4HIMA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggatacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4himA00
3CAMA 2NN6I 3ER0A 4DPGA 1L1OB 1JB7A 2IY5B 4GLXA 5FLXc 3I7FA 4JI1L 1CUKA 3RLOA 1I94Q 2EXDA 5E7NA 3I4MH 5FJ8G 1N34Q 4GKJL 1EOVA 4OWTB 4OXPA 4DV4L 4BY1H 4A3DG 3J81i 1MIUA 1RIPA 4K0KL 3D0FA 1PHJA 2UUBL 2CQOA 3NENA 1L1OA 4Y52H 1Q1EA 2DUDA 1B8AA 1VQ7A 5C4JH 2OWOA 4C3JH 4DV4Q 1U5KA 3OTOQ 1WCMH 3M4OH 2E5LL 4X6AH 4JI4L 4A3DH 1AH9A 5JJLA 3BZCA 5IWAQ 3PIOA 2KENA 2ZJPA 3U50C 4B3RL 1HZAA 2YV5A 1I6HH 3HKSA 4LW1A 1A8VA 1N32L 2PMZE 4O2DA 2ASBA 4LF8L 1JMCA 4X66Q 4DV0L 4IJHA 4POFA 1FVIA 4DKAC 4GOPC 1PH3A 1EFWA 4AYBG 1A0IA 4QY7A 1YHAA 1XJVA 1XMOQ 1QZHA 1I94L 3E9HA 4BXXG 2E2HH 5AJ3L 2PI2E 4OWXB 3I56A 1BKBA 5GQOA 2C35B 4YWMA 5IP7H 1WOCA 4OONA 1G51A 1IBML 1Z9FA 4HIKA 4A3CH 4GN5A 2I5LX 4JYAL 2VZAA 4LUVA 4DV7L 4IPCA 3A5ZB 3I55A 3ULPA 1QVCA 3AYHB 1W3SA 4GN3B 4J15A 4JOIA 5M5WH 5FLMH 1E22A 3RN2A 2R7FA 1WJJA 4YCUA 2YYZA 2Q2UA 1BBWA 4ALPA 1IBKL 5M5YH 1CKNA 1NMFA 2HIVA 1OXSC 1RL2A 4DV7Q 2UXDQ 1Y1WH 4B3TL 1N33Q 3AFQA 3F8TA 1Z47A 1PH5A 2A1AA 2OTJA 4A3BG 2YTYA 4P71A 1PH1A 1VQJA 3J80i 3TQYA 2WAQG 2K50A 1C7YA 1XMQL 4WJ3M 2VUMH 1V1QA 1PA6A 2Z0SA 3CPFA 5BR8Q 2PQAA 5GADC 1HR0W 1X3GA 1X6OA 2JK8A 2N49A 1VCIA 3CPWA 3I4MG 1Q46A 4A3EH 3GTLH 4JYAQ 5C44G 1CKMA 4MNOA 2OCEA 2JEAI 4A3LH 4DR5L 3S16H 5J3BA 5C0XI 4IFDI 2D62A 4B3SL 3I2ZA 4C3HH 2JA8G 4P73A 4UY8C 4DR6L 1QUQB 1JE5A 2KCMA 1IBLQ 2JA5G 1VQOA 4JI2L 3F2CA 5C4XG 3T1YL 4DR1L 3HKZE 5EAYA 3S24A 1PVOA 4AH6A 3S2DH 4UP9A 1SROA 4FDBA 4GLVB 3U4ZA 5C44H 4A3JG 1KQSA 4DAMA 3STBC 1VQ9A 4DUYL 3DLLA 4P72A 3E0EA 4LF6Q 2KHIA 4HJ8A 4KLKA 2CFMA 4KI0A 3CC2A 1KRTA 1J6QA 4LUOA 3W5OA 1KRSA 4B3RQ 4IPDA 3UDFA 4A3FH 3S1NH 3LGJA 3HOXG 1BVSA 5IT9c 1TWCH 5C0XJ 4DR7Q 3CCRA 1XMOL 4IOAA 4IFDJ 1N34L 1VQBA 4L5TA 4JI3L 4GKJQ 2MQHA 3HOWG 2YTVA 5GROA 4DV5Q 1K9MC 4OO1G 4A4IA 4EQ5A 4X65Q 2MNAA 4JI7Q 5K36G 1B70B 5C3EG 4LF7Q 5IYCH 1GM5A 4TVAB 2NN6G 1HNWL 2GVAA 4LF9L 1YITA 4DR4Q 1UWVA 1Q1BA 4IO9A 4GOPB 2HHHQ 1OXUA 1AE2A 1XPOA 1Q82C 3IRBA 4C3IH 1HJPA 2AKWB 4KHPQ 3L0OA 1UE6A 1HZCA 3BU2A 1YVCA 4BA2I 2EIFA 2UUBQ 4GLAC 3NEMA 3RLFA 5H1SE 1S72A 1AE3A 2PQAB 1E24A 1HNZL 3KOJA 4GOPA 2UUAQ 2IX0A 4JV5L 1SR3A 3F1ZA 1WYDA 1KIXA 4OX9Q 1IL2A 2ZM6L 4B3TQ 2F3IA 1N33L 3AFPA 4DNIA 4HJ9A 4BXXH 3PO2G 1M90C 1W2BA 4R4OA 5GAGC 3H3VI 1VQLA 3GTMH 3CQZH 3TREA 1Y1VG 5ELNA 1C0AA 3PCOB 4QGUA 3F2BA 3CP0A 3K7AH 4BY7G 3KJPA 4L5RC 1SLJA 4HIMA 3W1GA 4AQYQ 5M3FH 1U0LA 4NB3A 5LMUQ 1YHBA 2PNHA 3PO3G 4GKKQ 2UXBQ 3CCVA 3FHWA 2FXQA 4NXNL 3S1QH 4PZ8A 3ULJA 3I4NH 3CF5A 3B6YA 5FLMG 1S40A 4IPGA 3UDXA 2HT1A 2IX1A 4JI0L 3HOXH 4Y7NH 2Q2HA 1IBMQ 1VQ8A 1QVGA 4GNXB 3UDGA 2ALYB 1D8LA 4JV5Q 1Y1WG 4DV0Q 4YCWA 3G4SA 5JEAJ 2JJQA 4KHZA 4DV1L 4H02A 1YNXA 3CW2C 1IXRA 4LFBQ 1YHQA 1K73C 5LMNL 1XNRL 1PFSA 2JE6I 1J5EQ 2UU9L 2BH2A 2EQSA 2XGTA 1LTLA 2HHHL 5IYDG 3PIPA 4IOCA 4R4IA 3JAMc 1JJGA 4PZ7A 3G6EA 1TWGH 1N8RC 4JI6L 2R93H 1UEBA 4OO1I 1WI5A 3TS0A 2LXJA 3D31A 2E5LQ 4JI7L 3BZKA 4YY3L 4P74A 4QQBX 2AHOB 1NJIC 2CWAA 4A76A 4DR1Q 1EIYB 2BA1A 5IYDH 3MXNB 3STBD 3M85A 1NBWA 4LF4L 1SRUA 3FKIG 1E1TA 4DR3Q 3VDYA 2R7ZH 4X66L 4LFBL 3JAMi 4DR5Q 1OXTA 4L5SA 3KDFA 2VQFL 4LNQA 2QEXA 4DV3Q 4DV2L 1MJEA 4X64Q 4OX9L 4JI1Q 4BBRH 4OWWB 2UUAL 1VQEA 1XPUA 1L0WA 1FGUA 5C0XG 1VQMA 4QL5A 4IFDG 4LFAQ 4YHHL 2VQEQ 5IP9G 1QUQA 1BBUA 1NE3A 2Q2IA 1P8LA 3U4VA 1KHIA 2MO0A 4A3BH 1XNQQ 3TEHB 1TWFH 4B3ML 1PH7A 4R4TA 3PUVA 3PUYA 3RZDH 4JOIC 4YWKA 1PYBA 4IJLA 3GD7A 2N8NA 2VY3A 4JCVE 2JEBI 3PUWA 4ME3A 3J7ZC 3CMEA 3RR5A 1PH9A 3GO5A 4XIGS 4DV6L 4HIDA 1SN8A 5HY6A 5IWAL 2UUCL 4DUYQ 3PF4A 1ASYA 1E3PA 1PV4A 1KD1C 2I0QA 3S2HH 5IYBH 1JJCB 4A3MH 4JBJA 4LWCA 3NELA 4R4CA 5LMNQ 4DV1Q 4A75A 3AEVA 1EQRA 2Z6KA 2YTXA 3HOUG 4DR2Q 4JI8Q 2ES2A 1Q8KA 2A8VA 3T1YQ 1Q12A 2R6GA 5BR8L 3FP9A 1YI2A 1I3QH 1MKHA 3JC66 3CD6A 1GO3E 1VQ5A 2RCNA 3KDFB 1Y14B 4BY1G 4GKKL 4LFCL 1OXXK 1S3OA 2ATWA 5IP7G 1TXYA 1Q86C 1N36Q 2VUMG 3RZOH 3J7A5 3HOVG 2MO1A 1YEZA 1V43A 1EYGA 3E9IA 3K8AA 1IBKQ 3OW2A 1YJWA 3OYYA 4DAYB 3KFUA 4A3IH 4K0KQ 3J81j 3HOYG 1LYLA 1KXLA 3U58A 5JEAG 3PUXA 3H15A 2VS1A 4DV3L 2K5NA 4DV2Q 3PF5A 2A19A 2QA4A 3RNUA 2JA6G 1OTCA 3EIVA 3GDEA 1KC8C 2HQLA 2F52A 1E7ZA 1OXVA 2IHEA 3KLWA 3CCJA 3CCMA 4A3GG 1G6PA 4LFAL 5AJ3Q 4X62L 3GTPH 4R4QA 3PO2H 1HZ9A 3S15H 4JC0A 4X65L 2Y0SG 1N9WA 3CC7A 1X56A 1C9OA 2LXKA 1H95A 4A3FG 3M7NA 2OTLA 1K8AC 4UP7A 1EIFA 5GAEC 2WFWA 3KF8B 1K0RA 1PH8A 4LF5L 2AMCB 4X62Q 5JJIA 4BBSH 2AWNA 3S1MH 4QIWE 4KHPL 4A3JH 2WB1E 2MFIA 4EX5A 4DR7L 2B29A 4GNXC 4LF6L 3ICEA 5ELOA 1V9PA 3H0GG 3CCEA 5IYBG 1J5EL 2UU9Q 1NTGA 1UE7A 4PZ6A 4B3SQ 4LF5Q 2XTIA 3J81c 4BBRG 1KAWA 2NVTH 1VQHA 2CWPA 5M3FG 1VQPA 4LF4Q 4JI6Q 4UP8A 2QGQA 1WCMG 1MJCA 2K14A 4DR3L 4A3EG 2B63G 2UXCQ 2KHJA 3CXCA 4MZ9A 3T1HQ 4NXMQ 1GD7A 2KBNA 3ERSX 1Y1VH 4RMFA 1QVFA 2N3SA 2CKZB 1EQQA 3BJUA 2DGYA 2JA5H 3M9BA 2E8GA 5JJKA 3KF6A 3A0JA 1JT8A 1VS0A 4POGA 4JBMA 1LUZA 1YJNA 2H5XA 1CKOA 4R1JA 1EUJA 3H3VH 3A74A 4JBWA 5LMUL 2IT1A 1QZGA 2IHFA 1PYSB 1LM0A 5FJ8H 4YHHQ 2VQEL 4GN4B 1O7IA 2N78A 3M3YH 4B3MQ 1UE1A 3ULLA 3GTKH 3HOZH 3L7ZC 2JQOA 1I50H 4X64L 2E2JH 1XNRQ 2D0OA 2K4KA 2D0PA 4BY7H 4JG2A 1B7YB 1M1KC 4JI5L 3FKIH 2HIXA 2R7ZG 1VQDA 3S17H 1X54A 2NZHA 2B63H 3I4NG 3G71A 1FJGL 2R92H 2R7DA 2ZTCA 4MTNA 1P16A 3ZJYC 5IYCG 1Q7YC 5C3EH 2VNUD 3EBEA 1D7QA 1E1OA 2JA9A 1G291 1K3RA 4YWLA 2K75A 1HZBA 4DK6C 3M4QA 1JJ2A 4JI5Q 4A93G 2UXDL 1VQGA 3J80c 3S1RH 1VQCA 5IP9H 1VQ6A 4DUZQ 4BA1I 4C2MH 3S14H 1TWAH 4QJFA 1VQIA 4RG1A 4DR2L 2OQKA 3PSIA 4A93H 4APVA 1IYJB 2VW9A 1XTDA 3TRZA 2NVQH 4A3LG 4DV5L 1SE8A 1HR0L 2K5VA 3OTOL 5GAHC 4HJ5A 1YIJA 2JA7G 5M3MG 1NMGA 3Q8DA 1HNWQ 1HNZQ 2VQFQ 1X9NA 5IY0A 4GS3A 2Z6KC 4UPAA 1VQAA 2K5HA 4LF7L 2JA6H 1PH2A 1T9HA 1VQ4A 4LF8Q 4A3GH 1X65A 1L1OC 2V1CC 2L15A 4AYBE 1KL9A 2YU9H 1HNXQ 3I4OA 2GN5A 4A3IG 3RLNA 2RHQB 1R9TH 1VQKA 4LUZA 4XTCS 3CCUA 3CCLA 2F4VL 5LMNW 1EWIA 2OQ0A 4NPSA 4HJAA 3KJOA 2KCTA 1CSPA 1A63A 1N32Q 4YY3Q 5C4XH 1ASZA 2Q2TA 1HR0Q 4YCVA 3CCSA 1Q81C 3K7UC 4JI3Q 1PH4A 3PO3H 1HH2P 4DV6Q 2F4VQ 5M5XH 2R92G 3HFZB 2RF4A 1K83H 2Y0SE 3M4PA 3MEFA 3F2DA 4A3KH 2LSSA 4PG3A 4JBKA 1CKNB 4A3MG 5HGQA 1L2FA 5DLQE 3G48A 1I5FA 3NBHB 4DK3C 3A5UA 2CCZA 1YJ9A 3TS2A 4TQUS 2PI2A 2NVYH 2WB1G 2ZTDA 4A3KG 3UDIA 3PGZA 1HNXL 2GVBA 2WAQE 4LF9Q 4DR4L 4DR6Q 2BA0A 4JI2Q 1PH6A 3GTOH 1WFQA 3UE0A 3GTQH 4AIMA 1X3EA 1K8GA 1VQNA 2WP8J 3SGIA 3CMAA 3GTGH 1YZ6A 2AWOA 2I5MX 3PV0A 3K80C 1SMXA 4DUZL 5M3MH 4L5QA 2NZOA 1CSQA 2VL6A 3T1HL 4NXML 3GTJH 3EN2A 3CCQA 3HOUH 2JA8H 3CC4A 3HOZG 4GNXA 1N36L 1XMQQ 3AQQA 4A3CG 2NVXH 1UE5A 2BH8A 3HKZG 1NY4A 2ZJRA 3KF6B 2ZM6Q 2UXBL 2E2IH 3PUZA 2K52A 2R93G 1XPRA 1SFOH 2ID0A 3HOYH 3DM3A 4IPHA 2UXCL 1GKHA 1IZ6A 2RHSB 3UE1A 2JA7H 1VQFA 1DGSA 3H0GH 4JI8L 1X55A 4HIOA 2B3GA 4HJ7A 3K0XA 2UUCQ 4PMWA 1IBLL 4P75A 4AQYL 3HOVH 3K81C 1X3FA 4WJ4A 3RN5A 4NXNQ 1YBYA 2I5HA 4BBSG 4O0AA 1A62A 1FL0A 2ZJQA 3HOWH 1GVPA 3KYHC 3L2PA 4LFCQ 1XNQL 3WWVA 1FJGQ 3W1BA 1TWHH 4JI4Q 2ZTEA 4JI0Q 5IE8A
chains in the Genus database with same CATH superfamily
2B2WA 1DYQA 1OO9B 2NN6I 1BF4A 1L1OB 2XRQD 1I94Q 3T4AC 4A3DB 1C4QA 3M7GA 1EYDA 3E3XA 4IUNA 1PHJA 3QWNA 2WB1B 5CBEE 4Y52H 2DUDA 1B8AA 2LY7A 5C4JH 2A6HC 3VR3A 1U5KA 1WCMH 1BR9A 4A3DH 3KLRA 3PIOA 4FF3A 2ZJPA 1LT4D 1AN8A 3U50C 4B3RL 2YV5A 1I6HH 4LW1A 2PMZE 1NNXA 1EOTA 3MFYA 4DV0L 1IW7D 1LTBD 1FNVA 1FVIA 4POFA 5C3WA 3SK6A 1QZHA 3FKIB 3E9HA 1STEA 1KDCA 1A6XA 2O5IC 2G5DA 5IP7H 4CDDC 2AQ3B 1WTQA 4GN5A 3GTLB 1PZJD 2QCPX 1I4RA 4JYAL 2VZAA 1XXGA 2G9DA 1QVCA 2HDLA 1O80A 2IJ0A 1WJJA 2Q2UA 5EQ0A 4RWSC 3DWQA 3NK9A 1IBKL 2JA8B 2HIVA 1NMFA 4DV7Q 3I90A 1Z47A 1PH5A 1I4XA 2A1AA 2A73B 4A3BG 2OTJA 3KBGA 4P71A 5C5MA 3I3CA 2K7VA 2N88A 2K50A 1XMQL 1VF5C 2Z0SA 3CPFA 2PQAA 2LMCB 1X6OA 2Q8RE 2R92B 3GTLH 2SNSA 4DR5L 5J3BA 4IFDI 2D62A 2A6EC 4DR6L 2KCMA 1IBLQ 4JI2L 1W6KA 2JA5G 2E2JB 3HOZB 1F2LA 2I46A 3S24A 2F0VA 1PVOA 1BNZA 1TT2A 4GLVB 4CJ2C 4DR7L 1EU3A 3STBC 2E76C 3DLLA 1SNCA 2WIIB 4ULLA 4KLKA 1J6QA 4LUOA 4B3RQ 1KRSA 4N8X1 3LGJA 3CHBD 2MHVA 4I65A 1FD7D 4GKJQ 1VQBA 3FMCA 3NE5B 5K36G 3P20A 2K6AA 1Y8PB 2L1BA 1HNWL 3D6WA 1YITA 1UWVA 4IUTA 4GOPB 1JOKA 1CQFA 1EL0A 1EU4A 4HTHA 4WORA 4BA2I 2EIFA 1E24A 2A6HD 4GOPA 2IX0A 4LJZC 2O2LD 1IL2A 1N33L 3C1EA 4HJ9A 4BXXH 1U4MA 3DXJC 1M90C 3CQZH 1F2MA 2KOLA 5ELNA 3TREA 4DNRB 3PCOB 2VB3X 3F2BA 1M4VA 3T16A 2EPBA 1SLJA 3MXNA 2CVRA 1B53A 5LMUQ 1YHBA 4FXKC 4QCLA 3WDNA 3S1QH 1SNDA 4PZ8A 4RGMA 3CF5A 5FLMG 2B2WC 1I50B 4Y7NH 3GTGB 3UDGA 3ZYYX 1Y1WG 3I72A 4PV1C 4JPBW 4YCWA 5JEAJ 2JJQA 4DV1L 1EQTA 1IXRA 3CW2C 1XNRL 4BBRB 4CDFC 2XGTA 1LTLA 4IOCA 4C3JB 4R4IA 1JJGA 2DY8A 4JI6L 1CHQD 5CGKA 3D31A 2E5LQ 4JI7L 3BZKA 1LT3D 4QQBX 3A8IE 3NQIA 1KABA 2EJMA 3A54A 2BA1A 4Q0FA 5IYDH 1SSOA 3RUZA 3M85A 2R7ZH 3VDYA 1B9NA 4X66L 1UNSA 1OXTA 4P2CB 2F0MA 2QEXA 1EY6A 4DV2L 1MJEA 4OX9L 3ITPA 4BBRH 1AFPA 2KECA 4YHHL 2Q2IA 1NE3A 2A68D 2MO0A 4X3KA 1ILQA 1RTNA 5EKIA 4CJ0B 4ZKBB 4FVMA 1S5FD 3BG3A 3PUYA 2KVMA 4YWKA 2N8NA 1PH9A 4ME3A 2ZXPA 3VR4A 3QG1A 2EE1A 3PF4A 1ASYA 1NSNS 1PV4A 1KD1C 1I4GA 2I0QA 4FO2A 4KD3A 1WTPA 1X32A 4LMQD 1KTKA 1LT6D 1CM9A 3NELA 4WRDA 3EFXD 2A6ED 4QUCA 4HMJA 1EQRA 2YTXA 3JAML 4IUQA 2N55A 2TSSA 4JI8Q 2ES2A 1Q12A 2R6GA 1NR2A 3NUCA 2J0TD 2Q8TA 1Y14B 4M8AA 3HOVB 1MGSA 3CRKC 1PTOC 1JQYD 1EYGA 1V43A 2NTSA 3K8AA 3OW2A 3QO2A 2QW7A 3HOYG 2RDHA 3KBXA 2F03A 5D3IB 5FO9B 4DV2Q 1D5XC 1UAPA 2O5JC 2QA4A 4XT1B 3EIVA 1KC8C 2F52A 1E7ZA 1I4HA 3J7YW 4OO1H 4AYBB 3GTQB 1HZ9A 1ENCA 1H95A 3AMUA 1U4LA 5ISRA 1WTHA 1DOMA 5GAEC 1PH8A 3BVMA 2AMCB 1YNNC 2RVLA 5JJIA 2R61A 4BBSH 4RH6A 3LWUA 5ELDA 3K5MA 2DY7A 1V9PA 1UE7A 1JOOA 4PZ6A 5EBCA 4LF5Q 3I4MB 1GHJA 2OXPA 3VYUA 1VQHA 5M3FG 5C0XH 4JI6Q 1WCMG 2K14A 1MJCA 2QGQA 1NCVA 1HUMA 2F4IA 3D4RA 2OT2A 5EGTA 4RMFA 4HAEA 2EJGC 2DGYA 2TMPA 2E8GA 3GV6A 1YJNA 4XQNA 1CKOA 4KKSA 3V2TA 5LMUL 5FJ8H 2VQEL 3J7AF 2L9HA 4K8JA 1O7IA 1PLFA 3R8BA 5JOBA 2D0PA 1QG7A 1M1KC 4JI5L 2QF7A 4O42A 1LTID 2NZHA 1PTOH 2B63H 1FJGL 5FLXE 1EEID 2CHBD 5C3EH 5EPJA 1ZXTA 2JA9A 5I6YA 1HZBA 4A93G 4G7ZC 4XXEA 3SK5A 1GHKA 1Z6HA 5IP9H 3K5LA 1B50A 4RGOS 4M1UB 1EY0A 1IKLA 2R3ZA 4C2MH 4DK1A 4KN4C 4YIJA 1XTDA 2FFKB 3NWTA 3D3RA 1NMGA 3O13A 4CGYB 5HGTA 2NWGA 2XNAC 4R8NA 1LV9A 1EY5A 4EVOA 2JA6H 1PH2A 3C1FA 3D4DA 1X65A 1L1OC 2YU9H 2GN5A 3MTSA 3SHLA 3CCUA 1VMPA 1EWIA 5A2QL 1HPCA 3P7JA 4NPSA 3KJOA 4HJAA 3TP5A 1N32Q 4YCVA 1EIGA 1STAA 2OF1A 1PH4A 3PO3H 5C44B 2JP1A 4EQPA 5KYIA 1JWSD 2Y0SE 4A3KH 4UHVA 4PG3A 1SXTA 3BS1A 4DK3C 1YJ9A 3TS2A 2PI2A 2NVYH 2WB1G 5CYUA 3NQTA 4FYDA 1HNXL 3J80L 1H9SA 1PH6A 3GTOH 1WFQA 3PO2B 3TP7A 2Q8IB 3E5SA 3SGIA 1J8IA 3CMAA 1TQOA 2NVYB 3GTGH 2I5MX 2SNMA 2NZOA 1PTOF 3T1HL 3GTJH 3CCQA 2JA8H 1SDFA 1PTOB 4A3CG 2KQ3A 2K04A 3S17B 2BH8A 2ZJRA 1SE2A 3KF6B 3C3LA 3IFTA 2EJFC 2ID0A 2CQAA 2UXCL 3QR8A 2BDOA 2RHSB 2JA7H 4HJ7A 2EOTA 3CKIB 3CQZB 1X55A 3K0XA 3GTMB 4P75A 1SYGA 2K28A 1WTWA 4NXNQ 1YBYA 2I5HA 1FGBD 4O0AA 3GP7A 4RKBA 1XNQL 3NTHA 3W2DA 2EDGA 2QEJC 1L0YB 3H6MA 1TWHH 1Q82C 3CAMA 3K58A 2D2CC 1QCBD 1JB7A 5FLXc 3I7FA 3RLOA 3I4MH 1N34Q 3N6RA 4DA2A 5JVG3 4A3JB 4BY1H 3J81i 5IT9E 3D0FA 3HP3A 2Y0SB 2CQOA 1DM0B 1Q1EA 1TWGB 3BDOA 2JYOA 3MC0B 4DGZA 4U673 1NAPA 2M00A 1HZAA 4E6IA 5JVH3 1N32L 1PZID 4CDEC 2AUJD 2ASBA 1JMCA 4DKAC 1GUGA 4AYBG 4QY7A 1YHAA 4BXXG 3AB9A 1TY2A 4OWXB 3I56A 4A3GB 5GQOA 1SYCA 4OONA 4KJOA 1IBML 1Z9FA 4LUVA 3I55A 3ULPA 5IGGA 1H9RA 4GN3B 2XWJB 1HFNA 5M5WH 5FLMH 3RN2A 2L5TA 2EZVA 1PDQA 1BBWA 5M5YH 1CKNA 1F9QA 1OXSC 1RL2A 2EYMA 1YNJC 2K5DA 1BDOA 1G2SA 1N33Q 2X69A 3AFQA 3F8TA 4H44C 1PH1A 1C7YA 3SDZA 2VUMH 1A3TA 2PW7A 5KIXA 1DD2A 1X3GA 2JK8A 2N49A 3CPWA 1JOQA 1Q46A 1CKMA 4MNOA 2JEAI 5C0XI 4B3SL 2B2VC 1GJXA 2JA8G 4UY8C 3GTKB 3KLSA 5EAYA 3S2DH 4UP9A 1TS2A 4A3JG 4NKLA 1V1PB 1VQ9A 4LF6Q 1SNQA 4DUYL 4P72A 3E0EA 1O78A 2CFMA 3CC2A 4GZYC 1KRTA 3A8JE 3OMCA 4N9TA 4RCNA 3UDFA 4A3FH 3IL8A 5C0XJ 4DR7Q 3CCRA 3DM1A 5KEEA 1XMOL 4IOAA 1BCPC 5C4JB 2YTVA 4DV5Q 1K9MC 4OO1G 1E0BA 1EQVA 4JI7Q 5C3EG 4LF7Q 5IYCH 1RHPA 1GM5A 2F0QA 4HCSA 1IL8A 2HHHQ 2FMCA 1AP0A 4C3IH 3SK8A 2F0HA 4XYOA 1KAAA 4GLAC 2PQAB 3KOJA 1SR3A 3F1ZA 1WYDA 1XX8A 1KIXA 4B3TQ 2BE5C 3AFPA 2KHSA 4R4OA 5GAGC 1BCPB 1F9PA 1VQLA 1A15A 4HN7A 3CP0A 3K7AH 5LL6S 4DAVA 1NUCA 4AQYQ 4PMCA 5M3FH 1U0LA 1I4QA 2PPBC 3CU7A 4IZ8A 3FHWA 2FXQA 1B44D 2XRSD 3ULJA 1IW7C 2NVXB 2VB2X 2EYPA 5KGUA 1KNAA 3VYRA 1MSGA 1GUSA 2EYOA 2RSNA 2HT1A 4JI0L 1IBMQ 5J39A 2Q2HA 5JPMC 3HGBA 1DZ1A 1II3A 5IGBA 4K14A 4DV0Q 3HKZB 3BDCA 4H02A 1BXTA 5ELCA 2B39A 1ENFA 1FR3A 1PFSA 3PIP3 1S5ED 3JAMc 1KLGD 4PZ7A 3G6EA 1TWGH 3NXWA 4R9WA 2R93H 4B9XA 1WI5A 5DEHA 3TS0A 2LXJA 3IKJA 3TZDA 2KJXA 4YY3L 1LACA 4F87A 2KUMA 2PYKA 2L12A 3STBD 3SXHA 1JCKB 3S1MB 3HS0C 1GXDC 3JAMi 2O4XA 4L5SA 5A2QE 1VF7A 4L63B 4K5XA 4X64Q 3S1NB 4JI1Q 1R9TB 2F1MA 1XPUA 4QL5A 1QUQA 5FO7B 1QJOA 1P8LA 3U4VA 1KHIA 5K5PA 4A3BH 1XNQQ 1JWUD 1H9KA 1TWFH 2EY1A 3TBIB 2CH4A 1PH7A 4R4TA 4DAYA 5I4DA 4A3LH 3J7ZC 3CMEA 1PFNA 2JEBI 3BDLA 3RR5A 2RKSA 4XIGS 5HY6A 4KD4A 1JE4A 1V1PA 5M3MB 3FPPA 4XQQA 3HG9A 1GOZA 1HA5A 4KKTA 5C5LA 5LMNQ 4A75A 2B2VA 4CHTB 3HOUG 3BYTB 5I9PA 2PO4A 4LAAA 2A8VA 3T1YQ 4ZYSA 1I3QH 3V96A 2KCCA 3EVQA 3KDFB 4GKKL 3K59A 4HSVA 5CV8A 1GUTA 1OXXK 1UEAB 1S3OA 5CV5A 2ATWA 1TXYA 2HCIA 4Z9CB 1S5BD 3GV3A 3J7A5 2MO1A 1SMYC 2EYJA 1YJWA 3I4NB 4DAYB 1STYA 4K0KQ 1TVXA 3DWPA 1LYLA 1KXLA 5COYA 5LL6X 5JEAG 3RZDB 2PQEA 4BS9A 3K7AB 3GDEA 1G91A 2HQLA 1HRJA 3KLWA 1CI3M 1EFID 2PMZB 1BOSA 1SAPA 4R4QA 3NHHA 4X65L 3TDQA 2P5ZX 1U4PA 3C2PA 1HTPA 3M7NA 1V8QA 2OTLA 3VA7A 1EIFA 1WCMB 3KF8B 4X62Q 4MIUA 4I7AA 4QIWE 4KHPL 5EJWA 4EGVA 4MN3A 2MFIA 3ICEA 2LFNA 1NTGA 4B3SQ 1LTAD 1KAWA 4U68A 3K5OA 4ODGA 4IN3A 3ND8A 4IFDH 4DR3L 4A3EG 3CXCA 3T1HQ 1CQVA 2F3VA 1STBA 1GD7A 1SNPA 2KBNA 2L55A 1Y1VH 5I2YA 2N3SA 4A3FB 1JT8A 4HCEA 4QB4A 1XTCD 1B3QA 4J1MA 4JBWA 2KEEA 2IHFA 1ENAA 1MHWC 4OELB 4B3MQ 3MXUA 3GTKH 2F0GA 3L7ZC 2JQOA 4G57A 4X64L 1WTOA 3HOYB 3J81L 3VR2A 3NTIA 4JG2A 4B08A 4JK1C 1CT1D 3FKIH 2HIXA 3T51B 2NVQB 2E74C 1X54A 1P16A 5IYCG 2VNUD 1TWAB 3EBEA 1D7QA 4X3UA 1A3VA 1K3RA 2K03A 4CDCC 1VQGA 3S1RH 3L9AX 5I2XA 4DUZQ 1Q3LA 1Q8IA 3OHXC 3N52A 2CH4W 2XSCA 3IFDA 1TWAH 1ET6A 1VQIA 3J81E 1SNOA 4DR2L 1ILPA 2OQKA 1QB5D 4A93H 3MWYW 2F0KA 2VW9A 5M5WB 1AW7A 3W3AA 5GAHC 4HJ5A 5M5XB 1YIJA 4BY7B 1ONLA 2C5CA 2B2YC 5IY0A 1D1KA 1ZKOA 2Z6KC 1VQAA 4LF7L 3WOFA 3R93A 1T9HA 1VQ4A 4A3GH 1ZEQX 1DJRD 3I4OA 2PZTA 2RHQB 1VQKA 5CC4A 1TWCB 2F4VL 5LMNW 2OQ0A 2KCTA 1CSPA 2GA4B 4NP5A 3CCSA 3NBHA 5EKLA 2NTTA 2MUYA 1HH2P 2AUKA 5NUCA 1ESRA 3VYTA 3TN2A 3HFZB 4IQZA 4IUUA 1K83H 3M4PA 2J7ZA 4A3MG 1LO5D 5HGQA 4C3HB 1L2FA 3NBHB 2QKIC 4K5WA 4KK7A 4TQUS 1T5XD 2RBMA 3EROA 4FNFA 1QNUA 4A3KG 3SR1A 3UDIA 1TS4A 5E3FA 4C56C 3S14B 2WAQE 2DJFC 2BA0A 1EYCA 4K2LA 5BN5A 3GTPB 1K8GA 4C3JG 5LHY1 1VQNA 1YZ6A 1SMXA 2ICEC 3EJIA 4DUZL 4GKKQ 2NBFA 1FNWA 2V4DA 3HOZG 5D14A 4GNXA 1BCPD 3M4YA 1UE5A 1NY4A 2IWHA 4J8QA 2UXBL 3PUZA 5ELBA 1D2BA 4G4KA 1SFOH 4XT3B 2K5WA 4IPHA 1GKHA 3U9OA 3ONAB 1IZ6A 1DOLA 2HCCA 3VR5A 3H0GH 4HIOA 3QB3A 5T1GA 5IGCA 1E2WA 4AQYL 4OL7A 2ZXOA 3RN5A 2K5QA 2A69C 1HTLD 3KYHC 4RKLA 4LFCQ 3H09A 2FJ2A 4OEMB 3W1BA 2ZT9C 4JI0Q 4O1NA 1H9JA 2JSOA 1FYCA 3ER0A 3NPPA 4DPGA 2X6LA 2IY5B 5FKAC 4GLXA 2B2TC 4JI1L 5E7NA 5AFWA 1EOVA 2DNEA 4OWTB 4DV4L 5KNDA 1RIPA 3DEOA 4FXDA 2UUBL 2JN4A 3NENA 1L1OA 4G7HC 1VQ7A 1DCZA 2OWOA 4C3JH 1R4QB 2E5LL 4X6AH 3Q6SA 3BZCA 5IWAQ 1R4PB 2KENA 3HRZC 2D9UA 3C46A 4Q5VA 2FINB 3QJYA 4X66Q 1PH3A 1A0IA 2OEOA 1XJVA 1I94L 1RTOA 3VR6A 2E2HH 1BKBA 2C35B 5J22A 1WOCA 1GUOA 2NN6H 3UI2A 3S1QB 4A3IB 1G51A 4A3CH 1ESFA 3DUZA 3FRPB 1ICFB 3OPOA 3A5ZB 4J15A 4JOIA 2R7FA 2YYZA 4ALPA 2MJ8A 3TP6A 5ELFA 2NZ1D 2UXDQ 1Y1WH 4B3TL 4UAIA 4DN4M 1B9MA 3SE0A 2YTYA 1VQJA 1F9RA 4NDXA 3J80i 1VDZA 1ML0D 1V1QA 2DNCA 4A3MB 5BR8Q 1HR0W 3I4MG 4A3EH 4JYAQ 5C44G 2OCEA 5J1ZA 1PFMA 5K36H 2RSOA 4C3HH 2CW0D 1JE5A 3D6CA 4S3SA 5C4XG 3HKZE 4AH6A 4FDBA 3U4ZA 1KQSA 5I9OA 4DAMA 4HJ8A 4KI0A 3W5OA 4N8FA 2H1EA 1K0SA 5IT9c 1TWCH 4IFDJ 3BYYB 3FDTA 1N34L 4L5TA 1SMYD 3NTKA 1C8CA 3MEHA 2K01A 4A4IA 4X65Q 2MNAA 3H91A 4NW2A 5T1IA 1ZYRC 4LF9L 2NB0A 4IO9A 3ERQA 1AE2A 1SEBD 2F0JA 3Q0AA 1AEXA 1XPOA 3IRBA 1HJPA 4OIKA 4KHPQ 1XWEA 4FF4A 2R93B 1UE6A 2MP1A 5BN3A 3J7AV 1YVCA 4OIJA 2UUBQ 1CA5A 4K6DA 3NEMA 1S72A 5H1SE 2RCFA 4JV5L 2UUAQ 2WINB 4OX9Q 2ZM6L 3PO2G 1TS3A 5FO8B 1W2BA 1PTOD 1Y1VG 1PFBA 1HUNA 5DAUA 4BY7G 2WACA 2EXZA 4L5RC 1PRTD 4HIMA 2Z4IA 4NB3A 2PNHA 2UXBQ 4TRDA 1LT5D 3I4NH 1S40A 5IGFA 1WTXA 3UDXA 3Q22A 2IX1A 1YNJD 1VQ8A 2B2TA 1QVGA 1B1ZA 4ZUIA 2B8FA 3MXPA 4X3SA 4L8JA 1QNKA 3G4SA 3PIO3 2VUMB 1LABA 2PNRC 5C6AA 2B2UC 2JE6I 2UU9L 2BH2A 5D65A 3A7AB 4CKCA 2IX3A 2HHHL 2I07B 3PIPA 3TZUA 1N8RC 3K5NA 1UEBA 4OO1I 2SDFA 5JPNC 4P74A 2AHOB 2PCFB 2CWAA 1D6EC 1NBWA 3L3OC 1SRUA 4PMBA 4C3IG 4DR3Q 1HCZA 5EPLA 1G8ZD 4DR5Q 3KDFA 1ET9A 4ZQ3A 4C3HG 4DV3Q 3E6ZX 2UUAL 1VQEA 1L0WA 1KLUD 1FGUA 3NSWA 5EPKA 5C0XG 3S15B 4A3BB 2VQEQ 5IP9G 2X6GA 1RD9D 4K5VA 1H9MA 3TEHB 4ZCKA 4B3ML 3HOXB 1PRTF 3PUVA 2CW0C 4IJLA 3GD7A 1SE3A 5CV7A 3LWEA 4H0LC 4HIDA 3SVMA 3DEPA 1SN8A 5IWAL 1CZGA 4DUYQ 1JR0D 3URYA 4KJNA 1MI2A 4UDUC 3HOUB 4J6HA 3S2HH 4RHRA 5IYBH 1JJCB 4A3MH 1WTRA 3SK4A 4JBJA 4LK1C 2QDLA 3S1RB 1HQMC 4CBVA 1FNUA 2F0UA 4LWCA 1DXMA 4R4CA 1F77A 1E2ZA 3AEVA 4EQNA 2Z6KA 4DR2Q 5CMDA 1Y69U 2WKDA 5BR8L 1O7LA 1ZYRD 3QOJA 5D3DA 1MKHA 3JC66 3CD6A 1GO3E 2RCNA 4BY1G 4LFCL 5IP7G 1Q86C 2VUMG 3RZOH 1HXYD 3HOVG 3S2HB 3H94A 1Y8NB 1IBKQ 2EYHA 3OYYA 3KFUA 4A3IH 3J81j 3U58A 4DV3L 4KY5A 2A19A 3RNUA 2JA6G 1OTCA 3OMGA 1AZQA 3CCMA 3DMUA 5EKKA 5AJ3Q 3BZDB 3GTPH 3S15H 1K28A 3TMEA 1L0XB 3HEJA 1A2UA 1C9OA 2LXKA 1G2TA 4A3FG 1K8AC 3M4OB 2F0LA 2HD3A 4LF5L 2ZXRA 2F0WA 5DM63 3T56B 4A3EB 3MFGA 4EX5A 4DAPA 2B29A 4GNXC 4LF6L 3CCEA 2UU9Q 2JXMB 2XTIA 4I7ZC 4BBRG 1QWYA 4OHJA 1X3QA 4LF4Q 4UP8A 2B63G 2KHJA 4IURA 3ERSX 2WAQB 1Y8OB 1EQQA 3BJUA 3F2UA 5JJKA 3HOWB 1SYEA 1VS0A 4POGA 4ZLTF 2IT1A 3QOLA 4YHHQ 1IYUA 4RHSA 4GN4B 2JA6B 2N78A 3M3YH 3I70A 1UE1A 4R8IA 3HOZH 2K4KA 4BY7H 2NYZD 4ABNA 4FF2A 3NWSA 2R7ZG 5KNCA 3EQLC 3BVGA 2R7DA 3FVQA 3ZJYC 1STGA 1Q7YC 2D5DA 1E1OA 4JI5Q 4YWLA 4DK6C 3M4QA 2UXDL 1O7YA 5M9OA 2SOBA 3DHQA 2F0NA 3SEBA 1TKWB 1WVLA 5C4ZA 3S14H 1B3AA 5C3EB 1X3PA 5M5YB 1IYJB 1SBBB 2NVQH 4A3LG 1SE8A 1HR0L 4KV6A 1PYWD 2Z9HA 1EEFD 5C4HA 1HNWQ 1HNZQ 4GS3A 5IODA 4RAUC 1HHVA 2V1CC 3MAQA 4AYBE 5C4XB 4A3IG 1R9TH 3RLNA 1STNA 3A7LA 1NR4A 4LUZA 4XTCS 3CCLA 2XWBB 5C3XA 2LKVA 4DXFA 5C4XH 1RJTA 1ASZA 1HR0Q 2Q2TA 2F0OA 3K6OA 3K7UC 4JI3Q 3BVZA 5M5XH 1BBXC 3RZOB 3MEFA 1M8AA 2XIWA 3R3OA 2LSSA 3FPUB 4XDXA 1TIID 1CZWA 1U4RA 1I5FA 4C2MB 3A5UA 4ZAIA 2HDMA 3PGZA 2GVBA 2ENBA 2F0SA 4LF9Q 4N9PA 3UE0A 4AIMA 1IYVA 2E75C 4PQXA 5CV9A 3K80C 2XN9C 1CK1A 4L5QA 1LTTD 2L0CA 1CSQA 4NXML 3EA6A 3HOUH 3OIPA 2E2DC 3PQIA 1N36L 3VA5A 4WJWA 2ZM6Q 2E2IH 2F0PA 2HUGA 1CFMA 4MTKA 2R93G 3DM3A 3UE1A 3M3YB 1DGSA 2K33A 4KY7A 2F0DA 1Z7TA 4RCOA 4JVZA 1IBLL 3HOVH 3K81C 4ID6A 3LNNA 3HOWH 3MA2B 3P75A 1GVPA 2EVBA 5CR3A 3WWVA 5JAVA 4F88A 1Y1VB 4JI4Q 1D1IA 2ZTEA 5IE8A 4JW0A 2L4NA 1CUKA 1SYDA 2EXDA 5FJ8G 4GKJL 1CHPD 3V05A 3S9WA 4OXPA 3A56A 4A3DG 2RDFA 1MIUA 3R2TA 4K0KL 1JWMD 1RF2D 2IW3A 1JORA 4L6TB 4DV4Q 3KK7A 4BY1B 1D5MC 5CV6A 3OTOQ 3M4OH 1EIHA 4IALA 1EY4A 4JI4L 1AH9A 3KUPA 4DF7A 5JJLA 4KTAA 5IT9L 3HKSA 1A8VA 1IKMA 1K3BC 4O2DA 1DOKA 2F0TA 4LF8L 1RDPD 5FLXL 4QUFA 4IJHA 1EFWA 1G6PA 4GOPC 1XMOQ 3GQBA 2AQ2B 2DJGC 3OOCA 2PI2E 4DXGA 5AJ3L 1QOHA 3A55A 4YWMA 1BCPF 4HIKA 5FOBB 2I5LX 1HFGA 3Q23A 4DV7L 4IPCA 1SFOB 1LLRD 1BO0A 1W3SA 3AYHB 5KYLA 1E22A 1A3UA 4YCUA 2LS01 1EY7A 3VYSA 4FP5D 1BQQT 3MVVA 4TKOB 5JEAH 3TQYA 2WAQG 4WJ3M 3GTOB 2IPKD 1PA6A 5CV4A 4DK0A 2B2YA 5GADC 1VCIA 2J4XA 4XQJA 3S16H 4ZK9B 4V190 1LTGD 3I2ZA 4EQOA 4P73A 2EY5A 3U9SA 1QUQB 1VQOA 3F2CA 5A35A 3T1YL 4DR1L 1RCVD 1H9SB 1K83B 2WKCA 5BN4A 1SROA 2C9OA 2F3WA 1WD1A 5C44H 1MD2D 1QE6A 2KHIA 2H4OA 4IPDA 2JA5B 3S1NH 2EY2A 1BVSA 3HOXG 4K8IA 2FHTA 4JI3L 2MQHA 2M2LA 3HOWG 5GROA 4RGTA 4EQ5A 2NVTB 1B70B 2RQXA 3S16B 4TVAB 2NN6G 2GVAA 2WV6D 5KRUA 1WTVA 4DR4Q 1Q1BA 1EY8A 1GUWA 1OXUA 5DM73 1T5EA 2AKWB 3KLSX 3L0OA 5DNFA 1HZCA 3BU2A 3HZXA 3RLFA 1AE3A 1HNZL 1EWCA 1EZ8A 1GUNA 1Y1WB 1CTMA 2F3IA 4DNIA 3H3VI 3GTMH 1C0AA 2F0IA 1A2TA 4QGUA 2JA7B 3CRLC 5IOCA 3KJPA 3K0YA 1I6VC 3I91A 3W1GA 4CJ1B 2DN8A 3TP8A 3PO3G 2KEDA 3T13A 4X3TA 3CCVA 1VMCA 4NXNL 1BUVT 3OW7A 5I6WA 4H7BA 3B6YA 4HSPA 1J9OA 4IPGA 2XVSA 2QILA 2IL8A 3HOXH 1TWFB 4QIWB 3NP8A 2B2UA 4GNXB 5M3FB 2ALYB 1D8LA 5G3LD 4JV5Q 5IGDA 3E0JA 1F2YA 4KHZA 2A5HA 1YNXA 1EZ6A 3T53B 4LFBQ 1YHQA 1K73C 5LMNL 2F0FA 5E4WC 1J5EQ 4OGQC 3K57A 4G7OC 2EQSA 5IYDG 5E4XA 1Q90A 3TSSA 4CKBA 4H13C 4A3KB 1NJIC 4A76A 4DR1Q 4NMZA 4C3IB 3A8KE 1EIYB 3PO3B 3MXNB 4LF4L 1E1TA 3FKIG 4CKEA 4F8MA 1B4OA 1TS5A 5CORA 4LFBL 4BBSB 1XYIA 2VQFL 1WD0A 4LNQA 2PW5A 1S5CD 4OWWB 1SJHD 3MXGA 2YU9B 4HMIA 4IFDG 1VQMA 4LFAQ 1JICA 1BBUA 2AQ1B 5E1FA 1I6HB 1S5DD 1E2VA 3RZDH 4JOIC 1U9RA 1PYBA 2E2IB 2VY3A 4QF4A 4JCVE 3PUWA 1SNMA 5F2DA 3GO5A 4DV6L 2UUCL 2R7ZB 2RDGA 1E3PA 1W6JA 3I4LA 4ME5A 5G3LF 1HA6A 4ZUJA 2Z8LA 1LTRD 2BDNA 1I3QB 4DV1Q 3OSOA 3RD4A 1Q8KA 3R2IA 2B63B 4B9WA 1YI2A 3FP9A 3PMFA 1VQ5A 2BE5D 4FXGC 3JAME 2K05A 1N36Q 1PRTC 1YEZA 4FF1A 3E9IA 1AZPA 4ILWA 2HQEA 1SYFA 1KNEA 4DU9A 3X3MA 4DNTB 3PUXA 3H15A 2EY6A 2VS1A 3OWEB 2EYFA 1PXUA 1F2ZA 1SJED 2K5NA 4QMGA 3LX0A 3PF5A 2E2HB 2A69D 2IHEA 1OXVA 2G9HD 1F9SA 3Q24A 3MZ5A 3CCJA 3KF8A 1KDBA 4A3GG 5TSSA 5L37A 4LFAL 1SYBA 4X62L 3PO2H 3S2DB 5IIFA 4JC0A 2Y0SG 1N9WA 3CC7A 1X56A 1MSHA 2ICIA 4KN7C 4MHEA 4UP7A 3ND9A 1ICWA 2WFWA 4KMUC 1K0RA 2AWNA 3S1MH 3D4WA 4A3JH 2KCNA 2WB1E 4K6LA 4IUVA 4KY6A 1B2TA 5ELOA 1DONA 3H0GG 5IYBG 1J5EL 2PZWA 2RA4A 1RKNA 3J81c 2PZUA 2L11A 2B8GA 2VXWA 3RMHA 2NVTH 2CWPA 1VQPA 4K2KA 2UXCQ 4F7XA 4MZ9A 4NXMQ 1QILA 1D5ZC 1TWHB 2M9VA 1C48A 1QVFA 2CKZB 4HEDA 2JA5H 3M9BA 3KF6A 3A0JA 4JBMA 1LUZA 2H5XA 4R1JA 1EUJA 3FEWX 3A74A 1QZGA 3H3VH 1PYSB 1LM0A 1IHZA 2EYLA 4RA8A 4TSSA 3P1HA 5HURA 3ULLA 3H3VC 1I50H 2E2JH 1XNRQ 2D0OA 3AU7A 3G7LA 3G6JB 1B7YB 5ELEA 3GTJB 5CBAE 1VQDA 3S17H 4PNYA 3OIQA 3I4NG 3G71A 2BCOA 2R92H 2ZTCA 4MTNA 1K8OA 2MPMA 3I8ZA 1G291 3X3NA 2K75A 2Z1CA 1JJ2A 2MGSA 3J80c 1VQCA 1VQ6A 1PRTB 1RODA 3OWFA 4BA1I 3MHBA 4QJFA 4RG1A 1O7ZA 3PSIA 2K1BA 4APVA 3TRZA 4DV5L 2K5VA 4ZKCB 3OTOL 2NUCA 1UUPA 3QIAA 2JA7G 5M3MG 3Q8DA 1LTSD 2VQFQ 1K8MA 1X9NA 4UPAA 1EYAA 5JJZA 2K5HA 4BWGB 4LF8Q 3D8GA 1MBYA 5KNBA 3IAYA 2L15A 1KL9A 4C1NI 4WFN3 1HNXQ 2KA7A 2A68C 4RFBA 1A63A 4YY3Q 1G6ZA 1S4ZA 3H0GB 1Q81C 4IUPA 4DV6Q 2F4VQ 4HR7B 1JC7A 2R92G 2A74C 2RF4A 1PZKD 3F2DA 2Z6BA 3J80E 2QDBA 4V0BA 4JBKA 1CKNB 1JB3A 5DLQE 1HQRD 1STHA 3G48A 2CCZA 4C1NK 4ZRZA 4A93B 2ZTDA 5EBDA 4DR4L 4DR6Q 4KKUA 1TR5A 4JI2Q 4XYQA 3GTQH 1X3EA 1EY9A 4DFAA 2WP8J 3DWAA 1EWHA 2FMMA 5IGEA 2AWOA 5FK9C 3PV0A 4Y7NB 1SE4A 5M3MH 2VL6A 3EN2A 3NBIA 3CC4A 1XMQQ 3AQQA 2K32A 2NVXH 2Z4HA 3HKZG 2F0EA 1PMRA 2K52A 1XPRA 1TY0A 3HOYH 4RGNA 3I73A 1KDAA 1VQFA 4JI8L 2UUCQ 2B3GA 4PMWA 1YNND 4KHVA 1X3FA 4WJ4A 3WOEA 4BBSG 1A62A 1FL0A 1V1OA 2ZJQA 2BOSA 3L2PA 2SEBD 1FJGQ 1CA6A 1I4PA 1TU2B
chains in the Genus database with same CATH topology
3CAMA 2NN6I 3ER0A 4DPGA 1L1OB 1JB7A 2IY5B 4GLXA 5FLXc 3I7FA 4JI1L 1CUKA 3RLOA 1I94Q 2EXDA 5E7NA 3I4MH 5FJ8G 1N34Q 4GKJL 1EOVA 4OWTB 4OXPA 4DV4L 4BY1H 4A3DG 3J81i 1MIUA 1RIPA 4K0KL 3D0FA 1PHJA 2UUBL 2CQOA 3NENA 1L1OA 4Y52H 1Q1EA 2DUDA 1B8AA 1VQ7A 5C4JH 2OWOA 4C3JH 4DV4Q 1U5KA 3OTOQ 1WCMH 3M4OH 2E5LL 4X6AH 4JI4L 4A3DH 1AH9A 5JJLA 3BZCA 5IWAQ 3PIOA 2KENA 2ZJPA 3U50C 4B3RL 1HZAA 2YV5A 1I6HH 3HKSA 4LW1A 1A8VA 1N32L 2PMZE 4O2DA 2ASBA 4LF8L 1JMCA 4X66Q 4DV0L 4IJHA 4POFA 1FVIA 4DKAC 4GOPC 1PH3A 1EFWA 4AYBG 1A0IA 4QY7A 1YHAA 1XJVA 1XMOQ 1QZHA 1I94L 3E9HA 4BXXG 2E2HH 5AJ3L 2PI2E 4OWXB 3I56A 1BKBA 5GQOA 2C35B 4YWMA 5IP7H 1WOCA 4OONA 1G51A 1IBML 1Z9FA 4HIKA 4A3CH 4GN5A 2I5LX 4JYAL 2VZAA 4LUVA 4DV7L 4IPCA 3A5ZB 3I55A 3ULPA 1QVCA 3AYHB 1W3SA 4GN3B 4J15A 4JOIA 5M5WH 5FLMH 1E22A 3RN2A 2R7FA 1WJJA 4YCUA 2YYZA 2Q2UA 1BBWA 4ALPA 1IBKL 5M5YH 1CKNA 1NMFA 2HIVA 1OXSC 1RL2A 4DV7Q 2UXDQ 1Y1WH 4B3TL 1N33Q 3AFQA 3F8TA 1Z47A 1PH5A 2A1AA 2OTJA 4A3BG 2YTYA 4P71A 1PH1A 1VQJA 3J80i 3TQYA 2WAQG 2K50A 1C7YA 1XMQL 4WJ3M 2VUMH 1V1QA 1PA6A 2Z0SA 3CPFA 5BR8Q 2PQAA 5GADC 1HR0W 1X3GA 1X6OA 2JK8A 2N49A 1VCIA 3CPWA 3I4MG 1Q46A 4A3EH 3GTLH 4JYAQ 5C44G 1CKMA 4MNOA 2OCEA 2JEAI 4A3LH 4DR5L 3S16H 5J3BA 5C0XI 4IFDI 2D62A 4B3SL 3I2ZA 4C3HH 2JA8G 4P73A 4UY8C 4DR6L 1QUQB 1JE5A 2KCMA 1IBLQ 2JA5G 1VQOA 4JI2L 3F2CA 5C4XG 3T1YL 4DR1L 3HKZE 5EAYA 3S24A 1PVOA 4AH6A 3S2DH 4UP9A 1SROA 4FDBA 4GLVB 3U4ZA 5C44H 4A3JG 1KQSA 4DAMA 3STBC 1VQ9A 4DUYL 3DLLA 4P72A 3E0EA 4LF6Q 2KHIA 4HJ8A 4KLKA 2CFMA 4KI0A 3CC2A 1KRTA 1J6QA 4LUOA 3W5OA 1KRSA 4B3RQ 4IPDA 3UDFA 4A3FH 3S1NH 3LGJA 3HOXG 1BVSA 5IT9c 1TWCH 5C0XJ 4DR7Q 3CCRA 1XMOL 4IOAA 4IFDJ 1N34L 1VQBA 4L5TA 4JI3L 4GKJQ 2MQHA 3HOWG 2YTVA 5GROA 4DV5Q 1K9MC 4OO1G 4A4IA 4EQ5A 4X65Q 2MNAA 4JI7Q 5K36G 1B70B 5C3EG 4LF7Q 5IYCH 1GM5A 4TVAB 2NN6G 1HNWL 2GVAA 4LF9L 1YITA 4DR4Q 1UWVA 1Q1BA 4IO9A 4GOPB 2HHHQ 1OXUA 1AE2A 1XPOA 1Q82C 3IRBA 4C3IH 1HJPA 2AKWB 4KHPQ 3L0OA 1UE6A 1HZCA 3BU2A 1YVCA 4BA2I 2EIFA 2UUBQ 4GLAC 3NEMA 3RLFA 5H1SE 1S72A 1AE3A 2PQAB 1E24A 1HNZL 3KOJA 4GOPA 2UUAQ 2IX0A 4JV5L 1SR3A 3F1ZA 1WYDA 1KIXA 4OX9Q 1IL2A 2ZM6L 4B3TQ 2F3IA 1N33L 3AFPA 4DNIA 4HJ9A 4BXXH 3PO2G 1M90C 1W2BA 4R4OA 5GAGC 3H3VI 1VQLA 3GTMH 3CQZH 3TREA 1Y1VG 5ELNA 1C0AA 3PCOB 4QGUA 3F2BA 3CP0A 3K7AH 4BY7G 3KJPA 4L5RC 1SLJA 4HIMA 3W1GA 4AQYQ 5M3FH 1U0LA 4NB3A 5LMUQ 1YHBA 2PNHA 3PO3G 4GKKQ 2UXBQ 3CCVA 3FHWA 2FXQA 4NXNL 3S1QH 4PZ8A 3ULJA 3I4NH 3CF5A 3B6YA 5FLMG 1S40A 4IPGA 3UDXA 2HT1A 2IX1A 4JI0L 3HOXH 4Y7NH 2Q2HA 1IBMQ 1VQ8A 1QVGA 4GNXB 3UDGA 2ALYB 1D8LA 4JV5Q 1Y1WG 4DV0Q 4YCWA 3G4SA 5JEAJ 2JJQA 4KHZA 4DV1L 4H02A 1YNXA 3CW2C 1IXRA 4LFBQ 1YHQA 1K73C 5LMNL 1XNRL 1PFSA 2JE6I 1J5EQ 2UU9L 2BH2A 2EQSA 2XGTA 1LTLA 2HHHL 5IYDG 3PIPA 4IOCA 4R4IA 3JAMc 1JJGA 4PZ7A 3G6EA 1TWGH 1N8RC 4JI6L 2R93H 1UEBA 4OO1I 1WI5A 3TS0A 2LXJA 3D31A 2E5LQ 4JI7L 3BZKA 4YY3L 4P74A 4QQBX 2AHOB 1NJIC 2CWAA 4A76A 4DR1Q 1EIYB 2BA1A 5IYDH 3MXNB 3STBD 3M85A 1NBWA 4LF4L 1SRUA 3FKIG 1E1TA 4DR3Q 3VDYA 2R7ZH 4X66L 4LFBL 3JAMi 4DR5Q 1OXTA 4L5SA 3KDFA 2VQFL 4LNQA 2QEXA 4DV3Q 4DV2L 1MJEA 4X64Q 4OX9L 4JI1Q 4BBRH 4OWWB 2UUAL 1VQEA 1XPUA 1L0WA 1FGUA 5C0XG 1VQMA 4QL5A 4IFDG 4LFAQ 4YHHL 2VQEQ 5IP9G 1QUQA 1BBUA 1NE3A 2Q2IA 1P8LA 3U4VA 1KHIA 2MO0A 4A3BH 1XNQQ 3TEHB 1TWFH 4B3ML 1PH7A 4R4TA 3PUVA 3PUYA 3RZDH 4JOIC 4YWKA 1PYBA 4IJLA 3GD7A 2N8NA 2VY3A 4JCVE 2JEBI 3PUWA 4ME3A 3J7ZC 3CMEA 3RR5A 1PH9A 3GO5A 4XIGS 4DV6L 4HIDA 1SN8A 5HY6A 5IWAL 2UUCL 4DUYQ 3PF4A 1ASYA 1E3PA 1PV4A 1KD1C 2I0QA 3S2HH 5IYBH 1JJCB 4A3MH 4JBJA 4LWCA 3NELA 4R4CA 5LMNQ 4DV1Q 4A75A 3AEVA 1EQRA 2Z6KA 2YTXA 3HOUG 4DR2Q 4JI8Q 2ES2A 1Q8KA 2A8VA 3T1YQ 1Q12A 2R6GA 5BR8L 3FP9A 1YI2A 1I3QH 1MKHA 3JC66 3CD6A 1GO3E 1VQ5A 2RCNA 3KDFB 1Y14B 4BY1G 4GKKL 4LFCL 1OXXK 1S3OA 2ATWA 5IP7G 1TXYA 1Q86C 1N36Q 2VUMG 3RZOH 3J7A5 3HOVG 2MO1A 1YEZA 1V43A 1EYGA 3E9IA 3K8AA 1IBKQ 3OW2A 1YJWA 3OYYA 4DAYB 3KFUA 4A3IH 4K0KQ 3J81j 3HOYG 1LYLA 1KXLA 3U58A 5JEAG 3PUXA 3H15A 2VS1A 4DV3L 2K5NA 4DV2Q 3PF5A 2A19A 2QA4A 3RNUA 2JA6G 1OTCA 3EIVA 3GDEA 1KC8C 2HQLA 2F52A 1E7ZA 1OXVA 2IHEA 3KLWA 3CCJA 3CCMA 4A3GG 1G6PA 4LFAL 5AJ3Q 4X62L 3GTPH 4R4QA 3PO2H 1HZ9A 3S15H 4JC0A 4X65L 2Y0SG 1N9WA 3CC7A 1X56A 1C9OA 2LXKA 1H95A 4A3FG 3M7NA 2OTLA 1K8AC 4UP7A 1EIFA 5GAEC 2WFWA 3KF8B 1K0RA 1PH8A 4LF5L 2AMCB 4X62Q 5JJIA 4BBSH 2AWNA 3S1MH 4QIWE 4KHPL 4A3JH 2WB1E 2MFIA 4EX5A 4DR7L 2B29A 4GNXC 4LF6L 3ICEA 5ELOA 1V9PA 3H0GG 3CCEA 5IYBG 1J5EL 2UU9Q 1NTGA 1UE7A 4PZ6A 4B3SQ 4LF5Q 2XTIA 3J81c 4BBRG 1KAWA 2NVTH 1VQHA 2CWPA 5M3FG 1VQPA 4LF4Q 4JI6Q 4UP8A 2QGQA 1WCMG 1MJCA 2K14A 4DR3L 4A3EG 2B63G 2UXCQ 2KHJA 3CXCA 4MZ9A 3T1HQ 4NXMQ 1GD7A 2KBNA 3ERSX 1Y1VH 4RMFA 1QVFA 2N3SA 2CKZB 1EQQA 3BJUA 2DGYA 2JA5H 3M9BA 2E8GA 5JJKA 3KF6A 3A0JA 1JT8A 1VS0A 4POGA 4JBMA 1LUZA 1YJNA 2H5XA 1CKOA 4R1JA 1EUJA 3H3VH 3A74A 4JBWA 5LMUL 2IT1A 1QZGA 2IHFA 1PYSB 1LM0A 5FJ8H 4YHHQ 2VQEL 4GN4B 1O7IA 2N78A 3M3YH 4B3MQ 1UE1A 3ULLA 3GTKH 3HOZH 3L7ZC 2JQOA 1I50H 4X64L 2E2JH 1XNRQ 2D0OA 2K4KA 2D0PA 4BY7H 4JG2A 1B7YB 1M1KC 4JI5L 3FKIH 2HIXA 2R7ZG 1VQDA 3S17H 1X54A 2NZHA 2B63H 3I4NG 3G71A 1FJGL 2R92H 2R7DA 2ZTCA 4MTNA 1P16A 3ZJYC 5IYCG 1Q7YC 5C3EH 2VNUD 3EBEA 1D7QA 1E1OA 2JA9A 1G291 1K3RA 4YWLA 2K75A 1HZBA 4DK6C 3M4QA 1JJ2A 4JI5Q 4A93G 2UXDL 1VQGA 3J80c 3S1RH 1VQCA 5IP9H 1VQ6A 4DUZQ 4BA1I 4C2MH 3S14H 1TWAH 4QJFA 1VQIA 4RG1A 4DR2L 2OQKA 3PSIA 4A93H 4APVA 1IYJB 2VW9A 1XTDA 3TRZA 2NVQH 4A3LG 4DV5L 1SE8A 1HR0L 2K5VA 3OTOL 5GAHC 4HJ5A 1YIJA 2JA7G 5M3MG 1NMGA 3Q8DA 1HNWQ 1HNZQ 2VQFQ 1X9NA 5IY0A 4GS3A 2Z6KC 4UPAA 1VQAA 2K5HA 4LF7L 2JA6H 1PH2A 1T9HA 1VQ4A 4LF8Q 4A3GH 1X65A 1L1OC 2V1CC 2L15A 4AYBE 1KL9A 2YU9H 1HNXQ 3I4OA 2GN5A 4A3IG 3RLNA 2RHQB 1R9TH 1VQKA 4LUZA 4XTCS 3CCUA 3CCLA 2F4VL 5LMNW 1EWIA 2OQ0A 4NPSA 4HJAA 3KJOA 2KCTA 1CSPA 1A63A 1N32Q 4YY3Q 5C4XH 1ASZA 2Q2TA 1HR0Q 4YCVA 3CCSA 1Q81C 3K7UC 4JI3Q 1PH4A 3PO3H 1HH2P 4DV6Q 2F4VQ 5M5XH 2R92G 3HFZB 2RF4A 1K83H 2Y0SE 3M4PA 3MEFA 3F2DA 4A3KH 2LSSA 4PG3A 4JBKA 1CKNB 4A3MG 5HGQA 1L2FA 5DLQE 3G48A 1I5FA 3NBHB 4DK3C 3A5UA 2CCZA 1YJ9A 3TS2A 4TQUS 2PI2A 2NVYH 2WB1G 2ZTDA 4A3KG 3UDIA 3PGZA 1HNXL 2GVBA 2WAQE 4LF9Q 4DR4L 4DR6Q 2BA0A 4JI2Q 1PH6A 3GTOH 1WFQA 3UE0A 3GTQH 4AIMA 1X3EA 1K8GA 1VQNA 2WP8J 3SGIA 3CMAA 3GTGH 1YZ6A 2AWOA 2I5MX 3PV0A 3K80C 1SMXA 4DUZL 5M3MH 4L5QA 2NZOA 1CSQA 2VL6A 3T1HL 4NXML 3GTJH 3EN2A 3CCQA 3HOUH 2JA8H 3CC4A 3HOZG 4GNXA 1N36L 1XMQQ 3AQQA 4A3CG 2NVXH 1UE5A 2BH8A 3HKZG 1NY4A 2ZJRA 3KF6B 2ZM6Q 2UXBL 2E2IH 3PUZA 2K52A 2R93G 1XPRA 1SFOH 2ID0A 3HOYH 3DM3A 4IPHA 2UXCL 1GKHA 1IZ6A 2RHSB 3UE1A 2JA7H 1VQFA 1DGSA 3H0GH 4JI8L 1X55A 4HIOA 2B3GA 4HJ7A 3K0XA 2UUCQ 4PMWA 1IBLL 4P75A 4AQYL 3HOVH 3K81C 1X3FA 4WJ4A 3RN5A 4NXNQ 1YBYA 2I5HA 4BBSG 4O0AA 1A62A 1FL0A 2ZJQA 3HOWH 1GVPA 3KYHC 3L2PA 4LFCQ 1XNQL 3WWVA 1FJGQ 3W1BA 1TWHH 4JI4Q 2ZTEA 4JI0Q 5IE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAM A;  2NN6 I;  3ER0 A;  4DPG A;  1L1O B;  1JB7 A;  2IY5 B;  4GLX A;  5FLX c;  3I7F A;  4JI1 L;  1CUK A;  3RLO A;  1I94 Q;  2EXD A;  5E7N A;  3I4M H;  5FJ8 G;  1N34 Q;  4GKJ L;  1EOV A;  4OWT B;  4OXP A;  4DV4 L;  4BY1 H;  4A3D G;  3J81 i;  1MIU A;  1RIP A;  4K0K L;  3D0F A;  1PHJ A;  2UUB L;  2CQO A;  3NEN A;  1L1O A;  4Y52 H;  1Q1E A;  2DUD A;  1B8A A;  1VQ7 A;  5C4J H;  2OWO A;  4C3J H;  4DV4 Q;  1U5K A;  3OTO Q;  1WCM H;  3M4O H;  2E5L L;  4X6A H;  4JI4 L;  4A3D H;  1AH9 A;  5JJL A;  3BZC A;  5IWA Q;  3PIO A;  2KEN A;  2ZJP A;  3U50 C;  4B3R L;  1HZA A;  2YV5 A;  1I6H H;  3HKS A;  4LW1 A;  1A8V A;  1N32 L;  2PMZ E;  4O2D A;  2ASB A;  4LF8 L;  1JMC A;  4X66 Q;  4DV0 L;  4IJH A;  4POF A;  1FVI A;  4DKA C;  4GOP C;  1PH3 A;  1EFW A;  4AYB G;  1A0I A;  4QY7 A;  1YHA A;  1XJV A;  1XMO Q;  1QZH A;  1I94 L;  3E9H A;  4BXX G;  2E2H H;  5AJ3 L;  2PI2 E;  4OWX B;  3I56 A;  1BKB A;  5GQO A;  2C35 B;  4YWM A;  5IP7 H;  1WOC A;  4OON A;  1G51 A;  1IBM L;  1Z9F A;  4HIK A;  4A3C H;  4GN5 A;  2I5L X;  4JYA L;  2VZA A;  4LUV A;  4DV7 L;  4IPC A;  3A5Z B;  3I55 A;  3ULP A;  1QVC A;  3AYH B;  1W3S A;  4GN3 B;  4J15 A;  4JOI A;  5M5W H;  5FLM H;  1E22 A;  3RN2 A;  2R7F A;  1WJJ A;  4YCU A;  2YYZ A;  2Q2U A;  1BBW A;  4ALP A;  1IBK L;  5M5Y H;  1CKN A;  1NMF A;  2HIV A;  1OXS C;  1RL2 A;  4DV7 Q;  2UXD Q;  1Y1W H;  4B3T L;  1N33 Q;  3AFQ A;  3F8T A;  1Z47 A;  1PH5 A;  2A1A A;  2OTJ A;  4A3B G;  2YTY A;  4P71 A;  1PH1 A;  1VQJ A;  3J80 i;  3TQY A;  2WAQ G;  2K50 A;  1C7Y A;  1XMQ L;  4WJ3 M;  2VUM H;  1V1Q A;  1PA6 A;  2Z0S A;  3CPF A;  5BR8 Q;  2PQA A;  5GAD C;  1HR0 W;  1X3G A;  1X6O A;  2JK8 A;  2N49 A;  1VCI A;  3CPW A;  3I4M G;  1Q46 A;  4A3E H;  3GTL H;  4JYA Q;  5C44 G;  1CKM A;  4MNO A;  2OCE A;  2JEA I;  4A3L H;  4DR5 L;  3S16 H;  5J3B A;  5C0X I;  4IFD I;  2D62 A;  4B3S L;  3I2Z A;  4C3H H;  2JA8 G;  4P73 A;  4UY8 C;  4DR6 L;  1QUQ B;  1JE5 A;  2KCM A;  1IBL Q;  2JA5 G;  1VQO A;  4JI2 L;  3F2C A;  5C4X G;  3T1Y L;  4DR1 L;  3HKZ E;  5EAY A;  3S24 A;  1PVO A;  4AH6 A;  3S2D H;  4UP9 A;  1SRO A;  4FDB A;  4GLV B;  3U4Z A;  5C44 H;  4A3J G;  1KQS A;  4DAM A;  3STB C;  1VQ9 A;  4DUY L;  3DLL A;  4P72 A;  3E0E A;  4LF6 Q;  2KHI A;  4HJ8 A;  4KLK A;  2CFM A;  4KI0 A;  3CC2 A;  1KRT A;  1J6Q A;  4LUO A;  3W5O A;  1KRS A;  4B3R Q;  4IPD A;  3UDF A;  4A3F H;  3S1N H;  3LGJ A;  3HOX G;  1BVS A;  5IT9 c;  1TWC H;  5C0X J;  4DR7 Q;  3CCR A;  1XMO L;  4IOA A;  4IFD J;  1N34 L;  1VQB A;  4L5T A;  4JI3 L;  4GKJ Q;  2MQH A;  3HOW G;  2YTV A;  5GRO A;  4DV5 Q;  1K9M C;  4OO1 G;  4A4I A;  4EQ5 A;  4X65 Q;  2MNA A;  4JI7 Q;  5K36 G;  1B70 B;  5C3E G;  4LF7 Q;  5IYC H;  1GM5 A;  4TVA B;  2NN6 G;  1HNW L;  2GVA A;  4LF9 L;  1YIT A;  4DR4 Q;  1UWV A;  1Q1B A;  4IO9 A;  4GOP B;  2HHH Q;  1OXU A;  1AE2 A;  1XPO A;  1Q82 C;  3IRB A;  4C3I H;  1HJP A;  2AKW B;  4KHP Q;  3L0O A;  1UE6 A;  1HZC A;  3BU2 A;  1YVC A;  4BA2 I;  2EIF A;  2UUB Q;  4GLA C;  3NEM A;  3RLF A;  5H1S E;  1S72 A;  1AE3 A;  2PQA B;  1E24 A;  1HNZ L;  3KOJ A;  4GOP A;  2UUA Q;  2IX0 A;  4JV5 L;  1SR3 A;  3F1Z A;  1WYD A;  1KIX A;  4OX9 Q;  1IL2 A;  2ZM6 L;  4B3T Q;  2F3I A;  1N33 L;  3AFP A;  4DNI A;  4HJ9 A;  4BXX H;  3PO2 G;  1M90 C;  1W2B A;  4R4O A;  5GAG C;  3H3V I;  1VQL A;  3GTM H;  3CQZ H;  3TRE A;  1Y1V G;  5ELN A;  1C0A A;  3PCO B;  4QGU A;  3F2B A;  3CP0 A;  3K7A H;  4BY7 G;  3KJP A;  4L5R C;  1SLJ A;  4HIM A;  3W1G A;  4AQY Q;  5M3F H;  1U0L A;  4NB3 A;  5LMU Q;  1YHB A;  2PNH A;  3PO3 G;  4GKK Q;  2UXB Q;  3CCV A;  3FHW A;  2FXQ A;  4NXN L;  3S1Q H;  4PZ8 A;  3ULJ A;  3I4N H;  3CF5 A;  3B6Y A;  5FLM G;  1S40 A;  4IPG A;  3UDX A;  2HT1 A;  2IX1 A;  4JI0 L;  3HOX H;  4Y7N H;  2Q2H A;  1IBM Q;  1VQ8 A;  1QVG A;  4GNX B;  3UDG A;  2ALY B;  1D8L A;  4JV5 Q;  1Y1W G;  4DV0 Q;  4YCW A;  3G4S A;  5JEA J;  2JJQ A;  4KHZ A;  4DV1 L;  4H02 A;  1YNX A;  3CW2 C;  1IXR A;  4LFB Q;  1YHQ A;  1K73 C;  5LMN L;  1XNR L;  1PFS A;  2JE6 I;  1J5E Q;  2UU9 L;  2BH2 A;  2EQS A;  2XGT A;  1LTL A;  2HHH L;  5IYD G;  3PIP A;  4IOC A;  4R4I A;  3JAM c;  1JJG A;  4PZ7 A;  3G6E A;  1TWG H;  1N8R C;  4JI6 L;  2R93 H;  1UEB A;  4OO1 I;  1WI5 A;  3TS0 A;  2LXJ A;  3D31 A;  2E5L Q;  4JI7 L;  3BZK A;  4YY3 L;  4P74 A;  4QQB X;  2AHO B;  1NJI C;  2CWA A;  4A76 A;  4DR1 Q;  1EIY B;  2BA1 A;  5IYD H;  3MXN B;  3STB D;  3M85 A;  1NBW A;  4LF4 L;  1SRU A;  3FKI G;  1E1T A;  4DR3 Q;  3VDY A;  2R7Z H;  4X66 L;  4LFB L;  3JAM i;  4DR5 Q;  1OXT A;  4L5S A;  3KDF A;  2VQF L;  4LNQ A;  2QEX A;  4DV3 Q;  4DV2 L;  1MJE A;  4X64 Q;  4OX9 L;  4JI1 Q;  4BBR H;  4OWW B;  2UUA L;  1VQE A;  1XPU A;  1L0W A;  1FGU A;  5C0X G;  1VQM A;  4QL5 A;  4IFD G;  4LFA Q;  4YHH L;  2VQE Q;  5IP9 G;  1QUQ A;  1BBU A;  1NE3 A;  2Q2I A;  1P8L A;  3U4V A;  1KHI A;  2MO0 A;  4A3B H;  1XNQ Q;  3TEH B;  1TWF H;  4B3M L;  1PH7 A;  4R4T A;  3PUV A;  3PUY A;  3RZD H;  4JOI C;  4YWK A;  1PYB A;  4IJL A;  3GD7 A;  2N8N A;  2VY3 A;  4JCV E;  2JEB I;  3PUW A;  4ME3 A;  3J7Z C;  3CME A;  3RR5 A;  1PH9 A;  3GO5 A;  4XIG S;  4DV6 L;  4HID A;  1SN8 A;  5HY6 A;  5IWA L;  2UUC L;  4DUY Q;  3PF4 A;  1ASY A;  1E3P A;  1PV4 A;  1KD1 C;  2I0Q A;  3S2H H;  5IYB H;  1JJC B;  4A3M H;  4JBJ A;  4LWC A;  3NEL A;  4R4C A;  5LMN Q;  4DV1 Q;  4A75 A;  3AEV A;  1EQR A;  2Z6K A;  2YTX A;  3HOU G;  4DR2 Q;  4JI8 Q;  2ES2 A;  1Q8K A;  2A8V A;  3T1Y Q;  1Q12 A;  2R6G A;  5BR8 L;  3FP9 A;  1YI2 A;  1I3Q H;  1MKH A;  3JC6 6;  3CD6 A;  1GO3 E;  1VQ5 A;  2RCN A;  3KDF B;  1Y14 B;  4BY1 G;  4GKK L;  4LFC L;  1OXX K;  1S3O A;  2ATW A;  5IP7 G;  1TXY A;  1Q86 C;  1N36 Q;  2VUM G;  3RZO H;  3J7A 5;  3HOV G;  2MO1 A;  1YEZ A;  1V43 A;  1EYG A;  3E9I A;  3K8A A;  1IBK Q;  3OW2 A;  1YJW A;  3OYY A;  4DAY B;  3KFU A;  4A3I H;  4K0K Q;  3J81 j;  3HOY G;  1LYL A;  1KXL A;  3U58 A;  5JEA G;  3PUX A;  3H15 A;  2VS1 A;  4DV3 L;  2K5N A;  4DV2 Q;  3PF5 A;  2A19 A;  2QA4 A;  3RNU A;  2JA6 G;  1OTC A;  3EIV A;  3GDE A;  1KC8 C;  2HQL A;  2F52 A;  1E7Z A;  1OXV A;  2IHE A;  3KLW A;  3CCJ A;  3CCM A;  4A3G G;  1G6P A;  4LFA L;  5AJ3 Q;  4X62 L;  3GTP H;  4R4Q A;  3PO2 H;  1HZ9 A;  3S15 H;  4JC0 A;  4X65 L;  2Y0S G;  1N9W A;  3CC7 A;  1X56 A;  1C9O A;  2LXK A;  1H95 A;  4A3F G;  3M7N A;  2OTL A;  1K8A C;  4UP7 A;  1EIF A;  5GAE C;  2WFW A;  3KF8 B;  1K0R A;  1PH8 A;  4LF5 L;  2AMC B;  4X62 Q;  5JJI A;  4BBS H;  2AWN A;  3S1M H;  4QIW E;  4KHP L;  4A3J H;  2WB1 E;  2MFI A;  4EX5 A;  4DR7 L;  2B29 A;  4GNX C;  4LF6 L;  3ICE A;  5ELO A;  1V9P A;  3H0G G;  3CCE A;  5IYB G;  1J5E L;  2UU9 Q;  1NTG A;  1UE7 A;  4PZ6 A;  4B3S Q;  4LF5 Q;  2XTI A;  3J81 c;  4BBR G;  1KAW A;  2NVT H;  1VQH A;  2CWP A;  5M3F G;  1VQP A;  4LF4 Q;  4JI6 Q;  4UP8 A;  2QGQ A;  1WCM G;  1MJC A;  2K14 A;  4DR3 L;  4A3E G;  2B63 G;  2UXC Q;  2KHJ A;  3CXC A;  4MZ9 A;  3T1H Q;  4NXM Q;  1GD7 A;  2KBN A;  3ERS X;  1Y1V H;  4RMF A;  1QVF A;  2N3S A;  2CKZ B;  1EQQ A;  3BJU A;  2DGY A;  2JA5 H;  3M9B A;  2E8G A;  5JJK A;  3KF6 A;  3A0J A;  1JT8 A;  1VS0 A;  4POG A;  4JBM A;  1LUZ A;  1YJN A;  2H5X A;  1CKO A;  4R1J A;  1EUJ A;  3H3V H;  3A74 A;  4JBW A;  5LMU L;  2IT1 A;  1QZG A;  2IHF A;  1PYS B;  1LM0 A;  5FJ8 H;  4YHH Q;  2VQE L;  4GN4 B;  1O7I A;  2N78 A;  3M3Y H;  4B3M Q;  1UE1 A;  3ULL A;  3GTK H;  3HOZ H;  3L7Z C;  2JQO A;  1I50 H;  4X64 L;  2E2J H;  1XNR Q;  2D0O A;  2K4K A;  2D0P A;  4BY7 H;  4JG2 A;  1B7Y B;  1M1K C;  4JI5 L;  3FKI H;  2HIX A;  2R7Z G;  1VQD A;  3S17 H;  1X54 A;  2NZH A;  2B63 H;  3I4N G;  3G71 A;  1FJG L;  2R92 H;  2R7D A;  2ZTC A;  4MTN A;  1P16 A;  3ZJY C;  5IYC G;  1Q7Y C;  5C3E H;  2VNU D;  3EBE A;  1D7Q A;  1E1O A;  2JA9 A;  1G29 1;  1K3R A;  4YWL A;  2K75 A;  1HZB A;  4DK6 C;  3M4Q A;  1JJ2 A;  4JI5 Q;  4A93 G;  2UXD L;  1VQG A;  3J80 c;  3S1R H;  1VQC A;  5IP9 H;  1VQ6 A;  4DUZ Q;  4BA1 I;  4C2M H;  3S14 H;  1TWA H;  4QJF A;  1VQI A;  4RG1 A;  4DR2 L;  2OQK A;  3PSI A;  4A93 H;  4APV A;  1IYJ B;  2VW9 A;  1XTD A;  3TRZ A;  2NVQ H;  4A3L G;  4DV5 L;  1SE8 A;  1HR0 L;  2K5V A;  3OTO L;  5GAH C;  4HJ5 A;  1YIJ A;  2JA7 G;  5M3M G;  1NMG A;  3Q8D A;  1HNW Q;  1HNZ Q;  2VQF Q;  1X9N A;  5IY0 A;  4GS3 A;  2Z6K C;  4UPA A;  1VQA A;  2K5H A;  4LF7 L;  2JA6 H;  1PH2 A;  1T9H A;  1VQ4 A;  4LF8 Q;  4A3G H;  1X65 A;  1L1O C;  2V1C C;  2L15 A;  4AYB E;  1KL9 A;  2YU9 H;  1HNX Q;  3I4O A;  2GN5 A;  4A3I G;  3RLN A;  2RHQ B;  1R9T H;  1VQK A;  4LUZ A;  4XTC S;  3CCU A;  3CCL A;  2F4V L;  5LMN W;  1EWI A;  2OQ0 A;  4NPS A;  4HJA A;  3KJO A;  2KCT A;  1CSP A;  1A63 A;  1N32 Q;  4YY3 Q;  5C4X H;  1ASZ A;  2Q2T A;  1HR0 Q;  4YCV A;  3CCS A;  1Q81 C;  3K7U C;  4JI3 Q;  1PH4 A;  3PO3 H;  1HH2 P;  4DV6 Q;  2F4V Q;  5M5X H;  2R92 G;  3HFZ B;  2RF4 A;  1K83 H;  2Y0S E;  3M4P A;  3MEF A;  3F2D A;  4A3K H;  2LSS A;  4PG3 A;  4JBK A;  1CKN B;  4A3M G;  5HGQ A;  1L2F A;  5DLQ E;  3G48 A;  1I5F A;  3NBH B;  4DK3 C;  3A5U A;  2CCZ A;  1YJ9 A;  3TS2 A;  4TQU S;  2PI2 A;  2NVY H;  2WB1 G;  2ZTD A;  4A3K G;  3UDI A;  3PGZ A;  1HNX L;  2GVB A;  2WAQ E;  4LF9 Q;  4DR4 L;  4DR6 Q;  2BA0 A;  4JI2 Q;  1PH6 A;  3GTO H;  1WFQ A;  3UE0 A;  3GTQ H;  4AIM A;  1X3E A;  1K8G A;  1VQN A;  2WP8 J;  3SGI A;  3CMA A;  3GTG H;  1YZ6 A;  2AWO A;  2I5M X;  3PV0 A;  3K80 C;  1SMX A;  4DUZ L;  5M3M H;  4L5Q A;  2NZO A;  1CSQ A;  2VL6 A;  3T1H L;  4NXM L;  3GTJ H;  3EN2 A;  3CCQ A;  3HOU H;  2JA8 H;  3CC4 A;  3HOZ G;  4GNX A;  1N36 L;  1XMQ Q;  3AQQ A;  4A3C G;  2NVX H;  1UE5 A;  2BH8 A;  3HKZ G;  1NY4 A;  2ZJR A;  3KF6 B;  2ZM6 Q;  2UXB L;  2E2I H;  3PUZ A;  2K52 A;  2R93 G;  1XPR A;  1SFO H;  2ID0 A;  3HOY H;  3DM3 A;  4IPH A;  2UXC L;  1GKH A;  1IZ6 A;  2RHS B;  3UE1 A;  2JA7 H;  1VQF A;  1DGS A;  3H0G H;  4JI8 L;  1X55 A;  4HIO A;  2B3G A;  4HJ7 A;  3K0X A;  2UUC Q;  4PMW A;  1IBL L;  4P75 A;  4AQY L;  3HOV H;  3K81 C;  1X3F A;  4WJ4 A;  3RN5 A;  4NXN Q;  1YBY A;  2I5H A;  4BBS G;  4O0A A;  1A62 A;  1FL0 A;  2ZJQ A;  3HOW H;  1GVP A;  3KYH C;  3L2P A;  4LFC Q;  1XNQ L;  3WWV A;  1FJG Q;  3W1B A;  1TWH H;  4JI4 Q;  2ZTE A;  4JI0 Q;  5IE8 A; 
#chains in the Genus database with same CATH topology
 2B2W A;  1DYQ A;  1OO9 B;  2NN6 I;  1BF4 A;  1L1O B;  2XRQ D;  1I94 Q;  3T4A C;  4A3D B;  1C4Q A;  3M7G A;  1EYD A;  3E3X A;  4IUN A;  1PHJ A;  3QWN A;  2WB1 B;  5CBE E;  4Y52 H;  2DUD A;  1B8A A;  2LY7 A;  5C4J H;  2A6H C;  3VR3 A;  1U5K A;  1WCM H;  1BR9 A;  4A3D H;  3KLR A;  3PIO A;  4FF3 A;  2ZJP A;  1LT4 D;  1AN8 A;  3U50 C;  4B3R L;  2YV5 A;  1I6H H;  4LW1 A;  2PMZ E;  1NNX A;  1EOT A;  3MFY A;  4DV0 L;  1IW7 D;  1LTB D;  1FNV A;  1FVI A;  4POF A;  5C3W A;  3SK6 A;  1QZH A;  3FKI B;  3E9H A;  1STE A;  1KDC A;  1A6X A;  2O5I C;  2G5D A;  5IP7 H;  4CDD C;  2AQ3 B;  1WTQ A;  4GN5 A;  3GTL B;  1PZJ D;  2QCP X;  1I4R A;  4JYA L;  2VZA A;  1XXG A;  2G9D A;  1QVC A;  2HDL A;  1O80 A;  2IJ0 A;  1WJJ A;  2Q2U A;  5EQ0 A;  4RWS C;  3DWQ A;  3NK9 A;  1IBK L;  2JA8 B;  2HIV A;  1NMF A;  4DV7 Q;  3I90 A;  1Z47 A;  1PH5 A;  1I4X A;  2A1A A;  2A73 B;  4A3B G;  2OTJ A;  3KBG A;  4P71 A;  5C5M A;  3I3C A;  2K7V A;  2N88 A;  2K50 A;  1XMQ L;  1VF5 C;  2Z0S A;  3CPF A;  2PQA A;  2LMC B;  1X6O A;  2Q8R E;  2R92 B;  3GTL H;  2SNS A;  4DR5 L;  5J3B A;  4IFD I;  2D62 A;  2A6E C;  4DR6 L;  2KCM A;  1IBL Q;  4JI2 L;  1W6K A;  2JA5 G;  2E2J B;  3HOZ B;  1F2L A;  2I46 A;  3S24 A;  2F0V A;  1PVO A;  1BNZ A;  1TT2 A;  4GLV B;  4CJ2 C;  4DR7 L;  1EU3 A;  3STB C;  2E76 C;  3DLL A;  1SNC A;  2WII B;  4ULL A;  4KLK A;  1J6Q A;  4LUO A;  4B3R Q;  1KRS A;  4N8X 1;  3LGJ A;  3CHB D;  2MHV A;  4I65 A;  1FD7 D;  4GKJ Q;  1VQB A;  3FMC A;  3NE5 B;  5K36 G;  3P20 A;  2K6A A;  1Y8P B;  2L1B A;  1HNW L;  3D6W A;  1YIT A;  1UWV A;  4IUT A;  4GOP B;  1JOK A;  1CQF A;  1EL0 A;  1EU4 A;  4HTH A;  4WOR A;  4BA2 I;  2EIF A;  1E24 A;  2A6H D;  4GOP A;  2IX0 A;  4LJZ C;  2O2L D;  1IL2 A;  1N33 L;  3C1E A;  4HJ9 A;  4BXX H;  1U4M A;  3DXJ C;  1M90 C;  3CQZ H;  1F2M A;  2KOL A;  5ELN A;  3TRE A;  4DNR B;  3PCO B;  2VB3 X;  3F2B A;  1M4V A;  3T16 A;  2EPB A;  1SLJ A;  3MXN A;  2CVR A;  1B53 A;  5LMU Q;  1YHB A;  4FXK C;  4QCL A;  3WDN A;  3S1Q H;  1SND A;  4PZ8 A;  4RGM A;  3CF5 A;  5FLM G;  2B2W C;  1I50 B;  4Y7N H;  3GTG B;  3UDG A;  3ZYY X;  1Y1W G;  3I72 A;  4PV1 C;  4JPB W;  4YCW A;  5JEA J;  2JJQ A;  4DV1 L;  1EQT A;  1IXR A;  3CW2 C;  1XNR L;  4BBR B;  4CDF C;  2XGT A;  1LTL A;  4IOC A;  4C3J B;  4R4I A;  1JJG A;  2DY8 A;  4JI6 L;  1CHQ D;  5CGK A;  3D31 A;  2E5L Q;  4JI7 L;  3BZK A;  1LT3 D;  4QQB X;  3A8I E;  3NQI A;  1KAB A;  2EJM A;  3A54 A;  2BA1 A;  4Q0F A;  5IYD H;  1SSO A;  3RUZ A;  3M85 A;  2R7Z H;  3VDY A;  1B9N A;  4X66 L;  1UNS A;  1OXT A;  4P2C B;  2F0M A;  2QEX A;  1EY6 A;  4DV2 L;  1MJE A;  4OX9 L;  3ITP A;  4BBR H;  1AFP A;  2KEC A;  4YHH L;  2Q2I A;  1NE3 A;  2A68 D;  2MO0 A;  4X3K A;  1ILQ A;  1RTN A;  5EKI A;  4CJ0 B;  4ZKB B;  4FVM A;  1S5F D;  3BG3 A;  3PUY A;  2KVM A;  4YWK A;  2N8N A;  1PH9 A;  4ME3 A;  2ZXP A;  3VR4 A;  3QG1 A;  2EE1 A;  3PF4 A;  1ASY A;  1NSN S;  1PV4 A;  1KD1 C;  1I4G A;  2I0Q A;  4FO2 A;  4KD3 A;  1WTP A;  1X32 A;  4LMQ D;  1KTK A;  1LT6 D;  1CM9 A;  3NEL A;  4WRD A;  3EFX D;  2A6E D;  4QUC A;  4HMJ A;  1EQR A;  2YTX A;  3JAM L;  4IUQ A;  2N55 A;  2TSS A;  4JI8 Q;  2ES2 A;  1Q12 A;  2R6G A;  1NR2 A;  3NUC A;  2J0T D;  2Q8T A;  1Y14 B;  4M8A A;  3HOV B;  1MGS A;  3CRK C;  1PTO C;  1JQY D;  1EYG A;  1V43 A;  2NTS A;  3K8A A;  3OW2 A;  3QO2 A;  2QW7 A;  3HOY G;  2RDH A;  3KBX A;  2F03 A;  5D3I B;  5FO9 B;  4DV2 Q;  1D5X C;  1UAP A;  2O5J C;  2QA4 A;  4XT1 B;  3EIV A;  1KC8 C;  2F52 A;  1E7Z A;  1I4H A;  3J7Y W;  4OO1 H;  4AYB B;  3GTQ B;  1HZ9 A;  1ENC A;  1H95 A;  3AMU A;  1U4L A;  5ISR A;  1WTH A;  1DOM A;  5GAE C;  1PH8 A;  3BVM A;  2AMC B;  1YNN C;  2RVL A;  5JJI A;  2R61 A;  4BBS H;  4RH6 A;  3LWU A;  5ELD A;  3K5M A;  2DY7 A;  1V9P A;  1UE7 A;  1JOO A;  4PZ6 A;  5EBC A;  4LF5 Q;  3I4M B;  1GHJ A;  2OXP A;  3VYU A;  1VQH A;  5M3F G;  5C0X H;  4JI6 Q;  1WCM G;  2K14 A;  1MJC A;  2QGQ A;  1NCV A;  1HUM A;  2F4I A;  3D4R A;  2OT2 A;  5EGT A;  4RMF A;  4HAE A;  2EJG C;  2DGY A;  2TMP A;  2E8G A;  3GV6 A;  1YJN A;  4XQN A;  1CKO A;  4KKS A;  3V2T A;  5LMU L;  5FJ8 H;  2VQE L;  3J7A F;  2L9H A;  4K8J A;  1O7I A;  1PLF A;  3R8B A;  5JOB A;  2D0P A;  1QG7 A;  1M1K C;  4JI5 L;  2QF7 A;  4O42 A;  1LTI D;  2NZH A;  1PTO H;  2B63 H;  1FJG L;  5FLX E;  1EEI D;  2CHB D;  5C3E H;  5EPJ A;  1ZXT A;  2JA9 A;  5I6Y A;  1HZB A;  4A93 G;  4G7Z C;  4XXE A;  3SK5 A;  1GHK A;  1Z6H A;  5IP9 H;  3K5L A;  1B50 A;  4RGO S;  4M1U B;  1EY0 A;  1IKL A;  2R3Z A;  4C2M H;  4DK1 A;  4KN4 C;  4YIJ A;  1XTD A;  2FFK B;  3NWT A;  3D3R A;  1NMG A;  3O13 A;  4CGY B;  5HGT A;  2NWG A;  2XNA C;  4R8N A;  1LV9 A;  1EY5 A;  4EVO A;  2JA6 H;  1PH2 A;  3C1F A;  3D4D A;  1X65 A;  1L1O C;  2YU9 H;  2GN5 A;  3MTS A;  3SHL A;  3CCU A;  1VMP A;  1EWI A;  5A2Q L;  1HPC A;  3P7J A;  4NPS A;  3KJO A;  4HJA A;  3TP5 A;  1N32 Q;  4YCV A;  1EIG A;  1STA A;  2OF1 A;  1PH4 A;  3PO3 H;  5C44 B;  2JP1 A;  4EQP A;  5KYI A;  1JWS D;  2Y0S E;  4A3K H;  4UHV A;  4PG3 A;  1SXT A;  3BS1 A;  4DK3 C;  1YJ9 A;  3TS2 A;  2PI2 A;  2NVY H;  2WB1 G;  5CYU A;  3NQT A;  4FYD A;  1HNX L;  3J80 L;  1H9S A;  1PH6 A;  3GTO H;  1WFQ A;  3PO2 B;  3TP7 A;  2Q8I B;  3E5S A;  3SGI A;  1J8I A;  3CMA A;  1TQO A;  2NVY B;  3GTG H;  2I5M X;  2SNM A;  2NZO A;  1PTO F;  3T1H L;  3GTJ H;  3CCQ A;  2JA8 H;  1SDF A;  1PTO B;  4A3C G;  2KQ3 A;  2K04 A;  3S17 B;  2BH8 A;  2ZJR A;  1SE2 A;  3KF6 B;  3C3L A;  3IFT A;  2EJF C;  2ID0 A;  2CQA A;  2UXC L;  3QR8 A;  2BDO A;  2RHS B;  2JA7 H;  4HJ7 A;  2EOT A;  3CKI B;  3CQZ B;  1X55 A;  3K0X A;  3GTM B;  4P75 A;  1SYG A;  2K28 A;  1WTW A;  4NXN Q;  1YBY A;  2I5H A;  1FGB D;  4O0A A;  3GP7 A;  4RKB A;  1XNQ L;  3NTH A;  3W2D A;  2EDG A;  2QEJ C;  1L0Y B;  3H6M A;  1TWH H;  1Q82 C;  3CAM A;  3K58 A;  2D2C C;  1QCB D;  1JB7 A;  5FLX c;  3I7F A;  3RLO A;  3I4M H;  1N34 Q;  3N6R A;  4DA2 A;  5JVG 3;  4A3J B;  4BY1 H;  3J81 i;  5IT9 E;  3D0F A;  3HP3 A;  2Y0S B;  2CQO A;  1DM0 B;  1Q1E A;  1TWG B;  3BDO A;  2JYO A;  3MC0 B;  4DGZ A;  4U67 3;  1NAP A;  2M00 A;  1HZA A;  4E6I A;  5JVH 3;  1N32 L;  1PZI D;  4CDE C;  2AUJ D;  2ASB A;  1JMC A;  4DKA C;  1GUG A;  4AYB G;  4QY7 A;  1YHA A;  4BXX G;  3AB9 A;  1TY2 A;  4OWX B;  3I56 A;  4A3G B;  5GQO A;  1SYC A;  4OON A;  4KJO A;  1IBM L;  1Z9F A;  4LUV A;  3I55 A;  3ULP A;  5IGG A;  1H9R A;  4GN3 B;  2XWJ B;  1HFN A;  5M5W H;  5FLM H;  3RN2 A;  2L5T A;  2EZV A;  1PDQ A;  1BBW A;  5M5Y H;  1CKN A;  1F9Q A;  1OXS C;  1RL2 A;  2EYM A;  1YNJ C;  2K5D A;  1BDO A;  1G2S A;  1N33 Q;  2X69 A;  3AFQ A;  3F8T A;  4H44 C;  1PH1 A;  1C7Y A;  3SDZ A;  2VUM H;  1A3T A;  2PW7 A;  5KIX A;  1DD2 A;  1X3G A;  2JK8 A;  2N49 A;  3CPW A;  1JOQ A;  1Q46 A;  1CKM A;  4MNO A;  2JEA I;  5C0X I;  4B3S L;  2B2V C;  1GJX A;  2JA8 G;  4UY8 C;  3GTK B;  3KLS A;  5EAY A;  3S2D H;  4UP9 A;  1TS2 A;  4A3J G;  4NKL A;  1V1P B;  1VQ9 A;  4LF6 Q;  1SNQ A;  4DUY L;  4P72 A;  3E0E A;  1O78 A;  2CFM A;  3CC2 A;  4GZY C;  1KRT A;  3A8J E;  3OMC A;  4N9T A;  4RCN A;  3UDF A;  4A3F H;  3IL8 A;  5C0X J;  4DR7 Q;  3CCR A;  3DM1 A;  5KEE A;  1XMO L;  4IOA A;  1BCP C;  5C4J B;  2YTV A;  4DV5 Q;  1K9M C;  4OO1 G;  1E0B A;  1EQV A;  4JI7 Q;  5C3E G;  4LF7 Q;  5IYC H;  1RHP A;  1GM5 A;  2F0Q A;  4HCS A;  1IL8 A;  2HHH Q;  2FMC A;  1AP0 A;  4C3I H;  3SK8 A;  2F0H A;  4XYO A;  1KAA A;  4GLA C;  2PQA B;  3KOJ A;  1SR3 A;  3F1Z A;  1WYD A;  1XX8 A;  1KIX A;  4B3T Q;  2BE5 C;  3AFP A;  2KHS A;  4R4O A;  5GAG C;  1BCP B;  1F9P A;  1VQL A;  1A15 A;  4HN7 A;  3CP0 A;  3K7A H;  5LL6 S;  4DAV A;  1NUC A;  4AQY Q;  4PMC A;  5M3F H;  1U0L A;  1I4Q A;  2PPB C;  3CU7 A;  4IZ8 A;  3FHW A;  2FXQ A;  1B44 D;  2XRS D;  3ULJ A;  1IW7 C;  2NVX B;  2VB2 X;  2EYP A;  5KGU A;  1KNA A;  3VYR A;  1MSG A;  1GUS A;  2EYO A;  2RSN A;  2HT1 A;  4JI0 L;  1IBM Q;  5J39 A;  2Q2H A;  5JPM C;  3HGB A;  1DZ1 A;  1II3 A;  5IGB A;  4K14 A;  4DV0 Q;  3HKZ B;  3BDC A;  4H02 A;  1BXT A;  5ELC A;  2B39 A;  1ENF A;  1FR3 A;  1PFS A;  3PIP 3;  1S5E D;  3JAM c;  1KLG D;  4PZ7 A;  3G6E A;  1TWG H;  3NXW A;  4R9W A;  2R93 H;  4B9X A;  1WI5 A;  5DEH A;  3TS0 A;  2LXJ A;  3IKJ A;  3TZD A;  2KJX A;  4YY3 L;  1LAC A;  4F87 A;  2KUM A;  2PYK A;  2L12 A;  3STB D;  3SXH A;  1JCK B;  3S1M B;  3HS0 C;  1GXD C;  3JAM i;  2O4X A;  4L5S A;  5A2Q E;  1VF7 A;  4L63 B;  4K5X A;  4X64 Q;  3S1N B;  4JI1 Q;  1R9T B;  2F1M A;  1XPU A;  4QL5 A;  1QUQ A;  5FO7 B;  1QJO A;  1P8L A;  3U4V A;  1KHI A;  5K5P A;  4A3B H;  1XNQ Q;  1JWU D;  1H9K A;  1TWF H;  2EY1 A;  3TBI B;  2CH4 A;  1PH7 A;  4R4T A;  4DAY A;  5I4D A;  4A3L H;  3J7Z C;  3CME A;  1PFN A;  2JEB I;  3BDL A;  3RR5 A;  2RKS A;  4XIG S;  5HY6 A;  4KD4 A;  1JE4 A;  1V1P A;  5M3M B;  3FPP A;  4XQQ A;  3HG9 A;  1GOZ A;  1HA5 A;  4KKT A;  5C5L A;  5LMN Q;  4A75 A;  2B2V A;  4CHT B;  3HOU G;  3BYT B;  5I9P A;  2PO4 A;  4LAA A;  2A8V A;  3T1Y Q;  4ZYS A;  1I3Q H;  3V96 A;  2KCC A;  3EVQ A;  3KDF B;  4GKK L;  3K59 A;  4HSV A;  5CV8 A;  1GUT A;  1OXX K;  1UEA B;  1S3O A;  5CV5 A;  2ATW A;  1TXY A;  2HCI A;  4Z9C B;  1S5B D;  3GV3 A;  3J7A 5;  2MO1 A;  1SMY C;  2EYJ A;  1YJW A;  3I4N B;  4DAY B;  1STY A;  4K0K Q;  1TVX A;  3DWP A;  1LYL A;  1KXL A;  5COY A;  5LL6 X;  5JEA G;  3RZD B;  2PQE A;  4BS9 A;  3K7A B;  3GDE A;  1G91 A;  2HQL A;  1HRJ A;  3KLW A;  1CI3 M;  1EFI D;  2PMZ B;  1BOS A;  1SAP A;  4R4Q A;  3NHH A;  4X65 L;  3TDQ A;  2P5Z X;  1U4P A;  3C2P A;  1HTP A;  3M7N A;  1V8Q A;  2OTL A;  3VA7 A;  1EIF A;  1WCM B;  3KF8 B;  4X62 Q;  4MIU A;  4I7A A;  4QIW E;  4KHP L;  5EJW A;  4EGV A;  4MN3 A;  2MFI A;  3ICE A;  2LFN A;  1NTG A;  4B3S Q;  1LTA D;  1KAW A;  4U68 A;  3K5O A;  4ODG A;  4IN3 A;  3ND8 A;  4IFD H;  4DR3 L;  4A3E G;  3CXC A;  3T1H Q;  1CQV A;  2F3V A;  1STB A;  1GD7 A;  1SNP A;  2KBN A;  2L55 A;  1Y1V H;  5I2Y A;  2N3S A;  4A3F B;  1JT8 A;  4HCE A;  4QB4 A;  1XTC D;  1B3Q A;  4J1M A;  4JBW A;  2KEE A;  2IHF A;  1ENA A;  1MHW C;  4OEL B;  4B3M Q;  3MXU A;  3GTK H;  2F0G A;  3L7Z C;  2JQO A;  4G57 A;  4X64 L;  1WTO A;  3HOY B;  3J81 L;  3VR2 A;  3NTI A;  4JG2 A;  4B08 A;  4JK1 C;  1CT1 D;  3FKI H;  2HIX A;  3T51 B;  2NVQ B;  2E74 C;  1X54 A;  1P16 A;  5IYC G;  2VNU D;  1TWA B;  3EBE A;  1D7Q A;  4X3U A;  1A3V A;  1K3R A;  2K03 A;  4CDC C;  1VQG A;  3S1R H;  3L9A X;  5I2X A;  4DUZ Q;  1Q3L A;  1Q8I A;  3OHX C;  3N52 A;  2CH4 W;  2XSC A;  3IFD A;  1TWA H;  1ET6 A;  1VQI A;  3J81 E;  1SNO A;  4DR2 L;  1ILP A;  2OQK A;  1QB5 D;  4A93 H;  3MWY W;  2F0K A;  2VW9 A;  5M5W B;  1AW7 A;  3W3A A;  5GAH C;  4HJ5 A;  5M5X B;  1YIJ A;  4BY7 B;  1ONL A;  2C5C A;  2B2Y C;  5IY0 A;  1D1K A;  1ZKO A;  2Z6K C;  1VQA A;  4LF7 L;  3WOF A;  3R93 A;  1T9H A;  1VQ4 A;  4A3G H;  1ZEQ X;  1DJR D;  3I4O A;  2PZT A;  2RHQ B;  1VQK A;  5CC4 A;  1TWC B;  2F4V L;  5LMN W;  2OQ0 A;  2KCT A;  1CSP A;  2GA4 B;  4NP5 A;  3CCS A;  3NBH A;  5EKL A;  2NTT A;  2MUY A;  1HH2 P;  2AUK A;  5NUC A;  1ESR A;  3VYT A;  3TN2 A;  3HFZ B;  4IQZ A;  4IUU A;  1K83 H;  3M4P A;  2J7Z A;  4A3M G;  1LO5 D;  5HGQ A;  4C3H B;  1L2F A;  3NBH B;  2QKI C;  4K5W A;  4KK7 A;  4TQU S;  1T5X D;  2RBM A;  3ERO A;  4FNF A;  1QNU A;  4A3K G;  3SR1 A;  3UDI A;  1TS4 A;  5E3F A;  4C56 C;  3S14 B;  2WAQ E;  2DJF C;  2BA0 A;  1EYC A;  4K2L A;  5BN5 A;  3GTP B;  1K8G A;  4C3J G;  5LHY 1;  1VQN A;  1YZ6 A;  1SMX A;  2ICE C;  3EJI A;  4DUZ L;  4GKK Q;  2NBF A;  1FNW A;  2V4D A;  3HOZ G;  5D14 A;  4GNX A;  1BCP D;  3M4Y A;  1UE5 A;  1NY4 A;  2IWH A;  4J8Q A;  2UXB L;  3PUZ A;  5ELB A;  1D2B A;  4G4K A;  1SFO H;  4XT3 B;  2K5W A;  4IPH A;  1GKH A;  3U9O A;  3ONA B;  1IZ6 A;  1DOL A;  2HCC A;  3VR5 A;  3H0G H;  4HIO A;  3QB3 A;  5T1G A;  5IGC A;  1E2W A;  4AQY L;  4OL7 A;  2ZXO A;  3RN5 A;  2K5Q A;  2A69 C;  1HTL D;  3KYH C;  4RKL A;  4LFC Q;  3H09 A;  2FJ2 A;  4OEM B;  3W1B A;  2ZT9 C;  4JI0 Q;  4O1N A;  1H9J A;  2JSO A;  1FYC A;  3ER0 A;  3NPP A;  4DPG A;  2X6L A;  2IY5 B;  5FKA C;  4GLX A;  2B2T C;  4JI1 L;  5E7N A;  5AFW A;  1EOV A;  2DNE A;  4OWT B;  4DV4 L;  5KND A;  1RIP A;  3DEO A;  4FXD A;  2UUB L;  2JN4 A;  3NEN A;  1L1O A;  4G7H C;  1VQ7 A;  1DCZ A;  2OWO A;  4C3J H;  1R4Q B;  2E5L L;  4X6A H;  3Q6S A;  3BZC A;  5IWA Q;  1R4P B;  2KEN A;  3HRZ C;  2D9U A;  3C46 A;  4Q5V A;  2FIN B;  3QJY A;  4X66 Q;  1PH3 A;  1A0I A;  2OEO A;  1XJV A;  1I94 L;  1RTO A;  3VR6 A;  2E2H H;  1BKB A;  2C35 B;  5J22 A;  1WOC A;  1GUO A;  2NN6 H;  3UI2 A;  3S1Q B;  4A3I B;  1G51 A;  4A3C H;  1ESF A;  3DUZ A;  3FRP B;  1ICF B;  3OPO A;  3A5Z B;  4J15 A;  4JOI A;  2R7F A;  2YYZ A;  4ALP A;  2MJ8 A;  3TP6 A;  5ELF A;  2NZ1 D;  2UXD Q;  1Y1W H;  4B3T L;  4UAI A;  4DN4 M;  1B9M A;  3SE0 A;  2YTY A;  1VQJ A;  1F9R A;  4NDX A;  3J80 i;  1VDZ A;  1ML0 D;  1V1Q A;  2DNC A;  4A3M B;  5BR8 Q;  1HR0 W;  3I4M G;  4A3E H;  4JYA Q;  5C44 G;  2OCE A;  5J1Z A;  1PFM A;  5K36 H;  2RSO A;  4C3H H;  2CW0 D;  1JE5 A;  3D6C A;  4S3S A;  5C4X G;  3HKZ E;  4AH6 A;  4FDB A;  3U4Z A;  1KQS A;  5I9O A;  4DAM A;  4HJ8 A;  4KI0 A;  3W5O A;  4N8F A;  2H1E A;  1K0S A;  5IT9 c;  1TWC H;  4IFD J;  3BYY B;  3FDT A;  1N34 L;  4L5T A;  1SMY D;  3NTK A;  1C8C A;  3MEH A;  2K01 A;  4A4I A;  4X65 Q;  2MNA A;  3H91 A;  4NW2 A;  5T1I A;  1ZYR C;  4LF9 L;  2NB0 A;  4IO9 A;  3ERQ A;  1AE2 A;  1SEB D;  2F0J A;  3Q0A A;  1AEX A;  1XPO A;  3IRB A;  1HJP A;  4OIK A;  4KHP Q;  1XWE A;  4FF4 A;  2R93 B;  1UE6 A;  2MP1 A;  5BN3 A;  3J7A V;  1YVC A;  4OIJ A;  2UUB Q;  1CA5 A;  4K6D A;  3NEM A;  1S72 A;  5H1S E;  2RCF A;  4JV5 L;  2UUA Q;  2WIN B;  4OX9 Q;  2ZM6 L;  3PO2 G;  1TS3 A;  5FO8 B;  1W2B A;  1PTO D;  1Y1V G;  1PFB A;  1HUN A;  5DAU A;  4BY7 G;  2WAC A;  2EXZ A;  4L5R C;  1PRT D;  4HIM A;  2Z4I A;  4NB3 A;  2PNH A;  2UXB Q;  4TRD A;  1LT5 D;  3I4N H;  1S40 A;  5IGF A;  1WTX A;  3UDX A;  3Q22 A;  2IX1 A;  1YNJ D;  1VQ8 A;  2B2T A;  1QVG A;  1B1Z A;  4ZUI A;  2B8F A;  3MXP A;  4X3S A;  4L8J A;  1QNK A;  3G4S A;  3PIO 3;  2VUM B;  1LAB A;  2PNR C;  5C6A A;  2B2U C;  2JE6 I;  2UU9 L;  2BH2 A;  5D65 A;  3A7A B;  4CKC A;  2IX3 A;  2HHH L;  2I07 B;  3PIP A;  3TZU A;  1N8R C;  3K5N A;  1UEB A;  4OO1 I;  2SDF A;  5JPN C;  4P74 A;  2AHO B;  2PCF B;  2CWA A;  1D6E C;  1NBW A;  3L3O C;  1SRU A;  4PMB A;  4C3I G;  4DR3 Q;  1HCZ A;  5EPL A;  1G8Z D;  4DR5 Q;  3KDF A;  1ET9 A;  4ZQ3 A;  4C3H G;  4DV3 Q;  3E6Z X;  2UUA L;  1VQE A;  1L0W A;  1KLU D;  1FGU A;  3NSW A;  5EPK A;  5C0X G;  3S15 B;  4A3B B;  2VQE Q;  5IP9 G;  2X6G A;  1RD9 D;  4K5V A;  1H9M A;  3TEH B;  4ZCK A;  4B3M L;  3HOX B;  1PRT F;  3PUV A;  2CW0 C;  4IJL A;  3GD7 A;  1SE3 A;  5CV7 A;  3LWE A;  4H0L C;  4HID A;  3SVM A;  3DEP A;  1SN8 A;  5IWA L;  1CZG A;  4DUY Q;  1JR0 D;  3URY A;  4KJN A;  1MI2 A;  4UDU C;  3HOU B;  4J6H A;  3S2H H;  4RHR A;  5IYB H;  1JJC B;  4A3M H;  1WTR A;  3SK4 A;  4JBJ A;  4LK1 C;  2QDL A;  3S1R B;  1HQM C;  4CBV A;  1FNU A;  2F0U A;  4LWC A;  1DXM A;  4R4C A;  1F77 A;  1E2Z A;  3AEV A;  4EQN A;  2Z6K A;  4DR2 Q;  5CMD A;  1Y69 U;  2WKD A;  5BR8 L;  1O7L A;  1ZYR D;  3QOJ A;  5D3D A;  1MKH A;  3JC6 6;  3CD6 A;  1GO3 E;  2RCN A;  4BY1 G;  4LFC L;  5IP7 G;  1Q86 C;  2VUM G;  3RZO H;  1HXY D;  3HOV G;  3S2H B;  3H94 A;  1Y8N B;  1IBK Q;  2EYH A;  3OYY A;  3KFU A;  4A3I H;  3J81 j;  3U58 A;  4DV3 L;  4KY5 A;  2A19 A;  3RNU A;  2JA6 G;  1OTC A;  3OMG A;  1AZQ A;  3CCM A;  3DMU A;  5EKK A;  5AJ3 Q;  3BZD B;  3GTP H;  3S15 H;  1K28 A;  3TME A;  1L0X B;  3HEJ A;  1A2U A;  1C9O A;  2LXK A;  1G2T A;  4A3F G;  1K8A C;  3M4O B;  2F0L A;  2HD3 A;  4LF5 L;  2ZXR A;  2F0W A;  5DM6 3;  3T56 B;  4A3E B;  3MFG A;  4EX5 A;  4DAP A;  2B29 A;  4GNX C;  4LF6 L;  3CCE A;  2UU9 Q;  2JXM B;  2XTI A;  4I7Z C;  4BBR G;  1QWY A;  4OHJ A;  1X3Q A;  4LF4 Q;  4UP8 A;  2B63 G;  2KHJ A;  4IUR A;  3ERS X;  2WAQ B;  1Y8O B;  1EQQ A;  3BJU A;  3F2U A;  5JJK A;  3HOW B;  1SYE A;  1VS0 A;  4POG A;  4ZLT F;  2IT1 A;  3QOL A;  4YHH Q;  1IYU A;  4RHS A;  4GN4 B;  2JA6 B;  2N78 A;  3M3Y H;  3I70 A;  1UE1 A;  4R8I A;  3HOZ H;  2K4K A;  4BY7 H;  2NYZ D;  4ABN A;  4FF2 A;  3NWS A;  2R7Z G;  5KNC A;  3EQL C;  3BVG A;  2R7D A;  3FVQ A;  3ZJY C;  1STG A;  1Q7Y C;  2D5D A;  1E1O A;  4JI5 Q;  4YWL A;  4DK6 C;  3M4Q A;  2UXD L;  1O7Y A;  5M9O A;  2SOB A;  3DHQ A;  2F0N A;  3SEB A;  1TKW B;  1WVL A;  5C4Z A;  3S14 H;  1B3A A;  5C3E B;  1X3P A;  5M5Y B;  1IYJ B;  1SBB B;  2NVQ H;  4A3L G;  1SE8 A;  1HR0 L;  4KV6 A;  1PYW D;  2Z9H A;  1EEF D;  5C4H A;  1HNW Q;  1HNZ Q;  4GS3 A;  5IOD A;  4RAU C;  1HHV A;  2V1C C;  3MAQ A;  4AYB E;  5C4X B;  4A3I G;  1R9T H;  3RLN A;  1STN A;  3A7L A;  1NR4 A;  4LUZ A;  4XTC S;  3CCL A;  2XWB B;  5C3X A;  2LKV A;  4DXF A;  5C4X H;  1RJT A;  1ASZ A;  1HR0 Q;  2Q2T A;  2F0O A;  3K6O A;  3K7U C;  4JI3 Q;  3BVZ A;  5M5X H;  1BBX C;  3RZO B;  3MEF A;  1M8A A;  2XIW A;  3R3O A;  2LSS A;  3FPU B;  4XDX A;  1TII D;  1CZW A;  1U4R A;  1I5F A;  4C2M B;  3A5U A;  4ZAI A;  2HDM A;  3PGZ A;  2GVB A;  2ENB A;  2F0S A;  4LF9 Q;  4N9P A;  3UE0 A;  4AIM A;  1IYV A;  2E75 C;  4PQX A;  5CV9 A;  3K80 C;  2XN9 C;  1CK1 A;  4L5Q A;  1LTT D;  2L0C A;  1CSQ A;  4NXM L;  3EA6 A;  3HOU H;  3OIP A;  2E2D C;  3PQI A;  1N36 L;  3VA5 A;  4WJW A;  2ZM6 Q;  2E2I H;  2F0P A;  2HUG A;  1CFM A;  4MTK A;  2R93 G;  3DM3 A;  3UE1 A;  3M3Y B;  1DGS A;  2K33 A;  4KY7 A;  2F0D A;  1Z7T A;  4RCO A;  4JVZ A;  1IBL L;  3HOV H;  3K81 C;  4ID6 A;  3LNN A;  3HOW H;  3MA2 B;  3P75 A;  1GVP A;  2EVB A;  5CR3 A;  3WWV A;  5JAV A;  4F88 A;  1Y1V B;  4JI4 Q;  1D1I A;  2ZTE A;  5IE8 A;  4JW0 A;  2L4N A;  1CUK A;  1SYD A;  2EXD A;  5FJ8 G;  4GKJ L;  1CHP D;  3V05 A;  3S9W A;  4OXP A;  3A56 A;  4A3D G;  2RDF A;  1MIU A;  3R2T A;  4K0K L;  1JWM D;  1RF2 D;  2IW3 A;  1JOR A;  4L6T B;  4DV4 Q;  3KK7 A;  4BY1 B;  1D5M C;  5CV6 A;  3OTO Q;  3M4O H;  1EIH A;  4IAL A;  1EY4 A;  4JI4 L;  1AH9 A;  3KUP A;  4DF7 A;  5JJL A;  4KTA A;  5IT9 L;  3HKS A;  1A8V A;  1IKM A;  1K3B C;  4O2D A;  1DOK A;  2F0T A;  4LF8 L;  1RDP D;  5FLX L;  4QUF A;  4IJH A;  1EFW A;  1G6P A;  4GOP C;  1XMO Q;  3GQB A;  2AQ2 B;  2DJG C;  3OOC A;  2PI2 E;  4DXG A;  5AJ3 L;  1QOH A;  3A55 A;  4YWM A;  1BCP F;  4HIK A;  5FOB B;  2I5L X;  1HFG A;  3Q23 A;  4DV7 L;  4IPC A;  1SFO B;  1LLR D;  1BO0 A;  1W3S A;  3AYH B;  5KYL A;  1E22 A;  1A3U A;  4YCU A;  2LS0 1;  1EY7 A;  3VYS A;  4FP5 D;  1BQQ T;  3MVV A;  4TKO B;  5JEA H;  3TQY A;  2WAQ G;  4WJ3 M;  3GTO B;  2IPK D;  1PA6 A;  5CV4 A;  4DK0 A;  2B2Y A;  5GAD C;  1VCI A;  2J4X A;  4XQJ A;  3S16 H;  4ZK9 B;  4V19 0;  1LTG D;  3I2Z A;  4EQO A;  4P73 A;  2EY5 A;  3U9S A;  1QUQ B;  1VQO A;  3F2C A;  5A35 A;  3T1Y L;  4DR1 L;  1RCV D;  1H9S B;  1K83 B;  2WKC A;  5BN4 A;  1SRO A;  2C9O A;  2F3W A;  1WD1 A;  5C44 H;  1MD2 D;  1QE6 A;  2KHI A;  2H4O A;  4IPD A;  2JA5 B;  3S1N H;  2EY2 A;  1BVS A;  3HOX G;  4K8I A;  2FHT A;  4JI3 L;  2MQH A;  2M2L A;  3HOW G;  5GRO A;  4RGT A;  4EQ5 A;  2NVT B;  1B70 B;  2RQX A;  3S16 B;  4TVA B;  2NN6 G;  2GVA A;  2WV6 D;  5KRU A;  1WTV A;  4DR4 Q;  1Q1B A;  1EY8 A;  1GUW A;  1OXU A;  5DM7 3;  1T5E A;  2AKW B;  3KLS X;  3L0O A;  5DNF A;  1HZC A;  3BU2 A;  3HZX A;  3RLF A;  1AE3 A;  1HNZ L;  1EWC A;  1EZ8 A;  1GUN A;  1Y1W B;  1CTM A;  2F3I A;  4DNI A;  3H3V I;  3GTM H;  1C0A A;  2F0I A;  1A2T A;  4QGU A;  2JA7 B;  3CRL C;  5IOC A;  3KJP A;  3K0Y A;  1I6V C;  3I91 A;  3W1G A;  4CJ1 B;  2DN8 A;  3TP8 A;  3PO3 G;  2KED A;  3T13 A;  4X3T A;  3CCV A;  1VMC A;  4NXN L;  1BUV T;  3OW7 A;  5I6W A;  4H7B A;  3B6Y A;  4HSP A;  1J9O A;  4IPG A;  2XVS A;  2QIL A;  2IL8 A;  3HOX H;  1TWF B;  4QIW B;  3NP8 A;  2B2U A;  4GNX B;  5M3F B;  2ALY B;  1D8L A;  5G3L D;  4JV5 Q;  5IGD A;  3E0J A;  1F2Y A;  4KHZ A;  2A5H A;  1YNX A;  1EZ6 A;  3T53 B;  4LFB Q;  1YHQ A;  1K73 C;  5LMN L;  2F0F A;  5E4W C;  1J5E Q;  4OGQ C;  3K57 A;  4G7O C;  2EQS A;  5IYD G;  5E4X A;  1Q90 A;  3TSS A;  4CKB A;  4H13 C;  4A3K B;  1NJI C;  4A76 A;  4DR1 Q;  4NMZ A;  4C3I B;  3A8K E;  1EIY B;  3PO3 B;  3MXN B;  4LF4 L;  1E1T A;  3FKI G;  4CKE A;  4F8M A;  1B4O A;  1TS5 A;  5COR A;  4LFB L;  4BBS B;  1XYI A;  2VQF L;  1WD0 A;  4LNQ A;  2PW5 A;  1S5C D;  4OWW B;  1SJH D;  3MXG A;  2YU9 B;  4HMI A;  4IFD G;  1VQM A;  4LFA Q;  1JIC A;  1BBU A;  2AQ1 B;  5E1F A;  1I6H B;  1S5D D;  1E2V A;  3RZD H;  4JOI C;  1U9R A;  1PYB A;  2E2I B;  2VY3 A;  4QF4 A;  4JCV E;  3PUW A;  1SNM A;  5F2D A;  3GO5 A;  4DV6 L;  2UUC L;  2R7Z B;  2RDG A;  1E3P A;  1W6J A;  3I4L A;  4ME5 A;  5G3L F;  1HA6 A;  4ZUJ A;  2Z8L A;  1LTR D;  2BDN A;  1I3Q B;  4DV1 Q;  3OSO A;  3RD4 A;  1Q8K A;  3R2I A;  2B63 B;  4B9W A;  1YI2 A;  3FP9 A;  3PMF A;  1VQ5 A;  2BE5 D;  4FXG C;  3JAM E;  2K05 A;  1N36 Q;  1PRT C;  1YEZ A;  4FF1 A;  3E9I A;  1AZP A;  4ILW A;  2HQE A;  1SYF A;  1KNE A;  4DU9 A;  3X3M A;  4DNT B;  3PUX A;  3H15 A;  2EY6 A;  2VS1 A;  3OWE B;  2EYF A;  1PXU A;  1F2Z A;  1SJE D;  2K5N A;  4QMG A;  3LX0 A;  3PF5 A;  2E2H B;  2A69 D;  2IHE A;  1OXV A;  2G9H D;  1F9S A;  3Q24 A;  3MZ5 A;  3CCJ A;  3KF8 A;  1KDB A;  4A3G G;  5TSS A;  5L37 A;  4LFA L;  1SYB A;  4X62 L;  3PO2 H;  3S2D B;  5IIF A;  4JC0 A;  2Y0S G;  1N9W A;  3CC7 A;  1X56 A;  1MSH A;  2ICI A;  4KN7 C;  4MHE A;  4UP7 A;  3ND9 A;  1ICW A;  2WFW A;  4KMU C;  1K0R A;  2AWN A;  3S1M H;  3D4W A;  4A3J H;  2KCN A;  2WB1 E;  4K6L A;  4IUV A;  4KY6 A;  1B2T A;  5ELO A;  1DON A;  3H0G G;  5IYB G;  1J5E L;  2PZW A;  2RA4 A;  1RKN A;  3J81 c;  2PZU A;  2L11 A;  2B8G A;  2VXW A;  3RMH A;  2NVT H;  2CWP A;  1VQP A;  4K2K A;  2UXC Q;  4F7X A;  4MZ9 A;  4NXM Q;  1QIL A;  1D5Z C;  1TWH B;  2M9V A;  1C48 A;  1QVF A;  2CKZ B;  4HED A;  2JA5 H;  3M9B A;  3KF6 A;  3A0J A;  4JBM A;  1LUZ A;  2H5X A;  4R1J A;  1EUJ A;  3FEW X;  3A74 A;  1QZG A;  3H3V H;  1PYS B;  1LM0 A;  1IHZ A;  2EYL A;  4RA8 A;  4TSS A;  3P1H A;  5HUR A;  3ULL A;  3H3V C;  1I50 H;  2E2J H;  1XNR Q;  2D0O A;  3AU7 A;  3G7L A;  3G6J B;  1B7Y B;  5ELE A;  3GTJ B;  5CBA E;  1VQD A;  3S17 H;  4PNY A;  3OIQ A;  3I4N G;  3G71 A;  2BCO A;  2R92 H;  2ZTC A;  4MTN A;  1K8O A;  2MPM A;  3I8Z A;  1G29 1;  3X3N A;  2K75 A;  2Z1C A;  1JJ2 A;  2MGS A;  3J80 c;  1VQC A;  1VQ6 A;  1PRT B;  1ROD A;  3OWF A;  4BA1 I;  3MHB A;  4QJF A;  4RG1 A;  1O7Z A;  3PSI A;  2K1B A;  4APV A;  3TRZ A;  4DV5 L;  2K5V A;  4ZKC B;  3OTO L;  2NUC A;  1UUP A;  3QIA A;  2JA7 G;  5M3M G;  3Q8D A;  1LTS D;  2VQF Q;  1K8M A;  1X9N A;  4UPA A;  1EYA A;  5JJZ A;  2K5H A;  4BWG B;  4LF8 Q;  3D8G A;  1MBY A;  5KNB A;  3IAY A;  2L15 A;  1KL9 A;  4C1N I;  4WFN 3;  1HNX Q;  2KA7 A;  2A68 C;  4RFB A;  1A63 A;  4YY3 Q;  1G6Z A;  1S4Z A;  3H0G B;  1Q81 C;  4IUP A;  4DV6 Q;  2F4V Q;  4HR7 B;  1JC7 A;  2R92 G;  2A74 C;  2RF4 A;  1PZK D;  3F2D A;  2Z6B A;  3J80 E;  2QDB A;  4V0B A;  4JBK A;  1CKN B;  1JB3 A;  5DLQ E;  1HQR D;  1STH A;  3G48 A;  2CCZ A;  4C1N K;  4ZRZ A;  4A93 B;  2ZTD A;  5EBD A;  4DR4 L;  4DR6 Q;  4KKU A;  1TR5 A;  4JI2 Q;  4XYQ A;  3GTQ H;  1X3E A;  1EY9 A;  4DFA A;  2WP8 J;  3DWA A;  1EWH A;  2FMM A;  5IGE A;  2AWO A;  5FK9 C;  3PV0 A;  4Y7N B;  1SE4 A;  5M3M H;  2VL6 A;  3EN2 A;  3NBI A;  3CC4 A;  1XMQ Q;  3AQQ A;  2K32 A;  2NVX H;  2Z4H A;  3HKZ G;  2F0E A;  1PMR A;  2K52 A;  1XPR A;  1TY0 A;  3HOY H;  4RGN A;  3I73 A;  1KDA A;  1VQF A;  4JI8 L;  2UUC Q;  2B3G A;  4PMW A;  1YNN D;  4KHV A;  1X3F A;  4WJ4 A;  3WOE A;  4BBS G;  1A62 A;  1FL0 A;  1V1O A;  2ZJQ A;  2BOS A;  3L2P A;  2SEB D;  1FJG Q;  1CA6 A;  1I4P A;  1TU2 B; 
#chains in the Genus database with same CATH homology
 3CAM A;  2NN6 I;  3ER0 A;  4DPG A;  1L1O B;  1JB7 A;  2IY5 B;  4GLX A;  5FLX c;  3I7F A;  4JI1 L;  1CUK A;  3RLO A;  1I94 Q;  2EXD A;  5E7N A;  3I4M H;  5FJ8 G;  1N34 Q;  4GKJ L;  1EOV A;  4OWT B;  4OXP A;  4DV4 L;  4BY1 H;  4A3D G;  3J81 i;  1MIU A;  1RIP A;  4K0K L;  3D0F A;  1PHJ A;  2UUB L;  2CQO A;  3NEN A;  1L1O A;  4Y52 H;  1Q1E A;  2DUD A;  1B8A A;  1VQ7 A;  5C4J H;  2OWO A;  4C3J H;  4DV4 Q;  1U5K A;  3OTO Q;  1WCM H;  3M4O H;  2E5L L;  4X6A H;  4JI4 L;  4A3D H;  1AH9 A;  5JJL A;  3BZC A;  5IWA Q;  3PIO A;  2KEN A;  2ZJP A;  3U50 C;  4B3R L;  1HZA A;  2YV5 A;  1I6H H;  3HKS A;  4LW1 A;  1A8V A;  1N32 L;  2PMZ E;  4O2D A;  2ASB A;  4LF8 L;  1JMC A;  4X66 Q;  4DV0 L;  4IJH A;  4POF A;  1FVI A;  4DKA C;  4GOP C;  1PH3 A;  1EFW A;  4AYB G;  1A0I A;  4QY7 A;  1YHA A;  1XJV A;  1XMO Q;  1QZH A;  1I94 L;  3E9H A;  4BXX G;  2E2H H;  5AJ3 L;  2PI2 E;  4OWX B;  3I56 A;  1BKB A;  5GQO A;  2C35 B;  4YWM A;  5IP7 H;  1WOC A;  4OON A;  1G51 A;  1IBM L;  1Z9F A;  4HIK A;  4A3C H;  4GN5 A;  2I5L X;  4JYA L;  2VZA A;  4LUV A;  4DV7 L;  4IPC A;  3A5Z B;  3I55 A;  3ULP A;  1QVC A;  3AYH B;  1W3S A;  4GN3 B;  4J15 A;  4JOI A;  5M5W H;  5FLM H;  1E22 A;  3RN2 A;  2R7F A;  1WJJ A;  4YCU A;  2YYZ A;  2Q2U A;  1BBW A;  4ALP A;  1IBK L;  5M5Y H;  1CKN A;  1NMF A;  2HIV A;  1OXS C;  1RL2 A;  4DV7 Q;  2UXD Q;  1Y1W H;  4B3T L;  1N33 Q;  3AFQ A;  3F8T A;  1Z47 A;  1PH5 A;  2A1A A;  2OTJ A;  4A3B G;  2YTY A;  4P71 A;  1PH1 A;  1VQJ A;  3J80 i;  3TQY A;  2WAQ G;  2K50 A;  1C7Y A;  1XMQ L;  4WJ3 M;  2VUM H;  1V1Q A;  1PA6 A;  2Z0S A;  3CPF A;  5BR8 Q;  2PQA A;  5GAD C;  1HR0 W;  1X3G A;  1X6O A;  2JK8 A;  2N49 A;  1VCI A;  3CPW A;  3I4M G;  1Q46 A;  4A3E H;  3GTL H;  4JYA Q;  5C44 G;  1CKM A;  4MNO A;  2OCE A;  2JEA I;  4A3L H;  4DR5 L;  3S16 H;  5J3B A;  5C0X I;  4IFD I;  2D62 A;  4B3S L;  3I2Z A;  4C3H H;  2JA8 G;  4P73 A;  4UY8 C;  4DR6 L;  1QUQ B;  1JE5 A;  2KCM A;  1IBL Q;  2JA5 G;  1VQO A;  4JI2 L;  3F2C A;  5C4X G;  3T1Y L;  4DR1 L;  3HKZ E;  5EAY A;  3S24 A;  1PVO A;  4AH6 A;  3S2D H;  4UP9 A;  1SRO A;  4FDB A;  4GLV B;  3U4Z A;  5C44 H;  4A3J G;  1KQS A;  4DAM A;  3STB C;  1VQ9 A;  4DUY L;  3DLL A;  4P72 A;  3E0E A;  4LF6 Q;  2KHI A;  4HJ8 A;  4KLK A;  2CFM A;  4KI0 A;  3CC2 A;  1KRT A;  1J6Q A;  4LUO A;  3W5O A;  1KRS A;  4B3R Q;  4IPD A;  3UDF A;  4A3F H;  3S1N H;  3LGJ A;  3HOX G;  1BVS A;  5IT9 c;  1TWC H;  5C0X J;  4DR7 Q;  3CCR A;  1XMO L;  4IOA A;  4IFD J;  1N34 L;  1VQB A;  4L5T A;  4JI3 L;  4GKJ Q;  2MQH A;  3HOW G;  2YTV A;  5GRO A;  4DV5 Q;  1K9M C;  4OO1 G;  4A4I A;  4EQ5 A;  4X65 Q;  2MNA A;  4JI7 Q;  5K36 G;  1B70 B;  5C3E G;  4LF7 Q;  5IYC H;  1GM5 A;  4TVA B;  2NN6 G;  1HNW L;  2GVA A;  4LF9 L;  1YIT A;  4DR4 Q;  1UWV A;  1Q1B A;  4IO9 A;  4GOP B;  2HHH Q;  1OXU A;  1AE2 A;  1XPO A;  1Q82 C;  3IRB A;  4C3I H;  1HJP A;  2AKW B;  4KHP Q;  3L0O A;  1UE6 A;  1HZC A;  3BU2 A;  1YVC A;  4BA2 I;  2EIF A;  2UUB Q;  4GLA C;  3NEM A;  3RLF A;  5H1S E;  1S72 A;  1AE3 A;  2PQA B;  1E24 A;  1HNZ L;  3KOJ A;  4GOP A;  2UUA Q;  2IX0 A;  4JV5 L;  1SR3 A;  3F1Z A;  1WYD A;  1KIX A;  4OX9 Q;  1IL2 A;  2ZM6 L;  4B3T Q;  2F3I A;  1N33 L;  3AFP A;  4DNI A;  4HJ9 A;  4BXX H;  3PO2 G;  1M90 C;  1W2B A;  4R4O A;  5GAG C;  3H3V I;  1VQL A;  3GTM H;  3CQZ H;  3TRE A;  1Y1V G;  5ELN A;  1C0A A;  3PCO B;  4QGU A;  3F2B A;  3CP0 A;  3K7A H;  4BY7 G;  3KJP A;  4L5R C;  1SLJ A;  4HIM A;  3W1G A;  4AQY Q;  5M3F H;  1U0L A;  4NB3 A;  5LMU Q;  1YHB A;  2PNH A;  3PO3 G;  4GKK Q;  2UXB Q;  3CCV A;  3FHW A;  2FXQ A;  4NXN L;  3S1Q H;  4PZ8 A;  3ULJ A;  3I4N H;  3CF5 A;  3B6Y A;  5FLM G;  1S40 A;  4IPG A;  3UDX A;  2HT1 A;  2IX1 A;  4JI0 L;  3HOX H;  4Y7N H;  2Q2H A;  1IBM Q;  1VQ8 A;  1QVG A;  4GNX B;  3UDG A;  2ALY B;  1D8L A;  4JV5 Q;  1Y1W G;  4DV0 Q;  4YCW A;  3G4S A;  5JEA J;  2JJQ A;  4KHZ A;  4DV1 L;  4H02 A;  1YNX A;  3CW2 C;  1IXR A;  4LFB Q;  1YHQ A;  1K73 C;  5LMN L;  1XNR L;  1PFS A;  2JE6 I;  1J5E Q;  2UU9 L;  2BH2 A;  2EQS A;  2XGT A;  1LTL A;  2HHH L;  5IYD G;  3PIP A;  4IOC A;  4R4I A;  3JAM c;  1JJG A;  4PZ7 A;  3G6E A;  1TWG H;  1N8R C;  4JI6 L;  2R93 H;  1UEB A;  4OO1 I;  1WI5 A;  3TS0 A;  2LXJ A;  3D31 A;  2E5L Q;  4JI7 L;  3BZK A;  4YY3 L;  4P74 A;  4QQB X;  2AHO B;  1NJI C;  2CWA A;  4A76 A;  4DR1 Q;  1EIY B;  2BA1 A;  5IYD H;  3MXN B;  3STB D;  3M85 A;  1NBW A;  4LF4 L;  1SRU A;  3FKI G;  1E1T A;  4DR3 Q;  3VDY A;  2R7Z H;  4X66 L;  4LFB L;  3JAM i;  4DR5 Q;  1OXT A;  4L5S A;  3KDF A;  2VQF L;  4LNQ A;  2QEX A;  4DV3 Q;  4DV2 L;  1MJE A;  4X64 Q;  4OX9 L;  4JI1 Q;  4BBR H;  4OWW B;  2UUA L;  1VQE A;  1XPU A;  1L0W A;  1FGU A;  5C0X G;  1VQM A;  4QL5 A;  4IFD G;  4LFA Q;  4YHH L;  2VQE Q;  5IP9 G;  1QUQ A;  1BBU A;  1NE3 A;  2Q2I A;  1P8L A;  3U4V A;  1KHI A;  2MO0 A;  4A3B H;  1XNQ Q;  3TEH B;  1TWF H;  4B3M L;  1PH7 A;  4R4T A;  3PUV A;  3PUY A;  3RZD H;  4JOI C;  4YWK A;  1PYB A;  4IJL A;  3GD7 A;  2N8N A;  2VY3 A;  4JCV E;  2JEB I;  3PUW A;  4ME3 A;  3J7Z C;  3CME A;  3RR5 A;  1PH9 A;  3GO5 A;  4XIG S;  4DV6 L;  4HID A;  1SN8 A;  5HY6 A;  5IWA L;  2UUC L;  4DUY Q;  3PF4 A;  1ASY A;  1E3P A;  1PV4 A;  1KD1 C;  2I0Q A;  3S2H H;  5IYB H;  1JJC B;  4A3M H;  4JBJ A;  4LWC A;  3NEL A;  4R4C A;  5LMN Q;  4DV1 Q;  4A75 A;  3AEV A;  1EQR A;  2Z6K A;  2YTX A;  3HOU G;  4DR2 Q;  4JI8 Q;  2ES2 A;  1Q8K A;  2A8V A;  3T1Y Q;  1Q12 A;  2R6G A;  5BR8 L;  3FP9 A;  1YI2 A;  1I3Q H;  1MKH A;  3JC6 6;  3CD6 A;  1GO3 E;  1VQ5 A;  2RCN A;  3KDF B;  1Y14 B;  4BY1 G;  4GKK L;  4LFC L;  1OXX K;  1S3O A;  2ATW A;  5IP7 G;  1TXY A;  1Q86 C;  1N36 Q;  2VUM G;  3RZO H;  3J7A 5;  3HOV G;  2MO1 A;  1YEZ A;  1V43 A;  1EYG A;  3E9I A;  3K8A A;  1IBK Q;  3OW2 A;  1YJW A;  3OYY A;  4DAY B;  3KFU A;  4A3I H;  4K0K Q;  3J81 j;  3HOY G;  1LYL A;  1KXL A;  3U58 A;  5JEA G;  3PUX A;  3H15 A;  2VS1 A;  4DV3 L;  2K5N A;  4DV2 Q;  3PF5 A;  2A19 A;  2QA4 A;  3RNU A;  2JA6 G;  1OTC A;  3EIV A;  3GDE A;  1KC8 C;  2HQL A;  2F52 A;  1E7Z A;  1OXV A;  2IHE A;  3KLW A;  3CCJ A;  3CCM A;  4A3G G;  1G6P A;  4LFA L;  5AJ3 Q;  4X62 L;  3GTP H;  4R4Q A;  3PO2 H;  1HZ9 A;  3S15 H;  4JC0 A;  4X65 L;  2Y0S G;  1N9W A;  3CC7 A;  1X56 A;  1C9O A;  2LXK A;  1H95 A;  4A3F G;  3M7N A;  2OTL A;  1K8A C;  4UP7 A;  1EIF A;  5GAE C;  2WFW A;  3KF8 B;  1K0R A;  1PH8 A;  4LF5 L;  2AMC B;  4X62 Q;  5JJI A;  4BBS H;  2AWN A;  3S1M H;  4QIW E;  4KHP L;  4A3J H;  2WB1 E;  2MFI A;  4EX5 A;  4DR7 L;  2B29 A;  4GNX C;  4LF6 L;  3ICE A;  5ELO A;  1V9P A;  3H0G G;  3CCE A;  5IYB G;  1J5E L;  2UU9 Q;  1NTG A;  1UE7 A;  4PZ6 A;  4B3S Q;  4LF5 Q;  2XTI A;  3J81 c;  4BBR G;  1KAW A;  2NVT H;  1VQH A;  2CWP A;  5M3F G;  1VQP A;  4LF4 Q;  4JI6 Q;  4UP8 A;  2QGQ A;  1WCM G;  1MJC A;  2K14 A;  4DR3 L;  4A3E G;  2B63 G;  2UXC Q;  2KHJ A;  3CXC A;  4MZ9 A;  3T1H Q;  4NXM Q;  1GD7 A;  2KBN A;  3ERS X;  1Y1V H;  4RMF A;  1QVF A;  2N3S A;  2CKZ B;  1EQQ A;  3BJU A;  2DGY A;  2JA5 H;  3M9B A;  2E8G A;  5JJK A;  3KF6 A;  3A0J A;  1JT8 A;  1VS0 A;  4POG A;  4JBM A;  1LUZ A;  1YJN A;  2H5X A;  1CKO A;  4R1J A;  1EUJ A;  3H3V H;  3A74 A;  4JBW A;  5LMU L;  2IT1 A;  1QZG A;  2IHF A;  1PYS B;  1LM0 A;  5FJ8 H;  4YHH Q;  2VQE L;  4GN4 B;  1O7I A;  2N78 A;  3M3Y H;  4B3M Q;  1UE1 A;  3ULL A;  3GTK H;  3HOZ H;  3L7Z C;  2JQO A;  1I50 H;  4X64 L;  2E2J H;  1XNR Q;  2D0O A;  2K4K A;  2D0P A;  4BY7 H;  4JG2 A;  1B7Y B;  1M1K C;  4JI5 L;  3FKI H;  2HIX A;  2R7Z G;  1VQD A;  3S17 H;  1X54 A;  2NZH A;  2B63 H;  3I4N G;  3G71 A;  1FJG L;  2R92 H;  2R7D A;  2ZTC A;  4MTN A;  1P16 A;  3ZJY C;  5IYC G;  1Q7Y C;  5C3E H;  2VNU D;  3EBE A;  1D7Q A;  1E1O A;  2JA9 A;  1G29 1;  1K3R A;  4YWL A;  2K75 A;  1HZB A;  4DK6 C;  3M4Q A;  1JJ2 A;  4JI5 Q;  4A93 G;  2UXD L;  1VQG A;  3J80 c;  3S1R H;  1VQC A;  5IP9 H;  1VQ6 A;  4DUZ Q;  4BA1 I;  4C2M H;  3S14 H;  1TWA H;  4QJF A;  1VQI A;  4RG1 A;  4DR2 L;  2OQK A;  3PSI A;  4A93 H;  4APV A;  1IYJ B;  2VW9 A;  1XTD A;  3TRZ A;  2NVQ H;  4A3L G;  4DV5 L;  1SE8 A;  1HR0 L;  2K5V A;  3OTO L;  5GAH C;  4HJ5 A;  1YIJ A;  2JA7 G;  5M3M G;  1NMG A;  3Q8D A;  1HNW Q;  1HNZ Q;  2VQF Q;  1X9N A;  5IY0 A;  4GS3 A;  2Z6K C;  4UPA A;  1VQA A;  2K5H A;  4LF7 L;  2JA6 H;  1PH2 A;  1T9H A;  1VQ4 A;  4LF8 Q;  4A3G H;  1X65 A;  1L1O C;  2V1C C;  2L15 A;  4AYB E;  1KL9 A;  2YU9 H;  1HNX Q;  3I4O A;  2GN5 A;  4A3I G;  3RLN A;  2RHQ B;  1R9T H;  1VQK A;  4LUZ A;  4XTC S;  3CCU A;  3CCL A;  2F4V L;  5LMN W;  1EWI A;  2OQ0 A;  4NPS A;  4HJA A;  3KJO A;  2KCT A;  1CSP A;  1A63 A;  1N32 Q;  4YY3 Q;  5C4X H;  1ASZ A;  2Q2T A;  1HR0 Q;  4YCV A;  3CCS A;  1Q81 C;  3K7U C;  4JI3 Q;  1PH4 A;  3PO3 H;  1HH2 P;  4DV6 Q;  2F4V Q;  5M5X H;  2R92 G;  3HFZ B;  2RF4 A;  1K83 H;  2Y0S E;  3M4P A;  3MEF A;  3F2D A;  4A3K H;  2LSS A;  4PG3 A;  4JBK A;  1CKN B;  4A3M G;  5HGQ A;  1L2F A;  5DLQ E;  3G48 A;  1I5F A;  3NBH B;  4DK3 C;  3A5U A;  2CCZ A;  1YJ9 A;  3TS2 A;  4TQU S;  2PI2 A;  2NVY H;  2WB1 G;  2ZTD A;  4A3K G;  3UDI A;  3PGZ A;  1HNX L;  2GVB A;  2WAQ E;  4LF9 Q;  4DR4 L;  4DR6 Q;  2BA0 A;  4JI2 Q;  1PH6 A;  3GTO H;  1WFQ A;  3UE0 A;  3GTQ H;  4AIM A;  1X3E A;  1K8G A;  1VQN A;  2WP8 J;  3SGI A;  3CMA A;  3GTG H;  1YZ6 A;  2AWO A;  2I5M X;  3PV0 A;  3K80 C;  1SMX A;  4DUZ L;  5M3M H;  4L5Q A;  2NZO A;  1CSQ A;  2VL6 A;  3T1H L;  4NXM L;  3GTJ H;  3EN2 A;  3CCQ A;  3HOU H;  2JA8 H;  3CC4 A;  3HOZ G;  4GNX A;  1N36 L;  1XMQ Q;  3AQQ A;  4A3C G;  2NVX H;  1UE5 A;  2BH8 A;  3HKZ G;  1NY4 A;  2ZJR A;  3KF6 B;  2ZM6 Q;  2UXB L;  2E2I H;  3PUZ A;  2K52 A;  2R93 G;  1XPR A;  1SFO H;  2ID0 A;  3HOY H;  3DM3 A;  4IPH A;  2UXC L;  1GKH A;  1IZ6 A;  2RHS B;  3UE1 A;  2JA7 H;  1VQF A;  1DGS A;  3H0G H;  4JI8 L;  1X55 A;  4HIO A;  2B3G A;  4HJ7 A;  3K0X A;  2UUC Q;  4PMW A;  1IBL L;  4P75 A;  4AQY L;  3HOV H;  3K81 C;  1X3F A;  4WJ4 A;  3RN5 A;  4NXN Q;  1YBY A;  2I5H A;  4BBS G;  4O0A A;  1A62 A;  1FL0 A;  2ZJQ A;  3HOW H;  1GVP A;  3KYH C;  3L2P A;  4LFC Q;  1XNQ L;  3WWV A;  1FJG Q;  3W1B A;  1TWH H;  4JI4 Q;  2ZTE A;  4JI0 Q;  5IE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...