3S2HH

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s2hH00
1VQ5A 4DR2L 3W1GA 2JJQA 5IP7H 3PO2H 1EQQA 1X3EA 3DLLA 1YI2A 3LGJA 2JA8G 2E8GA 1R9TH 1GD7A 2HIVA 2GN5A 1WI5A 1X65A 2N78A 4DR6L 1L2FA 2V1CC 2VUMG 1JJGA 1BBUA 1CKNA 4L5RC 4X65L 2AHOB 4A3GH 2B63H 3L7ZC 1K73C 2PNHA 2RCNA 3NEMA 1K3RA 4YWMA 3HOXH 1VQKA 3S1MH 4IOAA 4IOCA 3J80c 1PH3A 1KRSA 5JEAG 4B3MQ 4POFA 4DUYL 4A3LH 3KYHC 4JOIA 1U0LA 1WCMG 2AWOA 4A3MH 5C44G 2OTJA 5IYBG 3S15H 1W3SA 2K52A 3I4NG 2KCTA 3HKSA 1N33Q 1HR0Q 3HOVG 2K4KA 3F2DA 5M3FH 4DV7Q 1IYJB 5HY6A 4GLVB 1SLJA 3UDGA 1PH1A 1VQ4A 1EQRA 2LSSA 4YCWA 1I6HH 2BH2A 1FL0A 2D0PA 3MEFA 1XNRQ 4DV6Q 1L1OA 4UP9A 3KOJA 3GTKH 4NPSA 4AIMA 2WB1E 4JI5Q 2JA8H 4JI7L 1N36Q 1VQ7A 1IZ6A 4R4OA 1D7QA 5HGQA 1EUJA 4X62L 1B70B 1XTDA 2VUMH 1FGUA 2HIXA 1WOCA 2Q2HA 4QL5A 3UE0A 1JJ2A 4P74A 1VQNA 5IP9G 5IE8A 5ELOA 4DR7L 3DM3A 2PI2E 5GQOA 4NB3A 3JAMc 4IFDJ 3CCQA 4DUZL 4L5SA 4OX9L 1NBWA 3K8AA 1PHJA 4JI2L 3RN5A 4R4QA 1WCMH 2ZM6Q 2NVXH 3HOWG 4OWTB 5C44H 3PIPA 5IYBH 2OCEA 2NN6I 3I4NH 1V9PA 4IPDA 5ELNA 3T1HQ 3L2PA 1YJWA 3RLOA 4BY7G 1MIUA 5IYCG 2ZTCA 3KF6B 3RZOH 4UP8A 1YNXA 4B3ML 2K50A 4BBSG 5LMNW 3IRBA 4TQUS 3I55A 4HIDA 4A3CH 4LFAQ 3AYHB 4AH6A 2EQSA 2B3GA 4LWCA 5M5WH 4OONA 1N33L 3H0GG 1HR0L 3U4ZA 3U50C 2EXDA 3U4VA 1UE5A 2IT1A 4A4IA 3UDFA 4DV2Q 1IBLL 1XNRL 4DV6L 1GO3E 3HOWH 2ATWA 3GTMH 4JI5L 1HZBA 1CSPA 1QVCA 2N8NA 1OXVA 4DR5Q 3L0OA 1N36L 3PUYA 2OTLA 4NXNQ 4B3SQ 4LUOA 2F3IA 3CMAA 1PH7A 3KDFB 4A75A 1SRUA 4BY7H 4RMFA 1QZHA 5IYCH 2ZJQA 3PGZA 4K0KQ 1SROA 4KI0A 4BBSH 2IHFA 1K8GA 2NVQH 2F52A 3EN2A 4DKAC 1XMOQ 1JE5A 3CP0A 3G48A 4C3HH 2ZM6L 4DV4Q 1NJIC 2CFMA 3PO2G 3GTLH 1Z47A 1IL2A 4GKKQ 1WJJA 4QIWE 3M7NA 4R4IA 4QQBX 5LMNQ 3K7AH 3HFZB 3GD7A 3H0GH 5GAHC 4DV5Q 3T1HL 1L1OB 1KAWA 2R7FA 3OYYA 3ICEA 4A3GG 3BZCA 5IY0A 2CWAA 4DV0Q 4JI6Q 1PH4A 3BU2A 1M90C 4A3LG 4A3IH 2PMZE 4GOPA 1VQPA 1VQ6A 2R7ZG 1NY4A 1RL2A 4JI0Q 3ERSX 1YJ9A 4A3MG 4GLAC 2I0QA 4LF9Q 1LTLA 2A1AA 4LUVA 4LFAL 1VQEA 1TWGH 4IPCA 1I94Q 2Z6KC 1L0WA 2F4VQ 2D62A 1Y1WG 4LFCQ 4JV5Q 1G6PA 2QA4A 4JBMA 1K9MC 2JK8A 2D0OA 2YU9H 4JI8Q 1PVOA 2OQ0A 1OXTA 3I7FA 1X54A 4JI1Q 3STBC 2NVTH 2Y0SE 1TWFH 5BR8Q 3F1ZA 1VS0A 4HJ8A 4DNIA 3AQQA 4DR1Q 1UWVA 1E24A 5GROA 3PF5A 2JE6I 2NZOA 2AKWB 3PF4A 4DR5L 2VQFQ 4NXML 3KJPA 4WJ4A 3NELA 2WAQE 3JC66 1WYDA 5H1SE 2JA5H 4NXNL 3D31A 4B3SL 4MZ9A 4LF4Q 3GTJH 2BA0A 1C0AA 4IFDG 1OXUA 3JAMi 4JI3Q 3TEHB 2MO1A 5C3EG 1V43A 3PCOB 2JA7G 1VQJA 2E2IH 3E9IA 4K0KL 1T9HA 2R7ZH 5IYDG 3BZKA 2ES2A 3EBEA 4HJ7A 1G51A 4A3JH 1B7YB 1VQMA 4DR3Q 1QUQA 4AYBE 1VQOA 4A3KG 1XMOL 2CCZA 3ULLA 1KXLA 3M4QA 1N32Q 2JEBI 1Z9FA 1XNQQ 1KL9A 4LF8Q 3TRZA 1Y1WH 1GKHA 5LMNL 1AE3A 1CUKA 4DV5L 4A76A 1S72A 4HIOA 1O7IA 1U5KA 1XJVA 2K75A 4JBKA 1SFOH 2MFIA 4DV0L 1VQ9A 1L1OC 2L15A 4R4TA 5M3MH 1PH8A 1YZ6A 2YV5A 4JI6L 1S3OA 1PV4A 2HT1A 2H5XA 1N34Q 3CCRA 4IJHA 1EIYB 4A3CG 4LW1A 3H3VI 3J81i 4LF9L 4FDBA 4WJ3M 1SR3A 3K80C 2UXCQ 1Q1EA 4DV1Q 1XPRA 4EQ5A 1I94L 1JB7A 3T1YQ 3OTOQ 2F4VL 2IHEA 5FLXc 4LFCL 4JV5L 2MO0A 4YWKA 2HQLA 1MJEA 4OO1G 5M5YH 2WP8J 3M4PA 3PSIA 5C3EH 5GADC 2JA7H 4JI8L 4L5TA 3M3YH 1YHQA 4JI1L 2PQAB 1EIFA 5IYDH 1K0RA 2ZTDA 5J3BA 2KHIA 3CPFA 2LXJA 3ZJYC 3HOYG 1Q1BA 5EAYA 3CCMA 4A3KH 3S1QH 3D0FA 4JBWA 1WFQA 1LYLA 4JCVE 2NVYH 4DR1L 4PZ7A 2VZAA 2ZJRA 2UXBQ 3PUXA 4DK6C 2VQFL 3OW2A 5C0XI 1HJPA 1VQHA 5DLQE 4DR4Q 1BKBA 4JC0A 4P72A 2YTVA 4LF5Q 4LF4L 3G6EA 4JI3L 3RLNA 1XPUA 1OTCA 1YHAA 4BBRG 2RHSB 3BJUA 2VS1A 3GO5A 1Q82C 4UP7A 3CCUA 3CXCA 4J15A 3J81c 1M1KC 1N32L 1XNQL 3J7ZC 2YTXA 2Y0SG 4LF8L 4P73A 4AQYQ 4DV7L 3J7A5 3FKIG 4IPGA 3H15A 1IBMQ 3CCSA 3F2CA 1EFWA 3CD6A 3HOZH 1NTGA 2XTIA 2WAQG 2KHJA 4R1JA 1PH2A 4A3IG 4XIGS 4BXXH 1PYSB 5JJLA 3CQZH 2CKZB 2GVBA 2PI2A 4B3TQ 3HOYH 1HNWQ 3UDIA 1N34L 1KC8C 1CKNB 1H95A 1FJGQ 2AMCB 2UXCL 2VNUD 1Q8KA 4DV1L 3G4SA 3TQYA 2N3SA 4DAYB 3S2DH 2Q2IA 3T1YL 3OTOL 3CCVA 4IFDI 4YY3Q 4MNOA 4AYBG 3GTPH 1TWHH 4GKJQ 4A3EG 1HNZQ 3TS2A 1LM0A 2JA6H 4HJ9A 1I50H 3HKZG 1S40A 4BBRH 3A0JA 4X64Q 2UU9Q 4PZ8A 4A93H 2CWPA 3K81C 1HZAA 2VY3A 2K5NA 4POGA 3KFUA 1EYGA 2JA5G 1PH6A 2UXBL 1VQGA 1X6OA 3FKIH 1Q12A 3M9BA 1Q7YC 4DR4L 3ULJA 2WFWA 3KF8B 4LF5L 4X66Q 4X6AH 4IO9A 1JT8A 4GN5A 1UE1A 2FXQA 3ULPA 1JMCA 2DGYA 4A3JG 4DUYQ 2K5HA 2HHHQ 1ASZA 1YHBA 4BA2I 2IX1A 4QGUA 1E22A 4TVAB 3RNUA 2NN6G 4AQYL 1K83H 1IXRA 4A3EH 2VL6A 5K36G 1QVGA 4GNXA 1IBML 3NBHB 1GM5A 1G291 3GDEA 2ZJPA 5E7NA 5M3MG 3I56A 4DV2L 3GTQH 4A3BG 5FLMG 3TS0A 4B3TL 2VQEQ 1HNWL 3UE1A 5FJ8G 1FJGL 1VQCA 1C9OA 1PYBA 2K14A 3KF6A 3I4MG 2OQKA 4A3DH 2Q2TA 1X56A 3M85A 4YCVA 2ALYB 3PIOA 2NZHA 4X62Q 2KENA 1J6QA 4O0AA 4DK3C 3EIVA 4YY3L 4GKJL 3S16H 1HNZL 1X9NA 1Q81C 4HIKA 4JOIC 2CQOA 3NENA 3PUVA 3TREA 1VQDA 3CCEA 1I3QH 4H02A 3FP9A 4X64L 2QEXA 3B6YA 2UU9L 3CC2A 4DV4L 2R92H 1JJCB 4LF7Q 4Y52H 1AE2A 2AWNA 2VW9A 4GKKL 4UPAA 3HKZE 3RZDH 3S24A 2RF4A 1BVSA 5IT9c 1BBWA 4C3IH 5LMUQ 1OXSC 1NMFA 1TWAH 4X66L 2R93G 2UXDQ 5C0XJ 3HOUH 3E9HA 2A19A 1C7YA 1VQ8A 4A3BH 3STBD 5FLMH 4A3FG 4JI0L 3G71A 3S2HH 3A5ZB 1CKMA 2GVAA 3KDFA 2UUBQ 5FJ8H 2UUCQ 4LUZA 4BY1G 4KLKA 4RG1A 4PMWA 1J5EQ 4YHHQ 2HHHL 3I2ZA 3I4MH 1CSQA 1HNXQ 1PH5A 1YVCA 3PV0A 1VQFA 2IX0A 1I5FA 4BA1I 2E5LQ 3WWVA 5C4XG 4XTCS 3HOZG 2QGQA 2ID0A 3PO3G 4QJFA 1KQSA 4BXXG 1KRTA 2KBNA 5BR8L 1DGSA 1W2BA 1IBLQ 3F8TA 2VQEL 1Q46A 1SN8A 4QY7A 4HIMA 4OWWB 1MJCA 2DUDA 2UUAQ 3Q8DA 5IWAQ 4P71A 4GOPB 3ER0A 2ZTEA 4P75A 4JYAQ 1PA6A 5GAGC 5JJKA 2MQHA 2JA9A 4GLXA 2JA6G 2R93H 3KJOA 2OWOA 4OWXB 4A3FH 3RN2A 4A93G 5JEAJ 4DPGA 4OXPA 4DR3L 4DAMA 2Q2UA 4BY1H 1PFSA 4LF7L 4PG3A 1A63A 4GNXB 3K7UC 3E0EA 3CW2C 4UY8C 2A8VA 3HOVH 3A74A 4EX5A 1Y14B 3CF5A 5C4XH 5LMUL 1FVIA 3I4OA 2C35B 1Y1VG 2MNAA 1XPOA 3PO3H 3W1BA 3RLFA 4R4CA 3GTOH 2UXDL 1IBKQ 2I5MX 4DV3Q 5AJ3Q 1VQBA 1P8LA 4JI4Q 4KHPQ 1NMGA 1K8AC 1SE8A 2YTYA 3RR5A 1KD1C 2UUCL 3CAMA 4MTNA 2UUBL 4B3RQ 1GVPA 2BH8A 1RIPA 1E1TA 2E2HH 4LFBQ 4LF6Q 1E3PA 1J5EL 1MKHA 1EOVA 4YHHL 3SGIA 1YJNA 3KLWA 3CPWA 1AH9A 4ME3A 3U58A 3VDYA 3CMEA 2IY5B 1HNXL 3AEVA 1VCIA 4JG2A 1XMQQ 2E2JH 5M5XH 4L5QA 1E1OA 3CC7A 3S1NH 1QUQB 5IP9H 2E5LL 3F2BA 1A62A 4Y7NH 1HH2P 3CCJA 1NE3A 1N8RC 2R7DA 1X3FA 4LNQA 3UDXA 1A8VA 4DR2Q 1LUZA 3W5OA 1YEZA 2XGTA 1D8LA 3PUZA 1VQAA 3FHWA 4A3DG 2LXKA 1QVFA 1SMXA 4IJLA 2JEAI 2UUAL 4NXMQ 4DR6Q 5IWAL 1P16A 4C3JH 1KIXA 4JYAL 1TXYA 4X65Q 1Y1VH 2BA1A 4GOPC 2EIFA 2JQOA 2I5HA 1HZCA 2B29A 3A5UA 4JBJA 2R92G 1UEBA 1VQIA 1A0IA 1V1QA 3M4OH 5IP7G 4IPHA 2R6GA 4C2MH 1Q86C 2PQAA 4PZ6A 3J81j 4YWLA 2YYZA 1UE6A 2Z0SA 2RHQB 4GS3A 4OO1I 3GTGH 1EWIA 4GN3B 4GNXC 3S1RH 1N9WA 2WB1G 4KHZA 5C0XG 5C4JH 4HJAA 2K5VA 3MXNB 2B63G 3HOUG 3HOXG 1HZ9A 3J80i 4DV3L 5AJ3L 3K0XA 1IBKL 4JI4L 4KHPL 1X55A 4O2DA 3AFQA 1VQLA 1HR0W 4GN4B 4B3RL 5GAEC 1YITA 2I5LX 1YIJA 4JI7Q 1CKOA 1QZGA 4LF6L 4LFBL 1YBYA 3H3VH 2KCMA 2Z6KA 3PUWA 3S14H 2ASBA 5JJIA 4APVA 5M3FG 1PH9A 1XMQL 4DR7Q 2N49A 3AFPA 1UE7A 3CC4A 1B8AA 4DUZQ 1KHIA 1ASYA 1TWCH 4ALPA 3CCLA 4OX9Q 3S17H 4YCUA 4JI2Q 1E7ZA 1X3GA 4HJ5A 1OXXK
chains in the Genus database with same CATH superfamily
1JE4A 4ZK9B 3W1GA 5E3FA 5IP7H 3PO2H 1EQQA 1X3EA 3LGJA 2E8GA 2R7ZB 3R2TA 1EL0A 1GD7A 2K28A 1JJGA 1SJHD 3M4YA 1SMYC 2AHOB 2A69D 2FMCA 1K73C 2I46A 4YWMA 1K3RA 2LMCB 2KCCA 5IGBA 4R8NA 4XQNA 1NR4A 2SEBD 3KYHC 1GHJA 4KV6A 5D3IB 5EKIA 2IW3A 2OTJA 2K52A 3I4NG 2KCTA 3WOFA 3NTKA 3HOVG 5M3FH 1SLJA 3UDGA 1PH1A 1VQ4A 2LSSA 2L9HA 2BDOA 1PRTD 4MIUA 1FGBD 1I6HH 1DYQA 1XNRQ 4DV6Q 5NUCA 3MZ5A 4S3SA 4UP9A 4NPSA 1ESFA 4CBVA 3DWPA 5L37A 1IZ6A 2KA7A 1B70B 1XTDA 5FK9C 2Z6BA 1WOCA 1B44D 2EVBA 4IALA 4P74A 2L1BA 2NVYB 5IP9G 3JAMc 4L5SA 1PHJA 4B9WA 4ODGA 4R4QA 1WCMH 5CV5A 1H9SB 5C44H 1F9RA 2VXWA 1EEFD 2NTSA 2FJ2A 1BCPD 2F0HA 1AEXA 3P7JA 3RLOA 2ZTCA 2K50A 3I55A 4HCEA 2KJXA 3HOZB 4LFAQ 2F0DA 3GQBA 2F0WA 2EQSA 1S5FD 4OONA 3H0GG 1R4QB 1TS4A 1JORA 1SNPA 2IT1A 1PYWD 3FRPB 4LK1C 1XNRL 4DV6L 4V0BA 1GO3E 3HOWH 2ATWA 1CSPA 1ICFB 1OXVA 3RUZA 1HA6A 1BXTA 3PUYA 4NXNQ 4LUOA 2F3IA 2A6EC 4A75A 5IYCH 5G3LF 1SROA 4KI0A 4BBSH 1X3QA 4RGNA 1JE5A 4DV4Q 2B2VA 1IL2A 4KN7C 4GKKQ 3M7NA 4R4IA 3K7AH 3VR6A 2PO4A 4UHVA 1S5DD 3OYYA 2R7FA 2CWAA 2SDFA 1WD0A 2F0IA 3BU2A 4DA2A 1Y8PB 1T5EA 3P75A 1K83B 3ERSX 1YJ9A 3A8JE 1TKWB 3PIP3 4LFAL 1I94Q 1L0WA 1LLRD 2F4VQ 1BCPB 4LFCQ 4L8JA 2JK8A 1I4XA 2A68D 4JI8Q 2OQ0A 1OXTA 3X3MA 1HCZA 3STBC 2RDHA 5ELFA 5J39A 3AQQA 2F0VA 4M8AA 4RCOA 3TMEA 4IZ8A 2F0GA 3K5LA 2VQFQ 3NELA 5D65A 3V05A 4NXNL 4LF4Q 3GTJH 1CQFA 3CU7A 1LT4D 3RZDB 5C3EG 3PCOB 1PXUA 2I07B 1R9TB 1T9HA 2QW7A 4C3IB 2ES2A 2EDGA 4O42A 1KXLA 4A3KG 1PFBA 3ULLA 3HOUB 4KD4A 1KTKA 2D9UA 3T4AC 5CBEE 1DZ1A 1O7IA 1V1PB 3NP8A 4K5WA 1XJVA 4C1NI 4JBKA 1SFOH 2MFIA 2EY5A 1JICA 1L1OC 5M3MH 4GZYC 4UAIA 1PV4A 3ITPA 3CCRA 3QO2A 4A3CG 2LFNA 3H3VI 5K5PA 4FDBA 1WVLA 4H0LC 5A2QE 1KLUD 1I94L 1RF2D 1F2ZA 2F4VL 1YNNC 3MFGA 4LFCL 4YWKA 4RKLA 5M5YH 1B1ZA 3M4PA 4EQPA 4JI8L 1YHQA 2PQAB 1EIFA 2KHIA 2VUMB 1Q1BA 1WFQA 4FXKC 2ZJRA 2VQFL 4BY1B 4RGMA 1BKBA 4P72A 2H1EA 2YTVA 3DUZA 4LF4L 1MI2A 1SNMA 3HG9A 1BR9A 3RLNA 4K5VA 3R8BA 2RHSB 1HTPA 4UP7A 2OEOA 2NB0A 5C4XB 1FD7D 5FLXE 1HQRD 1M1KC 3SK6A 4AQYQ 4DV7L 3J7A5 1UAPA 5ISRA 1IW7C 4OO1H 1ET9A 1HHVA 1EZ6A 4WJWA 2WAQG 4R1JA 4A3IG 4BXXH 5T1GA 4DXGA 2TSSA 2CKZB 1BDOA 2ICEC 5M5XB 1PFNA 3HOYH 1JWUD 4Y7NB 2BE5D 2RVLA 3EQLC 5EKLA 4ID6A 4DAYB 2N3SA 1I4QA 1IL8A 1STEA 1TWHH 4A3EG 1HNZQ 3JAML 3A0JA 2SOBA 1FYCA 5DAUA 3F2UA 4POGA 3U9OA 2JA5G 1PH6A 4JVZA 2P5ZX 1H9JA 1VQGA 3BG3A 1Q7YC 3FKIH 1Q12A 2PPBC 4KHVA 1STGA 4X66Q 2KVMA 4C2MB 2B2WC 1BOSA 5CC4A 2EYPA 1F2LA 4ZYSA 3K5OA 1EYAA 4H44C 2E75C 1W6KA 4BA2I 4JPBW 4AQYL 1J9OA 2XIWA 1LTTD 3L3OC 3GTQH 4A3BG 4HCSA 2VQEQ 3UE1A 2F0FA 5FJ8G 3S17B 1WTHA 1F9QA 2E76C 3KK7A 4A3DH 4KKSA 4RKBA 2Q2TA 1EWCA 1X56A 2NZHA 4X62Q 1J6QA 4O0AA 4DK3C 4DAPA 4CJ2C 1HNZL 4K14A 4TSSA 2JSOA 4XQQA 1Q90A 2QEXA 1SYGA 2R92H 4A3GB 1JJCB 4LF7Q 2HCCA 3S1MB 1ZXTA 3HKZE 3VYRA 4H7BA 5LL6S 2RF4A 3S24A 4A3MB 1OXSC 1NMFA 4X66L 2UXDQ 2MP1A 1C7YA 2A19A 1VQ8A 5KYLA 3HGBA 2CH4W 5FLMH 4A3FG 1Y1WB 3NQTA 4JI0L 2M9VA 3A5ZB 2UUCQ 1L0XB 4U68A 4KLKA 4I7ZC 1A6XA 5EPKA 1G91A 3TDQA 1C48A 1HNXQ 4NMZA 4HEDA 1KDCA 3D4RA 3MVVA 3HOZG 5FO8B 2QGQA 2ID0A 2XWJB 1KQSA 1B53A 2EYLA 2NWGA 2VQEL 4DF7A 2CW0C 4QY7A 2JA7B 1MJCA 5BN5A 3M3YB 3Q8DA 5CMDA 4P71A 3ER0A 2NVXB 4GLXA 3T13A 3VR3A 4X3TA 3I4NB 3I3CA 2K7VA 5IODA 2KEEA 2QEJC 2R3ZA 4DPGA 2Z4IA 4LF7L 2DNEA 1F9SA 3RZOB 3K7UC 3CW2C 5IT9L 3HOVH 1I6VC 4EX5A 4QCLA 1FVIA 2PW5A 3I4OA 3PO3H 3CRKC 3RLFA 2UXDL 5E1FA 2EYMA 1P8LA 1SE8A 2EOTA 1KD1C 2UUCL 4MTNA 2BH8A 4LF6Q 3AB9A 1EOVA 1RTNA 4IUUA 3CPWA 3U58A 1CM9A 2EY6A 1HNXL 3GTMB 4J6HA 1LTRD 1G8ZD 5IP9H 2WIIB 1A62A 3CCJA 5C4HA 2C9OA 1I4RA 3TN2A 3S2DB 1GJXA 2R7DA 4K5XA 1A8VA 4DR2Q 1D8LA 2J7ZA 3PUZA 1VQAA 2QF7A 4IJLA 4BBRB 4DR6Q 1ML0D 1KIXA 4C3HB 5JPNC 4GOPC 1K0SA 2VB3X 1SXTA 1GOZA 1EY5A 1AW7A 2B29A 3A5UA 1UEBA 1U4LA 2XNAC 1A0IA 4LMQD 1NAPA 3VR5A 1LT3D 1EOTA 1DOLA 2Z0SA 4C3IG 2PNRC 4GN3B 1ZEQX 2WB1G 3CKIB 5C4JH 2IWHA 2K5VA 3HOUG 1D5XC 1HZ9A 1X55A 4DNTB 1VQLA 4QMGA 1HR0W 2OT2A 5GAEC 1YITA 1GUNA 4LF6L 1IKLA 3H3VH 2CH4A 3K6OA 5KNBA 4HSPA 4WRDA 2JYOA 1PH9A 4DR7Q 2N49A 4F8MA 3AFPA 1UE7A 3CCLA 4ALPA 1SYFA 3QB3A 4DR2L 3DLLA 1YI2A 2FHTA 1WI5A 2GN5A 2N78A 4DR6L 1L2FA 2V1CC 2VUMG 5T1IA 4L5RC 2B63H 5IGCA 3HOXH 3NEMA 2NZ1D 4L6TB 1KRSA 4DUYL 2KHSA 1U0LA 2AWOA 1OO9B 3Q22A 2K05A 3S2HB 2K4KA 3F2DA 1XTCD 1IYJB 2L5TA 4YCWA 1PTOH 2NYZD 3I8ZA 2RSOA 1YNJD 3PMFA 1JCKB 3KOJA 4OIJA 5C3EB 3Q24A 3VYTA 2JA8H 3QR8A 1N36Q 3URYA 3MXUA 1Q3LA 1FGUA 2HIXA 1NSNS 2Q2HA 4QL5A 3UE0A 1B4OA 1SSOA 4A3KB 1JJ2A 5IE8A 4DR7L 5GQOA 3CCQA 3NBHA 5IYBH 2OCEA 2NN6I 3V2TA 3PIO3 1EQVA 4L63B 3T1HQ 4EGVA 4Z9CB 1MIUA 2RSNA 1PRTF 3KF6B 4UP8A 3J80L 5LMNW 1K28A 4A3CH 3AYHB 1BNZA 3JAME 5KYIA 2B8GA 1RD9D 1JWSD 3U4ZA 2A74C 4CGYB 3SK4A 4A4IA 1WTOA 4DV2Q 1IBLL 1BO0A 3E0JA 1EU3A 2WV6D 4DNRB 2JA6B 1KDBA 1I50B 1QVCA 1S5BD 1N36L 4ZQ3A 5I4DA 3CMAA 4A93B 4BY7H 1WTQA 4K0KQ 3NWTA 2IHFA 1K8GA 2NVQH 2GA4B 1XMOQ 1Y1VB 5A35A 1DXMA 3RD4A 1ZYRC 5IGFA 3FPUB 4QIWE 4QQBX 3HFZB 3T1HL 1KAWA 4A3GG 2VB2X 4RAUC 5IY0A 5JOBA 2H4OA 1G2SA 1GUOA 2PMZE 4GOPA 4A3IH 1VQPA 1NY4A 1RL2A 4A3EB 3GTGB 1LABA 4A3MG 4GLAC 3EA6A 1TWGH 4IPCA 3V96A 1EIGA 2Z6KC 3BVMA 1Y1WG 4JV5Q 1S4ZA 1K9MC 3OSOA 2A69C 2K5QA 2O4XA 2NVTH 1PFMA 3F1ZA 4HJ8A 3S16B 1RCVD 4DNIA 4DR1Q 3PF4A 4NXML 3KJPA 1I3QB 2WAQE 3JC66 2JA5H 3D31A 3EROA 2BA0A 4ZRZA 4IFDG 1OXUA 1RJTA 3JAMi 4JI3Q 4K6LA 1FR3A 4XT1B 3K57A 3S9WA 2JA7G 1VQJA 4K0KL 2R7ZH 3BZKA 3EBEA 1G51A 1B7YB 1VQMA 1TWAB 4DR3Q 1QUQA 1XMOL 2CCZA 3SK5A 4A3BB 1Z9FA 1XNQQ 1EFID 1GKHA 1CUKA 5AFWA 4WFN3 4A76A 4HIOA 1U5KA 4IURA 1STHA 1YZ6A 3EFXD 4FXDA 1VMCA 4HN7A 5M3FB 1N34Q 4CDDC 2FMMA 5CORA 1LTBD 3K80C 2F1MA 3N52A 1Q1EA 4KK7A 4PMCA 4DN4M 2X69A 1JOQA 4JV5L 1SMYD 4HTHA 4IN3A 1BCPC 3SVMA 1LO5D 5IYDH 2EYJA 2L12A 2FFKB 1MBYA 2LXJA 3ZJYC 2F0TA 1O80A 1CT1D 2QKIC 3MXNA 4JBWA 4JCVE 1LYLA 4DR1L 2NVYH 2PZWA 4A3FB 5IT9E 5I2YA 4DK6C 3OW2A 5C0XI 1HJPA 1QWYA 4DR4Q 1UNSA 1WCMB 4KKUA 2CHBD 5C44B 5CYUA 4JI3L 1NR2A 4FVMA 4BBRG 3BJUA 3TSSA 3MHBA 1Q82C 4C3HG 1SNDA 3NK9A 1LT6D 3LWUA 1XNQL 3D6CA 3D4WA 3H15A 1IBMQ 2OF1A 2E2HB 2G5DA 3HOZH 2XRQD 1PH2A 2BCOA 5CV9A 4IUQA 2GVBA 1EU4A 3S1NB 1HNWQ 1N34L 1CKNB 1FJGQ 3L9AX 1E2ZA 2F0KA 3SE0A 4F7XA 2VNUD 1ET6A 1Q8KA 3H91A 3D8GA 2Q2IA 3R93A 3Q0AA 4IFDI 3HOWB 1PRTB 3UI2A 4KN4C 2PZUA 2K32A 4HJ9A 3H09A 3TBIB 4C3JB 1A3UA 4PZ8A 4G7HC 3K81C 3ND9A 5I6WA 1S5ED 1HTLD 3D6WA 5D3DA 4DR4L 5I9PA 5BN3A 1EYDA 3A7AB 4MHEA 3KF8B 1I4PA 5ELEA 4GN5A 2LS01 2A68C 2FXQA 4BS9A 1JMCA 2AQ3B 3S1RB 4C1NK 2DJFC 1RKNA 5KNCA 1CK1A 2IX1A 1E22A 1U9RA 3VA7A 2O5JC 1K83H 1H9SA 4GNXA 3HEJA 1IBML 2DNCA 4YIJA 3S14B 3TS0A 1HNWL 1FJGL 4OIKA 1SYBA 1C9OA 3R2IA 3I4MG 2OQKA 1SDFA 3HS0C 1RTOA 3TZUA 2ALYB 4KY7A 1MSGA 3EIVA 4J8QA 4V190 4ZKCB 4JOIC 4ZKBB 2CQOA 3NENA 1VQDA 4CKBA 4H02A 2WB1B 3B6YA 4DV4L 3I73A 1AE2A 4GKKL 1EEID 3RZDH 2NN6H 3CHBD 4IQZA 4XYQA 4C3IH 5IT9c 5LMUQ 4DK0A 2PCFB 3S15B 2R93G 3NQIA 5C0XJ 2B2YC 2B2UC 3HOUH 3E9HA 1WTRA 1EQTA 3STBD 3P20A 2QCPX 4LUZA 1B9NA 2EXZA 1W6JA 2N55A 3I2ZA 1SFOB 4G57A 5CV7A 2ZXOA 3I70A 1PH5A 2IX0A 3MA2B 4BA1I 3WWVA 1GHKA 4XTCS 3QWNA 2KBNA 1W2BA 1SJED 1O7ZA 1A2UA 1Q46A 4HIMA 2UUAQ 1EWHA 4I7AA 2A6HC 2NTTA 2ZTEA 3E5SA 2XVSA 3J80E 2JA6G 2RCFA 1LTGD 5CGKA 1D1KA 3RN2A 4A93G 4OXPA 4BY1H 4K6DA 1GUWA 4PG3A 1A63A 5IOCA 4C56C 3E0EA 3K58A 4XT3B 5LMUL 1O7LA 3NBIA 5C4XH 5C5MA 2C35B 1Y1VG 3KBGA 3W1BA 3GTOH 2I5MX 3DWQA 5AJ3Q 4JI4Q 1FNVA 1NMGA 3J7AV 3CAMA 1D1IA 1CA6A 1E3PA 1MKHA 5CR3A 2DN8A 2E2DC 4XDXA 1AH9A 3VDYA 3CMEA 1VCIA 4JG2A 5M5XH 4L5QA 3F2BA 4Y7NH 1HH2P 3FVQA 1NE3A 4J1MA 3T51B 1N8RC 3UDXA 3OHXC 1V1PA 1RODA 2XGTA 2K6AA 2KECA 3FPPA 2JEAI 1B3QA 2UUAL 1DJRD 2F0EA 4X65Q 2RDFA 1H9RA 2BA1A 2EIFA 3A7LA 4KJOA 2JQOA 2Y0SB 1G2TA 3DXJC 3A8KE 2EY2A 3FKIB 3SHLA 1I4GA 2QILA 4RH6A 4RCNA 5IP7G 4R9WA 4C2MH 1Q86C 1V1OA 2PQAA 4PZ6A 4YWLA 5EPLA 4K2LA 1ENFA 1HXYD 1RHPA 2KUMA 1WTPA 4HJAA 4ABNA 1XXGA 1ILPA 3J80i 5AJ3L 4JI4L 3FMCA 4O2DA 4AYBB 5EQ0A 2IX3A 2YU9B 3T56B 2I5LX 4JI7Q 4RFBA 4P2CB 1QZGA 1LACA 3TP8A 2ASBA 3NXWA 5M3FG 4HR7B 3VYUA 1B8AA 4DUZQ 4OX9Q 3S17H 4YCUA 4JI2Q 1X3GA 1VQ5A 5C3XA 2E2IB 2DY8A 1LTAD 2HIVA 1F2MA 1X65A 2JP1A 3SK8A 4A3JB 3A8IE 1PTOF 5C0XH 2EYFA 4X65L 4A3GH 1VQKA 2PNHA 2RCNA 3S1MH 4IOAA 1ZKOA 4XQJA 4IOCA 3W3AA 4DAYA 3EJIA 3J80c 1PH3A 5JEAG 4B3MQ 4POFA 4JOIA 4PMBA 1WCMG 4A3MH 5C44G 2KOLA 3HKSA 2HDMA 4CJ0B 1JWMD 4NDXA 5HY6A 3KLSA 4ME5A 2M00A 4DU9A 1L1OA 2K5WA 1XYIA 2B2YA 3GTKH 3BZDB 3K59A 4JI5Q 4JI7L 1VQ7A 3E6ZX 4FF1A 4R4OA 1HUNA 1EUJA 4X62L 2PQEA 3SXHA 1SBBB 3MFYA 4IFDH 5ELOA 5FKAC 2PI2E 4CKEA 1QCBD 4DUZL 4OX9L 1NBWA 3CRLC 4JI2L 3RN5A 1D5MC 2NVXH 2ZM6Q 3HOWG 3BDOA 3I4NH 4IPDA 4C3JG 2AUKA 1MHWC 1QNUA 3L2PA 1GXDC 4ILWA 1YJWA 5ELBA 1WTWA 1M8AA 2F0SA 3LX0A 4QUFA 5IYCG 3RZOH 4IUTA 1YNXA 4B3ML 4BBSG 3GP7A 3IRBA 4TQUS 4HIDA 2CW0D 5C6AA 4U673 3CQZB 4LWCA 5M5WH 1SYDA 1TS3A 3OPOA 3MC0B 2EXDA 3U4VA 3UDFA 3GTMH 3O13A 4X3KA 4JI5L 2K33A 1ONLA 2Q8RE 4MN3A 5E4WC 1VF5C 4KY6A 3KDFB 4HSVA 3EVQA 3PGZA 1HUMA 3OOCA 5KEEA 4RA8A 1BBXC 4DKAC 3CP0A 4C3HH 2ZM6L 3GTLH 1Z47A 1AZQA 1PTOD 3GD7A 3H0GH 4DV5Q 2RKSA 3BZCA 4DV0Q 1SNQA 5EGTA 4CJ1B 4Q5VA 2B2WA 3C2PA 4A3LG 1VQ6A 2CVRA 4PNYA 1EY9A 2I0QA 4LF9Q 1LTLA 2A1AA 2PW7A 1STBA 2AQ2B 1VQEA 2EYOA 1B9MA 3LNNA 1TR5A 3QOLA 2QA4A 4JBMA 3N6RA 2D0OA 1STNA 4RWSC 1EY4A 1M4VA 1PVOA 4DK1A 3OIQA 1Y69U 4CKCA 1TWFH 5BR8Q 1T5XD 2L55A 3PF5A 1E24A 2JE6I 3I4LA 3FDTA 4WJ4A 3NHHA 3OW7A 1C0AA 2K03A 3TEHB 1PDQA 2F0OA 4HJ7A 4JK1C 1YNJC 1ICWA 4QF4A 3MXPA 1VQOA 1QB5D 1XWEA 3M4QA 3HOXB 1KL9A 4LF8Q 1EIHA 3TRZA 4DV5L 1S72A 2F03A 1JOKA 2K75A 3VA5A 3I4MB 4DV0L 2L15A 1PH8A 4NKLA 1EY6A 1S3OA 2H5XA 3MWYW 4LF9L 2M2LA 4WJ3M 1TU2B 4DV1Q 1TIID 4EQ5A 1PTOB 1SYCA 2BOSA 4FXGC 1JB7A 3T1YQ 1FNUA 1MSHA 2IHEA 5IGDA 5LHY1 3C1EA 3OIPA 5CBAE 2HQLA 1MJEA 4OO1G 3OMGA 2WP8J 5C3EH 2DY7A 3G6JB 4L5TA 1K0RA 4EQOA 2MPMA 3H94A 1SEBD 1PZID 3RMHA 2EPBA 5EAYA 3HOYG 2R93B 3CCMA 4A3KH 5KGUA 3S1QH 2UXBQ 3PUXA 4WORA 2DJGC 1E2VA 2IL8A 2PZTA 1YHAA 5FO7B 4HAEA 2HDLA 2VS1A 3GO5A 3CCUA 4J15A 2ZT9C 3J7ZC 2Y0SG 4TRDA 4LF8L 1PLFA 1NCVA 2ZXRA 3FKIG 4IPGA 3CCSA 3R3OA 3CD6A 2XTIA 2KHJA 1CA5A 2V4DA 5JJLA 2E2JB 4N8X1 3UDIA 4KY5A 5DM73 2EJFC 2AMCB 4DV1L 3TQYA 5EBDA 3C1FA 3T1YL 4RGTA 1TVXA 3CCVA 3MTSA 4AYBG 3GTPH 3G7LA 5JVG3 3TS2A 2JA6H 3GV3A 3TZDA 1I50H 3HKZG 4CDEC 2UU9Q 4A93H 2K5NA 3DEPA 3KFUA 1EYGA 1TY2A 1AFPA 2UXBL 1X6OA 4OEMB 3M4OB 1S5CD 2WFWA 1IYVA 1K3BC 2K1BA 5FO9B 4IO9A 1UE1A 3ULPA 1EY0A 2DGYA 4A3JG 5FOBB 2HHHQ 5D14A 3J81L 3DHQA 4QGUA 3RNUA 1X3PA 5C4ZA 2G9HD 5C3WA 3QOJA 2VL6A 4A3EH 3NUCA 5K36G 5M9OA 1GM5A 4ZUIA 1G291 1TWGB 2ZJPA 1HFNA 1KNAA 3I56A 4DV2L 1HFGA 5FLMG 2B8FA 3BDCA 1ZYRD 1TWCB 2EY1A 3KF6A 2K14A 3M85A 4YCVA 3PIOA 4G4KA 2WINB 3PO2B 3S16H 1X9NA 4HIKA 2D2CC 1PRTC 1TQOA 3CCEA 1I3QH 3FP9A 3VR4A 3ERQA 5I6YA 2UU9L 3CC2A 4Y52H 1CHQD 2ICIA 5DEHA 4H13C 4UPAA 2MJ8A 3OMCA 2Z4HA 1DONA 1TWAH 1D5ZC 4A3BH 1I4HA 4K8JA 3G71A 2FINB 1CKMA 2GVAA 5LL6X 2UUBQ 5FJ8H 4ULLA 4RG1A 4PMWA 1J5EQ 1NNXA 4YHHQ 2HHHL 1I6HB 3C46A 1CSQA 3LWEA 1WTXA 1TS2A 3PV0A 1I5FA 4ZUJA 2SNMA 2E5LQ 3PQIA 2LKVA 2L4NA 3PO3G 2JXMB 4FP5D 1KRTA 5JPMC 1DGSA 1ENCA 1U4MA 4ZLTF 3BVGA 1A3TA 2DUDA 2KEDA 5IWAQ 1F9PA 5GAGC 2MQHA 2JA9A 3KJOA 4A3FH 4EVOA 5JEAH 5EPJA 4DR3L 2Q2UA 1VDZA 1DCZA 3I90A 1TS5A 4GNXB 1D6EC 2QDLA 1CFMA 3A74A 1Y14B 3CF5A 2SNSA 5CV8A 3BYYB 4PV1C 4KHPQ 1VQBA 1L0YB 1K8AC 3NE5B 2YTYA 1ENAA 3RR5A 5CV6A 2UUBL 4B3RQ 1B50A 5J1ZA 2A5HA 3SDZA 1RIPA 1LTSD 2E2HH 1STYA 1J5EL 4YHHL 2K01A 3SGIA 1YJNA 1J8IA 1ESRA 2IY5B 3AEVA 1XMQQ 3S1NH 3H6MA 4N9TA 2E5LL 4OELB 1X3FA 3SR1A 1YEZA 3KBXA 1TT2A 3W2DA 3FHWA 2LXKA 1QVFA 4BBSB 3OWFA 4K8IA 2XRSD 4E6IA 5IWAL 4C3JH 1TXYA 3I72A 3BVZA 3T16A 3K7AB 4N8FA 4JBJA 3KLRA 1UUPA 1CI3M 2R6GA 3J81j 2YYZA 1UE6A 3HRZC 2A6ED 2RHQB 3S1RH 1N9WA 4KHZA 3T53B 1IYUA 2B63G 2N88A 3HOXG 4KHPL 3K0XA 1WTVA 2X6LA 2F0NA 1MGSA 4B3RL 3TP6A 5IIFA 1YIJA 4FF2A 2KCMA 2R61A 4IUNA 2Z6KA 4X3UA 3S14H 1XMQL 4O1NA 1H9MA 3GTJB 4HJ5A 2MUYA 2JJQA 2BDNA 4B08A 2JA8G 1R9TH 1A15A 1SE4A 2ZXPA 1BBUA 1CKNA 4K2KA 3L7ZC 4TKOB 1A3VA 3HZXA 3IFDA 1K8OA 3KLSX 4A3LH 1SE2A 2HUGA 2XN9C 1Z7TA 2J4XA 3NWSA 5TSSA 1SE3A 5IYBG 2RDGA 5M3MB 1W3SA 3S15H 1N33Q 1HR0Q 4DV7Q 4GLVB 1PZJD 1EQRA 2IJ0A 2BH2A 1FL0A 2D0PA 3MEFA 1PZKD 3P1HA 4AIMA 3E3XA 2WB1E 3KF8A 5JJZA 5M5YB 2B2TC 1EYCA 2K04A 2D5DA 1D7QA 2NUCA 5HGQA 2VUMH 3ND8A 4B9XA 1VQNA 2C5CA 4RHSA 3DM3A 4IFDJ 4NB3A 3K8AA 2PYKA 5DNFA 1QOHA 1LV9A 4OWTB 3PIPA 2BE5C 1V9PA 1YNND 5ELNA 1BUVT 4FYDA 4BY7G 2XWBB 5G3LD 4KTAA 1R4PB 3J7YW 1C4QA 1O78A 5HURA 3DWAA 1Q8IA 2LY7A 1HPCA 4G7OC 4AH6A 1HRJA 3KUPA 4XYOA 3GTOB 2L11A 1QNKA 5I9OA 4IUVA 1WD1A 3HOYB 2A6HD 2B3GA 3QIAA 1N33L 1HR0L 1IKMA 3U50C 1UE5A 2ENBA 3M7GA 1TWHB 3A55A 2F4IA 1HZBA 2RBMA 3IAYA 2N8NA 4DR5Q 1CHPD 3L0OA 4OHJA 2OTLA 3AU7A 1IW7D 4B3SQ 1O7YA 1PH7A 2A73B 1SRUA 4NP5A 4RMFA 1QZHA 2ZJQA 2Z8LA 3J81E 2F52A 3EN2A 3K0YA 1NJIC 3G48A 3PO2G 4LAAA 3K5MA 2CFMA 4ZCKA 1WJJA 2WACA 5LMNQ 5GAHC 4N9PA 1L1OB 3ICEA 1HQMC 2J0TD 4JI6Q 1LTID 5EBCA 3A56A 1PH4A 1M90C 4RGOS 2R7ZG 4JI0Q 3D4DA 1KABA 2HQEA 4ZAIA 4LUVA 3HKZB 4DGZA 4CDFC 3GTQB 1Z6HA 2K5DA 1Y8OB 3IKJA 2D62A 3QJYA 1G6PA 1RDPD 1IHZA 3NSWA 2YU9H 4A3DB 2RQXA 1X54A 3I7FA 4JI1Q 2CQAA 1SNOA 1LT5D 5CV4A 2EYHA 2Y0SE 4DFAA 4QB4A 1VS0A 1SYEA 4DAVA 1K8MA 1UWVA 5GROA 1FNWA 2NZOA 1A2TA 2AKWB 5I2XA 4DR5L 3DM1A 1EY7A 2KCNA 1WYDA 5H1SE 2R92B 4B3SL 4MZ9A 1BF4A 1XX8A 3D3RA 2MO1A 1PMRA 1V43A 3IFTA 2E2IH 1BQQT 3E9IA 2AQ1B 4G7ZC 5IYDG 3AMUA 1CTMA 4A3JH 1AZPA 4FO2A 4AYBE 1N32Q 2JEBI 1QILA 5JVH3 1Y1WH 5LMNL 1AE3A 3WDNA 2G9DA 2EE1A 1UEAB 5K36H 3BDLA 1QG7A 4R4TA 1VQ9A 4JI6L 2YV5A 2B2UA 3U9SA 1F77A 2HT1A 1EIYB 4IJHA 3NTHA 4LW1A 3J81i 3QG1A 1SR3A 3BS1A 2UXCQ 1XPRA 3DEOA 3OTOQ 5FLXc 1MD2D 3GTKB 2MO0A 2WKCA 4UDUC 3PSIA 2JA7H 5GADC 3M3YH 4JI1L 1EY8A 5J3BA 2ZTDA 1H9KA 3CPFA 2F0JA 3H3VC 1TY0A 3D0FA 4PZ7A 5F2DA 2JN4A 2VZAA 5JAVA 2IPKD 2B2TA 4RHRA 5DLQE 1VQHA 1DD2A 2F3WA 4JC0A 4LF5Q 3HP3A 3G6EA 1G6ZA 3MXGA 1XPUA 1CZGA 1OTCA 5ELCA 3HOVB 4FF4A 3CXCA 5HGTA 3J81c 3PO3B 2AUJD 1N32L 1VF7A 2YTXA 4FNFA 4P73A 1KDAA 3OWEB 3MEHA 1JR0D 3F2CA 1EFWA 1QJOA 1NTGA 4OL7A 4XIGS 5KRUA 3X3NA 1PYSB 3CQZH 5M5WB 1KNEA 2PI2A 4B3TQ 1SAPA 1H95A 1KC8C 4X3SA 3TP7A 3GV6A 2UXCL 2WKDA 2HD3A 3G4SA 3S2DH 3OTOL 2EZVA 4YY3Q 4MNOA 4GKJQ 1PTOC 2EJMA 1NUCA 1LM0A 3A54A 1S40A 4BBRH 4X64Q 4CDCC 3Q23A 2CWPA 1HZAA 1JOOA 5C5LA 2VY3A 4HMJA 3DMUA 3J7AF 3M9BA 3ULJA 4LF5L 4X6AH 1JT8A 3GTLB 1STAA 1SNCA 2B39A 2F0LA 3H0GB 4DUYQ 5C4JB 2K5HA 1U4RA 1ASZA 4PQXA 1YHBA 5KIXA 4HMIA 4TVAB 1B3AA 5COYA 3WOEA 1AP0A 1B2TA 1GUGA 2NN6G 1IXRA 1QVGA 1D2BA 3NBHB 1QE6A 1KAAA 3GDEA 5E7NA 5M3MG 4B3TL 1U4PA 1VQCA 1PYBA 2KENA 1TWFB 4YY3L 2L0CA 4GKJL 1Q81C 4NW2A 1F2YA 3PUVA 2QDBA 3TREA 1JQYD 4X64L 5IGGA 2B63B 1VMPA 2AWNA 2VW9A 4OGQC 1BVSA 1BBWA 3FEWX 1HA5A 3ONAB 2O2LD 3S2HH 1E2WA 1DM0B 2HCIA 2X6GA 3KDFA 4KKTA 4BY1G 5ELDA 1CZWA 3I4MH 1JB3A 1YVCA 4DXFA 1VQFA 2JA8B 5C4XG 1II3A 4QJFA 4BXXG 3C3LA 1GUTA 4CHTB 1GUSA 3IL8A 5BR8L 1IBLQ 1JC7A 3Q6SA 4EQNA 3F8TA 1SN8A 4OWWB 4QUCA 4GOPB 1C8CA 1DOKA 5A2QL 4P75A 4JYAQ 1PA6A 2Q8TA 5JJKA 3TP5A 2R93H 4I65A 3S1QB 3K5NA 2OWOA 4OWXB 1X32A 5EKKA 4IUPA 5EJWA 5JEAJ 4DAMA 2F0UA 5BN4A 1PFSA 5J22A 3VR2A 4UY8C 1E0BA 2A8VA 4LJZC 3MAQA 2MHVA 2MNAA 1XPOA 3ZYYX 4R4CA 1IBKQ 4DV3Q 1DOMA 2O5IC 2F3VA 4F87A 2Z1CA 4F88A 1CQVA 1GVPA 2F0QA 1E1TA 4QIWB 4XXEA 4LFBQ 2XSCA 4M1UB 3VYSA 1AN8A 5IGEA 3KLWA 4ME3A 5FLXL 4FF3A 2E2JH 3CC7A 1E1OA 1QUQB 2KQ3A 2PMZB 2RA4A 4LNQA 2B2VC 4BY7B 1LUZA 3W5OA 3GTPB 5E4XA 4A3DG 1SMXA 2NVQB 4NXMQ 2Q8IB 1P16A 5KNDA 1ILQA 4JYAL 1Y1VH 1BCPF 1KLGD 2NBFA 2I5HA 1HZCA 2OXPA 2F0PA 2R92G 1VQIA 1EZ8A 1V1QA 3M4OH 5DM63 2E74C 4IPHA 1V8QA 3BYTB 2TMPA 2MGSA 2WAQB 4KD3A 4A3IB 1Y8NB 4KJNA 4OO1I 4GS3A 4KMUC 3GTGH 1EWIA 4GNXC 5C0XG 4MTKA 3MXNB 2EJGC 1IBKL 4DV3L 3AFQA 2Z9HA 4GN4B 3NTIA 1CKOA 4LFBL 4Q0FA 1YBYA 3NPPA 2NVTB 4BWGB 3PUWA 5JJIA 4APVA 3I91A 3CC4A 1ASYA 1KHIA 4JW0A 1TWCH 4R8IA 3SEBA 2JA5B 1E7ZA 2F0MA 1OXXK
chains in the Genus database with same CATH topology
1VQ5A 4DR2L 3W1GA 2JJQA 5IP7H 3PO2H 1EQQA 1X3EA 3DLLA 1YI2A 3LGJA 2JA8G 2E8GA 1R9TH 1GD7A 2HIVA 2GN5A 1WI5A 1X65A 2N78A 4DR6L 1L2FA 2V1CC 2VUMG 1JJGA 1BBUA 1CKNA 4L5RC 4X65L 2AHOB 4A3GH 2B63H 3L7ZC 1K73C 2PNHA 2RCNA 3NEMA 1K3RA 4YWMA 3HOXH 1VQKA 3S1MH 4IOAA 4IOCA 3J80c 1PH3A 1KRSA 5JEAG 4B3MQ 4POFA 4DUYL 4A3LH 3KYHC 4JOIA 1U0LA 1WCMG 2AWOA 4A3MH 5C44G 2OTJA 5IYBG 3S15H 1W3SA 2K52A 3I4NG 2KCTA 3HKSA 1N33Q 1HR0Q 3HOVG 2K4KA 3F2DA 5M3FH 4DV7Q 1IYJB 5HY6A 4GLVB 1SLJA 3UDGA 1PH1A 1VQ4A 1EQRA 2LSSA 4YCWA 1I6HH 2BH2A 1FL0A 2D0PA 3MEFA 1XNRQ 4DV6Q 1L1OA 4UP9A 3KOJA 3GTKH 4NPSA 4AIMA 2WB1E 4JI5Q 2JA8H 4JI7L 1N36Q 1VQ7A 1IZ6A 4R4OA 1D7QA 5HGQA 1EUJA 4X62L 1B70B 1XTDA 2VUMH 1FGUA 2HIXA 1WOCA 2Q2HA 4QL5A 3UE0A 1JJ2A 4P74A 1VQNA 5IP9G 5IE8A 5ELOA 4DR7L 3DM3A 2PI2E 5GQOA 4NB3A 3JAMc 4IFDJ 3CCQA 4DUZL 4L5SA 4OX9L 1NBWA 3K8AA 1PHJA 4JI2L 3RN5A 4R4QA 1WCMH 2ZM6Q 2NVXH 3HOWG 4OWTB 5C44H 3PIPA 5IYBH 2OCEA 2NN6I 3I4NH 1V9PA 4IPDA 5ELNA 3T1HQ 3L2PA 1YJWA 3RLOA 4BY7G 1MIUA 5IYCG 2ZTCA 3KF6B 3RZOH 4UP8A 1YNXA 4B3ML 2K50A 4BBSG 5LMNW 3IRBA 4TQUS 3I55A 4HIDA 4A3CH 4LFAQ 3AYHB 4AH6A 2EQSA 2B3GA 4LWCA 5M5WH 4OONA 1N33L 3H0GG 1HR0L 3U4ZA 3U50C 2EXDA 3U4VA 1UE5A 2IT1A 4A4IA 3UDFA 4DV2Q 1IBLL 1XNRL 4DV6L 1GO3E 3HOWH 2ATWA 3GTMH 4JI5L 1HZBA 1CSPA 1QVCA 2N8NA 1OXVA 4DR5Q 3L0OA 1N36L 3PUYA 2OTLA 4NXNQ 4B3SQ 4LUOA 2F3IA 3CMAA 1PH7A 3KDFB 4A75A 1SRUA 4BY7H 4RMFA 1QZHA 5IYCH 2ZJQA 3PGZA 4K0KQ 1SROA 4KI0A 4BBSH 2IHFA 1K8GA 2NVQH 2F52A 3EN2A 4DKAC 1XMOQ 1JE5A 3CP0A 3G48A 4C3HH 2ZM6L 4DV4Q 1NJIC 2CFMA 3PO2G 3GTLH 1Z47A 1IL2A 4GKKQ 1WJJA 4QIWE 3M7NA 4R4IA 4QQBX 5LMNQ 3K7AH 3HFZB 3GD7A 3H0GH 5GAHC 4DV5Q 3T1HL 1L1OB 1KAWA 2R7FA 3OYYA 3ICEA 4A3GG 3BZCA 5IY0A 2CWAA 4DV0Q 4JI6Q 1PH4A 3BU2A 1M90C 4A3LG 4A3IH 2PMZE 4GOPA 1VQPA 1VQ6A 2R7ZG 1NY4A 1RL2A 4JI0Q 3ERSX 1YJ9A 4A3MG 4GLAC 2I0QA 4LF9Q 1LTLA 2A1AA 4LUVA 4LFAL 1VQEA 1TWGH 4IPCA 1I94Q 2Z6KC 1L0WA 2F4VQ 2D62A 1Y1WG 4LFCQ 4JV5Q 1G6PA 2QA4A 4JBMA 1K9MC 2JK8A 2D0OA 2YU9H 4JI8Q 1PVOA 2OQ0A 1OXTA 3I7FA 1X54A 4JI1Q 3STBC 2NVTH 2Y0SE 1TWFH 5BR8Q 3F1ZA 1VS0A 4HJ8A 4DNIA 3AQQA 4DR1Q 1UWVA 1E24A 5GROA 3PF5A 2JE6I 2NZOA 2AKWB 3PF4A 4DR5L 2VQFQ 4NXML 3KJPA 4WJ4A 3NELA 2WAQE 3JC66 1WYDA 5H1SE 2JA5H 4NXNL 3D31A 4B3SL 4MZ9A 4LF4Q 3GTJH 2BA0A 1C0AA 4IFDG 1OXUA 3JAMi 4JI3Q 3TEHB 2MO1A 5C3EG 1V43A 3PCOB 2JA7G 1VQJA 2E2IH 3E9IA 4K0KL 1T9HA 2R7ZH 5IYDG 3BZKA 2ES2A 3EBEA 4HJ7A 1G51A 4A3JH 1B7YB 1VQMA 4DR3Q 1QUQA 4AYBE 1VQOA 4A3KG 1XMOL 2CCZA 3ULLA 1KXLA 3M4QA 1N32Q 2JEBI 1Z9FA 1XNQQ 1KL9A 4LF8Q 3TRZA 1Y1WH 1GKHA 5LMNL 1AE3A 1CUKA 4DV5L 4A76A 1S72A 4HIOA 1O7IA 1U5KA 1XJVA 2K75A 4JBKA 1SFOH 2MFIA 4DV0L 1VQ9A 1L1OC 2L15A 4R4TA 5M3MH 1PH8A 1YZ6A 2YV5A 4JI6L 1S3OA 1PV4A 2HT1A 2H5XA 1N34Q 3CCRA 4IJHA 1EIYB 4A3CG 4LW1A 3H3VI 3J81i 4LF9L 4FDBA 4WJ3M 1SR3A 3K80C 2UXCQ 1Q1EA 4DV1Q 1XPRA 4EQ5A 1I94L 1JB7A 3T1YQ 3OTOQ 2F4VL 2IHEA 5FLXc 4LFCL 4JV5L 2MO0A 4YWKA 2HQLA 1MJEA 4OO1G 5M5YH 2WP8J 3M4PA 3PSIA 5C3EH 5GADC 2JA7H 4JI8L 4L5TA 3M3YH 1YHQA 4JI1L 2PQAB 1EIFA 5IYDH 1K0RA 2ZTDA 5J3BA 2KHIA 3CPFA 2LXJA 3ZJYC 3HOYG 1Q1BA 5EAYA 3CCMA 4A3KH 3S1QH 3D0FA 4JBWA 1WFQA 1LYLA 4JCVE 2NVYH 4DR1L 4PZ7A 2VZAA 2ZJRA 2UXBQ 3PUXA 4DK6C 2VQFL 3OW2A 5C0XI 1HJPA 1VQHA 5DLQE 4DR4Q 1BKBA 4JC0A 4P72A 2YTVA 4LF5Q 4LF4L 3G6EA 4JI3L 3RLNA 1XPUA 1OTCA 1YHAA 4BBRG 2RHSB 3BJUA 2VS1A 3GO5A 1Q82C 4UP7A 3CCUA 3CXCA 4J15A 3J81c 1M1KC 1N32L 1XNQL 3J7ZC 2YTXA 2Y0SG 4LF8L 4P73A 4AQYQ 4DV7L 3J7A5 3FKIG 4IPGA 3H15A 1IBMQ 3CCSA 3F2CA 1EFWA 3CD6A 3HOZH 1NTGA 2XTIA 2WAQG 2KHJA 4R1JA 1PH2A 4A3IG 4XIGS 4BXXH 1PYSB 5JJLA 3CQZH 2CKZB 2GVBA 2PI2A 4B3TQ 3HOYH 1HNWQ 3UDIA 1N34L 1KC8C 1CKNB 1H95A 1FJGQ 2AMCB 2UXCL 2VNUD 1Q8KA 4DV1L 3G4SA 3TQYA 2N3SA 4DAYB 3S2DH 2Q2IA 3T1YL 3OTOL 3CCVA 4IFDI 4YY3Q 4MNOA 4AYBG 3GTPH 1TWHH 4GKJQ 4A3EG 1HNZQ 3TS2A 1LM0A 2JA6H 4HJ9A 1I50H 3HKZG 1S40A 4BBRH 3A0JA 4X64Q 2UU9Q 4PZ8A 4A93H 2CWPA 3K81C 1HZAA 2VY3A 2K5NA 4POGA 3KFUA 1EYGA 2JA5G 1PH6A 2UXBL 1VQGA 1X6OA 3FKIH 1Q12A 3M9BA 1Q7YC 4DR4L 3ULJA 2WFWA 3KF8B 4LF5L 4X66Q 4X6AH 4IO9A 1JT8A 4GN5A 1UE1A 2FXQA 3ULPA 1JMCA 2DGYA 4A3JG 4DUYQ 2K5HA 2HHHQ 1ASZA 1YHBA 4BA2I 2IX1A 4QGUA 1E22A 4TVAB 3RNUA 2NN6G 4AQYL 1K83H 1IXRA 4A3EH 2VL6A 5K36G 1QVGA 4GNXA 1IBML 3NBHB 1GM5A 1G291 3GDEA 2ZJPA 5E7NA 5M3MG 3I56A 4DV2L 3GTQH 4A3BG 5FLMG 3TS0A 4B3TL 2VQEQ 1HNWL 3UE1A 5FJ8G 1FJGL 1VQCA 1C9OA 1PYBA 2K14A 3KF6A 3I4MG 2OQKA 4A3DH 2Q2TA 1X56A 3M85A 4YCVA 2ALYB 3PIOA 2NZHA 4X62Q 2KENA 1J6QA 4O0AA 4DK3C 3EIVA 4YY3L 4GKJL 3S16H 1HNZL 1X9NA 1Q81C 4HIKA 4JOIC 2CQOA 3NENA 3PUVA 3TREA 1VQDA 3CCEA 1I3QH 4H02A 3FP9A 4X64L 2QEXA 3B6YA 2UU9L 3CC2A 4DV4L 2R92H 1JJCB 4LF7Q 4Y52H 1AE2A 2AWNA 2VW9A 4GKKL 4UPAA 3HKZE 3RZDH 3S24A 2RF4A 1BVSA 5IT9c 1BBWA 4C3IH 5LMUQ 1OXSC 1NMFA 1TWAH 4X66L 2R93G 2UXDQ 5C0XJ 3HOUH 3E9HA 2A19A 1C7YA 1VQ8A 4A3BH 3STBD 5FLMH 4A3FG 4JI0L 3G71A 3S2HH 3A5ZB 1CKMA 2GVAA 3KDFA 2UUBQ 5FJ8H 2UUCQ 4LUZA 4BY1G 4KLKA 4RG1A 4PMWA 1J5EQ 4YHHQ 2HHHL 3I2ZA 3I4MH 1CSQA 1HNXQ 1PH5A 1YVCA 3PV0A 1VQFA 2IX0A 1I5FA 4BA1I 2E5LQ 3WWVA 5C4XG 4XTCS 3HOZG 2QGQA 2ID0A 3PO3G 4QJFA 1KQSA 4BXXG 1KRTA 2KBNA 5BR8L 1DGSA 1W2BA 1IBLQ 3F8TA 2VQEL 1Q46A 1SN8A 4QY7A 4HIMA 4OWWB 1MJCA 2DUDA 2UUAQ 3Q8DA 5IWAQ 4P71A 4GOPB 3ER0A 2ZTEA 4P75A 4JYAQ 1PA6A 5GAGC 5JJKA 2MQHA 2JA9A 4GLXA 2JA6G 2R93H 3KJOA 2OWOA 4OWXB 4A3FH 3RN2A 4A93G 5JEAJ 4DPGA 4OXPA 4DR3L 4DAMA 2Q2UA 4BY1H 1PFSA 4LF7L 4PG3A 1A63A 4GNXB 3K7UC 3E0EA 3CW2C 4UY8C 2A8VA 3HOVH 3A74A 4EX5A 1Y14B 3CF5A 5C4XH 5LMUL 1FVIA 3I4OA 2C35B 1Y1VG 2MNAA 1XPOA 3PO3H 3W1BA 3RLFA 4R4CA 3GTOH 2UXDL 1IBKQ 2I5MX 4DV3Q 5AJ3Q 1VQBA 1P8LA 4JI4Q 4KHPQ 1NMGA 1K8AC 1SE8A 2YTYA 3RR5A 1KD1C 2UUCL 3CAMA 4MTNA 2UUBL 4B3RQ 1GVPA 2BH8A 1RIPA 1E1TA 2E2HH 4LFBQ 4LF6Q 1E3PA 1J5EL 1MKHA 1EOVA 4YHHL 3SGIA 1YJNA 3KLWA 3CPWA 1AH9A 4ME3A 3U58A 3VDYA 3CMEA 2IY5B 1HNXL 3AEVA 1VCIA 4JG2A 1XMQQ 2E2JH 5M5XH 4L5QA 1E1OA 3CC7A 3S1NH 1QUQB 5IP9H 2E5LL 3F2BA 1A62A 4Y7NH 1HH2P 3CCJA 1NE3A 1N8RC 2R7DA 1X3FA 4LNQA 3UDXA 1A8VA 4DR2Q 1LUZA 3W5OA 1YEZA 2XGTA 1D8LA 3PUZA 1VQAA 3FHWA 4A3DG 2LXKA 1QVFA 1SMXA 4IJLA 2JEAI 2UUAL 4NXMQ 4DR6Q 5IWAL 1P16A 4C3JH 1KIXA 4JYAL 1TXYA 4X65Q 1Y1VH 2BA1A 4GOPC 2EIFA 2JQOA 2I5HA 1HZCA 2B29A 3A5UA 4JBJA 2R92G 1UEBA 1VQIA 1A0IA 1V1QA 3M4OH 5IP7G 4IPHA 2R6GA 4C2MH 1Q86C 2PQAA 4PZ6A 3J81j 4YWLA 2YYZA 1UE6A 2Z0SA 2RHQB 4GS3A 4OO1I 3GTGH 1EWIA 4GN3B 4GNXC 3S1RH 1N9WA 2WB1G 4KHZA 5C0XG 5C4JH 4HJAA 2K5VA 3MXNB 2B63G 3HOUG 3HOXG 1HZ9A 3J80i 4DV3L 5AJ3L 3K0XA 1IBKL 4JI4L 4KHPL 1X55A 4O2DA 3AFQA 1VQLA 1HR0W 4GN4B 4B3RL 5GAEC 1YITA 2I5LX 1YIJA 4JI7Q 1CKOA 1QZGA 4LF6L 4LFBL 1YBYA 3H3VH 2KCMA 2Z6KA 3PUWA 3S14H 2ASBA 5JJIA 4APVA 5M3FG 1PH9A 1XMQL 4DR7Q 2N49A 3AFPA 1UE7A 3CC4A 1B8AA 4DUZQ 1KHIA 1ASYA 1TWCH 4ALPA 3CCLA 4OX9Q 3S17H 4YCUA 4JI2Q 1E7ZA 1X3GA 4HJ5A 1OXXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 A;  4DR2 L;  3W1G A;  2JJQ A;  5IP7 H;  3PO2 H;  1EQQ A;  1X3E A;  3DLL A;  1YI2 A;  3LGJ A;  2JA8 G;  2E8G A;  1R9T H;  1GD7 A;  2HIV A;  2GN5 A;  1WI5 A;  1X65 A;  2N78 A;  4DR6 L;  1L2F A;  2V1C C;  2VUM G;  1JJG A;  1BBU A;  1CKN A;  4L5R C;  4X65 L;  2AHO B;  4A3G H;  2B63 H;  3L7Z C;  1K73 C;  2PNH A;  2RCN A;  3NEM A;  1K3R A;  4YWM A;  3HOX H;  1VQK A;  3S1M H;  4IOA A;  4IOC A;  3J80 c;  1PH3 A;  1KRS A;  5JEA G;  4B3M Q;  4POF A;  4DUY L;  4A3L H;  3KYH C;  4JOI A;  1U0L A;  1WCM G;  2AWO A;  4A3M H;  5C44 G;  2OTJ A;  5IYB G;  3S15 H;  1W3S A;  2K52 A;  3I4N G;  2KCT A;  3HKS A;  1N33 Q;  1HR0 Q;  3HOV G;  2K4K A;  3F2D A;  5M3F H;  4DV7 Q;  1IYJ B;  5HY6 A;  4GLV B;  1SLJ A;  3UDG A;  1PH1 A;  1VQ4 A;  1EQR A;  2LSS A;  4YCW A;  1I6H H;  2BH2 A;  1FL0 A;  2D0P A;  3MEF A;  1XNR Q;  4DV6 Q;  1L1O A;  4UP9 A;  3KOJ A;  3GTK H;  4NPS A;  4AIM A;  2WB1 E;  4JI5 Q;  2JA8 H;  4JI7 L;  1N36 Q;  1VQ7 A;  1IZ6 A;  4R4O A;  1D7Q A;  5HGQ A;  1EUJ A;  4X62 L;  1B70 B;  1XTD A;  2VUM H;  1FGU A;  2HIX A;  1WOC A;  2Q2H A;  4QL5 A;  3UE0 A;  1JJ2 A;  4P74 A;  1VQN A;  5IP9 G;  5IE8 A;  5ELO A;  4DR7 L;  3DM3 A;  2PI2 E;  5GQO A;  4NB3 A;  3JAM c;  4IFD J;  3CCQ A;  4DUZ L;  4L5S A;  4OX9 L;  1NBW A;  3K8A A;  1PHJ A;  4JI2 L;  3RN5 A;  4R4Q A;  1WCM H;  2ZM6 Q;  2NVX H;  3HOW G;  4OWT B;  5C44 H;  3PIP A;  5IYB H;  2OCE A;  2NN6 I;  3I4N H;  1V9P A;  4IPD A;  5ELN A;  3T1H Q;  3L2P A;  1YJW A;  3RLO A;  4BY7 G;  1MIU A;  5IYC G;  2ZTC A;  3KF6 B;  3RZO H;  4UP8 A;  1YNX A;  4B3M L;  2K50 A;  4BBS G;  5LMN W;  3IRB A;  4TQU S;  3I55 A;  4HID A;  4A3C H;  4LFA Q;  3AYH B;  4AH6 A;  2EQS A;  2B3G A;  4LWC A;  5M5W H;  4OON A;  1N33 L;  3H0G G;  1HR0 L;  3U4Z A;  3U50 C;  2EXD A;  3U4V A;  1UE5 A;  2IT1 A;  4A4I A;  3UDF A;  4DV2 Q;  1IBL L;  1XNR L;  4DV6 L;  1GO3 E;  3HOW H;  2ATW A;  3GTM H;  4JI5 L;  1HZB A;  1CSP A;  1QVC A;  2N8N A;  1OXV A;  4DR5 Q;  3L0O A;  1N36 L;  3PUY A;  2OTL A;  4NXN Q;  4B3S Q;  4LUO A;  2F3I A;  3CMA A;  1PH7 A;  3KDF B;  4A75 A;  1SRU A;  4BY7 H;  4RMF A;  1QZH A;  5IYC H;  2ZJQ A;  3PGZ A;  4K0K Q;  1SRO A;  4KI0 A;  4BBS H;  2IHF A;  1K8G A;  2NVQ H;  2F52 A;  3EN2 A;  4DKA C;  1XMO Q;  1JE5 A;  3CP0 A;  3G48 A;  4C3H H;  2ZM6 L;  4DV4 Q;  1NJI C;  2CFM A;  3PO2 G;  3GTL H;  1Z47 A;  1IL2 A;  4GKK Q;  1WJJ A;  4QIW E;  3M7N A;  4R4I A;  4QQB X;  5LMN Q;  3K7A H;  3HFZ B;  3GD7 A;  3H0G H;  5GAH C;  4DV5 Q;  3T1H L;  1L1O B;  1KAW A;  2R7F A;  3OYY A;  3ICE A;  4A3G G;  3BZC A;  5IY0 A;  2CWA A;  4DV0 Q;  4JI6 Q;  1PH4 A;  3BU2 A;  1M90 C;  4A3L G;  4A3I H;  2PMZ E;  4GOP A;  1VQP A;  1VQ6 A;  2R7Z G;  1NY4 A;  1RL2 A;  4JI0 Q;  3ERS X;  1YJ9 A;  4A3M G;  4GLA C;  2I0Q A;  4LF9 Q;  1LTL A;  2A1A A;  4LUV A;  4LFA L;  1VQE A;  1TWG H;  4IPC A;  1I94 Q;  2Z6K C;  1L0W A;  2F4V Q;  2D62 A;  1Y1W G;  4LFC Q;  4JV5 Q;  1G6P A;  2QA4 A;  4JBM A;  1K9M C;  2JK8 A;  2D0O A;  2YU9 H;  4JI8 Q;  1PVO A;  2OQ0 A;  1OXT A;  3I7F A;  1X54 A;  4JI1 Q;  3STB C;  2NVT H;  2Y0S E;  1TWF H;  5BR8 Q;  3F1Z A;  1VS0 A;  4HJ8 A;  4DNI A;  3AQQ A;  4DR1 Q;  1UWV A;  1E24 A;  5GRO A;  3PF5 A;  2JE6 I;  2NZO A;  2AKW B;  3PF4 A;  4DR5 L;  2VQF Q;  4NXM L;  3KJP A;  4WJ4 A;  3NEL A;  2WAQ E;  3JC6 6;  1WYD A;  5H1S E;  2JA5 H;  4NXN L;  3D31 A;  4B3S L;  4MZ9 A;  4LF4 Q;  3GTJ H;  2BA0 A;  1C0A A;  4IFD G;  1OXU A;  3JAM i;  4JI3 Q;  3TEH B;  2MO1 A;  5C3E G;  1V43 A;  3PCO B;  2JA7 G;  1VQJ A;  2E2I H;  3E9I A;  4K0K L;  1T9H A;  2R7Z H;  5IYD G;  3BZK A;  2ES2 A;  3EBE A;  4HJ7 A;  1G51 A;  4A3J H;  1B7Y B;  1VQM A;  4DR3 Q;  1QUQ A;  4AYB E;  1VQO A;  4A3K G;  1XMO L;  2CCZ A;  3ULL A;  1KXL A;  3M4Q A;  1N32 Q;  2JEB I;  1Z9F A;  1XNQ Q;  1KL9 A;  4LF8 Q;  3TRZ A;  1Y1W H;  1GKH A;  5LMN L;  1AE3 A;  1CUK A;  4DV5 L;  4A76 A;  1S72 A;  4HIO A;  1O7I A;  1U5K A;  1XJV A;  2K75 A;  4JBK A;  1SFO H;  2MFI A;  4DV0 L;  1VQ9 A;  1L1O C;  2L15 A;  4R4T A;  5M3M H;  1PH8 A;  1YZ6 A;  2YV5 A;  4JI6 L;  1S3O A;  1PV4 A;  2HT1 A;  2H5X A;  1N34 Q;  3CCR A;  4IJH A;  1EIY B;  4A3C G;  4LW1 A;  3H3V I;  3J81 i;  4LF9 L;  4FDB A;  4WJ3 M;  1SR3 A;  3K80 C;  2UXC Q;  1Q1E A;  4DV1 Q;  1XPR A;  4EQ5 A;  1I94 L;  1JB7 A;  3T1Y Q;  3OTO Q;  2F4V L;  2IHE A;  5FLX c;  4LFC L;  4JV5 L;  2MO0 A;  4YWK A;  2HQL A;  1MJE A;  4OO1 G;  5M5Y H;  2WP8 J;  3M4P A;  3PSI A;  5C3E H;  5GAD C;  2JA7 H;  4JI8 L;  4L5T A;  3M3Y H;  1YHQ A;  4JI1 L;  2PQA B;  1EIF A;  5IYD H;  1K0R A;  2ZTD A;  5J3B A;  2KHI A;  3CPF A;  2LXJ A;  3ZJY C;  3HOY G;  1Q1B A;  5EAY A;  3CCM A;  4A3K H;  3S1Q H;  3D0F A;  4JBW A;  1WFQ A;  1LYL A;  4JCV E;  2NVY H;  4DR1 L;  4PZ7 A;  2VZA A;  2ZJR A;  2UXB Q;  3PUX A;  4DK6 C;  2VQF L;  3OW2 A;  5C0X I;  1HJP A;  1VQH A;  5DLQ E;  4DR4 Q;  1BKB A;  4JC0 A;  4P72 A;  2YTV A;  4LF5 Q;  4LF4 L;  3G6E A;  4JI3 L;  3RLN A;  1XPU A;  1OTC A;  1YHA A;  4BBR G;  2RHS B;  3BJU A;  2VS1 A;  3GO5 A;  1Q82 C;  4UP7 A;  3CCU A;  3CXC A;  4J15 A;  3J81 c;  1M1K C;  1N32 L;  1XNQ L;  3J7Z C;  2YTX A;  2Y0S G;  4LF8 L;  4P73 A;  4AQY Q;  4DV7 L;  3J7A 5;  3FKI G;  4IPG A;  3H15 A;  1IBM Q;  3CCS A;  3F2C A;  1EFW A;  3CD6 A;  3HOZ H;  1NTG A;  2XTI A;  2WAQ G;  2KHJ A;  4R1J A;  1PH2 A;  4A3I G;  4XIG S;  4BXX H;  1PYS B;  5JJL A;  3CQZ H;  2CKZ B;  2GVB A;  2PI2 A;  4B3T Q;  3HOY H;  1HNW Q;  3UDI A;  1N34 L;  1KC8 C;  1CKN B;  1H95 A;  1FJG Q;  2AMC B;  2UXC L;  2VNU D;  1Q8K A;  4DV1 L;  3G4S A;  3TQY A;  2N3S A;  4DAY B;  3S2D H;  2Q2I A;  3T1Y L;  3OTO L;  3CCV A;  4IFD I;  4YY3 Q;  4MNO A;  4AYB G;  3GTP H;  1TWH H;  4GKJ Q;  4A3E G;  1HNZ Q;  3TS2 A;  1LM0 A;  2JA6 H;  4HJ9 A;  1I50 H;  3HKZ G;  1S40 A;  4BBR H;  3A0J A;  4X64 Q;  2UU9 Q;  4PZ8 A;  4A93 H;  2CWP A;  3K81 C;  1HZA A;  2VY3 A;  2K5N A;  4POG A;  3KFU A;  1EYG A;  2JA5 G;  1PH6 A;  2UXB L;  1VQG A;  1X6O A;  3FKI H;  1Q12 A;  3M9B A;  1Q7Y C;  4DR4 L;  3ULJ A;  2WFW A;  3KF8 B;  4LF5 L;  4X66 Q;  4X6A H;  4IO9 A;  1JT8 A;  4GN5 A;  1UE1 A;  2FXQ A;  3ULP A;  1JMC A;  2DGY A;  4A3J G;  4DUY Q;  2K5H A;  2HHH Q;  1ASZ A;  1YHB A;  4BA2 I;  2IX1 A;  4QGU A;  1E22 A;  4TVA B;  3RNU A;  2NN6 G;  4AQY L;  1K83 H;  1IXR A;  4A3E H;  2VL6 A;  5K36 G;  1QVG A;  4GNX A;  1IBM L;  3NBH B;  1GM5 A;  1G29 1;  3GDE A;  2ZJP A;  5E7N A;  5M3M G;  3I56 A;  4DV2 L;  3GTQ H;  4A3B G;  5FLM G;  3TS0 A;  4B3T L;  2VQE Q;  1HNW L;  3UE1 A;  5FJ8 G;  1FJG L;  1VQC A;  1C9O A;  1PYB A;  2K14 A;  3KF6 A;  3I4M G;  2OQK A;  4A3D H;  2Q2T A;  1X56 A;  3M85 A;  4YCV A;  2ALY B;  3PIO A;  2NZH A;  4X62 Q;  2KEN A;  1J6Q A;  4O0A A;  4DK3 C;  3EIV A;  4YY3 L;  4GKJ L;  3S16 H;  1HNZ L;  1X9N A;  1Q81 C;  4HIK A;  4JOI C;  2CQO A;  3NEN A;  3PUV A;  3TRE A;  1VQD A;  3CCE A;  1I3Q H;  4H02 A;  3FP9 A;  4X64 L;  2QEX A;  3B6Y A;  2UU9 L;  3CC2 A;  4DV4 L;  2R92 H;  1JJC B;  4LF7 Q;  4Y52 H;  1AE2 A;  2AWN A;  2VW9 A;  4GKK L;  4UPA A;  3HKZ E;  3RZD H;  3S24 A;  2RF4 A;  1BVS A;  5IT9 c;  1BBW A;  4C3I H;  5LMU Q;  1OXS C;  1NMF A;  1TWA H;  4X66 L;  2R93 G;  2UXD Q;  5C0X J;  3HOU H;  3E9H A;  2A19 A;  1C7Y A;  1VQ8 A;  4A3B H;  3STB D;  5FLM H;  4A3F G;  4JI0 L;  3G71 A;  3S2H H;  3A5Z B;  1CKM A;  2GVA A;  3KDF A;  2UUB Q;  5FJ8 H;  2UUC Q;  4LUZ A;  4BY1 G;  4KLK A;  4RG1 A;  4PMW A;  1J5E Q;  4YHH Q;  2HHH L;  3I2Z A;  3I4M H;  1CSQ A;  1HNX Q;  1PH5 A;  1YVC A;  3PV0 A;  1VQF A;  2IX0 A;  1I5F A;  4BA1 I;  2E5L Q;  3WWV A;  5C4X G;  4XTC S;  3HOZ G;  2QGQ A;  2ID0 A;  3PO3 G;  4QJF A;  1KQS A;  4BXX G;  1KRT A;  2KBN A;  5BR8 L;  1DGS A;  1W2B A;  1IBL Q;  3F8T A;  2VQE L;  1Q46 A;  1SN8 A;  4QY7 A;  4HIM A;  4OWW B;  1MJC A;  2DUD A;  2UUA Q;  3Q8D A;  5IWA Q;  4P71 A;  4GOP B;  3ER0 A;  2ZTE A;  4P75 A;  4JYA Q;  1PA6 A;  5GAG C;  5JJK A;  2MQH A;  2JA9 A;  4GLX A;  2JA6 G;  2R93 H;  3KJO A;  2OWO A;  4OWX B;  4A3F H;  3RN2 A;  4A93 G;  5JEA J;  4DPG A;  4OXP A;  4DR3 L;  4DAM A;  2Q2U A;  4BY1 H;  1PFS A;  4LF7 L;  4PG3 A;  1A63 A;  4GNX B;  3K7U C;  3E0E A;  3CW2 C;  4UY8 C;  2A8V A;  3HOV H;  3A74 A;  4EX5 A;  1Y14 B;  3CF5 A;  5C4X H;  5LMU L;  1FVI A;  3I4O A;  2C35 B;  1Y1V G;  2MNA A;  1XPO A;  3PO3 H;  3W1B A;  3RLF A;  4R4C A;  3GTO H;  2UXD L;  1IBK Q;  2I5M X;  4DV3 Q;  5AJ3 Q;  1VQB A;  1P8L A;  4JI4 Q;  4KHP Q;  1NMG A;  1K8A C;  1SE8 A;  2YTY A;  3RR5 A;  1KD1 C;  2UUC L;  3CAM A;  4MTN A;  2UUB L;  4B3R Q;  1GVP A;  2BH8 A;  1RIP A;  1E1T A;  2E2H H;  4LFB Q;  4LF6 Q;  1E3P A;  1J5E L;  1MKH A;  1EOV A;  4YHH L;  3SGI A;  1YJN A;  3KLW A;  3CPW A;  1AH9 A;  4ME3 A;  3U58 A;  3VDY A;  3CME A;  2IY5 B;  1HNX L;  3AEV A;  1VCI A;  4JG2 A;  1XMQ Q;  2E2J H;  5M5X H;  4L5Q A;  1E1O A;  3CC7 A;  3S1N H;  1QUQ B;  5IP9 H;  2E5L L;  3F2B A;  1A62 A;  4Y7N H;  1HH2 P;  3CCJ A;  1NE3 A;  1N8R C;  2R7D A;  1X3F A;  4LNQ A;  3UDX A;  1A8V A;  4DR2 Q;  1LUZ A;  3W5O A;  1YEZ A;  2XGT A;  1D8L A;  3PUZ A;  1VQA A;  3FHW A;  4A3D G;  2LXK A;  1QVF A;  1SMX A;  4IJL A;  2JEA I;  2UUA L;  4NXM Q;  4DR6 Q;  5IWA L;  1P16 A;  4C3J H;  1KIX A;  4JYA L;  1TXY A;  4X65 Q;  1Y1V H;  2BA1 A;  4GOP C;  2EIF A;  2JQO A;  2I5H A;  1HZC A;  2B29 A;  3A5U A;  4JBJ A;  2R92 G;  1UEB A;  1VQI A;  1A0I A;  1V1Q A;  3M4O H;  5IP7 G;  4IPH A;  2R6G A;  4C2M H;  1Q86 C;  2PQA A;  4PZ6 A;  3J81 j;  4YWL A;  2YYZ A;  1UE6 A;  2Z0S A;  2RHQ B;  4GS3 A;  4OO1 I;  3GTG H;  1EWI A;  4GN3 B;  4GNX C;  3S1R H;  1N9W A;  2WB1 G;  4KHZ A;  5C0X G;  5C4J H;  4HJA A;  2K5V A;  3MXN B;  2B63 G;  3HOU G;  3HOX G;  1HZ9 A;  3J80 i;  4DV3 L;  5AJ3 L;  3K0X A;  1IBK L;  4JI4 L;  4KHP L;  1X55 A;  4O2D A;  3AFQ A;  1VQL A;  1HR0 W;  4GN4 B;  4B3R L;  5GAE C;  1YIT A;  2I5L X;  1YIJ A;  4JI7 Q;  1CKO A;  1QZG A;  4LF6 L;  4LFB L;  1YBY A;  3H3V H;  2KCM A;  2Z6K A;  3PUW A;  3S14 H;  2ASB A;  5JJI A;  4APV A;  5M3F G;  1PH9 A;  1XMQ L;  4DR7 Q;  2N49 A;  3AFP A;  1UE7 A;  3CC4 A;  1B8A A;  4DUZ Q;  1KHI A;  1ASY A;  1TWC H;  4ALP A;  3CCL A;  4OX9 Q;  3S17 H;  4YCU A;  4JI2 Q;  1E7Z A;  1X3G A;  4HJ5 A;  1OXX K; 
#chains in the Genus database with same CATH topology
 1JE4 A;  4ZK9 B;  3W1G A;  5E3F A;  5IP7 H;  3PO2 H;  1EQQ A;  1X3E A;  3LGJ A;  2E8G A;  2R7Z B;  3R2T A;  1EL0 A;  1GD7 A;  2K28 A;  1JJG A;  1SJH D;  3M4Y A;  1SMY C;  2AHO B;  2A69 D;  2FMC A;  1K73 C;  2I46 A;  4YWM A;  1K3R A;  2LMC B;  2KCC A;  5IGB A;  4R8N A;  4XQN A;  1NR4 A;  2SEB D;  3KYH C;  1GHJ A;  4KV6 A;  5D3I B;  5EKI A;  2IW3 A;  2OTJ A;  2K52 A;  3I4N G;  2KCT A;  3WOF A;  3NTK A;  3HOV G;  5M3F H;  1SLJ A;  3UDG A;  1PH1 A;  1VQ4 A;  2LSS A;  2L9H A;  2BDO A;  1PRT D;  4MIU A;  1FGB D;  1I6H H;  1DYQ A;  1XNR Q;  4DV6 Q;  5NUC A;  3MZ5 A;  4S3S A;  4UP9 A;  4NPS A;  1ESF A;  4CBV A;  3DWP A;  5L37 A;  1IZ6 A;  2KA7 A;  1B70 B;  1XTD A;  5FK9 C;  2Z6B A;  1WOC A;  1B44 D;  2EVB A;  4IAL A;  4P74 A;  2L1B A;  2NVY B;  5IP9 G;  3JAM c;  4L5S A;  1PHJ A;  4B9W A;  4ODG A;  4R4Q A;  1WCM H;  5CV5 A;  1H9S B;  5C44 H;  1F9R A;  2VXW A;  1EEF D;  2NTS A;  2FJ2 A;  1BCP D;  2F0H A;  1AEX A;  3P7J A;  3RLO A;  2ZTC A;  2K50 A;  3I55 A;  4HCE A;  2KJX A;  3HOZ B;  4LFA Q;  2F0D A;  3GQB A;  2F0W A;  2EQS A;  1S5F D;  4OON A;  3H0G G;  1R4Q B;  1TS4 A;  1JOR A;  1SNP A;  2IT1 A;  1PYW D;  3FRP B;  4LK1 C;  1XNR L;  4DV6 L;  4V0B A;  1GO3 E;  3HOW H;  2ATW A;  1CSP A;  1ICF B;  1OXV A;  3RUZ A;  1HA6 A;  1BXT A;  3PUY A;  4NXN Q;  4LUO A;  2F3I A;  2A6E C;  4A75 A;  5IYC H;  5G3L F;  1SRO A;  4KI0 A;  4BBS H;  1X3Q A;  4RGN A;  1JE5 A;  4DV4 Q;  2B2V A;  1IL2 A;  4KN7 C;  4GKK Q;  3M7N A;  4R4I A;  3K7A H;  3VR6 A;  2PO4 A;  4UHV A;  1S5D D;  3OYY A;  2R7F A;  2CWA A;  2SDF A;  1WD0 A;  2F0I A;  3BU2 A;  4DA2 A;  1Y8P B;  1T5E A;  3P75 A;  1K83 B;  3ERS X;  1YJ9 A;  3A8J E;  1TKW B;  3PIP 3;  4LFA L;  1I94 Q;  1L0W A;  1LLR D;  2F4V Q;  1BCP B;  4LFC Q;  4L8J A;  2JK8 A;  1I4X A;  2A68 D;  4JI8 Q;  2OQ0 A;  1OXT A;  3X3M A;  1HCZ A;  3STB C;  2RDH A;  5ELF A;  5J39 A;  3AQQ A;  2F0V A;  4M8A A;  4RCO A;  3TME A;  4IZ8 A;  2F0G A;  3K5L A;  2VQF Q;  3NEL A;  5D65 A;  3V05 A;  4NXN L;  4LF4 Q;  3GTJ H;  1CQF A;  3CU7 A;  1LT4 D;  3RZD B;  5C3E G;  3PCO B;  1PXU A;  2I07 B;  1R9T B;  1T9H A;  2QW7 A;  4C3I B;  2ES2 A;  2EDG A;  4O42 A;  1KXL A;  4A3K G;  1PFB A;  3ULL A;  3HOU B;  4KD4 A;  1KTK A;  2D9U A;  3T4A C;  5CBE E;  1DZ1 A;  1O7I A;  1V1P B;  3NP8 A;  4K5W A;  1XJV A;  4C1N I;  4JBK A;  1SFO H;  2MFI A;  2EY5 A;  1JIC A;  1L1O C;  5M3M H;  4GZY C;  4UAI A;  1PV4 A;  3ITP A;  3CCR A;  3QO2 A;  4A3C G;  2LFN A;  3H3V I;  5K5P A;  4FDB A;  1WVL A;  4H0L C;  5A2Q E;  1KLU D;  1I94 L;  1RF2 D;  1F2Z A;  2F4V L;  1YNN C;  3MFG A;  4LFC L;  4YWK A;  4RKL A;  5M5Y H;  1B1Z A;  3M4P A;  4EQP A;  4JI8 L;  1YHQ A;  2PQA B;  1EIF A;  2KHI A;  2VUM B;  1Q1B A;  1WFQ A;  4FXK C;  2ZJR A;  2VQF L;  4BY1 B;  4RGM A;  1BKB A;  4P72 A;  2H1E A;  2YTV A;  3DUZ A;  4LF4 L;  1MI2 A;  1SNM A;  3HG9 A;  1BR9 A;  3RLN A;  4K5V A;  3R8B A;  2RHS B;  1HTP A;  4UP7 A;  2OEO A;  2NB0 A;  5C4X B;  1FD7 D;  5FLX E;  1HQR D;  1M1K C;  3SK6 A;  4AQY Q;  4DV7 L;  3J7A 5;  1UAP A;  5ISR A;  1IW7 C;  4OO1 H;  1ET9 A;  1HHV A;  1EZ6 A;  4WJW A;  2WAQ G;  4R1J A;  4A3I G;  4BXX H;  5T1G A;  4DXG A;  2TSS A;  2CKZ B;  1BDO A;  2ICE C;  5M5X B;  1PFN A;  3HOY H;  1JWU D;  4Y7N B;  2BE5 D;  2RVL A;  3EQL C;  5EKL A;  4ID6 A;  4DAY B;  2N3S A;  1I4Q A;  1IL8 A;  1STE A;  1TWH H;  4A3E G;  1HNZ Q;  3JAM L;  3A0J A;  2SOB A;  1FYC A;  5DAU A;  3F2U A;  4POG A;  3U9O A;  2JA5 G;  1PH6 A;  4JVZ A;  2P5Z X;  1H9J A;  1VQG A;  3BG3 A;  1Q7Y C;  3FKI H;  1Q12 A;  2PPB C;  4KHV A;  1STG A;  4X66 Q;  2KVM A;  4C2M B;  2B2W C;  1BOS A;  5CC4 A;  2EYP A;  1F2L A;  4ZYS A;  3K5O A;  1EYA A;  4H44 C;  2E75 C;  1W6K A;  4BA2 I;  4JPB W;  4AQY L;  1J9O A;  2XIW A;  1LTT D;  3L3O C;  3GTQ H;  4A3B G;  4HCS A;  2VQE Q;  3UE1 A;  2F0F A;  5FJ8 G;  3S17 B;  1WTH A;  1F9Q A;  2E76 C;  3KK7 A;  4A3D H;  4KKS A;  4RKB A;  2Q2T A;  1EWC A;  1X56 A;  2NZH A;  4X62 Q;  1J6Q A;  4O0A A;  4DK3 C;  4DAP A;  4CJ2 C;  1HNZ L;  4K14 A;  4TSS A;  2JSO A;  4XQQ A;  1Q90 A;  2QEX A;  1SYG A;  2R92 H;  4A3G B;  1JJC B;  4LF7 Q;  2HCC A;  3S1M B;  1ZXT A;  3HKZ E;  3VYR A;  4H7B A;  5LL6 S;  2RF4 A;  3S24 A;  4A3M B;  1OXS C;  1NMF A;  4X66 L;  2UXD Q;  2MP1 A;  1C7Y A;  2A19 A;  1VQ8 A;  5KYL A;  3HGB A;  2CH4 W;  5FLM H;  4A3F G;  1Y1W B;  3NQT A;  4JI0 L;  2M9V A;  3A5Z B;  2UUC Q;  1L0X B;  4U68 A;  4KLK A;  4I7Z C;  1A6X A;  5EPK A;  1G91 A;  3TDQ A;  1C48 A;  1HNX Q;  4NMZ A;  4HED A;  1KDC A;  3D4R A;  3MVV A;  3HOZ G;  5FO8 B;  2QGQ A;  2ID0 A;  2XWJ B;  1KQS A;  1B53 A;  2EYL A;  2NWG A;  2VQE L;  4DF7 A;  2CW0 C;  4QY7 A;  2JA7 B;  1MJC A;  5BN5 A;  3M3Y B;  3Q8D A;  5CMD A;  4P71 A;  3ER0 A;  2NVX B;  4GLX A;  3T13 A;  3VR3 A;  4X3T A;  3I4N B;  3I3C A;  2K7V A;  5IOD A;  2KEE A;  2QEJ C;  2R3Z A;  4DPG A;  2Z4I A;  4LF7 L;  2DNE A;  1F9S A;  3RZO B;  3K7U C;  3CW2 C;  5IT9 L;  3HOV H;  1I6V C;  4EX5 A;  4QCL A;  1FVI A;  2PW5 A;  3I4O A;  3PO3 H;  3CRK C;  3RLF A;  2UXD L;  5E1F A;  2EYM A;  1P8L A;  1SE8 A;  2EOT A;  1KD1 C;  2UUC L;  4MTN A;  2BH8 A;  4LF6 Q;  3AB9 A;  1EOV A;  1RTN A;  4IUU A;  3CPW A;  3U58 A;  1CM9 A;  2EY6 A;  1HNX L;  3GTM B;  4J6H A;  1LTR D;  1G8Z D;  5IP9 H;  2WII B;  1A62 A;  3CCJ A;  5C4H A;  2C9O A;  1I4R A;  3TN2 A;  3S2D B;  1GJX A;  2R7D A;  4K5X A;  1A8V A;  4DR2 Q;  1D8L A;  2J7Z A;  3PUZ A;  1VQA A;  2QF7 A;  4IJL A;  4BBR B;  4DR6 Q;  1ML0 D;  1KIX A;  4C3H B;  5JPN C;  4GOP C;  1K0S A;  2VB3 X;  1SXT A;  1GOZ A;  1EY5 A;  1AW7 A;  2B29 A;  3A5U A;  1UEB A;  1U4L A;  2XNA C;  1A0I A;  4LMQ D;  1NAP A;  3VR5 A;  1LT3 D;  1EOT A;  1DOL A;  2Z0S A;  4C3I G;  2PNR C;  4GN3 B;  1ZEQ X;  2WB1 G;  3CKI B;  5C4J H;  2IWH A;  2K5V A;  3HOU G;  1D5X C;  1HZ9 A;  1X55 A;  4DNT B;  1VQL A;  4QMG A;  1HR0 W;  2OT2 A;  5GAE C;  1YIT A;  1GUN A;  4LF6 L;  1IKL A;  3H3V H;  2CH4 A;  3K6O A;  5KNB A;  4HSP A;  4WRD A;  2JYO A;  1PH9 A;  4DR7 Q;  2N49 A;  4F8M A;  3AFP A;  1UE7 A;  3CCL A;  4ALP A;  1SYF A;  3QB3 A;  4DR2 L;  3DLL A;  1YI2 A;  2FHT A;  1WI5 A;  2GN5 A;  2N78 A;  4DR6 L;  1L2F A;  2V1C C;  2VUM G;  5T1I A;  4L5R C;  2B63 H;  5IGC A;  3HOX H;  3NEM A;  2NZ1 D;  4L6T B;  1KRS A;  4DUY L;  2KHS A;  1U0L A;  2AWO A;  1OO9 B;  3Q22 A;  2K05 A;  3S2H B;  2K4K A;  3F2D A;  1XTC D;  1IYJ B;  2L5T A;  4YCW A;  1PTO H;  2NYZ D;  3I8Z A;  2RSO A;  1YNJ D;  3PMF A;  1JCK B;  3KOJ A;  4OIJ A;  5C3E B;  3Q24 A;  3VYT A;  2JA8 H;  3QR8 A;  1N36 Q;  3URY A;  3MXU A;  1Q3L A;  1FGU A;  2HIX A;  1NSN S;  2Q2H A;  4QL5 A;  3UE0 A;  1B4O A;  1SSO A;  4A3K B;  1JJ2 A;  5IE8 A;  4DR7 L;  5GQO A;  3CCQ A;  3NBH A;  5IYB H;  2OCE A;  2NN6 I;  3V2T A;  3PIO 3;  1EQV A;  4L63 B;  3T1H Q;  4EGV A;  4Z9C B;  1MIU A;  2RSN A;  1PRT F;  3KF6 B;  4UP8 A;  3J80 L;  5LMN W;  1K28 A;  4A3C H;  3AYH B;  1BNZ A;  3JAM E;  5KYI A;  2B8G A;  1RD9 D;  1JWS D;  3U4Z A;  2A74 C;  4CGY B;  3SK4 A;  4A4I A;  1WTO A;  4DV2 Q;  1IBL L;  1BO0 A;  3E0J A;  1EU3 A;  2WV6 D;  4DNR B;  2JA6 B;  1KDB A;  1I50 B;  1QVC A;  1S5B D;  1N36 L;  4ZQ3 A;  5I4D A;  3CMA A;  4A93 B;  4BY7 H;  1WTQ A;  4K0K Q;  3NWT A;  2IHF A;  1K8G A;  2NVQ H;  2GA4 B;  1XMO Q;  1Y1V B;  5A35 A;  1DXM A;  3RD4 A;  1ZYR C;  5IGF A;  3FPU B;  4QIW E;  4QQB X;  3HFZ B;  3T1H L;  1KAW A;  4A3G G;  2VB2 X;  4RAU C;  5IY0 A;  5JOB A;  2H4O A;  1G2S A;  1GUO A;  2PMZ E;  4GOP A;  4A3I H;  1VQP A;  1NY4 A;  1RL2 A;  4A3E B;  3GTG B;  1LAB A;  4A3M G;  4GLA C;  3EA6 A;  1TWG H;  4IPC A;  3V96 A;  1EIG A;  2Z6K C;  3BVM A;  1Y1W G;  4JV5 Q;  1S4Z A;  1K9M C;  3OSO A;  2A69 C;  2K5Q A;  2O4X A;  2NVT H;  1PFM A;  3F1Z A;  4HJ8 A;  3S16 B;  1RCV D;  4DNI A;  4DR1 Q;  3PF4 A;  4NXM L;  3KJP A;  1I3Q B;  2WAQ E;  3JC6 6;  2JA5 H;  3D31 A;  3ERO A;  2BA0 A;  4ZRZ A;  4IFD G;  1OXU A;  1RJT A;  3JAM i;  4JI3 Q;  4K6L A;  1FR3 A;  4XT1 B;  3K57 A;  3S9W A;  2JA7 G;  1VQJ A;  4K0K L;  2R7Z H;  3BZK A;  3EBE A;  1G51 A;  1B7Y B;  1VQM A;  1TWA B;  4DR3 Q;  1QUQ A;  1XMO L;  2CCZ A;  3SK5 A;  4A3B B;  1Z9F A;  1XNQ Q;  1EFI D;  1GKH A;  1CUK A;  5AFW A;  4WFN 3;  4A76 A;  4HIO A;  1U5K A;  4IUR A;  1STH A;  1YZ6 A;  3EFX D;  4FXD A;  1VMC A;  4HN7 A;  5M3F B;  1N34 Q;  4CDD C;  2FMM A;  5COR A;  1LTB D;  3K80 C;  2F1M A;  3N52 A;  1Q1E A;  4KK7 A;  4PMC A;  4DN4 M;  2X69 A;  1JOQ A;  4JV5 L;  1SMY D;  4HTH A;  4IN3 A;  1BCP C;  3SVM A;  1LO5 D;  5IYD H;  2EYJ A;  2L12 A;  2FFK B;  1MBY A;  2LXJ A;  3ZJY C;  2F0T A;  1O80 A;  1CT1 D;  2QKI C;  3MXN A;  4JBW A;  4JCV E;  1LYL A;  4DR1 L;  2NVY H;  2PZW A;  4A3F B;  5IT9 E;  5I2Y A;  4DK6 C;  3OW2 A;  5C0X I;  1HJP A;  1QWY A;  4DR4 Q;  1UNS A;  1WCM B;  4KKU A;  2CHB D;  5C44 B;  5CYU A;  4JI3 L;  1NR2 A;  4FVM A;  4BBR G;  3BJU A;  3TSS A;  3MHB A;  1Q82 C;  4C3H G;  1SND A;  3NK9 A;  1LT6 D;  3LWU A;  1XNQ L;  3D6C A;  3D4W A;  3H15 A;  1IBM Q;  2OF1 A;  2E2H B;  2G5D A;  3HOZ H;  2XRQ D;  1PH2 A;  2BCO A;  5CV9 A;  4IUQ A;  2GVB A;  1EU4 A;  3S1N B;  1HNW Q;  1N34 L;  1CKN B;  1FJG Q;  3L9A X;  1E2Z A;  2F0K A;  3SE0 A;  4F7X A;  2VNU D;  1ET6 A;  1Q8K A;  3H91 A;  3D8G A;  2Q2I A;  3R93 A;  3Q0A A;  4IFD I;  3HOW B;  1PRT B;  3UI2 A;  4KN4 C;  2PZU A;  2K32 A;  4HJ9 A;  3H09 A;  3TBI B;  4C3J B;  1A3U A;  4PZ8 A;  4G7H C;  3K81 C;  3ND9 A;  5I6W A;  1S5E D;  1HTL D;  3D6W A;  5D3D A;  4DR4 L;  5I9P A;  5BN3 A;  1EYD A;  3A7A B;  4MHE A;  3KF8 B;  1I4P A;  5ELE A;  4GN5 A;  2LS0 1;  2A68 C;  2FXQ A;  4BS9 A;  1JMC A;  2AQ3 B;  3S1R B;  4C1N K;  2DJF C;  1RKN A;  5KNC A;  1CK1 A;  2IX1 A;  1E22 A;  1U9R A;  3VA7 A;  2O5J C;  1K83 H;  1H9S A;  4GNX A;  3HEJ A;  1IBM L;  2DNC A;  4YIJ A;  3S14 B;  3TS0 A;  1HNW L;  1FJG L;  4OIK A;  1SYB A;  1C9O A;  3R2I A;  3I4M G;  2OQK A;  1SDF A;  3HS0 C;  1RTO A;  3TZU A;  2ALY B;  4KY7 A;  1MSG A;  3EIV A;  4J8Q A;  4V19 0;  4ZKC B;  4JOI C;  4ZKB B;  2CQO A;  3NEN A;  1VQD A;  4CKB A;  4H02 A;  2WB1 B;  3B6Y A;  4DV4 L;  3I73 A;  1AE2 A;  4GKK L;  1EEI D;  3RZD H;  2NN6 H;  3CHB D;  4IQZ A;  4XYQ A;  4C3I H;  5IT9 c;  5LMU Q;  4DK0 A;  2PCF B;  3S15 B;  2R93 G;  3NQI A;  5C0X J;  2B2Y C;  2B2U C;  3HOU H;  3E9H A;  1WTR A;  1EQT A;  3STB D;  3P20 A;  2QCP X;  4LUZ A;  1B9N A;  2EXZ A;  1W6J A;  2N55 A;  3I2Z A;  1SFO B;  4G57 A;  5CV7 A;  2ZXO A;  3I70 A;  1PH5 A;  2IX0 A;  3MA2 B;  4BA1 I;  3WWV A;  1GHK A;  4XTC S;  3QWN A;  2KBN A;  1W2B A;  1SJE D;  1O7Z A;  1A2U A;  1Q46 A;  4HIM A;  2UUA Q;  1EWH A;  4I7A A;  2A6H C;  2NTT A;  2ZTE A;  3E5S A;  2XVS A;  3J80 E;  2JA6 G;  2RCF A;  1LTG D;  5CGK A;  1D1K A;  3RN2 A;  4A93 G;  4OXP A;  4BY1 H;  4K6D A;  1GUW A;  4PG3 A;  1A63 A;  5IOC A;  4C56 C;  3E0E A;  3K58 A;  4XT3 B;  5LMU L;  1O7L A;  3NBI A;  5C4X H;  5C5M A;  2C35 B;  1Y1V G;  3KBG A;  3W1B A;  3GTO H;  2I5M X;  3DWQ A;  5AJ3 Q;  4JI4 Q;  1FNV A;  1NMG A;  3J7A V;  3CAM A;  1D1I A;  1CA6 A;  1E3P A;  1MKH A;  5CR3 A;  2DN8 A;  2E2D C;  4XDX A;  1AH9 A;  3VDY A;  3CME A;  1VCI A;  4JG2 A;  5M5X H;  4L5Q A;  3F2B A;  4Y7N H;  1HH2 P;  3FVQ A;  1NE3 A;  4J1M A;  3T51 B;  1N8R C;  3UDX A;  3OHX C;  1V1P A;  1ROD A;  2XGT A;  2K6A A;  2KEC A;  3FPP A;  2JEA I;  1B3Q A;  2UUA L;  1DJR D;  2F0E A;  4X65 Q;  2RDF A;  1H9R A;  2BA1 A;  2EIF A;  3A7L A;  4KJO A;  2JQO A;  2Y0S B;  1G2T A;  3DXJ C;  3A8K E;  2EY2 A;  3FKI B;  3SHL A;  1I4G A;  2QIL A;  4RH6 A;  4RCN A;  5IP7 G;  4R9W A;  4C2M H;  1Q86 C;  1V1O A;  2PQA A;  4PZ6 A;  4YWL A;  5EPL A;  4K2L A;  1ENF A;  1HXY D;  1RHP A;  2KUM A;  1WTP A;  4HJA A;  4ABN A;  1XXG A;  1ILP A;  3J80 i;  5AJ3 L;  4JI4 L;  3FMC A;  4O2D A;  4AYB B;  5EQ0 A;  2IX3 A;  2YU9 B;  3T56 B;  2I5L X;  4JI7 Q;  4RFB A;  4P2C B;  1QZG A;  1LAC A;  3TP8 A;  2ASB A;  3NXW A;  5M3F G;  4HR7 B;  3VYU A;  1B8A A;  4DUZ Q;  4OX9 Q;  3S17 H;  4YCU A;  4JI2 Q;  1X3G A;  1VQ5 A;  5C3X A;  2E2I B;  2DY8 A;  1LTA D;  2HIV A;  1F2M A;  1X65 A;  2JP1 A;  3SK8 A;  4A3J B;  3A8I E;  1PTO F;  5C0X H;  2EYF A;  4X65 L;  4A3G H;  1VQK A;  2PNH A;  2RCN A;  3S1M H;  4IOA A;  1ZKO A;  4XQJ A;  4IOC A;  3W3A A;  4DAY A;  3EJI A;  3J80 c;  1PH3 A;  5JEA G;  4B3M Q;  4POF A;  4JOI A;  4PMB A;  1WCM G;  4A3M H;  5C44 G;  2KOL A;  3HKS A;  2HDM A;  4CJ0 B;  1JWM D;  4NDX A;  5HY6 A;  3KLS A;  4ME5 A;  2M00 A;  4DU9 A;  1L1O A;  2K5W A;  1XYI A;  2B2Y A;  3GTK H;  3BZD B;  3K59 A;  4JI5 Q;  4JI7 L;  1VQ7 A;  3E6Z X;  4FF1 A;  4R4O A;  1HUN A;  1EUJ A;  4X62 L;  2PQE A;  3SXH A;  1SBB B;  3MFY A;  4IFD H;  5ELO A;  5FKA C;  2PI2 E;  4CKE A;  1QCB D;  4DUZ L;  4OX9 L;  1NBW A;  3CRL C;  4JI2 L;  3RN5 A;  1D5M C;  2NVX H;  2ZM6 Q;  3HOW G;  3BDO A;  3I4N H;  4IPD A;  4C3J G;  2AUK A;  1MHW C;  1QNU A;  3L2P A;  1GXD C;  4ILW A;  1YJW A;  5ELB A;  1WTW A;  1M8A A;  2F0S A;  3LX0 A;  4QUF A;  5IYC G;  3RZO H;  4IUT A;  1YNX A;  4B3M L;  4BBS G;  3GP7 A;  3IRB A;  4TQU S;  4HID A;  2CW0 D;  5C6A A;  4U67 3;  3CQZ B;  4LWC A;  5M5W H;  1SYD A;  1TS3 A;  3OPO A;  3MC0 B;  2EXD A;  3U4V A;  3UDF A;  3GTM H;  3O13 A;  4X3K A;  4JI5 L;  2K33 A;  1ONL A;  2Q8R E;  4MN3 A;  5E4W C;  1VF5 C;  4KY6 A;  3KDF B;  4HSV A;  3EVQ A;  3PGZ A;  1HUM A;  3OOC A;  5KEE A;  4RA8 A;  1BBX C;  4DKA C;  3CP0 A;  4C3H H;  2ZM6 L;  3GTL H;  1Z47 A;  1AZQ A;  1PTO D;  3GD7 A;  3H0G H;  4DV5 Q;  2RKS A;  3BZC A;  4DV0 Q;  1SNQ A;  5EGT A;  4CJ1 B;  4Q5V A;  2B2W A;  3C2P A;  4A3L G;  1VQ6 A;  2CVR A;  4PNY A;  1EY9 A;  2I0Q A;  4LF9 Q;  1LTL A;  2A1A A;  2PW7 A;  1STB A;  2AQ2 B;  1VQE A;  2EYO A;  1B9M A;  3LNN A;  1TR5 A;  3QOL A;  2QA4 A;  4JBM A;  3N6R A;  2D0O A;  1STN A;  4RWS C;  1EY4 A;  1M4V A;  1PVO A;  4DK1 A;  3OIQ A;  1Y69 U;  4CKC A;  1TWF H;  5BR8 Q;  1T5X D;  2L55 A;  3PF5 A;  1E24 A;  2JE6 I;  3I4L A;  3FDT A;  4WJ4 A;  3NHH A;  3OW7 A;  1C0A A;  2K03 A;  3TEH B;  1PDQ A;  2F0O A;  4HJ7 A;  4JK1 C;  1YNJ C;  1ICW A;  4QF4 A;  3MXP A;  1VQO A;  1QB5 D;  1XWE A;  3M4Q A;  3HOX B;  1KL9 A;  4LF8 Q;  1EIH A;  3TRZ A;  4DV5 L;  1S72 A;  2F03 A;  1JOK A;  2K75 A;  3VA5 A;  3I4M B;  4DV0 L;  2L15 A;  1PH8 A;  4NKL A;  1EY6 A;  1S3O A;  2H5X A;  3MWY W;  4LF9 L;  2M2L A;  4WJ3 M;  1TU2 B;  4DV1 Q;  1TII D;  4EQ5 A;  1PTO B;  1SYC A;  2BOS A;  4FXG C;  1JB7 A;  3T1Y Q;  1FNU A;  1MSH A;  2IHE A;  5IGD A;  5LHY 1;  3C1E A;  3OIP A;  5CBA E;  2HQL A;  1MJE A;  4OO1 G;  3OMG A;  2WP8 J;  5C3E H;  2DY7 A;  3G6J B;  4L5T A;  1K0R A;  4EQO A;  2MPM A;  3H94 A;  1SEB D;  1PZI D;  3RMH A;  2EPB A;  5EAY A;  3HOY G;  2R93 B;  3CCM A;  4A3K H;  5KGU A;  3S1Q H;  2UXB Q;  3PUX A;  4WOR A;  2DJG C;  1E2V A;  2IL8 A;  2PZT A;  1YHA A;  5FO7 B;  4HAE A;  2HDL A;  2VS1 A;  3GO5 A;  3CCU A;  4J15 A;  2ZT9 C;  3J7Z C;  2Y0S G;  4TRD A;  4LF8 L;  1PLF A;  1NCV A;  2ZXR A;  3FKI G;  4IPG A;  3CCS A;  3R3O A;  3CD6 A;  2XTI A;  2KHJ A;  1CA5 A;  2V4D A;  5JJL A;  2E2J B;  4N8X 1;  3UDI A;  4KY5 A;  5DM7 3;  2EJF C;  2AMC B;  4DV1 L;  3TQY A;  5EBD A;  3C1F A;  3T1Y L;  4RGT A;  1TVX A;  3CCV A;  3MTS A;  4AYB G;  3GTP H;  3G7L A;  5JVG 3;  3TS2 A;  2JA6 H;  3GV3 A;  3TZD A;  1I50 H;  3HKZ G;  4CDE C;  2UU9 Q;  4A93 H;  2K5N A;  3DEP A;  3KFU A;  1EYG A;  1TY2 A;  1AFP A;  2UXB L;  1X6O A;  4OEM B;  3M4O B;  1S5C D;  2WFW A;  1IYV A;  1K3B C;  2K1B A;  5FO9 B;  4IO9 A;  1UE1 A;  3ULP A;  1EY0 A;  2DGY A;  4A3J G;  5FOB B;  2HHH Q;  5D14 A;  3J81 L;  3DHQ A;  4QGU A;  3RNU A;  1X3P A;  5C4Z A;  2G9H D;  5C3W A;  3QOJ A;  2VL6 A;  4A3E H;  3NUC A;  5K36 G;  5M9O A;  1GM5 A;  4ZUI A;  1G29 1;  1TWG B;  2ZJP A;  1HFN A;  1KNA A;  3I56 A;  4DV2 L;  1HFG A;  5FLM G;  2B8F A;  3BDC A;  1ZYR D;  1TWC B;  2EY1 A;  3KF6 A;  2K14 A;  3M85 A;  4YCV A;  3PIO A;  4G4K A;  2WIN B;  3PO2 B;  3S16 H;  1X9N A;  4HIK A;  2D2C C;  1PRT C;  1TQO A;  3CCE A;  1I3Q H;  3FP9 A;  3VR4 A;  3ERQ A;  5I6Y A;  2UU9 L;  3CC2 A;  4Y52 H;  1CHQ D;  2ICI A;  5DEH A;  4H13 C;  4UPA A;  2MJ8 A;  3OMC A;  2Z4H A;  1DON A;  1TWA H;  1D5Z C;  4A3B H;  1I4H A;  4K8J A;  3G71 A;  2FIN B;  1CKM A;  2GVA A;  5LL6 X;  2UUB Q;  5FJ8 H;  4ULL A;  4RG1 A;  4PMW A;  1J5E Q;  1NNX A;  4YHH Q;  2HHH L;  1I6H B;  3C46 A;  1CSQ A;  3LWE A;  1WTX A;  1TS2 A;  3PV0 A;  1I5F A;  4ZUJ A;  2SNM A;  2E5L Q;  3PQI A;  2LKV A;  2L4N A;  3PO3 G;  2JXM B;  4FP5 D;  1KRT A;  5JPM C;  1DGS A;  1ENC A;  1U4M A;  4ZLT F;  3BVG A;  1A3T A;  2DUD A;  2KED A;  5IWA Q;  1F9P A;  5GAG C;  2MQH A;  2JA9 A;  3KJO A;  4A3F H;  4EVO A;  5JEA H;  5EPJ A;  4DR3 L;  2Q2U A;  1VDZ A;  1DCZ A;  3I90 A;  1TS5 A;  4GNX B;  1D6E C;  2QDL A;  1CFM A;  3A74 A;  1Y14 B;  3CF5 A;  2SNS A;  5CV8 A;  3BYY B;  4PV1 C;  4KHP Q;  1VQB A;  1L0Y B;  1K8A C;  3NE5 B;  2YTY A;  1ENA A;  3RR5 A;  5CV6 A;  2UUB L;  4B3R Q;  1B50 A;  5J1Z A;  2A5H A;  3SDZ A;  1RIP A;  1LTS D;  2E2H H;  1STY A;  1J5E L;  4YHH L;  2K01 A;  3SGI A;  1YJN A;  1J8I A;  1ESR A;  2IY5 B;  3AEV A;  1XMQ Q;  3S1N H;  3H6M A;  4N9T A;  2E5L L;  4OEL B;  1X3F A;  3SR1 A;  1YEZ A;  3KBX A;  1TT2 A;  3W2D A;  3FHW A;  2LXK A;  1QVF A;  4BBS B;  3OWF A;  4K8I A;  2XRS D;  4E6I A;  5IWA L;  4C3J H;  1TXY A;  3I72 A;  3BVZ A;  3T16 A;  3K7A B;  4N8F A;  4JBJ A;  3KLR A;  1UUP A;  1CI3 M;  2R6G A;  3J81 j;  2YYZ A;  1UE6 A;  3HRZ C;  2A6E D;  2RHQ B;  3S1R H;  1N9W A;  4KHZ A;  3T53 B;  1IYU A;  2B63 G;  2N88 A;  3HOX G;  4KHP L;  3K0X A;  1WTV A;  2X6L A;  2F0N A;  1MGS A;  4B3R L;  3TP6 A;  5IIF A;  1YIJ A;  4FF2 A;  2KCM A;  2R61 A;  4IUN A;  2Z6K A;  4X3U A;  3S14 H;  1XMQ L;  4O1N A;  1H9M A;  3GTJ B;  4HJ5 A;  2MUY A;  2JJQ A;  2BDN A;  4B08 A;  2JA8 G;  1R9T H;  1A15 A;  1SE4 A;  2ZXP A;  1BBU A;  1CKN A;  4K2K A;  3L7Z C;  4TKO B;  1A3V A;  3HZX A;  3IFD A;  1K8O A;  3KLS X;  4A3L H;  1SE2 A;  2HUG A;  2XN9 C;  1Z7T A;  2J4X A;  3NWS A;  5TSS A;  1SE3 A;  5IYB G;  2RDG A;  5M3M B;  1W3S A;  3S15 H;  1N33 Q;  1HR0 Q;  4DV7 Q;  4GLV B;  1PZJ D;  1EQR A;  2IJ0 A;  2BH2 A;  1FL0 A;  2D0P A;  3MEF A;  1PZK D;  3P1H A;  4AIM A;  3E3X A;  2WB1 E;  3KF8 A;  5JJZ A;  5M5Y B;  2B2T C;  1EYC A;  2K04 A;  2D5D A;  1D7Q A;  2NUC A;  5HGQ A;  2VUM H;  3ND8 A;  4B9X A;  1VQN A;  2C5C A;  4RHS A;  3DM3 A;  4IFD J;  4NB3 A;  3K8A A;  2PYK A;  5DNF A;  1QOH A;  1LV9 A;  4OWT B;  3PIP A;  2BE5 C;  1V9P A;  1YNN D;  5ELN A;  1BUV T;  4FYD A;  4BY7 G;  2XWB B;  5G3L D;  4KTA A;  1R4P B;  3J7Y W;  1C4Q A;  1O78 A;  5HUR A;  3DWA A;  1Q8I A;  2LY7 A;  1HPC A;  4G7O C;  4AH6 A;  1HRJ A;  3KUP A;  4XYO A;  3GTO B;  2L11 A;  1QNK A;  5I9O A;  4IUV A;  1WD1 A;  3HOY B;  2A6H D;  2B3G A;  3QIA A;  1N33 L;  1HR0 L;  1IKM A;  3U50 C;  1UE5 A;  2ENB A;  3M7G A;  1TWH B;  3A55 A;  2F4I A;  1HZB A;  2RBM A;  3IAY A;  2N8N A;  4DR5 Q;  1CHP D;  3L0O A;  4OHJ A;  2OTL A;  3AU7 A;  1IW7 D;  4B3S Q;  1O7Y A;  1PH7 A;  2A73 B;  1SRU A;  4NP5 A;  4RMF A;  1QZH A;  2ZJQ A;  2Z8L A;  3J81 E;  2F52 A;  3EN2 A;  3K0Y A;  1NJI C;  3G48 A;  3PO2 G;  4LAA A;  3K5M A;  2CFM A;  4ZCK A;  1WJJ A;  2WAC A;  5LMN Q;  5GAH C;  4N9P A;  1L1O B;  3ICE A;  1HQM C;  2J0T D;  4JI6 Q;  1LTI D;  5EBC A;  3A56 A;  1PH4 A;  1M90 C;  4RGO S;  2R7Z G;  4JI0 Q;  3D4D A;  1KAB A;  2HQE A;  4ZAI A;  4LUV A;  3HKZ B;  4DGZ A;  4CDF C;  3GTQ B;  1Z6H A;  2K5D A;  1Y8O B;  3IKJ A;  2D62 A;  3QJY A;  1G6P A;  1RDP D;  1IHZ A;  3NSW A;  2YU9 H;  4A3D B;  2RQX A;  1X54 A;  3I7F A;  4JI1 Q;  2CQA A;  1SNO A;  1LT5 D;  5CV4 A;  2EYH A;  2Y0S E;  4DFA A;  4QB4 A;  1VS0 A;  1SYE A;  4DAV A;  1K8M A;  1UWV A;  5GRO A;  1FNW A;  2NZO A;  1A2T A;  2AKW B;  5I2X A;  4DR5 L;  3DM1 A;  1EY7 A;  2KCN A;  1WYD A;  5H1S E;  2R92 B;  4B3S L;  4MZ9 A;  1BF4 A;  1XX8 A;  3D3R A;  2MO1 A;  1PMR A;  1V43 A;  3IFT A;  2E2I H;  1BQQ T;  3E9I A;  2AQ1 B;  4G7Z C;  5IYD G;  3AMU A;  1CTM A;  4A3J H;  1AZP A;  4FO2 A;  4AYB E;  1N32 Q;  2JEB I;  1QIL A;  5JVH 3;  1Y1W H;  5LMN L;  1AE3 A;  3WDN A;  2G9D A;  2EE1 A;  1UEA B;  5K36 H;  3BDL A;  1QG7 A;  4R4T A;  1VQ9 A;  4JI6 L;  2YV5 A;  2B2U A;  3U9S A;  1F77 A;  2HT1 A;  1EIY B;  4IJH A;  3NTH A;  4LW1 A;  3J81 i;  3QG1 A;  1SR3 A;  3BS1 A;  2UXC Q;  1XPR A;  3DEO A;  3OTO Q;  5FLX c;  1MD2 D;  3GTK B;  2MO0 A;  2WKC A;  4UDU C;  3PSI A;  2JA7 H;  5GAD C;  3M3Y H;  4JI1 L;  1EY8 A;  5J3B A;  2ZTD A;  1H9K A;  3CPF A;  2F0J A;  3H3V C;  1TY0 A;  3D0F A;  4PZ7 A;  5F2D A;  2JN4 A;  2VZA A;  5JAV A;  2IPK D;  2B2T A;  4RHR A;  5DLQ E;  1VQH A;  1DD2 A;  2F3W A;  4JC0 A;  4LF5 Q;  3HP3 A;  3G6E A;  1G6Z A;  3MXG A;  1XPU A;  1CZG A;  1OTC A;  5ELC A;  3HOV B;  4FF4 A;  3CXC A;  5HGT A;  3J81 c;  3PO3 B;  2AUJ D;  1N32 L;  1VF7 A;  2YTX A;  4FNF A;  4P73 A;  1KDA A;  3OWE B;  3MEH A;  1JR0 D;  3F2C A;  1EFW A;  1QJO A;  1NTG A;  4OL7 A;  4XIG S;  5KRU A;  3X3N A;  1PYS B;  3CQZ H;  5M5W B;  1KNE A;  2PI2 A;  4B3T Q;  1SAP A;  1H95 A;  1KC8 C;  4X3S A;  3TP7 A;  3GV6 A;  2UXC L;  2WKD A;  2HD3 A;  3G4S A;  3S2D H;  3OTO L;  2EZV A;  4YY3 Q;  4MNO A;  4GKJ Q;  1PTO C;  2EJM A;  1NUC A;  1LM0 A;  3A54 A;  1S40 A;  4BBR H;  4X64 Q;  4CDC C;  3Q23 A;  2CWP A;  1HZA A;  1JOO A;  5C5L A;  2VY3 A;  4HMJ A;  3DMU A;  3J7A F;  3M9B A;  3ULJ A;  4LF5 L;  4X6A H;  1JT8 A;  3GTL B;  1STA A;  1SNC A;  2B39 A;  2F0L A;  3H0G B;  4DUY Q;  5C4J B;  2K5H A;  1U4R A;  1ASZ A;  4PQX A;  1YHB A;  5KIX A;  4HMI A;  4TVA B;  1B3A A;  5COY A;  3WOE A;  1AP0 A;  1B2T A;  1GUG A;  2NN6 G;  1IXR A;  1QVG A;  1D2B A;  3NBH B;  1QE6 A;  1KAA A;  3GDE A;  5E7N A;  5M3M G;  4B3T L;  1U4P A;  1VQC A;  1PYB A;  2KEN A;  1TWF B;  4YY3 L;  2L0C A;  4GKJ L;  1Q81 C;  4NW2 A;  1F2Y A;  3PUV A;  2QDB A;  3TRE A;  1JQY D;  4X64 L;  5IGG A;  2B63 B;  1VMP A;  2AWN A;  2VW9 A;  4OGQ C;  1BVS A;  1BBW A;  3FEW X;  1HA5 A;  3ONA B;  2O2L D;  3S2H H;  1E2W A;  1DM0 B;  2HCI A;  2X6G A;  3KDF A;  4KKT A;  4BY1 G;  5ELD A;  1CZW A;  3I4M H;  1JB3 A;  1YVC A;  4DXF A;  1VQF A;  2JA8 B;  5C4X G;  1II3 A;  4QJF A;  4BXX G;  3C3L A;  1GUT A;  4CHT B;  1GUS A;  3IL8 A;  5BR8 L;  1IBL Q;  1JC7 A;  3Q6S A;  4EQN A;  3F8T A;  1SN8 A;  4OWW B;  4QUC A;  4GOP B;  1C8C A;  1DOK A;  5A2Q L;  4P75 A;  4JYA Q;  1PA6 A;  2Q8T A;  5JJK A;  3TP5 A;  2R93 H;  4I65 A;  3S1Q B;  3K5N A;  2OWO A;  4OWX B;  1X32 A;  5EKK A;  4IUP A;  5EJW A;  5JEA J;  4DAM A;  2F0U A;  5BN4 A;  1PFS A;  5J22 A;  3VR2 A;  4UY8 C;  1E0B A;  2A8V A;  4LJZ C;  3MAQ A;  2MHV A;  2MNA A;  1XPO A;  3ZYY X;  4R4C A;  1IBK Q;  4DV3 Q;  1DOM A;  2O5I C;  2F3V A;  4F87 A;  2Z1C A;  4F88 A;  1CQV A;  1GVP A;  2F0Q A;  1E1T A;  4QIW B;  4XXE A;  4LFB Q;  2XSC A;  4M1U B;  3VYS A;  1AN8 A;  5IGE A;  3KLW A;  4ME3 A;  5FLX L;  4FF3 A;  2E2J H;  3CC7 A;  1E1O A;  1QUQ B;  2KQ3 A;  2PMZ B;  2RA4 A;  4LNQ A;  2B2V C;  4BY7 B;  1LUZ A;  3W5O A;  3GTP B;  5E4X A;  4A3D G;  1SMX A;  2NVQ B;  4NXM Q;  2Q8I B;  1P16 A;  5KND A;  1ILQ A;  4JYA L;  1Y1V H;  1BCP F;  1KLG D;  2NBF A;  2I5H A;  1HZC A;  2OXP A;  2F0P A;  2R92 G;  1VQI A;  1EZ8 A;  1V1Q A;  3M4O H;  5DM6 3;  2E74 C;  4IPH A;  1V8Q A;  3BYT B;  2TMP A;  2MGS A;  2WAQ B;  4KD3 A;  4A3I B;  1Y8N B;  4KJN A;  4OO1 I;  4GS3 A;  4KMU C;  3GTG H;  1EWI A;  4GNX C;  5C0X G;  4MTK A;  3MXN B;  2EJG C;  1IBK L;  4DV3 L;  3AFQ A;  2Z9H A;  4GN4 B;  3NTI A;  1CKO A;  4LFB L;  4Q0F A;  1YBY A;  3NPP A;  2NVT B;  4BWG B;  3PUW A;  5JJI A;  4APV A;  3I91 A;  3CC4 A;  1ASY A;  1KHI A;  4JW0 A;  1TWC H;  4R8I A;  3SEB A;  2JA5 B;  1E7Z A;  2F0M A;  1OXX K; 
#chains in the Genus database with same CATH homology
 1VQ5 A;  4DR2 L;  3W1G A;  2JJQ A;  5IP7 H;  3PO2 H;  1EQQ A;  1X3E A;  3DLL A;  1YI2 A;  3LGJ A;  2JA8 G;  2E8G A;  1R9T H;  1GD7 A;  2HIV A;  2GN5 A;  1WI5 A;  1X65 A;  2N78 A;  4DR6 L;  1L2F A;  2V1C C;  2VUM G;  1JJG A;  1BBU A;  1CKN A;  4L5R C;  4X65 L;  2AHO B;  4A3G H;  2B63 H;  3L7Z C;  1K73 C;  2PNH A;  2RCN A;  3NEM A;  1K3R A;  4YWM A;  3HOX H;  1VQK A;  3S1M H;  4IOA A;  4IOC A;  3J80 c;  1PH3 A;  1KRS A;  5JEA G;  4B3M Q;  4POF A;  4DUY L;  4A3L H;  3KYH C;  4JOI A;  1U0L A;  1WCM G;  2AWO A;  4A3M H;  5C44 G;  2OTJ A;  5IYB G;  3S15 H;  1W3S A;  2K52 A;  3I4N G;  2KCT A;  3HKS A;  1N33 Q;  1HR0 Q;  3HOV G;  2K4K A;  3F2D A;  5M3F H;  4DV7 Q;  1IYJ B;  5HY6 A;  4GLV B;  1SLJ A;  3UDG A;  1PH1 A;  1VQ4 A;  1EQR A;  2LSS A;  4YCW A;  1I6H H;  2BH2 A;  1FL0 A;  2D0P A;  3MEF A;  1XNR Q;  4DV6 Q;  1L1O A;  4UP9 A;  3KOJ A;  3GTK H;  4NPS A;  4AIM A;  2WB1 E;  4JI5 Q;  2JA8 H;  4JI7 L;  1N36 Q;  1VQ7 A;  1IZ6 A;  4R4O A;  1D7Q A;  5HGQ A;  1EUJ A;  4X62 L;  1B70 B;  1XTD A;  2VUM H;  1FGU A;  2HIX A;  1WOC A;  2Q2H A;  4QL5 A;  3UE0 A;  1JJ2 A;  4P74 A;  1VQN A;  5IP9 G;  5IE8 A;  5ELO A;  4DR7 L;  3DM3 A;  2PI2 E;  5GQO A;  4NB3 A;  3JAM c;  4IFD J;  3CCQ A;  4DUZ L;  4L5S A;  4OX9 L;  1NBW A;  3K8A A;  1PHJ A;  4JI2 L;  3RN5 A;  4R4Q A;  1WCM H;  2ZM6 Q;  2NVX H;  3HOW G;  4OWT B;  5C44 H;  3PIP A;  5IYB H;  2OCE A;  2NN6 I;  3I4N H;  1V9P A;  4IPD A;  5ELN A;  3T1H Q;  3L2P A;  1YJW A;  3RLO A;  4BY7 G;  1MIU A;  5IYC G;  2ZTC A;  3KF6 B;  3RZO H;  4UP8 A;  1YNX A;  4B3M L;  2K50 A;  4BBS G;  5LMN W;  3IRB A;  4TQU S;  3I55 A;  4HID A;  4A3C H;  4LFA Q;  3AYH B;  4AH6 A;  2EQS A;  2B3G A;  4LWC A;  5M5W H;  4OON A;  1N33 L;  3H0G G;  1HR0 L;  3U4Z A;  3U50 C;  2EXD A;  3U4V A;  1UE5 A;  2IT1 A;  4A4I A;  3UDF A;  4DV2 Q;  1IBL L;  1XNR L;  4DV6 L;  1GO3 E;  3HOW H;  2ATW A;  3GTM H;  4JI5 L;  1HZB A;  1CSP A;  1QVC A;  2N8N A;  1OXV A;  4DR5 Q;  3L0O A;  1N36 L;  3PUY A;  2OTL A;  4NXN Q;  4B3S Q;  4LUO A;  2F3I A;  3CMA A;  1PH7 A;  3KDF B;  4A75 A;  1SRU A;  4BY7 H;  4RMF A;  1QZH A;  5IYC H;  2ZJQ A;  3PGZ A;  4K0K Q;  1SRO A;  4KI0 A;  4BBS H;  2IHF A;  1K8G A;  2NVQ H;  2F52 A;  3EN2 A;  4DKA C;  1XMO Q;  1JE5 A;  3CP0 A;  3G48 A;  4C3H H;  2ZM6 L;  4DV4 Q;  1NJI C;  2CFM A;  3PO2 G;  3GTL H;  1Z47 A;  1IL2 A;  4GKK Q;  1WJJ A;  4QIW E;  3M7N A;  4R4I A;  4QQB X;  5LMN Q;  3K7A H;  3HFZ B;  3GD7 A;  3H0G H;  5GAH C;  4DV5 Q;  3T1H L;  1L1O B;  1KAW A;  2R7F A;  3OYY A;  3ICE A;  4A3G G;  3BZC A;  5IY0 A;  2CWA A;  4DV0 Q;  4JI6 Q;  1PH4 A;  3BU2 A;  1M90 C;  4A3L G;  4A3I H;  2PMZ E;  4GOP A;  1VQP A;  1VQ6 A;  2R7Z G;  1NY4 A;  1RL2 A;  4JI0 Q;  3ERS X;  1YJ9 A;  4A3M G;  4GLA C;  2I0Q A;  4LF9 Q;  1LTL A;  2A1A A;  4LUV A;  4LFA L;  1VQE A;  1TWG H;  4IPC A;  1I94 Q;  2Z6K C;  1L0W A;  2F4V Q;  2D62 A;  1Y1W G;  4LFC Q;  4JV5 Q;  1G6P A;  2QA4 A;  4JBM A;  1K9M C;  2JK8 A;  2D0O A;  2YU9 H;  4JI8 Q;  1PVO A;  2OQ0 A;  1OXT A;  3I7F A;  1X54 A;  4JI1 Q;  3STB C;  2NVT H;  2Y0S E;  1TWF H;  5BR8 Q;  3F1Z A;  1VS0 A;  4HJ8 A;  4DNI A;  3AQQ A;  4DR1 Q;  1UWV A;  1E24 A;  5GRO A;  3PF5 A;  2JE6 I;  2NZO A;  2AKW B;  3PF4 A;  4DR5 L;  2VQF Q;  4NXM L;  3KJP A;  4WJ4 A;  3NEL A;  2WAQ E;  3JC6 6;  1WYD A;  5H1S E;  2JA5 H;  4NXN L;  3D31 A;  4B3S L;  4MZ9 A;  4LF4 Q;  3GTJ H;  2BA0 A;  1C0A A;  4IFD G;  1OXU A;  3JAM i;  4JI3 Q;  3TEH B;  2MO1 A;  5C3E G;  1V43 A;  3PCO B;  2JA7 G;  1VQJ A;  2E2I H;  3E9I A;  4K0K L;  1T9H A;  2R7Z H;  5IYD G;  3BZK A;  2ES2 A;  3EBE A;  4HJ7 A;  1G51 A;  4A3J H;  1B7Y B;  1VQM A;  4DR3 Q;  1QUQ A;  4AYB E;  1VQO A;  4A3K G;  1XMO L;  2CCZ A;  3ULL A;  1KXL A;  3M4Q A;  1N32 Q;  2JEB I;  1Z9F A;  1XNQ Q;  1KL9 A;  4LF8 Q;  3TRZ A;  1Y1W H;  1GKH A;  5LMN L;  1AE3 A;  1CUK A;  4DV5 L;  4A76 A;  1S72 A;  4HIO A;  1O7I A;  1U5K A;  1XJV A;  2K75 A;  4JBK A;  1SFO H;  2MFI A;  4DV0 L;  1VQ9 A;  1L1O C;  2L15 A;  4R4T A;  5M3M H;  1PH8 A;  1YZ6 A;  2YV5 A;  4JI6 L;  1S3O A;  1PV4 A;  2HT1 A;  2H5X A;  1N34 Q;  3CCR A;  4IJH A;  1EIY B;  4A3C G;  4LW1 A;  3H3V I;  3J81 i;  4LF9 L;  4FDB A;  4WJ3 M;  1SR3 A;  3K80 C;  2UXC Q;  1Q1E A;  4DV1 Q;  1XPR A;  4EQ5 A;  1I94 L;  1JB7 A;  3T1Y Q;  3OTO Q;  2F4V L;  2IHE A;  5FLX c;  4LFC L;  4JV5 L;  2MO0 A;  4YWK A;  2HQL A;  1MJE A;  4OO1 G;  5M5Y H;  2WP8 J;  3M4P A;  3PSI A;  5C3E H;  5GAD C;  2JA7 H;  4JI8 L;  4L5T A;  3M3Y H;  1YHQ A;  4JI1 L;  2PQA B;  1EIF A;  5IYD H;  1K0R A;  2ZTD A;  5J3B A;  2KHI A;  3CPF A;  2LXJ A;  3ZJY C;  3HOY G;  1Q1B A;  5EAY A;  3CCM A;  4A3K H;  3S1Q H;  3D0F A;  4JBW A;  1WFQ A;  1LYL A;  4JCV E;  2NVY H;  4DR1 L;  4PZ7 A;  2VZA A;  2ZJR A;  2UXB Q;  3PUX A;  4DK6 C;  2VQF L;  3OW2 A;  5C0X I;  1HJP A;  1VQH A;  5DLQ E;  4DR4 Q;  1BKB A;  4JC0 A;  4P72 A;  2YTV A;  4LF5 Q;  4LF4 L;  3G6E A;  4JI3 L;  3RLN A;  1XPU A;  1OTC A;  1YHA A;  4BBR G;  2RHS B;  3BJU A;  2VS1 A;  3GO5 A;  1Q82 C;  4UP7 A;  3CCU A;  3CXC A;  4J15 A;  3J81 c;  1M1K C;  1N32 L;  1XNQ L;  3J7Z C;  2YTX A;  2Y0S G;  4LF8 L;  4P73 A;  4AQY Q;  4DV7 L;  3J7A 5;  3FKI G;  4IPG A;  3H15 A;  1IBM Q;  3CCS A;  3F2C A;  1EFW A;  3CD6 A;  3HOZ H;  1NTG A;  2XTI A;  2WAQ G;  2KHJ A;  4R1J A;  1PH2 A;  4A3I G;  4XIG S;  4BXX H;  1PYS B;  5JJL A;  3CQZ H;  2CKZ B;  2GVB A;  2PI2 A;  4B3T Q;  3HOY H;  1HNW Q;  3UDI A;  1N34 L;  1KC8 C;  1CKN B;  1H95 A;  1FJG Q;  2AMC B;  2UXC L;  2VNU D;  1Q8K A;  4DV1 L;  3G4S A;  3TQY A;  2N3S A;  4DAY B;  3S2D H;  2Q2I A;  3T1Y L;  3OTO L;  3CCV A;  4IFD I;  4YY3 Q;  4MNO A;  4AYB G;  3GTP H;  1TWH H;  4GKJ Q;  4A3E G;  1HNZ Q;  3TS2 A;  1LM0 A;  2JA6 H;  4HJ9 A;  1I50 H;  3HKZ G;  1S40 A;  4BBR H;  3A0J A;  4X64 Q;  2UU9 Q;  4PZ8 A;  4A93 H;  2CWP A;  3K81 C;  1HZA A;  2VY3 A;  2K5N A;  4POG A;  3KFU A;  1EYG A;  2JA5 G;  1PH6 A;  2UXB L;  1VQG A;  1X6O A;  3FKI H;  1Q12 A;  3M9B A;  1Q7Y C;  4DR4 L;  3ULJ A;  2WFW A;  3KF8 B;  4LF5 L;  4X66 Q;  4X6A H;  4IO9 A;  1JT8 A;  4GN5 A;  1UE1 A;  2FXQ A;  3ULP A;  1JMC A;  2DGY A;  4A3J G;  4DUY Q;  2K5H A;  2HHH Q;  1ASZ A;  1YHB A;  4BA2 I;  2IX1 A;  4QGU A;  1E22 A;  4TVA B;  3RNU A;  2NN6 G;  4AQY L;  1K83 H;  1IXR A;  4A3E H;  2VL6 A;  5K36 G;  1QVG A;  4GNX A;  1IBM L;  3NBH B;  1GM5 A;  1G29 1;  3GDE A;  2ZJP A;  5E7N A;  5M3M G;  3I56 A;  4DV2 L;  3GTQ H;  4A3B G;  5FLM G;  3TS0 A;  4B3T L;  2VQE Q;  1HNW L;  3UE1 A;  5FJ8 G;  1FJG L;  1VQC A;  1C9O A;  1PYB A;  2K14 A;  3KF6 A;  3I4M G;  2OQK A;  4A3D H;  2Q2T A;  1X56 A;  3M85 A;  4YCV A;  2ALY B;  3PIO A;  2NZH A;  4X62 Q;  2KEN A;  1J6Q A;  4O0A A;  4DK3 C;  3EIV A;  4YY3 L;  4GKJ L;  3S16 H;  1HNZ L;  1X9N A;  1Q81 C;  4HIK A;  4JOI C;  2CQO A;  3NEN A;  3PUV A;  3TRE A;  1VQD A;  3CCE A;  1I3Q H;  4H02 A;  3FP9 A;  4X64 L;  2QEX A;  3B6Y A;  2UU9 L;  3CC2 A;  4DV4 L;  2R92 H;  1JJC B;  4LF7 Q;  4Y52 H;  1AE2 A;  2AWN A;  2VW9 A;  4GKK L;  4UPA A;  3HKZ E;  3RZD H;  3S24 A;  2RF4 A;  1BVS A;  5IT9 c;  1BBW A;  4C3I H;  5LMU Q;  1OXS C;  1NMF A;  1TWA H;  4X66 L;  2R93 G;  2UXD Q;  5C0X J;  3HOU H;  3E9H A;  2A19 A;  1C7Y A;  1VQ8 A;  4A3B H;  3STB D;  5FLM H;  4A3F G;  4JI0 L;  3G71 A;  3S2H H;  3A5Z B;  1CKM A;  2GVA A;  3KDF A;  2UUB Q;  5FJ8 H;  2UUC Q;  4LUZ A;  4BY1 G;  4KLK A;  4RG1 A;  4PMW A;  1J5E Q;  4YHH Q;  2HHH L;  3I2Z A;  3I4M H;  1CSQ A;  1HNX Q;  1PH5 A;  1YVC A;  3PV0 A;  1VQF A;  2IX0 A;  1I5F A;  4BA1 I;  2E5L Q;  3WWV A;  5C4X G;  4XTC S;  3HOZ G;  2QGQ A;  2ID0 A;  3PO3 G;  4QJF A;  1KQS A;  4BXX G;  1KRT A;  2KBN A;  5BR8 L;  1DGS A;  1W2B A;  1IBL Q;  3F8T A;  2VQE L;  1Q46 A;  1SN8 A;  4QY7 A;  4HIM A;  4OWW B;  1MJC A;  2DUD A;  2UUA Q;  3Q8D A;  5IWA Q;  4P71 A;  4GOP B;  3ER0 A;  2ZTE A;  4P75 A;  4JYA Q;  1PA6 A;  5GAG C;  5JJK A;  2MQH A;  2JA9 A;  4GLX A;  2JA6 G;  2R93 H;  3KJO A;  2OWO A;  4OWX B;  4A3F H;  3RN2 A;  4A93 G;  5JEA J;  4DPG A;  4OXP A;  4DR3 L;  4DAM A;  2Q2U A;  4BY1 H;  1PFS A;  4LF7 L;  4PG3 A;  1A63 A;  4GNX B;  3K7U C;  3E0E A;  3CW2 C;  4UY8 C;  2A8V A;  3HOV H;  3A74 A;  4EX5 A;  1Y14 B;  3CF5 A;  5C4X H;  5LMU L;  1FVI A;  3I4O A;  2C35 B;  1Y1V G;  2MNA A;  1XPO A;  3PO3 H;  3W1B A;  3RLF A;  4R4C A;  3GTO H;  2UXD L;  1IBK Q;  2I5M X;  4DV3 Q;  5AJ3 Q;  1VQB A;  1P8L A;  4JI4 Q;  4KHP Q;  1NMG A;  1K8A C;  1SE8 A;  2YTY A;  3RR5 A;  1KD1 C;  2UUC L;  3CAM A;  4MTN A;  2UUB L;  4B3R Q;  1GVP A;  2BH8 A;  1RIP A;  1E1T A;  2E2H H;  4LFB Q;  4LF6 Q;  1E3P A;  1J5E L;  1MKH A;  1EOV A;  4YHH L;  3SGI A;  1YJN A;  3KLW A;  3CPW A;  1AH9 A;  4ME3 A;  3U58 A;  3VDY A;  3CME A;  2IY5 B;  1HNX L;  3AEV A;  1VCI A;  4JG2 A;  1XMQ Q;  2E2J H;  5M5X H;  4L5Q A;  1E1O A;  3CC7 A;  3S1N H;  1QUQ B;  5IP9 H;  2E5L L;  3F2B A;  1A62 A;  4Y7N H;  1HH2 P;  3CCJ A;  1NE3 A;  1N8R C;  2R7D A;  1X3F A;  4LNQ A;  3UDX A;  1A8V A;  4DR2 Q;  1LUZ A;  3W5O A;  1YEZ A;  2XGT A;  1D8L A;  3PUZ A;  1VQA A;  3FHW A;  4A3D G;  2LXK A;  1QVF A;  1SMX A;  4IJL A;  2JEA I;  2UUA L;  4NXM Q;  4DR6 Q;  5IWA L;  1P16 A;  4C3J H;  1KIX A;  4JYA L;  1TXY A;  4X65 Q;  1Y1V H;  2BA1 A;  4GOP C;  2EIF A;  2JQO A;  2I5H A;  1HZC A;  2B29 A;  3A5U A;  4JBJ A;  2R92 G;  1UEB A;  1VQI A;  1A0I A;  1V1Q A;  3M4O H;  5IP7 G;  4IPH A;  2R6G A;  4C2M H;  1Q86 C;  2PQA A;  4PZ6 A;  3J81 j;  4YWL A;  2YYZ A;  1UE6 A;  2Z0S A;  2RHQ B;  4GS3 A;  4OO1 I;  3GTG H;  1EWI A;  4GN3 B;  4GNX C;  3S1R H;  1N9W A;  2WB1 G;  4KHZ A;  5C0X G;  5C4J H;  4HJA A;  2K5V A;  3MXN B;  2B63 G;  3HOU G;  3HOX G;  1HZ9 A;  3J80 i;  4DV3 L;  5AJ3 L;  3K0X A;  1IBK L;  4JI4 L;  4KHP L;  1X55 A;  4O2D A;  3AFQ A;  1VQL A;  1HR0 W;  4GN4 B;  4B3R L;  5GAE C;  1YIT A;  2I5L X;  1YIJ A;  4JI7 Q;  1CKO A;  1QZG A;  4LF6 L;  4LFB L;  1YBY A;  3H3V H;  2KCM A;  2Z6K A;  3PUW A;  3S14 H;  2ASB A;  5JJI A;  4APV A;  5M3F G;  1PH9 A;  1XMQ L;  4DR7 Q;  2N49 A;  3AFP A;  1UE7 A;  3CC4 A;  1B8A A;  4DUZ Q;  1KHI A;  1ASY A;  1TWC H;  4ALP A;  3CCL A;  4OX9 Q;  3S17 H;  4YCU A;  4JI2 Q;  1E7Z A;  1X3G A;  4HJ5 A;  1OXX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...