4DK3C

Structure of editosome protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
83
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDKEFIVIRCMDQVKLGSRVLVQGTLRMNRHVDDSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
total genus 10
structure length 83
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk3C00
2ZTDA 3HOUG 3TRZA 4LFAQ 3ULPA 4DR6L 1RL2A 1HNXL 4QL5A 1VQGA 1OXSC 2R6GA 1VQFA 4A3DG 4KHPQ 2Q2IA 1PHJA 1EIYB 3B6YA 4R4CA 4LFCQ 2UUBL 4R4QA 2HIXA 1VQOA 2KHJA 3H3VH 3J81c 1A63A 1SN8A 1PH6A 4JI4Q 2HT1A 2E2IH 4NB3A 4X6AH 4R1JA 1EFWA 4GOPA 2XGTA 3K7AH 4A3MG 1JT8A 4BY1H 4RMFA 1W2BA 1N32Q 1LM0A 4GLVB 4DV1Q 2JA5H 4AH6A 4K0KQ 5M5YH 1XMQQ 5FJ8G 5C44H 3KJPA 2N78A 1HNWQ 3PSIA 2R93H 1E7ZA 1K83H 4BBRG 4LF8L 1YBYA 3KF8B 4TQUS 4BA1I 5IWAL 4DV3L 1X3GA 2Z6KC 3AFPA 1HR0Q 4PG3A 2MO1A 1K73C 3DLLA 1JB7A 3RN5A 2R7DA 4A3IG 1K8GA 3BZCA 3G4SA 4NXMQ 4JV5L 2CWAA 1MJEA 4A3BG 4OWWB 1NE3A 1UEBA 2Y0SE 1QUQA 3WWVA 3J7A5 1YJWA 4Y7NH 2OCEA 2PQAA 4JI5L 1M90C 2LXKA 1HR0W 3PUVA 4GKKQ 4A3FG 1PH7A 2IT1A 5JJLA 3CCRA 3F2BA 1NY4A 3HKZG 1B8AA 2HIVA 5BR8L 4GOPB 2KCTA 1TWHH 3BZKA 3ULJA 4JOIC 2ZTEA 1QVGA 4OXPA 4DV2Q 4JI0Q 5HY6A 1I94L 4B3TL 1Q1BA 4EQ5A 3FP9A 1I50H 1J6QA 4O2DA 4UP8A 1PH1A 3HOVH 4LF6Q 4KLKA 1N34L 2ALYB 4ALPA 4JYAL 1ASYA 2NZOA 1A0IA 3I2ZA 2KBNA 1EWIA 4H02A 2ZM6L 1VQ6A 1OXUA 5HGQA 4OWXB 4POFA 1Z9FA 2E5LQ 4A3CG 4Y52H 2EIFA 3HOWH 1PH2A 2UUAL 1K3RA 1Q1EA 3HKZE 3NELA 4HIKA 1SE8A 4IFDI 4HIOA 1Q8KA 2PQAB 2CCZA 1CSQA 2K14A 1G51A 3RZOH 2ZJRA 3F2DA 1PH9A 4DV7Q 3S1NH 1BKBA 4A75A 3H0GH 3KFUA 4L5SA 4LF5Q 1YNXA 3UDXA 4NXNQ 1X54A 1X3FA 2UXBL 4JI6Q 4P75A 1EOVA 1IBKL 4DAYB 1X56A 2RHQB 4DV6L 4DR7Q 1XNRL 2UXCQ 4BY1G 4IJLA 2B29A 2JA5G 4LWCA 4GOPC 4IPCA 2IX0A 4JI2Q 3KF6A 4DV4L 4ME3A 2R93G 4J15A 4X64L 1GVPA 1S40A 3CPFA 5C0XG 4GN4B 4TVAB 5GQOA 2QA4A 1EQRA 1WI5A 1FL0A 4AIMA 1Y1VH 3F1ZA 4DV5L 3GTQH 3GO5A 4BBRH 4UY8C 4LF4L 2AWNA 3J81i 3A74A 4MNOA 3UDGA 2IY5B 4C3HH 2F52A 2VW9A 1YHBA 1VQ7A 3I7FA 4POGA 2I5LX 1SRUA 1AE2A 3RLFA 4YWMA 4L5RC 1OTCA 4B3MQ 4HIDA 2DGYA 1XMOL 1MJCA 3CP0A 2RHSB 1Y14B 1YJ9A 4QJFA 3PF4A 3I4MH 3KF6B 4A3FH 2JA7H 2YTVA 1YVCA 1Q46A 3RZDH 3HOVG 3CXCA 1N8RC 3S16H 3CCVA 2JE6I 4X66Q 1J5EQ 4DR3L 3CCQA 4AQYQ 1XNQL 4JBJA 2K5HA 1PVOA 3L0OA 5FLXc 4OO1G 3OYYA 3K81C 4YY3L 1UE7A 3Q8DA 2K5VA 3HOWG 4BXXH 3S1RH 4WJ3M 4A3JH 4R4OA 4A4IA 3S14H 2VL6A 1FJGL 1E1TA 5JEAG 3D31A 4GN3B 3PGZA 3U4VA 4DR5Q 2A8VA 1KRSA 2ATWA 3UE0A 4IOAA 1XPOA 4DNIA 4DR2Q 3H0GG 1N9WA 1U5KA 1BVSA 1HNZQ 3RR5A 4A3GH 4P74A 1BBUA 5EAYA 4XTCS 1JMCA 3S2HH 5DLQE 1OXVA 3NENA 1YEZA 4OONA 4LF7L 5JJKA 2YTYA 1KQSA 2C35B 2NVYH 1E1OA 2IHFA 2LXJA 1MIUA 2D0OA 4X62Q 5LMUL 1VQ9A 4MZ9A 1VQLA 3EN2A 2CFMA 2EQSA 2UXDL 5M5WH 4JI8Q 2FXQA 4DUZL 4DAMA 1PH3A 1EQQA 3CC4A 4IPGA 4YHHL 4C3JH 5M5XH 1Y1VG 3HFZB 4OX9Q 4FDBA 1PYSB 2BA0A 3GTPH 1O7IA 3T1YL 1Y1WH 1YIJA 3D0FA 4DR4Q 1IBMQ 1U0LA 2OQKA 3NBHB 4B3SQ 3H3VI 2HHHL 2VNUD 3E9IA 4DK6C 4JBWA 4YWKA 3ZJYC 5GAHC 4JI3Q 3GTLH 1X65A 1PH4A 2HQLA 3GTKH 3KLWA 4A93H 4GKJQ 2OTJA 1IBLL 2JEBI 4DV0Q 1KXLA 2ASBA 5LMNL 2UUCQ 1PH5A 3I4MG 1XPUA 2JA7G 1I5FA 3J80c 2PNHA 1B70B 1LTLA 1KRTA 4APVA 1RIPA 3IRBA 4HJ7A 2XTIA 1JJGA 3JC66 2YYZA 4DPGA 5C0XI 2GN5A 4X65L 1N36L 1KL9A 3G6EA 4YCVA 3JAMi 2NN6G 2OTLA 3CCLA 3UE1A 4A3KH 4BXXG 5GROA 4IPHA 4A76A 4A3JG 3CC2A 3KDFA 1B7YB 4LUZA 5GAEC 1K8AC 4JBMA 2VQFQ 1NTGA 1T9HA 2MQHA 4DUYQ 3S24A 3HKSA 1P8LA 4JI7Q 4LFAL 1AH9A 1VCIA 1N33Q 2F4VQ 4IJHA 3OTOQ 4A3EH 5JJIA 2ZJPA 1SFOH 1YZ6A 2CKZB 1QUQB 2R7ZG 1NBWA 4KHPL 1G291 4C3IH 4A3GG 4LFCL 2PI2A 3PUZA 4JI4L 2K75A 1YHAA 2N49A 4LF9Q 1CUKA 2F3IA 4O0AA 4X62L 3CF5A 4HJ9A 1S72A 3M9BA 4JBKA 2VS1A 3PCOB 4C2MH 4DV1L 3W5OA 1TWGH 1N32L 4K0KL 4IFDJ 4MTNA 1C9OA 1XMQL 4QY7A 4NPSA 3STBC 1WJJA 3CCMA 1VQ4A 1QZGA 2B3GA 1D7QA 2UU9Q 3MEFA 1HNWL 4DR1Q 4PZ7A 2VQEQ 3KDFB 2BA1A 1HZAA 1NMFA 1TWAH 1I3QH 4GNXA 1WOCA 1GD7A 3W1BA 2I0QA 3T1HQ 3G48A 1VQPA 1HR0L 4LFBQ 4LW1A 5M3FH 1Y1WG 1X6OA 3TS2A 4B3RQ 4BBSH 4NXML 3BU2A 1M1KC 1XPRA 2JEAI 2NVQH 1CKNA 1W3SA 4A93G 5FLMH 3KOJA 4GKKL 3S17H 2K50A 3U4ZA 5C3EH 1L2FA 1VQEA 1GKHA 4DR6Q 3K7UC 1HNXQ 3PUWA 4DV2L 2WB1G 1VQJA 2K4KA 3S2DH 4JI0L 1H95A 3F2CA 1PV4A 5IP9H 2UUBQ 2VY3A 2V1CC 4LF6L 2NZHA 1IZ6A 3AYHB 2IHEA 2Q2HA 2IX1A 1FGUA 1IL2A 3PUXA 4GNXB 3CQZH 3K0XA 4DK3C 5IP7H 4L5TA 3RLNA 1NMGA 2WAQG 4XIGS 4JC0A 4A3KG 1XJVA 2E2JH 2E5LL 1I6HH 3J81j 2N8NA 2Z6KA 1PA6A 1CKMA 3MXNB 2MNAA 2OQ0A 3HOYG 1VQCA 1QZHA 1VQ8A 1YHQA 1CKNB 4LF8Q 5IWAQ 4DV3Q 1VQAA 3FHWA 2WB1E 3VDYA 1A8VA 4A3EG 1GM5A 3M7NA 1CSPA 3CCUA 2OWOA 2JA9A 3J80i 2GVBA 4DV7L 5C4XH 1AE3A 1C0AA 3PV0A 4JV5Q 2VUMH 4LF5L 4NXNL 2BH8A 2I5HA 5IYCH 2AHOB 4LUOA 1S3OA 4JI6L 2JJQA 2N3SA 2WAQE 2AMCB 3RLOA 1PH8A 2R7ZH 3KYHC 1HZCA 3GTOH 4DR7L 2UXCL 1YITA 5BR8Q 1Q12A 4JI2L 2NN6I 4P72A 3M85A 1OXTA 1OXXK 3GTJH 1VQMA 1WCMH 1I94Q 4LFBL 4B3TQ 3UDIA 2YTXA 3M4OH 3PO2H 4B3RL 1N34Q 4JYAQ 2B63H 4BY7H 1V43A 1NJIC 4UP7A 5M3FG 5E7NA 4GNXC 5GADC 3AEVA 2ZM6Q 2CWPA 4BBSG 3RN2A 3CW2C 2KENA 2CQOA 3M4PA 3U58A 3PO3H 3PIOA 1YJNA 3L7ZC 2E8GA 3I56A 1A62A 1X9NA 5FLMG 2UUAQ 1UE1A 4LUVA 3E9HA 3ERSX 2D62A 1E24A 3ER0A 4A3LH 4JI1Q 1HH2P 3A5ZB 4IPDA 5C3EG 3U50C 1K9MC 2EXDA 1EUJA 4B3ML 3FKIH 1IXRA 3ULLA 1Q7YC 2D0PA 1ASZA 5IP9G 3GTMH 1EIFA 1TXYA 3TEHB 1Q82C 1HZBA 2E2HH 2MO0A 4PZ8A 1JJ2A 2Y0SG 2Q2TA 2JA6H 3M3YH 2UXBQ 2PMZE 2H5XA 1IBKQ 4DV6Q 4X66L 1XNRQ 1J5EL 2JA8H 1X3EA 3I55A 4AQYL 5IP7G 1E3PA 2ZJQA 2WP8J 1KD1C 4UPAA 4DV4Q 5GAGC 4P73A 3CCSA 1DGSA 2WFWA 3CPWA 4KI0A 2BH2A 2GVAA 4X64Q 2JK8A 5C4JH 1VS0A 4QQBX 4DR5L 1BBWA 3J7ZC 3CC7A 5C4XG 4DR2L 5M3MH 4DV5Q 3HOYH 2VUMG 4R4IA 5IYCG 4LF4Q 5C0XJ 4LNQA 3CD6A 1HNZL 3HOZH 1L0WA 5IYBH 3I4OA 4GLXA 5IYDH 1SLJA 3K8AA 3A0JA 1UE5A 3TQYA 1VQ5A 3RNUA 1FVIA 5ELOA 4DKAC 4AYBG 3LGJA 4HJ8A 1XMOQ 5ELNA 1WCMG 2QEXA 2L15A 3CMEA 2Q2UA 2Z0SA 3I4NG 1PFSA 3CCJA 3PO2G 4JI8L 5AJ3Q 4KHZA 4GLAC 4OO1I 1IYJB 1WFQA 4QGUA 1Q86C 2B63G 4BY7G 4EX5A 4HJAA 3OW2A 3CMAA 1Z47A 2I5MX 4DR3Q 1XNQQ 1X55A 1KAWA 4OX9L 1HZ9A 1L1OA 3PO3G 4YY3Q 4DR4L 1IBML 2R92H 4PZ6A 4B3SL 4JI1L 3L2PA 1VQHA 4BA2I 3GD7A 4JI3L 3HOXH 4A3LG 2RF4A 4AYBE 1V1QA 2YV5A 1FJGQ 1CKOA 4GN5A 4GKJL 1C7YA 1JE5A 1VQIA 1TWCH 3FKIG 1WYDA 5K36G 4DV0L 3HOUH 2UUCL 1SR3A 3UDFA 1PYBA 2A19A 4OWTB 2K52A 2JA6G 5JEAJ 1R9TH 1VQDA 1MKHA 1XTDA 3M4QA 3TS0A 1KC8C 4A3DH 2JA8G 5C44G 4R4TA 4JG2A 2NVTH 3H15A 4LF7Q 5H1SE 4A3MH 5LMUQ 1L1OB 3EIVA 1JJCB 5IY0A 1SROA 3W1GA 3SGIA 2UXDQ 3CCEA 1KHIA 1Q81C 3EBEA 5FJ8H 1YI2A 4DUZQ 1E22A 3K80C 4YCUA 2VQFL 1QVCA 4YHHQ 1VQKA 2AKWB 3JAMc 4DUYL 2NVXH 4JI7L 3S15H 2MFIA 3DM3A 5M3MG 3KJOA 1N33L 3OTOL 3E0EA 2F4VL 3AFQA 1D8LA 1HJPA 4YCWA 4HJ5A 1QVFA 2R7FA 4PMWA 5IT9c 4IO9A 3T1YQ 1P16A 4A3IH 2JQOA 2LSSA 2ZTCA 1TWFH 4RG1A 5IYBG 5IYDG 3HOZG 4QIWE 2HHHQ 3GTGH 3PUYA 4A3BH 4GS3A 4IFDG 1LYLA 3AQQA 2RCNA 4LF9L 3PF5A 1K0RA 1KIXA 3TREA 4WJ4A 1IBLQ 2QGQA 4JOIA 3G71A 1UWVA 1GO3E 3NEMA 5AJ3L 4JI5Q 5LMNQ 1V9PA 5J3BA 1UE6A 2DUDA 3BJUA 2K5NA 1EYGA 1G6PA 5IE8A 2YU9H 3ICEA 1LUZA 2UU9L 4JCVE 4UP9A 3PIPA 2KHIA 2VQEL 2A1AA 4DR1L 3S1MH 1VQNA 1SMXA 2PI2E 3A5UA 5LMNW 4HIMA 4X65Q 3T1HL 3I4NH 1N36Q 2VZAA 2KCMA 4YWLA 3F8TA 3STBD 2R92G 1L1OC 2ID0A 4L5QA 4P71A 2ES2A 1VQBA 4A3CH 4IOCA 3HOXG 3S1QH 3GDEA 2AWOA 3CAMA
chains in the Genus database with same CATH superfamily
2A6ED 2ZTDA 3HOUG 4JVZA 5CR3A 4L6TB 2PZTA 1RL2A 4QL5A 4A3BB 3TP7A 5KEEA 4A3DG 1PHJA 4R4CA 1A63A 2KHJA 3J81c 4DAPA 4RA8A 4R1JA 4PNYA 5FKAC 1LTID 2YU9B 4DV1Q 2JA5H 4AH6A 2MJ8A 1XMQQ 5FJ8G 3KJPA 4B08A 1X3PA 4BA1I 5IWAL 4DF7A 5C0XH 5IODA 4KY6A 2MO1A 1K73C 3G4SA 4RCNA 5EKKA 2CWAA 1IKMA 2Y0SE 4FVMA 3J7A5 2PPBC 5JJLA 4GKKQ 5LL6S 2C9OA 1GUNA 1TY2A 3BZKA 3ULJA 2ZTEA 2GA4B 1TS2A 4DV2Q 4JI0Q 1U4MA 1PTOF 1Q1BA 4EQ5A 3FP9A 2OF1A 3K7AB 4O2DA 4UP8A 3HOVH 1N34L 2F0PA 4ALPA 2NZOA 5M5YB 5CC4A 4TKOB 3QB3A 4RGNA 4R8IA 2F0WA 1K3RA 3NELA 1S5DD 4IFDI 5J22A 2EYPA 3URYA 3IFTA 5JEAH 3GTKB 3UI2A 2F0DA 4A75A 4Y7NB 1X54A 4DAYB 2RHQB 4BY1G 2IWHA 4LWCA 3H3VC 3KF6A 1I50B 2R93G 4TRDA 1NR4A 1OO9B 1PZJD 1PDQA 1S40A 3QOLA 4GN4B 3F2UA 1E2ZA 3N52A 2CW0C 5COYA 4DV5L 3HOWB 3SEBA 2R61A 2F0UA 3J81i 2JXMB 1Q8IA 1YHBA 3S1NB 1SRUA 5I9OA 4H0LC 2DGYA 5HURA 1V1OA 2JA7H 4RGMA 1F2ZA 1YVCA 1PFNA 1Q46A 3RZDH 3S16H 4OEMB 4NMZA 1ILPA 1JQYD 1CI3M 1Z7TA 5CBEE 2HDLA 3Q8DA 2K5VA 1IKLA 1PZKD 2X6LA 4BXXH 2A6HC 2XNAC 2VL6A 1Y1VB 1BOSA 4GN3B 2A8VA 1ENCA 3UE0A 4GZYC 3H0GG 1I4XA 3NBHA 1D6EC 1U5KA 4C56C 1BVSA 1DOMA 1U4PA 3S2DB 4A3GH 1NSNS 1BBUA 4XTCS 1JMCA 4F87A 1CQVA 2YTYA 3I4MB 2L5TA 1AEXA 4FF2A 3J7AF 5LMUL 1EEFD 2PYKA 4IURA 2CFMA 2B2TC 4JI8Q 2O5IC 4DAMA 1PH3A 4EGVA 4YHHL 1D5MC 3QIAA 2P5ZX 1JWSD 4OX9Q 4FDBA 1PYSB 4PV1C 5E4WC 3GTPH 3S1RB 1Y1WH 1IBMQ 3H3VI 3SVMA 4C3HG 1D2BA 2LS01 5EKLA 1LTRD 1J8IA 1RHPA 2F0MA 2UUCQ 1I5FA 4FXKC 3IRBA 3JC66 1KNAA 1S5CD 3HP3A 5IIFA 1QNKA 1CZGA 4RGOS 3I70A 1KL9A 3JAMi 2NN6G 1K8MA 5M5WB 5I9PA 2M2LA 3CC2A 1KTKA 4C3JB 2O2LD 1T9HA 3S24A 1AH9A 4CDFC 3PQIA 3V2TA 4A3EH 2ZJPA 2B2UC 1YZ6A 5D14A 1QUQB 2R7ZG 1NBWA 1G291 4X3TA 3VYRA 2FMMA 3CF5A 1CHQD 1S72A 5FOBB 4JBKA 1D1IA 1PLFA 2F0TA 4G7HC 2VS1A 3PCOB 4DV1L 2F3VA 4IFDJ 1MSHA 1D1KA 1XMQL 3CCMA 1ONLA 1C48A 3OMGA 2VQEQ 1HZAA 1NMFA 5ELCA 3LWEA 1HHVA 4N9PA 2DNEA 3GV3A 1BCPC 1KLUD 1G8ZD 1JOKA 1KAAA 1TKWB 1CKNA 1LT5D 3LWUA 4A93G 5FLMH 4GKKL 2L12A 1WTPA 2K50A 2A69D 1EU3A 5C3EH 4DN4M 4DR6Q 4K5WA 4DV2L 2K7VA 4JI0L 2L4NA 5IP9H 1T5EA 3C1FA 2FHTA 4HCEA 2IHEA 1TWGB 2Q2HA 2IX1A 1FGUA 4C1NI 1WTRA 3CQZH 3K0XA 4DK3C 1BUVT 3RLNA 1NMGA 2WAQG 1AZQA 1CKMA 1I3QB 3E6ZX 2MNAA 1EOTA 1EY7A 2OQ0A 3HOYG 1VQCA 3K5MA 4BS9A 1JORA 1O7ZA 2PMZB 1A8VA 1H9SB 3CCUA 4PMCA 2JA9A 2GVBA 3J81E 3IFDA 4HSVA 2BH8A 3S17B 2WAQE 2R7ZH 3EFXD 1BO0A 3KYHC 1B50A 4WRDA 1ZXTA 2NVTB 4KD3A 4QUFA 2B2YC 1SNPA 3M7GA 4H44C 1I94Q 2RDGA 2WV6D 4XT1B 3P1HA 2E2JB 2Q8TA 1MI2A 1ICFB 4RKLA 1LT6D 3TMEA 2ZM6Q 4BBSG 2K5WA 2NTSA 1WVLA 2OT2A 3DM1A 3P20A 3X3MA 5T1IA 2QILA 5IT9L 1UE1A 4LUVA 3E9HA 1B2TA 4CGYB 4IPDA 1EUJA 3HG9A 2MPMA 2VUMB 3FKIH 3PMFA 2R3ZA 3GV6A 1Q7YC 2D0PA 3GTMH 1VMPA 1TXYA 4IUTA 3D6WA 1A15A 2WKCA 2JA6H 3M3YH 3NQTA 3NHHA 1WD0A 1WCMB 2WP8J 4UPAA 3I4NB 5GAGC 3CCSA 3PO2B 1PRTC 3CPWA 2BH2A 2QEJC 2ZXRA 5A2QE 4BY7B 1SYEA 2K05A 3J7ZC 4F7XA 5C4XG 4CDDC 1A2UA 3HOYH 2K5QA 4K6DA 3E3XA 2NTTA 3I4OA 4GLXA 4FF1A 1SLJA 1K8OA 1VQ5A 4IFDH 5ELOA 4AYBG 5JPNC 2SNMA 1EYAA 4KTAA 1XMOQ 4OHJA 1QG7A 4DK0A 4C1NK 4JI8L 2N88A 2B2VA 1WFQA 2B63G 3OOCA 1XNQQ 4OX9L 1L1OA 1TQOA 1IBML 5I2YA 2EJGC 4PZ6A 2JN4A 3L2PA 2A6EC 2RF4A 4AYBE 3GQBA 3R93A 4G57A 1FJGQ 4GN5A 1C7YA 1VQIA 5JJZA 4CKCA 2UUCL 3MEHA 1R4PB 2JP1A 4FF4A 1MKHA 3TS0A 5EBDA 2JA8G 5C44G 2F0EA 2J7ZA 5IOCA 1JJCB 4O42A 2Q8IB 3EQLC 3SGIA 1II3A 3CCEA 1Q81C 3EBEA 4DUZQ 4YCUA 2NVXH 2AKWB 3S15H 2L55A 5M3MG 2CH4W 3E0EA 4YCWA 1D8LA 4HJ5A 3T1YQ 2HCCA 1P16A 5IYBG 1DYQA 1TWFH 5KGUA 5CMDA 2XIWA 3HOUB 3PF5A 3QG1A 1A3VA 1SBBB 3TREA 4JOIA 1UWVA 1IL8A 1GO3E 5LMNQ 2F3WA 4A3DB 1XTCD 2K5NA 3J7YW 5IE8A 1CA5A 2ZXPA 2VQEL 3NTHA 3DWQA 3S1MH 1SMXA 3A5UA 5LMNW 2PZUA 2WIIB 2VZAA 2ID0A 4A3CH 4HMJA 4IOCA 3V96A 1TU2B 3GDEA 2B2UA 5J1ZA 3CAMA 4CBVA 3D6CA 2BDNA 4DR6L 5C3WA 5C4HA 1EIYB 4LFCQ 2J4XA 1EEID 3H3VH 2HIXA 1VQOA 1QJOA 2K28A 4JI4Q 4MN3A 2HT1A 2LY7A 4X6AH 3H09A 1EFWA 1GJXA 2DY8A 2KCNA 2XGTA 4GOPA 4A3MG 1VF5C 2K5DA 1JT8A 4KHVA 2V4DA 1W2BA 1LM0A 3LNNA 1SYBA 5C44H 1RTOA 1QCBD 2EYMA 2CVRA 2EYFA 3MC0B 4TQUS 1NCVA 1X3GA 5DEHA 2Z6KC 3AFPA 1HR0Q 1JB7A 3VR3A 2R7DA 4A3IG 1S5ED 5C5LA 4B9WA 3BDCA 4OWWB 1NE3A 2SNSA 4J6HA 3BDLA 3HS0C 1YJWA 1M90C 1HR0W 4A3FG 2IT1A 3CCRA 3F2BA 1NY4A 1B8AA 2HIVA 1SYFA 2KCTA 1TWHH 1QE6A 4OXPA 1ET6A 5HY6A 1I94L 2E2IB 1E0BA 3EJIA 4BY1B 4LF6Q 4KLKA 2ALYB 3R2TA 4FYDA 4PQXA 1A6XA 1B1ZA 4H02A 2ZM6L 1VQ6A 2E5LQ 3KUPA 2BCOA 4FP5D 1K83B 1LO5D 2I07B 4UAIA 2EIFA 4ZAIA 1YNND 3O13A 1Y1WB 1H9RA 1PH2A 1Q1EA 4HIKA 1LLRD 4F88A 4P2CB 3CHBD 4NP5A 4HIOA 1F9PA 2MHVA 2CCZA 2BE5D 5CORA 3RZOH 2SOBA 2ZJRA 3F2DA 4DV7Q 1U4RA 4K14A 4L5SA 1Q3LA 4JI6Q 4P75A 4DR7Q 4IJLA 2JA5G 4IPCA 1IW7D 2IX0A 4JI2Q 4ME3A 5KNBA 5TSSA 3SK4A 4NDXA 4DA2A 1VF7A 5C0XG 3C46A 4TVAB 5GQOA 2QA4A 2H1EA 1FL0A 3F1ZA 1LABA 3GO5A 3GTQH 3RD4A 3A74A 4MNOA 3HRZC 1AN8A 1Q90A 2F52A 1HFGA 1VQ7A 3I7FA 4QMGA 3TZUA 2VB3X 3H0GB 5CV9A 1XMOL 1MJCA 3CP0A 5EKIA 1YJ9A 3SK8A 3PF4A 1I4QA 3KF6B 4A3FH 2F0HA 2KQ3A 2K1BA 3HOVG 3TP6A 3CXCA 3FRPB 3WDNA 3LX0A 5FK9C 1J5EQ 1XNQL 4AQYQ 4JBJA 3SDZA 2KEDA 3OIPA 5FLXc 4EVOA 1RDPD 4R4OA 2SDFA 1FJGL 1E1TA 2EXZA 2IJ0A 3VR4A 3D31A 5KYLA 3PGZA 5JEAG 3OW7A 1XPOA 1G6ZA 4C3HB 1CHPD 4P74A 3NENA 1YEZA 1F2MA 1TR5A 4X3UA 1UEAB 3P7JA 1KQSA 5BN4A 1E1OA 2LXJA 3I4LA 3MFGA 1VQ9A 1VQLA 4MZ9A 2EQSA 4DUZL 4KV6A 4IPGA 5M5XH 4WJWA 5CV7A 3K59A 2XWBB 1F2YA 3TZDA 1PZID 1UUPA 5ELFA 3T1YL 3D0FA 4IN3A 3K5LA 1AZPA 3NBHB 4B3SQ 3S14B 2VNUD 1STEA 3GTLH 2A69C 5GAHC 3ZJYC 1V8QA 1X65A 1EY0A 2JSOA 1PH4A 1G2SA 3BYYB 3OHXC 1S5FD 4LK1C 2JEBI 1W6JA 5T1GA 2R7ZB 2ASBA 5LMNL 1PH5A 1XPUA 2JA7G 3S2HB 4APVA 4HN7A 5I2XA 2XTIA 1BXTA 2NVYB 2GN5A 3C1EA 3BVZA 4J8QA 1TT2A 3ND8A 4IZ8A 2OTLA 3VA7A 2KCCA 3UE1A 4A3KH 4BXXG 3KDFA 3E5SA 4LUZA 1BF4A 4JBMA 3BYTB 2F4IA 4LAAA 4DUYQ 3HKSA 2F4VQ 4IJHA 1EY9A 3OTOQ 5JJIA 3TDQA 1KABA 1SFOH 3IAYA 2CHBD 4A3GG 1PFMA 4LFCL 2PI2A 3R3OA 4A93B 1SJED 4JI4L 4H13C 1CUKA 1MSGA 2F3IA 4O0AA 4X62L 1EFID 1F9QA 4HCSA 4C2MH 3NWTA 4MTNA 4QY7A 1VQ4A 2TMPA 1WJJA 3STBC 1LACA 1D7QA 3MEFA 4CKEA 1TWAH 1FR3A 4GNXA 2Z8LA 2L0CA 5FO9B 2I0QA 1VQPA 1HR0L 4LW1A 2WAQB 1ILQA 4XYQA 5M3FH 4G7ZC 1Y1WG 3MXNA 5FO8B 1M1KC 3HOYB 5CBAE 1W3SA 5G3LF 2QW7A 1GUOA 3A8KE 1GKHA 1A3TA 1HA5A 2EY1A 1QOHA 3PUWA 1HNXQ 2K4KA 3QO2A 1SNOA 3F2CA 1PV4A 3K6OA 3ND9A 2V1CC 2E76C 5EGTA 4LF6L 1HPCA 3AYHB 2HUGA 3KK7A 2E5LL 1S5BD 1XJVA 4XIGS 3ERQA 2QF7A 2Z6KA 1NUCA 1QZHA 1VDZA 5A2QL 1CKNB 4LF8Q 4DV3Q 2B2WC 1VQAA 4A3EG 1GM5A 4BBSB 1STGA 2IW3A 1WTVA 2K01A 2OWOA 1C0AA 4DV7L 4U673 2NVQB 1AE3A 4R9WA 5IYCH 2AHOB 4LUOA 2TSSA 4JI6L 1GUWA 1XX8A 4DR7L 2AMCB 3RLOA 3GTOH 1L0YB 1HUNA 4V190 4ABNA 3QWNA 1YITA 1Q12A 4JI2L 3VYUA 4P72A 1OXXK 1O78A 4LFBL 4B3TQ 3M4OH 2YTXA 2IPKD 4CDEC 4JYAQ 3GP7A 4UP7A 1I6HB 2NVXB 5GADC 3AEVA 4R8NA 3JAML 2RKSA 5KIXA 3RN2A 3CW2C 1WTWA 2CQOA 3PO3H 4WORA 3PIOA 1PRTF 3L7ZC 4N8FA 3W2DA 5FLMG 2VXWA 5DNFA 1JC7A 3ERSX 5LHY1 1E24A 1QILA 4A3LH 1WTOA 3A5ZB 5C4XB 5C3EG 1K9MC 1RKNA 2EY5A 1I4PA 3MXPA 3VA5A 3ULLA 5IP9G 1EIFA 3HKZB 1HZBA 2XVSA 4PZ8A 1JJ2A 2ICEC 4HSPA 4RHSA 4IUUA 4UDUC 1J5EL 1EY6A 2JYOA 5L37A 4MTKA 4AYBB 4K5VA 4AQYL 1IYVA 3NBIA 4WFN3 4P73A 3WOEA 3SR1A 2WFWA 4X64Q 2B63B 1VS0A 1WTXA 1JCKB 4QQBX 3P75A 3VYSA 3NQIA 4R4IA 4ODGA 1HA6A 3NUCA 3HOZH 1L0WA 1HCZA 4BWGB 3CRKC 2RSOA 1SEBD 2L11A 3DWPA 4KY5A 3K8AA 4OGQC 3A0JA 3RNUA 3OSOA 1EU4A 2E2HB 4HJ8A 5LL6X 2EE1A 2L15A 1SE3A 2Z0SA 1LTBD 2A73B 2JA8B 2F0VA 4KHZA 5C44B 2EYHA 5JOBA 4EX5A 1SNMA 1Z47A 1KAWA 2B39A 1HZ9A 5FO7B 4YY3Q 1QNUA 5C4JB 2R92H 4B3SL 4JI1L 4BA2I 3HOXH 5M3MB 1ZEQX 3FKIG 1NNXA 3FDTA 3NP8A 1SR3A 3UDFA 2JA6G 2L9HA 3D4RA 1VQDA 1XTDA 3M4QA 1IHZA 1SE4A 5FLXE 4HMIA 5ELEA 4JG2A 1GOZA 3S9WA 4F8MA 1L1OB 4CJ2C 1SROA 3W1GA 2UXDQ 1KHIA 3Q22A 3K80C 4G7OC 4DUYL 2MFIA 2F4VL 2F0JA 3OTOL 3AFQA 5IT9c 4PMWA 3L9AX 2LSSA 4RG1A 3I8ZA 4ME5A 2HHHQ 1BNZA 3OWFA 3PUYA 1TWCB 4A3BH 4GS3A 4IFDG 2E2DC 3AQQA 3NSWA 2WINB 1K0RA 4DGZA 4X3KA 1M4VA 3G71A 3T51B 2DJFC 5AJ3L 1UE6A 3BJUA 2YU9H 1LT4D 1LUZA 2EJFC 3PIPA 2EJMA 4A3MB 4HIMA 3R8BA 4QF4A 1N36Q 1TVXA 1YNNC 3F8TA 3STBD 4ZCKA 4L5QA 4P71A 4S3SA 2AWOA 2HCIA 2BE5C 4HR7B 5I6WA 1HTPA 4LFAQ 4A3IB 3ULPA 5C3XA 1W6KA 4Q5VA 1HNXL 1VQGA 3GTGB 4KHPQ 1RODA 3BS1A 3B6YA 1DOKA 4OIKA 1PH6A 4A3FB 1DXMA 1IW7C 2PCFB 3K7AH 5DM73 4JPBW 2D9UA 5D65A 3CRLC 3IL8A 3KBXA 5M5YH 2WACA 1YNJD 2RA4A 2N78A 3FEWX 3NE5B 4BBRG 4LF8L 1YBYA 3KF8B 4DV3L 4PG3A 2E75C 5A35A 1HQRD 3RN5A 1K8GA 3BZCA 4NXMQ 1PTOB 1QUQA 1SMYD 2OCEA 2PQAA 4JI5L 4Y7NH 2LXKA 3OIQA 3HKZG 2A74C 3G6JB 4GOPB 3SK6A 1ENFA 4K2LA 1GUSA 1O80A 4XDXA 2RDFA 3MWYW 4B3TL 1VMCA 4MIUA 1K28A 1UNSA 1I50H 1C4QA 1STBA 1GHJA 4JYAL 3HGBA 2JA5B 1A0IA 2KBNA 2SEBD 4M1UB 1H9MA 1GUTA 5HGQA 4A3CG 4POFA 2B2WA 3NTKA 2M00A 3HOWH 1EYDA 3KLSX 3HKZE 2NUCA 1Q8KA 1XYIA 2K14A 1PH9A 3S1NH 3BZDB 2H4OA 1BKBA 2FMCA 3KFUA 3UDXA 4NXNQ 1EOVA 2WB1B 2IX3A 2XWJB 2UXCQ 1FD7D 2B29A 3NPPA 3K5NA 2X6GA 1CQFA 2B2TA 2FFKB 3HOVB 4X64L 1GVPA 3I73A 3CPFA 1KDAA 1EQRA 1HTLD 4K8IA 1U4LA 1Y1VH 4B9XA 4KMUC 4BBRH 1QWYA 1GXDC 5DAUA 2AWNA 3TBIB 2CQAA 1JB3A 3A7LA 4POGA 2I5LX 3RLFA 1AE2A 4YWMA 4L5RC 1TY0A 4B3MQ 1B53A 4HIDA 2FJ2A 4E6IA 1Y14B 3I4MH 2F0QA 1N8RC 2BOSA 5C5MA 2K5HA 1PVOA 3L0OA 2XRQD 3K81C 3SK5A 4YY3L 3IKJA 3S1RH 5D3DA 4A3JH 4WJ3M 4A4IA 2F0OA 2KEEA 3U4VA 3VR6A 4DR5Q 1L0XB 2RCFA 2ATWA 1Y8PB 4DNIA 4DR2Q 1MGSA 1N9WA 1NR2A 1SYDA 1KDBA 1STNA 2K32A 4IUPA 3RR5A 5EAYA 4K5XA 1PTOD 3DMUA 5DLQE 1OXVA 1HRJA 5JJKA 2JA7B 2QKIC 5ELDA 3RZDB 1MIUA 2D0OA 4X62Q 3S16B 1HUMA 2UXDL 5M5WH 3TP5A 1F77A 2M9VA 3CC4A 2HDMA 2F0NA 1HQMC 1V1PA 4C3JH 3HFZB 1WTQA 2BA0A 2HD3A 1O7IA 1R4QB 2PQEA 4DR4Q 1U0LA 4ZK9B 2HHHL 4DK6C 4YWKA 4PMBA 2HQLA 1NAPA 1A2TA 2NB0A 4GKJQ 2OTJA 3W3AA 4DV0Q 3Q6SA 3EVQA 3ZYYX 4A3GB 3J80c 1B70B 1LTLA 2YYZA 1EY8A 4DPGA 5KRUA 4IUVA 3BG3A 1N36L 5ISRA 4YCVA 3G6EA 4XT3B 4XQQA 3CCLA 1RCVD 5GROA 4A76A 1DOLA 2G9DA 5G3LD 1ESFA 5GAEC 1K8AC 2DY7A 2VQFQ 1NTGA 2MQHA 3GTPB 4JI7Q 1P8LA 4LFAL 2K04A 2AQ1B 2AQ3B 2CKZB 1CK1A 4CKBA 3RMHA 4KHPL 4C3IH 2F0FA 3PUZA 1SDFA 4QCLA 2K75A 2Z1CA 2N49A 4HJ9A 3M9BA 2PW7A 1U9RA 2B2YA 1TWGH 4QIWB 1C9OA 4NPSA 1SNCA 1QZGA 2B3GA 2UU9Q 3FMCA 1B44D 2Z4HA 3KDFB 1LTTD 2PO4A 1SJHD 4K8JA 1I3QH 3DXJC 1WOCA 1GD7A 4RGTA 4LFBQ 3T1HQ 3G48A 3T53B 2XN9C 1LV9A 2VB2X 3TS2A 5CV8A 4NXML 3H6MA 3BU2A 2JEAI 5EBCA 2F0KA 4NKLA 2XSCA 5F2DA 3KOJA 4A3EB 2K33A 3S17H 4K6LA 2EY6A 5I4DA 2WB1G 1VQJA 3MAQA 5CYUA 3T56B 2UUBQ 1UAPA 4KY7A 2NZHA 1IZ6A 3A56A 1IL2A 2RDHA 5KNDA 4DAVA 4GNXB 1QB5D 2E74C 5IP7H 4L5TA 4A3KG 2E2JH 4JC0A 1CT1D 2N8NA 1PA6A 3MXNB 3U9OA 1AP0A 4ID6A 2R92B 3CKIB 1YHQA 4RCOA 2KECA 3FHWA 2WB1E 3VDYA 3M7NA 1CSPA 2EVBA 1BR9A 2PW5A 3J80i 4X3SA 3PV0A 4JV5Q 2VUMH 1SXTA 4NXNL 1EZ8A 1S3OA 2JJQA 5C3EB 2UXCL 1PH8A 1HZCA 2QCPX 1FNUA 5BR8Q 4UHVA 2NN6I 1PMRA 3GTJH 1WCMH 3QOJA 5CV5A 3PO2H 2LMCB 3CQZB 4B3RL 1ZYRD 1J9OA 4BY7H 1NJIC 5M3FG 2CWPA 1ET9A 3M4PA 1I4HA 1A62A 3I56A 1X9NA 2UUAQ 5IGBA 3K58A 3ER0A 4JI1Q 1HH2P 2D5DA 5KNCA 1ML0D 5E3FA 4B3ML 5K36H 5IGCA 1ASZA 1Q82C 2MUYA 2Y0SG 2Q2TA 2UXBQ 5CV6A 4DK1A 1IBKQ 1JR0D 4DV6Q 1XNRQ 2DNCA 5FLXL 1E3PA 3AMUA 4IALA 4HAEA 2DN8A 1KD1C 1DONA 4ULLA 4DV4Q 5EPKA 1DD2A 2JK8A 4N9TA 4Q0FA 4DR5L 1A3UA 1JE4A 1LT3D 4DR2L 5IYCG 4LF4Q 2EDGA 4LNQA 2OXPA 5IYDH 1BCPF 1F2LA 3D4DA 1WD1A 3FKIB 1UE5A 3TQYA 3BVGA 3J81L 3GTMB 1Y69U 1RJTA 2JA6B 5ELNA 3M3YB 2KA7A 1SYGA 3T4AC 3CMEA 4KJNA 5AJ3Q 4OO1I 1KNEA 4GLAC 1Q86C 4U68A 2F03A 1HXYD 1FGBD 2LFNA 4DR3Q 4RHRA 2I46A 1GHKA 3PO3G 4DR4L 3GD7A 2L1BA 3DHQA 4A3LG 1RF2D 2YV5A 4GKJL 1JE5A 4DV0L 3HOUH 1LTSD 1PYBA 3AU7A 2LKVA 1R9TH 4A3DH 3D4WA 2ZT9C 4R4TA 4LF7Q 1YNJC 2EOTA 1PYWD 5I6YA 1DZ1A 5FJ8H 1E22A 1EZ6A 1SNQA 2MGSA 2VQFL 1VQKA 3JAMc 4JI7L 2NBFA 5E4XA 3DM3A 3KJOA 2C5CA 2R7FA 1SMYC 2JQOA 3HOZG 1ZKOA 3MFYA 4QIWE 3T16A 2ZXOA 4L8JA 1KIXA 2Z4IA 1SSOA 1IBLQ 3NEMA 4JI5Q 4ZUIA 5BN3A 1G6PA 3OMCA 1EYGA 1T5XD 2UU9L 4JCVE 1EWCA 2KHIA 2A1AA 3I90A 1EQTA 1DCZA 2B2VC 3C3LA 2PI2E 1TS5A 4X65Q 3T1HL 4KN7C 3X3NA 3DWAA 4YWLA 2R92G 1L1OC 2PNRC 4K2KA 4LJZC 1I4RA 3HOXG 1ESRA 3S1QH 4BBRB 5DM63 1IYUA 3S15B 2CH4A 1B9NA 3TRZA 2Z9HA 3J80E 1TWFB 3NWSA 5AFWA 1OXSC 1BDOA 2R6GA 1VQFA 3V05A 2Q2IA 3H91A 2UUBL 4R4QA 4DNRB 1SN8A 3NXWA 3H94A 2E2IH 4NB3A 1JWUD 4FO2A 3G7LA 5JVG3 4BY1H 4RMFA 1N32Q 4GLVB 4K0KQ 1SAPA 3D3RA 2B8GA 3S1MB 1HNWQ 3PSIA 2R93H 1E7ZA 1K83H 1H9KA 3K57A 1MD2D 2F1MA 4A3JB 4N8X1 1EIHA 3FPPA 2OEOA 3KLSA 3DLLA 1XXGA 4KK7A 4JV5L 5KYIA 1MJEA 4KN4C 4A3BG 1UEBA 3WWVA 1FNVA 3PUVA 1PH7A 2Q8RE 2G9HD 3A54A 4XYOA 5BR8L 1LTAD 4JOIC 1QVGA 5EJWA 1X3QA 4DAYA 2J0TD 5C4ZA 1J6QA 3MXUA 1PH1A 1ASYA 1JOOA 3I2ZA 1EWIA 2O4XA 3E0JA 4H7BA 1FNWA 1OXUA 1RD9D 4OWXB 4CJ0B 1Z9FA 2G5DA 4Y52H 1K3BC 3ITPA 2A68C 5EQ0A 3SHLA 4ZUJA 2UUAL 3MA2B 1SE8A 1SE2A 1FYCA 2PQAB 4KKTA 1CSQA 1G51A 3OPOA 3H0GH 3EROA 1PTOC 4LF5Q 1YNXA 1O7YA 1X3FA 4LMQD 2UXBL 1IBKL 2ENBA 1X56A 1TWHB 4DV6L 1XNRL 3K0YA 4GOPC 3SE0A 5EPJA 4DV4L 1M8AA 3MXGA 4J15A 4CJ1B 1WTHA 2K03A 2D2CC 1WI5A 1B3QA 4DNTB 4AIMA 4UY8C 4LF4L 1EQVA 1EYCA 4G4KA 3UDGA 2IY5B 4C3HH 4C3IB 2VW9A 3RZOB 1TS4A 4JK1C 1F9RA 1OTCA 2RHSB 2QDLA 4QJFA 1KLGD 4IUNA 5D3IB 2YTVA 3A8JE 3CCVA 1G2TA 2JE6I 3HZXA 1KDCA 2AUKA 2KHSA 1X32A 4X66Q 1HFNA 4DR3L 3CCQA 5IGDA 1LTGD 4OO1G 1EY4A 3OYYA 5JPMC 1UE7A 2NN6H 4DFAA 3HOWG 3ONAB 3S14H 4RFBA 3GTQB 4RWSC 1KRSA 4IOAA 4IUQA 1B4OA 1PXUA 2NWGA 1XWEA 5CV4A 1JOQA 1HNZQ 4XXEA 3S2HH 1DJRD 5E1FA 1ENAA 4OONA 4LF7L 4L63B 2C35B 3M4YA 2NVYH 2IHFA 4JW0A 1STYA 3EN2A 1E2VA 1DM0B 1D5ZC 2FXQA 3AB9A 1EQQA 4I7AA 1EL0A 1Y1VG 3TSSA 3OWEB 1TS3A 1YIJA 4RKBA 2OQKA 2CW0D 3E9IA 4JBWA 4JI3Q 1CTMA 4QB4A 5IGGA 3GTKH 3KLWA 1CFMA 1GUGA 4A93H 1JICA 3QJYA 2EY2A 1IBLL 1KXLA 2ICIA 3I4MG 3A7AB 2PNHA 1KRTA 1RIPA 4HJ7A 1JJGA 4O1NA 4ZKBB 3GTJB 2RSNA 5C0XI 1TIID 4X65L 2EYOA 1V1PB 3A55A 1BCPB 5EPLA 3Q23A 3MTSA 4IPHA 4A3JG 5M5XB 1B7YB 2K6AA 4OO1H 2A6HD 1VCIA 1N33Q 2B8FA 3GTLB 2KJXA 2MP1A 4Z9CB 4YIJA 2KVMA 1YHAA 4LF9Q 5J39A 1E2WA 1N32L 3W5OA 5BN5A 4K0KL 3FVQA 1H9JA 1ZYRC 3JAME 1HNWL 4DR1Q 4PZ7A 4C3JG 2BA1A 3W1BA 4HEDA 1CM9A 4A3KB 4FXGC 4KJOA 1X6OA 4B3RQ 1EWHA 4BBSH 1EY5A 2A5HA 3CU7A 1B9MA 1XPRA 5K5PA 2NVQH 1ICWA 1JWMD 3PIO3 1SFOB 1H9SA 3U4ZA 3RUZA 1L2FA 1VQEA 3K7UC 3S2DH 1MHWC 2AUJD 1H95A 2VY3A 4EQOA 4C2MB 3QR8A 4RH6A 5ELBA 2RVLA 3Q0AA 3PUXA 3MVVA 4ILWA 3C2PA 1I6HH 2FINB 3T13A 3J81j 1TWAB 2XRSD 3MZ5A 1VQ8A 5M3FB 5IWAQ 3L3OC 4ZKCB 1I6VC 2A68D 5C4XH 4C3IG 1Z6HA 4LF5L 1Y8NB 2I5HA 1F9SA 2KUMA 4KD4A 2N3SA 1R9TB 3DEPA 4ZQ3A 2DJGC 4DXGA 2NYZD 1BQQT 3M85A 1OXTA 4HTHA 1PRTB 2Y0SB 1VQMA 1CA6A 3UDIA 1AFPA 4MHEA 4J1MA 1N34Q 2B63H 1V43A 5E7NA 3NK9A 3DUZA 3U9SA 4GNXC 3TP8A 4I65A 3KF8A 2KENA 3U58A 2N55A 1YJNA 2E8GA 1BCPD 3BDOA 4I7ZC 2D62A 3Q24A 4OL7A 3U50C 5HGTA 2RQXA 2EXDA 5IGEA 4M8AA 4FF3A 1IXRA 4XQNA 2PZWA 2E2HH 3TEHB 2MO0A 3VYTA 3I72A 3GTOB 2PMZE 3K5OA 2H5XA 2NZ1D 4IQZA 4X66L 2JA8H 1X3EA 3I55A 5IP7G 2ZJQA 4EQPA 3M4OB 3HEJA 1DGSA 3D8GA 4KI0A 2GVAA 2IL8A 1I4GA 1BBXC 1STHA 5C4JH 3S1QB 1B3AA 3A8IE 4DU9A 2RBMA 1BBWA 3PO3B 3CC7A 4KKSA 5M3MH 1O7LA 4DV5Q 1Y8OB 2VUMG 3KBGA 5IGFA 5C0XJ 4FXDA 3CD6A 1HNZL 5IYBH 3TN2A 1D5XC 1S4ZA 4OELB 2HQEA 3WOFA 1SYCA 4ZRZA 1SNDA 1FVIA 4DKAC 3LGJA 2Z6BA 2F0GA 1C8CA 2QDBA 1WCMG 1EIGA 2QEXA 2Q2UA 3I4NG 1PFSA 3CCJA 3PO2G 1IYJB 4QGUA 4BY7G 1STAA 4HJAA 3OW2A 3CMAA 2R93B 4FNFA 2I5MX 1X55A 3PIP3 4EQNA 3EA6A 2EZVA 5IT9E 5JVH3 1VQHA 1RTNA 4JI3L 3N6RA 1V1QA 2EPBA 4QUCA 1CKOA 3VR5A 5JAVA 1TWCH 1G91A 1WYDA 5K36G 2O5JC 3HOZB 3J80L 2A19A 4OWTB 2K52A 4CDCC 5JEAJ 4V0BA 1KC8C 1CZWA 4OIJA 4RAUC 2NVTH 2BDOA 4XQJA 3H15A 5H1SE 4A3MH 2X69A 5C6AA 5LMUQ 2F0SA 3EIVA 5IY0A 3DEOA 1PFBA 3I91A 2F0LA 3MHBA 1YI2A 3SXHA 3FPUB 1PRTD 1QVCA 2F0IA 5NUCA 4YHHQ 1N33L 1HJPA 1QVFA 4IO9A 4TSSA 3HOXB 2KOLA 3VR2A 4A3IH 2ZTCA 5IYDG 4ZYSA 2AQ2B 3GTGH 3I3CA 1LYLA 2RCNA 4LF9L 4CHTB 3BVMA 4DXFA 2WKDA 4WJ4A 2QGQA 4ZLTF 3R2IA 1V9PA 5J3BA 1MBYA 2DUDA 2EYLA 3J7AV 1K0SA 3ICEA 4UP9A 4DR1L 1AW7A 3KLRA 5M9OA 1VQNA 3NTIA 3I4NH 4NW2A 2KCMA 2ES2A 1VQBA 2EYJA 5CGKA 4KKUA 1PTOH
chains in the Genus database with same CATH topology
2ZTDA 3HOUG 3TRZA 4LFAQ 3ULPA 4DR6L 1RL2A 1HNXL 4QL5A 1VQGA 1OXSC 2R6GA 1VQFA 4A3DG 4KHPQ 2Q2IA 1PHJA 1EIYB 3B6YA 4R4CA 4LFCQ 2UUBL 4R4QA 2HIXA 1VQOA 2KHJA 3H3VH 3J81c 1A63A 1SN8A 1PH6A 4JI4Q 2HT1A 2E2IH 4NB3A 4X6AH 4R1JA 1EFWA 4GOPA 2XGTA 3K7AH 4A3MG 1JT8A 4BY1H 4RMFA 1W2BA 1N32Q 1LM0A 4GLVB 4DV1Q 2JA5H 4AH6A 4K0KQ 5M5YH 1XMQQ 5FJ8G 5C44H 3KJPA 2N78A 1HNWQ 3PSIA 2R93H 1E7ZA 1K83H 4BBRG 4LF8L 1YBYA 3KF8B 4TQUS 4BA1I 5IWAL 4DV3L 1X3GA 2Z6KC 3AFPA 1HR0Q 4PG3A 2MO1A 1K73C 3DLLA 1JB7A 3RN5A 2R7DA 4A3IG 1K8GA 3BZCA 3G4SA 4NXMQ 4JV5L 2CWAA 1MJEA 4A3BG 4OWWB 1NE3A 1UEBA 2Y0SE 1QUQA 3WWVA 3J7A5 1YJWA 4Y7NH 2OCEA 2PQAA 4JI5L 1M90C 2LXKA 1HR0W 3PUVA 4GKKQ 4A3FG 1PH7A 2IT1A 5JJLA 3CCRA 3F2BA 1NY4A 3HKZG 1B8AA 2HIVA 5BR8L 4GOPB 2KCTA 1TWHH 3BZKA 3ULJA 4JOIC 2ZTEA 1QVGA 4OXPA 4DV2Q 4JI0Q 5HY6A 1I94L 4B3TL 1Q1BA 4EQ5A 3FP9A 1I50H 1J6QA 4O2DA 4UP8A 1PH1A 3HOVH 4LF6Q 4KLKA 1N34L 2ALYB 4ALPA 4JYAL 1ASYA 2NZOA 1A0IA 3I2ZA 2KBNA 1EWIA 4H02A 2ZM6L 1VQ6A 1OXUA 5HGQA 4OWXB 4POFA 1Z9FA 2E5LQ 4A3CG 4Y52H 2EIFA 3HOWH 1PH2A 2UUAL 1K3RA 1Q1EA 3HKZE 3NELA 4HIKA 1SE8A 4IFDI 4HIOA 1Q8KA 2PQAB 2CCZA 1CSQA 2K14A 1G51A 3RZOH 2ZJRA 3F2DA 1PH9A 4DV7Q 3S1NH 1BKBA 4A75A 3H0GH 3KFUA 4L5SA 4LF5Q 1YNXA 3UDXA 4NXNQ 1X54A 1X3FA 2UXBL 4JI6Q 4P75A 1EOVA 1IBKL 4DAYB 1X56A 2RHQB 4DV6L 4DR7Q 1XNRL 2UXCQ 4BY1G 4IJLA 2B29A 2JA5G 4LWCA 4GOPC 4IPCA 2IX0A 4JI2Q 3KF6A 4DV4L 4ME3A 2R93G 4J15A 4X64L 1GVPA 1S40A 3CPFA 5C0XG 4GN4B 4TVAB 5GQOA 2QA4A 1EQRA 1WI5A 1FL0A 4AIMA 1Y1VH 3F1ZA 4DV5L 3GTQH 3GO5A 4BBRH 4UY8C 4LF4L 2AWNA 3J81i 3A74A 4MNOA 3UDGA 2IY5B 4C3HH 2F52A 2VW9A 1YHBA 1VQ7A 3I7FA 4POGA 2I5LX 1SRUA 1AE2A 3RLFA 4YWMA 4L5RC 1OTCA 4B3MQ 4HIDA 2DGYA 1XMOL 1MJCA 3CP0A 2RHSB 1Y14B 1YJ9A 4QJFA 3PF4A 3I4MH 3KF6B 4A3FH 2JA7H 2YTVA 1YVCA 1Q46A 3RZDH 3HOVG 3CXCA 1N8RC 3S16H 3CCVA 2JE6I 4X66Q 1J5EQ 4DR3L 3CCQA 4AQYQ 1XNQL 4JBJA 2K5HA 1PVOA 3L0OA 5FLXc 4OO1G 3OYYA 3K81C 4YY3L 1UE7A 3Q8DA 2K5VA 3HOWG 4BXXH 3S1RH 4WJ3M 4A3JH 4R4OA 4A4IA 3S14H 2VL6A 1FJGL 1E1TA 5JEAG 3D31A 4GN3B 3PGZA 3U4VA 4DR5Q 2A8VA 1KRSA 2ATWA 3UE0A 4IOAA 1XPOA 4DNIA 4DR2Q 3H0GG 1N9WA 1U5KA 1BVSA 1HNZQ 3RR5A 4A3GH 4P74A 1BBUA 5EAYA 4XTCS 1JMCA 3S2HH 5DLQE 1OXVA 3NENA 1YEZA 4OONA 4LF7L 5JJKA 2YTYA 1KQSA 2C35B 2NVYH 1E1OA 2IHFA 2LXJA 1MIUA 2D0OA 4X62Q 5LMUL 1VQ9A 4MZ9A 1VQLA 3EN2A 2CFMA 2EQSA 2UXDL 5M5WH 4JI8Q 2FXQA 4DUZL 4DAMA 1PH3A 1EQQA 3CC4A 4IPGA 4YHHL 4C3JH 5M5XH 1Y1VG 3HFZB 4OX9Q 4FDBA 1PYSB 2BA0A 3GTPH 1O7IA 3T1YL 1Y1WH 1YIJA 3D0FA 4DR4Q 1IBMQ 1U0LA 2OQKA 3NBHB 4B3SQ 3H3VI 2HHHL 2VNUD 3E9IA 4DK6C 4JBWA 4YWKA 3ZJYC 5GAHC 4JI3Q 3GTLH 1X65A 1PH4A 2HQLA 3GTKH 3KLWA 4A93H 4GKJQ 2OTJA 1IBLL 2JEBI 4DV0Q 1KXLA 2ASBA 5LMNL 2UUCQ 1PH5A 3I4MG 1XPUA 2JA7G 1I5FA 3J80c 2PNHA 1B70B 1LTLA 1KRTA 4APVA 1RIPA 3IRBA 4HJ7A 2XTIA 1JJGA 3JC66 2YYZA 4DPGA 5C0XI 2GN5A 4X65L 1N36L 1KL9A 3G6EA 4YCVA 3JAMi 2NN6G 2OTLA 3CCLA 3UE1A 4A3KH 4BXXG 5GROA 4IPHA 4A76A 4A3JG 3CC2A 3KDFA 1B7YB 4LUZA 5GAEC 1K8AC 4JBMA 2VQFQ 1NTGA 1T9HA 2MQHA 4DUYQ 3S24A 3HKSA 1P8LA 4JI7Q 4LFAL 1AH9A 1VCIA 1N33Q 2F4VQ 4IJHA 3OTOQ 4A3EH 5JJIA 2ZJPA 1SFOH 1YZ6A 2CKZB 1QUQB 2R7ZG 1NBWA 4KHPL 1G291 4C3IH 4A3GG 4LFCL 2PI2A 3PUZA 4JI4L 2K75A 1YHAA 2N49A 4LF9Q 1CUKA 2F3IA 4O0AA 4X62L 3CF5A 4HJ9A 1S72A 3M9BA 4JBKA 2VS1A 3PCOB 4C2MH 4DV1L 3W5OA 1TWGH 1N32L 4K0KL 4IFDJ 4MTNA 1C9OA 1XMQL 4QY7A 4NPSA 3STBC 1WJJA 3CCMA 1VQ4A 1QZGA 2B3GA 1D7QA 2UU9Q 3MEFA 1HNWL 4DR1Q 4PZ7A 2VQEQ 3KDFB 2BA1A 1HZAA 1NMFA 1TWAH 1I3QH 4GNXA 1WOCA 1GD7A 3W1BA 2I0QA 3T1HQ 3G48A 1VQPA 1HR0L 4LFBQ 4LW1A 5M3FH 1Y1WG 1X6OA 3TS2A 4B3RQ 4BBSH 4NXML 3BU2A 1M1KC 1XPRA 2JEAI 2NVQH 1CKNA 1W3SA 4A93G 5FLMH 3KOJA 4GKKL 3S17H 2K50A 3U4ZA 5C3EH 1L2FA 1VQEA 1GKHA 4DR6Q 3K7UC 1HNXQ 3PUWA 4DV2L 2WB1G 1VQJA 2K4KA 3S2DH 4JI0L 1H95A 3F2CA 1PV4A 5IP9H 2UUBQ 2VY3A 2V1CC 4LF6L 2NZHA 1IZ6A 3AYHB 2IHEA 2Q2HA 2IX1A 1FGUA 1IL2A 3PUXA 4GNXB 3CQZH 3K0XA 4DK3C 5IP7H 4L5TA 3RLNA 1NMGA 2WAQG 4XIGS 4JC0A 4A3KG 1XJVA 2E2JH 2E5LL 1I6HH 3J81j 2N8NA 2Z6KA 1PA6A 1CKMA 3MXNB 2MNAA 2OQ0A 3HOYG 1VQCA 1QZHA 1VQ8A 1YHQA 1CKNB 4LF8Q 5IWAQ 4DV3Q 1VQAA 3FHWA 2WB1E 3VDYA 1A8VA 4A3EG 1GM5A 3M7NA 1CSPA 3CCUA 2OWOA 2JA9A 3J80i 2GVBA 4DV7L 5C4XH 1AE3A 1C0AA 3PV0A 4JV5Q 2VUMH 4LF5L 4NXNL 2BH8A 2I5HA 5IYCH 2AHOB 4LUOA 1S3OA 4JI6L 2JJQA 2N3SA 2WAQE 2AMCB 3RLOA 1PH8A 2R7ZH 3KYHC 1HZCA 3GTOH 4DR7L 2UXCL 1YITA 5BR8Q 1Q12A 4JI2L 2NN6I 4P72A 3M85A 1OXTA 1OXXK 3GTJH 1VQMA 1WCMH 1I94Q 4LFBL 4B3TQ 3UDIA 2YTXA 3M4OH 3PO2H 4B3RL 1N34Q 4JYAQ 2B63H 4BY7H 1V43A 1NJIC 4UP7A 5M3FG 5E7NA 4GNXC 5GADC 3AEVA 2ZM6Q 2CWPA 4BBSG 3RN2A 3CW2C 2KENA 2CQOA 3M4PA 3U58A 3PO3H 3PIOA 1YJNA 3L7ZC 2E8GA 3I56A 1A62A 1X9NA 5FLMG 2UUAQ 1UE1A 4LUVA 3E9HA 3ERSX 2D62A 1E24A 3ER0A 4A3LH 4JI1Q 1HH2P 3A5ZB 4IPDA 5C3EG 3U50C 1K9MC 2EXDA 1EUJA 4B3ML 3FKIH 1IXRA 3ULLA 1Q7YC 2D0PA 1ASZA 5IP9G 3GTMH 1EIFA 1TXYA 3TEHB 1Q82C 1HZBA 2E2HH 2MO0A 4PZ8A 1JJ2A 2Y0SG 2Q2TA 2JA6H 3M3YH 2UXBQ 2PMZE 2H5XA 1IBKQ 4DV6Q 4X66L 1XNRQ 1J5EL 2JA8H 1X3EA 3I55A 4AQYL 5IP7G 1E3PA 2ZJQA 2WP8J 1KD1C 4UPAA 4DV4Q 5GAGC 4P73A 3CCSA 1DGSA 2WFWA 3CPWA 4KI0A 2BH2A 2GVAA 4X64Q 2JK8A 5C4JH 1VS0A 4QQBX 4DR5L 1BBWA 3J7ZC 3CC7A 5C4XG 4DR2L 5M3MH 4DV5Q 3HOYH 2VUMG 4R4IA 5IYCG 4LF4Q 5C0XJ 4LNQA 3CD6A 1HNZL 3HOZH 1L0WA 5IYBH 3I4OA 4GLXA 5IYDH 1SLJA 3K8AA 3A0JA 1UE5A 3TQYA 1VQ5A 3RNUA 1FVIA 5ELOA 4DKAC 4AYBG 3LGJA 4HJ8A 1XMOQ 5ELNA 1WCMG 2QEXA 2L15A 3CMEA 2Q2UA 2Z0SA 3I4NG 1PFSA 3CCJA 3PO2G 4JI8L 5AJ3Q 4KHZA 4GLAC 4OO1I 1IYJB 1WFQA 4QGUA 1Q86C 2B63G 4BY7G 4EX5A 4HJAA 3OW2A 3CMAA 1Z47A 2I5MX 4DR3Q 1XNQQ 1X55A 1KAWA 4OX9L 1HZ9A 1L1OA 3PO3G 4YY3Q 4DR4L 1IBML 2R92H 4PZ6A 4B3SL 4JI1L 3L2PA 1VQHA 4BA2I 3GD7A 4JI3L 3HOXH 4A3LG 2RF4A 4AYBE 1V1QA 2YV5A 1FJGQ 1CKOA 4GN5A 4GKJL 1C7YA 1JE5A 1VQIA 1TWCH 3FKIG 1WYDA 5K36G 4DV0L 3HOUH 2UUCL 1SR3A 3UDFA 1PYBA 2A19A 4OWTB 2K52A 2JA6G 5JEAJ 1R9TH 1VQDA 1MKHA 1XTDA 3M4QA 3TS0A 1KC8C 4A3DH 2JA8G 5C44G 4R4TA 4JG2A 2NVTH 3H15A 4LF7Q 5H1SE 4A3MH 5LMUQ 1L1OB 3EIVA 1JJCB 5IY0A 1SROA 3W1GA 3SGIA 2UXDQ 3CCEA 1KHIA 1Q81C 3EBEA 5FJ8H 1YI2A 4DUZQ 1E22A 3K80C 4YCUA 2VQFL 1QVCA 4YHHQ 1VQKA 2AKWB 3JAMc 4DUYL 2NVXH 4JI7L 3S15H 2MFIA 3DM3A 5M3MG 3KJOA 1N33L 3OTOL 3E0EA 2F4VL 3AFQA 1D8LA 1HJPA 4YCWA 4HJ5A 1QVFA 2R7FA 4PMWA 5IT9c 4IO9A 3T1YQ 1P16A 4A3IH 2JQOA 2LSSA 2ZTCA 1TWFH 4RG1A 5IYBG 5IYDG 3HOZG 4QIWE 2HHHQ 3GTGH 3PUYA 4A3BH 4GS3A 4IFDG 1LYLA 3AQQA 2RCNA 4LF9L 3PF5A 1K0RA 1KIXA 3TREA 4WJ4A 1IBLQ 2QGQA 4JOIA 3G71A 1UWVA 1GO3E 3NEMA 5AJ3L 4JI5Q 5LMNQ 1V9PA 5J3BA 1UE6A 2DUDA 3BJUA 2K5NA 1EYGA 1G6PA 5IE8A 2YU9H 3ICEA 1LUZA 2UU9L 4JCVE 4UP9A 3PIPA 2KHIA 2VQEL 2A1AA 4DR1L 3S1MH 1VQNA 1SMXA 2PI2E 3A5UA 5LMNW 4HIMA 4X65Q 3T1HL 3I4NH 1N36Q 2VZAA 2KCMA 4YWLA 3F8TA 3STBD 2R92G 1L1OC 2ID0A 4L5QA 4P71A 2ES2A 1VQBA 4A3CH 4IOCA 3HOXG 3S1QH 3GDEA 2AWOA 3CAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  3HOU G;  3TRZ A;  4LFA Q;  3ULP A;  4DR6 L;  1RL2 A;  1HNX L;  4QL5 A;  1VQG A;  1OXS C;  2R6G A;  1VQF A;  4A3D G;  4KHP Q;  2Q2I A;  1PHJ A;  1EIY B;  3B6Y A;  4R4C A;  4LFC Q;  2UUB L;  4R4Q A;  2HIX A;  1VQO A;  2KHJ A;  3H3V H;  3J81 c;  1A63 A;  1SN8 A;  1PH6 A;  4JI4 Q;  2HT1 A;  2E2I H;  4NB3 A;  4X6A H;  4R1J A;  1EFW A;  4GOP A;  2XGT A;  3K7A H;  4A3M G;  1JT8 A;  4BY1 H;  4RMF A;  1W2B A;  1N32 Q;  1LM0 A;  4GLV B;  4DV1 Q;  2JA5 H;  4AH6 A;  4K0K Q;  5M5Y H;  1XMQ Q;  5FJ8 G;  5C44 H;  3KJP A;  2N78 A;  1HNW Q;  3PSI A;  2R93 H;  1E7Z A;  1K83 H;  4BBR G;  4LF8 L;  1YBY A;  3KF8 B;  4TQU S;  4BA1 I;  5IWA L;  4DV3 L;  1X3G A;  2Z6K C;  3AFP A;  1HR0 Q;  4PG3 A;  2MO1 A;  1K73 C;  3DLL A;  1JB7 A;  3RN5 A;  2R7D A;  4A3I G;  1K8G A;  3BZC A;  3G4S A;  4NXM Q;  4JV5 L;  2CWA A;  1MJE A;  4A3B G;  4OWW B;  1NE3 A;  1UEB A;  2Y0S E;  1QUQ A;  3WWV A;  3J7A 5;  1YJW A;  4Y7N H;  2OCE A;  2PQA A;  4JI5 L;  1M90 C;  2LXK A;  1HR0 W;  3PUV A;  4GKK Q;  4A3F G;  1PH7 A;  2IT1 A;  5JJL A;  3CCR A;  3F2B A;  1NY4 A;  3HKZ G;  1B8A A;  2HIV A;  5BR8 L;  4GOP B;  2KCT A;  1TWH H;  3BZK A;  3ULJ A;  4JOI C;  2ZTE A;  1QVG A;  4OXP A;  4DV2 Q;  4JI0 Q;  5HY6 A;  1I94 L;  4B3T L;  1Q1B A;  4EQ5 A;  3FP9 A;  1I50 H;  1J6Q A;  4O2D A;  4UP8 A;  1PH1 A;  3HOV H;  4LF6 Q;  4KLK A;  1N34 L;  2ALY B;  4ALP A;  4JYA L;  1ASY A;  2NZO A;  1A0I A;  3I2Z A;  2KBN A;  1EWI A;  4H02 A;  2ZM6 L;  1VQ6 A;  1OXU A;  5HGQ A;  4OWX B;  4POF A;  1Z9F A;  2E5L Q;  4A3C G;  4Y52 H;  2EIF A;  3HOW H;  1PH2 A;  2UUA L;  1K3R A;  1Q1E A;  3HKZ E;  3NEL A;  4HIK A;  1SE8 A;  4IFD I;  4HIO A;  1Q8K A;  2PQA B;  2CCZ A;  1CSQ A;  2K14 A;  1G51 A;  3RZO H;  2ZJR A;  3F2D A;  1PH9 A;  4DV7 Q;  3S1N H;  1BKB A;  4A75 A;  3H0G H;  3KFU A;  4L5S A;  4LF5 Q;  1YNX A;  3UDX A;  4NXN Q;  1X54 A;  1X3F A;  2UXB L;  4JI6 Q;  4P75 A;  1EOV A;  1IBK L;  4DAY B;  1X56 A;  2RHQ B;  4DV6 L;  4DR7 Q;  1XNR L;  2UXC Q;  4BY1 G;  4IJL A;  2B29 A;  2JA5 G;  4LWC A;  4GOP C;  4IPC A;  2IX0 A;  4JI2 Q;  3KF6 A;  4DV4 L;  4ME3 A;  2R93 G;  4J15 A;  4X64 L;  1GVP A;  1S40 A;  3CPF A;  5C0X G;  4GN4 B;  4TVA B;  5GQO A;  2QA4 A;  1EQR A;  1WI5 A;  1FL0 A;  4AIM A;  1Y1V H;  3F1Z A;  4DV5 L;  3GTQ H;  3GO5 A;  4BBR H;  4UY8 C;  4LF4 L;  2AWN A;  3J81 i;  3A74 A;  4MNO A;  3UDG A;  2IY5 B;  4C3H H;  2F52 A;  2VW9 A;  1YHB A;  1VQ7 A;  3I7F A;  4POG A;  2I5L X;  1SRU A;  1AE2 A;  3RLF A;  4YWM A;  4L5R C;  1OTC A;  4B3M Q;  4HID A;  2DGY A;  1XMO L;  1MJC A;  3CP0 A;  2RHS B;  1Y14 B;  1YJ9 A;  4QJF A;  3PF4 A;  3I4M H;  3KF6 B;  4A3F H;  2JA7 H;  2YTV A;  1YVC A;  1Q46 A;  3RZD H;  3HOV G;  3CXC A;  1N8R C;  3S16 H;  3CCV A;  2JE6 I;  4X66 Q;  1J5E Q;  4DR3 L;  3CCQ A;  4AQY Q;  1XNQ L;  4JBJ A;  2K5H A;  1PVO A;  3L0O A;  5FLX c;  4OO1 G;  3OYY A;  3K81 C;  4YY3 L;  1UE7 A;  3Q8D A;  2K5V A;  3HOW G;  4BXX H;  3S1R H;  4WJ3 M;  4A3J H;  4R4O A;  4A4I A;  3S14 H;  2VL6 A;  1FJG L;  1E1T A;  5JEA G;  3D31 A;  4GN3 B;  3PGZ A;  3U4V A;  4DR5 Q;  2A8V A;  1KRS A;  2ATW A;  3UE0 A;  4IOA A;  1XPO A;  4DNI A;  4DR2 Q;  3H0G G;  1N9W A;  1U5K A;  1BVS A;  1HNZ Q;  3RR5 A;  4A3G H;  4P74 A;  1BBU A;  5EAY A;  4XTC S;  1JMC A;  3S2H H;  5DLQ E;  1OXV A;  3NEN A;  1YEZ A;  4OON A;  4LF7 L;  5JJK A;  2YTY A;  1KQS A;  2C35 B;  2NVY H;  1E1O A;  2IHF A;  2LXJ A;  1MIU A;  2D0O A;  4X62 Q;  5LMU L;  1VQ9 A;  4MZ9 A;  1VQL A;  3EN2 A;  2CFM A;  2EQS A;  2UXD L;  5M5W H;  4JI8 Q;  2FXQ A;  4DUZ L;  4DAM A;  1PH3 A;  1EQQ A;  3CC4 A;  4IPG A;  4YHH L;  4C3J H;  5M5X H;  1Y1V G;  3HFZ B;  4OX9 Q;  4FDB A;  1PYS B;  2BA0 A;  3GTP H;  1O7I A;  3T1Y L;  1Y1W H;  1YIJ A;  3D0F A;  4DR4 Q;  1IBM Q;  1U0L A;  2OQK A;  3NBH B;  4B3S Q;  3H3V I;  2HHH L;  2VNU D;  3E9I A;  4DK6 C;  4JBW A;  4YWK A;  3ZJY C;  5GAH C;  4JI3 Q;  3GTL H;  1X65 A;  1PH4 A;  2HQL A;  3GTK H;  3KLW A;  4A93 H;  4GKJ Q;  2OTJ A;  1IBL L;  2JEB I;  4DV0 Q;  1KXL A;  2ASB A;  5LMN L;  2UUC Q;  1PH5 A;  3I4M G;  1XPU A;  2JA7 G;  1I5F A;  3J80 c;  2PNH A;  1B70 B;  1LTL A;  1KRT A;  4APV A;  1RIP A;  3IRB A;  4HJ7 A;  2XTI A;  1JJG A;  3JC6 6;  2YYZ A;  4DPG A;  5C0X I;  2GN5 A;  4X65 L;  1N36 L;  1KL9 A;  3G6E A;  4YCV A;  3JAM i;  2NN6 G;  2OTL A;  3CCL A;  3UE1 A;  4A3K H;  4BXX G;  5GRO A;  4IPH A;  4A76 A;  4A3J G;  3CC2 A;  3KDF A;  1B7Y B;  4LUZ A;  5GAE C;  1K8A C;  4JBM A;  2VQF Q;  1NTG A;  1T9H A;  2MQH A;  4DUY Q;  3S24 A;  3HKS A;  1P8L A;  4JI7 Q;  4LFA L;  1AH9 A;  1VCI A;  1N33 Q;  2F4V Q;  4IJH A;  3OTO Q;  4A3E H;  5JJI A;  2ZJP A;  1SFO H;  1YZ6 A;  2CKZ B;  1QUQ B;  2R7Z G;  1NBW A;  4KHP L;  1G29 1;  4C3I H;  4A3G G;  4LFC L;  2PI2 A;  3PUZ A;  4JI4 L;  2K75 A;  1YHA A;  2N49 A;  4LF9 Q;  1CUK A;  2F3I A;  4O0A A;  4X62 L;  3CF5 A;  4HJ9 A;  1S72 A;  3M9B A;  4JBK A;  2VS1 A;  3PCO B;  4C2M H;  4DV1 L;  3W5O A;  1TWG H;  1N32 L;  4K0K L;  4IFD J;  4MTN A;  1C9O A;  1XMQ L;  4QY7 A;  4NPS A;  3STB C;  1WJJ A;  3CCM A;  1VQ4 A;  1QZG A;  2B3G A;  1D7Q A;  2UU9 Q;  3MEF A;  1HNW L;  4DR1 Q;  4PZ7 A;  2VQE Q;  3KDF B;  2BA1 A;  1HZA A;  1NMF A;  1TWA H;  1I3Q H;  4GNX A;  1WOC A;  1GD7 A;  3W1B A;  2I0Q A;  3T1H Q;  3G48 A;  1VQP A;  1HR0 L;  4LFB Q;  4LW1 A;  5M3F H;  1Y1W G;  1X6O A;  3TS2 A;  4B3R Q;  4BBS H;  4NXM L;  3BU2 A;  1M1K C;  1XPR A;  2JEA I;  2NVQ H;  1CKN A;  1W3S A;  4A93 G;  5FLM H;  3KOJ A;  4GKK L;  3S17 H;  2K50 A;  3U4Z A;  5C3E H;  1L2F A;  1VQE A;  1GKH A;  4DR6 Q;  3K7U C;  1HNX Q;  3PUW A;  4DV2 L;  2WB1 G;  1VQJ A;  2K4K A;  3S2D H;  4JI0 L;  1H95 A;  3F2C A;  1PV4 A;  5IP9 H;  2UUB Q;  2VY3 A;  2V1C C;  4LF6 L;  2NZH A;  1IZ6 A;  3AYH B;  2IHE A;  2Q2H A;  2IX1 A;  1FGU A;  1IL2 A;  3PUX A;  4GNX B;  3CQZ H;  3K0X A;  4DK3 C;  5IP7 H;  4L5T A;  3RLN A;  1NMG A;  2WAQ G;  4XIG S;  4JC0 A;  4A3K G;  1XJV A;  2E2J H;  2E5L L;  1I6H H;  3J81 j;  2N8N A;  2Z6K A;  1PA6 A;  1CKM A;  3MXN B;  2MNA A;  2OQ0 A;  3HOY G;  1VQC A;  1QZH A;  1VQ8 A;  1YHQ A;  1CKN B;  4LF8 Q;  5IWA Q;  4DV3 Q;  1VQA A;  3FHW A;  2WB1 E;  3VDY A;  1A8V A;  4A3E G;  1GM5 A;  3M7N A;  1CSP A;  3CCU A;  2OWO A;  2JA9 A;  3J80 i;  2GVB A;  4DV7 L;  5C4X H;  1AE3 A;  1C0A A;  3PV0 A;  4JV5 Q;  2VUM H;  4LF5 L;  4NXN L;  2BH8 A;  2I5H A;  5IYC H;  2AHO B;  4LUO A;  1S3O A;  4JI6 L;  2JJQ A;  2N3S A;  2WAQ E;  2AMC B;  3RLO A;  1PH8 A;  2R7Z H;  3KYH C;  1HZC A;  3GTO H;  4DR7 L;  2UXC L;  1YIT A;  5BR8 Q;  1Q12 A;  4JI2 L;  2NN6 I;  4P72 A;  3M85 A;  1OXT A;  1OXX K;  3GTJ H;  1VQM A;  1WCM H;  1I94 Q;  4LFB L;  4B3T Q;  3UDI A;  2YTX A;  3M4O H;  3PO2 H;  4B3R L;  1N34 Q;  4JYA Q;  2B63 H;  4BY7 H;  1V43 A;  1NJI C;  4UP7 A;  5M3F G;  5E7N A;  4GNX C;  5GAD C;  3AEV A;  2ZM6 Q;  2CWP A;  4BBS G;  3RN2 A;  3CW2 C;  2KEN A;  2CQO A;  3M4P A;  3U58 A;  3PO3 H;  3PIO A;  1YJN A;  3L7Z C;  2E8G A;  3I56 A;  1A62 A;  1X9N A;  5FLM G;  2UUA Q;  1UE1 A;  4LUV A;  3E9H A;  3ERS X;  2D62 A;  1E24 A;  3ER0 A;  4A3L H;  4JI1 Q;  1HH2 P;  3A5Z B;  4IPD A;  5C3E G;  3U50 C;  1K9M C;  2EXD A;  1EUJ A;  4B3M L;  3FKI H;  1IXR A;  3ULL A;  1Q7Y C;  2D0P A;  1ASZ A;  5IP9 G;  3GTM H;  1EIF A;  1TXY A;  3TEH B;  1Q82 C;  1HZB A;  2E2H H;  2MO0 A;  4PZ8 A;  1JJ2 A;  2Y0S G;  2Q2T A;  2JA6 H;  3M3Y H;  2UXB Q;  2PMZ E;  2H5X A;  1IBK Q;  4DV6 Q;  4X66 L;  1XNR Q;  1J5E L;  2JA8 H;  1X3E A;  3I55 A;  4AQY L;  5IP7 G;  1E3P A;  2ZJQ A;  2WP8 J;  1KD1 C;  4UPA A;  4DV4 Q;  5GAG C;  4P73 A;  3CCS A;  1DGS A;  2WFW A;  3CPW A;  4KI0 A;  2BH2 A;  2GVA A;  4X64 Q;  2JK8 A;  5C4J H;  1VS0 A;  4QQB X;  4DR5 L;  1BBW A;  3J7Z C;  3CC7 A;  5C4X G;  4DR2 L;  5M3M H;  4DV5 Q;  3HOY H;  2VUM G;  4R4I A;  5IYC G;  4LF4 Q;  5C0X J;  4LNQ A;  3CD6 A;  1HNZ L;  3HOZ H;  1L0W A;  5IYB H;  3I4O A;  4GLX A;  5IYD H;  1SLJ A;  3K8A A;  3A0J A;  1UE5 A;  3TQY A;  1VQ5 A;  3RNU A;  1FVI A;  5ELO A;  4DKA C;  4AYB G;  3LGJ A;  4HJ8 A;  1XMO Q;  5ELN A;  1WCM G;  2QEX A;  2L15 A;  3CME A;  2Q2U A;  2Z0S A;  3I4N G;  1PFS A;  3CCJ A;  3PO2 G;  4JI8 L;  5AJ3 Q;  4KHZ A;  4GLA C;  4OO1 I;  1IYJ B;  1WFQ A;  4QGU A;  1Q86 C;  2B63 G;  4BY7 G;  4EX5 A;  4HJA A;  3OW2 A;  3CMA A;  1Z47 A;  2I5M X;  4DR3 Q;  1XNQ Q;  1X55 A;  1KAW A;  4OX9 L;  1HZ9 A;  1L1O A;  3PO3 G;  4YY3 Q;  4DR4 L;  1IBM L;  2R92 H;  4PZ6 A;  4B3S L;  4JI1 L;  3L2P A;  1VQH A;  4BA2 I;  3GD7 A;  4JI3 L;  3HOX H;  4A3L G;  2RF4 A;  4AYB E;  1V1Q A;  2YV5 A;  1FJG Q;  1CKO A;  4GN5 A;  4GKJ L;  1C7Y A;  1JE5 A;  1VQI A;  1TWC H;  3FKI G;  1WYD A;  5K36 G;  4DV0 L;  3HOU H;  2UUC L;  1SR3 A;  3UDF A;  1PYB A;  2A19 A;  4OWT B;  2K52 A;  2JA6 G;  5JEA J;  1R9T H;  1VQD A;  1MKH A;  1XTD A;  3M4Q A;  3TS0 A;  1KC8 C;  4A3D H;  2JA8 G;  5C44 G;  4R4T A;  4JG2 A;  2NVT H;  3H15 A;  4LF7 Q;  5H1S E;  4A3M H;  5LMU Q;  1L1O B;  3EIV A;  1JJC B;  5IY0 A;  1SRO A;  3W1G A;  3SGI A;  2UXD Q;  3CCE A;  1KHI A;  1Q81 C;  3EBE A;  5FJ8 H;  1YI2 A;  4DUZ Q;  1E22 A;  3K80 C;  4YCU A;  2VQF L;  1QVC A;  4YHH Q;  1VQK A;  2AKW B;  3JAM c;  4DUY L;  2NVX H;  4JI7 L;  3S15 H;  2MFI A;  3DM3 A;  5M3M G;  3KJO A;  1N33 L;  3OTO L;  3E0E A;  2F4V L;  3AFQ A;  1D8L A;  1HJP A;  4YCW A;  4HJ5 A;  1QVF A;  2R7F A;  4PMW A;  5IT9 c;  4IO9 A;  3T1Y Q;  1P16 A;  4A3I H;  2JQO A;  2LSS A;  2ZTC A;  1TWF H;  4RG1 A;  5IYB G;  5IYD G;  3HOZ G;  4QIW E;  2HHH Q;  3GTG H;  3PUY A;  4A3B H;  4GS3 A;  4IFD G;  1LYL A;  3AQQ A;  2RCN A;  4LF9 L;  3PF5 A;  1K0R A;  1KIX A;  3TRE A;  4WJ4 A;  1IBL Q;  2QGQ A;  4JOI A;  3G71 A;  1UWV A;  1GO3 E;  3NEM A;  5AJ3 L;  4JI5 Q;  5LMN Q;  1V9P A;  5J3B A;  1UE6 A;  2DUD A;  3BJU A;  2K5N A;  1EYG A;  1G6P A;  5IE8 A;  2YU9 H;  3ICE A;  1LUZ A;  2UU9 L;  4JCV E;  4UP9 A;  3PIP A;  2KHI A;  2VQE L;  2A1A A;  4DR1 L;  3S1M H;  1VQN A;  1SMX A;  2PI2 E;  3A5U A;  5LMN W;  4HIM A;  4X65 Q;  3T1H L;  3I4N H;  1N36 Q;  2VZA A;  2KCM A;  4YWL A;  3F8T A;  3STB D;  2R92 G;  1L1O C;  2ID0 A;  4L5Q A;  4P71 A;  2ES2 A;  1VQB A;  4A3C H;  4IOC A;  3HOX G;  3S1Q H;  3GDE A;  2AWO A;  3CAM A; 
#chains in the Genus database with same CATH topology
 2A6E D;  2ZTD A;  3HOU G;  4JVZ A;  5CR3 A;  4L6T B;  2PZT A;  1RL2 A;  4QL5 A;  4A3B B;  3TP7 A;  5KEE A;  4A3D G;  1PHJ A;  4R4C A;  1A63 A;  2KHJ A;  3J81 c;  4DAP A;  4RA8 A;  4R1J A;  4PNY A;  5FKA C;  1LTI D;  2YU9 B;  4DV1 Q;  2JA5 H;  4AH6 A;  2MJ8 A;  1XMQ Q;  5FJ8 G;  3KJP A;  4B08 A;  1X3P A;  4BA1 I;  5IWA L;  4DF7 A;  5C0X H;  5IOD A;  4KY6 A;  2MO1 A;  1K73 C;  3G4S A;  4RCN A;  5EKK A;  2CWA A;  1IKM A;  2Y0S E;  4FVM A;  3J7A 5;  2PPB C;  5JJL A;  4GKK Q;  5LL6 S;  2C9O A;  1GUN A;  1TY2 A;  3BZK A;  3ULJ A;  2ZTE A;  2GA4 B;  1TS2 A;  4DV2 Q;  4JI0 Q;  1U4M A;  1PTO F;  1Q1B A;  4EQ5 A;  3FP9 A;  2OF1 A;  3K7A B;  4O2D A;  4UP8 A;  3HOV H;  1N34 L;  2F0P A;  4ALP A;  2NZO A;  5M5Y B;  5CC4 A;  4TKO B;  3QB3 A;  4RGN A;  4R8I A;  2F0W A;  1K3R A;  3NEL A;  1S5D D;  4IFD I;  5J22 A;  2EYP A;  3URY A;  3IFT A;  5JEA H;  3GTK B;  3UI2 A;  2F0D A;  4A75 A;  4Y7N B;  1X54 A;  4DAY B;  2RHQ B;  4BY1 G;  2IWH A;  4LWC A;  3H3V C;  3KF6 A;  1I50 B;  2R93 G;  4TRD A;  1NR4 A;  1OO9 B;  1PZJ D;  1PDQ A;  1S40 A;  3QOL A;  4GN4 B;  3F2U A;  1E2Z A;  3N52 A;  2CW0 C;  5COY A;  4DV5 L;  3HOW B;  3SEB A;  2R61 A;  2F0U A;  3J81 i;  2JXM B;  1Q8I A;  1YHB A;  3S1N B;  1SRU A;  5I9O A;  4H0L C;  2DGY A;  5HUR A;  1V1O A;  2JA7 H;  4RGM A;  1F2Z A;  1YVC A;  1PFN A;  1Q46 A;  3RZD H;  3S16 H;  4OEM B;  4NMZ A;  1ILP A;  1JQY D;  1CI3 M;  1Z7T A;  5CBE E;  2HDL A;  3Q8D A;  2K5V A;  1IKL A;  1PZK D;  2X6L A;  4BXX H;  2A6H C;  2XNA C;  2VL6 A;  1Y1V B;  1BOS A;  4GN3 B;  2A8V A;  1ENC A;  3UE0 A;  4GZY C;  3H0G G;  1I4X A;  3NBH A;  1D6E C;  1U5K A;  4C56 C;  1BVS A;  1DOM A;  1U4P A;  3S2D B;  4A3G H;  1NSN S;  1BBU A;  4XTC S;  1JMC A;  4F87 A;  1CQV A;  2YTY A;  3I4M B;  2L5T A;  1AEX A;  4FF2 A;  3J7A F;  5LMU L;  1EEF D;  2PYK A;  4IUR A;  2CFM A;  2B2T C;  4JI8 Q;  2O5I C;  4DAM A;  1PH3 A;  4EGV A;  4YHH L;  1D5M C;  3QIA A;  2P5Z X;  1JWS D;  4OX9 Q;  4FDB A;  1PYS B;  4PV1 C;  5E4W C;  3GTP H;  3S1R B;  1Y1W H;  1IBM Q;  3H3V I;  3SVM A;  4C3H G;  1D2B A;  2LS0 1;  5EKL A;  1LTR D;  1J8I A;  1RHP A;  2F0M A;  2UUC Q;  1I5F A;  4FXK C;  3IRB A;  3JC6 6;  1KNA A;  1S5C D;  3HP3 A;  5IIF A;  1QNK A;  1CZG A;  4RGO S;  3I70 A;  1KL9 A;  3JAM i;  2NN6 G;  1K8M A;  5M5W B;  5I9P A;  2M2L A;  3CC2 A;  1KTK A;  4C3J B;  2O2L D;  1T9H A;  3S24 A;  1AH9 A;  4CDF C;  3PQI A;  3V2T A;  4A3E H;  2ZJP A;  2B2U C;  1YZ6 A;  5D14 A;  1QUQ B;  2R7Z G;  1NBW A;  1G29 1;  4X3T A;  3VYR A;  2FMM A;  3CF5 A;  1CHQ D;  1S72 A;  5FOB B;  4JBK A;  1D1I A;  1PLF A;  2F0T A;  4G7H C;  2VS1 A;  3PCO B;  4DV1 L;  2F3V A;  4IFD J;  1MSH A;  1D1K A;  1XMQ L;  3CCM A;  1ONL A;  1C48 A;  3OMG A;  2VQE Q;  1HZA A;  1NMF A;  5ELC A;  3LWE A;  1HHV A;  4N9P A;  2DNE A;  3GV3 A;  1BCP C;  1KLU D;  1G8Z D;  1JOK A;  1KAA A;  1TKW B;  1CKN A;  1LT5 D;  3LWU A;  4A93 G;  5FLM H;  4GKK L;  2L12 A;  1WTP A;  2K50 A;  2A69 D;  1EU3 A;  5C3E H;  4DN4 M;  4DR6 Q;  4K5W A;  4DV2 L;  2K7V A;  4JI0 L;  2L4N A;  5IP9 H;  1T5E A;  3C1F A;  2FHT A;  4HCE A;  2IHE A;  1TWG B;  2Q2H A;  2IX1 A;  1FGU A;  4C1N I;  1WTR A;  3CQZ H;  3K0X A;  4DK3 C;  1BUV T;  3RLN A;  1NMG A;  2WAQ G;  1AZQ A;  1CKM A;  1I3Q B;  3E6Z X;  2MNA A;  1EOT A;  1EY7 A;  2OQ0 A;  3HOY G;  1VQC A;  3K5M A;  4BS9 A;  1JOR A;  1O7Z A;  2PMZ B;  1A8V A;  1H9S B;  3CCU A;  4PMC A;  2JA9 A;  2GVB A;  3J81 E;  3IFD A;  4HSV A;  2BH8 A;  3S17 B;  2WAQ E;  2R7Z H;  3EFX D;  1BO0 A;  3KYH C;  1B50 A;  4WRD A;  1ZXT A;  2NVT B;  4KD3 A;  4QUF A;  2B2Y C;  1SNP A;  3M7G A;  4H44 C;  1I94 Q;  2RDG A;  2WV6 D;  4XT1 B;  3P1H A;  2E2J B;  2Q8T A;  1MI2 A;  1ICF B;  4RKL A;  1LT6 D;  3TME A;  2ZM6 Q;  4BBS G;  2K5W A;  2NTS A;  1WVL A;  2OT2 A;  3DM1 A;  3P20 A;  3X3M A;  5T1I A;  2QIL A;  5IT9 L;  1UE1 A;  4LUV A;  3E9H A;  1B2T A;  4CGY B;  4IPD A;  1EUJ A;  3HG9 A;  2MPM A;  2VUM B;  3FKI H;  3PMF A;  2R3Z A;  3GV6 A;  1Q7Y C;  2D0P A;  3GTM H;  1VMP A;  1TXY A;  4IUT A;  3D6W A;  1A15 A;  2WKC A;  2JA6 H;  3M3Y H;  3NQT A;  3NHH A;  1WD0 A;  1WCM B;  2WP8 J;  4UPA A;  3I4N B;  5GAG C;  3CCS A;  3PO2 B;  1PRT C;  3CPW A;  2BH2 A;  2QEJ C;  2ZXR A;  5A2Q E;  4BY7 B;  1SYE A;  2K05 A;  3J7Z C;  4F7X A;  5C4X G;  4CDD C;  1A2U A;  3HOY H;  2K5Q A;  4K6D A;  3E3X A;  2NTT A;  3I4O A;  4GLX A;  4FF1 A;  1SLJ A;  1K8O A;  1VQ5 A;  4IFD H;  5ELO A;  4AYB G;  5JPN C;  2SNM A;  1EYA A;  4KTA A;  1XMO Q;  4OHJ A;  1QG7 A;  4DK0 A;  4C1N K;  4JI8 L;  2N88 A;  2B2V A;  1WFQ A;  2B63 G;  3OOC A;  1XNQ Q;  4OX9 L;  1L1O A;  1TQO A;  1IBM L;  5I2Y A;  2EJG C;  4PZ6 A;  2JN4 A;  3L2P A;  2A6E C;  2RF4 A;  4AYB E;  3GQB A;  3R93 A;  4G57 A;  1FJG Q;  4GN5 A;  1C7Y A;  1VQI A;  5JJZ A;  4CKC A;  2UUC L;  3MEH A;  1R4P B;  2JP1 A;  4FF4 A;  1MKH A;  3TS0 A;  5EBD A;  2JA8 G;  5C44 G;  2F0E A;  2J7Z A;  5IOC A;  1JJC B;  4O42 A;  2Q8I B;  3EQL C;  3SGI A;  1II3 A;  3CCE A;  1Q81 C;  3EBE A;  4DUZ Q;  4YCU A;  2NVX H;  2AKW B;  3S15 H;  2L55 A;  5M3M G;  2CH4 W;  3E0E A;  4YCW A;  1D8L A;  4HJ5 A;  3T1Y Q;  2HCC A;  1P16 A;  5IYB G;  1DYQ A;  1TWF H;  5KGU A;  5CMD A;  2XIW A;  3HOU B;  3PF5 A;  3QG1 A;  1A3V A;  1SBB B;  3TRE A;  4JOI A;  1UWV A;  1IL8 A;  1GO3 E;  5LMN Q;  2F3W A;  4A3D B;  1XTC D;  2K5N A;  3J7Y W;  5IE8 A;  1CA5 A;  2ZXP A;  2VQE L;  3NTH A;  3DWQ A;  3S1M H;  1SMX A;  3A5U A;  5LMN W;  2PZU A;  2WII B;  2VZA A;  2ID0 A;  4A3C H;  4HMJ A;  4IOC A;  3V96 A;  1TU2 B;  3GDE A;  2B2U A;  5J1Z A;  3CAM A;  4CBV A;  3D6C A;  2BDN A;  4DR6 L;  5C3W A;  5C4H A;  1EIY B;  4LFC Q;  2J4X A;  1EEI D;  3H3V H;  2HIX A;  1VQO A;  1QJO A;  2K28 A;  4JI4 Q;  4MN3 A;  2HT1 A;  2LY7 A;  4X6A H;  3H09 A;  1EFW A;  1GJX A;  2DY8 A;  2KCN A;  2XGT A;  4GOP A;  4A3M G;  1VF5 C;  2K5D A;  1JT8 A;  4KHV A;  2V4D A;  1W2B A;  1LM0 A;  3LNN A;  1SYB A;  5C44 H;  1RTO A;  1QCB D;  2EYM A;  2CVR A;  2EYF A;  3MC0 B;  4TQU S;  1NCV A;  1X3G A;  5DEH A;  2Z6K C;  3AFP A;  1HR0 Q;  1JB7 A;  3VR3 A;  2R7D A;  4A3I G;  1S5E D;  5C5L A;  4B9W A;  3BDC A;  4OWW B;  1NE3 A;  2SNS A;  4J6H A;  3BDL A;  3HS0 C;  1YJW A;  1M90 C;  1HR0 W;  4A3F G;  2IT1 A;  3CCR A;  3F2B A;  1NY4 A;  1B8A A;  2HIV A;  1SYF A;  2KCT A;  1TWH H;  1QE6 A;  4OXP A;  1ET6 A;  5HY6 A;  1I94 L;  2E2I B;  1E0B A;  3EJI A;  4BY1 B;  4LF6 Q;  4KLK A;  2ALY B;  3R2T A;  4FYD A;  4PQX A;  1A6X A;  1B1Z A;  4H02 A;  2ZM6 L;  1VQ6 A;  2E5L Q;  3KUP A;  2BCO A;  4FP5 D;  1K83 B;  1LO5 D;  2I07 B;  4UAI A;  2EIF A;  4ZAI A;  1YNN D;  3O13 A;  1Y1W B;  1H9R A;  1PH2 A;  1Q1E A;  4HIK A;  1LLR D;  4F88 A;  4P2C B;  3CHB D;  4NP5 A;  4HIO A;  1F9P A;  2MHV A;  2CCZ A;  2BE5 D;  5COR A;  3RZO H;  2SOB A;  2ZJR A;  3F2D A;  4DV7 Q;  1U4R A;  4K14 A;  4L5S A;  1Q3L A;  4JI6 Q;  4P75 A;  4DR7 Q;  4IJL A;  2JA5 G;  4IPC A;  1IW7 D;  2IX0 A;  4JI2 Q;  4ME3 A;  5KNB A;  5TSS A;  3SK4 A;  4NDX A;  4DA2 A;  1VF7 A;  5C0X G;  3C46 A;  4TVA B;  5GQO A;  2QA4 A;  2H1E A;  1FL0 A;  3F1Z A;  1LAB A;  3GO5 A;  3GTQ H;  3RD4 A;  3A74 A;  4MNO A;  3HRZ C;  1AN8 A;  1Q90 A;  2F52 A;  1HFG A;  1VQ7 A;  3I7F A;  4QMG A;  3TZU A;  2VB3 X;  3H0G B;  5CV9 A;  1XMO L;  1MJC A;  3CP0 A;  5EKI A;  1YJ9 A;  3SK8 A;  3PF4 A;  1I4Q A;  3KF6 B;  4A3F H;  2F0H A;  2KQ3 A;  2K1B A;  3HOV G;  3TP6 A;  3CXC A;  3FRP B;  3WDN A;  3LX0 A;  5FK9 C;  1J5E Q;  1XNQ L;  4AQY Q;  4JBJ A;  3SDZ A;  2KED A;  3OIP A;  5FLX c;  4EVO A;  1RDP D;  4R4O A;  2SDF A;  1FJG L;  1E1T A;  2EXZ A;  2IJ0 A;  3VR4 A;  3D31 A;  5KYL A;  3PGZ A;  5JEA G;  3OW7 A;  1XPO A;  1G6Z A;  4C3H B;  1CHP D;  4P74 A;  3NEN A;  1YEZ A;  1F2M A;  1TR5 A;  4X3U A;  1UEA B;  3P7J A;  1KQS A;  5BN4 A;  1E1O A;  2LXJ A;  3I4L A;  3MFG A;  1VQ9 A;  1VQL A;  4MZ9 A;  2EQS A;  4DUZ L;  4KV6 A;  4IPG A;  5M5X H;  4WJW A;  5CV7 A;  3K59 A;  2XWB B;  1F2Y A;  3TZD A;  1PZI D;  1UUP A;  5ELF A;  3T1Y L;  3D0F A;  4IN3 A;  3K5L A;  1AZP A;  3NBH B;  4B3S Q;  3S14 B;  2VNU D;  1STE A;  3GTL H;  2A69 C;  5GAH C;  3ZJY C;  1V8Q A;  1X65 A;  1EY0 A;  2JSO A;  1PH4 A;  1G2S A;  3BYY B;  3OHX C;  1S5F D;  4LK1 C;  2JEB I;  1W6J A;  5T1G A;  2R7Z B;  2ASB A;  5LMN L;  1PH5 A;  1XPU A;  2JA7 G;  3S2H B;  4APV A;  4HN7 A;  5I2X A;  2XTI A;  1BXT A;  2NVY B;  2GN5 A;  3C1E A;  3BVZ A;  4J8Q A;  1TT2 A;  3ND8 A;  4IZ8 A;  2OTL A;  3VA7 A;  2KCC A;  3UE1 A;  4A3K H;  4BXX G;  3KDF A;  3E5S A;  4LUZ A;  1BF4 A;  4JBM A;  3BYT B;  2F4I A;  4LAA A;  4DUY Q;  3HKS A;  2F4V Q;  4IJH A;  1EY9 A;  3OTO Q;  5JJI A;  3TDQ A;  1KAB A;  1SFO H;  3IAY A;  2CHB D;  4A3G G;  1PFM A;  4LFC L;  2PI2 A;  3R3O A;  4A93 B;  1SJE D;  4JI4 L;  4H13 C;  1CUK A;  1MSG A;  2F3I A;  4O0A A;  4X62 L;  1EFI D;  1F9Q A;  4HCS A;  4C2M H;  3NWT A;  4MTN A;  4QY7 A;  1VQ4 A;  2TMP A;  1WJJ A;  3STB C;  1LAC A;  1D7Q A;  3MEF A;  4CKE A;  1TWA H;  1FR3 A;  4GNX A;  2Z8L A;  2L0C A;  5FO9 B;  2I0Q A;  1VQP A;  1HR0 L;  4LW1 A;  2WAQ B;  1ILQ A;  4XYQ A;  5M3F H;  4G7Z C;  1Y1W G;  3MXN A;  5FO8 B;  1M1K C;  3HOY B;  5CBA E;  1W3S A;  5G3L F;  2QW7 A;  1GUO A;  3A8K E;  1GKH A;  1A3T A;  1HA5 A;  2EY1 A;  1QOH A;  3PUW A;  1HNX Q;  2K4K A;  3QO2 A;  1SNO A;  3F2C A;  1PV4 A;  3K6O A;  3ND9 A;  2V1C C;  2E76 C;  5EGT A;  4LF6 L;  1HPC A;  3AYH B;  2HUG A;  3KK7 A;  2E5L L;  1S5B D;  1XJV A;  4XIG S;  3ERQ A;  2QF7 A;  2Z6K A;  1NUC A;  1QZH A;  1VDZ A;  5A2Q L;  1CKN B;  4LF8 Q;  4DV3 Q;  2B2W C;  1VQA A;  4A3E G;  1GM5 A;  4BBS B;  1STG A;  2IW3 A;  1WTV A;  2K01 A;  2OWO A;  1C0A A;  4DV7 L;  4U67 3;  2NVQ B;  1AE3 A;  4R9W A;  5IYC H;  2AHO B;  4LUO A;  2TSS A;  4JI6 L;  1GUW A;  1XX8 A;  4DR7 L;  2AMC B;  3RLO A;  3GTO H;  1L0Y B;  1HUN A;  4V19 0;  4ABN A;  3QWN A;  1YIT A;  1Q12 A;  4JI2 L;  3VYU A;  4P72 A;  1OXX K;  1O78 A;  4LFB L;  4B3T Q;  3M4O H;  2YTX A;  2IPK D;  4CDE C;  4JYA Q;  3GP7 A;  4UP7 A;  1I6H B;  2NVX B;  5GAD C;  3AEV A;  4R8N A;  3JAM L;  2RKS A;  5KIX A;  3RN2 A;  3CW2 C;  1WTW A;  2CQO A;  3PO3 H;  4WOR A;  3PIO A;  1PRT F;  3L7Z C;  4N8F A;  3W2D A;  5FLM G;  2VXW A;  5DNF A;  1JC7 A;  3ERS X;  5LHY 1;  1E24 A;  1QIL A;  4A3L H;  1WTO A;  3A5Z B;  5C4X B;  5C3E G;  1K9M C;  1RKN A;  2EY5 A;  1I4P A;  3MXP A;  3VA5 A;  3ULL A;  5IP9 G;  1EIF A;  3HKZ B;  1HZB A;  2XVS A;  4PZ8 A;  1JJ2 A;  2ICE C;  4HSP A;  4RHS A;  4IUU A;  4UDU C;  1J5E L;  1EY6 A;  2JYO A;  5L37 A;  4MTK A;  4AYB B;  4K5V A;  4AQY L;  1IYV A;  3NBI A;  4WFN 3;  4P73 A;  3WOE A;  3SR1 A;  2WFW A;  4X64 Q;  2B63 B;  1VS0 A;  1WTX A;  1JCK B;  4QQB X;  3P75 A;  3VYS A;  3NQI A;  4R4I A;  4ODG A;  1HA6 A;  3NUC A;  3HOZ H;  1L0W A;  1HCZ A;  4BWG B;  3CRK C;  2RSO A;  1SEB D;  2L11 A;  3DWP A;  4KY5 A;  3K8A A;  4OGQ C;  3A0J A;  3RNU A;  3OSO A;  1EU4 A;  2E2H B;  4HJ8 A;  5LL6 X;  2EE1 A;  2L15 A;  1SE3 A;  2Z0S A;  1LTB D;  2A73 B;  2JA8 B;  2F0V A;  4KHZ A;  5C44 B;  2EYH A;  5JOB A;  4EX5 A;  1SNM A;  1Z47 A;  1KAW A;  2B39 A;  1HZ9 A;  5FO7 B;  4YY3 Q;  1QNU A;  5C4J B;  2R92 H;  4B3S L;  4JI1 L;  4BA2 I;  3HOX H;  5M3M B;  1ZEQ X;  3FKI G;  1NNX A;  3FDT A;  3NP8 A;  1SR3 A;  3UDF A;  2JA6 G;  2L9H A;  3D4R A;  1VQD A;  1XTD A;  3M4Q A;  1IHZ A;  1SE4 A;  5FLX E;  4HMI A;  5ELE A;  4JG2 A;  1GOZ A;  3S9W A;  4F8M A;  1L1O B;  4CJ2 C;  1SRO A;  3W1G A;  2UXD Q;  1KHI A;  3Q22 A;  3K80 C;  4G7O C;  4DUY L;  2MFI A;  2F4V L;  2F0J A;  3OTO L;  3AFQ A;  5IT9 c;  4PMW A;  3L9A X;  2LSS A;  4RG1 A;  3I8Z A;  4ME5 A;  2HHH Q;  1BNZ A;  3OWF A;  3PUY A;  1TWC B;  4A3B H;  4GS3 A;  4IFD G;  2E2D C;  3AQQ A;  3NSW A;  2WIN B;  1K0R A;  4DGZ A;  4X3K A;  1M4V A;  3G71 A;  3T51 B;  2DJF C;  5AJ3 L;  1UE6 A;  3BJU A;  2YU9 H;  1LT4 D;  1LUZ A;  2EJF C;  3PIP A;  2EJM A;  4A3M B;  4HIM A;  3R8B A;  4QF4 A;  1N36 Q;  1TVX A;  1YNN C;  3F8T A;  3STB D;  4ZCK A;  4L5Q A;  4P71 A;  4S3S A;  2AWO A;  2HCI A;  2BE5 C;  4HR7 B;  5I6W A;  1HTP A;  4LFA Q;  4A3I B;  3ULP A;  5C3X A;  1W6K A;  4Q5V A;  1HNX L;  1VQG A;  3GTG B;  4KHP Q;  1ROD A;  3BS1 A;  3B6Y A;  1DOK A;  4OIK A;  1PH6 A;  4A3F B;  1DXM A;  1IW7 C;  2PCF B;  3K7A H;  5DM7 3;  4JPB W;  2D9U A;  5D65 A;  3CRL C;  3IL8 A;  3KBX A;  5M5Y H;  2WAC A;  1YNJ D;  2RA4 A;  2N78 A;  3FEW X;  3NE5 B;  4BBR G;  4LF8 L;  1YBY A;  3KF8 B;  4DV3 L;  4PG3 A;  2E75 C;  5A35 A;  1HQR D;  3RN5 A;  1K8G A;  3BZC A;  4NXM Q;  1PTO B;  1QUQ A;  1SMY D;  2OCE A;  2PQA A;  4JI5 L;  4Y7N H;  2LXK A;  3OIQ A;  3HKZ G;  2A74 C;  3G6J B;  4GOP B;  3SK6 A;  1ENF A;  4K2L A;  1GUS A;  1O80 A;  4XDX A;  2RDF A;  3MWY W;  4B3T L;  1VMC A;  4MIU A;  1K28 A;  1UNS A;  1I50 H;  1C4Q A;  1STB A;  1GHJ A;  4JYA L;  3HGB A;  2JA5 B;  1A0I A;  2KBN A;  2SEB D;  4M1U B;  1H9M A;  1GUT A;  5HGQ A;  4A3C G;  4POF A;  2B2W A;  3NTK A;  2M00 A;  3HOW H;  1EYD A;  3KLS X;  3HKZ E;  2NUC A;  1Q8K A;  1XYI A;  2K14 A;  1PH9 A;  3S1N H;  3BZD B;  2H4O A;  1BKB A;  2FMC A;  3KFU A;  3UDX A;  4NXN Q;  1EOV A;  2WB1 B;  2IX3 A;  2XWJ B;  2UXC Q;  1FD7 D;  2B29 A;  3NPP A;  3K5N A;  2X6G A;  1CQF A;  2B2T A;  2FFK B;  3HOV B;  4X64 L;  1GVP A;  3I73 A;  3CPF A;  1KDA A;  1EQR A;  1HTL D;  4K8I A;  1U4L A;  1Y1V H;  4B9X A;  4KMU C;  4BBR H;  1QWY A;  1GXD C;  5DAU A;  2AWN A;  3TBI B;  2CQA A;  1JB3 A;  3A7L A;  4POG A;  2I5L X;  3RLF A;  1AE2 A;  4YWM A;  4L5R C;  1TY0 A;  4B3M Q;  1B53 A;  4HID A;  2FJ2 A;  4E6I A;  1Y14 B;  3I4M H;  2F0Q A;  1N8R C;  2BOS A;  5C5M A;  2K5H A;  1PVO A;  3L0O A;  2XRQ D;  3K81 C;  3SK5 A;  4YY3 L;  3IKJ A;  3S1R H;  5D3D A;  4A3J H;  4WJ3 M;  4A4I A;  2F0O A;  2KEE A;  3U4V A;  3VR6 A;  4DR5 Q;  1L0X B;  2RCF A;  2ATW A;  1Y8P B;  4DNI A;  4DR2 Q;  1MGS A;  1N9W A;  1NR2 A;  1SYD A;  1KDB A;  1STN A;  2K32 A;  4IUP A;  3RR5 A;  5EAY A;  4K5X A;  1PTO D;  3DMU A;  5DLQ E;  1OXV A;  1HRJ A;  5JJK A;  2JA7 B;  2QKI C;  5ELD A;  3RZD B;  1MIU A;  2D0O A;  4X62 Q;  3S16 B;  1HUM A;  2UXD L;  5M5W H;  3TP5 A;  1F77 A;  2M9V A;  3CC4 A;  2HDM A;  2F0N A;  1HQM C;  1V1P A;  4C3J H;  3HFZ B;  1WTQ A;  2BA0 A;  2HD3 A;  1O7I A;  1R4Q B;  2PQE A;  4DR4 Q;  1U0L A;  4ZK9 B;  2HHH L;  4DK6 C;  4YWK A;  4PMB A;  2HQL A;  1NAP A;  1A2T A;  2NB0 A;  4GKJ Q;  2OTJ A;  3W3A A;  4DV0 Q;  3Q6S A;  3EVQ A;  3ZYY X;  4A3G B;  3J80 c;  1B70 B;  1LTL A;  2YYZ A;  1EY8 A;  4DPG A;  5KRU A;  4IUV A;  3BG3 A;  1N36 L;  5ISR A;  4YCV A;  3G6E A;  4XT3 B;  4XQQ A;  3CCL A;  1RCV D;  5GRO A;  4A76 A;  1DOL A;  2G9D A;  5G3L D;  1ESF A;  5GAE C;  1K8A C;  2DY7 A;  2VQF Q;  1NTG A;  2MQH A;  3GTP B;  4JI7 Q;  1P8L A;  4LFA L;  2K04 A;  2AQ1 B;  2AQ3 B;  2CKZ B;  1CK1 A;  4CKB A;  3RMH A;  4KHP L;  4C3I H;  2F0F A;  3PUZ A;  1SDF A;  4QCL A;  2K75 A;  2Z1C A;  2N49 A;  4HJ9 A;  3M9B A;  2PW7 A;  1U9R A;  2B2Y A;  1TWG H;  4QIW B;  1C9O A;  4NPS A;  1SNC A;  1QZG A;  2B3G A;  2UU9 Q;  3FMC A;  1B44 D;  2Z4H A;  3KDF B;  1LTT D;  2PO4 A;  1SJH D;  4K8J A;  1I3Q H;  3DXJ C;  1WOC A;  1GD7 A;  4RGT A;  4LFB Q;  3T1H Q;  3G48 A;  3T53 B;  2XN9 C;  1LV9 A;  2VB2 X;  3TS2 A;  5CV8 A;  4NXM L;  3H6M A;  3BU2 A;  2JEA I;  5EBC A;  2F0K A;  4NKL A;  2XSC A;  5F2D A;  3KOJ A;  4A3E B;  2K33 A;  3S17 H;  4K6L A;  2EY6 A;  5I4D A;  2WB1 G;  1VQJ A;  3MAQ A;  5CYU A;  3T56 B;  2UUB Q;  1UAP A;  4KY7 A;  2NZH A;  1IZ6 A;  3A56 A;  1IL2 A;  2RDH A;  5KND A;  4DAV A;  4GNX B;  1QB5 D;  2E74 C;  5IP7 H;  4L5T A;  4A3K G;  2E2J H;  4JC0 A;  1CT1 D;  2N8N A;  1PA6 A;  3MXN B;  3U9O A;  1AP0 A;  4ID6 A;  2R92 B;  3CKI B;  1YHQ A;  4RCO A;  2KEC A;  3FHW A;  2WB1 E;  3VDY A;  3M7N A;  1CSP A;  2EVB A;  1BR9 A;  2PW5 A;  3J80 i;  4X3S A;  3PV0 A;  4JV5 Q;  2VUM H;  1SXT A;  4NXN L;  1EZ8 A;  1S3O A;  2JJQ A;  5C3E B;  2UXC L;  1PH8 A;  1HZC A;  2QCP X;  1FNU A;  5BR8 Q;  4UHV A;  2NN6 I;  1PMR A;  3GTJ H;  1WCM H;  3QOJ A;  5CV5 A;  3PO2 H;  2LMC B;  3CQZ B;  4B3R L;  1ZYR D;  1J9O A;  4BY7 H;  1NJI C;  5M3F G;  2CWP A;  1ET9 A;  3M4P A;  1I4H A;  1A62 A;  3I56 A;  1X9N A;  2UUA Q;  5IGB A;  3K58 A;  3ER0 A;  4JI1 Q;  1HH2 P;  2D5D A;  5KNC A;  1ML0 D;  5E3F A;  4B3M L;  5K36 H;  5IGC A;  1ASZ A;  1Q82 C;  2MUY A;  2Y0S G;  2Q2T A;  2UXB Q;  5CV6 A;  4DK1 A;  1IBK Q;  1JR0 D;  4DV6 Q;  1XNR Q;  2DNC A;  5FLX L;  1E3P A;  3AMU A;  4IAL A;  4HAE A;  2DN8 A;  1KD1 C;  1DON A;  4ULL A;  4DV4 Q;  5EPK A;  1DD2 A;  2JK8 A;  4N9T A;  4Q0F A;  4DR5 L;  1A3U A;  1JE4 A;  1LT3 D;  4DR2 L;  5IYC G;  4LF4 Q;  2EDG A;  4LNQ A;  2OXP A;  5IYD H;  1BCP F;  1F2L A;  3D4D A;  1WD1 A;  3FKI B;  1UE5 A;  3TQY A;  3BVG A;  3J81 L;  3GTM B;  1Y69 U;  1RJT A;  2JA6 B;  5ELN A;  3M3Y B;  2KA7 A;  1SYG A;  3T4A C;  3CME A;  4KJN A;  5AJ3 Q;  4OO1 I;  1KNE A;  4GLA C;  1Q86 C;  4U68 A;  2F03 A;  1HXY D;  1FGB D;  2LFN A;  4DR3 Q;  4RHR A;  2I46 A;  1GHK A;  3PO3 G;  4DR4 L;  3GD7 A;  2L1B A;  3DHQ A;  4A3L G;  1RF2 D;  2YV5 A;  4GKJ L;  1JE5 A;  4DV0 L;  3HOU H;  1LTS D;  1PYB A;  3AU7 A;  2LKV A;  1R9T H;  4A3D H;  3D4W A;  2ZT9 C;  4R4T A;  4LF7 Q;  1YNJ C;  2EOT A;  1PYW D;  5I6Y A;  1DZ1 A;  5FJ8 H;  1E22 A;  1EZ6 A;  1SNQ A;  2MGS A;  2VQF L;  1VQK A;  3JAM c;  4JI7 L;  2NBF A;  5E4X A;  3DM3 A;  3KJO A;  2C5C A;  2R7F A;  1SMY C;  2JQO A;  3HOZ G;  1ZKO A;  3MFY A;  4QIW E;  3T16 A;  2ZXO A;  4L8J A;  1KIX A;  2Z4I A;  1SSO A;  1IBL Q;  3NEM A;  4JI5 Q;  4ZUI A;  5BN3 A;  1G6P A;  3OMC A;  1EYG A;  1T5X D;  2UU9 L;  4JCV E;  1EWC A;  2KHI A;  2A1A A;  3I90 A;  1EQT A;  1DCZ A;  2B2V C;  3C3L A;  2PI2 E;  1TS5 A;  4X65 Q;  3T1H L;  4KN7 C;  3X3N A;  3DWA A;  4YWL A;  2R92 G;  1L1O C;  2PNR C;  4K2K A;  4LJZ C;  1I4R A;  3HOX G;  1ESR A;  3S1Q H;  4BBR B;  5DM6 3;  1IYU A;  3S15 B;  2CH4 A;  1B9N A;  3TRZ A;  2Z9H A;  3J80 E;  1TWF B;  3NWS A;  5AFW A;  1OXS C;  1BDO A;  2R6G A;  1VQF A;  3V05 A;  2Q2I A;  3H91 A;  2UUB L;  4R4Q A;  4DNR B;  1SN8 A;  3NXW A;  3H94 A;  2E2I H;  4NB3 A;  1JWU D;  4FO2 A;  3G7L A;  5JVG 3;  4BY1 H;  4RMF A;  1N32 Q;  4GLV B;  4K0K Q;  1SAP A;  3D3R A;  2B8G A;  3S1M B;  1HNW Q;  3PSI A;  2R93 H;  1E7Z A;  1K83 H;  1H9K A;  3K57 A;  1MD2 D;  2F1M A;  4A3J B;  4N8X 1;  1EIH A;  3FPP A;  2OEO A;  3KLS A;  3DLL A;  1XXG A;  4KK7 A;  4JV5 L;  5KYI A;  1MJE A;  4KN4 C;  4A3B G;  1UEB A;  3WWV A;  1FNV A;  3PUV A;  1PH7 A;  2Q8R E;  2G9H D;  3A54 A;  4XYO A;  5BR8 L;  1LTA D;  4JOI C;  1QVG A;  5EJW A;  1X3Q A;  4DAY A;  2J0T D;  5C4Z A;  1J6Q A;  3MXU A;  1PH1 A;  1ASY A;  1JOO A;  3I2Z A;  1EWI A;  2O4X A;  3E0J A;  4H7B A;  1FNW A;  1OXU A;  1RD9 D;  4OWX B;  4CJ0 B;  1Z9F A;  2G5D A;  4Y52 H;  1K3B C;  3ITP A;  2A68 C;  5EQ0 A;  3SHL A;  4ZUJ A;  2UUA L;  3MA2 B;  1SE8 A;  1SE2 A;  1FYC A;  2PQA B;  4KKT A;  1CSQ A;  1G51 A;  3OPO A;  3H0G H;  3ERO A;  1PTO C;  4LF5 Q;  1YNX A;  1O7Y A;  1X3F A;  4LMQ D;  2UXB L;  1IBK L;  2ENB A;  1X56 A;  1TWH B;  4DV6 L;  1XNR L;  3K0Y A;  4GOP C;  3SE0 A;  5EPJ A;  4DV4 L;  1M8A A;  3MXG A;  4J15 A;  4CJ1 B;  1WTH A;  2K03 A;  2D2C C;  1WI5 A;  1B3Q A;  4DNT B;  4AIM A;  4UY8 C;  4LF4 L;  1EQV A;  1EYC A;  4G4K A;  3UDG A;  2IY5 B;  4C3H H;  4C3I B;  2VW9 A;  3RZO B;  1TS4 A;  4JK1 C;  1F9R A;  1OTC A;  2RHS B;  2QDL A;  4QJF A;  1KLG D;  4IUN A;  5D3I B;  2YTV A;  3A8J E;  3CCV A;  1G2T A;  2JE6 I;  3HZX A;  1KDC A;  2AUK A;  2KHS A;  1X32 A;  4X66 Q;  1HFN A;  4DR3 L;  3CCQ A;  5IGD A;  1LTG D;  4OO1 G;  1EY4 A;  3OYY A;  5JPM C;  1UE7 A;  2NN6 H;  4DFA A;  3HOW G;  3ONA B;  3S14 H;  4RFB A;  3GTQ B;  4RWS C;  1KRS A;  4IOA A;  4IUQ A;  1B4O A;  1PXU A;  2NWG A;  1XWE A;  5CV4 A;  1JOQ A;  1HNZ Q;  4XXE A;  3S2H H;  1DJR D;  5E1F A;  1ENA A;  4OON A;  4LF7 L;  4L63 B;  2C35 B;  3M4Y A;  2NVY H;  2IHF A;  4JW0 A;  1STY A;  3EN2 A;  1E2V A;  1DM0 B;  1D5Z C;  2FXQ A;  3AB9 A;  1EQQ A;  4I7A A;  1EL0 A;  1Y1V G;  3TSS A;  3OWE B;  1TS3 A;  1YIJ A;  4RKB A;  2OQK A;  2CW0 D;  3E9I A;  4JBW A;  4JI3 Q;  1CTM A;  4QB4 A;  5IGG A;  3GTK H;  3KLW A;  1CFM A;  1GUG A;  4A93 H;  1JIC A;  3QJY A;  2EY2 A;  1IBL L;  1KXL A;  2ICI A;  3I4M G;  3A7A B;  2PNH A;  1KRT A;  1RIP A;  4HJ7 A;  1JJG A;  4O1N A;  4ZKB B;  3GTJ B;  2RSN A;  5C0X I;  1TII D;  4X65 L;  2EYO A;  1V1P B;  3A55 A;  1BCP B;  5EPL A;  3Q23 A;  3MTS A;  4IPH A;  4A3J G;  5M5X B;  1B7Y B;  2K6A A;  4OO1 H;  2A6H D;  1VCI A;  1N33 Q;  2B8F A;  3GTL B;  2KJX A;  2MP1 A;  4Z9C B;  4YIJ A;  2KVM A;  1YHA A;  4LF9 Q;  5J39 A;  1E2W A;  1N32 L;  3W5O A;  5BN5 A;  4K0K L;  3FVQ A;  1H9J A;  1ZYR C;  3JAM E;  1HNW L;  4DR1 Q;  4PZ7 A;  4C3J G;  2BA1 A;  3W1B A;  4HED A;  1CM9 A;  4A3K B;  4FXG C;  4KJO A;  1X6O A;  4B3R Q;  1EWH A;  4BBS H;  1EY5 A;  2A5H A;  3CU7 A;  1B9M A;  1XPR A;  5K5P A;  2NVQ H;  1ICW A;  1JWM D;  3PIO 3;  1SFO B;  1H9S A;  3U4Z A;  3RUZ A;  1L2F A;  1VQE A;  3K7U C;  3S2D H;  1MHW C;  2AUJ D;  1H95 A;  2VY3 A;  4EQO A;  4C2M B;  3QR8 A;  4RH6 A;  5ELB A;  2RVL A;  3Q0A A;  3PUX A;  3MVV A;  4ILW A;  3C2P A;  1I6H H;  2FIN B;  3T13 A;  3J81 j;  1TWA B;  2XRS D;  3MZ5 A;  1VQ8 A;  5M3F B;  5IWA Q;  3L3O C;  4ZKC B;  1I6V C;  2A68 D;  5C4X H;  4C3I G;  1Z6H A;  4LF5 L;  1Y8N B;  2I5H A;  1F9S A;  2KUM A;  4KD4 A;  2N3S A;  1R9T B;  3DEP A;  4ZQ3 A;  2DJG C;  4DXG A;  2NYZ D;  1BQQ T;  3M85 A;  1OXT A;  4HTH A;  1PRT B;  2Y0S B;  1VQM A;  1CA6 A;  3UDI A;  1AFP A;  4MHE A;  4J1M A;  1N34 Q;  2B63 H;  1V43 A;  5E7N A;  3NK9 A;  3DUZ A;  3U9S A;  4GNX C;  3TP8 A;  4I65 A;  3KF8 A;  2KEN A;  3U58 A;  2N55 A;  1YJN A;  2E8G A;  1BCP D;  3BDO A;  4I7Z C;  2D62 A;  3Q24 A;  4OL7 A;  3U50 C;  5HGT A;  2RQX A;  2EXD A;  5IGE A;  4M8A A;  4FF3 A;  1IXR A;  4XQN A;  2PZW A;  2E2H H;  3TEH B;  2MO0 A;  3VYT A;  3I72 A;  3GTO B;  2PMZ E;  3K5O A;  2H5X A;  2NZ1 D;  4IQZ A;  4X66 L;  2JA8 H;  1X3E A;  3I55 A;  5IP7 G;  2ZJQ A;  4EQP A;  3M4O B;  3HEJ A;  1DGS A;  3D8G A;  4KI0 A;  2GVA A;  2IL8 A;  1I4G A;  1BBX C;  1STH A;  5C4J H;  3S1Q B;  1B3A A;  3A8I E;  4DU9 A;  2RBM A;  1BBW A;  3PO3 B;  3CC7 A;  4KKS A;  5M3M H;  1O7L A;  4DV5 Q;  1Y8O B;  2VUM G;  3KBG A;  5IGF A;  5C0X J;  4FXD A;  3CD6 A;  1HNZ L;  5IYB H;  3TN2 A;  1D5X C;  1S4Z A;  4OEL B;  2HQE A;  3WOF A;  1SYC A;  4ZRZ A;  1SND A;  1FVI A;  4DKA C;  3LGJ A;  2Z6B A;  2F0G A;  1C8C A;  2QDB A;  1WCM G;  1EIG A;  2QEX A;  2Q2U A;  3I4N G;  1PFS A;  3CCJ A;  3PO2 G;  1IYJ B;  4QGU A;  4BY7 G;  1STA A;  4HJA A;  3OW2 A;  3CMA A;  2R93 B;  4FNF A;  2I5M X;  1X55 A;  3PIP 3;  4EQN A;  3EA6 A;  2EZV A;  5IT9 E;  5JVH 3;  1VQH A;  1RTN A;  4JI3 L;  3N6R A;  1V1Q A;  2EPB A;  4QUC A;  1CKO A;  3VR5 A;  5JAV A;  1TWC H;  1G91 A;  1WYD A;  5K36 G;  2O5J C;  3HOZ B;  3J80 L;  2A19 A;  4OWT B;  2K52 A;  4CDC C;  5JEA J;  4V0B A;  1KC8 C;  1CZW A;  4OIJ A;  4RAU C;  2NVT H;  2BDO A;  4XQJ A;  3H15 A;  5H1S E;  4A3M H;  2X69 A;  5C6A A;  5LMU Q;  2F0S A;  3EIV A;  5IY0 A;  3DEO A;  1PFB A;  3I91 A;  2F0L A;  3MHB A;  1YI2 A;  3SXH A;  3FPU B;  1PRT D;  1QVC A;  2F0I A;  5NUC A;  4YHH Q;  1N33 L;  1HJP A;  1QVF A;  4IO9 A;  4TSS A;  3HOX B;  2KOL A;  3VR2 A;  4A3I H;  2ZTC A;  5IYD G;  4ZYS A;  2AQ2 B;  3GTG H;  3I3C A;  1LYL A;  2RCN A;  4LF9 L;  4CHT B;  3BVM A;  4DXF A;  2WKD A;  4WJ4 A;  2QGQ A;  4ZLT F;  3R2I A;  1V9P A;  5J3B A;  1MBY A;  2DUD A;  2EYL A;  3J7A V;  1K0S A;  3ICE A;  4UP9 A;  4DR1 L;  1AW7 A;  3KLR A;  5M9O A;  1VQN A;  3NTI A;  3I4N H;  4NW2 A;  2KCM A;  2ES2 A;  1VQB A;  2EYJ A;  5CGK A;  4KKU A;  1PTO H; 
#chains in the Genus database with same CATH homology
 2ZTD A;  3HOU G;  3TRZ A;  4LFA Q;  3ULP A;  4DR6 L;  1RL2 A;  1HNX L;  4QL5 A;  1VQG A;  1OXS C;  2R6G A;  1VQF A;  4A3D G;  4KHP Q;  2Q2I A;  1PHJ A;  1EIY B;  3B6Y A;  4R4C A;  4LFC Q;  2UUB L;  4R4Q A;  2HIX A;  1VQO A;  2KHJ A;  3H3V H;  3J81 c;  1A63 A;  1SN8 A;  1PH6 A;  4JI4 Q;  2HT1 A;  2E2I H;  4NB3 A;  4X6A H;  4R1J A;  1EFW A;  4GOP A;  2XGT A;  3K7A H;  4A3M G;  1JT8 A;  4BY1 H;  4RMF A;  1W2B A;  1N32 Q;  1LM0 A;  4GLV B;  4DV1 Q;  2JA5 H;  4AH6 A;  4K0K Q;  5M5Y H;  1XMQ Q;  5FJ8 G;  5C44 H;  3KJP A;  2N78 A;  1HNW Q;  3PSI A;  2R93 H;  1E7Z A;  1K83 H;  4BBR G;  4LF8 L;  1YBY A;  3KF8 B;  4TQU S;  4BA1 I;  5IWA L;  4DV3 L;  1X3G A;  2Z6K C;  3AFP A;  1HR0 Q;  4PG3 A;  2MO1 A;  1K73 C;  3DLL A;  1JB7 A;  3RN5 A;  2R7D A;  4A3I G;  1K8G A;  3BZC A;  3G4S A;  4NXM Q;  4JV5 L;  2CWA A;  1MJE A;  4A3B G;  4OWW B;  1NE3 A;  1UEB A;  2Y0S E;  1QUQ A;  3WWV A;  3J7A 5;  1YJW A;  4Y7N H;  2OCE A;  2PQA A;  4JI5 L;  1M90 C;  2LXK A;  1HR0 W;  3PUV A;  4GKK Q;  4A3F G;  1PH7 A;  2IT1 A;  5JJL A;  3CCR A;  3F2B A;  1NY4 A;  3HKZ G;  1B8A A;  2HIV A;  5BR8 L;  4GOP B;  2KCT A;  1TWH H;  3BZK A;  3ULJ A;  4JOI C;  2ZTE A;  1QVG A;  4OXP A;  4DV2 Q;  4JI0 Q;  5HY6 A;  1I94 L;  4B3T L;  1Q1B A;  4EQ5 A;  3FP9 A;  1I50 H;  1J6Q A;  4O2D A;  4UP8 A;  1PH1 A;  3HOV H;  4LF6 Q;  4KLK A;  1N34 L;  2ALY B;  4ALP A;  4JYA L;  1ASY A;  2NZO A;  1A0I A;  3I2Z A;  2KBN A;  1EWI A;  4H02 A;  2ZM6 L;  1VQ6 A;  1OXU A;  5HGQ A;  4OWX B;  4POF A;  1Z9F A;  2E5L Q;  4A3C G;  4Y52 H;  2EIF A;  3HOW H;  1PH2 A;  2UUA L;  1K3R A;  1Q1E A;  3HKZ E;  3NEL A;  4HIK A;  1SE8 A;  4IFD I;  4HIO A;  1Q8K A;  2PQA B;  2CCZ A;  1CSQ A;  2K14 A;  1G51 A;  3RZO H;  2ZJR A;  3F2D A;  1PH9 A;  4DV7 Q;  3S1N H;  1BKB A;  4A75 A;  3H0G H;  3KFU A;  4L5S A;  4LF5 Q;  1YNX A;  3UDX A;  4NXN Q;  1X54 A;  1X3F A;  2UXB L;  4JI6 Q;  4P75 A;  1EOV A;  1IBK L;  4DAY B;  1X56 A;  2RHQ B;  4DV6 L;  4DR7 Q;  1XNR L;  2UXC Q;  4BY1 G;  4IJL A;  2B29 A;  2JA5 G;  4LWC A;  4GOP C;  4IPC A;  2IX0 A;  4JI2 Q;  3KF6 A;  4DV4 L;  4ME3 A;  2R93 G;  4J15 A;  4X64 L;  1GVP A;  1S40 A;  3CPF A;  5C0X G;  4GN4 B;  4TVA B;  5GQO A;  2QA4 A;  1EQR A;  1WI5 A;  1FL0 A;  4AIM A;  1Y1V H;  3F1Z A;  4DV5 L;  3GTQ H;  3GO5 A;  4BBR H;  4UY8 C;  4LF4 L;  2AWN A;  3J81 i;  3A74 A;  4MNO A;  3UDG A;  2IY5 B;  4C3H H;  2F52 A;  2VW9 A;  1YHB A;  1VQ7 A;  3I7F A;  4POG A;  2I5L X;  1SRU A;  1AE2 A;  3RLF A;  4YWM A;  4L5R C;  1OTC A;  4B3M Q;  4HID A;  2DGY A;  1XMO L;  1MJC A;  3CP0 A;  2RHS B;  1Y14 B;  1YJ9 A;  4QJF A;  3PF4 A;  3I4M H;  3KF6 B;  4A3F H;  2JA7 H;  2YTV A;  1YVC A;  1Q46 A;  3RZD H;  3HOV G;  3CXC A;  1N8R C;  3S16 H;  3CCV A;  2JE6 I;  4X66 Q;  1J5E Q;  4DR3 L;  3CCQ A;  4AQY Q;  1XNQ L;  4JBJ A;  2K5H A;  1PVO A;  3L0O A;  5FLX c;  4OO1 G;  3OYY A;  3K81 C;  4YY3 L;  1UE7 A;  3Q8D A;  2K5V A;  3HOW G;  4BXX H;  3S1R H;  4WJ3 M;  4A3J H;  4R4O A;  4A4I A;  3S14 H;  2VL6 A;  1FJG L;  1E1T A;  5JEA G;  3D31 A;  4GN3 B;  3PGZ A;  3U4V A;  4DR5 Q;  2A8V A;  1KRS A;  2ATW A;  3UE0 A;  4IOA A;  1XPO A;  4DNI A;  4DR2 Q;  3H0G G;  1N9W A;  1U5K A;  1BVS A;  1HNZ Q;  3RR5 A;  4A3G H;  4P74 A;  1BBU A;  5EAY A;  4XTC S;  1JMC A;  3S2H H;  5DLQ E;  1OXV A;  3NEN A;  1YEZ A;  4OON A;  4LF7 L;  5JJK A;  2YTY A;  1KQS A;  2C35 B;  2NVY H;  1E1O A;  2IHF A;  2LXJ A;  1MIU A;  2D0O A;  4X62 Q;  5LMU L;  1VQ9 A;  4MZ9 A;  1VQL A;  3EN2 A;  2CFM A;  2EQS A;  2UXD L;  5M5W H;  4JI8 Q;  2FXQ A;  4DUZ L;  4DAM A;  1PH3 A;  1EQQ A;  3CC4 A;  4IPG A;  4YHH L;  4C3J H;  5M5X H;  1Y1V G;  3HFZ B;  4OX9 Q;  4FDB A;  1PYS B;  2BA0 A;  3GTP H;  1O7I A;  3T1Y L;  1Y1W H;  1YIJ A;  3D0F A;  4DR4 Q;  1IBM Q;  1U0L A;  2OQK A;  3NBH B;  4B3S Q;  3H3V I;  2HHH L;  2VNU D;  3E9I A;  4DK6 C;  4JBW A;  4YWK A;  3ZJY C;  5GAH C;  4JI3 Q;  3GTL H;  1X65 A;  1PH4 A;  2HQL A;  3GTK H;  3KLW A;  4A93 H;  4GKJ Q;  2OTJ A;  1IBL L;  2JEB I;  4DV0 Q;  1KXL A;  2ASB A;  5LMN L;  2UUC Q;  1PH5 A;  3I4M G;  1XPU A;  2JA7 G;  1I5F A;  3J80 c;  2PNH A;  1B70 B;  1LTL A;  1KRT A;  4APV A;  1RIP A;  3IRB A;  4HJ7 A;  2XTI A;  1JJG A;  3JC6 6;  2YYZ A;  4DPG A;  5C0X I;  2GN5 A;  4X65 L;  1N36 L;  1KL9 A;  3G6E A;  4YCV A;  3JAM i;  2NN6 G;  2OTL A;  3CCL A;  3UE1 A;  4A3K H;  4BXX G;  5GRO A;  4IPH A;  4A76 A;  4A3J G;  3CC2 A;  3KDF A;  1B7Y B;  4LUZ A;  5GAE C;  1K8A C;  4JBM A;  2VQF Q;  1NTG A;  1T9H A;  2MQH A;  4DUY Q;  3S24 A;  3HKS A;  1P8L A;  4JI7 Q;  4LFA L;  1AH9 A;  1VCI A;  1N33 Q;  2F4V Q;  4IJH A;  3OTO Q;  4A3E H;  5JJI A;  2ZJP A;  1SFO H;  1YZ6 A;  2CKZ B;  1QUQ B;  2R7Z G;  1NBW A;  4KHP L;  1G29 1;  4C3I H;  4A3G G;  4LFC L;  2PI2 A;  3PUZ A;  4JI4 L;  2K75 A;  1YHA A;  2N49 A;  4LF9 Q;  1CUK A;  2F3I A;  4O0A A;  4X62 L;  3CF5 A;  4HJ9 A;  1S72 A;  3M9B A;  4JBK A;  2VS1 A;  3PCO B;  4C2M H;  4DV1 L;  3W5O A;  1TWG H;  1N32 L;  4K0K L;  4IFD J;  4MTN A;  1C9O A;  1XMQ L;  4QY7 A;  4NPS A;  3STB C;  1WJJ A;  3CCM A;  1VQ4 A;  1QZG A;  2B3G A;  1D7Q A;  2UU9 Q;  3MEF A;  1HNW L;  4DR1 Q;  4PZ7 A;  2VQE Q;  3KDF B;  2BA1 A;  1HZA A;  1NMF A;  1TWA H;  1I3Q H;  4GNX A;  1WOC A;  1GD7 A;  3W1B A;  2I0Q A;  3T1H Q;  3G48 A;  1VQP A;  1HR0 L;  4LFB Q;  4LW1 A;  5M3F H;  1Y1W G;  1X6O A;  3TS2 A;  4B3R Q;  4BBS H;  4NXM L;  3BU2 A;  1M1K C;  1XPR A;  2JEA I;  2NVQ H;  1CKN A;  1W3S A;  4A93 G;  5FLM H;  3KOJ A;  4GKK L;  3S17 H;  2K50 A;  3U4Z A;  5C3E H;  1L2F A;  1VQE A;  1GKH A;  4DR6 Q;  3K7U C;  1HNX Q;  3PUW A;  4DV2 L;  2WB1 G;  1VQJ A;  2K4K A;  3S2D H;  4JI0 L;  1H95 A;  3F2C A;  1PV4 A;  5IP9 H;  2UUB Q;  2VY3 A;  2V1C C;  4LF6 L;  2NZH A;  1IZ6 A;  3AYH B;  2IHE A;  2Q2H A;  2IX1 A;  1FGU A;  1IL2 A;  3PUX A;  4GNX B;  3CQZ H;  3K0X A;  4DK3 C;  5IP7 H;  4L5T A;  3RLN A;  1NMG A;  2WAQ G;  4XIG S;  4JC0 A;  4A3K G;  1XJV A;  2E2J H;  2E5L L;  1I6H H;  3J81 j;  2N8N A;  2Z6K A;  1PA6 A;  1CKM A;  3MXN B;  2MNA A;  2OQ0 A;  3HOY G;  1VQC A;  1QZH A;  1VQ8 A;  1YHQ A;  1CKN B;  4LF8 Q;  5IWA Q;  4DV3 Q;  1VQA A;  3FHW A;  2WB1 E;  3VDY A;  1A8V A;  4A3E G;  1GM5 A;  3M7N A;  1CSP A;  3CCU A;  2OWO A;  2JA9 A;  3J80 i;  2GVB A;  4DV7 L;  5C4X H;  1AE3 A;  1C0A A;  3PV0 A;  4JV5 Q;  2VUM H;  4LF5 L;  4NXN L;  2BH8 A;  2I5H A;  5IYC H;  2AHO B;  4LUO A;  1S3O A;  4JI6 L;  2JJQ A;  2N3S A;  2WAQ E;  2AMC B;  3RLO A;  1PH8 A;  2R7Z H;  3KYH C;  1HZC A;  3GTO H;  4DR7 L;  2UXC L;  1YIT A;  5BR8 Q;  1Q12 A;  4JI2 L;  2NN6 I;  4P72 A;  3M85 A;  1OXT A;  1OXX K;  3GTJ H;  1VQM A;  1WCM H;  1I94 Q;  4LFB L;  4B3T Q;  3UDI A;  2YTX A;  3M4O H;  3PO2 H;  4B3R L;  1N34 Q;  4JYA Q;  2B63 H;  4BY7 H;  1V43 A;  1NJI C;  4UP7 A;  5M3F G;  5E7N A;  4GNX C;  5GAD C;  3AEV A;  2ZM6 Q;  2CWP A;  4BBS G;  3RN2 A;  3CW2 C;  2KEN A;  2CQO A;  3M4P A;  3U58 A;  3PO3 H;  3PIO A;  1YJN A;  3L7Z C;  2E8G A;  3I56 A;  1A62 A;  1X9N A;  5FLM G;  2UUA Q;  1UE1 A;  4LUV A;  3E9H A;  3ERS X;  2D62 A;  1E24 A;  3ER0 A;  4A3L H;  4JI1 Q;  1HH2 P;  3A5Z B;  4IPD A;  5C3E G;  3U50 C;  1K9M C;  2EXD A;  1EUJ A;  4B3M L;  3FKI H;  1IXR A;  3ULL A;  1Q7Y C;  2D0P A;  1ASZ A;  5IP9 G;  3GTM H;  1EIF A;  1TXY A;  3TEH B;  1Q82 C;  1HZB A;  2E2H H;  2MO0 A;  4PZ8 A;  1JJ2 A;  2Y0S G;  2Q2T A;  2JA6 H;  3M3Y H;  2UXB Q;  2PMZ E;  2H5X A;  1IBK Q;  4DV6 Q;  4X66 L;  1XNR Q;  1J5E L;  2JA8 H;  1X3E A;  3I55 A;  4AQY L;  5IP7 G;  1E3P A;  2ZJQ A;  2WP8 J;  1KD1 C;  4UPA A;  4DV4 Q;  5GAG C;  4P73 A;  3CCS A;  1DGS A;  2WFW A;  3CPW A;  4KI0 A;  2BH2 A;  2GVA A;  4X64 Q;  2JK8 A;  5C4J H;  1VS0 A;  4QQB X;  4DR5 L;  1BBW A;  3J7Z C;  3CC7 A;  5C4X G;  4DR2 L;  5M3M H;  4DV5 Q;  3HOY H;  2VUM G;  4R4I A;  5IYC G;  4LF4 Q;  5C0X J;  4LNQ A;  3CD6 A;  1HNZ L;  3HOZ H;  1L0W A;  5IYB H;  3I4O A;  4GLX A;  5IYD H;  1SLJ A;  3K8A A;  3A0J A;  1UE5 A;  3TQY A;  1VQ5 A;  3RNU A;  1FVI A;  5ELO A;  4DKA C;  4AYB G;  3LGJ A;  4HJ8 A;  1XMO Q;  5ELN A;  1WCM G;  2QEX A;  2L15 A;  3CME A;  2Q2U A;  2Z0S A;  3I4N G;  1PFS A;  3CCJ A;  3PO2 G;  4JI8 L;  5AJ3 Q;  4KHZ A;  4GLA C;  4OO1 I;  1IYJ B;  1WFQ A;  4QGU A;  1Q86 C;  2B63 G;  4BY7 G;  4EX5 A;  4HJA A;  3OW2 A;  3CMA A;  1Z47 A;  2I5M X;  4DR3 Q;  1XNQ Q;  1X55 A;  1KAW A;  4OX9 L;  1HZ9 A;  1L1O A;  3PO3 G;  4YY3 Q;  4DR4 L;  1IBM L;  2R92 H;  4PZ6 A;  4B3S L;  4JI1 L;  3L2P A;  1VQH A;  4BA2 I;  3GD7 A;  4JI3 L;  3HOX H;  4A3L G;  2RF4 A;  4AYB E;  1V1Q A;  2YV5 A;  1FJG Q;  1CKO A;  4GN5 A;  4GKJ L;  1C7Y A;  1JE5 A;  1VQI A;  1TWC H;  3FKI G;  1WYD A;  5K36 G;  4DV0 L;  3HOU H;  2UUC L;  1SR3 A;  3UDF A;  1PYB A;  2A19 A;  4OWT B;  2K52 A;  2JA6 G;  5JEA J;  1R9T H;  1VQD A;  1MKH A;  1XTD A;  3M4Q A;  3TS0 A;  1KC8 C;  4A3D H;  2JA8 G;  5C44 G;  4R4T A;  4JG2 A;  2NVT H;  3H15 A;  4LF7 Q;  5H1S E;  4A3M H;  5LMU Q;  1L1O B;  3EIV A;  1JJC B;  5IY0 A;  1SRO A;  3W1G A;  3SGI A;  2UXD Q;  3CCE A;  1KHI A;  1Q81 C;  3EBE A;  5FJ8 H;  1YI2 A;  4DUZ Q;  1E22 A;  3K80 C;  4YCU A;  2VQF L;  1QVC A;  4YHH Q;  1VQK A;  2AKW B;  3JAM c;  4DUY L;  2NVX H;  4JI7 L;  3S15 H;  2MFI A;  3DM3 A;  5M3M G;  3KJO A;  1N33 L;  3OTO L;  3E0E A;  2F4V L;  3AFQ A;  1D8L A;  1HJP A;  4YCW A;  4HJ5 A;  1QVF A;  2R7F A;  4PMW A;  5IT9 c;  4IO9 A;  3T1Y Q;  1P16 A;  4A3I H;  2JQO A;  2LSS A;  2ZTC A;  1TWF H;  4RG1 A;  5IYB G;  5IYD G;  3HOZ G;  4QIW E;  2HHH Q;  3GTG H;  3PUY A;  4A3B H;  4GS3 A;  4IFD G;  1LYL A;  3AQQ A;  2RCN A;  4LF9 L;  3PF5 A;  1K0R A;  1KIX A;  3TRE A;  4WJ4 A;  1IBL Q;  2QGQ A;  4JOI A;  3G71 A;  1UWV A;  1GO3 E;  3NEM A;  5AJ3 L;  4JI5 Q;  5LMN Q;  1V9P A;  5J3B A;  1UE6 A;  2DUD A;  3BJU A;  2K5N A;  1EYG A;  1G6P A;  5IE8 A;  2YU9 H;  3ICE A;  1LUZ A;  2UU9 L;  4JCV E;  4UP9 A;  3PIP A;  2KHI A;  2VQE L;  2A1A A;  4DR1 L;  3S1M H;  1VQN A;  1SMX A;  2PI2 E;  3A5U A;  5LMN W;  4HIM A;  4X65 Q;  3T1H L;  3I4N H;  1N36 Q;  2VZA A;  2KCM A;  4YWL A;  3F8T A;  3STB D;  2R92 G;  1L1O C;  2ID0 A;  4L5Q A;  4P71 A;  2ES2 A;  1VQB A;  4A3C H;  4IOC A;  3HOX G;  3S1Q H;  3GDE A;  2AWO A;  3CAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...