3S2HH

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s2hH00
2RCNA 4YY3L 3T1HQ 4A93G 1WCMH 3RN5A 2FXQA 4HIDA 5C4XH 3BJUA 2B3GA 3PF5A 2ZTCA 1L1OA 2N8NA 3S1RH 5C0XI 1N8RC 1QVGA 1HNWQ 1BKBA 1JMCA 2UUCQ 3F1ZA 4BBSH 4DV1L 4B3MQ 1UE1A 1CSQA 1EQRA 1A8VA 1OXTA 5C0XG 3FHWA 2K14A 3FKIH 1TWAH 3RLNA 4OX9Q 2Z6KA 1Y1VH 1VQJA 3MEFA 1JJ2A 5BR8Q 1G291 2OCEA 4JBKA 1PH2A 1VQ8A 4L5SA 5M5XH 4JYAQ 1BBWA 1P8LA 4JI4L 5FJ8G 4LF4Q 2F52A 1SR3A 1PH8A 3J81i 4IO9A 1XMQQ 4DR1L 4LF5L 2R92G 1NBWA 5FLMG 1V43A 2Y0SE 4GLXA 3KF6A 1C9OA 2UU9Q 3KFUA 4DR7Q 2JEBI 1K3RA 3PUXA 1VQ7A 3HKZG 1SLJA 3F2CA 4DV7Q 1VQMA 1L0WA 2VQFL 4QL5A 3T1HL 3CCRA 4X66L 2JA7H 3S24A 5AJ3L 5M5YH 2L15A 4AYBE 2OWOA 4LFCQ 1W3SA 1HNWL 2K5NA 4GNXC 2E2IH 2UUCL 3T1YQ 4DUZQ 2D0PA 3U50C 4DR3Q 4B3ML 3S1QH 4DPGA 2PI2A 3L7ZC 2N3SA 5JEAG 4WJ4A 3D31A 4OX9L 3W1GA 2YTXA 3KJOA 2R6GA 1E1OA 5BR8L 2QEXA 2WAQG 4GKKQ 2EXDA 2I0QA 2K4KA 4JYAL 1QUQA 4MZ9A 1L1OB 1PYSB 4UP7A 4LF4L 1XPOA 3NBHB 3S2HH 4JCVE 1TWCH 3UDXA 2E2JH 3GTOH 1XMQL 3ICEA 4A3LH 3HOVG 4IJLA 3L2PA 1Q82C 4DR7L 1PH1A 2KBNA 3PV0A 4DV7L 4YHHQ 5C4XG 5LMNQ 1HZCA 1ASZA 1SROA 5M3FH 2RHSB 1XMOQ 1AE2A 2OQKA 2WB1E 4LUVA 3TS0A 2LXKA 1FVIA 3G48A 4KHZA 4ME3A 3UE1A 3CCJA 2OTJA 2YTYA 5DLQE 4LFCL 3A0JA 1N33Q 1VQFA 1AH9A 4LW1A 3H15A 3RZDH 1CSPA 5IY0A 4AQYQ 1XPUA 3JAMi 3RLFA 1PH6A 1FJGQ 4PZ6A 3FKIG 1MJEA 3KF6B 4OWTB 4H02A 2JA6G 1Y1VG 2ZM6L 5JJKA 1IBLQ 5IE8A 4C3JH 1GKHA 3CPFA 4IJHA 4C3HH 3PUVA 5C44H 1VQKA 5C0XJ 2NZOA 4IPDA 3TQYA 1ASYA 1HZ9A 4OWWB 3J7ZC 3E0EA 4HIKA 1PH5A 2LSSA 1NY4A 1YJ9A 3KYHC 3E9IA 1K83H 2N78A 3I4OA 4HIOA 4DR5Q 4BY7H 1DGSA 5EAYA 2ID0A 4JI1Q 2JA7G 2EIFA 1OXSC 1XMOL 4UP8A 2LXJA 1EWIA 1EIYB 1N9WA 2UXBQ 2IY5B 4YY3Q 4B3SL 2I5LX 4A3IH 1S40A 4IPCA 1QUQB 2AHOB 3HOYH 4JBMA 1O7IA 1N33L 1KIXA 4L5RC 4A3MH 2HHHQ 3CMEA 3I2ZA 4HJ7A 1FJGL 5GAGC 3CC2A 1OXXK 4HJ8A 1E3PA 4X62L 3G4SA 3JC66 3B6YA 3UDIA 2KENA 3FP9A 3M4QA 3SGIA 1VS0A 1YITA 1IBLL 1JJCB 3M4PA 4O2DA 3KJPA 1KL9A 4P72A 1XJVA 4NXMQ 2WFWA 1HNZL 1WYDA 2MQHA 4O0AA 4A3LG 1OXUA 5M3MH 3HOZH 4DR6Q 3GTMH 4KLKA 3PUZA 3K0XA 1N36Q 4KI0A 5M3FG 2NN6I 4DR5L 4JI1L 4DR1Q 4LF5Q 3IRBA 1CKOA 4POGA 3RN2A 1S72A 5FLXc 1BVSA 1VQGA 4QGUA 5IYDH 2UXBL 2VQEL 2NN6G 2B29A 3I4MH 3UE0A 4X66Q 3PO3H 4JG2A 1K0RA 5AJ3Q 1C7YA 2HIXA 2HHHL 3DM3A 3GTPH 1WJJA 3BZCA 3M4OH 1L2FA 4DV6Q 4R1JA 4DUYL 2YV5A 5C44G 3KLWA 4JI6Q 1XNQL 3STBC 4RMFA 4A3GH 4L5TA 4XTCS 1H95A 2ZTEA 4A3KH 1Q46A 1X6OA 2K52A 4UPAA 3KDFA 3HOWH 1GO3E 3I7FA 1RL2A 4A3FH 4NXML 1IBMQ 1BBUA 2JA6H 2CWPA 3GO5A 3MXNB 4JOIC 1VCIA 4DR6L 4LNQA 2GN5A 2CQOA 3ULPA 4DR2Q 1PHJA 3GTLH 4BY7G 4BBRH 3HKSA 3K7UC 1PFSA 4QJFA 1N36L 1HNXQ 1I94Q 4LFBL 1C0AA 1U5KA 4YWLA 3CMAA 3S1MH 4P74A 1Q12A 3Q8DA 4PG3A 4A3IG 3HOYG 3TRZA 4ALPA 1TWHH 2HIVA 3HKZE 4A3MG 3A5ZB 3ER0A 2VY3A 3PF4A 4YWKA 3GDEA 5C4JH 4RG1A 4NPSA 4DV3L 1X56A 1GM5A 2R7DA 2IHEA 1JE5A 4QQBX 2AWOA 2JA5H 2BH2A 2Q2TA 4JI3Q 1J5EQ 2KCMA 4DV6L 1Z9FA 2Q2HA 4LFAQ 4JI6L 1WOCA 3STBD 1UEBA 2JE6I 3CCQA 3BU2A 2ZM6Q 2R93H 2KHIA 1IYJB 4X64L 2ASBA 1QZGA 5M3MG 3HOZG 1IBML 2IX1A 1YJNA 3NEMA 3CCUA 2ES2A 1YEZA 1HR0W 3CC7A 4R4QA 1UWVA 4YCUA 4X6AH 2WAQE 4DR2L 2KHJA 4EX5A 4FDBA 1HNXL 1R9TH 1E7ZA 1I94L 4B3RQ 1IBKL 4MTNA 4OWXB 1Q81C 5IYDG 4P73A 4PZ7A 2Z0SA 1KRSA 4TVAB 1L1OC 3I4MG 1VQDA 4BXXH 2ZJPA 3J7A5 3KDFB 3PO3G 4LF8Q 1W2BA 2UXCQ 1YJWA 2VS1A 4LF9L 3TEHB 1KXLA 4A4IA 2OQ0A 4B3SQ 2DUDA 2MO0A 4JI7Q 4A3CH 1VQAA 4NB3A 2ALYB 1D7QA 4JI3L 3OYYA 5J3BA 1J5EL 1K9MC 4A3GG 4C3IH 1CKMA 3M7NA 4IOAA 4A3KG 1PVOA 1QVCA 3G71A 4LFAL 3KF8B 3F2DA 3ERSX 3HOWG 4A3FG 1VQ4A 4X62Q 1VQOA 3LGJA 4A75A 4YWMA 4MNOA 2D0OA 3NELA 4GN5A 1K8GA 4UP9A 1YHQA 2A19A 4BBRG 1HZAA 3J80c 4R4IA 4HJAA 1HNZQ 4BA2I 1V9PA 3U4ZA 5IYBG 1S3OA 1SRUA 3HOXG 4LUZA 2ZJRA 4B3RL 3AYHB 1E24A 3H0GH 5GROA 3GTQH 4OXPA 3CPWA 3CXCA 1KC8C 4C2MH 1NJIC 4LF6Q 4JC0A 2C35B 5LMUL 1U0LA 5C3EH 1QZHA 3BZKA 3CC4A 4GLVB 1XNRQ 2D62A 4LF8L 4A3DH 3CCEA 1FL0A 2UXCL 2JA5G 4Y7NH 2VQEQ 4JI7L 2BH8A 4IFDI 1X3EA 1HZBA 4JBWA 3DLLA 3CCLA 1X3GA 1PH3A 3F8TA 2R93G 3RR5A 3CQZH 3E9HA 1K73C 5GAHC 4A3EH 4DUYQ 1Y14B 3ZJYC 5E7NA 1XNQQ 4DNIA 1N34L 1PH9A 2OTLA 3L0OA 2VUMH 4DAYB 1YHBA 4YCVA 2AKWB 4JOIA 3EN2A 1Q8KA 4R4CA 2H5XA 1B70B 4B3TL 4GOPC 3W1BA 3I56A 3ULLA 4A3BH 1NTGA 4BXXG 1I50H 1Q1BA 1SE8A 3VDYA 1CUKA 4LFBQ 4LF7L 4LF6L 3U58A 2VL6A 3CCMA 1JJGA 3UDFA 2E5LQ 4GKJQ 1OTCA 1XNRL 4IPHA 2I5MX 4A3CG 3EBEA 2CCZA 1VQEA 3S1NH 3AFQA 1KRTA 1CKNA 3A74A 1HR0Q 3GTGH 3I4NH 2WP8J 3W5OA 4HJ5A 5LMNW 4AIMA 4HIMA 2QGQA 2JJQA 4DV3Q 3J81c 4GNXA 2F4VQ 2PQAA 4P71A 3F2BA 3HOUH 3GD7A 3PIPA 4YCWA 2UXDQ 1KHIA 1X3FA 4JI2Q 1WI5A 3WWVA 3NENA 5IWAL 4POFA 4X64Q 3CCSA 1PH7A 1IZ6A 1Y1WG 3H0GG 3PUYA 1TWGH 4A76A 4OONA 4Y52H 1X9NA 2JA9A 1EYGA 4BY1H 5C3EG 4QIWE 1IXRA 1EUJA 2NVTH 4DV5Q 4A3DG 1EOVA 2MFIA 5IYBH 1SMXA 3HOXH 1PH4A 1IBKQ 4KHPQ 2E5LL 2ZJQA 1UE6A 4GKJL 1M90C 3M85A 1KAWA 1VQPA 2K5VA 5IT9c 4NXNQ 1D8LA 1HR0L 5ELNA 4LUOA 2QA4A 4DR4L 1JT8A 1TWFH 4LF9Q 1YHAA 3AEVA 2VW9A 2CKZB 4GN3B 4R4TA 1G51A 4A3EG 3PCOB 1EFWA 5IP9H 2F4VL 4K0KL 3K8AA 2R7ZH 3H3VI 3K80C 4JV5L 2UXDL 1UE7A 2VUMG 1N32Q 3CP0A 2BA0A 1MJCA 1UE5A 1NE3A 1MKHA 4GN4B 4JI2L 1VQHA 4PMWA 1Q7YC 4X65Q 1LYLA 3TS2A 2Y0SG 4APVA 4OO1G 1G6PA 4IFDJ 3AQQA 1CKNB 3CCVA 1K8AC 1M1KC 1B8AA 4A3BG 3D0FA 4GS3A 1HJPA 1I3QH 2BA1A 2NVXH 5GAEC 3RLOA 4GNXB 3K81C 2PQAB 3JAMc 5IP7H 4DV5L 1RIPA 4AYBG 3S15H 4KHPL 3GTKH 3AFPA 4P75A 2ZTDA 4JI0Q 3I4NG 1T9HA 2CFMA 1YBYA 5LMUQ 4NXNL 3ULJA 1GD7A 1VQNA 1YIJA 1AE3A 4LWCA 1SFOH 2XGTA 4JI8Q 1Z47A 3HOUG 2PNHA 2AMCB 2MNAA 2JEAI 4OO1I 2HQLA 1TXYA 4R4OA 5K36G 4QY7A 2CWAA 1IL2A 2Z6KC 1N32L 4DV4Q 2GVAA 2VNUD 1YNXA 4JI5Q 1NMGA 2F3IA 2K50A 4X65L 1YI2A 3G6EA 1Q1EA 3J81j 1X55A 4A3JH 3S17H 1X54A 2UUAQ 3CAMA 1N34Q 1A62A 3M3YH 2K75A 1EQQA 2N49A 3HFZB 4JBJA 1PA6A 2UU9L 2JA8H 4BY1G 4DV2Q 4GOPA 4WJ3M 1WCMG 1HH2P 2PMZE 5IYCH 4B3TQ 1YZ6A 1I6HH 2WB1G 3PO2H 1NMFA 1Y1WH 1E1TA 4DAMA 2B63H 2NVYH 5GQOA 5HY6A 4IOCA 1E22A 2RHQB 4JI0L 4L5QA 4LF7Q 4TQUS 4DV0Q 4A93H 4BA1I 2Q2IA 3T1YL 4UY8C 1J6QA 2GVBA 4DUZL 4DR3L 4BBSG 2RF4A 3OTOQ 5IP9G 4JI8L 2R7ZG 2E8GA 4IPGA 3OW2A 1QVFA 1MIUA 5H1SE 1LUZA 2E2HH 2R7FA 1KQSA 1VQ9A 4GKKL 3U4VA 4EQ5A 4DV4L 2DGYA 3CF5A 3PGZA 2I5HA 4JI5L 4IFDG 2UUBQ 4AH6A 2NVQH 2UUAL 1B7YB 2NZHA 2VZAA 5IWAQ 3K7AH 3GTJH 5FJ8H 4DV2L 1JB7A 5JJIA 1I5FA 5IP7G 3TREA 4YHHL 5LMNL 1XTDA 4J15A 3PIOA 2IT1A 3H3VH 1Q86C 2R92H 5FLMH 1SN8A 2YU9H 1VQIA 1X65A 1FGUA 1OXVA 5ELOA 1GVPA 5GADC 2HT1A 3I55A 2ATWA 2PI2E 1A63A 1VQCA 4DKAC 3EIVA 1YVCA 2IHFA 3CW2C 4DV0L 3J80i 5M5WH 2A8VA 3RNUA 4AQYL 1A0IA 1VQLA 1WFQA 1P16A 3M9BA 1VQ5A 3A5UA 3OTOL 3RZOH 2V1CC 4XIGS 4GOPB 2KCTA 4DV1Q 1KD1C 1PYBA 1LM0A 3PUWA 3CD6A 1PV4A 4DR4Q 2IX0A 4DK6C 2XTIA 4PZ8A 2YYZA 4DK3C 4K0KQ 2YTVA 5JEAJ 3S14H 4A3JG 3KOJA 4JV5Q 1V1QA 2JK8A 2Q2UA 2UUBL 4JI4Q 2JA8G 1EIFA 5IYCG 2JQOA 1VQBA 5JJLA 4GLAC 4HJ9A 3PO2G 1XPRA 2VQFQ 2B63G 2AWNA 5HGQA 2MO1A 3S16H 1VQ6A 1LTLA 2EQSA 3HOVH 3PSIA 2A1AA 2K5HA 3S2DH 3UDGA
chains in the Genus database with same CATH superfamily
4I65A 3PF5A 2PCFB 3H3VC 1EY7A 1QVGA 1A15A 1JMCA 5I2XA 2IX3A 5EPJA 4FF4A 1H9JA 1UEAB 2F0NA 5ISRA 1CSQA 2HQEA 5BN4A 1A8VA 1OXTA 5C0XG 3FHWA 1TWAH 1VQJA 1D2BA 5IGGA 2LY7A 5KYLA 3A54A 4JYAQ 4JI4L 3GTMB 2F52A 1XMQQ 4DR1L 1G8ZD 2UU9Q 4DR7Q 1VQMA 1EIHA 4QL5A 4QF4A 1WVLA 3I4MB 1II3A 4IUTA 2JA7H 1KTKA 1RTOA 3S24A 3KBXA 5AJ3L 4AYBE 4UAIA 1W3SA 2K5NA 1U9RA 4DUZQ 3U50C 1IW7C 1KAAA 5ELCA 1Y8NB 1HA6A 2PI2A 5JEAG 5LL6X 4A3FB 2R6GA 1D1IA 5E4WC 5CV7A 2I0QA 2NBFA 1XPOA 3J80L 4JCVE 2VB2X 1Z7TA 3HOVG 1MGSA 4CGYB 1Q82C 3S1MB 2MUYA 3PV0A 4QMGA 4DV7L 1EWCA 5C4XG 5LMNQ 1ASZA 2RHSB 1XX8A 2EVBA 2F1MA 4DXFA 2OQKA 4LUVA 4DA2A 3G48A 2WIIB 5DLQE 1N33Q 4LFCL 1VQFA 2NN6H 4LW1A 3H15A 1CSPA 4AQYQ 1MSHA 3JAMi 3RLFA 1PH6A 3SXHA 1Y1VG 3K5LA 1EYDA 3K58A 3PUVA 2FFKB 1BNZA 1EQTA 3C1EA 2NZOA 3OIQA 3TQYA 4ZK9B 4OWWB 2LSSA 5JVH3 1ZEQX 2G9DA 1HUNA 2Z4IA 1K8MA 4HIOA 1DGSA 4JI1Q 4ZKBB 1S5CD 2LXJA 1PMRA 1N9WA 2UXBQ 1DOLA 1S40A 2MGSA 1IHZA 5EKIA 4L5RC 4A3MH 1KABA 1F2ZA 2HHHQ 3OWEB 3SR1A 3P75A 4KMUC 5KNBA 4HJ8A 2KCNA 2J4XA 4F8MA 3FP9A 1X3QA 2C9OA 1JJCB 2N88A 4O2DA 3KJPA 1SSOA 1XJVA 2NZ1D 3FVQA 4CJ2C 1IYUA 3LWEA 1Y1WB 3T4AC 2NVYB 4KLKA 3PUZA 3H0GB 2QKIC 1N36Q 2RVLA 4LF5Q 5DNFA 4Y7NB 1CI3M 1YNJD 1STEA 5IT9L 4C3IG 3UE0A 3PO3H 3P20A 1RKNA 1K0RA 3BZCA 2EJGC 3SDZA 2F0VA 4DV6Q 4R1JA 4A3EB 3E0JA 4A3GH 1NUCA 4ABNA 4RMFA 1H95A 4FF1A 2ZTEA 4UPAA 4DN4M 5CBAE 3KDFA 3M7GA 1ZKOA 1B44D 3I70A 3SK6A 2JA6H 3GO5A 4G4KA 4KY5A 4DR6L 4ZRZA 2K32A 3K6OA 1PHJA 4BY7G 4FF2A 1I50B 1SBBB 1C0AA 1PFSA 1S5DD 4LFBL 3JAML 5AFWA 3N52A 1U5KA 2EYOA 5CV9A 4YWLA 1Q12A 3Q8DA 4AYBB 1PDQA 3S1NB 1O7LA 1TIID 1TWHH 3ER0A 2VY3A 3PF4A 4YWKA 4XQQA 1GM5A 4QQBX 2IHEA 1JE5A 2AQ3B 2AUKA 4JI3Q 4RGOS 2BDOA 4FXDA 1PZKD 2KCMA 4CDEC 1VF7A 4LFAQ 1SXTA 4JI6L 1UEBA 2ENBA 2JE6I 4XT1B 4IUNA 1MHWC 1F2YA 2F0PA 3I72A 2KHIA 2ZM6Q 1PTOF 2CQAA 4CKBA 4DF7A 2PZTA 1BDOA 1JWMD 1YEZA 1ICFB 1HUMA 1G91A 3GV3A 3CC7A 2CH4W 1TS3A 2WAQE 4DR2L 4BY1B 4DGZA 4FDBA 1IBKL 3BYTB 1V8QA 3CHBD 2IPKD 4BXXH 3I4MG 1JWUD 4LF8Q 2SOBA 2UXCQ 1TWFB 2J0TD 4HMJA 4A4IA 4A3CH 1FYCA 4RA8A 4B3SQ 2F0DA 3NP8A 1GUWA 1EL0A 1QVCA 1FNUA 3SEBA 4A3FG 4X3TA 1VQ4A 1VQOA 3U9SA 3LGJA 2FMCA 4GN5A 1GUOA 4UP9A 1TU2B 4HCEA 1YHQA 1A3TA 1EQVA 2SDFA 4DXGA 1S3OA 4LUZA 2ZJRA 2KJXA 4B3RL 2JA7B 2Z4HA 3CPWA 4CJ1B 4C2MH 4LF6Q 1PFNA 3CC4A 3BZKA 1SAPA 3NE5B 3AU7A 1YNJC 2BH8A 4IFDI 1G6ZA 3RR5A 2B2TA 2RDGA 1Y14B 1WD1A 1XNQQ 4A3JB 1HFNA 4DNIA 2VUMH 1B9MA 1Q8KA 2H5XA 3Q6SA 3PO2B 4Z9CB 1PZID 1GOZA 1NTGA 1SE8A 3NWSA 4LF7L 1D5ZC 2VL6A 1HHVA 3UDFA 2E5LQ 1OTCA 4IPHA 4QB4A 3MFGA 3BS1A 1BCPF 1AEXA 4ID6A 5LMNW 3NXWA 1NAPA 4P71A 3SK4A 2P5ZX 1W6JA 5KEEA 3W2DA 4JI2Q 2NVQB 3NENA 5IWAL 5FO9B 1Y1WG 3H0GG 3PUYA 1LACA 3F2UA 1CA5A 2L11A 3SE0A 1EUJA 3FRPB 4DV5Q 3HOXH 4KHPQ 2ZJQA 1UE6A 4NW2A 1KAWA 1D8LA 1HR0L 4LUOA 2JSOA 4ILWA 4L6TB 5HURA 4R4TA 2VW9A 4A3EG 3K80C 4JV5L 5FOBB 2VB3X 2WAQB 1PTOH 2KUMA 1CKNB 2HD3A 1M1KC 4IFDH 3D0FA 3S16B 1HJPA 4RH6A 2NVXH 3MXUA 4GNXB 3S2DB 2PQAB 2EYHA 1RIPA 4AYBG 1ICWA 3S1RB 3AFPA 3J80E 2ZTDA 4JI0Q 1DYQA 2E2DC 3H91A 1VQNA 1SFOH 3HOUG 1Z47A 4J1MA 2MNAA 2JEAI 3HGBA 1TXYA 2JA6B 4ZQ3A 1V1PA 1KDBA 1S5ED 5M5XB 4RHSA 5IGCA 2VNUD 2A69D 4N8X1 4OO1G 1YI2A 3S17H 3G6EA 3VA7A 2UUAQ 4JBJA 4ZLTF 4BY1G 3DM1A 2IWHA 4F87A 5IYCH 1I6HH 3KUPA 1MBYA 1E1TA 5GQOA 5HY6A 1E22A 1LTBD 2Q2IA 4UY8C 4OIKA 2PNRC 1EY0A 1QB5D 3EA6A 3OTOQ 2E8GA 3OW2A 1LTRD 5FK9C 3Q22A 1JOKA 3EVQA 5EBDA 2E2HH 4G7OC 2R7FA 4GKKL 3J7AF 3C46A 4EQ5A 4DK0A 1L0YB 2R61A 3DEOA 3K7AH 5FJ8H 1T5EA 5IP7G 2R92H 3IL8A 1VQIA 5FLXL 4GZYC 5DM73 5ELOA 5GADC 1J8IA 3I55A 1A63A 3NHHA 1VQCA 4DKAC 4X3KA 1BBXC 2A8VA 3H6MA 1DOMA 4PMBA 3Q23A 1VQ5A 1BOSA 2PW7A 3RZOH 4XIGS 2KCTA 1PYBA 1LM0A 4C3JB 4DK6C 1B1ZA 4OHJA 3NTHA 1AP0A 2YTVA 2XRQD 3LX0A 4A3JG 2JK8A 1NNXA 4JI4Q 2JA8G 4E6IA 1GHJA 1K83B 2JQOA 4C2MB 3PO2G 1E0BA 5HGQA 5JPMC 1LTLA 3JC66 3SK5A 2RCNA 4KHVA 4YY3L 3HOYB 2ZTCA 1EY4A 3AMUA 1LABA 5IGDA 3JAME 1BKBA 3F1ZA 1EY6A 2X6GA 4ZKCB 1CM9A 1EQRA 1NCVA 4LAAA 4DAPA 2K14A 2OCEA 1SDFA 4L5SA 5M3MB 3HOZB 4UHVA 1BBWA 3T56B 3OMCA 2RA4A 2A5HA 2ICIA 1SR3A 1PH8A 3J81i 2KCCA 5KYIA 1NBWA 1PRTF 1V43A 2Y0SE 3DMUA 5FLMG 1C9OA 3KFUA 5FKAC 5F2DA 3PUXA 1I4XA 5CV5A 4DV7Q 1ENCA 1HPCA 1WTPA 1I4GA 2NTSA 3GTPB 2CVRA 2L15A 4TKOB 2OWOA 4LFCQ 1NR2A 2E2IH 2UUCL 3T1YQ 4DR3Q 3L7ZC 2B8GA 2N3SA 4KD3A 2F0KA 4WJ4A 3D31A 5C5LA 4OX9L 1CQVA 5BR8L 2WAQG 3ZYYX 4MZ9A 1L1OB 1PYSB 4UP7A 1F9PA 3GTLB 4BBRB 3UDXA 2E2JH 1Q8IA 5CBEE 1LTID 2XRSD 3HOXB 1PH1A 2L55A 1HZCA 1SROA 5M3FH 4IUVA 4CDFC 1LT6D 3U9OA 3RMHA 2A6HC 4KHZA 1E2WA 2JA5B 2B2VA 1AH9A 5IY0A 1XPUA 5J22A 3FKIG 2HDLA 1QG7A 3NTIA 2JA6G 2R93B 5JJKA 1GKHA 4IQZA 4C3HH 5C44H 4B9XA 1SNQA 3WOFA 5C0XJ 1HZ9A 4KN7C 5K5PA 3J7ZC 4IUPA 2B39A 5ELBA 1R9TB 2F0JA 3KYHC 3ERQA 3I4OA 1V1OA 5EAYA 2ID0A 4ZAIA 1OXSC 1XMOL 3DWQA 4A3IH 1TQOA 4CJ0B 1PFMA 3I2ZA 3J81L 4HJ7A 1U4PA 1ZYRD 1E3PA 1PZJD 3B6YA 3UDIA 4ODGA 3SGIA 1GUGA 1YITA 1KL9A 4PQXA 1KDAA 4KJNA 1HNZL 1I6HB 3QIAA 4A3LG 5IGEA 4DR6Q 2A6EC 3D6CA 1FR3A 4V0BA 4KI0A 2NN6I 4DR5L 1C4QA 5KIXA 3IRBA 4POGA 5M9OA 1YNND 5C3EB 1S72A 4A3DB 2BDNA 5IYDH 2PZUA 2B29A 2RQXA 2F0EA 4X66Q 1GHKA 5D14A 1WJJA 2DNEA 1L2FA 4C3JG 2B8FA 5I4DA 4JI6Q 5C4HA 3STBC 4XTCS 4A3KH 1Q46A 4K5XA 3K7AB 3HOWH 3P7JA 1GO3E 3MAQA 4J8QA 5FO7B 4JOIC 2Y0SB 1VCIA 1VMPA 4DR2Q 3IFTA 4A3BB 4G57A 1UUPA 3CMAA 1EFID 4K2KA 4P74A 3HOYG 2QCPX 4ALPA 1HXYD 5EBCA 3GTGB 5CV6A 5JVG3 1QJOA 2IL8A 3MXGA 5C4JH 2MPMA 4RG1A 4NPSA 2R7DA 3MZ5A 2BH2A 3A7LA 2LKVA 5LHY1 2B2YC 1Z9FA 2Q2HA 5JJZA 1ML0D 2B2WC 2A74C 1Y69U 4X64L 1IYJB 1SYCA 2ASBA 5M3MG 1SE2A 3HOZG 4XXEA 3NEMA 3CCUA 2Q8RE 1UWVA 4H44C 2K5QA 2PO4A 2Z9HA 3CRKC 2JP1A 3FPUB 4BWGB 1E7ZA 4EX5A 4B3RQ 1ZXTA 4OWXB 1BQQT 4RKLA 4QCLA 4TVAB 4Q5VA 1HTPA 1VQDA 4O42A 4RHRA 3J7A5 4KJOA 1HTLD 2DUDA 1O80A 4B08A 2ALYB 1A2UA 1D7QA 3OYYA 1J5EL 2R7ZB 3M7NA 4IOAA 1PVOA 4DNRB 2DNCA 3F2DA 4FVMA 1ZYRC 4DNTB 1EU3A 4X62Q 3RUZA 2EJFC 2R3ZA 4MNOA 4FO2A 5BN3A 1I3QB 4BBRG 3J80c 4R4IA 3U4ZA 3HOXG 2MHVA 3TP6A 5CYUA 3AYHB 1E24A 1HQRD 5GROA 3GTQH 1CK1A 3GP7A 2HUGA 2C35B 5LMUL 1YNNC 3M4YA 4GLVB 1CZGA 1FL0A 4HSVA 2JA5G 1LT5D 2VQEQ 3A8KE 1HZBA 4JBWA 2IJ0A 5FLXE 1NR4A 2R93G 3CQZH 3E9HA 3I91A 4DUYQ 3V05A 2BOSA 1IKMA 2SNMA 2X6LA 3L0OA 2OTLA 4DAYB 1YHBA 2BE5D 4YCVA 3M3YB 1QNKA 5ELDA 2B2UC 1IYVA 4R4CA 4B3TL 1SYEA 4GOPC 4C1NI 4IUQA 1SYFA 3I56A 2B63B 1Q1BA 1QILA 4A93B 3ND9A 2I5MX 3DXJC 3TP5A 1CKNA 2NYZD 1HR0Q 3I4NH 2ICEC 3W5OA 4C3HB 3HS0C 2QGQA 4DV3Q 4GNXA 2EYMA 2HDMA 2PQAA 3HZXA 3PIPA 5E4XA 1KLUD 5C4ZA 3A7AB 1TVXA 5K36H 1KHIA 1DD2A 3J7AV 4HTHA 4L63B 2NTTA 1IZ6A 1EY5A 4FYDA 4JPBW 2RBMA 4Y52H 1X9NA 2YU9B 1LTSD 5TSSA 4A3IB 1H9SB 5C3EG 1I6VC 2NVTH 4A3DG 1SMXA 2EJMA 5M5WB 3M85A 1VQPA 5I2YA 5IT9c 3RD4A 2QILA 1LT3D 5ELNA 4DR4L 4IUUA 1JT8A 1G2SA 4EVOA 4LF9Q 1TT2A 3C2PA 3AEVA 4BBSH 2CKZB 1UNSA 1G51A 5I9OA 4K0KL 5IP9H 3K8AA 2EY5A 2RKSA 2UXDL 2BCOA 1A6XA 1NE3A 3PQIA 4GN4B 4PMWA 1Q7YC 4RCNA 3TS2A 2Y0SG 1K0SA 1G6PA 3NTKA 2KEDA 1LTAD 4A3BG 4I7ZC 5GAEC 3RLOA 3K81C 4XYOA 3JAMc 3QWNA 2QF7A 2OT2A 3S15H 1U4LA 3GTKH 1T9HA 2E74C 2TMPA 3NSWA 1YIJA 3OHXC 4LWCA 2F0LA 2AMCB 3HOWB 2DY8A 3MEHA 1TWAB 3NQTA 1F9QA 2AQ2B 1CT1D 2HQLA 4Q0FA 4R4OA 1JR0D 3T13A 2Z6KC 1N32L 2EE1A 3C3LA 1D1KA 1NMGA 2F3IA 2K50A 1Q1EA 3J81j 1WTVA 1X54A 1N34Q 2Q8TA 2N49A 2BE5C 3HFZB 2UU9L 4PMCA 2PMZE 2KQ3A 3MTSA 4PV1C 4EQOA 4L5QA 1AZPA 3P1HA 4DUZL 2GVBA 2EYJA 2RF4A 3MC0B 2R7ZG 2HCIA 4XYQA 3VR4A 1MIUA 3EJIA 1PXUA 4KK7A 3U4VA 3CF5A 2I5HA 1B9NA 1VMCA 3J81E 1MD2D 1B7YB 2MP1A 3CU7A 3QG1A 3GTJH 1JB7A 1I5FA 3MA2B 5LMNL 1XTDA 3PIOA 2XN9C 1I4PA 1PTOD 1SN8A 4R9WA 1X65A 1FGUA 1OXVA 4KV6A 3VR2A 3EIVA 3RNUA 4AQYL 1VQLA 4I7AA 4GOPB 3KK7A 4DFAA 1AN8A 1L0XB 4PZ8A 5C3XA 4G7HC 2EPBA 3S14H 1B3QA 5JEAH 2F0TA 1V1QA 2Q2UA 1TY0A 2UUBL 1EIFA 4GLAC 4HJ9A 1H9RA 2VQFQ 2B63G 1F9RA 2F0WA 2MO1A 3SHLA 3HOVH 2K5HA 3NUCA 4A93G 1WCMH 3RN5A 2FXQA 1DXMA 2EOTA 2NWGA 2K33A 5C4XH 2B3GA 2DJGC 1L1OA 4A3MB 1SNOA 4RAUC 2DY7A 3CQZB 1DOKA 1JOQA 2UUCQ 1EZ6A 4DV1L 1UE1A 2KOLA 1LTTD 3RLNA 4OX9Q 2XIWA 1Y1VH 3MEFA 1JJ2A 1SNPA 3T51B 5BR8Q 3MXPA 4JBKA 1VQ8A 3S9WA 1P8LA 2L5TA 3BZDB 3D4RA 1CHQD 2AUJD 4LF5L 1VQ7A 1K3RA 1SLJA 2F03A 1L0WA 3T1HL 1XXGA 3T53B 3PO3B 4H13C 5M5YH 1TR5A 4ZUIA 1HNWL 1O7ZA 1DCZA 3S1QH 4A3GB 4B3ML 4V190 4DPGA 2K28A 2O5JC 2FMMA 3W1GA 2YTXA 2EY6A 2QEXA 2K4KA 3EQLC 1C8CA 2PMZB 4LF4L 4K5WA 3NBHB 3S2HH 1TWCH 3GTOH 4BS9A 4XQNA 1U4MA 4EQPA 4QUCA 1D5XC 4IJLA 3L2PA 2Z1CA 4TRDA 3K59A 2KBNA 4YHHQ 3R8BA 1TWHB 3TZUA 1XMOQ 1PTOC 2WB1E 3TS0A 3UE1A 1FVIA 1MI2A 4R8NA 1VDZA 1JQYD 4RWSC 3QJYA 1EEFD 3E5SA 4QUFA 3RZDH 4FP5D 2D9UA 2L0CA 4PZ6A 3KF6B 4K6DA 1RJTA 4H02A 2JN4A 2ZM6L 3VYRA 3IFDA 4IJHA 3NQIA 2K05A 1VQKA 1O7YA 1GUTA 4IPDA 1ASYA 3W3AA 3E9IA 3S15B 1HA5A 2DJFC 2N78A 4DR5Q 4BY7H 1TS5A 2JA7G 3BVGA 1EY9A 2EIFA 4HR7B 5G3LF 1EWIA 1Y8OB 2A6HD 4B3SL 2I5LX 5L37A 4IPCA 1QUQB 5EPKA 4JBMA 4XT3B 1KIXA 4FXKC 3D4WA 2QW7A 2K01A 1U4RA 1FJGL 5GAGC 4NMZA 3CC2A 3G4SA 3A55A 2G5DA 1IBLL 2KENA 1VS0A 1JICA 2F0GA 4P72A 5IT9E 3T16A 2WFWA 1WYDA 2MQHA 3GTMH 4N8FA 4DR1Q 5E3FA 1TY2A 1NSNS 3RN2A 5FLXc 1BVSA 1VQGA 3EROA 5KRUA 4QGUA 2M00A 2NN6G 3I4MH 3QB3A 4WORA 5AJ3Q 1RHPA 3DM3A 3M4OH 5A2QL 4ULLA 3ITPA 1ET9A 2SEBD 4C1NK 4F7XA 3KLWA 1XNQL 2XVSA 4L5TA 1WTXA 3HP3A 2VUMB 4N9PA 3GTJB 4A3FH 2GA4B 4NXML 5CV8A 1BCPC 5EKKA 5T1GA 3MXNB 4KN4C 5D3IB 2A6ED 3ULPA 1CZWA 3R2IA 2RSOA 5CORA 3K7UC 1JWSD 4QJFA 5CV4A 4ZYSA 2WINB 3S1MH 5A35A 4RGMA 3FDTA 2PYKA 4U673 3HKZE 4A3MG 1EOTA 2OEOA 5HGTA 1SNMA 5D3DA 1QOHA 2LMCB 3GDEA 4OEMB 1STBA 2EYLA 3VYUA 2AWOA 2Q2TA 1WTRA 1J5EQ 2F3WA 3CRLC 4ME5A 3TSSA 3VR5A 1B50A 3STBD 1HFGA 5J39A 4P2CB 1IBML 2IX1A 2ES2A 4R4QA 1QCBD 2AQ1B 4YCUA 4HEDA 2KHJA 1WCMB 2E76C 1K8OA 1HNXL 1I94L 4K14A 2WB1B 4NP5A 1M8AA 3CKIB 2G9HD 1GUNA 3PO3G 3FMCA 3MFYA 4DAYA 3FPPA 2VS1A 1CFMA 2OQ0A 2MO0A 1VQAA 4A3GG 3D3RA 5J3BA 3URYA 4PNYA 1BXTA 1WD0A 3G71A 3G7LA 3OWFA 3KF8B 4CDCC 1PTOB 1QE6A 3VYTA 1FNWA 4LK1C 4A75A 3OIPA 2XNAC 2D0OA 3J7YW 3NELA 4K6LA 4KD4A 2NVXB 1LLRD 1V9PA 1SRUA 1JCKB 1G2TA 3H0GH 3WOEA 1SJED 1NJIC 4K8IA 2N55A 2H1EA 4YIJA 4JVZA 2D62A 1QNUA 4KY7A 5CMDA 1B2TA 4Y7NH 1SFOB 4R8IA 1PRTD 5I6YA 4HN7A 4JI7L 1X3EA 3CCLA 1C48A 1ESRA 3F8TA 1H9SA 4A3EH 1SE3A 2F0FA 3S17B 1KDCA 2LS01 4JOIA 3EN2A 5NUCA 4J6HA 3W1BA 3ULLA 4BXXG 1I50H 1QWYA 1CUKA 4LFBQ 1B53A 1AZQA 1E2ZA 4OIJA 1A3UA 3CCMA 1FD7D 2A73B 1XNRL 4A3CG 1JC7A 1VQEA 3ND8A 5IIFA 3S1NH 5CGKA 3A74A 3K5NA 1DZ1A 2Z6BA 2WP8J 4N9TA 4HJ5A 4HIMA 2E2HB 2JJQA 1W6KA 3J81c 2B2YA 1WTQA 3HOUH 3R3OA 2B2WA 2UXDQ 1ET6A 5COYA 5ELEA 2MJ8A 3NK9A 1WI5A 3PMFA 1PH7A 1WTHA 1TWGH 4OELB 1F77A 2R92B 1EYGA 4BY1H 3HKZB 4QIWE 1EOVA 5IYBH 1IBKQ 2FINB 4JW0A 3E3XA 2KA7A 4GKJL 5I9PA 3I90A 1BCPB 3RZOB 2QA4A 1M4VA 4KTAA 1TWFH 5T1IA 3AB9A 2F4VL 1EFWA 3PCOB 1UE7A 1XWEA 4RFBA 2VUMG 1N32Q 3CP0A 2BA0A 4DAVA 1UE5A 4FXGC 1MKHA 3TZDA 1VQHA 1H9KA 1LYLA 4IFDJ 3AQQA 2SNSA 1K8AC 2TSSA 4GS3A 2F0IA 5IP7H 1Q90A 4P75A 3M4OB 3Q24A 3DUZA 4NXNL 1GD7A 2F0UA 1LO5D 1PRTC 2PNHA 4OL7A 4QY7A 1OO9B 1B3AA 2D5DA 1BR9A 1YNXA 3N6RA 5EQ0A 3D8GA 4X65L 4A3JH 1J9OA 2B2UA 3CAMA 5D65A 2RDFA 1A3VA 5ELFA 1ILQA 2JA8H 4GOPA 1WCMG 4X3SA 1HH2P 1YZ6A 2WB1G 3PO2H 4F88A 1NMFA 4DAMA 3IKJA 3DHQA 3I3CA 2ZT9C 3QR8A 2L9HA 1SYBA 4LF7Q 2E2IB 1GXDC 3T1YL 4DR3L 4JI8L 4IPGA 1CQFA 2KECA 1RTNA 1QVFA 2CHBD 1BUVT 1LUZA 4MN3A 1VQ9A 4DV4L 2DGYA 4JI5L 5JPNC 4IFDG 2Z8LA 2UUBQ 2E2JB 2WACA 4AH6A 2NVQH 3V2TA 2VZAA 5IWAQ 1FNVA 2ZXPA 4DV2L 4J15A 2OXPA 3A8IE 2A68C 5M3FB 5FLMH 5J1ZA 2O4XA 5CC4A 2I07B 2HT1A 3K5OA 3SK8A 2ATWA 2PI2E 1O78A 5LL6S 2IHFA 4DV0L 3CW2C 3BG3A 4M1UB 1A0IA 1TKWB 1XTCD 1P16A 3VR6A 3M9BA 1F2LA 4CDDC 2V1CC 1KD1C 4DV1Q 3CD6A 1ENFA 1PV4A 3KLSA 5C44B 1ONLA 5IGFA 4JV5Q 3GQBA 1SYGA 3PIP3 5A2QE 3DWAA 1SMYD 1LTGD 5IYCG 4H0LC 1VQBA 3I73A 4QIWB 3VA5A 4RKBA 1XPRA 3S16H 2EQSA 2WV6D 2A1AA 3S2DH 1FGBD 3T1HQ 3HEJA 4HIDA 3BJUA 4DU9A 2N8NA 3S1RH 5C0XI 3NBHA 1N8RC 3V96A 1HNWQ 3MWYW 4B3MQ 3H94A 4H7BA 1JB3A 3G6JB 1DM0B 3FKIH 2Z6KA 1G291 3K0YA 1PH2A 1CA6A 5M5XH 4K8JA 5FJ8G 4LF4Q 2E75C 2FHTA 5FO8B 3NPPA 5JAVA 4IO9A 2R92G 2K5WA 4GLXA 3KF6A 2JEBI 4UDUC 3HKZG 1PLFA 3F2CA 2O2LD 3TMEA 2VQFL 4XQJA 3CCRA 1I4HA 3OPOA 4X66L 1AFPA 4HMIA 3MVVA 5I6WA 1VF5C 3HOUB 4GNXC 1RODA 3OW7A 5IGBA 1I4RA 2D0PA 4MHEA 4NDXA 4A3KB 3FEWX 2CW0D 1RF2D 1F9SA 3KJOA 1TS4A 1SYDA 2PPBC 1E1OA 4GKKQ 1TWGB 2EXDA 4JYAL 1QUQA 2L12A 5JOBA 2H4OA 2M2LA 2EYFA 1XMQL 3ICEA 4A3LH 1PRTB 1S4ZA 2D2CC 1D6EC 4DR7L 3C1FA 4RGNA 4K2LA 1BO0A 1LT4D 1AE2A 1A2TA 1LV9A 2LXKA 3DEPA 4ME3A 5C4JB 3CCJA 4WFN3 2OTJA 2VXWA 2YTYA 3MHBA 3A0JA 2NUCA 2Q8IB 1IKLA 4JK1C 1FJGQ 1MJEA 3E6ZX 5KNCA 4OWTB 1RCVD 4RGTA 5C3WA 1IBLQ 5IE8A 4C3JH 1STNA 3CPFA 2X69A 4K5VA 3UI2A 5C0XH 4HIKA 3E0EA 1PH5A 1NY4A 3A8JE 1YJ9A 4LJZC 1SMYC 1K83H 2K7VA 4OGQC 4HCSA 1GJXA 2NB0A 3PIO3 3OSOA 4UP8A 2EZVA 1EIYB 2IY5B 4YY3Q 2IW3A 1EU4A 3HOYH 3MXNA 2V4DA 2AHOB 1O7IA 1N33L 4ZCKA 3CMEA 2K6AA 3OOCA 1OXXK 4X62L 3M4QA 3L3OC 3M4PA 2JA8B 1I4QA 3HRZC 4NXMQ 1E2VA 4EGVA 4G7ZC 4X3UA 1IL8A 4O0AA 5IODA 1OXUA 5M3MH 3HOZH 2EDGA 3D6WA 3K57A 3GTQB 3K0XA 5M3FG 4JI1L 4HAEA 1CKOA 4DK1A 1S5BD 1SNDA 3TN2A 4IZ8A 2C5CA 2UXBL 2VQEL 1EZ8A 4JG2A 5C5MA 1C7YA 2HIXA 2HHHL 3GTPH 2F0SA 3I8ZA 5E1FA 4DUYL 4C3HG 2YV5A 5C44G 2B2TC 1K28A 3TP7A 2K52A 1X6OA 2CW0C 3I7FA 1RL2A 4KY6A 1IBMQ 1BBUA 2CWPA 1HRJA 3A56A 3R2TA 2GN5A 4LNQA 2CQOA 3GTLH 1CTMA 4BBRH 3HKSA 1N36L 5KNDA 1HNXQ 3ONAB 1I94Q 2RCFA 3KF8A 1XYIA 2F3VA 4PG3A 4A3IG 3TRZA 2DN8A 5DEHA 2HIVA 3I4NB 3BDLA 3A5ZB 1EYAA 4EQNA 4ZUJA 2LFNA 1T5XD 4DV3L 1X56A 2JA5H 2EY1A 2JXMB 4DV6L 3KLRA 1ILPA 2ZXRA 1WOCA 3SVMA 3CCQA 1EEID 2KHSA 3BU2A 2R93H 1QZGA 1F2MA 2PZWA 1YJNA 1BCPD 1SJHD 1HR0W 1WTWA 1K3BC 2XSCA 4X6AH 1R9TH 2NVTB 4MTNA 1Q81C 3NBIA 5IYDG 4P73A 2F0QA 4PZ7A 2Z0SA 1KRSA 2QEJC 1L1OC 2ZJPA 3KDFB 1DJRD 1W2BA 1YJWA 1KXLA 4LF9L 3TEHB 1JE4A 3QOLA 4JI7Q 3Q0AA 5C6AA 4BBSB 4NB3A 3FKIB 4JI3L 5IOCA 1K9MC 4C3IH 1CKMA 4CHTB 4A3KG 4LFAL 3ERSX 2K03A 3HOWG 2RSNA 1EYCA 1Z6HA 4YWMA 1ESFA 1K8GA 4HSPA 2A19A 1HZAA 5DAUA 4HJAA 1HNZQ 4BA2I 5IYBG 2K1BA 4OXPA 2CH4A 3GTKB 3CXCA 1KLGD 1KC8C 4JC0A 1U0LA 5C3EH 3D4DA 5BN5A 5KGUA 1QZHA 1XNRQ 4LF8L 4A3DH 1AW7A 3CCEA 2UXCL 4S3SA 3VYSA 1RDPD 3O13A 4KKTA 3DLLA 1X3GA 1PH3A 1ENAA 3DWPA 4WRDA 1GUSA 1K73C 5GAHC 3TDQA 3ZJYC 5E7NA 1R4QB 5DM63 1TS2A 1N34L 1PH9A 3VR3A 2AKWB 1B70B 4CKEA 4A3BH 3VDYA 4LF6L 3U58A 1JJGA 4GKJQ 3EBEA 4MTKA 4TSSA 2CCZA 3AFQA 1KRTA 2K04A 3K5MA 3GTGH 2PW5A 5CR3A 4AIMA 2F4VQ 3F2BA 2J7ZA 3GD7A 4YCWA 2KVMA 4CKCA 1X3FA 3NWTA 1SEBD 2KEEA 3WWVA 4POFA 4X64Q 3CCSA 1JOOA 1MSGA 3GV6A 4IURA 4A76A 4OONA 2JA9A 3H09A 2M9VA 1SNCA 1EIGA 1IXRA 2HCCA 3LWUA 1R4PB 2MFIA 1PH4A 2E5LL 3X3MA 2K5DA 4IN3A 1M90C 2K5VA 4NXNQ 2FJ2A 3BYYB 1KNAA 1STHA 4LMQD 1YHAA 4GN3B 1H9MA 5G3LD 2R7ZH 3H3VI 3S14B 1PFBA 1STYA 2F4IA 5EJWA 2XWBB 2A69C 1X32A 3LNNA 4JI2L 1MJCA 4X65Q 4APVA 2WKCA 3CCVA 1X3PA 4MIUA 1B8AA 4B9WA 1Y8PB 1I3QH 2BA1A 3HOVB 4CBVA 3BVZA 1PYWD 1HQMC 5C4XB 1KNEA 2F0MA 4DV5L 2QDLA 4KHPL 3I4NG 2CFMA 1YBYA 5LMUQ 2XWJB 3ULJA 4FNFA 1AE3A 2XGTA 4JI8Q 1D5MC 5EPLA 1RD9D 4OO1I 3KLSX 3BVMA 1Y1VB 5K36G 3R93A 2CWAA 4WJWA 1IL2A 4DV4Q 2GVAA 4JI5Q 4RCOA 1X55A 1CHPD 3BDOA 1A62A 3M3YH 2K75A 1EQQA 1PA6A 4DV2Q 4WJ3M 1Q3LA 4NKLA 2EY2A 5EKLA 4B3TQ 4C56C 1SE4A 1WTOA 1Y1WH 2O5IC 2B63H 2NVYH 5EGTA 3QO2A 4FF3A 2RDHA 3OMGA 4IOCA 5M5YB 2F0HA 2RHQB 4JI0L 4TQUS 4DV0Q 4A93H 4BA1I 3IAYA 1J6QA 2ZXOA 2F0OA 3S1QB 4BBSG 1IW7D 2L1BA 1EWHA 5IP9G 3I4LA 4L8JA 1UAPA 5H1SE 1KQSA 4M8AA 3PGZA 3S2HB 1TWCB 3GTOB 2EYPA 2UUAL 2NZHA 5JJIA 4XDXA 4YHHL 3L9AX 3TBIB 3TREA 1STAA 2IT1A 3H3VH 4U68A 1Q86C 1BF4A 2YU9H 1V1PB 1GVPA 1S5FD 3QOJA 1YVCA 4KKSA 3J80i 2PQEA 4C3IB 5M5WH 3RZDB 1B4OA 1WFQA 2JYOA 3TP8A 3A5UA 1EY8A 2B2VC 3OTOL 3PUWA 1STGA 4DR4Q 2IX0A 4O1NA 2L4NA 2XTIA 3EFXD 2WKDA 2QDBA 2YYZA 4DK3C 4K0KQ 5JEAJ 3KOJA 4IALA 3X3NA 4KKUA 2OF1A 3WDNA 1HCZA 5JJLA 3BDCA 4BY7B 1DONA 1JORA 4OO1H 2AWNA 3KBGA 2A68D 2EXZA 1VQ6A 3PSIA 2I46A 3HG9A 3UDGA
chains in the Genus database with same CATH topology
2RCNA 4YY3L 3T1HQ 4A93G 1WCMH 3RN5A 2FXQA 4HIDA 5C4XH 3BJUA 2B3GA 3PF5A 2ZTCA 1L1OA 2N8NA 3S1RH 5C0XI 1N8RC 1QVGA 1HNWQ 1BKBA 1JMCA 2UUCQ 3F1ZA 4BBSH 4DV1L 4B3MQ 1UE1A 1CSQA 1EQRA 1A8VA 1OXTA 5C0XG 3FHWA 2K14A 3FKIH 1TWAH 3RLNA 4OX9Q 2Z6KA 1Y1VH 1VQJA 3MEFA 1JJ2A 5BR8Q 1G291 2OCEA 4JBKA 1PH2A 1VQ8A 4L5SA 5M5XH 4JYAQ 1BBWA 1P8LA 4JI4L 5FJ8G 4LF4Q 2F52A 1SR3A 1PH8A 3J81i 4IO9A 1XMQQ 4DR1L 4LF5L 2R92G 1NBWA 5FLMG 1V43A 2Y0SE 4GLXA 3KF6A 1C9OA 2UU9Q 3KFUA 4DR7Q 2JEBI 1K3RA 3PUXA 1VQ7A 3HKZG 1SLJA 3F2CA 4DV7Q 1VQMA 1L0WA 2VQFL 4QL5A 3T1HL 3CCRA 4X66L 2JA7H 3S24A 5AJ3L 5M5YH 2L15A 4AYBE 2OWOA 4LFCQ 1W3SA 1HNWL 2K5NA 4GNXC 2E2IH 2UUCL 3T1YQ 4DUZQ 2D0PA 3U50C 4DR3Q 4B3ML 3S1QH 4DPGA 2PI2A 3L7ZC 2N3SA 5JEAG 4WJ4A 3D31A 4OX9L 3W1GA 2YTXA 3KJOA 2R6GA 1E1OA 5BR8L 2QEXA 2WAQG 4GKKQ 2EXDA 2I0QA 2K4KA 4JYAL 1QUQA 4MZ9A 1L1OB 1PYSB 4UP7A 4LF4L 1XPOA 3NBHB 3S2HH 4JCVE 1TWCH 3UDXA 2E2JH 3GTOH 1XMQL 3ICEA 4A3LH 3HOVG 4IJLA 3L2PA 1Q82C 4DR7L 1PH1A 2KBNA 3PV0A 4DV7L 4YHHQ 5C4XG 5LMNQ 1HZCA 1ASZA 1SROA 5M3FH 2RHSB 1XMOQ 1AE2A 2OQKA 2WB1E 4LUVA 3TS0A 2LXKA 1FVIA 3G48A 4KHZA 4ME3A 3UE1A 3CCJA 2OTJA 2YTYA 5DLQE 4LFCL 3A0JA 1N33Q 1VQFA 1AH9A 4LW1A 3H15A 3RZDH 1CSPA 5IY0A 4AQYQ 1XPUA 3JAMi 3RLFA 1PH6A 1FJGQ 4PZ6A 3FKIG 1MJEA 3KF6B 4OWTB 4H02A 2JA6G 1Y1VG 2ZM6L 5JJKA 1IBLQ 5IE8A 4C3JH 1GKHA 3CPFA 4IJHA 4C3HH 3PUVA 5C44H 1VQKA 5C0XJ 2NZOA 4IPDA 3TQYA 1ASYA 1HZ9A 4OWWB 3J7ZC 3E0EA 4HIKA 1PH5A 2LSSA 1NY4A 1YJ9A 3KYHC 3E9IA 1K83H 2N78A 3I4OA 4HIOA 4DR5Q 4BY7H 1DGSA 5EAYA 2ID0A 4JI1Q 2JA7G 2EIFA 1OXSC 1XMOL 4UP8A 2LXJA 1EWIA 1EIYB 1N9WA 2UXBQ 2IY5B 4YY3Q 4B3SL 2I5LX 4A3IH 1S40A 4IPCA 1QUQB 2AHOB 3HOYH 4JBMA 1O7IA 1N33L 1KIXA 4L5RC 4A3MH 2HHHQ 3CMEA 3I2ZA 4HJ7A 1FJGL 5GAGC 3CC2A 1OXXK 4HJ8A 1E3PA 4X62L 3G4SA 3JC66 3B6YA 3UDIA 2KENA 3FP9A 3M4QA 3SGIA 1VS0A 1YITA 1IBLL 1JJCB 3M4PA 4O2DA 3KJPA 1KL9A 4P72A 1XJVA 4NXMQ 2WFWA 1HNZL 1WYDA 2MQHA 4O0AA 4A3LG 1OXUA 5M3MH 3HOZH 4DR6Q 3GTMH 4KLKA 3PUZA 3K0XA 1N36Q 4KI0A 5M3FG 2NN6I 4DR5L 4JI1L 4DR1Q 4LF5Q 3IRBA 1CKOA 4POGA 3RN2A 1S72A 5FLXc 1BVSA 1VQGA 4QGUA 5IYDH 2UXBL 2VQEL 2NN6G 2B29A 3I4MH 3UE0A 4X66Q 3PO3H 4JG2A 1K0RA 5AJ3Q 1C7YA 2HIXA 2HHHL 3DM3A 3GTPH 1WJJA 3BZCA 3M4OH 1L2FA 4DV6Q 4R1JA 4DUYL 2YV5A 5C44G 3KLWA 4JI6Q 1XNQL 3STBC 4RMFA 4A3GH 4L5TA 4XTCS 1H95A 2ZTEA 4A3KH 1Q46A 1X6OA 2K52A 4UPAA 3KDFA 3HOWH 1GO3E 3I7FA 1RL2A 4A3FH 4NXML 1IBMQ 1BBUA 2JA6H 2CWPA 3GO5A 3MXNB 4JOIC 1VCIA 4DR6L 4LNQA 2GN5A 2CQOA 3ULPA 4DR2Q 1PHJA 3GTLH 4BY7G 4BBRH 3HKSA 3K7UC 1PFSA 4QJFA 1N36L 1HNXQ 1I94Q 4LFBL 1C0AA 1U5KA 4YWLA 3CMAA 3S1MH 4P74A 1Q12A 3Q8DA 4PG3A 4A3IG 3HOYG 3TRZA 4ALPA 1TWHH 2HIVA 3HKZE 4A3MG 3A5ZB 3ER0A 2VY3A 3PF4A 4YWKA 3GDEA 5C4JH 4RG1A 4NPSA 4DV3L 1X56A 1GM5A 2R7DA 2IHEA 1JE5A 4QQBX 2AWOA 2JA5H 2BH2A 2Q2TA 4JI3Q 1J5EQ 2KCMA 4DV6L 1Z9FA 2Q2HA 4LFAQ 4JI6L 1WOCA 3STBD 1UEBA 2JE6I 3CCQA 3BU2A 2ZM6Q 2R93H 2KHIA 1IYJB 4X64L 2ASBA 1QZGA 5M3MG 3HOZG 1IBML 2IX1A 1YJNA 3NEMA 3CCUA 2ES2A 1YEZA 1HR0W 3CC7A 4R4QA 1UWVA 4YCUA 4X6AH 2WAQE 4DR2L 2KHJA 4EX5A 4FDBA 1HNXL 1R9TH 1E7ZA 1I94L 4B3RQ 1IBKL 4MTNA 4OWXB 1Q81C 5IYDG 4P73A 4PZ7A 2Z0SA 1KRSA 4TVAB 1L1OC 3I4MG 1VQDA 4BXXH 2ZJPA 3J7A5 3KDFB 3PO3G 4LF8Q 1W2BA 2UXCQ 1YJWA 2VS1A 4LF9L 3TEHB 1KXLA 4A4IA 2OQ0A 4B3SQ 2DUDA 2MO0A 4JI7Q 4A3CH 1VQAA 4NB3A 2ALYB 1D7QA 4JI3L 3OYYA 5J3BA 1J5EL 1K9MC 4A3GG 4C3IH 1CKMA 3M7NA 4IOAA 4A3KG 1PVOA 1QVCA 3G71A 4LFAL 3KF8B 3F2DA 3ERSX 3HOWG 4A3FG 1VQ4A 4X62Q 1VQOA 3LGJA 4A75A 4YWMA 4MNOA 2D0OA 3NELA 4GN5A 1K8GA 4UP9A 1YHQA 2A19A 4BBRG 1HZAA 3J80c 4R4IA 4HJAA 1HNZQ 4BA2I 1V9PA 3U4ZA 5IYBG 1S3OA 1SRUA 3HOXG 4LUZA 2ZJRA 4B3RL 3AYHB 1E24A 3H0GH 5GROA 3GTQH 4OXPA 3CPWA 3CXCA 1KC8C 4C2MH 1NJIC 4LF6Q 4JC0A 2C35B 5LMUL 1U0LA 5C3EH 1QZHA 3BZKA 3CC4A 4GLVB 1XNRQ 2D62A 4LF8L 4A3DH 3CCEA 1FL0A 2UXCL 2JA5G 4Y7NH 2VQEQ 4JI7L 2BH8A 4IFDI 1X3EA 1HZBA 4JBWA 3DLLA 3CCLA 1X3GA 1PH3A 3F8TA 2R93G 3RR5A 3CQZH 3E9HA 1K73C 5GAHC 4A3EH 4DUYQ 1Y14B 3ZJYC 5E7NA 1XNQQ 4DNIA 1N34L 1PH9A 2OTLA 3L0OA 2VUMH 4DAYB 1YHBA 4YCVA 2AKWB 4JOIA 3EN2A 1Q8KA 4R4CA 2H5XA 1B70B 4B3TL 4GOPC 3W1BA 3I56A 3ULLA 4A3BH 1NTGA 4BXXG 1I50H 1Q1BA 1SE8A 3VDYA 1CUKA 4LFBQ 4LF7L 4LF6L 3U58A 2VL6A 3CCMA 1JJGA 3UDFA 2E5LQ 4GKJQ 1OTCA 1XNRL 4IPHA 2I5MX 4A3CG 3EBEA 2CCZA 1VQEA 3S1NH 3AFQA 1KRTA 1CKNA 3A74A 1HR0Q 3GTGH 3I4NH 2WP8J 3W5OA 4HJ5A 5LMNW 4AIMA 4HIMA 2QGQA 2JJQA 4DV3Q 3J81c 4GNXA 2F4VQ 2PQAA 4P71A 3F2BA 3HOUH 3GD7A 3PIPA 4YCWA 2UXDQ 1KHIA 1X3FA 4JI2Q 1WI5A 3WWVA 3NENA 5IWAL 4POFA 4X64Q 3CCSA 1PH7A 1IZ6A 1Y1WG 3H0GG 3PUYA 1TWGH 4A76A 4OONA 4Y52H 1X9NA 2JA9A 1EYGA 4BY1H 5C3EG 4QIWE 1IXRA 1EUJA 2NVTH 4DV5Q 4A3DG 1EOVA 2MFIA 5IYBH 1SMXA 3HOXH 1PH4A 1IBKQ 4KHPQ 2E5LL 2ZJQA 1UE6A 4GKJL 1M90C 3M85A 1KAWA 1VQPA 2K5VA 5IT9c 4NXNQ 1D8LA 1HR0L 5ELNA 4LUOA 2QA4A 4DR4L 1JT8A 1TWFH 4LF9Q 1YHAA 3AEVA 2VW9A 2CKZB 4GN3B 4R4TA 1G51A 4A3EG 3PCOB 1EFWA 5IP9H 2F4VL 4K0KL 3K8AA 2R7ZH 3H3VI 3K80C 4JV5L 2UXDL 1UE7A 2VUMG 1N32Q 3CP0A 2BA0A 1MJCA 1UE5A 1NE3A 1MKHA 4GN4B 4JI2L 1VQHA 4PMWA 1Q7YC 4X65Q 1LYLA 3TS2A 2Y0SG 4APVA 4OO1G 1G6PA 4IFDJ 3AQQA 1CKNB 3CCVA 1K8AC 1M1KC 1B8AA 4A3BG 3D0FA 4GS3A 1HJPA 1I3QH 2BA1A 2NVXH 5GAEC 3RLOA 4GNXB 3K81C 2PQAB 3JAMc 5IP7H 4DV5L 1RIPA 4AYBG 3S15H 4KHPL 3GTKH 3AFPA 4P75A 2ZTDA 4JI0Q 3I4NG 1T9HA 2CFMA 1YBYA 5LMUQ 4NXNL 3ULJA 1GD7A 1VQNA 1YIJA 1AE3A 4LWCA 1SFOH 2XGTA 4JI8Q 1Z47A 3HOUG 2PNHA 2AMCB 2MNAA 2JEAI 4OO1I 2HQLA 1TXYA 4R4OA 5K36G 4QY7A 2CWAA 1IL2A 2Z6KC 1N32L 4DV4Q 2GVAA 2VNUD 1YNXA 4JI5Q 1NMGA 2F3IA 2K50A 4X65L 1YI2A 3G6EA 1Q1EA 3J81j 1X55A 4A3JH 3S17H 1X54A 2UUAQ 3CAMA 1N34Q 1A62A 3M3YH 2K75A 1EQQA 2N49A 3HFZB 4JBJA 1PA6A 2UU9L 2JA8H 4BY1G 4DV2Q 4GOPA 4WJ3M 1WCMG 1HH2P 2PMZE 5IYCH 4B3TQ 1YZ6A 1I6HH 2WB1G 3PO2H 1NMFA 1Y1WH 1E1TA 4DAMA 2B63H 2NVYH 5GQOA 5HY6A 4IOCA 1E22A 2RHQB 4JI0L 4L5QA 4LF7Q 4TQUS 4DV0Q 4A93H 4BA1I 2Q2IA 3T1YL 4UY8C 1J6QA 2GVBA 4DUZL 4DR3L 4BBSG 2RF4A 3OTOQ 5IP9G 4JI8L 2R7ZG 2E8GA 4IPGA 3OW2A 1QVFA 1MIUA 5H1SE 1LUZA 2E2HH 2R7FA 1KQSA 1VQ9A 4GKKL 3U4VA 4EQ5A 4DV4L 2DGYA 3CF5A 3PGZA 2I5HA 4JI5L 4IFDG 2UUBQ 4AH6A 2NVQH 2UUAL 1B7YB 2NZHA 2VZAA 5IWAQ 3K7AH 3GTJH 5FJ8H 4DV2L 1JB7A 5JJIA 1I5FA 5IP7G 3TREA 4YHHL 5LMNL 1XTDA 4J15A 3PIOA 2IT1A 3H3VH 1Q86C 2R92H 5FLMH 1SN8A 2YU9H 1VQIA 1X65A 1FGUA 1OXVA 5ELOA 1GVPA 5GADC 2HT1A 3I55A 2ATWA 2PI2E 1A63A 1VQCA 4DKAC 3EIVA 1YVCA 2IHFA 3CW2C 4DV0L 3J80i 5M5WH 2A8VA 3RNUA 4AQYL 1A0IA 1VQLA 1WFQA 1P16A 3M9BA 1VQ5A 3A5UA 3OTOL 3RZOH 2V1CC 4XIGS 4GOPB 2KCTA 4DV1Q 1KD1C 1PYBA 1LM0A 3PUWA 3CD6A 1PV4A 4DR4Q 2IX0A 4DK6C 2XTIA 4PZ8A 2YYZA 4DK3C 4K0KQ 2YTVA 5JEAJ 3S14H 4A3JG 3KOJA 4JV5Q 1V1QA 2JK8A 2Q2UA 2UUBL 4JI4Q 2JA8G 1EIFA 5IYCG 2JQOA 1VQBA 5JJLA 4GLAC 4HJ9A 3PO2G 1XPRA 2VQFQ 2B63G 2AWNA 5HGQA 2MO1A 3S16H 1VQ6A 1LTLA 2EQSA 3HOVH 3PSIA 2A1AA 2K5HA 3S2DH 3UDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCN A;  4YY3 L;  3T1H Q;  4A93 G;  1WCM H;  3RN5 A;  2FXQ A;  4HID A;  5C4X H;  3BJU A;  2B3G A;  3PF5 A;  2ZTC A;  1L1O A;  2N8N A;  3S1R H;  5C0X I;  1N8R C;  1QVG A;  1HNW Q;  1BKB A;  1JMC A;  2UUC Q;  3F1Z A;  4BBS H;  4DV1 L;  4B3M Q;  1UE1 A;  1CSQ A;  1EQR A;  1A8V A;  1OXT A;  5C0X G;  3FHW A;  2K14 A;  3FKI H;  1TWA H;  3RLN A;  4OX9 Q;  2Z6K A;  1Y1V H;  1VQJ A;  3MEF A;  1JJ2 A;  5BR8 Q;  1G29 1;  2OCE A;  4JBK A;  1PH2 A;  1VQ8 A;  4L5S A;  5M5X H;  4JYA Q;  1BBW A;  1P8L A;  4JI4 L;  5FJ8 G;  4LF4 Q;  2F52 A;  1SR3 A;  1PH8 A;  3J81 i;  4IO9 A;  1XMQ Q;  4DR1 L;  4LF5 L;  2R92 G;  1NBW A;  5FLM G;  1V43 A;  2Y0S E;  4GLX A;  3KF6 A;  1C9O A;  2UU9 Q;  3KFU A;  4DR7 Q;  2JEB I;  1K3R A;  3PUX A;  1VQ7 A;  3HKZ G;  1SLJ A;  3F2C A;  4DV7 Q;  1VQM A;  1L0W A;  2VQF L;  4QL5 A;  3T1H L;  3CCR A;  4X66 L;  2JA7 H;  3S24 A;  5AJ3 L;  5M5Y H;  2L15 A;  4AYB E;  2OWO A;  4LFC Q;  1W3S A;  1HNW L;  2K5N A;  4GNX C;  2E2I H;  2UUC L;  3T1Y Q;  4DUZ Q;  2D0P A;  3U50 C;  4DR3 Q;  4B3M L;  3S1Q H;  4DPG A;  2PI2 A;  3L7Z C;  2N3S A;  5JEA G;  4WJ4 A;  3D31 A;  4OX9 L;  3W1G A;  2YTX A;  3KJO A;  2R6G A;  1E1O A;  5BR8 L;  2QEX A;  2WAQ G;  4GKK Q;  2EXD A;  2I0Q A;  2K4K A;  4JYA L;  1QUQ A;  4MZ9 A;  1L1O B;  1PYS B;  4UP7 A;  4LF4 L;  1XPO A;  3NBH B;  3S2H H;  4JCV E;  1TWC H;  3UDX A;  2E2J H;  3GTO H;  1XMQ L;  3ICE A;  4A3L H;  3HOV G;  4IJL A;  3L2P A;  1Q82 C;  4DR7 L;  1PH1 A;  2KBN A;  3PV0 A;  4DV7 L;  4YHH Q;  5C4X G;  5LMN Q;  1HZC A;  1ASZ A;  1SRO A;  5M3F H;  2RHS B;  1XMO Q;  1AE2 A;  2OQK A;  2WB1 E;  4LUV A;  3TS0 A;  2LXK A;  1FVI A;  3G48 A;  4KHZ A;  4ME3 A;  3UE1 A;  3CCJ A;  2OTJ A;  2YTY A;  5DLQ E;  4LFC L;  3A0J A;  1N33 Q;  1VQF A;  1AH9 A;  4LW1 A;  3H15 A;  3RZD H;  1CSP A;  5IY0 A;  4AQY Q;  1XPU A;  3JAM i;  3RLF A;  1PH6 A;  1FJG Q;  4PZ6 A;  3FKI G;  1MJE A;  3KF6 B;  4OWT B;  4H02 A;  2JA6 G;  1Y1V G;  2ZM6 L;  5JJK A;  1IBL Q;  5IE8 A;  4C3J H;  1GKH A;  3CPF A;  4IJH A;  4C3H H;  3PUV A;  5C44 H;  1VQK A;  5C0X J;  2NZO A;  4IPD A;  3TQY A;  1ASY A;  1HZ9 A;  4OWW B;  3J7Z C;  3E0E A;  4HIK A;  1PH5 A;  2LSS A;  1NY4 A;  1YJ9 A;  3KYH C;  3E9I A;  1K83 H;  2N78 A;  3I4O A;  4HIO A;  4DR5 Q;  4BY7 H;  1DGS A;  5EAY A;  2ID0 A;  4JI1 Q;  2JA7 G;  2EIF A;  1OXS C;  1XMO L;  4UP8 A;  2LXJ A;  1EWI A;  1EIY B;  1N9W A;  2UXB Q;  2IY5 B;  4YY3 Q;  4B3S L;  2I5L X;  4A3I H;  1S40 A;  4IPC A;  1QUQ B;  2AHO B;  3HOY H;  4JBM A;  1O7I A;  1N33 L;  1KIX A;  4L5R C;  4A3M H;  2HHH Q;  3CME A;  3I2Z A;  4HJ7 A;  1FJG L;  5GAG C;  3CC2 A;  1OXX K;  4HJ8 A;  1E3P A;  4X62 L;  3G4S A;  3JC6 6;  3B6Y A;  3UDI A;  2KEN A;  3FP9 A;  3M4Q A;  3SGI A;  1VS0 A;  1YIT A;  1IBL L;  1JJC B;  3M4P A;  4O2D A;  3KJP A;  1KL9 A;  4P72 A;  1XJV A;  4NXM Q;  2WFW A;  1HNZ L;  1WYD A;  2MQH A;  4O0A A;  4A3L G;  1OXU A;  5M3M H;  3HOZ H;  4DR6 Q;  3GTM H;  4KLK A;  3PUZ A;  3K0X A;  1N36 Q;  4KI0 A;  5M3F G;  2NN6 I;  4DR5 L;  4JI1 L;  4DR1 Q;  4LF5 Q;  3IRB A;  1CKO A;  4POG A;  3RN2 A;  1S72 A;  5FLX c;  1BVS A;  1VQG A;  4QGU A;  5IYD H;  2UXB L;  2VQE L;  2NN6 G;  2B29 A;  3I4M H;  3UE0 A;  4X66 Q;  3PO3 H;  4JG2 A;  1K0R A;  5AJ3 Q;  1C7Y A;  2HIX A;  2HHH L;  3DM3 A;  3GTP H;  1WJJ A;  3BZC A;  3M4O H;  1L2F A;  4DV6 Q;  4R1J A;  4DUY L;  2YV5 A;  5C44 G;  3KLW A;  4JI6 Q;  1XNQ L;  3STB C;  4RMF A;  4A3G H;  4L5T A;  4XTC S;  1H95 A;  2ZTE A;  4A3K H;  1Q46 A;  1X6O A;  2K52 A;  4UPA A;  3KDF A;  3HOW H;  1GO3 E;  3I7F A;  1RL2 A;  4A3F H;  4NXM L;  1IBM Q;  1BBU A;  2JA6 H;  2CWP A;  3GO5 A;  3MXN B;  4JOI C;  1VCI A;  4DR6 L;  4LNQ A;  2GN5 A;  2CQO A;  3ULP A;  4DR2 Q;  1PHJ A;  3GTL H;  4BY7 G;  4BBR H;  3HKS A;  3K7U C;  1PFS A;  4QJF A;  1N36 L;  1HNX Q;  1I94 Q;  4LFB L;  1C0A A;  1U5K A;  4YWL A;  3CMA A;  3S1M H;  4P74 A;  1Q12 A;  3Q8D A;  4PG3 A;  4A3I G;  3HOY G;  3TRZ A;  4ALP A;  1TWH H;  2HIV A;  3HKZ E;  4A3M G;  3A5Z B;  3ER0 A;  2VY3 A;  3PF4 A;  4YWK A;  3GDE A;  5C4J H;  4RG1 A;  4NPS A;  4DV3 L;  1X56 A;  1GM5 A;  2R7D A;  2IHE A;  1JE5 A;  4QQB X;  2AWO A;  2JA5 H;  2BH2 A;  2Q2T A;  4JI3 Q;  1J5E Q;  2KCM A;  4DV6 L;  1Z9F A;  2Q2H A;  4LFA Q;  4JI6 L;  1WOC A;  3STB D;  1UEB A;  2JE6 I;  3CCQ A;  3BU2 A;  2ZM6 Q;  2R93 H;  2KHI A;  1IYJ B;  4X64 L;  2ASB A;  1QZG A;  5M3M G;  3HOZ G;  1IBM L;  2IX1 A;  1YJN A;  3NEM A;  3CCU A;  2ES2 A;  1YEZ A;  1HR0 W;  3CC7 A;  4R4Q A;  1UWV A;  4YCU A;  4X6A H;  2WAQ E;  4DR2 L;  2KHJ A;  4EX5 A;  4FDB A;  1HNX L;  1R9T H;  1E7Z A;  1I94 L;  4B3R Q;  1IBK L;  4MTN A;  4OWX B;  1Q81 C;  5IYD G;  4P73 A;  4PZ7 A;  2Z0S A;  1KRS A;  4TVA B;  1L1O C;  3I4M G;  1VQD A;  4BXX H;  2ZJP A;  3J7A 5;  3KDF B;  3PO3 G;  4LF8 Q;  1W2B A;  2UXC Q;  1YJW A;  2VS1 A;  4LF9 L;  3TEH B;  1KXL A;  4A4I A;  2OQ0 A;  4B3S Q;  2DUD A;  2MO0 A;  4JI7 Q;  4A3C H;  1VQA A;  4NB3 A;  2ALY B;  1D7Q A;  4JI3 L;  3OYY A;  5J3B A;  1J5E L;  1K9M C;  4A3G G;  4C3I H;  1CKM A;  3M7N A;  4IOA A;  4A3K G;  1PVO A;  1QVC A;  3G71 A;  4LFA L;  3KF8 B;  3F2D A;  3ERS X;  3HOW G;  4A3F G;  1VQ4 A;  4X62 Q;  1VQO A;  3LGJ A;  4A75 A;  4YWM A;  4MNO A;  2D0O A;  3NEL A;  4GN5 A;  1K8G A;  4UP9 A;  1YHQ A;  2A19 A;  4BBR G;  1HZA A;  3J80 c;  4R4I A;  4HJA A;  1HNZ Q;  4BA2 I;  1V9P A;  3U4Z A;  5IYB G;  1S3O A;  1SRU A;  3HOX G;  4LUZ A;  2ZJR A;  4B3R L;  3AYH B;  1E24 A;  3H0G H;  5GRO A;  3GTQ H;  4OXP A;  3CPW A;  3CXC A;  1KC8 C;  4C2M H;  1NJI C;  4LF6 Q;  4JC0 A;  2C35 B;  5LMU L;  1U0L A;  5C3E H;  1QZH A;  3BZK A;  3CC4 A;  4GLV B;  1XNR Q;  2D62 A;  4LF8 L;  4A3D H;  3CCE A;  1FL0 A;  2UXC L;  2JA5 G;  4Y7N H;  2VQE Q;  4JI7 L;  2BH8 A;  4IFD I;  1X3E A;  1HZB A;  4JBW A;  3DLL A;  3CCL A;  1X3G A;  1PH3 A;  3F8T A;  2R93 G;  3RR5 A;  3CQZ H;  3E9H A;  1K73 C;  5GAH C;  4A3E H;  4DUY Q;  1Y14 B;  3ZJY C;  5E7N A;  1XNQ Q;  4DNI A;  1N34 L;  1PH9 A;  2OTL A;  3L0O A;  2VUM H;  4DAY B;  1YHB A;  4YCV A;  2AKW B;  4JOI A;  3EN2 A;  1Q8K A;  4R4C A;  2H5X A;  1B70 B;  4B3T L;  4GOP C;  3W1B A;  3I56 A;  3ULL A;  4A3B H;  1NTG A;  4BXX G;  1I50 H;  1Q1B A;  1SE8 A;  3VDY A;  1CUK A;  4LFB Q;  4LF7 L;  4LF6 L;  3U58 A;  2VL6 A;  3CCM A;  1JJG A;  3UDF A;  2E5L Q;  4GKJ Q;  1OTC A;  1XNR L;  4IPH A;  2I5M X;  4A3C G;  3EBE A;  2CCZ A;  1VQE A;  3S1N H;  3AFQ A;  1KRT A;  1CKN A;  3A74 A;  1HR0 Q;  3GTG H;  3I4N H;  2WP8 J;  3W5O A;  4HJ5 A;  5LMN W;  4AIM A;  4HIM A;  2QGQ A;  2JJQ A;  4DV3 Q;  3J81 c;  4GNX A;  2F4V Q;  2PQA A;  4P71 A;  3F2B A;  3HOU H;  3GD7 A;  3PIP A;  4YCW A;  2UXD Q;  1KHI A;  1X3F A;  4JI2 Q;  1WI5 A;  3WWV A;  3NEN A;  5IWA L;  4POF A;  4X64 Q;  3CCS A;  1PH7 A;  1IZ6 A;  1Y1W G;  3H0G G;  3PUY A;  1TWG H;  4A76 A;  4OON A;  4Y52 H;  1X9N A;  2JA9 A;  1EYG A;  4BY1 H;  5C3E G;  4QIW E;  1IXR A;  1EUJ A;  2NVT H;  4DV5 Q;  4A3D G;  1EOV A;  2MFI A;  5IYB H;  1SMX A;  3HOX H;  1PH4 A;  1IBK Q;  4KHP Q;  2E5L L;  2ZJQ A;  1UE6 A;  4GKJ L;  1M90 C;  3M85 A;  1KAW A;  1VQP A;  2K5V A;  5IT9 c;  4NXN Q;  1D8L A;  1HR0 L;  5ELN A;  4LUO A;  2QA4 A;  4DR4 L;  1JT8 A;  1TWF H;  4LF9 Q;  1YHA A;  3AEV A;  2VW9 A;  2CKZ B;  4GN3 B;  4R4T A;  1G51 A;  4A3E G;  3PCO B;  1EFW A;  5IP9 H;  2F4V L;  4K0K L;  3K8A A;  2R7Z H;  3H3V I;  3K80 C;  4JV5 L;  2UXD L;  1UE7 A;  2VUM G;  1N32 Q;  3CP0 A;  2BA0 A;  1MJC A;  1UE5 A;  1NE3 A;  1MKH A;  4GN4 B;  4JI2 L;  1VQH A;  4PMW A;  1Q7Y C;  4X65 Q;  1LYL A;  3TS2 A;  2Y0S G;  4APV A;  4OO1 G;  1G6P A;  4IFD J;  3AQQ A;  1CKN B;  3CCV A;  1K8A C;  1M1K C;  1B8A A;  4A3B G;  3D0F A;  4GS3 A;  1HJP A;  1I3Q H;  2BA1 A;  2NVX H;  5GAE C;  3RLO A;  4GNX B;  3K81 C;  2PQA B;  3JAM c;  5IP7 H;  4DV5 L;  1RIP A;  4AYB G;  3S15 H;  4KHP L;  3GTK H;  3AFP A;  4P75 A;  2ZTD A;  4JI0 Q;  3I4N G;  1T9H A;  2CFM A;  1YBY A;  5LMU Q;  4NXN L;  3ULJ A;  1GD7 A;  1VQN A;  1YIJ A;  1AE3 A;  4LWC A;  1SFO H;  2XGT A;  4JI8 Q;  1Z47 A;  3HOU G;  2PNH A;  2AMC B;  2MNA A;  2JEA I;  4OO1 I;  2HQL A;  1TXY A;  4R4O A;  5K36 G;  4QY7 A;  2CWA A;  1IL2 A;  2Z6K C;  1N32 L;  4DV4 Q;  2GVA A;  2VNU D;  1YNX A;  4JI5 Q;  1NMG A;  2F3I A;  2K50 A;  4X65 L;  1YI2 A;  3G6E A;  1Q1E A;  3J81 j;  1X55 A;  4A3J H;  3S17 H;  1X54 A;  2UUA Q;  3CAM A;  1N34 Q;  1A62 A;  3M3Y H;  2K75 A;  1EQQ A;  2N49 A;  3HFZ B;  4JBJ A;  1PA6 A;  2UU9 L;  2JA8 H;  4BY1 G;  4DV2 Q;  4GOP A;  4WJ3 M;  1WCM G;  1HH2 P;  2PMZ E;  5IYC H;  4B3T Q;  1YZ6 A;  1I6H H;  2WB1 G;  3PO2 H;  1NMF A;  1Y1W H;  1E1T A;  4DAM A;  2B63 H;  2NVY H;  5GQO A;  5HY6 A;  4IOC A;  1E22 A;  2RHQ B;  4JI0 L;  4L5Q A;  4LF7 Q;  4TQU S;  4DV0 Q;  4A93 H;  4BA1 I;  2Q2I A;  3T1Y L;  4UY8 C;  1J6Q A;  2GVB A;  4DUZ L;  4DR3 L;  4BBS G;  2RF4 A;  3OTO Q;  5IP9 G;  4JI8 L;  2R7Z G;  2E8G A;  4IPG A;  3OW2 A;  1QVF A;  1MIU A;  5H1S E;  1LUZ A;  2E2H H;  2R7F A;  1KQS A;  1VQ9 A;  4GKK L;  3U4V A;  4EQ5 A;  4DV4 L;  2DGY A;  3CF5 A;  3PGZ A;  2I5H A;  4JI5 L;  4IFD G;  2UUB Q;  4AH6 A;  2NVQ H;  2UUA L;  1B7Y B;  2NZH A;  2VZA A;  5IWA Q;  3K7A H;  3GTJ H;  5FJ8 H;  4DV2 L;  1JB7 A;  5JJI A;  1I5F A;  5IP7 G;  3TRE A;  4YHH L;  5LMN L;  1XTD A;  4J15 A;  3PIO A;  2IT1 A;  3H3V H;  1Q86 C;  2R92 H;  5FLM H;  1SN8 A;  2YU9 H;  1VQI A;  1X65 A;  1FGU A;  1OXV A;  5ELO A;  1GVP A;  5GAD C;  2HT1 A;  3I55 A;  2ATW A;  2PI2 E;  1A63 A;  1VQC A;  4DKA C;  3EIV A;  1YVC A;  2IHF A;  3CW2 C;  4DV0 L;  3J80 i;  5M5W H;  2A8V A;  3RNU A;  4AQY L;  1A0I A;  1VQL A;  1WFQ A;  1P16 A;  3M9B A;  1VQ5 A;  3A5U A;  3OTO L;  3RZO H;  2V1C C;  4XIG S;  4GOP B;  2KCT A;  4DV1 Q;  1KD1 C;  1PYB A;  1LM0 A;  3PUW A;  3CD6 A;  1PV4 A;  4DR4 Q;  2IX0 A;  4DK6 C;  2XTI A;  4PZ8 A;  2YYZ A;  4DK3 C;  4K0K Q;  2YTV A;  5JEA J;  3S14 H;  4A3J G;  3KOJ A;  4JV5 Q;  1V1Q A;  2JK8 A;  2Q2U A;  2UUB L;  4JI4 Q;  2JA8 G;  1EIF A;  5IYC G;  2JQO A;  1VQB A;  5JJL A;  4GLA C;  4HJ9 A;  3PO2 G;  1XPR A;  2VQF Q;  2B63 G;  2AWN A;  5HGQ A;  2MO1 A;  3S16 H;  1VQ6 A;  1LTL A;  2EQS A;  3HOV H;  3PSI A;  2A1A A;  2K5H A;  3S2D H;  3UDG A; 
#chains in the Genus database with same CATH topology
 4I65 A;  3PF5 A;  2PCF B;  3H3V C;  1EY7 A;  1QVG A;  1A15 A;  1JMC A;  5I2X A;  2IX3 A;  5EPJ A;  4FF4 A;  1H9J A;  1UEA B;  2F0N A;  5ISR A;  1CSQ A;  2HQE A;  5BN4 A;  1A8V A;  1OXT A;  5C0X G;  3FHW A;  1TWA H;  1VQJ A;  1D2B A;  5IGG A;  2LY7 A;  5KYL A;  3A54 A;  4JYA Q;  4JI4 L;  3GTM B;  2F52 A;  1XMQ Q;  4DR1 L;  1G8Z D;  2UU9 Q;  4DR7 Q;  1VQM A;  1EIH A;  4QL5 A;  4QF4 A;  1WVL A;  3I4M B;  1II3 A;  4IUT A;  2JA7 H;  1KTK A;  1RTO A;  3S24 A;  3KBX A;  5AJ3 L;  4AYB E;  4UAI A;  1W3S A;  2K5N A;  1U9R A;  4DUZ Q;  3U50 C;  1IW7 C;  1KAA A;  5ELC A;  1Y8N B;  1HA6 A;  2PI2 A;  5JEA G;  5LL6 X;  4A3F B;  2R6G A;  1D1I A;  5E4W C;  5CV7 A;  2I0Q A;  2NBF A;  1XPO A;  3J80 L;  4JCV E;  2VB2 X;  1Z7T A;  3HOV G;  1MGS A;  4CGY B;  1Q82 C;  3S1M B;  2MUY A;  3PV0 A;  4QMG A;  4DV7 L;  1EWC A;  5C4X G;  5LMN Q;  1ASZ A;  2RHS B;  1XX8 A;  2EVB A;  2F1M A;  4DXF A;  2OQK A;  4LUV A;  4DA2 A;  3G48 A;  2WII B;  5DLQ E;  1N33 Q;  4LFC L;  1VQF A;  2NN6 H;  4LW1 A;  3H15 A;  1CSP A;  4AQY Q;  1MSH A;  3JAM i;  3RLF A;  1PH6 A;  3SXH A;  1Y1V G;  3K5L A;  1EYD A;  3K58 A;  3PUV A;  2FFK B;  1BNZ A;  1EQT A;  3C1E A;  2NZO A;  3OIQ A;  3TQY A;  4ZK9 B;  4OWW B;  2LSS A;  5JVH 3;  1ZEQ X;  2G9D A;  1HUN A;  2Z4I A;  1K8M A;  4HIO A;  1DGS A;  4JI1 Q;  4ZKB B;  1S5C D;  2LXJ A;  1PMR A;  1N9W A;  2UXB Q;  1DOL A;  1S40 A;  2MGS A;  1IHZ A;  5EKI A;  4L5R C;  4A3M H;  1KAB A;  1F2Z A;  2HHH Q;  3OWE B;  3SR1 A;  3P75 A;  4KMU C;  5KNB A;  4HJ8 A;  2KCN A;  2J4X A;  4F8M A;  3FP9 A;  1X3Q A;  2C9O A;  1JJC B;  2N88 A;  4O2D A;  3KJP A;  1SSO A;  1XJV A;  2NZ1 D;  3FVQ A;  4CJ2 C;  1IYU A;  3LWE A;  1Y1W B;  3T4A C;  2NVY B;  4KLK A;  3PUZ A;  3H0G B;  2QKI C;  1N36 Q;  2RVL A;  4LF5 Q;  5DNF A;  4Y7N B;  1CI3 M;  1YNJ D;  1STE A;  5IT9 L;  4C3I G;  3UE0 A;  3PO3 H;  3P20 A;  1RKN A;  1K0R A;  3BZC A;  2EJG C;  3SDZ A;  2F0V A;  4DV6 Q;  4R1J A;  4A3E B;  3E0J A;  4A3G H;  1NUC A;  4ABN A;  4RMF A;  1H95 A;  4FF1 A;  2ZTE A;  4UPA A;  4DN4 M;  5CBA E;  3KDF A;  3M7G A;  1ZKO A;  1B44 D;  3I70 A;  3SK6 A;  2JA6 H;  3GO5 A;  4G4K A;  4KY5 A;  4DR6 L;  4ZRZ A;  2K32 A;  3K6O A;  1PHJ A;  4BY7 G;  4FF2 A;  1I50 B;  1SBB B;  1C0A A;  1PFS A;  1S5D D;  4LFB L;  3JAM L;  5AFW A;  3N52 A;  1U5K A;  2EYO A;  5CV9 A;  4YWL A;  1Q12 A;  3Q8D A;  4AYB B;  1PDQ A;  3S1N B;  1O7L A;  1TII D;  1TWH H;  3ER0 A;  2VY3 A;  3PF4 A;  4YWK A;  4XQQ A;  1GM5 A;  4QQB X;  2IHE A;  1JE5 A;  2AQ3 B;  2AUK A;  4JI3 Q;  4RGO S;  2BDO A;  4FXD A;  1PZK D;  2KCM A;  4CDE C;  1VF7 A;  4LFA Q;  1SXT A;  4JI6 L;  1UEB A;  2ENB A;  2JE6 I;  4XT1 B;  4IUN A;  1MHW C;  1F2Y A;  2F0P A;  3I72 A;  2KHI A;  2ZM6 Q;  1PTO F;  2CQA A;  4CKB A;  4DF7 A;  2PZT A;  1BDO A;  1JWM D;  1YEZ A;  1ICF B;  1HUM A;  1G91 A;  3GV3 A;  3CC7 A;  2CH4 W;  1TS3 A;  2WAQ E;  4DR2 L;  4BY1 B;  4DGZ A;  4FDB A;  1IBK L;  3BYT B;  1V8Q A;  3CHB D;  2IPK D;  4BXX H;  3I4M G;  1JWU D;  4LF8 Q;  2SOB A;  2UXC Q;  1TWF B;  2J0T D;  4HMJ A;  4A4I A;  4A3C H;  1FYC A;  4RA8 A;  4B3S Q;  2F0D A;  3NP8 A;  1GUW A;  1EL0 A;  1QVC A;  1FNU A;  3SEB A;  4A3F G;  4X3T A;  1VQ4 A;  1VQO A;  3U9S A;  3LGJ A;  2FMC A;  4GN5 A;  1GUO A;  4UP9 A;  1TU2 B;  4HCE A;  1YHQ A;  1A3T A;  1EQV A;  2SDF A;  4DXG A;  1S3O A;  4LUZ A;  2ZJR A;  2KJX A;  4B3R L;  2JA7 B;  2Z4H A;  3CPW A;  4CJ1 B;  4C2M H;  4LF6 Q;  1PFN A;  3CC4 A;  3BZK A;  1SAP A;  3NE5 B;  3AU7 A;  1YNJ C;  2BH8 A;  4IFD I;  1G6Z A;  3RR5 A;  2B2T A;  2RDG A;  1Y14 B;  1WD1 A;  1XNQ Q;  4A3J B;  1HFN A;  4DNI A;  2VUM H;  1B9M A;  1Q8K A;  2H5X A;  3Q6S A;  3PO2 B;  4Z9C B;  1PZI D;  1GOZ A;  1NTG A;  1SE8 A;  3NWS A;  4LF7 L;  1D5Z C;  2VL6 A;  1HHV A;  3UDF A;  2E5L Q;  1OTC A;  4IPH A;  4QB4 A;  3MFG A;  3BS1 A;  1BCP F;  1AEX A;  4ID6 A;  5LMN W;  3NXW A;  1NAP A;  4P71 A;  3SK4 A;  2P5Z X;  1W6J A;  5KEE A;  3W2D A;  4JI2 Q;  2NVQ B;  3NEN A;  5IWA L;  5FO9 B;  1Y1W G;  3H0G G;  3PUY A;  1LAC A;  3F2U A;  1CA5 A;  2L11 A;  3SE0 A;  1EUJ A;  3FRP B;  4DV5 Q;  3HOX H;  4KHP Q;  2ZJQ A;  1UE6 A;  4NW2 A;  1KAW A;  1D8L A;  1HR0 L;  4LUO A;  2JSO A;  4ILW A;  4L6T B;  5HUR A;  4R4T A;  2VW9 A;  4A3E G;  3K80 C;  4JV5 L;  5FOB B;  2VB3 X;  2WAQ B;  1PTO H;  2KUM A;  1CKN B;  2HD3 A;  1M1K C;  4IFD H;  3D0F A;  3S16 B;  1HJP A;  4RH6 A;  2NVX H;  3MXU A;  4GNX B;  3S2D B;  2PQA B;  2EYH A;  1RIP A;  4AYB G;  1ICW A;  3S1R B;  3AFP A;  3J80 E;  2ZTD A;  4JI0 Q;  1DYQ A;  2E2D C;  3H91 A;  1VQN A;  1SFO H;  3HOU G;  1Z47 A;  4J1M A;  2MNA A;  2JEA I;  3HGB A;  1TXY A;  2JA6 B;  4ZQ3 A;  1V1P A;  1KDB A;  1S5E D;  5M5X B;  4RHS A;  5IGC A;  2VNU D;  2A69 D;  4N8X 1;  4OO1 G;  1YI2 A;  3S17 H;  3G6E A;  3VA7 A;  2UUA Q;  4JBJ A;  4ZLT F;  4BY1 G;  3DM1 A;  2IWH A;  4F87 A;  5IYC H;  1I6H H;  3KUP A;  1MBY A;  1E1T A;  5GQO A;  5HY6 A;  1E22 A;  1LTB D;  2Q2I A;  4UY8 C;  4OIK A;  2PNR C;  1EY0 A;  1QB5 D;  3EA6 A;  3OTO Q;  2E8G A;  3OW2 A;  1LTR D;  5FK9 C;  3Q22 A;  1JOK A;  3EVQ A;  5EBD A;  2E2H H;  4G7O C;  2R7F A;  4GKK L;  3J7A F;  3C46 A;  4EQ5 A;  4DK0 A;  1L0Y B;  2R61 A;  3DEO A;  3K7A H;  5FJ8 H;  1T5E A;  5IP7 G;  2R92 H;  3IL8 A;  1VQI A;  5FLX L;  4GZY C;  5DM7 3;  5ELO A;  5GAD C;  1J8I A;  3I55 A;  1A63 A;  3NHH A;  1VQC A;  4DKA C;  4X3K A;  1BBX C;  2A8V A;  3H6M A;  1DOM A;  4PMB A;  3Q23 A;  1VQ5 A;  1BOS A;  2PW7 A;  3RZO H;  4XIG S;  2KCT A;  1PYB A;  1LM0 A;  4C3J B;  4DK6 C;  1B1Z A;  4OHJ A;  3NTH A;  1AP0 A;  2YTV A;  2XRQ D;  3LX0 A;  4A3J G;  2JK8 A;  1NNX A;  4JI4 Q;  2JA8 G;  4E6I A;  1GHJ A;  1K83 B;  2JQO A;  4C2M B;  3PO2 G;  1E0B A;  5HGQ A;  5JPM C;  1LTL A;  3JC6 6;  3SK5 A;  2RCN A;  4KHV A;  4YY3 L;  3HOY B;  2ZTC A;  1EY4 A;  3AMU A;  1LAB A;  5IGD A;  3JAM E;  1BKB A;  3F1Z A;  1EY6 A;  2X6G A;  4ZKC B;  1CM9 A;  1EQR A;  1NCV A;  4LAA A;  4DAP A;  2K14 A;  2OCE A;  1SDF A;  4L5S A;  5M3M B;  3HOZ B;  4UHV A;  1BBW A;  3T56 B;  3OMC A;  2RA4 A;  2A5H A;  2ICI A;  1SR3 A;  1PH8 A;  3J81 i;  2KCC A;  5KYI A;  1NBW A;  1PRT F;  1V43 A;  2Y0S E;  3DMU A;  5FLM G;  1C9O A;  3KFU A;  5FKA C;  5F2D A;  3PUX A;  1I4X A;  5CV5 A;  4DV7 Q;  1ENC A;  1HPC A;  1WTP A;  1I4G A;  2NTS A;  3GTP B;  2CVR A;  2L15 A;  4TKO B;  2OWO A;  4LFC Q;  1NR2 A;  2E2I H;  2UUC L;  3T1Y Q;  4DR3 Q;  3L7Z C;  2B8G A;  2N3S A;  4KD3 A;  2F0K A;  4WJ4 A;  3D31 A;  5C5L A;  4OX9 L;  1CQV A;  5BR8 L;  2WAQ G;  3ZYY X;  4MZ9 A;  1L1O B;  1PYS B;  4UP7 A;  1F9P A;  3GTL B;  4BBR B;  3UDX A;  2E2J H;  1Q8I A;  5CBE E;  1LTI D;  2XRS D;  3HOX B;  1PH1 A;  2L55 A;  1HZC A;  1SRO A;  5M3F H;  4IUV A;  4CDF C;  1LT6 D;  3U9O A;  3RMH A;  2A6H C;  4KHZ A;  1E2W A;  2JA5 B;  2B2V A;  1AH9 A;  5IY0 A;  1XPU A;  5J22 A;  3FKI G;  2HDL A;  1QG7 A;  3NTI A;  2JA6 G;  2R93 B;  5JJK A;  1GKH A;  4IQZ A;  4C3H H;  5C44 H;  4B9X A;  1SNQ A;  3WOF A;  5C0X J;  1HZ9 A;  4KN7 C;  5K5P A;  3J7Z C;  4IUP A;  2B39 A;  5ELB A;  1R9T B;  2F0J A;  3KYH C;  3ERQ A;  3I4O A;  1V1O A;  5EAY A;  2ID0 A;  4ZAI A;  1OXS C;  1XMO L;  3DWQ A;  4A3I H;  1TQO A;  4CJ0 B;  1PFM A;  3I2Z A;  3J81 L;  4HJ7 A;  1U4P A;  1ZYR D;  1E3P A;  1PZJ D;  3B6Y A;  3UDI A;  4ODG A;  3SGI A;  1GUG A;  1YIT A;  1KL9 A;  4PQX A;  1KDA A;  4KJN A;  1HNZ L;  1I6H B;  3QIA A;  4A3L G;  5IGE A;  4DR6 Q;  2A6E C;  3D6C A;  1FR3 A;  4V0B A;  4KI0 A;  2NN6 I;  4DR5 L;  1C4Q A;  5KIX A;  3IRB A;  4POG A;  5M9O A;  1YNN D;  5C3E B;  1S72 A;  4A3D B;  2BDN A;  5IYD H;  2PZU A;  2B29 A;  2RQX A;  2F0E A;  4X66 Q;  1GHK A;  5D14 A;  1WJJ A;  2DNE A;  1L2F A;  4C3J G;  2B8F A;  5I4D A;  4JI6 Q;  5C4H A;  3STB C;  4XTC S;  4A3K H;  1Q46 A;  4K5X A;  3K7A B;  3HOW H;  3P7J A;  1GO3 E;  3MAQ A;  4J8Q A;  5FO7 B;  4JOI C;  2Y0S B;  1VCI A;  1VMP A;  4DR2 Q;  3IFT A;  4A3B B;  4G57 A;  1UUP A;  3CMA A;  1EFI D;  4K2K A;  4P74 A;  3HOY G;  2QCP X;  4ALP A;  1HXY D;  5EBC A;  3GTG B;  5CV6 A;  5JVG 3;  1QJO A;  2IL8 A;  3MXG A;  5C4J H;  2MPM A;  4RG1 A;  4NPS A;  2R7D A;  3MZ5 A;  2BH2 A;  3A7L A;  2LKV A;  5LHY 1;  2B2Y C;  1Z9F A;  2Q2H A;  5JJZ A;  1ML0 D;  2B2W C;  2A74 C;  1Y69 U;  4X64 L;  1IYJ B;  1SYC A;  2ASB A;  5M3M G;  1SE2 A;  3HOZ G;  4XXE A;  3NEM A;  3CCU A;  2Q8R E;  1UWV A;  4H44 C;  2K5Q A;  2PO4 A;  2Z9H A;  3CRK C;  2JP1 A;  3FPU B;  4BWG B;  1E7Z A;  4EX5 A;  4B3R Q;  1ZXT A;  4OWX B;  1BQQ T;  4RKL A;  4QCL A;  4TVA B;  4Q5V A;  1HTP A;  1VQD A;  4O42 A;  4RHR A;  3J7A 5;  4KJO A;  1HTL D;  2DUD A;  1O80 A;  4B08 A;  2ALY B;  1A2U A;  1D7Q A;  3OYY A;  1J5E L;  2R7Z B;  3M7N A;  4IOA A;  1PVO A;  4DNR B;  2DNC A;  3F2D A;  4FVM A;  1ZYR C;  4DNT B;  1EU3 A;  4X62 Q;  3RUZ A;  2EJF C;  2R3Z A;  4MNO A;  4FO2 A;  5BN3 A;  1I3Q B;  4BBR G;  3J80 c;  4R4I A;  3U4Z A;  3HOX G;  2MHV A;  3TP6 A;  5CYU A;  3AYH B;  1E24 A;  1HQR D;  5GRO A;  3GTQ H;  1CK1 A;  3GP7 A;  2HUG A;  2C35 B;  5LMU L;  1YNN C;  3M4Y A;  4GLV B;  1CZG A;  1FL0 A;  4HSV A;  2JA5 G;  1LT5 D;  2VQE Q;  3A8K E;  1HZB A;  4JBW A;  2IJ0 A;  5FLX E;  1NR4 A;  2R93 G;  3CQZ H;  3E9H A;  3I91 A;  4DUY Q;  3V05 A;  2BOS A;  1IKM A;  2SNM A;  2X6L A;  3L0O A;  2OTL A;  4DAY B;  1YHB A;  2BE5 D;  4YCV A;  3M3Y B;  1QNK A;  5ELD A;  2B2U C;  1IYV A;  4R4C A;  4B3T L;  1SYE A;  4GOP C;  4C1N I;  4IUQ A;  1SYF A;  3I56 A;  2B63 B;  1Q1B A;  1QIL A;  4A93 B;  3ND9 A;  2I5M X;  3DXJ C;  3TP5 A;  1CKN A;  2NYZ D;  1HR0 Q;  3I4N H;  2ICE C;  3W5O A;  4C3H B;  3HS0 C;  2QGQ A;  4DV3 Q;  4GNX A;  2EYM A;  2HDM A;  2PQA A;  3HZX A;  3PIP A;  5E4X A;  1KLU D;  5C4Z A;  3A7A B;  1TVX A;  5K36 H;  1KHI A;  1DD2 A;  3J7A V;  4HTH A;  4L63 B;  2NTT A;  1IZ6 A;  1EY5 A;  4FYD A;  4JPB W;  2RBM A;  4Y52 H;  1X9N A;  2YU9 B;  1LTS D;  5TSS A;  4A3I B;  1H9S B;  5C3E G;  1I6V C;  2NVT H;  4A3D G;  1SMX A;  2EJM A;  5M5W B;  3M85 A;  1VQP A;  5I2Y A;  5IT9 c;  3RD4 A;  2QIL A;  1LT3 D;  5ELN A;  4DR4 L;  4IUU A;  1JT8 A;  1G2S A;  4EVO A;  4LF9 Q;  1TT2 A;  3C2P A;  3AEV A;  4BBS H;  2CKZ B;  1UNS A;  1G51 A;  5I9O A;  4K0K L;  5IP9 H;  3K8A A;  2EY5 A;  2RKS A;  2UXD L;  2BCO A;  1A6X A;  1NE3 A;  3PQI A;  4GN4 B;  4PMW A;  1Q7Y C;  4RCN A;  3TS2 A;  2Y0S G;  1K0S A;  1G6P A;  3NTK A;  2KED A;  1LTA D;  4A3B G;  4I7Z C;  5GAE C;  3RLO A;  3K81 C;  4XYO A;  3JAM c;  3QWN A;  2QF7 A;  2OT2 A;  3S15 H;  1U4L A;  3GTK H;  1T9H A;  2E74 C;  2TMP A;  3NSW A;  1YIJ A;  3OHX C;  4LWC A;  2F0L A;  2AMC B;  3HOW B;  2DY8 A;  3MEH A;  1TWA B;  3NQT A;  1F9Q A;  2AQ2 B;  1CT1 D;  2HQL A;  4Q0F A;  4R4O A;  1JR0 D;  3T13 A;  2Z6K C;  1N32 L;  2EE1 A;  3C3L A;  1D1K A;  1NMG A;  2F3I A;  2K50 A;  1Q1E A;  3J81 j;  1WTV A;  1X54 A;  1N34 Q;  2Q8T A;  2N49 A;  2BE5 C;  3HFZ B;  2UU9 L;  4PMC A;  2PMZ E;  2KQ3 A;  3MTS A;  4PV1 C;  4EQO A;  4L5Q A;  1AZP A;  3P1H A;  4DUZ L;  2GVB A;  2EYJ A;  2RF4 A;  3MC0 B;  2R7Z G;  2HCI A;  4XYQ A;  3VR4 A;  1MIU A;  3EJI A;  1PXU A;  4KK7 A;  3U4V A;  3CF5 A;  2I5H A;  1B9N A;  1VMC A;  3J81 E;  1MD2 D;  1B7Y B;  2MP1 A;  3CU7 A;  3QG1 A;  3GTJ H;  1JB7 A;  1I5F A;  3MA2 B;  5LMN L;  1XTD A;  3PIO A;  2XN9 C;  1I4P A;  1PTO D;  1SN8 A;  4R9W A;  1X65 A;  1FGU A;  1OXV A;  4KV6 A;  3VR2 A;  3EIV A;  3RNU A;  4AQY L;  1VQL A;  4I7A A;  4GOP B;  3KK7 A;  4DFA A;  1AN8 A;  1L0X B;  4PZ8 A;  5C3X A;  4G7H C;  2EPB A;  3S14 H;  1B3Q A;  5JEA H;  2F0T A;  1V1Q A;  2Q2U A;  1TY0 A;  2UUB L;  1EIF A;  4GLA C;  4HJ9 A;  1H9R A;  2VQF Q;  2B63 G;  1F9R A;  2F0W A;  2MO1 A;  3SHL A;  3HOV H;  2K5H A;  3NUC A;  4A93 G;  1WCM H;  3RN5 A;  2FXQ A;  1DXM A;  2EOT A;  2NWG A;  2K33 A;  5C4X H;  2B3G A;  2DJG C;  1L1O A;  4A3M B;  1SNO A;  4RAU C;  2DY7 A;  3CQZ B;  1DOK A;  1JOQ A;  2UUC Q;  1EZ6 A;  4DV1 L;  1UE1 A;  2KOL A;  1LTT D;  3RLN A;  4OX9 Q;  2XIW A;  1Y1V H;  3MEF A;  1JJ2 A;  1SNP A;  3T51 B;  5BR8 Q;  3MXP A;  4JBK A;  1VQ8 A;  3S9W A;  1P8L A;  2L5T A;  3BZD B;  3D4R A;  1CHQ D;  2AUJ D;  4LF5 L;  1VQ7 A;  1K3R A;  1SLJ A;  2F03 A;  1L0W A;  3T1H L;  1XXG A;  3T53 B;  3PO3 B;  4H13 C;  5M5Y H;  1TR5 A;  4ZUI A;  1HNW L;  1O7Z A;  1DCZ A;  3S1Q H;  4A3G B;  4B3M L;  4V19 0;  4DPG A;  2K28 A;  2O5J C;  2FMM A;  3W1G A;  2YTX A;  2EY6 A;  2QEX A;  2K4K A;  3EQL C;  1C8C A;  2PMZ B;  4LF4 L;  4K5W A;  3NBH B;  3S2H H;  1TWC H;  3GTO H;  4BS9 A;  4XQN A;  1U4M A;  4EQP A;  4QUC A;  1D5X C;  4IJL A;  3L2P A;  2Z1C A;  4TRD A;  3K59 A;  2KBN A;  4YHH Q;  3R8B A;  1TWH B;  3TZU A;  1XMO Q;  1PTO C;  2WB1 E;  3TS0 A;  3UE1 A;  1FVI A;  1MI2 A;  4R8N A;  1VDZ A;  1JQY D;  4RWS C;  3QJY A;  1EEF D;  3E5S A;  4QUF A;  3RZD H;  4FP5 D;  2D9U A;  2L0C A;  4PZ6 A;  3KF6 B;  4K6D A;  1RJT A;  4H02 A;  2JN4 A;  2ZM6 L;  3VYR A;  3IFD A;  4IJH A;  3NQI A;  2K05 A;  1VQK A;  1O7Y A;  1GUT A;  4IPD A;  1ASY A;  3W3A A;  3E9I A;  3S15 B;  1HA5 A;  2DJF C;  2N78 A;  4DR5 Q;  4BY7 H;  1TS5 A;  2JA7 G;  3BVG A;  1EY9 A;  2EIF A;  4HR7 B;  5G3L F;  1EWI A;  1Y8O B;  2A6H D;  4B3S L;  2I5L X;  5L37 A;  4IPC A;  1QUQ B;  5EPK A;  4JBM A;  4XT3 B;  1KIX A;  4FXK C;  3D4W A;  2QW7 A;  2K01 A;  1U4R A;  1FJG L;  5GAG C;  4NMZ A;  3CC2 A;  3G4S A;  3A55 A;  2G5D A;  1IBL L;  2KEN A;  1VS0 A;  1JIC A;  2F0G A;  4P72 A;  5IT9 E;  3T16 A;  2WFW A;  1WYD A;  2MQH A;  3GTM H;  4N8F A;  4DR1 Q;  5E3F A;  1TY2 A;  1NSN S;  3RN2 A;  5FLX c;  1BVS A;  1VQG A;  3ERO A;  5KRU A;  4QGU A;  2M00 A;  2NN6 G;  3I4M H;  3QB3 A;  4WOR A;  5AJ3 Q;  1RHP A;  3DM3 A;  3M4O H;  5A2Q L;  4ULL A;  3ITP A;  1ET9 A;  2SEB D;  4C1N K;  4F7X A;  3KLW A;  1XNQ L;  2XVS A;  4L5T A;  1WTX A;  3HP3 A;  2VUM B;  4N9P A;  3GTJ B;  4A3F H;  2GA4 B;  4NXM L;  5CV8 A;  1BCP C;  5EKK A;  5T1G A;  3MXN B;  4KN4 C;  5D3I B;  2A6E D;  3ULP A;  1CZW A;  3R2I A;  2RSO A;  5COR A;  3K7U C;  1JWS D;  4QJF A;  5CV4 A;  4ZYS A;  2WIN B;  3S1M H;  5A35 A;  4RGM A;  3FDT A;  2PYK A;  4U67 3;  3HKZ E;  4A3M G;  1EOT A;  2OEO A;  5HGT A;  1SNM A;  5D3D A;  1QOH A;  2LMC B;  3GDE A;  4OEM B;  1STB A;  2EYL A;  3VYU A;  2AWO A;  2Q2T A;  1WTR A;  1J5E Q;  2F3W A;  3CRL C;  4ME5 A;  3TSS A;  3VR5 A;  1B50 A;  3STB D;  1HFG A;  5J39 A;  4P2C B;  1IBM L;  2IX1 A;  2ES2 A;  4R4Q A;  1QCB D;  2AQ1 B;  4YCU A;  4HED A;  2KHJ A;  1WCM B;  2E76 C;  1K8O A;  1HNX L;  1I94 L;  4K14 A;  2WB1 B;  4NP5 A;  1M8A A;  3CKI B;  2G9H D;  1GUN A;  3PO3 G;  3FMC A;  3MFY A;  4DAY A;  3FPP A;  2VS1 A;  1CFM A;  2OQ0 A;  2MO0 A;  1VQA A;  4A3G G;  3D3R A;  5J3B A;  3URY A;  4PNY A;  1BXT A;  1WD0 A;  3G71 A;  3G7L A;  3OWF A;  3KF8 B;  4CDC C;  1PTO B;  1QE6 A;  3VYT A;  1FNW A;  4LK1 C;  4A75 A;  3OIP A;  2XNA C;  2D0O A;  3J7Y W;  3NEL A;  4K6L A;  4KD4 A;  2NVX B;  1LLR D;  1V9P A;  1SRU A;  1JCK B;  1G2T A;  3H0G H;  3WOE A;  1SJE D;  1NJI C;  4K8I A;  2N55 A;  2H1E A;  4YIJ A;  4JVZ A;  2D62 A;  1QNU A;  4KY7 A;  5CMD A;  1B2T A;  4Y7N H;  1SFO B;  4R8I A;  1PRT D;  5I6Y A;  4HN7 A;  4JI7 L;  1X3E A;  3CCL A;  1C48 A;  1ESR A;  3F8T A;  1H9S A;  4A3E H;  1SE3 A;  2F0F A;  3S17 B;  1KDC A;  2LS0 1;  4JOI A;  3EN2 A;  5NUC A;  4J6H A;  3W1B A;  3ULL A;  4BXX G;  1I50 H;  1QWY A;  1CUK A;  4LFB Q;  1B53 A;  1AZQ A;  1E2Z A;  4OIJ A;  1A3U A;  3CCM A;  1FD7 D;  2A73 B;  1XNR L;  4A3C G;  1JC7 A;  1VQE A;  3ND8 A;  5IIF A;  3S1N H;  5CGK A;  3A74 A;  3K5N A;  1DZ1 A;  2Z6B A;  2WP8 J;  4N9T A;  4HJ5 A;  4HIM A;  2E2H B;  2JJQ A;  1W6K A;  3J81 c;  2B2Y A;  1WTQ A;  3HOU H;  3R3O A;  2B2W A;  2UXD Q;  1ET6 A;  5COY A;  5ELE A;  2MJ8 A;  3NK9 A;  1WI5 A;  3PMF A;  1PH7 A;  1WTH A;  1TWG H;  4OEL B;  1F77 A;  2R92 B;  1EYG A;  4BY1 H;  3HKZ B;  4QIW E;  1EOV A;  5IYB H;  1IBK Q;  2FIN B;  4JW0 A;  3E3X A;  2KA7 A;  4GKJ L;  5I9P A;  3I90 A;  1BCP B;  3RZO B;  2QA4 A;  1M4V A;  4KTA A;  1TWF H;  5T1I A;  3AB9 A;  2F4V L;  1EFW A;  3PCO B;  1UE7 A;  1XWE A;  4RFB A;  2VUM G;  1N32 Q;  3CP0 A;  2BA0 A;  4DAV A;  1UE5 A;  4FXG C;  1MKH A;  3TZD A;  1VQH A;  1H9K A;  1LYL A;  4IFD J;  3AQQ A;  2SNS A;  1K8A C;  2TSS A;  4GS3 A;  2F0I A;  5IP7 H;  1Q90 A;  4P75 A;  3M4O B;  3Q24 A;  3DUZ A;  4NXN L;  1GD7 A;  2F0U A;  1LO5 D;  1PRT C;  2PNH A;  4OL7 A;  4QY7 A;  1OO9 B;  1B3A A;  2D5D A;  1BR9 A;  1YNX A;  3N6R A;  5EQ0 A;  3D8G A;  4X65 L;  4A3J H;  1J9O A;  2B2U A;  3CAM A;  5D65 A;  2RDF A;  1A3V A;  5ELF A;  1ILQ A;  2JA8 H;  4GOP A;  1WCM G;  4X3S A;  1HH2 P;  1YZ6 A;  2WB1 G;  3PO2 H;  4F88 A;  1NMF A;  4DAM A;  3IKJ A;  3DHQ A;  3I3C A;  2ZT9 C;  3QR8 A;  2L9H A;  1SYB A;  4LF7 Q;  2E2I B;  1GXD C;  3T1Y L;  4DR3 L;  4JI8 L;  4IPG A;  1CQF A;  2KEC A;  1RTN A;  1QVF A;  2CHB D;  1BUV T;  1LUZ A;  4MN3 A;  1VQ9 A;  4DV4 L;  2DGY A;  4JI5 L;  5JPN C;  4IFD G;  2Z8L A;  2UUB Q;  2E2J B;  2WAC A;  4AH6 A;  2NVQ H;  3V2T A;  2VZA A;  5IWA Q;  1FNV A;  2ZXP A;  4DV2 L;  4J15 A;  2OXP A;  3A8I E;  2A68 C;  5M3F B;  5FLM H;  5J1Z A;  2O4X A;  5CC4 A;  2I07 B;  2HT1 A;  3K5O A;  3SK8 A;  2ATW A;  2PI2 E;  1O78 A;  5LL6 S;  2IHF A;  4DV0 L;  3CW2 C;  3BG3 A;  4M1U B;  1A0I A;  1TKW B;  1XTC D;  1P16 A;  3VR6 A;  3M9B A;  1F2L A;  4CDD C;  2V1C C;  1KD1 C;  4DV1 Q;  3CD6 A;  1ENF A;  1PV4 A;  3KLS A;  5C44 B;  1ONL A;  5IGF A;  4JV5 Q;  3GQB A;  1SYG A;  3PIP 3;  5A2Q E;  3DWA A;  1SMY D;  1LTG D;  5IYC G;  4H0L C;  1VQB A;  3I73 A;  4QIW B;  3VA5 A;  4RKB A;  1XPR A;  3S16 H;  2EQS A;  2WV6 D;  2A1A A;  3S2D H;  1FGB D;  3T1H Q;  3HEJ A;  4HID A;  3BJU A;  4DU9 A;  2N8N A;  3S1R H;  5C0X I;  3NBH A;  1N8R C;  3V96 A;  1HNW Q;  3MWY W;  4B3M Q;  3H94 A;  4H7B A;  1JB3 A;  3G6J B;  1DM0 B;  3FKI H;  2Z6K A;  1G29 1;  3K0Y A;  1PH2 A;  1CA6 A;  5M5X H;  4K8J A;  5FJ8 G;  4LF4 Q;  2E75 C;  2FHT A;  5FO8 B;  3NPP A;  5JAV A;  4IO9 A;  2R92 G;  2K5W A;  4GLX A;  3KF6 A;  2JEB I;  4UDU C;  3HKZ G;  1PLF A;  3F2C A;  2O2L D;  3TME A;  2VQF L;  4XQJ A;  3CCR A;  1I4H A;  3OPO A;  4X66 L;  1AFP A;  4HMI A;  3MVV A;  5I6W A;  1VF5 C;  3HOU B;  4GNX C;  1ROD A;  3OW7 A;  5IGB A;  1I4R A;  2D0P A;  4MHE A;  4NDX A;  4A3K B;  3FEW X;  2CW0 D;  1RF2 D;  1F9S A;  3KJO A;  1TS4 A;  1SYD A;  2PPB C;  1E1O A;  4GKK Q;  1TWG B;  2EXD A;  4JYA L;  1QUQ A;  2L12 A;  5JOB A;  2H4O A;  2M2L A;  2EYF A;  1XMQ L;  3ICE A;  4A3L H;  1PRT B;  1S4Z A;  2D2C C;  1D6E C;  4DR7 L;  3C1F A;  4RGN A;  4K2L A;  1BO0 A;  1LT4 D;  1AE2 A;  1A2T A;  1LV9 A;  2LXK A;  3DEP A;  4ME3 A;  5C4J B;  3CCJ A;  4WFN 3;  2OTJ A;  2VXW A;  2YTY A;  3MHB A;  3A0J A;  2NUC A;  2Q8I B;  1IKL A;  4JK1 C;  1FJG Q;  1MJE A;  3E6Z X;  5KNC A;  4OWT B;  1RCV D;  4RGT A;  5C3W A;  1IBL Q;  5IE8 A;  4C3J H;  1STN A;  3CPF A;  2X69 A;  4K5V A;  3UI2 A;  5C0X H;  4HIK A;  3E0E A;  1PH5 A;  1NY4 A;  3A8J E;  1YJ9 A;  4LJZ C;  1SMY C;  1K83 H;  2K7V A;  4OGQ C;  4HCS A;  1GJX A;  2NB0 A;  3PIO 3;  3OSO A;  4UP8 A;  2EZV A;  1EIY B;  2IY5 B;  4YY3 Q;  2IW3 A;  1EU4 A;  3HOY H;  3MXN A;  2V4D A;  2AHO B;  1O7I A;  1N33 L;  4ZCK A;  3CME A;  2K6A A;  3OOC A;  1OXX K;  4X62 L;  3M4Q A;  3L3O C;  3M4P A;  2JA8 B;  1I4Q A;  3HRZ C;  4NXM Q;  1E2V A;  4EGV A;  4G7Z C;  4X3U A;  1IL8 A;  4O0A A;  5IOD A;  1OXU A;  5M3M H;  3HOZ H;  2EDG A;  3D6W A;  3K57 A;  3GTQ B;  3K0X A;  5M3F G;  4JI1 L;  4HAE A;  1CKO A;  4DK1 A;  1S5B D;  1SND A;  3TN2 A;  4IZ8 A;  2C5C A;  2UXB L;  2VQE L;  1EZ8 A;  4JG2 A;  5C5M A;  1C7Y A;  2HIX A;  2HHH L;  3GTP H;  2F0S A;  3I8Z A;  5E1F A;  4DUY L;  4C3H G;  2YV5 A;  5C44 G;  2B2T C;  1K28 A;  3TP7 A;  2K52 A;  1X6O A;  2CW0 C;  3I7F A;  1RL2 A;  4KY6 A;  1IBM Q;  1BBU A;  2CWP A;  1HRJ A;  3A56 A;  3R2T A;  2GN5 A;  4LNQ A;  2CQO A;  3GTL H;  1CTM A;  4BBR H;  3HKS A;  1N36 L;  5KND A;  1HNX Q;  3ONA B;  1I94 Q;  2RCF A;  3KF8 A;  1XYI A;  2F3V A;  4PG3 A;  4A3I G;  3TRZ A;  2DN8 A;  5DEH A;  2HIV A;  3I4N B;  3BDL A;  3A5Z B;  1EYA A;  4EQN A;  4ZUJ A;  2LFN A;  1T5X D;  4DV3 L;  1X56 A;  2JA5 H;  2EY1 A;  2JXM B;  4DV6 L;  3KLR A;  1ILP A;  2ZXR A;  1WOC A;  3SVM A;  3CCQ A;  1EEI D;  2KHS A;  3BU2 A;  2R93 H;  1QZG A;  1F2M A;  2PZW A;  1YJN A;  1BCP D;  1SJH D;  1HR0 W;  1WTW A;  1K3B C;  2XSC A;  4X6A H;  1R9T H;  2NVT B;  4MTN A;  1Q81 C;  3NBI A;  5IYD G;  4P73 A;  2F0Q A;  4PZ7 A;  2Z0S A;  1KRS A;  2QEJ C;  1L1O C;  2ZJP A;  3KDF B;  1DJR D;  1W2B A;  1YJW A;  1KXL A;  4LF9 L;  3TEH B;  1JE4 A;  3QOL A;  4JI7 Q;  3Q0A A;  5C6A A;  4BBS B;  4NB3 A;  3FKI B;  4JI3 L;  5IOC A;  1K9M C;  4C3I H;  1CKM A;  4CHT B;  4A3K G;  4LFA L;  3ERS X;  2K03 A;  3HOW G;  2RSN A;  1EYC A;  1Z6H A;  4YWM A;  1ESF A;  1K8G A;  4HSP A;  2A19 A;  1HZA A;  5DAU A;  4HJA A;  1HNZ Q;  4BA2 I;  5IYB G;  2K1B A;  4OXP A;  2CH4 A;  3GTK B;  3CXC A;  1KLG D;  1KC8 C;  4JC0 A;  1U0L A;  5C3E H;  3D4D A;  5BN5 A;  5KGU A;  1QZH A;  1XNR Q;  4LF8 L;  4A3D H;  1AW7 A;  3CCE A;  2UXC L;  4S3S A;  3VYS A;  1RDP D;  3O13 A;  4KKT A;  3DLL A;  1X3G A;  1PH3 A;  1ENA A;  3DWP A;  4WRD A;  1GUS A;  1K73 C;  5GAH C;  3TDQ A;  3ZJY C;  5E7N A;  1R4Q B;  5DM6 3;  1TS2 A;  1N34 L;  1PH9 A;  3VR3 A;  2AKW B;  1B70 B;  4CKE A;  4A3B H;  3VDY A;  4LF6 L;  3U58 A;  1JJG A;  4GKJ Q;  3EBE A;  4MTK A;  4TSS A;  2CCZ A;  3AFQ A;  1KRT A;  2K04 A;  3K5M A;  3GTG H;  2PW5 A;  5CR3 A;  4AIM A;  2F4V Q;  3F2B A;  2J7Z A;  3GD7 A;  4YCW A;  2KVM A;  4CKC A;  1X3F A;  3NWT A;  1SEB D;  2KEE A;  3WWV A;  4POF A;  4X64 Q;  3CCS A;  1JOO A;  1MSG A;  3GV6 A;  4IUR A;  4A76 A;  4OON A;  2JA9 A;  3H09 A;  2M9V A;  1SNC A;  1EIG A;  1IXR A;  2HCC A;  3LWU A;  1R4P B;  2MFI A;  1PH4 A;  2E5L L;  3X3M A;  2K5D A;  4IN3 A;  1M90 C;  2K5V A;  4NXN Q;  2FJ2 A;  3BYY B;  1KNA A;  1STH A;  4LMQ D;  1YHA A;  4GN3 B;  1H9M A;  5G3L D;  2R7Z H;  3H3V I;  3S14 B;  1PFB A;  1STY A;  2F4I A;  5EJW A;  2XWB B;  2A69 C;  1X32 A;  3LNN A;  4JI2 L;  1MJC A;  4X65 Q;  4APV A;  2WKC A;  3CCV A;  1X3P A;  4MIU A;  1B8A A;  4B9W A;  1Y8P B;  1I3Q H;  2BA1 A;  3HOV B;  4CBV A;  3BVZ A;  1PYW D;  1HQM C;  5C4X B;  1KNE A;  2F0M A;  4DV5 L;  2QDL A;  4KHP L;  3I4N G;  2CFM A;  1YBY A;  5LMU Q;  2XWJ B;  3ULJ A;  4FNF A;  1AE3 A;  2XGT A;  4JI8 Q;  1D5M C;  5EPL A;  1RD9 D;  4OO1 I;  3KLS X;  3BVM A;  1Y1V B;  5K36 G;  3R93 A;  2CWA A;  4WJW A;  1IL2 A;  4DV4 Q;  2GVA A;  4JI5 Q;  4RCO A;  1X55 A;  1CHP D;  3BDO A;  1A62 A;  3M3Y H;  2K75 A;  1EQQ A;  1PA6 A;  4DV2 Q;  4WJ3 M;  1Q3L A;  4NKL A;  2EY2 A;  5EKL A;  4B3T Q;  4C56 C;  1SE4 A;  1WTO A;  1Y1W H;  2O5I C;  2B63 H;  2NVY H;  5EGT A;  3QO2 A;  4FF3 A;  2RDH A;  3OMG A;  4IOC A;  5M5Y B;  2F0H A;  2RHQ B;  4JI0 L;  4TQU S;  4DV0 Q;  4A93 H;  4BA1 I;  3IAY A;  1J6Q A;  2ZXO A;  2F0O A;  3S1Q B;  4BBS G;  1IW7 D;  2L1B A;  1EWH A;  5IP9 G;  3I4L A;  4L8J A;  1UAP A;  5H1S E;  1KQS A;  4M8A A;  3PGZ A;  3S2H B;  1TWC B;  3GTO B;  2EYP A;  2UUA L;  2NZH A;  5JJI A;  4XDX A;  4YHH L;  3L9A X;  3TBI B;  3TRE A;  1STA A;  2IT1 A;  3H3V H;  4U68 A;  1Q86 C;  1BF4 A;  2YU9 H;  1V1P B;  1GVP A;  1S5F D;  3QOJ A;  1YVC A;  4KKS A;  3J80 i;  2PQE A;  4C3I B;  5M5W H;  3RZD B;  1B4O A;  1WFQ A;  2JYO A;  3TP8 A;  3A5U A;  1EY8 A;  2B2V C;  3OTO L;  3PUW A;  1STG A;  4DR4 Q;  2IX0 A;  4O1N A;  2L4N A;  2XTI A;  3EFX D;  2WKD A;  2QDB A;  2YYZ A;  4DK3 C;  4K0K Q;  5JEA J;  3KOJ A;  4IAL A;  3X3N A;  4KKU A;  2OF1 A;  3WDN A;  1HCZ A;  5JJL A;  3BDC A;  4BY7 B;  1DON A;  1JOR A;  4OO1 H;  2AWN A;  3KBG A;  2A68 D;  2EXZ A;  1VQ6 A;  3PSI A;  2I46 A;  3HG9 A;  3UDG A; 
#chains in the Genus database with same CATH homology
 2RCN A;  4YY3 L;  3T1H Q;  4A93 G;  1WCM H;  3RN5 A;  2FXQ A;  4HID A;  5C4X H;  3BJU A;  2B3G A;  3PF5 A;  2ZTC A;  1L1O A;  2N8N A;  3S1R H;  5C0X I;  1N8R C;  1QVG A;  1HNW Q;  1BKB A;  1JMC A;  2UUC Q;  3F1Z A;  4BBS H;  4DV1 L;  4B3M Q;  1UE1 A;  1CSQ A;  1EQR A;  1A8V A;  1OXT A;  5C0X G;  3FHW A;  2K14 A;  3FKI H;  1TWA H;  3RLN A;  4OX9 Q;  2Z6K A;  1Y1V H;  1VQJ A;  3MEF A;  1JJ2 A;  5BR8 Q;  1G29 1;  2OCE A;  4JBK A;  1PH2 A;  1VQ8 A;  4L5S A;  5M5X H;  4JYA Q;  1BBW A;  1P8L A;  4JI4 L;  5FJ8 G;  4LF4 Q;  2F52 A;  1SR3 A;  1PH8 A;  3J81 i;  4IO9 A;  1XMQ Q;  4DR1 L;  4LF5 L;  2R92 G;  1NBW A;  5FLM G;  1V43 A;  2Y0S E;  4GLX A;  3KF6 A;  1C9O A;  2UU9 Q;  3KFU A;  4DR7 Q;  2JEB I;  1K3R A;  3PUX A;  1VQ7 A;  3HKZ G;  1SLJ A;  3F2C A;  4DV7 Q;  1VQM A;  1L0W A;  2VQF L;  4QL5 A;  3T1H L;  3CCR A;  4X66 L;  2JA7 H;  3S24 A;  5AJ3 L;  5M5Y H;  2L15 A;  4AYB E;  2OWO A;  4LFC Q;  1W3S A;  1HNW L;  2K5N A;  4GNX C;  2E2I H;  2UUC L;  3T1Y Q;  4DUZ Q;  2D0P A;  3U50 C;  4DR3 Q;  4B3M L;  3S1Q H;  4DPG A;  2PI2 A;  3L7Z C;  2N3S A;  5JEA G;  4WJ4 A;  3D31 A;  4OX9 L;  3W1G A;  2YTX A;  3KJO A;  2R6G A;  1E1O A;  5BR8 L;  2QEX A;  2WAQ G;  4GKK Q;  2EXD A;  2I0Q A;  2K4K A;  4JYA L;  1QUQ A;  4MZ9 A;  1L1O B;  1PYS B;  4UP7 A;  4LF4 L;  1XPO A;  3NBH B;  3S2H H;  4JCV E;  1TWC H;  3UDX A;  2E2J H;  3GTO H;  1XMQ L;  3ICE A;  4A3L H;  3HOV G;  4IJL A;  3L2P A;  1Q82 C;  4DR7 L;  1PH1 A;  2KBN A;  3PV0 A;  4DV7 L;  4YHH Q;  5C4X G;  5LMN Q;  1HZC A;  1ASZ A;  1SRO A;  5M3F H;  2RHS B;  1XMO Q;  1AE2 A;  2OQK A;  2WB1 E;  4LUV A;  3TS0 A;  2LXK A;  1FVI A;  3G48 A;  4KHZ A;  4ME3 A;  3UE1 A;  3CCJ A;  2OTJ A;  2YTY A;  5DLQ E;  4LFC L;  3A0J A;  1N33 Q;  1VQF A;  1AH9 A;  4LW1 A;  3H15 A;  3RZD H;  1CSP A;  5IY0 A;  4AQY Q;  1XPU A;  3JAM i;  3RLF A;  1PH6 A;  1FJG Q;  4PZ6 A;  3FKI G;  1MJE A;  3KF6 B;  4OWT B;  4H02 A;  2JA6 G;  1Y1V G;  2ZM6 L;  5JJK A;  1IBL Q;  5IE8 A;  4C3J H;  1GKH A;  3CPF A;  4IJH A;  4C3H H;  3PUV A;  5C44 H;  1VQK A;  5C0X J;  2NZO A;  4IPD A;  3TQY A;  1ASY A;  1HZ9 A;  4OWW B;  3J7Z C;  3E0E A;  4HIK A;  1PH5 A;  2LSS A;  1NY4 A;  1YJ9 A;  3KYH C;  3E9I A;  1K83 H;  2N78 A;  3I4O A;  4HIO A;  4DR5 Q;  4BY7 H;  1DGS A;  5EAY A;  2ID0 A;  4JI1 Q;  2JA7 G;  2EIF A;  1OXS C;  1XMO L;  4UP8 A;  2LXJ A;  1EWI A;  1EIY B;  1N9W A;  2UXB Q;  2IY5 B;  4YY3 Q;  4B3S L;  2I5L X;  4A3I H;  1S40 A;  4IPC A;  1QUQ B;  2AHO B;  3HOY H;  4JBM A;  1O7I A;  1N33 L;  1KIX A;  4L5R C;  4A3M H;  2HHH Q;  3CME A;  3I2Z A;  4HJ7 A;  1FJG L;  5GAG C;  3CC2 A;  1OXX K;  4HJ8 A;  1E3P A;  4X62 L;  3G4S A;  3JC6 6;  3B6Y A;  3UDI A;  2KEN A;  3FP9 A;  3M4Q A;  3SGI A;  1VS0 A;  1YIT A;  1IBL L;  1JJC B;  3M4P A;  4O2D A;  3KJP A;  1KL9 A;  4P72 A;  1XJV A;  4NXM Q;  2WFW A;  1HNZ L;  1WYD A;  2MQH A;  4O0A A;  4A3L G;  1OXU A;  5M3M H;  3HOZ H;  4DR6 Q;  3GTM H;  4KLK A;  3PUZ A;  3K0X A;  1N36 Q;  4KI0 A;  5M3F G;  2NN6 I;  4DR5 L;  4JI1 L;  4DR1 Q;  4LF5 Q;  3IRB A;  1CKO A;  4POG A;  3RN2 A;  1S72 A;  5FLX c;  1BVS A;  1VQG A;  4QGU A;  5IYD H;  2UXB L;  2VQE L;  2NN6 G;  2B29 A;  3I4M H;  3UE0 A;  4X66 Q;  3PO3 H;  4JG2 A;  1K0R A;  5AJ3 Q;  1C7Y A;  2HIX A;  2HHH L;  3DM3 A;  3GTP H;  1WJJ A;  3BZC A;  3M4O H;  1L2F A;  4DV6 Q;  4R1J A;  4DUY L;  2YV5 A;  5C44 G;  3KLW A;  4JI6 Q;  1XNQ L;  3STB C;  4RMF A;  4A3G H;  4L5T A;  4XTC S;  1H95 A;  2ZTE A;  4A3K H;  1Q46 A;  1X6O A;  2K52 A;  4UPA A;  3KDF A;  3HOW H;  1GO3 E;  3I7F A;  1RL2 A;  4A3F H;  4NXM L;  1IBM Q;  1BBU A;  2JA6 H;  2CWP A;  3GO5 A;  3MXN B;  4JOI C;  1VCI A;  4DR6 L;  4LNQ A;  2GN5 A;  2CQO A;  3ULP A;  4DR2 Q;  1PHJ A;  3GTL H;  4BY7 G;  4BBR H;  3HKS A;  3K7U C;  1PFS A;  4QJF A;  1N36 L;  1HNX Q;  1I94 Q;  4LFB L;  1C0A A;  1U5K A;  4YWL A;  3CMA A;  3S1M H;  4P74 A;  1Q12 A;  3Q8D A;  4PG3 A;  4A3I G;  3HOY G;  3TRZ A;  4ALP A;  1TWH H;  2HIV A;  3HKZ E;  4A3M G;  3A5Z B;  3ER0 A;  2VY3 A;  3PF4 A;  4YWK A;  3GDE A;  5C4J H;  4RG1 A;  4NPS A;  4DV3 L;  1X56 A;  1GM5 A;  2R7D A;  2IHE A;  1JE5 A;  4QQB X;  2AWO A;  2JA5 H;  2BH2 A;  2Q2T A;  4JI3 Q;  1J5E Q;  2KCM A;  4DV6 L;  1Z9F A;  2Q2H A;  4LFA Q;  4JI6 L;  1WOC A;  3STB D;  1UEB A;  2JE6 I;  3CCQ A;  3BU2 A;  2ZM6 Q;  2R93 H;  2KHI A;  1IYJ B;  4X64 L;  2ASB A;  1QZG A;  5M3M G;  3HOZ G;  1IBM L;  2IX1 A;  1YJN A;  3NEM A;  3CCU A;  2ES2 A;  1YEZ A;  1HR0 W;  3CC7 A;  4R4Q A;  1UWV A;  4YCU A;  4X6A H;  2WAQ E;  4DR2 L;  2KHJ A;  4EX5 A;  4FDB A;  1HNX L;  1R9T H;  1E7Z A;  1I94 L;  4B3R Q;  1IBK L;  4MTN A;  4OWX B;  1Q81 C;  5IYD G;  4P73 A;  4PZ7 A;  2Z0S A;  1KRS A;  4TVA B;  1L1O C;  3I4M G;  1VQD A;  4BXX H;  2ZJP A;  3J7A 5;  3KDF B;  3PO3 G;  4LF8 Q;  1W2B A;  2UXC Q;  1YJW A;  2VS1 A;  4LF9 L;  3TEH B;  1KXL A;  4A4I A;  2OQ0 A;  4B3S Q;  2DUD A;  2MO0 A;  4JI7 Q;  4A3C H;  1VQA A;  4NB3 A;  2ALY B;  1D7Q A;  4JI3 L;  3OYY A;  5J3B A;  1J5E L;  1K9M C;  4A3G G;  4C3I H;  1CKM A;  3M7N A;  4IOA A;  4A3K G;  1PVO A;  1QVC A;  3G71 A;  4LFA L;  3KF8 B;  3F2D A;  3ERS X;  3HOW G;  4A3F G;  1VQ4 A;  4X62 Q;  1VQO A;  3LGJ A;  4A75 A;  4YWM A;  4MNO A;  2D0O A;  3NEL A;  4GN5 A;  1K8G A;  4UP9 A;  1YHQ A;  2A19 A;  4BBR G;  1HZA A;  3J80 c;  4R4I A;  4HJA A;  1HNZ Q;  4BA2 I;  1V9P A;  3U4Z A;  5IYB G;  1S3O A;  1SRU A;  3HOX G;  4LUZ A;  2ZJR A;  4B3R L;  3AYH B;  1E24 A;  3H0G H;  5GRO A;  3GTQ H;  4OXP A;  3CPW A;  3CXC A;  1KC8 C;  4C2M H;  1NJI C;  4LF6 Q;  4JC0 A;  2C35 B;  5LMU L;  1U0L A;  5C3E H;  1QZH A;  3BZK A;  3CC4 A;  4GLV B;  1XNR Q;  2D62 A;  4LF8 L;  4A3D H;  3CCE A;  1FL0 A;  2UXC L;  2JA5 G;  4Y7N H;  2VQE Q;  4JI7 L;  2BH8 A;  4IFD I;  1X3E A;  1HZB A;  4JBW A;  3DLL A;  3CCL A;  1X3G A;  1PH3 A;  3F8T A;  2R93 G;  3RR5 A;  3CQZ H;  3E9H A;  1K73 C;  5GAH C;  4A3E H;  4DUY Q;  1Y14 B;  3ZJY C;  5E7N A;  1XNQ Q;  4DNI A;  1N34 L;  1PH9 A;  2OTL A;  3L0O A;  2VUM H;  4DAY B;  1YHB A;  4YCV A;  2AKW B;  4JOI A;  3EN2 A;  1Q8K A;  4R4C A;  2H5X A;  1B70 B;  4B3T L;  4GOP C;  3W1B A;  3I56 A;  3ULL A;  4A3B H;  1NTG A;  4BXX G;  1I50 H;  1Q1B A;  1SE8 A;  3VDY A;  1CUK A;  4LFB Q;  4LF7 L;  4LF6 L;  3U58 A;  2VL6 A;  3CCM A;  1JJG A;  3UDF A;  2E5L Q;  4GKJ Q;  1OTC A;  1XNR L;  4IPH A;  2I5M X;  4A3C G;  3EBE A;  2CCZ A;  1VQE A;  3S1N H;  3AFQ A;  1KRT A;  1CKN A;  3A74 A;  1HR0 Q;  3GTG H;  3I4N H;  2WP8 J;  3W5O A;  4HJ5 A;  5LMN W;  4AIM A;  4HIM A;  2QGQ A;  2JJQ A;  4DV3 Q;  3J81 c;  4GNX A;  2F4V Q;  2PQA A;  4P71 A;  3F2B A;  3HOU H;  3GD7 A;  3PIP A;  4YCW A;  2UXD Q;  1KHI A;  1X3F A;  4JI2 Q;  1WI5 A;  3WWV A;  3NEN A;  5IWA L;  4POF A;  4X64 Q;  3CCS A;  1PH7 A;  1IZ6 A;  1Y1W G;  3H0G G;  3PUY A;  1TWG H;  4A76 A;  4OON A;  4Y52 H;  1X9N A;  2JA9 A;  1EYG A;  4BY1 H;  5C3E G;  4QIW E;  1IXR A;  1EUJ A;  2NVT H;  4DV5 Q;  4A3D G;  1EOV A;  2MFI A;  5IYB H;  1SMX A;  3HOX H;  1PH4 A;  1IBK Q;  4KHP Q;  2E5L L;  2ZJQ A;  1UE6 A;  4GKJ L;  1M90 C;  3M85 A;  1KAW A;  1VQP A;  2K5V A;  5IT9 c;  4NXN Q;  1D8L A;  1HR0 L;  5ELN A;  4LUO A;  2QA4 A;  4DR4 L;  1JT8 A;  1TWF H;  4LF9 Q;  1YHA A;  3AEV A;  2VW9 A;  2CKZ B;  4GN3 B;  4R4T A;  1G51 A;  4A3E G;  3PCO B;  1EFW A;  5IP9 H;  2F4V L;  4K0K L;  3K8A A;  2R7Z H;  3H3V I;  3K80 C;  4JV5 L;  2UXD L;  1UE7 A;  2VUM G;  1N32 Q;  3CP0 A;  2BA0 A;  1MJC A;  1UE5 A;  1NE3 A;  1MKH A;  4GN4 B;  4JI2 L;  1VQH A;  4PMW A;  1Q7Y C;  4X65 Q;  1LYL A;  3TS2 A;  2Y0S G;  4APV A;  4OO1 G;  1G6P A;  4IFD J;  3AQQ A;  1CKN B;  3CCV A;  1K8A C;  1M1K C;  1B8A A;  4A3B G;  3D0F A;  4GS3 A;  1HJP A;  1I3Q H;  2BA1 A;  2NVX H;  5GAE C;  3RLO A;  4GNX B;  3K81 C;  2PQA B;  3JAM c;  5IP7 H;  4DV5 L;  1RIP A;  4AYB G;  3S15 H;  4KHP L;  3GTK H;  3AFP A;  4P75 A;  2ZTD A;  4JI0 Q;  3I4N G;  1T9H A;  2CFM A;  1YBY A;  5LMU Q;  4NXN L;  3ULJ A;  1GD7 A;  1VQN A;  1YIJ A;  1AE3 A;  4LWC A;  1SFO H;  2XGT A;  4JI8 Q;  1Z47 A;  3HOU G;  2PNH A;  2AMC B;  2MNA A;  2JEA I;  4OO1 I;  2HQL A;  1TXY A;  4R4O A;  5K36 G;  4QY7 A;  2CWA A;  1IL2 A;  2Z6K C;  1N32 L;  4DV4 Q;  2GVA A;  2VNU D;  1YNX A;  4JI5 Q;  1NMG A;  2F3I A;  2K50 A;  4X65 L;  1YI2 A;  3G6E A;  1Q1E A;  3J81 j;  1X55 A;  4A3J H;  3S17 H;  1X54 A;  2UUA Q;  3CAM A;  1N34 Q;  1A62 A;  3M3Y H;  2K75 A;  1EQQ A;  2N49 A;  3HFZ B;  4JBJ A;  1PA6 A;  2UU9 L;  2JA8 H;  4BY1 G;  4DV2 Q;  4GOP A;  4WJ3 M;  1WCM G;  1HH2 P;  2PMZ E;  5IYC H;  4B3T Q;  1YZ6 A;  1I6H H;  2WB1 G;  3PO2 H;  1NMF A;  1Y1W H;  1E1T A;  4DAM A;  2B63 H;  2NVY H;  5GQO A;  5HY6 A;  4IOC A;  1E22 A;  2RHQ B;  4JI0 L;  4L5Q A;  4LF7 Q;  4TQU S;  4DV0 Q;  4A93 H;  4BA1 I;  2Q2I A;  3T1Y L;  4UY8 C;  1J6Q A;  2GVB A;  4DUZ L;  4DR3 L;  4BBS G;  2RF4 A;  3OTO Q;  5IP9 G;  4JI8 L;  2R7Z G;  2E8G A;  4IPG A;  3OW2 A;  1QVF A;  1MIU A;  5H1S E;  1LUZ A;  2E2H H;  2R7F A;  1KQS A;  1VQ9 A;  4GKK L;  3U4V A;  4EQ5 A;  4DV4 L;  2DGY A;  3CF5 A;  3PGZ A;  2I5H A;  4JI5 L;  4IFD G;  2UUB Q;  4AH6 A;  2NVQ H;  2UUA L;  1B7Y B;  2NZH A;  2VZA A;  5IWA Q;  3K7A H;  3GTJ H;  5FJ8 H;  4DV2 L;  1JB7 A;  5JJI A;  1I5F A;  5IP7 G;  3TRE A;  4YHH L;  5LMN L;  1XTD A;  4J15 A;  3PIO A;  2IT1 A;  3H3V H;  1Q86 C;  2R92 H;  5FLM H;  1SN8 A;  2YU9 H;  1VQI A;  1X65 A;  1FGU A;  1OXV A;  5ELO A;  1GVP A;  5GAD C;  2HT1 A;  3I55 A;  2ATW A;  2PI2 E;  1A63 A;  1VQC A;  4DKA C;  3EIV A;  1YVC A;  2IHF A;  3CW2 C;  4DV0 L;  3J80 i;  5M5W H;  2A8V A;  3RNU A;  4AQY L;  1A0I A;  1VQL A;  1WFQ A;  1P16 A;  3M9B A;  1VQ5 A;  3A5U A;  3OTO L;  3RZO H;  2V1C C;  4XIG S;  4GOP B;  2KCT A;  4DV1 Q;  1KD1 C;  1PYB A;  1LM0 A;  3PUW A;  3CD6 A;  1PV4 A;  4DR4 Q;  2IX0 A;  4DK6 C;  2XTI A;  4PZ8 A;  2YYZ A;  4DK3 C;  4K0K Q;  2YTV A;  5JEA J;  3S14 H;  4A3J G;  3KOJ A;  4JV5 Q;  1V1Q A;  2JK8 A;  2Q2U A;  2UUB L;  4JI4 Q;  2JA8 G;  1EIF A;  5IYC G;  2JQO A;  1VQB A;  5JJL A;  4GLA C;  4HJ9 A;  3PO2 G;  1XPR A;  2VQF Q;  2B63 G;  2AWN A;  5HGQ A;  2MO1 A;  3S16 H;  1VQ6 A;  1LTL A;  2EQS A;  3HOV H;  3PSI A;  2A1A A;  2K5H A;  3S2D H;  3UDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...