4RKLA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/v66t at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMTENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rklA00
4N9PA 4LAAA 4KHVA 3NUCA 5ISRA 4DU9A 1EY5A 1KDBA 2EYOA 1EYDA 1F2ZA 3ITPA 3MZ5A 3OMCA 4S3SA 3T16A 1STBA 1A2UA 3E5SA 3HEJA 3NXWA 5DEHA 5CV5A 3LX0A 3U9OA 5DAUA 1SYEA 3VA5A 1ENCA 3T13A 2EYJA 4ID6A 4RKBA 3SHLA 3TP5A 3P75A 1A3TA 1JOOA 1KAAA 1SYFA 2M00A 1KABA 3OWFA 3SK5A 5IGDA 1ENAA 2EYFA 5IGFA 1SNOA 1JORA 1SNDA 4KY5A 1TQOA 2PQEA 4PMCA 2F3VA 1EYAA 4YIJA 5I9OA 2F0VA 1STYA 2F0IA 2O4XA 3P1HA 2PZTA 5EKLA 3C1EA 4DFAA 1SYGA 5CV7A 3ERQA 5IGGA 1KDAA 4NMZA 3D4WA 4IALA 5KRUA 4QF4A 4K5VA 4H7BA 4K2KA 1A3VA 4KY6A 4EVOA 2F0KA 1SYDA 2F0WA 1NUCA 3SK6A 4KJNA 2F0UA 3DMUA 5C3WA 5JOBA 5E3FA 1TR5A 4HTHA 4ZUIA 4IZ8A 3TMEA 1JOKA 2OF1A 2EYPA 5K5PA 3EVQA 1RKNA 3EROA 3HZXA 4KY7A 3DHQA 1A2TA 2OEOA 4QMGA 2EY2A 5CR3A 4MIUA 4NP5A 4K5XA 4EQPA 5I9PA 3OMGA 5NUCA 5C4ZA 3D8GA 3TP6A 5KGUA 3V2TA 4K5WA 4ODGA 1EY0A 2NUCA 3QOJA 1KDCA 5C5MA 1STHA 3RUZA 5CC4A 5CV4A 2F0EA 2LKVA 1U9RA 2SNSA 5J39A 4WORA 5IGEA 2EXZA 4K8JA 4ZUJA 4K14A 1EY4A 2F0JA 4N9TA 4OL7A 4DF7A 4F8MA 2EYMA 2EY6A 1A3UA 4E6IA 1IHZA 1EY7A 4K2LA 5C5LA 4KD4A 4F7XA 2ENBA 3SK4A 4B9XA 5IOCA 2SOBA 5C6AA 3BDLA 1EYCA 2PZUA 3MXPA 1EY6A 3QB3A 5CV9A 1EY9A 3NHHA 2PW7A 5HGTA 1EY8A 2F0SA 5JAVA 4ZQ3A 2RKSA 1F2YA 2OXPA 3BDCA 2F0TA 4KD3A 5CGKA 4EQOA 2F0HA 3C1FA 3NP8A 3NK9A 2KHSA 4G57A 4J1MA 4IUNA 4K6DA 4J6HA 4HMJA 1NSNS 4R8NA 1STNA 3NQTA 2EYHA 5KYIA 4KTAA 2F0PA 3TP8A 2F0GA 2EYLA 3D6CA 4KV6A 5I6WA 5HURA 5IGCA 5IODA 1EZ6A 1F2MA 2F0OA 5I6YA 5KEEA 4B9WA 3MEHA 2EY1A 5C3XA 2RDFA 5M9OA 3R3OA 5C4HA 2KQ3A 1SNMA 2F0LA 2F0NA 2F0QA 3D4DA 1SNCA 1SNPA 1STGA 3MHBA 3MVVA 2HQEA 4PNYA 4WRDA 1TT2A 3SR1A 1EZ8A 5EGTA 4RKLA 2F3WA 2RBMA 4NDXA 1EQVA 2PW5A 1STAA 5KIXA 4EQNA 2PYKA 4QB4A 5F2DA 5J1ZA 4DGZA 5IIFA 2WACA 3PMFA 3SXHA 5IGBA 1SYCA 2PZWA 3QOLA 5CV6A 3OSOA 3TP7A 1JOQA 2F0FA 4ME5A 1SNQA 1AEXA 2SNMA 4TRDA 5E1FA 5EKKA 1II3A 4NKLA 1SYBA 4PMBA 3EJIA 2F0MA 3S9WA 2QDBA 5CV8A 4I65A 5J22A 2EY5A 3H6MA 2F0DA 4K8IA 3SK8A 5KYLA 4HMIA 4KJOA
chains in the Genus database with same CATH superfamily
2UXCQ 2OTLA 5C44B 3NTKA 4IUPA 1O78A 3GTGB 1QNUA 1XNQQ 4C3JB 1UE7A 1Q90A 3I4NB 3N6RA 3RZOB 1SYEA 2DY7A 1UUPA 2EYJA 1L2FA 2QKIC 3I4MH 2BH8A 2B2YA 2FMMA 1SNDA 3S17H 2K4KA 4G4KA 3GTLB 3NQIA 1PFSA 4IPGA 3K7AH 4NMZA 3D4WA 3EA6A 2JE6I 1X6OA 4X65L 3CCUA 4KKUA 1PH4A 5C3WA 1RJTA 4HIKA 5C4JB 3ONAB 3GTJB 1AN8A 4BBSB 3FVQA 4IPDA 4KY7A 4A3FG 4OIKA 2E2IB 3HOYB 3BDOA 1KTKA 2NZ1D 1K83B 2NUCA 2KEDA 3S2DB 1AE3A 1GOZA 1BF4A 1K73C 1HA5A 3MFYA 1SJED 4HJ9A 4K8JA 1JJCB 2EYMA 1MD2D 4E6IA 4JOIC 4K2LA 2B29A 4H44C 3RN5A 1IKLA 1MSHA 2FJ2A 3MFGA 1P16A 3GTMH 4WJ3M 4OO1I 1O7LA 1EUJA 4IUNA 3D6WA 2CH4A 2JA6B 1I5FA 5IODA 2KA7A 3EIVA 4QQBX 2XRSD 3RZDB 3BYYB 2PO4A 5M9OA 1HA6A 3HG9A 2XN9C 1VQJA 3H3VC 1SNCA 1SNPA 2TSSA 2EJMA 1BCPB 3KF6A 4DV5L 4HIDA 1HNWL 3GTPB 1QWYA 2K50A 1S4ZA 5IYDH 1WTXA 3CD6A 2KECA 4YY3L 3S2HB 1STAA 2NWGA 1N36Q 4EX5A 2B2UC 1HQRD 1JOQA 2AQ1B 2F0FA 1ICWA 4DR4Q 3RNUA 3BU2A 3KF8A 2PNHA 3O13A 2EY5A 4HSVA 5FKAC 4WJWA 1LLRD 3MEFA 1MSGA 1B1ZA 5G3LF 2WV6D 3K7AB 1XPRA 3E5SA 4JBMA 2IT1A 2J4XA 1KL9A 3CPFA 3UDXA 3CPWA 3CC7A 4L5RC 1E3PA 4C3HH 1SJHD 1MBYA 2ZT9C 5I4DA 2K1BA 3EFXD 2E2JB 1JOOA 1SFOB 3HOXG 1MHWC 1KABA 1HUNA 2VL6A 1EWHA 4JI0L 2K75A 1VQHA 1DONA 3OOCA 4LF5Q 4KKSA 2F0IA 4DFAA 2N78A 2OQKA 4IALA 1MGSA 3F2BA 2TMPA 1HJPA 3STBD 1PZKD 5FJ8H 3C3LA 2HCIA 4DXGA 3RN2A 3HOUH 3DMUA 4AQYL 5JJLA 3CAMA 1VF5C 2C9OA 3J7AF 5K36G 3NBHA 4QMGA 4NP5A 4C56C 2Z6KC 2R3ZA 4GNXB 1Z47A 4ME3A 1T5XD 3KF6B 4X65Q 1EU4A 4FXDA 4JI8Q 2I0QA 1ZYRC 5E4XA 3PCOB 3RUZA 3GTOH 5CV4A 4RGOS 2B2YC 1FR3A 5C0XG 2NVYB 1HR0W 1QJOA 1AH9A 3HS0C 1SROA 3U4VA 4DV6L 1VQ9A 3GQBA 4DV2L 4YCVA 1EY6A 2F3IA 4A3LG 2F0SA 3BZCA 1F2YA 1V1PB 3QJYA 3KLRA 3L3OC 3HKZE 3HP3A 1WTHA 2Y0SG 3GTMB 2K04A 4DV0Q 4JC0A 1WFQA 2A68C 2IX3A 3PUXA 5IGCA 3CP0A 1VQDA 3GTQB 3PV0A 4LK1C 1E7ZA 4IFDG 4BXXH 1BBXC 3RLFA 4A3BG 4R4IA 2RDGA 4JI1Q 1ICFB 4DR1Q 2Q8RE 2LXKA 3BVGA 1QB5D 2UUAQ 4RCNA 2O5IC 1Z6HA 3NWSA 2FINB 4A93B 1VQ7A 2JK8A 3HOVB 1SXTA 1QVFA 4TRDA 1JMCA 4FF1A 5CV8A 1SN8A 1IW7D 2F0DA 1JICA 2K52A 1GM5A 4RH6A 4C3JG 3DM1A 1IYUA 4IPCA 1KHIA 5CMDA 4X64L 2K33A 3BS1A 1X55A 1VQ6A 3NXWA 1VQKA 1H9RA 3CCMA 2F03A 1O80A 1GHKA 4ID6A 4U68A 3FDTA 2M00A 3S1MH 4B3SL 1F9QA 1S5DD 4DR4L 2EYFA 4CHTB 5EJWA 4B3RL 5FK9C 4BBRH 1TQOA 3M85A 3P1HA 1V1PA 4ZKBB 5KRUA 2PPBC 3S1NH 4LW1A 2NVXB 4EVOA 1EWIA 1LT5D 4DAYB 4JG2A 1FYCA 3AQQA 2BDNA 4J15A 4JI2L 2IHFA 2JA7H 4CDCC 5K5PA 3QO2A 5T1IA 5KNBA 2B2VC 3AU7A 3I8ZA 1LV9A 1VQAA 3MXGA 1I4RA 2WB1E 3DEOA 4IOCA 3QOJA 2R7DA 4CKEA 1KNAA 2F0EA 4UPAA 1IBML 2MO1A 1J8IA 3NELA 4A3GH 2QGQA 2K28A 4N9TA 3ZYYX 5C3EH 4OIJA 4IUTA 3T1HQ 4F7XA 2ASBA 1DGSA 2GA4B 4QGUA 2LFNA 3KLWA 4AQYQ 2HT1A 4JYAL 1X32A 1J9OA 3NHHA 5FLXE 5FO8B 1PXUA 1NTGA 4N8X1 2EDGA 1IKMA 1HNXQ 1Q12A 2KBNA 4LF8Q 4HEDA 5ELCA 1A15A 1SRUA 2D62A 1YITA 3S14H 3CW2C 5EQ0A 2B63B 4XIGS 1UE5A 2JN4A 3AMUA 2L55A 5I2YA 1R9TH 4KMUC 1Q82C 2XWBB 3HOZG 1DM0B 1TU2B 5F2DA 2B2UA 2Q2IA 4RCOA 2OWOA 3OWEB 1PH7A 1VF7A 2R7ZG 1TWAH 4ME5A 1EFWA 2YU9H 1SNQA 2G9HD 1DOLA 4O2DA 4PMBA 4XXEA 2XTIA 1HQMC 1JWUD 4KK7A 3V05A 4J8QA 1QZGA 1HPCA 2M9VA 4HMIA 5ELDA 2A74C 5CBAE 4A3EB 1YNXA 5D3IB 2VUMH 3HEJA 5DEHA 3STBC 3HOXB 1QUQA 2O2LD 2DJFC 2JA6H 3M4QA 1DZ1A 3S15H 1TWGB 1ENCA 4FNFA 4RKBA 3TP5A 4JK1C 2WB1G 2IHEA 4X62L 3KUPA 1YIJA 4IOAA 1IZ6A 2K32A 3RD4A 5I9OA 1STYA 2L1BA 1E2WA 1YNND 1Y1VH 5KNCA 3WWVA 2B63H 1BBUA 1X3FA 5D14A 1DOMA 3G7LA 1JOKA 1D1IA 4RA8A 4AYBG 2KCCA 1NR4A 1YBYA 4L5TA 3J81c 2MP1A 1Y1WB 3PQIA 3OMGA 4KI0A 4LWCA 5ELNA 4JW0A 4DPGA 4HJ8A 4LFBL 4YCWA 2BA0A 4RAUC 2K5QA 4WORA 2WP8J 1LTSD 2K5HA 1OXXK 4HCEA 2ZTCA 5A2QE 2I5LX 2E2JH 2N8NA 2BA1A 1A8VA 4IPHA 4YHHL 1PH9A 2HHHQ 3CCSA 3T53B 1QG7A 4K6DA 1Y8PB 4ZYSA 3RZDH 2RF4A 3D6CA 2PQAB 3D0FA 4FF2A 1QUQB 1L1OB 1QOHA 1SEBD 4P75A 1U0LA 5C3XA 1KLGD 4L6TB 5IWAQ 4K5WA 2JA7G 2KJXA 4HIMA 1TT2A 2WINB 4PQXA 1LT4D 1PTOB 1CUKA 3BJUA 1CKMA 1EQVA 2L5TA 3I4NG 1Z7TA 3I90A 4X66Q 1GUGA 1LTID 4RGNA 1PMRA 2DJGC 1WVLA 3OSOA 1RODA 1Y8OB 1HCZA 5K36H 1DXMA 1AEXA 5EKKA 4B3RQ 5ELOA 1TWAB 2I07B 1B2TA 1QZHA 3E6ZX 4BBRB 1YHAA 3NPPA 5JVH3 5ISRA 1J5EQ 3H3VI 2IWHA 2EYOA 3J7A5 1R4PB 4PZ8A 1XXGA 1VQPA 1BCPD 4LF6L 4JI2Q 3A54A 3SHLA 2Q8IB 3HOVG 3PO2G 4BY7H 5IGDA 1DOKA 1VQMA 1VQBA 4A93G 2PI2A 2ZTDA 1EYAA 5JPMC 3JAML 1I6HB 2UUBQ 3H91A 1BCPF 4Q0FA 4LF4L 1UEAB 3LWEA 3RLOA 3TQYA 1EL0A 5LL6X 5LMUL 3C46A 1RKNA 3EROA 5T1GA 2KCMA 2ZM6L 2EXDA 5E4WC 1H9JA 3NBHB 4UP7A 5JJKA 1U9RA 3E9HA 3S16B 1TVXA 1JE4A 2Z0SA 4OL7A 2E76C 1ZYRD 4F8MA 4KD4A 3CC4A 3HOZH 2R61A 3R2IA 1GXDC 1JJGA 5C6AA 2K7VA 3MXNA 1I50B 1IXRA 3I73A 1NMFA 3BDCA 1AZQA 4GOPA 3NEMA 4FYDA 2KHSA 5C0XH 2A69C 4LNQA 1X3QA 4B08A 1BXTA 4R8IA 3TP8A 2AUKA 2Z8LA 2L4NA 2F0OA 2E2HB 5KEEA 3ULPA 5FOBB 1FGUA 1E24A 1HZ9A 5M5WH 2SDFA 1JE5A 1SLJA 2EVBA 2YTYA 4HAEA 4IUUA 5M3MH 2IJ0A 5C3EG 2LY7A 5J1ZA 4BA2I 1HZBA 4OWWB 1U4RA 5IT9E 1S5BD 2CWAA 3J80L 1EQTA 1B50A 4OONA 1FGBD 3ER0A 2QCPX 3EJIA 1ML0D 3HOWB 3NBIA 2JXMB 1EEID 2BE5C 3I3CA 3NUCA 4G7ZC 1VQLA 4X3SA 1I94L 3HOZB 4IJLA 4XYOA 1JB3A 3H3VH 2K05A 1WYDA 2NB0A 4B3TL 2H1EA 3ULJA 1H9SB 5M3FH 1XWEA 3F1ZA 4XQQA 4LF7L 4DR3Q 3I56A 2UXBL 4DV1Q 4A75A 1WTPA 2JJQA 4K5VA 3G4SA 2D5DA 5A35A 2F0WA 2HQLA 5IYDG 1D1KA 1LACA 4C3IG 1Y8NB 2OF1A 1YZ6A 4DNRB 3I4LA 1TWFH 1HFGA 2IPKD 4L8JA 2O5JC 4DXFA 5IYBG 4PV1C 1I6HH 4NB3A 3FHWA 3M7GA 2I5MX 1L0WA 4BY1B 4ZKCB 3JAMi 3S1QB 1EY0A 4JPBW 4R4OA 2F4IA 5J39A 3U9SA 5JEAH 4AYBB 2EZVA 3J81L 4LF9L 2MJ8A 3FRPB 1TWGH 1Y14B 3VR2A 4C1NK 3G6EA 4OWXB 2RKSA 4A3BH 4YY3Q 2ZM6Q 2XSCA 5IYBH 1LTBD 5M3MB 2L15A 3PUVA 2JEAI 4X66L 3IL8A 2RDFA 2R92H 3P7JA 4CKBA 2E2HH 4V190 2F0LA 2CW0C 5IE8A 5AJ3Q 3GTQH 1CKNB 2HQEA 5CBEE 2B63G 1BCPC 5IIFA 4TVAB 4QL5A 3I91A 1RL2A 3BG3A 2VNUD 1SAPA 2XRQD 4UY8C 2SEBD 1K8MA 4NKLA 3TDQA 2CCZA 4MTNA 2E5LQ 4DUZQ 2Z6KA 4KN4C 3K5MA 4JI5L 4LAAA 4DR1L 4DAYA 3P20A 2VQEQ 3ITPA 2ZJRA 4S3SA 1UE6A 1Q7YC 1I6VC 2ICIA 2UXDQ 3S1RB 2LXJA 3SEBA 2FFKB 2X6LA 4LUOA 5FO9B 1IL8A 4UAIA 4BY7B 2R6GA 1I3QH 4OX9L 3OWFA 2E8GA 1AFPA 1SNOA 4G7HC 4KY5A 1GD7A 2ZTEA 4GKKL 1K0SA 2QDLA 4A3EH 1HTPA 4LFAL 4X64Q 4A3IG 4H7BA 3DWPA 3S14B 4DV6Q 2Z6BA 3QR8A 3K7UC 4JYAQ 1M4VA 3EQLC 3HZXA 4CGYB 3IRBA 2HD3A 1X3PA 5CR3A 4GOPC 4X62Q 3B6YA 4KHZA 1EFID 1T9HA 4K6LA 1N34L 2PMZE 1YJNA 5C5MA 3M4OB 2KUMA 1PFMA 2LKVA 2SNSA 4WFN3 1T5EA 2K5VA 1D5MC 1BNZA 2JSOA 4DAMA 5C0XI 3GTJH 1I50H 2ENBA 4NPSA 4UP8A 4B9XA 1OXUA 1SR3A 4GKJQ 2PW7A 5LL6S 1HXYD 4ZQ3A 4RMFA 5JPNC 1PV4A 4AIMA 1CFMA 2EIFA 1G8ZD 4PZ6A 2NTSA 2F0HA 3A8KE 3UE0A 1VQOA 3OHXC 3S16H 1XMQL 1JC7A 3H15A 1JB7A 1TY0A 4FF3A 2EYHA 3AFPA 1Y1VB 1NR2A 1AW7A 1EZ6A 4DR2L 3I4MB 2AQ3B 3VYRA 3A0JA 2ATWA 5D65A 3KFUA 5EPLA 3D4DA 1N33Q 1S5FD 1IYVA 2BE5D 2F3WA 4EGVA 3GTGH 3Q8DA 2RHQB 2MPMA 2PYKA 4QB4A 2HHHL 4DGZA 1YJWA 3S1RH 3PO3G 3HOXH 3T56B 4DR6L 1S5ED 1UNSA 2Y0SB 4LF8L 3PGZA 5BN3A 1N33L 1QVCA 1BOSA 4F88A 3OTOQ 5CORA 5J22A 4A3MB 2A6ED 2IW3A 2P5ZX 1XMOL 3M4PA 1F2LA 4HN7A 1N36L 4RG1A 1JWSD 1HNWQ 1C48A 3K0XA 5L37A 1X65A 3CCJA 1EQRA 3J7YW 1LABA 5CV5A 3OYYA 2KVMA 4AYBE 4R4QA 4P73A 2VQFQ 1HNZQ 1K9MC 3CC2A 2YTXA 2NBFA 1MJEA 2B2WA 1XJVA 1AE2A 2E75C 3M7NA 2RVLA 3BVZA 1S5CD 3ERQA 3MC0B 2MGSA 4YWLA 4X6AH 1G6ZA 2VUMG 1SMYD 1STEA 1GO3E 3CCRA 1SDFA 1XTCD 2VW9A 1CSQA 4GKKQ 1F77A 4LF9Q 4M8AA 4YWMA 4JCVE 1DJRD 5NUCA 5GAEC 5C4XB 1IYJB 3KLSA 5AFWA 2L9HA 5CC4A 4DUYQ 1JT8A 4JI6L 1U5KA 3CKIB 3K59A 2J0TD 1EYGA 5FLMH 2EY6A 1NAPA 3QWNA 2NVTH 4QJFA 3VYTA 4GN3B 1CM9A 5LHY1 4A3LH 3BDLA 1I4QA 3TBIB 1W6JA 2EOTA 1K28A 4OGQC 5A2QL 4BBSG 2OXPA 3ZJYC 4JI6Q 1PFBA 2ZJQA 3F8TA 1QCBD 2GN5A 1CZGA 4HMJA 1SBBB 4HCSA 3N52A 3Q6SA 1G2SA 3W5OA 1PTOD 1PYBA 2CFMA 5DM73 2CHBD 1NMGA 2EY1A 4BY1G 5M5XH 4LJZC 5C4HA 3J80E 2CH4W 3MVVA 2V1CC 3HKZG 4JI3Q 3GV3A 3J7ZC 4NW2A 4HSPA 3GTPH 4A3FB 3HOWG 2UXCL 2D0PA 4C3HB 1JCKB 4GS3A 2Z4IA 4DV4Q 1CQFA 3G6JB 1WTQA 3E9IA 1K3BC 1XYIA 1IW7C 4NXNQ 1A62A 1CSPA 4JBJA 3SK8A 4QUFA 5KYLA 3T1YL 3K81C 4LF4Q 1A0IA 3T16A 1STBA 1CTMA 4DV4L 4A93H 1WCMB 3OIQA 1RTNA 4FDBA 4H13C 2JA5G 1XMOQ 1B4OA 1KAAA 3CCQA 1WD0A 1VQ8A 2KOLA 3SK5A 1ENAA 3FPPA 2Q8TA 1Q46A 4WJ4A 3OW7A 1Q8KA 4DV3Q 3J81i 5EKLA 1G291 5IGGA 4POGA 2VXWA 4NXMQ 4QIWE 1OXTA 5M5YH 3TEHB 4MNOA 3KLSX 5FLXc 1XX8A 4A3MG 4P72A 2OTJA 4DR3L 2L12A 3FKIH 1HNZL 2EY2A 5M3FB 5I9PA 3R93A 3TP6A 1XMQQ 1DYQA 3HOYG 4A3KH 1ESRA 2A1AA 2PMZB 3VDYA 5FLXL 1KC8C 1CHQD 2F0JA 4MHEA 3GTOB 1EY7A 1Z9FA 2QA4A 1YNNC 5BR8Q 1H9MA 2KCTA 2LSSA 3D3RA 2I5HA 2OT2A 4R1JA 1PRTF 3CMAA 4EQOA 4FXGC 3DWAA 4DR6Q 2DY8A 1WI5A 3OIPA 4X3TA 4DUYL 2F0GA 1F2MA 2WAQG 3PIOA 1KRSA 3GV6A 4B9WA 1E0BA 2AHOB 1TS3A 2HIXA 3NTIA 4CJ1B 3R3OA 1VMPA 2JA7B 3R8BA 1Q86C 2Q2UA 1EZ8A 2RQXA 1FVIA 1B9MA 4BBRG 4DK3C 1IBKQ 4N8FA 2MFIA 5FLMG 4LF6Q 3NWTA 5HY6A 5JVG3 1VQIA 1A63A 3J80c 2Y0SE 4XTCS 4YCUA 3ND8A 2A73B 3K5NA 3VR5A 4DNTB 1WTWA 1IBKL 1HHVA 3T51B 4XQNA 2DUDA 3Q23A 2LS01 1V43A 1V9PA 3DEPA 5FJ8G 2UU9Q 3J7AV 2LMCB 2E5LL 1Q1EA 3A56A 4RGMA 1Q8IA 3CU7A 2NN6G 3TS2A 2A5HA 2HCCA 1JJ2A 5I2XA 2AKWB 4A3CH 3G48A 5IT9c 1J6QA 3VR6A 2X69A 1XNRQ 5EKIA 4QF4A 4C3HG 4IFDH 3T1HL 3ICEA 3MTSA 1LTTD 2D0OA 5JOBA 1NJIC 4GLVB 1D6EC 1JQYD 1B9NA 1U4MA 1UEBA 2Q2HA 2WAQB 1M1KC 1LT3D 2A6EC 2RSNA 1PH3A 3T4AC 4DK6C 1BVSA 5JJZA 2RHSB 4LFAQ 2VZAA 4NXML 2OQ0A 5BN4A 3BVMA 3TRZA 3M3YB 5IP9H 3SDZA 1Y1WG 2VB2X 3BYTB 4XDXA 2I46A 3DWQA 1W6KA 5EPKA 3MXNB 4DF7A 1O7ZA 1D5ZC 3H0GB 2B3GA 5C5LA 1KLUD 5C4JH 3I4NH 4A3DG 3PSIA 3SK4A 1VQCA 5KNDA 3U58A 2ICEC 1EYCA 4UDUC 1X54A 4L5QA 2R93B 3DM3A 3RLNA 3W3AA 2MO0A 4C2MB 2D2CC 2HDMA 2PI2E 3HKZB 2R7ZB 1NSNS 1VS0A 2A6HD 5KYIA 4IN3A 1I3QB 2CQOA 4IO9A 4B3MQ 3AEVA 3IFDA 4NXNL 3VR4A 3A8JE 1AZPA 1RTOA 3FPUB 1PTOH 2K6AA 1FNUA 1SE2A 3KBGA 1F9PA 4RKLA 4C2MH 5EPJA 5GQOA 4A3IH 3E0EA 1IBLL 2K01A 4EQNA 3HOYH 3F2DA 2VUMB 4H02A 2PQAA 1V8QA 2G9DA 1N8RC 4OX9Q 4L63B 1SYCA 2PZWA 3QOLA 1B3QA 1L0YB 2N49A 1L0XB 3X3MA 4B3TQ 5GAGC 1II3A 2Z9HA 2YTVA 2JA5B 2BH2A 1EIYB 1LT6D 4DV3L 3D4RA 1FJGL 4LUVA 1ENFA 1CKOA 4I7AA 4C3IB 2DNCA 4FO2A 4EQ5A 4GNXA 1N9WA 1FNWA 3OMCA 1CKNA 3TN2A 4JI4Q 4G7OC 1DCZA 1YEZA 3CQZH 1HH2P 1PH2A 2NYZD 5DAUA 1QILA 4RHSA 4A3EG 1N32L 2X6GA 3K6OA 1PH6A 3P75A 1A3TA 1SYFA 3RZOH 2L11A 3OTOL 1JORA 2EPBA 5C4XH 4JI4L 4YIJA 5BN5A 1GUNA 2F0VA 2N55A 3NTHA 4PZ7A 5CV7A 1KDAA 2EJFC 5GAHC 4KY6A 4QIWB 2F0UA 4LUZA 1CK1A 5E3FA 2YV5A 2R93G 2F4VL 2K14A 4EQPA 1L1OC 1YVCA 5C4ZA 3D8GA 3HOWH 5KGUA 2B8GA 1P8LA 3X3NA 2QEXA 2EXZA 3PUYA 4JOIA 2CWPA 2WKDA 4PMWA 1XNRL 1PRTB 4P74A 5COYA 4ABNA 1M90C 1YJ9A 3PUZA 4R9WA 4JV5Q 1XTDA 3Q24A 4DR5L 3H0GH 1TWCB 4CDEC 3S1MB 4JI8L 5JAVA 2B2TA 3I70A 4AH6A 3S1QH 1PRTD 1C4QA 3UI2A 1DD2A 1JR0D 4XQJA 4J1MA 1G2TA 1LUZA 4O1NA 3FMCA 3SE0A 5DM63 1S40A 3NQTA 5EBDA 3S1NB 2MQHA 2EYLA 1K8GA 3H0GG 4ZK9B 5I6YA 3J81E 3KJOA 1V1QA 1KAWA 1FNVA 3MEHA 3BZKA 1Y1VG 3I55A 3GTKH 4DA2A 2OCEA 3SVMA 4PG3A 1MJCA 2CQAA 3KF8B 1CI3M 1E1TA 2WACA 1HFNA 3GDEA 4V0BA 4TQUS 2A19A 4CKCA 1GVPA 2ZJPA 4DR7L 5G3LD 3KK7A 4MZ9A 4KKTA 1TXYA 5H1SE 2CVRA 1XPOA 2KEEA 4Y7NB 4JI3L 2E2DC 4U673 3HOUG 4OXPA 3WOEA 2V4DA 3W2DA 5IYCH 1HTLD 4IUQA 2PNRC 1RHPA 1BR9A 1X3EA 4ILWA 1EY5A 1KDBA 1RCVD 4LMQD 2K5WA 2UUAL 3IFTA 1EWCA 1RD9D 3HOUB 1VQNA 2HUGA 5IYCG 3TS0A 3TREA 5IGFA 1CQVA 4IFDI 2K5DA 3G71A 4JVZA 4Z9CB 2FHTA 1A6XA 4PMCA 1B7YB 3W1BA 1R9TB 4FVMA 1ASZA 2IY5B 3ERSX 3HRZC 1VCIA 1I4XA 3S17B 1H9SA 3GO5A 4A3JH 2CW0D 2HDLA 1LYLA 2F0KA 1B44D 4Q5VA 1TR5A 4HR7B 4GN4B 2EYPA 5IT9L 2BOSA 4A76A 1VQ4A 4A3BB 5JJIA 4K5XA 3M4OH 5D3DA 4LFCL 3MAQA 3V2TA 4DV0L 1VQEA 3CXCA 3VYSA 2JYOA 4YHHQ 4R4TA 1YI2A 3JC66 4A3DH 1EEFD 4DNIA 1ASYA 3EBEA 4CBVA 2NTTA 4DN4M 4B3ML 1EY9A 5M5WB 3BZDB 4GLXA 1EOVA 1D8LA 5DNFA 2B39A 3S2DH 3HFZB 2JQOA 4A3KB 4MTKA 4CJ2C 3PIO3 4KTAA 2XGTA 4DR5Q 1IBMQ 1O7YA 2AUJD 2Q2TA 2JA8G 2NVXH 4OO1H 1VQFA 2HIVA 3J80i 1QVGA 1SNMA 2R93H 4RHRA 1STGA 3T1YQ 3KBXA 3M4YA 4ULLA 4TSSA 2NVQB 4JI7L 4P71A 1WCMG 5KIXA 1PDQA 2RDHA 2EE1A 3LGJA 1TY2A 2EQSA 1E22A 4KHPQ 5IGBA 1GUOA 5CV6A 3TZUA 5IWAL 4A3FH 3CQZB 1B8AA 1WTVA 5C4XG 1GUSA 5AJ3L 4DAVA 1D5XC 1LTGD 4POFA 1I94Q 1LTRD 3PO2H 4BWGB 4JI7Q 1TKWB 2ALYB 4DV1L 4HJ7A 4KHPL 1K0RA 4C3JH 4Y52H 4DU9A 4A3GB 4QUCA 2DGYA 1H9KA 1YHBA 1PYSB 2ZXOA 1IL2A 3H09A 1AP0A 3CCEA 3CRKC 3U9OA 4APVA 1NCVA 2AWNA 1UE1A 1RIPA 1O7IA 2JEBI 3RMHA 1X56A 2B2TC 2JA6G 3I7FA 3S24A 1W2BA 2F3VA 2D9UA 2JA8B 2A8VA 5GADC 1JWMD 1TWHB 2Z4HA 3C1EA 5TSSA 1SYGA 1K3RA 1RDPD 1OO9B 2B2VA 2VB3X 2VQEL 3PF5A 1A3VA 3SK6A 3SGIA 4OEMB 2BCOA 4BA1I 2WIIB 1HR0L 3PIPA 4UP9A 4TKOB 4LF5L 1BUVT 2OEOA 2UUBL 1GHJA 4XT3B 4ODGA 1TWHH 1STHA 1HR0Q 2QILA 2WAQE 1ET9A 3NENA 2UUCL 5IGEA 1CA5A 2CKZB 4QCLA 4C1NI 4A3DB 5IY0A 1SMXA 1E2VA 3DUZA 5HGTA 4LFBQ 1EY8A 4H0LC 4A3KG 3JAMc 3K58A 3LNNA 5LMNQ 1SSOA 5CYUA 2UUCQ 1K83H 3NP8A 3A5UA 1E1OA 1F9RA 1PTOC 4YWKA 3A74A 1WD1A 3I72A 1CHPD 3H94A 4KV6A 4GKJL 1SE4A 2GVBA 2F0NA 1VQ5A 3MA2B 5IOCA 4DR7Q 4WRDA 4A3GG 3SR1A 2RCNA 1LTAD 2ZXRA 3URYA 1Y69U 5C44G 4RFBA 1VDZA 1ILPA 4DR2Q 1QE6A 1GUTA 3SXHA 1EOTA 3TP7A 1TS5A 2F1MA 3S15B 2SNMA 1MI2A 4IJHA 2AQ2B 5GROA 2KCNA 2F0MA 1U4LA 2NN6I 4K8IA 4HJAA 1EIGA 4N9PA 3V96A 4KHVA 2K5NA 3RR5A 1WTRA 4A4IA 3HGBA 1F2ZA 5JEAJ 5ELEA 3UDFA 1IBLQ 4DAPA 4A3JB 5IP7G 3E3XA 4RWSC 4ALPA 1ZEQX 4ZLTF 3QG1A 3VR3A 3I2ZA 2MHVA 1X3GA 2R7ZH 1PH1A 3I4MG 1FJGQ 2O4XA 3F2CA 3MWYW 3LWUA 4I7ZC 1WCMH 4ZCKA 1C0AA 3PIP3 1N34Q 5IP7H 1PYWD 1SYDA 3Q0AA 1HZCA 4KJNA 1PH8A 4K0KQ 4DV2Q 3TMEA 4GNXC 1SMYC 2H4OA 1G51A 2R92G 4CDFC 3Q22A 3PO3B 3A55A 4B3SQ 4MIUA 3AFQA 2JA8H 4ZRZA 4X3KA 4JI0Q 4FF4A 5C0XJ 1YNJD 3W1GA 4OELB 5LMUQ 1RF2D 3L0OA 2Z1CA 2N88A 4K14A 4KLKA 2F4VQ 1ZKOA 2WKCA 4BXXG 3J81j 2YYZA 1TWFB 2SOBA 2AMCB 1G6PA 2ID0A 3MXPA 5CV9A 1D7QA 3QB3A 4IQZA 1M8AA 2B8FA 1SE3A 1SE8A 2RCFA 1OXVA 4G57A 4M1UB 2KHJA 2FXQA 4A3IB 1B3AA 2IX0A 4R8NA 4DV7L 2F0PA 2NZOA 3CMEA 4JBWA 1UAPA 5ELBA 3FKIG 2FMCA 1B70B 1TWCH 2F0QA 2XVSA 4JBKA 2XIWA 4C3IH 5EGTA 4NDXA 3PMFA 3CF5A 1E2ZA 1PVOA 1N32Q 3U4ZA 1GJXA 1CA6A 2VS1A 4O42A 1XPUA 2NVYH 2QEJC 1LTLA 2VQFL 3A7AB 3OW2A 2R7FA 4DKAC 2JA9A 1D2BA 3S9WA 4I65A 4XT1B 1NE3A 1PFNA 2NVQH 2WB1B 3GTLH 3KDFA 2DN8A 2J7ZA 1OXSC 1KD1C 1MKHA 3MZ5A 1PRTC 2IL8A 1A2UA 1PTOF 3LX0A 3F2UA 1QNKA 1VQGA 1B53A 4FXKC 3VA5A 1K8AC 1WJJA 3WDNA 3HOVH 3T13A 4BY7G 2WFWA 4R4CA 4JI5Q 1S3OA 1C7YA 3A7LA 1KQSA 1V1OA 3EN2A 5C44H 2PQEA 3GTKB 3TZDA 1CT1D 3NSWA 3R2TA 1PHJA 2ZXPA 2N3SA 4HIOA 4K2KA 3IKJA 5M3MG 1U4PA 1NUCA 1I4HA 3JAME 2AWOA 4HTHA 5HGQA 5ELFA 1VMCA 1SFOH 1NNXA 3U50C 3UDGA 2XNAC 3TSSA 3M3YH 3E0JA 1LM0A 3PO3H 4OHJA 1PA6A 5DLQE 3PF4A 2G5DA 4GOPB 3K8AA 2K03A 5LMNL 5C3EB 3K0YA 2L0CA 1GKHA 3GD7A 4XYQA 2QF7A 3M9BA 3OPOA 4BBSH 4P2CB 2MUYA 4JI1L 1NY4A 2PZUA 1FD7D 5IP9G 1Y1WH 3K80C 1Q3LA 1EU3A 4F87A 5EAYA 2F0TA 2VY3A 4OO1G 3C1FA 3KJPA 3NK9A 4RGTA 2GVAA 3MXUA 3S2HH 3HKSA 3CCLA 1BBWA 1STNA 4KN7C 3A5ZB 1CZWA 3CHBD 3NE5B 4CDDC 4QY7A 2KQ3A 5FO7B 4PNYA 1OTCA 5M5XB 1KIXA 2RSOA 4DK1A 3IAYA 2NN6H 3K5LA 5M5YB 3FEWX 1PZID 3ND9A 3CCVA 3DLLA 1XNQL 1ONLA 4MN3A 1C9OA 1KNEA 3ULLA 2QDBA 4CJ0B 4IFDJ 3H6MA 2A6HC 4Y7NH 3AB9A 4KJOA 3L7ZC 2ES2A 4A3MH 3PUWA 1FL0A 2QW7A 1EYDA 2A68D 1GUWA 3UE1A 3K5OA 4LF7Q 1LO5D 2KENA 1C8CA 1TIID 1S72A 1KRTA 2UXBQ 1UWVA 1I4PA 4O0AA 4BS9A 4ZAIA 2PCFB 1ET6A 1J5EL 3PO2B 3UDIA 1BQQT 4K0KL 3WOFA 2R92B 1K8OA 2C35B 1BKBA 3I4OA 3L2PA 2PZTA 5E7NA 2IX1A 2M2LA 1YNJC 4IUVA 3QIAA 3KDFB 1W3SA 1PLFA 1EQQA 1NBWA 4JV5L 5BR8L 4ZUIA 4IZ8A 2NVTB 1F9SA 2YU9B 3EVQA 3DHQA 5J3BA 4HJ5A 1A2TA 1ESFA 3L9AX 1X9NA 4GLAC 3FKIB 4DV7Q 1KDCA 1H95A 2XWJB 3CRLC 2EJGC 4DK0A 4X3UA 4GN5A 3K57A 4ZUJA 1HNXL 2MNAA 1YHQA 1EY4A 3FP9A 1A3UA 1IHZA 1Q1BA 3D31A 1ILQA 2B2WC 1KXLA 3GP7A 1TS4A 2E74C 3C2PA 4GZYC 1HZAA 1EIFA 2E2IH 4KD3A 5CGKA 5LMNW 4BY1H 1EIHA 2KHIA 4LFCQ 4FP5D 3DXJC 4DV5Q 4J6HA 1WTOA 1WOCA 3KYHC 5I6WA 4L5SA 3KOJA 1TS2A 2A69D 5HURA 4IURA 4DUZL 2JP1A 2NZHA 3VYUA 4A3JG 3MHBA 2RA4A 5JEAG 1HRJA 2UXDL 4UHVA 2RBMA 1MIUA 5EBCA 2BDOA 5M3FG 2PW5A 2UU9L 2F52A 1BO0A 1R4QB 2C5CA 1I4GA 4A3CG 2JA5H 1BDOA 1HUMA 2H5XA 3VA7A 5E1FA 3AYHB 1ZXTA 1SYBA 2DNEA 1PH5A 1G91A 3A8IE 1L1OA 1Q81C 4OWTB 1PZJD
chains in the Genus database with same CATH topology
5C44B 3NTKA 4IUPA 1O78A 3GTGB 1QNUA 4C3JB 1Q90A 3I4NB 3N6RA 3RZOB 1SYEA 2DY7A 1UUPA 2EYJA 2QKIC 2B2YA 2FMMA 1SNDA 4G4KA 3GTLB 3NQIA 4NMZA 3D4WA 3EA6A 2JE6I 4KKUA 5C3WA 1RJTA 5C4JB 3ONAB 3GTJB 1AN8A 4BBSB 3FVQA 4KY7A 4OIKA 2E2IB 3HOYB 3BDOA 1KTKA 2NZ1D 1K83B 2NUCA 2KEDA 3S2DB 1GOZA 1BF4A 1HA5A 3MFYA 1SJED 4K8JA 2EYMA 1MD2D 4E6IA 4K2LA 4H44C 1IKLA 1MSHA 2FJ2A 3MFGA 4OO1I 1O7LA 4IUNA 3D6WA 2JA6B 5IODA 2KA7A 2XRSD 3RZDB 3BYYB 2PO4A 5M9OA 1HA6A 3HG9A 2XN9C 3H3VC 1SNCA 1SNPA 2TSSA 2EJMA 1BCPB 3GTPB 1QWYA 1S4ZA 1WTXA 2KECA 3S2HB 1STAA 2NWGA 2B2UC 1HQRD 1JOQA 2AQ1B 2F0FA 1ICWA 3KF8A 3O13A 2EY5A 4HSVA 5FKAC 4WJWA 1LLRD 1MSGA 1B1ZA 5G3LF 2WV6D 3K7AB 3E5SA 2IT1A 2J4XA 1SJHD 1MBYA 2ZT9C 5I4DA 2K1BA 3EFXD 2E2JB 1JOOA 1SFOB 1KABA 1HUNA 1EWHA 1DONA 3OOCA 4KKSA 2F0IA 4DFAA 4IALA 1MGSA 2TMPA 1PZKD 3C3LA 2HCIA 4DXGA 3DMUA 1VF5C 2C9OA 3J7AF 5K36G 3NBHA 4QMGA 4NP5A 4C56C 2R3ZA 1Z47A 1T5XD 1EU4A 4FXDA 1ZYRC 5E4XA 3RUZA 5CV4A 4RGOS 2B2YC 1FR3A 5C0XG 2NVYB 1QJOA 3HS0C 3GQBA 1EY6A 2F0SA 1F2YA 1V1PB 3QJYA 3KLRA 3L3OC 3HP3A 3GTMB 2K04A 2A68C 2IX3A 3PUXA 5IGCA 3GTQB 3PV0A 4LK1C 4IFDG 1BBXC 3RLFA 2RDGA 2Q8RE 3BVGA 1QB5D 4RCNA 2O5IC 1Z6HA 3NWSA 2FINB 4A93B 3HOVB 1SXTA 4TRDA 4FF1A 5CV8A 1IW7D 2F0DA 1JICA 4RH6A 4C3JG 3DM1A 1IYUA 5CMDA 2K33A 3BS1A 3NXWA 1H9RA 2F03A 1O80A 1GHKA 4ID6A 4U68A 3FDTA 2M00A 1F9QA 1S5DD 2EYFA 4CHTB 5EJWA 5FK9C 1TQOA 3M85A 3P1HA 1V1PA 4ZKBB 5KRUA 2PPBC 2NVXB 4EVOA 1LT5D 1FYCA 2BDNA 5K5PA 3QO2A 5T1IA 5KNBA 2B2VC 3AU7A 3I8ZA 1LV9A 3MXGA 1I4RA 3DEOA 3QOJA 4CKEA 1KNAA 2F0EA 1J8IA 2K28A 4N9TA 3ZYYX 4OIJA 4IUTA 4F7XA 2GA4B 2LFNA 1X32A 1J9OA 3NHHA 5FLXE 5FO8B 1PXUA 2EDGA 1IKMA 1Q12A 4HEDA 5ELCA 1A15A 2D62A 5EQ0A 2B63B 4XIGS 3AMUA 2L55A 5I2YA 4KMUC 2XWBB 1DM0B 1TU2B 5F2DA 2B2UA 4RCOA 3OWEB 1VF7A 4ME5A 1SNQA 2G9HD 1DOLA 4PMBA 4XXEA 1HQMC 1JWUD 4KK7A 3V05A 4J8QA 1HPCA 2M9VA 4HMIA 5ELDA 2A74C 5CBAE 4A3EB 5D3IB 3HEJA 5DEHA 3HOXB 2O2LD 1DZ1A 1TWGB 1ENCA 4FNFA 4RKBA 3TP5A 4JK1C 3KUPA 2K32A 3RD4A 5I9OA 1STYA 2L1BA 1E2WA 1YNND 5KNCA 5D14A 1DOMA 3G7LA 1JOKA 1D1IA 4RA8A 2KCCA 1NR4A 1Y1WB 2MP1A 3OMGA 4KI0A 2BA0A 4RAUC 2K5QA 4WORA 2WP8J 1LTSD 1OXXK 4HCEA 5A2QE 2BA1A 3T53B 1QG7A 4K6DA 1Y8PB 4ZYSA 3D6CA 4FF2A 1SEBD 1QOHA 5C3XA 1KLGD 4L6TB 4K5WA 2KJXA 1TT2A 2WINB 4PQXA 1LT4D 1PTOB 1EQVA 2L5TA 1Z7TA 3I90A 1GUGA 1LTID 4RGNA 1PMRA 1WVLA 3OSOA 1RODA 1Y8OB 1HCZA 5K36H 1DXMA 1AEXA 5EKKA 1TWAB 2I07B 1B2TA 3E6ZX 4BBRB 3NPPA 5JVH3 5ISRA 2IWHA 2EYOA 1R4PB 1XXGA 1BCPD 3A54A 3SHLA 2Q8IB 5IGDA 1DOKA 1EYAA 5JPMC 3JAML 1I6HB 3H91A 1BCPF 4Q0FA 1UEAB 3LWEA 1EL0A 5LL6X 3C46A 1RKNA 3EROA 5T1GA 5E4WC 1H9JA 1U9RA 3S16B 1TVXA 1JE4A 4OL7A 2E76C 1ZYRD 4F8MA 4KD4A 2R61A 3R2IA 1GXDC 5C6AA 2K7VA 3MXNA 1I50B 3I73A 3BDCA 1AZQA 4FYDA 2KHSA 5C0XH 2A69C 1X3QA 4B08A 1BXTA 4R8IA 3TP8A 2AUKA 2Z8LA 2L4NA 2F0OA 2E2HB 5KEEA 5FOBB 2SDFA 2EVBA 4HAEA 4IUUA 2IJ0A 2LY7A 5J1ZA 4BA2I 1U4RA 5IT9E 1S5BD 3J80L 1EQTA 1B50A 1FGBD 2QCPX 3EJIA 1ML0D 3HOWB 3NBIA 2JXMB 1EEID 2BE5C 3I3CA 3NUCA 4G7ZC 4X3SA 3HOZB 4XYOA 1JB3A 2K05A 2NB0A 2H1EA 1H9SB 1XWEA 4XQQA 1WTPA 4K5VA 2D5DA 5A35A 2F0WA 1D1KA 1LACA 4C3IG 1Y8NB 2OF1A 4DNRB 3I4LA 1HFGA 2IPKD 4L8JA 2O5JC 4DXFA 4PV1C 3M7GA 4BY1B 3S1QB 4ZKCB 1EY0A 5J39A 2F4IA 3U9SA 5JEAH 4AYBB 2EZVA 3J81L 2MJ8A 3FRPB 3VR2A 4C1NK 2RKSA 2XSCA 1LTBD 5M3MB 3PUVA 2JEAI 3IL8A 2RDFA 3P7JA 4CKBA 4V190 2F0LA 2CW0C 2HQEA 5CBEE 1BCPC 5IIFA 3I91A 3BG3A 2VNUD 1SAPA 2XRQD 2SEBD 1K8MA 4NKLA 3TDQA 4KN4C 3K5MA 4LAAA 4DAYA 3P20A 3ITPA 4S3SA 1I6VC 2ICIA 3S1RB 3SEBA 2FFKB 2X6LA 5FO9B 1IL8A 4UAIA 4BY7B 2R6GA 3OWFA 1AFPA 1SNOA 4G7HC 4KY5A 1HTPA 3S14B 4H7BA 3DWPA 1M4VA 3EQLC 3HZXA 4CGYB 1X3PA 5CR3A 4KHZA 1EFID 4K6LA 5C5MA 3M4OB 2KUMA 1PFMA 2LKVA 2SNSA 4WFN3 1T5EA 1D5MC 1BNZA 2JSOA 5C0XI 2ENBA 4B9XA 1OXUA 2PW7A 5LL6S 1HXYD 4ZQ3A 5JPNC 1CFMA 1G8ZD 2NTSA 2F0HA 3A8KE 3OHXC 1JC7A 1TY0A 4FF3A 2EYHA 1Y1VB 1NR2A 1AW7A 1EZ6A 3I4MB 2AQ3B 3VYRA 5D65A 5EPLA 3D4DA 1S5FD 1IYVA 2BE5D 2F3WA 4EGVA 2MPMA 2PYKA 4QB4A 4DGZA 3T56B 1UNSA 1S5ED 2Y0SB 5BN3A 1BOSA 4F88A 5CORA 5J22A 4A3MB 2A6ED 2IW3A 1F2LA 4HN7A 1JWSD 1C48A 3J7YW 1LABA 5CV5A 2KVMA 2NBFA 2B2WA 2E75C 3M7NA 2RVLA 3BVZA 1S5CD 3ERQA 3MC0B 2MGSA 1G6ZA 1SMYD 1STEA 1SDFA 1XTCD 1F77A 4M8AA 1DJRD 5NUCA 5C4XB 3KLSA 5AFWA 2L9HA 5CC4A 3CKIB 3K59A 2J0TD 2EY6A 1NAPA 3QWNA 3VYTA 1CM9A 5LHY1 3BDLA 1I4QA 3TBIB 1W6JA 2EOTA 4OGQC 5A2QL 2OXPA 1PFBA 1QCBD 1CZGA 4HMJA 1SBBB 4HCSA 3N52A 3Q6SA 1G2SA 1PTOD 5DM73 2CHBD 2EY1A 4LJZC 5C4HA 3J80E 3MVVA 3GV3A 4NW2A 4HSPA 4A3FB 4C3HB 1JCKB 2Z4IA 1CQFA 3G6JB 1WTQA 1XYIA 1IW7C 4QUFA 3SK8A 5KYLA 3T16A 1STBA 1CTMA 1WCMB 3OIQA 1RTNA 4H13C 1B4OA 1KAAA 1WD0A 2KOLA 3SK5A 1ENAA 3FPPA 2Q8TA 3OW7A 5EKLA 1G291 5IGGA 2VXWA 1OXTA 3KLSX 1XX8A 2L12A 2EY2A 5M3FB 5I9PA 3R93A 3TP6A 1DYQA 1ESRA 2PMZB 5FLXL 1CHQD 2F0JA 4MHEA 3GTOB 1EY7A 1YNNC 1H9MA 3D3RA 2OT2A 1PRTF 4EQOA 4FXGC 3DWAA 2DY8A 3OIPA 4X3TA 2F0GA 1F2MA 3GV6A 4B9WA 1E0BA 3NTIA 1TS3A 4CJ1B 3R3OA 1VMPA 2JA7B 3R8BA 1EZ8A 2RQXA 1B9MA 3NWTA 5JVG3 4XTCS 3ND8A 2A73B 3K5NA 3VR5A 4DNTB 1WTWA 1HHVA 3T51B 4XQNA 3Q23A 2LS01 1V43A 3DEPA 3J7AV 2LMCB 1Q1EA 3A56A 4RGMA 1Q8IA 3CU7A 2NN6G 2A5HA 2HCCA 5I2XA 3VR6A 2X69A 5EKIA 4QF4A 4C3HG 4IFDH 3MTSA 1LTTD 5JOBA 1D6EC 1JQYD 1B9NA 1U4MA 2WAQB 1LT3D 2A6EC 2RSNA 3T4AC 5JJZA 5BN4A 3BVMA 3M3YB 3SDZA 2VB2X 3BYTB 4XDXA 2I46A 3DWQA 1W6KA 5EPKA 4DF7A 1O7ZA 1D5ZC 3H0GB 5C5LA 1KLUD 3SK4A 5KNDA 2ICEC 1EYCA 4UDUC 2R93B 3W3AA 4C2MB 2D2CC 2HDMA 3HKZB 2R7ZB 1NSNS 2A6HD 5KYIA 4IN3A 1I3QB 3IFDA 3VR4A 3A8JE 1AZPA 1RTOA 3FPUB 1PTOH 2K6AA 1FNUA 1SE2A 3KBGA 1F9PA 4RKLA 5EPJA 2K01A 4EQNA 2VUMB 1V8QA 2G9DA 1SYCA 2PZWA 3QOLA 4L63B 1L0YB 1L0XB 3X3MA 1II3A 2JA5B 1LT6D 3D4RA 1ENFA 4C3IB 2DNCA 4FO2A 1FNWA 3OMCA 3TN2A 4G7OC 1DCZA 2NYZD 5DAUA 1QILA 4RHSA 2X6GA 3K6OA 3P75A 1A3TA 1SYFA 2L11A 1JORA 2EPBA 4YIJA 5BN5A 1GUNA 2F0VA 2N55A 3NTHA 5CV7A 1KDAA 2EJFC 4KY6A 4QIWB 2F0UA 1CK1A 5E3FA 4EQPA 5C4ZA 3D8GA 5KGUA 2B8GA 3X3NA 2EXZA 3PUYA 2WKDA 4PMWA 1PRTB 5COYA 4ABNA 3PUZA 4R9WA 3Q24A 1TWCB 3S1MB 5JAVA 2B2TA 3I70A 1PRTD 1C4QA 3UI2A 1DD2A 1JR0D 4XQJA 4J1MA 1G2TA 4O1NA 3FMCA 3SE0A 5DM63 3NQTA 5EBDA 3S1NB 2EYLA 4ZK9B 5I6YA 3J81E 1FNVA 3MEHA 4DA2A 3SVMA 2CQAA 1CI3M 2WACA 1HFNA 4V0BA 4TQUS 4CKCA 5G3LD 3KK7A 4KKTA 2CVRA 2KEEA 4Y7NB 2E2DC 4U673 3WOEA 2V4DA 3W2DA 1HTLD 2PNRC 4IUQA 1RHPA 1BR9A 4ILWA 1EY5A 1KDBA 1RCVD 4LMQD 2K5WA 3IFTA 1EWCA 1RD9D 3HOUB 2HUGA 5IGFA 1CQVA 4IFDI 2K5DA 4Z9CB 2FHTA 1A6XA 4PMCA 1R9TB 4FVMA 3HRZC 1VCIA 1I4XA 3S17B 1H9SA 3GO5A 2CW0D 2HDLA 2F0KA 1B44D 4Q5VA 1TR5A 4HR7B 2EYPA 5IT9L 2BOSA 4A3BB 4K5XA 5D3DA 3MAQA 3V2TA 3VYSA 2JYOA 1EEFD 4CBVA 2NTTA 4DN4M 1EY9A 5M5WB 3BZDB 5DNFA 2B39A 4A3KB 4CJ2C 3PIO3 4KTAA 1O7YA 2AUJD 4OO1H 1SNMA 4RHRA 1STGA 3KBXA 3M4YA 4ULLA 4TSSA 2NVQB 5KIXA 1PDQA 2RDHA 2EE1A 1TY2A 5IGBA 1GUOA 5CV6A 3TZUA 1WTVA 3CQZB 1GUSA 4DAVA 1D5XC 1LTGD 1LTRD 4BWGB 1TKWB 4DU9A 4A3GB 4QUCA 1H9KA 2ZXOA 3H09A 1AP0A 3CRKC 3U9OA 1NCVA 2AWNA 3RMHA 2JEBI 2B2TC 2F3VA 2D9UA 2JA8B 1JWMD 1TWHB 2Z4HA 3C1EA 5TSSA 1SYGA 1RDPD 1OO9B 2B2VA 2VB3X 1A3VA 3SK6A 2BCOA 4BA1I 2WIIB 4TKOB 1BUVT 2OEOA 1GHJA 4XT3B 4ODGA 1STHA 2QILA 1ET9A 5IGEA 1CA5A 4QCLA 4C1NI 4A3DB 1E2VA 3DUZA 5HGTA 1EY8A 4H0LC 3K58A 3LNNA 1SSOA 5CYUA 3NP8A 1F9RA 1PTOC 1WD1A 3I72A 1CHPD 3H94A 4KV6A 1SE4A 2F0NA 3MA2B 5IOCA 4WRDA 3SR1A 1LTAD 2ZXRA 3URYA 1Y69U 4RFBA 1VDZA 1ILPA 1QE6A 1GUTA 3SXHA 1EOTA 3TP7A 1TS5A 2F1MA 3S15B 2SNMA 1MI2A 2AQ2B 2KCNA 2F0MA 1U4LA 2NN6I 4K8IA 1EIGA 4N9PA 3V96A 4KHVA 1WTRA 3HGBA 1F2ZA 5JEAJ 5ELEA 4DAPA 4A3JB 4RWSC 1ZEQX 4ZLTF 3QG1A 3VR3A 2MHVA 2O4XA 3MWYW 3LWUA 4I7ZC 3PIP3 1PYWD 1SYDA 3Q0AA 4KJNA 3TMEA 1SMYC 2H4OA 3PO3B 3Q22A 3A55A 4MIUA 4ZRZA 4X3KA 4FF4A 5C0XJ 1YNJD 1RF2D 4K14A 2Z1CA 2N88A 1ZKOA 2WKCA 2YYZA 1TWFB 2SOBA 2ID0A 3MXPA 5CV9A 3QB3A 4IQZA 1M8AA 2B8FA 1SE3A 1OXVA 4G57A 4M1UB 4A3IB 1B3AA 2IX0A 4R8NA 2F0PA 4JBWA 1UAPA 5ELBA 2FMCA 2F0QA 2XVSA 2XIWA 5EGTA 4NDXA 3PMFA 1E2ZA 1GJXA 1CA6A 4O42A 2QEJC 3A7AB 1D2BA 3S9WA 4I65A 4XT1B 1PFNA 2WB1B 2DN8A 2J7ZA 1OXSC 3MZ5A 1PRTC 2IL8A 1A2UA 1PTOF 3LX0A 3F2UA 1QNKA 1B53A 4FXKC 3VA5A 3WDNA 3T13A 3A7LA 1V1OA 2PQEA 3GTKB 3TZDA 1CT1D 3NSWA 3R2TA 2ZXPA 4K2KA 3IKJA 1U4PA 1NUCA 1I4HA 3JAME 2AWOA 4HTHA 5ELFA 1VMCA 2XNAC 3TSSA 3E0JA 4OHJA 2K03A 5C3EB 3K0YA 2L0CA 3GD7A 4XYQA 2QF7A 3OPOA 4P2CB 2MUYA 2PZUA 1FD7D 1Q3LA 1EU3A 4F87A 2F0TA 4OO1G 3C1FA 3NK9A 4RGTA 3MXUA 1STNA 4KN7C 1CZWA 3CHBD 3NE5B 2KQ3A 5FO7B 4PNYA 5M5XB 2RSOA 4DK1A 3IAYA 2NN6H 3K5LA 5M5YB 3FEWX 1PZID 3ND9A 1ONLA 4MN3A 1KNEA 2QDBA 4CJ0B 4IFDJ 3H6MA 2A6HC 3AB9A 4KJOA 3L7ZC 3PUWA 1EYDA 2A68D 1GUWA 3K5OA 1LO5D 1C8CA 1TIID 1I4PA 4BS9A 4ZAIA 2PCFB 1ET6A 3PO2B 1BQQT 3WOFA 2R92B 1K8OA 2PZTA 2IX1A 2M2LA 1YNJC 4IUVA 3QIAA 1PLFA 4ZUIA 4IZ8A 2NVTB 1F9SA 2YU9B 3EVQA 3DHQA 1A2TA 1ESFA 3L9AX 3FKIB 1KDCA 2XWJB 3CRLC 2EJGC 4DK0A 4X3UA 3K57A 4ZUJA 1EY4A 1A3UA 1IHZA 1Q1BA 3D31A 1ILQA 2B2WC 3GP7A 1TS4A 2E74C 3C2PA 4GZYC 4KD3A 5CGKA 1EIHA 4FP5D 3DXJC 4J6HA 1WTOA 5I6WA 1TS2A 2A69D 5HURA 4IURA 2JP1A 3VYUA 3MHBA 2RA4A 5JEAG 1HRJA 2RBMA 5EBCA 2BDOA 2PW5A 1BO0A 1R4QB 2C5CA 1I4GA 1BDOA 1HUMA 3VA7A 5E1FA 1ZXTA 1SYBA 2DNEA 1G91A 3A8IE 1PZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9P A;  4LAA A;  4KHV A;  3NUC A;  5ISR A;  4DU9 A;  1EY5 A;  1KDB A;  2EYO A;  1EYD A;  1F2Z A;  3ITP A;  3MZ5 A;  3OMC A;  4S3S A;  3T16 A;  1STB A;  1A2U A;  3E5S A;  3HEJ A;  3NXW A;  5DEH A;  5CV5 A;  3LX0 A;  3U9O A;  5DAU A;  1SYE A;  3VA5 A;  1ENC A;  3T13 A;  2EYJ A;  4ID6 A;  4RKB A;  3SHL A;  3TP5 A;  3P75 A;  1A3T A;  1JOO A;  1KAA A;  1SYF A;  2M00 A;  1KAB A;  3OWF A;  3SK5 A;  5IGD A;  1ENA A;  2EYF A;  5IGF A;  1SNO A;  1JOR A;  1SND A;  4KY5 A;  1TQO A;  2PQE A;  4PMC A;  2F3V A;  1EYA A;  4YIJ A;  5I9O A;  2F0V A;  1STY A;  2F0I A;  2O4X A;  3P1H A;  2PZT A;  5EKL A;  3C1E A;  4DFA A;  1SYG A;  5CV7 A;  3ERQ A;  5IGG A;  1KDA A;  4NMZ A;  3D4W A;  4IAL A;  5KRU A;  4QF4 A;  4K5V A;  4H7B A;  4K2K A;  1A3V A;  4KY6 A;  4EVO A;  2F0K A;  1SYD A;  2F0W A;  1NUC A;  3SK6 A;  4KJN A;  2F0U A;  3DMU A;  5C3W A;  5JOB A;  5E3F A;  1TR5 A;  4HTH A;  4ZUI A;  4IZ8 A;  3TME A;  1JOK A;  2OF1 A;  2EYP A;  5K5P A;  3EVQ A;  1RKN A;  3ERO A;  3HZX A;  4KY7 A;  3DHQ A;  1A2T A;  2OEO A;  4QMG A;  2EY2 A;  5CR3 A;  4MIU A;  4NP5 A;  4K5X A;  4EQP A;  5I9P A;  3OMG A;  5NUC A;  5C4Z A;  3D8G A;  3TP6 A;  5KGU A;  3V2T A;  4K5W A;  4ODG A;  1EY0 A;  2NUC A;  3QOJ A;  1KDC A;  5C5M A;  1STH A;  3RUZ A;  5CC4 A;  5CV4 A;  2F0E A;  2LKV A;  1U9R A;  2SNS A;  5J39 A;  4WOR A;  5IGE A;  2EXZ A;  4K8J A;  4ZUJ A;  4K14 A;  1EY4 A;  2F0J A;  4N9T A;  4OL7 A;  4DF7 A;  4F8M A;  2EYM A;  2EY6 A;  1A3U A;  4E6I A;  1IHZ A;  1EY7 A;  4K2L A;  5C5L A;  4KD4 A;  4F7X A;  2ENB A;  3SK4 A;  4B9X A;  5IOC A;  2SOB A;  5C6A A;  3BDL A;  1EYC A;  2PZU A;  3MXP A;  1EY6 A;  3QB3 A;  5CV9 A;  1EY9 A;  3NHH A;  2PW7 A;  5HGT A;  1EY8 A;  2F0S A;  5JAV A;  4ZQ3 A;  2RKS A;  1F2Y A;  2OXP A;  3BDC A;  2F0T A;  4KD3 A;  5CGK A;  4EQO A;  2F0H A;  3C1F A;  3NP8 A;  3NK9 A;  2KHS A;  4G57 A;  4J1M A;  4IUN A;  4K6D A;  4J6H A;  4HMJ A;  1NSN S;  4R8N A;  1STN A;  3NQT A;  2EYH A;  5KYI A;  4KTA A;  2F0P A;  3TP8 A;  2F0G A;  2EYL A;  3D6C A;  4KV6 A;  5I6W A;  5HUR A;  5IGC A;  5IOD A;  1EZ6 A;  1F2M A;  2F0O A;  5I6Y A;  5KEE A;  4B9W A;  3MEH A;  2EY1 A;  5C3X A;  2RDF A;  5M9O A;  3R3O A;  5C4H A;  2KQ3 A;  1SNM A;  2F0L A;  2F0N A;  2F0Q A;  3D4D A;  1SNC A;  1SNP A;  1STG A;  3MHB A;  3MVV A;  2HQE A;  4PNY A;  4WRD A;  1TT2 A;  3SR1 A;  1EZ8 A;  5EGT A;  4RKL A;  2F3W A;  2RBM A;  4NDX A;  1EQV A;  2PW5 A;  1STA A;  5KIX A;  4EQN A;  2PYK A;  4QB4 A;  5F2D A;  5J1Z A;  4DGZ A;  5IIF A;  2WAC A;  3PMF A;  3SXH A;  5IGB A;  1SYC A;  2PZW A;  3QOL A;  5CV6 A;  3OSO A;  3TP7 A;  1JOQ A;  2F0F A;  4ME5 A;  1SNQ A;  1AEX A;  2SNM A;  4TRD A;  5E1F A;  5EKK A;  1II3 A;  4NKL A;  1SYB A;  4PMB A;  3EJI A;  2F0M A;  3S9W A;  2QDB A;  5CV8 A;  4I65 A;  5J22 A;  2EY5 A;  3H6M A;  2F0D A;  4K8I A;  3SK8 A;  5KYL A;  4HMI A;  4KJO A; 
#chains in the Genus database with same CATH topology
 2UXC Q;  2OTL A;  5C44 B;  3NTK A;  4IUP A;  1O78 A;  3GTG B;  1QNU A;  1XNQ Q;  4C3J B;  1UE7 A;  1Q90 A;  3I4N B;  3N6R A;  3RZO B;  1SYE A;  2DY7 A;  1UUP A;  2EYJ A;  1L2F A;  2QKI C;  3I4M H;  2BH8 A;  2B2Y A;  2FMM A;  1SND A;  3S17 H;  2K4K A;  4G4K A;  3GTL B;  3NQI A;  1PFS A;  4IPG A;  3K7A H;  4NMZ A;  3D4W A;  3EA6 A;  2JE6 I;  1X6O A;  4X65 L;  3CCU A;  4KKU A;  1PH4 A;  5C3W A;  1RJT A;  4HIK A;  5C4J B;  3ONA B;  3GTJ B;  1AN8 A;  4BBS B;  3FVQ A;  4IPD A;  4KY7 A;  4A3F G;  4OIK A;  2E2I B;  3HOY B;  3BDO A;  1KTK A;  2NZ1 D;  1K83 B;  2NUC A;  2KED A;  3S2D B;  1AE3 A;  1GOZ A;  1BF4 A;  1K73 C;  1HA5 A;  3MFY A;  1SJE D;  4HJ9 A;  4K8J A;  1JJC B;  2EYM A;  1MD2 D;  4E6I A;  4JOI C;  4K2L A;  2B29 A;  4H44 C;  3RN5 A;  1IKL A;  1MSH A;  2FJ2 A;  3MFG A;  1P16 A;  3GTM H;  4WJ3 M;  4OO1 I;  1O7L A;  1EUJ A;  4IUN A;  3D6W A;  2CH4 A;  2JA6 B;  1I5F A;  5IOD A;  2KA7 A;  3EIV A;  4QQB X;  2XRS D;  3RZD B;  3BYY B;  2PO4 A;  5M9O A;  1HA6 A;  3HG9 A;  2XN9 C;  1VQJ A;  3H3V C;  1SNC A;  1SNP A;  2TSS A;  2EJM A;  1BCP B;  3KF6 A;  4DV5 L;  4HID A;  1HNW L;  3GTP B;  1QWY A;  2K50 A;  1S4Z A;  5IYD H;  1WTX A;  3CD6 A;  2KEC A;  4YY3 L;  3S2H B;  1STA A;  2NWG A;  1N36 Q;  4EX5 A;  2B2U C;  1HQR D;  1JOQ A;  2AQ1 B;  2F0F A;  1ICW A;  4DR4 Q;  3RNU A;  3BU2 A;  3KF8 A;  2PNH A;  3O13 A;  2EY5 A;  4HSV A;  5FKA C;  4WJW A;  1LLR D;  3MEF A;  1MSG A;  1B1Z A;  5G3L F;  2WV6 D;  3K7A B;  1XPR A;  3E5S A;  4JBM A;  2IT1 A;  2J4X A;  1KL9 A;  3CPF A;  3UDX A;  3CPW A;  3CC7 A;  4L5R C;  1E3P A;  4C3H H;  1SJH D;  1MBY A;  2ZT9 C;  5I4D A;  2K1B A;  3EFX D;  2E2J B;  1JOO A;  1SFO B;  3HOX G;  1MHW C;  1KAB A;  1HUN A;  2VL6 A;  1EWH A;  4JI0 L;  2K75 A;  1VQH A;  1DON A;  3OOC A;  4LF5 Q;  4KKS A;  2F0I A;  4DFA A;  2N78 A;  2OQK A;  4IAL A;  1MGS A;  3F2B A;  2TMP A;  1HJP A;  3STB D;  1PZK D;  5FJ8 H;  3C3L A;  2HCI A;  4DXG A;  3RN2 A;  3HOU H;  3DMU A;  4AQY L;  5JJL A;  3CAM A;  1VF5 C;  2C9O A;  3J7A F;  5K36 G;  3NBH A;  4QMG A;  4NP5 A;  4C56 C;  2Z6K C;  2R3Z A;  4GNX B;  1Z47 A;  4ME3 A;  1T5X D;  3KF6 B;  4X65 Q;  1EU4 A;  4FXD A;  4JI8 Q;  2I0Q A;  1ZYR C;  5E4X A;  3PCO B;  3RUZ A;  3GTO H;  5CV4 A;  4RGO S;  2B2Y C;  1FR3 A;  5C0X G;  2NVY B;  1HR0 W;  1QJO A;  1AH9 A;  3HS0 C;  1SRO A;  3U4V A;  4DV6 L;  1VQ9 A;  3GQB A;  4DV2 L;  4YCV A;  1EY6 A;  2F3I A;  4A3L G;  2F0S A;  3BZC A;  1F2Y A;  1V1P B;  3QJY A;  3KLR A;  3L3O C;  3HKZ E;  3HP3 A;  1WTH A;  2Y0S G;  3GTM B;  2K04 A;  4DV0 Q;  4JC0 A;  1WFQ A;  2A68 C;  2IX3 A;  3PUX A;  5IGC A;  3CP0 A;  1VQD A;  3GTQ B;  3PV0 A;  4LK1 C;  1E7Z A;  4IFD G;  4BXX H;  1BBX C;  3RLF A;  4A3B G;  4R4I A;  2RDG A;  4JI1 Q;  1ICF B;  4DR1 Q;  2Q8R E;  2LXK A;  3BVG A;  1QB5 D;  2UUA Q;  4RCN A;  2O5I C;  1Z6H A;  3NWS A;  2FIN B;  4A93 B;  1VQ7 A;  2JK8 A;  3HOV B;  1SXT A;  1QVF A;  4TRD A;  1JMC A;  4FF1 A;  5CV8 A;  1SN8 A;  1IW7 D;  2F0D A;  1JIC A;  2K52 A;  1GM5 A;  4RH6 A;  4C3J G;  3DM1 A;  1IYU A;  4IPC A;  1KHI A;  5CMD A;  4X64 L;  2K33 A;  3BS1 A;  1X55 A;  1VQ6 A;  3NXW A;  1VQK A;  1H9R A;  3CCM A;  2F03 A;  1O80 A;  1GHK A;  4ID6 A;  4U68 A;  3FDT A;  2M00 A;  3S1M H;  4B3S L;  1F9Q A;  1S5D D;  4DR4 L;  2EYF A;  4CHT B;  5EJW A;  4B3R L;  5FK9 C;  4BBR H;  1TQO A;  3M85 A;  3P1H A;  1V1P A;  4ZKB B;  5KRU A;  2PPB C;  3S1N H;  4LW1 A;  2NVX B;  4EVO A;  1EWI A;  1LT5 D;  4DAY B;  4JG2 A;  1FYC A;  3AQQ A;  2BDN A;  4J15 A;  4JI2 L;  2IHF A;  2JA7 H;  4CDC C;  5K5P A;  3QO2 A;  5T1I A;  5KNB A;  2B2V C;  3AU7 A;  3I8Z A;  1LV9 A;  1VQA A;  3MXG A;  1I4R A;  2WB1 E;  3DEO A;  4IOC A;  3QOJ A;  2R7D A;  4CKE A;  1KNA A;  2F0E A;  4UPA A;  1IBM L;  2MO1 A;  1J8I A;  3NEL A;  4A3G H;  2QGQ A;  2K28 A;  4N9T A;  3ZYY X;  5C3E H;  4OIJ A;  4IUT A;  3T1H Q;  4F7X A;  2ASB A;  1DGS A;  2GA4 B;  4QGU A;  2LFN A;  3KLW A;  4AQY Q;  2HT1 A;  4JYA L;  1X32 A;  1J9O A;  3NHH A;  5FLX E;  5FO8 B;  1PXU A;  1NTG A;  4N8X 1;  2EDG A;  1IKM A;  1HNX Q;  1Q12 A;  2KBN A;  4LF8 Q;  4HED A;  5ELC A;  1A15 A;  1SRU A;  2D62 A;  1YIT A;  3S14 H;  3CW2 C;  5EQ0 A;  2B63 B;  4XIG S;  1UE5 A;  2JN4 A;  3AMU A;  2L55 A;  5I2Y A;  1R9T H;  4KMU C;  1Q82 C;  2XWB B;  3HOZ G;  1DM0 B;  1TU2 B;  5F2D A;  2B2U A;  2Q2I A;  4RCO A;  2OWO A;  3OWE B;  1PH7 A;  1VF7 A;  2R7Z G;  1TWA H;  4ME5 A;  1EFW A;  2YU9 H;  1SNQ A;  2G9H D;  1DOL A;  4O2D A;  4PMB A;  4XXE A;  2XTI A;  1HQM C;  1JWU D;  4KK7 A;  3V05 A;  4J8Q A;  1QZG A;  1HPC A;  2M9V A;  4HMI A;  5ELD A;  2A74 C;  5CBA E;  4A3E B;  1YNX A;  5D3I B;  2VUM H;  3HEJ A;  5DEH A;  3STB C;  3HOX B;  1QUQ A;  2O2L D;  2DJF C;  2JA6 H;  3M4Q A;  1DZ1 A;  3S15 H;  1TWG B;  1ENC A;  4FNF A;  4RKB A;  3TP5 A;  4JK1 C;  2WB1 G;  2IHE A;  4X62 L;  3KUP A;  1YIJ A;  4IOA A;  1IZ6 A;  2K32 A;  3RD4 A;  5I9O A;  1STY A;  2L1B A;  1E2W A;  1YNN D;  1Y1V H;  5KNC A;  3WWV A;  2B63 H;  1BBU A;  1X3F A;  5D14 A;  1DOM A;  3G7L A;  1JOK A;  1D1I A;  4RA8 A;  4AYB G;  2KCC A;  1NR4 A;  1YBY A;  4L5T A;  3J81 c;  2MP1 A;  1Y1W B;  3PQI A;  3OMG A;  4KI0 A;  4LWC A;  5ELN A;  4JW0 A;  4DPG A;  4HJ8 A;  4LFB L;  4YCW A;  2BA0 A;  4RAU C;  2K5Q A;  4WOR A;  2WP8 J;  1LTS D;  2K5H A;  1OXX K;  4HCE A;  2ZTC A;  5A2Q E;  2I5L X;  2E2J H;  2N8N A;  2BA1 A;  1A8V A;  4IPH A;  4YHH L;  1PH9 A;  2HHH Q;  3CCS A;  3T53 B;  1QG7 A;  4K6D A;  1Y8P B;  4ZYS A;  3RZD H;  2RF4 A;  3D6C A;  2PQA B;  3D0F A;  4FF2 A;  1QUQ B;  1L1O B;  1QOH A;  1SEB D;  4P75 A;  1U0L A;  5C3X A;  1KLG D;  4L6T B;  5IWA Q;  4K5W A;  2JA7 G;  2KJX A;  4HIM A;  1TT2 A;  2WIN B;  4PQX A;  1LT4 D;  1PTO B;  1CUK A;  3BJU A;  1CKM A;  1EQV A;  2L5T A;  3I4N G;  1Z7T A;  3I90 A;  4X66 Q;  1GUG A;  1LTI D;  4RGN A;  1PMR A;  2DJG C;  1WVL A;  3OSO A;  1ROD A;  1Y8O B;  1HCZ A;  5K36 H;  1DXM A;  1AEX A;  5EKK A;  4B3R Q;  5ELO A;  1TWA B;  2I07 B;  1B2T A;  1QZH A;  3E6Z X;  4BBR B;  1YHA A;  3NPP A;  5JVH 3;  5ISR A;  1J5E Q;  3H3V I;  2IWH A;  2EYO A;  3J7A 5;  1R4P B;  4PZ8 A;  1XXG A;  1VQP A;  1BCP D;  4LF6 L;  4JI2 Q;  3A54 A;  3SHL A;  2Q8I B;  3HOV G;  3PO2 G;  4BY7 H;  5IGD A;  1DOK A;  1VQM A;  1VQB A;  4A93 G;  2PI2 A;  2ZTD A;  1EYA A;  5JPM C;  3JAM L;  1I6H B;  2UUB Q;  3H91 A;  1BCP F;  4Q0F A;  4LF4 L;  1UEA B;  3LWE A;  3RLO A;  3TQY A;  1EL0 A;  5LL6 X;  5LMU L;  3C46 A;  1RKN A;  3ERO A;  5T1G A;  2KCM A;  2ZM6 L;  2EXD A;  5E4W C;  1H9J A;  3NBH B;  4UP7 A;  5JJK A;  1U9R A;  3E9H A;  3S16 B;  1TVX A;  1JE4 A;  2Z0S A;  4OL7 A;  2E76 C;  1ZYR D;  4F8M A;  4KD4 A;  3CC4 A;  3HOZ H;  2R61 A;  3R2I A;  1GXD C;  1JJG A;  5C6A A;  2K7V A;  3MXN A;  1I50 B;  1IXR A;  3I73 A;  1NMF A;  3BDC A;  1AZQ A;  4GOP A;  3NEM A;  4FYD A;  2KHS A;  5C0X H;  2A69 C;  4LNQ A;  1X3Q A;  4B08 A;  1BXT A;  4R8I A;  3TP8 A;  2AUK A;  2Z8L A;  2L4N A;  2F0O A;  2E2H B;  5KEE A;  3ULP A;  5FOB B;  1FGU A;  1E24 A;  1HZ9 A;  5M5W H;  2SDF A;  1JE5 A;  1SLJ A;  2EVB A;  2YTY A;  4HAE A;  4IUU A;  5M3M H;  2IJ0 A;  5C3E G;  2LY7 A;  5J1Z A;  4BA2 I;  1HZB A;  4OWW B;  1U4R A;  5IT9 E;  1S5B D;  2CWA A;  3J80 L;  1EQT A;  1B50 A;  4OON A;  1FGB D;  3ER0 A;  2QCP X;  3EJI A;  1ML0 D;  3HOW B;  3NBI A;  2JXM B;  1EEI D;  2BE5 C;  3I3C A;  3NUC A;  4G7Z C;  1VQL A;  4X3S A;  1I94 L;  3HOZ B;  4IJL A;  4XYO A;  1JB3 A;  3H3V H;  2K05 A;  1WYD A;  2NB0 A;  4B3T L;  2H1E A;  3ULJ A;  1H9S B;  5M3F H;  1XWE A;  3F1Z A;  4XQQ A;  4LF7 L;  4DR3 Q;  3I56 A;  2UXB L;  4DV1 Q;  4A75 A;  1WTP A;  2JJQ A;  4K5V A;  3G4S A;  2D5D A;  5A35 A;  2F0W A;  2HQL A;  5IYD G;  1D1K A;  1LAC A;  4C3I G;  1Y8N B;  2OF1 A;  1YZ6 A;  4DNR B;  3I4L A;  1TWF H;  1HFG A;  2IPK D;  4L8J A;  2O5J C;  4DXF A;  5IYB G;  4PV1 C;  1I6H H;  4NB3 A;  3FHW A;  3M7G A;  2I5M X;  1L0W A;  4BY1 B;  4ZKC B;  3JAM i;  3S1Q B;  1EY0 A;  4JPB W;  4R4O A;  2F4I A;  5J39 A;  3U9S A;  5JEA H;  4AYB B;  2EZV A;  3J81 L;  4LF9 L;  2MJ8 A;  3FRP B;  1TWG H;  1Y14 B;  3VR2 A;  4C1N K;  3G6E A;  4OWX B;  2RKS A;  4A3B H;  4YY3 Q;  2ZM6 Q;  2XSC A;  5IYB H;  1LTB D;  5M3M B;  2L15 A;  3PUV A;  2JEA I;  4X66 L;  3IL8 A;  2RDF A;  2R92 H;  3P7J A;  4CKB A;  2E2H H;  4V19 0;  2F0L A;  2CW0 C;  5IE8 A;  5AJ3 Q;  3GTQ H;  1CKN B;  2HQE A;  5CBE E;  2B63 G;  1BCP C;  5IIF A;  4TVA B;  4QL5 A;  3I91 A;  1RL2 A;  3BG3 A;  2VNU D;  1SAP A;  2XRQ D;  4UY8 C;  2SEB D;  1K8M A;  4NKL A;  3TDQ A;  2CCZ A;  4MTN A;  2E5L Q;  4DUZ Q;  2Z6K A;  4KN4 C;  3K5M A;  4JI5 L;  4LAA A;  4DR1 L;  4DAY A;  3P20 A;  2VQE Q;  3ITP A;  2ZJR A;  4S3S A;  1UE6 A;  1Q7Y C;  1I6V C;  2ICI A;  2UXD Q;  3S1R B;  2LXJ A;  3SEB A;  2FFK B;  2X6L A;  4LUO A;  5FO9 B;  1IL8 A;  4UAI A;  4BY7 B;  2R6G A;  1I3Q H;  4OX9 L;  3OWF A;  2E8G A;  1AFP A;  1SNO A;  4G7H C;  4KY5 A;  1GD7 A;  2ZTE A;  4GKK L;  1K0S A;  2QDL A;  4A3E H;  1HTP A;  4LFA L;  4X64 Q;  4A3I G;  4H7B A;  3DWP A;  3S14 B;  4DV6 Q;  2Z6B A;  3QR8 A;  3K7U C;  4JYA Q;  1M4V A;  3EQL C;  3HZX A;  4CGY B;  3IRB A;  2HD3 A;  1X3P A;  5CR3 A;  4GOP C;  4X62 Q;  3B6Y A;  4KHZ A;  1EFI D;  1T9H A;  4K6L A;  1N34 L;  2PMZ E;  1YJN A;  5C5M A;  3M4O B;  2KUM A;  1PFM A;  2LKV A;  2SNS A;  4WFN 3;  1T5E A;  2K5V A;  1D5M C;  1BNZ A;  2JSO A;  4DAM A;  5C0X I;  3GTJ H;  1I50 H;  2ENB A;  4NPS A;  4UP8 A;  4B9X A;  1OXU A;  1SR3 A;  4GKJ Q;  2PW7 A;  5LL6 S;  1HXY D;  4ZQ3 A;  4RMF A;  5JPN C;  1PV4 A;  4AIM A;  1CFM A;  2EIF A;  1G8Z D;  4PZ6 A;  2NTS A;  2F0H A;  3A8K E;  3UE0 A;  1VQO A;  3OHX C;  3S16 H;  1XMQ L;  1JC7 A;  3H15 A;  1JB7 A;  1TY0 A;  4FF3 A;  2EYH A;  3AFP A;  1Y1V B;  1NR2 A;  1AW7 A;  1EZ6 A;  4DR2 L;  3I4M B;  2AQ3 B;  3VYR A;  3A0J A;  2ATW A;  5D65 A;  3KFU A;  5EPL A;  3D4D A;  1N33 Q;  1S5F D;  1IYV A;  2BE5 D;  2F3W A;  4EGV A;  3GTG H;  3Q8D A;  2RHQ B;  2MPM A;  2PYK A;  4QB4 A;  2HHH L;  4DGZ A;  1YJW A;  3S1R H;  3PO3 G;  3HOX H;  3T56 B;  4DR6 L;  1S5E D;  1UNS A;  2Y0S B;  4LF8 L;  3PGZ A;  5BN3 A;  1N33 L;  1QVC A;  1BOS A;  4F88 A;  3OTO Q;  5COR A;  5J22 A;  4A3M B;  2A6E D;  2IW3 A;  2P5Z X;  1XMO L;  3M4P A;  1F2L A;  4HN7 A;  1N36 L;  4RG1 A;  1JWS D;  1HNW Q;  1C48 A;  3K0X A;  5L37 A;  1X65 A;  3CCJ A;  1EQR A;  3J7Y W;  1LAB A;  5CV5 A;  3OYY A;  2KVM A;  4AYB E;  4R4Q A;  4P73 A;  2VQF Q;  1HNZ Q;  1K9M C;  3CC2 A;  2YTX A;  2NBF A;  1MJE A;  2B2W A;  1XJV A;  1AE2 A;  2E75 C;  3M7N A;  2RVL A;  3BVZ A;  1S5C D;  3ERQ A;  3MC0 B;  2MGS A;  4YWL A;  4X6A H;  1G6Z A;  2VUM G;  1SMY D;  1STE A;  1GO3 E;  3CCR A;  1SDF A;  1XTC D;  2VW9 A;  1CSQ A;  4GKK Q;  1F77 A;  4LF9 Q;  4M8A A;  4YWM A;  4JCV E;  1DJR D;  5NUC A;  5GAE C;  5C4X B;  1IYJ B;  3KLS A;  5AFW A;  2L9H A;  5CC4 A;  4DUY Q;  1JT8 A;  4JI6 L;  1U5K A;  3CKI B;  3K59 A;  2J0T D;  1EYG A;  5FLM H;  2EY6 A;  1NAP A;  3QWN A;  2NVT H;  4QJF A;  3VYT A;  4GN3 B;  1CM9 A;  5LHY 1;  4A3L H;  3BDL A;  1I4Q A;  3TBI B;  1W6J A;  2EOT A;  1K28 A;  4OGQ C;  5A2Q L;  4BBS G;  2OXP A;  3ZJY C;  4JI6 Q;  1PFB A;  2ZJQ A;  3F8T A;  1QCB D;  2GN5 A;  1CZG A;  4HMJ A;  1SBB B;  4HCS A;  3N52 A;  3Q6S A;  1G2S A;  3W5O A;  1PTO D;  1PYB A;  2CFM A;  5DM7 3;  2CHB D;  1NMG A;  2EY1 A;  4BY1 G;  5M5X H;  4LJZ C;  5C4H A;  3J80 E;  2CH4 W;  3MVV A;  2V1C C;  3HKZ G;  4JI3 Q;  3GV3 A;  3J7Z C;  4NW2 A;  4HSP A;  3GTP H;  4A3F B;  3HOW G;  2UXC L;  2D0P A;  4C3H B;  1JCK B;  4GS3 A;  2Z4I A;  4DV4 Q;  1CQF A;  3G6J B;  1WTQ A;  3E9I A;  1K3B C;  1XYI A;  1IW7 C;  4NXN Q;  1A62 A;  1CSP A;  4JBJ A;  3SK8 A;  4QUF A;  5KYL A;  3T1Y L;  3K81 C;  4LF4 Q;  1A0I A;  3T16 A;  1STB A;  1CTM A;  4DV4 L;  4A93 H;  1WCM B;  3OIQ A;  1RTN A;  4FDB A;  4H13 C;  2JA5 G;  1XMO Q;  1B4O A;  1KAA A;  3CCQ A;  1WD0 A;  1VQ8 A;  2KOL A;  3SK5 A;  1ENA A;  3FPP A;  2Q8T A;  1Q46 A;  4WJ4 A;  3OW7 A;  1Q8K A;  4DV3 Q;  3J81 i;  5EKL A;  1G29 1;  5IGG A;  4POG A;  2VXW A;  4NXM Q;  4QIW E;  1OXT A;  5M5Y H;  3TEH B;  4MNO A;  3KLS X;  5FLX c;  1XX8 A;  4A3M G;  4P72 A;  2OTJ A;  4DR3 L;  2L12 A;  3FKI H;  1HNZ L;  2EY2 A;  5M3F B;  5I9P A;  3R93 A;  3TP6 A;  1XMQ Q;  1DYQ A;  3HOY G;  4A3K H;  1ESR A;  2A1A A;  2PMZ B;  3VDY A;  5FLX L;  1KC8 C;  1CHQ D;  2F0J A;  4MHE A;  3GTO B;  1EY7 A;  1Z9F A;  2QA4 A;  1YNN C;  5BR8 Q;  1H9M A;  2KCT A;  2LSS A;  3D3R A;  2I5H A;  2OT2 A;  4R1J A;  1PRT F;  3CMA A;  4EQO A;  4FXG C;  3DWA A;  4DR6 Q;  2DY8 A;  1WI5 A;  3OIP A;  4X3T A;  4DUY L;  2F0G A;  1F2M A;  2WAQ G;  3PIO A;  1KRS A;  3GV6 A;  4B9W A;  1E0B A;  2AHO B;  1TS3 A;  2HIX A;  3NTI A;  4CJ1 B;  3R3O A;  1VMP A;  2JA7 B;  3R8B A;  1Q86 C;  2Q2U A;  1EZ8 A;  2RQX A;  1FVI A;  1B9M A;  4BBR G;  4DK3 C;  1IBK Q;  4N8F A;  2MFI A;  5FLM G;  4LF6 Q;  3NWT A;  5HY6 A;  5JVG 3;  1VQI A;  1A63 A;  3J80 c;  2Y0S E;  4XTC S;  4YCU A;  3ND8 A;  2A73 B;  3K5N A;  3VR5 A;  4DNT B;  1WTW A;  1IBK L;  1HHV A;  3T51 B;  4XQN A;  2DUD A;  3Q23 A;  2LS0 1;  1V43 A;  1V9P A;  3DEP A;  5FJ8 G;  2UU9 Q;  3J7A V;  2LMC B;  2E5L L;  1Q1E A;  3A56 A;  4RGM A;  1Q8I A;  3CU7 A;  2NN6 G;  3TS2 A;  2A5H A;  2HCC A;  1JJ2 A;  5I2X A;  2AKW B;  4A3C H;  3G48 A;  5IT9 c;  1J6Q A;  3VR6 A;  2X69 A;  1XNR Q;  5EKI A;  4QF4 A;  4C3H G;  4IFD H;  3T1H L;  3ICE A;  3MTS A;  1LTT D;  2D0O A;  5JOB A;  1NJI C;  4GLV B;  1D6E C;  1JQY D;  1B9N A;  1U4M A;  1UEB A;  2Q2H A;  2WAQ B;  1M1K C;  1LT3 D;  2A6E C;  2RSN A;  1PH3 A;  3T4A C;  4DK6 C;  1BVS A;  5JJZ A;  2RHS B;  4LFA Q;  2VZA A;  4NXM L;  2OQ0 A;  5BN4 A;  3BVM A;  3TRZ A;  3M3Y B;  5IP9 H;  3SDZ A;  1Y1W G;  2VB2 X;  3BYT B;  4XDX A;  2I46 A;  3DWQ A;  1W6K A;  5EPK A;  3MXN B;  4DF7 A;  1O7Z A;  1D5Z C;  3H0G B;  2B3G A;  5C5L A;  1KLU D;  5C4J H;  3I4N H;  4A3D G;  3PSI A;  3SK4 A;  1VQC A;  5KND A;  3U58 A;  2ICE C;  1EYC A;  4UDU C;  1X54 A;  4L5Q A;  2R93 B;  3DM3 A;  3RLN A;  3W3A A;  2MO0 A;  4C2M B;  2D2C C;  2HDM A;  2PI2 E;  3HKZ B;  2R7Z B;  1NSN S;  1VS0 A;  2A6H D;  5KYI A;  4IN3 A;  1I3Q B;  2CQO A;  4IO9 A;  4B3M Q;  3AEV A;  3IFD A;  4NXN L;  3VR4 A;  3A8J E;  1AZP A;  1RTO A;  3FPU B;  1PTO H;  2K6A A;  1FNU A;  1SE2 A;  3KBG A;  1F9P A;  4RKL A;  4C2M H;  5EPJ A;  5GQO A;  4A3I H;  3E0E A;  1IBL L;  2K01 A;  4EQN A;  3HOY H;  3F2D A;  2VUM B;  4H02 A;  2PQA A;  1V8Q A;  2G9D A;  1N8R C;  4OX9 Q;  4L63 B;  1SYC A;  2PZW A;  3QOL A;  1B3Q A;  1L0Y B;  2N49 A;  1L0X B;  3X3M A;  4B3T Q;  5GAG C;  1II3 A;  2Z9H A;  2YTV A;  2JA5 B;  2BH2 A;  1EIY B;  1LT6 D;  4DV3 L;  3D4R A;  1FJG L;  4LUV A;  1ENF A;  1CKO A;  4I7A A;  4C3I B;  2DNC A;  4FO2 A;  4EQ5 A;  4GNX A;  1N9W A;  1FNW A;  3OMC A;  1CKN A;  3TN2 A;  4JI4 Q;  4G7O C;  1DCZ A;  1YEZ A;  3CQZ H;  1HH2 P;  1PH2 A;  2NYZ D;  5DAU A;  1QIL A;  4RHS A;  4A3E G;  1N32 L;  2X6G A;  3K6O A;  1PH6 A;  3P75 A;  1A3T A;  1SYF A;  3RZO H;  2L11 A;  3OTO L;  1JOR A;  2EPB A;  5C4X H;  4JI4 L;  4YIJ A;  5BN5 A;  1GUN A;  2F0V A;  2N55 A;  3NTH A;  4PZ7 A;  5CV7 A;  1KDA A;  2EJF C;  5GAH C;  4KY6 A;  4QIW B;  2F0U A;  4LUZ A;  1CK1 A;  5E3F A;  2YV5 A;  2R93 G;  2F4V L;  2K14 A;  4EQP A;  1L1O C;  1YVC A;  5C4Z A;  3D8G A;  3HOW H;  5KGU A;  2B8G A;  1P8L A;  3X3N A;  2QEX A;  2EXZ A;  3PUY A;  4JOI A;  2CWP A;  2WKD A;  4PMW A;  1XNR L;  1PRT B;  4P74 A;  5COY A;  4ABN A;  1M90 C;  1YJ9 A;  3PUZ A;  4R9W A;  4JV5 Q;  1XTD A;  3Q24 A;  4DR5 L;  3H0G H;  1TWC B;  4CDE C;  3S1M B;  4JI8 L;  5JAV A;  2B2T A;  3I70 A;  4AH6 A;  3S1Q H;  1PRT D;  1C4Q A;  3UI2 A;  1DD2 A;  1JR0 D;  4XQJ A;  4J1M A;  1G2T A;  1LUZ A;  4O1N A;  3FMC A;  3SE0 A;  5DM6 3;  1S40 A;  3NQT A;  5EBD A;  3S1N B;  2MQH A;  2EYL A;  1K8G A;  3H0G G;  4ZK9 B;  5I6Y A;  3J81 E;  3KJO A;  1V1Q A;  1KAW A;  1FNV A;  3MEH A;  3BZK A;  1Y1V G;  3I55 A;  3GTK H;  4DA2 A;  2OCE A;  3SVM A;  4PG3 A;  1MJC A;  2CQA A;  3KF8 B;  1CI3 M;  1E1T A;  2WAC A;  1HFN A;  3GDE A;  4V0B A;  4TQU S;  2A19 A;  4CKC A;  1GVP A;  2ZJP A;  4DR7 L;  5G3L D;  3KK7 A;  4MZ9 A;  4KKT A;  1TXY A;  5H1S E;  2CVR A;  1XPO A;  2KEE A;  4Y7N B;  4JI3 L;  2E2D C;  4U67 3;  3HOU G;  4OXP A;  3WOE A;  2V4D A;  3W2D A;  5IYC H;  1HTL D;  4IUQ A;  2PNR C;  1RHP A;  1BR9 A;  1X3E A;  4ILW A;  1EY5 A;  1KDB A;  1RCV D;  4LMQ D;  2K5W A;  2UUA L;  3IFT A;  1EWC A;  1RD9 D;  3HOU B;  1VQN A;  2HUG A;  5IYC G;  3TS0 A;  3TRE A;  5IGF A;  1CQV A;  4IFD I;  2K5D A;  3G71 A;  4JVZ A;  4Z9C B;  2FHT A;  1A6X A;  4PMC A;  1B7Y B;  3W1B A;  1R9T B;  4FVM A;  1ASZ A;  2IY5 B;  3ERS X;  3HRZ C;  1VCI A;  1I4X A;  3S17 B;  1H9S A;  3GO5 A;  4A3J H;  2CW0 D;  2HDL A;  1LYL A;  2F0K A;  1B44 D;  4Q5V A;  1TR5 A;  4HR7 B;  4GN4 B;  2EYP A;  5IT9 L;  2BOS A;  4A76 A;  1VQ4 A;  4A3B B;  5JJI A;  4K5X A;  3M4O H;  5D3D A;  4LFC L;  3MAQ A;  3V2T A;  4DV0 L;  1VQE A;  3CXC A;  3VYS A;  2JYO A;  4YHH Q;  4R4T A;  1YI2 A;  3JC6 6;  4A3D H;  1EEF D;  4DNI A;  1ASY A;  3EBE A;  4CBV A;  2NTT A;  4DN4 M;  4B3M L;  1EY9 A;  5M5W B;  3BZD B;  4GLX A;  1EOV A;  1D8L A;  5DNF A;  2B39 A;  3S2D H;  3HFZ B;  2JQO A;  4A3K B;  4MTK A;  4CJ2 C;  3PIO 3;  4KTA A;  2XGT A;  4DR5 Q;  1IBM Q;  1O7Y A;  2AUJ D;  2Q2T A;  2JA8 G;  2NVX H;  4OO1 H;  1VQF A;  2HIV A;  3J80 i;  1QVG A;  1SNM A;  2R93 H;  4RHR A;  1STG A;  3T1Y Q;  3KBX A;  3M4Y A;  4ULL A;  4TSS A;  2NVQ B;  4JI7 L;  4P71 A;  1WCM G;  5KIX A;  1PDQ A;  2RDH A;  2EE1 A;  3LGJ A;  1TY2 A;  2EQS A;  1E22 A;  4KHP Q;  5IGB A;  1GUO A;  5CV6 A;  3TZU A;  5IWA L;  4A3F H;  3CQZ B;  1B8A A;  1WTV A;  5C4X G;  1GUS A;  5AJ3 L;  4DAV A;  1D5X C;  1LTG D;  4POF A;  1I94 Q;  1LTR D;  3PO2 H;  4BWG B;  4JI7 Q;  1TKW B;  2ALY B;  4DV1 L;  4HJ7 A;  4KHP L;  1K0R A;  4C3J H;  4Y52 H;  4DU9 A;  4A3G B;  4QUC A;  2DGY A;  1H9K A;  1YHB A;  1PYS B;  2ZXO A;  1IL2 A;  3H09 A;  1AP0 A;  3CCE A;  3CRK C;  3U9O A;  4APV A;  1NCV A;  2AWN A;  1UE1 A;  1RIP A;  1O7I A;  2JEB I;  3RMH A;  1X56 A;  2B2T C;  2JA6 G;  3I7F A;  3S24 A;  1W2B A;  2F3V A;  2D9U A;  2JA8 B;  2A8V A;  5GAD C;  1JWM D;  1TWH B;  2Z4H A;  3C1E A;  5TSS A;  1SYG A;  1K3R A;  1RDP D;  1OO9 B;  2B2V A;  2VB3 X;  2VQE L;  3PF5 A;  1A3V A;  3SK6 A;  3SGI A;  4OEM B;  2BCO A;  4BA1 I;  2WII B;  1HR0 L;  3PIP A;  4UP9 A;  4TKO B;  4LF5 L;  1BUV T;  2OEO A;  2UUB L;  1GHJ A;  4XT3 B;  4ODG A;  1TWH H;  1STH A;  1HR0 Q;  2QIL A;  2WAQ E;  1ET9 A;  3NEN A;  2UUC L;  5IGE A;  1CA5 A;  2CKZ B;  4QCL A;  4C1N I;  4A3D B;  5IY0 A;  1SMX A;  1E2V A;  3DUZ A;  5HGT A;  4LFB Q;  1EY8 A;  4H0L C;  4A3K G;  3JAM c;  3K58 A;  3LNN A;  5LMN Q;  1SSO A;  5CYU A;  2UUC Q;  1K83 H;  3NP8 A;  3A5U A;  1E1O A;  1F9R A;  1PTO C;  4YWK A;  3A74 A;  1WD1 A;  3I72 A;  1CHP D;  3H94 A;  4KV6 A;  4GKJ L;  1SE4 A;  2GVB A;  2F0N A;  1VQ5 A;  3MA2 B;  5IOC A;  4DR7 Q;  4WRD A;  4A3G G;  3SR1 A;  2RCN A;  1LTA D;  2ZXR A;  3URY A;  1Y69 U;  5C44 G;  4RFB A;  1VDZ A;  1ILP A;  4DR2 Q;  1QE6 A;  1GUT A;  3SXH A;  1EOT A;  3TP7 A;  1TS5 A;  2F1M A;  3S15 B;  2SNM A;  1MI2 A;  4IJH A;  2AQ2 B;  5GRO A;  2KCN A;  2F0M A;  1U4L A;  2NN6 I;  4K8I A;  4HJA A;  1EIG A;  4N9P A;  3V96 A;  4KHV A;  2K5N A;  3RR5 A;  1WTR A;  4A4I A;  3HGB A;  1F2Z A;  5JEA J;  5ELE A;  3UDF A;  1IBL Q;  4DAP A;  4A3J B;  5IP7 G;  3E3X A;  4RWS C;  4ALP A;  1ZEQ X;  4ZLT F;  3QG1 A;  3VR3 A;  3I2Z A;  2MHV A;  1X3G A;  2R7Z H;  1PH1 A;  3I4M G;  1FJG Q;  2O4X A;  3F2C A;  3MWY W;  3LWU A;  4I7Z C;  1WCM H;  4ZCK A;  1C0A A;  3PIP 3;  1N34 Q;  5IP7 H;  1PYW D;  1SYD A;  3Q0A A;  1HZC A;  4KJN A;  1PH8 A;  4K0K Q;  4DV2 Q;  3TME A;  4GNX C;  1SMY C;  2H4O A;  1G51 A;  2R92 G;  4CDF C;  3Q22 A;  3PO3 B;  3A55 A;  4B3S Q;  4MIU A;  3AFQ A;  2JA8 H;  4ZRZ A;  4X3K A;  4JI0 Q;  4FF4 A;  5C0X J;  1YNJ D;  3W1G A;  4OEL B;  5LMU Q;  1RF2 D;  3L0O A;  2Z1C A;  2N88 A;  4K14 A;  4KLK A;  2F4V Q;  1ZKO A;  2WKC A;  4BXX G;  3J81 j;  2YYZ A;  1TWF B;  2SOB A;  2AMC B;  1G6P A;  2ID0 A;  3MXP A;  5CV9 A;  1D7Q A;  3QB3 A;  4IQZ A;  1M8A A;  2B8F A;  1SE3 A;  1SE8 A;  2RCF A;  1OXV A;  4G57 A;  4M1U B;  2KHJ A;  2FXQ A;  4A3I B;  1B3A A;  2IX0 A;  4R8N A;  4DV7 L;  2F0P A;  2NZO A;  3CME A;  4JBW A;  1UAP A;  5ELB A;  3FKI G;  2FMC A;  1B70 B;  1TWC H;  2F0Q A;  2XVS A;  4JBK A;  2XIW A;  4C3I H;  5EGT A;  4NDX A;  3PMF A;  3CF5 A;  1E2Z A;  1PVO A;  1N32 Q;  3U4Z A;  1GJX A;  1CA6 A;  2VS1 A;  4O42 A;  1XPU A;  2NVY H;  2QEJ C;  1LTL A;  2VQF L;  3A7A B;  3OW2 A;  2R7F A;  4DKA C;  2JA9 A;  1D2B A;  3S9W A;  4I65 A;  4XT1 B;  1NE3 A;  1PFN A;  2NVQ H;  2WB1 B;  3GTL H;  3KDF A;  2DN8 A;  2J7Z A;  1OXS C;  1KD1 C;  1MKH A;  3MZ5 A;  1PRT C;  2IL8 A;  1A2U A;  1PTO F;  3LX0 A;  3F2U A;  1QNK A;  1VQG A;  1B53 A;  4FXK C;  3VA5 A;  1K8A C;  1WJJ A;  3WDN A;  3HOV H;  3T13 A;  4BY7 G;  2WFW A;  4R4C A;  4JI5 Q;  1S3O A;  1C7Y A;  3A7L A;  1KQS A;  1V1O A;  3EN2 A;  5C44 H;  2PQE A;  3GTK B;  3TZD A;  1CT1 D;  3NSW A;  3R2T A;  1PHJ A;  2ZXP A;  2N3S A;  4HIO A;  4K2K A;  3IKJ A;  5M3M G;  1U4P A;  1NUC A;  1I4H A;  3JAM E;  2AWO A;  4HTH A;  5HGQ A;  5ELF A;  1VMC A;  1SFO H;  1NNX A;  3U50 C;  3UDG A;  2XNA C;  3TSS A;  3M3Y H;  3E0J A;  1LM0 A;  3PO3 H;  4OHJ A;  1PA6 A;  5DLQ E;  3PF4 A;  2G5D A;  4GOP B;  3K8A A;  2K03 A;  5LMN L;  5C3E B;  3K0Y A;  2L0C A;  1GKH A;  3GD7 A;  4XYQ A;  2QF7 A;  3M9B A;  3OPO A;  4BBS H;  4P2C B;  2MUY A;  4JI1 L;  1NY4 A;  2PZU A;  1FD7 D;  5IP9 G;  1Y1W H;  3K80 C;  1Q3L A;  1EU3 A;  4F87 A;  5EAY A;  2F0T A;  2VY3 A;  4OO1 G;  3C1F A;  3KJP A;  3NK9 A;  4RGT A;  2GVA A;  3MXU A;  3S2H H;  3HKS A;  3CCL A;  1BBW A;  1STN A;  4KN7 C;  3A5Z B;  1CZW A;  3CHB D;  3NE5 B;  4CDD C;  4QY7 A;  2KQ3 A;  5FO7 B;  4PNY A;  1OTC A;  5M5X B;  1KIX A;  2RSO A;  4DK1 A;  3IAY A;  2NN6 H;  3K5L A;  5M5Y B;  3FEW X;  1PZI D;  3ND9 A;  3CCV A;  3DLL A;  1XNQ L;  1ONL A;  4MN3 A;  1C9O A;  1KNE A;  3ULL A;  2QDB A;  4CJ0 B;  4IFD J;  3H6M A;  2A6H C;  4Y7N H;  3AB9 A;  4KJO A;  3L7Z C;  2ES2 A;  4A3M H;  3PUW A;  1FL0 A;  2QW7 A;  1EYD A;  2A68 D;  1GUW A;  3UE1 A;  3K5O A;  4LF7 Q;  1LO5 D;  2KEN A;  1C8C A;  1TII D;  1S72 A;  1KRT A;  2UXB Q;  1UWV A;  1I4P A;  4O0A A;  4BS9 A;  4ZAI A;  2PCF B;  1ET6 A;  1J5E L;  3PO2 B;  3UDI A;  1BQQ T;  4K0K L;  3WOF A;  2R92 B;  1K8O A;  2C35 B;  1BKB A;  3I4O A;  3L2P A;  2PZT A;  5E7N A;  2IX1 A;  2M2L A;  1YNJ C;  4IUV A;  3QIA A;  3KDF B;  1W3S A;  1PLF A;  1EQQ A;  1NBW A;  4JV5 L;  5BR8 L;  4ZUI A;  4IZ8 A;  2NVT B;  1F9S A;  2YU9 B;  3EVQ A;  3DHQ A;  5J3B A;  4HJ5 A;  1A2T A;  1ESF A;  3L9A X;  1X9N A;  4GLA C;  3FKI B;  4DV7 Q;  1KDC A;  1H95 A;  2XWJ B;  3CRL C;  2EJG C;  4DK0 A;  4X3U A;  4GN5 A;  3K57 A;  4ZUJ A;  1HNX L;  2MNA A;  1YHQ A;  1EY4 A;  3FP9 A;  1A3U A;  1IHZ A;  1Q1B A;  3D31 A;  1ILQ A;  2B2W C;  1KXL A;  3GP7 A;  1TS4 A;  2E74 C;  3C2P A;  4GZY C;  1HZA A;  1EIF A;  2E2I H;  4KD3 A;  5CGK A;  5LMN W;  4BY1 H;  1EIH A;  2KHI A;  4LFC Q;  4FP5 D;  3DXJ C;  4DV5 Q;  4J6H A;  1WTO A;  1WOC A;  3KYH C;  5I6W A;  4L5S A;  3KOJ A;  1TS2 A;  2A69 D;  5HUR A;  4IUR A;  4DUZ L;  2JP1 A;  2NZH A;  3VYU A;  4A3J G;  3MHB A;  2RA4 A;  5JEA G;  1HRJ A;  2UXD L;  4UHV A;  2RBM A;  1MIU A;  5EBC A;  2BDO A;  5M3F G;  2PW5 A;  2UU9 L;  2F52 A;  1BO0 A;  1R4Q B;  2C5C A;  1I4G A;  4A3C G;  2JA5 H;  1BDO A;  1HUM A;  2H5X A;  3VA7 A;  5E1F A;  3AYH B;  1ZXT A;  1SYB A;  2DNE A;  1PH5 A;  1G91 A;  3A8I E;  1L1O A;  1Q81 C;  4OWT B;  1PZJ D; 
#chains in the Genus database with same CATH homology
 5C44 B;  3NTK A;  4IUP A;  1O78 A;  3GTG B;  1QNU A;  4C3J B;  1Q90 A;  3I4N B;  3N6R A;  3RZO B;  1SYE A;  2DY7 A;  1UUP A;  2EYJ A;  2QKI C;  2B2Y A;  2FMM A;  1SND A;  4G4K A;  3GTL B;  3NQI A;  4NMZ A;  3D4W A;  3EA6 A;  2JE6 I;  4KKU A;  5C3W A;  1RJT A;  5C4J B;  3ONA B;  3GTJ B;  1AN8 A;  4BBS B;  3FVQ A;  4KY7 A;  4OIK A;  2E2I B;  3HOY B;  3BDO A;  1KTK A;  2NZ1 D;  1K83 B;  2NUC A;  2KED A;  3S2D B;  1GOZ A;  1BF4 A;  1HA5 A;  3MFY A;  1SJE D;  4K8J A;  2EYM A;  1MD2 D;  4E6I A;  4K2L A;  4H44 C;  1IKL A;  1MSH A;  2FJ2 A;  3MFG A;  4OO1 I;  1O7L A;  4IUN A;  3D6W A;  2JA6 B;  5IOD A;  2KA7 A;  2XRS D;  3RZD B;  3BYY B;  2PO4 A;  5M9O A;  1HA6 A;  3HG9 A;  2XN9 C;  3H3V C;  1SNC A;  1SNP A;  2TSS A;  2EJM A;  1BCP B;  3GTP B;  1QWY A;  1S4Z A;  1WTX A;  2KEC A;  3S2H B;  1STA A;  2NWG A;  2B2U C;  1HQR D;  1JOQ A;  2AQ1 B;  2F0F A;  1ICW A;  3KF8 A;  3O13 A;  2EY5 A;  4HSV A;  5FKA C;  4WJW A;  1LLR D;  1MSG A;  1B1Z A;  5G3L F;  2WV6 D;  3K7A B;  3E5S A;  2IT1 A;  2J4X A;  1SJH D;  1MBY A;  2ZT9 C;  5I4D A;  2K1B A;  3EFX D;  2E2J B;  1JOO A;  1SFO B;  1KAB A;  1HUN A;  1EWH A;  1DON A;  3OOC A;  4KKS A;  2F0I A;  4DFA A;  4IAL A;  1MGS A;  2TMP A;  1PZK D;  3C3L A;  2HCI A;  4DXG A;  3DMU A;  1VF5 C;  2C9O A;  3J7A F;  5K36 G;  3NBH A;  4QMG A;  4NP5 A;  4C56 C;  2R3Z A;  1Z47 A;  1T5X D;  1EU4 A;  4FXD A;  1ZYR C;  5E4X A;  3RUZ A;  5CV4 A;  4RGO S;  2B2Y C;  1FR3 A;  5C0X G;  2NVY B;  1QJO A;  3HS0 C;  3GQB A;  1EY6 A;  2F0S A;  1F2Y A;  1V1P B;  3QJY A;  3KLR A;  3L3O C;  3HP3 A;  3GTM B;  2K04 A;  2A68 C;  2IX3 A;  3PUX A;  5IGC A;  3GTQ B;  3PV0 A;  4LK1 C;  4IFD G;  1BBX C;  3RLF A;  2RDG A;  2Q8R E;  3BVG A;  1QB5 D;  4RCN A;  2O5I C;  1Z6H A;  3NWS A;  2FIN B;  4A93 B;  3HOV B;  1SXT A;  4TRD A;  4FF1 A;  5CV8 A;  1IW7 D;  2F0D A;  1JIC A;  4RH6 A;  4C3J G;  3DM1 A;  1IYU A;  5CMD A;  2K33 A;  3BS1 A;  3NXW A;  1H9R A;  2F03 A;  1O80 A;  1GHK A;  4ID6 A;  4U68 A;  3FDT A;  2M00 A;  1F9Q A;  1S5D D;  2EYF A;  4CHT B;  5EJW A;  5FK9 C;  1TQO A;  3M85 A;  3P1H A;  1V1P A;  4ZKB B;  5KRU A;  2PPB C;  2NVX B;  4EVO A;  1LT5 D;  1FYC A;  2BDN A;  5K5P A;  3QO2 A;  5T1I A;  5KNB A;  2B2V C;  3AU7 A;  3I8Z A;  1LV9 A;  3MXG A;  1I4R A;  3DEO A;  3QOJ A;  4CKE A;  1KNA A;  2F0E A;  1J8I A;  2K28 A;  4N9T A;  3ZYY X;  4OIJ A;  4IUT A;  4F7X A;  2GA4 B;  2LFN A;  1X32 A;  1J9O A;  3NHH A;  5FLX E;  5FO8 B;  1PXU A;  2EDG A;  1IKM A;  1Q12 A;  4HED A;  5ELC A;  1A15 A;  2D62 A;  5EQ0 A;  2B63 B;  4XIG S;  3AMU A;  2L55 A;  5I2Y A;  4KMU C;  2XWB B;  1DM0 B;  1TU2 B;  5F2D A;  2B2U A;  4RCO A;  3OWE B;  1VF7 A;  4ME5 A;  1SNQ A;  2G9H D;  1DOL A;  4PMB A;  4XXE A;  1HQM C;  1JWU D;  4KK7 A;  3V05 A;  4J8Q A;  1HPC A;  2M9V A;  4HMI A;  5ELD A;  2A74 C;  5CBA E;  4A3E B;  5D3I B;  3HEJ A;  5DEH A;  3HOX B;  2O2L D;  1DZ1 A;  1TWG B;  1ENC A;  4FNF A;  4RKB A;  3TP5 A;  4JK1 C;  3KUP A;  2K32 A;  3RD4 A;  5I9O A;  1STY A;  2L1B A;  1E2W A;  1YNN D;  5KNC A;  5D14 A;  1DOM A;  3G7L A;  1JOK A;  1D1I A;  4RA8 A;  2KCC A;  1NR4 A;  1Y1W B;  2MP1 A;  3OMG A;  4KI0 A;  2BA0 A;  4RAU C;  2K5Q A;  4WOR A;  2WP8 J;  1LTS D;  1OXX K;  4HCE A;  5A2Q E;  2BA1 A;  3T53 B;  1QG7 A;  4K6D A;  1Y8P B;  4ZYS A;  3D6C A;  4FF2 A;  1SEB D;  1QOH A;  5C3X A;  1KLG D;  4L6T B;  4K5W A;  2KJX A;  1TT2 A;  2WIN B;  4PQX A;  1LT4 D;  1PTO B;  1EQV A;  2L5T A;  1Z7T A;  3I90 A;  1GUG A;  1LTI D;  4RGN A;  1PMR A;  1WVL A;  3OSO A;  1ROD A;  1Y8O B;  1HCZ A;  5K36 H;  1DXM A;  1AEX A;  5EKK A;  1TWA B;  2I07 B;  1B2T A;  3E6Z X;  4BBR B;  3NPP A;  5JVH 3;  5ISR A;  2IWH A;  2EYO A;  1R4P B;  1XXG A;  1BCP D;  3A54 A;  3SHL A;  2Q8I B;  5IGD A;  1DOK A;  1EYA A;  5JPM C;  3JAM L;  1I6H B;  3H91 A;  1BCP F;  4Q0F A;  1UEA B;  3LWE A;  1EL0 A;  5LL6 X;  3C46 A;  1RKN A;  3ERO A;  5T1G A;  5E4W C;  1H9J A;  1U9R A;  3S16 B;  1TVX A;  1JE4 A;  4OL7 A;  2E76 C;  1ZYR D;  4F8M A;  4KD4 A;  2R61 A;  3R2I A;  1GXD C;  5C6A A;  2K7V A;  3MXN A;  1I50 B;  3I73 A;  3BDC A;  1AZQ A;  4FYD A;  2KHS A;  5C0X H;  2A69 C;  1X3Q A;  4B08 A;  1BXT A;  4R8I A;  3TP8 A;  2AUK A;  2Z8L A;  2L4N A;  2F0O A;  2E2H B;  5KEE A;  5FOB B;  2SDF A;  2EVB A;  4HAE A;  4IUU A;  2IJ0 A;  2LY7 A;  5J1Z A;  4BA2 I;  1U4R A;  5IT9 E;  1S5B D;  3J80 L;  1EQT A;  1B50 A;  1FGB D;  2QCP X;  3EJI A;  1ML0 D;  3HOW B;  3NBI A;  2JXM B;  1EEI D;  2BE5 C;  3I3C A;  3NUC A;  4G7Z C;  4X3S A;  3HOZ B;  4XYO A;  1JB3 A;  2K05 A;  2NB0 A;  2H1E A;  1H9S B;  1XWE A;  4XQQ A;  1WTP A;  4K5V A;  2D5D A;  5A35 A;  2F0W A;  1D1K A;  1LAC A;  4C3I G;  1Y8N B;  2OF1 A;  4DNR B;  3I4L A;  1HFG A;  2IPK D;  4L8J A;  2O5J C;  4DXF A;  4PV1 C;  3M7G A;  4BY1 B;  3S1Q B;  4ZKC B;  1EY0 A;  5J39 A;  2F4I A;  3U9S A;  5JEA H;  4AYB B;  2EZV A;  3J81 L;  2MJ8 A;  3FRP B;  3VR2 A;  4C1N K;  2RKS A;  2XSC A;  1LTB D;  5M3M B;  3PUV A;  2JEA I;  3IL8 A;  2RDF A;  3P7J A;  4CKB A;  4V19 0;  2F0L A;  2CW0 C;  2HQE A;  5CBE E;  1BCP C;  5IIF A;  3I91 A;  3BG3 A;  2VNU D;  1SAP A;  2XRQ D;  2SEB D;  1K8M A;  4NKL A;  3TDQ A;  4KN4 C;  3K5M A;  4LAA A;  4DAY A;  3P20 A;  3ITP A;  4S3S A;  1I6V C;  2ICI A;  3S1R B;  3SEB A;  2FFK B;  2X6L A;  5FO9 B;  1IL8 A;  4UAI A;  4BY7 B;  2R6G A;  3OWF A;  1AFP A;  1SNO A;  4G7H C;  4KY5 A;  1HTP A;  3S14 B;  4H7B A;  3DWP A;  1M4V A;  3EQL C;  3HZX A;  4CGY B;  1X3P A;  5CR3 A;  4KHZ A;  1EFI D;  4K6L A;  5C5M A;  3M4O B;  2KUM A;  1PFM A;  2LKV A;  2SNS A;  4WFN 3;  1T5E A;  1D5M C;  1BNZ A;  2JSO A;  5C0X I;  2ENB A;  4B9X A;  1OXU A;  2PW7 A;  5LL6 S;  1HXY D;  4ZQ3 A;  5JPN C;  1CFM A;  1G8Z D;  2NTS A;  2F0H A;  3A8K E;  3OHX C;  1JC7 A;  1TY0 A;  4FF3 A;  2EYH A;  1Y1V B;  1NR2 A;  1AW7 A;  1EZ6 A;  3I4M B;  2AQ3 B;  3VYR A;  5D65 A;  5EPL A;  3D4D A;  1S5F D;  1IYV A;  2BE5 D;  2F3W A;  4EGV A;  2MPM A;  2PYK A;  4QB4 A;  4DGZ A;  3T56 B;  1UNS A;  1S5E D;  2Y0S B;  5BN3 A;  1BOS A;  4F88 A;  5COR A;  5J22 A;  4A3M B;  2A6E D;  2IW3 A;  1F2L A;  4HN7 A;  1JWS D;  1C48 A;  3J7Y W;  1LAB A;  5CV5 A;  2KVM A;  2NBF A;  2B2W A;  2E75 C;  3M7N A;  2RVL A;  3BVZ A;  1S5C D;  3ERQ A;  3MC0 B;  2MGS A;  1G6Z A;  1SMY D;  1STE A;  1SDF A;  1XTC D;  1F77 A;  4M8A A;  1DJR D;  5NUC A;  5C4X B;  3KLS A;  5AFW A;  2L9H A;  5CC4 A;  3CKI B;  3K59 A;  2J0T D;  2EY6 A;  1NAP A;  3QWN A;  3VYT A;  1CM9 A;  5LHY 1;  3BDL A;  1I4Q A;  3TBI B;  1W6J A;  2EOT A;  4OGQ C;  5A2Q L;  2OXP A;  1PFB A;  1QCB D;  1CZG A;  4HMJ A;  1SBB B;  4HCS A;  3N52 A;  3Q6S A;  1G2S A;  1PTO D;  5DM7 3;  2CHB D;  2EY1 A;  4LJZ C;  5C4H A;  3J80 E;  3MVV A;  3GV3 A;  4NW2 A;  4HSP A;  4A3F B;  4C3H B;  1JCK B;  2Z4I A;  1CQF A;  3G6J B;  1WTQ A;  1XYI A;  1IW7 C;  4QUF A;  3SK8 A;  5KYL A;  3T16 A;  1STB A;  1CTM A;  1WCM B;  3OIQ A;  1RTN A;  4H13 C;  1B4O A;  1KAA A;  1WD0 A;  2KOL A;  3SK5 A;  1ENA A;  3FPP A;  2Q8T A;  3OW7 A;  5EKL A;  1G29 1;  5IGG A;  2VXW A;  1OXT A;  3KLS X;  1XX8 A;  2L12 A;  2EY2 A;  5M3F B;  5I9P A;  3R93 A;  3TP6 A;  1DYQ A;  1ESR A;  2PMZ B;  5FLX L;  1CHQ D;  2F0J A;  4MHE A;  3GTO B;  1EY7 A;  1YNN C;  1H9M A;  3D3R A;  2OT2 A;  1PRT F;  4EQO A;  4FXG C;  3DWA A;  2DY8 A;  3OIP A;  4X3T A;  2F0G A;  1F2M A;  3GV6 A;  4B9W A;  1E0B A;  3NTI A;  1TS3 A;  4CJ1 B;  3R3O A;  1VMP A;  2JA7 B;  3R8B A;  1EZ8 A;  2RQX A;  1B9M A;  3NWT A;  5JVG 3;  4XTC S;  3ND8 A;  2A73 B;  3K5N A;  3VR5 A;  4DNT B;  1WTW A;  1HHV A;  3T51 B;  4XQN A;  3Q23 A;  2LS0 1;  1V43 A;  3DEP A;  3J7A V;  2LMC B;  1Q1E A;  3A56 A;  4RGM A;  1Q8I A;  3CU7 A;  2NN6 G;  2A5H A;  2HCC A;  5I2X A;  3VR6 A;  2X69 A;  5EKI A;  4QF4 A;  4C3H G;  4IFD H;  3MTS A;  1LTT D;  5JOB A;  1D6E C;  1JQY D;  1B9N A;  1U4M A;  2WAQ B;  1LT3 D;  2A6E C;  2RSN A;  3T4A C;  5JJZ A;  5BN4 A;  3BVM A;  3M3Y B;  3SDZ A;  2VB2 X;  3BYT B;  4XDX A;  2I46 A;  3DWQ A;  1W6K A;  5EPK A;  4DF7 A;  1O7Z A;  1D5Z C;  3H0G B;  5C5L A;  1KLU D;  3SK4 A;  5KND A;  2ICE C;  1EYC A;  4UDU C;  2R93 B;  3W3A A;  4C2M B;  2D2C C;  2HDM A;  3HKZ B;  2R7Z B;  1NSN S;  2A6H D;  5KYI A;  4IN3 A;  1I3Q B;  3IFD A;  3VR4 A;  3A8J E;  1AZP A;  1RTO A;  3FPU B;  1PTO H;  2K6A A;  1FNU A;  1SE2 A;  3KBG A;  1F9P A;  4RKL A;  5EPJ A;  2K01 A;  4EQN A;  2VUM B;  1V8Q A;  2G9D A;  1SYC A;  2PZW A;  3QOL A;  4L63 B;  1L0Y B;  1L0X B;  3X3M A;  1II3 A;  2JA5 B;  1LT6 D;  3D4R A;  1ENF A;  4C3I B;  2DNC A;  4FO2 A;  1FNW A;  3OMC A;  3TN2 A;  4G7O C;  1DCZ A;  2NYZ D;  5DAU A;  1QIL A;  4RHS A;  2X6G A;  3K6O A;  3P75 A;  1A3T A;  1SYF A;  2L11 A;  1JOR A;  2EPB A;  4YIJ A;  5BN5 A;  1GUN A;  2F0V A;  2N55 A;  3NTH A;  5CV7 A;  1KDA A;  2EJF C;  4KY6 A;  4QIW B;  2F0U A;  1CK1 A;  5E3F A;  4EQP A;  5C4Z A;  3D8G A;  5KGU A;  2B8G A;  3X3N A;  2EXZ A;  3PUY A;  2WKD A;  4PMW A;  1PRT B;  5COY A;  4ABN A;  3PUZ A;  4R9W A;  3Q24 A;  1TWC B;  3S1M B;  5JAV A;  2B2T A;  3I70 A;  1PRT D;  1C4Q A;  3UI2 A;  1DD2 A;  1JR0 D;  4XQJ A;  4J1M A;  1G2T A;  4O1N A;  3FMC A;  3SE0 A;  5DM6 3;  3NQT A;  5EBD A;  3S1N B;  2EYL A;  4ZK9 B;  5I6Y A;  3J81 E;  1FNV A;  3MEH A;  4DA2 A;  3SVM A;  2CQA A;  1CI3 M;  2WAC A;  1HFN A;  4V0B A;  4TQU S;  4CKC A;  5G3L D;  3KK7 A;  4KKT A;  2CVR A;  2KEE A;  4Y7N B;  2E2D C;  4U67 3;  3WOE A;  2V4D A;  3W2D A;  1HTL D;  2PNR C;  4IUQ A;  1RHP A;  1BR9 A;  4ILW A;  1EY5 A;  1KDB A;  1RCV D;  4LMQ D;  2K5W A;  3IFT A;  1EWC A;  1RD9 D;  3HOU B;  2HUG A;  5IGF A;  1CQV A;  4IFD I;  2K5D A;  4Z9C B;  2FHT A;  1A6X A;  4PMC A;  1R9T B;  4FVM A;  3HRZ C;  1VCI A;  1I4X A;  3S17 B;  1H9S A;  3GO5 A;  2CW0 D;  2HDL A;  2F0K A;  1B44 D;  4Q5V A;  1TR5 A;  4HR7 B;  2EYP A;  5IT9 L;  2BOS A;  4A3B B;  4K5X A;  5D3D A;  3MAQ A;  3V2T A;  3VYS A;  2JYO A;  1EEF D;  4CBV A;  2NTT A;  4DN4 M;  1EY9 A;  5M5W B;  3BZD B;  5DNF A;  2B39 A;  4A3K B;  4CJ2 C;  3PIO 3;  4KTA A;  1O7Y A;  2AUJ D;  4OO1 H;  1SNM A;  4RHR A;  1STG A;  3KBX A;  3M4Y A;  4ULL A;  4TSS A;  2NVQ B;  5KIX A;  1PDQ A;  2RDH A;  2EE1 A;  1TY2 A;  5IGB A;  1GUO A;  5CV6 A;  3TZU A;  1WTV A;  3CQZ B;  1GUS A;  4DAV A;  1D5X C;  1LTG D;  1LTR D;  4BWG B;  1TKW B;  4DU9 A;  4A3G B;  4QUC A;  1H9K A;  2ZXO A;  3H09 A;  1AP0 A;  3CRK C;  3U9O A;  1NCV A;  2AWN A;  3RMH A;  2JEB I;  2B2T C;  2F3V A;  2D9U A;  2JA8 B;  1JWM D;  1TWH B;  2Z4H A;  3C1E A;  5TSS A;  1SYG A;  1RDP D;  1OO9 B;  2B2V A;  2VB3 X;  1A3V A;  3SK6 A;  2BCO A;  4BA1 I;  2WII B;  4TKO B;  1BUV T;  2OEO A;  1GHJ A;  4XT3 B;  4ODG A;  1STH A;  2QIL A;  1ET9 A;  5IGE A;  1CA5 A;  4QCL A;  4C1N I;  4A3D B;  1E2V A;  3DUZ A;  5HGT A;  1EY8 A;  4H0L C;  3K58 A;  3LNN A;  1SSO A;  5CYU A;  3NP8 A;  1F9R A;  1PTO C;  1WD1 A;  3I72 A;  1CHP D;  3H94 A;  4KV6 A;  1SE4 A;  2F0N A;  3MA2 B;  5IOC A;  4WRD A;  3SR1 A;  1LTA D;  2ZXR A;  3URY A;  1Y69 U;  4RFB A;  1VDZ A;  1ILP A;  1QE6 A;  1GUT A;  3SXH A;  1EOT A;  3TP7 A;  1TS5 A;  2F1M A;  3S15 B;  2SNM A;  1MI2 A;  2AQ2 B;  2KCN A;  2F0M A;  1U4L A;  2NN6 I;  4K8I A;  1EIG A;  4N9P A;  3V96 A;  4KHV A;  1WTR A;  3HGB A;  1F2Z A;  5JEA J;  5ELE A;  4DAP A;  4A3J B;  4RWS C;  1ZEQ X;  4ZLT F;  3QG1 A;  3VR3 A;  2MHV A;  2O4X A;  3MWY W;  3LWU A;  4I7Z C;  3PIP 3;  1PYW D;  1SYD A;  3Q0A A;  4KJN A;  3TME A;  1SMY C;  2H4O A;  3PO3 B;  3Q22 A;  3A55 A;  4MIU A;  4ZRZ A;  4X3K A;  4FF4 A;  5C0X J;  1YNJ D;  1RF2 D;  4K14 A;  2Z1C A;  2N88 A;  1ZKO A;  2WKC A;  2YYZ A;  1TWF B;  2SOB A;  2ID0 A;  3MXP A;  5CV9 A;  3QB3 A;  4IQZ A;  1M8A A;  2B8F A;  1SE3 A;  1OXV A;  4G57 A;  4M1U B;  4A3I B;  1B3A A;  2IX0 A;  4R8N A;  2F0P A;  4JBW A;  1UAP A;  5ELB A;  2FMC A;  2F0Q A;  2XVS A;  2XIW A;  5EGT A;  4NDX A;  3PMF A;  1E2Z A;  1GJX A;  1CA6 A;  4O42 A;  2QEJ C;  3A7A B;  1D2B A;  3S9W A;  4I65 A;  4XT1 B;  1PFN A;  2WB1 B;  2DN8 A;  2J7Z A;  1OXS C;  3MZ5 A;  1PRT C;  2IL8 A;  1A2U A;  1PTO F;  3LX0 A;  3F2U A;  1QNK A;  1B53 A;  4FXK C;  3VA5 A;  3WDN A;  3T13 A;  3A7L A;  1V1O A;  2PQE A;  3GTK B;  3TZD A;  1CT1 D;  3NSW A;  3R2T A;  2ZXP A;  4K2K A;  3IKJ A;  1U4P A;  1NUC A;  1I4H A;  3JAM E;  2AWO A;  4HTH A;  5ELF A;  1VMC A;  2XNA C;  3TSS A;  3E0J A;  4OHJ A;  2K03 A;  5C3E B;  3K0Y A;  2L0C A;  3GD7 A;  4XYQ A;  2QF7 A;  3OPO A;  4P2C B;  2MUY A;  2PZU A;  1FD7 D;  1Q3L A;  1EU3 A;  4F87 A;  2F0T A;  4OO1 G;  3C1F A;  3NK9 A;  4RGT A;  3MXU A;  1STN A;  4KN7 C;  1CZW A;  3CHB D;  3NE5 B;  2KQ3 A;  5FO7 B;  4PNY A;  5M5X B;  2RSO A;  4DK1 A;  3IAY A;  2NN6 H;  3K5L A;  5M5Y B;  3FEW X;  1PZI D;  3ND9 A;  1ONL A;  4MN3 A;  1KNE A;  2QDB A;  4CJ0 B;  4IFD J;  3H6M A;  2A6H C;  3AB9 A;  4KJO A;  3L7Z C;  3PUW A;  1EYD A;  2A68 D;  1GUW A;  3K5O A;  1LO5 D;  1C8C A;  1TII D;  1I4P A;  4BS9 A;  4ZAI A;  2PCF B;  1ET6 A;  3PO2 B;  1BQQ T;  3WOF A;  2R92 B;  1K8O A;  2PZT A;  2IX1 A;  2M2L A;  1YNJ C;  4IUV A;  3QIA A;  1PLF A;  4ZUI A;  4IZ8 A;  2NVT B;  1F9S A;  2YU9 B;  3EVQ A;  3DHQ A;  1A2T A;  1ESF A;  3L9A X;  3FKI B;  1KDC A;  2XWJ B;  3CRL C;  2EJG C;  4DK0 A;  4X3U A;  3K57 A;  4ZUJ A;  1EY4 A;  1A3U A;  1IHZ A;  1Q1B A;  3D31 A;  1ILQ A;  2B2W C;  3GP7 A;  1TS4 A;  2E74 C;  3C2P A;  4GZY C;  4KD3 A;  5CGK A;  1EIH A;  4FP5 D;  3DXJ C;  4J6H A;  1WTO A;  5I6W A;  1TS2 A;  2A69 D;  5HUR A;  4IUR A;  2JP1 A;  3VYU A;  3MHB A;  2RA4 A;  5JEA G;  1HRJ A;  2RBM A;  5EBC A;  2BDO A;  2PW5 A;  1BO0 A;  1R4Q B;  2C5C A;  1I4G A;  1BDO A;  1HUM A;  3VA7 A;  5E1F A;  1ZXT A;  1SYB A;  2DNE A;  1G91 A;  3A8I E;  1PZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...