4HIMA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggatacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4himA00
1SROA 4NXNQ 3I55A 4GKKQ 4JI1Q 3BZKA 3S2DH 3CCEA 1ASZA 4GN4B 1L1OA 2MO1A 4DV0L 4DV1Q 3I4NH 2R92H 4HJ8A 4BBSG 4XIGS 4A3LH 1A0IA 1O7IA 3JAMi 3PUZA 2D0OA 4GS3A 2R7DA 4A3CH 1X56A 3PIOA 1X6OA 3L0OA 4LF9Q 4A3EH 3M4QA 3I4MG 1VQNA 1PYBA 4LF7L 4GOPB 3OTOL 2JQOA 3S16H 3H0GG 1LUZA 4JBWA 5IP7H 1E24A 1BBWA 5IYDG 1HR0W 2JA5H 4JI6L 1P8LA 1GKHA 4LW1A 3SGIA 4DR5L 1PH2A 1EQQA 3GTGH 2K50A 4A3BH 1VQLA 1S40A 1ASYA 3K8AA 1L1OC 4MTNA 1WI5A 1V1QA 5C4XG 3HOYH 3PF4A 3A0JA 5FLMH 5JEAG 4A4IA 3E9HA 3OW2A 1XNRQ 3KDFA 1SFOH 3ULLA 4HJAA 2F4VL 5IT9c 1B8AA 1HNXQ 3I56A 1N32Q 4A3DG 4BBRH 5C0XJ 3T1HQ 1VQ7A 4BA1I 3A5ZB 5IP7G 2R93H 1CSPA 1WCMH 2UXDQ 1JT8A 4LF5Q 1Y1WH 4DR4L 4DR6L 4JI4Q 1K83H 3CCMA 5IYCH 4GKJQ 3RNUA 3F1ZA 1VQIA 1PHJA 4NB3A 5H1SE 4PMWA 4LNQA 2PMZE 5C3EH 2VQFQ 3PUVA 1W2BA 5M3FG 2BH8A 1WFQA 2JE6I 3FKIG 4HJ9A 4LUOA 1KD1C 1UE6A 3PUXA 2ZJQA 1HR0L 5HGQA 4DR3Q 1K8GA 1PV4A 1YHBA 4YY3Q 1L0WA 4AQYQ 2GVBA 1VQ5A 1N36L 2A19A 4DV6L 3RLNA 1KL9A 4A3JH 2VUMG 1Q46A 3E9IA 5M3FH 4DR3L 4GN5A 1XMQL 2UXCL 1KRSA 3J80i 4PZ7A 5GROA 1YJNA 1C9OA 3WWVA 4OO1I 3M4OH 2KCTA 5IWAQ 3CMEA 4DV7L 2NN6G 4R4OA 4LFAL 4FDBA 4R4IA 4C3HH 1NY4A 1YITA 4EQ5A 2LXJA 1HZAA 4A93G 4JI4L 4DR1Q 1RL2A 1R9TH 1SR3A 4DAYB 3DLLA 2Q2IA 2UUBL 1VQMA 3AEVA 1TWAH 3STBD 1UWVA 3L7ZC 1CKMA 1LM0A 4IPHA 4IJLA 4IOCA 4KHZA 3T1YQ 3PF5A 1PA6A 5HY6A 2HIXA 4JI5L 3KF6A 2VUMH 1VQPA 4L5RC 4A75A 2K5VA 2F4VQ 1MKHA 1NTGA 1OXTA 4L5QA 4JV5Q 2D0PA 4QY7A 3GTPH 1D8LA 3CCJA 4IFDI 1CUKA 1QUQA 3CCRA 3K81C 4IJHA 4DK6C 3CC7A 4JCVE 4LF6Q 2ZM6L 2B3GA 4X65Q 5BR8L 1HNZQ 3TS2A 1I94L 3GTMH 3CW2C 4DAMA 1I6HH 2XTIA 2PQAB 3ICEA 1T9HA 2Q2TA 4P75A 1N8RC 3CP0A 3M3YH 4HIKA 1X3EA 4DV2Q 4GLVB 4NXML 2ID0A 5M3MH 4UP9A 5C4XH 1VQCA 3KF6B 3OYYA 4LF9L 2CCZA 1VQEA 1VQ8A 4A3KG 3HOXG 2GVAA 4X64L 3M4PA 2QGQA 1MJCA 5JJIA 1IBML 2FXQA 1KQSA 2UXBQ 4DV6Q 3CCUA 3I4OA 1M1KC 1IZ6A 1N9WA 4PG3A 2IX0A 4P73A 4P74A 1A63A 1YNXA 3S1QH 4LF8L 2YTXA 4IO9A 2KENA 4DUZL 3CC2A 1OXVA 1SRUA 5M5WH 2R92G 3JAMc 4JYAQ 4B3RL 1E1TA 2K5NA 1JJ2A 4A3IH 3RLOA 1P16A 1PH7A 4HIDA 2ATWA 4DR6Q 4UPAA 1Z9FA 5IYBH 1YHQA 2JEAI 3FKIH 3RN5A 4PZ6A 1G6PA 3HOXH 1PH5A 3BZCA 3KYHC 1N34Q 1XPUA 2OQ0A 1VQ9A 2I5HA 4AH6A 4GN3B 4A3GG 1KAWA 3NENA 5IYCG 1XPOA 1VQBA 2B63H 3GD7A 2Q2UA 3HOZH 1IBLL 3PGZA 4DR4Q 1S72A 1YVCA 2R6GA 4DR2Q 3CCSA 2I0QA 4RG1A 5LMNW 1JMCA 2WP8J 4X64Q 2VQEQ 2E2IH 2UXDL 4JI8L 4C3IH 4LUZA 4YHHL 3TRZA 1GM5A 4YWLA 1HNZL 4YCVA 1V43A 3AFPA 4A3MG 3UDXA 2E5LL 1PH8A 4LF6L 2JA7H 3HOVG 1HNWQ 2F52A 3CAMA 2UU9L 1NMGA 1VQHA 4DV3L 2UUCQ 3GTJH 4DR5Q 3H3VI 3S17H 2JA9A 3VDYA 3CC4A 4X6AH 1Y1VG 2D62A 2ZTCA 2UUCL 3OTOQ 1YIJA 2UU9Q 4HJ5A 5GQOA 1TXYA 1OXUA 3MEFA 1C0AA 1I94Q 2JK8A 3CPFA 3HKZG 5M5XH 2IY5B 5E7NA 4A3MH 1CKNB 1IL2A 1HJPA 2RF4A 2ZM6Q 3W5OA 1VS0A 1B70B 2PNHA 3JC66 4TQUS 2L15A 3LGJA 5ELNA 2QEXA 4DV0Q 1PH1A 1Y1VH 3AQQA 1IBLQ 3NELA 4DR1L 3CCQA 4A3IG 4GKKL 2C35B 3HOUG 5AJ3Q 4R4TA 3UDGA 3T1YL 4YHHQ 1PFSA 2DUDA 4UP7A 4GOPA 4O2DA 2K52A 1K3RA 3D31A 1KRTA 4LFBL 5K36G 3J80c 4JI8Q 4UY8C 1KXLA 3M9BA 2RHQB 1GD7A 2JA6G 2KHJA 4DV1L 2NVXH 2UXCQ 2KCMA 1VQJA 5C0XG 1UEBA 4BY1G 3S15H 3W1GA 5DLQE 2Z0SA 1YJ9A 2AMCB 1E3PA 1Q12A 1RIPA 5FJ8G 1CKNA 3KJPA 2ES2A 1BVSA 4B3ML 2R93G 4XTCS 4BBRG 2AKWB 1EQRA 3PUWA 1M90C 3HOYG 4HIOA 1LTLA 2N78A 2MNAA 4JBMA 4JI0L 1W3SA 4QJFA 4L5TA 3A74A 3TEHB 3CXCA 3KDFB 2PI2A 4GLXA 3HOWG 4A3LG 3KF8B 1CSQA 1SLJA 1Q7YC 4H02A 1HZ9A 4A3JG 2IT1A 2YYZA 1UE5A 1N36Q 1FGUA 3FP9A 2Z6KC 4B3RQ 3S1NH 4JYAL 3ZJYC 2RCNA 1VQ4A 3HFZB 4DUZQ 4OWWB 1FVIA 4LFBQ 4TVAB 1EYGA 4LF8Q 4LFCQ 1K0RA 5GADC 4JG2A 2BA0A 2WAQE 5C44H 1V9PA 1X54A 2CWPA 2AWNA 5GAGC 4NPSA 1IBMQ 4LUVA 4DR7Q 4LF5L 3F8TA 2JA8G 1Q1BA 3BJUA 3L2PA 3CCLA 1IYJB 4JBJA 3S14H 2HT1A 2NZOA 3RZOH 4A3GH 1QVGA 2Z6KA 2CQOA 3K80C 4AYBG 4X65L 1HNXL 4PZ8A 3ULJA 4DV2L 1E22A 3HKSA 1J5EL 5ELOA 2JA5G 5IYDH 3NEMA 3BU2A 1WCMG 2VNUD 4JV5L 4DV3Q 3U58A 4QGUA 4BY1H 2F3IA 1Z47A 4DPGA 1AE3A 1N33Q 3S1RH 4LF7Q 1D7QA 4JI5Q 3S24A 3I4MH 1YEZA 5C44G 4BA2I 1VQKA 4R1JA 5BR8Q 1NBWA 2OWOA 1U0LA 2V1CC 4A3DH 1KHIA 1S3OA 3I2ZA 1OTCA 2E8GA 4GLAC 4P71A 2VQEL 4AIMA 3KJOA 1GO3E 3I4NG 4IFDJ 1VQ6A 4DR2L 4OWXB 2JA8H 1X65A 4WJ3M 5LMUL 3F2BA 1VQDA 1BBUA 2HQLA 2NVYH 1J6QA 3IRBA 4GNXC 1SMXA 3G6EA 2HHHL 4A3EG 2OTJA 2NN6I 4BY7G 4QL5A 1VQOA 3HOVH 4DV7Q 1I5FA 2DGYA 2LSSA 4IPCA 1N34L 2VY3A 3AFQA 5LMNL 4A3KH 3CD6A 1QUQB 2VW9A 1XNQQ 2OTLA 1YHAA 4BXXH 4DUYL 1TWCH 1WYDA 4MZ9A 4YCUA 3UE1A 1TWGH 3AYHB 4JI1L 2NVTH 4LWCA 2KHIA 2YTVA 1XMOQ 1K73C 3PO2H 5JJKA 2KBNA 4BY7H 4AQYL 2E2HH 5FLXc 5C0XI 2CFMA 4LFAQ 3M7NA 1EIFA 4OONA 4K0KQ 3A5UA 1NE3A 2JA6H 2PQAA 2I5LX 3B6YA 1EFWA 1FJGQ 1XMQQ 3GTLH 4X66L 3CQZH 1VCIA 4L5SA 2VQFL 1XJVA 4YWMA 3G4SA 3CF5A 3H3VH 1L2FA 4KHPQ 5C4JH 1I3QH 1K8AC 3RLFA 5FJ8H 2Q2HA 5C3EG 4DV5Q 2EQSA 4GKJL 4GNXB 3K0XA 3KOJA 4YY3L 3H0GH 3H15A 2BH2A 3HOZG 1QVFA 1WOCA 1GVPA 1PYSB 3KLWA 4WJ4A 4QIWE 1VQFA 4A76A 1E7ZA 4RMFA 4C3JH 1EUJA 4ALPA 4J15A 1KIXA 3TREA 1N32L 4APVA 3RR5A 3U50C 5IE8A 4JI2L 3U4VA 2MO0A 2IHFA 2AHOB 4LF4L 4NXMQ 1MIUA 2JJQA 4DKAC 1BKBA 1Q8KA 3NBHB 4JOIC 2ALYB 5IYBG 2N49A 2K75A 3ERSX 2MQHA 1XPRA 1FJGL 1G51A 2R7ZH 1JJGA 1XNRL 1WJJA 1VQAA 4MNOA 1YI2A 4A3FG 1YJWA 4A3CG 3PO3G 2A1AA 2RHSB 1TWHH 1TWFH 4R4QA 5IP9G 5GAHC 4POGA 1XMOL 2ASBA 3FHWA 3HKZE 5IY0A 3D0FA 4GNXA 4KHPL 1Q1EA 2QA4A 2N8NA 1YBYA 1XNQL 4JI6Q 3RZDH 4IOAA 1OXSC 2XGTA 2ZJPA 5LMNQ 1HZBA 1EOVA 1UE7A 4JI0Q 4A3FH 3EBEA 2CWAA 1X3GA 4X62L 4JI7L 4IPGA 1E1OA 4JOIA 3GTKH 2HIVA 3PO2G 1HH2P 3Q8DA 4HJ7A 1QZHA 1AH9A 2K4KA 3CPWA 3CCVA 1PH9A 4Y7NH 4DUYQ 3UDIA 2BA1A 4KI0A 2UUBQ 3J7A5 2PI2E 1G291 4C2MH 3G71A 2UUAQ 2CKZB 4R4CA 3TS0A 4POFA 4YWKA 3W1BA 4NXNL 1FL0A 1A62A 1NMFA 1HZCA 5IP9H 2WB1G 4IPDA 1IXRA 1EWIA 5AJ3L 2HHHQ 1QVCA 2B63G 4X62Q 4JI7Q 1N33L 5IWAL 2Y0SG 4YCWA 5FLMG 2JEBI 1DGSA 5LMUQ 3GDEA 1MJEA 2E2JH 2OQKA 2UUAL 3EIVA 4OWTB 1C7YA 4Y52H 3K7UC 1H95A 3PIPA 1B7YB 1YZ6A 3DM3A 2AWOA 3M85A 3TQYA 2B29A 3K7AH 4ME3A 3GTOH 4O0AA 1QZGA 1SE8A 1JB7A 2GN5A 2ZJRA 4JBKA 1K9MC 1PH3A 3U4ZA 2ZTEA 2IX1A 3UE0A 4A93H 1HR0Q 4EX5A 4P72A 1LYLA 3F2CA 3PSIA 4B3SL 2Y0SE 4DK3C 2A8VA 1IBKQ 4B3TQ 3F2DA 3PCOB 4OO1G 3S2HH 4UP8A 2VZAA 3J81j 4JI3L 1PH6A 1X55A 4KLKA 1J5EQ 3HOWH 4BBSH 4BXXG 4OX9L 3PUYA 3ULPA 2E5LQ 2YU9H 4LF4Q 3UDFA 1HNWL 1X3FA 5M3MG 2WAQG 2YV5A 1X9NA 4OXPA 2N3SA 4LFCL 1KC8C 2VL6A 1I50H 1Y14B 3STBC 3GO5A 5JEAJ 2EIFA 5EAYA 1NJIC 2MFIA 3T1HL 1AE2A 3S1MH 4DR7L 4DV4Q 2K14A 1EIYB 3E0EA 4DV5L 1VQGA 4A3BG 4AYBE 4OX9Q 1PVOA 4X66Q 4JI2Q 1PH4A 4DV4L 1OXXK 2NZHA 3J81c 1L1OB 2VS1A 3ER0A 5M5YH 2H5XA 3J81i 4B3TL 4IFDG 3KFUA 4K0KL 4B3SQ 3J7ZC 2ZTDA 4DNIA 1JJCB 3RN2A 3G48A 4HIMA 2WB1E 4GOPC 1Q81C 3HOUH 2EXDA 3MXNB 1Q82C 2NVQH 4QQBX 1CKOA 2JA7G 2WFWA 2LXKA 3I7FA 4JC0A 2UXBL 3EN2A 1Q86C 1A8VA 3GTQH 2R7ZG 1XTDA 2I5MX 4JI3Q 1JE5A 3PV0A 2OCEA 5JJLA 2R7FA 1IBKL 1U5KA 5J3BA 5GAEC 2IHEA 1Y1WG 3PO3H 1UE1A 1SN8A 2YTYA 4B3MQ 3CMAA 2K5HA
chains in the Genus database with same CATH superfamily
4K8IA 4JI1Q 2PMZB 2NVXB 2QDLA 2F0LA 4B08A 3I4NH 3SK4A 4Q0FA 4XIGS 1A0IA 1FYCA 4KKTA 2D0OA 1FR3A 1X56A 3L0OA 4ID6A 4DK0A 4A3EH 3SVMA 1PYBA 2Q8RE 4GOPB 3OTOL 2JQOA 3KK7A 3H0GG 3H94A 1RDPD 1HR0W 1E24A 1BBWA 1P8LA 2KVMA 3PO2B 2F4IA 3K8AA 1L1OC 2NVQB 4CDFC 1LTSD 3ITPA 5JEAG 3OW2A 1XNRQ 3BYYB 3D6CA 3JAML 4HJAA 1SNOA 5IOCA 2PCFB 5IGFA 3GTLB 3I56A 4A3DG 4BBRH 3MZ5A 5C0XJ 1BNZA 1CZWA 1MGSA 2UXDQ 1JWSD 2XRQD 1MSGA 1Y1WH 4AYBB 1K83H 2QF7A 4NW2A 4GKJQ 1EZ8A 2I07B 1TY0A 4K2LA 5C3EH 1SJED 3NWSA 2C9OA 1F9SA 3FKIG 4LUOA 1KD1C 4XXEA 2ZJQA 1CTMA 3HEJA 4K5WA 4KK7A 4JK1C 4ZUIA 1HR0L 2L1BA 1PV4A 1L0WA 1N36L 1A6XA 3RLNA 4WRDA 1Q46A 3E9IA 3MEHA 1ET9A 4OO1I 1C9OA 4TKOB 4KY7A 3R93A 4DU9A 2A6HD 4DAVA 1F9RA 2LXJA 3L9AX 3S9WA 3J7AV 1A3VA 3N52A 4DAYB 2PW5A 2JN4A 2Q2IA 3STBD 1WTXA 1UWVA 1CKMA 1LM0A 2EVBA 3T1YQ 2NZ1D 3GTLH 2PZUA 2HIXA 1VF7A 4L5RC 2K5VA 4IUNA 1EYAA 4GZYC 2D0PA 3DEPA 4QY7A 1ZEQX 4NKLA 1WTWA 2A6ED 1O7LA 4LMQD 4X65Q 3DWAA 4FF2A 2MP1A 2E2IB 3C1EA 3CW2C 1I6HH 1BXTA 3LX0A 1LTBD 1J9OA 1T9HA 1GUTA 1X3EA 2QILA 4XT1B 2ID0A 5M3MH 4OIKA 1VMCA 3KF6B 3T13A 5C3WA 1XTCD 5BN5A 3OIPA 1VQ8A 4A3KG 4IN3A 2GVAA 4X64L 1R9TB 2QDBA 1EFID 3M4PA 1MJCA 1PZID 3VYTA 2FXQA 1KQSA 1HFGA 2IX0A 2QEJC 3NBHA 1YNXA 4LF8L 5FO9B 5C4ZA 4IO9A 2KENA 1G8ZD 1OXVA 1SRUA 2R92G 1DJRD 3T16A 5LL6X 4B3RL 4H13C 4N9TA 3TP7A 1B3QA 1KDBA 4FF1A 1K0SA 1PH7A 1TS3A 1BBXC 1SE4A 2D9UA 4DR6Q 5IYBH 1YHQA 3MAQA 4PZ6A 1EY9A 5EPLA 2JP1A 3VR2A 1PMRA 1GHJA 1VQ9A 4C3IG 2K7VA 3GTJB 1XPOA 2A68D 3FRPB 1VQBA 3FVQA 3GD7A 3BDLA 2Q2UA 3HOZH 1BR9A 3PGZA 1S72A 5JEAH 1I6HB 4F88A 5LMNW 2UXDL 2WP8J 3BVGA 1LO5D 2VQEQ 2Z8LA 5EJWA 3MVVA 2NWGA 4OIJA 2A6HC 3MFYA 1OO9B 3GTKB 1V43A 1AP0A 2I46A 5M5XB 2UUCQ 1NMGA 3KBXA 2FHTA 2B2TC 3VA7A 2UUCL 1OXUA 2PW7A 1I4XA 5E4XA 4B9WA 3SHLA 4BY7B 2DJFC 4FF4A 5FLXL 2ZM6Q 1VS0A 1B2TA 3I91A 2L15A 2EXZA 3E6ZX 3S14B 4DV0Q 5ELNA 1Y1VH 4RHRA 2RDFA 3X3NA 3CCQA 4GKKL 1EWHA 1KDCA 1ML0D 1U9RA 4RKLA 4DGZA 1A15A 2DUDA 2K52A 1I50B 3J80c 2RHQB 1RF2D 3S2DB 4ZAIA 2UXCQ 3LWEA 2BE5D 1VQJA 3S15H 4H7BA 3W1GA 1YJ9A 4J8QA 1Q12A 5FJ8G 5EKIA 1CKNA 1V1PA 2FINB 4JBMA 1JCKB 2WIIB 1W3SA 2KHSA 4QJFA 2VB3X 1PXUA 4L5TA 4RGOS 3TEHB 3CXCA 3S16B 4A3LG 3ND8A 4A3JG 3MA2B 1SYBA 3FP9A 3ZJYC 1CHQD 4DUZQ 3I90A 4OWWB 1FVIA 1SBBB 4LFCQ 5KGUA 5JVH3 4ZKBB 2WAQE 2KCNA 4N8FA 1YNNC 1FNUA 4DR7Q 3HGBA 1O7ZA 2JA8G 5JJZA 3G7LA 2HT1A 3K80C 2CQOA 4AYBG 1SYCA 1KLGD 1ILQA 5I6YA 1KDAA 3HKSA 5ELOA 1J5EL 3PIO3 3NEMA 1WCMG 3P20A 1H9KA 2XN9C 3OHXC 1B53A 4QGUA 2WINB 1AE3A 1RD9D 4JI5Q 3I4MH 5CYUA 1YEZA 1VQKA 1STAA 1O7YA 4HR7B 1RTNA 1OTCA 2E8GA 4P71A 1JQYD 1AEXA 1VQ6A 4DR2L 2JA8H 1RHPA 3F2BA 1S5ED 2JA5B 1J6QA 2CW0C 4ODGA 5C3XA 3TP6A 2JSOA 4DV7Q 1F9QA 4IPCA 2VY3A 2TSSA 3CD6A 3H0GB 1Y1VB 4DUYL 2UXBQ 3UE1A 2NVTH 4YCUA 1TWGH 4V0BA 5JJKA 4BY7H 4AQYL 4R8IA 2A73B 2EY1A 4LFAQ 1PFNA 2EZVA 2PZWA 3M7NA 1U4RA 4KJOA 3IFTA 1NE3A 2JA6H 2ICEC 5I6WA 1XMQQ 3BVZA 3GTPB 2E75C 4L5SA 4KHPQ 1XJVA 5C5MA 4KHVA 4GKJL 1ESRA 2Q2HA 5FJ8H 2X69A 3H15A 3H0GH 5HURA 4WJ4A 1QVFA 1WOCA 3IFDA 1NCVA 2L11A 4C3JH 1EUJA 3HZXA 3TMEA 4J15A 1PTOB 3U50C 1LTRD 5IE8A 3U4VA 2AHOB 4LF4L 5FKAC 2PYKA 2ALYB 3ERSX 2MQHA 5A35A 1H9SA 1D5ZC 1WJJA 2R92B 1D5XC 1WVLA 3PO3G 4IQZA 2KCCA 1TWFH 5GAHC 1QB5D 3KBGA 1XNQL 1MI2A 5FLXE 1OXSC 1SAPA 2XGTA 3I70A 1UE7A 3T51B 2CWAA 4IPGA 4ME5A 3PO2G 2X6LA 1DONA 2OF1A 4G57A 5CV8A 2KQ3A 4DUYQ 3UDIA 3GTOB 1Q3LA 1G291 4ULLA 5C6AA 1STYA 3NP8A 4POFA 5I2YA 1A62A 1QNUA 2WB1G 5KEEA 2RA4A 1PRTD 3E5SA 4WORA 1FGBD 2D2CC 4DXFA 5IWAL 3GDEA 1MJEA 2UUAL 1C7YA 1H95A 4J1MA 3M85A 3TQYA 3K7AH 5JPNC 1QZGA 4A3GB 1PH3A 3U4ZA 3F2UA 4A93H 4DK3C 3C46A 3W3AA 1RKNA 3HOWH 2VZAA 1J5EQ 3IAYA 1HUMA 2EJMA 4BXXG 2F3WA 3PUYA 2WAQG 2YV5A 1GHKA 3DM1A 2VL6A 5LL6S 1Y14B 3STBC 5JEAJ 1G2SA 5IGCA 3VR6A 1AE2A 4DV5L 1DM0B 1STEA 4X66Q 4JI2Q 1VF5C 3ER0A 2J4XA 4B3TL 2LS01 4IFDG 4C3JB 2ZTDA 1TIID 5M3FB 1R4PB 4C3HG 1CKOA 2JA7G 2WFWA 1Q86C 1JOKA 1IL8A 2IJ0A 4BY1B 4L6TB 1BOSA 2OCEA 3PV0A 3VYSA 4P2CB 4RGTA 1IBKL 5GAEC 3WOEA 2RBMA 5KIXA 1JB3A 1UE1A 1SN8A 3CMAA 5J39A 3S2DH 1CQVA 2FMCA 1QG7A 5DAUA 3CCEA 3H91A 1L1OA 2MO1A 4G7HC 2R92H 2PO4A 4HJ8A 3A54A 4BBSG 1GUWA 5JPMC 3JAMi 3PUZA 2RVLA 2B63B 2K04A 3MXNA 3S16H 1W6JA 1LUZA 4TRDA 1X3QA 4JBWA 2R93G 4LW1A 4DR5L 3SGIA 1PH2A 1NR4A 2HD3A 2NN6H 1BDOA 4RKBA 2BDNA 2QKIC 1WD0A 2L4NA 1MHWC 3A0JA 5IGBA 3E9HA 2RSNA 1JC7A 3KDFA 3OMGA 5D65A 1SNCA 4DN4M 5C0XH 1SFOH 1DD2A 2F4VL 3KF8A 5C44B 1HNXQ 4U68A 2K28A 2NVYB 4PMCA 1N32Q 1PTOD 1TWHB 1EYDA 2Z1CA 1VQ7A 1HXYD 2R93H 1CSPA 1RODA 3H3VC 4LF5Q 4DR4L 3F1ZA 1HRJA 5CC4A 4NB3A 3MTSA 3PUVA 5K36H 4KN4C 1NNXA 2JE6I 2L55A 1C48A 1UE6A 3PUXA 5HGQA 4LAAA 4AQYQ 2GVBA 3J81E 1VQ5A 4A3BB 2Q8TA 1LABA 4ABNA 1Q8IA 5M3FH 4DR3L 3S1RB 3HRZC 1LTID 2KCTA 5IWAQ 5JVG3 4DAPA 1XX8A 4FDBA 4O42A 1NY4A 4EQ5A 1PRTC 4A93G 2KUMA 4Z9CB 4DR1Q 1RL2A 4RGMA 3GP7A 4MTKA 1PTOC 3DLLA 3AEVA 1VQMA 1TWAH 1C4QA 3PF5A 4IJLA 4KHZA 4OELB 1HUNA 2ZT9C 4JI5L 5C4JB 2F4VQ 3J80L 4L5QA 3GTPH 1PFBA 3DHQA 1PZKD 2F0IA 2KEDA 2NBFA 3K5OA 4JCVE 2RKSA 2ZM6L 2B3GA 3Q6SA 3MWYW 1HNZQ 1I4QA 1B1ZA 1I94L 1HHVA 4BS9A 2PQAB 3ICEA 4X3SA 2Q2TA 4DF7A 3TSSA 3V2TA 2P5ZX 2JA7B 1VQCA 3OYYA 2CCZA 1VQEA 2EYFA 2K5DA 2KOLA 5FK9C 1GJXA 5JJIA 3K6OA 5G3LF 2E2DC 4DV6Q 2D5DA 3I4OA 3CRLC 1A63A 4FF3A 5ELDA 4A3FB 4CJ0B 5M5WH 5IGGA 4K2KA 1QILA 4A3JB 2F0NA 1SE3A 2WAQB 3I8ZA 3K5NA 4M8AA 4UPAA 1TWCB 2NTTA 2C5CA 3FKIH 1JICA 3RN5A 3BDOA 3BZCA 2CH4A 4QIWB 1ONLA 2MGSA 2OQ0A 4RAUC 1KAWA 3NENA 5IYCG 1U4LA 5IODA 2R6GA 3I3CA 4DR2Q 2OXPA 4TSSA 4X64Q 2F0VA 3A55A 4XQQA 1GM5A 3BG3A 2E5LL 3UDXA 4LF6L 2JA7H 3HOVG 4RFBA 1EY0A 4KV6A 5F2DA 1Y1VG 2A6EC 1YIJA 2DY8A 1TXYA 3MEFA 4A3EB 1CZGA 1I94Q 2F0EA 2JK8A 3HKZG 4X3KA 2L9HA 4A3MH 1IL2A 1HJPA 1E0BA 1B70B 2EY5A 2PNHA 3JC66 2F0WA 3LGJA 1NUCA 2NTSA 1EU3A 4A3IG 2C35B 4DNTB 3HOUG 2B2YC 3NXWA 3UDGA 2FJ2A 4GOPA 4ZQ3A 1K3RA 3D31A 4LFBL 1EY7A 1CK1A 1RTOA 3A7LA 1DZ1A 1KXLA 4WJWA 3EJIA 2KCMA 1FNWA 1QJOA 4M1UB 4FO2A 5DLQE 1TU2B 2Z0SA 3EVQA 1E3PA 1Y8NB 4EVOA 2K03A 3KJPA 1BVSA 3A8IE 4XTCS 1WD1A 4HIOA 3OWEB 2MNAA 3D6WA 2B2UC 3A74A 4HAEA 1UNSA 1ZKOA 1SLJA 4H44C 4H02A 2IT1A 2YYZA 1UE5A 3CU7A 5M9OA 1E2WA 1XXGA 3S1NH 5IGDA 2O5JC 5M5WB 1EYGA 4LF8Q 2Z9HA 4EQOA 2BA0A 1V9PA 2B2UA 1QOHA 2CWPA 1V1PB 1IBMQ 4LUVA 3H6MA 2K6AA 2KA7A 2F0TA 3L2PA 5I9OA 3QR8A 3K0YA 3RZOH 3HG9A 5FO8B 2ZXOA 2RDGA 1T5XD 2JA5G 2RDHA 2VNUD 4JV5L 4DV3Q 4L63B 4BY1H 5J1ZA 1ZYRD 4LF7Q 1D7QA 3S24A 4CKCA 4RA8A 5BN3A 4I7AA 4XYQA 2OWOA 1JORA 2V1CC 2WB1B 1I4RA 5T1IA 4IFDJ 4WJ3M 5LMUL 2HQLA 3IRBA 1QWYA 3G6EA 2HHHL 2OTJA 2NN6I 4BY7G 4QL5A 4G7ZC 2LSSA 2DGYA 1N34L 4A3KH 1UAPA 2VW9A 1YHAA 2K32A 1E2ZA 4JI1L 1TWFB 2KJXA 1XMOQ 1K73C 2KBNA 2SEBD 1NR2A 1D1KA 2L12A 4OONA 5M5YB 2K01A 5C4HA 1K8OA 2I5LX 2JXMB 3B6YA 1EFWA 1WTOA 1ZXTA 2VQFL 1LTTD 4UAIA 5C3EG 3GV6A 4GNXB 3S1MB 4YY3L 2BH2A 3HOZG 1H9RA 1PYSB 1L0YB 4QIWE 3IL8A 2Z4HA 4RMFA 1L0XB 1KIXA 2ICIA 4JI2L 3T53B 2CQAA 3Q22A 1MIUA 2JJQA 3NBHB 2N49A 2K75A 3TP5A 1FJGL 2F0DA 2R7ZH 1LV9A 3S1NB 1JJGA 1XNRL 4A3DB 2HDMA 4ZCKA 2IWHA 1SEBD 2XRSD 1ICFB 4NDXA 4R4QA 5KYIA 2ASBA 3NE5B 2NVTB 3HKZE 2Z4IA 2EY2A 4KHPL 1Q1EA 4A3IB 3GQBA 4IOAA 3RZDH 4A3KB 1EYCA 2R61A 3SK8A 2ZJPA 1EOVA 1PFMA 3GTKH 4JOIA 1E1OA 5EQ0A 3EQLC 5KNCA 1AH9A 1TQOA 2K4KA 3CCVA 1A3UA 2K05A 4R9WA 4C2MH 3G71A 2CKZB 3TS0A 1IW7D 3I4NB 3W1BA 1FL0A 2I0QA 3CQZB 1EWIA 2HHHQ 1GUSA 1QVCA 1B44D 1ENFA 4HMJA 4RHSA 2AUJD 2Y0SG 2OQKA 1F2ZA 3EIVA 4OWTB 2Y0SB 3K7UC 2AWOA 2B29A 4ME3A 4FYDA 1JB7A 3P1HA 1SE8A 4KN7C 2ZJRA 2F0SA 1STBA 1K9MC 3UE0A 1HR0Q 3SR1A 1LYLA 4YIJA 5HGTA 3F2CA 2Y0SE 1IBKQ 4B3TQ 3F2DA 4OO1G 5CMDA 1X55A 4KLKA 1S4ZA 2IL8A 2B2TA 3WOFA 2MJ8A 1HNWL 2YU9H 2WACA 2EYLA 4OXPA 2F0FA 4G7OC 4LFCL 5DM73 1I50H 1TT2A 2EIFA 5EAYA 3S1MH 2MFIA 4UDUC 4DV4Q 2F0MA 2K14A 3E0EA 1VQGA 2EYMA 3O13A 5ELFA 4IUVA 1PVOA 5CV9A 1F2MA 1PH4A 4DV4L 2N88A 2NZHA 1Z6HA 3FKIB 1O78A 4OO1H 4B3SQ 4C2MB 4DNIA 3RN2A 5FOBB 1Q81C 3FDTA 3HOYB 1LACA 4QQBX 4JC0A 3EN2A 1VMPA 1LT4D 1JE5A 2F0PA 2OT2A 5DM63 5JJLA 1EEFD 1Y1WG 3PO3H 2L0CA 2YTYA 4B3MQ 2LMCB 4B9XA 2BDOA 4NXNQ 2BOSA 4GKKQ 1IKLA 3BZKA 1ASZA 4OGQC 4DV0L 2AQ2B 4DV1Q 1PTOF 3SDZA 1I4GA 1O7IA 4GS3A 1TY2A 5ELCA 3OW7A 4A3CH 3PIOA 2K5QA 1NAPA 1VQNA 1KLUD 4LK1C 5IP7H 2JA5H 3AU7A 4IUUA 4DK1A 3NTIA 2B2VC 1EWCA 4A3BH 1VQLA 3VYRA 2E74C 1EY4A 1S40A 5EGTA 1ASYA 1WI5A 5C4XG 3I4MB 3PF4A 1K3BC 3BVMA 3R3OA 1O80A 4A4IA 1EIGA 5E4WC 5IGEA 2F0UA 4RWSC 2XIWA 4HCEA 2AQ1B 3T1HQ 1SNQA 4BA1I 1QCBD 3A5ZB 5IP7G 1WCMH 4JI4Q 1PHJA 5DEHA 5H1SE 3M3YB 4LNQA 2PMZE 3J7YW 1EL0A 3J7AF 4S3SA 1W2BA 5M3FG 1WFQA 4HJ9A 4YY3Q 1STGA 4IUTA 2A19A 3BYTB 1KL9A 2VUMG 4JPBW 2EJGC 2UXCL 4IFDH 3J80i 4PZ7A 2BE5C 5GROA 3WWVA 1YJNA 4K14A 3CMEA 1SYEA 4DV7L 4R4IA 4C3HH 1YITA 2N55A 1HQMC 5T1GA 3L7ZC 4IPHA 3HOVB 2WKCA 1PA6A 2VUMH 1VQPA 3M4OB 2YU9B 3MXGA 2EE1A 2EY6A 2PPBC 4JV5Q 2G9DA 1D1IA 3D3RA 1CFMA 1QUQA 3CCRA 4O1NA 4DK6C 3CC7A 3KLRA 4RGNA 3TS2A 1ILPA 1UEAB 1IKMA 2F0HA 1BCPD 5DNFA 4QUCA 4HSPA 4JW0A 3NWTA 1TVXA 4P75A 2B2WA 3ZYYX 3M3YH 2HDLA 4HIKA 2O4XA 5C5LA 4Q5VA 2QCPX 4LF9L 3FMCA 3FPPA 3NPPA 2QGQA 4QB4A 3PO3B 1IZ6A 3VA5A 4P73A 1WTVA 1GUOA 3S1QH 3S17B 2YTXA 3CC2A 2B39A 1Y69U 4JYAQ 4FXGC 3FEWX 4N8X1 3HOXB 2K5NA 2M00A 3M7GA 4N9PA 3RLOA 3K7AB 3PIP3 1P16A 4HIDA 2ATWA 3K58A 4K6DA 1KABA 3D4DA 3S15B 1XPUA 5CV5A 4AH6A 3SXHA 2B63H 5I4DA 1IBLL 3KLSA 4DR4Q 1YVCA 1IYVA 2H1EA 1F2LA 1A3TA 2E2IH 2XNAC 3DMUA 4JI8L 1X3PA 4KKUA 4YWLA 3AFPA 3MXPA 4A3MG 1PH8A 5COYA 1DCZA 2F52A 3CAMA 4C1NI 3DXJC 4DV3L 4DR5Q 1M8AA 2RQXA 1TS4A 3OSOA 3CC4A 1YNJC 2ZTCA 1PYWD 5GQOA 1C0AA 1K8MA 3QO2A 3J80E 1SMYD 5E7NA 4FP5D 2HCIA 3W5OA 3R8BA 2KECA 1WTRA 1CI3M 3MC0B 4DXGA 5EBDA 2VUMB 4R4TA 1RCVD 4YHHQ 1PFSA 5K36G 1KRTA 1B50A 4UY8C 5ISRA 4QUFA 5LHY1 4DV1L 1UEBA 3HS0C 5EPKA 3H09A 1A2UA 3UI2A 2ES2A 1M90C 3PUWA 4HN7A 4C3HB 1LTLA 2CVRA 2LY7A 3KDFB 4GLXA 3TBIB 3QG1A 1V1OA 3KF8B 4CDCC 4KTAA 1TWAB 5EPJA 4XQJA 2B2VA 2RCNA 1IYUA 3A8KE 1VQ4A 2G5DA 5D14A 4LFBQ 5GADC 4EQPA 5C44H 1PTOH 2L5TA 3MFGA 4PMBA 5GAGC 3HOWB 1C8CA 1R4QB 1K83B 3VR4A 3F8TA 5D3IB 1Q1BA 1EZ6A 4NP5A 3CCLA 1FNVA 3PQIA 1LTAD 2K33A 2R93B 4JBJA 3S14H 2NZOA 2EDGA 4XT3B 2Z6KA 4XDXA 4F7XA 4X65L 1HNXL 3ULJA 1F77A 3N6RA 5FO7B 1ESFA 5CBEE 5IYDH 4BWGB 3U58A 1N33Q 4IURA 5JOBA 5KNDA 5C44G 1CQFA 2B8GA 5BR8Q 1NBWA 1U0LA 1WCMB 1S3OA 4GLAC 4AIMA 3KJOA 1GO3E 3I4NG 2QW7A 2EYPA 3NQTA 3HKZB 1U4PA 4A3EG 3QJYA 1VQOA 3OMCA 1WTPA 5LMNL 3IKJA 1XNQQ 3GTQB 2OTLA 5CORA 3P7JA 2KHIA 3PO2H 2DNEA 2E2HH 5C0XI 4IALA 4R8NA 2CFMA 2DNCA 4NMZA 3RZDB 2PQAA 1FJGQ 1VCIA 3H3VH 3G4SA 3CF5A 1L2FA 5C4JH 1I3QH 1K8AC 3D8GA 4RCOA 1S5BD 3K0XA 1GVPA 2JYOA 4A76A 3SK5A 4ALPA 4E6IA 1GOZA 3TREA 3QWNA 3NBIA 4BBRB 1SSOA 3C3LA 4FNFA 4DKAC 1Q8KA 4JOIC 2GA4B 1XPRA 1I4HA 1G51A 4ZLTF 4DAYA 2NUCA 1VQAA 4MNOA 5TSSA 4ZYSA 1EOTA 1YI2A 1YJWA 1HCZA 2NYZD 2A1AA 1Z7TA 1TWHH 4WFN3 2EYHA 5IP9G 4POGA 1V8QA 4DA2A 1XMOL 2M2LA 5IY0A 4GNXA 2CH4W 2QA4A 2N8NA 1YBYA 3EA6A 5K5PA 5LMNQ 1HZBA 4A3FH 2DY7A 1X3GA 4JI7L 1KNEA 3CKIB 4EGVA 1PH9A 5KYLA 2EPBA 1TS2A 3J7A5 2PI2E 2UUAQ 4R4CA 1B9MA 3SK6A 1NMFA 1HZCA 3OWFA 5IP9H 5AJ3L 1IXRA 1ENCA 4CKBA 2B63G 4JI7Q 4YCWA 5FLMG 1DGSA 5CBAE 5LMUQ 1EY5A 4KD3A 3D4RA 3PIPA 4F87A 3I73A 1MBYA 2PZTA 4HTHA 1JOQA 5E1FA 4EQNA 4DNRB 4EX5A 4P72A 4B3SL 1AZQA 1F2YA 2A8VA 2IW3A 3T4AC 3S2HH 1PH6A 4DR7L 4JI3L 1BUVT 4U673 4BBSH 1CA6A 4LF4Q 3UDFA 1X3FA 5M3MG 2WKDA 4JVZA 2E2HB 4OL7A 3T56B 3NSWA 1KC8C 4ZRZA 4K8JA 2EYOA 3Q23A 2WV6D 1G91A 1BCPB 1IW7C 3GO5A 1NJIC 1B3AA 5CV7A 1JE4A 2B2WC 5CR3A 1EIHA 1I4PA 4AYBE 5KRUA 4OEMB 2VS1A 4MHEA 2H5XA 3KFUA 4K0KL 3J7ZC 3TDQA 4GOPC 1QNKA 3HOUH 2EXDA 4ILWA 2NVQH 1Q82C 4H0LC 3I7FA 3MXUA 2UXBL 2R7ZG 5CV6A 1XTDA 2OEOA 2G9HD 2I5MX 1S5CD 1ICWA 2F0QA 1SXTA 1U5KA 5J3BA 2IHEA 2X6GA 2K5HA 1SROA 3DWQA 3BZDB 3I55A 5ELBA 1EY6A 1TWGB 4GN4B 1TS5A 1STNA 3EFXD 4CJ2C 1YNND 4F8MA 3LNNA 3PMFA 4A3LH 1B9NA 2CW0D 2R7DA 1X6OA 4LF9Q 3M4QA 3TZDA 3I4MG 4LF7L 3KLSX 1JWMD 5IYDG 2CHBD 3BDCA 1GKHA 4JI6L 3GTGH 1EQQA 2EJFC 2LKVA 2K50A 1LTGD 2DJGC 4A93B 3RZOB 4MTNA 1V1QA 3HOYH 2F0JA 1A2TA 5FLMH 3AB9A 1G2TA 1EQTA 3ULLA 5IIFA 5IT9c 3DUZA 3Q0AA 1B8AA 1II3A 2O2LD 3VR5A 4OHJA 1SE2A 2PNRC 1JT8A 2M9VA 4DR6L 3CCMA 3R2TA 5IYCH 3RNUA 1VQIA 2IPKD 4PMWA 2VQFQ 1JR0D 2BH8A 4FVMA 2EOTA 1KAAA 4LJZC 4C3JG 1M4VA 4DR3Q 1K8GA 1YHBA 4PV1C 4DV6L 4A3JH 3ONAB 1CA5A 3HOUB 4GN5A 1XMQL 1KRSA 4IUPA 2RCFA 1JOOA 4ZKCB 3M4OH 1BF4A 2NN6G 4R4OA 4LFAL 5M3MB 5KNBA 2ZXPA 1TR5A 3E0JA 3DWPA 1HZAA 3MHBA 4JI4L 3VYUA 1R9TH 1SR3A 3J81L 2UUBL 3U9SA 1XYIA 3SEBA 4IOCA 1GXDC 5HY6A 3KF6A 4X3UA 4A75A 2A74C 1MKHA 1NTGA 2F3VA 1OXTA 2HQEA 4IFDI 1D8LA 3CCJA 3TP8A 1CUKA 1LT3D 3K81C 4IJHA 2FMMA 4LF6Q 2SNSA 5BR8L 3KUPA 1STHA 3URYA 1AW7A 3GTMH 5EKLA 4DAMA 3QOJA 2XTIA 4UHVA 1PRTB 3AMUA 3L3OC 1SDFA 4G4KA 1N8RC 3CP0A 1LT5D 4DV2Q 4GLVB 4NXML 2J7ZA 4UP9A 3SE0A 5C4XH 4HCSA 1Y8PB 1F9PA 3QIAA 3HOXG 4CBVA 1HFNA 2A69C 1BO0A 2F0KA 2A68C 4QMGA 1EY8A 1NSNS 1IBML 3A56A 3CCUA 4PNYA 1M1KC 1N9WA 4PG3A 4P74A 2SDFA 3D4WA 2MHVA 3CHBD 4DUZL 3S1QB 1T5EA 3JAMc 1E1TA 3OIQA 2HUGA 1GUGA 1JJ2A 4A3IH 2VXWA 5IT9E 2BCOA 4C3IB 1PDQA 1DOLA 1H9JA 2JEAI 1Z9FA 4CDEC 2XSCA 3FPUB 1G6PA 3HOXH 1PH5A 3KYHC 1N34Q 3BS1A 5BN4A 2I5HA 4GN3B 4A3GG 4CGYB 3ND9A 2A69D 3K59A 3NK9A 3CCSA 4RG1A 1JMCA 2F0OA 3NUCA 5L37A 3X3MA 4I7ZC 4C3IH 1H9MA 4LUZA 4YHHL 3TRZA 1EU4A 1HNZL 4YCVA 4C56C 5CGKA 4MIUA 1HNWQ 5C4XB 2FFKB 2HCCA 5NUCA 2UU9L 3S2HB 1VQHA 3H3VI 3GTJH 1EEID 3S17H 2JA9A 3VDYA 4X6AH 3Q24A 2D62A 2UU9Q 3OTOQ 4HJ5A 3V96A 2AUKA 4KY6A 3CPFA 5M5XH 3GTMB 2IY5B 1CKNB 5CV4A 2RF4A 1D2BA 3R2IA 3A7AB 4TQUS 1UUPA 1PLFA 2SNMA 2QEXA 1PH1A 4QF4A 3TN2A 3AQQA 1KNAA 1IBLQ 3NELA 4DR1L 3NHHA 1W6KA 4KD4A 1CHPD 5AJ3Q 3T1YL 4UP7A 4O2DA 1FD7D 1CT1D 4JI8Q 3V05A 3M9BA 1Y1WB 1GD7A 2JA6G 2KHJA 2NVXH 1K28A 3CRKC 5C0XG 4BY1G 1KTKA 1BCPC 3K5LA 2AMCB 1RIPA 1S5FD 3ERQA 3QOLA 4B3ML 1TKWB 4BBRG 2AKWB 1EQRA 3HOYG 4CKEA 2N78A 2XVSA 4JI0L 1ZYRC 1WTHA 2PI2A 3HOWG 3OPOA 1Y8OB 1CSQA 4J6HA 1Q7YC 1HZ9A 1N36Q 1FGUA 1EQVA 5D3DA 1D6EC 3C2PA 2Z6KC 2F1MA 4B3RQ 4JYAL 3EROA 1SNPA 4V190 3HFZB 4TVAB 1AFPA 1K0RA 4JG2A 3QB3A 2AQ3B 4I65A 1X54A 4XQNA 2AWNA 4NPSA 4X3TA 4LF5L 4XYOA 3BJUA 1IYJB 3W2DA 3JAME 2VB2X 4A3GH 1QVGA 2DN8A 5I2XA 4CDDC 1G6ZA 4PZ8A 4DV2L 1E22A 4K6LA 2XWBB 2JA6B 1IHZA 1BQQT 1I6VC 3BU2A 1SFOB 1YNJD 5A2QL 1LLRD 2F3IA 1Z47A 4DPGA 3S1RH 2LFNA 2TMPA 4KY5A 3I72A 2MUYA 1LT6D 1PRTF 4BA2I 4R1JA 4A3DH 1KHIA 3I2ZA 2VQEL 2E2JB 4ZK9B 4ZUJA 4OWXB 1X65A 3GTGB 1B4OA 1VQDA 3NTKA 1BBUA 2NVYH 1DOKA 4GNXC 1HPCA 1SMXA 3RMHA 2IX3A 3HOVH 4IZ8A 2JA8B 1I5FA 2B8FA 3AFQA 1QUQB 1SJHD 1SYGA 2F03A 4BXXH 4IUQA 1TWCH 1WYDA 4MZ9A 3RUZA 3AYHB 2Z6BA 4LWCA 2YTVA 4PQXA 4K5VA 3GV3A 4A3MB 5FLXc 5EBCA 1EIFA 1H9SB 4K0KQ 3A5UA 3NQIA 3K5MA 3HP3A 4X66L 3CQZH 4YWMA 3RLFA 4DV5Q 1ENAA 2EQSA 3KOJA 2KEEA 3K57A 1DOMA 3KLWA 1VQFA 2ENBA 1E7ZA 2K1BA 5A2QE 1SYFA 1X32A 2V4DA 1N32L 4APVA 4K5XA 3RR5A 1I3QB 2IHFA 2MO0A 3HOZB 4NXMQ 4MN3A 1HTLD 1BKBA 4HSVA 1PZJD 3C1FA 5IYBG 5JAVA 3LWUA 4L8JA 5ELEA 1DXMA 4HEDA 3RD4A 1E2VA 4A3FG 4A3CG 1HQRD 2RHSB 2R3ZA 3OOCA 3FHWA 1HTPA 1VDZA 3D0FA 2H4OA 4HMIA 3WDNA 3VR3A 5E3FA 2A5HA 4JI6Q 4QCLA 2EYJA 1RJTA 4JI0Q 3EBEA 4KKSA 4FXDA 3E3XA 4X62L 2HIVA 4RCNA 1HH2P 3Q8DA 4HJ7A 1QZHA 3CPWA 1SYDA 2E76C 2K5WA 4Y7NH 3TZUA 2BA1A 4KI0A 2UUBQ 4KJNA 2F0GA 1AN8A 3I4LA 1BCPF 4YWKA 1QE6A 1AZPA 4NXNL 5IT9L 4KMUC 4IPDA 4X62Q 4BBSB 1N33L 2JEBI 2E2JH 4Y52H 1MD2D 3M4YA 1B7YB 1YZ6A 3DM3A 1SMYC 3GTOH 4O0AA 2J0TD 2GN5A 1GUNA 3G6JB 4JBKA 2RSOA 2ZTEA 2IX1A 1S5DD 4CHTB 4DFAA 1SNMA 4C1NK 1XWEA 3PSIA 1HA6A 2R7ZB 3PCOB 4UP8A 3J81j 4OX9L 3ULPA 2E5LQ 1X9NA 1J8IA 5C3EB 2N3SA 5G3LD 5EKKA 3A8JE 1ET6A 4CJ1B 5J22A 3T1HL 1WTQA 1EIYB 4A3BG 1DYQA 3DEOA 3U9OA 1Q90A 2B2YA 4OX9Q 3NTHA 2XWJB 1OXXK 4RH6A 3J81c 1L1OB 1JWUD 5M5YH 3J81i 2MPMA 1JJCB 2SOBA 3G48A 4HIMA 2WB1E 2NB0A 4FXKC 4Y7NB 3MXNB 2PQEA 1U4MA 2LXKA 3GTQH 1A8VA 3P75A 4JI3Q 1CM9A 2Q8IB 1MSHA 2R7FA 1D5MC 1SNDA 2ZXRA 5I9PA 2O5IC 5AFWA 1HA5A
chains in the Genus database with same CATH topology
1SROA 4NXNQ 3I55A 4GKKQ 4JI1Q 3BZKA 3S2DH 3CCEA 1ASZA 4GN4B 1L1OA 2MO1A 4DV0L 4DV1Q 3I4NH 2R92H 4HJ8A 4BBSG 4XIGS 4A3LH 1A0IA 1O7IA 3JAMi 3PUZA 2D0OA 4GS3A 2R7DA 4A3CH 1X56A 3PIOA 1X6OA 3L0OA 4LF9Q 4A3EH 3M4QA 3I4MG 1VQNA 1PYBA 4LF7L 4GOPB 3OTOL 2JQOA 3S16H 3H0GG 1LUZA 4JBWA 5IP7H 1E24A 1BBWA 5IYDG 1HR0W 2JA5H 4JI6L 1P8LA 1GKHA 4LW1A 3SGIA 4DR5L 1PH2A 1EQQA 3GTGH 2K50A 4A3BH 1VQLA 1S40A 1ASYA 3K8AA 1L1OC 4MTNA 1WI5A 1V1QA 5C4XG 3HOYH 3PF4A 3A0JA 5FLMH 5JEAG 4A4IA 3E9HA 3OW2A 1XNRQ 3KDFA 1SFOH 3ULLA 4HJAA 2F4VL 5IT9c 1B8AA 1HNXQ 3I56A 1N32Q 4A3DG 4BBRH 5C0XJ 3T1HQ 1VQ7A 4BA1I 3A5ZB 5IP7G 2R93H 1CSPA 1WCMH 2UXDQ 1JT8A 4LF5Q 1Y1WH 4DR4L 4DR6L 4JI4Q 1K83H 3CCMA 5IYCH 4GKJQ 3RNUA 3F1ZA 1VQIA 1PHJA 4NB3A 5H1SE 4PMWA 4LNQA 2PMZE 5C3EH 2VQFQ 3PUVA 1W2BA 5M3FG 2BH8A 1WFQA 2JE6I 3FKIG 4HJ9A 4LUOA 1KD1C 1UE6A 3PUXA 2ZJQA 1HR0L 5HGQA 4DR3Q 1K8GA 1PV4A 1YHBA 4YY3Q 1L0WA 4AQYQ 2GVBA 1VQ5A 1N36L 2A19A 4DV6L 3RLNA 1KL9A 4A3JH 2VUMG 1Q46A 3E9IA 5M3FH 4DR3L 4GN5A 1XMQL 2UXCL 1KRSA 3J80i 4PZ7A 5GROA 1YJNA 1C9OA 3WWVA 4OO1I 3M4OH 2KCTA 5IWAQ 3CMEA 4DV7L 2NN6G 4R4OA 4LFAL 4FDBA 4R4IA 4C3HH 1NY4A 1YITA 4EQ5A 2LXJA 1HZAA 4A93G 4JI4L 4DR1Q 1RL2A 1R9TH 1SR3A 4DAYB 3DLLA 2Q2IA 2UUBL 1VQMA 3AEVA 1TWAH 3STBD 1UWVA 3L7ZC 1CKMA 1LM0A 4IPHA 4IJLA 4IOCA 4KHZA 3T1YQ 3PF5A 1PA6A 5HY6A 2HIXA 4JI5L 3KF6A 2VUMH 1VQPA 4L5RC 4A75A 2K5VA 2F4VQ 1MKHA 1NTGA 1OXTA 4L5QA 4JV5Q 2D0PA 4QY7A 3GTPH 1D8LA 3CCJA 4IFDI 1CUKA 1QUQA 3CCRA 3K81C 4IJHA 4DK6C 3CC7A 4JCVE 4LF6Q 2ZM6L 2B3GA 4X65Q 5BR8L 1HNZQ 3TS2A 1I94L 3GTMH 3CW2C 4DAMA 1I6HH 2XTIA 2PQAB 3ICEA 1T9HA 2Q2TA 4P75A 1N8RC 3CP0A 3M3YH 4HIKA 1X3EA 4DV2Q 4GLVB 4NXML 2ID0A 5M3MH 4UP9A 5C4XH 1VQCA 3KF6B 3OYYA 4LF9L 2CCZA 1VQEA 1VQ8A 4A3KG 3HOXG 2GVAA 4X64L 3M4PA 2QGQA 1MJCA 5JJIA 1IBML 2FXQA 1KQSA 2UXBQ 4DV6Q 3CCUA 3I4OA 1M1KC 1IZ6A 1N9WA 4PG3A 2IX0A 4P73A 4P74A 1A63A 1YNXA 3S1QH 4LF8L 2YTXA 4IO9A 2KENA 4DUZL 3CC2A 1OXVA 1SRUA 5M5WH 2R92G 3JAMc 4JYAQ 4B3RL 1E1TA 2K5NA 1JJ2A 4A3IH 3RLOA 1P16A 1PH7A 4HIDA 2ATWA 4DR6Q 4UPAA 1Z9FA 5IYBH 1YHQA 2JEAI 3FKIH 3RN5A 4PZ6A 1G6PA 3HOXH 1PH5A 3BZCA 3KYHC 1N34Q 1XPUA 2OQ0A 1VQ9A 2I5HA 4AH6A 4GN3B 4A3GG 1KAWA 3NENA 5IYCG 1XPOA 1VQBA 2B63H 3GD7A 2Q2UA 3HOZH 1IBLL 3PGZA 4DR4Q 1S72A 1YVCA 2R6GA 4DR2Q 3CCSA 2I0QA 4RG1A 5LMNW 1JMCA 2WP8J 4X64Q 2VQEQ 2E2IH 2UXDL 4JI8L 4C3IH 4LUZA 4YHHL 3TRZA 1GM5A 4YWLA 1HNZL 4YCVA 1V43A 3AFPA 4A3MG 3UDXA 2E5LL 1PH8A 4LF6L 2JA7H 3HOVG 1HNWQ 2F52A 3CAMA 2UU9L 1NMGA 1VQHA 4DV3L 2UUCQ 3GTJH 4DR5Q 3H3VI 3S17H 2JA9A 3VDYA 3CC4A 4X6AH 1Y1VG 2D62A 2ZTCA 2UUCL 3OTOQ 1YIJA 2UU9Q 4HJ5A 5GQOA 1TXYA 1OXUA 3MEFA 1C0AA 1I94Q 2JK8A 3CPFA 3HKZG 5M5XH 2IY5B 5E7NA 4A3MH 1CKNB 1IL2A 1HJPA 2RF4A 2ZM6Q 3W5OA 1VS0A 1B70B 2PNHA 3JC66 4TQUS 2L15A 3LGJA 5ELNA 2QEXA 4DV0Q 1PH1A 1Y1VH 3AQQA 1IBLQ 3NELA 4DR1L 3CCQA 4A3IG 4GKKL 2C35B 3HOUG 5AJ3Q 4R4TA 3UDGA 3T1YL 4YHHQ 1PFSA 2DUDA 4UP7A 4GOPA 4O2DA 2K52A 1K3RA 3D31A 1KRTA 4LFBL 5K36G 3J80c 4JI8Q 4UY8C 1KXLA 3M9BA 2RHQB 1GD7A 2JA6G 2KHJA 4DV1L 2NVXH 2UXCQ 2KCMA 1VQJA 5C0XG 1UEBA 4BY1G 3S15H 3W1GA 5DLQE 2Z0SA 1YJ9A 2AMCB 1E3PA 1Q12A 1RIPA 5FJ8G 1CKNA 3KJPA 2ES2A 1BVSA 4B3ML 2R93G 4XTCS 4BBRG 2AKWB 1EQRA 3PUWA 1M90C 3HOYG 4HIOA 1LTLA 2N78A 2MNAA 4JBMA 4JI0L 1W3SA 4QJFA 4L5TA 3A74A 3TEHB 3CXCA 3KDFB 2PI2A 4GLXA 3HOWG 4A3LG 3KF8B 1CSQA 1SLJA 1Q7YC 4H02A 1HZ9A 4A3JG 2IT1A 2YYZA 1UE5A 1N36Q 1FGUA 3FP9A 2Z6KC 4B3RQ 3S1NH 4JYAL 3ZJYC 2RCNA 1VQ4A 3HFZB 4DUZQ 4OWWB 1FVIA 4LFBQ 4TVAB 1EYGA 4LF8Q 4LFCQ 1K0RA 5GADC 4JG2A 2BA0A 2WAQE 5C44H 1V9PA 1X54A 2CWPA 2AWNA 5GAGC 4NPSA 1IBMQ 4LUVA 4DR7Q 4LF5L 3F8TA 2JA8G 1Q1BA 3BJUA 3L2PA 3CCLA 1IYJB 4JBJA 3S14H 2HT1A 2NZOA 3RZOH 4A3GH 1QVGA 2Z6KA 2CQOA 3K80C 4AYBG 4X65L 1HNXL 4PZ8A 3ULJA 4DV2L 1E22A 3HKSA 1J5EL 5ELOA 2JA5G 5IYDH 3NEMA 3BU2A 1WCMG 2VNUD 4JV5L 4DV3Q 3U58A 4QGUA 4BY1H 2F3IA 1Z47A 4DPGA 1AE3A 1N33Q 3S1RH 4LF7Q 1D7QA 4JI5Q 3S24A 3I4MH 1YEZA 5C44G 4BA2I 1VQKA 4R1JA 5BR8Q 1NBWA 2OWOA 1U0LA 2V1CC 4A3DH 1KHIA 1S3OA 3I2ZA 1OTCA 2E8GA 4GLAC 4P71A 2VQEL 4AIMA 3KJOA 1GO3E 3I4NG 4IFDJ 1VQ6A 4DR2L 4OWXB 2JA8H 1X65A 4WJ3M 5LMUL 3F2BA 1VQDA 1BBUA 2HQLA 2NVYH 1J6QA 3IRBA 4GNXC 1SMXA 3G6EA 2HHHL 4A3EG 2OTJA 2NN6I 4BY7G 4QL5A 1VQOA 3HOVH 4DV7Q 1I5FA 2DGYA 2LSSA 4IPCA 1N34L 2VY3A 3AFQA 5LMNL 4A3KH 3CD6A 1QUQB 2VW9A 1XNQQ 2OTLA 1YHAA 4BXXH 4DUYL 1TWCH 1WYDA 4MZ9A 4YCUA 3UE1A 1TWGH 3AYHB 4JI1L 2NVTH 4LWCA 2KHIA 2YTVA 1XMOQ 1K73C 3PO2H 5JJKA 2KBNA 4BY7H 4AQYL 2E2HH 5FLXc 5C0XI 2CFMA 4LFAQ 3M7NA 1EIFA 4OONA 4K0KQ 3A5UA 1NE3A 2JA6H 2PQAA 2I5LX 3B6YA 1EFWA 1FJGQ 1XMQQ 3GTLH 4X66L 3CQZH 1VCIA 4L5SA 2VQFL 1XJVA 4YWMA 3G4SA 3CF5A 3H3VH 1L2FA 4KHPQ 5C4JH 1I3QH 1K8AC 3RLFA 5FJ8H 2Q2HA 5C3EG 4DV5Q 2EQSA 4GKJL 4GNXB 3K0XA 3KOJA 4YY3L 3H0GH 3H15A 2BH2A 3HOZG 1QVFA 1WOCA 1GVPA 1PYSB 3KLWA 4WJ4A 4QIWE 1VQFA 4A76A 1E7ZA 4RMFA 4C3JH 1EUJA 4ALPA 4J15A 1KIXA 3TREA 1N32L 4APVA 3RR5A 3U50C 5IE8A 4JI2L 3U4VA 2MO0A 2IHFA 2AHOB 4LF4L 4NXMQ 1MIUA 2JJQA 4DKAC 1BKBA 1Q8KA 3NBHB 4JOIC 2ALYB 5IYBG 2N49A 2K75A 3ERSX 2MQHA 1XPRA 1FJGL 1G51A 2R7ZH 1JJGA 1XNRL 1WJJA 1VQAA 4MNOA 1YI2A 4A3FG 1YJWA 4A3CG 3PO3G 2A1AA 2RHSB 1TWHH 1TWFH 4R4QA 5IP9G 5GAHC 4POGA 1XMOL 2ASBA 3FHWA 3HKZE 5IY0A 3D0FA 4GNXA 4KHPL 1Q1EA 2QA4A 2N8NA 1YBYA 1XNQL 4JI6Q 3RZDH 4IOAA 1OXSC 2XGTA 2ZJPA 5LMNQ 1HZBA 1EOVA 1UE7A 4JI0Q 4A3FH 3EBEA 2CWAA 1X3GA 4X62L 4JI7L 4IPGA 1E1OA 4JOIA 3GTKH 2HIVA 3PO2G 1HH2P 3Q8DA 4HJ7A 1QZHA 1AH9A 2K4KA 3CPWA 3CCVA 1PH9A 4Y7NH 4DUYQ 3UDIA 2BA1A 4KI0A 2UUBQ 3J7A5 2PI2E 1G291 4C2MH 3G71A 2UUAQ 2CKZB 4R4CA 3TS0A 4POFA 4YWKA 3W1BA 4NXNL 1FL0A 1A62A 1NMFA 1HZCA 5IP9H 2WB1G 4IPDA 1IXRA 1EWIA 5AJ3L 2HHHQ 1QVCA 2B63G 4X62Q 4JI7Q 1N33L 5IWAL 2Y0SG 4YCWA 5FLMG 2JEBI 1DGSA 5LMUQ 3GDEA 1MJEA 2E2JH 2OQKA 2UUAL 3EIVA 4OWTB 1C7YA 4Y52H 3K7UC 1H95A 3PIPA 1B7YB 1YZ6A 3DM3A 2AWOA 3M85A 3TQYA 2B29A 3K7AH 4ME3A 3GTOH 4O0AA 1QZGA 1SE8A 1JB7A 2GN5A 2ZJRA 4JBKA 1K9MC 1PH3A 3U4ZA 2ZTEA 2IX1A 3UE0A 4A93H 1HR0Q 4EX5A 4P72A 1LYLA 3F2CA 3PSIA 4B3SL 2Y0SE 4DK3C 2A8VA 1IBKQ 4B3TQ 3F2DA 3PCOB 4OO1G 3S2HH 4UP8A 2VZAA 3J81j 4JI3L 1PH6A 1X55A 4KLKA 1J5EQ 3HOWH 4BBSH 4BXXG 4OX9L 3PUYA 3ULPA 2E5LQ 2YU9H 4LF4Q 3UDFA 1HNWL 1X3FA 5M3MG 2WAQG 2YV5A 1X9NA 4OXPA 2N3SA 4LFCL 1KC8C 2VL6A 1I50H 1Y14B 3STBC 3GO5A 5JEAJ 2EIFA 5EAYA 1NJIC 2MFIA 3T1HL 1AE2A 3S1MH 4DR7L 4DV4Q 2K14A 1EIYB 3E0EA 4DV5L 1VQGA 4A3BG 4AYBE 4OX9Q 1PVOA 4X66Q 4JI2Q 1PH4A 4DV4L 1OXXK 2NZHA 3J81c 1L1OB 2VS1A 3ER0A 5M5YH 2H5XA 3J81i 4B3TL 4IFDG 3KFUA 4K0KL 4B3SQ 3J7ZC 2ZTDA 4DNIA 1JJCB 3RN2A 3G48A 4HIMA 2WB1E 4GOPC 1Q81C 3HOUH 2EXDA 3MXNB 1Q82C 2NVQH 4QQBX 1CKOA 2JA7G 2WFWA 2LXKA 3I7FA 4JC0A 2UXBL 3EN2A 1Q86C 1A8VA 3GTQH 2R7ZG 1XTDA 2I5MX 4JI3Q 1JE5A 3PV0A 2OCEA 5JJLA 2R7FA 1IBKL 1U5KA 5J3BA 5GAEC 2IHEA 1Y1WG 3PO3H 1UE1A 1SN8A 2YTYA 4B3MQ 3CMAA 2K5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRO A;  4NXN Q;  3I55 A;  4GKK Q;  4JI1 Q;  3BZK A;  3S2D H;  3CCE A;  1ASZ A;  4GN4 B;  1L1O A;  2MO1 A;  4DV0 L;  4DV1 Q;  3I4N H;  2R92 H;  4HJ8 A;  4BBS G;  4XIG S;  4A3L H;  1A0I A;  1O7I A;  3JAM i;  3PUZ A;  2D0O A;  4GS3 A;  2R7D A;  4A3C H;  1X56 A;  3PIO A;  1X6O A;  3L0O A;  4LF9 Q;  4A3E H;  3M4Q A;  3I4M G;  1VQN A;  1PYB A;  4LF7 L;  4GOP B;  3OTO L;  2JQO A;  3S16 H;  3H0G G;  1LUZ A;  4JBW A;  5IP7 H;  1E24 A;  1BBW A;  5IYD G;  1HR0 W;  2JA5 H;  4JI6 L;  1P8L A;  1GKH A;  4LW1 A;  3SGI A;  4DR5 L;  1PH2 A;  1EQQ A;  3GTG H;  2K50 A;  4A3B H;  1VQL A;  1S40 A;  1ASY A;  3K8A A;  1L1O C;  4MTN A;  1WI5 A;  1V1Q A;  5C4X G;  3HOY H;  3PF4 A;  3A0J A;  5FLM H;  5JEA G;  4A4I A;  3E9H A;  3OW2 A;  1XNR Q;  3KDF A;  1SFO H;  3ULL A;  4HJA A;  2F4V L;  5IT9 c;  1B8A A;  1HNX Q;  3I56 A;  1N32 Q;  4A3D G;  4BBR H;  5C0X J;  3T1H Q;  1VQ7 A;  4BA1 I;  3A5Z B;  5IP7 G;  2R93 H;  1CSP A;  1WCM H;  2UXD Q;  1JT8 A;  4LF5 Q;  1Y1W H;  4DR4 L;  4DR6 L;  4JI4 Q;  1K83 H;  3CCM A;  5IYC H;  4GKJ Q;  3RNU A;  3F1Z A;  1VQI A;  1PHJ A;  4NB3 A;  5H1S E;  4PMW A;  4LNQ A;  2PMZ E;  5C3E H;  2VQF Q;  3PUV A;  1W2B A;  5M3F G;  2BH8 A;  1WFQ A;  2JE6 I;  3FKI G;  4HJ9 A;  4LUO A;  1KD1 C;  1UE6 A;  3PUX A;  2ZJQ A;  1HR0 L;  5HGQ A;  4DR3 Q;  1K8G A;  1PV4 A;  1YHB A;  4YY3 Q;  1L0W A;  4AQY Q;  2GVB A;  1VQ5 A;  1N36 L;  2A19 A;  4DV6 L;  3RLN A;  1KL9 A;  4A3J H;  2VUM G;  1Q46 A;  3E9I A;  5M3F H;  4DR3 L;  4GN5 A;  1XMQ L;  2UXC L;  1KRS A;  3J80 i;  4PZ7 A;  5GRO A;  1YJN A;  1C9O A;  3WWV A;  4OO1 I;  3M4O H;  2KCT A;  5IWA Q;  3CME A;  4DV7 L;  2NN6 G;  4R4O A;  4LFA L;  4FDB A;  4R4I A;  4C3H H;  1NY4 A;  1YIT A;  4EQ5 A;  2LXJ A;  1HZA A;  4A93 G;  4JI4 L;  4DR1 Q;  1RL2 A;  1R9T H;  1SR3 A;  4DAY B;  3DLL A;  2Q2I A;  2UUB L;  1VQM A;  3AEV A;  1TWA H;  3STB D;  1UWV A;  3L7Z C;  1CKM A;  1LM0 A;  4IPH A;  4IJL A;  4IOC A;  4KHZ A;  3T1Y Q;  3PF5 A;  1PA6 A;  5HY6 A;  2HIX A;  4JI5 L;  3KF6 A;  2VUM H;  1VQP A;  4L5R C;  4A75 A;  2K5V A;  2F4V Q;  1MKH A;  1NTG A;  1OXT A;  4L5Q A;  4JV5 Q;  2D0P A;  4QY7 A;  3GTP H;  1D8L A;  3CCJ A;  4IFD I;  1CUK A;  1QUQ A;  3CCR A;  3K81 C;  4IJH A;  4DK6 C;  3CC7 A;  4JCV E;  4LF6 Q;  2ZM6 L;  2B3G A;  4X65 Q;  5BR8 L;  1HNZ Q;  3TS2 A;  1I94 L;  3GTM H;  3CW2 C;  4DAM A;  1I6H H;  2XTI A;  2PQA B;  3ICE A;  1T9H A;  2Q2T A;  4P75 A;  1N8R C;  3CP0 A;  3M3Y H;  4HIK A;  1X3E A;  4DV2 Q;  4GLV B;  4NXM L;  2ID0 A;  5M3M H;  4UP9 A;  5C4X H;  1VQC A;  3KF6 B;  3OYY A;  4LF9 L;  2CCZ A;  1VQE A;  1VQ8 A;  4A3K G;  3HOX G;  2GVA A;  4X64 L;  3M4P A;  2QGQ A;  1MJC A;  5JJI A;  1IBM L;  2FXQ A;  1KQS A;  2UXB Q;  4DV6 Q;  3CCU A;  3I4O A;  1M1K C;  1IZ6 A;  1N9W A;  4PG3 A;  2IX0 A;  4P73 A;  4P74 A;  1A63 A;  1YNX A;  3S1Q H;  4LF8 L;  2YTX A;  4IO9 A;  2KEN A;  4DUZ L;  3CC2 A;  1OXV A;  1SRU A;  5M5W H;  2R92 G;  3JAM c;  4JYA Q;  4B3R L;  1E1T A;  2K5N A;  1JJ2 A;  4A3I H;  3RLO A;  1P16 A;  1PH7 A;  4HID A;  2ATW A;  4DR6 Q;  4UPA A;  1Z9F A;  5IYB H;  1YHQ A;  2JEA I;  3FKI H;  3RN5 A;  4PZ6 A;  1G6P A;  3HOX H;  1PH5 A;  3BZC A;  3KYH C;  1N34 Q;  1XPU A;  2OQ0 A;  1VQ9 A;  2I5H A;  4AH6 A;  4GN3 B;  4A3G G;  1KAW A;  3NEN A;  5IYC G;  1XPO A;  1VQB A;  2B63 H;  3GD7 A;  2Q2U A;  3HOZ H;  1IBL L;  3PGZ A;  4DR4 Q;  1S72 A;  1YVC A;  2R6G A;  4DR2 Q;  3CCS A;  2I0Q A;  4RG1 A;  5LMN W;  1JMC A;  2WP8 J;  4X64 Q;  2VQE Q;  2E2I H;  2UXD L;  4JI8 L;  4C3I H;  4LUZ A;  4YHH L;  3TRZ A;  1GM5 A;  4YWL A;  1HNZ L;  4YCV A;  1V43 A;  3AFP A;  4A3M G;  3UDX A;  2E5L L;  1PH8 A;  4LF6 L;  2JA7 H;  3HOV G;  1HNW Q;  2F52 A;  3CAM A;  2UU9 L;  1NMG A;  1VQH A;  4DV3 L;  2UUC Q;  3GTJ H;  4DR5 Q;  3H3V I;  3S17 H;  2JA9 A;  3VDY A;  3CC4 A;  4X6A H;  1Y1V G;  2D62 A;  2ZTC A;  2UUC L;  3OTO Q;  1YIJ A;  2UU9 Q;  4HJ5 A;  5GQO A;  1TXY A;  1OXU A;  3MEF A;  1C0A A;  1I94 Q;  2JK8 A;  3CPF A;  3HKZ G;  5M5X H;  2IY5 B;  5E7N A;  4A3M H;  1CKN B;  1IL2 A;  1HJP A;  2RF4 A;  2ZM6 Q;  3W5O A;  1VS0 A;  1B70 B;  2PNH A;  3JC6 6;  4TQU S;  2L15 A;  3LGJ A;  5ELN A;  2QEX A;  4DV0 Q;  1PH1 A;  1Y1V H;  3AQQ A;  1IBL Q;  3NEL A;  4DR1 L;  3CCQ A;  4A3I G;  4GKK L;  2C35 B;  3HOU G;  5AJ3 Q;  4R4T A;  3UDG A;  3T1Y L;  4YHH Q;  1PFS A;  2DUD A;  4UP7 A;  4GOP A;  4O2D A;  2K52 A;  1K3R A;  3D31 A;  1KRT A;  4LFB L;  5K36 G;  3J80 c;  4JI8 Q;  4UY8 C;  1KXL A;  3M9B A;  2RHQ B;  1GD7 A;  2JA6 G;  2KHJ A;  4DV1 L;  2NVX H;  2UXC Q;  2KCM A;  1VQJ A;  5C0X G;  1UEB A;  4BY1 G;  3S15 H;  3W1G A;  5DLQ E;  2Z0S A;  1YJ9 A;  2AMC B;  1E3P A;  1Q12 A;  1RIP A;  5FJ8 G;  1CKN A;  3KJP A;  2ES2 A;  1BVS A;  4B3M L;  2R93 G;  4XTC S;  4BBR G;  2AKW B;  1EQR A;  3PUW A;  1M90 C;  3HOY G;  4HIO A;  1LTL A;  2N78 A;  2MNA A;  4JBM A;  4JI0 L;  1W3S A;  4QJF A;  4L5T A;  3A74 A;  3TEH B;  3CXC A;  3KDF B;  2PI2 A;  4GLX A;  3HOW G;  4A3L G;  3KF8 B;  1CSQ A;  1SLJ A;  1Q7Y C;  4H02 A;  1HZ9 A;  4A3J G;  2IT1 A;  2YYZ A;  1UE5 A;  1N36 Q;  1FGU A;  3FP9 A;  2Z6K C;  4B3R Q;  3S1N H;  4JYA L;  3ZJY C;  2RCN A;  1VQ4 A;  3HFZ B;  4DUZ Q;  4OWW B;  1FVI A;  4LFB Q;  4TVA B;  1EYG A;  4LF8 Q;  4LFC Q;  1K0R A;  5GAD C;  4JG2 A;  2BA0 A;  2WAQ E;  5C44 H;  1V9P A;  1X54 A;  2CWP A;  2AWN A;  5GAG C;  4NPS A;  1IBM Q;  4LUV A;  4DR7 Q;  4LF5 L;  3F8T A;  2JA8 G;  1Q1B A;  3BJU A;  3L2P A;  3CCL A;  1IYJ B;  4JBJ A;  3S14 H;  2HT1 A;  2NZO A;  3RZO H;  4A3G H;  1QVG A;  2Z6K A;  2CQO A;  3K80 C;  4AYB G;  4X65 L;  1HNX L;  4PZ8 A;  3ULJ A;  4DV2 L;  1E22 A;  3HKS A;  1J5E L;  5ELO A;  2JA5 G;  5IYD H;  3NEM A;  3BU2 A;  1WCM G;  2VNU D;  4JV5 L;  4DV3 Q;  3U58 A;  4QGU A;  4BY1 H;  2F3I A;  1Z47 A;  4DPG A;  1AE3 A;  1N33 Q;  3S1R H;  4LF7 Q;  1D7Q A;  4JI5 Q;  3S24 A;  3I4M H;  1YEZ A;  5C44 G;  4BA2 I;  1VQK A;  4R1J A;  5BR8 Q;  1NBW A;  2OWO A;  1U0L A;  2V1C C;  4A3D H;  1KHI A;  1S3O A;  3I2Z A;  1OTC A;  2E8G A;  4GLA C;  4P71 A;  2VQE L;  4AIM A;  3KJO A;  1GO3 E;  3I4N G;  4IFD J;  1VQ6 A;  4DR2 L;  4OWX B;  2JA8 H;  1X65 A;  4WJ3 M;  5LMU L;  3F2B A;  1VQD A;  1BBU A;  2HQL A;  2NVY H;  1J6Q A;  3IRB A;  4GNX C;  1SMX A;  3G6E A;  2HHH L;  4A3E G;  2OTJ A;  2NN6 I;  4BY7 G;  4QL5 A;  1VQO A;  3HOV H;  4DV7 Q;  1I5F A;  2DGY A;  2LSS A;  4IPC A;  1N34 L;  2VY3 A;  3AFQ A;  5LMN L;  4A3K H;  3CD6 A;  1QUQ B;  2VW9 A;  1XNQ Q;  2OTL A;  1YHA A;  4BXX H;  4DUY L;  1TWC H;  1WYD A;  4MZ9 A;  4YCU A;  3UE1 A;  1TWG H;  3AYH B;  4JI1 L;  2NVT H;  4LWC A;  2KHI A;  2YTV A;  1XMO Q;  1K73 C;  3PO2 H;  5JJK A;  2KBN A;  4BY7 H;  4AQY L;  2E2H H;  5FLX c;  5C0X I;  2CFM A;  4LFA Q;  3M7N A;  1EIF A;  4OON A;  4K0K Q;  3A5U A;  1NE3 A;  2JA6 H;  2PQA A;  2I5L X;  3B6Y A;  1EFW A;  1FJG Q;  1XMQ Q;  3GTL H;  4X66 L;  3CQZ H;  1VCI A;  4L5S A;  2VQF L;  1XJV A;  4YWM A;  3G4S A;  3CF5 A;  3H3V H;  1L2F A;  4KHP Q;  5C4J H;  1I3Q H;  1K8A C;  3RLF A;  5FJ8 H;  2Q2H A;  5C3E G;  4DV5 Q;  2EQS A;  4GKJ L;  4GNX B;  3K0X A;  3KOJ A;  4YY3 L;  3H0G H;  3H15 A;  2BH2 A;  3HOZ G;  1QVF A;  1WOC A;  1GVP A;  1PYS B;  3KLW A;  4WJ4 A;  4QIW E;  1VQF A;  4A76 A;  1E7Z A;  4RMF A;  4C3J H;  1EUJ A;  4ALP A;  4J15 A;  1KIX A;  3TRE A;  1N32 L;  4APV A;  3RR5 A;  3U50 C;  5IE8 A;  4JI2 L;  3U4V A;  2MO0 A;  2IHF A;  2AHO B;  4LF4 L;  4NXM Q;  1MIU A;  2JJQ A;  4DKA C;  1BKB A;  1Q8K A;  3NBH B;  4JOI C;  2ALY B;  5IYB G;  2N49 A;  2K75 A;  3ERS X;  2MQH A;  1XPR A;  1FJG L;  1G51 A;  2R7Z H;  1JJG A;  1XNR L;  1WJJ A;  1VQA A;  4MNO A;  1YI2 A;  4A3F G;  1YJW A;  4A3C G;  3PO3 G;  2A1A A;  2RHS B;  1TWH H;  1TWF H;  4R4Q A;  5IP9 G;  5GAH C;  4POG A;  1XMO L;  2ASB A;  3FHW A;  3HKZ E;  5IY0 A;  3D0F A;  4GNX A;  4KHP L;  1Q1E A;  2QA4 A;  2N8N A;  1YBY A;  1XNQ L;  4JI6 Q;  3RZD H;  4IOA A;  1OXS C;  2XGT A;  2ZJP A;  5LMN Q;  1HZB A;  1EOV A;  1UE7 A;  4JI0 Q;  4A3F H;  3EBE A;  2CWA A;  1X3G A;  4X62 L;  4JI7 L;  4IPG A;  1E1O A;  4JOI A;  3GTK H;  2HIV A;  3PO2 G;  1HH2 P;  3Q8D A;  4HJ7 A;  1QZH A;  1AH9 A;  2K4K A;  3CPW A;  3CCV A;  1PH9 A;  4Y7N H;  4DUY Q;  3UDI A;  2BA1 A;  4KI0 A;  2UUB Q;  3J7A 5;  2PI2 E;  1G29 1;  4C2M H;  3G71 A;  2UUA Q;  2CKZ B;  4R4C A;  3TS0 A;  4POF A;  4YWK A;  3W1B A;  4NXN L;  1FL0 A;  1A62 A;  1NMF A;  1HZC A;  5IP9 H;  2WB1 G;  4IPD A;  1IXR A;  1EWI A;  5AJ3 L;  2HHH Q;  1QVC A;  2B63 G;  4X62 Q;  4JI7 Q;  1N33 L;  5IWA L;  2Y0S G;  4YCW A;  5FLM G;  2JEB I;  1DGS A;  5LMU Q;  3GDE A;  1MJE A;  2E2J H;  2OQK A;  2UUA L;  3EIV A;  4OWT B;  1C7Y A;  4Y52 H;  3K7U C;  1H95 A;  3PIP A;  1B7Y B;  1YZ6 A;  3DM3 A;  2AWO A;  3M85 A;  3TQY A;  2B29 A;  3K7A H;  4ME3 A;  3GTO H;  4O0A A;  1QZG A;  1SE8 A;  1JB7 A;  2GN5 A;  2ZJR A;  4JBK A;  1K9M C;  1PH3 A;  3U4Z A;  2ZTE A;  2IX1 A;  3UE0 A;  4A93 H;  1HR0 Q;  4EX5 A;  4P72 A;  1LYL A;  3F2C A;  3PSI A;  4B3S L;  2Y0S E;  4DK3 C;  2A8V A;  1IBK Q;  4B3T Q;  3F2D A;  3PCO B;  4OO1 G;  3S2H H;  4UP8 A;  2VZA A;  3J81 j;  4JI3 L;  1PH6 A;  1X55 A;  4KLK A;  1J5E Q;  3HOW H;  4BBS H;  4BXX G;  4OX9 L;  3PUY A;  3ULP A;  2E5L Q;  2YU9 H;  4LF4 Q;  3UDF A;  1HNW L;  1X3F A;  5M3M G;  2WAQ G;  2YV5 A;  1X9N A;  4OXP A;  2N3S A;  4LFC L;  1KC8 C;  2VL6 A;  1I50 H;  1Y14 B;  3STB C;  3GO5 A;  5JEA J;  2EIF A;  5EAY A;  1NJI C;  2MFI A;  3T1H L;  1AE2 A;  3S1M H;  4DR7 L;  4DV4 Q;  2K14 A;  1EIY B;  3E0E A;  4DV5 L;  1VQG A;  4A3B G;  4AYB E;  4OX9 Q;  1PVO A;  4X66 Q;  4JI2 Q;  1PH4 A;  4DV4 L;  1OXX K;  2NZH A;  3J81 c;  1L1O B;  2VS1 A;  3ER0 A;  5M5Y H;  2H5X A;  3J81 i;  4B3T L;  4IFD G;  3KFU A;  4K0K L;  4B3S Q;  3J7Z C;  2ZTD A;  4DNI A;  1JJC B;  3RN2 A;  3G48 A;  4HIM A;  2WB1 E;  4GOP C;  1Q81 C;  3HOU H;  2EXD A;  3MXN B;  1Q82 C;  2NVQ H;  4QQB X;  1CKO A;  2JA7 G;  2WFW A;  2LXK A;  3I7F A;  4JC0 A;  2UXB L;  3EN2 A;  1Q86 C;  1A8V A;  3GTQ H;  2R7Z G;  1XTD A;  2I5M X;  4JI3 Q;  1JE5 A;  3PV0 A;  2OCE A;  5JJL A;  2R7F A;  1IBK L;  1U5K A;  5J3B A;  5GAE C;  2IHE A;  1Y1W G;  3PO3 H;  1UE1 A;  1SN8 A;  2YTY A;  4B3M Q;  3CMA A;  2K5H A; 
#chains in the Genus database with same CATH topology
 4K8I A;  4JI1 Q;  2PMZ B;  2NVX B;  2QDL A;  2F0L A;  4B08 A;  3I4N H;  3SK4 A;  4Q0F A;  4XIG S;  1A0I A;  1FYC A;  4KKT A;  2D0O A;  1FR3 A;  1X56 A;  3L0O A;  4ID6 A;  4DK0 A;  4A3E H;  3SVM A;  1PYB A;  2Q8R E;  4GOP B;  3OTO L;  2JQO A;  3KK7 A;  3H0G G;  3H94 A;  1RDP D;  1HR0 W;  1E24 A;  1BBW A;  1P8L A;  2KVM A;  3PO2 B;  2F4I A;  3K8A A;  1L1O C;  2NVQ B;  4CDF C;  1LTS D;  3ITP A;  5JEA G;  3OW2 A;  1XNR Q;  3BYY B;  3D6C A;  3JAM L;  4HJA A;  1SNO A;  5IOC A;  2PCF B;  5IGF A;  3GTL B;  3I56 A;  4A3D G;  4BBR H;  3MZ5 A;  5C0X J;  1BNZ A;  1CZW A;  1MGS A;  2UXD Q;  1JWS D;  2XRQ D;  1MSG A;  1Y1W H;  4AYB B;  1K83 H;  2QF7 A;  4NW2 A;  4GKJ Q;  1EZ8 A;  2I07 B;  1TY0 A;  4K2L A;  5C3E H;  1SJE D;  3NWS A;  2C9O A;  1F9S A;  3FKI G;  4LUO A;  1KD1 C;  4XXE A;  2ZJQ A;  1CTM A;  3HEJ A;  4K5W A;  4KK7 A;  4JK1 C;  4ZUI A;  1HR0 L;  2L1B A;  1PV4 A;  1L0W A;  1N36 L;  1A6X A;  3RLN A;  4WRD A;  1Q46 A;  3E9I A;  3MEH A;  1ET9 A;  4OO1 I;  1C9O A;  4TKO B;  4KY7 A;  3R93 A;  4DU9 A;  2A6H D;  4DAV A;  1F9R A;  2LXJ A;  3L9A X;  3S9W A;  3J7A V;  1A3V A;  3N52 A;  4DAY B;  2PW5 A;  2JN4 A;  2Q2I A;  3STB D;  1WTX A;  1UWV A;  1CKM A;  1LM0 A;  2EVB A;  3T1Y Q;  2NZ1 D;  3GTL H;  2PZU A;  2HIX A;  1VF7 A;  4L5R C;  2K5V A;  4IUN A;  1EYA A;  4GZY C;  2D0P A;  3DEP A;  4QY7 A;  1ZEQ X;  4NKL A;  1WTW A;  2A6E D;  1O7L A;  4LMQ D;  4X65 Q;  3DWA A;  4FF2 A;  2MP1 A;  2E2I B;  3C1E A;  3CW2 C;  1I6H H;  1BXT A;  3LX0 A;  1LTB D;  1J9O A;  1T9H A;  1GUT A;  1X3E A;  2QIL A;  4XT1 B;  2ID0 A;  5M3M H;  4OIK A;  1VMC A;  3KF6 B;  3T13 A;  5C3W A;  1XTC D;  5BN5 A;  3OIP A;  1VQ8 A;  4A3K G;  4IN3 A;  2GVA A;  4X64 L;  1R9T B;  2QDB A;  1EFI D;  3M4P A;  1MJC A;  1PZI D;  3VYT A;  2FXQ A;  1KQS A;  1HFG A;  2IX0 A;  2QEJ C;  3NBH A;  1YNX A;  4LF8 L;  5FO9 B;  5C4Z A;  4IO9 A;  2KEN A;  1G8Z D;  1OXV A;  1SRU A;  2R92 G;  1DJR D;  3T16 A;  5LL6 X;  4B3R L;  4H13 C;  4N9T A;  3TP7 A;  1B3Q A;  1KDB A;  4FF1 A;  1K0S A;  1PH7 A;  1TS3 A;  1BBX C;  1SE4 A;  2D9U A;  4DR6 Q;  5IYB H;  1YHQ A;  3MAQ A;  4PZ6 A;  1EY9 A;  5EPL A;  2JP1 A;  3VR2 A;  1PMR A;  1GHJ A;  1VQ9 A;  4C3I G;  2K7V A;  3GTJ B;  1XPO A;  2A68 D;  3FRP B;  1VQB A;  3FVQ A;  3GD7 A;  3BDL A;  2Q2U A;  3HOZ H;  1BR9 A;  3PGZ A;  1S72 A;  5JEA H;  1I6H B;  4F88 A;  5LMN W;  2UXD L;  2WP8 J;  3BVG A;  1LO5 D;  2VQE Q;  2Z8L A;  5EJW A;  3MVV A;  2NWG A;  4OIJ A;  2A6H C;  3MFY A;  1OO9 B;  3GTK B;  1V43 A;  1AP0 A;  2I46 A;  5M5X B;  2UUC Q;  1NMG A;  3KBX A;  2FHT A;  2B2T C;  3VA7 A;  2UUC L;  1OXU A;  2PW7 A;  1I4X A;  5E4X A;  4B9W A;  3SHL A;  4BY7 B;  2DJF C;  4FF4 A;  5FLX L;  2ZM6 Q;  1VS0 A;  1B2T A;  3I91 A;  2L15 A;  2EXZ A;  3E6Z X;  3S14 B;  4DV0 Q;  5ELN A;  1Y1V H;  4RHR A;  2RDF A;  3X3N A;  3CCQ A;  4GKK L;  1EWH A;  1KDC A;  1ML0 D;  1U9R A;  4RKL A;  4DGZ A;  1A15 A;  2DUD A;  2K52 A;  1I50 B;  3J80 c;  2RHQ B;  1RF2 D;  3S2D B;  4ZAI A;  2UXC Q;  3LWE A;  2BE5 D;  1VQJ A;  3S15 H;  4H7B A;  3W1G A;  1YJ9 A;  4J8Q A;  1Q12 A;  5FJ8 G;  5EKI A;  1CKN A;  1V1P A;  2FIN B;  4JBM A;  1JCK B;  2WII B;  1W3S A;  2KHS A;  4QJF A;  2VB3 X;  1PXU A;  4L5T A;  4RGO S;  3TEH B;  3CXC A;  3S16 B;  4A3L G;  3ND8 A;  4A3J G;  3MA2 B;  1SYB A;  3FP9 A;  3ZJY C;  1CHQ D;  4DUZ Q;  3I90 A;  4OWW B;  1FVI A;  1SBB B;  4LFC Q;  5KGU A;  5JVH 3;  4ZKB B;  2WAQ E;  2KCN A;  4N8F A;  1YNN C;  1FNU A;  4DR7 Q;  3HGB A;  1O7Z A;  2JA8 G;  5JJZ A;  3G7L A;  2HT1 A;  3K80 C;  2CQO A;  4AYB G;  1SYC A;  1KLG D;  1ILQ A;  5I6Y A;  1KDA A;  3HKS A;  5ELO A;  1J5E L;  3PIO 3;  3NEM A;  1WCM G;  3P20 A;  1H9K A;  2XN9 C;  3OHX C;  1B53 A;  4QGU A;  2WIN B;  1AE3 A;  1RD9 D;  4JI5 Q;  3I4M H;  5CYU A;  1YEZ A;  1VQK A;  1STA A;  1O7Y A;  4HR7 B;  1RTN A;  1OTC A;  2E8G A;  4P71 A;  1JQY D;  1AEX A;  1VQ6 A;  4DR2 L;  2JA8 H;  1RHP A;  3F2B A;  1S5E D;  2JA5 B;  1J6Q A;  2CW0 C;  4ODG A;  5C3X A;  3TP6 A;  2JSO A;  4DV7 Q;  1F9Q A;  4IPC A;  2VY3 A;  2TSS A;  3CD6 A;  3H0G B;  1Y1V B;  4DUY L;  2UXB Q;  3UE1 A;  2NVT H;  4YCU A;  1TWG H;  4V0B A;  5JJK A;  4BY7 H;  4AQY L;  4R8I A;  2A73 B;  2EY1 A;  4LFA Q;  1PFN A;  2EZV A;  2PZW A;  3M7N A;  1U4R A;  4KJO A;  3IFT A;  1NE3 A;  2JA6 H;  2ICE C;  5I6W A;  1XMQ Q;  3BVZ A;  3GTP B;  2E75 C;  4L5S A;  4KHP Q;  1XJV A;  5C5M A;  4KHV A;  4GKJ L;  1ESR A;  2Q2H A;  5FJ8 H;  2X69 A;  3H15 A;  3H0G H;  5HUR A;  4WJ4 A;  1QVF A;  1WOC A;  3IFD A;  1NCV A;  2L11 A;  4C3J H;  1EUJ A;  3HZX A;  3TME A;  4J15 A;  1PTO B;  3U50 C;  1LTR D;  5IE8 A;  3U4V A;  2AHO B;  4LF4 L;  5FKA C;  2PYK A;  2ALY B;  3ERS X;  2MQH A;  5A35 A;  1H9S A;  1D5Z C;  1WJJ A;  2R92 B;  1D5X C;  1WVL A;  3PO3 G;  4IQZ A;  2KCC A;  1TWF H;  5GAH C;  1QB5 D;  3KBG A;  1XNQ L;  1MI2 A;  5FLX E;  1OXS C;  1SAP A;  2XGT A;  3I70 A;  1UE7 A;  3T51 B;  2CWA A;  4IPG A;  4ME5 A;  3PO2 G;  2X6L A;  1DON A;  2OF1 A;  4G57 A;  5CV8 A;  2KQ3 A;  4DUY Q;  3UDI A;  3GTO B;  1Q3L A;  1G29 1;  4ULL A;  5C6A A;  1STY A;  3NP8 A;  4POF A;  5I2Y A;  1A62 A;  1QNU A;  2WB1 G;  5KEE A;  2RA4 A;  1PRT D;  3E5S A;  4WOR A;  1FGB D;  2D2C C;  4DXF A;  5IWA L;  3GDE A;  1MJE A;  2UUA L;  1C7Y A;  1H95 A;  4J1M A;  3M85 A;  3TQY A;  3K7A H;  5JPN C;  1QZG A;  4A3G B;  1PH3 A;  3U4Z A;  3F2U A;  4A93 H;  4DK3 C;  3C46 A;  3W3A A;  1RKN A;  3HOW H;  2VZA A;  1J5E Q;  3IAY A;  1HUM A;  2EJM A;  4BXX G;  2F3W A;  3PUY A;  2WAQ G;  2YV5 A;  1GHK A;  3DM1 A;  2VL6 A;  5LL6 S;  1Y14 B;  3STB C;  5JEA J;  1G2S A;  5IGC A;  3VR6 A;  1AE2 A;  4DV5 L;  1DM0 B;  1STE A;  4X66 Q;  4JI2 Q;  1VF5 C;  3ER0 A;  2J4X A;  4B3T L;  2LS0 1;  4IFD G;  4C3J B;  2ZTD A;  1TII D;  5M3F B;  1R4P B;  4C3H G;  1CKO A;  2JA7 G;  2WFW A;  1Q86 C;  1JOK A;  1IL8 A;  2IJ0 A;  4BY1 B;  4L6T B;  1BOS A;  2OCE A;  3PV0 A;  3VYS A;  4P2C B;  4RGT A;  1IBK L;  5GAE C;  3WOE A;  2RBM A;  5KIX A;  1JB3 A;  1UE1 A;  1SN8 A;  3CMA A;  5J39 A;  3S2D H;  1CQV A;  2FMC A;  1QG7 A;  5DAU A;  3CCE A;  3H91 A;  1L1O A;  2MO1 A;  4G7H C;  2R92 H;  2PO4 A;  4HJ8 A;  3A54 A;  4BBS G;  1GUW A;  5JPM C;  3JAM i;  3PUZ A;  2RVL A;  2B63 B;  2K04 A;  3MXN A;  3S16 H;  1W6J A;  1LUZ A;  4TRD A;  1X3Q A;  4JBW A;  2R93 G;  4LW1 A;  4DR5 L;  3SGI A;  1PH2 A;  1NR4 A;  2HD3 A;  2NN6 H;  1BDO A;  4RKB A;  2BDN A;  2QKI C;  1WD0 A;  2L4N A;  1MHW C;  3A0J A;  5IGB A;  3E9H A;  2RSN A;  1JC7 A;  3KDF A;  3OMG A;  5D65 A;  1SNC A;  4DN4 M;  5C0X H;  1SFO H;  1DD2 A;  2F4V L;  3KF8 A;  5C44 B;  1HNX Q;  4U68 A;  2K28 A;  2NVY B;  4PMC A;  1N32 Q;  1PTO D;  1TWH B;  1EYD A;  2Z1C A;  1VQ7 A;  1HXY D;  2R93 H;  1CSP A;  1ROD A;  3H3V C;  4LF5 Q;  4DR4 L;  3F1Z A;  1HRJ A;  5CC4 A;  4NB3 A;  3MTS A;  3PUV A;  5K36 H;  4KN4 C;  1NNX A;  2JE6 I;  2L55 A;  1C48 A;  1UE6 A;  3PUX A;  5HGQ A;  4LAA A;  4AQY Q;  2GVB A;  3J81 E;  1VQ5 A;  4A3B B;  2Q8T A;  1LAB A;  4ABN A;  1Q8I A;  5M3F H;  4DR3 L;  3S1R B;  3HRZ C;  1LTI D;  2KCT A;  5IWA Q;  5JVG 3;  4DAP A;  1XX8 A;  4FDB A;  4O42 A;  1NY4 A;  4EQ5 A;  1PRT C;  4A93 G;  2KUM A;  4Z9C B;  4DR1 Q;  1RL2 A;  4RGM A;  3GP7 A;  4MTK A;  1PTO C;  3DLL A;  3AEV A;  1VQM A;  1TWA H;  1C4Q A;  3PF5 A;  4IJL A;  4KHZ A;  4OEL B;  1HUN A;  2ZT9 C;  4JI5 L;  5C4J B;  2F4V Q;  3J80 L;  4L5Q A;  3GTP H;  1PFB A;  3DHQ A;  1PZK D;  2F0I A;  2KED A;  2NBF A;  3K5O A;  4JCV E;  2RKS A;  2ZM6 L;  2B3G A;  3Q6S A;  3MWY W;  1HNZ Q;  1I4Q A;  1B1Z A;  1I94 L;  1HHV A;  4BS9 A;  2PQA B;  3ICE A;  4X3S A;  2Q2T A;  4DF7 A;  3TSS A;  3V2T A;  2P5Z X;  2JA7 B;  1VQC A;  3OYY A;  2CCZ A;  1VQE A;  2EYF A;  2K5D A;  2KOL A;  5FK9 C;  1GJX A;  5JJI A;  3K6O A;  5G3L F;  2E2D C;  4DV6 Q;  2D5D A;  3I4O A;  3CRL C;  1A63 A;  4FF3 A;  5ELD A;  4A3F B;  4CJ0 B;  5M5W H;  5IGG A;  4K2K A;  1QIL A;  4A3J B;  2F0N A;  1SE3 A;  2WAQ B;  3I8Z A;  3K5N A;  4M8A A;  4UPA A;  1TWC B;  2NTT A;  2C5C A;  3FKI H;  1JIC A;  3RN5 A;  3BDO A;  3BZC A;  2CH4 A;  4QIW B;  1ONL A;  2MGS A;  2OQ0 A;  4RAU C;  1KAW A;  3NEN A;  5IYC G;  1U4L A;  5IOD A;  2R6G A;  3I3C A;  4DR2 Q;  2OXP A;  4TSS A;  4X64 Q;  2F0V A;  3A55 A;  4XQQ A;  1GM5 A;  3BG3 A;  2E5L L;  3UDX A;  4LF6 L;  2JA7 H;  3HOV G;  4RFB A;  1EY0 A;  4KV6 A;  5F2D A;  1Y1V G;  2A6E C;  1YIJ A;  2DY8 A;  1TXY A;  3MEF A;  4A3E B;  1CZG A;  1I94 Q;  2F0E A;  2JK8 A;  3HKZ G;  4X3K A;  2L9H A;  4A3M H;  1IL2 A;  1HJP A;  1E0B A;  1B70 B;  2EY5 A;  2PNH A;  3JC6 6;  2F0W A;  3LGJ A;  1NUC A;  2NTS A;  1EU3 A;  4A3I G;  2C35 B;  4DNT B;  3HOU G;  2B2Y C;  3NXW A;  3UDG A;  2FJ2 A;  4GOP A;  4ZQ3 A;  1K3R A;  3D31 A;  4LFB L;  1EY7 A;  1CK1 A;  1RTO A;  3A7L A;  1DZ1 A;  1KXL A;  4WJW A;  3EJI A;  2KCM A;  1FNW A;  1QJO A;  4M1U B;  4FO2 A;  5DLQ E;  1TU2 B;  2Z0S A;  3EVQ A;  1E3P A;  1Y8N B;  4EVO A;  2K03 A;  3KJP A;  1BVS A;  3A8I E;  4XTC S;  1WD1 A;  4HIO A;  3OWE B;  2MNA A;  3D6W A;  2B2U C;  3A74 A;  4HAE A;  1UNS A;  1ZKO A;  1SLJ A;  4H44 C;  4H02 A;  2IT1 A;  2YYZ A;  1UE5 A;  3CU7 A;  5M9O A;  1E2W A;  1XXG A;  3S1N H;  5IGD A;  2O5J C;  5M5W B;  1EYG A;  4LF8 Q;  2Z9H A;  4EQO A;  2BA0 A;  1V9P A;  2B2U A;  1QOH A;  2CWP A;  1V1P B;  1IBM Q;  4LUV A;  3H6M A;  2K6A A;  2KA7 A;  2F0T A;  3L2P A;  5I9O A;  3QR8 A;  3K0Y A;  3RZO H;  3HG9 A;  5FO8 B;  2ZXO A;  2RDG A;  1T5X D;  2JA5 G;  2RDH A;  2VNU D;  4JV5 L;  4DV3 Q;  4L63 B;  4BY1 H;  5J1Z A;  1ZYR D;  4LF7 Q;  1D7Q A;  3S24 A;  4CKC A;  4RA8 A;  5BN3 A;  4I7A A;  4XYQ A;  2OWO A;  1JOR A;  2V1C C;  2WB1 B;  1I4R A;  5T1I A;  4IFD J;  4WJ3 M;  5LMU L;  2HQL A;  3IRB A;  1QWY A;  3G6E A;  2HHH L;  2OTJ A;  2NN6 I;  4BY7 G;  4QL5 A;  4G7Z C;  2LSS A;  2DGY A;  1N34 L;  4A3K H;  1UAP A;  2VW9 A;  1YHA A;  2K32 A;  1E2Z A;  4JI1 L;  1TWF B;  2KJX A;  1XMO Q;  1K73 C;  2KBN A;  2SEB D;  1NR2 A;  1D1K A;  2L12 A;  4OON A;  5M5Y B;  2K01 A;  5C4H A;  1K8O A;  2I5L X;  2JXM B;  3B6Y A;  1EFW A;  1WTO A;  1ZXT A;  2VQF L;  1LTT D;  4UAI A;  5C3E G;  3GV6 A;  4GNX B;  3S1M B;  4YY3 L;  2BH2 A;  3HOZ G;  1H9R A;  1PYS B;  1L0Y B;  4QIW E;  3IL8 A;  2Z4H A;  4RMF A;  1L0X B;  1KIX A;  2ICI A;  4JI2 L;  3T53 B;  2CQA A;  3Q22 A;  1MIU A;  2JJQ A;  3NBH B;  2N49 A;  2K75 A;  3TP5 A;  1FJG L;  2F0D A;  2R7Z H;  1LV9 A;  3S1N B;  1JJG A;  1XNR L;  4A3D B;  2HDM A;  4ZCK A;  2IWH A;  1SEB D;  2XRS D;  1ICF B;  4NDX A;  4R4Q A;  5KYI A;  2ASB A;  3NE5 B;  2NVT B;  3HKZ E;  2Z4I A;  2EY2 A;  4KHP L;  1Q1E A;  4A3I B;  3GQB A;  4IOA A;  3RZD H;  4A3K B;  1EYC A;  2R61 A;  3SK8 A;  2ZJP A;  1EOV A;  1PFM A;  3GTK H;  4JOI A;  1E1O A;  5EQ0 A;  3EQL C;  5KNC A;  1AH9 A;  1TQO A;  2K4K A;  3CCV A;  1A3U A;  2K05 A;  4R9W A;  4C2M H;  3G71 A;  2CKZ B;  3TS0 A;  1IW7 D;  3I4N B;  3W1B A;  1FL0 A;  2I0Q A;  3CQZ B;  1EWI A;  2HHH Q;  1GUS A;  1QVC A;  1B44 D;  1ENF A;  4HMJ A;  4RHS A;  2AUJ D;  2Y0S G;  2OQK A;  1F2Z A;  3EIV A;  4OWT B;  2Y0S B;  3K7U C;  2AWO A;  2B29 A;  4ME3 A;  4FYD A;  1JB7 A;  3P1H A;  1SE8 A;  4KN7 C;  2ZJR A;  2F0S A;  1STB A;  1K9M C;  3UE0 A;  1HR0 Q;  3SR1 A;  1LYL A;  4YIJ A;  5HGT A;  3F2C A;  2Y0S E;  1IBK Q;  4B3T Q;  3F2D A;  4OO1 G;  5CMD A;  1X55 A;  4KLK A;  1S4Z A;  2IL8 A;  2B2T A;  3WOF A;  2MJ8 A;  1HNW L;  2YU9 H;  2WAC A;  2EYL A;  4OXP A;  2F0F A;  4G7O C;  4LFC L;  5DM7 3;  1I50 H;  1TT2 A;  2EIF A;  5EAY A;  3S1M H;  2MFI A;  4UDU C;  4DV4 Q;  2F0M A;  2K14 A;  3E0E A;  1VQG A;  2EYM A;  3O13 A;  5ELF A;  4IUV A;  1PVO A;  5CV9 A;  1F2M A;  1PH4 A;  4DV4 L;  2N88 A;  2NZH A;  1Z6H A;  3FKI B;  1O78 A;  4OO1 H;  4B3S Q;  4C2M B;  4DNI A;  3RN2 A;  5FOB B;  1Q81 C;  3FDT A;  3HOY B;  1LAC A;  4QQB X;  4JC0 A;  3EN2 A;  1VMP A;  1LT4 D;  1JE5 A;  2F0P A;  2OT2 A;  5DM6 3;  5JJL A;  1EEF D;  1Y1W G;  3PO3 H;  2L0C A;  2YTY A;  4B3M Q;  2LMC B;  4B9X A;  2BDO A;  4NXN Q;  2BOS A;  4GKK Q;  1IKL A;  3BZK A;  1ASZ A;  4OGQ C;  4DV0 L;  2AQ2 B;  4DV1 Q;  1PTO F;  3SDZ A;  1I4G A;  1O7I A;  4GS3 A;  1TY2 A;  5ELC A;  3OW7 A;  4A3C H;  3PIO A;  2K5Q A;  1NAP A;  1VQN A;  1KLU D;  4LK1 C;  5IP7 H;  2JA5 H;  3AU7 A;  4IUU A;  4DK1 A;  3NTI A;  2B2V C;  1EWC A;  4A3B H;  1VQL A;  3VYR A;  2E74 C;  1EY4 A;  1S40 A;  5EGT A;  1ASY A;  1WI5 A;  5C4X G;  3I4M B;  3PF4 A;  1K3B C;  3BVM A;  3R3O A;  1O80 A;  4A4I A;  1EIG A;  5E4W C;  5IGE A;  2F0U A;  4RWS C;  2XIW A;  4HCE A;  2AQ1 B;  3T1H Q;  1SNQ A;  4BA1 I;  1QCB D;  3A5Z B;  5IP7 G;  1WCM H;  4JI4 Q;  1PHJ A;  5DEH A;  5H1S E;  3M3Y B;  4LNQ A;  2PMZ E;  3J7Y W;  1EL0 A;  3J7A F;  4S3S A;  1W2B A;  5M3F G;  1WFQ A;  4HJ9 A;  4YY3 Q;  1STG A;  4IUT A;  2A19 A;  3BYT B;  1KL9 A;  2VUM G;  4JPB W;  2EJG C;  2UXC L;  4IFD H;  3J80 i;  4PZ7 A;  2BE5 C;  5GRO A;  3WWV A;  1YJN A;  4K14 A;  3CME A;  1SYE A;  4DV7 L;  4R4I A;  4C3H H;  1YIT A;  2N55 A;  1HQM C;  5T1G A;  3L7Z C;  4IPH A;  3HOV B;  2WKC A;  1PA6 A;  2VUM H;  1VQP A;  3M4O B;  2YU9 B;  3MXG A;  2EE1 A;  2EY6 A;  2PPB C;  4JV5 Q;  2G9D A;  1D1I A;  3D3R A;  1CFM A;  1QUQ A;  3CCR A;  4O1N A;  4DK6 C;  3CC7 A;  3KLR A;  4RGN A;  3TS2 A;  1ILP A;  1UEA B;  1IKM A;  2F0H A;  1BCP D;  5DNF A;  4QUC A;  4HSP A;  4JW0 A;  3NWT A;  1TVX A;  4P75 A;  2B2W A;  3ZYY X;  3M3Y H;  2HDL A;  4HIK A;  2O4X A;  5C5L A;  4Q5V A;  2QCP X;  4LF9 L;  3FMC A;  3FPP A;  3NPP A;  2QGQ A;  4QB4 A;  3PO3 B;  1IZ6 A;  3VA5 A;  4P73 A;  1WTV A;  1GUO A;  3S1Q H;  3S17 B;  2YTX A;  3CC2 A;  2B39 A;  1Y69 U;  4JYA Q;  4FXG C;  3FEW X;  4N8X 1;  3HOX B;  2K5N A;  2M00 A;  3M7G A;  4N9P A;  3RLO A;  3K7A B;  3PIP 3;  1P16 A;  4HID A;  2ATW A;  3K58 A;  4K6D A;  1KAB A;  3D4D A;  3S15 B;  1XPU A;  5CV5 A;  4AH6 A;  3SXH A;  2B63 H;  5I4D A;  1IBL L;  3KLS A;  4DR4 Q;  1YVC A;  1IYV A;  2H1E A;  1F2L A;  1A3T A;  2E2I H;  2XNA C;  3DMU A;  4JI8 L;  1X3P A;  4KKU A;  4YWL A;  3AFP A;  3MXP A;  4A3M G;  1PH8 A;  5COY A;  1DCZ A;  2F52 A;  3CAM A;  4C1N I;  3DXJ C;  4DV3 L;  4DR5 Q;  1M8A A;  2RQX A;  1TS4 A;  3OSO A;  3CC4 A;  1YNJ C;  2ZTC A;  1PYW D;  5GQO A;  1C0A A;  1K8M A;  3QO2 A;  3J80 E;  1SMY D;  5E7N A;  4FP5 D;  2HCI A;  3W5O A;  3R8B A;  2KEC A;  1WTR A;  1CI3 M;  3MC0 B;  4DXG A;  5EBD A;  2VUM B;  4R4T A;  1RCV D;  4YHH Q;  1PFS A;  5K36 G;  1KRT A;  1B50 A;  4UY8 C;  5ISR A;  4QUF A;  5LHY 1;  4DV1 L;  1UEB A;  3HS0 C;  5EPK A;  3H09 A;  1A2U A;  3UI2 A;  2ES2 A;  1M90 C;  3PUW A;  4HN7 A;  4C3H B;  1LTL A;  2CVR A;  2LY7 A;  3KDF B;  4GLX A;  3TBI B;  3QG1 A;  1V1O A;  3KF8 B;  4CDC C;  4KTA A;  1TWA B;  5EPJ A;  4XQJ A;  2B2V A;  2RCN A;  1IYU A;  3A8K E;  1VQ4 A;  2G5D A;  5D14 A;  4LFB Q;  5GAD C;  4EQP A;  5C44 H;  1PTO H;  2L5T A;  3MFG A;  4PMB A;  5GAG C;  3HOW B;  1C8C A;  1R4Q B;  1K83 B;  3VR4 A;  3F8T A;  5D3I B;  1Q1B A;  1EZ6 A;  4NP5 A;  3CCL A;  1FNV A;  3PQI A;  1LTA D;  2K33 A;  2R93 B;  4JBJ A;  3S14 H;  2NZO A;  2EDG A;  4XT3 B;  2Z6K A;  4XDX A;  4F7X A;  4X65 L;  1HNX L;  3ULJ A;  1F77 A;  3N6R A;  5FO7 B;  1ESF A;  5CBE E;  5IYD H;  4BWG B;  3U58 A;  1N33 Q;  4IUR A;  5JOB A;  5KND A;  5C44 G;  1CQF A;  2B8G A;  5BR8 Q;  1NBW A;  1U0L A;  1WCM B;  1S3O A;  4GLA C;  4AIM A;  3KJO A;  1GO3 E;  3I4N G;  2QW7 A;  2EYP A;  3NQT A;  3HKZ B;  1U4P A;  4A3E G;  3QJY A;  1VQO A;  3OMC A;  1WTP A;  5LMN L;  3IKJ A;  1XNQ Q;  3GTQ B;  2OTL A;  5COR A;  3P7J A;  2KHI A;  3PO2 H;  2DNE A;  2E2H H;  5C0X I;  4IAL A;  4R8N A;  2CFM A;  2DNC A;  4NMZ A;  3RZD B;  2PQA A;  1FJG Q;  1VCI A;  3H3V H;  3G4S A;  3CF5 A;  1L2F A;  5C4J H;  1I3Q H;  1K8A C;  3D8G A;  4RCO A;  1S5B D;  3K0X A;  1GVP A;  2JYO A;  4A76 A;  3SK5 A;  4ALP A;  4E6I A;  1GOZ A;  3TRE A;  3QWN A;  3NBI A;  4BBR B;  1SSO A;  3C3L A;  4FNF A;  4DKA C;  1Q8K A;  4JOI C;  2GA4 B;  1XPR A;  1I4H A;  1G51 A;  4ZLT F;  4DAY A;  2NUC A;  1VQA A;  4MNO A;  5TSS A;  4ZYS A;  1EOT A;  1YI2 A;  1YJW A;  1HCZ A;  2NYZ D;  2A1A A;  1Z7T A;  1TWH H;  4WFN 3;  2EYH A;  5IP9 G;  4POG A;  1V8Q A;  4DA2 A;  1XMO L;  2M2L A;  5IY0 A;  4GNX A;  2CH4 W;  2QA4 A;  2N8N A;  1YBY A;  3EA6 A;  5K5P A;  5LMN Q;  1HZB A;  4A3F H;  2DY7 A;  1X3G A;  4JI7 L;  1KNE A;  3CKI B;  4EGV A;  1PH9 A;  5KYL A;  2EPB A;  1TS2 A;  3J7A 5;  2PI2 E;  2UUA Q;  4R4C A;  1B9M A;  3SK6 A;  1NMF A;  1HZC A;  3OWF A;  5IP9 H;  5AJ3 L;  1IXR A;  1ENC A;  4CKB A;  2B63 G;  4JI7 Q;  4YCW A;  5FLM G;  1DGS A;  5CBA E;  5LMU Q;  1EY5 A;  4KD3 A;  3D4R A;  3PIP A;  4F87 A;  3I73 A;  1MBY A;  2PZT A;  4HTH A;  1JOQ A;  5E1F A;  4EQN A;  4DNR B;  4EX5 A;  4P72 A;  4B3S L;  1AZQ A;  1F2Y A;  2A8V A;  2IW3 A;  3T4A C;  3S2H H;  1PH6 A;  4DR7 L;  4JI3 L;  1BUV T;  4U67 3;  4BBS H;  1CA6 A;  4LF4 Q;  3UDF A;  1X3F A;  5M3M G;  2WKD A;  4JVZ A;  2E2H B;  4OL7 A;  3T56 B;  3NSW A;  1KC8 C;  4ZRZ A;  4K8J A;  2EYO A;  3Q23 A;  2WV6 D;  1G91 A;  1BCP B;  1IW7 C;  3GO5 A;  1NJI C;  1B3A A;  5CV7 A;  1JE4 A;  2B2W C;  5CR3 A;  1EIH A;  1I4P A;  4AYB E;  5KRU A;  4OEM B;  2VS1 A;  4MHE A;  2H5X A;  3KFU A;  4K0K L;  3J7Z C;  3TDQ A;  4GOP C;  1QNK A;  3HOU H;  2EXD A;  4ILW A;  2NVQ H;  1Q82 C;  4H0L C;  3I7F A;  3MXU A;  2UXB L;  2R7Z G;  5CV6 A;  1XTD A;  2OEO A;  2G9H D;  2I5M X;  1S5C D;  1ICW A;  2F0Q A;  1SXT A;  1U5K A;  5J3B A;  2IHE A;  2X6G A;  2K5H A;  1SRO A;  3DWQ A;  3BZD B;  3I55 A;  5ELB A;  1EY6 A;  1TWG B;  4GN4 B;  1TS5 A;  1STN A;  3EFX D;  4CJ2 C;  1YNN D;  4F8M A;  3LNN A;  3PMF A;  4A3L H;  1B9N A;  2CW0 D;  2R7D A;  1X6O A;  4LF9 Q;  3M4Q A;  3TZD A;  3I4M G;  4LF7 L;  3KLS X;  1JWM D;  5IYD G;  2CHB D;  3BDC A;  1GKH A;  4JI6 L;  3GTG H;  1EQQ A;  2EJF C;  2LKV A;  2K50 A;  1LTG D;  2DJG C;  4A93 B;  3RZO B;  4MTN A;  1V1Q A;  3HOY H;  2F0J A;  1A2T A;  5FLM H;  3AB9 A;  1G2T A;  1EQT A;  3ULL A;  5IIF A;  5IT9 c;  3DUZ A;  3Q0A A;  1B8A A;  1II3 A;  2O2L D;  3VR5 A;  4OHJ A;  1SE2 A;  2PNR C;  1JT8 A;  2M9V A;  4DR6 L;  3CCM A;  3R2T A;  5IYC H;  3RNU A;  1VQI A;  2IPK D;  4PMW A;  2VQF Q;  1JR0 D;  2BH8 A;  4FVM A;  2EOT A;  1KAA A;  4LJZ C;  4C3J G;  1M4V A;  4DR3 Q;  1K8G A;  1YHB A;  4PV1 C;  4DV6 L;  4A3J H;  3ONA B;  1CA5 A;  3HOU B;  4GN5 A;  1XMQ L;  1KRS A;  4IUP A;  2RCF A;  1JOO A;  4ZKC B;  3M4O H;  1BF4 A;  2NN6 G;  4R4O A;  4LFA L;  5M3M B;  5KNB A;  2ZXP A;  1TR5 A;  3E0J A;  3DWP A;  1HZA A;  3MHB A;  4JI4 L;  3VYU A;  1R9T H;  1SR3 A;  3J81 L;  2UUB L;  3U9S A;  1XYI A;  3SEB A;  4IOC A;  1GXD C;  5HY6 A;  3KF6 A;  4X3U A;  4A75 A;  2A74 C;  1MKH A;  1NTG A;  2F3V A;  1OXT A;  2HQE A;  4IFD I;  1D8L A;  3CCJ A;  3TP8 A;  1CUK A;  1LT3 D;  3K81 C;  4IJH A;  2FMM A;  4LF6 Q;  2SNS A;  5BR8 L;  3KUP A;  1STH A;  3URY A;  1AW7 A;  3GTM H;  5EKL A;  4DAM A;  3QOJ A;  2XTI A;  4UHV A;  1PRT B;  3AMU A;  3L3O C;  1SDF A;  4G4K A;  1N8R C;  3CP0 A;  1LT5 D;  4DV2 Q;  4GLV B;  4NXM L;  2J7Z A;  4UP9 A;  3SE0 A;  5C4X H;  4HCS A;  1Y8P B;  1F9P A;  3QIA A;  3HOX G;  4CBV A;  1HFN A;  2A69 C;  1BO0 A;  2F0K A;  2A68 C;  4QMG A;  1EY8 A;  1NSN S;  1IBM L;  3A56 A;  3CCU A;  4PNY A;  1M1K C;  1N9W A;  4PG3 A;  4P74 A;  2SDF A;  3D4W A;  2MHV A;  3CHB D;  4DUZ L;  3S1Q B;  1T5E A;  3JAM c;  1E1T A;  3OIQ A;  2HUG A;  1GUG A;  1JJ2 A;  4A3I H;  2VXW A;  5IT9 E;  2BCO A;  4C3I B;  1PDQ A;  1DOL A;  1H9J A;  2JEA I;  1Z9F A;  4CDE C;  2XSC A;  3FPU B;  1G6P A;  3HOX H;  1PH5 A;  3KYH C;  1N34 Q;  3BS1 A;  5BN4 A;  2I5H A;  4GN3 B;  4A3G G;  4CGY B;  3ND9 A;  2A69 D;  3K59 A;  3NK9 A;  3CCS A;  4RG1 A;  1JMC A;  2F0O A;  3NUC A;  5L37 A;  3X3M A;  4I7Z C;  4C3I H;  1H9M A;  4LUZ A;  4YHH L;  3TRZ A;  1EU4 A;  1HNZ L;  4YCV A;  4C56 C;  5CGK A;  4MIU A;  1HNW Q;  5C4X B;  2FFK B;  2HCC A;  5NUC A;  2UU9 L;  3S2H B;  1VQH A;  3H3V I;  3GTJ H;  1EEI D;  3S17 H;  2JA9 A;  3VDY A;  4X6A H;  3Q24 A;  2D62 A;  2UU9 Q;  3OTO Q;  4HJ5 A;  3V96 A;  2AUK A;  4KY6 A;  3CPF A;  5M5X H;  3GTM B;  2IY5 B;  1CKN B;  5CV4 A;  2RF4 A;  1D2B A;  3R2I A;  3A7A B;  4TQU S;  1UUP A;  1PLF A;  2SNM A;  2QEX A;  1PH1 A;  4QF4 A;  3TN2 A;  3AQQ A;  1KNA A;  1IBL Q;  3NEL A;  4DR1 L;  3NHH A;  1W6K A;  4KD4 A;  1CHP D;  5AJ3 Q;  3T1Y L;  4UP7 A;  4O2D A;  1FD7 D;  1CT1 D;  4JI8 Q;  3V05 A;  3M9B A;  1Y1W B;  1GD7 A;  2JA6 G;  2KHJ A;  2NVX H;  1K28 A;  3CRK C;  5C0X G;  4BY1 G;  1KTK A;  1BCP C;  3K5L A;  2AMC B;  1RIP A;  1S5F D;  3ERQ A;  3QOL A;  4B3M L;  1TKW B;  4BBR G;  2AKW B;  1EQR A;  3HOY G;  4CKE A;  2N78 A;  2XVS A;  4JI0 L;  1ZYR C;  1WTH A;  2PI2 A;  3HOW G;  3OPO A;  1Y8O B;  1CSQ A;  4J6H A;  1Q7Y C;  1HZ9 A;  1N36 Q;  1FGU A;  1EQV A;  5D3D A;  1D6E C;  3C2P A;  2Z6K C;  2F1M A;  4B3R Q;  4JYA L;  3ERO A;  1SNP A;  4V19 0;  3HFZ B;  4TVA B;  1AFP A;  1K0R A;  4JG2 A;  3QB3 A;  2AQ3 B;  4I65 A;  1X54 A;  4XQN A;  2AWN A;  4NPS A;  4X3T A;  4LF5 L;  4XYO A;  3BJU A;  1IYJ B;  3W2D A;  3JAM E;  2VB2 X;  4A3G H;  1QVG A;  2DN8 A;  5I2X A;  4CDD C;  1G6Z A;  4PZ8 A;  4DV2 L;  1E22 A;  4K6L A;  2XWB B;  2JA6 B;  1IHZ A;  1BQQ T;  1I6V C;  3BU2 A;  1SFO B;  1YNJ D;  5A2Q L;  1LLR D;  2F3I A;  1Z47 A;  4DPG A;  3S1R H;  2LFN A;  2TMP A;  4KY5 A;  3I72 A;  2MUY A;  1LT6 D;  1PRT F;  4BA2 I;  4R1J A;  4A3D H;  1KHI A;  3I2Z A;  2VQE L;  2E2J B;  4ZK9 B;  4ZUJ A;  4OWX B;  1X65 A;  3GTG B;  1B4O A;  1VQD A;  3NTK A;  1BBU A;  2NVY H;  1DOK A;  4GNX C;  1HPC A;  1SMX A;  3RMH A;  2IX3 A;  3HOV H;  4IZ8 A;  2JA8 B;  1I5F A;  2B8F A;  3AFQ A;  1QUQ B;  1SJH D;  1SYG A;  2F03 A;  4BXX H;  4IUQ A;  1TWC H;  1WYD A;  4MZ9 A;  3RUZ A;  3AYH B;  2Z6B A;  4LWC A;  2YTV A;  4PQX A;  4K5V A;  3GV3 A;  4A3M B;  5FLX c;  5EBC A;  1EIF A;  1H9S B;  4K0K Q;  3A5U A;  3NQI A;  3K5M A;  3HP3 A;  4X66 L;  3CQZ H;  4YWM A;  3RLF A;  4DV5 Q;  1ENA A;  2EQS A;  3KOJ A;  2KEE A;  3K57 A;  1DOM A;  3KLW A;  1VQF A;  2ENB A;  1E7Z A;  2K1B A;  5A2Q E;  1SYF A;  1X32 A;  2V4D A;  1N32 L;  4APV A;  4K5X A;  3RR5 A;  1I3Q B;  2IHF A;  2MO0 A;  3HOZ B;  4NXM Q;  4MN3 A;  1HTL D;  1BKB A;  4HSV A;  1PZJ D;  3C1F A;  5IYB G;  5JAV A;  3LWU A;  4L8J A;  5ELE A;  1DXM A;  4HED A;  3RD4 A;  1E2V A;  4A3F G;  4A3C G;  1HQR D;  2RHS B;  2R3Z A;  3OOC A;  3FHW A;  1HTP A;  1VDZ A;  3D0F A;  2H4O A;  4HMI A;  3WDN A;  3VR3 A;  5E3F A;  2A5H A;  4JI6 Q;  4QCL A;  2EYJ A;  1RJT A;  4JI0 Q;  3EBE A;  4KKS A;  4FXD A;  3E3X A;  4X62 L;  2HIV A;  4RCN A;  1HH2 P;  3Q8D A;  4HJ7 A;  1QZH A;  3CPW A;  1SYD A;  2E76 C;  2K5W A;  4Y7N H;  3TZU A;  2BA1 A;  4KI0 A;  2UUB Q;  4KJN A;  2F0G A;  1AN8 A;  3I4L A;  1BCP F;  4YWK A;  1QE6 A;  1AZP A;  4NXN L;  5IT9 L;  4KMU C;  4IPD A;  4X62 Q;  4BBS B;  1N33 L;  2JEB I;  2E2J H;  4Y52 H;  1MD2 D;  3M4Y A;  1B7Y B;  1YZ6 A;  3DM3 A;  1SMY C;  3GTO H;  4O0A A;  2J0T D;  2GN5 A;  1GUN A;  3G6J B;  4JBK A;  2RSO A;  2ZTE A;  2IX1 A;  1S5D D;  4CHT B;  4DFA A;  1SNM A;  4C1N K;  1XWE A;  3PSI A;  1HA6 A;  2R7Z B;  3PCO B;  4UP8 A;  3J81 j;  4OX9 L;  3ULP A;  2E5L Q;  1X9N A;  1J8I A;  5C3E B;  2N3S A;  5G3L D;  5EKK A;  3A8J E;  1ET6 A;  4CJ1 B;  5J22 A;  3T1H L;  1WTQ A;  1EIY B;  4A3B G;  1DYQ A;  3DEO A;  3U9O A;  1Q90 A;  2B2Y A;  4OX9 Q;  3NTH A;  2XWJ B;  1OXX K;  4RH6 A;  3J81 c;  1L1O B;  1JWU D;  5M5Y H;  3J81 i;  2MPM A;  1JJC B;  2SOB A;  3G48 A;  4HIM A;  2WB1 E;  2NB0 A;  4FXK C;  4Y7N B;  3MXN B;  2PQE A;  1U4M A;  2LXK A;  3GTQ H;  1A8V A;  3P75 A;  4JI3 Q;  1CM9 A;  2Q8I B;  1MSH A;  2R7F A;  1D5M C;  1SND A;  2ZXR A;  5I9P A;  2O5I C;  5AFW A;  1HA5 A; 
#chains in the Genus database with same CATH homology
 1SRO A;  4NXN Q;  3I55 A;  4GKK Q;  4JI1 Q;  3BZK A;  3S2D H;  3CCE A;  1ASZ A;  4GN4 B;  1L1O A;  2MO1 A;  4DV0 L;  4DV1 Q;  3I4N H;  2R92 H;  4HJ8 A;  4BBS G;  4XIG S;  4A3L H;  1A0I A;  1O7I A;  3JAM i;  3PUZ A;  2D0O A;  4GS3 A;  2R7D A;  4A3C H;  1X56 A;  3PIO A;  1X6O A;  3L0O A;  4LF9 Q;  4A3E H;  3M4Q A;  3I4M G;  1VQN A;  1PYB A;  4LF7 L;  4GOP B;  3OTO L;  2JQO A;  3S16 H;  3H0G G;  1LUZ A;  4JBW A;  5IP7 H;  1E24 A;  1BBW A;  5IYD G;  1HR0 W;  2JA5 H;  4JI6 L;  1P8L A;  1GKH A;  4LW1 A;  3SGI A;  4DR5 L;  1PH2 A;  1EQQ A;  3GTG H;  2K50 A;  4A3B H;  1VQL A;  1S40 A;  1ASY A;  3K8A A;  1L1O C;  4MTN A;  1WI5 A;  1V1Q A;  5C4X G;  3HOY H;  3PF4 A;  3A0J A;  5FLM H;  5JEA G;  4A4I A;  3E9H A;  3OW2 A;  1XNR Q;  3KDF A;  1SFO H;  3ULL A;  4HJA A;  2F4V L;  5IT9 c;  1B8A A;  1HNX Q;  3I56 A;  1N32 Q;  4A3D G;  4BBR H;  5C0X J;  3T1H Q;  1VQ7 A;  4BA1 I;  3A5Z B;  5IP7 G;  2R93 H;  1CSP A;  1WCM H;  2UXD Q;  1JT8 A;  4LF5 Q;  1Y1W H;  4DR4 L;  4DR6 L;  4JI4 Q;  1K83 H;  3CCM A;  5IYC H;  4GKJ Q;  3RNU A;  3F1Z A;  1VQI A;  1PHJ A;  4NB3 A;  5H1S E;  4PMW A;  4LNQ A;  2PMZ E;  5C3E H;  2VQF Q;  3PUV A;  1W2B A;  5M3F G;  2BH8 A;  1WFQ A;  2JE6 I;  3FKI G;  4HJ9 A;  4LUO A;  1KD1 C;  1UE6 A;  3PUX A;  2ZJQ A;  1HR0 L;  5HGQ A;  4DR3 Q;  1K8G A;  1PV4 A;  1YHB A;  4YY3 Q;  1L0W A;  4AQY Q;  2GVB A;  1VQ5 A;  1N36 L;  2A19 A;  4DV6 L;  3RLN A;  1KL9 A;  4A3J H;  2VUM G;  1Q46 A;  3E9I A;  5M3F H;  4DR3 L;  4GN5 A;  1XMQ L;  2UXC L;  1KRS A;  3J80 i;  4PZ7 A;  5GRO A;  1YJN A;  1C9O A;  3WWV A;  4OO1 I;  3M4O H;  2KCT A;  5IWA Q;  3CME A;  4DV7 L;  2NN6 G;  4R4O A;  4LFA L;  4FDB A;  4R4I A;  4C3H H;  1NY4 A;  1YIT A;  4EQ5 A;  2LXJ A;  1HZA A;  4A93 G;  4JI4 L;  4DR1 Q;  1RL2 A;  1R9T H;  1SR3 A;  4DAY B;  3DLL A;  2Q2I A;  2UUB L;  1VQM A;  3AEV A;  1TWA H;  3STB D;  1UWV A;  3L7Z C;  1CKM A;  1LM0 A;  4IPH A;  4IJL A;  4IOC A;  4KHZ A;  3T1Y Q;  3PF5 A;  1PA6 A;  5HY6 A;  2HIX A;  4JI5 L;  3KF6 A;  2VUM H;  1VQP A;  4L5R C;  4A75 A;  2K5V A;  2F4V Q;  1MKH A;  1NTG A;  1OXT A;  4L5Q A;  4JV5 Q;  2D0P A;  4QY7 A;  3GTP H;  1D8L A;  3CCJ A;  4IFD I;  1CUK A;  1QUQ A;  3CCR A;  3K81 C;  4IJH A;  4DK6 C;  3CC7 A;  4JCV E;  4LF6 Q;  2ZM6 L;  2B3G A;  4X65 Q;  5BR8 L;  1HNZ Q;  3TS2 A;  1I94 L;  3GTM H;  3CW2 C;  4DAM A;  1I6H H;  2XTI A;  2PQA B;  3ICE A;  1T9H A;  2Q2T A;  4P75 A;  1N8R C;  3CP0 A;  3M3Y H;  4HIK A;  1X3E A;  4DV2 Q;  4GLV B;  4NXM L;  2ID0 A;  5M3M H;  4UP9 A;  5C4X H;  1VQC A;  3KF6 B;  3OYY A;  4LF9 L;  2CCZ A;  1VQE A;  1VQ8 A;  4A3K G;  3HOX G;  2GVA A;  4X64 L;  3M4P A;  2QGQ A;  1MJC A;  5JJI A;  1IBM L;  2FXQ A;  1KQS A;  2UXB Q;  4DV6 Q;  3CCU A;  3I4O A;  1M1K C;  1IZ6 A;  1N9W A;  4PG3 A;  2IX0 A;  4P73 A;  4P74 A;  1A63 A;  1YNX A;  3S1Q H;  4LF8 L;  2YTX A;  4IO9 A;  2KEN A;  4DUZ L;  3CC2 A;  1OXV A;  1SRU A;  5M5W H;  2R92 G;  3JAM c;  4JYA Q;  4B3R L;  1E1T A;  2K5N A;  1JJ2 A;  4A3I H;  3RLO A;  1P16 A;  1PH7 A;  4HID A;  2ATW A;  4DR6 Q;  4UPA A;  1Z9F A;  5IYB H;  1YHQ A;  2JEA I;  3FKI H;  3RN5 A;  4PZ6 A;  1G6P A;  3HOX H;  1PH5 A;  3BZC A;  3KYH C;  1N34 Q;  1XPU A;  2OQ0 A;  1VQ9 A;  2I5H A;  4AH6 A;  4GN3 B;  4A3G G;  1KAW A;  3NEN A;  5IYC G;  1XPO A;  1VQB A;  2B63 H;  3GD7 A;  2Q2U A;  3HOZ H;  1IBL L;  3PGZ A;  4DR4 Q;  1S72 A;  1YVC A;  2R6G A;  4DR2 Q;  3CCS A;  2I0Q A;  4RG1 A;  5LMN W;  1JMC A;  2WP8 J;  4X64 Q;  2VQE Q;  2E2I H;  2UXD L;  4JI8 L;  4C3I H;  4LUZ A;  4YHH L;  3TRZ A;  1GM5 A;  4YWL A;  1HNZ L;  4YCV A;  1V43 A;  3AFP A;  4A3M G;  3UDX A;  2E5L L;  1PH8 A;  4LF6 L;  2JA7 H;  3HOV G;  1HNW Q;  2F52 A;  3CAM A;  2UU9 L;  1NMG A;  1VQH A;  4DV3 L;  2UUC Q;  3GTJ H;  4DR5 Q;  3H3V I;  3S17 H;  2JA9 A;  3VDY A;  3CC4 A;  4X6A H;  1Y1V G;  2D62 A;  2ZTC A;  2UUC L;  3OTO Q;  1YIJ A;  2UU9 Q;  4HJ5 A;  5GQO A;  1TXY A;  1OXU A;  3MEF A;  1C0A A;  1I94 Q;  2JK8 A;  3CPF A;  3HKZ G;  5M5X H;  2IY5 B;  5E7N A;  4A3M H;  1CKN B;  1IL2 A;  1HJP A;  2RF4 A;  2ZM6 Q;  3W5O A;  1VS0 A;  1B70 B;  2PNH A;  3JC6 6;  4TQU S;  2L15 A;  3LGJ A;  5ELN A;  2QEX A;  4DV0 Q;  1PH1 A;  1Y1V H;  3AQQ A;  1IBL Q;  3NEL A;  4DR1 L;  3CCQ A;  4A3I G;  4GKK L;  2C35 B;  3HOU G;  5AJ3 Q;  4R4T A;  3UDG A;  3T1Y L;  4YHH Q;  1PFS A;  2DUD A;  4UP7 A;  4GOP A;  4O2D A;  2K52 A;  1K3R A;  3D31 A;  1KRT A;  4LFB L;  5K36 G;  3J80 c;  4JI8 Q;  4UY8 C;  1KXL A;  3M9B A;  2RHQ B;  1GD7 A;  2JA6 G;  2KHJ A;  4DV1 L;  2NVX H;  2UXC Q;  2KCM A;  1VQJ A;  5C0X G;  1UEB A;  4BY1 G;  3S15 H;  3W1G A;  5DLQ E;  2Z0S A;  1YJ9 A;  2AMC B;  1E3P A;  1Q12 A;  1RIP A;  5FJ8 G;  1CKN A;  3KJP A;  2ES2 A;  1BVS A;  4B3M L;  2R93 G;  4XTC S;  4BBR G;  2AKW B;  1EQR A;  3PUW A;  1M90 C;  3HOY G;  4HIO A;  1LTL A;  2N78 A;  2MNA A;  4JBM A;  4JI0 L;  1W3S A;  4QJF A;  4L5T A;  3A74 A;  3TEH B;  3CXC A;  3KDF B;  2PI2 A;  4GLX A;  3HOW G;  4A3L G;  3KF8 B;  1CSQ A;  1SLJ A;  1Q7Y C;  4H02 A;  1HZ9 A;  4A3J G;  2IT1 A;  2YYZ A;  1UE5 A;  1N36 Q;  1FGU A;  3FP9 A;  2Z6K C;  4B3R Q;  3S1N H;  4JYA L;  3ZJY C;  2RCN A;  1VQ4 A;  3HFZ B;  4DUZ Q;  4OWW B;  1FVI A;  4LFB Q;  4TVA B;  1EYG A;  4LF8 Q;  4LFC Q;  1K0R A;  5GAD C;  4JG2 A;  2BA0 A;  2WAQ E;  5C44 H;  1V9P A;  1X54 A;  2CWP A;  2AWN A;  5GAG C;  4NPS A;  1IBM Q;  4LUV A;  4DR7 Q;  4LF5 L;  3F8T A;  2JA8 G;  1Q1B A;  3BJU A;  3L2P A;  3CCL A;  1IYJ B;  4JBJ A;  3S14 H;  2HT1 A;  2NZO A;  3RZO H;  4A3G H;  1QVG A;  2Z6K A;  2CQO A;  3K80 C;  4AYB G;  4X65 L;  1HNX L;  4PZ8 A;  3ULJ A;  4DV2 L;  1E22 A;  3HKS A;  1J5E L;  5ELO A;  2JA5 G;  5IYD H;  3NEM A;  3BU2 A;  1WCM G;  2VNU D;  4JV5 L;  4DV3 Q;  3U58 A;  4QGU A;  4BY1 H;  2F3I A;  1Z47 A;  4DPG A;  1AE3 A;  1N33 Q;  3S1R H;  4LF7 Q;  1D7Q A;  4JI5 Q;  3S24 A;  3I4M H;  1YEZ A;  5C44 G;  4BA2 I;  1VQK A;  4R1J A;  5BR8 Q;  1NBW A;  2OWO A;  1U0L A;  2V1C C;  4A3D H;  1KHI A;  1S3O A;  3I2Z A;  1OTC A;  2E8G A;  4GLA C;  4P71 A;  2VQE L;  4AIM A;  3KJO A;  1GO3 E;  3I4N G;  4IFD J;  1VQ6 A;  4DR2 L;  4OWX B;  2JA8 H;  1X65 A;  4WJ3 M;  5LMU L;  3F2B A;  1VQD A;  1BBU A;  2HQL A;  2NVY H;  1J6Q A;  3IRB A;  4GNX C;  1SMX A;  3G6E A;  2HHH L;  4A3E G;  2OTJ A;  2NN6 I;  4BY7 G;  4QL5 A;  1VQO A;  3HOV H;  4DV7 Q;  1I5F A;  2DGY A;  2LSS A;  4IPC A;  1N34 L;  2VY3 A;  3AFQ A;  5LMN L;  4A3K H;  3CD6 A;  1QUQ B;  2VW9 A;  1XNQ Q;  2OTL A;  1YHA A;  4BXX H;  4DUY L;  1TWC H;  1WYD A;  4MZ9 A;  4YCU A;  3UE1 A;  1TWG H;  3AYH B;  4JI1 L;  2NVT H;  4LWC A;  2KHI A;  2YTV A;  1XMO Q;  1K73 C;  3PO2 H;  5JJK A;  2KBN A;  4BY7 H;  4AQY L;  2E2H H;  5FLX c;  5C0X I;  2CFM A;  4LFA Q;  3M7N A;  1EIF A;  4OON A;  4K0K Q;  3A5U A;  1NE3 A;  2JA6 H;  2PQA A;  2I5L X;  3B6Y A;  1EFW A;  1FJG Q;  1XMQ Q;  3GTL H;  4X66 L;  3CQZ H;  1VCI A;  4L5S A;  2VQF L;  1XJV A;  4YWM A;  3G4S A;  3CF5 A;  3H3V H;  1L2F A;  4KHP Q;  5C4J H;  1I3Q H;  1K8A C;  3RLF A;  5FJ8 H;  2Q2H A;  5C3E G;  4DV5 Q;  2EQS A;  4GKJ L;  4GNX B;  3K0X A;  3KOJ A;  4YY3 L;  3H0G H;  3H15 A;  2BH2 A;  3HOZ G;  1QVF A;  1WOC A;  1GVP A;  1PYS B;  3KLW A;  4WJ4 A;  4QIW E;  1VQF A;  4A76 A;  1E7Z A;  4RMF A;  4C3J H;  1EUJ A;  4ALP A;  4J15 A;  1KIX A;  3TRE A;  1N32 L;  4APV A;  3RR5 A;  3U50 C;  5IE8 A;  4JI2 L;  3U4V A;  2MO0 A;  2IHF A;  2AHO B;  4LF4 L;  4NXM Q;  1MIU A;  2JJQ A;  4DKA C;  1BKB A;  1Q8K A;  3NBH B;  4JOI C;  2ALY B;  5IYB G;  2N49 A;  2K75 A;  3ERS X;  2MQH A;  1XPR A;  1FJG L;  1G51 A;  2R7Z H;  1JJG A;  1XNR L;  1WJJ A;  1VQA A;  4MNO A;  1YI2 A;  4A3F G;  1YJW A;  4A3C G;  3PO3 G;  2A1A A;  2RHS B;  1TWH H;  1TWF H;  4R4Q A;  5IP9 G;  5GAH C;  4POG A;  1XMO L;  2ASB A;  3FHW A;  3HKZ E;  5IY0 A;  3D0F A;  4GNX A;  4KHP L;  1Q1E A;  2QA4 A;  2N8N A;  1YBY A;  1XNQ L;  4JI6 Q;  3RZD H;  4IOA A;  1OXS C;  2XGT A;  2ZJP A;  5LMN Q;  1HZB A;  1EOV A;  1UE7 A;  4JI0 Q;  4A3F H;  3EBE A;  2CWA A;  1X3G A;  4X62 L;  4JI7 L;  4IPG A;  1E1O A;  4JOI A;  3GTK H;  2HIV A;  3PO2 G;  1HH2 P;  3Q8D A;  4HJ7 A;  1QZH A;  1AH9 A;  2K4K A;  3CPW A;  3CCV A;  1PH9 A;  4Y7N H;  4DUY Q;  3UDI A;  2BA1 A;  4KI0 A;  2UUB Q;  3J7A 5;  2PI2 E;  1G29 1;  4C2M H;  3G71 A;  2UUA Q;  2CKZ B;  4R4C A;  3TS0 A;  4POF A;  4YWK A;  3W1B A;  4NXN L;  1FL0 A;  1A62 A;  1NMF A;  1HZC A;  5IP9 H;  2WB1 G;  4IPD A;  1IXR A;  1EWI A;  5AJ3 L;  2HHH Q;  1QVC A;  2B63 G;  4X62 Q;  4JI7 Q;  1N33 L;  5IWA L;  2Y0S G;  4YCW A;  5FLM G;  2JEB I;  1DGS A;  5LMU Q;  3GDE A;  1MJE A;  2E2J H;  2OQK A;  2UUA L;  3EIV A;  4OWT B;  1C7Y A;  4Y52 H;  3K7U C;  1H95 A;  3PIP A;  1B7Y B;  1YZ6 A;  3DM3 A;  2AWO A;  3M85 A;  3TQY A;  2B29 A;  3K7A H;  4ME3 A;  3GTO H;  4O0A A;  1QZG A;  1SE8 A;  1JB7 A;  2GN5 A;  2ZJR A;  4JBK A;  1K9M C;  1PH3 A;  3U4Z A;  2ZTE A;  2IX1 A;  3UE0 A;  4A93 H;  1HR0 Q;  4EX5 A;  4P72 A;  1LYL A;  3F2C A;  3PSI A;  4B3S L;  2Y0S E;  4DK3 C;  2A8V A;  1IBK Q;  4B3T Q;  3F2D A;  3PCO B;  4OO1 G;  3S2H H;  4UP8 A;  2VZA A;  3J81 j;  4JI3 L;  1PH6 A;  1X55 A;  4KLK A;  1J5E Q;  3HOW H;  4BBS H;  4BXX G;  4OX9 L;  3PUY A;  3ULP A;  2E5L Q;  2YU9 H;  4LF4 Q;  3UDF A;  1HNW L;  1X3F A;  5M3M G;  2WAQ G;  2YV5 A;  1X9N A;  4OXP A;  2N3S A;  4LFC L;  1KC8 C;  2VL6 A;  1I50 H;  1Y14 B;  3STB C;  3GO5 A;  5JEA J;  2EIF A;  5EAY A;  1NJI C;  2MFI A;  3T1H L;  1AE2 A;  3S1M H;  4DR7 L;  4DV4 Q;  2K14 A;  1EIY B;  3E0E A;  4DV5 L;  1VQG A;  4A3B G;  4AYB E;  4OX9 Q;  1PVO A;  4X66 Q;  4JI2 Q;  1PH4 A;  4DV4 L;  1OXX K;  2NZH A;  3J81 c;  1L1O B;  2VS1 A;  3ER0 A;  5M5Y H;  2H5X A;  3J81 i;  4B3T L;  4IFD G;  3KFU A;  4K0K L;  4B3S Q;  3J7Z C;  2ZTD A;  4DNI A;  1JJC B;  3RN2 A;  3G48 A;  4HIM A;  2WB1 E;  4GOP C;  1Q81 C;  3HOU H;  2EXD A;  3MXN B;  1Q82 C;  2NVQ H;  4QQB X;  1CKO A;  2JA7 G;  2WFW A;  2LXK A;  3I7F A;  4JC0 A;  2UXB L;  3EN2 A;  1Q86 C;  1A8V A;  3GTQ H;  2R7Z G;  1XTD A;  2I5M X;  4JI3 Q;  1JE5 A;  3PV0 A;  2OCE A;  5JJL A;  2R7F A;  1IBK L;  1U5K A;  5J3B A;  5GAE C;  2IHE A;  1Y1W G;  3PO3 H;  1UE1 A;  1SN8 A;  2YTY A;  4B3M Q;  3CMA A;  2K5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...