4DK3C

Structure of editosome protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
83
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDKEFIVIRCMDQVKLGSRVLVQGTLRMNRHVDDSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 10
structure length 83
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk3C00
1YHAA 4DV6Q 4GKJL 4P72A 2IY5B 3PSIA 3STBC 1C9OA 3K7UC 3GTKH 3M4OH 1C0AA 1JJGA 3U4ZA 3RN2A 1JT8A 4R4CA 1QVCA 4JI3L 4DV7L 1X54A 1D7QA 2N3SA 1X3EA 1CKNA 1YI2A 4GLXA 1VQCA 2WAQG 4IFDJ 3GTMH 5IP9G 3ULJA 3CP0A 2BA0A 3U58A 4NB3A 3HFZB 3GDEA 3GTGH 4BBSH 4DAMA 5C3EG 1VQLA 2ZTDA 1Q81C 4A3JG 2CKZB 4R1JA 4DR5Q 1M1KC 2AKWB 3F1ZA 3CCJA 3H3VI 1JE5A 1C7YA 1I50H 4JI5Q 1ASYA 1CSPA 1HH2P 1IBLQ 4P75A 3KFUA 4LF4L 4DV1Q 5FJ8G 2YU9H 1SFOH 3CD6A 1WCMG 1LYLA 2RHSB 3FHWA 3KF6A 3VDYA 3S1MH 4BA1I 2UUCQ 3RZOH 4DR4L 4JV5Q 3AYHB 3RNUA 2RF4A 3FP9A 1YZ6A 1IXRA 3RZDH 3KOJA 4DUYQ 1HNZQ 5JJKA 2B3GA 4GKKQ 1K8GA 4DV1L 1FL0A 1A62A 4RG1A 4J15A 1PH8A 4YY3Q 1KXLA 4Y52H 1IBMQ 3CW2C 3J81c 4JV5L 1KIXA 5AJ3L 4MNOA 2VQEL 2K75A 3STBD 3OTOL 3CCSA 1NMFA 4DR7Q 4C3JH 4UPAA 1XNRQ 2HIXA 1X6OA 1Q82C 1MJEA 2MO1A 4JI0Q 4GKKL 3KJOA 4Y7NH 2JA5H 1VQ6A 1VQ7A 2WP8J 4QL5A 3H3VH 4GLVB 4YY3L 1X3GA 1IBML 3CMEA 4LUZA 1P16A 4YWMA 1XMOL 2R7ZH 4A3BH 4C3IH 4GN5A 4B3TQ 4EQ5A 4A3DH 4A3CH 2AWNA 2A19A 4DR7L 3KYHC 1X56A 3HOZG 5FLMH 2Q2TA 1XNRL 3F8TA 4BBRG 4JOIA 4XIGS 4JI0L 4X62Q 5IYBG 3E9HA 4LF8L 4A3LH 3ULLA 3PUVA 4PZ8A 1YBYA 4JCVE 1BBWA 4QY7A 4POFA 4JI1Q 4LF6L 1JJ2A 2WFWA 3J81i 4X64Q 1B7YB 2K4KA 1KRSA 4OWXB 2ZTEA 3NBHB 4O2DA 3RLFA 4AQYQ 1HNWQ 2UXCQ 1UE6A 1CSQA 1UE5A 2I0QA 2UUAQ 4MTNA 1YJ9A 4X62L 1J5EQ 1HJPA 1N8RC 4B3RQ 3K7AH 5IWAL 1EUJA 4A75A 4LF5L 2PNHA 1G291 2XGTA 4DV2Q 4PG3A 3U50C 3WWVA 2D0PA 2JA6G 1T9HA 1K3RA 4L5RC 3Q8DA 4X64L 2UXCL 1I6HH 1G6PA 4AQYL 1BVSA 3GD7A 1IL2A 3I4MH 4GOPB 1EOVA 1GO3E 2DGYA 4POGA 4R4QA 2UUAL 2ALYB 3J80i 5ELOA 4TVAB 1P8LA 2NZHA 1J5EL 1SR3A 3HOXH 1VQFA 2E5LQ 4OX9L 3I4NH 3BZKA 3CCMA 4DV2L 3S16H 1Y1VH 3PO2H 1IYJB 3RR5A 5C4XH 1B8AA 2CWAA 3T1YL 4A3KH 3M9BA 1QUQB 1SROA 1K0RA 1FVIA 1Y1WG 5GAGC 2UUBL 1I94Q 3UDXA 1EQRA 4RMFA 4DUZQ 4OO1I 1QZHA 3H0GG 3NENA 2QA4A 1HZBA 4NXMQ 1N32Q 5IY0A 1K73C 3FKIH 2PQAB 4DV4Q 3JAMc 5M3FG 1R9TH 2GN5A 1VQ5A 1GKHA 1VQEA 2JK8A 1SLJA 2GVBA 2WAQE 4DK6C 4EX5A 4DUZL 1XJVA 2R7DA 2R7ZG 3S14H 4A3DG 2KHJA 2OTJA 1V9PA 1KD1C 3GTLH 4DR3Q 4HJ5A 3G71A 2Q2HA 4LF7L 1N32L 5FLMG 4DV4L 3CMAA 4A3LG 2PI2A 2D62A 2JA8H 2V1CC 3E0EA 3I55A 1OXUA 4ME3A 4BY1H 4NXNQ 3KJPA 2E5LL 3K8AA 5IE8A 4H02A 1NBWA 4APVA 4JI2L 4JBKA 4GS3A 3W1GA 3J81j 3ICEA 3KDFB 3AFPA 4A3EG 4YCWA 3NEMA 2VUMG 5M3MH 4BXXH 4QIWE 1TWAH 2FXQA 2EIFA 3PUWA 3JAMi 1GM5A 4JBMA 3T1HQ 1L1OC 1OXXK 5GAHC 4LNQA 4NXNL 5GROA 4DV6L 4HJAA 4LF9Q 1Q1EA 5M5YH 2H5XA 5IYCG 4IFDG 3GTQH 2KBNA 2UXBQ 3HOYH 4WJ3M 5DLQE 1VQDA 1NTGA 2LXKA 5C0XG 3D31A 1HZAA 1N34Q 5IT9c 2ZJQA 2A8VA 4DV0Q 3T1HL 3I4OA 2ES2A 3PF5A 1BKBA 4KLKA 4A3FG 4A3GG 1AE3A 2B63H 3K81C 2PMZE 2E2IH 3PO2G 4R4IA 3SGIA 4AYBE 1EFWA 2UU9Q 2UXBL 4A3KG 4X6AH 3MXNB 1GVPA 4JYAQ 1E1TA 3S24A 5HGQA 1EWIA 3HOVH 4GN3B 1N34L 4LFAQ 1E7ZA 1E3PA 2VY3A 5LMNQ 3TEHB 3BU2A 4JG2A 1D8LA 4DR5L 2JA7G 5LMUQ 4OONA 4JI5L 3CC2A 1K8AC 1E22A 1IBLL 3PO3G 1XNQQ 2BA1A 2PQAA 3M4PA 1YJWA 2UU9L 2LSSA 1SMXA 4UP9A 2R7FA 4TQUS 3S1NH 2UUCL 4GNXA 2N78A 4LFAL 5LMNL 1Q8KA 1E24A 4A93G 4BY7G 1YNXA 2NN6I 3CCRA 4A3IG 1O7IA 2WB1E 4DUYL 1HNZL 1VQJA 1WJJA 3I7FA 4QJFA 2HQLA 1Y14B 4A3MH 1PH3A 1LM0A 4GN4B 2VL6A 4AYBG 5JJLA 1FJGQ 4JBWA 1V1QA 4PMWA 5J3BA 3HKSA 2OTLA 2EQSA 3HKZE 2UXDQ 3PV0A 4DR6Q 1HR0Q 1VQOA 2QGQA 1WYDA 1XPRA 4PZ6A 3M7NA 1SN8A 3CAMA 1I3QH 3UE1A 4DR4Q 4LUVA 3BZCA 2L15A 5IYDH 2R92H 4X66Q 1VQ4A 3EIVA 5GAEC 3HOWH 1CKMA 2N8NA 2AHOB 1V43A 3EN2A 3GTJH 2K14A 4O0AA 3LGJA 4FDBA 2VW9A 3G4SA 1UWVA 4AH6A 1HR0L 4B3TL 1PH2A 2MFIA 2CFMA 1WI5A 4IPHA 5C44H 1M90C 2WB1G 1VQNA 3HOUH 2DUDA 4YCUA 5C0XI 3PF4A 2LXJA 2RCNA 1W2BA 1KC8C 4X66L 4HIOA 4JI8Q 1X9NA 4BBSG 2CWPA 2JQOA 1Q7YC 4JI1L 3AQQA 4P73A 3W1BA 2MNAA 4KHPQ 1VQHA 3HKZG 4DV3Q 1N36Q 3DLLA 1HNWL 3CPFA 1VQMA 1OXVA 1E1OA 5H1SE 4LWCA 5BR8Q 3CCEA 1PH1A 3PCOB 5GQOA 3F2BA 5JEAJ 4DPGA 3M4QA 2HHHQ 2MO0A 4X65Q 4B3RL 1A0IA 1MKHA 4R4OA 1K83H 1VQ8A 5ELNA 1KHIA 1PYSB 4UP8A 2YTYA 2Z6KA 3G48A 4DV3L 4YHHQ 4KHZA 1UE7A 3OYYA 1FGUA 1HZCA 2I5HA 2C35B 1JJCB 4IPCA 3CCUA 1NJIC 1PH9A 1IZ6A 1CUKA 5BR8L 3M85A 1YITA 3CCLA 4DK3C 2HHHL 3GTPH 2MQHA 5IP9H 4X65L 1YEZA 1Q46A 4A4IA 1VQIA 1KAWA 3H15A 3K0XA 4GNXC 5K36G 1EIFA 2K5NA 2N49A 3A5ZB 4P71A 1Q86C 1PFSA 4YHHL 4A3JH 1CKOA 1TWCH 3CC7A 3TQYA 2CCZA 1VS0A 1XPOA 1VQPA 2IHEA 4YWLA 3L2PA 2JA9A 1U0LA 1I94L 4P74A 4PZ7A 2JA5G 5JJIA 2OQKA 1A63A 5FJ8H 1OXSC 4HIKA 2E2JH 2JEAI 4DKAC 1WCMH 4A3BG 4A3CG 3A0JA 1L0WA 4NXML 3K80C 4JBJA 2F52A 3KF6B 2E8GA 1JB7A 2JJQA 1S40A 1NE3A 2NVYH 4JOIC 1S3OA 3MEFA 4A76A 1EQQA 2GVAA 2ZJRA 2ZJPA 2CQOA 2Q2UA 4DR3L 3W5OA 4L5SA 2QEXA 3UDGA 4L5QA 1XMQQ 1TXYA 2YTXA 2YV5A 2Z0SA 3ER0A 2F3IA 3NELA 2IHFA 3J7ZC 1Z9FA 1U5KA 3PUYA 2VS1A 4R4TA 1MIUA 4OXPA 2IT1A 1VQKA 2XTIA 5FLXc 3I2ZA 1LTLA 3I4MG 4GOPA 2ID0A 4DR1Q 3S15H 3EBEA 1XMQL 1EYGA 2YTVA 1JMCA 3CXCA 3HOXG 3HOZH 4LF9L 2OCEA 4BBRH 3I4NG 1RL2A 2K5VA 5IYBH 1Y1VG 3A5UA 4LFBQ 2Z6KC 3PUZA 5C4XG 1X3FA 1QUQA 3ULPA 4UY8C 2I5LX 2ZM6Q 4DR1L 4LFCQ 3S1QH 2ASBA 1PVOA 5IP7H 2A1AA 1KL9A 3F2DA 4DV0L 1PV4A 4LF4Q 5E7NA 3PGZA 3I56A 3M3YH 3PIOA 2KCTA 3KLWA 4YWKA 5C0XJ 1L1OB 4LFBL 1EIYB 2KCMA 3FKIG 1PH5A 1G51A 1KRTA 3CQZH 1PH4A 1S72A 4K0KQ 2PI2E 2JA6H 2Y0SE 2ZM6L 4JYAL 4LFCL 2K52A 4XTCS 1VQ9A 2K50A 4GLAC 2ATWA 4JC0A 2I5MX 5LMUL 1B70B 1HNXQ 5M5WH 4WJ4A 2RHQB 4JI4Q 3UDIA 1XNQL 1L2FA 5GADC 3ZJYC 1YJNA 5AJ3Q 3CCQA 4B3SQ 2VQEQ 2JA8G 4K0KL 3OTOQ 2B29A 5LMNW 1YHQA 4BY1G 2AWOA 2D0OA 1HZ9A 1DGSA 1Z47A 3UDFA 1W3SA 3AFQA 4L5TA 5HY6A 2NVQH 2AMCB 1Y1WH 1BBUA 1IBKQ 1HNXL 3KDFA 3CF5A 4IPDA 3ERSX 2E2HH 3RN5A 4HIDA 4B3MQ 4JI4L 5M3MG 1WFQA 3H0GH 2JE6I 1XMOQ 1OXTA 1PYBA 1FJGL 4BXXG 2BH2A 4B3SL 4OO1G 1VQBA 3IRBA 4MZ9A 1KQSA 1N33Q 2VZAA 2Y0SG 2UXDL 2R93H 4DR6L 1YVCA 4IFDI 3RLOA 5M3FH 2ZTCA 4QGUA 1IBKL 4LF8Q 4DR2Q 1LUZA 2IX0A 3BJUA 2KENA 1AH9A 4LF6Q 3HOYG 3TREA 1TWGH 4GOPC 4B3ML 4JI6Q 1YHBA 3GTOH 2JEBI 1HR0W 4HJ9A 1PH6A 4YCVA 1N33L 2BH8A 1A8VA 1Q12A 4IJLA 4IPGA 3J80c 3CC4A 1X55A 1QZGA 2VNUD 1J6QA 4UP7A 4DR2L 2NVXH 2B63G 1PHJA 5IWAQ 2R6GA 3L7ZC 4LF5Q 1TWHH 1NMGA 1UE1A 4AIMA 4DAYB 5JEAG 4JI8L 2VQFQ 3GO5A 1OTCA 4JI6L 2F4VQ 3HOVG 4A3EH 2VUMH 5IP7G 4DNIA 4JI7Q 1Q1BA 3B6YA 4KHPL 1N36L 3S2DH 2EXDA 2HIVA 2HT1A 5M5XH 5EAYA 3PUXA 3UE0A 3KF8B 1L1OA 4OWTB 4IO9A 1CKNB 1PA6A 4OX9Q 4QQBX 1I5FA 1X65A 2VQFL 3E9IA 5IYCH 1XTDA 4LW1A 1K9MC 2F4VL 4IOAA 3T1YQ 4IOCA 4JI7L 3S17H 3OW2A 4KI0A 5C3EH 3RLNA 2UUBQ 4A3MG 2KHIA 1SE8A 4A3FH 4BA2I 4A3GH 4HJ7A 4ALPA 3F2CA 1YIJA 2OWOA 3TRZA 1H95A 1PH7A 1VQGA 1NY4A 3AEVA 2IX1A 2OQ0A 1UEBA 3S2HH 1QVFA 3JC66 1SRUA 3PIPA 1AE2A 1N9WA 4DV5Q 3CCVA 5IYDG 2JA7H 2R92G 1RIPA 2NVTH 3HOWG 4LUOA 3CPWA 3J7A5 2YYZA 3DM3A 1VQAA 3PO3H 4C3HH 3TS0A 4LF7Q 2R93G 1ASZA 5C4JH 4OWWB 1MJCA 3D0FA 5C44G 3S1RH 1WOCA 4GNXB 3HOUG 4NPSA 4GKJQ 4DV5L 4A93H 3L0OA 2K5HA 4BY7H 4JI2Q 4A3IH 1TWFH 1XPUA 2Q2IA 3TS2A 4C2MH 2NN6G 4IJHA 1VCIA 3A74A 2NZOA 3G6EA 3U4VA 4DV7Q 4JI3Q 4HIMA 1GD7A 1QVGA 4HJ8A
chains in the Genus database with same CATH superfamily
5AFWA 1RDPD 3E3XA 4P72A 3OHXC 2JN4A 3PSIA 3STBC 2F0EA 3BVZA 2SNSA 3GTKH 5E4WC 5COYA 3RN2A 1NR4A 4R4CA 1QVCA 2JP1A 1X3EA 1Q8IA 2XIWA 2OXPA 1HRJA 4IUPA 1DJRD 5EGTA 3HFZB 3GDEA 1AEXA 2CKZB 4R1JA 3VR5A 4DR5Q 3F1ZA 4C56C 4FF2A 1SYCA 1HH2P 2F0OA 4LF4L 1DZ1A 3TDQA 3A7AB 2YU9H 4DXFA 1U4MA 5LL6X 4BA1I 4FXKC 3DWAA 2RF4A 1IXRA 3RZDH 3FKIB 1TWCB 2B3GA 3TZDA 1K8GA 4RG1A 2A5HA 5IGFA 3OWEB 4Y52H 3J81c 5DAUA 5K36H 2E2JB 4QF4A 2VQEL 1S5ED 3OTOL 1NMFA 2X6LA 2NVYB 1MJEA 4G7HC 4G7OC 2J7ZA 4Y7NH 1KDCA 1X3GA 3CMEA 4A3DH 4C3IH 3BYYB 4EQ5A 3BDLA 2AWNA 2A19A 1X56A 3HOZG 4BBRG 3R3OA 1NAPA 2LS01 5G3LF 4LF8L 1EY5A 3ULLA 1S5FD 4QY7A 1ENFA 5G3LD 3Q22A 3O13A 4X64Q 1B7YB 2K4KA 5KEEA 1UE6A 2XWJB 2I0QA 4MTNA 4K2KA 1SE4A 1U9RA 2E75C 3K7AH 4LF5L 2B2WA 2XGTA 5I2YA 3S14H 2JA6G 2D0PA 4RWSC 5JVH3 1K3RA 2K5WA 3Q8DA 4X64L 3GD7A 1IL2A 1B3AA 1D5MC 1JB3A 1EOVA 1GO3E 3MXUA 2E5LQ 4OX9L 2A68C 2G5DA 4KY6A 3PO2H 1IYJB 2A69D 3QB3A 3RR5A 4XQNA 2CWAA 2XSCA 1YNNC 2UUBL 3UDXA 2A6HC 4DUZQ 4OO1I 1J8IA 4N9TA 3FMCA 5EKKA 3NENA 5ELBA 2L4NA 2EXZA 3FKIH 1R9TH 4DK6C 1XJVA 4DUZL 3MZ5A 4H44C 1Y1WB 3I70A 2K33A 1EWCA 4DR3Q 3G71A 2AQ1B 1ICWA 2PI2A 3I55A 2R93B 4H02A 1ZEQX 1GUSA 5M3FB 2F0DA 1R4PB 3T13A 4PMCA 4QIWE 4OO1H 1TWAH 3URYA 1X32A 3JAMi 1GM5A 4LNQA 4DV6L 1Q1EA 4QB4A 2KBNA 1STAA 4WJ3M 3JAME 1TS5A 2LXKA 5C0XG 3D31A 1JORA 4DF7A 1HQMC 2ZJQA 2A8VA 5J1ZA 1SNQA 3S2DB 1AE3A 4AYBE 1GVPA 1EL0A 1E1TA 3A8IE 5HGQA 1EWIA 2QILA 3HOVH 3DMUA 3BU2A 4JG2A 2JA7G 2K6AA 2M2LA 4OONA 5C3EB 3CC2A 1K8AC 2NWGA 2BA1A 1JOOA 1A15A 3NWTA 4G4KA 4BY7G 5C5MA 1YNXA 3OSOA 1HNZL 2WB1E 4QIWB 1VQJA 4QJFA 4GN4B 5CV4A 2XWBB 4PMWA 2EVBA 3HKZE 1VQOA 1W6JA 1WYDA 1PTOB 4K2LA 3M7NA 1IKLA 3UE1A 1RHPA 4A93B 2L15A 3TSSA 4X66Q 3EIVA 1CKMA 2D2CC 3NTHA 4AH6A 4AYBB 4B3TL 5D65A 1SYGA 2CFMA 1M90C 3HOUH 5FK9C 2DUDA 1KC8C 4X66L 2A74C 4HIOA 4N9PA 1LT5D 1Q7YC 3AQQA 3BG3A 2MNAA 2RDFA 1FR3A 1E1OA 3MEHA 1D5ZC 3GQBA 4FVMA 2FMMA 3M4QA 2MO0A 3GTMB 1LTSD 4B3RL 2WB1B 1MKHA 2XNAC 4R4OA 3VYSA 3C2PA 3P1HA 2BE5C 3FPUB 1SEBD 2WKCA 3OYYA 1FGUA 1EU4A 4KD4A 2I5HA 2C35B 1UAPA 3HKZB 3HGBA 2AUJD 3CCLA 3GTPH 1YEZA 4A4IA 1VQIA 5K36G 2K32A 1SFOB 2K5NA 3OW7A 4IURA 1PFSA 3HEJA 3CC7A 1TT2A 1VQPA 4FF1A 2IHEA 4YWLA 3K59A 1SE2A 2JEAI 4HIKA 4C3IG 3FVQA 1TU2B 3A0JA 4JBJA 4QMGA 1BR9A 1CQVA 1HUMA 1LT6D 2B2UC 1TS2A 2L1BA 1JB7A 2KUMA 4JOIC 1S3OA 4C3JB 5DEHA 1XYIA 2ZJRA 2CQOA 2NUCA 2R7ZB 3MXGA 3UDGA 1XMQQ 1TXYA 2YV5A 4MN3A 1G2SA 1Z9FA 2V4DA 1K0SA 2PZTA 4OXPA 5IT9L 2HCIA 1VQKA 2XTIA 4GOPA 3QOLA 1Q90A 4K5VA 1XMQL 4LAAA 5I4DA 3NHHA 1CHQD 3ZYYX 4PV1C 1B44D 1I4PA 1QILA 4FNFA 1QUQA 2MJ8A 2I5LX 2ZM6Q 4DV0L 4CDCC 4ZK9B 5E7NA 1K8OA 1QOHA 4WRDA 4YWKA 3FKIG 1G51A 1PH4A 1S72A 1EFID 4JYAL 2ZM6L 2EYPA 4ABNA 3D8GA 2F3VA 2I5MX 4KV6A 5LMUL 1HNXQ 4DGZA 1PRTB 1S5CD 4WJ4A 1L2FA 4IUVA 3CCQA 4B3SQ 5LMNW 1YHQA 1TY0A 2AWOA 2F3WA 4NDXA 1Z47A 3AFQA 4B08A 3CU7A 1B53A 4HAEA 1HNXL 3KDFA 2E2HH 2D5DA 4A3IB 2F0WA 1XMOQ 4OO1G 1PYBA 1FJGL 4B3SL 3GP7A 2DN8A 2Y0SG 3SHLA 3FPPA 1II3A 1YVCA 4CDFC 2UXDL 1UNSA 2IX0A 1AH9A 2K03A 1Z7TA 1LTTD 2CW0C 1HR0W 3K5OA 4HJ9A 1PH6A 3D6WA 1A8VA 1PZKD 2RA4A 1QZGA 2ZT9C 1VMPA 5IWAQ 2R6GA 3VA5A 1TWHH 4HSVA 3TP6A 2VQFQ 4JI8L 2F4VQ 3HOVG 4A3EH 4HR7B 2VUMH 4JI7Q 3B6YA 4KHPL 2HIVA 2EOTA 2EY6A 5EAYA 3UE0A 3KF8B 4OWTB 2MP1A 2WINB 1CKNB 3U9SA 1FD7D 1X65A 2VQFL 2B63B 5IYCH 2E2IB 2F4VL 5EBDA 4JI7L 3S1MB 2HCCA 4KI0A 4CKBA 2KHSA 3HP3A 4N8FA 3W2DA 2IPKD 2Z4IA 2HQEA 5JJZA 1YIJA 2OWOA 2OT2A 1PH7A 3C3LA 5A2QL 1NY4A 3AEVA 2OQ0A 3LWUA 1SRUA 4U673 2PCFB 3NE5B 4FYDA 2PNRC 1JWUD 4LUOA 4RA8A 3T51B 3J7A5 4ZUIA 4JK1C 2YYZA 3TS0A 2R93G 5C4JH 3ND8A 4OWWB 1KLGD 3S1RH 3E5SA 4ULLA 2B2TC 4GNXB 3HOUG 3J7AV 2K5HA 5FLXL 4A3IH 1TWFH 3NK9A 2Q2IA 3TS2A 4C2MH 3BDOA 4HSPA 4IJHA 2R92B 4RKBA 1MSHA 2DNCA 2NZOA 3A74A 4DV7Q 1F2LA 3D6CA 1QVGA 4KJOA 2TSSA 4EVOA 1YHAA 3VYRA 2RDGA 5IOCA 2B8GA 3M4OH 1JJGA 1M8AA 3U4ZA 1JT8A 3VYUA 4DV7L 4YIJA 5ELCA 5A2QE 5JPNC 2FJ2A 1DOMA 3M7GA 5TSSA 4FF4A 3ULJA 3CP0A 2BA0A 3TMEA 3SEBA 3S9WA 5C3EG 1M1KC 1SNPA 1X3PA 1F9PA 3NTKA 1C7YA 1I50H 4JI5Q 1ASYA 2K1BA 1IBLQ 5FLXE 3VDYA 1PTOC 3S1MH 1Y8NB 4JV5Q 5DM63 4H7BA 1GHJA 3RNUA 3FP9A 4FP5D 4A3JB 4WORA 1SBBB 4GKKQ 1JOKA 4FO2A 4JV5L 3HRZC 2F0GA 3DWQA 1WCMB 4MNOA 3STBD 1STNA 2RQXA 4DR7Q 4UPAA 5FO9B 1UEAB 1Q82C 3OOCA 3I91A 4GKKL 4V0BA 1VQ6A 3IFDA 5KYLA 1FYCA 1WTRA 5CV6A 4LUZA 4YWMA 1H9JA 4A3BH 4GN5A 4A3CH 3SR1A 2DY7A 4DR7L 2LMCB 4RCOA 4K6DA 2Q2TA 4JOIA 4X62Q 2NZ1D 4KKTA 2LKVA 3PUVA 4PZ8A 1XTCD 4JCVE 5CC4A 4JI1Q 1DM0B 4LF6L 1ZXTA 2WFWA 1PMRA 2EYHA 1HNWQ 2ZTEA 3RLFA 4CBVA 3KLSX 2K28A 1UE5A 1EQVA 2UUAQ 3S15B 4MTKA 4X62L 5IGGA 1EUJA 4LJZC 1EZ8A 2PPBC 3U50C 1BVSA 1CZGA 4IN3A 1CK1A 2L55A 2DGYA 4POGA 4R4QA 2UUAL 3S1QB 1SR3A 3HOXH 1JR0D 3I4NH 3Q0AA 3M3YB 3BZKA 1NR2A 4ZKCB 1BCPB 3S16H 1B8AA 1EY9A 3T1YL 3M9BA 3CQZB 1JWMD 3FEWX 4R8IA 3H3VC 1I94Q 1EQRA 2QKIC 1HTLD 3DXJC 1QZHA 5M5WB 2KEEA 3VA7A 4NXMQ 1EYCA 2PQAB 4DV4Q 1WTPA 4DK1A 1FGBD 1VQEA 2X6GA 2L0CA 2GVBA 4EX5A 2NVQB 2BDNA 1NNXA 1I3QB 2R7ZG 2OEOA 1KD1C 1IW7C 2O4XA 2R61A 3GTLH 3QJYA 2EJMA 1F2YA 3H0GB 4DV4L 2KEDA 4A3LG 2JA8H 1MI2A 3E0EA 1V1OA 5IGBA 1OXUA 3KJPA 3X3MA 3K8AA 4JI2L 3W1GA 3J81j 4ZUJA 4A3EG 4KTAA 2VUMG 1DCZA 4R9WA 2EYOA 3V2TA 1LTAD 1CFMA 2EIFA 2FXQA 3PUWA 4JBMA 1VQNA 5GAHC 5C3WA 1GHKA 3BZDB 2A68D 2K7VA 1TVXA 5IYCG 2FHTA 1JOQA 2EYLA 2EY1A 2XRSD 1YNND 4TKOB 1RTNA 1HZAA 1N34Q 2A6HD 4KN7C 5IT9c 4ZLTF 3PF5A 1BKBA 5IGEA 5M5XB 4KN4C 4F87A 1GUWA 2F1MA 5JEAH 1PFNA 3S24A 3CRKC 1PZID 4LFAQ 1N34L 1E3PA 1EWHA 2J4XA 2K01A 4DR5L 2B2VC 2RSOA 3X3NA 1XNQQ 1D1IA 3M4PA 1SMXA 4A3GB 1C48A 3P7JA 3K6OA 4LFAL 1Q8KA 1XXGA 3CCRA 4A3IG 1O7IA 2HQLA 5CORA 3SK4A 1LM0A 2NVTB 2VL6A 1RTOA 4L6TB 3HKSA 2OTLA 4C3HB 1K8MA 1STGA 3PV0A 5E4XA 2J0TD 2QGQA 3NQIA 2RDHA 1TS3A 3ND9A 1XPRA 5I2XA 1EU3A 3CAMA 1I3QH 1V8QA 1BF4A 1D1KA 4DR4Q 1ZYRC 3D4DA 2N8NA 3M4YA 4KY7A 4FDBA 1GJXA 1ENCA 1E2WA 4NKLA 1QCBD 1PH2A 3EROA 4DNTB 1WI5A 4IPHA 4DR4L 3PF4A 3MVVA 4LMQD 3QO2A 3A55A 1VDZA 5EPLA 2CWPA 1F77A 5BN5A 1Y8PB 4DV3Q 3DLLA 5T1GA 1VQMA 1RODA 3BVGA 3TN2A 3CCEA 5JEAJ 5C3XA 1A0IA 1VQ8A 2PZWA 1KHIA 4UP8A 3G48A 4DV3L 4BBSB 1UE7A 5FOBB 3CCUA 1A2UA 2O5JC 4IUTA 1CUKA 4K14A 3M85A 3OIPA 1SMYC 4DK3C 2E5LL 5IP9H 4GNXC 3JAML 2ZXOA 4HCSA 1WTHA 1EIFA 2N49A 4P71A 3RZOB 2NYZD 1Q86C 2JYOA 2JXMB 1TWCH 3Q23A 3TQYA 2CCZA 1VS0A 3E6ZX 4HTHA 3MA2B 4P74A 3VR2A 5JJIA 1KDAA 1O80A 1OXSC 1RCVD 4KY5A 2E2JH 4A3BG 1A63A 1CT1D 4A3CG 1L0WA 1TY2A 2E8GA 1F2ZA 2JJQA 5I6WA 1S40A 2NVYH 4BS9A 1EQQA 4QUFA 2ZJPA 1G8ZD 2Q2UA 3R8BA 2JA5B 2L11A 4DR3L 4ODGA 1CQFA 2K05A 2QEXA 1LABA 4L5QA 2Z0SA 3ER0A 2F3IA 2IHFA 1U5KA 1A3VA 1MIUA 2BE5D 1AP0A 5FLXc 3IFTA 2C9OA 4KHVA 1AN8A 3HOXG 3I4NG 5IYBH 2K5VA 2Z6KC 3PUZA 4KK7A 1S5DD 1SYEA 5EQ0A 4K5WA 1I6HB 4LFCQ 1V1PB 1R4QB 2PW5A 2KCTA 4XYQA 2N88A 2KCMA 5C6AA 4A3FB 1KRTA 4K0KQ 2PI2E 5M9OA 3A7LA 1Y1VB 3V05A 1C8CA 4LFCL 5C4XB 4A3KB 4XDXA 1A2TA 4GLAC 5IODA 1PDQA 2RHQB 3GV3A 3UDIA 1Q3LA 1YJNA 2XVSA 5AJ3Q 4RAUC 4K0KL 2LFNA 2JA8G 2PZUA 2B29A 4M1UB 2D0OA 1DGSA 1JQYD 1Y1WH 5EPKA 1FNUA 1F9QA 1MSGA 4IUNA 4IPDA 1C4QA 3CRLC 4IALA 5EBCA 4HIDA 2KOLA 2NTTA 1WFQA 1OXTA 1VQBA 4IQZA 4Z9CB 2VZAA 2R93H 2A69C 1H9SA 1SNOA 4IFDI 5CBAE 5M3FH 2ZTCA 4DR2Q 4BY1B 1LUZA 2KENA 1EQTA 4JI6Q 1YHBA 1O7LA 5CR3A 2JEBI 5M3MB 3SXHA 5E1FA 1BCPC 2G9HD 4DR2L 3MFYA 1PHJA 1XX8A 3MXNA 3FDTA 5M5YB 4DAYB 5KIXA 5JEAG 1OTCA 2CH4W 4JI6L 1B1ZA 3MHBA 4DNIA 3D3RA 3GTGB 3S2DH 4QQBX 3VR4A 4IFDH 4I7ZC 2Z6BA 5C3EH 3RLNA 2A73B 3K5NA 3MC0B 1WTXA 4A3FH 4BA2I 4ALPA 3OIQA 4FXDA 1EY4A 2IX1A 3N52A 4CHTB 3IAYA 1HHVA 1QVFA 3JC66 1DD2A 1N9WA 1PYWD 1WVLA 4XT3B 2CW0D 1HPCA 2I07B 1LV9A 3CPWA 4A3MB 4LF7Q 1HA6A 1PTOH 1MJCA 3DEPA 2EJFC 1WOCA 5CV5A 2P5ZX 5EJWA 3VR3A 4A93H 1RKNA 4E6IA 1XPUA 1SDFA 1ENAA 4UAIA 2QCPX 3HOWB 3U4VA 3GTJB 3SDZA 3TZUA 2IY5B 1DOKA 5D3IB 3K5LA 3LX0A 3K7UC 5IGDA 1O7ZA 1CZWA 1C0AA 2Q8IB 1X54A 1D7QA 3KF8A 2N3SA 1CKNA 1YI2A 4GLXA 1NSNS 1VQCA 1ESFA 3I4MB 4OELB 4IFDJ 3GTMH 5IP9G 1E2VA 2K04A 2HDMA 1GXDC 3U58A 4NB3A 1DXMA 4J8QA 5IGCA 3GTGH 5ISRA 1Q81C 1K83B 3H3VI 3CCJA 4G7ZC 1KNEA 1G2TA 1CSPA 4MIUA 1SJHD 4P75A 3KFUA 4DV1Q 2A6EC 1SFOH 3CD6A 2RHSB 1LYLA 1SNMA 3FHWA 3KF6A 4BWGB 2UUCQ 1KNAA 2VB2X 4RFBA 1EYDA 1HA5A 1YZ6A 5CV7A 5JJKA 3KOJA 4DUYQ 3E0JA 3H6MA 3J81L 3AB9A 2IW3A 4DV1L 4PQXA 4C1NI 4JW0A 4YY3Q 2EJGC 3CW2C 1UUPA 1SJED 4F88A 3CCSA 4C3JH 2NTSA 1CTMA 4JI0Q 4OEMB 1G91A 2ICEC 1VQ7A 2AQ2B 4QL5A 3H3VH 3J80L 1EYAA 4YY3L 1XMOL 2R7ZH 3AU7A 3T4AC 4DFAA 1EY0A 4R8NA 4JI0L 4A3LH 1ONLA 5IYBG 1I4QA 4POFA 2ICIA 2KVMA 2E74C 4ZRZA 3J81i 3I3CA 1KRSA 2B8FA 1PTOF 3NBHB 3HOYB 3C1FA 1CSQA 2K5QA 2IJ0A 1PTOD 1YJ9A 5C4HA 1J5EQ 3J81E 1HJPA 2EYMA 3HOZB 1KLUD 5IWAL 4BBRB 4DV2Q 4PG3A 5FKAC 2HD3A 4MHEA 3I4MH 3QOJA 1S5BD 4GOPB 2ALYB 3J80i 1LTGD 1LACA 4TVAB 5ELOA 1P8LA 1J5EL 4HMJA 1SYDA 3VYTA 1SYFA 1WD1A 3CCMA 4DV2L 4O42A 3J80E 1QUQB 1SROA 1K0RA 1FVIA 1Y1WG 1SYBA 2JA6B 3S1NB 5GAGC 2Q8TA 4RMFA 4JPBW 4RKLA 2QA4A 1N32Q 5IY0A 4X3UA 3I90A 4RGTA 2WV6D 3SK6A 3JAMc 3NP8A 2GN5A 5M3FG 1GKHA 5E3FA 2JK8A 1SLJA 2O2LD 2WAQE 5C4ZA 2R7DA 3EJIA 3EQLC 2EPBA 2OTJA 1N32L 4HJ5A 2DJGC 2Q2HA 5FLMG 1HXYD 5KNCA 2D62A 2WKDA 2V1CC 4ME3A 4M8AA 1NBWA 4JBKA 1WTWA 2H1EA 3KDFB 5T1IA 4YCWA 2ZXPA 3NEMA 1TWGB 1B3QA 3MWYW 4BXXH 1VF5C 1EEID 5ELFA 1OXXK 5GROA 4LF9Q 4OIJA 1U4LA 2H5XA 4IFDG 1VMCA 2NVXB 5CYUA 2F0FA 1AZPA 3HOYH 5DLQE 1TKWB 1VQDA 2FMCA 1NTGA 1LTID 1B50A 3I4OA 1CA6A 2ES2A 4KLKA 4A3FG 1F9SA 2B63H 3K81C 2E2IH 4R4IA 1EFWA 2UU9Q 4A3KG 4X6AH 2WAQB 4EQPA 4XQQA 1E7ZA 3TEHB 3LNNA 4NW2A 3S17B 4KKUA 4JI5L 1IW7D 1IBLL 3RMHA 2PQAA 2UU9L 2CVRA 2LSSA 2Z9HA 4UP9A 2JSOA 3CHBD 3S1NH 4X3SA 3K57A 4A93G 2F03A 1RF2D 4CKCA 4ZCKA 3S2HB 2NN6I 2EE1A 1WJJA 3I7FA 1SNDA 1Y14B 4RGMA 1PH3A 2JA7B 1BNZA 4AYBG 5JJLA 3ITPA 1V1QA 5J3BA 4PNYA 1MGSA 5KNDA 1BXTA 4DR6Q 4PZ6A 1EIGA 5BN4A 2B2UA 2PYKA 3TP7A 3KLRA 4WFN3 4BY7B 2R92H 2AHOB 3TP5A 1V43A 3EN2A 2K14A 1BO0A 4O0AA 3G4SA 2VW9A 2SEBD 5JPMC 5CBEE 1PFMA 1X3QA 4DXGA 2WB1G 5C0XI 5DM73 2RCNA 4RGNA 2JQOA 1S4ZA 3QG1A 4JI1L 2NN6H 4WJWA 4K8IA 4H13C 4P73A 1VQHA 1BQQT 3HKZG 1N36Q 1HNWL 3CPFA 4I65A 1OXVA 1D6EC 1FNVA 1IL8A 5BR8Q 1PH1A 3PCOB 4DPGA 2HHHQ 1RD9D 2B2YC 5ELNA 1PYSB 1ET6A 2MGSA 2YTYA 1KTKA 4YHHQ 4KHZA 3BS1A 1ICFB 1HZCA 2E76C 5LL6S 2QDLA 4IPCA 5IIFA 3J7YW 1PH9A 1IZ6A 5BR8L 1VF7A 4TSSA 3I4LA 2HDLA 4RHSA 1YITA 1A6XA 5KRUA 2HHHL 3OMCA 3H15A 3SE0A 3A5ZB 4OL7A 4CKEA 4C3JG 1WD0A 1BDOA 1K3BC 4YHHL 1ZYRD 3RUZA 4A3JH 1CKOA 4P2CB 5NUCA 5J39A 1JCKB 1LTRD 2KQ3A 3DEOA 3L2PA 1I94L 2JA9A 1ESRA 4PMBA 5FJ8H 1WCMH 4NXML 2O5IC 3K80C 2F52A 4CGYB 2Q8RE 4EQOA 1NE3A 2AQ3B 3TP8A 3MEFA 4A76A 2WACA 4Y7NB 1QNUA 3GTOB 3W5OA 4L5SA 4A3DB 4V190 4C3IB 4X3TA 1W6KA 3J7ZC 4ZKBB 2VS1A 1HTPA 1RJTA 4R4TA 2KA7A 3CKIB 3I4MG 4C1NK 2ID0A 4DR1Q 3S15H 3RD4A 3EBEA 1PRTC 1EYGA 1SMYD 2YTVA 1JMCA 4ZAIA 1LLRD 2OCEA 1RL2A 1MHWC 1YNJC 3A5UA 3K7AB 1PXUA 3ULPA 5I6YA 1DOLA 4UY8C 3S14B 4DR1L 1IYVA 1EY6A 2EY2A 3S1QH 2F0SA 4LF4Q 1IYUA 4CJ1B 5JAVA 3M3YH 4CDDC 1EEFD 3KLWA 5C0XJ 1L1OB 3CQZH 1HCZA 2Y0SE 3PO2B 2IWHA 2K52A 4XXEA 2ATWA 1QG7A 2F0UA 2F0MA 5M5WH 2E2DC 3LWEA 2M00A 4JI4Q 1XNQL 1T5XD 5GADC 3ZJYC 2EY5A 4EGVA 2VQEQ 3L3OC 3OMGA 4JVZA 3OTOQ 3PO3B 1HZ9A 3UDFA 2NVQH 4RCNA 1A3UA 1R9TB 3IKJA 2FFKB 3CF5A 2F0QA 1T5EA 3ERSX 5CGKA 1IKMA 4B3MQ 1MBYA 4JI4L 3H0GH 4BXXG 2BH2A 3IRBA 4MZ9A 1KQSA 1EY8A 2L12A 3HZXA 1SE3A 4LF8Q 1I6VC 2B2TA 3BJUA 4L63B 3HOYG 1ET9A 3QR8A 4GOPC 4B3ML 5A35A 3GTOH 3VR6A 1B4OA 3PIP3 1I4XA 4IUUA 4YCVA 2BH8A 1Q12A 3J80c 1TWAB 3CC4A 1QNKA 2VNUD 1J6QA 2Y0SB 2B63G 1STYA 3L7ZC 3T53B 4LF5Q 1NMGA 4AIMA 3GO5A 1V1PA 3DM1A 1ML0D 5JOBA 4U68A 3I73A 4J6HA 3V96A 3Q6SA 1NUCA 3WOFA 1Q1BA 5IP7G 4KJNA 2EXDA 2HT1A 5M5XH 3BDCA 3PUXA 1I4HA 5ELDA 4OX9Q 3N6RA 1I5FA 3E9IA 1XTDA 3MFGA 1K9MC 4IOAA 3WDNA 4IOCA 1STHA 2G9DA 5EKLA 1A3TA 3HOVB 2UUBQ 1PZJD 2IL8A 2K5DA 2KHIA 1GUGA 1CHPD 4A3GH 3D4RA 4HJ7A 2QF7A 3HS0C 1KDBA 1UEBA 4LK1C 3PIPA 4DV5Q 3H94A 4Q5VA 3CCVA 3AMUA 2R92G 1RIPA 3NQTA 2NVTH 5HURA 1BCPF 3DUZA 3PO3H 1BOSA 4C3HH 1ASZA 2VXWA 1BCPD 3QIAA 5EKIA 2M9VA 2F0HA 4CDEC 4GKJQ 1E2ZA 1GUNA 2F0JA 4DV5L 3I8ZA 3L0OA 3G6JB 2NN6G 4NP5A 1VCIA 2F0NA 1GUTA 3R93A 5DNFA 4JI3Q 4B9WA 4KKSA 4HIMA 3SK8A 1EIHA 2ENBA 3KK7A 4DV6Q 4GKJL 4DAYA 2SDFA 4L8JA 4OIKA 1C9OA 1AZQA 3HOUB 1EY7A 1LT3D 2PO4A 4X3KA 1LO5D 3TBIB 4JI3L 1BBXC 3MAQA 3EA6A 5D3DA 2WAQG 3QWNA 3WOEA 4BBSH 4DAMA 2QW7A 1VQLA 2ZTDA 3K5MA 4A3JG 2AKWB 2KCNA 2RVLA 1JE5A 2F0PA 1DONA 1JWSD 2B39A 1CM9A 5KGUA 3J7AF 5KNBA 2D9UA 3A8JE 5FJ8G 1WCMG 3K0YA 3GTPB 3RZOH 3NXWA 1K28A 3AYHB 2B2YA 4I7AA 1HNZQ 1TS4A 4FXGC 3W3AA 4IZ8A 1FL0A 1A62A 4J15A 4UHVA 1PH8A 4DU9A 1KXLA 1QE6A 4ZQ3A 1IBMQ 1KIXA 3R2TA 5AJ3L 2K75A 1SNCA 1O7YA 2F0VA 2RSNA 1XNRQ 2HIXA 1X6OA 2MO1A 1OO9B 3KJOA 2JA5H 2WP8J 4S3SA 4GLVB 3H91A 5FO7B 1IBML 2BDOA 1P16A 4B3TQ 1MD2D 4KD3A 3KYHC 5FLMH 1XNRL 1FNWA 3F8TA 2EZVA 4XIGS 4DN4M 3E9HA 1YBYA 1BBWA 2ZXRA 1JJ2A 4OHJA 3GTQB 1B9NA 2UXCQ 3BVMA 4OWXB 4AQYQ 4O2DA 1Y69U 2CH4A 2A6ED 3KBGA 4QUCA 1CA5A 1H9MA 3F2UA 4HCEA 1N8RC 4B3RQ 4A75A 1ZKOA 2PNHA 1G291 3WWVA 2X69A 1I6HH 2DY8A 1T9HA 4L5RC 1G6PA 2UXCL 4DK0A 4ME5A 4G57A 5CMDA 4AQYL 1KABA 2NZHA 1BUVT 1VQFA 1HFNA 1F2MA 1H9KA 1LT4D 2GA4B 1Y1VH 5C4XH 4A3KH 3T16A 3PQIA 1HFGA 2B2VA 3H0GG 1DYQA 3SVMA 1HZBA 1SAPA 1STBA 1K73C 3C1EA 1GOZA 1QJOA 4DAPA 2L9HA 4OGQC 1VQ5A 2LY7A 4H0LC 2I46A 4A3DG 2E2HB 2KHJA 1V9PA 4LF7L 2VB3X 1ILQA 3CMAA 2Z4HA 2RKSA 4BY1H 4NXNQ 4XYOA 2DJFC 4CJ2C 5IE8A 4CJ0B 4APVA 4GS3A 5C44B 3ICEA 3NBHA 2CHBD 3AFPA 3A8KE 4RHRA 5M3MH 4Q0FA 1U4PA 1L1OC 3T1HQ 4NXNL 4HJAA 1H9SB 5BN3A 1JICA 5M5YH 2UXBQ 3GTQH 1M4VA 1TWHB 3GV6A 4HN7A 1Z6HA 4A3EB 2VUMB 1HQRD 4DV0Q 3T1HL 2EYJA 2KJXA 4A3GG 4K8JA 2PMZE 3PO2G 2UXBL 3SGIA 2KCCA 1AW7A 3ERQA 3MXNB 1JE4A 2R3ZA 4JYAQ 4K5XA 4GN3B 2VY3A 4DA2A 5LMNQ 1PLFA 1D8LA 5LMUQ 1E0BA 5EPJA 1E22A 3A56A 4N8X1 4C3HG 4F8MA 3C46A 1YJWA 2DNEA 3PO3G 2Z1CA 2R7FA 4TQUS 1NCVA 2UUCL 4GNXA 2N78A 5LMNL 4ILWA 3K58A 1E24A 3BYTB 3NSWA 2PQEA 4DUYL 4B9XA 4A3MH 1D5XC 1SXTA 5CV8A 5IT9E 1FJGQ 4JBWA 2KECA 4DNRB 1I4GA 1AFPA 2CQAA 2EQSA 2UXDQ 5C4JB 1HR0Q 1G6ZA 1SN8A 3S1RB 1PFBA 4LUVA 3BZCA 3FRPB 5IYDH 1VQ4A 5GAEC 3HOWH 1TWFB 3P20A 1SSOA 1L0YB 3KBXA 4C2MB 3GTJH 3LGJA 3G7LA 2PMZB 1WTVA 3EFXD 1UWVA 1HR0L 1B2TA 2MFIA 5C44H 3KLSA 4YCUA 2NBFA 2LXJA 4HMIA 1W2BA 4JI8Q 1X9NA 4BBSG 3M4OB 3L9AX 3W1BA 4EQNA 4KHPQ 4XQJA 2F4IA 5H1SE 1L0XB 4LWCA 3DHQA 5C5LA 5GQOA 3F2BA 1F9RA 5F2DA 4X65Q 1K83H 1I4RA 2SNMA 2Z8LA 3MXPA 2Z6KA 1IHZA 5FO8B 1JJCB 1NJIC 4RGOS 1O78A 1I50B 2MQHA 4X65L 1Q46A 1KAWA 3K0XA 4NMZA 2TMPA 2F0IA 3NWSA 2OF1A 3P75A 1TQOA 1XPOA 2N55A 2JA5G 1WTQA 1U0LA 2NB0A 4PZ7A 1QB5D 1WTOA 2OQKA 3IL8A 3NBIA 4KMUC 4DKAC 1HUNA 3OPOA 4O1NA 3U9OA 3KF6B 4FF3A 3PIO3 5J22A 1ILPA 2GVAA 2RBMA 1TIID 2C5CA 4A3BB 2MHVA 2YTXA 5I9PA 4ZYSA 3DWPA 3NELA 3PUYA 2B2WC 3MTSA 1EZ6A 2BOSA 1J9OA 2IT1A 4DAVA 3I2ZA 1LTLA 2F0TA 2AUKA 1GUOA 3CXCA 3HOZH 4LF9L 4BBRH 2MUYA 3I72A 3A54A 1Y1VG 2EYFA 2PW7A 1CI3M 5HGTA 4LFBQ 5C4XG 1X3FA 3T56B 1U4RA 2ASBA 1PVOA 5IP7H 2A1AA 1KL9A 3F2DA 1PV4A 3UI2A 3PGZA 3I56A 3PIOA 4LFBL 3HOXB 1EIYB 3I4NB 4K6LA 3S16B 2JA6H 2RCFA 4GZYC 4XTCS 3OWFA 1VQ9A 2K50A 4JC0A 1B70B 4IUQA 1B9MA 1QWYA 2F0LA 5KYIA 2QDBA 4BY1G 1W3SA 4L5TA 5HY6A 1H9RA 2AMCB 1BBUA 3KUPA 1IBKQ 3D4WA 1PRTF 3RN5A 3NTIA 5M3MG 2JE6I 1PRTD 1Y8OB 3GTLB 5CV9A 2SOBA 1N33Q 4DR6L 3RLOA 1XWEA 2JA8B 1YNJD 4QGUA 1IBKL 4LF6Q 3TREA 1TWGH 5L37A 3PMFA 2HUGA 3NUCA 3GTKB 3R2IA 3ONAB 1N33L 3EVQA 1LTBD 4IJLA 4IPGA 4J1MA 1D2BA 1X55A 2XRQD 2IX3A 4UP7A 2QEJC 2NVXH 1UE1A 1TR5A 2L5TA 5JVG3 3Q24A 3H09A 1KAAA 1N36L 5K5PA 4QCLA 4IO9A 1L1OA 1PA6A 2XN9C 4LW1A 3HG9A 2YU9B 1EOTA 3T1YQ 1JC7A 3S17H 4ID6A 5C0XH 3OW2A 5I9OA 4A3MG 1SE8A 3RZDB 4XT1B 3F2CA 2MPMA 5D14A 3TRZA 1H95A 1VQGA 2BCOA 3S2HH 1AE2A 4F7XA 4UDUC 5IYDG 2FINB 1STEA 2JA7H 3HOWG 2WIIB 3NPPA 2H4OA 3SK5A 3DM3A 1VQAA 3D0FA 5C44G 4NPSA 4RH6A 4BY7H 4JI2Q 2F0KA 4HEDA 2EDGA 4TRDA 5ELEA 3G6EA 1GD7A 5LHY1 1PH5A 4HJ8A
chains in the Genus database with same CATH topology
1YHAA 4DV6Q 4GKJL 4P72A 2IY5B 3PSIA 3STBC 1C9OA 3K7UC 3GTKH 3M4OH 1C0AA 1JJGA 3U4ZA 3RN2A 1JT8A 4R4CA 1QVCA 4JI3L 4DV7L 1X54A 1D7QA 2N3SA 1X3EA 1CKNA 1YI2A 4GLXA 1VQCA 2WAQG 4IFDJ 3GTMH 5IP9G 3ULJA 3CP0A 2BA0A 3U58A 4NB3A 3HFZB 3GDEA 3GTGH 4BBSH 4DAMA 5C3EG 1VQLA 2ZTDA 1Q81C 4A3JG 2CKZB 4R1JA 4DR5Q 1M1KC 2AKWB 3F1ZA 3CCJA 3H3VI 1JE5A 1C7YA 1I50H 4JI5Q 1ASYA 1CSPA 1HH2P 1IBLQ 4P75A 3KFUA 4LF4L 4DV1Q 5FJ8G 2YU9H 1SFOH 3CD6A 1WCMG 1LYLA 2RHSB 3FHWA 3KF6A 3VDYA 3S1MH 4BA1I 2UUCQ 3RZOH 4DR4L 4JV5Q 3AYHB 3RNUA 2RF4A 3FP9A 1YZ6A 1IXRA 3RZDH 3KOJA 4DUYQ 1HNZQ 5JJKA 2B3GA 4GKKQ 1K8GA 4DV1L 1FL0A 1A62A 4RG1A 4J15A 1PH8A 4YY3Q 1KXLA 4Y52H 1IBMQ 3CW2C 3J81c 4JV5L 1KIXA 5AJ3L 4MNOA 2VQEL 2K75A 3STBD 3OTOL 3CCSA 1NMFA 4DR7Q 4C3JH 4UPAA 1XNRQ 2HIXA 1X6OA 1Q82C 1MJEA 2MO1A 4JI0Q 4GKKL 3KJOA 4Y7NH 2JA5H 1VQ6A 1VQ7A 2WP8J 4QL5A 3H3VH 4GLVB 4YY3L 1X3GA 1IBML 3CMEA 4LUZA 1P16A 4YWMA 1XMOL 2R7ZH 4A3BH 4C3IH 4GN5A 4B3TQ 4EQ5A 4A3DH 4A3CH 2AWNA 2A19A 4DR7L 3KYHC 1X56A 3HOZG 5FLMH 2Q2TA 1XNRL 3F8TA 4BBRG 4JOIA 4XIGS 4JI0L 4X62Q 5IYBG 3E9HA 4LF8L 4A3LH 3ULLA 3PUVA 4PZ8A 1YBYA 4JCVE 1BBWA 4QY7A 4POFA 4JI1Q 4LF6L 1JJ2A 2WFWA 3J81i 4X64Q 1B7YB 2K4KA 1KRSA 4OWXB 2ZTEA 3NBHB 4O2DA 3RLFA 4AQYQ 1HNWQ 2UXCQ 1UE6A 1CSQA 1UE5A 2I0QA 2UUAQ 4MTNA 1YJ9A 4X62L 1J5EQ 1HJPA 1N8RC 4B3RQ 3K7AH 5IWAL 1EUJA 4A75A 4LF5L 2PNHA 1G291 2XGTA 4DV2Q 4PG3A 3U50C 3WWVA 2D0PA 2JA6G 1T9HA 1K3RA 4L5RC 3Q8DA 4X64L 2UXCL 1I6HH 1G6PA 4AQYL 1BVSA 3GD7A 1IL2A 3I4MH 4GOPB 1EOVA 1GO3E 2DGYA 4POGA 4R4QA 2UUAL 2ALYB 3J80i 5ELOA 4TVAB 1P8LA 2NZHA 1J5EL 1SR3A 3HOXH 1VQFA 2E5LQ 4OX9L 3I4NH 3BZKA 3CCMA 4DV2L 3S16H 1Y1VH 3PO2H 1IYJB 3RR5A 5C4XH 1B8AA 2CWAA 3T1YL 4A3KH 3M9BA 1QUQB 1SROA 1K0RA 1FVIA 1Y1WG 5GAGC 2UUBL 1I94Q 3UDXA 1EQRA 4RMFA 4DUZQ 4OO1I 1QZHA 3H0GG 3NENA 2QA4A 1HZBA 4NXMQ 1N32Q 5IY0A 1K73C 3FKIH 2PQAB 4DV4Q 3JAMc 5M3FG 1R9TH 2GN5A 1VQ5A 1GKHA 1VQEA 2JK8A 1SLJA 2GVBA 2WAQE 4DK6C 4EX5A 4DUZL 1XJVA 2R7DA 2R7ZG 3S14H 4A3DG 2KHJA 2OTJA 1V9PA 1KD1C 3GTLH 4DR3Q 4HJ5A 3G71A 2Q2HA 4LF7L 1N32L 5FLMG 4DV4L 3CMAA 4A3LG 2PI2A 2D62A 2JA8H 2V1CC 3E0EA 3I55A 1OXUA 4ME3A 4BY1H 4NXNQ 3KJPA 2E5LL 3K8AA 5IE8A 4H02A 1NBWA 4APVA 4JI2L 4JBKA 4GS3A 3W1GA 3J81j 3ICEA 3KDFB 3AFPA 4A3EG 4YCWA 3NEMA 2VUMG 5M3MH 4BXXH 4QIWE 1TWAH 2FXQA 2EIFA 3PUWA 3JAMi 1GM5A 4JBMA 3T1HQ 1L1OC 1OXXK 5GAHC 4LNQA 4NXNL 5GROA 4DV6L 4HJAA 4LF9Q 1Q1EA 5M5YH 2H5XA 5IYCG 4IFDG 3GTQH 2KBNA 2UXBQ 3HOYH 4WJ3M 5DLQE 1VQDA 1NTGA 2LXKA 5C0XG 3D31A 1HZAA 1N34Q 5IT9c 2ZJQA 2A8VA 4DV0Q 3T1HL 3I4OA 2ES2A 3PF5A 1BKBA 4KLKA 4A3FG 4A3GG 1AE3A 2B63H 3K81C 2PMZE 2E2IH 3PO2G 4R4IA 3SGIA 4AYBE 1EFWA 2UU9Q 2UXBL 4A3KG 4X6AH 3MXNB 1GVPA 4JYAQ 1E1TA 3S24A 5HGQA 1EWIA 3HOVH 4GN3B 1N34L 4LFAQ 1E7ZA 1E3PA 2VY3A 5LMNQ 3TEHB 3BU2A 4JG2A 1D8LA 4DR5L 2JA7G 5LMUQ 4OONA 4JI5L 3CC2A 1K8AC 1E22A 1IBLL 3PO3G 1XNQQ 2BA1A 2PQAA 3M4PA 1YJWA 2UU9L 2LSSA 1SMXA 4UP9A 2R7FA 4TQUS 3S1NH 2UUCL 4GNXA 2N78A 4LFAL 5LMNL 1Q8KA 1E24A 4A93G 4BY7G 1YNXA 2NN6I 3CCRA 4A3IG 1O7IA 2WB1E 4DUYL 1HNZL 1VQJA 1WJJA 3I7FA 4QJFA 2HQLA 1Y14B 4A3MH 1PH3A 1LM0A 4GN4B 2VL6A 4AYBG 5JJLA 1FJGQ 4JBWA 1V1QA 4PMWA 5J3BA 3HKSA 2OTLA 2EQSA 3HKZE 2UXDQ 3PV0A 4DR6Q 1HR0Q 1VQOA 2QGQA 1WYDA 1XPRA 4PZ6A 3M7NA 1SN8A 3CAMA 1I3QH 3UE1A 4DR4Q 4LUVA 3BZCA 2L15A 5IYDH 2R92H 4X66Q 1VQ4A 3EIVA 5GAEC 3HOWH 1CKMA 2N8NA 2AHOB 1V43A 3EN2A 3GTJH 2K14A 4O0AA 3LGJA 4FDBA 2VW9A 3G4SA 1UWVA 4AH6A 1HR0L 4B3TL 1PH2A 2MFIA 2CFMA 1WI5A 4IPHA 5C44H 1M90C 2WB1G 1VQNA 3HOUH 2DUDA 4YCUA 5C0XI 3PF4A 2LXJA 2RCNA 1W2BA 1KC8C 4X66L 4HIOA 4JI8Q 1X9NA 4BBSG 2CWPA 2JQOA 1Q7YC 4JI1L 3AQQA 4P73A 3W1BA 2MNAA 4KHPQ 1VQHA 3HKZG 4DV3Q 1N36Q 3DLLA 1HNWL 3CPFA 1VQMA 1OXVA 1E1OA 5H1SE 4LWCA 5BR8Q 3CCEA 1PH1A 3PCOB 5GQOA 3F2BA 5JEAJ 4DPGA 3M4QA 2HHHQ 2MO0A 4X65Q 4B3RL 1A0IA 1MKHA 4R4OA 1K83H 1VQ8A 5ELNA 1KHIA 1PYSB 4UP8A 2YTYA 2Z6KA 3G48A 4DV3L 4YHHQ 4KHZA 1UE7A 3OYYA 1FGUA 1HZCA 2I5HA 2C35B 1JJCB 4IPCA 3CCUA 1NJIC 1PH9A 1IZ6A 1CUKA 5BR8L 3M85A 1YITA 3CCLA 4DK3C 2HHHL 3GTPH 2MQHA 5IP9H 4X65L 1YEZA 1Q46A 4A4IA 1VQIA 1KAWA 3H15A 3K0XA 4GNXC 5K36G 1EIFA 2K5NA 2N49A 3A5ZB 4P71A 1Q86C 1PFSA 4YHHL 4A3JH 1CKOA 1TWCH 3CC7A 3TQYA 2CCZA 1VS0A 1XPOA 1VQPA 2IHEA 4YWLA 3L2PA 2JA9A 1U0LA 1I94L 4P74A 4PZ7A 2JA5G 5JJIA 2OQKA 1A63A 5FJ8H 1OXSC 4HIKA 2E2JH 2JEAI 4DKAC 1WCMH 4A3BG 4A3CG 3A0JA 1L0WA 4NXML 3K80C 4JBJA 2F52A 3KF6B 2E8GA 1JB7A 2JJQA 1S40A 1NE3A 2NVYH 4JOIC 1S3OA 3MEFA 4A76A 1EQQA 2GVAA 2ZJRA 2ZJPA 2CQOA 2Q2UA 4DR3L 3W5OA 4L5SA 2QEXA 3UDGA 4L5QA 1XMQQ 1TXYA 2YTXA 2YV5A 2Z0SA 3ER0A 2F3IA 3NELA 2IHFA 3J7ZC 1Z9FA 1U5KA 3PUYA 2VS1A 4R4TA 1MIUA 4OXPA 2IT1A 1VQKA 2XTIA 5FLXc 3I2ZA 1LTLA 3I4MG 4GOPA 2ID0A 4DR1Q 3S15H 3EBEA 1XMQL 1EYGA 2YTVA 1JMCA 3CXCA 3HOXG 3HOZH 4LF9L 2OCEA 4BBRH 3I4NG 1RL2A 2K5VA 5IYBH 1Y1VG 3A5UA 4LFBQ 2Z6KC 3PUZA 5C4XG 1X3FA 1QUQA 3ULPA 4UY8C 2I5LX 2ZM6Q 4DR1L 4LFCQ 3S1QH 2ASBA 1PVOA 5IP7H 2A1AA 1KL9A 3F2DA 4DV0L 1PV4A 4LF4Q 5E7NA 3PGZA 3I56A 3M3YH 3PIOA 2KCTA 3KLWA 4YWKA 5C0XJ 1L1OB 4LFBL 1EIYB 2KCMA 3FKIG 1PH5A 1G51A 1KRTA 3CQZH 1PH4A 1S72A 4K0KQ 2PI2E 2JA6H 2Y0SE 2ZM6L 4JYAL 4LFCL 2K52A 4XTCS 1VQ9A 2K50A 4GLAC 2ATWA 4JC0A 2I5MX 5LMUL 1B70B 1HNXQ 5M5WH 4WJ4A 2RHQB 4JI4Q 3UDIA 1XNQL 1L2FA 5GADC 3ZJYC 1YJNA 5AJ3Q 3CCQA 4B3SQ 2VQEQ 2JA8G 4K0KL 3OTOQ 2B29A 5LMNW 1YHQA 4BY1G 2AWOA 2D0OA 1HZ9A 1DGSA 1Z47A 3UDFA 1W3SA 3AFQA 4L5TA 5HY6A 2NVQH 2AMCB 1Y1WH 1BBUA 1IBKQ 1HNXL 3KDFA 3CF5A 4IPDA 3ERSX 2E2HH 3RN5A 4HIDA 4B3MQ 4JI4L 5M3MG 1WFQA 3H0GH 2JE6I 1XMOQ 1OXTA 1PYBA 1FJGL 4BXXG 2BH2A 4B3SL 4OO1G 1VQBA 3IRBA 4MZ9A 1KQSA 1N33Q 2VZAA 2Y0SG 2UXDL 2R93H 4DR6L 1YVCA 4IFDI 3RLOA 5M3FH 2ZTCA 4QGUA 1IBKL 4LF8Q 4DR2Q 1LUZA 2IX0A 3BJUA 2KENA 1AH9A 4LF6Q 3HOYG 3TREA 1TWGH 4GOPC 4B3ML 4JI6Q 1YHBA 3GTOH 2JEBI 1HR0W 4HJ9A 1PH6A 4YCVA 1N33L 2BH8A 1A8VA 1Q12A 4IJLA 4IPGA 3J80c 3CC4A 1X55A 1QZGA 2VNUD 1J6QA 4UP7A 4DR2L 2NVXH 2B63G 1PHJA 5IWAQ 2R6GA 3L7ZC 4LF5Q 1TWHH 1NMGA 1UE1A 4AIMA 4DAYB 5JEAG 4JI8L 2VQFQ 3GO5A 1OTCA 4JI6L 2F4VQ 3HOVG 4A3EH 2VUMH 5IP7G 4DNIA 4JI7Q 1Q1BA 3B6YA 4KHPL 1N36L 3S2DH 2EXDA 2HIVA 2HT1A 5M5XH 5EAYA 3PUXA 3UE0A 3KF8B 1L1OA 4OWTB 4IO9A 1CKNB 1PA6A 4OX9Q 4QQBX 1I5FA 1X65A 2VQFL 3E9IA 5IYCH 1XTDA 4LW1A 1K9MC 2F4VL 4IOAA 3T1YQ 4IOCA 4JI7L 3S17H 3OW2A 4KI0A 5C3EH 3RLNA 2UUBQ 4A3MG 2KHIA 1SE8A 4A3FH 4BA2I 4A3GH 4HJ7A 4ALPA 3F2CA 1YIJA 2OWOA 3TRZA 1H95A 1PH7A 1VQGA 1NY4A 3AEVA 2IX1A 2OQ0A 1UEBA 3S2HH 1QVFA 3JC66 1SRUA 3PIPA 1AE2A 1N9WA 4DV5Q 3CCVA 5IYDG 2JA7H 2R92G 1RIPA 2NVTH 3HOWG 4LUOA 3CPWA 3J7A5 2YYZA 3DM3A 1VQAA 3PO3H 4C3HH 3TS0A 4LF7Q 2R93G 1ASZA 5C4JH 4OWWB 1MJCA 3D0FA 5C44G 3S1RH 1WOCA 4GNXB 3HOUG 4NPSA 4GKJQ 4DV5L 4A93H 3L0OA 2K5HA 4BY7H 4JI2Q 4A3IH 1TWFH 1XPUA 2Q2IA 3TS2A 4C2MH 2NN6G 4IJHA 1VCIA 3A74A 2NZOA 3G6EA 3U4VA 4DV7Q 4JI3Q 4HIMA 1GD7A 1QVGA 4HJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHA A;  4DV6 Q;  4GKJ L;  4P72 A;  2IY5 B;  3PSI A;  3STB C;  1C9O A;  3K7U C;  3GTK H;  3M4O H;  1C0A A;  1JJG A;  3U4Z A;  3RN2 A;  1JT8 A;  4R4C A;  1QVC A;  4JI3 L;  4DV7 L;  1X54 A;  1D7Q A;  2N3S A;  1X3E A;  1CKN A;  1YI2 A;  4GLX A;  1VQC A;  2WAQ G;  4IFD J;  3GTM H;  5IP9 G;  3ULJ A;  3CP0 A;  2BA0 A;  3U58 A;  4NB3 A;  3HFZ B;  3GDE A;  3GTG H;  4BBS H;  4DAM A;  5C3E G;  1VQL A;  2ZTD A;  1Q81 C;  4A3J G;  2CKZ B;  4R1J A;  4DR5 Q;  1M1K C;  2AKW B;  3F1Z A;  3CCJ A;  3H3V I;  1JE5 A;  1C7Y A;  1I50 H;  4JI5 Q;  1ASY A;  1CSP A;  1HH2 P;  1IBL Q;  4P75 A;  3KFU A;  4LF4 L;  4DV1 Q;  5FJ8 G;  2YU9 H;  1SFO H;  3CD6 A;  1WCM G;  1LYL A;  2RHS B;  3FHW A;  3KF6 A;  3VDY A;  3S1M H;  4BA1 I;  2UUC Q;  3RZO H;  4DR4 L;  4JV5 Q;  3AYH B;  3RNU A;  2RF4 A;  3FP9 A;  1YZ6 A;  1IXR A;  3RZD H;  3KOJ A;  4DUY Q;  1HNZ Q;  5JJK A;  2B3G A;  4GKK Q;  1K8G A;  4DV1 L;  1FL0 A;  1A62 A;  4RG1 A;  4J15 A;  1PH8 A;  4YY3 Q;  1KXL A;  4Y52 H;  1IBM Q;  3CW2 C;  3J81 c;  4JV5 L;  1KIX A;  5AJ3 L;  4MNO A;  2VQE L;  2K75 A;  3STB D;  3OTO L;  3CCS A;  1NMF A;  4DR7 Q;  4C3J H;  4UPA A;  1XNR Q;  2HIX A;  1X6O A;  1Q82 C;  1MJE A;  2MO1 A;  4JI0 Q;  4GKK L;  3KJO A;  4Y7N H;  2JA5 H;  1VQ6 A;  1VQ7 A;  2WP8 J;  4QL5 A;  3H3V H;  4GLV B;  4YY3 L;  1X3G A;  1IBM L;  3CME A;  4LUZ A;  1P16 A;  4YWM A;  1XMO L;  2R7Z H;  4A3B H;  4C3I H;  4GN5 A;  4B3T Q;  4EQ5 A;  4A3D H;  4A3C H;  2AWN A;  2A19 A;  4DR7 L;  3KYH C;  1X56 A;  3HOZ G;  5FLM H;  2Q2T A;  1XNR L;  3F8T A;  4BBR G;  4JOI A;  4XIG S;  4JI0 L;  4X62 Q;  5IYB G;  3E9H A;  4LF8 L;  4A3L H;  3ULL A;  3PUV A;  4PZ8 A;  1YBY A;  4JCV E;  1BBW A;  4QY7 A;  4POF A;  4JI1 Q;  4LF6 L;  1JJ2 A;  2WFW A;  3J81 i;  4X64 Q;  1B7Y B;  2K4K A;  1KRS A;  4OWX B;  2ZTE A;  3NBH B;  4O2D A;  3RLF A;  4AQY Q;  1HNW Q;  2UXC Q;  1UE6 A;  1CSQ A;  1UE5 A;  2I0Q A;  2UUA Q;  4MTN A;  1YJ9 A;  4X62 L;  1J5E Q;  1HJP A;  1N8R C;  4B3R Q;  3K7A H;  5IWA L;  1EUJ A;  4A75 A;  4LF5 L;  2PNH A;  1G29 1;  2XGT A;  4DV2 Q;  4PG3 A;  3U50 C;  3WWV A;  2D0P A;  2JA6 G;  1T9H A;  1K3R A;  4L5R C;  3Q8D A;  4X64 L;  2UXC L;  1I6H H;  1G6P A;  4AQY L;  1BVS A;  3GD7 A;  1IL2 A;  3I4M H;  4GOP B;  1EOV A;  1GO3 E;  2DGY A;  4POG A;  4R4Q A;  2UUA L;  2ALY B;  3J80 i;  5ELO A;  4TVA B;  1P8L A;  2NZH A;  1J5E L;  1SR3 A;  3HOX H;  1VQF A;  2E5L Q;  4OX9 L;  3I4N H;  3BZK A;  3CCM A;  4DV2 L;  3S16 H;  1Y1V H;  3PO2 H;  1IYJ B;  3RR5 A;  5C4X H;  1B8A A;  2CWA A;  3T1Y L;  4A3K H;  3M9B A;  1QUQ B;  1SRO A;  1K0R A;  1FVI A;  1Y1W G;  5GAG C;  2UUB L;  1I94 Q;  3UDX A;  1EQR A;  4RMF A;  4DUZ Q;  4OO1 I;  1QZH A;  3H0G G;  3NEN A;  2QA4 A;  1HZB A;  4NXM Q;  1N32 Q;  5IY0 A;  1K73 C;  3FKI H;  2PQA B;  4DV4 Q;  3JAM c;  5M3F G;  1R9T H;  2GN5 A;  1VQ5 A;  1GKH A;  1VQE A;  2JK8 A;  1SLJ A;  2GVB A;  2WAQ E;  4DK6 C;  4EX5 A;  4DUZ L;  1XJV A;  2R7D A;  2R7Z G;  3S14 H;  4A3D G;  2KHJ A;  2OTJ A;  1V9P A;  1KD1 C;  3GTL H;  4DR3 Q;  4HJ5 A;  3G71 A;  2Q2H A;  4LF7 L;  1N32 L;  5FLM G;  4DV4 L;  3CMA A;  4A3L G;  2PI2 A;  2D62 A;  2JA8 H;  2V1C C;  3E0E A;  3I55 A;  1OXU A;  4ME3 A;  4BY1 H;  4NXN Q;  3KJP A;  2E5L L;  3K8A A;  5IE8 A;  4H02 A;  1NBW A;  4APV A;  4JI2 L;  4JBK A;  4GS3 A;  3W1G A;  3J81 j;  3ICE A;  3KDF B;  3AFP A;  4A3E G;  4YCW A;  3NEM A;  2VUM G;  5M3M H;  4BXX H;  4QIW E;  1TWA H;  2FXQ A;  2EIF A;  3PUW A;  3JAM i;  1GM5 A;  4JBM A;  3T1H Q;  1L1O C;  1OXX K;  5GAH C;  4LNQ A;  4NXN L;  5GRO A;  4DV6 L;  4HJA A;  4LF9 Q;  1Q1E A;  5M5Y H;  2H5X A;  5IYC G;  4IFD G;  3GTQ H;  2KBN A;  2UXB Q;  3HOY H;  4WJ3 M;  5DLQ E;  1VQD A;  1NTG A;  2LXK A;  5C0X G;  3D31 A;  1HZA A;  1N34 Q;  5IT9 c;  2ZJQ A;  2A8V A;  4DV0 Q;  3T1H L;  3I4O A;  2ES2 A;  3PF5 A;  1BKB A;  4KLK A;  4A3F G;  4A3G G;  1AE3 A;  2B63 H;  3K81 C;  2PMZ E;  2E2I H;  3PO2 G;  4R4I A;  3SGI A;  4AYB E;  1EFW A;  2UU9 Q;  2UXB L;  4A3K G;  4X6A H;  3MXN B;  1GVP A;  4JYA Q;  1E1T A;  3S24 A;  5HGQ A;  1EWI A;  3HOV H;  4GN3 B;  1N34 L;  4LFA Q;  1E7Z A;  1E3P A;  2VY3 A;  5LMN Q;  3TEH B;  3BU2 A;  4JG2 A;  1D8L A;  4DR5 L;  2JA7 G;  5LMU Q;  4OON A;  4JI5 L;  3CC2 A;  1K8A C;  1E22 A;  1IBL L;  3PO3 G;  1XNQ Q;  2BA1 A;  2PQA A;  3M4P A;  1YJW A;  2UU9 L;  2LSS A;  1SMX A;  4UP9 A;  2R7F A;  4TQU S;  3S1N H;  2UUC L;  4GNX A;  2N78 A;  4LFA L;  5LMN L;  1Q8K A;  1E24 A;  4A93 G;  4BY7 G;  1YNX A;  2NN6 I;  3CCR A;  4A3I G;  1O7I A;  2WB1 E;  4DUY L;  1HNZ L;  1VQJ A;  1WJJ A;  3I7F A;  4QJF A;  2HQL A;  1Y14 B;  4A3M H;  1PH3 A;  1LM0 A;  4GN4 B;  2VL6 A;  4AYB G;  5JJL A;  1FJG Q;  4JBW A;  1V1Q A;  4PMW A;  5J3B A;  3HKS A;  2OTL A;  2EQS A;  3HKZ E;  2UXD Q;  3PV0 A;  4DR6 Q;  1HR0 Q;  1VQO A;  2QGQ A;  1WYD A;  1XPR A;  4PZ6 A;  3M7N A;  1SN8 A;  3CAM A;  1I3Q H;  3UE1 A;  4DR4 Q;  4LUV A;  3BZC A;  2L15 A;  5IYD H;  2R92 H;  4X66 Q;  1VQ4 A;  3EIV A;  5GAE C;  3HOW H;  1CKM A;  2N8N A;  2AHO B;  1V43 A;  3EN2 A;  3GTJ H;  2K14 A;  4O0A A;  3LGJ A;  4FDB A;  2VW9 A;  3G4S A;  1UWV A;  4AH6 A;  1HR0 L;  4B3T L;  1PH2 A;  2MFI A;  2CFM A;  1WI5 A;  4IPH A;  5C44 H;  1M90 C;  2WB1 G;  1VQN A;  3HOU H;  2DUD A;  4YCU A;  5C0X I;  3PF4 A;  2LXJ A;  2RCN A;  1W2B A;  1KC8 C;  4X66 L;  4HIO A;  4JI8 Q;  1X9N A;  4BBS G;  2CWP A;  2JQO A;  1Q7Y C;  4JI1 L;  3AQQ A;  4P73 A;  3W1B A;  2MNA A;  4KHP Q;  1VQH A;  3HKZ G;  4DV3 Q;  1N36 Q;  3DLL A;  1HNW L;  3CPF A;  1VQM A;  1OXV A;  1E1O A;  5H1S E;  4LWC A;  5BR8 Q;  3CCE A;  1PH1 A;  3PCO B;  5GQO A;  3F2B A;  5JEA J;  4DPG A;  3M4Q A;  2HHH Q;  2MO0 A;  4X65 Q;  4B3R L;  1A0I A;  1MKH A;  4R4O A;  1K83 H;  1VQ8 A;  5ELN A;  1KHI A;  1PYS B;  4UP8 A;  2YTY A;  2Z6K A;  3G48 A;  4DV3 L;  4YHH Q;  4KHZ A;  1UE7 A;  3OYY A;  1FGU A;  1HZC A;  2I5H A;  2C35 B;  1JJC B;  4IPC A;  3CCU A;  1NJI C;  1PH9 A;  1IZ6 A;  1CUK A;  5BR8 L;  3M85 A;  1YIT A;  3CCL A;  4DK3 C;  2HHH L;  3GTP H;  2MQH A;  5IP9 H;  4X65 L;  1YEZ A;  1Q46 A;  4A4I A;  1VQI A;  1KAW A;  3H15 A;  3K0X A;  4GNX C;  5K36 G;  1EIF A;  2K5N A;  2N49 A;  3A5Z B;  4P71 A;  1Q86 C;  1PFS A;  4YHH L;  4A3J H;  1CKO A;  1TWC H;  3CC7 A;  3TQY A;  2CCZ A;  1VS0 A;  1XPO A;  1VQP A;  2IHE A;  4YWL A;  3L2P A;  2JA9 A;  1U0L A;  1I94 L;  4P74 A;  4PZ7 A;  2JA5 G;  5JJI A;  2OQK A;  1A63 A;  5FJ8 H;  1OXS C;  4HIK A;  2E2J H;  2JEA I;  4DKA C;  1WCM H;  4A3B G;  4A3C G;  3A0J A;  1L0W A;  4NXM L;  3K80 C;  4JBJ A;  2F52 A;  3KF6 B;  2E8G A;  1JB7 A;  2JJQ A;  1S40 A;  1NE3 A;  2NVY H;  4JOI C;  1S3O A;  3MEF A;  4A76 A;  1EQQ A;  2GVA A;  2ZJR A;  2ZJP A;  2CQO A;  2Q2U A;  4DR3 L;  3W5O A;  4L5S A;  2QEX A;  3UDG A;  4L5Q A;  1XMQ Q;  1TXY A;  2YTX A;  2YV5 A;  2Z0S A;  3ER0 A;  2F3I A;  3NEL A;  2IHF A;  3J7Z C;  1Z9F A;  1U5K A;  3PUY A;  2VS1 A;  4R4T A;  1MIU A;  4OXP A;  2IT1 A;  1VQK A;  2XTI A;  5FLX c;  3I2Z A;  1LTL A;  3I4M G;  4GOP A;  2ID0 A;  4DR1 Q;  3S15 H;  3EBE A;  1XMQ L;  1EYG A;  2YTV A;  1JMC A;  3CXC A;  3HOX G;  3HOZ H;  4LF9 L;  2OCE A;  4BBR H;  3I4N G;  1RL2 A;  2K5V A;  5IYB H;  1Y1V G;  3A5U A;  4LFB Q;  2Z6K C;  3PUZ A;  5C4X G;  1X3F A;  1QUQ A;  3ULP A;  4UY8 C;  2I5L X;  2ZM6 Q;  4DR1 L;  4LFC Q;  3S1Q H;  2ASB A;  1PVO A;  5IP7 H;  2A1A A;  1KL9 A;  3F2D A;  4DV0 L;  1PV4 A;  4LF4 Q;  5E7N A;  3PGZ A;  3I56 A;  3M3Y H;  3PIO A;  2KCT A;  3KLW A;  4YWK A;  5C0X J;  1L1O B;  4LFB L;  1EIY B;  2KCM A;  3FKI G;  1PH5 A;  1G51 A;  1KRT A;  3CQZ H;  1PH4 A;  1S72 A;  4K0K Q;  2PI2 E;  2JA6 H;  2Y0S E;  2ZM6 L;  4JYA L;  4LFC L;  2K52 A;  4XTC S;  1VQ9 A;  2K50 A;  4GLA C;  2ATW A;  4JC0 A;  2I5M X;  5LMU L;  1B70 B;  1HNX Q;  5M5W H;  4WJ4 A;  2RHQ B;  4JI4 Q;  3UDI A;  1XNQ L;  1L2F A;  5GAD C;  3ZJY C;  1YJN A;  5AJ3 Q;  3CCQ A;  4B3S Q;  2VQE Q;  2JA8 G;  4K0K L;  3OTO Q;  2B29 A;  5LMN W;  1YHQ A;  4BY1 G;  2AWO A;  2D0O A;  1HZ9 A;  1DGS A;  1Z47 A;  3UDF A;  1W3S A;  3AFQ A;  4L5T A;  5HY6 A;  2NVQ H;  2AMC B;  1Y1W H;  1BBU A;  1IBK Q;  1HNX L;  3KDF A;  3CF5 A;  4IPD A;  3ERS X;  2E2H H;  3RN5 A;  4HID A;  4B3M Q;  4JI4 L;  5M3M G;  1WFQ A;  3H0G H;  2JE6 I;  1XMO Q;  1OXT A;  1PYB A;  1FJG L;  4BXX G;  2BH2 A;  4B3S L;  4OO1 G;  1VQB A;  3IRB A;  4MZ9 A;  1KQS A;  1N33 Q;  2VZA A;  2Y0S G;  2UXD L;  2R93 H;  4DR6 L;  1YVC A;  4IFD I;  3RLO A;  5M3F H;  2ZTC A;  4QGU A;  1IBK L;  4LF8 Q;  4DR2 Q;  1LUZ A;  2IX0 A;  3BJU A;  2KEN A;  1AH9 A;  4LF6 Q;  3HOY G;  3TRE A;  1TWG H;  4GOP C;  4B3M L;  4JI6 Q;  1YHB A;  3GTO H;  2JEB I;  1HR0 W;  4HJ9 A;  1PH6 A;  4YCV A;  1N33 L;  2BH8 A;  1A8V A;  1Q12 A;  4IJL A;  4IPG A;  3J80 c;  3CC4 A;  1X55 A;  1QZG A;  2VNU D;  1J6Q A;  4UP7 A;  4DR2 L;  2NVX H;  2B63 G;  1PHJ A;  5IWA Q;  2R6G A;  3L7Z C;  4LF5 Q;  1TWH H;  1NMG A;  1UE1 A;  4AIM A;  4DAY B;  5JEA G;  4JI8 L;  2VQF Q;  3GO5 A;  1OTC A;  4JI6 L;  2F4V Q;  3HOV G;  4A3E H;  2VUM H;  5IP7 G;  4DNI A;  4JI7 Q;  1Q1B A;  3B6Y A;  4KHP L;  1N36 L;  3S2D H;  2EXD A;  2HIV A;  2HT1 A;  5M5X H;  5EAY A;  3PUX A;  3UE0 A;  3KF8 B;  1L1O A;  4OWT B;  4IO9 A;  1CKN B;  1PA6 A;  4OX9 Q;  4QQB X;  1I5F A;  1X65 A;  2VQF L;  3E9I A;  5IYC H;  1XTD A;  4LW1 A;  1K9M C;  2F4V L;  4IOA A;  3T1Y Q;  4IOC A;  4JI7 L;  3S17 H;  3OW2 A;  4KI0 A;  5C3E H;  3RLN A;  2UUB Q;  4A3M G;  2KHI A;  1SE8 A;  4A3F H;  4BA2 I;  4A3G H;  4HJ7 A;  4ALP A;  3F2C A;  1YIJ A;  2OWO A;  3TRZ A;  1H95 A;  1PH7 A;  1VQG A;  1NY4 A;  3AEV A;  2IX1 A;  2OQ0 A;  1UEB A;  3S2H H;  1QVF A;  3JC6 6;  1SRU A;  3PIP A;  1AE2 A;  1N9W A;  4DV5 Q;  3CCV A;  5IYD G;  2JA7 H;  2R92 G;  1RIP A;  2NVT H;  3HOW G;  4LUO A;  3CPW A;  3J7A 5;  2YYZ A;  3DM3 A;  1VQA A;  3PO3 H;  4C3H H;  3TS0 A;  4LF7 Q;  2R93 G;  1ASZ A;  5C4J H;  4OWW B;  1MJC A;  3D0F A;  5C44 G;  3S1R H;  1WOC A;  4GNX B;  3HOU G;  4NPS A;  4GKJ Q;  4DV5 L;  4A93 H;  3L0O A;  2K5H A;  4BY7 H;  4JI2 Q;  4A3I H;  1TWF H;  1XPU A;  2Q2I A;  3TS2 A;  4C2M H;  2NN6 G;  4IJH A;  1VCI A;  3A74 A;  2NZO A;  3G6E A;  3U4V A;  4DV7 Q;  4JI3 Q;  4HIM A;  1GD7 A;  1QVG A;  4HJ8 A; 
#chains in the Genus database with same CATH topology
 5AFW A;  1RDP D;  3E3X A;  4P72 A;  3OHX C;  2JN4 A;  3PSI A;  3STB C;  2F0E A;  3BVZ A;  2SNS A;  3GTK H;  5E4W C;  5COY A;  3RN2 A;  1NR4 A;  4R4C A;  1QVC A;  2JP1 A;  1X3E A;  1Q8I A;  2XIW A;  2OXP A;  1HRJ A;  4IUP A;  1DJR D;  5EGT A;  3HFZ B;  3GDE A;  1AEX A;  2CKZ B;  4R1J A;  3VR5 A;  4DR5 Q;  3F1Z A;  4C56 C;  4FF2 A;  1SYC A;  1HH2 P;  2F0O A;  4LF4 L;  1DZ1 A;  3TDQ A;  3A7A B;  2YU9 H;  4DXF A;  1U4M A;  5LL6 X;  4BA1 I;  4FXK C;  3DWA A;  2RF4 A;  1IXR A;  3RZD H;  3FKI B;  1TWC B;  2B3G A;  3TZD A;  1K8G A;  4RG1 A;  2A5H A;  5IGF A;  3OWE B;  4Y52 H;  3J81 c;  5DAU A;  5K36 H;  2E2J B;  4QF4 A;  2VQE L;  1S5E D;  3OTO L;  1NMF A;  2X6L A;  2NVY B;  1MJE A;  4G7H C;  4G7O C;  2J7Z A;  4Y7N H;  1KDC A;  1X3G A;  3CME A;  4A3D H;  4C3I H;  3BYY B;  4EQ5 A;  3BDL A;  2AWN A;  2A19 A;  1X56 A;  3HOZ G;  4BBR G;  3R3O A;  1NAP A;  2LS0 1;  5G3L F;  4LF8 L;  1EY5 A;  3ULL A;  1S5F D;  4QY7 A;  1ENF A;  5G3L D;  3Q22 A;  3O13 A;  4X64 Q;  1B7Y B;  2K4K A;  5KEE A;  1UE6 A;  2XWJ B;  2I0Q A;  4MTN A;  4K2K A;  1SE4 A;  1U9R A;  2E75 C;  3K7A H;  4LF5 L;  2B2W A;  2XGT A;  5I2Y A;  3S14 H;  2JA6 G;  2D0P A;  4RWS C;  5JVH 3;  1K3R A;  2K5W A;  3Q8D A;  4X64 L;  3GD7 A;  1IL2 A;  1B3A A;  1D5M C;  1JB3 A;  1EOV A;  1GO3 E;  3MXU A;  2E5L Q;  4OX9 L;  2A68 C;  2G5D A;  4KY6 A;  3PO2 H;  1IYJ B;  2A69 D;  3QB3 A;  3RR5 A;  4XQN A;  2CWA A;  2XSC A;  1YNN C;  2UUB L;  3UDX A;  2A6H C;  4DUZ Q;  4OO1 I;  1J8I A;  4N9T A;  3FMC A;  5EKK A;  3NEN A;  5ELB A;  2L4N A;  2EXZ A;  3FKI H;  1R9T H;  4DK6 C;  1XJV A;  4DUZ L;  3MZ5 A;  4H44 C;  1Y1W B;  3I70 A;  2K33 A;  1EWC A;  4DR3 Q;  3G71 A;  2AQ1 B;  1ICW A;  2PI2 A;  3I55 A;  2R93 B;  4H02 A;  1ZEQ X;  1GUS A;  5M3F B;  2F0D A;  1R4P B;  3T13 A;  4PMC A;  4QIW E;  4OO1 H;  1TWA H;  3URY A;  1X32 A;  3JAM i;  1GM5 A;  4LNQ A;  4DV6 L;  1Q1E A;  4QB4 A;  2KBN A;  1STA A;  4WJ3 M;  3JAM E;  1TS5 A;  2LXK A;  5C0X G;  3D31 A;  1JOR A;  4DF7 A;  1HQM C;  2ZJQ A;  2A8V A;  5J1Z A;  1SNQ A;  3S2D B;  1AE3 A;  4AYB E;  1GVP A;  1EL0 A;  1E1T A;  3A8I E;  5HGQ A;  1EWI A;  2QIL A;  3HOV H;  3DMU A;  3BU2 A;  4JG2 A;  2JA7 G;  2K6A A;  2M2L A;  4OON A;  5C3E B;  3CC2 A;  1K8A C;  2NWG A;  2BA1 A;  1JOO A;  1A15 A;  3NWT A;  4G4K A;  4BY7 G;  5C5M A;  1YNX A;  3OSO A;  1HNZ L;  2WB1 E;  4QIW B;  1VQJ A;  4QJF A;  4GN4 B;  5CV4 A;  2XWB B;  4PMW A;  2EVB A;  3HKZ E;  1VQO A;  1W6J A;  1WYD A;  1PTO B;  4K2L A;  3M7N A;  1IKL A;  3UE1 A;  1RHP A;  4A93 B;  2L15 A;  3TSS A;  4X66 Q;  3EIV A;  1CKM A;  2D2C C;  3NTH A;  4AH6 A;  4AYB B;  4B3T L;  5D65 A;  1SYG A;  2CFM A;  1M90 C;  3HOU H;  5FK9 C;  2DUD A;  1KC8 C;  4X66 L;  2A74 C;  4HIO A;  4N9P A;  1LT5 D;  1Q7Y C;  3AQQ A;  3BG3 A;  2MNA A;  2RDF A;  1FR3 A;  1E1O A;  3MEH A;  1D5Z C;  3GQB A;  4FVM A;  2FMM A;  3M4Q A;  2MO0 A;  3GTM B;  1LTS D;  4B3R L;  2WB1 B;  1MKH A;  2XNA C;  4R4O A;  3VYS A;  3C2P A;  3P1H A;  2BE5 C;  3FPU B;  1SEB D;  2WKC A;  3OYY A;  1FGU A;  1EU4 A;  4KD4 A;  2I5H A;  2C35 B;  1UAP A;  3HKZ B;  3HGB A;  2AUJ D;  3CCL A;  3GTP H;  1YEZ A;  4A4I A;  1VQI A;  5K36 G;  2K32 A;  1SFO B;  2K5N A;  3OW7 A;  4IUR A;  1PFS A;  3HEJ A;  3CC7 A;  1TT2 A;  1VQP A;  4FF1 A;  2IHE A;  4YWL A;  3K59 A;  1SE2 A;  2JEA I;  4HIK A;  4C3I G;  3FVQ A;  1TU2 B;  3A0J A;  4JBJ A;  4QMG A;  1BR9 A;  1CQV A;  1HUM A;  1LT6 D;  2B2U C;  1TS2 A;  2L1B A;  1JB7 A;  2KUM A;  4JOI C;  1S3O A;  4C3J B;  5DEH A;  1XYI A;  2ZJR A;  2CQO A;  2NUC A;  2R7Z B;  3MXG A;  3UDG A;  1XMQ Q;  1TXY A;  2YV5 A;  4MN3 A;  1G2S A;  1Z9F A;  2V4D A;  1K0S A;  2PZT A;  4OXP A;  5IT9 L;  2HCI A;  1VQK A;  2XTI A;  4GOP A;  3QOL A;  1Q90 A;  4K5V A;  1XMQ L;  4LAA A;  5I4D A;  3NHH A;  1CHQ D;  3ZYY X;  4PV1 C;  1B44 D;  1I4P A;  1QIL A;  4FNF A;  1QUQ A;  2MJ8 A;  2I5L X;  2ZM6 Q;  4DV0 L;  4CDC C;  4ZK9 B;  5E7N A;  1K8O A;  1QOH A;  4WRD A;  4YWK A;  3FKI G;  1G51 A;  1PH4 A;  1S72 A;  1EFI D;  4JYA L;  2ZM6 L;  2EYP A;  4ABN A;  3D8G A;  2F3V A;  2I5M X;  4KV6 A;  5LMU L;  1HNX Q;  4DGZ A;  1PRT B;  1S5C D;  4WJ4 A;  1L2F A;  4IUV A;  3CCQ A;  4B3S Q;  5LMN W;  1YHQ A;  1TY0 A;  2AWO A;  2F3W A;  4NDX A;  1Z47 A;  3AFQ A;  4B08 A;  3CU7 A;  1B53 A;  4HAE A;  1HNX L;  3KDF A;  2E2H H;  2D5D A;  4A3I B;  2F0W A;  1XMO Q;  4OO1 G;  1PYB A;  1FJG L;  4B3S L;  3GP7 A;  2DN8 A;  2Y0S G;  3SHL A;  3FPP A;  1II3 A;  1YVC A;  4CDF C;  2UXD L;  1UNS A;  2IX0 A;  1AH9 A;  2K03 A;  1Z7T A;  1LTT D;  2CW0 C;  1HR0 W;  3K5O A;  4HJ9 A;  1PH6 A;  3D6W A;  1A8V A;  1PZK D;  2RA4 A;  1QZG A;  2ZT9 C;  1VMP A;  5IWA Q;  2R6G A;  3VA5 A;  1TWH H;  4HSV A;  3TP6 A;  2VQF Q;  4JI8 L;  2F4V Q;  3HOV G;  4A3E H;  4HR7 B;  2VUM H;  4JI7 Q;  3B6Y A;  4KHP L;  2HIV A;  2EOT A;  2EY6 A;  5EAY A;  3UE0 A;  3KF8 B;  4OWT B;  2MP1 A;  2WIN B;  1CKN B;  3U9S A;  1FD7 D;  1X65 A;  2VQF L;  2B63 B;  5IYC H;  2E2I B;  2F4V L;  5EBD A;  4JI7 L;  3S1M B;  2HCC A;  4KI0 A;  4CKB A;  2KHS A;  3HP3 A;  4N8F A;  3W2D A;  2IPK D;  2Z4I A;  2HQE A;  5JJZ A;  1YIJ A;  2OWO A;  2OT2 A;  1PH7 A;  3C3L A;  5A2Q L;  1NY4 A;  3AEV A;  2OQ0 A;  3LWU A;  1SRU A;  4U67 3;  2PCF B;  3NE5 B;  4FYD A;  2PNR C;  1JWU D;  4LUO A;  4RA8 A;  3T51 B;  3J7A 5;  4ZUI A;  4JK1 C;  2YYZ A;  3TS0 A;  2R93 G;  5C4J H;  3ND8 A;  4OWW B;  1KLG D;  3S1R H;  3E5S A;  4ULL A;  2B2T C;  4GNX B;  3HOU G;  3J7A V;  2K5H A;  5FLX L;  4A3I H;  1TWF H;  3NK9 A;  2Q2I A;  3TS2 A;  4C2M H;  3BDO A;  4HSP A;  4IJH A;  2R92 B;  4RKB A;  1MSH A;  2DNC A;  2NZO A;  3A74 A;  4DV7 Q;  1F2L A;  3D6C A;  1QVG A;  4KJO A;  2TSS A;  4EVO A;  1YHA A;  3VYR A;  2RDG A;  5IOC A;  2B8G A;  3M4O H;  1JJG A;  1M8A A;  3U4Z A;  1JT8 A;  3VYU A;  4DV7 L;  4YIJ A;  5ELC A;  5A2Q E;  5JPN C;  2FJ2 A;  1DOM A;  3M7G A;  5TSS A;  4FF4 A;  3ULJ A;  3CP0 A;  2BA0 A;  3TME A;  3SEB A;  3S9W A;  5C3E G;  1M1K C;  1SNP A;  1X3P A;  1F9P A;  3NTK A;  1C7Y A;  1I50 H;  4JI5 Q;  1ASY A;  2K1B A;  1IBL Q;  5FLX E;  3VDY A;  1PTO C;  3S1M H;  1Y8N B;  4JV5 Q;  5DM6 3;  4H7B A;  1GHJ A;  3RNU A;  3FP9 A;  4FP5 D;  4A3J B;  4WOR A;  1SBB B;  4GKK Q;  1JOK A;  4FO2 A;  4JV5 L;  3HRZ C;  2F0G A;  3DWQ A;  1WCM B;  4MNO A;  3STB D;  1STN A;  2RQX A;  4DR7 Q;  4UPA A;  5FO9 B;  1UEA B;  1Q82 C;  3OOC A;  3I91 A;  4GKK L;  4V0B A;  1VQ6 A;  3IFD A;  5KYL A;  1FYC A;  1WTR A;  5CV6 A;  4LUZ A;  4YWM A;  1H9J A;  4A3B H;  4GN5 A;  4A3C H;  3SR1 A;  2DY7 A;  4DR7 L;  2LMC B;  4RCO A;  4K6D A;  2Q2T A;  4JOI A;  4X62 Q;  2NZ1 D;  4KKT A;  2LKV A;  3PUV A;  4PZ8 A;  1XTC D;  4JCV E;  5CC4 A;  4JI1 Q;  1DM0 B;  4LF6 L;  1ZXT A;  2WFW A;  1PMR A;  2EYH A;  1HNW Q;  2ZTE A;  3RLF A;  4CBV A;  3KLS X;  2K28 A;  1UE5 A;  1EQV A;  2UUA Q;  3S15 B;  4MTK A;  4X62 L;  5IGG A;  1EUJ A;  4LJZ C;  1EZ8 A;  2PPB C;  3U50 C;  1BVS A;  1CZG A;  4IN3 A;  1CK1 A;  2L55 A;  2DGY A;  4POG A;  4R4Q A;  2UUA L;  3S1Q B;  1SR3 A;  3HOX H;  1JR0 D;  3I4N H;  3Q0A A;  3M3Y B;  3BZK A;  1NR2 A;  4ZKC B;  1BCP B;  3S16 H;  1B8A A;  1EY9 A;  3T1Y L;  3M9B A;  3CQZ B;  1JWM D;  3FEW X;  4R8I A;  3H3V C;  1I94 Q;  1EQR A;  2QKI C;  1HTL D;  3DXJ C;  1QZH A;  5M5W B;  2KEE A;  3VA7 A;  4NXM Q;  1EYC A;  2PQA B;  4DV4 Q;  1WTP A;  4DK1 A;  1FGB D;  1VQE A;  2X6G A;  2L0C A;  2GVB A;  4EX5 A;  2NVQ B;  2BDN A;  1NNX A;  1I3Q B;  2R7Z G;  2OEO A;  1KD1 C;  1IW7 C;  2O4X A;  2R61 A;  3GTL H;  3QJY A;  2EJM A;  1F2Y A;  3H0G B;  4DV4 L;  2KED A;  4A3L G;  2JA8 H;  1MI2 A;  3E0E A;  1V1O A;  5IGB A;  1OXU A;  3KJP A;  3X3M A;  3K8A A;  4JI2 L;  3W1G A;  3J81 j;  4ZUJ A;  4A3E G;  4KTA A;  2VUM G;  1DCZ A;  4R9W A;  2EYO A;  3V2T A;  1LTA D;  1CFM A;  2EIF A;  2FXQ A;  3PUW A;  4JBM A;  1VQN A;  5GAH C;  5C3W A;  1GHK A;  3BZD B;  2A68 D;  2K7V A;  1TVX A;  5IYC G;  2FHT A;  1JOQ A;  2EYL A;  2EY1 A;  2XRS D;  1YNN D;  4TKO B;  1RTN A;  1HZA A;  1N34 Q;  2A6H D;  4KN7 C;  5IT9 c;  4ZLT F;  3PF5 A;  1BKB A;  5IGE A;  5M5X B;  4KN4 C;  4F87 A;  1GUW A;  2F1M A;  5JEA H;  1PFN A;  3S24 A;  3CRK C;  1PZI D;  4LFA Q;  1N34 L;  1E3P A;  1EWH A;  2J4X A;  2K01 A;  4DR5 L;  2B2V C;  2RSO A;  3X3N A;  1XNQ Q;  1D1I A;  3M4P A;  1SMX A;  4A3G B;  1C48 A;  3P7J A;  3K6O A;  4LFA L;  1Q8K A;  1XXG A;  3CCR A;  4A3I G;  1O7I A;  2HQL A;  5COR A;  3SK4 A;  1LM0 A;  2NVT B;  2VL6 A;  1RTO A;  4L6T B;  3HKS A;  2OTL A;  4C3H B;  1K8M A;  1STG A;  3PV0 A;  5E4X A;  2J0T D;  2QGQ A;  3NQI A;  2RDH A;  1TS3 A;  3ND9 A;  1XPR A;  5I2X A;  1EU3 A;  3CAM A;  1I3Q H;  1V8Q A;  1BF4 A;  1D1K A;  4DR4 Q;  1ZYR C;  3D4D A;  2N8N A;  3M4Y A;  4KY7 A;  4FDB A;  1GJX A;  1ENC A;  1E2W A;  4NKL A;  1QCB D;  1PH2 A;  3ERO A;  4DNT B;  1WI5 A;  4IPH A;  4DR4 L;  3PF4 A;  3MVV A;  4LMQ D;  3QO2 A;  3A55 A;  1VDZ A;  5EPL A;  2CWP A;  1F77 A;  5BN5 A;  1Y8P B;  4DV3 Q;  3DLL A;  5T1G A;  1VQM A;  1ROD A;  3BVG A;  3TN2 A;  3CCE A;  5JEA J;  5C3X A;  1A0I A;  1VQ8 A;  2PZW A;  1KHI A;  4UP8 A;  3G48 A;  4DV3 L;  4BBS B;  1UE7 A;  5FOB B;  3CCU A;  1A2U A;  2O5J C;  4IUT A;  1CUK A;  4K14 A;  3M85 A;  3OIP A;  1SMY C;  4DK3 C;  2E5L L;  5IP9 H;  4GNX C;  3JAM L;  2ZXO A;  4HCS A;  1WTH A;  1EIF A;  2N49 A;  4P71 A;  3RZO B;  2NYZ D;  1Q86 C;  2JYO A;  2JXM B;  1TWC H;  3Q23 A;  3TQY A;  2CCZ A;  1VS0 A;  3E6Z X;  4HTH A;  3MA2 B;  4P74 A;  3VR2 A;  5JJI A;  1KDA A;  1O80 A;  1OXS C;  1RCV D;  4KY5 A;  2E2J H;  4A3B G;  1A63 A;  1CT1 D;  4A3C G;  1L0W A;  1TY2 A;  2E8G A;  1F2Z A;  2JJQ A;  5I6W A;  1S40 A;  2NVY H;  4BS9 A;  1EQQ A;  4QUF A;  2ZJP A;  1G8Z D;  2Q2U A;  3R8B A;  2JA5 B;  2L11 A;  4DR3 L;  4ODG A;  1CQF A;  2K05 A;  2QEX A;  1LAB A;  4L5Q A;  2Z0S A;  3ER0 A;  2F3I A;  2IHF A;  1U5K A;  1A3V A;  1MIU A;  2BE5 D;  1AP0 A;  5FLX c;  3IFT A;  2C9O A;  4KHV A;  1AN8 A;  3HOX G;  3I4N G;  5IYB H;  2K5V A;  2Z6K C;  3PUZ A;  4KK7 A;  1S5D D;  1SYE A;  5EQ0 A;  4K5W A;  1I6H B;  4LFC Q;  1V1P B;  1R4Q B;  2PW5 A;  2KCT A;  4XYQ A;  2N88 A;  2KCM A;  5C6A A;  4A3F B;  1KRT A;  4K0K Q;  2PI2 E;  5M9O A;  3A7L A;  1Y1V B;  3V05 A;  1C8C A;  4LFC L;  5C4X B;  4A3K B;  4XDX A;  1A2T A;  4GLA C;  5IOD A;  1PDQ A;  2RHQ B;  3GV3 A;  3UDI A;  1Q3L A;  1YJN A;  2XVS A;  5AJ3 Q;  4RAU C;  4K0K L;  2LFN A;  2JA8 G;  2PZU A;  2B29 A;  4M1U B;  2D0O A;  1DGS A;  1JQY D;  1Y1W H;  5EPK A;  1FNU A;  1F9Q A;  1MSG A;  4IUN A;  4IPD A;  1C4Q A;  3CRL C;  4IAL A;  5EBC A;  4HID A;  2KOL A;  2NTT A;  1WFQ A;  1OXT A;  1VQB A;  4IQZ A;  4Z9C B;  2VZA A;  2R93 H;  2A69 C;  1H9S A;  1SNO A;  4IFD I;  5CBA E;  5M3F H;  2ZTC A;  4DR2 Q;  4BY1 B;  1LUZ A;  2KEN A;  1EQT A;  4JI6 Q;  1YHB A;  1O7L A;  5CR3 A;  2JEB I;  5M3M B;  3SXH A;  5E1F A;  1BCP C;  2G9H D;  4DR2 L;  3MFY A;  1PHJ A;  1XX8 A;  3MXN A;  3FDT A;  5M5Y B;  4DAY B;  5KIX A;  5JEA G;  1OTC A;  2CH4 W;  4JI6 L;  1B1Z A;  3MHB A;  4DNI A;  3D3R A;  3GTG B;  3S2D H;  4QQB X;  3VR4 A;  4IFD H;  4I7Z C;  2Z6B A;  5C3E H;  3RLN A;  2A73 B;  3K5N A;  3MC0 B;  1WTX A;  4A3F H;  4BA2 I;  4ALP A;  3OIQ A;  4FXD A;  1EY4 A;  2IX1 A;  3N52 A;  4CHT B;  3IAY A;  1HHV A;  1QVF A;  3JC6 6;  1DD2 A;  1N9W A;  1PYW D;  1WVL A;  4XT3 B;  2CW0 D;  1HPC A;  2I07 B;  1LV9 A;  3CPW A;  4A3M B;  4LF7 Q;  1HA6 A;  1PTO H;  1MJC A;  3DEP A;  2EJF C;  1WOC A;  5CV5 A;  2P5Z X;  5EJW A;  3VR3 A;  4A93 H;  1RKN A;  4E6I A;  1XPU A;  1SDF A;  1ENA A;  4UAI A;  2QCP X;  3HOW B;  3U4V A;  3GTJ B;  3SDZ A;  3TZU A;  2IY5 B;  1DOK A;  5D3I B;  3K5L A;  3LX0 A;  3K7U C;  5IGD A;  1O7Z A;  1CZW A;  1C0A A;  2Q8I B;  1X54 A;  1D7Q A;  3KF8 A;  2N3S A;  1CKN A;  1YI2 A;  4GLX A;  1NSN S;  1VQC A;  1ESF A;  3I4M B;  4OEL B;  4IFD J;  3GTM H;  5IP9 G;  1E2V A;  2K04 A;  2HDM A;  1GXD C;  3U58 A;  4NB3 A;  1DXM A;  4J8Q A;  5IGC A;  3GTG H;  5ISR A;  1Q81 C;  1K83 B;  3H3V I;  3CCJ A;  4G7Z C;  1KNE A;  1G2T A;  1CSP A;  4MIU A;  1SJH D;  4P75 A;  3KFU A;  4DV1 Q;  2A6E C;  1SFO H;  3CD6 A;  2RHS B;  1LYL A;  1SNM A;  3FHW A;  3KF6 A;  4BWG B;  2UUC Q;  1KNA A;  2VB2 X;  4RFB A;  1EYD A;  1HA5 A;  1YZ6 A;  5CV7 A;  5JJK A;  3KOJ A;  4DUY Q;  3E0J A;  3H6M A;  3J81 L;  3AB9 A;  2IW3 A;  4DV1 L;  4PQX A;  4C1N I;  4JW0 A;  4YY3 Q;  2EJG C;  3CW2 C;  1UUP A;  1SJE D;  4F88 A;  3CCS A;  4C3J H;  2NTS A;  1CTM A;  4JI0 Q;  4OEM B;  1G91 A;  2ICE C;  1VQ7 A;  2AQ2 B;  4QL5 A;  3H3V H;  3J80 L;  1EYA A;  4YY3 L;  1XMO L;  2R7Z H;  3AU7 A;  3T4A C;  4DFA A;  1EY0 A;  4R8N A;  4JI0 L;  4A3L H;  1ONL A;  5IYB G;  1I4Q A;  4POF A;  2ICI A;  2KVM A;  2E74 C;  4ZRZ A;  3J81 i;  3I3C A;  1KRS A;  2B8F A;  1PTO F;  3NBH B;  3HOY B;  3C1F A;  1CSQ A;  2K5Q A;  2IJ0 A;  1PTO D;  1YJ9 A;  5C4H A;  1J5E Q;  3J81 E;  1HJP A;  2EYM A;  3HOZ B;  1KLU D;  5IWA L;  4BBR B;  4DV2 Q;  4PG3 A;  5FKA C;  2HD3 A;  4MHE A;  3I4M H;  3QOJ A;  1S5B D;  4GOP B;  2ALY B;  3J80 i;  1LTG D;  1LAC A;  4TVA B;  5ELO A;  1P8L A;  1J5E L;  4HMJ A;  1SYD A;  3VYT A;  1SYF A;  1WD1 A;  3CCM A;  4DV2 L;  4O42 A;  3J80 E;  1QUQ B;  1SRO A;  1K0R A;  1FVI A;  1Y1W G;  1SYB A;  2JA6 B;  3S1N B;  5GAG C;  2Q8T A;  4RMF A;  4JPB W;  4RKL A;  2QA4 A;  1N32 Q;  5IY0 A;  4X3U A;  3I90 A;  4RGT A;  2WV6 D;  3SK6 A;  3JAM c;  3NP8 A;  2GN5 A;  5M3F G;  1GKH A;  5E3F A;  2JK8 A;  1SLJ A;  2O2L D;  2WAQ E;  5C4Z A;  2R7D A;  3EJI A;  3EQL C;  2EPB A;  2OTJ A;  1N32 L;  4HJ5 A;  2DJG C;  2Q2H A;  5FLM G;  1HXY D;  5KNC A;  2D62 A;  2WKD A;  2V1C C;  4ME3 A;  4M8A A;  1NBW A;  4JBK A;  1WTW A;  2H1E A;  3KDF B;  5T1I A;  4YCW A;  2ZXP A;  3NEM A;  1TWG B;  1B3Q A;  3MWY W;  4BXX H;  1VF5 C;  1EEI D;  5ELF A;  1OXX K;  5GRO A;  4LF9 Q;  4OIJ A;  1U4L A;  2H5X A;  4IFD G;  1VMC A;  2NVX B;  5CYU A;  2F0F A;  1AZP A;  3HOY H;  5DLQ E;  1TKW B;  1VQD A;  2FMC A;  1NTG A;  1LTI D;  1B50 A;  3I4O A;  1CA6 A;  2ES2 A;  4KLK A;  4A3F G;  1F9S A;  2B63 H;  3K81 C;  2E2I H;  4R4I A;  1EFW A;  2UU9 Q;  4A3K G;  4X6A H;  2WAQ B;  4EQP A;  4XQQ A;  1E7Z A;  3TEH B;  3LNN A;  4NW2 A;  3S17 B;  4KKU A;  4JI5 L;  1IW7 D;  1IBL L;  3RMH A;  2PQA A;  2UU9 L;  2CVR A;  2LSS A;  2Z9H A;  4UP9 A;  2JSO A;  3CHB D;  3S1N H;  4X3S A;  3K57 A;  4A93 G;  2F03 A;  1RF2 D;  4CKC A;  4ZCK A;  3S2H B;  2NN6 I;  2EE1 A;  1WJJ A;  3I7F A;  1SND A;  1Y14 B;  4RGM A;  1PH3 A;  2JA7 B;  1BNZ A;  4AYB G;  5JJL A;  3ITP A;  1V1Q A;  5J3B A;  4PNY A;  1MGS A;  5KND A;  1BXT A;  4DR6 Q;  4PZ6 A;  1EIG A;  5BN4 A;  2B2U A;  2PYK A;  3TP7 A;  3KLR A;  4WFN 3;  4BY7 B;  2R92 H;  2AHO B;  3TP5 A;  1V43 A;  3EN2 A;  2K14 A;  1BO0 A;  4O0A A;  3G4S A;  2VW9 A;  2SEB D;  5JPM C;  5CBE E;  1PFM A;  1X3Q A;  4DXG A;  2WB1 G;  5C0X I;  5DM7 3;  2RCN A;  4RGN A;  2JQO A;  1S4Z A;  3QG1 A;  4JI1 L;  2NN6 H;  4WJW A;  4K8I A;  4H13 C;  4P73 A;  1VQH A;  1BQQ T;  3HKZ G;  1N36 Q;  1HNW L;  3CPF A;  4I65 A;  1OXV A;  1D6E C;  1FNV A;  1IL8 A;  5BR8 Q;  1PH1 A;  3PCO B;  4DPG A;  2HHH Q;  1RD9 D;  2B2Y C;  5ELN A;  1PYS B;  1ET6 A;  2MGS A;  2YTY A;  1KTK A;  4YHH Q;  4KHZ A;  3BS1 A;  1ICF B;  1HZC A;  2E76 C;  5LL6 S;  2QDL A;  4IPC A;  5IIF A;  3J7Y W;  1PH9 A;  1IZ6 A;  5BR8 L;  1VF7 A;  4TSS A;  3I4L A;  2HDL A;  4RHS A;  1YIT A;  1A6X A;  5KRU A;  2HHH L;  3OMC A;  3H15 A;  3SE0 A;  3A5Z B;  4OL7 A;  4CKE A;  4C3J G;  1WD0 A;  1BDO A;  1K3B C;  4YHH L;  1ZYR D;  3RUZ A;  4A3J H;  1CKO A;  4P2C B;  5NUC A;  5J39 A;  1JCK B;  1LTR D;  2KQ3 A;  3DEO A;  3L2P A;  1I94 L;  2JA9 A;  1ESR A;  4PMB A;  5FJ8 H;  1WCM H;  4NXM L;  2O5I C;  3K80 C;  2F52 A;  4CGY B;  2Q8R E;  4EQO A;  1NE3 A;  2AQ3 B;  3TP8 A;  3MEF A;  4A76 A;  2WAC A;  4Y7N B;  1QNU A;  3GTO B;  3W5O A;  4L5S A;  4A3D B;  4V19 0;  4C3I B;  4X3T A;  1W6K A;  3J7Z C;  4ZKB B;  2VS1 A;  1HTP A;  1RJT A;  4R4T A;  2KA7 A;  3CKI B;  3I4M G;  4C1N K;  2ID0 A;  4DR1 Q;  3S15 H;  3RD4 A;  3EBE A;  1PRT C;  1EYG A;  1SMY D;  2YTV A;  1JMC A;  4ZAI A;  1LLR D;  2OCE A;  1RL2 A;  1MHW C;  1YNJ C;  3A5U A;  3K7A B;  1PXU A;  3ULP A;  5I6Y A;  1DOL A;  4UY8 C;  3S14 B;  4DR1 L;  1IYV A;  1EY6 A;  2EY2 A;  3S1Q H;  2F0S A;  4LF4 Q;  1IYU A;  4CJ1 B;  5JAV A;  3M3Y H;  4CDD C;  1EEF D;  3KLW A;  5C0X J;  1L1O B;  3CQZ H;  1HCZ A;  2Y0S E;  3PO2 B;  2IWH A;  2K52 A;  4XXE A;  2ATW A;  1QG7 A;  2F0U A;  2F0M A;  5M5W H;  2E2D C;  3LWE A;  2M00 A;  4JI4 Q;  1XNQ L;  1T5X D;  5GAD C;  3ZJY C;  2EY5 A;  4EGV A;  2VQE Q;  3L3O C;  3OMG A;  4JVZ A;  3OTO Q;  3PO3 B;  1HZ9 A;  3UDF A;  2NVQ H;  4RCN A;  1A3U A;  1R9T B;  3IKJ A;  2FFK B;  3CF5 A;  2F0Q A;  1T5E A;  3ERS X;  5CGK A;  1IKM A;  4B3M Q;  1MBY A;  4JI4 L;  3H0G H;  4BXX G;  2BH2 A;  3IRB A;  4MZ9 A;  1KQS A;  1EY8 A;  2L12 A;  3HZX A;  1SE3 A;  4LF8 Q;  1I6V C;  2B2T A;  3BJU A;  4L63 B;  3HOY G;  1ET9 A;  3QR8 A;  4GOP C;  4B3M L;  5A35 A;  3GTO H;  3VR6 A;  1B4O A;  3PIP 3;  1I4X A;  4IUU A;  4YCV A;  2BH8 A;  1Q12 A;  3J80 c;  1TWA B;  3CC4 A;  1QNK A;  2VNU D;  1J6Q A;  2Y0S B;  2B63 G;  1STY A;  3L7Z C;  3T53 B;  4LF5 Q;  1NMG A;  4AIM A;  3GO5 A;  1V1P A;  3DM1 A;  1ML0 D;  5JOB A;  4U68 A;  3I73 A;  4J6H A;  3V96 A;  3Q6S A;  1NUC A;  3WOF A;  1Q1B A;  5IP7 G;  4KJN A;  2EXD A;  2HT1 A;  5M5X H;  3BDC A;  3PUX A;  1I4H A;  5ELD A;  4OX9 Q;  3N6R A;  1I5F A;  3E9I A;  1XTD A;  3MFG A;  1K9M C;  4IOA A;  3WDN A;  4IOC A;  1STH A;  2G9D A;  5EKL A;  1A3T A;  3HOV B;  2UUB Q;  1PZJ D;  2IL8 A;  2K5D A;  2KHI A;  1GUG A;  1CHP D;  4A3G H;  3D4R A;  4HJ7 A;  2QF7 A;  3HS0 C;  1KDB A;  1UEB A;  4LK1 C;  3PIP A;  4DV5 Q;  3H94 A;  4Q5V A;  3CCV A;  3AMU A;  2R92 G;  1RIP A;  3NQT A;  2NVT H;  5HUR A;  1BCP F;  3DUZ A;  3PO3 H;  1BOS A;  4C3H H;  1ASZ A;  2VXW A;  1BCP D;  3QIA A;  5EKI A;  2M9V A;  2F0H A;  4CDE C;  4GKJ Q;  1E2Z A;  1GUN A;  2F0J A;  4DV5 L;  3I8Z A;  3L0O A;  3G6J B;  2NN6 G;  4NP5 A;  1VCI A;  2F0N A;  1GUT A;  3R93 A;  5DNF A;  4JI3 Q;  4B9W A;  4KKS A;  4HIM A;  3SK8 A;  1EIH A;  2ENB A;  3KK7 A;  4DV6 Q;  4GKJ L;  4DAY A;  2SDF A;  4L8J A;  4OIK A;  1C9O A;  1AZQ A;  3HOU B;  1EY7 A;  1LT3 D;  2PO4 A;  4X3K A;  1LO5 D;  3TBI B;  4JI3 L;  1BBX C;  3MAQ A;  3EA6 A;  5D3D A;  2WAQ G;  3QWN A;  3WOE A;  4BBS H;  4DAM A;  2QW7 A;  1VQL A;  2ZTD A;  3K5M A;  4A3J G;  2AKW B;  2KCN A;  2RVL A;  1JE5 A;  2F0P A;  1DON A;  1JWS D;  2B39 A;  1CM9 A;  5KGU A;  3J7A F;  5KNB A;  2D9U A;  3A8J E;  5FJ8 G;  1WCM G;  3K0Y A;  3GTP B;  3RZO H;  3NXW A;  1K28 A;  3AYH B;  2B2Y A;  4I7A A;  1HNZ Q;  1TS4 A;  4FXG C;  3W3A A;  4IZ8 A;  1FL0 A;  1A62 A;  4J15 A;  4UHV A;  1PH8 A;  4DU9 A;  1KXL A;  1QE6 A;  4ZQ3 A;  1IBM Q;  1KIX A;  3R2T A;  5AJ3 L;  2K75 A;  1SNC A;  1O7Y A;  2F0V A;  2RSN A;  1XNR Q;  2HIX A;  1X6O A;  2MO1 A;  1OO9 B;  3KJO A;  2JA5 H;  2WP8 J;  4S3S A;  4GLV B;  3H91 A;  5FO7 B;  1IBM L;  2BDO A;  1P16 A;  4B3T Q;  1MD2 D;  4KD3 A;  3KYH C;  5FLM H;  1XNR L;  1FNW A;  3F8T A;  2EZV A;  4XIG S;  4DN4 M;  3E9H A;  1YBY A;  1BBW A;  2ZXR A;  1JJ2 A;  4OHJ A;  3GTQ B;  1B9N A;  2UXC Q;  3BVM A;  4OWX B;  4AQY Q;  4O2D A;  1Y69 U;  2CH4 A;  2A6E D;  3KBG A;  4QUC A;  1CA5 A;  1H9M A;  3F2U A;  4HCE A;  1N8R C;  4B3R Q;  4A75 A;  1ZKO A;  2PNH A;  1G29 1;  3WWV A;  2X69 A;  1I6H H;  2DY8 A;  1T9H A;  4L5R C;  1G6P A;  2UXC L;  4DK0 A;  4ME5 A;  4G57 A;  5CMD A;  4AQY L;  1KAB A;  2NZH A;  1BUV T;  1VQF A;  1HFN A;  1F2M A;  1H9K A;  1LT4 D;  2GA4 B;  1Y1V H;  5C4X H;  4A3K H;  3T16 A;  3PQI A;  1HFG A;  2B2V A;  3H0G G;  1DYQ A;  3SVM A;  1HZB A;  1SAP A;  1STB A;  1K73 C;  3C1E A;  1GOZ A;  1QJO A;  4DAP A;  2L9H A;  4OGQ C;  1VQ5 A;  2LY7 A;  4H0L C;  2I46 A;  4A3D G;  2E2H B;  2KHJ A;  1V9P A;  4LF7 L;  2VB3 X;  1ILQ A;  3CMA A;  2Z4H A;  2RKS A;  4BY1 H;  4NXN Q;  4XYO A;  2DJF C;  4CJ2 C;  5IE8 A;  4CJ0 B;  4APV A;  4GS3 A;  5C44 B;  3ICE A;  3NBH A;  2CHB D;  3AFP A;  3A8K E;  4RHR A;  5M3M H;  4Q0F A;  1U4P A;  1L1O C;  3T1H Q;  4NXN L;  4HJA A;  1H9S B;  5BN3 A;  1JIC A;  5M5Y H;  2UXB Q;  3GTQ H;  1M4V A;  1TWH B;  3GV6 A;  4HN7 A;  1Z6H A;  4A3E B;  2VUM B;  1HQR D;  4DV0 Q;  3T1H L;  2EYJ A;  2KJX A;  4A3G G;  4K8J A;  2PMZ E;  3PO2 G;  2UXB L;  3SGI A;  2KCC A;  1AW7 A;  3ERQ A;  3MXN B;  1JE4 A;  2R3Z A;  4JYA Q;  4K5X A;  4GN3 B;  2VY3 A;  4DA2 A;  5LMN Q;  1PLF A;  1D8L A;  5LMU Q;  1E0B A;  5EPJ A;  1E22 A;  3A56 A;  4N8X 1;  4C3H G;  4F8M A;  3C46 A;  1YJW A;  2DNE A;  3PO3 G;  2Z1C A;  2R7F A;  4TQU S;  1NCV A;  2UUC L;  4GNX A;  2N78 A;  5LMN L;  4ILW A;  3K58 A;  1E24 A;  3BYT B;  3NSW A;  2PQE A;  4DUY L;  4B9X A;  4A3M H;  1D5X C;  1SXT A;  5CV8 A;  5IT9 E;  1FJG Q;  4JBW A;  2KEC A;  4DNR B;  1I4G A;  1AFP A;  2CQA A;  2EQS A;  2UXD Q;  5C4J B;  1HR0 Q;  1G6Z A;  1SN8 A;  3S1R B;  1PFB A;  4LUV A;  3BZC A;  3FRP B;  5IYD H;  1VQ4 A;  5GAE C;  3HOW H;  1TWF B;  3P20 A;  1SSO A;  1L0Y B;  3KBX A;  4C2M B;  3GTJ H;  3LGJ A;  3G7L A;  2PMZ B;  1WTV A;  3EFX D;  1UWV A;  1HR0 L;  1B2T A;  2MFI A;  5C44 H;  3KLS A;  4YCU A;  2NBF A;  2LXJ A;  4HMI A;  1W2B A;  4JI8 Q;  1X9N A;  4BBS G;  3M4O B;  3L9A X;  3W1B A;  4EQN A;  4KHP Q;  4XQJ A;  2F4I A;  5H1S E;  1L0X B;  4LWC A;  3DHQ A;  5C5L A;  5GQO A;  3F2B A;  1F9R A;  5F2D A;  4X65 Q;  1K83 H;  1I4R A;  2SNM A;  2Z8L A;  3MXP A;  2Z6K A;  1IHZ A;  5FO8 B;  1JJC B;  1NJI C;  4RGO S;  1O78 A;  1I50 B;  2MQH A;  4X65 L;  1Q46 A;  1KAW A;  3K0X A;  4NMZ A;  2TMP A;  2F0I A;  3NWS A;  2OF1 A;  3P75 A;  1TQO A;  1XPO A;  2N55 A;  2JA5 G;  1WTQ A;  1U0L A;  2NB0 A;  4PZ7 A;  1QB5 D;  1WTO A;  2OQK A;  3IL8 A;  3NBI A;  4KMU C;  4DKA C;  1HUN A;  3OPO A;  4O1N A;  3U9O A;  3KF6 B;  4FF3 A;  3PIO 3;  5J22 A;  1ILP A;  2GVA A;  2RBM A;  1TII D;  2C5C A;  4A3B B;  2MHV A;  2YTX A;  5I9P A;  4ZYS A;  3DWP A;  3NEL A;  3PUY A;  2B2W C;  3MTS A;  1EZ6 A;  2BOS A;  1J9O A;  2IT1 A;  4DAV A;  3I2Z A;  1LTL A;  2F0T A;  2AUK A;  1GUO A;  3CXC A;  3HOZ H;  4LF9 L;  4BBR H;  2MUY A;  3I72 A;  3A54 A;  1Y1V G;  2EYF A;  2PW7 A;  1CI3 M;  5HGT A;  4LFB Q;  5C4X G;  1X3F A;  3T56 B;  1U4R A;  2ASB A;  1PVO A;  5IP7 H;  2A1A A;  1KL9 A;  3F2D A;  1PV4 A;  3UI2 A;  3PGZ A;  3I56 A;  3PIO A;  4LFB L;  3HOX B;  1EIY B;  3I4N B;  4K6L A;  3S16 B;  2JA6 H;  2RCF A;  4GZY C;  4XTC S;  3OWF A;  1VQ9 A;  2K50 A;  4JC0 A;  1B70 B;  4IUQ A;  1B9M A;  1QWY A;  2F0L A;  5KYI A;  2QDB A;  4BY1 G;  1W3S A;  4L5T A;  5HY6 A;  1H9R A;  2AMC B;  1BBU A;  3KUP A;  1IBK Q;  3D4W A;  1PRT F;  3RN5 A;  3NTI A;  5M3M G;  2JE6 I;  1PRT D;  1Y8O B;  3GTL B;  5CV9 A;  2SOB A;  1N33 Q;  4DR6 L;  3RLO A;  1XWE A;  2JA8 B;  1YNJ D;  4QGU A;  1IBK L;  4LF6 Q;  3TRE A;  1TWG H;  5L37 A;  3PMF A;  2HUG A;  3NUC A;  3GTK B;  3R2I A;  3ONA B;  1N33 L;  3EVQ A;  1LTB D;  4IJL A;  4IPG A;  4J1M A;  1D2B A;  1X55 A;  2XRQ D;  2IX3 A;  4UP7 A;  2QEJ C;  2NVX H;  1UE1 A;  1TR5 A;  2L5T A;  5JVG 3;  3Q24 A;  3H09 A;  1KAA A;  1N36 L;  5K5P A;  4QCL A;  4IO9 A;  1L1O A;  1PA6 A;  2XN9 C;  4LW1 A;  3HG9 A;  2YU9 B;  1EOT A;  3T1Y Q;  1JC7 A;  3S17 H;  4ID6 A;  5C0X H;  3OW2 A;  5I9O A;  4A3M G;  1SE8 A;  3RZD B;  4XT1 B;  3F2C A;  2MPM A;  5D14 A;  3TRZ A;  1H95 A;  1VQG A;  2BCO A;  3S2H H;  1AE2 A;  4F7X A;  4UDU C;  5IYD G;  2FIN B;  1STE A;  2JA7 H;  3HOW G;  2WII B;  3NPP A;  2H4O A;  3SK5 A;  3DM3 A;  1VQA A;  3D0F A;  5C44 G;  4NPS A;  4RH6 A;  4BY7 H;  4JI2 Q;  2F0K A;  4HED A;  2EDG A;  4TRD A;  5ELE A;  3G6E A;  1GD7 A;  5LHY 1;  1PH5 A;  4HJ8 A; 
#chains in the Genus database with same CATH homology
 1YHA A;  4DV6 Q;  4GKJ L;  4P72 A;  2IY5 B;  3PSI A;  3STB C;  1C9O A;  3K7U C;  3GTK H;  3M4O H;  1C0A A;  1JJG A;  3U4Z A;  3RN2 A;  1JT8 A;  4R4C A;  1QVC A;  4JI3 L;  4DV7 L;  1X54 A;  1D7Q A;  2N3S A;  1X3E A;  1CKN A;  1YI2 A;  4GLX A;  1VQC A;  2WAQ G;  4IFD J;  3GTM H;  5IP9 G;  3ULJ A;  3CP0 A;  2BA0 A;  3U58 A;  4NB3 A;  3HFZ B;  3GDE A;  3GTG H;  4BBS H;  4DAM A;  5C3E G;  1VQL A;  2ZTD A;  1Q81 C;  4A3J G;  2CKZ B;  4R1J A;  4DR5 Q;  1M1K C;  2AKW B;  3F1Z A;  3CCJ A;  3H3V I;  1JE5 A;  1C7Y A;  1I50 H;  4JI5 Q;  1ASY A;  1CSP A;  1HH2 P;  1IBL Q;  4P75 A;  3KFU A;  4LF4 L;  4DV1 Q;  5FJ8 G;  2YU9 H;  1SFO H;  3CD6 A;  1WCM G;  1LYL A;  2RHS B;  3FHW A;  3KF6 A;  3VDY A;  3S1M H;  4BA1 I;  2UUC Q;  3RZO H;  4DR4 L;  4JV5 Q;  3AYH B;  3RNU A;  2RF4 A;  3FP9 A;  1YZ6 A;  1IXR A;  3RZD H;  3KOJ A;  4DUY Q;  1HNZ Q;  5JJK A;  2B3G A;  4GKK Q;  1K8G A;  4DV1 L;  1FL0 A;  1A62 A;  4RG1 A;  4J15 A;  1PH8 A;  4YY3 Q;  1KXL A;  4Y52 H;  1IBM Q;  3CW2 C;  3J81 c;  4JV5 L;  1KIX A;  5AJ3 L;  4MNO A;  2VQE L;  2K75 A;  3STB D;  3OTO L;  3CCS A;  1NMF A;  4DR7 Q;  4C3J H;  4UPA A;  1XNR Q;  2HIX A;  1X6O A;  1Q82 C;  1MJE A;  2MO1 A;  4JI0 Q;  4GKK L;  3KJO A;  4Y7N H;  2JA5 H;  1VQ6 A;  1VQ7 A;  2WP8 J;  4QL5 A;  3H3V H;  4GLV B;  4YY3 L;  1X3G A;  1IBM L;  3CME A;  4LUZ A;  1P16 A;  4YWM A;  1XMO L;  2R7Z H;  4A3B H;  4C3I H;  4GN5 A;  4B3T Q;  4EQ5 A;  4A3D H;  4A3C H;  2AWN A;  2A19 A;  4DR7 L;  3KYH C;  1X56 A;  3HOZ G;  5FLM H;  2Q2T A;  1XNR L;  3F8T A;  4BBR G;  4JOI A;  4XIG S;  4JI0 L;  4X62 Q;  5IYB G;  3E9H A;  4LF8 L;  4A3L H;  3ULL A;  3PUV A;  4PZ8 A;  1YBY A;  4JCV E;  1BBW A;  4QY7 A;  4POF A;  4JI1 Q;  4LF6 L;  1JJ2 A;  2WFW A;  3J81 i;  4X64 Q;  1B7Y B;  2K4K A;  1KRS A;  4OWX B;  2ZTE A;  3NBH B;  4O2D A;  3RLF A;  4AQY Q;  1HNW Q;  2UXC Q;  1UE6 A;  1CSQ A;  1UE5 A;  2I0Q A;  2UUA Q;  4MTN A;  1YJ9 A;  4X62 L;  1J5E Q;  1HJP A;  1N8R C;  4B3R Q;  3K7A H;  5IWA L;  1EUJ A;  4A75 A;  4LF5 L;  2PNH A;  1G29 1;  2XGT A;  4DV2 Q;  4PG3 A;  3U50 C;  3WWV A;  2D0P A;  2JA6 G;  1T9H A;  1K3R A;  4L5R C;  3Q8D A;  4X64 L;  2UXC L;  1I6H H;  1G6P A;  4AQY L;  1BVS A;  3GD7 A;  1IL2 A;  3I4M H;  4GOP B;  1EOV A;  1GO3 E;  2DGY A;  4POG A;  4R4Q A;  2UUA L;  2ALY B;  3J80 i;  5ELO A;  4TVA B;  1P8L A;  2NZH A;  1J5E L;  1SR3 A;  3HOX H;  1VQF A;  2E5L Q;  4OX9 L;  3I4N H;  3BZK A;  3CCM A;  4DV2 L;  3S16 H;  1Y1V H;  3PO2 H;  1IYJ B;  3RR5 A;  5C4X H;  1B8A A;  2CWA A;  3T1Y L;  4A3K H;  3M9B A;  1QUQ B;  1SRO A;  1K0R A;  1FVI A;  1Y1W G;  5GAG C;  2UUB L;  1I94 Q;  3UDX A;  1EQR A;  4RMF A;  4DUZ Q;  4OO1 I;  1QZH A;  3H0G G;  3NEN A;  2QA4 A;  1HZB A;  4NXM Q;  1N32 Q;  5IY0 A;  1K73 C;  3FKI H;  2PQA B;  4DV4 Q;  3JAM c;  5M3F G;  1R9T H;  2GN5 A;  1VQ5 A;  1GKH A;  1VQE A;  2JK8 A;  1SLJ A;  2GVB A;  2WAQ E;  4DK6 C;  4EX5 A;  4DUZ L;  1XJV A;  2R7D A;  2R7Z G;  3S14 H;  4A3D G;  2KHJ A;  2OTJ A;  1V9P A;  1KD1 C;  3GTL H;  4DR3 Q;  4HJ5 A;  3G71 A;  2Q2H A;  4LF7 L;  1N32 L;  5FLM G;  4DV4 L;  3CMA A;  4A3L G;  2PI2 A;  2D62 A;  2JA8 H;  2V1C C;  3E0E A;  3I55 A;  1OXU A;  4ME3 A;  4BY1 H;  4NXN Q;  3KJP A;  2E5L L;  3K8A A;  5IE8 A;  4H02 A;  1NBW A;  4APV A;  4JI2 L;  4JBK A;  4GS3 A;  3W1G A;  3J81 j;  3ICE A;  3KDF B;  3AFP A;  4A3E G;  4YCW A;  3NEM A;  2VUM G;  5M3M H;  4BXX H;  4QIW E;  1TWA H;  2FXQ A;  2EIF A;  3PUW A;  3JAM i;  1GM5 A;  4JBM A;  3T1H Q;  1L1O C;  1OXX K;  5GAH C;  4LNQ A;  4NXN L;  5GRO A;  4DV6 L;  4HJA A;  4LF9 Q;  1Q1E A;  5M5Y H;  2H5X A;  5IYC G;  4IFD G;  3GTQ H;  2KBN A;  2UXB Q;  3HOY H;  4WJ3 M;  5DLQ E;  1VQD A;  1NTG A;  2LXK A;  5C0X G;  3D31 A;  1HZA A;  1N34 Q;  5IT9 c;  2ZJQ A;  2A8V A;  4DV0 Q;  3T1H L;  3I4O A;  2ES2 A;  3PF5 A;  1BKB A;  4KLK A;  4A3F G;  4A3G G;  1AE3 A;  2B63 H;  3K81 C;  2PMZ E;  2E2I H;  3PO2 G;  4R4I A;  3SGI A;  4AYB E;  1EFW A;  2UU9 Q;  2UXB L;  4A3K G;  4X6A H;  3MXN B;  1GVP A;  4JYA Q;  1E1T A;  3S24 A;  5HGQ A;  1EWI A;  3HOV H;  4GN3 B;  1N34 L;  4LFA Q;  1E7Z A;  1E3P A;  2VY3 A;  5LMN Q;  3TEH B;  3BU2 A;  4JG2 A;  1D8L A;  4DR5 L;  2JA7 G;  5LMU Q;  4OON A;  4JI5 L;  3CC2 A;  1K8A C;  1E22 A;  1IBL L;  3PO3 G;  1XNQ Q;  2BA1 A;  2PQA A;  3M4P A;  1YJW A;  2UU9 L;  2LSS A;  1SMX A;  4UP9 A;  2R7F A;  4TQU S;  3S1N H;  2UUC L;  4GNX A;  2N78 A;  4LFA L;  5LMN L;  1Q8K A;  1E24 A;  4A93 G;  4BY7 G;  1YNX A;  2NN6 I;  3CCR A;  4A3I G;  1O7I A;  2WB1 E;  4DUY L;  1HNZ L;  1VQJ A;  1WJJ A;  3I7F A;  4QJF A;  2HQL A;  1Y14 B;  4A3M H;  1PH3 A;  1LM0 A;  4GN4 B;  2VL6 A;  4AYB G;  5JJL A;  1FJG Q;  4JBW A;  1V1Q A;  4PMW A;  5J3B A;  3HKS A;  2OTL A;  2EQS A;  3HKZ E;  2UXD Q;  3PV0 A;  4DR6 Q;  1HR0 Q;  1VQO A;  2QGQ A;  1WYD A;  1XPR A;  4PZ6 A;  3M7N A;  1SN8 A;  3CAM A;  1I3Q H;  3UE1 A;  4DR4 Q;  4LUV A;  3BZC A;  2L15 A;  5IYD H;  2R92 H;  4X66 Q;  1VQ4 A;  3EIV A;  5GAE C;  3HOW H;  1CKM A;  2N8N A;  2AHO B;  1V43 A;  3EN2 A;  3GTJ H;  2K14 A;  4O0A A;  3LGJ A;  4FDB A;  2VW9 A;  3G4S A;  1UWV A;  4AH6 A;  1HR0 L;  4B3T L;  1PH2 A;  2MFI A;  2CFM A;  1WI5 A;  4IPH A;  5C44 H;  1M90 C;  2WB1 G;  1VQN A;  3HOU H;  2DUD A;  4YCU A;  5C0X I;  3PF4 A;  2LXJ A;  2RCN A;  1W2B A;  1KC8 C;  4X66 L;  4HIO A;  4JI8 Q;  1X9N A;  4BBS G;  2CWP A;  2JQO A;  1Q7Y C;  4JI1 L;  3AQQ A;  4P73 A;  3W1B A;  2MNA A;  4KHP Q;  1VQH A;  3HKZ G;  4DV3 Q;  1N36 Q;  3DLL A;  1HNW L;  3CPF A;  1VQM A;  1OXV A;  1E1O A;  5H1S E;  4LWC A;  5BR8 Q;  3CCE A;  1PH1 A;  3PCO B;  5GQO A;  3F2B A;  5JEA J;  4DPG A;  3M4Q A;  2HHH Q;  2MO0 A;  4X65 Q;  4B3R L;  1A0I A;  1MKH A;  4R4O A;  1K83 H;  1VQ8 A;  5ELN A;  1KHI A;  1PYS B;  4UP8 A;  2YTY A;  2Z6K A;  3G48 A;  4DV3 L;  4YHH Q;  4KHZ A;  1UE7 A;  3OYY A;  1FGU A;  1HZC A;  2I5H A;  2C35 B;  1JJC B;  4IPC A;  3CCU A;  1NJI C;  1PH9 A;  1IZ6 A;  1CUK A;  5BR8 L;  3M85 A;  1YIT A;  3CCL A;  4DK3 C;  2HHH L;  3GTP H;  2MQH A;  5IP9 H;  4X65 L;  1YEZ A;  1Q46 A;  4A4I A;  1VQI A;  1KAW A;  3H15 A;  3K0X A;  4GNX C;  5K36 G;  1EIF A;  2K5N A;  2N49 A;  3A5Z B;  4P71 A;  1Q86 C;  1PFS A;  4YHH L;  4A3J H;  1CKO A;  1TWC H;  3CC7 A;  3TQY A;  2CCZ A;  1VS0 A;  1XPO A;  1VQP A;  2IHE A;  4YWL A;  3L2P A;  2JA9 A;  1U0L A;  1I94 L;  4P74 A;  4PZ7 A;  2JA5 G;  5JJI A;  2OQK A;  1A63 A;  5FJ8 H;  1OXS C;  4HIK A;  2E2J H;  2JEA I;  4DKA C;  1WCM H;  4A3B G;  4A3C G;  3A0J A;  1L0W A;  4NXM L;  3K80 C;  4JBJ A;  2F52 A;  3KF6 B;  2E8G A;  1JB7 A;  2JJQ A;  1S40 A;  1NE3 A;  2NVY H;  4JOI C;  1S3O A;  3MEF A;  4A76 A;  1EQQ A;  2GVA A;  2ZJR A;  2ZJP A;  2CQO A;  2Q2U A;  4DR3 L;  3W5O A;  4L5S A;  2QEX A;  3UDG A;  4L5Q A;  1XMQ Q;  1TXY A;  2YTX A;  2YV5 A;  2Z0S A;  3ER0 A;  2F3I A;  3NEL A;  2IHF A;  3J7Z C;  1Z9F A;  1U5K A;  3PUY A;  2VS1 A;  4R4T A;  1MIU A;  4OXP A;  2IT1 A;  1VQK A;  2XTI A;  5FLX c;  3I2Z A;  1LTL A;  3I4M G;  4GOP A;  2ID0 A;  4DR1 Q;  3S15 H;  3EBE A;  1XMQ L;  1EYG A;  2YTV A;  1JMC A;  3CXC A;  3HOX G;  3HOZ H;  4LF9 L;  2OCE A;  4BBR H;  3I4N G;  1RL2 A;  2K5V A;  5IYB H;  1Y1V G;  3A5U A;  4LFB Q;  2Z6K C;  3PUZ A;  5C4X G;  1X3F A;  1QUQ A;  3ULP A;  4UY8 C;  2I5L X;  2ZM6 Q;  4DR1 L;  4LFC Q;  3S1Q H;  2ASB A;  1PVO A;  5IP7 H;  2A1A A;  1KL9 A;  3F2D A;  4DV0 L;  1PV4 A;  4LF4 Q;  5E7N A;  3PGZ A;  3I56 A;  3M3Y H;  3PIO A;  2KCT A;  3KLW A;  4YWK A;  5C0X J;  1L1O B;  4LFB L;  1EIY B;  2KCM A;  3FKI G;  1PH5 A;  1G51 A;  1KRT A;  3CQZ H;  1PH4 A;  1S72 A;  4K0K Q;  2PI2 E;  2JA6 H;  2Y0S E;  2ZM6 L;  4JYA L;  4LFC L;  2K52 A;  4XTC S;  1VQ9 A;  2K50 A;  4GLA C;  2ATW A;  4JC0 A;  2I5M X;  5LMU L;  1B70 B;  1HNX Q;  5M5W H;  4WJ4 A;  2RHQ B;  4JI4 Q;  3UDI A;  1XNQ L;  1L2F A;  5GAD C;  3ZJY C;  1YJN A;  5AJ3 Q;  3CCQ A;  4B3S Q;  2VQE Q;  2JA8 G;  4K0K L;  3OTO Q;  2B29 A;  5LMN W;  1YHQ A;  4BY1 G;  2AWO A;  2D0O A;  1HZ9 A;  1DGS A;  1Z47 A;  3UDF A;  1W3S A;  3AFQ A;  4L5T A;  5HY6 A;  2NVQ H;  2AMC B;  1Y1W H;  1BBU A;  1IBK Q;  1HNX L;  3KDF A;  3CF5 A;  4IPD A;  3ERS X;  2E2H H;  3RN5 A;  4HID A;  4B3M Q;  4JI4 L;  5M3M G;  1WFQ A;  3H0G H;  2JE6 I;  1XMO Q;  1OXT A;  1PYB A;  1FJG L;  4BXX G;  2BH2 A;  4B3S L;  4OO1 G;  1VQB A;  3IRB A;  4MZ9 A;  1KQS A;  1N33 Q;  2VZA A;  2Y0S G;  2UXD L;  2R93 H;  4DR6 L;  1YVC A;  4IFD I;  3RLO A;  5M3F H;  2ZTC A;  4QGU A;  1IBK L;  4LF8 Q;  4DR2 Q;  1LUZ A;  2IX0 A;  3BJU A;  2KEN A;  1AH9 A;  4LF6 Q;  3HOY G;  3TRE A;  1TWG H;  4GOP C;  4B3M L;  4JI6 Q;  1YHB A;  3GTO H;  2JEB I;  1HR0 W;  4HJ9 A;  1PH6 A;  4YCV A;  1N33 L;  2BH8 A;  1A8V A;  1Q12 A;  4IJL A;  4IPG A;  3J80 c;  3CC4 A;  1X55 A;  1QZG A;  2VNU D;  1J6Q A;  4UP7 A;  4DR2 L;  2NVX H;  2B63 G;  1PHJ A;  5IWA Q;  2R6G A;  3L7Z C;  4LF5 Q;  1TWH H;  1NMG A;  1UE1 A;  4AIM A;  4DAY B;  5JEA G;  4JI8 L;  2VQF Q;  3GO5 A;  1OTC A;  4JI6 L;  2F4V Q;  3HOV G;  4A3E H;  2VUM H;  5IP7 G;  4DNI A;  4JI7 Q;  1Q1B A;  3B6Y A;  4KHP L;  1N36 L;  3S2D H;  2EXD A;  2HIV A;  2HT1 A;  5M5X H;  5EAY A;  3PUX A;  3UE0 A;  3KF8 B;  1L1O A;  4OWT B;  4IO9 A;  1CKN B;  1PA6 A;  4OX9 Q;  4QQB X;  1I5F A;  1X65 A;  2VQF L;  3E9I A;  5IYC H;  1XTD A;  4LW1 A;  1K9M C;  2F4V L;  4IOA A;  3T1Y Q;  4IOC A;  4JI7 L;  3S17 H;  3OW2 A;  4KI0 A;  5C3E H;  3RLN A;  2UUB Q;  4A3M G;  2KHI A;  1SE8 A;  4A3F H;  4BA2 I;  4A3G H;  4HJ7 A;  4ALP A;  3F2C A;  1YIJ A;  2OWO A;  3TRZ A;  1H95 A;  1PH7 A;  1VQG A;  1NY4 A;  3AEV A;  2IX1 A;  2OQ0 A;  1UEB A;  3S2H H;  1QVF A;  3JC6 6;  1SRU A;  3PIP A;  1AE2 A;  1N9W A;  4DV5 Q;  3CCV A;  5IYD G;  2JA7 H;  2R92 G;  1RIP A;  2NVT H;  3HOW G;  4LUO A;  3CPW A;  3J7A 5;  2YYZ A;  3DM3 A;  1VQA A;  3PO3 H;  4C3H H;  3TS0 A;  4LF7 Q;  2R93 G;  1ASZ A;  5C4J H;  4OWW B;  1MJC A;  3D0F A;  5C44 G;  3S1R H;  1WOC A;  4GNX B;  3HOU G;  4NPS A;  4GKJ Q;  4DV5 L;  4A93 H;  3L0O A;  2K5H A;  4BY7 H;  4JI2 Q;  4A3I H;  1TWF H;  1XPU A;  2Q2I A;  3TS2 A;  4C2M H;  2NN6 G;  4IJH A;  1VCI A;  3A74 A;  2NZO A;  3G6E A;  3U4V A;  4DV7 Q;  4JI3 Q;  4HIM A;  1GD7 A;  1QVG A;  4HJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...