1HOCB 3OVUB 4MB1A 4LF5Q 5E4IA 5AVTB 1JRHH 1K85A 4KJPD 1D5BA 3JTTB 1K5NA 1HEZA 3QUXC 1JOQA 4R97B 1J9OA 5D7EA 4FF4A 2K6ZA 5JJKA 3WS3B 1EXUB 2OMXA 1CLOL 3KBPA 2EDLA 3MCG1 3GS7A 4MB3A 4LOEA 4O02A 3TYGL 4HIMA 1KYDA 4X99B 3F8UB 3NIDF 5FA4A 4GINA 2DWEB 3VE0A 4YK4C 5FO8A 4TL4A 3T3MF 1BGXH 4XNUH 5GGSA 3EGXA 1LP9F 2JQAA 1A5FL 5EB9A 3VFRB 1NZRA 3DUUA 1NEPA 2R0ZH 1HINH 3NJIA 4LCUB 5JUEH 1PX8A 2W60B 4WWID 2NY6B 5DO8A 4L48A 4RMBA 3O6FB 1BSIA 1YEIL 2X9ZA 4KMTL 4C1NI 1RUKH 2LW3A 4MD5A 2JTYA 2AJSH 4QKXB 3SDDB 4I77H 4N0CD 3MLXH 5IMKA 4JFFD 4D0DA 5D4IA 3STBA 2NUPA 5I28A 4I5BB 2Z35A 2L5TA 4K3GA 1X5JA 3LKPB 5IVXB 3UTPE 3FQWB 2AGJL 2YZ8A 1TKWA 4JHWL 1KJMB 3K4ZA 3ZU8A 4U6HA 1E4KA 2HB0A 4JZNA 2FR4A 2F08A 4KJYB 1A64A 3L5JA 5EOQH 1MRFL 3ZE1E 3VCLA 3SQBA 1M2VA 3DVIA 5L8LB 2JA6H 3ES6B 5IT9E 3GMNA 5LBGA 5I8CB 4B53A 1TSRA 2A83B 4JJ5B 3TEWA 3CC5B 2J44A 2Y5EA 4ZAKD 4J8RA 3JAML 5T1MB 1NAML 3LN4A 4JFFB 1WI5A 1SEBD 4NIKB 3TEXA 3FYIB 1AE6L 4LUZA 1S5HA 1CDBA 2TRYA 2JEAI 1V43A 2V2XB 1NBZA 3KBGA 4A3BB 5EULV 5BVJA 1S7RA 3G6DL 3P40A 2B63B 3QXTA 2VR5A 4N20A 4GRWB 4RA0C 2FO4A 1KIXA 4JN1H 5D1XE 5T1GA 3BX7C 2HX9A 4TPRL 3MOAL 5I6WA 4JI6Q 3G04A 2RHQB 1ID2A 4DKEH 2K33A 1IC0A 5J6HB 4BE6A 4I7AA 2DS4A 3EUDA 3LIZA 2ZX8A 4LLAA 3I4OA 2VIRA 4DSYA 1UURA 4HJSA 4NP5A 1GS7A 5J13C 1GVIA 15C8L 2D3NA 1KY7A 4JRXE 4DR6Q 3ZR5A 4ZAKB 4PRAA 1C5DA 3CVIL 5E1FA 1F02I 3S2DB 3FO9B 3SE9H 3GDCA 1SEBB 2VUMH 4FQ2H 4HUVA 3MEHA 5IT2L 1MFDH 1WZKA 5FPIA 5F7DB 1JNNH 2P8PA 5ESAA 2E7MA 5LMUL 2G3MA 3HR5B 4MA3B 1JGEB 2BVOB 4U1JA 1MCOH 5J12B 1I9JL 3DX7A 3WTUA 3IM1A 3CUPA 4XNUL 1BWMA 7TAAA 1NCWH 3JTBA 2X4OA 4EN3C 3FN9A 3OW7A 3FPYA 3N85H 2R0ZL 1IYJB 2RSNA 1TQTA 1HINL 4UAIA 1AR1C 4M7LL 5KS9B 1LO2H 3J2PA 3QR8A 5LMUQ 1S8DA 3MRDA 5AYUH 1T5XD 3GC3A 1QR1A 4LP5A 1VDZA 1RUKL 2M9VA 2AJSL 2YQBA 3SDCA 3GZQA 4I77L 3MLXL 1X3PA 4OD3L 3IJSB 4LKXB 4XPGH 4ZX5A 1XPRA 3CQFA 1KDBA 3BVTA 5DGQA 3U1SH 3IJ9A 5JJZA 3CCHB 4O51B 4RFEB 4YO0A 1EZUA 4X4ME 1VA9A 4NQSA 5EF1A 4IOAA 2W80C 1QNZL 2H3XC 2BSRB 1CSPA 3CPLA 2G9HA 3C5ZB 3S0PA 2OYLA 4G6FD 2EEDA 3SBRA 1RZ8B 4P2AA 1IGCH 3F7VA 4MJ5B 4P8QA 1KGJA 5EEZA 3A4AA 5HVGB 5C2UB 2EE6A 4AIEA 4NDXA 5KVDH 1T5XB 3P7JA 1CPUA 1M05B 4LGPB 4PJHF 3UMTA 1VQ5A 5FDYA 4FG6D 4K5OA 2N88A 1KHIA 3SBPA 1BQUA 1R5WA 4ODSH 4FFVD 4G7SB 4BQBA 3GHEL 3PV7A 4PP2A 1EAJA 3QUZC 4WWOA 2YUWA 5HGDA 4YFEA 3IJEA 2GABA 4GT0A 4Z7WA 3B7SA 4JN1L 4NKLA 3VXNA 3BVWA 3MNVB 5IOPB 3KOJA 3J80E 3PUVA 5M3FG 3F12B 2VSDA 4O2DA 3V0EA 4DKEL 4G6FB 1QHOA 4NUMA 3VI4A 1ZTXL 2PKDA 4I0CC 1B0RA 3PWPA 4KNQA 4OO1I 5GS3A 1IGML 5FLVA 4F5CA 3U0TB 1QVGA 1WBXB 1W6WA 5C0DA 3UZEC 2KLTA 4MD4A 5HDRA 1FAKT 2YWZA 1FFNB 4RBPH 3UL4A 1N33L 4KRLB 1MFDL 3VVVA 5GADC 4DUWA 2XRAL 4XQNA 5FW8A 1K83H 2YJQA 5C0BD 5I2IB 4G72B 4JREC 1MCOL 1J1XH 3AY4A 5DD6A 2EDOA 5FAAA 3AREC 1BLNB 1HHVA 3HS0A 2EO7A 4BY1H 4FTVA 4XN8A 1N33Q 3NCYP 2GITB 2X3AA 1ACYH 2CUAA 2I60H 3GLAA 3KDPB 3BZKA 1A15A 2ZXCA 5D1QA 4P2CG 3AREA 3AS0A 2I26N 1EK3A 1LO2L 3M4OH 2XZQH 4L4TD 3KWWA 1ZK5A 2E6PA 3F7YB 4UTBH 5GZOC 3JV4B 4MBOA 1D1KA 3UZVA 2BY3A 3LXCA 4XNZB 2V2WA 5LXGH 3CDCA 4EIZC 1OP9A 2DAVA 2KPWA 3HBPA 3L5WA 4FRWA 4IBSA 4PJIA 4H8VA 4JGUA 1BMGA 2EVGA 3HBQA 5DHVH 1HS6A 3UBXI 1IHZA 1I8LA 2L7EA 2NY0D 1T1ZB 2Z3FA 4Y5YA 5E00B 5C0BB 4ZW7A 3TH2T 1T1XB 2GJ6D 1E0OB 4HF5H 2YMTA 3P54A 2NTFB 3FT1A 2XFGB 4MGXA 4WHYG 2HRHA 4A3LG 3LRLA 2QILA 2UXGA 3EDEA 3RE0A 2Q5BA 3A8KE 2Z31A 4GYBA 4UZGA 2KVMA 2E9BA 3BRGC 5CXPA 2ZTCA 3B9DA 5KVDL 5IMLA 3PIPA 4L4TB 4PJCB 1ICFB 1STYA 2ZXDA 4YHHL 2X2UA 3IDMA 3LZLA 4G6KL 1G9HA 3CZEA 2RFXB 1TEYA 2ADGB 4KVPA 4G7HC 2L8AA 2YAQA 4GRMA 4ODSL 3T09A 1A6WH 2PCFB 3TLRA 1NAMB 4JI4L 3EFOA 5EUOE 3T4AC 1V1PA 2FX8H 3BIBX 3GM0A 1DO5A 3PFQA 2ICWI 4FLRA 4RISH 5F7YC 2NY0B 1ZMYA 2ADJB 3VSTA 3EF7A 2GJ6B 4YHHQ 4B3SL 3IXAA 2VXTL 4LLQB 4E41B 1D7CA 1WCMB 4XTRD 4XR8C 1SNDA 4JI4Q 1BVNP 4P5KA 5AUMB 2WHVA 4LSUH 5D96C 4OF0A 1YMMA 1ZKAA 2DM2A 4XNDA 4PP1D 1C48A 1F90H 1ORQB 3WFBH 4PJ5D 4DR4L 1ZLVH 1ZYRC 1TMQA 4RGOS 1T66C 5BQDA 3T1FA 3ZLQC 1O6TA 4JPVH 4ABWA 1ICTA 4K6DA 1BFVH 4Q74A 4LLMA 1HWHB 1T5WA 4MAZA 4D9LL 4AQ1B 1H6UA 2X2HA 4A3IG 2J8HA 3OMCA 4IM8A 3GMOB 3MDJA 4A3GB 2WTPA 4M6ML 1G7HB 5C44H 4DR4Q 1J1XL 1OTUD 1T89A 3BDXA 1AJ7H 3I4NG 4XC1L 5D7IB 3ULVL 1SROA 5I6KA 4CUCA 2P5PA 2ZSWB 3CD6A 4JJOA 3TBSA 2ADFH 2I60L 3ZE2E 1YMHA 2TAAA 4PJGF 4YVUA 4R4CA 2VM4A 2IGTA 2I5YH 1SYDA 4LLDA 5BW7A 1EY9A 5ISRA 1WWBX 1I53A 1JXKA 4UTBL 1MIMH 4PJ5B 3FQNA 5E5MB 1EY4A 5DMKB 1NJ9B 4A38A 1DDHB 4KH2A 5KVGL 1LO5B 5LXGL 2R2BA 2Q8IB 3MMEB 3ND8A 2Z7WA 3EAKA 3OHMB 2I24N 5D7LE 5C0GA 5IM7A 2HMIC 4BUHA 1I7TB 1AGDA 4QNPE 4A2LA 2JKRM 4XI5D 3AWEA 1WC7A 3CC4A 4TNVK 2R0KL 1DZ0A 4QY8B 4HF5L 3JVGC 3TN2A 5EDXA 2ZKXA 4IW4C 1EA9C 4KK6D 3GI9H 1SFOH 1OW0A 1KOAA 4Y52H 3VXPB 4K73A 5C0CA 4PJEB 5FJ8G 3QIUD 4JHUA 2JYOA 1MVUB 2QR0A 1F42A 2WD0A 3GO1H 4CVZB 5BOPA 3S3DB 3V6FA 3FRPA 3GSQA 3H9YA 2PCPA 4X7FC 2CKNA 2UUDH 3VFNA 3KJOA 2AHIA 3IU3B 1HKLL 5JLZB 5GIRA 4BH8B 1TCRA 5JHAA 2B2TA 4JOIA 2VNCA 5F89B 4V1DA 2XVKA 1DOMA 1IEBB 1MI5E 3WEXB 2LT9A 1MWAH 4GFXA 2EXDA 1BFSA 3DNKA 4OD2B 5JDSB 3GTNA 1DLFH 2F15A 4H8WH 3QDGE 3ARYA 1XF4B 1LLRD 1JTPA 3L2PA 1JZ2A 5A1AA 3KPNB 4RGNC 1UC6A 2ENJA 3RVVC 5JTWA 1GPOH 4Z23A 2Q3AA 1MDAA 3RAJL 2Z6FA 2N56A 4EUPA 5E99H 2ICES 1S9YA 3BP7B 3QIUB 4YHOH 3U6XA 3WFBL 4K2LA 3L2NA 4JN2A 5G5DA 3TJHC 2JA6G 4AV0A 4TNFA 4H20H 4JPVL 3X1NA 3CMEA 1QBMH 1ZHLB 1D7QA 3IU4L 5DCCA 2FNWA 3RWHB 2VDOH 1BFVL 1V05A 4G1EB 2YPVH 3KCPA 3OLEA 5EU7E 1NCCH 4PMBA 1IC5H 3ZMNA 3X3GH 3VNZA 1WGOA 6FABH 1A6ZB 4OBRA 1WBYB 5DM73 1E5ZA 2DM7A 5HHQB 2VDLL 4H13C 4WHTB 3E6HA 2MCAA 1SMXA 1ROWA 3G5ZB 2X69A 2FWOB 4AM0Q 2X1WL 3UYOD 5FGSA 3HHRB 4O58H 1GUSA 1Z9OA 3ER0A 1NUFA 2ADFL 1ACZA 3OB8A 3K8AA 2CPUA 2MKWA 3V4VB 2A5HA 2P47B 1QILA 2DN7A 1EAQA 5GXBB 3C8HA 1JF5A 2CM5A 2I5YL 4WV1A 4DP2X 3DGGB 3T0BA 1Q8KA 3VDYA 5MEOA 1MIML 3I6KA 1PS3A 4AZ8A 5KSBE 4DPAX 1NMCC 2GSIB 2BP0A 1B2TA 3HFZB 2AEQH 2E7HA 1EXHA 3PDOB 3MXGA 3SYPA 1CGWA 1I3QH 4NPJA 4ONFL 1RZKC 2VUMG 1W15A 1XCTB 4CN6A 1B2WH 3ESMA 3KBHE 4I87A 4FA6A 3MUY1 1MFCH 4JFVA 5L9DH 3IK2A 4AW4A 3D18B 1JV5B 1NUDA 4BFIB 4PJFB 4NWUH 2NY4D 2NVXH 1KYUA 1HDMA 1O6SA 2VXSH 4WUUA 2F0LA 4R4TA 3GTQH 4TTDC 4GW1B 5KSAD 3ZIMA 1DN0A 1DJHA 1HHHA 5T5FL 2WWKT 2E47A 3RN2A 2X4QA 2WN3A 4F8OA 2CLVA 2HH0H 3O6KH 2CJTA 2IFGA 4FQXA 1UD3A 4ZFFA 4X6BA 3DM1A 1MWAL 4JCWA 5B7EA 1W0WA 1YEZA 4U1LB 3OL2A 5I5MA 4LFHG 1PVOA 2EP6A 3LS4H 3FO1A 4H8WL 2ZWZA 2IGFL 4ODTL 2Q6WB 1FC2D 4O1NA 3CVBA 1UWGH 4Z7VE 4CW1B 1N67A 3MX0B 4U2ZA 1DQQA 1YEEL 4HDIA 4EKJA 2NY5C 5HI4C 3ULVD 3IDNB 3Q9PA 4OIBA 5CORA 2NY4B 1WTLA 1MLBB 1ENCA 5E99L 4K7FA 5KSAB 4XP6H 4HOMA 3OAWA 1DJZA 2WZPD 4P75A 4H20L 4FQ1L 4MTKA 3H8NA 1OB1B 3MRPB 1FC1A 3BQUB 4Q8BA 2YPVL 1NCCL 2DIJA 4HMEA 2V37A 2WGNB 4H8QA 4QY7A 1PH7A 3Q6GH 1OQOA 2HKFH 3L3JA 2H6UA 3FAWA 3MUJA 1I3GH 1HZ9A 2GTZB 3JWDC 3X14A 3PGCB 5T3XH 2PPCA 1AQHA 4XCCH 4O58L 4MD0A 2XRQD 4I1RA 1A6AB 2R0WH 1RIUH 1A0QL 4NCC2 1UJ3A 5A35A 1A4AA 5HDBB 2KA7A 4I0KA 3T2PA 3PUYA 1EEYB 4APXA 2AQQA 5L2KA 5IVNA 1X7QB 2OMTA 3KJ4B 4F3FA 1CZWA 1Q1EA 5E08H 3BQVA 1OPGL 1Q81C 1RURL 5KNCA 3W56A 3ZKQD 3I3BA 3H4HA 3VD0A 1PYWD 2EY5A 5FKPA 1X65A 4IBYA 4N6QA 5EN2A 2XX1A 3G6JE 4ZQTA 1JZIA 3ECBB 3K2MC 4MDRA 3SJVD 4BZ2H 5FYJU 3HC3L 1NM9A 2XKUA 1GJXA 1B53A 4LAQL 2FZ3B 1OP4A 4JPBW 4NHCH 3DMMC 1A6TB 4NAQA 2IOIA 5L9DL 3MEFA 3S14B 2R69A 2N49A 1LE5B 3ARDA 3ILQD 1TZIA 4MRBA 4NWUL 3VA5A 1H5BB 1U92B 4PJ7F 5LB1A 5LDUA 3DMMA 2VXSL 12E8H 1WLHA 4BY1G 4B9IA 4EI5B 4Q97A 4U33A 1FVDB 3FKUS 4OCRH 4KRPD 3KDMB 3VYSA 4LOUD 4O2EA 3MCLL 3O6KL 1S7QA 1EUJA 3A4FA 1YNXA 5CJBA 1PYWB 3FONA 4OF6A 4Q58C 1G9EA 2DKSA 2AEIT 2EVHA 4UY8C 2QLVB 4NBZB 4X98A 1UTDA 1I1YA 4GS7C 2AC0A 3LS4L 3NIDB 1O80A 5I18H 3T3MB 4WJWA 1VDGA 2E0PA 1LP9B 4PTTA 1ZY9A 3GMMA 4KI5F 3A6CH 3LSOA 2LLNA 1VPOH 2ITDA 3BYTA 3TWYA 4WY7H 1EQWA 2XIWA 3VXMD 2EYMA 2COQA 5BMFL 4XOCA 2WQSA 3C8KA 3V0DA 4KNTA 4ZFZA 4LCWE 1J18A 4XP6L 2D7QA 4ZOBA 2YARA 4ZO6A 4MZ2A 2G0LA 4ODUB 1DE4A 1W0VB 4KRPB 3BO8A 3RP1A 4D0CB 1KC5H 3BZDA 3G7TA 1YJDC 2DYRB 1M53A 5EO1A 2IH8A 3VFWB 2EICA 3HKSA 1E27A 2W0FB 3LN9A 2JELH 2HA1A 4LDEB 4QRRE 2PPEA 4M8RA 4QRPD 3NJFA 1F9QA 4R83A 3SKNA 2BOBA 4HHGA 4AM0B 1FFOA 2FWUA 4LSPH 2EVBA 1OCRB 4AJVA 2JN4A 4E41D 1EDYA 2XN9A 3Q6GL 2HKFL 1ONLA 5LG6A 4R97C 1CVRA 1I3GL 1FL0A 5I30H 4NGHL 4PRNB 4FG2A 4UT6L 5I1AA 3ZHFA 4YHNB 4DAPA 3OAZH 4NNYB 4XCCL 2A6ED 2VDLB 3S37X 1DJSA 3GMQA 3ATEA 2R0WL 2DEXX 1RIUL 3VXMB 5DMYA 2H1EA 3WIAA 4BSWB 1FH5H 2E74C 4XPTH 1JC7A 5IODA 5DYOB 4RMFA 1BX2B 2UY7B 3RVUC 1RIHL 1CSQA 2ZM6L 1S3OA 2O5IC 2BE5C 4GAYA 3ARGA 4Y4HC 5ICZB 3APFA 1H9MA 2NY6C 4N0FB 3O6FC 3V0FA 4ZMPA 1LYLA 3V95A 1BXUA 4QRPB 2EDFA 4Y4HA 4BZ2L 2XA3A 3U2SA 2B2UA 3IMBA 1A7NH 1F1AA 1WCBB 5E6YA 4KJPC 2ZM6Q 1J05A 1ILUA 2D3VA 3QO1A 2A6IB 4UAHA 2GCYA 3VYPA 2FMCA 1RZJC 3J7A5 3EYVB 4P2YA 3ZR6A 2DF3A 5ICYB 5C44G 4P3CL 2BA0A 3TEZA 4FQIH 1WZMA 4OI8A 4FQHB 4KZDH 1UVQA 3COOA 1BIIA 3IJHA 4GEIA 2AXWA 5B3JF 5FDWA 5CZVH 5KJ4A 1GUTA 1IEAA 1L1OB 1F97A 1F4XH 1YN7B 2DJMA 2JMRA 2DLIA 3EJRA 2KHJA 4A6YA 4BSJA 1QRNE 1KXQE 3PO2H 3UC0H 1QFOA 2SOBA 3IFOB 5I8CA 4N0CC 5I18L 3S2CA 1MWAB 3FKIB 1JGLH 3LN5B 3G5YB 1S9WA 2D7OA 3DJSA 4KHPL 1WTVA 1DJRD 2X4UB 3A6CL 5T1MA 1VPOL 2F1ZA 3W2DA 1BDOA 3GTGB 4OD1H 4U7MA 3NBHB 2X12A 1VRSA 3N1FC 1ZGLM 4KUZH 5DRXB 3V0JA 3EJPA 3N1GC 4PV8A 3EJUA 1IO4C 2FECI 4P48A 5EUKA 4Q6IB 1Q0YH 4KHPQ 2B1HH 3NCYS 3OM3B 4KZCA 2XVLA 4MMZA 4AQZA 4Z3FA 1KUMA 3ILDA 1XB3A 4DJMA 3EYFB 3OKDA 4IJHA 2O5NA 2Y1ZA 1B2YA 4LSPL 4UOZA 4S1SL 4JBSA 4XBEH 4ZAKC 1JHLH 3DV6A 1AQMA 1L0PA 2GA4B 4KKNA 1G0YR 2HJLB 4GI8A 2RHEA 5I30L 2Q20A 1MSPA 5I6LA 3WKMH 4QWWD 2G5BA 2IF7A 4KO5A 1QWNA 5I76B 3RURA 3MRBB 5AVYB 5FYKH 5J12C 5C4HA 4GRLA 4R26H 1DUZA 1KIUB 4KO9A 4PJHB 4U1HA 1SVCP 1S7XA 3PXHA 1T0NB 4JDZB 1I3RA 5EBGA 5AAMA 3T3PF 1Z0MA 3KW8A 1P7QB 3X13A 1OO9B 2CDGB 4NHUA 2VZSA 3Q2VA 4QDGA 3DXJC 3WDNA 4OZ4A 5FGBC 1IAMA 4HUWB 4JI2Q 3AXHA 4NKDB 4DR2L 1OCWH 3GDEA 1AN8A 4S1RH 5J7CC 1FA4A 1E9QB 5FECB 1F3JB 1YHBA 3KW7A 4BWTA 1O5PA 3BPCA 4HJIA 4KV5F 5T1DL 4I7ZC 3MRLA 1TYJA 1I3QB 1RF2D 2VZTA 3NPPA 2BNUA 4JRYA 1QZNA 5D2LE 3IJSA 4LKXA 1KCUH 4FQIL 3D9AH 3MAWA 2HFFA 5F7FA 2ZD0A 4QR7A 4KK8D 3CCHA 4I9WE 4NJAL 3L48A 2NVXB 3SPVB 3IF1B 2XFXB 2R27A 1RZPA 3L08A 3NSDA 3HKZB 1EFXA 2B2XL 5I2YA 3BAEH 1MNNA 1CI5A 4RZKA 2FXQA 2ZPKH 4GQPH 3Q0AA 4NQEE 4TSBH 1OTTD 4E42B 1FZKA 1QSVA 4LF7L 3QDJD 5LCVH 4L8DB 3ZQXA 3FB6B 5DS8B 1RZ8A 4S3SA 1DLHB 1WD8A 4A3KB 2EH7H 2JB6A 3LZQA 2GK2A 5F72S 3F04A 4U1SB 4M4RB 5ID0B 1E6JH 1VQ9A 3W3BA 3T0EA 1GJWA 1RH8A 4PLJD 1AO7A 2BMKA 1UUNA 4PCTA 3QUML 3WN5B 1QR4A 1I85C 2J6EH 3QW9A 2BIPA 3M8OL 2MNAA 4DTGH 2QMKA 1JB7A 1HXMB 2J72A 1VACB 2PR9A 4GKZA 2YD7A 3J81L 2R23B 2ZQKA 1I85A 3NK3A 1KCRL 3QP3A 5F7MC 2Q7YA 4IJLA 1EJ8A 4HALA 1LV9A 4TVPL 3UAJD 2V2TB 2EJFC 3Q6FB 4MNQE 2AQ1B 1G1CA 3B9EA 2HAZA 1S7VA 1JHLL 1P2CA 4MS8D 1OGTA 4FG6C 4HFWA 1PYSB 4MAUL 1CGXA 4W9FC 1M71A 3RWDB 4JM4H 4Q6KA 3T8MA 2VDKH 1VQ4A 5DFWH 4FFVC 2OBGA 3NQTA 4FGMA 4OQTH 3WKML 3ZHKA 2CJ3A 2QVKA 3UYPA 5C4JB 3UTTD 2XPYA 1FL5A 2E27H 4N9GB 4R26L 1OLZA 2PZTA 2B77A 1VGKB 3HC0A 1UFUA 3WYRA 3MFYA 2WAQE 2YU9B 1NCIA 5AD0B 5EEVA 4LVNC 4UQ2B 1WA0X 2DICA 2F54E 1WG3A 1NEZB 4F7MB 4LK4A 4YDVA 3DIDA 4Y1AE 4LNRA 1EQRA 4MSWB 2I27N 1NGYA 4S1RL 5IG7B 3BAXA 5INDB 1G6RH 4XNZC 3VMOA 5DC4B 2OMNA 4G6AD 2VH5H 4XXCC 2NYZD 2PO6D 5BO1H 3IRZA 1N5AB 3LXUX 2HLFD 4GZYC 3EYUH 1SYGA 1EHLH 1CFNB 3HMXL 1KCUL 4UNUA 2IAMA 5C0AD 3DX9A 2O5ZH 3WMQA 3UTTB 2BIOA 1T4KB 3QQXA 2VZ3A 2BW4A 4QTHA 3B7UX 2ES2A 5GGSY 3VRIB 2HKAA 1OAYH 3UPAA 2OK0H 1JBJA 3D51A 4YDJB 4GO6B 4KKAD 3BAEL 3SK4A 2YBGA 1R3IL 1A3TA 4TSBL 4UMGA 3ET9F 3TIDA 4Q2ZA 2J1YA 4KHVA 1AR2A 3EN2A 3NTIA 5LCVL 1NCHA 1C8CA 2XWCA 4LO9A 3HLKA 2EH7L 1JPGB 3FB5A 2KS0A 4PGEA 2CLZB 2EYJA 2XV0A 4QXWA 3L9RB 1NMBH 1E6JL 2PO6B 3ENEA 1P5UB 3HC2A 4J2XA 2FX7H 1G6PA 3CMOH 3FFOA 5I5RA 3K6SA 1K8MA 1PZJD 3P3UA 2NY0C 3DWQA 5C0AB 3H0GB 2DQDH 4D0BB 2DMKA 5AWNL 1QYGH 4N9TA 3C6EA 3WE6A 4HA1A 43CAB 2XPZA 2AMCB 2XG5B 2EINB 2E4FA 1N36Q 5DEFB 5B38A 3VUAA 1M7DA 3VD7A 1ZLUK 2OTLA 1L9QA 1AZVA 4LLYA 5LDSA 1IBHA 3LEVH 4YSRA 1QLEH 3QSKB 4ODXA 2ZX9A 3GMRB 1PZ5A 1TIID 1G7JB 4XOAA 1MW2A 4WWNA 3VQMA 4YJZL 1JI2A 5D8JL 4ZTPH 5KVFH 4AQ1C 4OQTL 2C26A 4R4OA 2F6AA 4G2AA 4RGMA 1CD1B 2R15A 2VW7A 2BH0A 3BDOA 2E27L 2QKIB 4JFZH 4ID6A 3REVB 4DFAA 2WXIA 4YLBA 1NA8A 1A1NA 5B38B 2ERJB 3GMOA 2AQ3A 4R0LC 4ABVA 2A9MH 4RX4D 5IW6A 4XTRC 4E9XA 1PY0A 2QA4A 3FTWA 3NZHL 5SV3A 3J81j 4R0LA 1UUPA 4PP1C 3GS0A 3RIAK 3WMPA 1ZHBB 3UTOA 2ZUSA 4R7XA 3UJTL 1A4BA 4TUKH 5F1NB 1Z7JA 4KHXH 3L7ZC 2VH5L 4L6TB 4TF4A 2DY2A 3D33A 1B9MA 2I9LB 4EE2A 3Q22A 3BLPX 4UF7C 3GJFK 3EYUL 5GRZA 5IJKA 1EHLL 5BQ7B 2WLNA 3BD5A 4WO0A 1MFAH 2O5ZL 5KBKA 4XB7A 1OTUC 2RAMA 2KL6A 3GSWB 3RPKA 1N3NB 3IMWA 3UTSA 5IQOA 2LVEA 2Z93A 4HIJB 5CEZH 4HWBL 43C9A 3S1MH 4OFPA 4V11A 3IDGB 5EIIG 1SY6L 1Q46A 2R1WB 2FFKB 5AFWA 1IKNC 1UXWA 1T1YB 1YYLH 3FFDB 4PMEA 4TVPD 3B2XA 3VXPA 4AGLA 2X09A 3LVEA 2EKSB 5L2JA 3G5XB 1FCCA 4YXLH 4D3CH 5HY9A 3V4UL 2L1BA 3S17H 1NMBL 2P8LB 5BZWA 1GA2A 3UIZA 1KACB 1DR9A 5JLZA 4YE0A 1XT5A 1ETB1 2FX7L 2UXCQ 1HE8A 1PG7X 4XI5C 3QH3B 1N4XH 1OD7A 2Q0ZX 2XWXA 3GB7A 4ONHA 2JKIS 1YQ2A 5GS0D 1HFGA 3QUMB 5F96H 1EIHA 1SLJA 5IMMA 3FB7B 3LPPA 1QYGL 3V0WL 2P49B 2X7LB 3FQUB 4IS6B 1ESRA 3O45B 3D4ZA 4KK6C 3AMLA 4NENA 5JEAG 1F2MA 1CF1A 4NZRL 1NCDH 4FABH 4DU9A 3GZOA 4U4BA 4PWEA 3QIUC 1GSMA 5IQLA 3UP1A 4UV7H 2VZUA 2AF2A 1N12A 4Y2DA 3LEVL 5DRWB 1IL1A 3AT9A 1X4ZA 1QLEL 5D5ME 3P30H 4JQIA 5JEAJ 1T22A 3BP7A 4HKBA 5EORH 3M7FB 2XQ0A 2FHTA 3TH4T 4JDTH 3ZE2F 3PO2G 1PLAA 1HUNA 1X3FA 4ZTPL 1WH0A 3VAEA 3CCJA 5SWZD 1C7TA 2FLMA 4CADB 1XSOA 5HY6A 2BXZA 4N6RA 3S96A 1I7UA 1T6BX 4LHUG 1A6ZA 2C3GA 4X3TA 4U7KA 5HHQA 3MA2B 2A9ML 5KYYB 4QHKI 4WHTA 4WGVB 3IGKA 3RNKB 3H1ZA 4HBQA 3G5ZA 4QTIH 4B50A 4BH7B 3ELAT 4L5RC 1E4WH 1MXGA 5IB2B 1UASA 7PAZA 1XVSA 2B2WA 4WDIA 3G71A 1TU2B 3I6GB 3MA9H 3T65B 4TUKL 2HVJB 3PL6A 3D09A 4KHXL 1NSNS 2AVGA 1RUPL 1AQKL 4HKJA 4J6IA 2CR0A 3ISYA 5IHLB 3MNZA 4WI4A 4NO0B 3EF4A 1OV8A 5SWZB 1QQDB 2WTOA 2AABL 4KDWA 1TWGB 3PDOA 4DNRB 1A47A 4M5YH 1J0KA 4LSRL 2CIKB 3QJQB 4JE0A 3QNYA 2NOYA 3R06B 5D7JD 4ZXBA 5J1AA 3BH9B 4JANA 1JZ7A 2Y72A 2KZ1B 1XR9B 2BVPB 2XIDA 1YYLL 3NDZE 4MTMA 2XCMC 2FINB 3IXTA 4P2QE 1LVEA 1K4DA 4FNPA 4DETA 5K9KB 1AOHA 1BCPD 3FPPA 4HVBA 1T21A 1WPCA 1XJVA 2RA1A 4YXLL 3OIPA 1MH5A 2ISDA 3STZB 3X17A 4QIWB 1J88A 1ET7A 1CT8A 3LQAC 4HWEH 3GI8H 1IT9H 4QEGA 4A3FH 3EQLC 1JZHA 2J12B 3DTXB 3MROA 1N4XL 2H3NA 1ET5A 2NX5D 3FS9A 5F70A 3WTSA 3RZCD 4EX5A 3BJLA 1JF6A 5F96L 3OMAB 1CFTA 3N04A 4HSCX 4KKCD 2XBTA 3U9UA 5C8JB 5MEND 4I8DA 5GISH 4TUJA 5IB1B 4J6HA 3Q8BA 4C56D 1SJHD 4XWOD 5D7JB 2NY4C 1NCDL 1W8EA 4HWNA 1UD5A 2OWOA 3JWOL 5ITBL 2Z64C 3VSQA 4ABQA 3KLDA 5IT9L 5H35B 5KSAC 2I85A 4ZO8A 1BVLB 5FB8B 5FUCE 3FO0H 3IDNA 1UYWH 3B3IB 3DIFB 5C0ND 2SEBD 4HG4K 1FFPA 1MLBA 1VFAA 3QIBD 3QORA 4KJQD 4N8VG 5EORL 1A66A 3MRKA 3HS8A 4JDTL 3DJ9A 4O2FB 4OB5L 4BQCA 3BQUC 4OKVB 1A14H 3VXRA 3PABA 1T03H 3PJLA 3UEQA 3S3PA 1EVTC 4F9LA 4PJ7B 1U8LB 3EH5B 4HS6B 1RJLA 4A3DH 1J86A 3H2WA 4U6XB 4RRPG 2CE6A 2OMVA 1X9UA 5GGTH 4X6DA 2NX5B 3RNQA 5H4YA 3RZCB 3GKWH 4JV5Q 5JQHC 3EKCA 4QRSB 5MENB 1KTJA 3NWSA 3RLOA 4IEFA 2DQCH 3ULVC 1KBGH 1SJHB 4C56B 4QTIL 2EUVA 4BXSV 5ELNA 1J8HD 2XWEA 1RJYA 1E4WL 3SKMA 3V6OC 2VL5A 3B2MA 3KJ4C 3MC0B 2VUKA 1P4IL 2NNRA 3PP4L 3SYOA 2SEBB 1IFRA 3QIBB 1UEAB 2X40A 4L8JA 1AGFA 3C5JB 4K5LA 3TNNA 3II1A 4X3UA 3RD4A 2WZPA 2VRKA 1FNLA 2AV7B 2AHOB 2F58L 4UTBA 2IBZY 1VQDA 3G08B 3QC5X 5BN5A 2ZWNA 3F64A 5D7SH 4Z77B 4IBTA 1DDTA 1MBYA 2CJUL 3RWCA 2YD0A 3MLWH 3O4LE 2OJ1A 1H5BC 2VJXA 3F7KA 5K5YA 5DHVA 1RFDH 4NQVA 1J8HB 1YQVL 1NDGB 4P4RB 4M00A 4F8NA 1TUPA 2CK0H 4UNVA 4AGNA 2PMZB 4LHJB 1PCXA 3ARBA 4HJ0D 1U6AL 3RB7A 1HE7A 1AMYA 3FSOA 2VLRD 4QHUA 4HWEL 4C3JH 4L4VE 4QXTB 3GI8L 3BWZA 3EFFA 4JM0A 3MBED 2DN8A 5DJ8B 3B2VH 3C5XA 1L9TA 4DF7A 2W0PA 3NOIA 5DC2A 5CM1A 5HPMA 3WFEL 1SYVA 1HSAB 3SJVA 3B7RL 1XL4A 2WZ0A 3QJXA 3ASOB 2OR8A 5HJ3A 1NAKH 5JW4N 3FTYA 1EIBA 3ILQC 1NCOA 5IB5B 4GG6E 1JCVA 3ZHNA 4PB0H 3LD8C 4OCMC 4WZ9A 4ZDHA 4OI7A 4IQZA 1T83C 4CN4A 3ZL1A 3NJVA 1UYWL 1TNMA 2NSQA 4KRPC 2EECA 4OLYH 4ZD3H 4RQQA 3K81C 2E6JA 1P9MC 4LOUC 2GEQA 2QHRH 2WCSA 1T83A 1T03L 1D5ZB 2DWSA 1A14L 1V5JA 4JZOB 1CJYA 5B7MA 2VLRB 5GGVL 4ODUA 4QAWA 3DYPA 1W0VA 1YSOA 3D12B 3L7FA 3HUJF 4ETQA 1Y8OB 4WI0A 3KF6A 3TCLB 1O5DT 2J88H 3MBEB 4Y19D 5ID1B 4OT1L 2AAAA 3A67H 1IQDB 4GSUA 3GTLH 4QF1A 1XGQB 2NR6A 5IHZB 4U31A 3GKWL 4JQVC 3QZOA 1A3VA 2WB1G 2O6DA 3MBWA 1K8OA 3FT4B 1RK0A 5T1LD 4TSCH 3J80L 1BZ7A 2DQCL 1KBGL 1QX1A 2F0GA 2KERA 4JQVA 5I1DA 2RKSA 1CGSH 2ZKMX 1BUVT 4NRXA 4JG9A 4MJIA 4I85A 3WEOA 4WTQA 3L1EA 2AXHA 2R1YA 4XN4A 1DVYA 4JY6B 4WQOA 5CSZA 2MQCA 1FIEA 4J3OF 1NSNH 1WP6A 3SCMA 3U82B 1R3KB 3TBBA 2YIHA 3A6OA 2ED6A 2E7DA 1QFHA 4FFTA 1PH9A 2H0FA 2EABA 5L4IA 3S3SA 3TP7A 1Q90A 3G6AA 5ICZA 3HNTH 5I73B 5AAWC 5E8NB 1B44D 1O78A 2F4IA 4Y19B 3RR5A 4LF9L 3P1HA 3LHAA 2OL3H 1ZS8B 5D7SL 3I56A 2F9BT 2IV9A 2ZOKB 4XMVA 5TK4A 2RH0A 3UTPD 2Q1EA 1U8NB 5HYJE 5JOFB 3PWVA 2A6EC 5DI8A 4U1GB 3LQZB 5ANMA 4R96A 5T1LB 1LGVA 4S2SA 4XNMB 4HP5A 3DRTA 3D50A 3HG3A 1RFDL 1NGXB 5I15H 1EFID 2E8GA 3QVAA 1CXKA 2D9CA 3SGJC 1CICD 1DQJB 1Z66A 2CK0L 3C12A 4PY7A 4F8LA 3QJZA 1L1OC 4DHLA 4XPAH 2NTSA 1OSPH 4WK0B 1NEUA 5H2BA 1W0YT 2C4FT 1NUGA 1DGSA 4YSDA 2BZ7A 1FL6B 1U2CA 4LGSB 2ATAA 3MCYA 2ATKB 5DAUA 3WOEA 3D85D 1Y1WH 3KUPA 5I16A 4H8WC 1KYAA 1U9KA 3HZXA 4LF3A 2X6MA 4FQLH 1NAKL 1RL1A 2JCCF 1ZT7A 5DJXB 1MWAA 3QYMA 1TWHB 3K71B 4GAGH 4PB0L 2EZVA 4OCYH 2DIBA 2RBLA 3LPOA 4MYWB 4BK4A 5D1XD 3ILPB 2AANA 1X44A 3OAYH 4OZIA 2WTRA 4P0DA 3K58A 3N1MC 5CJQH 3ZE1B 4Q6IC 1CICB 3PU7A 2WUBH 4ZD3L 3NFPA 1YEDB 1JRHI 3I3EA 3W0WE 2L9HA 1ET8A 3GNMH 4XNYH 1THCA 2DEWX 4JRXD 1S5FD 3KPOB 4Y7NH 1I4XA 3OOCA 5G4NA 4KY6A 2J88L 4GIOA 3KCWA 3A67L 4XYQA 2F8OA 1GSKA 4DVBB 1WT5C 1X55A 4AL8H 3EJCA 2YPVA 3VMNA 2IQ9H 1TY0A 3LZRA 1HHKB 5EOTA 1DJXA 4JMNA 1WT5A 1PZ2A 4U6YA 2F0HA 1CGSL 5CEYB 5D7HA 2HTLD 4KJWD 5D1XB 3CVHH 4J2QA 3LKRB 3DEPA 3FTGA 2Y0SG 2GJJA 4LMQE 1J12A 2F7OA 2YXVA 4HXAH 3ZGIA 2X1QA 1IL8A 2DLEA 2A99A 3CLEL 4M61B 4Y9CA 4JFOA 4P07A 1SEQH 5FYKU 5BXFA 4AMKL 5ELFA 1BF5A 4JRXB 2AKRB 1CQYA 1QFWL 2CDGA 2KPNA 4HJ7A 2PWFA 4EKXA 2A4ZA 3K80A 3MTSA 3QUKA 1SYBA 3B6SB 4BK5C 3CFJB 5CKGA 2OL3L 2G5DA 4NC1E 4WWKA 3NTKA 3EOBB 3FW6A 3AQQA 4WEEA 5B1BB 4QWWC 5IKCB 4AGMA 3PO3H 2Q3ZA 4Z9CB 4LSDA 5JHDE 4DK3A 4CKCA 5I71B 1MRCH 1QRKA 1R1CA 2V0AA 3BP6A 4O2CA 5I15L 3LX9A 4K0KL 3FMGL 3KLLA 1C5BH 3UABA 4IUUA 3U9SA 2APFA 1I6HH 4R4BA 1VQ7A 4QI3A 4XPAL 1W16A 4JR9H 4EQOA 5ESVA 3IGFA 4NXML 1JMCA 3F3HA 2B39A 3FUIA 4OUUA 4XXWC 1EJFA 3IF1A 2NY3D 2DLFH 3L4XA 4M48L 4IU2A 5C3EH 1JK9B 2COVD 1YDPA 4K0KQ 1M9WA 5FKAA 1GGTA 5DZOA 1ZHNB 4N4YB 4ZPTA 2B2VC 5IROD 3FB6A 2KUMA 1BCIA 2WY3B 2F0QA 1Q9KB 5AFAA 1S9XA 1QUQB 2Q2UA 3S1QH 3UC2A 2K14A 4WRLA 2X6AA 4GAGL 5F7EH 5BZZA 3RBGA 1VFMA 3WKYA 3HI6L 1M90C 4KK8C 2WBJD 3CG8A 1SGKA 1YRKA 1I9IH 3RA7L 4ZZFA 1PD0A 2WUBL 4YWMA 4YLCA 2WJ7A 4BINA 4EAEA 3H3KA 3RB5A 4J15A 2WWNA 3UTZB 3GNML 4R84A 1UB6B 5EBCA 3L1GA 1OTTC 2R23A 3IL8A 2NY3B 3IFLH 3LNGA 1JWMD 1PAMA 4GKLA 5IMOB 6PCYA 3QQ9D 2W94A 2O6CA 5DC9B 3QDJA 4A3FG 4A3DB 3FO2A 3PG2A 4RWYH 5HI5D 4HIDA 4YHLH 3OTOL 2VABB 3W1ZA 4PLJC 4AL8L 3T13A 4IURA 4HJAA 1NGZB 1TNNA 2IQ9L 4QRUA 1JZ6A 4P3DB 1DCEA 1F86A 1AIFA 2VXVH 1PCSA 2WBJB 3NFSH 1JF1A 5D2LF 8FABB 3VNYA 4P57B 1KCBA 4JDVB 4DQOH 3OTOQ 4JLRB 5TH2B 3QE5A 5KYUA 1JZDC 4YS4A 3UAJC 5ITFB 2Z91B 3Q8CA 3W9EB 3FU6A 4MHHI 4DV7L 2Y69B 3HCVB 1JWMB 3UAJA 5DD3H 1H0DA 3MJ7A 3FQ2A 4MS8C 3VX1A 1BOYA 3CNKA 4BQ8A 3UEZA 5MERA 4N0YL 1PA6A 4PJ9D 2MO0A 1SYSB 2V7NB 3IRBA 5C1MB 1R33A 3NSJA 4J4PD 4HOXA 1YNTA 1CFBA 4GXFA 4AUUA 2MP1A 4BZ2A 2APBA 1OXXK 3TS2A 1KB3A 1MRCL 4DV7Q 4H40A 3NWTA 4WK2B 3NIFF 4LKCB 2VERN 3ZZQA 4A7QA 5H94B 1C5BL 1JE6A 4F58L 3H6MA 1GD7A 2NYYD 4Q5VA 1IAOB 3GXMA 3K4AA 4L4JA 2A77H 1I8IA 3NYKA 1R75A 4LOFA 4NNPH 1OM3L 1Z9FA 5JW5B 2WQRA 3QJVB 5I8OH 2WKLA 1NDMB 1M42A 4E5XB 1B70B 2EYLA 2VQ4A 2DWXA 2C4FU 1PX3A 4RDQF 1RVFH 3P0YH 3S5YA 1WAAA 2FDBP 4C3JB 4QJ5B 4G6AC 1QBBA 3WMSA 1E2ZA 1OCZB 4WCYL 2PO6C 3RFZB 1P5UC 1NGQL 2J7LA 2YEZB 4PJ9B 4AYSA 1AD0A 2HLFC 3KLAB 4XP4L 3NH7L 2CLZA 2LY7A 5F7EL 1GJIA 2NYZA 5C2BH 2PO6A 3PUCA 4FEIA 2HQLA 4XO5A 1XD1A 2ZG3A 4J3VA 1CE1H 1KTLB 1QWYA 1I9IL 2AK1H 3T1YL 3DYOA 1KIRA 3QUHA 4H2AA 5FHAH 3U46A 2XI9A 2BHYA 3IAGC 1MI2A 1YHAA 2XKNA 3BKJL 4KKAC 4U673 4OONA 5EPJA 3IWVA 2G2RA 3APCA 1QE6A 1KPRA 1PD1A 4F7CB 3GHPA 2YLHA 1ACCA 3F6JA 3RZOH 1U30A 2XIIA 3HOYB 2ICEA 4FXGB 3IFLL 3FL7A 1OP5H 4B9KC 1LEIB 1HXYA 3MU3A 4XYOA 2FEEL 2Z34A 2NB0A 1AD9A 1FZOB 5FWRA 5LXVA 3C6SA 4NO3A 4FOMA 3QDHA 4N28A 2D0HA 4J8QA 5EUOB 1EYDA 2E76C 1L9SA 1GL4B 4QUOA 4W93A 4B95C 3FU9A 3MLTB 5J1TC 2W88A 2WLIA 4WO4A 4XGZB 2QKIC 3HLAB 4F8QA 4W9LC 1SXBA 3I84A 3NFSL 2ERJC 1NPUA 3CU1A 3DWTA 2L12A 1RHFA 3DSNB 4H1LB 4HBCH 1SQMA 1SXCA 2WBKA 4DQOL 4BWUA 3N6RA 4C47A 1PKQB 4F5CE 2YOCA 1STNA 2XQYG 3U4EB 4NX0A 5ISZA 2IH3B 9CGTA 1NFIB 5D4HA 4DK6A 3B9KA 4GNXA 5EIIA 2L15A 2J5LB 4URKA 5DD3L 3UE0A 4G6JH 4QXGH 4IN3A 5D7LD 1NICA 3EJQA 3P9LB 3SGKC 1ZHBA 5JMOC 1U4FA 4OL7A 2L4OA 3GPSA 2BHZA 3K5MA 5ICXA 1NINA 2I9LA 3PUZA 1NGWB 1PY9A 2ADIB 4C2MH 4PGJA 4NI3A 1P7HL 2Z6KA 4F24A 4EVOA 5D1QE 2BSTB 4NNPL 1DXMA 2A77L 2NN6H 2HRPH 3ZE2B 1O7IA 1SJMA 2R1XB 3B9VA 3O3UN 3KWVA 4ANXA 3HNSH 3V5HA 1HKFA 1T7XA 2XG4A 2E86A 3LXAA 4XCYA 4RESB 5EPLA 3KPRA 3PLYA 1JWSB 3KPMA 1E1TA 1GUGA 2F0VA 1RVFL 4MQ7B 5AL8A 5DUMH 1TIUA 3HBZA 1MI5D 2H2PD 5D7LB 4LXFA 2GT9B 4U1NB 4IHOB 4LLUB 5DK0B 4M4PA 3A4EA 2DQJH 1CXHA 3EGSA 3QC6X 2EKSA 1VENA 3ZZ1A 2O5YH 1RERA 4HFUL 2P8LA 4DP4X 5C2BL 4Z7UA 2F0KA 2IPKA 1JJCB 4JHZA 2XJKA 1CE1L 1NBVH 3NJGA 3CN0A 2EQDA 5KIXA 1MCKA 2EYRA 5E94A 3K2UL 3ALPA 5KWYC 3IGLA 4Z0XA 5LWYL 4LHUA 4A3GG 3FB7A 4XE5B 2CGZA 2HFEB 3J81c 4M1DH 4KITB 1UH3A 1HC1A 3HR6A 3L5XH 4LPTA 3K91A 3SDXF 3OKKA 4TN9A 1WTHA 2QGCA 1MI5B 5DRWA 2BJMH 2BS9A 2FH8A 1MJJA 4R3SB 4NKMB 3ZZSA 1Y1WG 5HHNA 2XBDA 2IWFA 4PTUA 3JV6A 3CFKA 2WZ5A 3DDGA 5GS0C 4KC3B 5E7FA 1RIVL 4CVXB 3ME0B 4LSQH 1YMME 1EBPA 3BZ4B 2A7BA 4HX1B 3O13A 2NNCA 1IV8A 3ISRA 3BESR 4AEIH 2C7UB 3G5VA 2BZDA 5D6DA 4OZFH 5BOZG 2C9PA 2R4RH 3WFZA 2NCMA 1BBJA 4KDTC 4G6JL 3QUYA 4QXGL 3PUXA 4B60A 2C9RA 3MUUA 1I9EA 4DERA 1U8KB 2J20A 3MO1A 2PTTA 4A2HA 4P2OD 3C60B 1YEHL 4B3TL 1JS4A 2X4PB 1QEXA 2Y5QA 3IRCA 3TBWA 2WQXA 5HGHB 2OX5B 4IRJA 3JVFC 1L9NA 1V3LA 2IWGA 5I1JL 1FO0H 1HH9A 3GSVA 1QQDA 4WJG3 3ARQA 4PGBB 1ENFA 1GXEA 5CILL 1H6TA 4B3TQ 3R19A 3SOBH 4BELD 4ZG1A 5A2JH 5AB2A 4AVKA 4YFLI 1FL3A 3L3KA 4QYOB 4Q9CA 3D4RA 4Y0GA 4H8HA 3HP3A 2F8IA 3D05A 2QBWA 2WO2B 3HW7A 2GSGA 4GSQA 3IAPA 1F6AB 1HHJA 3QWRD 3JV5A 1YJ9A 4OIJA 1MKHA 4KJNA 2PW2A 2WYIA 3CAFA 4BBSH 3NCMA 5DUML 1JYNA 4CILA 1XBRA 1CO1A 1T2QH 1ZA6A 5AVUB 2GTWA 1CD9B 1STAA 1E5UI 1OT4A 3BUYA 3VA2C 5AOKA 2DQJL 4N8VA 1GZPB 4P2OB 3DXAB 4TNEA 2J8UE 2O5YL 5D5MF 5AOLA 1ESOA 3EBIA 1R4XA 3C8DA 3L4YA 3S1QB 1WUNT 3PO3G 4PJAF 1NBVL 4U1KB 1WWCA 4RRPA 4LE8A 5IEKA 4NZTL 2DW5A 4D8PA 1K6QH 4MCZA 5D7JC 5IR1B 4HCGA 4NKIL 2VITA 2ZOWA 4NAJA 4G7VH 5D71H 2J6EA 1HAWA 3B5TA 4M1DL 3Q5YA 2FYYB 1QFUL 1BCPC 1FNHA 4M1GH 1KGUA 3CZLA 1SNPA 4IPGA 4AIZA 2XDHA 5C3EG 3LIUA 4PJ6A 3H4FA 1LT3D 2BJML 3QCUL 4IUVA 4XVTH 2NCEA 4LP8A 1ZE3C 5ACZB 1X3DA 4P71A 4ZMWA 1Q3LA 3ITPA 1NPJA 2CKBL 2EZ0D 4ZUWB 1AKPA 1OK0A 3D69A 3DETD 4XO8A 1FYCA 2E9JA 3SBWC 5KN5A 3Q2NA 5F1SA 3RZCC 5F3BB 1HTYA 2YSTA 1U3HD 1RIPA 4PWHA 4A7GA 5B3SB 1NQBA 2FL5A 3L1OH 3D08A 3GTTA 4KKCC 3L1FA 2XTIA 4FN0A 4OQTA 5HVHB 2NX5A 4C56C 4L1HA 5AW0B 1T3FA 1GKHA 4XWOC 4E36A 3RZCA 2H26B 2F1BA 1G6ZA 3OF6A 4FNFA 1SJVA 1Y0LB 1RJTA 3TREA 3OPZH 1S4IA 3NQIA 3IGAA 1R5IB 2PP8A 2J2ZA 2R4RL 5C0NC 2Y7MA 3QIBC 4KJQC 4TKOB 1G2SA 2IDSA 3HG2A 2ZYIA 3UPRB 5IB3B 2SEBA 1LEGB 3MRGA 2RQXA 4RHSA 1GHFL 3I75B 4DNLA 3RTQB 4EGVA 1GOZA 1I1FB 2A4CA 1WZLA 1FO0L 1G6RA 4X4YB 2X70B 3FTVA 3WHXB 2RHSB 1UZ8A 3CAMA 1U3HB 2YXMA 5BPPA 1XF2A 4OM1L 4AG4L 4LJZC 1YN6B 3UDIA 2WNWA 3KAAA 4YNYA 4X5XA 4QXVA 5DJ0B 3FAXA 3BI9X 1I4RA 3HOGA 2D4FA 3PXJA 1IGFH 3DUSA 5DQJA 4HMJA 3QFDB 2DPKA 3EBGA 1OM9A 1CXEA 3OJ2C 1JMZA 3QPXH 4LU5H 3ASWA 3BS1A 5JO5A 1RZIB 2APSA 4P4RA 1MCBA 3A6BL 3N55A 1T2QL 4OV6F 1CYGA 1W6JA 3G6JB 1UA6H 1EL0A 2RCNA 1I75A 3IJ7A 2VZOA 1IGYA 4G9FA 1TPXB 2WBXA 5I1GH 2IEPA 1EYGA 3ILEA 3ZQ9A 2OZNA 2JLLA 5I1KH 5D70H 4U3SB 3HN5A 1QSFA 4WUUE 2F3WA 2A9AA 3U25A 5KSVA 1U8MB 4LCWD 1GOFA 1HUMA 3VXSA 5D71L 1T5EA 1FHGA 5C08E 3C5SA 4N2AA 4I1PA 3KYHC 4H44C 4QRBA 4YZWA 1A6XA 2PLTA 3BVZA 4L1BA 1TLKA 3E6FA 5COYA 4XH2B 3U4BL 1JGDA 2OF1A 4Q6YA 4HJ0C 4XVSL 1DBKL 3O9WD 1D5ZC 2NZ1D 4QRRD 4KTYA 4MQXD 3TO2A 2ZKYA 4JDEB 3ESOA 2HVBA 1H3PH 5ELBA 4OZGF 5GAHC 5KUMA 4LRIA 2AUKA 4QUFA 2JIXD 2ZXWB 3MBEC 1AGBB 1RK7A 1O0VA 2TSSA 1G8ZD 2K6YA 2X4NB 2VLRA 2XY2A 4BV1A 4W4NA 1C8PA 2X05A 3ARUA 1F58L 3GSNB 5EIQA 5TGBB 3QT2A 3L1OL 4RKBA 2IPTH 4B3EA 2W8CA 3FOMB 3DWAA 1A0IA 5CLTA 4WJ3M 2WBWB 5JQ6H 3UPCA 1VSCA 4NZDA 4HKZB 3B5GA 1U93B 4FLHA 3ULSA 2GUOB 3I9AA 3FT4A 2EDNA 3OPZL 2E2JB 4ULLA 4BKLB 1XAKA 2JKJA 4ZJ9A 3T56B 4QJFA 3O9WB 4QRRB 2EY6A 4M7ZB 2ZE0A 5J1ZA 3L95B 3TV3H 5I73C 3RMHA 1TDQA 2JIXB 3R7RA 1CTMA 2HPOA 4MMYA 3IDYB 3TWCH 2KDGA 2LU4A 2C1PA 3Q8FA 4HJTA 3H2QA 5DSCB 3OKEB 2TRHA 4HLEA 4I3GA 4X65Q 4QT5A 4BIKA 1PZAA 1WE5A 1MAML 5A7BA 5T33H 4U1GC 2YUVA 1XGTB 4UM8B 4YGVA 1LEKA 1AS7A 3P3RA 3ZMEA 1DBMH 2LLLA 4DAGL 4ONGL 1TYEB 4MAYB 4XCEB 4DKAC 1IGFL 3OHXA 4OJYA 2IY5B 3IJYB 1HHGB 2NDFA 2J55A 2IDTA 1G7IB 4XNMA 1MRDH 1JORA 2AXFA 4H25B 1NGXA 1EJOH 2VXWA 3GMLA 1FYTE 4LU5L 5C5MA 2BH2A 2GFBB 4DV5L 3TBCA 3VXUE 4DKAA 1QRND 3I2ZA 1GS6X 1XXFC 2GY7B 3QR0A 2ZSVB 3M17B 2BIMA 3JWNE 3CDGB 5I1GL 4BY7H 4HN7A 3EO9L 4F7PB 4H8UA 1FVCB 2VDPH 1HK6A 1EHAA 3M3YH 1J0YA 5D70L 1FGNH 5E9DE 3ROLB 3UGUA 3WFDH 2WSKA 2E7CA 1KGCE 3ZDZE 1GCFA 4DV5Q 2AQPA 4H8PA 4JQXA 4XN5A 5KANG 1KB5H 2ATKA 4ZUTB 4E0RB 5FOBB 3PE9A 2MQHA 2PW5A 3OSOA 4ZYKA 2NN6G 4PR5B 5IIEA 1DCZA 3T9WA 1CDYA 2R0LH 2X0WA 1CICC 3KD4A 4L29B 1JPFB 3JWOC 1C4QA 3ILPA 3HG1D 3I4MH 1P4BH 1E3ZA 1BJ1J 4R8WH 3IPBA 2Y0SA 1QRNB 1D5MB 1H3PL 4JFQA 4WW1A 5F44A 3MZTA 1RMFH 4ZUIA 1D2OA 1J5CA 1A8ZA 3ZE0E 4AITA 1JZEA 2DY8A 3Q01A 3QJSB 3KPOA 4PMCA 2CKBB 2UY6B 1HSBA 2NXZD 2FJGA 3QG7H 1GC1H 3MJ9H 2WYHA 5GHWH 4IKKA 3D85A 5IGXH 2G4EA 3WAKA 2RSOA 5D1XC 5GJTL 1JK8B 1T20B 2BWIA 5GJSL 1NFDE 1BVKA 4JFHE 5EOCH 4EI6A 4HULB 4WI2A 4NFDA 2X2YA 1QI5A 1FNEB 4OZFB 1PFCA 3HG1B 4Y16A 1ASPA 2X53A 2XN9E 4WWPA 5IJBC 2P43B 4UAOB 1IJNA 3U4AA 3C08H 3TV3L 2BP8B 3V6BR 4K7PH 3BP5B 3L7EB 3IJ8A 4EN2A 2ZX5A 4DUYL 5I26A 3KLKA 4ZSOA 3FRUB 5T33L 2VL6A 4IRSD 2NXZB 1X6LA 1OY3B 3H6AA 5I71C 3T1HL 3CF5A 4I9WD 1RZ7H 2HTLC 3ISWA 4KJWC 2FIKA 4DUYQ 1HNGA 3PS6A 3L3DA 1XGUA 5F9OH 3RKPA 3LWUA 2IADA 4UI2A 1S5IH 4NQED 4NM8L 3GTKB 2VN7A 3WD5H 1J8RA 3DA0A 1CQFA 4QCLA 1REIA 3T1HQ 1U95B 1II4E 3MLUL 3SYCA 5I8EB 5IHWA 1WYDA 4JJHA 4YHPB 1FGNL 1XIWA 1YPZF 1EEZA 1U3NA 4HKXA 5D2LB 2D3JA 1MY7A 4NC2B 4D9QE 5I66A 4HC1H 2OTUB 4IRSB 2BA1A 2K8QA 2FT7A 1ES0B 1VB9A 4UINL 1A1MA 1RI8A 1DEDA 1QG3A 1BD2A 1L6XA 3GBDA 3IE9A 4A7SA 3K5LA 2Z65C 2V5SA 4PG2A 2R0LL 2BC4A 3HHSB 1XSKA 4L1LA 3RY6C 4LLVB 2VO5A 4POFA 4AC4A 4Z7OF 2OTWA 3CN2A 1UENA 3FJTA 4FP8H 4MNQD 4NQEB 4DKDC 5GS1A 3R8QA 4HIIB 4R8WL 5EPMA 1GTFA 2NY3C 1RHPA 2DJSA 1PTOF 1SFDA 2EJGC 3IYLW 5KG9B 5M5YB 2VMFA 1Z6JT 4BBSG 1RMFL 4AQ8C 3FQRA 2I5HA 1INQB 3L4CA 4DZ8B 4DFIA 5AVSB 1CKNA 5IROC 2D03H 2IH1B 3T6XA 5T1KD 4GBXA 4HTHA 1X5YA 4LCYB 2J73A 3SK5A 2EDBA 2WLLA 2OSLB 1OANA 4HIHA 1CXIA 4PJDF 5DXWA 4Q0FA 2QZ5A 3ULAB 1OE3A 1E28A 2WBJC 4P3WA 4ODBD 5GGTA 4C8XA 6TAAA 2CO3A 5EOCL 3U9WA 2F54D 4FNRA 4E9LA 4R4ND 3NRFA 3IEAA 4LFAL 3OTTA 1ROCA 5DF0A 4NXNL 3II2A 1W8OA 4MNQB 3MGTA 8FABA 4A4IA 5BCAA 1JDCA 3EJYD 4P57A 5CJXA 4L1TA 1UWXK 1AFPA 4X5QA 3OKLA 3P4OB 1PFBA 1SF3A 3GXDA 3ML8A 4K7PL 3HKZG 1SN5A 2CH4A 3QQ9C 3LKSB 4OX9L 3HCVA 4LFAQ 3SHLA 4F57H 5HI5C 2NDGA 1VMPA 2ARWA 5T1KB 4NXNQ 3V0HA 2XNAB 2BOLA 5T3ZE 1JICA 3O11B 4HGWB 3G7LA 2EEAA 2AQRA 2IOMA 4ZT1A 4AK1A 1E9OB 2GYSA 3JTSA 4QOKA 1RZ7L 5G4OA 4G8EA 1LACA 3BMWA 1ADQH 5F9OL 1TETH 3BD3A 1A9EA 4OX9Q 1F2LA 1NKOA 4J1UB 2F54B 5FXCH 4RHRA 5EBMA 8CGTA 5M5XH 3R3OA 3VDCA 3WD5L 2YRLA 4Z3EA 5GAGC 3BSZH 3MRRB 1AEXA 1XZ0A 1FV1B 1Z5LA 3C2AH 3DIVA 5IW1B 5JIKA 4UIKH 1ZT1A 5JMRA 1BZ9B 3ATAA 4JRYE 4JKKA 1VHPA 4YIQA 4CL7A 2ZONA 2GY5A 3FULA 4TOYL 3CN4A 4PJ9C 5CINH 5IQ9B 3BUBA 1YYCA 1WJ3A 3BLBA 2D4DA 1BG1A 2WUCH 4J4PC 4ZTEA 5M5WB 2OJEB 4ORGB 4QHNB 5EO0B 1L6ZA 4HUVB 2A69D 4U6VH 3BVUA 3TN0D 2ZCKH 4ZCKA 3BN3B 4I48A 5D72L 5C70A 2B2YA 3KLAA 1MZZA 3UO8B 4Z3JA 2H1XA 2NYYC 1KCLA 5CMDA 3QXDA 1VQGA 2AV1B 3DX6A 4YPGB 4PLNC 1JZ4A 4FP8L 4HJ9A 1KTLA 1EWCA 1CN4A 4FXGC 3MGOA 4GSDH 5LJYH 2DDQL 1XR8B 2Q2IA 1L5GA 1UACL 2CDEA 3PQIA 5BZDB 3VI3E 2HUEA 1QJOA 4YR6B 2EDGA 2XQYA 1H3WM 3L6FB 3QZWB 1AC6A 4JFDA 4JCMA 4X9FA 3O3DB 3T4YB 1AO7E 3NRQA 2A9DA 3MRMB 1Y14B 3WFCH 2D03L 3F7RA 1B4JH 4DN4H 3HOWH 2A6DA 2CO1A 1AQ8A 1Y1UA 4G8GE 2X3CA 4JUSA 1YO4A 3TN0B 1CFQB 5EUOA 4KI0A 4GIAA 1HFNA 1NY4A 3DPBA 3MNWA 1LO0H 5L4MA 4XGZA 3DSFH 4ICWA 1ZPUA 3R18A 1ODUA 5IEHB 4DV3L 1IKMA 3OSKA 3H91A 4Z3GA 4D8OA 1JOKA 1O7YA 1G4MA 2V8MA 5K39B 1OHQA 2CXKA 1YEFH 4OLUH 1O7DC 2MOVA 3IDXL 4N8PA 3S97C 3FF7A 1JNLH 2J5LC 4XP9H 4IBZA 5KBNC 5K1JA 2RACA 2IQAB 4F57L 3MXNA 2N0MA 4DV3Q 3CMAA 1IE4A 1S7SA 3NN8A 5CJ5A 1G1YA 4K71B 4FFZH 4ZUVA 5EO9B 3MV7D 1B4OA 2EY2A 3OPOA 2P26A 3ECQA 5AW4B 2OL3A 2WXJA 1ADQL 2DMHA 4OIKA 1TETL 3ZRFC 1A9BB 1ETZB 2WP3T 5DJ6B 5FYJE 3VFTB 1TWAH 3A7AB 3KDFB 2V7HA 3BSZL 3TTYA 2IJ0A 4C4KO 2IALB 1L4IA 4JFTA 3C2AL 3SYAA 3DM3A 1MIEH 2WVVB 3MR9B 1N34L 4UIKL 2R7EA 1S9KC 3WSQH 1GR7A 1W72L 2V17L 3HAEH 1J5HA 2H8PA 4BQ9A 2CQAA 2PYEB 2XXCB 5HHPA 4RMUA 3TFBA 4ATWA 1N7MH 1FJ1A 2WUCL 3BHBB 1E5CA 3S16B 3CZNA 4HYTB 4RIRB 5DT1H 4AGOA 3M3YB 5D7LA 4TQEH 4U6VL 3K59A 2ZCKL 5IVZB 3MV7B 4BFGA 3BVDB 1N34Q 4YHIB 4Z7WF 3ARPA 1E65A 1UWVA 1JG9A 2A6JA 1I7RB 2W0KA 3FCSB 4KY7A 1VESA 4I9XA 1A3LH 3MRCA 4UDTB 3KFUA 4L18A 3LGJA 3GF8A 4GSDL 3WIHH 3NXWA 5F1IA 4TLKA 2F68X 2JXMA 4MA1B 2E9WA 1OB0A 5DLMH 3VI4F 4B96A 5B38G 2FATH 5AZEH 1T80A 3I9GH 2EO1A 1F45A 2DJUA 1F00I 3DROB 2APTA 3VFOA 5LN8A 2J25A 3WFCL 4GLAC 2H2PC 3IN0A 4ZOAA 2BSSB 3VD3A 3GQBA 2KCCA 4XWGH 4BY7G 4XNBA 4DN4L 4YHZL 2YGOA 5FO7A 3PHOB 2BCKB 2L11A 4G7YH 3QZPA 4RAUA 4RA3A 3R1GH 5DJDA 2R29H 3CSGA 2KHIA 4XNXH 1PF3A 3UYRH 1I1AB 4YQXL 3GSRB 3QDGA 4BE5A 4EO5A 1XCWA 3MACH 3DSFL 2Y23A 4N2DA 4XP5L 3ARFD 5FGCE 5KZCD 5FYLE 2P48B 3CFQA 3PJSB 2VMCA 4CVXA 3ME0A 4NQDA 1KTDB 3O3AA 4ECNA 4PREA 1XEDA 4B9FA 1J9RA 4IOSD 5DQ9A 4GB9A 2CNYA 5GGQH 1YEFL 2K75A 2VN4A 4HX1A 4OLUL 2I07A 3I4MG 1JNLL 3CVHA 2EYOA 3O0RH 5D5MB 4PM1A 1B4RA 4XP9L 4HSPA 3OV6A 4MDJA 1WD1A 3LRSA 4EVNA 4HPOH 4PJAB 1D5XB 1SNRA 2ARJQ 3E3QC 2FGWH 3OJDA 1JP5A 2G5UA 4GQZA 4LSSL 4F2EA 3V5DA 2D9QB 2IH9A 1QNUA 5TDOB 3RG1C 4PJIF 4FFZL 4FDWA 4FYSA 1CCZA 3K5RA 3IDIB 4KLKA 4G9DA 3TXAA 5B8CB 1QNKA 3CFDA 4NKOB 1E0BA 4ZUUB 3IMVA 3G48A 4WI7A 3D25A 2DQFA 3ARFB 3QNFA 4NN6B 5LGJA 3VFVB 5KZCB 4Y4FD 5K1VA 3GQFA 1QATA 4Z78B 3WG7B 3T77B 4Q7DA 4OV5B 3SDAD 4PRBB 4W9KC 1WD0A 25C8L 1MIEL 1C9OA 2HQEA 3QRFM 4AH2B 4LL4A 5E5LA 4N1EA 4JCLA 3BWSA 4RFOH 2OT2A 1ECZA 5CP7A 3VQ1C 1N7ML 3L9AX 2JJSA 4O02H 4P2OC 4UQIM 5KSBA 2R59A 5A16B 2EYTB 3PHSA 1P1ZB 4TQEL 3ZSTA 2PO4A 2BINA 2V3DA 3ARZA 5DJYB 5HYSG 4LIQH 4CNIA 1IYVA 2YLKA 1EMTH 1MF2H 3FHQA 3T0XA 3LKQA 5DUJA 3KYMA 4ODVH 4POZD 3QNXB 4Y4FB 1LDPL 5DZJA 1ZPLA 3S4SG 3ZTDC 2ZOOA 1F8TH 1I82A 2OMWA 2YD5A 3NSFA 3WEBA 2QPUA 5CFAA 2FATL 5E8EB 3I9GL 1TQOA 4X5WB 3S1RB 2K4AA 4Z7AA 2IDFA 1R34A 3TT3H 4NRYB 4MN3A 5KGUA 2E2IB 1BBDH 2NQDA 4HZ1A 4XWGL 1XGPB 3U7AA 4A2EA 2XJLA 2ALAA 3H3BC 5K59E 2PW1A 4G7YL 2JH2A 4M5SA 3BT2H 3UAEA 2Q2TA 4OLZH 4IMKA 2Y06H 4I18A 3UYRL 2WXMA 1CK0L 1SMAA 3QISA 1N70A 4U1MA 1Y18B 3EFXD 3MACL 3TOPA 4X4KA 5HVHC 1WF5A 4DPRA 1N2RA 5F3BA 4Z7VA 3RGVA 4NKQB 2G75A 2HN7A 1Z9SA 3RDJA 4R9WA 4YWKA 3KJ6L 3DRQA 3FQTB 3SHSA 4XRCA 5KJ7E 4DCQB 5LG1A 3APNA 3TJEL 3L13A 4OVVA 4HPOL 1S78D 3VXOB 2Z92B 1LTID 1NGPH 2R7ZH 2VE6B 1UGKA 1URZA 4FZEL 3K6FA 4H4NA 2YPLA 2I25N 1HRJA 3IKCA 5DUBA 1J5EL 5F3HB 2EZ0C 3D06A 3DETC 4XAWH 5DA4A 3LNDA 3CMGA 5IB3A 3RIFF 1GY1A 1LEGA 4XQJA 3WUWG 1U3HC 3UDXA 3O4LD 4FS0A 5K1NA 1KEGH 3CIQA 3LH9A 5MEQB 3HC4L 4Y8DC 1EY5A 3EZJB 4AI7A 4WSJA 4X6FB 5CD5D 3TO4A 1U3HA 1R19A 2EYFA 1J5EQ 3HPLB 3K0XA 1ZGLP 3RI5F 4M9PA 1MJUL 5M5XB 1BG9A 2FSEB 3L3GB 5DJ0A 1UXMA 1WBZB 1NM4A 3DO7A 4AENB 3N2JA 4CMMB 2DKMA 4OY9A 3C09B 4RFOL 4L4VD 2XYBA 5L7XH 1M8AA 3UGEA 5GRVK 5AG9A 2L3BA 4O02L 4F87A 3ZIYA 4DUVA 1W72B 2CQOA 2R7DA 5D3IB 2WV3A 3FN0H 1D6EB 2X9WA 3G6JA 2XN2A 4P23D 4TM9A 4ZMLA 5LL6S 1DVFD 2PXYD 3MLPA 5MP6H 2YGPA 1EMTL 1MF2L 1SUJA 5C3TA 3RJDA 1BREA 1BM7A 5HYEA 3O4LB 1VFOA 4MJ6B 4R4FH 4A2MA 3H94A 1KIQA 2VRAA 1T4WA 4DPGA 2PWEA 3X3FH 4S0SD 3EJIA 2VLLA 3S3BB 4GIPD 1F8TL 3DGDA 5J56B 1E4JA 4M5TA 5ELOA 4UNIA 3JT2A 3X12A 2FUTA 4NT6B 4PEEA 3VJ6B 1BKBA 4RGTA 5EZIH 1BBDL 1L7IL 2H2SD 3LRHA 3WLBA 4JGNA 3DBXB 3QHFH 1K5WA 1GYUA 1OVZA 4MXVE 5C09E 5F9JB 3O2WL 3BT2L 4JDEA 1B3JA 1G7LB 3APMA 2IXQB 2Y06L 1WFJA 4KTEH 4NZUH 4OLZL 4P23B 4AKQA 1DVFB 2PXYB 2JSOA 3QO2A 2AQ2A 2OCCB 4P2RA 1AGBA 5CGYD 4ZMZA 5KBPA 3LEXB 3CDZB 1SDDB 4Y5XA 4W68A 5CEXA 1IBDA 4MWFB 4KX9A 3BGFB 4G80B 1JSYA 5L6YH 2ESVE 1S3RA 2AJ3A 3K7UC 4N2IA 2WQWA 2CHNA 2ARJB 4N3TA 4PJBA 3UBXB 5F7LB 1E5AA 3VXRE 4AMXA 5IP9H 3EO0B 4LCWA 3GIVB 4XIGS 4PH8A 1PZKD 4KY1H 2KQNA 3QZMA 1DQLH 3K7UA 3IPFA 1YEJH 3O9WC 3SEBA 3J7ZC 1JFQL 3UAAA 3WLWD 4MQXC 4M7ZC 3BFOA 4ODWA 1N59A 3D2UA 3MJ8B 3O3BA 4QD2E 1DBJH 3NA4A 4X6DE 4K5XA 5ILTH 4H26B 5KBDA 1MCRA 3IDYC 5SV4A 3MA7B 3PCYA 4XAWL 3SZKC 4PWFA 3HOWG 5C0JB 5HYJD 4JKNA 1R3LA 2CWPA 1KEGL 1UE1A 3AS3A 4R90H 1EV2E 1IIKA 3LIZL 3V7AG 3LAFA 4HV8A 1JDAA 4JBMA 5C4XG 2YTXA 3U1QA 5HVFB 3KJPA 2JKTM 3X1GA 5KEEA 4I4WB 1RZGB 3Q8AA 4PV1C 1A6VL 2ICWB 1FFTB 4X8JB 3BIKB 4OWWB 1H9RA 3HE7A 2X2IA 2QLYA 2P5WE 5DJCA 3QPQD 3AQYA 2CJSA 4M6AA 4DN3H 1DSWA 1PGRB 3H9SE 3IJYA 1PLCA 5L7XL 2L7QA 3NUKA 4PLKD 3BAYA 4K9EL 5K9JH 2ITFA 2WGXA 1QVOA 2W92A 5I74B 1U8IA 2GKIA 3FN0L 1LTRD 1KCVH 1RTNA 5EZLB 4V2BA 4Y1SA 3VGHA 4CSZA 4NFBA 1ZDQA 1SXSA 2DQHH 4LNVA 4U1IB 5HYJB 4RFBA 1AXSB 1TQCB 3PIQB 3GGWA 3NBIA 3NAAH 4R4FL 3X3FL 2HFTA 4WKXA 4WTZG 2OQJB 4RMVA 3DLLA 2I7SA 1FD7D 1MLCA 1U91A 4K94L 1PEZA 5FLXE 1WD9A 1YECH 5GGUB 3R7QA 1SVZA 3W0WD 2OMZB 2V4DA 3AYHB 1SFHA 2IWEA 5EZIL 4D94A 4W9HC 4H7BA 1XGYL 2QJDA 3MLYH 1D5MC 3P4MA 2CO7B 5I5JA 3J27A 5C7ZA 4R7LA 3K74B 2P3YA 3AFQA 2EIZB 1QUNB 1BVSA 3HAEG 4G6MH 3V8OA 2W9EH 2BRRH 3MFFA 4F20A 4R6UA 4KTEL 1EQQA 2H1PH 4NZUL 2PYFB 3FBKA 1CKMA 1ASYA 1L9OA 1EZSA 1OQXA 3NJLA 2FQFA 4F37K 2D62A 4CJ1B 4LQFH 1LNUB 2WLZA 1KLGA 3HI1A 5CV5A 1QZHA 3U36B 3I7FA 1TO4A 1TEGA 1PTOD 5L6YL 3RDTB 1AFVH 2IBGA 3U7YL 1XF1A 1E40A 4M9OA 3SY0B 5C7XL 3W0WB 3AEVA 2BSEA 4DW2H 4JM2A 5E4OA 2VDNH 4KY1L 3HRPA 1DQLL 4F2MA 1YEJL 3BEVA 1GGIH 4DP1X 4NRZA 5TE7H 4UAOC 1B9NA 1PH6A 1HILB 1F3DH 3BPOB 4AW7A 5EBWA 1ED3B 4OM0H 4RZCA 3R4DA 4YSUA 5DMJB 4XP1H 1D1IA 2BP8A 3ERSX 4HEME 4XQQA 4JPWL 5CCKH 2LE9A 4JPIB 3MRNB 2NXZC 4ILDA 4R90L 4N8CH 4FMKA 3U9PH 4Z7OB 1I4GA 3C3LA 3HNVH 3QQ3A 3RPIA 3VGAC 2ID0A 2EVIA 3FT2B 1PTOB 1MFUA 3K8KA 2MPVA 3ZDZF 1FO0A 1NIDA 4WNQB 1CFMA 1P53A 1FBIL 4DN3L 1HNWL 3STBD 3F65A 1D5BB 2K3HA 2KUTA 4XX1E 1K5NB 2UUAL 1HEZB 1TJIH 2CR3A 4YEFA 5K9JL 2OMXB 2ZWKA 3CC7A 1GW0A 4P46D 1KCVL 1A2YA 4O02B 5ANME 3L9BA 2AQNA 3DO4A 4I13B 5AW6B 3PGFL 2MPAH 5IQNA 3VE0B 5FO8B 1UZ6F 1HNWQ 4IRSC 3EGXB 3NAAL 3CFBA 3NELA 5GGSB 5JHDB 3VD9A 2ATWA 2D2CC 1X5XA 1AGCA 1FDLH 3DUUB 4PW3A 1FN4A 4AJ0A 4UP8A 3GO5A 1KDAA 3WY3A 5E7BA 2IFFH 5JNYA 1YECL 2VZVA 2CPCA 3E3XA 4Y2LA 1QLRA 3PV0A 4MD5B 4CJ0A 1MCWW 5FHBH 1WIUA 1QO3A 2WPGA 4A67A 5IMKB 1KNOA 2XA8L 3WOFA 2NUPB 3EOAA 3MLYL 1SHMA 2Z35B 1NE3A 3LX0A 4LUVA 2FBJH 4DVRH 1UD2A 2K5DA 3AB0B 9PCYA 2H1PL 4R7DA 1TKWB 4JBJA 2NXYD 5FW6A 4LRNH 2F3VA 4U6HB 4IPHA 4N0RA 2FR4B 4LQFL 3E0EA 1U9RA 4OELB 2CLRA 3FYEB 5M3MB 3SQBB 2HD3A 1M2VB 3K72A 4KQ3L 4DT2A 1R3JA 1VADA 1PZID 1NCAL 1WFIA 2FAUA 3FB8A 4NPKA 1EY6A 3S34L 4CN1A 3P11L 3GMNB 2B59A 3CCEA 3A54A 4Q56A 2W5PA 4E9YA 5IF0B 2OV0A 4AYEC 1HEHC 1K8IA 2ZTDA 5E03A 1ZJAA 4J8RB 4JFEE 3WNOA 5CC4A 1ASZA 3LN4B 1P6WA 3Q2CA 4BBRB 1L3NA 5TE7L 3WHE0 2E59A 5KJRH 1S5HB 5CR8A 5ANHA 3RWFA 4BS9A 1NJIC 3D30A 1LK3H 1JZ5A 1Q1JH 2MHVA 3KXFE 1NBZB 1IVLA 2YC1A 2YOAA 5BVJB 3QDME 1S7RB 3WDIA 1F11A 3VYUA 2NY7H 3T6ZA 2XACC 1CUKA 2NXYB 1Z9LA 1ZLSH 2XNAC 3HOZB 2FO4B 3GD1C 4N8CL 3U9PL 3HNVL 4AYMC 4LZKA 4AZUA 4Z1PA 3G04B 1GZHC 3ETSA 1TZAA 2AJUL 1JVOA 1KF9B 1SMYD 3K6NA 1K3RA 1VQAA 3BP4B 2Z0BA 3QNZA 3EJZD 2IX0A 4OJDH 4GXUM 3T8XA 2VIRB 3AQXA 4ZAIA 2A8VA 1IB5A 2C9AA 2MMXA 1SBBA 4R4NC 3HOUG 1X5FA 3SDCD 2WAQA 3DVGA 4PG3A 5CSGA 4PRAB 1C5DB 2VZ1A 3S9WA 3A21A 1TJIL 1QWHA 4LF6Q 3EJYC 5DLQE 2FECL 3D39A 1Q86C 3T0AA 2X4RB 3GPEA 1KULA 4Y1AA 1ZOXA 1E30A 3ALXA 2VB5A 2P8PB 4GW4A 5ESAB 2R7ZG 3A55A 4U1JB 2EDJA 2EJ1A 2MPAL 4DR1L 2ZCHL 5TF1H 3CUPB 3L2MA 3ETTA 2VKXA 2CKZB 2X4OB 2G9HD 3ZX1A 1FDLL 4AYID 2WKCA 1QOHA 3IN2A 2IBBA 3MRDB 1QR1B 1S8DB 3KYKH 1PVHA 4DR1Q 1HCVA 2FEEI 4K2UH 2DMGA 2PP9A 3SDCB 1ZLUH 1DCLA 2OPCA 1I5FA 4AYBE 1MQ8A 3HIZA 4GRWF 1EHKB 2K7QA 4AQEA 5EU3A 3AU0A 1Z1WA 4ZW6A 3EH1A 4G5ZH 1O7SA