4HIMA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggatacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4himA00
1E22A 5C44H 3RZOH 1CUKA 1KL9A 4GN4B 4KHPQ 4DAYB 1IBLQ 1PYSB 4LF5Q 4YY3Q 3CC4A 2JA8G 1OXUA 4O0AA 1NBWA 4OWXB 2VQFL 4A4IA 2NVXH 2UUAL 2CCZA 3K81C 5M3FG 1X6OA 3EBEA 4P75A 3PO3H 4BY7G 1QVCA 3PO2H 5IYDG 3CCMA 3IRBA 1L1OA 3H15A 4A3MG 1VQPA 2OWOA 4JYAQ 3I55A 1HNZL 1D7QA 2FXQA 2UXCL 3TRZA 1UE1A 2K52A 3CXCA 2Y0SG 4A3BG 3M4PA 5M5WH 2NN6G 3CF5A 2PQAA 3K7AH 3F2CA 1HZBA 4DV5Q 1UE5A 3A5UA 4HJAA 4POGA 4LF7Q 3W1BA 4EQ5A 3PUXA 2EXDA 2YV5A 1PH2A 2E2HH 1PVOA 3UDGA 1YVCA 4NB3A 5GROA 1XMQQ 2JA6H 4QY7A 1L1OB 4JI2L 3ULJA 4IOCA 3DM3A 3PV0A 2Q2HA 4P71A 1VQ7A 2ZJRA 4DR4Q 4NXNL 1X65A 4DR5L 1XMOL 5FLXc 1MKHA 2PQAB 1W3SA 4LF8Q 3M3YH 3SGIA 1I50H 4A3JG 1GM5A 4DR6L 1XPRA 1JJCB 4R4CA 5JJIA 5GQOA 3HKZG 5IWAQ 2YU9H 2F3IA 3B6YA 2HIVA 1PH7A 1UWVA 4LUVA 4YCUA 1H95A 4IPHA 3K80C 4DV1Q 1Y14B 3ZJYC 3PUVA 2WAQE 3KLWA 4UPAA 1PHJA 2OTLA 1HH2P 2RF4A 2B63G 4A3BH 4NXML 1X54A 1UE7A 1Y1WG 5GAHC 4JI3L 1J5EL 1AH9A 2CKZB 1QZHA 2LSSA 2K5NA 3K0XA 3S24A 4A3KG 1QVFA 1HNWQ 3AFPA 2NN6I 4WJ3M 4UP7A 3H0GG 1S40A 3W5OA 1HR0L 4DR5Q 4LF9L 3GDEA 1PH8A 1XJVA 1SROA 1EOVA 1MJEA 1L1OC 3KF8B 1JB7A 1GO3E 1WFQA 3AYHB 1LUZA 2IHEA 4DR6Q 1KAWA 1E3PA 3EIVA 3GD7A 3UDFA 3GTGH 1YJWA 4A3FG 1IBML 4IFDJ 1SR3A 3I7FA 4QQBX 3KJPA 4DV4Q 4DV2Q 3AQQA 4MTNA 1D8LA 4IPGA 3S1NH 1OXXK 1T9HA 3STBD 5GAEC 2JEBI 1U0LA 3U50C 4A3EH 1I94L 2OCEA 5M3MH 4A3DH 3HFZB 4R4OA 4HIMA 3PGZA 3PUWA 1NMFA 2K14A 4HIOA 4C3IH 3GTJH 4JI3Q 3BZCA 3MEFA 4LF4Q 1KC8C 4HIDA 5LMUL 3L0OA 2CWPA 5E7NA 1VQCA 1CKMA 3VDYA 4XTCS 4OWWB 1WOCA 1Q1EA 4DR3Q 3M4QA 2E5LL 1YZ6A 3HOWG 3S16H 3CCEA 1DGSA 1PH6A 2EIFA 2I5MX 4KHPL 3HOVG 2DGYA 1IBLL 4LF5L 4YY3L 2R7ZH 1BBUA 3CPWA 1P16A 3I4OA 1EQRA 5IE8A 1ASYA 2VQEQ 4NPSA 1N32Q 1PYBA 1IBMQ 3PUZA 1YHAA 3A74A 3S17H 4TVAB 5J3BA 4TQUS 2QEXA 4BA1I 1VQ8A 2UUCL 4JI7L 4JYAL 4A3FH 4BBRG 4GS3A 1QVGA 4B3TQ 3BZKA 2GVAA 5M5XH 2UUBQ 5DLQE 1UEBA 2IY5B 1N34L 4LF6L 1G291 2Y0SE 4DV5L 4LNQA 1V1QA 1V43A 1I94Q 5IP9G 4LF7L 3G71A 3I56A 1TWCH 2VS1A 4Y7NH 2K5HA 2R7FA 1XMQL 2WP8J 1X3GA 4POFA 2KCMA 1XNQQ 3GTMH 3I4MH 1U5KA 3HOYG 1MJCA 1GKHA 3A5ZB 4BY1G 1VQMA 4A3GG 4DR4L 2UXBL 3J80i 1Q86C 1S72A 4GOPC 2RCNA 3K7UC 5LMNW 4LF8L 2I5LX 4LFAQ 3HOXG 4LUOA 1YHQA 2R92G 2A19A 4AYBG 1GVPA 4BXXH 2ZTCA 3HOWH 3I4NG 2ZJPA 3MXNB 1TWGH 4R1JA 4OX9Q 2AHOB 3TEHB 2F4VQ 2KENA 3G48A 1Q12A 1C9OA 4GNXC 3T1YQ 1JMCA 5IWAL 1E7ZA 4AH6A 1VQ9A 3PUYA 3HKZE 2Z0SA 1FL0A 2EQSA 3PIPA 2AKWB 2UUCQ 1TXYA 4JI7Q 5IYBH 2KCTA 3STBC 4DV1L 1X9NA 4JI6Q 4DR7L 2MNAA 4GKJQ 2JA7H 4LF6Q 1NTGA 5IP7H 1VCIA 3ICEA 1W2BA 1EUJA 5IP9H 5ELOA 1K73C 1UE6A 2D0PA 4GKKQ 4IO9A 1HNWL 3RNUA 2JA9A 1IXRA 4K0KQ 5C4XH 3FKIG 4IJLA 2UXBQ 1KD1C 3D31A 4GLVB 1B70B 3NEMA 1EFWA 3BJUA 5IY0A 4BY1H 4JBKA 5GADC 4JV5L 2JA5G 1I3QH 1LTLA 4BBSG 3NELA 3HOZG 4DV7Q 1NMGA 1WI5A 5JEAG 4DK6C 3J81c 1YI2A 1K83H 5JJKA 4L5RC 1A0IA 2GN5A 2JA8H 3I4NH 3CCUA 4DV4L 1Q1BA 1K0RA 4DV2L 4HJ9A 4JI4Q 2YTYA 4LFCQ 1JJ2A 5M3FH 1EYGA 4BY7H 3CMAA 1YIJA 1IBKQ 5IYDH 4DR7Q 5FJ8G 4DV0Q 4B3RL 2N49A 1TWAH 1Y1VG 4A3MH 4X6AH 2YTVA 1LM0A 2ALYB 3J7ZC 4AIMA 1E24A 3TS0A 3U58A 1K8AC 4KI0A 4JOIC 3RN2A 1FGUA 2WFWA 3I2ZA 4IPDA 4JG2A 2IT1A 4JCVE 2JK8A 2MO1A 3CC2A 1V9PA 4LF4L 4IPCA 4YCWA 1M1KC 3CD6A 3FHWA 5FLMG 4DR3L 1VQBA 4DAMA 1WYDA 1N9WA 3S1QH 3S1MH 1FJGQ 2VNUD 2V1CC 4JV5Q 4A3LG 4J15A 3PCOB 2BA0A 2JA5H 2VQEL 4A3JH 4DR1Q 4XIGS 3JAMc 4A76A 3PF5A 3HOZH 4BBSH 1TWFH 1N32L 1A63A 4GOPA 4A75A 2JE6I 1KHIA 5EAYA 2N8NA 4LUZA 3CAMA 1Z9FA 1B8AA 1HZCA 2UUBL 5C3EG 1GD7A 3NBHB 1SE8A 3PSIA 4B3TL 4UP8A 4JI0Q 3PF4A 1VQLA 1YITA 4YWLA 5C4JH 1R9TH 4HJ8A 3LGJA 4GNXA 2ATWA 4IFDG 4B3RQ 1NY4A 5IT9c 2DUDA 1OXTA 3M9BA 5ELNA 2UU9Q 1VQAA 4DV3Q 4JBJA 2R93G 4GOPB 1VQKA 2K5VA 3H3VH 1XNQL 2XGTA 2B63H 1OXSC 4JBWA 1A8VA 4YCVA 1Y1WH 3KYHC 2ID0A 2ES2A 3H3VI 1VQHA 2Q2UA 4GNXB 2BA1A 5AJ3Q 4A3KH 4LFAL 3CCQA 1XTDA 4AQYL 3CCJA 4ALPA 4A3CG 1SRUA 1WCMG 3H0GH 4AYBE 2MQHA 1SFOH 4IJHA 4B3MQ 4OX9L 2E2JH 1YNXA 2F4VL 4X64Q 2LXJA 4L5TA 4HJ7A 1EQQA 3T1YL 4DPGA 1CSPA 1VQ6A 2VZAA 1Q8KA 3KOJA 2VW9A 3HOUG 1BBWA 4X62Q 3M4OH 2ZM6Q 1LYLA 3RN5A 2IHFA 4WJ4A 1VQEA 2WB1G 1PV4A 4JI6L 1G6PA 5IYCG 2QA4A 1X55A 3NENA 4GKJL 1Q46A 4X65L 4PZ6A 1IL2A 2RHQB 3FP9A 5HY6A 4DK3C 1PFSA 2R7DA 1I5FA 3F1ZA 1B7YB 4DV6Q 2YTXA 1VQJA 1PH5A 1K8GA 2ZTEA 4GKKL 3PO3G 1XPOA 2AMCB 4QJFA 4KHZA 4K0KL 2MO0A 2QGQA 4JOIA 2E8GA 2HQLA 4JI8Q 1I6HH 1K9MC 1YJNA 3CQZH 1QUQA 5M5YH 4AQYQ 3S1RH 1QZGA 1PH4A 3G4SA 2Z6KC 4DV7L 3KF6A 3HKSA 1VQOA 2I0QA 2H5XA 4RMFA 1JE5A 1WCMH 3HOVH 1KXLA 3CCSA 4DUYQ 4B3SQ 2JA6G 2B29A 4GN3B 4LFCL 5C0XG 3T1HQ 1VQ5A 4JI4L 1JT8A 3M7NA 2XTIA 4P74A 4JI1L 4P72A 1TWHH 3HOUH 2BH8A 1IBKL 1QUQB 4DV0L 4X66Q 2PI2E 3KF6B 2HIXA 4QGUA 4X65Q 4L5SA 3UDXA 4L5QA 4BBRH 3D0FA 1Q7YC 3TS2A 1YBYA 5HGQA 2JEAI 4FDBA 3E0EA 1OTCA 3ULLA 3GTKH 4PZ7A 1JJGA 2GVBA 4YHHQ 2NVTH 4JI5Q 1Z47A 5JJLA 1E1OA 1P8LA 2BH2A 4DR2Q 4HIKA 1N33Q 2A8VA 3S2HH 4A93G 2IX1A 3HOYH 3AEVA 1FJGL 4A3GH 3F2DA 3KDFA 1SMXA 4MNOA 2OQKA 4PZ8A 3HOXH 2R92H 4DR1L 4KLKA 1VQNA 2HT1A 3K8AA 1XPUA 4OO1G 3M85A 4LFBQ 4JI1Q 4YWMA 2UXDQ 3TQYA 4A3IG 1VQDA 5LMNQ 4JI0L 2D62A 3OTOL 3UDIA 4R4QA 5C0XJ 3KDFB 4O2DA 5JEAJ 2Q2IA 4MZ9A 5C0XI 1N36Q 2UU9L 2HHHQ 2OTJA 2A1AA 4DV3L 5BR8L 1HJPA 1BKBA 4OONA 1AE3A 1VS0A 3KJOA 1PH3A 1KRSA 4DKAC 2PMZE 1A62A 4R4IA 2VQFQ 2UUAQ 3RLNA 1YJ9A 5AJ3L 1HZAA 2L15A 2KHIA 5K36G 4P73A 3G6EA 1M90C 3FKIH 1O7IA 1XNRL 2ZJQA 4B3ML 4A93H 4ME3A 4A3EG 5M3MG 4PMWA 1HNZQ 4X64L 2KHJA 1KRTA 1CKNA 1HNXL 4A3DG 1L2FA 1E1TA 4GN5A 2UXCQ 2VUMG 4C3JH 3WWVA 1AE2A 2C35B 2MFIA 1HR0W 3CMEA 3RR5A 4X62L 2R6GA 3J80c 2ZM6L 4C2MH 1N34Q 1S3OA 2Q2TA 4GLXA 1FVIA 3RLFA 2Z6KA 1X3FA 3EN2A 1C7YA 1EWIA 1HZ9A 2WB1E 2AWOA 3F2BA 1VQ4A 3S2DH 3OTOQ 1VQFA 1NE3A 3ERSX 4JI2Q 2I5HA 2YYZA 3CCLA 4A3IH 1KIXA 1CKNB 3OYYA 3TREA 2E5LQ 4OO1I 3ER0A 5FJ8H 4NXNQ 4DV6L 1N8RC 2R7ZG 1Y1VH 1XMOQ 4GLAC 5BR8Q 1Q81C 2LXKA 2JQOA 3CP0A 2ZTDA 1Q82C 2JJQA 2K75A 1CSQA 3DLLA 3CCRA 3GTPH 4EX5A 3OW2A 2NVQH 2RHSB 4JI8L 3UE0A 4C3HH 2K50A 3CCVA 4RG1A 3A0JA 4H02A 5FLMH 4JBMA 1XNRQ 4LW1A 3J81j 4Y52H 3L2PA 3E9IA 1HNXQ 1SLJA 2WAQG 4DUYL 1C0AA 1SN8A 4B3SL 3KFUA 3T1HL 2F52A 2N3SA 4OWTB 4OXPA 4A3LH 2CQOA 2VUMH 4UP9A 2KBNA 1WJJA 3I4MG 1IZ6A 4NXMQ 2CWAA 4UY8C 2CFMA 1J5EQ 4PG3A 3J81i 4X66L 2D0OA 2NZHA 1K3RA 3S15H 2ASBA 1PH9A 3GO5A 4YWKA 5C3EH 4DUZL 5C44G 4BXXG 3F8TA 3U4VA 3U4ZA 1HR0Q 4LF9Q 2OQ0A 1RL2A 4YHHL 4JI5L 2K4KA 4R4TA 1L0WA 4DNIA 1MIUA 1KQSA 1ASZA 4IFDI 1BVSA 1IYJB 3RLOA 1YEZA 3PO2G 2R93H 1VQIA 2B3GA 1OXVA 3CW2C 4DR2L 1PH1A 2AWNA 5IYBG 1N33L 1RIPA 4JC0A 1EIYB 3JC66 3BU2A 3GTLH 1YHBA 1X3EA 3L7ZC 3PIOA 1PA6A 2JA7G 1G51A 1X56A 4APVA 5IP7G 3CPFA 4HJ5A 2IX0A 1NJIC 2VY3A 4BA2I 5H1SE 4A3CH 4QL5A 4QIWE 1EIFA 3W1GA 5GAGC 4LFBL 2E2IH 2UXDL 2NVYH 2N78A 5LMNL 3J7A5 5C4XG 3E9HA 2VL6A 3GTOH 3Q8DA 1J6QA 3GTQH 2PNHA 1CKOA 3UE1A 3ULPA 3S14H 3AFQA 3JAMi 4IOAA 5LMUQ 5IYCH 2PI2A 4LWCA 1N36L 2HHHL 4DUZQ 3CC7A 1VQGA 3RZDH 2NZOA
chains in the Genus database with same CATH superfamily
1E22A 4KHPQ 2A6HC 4LF5Q 1WTWA 2CCZA 3EBEA 4P75A 2D5DA 3PO2H 5IYDG 1GUNA 3CCMA 1D7QA 2EYFA 2MGSA 2KVMA 4N9PA 4TKOB 5EKKA 2NN6G 3CF5A 3F2CA 4DV5Q 3SK6A 1UE5A 3C1FA 1BQQT 2EXDA 3VYRA 1PVOA 1KNAA 4NB3A 4KN7C 1JWSD 1QB5D 3ULJA 4IOCA 3FEWX 4G4KA 4P71A 3J7YW 1VQ7A 2ZJRA 4DR4Q 4Q0FA 1XMOL 5FLXc 1MKHA 1W3SA 2PQAB 3NBIA 4A3JG 2VUMB 3A54A 4FF4A 1XPRA 1JCKB 5JJIA 1STBA 5C3EB 1WVLA 4PMBA 3B6YA 1PH7A 1TU2B 5TSSA 4DV1Q 2L4NA 1RKNA 2WAQE 4O1NA 5J22A 1SAPA 1PHJA 1HH2P 4EGVA 2B63G 4A3BH 4NXML 1X54A 1UE7A 2OF1A 5GAHC 4U68A 2CKZB 2SNMA 2B2VA 1HNWQ 3VYUA 2RVLA 1JE4A 1RJTA 4OIKA 3W5OA 5JAVA 3GDEA 3PIP3 3T4AC 1PH8A 2ZXPA 1MJEA 1SMYC 1WFQA 2LY7A 2RSOA 4DR6Q 3MWYW 4IFDJ 1IBML 2X69A 4RFBA 3KJPA 1M8AA 3Q22A 3OSOA 3L3OC 1D8LA 1I94L 2NVXB 3Q23A 2L11A 2PNRC 3TN2A 3VA5A 4HIMA 4JI3Q 2CWPA 2FINB 4CJ2C 4XTCS 1MI2A 5EPJA 2C5CA 1JWMD 3K7AB 3CCEA 1SJED 4TRDA 2ZXOA 2JA6B 3I4OA 1EQRA 3D4RA 3MC0B 3NTIA 4NPSA 4HN7A 1A2TA 1JORA 3A74A 3S17H 2HCCA 2B8GA 4A3FH 3M3YB 4GS3A 3BZKA 1MSHA 2GVAA 1I50B 5DLQE 1UEBA 3I91A 1SJHD 4LF6L 1G291 3KBGA 1V1QA 1O7ZA 3URYA 1I4HA 5DNFA 3NP8A 4FXKC 2WP8J 1X3GA 4POFA 1XNQQ 1U5KA 1Y69U 1MJCA 4A3GG 3J80i 5CV5A 3CHBD 5LMNW 4LFAQ 1STEA 4LUOA 4AYBG 4YIJA 5C3XA 4BXXH 2NBFA 5F2DA 3I4NG 2DY7A 2PCFB 2VB2X 4QIWB 1TWGH 1BF4A 2KENA 3T1YQ 1GUGA 1VQ9A 3PUYA 2AKWB 1TXYA 3K6OA 3D8GA 1IYUA 1NTGA 1SYGA 1EUJA 4LAAA 3R8BA 4G7HC 1UE6A 2D0PA 2L12A 2JA9A 5C4XH 4ZRZA 4GLVB 1TQOA 5HURA 1B70B 4CDFC 4A3EB 1GUOA 2K5QA 4A3DB 4BY1H 3FRPB 5IY0A 2EJGC 5GADC 1I3QH 1SYDA 4C3JG 3HOZG 3HS0C 4DV7Q 5JJKA 1K83H 3J81E 4L5RC 1A0IA 2GN5A 4IUPA 5D3IB 4DV4L 3T51B 4DFAA 5JPMC 4BY7H 5DM63 1YIJA 1IBKQ 4DV0Q 1TIID 1TWAH 1Y1VG 3IFTA 4IUUA 4AIMA 1K8AC 1IKLA 4KI0A 4JOIC 4IPDA 2ZT9C 4GZYC 4JCVE 2JK8A 3CC2A 2IWHA 1DM0B 1V9PA 5ISRA 2I07B 4YCWA 4P2CB 5M5XB 1M1KC 4DGZA 1MSGA 3O13A 4IUQA 3FHWA 4CBVA 5FLMG 1WYDA 3QB3A 2V1CC 4KKUA 4KV6A 4X3SA 1Q3LA 2VQEL 3PF5A 4DR1Q 4A76A 3JAMc 3I4MB 1VF7A 1N32L 4XXEA 1MD2D 5HGTA 4GOPA 4A75A 1B8AA 2UUBL 3NBHB 3PSIA 4UP8A 2O4XA 1YITA 2E75C 5IT9c 1EU3A 5ELNA 3T56B 4JBJA 1ZXTA 2R93G 5LL6S 2DJGC 4K6LA 3H3VH 1OXSC 4JBWA 1HUNA 3Q0AA 1Y8PB 4A3KH 4AQYL 4ALPA 1TS5A 4B9WA 4AYBE 1SFOH 4B3MQ 2F4VL 2E2JH 2LXJA 4L5TA 3X3NA 3CRLC 2VZAA 3KOJA 1BBWA 5C5MA 4BWGB 4X62Q 5EGTA 1CHQD 4L63B 2ZM6Q 5CMDA 2F0UA 3OW7A 1G6PA 5IYCG 2QF7A 3NENA 4GKJL 2PZTA 1IL2A 2RHQB 5HY6A 4FF3A 2R7DA 3I4NB 3F1ZA 4PQXA 3BDLA 1LTAD 3DEPA 2A5HA 1X3PA 1F2LA 2AUJD 1SXTA 2ZTEA 4GKKL 3PO3G 1XPOA 3GV3A 5ELBA 4K0KL 4KN4C 1EY4A 4KHVA 2BDOA 1CTMA 2J7ZA 3NQTA 2EOTA 2RBMA 2E8GA 2HQLA 1KNEA 3VYSA 4B9XA 1K9MC 1QUQA 1PH4A 2Y0SB 1FR3A 3KF6A 1FNWA 2I0QA 1WCMH 3CCSA 4DUYQ 2B29A 5C0XG 1JT8A 4JI4L 1AP0A 5CGKA 4P74A 3M7NA 1TWHH 1RDPD 3D3RA 2BH8A 3KLRA 4MHEA 1YNND 4X65Q 4L5SA 3AMUA 3UDXA 3D0FA 1YBYA 3C1EA 2JEAI 1EOTA 3HOZB 5CV7A 1TWFB 4Z9CB 1JJGA 2GVBA 3HKZB 3T13A 3TP8A 1Z47A 5JJLA 1ENAA 1P8LA 4ME5A 4DR2Q 2BH2A 2LKVA 3S2HH 4A93G 5DAUA 1FJGL 4CDCC 1BBXC 5BN5A 2K01A 3KDFA 4MNOA 3TP5A 2AQ1B 2KEEA 4FYDA 1O7LA 2R92H 1Y1WB 1XPUA 1HUMA 4KD4A 4JPBW 4YWMA 2UXDQ 4LK1C 4KY6A 4R4QA 3H0GB 4O2DA 4XYOA 4XQQA 2E2DC 1PMRA 2UU9L 2OTJA 1KAAA 2A1AA 5BR8L 3D6CA 3M4OB 1HJPA 3PIO3 4OONA 4UAIA 2K32A 2PMZE 1Q8IA 2VQFQ 2UUAQ 1YJ9A 3I73A 5K36G 3PQIA 1CZWA 3G6EA 1S5BD 3AB9A 1XNRL 1K0SA 1HNZQ 2UXCQ 5FLXL 3IL8A 4C3IG 4KY5A 3BDCA 2PMZB 1PFMA 2NTSA 1I6HB 3CQZB 1VQ4A 4OO1H 4WJWA 3OTOQ 2I5HA 2YYZA 3CCLA 3DXJC 1CKNB 3ER0A 4NXNQ 2R7ZG 4LJZC 1F9QA 5IGBA 1RTOA 2K75A 1KDAA 2A6HD 3E6ZX 3P75A 1WTVA 2NYZD 1I4XA 5J39A 1QCBD 2K50A 3CCVA 2DNEA 4H02A 4JBMA 3GTKB 4LW1A 4DXGA 3MXUA 4EVOA 2F0MA 1EIGA 3E9IA 1SLJA 3QIAA 1HNXQ 1C0AA 3K59A 3QWNA 2CQOA 2VUMH 1IZ6A 4DF7A 1MGSA 2CFMA 4PG3A 5EJWA 3J81i 1K3RA 3FPPA 4YWKA 5C3EH 5C44G 2EVBA 3F8TA 3U4ZA 4LF9Q 4YHHL 4JI5L 3NWSA 4DNIA 1MIUA 1KQSA 4RCOA 1ASZA 1BVSA 3RLOA 3VYTA 5C6AA 3NTHA 1DJRD 1OXVA 1U9RA 1N33L 1RIPA 2F0SA 1B3QA 4JC0A 1Y8OB 2EYOA 3BU2A 3DHQA 3L7ZC 2M00A 1QOHA 1IW7C 2O5IC 1KLGD 2B2VC 4QL5A 5JPNC 5GAGC 4LFBL 1B4OA 2KECA 2I46A 5LMNL 3FKIB 2K28A 3UE1A 4A93B 4FXDA 1C4QA 2HHHL 5EKLA 1BCPF 4C2MB 1I4PA 4GN4B 2JA8G 1NSNS 1PYSB 4YY3Q 3CC4A 4O0AA 1CHPD 2QILA 2NVXH 3K81C 5M3FG 1X6OA 2PQEA 3WOEA 1AZPA 1L1OA 3H15A 4A3MG 1VQPA 2OWOA 4JYAQ 3I55A 2SNSA 4MTKA 2FXQA 1EY0A 3CXCA 4L8JA 3HGBA 3T16A 1B9NA 2V4DA 1TY2A 3K7AH 1HZBA 4HAEA 4LF7Q 3PUXA 2DY8A 2A68C 2Q8TA 1SBBB 1YVCA 5KIXA 1XMQQ 2JA6H 1CZGA 2PW7A 4JI2L 3EA6A 2Q2HA 1H9KA 5FLXE 1XXGA 3M3YH 1CA5A 1BOSA 3SGIA 1I50H 2IJ0A 4K2LA 4DR6L 2RCFA 1EY8A 1BR9A 1JJCB 3S15B 2NZ1D 4PNYA 5GQOA 5T1GA 1V8QA 1NCVA 1CA6A 4K8JA 1AN8A 4NP5A 1Y14B 3ZJYC 3P20A 3KLWA 4UPAA 1PLFA 4IN3A 2NWGA 4JI3L 1U4LA 1AH9A 2L5TA 3K0XA 2K5NA 4KTAA 3GTLB 2WINB 5BN3A 1QVFA 4BS9A 3F2UA 4UP7A 1HR0L 4DR5Q 1XJVA 2F0JA 3KF8B 2E2IB 1GO3E 3GTOB 1KAWA 3GTQB 3UDFA 1YJWA 1DONA 2PZWA 4QQBX 5ELDA 4DV2Q 2L9HA 1RD9D 4MIUA 2XWJB 5A35A 1T9HA 5C44B 4IUTA 2K05A 3U50C 5KNCA 4A3EH 4A3DH 1EYDA 3HFZB 3PGZA 2K14A 4OIJA 2CHBD 3JAML 3MEFA 5LMUL 2L0CA 5E7NA 1CKMA 3VDYA 2IL8A 1Q1EA 4DR3Q 3M4QA 5M5WB 5ELFA 2E5LL 1CK1A 1DGSA 2I5MX 3HOVG 3FPUB 1IBLL 3GP7A 1P16A 2H1EA 2IW3A 2F3VA 4J1MA 4ZUJA 1PYBA 4IUVA 1JOOA 4TQUS 2QEJC 4BA1I 4BBRG 4B3TQ 5M5XH 1GHJA 2K5WA 2WV6D 3SK5A 1N34L 2F0HA 1RTNA 2G9DA 3G71A 3MXNA 5L37A 2K5DA 2KCMA 3I4MH 3HOYG 3A5ZB 1GKHA 1QWYA 2AUKA 4HMJA 1VQMA 2RDFA 4GOPC 4LF8L 4FVMA 2JN4A 2RKSA 2RDHA 3HOXG 1QILA 2AHOB 1WTRA 3SEBA 3G48A 1JMCA 1R4QB 1EY6A 3QR8A 5JOBA 5IWAL 3RUZA 4V0BA 1E7ZA 4AH6A 3QOLA 2Z0SA 1H9SB 1Z6HA 2HDMA 2UUCQ 3LWUA 1C48A 5CBAE 4JI7Q 4IUNA 5IYBH 2KCTA 3STBC 4JI6Q 3OMCA 2MNAA 3GTGB 1VCIA 2B2YA 5ELOA 1G6ZA 1UAPA 4IO9A 3RNUA 3S1NB 1IXRA 3EFXD 4IJLA 1LT6D 1KD1C 4NW2A 5CC4A 5M3MB 1EFWA 4JBKA 4DK1A 4CJ0B 2JA5G 1D1KA 3NELA 4DAVA 1WI5A 4DK6C 4B08A 1GUSA 1YI2A 3GTJB 3I4NH 3I90A 3CCUA 1K0RA 2FFKB 2YTYA 3OIPA 1JJ2A 2D9UA 4RGMA 3S16B 3CMAA 2F0TA 2MPMA 2N49A 4X6AH 5I6WA 1LM0A 1JOQA 4RA8A 2OT2A 4XQJA 3RN2A 1FGUA 2WFWA 3I2ZA 4JG2A 5IGDA 4LF4L 2BDNA 1IL8A 4IPCA 2ZXRA 4FP5D 1ZKOA 1VQBA 1EYCA 2VNUD 4JV5Q 2WAQB 3E0JA 2ICEC 4A3LG 2BA0A 1IKMA 3GTMB 4XIGS 3HOZH 3JAME 1T5XD 1TWFH 1SE4A 1WD1A 1KHIA 2TMPA 4LUZA 1Z9FA 4TSSA 2WKDA 3KLSA 2X6LA 3OIQA 1LTSD 3PF4A 4RWSC 4YWLA 4GNXA 4B3RQ 1V1PA 2MUYA 1WD0A 5IT9E 1F9PA 1I4RA 1OXTA 3M9BA 1BCPB 4DV3Q 1JR0D 1VQKA 1HCZA 2A69D 2K04A 1A8VA 1Y1WH 3KK7A 1VMPA 2ES2A 2NUCA 2F0IA 2JA7B 4C1NK 1VDZA 3CCJA 3H0GH 3MAQA 4OX9L 2B8FA 4X64Q 2A6EC 1EQQA 3I70A 1KLUD 4DU9A 2X6GA 2VW9A 3M4OH 1CQVA 2IHFA 1VQEA 3GQBA 1FNUA 2WB1G 2SEBD 2QA4A 1LO5D 2HQEA 1Q46A 4X65L 3H94A 1I6VC 4DK3C 1RODA 2AQ3B 2QCPX 2RDGA 1K8GA 1VQJA 1PH5A 1B53A 2AQ2B 2AMCB 3HRZC 1DOKA 1BUVT 1LTBD 2PO4A 1L0XB 1BCPC 1I6HH 3CQZH 1QZGA 3G4SA 1HFNA 2EYMA 1JE5A 1KXLA 4LFCL 1D2BA 4ZCKA 2EJMA 3RMHA 1ILQA 3S1QB 3S1MB 4N9TA 3MZ5A 3TS2A 1SYEA 2JA5B 4A3JB 1PRTC 2Z9HA 1S5FD 3E0EA 4FDBA 4K5XA 1M4VA 4RHRA 1OTCA 1S5DD 4J8QA 3GTKH 4K2KA 5I2YA 1BNZA 4DNTB 5E1FA 3K0YA 4KKTA 2K33A 3CU7A 4PMCA 1EQTA 1STNA 1AZQA 2B63B 1B2TA 2HD3A 1STAA 3U9SA 2CH4W 1VQDA 4JI0L 2D62A 3OTOL 3NK9A 2GA4B 3NPPA 5C0XJ 2KOLA 5JEAJ 4QMGA 2FHTA 4MZ9A 1ET9A 4PV1C 3V2TA 1N36Q 3N52A 2RQXA 5EQ0A 5C4ZA 1AFPA 1WTPA 1HTLD 3TP7A 1BKBA 2E74C 2F0QA 1F77A 1PH3A 3KJOA 1KRSA 4DKAC 4R4IA 1SNDA 2R61A 1CI3M 5AJ3L 1HZAA 1M90C 3FKIH 1O7IA 2F0LA 4A93H 4ME3A 3EJIA 1KRTA 1E2VA 1HNXL 2EDGA 3V96A 4GN5A 3A8IE 1CT1D 1IW7D 4H0LC 1HR0W 1GHKA 3R3OA 4C2MH 3K5OA 2F0GA 2Z6KA 1X3FA 3EN2A 3I8ZA 1VMCA 2WB1E 2AWOA 3F2BA 5M5YB 2B2WA 1VQFA 3ERSX 1PTOC 1KIXA 3OYYA 3TREA 1AEXA 5FJ8H 4DV6L 1XMOQ 1Q81C 4L6TB 5M9OA 1F2ZA 4ZLTF 2RHSB 4JI8L 3UE0A 3QOJA 3A0JA 1YNJD 1O80A 1KDBA 2B2UA 1SNPA 3ERQA 2NVTB 1EEFD 4B3SL 5IGEA 5IOCA 3T1HL 1Y8NB 2F52A 4OWTB 4OXPA 2EY6A 1WJJA 4NXMQ 4UY8C 3H09A 2A68D 4A3GB 4X66L 2D0OA 5LHY1 3S15H 2ASBA 3I4LA 3GO5A 1QNKA 1NR2A 4AYBB 4BXXG 1EY7A 4IFDH 3CRKC 2M2LA 4CDEC 3DM1A 2K4KA 2LMCB 4R4TA 1FNVA 1ICFB 1IYJB 1EWHA 1YEZA 1PH1A 2F0VA 1SNOA 3CW2C 1PZID 3GTLH 2NTTA 4ZK9B 4APVA 3C2PA 4A3CH 4BA2I 4G7OC 3E5SA 3LX0A 5H1SE 2EY1A 1PDQA 1LT3D 1EIFA 2E2IH 1XWEA 5C4XG 3E9HA 4ZYSA 3GTOH 3Q8DA 3GTQH 3JAMi 4WRDA 4LWCA 1VF5C 3A8KE 4C3JB 4DUZQ 1HHVA 1VQGA 1H9MA 1AW7A 2CH4A 4X3TA 5C44H 4DAYB 1MBYA 4OWXB 3S2DB 3NWTA 4A4IA 3SHLA 3R93A 5AFWA 4BY7G 1XX8A 4RKBA 1B1ZA 1JC7A 1Y1VB 2XSCA 2K52A 5IGGA 3M4PA 5M5WH 2PQAA 4HJAA 3GTPB 1PZKD 2L55A 4Q5VA 3A5UA 3NQIA 4POGA 4EQ5A 3EQLC 1PH2A 4DK0A 3UDGA 5GROA 3U9OA 4X3KA 2MHVA 3PV0A 2EYHA 1TR5A 2BE5C 1SDFA 4DR5L 1ONLA 4R9WA 2KHSA 1LTGD 2A74C 1A15A 2D2CC 1DZ1A 5KRUA 1J8IA 2RA4A 4CHTB 2F0OA 3MFYA 5C5LA 4DNRB 2HIVA 1UWVA 4LUVA 4YCUA 2Z4IA 3K80C 2R93B 2QDLA 2RF4A 5D65A 1J5EL 1QZHA 4A3KG 5I6YA 1DOMA 3AFPA 4WJ3M 5G3LF 2HUGA 1S40A 2G5DA 4NMZA 1MHWC 1D1IA 4UDUC 2NVYB 3AYHB 1LUZA 1E3PA 3EIVA 3GTGH 5FO7B 1ESRA 5J1ZA 5DM73 3I7FA 3KUPA 3ONAB 3E3XA 3FDTA 4DV4Q 3AQQA 2ICIA 4DN4M 3S1NH 1OXXK 3RZOB 3STBD 1U0LA 1ZEQX 3D4DA 2OCEA 3IFDA 2DJFC 2JXMB 4QF4A 5M3MH 3PO3B 2F3WA 3PUWA 3AU7A 1KTKA 1NNXA 3GTJH 1X3QA 1S5CD 3BZCA 2QDBA 2OXPA 1DYQA 2Z8LA 2QW7A 1KC8C 4I65A 3L0OA 4M1UB 1HA6A 4OWWB 1WOCA 3HOWG 3S16H 5I9PA 1PH6A 4KHPL 2E2HB 4LF5L 1WTQA 1BBUA 1LABA 2H4OA 2LFNA 1D5XC 5IE8A 1ASYA 1B3AA 2IX3A 2VQEQ 1N32Q 1YHAA 2EE1A 4TVAB 2UUCL 2EPBA 2QEXA 4JI7L 3HG9A 1F2MA 4CKCA 1QVGA 4F7XA 2UUBQ 2IY5B 1PXUA 4HCSA 1EQVA 4DV5L 4H7BA 1V43A 5IP9G 1PFNA 3I56A 1G2TA 2YU9B 1A6XA 2R7FA 3D6WA 1FD7D 2SDFA 1H9JA 3GTMH 1I4GA 2XIWA 5G3LD 4K5VA 4DR4L 1SSOA 5EBCA 1EFID 1YHQA 2R92G 1GXDC 1SYBA 2ZTCA 5CYUA 1SMYD 2F4VQ 1TS4A 1HQRD 2R3ZA 2FMCA 4GNXC 3K5LA 1ENCA 2EQSA 4I7ZC 4DV1L 4GKJQ 4ID6A 2JA7H 1STGA 3OMGA 2PW5A 5IP7H 3ICEA 1LTRD 3J7AV 1PRTF 3V05A 2F0WA 4F8MA 1G91A 4JK1C 4GKKQ 1HNWL 3DWPA 4K0KQ 2UXBQ 1LTID 3D31A 2Z1CA 1K8OA 4OEMB 4JV5L 3RD4A 1K3BC 1LTLA 2J0TD 4BBSG 4X3UA 5JEAG 4C3IB 2CQAA 2A6ED 3J7AF 1Q1BA 4JI4Q 1FYCA 2F0EA 5IYDH 4DR7Q 4B3RL 2R7ZB 2EYPA 3R2IA 4KY7A 2YTVA 3Q24A 2ALYB 3J7ZC 1X32A 2DN8A 4N8FA 2NN6H 2MO1A 4KJOA 1Z7TA 4ABNA 5ELCA 1BCPD 1S5ED 3NBHA 4UHVA 3S1QH 3S1MH 1TWCB 1FJGQ 3OHXC 4Y7NB 4J15A 2JA5H 3EROA 4A3JH 1UNSA 1IHZA 2JE6I 5EAYA 2N8NA 3PMFA 2CVRA 1E2WA 1HZCA 5C3EG 1GD7A 3H3VC 2BCOA 1O78A 1LV9A 3HOWB 2ATWA 4HJ8A 3LGJA 1NY4A 3P1HA 2DUDA 1PTOF 2UU9Q 1PRTD 3DEOA 3W2DA 4GOPB 1XNQL 2B63H 3MVVA 3KYHC 1NR4A 3H3VI 3FMCA 2BA1A 1EIHA 4LFAL 5E4XA 1EL0A 3WDNA 1YNXA 1EEID 4HJ7A 3GV6A 5IODA 3T1YL 4DPGA 1CSPA 1VQ6A 3HOUG 1ENFA 3I3CA 1D5MC 4WJ4A 4HMIA 2PPBC 1X55A 2L1BA 2KCNA 3DWAA 3FP9A 4F87A 2JP1A 1EY5A 2JA8B 1XYIA 1I5FA 1B7YB 2YTXA 4G57A 3TMEA 5M3FB 3T53B 2KCCA 5E3FA 2PYKA 2MO0A 2QGQA 3VR4A 4A3MB 3MXPA 4KD3A 3HEJA 1YJNA 5M5YH 2CW0C 2Z6KC 4DV7L 1TY0A 1EZ6A 3LNNA 1VQOA 2B2WC 2H5XA 5I9OA 4IQZA 1ESFA 2JA6G 1EY9A 4ZAIA 4RHSA 4P72A 3ITPA 1SEBD 1IBKL 1QUQB 4DV0L 1GOZA 3KF6B 2HIXA 1STHA 4QGUA 3K58A 3C3LA 2K03A 3FVQA 4L5QA 1KDCA 3VR6A 1PTOD 4KJNA 4O42A 4BBSB 3NE5B 3ULLA 1SNMA 4YHHQ 2NVTH 1NUCA 4JI5Q 2B2UC 4NKLA 1ILPA 1E1OA 5C4JB 1R9TB 4K5WA 2A8VA 1N33Q 3BZDB 2IX1A 4H13C 1HA5A 4A3GH 3F2DA 4ZQ3A 4PZ8A 4DR1L 4ODGA 1II3A 1ICWA 3TSSA 1WTHA 4KLKA 1VQNA 3K8AA 3M85A 3MEHA 4LFBQ 4JI1Q 4DXFA 4EQNA 3TQYA 4A3IG 5IGCA 3OWEB 5LMNQ 3EVQA 2B39A 3KDFB 1F9SA 2Q2IA 2F0PA 1E0BA 2HHHQ 4RCNA 1VS0A 4S3SA 4C3HG 3N6RA 3MA2B 1EU4A 4RGOS 4CGYB 3BVMA 4P73A 4ZUIA 4B3ML 4A3EG 4PMWA 5COYA 4A3DG 1CKNA 1G8ZD 1E1TA 1L2FA 3A7AB 5BN4A 4C3JH 3WWVA 2KA7A 3RR5A 4X62L 3J80c 4EQOA 2ZM6L 1S3OA 5I4DA 4GLXA 1FVIA 3RLFA 3J81L 3S1RB 1HZ9A 3S2DH 4QCLA 4JI2Q 4OO1I 3HOVB 1Y1VH 2LXKA 4XYQA 2ENBA 2ZTDA 3SR1A 3HOUB 2WACA 3DLLA 3GTPH 3OW2A 3SXHA 3BVGA 5KYLA 4BBRB 2A73B 5FLMH 4Y52H 3L2PA 4DUYL 1SN8A 1H9RA 4R8IA 5C3WA 3NTKA 2F0DA 5C4HA 1PRTB 2KBNA 4ZKCB 3I4MG 3HOYB 2CWAA 3VA7A 2NZHA 1PH9A 3HOXB 4DUZL 3U4VA 1HR0Q 2BE5D 1CM9A 2XWBB 1RL2A 1V1OA 4QUFA 3TP6A 2R93H 3PO2G 1VQIA 2B3GA 3HZXA 4DR2L 5IYBG 1EIYB 1YHBA 1X56A 2EY2A 2IX0A 2VY3A 1Q90A 5CV6A 3NUCA 1GUTA 4QIWE 2J4XA 4K8IA 2UXDL 2NVYH 2VL6A 3VR2A 1J6QA 2K7VA 3ULPA 4IOAA 3AFQA 3OWFA 5LMUQ 1ET6A 1FGBD 5IYCH 2PI2A 3KBXA 3MFGA 5K5PA 3CC7A 4HJ5A 1PA6A 2E5LQ 2NZOA 2EJFC 4NDXA 3RZOH 1CUKA 1KL9A 1A63A 1IBLQ 3IAYA 1OXUA 2VQFL 1NBWA 4K6DA 3TBIB 2UUAL 3BS1A 4HR7B 3PO3H 4A3IB 2MP1A 1QVCA 3IRBA 1HNZL 3DUZA 5CV9A 3TRZA 1UE1A 2UXCL 5IGFA 2Y0SG 4A3BG 2DNCA 3BYYB 1N34Q 1PTOB 1TT2A 3VR5A 2FMMA 4FO2A 3W1BA 2E2HH 1LTTD 2YV5A 2NVQB 4C3HB 5C0XH 4QY7A 5E4WC 4RAUC 1L1OB 1E2ZA 3DM3A 1ZYRC 4NXNL 1X65A 4HTHA 4LF8Q 2OEOA 1PYWD 3K5MA 1DD2A 1GM5A 3SK4A 2EYJA 2SOBA 5KYIA 4R4CA 3HP3A 5JVG3 4ILWA 3HKZG 3H91A 5IWAQ 2F3IA 2YU9H 4DA2A 1H95A 4IPHA 4OL7A 2N88A 4KK7A 5KEEA 3PUVA 5I2XA 2XRQD 2F1MA 2OTLA 4M8AA 3TZDA 3KF8A 1Y1WG 4IALA 4OHJA 4HEDA 2LSSA 3S24A 2XVSA 2NN6I 1U4PA 1SYCA 3H0GG 2F0KA 4LF9L 1SROA 1EOVA 4FF2A 1D6EC 1L1OC 1JB7A 2BOSA 4KMUC 2F4IA 1GJXA 2IHEA 1R4PB 3GD7A 3S14B 2B2TA 4A3FG 1NAPA 1SR3A 2WB1B 3K57A 2KJXA 4MTNA 3RZDB 5K36H 4IPGA 1F9RA 5GAEC 2JEBI 5KNDA 1JOKA 4R4OA 3L9AX 1NMFA 3CKIB 4HIOA 3PO2B 4C3IH 2EXZA 2XRSD 4LF4Q 4HIDA 2F03A 1VQCA 1S4ZA 5A2QL 1WTXA 1I4QA 1YZ6A 2EIFA 1B50A 2DGYA 2N55A 4YY3L 2R7ZH 3CPWA 5EKIA 3X3MA 3SK8A 1WTOA 1IBMQ 3PUZA 5J3BA 1RHPA 4JYAL 1VQ8A 2TSSA 3TZUA 4FNFA 5CORA 1XTCD 1PZJD 2Z6BA 4LNQA 2Y0SE 3NSWA 1I94Q 4LF7L 1SYFA 1TWCH 2VS1A 3BDOA 4Y7NH 2K5HA 1XMQL 1DCZA 1KABA 2UXBL 4BY1G 1HPCA 1H9SA 2K6AA 2E76C 1Q86C 1S72A 2RCNA 3I72A 3K7UC 1JICA 2I5LX 1K28A 2A19A 1GVPA 4HCEA 4A3BB 3HOWH 2HDLA 2ZJPA 3MXNB 4N8X1 4R1JA 4OX9Q 3TEHB 1Q12A 1C9OA 1QNUA 3HKZE 1FL0A 4H44C 4CDDC 3PIPA 1A3TA 1A2UA 1HRJA 1X9NA 4DR7L 4U673 3UI2A 4LF6Q 5FOBB 4FF1A 1SNCA 1W2BA 2A69C 3WOFA 5IP9H 1K73C 3DWQA 3FKIG 3SDZA 4OGQC 3S9WA 3NEMA 3ND9A 3BJUA 3D4WA 1NMGA 3BYTB 3BG3A 3J81c 2JA8H 1JB3A 1BO0A 4QB4A 4LFCQ 4HJ9A 4DV2L 5M3FH 1EYGA 5FO9B 3A56A 2KEDA 5FO8B 1JWUD 5FJ8G 4A3MH 3U58A 3SE0A 1E24A 2Q8IB 2EYLA 4MN3A 3TS0A 3Q6SA 1J9OA 1LT4D 3SVMA 4R8NA 2IT1A 4E6IA 3S17B 2EY5A 4A3FB 5KNBA 4ZKBB 3CD6A 1STYA 1B44D 4DR3L 1SE2A 4C56C 4DAMA 3W3AA 1N9WA 3OPOA 1JQYD 2CW0D 3PCOB 1LT5D 4BBSH 4CKEA 5JEAH 4JW0A 3CAMA 2B2YC 3A8JE 4B3TL 5A2QE 1SE8A 2M9VA 4JI0Q 1VQLA 4XDXA 5C4JH 1R9TH 4IZ8A 4IFDG 1TWGB 4JVZA 3C46A 1VQAA 4LMQD 1CFMA 2Z4HA 2K5VA 3VR3A 2XGTA 5DEHA 2KQ3A 3J80L 4YCVA 4F88A 2ID0A 1VQHA 2QKIC 2Q2UA 1DXMA 1D5ZC 1V1PB 5AJ3Q 4GNXB 3CCQA 1XTDA 2RSNA 4KKSA 4A3CG 1SRUA 1WCMG 2F0FA 3IKJA 2MQHA 4IJHA 2K1BA 4WFN3 1Q8KA 5C4XB 2O2LD 4HSPA 1LYLA 2VXWA 5KGUA 3RN5A 1W6KA 1PV4A 4JI6L 4EQPA 4BY1B 1I3QB 4PZ6A 4ULLA 5ELEA 1K83B 1PFSA 3P7JA 1BDOA 4OELB 4DV6Q 3MTSA 2JSOA 2EZVA 2Q8RE 4BY7B 4QJFA 4KHZA 4FXGC 1TWAB 4JOIA 4JI8Q 1IYVA 3S1RH 5EPKA 4AQYQ 3HKSA 4RMFA 4XQNA 5IIFA 1U4RA 3HOVH 1F2YA 4B3SQ 4GN3B 3T1HQ 1VQ5A 2XTIA 4JI1L 3DMUA 4J6HA 3HOUH 1HQMC 4X66Q 2PI2E 5EBDA 4BBRH 1Q7YC 5CR3A 5HGQA 1EZ8A 4PZ7A 1BXTA 1RF2D 2G9HD 5LL6X 1A3VA 4CKBA 3MHBA 1B9MA 1LACA 4HIKA 3HOYH 1TVXA 3AEVA 1YNJC 1O7YA 4QUCA 1SMXA 1A3UA 2OQKA 4HSVA 3HOXH 1L0YB 2O5JC 2HT1A 1TS2A 4OO1G 2WKCA 4A3KB 1EYAA 5CBEE 3UDIA 1SFOB 1HFGA 5JVH3 2E2JB 3M7GA 5C0XI 4DV3L 1AE3A 2VB3X 3NXWA 1A62A 3ND8A 5CV8A 4RGNA 4DAPA 3RLNA 2KUMA 4RGTA 2L15A 3KLSX 2KHIA 3R2TA 2PZUA 3A7LA 3MXGA 2ZJQA 1QJOA 1SNQA 3TDQA 2FJ2A 5M3MG 4X64L 2KHJA 2VUMG 5JJZA 5EPLA 1AE2A 2C35B 2MFIA 5FKAC 3CMEA 2R6GA 1G2SA 3J80E 2Q2TA 3A55A 1C7YA 3G7LA 1EWIA 1YNNC 1NE3A 1LLRD 1SE3A 4A3IH 4RH6A 4WORA 1WCMB 1UUPA 5D14A 1N8RC 1EWCA 1OO9B 4GLAC 5BR8Q 3G6JB 1RCVD 2JQOA 3CP0A 1TWHB 1Q82C 2JJQA 1CSQA 1PTOH 5CV4A 3CCRA 5D3DA 3NHHA 4EX5A 2NVQH 4C3HH 4XT1B 2XNAC 1T5EA 2F0NA 2JYOA 3QG1A 4RG1A 1XNRQ 3J81j 1UEAB 2WAQG 4RKLA 3KFUA 4A3LH 2N3SA 1TKWB 4IURA 4UP9A 4V190 3S2HB 1J5EQ 2NB0A 1GUWA 2HCIA 1TS3A 2IPKD 3LWEA 4C1NI 2LS01 2R92B 3M4YA 3ZYYX 1QG7A 1ZYRD 3H6MA 2OQ0A 3QO2A 1K8MA 1L0WA 2P5ZX 4I7AA 5IT9L 4IFDI 1DOLA 1C8CA 2AWNA 5FK9C 1QE6A 1W6JA 2XN9C 4CJ1B 3K5NA 2MJ8A 3JC66 1CQFA 1X3EA 3PIOA 2JA7G 1G51A 3BVZA 3OOCA 5NUCA 5IP7G 3CPFA 1NJIC 4XT3B 4G7ZC 5T1IA 2C9OA 2WIIB 3W1GA 3QJYA 4DAYA 3J7A5 2N78A 4K14A 2PNHA 1CKOA 3S14H 1U4MA 1HXYD 1PFBA 1ML0D 1N36L 2B2TC 3RZDH 1HTPA
chains in the Genus database with same CATH topology
1E22A 5C44H 3RZOH 1CUKA 1KL9A 4GN4B 4KHPQ 4DAYB 1IBLQ 1PYSB 4LF5Q 4YY3Q 3CC4A 2JA8G 1OXUA 4O0AA 1NBWA 4OWXB 2VQFL 4A4IA 2NVXH 2UUAL 2CCZA 3K81C 5M3FG 1X6OA 3EBEA 4P75A 3PO3H 4BY7G 1QVCA 3PO2H 5IYDG 3CCMA 3IRBA 1L1OA 3H15A 4A3MG 1VQPA 2OWOA 4JYAQ 3I55A 1HNZL 1D7QA 2FXQA 2UXCL 3TRZA 1UE1A 2K52A 3CXCA 2Y0SG 4A3BG 3M4PA 5M5WH 2NN6G 3CF5A 2PQAA 3K7AH 3F2CA 1HZBA 4DV5Q 1UE5A 3A5UA 4HJAA 4POGA 4LF7Q 3W1BA 4EQ5A 3PUXA 2EXDA 2YV5A 1PH2A 2E2HH 1PVOA 3UDGA 1YVCA 4NB3A 5GROA 1XMQQ 2JA6H 4QY7A 1L1OB 4JI2L 3ULJA 4IOCA 3DM3A 3PV0A 2Q2HA 4P71A 1VQ7A 2ZJRA 4DR4Q 4NXNL 1X65A 4DR5L 1XMOL 5FLXc 1MKHA 2PQAB 1W3SA 4LF8Q 3M3YH 3SGIA 1I50H 4A3JG 1GM5A 4DR6L 1XPRA 1JJCB 4R4CA 5JJIA 5GQOA 3HKZG 5IWAQ 2YU9H 2F3IA 3B6YA 2HIVA 1PH7A 1UWVA 4LUVA 4YCUA 1H95A 4IPHA 3K80C 4DV1Q 1Y14B 3ZJYC 3PUVA 2WAQE 3KLWA 4UPAA 1PHJA 2OTLA 1HH2P 2RF4A 2B63G 4A3BH 4NXML 1X54A 1UE7A 1Y1WG 5GAHC 4JI3L 1J5EL 1AH9A 2CKZB 1QZHA 2LSSA 2K5NA 3K0XA 3S24A 4A3KG 1QVFA 1HNWQ 3AFPA 2NN6I 4WJ3M 4UP7A 3H0GG 1S40A 3W5OA 1HR0L 4DR5Q 4LF9L 3GDEA 1PH8A 1XJVA 1SROA 1EOVA 1MJEA 1L1OC 3KF8B 1JB7A 1GO3E 1WFQA 3AYHB 1LUZA 2IHEA 4DR6Q 1KAWA 1E3PA 3EIVA 3GD7A 3UDFA 3GTGH 1YJWA 4A3FG 1IBML 4IFDJ 1SR3A 3I7FA 4QQBX 3KJPA 4DV4Q 4DV2Q 3AQQA 4MTNA 1D8LA 4IPGA 3S1NH 1OXXK 1T9HA 3STBD 5GAEC 2JEBI 1U0LA 3U50C 4A3EH 1I94L 2OCEA 5M3MH 4A3DH 3HFZB 4R4OA 4HIMA 3PGZA 3PUWA 1NMFA 2K14A 4HIOA 4C3IH 3GTJH 4JI3Q 3BZCA 3MEFA 4LF4Q 1KC8C 4HIDA 5LMUL 3L0OA 2CWPA 5E7NA 1VQCA 1CKMA 3VDYA 4XTCS 4OWWB 1WOCA 1Q1EA 4DR3Q 3M4QA 2E5LL 1YZ6A 3HOWG 3S16H 3CCEA 1DGSA 1PH6A 2EIFA 2I5MX 4KHPL 3HOVG 2DGYA 1IBLL 4LF5L 4YY3L 2R7ZH 1BBUA 3CPWA 1P16A 3I4OA 1EQRA 5IE8A 1ASYA 2VQEQ 4NPSA 1N32Q 1PYBA 1IBMQ 3PUZA 1YHAA 3A74A 3S17H 4TVAB 5J3BA 4TQUS 2QEXA 4BA1I 1VQ8A 2UUCL 4JI7L 4JYAL 4A3FH 4BBRG 4GS3A 1QVGA 4B3TQ 3BZKA 2GVAA 5M5XH 2UUBQ 5DLQE 1UEBA 2IY5B 1N34L 4LF6L 1G291 2Y0SE 4DV5L 4LNQA 1V1QA 1V43A 1I94Q 5IP9G 4LF7L 3G71A 3I56A 1TWCH 2VS1A 4Y7NH 2K5HA 2R7FA 1XMQL 2WP8J 1X3GA 4POFA 2KCMA 1XNQQ 3GTMH 3I4MH 1U5KA 3HOYG 1MJCA 1GKHA 3A5ZB 4BY1G 1VQMA 4A3GG 4DR4L 2UXBL 3J80i 1Q86C 1S72A 4GOPC 2RCNA 3K7UC 5LMNW 4LF8L 2I5LX 4LFAQ 3HOXG 4LUOA 1YHQA 2R92G 2A19A 4AYBG 1GVPA 4BXXH 2ZTCA 3HOWH 3I4NG 2ZJPA 3MXNB 1TWGH 4R1JA 4OX9Q 2AHOB 3TEHB 2F4VQ 2KENA 3G48A 1Q12A 1C9OA 4GNXC 3T1YQ 1JMCA 5IWAL 1E7ZA 4AH6A 1VQ9A 3PUYA 3HKZE 2Z0SA 1FL0A 2EQSA 3PIPA 2AKWB 2UUCQ 1TXYA 4JI7Q 5IYBH 2KCTA 3STBC 4DV1L 1X9NA 4JI6Q 4DR7L 2MNAA 4GKJQ 2JA7H 4LF6Q 1NTGA 5IP7H 1VCIA 3ICEA 1W2BA 1EUJA 5IP9H 5ELOA 1K73C 1UE6A 2D0PA 4GKKQ 4IO9A 1HNWL 3RNUA 2JA9A 1IXRA 4K0KQ 5C4XH 3FKIG 4IJLA 2UXBQ 1KD1C 3D31A 4GLVB 1B70B 3NEMA 1EFWA 3BJUA 5IY0A 4BY1H 4JBKA 5GADC 4JV5L 2JA5G 1I3QH 1LTLA 4BBSG 3NELA 3HOZG 4DV7Q 1NMGA 1WI5A 5JEAG 4DK6C 3J81c 1YI2A 1K83H 5JJKA 4L5RC 1A0IA 2GN5A 2JA8H 3I4NH 3CCUA 4DV4L 1Q1BA 1K0RA 4DV2L 4HJ9A 4JI4Q 2YTYA 4LFCQ 1JJ2A 5M3FH 1EYGA 4BY7H 3CMAA 1YIJA 1IBKQ 5IYDH 4DR7Q 5FJ8G 4DV0Q 4B3RL 2N49A 1TWAH 1Y1VG 4A3MH 4X6AH 2YTVA 1LM0A 2ALYB 3J7ZC 4AIMA 1E24A 3TS0A 3U58A 1K8AC 4KI0A 4JOIC 3RN2A 1FGUA 2WFWA 3I2ZA 4IPDA 4JG2A 2IT1A 4JCVE 2JK8A 2MO1A 3CC2A 1V9PA 4LF4L 4IPCA 4YCWA 1M1KC 3CD6A 3FHWA 5FLMG 4DR3L 1VQBA 4DAMA 1WYDA 1N9WA 3S1QH 3S1MH 1FJGQ 2VNUD 2V1CC 4JV5Q 4A3LG 4J15A 3PCOB 2BA0A 2JA5H 2VQEL 4A3JH 4DR1Q 4XIGS 3JAMc 4A76A 3PF5A 3HOZH 4BBSH 1TWFH 1N32L 1A63A 4GOPA 4A75A 2JE6I 1KHIA 5EAYA 2N8NA 4LUZA 3CAMA 1Z9FA 1B8AA 1HZCA 2UUBL 5C3EG 1GD7A 3NBHB 1SE8A 3PSIA 4B3TL 4UP8A 4JI0Q 3PF4A 1VQLA 1YITA 4YWLA 5C4JH 1R9TH 4HJ8A 3LGJA 4GNXA 2ATWA 4IFDG 4B3RQ 1NY4A 5IT9c 2DUDA 1OXTA 3M9BA 5ELNA 2UU9Q 1VQAA 4DV3Q 4JBJA 2R93G 4GOPB 1VQKA 2K5VA 3H3VH 1XNQL 2XGTA 2B63H 1OXSC 4JBWA 1A8VA 4YCVA 1Y1WH 3KYHC 2ID0A 2ES2A 3H3VI 1VQHA 2Q2UA 4GNXB 2BA1A 5AJ3Q 4A3KH 4LFAL 3CCQA 1XTDA 4AQYL 3CCJA 4ALPA 4A3CG 1SRUA 1WCMG 3H0GH 4AYBE 2MQHA 1SFOH 4IJHA 4B3MQ 4OX9L 2E2JH 1YNXA 2F4VL 4X64Q 2LXJA 4L5TA 4HJ7A 1EQQA 3T1YL 4DPGA 1CSPA 1VQ6A 2VZAA 1Q8KA 3KOJA 2VW9A 3HOUG 1BBWA 4X62Q 3M4OH 2ZM6Q 1LYLA 3RN5A 2IHFA 4WJ4A 1VQEA 2WB1G 1PV4A 4JI6L 1G6PA 5IYCG 2QA4A 1X55A 3NENA 4GKJL 1Q46A 4X65L 4PZ6A 1IL2A 2RHQB 3FP9A 5HY6A 4DK3C 1PFSA 2R7DA 1I5FA 3F1ZA 1B7YB 4DV6Q 2YTXA 1VQJA 1PH5A 1K8GA 2ZTEA 4GKKL 3PO3G 1XPOA 2AMCB 4QJFA 4KHZA 4K0KL 2MO0A 2QGQA 4JOIA 2E8GA 2HQLA 4JI8Q 1I6HH 1K9MC 1YJNA 3CQZH 1QUQA 5M5YH 4AQYQ 3S1RH 1QZGA 1PH4A 3G4SA 2Z6KC 4DV7L 3KF6A 3HKSA 1VQOA 2I0QA 2H5XA 4RMFA 1JE5A 1WCMH 3HOVH 1KXLA 3CCSA 4DUYQ 4B3SQ 2JA6G 2B29A 4GN3B 4LFCL 5C0XG 3T1HQ 1VQ5A 4JI4L 1JT8A 3M7NA 2XTIA 4P74A 4JI1L 4P72A 1TWHH 3HOUH 2BH8A 1IBKL 1QUQB 4DV0L 4X66Q 2PI2E 3KF6B 2HIXA 4QGUA 4X65Q 4L5SA 3UDXA 4L5QA 4BBRH 3D0FA 1Q7YC 3TS2A 1YBYA 5HGQA 2JEAI 4FDBA 3E0EA 1OTCA 3ULLA 3GTKH 4PZ7A 1JJGA 2GVBA 4YHHQ 2NVTH 4JI5Q 1Z47A 5JJLA 1E1OA 1P8LA 2BH2A 4DR2Q 4HIKA 1N33Q 2A8VA 3S2HH 4A93G 2IX1A 3HOYH 3AEVA 1FJGL 4A3GH 3F2DA 3KDFA 1SMXA 4MNOA 2OQKA 4PZ8A 3HOXH 2R92H 4DR1L 4KLKA 1VQNA 2HT1A 3K8AA 1XPUA 4OO1G 3M85A 4LFBQ 4JI1Q 4YWMA 2UXDQ 3TQYA 4A3IG 1VQDA 5LMNQ 4JI0L 2D62A 3OTOL 3UDIA 4R4QA 5C0XJ 3KDFB 4O2DA 5JEAJ 2Q2IA 4MZ9A 5C0XI 1N36Q 2UU9L 2HHHQ 2OTJA 2A1AA 4DV3L 5BR8L 1HJPA 1BKBA 4OONA 1AE3A 1VS0A 3KJOA 1PH3A 1KRSA 4DKAC 2PMZE 1A62A 4R4IA 2VQFQ 2UUAQ 3RLNA 1YJ9A 5AJ3L 1HZAA 2L15A 2KHIA 5K36G 4P73A 3G6EA 1M90C 3FKIH 1O7IA 1XNRL 2ZJQA 4B3ML 4A93H 4ME3A 4A3EG 5M3MG 4PMWA 1HNZQ 4X64L 2KHJA 1KRTA 1CKNA 1HNXL 4A3DG 1L2FA 1E1TA 4GN5A 2UXCQ 2VUMG 4C3JH 3WWVA 1AE2A 2C35B 2MFIA 1HR0W 3CMEA 3RR5A 4X62L 2R6GA 3J80c 2ZM6L 4C2MH 1N34Q 1S3OA 2Q2TA 4GLXA 1FVIA 3RLFA 2Z6KA 1X3FA 3EN2A 1C7YA 1EWIA 1HZ9A 2WB1E 2AWOA 3F2BA 1VQ4A 3S2DH 3OTOQ 1VQFA 1NE3A 3ERSX 4JI2Q 2I5HA 2YYZA 3CCLA 4A3IH 1KIXA 1CKNB 3OYYA 3TREA 2E5LQ 4OO1I 3ER0A 5FJ8H 4NXNQ 4DV6L 1N8RC 2R7ZG 1Y1VH 1XMOQ 4GLAC 5BR8Q 1Q81C 2LXKA 2JQOA 3CP0A 2ZTDA 1Q82C 2JJQA 2K75A 1CSQA 3DLLA 3CCRA 3GTPH 4EX5A 3OW2A 2NVQH 2RHSB 4JI8L 3UE0A 4C3HH 2K50A 3CCVA 4RG1A 3A0JA 4H02A 5FLMH 4JBMA 1XNRQ 4LW1A 3J81j 4Y52H 3L2PA 3E9IA 1HNXQ 1SLJA 2WAQG 4DUYL 1C0AA 1SN8A 4B3SL 3KFUA 3T1HL 2F52A 2N3SA 4OWTB 4OXPA 4A3LH 2CQOA 2VUMH 4UP9A 2KBNA 1WJJA 3I4MG 1IZ6A 4NXMQ 2CWAA 4UY8C 2CFMA 1J5EQ 4PG3A 3J81i 4X66L 2D0OA 2NZHA 1K3RA 3S15H 2ASBA 1PH9A 3GO5A 4YWKA 5C3EH 4DUZL 5C44G 4BXXG 3F8TA 3U4VA 3U4ZA 1HR0Q 4LF9Q 2OQ0A 1RL2A 4YHHL 4JI5L 2K4KA 4R4TA 1L0WA 4DNIA 1MIUA 1KQSA 1ASZA 4IFDI 1BVSA 1IYJB 3RLOA 1YEZA 3PO2G 2R93H 1VQIA 2B3GA 1OXVA 3CW2C 4DR2L 1PH1A 2AWNA 5IYBG 1N33L 1RIPA 4JC0A 1EIYB 3JC66 3BU2A 3GTLH 1YHBA 1X3EA 3L7ZC 3PIOA 1PA6A 2JA7G 1G51A 1X56A 4APVA 5IP7G 3CPFA 4HJ5A 2IX0A 1NJIC 2VY3A 4BA2I 5H1SE 4A3CH 4QL5A 4QIWE 1EIFA 3W1GA 5GAGC 4LFBL 2E2IH 2UXDL 2NVYH 2N78A 5LMNL 3J7A5 5C4XG 3E9HA 2VL6A 3GTOH 3Q8DA 1J6QA 3GTQH 2PNHA 1CKOA 3UE1A 3ULPA 3S14H 3AFQA 3JAMi 4IOAA 5LMUQ 5IYCH 2PI2A 4LWCA 1N36L 2HHHL 4DUZQ 3CC7A 1VQGA 3RZDH 2NZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E22 A;  5C44 H;  3RZO H;  1CUK A;  1KL9 A;  4GN4 B;  4KHP Q;  4DAY B;  1IBL Q;  1PYS B;  4LF5 Q;  4YY3 Q;  3CC4 A;  2JA8 G;  1OXU A;  4O0A A;  1NBW A;  4OWX B;  2VQF L;  4A4I A;  2NVX H;  2UUA L;  2CCZ A;  3K81 C;  5M3F G;  1X6O A;  3EBE A;  4P75 A;  3PO3 H;  4BY7 G;  1QVC A;  3PO2 H;  5IYD G;  3CCM A;  3IRB A;  1L1O A;  3H15 A;  4A3M G;  1VQP A;  2OWO A;  4JYA Q;  3I55 A;  1HNZ L;  1D7Q A;  2FXQ A;  2UXC L;  3TRZ A;  1UE1 A;  2K52 A;  3CXC A;  2Y0S G;  4A3B G;  3M4P A;  5M5W H;  2NN6 G;  3CF5 A;  2PQA A;  3K7A H;  3F2C A;  1HZB A;  4DV5 Q;  1UE5 A;  3A5U A;  4HJA A;  4POG A;  4LF7 Q;  3W1B A;  4EQ5 A;  3PUX A;  2EXD A;  2YV5 A;  1PH2 A;  2E2H H;  1PVO A;  3UDG A;  1YVC A;  4NB3 A;  5GRO A;  1XMQ Q;  2JA6 H;  4QY7 A;  1L1O B;  4JI2 L;  3ULJ A;  4IOC A;  3DM3 A;  3PV0 A;  2Q2H A;  4P71 A;  1VQ7 A;  2ZJR A;  4DR4 Q;  4NXN L;  1X65 A;  4DR5 L;  1XMO L;  5FLX c;  1MKH A;  2PQA B;  1W3S A;  4LF8 Q;  3M3Y H;  3SGI A;  1I50 H;  4A3J G;  1GM5 A;  4DR6 L;  1XPR A;  1JJC B;  4R4C A;  5JJI A;  5GQO A;  3HKZ G;  5IWA Q;  2YU9 H;  2F3I A;  3B6Y A;  2HIV A;  1PH7 A;  1UWV A;  4LUV A;  4YCU A;  1H95 A;  4IPH A;  3K80 C;  4DV1 Q;  1Y14 B;  3ZJY C;  3PUV A;  2WAQ E;  3KLW A;  4UPA A;  1PHJ A;  2OTL A;  1HH2 P;  2RF4 A;  2B63 G;  4A3B H;  4NXM L;  1X54 A;  1UE7 A;  1Y1W G;  5GAH C;  4JI3 L;  1J5E L;  1AH9 A;  2CKZ B;  1QZH A;  2LSS A;  2K5N A;  3K0X A;  3S24 A;  4A3K G;  1QVF A;  1HNW Q;  3AFP A;  2NN6 I;  4WJ3 M;  4UP7 A;  3H0G G;  1S40 A;  3W5O A;  1HR0 L;  4DR5 Q;  4LF9 L;  3GDE A;  1PH8 A;  1XJV A;  1SRO A;  1EOV A;  1MJE A;  1L1O C;  3KF8 B;  1JB7 A;  1GO3 E;  1WFQ A;  3AYH B;  1LUZ A;  2IHE A;  4DR6 Q;  1KAW A;  1E3P A;  3EIV A;  3GD7 A;  3UDF A;  3GTG H;  1YJW A;  4A3F G;  1IBM L;  4IFD J;  1SR3 A;  3I7F A;  4QQB X;  3KJP A;  4DV4 Q;  4DV2 Q;  3AQQ A;  4MTN A;  1D8L A;  4IPG A;  3S1N H;  1OXX K;  1T9H A;  3STB D;  5GAE C;  2JEB I;  1U0L A;  3U50 C;  4A3E H;  1I94 L;  2OCE A;  5M3M H;  4A3D H;  3HFZ B;  4R4O A;  4HIM A;  3PGZ A;  3PUW A;  1NMF A;  2K14 A;  4HIO A;  4C3I H;  3GTJ H;  4JI3 Q;  3BZC A;  3MEF A;  4LF4 Q;  1KC8 C;  4HID A;  5LMU L;  3L0O A;  2CWP A;  5E7N A;  1VQC A;  1CKM A;  3VDY A;  4XTC S;  4OWW B;  1WOC A;  1Q1E A;  4DR3 Q;  3M4Q A;  2E5L L;  1YZ6 A;  3HOW G;  3S16 H;  3CCE A;  1DGS A;  1PH6 A;  2EIF A;  2I5M X;  4KHP L;  3HOV G;  2DGY A;  1IBL L;  4LF5 L;  4YY3 L;  2R7Z H;  1BBU A;  3CPW A;  1P16 A;  3I4O A;  1EQR A;  5IE8 A;  1ASY A;  2VQE Q;  4NPS A;  1N32 Q;  1PYB A;  1IBM Q;  3PUZ A;  1YHA A;  3A74 A;  3S17 H;  4TVA B;  5J3B A;  4TQU S;  2QEX A;  4BA1 I;  1VQ8 A;  2UUC L;  4JI7 L;  4JYA L;  4A3F H;  4BBR G;  4GS3 A;  1QVG A;  4B3T Q;  3BZK A;  2GVA A;  5M5X H;  2UUB Q;  5DLQ E;  1UEB A;  2IY5 B;  1N34 L;  4LF6 L;  1G29 1;  2Y0S E;  4DV5 L;  4LNQ A;  1V1Q A;  1V43 A;  1I94 Q;  5IP9 G;  4LF7 L;  3G71 A;  3I56 A;  1TWC H;  2VS1 A;  4Y7N H;  2K5H A;  2R7F A;  1XMQ L;  2WP8 J;  1X3G A;  4POF A;  2KCM A;  1XNQ Q;  3GTM H;  3I4M H;  1U5K A;  3HOY G;  1MJC A;  1GKH A;  3A5Z B;  4BY1 G;  1VQM A;  4A3G G;  4DR4 L;  2UXB L;  3J80 i;  1Q86 C;  1S72 A;  4GOP C;  2RCN A;  3K7U C;  5LMN W;  4LF8 L;  2I5L X;  4LFA Q;  3HOX G;  4LUO A;  1YHQ A;  2R92 G;  2A19 A;  4AYB G;  1GVP A;  4BXX H;  2ZTC A;  3HOW H;  3I4N G;  2ZJP A;  3MXN B;  1TWG H;  4R1J A;  4OX9 Q;  2AHO B;  3TEH B;  2F4V Q;  2KEN A;  3G48 A;  1Q12 A;  1C9O A;  4GNX C;  3T1Y Q;  1JMC A;  5IWA L;  1E7Z A;  4AH6 A;  1VQ9 A;  3PUY A;  3HKZ E;  2Z0S A;  1FL0 A;  2EQS A;  3PIP A;  2AKW B;  2UUC Q;  1TXY A;  4JI7 Q;  5IYB H;  2KCT A;  3STB C;  4DV1 L;  1X9N A;  4JI6 Q;  4DR7 L;  2MNA A;  4GKJ Q;  2JA7 H;  4LF6 Q;  1NTG A;  5IP7 H;  1VCI A;  3ICE A;  1W2B A;  1EUJ A;  5IP9 H;  5ELO A;  1K73 C;  1UE6 A;  2D0P A;  4GKK Q;  4IO9 A;  1HNW L;  3RNU A;  2JA9 A;  1IXR A;  4K0K Q;  5C4X H;  3FKI G;  4IJL A;  2UXB Q;  1KD1 C;  3D31 A;  4GLV B;  1B70 B;  3NEM A;  1EFW A;  3BJU A;  5IY0 A;  4BY1 H;  4JBK A;  5GAD C;  4JV5 L;  2JA5 G;  1I3Q H;  1LTL A;  4BBS G;  3NEL A;  3HOZ G;  4DV7 Q;  1NMG A;  1WI5 A;  5JEA G;  4DK6 C;  3J81 c;  1YI2 A;  1K83 H;  5JJK A;  4L5R C;  1A0I A;  2GN5 A;  2JA8 H;  3I4N H;  3CCU A;  4DV4 L;  1Q1B A;  1K0R A;  4DV2 L;  4HJ9 A;  4JI4 Q;  2YTY A;  4LFC Q;  1JJ2 A;  5M3F H;  1EYG A;  4BY7 H;  3CMA A;  1YIJ A;  1IBK Q;  5IYD H;  4DR7 Q;  5FJ8 G;  4DV0 Q;  4B3R L;  2N49 A;  1TWA H;  1Y1V G;  4A3M H;  4X6A H;  2YTV A;  1LM0 A;  2ALY B;  3J7Z C;  4AIM A;  1E24 A;  3TS0 A;  3U58 A;  1K8A C;  4KI0 A;  4JOI C;  3RN2 A;  1FGU A;  2WFW A;  3I2Z A;  4IPD A;  4JG2 A;  2IT1 A;  4JCV E;  2JK8 A;  2MO1 A;  3CC2 A;  1V9P A;  4LF4 L;  4IPC A;  4YCW A;  1M1K C;  3CD6 A;  3FHW A;  5FLM G;  4DR3 L;  1VQB A;  4DAM A;  1WYD A;  1N9W A;  3S1Q H;  3S1M H;  1FJG Q;  2VNU D;  2V1C C;  4JV5 Q;  4A3L G;  4J15 A;  3PCO B;  2BA0 A;  2JA5 H;  2VQE L;  4A3J H;  4DR1 Q;  4XIG S;  3JAM c;  4A76 A;  3PF5 A;  3HOZ H;  4BBS H;  1TWF H;  1N32 L;  1A63 A;  4GOP A;  4A75 A;  2JE6 I;  1KHI A;  5EAY A;  2N8N A;  4LUZ A;  3CAM A;  1Z9F A;  1B8A A;  1HZC A;  2UUB L;  5C3E G;  1GD7 A;  3NBH B;  1SE8 A;  3PSI A;  4B3T L;  4UP8 A;  4JI0 Q;  3PF4 A;  1VQL A;  1YIT A;  4YWL A;  5C4J H;  1R9T H;  4HJ8 A;  3LGJ A;  4GNX A;  2ATW A;  4IFD G;  4B3R Q;  1NY4 A;  5IT9 c;  2DUD A;  1OXT A;  3M9B A;  5ELN A;  2UU9 Q;  1VQA A;  4DV3 Q;  4JBJ A;  2R93 G;  4GOP B;  1VQK A;  2K5V A;  3H3V H;  1XNQ L;  2XGT A;  2B63 H;  1OXS C;  4JBW A;  1A8V A;  4YCV A;  1Y1W H;  3KYH C;  2ID0 A;  2ES2 A;  3H3V I;  1VQH A;  2Q2U A;  4GNX B;  2BA1 A;  5AJ3 Q;  4A3K H;  4LFA L;  3CCQ A;  1XTD A;  4AQY L;  3CCJ A;  4ALP A;  4A3C G;  1SRU A;  1WCM G;  3H0G H;  4AYB E;  2MQH A;  1SFO H;  4IJH A;  4B3M Q;  4OX9 L;  2E2J H;  1YNX A;  2F4V L;  4X64 Q;  2LXJ A;  4L5T A;  4HJ7 A;  1EQQ A;  3T1Y L;  4DPG A;  1CSP A;  1VQ6 A;  2VZA A;  1Q8K A;  3KOJ A;  2VW9 A;  3HOU G;  1BBW A;  4X62 Q;  3M4O H;  2ZM6 Q;  1LYL A;  3RN5 A;  2IHF A;  4WJ4 A;  1VQE A;  2WB1 G;  1PV4 A;  4JI6 L;  1G6P A;  5IYC G;  2QA4 A;  1X55 A;  3NEN A;  4GKJ L;  1Q46 A;  4X65 L;  4PZ6 A;  1IL2 A;  2RHQ B;  3FP9 A;  5HY6 A;  4DK3 C;  1PFS A;  2R7D A;  1I5F A;  3F1Z A;  1B7Y B;  4DV6 Q;  2YTX A;  1VQJ A;  1PH5 A;  1K8G A;  2ZTE A;  4GKK L;  3PO3 G;  1XPO A;  2AMC B;  4QJF A;  4KHZ A;  4K0K L;  2MO0 A;  2QGQ A;  4JOI A;  2E8G A;  2HQL A;  4JI8 Q;  1I6H H;  1K9M C;  1YJN A;  3CQZ H;  1QUQ A;  5M5Y H;  4AQY Q;  3S1R H;  1QZG A;  1PH4 A;  3G4S A;  2Z6K C;  4DV7 L;  3KF6 A;  3HKS A;  1VQO A;  2I0Q A;  2H5X A;  4RMF A;  1JE5 A;  1WCM H;  3HOV H;  1KXL A;  3CCS A;  4DUY Q;  4B3S Q;  2JA6 G;  2B29 A;  4GN3 B;  4LFC L;  5C0X G;  3T1H Q;  1VQ5 A;  4JI4 L;  1JT8 A;  3M7N A;  2XTI A;  4P74 A;  4JI1 L;  4P72 A;  1TWH H;  3HOU H;  2BH8 A;  1IBK L;  1QUQ B;  4DV0 L;  4X66 Q;  2PI2 E;  3KF6 B;  2HIX A;  4QGU A;  4X65 Q;  4L5S A;  3UDX A;  4L5Q A;  4BBR H;  3D0F A;  1Q7Y C;  3TS2 A;  1YBY A;  5HGQ A;  2JEA I;  4FDB A;  3E0E A;  1OTC A;  3ULL A;  3GTK H;  4PZ7 A;  1JJG A;  2GVB A;  4YHH Q;  2NVT H;  4JI5 Q;  1Z47 A;  5JJL A;  1E1O A;  1P8L A;  2BH2 A;  4DR2 Q;  4HIK A;  1N33 Q;  2A8V A;  3S2H H;  4A93 G;  2IX1 A;  3HOY H;  3AEV A;  1FJG L;  4A3G H;  3F2D A;  3KDF A;  1SMX A;  4MNO A;  2OQK A;  4PZ8 A;  3HOX H;  2R92 H;  4DR1 L;  4KLK A;  1VQN A;  2HT1 A;  3K8A A;  1XPU A;  4OO1 G;  3M85 A;  4LFB Q;  4JI1 Q;  4YWM A;  2UXD Q;  3TQY A;  4A3I G;  1VQD A;  5LMN Q;  4JI0 L;  2D62 A;  3OTO L;  3UDI A;  4R4Q A;  5C0X J;  3KDF B;  4O2D A;  5JEA J;  2Q2I A;  4MZ9 A;  5C0X I;  1N36 Q;  2UU9 L;  2HHH Q;  2OTJ A;  2A1A A;  4DV3 L;  5BR8 L;  1HJP A;  1BKB A;  4OON A;  1AE3 A;  1VS0 A;  3KJO A;  1PH3 A;  1KRS A;  4DKA C;  2PMZ E;  1A62 A;  4R4I A;  2VQF Q;  2UUA Q;  3RLN A;  1YJ9 A;  5AJ3 L;  1HZA A;  2L15 A;  2KHI A;  5K36 G;  4P73 A;  3G6E A;  1M90 C;  3FKI H;  1O7I A;  1XNR L;  2ZJQ A;  4B3M L;  4A93 H;  4ME3 A;  4A3E G;  5M3M G;  4PMW A;  1HNZ Q;  4X64 L;  2KHJ A;  1KRT A;  1CKN A;  1HNX L;  4A3D G;  1L2F A;  1E1T A;  4GN5 A;  2UXC Q;  2VUM G;  4C3J H;  3WWV A;  1AE2 A;  2C35 B;  2MFI A;  1HR0 W;  3CME A;  3RR5 A;  4X62 L;  2R6G A;  3J80 c;  2ZM6 L;  4C2M H;  1N34 Q;  1S3O A;  2Q2T A;  4GLX A;  1FVI A;  3RLF A;  2Z6K A;  1X3F A;  3EN2 A;  1C7Y A;  1EWI A;  1HZ9 A;  2WB1 E;  2AWO A;  3F2B A;  1VQ4 A;  3S2D H;  3OTO Q;  1VQF A;  1NE3 A;  3ERS X;  4JI2 Q;  2I5H A;  2YYZ A;  3CCL A;  4A3I H;  1KIX A;  1CKN B;  3OYY A;  3TRE A;  2E5L Q;  4OO1 I;  3ER0 A;  5FJ8 H;  4NXN Q;  4DV6 L;  1N8R C;  2R7Z G;  1Y1V H;  1XMO Q;  4GLA C;  5BR8 Q;  1Q81 C;  2LXK A;  2JQO A;  3CP0 A;  2ZTD A;  1Q82 C;  2JJQ A;  2K75 A;  1CSQ A;  3DLL A;  3CCR A;  3GTP H;  4EX5 A;  3OW2 A;  2NVQ H;  2RHS B;  4JI8 L;  3UE0 A;  4C3H H;  2K50 A;  3CCV A;  4RG1 A;  3A0J A;  4H02 A;  5FLM H;  4JBM A;  1XNR Q;  4LW1 A;  3J81 j;  4Y52 H;  3L2P A;  3E9I A;  1HNX Q;  1SLJ A;  2WAQ G;  4DUY L;  1C0A A;  1SN8 A;  4B3S L;  3KFU A;  3T1H L;  2F52 A;  2N3S A;  4OWT B;  4OXP A;  4A3L H;  2CQO A;  2VUM H;  4UP9 A;  2KBN A;  1WJJ A;  3I4M G;  1IZ6 A;  4NXM Q;  2CWA A;  4UY8 C;  2CFM A;  1J5E Q;  4PG3 A;  3J81 i;  4X66 L;  2D0O A;  2NZH A;  1K3R A;  3S15 H;  2ASB A;  1PH9 A;  3GO5 A;  4YWK A;  5C3E H;  4DUZ L;  5C44 G;  4BXX G;  3F8T A;  3U4V A;  3U4Z A;  1HR0 Q;  4LF9 Q;  2OQ0 A;  1RL2 A;  4YHH L;  4JI5 L;  2K4K A;  4R4T A;  1L0W A;  4DNI A;  1MIU A;  1KQS A;  1ASZ A;  4IFD I;  1BVS A;  1IYJ B;  3RLO A;  1YEZ A;  3PO2 G;  2R93 H;  1VQI A;  2B3G A;  1OXV A;  3CW2 C;  4DR2 L;  1PH1 A;  2AWN A;  5IYB G;  1N33 L;  1RIP A;  4JC0 A;  1EIY B;  3JC6 6;  3BU2 A;  3GTL H;  1YHB A;  1X3E A;  3L7Z C;  3PIO A;  1PA6 A;  2JA7 G;  1G51 A;  1X56 A;  4APV A;  5IP7 G;  3CPF A;  4HJ5 A;  2IX0 A;  1NJI C;  2VY3 A;  4BA2 I;  5H1S E;  4A3C H;  4QL5 A;  4QIW E;  1EIF A;  3W1G A;  5GAG C;  4LFB L;  2E2I H;  2UXD L;  2NVY H;  2N78 A;  5LMN L;  3J7A 5;  5C4X G;  3E9H A;  2VL6 A;  3GTO H;  3Q8D A;  1J6Q A;  3GTQ H;  2PNH A;  1CKO A;  3UE1 A;  3ULP A;  3S14 H;  3AFQ A;  3JAM i;  4IOA A;  5LMU Q;  5IYC H;  2PI2 A;  4LWC A;  1N36 L;  2HHH L;  4DUZ Q;  3CC7 A;  1VQG A;  3RZD H;  2NZO A; 
#chains in the Genus database with same CATH topology
 1E22 A;  4KHP Q;  2A6H C;  4LF5 Q;  1WTW A;  2CCZ A;  3EBE A;  4P75 A;  2D5D A;  3PO2 H;  5IYD G;  1GUN A;  3CCM A;  1D7Q A;  2EYF A;  2MGS A;  2KVM A;  4N9P A;  4TKO B;  5EKK A;  2NN6 G;  3CF5 A;  3F2C A;  4DV5 Q;  3SK6 A;  1UE5 A;  3C1F A;  1BQQ T;  2EXD A;  3VYR A;  1PVO A;  1KNA A;  4NB3 A;  4KN7 C;  1JWS D;  1QB5 D;  3ULJ A;  4IOC A;  3FEW X;  4G4K A;  4P71 A;  3J7Y W;  1VQ7 A;  2ZJR A;  4DR4 Q;  4Q0F A;  1XMO L;  5FLX c;  1MKH A;  1W3S A;  2PQA B;  3NBI A;  4A3J G;  2VUM B;  3A54 A;  4FF4 A;  1XPR A;  1JCK B;  5JJI A;  1STB A;  5C3E B;  1WVL A;  4PMB A;  3B6Y A;  1PH7 A;  1TU2 B;  5TSS A;  4DV1 Q;  2L4N A;  1RKN A;  2WAQ E;  4O1N A;  5J22 A;  1SAP A;  1PHJ A;  1HH2 P;  4EGV A;  2B63 G;  4A3B H;  4NXM L;  1X54 A;  1UE7 A;  2OF1 A;  5GAH C;  4U68 A;  2CKZ B;  2SNM A;  2B2V A;  1HNW Q;  3VYU A;  2RVL A;  1JE4 A;  1RJT A;  4OIK A;  3W5O A;  5JAV A;  3GDE A;  3PIP 3;  3T4A C;  1PH8 A;  2ZXP A;  1MJE A;  1SMY C;  1WFQ A;  2LY7 A;  2RSO A;  4DR6 Q;  3MWY W;  4IFD J;  1IBM L;  2X69 A;  4RFB A;  3KJP A;  1M8A A;  3Q22 A;  3OSO A;  3L3O C;  1D8L A;  1I94 L;  2NVX B;  3Q23 A;  2L11 A;  2PNR C;  3TN2 A;  3VA5 A;  4HIM A;  4JI3 Q;  2CWP A;  2FIN B;  4CJ2 C;  4XTC S;  1MI2 A;  5EPJ A;  2C5C A;  1JWM D;  3K7A B;  3CCE A;  1SJE D;  4TRD A;  2ZXO A;  2JA6 B;  3I4O A;  1EQR A;  3D4R A;  3MC0 B;  3NTI A;  4NPS A;  4HN7 A;  1A2T A;  1JOR A;  3A74 A;  3S17 H;  2HCC A;  2B8G A;  4A3F H;  3M3Y B;  4GS3 A;  3BZK A;  1MSH A;  2GVA A;  1I50 B;  5DLQ E;  1UEB A;  3I91 A;  1SJH D;  4LF6 L;  1G29 1;  3KBG A;  1V1Q A;  1O7Z A;  3URY A;  1I4H A;  5DNF A;  3NP8 A;  4FXK C;  2WP8 J;  1X3G A;  4POF A;  1XNQ Q;  1U5K A;  1Y69 U;  1MJC A;  4A3G G;  3J80 i;  5CV5 A;  3CHB D;  5LMN W;  4LFA Q;  1STE A;  4LUO A;  4AYB G;  4YIJ A;  5C3X A;  4BXX H;  2NBF A;  5F2D A;  3I4N G;  2DY7 A;  2PCF B;  2VB2 X;  4QIW B;  1TWG H;  1BF4 A;  2KEN A;  3T1Y Q;  1GUG A;  1VQ9 A;  3PUY A;  2AKW B;  1TXY A;  3K6O A;  3D8G A;  1IYU A;  1NTG A;  1SYG A;  1EUJ A;  4LAA A;  3R8B A;  4G7H C;  1UE6 A;  2D0P A;  2L12 A;  2JA9 A;  5C4X H;  4ZRZ A;  4GLV B;  1TQO A;  5HUR A;  1B70 B;  4CDF C;  4A3E B;  1GUO A;  2K5Q A;  4A3D B;  4BY1 H;  3FRP B;  5IY0 A;  2EJG C;  5GAD C;  1I3Q H;  1SYD A;  4C3J G;  3HOZ G;  3HS0 C;  4DV7 Q;  5JJK A;  1K83 H;  3J81 E;  4L5R C;  1A0I A;  2GN5 A;  4IUP A;  5D3I B;  4DV4 L;  3T51 B;  4DFA A;  5JPM C;  4BY7 H;  5DM6 3;  1YIJ A;  1IBK Q;  4DV0 Q;  1TII D;  1TWA H;  1Y1V G;  3IFT A;  4IUU A;  4AIM A;  1K8A C;  1IKL A;  4KI0 A;  4JOI C;  4IPD A;  2ZT9 C;  4GZY C;  4JCV E;  2JK8 A;  3CC2 A;  2IWH A;  1DM0 B;  1V9P A;  5ISR A;  2I07 B;  4YCW A;  4P2C B;  5M5X B;  1M1K C;  4DGZ A;  1MSG A;  3O13 A;  4IUQ A;  3FHW A;  4CBV A;  5FLM G;  1WYD A;  3QB3 A;  2V1C C;  4KKU A;  4KV6 A;  4X3S A;  1Q3L A;  2VQE L;  3PF5 A;  4DR1 Q;  4A76 A;  3JAM c;  3I4M B;  1VF7 A;  1N32 L;  4XXE A;  1MD2 D;  5HGT A;  4GOP A;  4A75 A;  1B8A A;  2UUB L;  3NBH B;  3PSI A;  4UP8 A;  2O4X A;  1YIT A;  2E75 C;  5IT9 c;  1EU3 A;  5ELN A;  3T56 B;  4JBJ A;  1ZXT A;  2R93 G;  5LL6 S;  2DJG C;  4K6L A;  3H3V H;  1OXS C;  4JBW A;  1HUN A;  3Q0A A;  1Y8P B;  4A3K H;  4AQY L;  4ALP A;  1TS5 A;  4B9W A;  4AYB E;  1SFO H;  4B3M Q;  2F4V L;  2E2J H;  2LXJ A;  4L5T A;  3X3N A;  3CRL C;  2VZA A;  3KOJ A;  1BBW A;  5C5M A;  4BWG B;  4X62 Q;  5EGT A;  1CHQ D;  4L63 B;  2ZM6 Q;  5CMD A;  2F0U A;  3OW7 A;  1G6P A;  5IYC G;  2QF7 A;  3NEN A;  4GKJ L;  2PZT A;  1IL2 A;  2RHQ B;  5HY6 A;  4FF3 A;  2R7D A;  3I4N B;  3F1Z A;  4PQX A;  3BDL A;  1LTA D;  3DEP A;  2A5H A;  1X3P A;  1F2L A;  2AUJ D;  1SXT A;  2ZTE A;  4GKK L;  3PO3 G;  1XPO A;  3GV3 A;  5ELB A;  4K0K L;  4KN4 C;  1EY4 A;  4KHV A;  2BDO A;  1CTM A;  2J7Z A;  3NQT A;  2EOT A;  2RBM A;  2E8G A;  2HQL A;  1KNE A;  3VYS A;  4B9X A;  1K9M C;  1QUQ A;  1PH4 A;  2Y0S B;  1FR3 A;  3KF6 A;  1FNW A;  2I0Q A;  1WCM H;  3CCS A;  4DUY Q;  2B29 A;  5C0X G;  1JT8 A;  4JI4 L;  1AP0 A;  5CGK A;  4P74 A;  3M7N A;  1TWH H;  1RDP D;  3D3R A;  2BH8 A;  3KLR A;  4MHE A;  1YNN D;  4X65 Q;  4L5S A;  3AMU A;  3UDX A;  3D0F A;  1YBY A;  3C1E A;  2JEA I;  1EOT A;  3HOZ B;  5CV7 A;  1TWF B;  4Z9C B;  1JJG A;  2GVB A;  3HKZ B;  3T13 A;  3TP8 A;  1Z47 A;  5JJL A;  1ENA A;  1P8L A;  4ME5 A;  4DR2 Q;  2BH2 A;  2LKV A;  3S2H H;  4A93 G;  5DAU A;  1FJG L;  4CDC C;  1BBX C;  5BN5 A;  2K01 A;  3KDF A;  4MNO A;  3TP5 A;  2AQ1 B;  2KEE A;  4FYD A;  1O7L A;  2R92 H;  1Y1W B;  1XPU A;  1HUM A;  4KD4 A;  4JPB W;  4YWM A;  2UXD Q;  4LK1 C;  4KY6 A;  4R4Q A;  3H0G B;  4O2D A;  4XYO A;  4XQQ A;  2E2D C;  1PMR A;  2UU9 L;  2OTJ A;  1KAA A;  2A1A A;  5BR8 L;  3D6C A;  3M4O B;  1HJP A;  3PIO 3;  4OON A;  4UAI A;  2K32 A;  2PMZ E;  1Q8I A;  2VQF Q;  2UUA Q;  1YJ9 A;  3I73 A;  5K36 G;  3PQI A;  1CZW A;  3G6E A;  1S5B D;  3AB9 A;  1XNR L;  1K0S A;  1HNZ Q;  2UXC Q;  5FLX L;  3IL8 A;  4C3I G;  4KY5 A;  3BDC A;  2PMZ B;  1PFM A;  2NTS A;  1I6H B;  3CQZ B;  1VQ4 A;  4OO1 H;  4WJW A;  3OTO Q;  2I5H A;  2YYZ A;  3CCL A;  3DXJ C;  1CKN B;  3ER0 A;  4NXN Q;  2R7Z G;  4LJZ C;  1F9Q A;  5IGB A;  1RTO A;  2K75 A;  1KDA A;  2A6H D;  3E6Z X;  3P75 A;  1WTV A;  2NYZ D;  1I4X A;  5J39 A;  1QCB D;  2K50 A;  3CCV A;  2DNE A;  4H02 A;  4JBM A;  3GTK B;  4LW1 A;  4DXG A;  3MXU A;  4EVO A;  2F0M A;  1EIG A;  3E9I A;  1SLJ A;  3QIA A;  1HNX Q;  1C0A A;  3K59 A;  3QWN A;  2CQO A;  2VUM H;  1IZ6 A;  4DF7 A;  1MGS A;  2CFM A;  4PG3 A;  5EJW A;  3J81 i;  1K3R A;  3FPP A;  4YWK A;  5C3E H;  5C44 G;  2EVB A;  3F8T A;  3U4Z A;  4LF9 Q;  4YHH L;  4JI5 L;  3NWS A;  4DNI A;  1MIU A;  1KQS A;  4RCO A;  1ASZ A;  1BVS A;  3RLO A;  3VYT A;  5C6A A;  3NTH A;  1DJR D;  1OXV A;  1U9R A;  1N33 L;  1RIP A;  2F0S A;  1B3Q A;  4JC0 A;  1Y8O B;  2EYO A;  3BU2 A;  3DHQ A;  3L7Z C;  2M00 A;  1QOH A;  1IW7 C;  2O5I C;  1KLG D;  2B2V C;  4QL5 A;  5JPN C;  5GAG C;  4LFB L;  1B4O A;  2KEC A;  2I46 A;  5LMN L;  3FKI B;  2K28 A;  3UE1 A;  4A93 B;  4FXD A;  1C4Q A;  2HHH L;  5EKL A;  1BCP F;  4C2M B;  1I4P A;  4GN4 B;  2JA8 G;  1NSN S;  1PYS B;  4YY3 Q;  3CC4 A;  4O0A A;  1CHP D;  2QIL A;  2NVX H;  3K81 C;  5M3F G;  1X6O A;  2PQE A;  3WOE A;  1AZP A;  1L1O A;  3H15 A;  4A3M G;  1VQP A;  2OWO A;  4JYA Q;  3I55 A;  2SNS A;  4MTK A;  2FXQ A;  1EY0 A;  3CXC A;  4L8J A;  3HGB A;  3T16 A;  1B9N A;  2V4D A;  1TY2 A;  3K7A H;  1HZB A;  4HAE A;  4LF7 Q;  3PUX A;  2DY8 A;  2A68 C;  2Q8T A;  1SBB B;  1YVC A;  5KIX A;  1XMQ Q;  2JA6 H;  1CZG A;  2PW7 A;  4JI2 L;  3EA6 A;  2Q2H A;  1H9K A;  5FLX E;  1XXG A;  3M3Y H;  1CA5 A;  1BOS A;  3SGI A;  1I50 H;  2IJ0 A;  4K2L A;  4DR6 L;  2RCF A;  1EY8 A;  1BR9 A;  1JJC B;  3S15 B;  2NZ1 D;  4PNY A;  5GQO A;  5T1G A;  1V8Q A;  1NCV A;  1CA6 A;  4K8J A;  1AN8 A;  4NP5 A;  1Y14 B;  3ZJY C;  3P20 A;  3KLW A;  4UPA A;  1PLF A;  4IN3 A;  2NWG A;  4JI3 L;  1U4L A;  1AH9 A;  2L5T A;  3K0X A;  2K5N A;  4KTA A;  3GTL B;  2WIN B;  5BN3 A;  1QVF A;  4BS9 A;  3F2U A;  4UP7 A;  1HR0 L;  4DR5 Q;  1XJV A;  2F0J A;  3KF8 B;  2E2I B;  1GO3 E;  3GTO B;  1KAW A;  3GTQ B;  3UDF A;  1YJW A;  1DON A;  2PZW A;  4QQB X;  5ELD A;  4DV2 Q;  2L9H A;  1RD9 D;  4MIU A;  2XWJ B;  5A35 A;  1T9H A;  5C44 B;  4IUT A;  2K05 A;  3U50 C;  5KNC A;  4A3E H;  4A3D H;  1EYD A;  3HFZ B;  3PGZ A;  2K14 A;  4OIJ A;  2CHB D;  3JAM L;  3MEF A;  5LMU L;  2L0C A;  5E7N A;  1CKM A;  3VDY A;  2IL8 A;  1Q1E A;  4DR3 Q;  3M4Q A;  5M5W B;  5ELF A;  2E5L L;  1CK1 A;  1DGS A;  2I5M X;  3HOV G;  3FPU B;  1IBL L;  3GP7 A;  1P16 A;  2H1E A;  2IW3 A;  2F3V A;  4J1M A;  4ZUJ A;  1PYB A;  4IUV A;  1JOO A;  4TQU S;  2QEJ C;  4BA1 I;  4BBR G;  4B3T Q;  5M5X H;  1GHJ A;  2K5W A;  2WV6 D;  3SK5 A;  1N34 L;  2F0H A;  1RTN A;  2G9D A;  3G71 A;  3MXN A;  5L37 A;  2K5D A;  2KCM A;  3I4M H;  3HOY G;  3A5Z B;  1GKH A;  1QWY A;  2AUK A;  4HMJ A;  1VQM A;  2RDF A;  4GOP C;  4LF8 L;  4FVM A;  2JN4 A;  2RKS A;  2RDH A;  3HOX G;  1QIL A;  2AHO B;  1WTR A;  3SEB A;  3G48 A;  1JMC A;  1R4Q B;  1EY6 A;  3QR8 A;  5JOB A;  5IWA L;  3RUZ A;  4V0B A;  1E7Z A;  4AH6 A;  3QOL A;  2Z0S A;  1H9S B;  1Z6H A;  2HDM A;  2UUC Q;  3LWU A;  1C48 A;  5CBA E;  4JI7 Q;  4IUN A;  5IYB H;  2KCT A;  3STB C;  4JI6 Q;  3OMC A;  2MNA A;  3GTG B;  1VCI A;  2B2Y A;  5ELO A;  1G6Z A;  1UAP A;  4IO9 A;  3RNU A;  3S1N B;  1IXR A;  3EFX D;  4IJL A;  1LT6 D;  1KD1 C;  4NW2 A;  5CC4 A;  5M3M B;  1EFW A;  4JBK A;  4DK1 A;  4CJ0 B;  2JA5 G;  1D1K A;  3NEL A;  4DAV A;  1WI5 A;  4DK6 C;  4B08 A;  1GUS A;  1YI2 A;  3GTJ B;  3I4N H;  3I90 A;  3CCU A;  1K0R A;  2FFK B;  2YTY A;  3OIP A;  1JJ2 A;  2D9U A;  4RGM A;  3S16 B;  3CMA A;  2F0T A;  2MPM A;  2N49 A;  4X6A H;  5I6W A;  1LM0 A;  1JOQ A;  4RA8 A;  2OT2 A;  4XQJ A;  3RN2 A;  1FGU A;  2WFW A;  3I2Z A;  4JG2 A;  5IGD A;  4LF4 L;  2BDN A;  1IL8 A;  4IPC A;  2ZXR A;  4FP5 D;  1ZKO A;  1VQB A;  1EYC A;  2VNU D;  4JV5 Q;  2WAQ B;  3E0J A;  2ICE C;  4A3L G;  2BA0 A;  1IKM A;  3GTM B;  4XIG S;  3HOZ H;  3JAM E;  1T5X D;  1TWF H;  1SE4 A;  1WD1 A;  1KHI A;  2TMP A;  4LUZ A;  1Z9F A;  4TSS A;  2WKD A;  3KLS A;  2X6L A;  3OIQ A;  1LTS D;  3PF4 A;  4RWS C;  4YWL A;  4GNX A;  4B3R Q;  1V1P A;  2MUY A;  1WD0 A;  5IT9 E;  1F9P A;  1I4R A;  1OXT A;  3M9B A;  1BCP B;  4DV3 Q;  1JR0 D;  1VQK A;  1HCZ A;  2A69 D;  2K04 A;  1A8V A;  1Y1W H;  3KK7 A;  1VMP A;  2ES2 A;  2NUC A;  2F0I A;  2JA7 B;  4C1N K;  1VDZ A;  3CCJ A;  3H0G H;  3MAQ A;  4OX9 L;  2B8F A;  4X64 Q;  2A6E C;  1EQQ A;  3I70 A;  1KLU D;  4DU9 A;  2X6G A;  2VW9 A;  3M4O H;  1CQV A;  2IHF A;  1VQE A;  3GQB A;  1FNU A;  2WB1 G;  2SEB D;  2QA4 A;  1LO5 D;  2HQE A;  1Q46 A;  4X65 L;  3H94 A;  1I6V C;  4DK3 C;  1ROD A;  2AQ3 B;  2QCP X;  2RDG A;  1K8G A;  1VQJ A;  1PH5 A;  1B53 A;  2AQ2 B;  2AMC B;  3HRZ C;  1DOK A;  1BUV T;  1LTB D;  2PO4 A;  1L0X B;  1BCP C;  1I6H H;  3CQZ H;  1QZG A;  3G4S A;  1HFN A;  2EYM A;  1JE5 A;  1KXL A;  4LFC L;  1D2B A;  4ZCK A;  2EJM A;  3RMH A;  1ILQ A;  3S1Q B;  3S1M B;  4N9T A;  3MZ5 A;  3TS2 A;  1SYE A;  2JA5 B;  4A3J B;  1PRT C;  2Z9H A;  1S5F D;  3E0E A;  4FDB A;  4K5X A;  1M4V A;  4RHR A;  1OTC A;  1S5D D;  4J8Q A;  3GTK H;  4K2K A;  5I2Y A;  1BNZ A;  4DNT B;  5E1F A;  3K0Y A;  4KKT A;  2K33 A;  3CU7 A;  4PMC A;  1EQT A;  1STN A;  1AZQ A;  2B63 B;  1B2T A;  2HD3 A;  1STA A;  3U9S A;  2CH4 W;  1VQD A;  4JI0 L;  2D62 A;  3OTO L;  3NK9 A;  2GA4 B;  3NPP A;  5C0X J;  2KOL A;  5JEA J;  4QMG A;  2FHT A;  4MZ9 A;  1ET9 A;  4PV1 C;  3V2T A;  1N36 Q;  3N52 A;  2RQX A;  5EQ0 A;  5C4Z A;  1AFP A;  1WTP A;  1HTL D;  3TP7 A;  1BKB A;  2E74 C;  2F0Q A;  1F77 A;  1PH3 A;  3KJO A;  1KRS A;  4DKA C;  4R4I A;  1SND A;  2R61 A;  1CI3 M;  5AJ3 L;  1HZA A;  1M90 C;  3FKI H;  1O7I A;  2F0L A;  4A93 H;  4ME3 A;  3EJI A;  1KRT A;  1E2V A;  1HNX L;  2EDG A;  3V96 A;  4GN5 A;  3A8I E;  1CT1 D;  1IW7 D;  4H0L C;  1HR0 W;  1GHK A;  3R3O A;  4C2M H;  3K5O A;  2F0G A;  2Z6K A;  1X3F A;  3EN2 A;  3I8Z A;  1VMC A;  2WB1 E;  2AWO A;  3F2B A;  5M5Y B;  2B2W A;  1VQF A;  3ERS X;  1PTO C;  1KIX A;  3OYY A;  3TRE A;  1AEX A;  5FJ8 H;  4DV6 L;  1XMO Q;  1Q81 C;  4L6T B;  5M9O A;  1F2Z A;  4ZLT F;  2RHS B;  4JI8 L;  3UE0 A;  3QOJ A;  3A0J A;  1YNJ D;  1O80 A;  1KDB A;  2B2U A;  1SNP A;  3ERQ A;  2NVT B;  1EEF D;  4B3S L;  5IGE A;  5IOC A;  3T1H L;  1Y8N B;  2F52 A;  4OWT B;  4OXP A;  2EY6 A;  1WJJ A;  4NXM Q;  4UY8 C;  3H09 A;  2A68 D;  4A3G B;  4X66 L;  2D0O A;  5LHY 1;  3S15 H;  2ASB A;  3I4L A;  3GO5 A;  1QNK A;  1NR2 A;  4AYB B;  4BXX G;  1EY7 A;  4IFD H;  3CRK C;  2M2L A;  4CDE C;  3DM1 A;  2K4K A;  2LMC B;  4R4T A;  1FNV A;  1ICF B;  1IYJ B;  1EWH A;  1YEZ A;  1PH1 A;  2F0V A;  1SNO A;  3CW2 C;  1PZI D;  3GTL H;  2NTT A;  4ZK9 B;  4APV A;  3C2P A;  4A3C H;  4BA2 I;  4G7O C;  3E5S A;  3LX0 A;  5H1S E;  2EY1 A;  1PDQ A;  1LT3 D;  1EIF A;  2E2I H;  1XWE A;  5C4X G;  3E9H A;  4ZYS A;  3GTO H;  3Q8D A;  3GTQ H;  3JAM i;  4WRD A;  4LWC A;  1VF5 C;  3A8K E;  4C3J B;  4DUZ Q;  1HHV A;  1VQG A;  1H9M A;  1AW7 A;  2CH4 A;  4X3T A;  5C44 H;  4DAY B;  1MBY A;  4OWX B;  3S2D B;  3NWT A;  4A4I A;  3SHL A;  3R93 A;  5AFW A;  4BY7 G;  1XX8 A;  4RKB A;  1B1Z A;  1JC7 A;  1Y1V B;  2XSC A;  2K52 A;  5IGG A;  3M4P A;  5M5W H;  2PQA A;  4HJA A;  3GTP B;  1PZK D;  2L55 A;  4Q5V A;  3A5U A;  3NQI A;  4POG A;  4EQ5 A;  3EQL C;  1PH2 A;  4DK0 A;  3UDG A;  5GRO A;  3U9O A;  4X3K A;  2MHV A;  3PV0 A;  2EYH A;  1TR5 A;  2BE5 C;  1SDF A;  4DR5 L;  1ONL A;  4R9W A;  2KHS A;  1LTG D;  2A74 C;  1A15 A;  2D2C C;  1DZ1 A;  5KRU A;  1J8I A;  2RA4 A;  4CHT B;  2F0O A;  3MFY A;  5C5L A;  4DNR B;  2HIV A;  1UWV A;  4LUV A;  4YCU A;  2Z4I A;  3K80 C;  2R93 B;  2QDL A;  2RF4 A;  5D65 A;  1J5E L;  1QZH A;  4A3K G;  5I6Y A;  1DOM A;  3AFP A;  4WJ3 M;  5G3L F;  2HUG A;  1S40 A;  2G5D A;  4NMZ A;  1MHW C;  1D1I A;  4UDU C;  2NVY B;  3AYH B;  1LUZ A;  1E3P A;  3EIV A;  3GTG H;  5FO7 B;  1ESR A;  5J1Z A;  5DM7 3;  3I7F A;  3KUP A;  3ONA B;  3E3X A;  3FDT A;  4DV4 Q;  3AQQ A;  2ICI A;  4DN4 M;  3S1N H;  1OXX K;  3RZO B;  3STB D;  1U0L A;  1ZEQ X;  3D4D A;  2OCE A;  3IFD A;  2DJF C;  2JXM B;  4QF4 A;  5M3M H;  3PO3 B;  2F3W A;  3PUW A;  3AU7 A;  1KTK A;  1NNX A;  3GTJ H;  1X3Q A;  1S5C D;  3BZC A;  2QDB A;  2OXP A;  1DYQ A;  2Z8L A;  2QW7 A;  1KC8 C;  4I65 A;  3L0O A;  4M1U B;  1HA6 A;  4OWW B;  1WOC A;  3HOW G;  3S16 H;  5I9P A;  1PH6 A;  4KHP L;  2E2H B;  4LF5 L;  1WTQ A;  1BBU A;  1LAB A;  2H4O A;  2LFN A;  1D5X C;  5IE8 A;  1ASY A;  1B3A A;  2IX3 A;  2VQE Q;  1N32 Q;  1YHA A;  2EE1 A;  4TVA B;  2UUC L;  2EPB A;  2QEX A;  4JI7 L;  3HG9 A;  1F2M A;  4CKC A;  1QVG A;  4F7X A;  2UUB Q;  2IY5 B;  1PXU A;  4HCS A;  1EQV A;  4DV5 L;  4H7B A;  1V43 A;  5IP9 G;  1PFN A;  3I56 A;  1G2T A;  2YU9 B;  1A6X A;  2R7F A;  3D6W A;  1FD7 D;  2SDF A;  1H9J A;  3GTM H;  1I4G A;  2XIW A;  5G3L D;  4K5V A;  4DR4 L;  1SSO A;  5EBC A;  1EFI D;  1YHQ A;  2R92 G;  1GXD C;  1SYB A;  2ZTC A;  5CYU A;  1SMY D;  2F4V Q;  1TS4 A;  1HQR D;  2R3Z A;  2FMC A;  4GNX C;  3K5L A;  1ENC A;  2EQS A;  4I7Z C;  4DV1 L;  4GKJ Q;  4ID6 A;  2JA7 H;  1STG A;  3OMG A;  2PW5 A;  5IP7 H;  3ICE A;  1LTR D;  3J7A V;  1PRT F;  3V05 A;  2F0W A;  4F8M A;  1G91 A;  4JK1 C;  4GKK Q;  1HNW L;  3DWP A;  4K0K Q;  2UXB Q;  1LTI D;  3D31 A;  2Z1C A;  1K8O A;  4OEM B;  4JV5 L;  3RD4 A;  1K3B C;  1LTL A;  2J0T D;  4BBS G;  4X3U A;  5JEA G;  4C3I B;  2CQA A;  2A6E D;  3J7A F;  1Q1B A;  4JI4 Q;  1FYC A;  2F0E A;  5IYD H;  4DR7 Q;  4B3R L;  2R7Z B;  2EYP A;  3R2I A;  4KY7 A;  2YTV A;  3Q24 A;  2ALY B;  3J7Z C;  1X32 A;  2DN8 A;  4N8F A;  2NN6 H;  2MO1 A;  4KJO A;  1Z7T A;  4ABN A;  5ELC A;  1BCP D;  1S5E D;  3NBH A;  4UHV A;  3S1Q H;  3S1M H;  1TWC B;  1FJG Q;  3OHX C;  4Y7N B;  4J15 A;  2JA5 H;  3ERO A;  4A3J H;  1UNS A;  1IHZ A;  2JE6 I;  5EAY A;  2N8N A;  3PMF A;  2CVR A;  1E2W A;  1HZC A;  5C3E G;  1GD7 A;  3H3V C;  2BCO A;  1O78 A;  1LV9 A;  3HOW B;  2ATW A;  4HJ8 A;  3LGJ A;  1NY4 A;  3P1H A;  2DUD A;  1PTO F;  2UU9 Q;  1PRT D;  3DEO A;  3W2D A;  4GOP B;  1XNQ L;  2B63 H;  3MVV A;  3KYH C;  1NR4 A;  3H3V I;  3FMC A;  2BA1 A;  1EIH A;  4LFA L;  5E4X A;  1EL0 A;  3WDN A;  1YNX A;  1EEI D;  4HJ7 A;  3GV6 A;  5IOD A;  3T1Y L;  4DPG A;  1CSP A;  1VQ6 A;  3HOU G;  1ENF A;  3I3C A;  1D5M C;  4WJ4 A;  4HMI A;  2PPB C;  1X55 A;  2L1B A;  2KCN A;  3DWA A;  3FP9 A;  4F87 A;  2JP1 A;  1EY5 A;  2JA8 B;  1XYI A;  1I5F A;  1B7Y B;  2YTX A;  4G57 A;  3TME A;  5M3F B;  3T53 B;  2KCC A;  5E3F A;  2PYK A;  2MO0 A;  2QGQ A;  3VR4 A;  4A3M B;  3MXP A;  4KD3 A;  3HEJ A;  1YJN A;  5M5Y H;  2CW0 C;  2Z6K C;  4DV7 L;  1TY0 A;  1EZ6 A;  3LNN A;  1VQO A;  2B2W C;  2H5X A;  5I9O A;  4IQZ A;  1ESF A;  2JA6 G;  1EY9 A;  4ZAI A;  4RHS A;  4P72 A;  3ITP A;  1SEB D;  1IBK L;  1QUQ B;  4DV0 L;  1GOZ A;  3KF6 B;  2HIX A;  1STH A;  4QGU A;  3K58 A;  3C3L A;  2K03 A;  3FVQ A;  4L5Q A;  1KDC A;  3VR6 A;  1PTO D;  4KJN A;  4O42 A;  4BBS B;  3NE5 B;  3ULL A;  1SNM A;  4YHH Q;  2NVT H;  1NUC A;  4JI5 Q;  2B2U C;  4NKL A;  1ILP A;  1E1O A;  5C4J B;  1R9T B;  4K5W A;  2A8V A;  1N33 Q;  3BZD B;  2IX1 A;  4H13 C;  1HA5 A;  4A3G H;  3F2D A;  4ZQ3 A;  4PZ8 A;  4DR1 L;  4ODG A;  1II3 A;  1ICW A;  3TSS A;  1WTH A;  4KLK A;  1VQN A;  3K8A A;  3M85 A;  3MEH A;  4LFB Q;  4JI1 Q;  4DXF A;  4EQN A;  3TQY A;  4A3I G;  5IGC A;  3OWE B;  5LMN Q;  3EVQ A;  2B39 A;  3KDF B;  1F9S A;  2Q2I A;  2F0P A;  1E0B A;  2HHH Q;  4RCN A;  1VS0 A;  4S3S A;  4C3H G;  3N6R A;  3MA2 B;  1EU4 A;  4RGO S;  4CGY B;  3BVM A;  4P73 A;  4ZUI A;  4B3M L;  4A3E G;  4PMW A;  5COY A;  4A3D G;  1CKN A;  1G8Z D;  1E1T A;  1L2F A;  3A7A B;  5BN4 A;  4C3J H;  3WWV A;  2KA7 A;  3RR5 A;  4X62 L;  3J80 c;  4EQO A;  2ZM6 L;  1S3O A;  5I4D A;  4GLX A;  1FVI A;  3RLF A;  3J81 L;  3S1R B;  1HZ9 A;  3S2D H;  4QCL A;  4JI2 Q;  4OO1 I;  3HOV B;  1Y1V H;  2LXK A;  4XYQ A;  2ENB A;  2ZTD A;  3SR1 A;  3HOU B;  2WAC A;  3DLL A;  3GTP H;  3OW2 A;  3SXH A;  3BVG A;  5KYL A;  4BBR B;  2A73 B;  5FLM H;  4Y52 H;  3L2P A;  4DUY L;  1SN8 A;  1H9R A;  4R8I A;  5C3W A;  3NTK A;  2F0D A;  5C4H A;  1PRT B;  2KBN A;  4ZKC B;  3I4M G;  3HOY B;  2CWA A;  3VA7 A;  2NZH A;  1PH9 A;  3HOX B;  4DUZ L;  3U4V A;  1HR0 Q;  2BE5 D;  1CM9 A;  2XWB B;  1RL2 A;  1V1O A;  4QUF A;  3TP6 A;  2R93 H;  3PO2 G;  1VQI A;  2B3G A;  3HZX A;  4DR2 L;  5IYB G;  1EIY B;  1YHB A;  1X56 A;  2EY2 A;  2IX0 A;  2VY3 A;  1Q90 A;  5CV6 A;  3NUC A;  1GUT A;  4QIW E;  2J4X A;  4K8I A;  2UXD L;  2NVY H;  2VL6 A;  3VR2 A;  1J6Q A;  2K7V A;  3ULP A;  4IOA A;  3AFQ A;  3OWF A;  5LMU Q;  1ET6 A;  1FGB D;  5IYC H;  2PI2 A;  3KBX A;  3MFG A;  5K5P A;  3CC7 A;  4HJ5 A;  1PA6 A;  2E5L Q;  2NZO A;  2EJF C;  4NDX A;  3RZO H;  1CUK A;  1KL9 A;  1A63 A;  1IBL Q;  3IAY A;  1OXU A;  2VQF L;  1NBW A;  4K6D A;  3TBI B;  2UUA L;  3BS1 A;  4HR7 B;  3PO3 H;  4A3I B;  2MP1 A;  1QVC A;  3IRB A;  1HNZ L;  3DUZ A;  5CV9 A;  3TRZ A;  1UE1 A;  2UXC L;  5IGF A;  2Y0S G;  4A3B G;  2DNC A;  3BYY B;  1N34 Q;  1PTO B;  1TT2 A;  3VR5 A;  2FMM A;  4FO2 A;  3W1B A;  2E2H H;  1LTT D;  2YV5 A;  2NVQ B;  4C3H B;  5C0X H;  4QY7 A;  5E4W C;  4RAU C;  1L1O B;  1E2Z A;  3DM3 A;  1ZYR C;  4NXN L;  1X65 A;  4HTH A;  4LF8 Q;  2OEO A;  1PYW D;  3K5M A;  1DD2 A;  1GM5 A;  3SK4 A;  2EYJ A;  2SOB A;  5KYI A;  4R4C A;  3HP3 A;  5JVG 3;  4ILW A;  3HKZ G;  3H91 A;  5IWA Q;  2F3I A;  2YU9 H;  4DA2 A;  1H95 A;  4IPH A;  4OL7 A;  2N88 A;  4KK7 A;  5KEE A;  3PUV A;  5I2X A;  2XRQ D;  2F1M A;  2OTL A;  4M8A A;  3TZD A;  3KF8 A;  1Y1W G;  4IAL A;  4OHJ A;  4HED A;  2LSS A;  3S24 A;  2XVS A;  2NN6 I;  1U4P A;  1SYC A;  3H0G G;  2F0K A;  4LF9 L;  1SRO A;  1EOV A;  4FF2 A;  1D6E C;  1L1O C;  1JB7 A;  2BOS A;  4KMU C;  2F4I A;  1GJX A;  2IHE A;  1R4P B;  3GD7 A;  3S14 B;  2B2T A;  4A3F G;  1NAP A;  1SR3 A;  2WB1 B;  3K57 A;  2KJX A;  4MTN A;  3RZD B;  5K36 H;  4IPG A;  1F9R A;  5GAE C;  2JEB I;  5KND A;  1JOK A;  4R4O A;  3L9A X;  1NMF A;  3CKI B;  4HIO A;  3PO2 B;  4C3I H;  2EXZ A;  2XRS D;  4LF4 Q;  4HID A;  2F03 A;  1VQC A;  1S4Z A;  5A2Q L;  1WTX A;  1I4Q A;  1YZ6 A;  2EIF A;  1B50 A;  2DGY A;  2N55 A;  4YY3 L;  2R7Z H;  3CPW A;  5EKI A;  3X3M A;  3SK8 A;  1WTO A;  1IBM Q;  3PUZ A;  5J3B A;  1RHP A;  4JYA L;  1VQ8 A;  2TSS A;  3TZU A;  4FNF A;  5COR A;  1XTC D;  1PZJ D;  2Z6B A;  4LNQ A;  2Y0S E;  3NSW A;  1I94 Q;  4LF7 L;  1SYF A;  1TWC H;  2VS1 A;  3BDO A;  4Y7N H;  2K5H A;  1XMQ L;  1DCZ A;  1KAB A;  2UXB L;  4BY1 G;  1HPC A;  1H9S A;  2K6A A;  2E76 C;  1Q86 C;  1S72 A;  2RCN A;  3I72 A;  3K7U C;  1JIC A;  2I5L X;  1K28 A;  2A19 A;  1GVP A;  4HCE A;  4A3B B;  3HOW H;  2HDL A;  2ZJP A;  3MXN B;  4N8X 1;  4R1J A;  4OX9 Q;  3TEH B;  1Q12 A;  1C9O A;  1QNU A;  3HKZ E;  1FL0 A;  4H44 C;  4CDD C;  3PIP A;  1A3T A;  1A2U A;  1HRJ A;  1X9N A;  4DR7 L;  4U67 3;  3UI2 A;  4LF6 Q;  5FOB B;  4FF1 A;  1SNC A;  1W2B A;  2A69 C;  3WOF A;  5IP9 H;  1K73 C;  3DWQ A;  3FKI G;  3SDZ A;  4OGQ C;  3S9W A;  3NEM A;  3ND9 A;  3BJU A;  3D4W A;  1NMG A;  3BYT B;  3BG3 A;  3J81 c;  2JA8 H;  1JB3 A;  1BO0 A;  4QB4 A;  4LFC Q;  4HJ9 A;  4DV2 L;  5M3F H;  1EYG A;  5FO9 B;  3A56 A;  2KED A;  5FO8 B;  1JWU D;  5FJ8 G;  4A3M H;  3U58 A;  3SE0 A;  1E24 A;  2Q8I B;  2EYL A;  4MN3 A;  3TS0 A;  3Q6S A;  1J9O A;  1LT4 D;  3SVM A;  4R8N A;  2IT1 A;  4E6I A;  3S17 B;  2EY5 A;  4A3F B;  5KNB A;  4ZKB B;  3CD6 A;  1STY A;  1B44 D;  4DR3 L;  1SE2 A;  4C56 C;  4DAM A;  3W3A A;  1N9W A;  3OPO A;  1JQY D;  2CW0 D;  3PCO B;  1LT5 D;  4BBS H;  4CKE A;  5JEA H;  4JW0 A;  3CAM A;  2B2Y C;  3A8J E;  4B3T L;  5A2Q E;  1SE8 A;  2M9V A;  4JI0 Q;  1VQL A;  4XDX A;  5C4J H;  1R9T H;  4IZ8 A;  4IFD G;  1TWG B;  4JVZ A;  3C46 A;  1VQA A;  4LMQ D;  1CFM A;  2Z4H A;  2K5V A;  3VR3 A;  2XGT A;  5DEH A;  2KQ3 A;  3J80 L;  4YCV A;  4F88 A;  2ID0 A;  1VQH A;  2QKI C;  2Q2U A;  1DXM A;  1D5Z C;  1V1P B;  5AJ3 Q;  4GNX B;  3CCQ A;  1XTD A;  2RSN A;  4KKS A;  4A3C G;  1SRU A;  1WCM G;  2F0F A;  3IKJ A;  2MQH A;  4IJH A;  2K1B A;  4WFN 3;  1Q8K A;  5C4X B;  2O2L D;  4HSP A;  1LYL A;  2VXW A;  5KGU A;  3RN5 A;  1W6K A;  1PV4 A;  4JI6 L;  4EQP A;  4BY1 B;  1I3Q B;  4PZ6 A;  4ULL A;  5ELE A;  1K83 B;  1PFS A;  3P7J A;  1BDO A;  4OEL B;  4DV6 Q;  3MTS A;  2JSO A;  2EZV A;  2Q8R E;  4BY7 B;  4QJF A;  4KHZ A;  4FXG C;  1TWA B;  4JOI A;  4JI8 Q;  1IYV A;  3S1R H;  5EPK A;  4AQY Q;  3HKS A;  4RMF A;  4XQN A;  5IIF A;  1U4R A;  3HOV H;  1F2Y A;  4B3S Q;  4GN3 B;  3T1H Q;  1VQ5 A;  2XTI A;  4JI1 L;  3DMU A;  4J6H A;  3HOU H;  1HQM C;  4X66 Q;  2PI2 E;  5EBD A;  4BBR H;  1Q7Y C;  5CR3 A;  5HGQ A;  1EZ8 A;  4PZ7 A;  1BXT A;  1RF2 D;  2G9H D;  5LL6 X;  1A3V A;  4CKB A;  3MHB A;  1B9M A;  1LAC A;  4HIK A;  3HOY H;  1TVX A;  3AEV A;  1YNJ C;  1O7Y A;  4QUC A;  1SMX A;  1A3U A;  2OQK A;  4HSV A;  3HOX H;  1L0Y B;  2O5J C;  2HT1 A;  1TS2 A;  4OO1 G;  2WKC A;  4A3K B;  1EYA A;  5CBE E;  3UDI A;  1SFO B;  1HFG A;  5JVH 3;  2E2J B;  3M7G A;  5C0X I;  4DV3 L;  1AE3 A;  2VB3 X;  3NXW A;  1A62 A;  3ND8 A;  5CV8 A;  4RGN A;  4DAP A;  3RLN A;  2KUM A;  4RGT A;  2L15 A;  3KLS X;  2KHI A;  3R2T A;  2PZU A;  3A7L A;  3MXG A;  2ZJQ A;  1QJO A;  1SNQ A;  3TDQ A;  2FJ2 A;  5M3M G;  4X64 L;  2KHJ A;  2VUM G;  5JJZ A;  5EPL A;  1AE2 A;  2C35 B;  2MFI A;  5FKA C;  3CME A;  2R6G A;  1G2S A;  3J80 E;  2Q2T A;  3A55 A;  1C7Y A;  3G7L A;  1EWI A;  1YNN C;  1NE3 A;  1LLR D;  1SE3 A;  4A3I H;  4RH6 A;  4WOR A;  1WCM B;  1UUP A;  5D14 A;  1N8R C;  1EWC A;  1OO9 B;  4GLA C;  5BR8 Q;  3G6J B;  1RCV D;  2JQO A;  3CP0 A;  1TWH B;  1Q82 C;  2JJQ A;  1CSQ A;  1PTO H;  5CV4 A;  3CCR A;  5D3D A;  3NHH A;  4EX5 A;  2NVQ H;  4C3H H;  4XT1 B;  2XNA C;  1T5E A;  2F0N A;  2JYO A;  3QG1 A;  4RG1 A;  1XNR Q;  3J81 j;  1UEA B;  2WAQ G;  4RKL A;  3KFU A;  4A3L H;  2N3S A;  1TKW B;  4IUR A;  4UP9 A;  4V19 0;  3S2H B;  1J5E Q;  2NB0 A;  1GUW A;  2HCI A;  1TS3 A;  2IPK D;  3LWE A;  4C1N I;  2LS0 1;  2R92 B;  3M4Y A;  3ZYY X;  1QG7 A;  1ZYR D;  3H6M A;  2OQ0 A;  3QO2 A;  1K8M A;  1L0W A;  2P5Z X;  4I7A A;  5IT9 L;  4IFD I;  1DOL A;  1C8C A;  2AWN A;  5FK9 C;  1QE6 A;  1W6J A;  2XN9 C;  4CJ1 B;  3K5N A;  2MJ8 A;  3JC6 6;  1CQF A;  1X3E A;  3PIO A;  2JA7 G;  1G51 A;  3BVZ A;  3OOC A;  5NUC A;  5IP7 G;  3CPF A;  1NJI C;  4XT3 B;  4G7Z C;  5T1I A;  2C9O A;  2WII B;  3W1G A;  3QJY A;  4DAY A;  3J7A 5;  2N78 A;  4K14 A;  2PNH A;  1CKO A;  3S14 H;  1U4M A;  1HXY D;  1PFB A;  1ML0 D;  1N36 L;  2B2T C;  3RZD H;  1HTP A; 
#chains in the Genus database with same CATH homology
 1E22 A;  5C44 H;  3RZO H;  1CUK A;  1KL9 A;  4GN4 B;  4KHP Q;  4DAY B;  1IBL Q;  1PYS B;  4LF5 Q;  4YY3 Q;  3CC4 A;  2JA8 G;  1OXU A;  4O0A A;  1NBW A;  4OWX B;  2VQF L;  4A4I A;  2NVX H;  2UUA L;  2CCZ A;  3K81 C;  5M3F G;  1X6O A;  3EBE A;  4P75 A;  3PO3 H;  4BY7 G;  1QVC A;  3PO2 H;  5IYD G;  3CCM A;  3IRB A;  1L1O A;  3H15 A;  4A3M G;  1VQP A;  2OWO A;  4JYA Q;  3I55 A;  1HNZ L;  1D7Q A;  2FXQ A;  2UXC L;  3TRZ A;  1UE1 A;  2K52 A;  3CXC A;  2Y0S G;  4A3B G;  3M4P A;  5M5W H;  2NN6 G;  3CF5 A;  2PQA A;  3K7A H;  3F2C A;  1HZB A;  4DV5 Q;  1UE5 A;  3A5U A;  4HJA A;  4POG A;  4LF7 Q;  3W1B A;  4EQ5 A;  3PUX A;  2EXD A;  2YV5 A;  1PH2 A;  2E2H H;  1PVO A;  3UDG A;  1YVC A;  4NB3 A;  5GRO A;  1XMQ Q;  2JA6 H;  4QY7 A;  1L1O B;  4JI2 L;  3ULJ A;  4IOC A;  3DM3 A;  3PV0 A;  2Q2H A;  4P71 A;  1VQ7 A;  2ZJR A;  4DR4 Q;  4NXN L;  1X65 A;  4DR5 L;  1XMO L;  5FLX c;  1MKH A;  2PQA B;  1W3S A;  4LF8 Q;  3M3Y H;  3SGI A;  1I50 H;  4A3J G;  1GM5 A;  4DR6 L;  1XPR A;  1JJC B;  4R4C A;  5JJI A;  5GQO A;  3HKZ G;  5IWA Q;  2YU9 H;  2F3I A;  3B6Y A;  2HIV A;  1PH7 A;  1UWV A;  4LUV A;  4YCU A;  1H95 A;  4IPH A;  3K80 C;  4DV1 Q;  1Y14 B;  3ZJY C;  3PUV A;  2WAQ E;  3KLW A;  4UPA A;  1PHJ A;  2OTL A;  1HH2 P;  2RF4 A;  2B63 G;  4A3B H;  4NXM L;  1X54 A;  1UE7 A;  1Y1W G;  5GAH C;  4JI3 L;  1J5E L;  1AH9 A;  2CKZ B;  1QZH A;  2LSS A;  2K5N A;  3K0X A;  3S24 A;  4A3K G;  1QVF A;  1HNW Q;  3AFP A;  2NN6 I;  4WJ3 M;  4UP7 A;  3H0G G;  1S40 A;  3W5O A;  1HR0 L;  4DR5 Q;  4LF9 L;  3GDE A;  1PH8 A;  1XJV A;  1SRO A;  1EOV A;  1MJE A;  1L1O C;  3KF8 B;  1JB7 A;  1GO3 E;  1WFQ A;  3AYH B;  1LUZ A;  2IHE A;  4DR6 Q;  1KAW A;  1E3P A;  3EIV A;  3GD7 A;  3UDF A;  3GTG H;  1YJW A;  4A3F G;  1IBM L;  4IFD J;  1SR3 A;  3I7F A;  4QQB X;  3KJP A;  4DV4 Q;  4DV2 Q;  3AQQ A;  4MTN A;  1D8L A;  4IPG A;  3S1N H;  1OXX K;  1T9H A;  3STB D;  5GAE C;  2JEB I;  1U0L A;  3U50 C;  4A3E H;  1I94 L;  2OCE A;  5M3M H;  4A3D H;  3HFZ B;  4R4O A;  4HIM A;  3PGZ A;  3PUW A;  1NMF A;  2K14 A;  4HIO A;  4C3I H;  3GTJ H;  4JI3 Q;  3BZC A;  3MEF A;  4LF4 Q;  1KC8 C;  4HID A;  5LMU L;  3L0O A;  2CWP A;  5E7N A;  1VQC A;  1CKM A;  3VDY A;  4XTC S;  4OWW B;  1WOC A;  1Q1E A;  4DR3 Q;  3M4Q A;  2E5L L;  1YZ6 A;  3HOW G;  3S16 H;  3CCE A;  1DGS A;  1PH6 A;  2EIF A;  2I5M X;  4KHP L;  3HOV G;  2DGY A;  1IBL L;  4LF5 L;  4YY3 L;  2R7Z H;  1BBU A;  3CPW A;  1P16 A;  3I4O A;  1EQR A;  5IE8 A;  1ASY A;  2VQE Q;  4NPS A;  1N32 Q;  1PYB A;  1IBM Q;  3PUZ A;  1YHA A;  3A74 A;  3S17 H;  4TVA B;  5J3B A;  4TQU S;  2QEX A;  4BA1 I;  1VQ8 A;  2UUC L;  4JI7 L;  4JYA L;  4A3F H;  4BBR G;  4GS3 A;  1QVG A;  4B3T Q;  3BZK A;  2GVA A;  5M5X H;  2UUB Q;  5DLQ E;  1UEB A;  2IY5 B;  1N34 L;  4LF6 L;  1G29 1;  2Y0S E;  4DV5 L;  4LNQ A;  1V1Q A;  1V43 A;  1I94 Q;  5IP9 G;  4LF7 L;  3G71 A;  3I56 A;  1TWC H;  2VS1 A;  4Y7N H;  2K5H A;  2R7F A;  1XMQ L;  2WP8 J;  1X3G A;  4POF A;  2KCM A;  1XNQ Q;  3GTM H;  3I4M H;  1U5K A;  3HOY G;  1MJC A;  1GKH A;  3A5Z B;  4BY1 G;  1VQM A;  4A3G G;  4DR4 L;  2UXB L;  3J80 i;  1Q86 C;  1S72 A;  4GOP C;  2RCN A;  3K7U C;  5LMN W;  4LF8 L;  2I5L X;  4LFA Q;  3HOX G;  4LUO A;  1YHQ A;  2R92 G;  2A19 A;  4AYB G;  1GVP A;  4BXX H;  2ZTC A;  3HOW H;  3I4N G;  2ZJP A;  3MXN B;  1TWG H;  4R1J A;  4OX9 Q;  2AHO B;  3TEH B;  2F4V Q;  2KEN A;  3G48 A;  1Q12 A;  1C9O A;  4GNX C;  3T1Y Q;  1JMC A;  5IWA L;  1E7Z A;  4AH6 A;  1VQ9 A;  3PUY A;  3HKZ E;  2Z0S A;  1FL0 A;  2EQS A;  3PIP A;  2AKW B;  2UUC Q;  1TXY A;  4JI7 Q;  5IYB H;  2KCT A;  3STB C;  4DV1 L;  1X9N A;  4JI6 Q;  4DR7 L;  2MNA A;  4GKJ Q;  2JA7 H;  4LF6 Q;  1NTG A;  5IP7 H;  1VCI A;  3ICE A;  1W2B A;  1EUJ A;  5IP9 H;  5ELO A;  1K73 C;  1UE6 A;  2D0P A;  4GKK Q;  4IO9 A;  1HNW L;  3RNU A;  2JA9 A;  1IXR A;  4K0K Q;  5C4X H;  3FKI G;  4IJL A;  2UXB Q;  1KD1 C;  3D31 A;  4GLV B;  1B70 B;  3NEM A;  1EFW A;  3BJU A;  5IY0 A;  4BY1 H;  4JBK A;  5GAD C;  4JV5 L;  2JA5 G;  1I3Q H;  1LTL A;  4BBS G;  3NEL A;  3HOZ G;  4DV7 Q;  1NMG A;  1WI5 A;  5JEA G;  4DK6 C;  3J81 c;  1YI2 A;  1K83 H;  5JJK A;  4L5R C;  1A0I A;  2GN5 A;  2JA8 H;  3I4N H;  3CCU A;  4DV4 L;  1Q1B A;  1K0R A;  4DV2 L;  4HJ9 A;  4JI4 Q;  2YTY A;  4LFC Q;  1JJ2 A;  5M3F H;  1EYG A;  4BY7 H;  3CMA A;  1YIJ A;  1IBK Q;  5IYD H;  4DR7 Q;  5FJ8 G;  4DV0 Q;  4B3R L;  2N49 A;  1TWA H;  1Y1V G;  4A3M H;  4X6A H;  2YTV A;  1LM0 A;  2ALY B;  3J7Z C;  4AIM A;  1E24 A;  3TS0 A;  3U58 A;  1K8A C;  4KI0 A;  4JOI C;  3RN2 A;  1FGU A;  2WFW A;  3I2Z A;  4IPD A;  4JG2 A;  2IT1 A;  4JCV E;  2JK8 A;  2MO1 A;  3CC2 A;  1V9P A;  4LF4 L;  4IPC A;  4YCW A;  1M1K C;  3CD6 A;  3FHW A;  5FLM G;  4DR3 L;  1VQB A;  4DAM A;  1WYD A;  1N9W A;  3S1Q H;  3S1M H;  1FJG Q;  2VNU D;  2V1C C;  4JV5 Q;  4A3L G;  4J15 A;  3PCO B;  2BA0 A;  2JA5 H;  2VQE L;  4A3J H;  4DR1 Q;  4XIG S;  3JAM c;  4A76 A;  3PF5 A;  3HOZ H;  4BBS H;  1TWF H;  1N32 L;  1A63 A;  4GOP A;  4A75 A;  2JE6 I;  1KHI A;  5EAY A;  2N8N A;  4LUZ A;  3CAM A;  1Z9F A;  1B8A A;  1HZC A;  2UUB L;  5C3E G;  1GD7 A;  3NBH B;  1SE8 A;  3PSI A;  4B3T L;  4UP8 A;  4JI0 Q;  3PF4 A;  1VQL A;  1YIT A;  4YWL A;  5C4J H;  1R9T H;  4HJ8 A;  3LGJ A;  4GNX A;  2ATW A;  4IFD G;  4B3R Q;  1NY4 A;  5IT9 c;  2DUD A;  1OXT A;  3M9B A;  5ELN A;  2UU9 Q;  1VQA A;  4DV3 Q;  4JBJ A;  2R93 G;  4GOP B;  1VQK A;  2K5V A;  3H3V H;  1XNQ L;  2XGT A;  2B63 H;  1OXS C;  4JBW A;  1A8V A;  4YCV A;  1Y1W H;  3KYH C;  2ID0 A;  2ES2 A;  3H3V I;  1VQH A;  2Q2U A;  4GNX B;  2BA1 A;  5AJ3 Q;  4A3K H;  4LFA L;  3CCQ A;  1XTD A;  4AQY L;  3CCJ A;  4ALP A;  4A3C G;  1SRU A;  1WCM G;  3H0G H;  4AYB E;  2MQH A;  1SFO H;  4IJH A;  4B3M Q;  4OX9 L;  2E2J H;  1YNX A;  2F4V L;  4X64 Q;  2LXJ A;  4L5T A;  4HJ7 A;  1EQQ A;  3T1Y L;  4DPG A;  1CSP A;  1VQ6 A;  2VZA A;  1Q8K A;  3KOJ A;  2VW9 A;  3HOU G;  1BBW A;  4X62 Q;  3M4O H;  2ZM6 Q;  1LYL A;  3RN5 A;  2IHF A;  4WJ4 A;  1VQE A;  2WB1 G;  1PV4 A;  4JI6 L;  1G6P A;  5IYC G;  2QA4 A;  1X55 A;  3NEN A;  4GKJ L;  1Q46 A;  4X65 L;  4PZ6 A;  1IL2 A;  2RHQ B;  3FP9 A;  5HY6 A;  4DK3 C;  1PFS A;  2R7D A;  1I5F A;  3F1Z A;  1B7Y B;  4DV6 Q;  2YTX A;  1VQJ A;  1PH5 A;  1K8G A;  2ZTE A;  4GKK L;  3PO3 G;  1XPO A;  2AMC B;  4QJF A;  4KHZ A;  4K0K L;  2MO0 A;  2QGQ A;  4JOI A;  2E8G A;  2HQL A;  4JI8 Q;  1I6H H;  1K9M C;  1YJN A;  3CQZ H;  1QUQ A;  5M5Y H;  4AQY Q;  3S1R H;  1QZG A;  1PH4 A;  3G4S A;  2Z6K C;  4DV7 L;  3KF6 A;  3HKS A;  1VQO A;  2I0Q A;  2H5X A;  4RMF A;  1JE5 A;  1WCM H;  3HOV H;  1KXL A;  3CCS A;  4DUY Q;  4B3S Q;  2JA6 G;  2B29 A;  4GN3 B;  4LFC L;  5C0X G;  3T1H Q;  1VQ5 A;  4JI4 L;  1JT8 A;  3M7N A;  2XTI A;  4P74 A;  4JI1 L;  4P72 A;  1TWH H;  3HOU H;  2BH8 A;  1IBK L;  1QUQ B;  4DV0 L;  4X66 Q;  2PI2 E;  3KF6 B;  2HIX A;  4QGU A;  4X65 Q;  4L5S A;  3UDX A;  4L5Q A;  4BBR H;  3D0F A;  1Q7Y C;  3TS2 A;  1YBY A;  5HGQ A;  2JEA I;  4FDB A;  3E0E A;  1OTC A;  3ULL A;  3GTK H;  4PZ7 A;  1JJG A;  2GVB A;  4YHH Q;  2NVT H;  4JI5 Q;  1Z47 A;  5JJL A;  1E1O A;  1P8L A;  2BH2 A;  4DR2 Q;  4HIK A;  1N33 Q;  2A8V A;  3S2H H;  4A93 G;  2IX1 A;  3HOY H;  3AEV A;  1FJG L;  4A3G H;  3F2D A;  3KDF A;  1SMX A;  4MNO A;  2OQK A;  4PZ8 A;  3HOX H;  2R92 H;  4DR1 L;  4KLK A;  1VQN A;  2HT1 A;  3K8A A;  1XPU A;  4OO1 G;  3M85 A;  4LFB Q;  4JI1 Q;  4YWM A;  2UXD Q;  3TQY A;  4A3I G;  1VQD A;  5LMN Q;  4JI0 L;  2D62 A;  3OTO L;  3UDI A;  4R4Q A;  5C0X J;  3KDF B;  4O2D A;  5JEA J;  2Q2I A;  4MZ9 A;  5C0X I;  1N36 Q;  2UU9 L;  2HHH Q;  2OTJ A;  2A1A A;  4DV3 L;  5BR8 L;  1HJP A;  1BKB A;  4OON A;  1AE3 A;  1VS0 A;  3KJO A;  1PH3 A;  1KRS A;  4DKA C;  2PMZ E;  1A62 A;  4R4I A;  2VQF Q;  2UUA Q;  3RLN A;  1YJ9 A;  5AJ3 L;  1HZA A;  2L15 A;  2KHI A;  5K36 G;  4P73 A;  3G6E A;  1M90 C;  3FKI H;  1O7I A;  1XNR L;  2ZJQ A;  4B3M L;  4A93 H;  4ME3 A;  4A3E G;  5M3M G;  4PMW A;  1HNZ Q;  4X64 L;  2KHJ A;  1KRT A;  1CKN A;  1HNX L;  4A3D G;  1L2F A;  1E1T A;  4GN5 A;  2UXC Q;  2VUM G;  4C3J H;  3WWV A;  1AE2 A;  2C35 B;  2MFI A;  1HR0 W;  3CME A;  3RR5 A;  4X62 L;  2R6G A;  3J80 c;  2ZM6 L;  4C2M H;  1N34 Q;  1S3O A;  2Q2T A;  4GLX A;  1FVI A;  3RLF A;  2Z6K A;  1X3F A;  3EN2 A;  1C7Y A;  1EWI A;  1HZ9 A;  2WB1 E;  2AWO A;  3F2B A;  1VQ4 A;  3S2D H;  3OTO Q;  1VQF A;  1NE3 A;  3ERS X;  4JI2 Q;  2I5H A;  2YYZ A;  3CCL A;  4A3I H;  1KIX A;  1CKN B;  3OYY A;  3TRE A;  2E5L Q;  4OO1 I;  3ER0 A;  5FJ8 H;  4NXN Q;  4DV6 L;  1N8R C;  2R7Z G;  1Y1V H;  1XMO Q;  4GLA C;  5BR8 Q;  1Q81 C;  2LXK A;  2JQO A;  3CP0 A;  2ZTD A;  1Q82 C;  2JJQ A;  2K75 A;  1CSQ A;  3DLL A;  3CCR A;  3GTP H;  4EX5 A;  3OW2 A;  2NVQ H;  2RHS B;  4JI8 L;  3UE0 A;  4C3H H;  2K50 A;  3CCV A;  4RG1 A;  3A0J A;  4H02 A;  5FLM H;  4JBM A;  1XNR Q;  4LW1 A;  3J81 j;  4Y52 H;  3L2P A;  3E9I A;  1HNX Q;  1SLJ A;  2WAQ G;  4DUY L;  1C0A A;  1SN8 A;  4B3S L;  3KFU A;  3T1H L;  2F52 A;  2N3S A;  4OWT B;  4OXP A;  4A3L H;  2CQO A;  2VUM H;  4UP9 A;  2KBN A;  1WJJ A;  3I4M G;  1IZ6 A;  4NXM Q;  2CWA A;  4UY8 C;  2CFM A;  1J5E Q;  4PG3 A;  3J81 i;  4X66 L;  2D0O A;  2NZH A;  1K3R A;  3S15 H;  2ASB A;  1PH9 A;  3GO5 A;  4YWK A;  5C3E H;  4DUZ L;  5C44 G;  4BXX G;  3F8T A;  3U4V A;  3U4Z A;  1HR0 Q;  4LF9 Q;  2OQ0 A;  1RL2 A;  4YHH L;  4JI5 L;  2K4K A;  4R4T A;  1L0W A;  4DNI A;  1MIU A;  1KQS A;  1ASZ A;  4IFD I;  1BVS A;  1IYJ B;  3RLO A;  1YEZ A;  3PO2 G;  2R93 H;  1VQI A;  2B3G A;  1OXV A;  3CW2 C;  4DR2 L;  1PH1 A;  2AWN A;  5IYB G;  1N33 L;  1RIP A;  4JC0 A;  1EIY B;  3JC6 6;  3BU2 A;  3GTL H;  1YHB A;  1X3E A;  3L7Z C;  3PIO A;  1PA6 A;  2JA7 G;  1G51 A;  1X56 A;  4APV A;  5IP7 G;  3CPF A;  4HJ5 A;  2IX0 A;  1NJI C;  2VY3 A;  4BA2 I;  5H1S E;  4A3C H;  4QL5 A;  4QIW E;  1EIF A;  3W1G A;  5GAG C;  4LFB L;  2E2I H;  2UXD L;  2NVY H;  2N78 A;  5LMN L;  3J7A 5;  5C4X G;  3E9H A;  2VL6 A;  3GTO H;  3Q8D A;  1J6Q A;  3GTQ H;  2PNH A;  1CKO A;  3UE1 A;  3ULP A;  3S14 H;  3AFQ A;  3JAM i;  4IOA A;  5LMU Q;  5IYC H;  2PI2 A;  4LWC A;  1N36 L;  2HHH L;  4DUZ Q;  3CC7 A;  1VQG A;  3RZD H;  2NZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...