4HIMA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggatacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4himA00
2NN6I 1E3PA 1Q8KA 5E7NA 5FLMH 4DUYL 3J80i 5FJ8G 4YWLA 5IYDG 4DV5Q 1K8GA 4JI6L 2KENA 2UXDL 2VUMG 1HH2P 3CCJA 1A0IA 1UE5A 1D8LA 3CCQA 1I94L 2PMZE 4A75A 1PH5A 4X62L 1ASYA 1QVFA 2VL6A 3CD6A 3GTLH 2F52A 1EWIA 3HOXH 2NZHA 1NBWA 3CW2C 2NVXH 4JI0Q 4JYAQ 2IX0A 2BA1A 3I7FA 4DV7L 4JI4L 4BBSH 3KJPA 3ZJYC 1XNQL 1X6OA 1Y14B 1XMQQ 1K9MC 2UUAL 4YHHL 2DUDA 4BY1H 4JI3Q 4A3IG 1XJVA 3KDFB 1VQOA 4NXNL 3S2DH 4TVAB 3UDGA 5M5YH 3KOJA 5FLMG 2N78A 3CQZH 4IPGA 4LF7L 4LUZA 3IRBA 2E5LL 4DR2Q 4JI5L 1YHQA 4DV4Q 1I6HH 3EN2A 3PUYA 4JBWA 5ELOA 3GTOH 5LMNL 4JC0A 1OTCA 5J3BA 4DK3C 2JEBI 1VQDA 2PI2A 4EX5A 2WAQG 1Q46A 3HOXG 4H02A 3H3VI 3I55A 1IBMQ 3CCLA 4UPAA 3E9HA 1K3RA 1IL2A 4ME3A 3STBD 2EQSA 1W2BA 1QZHA 1PH9A 4BBSG 3ULPA 4BY1G 2EIFA 3T1HL 1PH4A 4R4OA 4P72A 3E9IA 4QGUA 3L0OA 4HIKA 1VQLA 4DR6Q 2AHOB 1L1OB 1VQFA 2L15A 4QJFA 1CUKA 2K75A 4LFAL 1IYJB 4NB3A 2PQAB 4YY3Q 4R4QA 3ICEA 3M7NA 4IFDI 1KRTA 2PNHA 1K73C 3PSIA 4PZ8A 1FJGL 2RHQB 3TS0A 1YIJA 4UP7A 4DNIA 1HJPA 1N8RC 3T1YQ 3CCUA 3J7ZC 4AIMA 4LF9Q 3CMEA 4JV5Q 1XTDA 2YTVA 1YBYA 2LXJA 4LF5Q 1VCIA 4HJ9A 4YCWA 3I4MH 3HKZG 4GOPA 4JG2A 4DR1L 1HZAA 4PG3A 1YJWA 5IWAL 1VQJA 2WP8J 1R9TH 4DV1Q 2HT1A 3UDXA 1X56A 3M4PA 4DV0L 2OWOA 3ER0A 2K5HA 4OX9L 4AQYQ 4P71A 2LSSA 1O7IA 2Z6KC 3SGIA 3OTOQ 3CCMA 1ASZA 1TXYA 3W1BA 5HY6A 1VQHA 2JE6I 2C35B 4K0KL 4LFBL 1SN8A 1M90C 1S3OA 4GKJQ 1YHBA 4GKKQ 4IOCA 4POFA 3NENA 3I4MG 3S17H 4IOAA 1J6QA 1W3SA 2HIXA 3UE1A 3K8AA 2VY3A 5JEAG 3OW2A 1QUQB 1EIYB 2B63H 4BY7H 2K50A 2N8NA 3PV0A 2MQHA 4JI7Q 2WAQE 3DM3A 2CWPA 2I5HA 5IP9G 4ALPA 1WI5A 1YJ9A 1I5FA 3UDIA 3DLLA 4GN3B 3CC7A 2UUBL 1MKHA 1EOVA 3BJUA 4NXML 3HOWH 4QL5A 3CP0A 1SROA 3A5UA 4DR4Q 2OTJA 5C0XI 3J81i 4A3MG 1AE3A 1PH7A 2UXBL 3K80C 5GQOA 4PMWA 4DV5L 4C3IH 3HOVH 5BR8Q 4X66Q 4LNQA 2R7DA 5K36G 2E8GA 3TREA 1FGUA 4DPGA 2ZTEA 1GD7A 1OXVA 3F2DA 4GLVB 1HR0W 2MO0A 3F8TA 4RMFA 4LF8Q 1JT8A 1X3EA 4DV3Q 1V43A 2B63G 3TRZA 4BY7G 1YEZA 3PO3H 1KXLA 1X3FA 2VW9A 2VZAA 1UEBA 3KF6B 4JI3L 1XMQL 1YVCA 1JMCA 3G48A 1WYDA 3HKZE 3HOWG 1X65A 5IYCG 2B29A 3K7AH 3CXCA 1MIUA 1PH8A 2GVAA 2JK8A 4DV2Q 1Q82C 2Y0SG 4IJLA 1EYGA 3HOVG 3FHWA 4R4TA 4FDBA 4DAMA 4X64L 3RN2A 1T9HA 1TWGH 1N33Q 1EIFA 4AH6A 1GM5A 3F1ZA 4DV4L 1NY4A 1MJCA 4DR7Q 2Q2HA 1NMGA 1JB7A 1L1OC 1LYLA 2ZJRA 4A3EH 3CCSA 4O0AA 1AE2A 3JAMi 4IPHA 1BBWA 3PF5A 1IBML 3CAMA 1V1QA 1VQNA 4MTNA 2JEAI 2CKZB 3PO3G 3GD7A 3S16H 4OXPA 4JOIC 4JI1Q 5C0XJ 2HHHL 4XTCS 1OXUA 2F4VQ 1PV4A 3S1NH 4YWMA 2UXCQ 1EQRA 1P8LA 1PYBA 4DUZL 2QA4A 3U4ZA 4DR6L 4DKAC 1Q86C 2R7ZG 2VS1A 5DLQE 4LWCA 4B3TQ 1TWCH 1X3GA 4A93H 3L2PA 3GTJH 5LMUL 1UE7A 3PUWA 1PVOA 1JJ2A 4YCUA 2UUCQ 2R92H 1DGSA 1U5KA 4JV5L 4A3EG 3M85A 2I5LX 1XPOA 4LF6Q 2BH2A 4KHPQ 1H95A 4B3SL 5LMNW 3HOYH 4GLXA 5GADC 4B3RQ 1HR0Q 1GKHA 2IX1A 4DAYB 2A8VA 1LTLA 1SR3A 5IT9c 1QVGA 3K81C 1A62A 3PCOB 3S24A 4GNXC 4DR5Q 2KHIA 4JCVE 3FP9A 3HKSA 3A74A 2OTLA 1YHAA 2RHSB 3OTOL 2UU9Q 1BBUA 1SE8A 4B3MQ 3G6EA 1HNWQ 1JJCB 4A93G 1M1KC 2K14A 5AJ3Q 3PF4A 4A76A 4A3FH 4L5QA 2R92G 3KDFA 1K0RA 4PZ6A 1VQIA 2XGTA 2MO1A 1BVSA 1EFWA 2CWAA 2D62A 1CSPA 2CFMA 3PIOA 2AMCB 3M3YH 4GKJL 4JI6Q 2NZOA 3HOYG 4GKKL 4QIWE 1G51A 3CCEA 2UXDQ 3J81j 3KFUA 1VQEA 3J7A5 1I94Q 4LF4L 1I50H 4X62Q 4JI7L 1CKNA 4AYBG 2IY5B 4X65L 3CCRA 2EXDA 3I2ZA 2YYZA 1XPRA 1PHJA 3J80c 1XNQQ 5JJIA 4YHHQ 3STBC 2Q2IA 4LFCL 1N34Q 1KRSA 4A3FG 2IHFA 2YTYA 3S15H 3I4OA 1L1OA 4JI8L 3RN5A 1VQ5A 5BR8L 4IJHA 1N36L 4BBRH 4C3HH 4LF7Q 4BA1I 2E5LQ 4WJ4A 4KLKA 2ZJQA 2AWOA 4LF8L 2E2JH 3CMAA 3GTGH 2QEXA 4JOIA 1VQGA 4YCVA 4DV3L 4A3CH 5LMNQ 1AH9A 5IYBH 4GS3A 5C4JH 4MZ9A 3F2BA 3GTMH 4O2DA 3GTQH 1PFSA 5JJKA 3PIPA 4GN5A 4A4IA 3W1GA 4DR3L 3S14H 1TWHH 3T1HQ 2NVYH 2ZJPA 2JA9A 4RG1A 2MNAA 1N32L 1X54A 1I3QH 1YNXA 2N49A 4HJ5A 4L5RC 4QY7A 4DK6C 3I56A 4Y7NH 3RLOA 1PH3A 2I0QA 1HNZL 1PH2A 1NE3A 2NVTH 1B8AA 2E2IH 4BBRG 4LFAQ 3OYYA 1PH6A 1N33L 1E24A 3M4OH 1WFQA 3RNUA 4P73A 2ZM6Q 4A3CG 3EIVA 4UP9A 1QVCA 5FLXc 4A3LH 5IYBG 5JJLA 3G4SA 4GNXA 1Z47A 3UE0A 2DGYA 5M3MH 1Y1WH 2Z0SA 4A3BH 1Q1BA 1CKOA 4JI0L 4C3JH 2F4VL 4HIMA 2ALYB 4JYAL 2KCMA 3B6YA 4OWTB 2KCTA 2GN5A 4IO9A 1VQCA 2B3GA 4UP8A 4DR1Q 3U4VA 2LXKA 4JI2Q 2ATWA 4HIDA 2NVQH 3HOUH 2VQFQ 4AYBE 4DV0Q 1KAWA 1FVIA 3GO5A 1G291 4APVA 4B3TL 3HOZH 2WFWA 1HZBA 3JC66 1NTGA 3KYHC 5JEAJ 1PH1A 1IBKQ 2UUCL 4OO1G 4DV6Q 4DR2L 4KHPL 1KL9A 4K0KQ 1YZ6A 5M3FH 4A3LG 1VQBA 3H0GH 4J15A 1LM0A 1E1TA 3BZCA 2VUMH 1E7ZA 3TEHB 1Y1WG 1IBLQ 4Y52H 4A3BG 3AFQA 4IPCA 2ID0A 4TQUS 2VQEQ 2GVBA 4HJ8A 4DR5L 1TWAH 1XMOQ 2RF4A 3M9BA 1HNXQ 4JBKA 3HOUG 4HJAA 2E2HH 2Z6KA 2KBNA 2MFIA 1HNWL 1D7QA 1Q1EA 3KF6A 3HOZG 1S72A 3KJOA 1J5EQ 1WOCA 5IE8A 5AJ3L 2UUBQ 3TS2A 1EUJA 4XIGS 4NXMQ 3D31A 3NELA 1K8AC 1RIPA 1S40A 4YY3L 3AYHB 2HQLA 2UXBQ 5M3FG 1VQ8A 2OQ0A 3H0GG 2R93H 1NJIC 2NN6G 3T1YL 4LF9L 1HZCA 1XNRQ 4A3JH 1KQSA 1VQAA 1VQKA 4LF5L 1E22A 1Q12A 4C2MH 1VQ6A 5C44H 5H1SE 3ULJA 4JBMA 4OWWB 3AQQA 2OCEA 1VQPA 1C7YA 2K4KA 3J81c 4P74A 4KHZA 3EBEA 3RZOH 3KLWA 4L5SA 1VQ7A 3H3VH 4DV1L 2D0OA 3PGZA 2XTIA 2R7FA 3WWVA 1N34L 2R6GA 3K0XA 2H5XA 4AQYL 3NEMA 3CC4A 2V1CC 2WB1G 2CQOA 3GDEA 1GO3E 3GTPH 1LUZA 4X64Q 2R93G 1OXXK 4R1JA 2BH8A 3BU2A 4A3JG 1YI2A 3RLFA 2ZTCA 4L5TA 2FXQA 2Y0SE 1NMFA 1X55A 2RCNA 4OWXB 4DUYQ 3RR5A 4HJ7A 1A63A 1A8VA 5C44G 1CKMA 1YJNA 1CKNB 2JA6H 3GTKH 4GOPB 1Y1VH 3CPFA 4HIOA 5IY0A 4POGA 4R4CA 3Q8DA 5C4XH 3M4QA 3TQYA 2AKWB 2HHHQ 1G6PA 2KHJA 4DV7Q 4JI4Q 3W5OA 4DUZQ 2VNUD 5M5WH 3S1MH 3I4NH 4LW1A 2D0PA 2ZTDA 2UUAQ 1VQ9A 3S1RH 1MJEA 3U50C 3K7UC 3JAMc 1PYSB 4DR4L 1FL0A 4WJ3M 3PUZA 2ZM6L 1KC8C 1QZGA 4NXNQ 2A19A 5LMUQ 4X66L 4P75A 2QGQA 4IFDG 2PQAA 1VQMA 1TWFH 3PO2H 1WCMH 2JJQA 4B3SQ 2JA6G 4X6AH 4JI5Q 4A3DH 1Y1VG 2A1AA 2BA0A 2I5MX 3A0JA 3MXNB 5C4XG 3PUXA 3U58A 2IHEA 3BZKA 4KI0A 5IP7H 4IPDA 4EQ5A 2CCZA 4LUOA 3NBHB 1Q81C 2Q2UA 2OQKA 5GAHC 1SMXA 3VDYA 4JI2L 1UWVA 2K5NA 1U0LA 2VQFL 5IP9H 3I4NG 1UE1A 2JQOA 1CSQA 2JA8H 3H15A 1OXSC 1P16A 4BXXH 4YWKA 1K83H 4DV2L 1UE6A 1IBKL 1XPUA 4GLAC 4DV6L 4A3MH 2IT1A 5M5XH 1C0AA 1KIXA 4A3GH 1B70B 4QQBX 4DR7L 2YTXA 4GNXB 2JA5H 2WB1E 1WCMG 5GAGC 5GAEC 4MNOA 2JA7H 1FJGQ 3PO2G 4A3DG 1IBLL 2Q2TA 4JBJA 1VS0A 4GN4B 2VQEL 5IP7G 5C3EH 1N9WA 1XMOL 1KD1C 1HNXL 1V9PA 4LF4Q 1L2FA 4JI1L 1X9NA 3ULLA 1BKBA 1B7YB 1JE5A 1SLJA 5HGQA 4A3KH 1SFOH 3MEFA 4IFDJ 4UY8C 5EAYA 4X65Q 2UXCL 3AEVA 1QUQA 3CC2A 1SRUA 1GVPA 1RL2A 1J5EL 2JA8G 4BXXG 5IWAQ 4NPSA 1C9OA 3ERSX 3CCVA 5IYCH 4LFCQ 3UDFA 2ASBA 3CF5A 4OX9Q 4OO1I 3FKIH 3KF8B 2K52A 4A3GG 4JI8Q 3CPWA 1N36Q 5C0XG 2JA5G 4BA2I 1HZ9A 1EQQA 4LF6L 1XNRL 2JA7G 2YV5A 3RZDH 3S1QH 3RLNA 5FJ8H 4LFBQ 5IYDH 1L0WA 3S2HH 1VQ4A 4B3RL 1HR0L 4PZ7A 5C3EG 5GROA 3D0FA 3HFZB 1IZ6A 3LGJA 5M3MG 3G71A 2K5VA 1JJGA 4A3KG 1OXTA 4R4IA 2AWNA 3F2CA 1Z9FA 3A5ZB 4DR3Q 1WJJA 1Q7YC 3PUVA 3AFPA 1YITA 1KHIA 4OONA 1PA6A 2ES2A 3E0EA 3L7ZC 2UU9L 4GOPC 4B3ML 1N32Q 1IXRA 2HIVA 4LUVA 1E1OA 2N3SA 3FKIG 2PI2E 2R7ZH 2F3IA 4A3IH 1HNZQ 5ELNA 2YU9H
chains in the Genus database with same CATH superfamily
2F0PA 1S5CD 3NTIA 2NN6I 1E3PA 5FLMH 3HKZB 1SYBA 4JI6L 2B8FA 3PQIA 2UXDL 1A0IA 1MGSA 2BOSA 3D6WA 1D6EC 3CCQA 1IYVA 2PMZE 3GTLH 2NB0A 2F52A 1EWIA 4JI0Q 2K1BA 4O42A 2I07B 3KJPA 4X3TA 1K9MC 4BWGB 1DD2A 4A3IG 3VR3A 3IKJA 1I50B 4XDXA 3KOJA 3CQZH 3NSWA 4LUZA 3IRBA 2OF1A 3A54A 4DNTB 1DCZA 1YHQA 2N55A 5K36G 5LMNL 4JC0A 4DK3C 4X3KA 1K3BC 1VQDA 4FF3A 1IHZA 2WAQG 3I55A 1DXMA 3DMUA 4ZK9B 3STBD 1QZHA 2EQSA 2XRQD 1PH9A 4BBSG 1STHA 3ULPA 4BY1G 4RA8A 4QGUA 3SHLA 2AHOB 1L1OB 2KJXA 4FXDA 2K75A 4YY3Q 1EWCA 3EQLC 2PNHA 3TS0A 4M8AA 1YIJA 2O5IC 4HMIA 1TS2A 3CCUA 1STAA 3CMEA 1YBYA 2DNEA 1PZID 3HOWB 4NW2A 1STGA 1VCIA 4HJ9A 4CKBA 5JEAH 2X6GA 2WP8J 3OMGA 3KBGA 3W1BA 4PQXA 1GUOA 2RA4A 1ZYRD 4ME5A 3MAQA 4LFBL 5I6YA 1EYCA 3DUZA 2EYJA 3MXUA 3I4MG 1ICFB 4IOAA 3K8AA 3MXNA 1AZQA 4J1MA 2N8NA 1TU2B 4ULLA 4JI7Q 2CWPA 4ALPA 1WI5A 4GN3B 2UUBL 1MKHA 3BJUA 3BZDB 4NXML 3HOWH 4OL7A 1HFNA 1SEBD 1SROA 4DR4Q 2OTJA 1GXDC 3K80C 5GQOA 4C3IH 3OWEB 5BR8Q 4DPGA 4J6HA 1Y8OB 4RFBA 4RMFA 1JT8A 4FP5D 1PTOD 2NTSA 4WRDA 2VW9A 2QCPX 2R92B 3KF6B 1JMCA 1JWSD 1BCPC 1EY7A 2MJ8A 2JK8A 2Y0SG 4R4TA 4FDBA 5FO7B 1GM5A 5JVG3 3OSOA 4DR7Q 2Q2HA 1X3QA 1JB7A 3SVMA 4O0AA 4TRDA 3P7JA 3PF5A 5CORA 4RWSC 1WVLA 5CYUA 2E2DC 3PO3G 4OXPA 1H9JA 4JOIC 5C0XJ 4ZRZA 3K5NA 2PZTA 2F4VQ 1RTOA 2IW3A 4YWMA 1I4HA 1LACA 2K28A 3M3YB 3WOFA 1LTRD 2ICIA 4MN3A 1H9SB 1VMCA 3KBXA 1QOHA 2VB2X 2ZXOA 1TWCH 4X3UA 1X3GA 3L2PA 1JJ2A 2R92H 1U5KA 4A3EG 3M85A 2MPMA 1GHJA 4B3SL 5AFWA 3HOYH 3OWFA 5GADC 4B3RQ 1FGBD 3QWNA 4DAYB 1LTLA 1SR3A 3DWQA 3S15B 1ILPA 1CA6A 4C3HB 1K8MA 2KA7A 4FF2A 4JCVE 1JOQA 3TZDA 1YHAA 2A69C 3GTGB 2E2JB 2F1MA 4EQNA 1L0YB 5AJ3Q 4A3FH 4L5QA 3KDFA 1K0RA 4PZ6A 4DAVA 2CWAA 2B2UC 1CSPA 1H9KA 3H91A 3TP6A 4WFN3 3M3YH 1EIGA 5BN4A 1G51A 2DY8A 1I3QB 1KLUD 3NQIA 4X62Q 4JI7L 4H0LC 2OT2A 2IY5B 3IFTA 2EXDA 3FEWX 1XPRA 1CI3M 1M4VA 3DXJC 3SK4A 3S15H 5M3MB 4YIJA 3I4OA 5FLXE 2RKSA 5FO9B 1Y1WB 1WTPA 3T51B 5BR8L 4C3JB 3K58A 4C3HH 2RQXA 1G8ZD 4LF7Q 2RSOA 4OEMB 2E2JH 3GTGH 4JOIA 1VQGA 3D4WA 5IYBH 4L63B 4MZ9A 2F0UA 3F2BA 4FO2A 5JJKA 5M9OA 3W1GA 2OXPA 3A56A 1V1PA 4IZ8A 3NBHA 2JA9A 1X54A 1I3QH 1YNXA 4L5RC 1HNZL 4BBRG 4LFAQ 2HDLA 5JPMC 4P2CB 5CV4A 2L5TA 4CBVA 2HUGA 4P73A 3LNNA 1B44D 2EDGA 1DJRD 4A3CG 4UP9A 4A3LH 3OHXC 1RD9D 3G4SA 1BCPF 5C5MA 2DGYA 5M3MH 1Y1WH 2YU9B 1FD7D 4C3JH 2F4VL 3HEJA 4JYAL 2KCTA 2EY6A 2GN5A 1VQCA 2WIIB 3U4VA 2R93B 2LXKA 4JI2Q 4HIDA 2Z4HA 3NUCA 2VQFQ 4DV0Q 1KAWA 1FVIA 1G291 3R2TA 3HOZH 2B2UA 2WFWA 2O5JC 2L9HA 5KYIA 1WTRA 2ZT9C 4OO1G 4CKCA 4DR2L 1I6VC 4K0KQ 5J1ZA 1A6XA 4IUTA 4DU9A 4J15A 3J81E 2A5HA 1EIHA 1I4XA 1QWYA 4I65A 2D9UA 2WINB 3I72A 4IPCA 4RHRA 2VQEQ 4HJ8A 3TSSA 1XMOQ 3M9BA 1HNXQ 1EZ6A 1HFGA 2ZXRA 2KBNA 1I6HB 1STBA 1D7QA 3G7LA 1S72A 3KJOA 1WD1A 2EPBA 1WOCA 5AJ3L 1EUJA 4XIGS 1J8IA 1Y1VB 2EYLA 4KKSA 2UXBQ 2OQ0A 2R93H 1HZCA 1IKMA 1B4OA 1F77A 1VQKA 1DOKA 1LT6D 2H4OA 5H1SE 3ULJA 3AQQA 2OCEA 2SNSA 1EY9A 2B2WC 3EBEA 5KYLA 2M00A 2XRSD 3H3VH 2Z1CA 2R7FA 4QMGA 3JAML 4AQYL 1FNUA 3D8GA 1C8CA 2WB1G 2CHBD 4IUNA 1JWMD 1LUZA 4X64Q 3Q6SA 2BH8A 3RLFA 2QDLA 1NMFA 4IFDH 1DONA 2F0WA 1A63A 1IW7D 1A8VA 2B2YA 2JA8B 2VXWA 1Y1VH 3CPFA 4A3MB 2FFKB 3M4QA 2K03A 2HHHQ 5LL6X 2KHJA 3Q24A 4DUZQ 2UUAQ 3D6CA 3RMHA 1MJEA 2KOLA 4NXNQ 1AFPA 4RKLA 3KLRA 4X66L 4P75A 2QGQA 5E3FA 5I9OA 3BVZA 1NR2A 2JA6G 4JI5Q 3MXNB 1RJTA 2SEBD 3PUXA 2PQEA 2Q8TA 2EYOA 2OQKA 2F0FA 5GAHC 3VDYA 4JI2L 1UWVA 2K5NA 4KV6A 3L3OC 2VQFL 1LT5D 5IP9H 5A2QL 3S1QB 2JQOA 1CSQA 3ITPA 4ABNA 2JA8H 1P16A 3NWSA 2PCFB 4KKTA 5C5LA 4A3MH 1SNQA 1E0BA 2LMCB 4C1NK 1U4RA 5C0XH 1IYUA 3P1HA 4MNOA 1FJGQ 4A3DG 1Q90A 2Z8LA 4GN4B 2VQEL 5IP7G 1N9WA 1XMOL 1HNXL 3FPUB 3WOEA 5CC4A 3K5MA 1JE5A 3MEFA 2F0QA 1TT2A 4EVOA 3E6ZX 3C1FA 3CC2A 5IWAQ 1C9OA 4EQPA 4F87A 1QB5D 3V2TA 2ASBA 4H7BA 5IGBA 4A3GG 3KLSX 1N36Q 2PZUA 2JA7G 1JR0D 2YV5A 3RZDH 3S1QH 3S2HH 1GUGA 1Z7TA 5C3EG 5CGKA 5GROA 1V1OA 3OW7A 4A3KG 5F2DA 1G2TA 3F2CA 4DR3Q 1WJJA 3AFPA 1KHIA 1TIID 2UU9L 1N32Q 3KUPA 1IXRA 3BVGA 4HAEA 2PI2E 3E0JA 4IQZA 4LK1C 2WV6D 2MHVA 1CQVA 2ICEC 3EVQA 5FJ8G 4DV5Q 5IYDG 2FJ2A 1JOKA 1X3PA 1HH2P 3CCJA 3DWAA 1I94L 3CD6A 1PH5A 1EY0A 4A75A 1QVFA 4R8IA 3GP7A 3HOXH 1HQMC 2AQ1B 2NZHA 2IX0A 3I7FA 3URYA 5ELEA 1EFID 4K5WA 1Y14B 2UUAL 1B9NA 1D5ZC 1XJVA 3KDFB 4NXNL 2XN9C 1BDOA 1H9SA 4NDXA 5M5YH 5FLMG 4IPGA 2RDFA 4JI5L 1OTCA 5FK9C 3A8JE 1BCPB 2QKIC 2PI2A 4EX5A 1IBMQ 3CCLA 3E9HA 1K3RA 4DAYA 4RGMA 1W2BA 3T1HL 5C4ZA 1TY0A 3E9IA 2A6EC 3L0OA 1VQLA 4K6DA 4DR6Q 5C4JB 1GUWA 4N8X1 1YNND 2RDGA 3QIAA 3DEPA 4BY7B 3M7NA 3ICEA 3T53B 3A8KE 3PSIA 1FJGL 4QB4A 3QOJA 5D65A 3T1YQ 4JV5Q 1XTDA 3P20A 3HKZG 1WD0A 4WJWA 5JPNC 1C4QA 3HOVB 3VR6A 5IWAL 1VQJA 1X56A 3M4PA 5NUCA 4JW0A 2LSSA 3SGIA 1W6KA 1ASZA 1TXYA 3T13A 1VQHA 5C3WA 1EOTA 3UI2A 2PZWA 1SN8A 2K32A 1M90C 2XNAC 5DM73 3NTHA 3RD4A 2HIXA 3UE1A 2VY3A 5JEAG 1EIYB 4BY7H 2K50A 3PV0A 1TWGB 2G9DA 1Y8PB 2F0MA 1ESFA 4RGOS 3UDIA 1O80A 1LT3D 2J0TD 3BVMA 1EOVA 1E2VA 4QL5A 1LV9A 2Z6BA 3K5LA 3HRZC 4L8JA 1QCBD 3S16B 4NMZA 4DV5L 3HGBA 3HOVH 4XQJA 2R7DA 1I4GA 2E8GA 1FGUA 1UAPA 2ZTEA 1GD7A 4OHJA 4GLVB 3SR1A 1HR0W 4XYOA 3F8TA 1SXTA 4LF8Q 1FR3A 2JXMB 2X69A 3GTJB 4RGNA 1X3FA 2DNCA 2VZAA 3NPPA 1YVCA 1NR4A 4DK0A 1NNXA 1BUVT 2HDMA 4QF4A 3HOWG 5IYCG 1QE6A 1PH8A 4CDEC 1MIUA 3CXCA 4JK1C 5K5PA 1E2ZA 1PMRA 4Z9CB 4C3IG 1JE4A 3A7LA 1GUSA 3RZOB 3RN2A 1TWGH 3CKIB 1MJCA 3TZUA 2RVLA 1NMGA 1LYLA 1LTTD 2ZJRA 3JAMi 5KIXA 2D5DA 2F0KA 1IBML 3ND9A 2JEAI 4MTNA 3S16H 1AW7A 4XTCS 3SK5A 4K6LA 1P8LA 5C3XA 2QA4A 3I91A 3U4ZA 4DR6L 4BS9A 4K5VA 4DKAC 2R7ZG 1RCVD 2VS1A 4A93H 3GTJH 3DEOA 1TVXA 3PUWA 4G7HC 1PVOA 4N8FA 1ZEQX 5IOCA 1PRTB 4JV5L 4LF6Q 3FPPA 5I2XA 1HR0Q 2PW5A 2A8VA 5FO8B 5IT9c 3J80E 3K81C 3NXWA 4U673 3MEHA 2RDHA 1WCMB 2RHSB 4B3MQ 1HNWQ 2K14A 4HR7B 1XXGA 3GTMB 2CH4A 4IURA 2R92G 1G91A 2MO1A 3BDOA 3ERQA 4KY5A 2NVYB 2NZOA 3HOYG 3CCEA 3K6OA 3IFDA 1VQEA 2EY1A 4LF4L 1I50H 2KVMA 2F0OA 4K14A 4AYBG 5I9PA 4X65L 2JA5B 2K5QA 1XNQQ 1SNMA 4YHHQ 2K33A 2Q2IA 4LFCL 3A7AB 1KRSA 4A3FG 2IHFA 1RTNA 4JI8L 3RN5A 1EY5A 4HSVA 1SFOB 4BA1I 2E5LQ 1SNCA 1SYGA 2ZJQA 2AWOA 2J7ZA 5EKKA 2NVQB 3HOUB 4LF8L 1AH9A 4YCVA 1EQVA 3AB9A 1SAPA 3GTMH 4O2DA 3PIPA 4CDDC 3BS1A 3TBIB 5M3FB 2NVYH 2A6HD 3H0GB 1Y8NB 2MNAA 2PPBC 2PW7A 4HJ5A 4DK6C 3I56A 2EJFC 1PH2A 1NE3A 4C3HG 3OYYA 1PH6A 3QR8A 1WFQA 3RNUA 2G5DA 1EQTA 1VMPA 1YNJD 4I7ZC 1HUNA 2NUCA 2E2HB 3EIVA 4HCSA 5IYBG 1Q3LA 2BE5D 2B2VC 2L4NA 4XQNA 4A3IB 1LLRD 2BDOA 4JI0L 5D3IB 2ALYB 2K01A 4DR1Q 1O7LA 2NVQH 2ATWA 3HOUH 4KY7A 1SYDA 5LL6S 2IL8A 3H09A 2FHTA 1S5ED 4APVA 4K2LA 1E2WA 1NTGA 3KYHC 1CM9A 4KJOA 1S5FD 2OEOA 4XXEA 2IWHA 1U4LA 5M3FH 4A3LG 1SDFA 3H0GH 4BY1B 3EROA 2NN6H 1MSGA 1Y1WG 5IT9L 1IBLQ 3J81L 3AFQA 4Q5VA 4C3JG 2GVBA 3C1EA 1F2MA 2NZ1D 1LTID 3ND8A 3QJYA 3CU7A 4JPBW 3VYRA 5KEEA 4JBKA 2E2HH 1F2LA 1HNWL 4ZKCB 3HOZG 1IL8A 2LKVA 1TY2A 1SSOA 3D31A 5JJZA 3M7GA 5KNBA 4CJ2C 1S40A 4YY3L 3AYHB 2EY2A 1VQ8A 3MFYA 2Z9HA 1XNRQ 3I4NB 1VDZA 1SMYC 1VQPA 4HSPA 4RH6A 5A35A 3C46A 3NEMA 3SK8A 2MP1A 1H9RA 4RKBA 2R93G 2H1EA 4ZAIA 1OXXK 2B2VA 2DJGC 3BU2A 1YI2A 2PO4A 2ZTCA 4L5TA 4DUYQ 4HJ7A 1X55A 3WDNA 3RR5A 4CKEA 4CDCC 5KNCA 1CKNB 1YJNA 4K5XA 3R8BA 5IY0A 4L6TB 2C5CA 4R4CA 3NWTA 2K5DA 4ZLTF 5ELFA 2AKWB 4C1NI 1G6PA 2BCOA 3HG9A 4FYDA 4DV7Q 3I4NH 4LW1A 2D0PA 2ZTDA 4PMCA 4DR4L 3K7UC 3N52A 3JAMc 1HA6A 1EEID 1FL0A 1LTGD 1XTCD 1NUCA 3PUZA 1ZKOA 4J8QA 4ODGA 5LMUQ 1KC8C 2AUKA 2ZXPA 4IFDG 1VQMA 2L55A 2JJQA 4EQOA 1Y1VG 2BA0A 1LABA 2I5MX 4LMQD 4G4KA 2IHEA 2CCZA 1Q81C 1TS3A 2Q2UA 1SMXA 1U0LA 1QNKA 5CV9A 3I70A 2KUMA 4YWKA 4GLAC 2CQAA 3PO3B 5BN5A 3J7AV 1KIXA 3O13A 2NYZD 5CV6A 4QQBX 1JICA 4DR7L 2YTXA 4GNXB 5GAGC 3IL8A 5GAEC 1IBLL 4JBJA 1MHWC 3VR5A 1V9PA 1BCPD 1X9NA 1PRTC 3ULLA 1KNEA 2JA8G 2K7VA 3CCVA 3UDFA 5EJWA 1ET9A 1WTXA 4OX9Q 4OO1I 1XX8A 2K52A 5C0XG 3TMEA 1XNRL 4DNRB 1L0WA 2RBMA 2L1BA 1JQYD 4B3RL 3D0FA 3HFZB 4TKOB 3H94A 4FF4A 3S2DB 1HRJA 1CT1D 1D1IA 1Z9FA 5IIFA 3MTSA 1Q7YC 2CH4W 1YITA 5EQ0A 3K0YA 3L7ZC 3SE0A 3EFXD 3GTOB 2K5WA 2C9OA 2N3SA 2YU9H 1B2TA 1U4MA 1AEXA 1Q8KA 1K8OA 4DUYL 1K8GA 1JCKB 1TKWB 4YWLA 4G7ZC 1QJOA 2VUMG 1FYCA 1UE5A 3E5SA 4X62L 3J7AF 2VL6A 4K2KA 1NBWA 2A69D 4NKLA 4DV7L 4RHSA 3ZJYC 1X6OA 5ELDA 4JI3Q 2TMPA 2DUDA 5CV7A 1VQOA 3LX0A 3S2DH 4TVAB 2N78A 4XYQA 1W6JA 5CV8A 4LF7L 2KEDA 2L0CA 1PFBA 1BOSA 1I6HH 4DV4Q 3EN2A 3PUYA 4JBWA 5ELOA 3GTOH 2JEBI 4H13C 3FRPB 3HOXG 4H02A 2A68C 5CV5A 4ME3A 5J39A 2EIFA 4R4OA 1I4RA 2DJFC 3QB3A 1RF2D 4HIKA 1SYCA 1NCVA 1VQFA 1KAAA 2L15A 3S17B 1B1ZA 1A3UA 3W3AA 4LFAL 1IYJB 1S5DD 3HZXA 2PQAB 2F0GA 4R4QA 2B63B 4EGVA 1K73C 4PZ8A 1TR5A 1PYWD 2RHQB 4DNIA 1PFMA 4LF9Q 1EY6A 4AIMA 3J7ZC 5IGFA 4TSSA 2LXJA 1F9QA 2CW0C 4LF5Q 3I8ZA 3TP8A 4YCWA 4V190 3M4OB 1CZGA 4JG2A 1LTBD 1HZAA 4PG3A 4DV1Q 3UDXA 4DV0L 3CRLC 2OWOA 3ER0A 4OX9L 3OTOQ 1O7IA 2Z6KC 5I2YA 2JE6I 2KEEA 2C35B 4K0KL 1RKNA 1PRTF 1PRTD 1J9OA 3NHHA 1HCZA 1S3OA 5LHY1 4GKJQ 1YHBA 2SDFA 4GKKQ 1A3TA 3S17H 3K7AB 4MTKA 2B2WA 1W3SA 3D4DA 1ENAA 4G7OC 2B2TC 3U9SA 4PNYA 2B63H 4LAAA 2WAQE 1PFNA 1HUMA 2I5HA 2FMCA 4KJNA 3I90A 3G6JB 4R8NA 1UEAB 3CC7A 3MXGA 5EPLA 5JOBA 3A5UA 4DAPA 3J81i 1PH7A 2UXBL 5IODA 1NSNS 5ELCA 4LNQA 3S1NB 3C3LA 1OXVA 5IGCA 1SE2A 2MO0A 4MHEA 1X3EA 4KMUC 1XWEA 4BY7G 3TRZA 2NTTA 1YEZA 2F0LA 4KD3A 2O2LD 3PIP3 1UEBA 1RHPA 4JI3L 3G48A 1JC7A 3H6MA 3GV6A 1EY4A 5E4WC 2B29A 3K7AH 1Y69U 2CVRA 4DV2Q 2K6AA 3A55A 4IJLA 1EYGA 1B3QA 3HOVG 2A74C 4X64L 1N33Q 1T9HA 1EIFA 4AH6A 2TSSA 1ZXTA 3F1ZA 4DV4L 4RGTA 1NY4A 2XVSA 3MA2B 3U9OA 3QG1A 3FVQA 1CA5A 1EL0A 3MWYW 3L9AX 3GD7A 3GTPB 4JI1Q 2HHHL 1OXUA 2EXZA 3S1NH 2UXCQ 1EQRA 4DUZL 4U68A 1HXYD 4PV1C 1Q86C 4FF1A 3GTKB 1TS4A 3BYTB 4LWCA 1KDCA 1EU4A 1UE7A 3TP5A 3I3CA 2UUCQ 4GZYC 4KHPQ 2F0SA 1H95A 2EJMA 5LMNW 4GLXA 1GKHA 2AQ3B 4DXGA 3S24A 3J80L 4GNXC 1Q8IA 3FP9A 3OIPA 1D5XC 1TWFB 3A74A 3HKSA 2OTLA 3OTOL 1BBUA 1SE8A 5E1FA 4A93G 4A76A 3GTQB 1CQFA 5L37A 1VQIA 4G57A 2K05A 2D62A 3S14B 5JVH3 1TWHB 4GKJL 4JI6Q 4GKKL 2UXDQ 3KFUA 2NVTB 5CMDA 1CKNA 4A3GB 4N9PA 3CCRA 1BXTA 4R9WA 2JA7B 2HD3A 2YYZA 5JJIA 3STBC 1HPCA 1RDPD 2QILA 3W2DA 5C3EB 1VQ5A 4A3BB 4A3KB 1N36L 4IJHA 4DFAA 4WJ4A 4KLKA 4XT3B 2BDNA 5EBDA 2EJGC 5LMNQ 4GS3A 5C4JH 4KD4A 3GTQH 1PFSA 1KTKA 4GN5A 5A2QE 3ZYYX 1STEA 4K8IA 4DR3L 3S14H 2JN4A 1TWHH 2ZJPA 1KLGD 1N32L 1F9PA 2N49A 3NK9A 1PH3A 2NVTH 1B50A 1B8AA 1PZJD 2HCCA 1N33L 2EYFA 1TWAB 3HP3A 3SEBA 2ZM6Q 5CBEE 1MBYA 1SBBB 1QVCA 1ZYRC 5FLXc 5JJLA 4GNXA 4RCNA 2SNMA 1Z47A 2F0JA 4UDUC 3UE0A 5E4XA 2Z0SA 4A3BH 1Q1BA 4HCEA 4HIMA 2KCMA 3B6YA 1S5BD 3NBIA 2B3GA 4UP8A 2EOTA 2V4DA 2QF7A 3EA6A 4A3JB 1HZBA 5C44B 3I4LA 2UUCL 4KHPL 3S9WA 2F4IA 1VQBA 1HA5A 1LO5D 1E7ZA 3TEHB 3KK7A 5D14A 3CQZB 1TWAH 2RF4A 1I4PA 1JOOA 3OIQA 4F7XA 3QOLA 3BYYB 3HOUG 2NBFA 1PTOC 2MFIA 3A8IE 1G6ZA 1PXUA 2UUBQ 4NXMQ 1G2SA 1K8AC 1SJHD 1VF7A 3K59A 3DM1A 5C4XB 1STNA 5M3FG 3H0GG 4CDFC 4XQQA 3VA5A 2L11A 1NJIC 4ZQ3A 2NN6G 3T1YL 4DN4M 3FMCA 4A3JH 5KGUA 1VQ6A 5C44H 4OWWB 3AU7A 4DA2A 2K4KA 3J81c 2A6ED 4P74A 3RZOH 2E75C 1VQ7A 3PGZA 1FNVA 3K0XA 3PO2B 2H5XA 3LWUA 3CC4A 4JVZA 5CBAE 1SYFA 1MI2A 1GO3E 3R2IA 5DEHA 4ILWA 1B3AA 2RCNA 4OWXB 1WTVA 1A2TA 5EGTA 1CHPD 5DM63 4IUQA 1K83B 5C4XH 5M5XB 4FNFA 1R4PB 3T4AC 4JI4Q 2LY7A 2VNUD 2DN8A 1WTHA 4MIUA 4HTHA 3U50C 1PYSB 3CRKC 3VYTA 1SYEA 1II3A 4ZUJA 2ZM6L 3M4YA 3C2PA 4H44C 1BR9A 5FLXL 2PQAA 3PO2H 1WCMH 4B3SQ 4X6AH 1EEFD 2A1AA 3A0JA 4IUVA 1WTOA 3FKIB 4KI0A 4KHVA 4C3IB 1GUNA 3SDZA 4QIWB 3K57A 3I4NG 4BXXH 4FVMA 2IJ0A 1K83H 1ICWA 2KCCA 5T1GA 5IGGA 2IT1A 5M5XH 1U9RA 3RUZA 3VR4A 2JA5H 2WB1E 3PIO3 1OO9B 3NTKA 2Q2TA 3SXHA 4QUCA 2R7ZB 1IKLA 1KD1C 1XYIA 2F0HA 1L2FA 1B9MA 1GUTA 1PLFA 1BKBA 1SFOH 4IFDJ 5EAYA 3AEVA 1SRUA 1GVPA 1RL2A 4ZUIA 3X3MA 4NPSA 4LJZC 3OPOA 5IYCH 2KCNA 2QEJC 3FKIH 3KF8B 2WAQB 3SK6A 2NVXB 1BO0A 3I73A 5T1IA 4LF6L 4BBSB 3RLNA 4IUPA 1VQ4A 3E3XA 1HR0L 1PTOF 3EJIA 4PZ7A 1TWCB 5M3MG 3G71A 2F0TA 2K5VA 5ISRA 3MVVA 1OXTA 4HEDA 4R4IA 2AWNA 1SNPA 5EKIA 4KY6A 1D1KA 3E0EA 4B3ML 4GOPC 3HOYB 2HIVA 4OIJA 2R7ZH 2F3IA 1JB3A 4A3IH 3VA7A 1HNZQ 1ILQA 2R3ZA 5C6AA 4RCOA 5E7NA 4AYBB 3J80i 4DF7A 4OGQC 2KENA 5JAVA 4CHTB 5K36H 5G3LF 1D8LA 1ASYA 3Q22A 5G3LD 4A3FB 1F9RA 4FXKC 2NVXH 3CW2C 3DWPA 3OMCA 4JYAQ 2BA1A 4JI4L 4BBSH 3D3RA 4FXGC 1XNQL 1EYDA 4BY1H 1XMQQ 2EYHA 2DY7A 4YHHL 2FMMA 3MZ5A 3UDGA 3I4MB 1HHVA 2F0EA 5EKLA 4S3SA 4OIKA 2E5LL 4DR2Q 1ESRA 1EZ8A 1R9TB 5J3BA 1Q46A 3H3VI 1HTPA 2O4XA 4UPAA 1IL2A 4N9TA 1PH4A 3V96A 4P72A 2XWJB 2G9HD 4QJFA 1CUKA 3ONAB 1DOMA 3Q23A 4NB3A 4IFDI 1QILA 1KRTA 1O78A 2A73B 4UP7A 1F2ZA 2AUJD 1D2BA 1HJPA 1N8RC 2YTVA 5FKAC 3I4MH 4V0BA 5COYA 4GOPA 1IW7C 4DR1L 2Y0SB 1SJED 1YJWA 1R9TH 3D4RA 2HT1A 1STYA 2F0IA 2K5HA 4AQYQ 4P71A 3CCMA 1CFMA 5HY6A 3V05A 2VB3X 3CHBD 5EBCA 2MUYA 3MFGA 4M1UB 3HOZB 4IOCA 4POFA 3NENA 2FINB 1J6QA 3OW2A 1QUQB 2PNRC 2EY5A 4UHVA 2MQHA 3DM3A 2SOBA 5IP9G 1YJ9A 3TDQA 1I5FA 3AMUA 3DLLA 4A3EB 4F88A 4KTAA 3CP0A 5C0XI 4A3MG 1AE3A 2F0VA 1NAPA 4PMWA 2Q8IB 1FNWA 4X66Q 3TREA 3F2DA 3Q0AA 4DV3Q 1V43A 2B63G 5C4HA 1KXLA 3PO3H 2B2YC 4HMJA 2PYKA 2L12A 1XMQL 2QDBA 1WYDA 3HKZE 2MGSA 3PMFA 1X65A 2GVAA 1Q82C 1M8AA 3MC0B 3FHWA 4DAMA 3K5OA 4ZCKA 5IT9E 3P75A 4NP5A 1L1OC 4A3EH 1SMYD 5J22A 3CCSA 3GV3A 1AE2A 4IPHA 1BBWA 3CAMA 1V1QA 1VQNA 3BDCA 2CKZB 2F0NA 1U4PA 1PV4A 1DYQA 1JWUD 1PYBA 1BF4A 2KHSA 5DLQE 4B3TQ 2ENBA 5I6WA 5LMUL 2XWBB 1H9MA 2EVBA 4K8JA 4YCUA 1DGSA 1XPOA 1B53A 2I5LX 3X3NA 1PDQA 4E6IA 1UNSA 2BH2A 4ZKBB 2K04A 2IX1A 4B9WA 2X6LA 2JSOA 5BN3A 1QVGA 1ENCA 1A62A 2HQEA 3PCOB 4BBRB 4DR5Q 2KHIA 2WACA 1LT4D 2PMZB 2UU9Q 4ID6A 3G6EA 2F0DA 1JJCB 4DK1A 5IGDA 1M1KC 3PF4A 2J4XA 1DM0B 4O1NA 1C48A 1F2YA 2XGTA 1DZ1A 1BVSA 1EFWA 1K28A 3PIOA 2CFMA 2AMCB 2R61A 4X3SA 1BQQT 4QIWE 2QW7A 1PTOB 3J81j 3J7A5 5FOBB 1T5XD 4Y7NB 1I94Q 1LTAD 1ONLA 2E2IB 1KDAA 1KABA 2NWGA 3I2ZA 1PHJA 2M2LA 3J80c 5DAUA 1N34Q 4CGYB 4F8MA 2YTYA 1ENFA 1L1OA 1DOLA 4BBRH 1PZKD 3BDLA 1S4ZA 1YNNC 1SE3A 2B39A 3CMAA 2QEXA 4DV3L 4A3CH 2JYOA 4A4IA 5KNDA 4KN7C 3F2UA 3RZDB 3T1HQ 2EZVA 1D5MC 4RG1A 5I4DA 3S2HB 1A2UA 1PTOH 4WORA 4UAIA 2VUMB 4QY7A 3R93A 4Y7NH 3RLOA 2I0QA 1SNDA 2E2IH 1ET6A 3IAYA 1E24A 4OELB 3M4OH 3FDTA 5D3DA 4OO1H 2IPKD 2WKCA 1WTQA 4KK7A 3OOCA 2F03A 1L0XB 2D2CC 1EU3A 1CKOA 4IUUA 2WB1B 1ML0D 2RSNA 4OWTB 4IO9A 2IX3A 3NQTA 5EPJA 1MSHA 2E74C 1AN8A 4AYBE 3GO5A 4B3TL 4QCLA 5DNFA 1TQOA 2Z4IA 4C2MB 4I7AA 3JC66 5JEAJ 1PH1A 1IBKQ 3HOXB 4DV6Q 1KL9A 1HTLD 3KF8A 1YZ6A 4KN4C 1I4QA 1QNUA 1LM0A 1E1TA 1HQRD 3BZCA 3MXPA 1MD2D 2VUMH 3HS0C 4Y52H 4A3BG 2ID0A 4TQUS 5M5YB 4DR5L 4HJAA 4HN7A 2Z6KA 1Q1EA 3KF6A 1K0SA 1A3VA 1J5EQ 1CHQD 5IE8A 3TS2A 2JA6B 3NELA 1RIPA 2HQLA 1KNAA 1GHKA 1O7ZA 3TN2A 2RCFA 4LF9L 4IALA 1EWHA 2B2TA 2A68D 1KQSA 1VQAA 5M5WB 3S1MB 4LF5L 1E22A 1Q12A 4C2MH 3S1RB 3NP8A 4JBMA 1C7YA 1QG7A 4KHZA 3JAME 3KLWA 4L5SA 4DV1L 2D0OA 2EYMA 2XTIA 4IN3A 3WWVA 5HURA 2LS01 1N34L 2R6GA 4A3DB 5ELBA 1SNOA 2V1CC 2B8GA 1Z6HA 2CQOA 3GDEA 4PMBA 1A15A 3GTPH 1AP0A 4B9XA 4R1JA 2CW0D 1JORA 4A3JG 2LFNA 3VR2A 2FXQA 2Y0SE 1BNZA 5C44G 1CKMA 2JA6H 3GTKH 2GA4B 5TSSA 4GOPB 4HIOA 1V8QA 4POGA 3Q8DA 5KRUA 1X32A 2KQ3A 3DHQA 1VF5C 3TQYA 3QO2A 1RODA 3J7YW 3MHBA 3W5OA 5M5WH 1T5EA 3S1MH 4CJ1B 5EPKA 1VQ9A 3S1RH 1EY8A 4XT1B 4KKUA 4WJ3M 1QZGA 2A19A 3GQBA 2F3WA 1TWFH 4A3DH 3VYUA 5C4XG 1SE4A 3U58A 1F9SA 1V1PB 3BZKA 5IP7H 4IPDA 3T16A 4EQ5A 4LUOA 3NBHB 3H3VC 2E76C 5HGTA 2AQ2B 3VYSA 1UUPA 3N6RA 1CZWA 1KDBA 1UE1A 1AZPA 4DXFA 3H15A 1OXSC 4DV2L 1GOZA 1UE6A 1IBKL 1XPUA 4RAUC 4DV6L 1C0AA 1GJXA 1R4QB 2XSCA 4A3GH 1B70B 4CJ0B 2EYPA 2JP1A 3TP7A 3PO2G 1WCMG 2JA7H 1BBXC 1WTWA 1VS0A 2F3VA 1CTMA 2WKDA 5C3EH 2XIWA 4LF4Q 4JI1L 4ZYSA 1B7YB 4A3KH 1SLJA 2I46A 5HGQA 2EE1A 4UY8C 4X65Q 2UXCL 3NE5B 1QUQA 1J5EL 3LWEA 4BXXG 3ERSX 4LFCQ 3R3OA 3CF5A 2A6HC 4QUFA 4JI8Q 3CPWA 2HCIA 3GTLB 4C56C 2JA5G 4BA2I 1HZ9A 1EQQA 4DGZA 1TS5A 5FJ8H 1EYAA 4LFBQ 5IYDH 2M9VA 5IGEA 2KECA 1IZ6A 1YNJC 3LGJA 4A93B 1JJGA 5CR3A 2BE5C 3A5ZB 3PUVA 4B08A 2P5ZX 4OONA 1PA6A 2ES2A 1LTSD 2Q8RE 1CK1A 1O7YA 3KLSA 3BG3A 4LUVA 1E1OA 3FKIG 4Q0FA 2N88A 3T56B 5ELNA
chains in the Genus database with same CATH topology
2NN6I 1E3PA 1Q8KA 5E7NA 5FLMH 4DUYL 3J80i 5FJ8G 4YWLA 5IYDG 4DV5Q 1K8GA 4JI6L 2KENA 2UXDL 2VUMG 1HH2P 3CCJA 1A0IA 1UE5A 1D8LA 3CCQA 1I94L 2PMZE 4A75A 1PH5A 4X62L 1ASYA 1QVFA 2VL6A 3CD6A 3GTLH 2F52A 1EWIA 3HOXH 2NZHA 1NBWA 3CW2C 2NVXH 4JI0Q 4JYAQ 2IX0A 2BA1A 3I7FA 4DV7L 4JI4L 4BBSH 3KJPA 3ZJYC 1XNQL 1X6OA 1Y14B 1XMQQ 1K9MC 2UUAL 4YHHL 2DUDA 4BY1H 4JI3Q 4A3IG 1XJVA 3KDFB 1VQOA 4NXNL 3S2DH 4TVAB 3UDGA 5M5YH 3KOJA 5FLMG 2N78A 3CQZH 4IPGA 4LF7L 4LUZA 3IRBA 2E5LL 4DR2Q 4JI5L 1YHQA 4DV4Q 1I6HH 3EN2A 3PUYA 4JBWA 5ELOA 3GTOH 5LMNL 4JC0A 1OTCA 5J3BA 4DK3C 2JEBI 1VQDA 2PI2A 4EX5A 2WAQG 1Q46A 3HOXG 4H02A 3H3VI 3I55A 1IBMQ 3CCLA 4UPAA 3E9HA 1K3RA 1IL2A 4ME3A 3STBD 2EQSA 1W2BA 1QZHA 1PH9A 4BBSG 3ULPA 4BY1G 2EIFA 3T1HL 1PH4A 4R4OA 4P72A 3E9IA 4QGUA 3L0OA 4HIKA 1VQLA 4DR6Q 2AHOB 1L1OB 1VQFA 2L15A 4QJFA 1CUKA 2K75A 4LFAL 1IYJB 4NB3A 2PQAB 4YY3Q 4R4QA 3ICEA 3M7NA 4IFDI 1KRTA 2PNHA 1K73C 3PSIA 4PZ8A 1FJGL 2RHQB 3TS0A 1YIJA 4UP7A 4DNIA 1HJPA 1N8RC 3T1YQ 3CCUA 3J7ZC 4AIMA 4LF9Q 3CMEA 4JV5Q 1XTDA 2YTVA 1YBYA 2LXJA 4LF5Q 1VCIA 4HJ9A 4YCWA 3I4MH 3HKZG 4GOPA 4JG2A 4DR1L 1HZAA 4PG3A 1YJWA 5IWAL 1VQJA 2WP8J 1R9TH 4DV1Q 2HT1A 3UDXA 1X56A 3M4PA 4DV0L 2OWOA 3ER0A 2K5HA 4OX9L 4AQYQ 4P71A 2LSSA 1O7IA 2Z6KC 3SGIA 3OTOQ 3CCMA 1ASZA 1TXYA 3W1BA 5HY6A 1VQHA 2JE6I 2C35B 4K0KL 4LFBL 1SN8A 1M90C 1S3OA 4GKJQ 1YHBA 4GKKQ 4IOCA 4POFA 3NENA 3I4MG 3S17H 4IOAA 1J6QA 1W3SA 2HIXA 3UE1A 3K8AA 2VY3A 5JEAG 3OW2A 1QUQB 1EIYB 2B63H 4BY7H 2K50A 2N8NA 3PV0A 2MQHA 4JI7Q 2WAQE 3DM3A 2CWPA 2I5HA 5IP9G 4ALPA 1WI5A 1YJ9A 1I5FA 3UDIA 3DLLA 4GN3B 3CC7A 2UUBL 1MKHA 1EOVA 3BJUA 4NXML 3HOWH 4QL5A 3CP0A 1SROA 3A5UA 4DR4Q 2OTJA 5C0XI 3J81i 4A3MG 1AE3A 1PH7A 2UXBL 3K80C 5GQOA 4PMWA 4DV5L 4C3IH 3HOVH 5BR8Q 4X66Q 4LNQA 2R7DA 5K36G 2E8GA 3TREA 1FGUA 4DPGA 2ZTEA 1GD7A 1OXVA 3F2DA 4GLVB 1HR0W 2MO0A 3F8TA 4RMFA 4LF8Q 1JT8A 1X3EA 4DV3Q 1V43A 2B63G 3TRZA 4BY7G 1YEZA 3PO3H 1KXLA 1X3FA 2VW9A 2VZAA 1UEBA 3KF6B 4JI3L 1XMQL 1YVCA 1JMCA 3G48A 1WYDA 3HKZE 3HOWG 1X65A 5IYCG 2B29A 3K7AH 3CXCA 1MIUA 1PH8A 2GVAA 2JK8A 4DV2Q 1Q82C 2Y0SG 4IJLA 1EYGA 3HOVG 3FHWA 4R4TA 4FDBA 4DAMA 4X64L 3RN2A 1T9HA 1TWGH 1N33Q 1EIFA 4AH6A 1GM5A 3F1ZA 4DV4L 1NY4A 1MJCA 4DR7Q 2Q2HA 1NMGA 1JB7A 1L1OC 1LYLA 2ZJRA 4A3EH 3CCSA 4O0AA 1AE2A 3JAMi 4IPHA 1BBWA 3PF5A 1IBML 3CAMA 1V1QA 1VQNA 4MTNA 2JEAI 2CKZB 3PO3G 3GD7A 3S16H 4OXPA 4JOIC 4JI1Q 5C0XJ 2HHHL 4XTCS 1OXUA 2F4VQ 1PV4A 3S1NH 4YWMA 2UXCQ 1EQRA 1P8LA 1PYBA 4DUZL 2QA4A 3U4ZA 4DR6L 4DKAC 1Q86C 2R7ZG 2VS1A 5DLQE 4LWCA 4B3TQ 1TWCH 1X3GA 4A93H 3L2PA 3GTJH 5LMUL 1UE7A 3PUWA 1PVOA 1JJ2A 4YCUA 2UUCQ 2R92H 1DGSA 1U5KA 4JV5L 4A3EG 3M85A 2I5LX 1XPOA 4LF6Q 2BH2A 4KHPQ 1H95A 4B3SL 5LMNW 3HOYH 4GLXA 5GADC 4B3RQ 1HR0Q 1GKHA 2IX1A 4DAYB 2A8VA 1LTLA 1SR3A 5IT9c 1QVGA 3K81C 1A62A 3PCOB 3S24A 4GNXC 4DR5Q 2KHIA 4JCVE 3FP9A 3HKSA 3A74A 2OTLA 1YHAA 2RHSB 3OTOL 2UU9Q 1BBUA 1SE8A 4B3MQ 3G6EA 1HNWQ 1JJCB 4A93G 1M1KC 2K14A 5AJ3Q 3PF4A 4A76A 4A3FH 4L5QA 2R92G 3KDFA 1K0RA 4PZ6A 1VQIA 2XGTA 2MO1A 1BVSA 1EFWA 2CWAA 2D62A 1CSPA 2CFMA 3PIOA 2AMCB 3M3YH 4GKJL 4JI6Q 2NZOA 3HOYG 4GKKL 4QIWE 1G51A 3CCEA 2UXDQ 3J81j 3KFUA 1VQEA 3J7A5 1I94Q 4LF4L 1I50H 4X62Q 4JI7L 1CKNA 4AYBG 2IY5B 4X65L 3CCRA 2EXDA 3I2ZA 2YYZA 1XPRA 1PHJA 3J80c 1XNQQ 5JJIA 4YHHQ 3STBC 2Q2IA 4LFCL 1N34Q 1KRSA 4A3FG 2IHFA 2YTYA 3S15H 3I4OA 1L1OA 4JI8L 3RN5A 1VQ5A 5BR8L 4IJHA 1N36L 4BBRH 4C3HH 4LF7Q 4BA1I 2E5LQ 4WJ4A 4KLKA 2ZJQA 2AWOA 4LF8L 2E2JH 3CMAA 3GTGH 2QEXA 4JOIA 1VQGA 4YCVA 4DV3L 4A3CH 5LMNQ 1AH9A 5IYBH 4GS3A 5C4JH 4MZ9A 3F2BA 3GTMH 4O2DA 3GTQH 1PFSA 5JJKA 3PIPA 4GN5A 4A4IA 3W1GA 4DR3L 3S14H 1TWHH 3T1HQ 2NVYH 2ZJPA 2JA9A 4RG1A 2MNAA 1N32L 1X54A 1I3QH 1YNXA 2N49A 4HJ5A 4L5RC 4QY7A 4DK6C 3I56A 4Y7NH 3RLOA 1PH3A 2I0QA 1HNZL 1PH2A 1NE3A 2NVTH 1B8AA 2E2IH 4BBRG 4LFAQ 3OYYA 1PH6A 1N33L 1E24A 3M4OH 1WFQA 3RNUA 4P73A 2ZM6Q 4A3CG 3EIVA 4UP9A 1QVCA 5FLXc 4A3LH 5IYBG 5JJLA 3G4SA 4GNXA 1Z47A 3UE0A 2DGYA 5M3MH 1Y1WH 2Z0SA 4A3BH 1Q1BA 1CKOA 4JI0L 4C3JH 2F4VL 4HIMA 2ALYB 4JYAL 2KCMA 3B6YA 4OWTB 2KCTA 2GN5A 4IO9A 1VQCA 2B3GA 4UP8A 4DR1Q 3U4VA 2LXKA 4JI2Q 2ATWA 4HIDA 2NVQH 3HOUH 2VQFQ 4AYBE 4DV0Q 1KAWA 1FVIA 3GO5A 1G291 4APVA 4B3TL 3HOZH 2WFWA 1HZBA 3JC66 1NTGA 3KYHC 5JEAJ 1PH1A 1IBKQ 2UUCL 4OO1G 4DV6Q 4DR2L 4KHPL 1KL9A 4K0KQ 1YZ6A 5M3FH 4A3LG 1VQBA 3H0GH 4J15A 1LM0A 1E1TA 3BZCA 2VUMH 1E7ZA 3TEHB 1Y1WG 1IBLQ 4Y52H 4A3BG 3AFQA 4IPCA 2ID0A 4TQUS 2VQEQ 2GVBA 4HJ8A 4DR5L 1TWAH 1XMOQ 2RF4A 3M9BA 1HNXQ 4JBKA 3HOUG 4HJAA 2E2HH 2Z6KA 2KBNA 2MFIA 1HNWL 1D7QA 1Q1EA 3KF6A 3HOZG 1S72A 3KJOA 1J5EQ 1WOCA 5IE8A 5AJ3L 2UUBQ 3TS2A 1EUJA 4XIGS 4NXMQ 3D31A 3NELA 1K8AC 1RIPA 1S40A 4YY3L 3AYHB 2HQLA 2UXBQ 5M3FG 1VQ8A 2OQ0A 3H0GG 2R93H 1NJIC 2NN6G 3T1YL 4LF9L 1HZCA 1XNRQ 4A3JH 1KQSA 1VQAA 1VQKA 4LF5L 1E22A 1Q12A 4C2MH 1VQ6A 5C44H 5H1SE 3ULJA 4JBMA 4OWWB 3AQQA 2OCEA 1VQPA 1C7YA 2K4KA 3J81c 4P74A 4KHZA 3EBEA 3RZOH 3KLWA 4L5SA 1VQ7A 3H3VH 4DV1L 2D0OA 3PGZA 2XTIA 2R7FA 3WWVA 1N34L 2R6GA 3K0XA 2H5XA 4AQYL 3NEMA 3CC4A 2V1CC 2WB1G 2CQOA 3GDEA 1GO3E 3GTPH 1LUZA 4X64Q 2R93G 1OXXK 4R1JA 2BH8A 3BU2A 4A3JG 1YI2A 3RLFA 2ZTCA 4L5TA 2FXQA 2Y0SE 1NMFA 1X55A 2RCNA 4OWXB 4DUYQ 3RR5A 4HJ7A 1A63A 1A8VA 5C44G 1CKMA 1YJNA 1CKNB 2JA6H 3GTKH 4GOPB 1Y1VH 3CPFA 4HIOA 5IY0A 4POGA 4R4CA 3Q8DA 5C4XH 3M4QA 3TQYA 2AKWB 2HHHQ 1G6PA 2KHJA 4DV7Q 4JI4Q 3W5OA 4DUZQ 2VNUD 5M5WH 3S1MH 3I4NH 4LW1A 2D0PA 2ZTDA 2UUAQ 1VQ9A 3S1RH 1MJEA 3U50C 3K7UC 3JAMc 1PYSB 4DR4L 1FL0A 4WJ3M 3PUZA 2ZM6L 1KC8C 1QZGA 4NXNQ 2A19A 5LMUQ 4X66L 4P75A 2QGQA 4IFDG 2PQAA 1VQMA 1TWFH 3PO2H 1WCMH 2JJQA 4B3SQ 2JA6G 4X6AH 4JI5Q 4A3DH 1Y1VG 2A1AA 2BA0A 2I5MX 3A0JA 3MXNB 5C4XG 3PUXA 3U58A 2IHEA 3BZKA 4KI0A 5IP7H 4IPDA 4EQ5A 2CCZA 4LUOA 3NBHB 1Q81C 2Q2UA 2OQKA 5GAHC 1SMXA 3VDYA 4JI2L 1UWVA 2K5NA 1U0LA 2VQFL 5IP9H 3I4NG 1UE1A 2JQOA 1CSQA 2JA8H 3H15A 1OXSC 1P16A 4BXXH 4YWKA 1K83H 4DV2L 1UE6A 1IBKL 1XPUA 4GLAC 4DV6L 4A3MH 2IT1A 5M5XH 1C0AA 1KIXA 4A3GH 1B70B 4QQBX 4DR7L 2YTXA 4GNXB 2JA5H 2WB1E 1WCMG 5GAGC 5GAEC 4MNOA 2JA7H 1FJGQ 3PO2G 4A3DG 1IBLL 2Q2TA 4JBJA 1VS0A 4GN4B 2VQEL 5IP7G 5C3EH 1N9WA 1XMOL 1KD1C 1HNXL 1V9PA 4LF4Q 1L2FA 4JI1L 1X9NA 3ULLA 1BKBA 1B7YB 1JE5A 1SLJA 5HGQA 4A3KH 1SFOH 3MEFA 4IFDJ 4UY8C 5EAYA 4X65Q 2UXCL 3AEVA 1QUQA 3CC2A 1SRUA 1GVPA 1RL2A 1J5EL 2JA8G 4BXXG 5IWAQ 4NPSA 1C9OA 3ERSX 3CCVA 5IYCH 4LFCQ 3UDFA 2ASBA 3CF5A 4OX9Q 4OO1I 3FKIH 3KF8B 2K52A 4A3GG 4JI8Q 3CPWA 1N36Q 5C0XG 2JA5G 4BA2I 1HZ9A 1EQQA 4LF6L 1XNRL 2JA7G 2YV5A 3RZDH 3S1QH 3RLNA 5FJ8H 4LFBQ 5IYDH 1L0WA 3S2HH 1VQ4A 4B3RL 1HR0L 4PZ7A 5C3EG 5GROA 3D0FA 3HFZB 1IZ6A 3LGJA 5M3MG 3G71A 2K5VA 1JJGA 4A3KG 1OXTA 4R4IA 2AWNA 3F2CA 1Z9FA 3A5ZB 4DR3Q 1WJJA 1Q7YC 3PUVA 3AFPA 1YITA 1KHIA 4OONA 1PA6A 2ES2A 3E0EA 3L7ZC 2UU9L 4GOPC 4B3ML 1N32Q 1IXRA 2HIVA 4LUVA 1E1OA 2N3SA 3FKIG 2PI2E 2R7ZH 2F3IA 4A3IH 1HNZQ 5ELNA 2YU9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  1E3P A;  1Q8K A;  5E7N A;  5FLM H;  4DUY L;  3J80 i;  5FJ8 G;  4YWL A;  5IYD G;  4DV5 Q;  1K8G A;  4JI6 L;  2KEN A;  2UXD L;  2VUM G;  1HH2 P;  3CCJ A;  1A0I A;  1UE5 A;  1D8L A;  3CCQ A;  1I94 L;  2PMZ E;  4A75 A;  1PH5 A;  4X62 L;  1ASY A;  1QVF A;  2VL6 A;  3CD6 A;  3GTL H;  2F52 A;  1EWI A;  3HOX H;  2NZH A;  1NBW A;  3CW2 C;  2NVX H;  4JI0 Q;  4JYA Q;  2IX0 A;  2BA1 A;  3I7F A;  4DV7 L;  4JI4 L;  4BBS H;  3KJP A;  3ZJY C;  1XNQ L;  1X6O A;  1Y14 B;  1XMQ Q;  1K9M C;  2UUA L;  4YHH L;  2DUD A;  4BY1 H;  4JI3 Q;  4A3I G;  1XJV A;  3KDF B;  1VQO A;  4NXN L;  3S2D H;  4TVA B;  3UDG A;  5M5Y H;  3KOJ A;  5FLM G;  2N78 A;  3CQZ H;  4IPG A;  4LF7 L;  4LUZ A;  3IRB A;  2E5L L;  4DR2 Q;  4JI5 L;  1YHQ A;  4DV4 Q;  1I6H H;  3EN2 A;  3PUY A;  4JBW A;  5ELO A;  3GTO H;  5LMN L;  4JC0 A;  1OTC A;  5J3B A;  4DK3 C;  2JEB I;  1VQD A;  2PI2 A;  4EX5 A;  2WAQ G;  1Q46 A;  3HOX G;  4H02 A;  3H3V I;  3I55 A;  1IBM Q;  3CCL A;  4UPA A;  3E9H A;  1K3R A;  1IL2 A;  4ME3 A;  3STB D;  2EQS A;  1W2B A;  1QZH A;  1PH9 A;  4BBS G;  3ULP A;  4BY1 G;  2EIF A;  3T1H L;  1PH4 A;  4R4O A;  4P72 A;  3E9I A;  4QGU A;  3L0O A;  4HIK A;  1VQL A;  4DR6 Q;  2AHO B;  1L1O B;  1VQF A;  2L15 A;  4QJF A;  1CUK A;  2K75 A;  4LFA L;  1IYJ B;  4NB3 A;  2PQA B;  4YY3 Q;  4R4Q A;  3ICE A;  3M7N A;  4IFD I;  1KRT A;  2PNH A;  1K73 C;  3PSI A;  4PZ8 A;  1FJG L;  2RHQ B;  3TS0 A;  1YIJ A;  4UP7 A;  4DNI A;  1HJP A;  1N8R C;  3T1Y Q;  3CCU A;  3J7Z C;  4AIM A;  4LF9 Q;  3CME A;  4JV5 Q;  1XTD A;  2YTV A;  1YBY A;  2LXJ A;  4LF5 Q;  1VCI A;  4HJ9 A;  4YCW A;  3I4M H;  3HKZ G;  4GOP A;  4JG2 A;  4DR1 L;  1HZA A;  4PG3 A;  1YJW A;  5IWA L;  1VQJ A;  2WP8 J;  1R9T H;  4DV1 Q;  2HT1 A;  3UDX A;  1X56 A;  3M4P A;  4DV0 L;  2OWO A;  3ER0 A;  2K5H A;  4OX9 L;  4AQY Q;  4P71 A;  2LSS A;  1O7I A;  2Z6K C;  3SGI A;  3OTO Q;  3CCM A;  1ASZ A;  1TXY A;  3W1B A;  5HY6 A;  1VQH A;  2JE6 I;  2C35 B;  4K0K L;  4LFB L;  1SN8 A;  1M90 C;  1S3O A;  4GKJ Q;  1YHB A;  4GKK Q;  4IOC A;  4POF A;  3NEN A;  3I4M G;  3S17 H;  4IOA A;  1J6Q A;  1W3S A;  2HIX A;  3UE1 A;  3K8A A;  2VY3 A;  5JEA G;  3OW2 A;  1QUQ B;  1EIY B;  2B63 H;  4BY7 H;  2K50 A;  2N8N A;  3PV0 A;  2MQH A;  4JI7 Q;  2WAQ E;  3DM3 A;  2CWP A;  2I5H A;  5IP9 G;  4ALP A;  1WI5 A;  1YJ9 A;  1I5F A;  3UDI A;  3DLL A;  4GN3 B;  3CC7 A;  2UUB L;  1MKH A;  1EOV A;  3BJU A;  4NXM L;  3HOW H;  4QL5 A;  3CP0 A;  1SRO A;  3A5U A;  4DR4 Q;  2OTJ A;  5C0X I;  3J81 i;  4A3M G;  1AE3 A;  1PH7 A;  2UXB L;  3K80 C;  5GQO A;  4PMW A;  4DV5 L;  4C3I H;  3HOV H;  5BR8 Q;  4X66 Q;  4LNQ A;  2R7D A;  5K36 G;  2E8G A;  3TRE A;  1FGU A;  4DPG A;  2ZTE A;  1GD7 A;  1OXV A;  3F2D A;  4GLV B;  1HR0 W;  2MO0 A;  3F8T A;  4RMF A;  4LF8 Q;  1JT8 A;  1X3E A;  4DV3 Q;  1V43 A;  2B63 G;  3TRZ A;  4BY7 G;  1YEZ A;  3PO3 H;  1KXL A;  1X3F A;  2VW9 A;  2VZA A;  1UEB A;  3KF6 B;  4JI3 L;  1XMQ L;  1YVC A;  1JMC A;  3G48 A;  1WYD A;  3HKZ E;  3HOW G;  1X65 A;  5IYC G;  2B29 A;  3K7A H;  3CXC A;  1MIU A;  1PH8 A;  2GVA A;  2JK8 A;  4DV2 Q;  1Q82 C;  2Y0S G;  4IJL A;  1EYG A;  3HOV G;  3FHW A;  4R4T A;  4FDB A;  4DAM A;  4X64 L;  3RN2 A;  1T9H A;  1TWG H;  1N33 Q;  1EIF A;  4AH6 A;  1GM5 A;  3F1Z A;  4DV4 L;  1NY4 A;  1MJC A;  4DR7 Q;  2Q2H A;  1NMG A;  1JB7 A;  1L1O C;  1LYL A;  2ZJR A;  4A3E H;  3CCS A;  4O0A A;  1AE2 A;  3JAM i;  4IPH A;  1BBW A;  3PF5 A;  1IBM L;  3CAM A;  1V1Q A;  1VQN A;  4MTN A;  2JEA I;  2CKZ B;  3PO3 G;  3GD7 A;  3S16 H;  4OXP A;  4JOI C;  4JI1 Q;  5C0X J;  2HHH L;  4XTC S;  1OXU A;  2F4V Q;  1PV4 A;  3S1N H;  4YWM A;  2UXC Q;  1EQR A;  1P8L A;  1PYB A;  4DUZ L;  2QA4 A;  3U4Z A;  4DR6 L;  4DKA C;  1Q86 C;  2R7Z G;  2VS1 A;  5DLQ E;  4LWC A;  4B3T Q;  1TWC H;  1X3G A;  4A93 H;  3L2P A;  3GTJ H;  5LMU L;  1UE7 A;  3PUW A;  1PVO A;  1JJ2 A;  4YCU A;  2UUC Q;  2R92 H;  1DGS A;  1U5K A;  4JV5 L;  4A3E G;  3M85 A;  2I5L X;  1XPO A;  4LF6 Q;  2BH2 A;  4KHP Q;  1H95 A;  4B3S L;  5LMN W;  3HOY H;  4GLX A;  5GAD C;  4B3R Q;  1HR0 Q;  1GKH A;  2IX1 A;  4DAY B;  2A8V A;  1LTL A;  1SR3 A;  5IT9 c;  1QVG A;  3K81 C;  1A62 A;  3PCO B;  3S24 A;  4GNX C;  4DR5 Q;  2KHI A;  4JCV E;  3FP9 A;  3HKS A;  3A74 A;  2OTL A;  1YHA A;  2RHS B;  3OTO L;  2UU9 Q;  1BBU A;  1SE8 A;  4B3M Q;  3G6E A;  1HNW Q;  1JJC B;  4A93 G;  1M1K C;  2K14 A;  5AJ3 Q;  3PF4 A;  4A76 A;  4A3F H;  4L5Q A;  2R92 G;  3KDF A;  1K0R A;  4PZ6 A;  1VQI A;  2XGT A;  2MO1 A;  1BVS A;  1EFW A;  2CWA A;  2D62 A;  1CSP A;  2CFM A;  3PIO A;  2AMC B;  3M3Y H;  4GKJ L;  4JI6 Q;  2NZO A;  3HOY G;  4GKK L;  4QIW E;  1G51 A;  3CCE A;  2UXD Q;  3J81 j;  3KFU A;  1VQE A;  3J7A 5;  1I94 Q;  4LF4 L;  1I50 H;  4X62 Q;  4JI7 L;  1CKN A;  4AYB G;  2IY5 B;  4X65 L;  3CCR A;  2EXD A;  3I2Z A;  2YYZ A;  1XPR A;  1PHJ A;  3J80 c;  1XNQ Q;  5JJI A;  4YHH Q;  3STB C;  2Q2I A;  4LFC L;  1N34 Q;  1KRS A;  4A3F G;  2IHF A;  2YTY A;  3S15 H;  3I4O A;  1L1O A;  4JI8 L;  3RN5 A;  1VQ5 A;  5BR8 L;  4IJH A;  1N36 L;  4BBR H;  4C3H H;  4LF7 Q;  4BA1 I;  2E5L Q;  4WJ4 A;  4KLK A;  2ZJQ A;  2AWO A;  4LF8 L;  2E2J H;  3CMA A;  3GTG H;  2QEX A;  4JOI A;  1VQG A;  4YCV A;  4DV3 L;  4A3C H;  5LMN Q;  1AH9 A;  5IYB H;  4GS3 A;  5C4J H;  4MZ9 A;  3F2B A;  3GTM H;  4O2D A;  3GTQ H;  1PFS A;  5JJK A;  3PIP A;  4GN5 A;  4A4I A;  3W1G A;  4DR3 L;  3S14 H;  1TWH H;  3T1H Q;  2NVY H;  2ZJP A;  2JA9 A;  4RG1 A;  2MNA A;  1N32 L;  1X54 A;  1I3Q H;  1YNX A;  2N49 A;  4HJ5 A;  4L5R C;  4QY7 A;  4DK6 C;  3I56 A;  4Y7N H;  3RLO A;  1PH3 A;  2I0Q A;  1HNZ L;  1PH2 A;  1NE3 A;  2NVT H;  1B8A A;  2E2I H;  4BBR G;  4LFA Q;  3OYY A;  1PH6 A;  1N33 L;  1E24 A;  3M4O H;  1WFQ A;  3RNU A;  4P73 A;  2ZM6 Q;  4A3C G;  3EIV A;  4UP9 A;  1QVC A;  5FLX c;  4A3L H;  5IYB G;  5JJL A;  3G4S A;  4GNX A;  1Z47 A;  3UE0 A;  2DGY A;  5M3M H;  1Y1W H;  2Z0S A;  4A3B H;  1Q1B A;  1CKO A;  4JI0 L;  4C3J H;  2F4V L;  4HIM A;  2ALY B;  4JYA L;  2KCM A;  3B6Y A;  4OWT B;  2KCT A;  2GN5 A;  4IO9 A;  1VQC A;  2B3G A;  4UP8 A;  4DR1 Q;  3U4V A;  2LXK A;  4JI2 Q;  2ATW A;  4HID A;  2NVQ H;  3HOU H;  2VQF Q;  4AYB E;  4DV0 Q;  1KAW A;  1FVI A;  3GO5 A;  1G29 1;  4APV A;  4B3T L;  3HOZ H;  2WFW A;  1HZB A;  3JC6 6;  1NTG A;  3KYH C;  5JEA J;  1PH1 A;  1IBK Q;  2UUC L;  4OO1 G;  4DV6 Q;  4DR2 L;  4KHP L;  1KL9 A;  4K0K Q;  1YZ6 A;  5M3F H;  4A3L G;  1VQB A;  3H0G H;  4J15 A;  1LM0 A;  1E1T A;  3BZC A;  2VUM H;  1E7Z A;  3TEH B;  1Y1W G;  1IBL Q;  4Y52 H;  4A3B G;  3AFQ A;  4IPC A;  2ID0 A;  4TQU S;  2VQE Q;  2GVB A;  4HJ8 A;  4DR5 L;  1TWA H;  1XMO Q;  2RF4 A;  3M9B A;  1HNX Q;  4JBK A;  3HOU G;  4HJA A;  2E2H H;  2Z6K A;  2KBN A;  2MFI A;  1HNW L;  1D7Q A;  1Q1E A;  3KF6 A;  3HOZ G;  1S72 A;  3KJO A;  1J5E Q;  1WOC A;  5IE8 A;  5AJ3 L;  2UUB Q;  3TS2 A;  1EUJ A;  4XIG S;  4NXM Q;  3D31 A;  3NEL A;  1K8A C;  1RIP A;  1S40 A;  4YY3 L;  3AYH B;  2HQL A;  2UXB Q;  5M3F G;  1VQ8 A;  2OQ0 A;  3H0G G;  2R93 H;  1NJI C;  2NN6 G;  3T1Y L;  4LF9 L;  1HZC A;  1XNR Q;  4A3J H;  1KQS A;  1VQA A;  1VQK A;  4LF5 L;  1E22 A;  1Q12 A;  4C2M H;  1VQ6 A;  5C44 H;  5H1S E;  3ULJ A;  4JBM A;  4OWW B;  3AQQ A;  2OCE A;  1VQP A;  1C7Y A;  2K4K A;  3J81 c;  4P74 A;  4KHZ A;  3EBE A;  3RZO H;  3KLW A;  4L5S A;  1VQ7 A;  3H3V H;  4DV1 L;  2D0O A;  3PGZ A;  2XTI A;  2R7F A;  3WWV A;  1N34 L;  2R6G A;  3K0X A;  2H5X A;  4AQY L;  3NEM A;  3CC4 A;  2V1C C;  2WB1 G;  2CQO A;  3GDE A;  1GO3 E;  3GTP H;  1LUZ A;  4X64 Q;  2R93 G;  1OXX K;  4R1J A;  2BH8 A;  3BU2 A;  4A3J G;  1YI2 A;  3RLF A;  2ZTC A;  4L5T A;  2FXQ A;  2Y0S E;  1NMF A;  1X55 A;  2RCN A;  4OWX B;  4DUY Q;  3RR5 A;  4HJ7 A;  1A63 A;  1A8V A;  5C44 G;  1CKM A;  1YJN A;  1CKN B;  2JA6 H;  3GTK H;  4GOP B;  1Y1V H;  3CPF A;  4HIO A;  5IY0 A;  4POG A;  4R4C A;  3Q8D A;  5C4X H;  3M4Q A;  3TQY A;  2AKW B;  2HHH Q;  1G6P A;  2KHJ A;  4DV7 Q;  4JI4 Q;  3W5O A;  4DUZ Q;  2VNU D;  5M5W H;  3S1M H;  3I4N H;  4LW1 A;  2D0P A;  2ZTD A;  2UUA Q;  1VQ9 A;  3S1R H;  1MJE A;  3U50 C;  3K7U C;  3JAM c;  1PYS B;  4DR4 L;  1FL0 A;  4WJ3 M;  3PUZ A;  2ZM6 L;  1KC8 C;  1QZG A;  4NXN Q;  2A19 A;  5LMU Q;  4X66 L;  4P75 A;  2QGQ A;  4IFD G;  2PQA A;  1VQM A;  1TWF H;  3PO2 H;  1WCM H;  2JJQ A;  4B3S Q;  2JA6 G;  4X6A H;  4JI5 Q;  4A3D H;  1Y1V G;  2A1A A;  2BA0 A;  2I5M X;  3A0J A;  3MXN B;  5C4X G;  3PUX A;  3U58 A;  2IHE A;  3BZK A;  4KI0 A;  5IP7 H;  4IPD A;  4EQ5 A;  2CCZ A;  4LUO A;  3NBH B;  1Q81 C;  2Q2U A;  2OQK A;  5GAH C;  1SMX A;  3VDY A;  4JI2 L;  1UWV A;  2K5N A;  1U0L A;  2VQF L;  5IP9 H;  3I4N G;  1UE1 A;  2JQO A;  1CSQ A;  2JA8 H;  3H15 A;  1OXS C;  1P16 A;  4BXX H;  4YWK A;  1K83 H;  4DV2 L;  1UE6 A;  1IBK L;  1XPU A;  4GLA C;  4DV6 L;  4A3M H;  2IT1 A;  5M5X H;  1C0A A;  1KIX A;  4A3G H;  1B70 B;  4QQB X;  4DR7 L;  2YTX A;  4GNX B;  2JA5 H;  2WB1 E;  1WCM G;  5GAG C;  5GAE C;  4MNO A;  2JA7 H;  1FJG Q;  3PO2 G;  4A3D G;  1IBL L;  2Q2T A;  4JBJ A;  1VS0 A;  4GN4 B;  2VQE L;  5IP7 G;  5C3E H;  1N9W A;  1XMO L;  1KD1 C;  1HNX L;  1V9P A;  4LF4 Q;  1L2F A;  4JI1 L;  1X9N A;  3ULL A;  1BKB A;  1B7Y B;  1JE5 A;  1SLJ A;  5HGQ A;  4A3K H;  1SFO H;  3MEF A;  4IFD J;  4UY8 C;  5EAY A;  4X65 Q;  2UXC L;  3AEV A;  1QUQ A;  3CC2 A;  1SRU A;  1GVP A;  1RL2 A;  1J5E L;  2JA8 G;  4BXX G;  5IWA Q;  4NPS A;  1C9O A;  3ERS X;  3CCV A;  5IYC H;  4LFC Q;  3UDF A;  2ASB A;  3CF5 A;  4OX9 Q;  4OO1 I;  3FKI H;  3KF8 B;  2K52 A;  4A3G G;  4JI8 Q;  3CPW A;  1N36 Q;  5C0X G;  2JA5 G;  4BA2 I;  1HZ9 A;  1EQQ A;  4LF6 L;  1XNR L;  2JA7 G;  2YV5 A;  3RZD H;  3S1Q H;  3RLN A;  5FJ8 H;  4LFB Q;  5IYD H;  1L0W A;  3S2H H;  1VQ4 A;  4B3R L;  1HR0 L;  4PZ7 A;  5C3E G;  5GRO A;  3D0F A;  3HFZ B;  1IZ6 A;  3LGJ A;  5M3M G;  3G71 A;  2K5V A;  1JJG A;  4A3K G;  1OXT A;  4R4I A;  2AWN A;  3F2C A;  1Z9F A;  3A5Z B;  4DR3 Q;  1WJJ A;  1Q7Y C;  3PUV A;  3AFP A;  1YIT A;  1KHI A;  4OON A;  1PA6 A;  2ES2 A;  3E0E A;  3L7Z C;  2UU9 L;  4GOP C;  4B3M L;  1N32 Q;  1IXR A;  2HIV A;  4LUV A;  1E1O A;  2N3S A;  3FKI G;  2PI2 E;  2R7Z H;  2F3I A;  4A3I H;  1HNZ Q;  5ELN A;  2YU9 H; 
#chains in the Genus database with same CATH topology
 2F0P A;  1S5C D;  3NTI A;  2NN6 I;  1E3P A;  5FLM H;  3HKZ B;  1SYB A;  4JI6 L;  2B8F A;  3PQI A;  2UXD L;  1A0I A;  1MGS A;  2BOS A;  3D6W A;  1D6E C;  3CCQ A;  1IYV A;  2PMZ E;  3GTL H;  2NB0 A;  2F52 A;  1EWI A;  4JI0 Q;  2K1B A;  4O42 A;  2I07 B;  3KJP A;  4X3T A;  1K9M C;  4BWG B;  1DD2 A;  4A3I G;  3VR3 A;  3IKJ A;  1I50 B;  4XDX A;  3KOJ A;  3CQZ H;  3NSW A;  4LUZ A;  3IRB A;  2OF1 A;  3A54 A;  4DNT B;  1DCZ A;  1YHQ A;  2N55 A;  5K36 G;  5LMN L;  4JC0 A;  4DK3 C;  4X3K A;  1K3B C;  1VQD A;  4FF3 A;  1IHZ A;  2WAQ G;  3I55 A;  1DXM A;  3DMU A;  4ZK9 B;  3STB D;  1QZH A;  2EQS A;  2XRQ D;  1PH9 A;  4BBS G;  1STH A;  3ULP A;  4BY1 G;  4RA8 A;  4QGU A;  3SHL A;  2AHO B;  1L1O B;  2KJX A;  4FXD A;  2K75 A;  4YY3 Q;  1EWC A;  3EQL C;  2PNH A;  3TS0 A;  4M8A A;  1YIJ A;  2O5I C;  4HMI A;  1TS2 A;  3CCU A;  1STA A;  3CME A;  1YBY A;  2DNE A;  1PZI D;  3HOW B;  4NW2 A;  1STG A;  1VCI A;  4HJ9 A;  4CKB A;  5JEA H;  2X6G A;  2WP8 J;  3OMG A;  3KBG A;  3W1B A;  4PQX A;  1GUO A;  2RA4 A;  1ZYR D;  4ME5 A;  3MAQ A;  4LFB L;  5I6Y A;  1EYC A;  3DUZ A;  2EYJ A;  3MXU A;  3I4M G;  1ICF B;  4IOA A;  3K8A A;  3MXN A;  1AZQ A;  4J1M A;  2N8N A;  1TU2 B;  4ULL A;  4JI7 Q;  2CWP A;  4ALP A;  1WI5 A;  4GN3 B;  2UUB L;  1MKH A;  3BJU A;  3BZD B;  4NXM L;  3HOW H;  4OL7 A;  1HFN A;  1SEB D;  1SRO A;  4DR4 Q;  2OTJ A;  1GXD C;  3K80 C;  5GQO A;  4C3I H;  3OWE B;  5BR8 Q;  4DPG A;  4J6H A;  1Y8O B;  4RFB A;  4RMF A;  1JT8 A;  4FP5 D;  1PTO D;  2NTS A;  4WRD A;  2VW9 A;  2QCP X;  2R92 B;  3KF6 B;  1JMC A;  1JWS D;  1BCP C;  1EY7 A;  2MJ8 A;  2JK8 A;  2Y0S G;  4R4T A;  4FDB A;  5FO7 B;  1GM5 A;  5JVG 3;  3OSO A;  4DR7 Q;  2Q2H A;  1X3Q A;  1JB7 A;  3SVM A;  4O0A A;  4TRD A;  3P7J A;  3PF5 A;  5COR A;  4RWS C;  1WVL A;  5CYU A;  2E2D C;  3PO3 G;  4OXP A;  1H9J A;  4JOI C;  5C0X J;  4ZRZ A;  3K5N A;  2PZT A;  2F4V Q;  1RTO A;  2IW3 A;  4YWM A;  1I4H A;  1LAC A;  2K28 A;  3M3Y B;  3WOF A;  1LTR D;  2ICI A;  4MN3 A;  1H9S B;  1VMC A;  3KBX A;  1QOH A;  2VB2 X;  2ZXO A;  1TWC H;  4X3U A;  1X3G A;  3L2P A;  1JJ2 A;  2R92 H;  1U5K A;  4A3E G;  3M85 A;  2MPM A;  1GHJ A;  4B3S L;  5AFW A;  3HOY H;  3OWF A;  5GAD C;  4B3R Q;  1FGB D;  3QWN A;  4DAY B;  1LTL A;  1SR3 A;  3DWQ A;  3S15 B;  1ILP A;  1CA6 A;  4C3H B;  1K8M A;  2KA7 A;  4FF2 A;  4JCV E;  1JOQ A;  3TZD A;  1YHA A;  2A69 C;  3GTG B;  2E2J B;  2F1M A;  4EQN A;  1L0Y B;  5AJ3 Q;  4A3F H;  4L5Q A;  3KDF A;  1K0R A;  4PZ6 A;  4DAV A;  2CWA A;  2B2U C;  1CSP A;  1H9K A;  3H91 A;  3TP6 A;  4WFN 3;  3M3Y H;  1EIG A;  5BN4 A;  1G51 A;  2DY8 A;  1I3Q B;  1KLU D;  3NQI A;  4X62 Q;  4JI7 L;  4H0L C;  2OT2 A;  2IY5 B;  3IFT A;  2EXD A;  3FEW X;  1XPR A;  1CI3 M;  1M4V A;  3DXJ C;  3SK4 A;  3S15 H;  5M3M B;  4YIJ A;  3I4O A;  5FLX E;  2RKS A;  5FO9 B;  1Y1W B;  1WTP A;  3T51 B;  5BR8 L;  4C3J B;  3K58 A;  4C3H H;  2RQX A;  1G8Z D;  4LF7 Q;  2RSO A;  4OEM B;  2E2J H;  3GTG H;  4JOI A;  1VQG A;  3D4W A;  5IYB H;  4L63 B;  4MZ9 A;  2F0U A;  3F2B A;  4FO2 A;  5JJK A;  5M9O A;  3W1G A;  2OXP A;  3A56 A;  1V1P A;  4IZ8 A;  3NBH A;  2JA9 A;  1X54 A;  1I3Q H;  1YNX A;  4L5R C;  1HNZ L;  4BBR G;  4LFA Q;  2HDL A;  5JPM C;  4P2C B;  5CV4 A;  2L5T A;  4CBV A;  2HUG A;  4P73 A;  3LNN A;  1B44 D;  2EDG A;  1DJR D;  4A3C G;  4UP9 A;  4A3L H;  3OHX C;  1RD9 D;  3G4S A;  1BCP F;  5C5M A;  2DGY A;  5M3M H;  1Y1W H;  2YU9 B;  1FD7 D;  4C3J H;  2F4V L;  3HEJ A;  4JYA L;  2KCT A;  2EY6 A;  2GN5 A;  1VQC A;  2WII B;  3U4V A;  2R93 B;  2LXK A;  4JI2 Q;  4HID A;  2Z4H A;  3NUC A;  2VQF Q;  4DV0 Q;  1KAW A;  1FVI A;  1G29 1;  3R2T A;  3HOZ H;  2B2U A;  2WFW A;  2O5J C;  2L9H A;  5KYI A;  1WTR A;  2ZT9 C;  4OO1 G;  4CKC A;  4DR2 L;  1I6V C;  4K0K Q;  5J1Z A;  1A6X A;  4IUT A;  4DU9 A;  4J15 A;  3J81 E;  2A5H A;  1EIH A;  1I4X A;  1QWY A;  4I65 A;  2D9U A;  2WIN B;  3I72 A;  4IPC A;  4RHR A;  2VQE Q;  4HJ8 A;  3TSS A;  1XMO Q;  3M9B A;  1HNX Q;  1EZ6 A;  1HFG A;  2ZXR A;  2KBN A;  1I6H B;  1STB A;  1D7Q A;  3G7L A;  1S72 A;  3KJO A;  1WD1 A;  2EPB A;  1WOC A;  5AJ3 L;  1EUJ A;  4XIG S;  1J8I A;  1Y1V B;  2EYL A;  4KKS A;  2UXB Q;  2OQ0 A;  2R93 H;  1HZC A;  1IKM A;  1B4O A;  1F77 A;  1VQK A;  1DOK A;  1LT6 D;  2H4O A;  5H1S E;  3ULJ A;  3AQQ A;  2OCE A;  2SNS A;  1EY9 A;  2B2W C;  3EBE A;  5KYL A;  2M00 A;  2XRS D;  3H3V H;  2Z1C A;  2R7F A;  4QMG A;  3JAM L;  4AQY L;  1FNU A;  3D8G A;  1C8C A;  2WB1 G;  2CHB D;  4IUN A;  1JWM D;  1LUZ A;  4X64 Q;  3Q6S A;  2BH8 A;  3RLF A;  2QDL A;  1NMF A;  4IFD H;  1DON A;  2F0W A;  1A63 A;  1IW7 D;  1A8V A;  2B2Y A;  2JA8 B;  2VXW A;  1Y1V H;  3CPF A;  4A3M B;  2FFK B;  3M4Q A;  2K03 A;  2HHH Q;  5LL6 X;  2KHJ A;  3Q24 A;  4DUZ Q;  2UUA Q;  3D6C A;  3RMH A;  1MJE A;  2KOL A;  4NXN Q;  1AFP A;  4RKL A;  3KLR A;  4X66 L;  4P75 A;  2QGQ A;  5E3F A;  5I9O A;  3BVZ A;  1NR2 A;  2JA6 G;  4JI5 Q;  3MXN B;  1RJT A;  2SEB D;  3PUX A;  2PQE A;  2Q8T A;  2EYO A;  2OQK A;  2F0F A;  5GAH C;  3VDY A;  4JI2 L;  1UWV A;  2K5N A;  4KV6 A;  3L3O C;  2VQF L;  1LT5 D;  5IP9 H;  5A2Q L;  3S1Q B;  2JQO A;  1CSQ A;  3ITP A;  4ABN A;  2JA8 H;  1P16 A;  3NWS A;  2PCF B;  4KKT A;  5C5L A;  4A3M H;  1SNQ A;  1E0B A;  2LMC B;  4C1N K;  1U4R A;  5C0X H;  1IYU A;  3P1H A;  4MNO A;  1FJG Q;  4A3D G;  1Q90 A;  2Z8L A;  4GN4 B;  2VQE L;  5IP7 G;  1N9W A;  1XMO L;  1HNX L;  3FPU B;  3WOE A;  5CC4 A;  3K5M A;  1JE5 A;  3MEF A;  2F0Q A;  1TT2 A;  4EVO A;  3E6Z X;  3C1F A;  3CC2 A;  5IWA Q;  1C9O A;  4EQP A;  4F87 A;  1QB5 D;  3V2T A;  2ASB A;  4H7B A;  5IGB A;  4A3G G;  3KLS X;  1N36 Q;  2PZU A;  2JA7 G;  1JR0 D;  2YV5 A;  3RZD H;  3S1Q H;  3S2H H;  1GUG A;  1Z7T A;  5C3E G;  5CGK A;  5GRO A;  1V1O A;  3OW7 A;  4A3K G;  5F2D A;  1G2T A;  3F2C A;  4DR3 Q;  1WJJ A;  3AFP A;  1KHI A;  1TII D;  2UU9 L;  1N32 Q;  3KUP A;  1IXR A;  3BVG A;  4HAE A;  2PI2 E;  3E0J A;  4IQZ A;  4LK1 C;  2WV6 D;  2MHV A;  1CQV A;  2ICE C;  3EVQ A;  5FJ8 G;  4DV5 Q;  5IYD G;  2FJ2 A;  1JOK A;  1X3P A;  1HH2 P;  3CCJ A;  3DWA A;  1I94 L;  3CD6 A;  1PH5 A;  1EY0 A;  4A75 A;  1QVF A;  4R8I A;  3GP7 A;  3HOX H;  1HQM C;  2AQ1 B;  2NZH A;  2IX0 A;  3I7F A;  3URY A;  5ELE A;  1EFI D;  4K5W A;  1Y14 B;  2UUA L;  1B9N A;  1D5Z C;  1XJV A;  3KDF B;  4NXN L;  2XN9 C;  1BDO A;  1H9S A;  4NDX A;  5M5Y H;  5FLM G;  4IPG A;  2RDF A;  4JI5 L;  1OTC A;  5FK9 C;  3A8J E;  1BCP B;  2QKI C;  2PI2 A;  4EX5 A;  1IBM Q;  3CCL A;  3E9H A;  1K3R A;  4DAY A;  4RGM A;  1W2B A;  3T1H L;  5C4Z A;  1TY0 A;  3E9I A;  2A6E C;  3L0O A;  1VQL A;  4K6D A;  4DR6 Q;  5C4J B;  1GUW A;  4N8X 1;  1YNN D;  2RDG A;  3QIA A;  3DEP A;  4BY7 B;  3M7N A;  3ICE A;  3T53 B;  3A8K E;  3PSI A;  1FJG L;  4QB4 A;  3QOJ A;  5D65 A;  3T1Y Q;  4JV5 Q;  1XTD A;  3P20 A;  3HKZ G;  1WD0 A;  4WJW A;  5JPN C;  1C4Q A;  3HOV B;  3VR6 A;  5IWA L;  1VQJ A;  1X56 A;  3M4P A;  5NUC A;  4JW0 A;  2LSS A;  3SGI A;  1W6K A;  1ASZ A;  1TXY A;  3T13 A;  1VQH A;  5C3W A;  1EOT A;  3UI2 A;  2PZW A;  1SN8 A;  2K32 A;  1M90 C;  2XNA C;  5DM7 3;  3NTH A;  3RD4 A;  2HIX A;  3UE1 A;  2VY3 A;  5JEA G;  1EIY B;  4BY7 H;  2K50 A;  3PV0 A;  1TWG B;  2G9D A;  1Y8P B;  2F0M A;  1ESF A;  4RGO S;  3UDI A;  1O80 A;  1LT3 D;  2J0T D;  3BVM A;  1EOV A;  1E2V A;  4QL5 A;  1LV9 A;  2Z6B A;  3K5L A;  3HRZ C;  4L8J A;  1QCB D;  3S16 B;  4NMZ A;  4DV5 L;  3HGB A;  3HOV H;  4XQJ A;  2R7D A;  1I4G A;  2E8G A;  1FGU A;  1UAP A;  2ZTE A;  1GD7 A;  4OHJ A;  4GLV B;  3SR1 A;  1HR0 W;  4XYO A;  3F8T A;  1SXT A;  4LF8 Q;  1FR3 A;  2JXM B;  2X69 A;  3GTJ B;  4RGN A;  1X3F A;  2DNC A;  2VZA A;  3NPP A;  1YVC A;  1NR4 A;  4DK0 A;  1NNX A;  1BUV T;  2HDM A;  4QF4 A;  3HOW G;  5IYC G;  1QE6 A;  1PH8 A;  4CDE C;  1MIU A;  3CXC A;  4JK1 C;  5K5P A;  1E2Z A;  1PMR A;  4Z9C B;  4C3I G;  1JE4 A;  3A7L A;  1GUS A;  3RZO B;  3RN2 A;  1TWG H;  3CKI B;  1MJC A;  3TZU A;  2RVL A;  1NMG A;  1LYL A;  1LTT D;  2ZJR A;  3JAM i;  5KIX A;  2D5D A;  2F0K A;  1IBM L;  3ND9 A;  2JEA I;  4MTN A;  3S16 H;  1AW7 A;  4XTC S;  3SK5 A;  4K6L A;  1P8L A;  5C3X A;  2QA4 A;  3I91 A;  3U4Z A;  4DR6 L;  4BS9 A;  4K5V A;  4DKA C;  2R7Z G;  1RCV D;  2VS1 A;  4A93 H;  3GTJ H;  3DEO A;  1TVX A;  3PUW A;  4G7H C;  1PVO A;  4N8F A;  1ZEQ X;  5IOC A;  1PRT B;  4JV5 L;  4LF6 Q;  3FPP A;  5I2X A;  1HR0 Q;  2PW5 A;  2A8V A;  5FO8 B;  5IT9 c;  3J80 E;  3K81 C;  3NXW A;  4U67 3;  3MEH A;  2RDH A;  1WCM B;  2RHS B;  4B3M Q;  1HNW Q;  2K14 A;  4HR7 B;  1XXG A;  3GTM B;  2CH4 A;  4IUR A;  2R92 G;  1G91 A;  2MO1 A;  3BDO A;  3ERQ A;  4KY5 A;  2NVY B;  2NZO A;  3HOY G;  3CCE A;  3K6O A;  3IFD A;  1VQE A;  2EY1 A;  4LF4 L;  1I50 H;  2KVM A;  2F0O A;  4K14 A;  4AYB G;  5I9P A;  4X65 L;  2JA5 B;  2K5Q A;  1XNQ Q;  1SNM A;  4YHH Q;  2K33 A;  2Q2I A;  4LFC L;  3A7A B;  1KRS A;  4A3F G;  2IHF A;  1RTN A;  4JI8 L;  3RN5 A;  1EY5 A;  4HSV A;  1SFO B;  4BA1 I;  2E5L Q;  1SNC A;  1SYG A;  2ZJQ A;  2AWO A;  2J7Z A;  5EKK A;  2NVQ B;  3HOU B;  4LF8 L;  1AH9 A;  4YCV A;  1EQV A;  3AB9 A;  1SAP A;  3GTM H;  4O2D A;  3PIP A;  4CDD C;  3BS1 A;  3TBI B;  5M3F B;  2NVY H;  2A6H D;  3H0G B;  1Y8N B;  2MNA A;  2PPB C;  2PW7 A;  4HJ5 A;  4DK6 C;  3I56 A;  2EJF C;  1PH2 A;  1NE3 A;  4C3H G;  3OYY A;  1PH6 A;  3QR8 A;  1WFQ A;  3RNU A;  2G5D A;  1EQT A;  1VMP A;  1YNJ D;  4I7Z C;  1HUN A;  2NUC A;  2E2H B;  3EIV A;  4HCS A;  5IYB G;  1Q3L A;  2BE5 D;  2B2V C;  2L4N A;  4XQN A;  4A3I B;  1LLR D;  2BDO A;  4JI0 L;  5D3I B;  2ALY B;  2K01 A;  4DR1 Q;  1O7L A;  2NVQ H;  2ATW A;  3HOU H;  4KY7 A;  1SYD A;  5LL6 S;  2IL8 A;  3H09 A;  2FHT A;  1S5E D;  4APV A;  4K2L A;  1E2W A;  1NTG A;  3KYH C;  1CM9 A;  4KJO A;  1S5F D;  2OEO A;  4XXE A;  2IWH A;  1U4L A;  5M3F H;  4A3L G;  1SDF A;  3H0G H;  4BY1 B;  3ERO A;  2NN6 H;  1MSG A;  1Y1W G;  5IT9 L;  1IBL Q;  3J81 L;  3AFQ A;  4Q5V A;  4C3J G;  2GVB A;  3C1E A;  1F2M A;  2NZ1 D;  1LTI D;  3ND8 A;  3QJY A;  3CU7 A;  4JPB W;  3VYR A;  5KEE A;  4JBK A;  2E2H H;  1F2L A;  1HNW L;  4ZKC B;  3HOZ G;  1IL8 A;  2LKV A;  1TY2 A;  1SSO A;  3D31 A;  5JJZ A;  3M7G A;  5KNB A;  4CJ2 C;  1S40 A;  4YY3 L;  3AYH B;  2EY2 A;  1VQ8 A;  3MFY A;  2Z9H A;  1XNR Q;  3I4N B;  1VDZ A;  1SMY C;  1VQP A;  4HSP A;  4RH6 A;  5A35 A;  3C46 A;  3NEM A;  3SK8 A;  2MP1 A;  1H9R A;  4RKB A;  2R93 G;  2H1E A;  4ZAI A;  1OXX K;  2B2V A;  2DJG C;  3BU2 A;  1YI2 A;  2PO4 A;  2ZTC A;  4L5T A;  4DUY Q;  4HJ7 A;  1X55 A;  3WDN A;  3RR5 A;  4CKE A;  4CDC C;  5KNC A;  1CKN B;  1YJN A;  4K5X A;  3R8B A;  5IY0 A;  4L6T B;  2C5C A;  4R4C A;  3NWT A;  2K5D A;  4ZLT F;  5ELF A;  2AKW B;  4C1N I;  1G6P A;  2BCO A;  3HG9 A;  4FYD A;  4DV7 Q;  3I4N H;  4LW1 A;  2D0P A;  2ZTD A;  4PMC A;  4DR4 L;  3K7U C;  3N52 A;  3JAM c;  1HA6 A;  1EEI D;  1FL0 A;  1LTG D;  1XTC D;  1NUC A;  3PUZ A;  1ZKO A;  4J8Q A;  4ODG A;  5LMU Q;  1KC8 C;  2AUK A;  2ZXP A;  4IFD G;  1VQM A;  2L55 A;  2JJQ A;  4EQO A;  1Y1V G;  2BA0 A;  1LAB A;  2I5M X;  4LMQ D;  4G4K A;  2IHE A;  2CCZ A;  1Q81 C;  1TS3 A;  2Q2U A;  1SMX A;  1U0L A;  1QNK A;  5CV9 A;  3I70 A;  2KUM A;  4YWK A;  4GLA C;  2CQA A;  3PO3 B;  5BN5 A;  3J7A V;  1KIX A;  3O13 A;  2NYZ D;  5CV6 A;  4QQB X;  1JIC A;  4DR7 L;  2YTX A;  4GNX B;  5GAG C;  3IL8 A;  5GAE C;  1IBL L;  4JBJ A;  1MHW C;  3VR5 A;  1V9P A;  1BCP D;  1X9N A;  1PRT C;  3ULL A;  1KNE A;  2JA8 G;  2K7V A;  3CCV A;  3UDF A;  5EJW A;  1ET9 A;  1WTX A;  4OX9 Q;  4OO1 I;  1XX8 A;  2K52 A;  5C0X G;  3TME A;  1XNR L;  4DNR B;  1L0W A;  2RBM A;  2L1B A;  1JQY D;  4B3R L;  3D0F A;  3HFZ B;  4TKO B;  3H94 A;  4FF4 A;  3S2D B;  1HRJ A;  1CT1 D;  1D1I A;  1Z9F A;  5IIF A;  3MTS A;  1Q7Y C;  2CH4 W;  1YIT A;  5EQ0 A;  3K0Y A;  3L7Z C;  3SE0 A;  3EFX D;  3GTO B;  2K5W A;  2C9O A;  2N3S A;  2YU9 H;  1B2T A;  1U4M A;  1AEX A;  1Q8K A;  1K8O A;  4DUY L;  1K8G A;  1JCK B;  1TKW B;  4YWL A;  4G7Z C;  1QJO A;  2VUM G;  1FYC A;  1UE5 A;  3E5S A;  4X62 L;  3J7A F;  2VL6 A;  4K2K A;  1NBW A;  2A69 D;  4NKL A;  4DV7 L;  4RHS A;  3ZJY C;  1X6O A;  5ELD A;  4JI3 Q;  2TMP A;  2DUD A;  5CV7 A;  1VQO A;  3LX0 A;  3S2D H;  4TVA B;  2N78 A;  4XYQ A;  1W6J A;  5CV8 A;  4LF7 L;  2KED A;  2L0C A;  1PFB A;  1BOS A;  1I6H H;  4DV4 Q;  3EN2 A;  3PUY A;  4JBW A;  5ELO A;  3GTO H;  2JEB I;  4H13 C;  3FRP B;  3HOX G;  4H02 A;  2A68 C;  5CV5 A;  4ME3 A;  5J39 A;  2EIF A;  4R4O A;  1I4R A;  2DJF C;  3QB3 A;  1RF2 D;  4HIK A;  1SYC A;  1NCV A;  1VQF A;  1KAA A;  2L15 A;  3S17 B;  1B1Z A;  1A3U A;  3W3A A;  4LFA L;  1IYJ B;  1S5D D;  3HZX A;  2PQA B;  2F0G A;  4R4Q A;  2B63 B;  4EGV A;  1K73 C;  4PZ8 A;  1TR5 A;  1PYW D;  2RHQ B;  4DNI A;  1PFM A;  4LF9 Q;  1EY6 A;  4AIM A;  3J7Z C;  5IGF A;  4TSS A;  2LXJ A;  1F9Q A;  2CW0 C;  4LF5 Q;  3I8Z A;  3TP8 A;  4YCW A;  4V19 0;  3M4O B;  1CZG A;  4JG2 A;  1LTB D;  1HZA A;  4PG3 A;  4DV1 Q;  3UDX A;  4DV0 L;  3CRL C;  2OWO A;  3ER0 A;  4OX9 L;  3OTO Q;  1O7I A;  2Z6K C;  5I2Y A;  2JE6 I;  2KEE A;  2C35 B;  4K0K L;  1RKN A;  1PRT F;  1PRT D;  1J9O A;  3NHH A;  1HCZ A;  1S3O A;  5LHY 1;  4GKJ Q;  1YHB A;  2SDF A;  4GKK Q;  1A3T A;  3S17 H;  3K7A B;  4MTK A;  2B2W A;  1W3S A;  3D4D A;  1ENA A;  4G7O C;  2B2T C;  3U9S A;  4PNY A;  2B63 H;  4LAA A;  2WAQ E;  1PFN A;  1HUM A;  2I5H A;  2FMC A;  4KJN A;  3I90 A;  3G6J B;  4R8N A;  1UEA B;  3CC7 A;  3MXG A;  5EPL A;  5JOB A;  3A5U A;  4DAP A;  3J81 i;  1PH7 A;  2UXB L;  5IOD A;  1NSN S;  5ELC A;  4LNQ A;  3S1N B;  3C3L A;  1OXV A;  5IGC A;  1SE2 A;  2MO0 A;  4MHE A;  1X3E A;  4KMU C;  1XWE A;  4BY7 G;  3TRZ A;  2NTT A;  1YEZ A;  2F0L A;  4KD3 A;  2O2L D;  3PIP 3;  1UEB A;  1RHP A;  4JI3 L;  3G48 A;  1JC7 A;  3H6M A;  3GV6 A;  1EY4 A;  5E4W C;  2B29 A;  3K7A H;  1Y69 U;  2CVR A;  4DV2 Q;  2K6A A;  3A55 A;  4IJL A;  1EYG A;  1B3Q A;  3HOV G;  2A74 C;  4X64 L;  1N33 Q;  1T9H A;  1EIF A;  4AH6 A;  2TSS A;  1ZXT A;  3F1Z A;  4DV4 L;  4RGT A;  1NY4 A;  2XVS A;  3MA2 B;  3U9O A;  3QG1 A;  3FVQ A;  1CA5 A;  1EL0 A;  3MWY W;  3L9A X;  3GD7 A;  3GTP B;  4JI1 Q;  2HHH L;  1OXU A;  2EXZ A;  3S1N H;  2UXC Q;  1EQR A;  4DUZ L;  4U68 A;  1HXY D;  4PV1 C;  1Q86 C;  4FF1 A;  3GTK B;  1TS4 A;  3BYT B;  4LWC A;  1KDC A;  1EU4 A;  1UE7 A;  3TP5 A;  3I3C A;  2UUC Q;  4GZY C;  4KHP Q;  2F0S A;  1H95 A;  2EJM A;  5LMN W;  4GLX A;  1GKH A;  2AQ3 B;  4DXG A;  3S24 A;  3J80 L;  4GNX C;  1Q8I A;  3FP9 A;  3OIP A;  1D5X C;  1TWF B;  3A74 A;  3HKS A;  2OTL A;  3OTO L;  1BBU A;  1SE8 A;  5E1F A;  4A93 G;  4A76 A;  3GTQ B;  1CQF A;  5L37 A;  1VQI A;  4G57 A;  2K05 A;  2D62 A;  3S14 B;  5JVH 3;  1TWH B;  4GKJ L;  4JI6 Q;  4GKK L;  2UXD Q;  3KFU A;  2NVT B;  5CMD A;  1CKN A;  4A3G B;  4N9P A;  3CCR A;  1BXT A;  4R9W A;  2JA7 B;  2HD3 A;  2YYZ A;  5JJI A;  3STB C;  1HPC A;  1RDP D;  2QIL A;  3W2D A;  5C3E B;  1VQ5 A;  4A3B B;  4A3K B;  1N36 L;  4IJH A;  4DFA A;  4WJ4 A;  4KLK A;  4XT3 B;  2BDN A;  5EBD A;  2EJG C;  5LMN Q;  4GS3 A;  5C4J H;  4KD4 A;  3GTQ H;  1PFS A;  1KTK A;  4GN5 A;  5A2Q E;  3ZYY X;  1STE A;  4K8I A;  4DR3 L;  3S14 H;  2JN4 A;  1TWH H;  2ZJP A;  1KLG D;  1N32 L;  1F9P A;  2N49 A;  3NK9 A;  1PH3 A;  2NVT H;  1B50 A;  1B8A A;  1PZJ D;  2HCC A;  1N33 L;  2EYF A;  1TWA B;  3HP3 A;  3SEB A;  2ZM6 Q;  5CBE E;  1MBY A;  1SBB B;  1QVC A;  1ZYR C;  5FLX c;  5JJL A;  4GNX A;  4RCN A;  2SNM A;  1Z47 A;  2F0J A;  4UDU C;  3UE0 A;  5E4X A;  2Z0S A;  4A3B H;  1Q1B A;  4HCE A;  4HIM A;  2KCM A;  3B6Y A;  1S5B D;  3NBI A;  2B3G A;  4UP8 A;  2EOT A;  2V4D A;  2QF7 A;  3EA6 A;  4A3J B;  1HZB A;  5C44 B;  3I4L A;  2UUC L;  4KHP L;  3S9W A;  2F4I A;  1VQB A;  1HA5 A;  1LO5 D;  1E7Z A;  3TEH B;  3KK7 A;  5D14 A;  3CQZ B;  1TWA H;  2RF4 A;  1I4P A;  1JOO A;  3OIQ A;  4F7X A;  3QOL A;  3BYY B;  3HOU G;  2NBF A;  1PTO C;  2MFI A;  3A8I E;  1G6Z A;  1PXU A;  2UUB Q;  4NXM Q;  1G2S A;  1K8A C;  1SJH D;  1VF7 A;  3K59 A;  3DM1 A;  5C4X B;  1STN A;  5M3F G;  3H0G G;  4CDF C;  4XQQ A;  3VA5 A;  2L11 A;  1NJI C;  4ZQ3 A;  2NN6 G;  3T1Y L;  4DN4 M;  3FMC A;  4A3J H;  5KGU A;  1VQ6 A;  5C44 H;  4OWW B;  3AU7 A;  4DA2 A;  2K4K A;  3J81 c;  2A6E D;  4P74 A;  3RZO H;  2E75 C;  1VQ7 A;  3PGZ A;  1FNV A;  3K0X A;  3PO2 B;  2H5X A;  3LWU A;  3CC4 A;  4JVZ A;  5CBA E;  1SYF A;  1MI2 A;  1GO3 E;  3R2I A;  5DEH A;  4ILW A;  1B3A A;  2RCN A;  4OWX B;  1WTV A;  1A2T A;  5EGT A;  1CHP D;  5DM6 3;  4IUQ A;  1K83 B;  5C4X H;  5M5X B;  4FNF A;  1R4P B;  3T4A C;  4JI4 Q;  2LY7 A;  2VNU D;  2DN8 A;  1WTH A;  4MIU A;  4HTH A;  3U50 C;  1PYS B;  3CRK C;  3VYT A;  1SYE A;  1II3 A;  4ZUJ A;  2ZM6 L;  3M4Y A;  3C2P A;  4H44 C;  1BR9 A;  5FLX L;  2PQA A;  3PO2 H;  1WCM H;  4B3S Q;  4X6A H;  1EEF D;  2A1A A;  3A0J A;  4IUV A;  1WTO A;  3FKI B;  4KI0 A;  4KHV A;  4C3I B;  1GUN A;  3SDZ A;  4QIW B;  3K57 A;  3I4N G;  4BXX H;  4FVM A;  2IJ0 A;  1K83 H;  1ICW A;  2KCC A;  5T1G A;  5IGG A;  2IT1 A;  5M5X H;  1U9R A;  3RUZ A;  3VR4 A;  2JA5 H;  2WB1 E;  3PIO 3;  1OO9 B;  3NTK A;  2Q2T A;  3SXH A;  4QUC A;  2R7Z B;  1IKL A;  1KD1 C;  1XYI A;  2F0H A;  1L2F A;  1B9M A;  1GUT A;  1PLF A;  1BKB A;  1SFO H;  4IFD J;  5EAY A;  3AEV A;  1SRU A;  1GVP A;  1RL2 A;  4ZUI A;  3X3M A;  4NPS A;  4LJZ C;  3OPO A;  5IYC H;  2KCN A;  2QEJ C;  3FKI H;  3KF8 B;  2WAQ B;  3SK6 A;  2NVX B;  1BO0 A;  3I73 A;  5T1I A;  4LF6 L;  4BBS B;  3RLN A;  4IUP A;  1VQ4 A;  3E3X A;  1HR0 L;  1PTO F;  3EJI A;  4PZ7 A;  1TWC B;  5M3M G;  3G71 A;  2F0T A;  2K5V A;  5ISR A;  3MVV A;  1OXT A;  4HED A;  4R4I A;  2AWN A;  1SNP A;  5EKI A;  4KY6 A;  1D1K A;  3E0E A;  4B3M L;  4GOP C;  3HOY B;  2HIV A;  4OIJ A;  2R7Z H;  2F3I A;  1JB3 A;  4A3I H;  3VA7 A;  1HNZ Q;  1ILQ A;  2R3Z A;  5C6A A;  4RCO A;  5E7N A;  4AYB B;  3J80 i;  4DF7 A;  4OGQ C;  2KEN A;  5JAV A;  4CHT B;  5K36 H;  5G3L F;  1D8L A;  1ASY A;  3Q22 A;  5G3L D;  4A3F B;  1F9R A;  4FXK C;  2NVX H;  3CW2 C;  3DWP A;  3OMC A;  4JYA Q;  2BA1 A;  4JI4 L;  4BBS H;  3D3R A;  4FXG C;  1XNQ L;  1EYD A;  4BY1 H;  1XMQ Q;  2EYH A;  2DY7 A;  4YHH L;  2FMM A;  3MZ5 A;  3UDG A;  3I4M B;  1HHV A;  2F0E A;  5EKL A;  4S3S A;  4OIK A;  2E5L L;  4DR2 Q;  1ESR A;  1EZ8 A;  1R9T B;  5J3B A;  1Q46 A;  3H3V I;  1HTP A;  2O4X A;  4UPA A;  1IL2 A;  4N9T A;  1PH4 A;  3V96 A;  4P72 A;  2XWJ B;  2G9H D;  4QJF A;  1CUK A;  3ONA B;  1DOM A;  3Q23 A;  4NB3 A;  4IFD I;  1QIL A;  1KRT A;  1O78 A;  2A73 B;  4UP7 A;  1F2Z A;  2AUJ D;  1D2B A;  1HJP A;  1N8R C;  2YTV A;  5FKA C;  3I4M H;  4V0B A;  5COY A;  4GOP A;  1IW7 C;  4DR1 L;  2Y0S B;  1SJE D;  1YJW A;  1R9T H;  3D4R A;  2HT1 A;  1STY A;  2F0I A;  2K5H A;  4AQY Q;  4P71 A;  3CCM A;  1CFM A;  5HY6 A;  3V05 A;  2VB3 X;  3CHB D;  5EBC A;  2MUY A;  3MFG A;  4M1U B;  3HOZ B;  4IOC A;  4POF A;  3NEN A;  2FIN B;  1J6Q A;  3OW2 A;  1QUQ B;  2PNR C;  2EY5 A;  4UHV A;  2MQH A;  3DM3 A;  2SOB A;  5IP9 G;  1YJ9 A;  3TDQ A;  1I5F A;  3AMU A;  3DLL A;  4A3E B;  4F88 A;  4KTA A;  3CP0 A;  5C0X I;  4A3M G;  1AE3 A;  2F0V A;  1NAP A;  4PMW A;  2Q8I B;  1FNW A;  4X66 Q;  3TRE A;  3F2D A;  3Q0A A;  4DV3 Q;  1V43 A;  2B63 G;  5C4H A;  1KXL A;  3PO3 H;  2B2Y C;  4HMJ A;  2PYK A;  2L12 A;  1XMQ L;  2QDB A;  1WYD A;  3HKZ E;  2MGS A;  3PMF A;  1X65 A;  2GVA A;  1Q82 C;  1M8A A;  3MC0 B;  3FHW A;  4DAM A;  3K5O A;  4ZCK A;  5IT9 E;  3P75 A;  4NP5 A;  1L1O C;  4A3E H;  1SMY D;  5J22 A;  3CCS A;  3GV3 A;  1AE2 A;  4IPH A;  1BBW A;  3CAM A;  1V1Q A;  1VQN A;  3BDC A;  2CKZ B;  2F0N A;  1U4P A;  1PV4 A;  1DYQ A;  1JWU D;  1PYB A;  1BF4 A;  2KHS A;  5DLQ E;  4B3T Q;  2ENB A;  5I6W A;  5LMU L;  2XWB B;  1H9M A;  2EVB A;  4K8J A;  4YCU A;  1DGS A;  1XPO A;  1B53 A;  2I5L X;  3X3N A;  1PDQ A;  4E6I A;  1UNS A;  2BH2 A;  4ZKB B;  2K04 A;  2IX1 A;  4B9W A;  2X6L A;  2JSO A;  5BN3 A;  1QVG A;  1ENC A;  1A62 A;  2HQE A;  3PCO B;  4BBR B;  4DR5 Q;  2KHI A;  2WAC A;  1LT4 D;  2PMZ B;  2UU9 Q;  4ID6 A;  3G6E A;  2F0D A;  1JJC B;  4DK1 A;  5IGD A;  1M1K C;  3PF4 A;  2J4X A;  1DM0 B;  4O1N A;  1C48 A;  1F2Y A;  2XGT A;  1DZ1 A;  1BVS A;  1EFW A;  1K28 A;  3PIO A;  2CFM A;  2AMC B;  2R61 A;  4X3S A;  1BQQ T;  4QIW E;  2QW7 A;  1PTO B;  3J81 j;  3J7A 5;  5FOB B;  1T5X D;  4Y7N B;  1I94 Q;  1LTA D;  1ONL A;  2E2I B;  1KDA A;  1KAB A;  2NWG A;  3I2Z A;  1PHJ A;  2M2L A;  3J80 c;  5DAU A;  1N34 Q;  4CGY B;  4F8M A;  2YTY A;  1ENF A;  1L1O A;  1DOL A;  4BBR H;  1PZK D;  3BDL A;  1S4Z A;  1YNN C;  1SE3 A;  2B39 A;  3CMA A;  2QEX A;  4DV3 L;  4A3C H;  2JYO A;  4A4I A;  5KND A;  4KN7 C;  3F2U A;  3RZD B;  3T1H Q;  2EZV A;  1D5M C;  4RG1 A;  5I4D A;  3S2H B;  1A2U A;  1PTO H;  4WOR A;  4UAI A;  2VUM B;  4QY7 A;  3R93 A;  4Y7N H;  3RLO A;  2I0Q A;  1SND A;  2E2I H;  1ET6 A;  3IAY A;  1E24 A;  4OEL B;  3M4O H;  3FDT A;  5D3D A;  4OO1 H;  2IPK D;  2WKC A;  1WTQ A;  4KK7 A;  3OOC A;  2F03 A;  1L0X B;  2D2C C;  1EU3 A;  1CKO A;  4IUU A;  2WB1 B;  1ML0 D;  2RSN A;  4OWT B;  4IO9 A;  2IX3 A;  3NQT A;  5EPJ A;  1MSH A;  2E74 C;  1AN8 A;  4AYB E;  3GO5 A;  4B3T L;  4QCL A;  5DNF A;  1TQO A;  2Z4I A;  4C2M B;  4I7A A;  3JC6 6;  5JEA J;  1PH1 A;  1IBK Q;  3HOX B;  4DV6 Q;  1KL9 A;  1HTL D;  3KF8 A;  1YZ6 A;  4KN4 C;  1I4Q A;  1QNU A;  1LM0 A;  1E1T A;  1HQR D;  3BZC A;  3MXP A;  1MD2 D;  2VUM H;  3HS0 C;  4Y52 H;  4A3B G;  2ID0 A;  4TQU S;  5M5Y B;  4DR5 L;  4HJA A;  4HN7 A;  2Z6K A;  1Q1E A;  3KF6 A;  1K0S A;  1A3V A;  1J5E Q;  1CHQ D;  5IE8 A;  3TS2 A;  2JA6 B;  3NEL A;  1RIP A;  2HQL A;  1KNA A;  1GHK A;  1O7Z A;  3TN2 A;  2RCF A;  4LF9 L;  4IAL A;  1EWH A;  2B2T A;  2A68 D;  1KQS A;  1VQA A;  5M5W B;  3S1M B;  4LF5 L;  1E22 A;  1Q12 A;  4C2M H;  3S1R B;  3NP8 A;  4JBM A;  1C7Y A;  1QG7 A;  4KHZ A;  3JAM E;  3KLW A;  4L5S A;  4DV1 L;  2D0O A;  2EYM A;  2XTI A;  4IN3 A;  3WWV A;  5HUR A;  2LS0 1;  1N34 L;  2R6G A;  4A3D B;  5ELB A;  1SNO A;  2V1C C;  2B8G A;  1Z6H A;  2CQO A;  3GDE A;  4PMB A;  1A15 A;  3GTP H;  1AP0 A;  4B9X A;  4R1J A;  2CW0 D;  1JOR A;  4A3J G;  2LFN A;  3VR2 A;  2FXQ A;  2Y0S E;  1BNZ A;  5C44 G;  1CKM A;  2JA6 H;  3GTK H;  2GA4 B;  5TSS A;  4GOP B;  4HIO A;  1V8Q A;  4POG A;  3Q8D A;  5KRU A;  1X32 A;  2KQ3 A;  3DHQ A;  1VF5 C;  3TQY A;  3QO2 A;  1ROD A;  3J7Y W;  3MHB A;  3W5O A;  5M5W H;  1T5E A;  3S1M H;  4CJ1 B;  5EPK A;  1VQ9 A;  3S1R H;  1EY8 A;  4XT1 B;  4KKU A;  4WJ3 M;  1QZG A;  2A19 A;  3GQB A;  2F3W A;  1TWF H;  4A3D H;  3VYU A;  5C4X G;  1SE4 A;  3U58 A;  1F9S A;  1V1P B;  3BZK A;  5IP7 H;  4IPD A;  3T16 A;  4EQ5 A;  4LUO A;  3NBH B;  3H3V C;  2E76 C;  5HGT A;  2AQ2 B;  3VYS A;  1UUP A;  3N6R A;  1CZW A;  1KDB A;  1UE1 A;  1AZP A;  4DXF A;  3H15 A;  1OXS C;  4DV2 L;  1GOZ A;  1UE6 A;  1IBK L;  1XPU A;  4RAU C;  4DV6 L;  1C0A A;  1GJX A;  1R4Q B;  2XSC A;  4A3G H;  1B70 B;  4CJ0 B;  2EYP A;  2JP1 A;  3TP7 A;  3PO2 G;  1WCM G;  2JA7 H;  1BBX C;  1WTW A;  1VS0 A;  2F3V A;  1CTM A;  2WKD A;  5C3E H;  2XIW A;  4LF4 Q;  4JI1 L;  4ZYS A;  1B7Y B;  4A3K H;  1SLJ A;  2I46 A;  5HGQ A;  2EE1 A;  4UY8 C;  4X65 Q;  2UXC L;  3NE5 B;  1QUQ A;  1J5E L;  3LWE A;  4BXX G;  3ERS X;  4LFC Q;  3R3O A;  3CF5 A;  2A6H C;  4QUF A;  4JI8 Q;  3CPW A;  2HCI A;  3GTL B;  4C56 C;  2JA5 G;  4BA2 I;  1HZ9 A;  1EQQ A;  4DGZ A;  1TS5 A;  5FJ8 H;  1EYA A;  4LFB Q;  5IYD H;  2M9V A;  5IGE A;  2KEC A;  1IZ6 A;  1YNJ C;  3LGJ A;  4A93 B;  1JJG A;  5CR3 A;  2BE5 C;  3A5Z B;  3PUV A;  4B08 A;  2P5Z X;  4OON A;  1PA6 A;  2ES2 A;  1LTS D;  2Q8R E;  1CK1 A;  1O7Y A;  3KLS A;  3BG3 A;  4LUV A;  1E1O A;  3FKI G;  4Q0F A;  2N88 A;  3T56 B;  5ELN A; 
#chains in the Genus database with same CATH homology
 2NN6 I;  1E3P A;  1Q8K A;  5E7N A;  5FLM H;  4DUY L;  3J80 i;  5FJ8 G;  4YWL A;  5IYD G;  4DV5 Q;  1K8G A;  4JI6 L;  2KEN A;  2UXD L;  2VUM G;  1HH2 P;  3CCJ A;  1A0I A;  1UE5 A;  1D8L A;  3CCQ A;  1I94 L;  2PMZ E;  4A75 A;  1PH5 A;  4X62 L;  1ASY A;  1QVF A;  2VL6 A;  3CD6 A;  3GTL H;  2F52 A;  1EWI A;  3HOX H;  2NZH A;  1NBW A;  3CW2 C;  2NVX H;  4JI0 Q;  4JYA Q;  2IX0 A;  2BA1 A;  3I7F A;  4DV7 L;  4JI4 L;  4BBS H;  3KJP A;  3ZJY C;  1XNQ L;  1X6O A;  1Y14 B;  1XMQ Q;  1K9M C;  2UUA L;  4YHH L;  2DUD A;  4BY1 H;  4JI3 Q;  4A3I G;  1XJV A;  3KDF B;  1VQO A;  4NXN L;  3S2D H;  4TVA B;  3UDG A;  5M5Y H;  3KOJ A;  5FLM G;  2N78 A;  3CQZ H;  4IPG A;  4LF7 L;  4LUZ A;  3IRB A;  2E5L L;  4DR2 Q;  4JI5 L;  1YHQ A;  4DV4 Q;  1I6H H;  3EN2 A;  3PUY A;  4JBW A;  5ELO A;  3GTO H;  5LMN L;  4JC0 A;  1OTC A;  5J3B A;  4DK3 C;  2JEB I;  1VQD A;  2PI2 A;  4EX5 A;  2WAQ G;  1Q46 A;  3HOX G;  4H02 A;  3H3V I;  3I55 A;  1IBM Q;  3CCL A;  4UPA A;  3E9H A;  1K3R A;  1IL2 A;  4ME3 A;  3STB D;  2EQS A;  1W2B A;  1QZH A;  1PH9 A;  4BBS G;  3ULP A;  4BY1 G;  2EIF A;  3T1H L;  1PH4 A;  4R4O A;  4P72 A;  3E9I A;  4QGU A;  3L0O A;  4HIK A;  1VQL A;  4DR6 Q;  2AHO B;  1L1O B;  1VQF A;  2L15 A;  4QJF A;  1CUK A;  2K75 A;  4LFA L;  1IYJ B;  4NB3 A;  2PQA B;  4YY3 Q;  4R4Q A;  3ICE A;  3M7N A;  4IFD I;  1KRT A;  2PNH A;  1K73 C;  3PSI A;  4PZ8 A;  1FJG L;  2RHQ B;  3TS0 A;  1YIJ A;  4UP7 A;  4DNI A;  1HJP A;  1N8R C;  3T1Y Q;  3CCU A;  3J7Z C;  4AIM A;  4LF9 Q;  3CME A;  4JV5 Q;  1XTD A;  2YTV A;  1YBY A;  2LXJ A;  4LF5 Q;  1VCI A;  4HJ9 A;  4YCW A;  3I4M H;  3HKZ G;  4GOP A;  4JG2 A;  4DR1 L;  1HZA A;  4PG3 A;  1YJW A;  5IWA L;  1VQJ A;  2WP8 J;  1R9T H;  4DV1 Q;  2HT1 A;  3UDX A;  1X56 A;  3M4P A;  4DV0 L;  2OWO A;  3ER0 A;  2K5H A;  4OX9 L;  4AQY Q;  4P71 A;  2LSS A;  1O7I A;  2Z6K C;  3SGI A;  3OTO Q;  3CCM A;  1ASZ A;  1TXY A;  3W1B A;  5HY6 A;  1VQH A;  2JE6 I;  2C35 B;  4K0K L;  4LFB L;  1SN8 A;  1M90 C;  1S3O A;  4GKJ Q;  1YHB A;  4GKK Q;  4IOC A;  4POF A;  3NEN A;  3I4M G;  3S17 H;  4IOA A;  1J6Q A;  1W3S A;  2HIX A;  3UE1 A;  3K8A A;  2VY3 A;  5JEA G;  3OW2 A;  1QUQ B;  1EIY B;  2B63 H;  4BY7 H;  2K50 A;  2N8N A;  3PV0 A;  2MQH A;  4JI7 Q;  2WAQ E;  3DM3 A;  2CWP A;  2I5H A;  5IP9 G;  4ALP A;  1WI5 A;  1YJ9 A;  1I5F A;  3UDI A;  3DLL A;  4GN3 B;  3CC7 A;  2UUB L;  1MKH A;  1EOV A;  3BJU A;  4NXM L;  3HOW H;  4QL5 A;  3CP0 A;  1SRO A;  3A5U A;  4DR4 Q;  2OTJ A;  5C0X I;  3J81 i;  4A3M G;  1AE3 A;  1PH7 A;  2UXB L;  3K80 C;  5GQO A;  4PMW A;  4DV5 L;  4C3I H;  3HOV H;  5BR8 Q;  4X66 Q;  4LNQ A;  2R7D A;  5K36 G;  2E8G A;  3TRE A;  1FGU A;  4DPG A;  2ZTE A;  1GD7 A;  1OXV A;  3F2D A;  4GLV B;  1HR0 W;  2MO0 A;  3F8T A;  4RMF A;  4LF8 Q;  1JT8 A;  1X3E A;  4DV3 Q;  1V43 A;  2B63 G;  3TRZ A;  4BY7 G;  1YEZ A;  3PO3 H;  1KXL A;  1X3F A;  2VW9 A;  2VZA A;  1UEB A;  3KF6 B;  4JI3 L;  1XMQ L;  1YVC A;  1JMC A;  3G48 A;  1WYD A;  3HKZ E;  3HOW G;  1X65 A;  5IYC G;  2B29 A;  3K7A H;  3CXC A;  1MIU A;  1PH8 A;  2GVA A;  2JK8 A;  4DV2 Q;  1Q82 C;  2Y0S G;  4IJL A;  1EYG A;  3HOV G;  3FHW A;  4R4T A;  4FDB A;  4DAM A;  4X64 L;  3RN2 A;  1T9H A;  1TWG H;  1N33 Q;  1EIF A;  4AH6 A;  1GM5 A;  3F1Z A;  4DV4 L;  1NY4 A;  1MJC A;  4DR7 Q;  2Q2H A;  1NMG A;  1JB7 A;  1L1O C;  1LYL A;  2ZJR A;  4A3E H;  3CCS A;  4O0A A;  1AE2 A;  3JAM i;  4IPH A;  1BBW A;  3PF5 A;  1IBM L;  3CAM A;  1V1Q A;  1VQN A;  4MTN A;  2JEA I;  2CKZ B;  3PO3 G;  3GD7 A;  3S16 H;  4OXP A;  4JOI C;  4JI1 Q;  5C0X J;  2HHH L;  4XTC S;  1OXU A;  2F4V Q;  1PV4 A;  3S1N H;  4YWM A;  2UXC Q;  1EQR A;  1P8L A;  1PYB A;  4DUZ L;  2QA4 A;  3U4Z A;  4DR6 L;  4DKA C;  1Q86 C;  2R7Z G;  2VS1 A;  5DLQ E;  4LWC A;  4B3T Q;  1TWC H;  1X3G A;  4A93 H;  3L2P A;  3GTJ H;  5LMU L;  1UE7 A;  3PUW A;  1PVO A;  1JJ2 A;  4YCU A;  2UUC Q;  2R92 H;  1DGS A;  1U5K A;  4JV5 L;  4A3E G;  3M85 A;  2I5L X;  1XPO A;  4LF6 Q;  2BH2 A;  4KHP Q;  1H95 A;  4B3S L;  5LMN W;  3HOY H;  4GLX A;  5GAD C;  4B3R Q;  1HR0 Q;  1GKH A;  2IX1 A;  4DAY B;  2A8V A;  1LTL A;  1SR3 A;  5IT9 c;  1QVG A;  3K81 C;  1A62 A;  3PCO B;  3S24 A;  4GNX C;  4DR5 Q;  2KHI A;  4JCV E;  3FP9 A;  3HKS A;  3A74 A;  2OTL A;  1YHA A;  2RHS B;  3OTO L;  2UU9 Q;  1BBU A;  1SE8 A;  4B3M Q;  3G6E A;  1HNW Q;  1JJC B;  4A93 G;  1M1K C;  2K14 A;  5AJ3 Q;  3PF4 A;  4A76 A;  4A3F H;  4L5Q A;  2R92 G;  3KDF A;  1K0R A;  4PZ6 A;  1VQI A;  2XGT A;  2MO1 A;  1BVS A;  1EFW A;  2CWA A;  2D62 A;  1CSP A;  2CFM A;  3PIO A;  2AMC B;  3M3Y H;  4GKJ L;  4JI6 Q;  2NZO A;  3HOY G;  4GKK L;  4QIW E;  1G51 A;  3CCE A;  2UXD Q;  3J81 j;  3KFU A;  1VQE A;  3J7A 5;  1I94 Q;  4LF4 L;  1I50 H;  4X62 Q;  4JI7 L;  1CKN A;  4AYB G;  2IY5 B;  4X65 L;  3CCR A;  2EXD A;  3I2Z A;  2YYZ A;  1XPR A;  1PHJ A;  3J80 c;  1XNQ Q;  5JJI A;  4YHH Q;  3STB C;  2Q2I A;  4LFC L;  1N34 Q;  1KRS A;  4A3F G;  2IHF A;  2YTY A;  3S15 H;  3I4O A;  1L1O A;  4JI8 L;  3RN5 A;  1VQ5 A;  5BR8 L;  4IJH A;  1N36 L;  4BBR H;  4C3H H;  4LF7 Q;  4BA1 I;  2E5L Q;  4WJ4 A;  4KLK A;  2ZJQ A;  2AWO A;  4LF8 L;  2E2J H;  3CMA A;  3GTG H;  2QEX A;  4JOI A;  1VQG A;  4YCV A;  4DV3 L;  4A3C H;  5LMN Q;  1AH9 A;  5IYB H;  4GS3 A;  5C4J H;  4MZ9 A;  3F2B A;  3GTM H;  4O2D A;  3GTQ H;  1PFS A;  5JJK A;  3PIP A;  4GN5 A;  4A4I A;  3W1G A;  4DR3 L;  3S14 H;  1TWH H;  3T1H Q;  2NVY H;  2ZJP A;  2JA9 A;  4RG1 A;  2MNA A;  1N32 L;  1X54 A;  1I3Q H;  1YNX A;  2N49 A;  4HJ5 A;  4L5R C;  4QY7 A;  4DK6 C;  3I56 A;  4Y7N H;  3RLO A;  1PH3 A;  2I0Q A;  1HNZ L;  1PH2 A;  1NE3 A;  2NVT H;  1B8A A;  2E2I H;  4BBR G;  4LFA Q;  3OYY A;  1PH6 A;  1N33 L;  1E24 A;  3M4O H;  1WFQ A;  3RNU A;  4P73 A;  2ZM6 Q;  4A3C G;  3EIV A;  4UP9 A;  1QVC A;  5FLX c;  4A3L H;  5IYB G;  5JJL A;  3G4S A;  4GNX A;  1Z47 A;  3UE0 A;  2DGY A;  5M3M H;  1Y1W H;  2Z0S A;  4A3B H;  1Q1B A;  1CKO A;  4JI0 L;  4C3J H;  2F4V L;  4HIM A;  2ALY B;  4JYA L;  2KCM A;  3B6Y A;  4OWT B;  2KCT A;  2GN5 A;  4IO9 A;  1VQC A;  2B3G A;  4UP8 A;  4DR1 Q;  3U4V A;  2LXK A;  4JI2 Q;  2ATW A;  4HID A;  2NVQ H;  3HOU H;  2VQF Q;  4AYB E;  4DV0 Q;  1KAW A;  1FVI A;  3GO5 A;  1G29 1;  4APV A;  4B3T L;  3HOZ H;  2WFW A;  1HZB A;  3JC6 6;  1NTG A;  3KYH C;  5JEA J;  1PH1 A;  1IBK Q;  2UUC L;  4OO1 G;  4DV6 Q;  4DR2 L;  4KHP L;  1KL9 A;  4K0K Q;  1YZ6 A;  5M3F H;  4A3L G;  1VQB A;  3H0G H;  4J15 A;  1LM0 A;  1E1T A;  3BZC A;  2VUM H;  1E7Z A;  3TEH B;  1Y1W G;  1IBL Q;  4Y52 H;  4A3B G;  3AFQ A;  4IPC A;  2ID0 A;  4TQU S;  2VQE Q;  2GVB A;  4HJ8 A;  4DR5 L;  1TWA H;  1XMO Q;  2RF4 A;  3M9B A;  1HNX Q;  4JBK A;  3HOU G;  4HJA A;  2E2H H;  2Z6K A;  2KBN A;  2MFI A;  1HNW L;  1D7Q A;  1Q1E A;  3KF6 A;  3HOZ G;  1S72 A;  3KJO A;  1J5E Q;  1WOC A;  5IE8 A;  5AJ3 L;  2UUB Q;  3TS2 A;  1EUJ A;  4XIG S;  4NXM Q;  3D31 A;  3NEL A;  1K8A C;  1RIP A;  1S40 A;  4YY3 L;  3AYH B;  2HQL A;  2UXB Q;  5M3F G;  1VQ8 A;  2OQ0 A;  3H0G G;  2R93 H;  1NJI C;  2NN6 G;  3T1Y L;  4LF9 L;  1HZC A;  1XNR Q;  4A3J H;  1KQS A;  1VQA A;  1VQK A;  4LF5 L;  1E22 A;  1Q12 A;  4C2M H;  1VQ6 A;  5C44 H;  5H1S E;  3ULJ A;  4JBM A;  4OWW B;  3AQQ A;  2OCE A;  1VQP A;  1C7Y A;  2K4K A;  3J81 c;  4P74 A;  4KHZ A;  3EBE A;  3RZO H;  3KLW A;  4L5S A;  1VQ7 A;  3H3V H;  4DV1 L;  2D0O A;  3PGZ A;  2XTI A;  2R7F A;  3WWV A;  1N34 L;  2R6G A;  3K0X A;  2H5X A;  4AQY L;  3NEM A;  3CC4 A;  2V1C C;  2WB1 G;  2CQO A;  3GDE A;  1GO3 E;  3GTP H;  1LUZ A;  4X64 Q;  2R93 G;  1OXX K;  4R1J A;  2BH8 A;  3BU2 A;  4A3J G;  1YI2 A;  3RLF A;  2ZTC A;  4L5T A;  2FXQ A;  2Y0S E;  1NMF A;  1X55 A;  2RCN A;  4OWX B;  4DUY Q;  3RR5 A;  4HJ7 A;  1A63 A;  1A8V A;  5C44 G;  1CKM A;  1YJN A;  1CKN B;  2JA6 H;  3GTK H;  4GOP B;  1Y1V H;  3CPF A;  4HIO A;  5IY0 A;  4POG A;  4R4C A;  3Q8D A;  5C4X H;  3M4Q A;  3TQY A;  2AKW B;  2HHH Q;  1G6P A;  2KHJ A;  4DV7 Q;  4JI4 Q;  3W5O A;  4DUZ Q;  2VNU D;  5M5W H;  3S1M H;  3I4N H;  4LW1 A;  2D0P A;  2ZTD A;  2UUA Q;  1VQ9 A;  3S1R H;  1MJE A;  3U50 C;  3K7U C;  3JAM c;  1PYS B;  4DR4 L;  1FL0 A;  4WJ3 M;  3PUZ A;  2ZM6 L;  1KC8 C;  1QZG A;  4NXN Q;  2A19 A;  5LMU Q;  4X66 L;  4P75 A;  2QGQ A;  4IFD G;  2PQA A;  1VQM A;  1TWF H;  3PO2 H;  1WCM H;  2JJQ A;  4B3S Q;  2JA6 G;  4X6A H;  4JI5 Q;  4A3D H;  1Y1V G;  2A1A A;  2BA0 A;  2I5M X;  3A0J A;  3MXN B;  5C4X G;  3PUX A;  3U58 A;  2IHE A;  3BZK A;  4KI0 A;  5IP7 H;  4IPD A;  4EQ5 A;  2CCZ A;  4LUO A;  3NBH B;  1Q81 C;  2Q2U A;  2OQK A;  5GAH C;  1SMX A;  3VDY A;  4JI2 L;  1UWV A;  2K5N A;  1U0L A;  2VQF L;  5IP9 H;  3I4N G;  1UE1 A;  2JQO A;  1CSQ A;  2JA8 H;  3H15 A;  1OXS C;  1P16 A;  4BXX H;  4YWK A;  1K83 H;  4DV2 L;  1UE6 A;  1IBK L;  1XPU A;  4GLA C;  4DV6 L;  4A3M H;  2IT1 A;  5M5X H;  1C0A A;  1KIX A;  4A3G H;  1B70 B;  4QQB X;  4DR7 L;  2YTX A;  4GNX B;  2JA5 H;  2WB1 E;  1WCM G;  5GAG C;  5GAE C;  4MNO A;  2JA7 H;  1FJG Q;  3PO2 G;  4A3D G;  1IBL L;  2Q2T A;  4JBJ A;  1VS0 A;  4GN4 B;  2VQE L;  5IP7 G;  5C3E H;  1N9W A;  1XMO L;  1KD1 C;  1HNX L;  1V9P A;  4LF4 Q;  1L2F A;  4JI1 L;  1X9N A;  3ULL A;  1BKB A;  1B7Y B;  1JE5 A;  1SLJ A;  5HGQ A;  4A3K H;  1SFO H;  3MEF A;  4IFD J;  4UY8 C;  5EAY A;  4X65 Q;  2UXC L;  3AEV A;  1QUQ A;  3CC2 A;  1SRU A;  1GVP A;  1RL2 A;  1J5E L;  2JA8 G;  4BXX G;  5IWA Q;  4NPS A;  1C9O A;  3ERS X;  3CCV A;  5IYC H;  4LFC Q;  3UDF A;  2ASB A;  3CF5 A;  4OX9 Q;  4OO1 I;  3FKI H;  3KF8 B;  2K52 A;  4A3G G;  4JI8 Q;  3CPW A;  1N36 Q;  5C0X G;  2JA5 G;  4BA2 I;  1HZ9 A;  1EQQ A;  4LF6 L;  1XNR L;  2JA7 G;  2YV5 A;  3RZD H;  3S1Q H;  3RLN A;  5FJ8 H;  4LFB Q;  5IYD H;  1L0W A;  3S2H H;  1VQ4 A;  4B3R L;  1HR0 L;  4PZ7 A;  5C3E G;  5GRO A;  3D0F A;  3HFZ B;  1IZ6 A;  3LGJ A;  5M3M G;  3G71 A;  2K5V A;  1JJG A;  4A3K G;  1OXT A;  4R4I A;  2AWN A;  3F2C A;  1Z9F A;  3A5Z B;  4DR3 Q;  1WJJ A;  1Q7Y C;  3PUV A;  3AFP A;  1YIT A;  1KHI A;  4OON A;  1PA6 A;  2ES2 A;  3E0E A;  3L7Z C;  2UU9 L;  4GOP C;  4B3M L;  1N32 Q;  1IXR A;  2HIV A;  4LUV A;  1E1O A;  2N3S A;  3FKI G;  2PI2 E;  2R7Z H;  2F3I A;  4A3I H;  1HNZ Q;  5ELN A;  2YU9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...