3FRPB

Crystal structure of cobra venom factor, a co-factor for c3- and c5 convertase cvfbb
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
368
structure length
343
Chain Sequence
LNLDITIELPDREVPIRYRINRTVETKLNQDITVTASATMTILTFYNAQVCNKFHLNVSVENIHALMLKICTRYLGEVDSTMTIIDISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHFKILKHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSLNHQERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKTHQYISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEEFQKLCDDFAQFSYTLTEFGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Cobra Venom Factor, a Cofactor for C3- and C5-Convertase CVFBb.
pubmed doi rcsb
molecule tags Hydrolase cofactor
molecule keywords Cobra venom factor alpha chain
total genus 59
structure length 343
sequence length 368
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01759 NTR UNC-6/NTR/C345C module
B PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.210.20 Mainly Beta Single Sheet ubp-family deubiquitinating enzyme fold ubp-family deubiquitinating enzyme fold 3frpB01
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3frpB03
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3frpB02
3T4AC 2ICEC 5FOBB 3I70A 3L3OC 2XWJB 5FO7B 2PN5A 1JC7A 1XWEA 1D2BA 1BV8A 1JB3A 3MA2B 4D94A 2TMPA 3FRPB 1BR9A 3CKIB 3HS0C 2A73B 5JPMC 1OO9B 5JPNC 2XWBB 4FXKC 3HRZC 2A74C 1UEAB 3CU7A 2WIIB 2QKIC 4LNVA 1GXDC 1EDYA 4FXGC 2I07B 3KLSA 1AYOA 1BUVT 1UAPA 5FO9B 2J0TD 2WINB 3G6JB 1PXUA 1BQQT 4ILWA 5FO8B 2E2DC 2B39A 3V96A 3OHXC
chains in the Genus database with same CATH superfamily
4LFCQ 5BVJB 3KBPA 4Z5RA 1RULH 4JK0D 1Q0XL 2EIZA 2NYZD 3WU1A 1B7YB 4BZ1L 4ZOBA 1UYWL 2CKBA 2PKDA 3DUUB 3SR1A 4FTVA 4PJ7B 5B1BB 4CBPA 1AGEB 2V7NA 5EU5A 5AWNL 4OX9L 4E6IA 1N32L 1M6OA 1QRND 4DFIA 2GJZA 1IAIL 1R4PB 1Q9KA 4J2XA 3P30H 5E2UL 3V7MA 1PRTC 1NBCA 1F45A 4IRJD 2NY2C 4J2QA 3H0GG 4L4TD 3VFSB 3SDZA 1PTOD 1VFMA 1U8MA 1YBYA 4JI3L 3KLQA 1XGRB 2EOTA 4XBEH 5KVEE 4UNIA 1H5BC 5C2UB 1LQBC 4Y19B 1FORL 3BPNC 3OPZH 4X7CC 4Y0GA 3RY6C 1ED3A 4ZS6D 3BFOA 4UZGA 2F4VL 2IPKA 1IAKA 2R15A 3QNYA 3MRKB 4GKZA 5LMUL 4UM8B 4YGVA 2OTUA 3P11L 3RDTD 5I76A 4RAUA 2E5LL 4UBDD 2YOCA 3SK4A 1G1YA 1CKNA 1IW7C 2WV6D 1COBA 4KNTA 4JJHA 4MQ7A 2DWDB 4Y2DD 2K1BA 3D85B 4J3VA 3UC2A 3IBOA 5KNBA 4XC3L 3DSFH 3Q24A 1F1GA 3OB0K 1UGKA 4HWNA 3FNKA 2APFA 1B90A 3W82A 4E9SA 4OTXL 2ES2A 3VWKD 4DV4Q 4PJ5D 1NSNL 5ESAB 4RSVA 2MRYA 2Z7ZA 2H26A 5FOBB 1L7IH 3RWIB 3C2AH 1OAUH 3ARFA 1OAQH 5ICXA 1HNZQ 2HT1A 1G9ML 4MJID 1M9SA 1Y18A 5I8OH 3BPLB 4KKPA 3R8BA 1AO7D 4EIGB 2G5DA 4CJ2C 1BYOA 4YWKA 3DRQA 3LKPA 4HP5A 4R4QA 1NC2B 1VGKA 4NZFA 5E2JA 4FG4A 2DLHA 4N0CD 1I31A 3L5IA 4ZT1A 5C0FB 4X98A 4M1DL 4TNEA 1ROCA 1NMBH 1JNLH 1H8LA 3HRPA 2ED9A 2FQEA 3MMEB 4ZAKC 5I74C 3P73A 3C09C 2VXWA 4KDTC 3BZFA 3STZB 2FR4A 4N86A 4MTMA 4DKDC 1BSIA 2PW2B 5T1KA 1QBMH 3HS8A 3TV3L 4MAUL 1U8OA 1JWSD 1R0AL 3REWA 1RDPD 2R0ZH 1NKRA 2HH0H 3DHQA 2W0PA 5TE6L 3RVXD 2R4SH 5AAWA 2AV7B 2Y7MA 2IAMB 3L2LA 1M7XA 4DCQB 1I3RA 3F7LA 4V11A 3RZCD 5FCSH 1PG7X 3ZHKA 4CBZA 5JOBA 3BX7C 5D9SA 5M3MG 3GRWA 3UAJD 4B9YA 4A3DB 3L1GA 3QISA 4NQUA 5ELDA 3OTOQ 3IFNH 4C57C 3Q6GL 4F37K 5JIDA 2FBJL 3CF5A 3QOJA 4B9ZA 4DV7Q 2FINB 1IGYB 4J3UA 4EAEA 5I17A 1I6HB 2A6KB 2H3KA 3VI3E 1MIMH 5BZWA 1K0SA 3NBHA 3BKYH 2F5AH 2F15A 4MJ6A 1C4QA 2C5CA 3OMZA 1T0NB 5DJ0B 4BK5C 5L8LB 1JVLA 2N7BA 1V05A 3C3LA 5GGSY 1IL1B 1TNNA 4H0LC 1JJGA 5C0XG 4DK3C 4OUUB 5AW7B 3WMSA 3B9AA 2PTTB 1SEBA 3MLTB 1Y8OB 5D7LB 1J5HA 5C0JB 3UTZA 1IMHC 3NFNA 5B38B 3VFGH 5F7UA 3O8XC 4QMGA 3D50A 1OPOA 1XF3A 4L3AA 1VFBB 4E5XA 2YQ2A 3G5WA 1EAPA 1BEXA 1RUAL 4HETA 2B0SL 5EOTB 5A2JH 1ENFA 4L8CB 3BQUA 2Y1YA 4IK6A 2KOLA 3QXVA 4IBVA 2ITCB 4HPOL 3GSOB 2RBMA 2JKXA 1MSHA 4M62L 3GINA 4JI0Q 4IS6A 3S96B 5F7WC 3VXSD 3H3PH 4UOW0 1INQB 2CFMA 5MENA 3SDYL 4C59B 3VD4A 3KYNA 4EKXA 4AQAA 3FUFA 5IROA 1Q0YL 3FU7A 1BG9A 4MLSA 5MEQB 3GSXB 4XNYH 1F9SA 4YWMA 2ZCHL 3JUZA 4JBSA 3BN9C 2ADFL 2H6PA 1ZDSA 4L9LA 3E0JA 4UNVA 2AV1B 3K1KC 1OP5K 1WC7A 3K2KA 3L5JA 1ID5I 4NQXA 4OV6F 4DPGA 4HKXA 3CDFA 2EVJA 1FFNA 1DBMH 2DQFA 4NXML 3TEWA 1GJIA 4JG5A 2DKSA 4XZ4A 1CTMA 1ZRUA 4B7IA 2K0RA 1PD0A 3SDAB 5EU4A 1EQVA 3UTTB 4XMPH 2F0OA 3U9OA 3DBXB 2LLNA 2WMPA 4G72B 4F8QA 1FQ9C 5DHDA 3CN0A 4QGYA 2PQAB 5HI5C 1TPXB 2GK2A 2TRYA 4OZFH 1OE1A 4AQOA 4G8GA 3HCVB 4Y4HC 2PW1B 5FKPB 3TA3A 1BQLH 4TNVK 4Z3FA 2Y7QB 3V4VL 3MRQA 4W6WB 3RI5K 3TBYA 4JUTA 5ELOA 4U3SA 2OF1A 2KCMA 2AK4B 2PYEB 3BDBA 1U2YA 2C8NA 3EJSA 3ROOA 1LD9A 3GKWL 3ZJYC 1EZSA 4FYDA 1QFWM 1VGEH 1F4AA 5DJ8B 4YIJA 1K3IA 3OAYK 3QJVB 2Y0SG 2EAEA 5CR1A 1FHNA 4AYBB 3OW7A 3DUZA 4Q0FA 1V5JA 4W9KC 4XPTH 2KH2B 5L2KE 2YJLA 4OJFL 1KTDA 3QULB 4JCLA 5CIPH 4E41E 3NCBB 1MCRA 4LNRB 1WWCA 1GXEA 4IEFA 1BCPD 2Y36H 3BFWA 4R5TA 4DXGA 1N33Q 2JQZA 1QNKA 3RLNA 1CGWA 2F6AA 4WTXA 2XZAH 4ZUSA 2JA5G 2B7DT 4YBQC 1F90L 2P52A 1HXYB 2FWUA 5EPLA 2LV4A 1NCGA 5LN4A 3N42B 5D72L 4UDUC 1O9ZA 3H15A 1S9YA 3PUZA 1WP6A 2CPCA 1S7TA 4GRWH 1HR0W 2B1HH 4OLZL 4PRPE 3UTTE 4NNPL 5C0AB 4CMHC 4Z3HA 4WLCA 4KKRA 1S7RA 5I6LA 1MUJA 1PFSA 3RB5A 1C5DB 5MEOB 2EH8L 3MA9L 1KULA 1AXIB 1T5XB 2WYIA 3IB4A 1KL9A 2VDOB 1G1KA 1A0IA 1G7QA 2W07B 4A3BH 5TE7H 1KV3A 3UJJH 3C5XA 1KIUA 1VFAB 4M56A 5ISZB 5E5LA 1G4RA 4OLVL 2IQ9L 4AH6A 3HB3B 4TQIA 5IHBA 5L4IA 2BY3A 3ZZLA 2CNYA 4Y5VC 3PPSA 4IJHA 1MD2D 2YSTA 3P77A 2E27H 4P5KA 5ELEA 3EFFA 1GPOL 3FQNA 3LVEA 3V0EA 1VQLA 3FT2B 3F05A 3IDGB 4HK3N 1YPZF 3O8XD 4OR1A 3U1SH 3QZWG 1WISA 4ICWA 1YVCA 1NGYA 2M9VA 3MGOB 5F96H 2BY0A 5BVPH 4BBRH 1KLGD 1J9TA 1VFOA 35C8L 5D7IB 4P3DA 1J0YA 4I7ZC 1S7XA 1MI2A 1I50H 5JJZA 2BVOB 3T3MB 1SXSA 4AYID 1G291 3T6ZA 1N59B 3BDYH 5INDB 3HN3A 5T3XL 1PH1A 1X5FA 1HZBA 3GZKA 1NIBA 3L3HB 5CGYD 2ZCZA 3V5DB 2F0WA 3WFBH 4PIBA 2BDOA 5GRJH 5JJKA 5HBBA 3BUYA 4JBJA 3WIIH 5EBDA 2WLNA 5KZCD 4Z9KB 3MLSH 1HL4A 1MSPA 5D14A 2RBLA 1H3PH 5HI4D 4APQD 1PX4A 3V4VA 1WTHA 4FN0A 1EMTL 1N6VA 1NC4B 4I18C 4MAUH 3DRTB 3JTSB 3JXAA 2WSDA 3T65B 1X9UA 1G43A 5ELNA 3AMUA 4H1LG 4NENA 1I75A 4WUKH 5AD0A 3H0TB 4HMJA 3OSOA 2X3CA 4UYPA 3RL2B 1TWGB 4XPGL 5D7JB 1EHKB 1NCUA 4DIXA 3LAFA 3A54A 2Q6WA 3FH5A 1IYJB 3LKNB 4P2AA 5KBKA 1HHJA 5JZ7D 1QRKA 2GTWB 4P59L 4FNQA 3QRFM 3EO9H 1GUOA 2EIKB 4RCAA 5C09E 3ZKNC 1F9QA 1MEXL 2F0UA 3GEFA 3ARDB 4ZRGA 5IB2A 4XN1A 1OTTD 3QCUL 3ZO9A 2QT6A 2BSSB 1ZJBA 2A5UA 1JF6A 2LVEA 5JA8B 2J25A 3I74A 3OMGA 1G9NH 1AYRA 2SOBA 1NANI 2GFBB 2L9HA 4ZLTF 1ZHBB 4YDZA 4M5YH 4DKTA 1NGWB 4LVHC 5HYJA 3SJVE 3HPLB 3NGBB 3P69A 4TPRH 2L7JA 1M1XB 4PJAB 1I1AC 4OZIB 4XGZA 5C4JH 3FUDA 3II3A 4AE0A 4KTEL 3KPSB 1TQTA 5A6IA 7TAAA 4BGDA 3HE6C 5ISRA 3IDJA 2J44A 2GC4C 4I1RA 1GJXA 3AUVA 4XWOD 3DVIA 1SYDA 1TZHA 5JW4Q 3QJYA 1AACA 3BH9B 4P5TC 2WXQA 4P2QD 1WUNT 4ZK9B 1SBBA 2VZTA 4JVPA 1NANH 3LH2L 1FE8L 1A5FL 4WGVB 3UTPD 2WVVA 2VLRD 1DQKA 2EDNA 2HYMA 4IS6B 1JPEA 3EJZD 3RA7L 3VWJD 3MC0B 2BSCA 2I7SA 4DFHA 1N34Q 2ZTCA 3MX0A 4P2RB 4JM4L 1WBXA 1GTFA 3DVNB 4LASL 5AYUL 4MXWH 1T1WA 4CJ1B 3VG0H 2Z93B 1VF5C 4X3TA 2HVJA 2KMWA 5GGVL 2COQA 3U58A 2WWMD 1XWEA 4WQOA 2O30A 4QRTA 3KLHD 1DJSA 2VLKE 2AANA 4I77H 1YG9A 4FYSA 1I8UA 4TF4A 2B2XL 3VDCA 4Q9RL 1FNFA 5DM73 2CDEA 2IPUK 2XQYA 4QRBA 3MO1B 2AQ3A 3AU1B 3SHSA 5F7LB 5EF2A 3D3RA 1XCTB 3WOEA 3K0XA 1R1CA 4MDJA 4YDMA 5C3EH 2OL3A 4JI5L 4AQAB 1QQDB 1A14L 4Z7VF 1DVFC 3GS0A 4Y4FA 4AGPA 1KCKA 1T5XD 1HZ9A 1MG3C 2GJ6B 4QD2E 2NZ1A 5IMMA 3QBTB 3G6JA 4ZKCB 1Y1WB 4QT5A 2OZ4A 2ZKYA 4HIEA 1PRTD 4W70A 1XNRQ 4N0FA 5E2WH 1A9EB 4L1DA 3BESR 4X6DE 4QXVA 5CN1A 5B39B 3D09A 4ALAC 3I70A 1HS6A 2GCYA 1YNJD 4BBSH 3GJFH 3UJTH 4DT2A 4JJOA 4DPBX 2IPKD 3EROA 1EJ8A 5TH2B 1OIOA 4HU8A 4KLKA 3PWLA 3ASWA 4X6CB 2MQHA 3TOPA 1VMPA 1HEZB 5B4MC 5T1IA 1OAZH 5F0PB 3E6HA 3SDYH 3QQ3B 1IYUA 3US1A 2FJGA 5J13C 3N41F 4NN5B 2NY0D 3SDCD 2E8YA 4PJGE 1J1PH 2ADGB 5F1KC 5T1MB 1LT6D 4OZHE 4G11A 1B3AA 4BBSG 4JRFA 2V6HA 3T08A 3POCA 2N3SA 2P5WD 4XCEB 1DLHB 2JB6A 1Y1VB 3EDKA 4OFIA 4CMHB 1NDTA 2V4DA 2ARWA 3D4DA 2Q1EA 4FQLH 3BZDA 3FHAA 1DBML 3TTSA 2WGXA 4HA1A 3SEBA 1BYPA 4G9FA 1NB8A 2F5BL 4YDLC 3FQ2A 3TT1L 3X3GL 1IC7H 1NCIA 1HZAA 2CLRA 2QEXA 1BEYH 2Q2EB 4GSDL 4KKAD 1SJEA 1F8TH 3DRQB 3ESUF 4FDWA 1GJUA 1PNDA 2PP9A 2H7WA 5E4EB 2Z6KA 3U4ZA 2Y23A 2NZOA 4MVBC 2O5IC 1RIVH 2WTOA 3U36B 2EYOA 1VLXA 2K50A 1GKOA 3GQFA 4E9WA 3ISYA 2NBFA 4UT9L 3N43F 2XFGB 5T1KB 4HPOH 4HJGB 2WLMA 3MRLA 2YK1H 4BQ8A 3F2BA 4JPQA 1JB3A 5AVQB 3ZGIA 3EHBB 2EABA 5I0VA 5H37G 4NNXB 4NQTA 4XP1L 3DJRA 2IIJA 1OM9A 43C9A 3L5XH 1WCMG 2K5NA 5EUOF 1I7RA 4JM0A 1VCIA 2ZXOA 1HVXA 3L13A 4HIJA 3SDDA 3U2JA 1VQBA 2P24A 2B2WC 3GUFA 3O9WC 4M8QA 1MVFA 3VJ6A 1WJJA 2F54B 5IJCC 5HGQA 3IDXL 4IOSA 1D1IA 5DUJA 4L5FL 3GMLA 3R7QA 3CCHA 3F7VA 2NDGA 3S34L 4NQDB 3UZVA 2E46A 1BOGB 5DA0B 5DR5H 2JJSC 3MAQA 3AB9A 4R4BA 2W59A 3DJ9A 1OOWA 4W9HC 2ZUWA 4OD2B 5CS7A 4HUXA 4LSTL 5H4ZA 4ERSH 3VMPA 1TVHA 1Z2KA 3LRMA 4WK0B 32C2A 3QI9B 4JHAH 4ZI8A 2WKOF 1QWNA 4BSVA 4MCMA 2X4PA 5MHSD 2DQIL 3RWJA 3MNVA 5ITFA 2VQUA 3RE0A 3T3MF 4MX7B 7FABH 3QNYB 4YHML 1BIIB 3ZN6A 3Q8AA 5CBAB 1WEJL 1DUZA 3F64A 3VVWA 1HHKB 1HYRC 4HOXA 2OMZB 1ZLSH 3S14B 3VXOA 1D7BA 4TSSA 2YPLE 3LXAA 3WTVA 4FQCL 4PTTB 3DOHA 2AS5M 3MV8A 3GK8L 2QCPX 4CMMB 4HF5L 1TZIB 2EIDA 4PRAB 1Q82C 2OR7A 1D5XA 2W0FB 1INDH 2IFFL 2FJHA 2NW3B 3IXAB 5CU5A 5FHBH 8PAZA 1EK3A 1ET7A 1U8KB 3J7ZC 1NICA 5CINH 3T0EC 3LNIA 1VEPA 3AFPA 2XRAH 3MJGX 2E7MA 4FQXA 4FG6C 1K83H 1B6DA 4RMWA 1JHKH 4TUOB 4NKMB 4P4KA 3RUGA 1E27A 2HMIC 3J7YW 4B53A 4OKVB 1URZA 4NXNQ 1RPQA 3AC0A 1WA0X 4I89A 4RMVA 4RKLA 4LT7A 4XX1G 4BZ2H 1EY6A 4AW4A 2F0CA 1BP3B 2EDRA 3LS4L 1Q72H 2VDKB 4I13B 2FK9A 1RIPA 2FD6L 2OMZA 1G1CA 1NINA 4FQ1H 1IFHL 1DVTA 3NIGE 3ML8A 4PJ8B 4QOKE 2H8PA 2X4UA 5LHDA 3L3KA 4J6HA 3W2DL 3RZCA 5HGBB 4WK2B 1G6RH 4PM1A 4FMVA 4NQCA 3KLDA 3X2QB 2MJWA 1HUNA 3BPCB 3RWEA 1D9KD 3IWUA 4WVRA 3AJ7A 2TSBA 3UMTA 4KUZL 3QPXH 3WN6A 3IBEA 3OTTA 5DNFA 1P5VA 3HKZG 3CHOA 4OKVA 1BFSA 2WLLB 4O9HL 4HSVA 4PTTA 1RK1B 2KQ3A 2NXZD 4GEIA 4A76A 2HUGA 1GD7A 2WVSA 4ZAKB 3K6DA 2OL3B 2CK0H 4K2UL 1DFBH 4ZMYA 1ONLA 3ZYJA 1NTDA 3BZEB 5BN4A 1JPGB 2XJKA 4NN6B 1TVXA 4L4JA 4XHQA 1E40A 1C0AA 4PFEA 3MNVB 3KF6A 5DRXA 4LASH 4RGMB 5AYUH 3LKRB 4HVBA 2A0LC 4D8PA 3K6OA 1D5IH 4JY4A 3WUWA 3ND8A 3EO0B 2Z9TA 3MDJA 3NEXA 3MCKB 2QR0A 3E3QC 5E1AB 5CBAA 4WNJA 1LK2A 5I8EB 4G43B 1XT5A 1CO1A 3ULVC 4QDGA 1DLFL 3MROB 1W15A 3D4CA 3RX9A 3IWVA 2XFXB 1RJYA 3QUXD 4FZEL 4K3GA 4EDWL 3TEUA 4F20A 2GVBA 2GQHA 4PB9H 3L1OH 1I5FA 1LJMA 3D18A 4WRLA 2LU3A 3CXDL 1BZ7B 5EQ0A 3H9YA 2NY6D 3ZMRA 2DIEA 3U25A 5GAHC 2QMJA 2V2XA 4M93C 1KV7A 4B9JA 3FT4B 4OM1H 1VQOA 3DXAD 5DJDB 4Z7NF 1EEZB 3PABB 1HXMB 2GY7B 1PZDA 2QFPA 2OXHA 1R5IA 2W60A 2BE5C 2UZPA 2AXFA 4W9LC 2X4NB 4G8GD 2K14A 3FSVA 43CAA 4F3FB 2HFGL 2YPVH 4IBQA 3MBWA 1KRSA 2IALA 3IFOB 3ZUCA 3KW8A 1XX8A 5T5NG 3RVTD 5M94B 1FV1B 3BGMA 5I2IB 5C6TL 1KLGA 2VDPB 5IQMA 2WNWA 2N0KA 2L15A 4X99B 4NKLA 5ISZE 4OVUA 3HBGA 1KJ2L 2FMMA 3LNNA 1YNKL 1MJ7L 1OP4A 4KKBD 4NKIL 5DQ9B 5I16B 1QZGA 4MMXC 5KVMC 5AW0B 3F7YB 1MI5B 4YL4A 4DOHB 3HTLX 4GRLC 4ZUIA 1ADWA 1P84J 4ODBD 1UEAB 1FO0B 4KROB 4JFFA 3L6FA 4A3JH 3RURA 3QJSB 4DKFH 2ITFA 3N43B 2K6YA 2RAMA 5GGRA 3TIEA 1E1TA 2RQEA 2NY4B 5T33L 1F58L 3JC66 4ABQA 3ONAB 2VR8A 4ZO8A 5B7FA 1G2TA 3ILPA 1F97A 3GIVB 2Z3FA 2H0EA 1H9DA 2XICA 3QUXB 4XVSH 5I1KL 3W38A 2IJ0C 3MFGB 1MKHA 1G9MC 4OI9A 1STGA 5DSCB 4ZW5A 3VM5A 1JZ7A 4G8AC 4XMVA 2I9LA 2ZX6A 5KYYB 3S37L 4WDIB 5HDBE 2C7UB 2VQFL 4JV5Q 4NLHA 3RY6A 4FJZA 4O02B 5E00A 5ESVA 3K6SA 2GUOA 2SEBA 4PJHA 4Q6KA 4OHJA 3HOZG 1Y6KR 2QQLL 4FNRA 1I7RB 4ABUA 4XXCC 4U0QB 3GRWH 1CU4L 1J1OL 1E7VA 4XXCA 3N55A 1WA1X 2XVSA 3R93A 1MFVA 3KS0J 4APXA 2F9BT 2OTWA 3INUL 1IT9H 5D70H 4WV1C 2KBNA 1U4FA 3MRGA 4XN2A 2VKWA 3FFCD 1MREL 3H56A 3BVXA 3IETB 2QSCH 3Q5TA 3LD8B 5IMOA 4BFKA 1KZYA 2KT6A 4DV0Q 2ICIA 1NCDH 2E2JB 1BLIA 1QQDA 4L4VA 2ZAIA 3KPQA 2AFNA 4UP7A 3MX0B 2EH7L 3DPDA 4LLDB 5DQDL 4DP4X 1C8QA 2G3XA 1YAIA 5KVFE 5I28A 1U3NA 4Y7NB 3ORJA 2DQEL 3Q6FA 4JGJA 5T5FH 5KWYC 4KTAA 3GMRA 2H41A 4MD0A 1XGYL 3CZGA 1OP3K 4FQLL 1ZLSL 3L3OC 2GJPA 2CRYA 4HGWB 3NZHH 2HQLA 5HHOA 1ETA1 4JFUA 3CMOL 1INDL 2IFFH 3BG3A 4ES9A 5KUMA 4BY7B 2CO7A 1J0JA 2XWTB 1L0QA 3LNFA 4JEGB 5DZOA 4G5ZH 1LYQA 1PX3A 4Z7OE 1XTCD 4NBXB 1CE1L 2HJKB 3VXRB 5IB5B 4A7GA 4GKOA 4APQA 2AI0H 4TNWK 3UO8B 2GC7C 3Q8CA 3GNML 4P46B 4MTNA 2X3AA 1LO3L 5CM1A 1ZEAL 2K7QA 3SGEI 2EYSB 1V55B 1HKFA 2XZCL 4HH9A 2J8UF 4YHMH 1CQKA 1UCBH 3X3GH 2GCYB 3ZDYF 4AZ8A 5EEXA 4YO0B 2VDKH 1IEAB 5C9JA 5IB1A 2PMZE 4UILL 3BD4A 1CE6A 1IFHH 4P8QA 3ZKMD 3K8MA 2QHRH 4I3SL 3VGFA 1CHPD 4KHPQ 4CVUA 5E4IA 4J8QA 3SVMA 1OAKH 1T9HA 2XTSA 2C3VB 3JZYA 4HF5H 5A43C 4XPAL 2UXCL 1OL0A 1M56B 1X5AA 4RCOA 4DR4L 1NAKH 3C8KA 3M88A 3CVHA 1XXDC 2UYLB 3JTTB 4EQ2A 2YWZA 1EOVA 1SQ2N 4YX2H 1EZ8A 5L9DH 1YI2A 1FYTE 3ESNA 4HJ8A 5K36H 2ZG3A 4OF7A 4S1QH 4GRLD 1OGTA 3IDNB 1R3KA 1YNNC 4QAWA 4P2OD 1NC4A 4XI5D 2QGQA 4WFN3 1LEIA 5DDHA 2JJTA 1Q1PA 4P2QE 2GITB 4OFVA 1U2HA 3P2DA 4N9PA 1EFWA 1AZCA 4PR5A 5J3HC 4IFDG 5L37A 5CZKA 2HIVA 3PUXA 2YC1B 2KYIA 2HRPL 4X64Q 4R4IA 2HQEA 3KPSE 3NSXA 1I4HA 1RKRA 2VLRA 2ITDA 4YDNA 3VRLE 1N3NA 5KBNC 1DYZA 12E8L 2VSMB 1B0IA 1IBLQ 1S5IH 1JV2A 5EPJA 4JFFE 3ZKQD 3O6FD 5D1ZA 3F2LA 3N1GC 1M7IB 3TIDA 2Y4SA 3OR7B 3NK9A 1HFUA 5KNCA 2EICA 3CC7A 3TREA 3AS1A 3KPNB 4E36A 1EU4A 2J4WH 5L8JB 1FA4A 5F8QC 2OSXA 2XQ0A 5I4DA 2MUYA 4PZ8A 2JTDA 3HC2A 2E2JH 4RRPA 4BWTA 4CKEA 4O9HH 5D2LB 4MD5B 1KELH 2MSPA 3BZCA 1QD0A 5IV2B 1UWEH 3KPLB 3BXNB 3V55A 2QILA 3J80i 1BAWA 5CJQL 4PRID 4QLRA 3RWHB 2AERT 1T5XA 3GGWA 1OEZW 2B2UC 3LKQA 3PWVA 1ACZA 4L9LC 2EY5A 4WJ5B 5IF0A 3O2DH 5E8EB 1V7MH 4LKCB 1SRUA 3O6MH 1W72B 3GMNA 2FGWL 2AXFB 1WTGT 4QQBX 1EIBA 2WCSA 4GG6E 3L08A 4G57A 4YLBA 1X9NA 4OM1L 3S3CB 4F7TA 3CFCL 2NVYH 1WQVT 2E7DA 2QA4A 5CLZA 3ZLQC 4FQIH 1D3CA 1DJYA 4LOEA 5DCCA 5C9JB 3N1PC 3LNGA 3QEQE 2H32H 4ZX5A 3MXWL 1RLWA 1QSEE 1BQRA 1FN4B 2DQHH 2R0WH 3CSBA 3F6IA 4DCQA 1TCRB 5AWNH 1JL8A 1N34L 4R7NB 1UT2A 1D9KB 1IAIH 4LAAA 2Z8WC 4FAAB 1JV2B 4LSPH 3KPPB 5C6TH 5AAMC 2BFVL 1H19A 2OULB 4DW2L 4A7TA 2A68D 2LXKA 1TWHB 2ITEA 4ZUWA 4DV1L 4KX7A 4AQ1C 5ABZA 3T0VA 3P3TA 4DNRB 3WTTA 3IFPA 4NN6C 1NOFA 2J73A 1STNA 1Y1WH 2NVXH 3SBWA 4P3CH 5EN2B 2VSKB 5C0IB 4HJSA 2XLLA 4KHXH 4OF3A 3EYOB 1ZK5A 1AMYA 4C3IB 1BBUA 3PF4A 3AWGA 1LEIB 1LDSA 4XHJC 1T4WA 2V5YA 3EXLA 4Z7VA 1MJJB 1NIEA 3EFFB 1EEID 2Y9RT 4EO5A 2D7TH 3BEVA 4FABL 5I1JH 5I6XB 3IGUA 1D9KC 1JZIA 3L4TA 1D5ZB 1G0YR 1M42A 4M4PA 4NZ8A 4CU6A 4LLUB 2F03A 1KY6A 2NYYD 3JVFC 2JCCF 4RRPG 3U1QA 3GTKB 1GSMA 3VXMB 4EI6A 4OTXH 4OBRA 2HX9A 1NSNH 3PGCA 4MZ3A 5MEQA 1AE6L 2DQ6A 3ZT7A 3ILPB 4ZMPA 4GT0A 1LM8V 2EDHA 1MWAA 1T2QL 1KXQE 4H8HA 3MJ9A 4O4YL 2E7CA 4M6NH 5J9PA 5L4JA 5KYNA 3A74A 2F7PA 3GSOA 5EZLA 1GUWA 1E30A 1KTRL 3C5ZC 3LD8C 5H1SE 1FYTB 2O5NA 3OAZK 5I30L 1MFMA 2XNAA 3DVGB 4PB9L 1FNSH 1YN6A 4HLJA 4HIDA 1SZNA 4GUPA 4NZRL 3W5NA 1QLRB 3OXRB 3ILQC 2QEJA 1EVTC 5F89A 5BPPA 3NIDE 5D6CB 3RWEB 1PFBA 5I19H 1KPRA 3DBXA 4V190 4NP9A 5IT9E 2PTTA 3MLTA 4XMXA 4I0PD 4J1UB 3IU4L 3K72A 2KLTA 4PJFB 4JMNA 5E00B 4XWGH 2K9UA 3KF8B 4FFTA 3SQOL 3DDFA 4H8WH 1YY9D 2VDQL 1JPST 3JVGA 1IE4A 5E5MB 4Z7UB 4ZNEE 2X6GA 4K5MA 1ZV5A 1MFAL 3NIGB 4QOKB 1FL3A 3ZY7A 1WHOA 1CQVA 1GS7A 4U1KB 4A38A 4BSWA 3A67L 4P2RE 1MFBL 2VM9A 4P2QA 4PCYA 4Y8AA 2OSLB 5BZXA 4ODWA 1FFTB 2X42A 5KSAD 5TQ2L 1VS0A 1HFNA 2YPVA 3OMAB 5CP3A 2GIMA 4NJAH 4ZSOE 1M2VB 5C3EG 1N2RB 5T5FL 3TRZA 1YO4A 1SF5A 2EADA 2OXPA 4JM2B 3HPJB 4RZCB 3P3SA 5DZVA 1JGVL 3KEDA 2NSXA 2CBTA 3QDHA 4NEHB 4UDUB 3VQLA 3S17H 4IBTA 5JPMB 3LXBA 3T1HQ 4N28A 3RMHA 4KWUA 3QZLA 1E8YA 3O3EB 4D94A 4A3FB 4OD3H 5J1AA 4KMTL 1AOZA 2AJZB 2KUTA 1ZXKA 3L3DB 3M4OH 4GNXA 4GEJA 3QUMB 4OFKA 2R69H 4KKLC 2VJ8A 4WCYL 2PW1A 4PRIB 4FXKC 5AJ3L 3GTLH 2AVGA 4DKFL 1JZ3A 5HGTA 3HOZB 4BCZA 4LFAQ 4O58L 5I9OA 4MASA 3FO2B 2CGZA 3CLFL 3PJNA 4ISVB 4YHKH 1DBKL 4A37A 5MENE 5E24E 1PIGA 3LZOA 3B2DC 2QPSA 3ICEA 1E7UA 5D7SH 1X5HA 2O72A 1PZID 2XVGA 3QGVA 2NNCA 1YNXA 4DN3H 4ZW7A 4YBHA 2L4OA 4FF4A 3UTSB 3EQLC 3KLAB 3BISA 3MLVL 1R9FA 4ZNCD 3C6SA 2V5SA 1EEZA 3PL6A 3MLRH 2F54D 1XSIA 2R9HC 4KVCL 3REWB 5E1QA 3AXLB 3FRUA 4P2OB 1J9OA 1F18A 2DQUL 3DGGA 4GAFB 1GKEA 2GN5A 4HLZG 3V6ZB 2P80D 3BZFB 2FR4B 2HLFD 4PI2A 4EI5D 3UE0A 3IPBA 1AAJA 2WWKT 5LDUA 5F44A 1JHLL 1O6TA 5DD3H 5DJAB 5EZJA 3T3PE 3BFQG 1FV1A 5FHAH 1FNVA 3BAJA 3MRFA 5HDLA 1B3JA 4IJ3B 4S1QL 3ZDZF 2CBQA 4MZ2A 1OM3L 1K83B 4OF0A 2KEDA 4PWJA 3CDCA 1IKOP 1MFEL 1P5UC 2XN9E 4PG2C 5EJWA 3BAYA 3LS5H 3A7LA 4J4PA 5L4MA 5IIEA 1ENAA 1I1AB 5FK9C 1E4KC 1BXXA 2BP5M 2R4RL 3A22A 3G08B 3K46A 5EZIH 3Q2NA 4WWOA 2MJ8A 4E2OA 4Y2NA 4YSEA 4XMPL 4PCKA 3D5OF 4YAQA 2R83A 4O02H 5FOJA 2EINB 5FW8A 4C54A 5JJLA 1ULVA 4U1IA 5F2DA 4LMQD 1RIUH 4DZ8B 5GJTL 2NY0C 4UAOC 1BQLL 2MKLC 2VM4A 4MAYB 2KI6A 1H15B 2G9HA 2GT9A 5I1IH 2ISDA 1XGTA 3MLUH 2FWLB 5I76B 3PDGA 1AGEA 1J9SA 5ID1B 3CHXA 3OJDA 3BAIA 3DUUA 1WFNA 3RBSA 1A62A 5CYUA 3MV7A 4HXAH 3S48A 5GS0C 1NL0L 5F88A 1SJVA 3HUJF 3AZUA 5IVZB 4BWWA 4XP6H 4CKCA 2CXGA 1U30A 2EE9A 4LDOB 1EDYA 5FM8A 4I4WA 4FFZH 3J7AV 4C56A 2IHEA 3KPOB 5K39B 1PVOA 3IJ8A 4L4TB 1ADQA 1BCIA 4IALA 3D18B 4N2IA 1AR1D 2AAAA 1Y69U 1QBAA 3BWZA 1M53A 4K6LA 3RZCB 1AZNA 4AV5A 1KJMB 3RGVC 4RBPH 3X12B 4JI8Q 1F9RA 1KDIA 2Y5TB 3BPOC 2X4SA 4JB9H 3J81c 3KXFB 3KCPA 1PRTF 5HVGB 3FFCA 2QDVA 2JA7B 4KMUC 2UZXA 5LNEA 3RFRA 4CC4A 3GO5A 3LRSA 1E6JL 4LIQL 1QR1A 3DIFA 3D3VE 5I8KL 3EH2A 3NYKA 1KEMH 4FHKA 1UA6H 2UWEB 5KSAB 3KHQA 1J0IA 5FLMH 2IDCA 5DK0A 1M6OB 5CJ8A 4XB3A 5LL6X 2VW4A 4PJCF 1RAMA 1H0DB 2NW2B 2DYPB 3ATAA 4NDMA 3DMMA 2WINA 3HOUB 1SVZA 2AQSA 2NLJA 3FQUB 2N01B 2QPFA 3UZVB 2WAQB 4XNXH 5CNHA 3WIHA 4XWOC 2EYPA 4X7TB 4QAMB 4N90D 1SMYD 3IN2A 2XIWA 3QS2A 3WIHH 2DWYA 1V3JA 4HXBL 3GXMA 4NAMA 2PYEE 4EN3A 3GJEB 5JUEL 1BFOA 4DPAX 2HVJB 4FABH 5I1JL 4AKPA 1KYFA 2K70A 3ITPA 12E8H 4Y1AD 3U4EB 1X44A 4UINH 1OAYH 1UD3A 3FMGL 1STYA 2VXSL 4OCWH 4UTBL 4L5QA 2V0AA 2VB5A 1RF2D 5J57B 1ZTXL 4V2CB 3H4HA 2VDNB 3LRLA 2X1XR 1BMGA 5D1QE 2BWDA 4PJ9D 2EE2A 5L2KA 1D7DA 1UT9A 1N5YL 4TOYL 5DTFA 4IIZA 3TO4C 1KGCE 1OPGL 5K39A 4G7SB 1LO5B 4LSUL 5MP6H 1M1XA 1P6AB 2HCIA 5CJ5A 4U1NA 3U0WH 1S4ZA 3ECVA 1P53A 2ODIA 1U3HA 1KCVH 1BVKA 2JJWA 2Y5TA 4Y19D 2BP0B 3FO1B 4AH2A 3H2QA 3HN8A 5AAPA 3PWPA 2AEOA 3U9UB 3QIBA 4H25B 3DIFB 4IK7A 3PGZA 5C09A 4WJG3 2CHZA 3KPOA 4OGYH 3RIFK 4TVPH 3SE4A 4FQXC 2F0EA 4OB5L 1Q38A 1O80A 1NMGA 2KCCA 1QABA 4JHVA 1A66A 3X13A 4S1DD 3X1EA 3X12A 2JK5B 2JEBI 1N32Q 3L5WB 4XODA 4DERA 1QI4A 2V3DA 2YFNA 5BVJA 3MFFA 3DLLA 4JFDB 4NLAA 2XBZA 4HCEA 1KRTA 4ZOAA 3HZKB 4LLQB 4ISVA 4M7JL 1XO8A 4YCWA 2COVD 5AKRA 3FHWA 4AMWA 3X1NA 3EO9L 1AE3A 4KN4C 1VPOL 4OCSL 3QYNA 5IFAL 1FNSL 4DV4L 3E6FA 1SFOB 3B9KB 2QPDB 2H47C 3MU3A 4A6YA 2D8KA 4YHNB 5JYLA 1F42A 2B63B 1FH2A 1HHVA 2WZ5A 5ID0B 3ZDXF 1XZ0A 4DK5A 2GJRA 4HIHB 5D1ZD 5JW3L 1P1VA 3KCWA 4DETA 1HESA 4WFFE 1T7WA 3DVFA 4EI0A 2Q76A 1EUJA 1JOOA 2FJSA 1SEQL 5IJDC 3ARZA 4GMSH 2PYKA 1B4JH 5LMUQ 1RZKL 3I90A 3IN0A 2TSSA 5BN3A 1QX1A 3QZMA 3GTNA 3SKNA 4XWGL 1V10A 3HZVA 3TA4D 1ZANH 3B2MA 3LN9A 3Q1SL 3RAJH 1N18A 2RCSH 2IFGA 2QVMA 5IGXL 1MNNA 2OM5A 2ZWZA 2BLFA 3MRLB 5C4XB 2QVTA 1XEDA 3UYPB 4PRIA 3IFDA 3QO0B 1HILA 1YUKB 4ODXB 1A5FH 4E9QA 2KLRA 4HWBA 1A3ZA 5EU6E 1WAAE 1QRNE 3ARGD 4ZUVA 4G8EA 4OO1I 2K4KA 3JYBA 2FHBA 1PH4A 3AS3A 4GXVL 1A0QL 2EXYD 5E8DH 1DOLA 2OI9C 3QJFA 3BIKB 1QE6A 3QUML 1VA9A 4RNRA 1E5YA 2NNAA 3V0VA 5K59F 5MERA 4FNTA 3SD2A 1H3UA 2EYLA 2X12A 1NY4A 1U36A 1OWRM 3V7AE 1ET9A 4OWWB 1BVNP 1U8QB 2XNAB 4G6AD 4Z7QB 4QUFA 1RXLA 3W9EB 5MEPB 4LF7Q 4AIZA 2C9RA 1QFOA 4U49A 1QACA 1E4JA 1C1EL 5CHNA 2VDLL 2DJMA 1WVLA 1QPXA 4AK2A 3KOJA 3HPLA 3ABMB 2H3XC 3TL5A 1DJXA 2WB1E 4NGHL 3SQOH 4YNYB 1UACH 3PHSA 5DQJA 4CSSA 2GA4B 1H3VA 2QQNH 1VQJA 3GSNA 1DBBL 3VFOA 3CFKA 2L7UA 1QSEB 2EDWA 4A55A 1QHQA 1OALA 2BSTB 3SO5A 4L9DA 4Y1AB 1RUQH 2KC0A 4HJ9A 4GS3A 3B7TA 2AGJH 4JFFD 4K0OA 3CDYA 4P2QB 2BVQB 4ADGA 5A2FA 1U8NA 4JFSA 5CP3H 1CGVA 5C0BB 5I15L 1HNXQ 2AXGA 1TEFA 3QNZA 2BNQB 5MI0B 3ESOA 2Y1AA 3KBGA 4Y4HD 1BIHA 1KJVA 5E7NA 2UZYA 2Y06H 4Y9BA 2CRMA 2IAMC 1BMWA 1LK3H 5BUPA 3HZYA 3UJIH 4JG1H 5TDPA 4EQPA 4Y5YB 1O7DC 3FT1A 3PAZA 4P46D 4LNQA 3TH3T 2F0HA 3U7YL 1NDMA 4BDVB 4AQ8A 1MY5A 4L05A 4TUKL 3U82B 3UC0H 2VAJA 5LGHL 4QIRA 2H6OA 1PH7A 5F89B 1NKGA 4LP8A 4LLAA 4MA3B 2FCBA 4GUPB 4GSDH 1L0YB 2ZONA 4OZHF 3RYMA 3SY0B 1A9VA 3WNJA 2VLKB 3I2ZA 1ZT7A 3A4DA 3Q9QA 3ZK0A 2CLVB 3BN3B 3IJEA 4V1DB 5LBSA 3K81A 4HOMA 3KGTA 1A9BB 3OC5A 3CCMA 4Y52H 2D7QA 5IJVB 4I5BB 4Z1PA 3MCLL 5JIPA 1MBYA 3NJLA 4PUBH 3HHMA 3JWNC 1V27A 4HKZA 4YZFF 1QA9A 2VXQA 5SWZA 4V0BA 1MIUA 3TJPA 4F1ZA 2VNCA 3UDIA 3KWUA 1L1OC 1C5CL 1MWAH 2JA6B 3QEQD 3E3QE 3FF7A 1M7DA 4FP8L 3D39D 4OZ4A 3QZOA 3BWSA 3GI9H 4TKOB 3KJ6L 4TVPE 1PTZA 1NCWL 5I1EH 3DETC 1UA6L 1JFQH 4PJDA 3ZBMA 3T4AB 3LHPL 1IC1A 4GBXB 5DK3A 2PW5A 3GMOA 4ZYKB 2P8LA 1CYWA 2WTRB 5IV2A 5FHAL 1DQDH 1XCXA 5LXVA 3GTJH 2ESVA 5GROA 2H1LM 3TEHB 3FB5A 4M5ZL 4S1SH 3CZKA 2WUCH 5ISZA 4D2NA 4A6YH 2VE6A 1WGOA 3D06A 4LQ1A 3TJEH 1UT1A 2E0PA 1ZIBA 4LB8A 4HJJL 4XTRD 2Q86B 1KGWA 1VHPA 2D3VA 4B3TL 1P4IL 4NKDB 5D7JA 1CFQA 4IU3B 3BQUB 4NQQA 1J48A 3IJ9A 4LF6Q 1UQSA 2NY3D 3B6SA 5EUKB 4DV6L 1FYCA 1P5UA 2G5BB 2BVTA 2OTPA 3VU2A 1KIPA 4Y8DC 2X7LA 3FOLA 3IDIB 1A7NH 5ACMA 3WGUB 1SFHA 4R0LA 4R8WH 4WW2C 5EO1A 1A1NA 3F7QA 4PVLA 5F1OB 2XC8A 3V4VB 2X41A 1SEBB 2QQKL 3LKSA 1MG2C 1I8IA 2AF2A 2XX0A 2F3WA 4R7NA 3R3OA 1R17A 1JZFA 1OP5H 4EZMA 5T1KD 1MLCA 3ZR5A 3ZDZE 4DVBA 1OPGH 2N56A 2PN5A 4I7AA 4ZUWB 2Z4HA 3ISWA 5BO1H 2DD8L 4ME3A 2JKSA 4L18A 5DO2C 3CX5J 3KYOA 3BDCA 4NRZA 3I02B 1EFID 1H5BA 2QTEA 2A6ED 3JTSA 3K91A 4PJIB 5CIPA 2NX5A 4P75A 4ZAKD 3I2CL 3ZTJH 1RERA 3WELA 5IB1B 4KDVA 4ODTH 4GW1A 3L7FB 4NKQB 4AK1A 1DCZA 4PMEA 3QCTL 4HQQH 4C3IG 4U6HA 4N0CC 4DSYA 4N8FA 3TBCA 1BF4A 3FAXA 4FI7A 4QHUB 2HA1A 4JZNB 5E2TL 3MRNA 3JAMi 2F0FA 1K8DA 1KEGL 3WLBB 1EFQA 1U3JA 3C2AL 2VB2X 1DQML 5FGSA 2YEVB 4QTHA 2HRGA 4DR6Q 1NEUA 1TJHL 5ACLA 4M8VA 2O61B 1UURA 3IL8A 2RJMA 4BKLB 1A6XA 3EO1B 5IEHB 5CLXA 4AJVA 3MLZL 2KJXA 2XWCA 3BHBB 2ZXEB 3GUTB 3CFEB 3VWKC 2QHLA 4LNRA 2W38A 5GRUL 2ESVB 2JWYA 2Q8AL 4RKBA 3IMBA 4X65L 4DR7L 5LXGH 2YPLA 1INEL 4YO0A 3F04A 3QJUB 1KIPB 4KH2A 3VH8G 2XWRA 4Y2DC 2N55A 3EBHA 2AK4D 1RULL 1BVLB 1BBDH 3GPEA 4WWPA 3PWJA 2VN4A 3NQKA 1V8QA 1CXFA 5MEND 1OF2A 2Y7OA 5DVKA 2VIRB 3NELA 2DRUA 4WUUB 1NLDL 1QRNA 4RFNB 4H7VA 5I82A 4HN7A 2IMNA 2NNRA 2HKAA 3SYOA 4DKEH 1DZ1A 4FXGB 4WHTA 3DV4B 2FX7H 4K71C 2KDYA 4O2CB 2VRKA 4FF2A 1A64A 3VRJA 4XBPA 4C56E 1Q1EA 2RCNA 3LCYA 5E5UB 3VI4B 4EBQL 3SEPA 3IFLH 1B2WL 4X4ME 4W9DC 1T66C 1E2WA 3A24A 4XXDB 1G9MH 2E7LC 3HOZH 1AKJA 1FORH 1ZLVH 3FOMB 4OCYL 2RQ8A 3QXWA 2LVCA 2FLMA 4DKAA 4YY3L 3G7TA 4NC1C 2JXMB 2H1PL 1JE4A 4HFWB 1N7ML 1UTDA 2D0PA 1XF2A 4QGUA 4GLAC 2EIEA 1SE4A 3OZKA 5LUMA 1A2YA 4HKXB 5FA3A 4H8PA 5EA0L 1C5BH 4OGYL 1I82A 1ITCA 4UANA 3VFSA 1XH0A 1CLVA 2HVKA 2EYFA 4TLTA 2PWDA 2RGSA 2YRLA 1JZ6A 3O2DA 2ZOWA 2UXFA 3OQ3B 1Q8KA 3GFUA 2P43B 3OB0H 1INQA 2VQ1B 2A73A 3CAFA 5I1AA 3TURA 4HPHA 2XN9B 2B9BA 3S2DH 4XTRC 3FQTA 4YHPB 4K3JH 4LDLB 4F8MA 4K8IA 5SX5H 3VXME 4YHLL 4MJJA 5KYIA 2H32A 3VD9A 4Y1AA 3T0BA 3T8VA 4POYA 3VFNB 5F7HA 2X53A 1OQOA 1NCJA 2FRGP 2P5EE 3CZFB 3DECA 3NK3A 3O8XB 3TA3C 3BEWA 2IBGA 4DUXA 4LFHD 5DEHA 4HLEA 1JGEB 1N67A 1UD8A 2AW2A 3BP4B 1P7QB 3MLWL 4PJ9A 3TLRA 4NM8L 3WFZA 4C2MH 3HOYB 4N2AA 5HDRA 5IW3A 2BCOA 4NQEB 3VXNA 5DFAA 4X4YA 4L4VB 1CICA 5GRVL 3OKDA 1ORSA 1SLWA 1DTUA 1T1YB 5D5ME 2ID0A 3ZHFA 2VXUL 2DQGL 3G5VB 3QIUA 2ENPA 3L1FA 3PV6A 1QLFB 1JQYD 3T1YQ 2F2HA 2BCKA 2YIHA 3GMPB 3MA7A 2MO1A 3OJVC 4JRLA 2K6AA 3FB8A 1XZ0B 3R18A 4MA3A 3SY0A 4C56D 3PABA 1Z3GL 4D0CB 2CHXA 3BD3A 4FYTA 4WWKA 4BUQA 2UU9Q 2WXPA 3S6CA 1E65A 1N12A 3PWPE 4PRHB 3VMOA 3ZXAC 4X5RA 3RNKA 1THCA 2R1WB 2Y1ZA 3VFUA 3LIZA 3GB7A 4XP9H 2XWJB 3ZDYE 4TXVB 1S5FD 2W1NA 2VDMH 2NN6I 3WGVB 4N2KA 2VO8A 4FF3A 2XG4B 2B63G 1J12A 1KN4H 3FTGA 4JG1L 5EKLA 5FGCE 5MERB 2YV5A 2R2HB 4K55A 1K6QH 2YPKB 3AQQA 3QO0A 2F5AL 4UB0H 2DWDA 3IMWA 5AOMA 2Z8RA 5FYKL 3CSYA 2AUKA 1UCTA 4JYAQ 2F4IA 3AY4A 5CN2A 4YHNA 1UZ6E 2QQLH 4GQPH 4XPTL 1CI5A 4UMSA 1A47A 5IEKA 1I50B 3QE5A 4YSDA 3S97C 5IREA 1DVZA 2XBDA 1WS8A 1TWFB 4E0RB 4TNGA 3MCLH 1CXKA 3FKIG 2J71A 1R0AH 2EDOA 4N0UA 2NMSA 1GA2A 1IGIH 4NZDA 1HH6B 4AEHL 2QQNL 2IX1A 3O9WB 4EIBA 4LSRL 1HQMC 4M43L 3I72A 2CA3A 4OI8A 1C5CH 4BK5A 3QDMA 4FA6A 4X80H 3SBQA 3O6LH 1OP9A 5I8KH 4B9WA 4GPVA 4E9YA 5M3MB 1KCBA 2A6KA 1ET5A 1F3DH 5DQ9A 2H1XA 2BJML 4AIZB 3ZT6A 2ZOOA 3FUHA 1MW1A 1RK7A 2Q8BH 1OXVA 4IBSA 1YECH 1MLBA 5SWSD 2L5TA 4F5CE 5K9QI 2XKUA 1O9WA 2DW5A 4LCWB 1U8IA 3KBFA 2LW3A 3P73B 3G5XA 4LSQL 2A3TA 4LVNC 1QMUA 3VWKA 5E6RB 4JANB 3ALXA 5D2NE 3PRZA 4KDWA 3DO7A 4G6AC 9CGTA 2WKGA 3QJFB 2DIJA 4JRYE 3U7YH 4CNIA 1XGPA 4JL2A 1RZIA 4HCRH 4JFXB 3SE8L 3NPSB 4XPHH 4YHIB 4KX8A 5EEUA 3GBLA 1PTOB 4HC1A 2JI3A 3HMXL 5DTFB 4AM0B 1U6AL 1YEGH 3K80A 3QG6A 1I3QH 3EIFA 3ZL2A 3UGEA 3CMOH 4Y19A 2X4UB 4R2GB 4PGCA 2FEEI 3B9VA 4LAJH 4YUEL 1HINH 1M1SA 3D34A 4ODTL 3BVUA 2FO4A 3P4NB 4ZFGL 3GBNH 4XT1B 1Q9KB 2DJ4A 2GJ6D 3QIBB 1HCZA 4L1BA 4B9KC 2NZIA 2WQXA 1CFBA 4NXSA 1W91A 1NBQA 4QRPB 3BPNB 4IRZA 1BFVL 2VDRB 4CDGC 2QW7A 3DURA 5B7MA 4D8PB 3QIWA 5J13B 1UD4A 4HZLA 5HHXL 5J1SC 1UH3A 2AUJD 3DX6A 2YMXL 3FVQA 2DI8A 4GLRH 3A5UA 1IAKB 1XDTT 2IWHA 2PPFA 1A7RH 3T1HL 3DO3A 2CH4W 4JFYB 3L3OA 4DQAA 4UTAL 2CJ3A 2D4FA 3U50C 5HPOA 5KBPA 3TZVD 5B22A 1SYVB 3T4YA 5J56B 3HI6L 3DTDA 2G4GA 3VDYA 4P3WA 3TASA 1DSFL 4JI7Q 3HP3A 4DU9A 1WWWX 4POZD 4XCCH 3D6GA 2L1BA 1B4OA 2XQYK 4H20L 4B41A 1Q1JL 4RGOH 4DNLA 2J43A 3ZTDC 4QF4A 1UZGA 4JRYB 4MMZB 1CKOA 2AQNA 5AW3B 3KF6B 3FSAA 4HZLB 4LWCA 5D7IE 5B3SB 4UQIM 4A67A 4U7KA 5DZJA 3VG9C 3RHWF 2BP0A 2K7PA 5GAEC 1X9RA 1NSNS 3JV4A 1IQWH 4D3CL 4HUVA 4YWGL 1SEBD 1QZNA 4U1SB 3NCCB 2R0KH 4XZUB 2AWOA 1E3ZA 2VERN 5DHYA 3BC9A 1CMOA 2UWEF 1ZT4B 4BA1I 5ICYA 2A6DB 4DPCX 1DQVA 3IF1B 4YN3A 5D7HA 4R7XA 2ZOUA 1E6OL 2JCCE 2YSSA 2CWAA 4PRPD 4LCYB 1AKJD 4QRPE 1VQGA 3MOBH 3OJDB 1BBDL 2QV4A 4MS8C 3RVXC 5T3XD 5CEXB 5AKSA 5DMYA 1Q9LB 1D8LA 1S7WB 3FFOA 3WNMA 2HKFH 4P9ML 4FZ8H 5DJYB 2I5MX 3ZYOA 5EEWA 2VUKA 4IMKC 4Y5XB 3J81E 1EWHA 1IBML 1DQLH 4HUXB 4KD4A 1QSFD 4FQJL 4JFDD 4YE0A 1PY9A 4C2MB 3P4NA 4N1HB 4R0LC 5I2XA 3T4AC 1WD1A 3THML 5AG8A 3RGBA 1QW8A 2NTSP 1M90C 4MNQE 2AJSL 2R1YA 2APBA 4HUUB 1H8SA 1OD9A 4WFEE 5IVXF 1IM9A 4CDHA 1CFTA 1O7ZA 3PSIA 2EZVA 1SMYC 4IKJA 1SJED 3DJTA 1PFMA 5DYOB 1OTCA 1AZZC 1NFDA 5EULV 1ECYA 1VQCA 1MVYA 3R06A 5DUBA 5DK0B 2HFEB 2R1XA 3K8LA 1KTKE 5EPMA 3J80E 4DR1L 1IBKQ 1T1YA 3TA3D 3S1QH 4BY1B 1INEH 1K72A 3L1EA 3WDNA 4JI2L 3SK6A 1SDAB 2AKRA 2HTLC 3MRPA 1ADQL 2WBJD 1X56A 3MRRB 1BZQK 1TPXC 2GK0A 2WNKA 5LQBL 3UTSD 5FLXE 3P2TA 3D2UB 1FZJA 4QTIL 3U48A 2CO2A 3ZSTA 1EHLH 2FT8A 1ZGLA 5I6XC 1VZGA 2R2HA 2CCVA 2R56L 3APDA 4UBDC 1BWMA 4X62L 4P74A 3OKLB 3RDTC 1PFNA 2GW5A 4XPGH 4WORA 4GOPC 1TJGH 3AMKA 4YSRA 1E5UI 3I6LD 3P02A 4MA1B 2BIQA 3GB7B 4K7PH 4U1HB 5HHMD 1SE8A 3GD7A 5CD3A 2DN8A 3FYIB 2DL9A 1R3JB 3FU9A 4RA8A 3NDYE 1PRTB 1P4BH 5IG7A 1JZJA 5IOPA 1WTLA 1SXZA 1BG1A 4XNMB 2E8ZA 1HIML 3KL5A 5D7KD 5GGVH 2XWJA 1G6VK 2C3WA 2VERA 5IMLA 3KLAA 2A74B 3NESA 2PP8A 4GNXB 1PU0A 2JKNA 2VLMD 4JPIA 4X6FB 5D93B 3UEZA 3VYNA 5L0QB 3IFTA 1R5VA 1EZUA 3PL6B 3CPWA 3TBSB 2NVTH 2EEFA 2B1OA 4N24A 1DO5A 5I0ZA 3TT1H 1R3HB 1NGXB 5CV8A 4DUYQ 3K5RA 3F84A 5DO8A 1RCYA 5A3IC 3B43A 4MNQD 4OV5B 1EMTH 5DZLA 4AYMC 2YR3A 2XKNB 4G7YL 4MJIE 3KVDD 1ECZA 5FYJE 4JCMA 5IGBA 4LSVL 3V6OC 2YK1L 2Z1KA 3MV8D 4U6YA 2X70B 2VDML 5H37A 3NEEA 4FA8A 2YAFA 5F93C 2VDQH 2WKCA 3HC4H 4BBWA 3LQAL 3MRIA 2CKNA 5E6SB 1UNSA 5EDSA 5HP5A 1TS5A 2CMRH 5EZJB 1M6UA 1QRNB 3QWNA 1MFAH 1TZHB 2WXMA 1CFVL 3HEIB 4G42A 4WWID 3D33A 3KGRA 4IKKA 1CLCA 3PFUA 4JM2F 5HHNB 4PW9A 1CZGA 1O5DT 2HFFA 1YEFL 3ARGB 3ASOB 4XH2A 2WZ0A 5AVVB 5JR1L 2Y2TA 4ILWA 5CEYA 1CHQD 2YQ3A 5JHDD 4NX0A 4BFIA 2V9UA 3LB6D 3IRCA 3KGUA 5CUSL 2WXIA 1IKNA 1AOHA 3U30C 4UCFA 5DR5L 2V2TB 4NDXA 1A6WL 4LSRH 4M43H 1TXYA 2NY1B 4C83A 4OW6A 1Y0LB 1KG0A 1URLA 1KTBA 4ONFL 4ZPTA 5JOFB 2UUCL 5KSBB 2VQ1A 2WVVB 3CFMA 1OKEA 1C7TA 1RTOA 4WCYH 3RVWC 3LWEA 1CG9A 4ZMZA 4FFZA 3FYEB 4AYGA 3BEWB 1YEDB 3TBTA 4FNFA 4H1LH 4DAMA 1JPFA 2HVKB 1PEWA 4MXWL 1N64L 3G6JB 4UT9H 1DM0B 3OWFA 4B3ML 2GJ6A 5GZND 1TS3A 5LGKA 3G4SA 2WOYA 1HX0A 3SDXB 3N41B 5HYJB 4FJYA 1QBLH 2WLYA 2WXFA 1SBSL 2DBJA 3SKMB 1A3QA 4JO3H 3BKJL 4A3KB 1YNTA 2X87A 1VERA 4HJ5A 3GSVB 5EO9A 3T9WA 4DO5A 5DD1H 5C0CB 1R5WB 1LE5B 1K6QL 1Q86C 3MHBA 2D03L 4HGMA 4BBSB 3GJFB 1NR2A 1SUJA 3QZWB 4CW1B 1N36Q 1JYNA 4X0KB 4A04A 1PKQA 3DWTA 1MJ8L 1T22B 3DX0A 3OG6B 1F4WL 2P5WE 2VMCA 3MO1A 5INDA 5C0NC 1NFDE 5HGHA 4JKLA 1DSFH 4PLKD 4CILA 5E2WL 1A63A 1KJ3L 4P2RA 4WTZG 1HZKA 4Y16B 5DFVC 5IQLA 2WC7A 3T2OA 3AU7A 4ZFGH 1ORQA 5GS1B 1YDPB 2C5DC 3FQYA 5E4EC 1J9RA 3BE1L 2OK0H 3EYUL 2E5LQ 3O2WL 4GO9A 5D7IA 3Q7JA 4DR6L 3MV9E 3SE3A 4JFEB 4Z7NB 2F58L 2B2VC 1LO5D 1S9VA 2PUQT 1XB8A 4LVNB 3IKJA 3SOBL 1NAML 5A6LA 3VYPA 1M57B 1RZ7H 4NJ9H 2NT1A 2W9EH 3QIUD 1N8RC 5D55A 3QA3A 2BS9A 4YWGH 5AZUA 3WFEH 2Z64C 1HHIB 1HHJB 4J6RL 2BNRD 2Z1CA 4KJWC 3SOTA 2JA6H 3NRPA 4M6OL 4QRSB 5DMIH 4DGVL 5GJTH 1RPUA 3X3FH 3CAMA 2G60L 2OQJA 5B1CA 1KFAL 2A99A 1KXQA 4KUZH 1HH9B 1LO0L 3MOBL 1SYEA 3TFBA 4ZUUA 3LV3B 2Q87A 3MLUL 4GW1B 4F91B 2PZUA 4K7PX 3PF5A 5H94B 5DMKB 4N2HA 5FHBL 3FMCA 5IBTL 2P8LB 1J8KA 3FFCE 4NNYB 4IOCA 2F54E 1F41A 2BWIA 4JS7A 4HJ0D 2ZPKH 2LMCB 3S2AA 1IL8A 1WFJA 3D9AH 1CXEA 2NZ1D 2K6ZA 2PPDA 3HNSH 4FJ6A 5FO9A 4DV6Q 2Z7UA 5H4YA 2OZ4H 3WN5A 3FO0L 5AB2A 3RX8A 1N70A 2X6BA 1NUFA 1TEYA 2M2DA 3LQMA 2Z91A 4J3OF 4OCMC 1I1FA 3W5OA 4G1MB 1F77A 1NPUA 1XIWD 4LCUB 4KXCA 4HSAC 1E4WH 1IGCL 1BDYA 2BNUB 3ROLA 4ADIA 5HYQB 1QSVA 4XE0A 3RNQB 5CP7B 3V0GA 4ELME 3CMAA 1NMBL 2A68C 3U0PB 4PI0A 3NFSL 4F2EA 2ZXAA 5DHVB 2WJ7A 3UROR 5DJZB 1I8IB 5LMNW 3M7FB 3ERQA 3ZDZB 5HGHB 2VZ1A 4XCCL 3DMMC 3RX5A 1NE3A 5DEZA 4X66Q 2P7TA 2VQ4A 1FDLL 4QY8B 3MRBB 1GOFA 3DGDA 2QZ5A 1AH1A 5ECGA 4GG8A 3IJHA 4ZDHB 1RD6A 3LDBC 4KKTA 3UCQA 1KZQA 3G48A 2R4SL 2EZ0C 3UTTD 3W0WD 2NY4D 2M26A 3RIKA 3S16H 1O75A 1ZT1B 2X44D 4JBMA 1ZDQA 2LU4A 4JI4Q 1IUZA 1ENCA 1U95A 4TQ8A 4B27A 1LO2H 3PUUA 5KG9B 1ES0A 1P2CA 2CVRA 3HE7B 2AMCB 1GUTA 3MN8A 5FWQA 3GLAA 3S5ZA 1BVOA 4NQCD 4PGBB 5D65A 4YHOH 3RRQA 2VE6B 1ZLEA 1G7QB 1RI8A 5DM63 5DMKA 2XYBA 2GBVA 4DO4A 4FXLA 1RHFA 1O7IA 2PABA 1EY5A 2FUTA 2FBJH 3STBA 2B9AA 3SSGA 2LFEA 2GPZA 3F12A 4X8XA 3X14A 1V9PA 2KEEA 5ALBL 4NKDA 3QDGE 3K6FA 3SCMC 4PP2A 2GSMB 2ADYA 1FNEA 2AHOB 2VDRH 3QC5X 1KYAA 4OIJA 3SE0A 1J0KA 1OB0A 1HEHC 2VSCA 3OAYH 3F5WB 1YRKA 4M9PA 1ROWA 5M5WH 2EXYC 1PZKD 4NT6A 5C0AA 3T09A 2XCMC 4XC1L 3QXTA 3VFRB 2W5PA 4M5SA 4D0DA 3TSSA 1YMHB 2FSEA 2BNQA 3HOVG 2E6PA 3DX8A 3DX2A 4MNQA 3LMJL 3THMH 5BJTA 4ALPA 2FEDD 1Z5LB 1DN2A 3HZYB 5DZ9A 5EFIB 4L8JA 3HFFA 3HRZA 2R0LL 1LMIA 4GYBA 1T1ZB 2WQAA 3HE6A 1YEWA 3T8XA 3GSNB 5D96B 2NVTB 4P2OC 3UOAB 3W2DH 5HHNA 3QUXA 1DZ0A 3WKMH 1W80A 2FEJA 3KPQB 1JNNL 3TP6A 4LHUA 1OTUC 1WCMH 1PZCA 2TSAA 2E9BA 4G8FA 3HI5L 3GRWL 1T0OA 3C60B 3ARBC 3PDDA 1IIKA 2SEBB 1YNTB 3CXDH 4GW4B 3S24A 1ZJAA 2VLKA 4PJHB 2OMYB 2JA9A 2EDQA 1BKBA 2X6AA 3LZQA 4R97B 2XHNA 4ADJA 5IP9G 2D0GA 4NKIH 1L6PA 4UM9D 4UMGA 2XWXA 1HEJC 1AANA 3ZE1B 4IOFD 2BSTA 2BCMA 4C4KO 1FGBD 3P9MA 3VFPA 3QRGL 2BIIA 3JVGC 2YEZA 4JFED 1QFWL 5JPMC 1E28A 4PV9A 2QSCL 5JPNC 3BQVA 3NJJA 4LK1C 2V4LA 2PWGA 2ETWA 4F2ME 3Q1SH 3S2DB 1TQCB 1QFUH 1CB4A 1ASYA 2UZYB 3AM8A 5KJRH 4FQXD 1G6RA 1QSED 5E3FA 2G5RA 4LPUA 4XRCA 5DEFB 2DM3A 1SROA 1TG8A 2H6PB 5J11C 3W39A 2OXGA 1A3VA 1I4FB 3PP3H 1HDMA 1T7VA 4JO3L 2VDNH 5LJYH 4N5EC 3MRPB 1NTGA 1ZS8A 4UU9B 3LZPA 4PQXA 3ZMEA 5C97A 3HOUG 1A3LL 4OQTA 3MJ7B 4YLQT 4DAGL 4U33A 1YNKH 1EHLL 3RN2A 5I8CA 1MJ8H 1FGVL 1RL1A 3LEYL 5E8NA 4C55A 1K28A 4JG0H 2XN0A 2YUXA 4KO9A 1LM0A 3ILDA 5IGFA 2RH0A 5ID0A 3BU2A 3ZZSA 4PMCA 3MBWB 1F11B 4HWEH 4MKTA 2A83A 4F3FA 3MNDA 4QJ3B 3LX0A 3QFDA 4RESB 4WI4A 1IT9L 1FL0A 1C1EH 5D70L 5T33H 4PJCA 1ZGLB 4LPVA 4JGNA 1AG6A 1FZJB 2AABL 3DX7A 3UYPA 4JFTA 1CTNA 1F90H 1KLGB 4P4RA 3UYRL 2BZDA 3RIFF 3A3YB 3VW3H 1G7JB 4XMLH 5D8JL 1NAMH 2DJSA 4DV2Q 4KKUA 3BKJH 1BXVA 1EHXA 3BS1A 1ASPA 1UB5A 5DEGB 3ULVF 3BZ5A 4J3BA 5BW7A 4PZ7A 43CAB 3VFVA 2E86A 3ATEA 3S88H 3A6BH 1SDDA 4OF8A 2V33A 2JELH 3QEHA 4UQCA 3HMWL 1NFDF 5AVYB 2GTZB 5TFSH 1R5IB 1KCRL 1R3HA 3BGMB 2WZAA 2UXDQ 1WTVA 2FMCA 3QJXA 3VD1A 4HDIB 3X3FL 4Y2OB 3QW9A 5TE7L 3Q0AA 1QILA 4KQ4L 4UDTB 5CCKH 1EQWA 4X6FA 1N5AB 2A74A 1X5GA 4KXAA 2JVUA 3CC1A 3CPUA 1AIFB 2J1WA 3FN3A 3OZLA 5HJ3A 2OK0L 2B3RA 3W1GA 4PS8A 3D25A 2A6HC 4NW2A 4R7LA 3ECBB 1Y1VG 2RSOA 3S3PA 2DQDH 3HR6A 4MA8H 1H9MA 2KHAA 1IC0A 3G5YB 5C07D 2FO1A 5LAXA 1OARH 3MACL 3CSTA 2FJUB 2X89D 3MXUA 3POHA 4K15A 2OCFD 2CD0A 2A77L 2X6VA 2BA1A 1K5WA 3PAVA 3L3GB 4PG9B 4MXVF 4PJ8A 3D87B 3RPKA 2WWNA 4C3HB 2B1AL 2WCPA 2ZQKA 4G7RB 4U1NB 4IIQA 2QHRL 4KKBC 3BMVA 2J6EL 4LDEB 2EDTA 3U4EA 3RHWK 4KROD 3NFSH 1FC1A 3KDFA 4KVNL 5L2JB 2VUYA 5KEEA 1EWIA 1DJIA 1HN1A 1RZ8A 1WGVA 1T80A 5DYOA 3IGFA 3GV6A 4IJTA 3RWFB 3BGAA 3DMMB 3L2MA 3V79C 1PXUA 1EGJH 4PPTA 4ACPA 3PWPB 2OMVB 3DIVA 2D7NA 5BQ7B 4U4BA 5IFHL 3HNSL 5IBLD 5A6MA 3RGHA 4NQSB 2JSFA 5HVHB 5M3FB 2WXRA 1OCWH 3STLA 1WA2X 1RZ7L 1SJHB 5JQ6H 2NUTB 2WLLA 3DSNA 1FP5A 5DUPH 1ZVSA 4FVMA 1IEBA 3BMWA 4FNSA 2WLKA 1WVZA 4XPAH 4N9TA 1CKNB 4MQ7B 3V05A 1NCAL 1HK6A 1XMWA 2A6JB 2G9KA 3B7SA 1NAKL 5J11B 1ANUA 1RZ8B 2IWKA 5K93A 1PQZB 3FSOA 3DK0A 5TK2A 1CK0H 3TNMB 1PZUB 3UJJL 2BFVH 1GC1C 4KFZC 1T5WB 5CJXA 4YSUA 2C9UA 2BVEA 4RMRA 3WUWB 1MFCL 5EOQL 3G3LA 3LSOA 1Z6HA 4NFDA 4NQVA 4F33B 2R9HD 2K5DA 4XO8A 2MNAA 4IOFC 2FO4B 1QVFA 2E27L 3D39E 2EJFC 3ESMA 3O11B 4A7QA 3KJPA 1LO2L 1ZLWK 4JR9L 1OVZA 3ARBD 1MHHB 4NXNL 1CGUA 1JPSH 3TVMA 3BO8A 4YVUA 1S46A 4LUOA 4NOBA 3UBXG 3FJTA 2VAAB 3S98A 3U4BH 4B3EA 1DL7L 3SJVD 1OGAB 4IRJA 2F0DA 3H54A 2W0KA 4U1LB 5EBMB 2WKOA 5G4NA 4JFXA 3UO1H 4XXWA 5KSUB 1HHKA 4OELB 2YMTA 3TESA 4N68A 1DUZB 1TVHB 5JHLA 4KKNA 1YPZA 1WIPA 3D0VB 1JK8B 5L0QC 1A4KB 4DK6A 1KWGA 4KK6C 3HI1A 3AGVA 5GAGC 3MV8B 4PREB 1VQ8A 2VC2L 5ITFB 3OLEA 1CVRA 2DQHL 4NO0D 4JO1H 4R6UA 3KXFA 3K57A 1FRGL 1KELL 4XTCS 4JKNA 4M03A 4OGXL 5HHOE 4YR6A 1GR7A 3ULUE 1IEBB 4F87A 1BCPF 3MRMA 4GXFA 3FQ1A 2FZ3B 2ZX7A 2BHYA 1KB9J 3B7UX 2Z31A 2XXGA 3CQQA 4XC1H 5CEZE 1XB6A 1KCSH 3I6GA 3O3EA 4MX7A 4FNLL 1MRDL 4ABWA 4IJ3C 1BQHA 4A75A 1OK8A 4MJ2A 4MA1C 3U6XS 3CSPA 1V7ML 3L4YA 1G9EA 3QS3A 4ZQTA 1KSRA 1UM5L 4M5WA 1S5HB 4PRPA 1PLFA 5B8CA 1MHEA 2YU9H 4X6DF 3MGTB 4WIQA 2CWRA 4G1EA 1U8HB 3SCMD 3IDMB 3OWRA 3BZDB 4LAQH 2IX0A 4FQIL 5J8OA 4A93B 1ACYL 4HJUA 3C12A 1QFUL 4LESA 4NN7C 4EI5A 4UTAA 3U7WL 2G9DA 4UOZA 2VKXA 5E5MA 2C4XA 3GXIA 3VYSA 3I4NG 5C3IA 3NTCH 2K04A 4JVZA 1JF1B 1MI5E 1K3RA 4HZAA 3A8KE 4F7MA 4N0UB 2Y7SA 3EG9B 3EOBA 1DOKA 3ILQD 3WS6C 4KQ3H 2O2LD 3US9A 4YH6A 5IE8A 1IILE 4HC1L 2WVUA 3Q13A 5HYJE 3QHFL 2KUMA 3M46A 2PCFB 1MCKA 4ZSOA 1XIWA 3FB8B 4F80A 4IDLA 5ESQA 2BA0A 1DVUA 3D0VA 2F0VA 4W6XB 1XR9B 1VQ6A 1HSBB 4HU2A 1I6VC 4HIOA 4YOKA 2AJZA 2ICWJ 2QV2A 1FWXA 4P2RD 4L23A 3TP7A 3CFDA 3DX3A 2FJGB 1OGAA 4IRJB 2KBGA 2VAAA 1GHJA 1H9JA 1KQSA 3LKOB 1TLKA 3OXSB 1GYCA 2MNJB 5K33A 4GKSB 3F8UB 2JF1A 1EHNA 1YN7B 2UXVA 1AE6H 4I77L 4XCEA 2PTVA 1XIWC 1QHOA 2Z6BA 3AXLA 4NQDA 2ZJQA 1HCFX 2RB8A 4P2OA 4XPBL 5A16B 5J06A 4Y2OA 3T8XB 1EQQA 5ITBH 4G9FB 4JDZA 4Z7VE 5BOJA 4IU2A 4KK6D 5EORH 5IM7B 5AB1A 3CSYB 2BNRE 4KO6A 3V0AC 3NTKA 3WS6A 1L9TA 3QJRB 4NJAL 1X5JA 2H3NA 3GHEL 5AW6B 4NN5C 3QRBA 1XGZA 2J5WA 4BGLA 4HX1A 3IEAA 5IK3B 4KGJA 3PQYB 2CNZA 4QY7A 1JT8A 3B5GA 5CD5D 2Q2LA 4X66L 3EW3B 3GSUA 5D5MF 2BHFA 1HSAB 2FJFB 4J3XA 4TKWA 4ZMXA 1NDGB 3HOVB 4YXLL 1CZ8L 4M02A 4XVJH 5TE4L 5IGEA 5B38G 3G6DH 3VW3L 3QXDA 1FNLA 3AREA 5B8CC 3D05A 4PJGF 1OO9B 3TPUB 4JKWA 1T5EA 3CLFH 4KO7A 2Q7YB 1YN6B 1LILA 2F68X 3D7PA 3FF8A 5KJRL 1P7BA 2BP3A 3M7OA 1WBXB 4W9ZA 3NP8A 3IRZA 4I8DA 3QWOA 5C0BE 5F3BB 4DUVA 1RJTA 4OLUL 3CUPB 3W11D 3K81C 4A4IA 2ATPA 1AXSB 4MVBD 5AOKA 1KPRB 4K3EL 5E03A 4XP4L 2CCWA 1EZ6A 4YSCA 1LNUB 2YU9B 4DP0X 1T89C 5C2BL 3K0YA 4Z77B 2YD2A 3MJ9H 1KHIA 2B8GA 4FQCH 1A3LH 5FK9B 1FYTA 2P3YA 2V3EA 4JPKL 3E1F1 1KTKA 2WB1G 2BY2A 1T21B 2ZXBA 4A3FH 3L17A 3S3JA 2VS1A 1NEZA 2WB7A 2K28A 3NJXA 1X5KA 4G9FE 4Z7VB 2GFBA 5K5YA 1T6BX 3O4OC 3P1VA 2DB8A 2RDGA 3L3GA 4XP6L 1EYGA 4J1UA 4O58H 4NWTL 1U8LB 1FVEA 4IBLT 4WFGE 4PMFA 3VXMA 4AKQA 3FULA 3NJIA 3ULUC 2WP8J 3MRNB 3TVMC 1MJUL 5GIRA 3B8YA 3V7AG 4H1LB 3SGDH 4AMKL 3I4OA 2LKVA 3TN2A 4L29B 3C5SB 3W0WA 3DI2B 5HHPA 3FQRB 1N59A 1JXGA 5IW6A 3NMEA 3QIAA 2YZ1A 1MF2L 4OZGE 4XI5C 3IMSA 1F4YH 2I0QA 4PCSA 2D5DA 3G6JE 4RA3A 2ENSA 3MRBA 3WN5C 3VTTA 3AU1A 4XQQA 5JOPE 3L7FA 2Q8BL 5AOLA 5G4MA 1G7HA 1GYVA 2HT3C 2IH9A 2GBAA 4LOFA 4M7KH 3BDOA 2BDNH 4HDIA 4TM9A 3ZDXB 2I26N 3FT2A 4KZCA 2M8XA 4U7SA 3FT3B 4YXKL 1LO4H 1PLGL 2YRZA 4NRZB 3BXNA 3C6LA 3NABH 1FYHB 1MFEH 4Q89A 3S5LG 1YEEH 1JWSA 4XNXL 2FNWA 2J1XA 2A6HD 4HCRL 3SE8H 3LKQB 1VKXA 1TWCB 4L2YA 3WFHB 4FF9A 2FSDA 3EJJX 5L88H 4MXQD 2R39A 1B3QA 4K5OA 3EO1A 4U2ZA 5IEHA 2YS4A 3VGBA 5C0XI 4MDIB 4QHNA 3I4MH 3ZQ9A 3TXAA 1I7TB 5JAVA 1JZGA 2BK8A 4WUUA 3QFDB 1OAYL 3FMGH 1V7NH 4LP5A 3EJZC 2A83B 4UTBH 1K8DB 4DN3L 1YHQA 2DM2A 4ODUB 1S7SA 2MNUA 4P5TD 3K5LA 3DC0A 4Q0XL 4R5XA 2AJUL 1EEQA 5CV5A 3HE6D 3WJLC 3V6BR 5MI0C 1N5YH 4WW2F 2J6EH 2A6IA 2B2VA 2HKHH 3NEOA 1CDUA 4DV7L 2PNRC 4JI6L 1EJFA 3AUWB 3D4GA 1KTLB 3K0WA 1UWGH 5IB2B 4X7SL 1OW0C 5IBUB 2UXGA 3LDBB 1T03L 4PJDB 3TWCL 2BNRA 1EY4A 4AJWA 3M07A 3M85A 4XCFH 3RTQA 1NZRA 2IH1A 2DICA 4IRSC 4PJXA 4B5EA 1WITA 5IFHH 1OT2A 5J12C 2WTPA 4WSKA 4Y5VB 1FH5H 2W95A 4M8AA 3HG4A 5FDYA 3H0TA 3VD5A 2VDPL 4KHPL 3BSZA 4LEXL 2DUDA 4PBVC 1NJ9B 3L4CA 2QF7A 2HT4D 4PJAE 4OZIE 5IJVA 4OQTH 3MTXA 1A6UH 1Q1JH 5FM5M 2FD6H 3BP6B 3KJ4C 4XNUH 2E74C 5I5JA 5D2NB 3OKMB 3G6AA 1VQMA 3P9MB 4RGOS 4N2GA 1S7VA 4AQEA 5ETUA 3FB6A 4ZYKA 1CPUA 4G6KH 4XAKE 1DJZA 4J3OG 3BP7B 4OD1H 1SOKA 1BOSA 2Y7QA 2DLEA 2FX9L 4RGNC 3VXRA 4V1DA 5GSRB 1C5DA 5MEOA 4BE6A 4UV4L 1GIGH 2YA2A 1XF4B 3KD4A 2OMNA 2P8PB 2EJMA 3LOWA 1WAEA 1UH2A 3CRLC 5IP4A 3TO2B 5BUGA 2P47B 5C0RL 1MJ7H 4GO8A 5CGYC 1TR7A 3QZBA 1Y1VH 3ZTCC 1JF5A 1T6WA 2HIXA 3GTOB 1IJNA 2Z34A 3VCLB 5CCJA 4GMSL 4BIKA 1CE6B 4JREC 5E6IC 1DFBL 1U33A 4R4NC 3AXIA 4DP7X 4KHTL 3ZTJG 4AYBA 1ZANL 4FFZL 4NNYA 1VFUA 3CCUA 3BWUF 4FYRA 4OZHA 4ZW6A 5CORA 2HJLB 1F58H 3FAWA 2V8MA 1BVZA 5I1CL 1X4ZA 4DVRH 1D5IL 3JTTA 5F0JB 3V6FB 2YXMA 2D2OA 5T3ZD 1AFVH 1OTUD 1UB6A 2EJ1A 2CUAA 2VR3A 4GJTB 3QNXA 3CXHJ 3HOUH 4Y89A 2Q5BA 1OF0A 4RLDA 1GW0A 1XTLA 3BZ4A 3EH4B 2Y7NA 3WO4B 2VC2H 4EN3C 4A3EG 3BP5B 4TOYH 1K5NB 4DGIH 4LHQB 4JY6B 5CKAA 4PSPA 4R9WA 1XCWA 3PQIA 4L3ED 5I6WA 4PJEA 3WKNA 1GVPA 1J9QA 1SFDA 4LBAA 5I6YA 1EAPB 4ANVA 3QORA 1XSOA 4WV1B 3ER0A 4BFOA 1GYUA 5AENA 5KW9L 5D2NA 3NDZE 3RVTC 4BKTC 3Q5OA 4GSQA 1MNUL 4K23L 2ZKHL 2J5LC 1OK0A 1CG9B 5IYBH 4GS7C 4OB5H 1QTSA 1GM5A 2PPCA 1A1MB 3KYNB 4UIKL 1RP9A 3I9AA 3WIHL 2VW7A 1DOMA 2WMPB 3KJOA 4A3BB 1Q8MA 1QNZH 5IMOB 1DXMA 4NZJA 3MV7D 5CLWA 1WTQA 4JQVC 4P23B 3Q48A 4QKXB 2QVKA 3V4PH 4WO4C 2N1TE 2YA1A 3CBKB 3EDDA 1T22A 5GXBB 2AGJL 2NTFA 1SXAA 1QZ1A 3CFKB 4QY8A 2BMKB 2HJFB 2X5PA 1U58A 3FPPA 2CCZA 1KMGA 2LXJA 1G94A 3J8F7 3WXWH 5F3BA 3BVZA 1KYOJ 4TUUA 2B63H 5GQOA 1E4HA 4UT9A 4R8NA 1YEKL 4I1NB 5IR1B 2KKQA 1HH2P 1QUNB 2Q7YA 3QUXC 1IXRA 5AVZB 4U1MA 2HLAA 5MENB 3Q22A 5LCVL 4ETQA 1E9PB 1PFOA 2DH3A 3MYJA 2B15A 4BY7H 2CRIA 2E9JA 2EEDA 1VDZA 4ANUA 4NO0A 1T0MA 1WCMB 1E8WA 1CE1H 2RCSL 5F9OL 3AY2A 1S8DB 3IAQA 2WXHA 5HHQB 2C9PA 1DANU 2VDLH 1YJNA 2WNGA 6PAZA 3DMMD 4TRDA 5IQOA 3KLSX 3GO1H 2WXKA 4PLJD 1JRHL 3VFGL 4PH8A 2F0LA 2A9CA 1OCZB 2B0SH 2DTMH 4O2FB 5D1XC 4QHKJ 1I1RA 3PF2A 3X3NA 1RZGB 3QUKB 4ZJ9A 3AABA 5CBEB 1J10A 1RUQL 5E95B 5CJOH 3B9KA 1HU8A 1VPOH 3ETTA 4OCSH 1U3HB 2FGZA 2K03A 3FN0L 1EU3A 3MRRA 3J81j 4P99A 2YRBA 5LHY1 1QR4A 1G91A 5KVFH 3KLRA 1TENA 2VLLB 2Y22A 4OY9A 4B9GA 1B9KA 2VQEQ 4BFEA 5I2IA 3MODH 2MOQA 4XCNB 3VWJB 1TTCA 3FQRA 2C1PB 4NP4H 5IG7B 4OM0L 1I7UB 1YLBB 2JCCA 3ARSA 5C07B 1KNAA 2E47A 3X13B 2V1CC 1B4JL 1MREH 3WIAA 2DM4A 5TQ0L 3CK0L 2DY2A 4HIHA 4W4NA 1YYCA 3G6DL 4PJ5B 2ID5A 2ZT9C 5HPMA 4M6MH 2ZJRA 3HVDA 4KBPA 2F1MA 3ERSX 2MTPA 4PS7A 2OX5A 4DV5Q 4XNZC 1IARB 2EDMA 4UAOB 5F9JB 1AZRA 3L4WA 3ZYYX 3I4NH 4OSUH 1BBJB 5KEZA 3H6MA 2Y2YA 1KB5A 2V2XB 4QF1A 2XETA 2ZX9A 3L0OA 4IDJL 5AQ0A 3VA7A 3WHE1 5EU7C 2HMID 3WG7B 1XR8B 1USQA 1T7ZA 2LQRA 2ZP0T 4GXVH 1CL7I 1R5VB 2EEAA 2FVNA 5C0FA 4FG6D 4NHCH 1GOHA 4NWUL 1MCNA 5KSUA 3BUBA 4FFYL 3EBAA 3M4YA 1CXIA 3H0GB 2XTJD 3EIVA 4KI5D 1YEEL 3K74B 4BFJA 5IIFA 1IO4C 4UAIA 5IWAL 4LFBQ 3MLYL 3N44F 3O13A 1IBYA 3EBGA 3Q8BA 2RCFA 2FX8L 2IH3B 3MV8E 4Y2LA 4A3KG 4M3KB 4QRRA 4XZUA 4H88H 4PRHD 4N1EA 1P4LB 4Y5XC 1IEHA 3RPIA 1D7CA 2G2RA 1GMEA 2J1KA 1E2ZA 1J8HA 3CDZB 3MUZ1 3QJHB 4RGMA 3I2CH 3ZIYA 1H0DA 3QYMA 3UTPE 2H4OA 1IQDB 1KJ3H 4EE2A 1UWXK 4JE4B 1WUZA 2XV6B 4I9WD 2H2PC 1HSAA 2FJFA 1ZPUA 3N0PB 4Q2ZB 4C3IH 2X6UA 1KYOK 4ANXA 1CA5A 2NLJB 3FQUA 1NMCC 3S4SB 4TSBH 4ZPTB 2BOSA 1JCKA 3MXWH 4G43A 1F4YL 2F53A 3EAKA 4OZGF 1T83A 3GXUB 5C6PB 2HKHL 5HGBA 3CXHK 1TIID 3L3KB 3UACA 2HT2C 2FLRT 3OKEB 1PW3A 1TXKA 1ZT4A 3DPBB 4K9JA 4OFYD 4QRUA 3E8UL 1XGQB 5BOZG 5G5DA 3P75A 1U8MB 1S3KL 3CV5A 4Y4FD 3RY5A 1KB5H 4JI3Q 2AAVA 3C8HA 4UV4H 4WNSA 4J5VA 4WI3A 1PLAA 3PMFA 4F7EB 2FT6A 4GRLB 4LO9A 4MZIA 3BYYB 4UT7H 3JWDL 1SHMA 1NEZG 4JKKA 2QTVA 4DK1A 5E08H 3CU1A 2NVYB 1SN0A 3VJ6B 1GGTA 1N0LA 3JYCA 3S1MB 2K8MA 2C34A 4XNUL 3EBEA 3ZTNL 4OLVH 5BO0D 2X2IA 3MV11 3WENA 4LLMB 5I1CH 43C9B 3OLGA 3UDGA 2Z65C 3BH8B 1RUPH 5ESQB 3T0EB 1EXGA 1I9RH 3MRHA 5FUCC 4QHKI 1W8EA 1XR8A 4CKBA 1XL4A 4KK7A 4IIQB 1OY3B 4L5RC 2ZWNA 3MRKA 4J3WA 4UM8A 5CWSA 1PG7L 3BW9A 3QYCA 5I1GH 1TWHH 1MXGA 3ZHLA 3RL1B 2P28B 2ZTDA 1KN2H 1T2QH 4O4YH 3M7NA 2VLJB 1JF1A 1GKHA 3QJHA 4TVUA 1Y6NR 2IMMA 3RWJB 4HLZH 2X6MA 3QDMB 3SBRA 1E42A 4AX3A 4DZ8A 3I4NB 3TFKC 1B4RA 1C9OA 1LWJA 1TS2A 3P4MB 3TP5A 1EFXA 1RUML 5E8PA 5CSZB 1B4TA</