3FRPB

Crystal structure of cobra venom factor, a co-factor for c3- and c5 convertase cvfbb
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
368
structure length
343
Chain Sequence
b'LNLDITIELPDREVPIRYRINRTVETKLNQDITVTASATMTILTFYNAQVCNKFHLNVSVENIHALMLKICTRYLGEVDSTMTIIDISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHFKILKHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSLNHQERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKTHQYISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEEFQKLCDDFAQFSYTLTEFGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cobra venom factor alpha chain
publication title The Crystal Structure of Cobra Venom Factor, a Cofactor for C3- and C5-Convertase CVFBb.
pubmed doi rcsb
molecule tags Hydrolase cofactor
total genus 59
structure length 343
sequence length 368
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01759 NTR UNC-6/NTR/C345C module
B PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.210.20 Mainly Beta Single Sheet ubp-family deubiquitinating enzyme fold ubp-family deubiquitinating enzyme fold 3frpB01
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3frpB03
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3frpB02
3HRZC 5FO7B 2A73B 2J0TD 3CKIB 2I07B 3I70A 1UEAB 1GXDC 1PXUA 2QKIC 2XWBB 2A74C 2WIIB 3MA2B 2B39A 4FXKC 5FO9B 5JPMC 5FOBB 5JPNC 1JB3A 2WINB 5FO8B 2TMPA 4D94A 1BV8A 3L3OC 2E2DC 4ILWA 1BUVT 2PN5A 3G6JB 3HS0C 4FXGC 1BQQT 2ICEC 1AYOA 3CU7A 3KLSA 4LNVA 3OHXC 1OO9B 2XWJB 1D2BA 3FRPB 1EDYA 1BR9A 1JC7A 3T4AC 3V96A 1UAPA 1XWEA
chains in the Genus database with same CATH superfamily
3LWEA 1V10A 4ZOCA 3QG7H 1AQDA 4LPVA 4DAGL 4EIUA 1G87A 1V1PB 3C5ZC 3ZTEA 4UU9A 1A9EA 1NCCH 1GUTA 2VJ8A 3ARSA 3TO2B 5B38B 1IKFH 3QUMB 3P1HA 3IRPX 1CKOA 1TETL 1A14H 4F15C 3UTPD 2DQUH 1TJHL 2DQDL 2Q3ZA 3O81A 1STGA 5DFVD 3FT3A 5EUOE 5DO2C 2VIRA 2YPLE 5IWAQ 1FVCB 2EY1A 2JQOA 2E56A 3CDGA 3H3VH 2R7EA 4LCCB 1FYHB 4LLQA 2WCGA 4ZX4A 3N43B 4WO4C 2OAAA 1XCTA 1RK1B 3H9HA 5D8JH 3F65A 3VM5A 5CD3B 3FQWB 1FL3A 1U95A 2RHEA 1Q38A 3KYMA 4OBSA 3ULUD 4G8FA 4A04A 5ELCA 1EY9A 1UE1A 3WDHA 2Q87A 5C0CD 5IYBG 4OO1G 1CXKA 2V9QA 4KJPC 4P46C 4PUBH 4PWKA 5DQDL 1XGYH 3C08H 4NQDA 4AKOA 3NK4A 4ANUA 3T5WA 5KYWB 3F7LA 4J6HA 4M5YH 1GGIH 5DMKA 5SWZA 2C7UA 3FUJA 1KJVB 3T8XA 2WWKT 1IKLA 4FI6A 3ZE0B 3DHMA 1F41A 2ZUVA 3LKQA 3L08A 3PG2A 3QDMB 3IT8D 5HHMB 5AG9A 1WI5A 1FHNA 1KBGL 5JOBA 4O00A 2ZCHL 1BAFL 1UCBL 1VKXA 1HWGB 4P2QA 2CXKA 4HWZB 2VLMD 5ACZA 4RMFA 3KJ6L 2X9XA 1G2SA 3I91A 2EKSB 2UUBL 3VGDA 1OE1A 1JHLL 4D9QE 1T6BX 5C0XI 1ETB1 2ATPB 4JHZA 1FJ1B 2F68X 1VQPA 5T1MA 4DKFL 5C0AB 1KC5H 1CTOA 5IEKB 5J1AB 2VDMH 4KVCL 4WAFA 1QFOA 3DVNA 2XQBL 3O3BB 4LVEA 5CEYB 2N8NA 4I77H 3QQ3B 1ED3B 3BFQG 2PR9A 1VFBA 2XKNA 2ZD0A 1O6SA 1MCIA 2VR7A 4FTDA 3LN4A 4PWHA 1EY5A 5CZKA 3TA4D 4ELMA 5IKCA 3EGSA 2NN6G 2EABA 1OSYA 2GSGB 5EF3A 4BJLA 4J39A 4DP5X 1E24A 2GAZB 4IOIB 2GITA 5EPMB 4MFHA 2R0WH 3V9CA 5IYBH 3RN5A 4OO1H 1I85C 4YR6A 5IB4B 1X3GA 2J0TD 1XIWD 4JQVC 4TSBL 2AI0L 2Z0UA 4O58H 4XPHH 5JXAH 3GFUA 4K9EH 1YEEL 4JN2A 3LZQA 5AVXB 4RH6A 2OJZL 2BM3A 2YTYA 5IMLB 2K1MA 1RJLB 3QWQB 4UT9H 5C0DB 5KYIA 2DJSA 2WSKA 5JHBA 2NY4C 4AEIL 1QABA 1EDYA 1F9SA 5B39A 3BCDA 4L8CB 1IAKB 3L2MA 5JHDA 1PIGA 3TO4C 4LKXA 1H9MA 2YBRB 5L6YH 4OZFG 4BK5A 4V2BA 5K39A 4RIRB 1EGJH 2N1TE 2CQAA 1IBMQ 1JRHH 1MPAH 2CR3A 4K15A 3DURA 4N2OA 1INDL 2ICIA 2ADYA 1A6XA 1M9WA 1DQLL 3RHWF 1T6VN 1D7BA 1FZJB 4YIQA 1Z9MA 3WTXA 1IM3A 5KAQF 3WSQL 2IJ0C 4RETB 4GI8A 1F42A 1WWWX 2NW3A 1RJZB 2WXRA 1T2JA 4KROB 2QSTA 1UFGA 4HLJA 1A7OL 3HC4L 4M03A 4NPJA 4P74A 5GAHC 1QLEH 3WJLA 2IAMC 4M56A 4PJFF 1AGEB 5HI5D 1NC4B 3W2DL 3LRLA 4XC1H 2QQNH 5AZEL 3K4ZA 4KMLB 5D1XD 3STZB 5BS0B 4K07A 4NZDA 1RZIA 3RGVA 2AJSL 3FFDB 4QXUL 5DVKA 3VSQA 1NGQH 1IM9D 2BRQA 2H41A 1BA9A 1X9NA 3VFMB 4A3MH 1VZIA 3QO1A 3BSZH 4OIFA 4YSDA 3N6YA 1UUNA 5JIDA 3SQBB 5J5EA 3DX9B 5E56A 3VWJB 1XYIA 4KZEL 1CDUA 2TSAA 1PFOA 3NH7L 3E9UA 4AMKL 5AW7B 5C0XJ 1MHPL 2WQAA 4YSRA 4Y5XA 1NFDB 3AQDA 1IBHA 2XJLA 4MNHB 4OM1L 4RFOL 5B1AB 5BZDA 1T1YA 4RGMC 3IE4A 3HEJA 3FK3A 4K3JL 5F1SA 2GSIA 2HPTA 3LKRB 1CUKA 3DYPA 3FKUS 3QJFB 3KYKH 2HLAA 4HJGB 3SDDA 2QGQA 4GEIA 2VXQA 3DVFA 4GP5B 4OLVH 3PUCA 1R4QB 4X4ZA 5DRZA 5I0DA 1UKQA 3TT1H 3NZ8A 2QGEA 4DF9A 3Q1SL 3SKMA 3T53B 3MUGB 1X5KA 2FEJA 1M1XA 1WBYA 5D1ZI 2ZUXA 1NGYA 4F8MA 4XN9A 5IJBC 5G4NA 4BS9A 1EEZB 1OQXA 3MRRA 4G6AC 1K8DA 4XN5A 3OAZK 3MU3A 4IJ3C 1BM3L 3T2LA 3DRQA 4PRIB 1UACL 2V1CC 4N2IA 4ADGA 2EH8L 2W9LA 1KCBA 2ADGA 5EU6D 1NDGB 5B8CC 3IFLH 4YHIA 8FABA 1KPVB 1QLRB 3VXRD 3SJVE 4QPEA 3BZDA 4CSPA 2CO7B 4OF5A 3IF1B 4QAMB 3VNZA 3IFPB 1GXEA 2FFKB 1HQRB 1JTTA 2R39A 3P0YH 5M7QA 1X9LA 3FT4B 5I28A 3O4LD 4AEFA 5DSCB 2I25N 2VISB 1AQMA 3CSFA 2VDMB 3EYFA 4GH7B 3IMUA 5A2QL 1S7XB 2BFGA 3WU1A 1QNKA 2VXUL 4E41D 3MXNA 3S98A 4DEWA 4BV1A 1GZQA 4MLSA 5IGDA 2LVCA 2ZKXA 3BQVA 3CVIH 1J9CT 3AXIA 4H5SA 4I85A 3KPOB 1XR8B 4A7TA 3FN0H 2F03A 4XO9A 3RBGA 1CQVA 1UZ8B 2F5BL 5AVRB 2NUCA 4CGUB 2JYOA 1HHIB 5HYJB 1H5BC 5CV7A 2G9HB 3VD2A 5I9OA 4LSSH 1WAAA 3EYOA 4OJFH 1FFNA 1JZFA 1ROWA 3BAIA 3H2WA 1ACYL 1XFPA 2JCCF 3LKOB 3PWPD 4GO9A 4OGZA 4ACTA 5FOBA 3KL0A 1NCHA 1W2BA 3K5NA 1PZ5B 2XWTA 5E95B 2EVJA 1QA9A 2E6JA 4D9RD 1JYNA 4R4ND 1C1EH 3GTGH 5CP3H 3AT9A 2JQZA 1C8PA 2B1AL 2L55A 4G59C 2OWOA 1MEXL 2YPVL 4R7XA 3MROA 5D1ZA 1YEFH 2OMWB 2CH8A 3F6IA 4AVHA 4PJDE 4EBQL 5EUOA 3V4PH 4EUPA 4JQIA 1JGUH 1WFTA 4S0SD 3FB6B 2J7ZA 3MRMB 3KJ4B 4A75A 1MDTA 4WU7B 2VDQH 1Q9KB 4KXBA 4HS8H 5K9JL 3PIQB 3B7TA 1L3NA 4IBYA 1N59A 4RAHA 4JO2H 3NACL 4KKZA 4YDVA 4F57L 4DV1Q 1SNRA 1UEMA 5A2CA 2VERN 2WZAA 1MNNA 4IPHA 5B1BB 5D2NA 5FFGA 5GS1C 1F90L 3NABH 1ZLVH 3FPYA 1GKEA 3Q6GL 4Y4KC 4DUYL 1F58H 3ZQXA 1QLEB 1A7PH 1E5AA 4JFTA 1QWHA 3E3XA 1EO5A 2IALB 2QMJA 43C9A 1LLRD 5DMGC 4P3DB 1SY6A 3FQNA 3BC9A 4IIQC 1SYDA 4R4TA 4PMFA 5BOPA 3F7PC 1WTWA 4P06A 4UNTA 3THMH 2ZICA 3BN9C 2W92A 2ARWA 3UMTA 3OF6D 1FFTB 4R26L 4DGZA 5E6IB 4A3MB 3RR5A 4F33A 4HXAL 1RPKA 3ARZA 3N9GH 4PJAA 4X66Q 1U3HD 1S46A 4C2MH 5IOPA 3K2UL 3U2SA 3D87B 4PMEA 4N3TA 1WV7T 1X7TA 1W0VB 1WHOA 3MLYL 3JWNG 4MA3A 4E42B 2VRKA 4K94C 4PJXE 4B5EA 3E6FB 1JI2A 5C3XA 3K4DA 4P2OA 3CBKB 1FV1A 5DNFA 1OALA 4KN4C 2E7MA 3DBXA 4CKBA 1XD0A 1T04B 2WB1E 4BWUA 1QSVA 3L3IA 5GIRB 4ZW8A 4ZFZA 4F91B 4KH2A 5C9JB 4LVNB 5JIKA 5FKPA 3TIDB 1OP3K 2MUYA 2D3LA 2HH0H 4LCCC 3QAZB 4UQ2A 1K72A 4XGZB 3IGLA 2BY3A 3VA6A 3HJEA 3WD5H 1NC2D 5C6WH 3S2DH 4P9MH 2AV1B 3N06B 1PAMA 3MCLH 2WGNB 1BOYA 3NSCA 1PIFA 4BZ2L 1JOKA 3ARGD 4XPFH 3MI6A 3NSXA 2AS5M 4I7ZC 3QT2A 5JDSB 1L0XA 2ZSVB 1YJDL 5A43C 1C5DB 1DSYA 2X4QB 3HC2A 3QEGH 5FCUL 3A47A 3ESMA 3EH4B 4YZFE 1YUHA 4F7MB 2HHHL 1QSED 3VMNA 1IIIA 4N8PA 3N1FC 4DK6C 4IBUA 4PP2A 4L63B 5HJDA 3U25A 1PZBA 5JDJA 4MAUL 5FLMG 1E9PA 2AEOA 2MPAL 5TF1L 4Z78A 2YEQA 3CLWA 3JWNH 1RJYA 1UKSA 3NFPB 2EE3A 2A74A 3IDGB 1N7ML 2Y0SG 1UE5A 3N1PC 4L4TD 4WF7A 1GUWA 2EE1A 2PO6D 3CHPA 3NWSA 1FCGA 4RGOH 4QHUA 2HJFB 4FLOA 3SODB 3NP8A 4MS8D 1AGCB 2V2TA 1N68A 4S1DD 5MHSE 1ZS8A 2D5DA 3P40A 4HJ8A 1S7TB 1D5ZB 3UDGA 1S9YB 5IB2A 2EXTA 1E3FA 4F24A 5KSAA 4QTIL 4I1NB 5I1LB 1XMQL 1R3IH 1KIUA 2VNUD 4M6OH 3IDIB 4N6RB 2OYMA 3RLSA 4AT6B 2XA8H 3ESOA 1H3XA 3DRTA 5SX5H 1IC5H 1T4WA 2BHUA 4ZPTA 3V5KA 3A67H 1BCPD 2NNAA 4JO4L 4QHLA 1I4RA 1TXYA 1S3RA 3I02A 1FH5H 3RU8H 2OR9H 2EDOA 4P9HC 3WNNA 3F12B 3HR5B 2NNRA 3STLA 3NTKA 3GTGB 5GGVL 2PYEE 4AIMA 2PW1A 4M9PA 3RBSA 2WJ7A 4RZKA 1OCWH 2CNZA 3QPKA 1WS7A 3QHFH 5EUKA 1RV6X 1P84K 5FLMH 3FAWA 3I6LD 4X7EC 5SWSA 3TH4T 1A7RH 3ZE2F 3ZTNH 1KTJA 1TVBA 4Y16B 2NTTA 1CGUA 1H3WM 1S3KL 3L4ZA 4TUJA 1ZLUH 3V4PB 4B9FA 3T8MA 4AUUA 1MFNA 1VFOA 2YEZB 1CD9B 2DLTA 1MJUL 4HK3J 2ETWA 3DX1A 5F7WC 3FO0H 3KWWA 4DR5L 1JPEA 2VDQB 1E4WL 1AACA 3MRQA 4DETA 4I13B 5IGBA 4JCLA 3RPIA 2C4FT 3HOWG 1CWVA 3BE1L 1I8UA 3KPLB 4DR3L 3H9SB 5CSZA 3BRFA 2ZG1A 3BXNA 4NZTL 4HULB 4GG6E 2XWBA 4NW2A 2JIXA 5CGBA 3LHPL 2WBXA 2VAAA 5C6TL 4GOPB 2IANE 3VE0A 5DRWA 5DJYB 4U1GB 3W1ZA 1E0BA 5IQNA 3KL3A 4LU5L 1JB7A 3Q8AA 4A66A 4HPOH 3BP7B 1GGYA 5GJTL 1E1OA 4EXKA 3FL7A 3R8BA 2AABL 3WOFA 4KROC 2PWDA 3SJVA 3ULVF 4OJAA 4C4KT 1KXHA 1AZPA 4H8HA 5E70A 3GKWL 1G9MC 2B4CL 5IHZB 3SDCD 4WFEE 5HYQA 1T2QH 5J4MA 1GR7A 3CCJA 2IVFC 4A7SA 4ZPVA 5GGTL 3UZEA 3X17A 2CUMA 4Q9CA 2LU7A 4C2MB 3T6ZA 4KI5E 1DEEA 3AU7A 4AH6A 2ZSWB 5ECJE 2JA9A 1W2KT 3CZKA 5JUEL 1BZ7A 5K5PA 4IKIA 1IX2A 1NUGA 4F37K 5CV8A 3HS9A 4F3FA 4TRDA 3ZYOA 3DMMD 5DT1H 5KYNA 3VWJC 2TRHA 1CB4A 4UBDC 1J05B 1PZSA 3HOWH 6PCYA 1R75A 5IM7B 3SK5A 4F93B 3UYOD 1PH8A 3D7PA 3U36A 4HLEA 2XWRA 3AYHB 3BQUA 1PMRA 2JCCB 3L7FA 1HCYA 1PG7L 3NP3A 4C4UA 4P57A 2Z8SA 1F9RA 5JQIB 4G4KA 3L1FA 4NZRH 3UTSB 2A6KA 2VABB 4UT6L 1JT8A 5E4IA 3GC3A 3PWJA 1Q94A 1ONQB 3VI4F 2PZWA 3S2DB 3S3JA 3OMCA 3F2LA 4XI5C 3HI1B 1BAGA 5E0FA 3FH7A 1ZT7A 5IGXH 4F5CE 2UWEF 1EWIA 4PG2A 2OFQA 5K1NA 4AM0A 4H8WC 4HZLA 4OZIE 2H32H 4FABH 4JRXA 4PJDA 1ODUA 3WUWA 4FYSA 4WO0A 3VFVB 4GUPA 4BWWA 1VB9A 1NMBH 4JJ5B 3PGDA 4IMLB 2E2DC 1J18A 5E4XA 1MCPH 4L18A 1OLLA 2X7LB 3KPSA 2VRAA 1P2CA 2PR4L 2EZVA 4DT2A 1ZGLP 4Y4HD 2UUDK 2KMWA 3HE7D 4QF1A 3BZFB 4HFUL 4JPBW 4ZJ9A 2SNSA 4AQYQ 2QT6A 4AMWA 3UZVA 4FZ8H 1AHWB 4I0CC 1A6ZA 2GBTA 2BA1A 1FC2D 3DIDA 2BMKB 1TQVA 3GHPA 3ZUCA 3ULVH 2BP8A 2PABA 3SKOA 6CGTA 4X65L 4RGOS 1RVFL 3A6OA 2JVUA 5DC2A 3WNJA 5IFHH 5LVEA 1W0WB 1GJXA 5CZRA 2UX7A 2NXYD 2WXOA 1E90A 3SDXE 1PFMA 1Z5YD 1HH6B 5JW4R 3EFOA 4ZQKA 3W5OA 1Y0LA 4UZSA 5MEPA 3B9AA 7CGTA 3GBNL 3X3GH 4HC1A 4PJ8B 4FNQA 4RFNC 4ZXBA 5LGJB 5BUGA 3OB0H 4K3EH 3BVGA 5T3XL 1N5YL 5F0LB 2EEFA 3B7YA 3UP1A 3TBIB 3QULB 1U58A 4IFDI 1LTRD 5D7JA 4OCNC 5HHVH 3SHLA 1YN7B 3PXHA 5DEGA 4AQOA 3HOXG 4CKQA 1T3FB 4PJXA 3OR6A 2EYSA 2L12A 5KBDA 3FRPG 2EKJA 4X4ME 2Q2UA 2EIBA 3H3PL 2JEBI 1XF4B 3BHBB 4ZTOL 1EQVA 1LDPL 1P6WA 2WB1A 3MLSL 4ESKA 3TT3L 1A63A 1GJWA 3VYNA 3HFFA 4MQSB 2D0PA 3QNYA 5GZNA 1J5DA 1TFHA 1E4JA 1NEZG 1VACB 2ADIB 1YNJD 3MFYA 1LP9F 4N4YB 1SN2A 3I2CL 4JCMA 1JPGA 4KH9A 4N1EA 5J3HC 3RY6A 3EO1A 5DM63 5DRXB 3MV9A 3K71B 2LAGB 4NYLA 4LP5A 1PH2A 1W6WA 4OM0H 1SNDA 3MZGB 4FL4B 4DOHB 4EN3D 3GBML 4H7BA 5IREA 3NIFB 1BJ8A 1QCBD 1AP2B 1FSKC 3D50A 4POFA 3L3GA 4J27A 1MUJB 4D7BA 2MFIA 1A0QH 4ABWA 3EJZC 2D03L 2DDQH 5EF1A 3DVIA 1XTCD 5I18L 3MGOA 5GGSY 1UZ6E 3VSTA 2OBGA 3JTSB 2K28A 4TVPD 1KIXA 2K14A 3SDYH 4IJHA 2H1PL 3G9AB 5C71A 5C5MA 3JQOB 3IDYB 4DTGL 5JHLH 2OMVA 3MJ7A 3NBHA 2IH1B 5GS0D 3BWSA 1UADC 4RGMA 5G3LD 3HOXH 3BD3A 4O02H 3TFKC 3RNQA 3D9AH 4URTB 5HVGB 2DD8H 1NIDA 1RU9H 5E6IC 2BP0B 1FH2A 4Q89A 3S5LA 5DD6B 5KVDH 3CSPA 3PWNA 3QZMA 4YXLL 3BZ4A 1AC6A 1D5XB 4UCFA 2A6HD 4CU6A 3DTDA 3HUJF 1FF5A 3HOWB 1HHGA 4JHAL 4TUOA 4IDLA 4P07A 5D1QA 3K80A 4P4RA 1TF4A 2HXAA 4NM4H 4TVUA 1N6QH 1WOCA 3QEQD 4GKZB 2AEPL 4RISH 2Q6WB 2VLJE 5F2DA 4BE5A 3ESNA 2PQEA 2ZYSA 1BVLB 2WXMA 3H42H 4YWGH 3RWJB 3ARDB 3F64A 1RUML 2FZ3B 4EZMA 1MREL 2XWZA 1JZDC 2Z91A 4NO0B 3CFBA 4QWWD 1BHGA 3QFJE 1P5UA 4FQXA 4N90E 5LBSA 5I76A 2Q2IA 15C8L 2YQ2A 4LCYA 4UANA 3ULAB 5HXMA 1O7SA 3QAZC 1BXAA 3J8F7 3LX0A 3IJEB 3ZE2B 1ZSHA 2B8OT 4OLYH 4CDDC 4OZGA 4XVSH 3E80A 4MXWH 2H32B 3L45A 3KPMB 5D7LB 2AJVL 2CIIA 1WCBA 4N3UA 2KPNA 1PD6A 4WDIB 5C0BB 1JZ8A 3GTPH 1UWVA 3L3JA 1MAJA 3RVWD 1BX2A 1YDPB 2FHBA 4OUOA 4AY0A 1II3A 1DVFA 1N0XH 3AFPA 3B6SB 4HS3A 4UDUB 5MENA 2EVIA 2ZAIA 2ZZUT 1UWXH 5E8PB 2ALYB 4X7SH 3ELAT 4R83A 4QGYA 2B3IA 1ET9A 3D69A 3CD4A 1MWOA 4RBPK 3GINA 4KUZL 4BA2I 1KACB 1QWNA 3GTJH 5BRQA 3BT2H 1KD1C 3WE6B 2Y2YA 4JCWA 1NM4A 3VRJA 2TSBA 1RUKH 2IDQA 5FGRA 3P7JA 4N1HB 4L3EA 4KPHH 2UVEA 2PWHA 4NPSA 4G83A 1D5ZC 1CVSC 1U3JA 3VFTA 3TBWB 1LTSD 2FMMA 3QCVL 2KOLA 3GGWA 2IHEA 4L8BA 4C56A 4HWBL 4KQ4L 3EYSH 2JKTM 3BWAB 2WXIA 1ORSB 4N9GB 5DVOA 5FEBA 2PPDA 2DNCA 1IGJB 3DGCR 4DFHA 1HZHL 4JG0H 1DP0A 4J3XA 1NWOA 3ZRCC 2Z8WC 4P23B 5IFAL 3L3HA 4QJ3B 3RPBA 1C5CL 5LN4A 2MNJB 4QTHB 5ALCL 1NBQA 1CL7L 4HJIA 2FJHB 4JFFA 4FTVB 4N25A 2X4TA 2CDEB 1NKOA 1ZJBA 5DZNA 1N5AB 2X9WA 3L4VA 3TM6A 2B2TA 1MJ7H 3PNRB 1RMFH 3BEVA 4WIQA 1QZ1A 3VVWA 3ECBA 3Q01A 3FCUB 1JV5A 4MWFB 1STEA 1LO2H 3KF6B 4FDBA 4YWMA 2NPLX 4LSRL 5TSSA 4Y16C 5FYKL 2X53A 3VFSB 4ZMTA 1I4FB 2F8OA 1JPST 2Y6SC 4FQ2L 1QACA 3I84A 3FT0A 1KCVH 1N9PA 3I50L 1TWFH 1NCDL 4NLHA 1CKNB 4XT3B 1TJXA 4G8GE 5IW6B 2D3NA 3HTLX 1XF3A 1VQLA 2R56L 3MSPA 3F7KA 3V4VL 1X7QB 4Z5RA 4XOAA 4JHWH 4PNYA 2VZSA 4K5XA 3ARXA 5EWIH 1LWRA 2NYZA 4GOPC 1I7RA 4LF7L 3CH8A 3LDBB 4OJEH 4F2ME 4W9EC 1DVTA 4U1GC 4L5FL 2DQFA 4PJ9A 1K83H 3VH8G 3UTTE 1A6PA 1GTNA 1A3LH 1BECA 1V3JA 5IIFA 1YEJL 4LLMB 3HS0B 4PRNA 5A2FA 2N0KA 3RVVC 5DA4A 4W9KC 2KDGA 2XXCB 1SMYC 1JNHA 1KPRB 2DLEA 2QVTA 1PY0A 3PSIA 3HOXB 4X6DF 2ZAHA 4O02B 2QILA 3RN2A 4IW4C 4JI5L 1XPOA 1HKLL 1X5LA 3QPXH 4K2UL 1BDYA 4AGLA 4MQ7A 4B9XA 1A21A 2F58H 5TDPB 4OD2A 2X2YA 2HVJB 2DJ4A 2YMXL 1BVNP 1DBML 2DQGH 3V6OA 1GM5A 5G5DB 1NEZB 3MRCA 4TQUS 2BE5C 1WD0A 4NRXA 4ZO7A 3QXWA 2N3JA 2K6ZA 3BYYB 1KLUA 4ISVB 4Q4EA 4DGYH 4MJ5A 1MF2H 5LDUA 1C8QA 5D4QA 1WFOA 3HVDA 4LNRA 3RVTC 2FT6A 5D3IB 1PYBA 2Y7QB 2QPEB 2ZX8A 3KPNB 1SDYA 2B2YC 2EDYA 4ZUVB 3QUKB 1JDCA 5IMOA 4CBZA 1B4OA 4ZYKB 3TS8A 3TP7A 2LW3A 5HGBA 5IYDG 1D5IL 4OX9L 3BVWA 5F9JB 3ARPA 4DK6A 3CXCA 1ZSDB 4GRWH 2F0MA 1A4AA 3T3MF 1Q90A 2BP5M 4PS4L 1IFGA 3NUKA 4ONFH 2XG5B 4WWOA 5I6YA 1EHAA 4LQ1A 4U1IA 1PTOF 4DZBB 1Q0XH 4JX0A 2HTKD 3NIDB 3GBDA 1Z7TA 3M4OH 4X4MA 1X5ZA 3GEFA 1M3JA 1LTXA 1C7SA 3E8UH 4LASH 4LBEA 2DWDA 2YMTA 4DPGA 3QG6A 1LP9B 3DSNA 4JM2A 3Q1EA 1P8LA 3UE1A 4G6ML 5JJIA 1WIPA 1MFAH 4MJIE 5FPIA 3C75A 4NOFA 3OIQA 1DBBH 3BDXA 1SN8A 3X1FA 4BRVA 2I46A 2YFOA 4KWUA 1I94Q 4JO5A 4ANXA 1O7VA 5KEEA 3MV7E 4FYQA 1A1OA 3GV3A 3P9MA 3JWNC 1B2YA 4CU8A 3C1EA 5BQ7A 3WLWD 3DO7A 1AIFA 3JAML 2A5HA 1H9SB 3H6MA 3IPFA 4L2LA 1OK0A 2JKXA 2IWHA 3GTJB 4L1HA 4PYHA 2K70A 3O11B 3V6BR 4FFYL 2CLZA 3F01A 1SYGA 2DQTL 5AYUH 1AHWC 2DY8A 3BGFB 1EEFD 4DWHA 4ABNA 2J4WL 4QOKB 3VXUA 1TWAH 3AACA 3G6JB 4P5KA 4BFIA 5IYDH 1OAZH 5F7HA 5I2IB 3RNUA 4U68A 4HAKA 4G70B 3GRWH 4JOIA 2XFXA 2WNKA 1YEGL 4HBCL 4KXZH 5CSGA 4MHEA 1PKOA 5B1JC 3IPBA 4M1CC 3EJJX 2WP3T 2WWMD 4YHMH 3F2DA 4OD3H 5BZXA 4PJEA 4DR6L 3BDYH 4L4VE 5I75C 2V7NB 3EFFA 1I7UB 3WCYA 3PWVA 1QX1A 4PJ8C 1E8ZA 2WIIB 1A4JB 1MFMA 3Q6FA 4KKBC 1JGEA 4CSSA 5C0IA 4PJBB 3L0OA 1WP6A 3G6DL 2APBA 1XH2A 4H0IA 4YAQB 1NAML 4YQXL 3ECWA 2BERA 5C07E 5BW7C 2AQ3B 2AVGA 1BFSA 1JSYA 3O41B 3SDAA 2I5YH 2X3AA 1FI8C 1EXGA 2HQEA 1CR9H 1PSKL 2VLJA 3MOAH 3TCXA 1UUPA 1CUOA 4F2EA 4PGEA 5JOFA 1ILQA 4OCXH 2DKUA 3PHSA 3C60A 4KMTL 2OQ0A 4QTFA 1S7QB 4UNUA 4WFFE 3UYPB 1SVBA 4JY4A 4PRBB 5A2QE 2I32A 1G7HA 1EAPB 4KHXL 1TWFB 3O2VH 4NAMA 4KKLD 3FMGL 1E4KC 3ZLQC 3MRNB 3ULUF 3H91A 3ABLB 4OTXH 2Q86B 3EBIA 1XMEB 3G5ZA 4RAUA 1JYXA 3D1MC 3MVVA 2OJEA 4UB0H 3ZTDC 4JI3Q 3OHXB 4FL4C 5E4EC 1M4KA 1AEXA 3K8MA 5C4XB 5DO8A 2HVKB 2QLVB 4ZMXA 1K83B 2O6EA 3TOPA 2WANA 1QSFB 1KBVA 1LO5B 1EHLL 4W4OC 3QC6X 3MRLB 1MCSA 2F5AL 3L5WA 25C8L 1ZHLA 2ATAA 4XBMA 5EN2A 2HT2C 5IBTL 5TF0A 3E5SA 3QRLA 1BQSA 3CHQA 5D71H 3ARBA 5H37G 1JNLL 1D1KA 3DETC 3NIGF 4FXLA 5A16A 1JPSH 1EEUA 3QHZH 3WEMA 4RGNB 4Z3HA 4LLUA 3VD0A 3OMAB 4PZ8A 4IIZA 3CQPA 5CEZD 2IQAB 4ZW5A 4MD0B 1RFDH 2PO4A 2APSA 3MKKA 1WPCA 1KGUA 3HCVB 4GQQA 1XGRA 2KUMA 3O3AB 4XYOA 2NLJA 2VH5H 5ADPH 3U50C 4G1MB 3RGHA 1XCWA 1D5XC 5JOEA 1NCTA 4GRLD 4NDMA 1W72H 4TNGA 5MP6L 2JQMA 2XTLA 3P0GB 3D4RA 1TJIH 4XXCC 1EFQA 1M1KC 2BZCA 4IS6B 3SPIA 4F58L 1GOGA 3HBQA 3IB4A 3CCEA 3O9WB 1WLHA 1RH8A 1IQDA 7FABL 4ODHL 1YEHH 3MBEA 5IJDC 1ES0A 5EKIA 3ARDC 1DGSA 1CXEA 4J1UA 4JFXB 3VH8B 2A9NL 2VL4A 2WUBL 4GRWB 1EV2E 1KGWA 1IE5A 4PRAA 3KE0A 4X4YA 3MGAA 2IQ9L 3LQMA 4MB1A 1DLFL 1GUGA 2VDRL 2ZXOA 1Y07A 3NAAL 3WFBH 3VR3A 3QDHA 3M4OB 5LXGH 3F8TA 1MZYA 1SJEB 5H37H 3VA2C 3OVUB 3U4BL 5EZOH 5L2KE 4K8IA 4NNPH 5E2WL 3KYHC 2MCPH 4GP8B 3RUGB 2XQYK 1WZAA 3G5YB 4KX9A 1E6OL 4EOWH 4QHKI 5IHUL 4TNVK 3D2UB 4MYWB 4JR9H 2OMYA 2XYBA 3UC0H 3NFSH 5IE8A 2G3NA 3RB5A 4IALA 2FJSA 4LFAL 2YC1A 4XMUA 5I19L 2YHGA 3COOA 3ZZSA 2AEQL 5AVYB 4LF5Q 3GSRA 4LP8A 4QRPE 3WG7B 5C2BH 4G8GA 1J8IA 3J81L 3DJSA 4HIXH 4UTAL 4P4KD 2SEBB 3TBCA 5IQ7L 5E2JA 1ENCA 2BK8A 2DBLL 5KNBA 1Z9OA 4Z0BH 4NUPA 1P7HL 4F2MA 1EUUA 3EBGA 3L6FA 3SE3A 2CVRA 1MFUA 3KWUA 4OEMB 1XEUA 4BINA 5JW5A 4Z8FH 3SQOH 1TWAB 3CKIB 2NYYD 2GY7B 4JV5L 1N12A 3PAVA 4ZTPL 4N26A 5F9DC 5EO1A 3CSYB 3ULVC 3SY6A 4G7VH 1BD2B 4N5UA 5AZUA 1P7BA 3CN1A 1H15A 1AJ7L 4PREB 4AXWA 1Q1JH 2J2ZB 1U8IB 4YHKL 5E2VL 2IGFH 1GS7A 2R7FA 1IEBB 4LDEB 1G6RA 5FW8A 5E3FA 2XQYA 4K94L 3QUML 5I1GH 4FN0A 2Y3NA 5DUPH 1I9JL 2Z7WA 2PW5A 1ZPLA 1BOSA 2K7PA 4P23C 5I74B 5JW3L 4S2SA 1NCBH 4ONGH 5DUBB 3D18B 5EKLA 4GLXA 2K78A 3CDYA 3PWLB 2VM9A 4DK3C 1U21A 2C1OA 3ETTA 4KBPA 3VWKA 4QIWE 3K8KA 4KV5E 3RGBA 4Y7MA 1TTRA 4BQCA 2CBQA 4MCNA 4N6QA 4Y52H 2NTFA 4IRZA 1MFBL 1K5WA 5D70H 4FEMA 4OH2A 3U4VA 1AD0B 1IT9L 2X2HA 3LPOA 5ANHA 1S7SA 3FONB 2NCEA 5HY9A 4CJ0B 3WNIA 3APNA 2YD2A 5A2LH 1X65A 4BFFA 1FUNA 4J6RH 1VQIA 1CBVL 1H6UA 4WEBL 5CJBA 4UOJA 2QADD 3RWHB 3TJHD 2AJZA 4BXSV 2X4NB 5KYUB 2EC9T 1M57B 1DOKA 2HX9A 2R69L 3HZVA 4JPVL 3TV3L 3NZSA 1A2YA 2VKWA 1CK1A 3UFIA 5CCHE 2FD6L 3L5IA 3RX5A 2H26A 1VQKA 2Y36L 4P5TB 1T22B 4MMZA 2WXGA 1JGLH 3LDBC 4RDQF 2BDOA 1PRTD 3DOSB 4YN3A 3SYOA 4RQQB 4AYMC 1S9XA 4MJIA 3L7EA 4K7PY 3BZEA 1BKBA 2V5YA 4KDWA 2ZWSA 1FBIL 4GIPD 2J43A 3OV6A 4R7DB 3WIFA 3HS0C 1V27A 4Y1AD 1JPTL 1NLBL 1NJ9A 2JJWA 3M1CA 3QUGA 6FABL 1ET6A 4NXMQ 1KB5A 4ZFGL 5IHLB 3NK9A 1HT6A 3BH9A 1TZIA 2GEQA 2X69A 1EPFA 1LE9A 3UDWA 5FWQA 2LLNA 1P4BH 2NT0A 2VLRD 2XPGA 4NWTL 3K46A 1N2RB 1FE8H 1HOEA 3P4MA 2R4SH 4AIOA 3QQ4A 4D8PA 3VA7A 4KJNA 4BA8A 5M95B 5ENWB 1VQJA 4Q74A 1U3NA 3MMEB 5IG7B 2LFNA 1BQLH 4ERSH 3S8FB 3IJYB 1W72B 3CFCL 3CHOA 1IJ9A 3PHQA 1BV8A 3WWVA 2CRIA 4GXUM 1IGYA 2R27A 4L3CA 5C09E 5GSVA 4B9CA 4P9HL 1X3FA 4X9GA 3KDFB 1NH6A 2F74B 4WNSA 3LRGA 1FL5B 4GI9A 2OYPA 3L2NA 5EU5A 1URZA 2WJ5A 3IXTB 1N67A 4BSWA 5K59F 1C08B 5DC9B 5F8RC 1VZHA 4JUTA 4DGIH 5GRXG 5DLMH 3QFDB 2BNQE 4GAJH 4QRUB 1A2TA 4ZQ3A 1JWUB 3LN9A 4XMVA 3UTQB 3WKNA 4KGJA 2PYFA 3J7YW 4WWKA 5JW4M 1BOGB 4HCRA 4AZ8A 4XPBL 2PCFA 1H3PH 4HPYL 1BBXC 5AUMB 4HH9B 4NEHB 5C07A 3ES6B 1TZHA 1WFJA 2CLRB 1J6QA 3IU3A 3DHUA 4FG0A 4PGDA 1LDSA 4X9IA 5K93A 5LWYL 3NBNA 3A5UA 2ZXEB 2WVVB 1CTNA 4PV8B 2NX5A 4RNRA 5EBWB 1YG9A 3VXNB 1I9RL 3OLGA 3VRIB 5IP9G 5A7BA 3B5GA 4ALAH 1XR9A 4G9FB 1IGMH 1TR7A 3MNVB 2VY3A 3WY3A 4NQDD 4AENA 4GO6B 1F2LA 3RWFA 3QIUD 1KXQE 3UDFA 3A6BH 1IKNC 3MNMA 5E23A 1PLGL 2O6CA 3NSDA 4IRJB 2H0EA 2XXGA 4K7FB 2B2VA 4XO3A 4OIJA 2E59A 3BD5A 1G9ML 3QI9D 4G42B 4DN3L 4BH7A 1K0RA 2VB5A 5DR5L 4H02A 4ICWA 1JXJA 5ADOL 2Z35A 1PCSA 43CAA 5GS2H 5ISZA 3C6LD 5IWLA 3BGFC 3HHRB 4YUEH 4NWUL 5KGUA 1JN6A 1QO3A 2N3SA 1E4HA 1WYJA 3GLEA 1MHCA 2G3XA 3FHQA 3QG7L 4OB5H 5I26A 1QFHA 3H55A 2UXCL 3PQYE 3FU3A 4BGDA 1NCCL 3DIVA 3HC0A 3E6ZX 1IKFL 4PGCA 4Y7OC 3VYTA 4DO6A 4XNXL 4YJZL 1QI5A 2DQUL 4HUXA 4EKXA 1QBBA 4PJ5B 5IP9H 2GJJA 5I8CB 2IH8A 5JOPD 1WC7B 1NDMB 4JFDA 5T1LD 3RZCD 4GJTB 2XTJD 3BFOA 1KLGA 3NN8A 3N3EA 2OA9A 5E9DE 2PNHA 2A4EA 5E8NA 4A3JG 5GGQH 4JKPH 4AYDC 2UUCL 1CFSB 3HG9A 2RVLA 4IKJA 4LXFA 4XVJH 1KXVA 1TEYA 4O2DA 1BJ1H 1Z7JA 5D9SA 1TWGH 1D5BA 4H8WL 4KKPA 4M8QB 4PUBL 1YPZB 5L4FA 1XGYL 3C08L 3TA3D 3BZ5A 4L1DA 2FECI 3KPTA 4M5YL 1WD8A 5DJAA 2DYRB 3GKZA 1UD6A 2X2JA 3WEBA 2JXMB 1N8ZB 2IDTA 2YRPA 1INQB 1P5VA 4RVBA 1D7QA 4IK6A 1QG3A 3QEHA 4N86A 4WJKB 5LCVL 1OGAD 1EA9C 1T0OA 4LK1C 1A3TA 2X9YA 1CICD 4X9HA 1SN5A 3LQZB 3OHXC 4UUJA 1Z9PA 5NUCA 4RESB 5I6PA 4NUJA 2YU9H 4MKTA 5AW3B 2JP1A 3BVNB 1THCA 3GMPA 1KC5L 3ABGA 2VDML 1KNOB 5K36G 4S1RL 4BCYA 2XIIA 3D3VB 3G5VB 2FBJH 2E27H 3LXCA 1JTPA 1SFOB 2JKWA 4I77L 1X3DA 4HD5A 4DH2A 5EOTB 4QRPA 4U7MA 5DJXB 1H3TA 3V0JA 3B3IB 3T65B 1S5DD 5JJZA 3O45A 2KVMA 3QUYD 4YC2C 1OF0A 3PRZA 4G5AA 2GJZB 4GAYA 4QY8A 5K9KA 3GMNA 4PD4J 3CCLA 2DLIA 4B9JA 4A3JH 2GW5A 4MJ2A 4RRPA 4NN5B 4IRSA 4RGNC 4ZFOB 2IC2A 2YUZA 2V7HA 4J5VA 2GI0A 2R0WL 4QD2E 1N8OE 3NSFA 5TGBB 4QKXB 1CT8A 4KKQA 1GPOL 1NANH 2DN7A 4K8RH 3RAJH 1IKMA 4RSYA 4O58L 3CCSA 5BN5A 1NMFA 4XPHL 3ZKNC 2DYPA 5HPMA 1FLTX 5JXAL 2CH4A 1PH4A 5I6NA 1INEH 2X5PA 3ZZQA 3FOLA 2F53E 1YC8A 2KENA 3CC1A 2GPZA 8CGTA 5E6YA 3K3QA 3O9WC 1TS3A 4UT9L 4ILDA 4PTTA 3CFEB 4GKJL 1R34A 5AZ2L 1IC4H 4XE5B 3GQBA 4AVJA 1U41A 4BIKA 5HVWA 1S9VA 3K5LA 3HOYG 4X8JA 3TWCH 4HJAA 3SSGA 5K36H 3UAJA 1IBLQ 4PJ7B 5D7KE 4R4BB 4MAYD 2YKLH 4BZ1H 5DZVA 5AOLA 2Z6FA 3MNZA 3L9AX 4V1DA 3WDIA 2H2PC 3HKZA 4N0FA 3SDDD 5L6YL 2GTWA 1MAML 3DJ9A 4FQ1H 4JK0D 2ZOTA 3V0DA 1GZPB 2VLKE 2WMPA 4DKTA 1EGJL 1MGSA 2BWDA 2VB3X 1MPAL 2Z4QB 1Q1BA 1G0YR 1XSKA 2ESVD 3II1A 3K72B 3AREA 5I0YA 4I0PB 1GW6A 1DZ0A 2HRGA 1D6EA 2BSTB 3FZUD 1QRND 4HKBB 3F04A 3WTWA 2V6HA 1F4XH 1F5WA 5IVXF 2BXZA 1F2ZA 2COQA 1DLHB 3VD7A 3L3DA 4NJAL 1PLCA 2RQXA 1QLEL 1A6TB 4LGSB 4NKLA 2VR8A 1VQOA 4ZX6A 5HY6A 3MLUH 1HHJA 4XC1L 3ND9A 2QQNL 4WENB 5CD5D 1CD1B 3HOUG 1CT1D 4YWKA 3MTRA 3LWUA 1XCQB 4YSCA 2NY5H 4V11A 4PEEA 2YK1H 5EU4A 5F0PB 1XB6A 1CGXA 1HYSD 1NGQL 2K4WA 2BOBA 4WUUE 2XN9D 3BSZL 4YSOA 2UX6A 1OB0A 3HOYH 5L9DL 2YD3A 1OARL 1LV9A 1H6EA 4YOKA 3TBTB 3I6KB 1BXUA 3EHBB 3LEYH 3I72A 3C87A 2Q76B 3CMGA 1XH3A 4NC1E 4FFZA 5IF0B 4W68A 3ZRSA 1QFPA 3B2UC 1P6FA 3WY4A 4J8RB 1AXTH 1PFNA 1Q9WA 4MXVE 1NL0H 1AKJD 5I74C 2TRYA 5KSBF 4KY5A 4HJEA 2QDLA 2OTPA 3KYKL 3QCUH 4YL9A 2B29A 2CFMA 2HDMA 2G75A 4OLVL 2PZTA 4JI6L 4KK6C 5F7FA 4A6YA 1BQHG 2UY6A 2OSLB 3TT1L 4K5PA 3CXFA 4WUKH 3E3QE 1URLA 1GTFA 5IV2B 3IBEA 1CVRA 4AIXA 4Y9CA 4G8EB 3G6EA 1TWGB 1VQCA 1MI5A 4JRYA 4B9PA 1E27A 1IBFA 3HOUH 2A68C 2NVQH 2YUXA 3VGEA 1NCOA 1BLNA 3W57A 5ALBH 4ES9A 4BK8A 4ODXB 2XG4B 4K9EL 4XODA 3FU0A 1BVKB 2VZUA 4M43H 2AXGB 3IFLL 2EYFA 4MQXD 4F8QA 2YPLD 1HOCA 4JZNA 2WBJD 3WY2A 1FA4A 3PE9A 1BAWA 1LGVA 3VMOA 5AJ3Q 1R24A 4XVTH 4UM9D 3P0YL 5ESVB 2YU9B 2K8QA 5B21A 5TDNA 4M3JA 5CLXA 2GYSA 1PZKD 4WI4A 1RP8A 3RWIA 4P5TC 3NRQA 2VL6A 4POGA 1DVXA 2EAEA 2GFBA 4HIKA 3CVIL 3BUYA 1UXSA 4LVHB 1RPQA 1KXQA 4WLCA 5AOZA 2NTSA 3BRDA 1O9ZA 4YLBA 2LE9A 1UB5A 3AAZA 3FN0L 1A02N 2O61A 4GB9A 4DUYQ 2FX8H 3DVGA 5FW6A 4RWHA 2BWIA 2MNAA 4A3JB 2OL3H 3DO4A 4ZMOA 3K8LA 1QNZH 5GISH 3DM3A 1LD9A 4WU5B 5I5RA 3M4YA 5AW9B 2EO9A 3FOMA 3BP6B 3UTOA 5F1IB 3VTMA 3QUZA 4OJFL 1HWHB 5KOVC 2HLFC 2PCPB 1TVHA 4UOW1 5FYJH 1NGPH 2OCJA 1HHHB 4ZUTA 3D39A 1X5AA 4ODWB 3UAAA 2C3GA 2NR6A 1ZT1A 4LHUG 1SYBA 1T89C 1C1EL 1S5ED 4JFOA 1L7IL 1EVTC 3I56A 3GEWB 4Z76B 4HGMA 2OTUA 2XZQL 1YEFL 5TFSH 4NC2B 3E9HA 4RG1A 4M5ZH 1NAKH 3NG5A 3LTVA 2XQ0A 3O6KH 3T0EE 4ZMNA 1WTGT 3V4PL 2MOGA 3PCYA 5BR8L 4L5FE 2R1XB 4DJMA 2AERT 1FNSH 1JGUL 3CD6A 2QFRA 3UBXB 5CC4A 2KCCA 4GNKB 5FK9B 3SPVA 3BVTA 1TNNA 2WD0A 4NQVA 4NO5B 2VDQL 3MC0A 3MRHA 3U4ZA 1EFXB 5E9DA 4Z7QB 1OZUA 4HS8L 1H8NA 2EDGA 2F0GA 1KCKA 4FNFA 1UD5A 5DFVC 2LTQB 1YNTA 1U2YA 4JO2L 4JYAL 1WTLA 2UXBL 3LNGA 3MAWA 1QWUA 3CPLA 1KG0B 4Y2OB 3ZMEA 2NB0A 4XWOD 1TCRA 3WO4C 3HJ0A 3TZVB 5ETUA 3TYFA 3NABL 3Q8BA 3KLLA 4JZJB 4UT7H 4O9HH 1IC7H 1F58L 3LEXB 5MERB 1A7PL 2GJRA 2JV6A 4A7UA 1A66A 4IRJC 3QQDA 1AIZA 2A6IA 3Q3GA 5JVG3 2QVIA 1M7DB 3HMWH 4GSQA 4L8DB 3T2QA 5J57B 3THML 3CX2A 2ITCB 4ZUUB 3FQUA 2CHNA 4PRHD 4LNVA 5M3FG 1H0DA 1QPXA 3B9KB 4FMVA 4N87A 4OAWA 4AG4H 2WLIA 1DL7L 2LXJA 3F05A 4AGQA 1KIQA 3N9GL 1MCFA 2F54A 2MQHA 4XIGS 3ZQ9A 4H26B 4ENED 2AWNA 3HOYB 1O7YA 1NZRA 3WN5B 2H4OA 4YDKH 3LD8C 4JE0A 4PLOB 2H0FA 5HVFB 2G2RA 1BLIA 1CIUA 3OM3B 1KEML 5F3HB 5G2NA 4XPTH 2YGPA 1SYCA 3AMUA 3RL1A 3KLHD 4Z1PA 5G3LF 2Q8RE 1MW3A 2DQEH 2WBKA 5HDBE 1HSAA 4PJIE 4I1PA 1C16B 5KSAD 3T6WA 5I16B 4UDTA 4I7AA 2DOCA 3MODH 4F20A 1AO7B 3QZPA 1NICA 3HE6B 5FF6B 2YAOA 4AYBG 1HXYD 4JFHD 4PW4A 4YEEA 3VI4A 5I8OH 2RJMA 3S1RH 1JERA 2A3TA 1DDHB 3OXRA 5D2LF 3OKEB 2Q7AA 3QAQA 4ZYSA 1JWMA 2UWEA 2HH0L 2Y6TE 4QRFA 2F53A 3U58A 1N4XH 3WD5L 1N3NB 4NXSA 4P9ML 1SEBA 2VRQA 4XHJC 1BZ9B 2NY3B 2WXLA 3BEWA 1AZQA 3MRKB 2OJ1A 4JKKA 3WGUB 3HOUB 2NVQB 5DDHA 1C4QA 4GBXD 3TC9A 3JWOH 2G0LA 3LVTA 3S0PA 4AX3A 3QEGL 4NZUL 5DYOA 1HNXL 3EYVA 4KJQD 2NRDA 4QXTA 4A3DG 3DX7A 5CO1A 1GYAA 5F9AC 3EGXB 3K7UC 3OIPA 4PJGE 3SD2A 3IN2A 4I5BB 1OW0A 2L7QA 2BNRA 2W8CA 2P26A 4KMQA 1CLVA 1MHEA 5BQDA 2HKHL 1N8RC 3HOVG 1SGKA 2HRHA 5D7IE 4DV0Q 2LFGA 4B9WA 3LX9A 1O9VA 2CKBA 3MLPA 5BRZE 1HXMB 1EBAA 2ZUSA 4BQ6A 1YI2A 2KCMA 4CAGA 2YBGA 2MKWA 2RB8A 1ITCA 2FRGP 1HWWA 3CCHA 3LKPA 4RGOL 1VQAA 4D0CA 5FO8B 4HUVB 1Z9FA 1NIAA 5DMJB 4F8LA 1FR3A 1I7ZA 1NKGA 4AIZB 1YQVH 4YBQD 3B4NA 3FSVA 4Y19D 2A9MH 1NCAL 2GC4C 4B97A 2XBDA 1BQHB 2OL3B 4HIIA 1EJ6A 4BSVA 1MVYA 2JKSA 1SJVA 4FKEA 3T8VA 3FMCA 1R3IL 2AWOA 4M6OL 3SJVD 3P77B 1B70B 5IHHA 2XA8L 1ZYRC 2LSSA 2RALA 5F6HJ 3QO2A 1KENH 3PNWA 2NZ1A 4QGUA 1IC5L 4NN5C 5F21B 2IH3B 3A67L 3DX2A 4M02A 1CLCA 1OCOB 4DKAC 2BOCA 2G2PA 1JGVH 1TCMA 2H5XA 3ETSA 1KLFA 1L7TH 3H2PA 1FH5L 1V7NL 3O3EA 3RU8L 4Q8BA 3VXTB 5HI5C 1U0LA 2OR9L 1AHMA 3QORB 4U1HA 4A3DH 5E94A 3M6DA 5FIEA 2R0ZL 3S96A 1Y1WH 3B5HA 4XP9H 5IMKB 1KCLA 2A73A 4KKCD 4JLRA 4OCMC 3JV5A 2AKRA 4OUUA 3MN8A 4Z7UE 3EROA 3FYIB 3QHFL 3FBKA 1A6AA 4TTGA 2Q8BL 4PY7B 4C47A 1JK9B 1UUSA 1SJHB 1TTUA 2QPSA 3CDZB 3MPCA 5KSBB 2IBGA 3PL6B 2KDYA 2ITEA 2FNBA 2LV4A 5I0VA 2OQJB 5JPMB 2MHAA 4ZRZA 2X4OA 4Y2DA 3FO0L 4HKZB 4JQXA 3GXNA 3N1GC 3NE5B 5EOCJ 4PFEA 3MFGA 3CC4A 2ERJB 3K0WA 1M7UA 4N0UE 4W9DC 1K4CA 2R9HD 1PHJA 3DX4A 4JE4B 3RL2B 3T4YB 5IJCC 3KLKA 4ADIA 1TTCA 1IXRA 4ME5A 1MJ8H 3KHQA 2EILB 1BPVA 1V9PA 4X5WA 4XP4H 3ESUF 1JZ2A 5E1AA 4Z7NB 5JORB 2XV2A 4Z7AA 5IB3A 4E0RB 1VCIA 5BVJA 4HPOL 3GMLA 5MEOB 3QYNA 1E8YA 3WKYA 4KITB 4X6CF 1XZ0A 4X7FC 1U4EA 1LT3D 5FGCB 3NUCA 2F4VL 5I2YA 1TENA 2R2BB 2RD0A 3PCOB 3A6CH 4LHUB 4WTXA 5D72H 3T0DA 1K4DB 4OLXH 1T2QL 5H2BA 2WNXA 12E8H 4XMKH 4JY6B 4OU3A 3H1ZA 4XTCS 5HHOD 1L5GA 4OLWH 2I07A 4X5XA 1EYCA 3BJ91 5ABAA 5HYSB 3HUJA 1EWCA 1EYDA 2X4RB 4QHPA 5HHPA 3S9DB 3ARQA 3NPSB 3HLAA 3F7RA 4KNTA 3O8XB 5KW9H 4G7QB 5LJYH 3Q48A 1NOAA 4A3LH 4LLWA 5DT1L 4DV7L 2P49B 2VDNH 4GW1A 1P4LA 2D3VA 2YFNA 4PG9A 2W60B 3EJQA 3EHBC 4H7VA 1AFVH 4A3FG 3AITA 4PB9L 2PWGA 5DUMH 2GJPA 4LLVA 5I82A 3PDOA 2XACC 5TPWL 1ZVSA 2UZYB 2VC2L 3S1RB 2H6UA 2A1AA 2YD8A 3I6SA 1HNGA 1OP5H 3WIIH 1J1XL 3QPQD 1KTBA 3U4AA 5B3SB 5IY0A 4CN4A 1J12A 4LSQH 1H19A 1EO8H 2OULB 4PWJA 4ZMWA 2ENJA 3UBGA 2M1KA 3RJDA 1V05A 2PCYA 3IGAB 1CC3A 3T1YL 4AEHH 1ZLWH 1VESA 2DRUA 1DR9A 4MMXA 3UACA 1BF2A 2YIHA 3K0YA 3WHXA 4ACPA 5JW4N 3T1FA 4IMKC 3CPWA 5CIPA 1AMXA 3IBOA 1AE6H 5AOJA 1JXKA 2H3NB 2CLVA 1ZWIB 1NMBL 1A4KA 2VLME 2DL2A 3HN3A 3LRSB 4LRIA 4NI6A 4WEEA 1JXGA 4UYQA 4BM7A 5HD8C 4MCYB 3IAQA 2OXPA 3KYNA 5E00B 3AU1A 3E7JA 5IQMA 4FF3A 5T33H 2W0PA 4ZFQA 4ABVA 1SOQA 3DV4A 4B3RL 2DBJA 1W16A 2PPEA 5F71A 5JPNB 2HT3C 4AYBB 1KV7A 4FHJA 1RUPH 3D4ZA 1W80A 4LVHC 2DJUA 3ULVL 1PYWD 1C9OA 1ZIBA 1GSMA 1S7UB 3MLXL 4GW4B 4QRBA 4WTZG 3DYOA 5IFHL 4OV5B 3BWZA 4FXGB 2DIBA 4XX1G 4YHNA 3KDPB 2DM4A 1U8LB 4QRRA 1HI6B 2WO4A 5DD5H 2IWKA 3WEAA 1PFBA 3FU7B 2IPKD 4APQB 3B2DC 1N6VA 1FL0A 3X3GL 2E2IH 2KZWA 4G7SB 4K8RC 2EUWA 3FHWA 3JSSA 4A3DB 2NTSP 2YD7A 3RX7A 3SGKC 3UEQA 2HX7A 4PVMA 4N8FA 1YYMH 1Y1WB 4MNQA 2AQ1B 3UOAB 2XJKA 4KK8D 2VSKB 4H0HB 2GBVA 1K6QH 4FNRA 4LK4A 4KFMA 3ZE0E 5HHVL 4J28A 2JA8G 3ZE1B 4FX5A 3QDME 3S4SA 3CHSA 2YUWA 2CDGB 1U3HC 4PJIA 4RX4D 4I4WA 3K59A 3HN5A 4TLTA 2F7QA 3Q2NA 1V3MA 4G7RB 5FECA 2N49A 2EDEA 1IGTA 3TVMA 2QR0A 1KJ2H 3KCPA 1QVOB 1JHKH 1MXGA 4NC0B 1SNOA 1DFBH 4MB3A 4NM8H 3FQRB 4BE6A 5C0AE 1ORQA 5FK9C 4H8VA 4H88H 4NO2A 3KPRB 4NQCD 3EH3B 4I89A 4M62H 5EZJA 1SZNA 5EO0A 4OM0L 4NKMB 4ZK9B 4Y9BA 5AAMC 2W65B 2PYED 5IK3A 3GSXA 3H7BB 2LTQC 2FHCA 3FPXA 4NQXB 5KYXB 2EQSA 4R8NA 1C12A 2H0PA 4I2XE 4IBSA 1P16A 2X12A 1A0QL 4JZOA 2DDQL 5DJZA 5JIMA 3GB7B 1CGSH 3H0TB 3TZVC 1JP5A 5CR3A 4JZJC 3DK0A 1DD2A 5D1XE 1FZOB 1Q3LA 4X6DA 3SDYL 4AW7A 4HHWA 5IOKA 2EIKB 2GCYB 5D7IA 3MJ9H 4Z7IA 3WEXB 5JHLL 1E3ZA 2AQSA 3ZT5A 2JA8H 4MJJA 1I1AA 4HHAB 3UO1H 4X6EA 1Y8OB 2I7SA 4O02L 2W81C 3B9KC 4D3CH 3D9AL 3RWDA 1YIJA 2D31A 2DD8L 2IAND 4YSTA 4P2CG 1PF3A 1DBJL 3U9PH 5KVDL 2XYCA 3VXSA 1I1YA 2GT9B 4CDGC 5AW4B 1FYTB 4HISA 1MVUB 1VHPA 3WN5C 3OKNB 1A4CA 1K28A 2VDNB 5DZLA 3FSZA 3S88H 3MX0B 1WQVT 4AVKA 3QUXA 1RZPA 1NB8A 4A4IA 4GI6A 2OW6A 5FO9A 4NM4L 4AQAB 4RISL 2KA7A 3WELA 3FDWA 4YHPA 3RUZA 2ITFA 4WFED 3VYOA 1YITA 4YGVA 5EOCL 1LHZA 1XGQA 3CCMA 3H42L 1AXSA 1MH5B 3HE6C 3S2AA 1P7KB 4NXKA 4IU2B 5AVWB 4DQOH 5C3IA 2Y1AA 2BHFA 1DANT 3OKMB 2FYYA 1CE6A 1JUFB 3GSWA 1JPFA 2JA7G 3MV8D 2EYRB 4KI5D 4P2RD 4YDJA 1KWGA 5KNDA 5K5YA 2YS4A 4LFBL 1SF3A 4S10A 3SE9H 4Z7UA 3K6FA 3W39B 3IWUA 2AHIA 4OLYL 2BC4B 5DJ0A 4XO5A 3GUFA 4XVSL 1HUMA 1B4JH 2NY3C 3FH5A 1BBUA 1DQVA 1OOAA 4DUZL 2BOLA 3VXRE 2HIXA 2FMCA 2JN4A 2XZAH 4XO4A 4H25A 3FB7B 2YXMA 2G5BA 3SOTA 1P7QD 3PMFA 1BP3B 3WIHL 3M4PA 3H3BC 3O4LE 3WLBB 1N0XL 1MWAH 3K5RA 5CN2A 5JZ7C 4NQUA 2F0SA 2ATKB 4PS3A 3AFQA 2HT4C 3HRPA 1AI1H 4X7SL 1SBBB 4M4PA 1PG7W 3DUSB 4EI5D 3DO3A 3ARFD 2EUZA 3QEUA 3P4NA 1NFDE 2AJUH 2Y22A 3EJPA 4W1TA 4JAMB 3RDTB 3DV6B 3BT2L 4KY1H 1KBGH 2WQVA 4PJCF 3CFJB 2DWEA 1BYPA 3F7YB 5MI0B 3OKDA 1RUKL 3QWOA 5DYFA 3MZTA 1BAFH 3FFCB 2CCWA 3CLEH 4PIBA 2WFWA 2VSMB 4KPHL 5F97E 4AQ8C 2JA7H 4R3SB 4F88A 1Q9LB 3OWEA 3RX9A 3ME0B 2BSRA 5DJCB 5HBBA 1S4ZA 3L4YA 2WYTA 3PWPE 4UQDA 1GIGL 1I8IB 3EYSL 3VMPA 4DKFH 3K74B 2E2IB 3KLAA 3LB6D 4HJUA 3GIVB 4KVCH 1GYWA 5DC0A 4AJWA 5IMMB 1PKQA 4FRWA 3NOIA 1XNQL 4JI5Q 1WD1A 5KANG 3J2PA 4XB7A 4OIAA 3EZ8A 4LIQE 1JYVA 4N0YH 3ZTCC 2PMZE 3SCMD 1S7RB 4OI9A 4KHPQ 3QORC 4Y5YC 3QFGA 2P5EB 4PRIE 1HX0A 3LEVH 3IJSA 1SYSB 3ROOB 3HEIB 1G7LB 4L48A 1JQYD 3GXTA 4YPGA 1T83C 4NKDB 1KJ2B 4XMLH 3VFNA 3FEWX 4Z7WF 5IWAL 1IW7D 3P3TA 1EH9A 1LO2L 2JJVA 4TSBH 1ACZA 4D0BB 2A6EC 2R29H 5JPMC 2D4DA 4HKXA 3U48A 3QZWG 1LO4L 5AKTA 3ZMRA 3L9YA 4A7VA 1RIUH 2ERJC 1FN4A 2D0FA 3MOBH 3TTSA 2DWXA 1I5FA 2DLHA 2XFGB 4JHWL 1RURH 3SKUD 2BSED 3GTTA 1KJMB 5AW0B 2PQAB 2ZOKA 5HYJE 5HHQB 1E9OB 1HFUA 2GVBA 3IGFA 3JBG7 2CR6A 4WSJA 4HIEB 3V5DA 5TK2A 2YXWA 3O4OB 4DPRA 3OX8B 2EIFA 2HFTA 3OQRA 2DQIH 1F3JB 3CVHA 3DX6B 2JA8B 3UO8B 4MNGA 3HIZA 4FP8H 5CCGE 1FFPB 3GM0A 3KD4A 1R5VA 1UXWB 1QMUA 5LAXB 1FGNL 1I6VC 1QUQB 4DV5Q 2F58L 4N0CD 1RULH 3S1QH 2LAAA 3NPSC 3W82A 3Q2LA 4MDJA 3O8XC 3WY1A 2JELH 4DGYL 1M6UA 1U8JA 1OTUD 2A1WH 2OI9B 4CC0A 4L1SA 1FL6B 1XIWA 5DZ9A 4I3RH 2NXZD 3ZGIA 1F9PA 1ZV9A 1XQ4A 2EYHA 5DJ6B 3EYQC 1QNUA 3SPHA 3T1HQ 3J7AF 1JJUA 2WTOA 5FLXL 3UZQA 2NXYC 1XXDC 4KKUA 3UPRB 2XNAB 1M2OA 2I24N 3WBDA 3V95A 5CBAB 4ONFL 4TVAB 4YSEA 4HUWB 3QDJD 1L2FA 4DPCX 2MJWA 1BF8A 3J7AV 4NUGH 1A6WH 1AANA 1QSEE 1QBAA 1Q0XL 3JWOC 4N9OB 4CKCA 4QYOB 3X3FH 3TIEA 4LASL 4PR5A 2WAQG 3NJFA 4FCHA 2QSVA 2Z65C 2EKSA 2CGYA 2NUTB 1AD9B 1PL3A 1N64H 3GTQH 1KIPB 1NGXB 1MFAL 1QW8A 3ERXA 4L0YA 1MWAB 2F7OA 3FU9A 3QGVA 1DBBL 3Q1SH 4GKSB 5C0AA 5IEKA 1NY4A 4N24A 1QYGH 1EYAA 1CSQA 4XP6H 3QFJD 1C7TA 1FNGB 1ZHBA 3US1A 2VQ4A 2CE6A 3B8SA 5CZXC 2B2XH 3CHRA 1TY2A 3CE1A 4K5LA 4HCFA 4N22A 3PGZA 1OO2A 4WW2B 1D9KD 4IUQA 1UACH 4I2XA 3GSVB 5JW4Q 2XPYA 4FKHA 4Q6IB 3GMMA 2AQ2A 1E9QA 5JPNC 4KD3A 2YXFA 2PYKA 4M1UB 2F0VA 1YEDA 2JA7B 3DWTA 3H9YA 5D1XA 3QDGB 4PZ7A 1OAZL 3BKJH 5IB5A 4R4QA 5IHBA 1SHMA 3VQ2C 2TAAA 3GRWL 4HKJA 4FXGC 5DTFB 5J9PA 1P9MA 2KEDA 1R5IB 1NCIA 1F11B 2FO4A 1AS7A 1JHTB 5JXEC 1UWGL 1RPUA 1U6AH 4DVRH 1DVZA 4YHML 2RQ8A 3BDYL 4RH4A 2MSPA 4APQC 1KYOK 1RJLA 5SWQB 4L9LB 1HZ9A 1V5JA 2XKUA 1GH7A 1NUCA 1E7UA 2L0CA 5DHYA 3S17H 1JIBA 2BVOA 3I6LE 3H3VI 1W91A 4JS7A 4KO5A 4P3CH 4JG5A 4U6XA 4PGBB 5CR8A 4K55A 4W9JC 3U7AA 5HYEA 4Z3IA 3H3KA 3TF4A 3OJMB 1T03H 3NELA 2AXWA 5J89A 1IAKA 3AMLA 4WSKA 2I5YL 1T66C 3TP8A 1CR9L 2B20A 2K9UA 2L8AA 4TQEH 4X5RA 1LJMA 5C3TA 4ELKB 4MX7B 2A6HC 2X6UA 1DE4B 4NPYB 4L2YA 1CXLA 4OCXL 4UTBA 2XBZA 1CDGA 4N1CA 3SYQA 4RIRA 2A0LC 3K58A 1RZQA 2ZWYA 2G5UA 4V33A 1Z66A 3O2VL 3GMQB 3FJTA 1CLOH 3C9NB 4JPSA 5ESAA 4JBMA 4UQEA 4OTXL 4CMHB 2EDJA 2AJYH 1MW2A 4FYTA 2VWEC 4AYEC 4DXFA 1ZHKA 4PP1D 4R0LA 4OIIH 4PJHF 4UB0L 1A1NA 1ZEAL 4PAZA 5HPOA 5EU6A 3ZL1A 3BP5A 3FCSA 4QWWC 4KU1A 3VXRA 1AGEA 3D51A 5LL6X 2RSNA 4OVUA 3IKCA 1SUJA 5HVHB 5LGKA 5D55A 4U2ZA 2BJML 1WBZA 4WK4B 1SBSL 3FFDA 2EXYC 3O4LA 3IL8A 4GKLA 2R23A 1SYEA 5ELEA 2PW2B 5F8QC 5DI8B 4Z7VB 1X55A 4LFAQ 3GTKH 2NY2B 3GSNL 4WGWB 5FYLH 4DW2H 5D71L 4E41A 2VR6A 3KXFB 1LABA 2JKRM 2R2EB 4R96B 5GHWH 5FA4B 1MCLA 3KYOB 1LILA 1IVLA 2IV8A 4G8GD 3K7AH 1JPSL 2FL5B 1TZAA 2R1YB 3HG5A 3OGCB 3MLZH 3QHZL 4AQZA 4PJCB 4KKAC 4LLYB 4PU2A 1PCXA 1NFDA 2HP4A 3CZUB 4OO1I 3S1QB 2CBOA 2IBZY 1RHFA 4YE4L 2VH5L 5E9NA 5ADPL 2J8HA 4KJYA 4XZUA 3MXUA 4XNAA 5HI4D 3UTTD 4PCTA 3U6RB 2AQQA 1W72L 1MHHB 3M88A 5F3BB 3QJFA 1D5RA 4WV1C 4Y8DC 2ZCKH 3ZYIA 1LLAA 5IEHA 3DROA 1TJIL 1VA9A 3ZDYB 4F9PC 3ATDA 1FZMB 4I48A 3PWPA 3GSOA 3HZMB 4LPXA 5JQHC 3H9SE 4HK0B 4A68A 2XGTA 4LEXH 1WT5A 1IU1A 1YEHL 5IB1B 1YZ6A 3K2UH 1T5KA 4YHHQ 3M85A 1FFOB 2Z31B 1G7MA 4HHGA 1G7PA 3K81A 5IBUG 3REWA 2PMZA 5LO7A 5JNYA 1Y7VA 4LAQH 1U8NA 3RTQD 2N78A 1J86A 2G4GA 3MLWL 4L5SA 1NUFA 2SDFA 3TN0D 1XEDA 5LXGL 5C0XG 3IDNA 3QXVA 5E5UB 2CO7A 5EZOL 2NN6I 2WKOA 1JRHI 5GGRB 2NMSA 1HQRA 4K6DA 5BN3A 3BSGA 3GTQB 3CZGA 1PLBA 4EOWL 1JZHA 5DD3L 4JR9L 4UQ9A 1EQRA 4WNQA 3NFSL 1CGWA 3APDA 3UC0L 4MRBA 3E6HB 4ZAKD 3TNNA 1LMIA 3KXFD 3N91A 2GJ6D 3DX8B 1J9SA 3H7LA 4HUKB 3CFMA 2HRPH 4DV1L 3LSOB 1RY7B 3NTCH 4XZ4A 1A65A 3LH2H 5C2BL 4HIXL 1PQZB 1QUPA 2JTDA 4NQEB 4X6FB 5E6SB 5A2JH 6PAZA 3HP3A 4CVZB 4NFBA 1KT2B 4Q0FA 2CCZA 3GYRA 3JZYA 4F7TA 4LUVA 5MEQB 1CTMA 4Z8FL 4HIJB 2Q10A 3RDTC 3NCMA 5FUZH 2IFFH 3SQOL 2G9HA 1UATA 3B9EA 1Q81C 2CRZA 2JCCE 2ZNXA 4M6AA 4PV9A 5MI0C 2GK2A 2NZHA 2J88H 5J0BA 3STBC 4G7VL 5IR1B 2XSCA 2BS9A 4MJID 3LKOA 3OF6A 4FF2A 2OMUA 1WFNA 2MPAH 3UROR 3L3KB 4KNQA 1Q1JL 3BLBA 4Q2ZB 2IGFL 3OKLB 3UPCA 2FR4B 1CE1H 2CCVA 4X66L 1GGTA 1SM3H 3MV7D 5J56B 4HXBH 1E4XL 3TZUA 3X13B 4KD4A 5C0XH 5I1GL 3I3DA 3EJYD 1NGWA 3D0VA 1HHVA 3VFWB 2JJTA 4I18B 1QVGA 3S17B 3E9IA 3GSQA 1NCBL 1WBXA 4ONGL 3DI3B 3LPGA 5J6HB 4PS7A 3WUZA 3C2SA 4G57A 5E1FA 4RMBA 2YQ3A 5T1IA 3C1FA 3FT2B 1EFWA 2F8XC 5E2UH 2P5WB 5IFJA 1ENFA 3FB6A 4U4IA 2Y07H 4OZHE 5JO5A 3VRLE 5D70L 5BCAA 1NBCA 2W59A 1DYZA 3JWNE 1BFTA 1MY7A 2FSDA 1Z5HA 3O13A 1KAAA 1WAAF 4L4VD 4J6RL 3QIWD 1DTUA 5GGVH 2UUAQ 2YAFA 3VFUA 3ARGA 3CFQA 3F7VA 1B4RA 1REIA 1E22A 2Z8LA 3PUYA 4UU9B 1U8QA 4GRMB 4R8WL 2Y1VA 3ZZ1A 1DJSA 1F4AA 1L9OA 2WM0A 2YLHA 3VUAA 2CZNA 4MRCA 1ULVA 2Y7MA 2ZUYA 3ATBA 2EDHA 1QSEA 5LB1A 5C07D 3L4CA 3HRZA 1MJUH 3EIVA 2Z8RA 3FT3B 3QK0A 4KK9D 3O2WH 2VIRB 3BP4A 2EZ0C 4TVPE 1E4WH 1JGLL 4CHTB 4FG4A 3V0VA 3VD3A 3CDGB 5KVEL 3O0RL 1A8JH 2CW0C 2R7EB 3WKPA 2R93H 4LLQB 5EUOF 3BE1H 1RKRA 3H9HB 2VXQH 2KEEA 3GTKB 3VFPA 1FL3B 1U95B 1QE6A 2VITB 3CFKA 3KYMB 3O4OC 1JMCA 4G8FB 4L4TA 3REVA 4MCZA 2VERA 2PO6A 3MLVH 3K7AB 2GBAA 3CN4A 3HFMH 3PF4A 4F80A 1M90C 5EIIA 4JDEA 1P4BL 3T3PB 2EYTA 4HU2A 1FE8L 4OZFA 2R4SL 2UXDQ 2FXQA 5SWZB 3T8XB 5DMKB 2C7UB 1MRFH 2H5UA 2PF6A 3UL4A 3SOBH 1KSRA 4CVXA 3LKQB 1TNMA 3VXMD 3FHAA 3KW8A 2B2WC 1BQLL 3CFDA 2Y0SE 3QEQE 1VKXB 2B4CH 4P2QB 1BO0A 5ACZB 4FD0A 4LCWD 4MVBC 5PAZA 4AWJC 1SYFA 1KTDA 3MAQA 1YEZA 1P53A 5L8JB 3CX5K 2UXGA 2HTLD 2C7FA 3KPQA 1IARB 1OE2A 2WKCA 1XH0A 4XGZA 5AOIA 5T1MB 4KJOA 4FJZA 3S24A 4DGIL 1KHIA 1J0ZA 1WRFA 2AGJL 4HWEL 4NB7A 4NNXA 1DANU 4EUPG 3W5MA 5DLML 2OZ4A 4GAJL 1U8PB 3DVNB 1SMOA 4JFED 4DOHE 5B22A 3NIFE 4NKIH 4MD4A 1RODA 2J4XA 2W9EH 2O5ZH 1YY9C 2XKNB 4RKBA 2ZSVA 2E7LC 1O6SB 3B56A 1Q86C 4W9GC 1JF6A 2NYKA 3LN4B 4GQPH 4ELMB 5IKCB 3C5JA 3EGSB 5EEXA 1H3PL 3S35H 4HG4K 4EKJA 2XNAC 4FOMA 1D5MC 2HSIA 5F44A 2F1ZA 3AC0A 4ORGA 1GVPA 2V17H 3PHAA 1FNEB 1PG7H 2GITB 1LYQA 4K71B 1VF5C 4ZKBB 2UUCQ 3OAZH 3R8QA 2F0WA 1MCWM 2X89D 2FEDD 4YR6B 4HJ7A 1DBAL 2XC8A 5DEFA 5FJ8G 3NFPA 5IVXA 4NCC2 1AH1A 3HAEG 4JN2B 1RJTA 3KGSA 3A6BL 4NKQB 3GK8H 3K6OA 4A63A 4PMWA 1R3KA 1I4XA 3KS0J 3AM8A 3CRLC 2EXWD 5IQ9A 2JE6I 2O26U 2B39A 1S7TA 4N2AA 1U91A 3ZYYX 2XVKA 3L9BA 3MXWH 4GP4B 1YJWA 4KFZC 4WW2C 2IHFA 2NUPA 4W9ZA 3UAEA 1JZ4A 2YAMA 4CDCC 4IBWA 2ARJA 5FR3A 4TLUA 5L2KD 4EUPH 2K8MA 3SDCA 2NBFA 3EFXD 4JQIH 5DWUH 4CILA 5JHDB 3AUWB 5IBUB 4Q97A 4LKXB 3IMSA 5HDQL 4YUEL 3H09A 4DK0A 1JD9A 4Y5YA 4DUXA 4X2UA 3D12B 4KJWC 1IMHC 1ZLVK 5J7CC 5CJ5A 3KWXA 5K39B 1VQ5A 3TXAA 5KVGH 4OB5L 3CH1A 3QVAA 5CEXB 1T83A 3DURB 1F3DJ 1L1OB 1NAPA 2L15A 1DUZA 4BQ8A 4ZNEA 1KMGA 4YIQB 5IGGA 3DMMA 1IM3B 5CJXA 3AY2A 4H2AA 1TXKA 4L9LC 4R9WA 1V7MH 2NW3B 3OSVA 4MTKA 5D7LE 5C0BE 1CKMA 3P0VH 4R5XA 3VXPA 1D7DA 3AGWA 2ZXQA 1B2WH 4ZX5A 2LHAA 2EXDA 2A77H 2K6AA 1SXBA 4LCIH 5B1CA 5I4DA 4ANWA 1SY6H 5GGQL 4R4CA 3CMOH 4JKPL 4XRCB 4NNYB 2DJMA 4XVJL 3ZL2A 3EH1A 3RGVB 3BUDA 2QA4A 1WTQA 3S2HH 3A24A 3LV3A 3QO1B 4XQQA 4OFVA 5GGVY 4YDNA 3C46A 1SOXA 2V33A 5DJYA 2LFEA 2VGLM 2QCPX 1CDYA 4TLKA 4QRQB 2EDMA 3QA3A 4CMHC 1K9TA 2Z92A 4Y5XB 4MXQD 2WACA 1WFMA 5FAAA 4B50A 3R18A 2NZ9C 1ZT4A 4U7SA 5BZDB 1DJGA 4M4RA 3JT0A 1LDPH 1I6HH 3KNBB 3QP3A 5EEVA 1AZBA 2GSIB 1YJ9A 2Q9OA 4IOFC 4C1NK 2P43B 2R93B 3RFRA 2HLAB 2EXZA 5DRZB 3I2CH 5CM1A 3HZYB 3RMHA 5HVHC 3NZ8B 2CALA 2FBJL 2E27L 3HE7A 4Y4HA 1UA7A 3SKMB 4Q5VA 4YNYA 3ARED 2AUJD 3J7HA 2ZXBA 3SE0A 1KTKA 2V37A 1M1XB 1WBYB 1MIMH 2IBZX 2NY2C 3WMSA 3PJNA 4HIHA 1NGYB 4HJTA 1E5BA 1TSRA 1XBDA 1PW3A 2I9LA 1T5XD 3MRRB 1BDOA 1X5GA 3SPJA 1IHZA 1X3QA 1K8DB 2OTWA 5AYQA 4F7EB 4YSSA 4P5RA 5L0QC 3HNVH 2VQFL 1QFUH 3Q8DA 3DRQB 4G43B 5ANMB 2PTUA 3FN9A 2WQXA 1TVXA 1OCCB 2ADGB 2WQSA 5DZPA 3KBFA 2KQNA 3RIFK 4CNIA 1CBJA 4YHIB 4BY7G 8FABB 4ZSOA 3VD4A 1X4ZA 5C6AA 4K8RL 3MBXH 3BZDB 5HJGA 1XSOA 2EPBA 2Y23A 2PXYD 3B1TA 3Q9QA 3RAJL 5TH2A 1DM0B 1XPRA 5AOKA 5D6CA 3IXAA 1WVLA 3DJRA 1INEL 1L9QA 3BKYH 3EYFB 1VQFA 1R19A 3KH4A 4GLRI 4B60A 2I69A 3QZNA 4HIOA 3C2PA 3MXNB 3LNDA 2X1XR 4TKWA 5IJKC 1GZQB 5SX5K 3PP3H 2Q2LA 1IC4L 2YXVA 4H5SB 5L2JA 1YEWA 4JHAH 3VFRA 5FUOH 1OP3H 2Z31C 4UOW0 3TWCL 3HVNA 1E1TA 4NBZB 4BZ1L 5CF3A 3HLKA 3T6VA 4YDIH 2KCNA 5BO0D 4YY3Q 5C09D 4P75A 2F1BA 3MCKA 1SDDA 1OCZB 3TTYA 4OZHA 2F3VA 4FQ1L 4RMQA 2P48B 4UTCA 3DIFA 2G5DA 3EYOB 1LO3L 3D33A 4E9WA 1TQCB 3BAJA 2QKIA 1N18A 2DLGA 5IBLD 3UIYA 5FOBB 1HS6A 2XWTB 1N0LA 2BNQD 1QA9B 4EN3A 3D8MA 3TBSB 4N9TA 4BY7H 4C83B 5IJVA 4HLZG 1F4XL 1Z2KA 2DI8A 2R0LH 3OPUA 5C08D 2NSXA 3V6FA 4K5VA 4RMVA 3I9GH 3MROB 5D1ZB 4WI7A 2DKSA 5C44G 2JQAA 4LSTL 4Y4FD 3RB7A 5GPRA 5F9WC 4OWTB 3SK8A 3MLUL 3AT8A 4JFZH 5T3ZH 5M3MG 5I66A 1TJMA 1PA6A 1G84A 5EUOB 4EUPB 2YK1L 5BJTA 1MRDH 4JNXA 3EDFA 3N52A 1EY6A 2PWFA 2AVFA 4PJDF 1U8MB 1ADQA 2X0WA 2QZ5A 4FLRA 4F37F 4TNEA 4LO9A 1DDTA 1D3CA 4FADA 4MMYA 2VDKL 1GY1A 4YDVB 4FA8A 4KRPB 1NBYA 3OPOA 2NY6D 3KH3A 4KX7A 4UOZA 5D2NB 4HIMA 1G91A 3MXPA 5E1QA 1JNJA 1UENA 1AXTL 4EVNB 5D2LA 4OWWB 1WO2A 1NL0L 5EAYA 1QZGA 3FFOA 1RAMA 4I18C 3NIDE 3I4NH 3DYMA 2H6OA 2Y0SA 5E8DH 3QEQA 4HS6A 3QCUL 4IGBD 1XVSA 4MJ6A 5F7UA 2YAHA 1A1MA 1I9IH 43C9B 4APXA 1FO0A 3WFZA 4Y9FA 5HTSA 1YVCA 3FQNB 1UNSA 2Z93A 4KQ4H 4U1LA 4WUKL 5IVZA 3U2IA 5C86A 4A2DA 5CN3A 3S2HB 3TP6A 3VSVA 2LKVA 1HZHH 3FBQA 3CHBD 5A35A 4KRMB 2NR6D 1JL8A 2YZ8A 1O7DE 3PQYD 4F33B 3QJHA 1NPJA 4PJAB 5E51A 5M3MH 5EU3A 2W1NA 4X50A 5IROC 5I6OA 5IOPB 4HV8B 1R46A 1D2BA 3U2SB 1PD0A 1BMZA 2EEXA 3JAMi 5ALBL 4BWGB 4L0ZA 3KGTA 5T1JA 1EIFA 1UJTA 1U5KA 5GGSA 3EAKA 1I8KA 2C9RA 2MNUA 4J6IA 4PMBA 1I6HB 4J3OF 4P2OB 3G6JE 4QOKE 4XVTL 4LSRH 1X6OA 4JM4H 3FO2B 3DBXB 1KUMA 4PJXF 1YNNC 2R6GA 2F1AA 2ICEB 3JWDH 3L3IB 1YMMB 3UBHA 5GXBB 4ZFZB 2AC0A 3BLKA 4YDMA 5FKPB 3I50H 5F7DA 1NCDH 3B2VH 3SGDI 4UQ2B 2JA6G 2CUHA 2HZHA 2BIQA 2OMXA 5DK0A 4UV7H 2Y24A 5FHAL 3CXDH 5DD6A 1XO8A 1MKHA 4PJBE 2ADFH 5CEZE 4P2AA 3AXHA 1EJ8A 4ODBD 4Y1SA 2QDWA 2OL3L 4MDRA 4PLKD 1L0XB 2OT2A 4XN8A 1QNZL 5GISL 3QJRB 2I5HA 4MDIA 5HI3C 2JA5G 4IKLA 1IJNA 1YUHB 2Q6WA 4J3VA 4PP2B 3OAYK 5DGQA 4YZFF 2AJ3A 2QQQA 5FYJL 3PO3G 1NGPL 1M7XA 1HQ4A 1E9PB 2WVUA 3OJ2C 3GS7A 5DC4B 4GIAA 3PV7A 2QELA 4Z78B 1Q9OA 4R4FH 3TN2A 1RJYB 1OAJA 5T3XD 2X05A 2A74B 3V0WH 4AQ1A 4S3SA 2YD5A 5CR1A 3L48A 3QQ9D 3HMXA 4UNIA 1XDTT 3LCYA 1EEID 2H1XA 4KTDH 1DBMH 5C0GA 3BOVA 5TFSL 2AK4D 4M5ZL 1UEAB 1NAKL 4HIQA 3MO1B 1PMYA 3ILQD 2ADJA 3O6FD 2V2TB 2ZKWA 1B9NA 1I7TA 1ZS8B 1O7ZA 3MUY1 3O6KL 5IB2B 1DJHA 1WGVA 2BCOA 1FNSL 2JWYA 1QSFE 3OB0K 1S78C 2GA4B 2C26A 1X7SA 1KIUB 3OW7A 3FO9A 3EF4A 4UDUA 3DRTB 3DBSA 2A8VA 1TG8A 2XXFA 4WJWA 4I3SH 4M3KB 3N41F 5IVOA 4JJOA 4OLZH 3V5KB 5ELFA 4ZPTB 4FMKA 2F53D 3B5TA 3KM2A 4OQTA 4K71C 5DLLA 1T0NA 2NNAB 4JY5H 1HSBA 4HC1H 3I02B 2YD1A 1U8HA 3W0WD 1SRUA 4LOUD 3VXQB 4WI8A 2Y25A 4X6CA 4KQ0A 4BY7B 3EIFA 3STLB 4RGNE 4GLAC 1F00I 2KS0A 2PW1B 5F1NA 2NQCA 1KDJA 4O9HL 1IC7L 3RJQB 4XAWH 2CHXA 3RVUC 5I1HH 1IL1A 2BVQB 2Y1YA 5EUKB 3PO3H 4J3OH 1X6NA 5SWSB 4IBZA 2UUDH 1L9RA 5TJWK 4TSAH 4TUJB 2EDXA 2FEEL 3HMWL 1DQDH 4UF7C 1EIBA 3HN8A 5GRVK 1TEFA 3TBVA 3S5LG 1SFHA 2F1EA 3CPFA 4L8SA 4JI0L 2BHYA 1HC1A 3KWWB 4NIKB 4AG4L 3V4LA 2VLKD 3MRQB 3NSWA 4KXCA 3RPIB 1IGJA 2R59A 1IBYA 4K0OA 4OSUH 2HPOA 1CICC 2QW7A 3F3HA 5CSZB 2P45B 2W0FA 3EW3B 5FLXE 1V3LA 3MRPA 4JFPB 1XXGA 3BXNB 4YDKL 4BK5C 2XWBB 4MZ3A 5IYCG 4GRWE 2JIXB 3QRGL 4XPTL 5K9OA 2ZPKH 2VAAB 1SR3A 4LZKA 3VE0B 4XWGH 5DRWB 2DQEL 4GG6F 4FFYH 2HMIC 2MJ8A 1DSFH 2DQTH 3ULPA 1N5AA 4R8IA 3CIAA 5DZJA 1Z9SA 3EJTA 3I4NB 2J4WH 3QE5A 4W9CC 4EQPA 3R8BB 1YN6A 1BIIB 1U2HA 3D25A 4XC3L 3ONAB 1I4GA 1Q0EA 3RDJA 4EQOA 1E0OB 3RUGE 5JTWA 3WJLC 2YAEA 1LYLA 1TQBB 2VL5A 3CJJA 1GO3E 2ILLA 4WUUD 1PNDA 5HYQB 1FGVH 3UX9B 3BKCH 1WTOA 1BZDA 1I50H 4P99A 3SEPA 3QIBD 3SBQA 5GZOD 1N4XL 4HMJA 2V3DA 4ZPVB 1KGJA 3RGVC 4P5MA 4PCSA 5M3MB 2MOVA 1DEEB 3J81i 1YZZA 3CSGA 3JWOL 2C9UA 2IAAC 3QR0A 2FSEA 2Y1ZA 1BZ7B 1T2XA 5H94A 3R2TA 4F3FB 4KI5F 4AITA 1S40A 2F0LA 3K91A 4YQXH 1J8HB 3D08A 3HS8A 4LEOA 3U1QA 4Z7OB 3LRMA 3PHOA 4X98B 1A62A 4KKNA 1USZA 2QBWA 4IFDH 2P42B 4Y5XC 4UQBA 3AS0A 3M1BA 3N44F 5H35A 3U36B 1TIID 1TYRA 5KSBE 1BD2E 3BQUB 1OTTC 3L7FB 5IYCH 1VCAA 2H7WA 3HA0A 1LE5A 4P57B 5CYUA 2EQDA 1DCLA 3ZRFC 3MV11 4H8UA 4OI8A 4ZFFA 1FORL 2HFEA 1DCZA 1I94L 3PWJB 3SDDC 1Q94B 3FRPA 1CFTA 5LBSH 2GN5A 1JZ7A 4L5TA 3JC66 4XOEA 4L9DA 5TDPA 3T0AA 1FDLH 1L6ZA 1KCSH 1U4PA 4A3IG 4M29A