4RKLA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/v66t at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMTENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rklA00
4J6HA 1SNPA 4ZUJA 4RKBA 1SNCA 1STAA 4S3SA 5DEHA 3S9WA 1F2MA 4DU9A 2PQEA 4ODGA 4HMIA 4WORA 4HTHA 2WACA 4EQOA 1SNMA 4IUNA 3D4DA 4K8IA 1JORA 5NUCA 1AEXA 5DAUA 3MZ5A 2OEOA 4K5XA 4RKLA 5J1ZA 2RDFA 2QDBA 3VA5A 2EYLA 5I6WA 4IALA 5C4HA 3C1EA 3EROA 5KYLA 4NMZA 3DMUA 3MVVA 2EY5A 3DHQA 5EKKA 4B9XA 5KEEA 5CV5A 1EY8A 5IGCA 3OSOA 1II3A 2F0NA 2OF1A 2F0IA 4NDXA 5C6AA 4QB4A 2EYMA 1EZ8A 3SK8A 4DGZA 4E6IA 3MXPA 2EYPA 3RUZA 2F3WA 4OL7A 1STNA 1A3UA 3D6CA 4IZ8A 3SHLA 3NXWA 4I65A 4NP5A 2PZWA 2F0SA 2LKVA 4QF4A 2F0OA 2PW7A 2SNSA 3P1HA 2NUCA 5I9PA 1ENAA 5JAVA 2M00A 3ERQA 1TT2A 5C3WA 3BDCA 4ME5A 4N9TA 1A2UA 5CV8A 1EZ6A 4KV6A 2F0UA 2RKSA 5IGGA 1JOKA 3OMGA 1KABA 5CV4A 1SYBA 2F0JA 4HMJA 3TP5A 1KDAA 4KTAA 1SNOA 3NHHA 4KY7A 4NKLA 3MHBA 3TP8A 1SNDA 1SYGA 2HQEA 1F2YA 1KDCA 5F2DA 2RBMA 5KIXA 4PNYA 2OXPA 4K6DA 2EYJA 1STHA 5J22A 4WRDA 1STBA 2F0EA 2F0DA 2PW5A 3T16A 1ENCA 4B9WA 3V2TA 5CC4A 2EYOA 3SXHA 3QOJA 5KYIA 3MEHA 1RKNA 4J1MA 5CR3A 3TP7A 1KDBA 2F0WA 5EGTA 2O4XA 1EYDA 2SNMA 4ID6A 2F3VA 4TRDA 3R3OA 3SK6A 3NK9A 5IOCA 5IODA 2F0HA 3D4WA 3D8GA 3QOLA 4EVOA 5KRUA 1A3TA 3ITPA 4KD4A 3SK4A 5I9OA 5M9OA 5JOBA 4DFAA 2PZTA 4K5VA 5HURA 2F0KA 2KQ3A 3NP8A 1SYEA 4F7XA 5IIFA 1JOQA 3E5SA 1F2ZA 3NUCA 1SYFA 5CV9A 2ENBA 5IGBA 5J39A 1A3VA 4PMBA 1EYAA 1NSNS 2PYKA 4F8MA 1STGA 2KHSA 4K8JA 4K2LA 2EY1A 5EKLA 5ISRA 1U9RA 5I6YA 5IGEA 4DF7A 2SOBA 1JOOA 5E1FA 4K5WA 1EY4A 4G57A 5C5LA 4N9PA 3SR1A 2F0FA 1EQVA 3SK5A 1STYA 2F0VA 2PZUA 1A2TA 1EY5A 1SYCA 3EVQA 3HZXA 3PMFA 1EY6A 4R8NA 1SNQA 5E3FA 5HGTA 5IGDA 4QMGA 3U9OA 4H7BA 4K2KA 4PMCA 3H6MA 1TQOA 4EQPA 5CGKA 4EQNA 3T13A 1IHZA 5CV6A 4KD3A 3HEJA 2F0GA 2F0MA 4ZQ3A 3TP6A 5K5PA 4ZUIA 4KJNA 3TMEA 5IGFA 3QB3A 3LX0A 4K14A 4MIUA 5C5MA 1EY0A 1EY9A 2EY2A 4LAAA 1SYDA 1NUCA 1TR5A 5KGUA 2F0LA 3OMCA 3P75A 5C4ZA 2EY6A 1EYCA 2EYFA 2F0PA 3EJIA 4KHVA 3BDLA 5CV7A 1EY7A 2F0TA 4KY5A 4KJOA 4KY6A 2F0QA 5C3XA 2EXZA 3OWFA 2EYHA 3NQTA 3C1FA 1KAAA 4YIJA
chains in the Genus database with same CATH superfamily
1K8AC 3CQZH 5T1GA 1EU4A 1X3PA 1SSOA 3IAYA 1XPUA 2E5LQ 1NY4A 2EDGA 1HR0L 3UDFA 5C0XG 1E1TA 1G291 3MC0B 3C1EA 3EROA 4C56C 4CJ1B 3L3OC 5JJZA 4KKTA 1ENFA 5ELFA 4GNXA 2OF1A 4NDXA 1EZ8A 1N34Q 1PLFA 1I5FA 1B1ZA 3D6CA 3CC7A 2H4OA 4R8IA 1Y1WB 1M4VA 2AQ2B 1YJNA 4A3FH 1XPRA 1TT2A 3R8BA 3OHXC 3OOCA 3EIVA 1LTRD 5M3MG 2KCNA 3KLRA 3NBHB 3GTGB 1M90C 1PFMA 3R93A 3CW2C 4UDUC 1VQPA 3NTKA 4J8QA 5M3MB 2HUGA 2LS01 2PW5A 3UI2A 1MJCA 3GTOH 1UE5A 1LTID 1YI2A 1EYDA 3R3OA 4EGVA 2BH2A 2Z1CA 1X3QA 1HNZQ 3GDEA 1BOSA 1LABA 3W1BA 3OIPA 1QNUA 3NUCA 2UUBQ 1Y8PB 4L5TA 4LW1A 1IYUA 1IBLL 1MD2D 3G48A 3J80E 1K8GA 2HCIA 3SR1A 1FGBD 1VQFA 1K3BC 3SK5A 2WFWA 3PV0A 1Z47A 1E2WA 2GVAA 1S40A 4DR4Q 1S5DD 5IYCH 4GS3A 2B2VC 4KD3A 3A7AB 4OX9Q 5JEAG 2YU9B 1VF7A 4BBRG 1E2VA 2ICEC 3OMCA 3QR8A 1S5FD 2EXZA 4A3JH 3I4MG 1BBUA 1C0AA 1G91A 4YIJA 1LTLA 1SNPA 2B2YC 2G5DA 3LNNA 1E22A 3S9WA 4BBRB 4A75A 4GOPB 2Z8LA 4O2DA 4TSSA 2JP1A 4ZYSA 4MZ9A 3KF6A 2VS1A 2NVTB 1QUQB 3CU7A 3I4MB 1PTOH 3S14H 3FPPA 1IBKL 4GN3B 3STBC 4G7HC 4Z9CB 4DK1A 4IOAA 2OQKA 1QVFA 4DV4L 3GV6A 4NXML 3M3YB 1RL2A 1V1OA 5I9PA 1BO0A 3ERQA 1U5KA 1BCPC 5G3LF 3Q0AA 4L5SA 1CA6A 1HNXQ 2R92H 1CA5A 1KABA 4EQ5A 1WVLA 5BN5A 4LF7Q 3S17B 3M4OH 2KECA 3X3NA 1PRTC 1STBA 4IUTA 3WOFA 4GN4B 3DWAA 5CR3A 2IWHA 3PSIA 1IBMQ 1LACA 3J7A5 3D4WA 4AH6A 3K8AA 4XT3B 4DR3L 1L2FA 1I94L 3T1HQ 1PMRA 1ICFB 4FP5D 1KLUD 2PZTA 5HURA 2JA5H 1SRUA 2KQ3A 3X3MA 1VS0A 1CSQA 4RMFA 2KA7A 4Q5VA 3HFZB 1K28A 4AYBE 4OWXB 2KHSA 3NSWA 2K5DA 3S15B 2XWBB 1N36L 2XVSA 3HP3A 3DLLA 1NMGA 2F0FA 3HS0C 1EQRA 2FHTA 1Y69U 4LWCA 1SYCA 4YWLA 3D4RA 4WJ4A 1N33L 3J81L 3S24A 2NN6H 1K8OA 2B2UA 3H15A 1Y8OB 2VQEQ 5C5MA 1R9TB 4RFBA 4DK6C 3RN5A 2EZVA 1CZWA 3EJIA 4P73A 3GP7A 2K50A 1F77A 2UUAQ 2NTTA 4LF5Q 4YHHQ 4J6HA 2R6GA 3B6YA 4C3IH 1STAA 1JJCB 4HJ5A 3RR5A 1EU3A 1XWEA 2JE6I 5LHY1 3FPUB 1K83H 1TVXA 1B9MA 1UEAB 2K5QA 1V1PB 4CBVA 1UEBA 4A3LH 3MVVA 5K36H 1MBYA 3NEMA 4LFAL 1ZKOA 1XNQL 1PYSB 2AUKA 1W3SA 4CDEC 2UU9L 3RUZA 1A3UA 1AZQA 3UDIA 2CQAA 3BDCA 4B3ML 4QIWE 1EL0A 3EFXD 4KHPL 3F8TA 2A6HD 3I8ZA 3PQIA 1XTCD 1PH1A 1BCPB 4HN7A 4DAVA 3BVZA 4PQXA 1Q81C 2WP8J 2B8GA 4PNYA 1I6HB 1PH4A 1E1OA 3K5LA 5D3IB 1JT8A 2BDOA 1BVSA 2E74C 4K6LA 2WINB 3KDFB 4TRDA 3KOJA 2F3VA 1D6EC 3NQIA 4IQZA 1X3FA 5IP7G 4QGUA 1UUPA 3K57A 2IJ0A 3U50C 2JQOA 1JOQA 2K6AA 2ENBA 5M3MH 3ZYYX 3CCUA 5DNFA 1K3RA 5I2YA 2EY1A 3T51B 3S2DB 4GKKQ 2A68D 3T1YL 2HQLA 1EIYB 4H13C 1O7YA 4B3TQ 4DV2L 3BU2A 4JK1C 3A54A 2E2HB 5LL6S 2XRSD 2E2JB 1DD2A 4KHZA 2A6EC 3H6MA 4JBWA 2ZTCA 3CCJA 1WFQA 4ZQ3A 1B2TA 2Q2TA 4AQYQ 2Y0SG 1IW7D 1V9PA 1GUTA 4HR7B 1XNRL 2JA8G 3NELA 3I4LA 1MI2A 5C4JH 1EY7A 3S1QB 1IYVA 4DAYB 3C1FA 1JORA 2Y0SB 1EQTA 4ODGA 2BDNA 4WORA 2Z9HA 4HTHA 1ET9A 2A69C 4ZLTF 3GTQH 2JA8B 5A2QE 1H95A 4K8IA 1V43A 4C1NK 3QJYA 3FRPB 5NUCA 3CPWA 1M1KC 3CQZB 2YU9H 1PTOC 2LY7A 2HCCA 4X65L 2CKZB 3TEHB 2JEAI 3I73A 3P20A 3NE5B 3DHQA 2ZXRA 3J80L 2Q8RE 1GHJA 2SEBD 1EOTA 1YIJA 3TS0A 5IWAQ 4RGMA 4YWKA 1D8LA 1GD7A 2NVXB 3U58A 4LF6Q 5G3LD 3SDZA 1PA6A 2NVTH 3TS2A 3I4MH 3L7ZC 1S5BD 2F4VL 4X66Q 4B08A 1G6PA 5GQOA 1EZ6A 2RCFA 3OMGA 1BNZA 4KTAA 1SNOA 1PFBA 4LF9L 3GTJH 4JI4L 4R4IA 1TWGH 4CKCA 2HT1A 3T4AC 1GOZA 4LUZA 4DV3L 1WTWA 1KDBA 1QILA 1SMXA 1G2SA 1VCIA 3RLOA 1SAPA 2N55A 2A8VA 1YNXA 2GN5A 1BXTA 1OO9B 3GTOB 4H44C 1CI3M 3S17H 3G4SA 2ZXOA 1L1OB 1VQEA 4JV5Q 1B53A 4OIKA 3A74A 2E75C 3MXNA 2NZ1D 4YY3L 4IUQA 2PMZE 2ZTDA 1B44D 3A8JE 4ALPA 4XTCS 1JE4A 4DR6Q 1UE1A 1NNXA 4GKJL 3A5UA 2K4KA 1T5XD 2Q2HA 3VR6A 3J7YW 3TDQA 1KC8C 3EVQA 4JI5L 4ULLA 2IT1A 4G7ZC 4DK3C 3U9OA 1WTQA 2XGTA 4U68A 1XXGA 1XMQQ 5K5PA 2AMCB 2X69A 3QB3A 3IRBA 1J5EL 1S4ZA 4JI6Q 2F0LA 4DR7Q 4XDXA 4JVZA 4A3JG 4KHVA 4WJ3M 3BDLA 5CV7A 4X62L 1FR3A 1YZ6A 4LF4L 2QF7A 4Y7NB 1N32L 5DEHA 1WTPA 2QEXA 4BWGB 4DR2Q 1WOCA 2YTVA 1PH9A 4A3JB 4JG2A 3FMCA 2VB3X 5EBCA 3MZ5A 4F88A 3F2UA 2QEJC 2YTYA 2EYLA 2VY3A 4A3GH 1CQFA 5AJ3L 3CCMA 2IW3A 1JC7A 1I4RA 1PTOB 1EUJA 4PV1C 3W5OA 3OIQA 4DAPA 1VQAA 5KNBA 2Z0SA 3J80i 2NN6I 2KEEA 4K0KL 1H9SA 3UE0A 2EPBA 3FHWA 1WTRA 4OO1I 4G7OC 1PZKD 1HNWL 1Q3LA 2QW7A 1G8ZD 2BCOA 2R92B 4CKBA 1KDCA 5F2DA 4IPDA 1R4PB 2NTSA 2UXBL 3PO3G 1X56A 2Q2IA 3V2TA 3QOJA 1ZYRC 2WV6D 3VYTA 1O7IA 1LTSD 5IODA 2WB1E 3MAQA 2OTLA 4LFCL 3PCOB 2I5MX 3PO3B 3ITPA 2ZXPA 3VR5A 2ZTEA 2YYZA 2MGSA 4K5VA 2F0KA 3G71A 1B50A 3CD6A 4YWMA 1I6HH 4FO2A 5IGBA 1X65A 1YJ9A 3KJOA 1M8AA 3FDTA 1A15A 1I50H 5HY6A 5EBDA 3NBHA 2DY7A 3VR3A 1VF5C 5D3DA 1HR0Q 2NZOA 1C4QA 4JI7L 3G7LA 1EQVA 3PUZA 3JAMc 5I4DA 1EY5A 4R8NA 5HGTA 3TRZA 2MP1A 1WCMG 4OO1G 1BCPF 4ZUIA 2J7ZA 3SVMA 5IP7H 4LF8L 4Y52H 2DNEA 1HA6A 1MHWC 1J6QA 1EYCA 1PYWD 2IY5B 4DUYQ 3AQQA 3T56B 4C3IG 4DV6L 1WI5A 1I4PA 2E2HH 1KAAA 1B3AA 1H9RA 3AFPA 5CYUA 5FKAC 2E2JH 1PRTF 4RKBA 4S3SA 4YCUA 3K0XA 1NMFA 1S3OA 1AEXA 4C3IB 5LL6X 5A35A 1IZ6A 3H3VC 3S1QH 2B2WA 1K83B 3PUYA 4XIGS 3CCRA 1SLJA 5ELOA 4NXNQ 1HUMA 4DUZL 3OSOA 3KLWA 4QB4A 4L5RC 1JB7A 1STNA 2JA8H 1RTNA 1SMYC 2B8FA 1MSGA 1Z6HA 4L8JA 2LKVA 4NP5A 5DLQE 1HRJA 4DKAC 2L55A 1CHQD 1K73C 1IBLQ 4AYBG 2VXWA 4MN3A 4DR5L 2F0JA 1KDAA 1QZHA 2B29A 3F2CA 3K5OA 4V0BA 4GOPA 2NVXH 1IL8A 2DY8A 2EYJA 4OHJA 1YHAA 2K1BA 1DONA 4AYBB 3PF4A 4JI8Q 1QUQA 5FOBB 5A2QL 5EGTA 1WD1A 2R61A 1GUOA 1CHPD 5FLXc 4JW0A 3H3VI 2KCMA 5IT9L 2CVRA 2JA7H 3T53B 1VQ8A 3I91A 2KJXA 1KLGD 3ERSX 1SYEA 3JAME 4H02A 1OXSC 1MJEA 4RCNA 4DNIA 3I7FA 4F8MA 4ZAIA 4K8JA 3D3RA 1RIPA 3IKJA 5EKLA 1U9RA 5CBEE 1EY4A 2EVBA 5C5LA 3H0GH 4FNFA 2F4IA 1EFWA 1STYA 3K80C 3GQBA 2N8NA 1XYIA 1DYQA 3ULPA 3A5ZB 2H1EA 5CGKA 4DV4Q 2XNAC 1Q8IA 4NXMQ 1VQMA 2PI2A 1FVIA 2E8GA 1PH5A 1FYCA 4OIJA 4QJFA 1EEID 1BDOA 4UP7A 3NENA 3Q22A 3KF8B 2PQAB 2OWOA 2UXDQ 1TKWB 2E2IH 1H9JA 2ZJPA 5C4JB 1F2MA 1VQ6A 1YHBA 1ASZA 1ONLA 4B3SL 1SNMA 4A3EG 3C3LA 2OEOA 4K5XA 2QDBA 5JPNC 4QIWB 2KUMA 1RCVD 3GTQB 3M4PA 1SBBB 1LYLA 1SDFA 3CCEA 4Y7NH 5ELEA 4DV5L 1II3A 4DR3Q 1QE6A 4A3EB 1PH8A 1I94Q 1QVCA 2A74C 3HOXG 4FYDA 4HIOA 1K0RA 4QF4A 4BXXH 1ASYA 3Q24A 2BE5D 2JYOA 1VDZA 4BA1I 1IKMA 1N34L 1CKNB 3NPPA 4IPCA 1IYJB 2R3ZA 3J7ZC 1N36Q 4DV7Q 3KJPA 1SN8A 1JICA 1MGSA 2HQEA 1F2YA 2OQ0A 1TY2A 1TWCB 5IYBG 5CORA 4KMUC 1N33Q 3P7JA 5J22A 1B3QA 2K05A 4JBMA 3GTJB 4P2CB 2B2YA 2EJFC 3CMAA 2K33A 2IHFA 1SFOB 1E3PA 1TWGB 1V1PA 2F0HA 1T9HA 1P8LA 1XMOL 3S2HB 1RHPA 1VQ4A 1QOHA 2CQOA 4DFAA 4OXPA 4IUUA 2B3GA 2TSSA 3K7UC 4FXKC 1JJ2A 1BKBA 4PMBA 1PTOF 1WTOA 5L37A 1HNZL 2PYKA 3S16B 1PXUA 5FO7B 3STBD 2NVQH 3LGJA 1I4XA 5E1FA 1W2BA 3PO3H 1LV9A 4N9PA 4CKEA 4QQBX 3PMFA 5C44H 1SNQA 4LFAQ 3RZDH 5DM63 1F9SA 2CWAA 4BBSG 2M9VA 1BCPD 1KD1C 2UU9Q 3NBIA 4CHTB 2F3IA 4RA8A 1U4PA 4A3DG 2Z4IA 3EQLC 1X3GA 2GVBA 3KDFA 1TR5A 4DR4L 2EYFA 3GTKH 4BBSB 2K5VA 4DAMA 3I2ZA 3QWNA 4LFBL 3TREA 5EPLA 3RD4A 1X3EA 4A3DB 1OXUA 1H9MA 2Z4HA 3A7LA 2QILA 4FXDA 4CDCC 1I4HA 4HSPA 1CK1A 4EQOA 3HKZE 4IUNA 4UHVA 2K01A 4A3GG 4ZK9B 1CUKA 4M8AA 5EKIA 1K9MC 3CHBD 3VA5A 1HFGA 2ATWA 2K5HA 3Q8DA 4AIMA 1GUWA 1HQMC 4GLXA 1I4QA 2LXJA 3DMUA 3WWVA 1WCMH 4X64L 4OO1H 2D9UA 3K81C 4LMQD 4A3GB 1HTPA 3OPOA 4DK0A 2QCPX 1NJIC 1KRTA 3NXWA 4POGA 2F0SA 2NUCA 1STEA 4DV1L 1XTDA 1VQIA 3Q23A 3W1GA 1DZ1A 2TMPA 4DAYA 3T1YQ 4L6TB 5D65A 2EJGC 4G4KA 4C3JH 3NHHA 2MQHA 2RVLA 2ZT9C 3E9HA 5M5YB 1EOVA 3TP8A 1HNXL 3T16A 1WTXA 4IJHA 2IX3A 2EYOA 3BDOA 1EFID 3SXHA 4DR1L 1BQQT 2QKIC 4LNQA 1PH3A 1PZJD 2PNHA 3I4NH 3NK9A 2A6HC 2XSCA 1A3TA 3WOEA 2UXCQ 1HPCA 5GAEC 1IBML 3SE0A 1CQVA 3QO2A 1UWVA 3T1HL 1HH2P 4HCSA 3QIAA 4A3MG 3W3AA 4X65Q 1WYDA 1I50B 1EIGA 1A2TA 1PRTB 4OEMB 1EY6A 4HJ8A 3HKSA 2EXDA 1JWUD 4KN7C 4EQPA 2R7DA 1TS3A 2RHSB 4IFDJ 1Q1BA 4GZYC 1EIFA 1Q7YC 3HEJA 4A3MB 1D7QA 3VYSA 5IGFA 1SEBD 4K14A 4MNOA 4X3TA 1VQ9A 5KGUA 4LAAA 1SYDA 1SE3A 2A68C 3S1NB 2VUMG 2ZM6Q 2K32A 4KY6A 5T1IA 3MXGA 2HDMA 5ELBA 4NW2A 2B2TC 2G9DA 2BA1A 4ZUJA 1L0WA 1VQDA 1L1OA 2VB2X 4XT1B 5M5XB 2J4XA 1BF4A 3K59A 1DXMA 5JPMC 3NWTA 4IOCA 4JI4Q 2NZHA 2VUMB 2UUAL 4A3KG 1Q1EA 4LF5L 2HDLA 3C46A 2ASBA 2RDFA 1XX8A 2KBNA 1YITA 4JI0L 2GA4B 3I90A 1I4GA 3KFUA 1HZCA 3GTMH 5ELNA 3J81i 4A3KB 2WB1G 1Y1VH 2EYMA 1HA5A 2OT2A 1Z7TA 2EYPA 4X3UA 2F3WA 4E6IA 3GTPB 3KBXA 4IZ8A 5BN3A 4JOIC 3ND9A 2F0OA 2PW7A 2XWJB 4F87A 1C7YA 2Z6KC 2KEDA 4FF3A 4R1JA 1WJJA 4YY3Q 1HCZA 2JA6G 2A1AA 4ME5A 5CV8A 2WB1B 5IGGA 1KIXA 1CM9A 1R4QB 1GUSA 1AW7A 1U4MA 4HMJA 4ZRZA 2A6ED 3TP5A 4GKJQ 4A3EH 1D5ZC 1HZ9A 2KHIA 1Q90A 2K28A 4TVAB 3H3VH 3U4ZA 2PI2E 3MFGA 1LUZA 5BR8L 1VQBA 2F0EA 1PH6A 1HR0W 1DOLA 1CT1D 1IXRA 1RDPD 4RGOS 3W2DA 2JA7G 2NBFA 3HOXH 1ILQA 4YCVA 4X62Q 1GUGA 4JI3L 5JOBA 1OXVA 4QCLA 3K5MA 2A69D 4RHRA 1TWCH 5I2XA 5CV9A 1F2ZA 4BS9A 2P5ZX 3VR2A 1PTOD 2L5TA 2JA7B 4ABNA 3ND8A 1NSNS 4NPSA 1PHJA 4XQQA 4K2LA 1SFOH 3H0GG 1UE6A 3I4OA 2Q8IB 3HOYG 2IX0A 2SOBA 4K5WA 5IYBH 3S2HH 4CDDC 3RZOH 4WFN3 4HIKA 1SE2A 4XXEA 4TKOB 3NTIA 1E7ZA 3D0FA 4APVA 4GKKL 2BH8A 4H7BA 3BVMA 3H0GB 3MTSA 3HGBA 4HCEA 1Y14B 3S16H 3TMEA 4K0KQ 2FINB 4LUVA 5C4ZA 1BBWA 5LMNQ 1ET6A 1PVOA 2RCNA 1C9OA 2LSSA 5E4XA 1AP0A 1JWSD 2PQEA 4A4IA 1NTGA 4KN4C 4A3CH 1Y8NB 2D5DA 2C9OA 2E2IB 4PZ6A 1YNJD 5J1ZA 1K0SA 1AE2A 2NB0A 4BBSH 2DJFC 4CJ0B 3R2TA 4LFCQ 4R4CA 4A3DH 2SDFA 4BXXG 2RQXA 4DGZA 3GO5A 2L9HA 1DOMA 1CSPA 4L5QA 1HZAA 4U673 3BG3A 4C2MB 5JVG3 1Q82C 5C3WA 1B9NA 2FMCA 5IWAL 3OW7A 1A2UA 1YEZA 4JYAL 2AHOB 3MA2B 4LF6L 4KY7A 4A3BG 1DCZA 3CCLA 5EQ0A 4X66L 3RMHA 4K6DA 4X3SA 2BA0A 4XQJA 1ENCA 5M5WH 4R4OA 2Q2UA 1GXDC 3IFDA 3I3CA 2RSOA 5FLMH 4A3BB 3SK6A 4RHSA 5D14A 4JI1L 1TXYA 3NWSA 3H91A 3L2PA 1C48A 1VQNA 2NYZD 2O5IC 4P72A 3D31A 5M5YH 4DV6Q 3DM3A 3NP8A 1T5EA 4QY7A 4DN4M 1YBYA 5IYDG 2CCZA 2L4NA 4FXGC 4BY1H 3HOWG 2O2LD 2FMMA 1D2BA 1IL2A 1EYAA 4LUOA 1TS2A 2D62A 1HTLD 4DNRB 2KENA 1NR2A 1FD7D 4P74A 1OXXK 5C44G 4JI2Q 4JC0A 1SJED 5KNDA 1H9KA 1AFPA 1GJXA 1OTCA 4BA2I 4N8X1 1KHIA 1FL0A 3WDNA 4DUZQ 1EQQA 4IFDI 2NVQB 1TWAB 3CRKC 3TP6A 5C44B 2MUYA 2V1CC 3RZDB 4MIUA 4OELB 4DNTB 1VQOA 1VMCA 2VNUD 4PZ7A 1SE4A 1UNSA 1O78A 2RHQB 2F0QA 2EIFA 1SE8A 3CCQA 2RSNA 1SR3A 2PNRC 3NQTA 4HJ7A 3GTKB 3MXNB 4DR7L 4V190 1PFNA 4A3MH 2ALYB 5FO9B 4XQNA 3S1NH 3IL8A 1EIHA 1K8MA 2CW0C 1B70B 2L11A 4I7AA 4DR2L 4NMZA 3MFYA 5J3BA 2K52A 2D2CC 5M5XH 5C6AA 3M4YA 4OL7A 1EEFD 1WCMB 2I5LX 2VUMH 4M1UB 1ENAA 3GTLB 1YJWA 1X55A 4O42A 2L15A 1CFMA 3BZKA 4C3JG 1GKHA 4X3KA 4IFDG 1IKLA 1JOKA 5CV4A 4WJWA 3KF8A 2PQAA 2B2WC 4A3KH 3CP0A 2MPMA 1HFNA 4L63B 1ESRA 3GTPH 2OXPA 1RJTA 1STHA 4C3JB 5JVH3 3I4NG 3PF5A 5KYIA 1RKNA 2L0CA 2RA4A 4GLVB 1MKHA 1QJOA 5M3FH 4IPHA 5GAGC 3OTOL 3BZDB 1A63A 3TZDA 2WAQE 3CPFA 5M9OA 1JE5A 4KKUA 5E4WC 4FF2A 2R7ZH 3I4NB 1DJRD 3J80c 4DV0L 1UE7A 3G6EA 4B3RL 3OWEB 1YNND 2PPBC 2JA6H 2I5HA 1LT6D 4GNXC 5ISRA 3CXCA 5I6YA 1CZGA 1CKNA 3HKZG 1ICWA 1JMCA 2ZJQA 3M85A 2BOSA 3KUPA 4UP9A 1VQJA 1QNKA 2PZUA 2AWOA 1SMYD 3HZXA 5E3FA 4QMGA 4DV5Q 1E24A 3HRZC 3CAMA 5CV6A 1Y1WG 5IP9H 3HKZB 5LMUL 4JBKA 2RDGA 4KJNA 3LX0A 2X6GA 1EY0A 2EE1A 3EA6A 2QGQA 4ZCKA 3F2DA 4UY8C 2O5JC 5EAYA 2EY6A 5JJKA 4KJOA 3HOZG 1JR0D 5KNCA 4PZ8A 4C3HG 2UUCL 4CGYB 2KCCA 2ID0A 1U4RA 3HOYH 1O7LA 1IBKQ 4DUYL 1QWYA 2M2LA 3HOZB 2R7FA 2MHVA 1KTKA 1FJGL 3AFQA 4C3HB 2L12A 1GHKA 1Y1VG 4LJZC 4XYQA 4RGTA 2EY5A 5EKKA 4B9XA 2VQFL 1WTHA 1XMOQ 2F0NA 3E6ZX 1TY0A 2K04A 3SK8A 2PZWA 1BUVT 4QUCA 4YCWA 3I70A 3GTMB 3E0EA 1LTAD 4NXNL 4IURA 1D1KA 1Y1VB 2FFKB 3M4QA 1ML0D 1A0IA 1X54A 2JSOA 3S1RH 2AQ3B 4RGNA 4KV6A 3K5NA 3D6WA 1HXYD 4DXGA 2HHHL 1SYBA 1JJGA 2NVYH 3F2BA 1N8RC 5DM73 2LFNA 4NKLA 1W6JA 2A19A 2F1MA 4IPGA 3CMEA 3AYHB 2CH4A 4C2MH 5C3EG 4WRDA 3H94A 4B9WA 2E5LL 2MJ8A 4P75A 1LT4D 4J15A 3RLNA 3TN2A 4HJAA 2BE5C 2N49A 4ID6A 4HEDA 3QG1A 3PGZA 3QOLA 4DA2A 3TBIB 4IUVA 5I9OA 3SK4A 5C3EB 4JI8L 3UDGA 2B2VA 5IIFA 3HOXB 4LFBQ 1A3VA 1TWHB 5FLXE 3EN2A 3GD7A 2MO0A 2JXMB 1XJVA 3TQYA 2F52A 4A3BH 4IUPA 4RAUC 5IGEA 4DF7A 3OYYA 1JOOA 2XTIA 5COYA 3ZJYC 5AFWA 4ZKCB 5EJWA 4X6AH 2PCFB 4FF4A 1I3QB 2RF4A 4X64Q 4GNXB 1TS5A 2MNAA 1AN8A 1TQOA 3VA7A 3T13A 3RZOB 3A0JA 3PUVA 4IN3A 3HOUG 2YTXA 2JK8A 3K58A 3E9IA 3SEBA 1NUCA 2AQ1B 4R4QA 1S5CD 4DV1Q 2OTJA 5IYDH 3VR4A 3HOWH 1ILPA 1RD9D 3MWYW 2JEBI 1VQ7A 3FKIG 2IPKD 3HOUB 1TWAH 2UUBL 2B39A 2C35B 4A3CG 1TU2B 1X32A 1U4LA 2E2DC 1PH7A 1SJHD 3E0JA 1XNQQ 5DAUA 1RF2D 1RTOA 1CKMA 2UXDL 4DR1Q 5C4XG 3FKIB 4A93H 5FK9C 5KYLA 1FNVA 2D0PA 2F0IA 4B3MQ 4QL5A 3VYRA 5HGQA 1LT3D 3K6OA 3V05A 1D5XC 3HOVG 4OX9L 3BYTB 3I56A 1PRTD 4KHPQ 5C4XB 5JAVA 1ZXTA 3CC2A 5EPJA 4N9TA 2J0TD 1LT5D 2G9HD 2HD3A 3I72A 3L9AX 3HOVB 2XN9C 2EQSA 4O1NA 2B2UC 1VQCA 3L0OA 2I07B 3AMUA 2RBMA 5KIXA 2HHHQ 1PH2A 1J9OA 1LTBD 4DV7L 5FLMG 1TIID 3GTLH 1Z9FA 4J1MA 4OWTB 2F0WA 2SNMA 4CJ2C 1KNAA 4OGQC 2AWNA 5ELDA 4BY1G 5M5WB 2AUJD 3LWEA 2D0OA 1X6OA 1TWFB 1FGUA 1HHVA 4UAIA 1KXLA 1F9QA 5J39A 3BYYB 1G2TA 3N6RA 4HIMA 5LMNW 4DV2Q 4IFDH 1ZEQX 4BY1B 4NB3A 3UDXA 4A3IG 4KLKA 3KF6B 4JPBW 1VQLA 2ZJRA 4JI0Q 2PMZB 4G57A 1E2ZA 3N52A 3R2IA 3K7AH 4LF7L 4BY7G 2KCTA 4FVMA 2NWGA 4EX5A 4A3IB 1XNRQ 3OW2A 5GADC 4PMCA 3BJUA 5FJ8G 4H0LC 4JBJA 1A8VA 4EQNA 1WD0A 1QCBD 5FO8B 3AU7A 1PV4A 1GVPA 1Q12A 1KQSA 4BY7B 3PO2H 3J7AF 3P75A 1P16A 4DPGA 1S72A 2KVMA 4PG3A 2F0TA 4KY5A 2EJMA 5C3XA 3BS1A 2EYHA 3S1MB 1E0BA 5IT9c 5GAHC 4HAEA 2CWPA 4QUFA 5IY0A 2WACA 4MHEA 1KNEA 2N78A 3GV3A 3UE1A 3M7NA 3E3XA 2LMCB 5BR8Q 2DNCA 3ICEA 3MEFA 5C4HA 4DXFA 4P71A 5C0XH 3DEPA 1Y1WH 4RH6A 5KEEA 3PIO3 3H09A 1EY8A 4C1NI 3RNUA 1VQKA 2WIIB 2F4VQ 4JI3Q 1WTVA 1NE3A 1L1OC 5H1SE 2VQEL 3GTGH 1Q8KA 3HOZH 4GN5A 3M9BA 2R93G 2M00A 1MIUA 4LF9Q 4C3HH 3F1ZA 3JAML 1IW7C 4HSVA 3HG9A 4YHHL 4DV3Q 3PUWA 4PMWA 3MHBA 2R93B 1SYGA 3PIOA 3J81j 1VQHA 4ILWA 2F0DA 2B2TA 5M3FG 1D5MC 3JC66 2R7ZG 1SXTA 4R9WA 2B63G 1S5ED 4IO9A 5CBAE 2HIVA 2RDHA 3FP9A 2K03A 3BZCA 5C0XJ 5M3FB 4KKSA 2R7ZB 1B8AA 2B63B 2F03A 4JI5Q 3KYHC 3A55A 2UXCL 1GO3E 1SROA 2JA6B 4JOIA 4MTKA 1G51A 1V8QA 5C3EH 2Z6KA 2PO4A 3DM1A 1J5EQ 4N8FA 2DN8A 1AZPA 2A73B 5IP9G 3AEVA 5IGDA 2FXQA 5CMDA 1TWHH 5IT9E 1EWHA 2DJGC 4LF4Q 1N32Q 2KOLA 1EY9A 2EY2A 1HJPA 1JWMD 4FDBA 3A8KE 4KI0A 1FNUA 2IL8A 5JEAH 3I55A 1MSHA 4A76A 1O80A 1QZGA 4BBRH 1YVCA 4A3FG 3TZUA 1W6KA 1I3QH 4JYAQ 4IJLA 4FF1A 1L0YB 1HUNA 2OCEA 1F2LA 3EBEA 1QG7A 1GUNA 2ZM6L 1VQ5A 5AJ3Q 2CH4W 1UAPA 2QDLA 4MTNA 4A3FB 2C5CA 4UPAA 5FLXL 3HOYB 4OWWB 1NBWA 1JB3A 2K14A 3DXJC 4B3TL 4JI1Q 3O13A 2JN4A 4R4TA 1LM0A 3HOUH 3M3YH 1LLRD 3ULJA 2DUDA 2WAQG 5BN4A 1HNWQ 3DEOA 4TQUS 4AQYL 1B4OA 2SNSA 1YNJC 1AH9A 4GLAC 3RLFA 2K75A 2ES2A 3FKIH 4LK1C 3VYUA 2UXBQ 5JJIA 3CC4A 2WAQB 1X9NA 2WKDA 1NAPA 5JEAJ 1OXTA 1O7ZA 4UP8A 3PIP3 2LXKA 3S1RB 2MO1A 1SNDA 2N88A 5C4XH 3JAMi 1NCVA 3KLSX 2NVYB 3AB9A 3TSSA 3CKIB 2E76C 1CKOA 5CC4A 1QVGA 1BR9A 3MEHA 1N9WA 1U0LA 3TP7A 5IYCG 1F9PA 2O4XA 2VL6A 3J81c 5ELCA 3HOVH 1PYBA 1C8CA 5KRUA 4KD4A 3C2PA 4F7XA 2MFIA 1SYFA 3PIPA 3S15H 5TSSA 4ME3A 4JI7Q 4RCOA 3BVGA 1V1QA 3G6JB 3DUZA 3KBGA 2Z6BA 3CCSA 2FJ2A 2EOTA 2Q8TA 1JCKB 2F0VA 1TWFH 2YV5A 1EYGA 4LF8Q 1HZBA 2JA9A 2A5HA 1A6XA 3VDYA 3URYA 1FNWA 4K2KA 1R9TH 2H5XA 1IHZA 2F0GA 1CTMA 3A56A 1D1IA 3NTHA 3M7GA 2QA4A 1PDQA 3S14B 1DM0B 1I6VC 3DWQA 3CRLC 3OWFA 1KAWA 2DGYA 4JV5L 1AE3A 1Q46A 4A3IH 1EWIA 3HOWB 1B7YB 1SNCA 1EWCA 4Q0FA 2R92G 4DU9A 5LMNL 4HMIA 2ICIA 1G6ZA 1LTTD 2I0QA 3A8IE 3D4DA 4A93G 4HJ9A 3CCVA 4RKLA 4BY7H 5I6WA 4DR6L 1QB5D 3KLSA 1PFSA 4IALA 3ULLA 1BBXC 3CF5A 5FJ8H 3OTOQ 5CV5A 1LO5D 3S1MH 2CFMA 5IGCA 4CDFC 4A93B 2HIXA 3M4OB 3MXPA 2Y0SE 1XMQL 3SHLA 4DV0Q 4B3RQ 4I65A 4DR5Q 3V96A 3RN2A 3P1HA 2X6LA 4JI6L 1VMPA 2JA5G 2AKWB 2K5WA 1ZYRD 2WKCA 5GROA 2F0UA 2RKSA 5EPKA 2N3SA 4RWSC 2XIWA 4XYOA 2JJQA 3J81E 3J7AV 2VW9A 2JA5B 3U9SA 2V4DA 4ZKBB 2K7VA 1XPOA 1YHQA 4O0AA 5IE8A 1A62A 3IFTA 5LMUQ 3Q6SA 3LWUA 2VZAA 1DGSA 3KK7A 5IOCA 1VQGA 3D8GA 1KL9A 2NN6G 4EVOA 2CHBD 5C0XI 2R93H 1HQRD 3E5SA 2UUCQ 3S2DH 1GM5A 2IHEA 4JCVE 1L0XB 5E7NA 3FEWX 1RODA 2CW0D 1STGA 3MXUA 3ER0A 4HIDA 1ESFA 3ONAB 1LTGD 1FJGQ 2K5NA 3PUXA 5JJLA 3U4VA 2I46A 1NR4A 3SGIA 2VQFQ 3DWPA 4KK7A 1YNNC 4POFA 2XRQD 1J8IA 1TS4A 3K7AB 4A3LG 5K36G 4JI2L 2KHJA 2F0MA 1Q86C 2B63H 3PO2G 4I7ZC 1H9SB 1DOKA 3K0YA 2F0PA 4GOPC 1F9RA 4RG1A 4B3SQ 2L1BA 2IX1A 3FVQA 1KRSA 4OONA 1PZID 1JQYD 3PO2B
chains in the Genus database with same CATH topology
5T1GA 1EU4A 1X3PA 1SSOA 3IAYA 2EDGA 5C0XG 1G291 3MC0B 3C1EA 3EROA 4C56C 4CJ1B 3L3OC 5JJZA 4KKTA 1ENFA 5ELFA 2OF1A 4NDXA 1EZ8A 1PLFA 1B1ZA 3D6CA 2H4OA 4R8IA 1Y1WB 1M4VA 2AQ2B 1TT2A 3R8BA 3OHXC 3OOCA 1LTRD 2KCNA 3KLRA 3GTGB 1PFMA 3R93A 4UDUC 3NTKA 4J8QA 5M3MB 2HUGA 2LS01 2PW5A 3UI2A 1LTID 1EYDA 3R3OA 4EGVA 2Z1CA 1X3QA 1BOSA 1LABA 3OIPA 1QNUA 3NUCA 1Y8PB 1IYUA 1MD2D 3J80E 2HCIA 3SR1A 1FGBD 3SK5A 3PV0A 1Z47A 1E2WA 1S5DD 2B2VC 4KD3A 3A7AB 5JEAG 2YU9B 1VF7A 1E2VA 2ICEC 3OMCA 1S5FD 2EXZA 1G91A 4YIJA 1SNPA 2B2YC 3LNNA 3S9WA 4BBRB 2Z8LA 4TSSA 2JP1A 4ZYSA 2NVTB 3CU7A 3I4MB 1PTOH 3FPPA 4G7HC 4Z9CB 4DK1A 3GV6A 3M3YB 1V1OA 5I9PA 1BO0A 3ERQA 1BCPC 5G3LF 3Q0AA 1CA6A 1CA5A 1KABA 1WVLA 5BN5A 3S17B 2KECA 3X3NA 1PRTC 1STBA 4IUTA 3WOFA 3DWAA 5CR3A 2IWHA 1LACA 3D4WA 4XT3B 1PMRA 1KLUD 2PZTA 4FP5D 5HURA 2KQ3A 3X3MA 2KA7A 4Q5VA 2KHSA 3NSWA 2K5DA 3S15B 2XWBB 2XVSA 3HP3A 2F0FA 3HS0C 2FHTA 1Y69U 1SYCA 3D4RA 3J81L 2NN6H 1K8OA 2B2UA 1Y8OB 5C5MA 1R9TB 4RFBA 2EZVA 1CZWA 3EJIA 3GP7A 1F77A 2NTTA 4J6HA 2R6GA 1STAA 1EU3A 1XWEA 2JE6I 5LHY1 3FPUB 1TVXA 1B9MA 1UEAB 2K5QA 1V1PB 4CBVA 5K36H 3MVVA 1MBYA 1ZKOA 2AUKA 3RUZA 1A3UA 1AZQA 2CQAA 3BDCA 1EL0A 3EFXD 2A6HD 3I8ZA 1XTCD 1BCPB 4HN7A 4DAVA 3BVZA 4PQXA 2WP8J 2B8GA 4PNYA 1I6HB 3K5LA 5D3IB 2BDOA 2E74C 4K6LA 2WINB 4TRDA 2F3VA 1D6EC 3NQIA 4IQZA 1UUPA 3K57A 2IJ0A 1JOQA 2K6AA 2ENBA 3ZYYX 5DNFA 5I2YA 2EY1A 3T51B 3S2DB 2A68D 4H13C 1O7YA 4JK1C 3A54A 2E2HB 5LL6S 2XRSD 2E2JB 1DD2A 4KHZA 2A6EC 3H6MA 4JBWA 4ZQ3A 1B2TA 1IW7D 1GUTA 4HR7B 3I4LA 1MI2A 1EY7A 3S1QB 1IYVA 3C1FA 1JORA 2Y0SB 1EQTA 4ODGA 2BDNA 4WORA 4HTHA 1ET9A 2A69C 4ZLTF 2JA8B 5A2QE 4K8IA 1V43A 4C1NK 3QJYA 3FRPB 5NUCA 3CQZB 1PTOC 2LY7A 2HCCA 2JEAI 3I73A 3P20A 3NE5B 3DHQA 2ZXRA 3J80L 2Q8RE 1GHJA 2SEBD 1EOTA 4RGMA 2NVXB 5G3LD 3SDZA 3L7ZC 1S5BD 4B08A 1EZ6A 3OMGA 1BNZA 4KTAA 1SNOA 1PFBA 4CKCA 3T4AC 1GOZA 1WTWA 1KDBA 1QILA 1G2SA 1VCIA 1SAPA 2N55A 1BXTA 1OO9B 3GTOB 4H44C 1CI3M 2ZXOA 1B53A 4OIKA 2E75C 3MXNA 2NZ1D 4IUQA 1B44D 3A8JE 4XTCS 1JE4A 1T5XD 3VR6A 3J7YW 3TDQA 3EVQA 4ULLA 2IT1A 4G7ZC 3U9OA 1WTQA 4U68A 1XXGA 5K5PA 2X69A 3QB3A 1S4ZA 2F0LA 4XDXA 4KHVA 3BDLA 5CV7A 1FR3A 2QF7A 4Y7NB 5DEHA 1WTPA 4BWGB 4A3JB 3FMCA 2VB3X 5EBCA 3MZ5A 4F88A 3F2UA 2QEJC 2EYLA 1CQFA 2IW3A 1JC7A 1I4RA 1PTOB 4PV1C 3OIQA 4DAPA 5KNBA 2NN6I 2KEEA 1H9SA 2EPBA 1WTRA 4OO1I 4G7OC 1PZKD 1Q3LA 1G8ZD 2BCOA 2R92B 4CKBA 1KDCA 5F2DA 1R4PB 2NTSA 3V2TA 3QOJA 1ZYRC 2WV6D 3VYTA 1LTSD 5IODA 3MAQA 3PO3B 3ITPA 2ZXPA 3VR5A 2YYZA 2MGSA 4K5VA 2F0KA 1B50A 4FO2A 5IGBA 1M8AA 3FDTA 1A15A 5EBDA 3NBHA 2DY7A 3VR3A 1VF5C 5D3DA 1C4QA 3G7LA 1EQVA 3PUZA 5I4DA 1EY5A 4R8NA 5HGTA 2MP1A 4OO1G 1BCPF 4ZUIA 2J7ZA 3SVMA 2DNEA 1HA6A 1EYCA 1PYWD 3T56B 4C3IG 1I4PA 1KAAA 1B3AA 1H9RA 5CYUA 5FKAC 1PRTF 4RKBA 4S3SA 1AEXA 4C3IB 5LL6X 5A35A 3H3VC 2B2WA 1K83B 3PUYA 4XIGS 1HUMA 3OSOA 4QB4A 1STNA 1RTNA 1SMYC 2B8FA 1MSGA 1Z6HA 4L8JA 2LKVA 4NP5A 1HRJA 2L55A 1CHQD 2VXWA 4MN3A 2F0JA 1KDAA 3K5OA 4V0BA 1IL8A 2DY8A 2EYJA 4OHJA 2K1BA 1DONA 4AYBB 5FOBB 5A2QL 5EGTA 1WD1A 2R61A 1GUOA 1CHPD 5IT9L 2CVRA 3T53B 2KJXA 3I91A 1KLGD 1SYEA 3JAME 1OXSC 4RCNA 4F8MA 4ZAIA 4K8JA 3D3RA 3IKJA 5EKLA 1U9RA 5CBEE 1EY4A 2EVBA 5C5LA 2F4IA 4FNFA 1STYA 3GQBA 1XYIA 1DYQA 2H1EA 5CGKA 2XNAC 1Q8IA 1FYCA 4OIJA 1EEID 1BDOA 3Q22A 1TKWB 1H9JA 5C4JB 1F2MA 1ONLA 1SNMA 3C3LA 2OEOA 4K5XA 2QDBA 5JPNC 4QIWB 2KUMA 1RCVD 3GTQB 1SBBB 1SDFA 5ELEA 1II3A 4A3EB 1QE6A 2A74C 4FYDA 4QF4A 3Q24A 2BE5D 2JYOA 1VDZA 4BA1I 1IKMA 3NPPA 2R3ZA 1JICA 1MGSA 2HQEA 1F2YA 1TY2A 1TWCB 5CORA 4KMUC 3P7JA 5J22A 2K05A 3GTJB 4P2CB 2B2YA 2EJFC 2K33A 1SFOB 1TWGB 1V1PA 2F0HA 3S2HB 1RHPA 1QOHA 4DFAA 4IUUA 2TSSA 4FXKC 4PMBA 1PTOF 1WTOA 2PYKA 3S16B 1PXUA 5FO7B 1I4XA 5E1FA 1LV9A 4N9PA 4CKEA 3PMFA 1SNQA 5DM63 1F9SA 2M9VA 1BCPD 3NBIA 4CHTB 4RA8A 1U4PA 2Z4IA 3EQLC 1TR5A 2EYFA 4BBSB 3QWNA 5EPLA 3RD4A 4A3DB 1OXUA 1H9MA 2Z4HA 3A7LA 2QILA 4FXDA 1I4HA 4HSPA 1CK1A 4EQOA 4IUNA 2K01A 4ZK9B 4M8AA 5EKIA 3CHBD 3VA5A 1HFGA 1GUWA 1HQMC 1I4QA 3DMUA 4OO1H 2D9UA 4LMQD 4A3GB 1HTPA 3OPOA 4DK0A 2QCPX 3NXWA 2F0SA 2NUCA 1STEA 3Q23A 1DZ1A 2TMPA 4DAYA 4L6TB 5D65A 2EJGC 4G4KA 3NHHA 2RVLA 2ZT9C 5M5YB 3TP8A 3T16A 1WTXA 2IX3A 2EYOA 3BDOA 1EFID 3SXHA 1BQQT 2QKIC 1PZJD 3NK9A 2A6HC 2XSCA 1A3TA 3WOEA 1HPCA 3SE0A 1CQVA 3QO2A 4HCSA 3QIAA 3W3AA 1I50B 1EIGA 1A2TA 1PRTB 1EY6A 1JWUD 4KN7C 4EQPA 1TS3A 4IFDJ 4GZYC 1Q1BA 3HEJA 4A3MB 3VYSA 5IGFA 1SEBD 4K14A 4X3TA 5KGUA 4LAAA 1SYDA 1SE3A 2A68C 3S1NB 2K32A 4KY6A 5T1IA 3MXGA 2HDMA 5ELBA 4NW2A 2B2TC 2G9DA 2BA1A 4ZUJA 2VB2X 4XT1B 5M5XB 2J4XA 1BF4A 3K59A 1DXMA 5JPMC 3NWTA 2VUMB 1Q1EA 3C46A 2HDLA 2RDFA 1XX8A 2GA4B 3I90A 1I4GA 4A3KB 2EYMA 1HA5A 2OT2A 1Z7TA 2EYPA 4X3UA 2F3WA 4E6IA 3GTPB 3KBXA 4IZ8A 5BN3A 3ND9A 2F0OA 2PW7A 2XWJB 4F87A 2KEDA 4FF3A 1HCZA 4ME5A 5CV8A 2WB1B 5IGGA 1R4QB 1CM9A 1GUSA 1AW7A 1U4MA 4HMJA 4ZRZA 2A6ED 3TP5A 1D5ZC 1Q90A 2K28A 3MFGA 2F0EA 1DOLA 1CT1D 1RDPD 4RGOS 3W2DA 2NBFA 1ILQA 1GUGA 5JOBA 1OXVA 4QCLA 3K5MA 2A69D 4RHRA 5I2XA 5CV9A 1F2ZA 4BS9A 3VR2A 1PTOD 2L5TA 2JA7B 4ABNA 3ND8A 1NSNS 4XQQA 4K2LA 2Q8IB 2IX0A 2SOBA 4K5WA 4WFN3 1SE2A 4XXEA 4TKOB 3NTIA 4H7BA 3BVMA 3H0GB 3MTSA 3HGBA 4HCEA 3TMEA 2FINB 5C4ZA 1ET6A 5E4XA 1AP0A 1JWSD 2PQEA 4KN4C 1Y8NB 2D5DA 2C9OA 2E2IB 5J1ZA 1YNJD 2NB0A 4CJ0B 3R2TA 2SDFA 2RQXA 4DGZA 3GO5A 2L9HA 1DOMA 4U673 3BG3A 4C2MB 5JVG3 5C3WA 1B9NA 2FMCA 3OW7A 1A2UA 3MA2B 4KY7A 1DCZA 5EQ0A 3RMHA 4K6DA 4X3SA 2BA0A 4XQJA 1ENCA 1GXDC 3IFDA 3I3CA 2RSOA 4A3BB 3SK6A 4RHSA 5D14A 3NWSA 3H91A 1C48A 2NYZD 2O5IC 3D31A 3NP8A 1T5EA 4DN4M 2L4NA 4FXGC 2O2LD 2FMMA 1D2BA 1EYAA 1TS2A 2D62A 1HTLD 4DNRB 1NR2A 1FD7D 1OXXK 1SJED 5KNDA 1H9KA 1AFPA 1GJXA 4BA2I 2NVQB 3WDNA 4IFDI 1TWAB 3CRKC 3TP6A 5C44B 2MUYA 3RZDB 4MIUA 4DNTB 1VMCA 2VNUD 1SE4A 1UNSA 1O78A 2F0QA 2RSNA 2PNRC 3NQTA 3GTKB 4V190 1PFNA 5FO9B 4XQNA 3IL8A 1EIHA 1K8MA 2CW0C 2L11A 4NMZA 3MFYA 2D2CC 5C6AA 3M4YA 4OL7A 1EEFD 1WCMB 4M1UB 1ENAA 3GTLB 4O42A 1CFMA 4C3JG 4X3KA 4IFDG 1IKLA 1JOKA 5CV4A 4WJWA 3KF8A 2B2WC 2MPMA 1HFNA 4L63B 1ESRA 2OXPA 1RJTA 1STHA 4C3JB 5JVH3 5KYIA 1RKNA 2L0CA 2RA4A 1QJOA 3BZDB 3TZDA 5M9OA 4KKUA 5E4WC 4FF2A 3I4NB 1DJRD 3OWEB 1YNND 2PPBC 1LT6D 5ISRA 5I6YA 1CZGA 1ICWA 3M85A 2BOSA 3KUPA 1QNKA 2PZUA 2AWOA 1SMYD 3HZXA 5E3FA 4QMGA 3HRZC 5CV6A 3HKZB 2RDGA 4KJNA 3LX0A 2X6GA 1EY0A 2EE1A 3EA6A 2O5JC 2EY6A 4KJOA 1JR0D 5KNCA 4C3HG 4CGYB 2KCCA 2ID0A 1U4RA 1O7LA 1QWYA 2M2LA 3HOZB 2MHVA 1KTKA 4C3HB 2L12A 1GHKA 4LJZC 4XYQA 4RGTA 2EY5A 5EKKA 4B9XA 2F0NA 3E6ZX 1TY0A 2K04A 3SK8A 2PZWA 1BUVT 4QUCA 3GTMB 3I70A 1LTAD 4IURA 1D1KA 1Y1VB 2FFKB 1ML0D 2JSOA 2AQ3B 4RGNA 4KV6A 3K5NA 3D6WA 1HXYD 4DXGA 1SYBA 5DM73 2LFNA 4NKLA 1W6JA 2F1MA 4WRDA 3H94A 4B9WA 2MJ8A 1LT4D 3TN2A 2BE5C 4ID6A 4HEDA 3QG1A 3QOLA 4DA2A 3TBIB 4IUVA 5I9OA 3SK4A 5C3EB 2B2VA 5IIFA 3HOXB 1A3VA 1TWHB 5FLXE 3GD7A 2JXMB 4IUPA 4RAUC 5IGEA 4DF7A 1JOOA 5COYA 5AFWA 4ZKCB 5EJWA 2PCFB 4FF4A 1I3QB 1TS5A 1AN8A 1TQOA 3VA7A 3T13A 3RZOB 3PUVA 4IN3A 3K58A 3SEBA 1NUCA 2AQ1B 1S5CD 3VR4A 1ILPA 1RD9D 3MWYW 2JEBI 2IPKD 3HOUB 2B39A 1TU2B 1X32A 1U4LA 2E2DC 1SJHD 3E0JA 5DAUA 1RF2D 1RTOA 3FKIB 5FK9C 5KYLA 1FNVA 2F0IA 3VYRA 1LT3D 3K6OA 3V05A 1D5XC 3BYTB 1PRTD 5C4XB 5JAVA 1ZXTA 5EPJA 4N9TA 2J0TD 1LT5D 2G9HD 3I72A 3L9AX 3HOVB 2XN9C 4O1NA 2B2UC 2I07B 3AMUA 2RBMA 5KIXA 1J9OA 1LTBD 1TIID 4J1MA 2F0WA 2SNMA 4CJ2C 1KNAA 4OGQC 2AWNA 5ELDA 5M5WB 2AUJD 3LWEA 1TWFB 1HHVA 4UAIA 1F9QA 5J39A 3BYYB 1G2TA 3N6RA 4IFDH 1ZEQX 4BY1B 2PMZB 4G57A 1E2ZA 3N52A 3R2IA 4FVMA 2NWGA 4A3IB 4PMCA 4H0LC 4EQNA 1WD0A 1QCBD 5FO8B 3AU7A 1Q12A 4BY7B 3J7AF 3P75A 2KVMA 2F0TA 4KY5A 2EJMA 5C3XA 3BS1A 2EYHA 3S1MB 1E0BA 4HAEA 4QUFA 2WACA 4MHEA 1KNEA 3GV3A 3M7NA 2LMCB 2DNCA 5C4HA 4DXFA 5C0XH 3DEPA 4RH6A 5KEEA 3PIO3 3H09A 1EY8A 4C1NI 2WIIB 1WTVA 2M00A 3JAML 1IW7C 4HSVA 3HG9A 3PUWA 4PMWA 3MHBA 2R93B 1SYGA 4ILWA 2F0DA 2B2TA 1D5MC 1SXTA 4R9WA 1S5ED 5CBAE 2RDHA 2K03A 5C0XJ 5M3FB 4KKSA 2R7ZB 2B63B 2F03A 3A55A 2JA6B 1V8QA 2PO4A 3DM1A 2DN8A 1AZPA 2A73B 5IGDA 5CMDA 5IT9E 1EWHA 2KOLA 1EY9A 2EY2A 1JWMD 3A8KE 4KI0A 1FNUA 2IL8A 5JEAH 1MSHA 1O80A 3TZUA 1W6KA 4FF1A 1L0YB 1HUNA 1F2LA 1QG7A 1GUNA 1UAPA 4A3FB 2C5CA 5FLXL 3HOYB 1JB3A 3DXJC 3O13A 1LLRD 5BN4A 3DEOA 4TQUS 1B4OA 2SNSA 1YNJC 3RLFA 4LK1C 3VYUA 2WAQB 2WKDA 1NAPA 5JEAJ 1OXTA 1O7ZA 3PIP3 3S1RB 1SNDA 2N88A 1NCVA 3KLSX 2NVYB 3AB9A 3TSSA 3CKIB 2E76C 5CC4A 1BR9A 3MEHA 3TP7A 1F9PA 2O4XA 5ELCA 1C8CA 5KRUA 4KD4A 3C2PA 4F7XA 1SYFA 5TSSA 4RCOA 3BVGA 3G6JB 3DUZA 3KBGA 2FJ2A 2EOTA 2Q8TA 1JCKB 2F0VA 2A5HA 1A6XA 3URYA 1FNWA 4K2KA 1IHZA 2F0GA 1CTMA 3A56A 1D1IA 3NTHA 3M7GA 1PDQA 3S14B 1DM0B 1I6VC 3DWQA 3CRLC 3OWFA 3HOWB 1SNCA 1EWCA 4Q0FA 4DU9A 4HMIA 2ICIA 1G6ZA 1LTTD 3A8IE 3D4DA 4RKLA 5I6WA 1QB5D 3KLSA 4IALA 1BBXC 5CV5A 1LO5D 5IGCA 4A93B 3M4OB 3MXPA 3SHLA 4I65A 3V96A 3P1HA 2X6LA 1VMPA 2K5WA 1ZYRD 2WKCA 2F0UA 2RKSA 5EPKA 4RWSC 2XIWA 4XYOA 3J81E 3J7AV 2JA5B 3U9SA 2V4DA 4ZKBB 2K7VA 3IFTA 3Q6SA 3LWUA 3KK7A 5IOCA 3D8GA 2NN6G 4EVOA 2CHBD 5C0XI 1HQRD 3E5SA 1L0XB 3FEWX 1RODA 2CW0D 1STGA 3MXUA 1ESFA 3ONAB 1LTGD 3PUXA 2I46A 1NR4A 3DWPA 4KK7A 1YNNC 2XRQD 1J8IA 1TS4A 3K7AB 5K36G 2F0MA 4I7ZC 1H9SB 1DOKA 3K0YA 2F0PA 1F9RA 2L1BA 2IX1A 3FVQA 1PZID 1JQYD 3PO2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6H A;  1SNP A;  4ZUJ A;  4RKB A;  1SNC A;  1STA A;  4S3S A;  5DEH A;  3S9W A;  1F2M A;  4DU9 A;  2PQE A;  4ODG A;  4HMI A;  4WOR A;  4HTH A;  2WAC A;  4EQO A;  1SNM A;  4IUN A;  3D4D A;  4K8I A;  1JOR A;  5NUC A;  1AEX A;  5DAU A;  3MZ5 A;  2OEO A;  4K5X A;  4RKL A;  5J1Z A;  2RDF A;  2QDB A;  3VA5 A;  2EYL A;  5I6W A;  4IAL A;  5C4H A;  3C1E A;  3ERO A;  5KYL A;  4NMZ A;  3DMU A;  3MVV A;  2EY5 A;  3DHQ A;  5EKK A;  4B9X A;  5KEE A;  5CV5 A;  1EY8 A;  5IGC A;  3OSO A;  1II3 A;  2F0N A;  2OF1 A;  2F0I A;  4NDX A;  5C6A A;  4QB4 A;  2EYM A;  1EZ8 A;  3SK8 A;  4DGZ A;  4E6I A;  3MXP A;  2EYP A;  3RUZ A;  2F3W A;  4OL7 A;  1STN A;  1A3U A;  3D6C A;  4IZ8 A;  3SHL A;  3NXW A;  4I65 A;  4NP5 A;  2PZW A;  2F0S A;  2LKV A;  4QF4 A;  2F0O A;  2PW7 A;  2SNS A;  3P1H A;  2NUC A;  5I9P A;  1ENA A;  5JAV A;  2M00 A;  3ERQ A;  1TT2 A;  5C3W A;  3BDC A;  4ME5 A;  4N9T A;  1A2U A;  5CV8 A;  1EZ6 A;  4KV6 A;  2F0U A;  2RKS A;  5IGG A;  1JOK A;  3OMG A;  1KAB A;  5CV4 A;  1SYB A;  2F0J A;  4HMJ A;  3TP5 A;  1KDA A;  4KTA A;  1SNO A;  3NHH A;  4KY7 A;  4NKL A;  3MHB A;  3TP8 A;  1SND A;  1SYG A;  2HQE A;  1F2Y A;  1KDC A;  5F2D A;  2RBM A;  5KIX A;  4PNY A;  2OXP A;  4K6D A;  2EYJ A;  1STH A;  5J22 A;  4WRD A;  1STB A;  2F0E A;  2F0D A;  2PW5 A;  3T16 A;  1ENC A;  4B9W A;  3V2T A;  5CC4 A;  2EYO A;  3SXH A;  3QOJ A;  5KYI A;  3MEH A;  1RKN A;  4J1M A;  5CR3 A;  3TP7 A;  1KDB A;  2F0W A;  5EGT A;  2O4X A;  1EYD A;  2SNM A;  4ID6 A;  2F3V A;  4TRD A;  3R3O A;  3SK6 A;  3NK9 A;  5IOC A;  5IOD A;  2F0H A;  3D4W A;  3D8G A;  3QOL A;  4EVO A;  5KRU A;  1A3T A;  3ITP A;  4KD4 A;  3SK4 A;  5I9O A;  5M9O A;  5JOB A;  4DFA A;  2PZT A;  4K5V A;  5HUR A;  2F0K A;  2KQ3 A;  3NP8 A;  1SYE A;  4F7X A;  5IIF A;  1JOQ A;  3E5S A;  1F2Z A;  3NUC A;  1SYF A;  5CV9 A;  2ENB A;  5IGB A;  5J39 A;  1A3V A;  4PMB A;  1EYA A;  1NSN S;  2PYK A;  4F8M A;  1STG A;  2KHS A;  4K8J A;  4K2L A;  2EY1 A;  5EKL A;  5ISR A;  1U9R A;  5I6Y A;  5IGE A;  4DF7 A;  2SOB A;  1JOO A;  5E1F A;  4K5W A;  1EY4 A;  4G57 A;  5C5L A;  4N9P A;  3SR1 A;  2F0F A;  1EQV A;  3SK5 A;  1STY A;  2F0V A;  2PZU A;  1A2T A;  1EY5 A;  1SYC A;  3EVQ A;  3HZX A;  3PMF A;  1EY6 A;  4R8N A;  1SNQ A;  5E3F A;  5HGT A;  5IGD A;  4QMG A;  3U9O A;  4H7B A;  4K2K A;  4PMC A;  3H6M A;  1TQO A;  4EQP A;  5CGK A;  4EQN A;  3T13 A;  1IHZ A;  5CV6 A;  4KD3 A;  3HEJ A;  2F0G A;  2F0M A;  4ZQ3 A;  3TP6 A;  5K5P A;  4ZUI A;  4KJN A;  3TME A;  5IGF A;  3QB3 A;  3LX0 A;  4K14 A;  4MIU A;  5C5M A;  1EY0 A;  1EY9 A;  2EY2 A;  4LAA A;  1SYD A;  1NUC A;  1TR5 A;  5KGU A;  2F0L A;  3OMC A;  3P75 A;  5C4Z A;  2EY6 A;  1EYC A;  2EYF A;  2F0P A;  3EJI A;  4KHV A;  3BDL A;  5CV7 A;  1EY7 A;  2F0T A;  4KY5 A;  4KJO A;  4KY6 A;  2F0Q A;  5C3X A;  2EXZ A;  3OWF A;  2EYH A;  3NQT A;  3C1F A;  1KAA A;  4YIJ A; 
#chains in the Genus database with same CATH topology
 1K8A C;  3CQZ H;  5T1G A;  1EU4 A;  1X3P A;  1SSO A;  3IAY A;  1XPU A;  2E5L Q;  1NY4 A;  2EDG A;  1HR0 L;  3UDF A;  5C0X G;  1E1T A;  1G29 1;  3MC0 B;  3C1E A;  3ERO A;  4C56 C;  4CJ1 B;  3L3O C;  5JJZ A;  4KKT A;  1ENF A;  5ELF A;  4GNX A;  2OF1 A;  4NDX A;  1EZ8 A;  1N34 Q;  1PLF A;  1I5F A;  1B1Z A;  3D6C A;  3CC7 A;  2H4O A;  4R8I A;  1Y1W B;  1M4V A;  2AQ2 B;  1YJN A;  4A3F H;  1XPR A;  1TT2 A;  3R8B A;  3OHX C;  3OOC A;  3EIV A;  1LTR D;  5M3M G;  2KCN A;  3KLR A;  3NBH B;  3GTG B;  1M90 C;  1PFM A;  3R93 A;  3CW2 C;  4UDU C;  1VQP A;  3NTK A;  4J8Q A;  5M3M B;  2HUG A;  2LS0 1;  2PW5 A;  3UI2 A;  1MJC A;  3GTO H;  1UE5 A;  1LTI D;  1YI2 A;  1EYD A;  3R3O A;  4EGV A;  2BH2 A;  2Z1C A;  1X3Q A;  1HNZ Q;  3GDE A;  1BOS A;  1LAB A;  3W1B A;  3OIP A;  1QNU A;  3NUC A;  2UUB Q;  1Y8P B;  4L5T A;  4LW1 A;  1IYU A;  1IBL L;  1MD2 D;  3G48 A;  3J80 E;  1K8G A;  2HCI A;  3SR1 A;  1FGB D;  1VQF A;  1K3B C;  3SK5 A;  2WFW A;  3PV0 A;  1Z47 A;  1E2W A;  2GVA A;  1S40 A;  4DR4 Q;  1S5D D;  5IYC H;  4GS3 A;  2B2V C;  4KD3 A;  3A7A B;  4OX9 Q;  5JEA G;  2YU9 B;  1VF7 A;  4BBR G;  1E2V A;  2ICE C;  3OMC A;  3QR8 A;  1S5F D;  2EXZ A;  4A3J H;  3I4M G;  1BBU A;  1C0A A;  1G91 A;  4YIJ A;  1LTL A;  1SNP A;  2B2Y C;  2G5D A;  3LNN A;  1E22 A;  3S9W A;  4BBR B;  4A75 A;  4GOP B;  2Z8L A;  4O2D A;  4TSS A;  2JP1 A;  4ZYS A;  4MZ9 A;  3KF6 A;  2VS1 A;  2NVT B;  1QUQ B;  3CU7 A;  3I4M B;  1PTO H;  3S14 H;  3FPP A;  1IBK L;  4GN3 B;  3STB C;  4G7H C;  4Z9C B;  4DK1 A;  4IOA A;  2OQK A;  1QVF A;  4DV4 L;  3GV6 A;  4NXM L;  3M3Y B;  1RL2 A;  1V1O A;  5I9P A;  1BO0 A;  3ERQ A;  1U5K A;  1BCP C;  5G3L F;  3Q0A A;  4L5S A;  1CA6 A;  1HNX Q;  2R92 H;  1CA5 A;  1KAB A;  4EQ5 A;  1WVL A;  5BN5 A;  4LF7 Q;  3S17 B;  3M4O H;  2KEC A;  3X3N A;  1PRT C;  1STB A;  4IUT A;  3WOF A;  4GN4 B;  3DWA A;  5CR3 A;  2IWH A;  3PSI A;  1IBM Q;  1LAC A;  3J7A 5;  3D4W A;  4AH6 A;  3K8A A;  4XT3 B;  4DR3 L;  1L2F A;  1I94 L;  3T1H Q;  1PMR A;  1ICF B;  4FP5 D;  1KLU D;  2PZT A;  5HUR A;  2JA5 H;  1SRU A;  2KQ3 A;  3X3M A;  1VS0 A;  1CSQ A;  4RMF A;  2KA7 A;  4Q5V A;  3HFZ B;  1K28 A;  4AYB E;  4OWX B;  2KHS A;  3NSW A;  2K5D A;  3S15 B;  2XWB B;  1N36 L;  2XVS A;  3HP3 A;  3DLL A;  1NMG A;  2F0F A;  3HS0 C;  1EQR A;  2FHT A;  1Y69 U;  4LWC A;  1SYC A;  4YWL A;  3D4R A;  4WJ4 A;  1N33 L;  3J81 L;  3S24 A;  2NN6 H;  1K8O A;  2B2U A;  3H15 A;  1Y8O B;  2VQE Q;  5C5M A;  1R9T B;  4RFB A;  4DK6 C;  3RN5 A;  2EZV A;  1CZW A;  3EJI A;  4P73 A;  3GP7 A;  2K50 A;  1F77 A;  2UUA Q;  2NTT A;  4LF5 Q;  4YHH Q;  4J6H A;  2R6G A;  3B6Y A;  4C3I H;  1STA A;  1JJC B;  4HJ5 A;  3RR5 A;  1EU3 A;  1XWE A;  2JE6 I;  5LHY 1;  3FPU B;  1K83 H;  1TVX A;  1B9M A;  1UEA B;  2K5Q A;  1V1P B;  4CBV A;  1UEB A;  4A3L H;  3MVV A;  5K36 H;  1MBY A;  3NEM A;  4LFA L;  1ZKO A;  1XNQ L;  1PYS B;  2AUK A;  1W3S A;  4CDE C;  2UU9 L;  3RUZ A;  1A3U A;  1AZQ A;  3UDI A;  2CQA A;  3BDC A;  4B3M L;  4QIW E;  1EL0 A;  3EFX D;  4KHP L;  3F8T A;  2A6H D;  3I8Z A;  3PQI A;  1XTC D;  1PH1 A;  1BCP B;  4HN7 A;  4DAV A;  3BVZ A;  4PQX A;  1Q81 C;  2WP8 J;  2B8G A;  4PNY A;  1I6H B;  1PH4 A;  1E1O A;  3K5L A;  5D3I B;  1JT8 A;  2BDO A;  1BVS A;  2E74 C;  4K6L A;  2WIN B;  3KDF B;  4TRD A;  3KOJ A;  2F3V A;  1D6E C;  3NQI A;  4IQZ A;  1X3F A;  5IP7 G;  4QGU A;  1UUP A;  3K57 A;  2IJ0 A;  3U50 C;  2JQO A;  1JOQ A;  2K6A A;  2ENB A;  5M3M H;  3ZYY X;  3CCU A;  5DNF A;  1K3R A;  5I2Y A;  2EY1 A;  3T51 B;  3S2D B;  4GKK Q;  2A68 D;  3T1Y L;  2HQL A;  1EIY B;  4H13 C;  1O7Y A;  4B3T Q;  4DV2 L;  3BU2 A;  4JK1 C;  3A54 A;  2E2H B;  5LL6 S;  2XRS D;  2E2J B;  1DD2 A;  4KHZ A;  2A6E C;  3H6M A;  4JBW A;  2ZTC A;  3CCJ A;  1WFQ A;  4ZQ3 A;  1B2T A;  2Q2T A;  4AQY Q;  2Y0S G;  1IW7 D;  1V9P A;  1GUT A;  4HR7 B;  1XNR L;  2JA8 G;  3NEL A;  3I4L A;  1MI2 A;  5C4J H;  1EY7 A;  3S1Q B;  1IYV A;  4DAY B;  3C1F A;  1JOR A;  2Y0S B;  1EQT A;  4ODG A;  2BDN A;  4WOR A;  2Z9H A;  4HTH A;  1ET9 A;  2A69 C;  4ZLT F;  3GTQ H;  2JA8 B;  5A2Q E;  1H95 A;  4K8I A;  1V43 A;  4C1N K;  3QJY A;  3FRP B;  5NUC A;  3CPW A;  1M1K C;  3CQZ B;  2YU9 H;  1PTO C;  2LY7 A;  2HCC A;  4X65 L;  2CKZ B;  3TEH B;  2JEA I;  3I73 A;  3P20 A;  3NE5 B;  3DHQ A;  2ZXR A;  3J80 L;  2Q8R E;  1GHJ A;  2SEB D;  1EOT A;  1YIJ A;  3TS0 A;  5IWA Q;  4RGM A;  4YWK A;  1D8L A;  1GD7 A;  2NVX B;  3U58 A;  4LF6 Q;  5G3L D;  3SDZ A;  1PA6 A;  2NVT H;  3TS2 A;  3I4M H;  3L7Z C;  1S5B D;  2F4V L;  4X66 Q;  4B08 A;  1G6P A;  5GQO A;  1EZ6 A;  2RCF A;  3OMG A;  1BNZ A;  4KTA A;  1SNO A;  1PFB A;  4LF9 L;  3GTJ H;  4JI4 L;  4R4I A;  1TWG H;  4CKC A;  2HT1 A;  3T4A C;  1GOZ A;  4LUZ A;  4DV3 L;  1WTW A;  1KDB A;  1QIL A;  1SMX A;  1G2S A;  1VCI A;  3RLO A;  1SAP A;  2N55 A;  2A8V A;  1YNX A;  2GN5 A;  1BXT A;  1OO9 B;  3GTO B;  4H44 C;  1CI3 M;  3S17 H;  3G4S A;  2ZXO A;  1L1O B;  1VQE A;  4JV5 Q;  1B53 A;  4OIK A;  3A74 A;  2E75 C;  3MXN A;  2NZ1 D;  4YY3 L;  4IUQ A;  2PMZ E;  2ZTD A;  1B44 D;  3A8J E;  4ALP A;  4XTC S;  1JE4 A;  4DR6 Q;  1UE1 A;  1NNX A;  4GKJ L;  3A5U A;  2K4K A;  1T5X D;  2Q2H A;  3VR6 A;  3J7Y W;  3TDQ A;  1KC8 C;  3EVQ A;  4JI5 L;  4ULL A;  2IT1 A;  4G7Z C;  4DK3 C;  3U9O A;  1WTQ A;  2XGT A;  4U68 A;  1XXG A;  1XMQ Q;  5K5P A;  2AMC B;  2X69 A;  3QB3 A;  3IRB A;  1J5E L;  1S4Z A;  4JI6 Q;  2F0L A;  4DR7 Q;  4XDX A;  4JVZ A;  4A3J G;  4KHV A;  4WJ3 M;  3BDL A;  5CV7 A;  4X62 L;  1FR3 A;  1YZ6 A;  4LF4 L;  2QF7 A;  4Y7N B;  1N32 L;  5DEH A;  1WTP A;  2QEX A;  4BWG B;  4DR2 Q;  1WOC A;  2YTV A;  1PH9 A;  4A3J B;  4JG2 A;  3FMC A;  2VB3 X;  5EBC A;  3MZ5 A;  4F88 A;  3F2U A;  2QEJ C;  2YTY A;  2EYL A;  2VY3 A;  4A3G H;  1CQF A;  5AJ3 L;  3CCM A;  2IW3 A;  1JC7 A;  1I4R A;  1PTO B;  1EUJ A;  4PV1 C;  3W5O A;  3OIQ A;  4DAP A;  1VQA A;  5KNB A;  2Z0S A;  3J80 i;  2NN6 I;  2KEE A;  4K0K L;  1H9S A;  3UE0 A;  2EPB A;  3FHW A;  1WTR A;  4OO1 I;  4G7O C;  1PZK D;  1HNW L;  1Q3L A;  2QW7 A;  1G8Z D;  2BCO A;  2R92 B;  4CKB A;  1KDC A;  5F2D A;  4IPD A;  1R4P B;  2NTS A;  2UXB L;  3PO3 G;  1X56 A;  2Q2I A;  3V2T A;  3QOJ A;  1ZYR C;  2WV6 D;  3VYT A;  1O7I A;  1LTS D;  5IOD A;  2WB1 E;  3MAQ A;  2OTL A;  4LFC L;  3PCO B;  2I5M X;  3PO3 B;  3ITP A;  2ZXP A;  3VR5 A;  2ZTE A;  2YYZ A;  2MGS A;  4K5V A;  2F0K A;  3G71 A;  1B50 A;  3CD6 A;  4YWM A;  1I6H H;  4FO2 A;  5IGB A;  1X65 A;  1YJ9 A;  3KJO A;  1M8A A;  3FDT A;  1A15 A;  1I50 H;  5HY6 A;  5EBD A;  3NBH A;  2DY7 A;  3VR3 A;  1VF5 C;  5D3D A;  1HR0 Q;  2NZO A;  1C4Q A;  4JI7 L;  3G7L A;  1EQV A;  3PUZ A;  3JAM c;  5I4D A;  1EY5 A;  4R8N A;  5HGT A;  3TRZ A;  2MP1 A;  1WCM G;  4OO1 G;  1BCP F;  4ZUI A;  2J7Z A;  3SVM A;  5IP7 H;  4LF8 L;  4Y52 H;  2DNE A;  1HA6 A;  1MHW C;  1J6Q A;  1EYC A;  1PYW D;  2IY5 B;  4DUY Q;  3AQQ A;  3T56 B;  4C3I G;  4DV6 L;  1WI5 A;  1I4P A;  2E2H H;  1KAA A;  1B3A A;  1H9R A;  3AFP A;  5CYU A;  5FKA C;  2E2J H;  1PRT F;  4RKB A;  4S3S A;  4YCU A;  3K0X A;  1NMF A;  1S3O A;  1AEX A;  4C3I B;  5LL6 X;  5A35 A;  1IZ6 A;  3H3V C;  3S1Q H;  2B2W A;  1K83 B;  3PUY A;  4XIG S;  3CCR A;  1SLJ A;  5ELO A;  4NXN Q;  1HUM A;  4DUZ L;  3OSO A;  3KLW A;  4QB4 A;  4L5R C;  1JB7 A;  1STN A;  2JA8 H;  1RTN A;  1SMY C;  2B8F A;  1MSG A;  1Z6H A;  4L8J A;  2LKV A;  4NP5 A;  5DLQ E;  1HRJ A;  4DKA C;  2L55 A;  1CHQ D;  1K73 C;  1IBL Q;  4AYB G;  2VXW A;  4MN3 A;  4DR5 L;  2F0J A;  1KDA A;  1QZH A;  2B29 A;  3F2C A;  3K5O A;  4V0B A;  4GOP A;  2NVX H;  1IL8 A;  2DY8 A;  2EYJ A;  4OHJ A;  1YHA A;  2K1B A;  1DON A;  4AYB B;  3PF4 A;  4JI8 Q;  1QUQ A;  5FOB B;  5A2Q L;  5EGT A;  1WD1 A;  2R61 A;  1GUO A;  1CHP D;  5FLX c;  4JW0 A;  3H3V I;  2KCM A;  5IT9 L;  2CVR A;  2JA7 H;  3T53 B;  1VQ8 A;  3I91 A;  2KJX A;  1KLG D;  3ERS X;  1SYE A;  3JAM E;  4H02 A;  1OXS C;  1MJE A;  4RCN A;  4DNI A;  3I7F A;  4F8M A;  4ZAI A;  4K8J A;  3D3R A;  1RIP A;  3IKJ A;  5EKL A;  1U9R A;  5CBE E;  1EY4 A;  2EVB A;  5C5L A;  3H0G H;  4FNF A;  2F4I A;  1EFW A;  1STY A;  3K80 C;  3GQB A;  2N8N A;  1XYI A;  1DYQ A;  3ULP A;  3A5Z B;  2H1E A;  5CGK A;  4DV4 Q;  2XNA C;  1Q8I A;  4NXM Q;  1VQM A;  2PI2 A;  1FVI A;  2E8G A;  1PH5 A;  1FYC A;  4OIJ A;  4QJF A;  1EEI D;  1BDO A;  4UP7 A;  3NEN A;  3Q22 A;  3KF8 B;  2PQA B;  2OWO A;  2UXD Q;  1TKW B;  2E2I H;  1H9J A;  2ZJP A;  5C4J B;  1F2M A;  1VQ6 A;  1YHB A;  1ASZ A;  1ONL A;  4B3S L;  1SNM A;  4A3E G;  3C3L A;  2OEO A;  4K5X A;  2QDB A;  5JPN C;  4QIW B;  2KUM A;  1RCV D;  3GTQ B;  3M4P A;  1SBB B;  1LYL A;  1SDF A;  3CCE A;  4Y7N H;  5ELE A;  4DV5 L;  1II3 A;  4DR3 Q;  1QE6 A;  4A3E B;  1PH8 A;  1I94 Q;  1QVC A;  2A74 C;  3HOX G;  4FYD A;  4HIO A;  1K0R A;  4QF4 A;  4BXX H;  1ASY A;  3Q24 A;  2BE5 D;  2JYO A;  1VDZ A;  4BA1 I;  1IKM A;  1N34 L;  1CKN B;  3NPP A;  4IPC A;  1IYJ B;  2R3Z A;  3J7Z C;  1N36 Q;  4DV7 Q;  3KJP A;  1SN8 A;  1JIC A;  1MGS A;  2HQE A;  1F2Y A;  2OQ0 A;  1TY2 A;  1TWC B;  5IYB G;  5COR A;  4KMU C;  1N33 Q;  3P7J A;  5J22 A;  1B3Q A;  2K05 A;  4JBM A;  3GTJ B;  4P2C B;  2B2Y A;  2EJF C;  3CMA A;  2K33 A;  2IHF A;  1SFO B;  1E3P A;  1TWG B;  1V1P A;  2F0H A;  1T9H A;  1P8L A;  1XMO L;  3S2H B;  1RHP A;  1VQ4 A;  1QOH A;  2CQO A;  4DFA A;  4OXP A;  4IUU A;  2B3G A;  2TSS A;  3K7U C;  4FXK C;  1JJ2 A;  1BKB A;  4PMB A;  1PTO F;  1WTO A;  5L37 A;  1HNZ L;  2PYK A;  3S16 B;  1PXU A;  5FO7 B;  3STB D;  2NVQ H;  3LGJ A;  1I4X A;  5E1F A;  1W2B A;  3PO3 H;  1LV9 A;  4N9P A;  4CKE A;  4QQB X;  3PMF A;  5C44 H;  1SNQ A;  4LFA Q;  3RZD H;  5DM6 3;  1F9S A;  2CWA A;  4BBS G;  2M9V A;  1BCP D;  1KD1 C;  2UU9 Q;  3NBI A;  4CHT B;  2F3I A;  4RA8 A;  1U4P A;  4A3D G;  2Z4I A;  3EQL C;  1X3G A;  2GVB A;  3KDF A;  1TR5 A;  4DR4 L;  2EYF A;  3GTK H;  4BBS B;  2K5V A;  4DAM A;  3I2Z A;  3QWN A;  4LFB L;  3TRE A;  5EPL A;  3RD4 A;  1X3E A;  4A3D B;  1OXU A;  1H9M A;  2Z4H A;  3A7L A;  2QIL A;  4FXD A;  4CDC C;  1I4H A;  4HSP A;  1CK1 A;  4EQO A;  3HKZ E;  4IUN A;  4UHV A;  2K01 A;  4A3G G;  4ZK9 B;  1CUK A;  4M8A A;  5EKI A;  1K9M C;  3CHB D;  3VA5 A;  1HFG A;  2ATW A;  2K5H A;  3Q8D A;  4AIM A;  1GUW A;  1HQM C;  4GLX A;  1I4Q A;  2LXJ A;  3DMU A;  3WWV A;  1WCM H;  4X64 L;  4OO1 H;  2D9U A;  3K81 C;  4LMQ D;  4A3G B;  1HTP A;  3OPO A;  4DK0 A;  2QCP X;  1NJI C;  1KRT A;  3NXW A;  4POG A;  2F0S A;  2NUC A;  1STE A;  4DV1 L;  1XTD A;  1VQI A;  3Q23 A;  3W1G A;  1DZ1 A;  2TMP A;  4DAY A;  3T1Y Q;  4L6T B;  5D65 A;  2EJG C;  4G4K A;  4C3J H;  3NHH A;  2MQH A;  2RVL A;  2ZT9 C;  3E9H A;  5M5Y B;  1EOV A;  3TP8 A;  1HNX L;  3T16 A;  1WTX A;  4IJH A;  2IX3 A;  2EYO A;  3BDO A;  1EFI D;  3SXH A;  4DR1 L;  1BQQ T;  2QKI C;  4LNQ A;  1PH3 A;  1PZJ D;  2PNH A;  3I4N H;  3NK9 A;  2A6H C;  2XSC A;  1A3T A;  3WOE A;  2UXC Q;  1HPC A;  5GAE C;  1IBM L;  3SE0 A;  1CQV A;  3QO2 A;  1UWV A;  3T1H L;  1HH2 P;  4HCS A;  3QIA A;  4A3M G;  3W3A A;  4X65 Q;  1WYD A;  1I50 B;  1EIG A;  1A2T A;  1PRT B;  4OEM B;  1EY6 A;  4HJ8 A;  3HKS A;  2EXD A;  1JWU D;  4KN7 C;  4EQP A;  2R7D A;  1TS3 A;  2RHS B;  4IFD J;  1Q1B A;  4GZY C;  1EIF A;  1Q7Y C;  3HEJ A;  4A3M B;  1D7Q A;  3VYS A;  5IGF A;  1SEB D;  4K14 A;  4MNO A;  4X3T A;  1VQ9 A;  5KGU A;  4LAA A;  1SYD A;  1SE3 A;  2A68 C;  3S1N B;  2VUM G;  2ZM6 Q;  2K32 A;  4KY6 A;  5T1I A;  3MXG A;  2HDM A;  5ELB A;  4NW2 A;  2B2T C;  2G9D A;  2BA1 A;  4ZUJ A;  1L0W A;  1VQD A;  1L1O A;  2VB2 X;  4XT1 B;  5M5X B;  2J4X A;  1BF4 A;  3K59 A;  1DXM A;  5JPM C;  3NWT A;  4IOC A;  4JI4 Q;  2NZH A;  2VUM B;  2UUA L;  4A3K G;  1Q1E A;  4LF5 L;  2HDL A;  3C46 A;  2ASB A;  2RDF A;  1XX8 A;  2KBN A;  1YIT A;  4JI0 L;  2GA4 B;  3I90 A;  1I4G A;  3KFU A;  1HZC A;  3GTM H;  5ELN A;  3J81 i;  4A3K B;  2WB1 G;  1Y1V H;  2EYM A;  1HA5 A;  2OT2 A;  1Z7T A;  2EYP A;  4X3U A;  2F3W A;  4E6I A;  3GTP B;  3KBX A;  4IZ8 A;  5BN3 A;  4JOI C;  3ND9 A;  2F0O A;  2PW7 A;  2XWJ B;  4F87 A;  1C7Y A;  2Z6K C;  2KED A;  4FF3 A;  4R1J A;  1WJJ A;  4YY3 Q;  1HCZ A;  2JA6 G;  2A1A A;  4ME5 A;  5CV8 A;  2WB1 B;  5IGG A;  1KIX A;  1CM9 A;  1R4Q B;  1GUS A;  1AW7 A;  1U4M A;  4HMJ A;  4ZRZ A;  2A6E D;  3TP5 A;  4GKJ Q;  4A3E H;  1D5Z C;  1HZ9 A;  2KHI A;  1Q90 A;  2K28 A;  4TVA B;  3H3V H;  3U4Z A;  2PI2 E;  3MFG A;  1LUZ A;  5BR8 L;  1VQB A;  2F0E A;  1PH6 A;  1HR0 W;  1DOL A;  1CT1 D;  1IXR A;  1RDP D;  4RGO S;  3W2D A;  2JA7 G;  2NBF A;  3HOX H;  1ILQ A;  4YCV A;  4X62 Q;  1GUG A;  4JI3 L;  5JOB A;  1OXV A;  4QCL A;  3K5M A;  2A69 D;  4RHR A;  1TWC H;  5I2X A;  5CV9 A;  1F2Z A;  4BS9 A;  2P5Z X;  3VR2 A;  1PTO D;  2L5T A;  2JA7 B;  4ABN A;  3ND8 A;  1NSN S;  4NPS A;  1PHJ A;  4XQQ A;  4K2L A;  1SFO H;  3H0G G;  1UE6 A;  3I4O A;  2Q8I B;  3HOY G;  2IX0 A;  2SOB A;  4K5W A;  5IYB H;  3S2H H;  4CDD C;  3RZO H;  4WFN 3;  4HIK A;  1SE2 A;  4XXE A;  4TKO B;  3NTI A;  1E7Z A;  3D0F A;  4APV A;  4GKK L;  2BH8 A;  4H7B A;  3BVM A;  3H0G B;  3MTS A;  3HGB A;  4HCE A;  1Y14 B;  3S16 H;  3TME A;  4K0K Q;  2FIN B;  4LUV A;  5C4Z A;  1BBW A;  5LMN Q;  1ET6 A;  1PVO A;  2RCN A;  1C9O A;  2LSS A;  5E4X A;  1AP0 A;  1JWS D;  2PQE A;  4A4I A;  1NTG A;  4KN4 C;  4A3C H;  1Y8N B;  2D5D A;  2C9O A;  2E2I B;  4PZ6 A;  1YNJ D;  5J1Z A;  1K0S A;  1AE2 A;  2NB0 A;  4BBS H;  2DJF C;  4CJ0 B;  3R2T A;  4LFC Q;  4R4C A;  4A3D H;  2SDF A;  4BXX G;  2RQX A;  4DGZ A;  3GO5 A;  2L9H A;  1DOM A;  1CSP A;  4L5Q A;  1HZA A;  4U67 3;  3BG3 A;  4C2M B;  5JVG 3;  1Q82 C;  5C3W A;  1B9N A;  2FMC A;  5IWA L;  3OW7 A;  1A2U A;  1YEZ A;  4JYA L;  2AHO B;  3MA2 B;  4LF6 L;  4KY7 A;  4A3B G;  1DCZ A;  3CCL A;  5EQ0 A;  4X66 L;  3RMH A;  4K6D A;  4X3S A;  2BA0 A;  4XQJ A;  1ENC A;  5M5W H;  4R4O A;  2Q2U A;  1GXD C;  3IFD A;  3I3C A;  2RSO A;  5FLM H;  4A3B B;  3SK6 A;  4RHS A;  5D14 A;  4JI1 L;  1TXY A;  3NWS A;  3H91 A;  3L2P A;  1C48 A;  1VQN A;  2NYZ D;  2O5I C;  4P72 A;  3D31 A;  5M5Y H;  4DV6 Q;  3DM3 A;  3NP8 A;  1T5E A;  4QY7 A;  4DN4 M;  1YBY A;  5IYD G;  2CCZ A;  2L4N A;  4FXG C;  4BY1 H;  3HOW G;  2O2L D;  2FMM A;  1D2B A;  1IL2 A;  1EYA A;  4LUO A;  1TS2 A;  2D62 A;  1HTL D;  4DNR B;  2KEN A;  1NR2 A;  1FD7 D;  4P74 A;  1OXX K;  5C44 G;  4JI2 Q;  4JC0 A;  1SJE D;  5KND A;  1H9K A;  1AFP A;  1GJX A;  1OTC A;  4BA2 I;  4N8X 1;  1KHI A;  1FL0 A;  3WDN A;  4DUZ Q;  1EQQ A;  4IFD I;  2NVQ B;  1TWA B;  3CRK C;  3TP6 A;  5C44 B;  2MUY A;  2V1C C;  3RZD B;  4MIU A;  4OEL B;  4DNT B;  1VQO A;  1VMC A;  2VNU D;  4PZ7 A;  1SE4 A;  1UNS A;  1O78 A;  2RHQ B;  2F0Q A;  2EIF A;  1SE8 A;  3CCQ A;  2RSN A;  1SR3 A;  2PNR C;  3NQT A;  4HJ7 A;  3GTK B;  3MXN B;  4DR7 L;  4V19 0;  1PFN A;  4A3M H;  2ALY B;  5FO9 B;  4XQN A;  3S1N H;  3IL8 A;  1EIH A;  1K8M A;  2CW0 C;  1B70 B;  2L11 A;  4I7A A;  4DR2 L;  4NMZ A;  3MFY A;  5J3B A;  2K52 A;  2D2C C;  5M5X H;  5C6A A;  3M4Y A;  4OL7 A;  1EEF D;  1WCM B;  2I5L X;  2VUM H;  4M1U B;  1ENA A;  3GTL B;  1YJW A;  1X55 A;  4O42 A;  2L15 A;  1CFM A;  3BZK A;  4C3J G;  1GKH A;  4X3K A;  4IFD G;  1IKL A;  1JOK A;  5CV4 A;  4WJW A;  3KF8 A;  2PQA A;  2B2W C;  4A3K H;  3CP0 A;  2MPM A;  1HFN A;  4L63 B;  1ESR A;  3GTP H;  2OXP A;  1RJT A;  1STH A;  4C3J B;  5JVH 3;  3I4N G;  3PF5 A;  5KYI A;  1RKN A;  2L0C A;  2RA4 A;  4GLV B;  1MKH A;  1QJO A;  5M3F H;  4IPH A;  5GAG C;  3OTO L;  3BZD B;  1A63 A;  3TZD A;  2WAQ E;  3CPF A;  5M9O A;  1JE5 A;  4KKU A;  5E4W C;  4FF2 A;  2R7Z H;  3I4N B;  1DJR D;  3J80 c;  4DV0 L;  1UE7 A;  3G6E A;  4B3R L;  3OWE B;  1YNN D;  2PPB C;  2JA6 H;  2I5H A;  1LT6 D;  4GNX C;  5ISR A;  3CXC A;  5I6Y A;  1CZG A;  1CKN A;  3HKZ G;  1ICW A;  1JMC A;  2ZJQ A;  3M85 A;  2BOS A;  3KUP A;  4UP9 A;  1VQJ A;  1QNK A;  2PZU A;  2AWO A;  1SMY D;  3HZX A;  5E3F A;  4QMG A;  4DV5 Q;  1E24 A;  3HRZ C;  3CAM A;  5CV6 A;  1Y1W G;  5IP9 H;  3HKZ B;  5LMU L;  4JBK A;  2RDG A;  4KJN A;  3LX0 A;  2X6G A;  1EY0 A;  2EE1 A;  3EA6 A;  2QGQ A;  4ZCK A;  3F2D A;  4UY8 C;  2O5J C;  5EAY A;  2EY6 A;  5JJK A;  4KJO A;  3HOZ G;  1JR0 D;  5KNC A;  4PZ8 A;  4C3H G;  2UUC L;  4CGY B;  2KCC A;  2ID0 A;  1U4R A;  3HOY H;  1O7L A;  1IBK Q;  4DUY L;  1QWY A;  2M2L A;  3HOZ B;  2R7F A;  2MHV A;  1KTK A;  1FJG L;  3AFQ A;  4C3H B;  2L12 A;  1GHK A;  1Y1V G;  4LJZ C;  4XYQ A;  4RGT A;  2EY5 A;  5EKK A;  4B9X A;  2VQF L;  1WTH A;  1XMO Q;  2F0N A;  3E6Z X;  1TY0 A;  2K04 A;  3SK8 A;  2PZW A;  1BUV T;  4QUC A;  4YCW A;  3I70 A;  3GTM B;  3E0E A;  1LTA D;  4NXN L;  4IUR A;  1D1K A;  1Y1V B;  2FFK B;  3M4Q A;  1ML0 D;  1A0I A;  1X54 A;  2JSO A;  3S1R H;  2AQ3 B;  4RGN A;  4KV6 A;  3K5N A;  3D6W A;  1HXY D;  4DXG A;  2HHH L;  1SYB A;  1JJG A;  2NVY H;  3F2B A;  1N8R C;  5DM7 3;  2LFN A;  4NKL A;  1W6J A;  2A19 A;  2F1M A;  4IPG A;  3CME A;  3AYH B;  2CH4 A;  4C2M H;  5C3E G;  4WRD A;  3H94 A;  4B9W A;  2E5L L;  2MJ8 A;  4P75 A;  1LT4 D;  4J15 A;  3RLN A;  3TN2 A;  4HJA A;  2BE5 C;  2N49 A;  4ID6 A;  4HED A;  3QG1 A;  3PGZ A;  3QOL A;  4DA2 A;  3TBI B;  4IUV A;  5I9O A;  3SK4 A;  5C3E B;  4JI8 L;  3UDG A;  2B2V A;  5IIF A;  3HOX B;  4LFB Q;  1A3V A;  1TWH B;  5FLX E;  3EN2 A;  3GD7 A;  2MO0 A;  2JXM B;  1XJV A;  3TQY A;  2F52 A;  4A3B H;  4IUP A;  4RAU C;  5IGE A;  4DF7 A;  3OYY A;  1JOO A;  2XTI A;  5COY A;  3ZJY C;  5AFW A;  4ZKC B;  5EJW A;  4X6A H;  2PCF B;  4FF4 A;  1I3Q B;  2RF4 A;  4X64 Q;  4GNX B;  1TS5 A;  2MNA A;  1AN8 A;  1TQO A;  3VA7 A;  3T13 A;  3RZO B;  3A0J A;  3PUV A;  4IN3 A;  3HOU G;  2YTX A;  2JK8 A;  3K58 A;  3E9I A;  3SEB A;  1NUC A;  2AQ1 B;  4R4Q A;  1S5C D;  4DV1 Q;  2OTJ A;  5IYD H;  3VR4 A;  3HOW H;  1ILP A;  1RD9 D;  3MWY W;  2JEB I;  1VQ7 A;  3FKI G;  2IPK D;  3HOU B;  1TWA H;  2UUB L;  2B39 A;  2C35 B;  4A3C G;  1TU2 B;  1X32 A;  1U4L A;  2E2D C;  1PH7 A;  1SJH D;  3E0J A;  1XNQ Q;  5DAU A;  1RF2 D;  1RTO A;  1CKM A;  2UXD L;  4DR1 Q;  5C4X G;  3FKI B;  4A93 H;  5FK9 C;  5KYL A;  1FNV A;  2D0P A;  2F0I A;  4B3M Q;  4QL5 A;  3VYR A;  5HGQ A;  1LT3 D;  3K6O A;  3V05 A;  1D5X C;  3HOV G;  4OX9 L;  3BYT B;  3I56 A;  1PRT D;  4KHP Q;  5C4X B;  5JAV A;  1ZXT A;  3CC2 A;  5EPJ A;  4N9T A;  2J0T D;  1LT5 D;  2G9H D;  2HD3 A;  3I72 A;  3L9A X;  3HOV B;  2XN9 C;  2EQS A;  4O1N A;  2B2U C;  1VQC A;  3L0O A;  2I07 B;  3AMU A;  2RBM A;  5KIX A;  2HHH Q;  1PH2 A;  1J9O A;  1LTB D;  4DV7 L;  5FLM G;  1TII D;  3GTL H;  1Z9F A;  4J1M A;  4OWT B;  2F0W A;  2SNM A;  4CJ2 C;  1KNA A;  4OGQ C;  2AWN A;  5ELD A;  4BY1 G;  5M5W B;  2AUJ D;  3LWE A;  2D0O A;  1X6O A;  1TWF B;  1FGU A;  1HHV A;  4UAI A;  1KXL A;  1F9Q A;  5J39 A;  3BYY B;  1G2T A;  3N6R A;  4HIM A;  5LMN W;  4DV2 Q;  4IFD H;  1ZEQ X;  4BY1 B;  4NB3 A;  3UDX A;  4A3I G;  4KLK A;  3KF6 B;  4JPB W;  1VQL A;  2ZJR A;  4JI0 Q;  2PMZ B;  4G57 A;  1E2Z A;  3N52 A;  3R2I A;  3K7A H;  4LF7 L;  4BY7 G;  2KCT A;  4FVM A;  2NWG A;  4EX5 A;  4A3I B;  1XNR Q;  3OW2 A;  5GAD C;  4PMC A;  3BJU A;  5FJ8 G;  4H0L C;  4JBJ A;  1A8V A;  4EQN A;  1WD0 A;  1QCB D;  5FO8 B;  3AU7 A;  1PV4 A;  1GVP A;  1Q12 A;  1KQS A;  4BY7 B;  3PO2 H;  3J7A F;  3P75 A;  1P16 A;  4DPG A;  1S72 A;  2KVM A;  4PG3 A;  2F0T A;  4KY5 A;  2EJM A;  5C3X A;  3BS1 A;  2EYH A;  3S1M B;  1E0B A;  5IT9 c;  5GAH C;  4HAE A;  2CWP A;  4QUF A;  5IY0 A;  2WAC A;  4MHE A;  1KNE A;  2N78 A;  3GV3 A;  3UE1 A;  3M7N A;  3E3X A;  2LMC B;  5BR8 Q;  2DNC A;  3ICE A;  3MEF A;  5C4H A;  4DXF A;  4P71 A;  5C0X H;  3DEP A;  1Y1W H;  4RH6 A;  5KEE A;  3PIO 3;  3H09 A;  1EY8 A;  4C1N I;  3RNU A;  1VQK A;  2WII B;  2F4V Q;  4JI3 Q;  1WTV A;  1NE3 A;  1L1O C;  5H1S E;  2VQE L;  3GTG H;  1Q8K A;  3HOZ H;  4GN5 A;  3M9B A;  2R93 G;  2M00 A;  1MIU A;  4LF9 Q;  4C3H H;  3F1Z A;  3JAM L;  1IW7 C;  4HSV A;  3HG9 A;  4YHH L;  4DV3 Q;  3PUW A;  4PMW A;  3MHB A;  2R93 B;  1SYG A;  3PIO A;  3J81 j;  1VQH A;  4ILW A;  2F0D A;  2B2T A;  5M3F G;  1D5M C;  3JC6 6;  2R7Z G;  1SXT A;  4R9W A;  2B63 G;  1S5E D;  4IO9 A;  5CBA E;  2HIV A;  2RDH A;  3FP9 A;  2K03 A;  3BZC A;  5C0X J;  5M3F B;  4KKS A;  2R7Z B;  1B8A A;  2B63 B;  2F03 A;  4JI5 Q;  3KYH C;  3A55 A;  2UXC L;  1GO3 E;  1SRO A;  2JA6 B;  4JOI A;  4MTK A;  1G51 A;  1V8Q A;  5C3E H;  2Z6K A;  2PO4 A;  3DM1 A;  1J5E Q;  4N8F A;  2DN8 A;  1AZP A;  2A73 B;  5IP9 G;  3AEV A;  5IGD A;  2FXQ A;  5CMD A;  1TWH H;  5IT9 E;  1EWH A;  2DJG C;  4LF4 Q;  1N32 Q;  2KOL A;  1EY9 A;  2EY2 A;  1HJP A;  1JWM D;  4FDB A;  3A8K E;  4KI0 A;  1FNU A;  2IL8 A;  5JEA H;  3I55 A;  1MSH A;  4A76 A;  1O80 A;  1QZG A;  4BBR H;  1YVC A;  4A3F G;  3TZU A;  1W6K A;  1I3Q H;  4JYA Q;  4IJL A;  4FF1 A;  1L0Y B;  1HUN A;  2OCE A;  1F2L A;  3EBE A;  1QG7 A;  1GUN A;  2ZM6 L;  1VQ5 A;  5AJ3 Q;  2CH4 W;  1UAP A;  2QDL A;  4MTN A;  4A3F B;  2C5C A;  4UPA A;  5FLX L;  3HOY B;  4OWW B;  1NBW A;  1JB3 A;  2K14 A;  3DXJ C;  4B3T L;  4JI1 Q;  3O13 A;  2JN4 A;  4R4T A;  1LM0 A;  3HOU H;  3M3Y H;  1LLR D;  3ULJ A;  2DUD A;  2WAQ G;  5BN4 A;  1HNW Q;  3DEO A;  4TQU S;  4AQY L;  1B4O A;  2SNS A;  1YNJ C;  1AH9 A;  4GLA C;  3RLF A;  2K75 A;  2ES2 A;  3FKI H;  4LK1 C;  3VYU A;  2UXB Q;  5JJI A;  3CC4 A;  2WAQ B;  1X9N A;  2WKD A;  1NAP A;  5JEA J;  1OXT A;  1O7Z A;  4UP8 A;  3PIP 3;  2LXK A;  3S1R B;  2MO1 A;  1SND A;  2N88 A;  5C4X H;  3JAM i;  1NCV A;  3KLS X;  2NVY B;  3AB9 A;  3TSS A;  3CKI B;  2E76 C;  1CKO A;  5CC4 A;  1QVG A;  1BR9 A;  3MEH A;  1N9W A;  1U0L A;  3TP7 A;  5IYC G;  1F9P A;  2O4X A;  2VL6 A;  3J81 c;  5ELC A;  3HOV H;  1PYB A;  1C8C A;  5KRU A;  4KD4 A;  3C2P A;  4F7X A;  2MFI A;  1SYF A;  3PIP A;  3S15 H;  5TSS A;  4ME3 A;  4JI7 Q;  4RCO A;  3BVG A;  1V1Q A;  3G6J B;  3DUZ A;  3KBG A;  2Z6B A;  3CCS A;  2FJ2 A;  2EOT A;  2Q8T A;  1JCK B;  2F0V A;  1TWF H;  2YV5 A;  1EYG A;  4LF8 Q;  1HZB A;  2JA9 A;  2A5H A;  1A6X A;  3VDY A;  3URY A;  1FNW A;  4K2K A;  1R9T H;  2H5X A;  1IHZ A;  2F0G A;  1CTM A;  3A56 A;  1D1I A;  3NTH A;  3M7G A;  2QA4 A;  1PDQ A;  3S14 B;  1DM0 B;  1I6V C;  3DWQ A;  3CRL C;  3OWF A;  1KAW A;  2DGY A;  4JV5 L;  1AE3 A;  1Q46 A;  4A3I H;  1EWI A;  3HOW B;  1B7Y B;  1SNC A;  1EWC A;  4Q0F A;  2R92 G;  4DU9 A;  5LMN L;  4HMI A;  2ICI A;  1G6Z A;  1LTT D;  2I0Q A;  3A8I E;  3D4D A;  4A93 G;  4HJ9 A;  3CCV A;  4RKL A;  4BY7 H;  5I6W A;  4DR6 L;  1QB5 D;  3KLS A;  1PFS A;  4IAL A;  3ULL A;  1BBX C;  3CF5 A;  5FJ8 H;  3OTO Q;  5CV5 A;  1LO5 D;  3S1M H;  2CFM A;  5IGC A;  4CDF C;  4A93 B;  2HIX A;  3M4O B;  3MXP A;  2Y0S E;  1XMQ L;  3SHL A;  4DV0 Q;  4B3R Q;  4I65 A;  4DR5 Q;  3V96 A;  3RN2 A;  3P1H A;  2X6L A;  4JI6 L;  1VMP A;  2JA5 G;  2AKW B;  2K5W A;  1ZYR D;  2WKC A;  5GRO A;  2F0U A;  2RKS A;  5EPK A;  2N3S A;  4RWS C;  2XIW A;  4XYO A;  2JJQ A;  3J81 E;  3J7A V;  2VW9 A;  2JA5 B;  3U9S A;  2V4D A;  4ZKB B;  2K7V A;  1XPO A;  1YHQ A;  4O0A A;  5IE8 A;  1A62 A;  3IFT A;  5LMU Q;  3Q6S A;  3LWU A;  2VZA A;  1DGS A;  3KK7 A;  5IOC A;  1VQG A;  3D8G A;  1KL9 A;  2NN6 G;  4EVO A;  2CHB D;  5C0X I;  2R93 H;  1HQR D;  3E5S A;  2UUC Q;  3S2D H;  1GM5 A;  2IHE A;  4JCV E;  1L0X B;  5E7N A;  3FEW X;  1ROD A;  2CW0 D;  1STG A;  3MXU A;  3ER0 A;  4HID A;  1ESF A;  3ONA B;  1LTG D;  1FJG Q;  2K5N A;  3PUX A;  5JJL A;  3U4V A;  2I46 A;  1NR4 A;  3SGI A;  2VQF Q;  3DWP A;  4KK7 A;  1YNN C;  4POF A;  2XRQ D;  1J8I A;  1TS4 A;  3K7A B;  4A3L G;  5K36 G;  4JI2 L;  2KHJ A;  2F0M A;  1Q86 C;  2B63 H;  3PO2 G;  4I7Z C;  1H9S B;  1DOK A;  3K0Y A;  2F0P A;  4GOP C;  1F9R A;  4RG1 A;  4B3S Q;  2L1B A;  2IX1 A;  3FVQ A;  1KRS A;  4OON A;  1PZI D;  1JQY D;  3PO2 B; 
#chains in the Genus database with same CATH homology
 5T1G A;  1EU4 A;  1X3P A;  1SSO A;  3IAY A;  2EDG A;  5C0X G;  1G29 1;  3MC0 B;  3C1E A;  3ERO A;  4C56 C;  4CJ1 B;  3L3O C;  5JJZ A;  4KKT A;  1ENF A;  5ELF A;  2OF1 A;  4NDX A;  1EZ8 A;  1PLF A;  1B1Z A;  3D6C A;  2H4O A;  4R8I A;  1Y1W B;  1M4V A;  2AQ2 B;  1TT2 A;  3R8B A;  3OHX C;  3OOC A;  1LTR D;  2KCN A;  3KLR A;  3GTG B;  1PFM A;  3R93 A;  4UDU C;  3NTK A;  4J8Q A;  5M3M B;  2HUG A;  2LS0 1;  2PW5 A;  3UI2 A;  1LTI D;  1EYD A;  3R3O A;  4EGV A;  2Z1C A;  1X3Q A;  1BOS A;  1LAB A;  3OIP A;  1QNU A;  3NUC A;  1Y8P B;  1IYU A;  1MD2 D;  3J80 E;  2HCI A;  3SR1 A;  1FGB D;  3SK5 A;  3PV0 A;  1Z47 A;  1E2W A;  1S5D D;  2B2V C;  4KD3 A;  3A7A B;  5JEA G;  2YU9 B;  1VF7 A;  1E2V A;  2ICE C;  3OMC A;  1S5F D;  2EXZ A;  1G91 A;  4YIJ A;  1SNP A;  2B2Y C;  3LNN A;  3S9W A;  4BBR B;  2Z8L A;  4TSS A;  2JP1 A;  4ZYS A;  2NVT B;  3CU7 A;  3I4M B;  1PTO H;  3FPP A;  4G7H C;  4Z9C B;  4DK1 A;  3GV6 A;  3M3Y B;  1V1O A;  5I9P A;  1BO0 A;  3ERQ A;  1BCP C;  5G3L F;  3Q0A A;  1CA6 A;  1CA5 A;  1KAB A;  1WVL A;  5BN5 A;  3S17 B;  2KEC A;  3X3N A;  1PRT C;  1STB A;  4IUT A;  3WOF A;  3DWA A;  5CR3 A;  2IWH A;  1LAC A;  3D4W A;  4XT3 B;  1PMR A;  1KLU D;  2PZT A;  4FP5 D;  5HUR A;  2KQ3 A;  3X3M A;  2KA7 A;  4Q5V A;  2KHS A;  3NSW A;  2K5D A;  3S15 B;  2XWB B;  2XVS A;  3HP3 A;  2F0F A;  3HS0 C;  2FHT A;  1Y69 U;  1SYC A;  3D4R A;  3J81 L;  2NN6 H;  1K8O A;  2B2U A;  1Y8O B;  5C5M A;  1R9T B;  4RFB A;  2EZV A;  1CZW A;  3EJI A;  3GP7 A;  1F77 A;  2NTT A;  4J6H A;  2R6G A;  1STA A;  1EU3 A;  1XWE A;  2JE6 I;  5LHY 1;  3FPU B;  1TVX A;  1B9M A;  1UEA B;  2K5Q A;  1V1P B;  4CBV A;  5K36 H;  3MVV A;  1MBY A;  1ZKO A;  2AUK A;  3RUZ A;  1A3U A;  1AZQ A;  2CQA A;  3BDC A;  1EL0 A;  3EFX D;  2A6H D;  3I8Z A;  1XTC D;  1BCP B;  4HN7 A;  4DAV A;  3BVZ A;  4PQX A;  2WP8 J;  2B8G A;  4PNY A;  1I6H B;  3K5L A;  5D3I B;  2BDO A;  2E74 C;  4K6L A;  2WIN B;  4TRD A;  2F3V A;  1D6E C;  3NQI A;  4IQZ A;  1UUP A;  3K57 A;  2IJ0 A;  1JOQ A;  2K6A A;  2ENB A;  3ZYY X;  5DNF A;  5I2Y A;  2EY1 A;  3T51 B;  3S2D B;  2A68 D;  4H13 C;  1O7Y A;  4JK1 C;  3A54 A;  2E2H B;  5LL6 S;  2XRS D;  2E2J B;  1DD2 A;  4KHZ A;  2A6E C;  3H6M A;  4JBW A;  4ZQ3 A;  1B2T A;  1IW7 D;  1GUT A;  4HR7 B;  3I4L A;  1MI2 A;  1EY7 A;  3S1Q B;  1IYV A;  3C1F A;  1JOR A;  2Y0S B;  1EQT A;  4ODG A;  2BDN A;  4WOR A;  4HTH A;  1ET9 A;  2A69 C;  4ZLT F;  2JA8 B;  5A2Q E;  4K8I A;  1V43 A;  4C1N K;  3QJY A;  3FRP B;  5NUC A;  3CQZ B;  1PTO C;  2LY7 A;  2HCC A;  2JEA I;  3I73 A;  3P20 A;  3NE5 B;  3DHQ A;  2ZXR A;  3J80 L;  2Q8R E;  1GHJ A;  2SEB D;  1EOT A;  4RGM A;  2NVX B;  5G3L D;  3SDZ A;  3L7Z C;  1S5B D;  4B08 A;  1EZ6 A;  3OMG A;  1BNZ A;  4KTA A;  1SNO A;  1PFB A;  4CKC A;  3T4A C;  1GOZ A;  1WTW A;  1KDB A;  1QIL A;  1G2S A;  1VCI A;  1SAP A;  2N55 A;  1BXT A;  1OO9 B;  3GTO B;  4H44 C;  1CI3 M;  2ZXO A;  1B53 A;  4OIK A;  2E75 C;  3MXN A;  2NZ1 D;  4IUQ A;  1B44 D;  3A8J E;  4XTC S;  1JE4 A;  1T5X D;  3VR6 A;  3J7Y W;  3TDQ A;  3EVQ A;  4ULL A;  2IT1 A;  4G7Z C;  3U9O A;  1WTQ A;  4U68 A;  1XXG A;  5K5P A;  2X69 A;  3QB3 A;  1S4Z A;  2F0L A;  4XDX A;  4KHV A;  3BDL A;  5CV7 A;  1FR3 A;  2QF7 A;  4Y7N B;  5DEH A;  1WTP A;  4BWG B;  4A3J B;  3FMC A;  2VB3 X;  5EBC A;  3MZ5 A;  4F88 A;  3F2U A;  2QEJ C;  2EYL A;  1CQF A;  2IW3 A;  1JC7 A;  1I4R A;  1PTO B;  4PV1 C;  3OIQ A;  4DAP A;  5KNB A;  2NN6 I;  2KEE A;  1H9S A;  2EPB A;  1WTR A;  4OO1 I;  4G7O C;  1PZK D;  1Q3L A;  1G8Z D;  2BCO A;  2R92 B;  4CKB A;  1KDC A;  5F2D A;  1R4P B;  2NTS A;  3V2T A;  3QOJ A;  1ZYR C;  2WV6 D;  3VYT A;  1LTS D;  5IOD A;  3MAQ A;  3PO3 B;  3ITP A;  2ZXP A;  3VR5 A;  2YYZ A;  2MGS A;  4K5V A;  2F0K A;  1B50 A;  4FO2 A;  5IGB A;  1M8A A;  3FDT A;  1A15 A;  5EBD A;  3NBH A;  2DY7 A;  3VR3 A;  1VF5 C;  5D3D A;  1C4Q A;  3G7L A;  1EQV A;  3PUZ A;  5I4D A;  1EY5 A;  4R8N A;  5HGT A;  2MP1 A;  4OO1 G;  1BCP F;  4ZUI A;  2J7Z A;  3SVM A;  2DNE A;  1HA6 A;  1EYC A;  1PYW D;  3T56 B;  4C3I G;  1I4P A;  1KAA A;  1B3A A;  1H9R A;  5CYU A;  5FKA C;  1PRT F;  4RKB A;  4S3S A;  1AEX A;  4C3I B;  5LL6 X;  5A35 A;  3H3V C;  2B2W A;  1K83 B;  3PUY A;  4XIG S;  1HUM A;  3OSO A;  4QB4 A;  1STN A;  1RTN A;  1SMY C;  2B8F A;  1MSG A;  1Z6H A;  4L8J A;  2LKV A;  4NP5 A;  1HRJ A;  2L55 A;  1CHQ D;  2VXW A;  4MN3 A;  2F0J A;  1KDA A;  3K5O A;  4V0B A;  1IL8 A;  2DY8 A;  2EYJ A;  4OHJ A;  2K1B A;  1DON A;  4AYB B;  5FOB B;  5A2Q L;  5EGT A;  1WD1 A;  2R61 A;  1GUO A;  1CHP D;  5IT9 L;  2CVR A;  3T53 B;  2KJX A;  3I91 A;  1KLG D;  1SYE A;  3JAM E;  1OXS C;  4RCN A;  4F8M A;  4ZAI A;  4K8J A;  3D3R A;  3IKJ A;  5EKL A;  1U9R A;  5CBE E;  1EY4 A;  2EVB A;  5C5L A;  2F4I A;  4FNF A;  1STY A;  3GQB A;  1XYI A;  1DYQ A;  2H1E A;  5CGK A;  2XNA C;  1Q8I A;  1FYC A;  4OIJ A;  1EEI D;  1BDO A;  3Q22 A;  1TKW B;  1H9J A;  5C4J B;  1F2M A;  1ONL A;  1SNM A;  3C3L A;  2OEO A;  4K5X A;  2QDB A;  5JPN C;  4QIW B;  2KUM A;  1RCV D;  3GTQ B;  1SBB B;  1SDF A;  5ELE A;  1II3 A;  4A3E B;  1QE6 A;  2A74 C;  4FYD A;  4QF4 A;  3Q24 A;  2BE5 D;  2JYO A;  1VDZ A;  4BA1 I;  1IKM A;  3NPP A;  2R3Z A;  1JIC A;  1MGS A;  2HQE A;  1F2Y A;  1TY2 A;  1TWC B;  5COR A;  4KMU C;  3P7J A;  5J22 A;  2K05 A;  3GTJ B;  4P2C B;  2B2Y A;  2EJF C;  2K33 A;  1SFO B;  1TWG B;  1V1P A;  2F0H A;  3S2H B;  1RHP A;  1QOH A;  4DFA A;  4IUU A;  2TSS A;  4FXK C;  4PMB A;  1PTO F;  1WTO A;  2PYK A;  3S16 B;  1PXU A;  5FO7 B;  1I4X A;  5E1F A;  1LV9 A;  4N9P A;  4CKE A;  3PMF A;  1SNQ A;  5DM6 3;  1F9S A;  2M9V A;  1BCP D;  3NBI A;  4CHT B;  4RA8 A;  1U4P A;  2Z4I A;  3EQL C;  1TR5 A;  2EYF A;  4BBS B;  3QWN A;  5EPL A;  3RD4 A;  4A3D B;  1OXU A;  1H9M A;  2Z4H A;  3A7L A;  2QIL A;  4FXD A;  1I4H A;  4HSP A;  1CK1 A;  4EQO A;  4IUN A;  2K01 A;  4ZK9 B;  4M8A A;  5EKI A;  3CHB D;  3VA5 A;  1HFG A;  1GUW A;  1HQM C;  1I4Q A;  3DMU A;  4OO1 H;  2D9U A;  4LMQ D;  4A3G B;  1HTP A;  3OPO A;  4DK0 A;  2QCP X;  3NXW A;  2F0S A;  2NUC A;  1STE A;  3Q23 A;  1DZ1 A;  2TMP A;  4DAY A;  4L6T B;  5D65 A;  2EJG C;  4G4K A;  3NHH A;  2RVL A;  2ZT9 C;  5M5Y B;  3TP8 A;  3T16 A;  1WTX A;  2IX3 A;  2EYO A;  3BDO A;  1EFI D;  3SXH A;  1BQQ T;  2QKI C;  1PZJ D;  3NK9 A;  2A6H C;  2XSC A;  1A3T A;  3WOE A;  1HPC A;  3SE0 A;  1CQV A;  3QO2 A;  4HCS A;  3QIA A;  3W3A A;  1I50 B;  1EIG A;  1A2T A;  1PRT B;  1EY6 A;  1JWU D;  4KN7 C;  4EQP A;  1TS3 A;  4IFD J;  4GZY C;  1Q1B A;  3HEJ A;  4A3M B;  3VYS A;  5IGF A;  1SEB D;  4K14 A;  4X3T A;  5KGU A;  4LAA A;  1SYD A;  1SE3 A;  2A68 C;  3S1N B;  2K32 A;  4KY6 A;  5T1I A;  3MXG A;  2HDM A;  5ELB A;  4NW2 A;  2B2T C;  2G9D A;  2BA1 A;  4ZUJ A;  2VB2 X;  4XT1 B;  5M5X B;  2J4X A;  1BF4 A;  3K59 A;  1DXM A;  5JPM C;  3NWT A;  2VUM B;  1Q1E A;  3C46 A;  2HDL A;  2RDF A;  1XX8 A;  2GA4 B;  3I90 A;  1I4G A;  4A3K B;  2EYM A;  1HA5 A;  2OT2 A;  1Z7T A;  2EYP A;  4X3U A;  2F3W A;  4E6I A;  3GTP B;  3KBX A;  4IZ8 A;  5BN3 A;  3ND9 A;  2F0O A;  2PW7 A;  2XWJ B;  4F87 A;  2KED A;  4FF3 A;  1HCZ A;  4ME5 A;  5CV8 A;  2WB1 B;  5IGG A;  1R4Q B;  1CM9 A;  1GUS A;  1AW7 A;  1U4M A;  4HMJ A;  4ZRZ A;  2A6E D;  3TP5 A;  1D5Z C;  1Q90 A;  2K28 A;  3MFG A;  2F0E A;  1DOL A;  1CT1 D;  1RDP D;  4RGO S;  3W2D A;  2NBF A;  1ILQ A;  1GUG A;  5JOB A;  1OXV A;  4QCL A;  3K5M A;  2A69 D;  4RHR A;  5I2X A;  5CV9 A;  1F2Z A;  4BS9 A;  3VR2 A;  1PTO D;  2L5T A;  2JA7 B;  4ABN A;  3ND8 A;  1NSN S;  4XQQ A;  4K2L A;  2Q8I B;  2IX0 A;  2SOB A;  4K5W A;  4WFN 3;  1SE2 A;  4XXE A;  4TKO B;  3NTI A;  4H7B A;  3BVM A;  3H0G B;  3MTS A;  3HGB A;  4HCE A;  3TME A;  2FIN B;  5C4Z A;  1ET6 A;  5E4X A;  1AP0 A;  1JWS D;  2PQE A;  4KN4 C;  1Y8N B;  2D5D A;  2C9O A;  2E2I B;  5J1Z A;  1YNJ D;  2NB0 A;  4CJ0 B;  3R2T A;  2SDF A;  2RQX A;  4DGZ A;  3GO5 A;  2L9H A;  1DOM A;  4U67 3;  3BG3 A;  4C2M B;  5JVG 3;  5C3W A;  1B9N A;  2FMC A;  3OW7 A;  1A2U A;  3MA2 B;  4KY7 A;  1DCZ A;  5EQ0 A;  3RMH A;  4K6D A;  4X3S A;  2BA0 A;  4XQJ A;  1ENC A;  1GXD C;  3IFD A;  3I3C A;  2RSO A;  4A3B B;  3SK6 A;  4RHS A;  5D14 A;  3NWS A;  3H91 A;  1C48 A;  2NYZ D;  2O5I C;  3D31 A;  3NP8 A;  1T5E A;  4DN4 M;  2L4N A;  4FXG C;  2O2L D;  2FMM A;  1D2B A;  1EYA A;  1TS2 A;  2D62 A;  1HTL D;  4DNR B;  1NR2 A;  1FD7 D;  1OXX K;  1SJE D;  5KND A;  1H9K A;  1AFP A;  1GJX A;  4BA2 I;  2NVQ B;  3WDN A;  4IFD I;  1TWA B;  3CRK C;  3TP6 A;  5C44 B;  2MUY A;  3RZD B;  4MIU A;  4DNT B;  1VMC A;  2VNU D;  1SE4 A;  1UNS A;  1O78 A;  2F0Q A;  2RSN A;  2PNR C;  3NQT A;  3GTK B;  4V19 0;  1PFN A;  5FO9 B;  4XQN A;  3IL8 A;  1EIH A;  1K8M A;  2CW0 C;  2L11 A;  4NMZ A;  3MFY A;  2D2C C;  5C6A A;  3M4Y A;  4OL7 A;  1EEF D;  1WCM B;  4M1U B;  1ENA A;  3GTL B;  4O42 A;  1CFM A;  4C3J G;  4X3K A;  4IFD G;  1IKL A;  1JOK A;  5CV4 A;  4WJW A;  3KF8 A;  2B2W C;  2MPM A;  1HFN A;  4L63 B;  1ESR A;  2OXP A;  1RJT A;  1STH A;  4C3J B;  5JVH 3;  5KYI A;  1RKN A;  2L0C A;  2RA4 A;  1QJO A;  3BZD B;  3TZD A;  5M9O A;  4KKU A;  5E4W C;  4FF2 A;  3I4N B;  1DJR D;  3OWE B;  1YNN D;  2PPB C;  1LT6 D;  5ISR A;  5I6Y A;  1CZG A;  1ICW A;  3M85 A;  2BOS A;  3KUP A;  1QNK A;  2PZU A;  2AWO A;  1SMY D;  3HZX A;  5E3F A;  4QMG A;  3HRZ C;  5CV6 A;  3HKZ B;  2RDG A;  4KJN A;  3LX0 A;  2X6G A;  1EY0 A;  2EE1 A;  3EA6 A;  2O5J C;  2EY6 A;  4KJO A;  1JR0 D;  5KNC A;  4C3H G;  4CGY B;  2KCC A;  2ID0 A;  1U4R A;  1O7L A;  1QWY A;  2M2L A;  3HOZ B;  2MHV A;  1KTK A;  4C3H B;  2L12 A;  1GHK A;  4LJZ C;  4XYQ A;  4RGT A;  2EY5 A;  5EKK A;  4B9X A;  2F0N A;  3E6Z X;  1TY0 A;  2K04 A;  3SK8 A;  2PZW A;  1BUV T;  4QUC A;  3GTM B;  3I70 A;  1LTA D;  4IUR A;  1D1K A;  1Y1V B;  2FFK B;  1ML0 D;  2JSO A;  2AQ3 B;  4RGN A;  4KV6 A;  3K5N A;  3D6W A;  1HXY D;  4DXG A;  1SYB A;  5DM7 3;  2LFN A;  4NKL A;  1W6J A;  2F1M A;  4WRD A;  3H94 A;  4B9W A;  2MJ8 A;  1LT4 D;  3TN2 A;  2BE5 C;  4ID6 A;  4HED A;  3QG1 A;  3QOL A;  4DA2 A;  3TBI B;  4IUV A;  5I9O A;  3SK4 A;  5C3E B;  2B2V A;  5IIF A;  3HOX B;  1A3V A;  1TWH B;  5FLX E;  3GD7 A;  2JXM B;  4IUP A;  4RAU C;  5IGE A;  4DF7 A;  1JOO A;  5COY A;  5AFW A;  4ZKC B;  5EJW A;  2PCF B;  4FF4 A;  1I3Q B;  1TS5 A;  1AN8 A;  1TQO A;  3VA7 A;  3T13 A;  3RZO B;  3PUV A;  4IN3 A;  3K58 A;  3SEB A;  1NUC A;  2AQ1 B;  1S5C D;  3VR4 A;  1ILP A;  1RD9 D;  3MWY W;  2JEB I;  2IPK D;  3HOU B;  2B39 A;  1TU2 B;  1X32 A;  1U4L A;  2E2D C;  1SJH D;  3E0J A;  5DAU A;  1RF2 D;  1RTO A;  3FKI B;  5FK9 C;  5KYL A;  1FNV A;  2F0I A;  3VYR A;  1LT3 D;  3K6O A;  3V05 A;  1D5X C;  3BYT B;  1PRT D;  5C4X B;  5JAV A;  1ZXT A;  5EPJ A;  4N9T A;  2J0T D;  1LT5 D;  2G9H D;  3I72 A;  3L9A X;  3HOV B;  2XN9 C;  4O1N A;  2B2U C;  2I07 B;  3AMU A;  2RBM A;  5KIX A;  1J9O A;  1LTB D;  1TII D;  4J1M A;  2F0W A;  2SNM A;  4CJ2 C;  1KNA A;  4OGQ C;  2AWN A;  5ELD A;  5M5W B;  2AUJ D;  3LWE A;  1TWF B;  1HHV A;  4UAI A;  1F9Q A;  5J39 A;  3BYY B;  1G2T A;  3N6R A;  4IFD H;  1ZEQ X;  4BY1 B;  2PMZ B;  4G57 A;  1E2Z A;  3N52 A;  3R2I A;  4FVM A;  2NWG A;  4A3I B;  4PMC A;  4H0L C;  4EQN A;  1WD0 A;  1QCB D;  5FO8 B;  3AU7 A;  1Q12 A;  4BY7 B;  3J7A F;  3P75 A;  2KVM A;  2F0T A;  4KY5 A;  2EJM A;  5C3X A;  3BS1 A;  2EYH A;  3S1M B;  1E0B A;  4HAE A;  4QUF A;  2WAC A;  4MHE A;  1KNE A;  3GV3 A;  3M7N A;  2LMC B;  2DNC A;  5C4H A;  4DXF A;  5C0X H;  3DEP A;  4RH6 A;  5KEE A;  3PIO 3;  3H09 A;  1EY8 A;  4C1N I;  2WII B;  1WTV A;  2M00 A;  3JAM L;  1IW7 C;  4HSV A;  3HG9 A;  3PUW A;  4PMW A;  3MHB A;  2R93 B;  1SYG A;  4ILW A;  2F0D A;  2B2T A;  1D5M C;  1SXT A;  4R9W A;  1S5E D;  5CBA E;  2RDH A;  2K03 A;  5C0X J;  5M3F B;  4KKS A;  2R7Z B;  2B63 B;  2F03 A;  3A55 A;  2JA6 B;  1V8Q A;  2PO4 A;  3DM1 A;  2DN8 A;  1AZP A;  2A73 B;  5IGD A;  5CMD A;  5IT9 E;  1EWH A;  2KOL A;  1EY9 A;  2EY2 A;  1JWM D;  3A8K E;  4KI0 A;  1FNU A;  2IL8 A;  5JEA H;  1MSH A;  1O80 A;  3TZU A;  1W6K A;  4FF1 A;  1L0Y B;  1HUN A;  1F2L A;  1QG7 A;  1GUN A;  1UAP A;  4A3F B;  2C5C A;  5FLX L;  3HOY B;  1JB3 A;  3DXJ C;  3O13 A;  1LLR D;  5BN4 A;  3DEO A;  4TQU S;  1B4O A;  2SNS A;  1YNJ C;  3RLF A;  4LK1 C;  3VYU A;  2WAQ B;  2WKD A;  1NAP A;  5JEA J;  1OXT A;  1O7Z A;  3PIP 3;  3S1R B;  1SND A;  2N88 A;  1NCV A;  3KLS X;  2NVY B;  3AB9 A;  3TSS A;  3CKI B;  2E76 C;  5CC4 A;  1BR9 A;  3MEH A;  3TP7 A;  1F9P A;  2O4X A;  5ELC A;  1C8C A;  5KRU A;  4KD4 A;  3C2P A;  4F7X A;  1SYF A;  5TSS A;  4RCO A;  3BVG A;  3G6J B;  3DUZ A;  3KBG A;  2FJ2 A;  2EOT A;  2Q8T A;  1JCK B;  2F0V A;  2A5H A;  1A6X A;  3URY A;  1FNW A;  4K2K A;  1IHZ A;  2F0G A;  1CTM A;  3A56 A;  1D1I A;  3NTH A;  3M7G A;  1PDQ A;  3S14 B;  1DM0 B;  1I6V C;  3DWQ A;  3CRL C;  3OWF A;  3HOW B;  1SNC A;  1EWC A;  4Q0F A;  4DU9 A;  4HMI A;  2ICI A;  1G6Z A;  1LTT D;  3A8I E;  3D4D A;  4RKL A;  5I6W A;  1QB5 D;  3KLS A;  4IAL A;  1BBX C;  5CV5 A;  1LO5 D;  5IGC A;  4A93 B;  3M4O B;  3MXP A;  3SHL A;  4I65 A;  3V96 A;  3P1H A;  2X6L A;  1VMP A;  2K5W A;  1ZYR D;  2WKC A;  2F0U A;  2RKS A;  5EPK A;  4RWS C;  2XIW A;  4XYO A;  3J81 E;  3J7A V;  2JA5 B;  3U9S A;  2V4D A;  4ZKB B;  2K7V A;  3IFT A;  3Q6S A;  3LWU A;  3KK7 A;  5IOC A;  3D8G A;  2NN6 G;  4EVO A;  2CHB D;  5C0X I;  1HQR D;  3E5S A;  1L0X B;  3FEW X;  1ROD A;  2CW0 D;  1STG A;  3MXU A;  1ESF A;  3ONA B;  1LTG D;  3PUX A;  2I46 A;  1NR4 A;  3DWP A;  4KK7 A;  1YNN C;  2XRQ D;  1J8I A;  1TS4 A;  3K7A B;  5K36 G;  2F0M A;  4I7Z C;  1H9S B;  1DOK A;  3K0Y A;  2F0P A;  1F9R A;  2L1B A;  2IX1 A;  3FVQ A;  1PZI D;  1JQY D;  3PO2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...