4DK3C

Structure of editosome protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
83
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDKEFIVIRCMDQVKLGSRVLVQGTLRMNRHVDDSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 10
structure length 83
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk3C00
4X62L 1SMXA 1Y1VG 1KRSA 3PCOB 1IBKL 3CCVA 2R7ZH 4IPCA 2MFIA 3M3YH 1TWHH 4RG1A 2UUCQ 1VQDA 4O2DA 3RN2A 3W1BA 1JJ2A 4DR4Q 1VQLA 2LSSA 2UUCL 3GTQH 1EOVA 3JAMc 4YHHQ 1VQ5A 4X6AH 4JI6Q 3KLWA 4A93H 1VQHA 2AWOA 4DR4L 1Y14B 2DGYA 2ALYB 5H1SE 4JI8Q 3U58A 1CUKA 4JI6L 1VQMA 1QZHA 3VDYA 3RZDH 1QVCA 4B3SL 2KBNA 3S1RH 4P71A 2B63G 1B7YB 2WB1E 4DV4Q 1Q1EA 1PH3A 1YBYA 2WP8J 1XNQQ 4C3JH 2E2IH 1XNQL 1X6OA 5AJ3Q 4HJ8A 2HIXA 1N9WA 3I7FA 4QJFA 5GADC 4HIOA 1B8AA 1TWAH 1YIJA 1VQFA 4HIKA 4RMFA 5AJ3L 4LNQA 4IPHA 4LF8Q 4GOPA 3M9BA 2A8VA 3HFZB 2E2HH 1KAWA 4A3IH 1Z47A 3G6EA 2ATWA 3KYHC 3PUWA 5IYDG 3UDFA 4IO9A 5C44G 2R6GA 2R7FA 2UUBL 4JI4Q 3HOYH 1SFOH 1ASZA 5E7NA 4OX9Q 4LF7Q 1NY4A 3TS0A 2YTXA 4EQ5A 4JI4L 1ASYA 2VNUD 2QGQA 3NBHB 2AKWB 4DV3L 4DR5L 1WCMH 5IP9H 2E2JH 4A76A 2HQLA 4BY7G 2PI2E 4BXXG 1KXLA 1X55A 3Q8DA 4AQYL 1PH9A 1OXXK 4HJ7A 2UXCQ 2Z6KC 2FXQA 1FJGQ 3UDXA 3KDFB 1A0IA 2N78A 2R93G 1UWVA 2UXCL 4JI1Q 1J6QA 4A3FH 4JC0A 1QVFA 3S17H 3M85A 5IE8A 5ELNA 4L5TA 2HIVA 4JI1L 3CF5A 4JI5Q 4BA2I 4DR7L 5C3EG 4POGA 3RLOA 3ER0A 1Q82C 4WJ4A 1KHIA 3L0OA 5GAHC 1VQEA 4BBRH 2V1CC 1MKHA 4DR1Q 5LMUQ 3PO2G 5FJ8G 1VQPA 2MO0A 2GVBA 3S15H 2LXJA 3CC2A 3AYHB 1VQIA 3PUVA 4IFDJ 3KJOA 4JG2A 4A3DH 4IPGA 2K5HA 3I4OA 3AFPA 4POFA 3W5OA 4BBSG 5FLMG 2Q2HA 2Q2IA 1PH8A 3I4NH 2B29A 1QZGA 1N34Q 4DV5Q 1E1TA 1V43A 5GAGC 4YCWA 5IYCH 3CCQA 3JC66 4C2MH 2JQOA 1HH2P 3D0FA 4IJLA 3CCJA 2WAQE 5GROA 1Q86C 3KF6A 1FL0A 3L2PA 1HR0W 4BY1H 1VQNA 1PVOA 4QQBX 3OW2A 2Q2TA 2CQOA 3J80c 1YJNA 5JEAJ 1KIXA 4WJ3M 3F8TA 1DGSA 5C4XH 4NXNL 1KRTA 2Z0SA 4A3MG 2OQ0A 4JBMA 2K50A 1E22A 1V1QA 2PNHA 1SRUA 2NVYH 4UP7A 4IOCA 2NVXH 1E7ZA 2JE6I 4DV1Q 4LW1A 4DUYQ 2KENA 4P72A 3B6YA 2ZJRA 1XMQL 1Q7YC 1H95A 4PZ7A 4YY3Q 4DV1L 3K7UC 4YWKA 1CKMA 2OWOA 5M3MH 4JI0Q 3PO3G 2JA6G 3H0GG 4GNXB 4UP8A 4HJ5A 2K4KA 2HHHL 4YY3L 4GNXC 1VQJA 1EYGA 4JI0L 5IYBG 3OYYA 1PHJA 3I4MH 4GKKQ 2GN5A 1HNWQ 1D7QA 4GKKL 4A3BH 1UE7A 3KDFA 3S1NH 3AFQA 3LGJA 1KQSA 4ALPA 4J15A 5LMNQ 1IYJB 1HNWL 4AIMA 3K8AA 1U0LA 3SGIA 1L2FA 4OWXB 3I56A 5C0XJ 2UUAQ 4QIWE 1HNZQ 3EIVA 1LYLA 5LMNL 1XPRA 2YU9H 4A3KH 1N33Q 4LF6L 1K8AC 2F3IA 1K3RA 1P8LA 3J81i 1U5KA 3JAMi 3CCEA 1KC8C 1YNXA 1E24A 1Y1WH 3CCUA 4K0KQ 2CCZA 4DAYB 1WFQA 2JK8A 3NENA 2JA5H 2NZHA 4DKAC 4C3IH 1NTGA 4DV2Q 1XNRQ 2IY5B 4O0AA 2MQHA 3KFUA 1Q8KA 3J7A5 4DV2L 3PF4A 1C9OA 1CKNB 5IP7H 3PF5A 1XTDA 1IZ6A 1EQRA 3NEMA 4YHHL 4A75A 3S1QH 4A3GG 2NVQH 4JI7Q 3ZJYC 2ZM6Q 2JA7G 4JI8L 1Y1VH 1V9PA 3F1ZA 3TQYA 1EFWA 1SE8A 4B3RQ 4OO1I 3CP0A 1IBMQ 2NZOA 1G51A 1HZ9A 4MTNA 2VQEQ 1PYBA 5K36G 4B3TQ 4DV4L 1UE1A 1K9MC 3TRZA 2BA1A 1JE5A 1N36Q 2GVAA 2A1AA 4B3TL 2YTYA 3CW2C 3OTOQ 3HOUG 1L1OA 1N36L 1RL2A 1SLJA 2WAQG 2A19A 3OTOL 4DK3C 1YEZA 5GQOA 1MJCA 1VQCA 2I5LX 4LF8L 1PH4A 2KHJA 2B63H 1AE3A 3PV0A 4R4CA 5IY0A 3M4QA 2RHSB 1VCIA 3HKZE 3HOVG 1O7IA 2VUMG 2AWNA 2IHFA 1BKBA 1T9HA 1YI2A 4LF7L 4OX9L 3CMAA 1W3SA 1XJVA 1BBWA 1Q46A 1EUJA 1YZ6A 3BJUA 4DUZQ 1GD7A 4IPDA 2K5NA 3T1HQ 1CSPA 4DUZL 4LUOA 4LUVA 2D0PA 5IYDH 2BH8A 4ME3A 4JI2Q 5C44H 3T1HL 1GVPA 1PYSB 4A3CG 2XTIA 4XTCS 1X3GA 4AYBG 1TXYA 3U4VA 5BR8Q 3CPFA 5M5WH 2R92G 4JOIA 4R4QA 1SR3A 1FJGL 4MNOA 2I5HA 4BA1I 1VS0A 2AHOB 1D8LA 3UE1A 4LF5Q 5BR8L 2IX0A 2ZJQA 4L5SA 2OTLA 4C3HH 3DLLA 2JA8G 4LF5L 3S16H 3GDEA 1I50H 1SN8A 4LF9Q 2QEXA 2E5LQ 5ELOA 3GO5A 5EAYA 4JI5L 4BY7H 4BXXH 3G71A 1PH7A 4DR6Q 2PQAB 1N32Q 2H5XA 4DR6L 3M7NA 4TVAB 2R93H 1N32L 3K7AH 5LMUL 1NMFA 2ID0A 1Q12A 4HJAA 4DR1L 4LFAQ 3H15A 3GTPH 1M90C 3F2BA 1X65A 1VQKA 2CWPA 1I5FA 3D31A 3A0JA 4A3JG 4GKJQ 1BBUA 3HOXG 4LFBQ 5C3EH 5JJKA 2Y0SG 3J80i 3CPWA 3ULJA 3CCLA 4GKJL 4LFBL 4DV6Q 2EIFA 4GN3B 1S72A 4KHPQ 3PO2H 4AH6A 4JOIC 1N34L 5FJ8H 4A4IA 4DV5L 1YJ9A 3CC4A 2JEAI 4QGUA 1JJGA 4KHPL 1AE2A 1CKOA 3S14H 4OWWB 4IFDI 4DNIA 3PIOA 1XMOQ 3GTOH 3AEVA 2N49A 1YHAA 3GD7A 4GS3A 2KCTA 5IWAQ 1XMOL 4DV7Q 2WFWA 1IXRA 4A3EG 4R4IA 4TQUS 5FLMH 3I55A 5M3FG 1M1KC 4BBSH 3TS2A 4JI3Q 4DV7L 4GLVB 3TEHB 3HOWG 1E1OA 1OTCA 2PI2A 1A8VA 2N3SA 2MO1A 2EXDA 3FKIG 4LF4Q 2K52A 1RIPA 5IT9c 1UE6A 4DUYL 3HOZG 3GTGH 1PH1A 1GM5A 2ZTEA 3CAMA 4AYBE 3HKZG 3KOJA 4UP9A 2Z6KA 1R9TH 4HJ9A 1FGUA 3S24A 4IJHA 3PUZA 4A3MH 1HZBA 1X54A 1IL2A 3H3VI 3H3VH 4A3LG 3A5ZB 1EWIA 4JCVE 3UE0A 3STBC 3WWVA 1HZAA 1L1OC 4GOPB 2UXBL 5J3BA 1K83H 3CCRA 4GOPC 1NJIC 4UY8C 1JB7A 1G6PA 2NN6I 1PV4A 1HNXQ 4DPGA 3PO3H 3PIPA 2UUAL 2YV5A 3MEFA 4P74A 1HNZL 1VQ9A 1X9NA 3H0GH 1HNXL 2JA6H 2IX1A 3S1MH 1OXVA 1C0AA 2MNAA 1N33L 2UXDQ 5IYBH 4PG3A 3E9IA 2R7ZG 3MXNB 1PH5A 2AMCB 4K0KL 2UXDL 1WI5A 3ERSX 4DAMA 1NMGA 3M4PA 3A74A 5C0XI 1XNRL 2Y0SE 3BZKA 1VQ7A 2ES2A 2IHEA 3U4ZA 1YITA 4GN4B 3FHWA 1HR0Q 5M5XH 4A93G 2K14A 4JYAQ 1PH6A 3KF8B 3GTLH 2PMZE 4PZ6A 4X62Q 3CQZH 3PSIA 1JJCB 4KLKA 1VQOA 4JYAL 4JI7L 2ZM6L 1XPOA 1LTLA 4NXMQ 1I6HH 3DM3A 2HT1A 2VY3A 3CCSA 4OO1G 3L7ZC 4JV5Q 4B3RL 4NXML 2R7DA 1A62A 1TWGH 4JBJA 4X66Q 1IBML 4YWMA 2VQEL 5FLXc 2YTVA 4JV5L 3RN5A 4X66L 3J81c 3CMEA 4MZ9A 3E9HA 3PUYA 4A3GH 1VQ8A 2F4VQ 2VW9A 4B3SQ 2RHQB 1IBLQ 2JA7H 1HJPA 1C7YA 1GO3E 4A3IG 2F4VL 4R1JA 2BA0A 2VQFQ 5HGQA 3ULPA 1EQQA 1IBLL 1VQAA 2EQSA 2I5MX 4LWCA 1MIUA 1VQBA 4P73A 4X64Q 2K5VA 2QA4A 4JBWA 3PUXA 2VQFL 3HOYG 4GNXA 1K73C 3EN2A 4X64L 2I0QA 3GTMH 4DV0Q 3TREA 3PGZA 3HOUH 1G291 3S2HH 3RR5A 1OXTA 2XGTA 3KF6B 1X3FA 1WCMG 5IP9G 4DV0L 3E0EA 4OWTB 2F52A 1WJJA 2ZTCA 1QUQB 2UUBQ 2YYZA 4LFCQ 2N8NA 1JT8A 1X3EA 4PZ8A 4JI2L 1VQGA 4P75A 4X65Q 3CCMA 3HOVH 4LFCL 1K0RA 1OXUA 3EBEA 4KHZA 2VUMH 1NBWA 2BH2A 1SROA 2L15A 3F2CA 4A3FG 4X65L 4DV3Q 4DR5Q 4Y52H 2JJQA 1S3OA 3NELA 1LUZA 3FP9A 1S40A 2RF4A 2JA9A 4AQYQ 5JJLA 2OTJA 4JBKA 4GLXA 1Q81C 3RLNA 4LF9L 2E5LL 3K80C 4BBRG 1B70B 4QY7A 1CKNA 3J81j 4KI0A 4A3CH 1A63A 2R92H 3CD6A 2Q2UA 3U50C 3RNUA 3S2DH 1HZCA 1CSQA 1I3QH 4YCUA 4LFAL 1WOCA 1WYDA 4NB3A 2KCMA 2JA8H 4L5RC 2OQKA 3CC7A 4DR7Q 4DR2Q 4A3DG 1X56A 1EIFA 1XPUA 1LM0A 2CKZB 1YJWA 3CXCA 4DR2L 3I4NG 1TWCH 1UEBA 2VZAA 5LMNW 4DV6L 1N8RC 2DUDA 4L5QA 4R4TA 5IYCG 3ICEA 3I2ZA 4BY1G 3UDGA 1TWFH 2NVTH 2VL6A 2OCEA 1KL9A 5HY6A 1MJEA 4IFDG 4XIGS 4UPAA 1AH9A 2K75A 4R4OA 1Z9FA 4A3JH 3HOXH 5C4XG 1E3PA 3HKSA 4YCVA 2D62A 3BZCA 1PFSA 2JEBI 5IWAL 2ZJPA 3J7ZC 3UDIA 1BVSA 2C35B 4OXPA 2D0OA 3M4OH 3AQQA 1EIYB 4JI3L 3T1YQ 4QL5A 4LUZA 3K0XA 3T1YL 1Q1BA 4LF4L 4GLAC 1W2BA 2KHIA 5M3MG 4Y7NH 4NXNQ 2WB1G 5JEAG 1QVGA 4DK6C 2IT1A 3RLFA 1QUQA 4NPSA 4A3EH 3I4MG 1L1OB 1OXSC 5M3FH 4YWLA 2E8GA 4B3MQ 4DR3Q 4A3BG 5C4JH 1FVIA 1GKHA 1UE5A 1YHBA 3G48A 4GN5A 1PH2A 5JJIA 1PA6A 1XMQQ 3HOWH 4FDBA 3GTKH 2VS1A 4DR3L 1YHQA 4B3ML 3FKIH 4H02A 4IOAA 3W1GA 2NN6G 3ULLA 2UXBQ 2ASBA 3HOZH 4PMWA 3KJPA 1I94Q 2RCNA 4A3KG 1JMCA 2HHHQ 3GTJH 1L0WA 3RZOH 5GAEC 1NE3A 2PQAA 4APVA 3K81C 1K8GA 1I94L 3IRBA 2UU9L 1KD1C 4OONA 5DLQE 1Y1WG 1J5EQ 4A3LH 2CFMA 1YVCA 2B3GA 1VQ4A 2LXKA 4HIMA 2JA5G 3STBD 1J5EL 2ZTDA 1VQ6A 3A5UA 5C0XG 3F2DA 3BU2A 3G4SA 5IP7G 4EX5A 2UU9Q 4LF6Q 4HIDA 1IBKQ 2CWAA 5M5YH 1HR0L 1P16A
chains in the Genus database with same CATH superfamily
1KRSA 3PCOB 4FXDA 1RODA 3M3YH 2UUCQ 1S5BD 5G3LF 1YNJD 3W1BA 2F0TA 1CA5A 1VQLA 2UUCL 1EOVA 3JAMc 1SE2A 3VR2A 2AWOA 2DGYA 5H1SE 4K5WA 4UDUC 1QZHA 4N9TA 3S1RH 4P71A 2B63G 2K5DA 5TSSA 4OO1H 4DV4Q 2F0GA 1XNQQ 2EY5A 2I46A 1ML0D 1CHQD 1XNQL 1RHPA 1MBYA 2AQ2B 2HIXA 2YU9B 1B8AA 1TWAH 4A3KB 2JSOA 4RMFA 4GOPA 3M9BA 4CDFC 4A3IH 1Z47A 3G6EA 3KYHC 5CGKA 3M3YB 2F4IA 1DOKA 3F2UA 1U9RA 2JA5B 1SFOH 3K5NA 2PZWA 4LF7Q 3TS0A 1SSOA 5IOCA 1EOTA 1SNQA 3EQLC 1K8MA 5EKLA 1J9OA 1HUNA 5IP9H 2E2JH 1G6ZA 3S1RB 4AQYL 1S5DD 2AQ1B 3DWQA 1FJGQ 3UDXA 2R93G 1A0IA 4K14A 2F0KA 5IE8A 2MP1A 4L5TA 1JWUD 2L11A 4QB4A 2ENBA 2N88A 5DM63 5C3EG 4POGA 3NXWA 1GUOA 1T5EA 2F0IA 4R8IA 4A3IB 1R4QB 1R4PB 2QDBA 2MO0A 3V2TA 3HEJA 3T13A 1EU3A 2SEBD 4RKLA 4A3DH 4IPGA 1STNA 2K5HA 1ICWA 3AFPA 2E2JB 1GJXA 2Q2HA 2IL8A 1V43A 5GAGC 3JC66 1HH2P 3CCJA 4BY1H 2WAQE 5GROA 1K3BC 1MSGA 1PVOA 4J6HA 3OW2A 4PMBA 2FFKB 3I73A 3EROA 4RH6A 1CZWA 2Q2TA 1ILQA 3OWFA 3V96A 2OQ0A 2PNHA 3D4WA 3T53B 1TQOA 2JE6I 3B6YA 2ZJRA 3K7UC 2UXBL 4GNXB 1L0XB 4A3DB 4GNXC 1EYGA 5KIXA 2E74C 5IYBG 3I4MH 3ND9A 2GN5A 2WACA 1D7QA 1UE7A 3J7YW 5EPKA 1KQSA 1IYJB 3S9WA 2X69A 1CI3M 3I56A 2NN6H 2CH4W 4UAIA 4DXGA 4Z9CB 5CV8A 2F3IA 3J81i 2FINB 1U4LA 4K0KQ 2B2VC 5LL6X 2L55A 4CBVA 4BBSB 4CKEA 2MQHA 3K0YA 3J7A5 3PF4A 3PF5A 1FNUA 4YHHL 1JOKA 2F0PA 2JA7G 3I4MB 3TQYA 4MTNA 5IGDA 1HZ9A 1PYBA 2K1BA 5G3LD 3H3VC 1L0YB 1K9MC 1X32A 3TRZA 1IL8A 1N36Q 1EZ6A 2YTYA 1L1OA 3U9SA 1N36L 3S1MB 4MHEA 1YEZA 3DEPA 1AE3A 1ZEQX 2RHSB 3J7AF 1W6KA 3SK4A 1O7IA 2AWNA 1GHKA 1BKBA 1YI2A 4Q5VA 3CMAA 1W3SA 2Z9HA 1LO5D 1Q46A 1YZ6A 2EY6A 3SVMA 5M5XB 1XJVA 2VXWA 3R93A 1CSPA 4FO2A 1SMYC 2BH8A 5C44H 1GVPA 2KHSA 1X3GA 1EY9A 3U4VA 4RAUC 5M5WH 4R4QA 3PIP3 1EWCA 4LF5Q 1EYAA 1VS0A 1CTMA 2IX0A 1D5ZC 3N52A 4LF5L 1I50H 1DXMA 1GOZA 4LF9Q 4DR6Q 1HHVA 4HMIA 2PQAB 5CV4A 1TY2A 2KUMA 4DR6L 3M7NA 4DR1L 1C4QA 2PZTA 1QNKA 1M90C 1S5CD 1LT6D 2OEOA 4DK0A 1I5FA 5C6AA 1STBA 1XX8A 2MHVA 5JJKA 2Y0SG 5E3FA 1SDFA 3J80i 5I6WA 4RHSA 1Z7TA 3IL8A 4DV6Q 5C44B 2L5TA 3PO2H 2CH4A 3CC4A 5FLXE 4A4IA 1YJ9A 4QGUA 3J81E 1PZJD 1AE2A 2FMMA 2Z8LA 1XMOQ 3GTOH 4XT3B 3AEVA 1DOLA 5IWAQ 1XMOL 5CV7A 4R4IA 4TQUS 1PTOC 2Z1CA 1E1OA 2A73B 1OTCA 1G91A 2F3WA 5IT9c 5KEEA 3NK9A 3NWSA 4M1UB 1GM5A 5C3WA 1R9TH 4HJ9A 1FGUA 3S24A 4IJHA 1DYQA 1IL2A 1HZBA 1OO9B 3STBC 3WWVA 1HZAA 3RD4A 5FOBB 3CCRA 1PV4A 1RF2D 3BYYB 1BQQT 1F2ZA 4DPGA 2UUAL 2YV5A 4P74A 1HCZA 1X9NA 3H0GH 2JA6H 3GTOB 1OXVA 1EY7A 2MNAA 3NWTA 1CHPD 3E9IA 4CDDC 1WI5A 3ERSX 4DAMA 2RSOA 3M4PA 3M4OB 1YNJC 1TY0A 5C0XI 4FYDA 4G4KA 1VQ7A 1F9RA 3U4ZA 1NAPA 5JJZA 4GN4B 4JYAQ 1SE3A 2AUKA 4Y7NB 3PSIA 4P2CB 1VQOA 4JYAL 4JI7L 4NXMQ 4KJOA 3P75A 4KD4A 1TR5A 2K28A 4OO1G 2RDGA 4NXML 4X66Q 2EJFC 3RN5A 4X66L 2A69C 3PUYA 1VQ8A 3H0GB 3I72A 2F4VQ 4CJ0B 3D4DA 2VW9A 1QOHA 1IBLQ 1GUTA 3C1FA 4A3IG 3AMUA 2F4VL 3IFTA 2BA0A 3ULPA 2A74C 1H9SB 1IBLL 5K36H 3MHBA 3SEBA 1GUNA 3CHBD 4JBWA 4GNXA 1BBXC 3KBGA 1GUSA 4OEMB 1LT3D 2IW3A 1NR4A 1OXTA 1O80A 5IP9G 4OWTB 2ZTCA 2F0SA 4JI2L 2R61A 1VQGA 2BH2A 2B2VA 3F2CA 3SDZA 2E75C 3QG1A 1LUZA 1K28A 3FP9A 1S40A 2RF4A 4JBKA 2E5LL 4QY7A 3NUCA 4KY6A 4CGYB 1HZCA 4C3JB 3QJYA 4LFAL 1WYDA 2JA8H 2OQKA 2AQ3B 4A3DG 3L9AX 1ET6A 2QF7A 4HCSA 4DU9A 1FGBD 1TWCH 2B2UC 4Q0FA 4NMZA 3SR1A 1U4RA 1ONLA 1SYBA 1BDOA 4WRDA 3ICEA 3I2ZA 4BY1G 3R8BA 5T1GA 2ICIA 4ZRZA 3QOJA 4A3JH 1E3PA 1PTOF 3BZCA 2D0OA 1Z6HA 4JI3L 1PZKD 4ZYSA 5IGEA 2M9VA 4GZYC 4GLAC 5CR3A 3S17B 2E2DC 4NPSA 4A3EH 3I4MG 3C46A 2L0CA 2EE1A 2E8GA 2VB2X 4B3MQ 1TWCB 5C4JH 2ZXOA 3AU7A 3T4AC 3HOWH 1M8AA 4FDBA 3GTKH 4B3ML 2G5DA 1H9MA 3T56B 2NN6G 3ULLA 2ASBA 3HOZH 2HHHQ 3GTJH 2PQAA 1EWHA 1E2WA 3VYTA 1AZPA 4XQQA 4RCNA 5DLQE 2KECA 1TKWB 2M00A 4IALA 2LXKA 2F0VA 2PMZB 3X3MA 3F2DA 4LK1C 5EBCA 1KTKA 4EX5A 2F0QA 2PO4A 5M5YH 2DN8A 4DAPA 2Z4HA 3QR8A 4X62L 4RG1A 5C4JB 4DN4M 4JW0A 4O2DA 4CKCA 1C8CA 3P20A 2NVXB 4DR4Q 2LSSA 1B1ZA 3OIPA 1QCBD 4DR4L 4G7OC 3GTJB 3R2IA 4JI8Q 1AN8A 5FO7B 1SBBB 3VDYA 2XRSD 3GV6A 4B3SL 2RA4A 2CW0C 3TP6A 3HP3A 2WB1E 3T16A 1Q1EA 1PH3A 5DNFA 3TN2A 4ABNA 1ESFA 4EQNA 1KNEA 4KV6A 4LNQA 1VQFA 4HIKA 3PMFA 4IPHA 4KY5A 4LF8Q 1NNXA 1XXGA 3R3OA 4QMGA 5C44G 3P7JA 2UUBL 2K04A 1A3VA 3EFXD 2OT2A 5ELBA 1NSNS 2YTXA 4FXGC 1JB3A 4HSPA 4ID6A 2VNUD 3D8GA 5T1IA 4DV3L 4IURA 2CHBD 1WCMH 1KNAA 4BWGB 1LTSD 2PPBC 3Q8DA 1PH9A 2UXCQ 2Z6KC 1NR2A 1PXUA 2N78A 1UWVA 5EPJA 2UXCL 3W3AA 2VB3X 1MSHA 2HIVA 4C1NI 2IJ0A 3G6JB 1TS3A 3RLOA 4WJ4A 1Q82C 1KHIA 5GAHC 1VQEA 2V1CC 3PO2G 5LMUQ 2GVBA 3S15H 3CC2A 4KHVA 4OELB 1XTCD 4G57A 1VQIA 4MTKA 2FJ2A 4JG2A 1WCMB 3W5OA 3I4NH 1QZGA 1N34Q 4DV5Q 2F0JA 5FLXL 2NWGA 3KK7A 5IYCH 3CCQA 1MGSA 1CQFA 2JQOA 3D0FA 5FO8B 3E5SA 3J81L 5KRUA 2V4DA 4QQBX 1IW7D 2CQOA 5HURA 1KIXA 4WJ3M 4C3HB 4S3SA 4NXNL 2PW5A 2ZT9C 1EIGA 4K2KA 1Q3LA 1H9RA 1E22A 1V1QA 2P5ZX 4LMQD 4UP7A 2Z6BA 1E7ZA 1SYFA 4DUYQ 3EJIA 4P72A 4DNRB 3S15B 3NBHA 5J1ZA 1H95A 3DXJC 4PZ7A 3LNNA 2OWOA 1CKMA 4N9PA 5M3MH 2JA6G 3H0GG 4HJ5A 4GKKQ 1VQJA 1AZQA 1PHJA 3VYRA 1ZXTA 1HNWQ 3I4NB 4GKKL 3KDFA 4ALPA 4J15A 1K0SA 1HNWL 4AIMA 3SGIA 4FF2A 1UAPA 1PFBA 5C4HA 3OSOA 2H4OA 1XPRA 2YU9H 1AP0A 2IWHA 4F87A 4A3KH 2B2UA 4TKOB 1P8LA 1U5KA 3JAMi 1BR9A 1KC8C 3OHXC 2BE5D 1E24A 2RDFA 2JA5H 3DMUA 2NZHA 4DKAC 2IY5B 1NTGA 1LLRD 1XNRQ 1EFID 2HQEA 1CKNB 5IP7H 1XTDA 5M3MB 4A75A 3S1QH 4R9WA 1D5XC 2RVLA 2BDNA 3F1ZA 1EFWA 3A8IE 2J7ZA 1SAPA 2IPKD 3CP0A 1KDCA 5K36G 4L8JA 4F7XA 4DV4L 1LTTD 1JE5A 1KAAA 5IGBA 3A54A 5EKKA 1RL2A 3IAYA 2F0HA 1H9JA 3K6OA 1Y69U 3PV0A 3M4QA 3K5MA 3TSSA 2D2CC 3NE5B 4LF7L 1J8IA 3S1QB 1EUJA 2PZUA 3HZXA 2D0PA 4LUVA 4NP5A 5C5MA 1CA6A 5I9OA 1I6HB 5LL6S 1RD9D 3URYA 2K7VA 3CPFA 5JPNC 5EQ0A 1FJGL 4O1NA 4BA1I 2AHOB 2EJGC 4L5SA 3KLSA 2JA8G 2F1MA 3S16H 4DAYA 1WTPA 2QEXA 1WTOA 5ELOA 3GO5A 5EAYA 4B9XA 2C5CA 3BYTB 4J8QA 4TVAB 5ELCA 3K7AH 2ID0A 1Q12A 1BOSA 4K5XA 4L6TB 3GTPH 1X65A 1VQKA 1MD2D 2CWPA 3D31A 2F3VA 4IUNA 2MPMA 4A3JG 3D3RA 3S2HB 1TT2A 4I7ZC 2WAQB 3ULJA 1B50A 3CCLA 4GN3B 1IYUA 3TP5A 2JEAI 5FJ8H 3JAME 3K58A 1PLFA 5CV9A 4CJ2C 4IFDI 4DNIA 1D1KA 4OIJA 1WTRA 2N49A 1G8ZD 1YHAA 3S16B 1RKNA 1A2UA 2EVBA 2D9UA 4A3EG 4CJ1B 5FLMH 4BBSH 2J4XA 3TS2A 2HCIA 1AFPA 4ZKBB 4GLVB 3TEHB 1B3AA 3HOWG 1A8VA 1EYDA 3K7AB 1RIPA 3GTPB 2NYZD 3HOZG 3BDLA 3GTGH 3CAMA 1SNOA 3HKZG 4AYBE 2L1BA 2Z6KA 4H0LC 2B2YC 3H3VH 1IHZA 3A5ZB 1EWIA 4JCVE 3UE0A 5CORA 1TS5A 4N8X1 5J3BA 1HRJA 3CRKC 4UY8C 3WOEA 1HNXQ 2LFNA 2NVTB 3PO3H 3PIPA 3BDCA 5CV5A 1VQ9A 1HNXL 2IX1A 2EY2A 3S1MH 5JVH3 2EYFA 2RDHA 4QUCA 5AFWA 3HOXB 4LAAA 2AMCB 4K0KL 2CQAA 3QB3A 1NMGA 1AW7A 4FF3A 2A6HD 2XIWA 1YITA 1TS2A 3FHWA 5M5XH 2K14A 1PH6A 3GTGB 1E2VA 3GTLH 4PZ6A 1JJCB 1STGA 3BVZA 5NUCA 3DM3A 5M3FB 2VY3A 1HPCA 4JBJA 3D4RA 1TWGH 4ZKCB 1O78A 3TDQA 5FLXc 3ITPA 1WD1A 3J81c 3CMEA 3PO3B 1BCPD 3IKJA 4A3GH 2O5JC 4RKBA 1EIHA 2TMPA 4HMJA 3H6MA 1EQQA 3CU7A 1VQAA 4KKUA 3X3NA 5KYLA 1MIUA 4X64Q 1LTGD 2F0WA 3A7AB 5I2XA 1B2TA 3EA6A 4X64L 3PGZA 4RGMA 3RR5A 3GTLB 3KF6B 1WCMG 1HFGA 2PYKA 1RCVD 3KBXA 2R7ZB 2N8NA 2X6GA 4KN4C 1JT8A 5CYUA 1X3EA 4DXFA 1F2YA 1TWGB 3CCMA 3HOVH 1OXUA 4KHZA 1A15A 2KQ3A 1SE4A 5EPLA 4DR5Q 4Y52H 2DY7A 4A3GB 2EY1A 1S3OA 4MN3A 1I6VC 2WKCA 3RUZA 3MXNA 1KLUD 2OTJA 4GLXA 3RLNA 4LF9L 4EQPA 1S4ZA 1CKNA 1UNSA 3NTIA 1A63A 2HCCA 3KUPA 1WD0A 2G9HD 3KF8A 1I3QH 4YCUA 2E2IB 4DR7Q 4L5RC 4ZUJA 2E76C 4ZCKA 4DR2Q 1I4RA 5E4XA 1XPUA 2ZXPA 2JN4A 4DR2L 3I4NG 1UEBA 5KNDA 3SK6A 4DV6L 3PQIA 4L5QA 5IYCG 3HOVB 1TWFH 1B9NA 2VL6A 5I6YA 5IGFA 4FF4A 5HY6A 4G7HC 3MXUA 1IW7C 1NCVA 4XIGS 4UPAA 1AH9A 4R4OA 1Z9FA 1PTOB 3RMHA 1BXTA 1QWYA 3TZUA 2D62A 1DOMA 1TVXA 5IWAL 1O7ZA 5DAUA 1BVSA 3M4OH 2B8GA 3AQQA 3I70A 4ZAIA 5CBAE 5KYIA 3DUZA 4QL5A 3DWAA 4LUZA 1BF4A 1BNZA 2F0OA 1HTPA 3A7LA 1S5FD 1Q1BA 1I3QB 5M3MG 4Y7NH 1SNCA 4A3FB 1CM9A 4DK6C 3MWYW 1QUQA 3VR4A 2XSCA 4QF4A 1FVIA 4GN5A 1RJTA 1UE5A 1YHBA 3G48A 1PH2A 1XMQQ 3Q24A 3MXPA 2VS1A 1SYCA 3FKIH 3W1GA 1TWFB 5ISRA 4PMWA 3KJPA 1I94Q 3E0JA 4A3KG 1L0WA 1D6EC 1I94L 4IQZA 2QILA 4QUFA 1JORA 1STAA 2BE5C 1J5EQ 4A3LH 2CFMA 2B3GA 4HIMA 2JA5G 4B9WA 1J5EL 4KKSA 3BU2A 4LF6Q 5IP7G 4HIDA 1IBKQ 2WINB 5KNBA 1HFNA 1EY0A 1IBKL 1SMXA 1NUCA 1PFMA 4IPCA 2MFIA 1VQDA 1STHA 5EGTA 1JJ2A 4EVOA 3FKIB 1ET9A 3GTQH 2KOLA 1FNWA 1VQ5A 4A93H 3KLWA 1VQHA 3HS0C 1Y14B 5E4WC 3U58A 1CUKA 3OWEB 1VQMA 3RZDH 2MGSA 2K32A 3D6WA 1B7YB 1YBYA 1I4GA 3S1NB 4K2LA 4U68A 3G7LA 4C3JH 2KCNA 3J80E 4HJ8A 4M8AA 5GADC 1DCZA 4HIOA 4IZ8A 1YIJA 2EYMA 4IUTA 5FKAC 4O42A 3HFZB 3FMCA 1KAWA 1VMPA 2ATWA 3PUWA 1Y1WB 2R6GA 2R7FA 2BOSA 1ZKOA 4C3IB 5IT9E 1ASZA 5E7NA 4OX9Q 3NSWA 3GTQB 1NY4A 2F0EA 2K05A 4EQ5A 4A93B 3MZ5A 4IN3A 2QGQA 3NBHB 2C9OA 2K6AA 5IIFA 3RZDB 1ILPA 1D1IA 1EQVA 1OXXK 3T51B 4ILWA 1GUGA 3KDFB 1J6QA 1II3A 4JC0A 1I4HA 2K5WA 1QVFA 3S17H 4KK7A 4JI5Q 4XDXA 3EVQA 3QIAA 1JE4A 3L0OA 1DD2A 2CVRA 1MKHA 1B9MA 5FJ8G 1VQPA 3NTKA 3U9OA 1VDZA 3KLSX 2Z4IA 3OPOA 3ZYYX 2BDOA 3H91A 2KCCA 3I4OA 2DNEA 4POFA 1Q8IA 4BBSG 5FLMG 1PH8A 2B29A 1E1TA 2WIIB 3JAML 3NTHA 3KF6A 1Q86C 1VQNA 1HR0W 1C48A 4KTAA 1LACA 1YJNA 5JEAJ 1HQMC 3F8TA 5CBEE 4FP5D 2Z0SA 1D2BA 2K50A 2NVYH 1HXYD 4IOCA 1SRUA 4OL7A 3VR5A 2NVXH 4DV1Q 1B4OA 1SNPA 1Q7YC 2LMCB 4DV1L 1LTRD 4YWKA 4JI0Q 3PO3G 5JEAH 4UP8A 5CV6A 2HHHL 1WTQA 4JI0L 4HSVA 5C3EB 4A3BH 4QIWB 2N55A 3LGJA 2H1EA 4OWXB 2A6HC 5C0XJ 4QIWE 1HNZQ 2B2TC 5L37A 1N33Q 4B08A 4G7ZC 1K3RA 1SNMA 1YNXA 3OMGA 2BCOA 3CCUA 1I4XA 4DAYB 1WFQA 5JOBA 2NVYB 1Q8KA 5EKIA 5C0XH 3IFDA 3WOFA 1C9OA 1BCPC 1IZ6A 1PYWD 4A3GG 2WB1B 4LJZC 2NVQH 3MEHA 1F9PA 2ZM6Q 4JI8L 1Y1VH 1V9PA 2EOTA 4B3RQ 1WVLA 1EZ8A 4OO1I 1HA6A 4A3BB 1S5ED 1IBMQ 1SYEA 1G51A 2NZOA 2VQEQ 2K03A 4B3TQ 1RTOA 3PIO3 2GVAA 2F0MA 4B3TL 4NKLA 3CW2C 2J0TD 1SLJA 2A19A 1FR3A 1VQCA 2I5LX 4LF8L 2K33A 4OHJA 1VCIA 1BO0A 3HKZE 3HOVG 1A3UA 2IHFA 2EZVA 4N8FA 1JQYD 3VR3A 2NVQB 1GD7A 3ND8A 4FF1A 4H13C 3VA7A 3T1HQ 1Y1VB 4LUOA 1EQTA 1M4VA 4XQNA 5IYDH 5KNCA 3T1HL 1PRTF 1A2TA 1PYSB 4XTCS 3H09A 1SR3A 4MNOA 2I5HA 4RWSC 3UE1A 3A8JE 1D8LA 2OTLA 4JVZA 3DWPA 3C1EA 4C3HH 1GHJA 1CFMA 1SN8A 1Y8OB 4BY7H 4BXXH 3A55A 3G71A 3QWNA 2A68D 3NP8A 4KJNA 3TZDA 1NMFA 5LMUL 2RKSA 1G2TA 3F2BA 3GTMB 3VYUA 3A0JA 5K5PA 4GKJQ 1BBUA 1FD7D 3SK8A 3CPWA 3K5OA 4GKJL 2EIFA 1S72A 4KHPQ 4JOIC 1N34L 4DV5L 5ELFA 1JJGA 4I65A 3I90A 4KHPL 1CKOA 4OWWB 1SJHD 3R2TA 1EY5A 5C4ZA 1UEAB 3MXGA 2WFWA 2QEJC 4DV7Q 4BY7B 3I55A 1M1KC 3FPPA 1TS4A 4PV1C 4DV7L 5F2DA 3K59A 2MO1A 2EXDA 3FKIG 4LF4Q 4DUYL 1B3QA 1EYCA 3S2DB 4OIKA 3KOJA 2KA7A 1HUMA 2Q8TA 1ENAA 3PUZA 2EYPA 4A3MH 4A3LG 3H3VI 3P1HA 1L1OC 2A6ED 5JAVA 5ELEA 1NJIC 1LV9A 2NN6I 3TBIB 2EPBA 2F0FA 3MEFA 1X3QA 1C0AA 3TP8A 4PG3A 3MXNB 4QCLA 1K8OA 3A74A 5FK9C 1XNRL 2Y0SE 1XYIA 2Q8RE 1BCPF 1IKLA 1QE6A 3NHHA 4CDEC 1HR0Q 2ES2A 4A93G 3M4YA 3KF8B 5D3IB 5A35A 1RDPD 1I6HH 2ICEC 4A3MB 4FXKC 3A56A 2HT1A 1KABA 3CCSA 3L7ZC 2R7DA 1A62A 2NBFA 4C3JG 2YTVA 4ZLTF 1SNDA 1W6JA 4MZ9A 3DHQA 2RHQB 3RZOB 3C2PA 1C7YA 1GO3E 1EEFD 5HGQA 2IX3A 3Q0AA 2I5MX 4LWCA 2K5VA 3PUXA 1WTVA 4RFBA 3J80L 5C5LA 2I0QA 1FNVA 3HOUH 4X3UA 1G291 1A6XA 1I4PA 3S2HH 2A69D 1I4QA 1X3FA 1U4MA 1QUQB 2YYZA 2B2TA 4LFCQ 4PZ8A 5IT9L 4X65Q 1Y8PB 4LFCL 1XWEA 3EBEA 2VUMH 1NBWA 4YIJA 1ZYRD 2QW7A 4X65L 1HA5A 2LS01 3WDNA 4I7AA 4CHTB 5CC4A 1EU4A 4AQYQ 5JJLA 3OIQA 5KGUA 1PRTD 4F88A 1YNND 4KI0A 5IGGA 3J81j 4A3CH 3I3CA 2K5QA 2R92H 3CD6A 2R3ZA 1WTHA 2Q2UA 3U50C 3RNUA 1CSQA 1WOCA 4KKTA 4NB3A 4F8MA 2KCMA 3HOUB 3SHLA 2FHTA 1TWAB 1EIFA 5D3DA 1YJWA 2PNRC 3A8KE 4L63B 5IGCA 1VMCA 2QDLA 5LMNW 4DNTB 2DUDA 4R4TA 4E6IA 4XT1B 1GUWA 4UHVA 2NVTH 4PMCA 2VUMB 1SFOB 4IUUA 1KL9A 2Q8IB 1MJEA 1KDBA 4XQJA 1E2ZA 3HOXH 4KN7C 1PFSA 1FYCA 1JCKB 2B39A 2C35B 4OXPA 4FVMA 2B2WC 4ZK9B 1SEBD 4AYBB 4TRDA 2R92B 1F2LA 4WFN3 2WB1G 5JEAG 4KMUC 2IT1A 2XN9C 4X3TA 3RLFA 1OXSC 5M3FH 4A3BG 3SE0A 5JJIA 2NUCA 1YHQA 4RA8A 4IOAA 5DM73 2JP1A 4RGNA 2UXBQ 1LTBD 4RHRA 2EDGA 4APVA 2PW7A 4K5VA 4EQOA 1KD1C 4OONA 1PZID 3NQTA 1VQ4A 3FRPB 1VQ6A 2XWBB 2L9HA 5C0XG 4BY1B 2FMCA 3G4SA 2UU9Q 1QJOA 2NTTA 3V05A 1P16A 4JOIA 2UU9L 1CZGA 1Y1VG 3CCVA 2R7ZH 2DNCA 2WKDA 1TWHH 3I91A 4V0BA 3RN2A 3O13A 1WTXA 4YHHQ 4X6AH 4JI6Q 2DY8A 2XNAC 2ALYB 2OF1A 4JI6L 1QVCA 2KBNA 1MHWC 4HEDA 2WP8J 1DM0B 3M7GA 2K01A 1SYDA 3NQIA 2E2IH 5BN3A 1X6OA 5AJ3Q 4ULLA 1N9WA 3I7FA 4QJFA 1T5XD 3BS1A 1CT1D 3AB9A 5AJ3L 5C3XA 1IYVA 2A8VA 2E2HH 2CW0D 3UDFA 5IYDG 4IO9A 1TWHB 4JI4Q 3HOYH 2I07B 3BVGA 4JI4L 1ASYA 1PTOH 2SNMA 4C3HG 3HG9A 2AKWB 4DR5L 2KEDA 4XYOA 4A76A 2HQLA 4BY7G 2PI2E 4BXXG 1KXLA 1SXTA 1X55A 3SXHA 2AUJD 3GP7A 4RGTA 4HJ7A 2A68C 2FXQA 2EYHA 1STYA 4ME5A 2L4NA 4JI1Q 4A3FH 1JWSD 4DGZA 3M85A 4DA2A 5ELNA 1LT4D 3TP7A 4JI1L 3CF5A 4BA2I 4DR7L 3ER0A 2E2HB 4NW2A 1QB5D 4HN7A 4BBRH 4DR1Q 3QOLA 3HOYB 1KLGD 2LXJA 2EYLA 1WTWA 3Q6SA 1V1PB 3AYHB 2F03A 1EY6A 1V8QA 3PUVA 4IFDJ 3KJOA 2L12A 2A5HA 3I8ZA 4RGOS 3LWUA 2Q2IA 2OXPA 4YCWA 4C2MH 1SJED 4IJLA 3L2PA 1FL0A 5M5WB 3MFYA 4XYQA 3J80c 4IFDH 1DGSA 5C4XH 1KRTA 1I50B 2RCFA 4A3MG 4JBMA 4BBRB 4HCEA 2A6EC 4LW1A 4K8JA 2KENA 2SOBA 1XMQL 5A2QE 1DONA 2X6LA 4YY3Q 4H44C 2F0UA 4TSSA 4J1MA 1O7YA 2K4KA 4DFAA 4YY3L 1G6PA 3OYYA 1F9QA 1EY4A 2KJXA 3HGBA 3S1NH 3AFQA 4HAEA 5LMNQ 3PO2B 3K8AA 1U0LA 4K6DA 4C2MB 1LTID 1JC7A 1L2FA 1UUPA 2UUAQ 3EIVA 4WORA 1LYLA 5LMNL 1JWMD 4LF6L 1K8AC 3I4LA 1U4PA 3GV3A 3CCEA 5C4XB 1Y1WH 4X3SA 2CCZA 4PNYA 4HTHA 2JK8A 3NENA 1KDAA 4KD3A 2TSSA 4C3IH 5M9OA 4DV2Q 4O0AA 3KFUA 3FEWX 3MTSA 4K8IA 3GQBA 2D5DA 4DV2L 2F0LA 4IUPA 1EQRA 3NEMA 1JR0D 2B2WA 4JI7Q 3ZJYC 1PFNA 3DEOA 1R9TB 2QKIC 1F77A 1SE8A 4JPBW 4X3KA 4RCOA 4ZQ3A 1VF5C 1B53A 1UE1A 2BA1A 5BN5A 1D5MC 1RTNA 2B2YA 2A1AA 2NB0A 3OTOQ 3HOUG 5JVG3 5BN4A 2JA6B 1STEA 3OW7A 2WAQG 3OTOL 4DK3C 5GQOA 1MJCA 1PH4A 2KHJA 3UI2A 4R4CA 5IY0A 2B63H 4U673 2WV6D 3Q23A 5COYA 2HD3A 2VUMG 1T9HA 1ZYRC 4OX9L 4V190 2DJFC 1BBWA 4DUZQ 2KEEA 2MUYA 3BJUA 1VF7A 4IPDA 2K5NA 2O2LD 4DUZL 4ZUIA 1PRTB 4ME3A 4JI2Q 1PRTC 4A3CG 1YNNC 2XTIA 4AYBG 1TXYA 5BR8Q 3VYSA 2R92G 4IUQA 4OGQC 4EGVA 5BR8L 2F0DA 2ZJQA 3DLLA 1ENCA 3GDEA 1BUVT 3KLRA 2E5LQ 4JI5L 1ICFB 3ERQA 1MI2A 1PH7A 1N32Q 2B63B 2H5XA 2F0NA 2R93H 1N32L 4C1NK 4HJAA 4LFAQ 1QILA 3H15A 3Q22A 3W2DA 4ODGA 4LFBQ 3HOXG 5D65A 4K6LA 5C3EH 1B44D 3SK5A 4LFBL 3MAQA 2JYOA 3LWEA 4AH6A 5EJWA 1SYGA 4C56C 2LKVA 3S14H 5I4DA 3PIOA 1EEID 3GD7A 2B8FA 4GS3A 1X3PA 2KCTA 3H94A 3K5LA 1IXRA 5M3FG 4KY7A 4DK1A 1TU2B 4HR7B 4JI3Q 1EL0A 2PI2A 2N3SA 2R93B 3K57A 2K52A 1UE6A 3MVVA 1QG7A 2RSNA 1PH1A 1HTLD 2ZTEA 4UP9A 2JA8B 4CDCC 4DAVA 3DM1A 1F9SA 1X54A 4PQXA 4GOPB 4CKBA 1K83H 2EJMA 4GOPC 1JB7A 3MC0B 3S14B 2XWJB 3MA2B 1HNZL 3E6ZX 2SNSA 1N33L 2UXDQ 5IYBH 4A3JB 1ESRA 2R7ZG 2HDMA 4BS9A 1PH5A 5J22A 2UXDL 1V1PA 4MIUA 1A3TA 1BCPB 3FVQA 3BZKA 2IHEA 2ZXRA 5I9PA 2HDLA 2EYJA 1CK1A 2PMZE 3CQZH 4X62Q 4KLKA 2ZM6L 1E0BA 1XPOA 1LTLA 2EXZA 2SDFA 3CKIB 4A3EB 2KVMA 3BVMA 1IKMA 2JXMB 3E3XA 4JV5Q 4B3RL 2XVSA 4XXEA 1K83B 1IBML 5I2YA 3HOWB 3OOCA 1LT5D 4YWMA 2VQEL 3GTKB 4JV5L 5CMDA 3E9HA 3HOZB 5DEHA 4B3SQ 3VA5A 3NPPA 3HKZB 5HGTA 1HJPA 2JA7H 3CRLC 4R1JA 2VQFQ 2EQSA 1LTAD 3OMCA 1VQBA 4P73A 3N6RA 3L3OC 2VQFL 2QA4A 3HOYG 2RBMA 1AEXA 1K73C 3EN2A 2MJ8A 3GTMH 1PDQA 2EYOA 3NBIA 4DV0Q 3TREA 5D14A 2XGTA 1JOOA 3CQZB 5M5YB 4DV0L 5EBDA 3E0EA 1LABA 2F52A 1WJJA 2UUBQ 5LHY1 1Q90A 1V1OA 4P75A 1DJRD 1K0RA 3ONAB 2RQXA 1SROA 2L15A 5E1FA 4A3FG 4DV3Q 3C3LA 2PQEA 2JJQA 3LX0A 1JOQA 3NELA 2JA9A 2JA7B 2GA4B 3VR6A 1Q81C 1SMYD 3K80C 4BBRG 1B70B 3HRZC 3S2DH 1Y8NB 3CC7A 5FO9B 1X56A 1LM0A 2CKZB 3CXCA 2VZAA 1O7LA 1N8RC 3UDGA 1CQVA 2OCEA 4WJWA 1F2MA 3FDTA 4IFDG 3D6CA 1ENFA 1G2SA 2K75A 4R8NA 4IUVA 3MFGA 5C4XG 1HQRD 3HKSA 1H9SA 4YCVA 2NTSA 2JEBI 4NDXA 2ZJPA 3J7ZC 3UDIA 3J7AV 2HUGA 4H7BA 1TIID 5JPMC 1EIYB 1H9KA 3T1YQ 2QCPX 3K0XA 2G9DA 3T1YL 4DF7A 4LF4L 1W2BA 2KHIA 4JK1C 4NXNQ 3BG3A 1QVGA 3QO2A 1L1OB 3BZDB 1PTOD 4YWLA 1DZ1A 1EY8A 2M2LA 4DR3Q 1GKHA 1GXDC 1PMRA 1PA6A 4DR3L 4H02A 3TMEA 1QNUA 5A2QL 2O5IC 1JMCA 2RCNA 2LY7A 3RZOH 5GAEC 1NE3A 1K8GA 3K81C 2NZ1D 3IRBA 2Y0SB 2O4XA 1Y1WG 1YVCA 2DJGC 1JICA 5IODA 3STBD 4C3IG 4FNFA 5ELDA 2ZTDA 5J39A 2XRQD 3BDOA 3FPUB 3A5UA 2PCFB 2CWAA 1HR0L
chains in the Genus database with same CATH topology
4X62L 1SMXA 1Y1VG 1KRSA 3PCOB 1IBKL 3CCVA 2R7ZH 4IPCA 2MFIA 3M3YH 1TWHH 4RG1A 2UUCQ 1VQDA 4O2DA 3RN2A 3W1BA 1JJ2A 4DR4Q 1VQLA 2LSSA 2UUCL 3GTQH 1EOVA 3JAMc 4YHHQ 1VQ5A 4X6AH 4JI6Q 3KLWA 4A93H 1VQHA 2AWOA 4DR4L 1Y14B 2DGYA 2ALYB 5H1SE 4JI8Q 3U58A 1CUKA 4JI6L 1VQMA 1QZHA 3VDYA 3RZDH 1QVCA 4B3SL 2KBNA 3S1RH 4P71A 2B63G 1B7YB 2WB1E 4DV4Q 1Q1EA 1PH3A 1YBYA 2WP8J 1XNQQ 4C3JH 2E2IH 1XNQL 1X6OA 5AJ3Q 4HJ8A 2HIXA 1N9WA 3I7FA 4QJFA 5GADC 4HIOA 1B8AA 1TWAH 1YIJA 1VQFA 4HIKA 4RMFA 5AJ3L 4LNQA 4IPHA 4LF8Q 4GOPA 3M9BA 2A8VA 3HFZB 2E2HH 1KAWA 4A3IH 1Z47A 3G6EA 2ATWA 3KYHC 3PUWA 5IYDG 3UDFA 4IO9A 5C44G 2R6GA 2R7FA 2UUBL 4JI4Q 3HOYH 1SFOH 1ASZA 5E7NA 4OX9Q 4LF7Q 1NY4A 3TS0A 2YTXA 4EQ5A 4JI4L 1ASYA 2VNUD 2QGQA 3NBHB 2AKWB 4DV3L 4DR5L 1WCMH 5IP9H 2E2JH 4A76A 2HQLA 4BY7G 2PI2E 4BXXG 1KXLA 1X55A 3Q8DA 4AQYL 1PH9A 1OXXK 4HJ7A 2UXCQ 2Z6KC 2FXQA 1FJGQ 3UDXA 3KDFB 1A0IA 2N78A 2R93G 1UWVA 2UXCL 4JI1Q 1J6QA 4A3FH 4JC0A 1QVFA 3S17H 3M85A 5IE8A 5ELNA 4L5TA 2HIVA 4JI1L 3CF5A 4JI5Q 4BA2I 4DR7L 5C3EG 4POGA 3RLOA 3ER0A 1Q82C 4WJ4A 1KHIA 3L0OA 5GAHC 1VQEA 4BBRH 2V1CC 1MKHA 4DR1Q 5LMUQ 3PO2G 5FJ8G 1VQPA 2MO0A 2GVBA 3S15H 2LXJA 3CC2A 3AYHB 1VQIA 3PUVA 4IFDJ 3KJOA 4JG2A 4A3DH 4IPGA 2K5HA 3I4OA 3AFPA 4POFA 3W5OA 4BBSG 5FLMG 2Q2HA 2Q2IA 1PH8A 3I4NH 2B29A 1QZGA 1N34Q 4DV5Q 1E1TA 1V43A 5GAGC 4YCWA 5IYCH 3CCQA 3JC66 4C2MH 2JQOA 1HH2P 3D0FA 4IJLA 3CCJA 2WAQE 5GROA 1Q86C 3KF6A 1FL0A 3L2PA 1HR0W 4BY1H 1VQNA 1PVOA 4QQBX 3OW2A 2Q2TA 2CQOA 3J80c 1YJNA 5JEAJ 1KIXA 4WJ3M 3F8TA 1DGSA 5C4XH 4NXNL 1KRTA 2Z0SA 4A3MG 2OQ0A 4JBMA 2K50A 1E22A 1V1QA 2PNHA 1SRUA 2NVYH 4UP7A 4IOCA 2NVXH 1E7ZA 2JE6I 4DV1Q 4LW1A 4DUYQ 2KENA 4P72A 3B6YA 2ZJRA 1XMQL 1Q7YC 1H95A 4PZ7A 4YY3Q 4DV1L 3K7UC 4YWKA 1CKMA 2OWOA 5M3MH 4JI0Q 3PO3G 2JA6G 3H0GG 4GNXB 4UP8A 4HJ5A 2K4KA 2HHHL 4YY3L 4GNXC 1VQJA 1EYGA 4JI0L 5IYBG 3OYYA 1PHJA 3I4MH 4GKKQ 2GN5A 1HNWQ 1D7QA 4GKKL 4A3BH 1UE7A 3KDFA 3S1NH 3AFQA 3LGJA 1KQSA 4ALPA 4J15A 5LMNQ 1IYJB 1HNWL 4AIMA 3K8AA 1U0LA 3SGIA 1L2FA 4OWXB 3I56A 5C0XJ 2UUAQ 4QIWE 1HNZQ 3EIVA 1LYLA 5LMNL 1XPRA 2YU9H 4A3KH 1N33Q 4LF6L 1K8AC 2F3IA 1K3RA 1P8LA 3J81i 1U5KA 3JAMi 3CCEA 1KC8C 1YNXA 1E24A 1Y1WH 3CCUA 4K0KQ 2CCZA 4DAYB 1WFQA 2JK8A 3NENA 2JA5H 2NZHA 4DKAC 4C3IH 1NTGA 4DV2Q 1XNRQ 2IY5B 4O0AA 2MQHA 3KFUA 1Q8KA 3J7A5 4DV2L 3PF4A 1C9OA 1CKNB 5IP7H 3PF5A 1XTDA 1IZ6A 1EQRA 3NEMA 4YHHL 4A75A 3S1QH 4A3GG 2NVQH 4JI7Q 3ZJYC 2ZM6Q 2JA7G 4JI8L 1Y1VH 1V9PA 3F1ZA 3TQYA 1EFWA 1SE8A 4B3RQ 4OO1I 3CP0A 1IBMQ 2NZOA 1G51A 1HZ9A 4MTNA 2VQEQ 1PYBA 5K36G 4B3TQ 4DV4L 1UE1A 1K9MC 3TRZA 2BA1A 1JE5A 1N36Q 2GVAA 2A1AA 4B3TL 2YTYA 3CW2C 3OTOQ 3HOUG 1L1OA 1N36L 1RL2A 1SLJA 2WAQG 2A19A 3OTOL 4DK3C 1YEZA 5GQOA 1MJCA 1VQCA 2I5LX 4LF8L 1PH4A 2KHJA 2B63H 1AE3A 3PV0A 4R4CA 5IY0A 3M4QA 2RHSB 1VCIA 3HKZE 3HOVG 1O7IA 2VUMG 2AWNA 2IHFA 1BKBA 1T9HA 1YI2A 4LF7L 4OX9L 3CMAA 1W3SA 1XJVA 1BBWA 1Q46A 1EUJA 1YZ6A 3BJUA 4DUZQ 1GD7A 4IPDA 2K5NA 3T1HQ 1CSPA 4DUZL 4LUOA 4LUVA 2D0PA 5IYDH 2BH8A 4ME3A 4JI2Q 5C44H 3T1HL 1GVPA 1PYSB 4A3CG 2XTIA 4XTCS 1X3GA 4AYBG 1TXYA 3U4VA 5BR8Q 3CPFA 5M5WH 2R92G 4JOIA 4R4QA 1SR3A 1FJGL 4MNOA 2I5HA 4BA1I 1VS0A 2AHOB 1D8LA 3UE1A 4LF5Q 5BR8L 2IX0A 2ZJQA 4L5SA 2OTLA 4C3HH 3DLLA 2JA8G 4LF5L 3S16H 3GDEA 1I50H 1SN8A 4LF9Q 2QEXA 2E5LQ 5ELOA 3GO5A 5EAYA 4JI5L 4BY7H 4BXXH 3G71A 1PH7A 4DR6Q 2PQAB 1N32Q 2H5XA 4DR6L 3M7NA 4TVAB 2R93H 1N32L 3K7AH 5LMUL 1NMFA 2ID0A 1Q12A 4HJAA 4DR1L 4LFAQ 3H15A 3GTPH 1M90C 3F2BA 1X65A 1VQKA 2CWPA 1I5FA 3D31A 3A0JA 4A3JG 4GKJQ 1BBUA 3HOXG 4LFBQ 5C3EH 5JJKA 2Y0SG 3J80i 3CPWA 3ULJA 3CCLA 4GKJL 4LFBL 4DV6Q 2EIFA 4GN3B 1S72A 4KHPQ 3PO2H 4AH6A 4JOIC 1N34L 5FJ8H 4A4IA 4DV5L 1YJ9A 3CC4A 2JEAI 4QGUA 1JJGA 4KHPL 1AE2A 1CKOA 3S14H 4OWWB 4IFDI 4DNIA 3PIOA 1XMOQ 3GTOH 3AEVA 2N49A 1YHAA 3GD7A 4GS3A 2KCTA 5IWAQ 1XMOL 4DV7Q 2WFWA 1IXRA 4A3EG 4R4IA 4TQUS 5FLMH 3I55A 5M3FG 1M1KC 4BBSH 3TS2A 4JI3Q 4DV7L 4GLVB 3TEHB 3HOWG 1E1OA 1OTCA 2PI2A 1A8VA 2N3SA 2MO1A 2EXDA 3FKIG 4LF4Q 2K52A 1RIPA 5IT9c 1UE6A 4DUYL 3HOZG 3GTGH 1PH1A 1GM5A 2ZTEA 3CAMA 4AYBE 3HKZG 3KOJA 4UP9A 2Z6KA 1R9TH 4HJ9A 1FGUA 3S24A 4IJHA 3PUZA 4A3MH 1HZBA 1X54A 1IL2A 3H3VI 3H3VH 4A3LG 3A5ZB 1EWIA 4JCVE 3UE0A 3STBC 3WWVA 1HZAA 1L1OC 4GOPB 2UXBL 5J3BA 1K83H 3CCRA 4GOPC 1NJIC 4UY8C 1JB7A 1G6PA 2NN6I 1PV4A 1HNXQ 4DPGA 3PO3H 3PIPA 2UUAL 2YV5A 3MEFA 4P74A 1HNZL 1VQ9A 1X9NA 3H0GH 1HNXL 2JA6H 2IX1A 3S1MH 1OXVA 1C0AA 2MNAA 1N33L 2UXDQ 5IYBH 4PG3A 3E9IA 2R7ZG 3MXNB 1PH5A 2AMCB 4K0KL 2UXDL 1WI5A 3ERSX 4DAMA 1NMGA 3M4PA 3A74A 5C0XI 1XNRL 2Y0SE 3BZKA 1VQ7A 2ES2A 2IHEA 3U4ZA 1YITA 4GN4B 3FHWA 1HR0Q 5M5XH 4A93G 2K14A 4JYAQ 1PH6A 3KF8B 3GTLH 2PMZE 4PZ6A 4X62Q 3CQZH 3PSIA 1JJCB 4KLKA 1VQOA 4JYAL 4JI7L 2ZM6L 1XPOA 1LTLA 4NXMQ 1I6HH 3DM3A 2HT1A 2VY3A 3CCSA 4OO1G 3L7ZC 4JV5Q 4B3RL 4NXML 2R7DA 1A62A 1TWGH 4JBJA 4X66Q 1IBML 4YWMA 2VQEL 5FLXc 2YTVA 4JV5L 3RN5A 4X66L 3J81c 3CMEA 4MZ9A 3E9HA 3PUYA 4A3GH 1VQ8A 2F4VQ 2VW9A 4B3SQ 2RHQB 1IBLQ 2JA7H 1HJPA 1C7YA 1GO3E 4A3IG 2F4VL 4R1JA 2BA0A 2VQFQ 5HGQA 3ULPA 1EQQA 1IBLL 1VQAA 2EQSA 2I5MX 4LWCA 1MIUA 1VQBA 4P73A 4X64Q 2K5VA 2QA4A 4JBWA 3PUXA 2VQFL 3HOYG 4GNXA 1K73C 3EN2A 4X64L 2I0QA 3GTMH 4DV0Q 3TREA 3PGZA 3HOUH 1G291 3S2HH 3RR5A 1OXTA 2XGTA 3KF6B 1X3FA 1WCMG 5IP9G 4DV0L 3E0EA 4OWTB 2F52A 1WJJA 2ZTCA 1QUQB 2UUBQ 2YYZA 4LFCQ 2N8NA 1JT8A 1X3EA 4PZ8A 4JI2L 1VQGA 4P75A 4X65Q 3CCMA 3HOVH 4LFCL 1K0RA 1OXUA 3EBEA 4KHZA 2VUMH 1NBWA 2BH2A 1SROA 2L15A 3F2CA 4A3FG 4X65L 4DV3Q 4DR5Q 4Y52H 2JJQA 1S3OA 3NELA 1LUZA 3FP9A 1S40A 2RF4A 2JA9A 4AQYQ 5JJLA 2OTJA 4JBKA 4GLXA 1Q81C 3RLNA 4LF9L 2E5LL 3K80C 4BBRG 1B70B 4QY7A 1CKNA 3J81j 4KI0A 4A3CH 1A63A 2R92H 3CD6A 2Q2UA 3U50C 3RNUA 3S2DH 1HZCA 1CSQA 1I3QH 4YCUA 4LFAL 1WOCA 1WYDA 4NB3A 2KCMA 2JA8H 4L5RC 2OQKA 3CC7A 4DR7Q 4DR2Q 4A3DG 1X56A 1EIFA 1XPUA 1LM0A 2CKZB 1YJWA 3CXCA 4DR2L 3I4NG 1TWCH 1UEBA 2VZAA 5LMNW 4DV6L 1N8RC 2DUDA 4L5QA 4R4TA 5IYCG 3ICEA 3I2ZA 4BY1G 3UDGA 1TWFH 2NVTH 2VL6A 2OCEA 1KL9A 5HY6A 1MJEA 4IFDG 4XIGS 4UPAA 1AH9A 2K75A 4R4OA 1Z9FA 4A3JH 3HOXH 5C4XG 1E3PA 3HKSA 4YCVA 2D62A 3BZCA 1PFSA 2JEBI 5IWAL 2ZJPA 3J7ZC 3UDIA 1BVSA 2C35B 4OXPA 2D0OA 3M4OH 3AQQA 1EIYB 4JI3L 3T1YQ 4QL5A 4LUZA 3K0XA 3T1YL 1Q1BA 4LF4L 4GLAC 1W2BA 2KHIA 5M3MG 4Y7NH 4NXNQ 2WB1G 5JEAG 1QVGA 4DK6C 2IT1A 3RLFA 1QUQA 4NPSA 4A3EH 3I4MG 1L1OB 1OXSC 5M3FH 4YWLA 2E8GA 4B3MQ 4DR3Q 4A3BG 5C4JH 1FVIA 1GKHA 1UE5A 1YHBA 3G48A 4GN5A 1PH2A 5JJIA 1PA6A 1XMQQ 3HOWH 4FDBA 3GTKH 2VS1A 4DR3L 1YHQA 4B3ML 3FKIH 4H02A 4IOAA 3W1GA 2NN6G 3ULLA 2UXBQ 2ASBA 3HOZH 4PMWA 3KJPA 1I94Q 2RCNA 4A3KG 1JMCA 2HHHQ 3GTJH 1L0WA 3RZOH 5GAEC 1NE3A 2PQAA 4APVA 3K81C 1K8GA 1I94L 3IRBA 2UU9L 1KD1C 4OONA 5DLQE 1Y1WG 1J5EQ 4A3LH 2CFMA 1YVCA 2B3GA 1VQ4A 2LXKA 4HIMA 2JA5G 3STBD 1J5EL 2ZTDA 1VQ6A 3A5UA 5C0XG 3F2DA 3BU2A 3G4SA 5IP7G 4EX5A 2UU9Q 4LF6Q 4HIDA 1IBKQ 2CWAA 5M5YH 1HR0L 1P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 L;  1SMX A;  1Y1V G;  1KRS A;  3PCO B;  1IBK L;  3CCV A;  2R7Z H;  4IPC A;  2MFI A;  3M3Y H;  1TWH H;  4RG1 A;  2UUC Q;  1VQD A;  4O2D A;  3RN2 A;  3W1B A;  1JJ2 A;  4DR4 Q;  1VQL A;  2LSS A;  2UUC L;  3GTQ H;  1EOV A;  3JAM c;  4YHH Q;  1VQ5 A;  4X6A H;  4JI6 Q;  3KLW A;  4A93 H;  1VQH A;  2AWO A;  4DR4 L;  1Y14 B;  2DGY A;  2ALY B;  5H1S E;  4JI8 Q;  3U58 A;  1CUK A;  4JI6 L;  1VQM A;  1QZH A;  3VDY A;  3RZD H;  1QVC A;  4B3S L;  2KBN A;  3S1R H;  4P71 A;  2B63 G;  1B7Y B;  2WB1 E;  4DV4 Q;  1Q1E A;  1PH3 A;  1YBY A;  2WP8 J;  1XNQ Q;  4C3J H;  2E2I H;  1XNQ L;  1X6O A;  5AJ3 Q;  4HJ8 A;  2HIX A;  1N9W A;  3I7F A;  4QJF A;  5GAD C;  4HIO A;  1B8A A;  1TWA H;  1YIJ A;  1VQF A;  4HIK A;  4RMF A;  5AJ3 L;  4LNQ A;  4IPH A;  4LF8 Q;  4GOP A;  3M9B A;  2A8V A;  3HFZ B;  2E2H H;  1KAW A;  4A3I H;  1Z47 A;  3G6E A;  2ATW A;  3KYH C;  3PUW A;  5IYD G;  3UDF A;  4IO9 A;  5C44 G;  2R6G A;  2R7F A;  2UUB L;  4JI4 Q;  3HOY H;  1SFO H;  1ASZ A;  5E7N A;  4OX9 Q;  4LF7 Q;  1NY4 A;  3TS0 A;  2YTX A;  4EQ5 A;  4JI4 L;  1ASY A;  2VNU D;  2QGQ A;  3NBH B;  2AKW B;  4DV3 L;  4DR5 L;  1WCM H;  5IP9 H;  2E2J H;  4A76 A;  2HQL A;  4BY7 G;  2PI2 E;  4BXX G;  1KXL A;  1X55 A;  3Q8D A;  4AQY L;  1PH9 A;  1OXX K;  4HJ7 A;  2UXC Q;  2Z6K C;  2FXQ A;  1FJG Q;  3UDX A;  3KDF B;  1A0I A;  2N78 A;  2R93 G;  1UWV A;  2UXC L;  4JI1 Q;  1J6Q A;  4A3F H;  4JC0 A;  1QVF A;  3S17 H;  3M85 A;  5IE8 A;  5ELN A;  4L5T A;  2HIV A;  4JI1 L;  3CF5 A;  4JI5 Q;  4BA2 I;  4DR7 L;  5C3E G;  4POG A;  3RLO A;  3ER0 A;  1Q82 C;  4WJ4 A;  1KHI A;  3L0O A;  5GAH C;  1VQE A;  4BBR H;  2V1C C;  1MKH A;  4DR1 Q;  5LMU Q;  3PO2 G;  5FJ8 G;  1VQP A;  2MO0 A;  2GVB A;  3S15 H;  2LXJ A;  3CC2 A;  3AYH B;  1VQI A;  3PUV A;  4IFD J;  3KJO A;  4JG2 A;  4A3D H;  4IPG A;  2K5H A;  3I4O A;  3AFP A;  4POF A;  3W5O A;  4BBS G;  5FLM G;  2Q2H A;  2Q2I A;  1PH8 A;  3I4N H;  2B29 A;  1QZG A;  1N34 Q;  4DV5 Q;  1E1T A;  1V43 A;  5GAG C;  4YCW A;  5IYC H;  3CCQ A;  3JC6 6;  4C2M H;  2JQO A;  1HH2 P;  3D0F A;  4IJL A;  3CCJ A;  2WAQ E;  5GRO A;  1Q86 C;  3KF6 A;  1FL0 A;  3L2P A;  1HR0 W;  4BY1 H;  1VQN A;  1PVO A;  4QQB X;  3OW2 A;  2Q2T A;  2CQO A;  3J80 c;  1YJN A;  5JEA J;  1KIX A;  4WJ3 M;  3F8T A;  1DGS A;  5C4X H;  4NXN L;  1KRT A;  2Z0S A;  4A3M G;  2OQ0 A;  4JBM A;  2K50 A;  1E22 A;  1V1Q A;  2PNH A;  1SRU A;  2NVY H;  4UP7 A;  4IOC A;  2NVX H;  1E7Z A;  2JE6 I;  4DV1 Q;  4LW1 A;  4DUY Q;  2KEN A;  4P72 A;  3B6Y A;  2ZJR A;  1XMQ L;  1Q7Y C;  1H95 A;  4PZ7 A;  4YY3 Q;  4DV1 L;  3K7U C;  4YWK A;  1CKM A;  2OWO A;  5M3M H;  4JI0 Q;  3PO3 G;  2JA6 G;  3H0G G;  4GNX B;  4UP8 A;  4HJ5 A;  2K4K A;  2HHH L;  4YY3 L;  4GNX C;  1VQJ A;  1EYG A;  4JI0 L;  5IYB G;  3OYY A;  1PHJ A;  3I4M H;  4GKK Q;  2GN5 A;  1HNW Q;  1D7Q A;  4GKK L;  4A3B H;  1UE7 A;  3KDF A;  3S1N H;  3AFQ A;  3LGJ A;  1KQS A;  4ALP A;  4J15 A;  5LMN Q;  1IYJ B;  1HNW L;  4AIM A;  3K8A A;  1U0L A;  3SGI A;  1L2F A;  4OWX B;  3I56 A;  5C0X J;  2UUA Q;  4QIW E;  1HNZ Q;  3EIV A;  1LYL A;  5LMN L;  1XPR A;  2YU9 H;  4A3K H;  1N33 Q;  4LF6 L;  1K8A C;  2F3I A;  1K3R A;  1P8L A;  3J81 i;  1U5K A;  3JAM i;  3CCE A;  1KC8 C;  1YNX A;  1E24 A;  1Y1W H;  3CCU A;  4K0K Q;  2CCZ A;  4DAY B;  1WFQ A;  2JK8 A;  3NEN A;  2JA5 H;  2NZH A;  4DKA C;  4C3I H;  1NTG A;  4DV2 Q;  1XNR Q;  2IY5 B;  4O0A A;  2MQH A;  3KFU A;  1Q8K A;  3J7A 5;  4DV2 L;  3PF4 A;  1C9O A;  1CKN B;  5IP7 H;  3PF5 A;  1XTD A;  1IZ6 A;  1EQR A;  3NEM A;  4YHH L;  4A75 A;  3S1Q H;  4A3G G;  2NVQ H;  4JI7 Q;  3ZJY C;  2ZM6 Q;  2JA7 G;  4JI8 L;  1Y1V H;  1V9P A;  3F1Z A;  3TQY A;  1EFW A;  1SE8 A;  4B3R Q;  4OO1 I;  3CP0 A;  1IBM Q;  2NZO A;  1G51 A;  1HZ9 A;  4MTN A;  2VQE Q;  1PYB A;  5K36 G;  4B3T Q;  4DV4 L;  1UE1 A;  1K9M C;  3TRZ A;  2BA1 A;  1JE5 A;  1N36 Q;  2GVA A;  2A1A A;  4B3T L;  2YTY A;  3CW2 C;  3OTO Q;  3HOU G;  1L1O A;  1N36 L;  1RL2 A;  1SLJ A;  2WAQ G;  2A19 A;  3OTO L;  4DK3 C;  1YEZ A;  5GQO A;  1MJC A;  1VQC A;  2I5L X;  4LF8 L;  1PH4 A;  2KHJ A;  2B63 H;  1AE3 A;  3PV0 A;  4R4C A;  5IY0 A;  3M4Q A;  2RHS B;  1VCI A;  3HKZ E;  3HOV G;  1O7I A;  2VUM G;  2AWN A;  2IHF A;  1BKB A;  1T9H A;  1YI2 A;  4LF7 L;  4OX9 L;  3CMA A;  1W3S A;  1XJV A;  1BBW A;  1Q46 A;  1EUJ A;  1YZ6 A;  3BJU A;  4DUZ Q;  1GD7 A;  4IPD A;  2K5N A;  3T1H Q;  1CSP A;  4DUZ L;  4LUO A;  4LUV A;  2D0P A;  5IYD H;  2BH8 A;  4ME3 A;  4JI2 Q;  5C44 H;  3T1H L;  1GVP A;  1PYS B;  4A3C G;  2XTI A;  4XTC S;  1X3G A;  4AYB G;  1TXY A;  3U4V A;  5BR8 Q;  3CPF A;  5M5W H;  2R92 G;  4JOI A;  4R4Q A;  1SR3 A;  1FJG L;  4MNO A;  2I5H A;  4BA1 I;  1VS0 A;  2AHO B;  1D8L A;  3UE1 A;  4LF5 Q;  5BR8 L;  2IX0 A;  2ZJQ A;  4L5S A;  2OTL A;  4C3H H;  3DLL A;  2JA8 G;  4LF5 L;  3S16 H;  3GDE A;  1I50 H;  1SN8 A;  4LF9 Q;  2QEX A;  2E5L Q;  5ELO A;  3GO5 A;  5EAY A;  4JI5 L;  4BY7 H;  4BXX H;  3G71 A;  1PH7 A;  4DR6 Q;  2PQA B;  1N32 Q;  2H5X A;  4DR6 L;  3M7N A;  4TVA B;  2R93 H;  1N32 L;  3K7A H;  5LMU L;  1NMF A;  2ID0 A;  1Q12 A;  4HJA A;  4DR1 L;  4LFA Q;  3H15 A;  3GTP H;  1M90 C;  3F2B A;  1X65 A;  1VQK A;  2CWP A;  1I5F A;  3D31 A;  3A0J A;  4A3J G;  4GKJ Q;  1BBU A;  3HOX G;  4LFB Q;  5C3E H;  5JJK A;  2Y0S G;  3J80 i;  3CPW A;  3ULJ A;  3CCL A;  4GKJ L;  4LFB L;  4DV6 Q;  2EIF A;  4GN3 B;  1S72 A;  4KHP Q;  3PO2 H;  4AH6 A;  4JOI C;  1N34 L;  5FJ8 H;  4A4I A;  4DV5 L;  1YJ9 A;  3CC4 A;  2JEA I;  4QGU A;  1JJG A;  4KHP L;  1AE2 A;  1CKO A;  3S14 H;  4OWW B;  4IFD I;  4DNI A;  3PIO A;  1XMO Q;  3GTO H;  3AEV A;  2N49 A;  1YHA A;  3GD7 A;  4GS3 A;  2KCT A;  5IWA Q;  1XMO L;  4DV7 Q;  2WFW A;  1IXR A;  4A3E G;  4R4I A;  4TQU S;  5FLM H;  3I55 A;  5M3F G;  1M1K C;  4BBS H;  3TS2 A;  4JI3 Q;  4DV7 L;  4GLV B;  3TEH B;  3HOW G;  1E1O A;  1OTC A;  2PI2 A;  1A8V A;  2N3S A;  2MO1 A;  2EXD A;  3FKI G;  4LF4 Q;  2K52 A;  1RIP A;  5IT9 c;  1UE6 A;  4DUY L;  3HOZ G;  3GTG H;  1PH1 A;  1GM5 A;  2ZTE A;  3CAM A;  4AYB E;  3HKZ G;  3KOJ A;  4UP9 A;  2Z6K A;  1R9T H;  4HJ9 A;  1FGU A;  3S24 A;  4IJH A;  3PUZ A;  4A3M H;  1HZB A;  1X54 A;  1IL2 A;  3H3V I;  3H3V H;  4A3L G;  3A5Z B;  1EWI A;  4JCV E;  3UE0 A;  3STB C;  3WWV A;  1HZA A;  1L1O C;  4GOP B;  2UXB L;  5J3B A;  1K83 H;  3CCR A;  4GOP C;  1NJI C;  4UY8 C;  1JB7 A;  1G6P A;  2NN6 I;  1PV4 A;  1HNX Q;  4DPG A;  3PO3 H;  3PIP A;  2UUA L;  2YV5 A;  3MEF A;  4P74 A;  1HNZ L;  1VQ9 A;  1X9N A;  3H0G H;  1HNX L;  2JA6 H;  2IX1 A;  3S1M H;  1OXV A;  1C0A A;  2MNA A;  1N33 L;  2UXD Q;  5IYB H;  4PG3 A;  3E9I A;  2R7Z G;  3MXN B;  1PH5 A;  2AMC B;  4K0K L;  2UXD L;  1WI5 A;  3ERS X;  4DAM A;  1NMG A;  3M4P A;  3A74 A;  5C0X I;  1XNR L;  2Y0S E;  3BZK A;  1VQ7 A;  2ES2 A;  2IHE A;  3U4Z A;  1YIT A;  4GN4 B;  3FHW A;  1HR0 Q;  5M5X H;  4A93 G;  2K14 A;  4JYA Q;  1PH6 A;  3KF8 B;  3GTL H;  2PMZ E;  4PZ6 A;  4X62 Q;  3CQZ H;  3PSI A;  1JJC B;  4KLK A;  1VQO A;  4JYA L;  4JI7 L;  2ZM6 L;  1XPO A;  1LTL A;  4NXM Q;  1I6H H;  3DM3 A;  2HT1 A;  2VY3 A;  3CCS A;  4OO1 G;  3L7Z C;  4JV5 Q;  4B3R L;  4NXM L;  2R7D A;  1A62 A;  1TWG H;  4JBJ A;  4X66 Q;  1IBM L;  4YWM A;  2VQE L;  5FLX c;  2YTV A;  4JV5 L;  3RN5 A;  4X66 L;  3J81 c;  3CME A;  4MZ9 A;  3E9H A;  3PUY A;  4A3G H;  1VQ8 A;  2F4V Q;  2VW9 A;  4B3S Q;  2RHQ B;  1IBL Q;  2JA7 H;  1HJP A;  1C7Y A;  1GO3 E;  4A3I G;  2F4V L;  4R1J A;  2BA0 A;  2VQF Q;  5HGQ A;  3ULP A;  1EQQ A;  1IBL L;  1VQA A;  2EQS A;  2I5M X;  4LWC A;  1MIU A;  1VQB A;  4P73 A;  4X64 Q;  2K5V A;  2QA4 A;  4JBW A;  3PUX A;  2VQF L;  3HOY G;  4GNX A;  1K73 C;  3EN2 A;  4X64 L;  2I0Q A;  3GTM H;  4DV0 Q;  3TRE A;  3PGZ A;  3HOU H;  1G29 1;  3S2H H;  3RR5 A;  1OXT A;  2XGT A;  3KF6 B;  1X3F A;  1WCM G;  5IP9 G;  4DV0 L;  3E0E A;  4OWT B;  2F52 A;  1WJJ A;  2ZTC A;  1QUQ B;  2UUB Q;  2YYZ A;  4LFC Q;  2N8N A;  1JT8 A;  1X3E A;  4PZ8 A;  4JI2 L;  1VQG A;  4P75 A;  4X65 Q;  3CCM A;  3HOV H;  4LFC L;  1K0R A;  1OXU A;  3EBE A;  4KHZ A;  2VUM H;  1NBW A;  2BH2 A;  1SRO A;  2L15 A;  3F2C A;  4A3F G;  4X65 L;  4DV3 Q;  4DR5 Q;  4Y52 H;  2JJQ A;  1S3O A;  3NEL A;  1LUZ A;  3FP9 A;  1S40 A;  2RF4 A;  2JA9 A;  4AQY Q;  5JJL A;  2OTJ A;  4JBK A;  4GLX A;  1Q81 C;  3RLN A;  4LF9 L;  2E5L L;  3K80 C;  4BBR G;  1B70 B;  4QY7 A;  1CKN A;  3J81 j;  4KI0 A;  4A3C H;  1A63 A;  2R92 H;  3CD6 A;  2Q2U A;  3U50 C;  3RNU A;  3S2D H;  1HZC A;  1CSQ A;  1I3Q H;  4YCU A;  4LFA L;  1WOC A;  1WYD A;  4NB3 A;  2KCM A;  2JA8 H;  4L5R C;  2OQK A;  3CC7 A;  4DR7 Q;  4DR2 Q;  4A3D G;  1X56 A;  1EIF A;  1XPU A;  1LM0 A;  2CKZ B;  1YJW A;  3CXC A;  4DR2 L;  3I4N G;  1TWC H;  1UEB A;  2VZA A;  5LMN W;  4DV6 L;  1N8R C;  2DUD A;  4L5Q A;  4R4T A;  5IYC G;  3ICE A;  3I2Z A;  4BY1 G;  3UDG A;  1TWF H;  2NVT H;  2VL6 A;  2OCE A;  1KL9 A;  5HY6 A;  1MJE A;  4IFD G;  4XIG S;  4UPA A;  1AH9 A;  2K75 A;  4R4O A;  1Z9F A;  4A3J H;  3HOX H;  5C4X G;  1E3P A;  3HKS A;  4YCV A;  2D62 A;  3BZC A;  1PFS A;  2JEB I;  5IWA L;  2ZJP A;  3J7Z C;  3UDI A;  1BVS A;  2C35 B;  4OXP A;  2D0O A;  3M4O H;  3AQQ A;  1EIY B;  4JI3 L;  3T1Y Q;  4QL5 A;  4LUZ A;  3K0X A;  3T1Y L;  1Q1B A;  4LF4 L;  4GLA C;  1W2B A;  2KHI A;  5M3M G;  4Y7N H;  4NXN Q;  2WB1 G;  5JEA G;  1QVG A;  4DK6 C;  2IT1 A;  3RLF A;  1QUQ A;  4NPS A;  4A3E H;  3I4M G;  1L1O B;  1OXS C;  5M3F H;  4YWL A;  2E8G A;  4B3M Q;  4DR3 Q;  4A3B G;  5C4J H;  1FVI A;  1GKH A;  1UE5 A;  1YHB A;  3G48 A;  4GN5 A;  1PH2 A;  5JJI A;  1PA6 A;  1XMQ Q;  3HOW H;  4FDB A;  3GTK H;  2VS1 A;  4DR3 L;  1YHQ A;  4B3M L;  3FKI H;  4H02 A;  4IOA A;  3W1G A;  2NN6 G;  3ULL A;  2UXB Q;  2ASB A;  3HOZ H;  4PMW A;  3KJP A;  1I94 Q;  2RCN A;  4A3K G;  1JMC A;  2HHH Q;  3GTJ H;  1L0W A;  3RZO H;  5GAE C;  1NE3 A;  2PQA A;  4APV A;  3K81 C;  1K8G A;  1I94 L;  3IRB A;  2UU9 L;  1KD1 C;  4OON A;  5DLQ E;  1Y1W G;  1J5E Q;  4A3L H;  2CFM A;  1YVC A;  2B3G A;  1VQ4 A;  2LXK A;  4HIM A;  2JA5 G;  3STB D;  1J5E L;  2ZTD A;  1VQ6 A;  3A5U A;  5C0X G;  3F2D A;  3BU2 A;  3G4S A;  5IP7 G;  4EX5 A;  2UU9 Q;  4LF6 Q;  4HID A;  1IBK Q;  2CWA A;  5M5Y H;  1HR0 L;  1P16 A; 
#chains in the Genus database with same CATH topology
 1KRS A;  3PCO B;  4FXD A;  1ROD A;  3M3Y H;  2UUC Q;  1S5B D;  5G3L F;  1YNJ D;  3W1B A;  2F0T A;  1CA5 A;  1VQL A;  2UUC L;  1EOV A;  3JAM c;  1SE2 A;  3VR2 A;  2AWO A;  2DGY A;  5H1S E;  4K5W A;  4UDU C;  1QZH A;  4N9T A;  3S1R H;  4P71 A;  2B63 G;  2K5D A;  5TSS A;  4OO1 H;  4DV4 Q;  2F0G A;  1XNQ Q;  2EY5 A;  2I46 A;  1ML0 D;  1CHQ D;  1XNQ L;  1RHP A;  1MBY A;  2AQ2 B;  2HIX A;  2YU9 B;  1B8A A;  1TWA H;  4A3K B;  2JSO A;  4RMF A;  4GOP A;  3M9B A;  4CDF C;  4A3I H;  1Z47 A;  3G6E A;  3KYH C;  5CGK A;  3M3Y B;  2F4I A;  1DOK A;  3F2U A;  1U9R A;  2JA5 B;  1SFO H;  3K5N A;  2PZW A;  4LF7 Q;  3TS0 A;  1SSO A;  5IOC A;  1EOT A;  1SNQ A;  3EQL C;  1K8M A;  5EKL A;  1J9O A;  1HUN A;  5IP9 H;  2E2J H;  1G6Z A;  3S1R B;  4AQY L;  1S5D D;  2AQ1 B;  3DWQ A;  1FJG Q;  3UDX A;  2R93 G;  1A0I A;  4K14 A;  2F0K A;  5IE8 A;  2MP1 A;  4L5T A;  1JWU D;  2L11 A;  4QB4 A;  2ENB A;  2N88 A;  5DM6 3;  5C3E G;  4POG A;  3NXW A;  1GUO A;  1T5E A;  2F0I A;  4R8I A;  4A3I B;  1R4Q B;  1R4P B;  2QDB A;  2MO0 A;  3V2T A;  3HEJ A;  3T13 A;  1EU3 A;  2SEB D;  4RKL A;  4A3D H;  4IPG A;  1STN A;  2K5H A;  1ICW A;  3AFP A;  2E2J B;  1GJX A;  2Q2H A;  2IL8 A;  1V43 A;  5GAG C;  3JC6 6;  1HH2 P;  3CCJ A;  4BY1 H;  2WAQ E;  5GRO A;  1K3B C;  1MSG A;  1PVO A;  4J6H A;  3OW2 A;  4PMB A;  2FFK B;  3I73 A;  3ERO A;  4RH6 A;  1CZW A;  2Q2T A;  1ILQ A;  3OWF A;  3V96 A;  2OQ0 A;  2PNH A;  3D4W A;  3T53 B;  1TQO A;  2JE6 I;  3B6Y A;  2ZJR A;  3K7U C;  2UXB L;  4GNX B;  1L0X B;  4A3D B;  4GNX C;  1EYG A;  5KIX A;  2E74 C;  5IYB G;  3I4M H;  3ND9 A;  2GN5 A;  2WAC A;  1D7Q A;  1UE7 A;  3J7Y W;  5EPK A;  1KQS A;  1IYJ B;  3S9W A;  2X69 A;  1CI3 M;  3I56 A;  2NN6 H;  2CH4 W;  4UAI A;  4DXG A;  4Z9C B;  5CV8 A;  2F3I A;  3J81 i;  2FIN B;  1U4L A;  4K0K Q;  2B2V C;  5LL6 X;  2L55 A;  4CBV A;  4BBS B;  4CKE A;  2MQH A;  3K0Y A;  3J7A 5;  3PF4 A;  3PF5 A;  1FNU A;  4YHH L;  1JOK A;  2F0P A;  2JA7 G;  3I4M B;  3TQY A;  4MTN A;  5IGD A;  1HZ9 A;  1PYB A;  2K1B A;  5G3L D;  3H3V C;  1L0Y B;  1K9M C;  1X32 A;  3TRZ A;  1IL8 A;  1N36 Q;  1EZ6 A;  2YTY A;  1L1O A;  3U9S A;  1N36 L;  3S1M B;  4MHE A;  1YEZ A;  3DEP A;  1AE3 A;  1ZEQ X;  2RHS B;  3J7A F;  1W6K A;  3SK4 A;  1O7I A;  2AWN A;  1GHK A;  1BKB A;  1YI2 A;  4Q5V A;  3CMA A;  1W3S A;  2Z9H A;  1LO5 D;  1Q46 A;  1YZ6 A;  2EY6 A;  3SVM A;  5M5X B;  1XJV A;  2VXW A;  3R93 A;  1CSP A;  4FO2 A;  1SMY C;  2BH8 A;  5C44 H;  1GVP A;  2KHS A;  1X3G A;  1EY9 A;  3U4V A;  4RAU C;  5M5W H;  4R4Q A;  3PIP 3;  1EWC A;  4LF5 Q;  1EYA A;  1VS0 A;  1CTM A;  2IX0 A;  1D5Z C;  3N52 A;  4LF5 L;  1I50 H;  1DXM A;  1GOZ A;  4LF9 Q;  4DR6 Q;  1HHV A;  4HMI A;  2PQA B;  5CV4 A;  1TY2 A;  2KUM A;  4DR6 L;  3M7N A;  4DR1 L;  1C4Q A;  2PZT A;  1QNK A;  1M90 C;  1S5C D;  1LT6 D;  2OEO A;  4DK0 A;  1I5F A;  5C6A A;  1STB A;  1XX8 A;  2MHV A;  5JJK A;  2Y0S G;  5E3F A;  1SDF A;  3J80 i;  5I6W A;  4RHS A;  1Z7T A;  3IL8 A;  4DV6 Q;  5C44 B;  2L5T A;  3PO2 H;  2CH4 A;  3CC4 A;  5FLX E;  4A4I A;  1YJ9 A;  4QGU A;  3J81 E;  1PZJ D;  1AE2 A;  2FMM A;  2Z8L A;  1XMO Q;  3GTO H;  4XT3 B;  3AEV A;  1DOL A;  5IWA Q;  1XMO L;  5CV7 A;  4R4I A;  4TQU S;  1PTO C;  2Z1C A;  1E1O A;  2A73 B;  1OTC A;  1G91 A;  2F3W A;  5IT9 c;  5KEE A;  3NK9 A;  3NWS A;  4M1U B;  1GM5 A;  5C3W A;  1R9T H;  4HJ9 A;  1FGU A;  3S24 A;  4IJH A;  1DYQ A;  1IL2 A;  1HZB A;  1OO9 B;  3STB C;  3WWV A;  1HZA A;  3RD4 A;  5FOB B;  3CCR A;  1PV4 A;  1RF2 D;  3BYY B;  1BQQ T;  1F2Z A;  4DPG A;  2UUA L;  2YV5 A;  4P74 A;  1HCZ A;  1X9N A;  3H0G H;  2JA6 H;  3GTO B;  1OXV A;  1EY7 A;  2MNA A;  3NWT A;  1CHP D;  3E9I A;  4CDD C;  1WI5 A;  3ERS X;  4DAM A;  2RSO A;  3M4P A;  3M4O B;  1YNJ C;  1TY0 A;  5C0X I;  4FYD A;  4G4K A;  1VQ7 A;  1F9R A;  3U4Z A;  1NAP A;  5JJZ A;  4GN4 B;  4JYA Q;  1SE3 A;  2AUK A;  4Y7N B;  3PSI A;  4P2C B;  1VQO A;  4JYA L;  4JI7 L;  4NXM Q;  4KJO A;  3P75 A;  4KD4 A;  1TR5 A;  2K28 A;  4OO1 G;  2RDG A;  4NXM L;  4X66 Q;  2EJF C;  3RN5 A;  4X66 L;  2A69 C;  3PUY A;  1VQ8 A;  3H0G B;  3I72 A;  2F4V Q;  4CJ0 B;  3D4D A;  2VW9 A;  1QOH A;  1IBL Q;  1GUT A;  3C1F A;  4A3I G;  3AMU A;  2F4V L;  3IFT A;  2BA0 A;  3ULP A;  2A74 C;  1H9S B;  1IBL L;  5K36 H;  3MHB A;  3SEB A;  1GUN A;  3CHB D;  4JBW A;  4GNX A;  1BBX C;  3KBG A;  1GUS A;  4OEM B;  1LT3 D;  2IW3 A;  1NR4 A;  1OXT A;  1O80 A;  5IP9 G;  4OWT B;  2ZTC A;  2F0S A;  4JI2 L;  2R61 A;  1VQG A;  2BH2 A;  2B2V A;  3F2C A;  3SDZ A;  2E75 C;  3QG1 A;  1LUZ A;  1K28 A;  3FP9 A;  1S40 A;  2RF4 A;  4JBK A;  2E5L L;  4QY7 A;  3NUC A;  4KY6 A;  4CGY B;  1HZC A;  4C3J B;  3QJY A;  4LFA L;  1WYD A;  2JA8 H;  2OQK A;  2AQ3 B;  4A3D G;  3L9A X;  1ET6 A;  2QF7 A;  4HCS A;  4DU9 A;  1FGB D;  1TWC H;  2B2U C;  4Q0F A;  4NMZ A;  3SR1 A;  1U4R A;  1ONL A;  1SYB A;  1BDO A;  4WRD A;  3ICE A;  3I2Z A;  4BY1 G;  3R8B A;  5T1G A;  2ICI A;  4ZRZ A;  3QOJ A;  4A3J H;  1E3P A;  1PTO F;  3BZC A;  2D0O A;  1Z6H A;  4JI3 L;  1PZK D;  4ZYS A;  5IGE A;  2M9V A;  4GZY C;  4GLA C;  5CR3 A;  3S17 B;  2E2D C;  4NPS A;  4A3E H;  3I4M G;  3C46 A;  2L0C A;  2EE1 A;  2E8G A;  2VB2 X;  4B3M Q;  1TWC B;  5C4J H;  2ZXO A;  3AU7 A;  3T4A C;  3HOW H;  1M8A A;  4FDB A;  3GTK H;  4B3M L;  2G5D A;  1H9M A;  3T56 B;  2NN6 G;  3ULL A;  2ASB A;  3HOZ H;  2HHH Q;  3GTJ H;  2PQA A;  1EWH A;  1E2W A;  3VYT A;  1AZP A;  4XQQ A;  4RCN A;  5DLQ E;  2KEC A;  1TKW B;  2M00 A;  4IAL A;  2LXK A;  2F0V A;  2PMZ B;  3X3M A;  3F2D A;  4LK1 C;  5EBC A;  1KTK A;  4EX5 A;  2F0Q A;  2PO4 A;  5M5Y H;  2DN8 A;  4DAP A;  2Z4H A;  3QR8 A;  4X62 L;  4RG1 A;  5C4J B;  4DN4 M;  4JW0 A;  4O2D A;  4CKC A;  1C8C A;  3P20 A;  2NVX B;  4DR4 Q;  2LSS A;  1B1Z A;  3OIP A;  1QCB D;  4DR4 L;  4G7O C;  3GTJ B;  3R2I A;  4JI8 Q;  1AN8 A;  5FO7 B;  1SBB B;  3VDY A;  2XRS D;  3GV6 A;  4B3S L;  2RA4 A;  2CW0 C;  3TP6 A;  3HP3 A;  2WB1 E;  3T16 A;  1Q1E A;  1PH3 A;  5DNF A;  3TN2 A;  4ABN A;  1ESF A;  4EQN A;  1KNE A;  4KV6 A;  4LNQ A;  1VQF A;  4HIK A;  3PMF A;  4IPH A;  4KY5 A;  4LF8 Q;  1NNX A;  1XXG A;  3R3O A;  4QMG A;  5C44 G;  3P7J A;  2UUB L;  2K04 A;  1A3V A;  3EFX D;  2OT2 A;  5ELB A;  1NSN S;  2YTX A;  4FXG C;  1JB3 A;  4HSP A;  4ID6 A;  2VNU D;  3D8G A;  5T1I A;  4DV3 L;  4IUR A;  2CHB D;  1WCM H;  1KNA A;  4BWG B;  1LTS D;  2PPB C;  3Q8D A;  1PH9 A;  2UXC Q;  2Z6K C;  1NR2 A;  1PXU A;  2N78 A;  1UWV A;  5EPJ A;  2UXC L;  3W3A A;  2VB3 X;  1MSH A;  2HIV A;  4C1N I;  2IJ0 A;  3G6J B;  1TS3 A;  3RLO A;  4WJ4 A;  1Q82 C;  1KHI A;  5GAH C;  1VQE A;  2V1C C;  3PO2 G;  5LMU Q;  2GVB A;  3S15 H;  3CC2 A;  4KHV A;  4OEL B;  1XTC D;  4G57 A;  1VQI A;  4MTK A;  2FJ2 A;  4JG2 A;  1WCM B;  3W5O A;  3I4N H;  1QZG A;  1N34 Q;  4DV5 Q;  2F0J A;  5FLX L;  2NWG A;  3KK7 A;  5IYC H;  3CCQ A;  1MGS A;  1CQF A;  2JQO A;  3D0F A;  5FO8 B;  3E5S A;  3J81 L;  5KRU A;  2V4D A;  4QQB X;  1IW7 D;  2CQO A;  5HUR A;  1KIX A;  4WJ3 M;  4C3H B;  4S3S A;  4NXN L;  2PW5 A;  2ZT9 C;  1EIG A;  4K2K A;  1Q3L A;  1H9R A;  1E22 A;  1V1Q A;  2P5Z X;  4LMQ D;  4UP7 A;  2Z6B A;  1E7Z A;  1SYF A;  4DUY Q;  3EJI A;  4P72 A;  4DNR B;  3S15 B;  3NBH A;  5J1Z A;  1H95 A;  3DXJ C;  4PZ7 A;  3LNN A;  2OWO A;  1CKM A;  4N9P A;  5M3M H;  2JA6 G;  3H0G G;  4HJ5 A;  4GKK Q;  1VQJ A;  1AZQ A;  1PHJ A;  3VYR A;  1ZXT A;  1HNW Q;  3I4N B;  4GKK L;  3KDF A;  4ALP A;  4J15 A;  1K0S A;  1HNW L;  4AIM A;  3SGI A;  4FF2 A;  1UAP A;  1PFB A;  5C4H A;  3OSO A;  2H4O A;  1XPR A;  2YU9 H;  1AP0 A;  2IWH A;  4F87 A;  4A3K H;  2B2U A;  4TKO B;  1P8L A;  1U5K A;  3JAM i;  1BR9 A;  1KC8 C;  3OHX C;  2BE5 D;  1E24 A;  2RDF A;  2JA5 H;  3DMU A;  2NZH A;  4DKA C;  2IY5 B;  1NTG A;  1LLR D;  1XNR Q;  1EFI D;  2HQE A;  1CKN B;  5IP7 H;  1XTD A;  5M3M B;  4A75 A;  3S1Q H;  4R9W A;  1D5X C;  2RVL A;  2BDN A;  3F1Z A;  1EFW A;  3A8I E;  2J7Z A;  1SAP A;  2IPK D;  3CP0 A;  1KDC A;  5K36 G;  4L8J A;  4F7X A;  4DV4 L;  1LTT D;  1JE5 A;  1KAA A;  5IGB A;  3A54 A;  5EKK A;  1RL2 A;  3IAY A;  2F0H A;  1H9J A;  3K6O A;  1Y69 U;  3PV0 A;  3M4Q A;  3K5M A;  3TSS A;  2D2C C;  3NE5 B;  4LF7 L;  1J8I A;  3S1Q B;  1EUJ A;  2PZU A;  3HZX A;  2D0P A;  4LUV A;  4NP5 A;  5C5M A;  1CA6 A;  5I9O A;  1I6H B;  5LL6 S;  1RD9 D;  3URY A;  2K7V A;  3CPF A;  5JPN C;  5EQ0 A;  1FJG L;  4O1N A;  4BA1 I;  2AHO B;  2EJG C;  4L5S A;  3KLS A;  2JA8 G;  2F1M A;  3S16 H;  4DAY A;  1WTP A;  2QEX A;  1WTO A;  5ELO A;  3GO5 A;  5EAY A;  4B9X A;  2C5C A;  3BYT B;  4J8Q A;  4TVA B;  5ELC A;  3K7A H;  2ID0 A;  1Q12 A;  1BOS A;  4K5X A;  4L6T B;  3GTP H;  1X65 A;  1VQK A;  1MD2 D;  2CWP A;  3D31 A;  2F3V A;  4IUN A;  2MPM A;  4A3J G;  3D3R A;  3S2H B;  1TT2 A;  4I7Z C;  2WAQ B;  3ULJ A;  1B50 A;  3CCL A;  4GN3 B;  1IYU A;  3TP5 A;  2JEA I;  5FJ8 H;  3JAM E;  3K58 A;  1PLF A;  5CV9 A;  4CJ2 C;  4IFD I;  4DNI A;  1D1K A;  4OIJ A;  1WTR A;  2N49 A;  1G8Z D;  1YHA A;  3S16 B;  1RKN A;  1A2U A;  2EVB A;  2D9U A;  4A3E G;  4CJ1 B;  5FLM H;  4BBS H;  2J4X A;  3TS2 A;  2HCI A;  1AFP A;  4ZKB B;  4GLV B;  3TEH B;  1B3A A;  3HOW G;  1A8V A;  1EYD A;  3K7A B;  1RIP A;  3GTP B;  2NYZ D;  3HOZ G;  3BDL A;  3GTG H;  3CAM A;  1SNO A;  3HKZ G;  4AYB E;  2L1B A;  2Z6K A;  4H0L C;  2B2Y C;  3H3V H;  1IHZ A;  3A5Z B;  1EWI A;  4JCV E;  3UE0 A;  5COR A;  1TS5 A;  4N8X 1;  5J3B A;  1HRJ A;  3CRK C;  4UY8 C;  3WOE A;  1HNX Q;  2LFN A;  2NVT B;  3PO3 H;  3PIP A;  3BDC A;  5CV5 A;  1VQ9 A;  1HNX L;  2IX1 A;  2EY2 A;  3S1M H;  5JVH 3;  2EYF A;  2RDH A;  4QUC A;  5AFW A;  3HOX B;  4LAA A;  2AMC B;  4K0K L;  2CQA A;  3QB3 A;  1NMG A;  1AW7 A;  4FF3 A;  2A6H D;  2XIW A;  1YIT A;  1TS2 A;  3FHW A;  5M5X H;  2K14 A;  1PH6 A;  3GTG B;  1E2V A;  3GTL H;  4PZ6 A;  1JJC B;  1STG A;  3BVZ A;  5NUC A;  3DM3 A;  5M3F B;  2VY3 A;  1HPC A;  4JBJ A;  3D4R A;  1TWG H;  4ZKC B;  1O78 A;  3TDQ A;  5FLX c;  3ITP A;  1WD1 A;  3J81 c;  3CME A;  3PO3 B;  1BCP D;  3IKJ A;  4A3G H;  2O5J C;  4RKB A;  1EIH A;  2TMP A;  4HMJ A;  3H6M A;  1EQQ A;  3CU7 A;  1VQA A;  4KKU A;  3X3N A;  5KYL A;  1MIU A;  4X64 Q;  1LTG D;  2F0W A;  3A7A B;  5I2X A;  1B2T A;  3EA6 A;  4X64 L;  3PGZ A;  4RGM A;  3RR5 A;  3GTL B;  3KF6 B;  1WCM G;  1HFG A;  2PYK A;  1RCV D;  3KBX A;  2R7Z B;  2N8N A;  2X6G A;  4KN4 C;  1JT8 A;  5CYU A;  1X3E A;  4DXF A;  1F2Y A;  1TWG B;  3CCM A;  3HOV H;  1OXU A;  4KHZ A;  1A15 A;  2KQ3 A;  1SE4 A;  5EPL A;  4DR5 Q;  4Y52 H;  2DY7 A;  4A3G B;  2EY1 A;  1S3O A;  4MN3 A;  1I6V C;  2WKC A;  3RUZ A;  3MXN A;  1KLU D;  2OTJ A;  4GLX A;  3RLN A;  4LF9 L;  4EQP A;  1S4Z A;  1CKN A;  1UNS A;  3NTI A;  1A63 A;  2HCC A;  3KUP A;  1WD0 A;  2G9H D;  3KF8 A;  1I3Q H;  4YCU A;  2E2I B;  4DR7 Q;  4L5R C;  4ZUJ A;  2E76 C;  4ZCK A;  4DR2 Q;  1I4R A;  5E4X A;  1XPU A;  2ZXP A;  2JN4 A;  4DR2 L;  3I4N G;  1UEB A;  5KND A;  3SK6 A;  4DV6 L;  3PQI A;  4L5Q A;  5IYC G;  3HOV B;  1TWF H;  1B9N A;  2VL6 A;  5I6Y A;  5IGF A;  4FF4 A;  5HY6 A;  4G7H C;  3MXU A;  1IW7 C;  1NCV A;  4XIG S;  4UPA A;  1AH9 A;  4R4O A;  1Z9F A;  1PTO B;  3RMH A;  1BXT A;  1QWY A;  3TZU A;  2D62 A;  1DOM A;  1TVX A;  5IWA L;  1O7Z A;  5DAU A;  1BVS A;  3M4O H;  2B8G A;  3AQQ A;  3I70 A;  4ZAI A;  5CBA E;  5KYI A;  3DUZ A;  4QL5 A;  3DWA A;  4LUZ A;  1BF4 A;  1BNZ A;  2F0O A;  1HTP A;  3A7L A;  1S5F D;  1Q1B A;  1I3Q B;  5M3M G;  4Y7N H;  1SNC A;  4A3F B;  1CM9 A;  4DK6 C;  3MWY W;  1QUQ A;  3VR4 A;  2XSC A;  4QF4 A;  1FVI A;  4GN5 A;  1RJT A;  1UE5 A;  1YHB A;  3G48 A;  1PH2 A;  1XMQ Q;  3Q24 A;  3MXP A;  2VS1 A;  1SYC A;  3FKI H;  3W1G A;  1TWF B;  5ISR A;  4PMW A;  3KJP A;  1I94 Q;  3E0J A;  4A3K G;  1L0W A;  1D6E C;  1I94 L;  4IQZ A;  2QIL A;  4QUF A;  1JOR A;  1STA A;  2BE5 C;  1J5E Q;  4A3L H;  2CFM A;  2B3G A;  4HIM A;  2JA5 G;  4B9W A;  1J5E L;  4KKS A;  3BU2 A;  4LF6 Q;  5IP7 G;  4HID A;  1IBK Q;  2WIN B;  5KNB A;  1HFN A;  1EY0 A;  1IBK L;  1SMX A;  1NUC A;  1PFM A;  4IPC A;  2MFI A;  1VQD A;  1STH A;  5EGT A;  1JJ2 A;  4EVO A;  3FKI B;  1ET9 A;  3GTQ H;  2KOL A;  1FNW A;  1VQ5 A;  4A93 H;  3KLW A;  1VQH A;  3HS0 C;  1Y14 B;  5E4W C;  3U58 A;  1CUK A;  3OWE B;  1VQM A;  3RZD H;  2MGS A;  2K32 A;  3D6W A;  1B7Y B;  1YBY A;  1I4G A;  3S1N B;  4K2L A;  4U68 A;  3G7L A;  4C3J H;  2KCN A;  3J80 E;  4HJ8 A;  4M8A A;  5GAD C;  1DCZ A;  4HIO A;  4IZ8 A;  1YIJ A;  2EYM A;  4IUT A;  5FKA C;  4O42 A;  3HFZ B;  3FMC A;  1KAW A;  1VMP A;  2ATW A;  3PUW A;  1Y1W B;  2R6G A;  2R7F A;  2BOS A;  1ZKO A;  4C3I B;  5IT9 E;  1ASZ A;  5E7N A;  4OX9 Q;  3NSW A;  3GTQ B;  1NY4 A;  2F0E A;  2K05 A;  4EQ5 A;  4A93 B;  3MZ5 A;  4IN3 A;  2QGQ A;  3NBH B;  2C9O A;  2K6A A;  5IIF A;  3RZD B;  1ILP A;  1D1I A;  1EQV A;  1OXX K;  3T51 B;  4ILW A;  1GUG A;  3KDF B;  1J6Q A;  1II3 A;  4JC0 A;  1I4H A;  2K5W A;  1QVF A;  3S17 H;  4KK7 A;  4JI5 Q;  4XDX A;  3EVQ A;  3QIA A;  1JE4 A;  3L0O A;  1DD2 A;  2CVR A;  1MKH A;  1B9M A;  5FJ8 G;  1VQP A;  3NTK A;  3U9O A;  1VDZ A;  3KLS X;  2Z4I A;  3OPO A;  3ZYY X;  2BDO A;  3H91 A;  2KCC A;  3I4O A;  2DNE A;  4POF A;  1Q8I A;  4BBS G;  5FLM G;  1PH8 A;  2B29 A;  1E1T A;  2WII B;  3JAM L;  3NTH A;  3KF6 A;  1Q86 C;  1VQN A;  1HR0 W;  1C48 A;  4KTA A;  1LAC A;  1YJN A;  5JEA J;  1HQM C;  3F8T A;  5CBE E;  4FP5 D;  2Z0S A;  1D2B A;  2K50 A;  2NVY H;  1HXY D;  4IOC A;  1SRU A;  4OL7 A;  3VR5 A;  2NVX H;  4DV1 Q;  1B4O A;  1SNP A;  1Q7Y C;  2LMC B;  4DV1 L;  1LTR D;  4YWK A;  4JI0 Q;  3PO3 G;  5JEA H;  4UP8 A;  5CV6 A;  2HHH L;  1WTQ A;  4JI0 L;  4HSV A;  5C3E B;  4A3B H;  4QIW B;  2N55 A;  3LGJ A;  2H1E A;  4OWX B;  2A6H C;  5C0X J;  4QIW E;  1HNZ Q;  2B2T C;  5L37 A;  1N33 Q;  4B08 A;  4G7Z C;  1K3R A;  1SNM A;  1YNX A;  3OMG A;  2BCO A;  3CCU A;  1I4X A;  4DAY B;  1WFQ A;  5JOB A;  2NVY B;  1Q8K A;  5EKI A;  5C0X H;  3IFD A;  3WOF A;  1C9O A;  1BCP C;  1IZ6 A;  1PYW D;  4A3G G;  2WB1 B;  4LJZ C;  2NVQ H;  3MEH A;  1F9P A;  2ZM6 Q;  4JI8 L;  1Y1V H;  1V9P A;  2EOT A;  4B3R Q;  1WVL A;  1EZ8 A;  4OO1 I;  1HA6 A;  4A3B B;  1S5E D;  1IBM Q;  1SYE A;  1G51 A;  2NZO A;  2VQE Q;  2K03 A;  4B3T Q;  1RTO A;  3PIO 3;  2GVA A;  2F0M A;  4B3T L;  4NKL A;  3CW2 C;  2J0T D;  1SLJ A;  2A19 A;  1FR3 A;  1VQC A;  2I5L X;  4LF8 L;  2K33 A;  4OHJ A;  1VCI A;  1BO0 A;  3HKZ E;  3HOV G;  1A3U A;  2IHF A;  2EZV A;  4N8F A;  1JQY D;  3VR3 A;  2NVQ B;  1GD7 A;  3ND8 A;  4FF1 A;  4H13 C;  3VA7 A;  3T1H Q;  1Y1V B;  4LUO A;  1EQT A;  1M4V A;  4XQN A;  5IYD H;  5KNC A;  3T1H L;  1PRT F;  1A2T A;  1PYS B;  4XTC S;  3H09 A;  1SR3 A;  4MNO A;  2I5H A;  4RWS C;  3UE1 A;  3A8J E;  1D8L A;  2OTL A;  4JVZ A;  3DWP A;  3C1E A;  4C3H H;  1GHJ A;  1CFM A;  1SN8 A;  1Y8O B;  4BY7 H;  4BXX H;  3A55 A;  3G71 A;  3QWN A;  2A68 D;  3NP8 A;  4KJN A;  3TZD A;  1NMF A;  5LMU L;  2RKS A;  1G2T A;  3F2B A;  3GTM B;  3VYU A;  3A0J A;  5K5P A;  4GKJ Q;  1BBU A;  1FD7 D;  3SK8 A;  3CPW A;  3K5O A;  4GKJ L;  2EIF A;  1S72 A;  4KHP Q;  4JOI C;  1N34 L;  4DV5 L;  5ELF A;  1JJG A;  4I65 A;  3I90 A;  4KHP L;  1CKO A;  4OWW B;  1SJH D;  3R2T A;  1EY5 A;  5C4Z A;  1UEA B;  3MXG A;  2WFW A;  2QEJ C;  4DV7 Q;  4BY7 B;  3I55 A;  1M1K C;  3FPP A;  1TS4 A;  4PV1 C;  4DV7 L;  5F2D A;  3K59 A;  2MO1 A;  2EXD A;  3FKI G;  4LF4 Q;  4DUY L;  1B3Q A;  1EYC A;  3S2D B;  4OIK A;  3KOJ A;  2KA7 A;  1HUM A;  2Q8T A;  1ENA A;  3PUZ A;  2EYP A;  4A3M H;  4A3L G;  3H3V I;  3P1H A;  1L1O C;  2A6E D;  5JAV A;  5ELE A;  1NJI C;  1LV9 A;  2NN6 I;  3TBI B;  2EPB A;  2F0F A;  3MEF A;  1X3Q A;  1C0A A;  3TP8 A;  4PG3 A;  3MXN B;  4QCL A;  1K8O A;  3A74 A;  5FK9 C;  1XNR L;  2Y0S E;  1XYI A;  2Q8R E;  1BCP F;  1IKL A;  1QE6 A;  3NHH A;  4CDE C;  1HR0 Q;  2ES2 A;  4A93 G;  3M4Y A;  3KF8 B;  5D3I B;  5A35 A;  1RDP D;  1I6H H;  2ICE C;  4A3M B;  4FXK C;  3A56 A;  2HT1 A;  1KAB A;  3CCS A;  3L7Z C;  2R7D A;  1A62 A;  2NBF A;  4C3J G;  2YTV A;  4ZLT F;  1SND A;  1W6J A;  4MZ9 A;  3DHQ A;  2RHQ B;  3RZO B;  3C2P A;  1C7Y A;  1GO3 E;  1EEF D;  5HGQ A;  2IX3 A;  3Q0A A;  2I5M X;  4LWC A;  2K5V A;  3PUX A;  1WTV A;  4RFB A;  3J80 L;  5C5L A;  2I0Q A;  1FNV A;  3HOU H;  4X3U A;  1G29 1;  1A6X A;  1I4P A;  3S2H H;  2A69 D;  1I4Q A;  1X3F A;  1U4M A;  1QUQ B;  2YYZ A;  2B2T A;  4LFC Q;  4PZ8 A;  5IT9 L;  4X65 Q;  1Y8P B;  4LFC L;  1XWE A;  3EBE A;  2VUM H;  1NBW A;  4YIJ A;  1ZYR D;  2QW7 A;  4X65 L;  1HA5 A;  2LS0 1;  3WDN A;  4I7A A;  4CHT B;  5CC4 A;  1EU4 A;  4AQY Q;  5JJL A;  3OIQ A;  5KGU A;  1PRT D;  4F88 A;  1YNN D;  4KI0 A;  5IGG A;  3J81 j;  4A3C H;  3I3C A;  2K5Q A;  2R92 H;  3CD6 A;  2R3Z A;  1WTH A;  2Q2U A;  3U50 C;  3RNU A;  1CSQ A;  1WOC A;  4KKT A;  4NB3 A;  4F8M A;  2KCM A;  3HOU B;  3SHL A;  2FHT A;  1TWA B;  1EIF A;  5D3D A;  1YJW A;  2PNR C;  3A8K E;  4L63 B;  5IGC A;  1VMC A;  2QDL A;  5LMN W;  4DNT B;  2DUD A;  4R4T A;  4E6I A;  4XT1 B;  1GUW A;  4UHV A;  2NVT H;  4PMC A;  2VUM B;  1SFO B;  4IUU A;  1KL9 A;  2Q8I B;  1MJE A;  1KDB A;  4XQJ A;  1E2Z A;  3HOX H;  4KN7 C;  1PFS A;  1FYC A;  1JCK B;  2B39 A;  2C35 B;  4OXP A;  4FVM A;  2B2W C;  4ZK9 B;  1SEB D;  4AYB B;  4TRD A;  2R92 B;  1F2L A;  4WFN 3;  2WB1 G;  5JEA G;  4KMU C;  2IT1 A;  2XN9 C;  4X3T A;  3RLF A;  1OXS C;  5M3F H;  4A3B G;  3SE0 A;  5JJI A;  2NUC A;  1YHQ A;  4RA8 A;  4IOA A;  5DM7 3;  2JP1 A;  4RGN A;  2UXB Q;  1LTB D;  4RHR A;  2EDG A;  4APV A;  2PW7 A;  4K5V A;  4EQO A;  1KD1 C;  4OON A;  1PZI D;  3NQT A;  1VQ4 A;  3FRP B;  1VQ6 A;  2XWB B;  2L9H A;  5C0X G;  4BY1 B;  2FMC A;  3G4S A;  2UU9 Q;  1QJO A;  2NTT A;  3V05 A;  1P16 A;  4JOI A;  2UU9 L;  1CZG A;  1Y1V G;  3CCV A;  2R7Z H;  2DNC A;  2WKD A;  1TWH H;  3I91 A;  4V0B A;  3RN2 A;  3O13 A;  1WTX A;  4YHH Q;  4X6A H;  4JI6 Q;  2DY8 A;  2XNA C;  2ALY B;  2OF1 A;  4JI6 L;  1QVC A;  2KBN A;  1MHW C;  4HED A;  2WP8 J;  1DM0 B;  3M7G A;  2K01 A;  1SYD A;  3NQI A;  2E2I H;  5BN3 A;  1X6O A;  5AJ3 Q;  4ULL A;  1N9W A;  3I7F A;  4QJF A;  1T5X D;  3BS1 A;  1CT1 D;  3AB9 A;  5AJ3 L;  5C3X A;  1IYV A;  2A8V A;  2E2H H;  2CW0 D;  3UDF A;  5IYD G;  4IO9 A;  1TWH B;  4JI4 Q;  3HOY H;  2I07 B;  3BVG A;  4JI4 L;  1ASY A;  1PTO H;  2SNM A;  4C3H G;  3HG9 A;  2AKW B;  4DR5 L;  2KED A;  4XYO A;  4A76 A;  2HQL A;  4BY7 G;  2PI2 E;  4BXX G;  1KXL A;  1SXT A;  1X55 A;  3SXH A;  2AUJ D;  3GP7 A;  4RGT A;  4HJ7 A;  2A68 C;  2FXQ A;  2EYH A;  1STY A;  4ME5 A;  2L4N A;  4JI1 Q;  4A3F H;  1JWS D;  4DGZ A;  3M85 A;  4DA2 A;  5ELN A;  1LT4 D;  3TP7 A;  4JI1 L;  3CF5 A;  4BA2 I;  4DR7 L;  3ER0 A;  2E2H B;  4NW2 A;  1QB5 D;  4HN7 A;  4BBR H;  4DR1 Q;  3QOL A;  3HOY B;  1KLG D;  2LXJ A;  2EYL A;  1WTW A;  3Q6S A;  1V1P B;  3AYH B;  2F03 A;  1EY6 A;  1V8Q A;  3PUV A;  4IFD J;  3KJO A;  2L12 A;  2A5H A;  3I8Z A;  4RGO S;  3LWU A;  2Q2I A;  2OXP A;  4YCW A;  4C2M H;  1SJE D;  4IJL A;  3L2P A;  1FL0 A;  5M5W B;  3MFY A;  4XYQ A;  3J80 c;  4IFD H;  1DGS A;  5C4X H;  1KRT A;  1I50 B;  2RCF A;  4A3M G;  4JBM A;  4BBR B;  4HCE A;  2A6E C;  4LW1 A;  4K8J A;  2KEN A;  2SOB A;  1XMQ L;  5A2Q E;  1DON A;  2X6L A;  4YY3 Q;  4H44 C;  2F0U A;  4TSS A;  4J1M A;  1O7Y A;  2K4K A;  4DFA A;  4YY3 L;  1G6P A;  3OYY A;  1F9Q A;  1EY4 A;  2KJX A;  3HGB A;  3S1N H;  3AFQ A;  4HAE A;  5LMN Q;  3PO2 B;  3K8A A;  1U0L A;  4K6D A;  4C2M B;  1LTI D;  1JC7 A;  1L2F A;  1UUP A;  2UUA Q;  3EIV A;  4WOR A;  1LYL A;  5LMN L;  1JWM D;  4LF6 L;  1K8A C;  3I4L A;  1U4P A;  3GV3 A;  3CCE A;  5C4X B;  1Y1W H;  4X3S A;  2CCZ A;  4PNY A;  4HTH A;  2JK8 A;  3NEN A;  1KDA A;  4KD3 A;  2TSS A;  4C3I H;  5M9O A;  4DV2 Q;  4O0A A;  3KFU A;  3FEW X;  3MTS A;  4K8I A;  3GQB A;  2D5D A;  4DV2 L;  2F0L A;  4IUP A;  1EQR A;  3NEM A;  1JR0 D;  2B2W A;  4JI7 Q;  3ZJY C;  1PFN A;  3DEO A;  1R9T B;  2QKI C;  1F77 A;  1SE8 A;  4JPB W;  4X3K A;  4RCO A;  4ZQ3 A;  1VF5 C;  1B53 A;  1UE1 A;  2BA1 A;  5BN5 A;  1D5M C;  1RTN A;  2B2Y A;  2A1A A;  2NB0 A;  3OTO Q;  3HOU G;  5JVG 3;  5BN4 A;  2JA6 B;  1STE A;  3OW7 A;  2WAQ G;  3OTO L;  4DK3 C;  5GQO A;  1MJC A;  1PH4 A;  2KHJ A;  3UI2 A;  4R4C A;  5IY0 A;  2B63 H;  4U67 3;  2WV6 D;  3Q23 A;  5COY A;  2HD3 A;  2VUM G;  1T9H A;  1ZYR C;  4OX9 L;  4V19 0;  2DJF C;  1BBW A;  4DUZ Q;  2KEE A;  2MUY A;  3BJU A;  1VF7 A;  4IPD A;  2K5N A;  2O2L D;  4DUZ L;  4ZUI A;  1PRT B;  4ME3 A;  4JI2 Q;  1PRT C;  4A3C G;  1YNN C;  2XTI A;  4AYB G;  1TXY A;  5BR8 Q;  3VYS A;  2R92 G;  4IUQ A;  4OGQ C;  4EGV A;  5BR8 L;  2F0D A;  2ZJQ A;  3DLL A;  1ENC A;  3GDE A;  1BUV T;  3KLR A;  2E5L Q;  4JI5 L;  1ICF B;  3ERQ A;  1MI2 A;  1PH7 A;  1N32 Q;  2B63 B;  2H5X A;  2F0N A;  2R93 H;  1N32 L;  4C1N K;  4HJA A;  4LFA Q;  1QIL A;  3H15 A;  3Q22 A;  3W2D A;  4ODG A;  4LFB Q;  3HOX G;  5D65 A;  4K6L A;  5C3E H;  1B44 D;  3SK5 A;  4LFB L;  3MAQ A;  2JYO A;  3LWE A;  4AH6 A;  5EJW A;  1SYG A;  4C56 C;  2LKV A;  3S14 H;  5I4D A;  3PIO A;  1EEI D;  3GD7 A;  2B8F A;  4GS3 A;  1X3P A;  2KCT A;  3H94 A;  3K5L A;  1IXR A;  5M3F G;  4KY7 A;  4DK1 A;  1TU2 B;  4HR7 B;  4JI3 Q;  1EL0 A;  2PI2 A;  2N3S A;  2R93 B;  3K57 A;  2K52 A;  1UE6 A;  3MVV A;  1QG7 A;  2RSN A;  1PH1 A;  1HTL D;  2ZTE A;  4UP9 A;  2JA8 B;  4CDC C;  4DAV A;  3DM1 A;  1F9S A;  1X54 A;  4PQX A;  4GOP B;  4CKB A;  1K83 H;  2EJM A;  4GOP C;  1JB7 A;  3MC0 B;  3S14 B;  2XWJ B;  3MA2 B;  1HNZ L;  3E6Z X;  2SNS A;  1N33 L;  2UXD Q;  5IYB H;  4A3J B;  1ESR A;  2R7Z G;  2HDM A;  4BS9 A;  1PH5 A;  5J22 A;  2UXD L;  1V1P A;  4MIU A;  1A3T A;  1BCP B;  3FVQ A;  3BZK A;  2IHE A;  2ZXR A;  5I9P A;  2HDL A;  2EYJ A;  1CK1 A;  2PMZ E;  3CQZ H;  4X62 Q;  4KLK A;  2ZM6 L;  1E0B A;  1XPO A;  1LTL A;  2EXZ A;  2SDF A;  3CKI B;  4A3E B;  2KVM A;  3BVM A;  1IKM A;  2JXM B;  3E3X A;  4JV5 Q;  4B3R L;  2XVS A;  4XXE A;  1K83 B;  1IBM L;  5I2Y A;  3HOW B;  3OOC A;  1LT5 D;  4YWM A;  2VQE L;  3GTK B;  4JV5 L;  5CMD A;  3E9H A;  3HOZ B;  5DEH A;  4B3S Q;  3VA5 A;  3NPP A;  3HKZ B;  5HGT A;  1HJP A;  2JA7 H;  3CRL C;  4R1J A;  2VQF Q;  2EQS A;  1LTA D;  3OMC A;  1VQB A;  4P73 A;  3N6R A;  3L3O C;  2VQF L;  2QA4 A;  3HOY G;  2RBM A;  1AEX A;  1K73 C;  3EN2 A;  2MJ8 A;  3GTM H;  1PDQ A;  2EYO A;  3NBI A;  4DV0 Q;  3TRE A;  5D14 A;  2XGT A;  1JOO A;  3CQZ B;  5M5Y B;  4DV0 L;  5EBD A;  3E0E A;  1LAB A;  2F52 A;  1WJJ A;  2UUB Q;  5LHY 1;  1Q90 A;  1V1O A;  4P75 A;  1DJR D;  1K0R A;  3ONA B;  2RQX A;  1SRO A;  2L15 A;  5E1F A;  4A3F G;  4DV3 Q;  3C3L A;  2PQE A;  2JJQ A;  3LX0 A;  1JOQ A;  3NEL A;  2JA9 A;  2JA7 B;  2GA4 B;  3VR6 A;  1Q81 C;  1SMY D;  3K80 C;  4BBR G;  1B70 B;  3HRZ C;  3S2D H;  1Y8N B;  3CC7 A;  5FO9 B;  1X56 A;  1LM0 A;  2CKZ B;  3CXC A;  2VZA A;  1O7L A;  1N8R C;  3UDG A;  1CQV A;  2OCE A;  4WJW A;  1F2M A;  3FDT A;  4IFD G;  3D6C A;  1ENF A;  1G2S A;  2K75 A;  4R8N A;  4IUV A;  3MFG A;  5C4X G;  1HQR D;  3HKS A;  1H9S A;  4YCV A;  2NTS A;  2JEB I;  4NDX A;  2ZJP A;  3J7Z C;  3UDI A;  3J7A V;  2HUG A;  4H7B A;  1TII D;  5JPM C;  1EIY B;  1H9K A;  3T1Y Q;  2QCP X;  3K0X A;  2G9D A;  3T1Y L;  4DF7 A;  4LF4 L;  1W2B A;  2KHI A;  4JK1 C;  4NXN Q;  3BG3 A;  1QVG A;  3QO2 A;  1L1O B;  3BZD B;  1PTO D;  4YWL A;  1DZ1 A;  1EY8 A;  2M2L A;  4DR3 Q;  1GKH A;  1GXD C;  1PMR A;  1PA6 A;  4DR3 L;  4H02 A;  3TME A;  1QNU A;  5A2Q L;  2O5I C;  1JMC A;  2RCN A;  2LY7 A;  3RZO H;  5GAE C;  1NE3 A;  1K8G A;  3K81 C;  2NZ1 D;  3IRB A;  2Y0S B;  2O4X A;  1Y1W G;  1YVC A;  2DJG C;  1JIC A;  5IOD A;  3STB D;  4C3I G;  4FNF A;  5ELD A;  2ZTD A;  5J39 A;  2XRQ D;  3BDO A;  3FPU B;  3A5U A;  2PCF B;  2CWA A;  1HR0 L; 
#chains in the Genus database with same CATH homology
 4X62 L;  1SMX A;  1Y1V G;  1KRS A;  3PCO B;  1IBK L;  3CCV A;  2R7Z H;  4IPC A;  2MFI A;  3M3Y H;  1TWH H;  4RG1 A;  2UUC Q;  1VQD A;  4O2D A;  3RN2 A;  3W1B A;  1JJ2 A;  4DR4 Q;  1VQL A;  2LSS A;  2UUC L;  3GTQ H;  1EOV A;  3JAM c;  4YHH Q;  1VQ5 A;  4X6A H;  4JI6 Q;  3KLW A;  4A93 H;  1VQH A;  2AWO A;  4DR4 L;  1Y14 B;  2DGY A;  2ALY B;  5H1S E;  4JI8 Q;  3U58 A;  1CUK A;  4JI6 L;  1VQM A;  1QZH A;  3VDY A;  3RZD H;  1QVC A;  4B3S L;  2KBN A;  3S1R H;  4P71 A;  2B63 G;  1B7Y B;  2WB1 E;  4DV4 Q;  1Q1E A;  1PH3 A;  1YBY A;  2WP8 J;  1XNQ Q;  4C3J H;  2E2I H;  1XNQ L;  1X6O A;  5AJ3 Q;  4HJ8 A;  2HIX A;  1N9W A;  3I7F A;  4QJF A;  5GAD C;  4HIO A;  1B8A A;  1TWA H;  1YIJ A;  1VQF A;  4HIK A;  4RMF A;  5AJ3 L;  4LNQ A;  4IPH A;  4LF8 Q;  4GOP A;  3M9B A;  2A8V A;  3HFZ B;  2E2H H;  1KAW A;  4A3I H;  1Z47 A;  3G6E A;  2ATW A;  3KYH C;  3PUW A;  5IYD G;  3UDF A;  4IO9 A;  5C44 G;  2R6G A;  2R7F A;  2UUB L;  4JI4 Q;  3HOY H;  1SFO H;  1ASZ A;  5E7N A;  4OX9 Q;  4LF7 Q;  1NY4 A;  3TS0 A;  2YTX A;  4EQ5 A;  4JI4 L;  1ASY A;  2VNU D;  2QGQ A;  3NBH B;  2AKW B;  4DV3 L;  4DR5 L;  1WCM H;  5IP9 H;  2E2J H;  4A76 A;  2HQL A;  4BY7 G;  2PI2 E;  4BXX G;  1KXL A;  1X55 A;  3Q8D A;  4AQY L;  1PH9 A;  1OXX K;  4HJ7 A;  2UXC Q;  2Z6K C;  2FXQ A;  1FJG Q;  3UDX A;  3KDF B;  1A0I A;  2N78 A;  2R93 G;  1UWV A;  2UXC L;  4JI1 Q;  1J6Q A;  4A3F H;  4JC0 A;  1QVF A;  3S17 H;  3M85 A;  5IE8 A;  5ELN A;  4L5T A;  2HIV A;  4JI1 L;  3CF5 A;  4JI5 Q;  4BA2 I;  4DR7 L;  5C3E G;  4POG A;  3RLO A;  3ER0 A;  1Q82 C;  4WJ4 A;  1KHI A;  3L0O A;  5GAH C;  1VQE A;  4BBR H;  2V1C C;  1MKH A;  4DR1 Q;  5LMU Q;  3PO2 G;  5FJ8 G;  1VQP A;  2MO0 A;  2GVB A;  3S15 H;  2LXJ A;  3CC2 A;  3AYH B;  1VQI A;  3PUV A;  4IFD J;  3KJO A;  4JG2 A;  4A3D H;  4IPG A;  2K5H A;  3I4O A;  3AFP A;  4POF A;  3W5O A;  4BBS G;  5FLM G;  2Q2H A;  2Q2I A;  1PH8 A;  3I4N H;  2B29 A;  1QZG A;  1N34 Q;  4DV5 Q;  1E1T A;  1V43 A;  5GAG C;  4YCW A;  5IYC H;  3CCQ A;  3JC6 6;  4C2M H;  2JQO A;  1HH2 P;  3D0F A;  4IJL A;  3CCJ A;  2WAQ E;  5GRO A;  1Q86 C;  3KF6 A;  1FL0 A;  3L2P A;  1HR0 W;  4BY1 H;  1VQN A;  1PVO A;  4QQB X;  3OW2 A;  2Q2T A;  2CQO A;  3J80 c;  1YJN A;  5JEA J;  1KIX A;  4WJ3 M;  3F8T A;  1DGS A;  5C4X H;  4NXN L;  1KRT A;  2Z0S A;  4A3M G;  2OQ0 A;  4JBM A;  2K50 A;  1E22 A;  1V1Q A;  2PNH A;  1SRU A;  2NVY H;  4UP7 A;  4IOC A;  2NVX H;  1E7Z A;  2JE6 I;  4DV1 Q;  4LW1 A;  4DUY Q;  2KEN A;  4P72 A;  3B6Y A;  2ZJR A;  1XMQ L;  1Q7Y C;  1H95 A;  4PZ7 A;  4YY3 Q;  4DV1 L;  3K7U C;  4YWK A;  1CKM A;  2OWO A;  5M3M H;  4JI0 Q;  3PO3 G;  2JA6 G;  3H0G G;  4GNX B;  4UP8 A;  4HJ5 A;  2K4K A;  2HHH L;  4YY3 L;  4GNX C;  1VQJ A;  1EYG A;  4JI0 L;  5IYB G;  3OYY A;  1PHJ A;  3I4M H;  4GKK Q;  2GN5 A;  1HNW Q;  1D7Q A;  4GKK L;  4A3B H;  1UE7 A;  3KDF A;  3S1N H;  3AFQ A;  3LGJ A;  1KQS A;  4ALP A;  4J15 A;  5LMN Q;  1IYJ B;  1HNW L;  4AIM A;  3K8A A;  1U0L A;  3SGI A;  1L2F A;  4OWX B;  3I56 A;  5C0X J;  2UUA Q;  4QIW E;  1HNZ Q;  3EIV A;  1LYL A;  5LMN L;  1XPR A;  2YU9 H;  4A3K H;  1N33 Q;  4LF6 L;  1K8A C;  2F3I A;  1K3R A;  1P8L A;  3J81 i;  1U5K A;  3JAM i;  3CCE A;  1KC8 C;  1YNX A;  1E24 A;  1Y1W H;  3CCU A;  4K0K Q;  2CCZ A;  4DAY B;  1WFQ A;  2JK8 A;  3NEN A;  2JA5 H;  2NZH A;  4DKA C;  4C3I H;  1NTG A;  4DV2 Q;  1XNR Q;  2IY5 B;  4O0A A;  2MQH A;  3KFU A;  1Q8K A;  3J7A 5;  4DV2 L;  3PF4 A;  1C9O A;  1CKN B;  5IP7 H;  3PF5 A;  1XTD A;  1IZ6 A;  1EQR A;  3NEM A;  4YHH L;  4A75 A;  3S1Q H;  4A3G G;  2NVQ H;  4JI7 Q;  3ZJY C;  2ZM6 Q;  2JA7 G;  4JI8 L;  1Y1V H;  1V9P A;  3F1Z A;  3TQY A;  1EFW A;  1SE8 A;  4B3R Q;  4OO1 I;  3CP0 A;  1IBM Q;  2NZO A;  1G51 A;  1HZ9 A;  4MTN A;  2VQE Q;  1PYB A;  5K36 G;  4B3T Q;  4DV4 L;  1UE1 A;  1K9M C;  3TRZ A;  2BA1 A;  1JE5 A;  1N36 Q;  2GVA A;  2A1A A;  4B3T L;  2YTY A;  3CW2 C;  3OTO Q;  3HOU G;  1L1O A;  1N36 L;  1RL2 A;  1SLJ A;  2WAQ G;  2A19 A;  3OTO L;  4DK3 C;  1YEZ A;  5GQO A;  1MJC A;  1VQC A;  2I5L X;  4LF8 L;  1PH4 A;  2KHJ A;  2B63 H;  1AE3 A;  3PV0 A;  4R4C A;  5IY0 A;  3M4Q A;  2RHS B;  1VCI A;  3HKZ E;  3HOV G;  1O7I A;  2VUM G;  2AWN A;  2IHF A;  1BKB A;  1T9H A;  1YI2 A;  4LF7 L;  4OX9 L;  3CMA A;  1W3S A;  1XJV A;  1BBW A;  1Q46 A;  1EUJ A;  1YZ6 A;  3BJU A;  4DUZ Q;  1GD7 A;  4IPD A;  2K5N A;  3T1H Q;  1CSP A;  4DUZ L;  4LUO A;  4LUV A;  2D0P A;  5IYD H;  2BH8 A;  4ME3 A;  4JI2 Q;  5C44 H;  3T1H L;  1GVP A;  1PYS B;  4A3C G;  2XTI A;  4XTC S;  1X3G A;  4AYB G;  1TXY A;  3U4V A;  5BR8 Q;  3CPF A;  5M5W H;  2R92 G;  4JOI A;  4R4Q A;  1SR3 A;  1FJG L;  4MNO A;  2I5H A;  4BA1 I;  1VS0 A;  2AHO B;  1D8L A;  3UE1 A;  4LF5 Q;  5BR8 L;  2IX0 A;  2ZJQ A;  4L5S A;  2OTL A;  4C3H H;  3DLL A;  2JA8 G;  4LF5 L;  3S16 H;  3GDE A;  1I50 H;  1SN8 A;  4LF9 Q;  2QEX A;  2E5L Q;  5ELO A;  3GO5 A;  5EAY A;  4JI5 L;  4BY7 H;  4BXX H;  3G71 A;  1PH7 A;  4DR6 Q;  2PQA B;  1N32 Q;  2H5X A;  4DR6 L;  3M7N A;  4TVA B;  2R93 H;  1N32 L;  3K7A H;  5LMU L;  1NMF A;  2ID0 A;  1Q12 A;  4HJA A;  4DR1 L;  4LFA Q;  3H15 A;  3GTP H;  1M90 C;  3F2B A;  1X65 A;  1VQK A;  2CWP A;  1I5F A;  3D31 A;  3A0J A;  4A3J G;  4GKJ Q;  1BBU A;  3HOX G;  4LFB Q;  5C3E H;  5JJK A;  2Y0S G;  3J80 i;  3CPW A;  3ULJ A;  3CCL A;  4GKJ L;  4LFB L;  4DV6 Q;  2EIF A;  4GN3 B;  1S72 A;  4KHP Q;  3PO2 H;  4AH6 A;  4JOI C;  1N34 L;  5FJ8 H;  4A4I A;  4DV5 L;  1YJ9 A;  3CC4 A;  2JEA I;  4QGU A;  1JJG A;  4KHP L;  1AE2 A;  1CKO A;  3S14 H;  4OWW B;  4IFD I;  4DNI A;  3PIO A;  1XMO Q;  3GTO H;  3AEV A;  2N49 A;  1YHA A;  3GD7 A;  4GS3 A;  2KCT A;  5IWA Q;  1XMO L;  4DV7 Q;  2WFW A;  1IXR A;  4A3E G;  4R4I A;  4TQU S;  5FLM H;  3I55 A;  5M3F G;  1M1K C;  4BBS H;  3TS2 A;  4JI3 Q;  4DV7 L;  4GLV B;  3TEH B;  3HOW G;  1E1O A;  1OTC A;  2PI2 A;  1A8V A;  2N3S A;  2MO1 A;  2EXD A;  3FKI G;  4LF4 Q;  2K52 A;  1RIP A;  5IT9 c;  1UE6 A;  4DUY L;  3HOZ G;  3GTG H;  1PH1 A;  1GM5 A;  2ZTE A;  3CAM A;  4AYB E;  3HKZ G;  3KOJ A;  4UP9 A;  2Z6K A;  1R9T H;  4HJ9 A;  1FGU A;  3S24 A;  4IJH A;  3PUZ A;  4A3M H;  1HZB A;  1X54 A;  1IL2 A;  3H3V I;  3H3V H;  4A3L G;  3A5Z B;  1EWI A;  4JCV E;  3UE0 A;  3STB C;  3WWV A;  1HZA A;  1L1O C;  4GOP B;  2UXB L;  5J3B A;  1K83 H;  3CCR A;  4GOP C;  1NJI C;  4UY8 C;  1JB7 A;  1G6P A;  2NN6 I;  1PV4 A;  1HNX Q;  4DPG A;  3PO3 H;  3PIP A;  2UUA L;  2YV5 A;  3MEF A;  4P74 A;  1HNZ L;  1VQ9 A;  1X9N A;  3H0G H;  1HNX L;  2JA6 H;  2IX1 A;  3S1M H;  1OXV A;  1C0A A;  2MNA A;  1N33 L;  2UXD Q;  5IYB H;  4PG3 A;  3E9I A;  2R7Z G;  3MXN B;  1PH5 A;  2AMC B;  4K0K L;  2UXD L;  1WI5 A;  3ERS X;  4DAM A;  1NMG A;  3M4P A;  3A74 A;  5C0X I;  1XNR L;  2Y0S E;  3BZK A;  1VQ7 A;  2ES2 A;  2IHE A;  3U4Z A;  1YIT A;  4GN4 B;  3FHW A;  1HR0 Q;  5M5X H;  4A93 G;  2K14 A;  4JYA Q;  1PH6 A;  3KF8 B;  3GTL H;  2PMZ E;  4PZ6 A;  4X62 Q;  3CQZ H;  3PSI A;  1JJC B;  4KLK A;  1VQO A;  4JYA L;  4JI7 L;  2ZM6 L;  1XPO A;  1LTL A;  4NXM Q;  1I6H H;  3DM3 A;  2HT1 A;  2VY3 A;  3CCS A;  4OO1 G;  3L7Z C;  4JV5 Q;  4B3R L;  4NXM L;  2R7D A;  1A62 A;  1TWG H;  4JBJ A;  4X66 Q;  1IBM L;  4YWM A;  2VQE L;  5FLX c;  2YTV A;  4JV5 L;  3RN5 A;  4X66 L;  3J81 c;  3CME A;  4MZ9 A;  3E9H A;  3PUY A;  4A3G H;  1VQ8 A;  2F4V Q;  2VW9 A;  4B3S Q;  2RHQ B;  1IBL Q;  2JA7 H;  1HJP A;  1C7Y A;  1GO3 E;  4A3I G;  2F4V L;  4R1J A;  2BA0 A;  2VQF Q;  5HGQ A;  3ULP A;  1EQQ A;  1IBL L;  1VQA A;  2EQS A;  2I5M X;  4LWC A;  1MIU A;  1VQB A;  4P73 A;  4X64 Q;  2K5V A;  2QA4 A;  4JBW A;  3PUX A;  2VQF L;  3HOY G;  4GNX A;  1K73 C;  3EN2 A;  4X64 L;  2I0Q A;  3GTM H;  4DV0 Q;  3TRE A;  3PGZ A;  3HOU H;  1G29 1;  3S2H H;  3RR5 A;  1OXT A;  2XGT A;  3KF6 B;  1X3F A;  1WCM G;  5IP9 G;  4DV0 L;  3E0E A;  4OWT B;  2F52 A;  1WJJ A;  2ZTC A;  1QUQ B;  2UUB Q;  2YYZ A;  4LFC Q;  2N8N A;  1JT8 A;  1X3E A;  4PZ8 A;  4JI2 L;  1VQG A;  4P75 A;  4X65 Q;  3CCM A;  3HOV H;  4LFC L;  1K0R A;  1OXU A;  3EBE A;  4KHZ A;  2VUM H;  1NBW A;  2BH2 A;  1SRO A;  2L15 A;  3F2C A;  4A3F G;  4X65 L;  4DV3 Q;  4DR5 Q;  4Y52 H;  2JJQ A;  1S3O A;  3NEL A;  1LUZ A;  3FP9 A;  1S40 A;  2RF4 A;  2JA9 A;  4AQY Q;  5JJL A;  2OTJ A;  4JBK A;  4GLX A;  1Q81 C;  3RLN A;  4LF9 L;  2E5L L;  3K80 C;  4BBR G;  1B70 B;  4QY7 A;  1CKN A;  3J81 j;  4KI0 A;  4A3C H;  1A63 A;  2R92 H;  3CD6 A;  2Q2U A;  3U50 C;  3RNU A;  3S2D H;  1HZC A;  1CSQ A;  1I3Q H;  4YCU A;  4LFA L;  1WOC A;  1WYD A;  4NB3 A;  2KCM A;  2JA8 H;  4L5R C;  2OQK A;  3CC7 A;  4DR7 Q;  4DR2 Q;  4A3D G;  1X56 A;  1EIF A;  1XPU A;  1LM0 A;  2CKZ B;  1YJW A;  3CXC A;  4DR2 L;  3I4N G;  1TWC H;  1UEB A;  2VZA A;  5LMN W;  4DV6 L;  1N8R C;  2DUD A;  4L5Q A;  4R4T A;  5IYC G;  3ICE A;  3I2Z A;  4BY1 G;  3UDG A;  1TWF H;  2NVT H;  2VL6 A;  2OCE A;  1KL9 A;  5HY6 A;  1MJE A;  4IFD G;  4XIG S;  4UPA A;  1AH9 A;  2K75 A;  4R4O A;  1Z9F A;  4A3J H;  3HOX H;  5C4X G;  1E3P A;  3HKS A;  4YCV A;  2D62 A;  3BZC A;  1PFS A;  2JEB I;  5IWA L;  2ZJP A;  3J7Z C;  3UDI A;  1BVS A;  2C35 B;  4OXP A;  2D0O A;  3M4O H;  3AQQ A;  1EIY B;  4JI3 L;  3T1Y Q;  4QL5 A;  4LUZ A;  3K0X A;  3T1Y L;  1Q1B A;  4LF4 L;  4GLA C;  1W2B A;  2KHI A;  5M3M G;  4Y7N H;  4NXN Q;  2WB1 G;  5JEA G;  1QVG A;  4DK6 C;  2IT1 A;  3RLF A;  1QUQ A;  4NPS A;  4A3E H;  3I4M G;  1L1O B;  1OXS C;  5M3F H;  4YWL A;  2E8G A;  4B3M Q;  4DR3 Q;  4A3B G;  5C4J H;  1FVI A;  1GKH A;  1UE5 A;  1YHB A;  3G48 A;  4GN5 A;  1PH2 A;  5JJI A;  1PA6 A;  1XMQ Q;  3HOW H;  4FDB A;  3GTK H;  2VS1 A;  4DR3 L;  1YHQ A;  4B3M L;  3FKI H;  4H02 A;  4IOA A;  3W1G A;  2NN6 G;  3ULL A;  2UXB Q;  2ASB A;  3HOZ H;  4PMW A;  3KJP A;  1I94 Q;  2RCN A;  4A3K G;  1JMC A;  2HHH Q;  3GTJ H;  1L0W A;  3RZO H;  5GAE C;  1NE3 A;  2PQA A;  4APV A;  3K81 C;  1K8G A;  1I94 L;  3IRB A;  2UU9 L;  1KD1 C;  4OON A;  5DLQ E;  1Y1W G;  1J5E Q;  4A3L H;  2CFM A;  1YVC A;  2B3G A;  1VQ4 A;  2LXK A;  4HIM A;  2JA5 G;  3STB D;  1J5E L;  2ZTD A;  1VQ6 A;  3A5U A;  5C0X G;  3F2D A;  3BU2 A;  3G4S A;  5IP7 G;  4EX5 A;  2UU9 Q;  4LF6 Q;  4HID A;  1IBK Q;  2CWA A;  5M5Y H;  1HR0 L;  1P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...