4RKLA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/v66t at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMTENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rklA00
1U9RA 1STHA 3D4WA 4IZ8A 5EKLA 1EY8A 1TQOA 1KAAA 5C6AA 2F3WA 4RKBA 1AEXA 2EYJA 2PZWA 5I9OA 3OWFA 4IUNA 2F0GA 4F7XA 2F0DA 4KTAA 4HMJA 3SK5A 3TMEA 3NK9A 4K14A 5CV9A 1SNQA 1SYDA 2F0SA 2EYLA 5E3FA 5C3WA 3D6CA 4PMCA 4K5WA 2QDBA 1STBA 4DGZA 4K6DA 1II3A 4ZUIA 5J22A 5HGTA 2OEOA 3EJIA 4ME5A 4F8MA 4QF4A 3BDCA 1EY9A 5CGKA 2OF1A 5EGTA 4PMBA 1EY7A 2EY1A 4K2LA 4E6IA 5IGDA 2F0LA 1F2ZA 3H6MA 1EYAA 4EVOA 4WRDA 1KDBA 1SNMA 3QB3A 1ENAA 3EROA 4KY7A 2EYOA 5DEHA 2F0PA 1SYFA 2F0MA 3NQTA 4KD3A 2EY2A 2PZUA 5CV6A 1NSNS 5I6YA 3ERQA 1A2TA 2O4XA 5IGGA 1A2UA 4B9XA 1F2MA 1EY5A 2EXZA 1RKNA 1EQVA 3QOJA 1KDCA 3NXWA 4DFAA 5IIFA 3SXHA 2EYPA 4ID6A 4K5XA 4B9WA 4DU9A 3SR1A 5KYLA 5ISRA 4K8JA 4S3SA 5J39A 2NUCA 2F0KA 2RKSA 5I6WA 3TP8A 4KJNA 5CV7A 4IALA 2PW7A 3C1EA 1A3TA 3EVQA 1SYBA 5KYIA 4EQPA 1F2YA 5JAVA 1EZ8A 3MHBA 1STGA 5IODA 2RDFA 1EY6A 1SYCA 4ODGA 3DHQA 4TRDA 4KD4A 2KQ3A 4EQOA 2M00A 5JOBA 5IGCA 1JORA 4NDXA 1JOOA 4J1MA 3PMFA 5CV5A 3D8GA 3VA5A 5C3XA 5IGEA 2F0TA 5CC4A 1KDAA 3DMUA 3RUZA 3P75A 3S9WA 1STNA 2LKVA 5NUCA 2EY5A 3HZXA 4LAAA 4MIUA 5CV8A 3MZ5A 3T13A 5C5LA 3NUCA 3V2TA 4YIJA 4QB4A 1NUCA 2EYFA 4WORA 1A3UA 3OMGA 3NP8A 1EY0A 1SNDA 3D4DA 4G57A 4R8NA 5KEEA 2EY6A 3MXPA 2EYMA 2F0WA 2RBMA 5EKKA 1EYDA 5CV4A 2SOBA 3OSOA 5J1ZA 3P1HA 4KJOA 2F0NA 3BDLA 4OL7A 4RKLA 4PNYA 5DAUA 3SK4A 5E1FA 3SK8A 1KABA 3HEJA 2F0UA 2F0JA 1JOQA 4H7BA 5F2DA 1A3VA 2F0FA 1ENCA 4HTHA 1SNPA 4KY6A 1EZ6A 4NP5A 5KRUA 5C4ZA 2PW5A 3E5SA 4QMGA 2SNMA 4K2KA 2OXPA 1JOKA 4EQNA 3LX0A 5CR3A 3TP7A 3TP5A 2KHSA 4I65A 4NKLA 2F3VA 2SNSA 1EY4A 3NHHA 1TR5A 2F0EA 5HURA 1EYCA 1TT2A 2F0IA 5IGFA 4KY5A 5KIXA 2PYKA 3TP6A 2F0VA 3SHLA 5KGUA 5I9PA 1SNOA 3ITPA 3R3OA 3C1FA 3MVVA 4KHVA 5C5MA 4K5VA 5K5PA 5M9OA 1STYA 2PQEA 1SYEA 4HMIA 3MEHA 3SK6A 5C4HA 4N9PA 4K8IA 2WACA 3QOLA 4ZQ3A 2F0OA 3OMCA 4DF7A 4KV6A 4NMZA 2EYHA 3T16A 1SYGA 3U9OA 5IOCA 2F0HA 2F0QA 1STAA 4J6HA 4ZUJA 5IGBA 4N9TA 1IHZA 1SNCA 2HQEA 2ENBA 2PZTA
chains in the Genus database with same CATH superfamily
5IWAL 4WJWA 2IW3A 1FNUA 3HOXB 1G51A 5EKLA 5FLXL 2K5VA 1SMYD 3NTKA 1Q7YC 3I91A 2JA5G 4RCOA 1R9TH 3VR6A 1PYSB 3OTOQ 3M4OB 4K0KQ 3MEFA 1YITA 4X3TA 3NBHB 4LUOA 3J80c 4A93G 1CK1A 2I5HA 1WTQA 2OF1A 5IYCG 3J81c 2ZJRA 3HOUB 2Z6BA 1YNNC 2K50A 3A0JA 1J5EL 1I4QA 3RD4A 4JCVE 3GV6A 2ZM6L 3KF8A 1B9MA 4DR5Q 4C2MH 4JVZA 3NQTA 5M3FG 2RVLA 3CPWA 4G4KA 1ILPA 1E1TA 1A2UA 3OIQA 1N34L 1DOLA 1RKNA 5EPLA 3NXWA 3IKJA 1CKMA 3S2HB 5CMDA 1HR0Q 2J7ZA 3OTOL 2LXJA 4HIOA 4KJNA 5FJ8G 4UY8C 1SYBA 2UUBQ 3FVQA 5FO7B 2F4IA 1EQRA 4DR5L 4L5RC 1Y14B 3BVZA 1HZ9A 2B2YC 4A75A 2DJFC 2M00A 5BN4A 2BH2A 1UAPA 3V96A 5ELBA 2M2LA 5D3IB 2B2VA 5KNDA 1VDZA 2LFNA 4ULLA 1PYWD 4IFDH 2D2CC 3BU2A 3OWEB 1YHAA 4KJOA 4AQYQ 2L9HA 2UUBL 1VQ4A 3I7FA 3F2CA 1ML0D 3U4VA 4IOCA 1BXTA 1VCIA 2MQHA 1SDFA 4I65A 3TDQA 2F0IA 3HS0C 4H02A 1BO0A 4IUUA 2B2YA 5HGTA 2JA7H 1SYGA 3PO3H 3HFZB 3OYYA 2IX1A 1F9RA 1IHZA 4A4IA 5JEAG 4AQYL 1TY2A 2OQ0A 2XIWA 3VR5A 4ZLTF 4JI1Q 4GLXA 4KTAA 3TQYA 1GUSA 5E3FA 4PMCA 3AQQA 5EPJA 4LFCQ 1PTOB 2NZ1D 3TREA 2DY8A 1EY7A 3Q24A 3ONAB 3RNUA 2V4DA 3QB3A 1VQGA 2EVBA 3KBGA 5IP9H 4JI1L 2PQAA 1IL8A 1T5XD 2O4XA 3KLRA 4FNFA 1F2MA 3PGZA 4DUYQ 1WD1A 1SE2A 3CCSA 3SXHA 5M5YB 1ESFA 1B3AA 3N6RA 3CCEA 5GAHC 1QVFA 4LFCL 1NMGA 1Z6HA 3GTPB 2FHTA 3J80E 3J7AV 1HUMA 3S16B 2VXWA 3J81E 3K5LA 1UWVA 2DNEA 1G6ZA 2E2JH 1R4QB 1ASYA 4I7ZC 1TS3A 4BA2I 1JMCA 3HOXH 4MIUA 4DUYL 3MZ5A 4A3GG 2J4XA 1XNQQ 2K28A 4RCNA 1N32Q 4G57A 4WJ3M 2OCEA 1HR0W 2B29A 4MTKA 5C0XH 3M4OH 4CHTB 1O78A 1LTLA 2HCIA 3HOWB 3DEPA 3EA6A 4P74A 2DNCA 2Z0SA 3PO3G 4DV1Q 3HOUH 3TZDA 4EGVA 1PA6A 3J81j 4DGZA 4L8JA 2KHSA 3MWYW 3HKZG 3F1ZA 1SLJA 4V190 3CCQA 3GTGB 3RZOB 2VUMB 4KI0A 1VQNA 1SJHD 2K03A 1XNQL 4HMIA 3CD6A 3CU7A 3QR8A 2WACA 4IUTA 1N32L 3CMAA 3S24A 2HUGA 3HOVB 2F0HA 2F0QA 1EU4A 3EQLC 1PH7A 4N9TA 1QNUA 5ELEA 3MXGA 2HQEA 3GTKB 1OO9B 4OONA 1VQLA 1HFGA 1TY0A 4B3SQ 3DWPA 2WB1G 2F3WA 4P72A 4RKBA 4DV1L 2D0PA 1UNSA 2TMPA 4FF1A 2Q8RE 2EZVA 2E2IH 1MBYA 1N36Q 1HQMC 2F0GA 2H4OA 5IP7H 1A15A 1AH9A 1K73C 5EJWA 4DV3Q 4OIKA 4RFBA 4FYDA 4LF9L 1DM0B 3ND8A 2AHOB 3Q23A 1H9KA 4JYAQ 5CGKA 4A3KB 3S1NH 4PZ6A 4K2LA 3CF5A 1T9HA 1PZKD 4B3RQ 4EVOA 3E0JA 1Y8OB 1ENAA 2EYOA 4B3SL 4IQZA 5CV6A 3I4OA 3KJOA 5JEAJ 4TQUS 1VQJA 1QJOA 1QCBD 4X65Q 3QOJA 4R4IA 3H0GB 1N36L 3M3YB 2SDFA 2XNAC 3TZUA 4DV3L 5J39A 4S3SA 4DV4Q 3HOXG 2HDMA 3RLNA 3TP8A 5JPNC 5CV7A 5LHY1 4FO2A 4JYAL 3MXUA 2AUJD 4BBRH 2NB0A 2C9OA 4JI7Q 4IJLA 2MNAA 1JR0D 1YHBA 1LABA 4DV6Q 5DM63 3SVMA 4CJ1B 1S5FD 1C7YA 4X65L 3DUZA 1TWFH 2FXQA 5C5LA 3HOUG 1HUNA 1EIGA 3BYTB 1SNDA 3DLLA 3DXJC 2A6ED 1XWEA 2F0WA 4DV4L 4L6TB 4CDCC 4LFBL 4DK6C 3M9BA 1RIPA 1YI2A 1Q81C 3E9HA 1U0LA 3FPPA 1ENCA 5J3BA 3V05A 4JI7L 3AEVA 4R4TA 4YHHQ 4IFDJ 2G5DA 4DV6L 3NPPA 4NPSA 1HFNA 1X3QA 4DAYA 2R7ZH 1TR5A 2KECA 1X9NA 2KUMA 3MXNB 1PLFA 4MZ9A 2IJ0A 2F0VA 3R93A 5KGUA 5ELFA 4PZ7A 1A6XA 1JQYD 1STYA 1H95A 3R2TA 3SK6A 4LK1C 4DR6Q 2A69C 4QY7A 1MI2A 2WP8J 1SAPA 2ASBA 4YWMA 2SEBD 1U9RA 1TWCH 4J8QA 1Z7TA 4IZ8A 3SEBA 3UDXA 1EY8A 4LW1A 1RTOA 1HNXQ 1EWCA 4YHHL 3GV3A 3GTPH 3CRKC 4A3LH 1Q1EA 2F0DA 4GOPC 2WAQB 1HHVA 3Q0AA 5J22A 2CH4W 1STEA 3RMHA 3S1MB 1P8LA 1U4RA 1L1OC 4YWLA 5M5XB 4DR6L 1P16A 3I4NB 2EY1A 3A7AB 1SE8A 1Y69U 2VQEL 5DEHA 4ZCKA 1A63A 1XTCD 1HNXL 5EQ0A 5IGGA 3JAMc 3HOZH 4JOIC 5IIFA 2QA4A 1PRTC 1K83B 4P2CB 4X62Q 1AZQA 3OIPA 2D0OA 2NUCA 3GTGH 3RZOH 2VUMH 1LTSD 2B2WC 4PZ8A 3RZDB 1A3TA 1I4RA 1Z9FA 4GOPA 1EZ8A 1PH6A 5DNFA 4BXXH 3A8JE 2AUKA 1I6HB 1OXXK 2QEJC 1G2SA 4GNXC 4KHPQ 5JOBA 1PH1A 4JI5Q 3GTKH 2GVAA 1K8AC 4JV5Q 3FRPB 1HNWQ 5I4DA 4HAEA 3QIAA 4YIJA 3I4MB 1JCKB 5GROA 2EYFA 1AW7A 4A3FH 1F9SA 4X62L 3PCOB 1B53A 2CWPA 1U4PA 5EPKA 5LMNQ 4XYQA 1I4HA 3E6ZX 3HEJA 2EE1A 3NSWA 1GHJA 3VYRA 3TS0A 2PW5A 1R9TB 2RCFA 1MGSA 4AYBE 4DNIA 5C4JH 4KHPL 3LX0A 3DM3A 4JI5L 2B2WA 4JV5L 1EYGA 1QE6A 5KIXA 3OOCA 4TVAB 2PYKA 1XNRQ 1I5FA 1HNWL 1SNOA 3PV0A 4X66Q 3C1FA 2HCCA 1SXTA 1PH3A 4A3LG 3H0GH 4L5QA 2ZXPA 2CKZB 4C2MB 1IBMQ 4R1JA 2KEDA 1STAA 1LT4D 4PV1C 4A3BB 1B7YB 1K0RA 3M3YH 1YNND 4O2DA 1SRUA 5LMNL 2PZTA 1IBLQ 2H1EA 3K8AA 2HHHL 4KKUA 2MHVA 4J15A 1KAAA 4XIGS 3SGIA 1PVOA 1WTRA 1B3QA 4ZKBB 2L12A 1D5MC 1G6PA 5C44H 4Z9CB 4DR2Q 2AKWB 1XNRL 4X66L 1FGUA 2QDBA 4XQQA 3HOWG 3TEHB 2N88A 1IBML 4PMBA 4OO1I 1H9RA 1HRJA 2JA8H 5FKAC 4DV0Q 1IBLL 4DUZL 1Q3LA 5CORA 2VUMG 1GUGA 1LLRD 4UPAA 3KLWA 4DA2A 1CTMA 4XQJA 3ZYYX 2YYZA 5FK9C 3HOVG 4X3SA 2EYPA 4AYBB 3K7UC 3M85A 3G6JB 3CHBD 4KN4C 1HTLD 1VQMA 1PHJA 4XT1B 1B9NA 2JE6I 4BY7H 1YBYA 1X32A 1PH8A 1EY6A 4DV0L 5COYA 4EQOA 4OWWB 1ONLA 1DYQA 1PH5A 1N9WA 2ICIA 2JEBI 5BN3A 4RGOS 2JA7B 1IYJB 2I0QA 4C56C 4A3KG 4CDDC 4NXMQ 2EDGA 3OW2A 3JAME 3DM1A 1A3UA 1BKBA 1OXVA 4CKEA 1TWHH 3KK7A 2RSOA 3CC4A 3KF6A 1LO5D 5J1ZA 1WTWA 4GS3A 1LYLA 2VW9A 2XRSD 1VS0A 5F2DA 1Q12A 3H0GG 3S1MH 4KN7C 5C4ZA 3E5SA 5M5XH 1VQHA 4IURA 4P71A 3KJPA 2Z4HA 2UXCQ 3NHHA 1FYCA 3PIOA 1E7ZA 3R3OA 4KHVA 1ICWA 4NXML 3PQIA 2KHIA 3X3MA 1SYEA 2ZTEA 1YVCA 1F2LA 5K36H 3S1QB 3DWAA 4P73A 1K83H 2QGQA 4G7HC 5LMNW 3RZDH 3I8ZA 2PZWA 4R8IA 1WJJA 4F7XA 1YNXA 2MPMA 3CQZB 1PTOC 1Q8KA 2IT1A 2N8NA 2EXDA 4QCLA 1B4OA 4K6DA 2R93H 2Q2TA 1CKOA 3RLOA 2NTSA 1OXSC 2E2JB 3I4MH 3H3VC 4DAMA 3O13A 2HT1A 2ZTCA 1JICA 4UP9A 1E22A 4A3CH 2BDOA 1XPOA 1N34Q 1VQFA 5BN5A 1KDCA 5D14A 4M1UB 1QVCA 1TKWB 2X69A 2VNUD 1I4XA 5JJZA 2DN8A 3VDYA 3WOEA 2F03A 1RDPD 1HZAA 2KEEA 3AFQA 3CMEA 5L37A 1HH2P 1Q82C 1UUPA 2PMZE 2MJ8A 1H9SA 1PFNA 1HXYD 3OW7A 1OTCA 2MO0A 1S5BD 2WKCA 1SYCA 1NCVA 2WAQG 5KNBA 2YU9B 4A3BH 5FO8B 3PIO3 2KVMA 3K5OA 4DK0A 1IKMA 2E2DC 5C3EH 1E2VA 2K75A 4OWXB 2NVQB 1EWIA 1AE2A 3V2TA 1J8IA 2NN6I 3I4NG 1K9MC 5JVH3 1M90C 3D4DA 4R8NA 4ZAIA 1Z47A 3Q22A 1PYBA 2MO1A 3EFXD 3TRZA 3TS2A 1A3VA 2E2IB 3PF5A 2FMMA 2VS1A 2K5WA 4A76A 5K36G 1G291 2WKDA 2B2TC 1VQEA 5IYDH 3ND9A 1W3SA 4OWTB 2OQKA 3S1NB 4LFAQ 1KAWA 1G2TA 3QWNA 1EFWA 1D8LA 2EIFA 5M3MB 2IY5B 3L2PA 4NMZA 2JN4A 1KNEA 4X3KA 1YEZA 3HOYH 4YY3Q 2PMZB 1LTGD 4JI6Q 1OXTA 2JA9A 1LTRD 1YZ6A 4HIMA 3UDGA 4A3CG 2CH4A 4ZYSA 2MP1A 4BBRB 4LFAL 4A3DH 1II3A 4KMUC 4DK3C 3BVGA 1PFMA 4EQ5A 4RGTA 1SJED 5JVG3 1B50A 3D31A 1XMOQ 2B39A 1U5KA 2BA1A 1TWFB 4RGNA 3QO2A 5I6YA 4YY3L 2UXBQ 3CCJA 4JI6L 1B8AA 3E0EA 1A8VA 1EY5A 1HQRD 4KHZA 5D65A 2QW7A 2B2UC 1BF4A 4ID6A 4A3BG 2K7VA 4P75A 3UE0A 2AWOA 1PZJD 1VQIA 1O80A 1D2BA 1RL2A 5TSSA 1PV4A 2F3IA 2RF4A 1EIYB 3C46A 3VR4A 2WV6D 3ICEA 2R7ZB 1MJEA 3K5NA 1XMOL 4HCEA 5CYUA 3D6WA 3VYUA 3DWQA 3S1QH 2UXBL 3D8GA 1W6JA 2K33A 5KNCA 5H1SE 4OXPA 3UE1A 1QZHA 1CKNA 3BYYB 1Q1BA 3NUCA 1BBXC 4IPGA 1LTBD 3G4SA 5EBCA 5IYDG 1TWCB 4Y52H 1GHKA 1G8ZD 2EY6A 4DK1A 1FNWA 2A69D 3CQZH 1D7QA 1ZKOA 2F0UA 3GTMB 2B2UA 1DD2A 4IFDG 2QILA 3GO5A 4RHRA 1BCPD 1SNPA 4YCVA 2N55A 2SNMA 4AYBG 1QZGA 2OXPA 3NENA 3URYA 1PH2A 1QNKA 4C3JH 1JWMD 3TP6A 3SHLA 3PIPA 2FFKB 1JE4A 3NWTA 1JB7A 1VF7A 2A5HA 1GO3E 5AJ3Q 1KXLA 3G7LA 1HA5A 3PUYA 4JK1C 3GTJH 1STHA 1SFOB 3HOZB 1TU2B 2JA7G 1I3QH 4ZK9B 5I2YA 3S14B 2EYJA 4FDBA 2QEXA 3RN2A 2VB3X 2ZT9C 3GQBA 1DOKA 3AU7A 2A8VA 1PRTD 4K14A 2YU9H 2EYLA 3PUVA 3D6CA 1LUZA 3KDFA 1S72A 4ZUIA 3KFUA 3VR3A 4LF9Q 2PI2A 4FF4A 2NVQH 1X3EA 5AJ3L 1K8MA 2A1AA 3J81i 5IGDA 1YHQA 1O7LA 3HRZC 4RGMA 3CCLA 1EL0A 3PUWA 1X65A 4NB3A 3I55A 1UE6A 1RTNA 4JC0A 2KCMA 5IY0A 4A3FB 3GTQB 1LV9A 1NNXA 4GLAC 4GLVB 3U4ZA 3ZJYC 3SR1A 1FD7D 5IP9G 3GDEA 3OHXC 3RLFA 3J7YW 4A3IH 4XQNA 2Q2HA 5C4JB 1B1ZA 4IO9A 4L5TA 1S5ED 5M3MH 1DCZA 1AN8A 2PNHA 3UDFA 2A68C 2Z6KC 2JEAI 5IGCA 1HPCA 4NDXA 5CV5A 1GUTA 1JC7A 5CC4A 1SE4A 3J7AF 1STNA 1GD7A 3FPUB 3VA7A 1LACA 4EX5A 1D1KA 2TSSA 1M8AA 3J80L 1UE1A 1IYUA 1N33Q 2YTVA 2XRQD 1EOTA 3J81L 1S5DD 1LT3D 2PQAB 3N52A 4LFBQ 2FJ2A 1PH9A 2NWGA 2F0FA 3CAMA 4R4QA 3W1BA 5IYBH 5C44B 4GN3B 5C0XG 4JI4Q 4ILWA 1B44D 3I73A 3GTLB 2QKIC 2D9UA 2ATWA 2B3GA 2D62A 5IT9c 2PQEA 2JA8B 4QQBX 3E9IA 5M5WB 1N33L 2L15A 2QDLA 3MTSA 1CA5A 3CC2A 2ICEC 2YV5A 1XX8A 1EIFA 1JWSD 1EOVA 1VQ8A 1L0YB 4RAUC 4LUZA 1VQ7A 4LF4Q 4JI4L 3R2IA 3A5ZB 4DR4Q 3L7ZC 3T53B 1GOZA 1NR4A 2K5HA 2YTYA 5C3WA 4BY7B 4UP7A 2LS01 2YTXA 2OEOA 3UI2A 4QF4A 5I2XA 5IP7G 1YJNA 3M7GA 4Q0FA 1B2TA 3CP0A 1PMRA 3H6MA 2IX0A 1TS4A 1DONA 4FXDA 2VQEQ 1BCPC 1CHQD 4O0AA 4LF5Q 2ALYB 1WTVA 3CXCA 1O7YA 2B8GA 4DNTB 2M9VA 1UEBA 4LF4L 3GTMH 1JJGA 1EQVA 4NW2A 5M3MG 4DR4L 4H0LC 1TWHB 3K6OA 4C1NK 2JA6H 1MKHA 3IFDA 2K6AA 5JJKA 3PO2H 3NELA 2RKSA 4BS9A 2R92B 1ET9A 1PH4A 1KLGD 1ILQA 2E74C 1L0WA 3K0XA 3MHBA 2I07B 5FLXc 4RG1A 3F8TA 4LF5L 1LTAD 4F88A 4LF8Q 4HJ9A 1C0AA 3VA5A 4BBRG 2X6LA 1SFOH 1ESRA 3VR2A 3S14H 1NMFA 3U9SA 4XT3B 5BR8Q 1CQFA 1KRSA 1KTKA 5KEEA 4HJ8A 4Q5VA 2SOBA 1V1PA 2WINB 4RKLA 4X64Q 4OO1H 2RDHA 4HIDA 1J6QA 2LXKA 2AMCB 4IN3A 2K52A 4IUVA 5CR3A 3M4YA 5HURA 4LF8L 4JBMA 4XYOA 2JJQA 3LWEA 2R93B 1WCMB 1L1OA 1PTOD 2HIVA 5K5PA 4LMQD 4LF6L 1NY4A 1X56A 1Y1VH 5BR8L 2R7ZG 4DF7A 3GTQH 1VF5C 1DJRD 3NWSA 5ELOA 5IGBA 1N8RC 3IFTA 4X64L 1HZCA 1T5EA 1FL0A 4JOIA 4JI3L 4B3MQ 1GUNA 1S40A 2HHHQ 1NE3A 1F9QA 4ZRZA 5I9OA 4MHEA 3DEOA 3H3VI 4DN4M 1CT1D 1QUQB 5C0XJ 5CV9A 1VQ9A 4DAPA 4GN4B 4K5WA 3A7LA 4GNXA 2MGSA 4F8MA 2E8GA 1XPRA 1C9OA 4YCWA 5IT9E 4DAYB 1JT8A 1FR3A 3I70A 1WVLA 1F2ZA 4DUZQ 4WRDA 1KDBA 4B3ML 5C3EB 2ZJQA 1SYFA 2F0MA 1QG7A 2A73B 2CW0C 2EY2A 2LMCB 4C3IH 1VQ5A 3SE0A 5FOBB 2EXZA 1VQAA 4A3MH 1GKHA 4JBJA 4K5XA 2R3ZA 1MIUA 4KKTA 5ISRA 1X6OA 3GD7A 3GTLH 3CW2C 3HOZG 3C2PA 3TSSA 5ELDA 2DJGC 3C1EA 4PG3A 3EVQA 5GQOA 1VQKA 1F2YA 5JAVA 1M4VA 4BWGB 1STGA 4H13C 4N8X1 5M5WH 2CQOA 2RHQB 4KD4A 3EBEA 1PZID 2K5QA 5LL6X 4OO1G 2N3SA 4BXXG 1CSPA 3CCUA 5GAEC 5C4XB 2RSNA 1NUCA 1KRTA 1V8QA 2B63H 1IBKQ 4WJ4A 1WTHA 4DPGA 3HOYB 4QUCA 5EKKA 1DZ1A 3OSOA 4IPCA 1NAPA 2F0NA 2N49A 4DV5Q 4A3FG 2E76C 4JPBW 3T4AC 4DV2Q 2B8FA 2WB1E 3NBHA 2IX3A 4RHSA 3S17B 2EOTA 2MFIA 3K7AH 1DXMA 2R7FA 4LUVA 4A3DB 5FLXE 4ALPA 2IPKD 2OWOA 1HZBA 4GOPB 1D6EC 2NZOA 2LY7A 4K6LA 2F0OA 4KV6A 2JK8A 3T16A 1IBKL 2BCOA 2HD3A 2JXMB 3D4RA 1WYDA 5A2QE 4KY6A 3NBIA 3K59A 4OHJA 4DV5L 2R92H 2L0CA 4DV2L 1X3GA 4KLKA 2A6HC 1DOMA 3Q8DA 4L63B 3SK5A 5IYCH 1S4ZA 1VQBA 1Y8NB 4OIJA 3TMEA 1SN8A 1SNQA 4JBKA 2XGTA 4C1NI 2NN6H 2CFMA 4ME5A 2VB2X 4BBSB 5C44G 1K0SA 3UDIA 3F2DA 1R4PB 2WFWA 2F4VL 1EYAA 1IW7C 3L9AX 4KY7A 5E1FA 3BVMA 2EPBA 1NTGA 3A55A 1SROA 2JQOA 4B9XA 2JA8G 3IRBA 4A3EB 1K3RA 3ERSX 4DNRB 2XWJB 3I72A 4HSVA 4XTCS 4OX9Q 1ET6A 4K8JA 1SSOA 1WCMH 1EEFD 5GAGC 1I6VC 3BJUA 5KYIA 4B3TL 1KD1C 4C3JB 2BH8A 3RN5A 3NE5B 2KQ3A 1I94Q 3AYHB 1D1IA 3GP7A 3PMFA 4BY7G 5G3LD 1V1OA 5LL6S 2NVYB 3RUZA 4OX9L 3CCMA 1XJVA 4XXEA 2BOSA 3GTJB 3I90A 2EYMA 1NR2A 5ELCA 3T1YQ 1I3QB 2GA4B 4X6AH 5JPMC 4APVA 5EBDA 4F87A 4H7BA 4HTHA 3GTOB 1EQQA 1KC8C 1I94L 2VZAA 2RDGA 1QWYA 2FMCA 3R8BA 4FXKC 3JAML 2RA4A 2K05A 4H44C 1PFBA 5D3DA 2ZXRA 5IGFA 4LF7L 2R92G 5I9PA 3ITPA 4HJ5A 2K5NA 4UHVA 5A2QL 5JEAH 1S5CD 1X55A 1Q90A 3H09A 3OMCA 4U673 2XWBB 4JBWA 3T1YL 1WTOA 3HGBA 2B2VC 5FO9B 2NN6G 4GN5A 3L0OA 2KBNA 2Z1CA 4IPDA 1Y1WB 1WFQA 3U58A 2XN9C 2PPBC 2QCPX 1WTPA 5E4XA 3G6EA 3KF6B 4A3IB 1O7IA 2O2LD 2EJMA 2H5XA 4FVMA 2F0SA 2JP1A 3M4PA 4K0KL 1E24A 3CKIB 1CZWA 3A8IE 1MSHA 1EWHA 5C4XH 4RWSC 4DR1Q 2E75C 2N78A 2R93G 1WCMG 1SNMA 2A68D 1TWGH 2NVTB 3I4MG 3FHWA 3I4LA 1QVGA 1W2BA 1BNZA 2EJGC 3W3AA 4O42A 4HIKA 1HR0L 5T1GA 2F1MA 1CM9A 1NBWA 3S17H 1AFPA 1LM0A 3IL8A 2Z8LA 4IALA 4DXFA 4UDUC 4R4OA 2NYZD 2B2TA 1CA6A 5IE8A 4G7ZC 1FGBD 4DR1L 1IKLA 1D5ZC 1ZYRC 3EN2A 2NZHA 4UAIA 4AH6A 2NVXH 4TRDA 3TBIB 4A3GH 1RODA 2G9HD 3F2UA 1JOOA 3JC66 5IGEA 4Y7NH 4UP8A 2AWNA 1JJ2A 5CV8A 3LGJA 3T13A 1PFSA 4ZKCB 4MTNA 4C3HB 3OMGA 4ME3A 3MC0B 5C3EG 2BDNA 1BCPF 1XXGA 1TS5A 5CV4A 1LT5D 2K04A 1EU3A 4CBVA 5KRUA 1XPUA 3BZKA 1EZ6A 3FEWX 4QMGA 4BBSH 1G91A 4K2KA 4POGA 1RD9D 3KBXA 3BG3A 2I5MX 3TP7A 3QG1A 1EY4A 2F0EA 1F77A 1CHPD 1H9SB 1Q8IA 2DGYA 3BZCA 4CDFC 3MVVA 3FKIB 4KKSA 1B70B 3MEHA 3KF8B 4A3EH 2GN5A 3HG9A 1EIHA 1WTXA 2V1CC 3FMCA 2I46A 1O7ZA 1I50H 1C4QA 1GXDC 3T56B 2K14A 1GJXA 1PDQA 1LTID 3D4WA 3HKSA 4MNOA 2CVRA 5EKIA 4KK7A 5C4XG 1PRTF 2JA6B 3OWFA 1GUWA 2PCFB 1X54A 1CUKA 3PO2B 3HOYG 1S3OA 2KCTA 2FINB 4AIMA 4IFDI 4NXNQ 3KUPA 4O1NA 4HSPA 2R61A 2NVYH 2Q2IA 1HTPA 1E2WA 3BZDB 3PUZA 4BA1I 1BVSA 1HJPA 2PO4A 3WDNA 1XMQQ 2CWAA 1LTTD 2L1BA 4A3DG 1D5XC 2Z4IA 4HEDA 4I7AA 1BOSA 2UXDQ 2KJXA 2PZUA 1SMYC 5JJIA 2Y0SE 1A2TA 2UU9Q 1A62A 1FNVA 2Q2UA 4TSSA 4DFAA 3GTOH 3L3OC 3U50C 3M4QA 5KYLA 4B9WA 2KCNA 4NXNL 4TKOB 4WFN3 2R6GA 2OTJA 5ELNA 3MXNA 2C35B 2KA7A 2PW7A 4JI0Q 3J80i 2JYOA 4DV7Q 1WOCA 1XMQL 3RR5A 2O5IC 2UUAQ 1MD2D 3DHQA 1IXRA 5JJLA 2UXDL 1W6KA 1Y1VB 1UEAB 4IPHA 2UU9L 4A3JB 1C8CA 2KENA 1Y1WH 4BBSG 1TWAB 4QB4A 1GUOA 1NJIC 3AB9A 2L55A 3EIVA 5CBEE 4IJHA 3S2HH 2RBMA 1JJCB 2HQLA 5GADC 4CJ2C 4JI0L 3BDLA 4OL7A 3SK8A 3WWVA 4DV7L 1KABA 1JOQA 4A3EG 2CQAA 2ZXOA 4NP5A 2UUAL 5T1IA 1JOKA 4QIWE 3S15B 1MHWC 3PIP3 2F3VA 2SNSA 3A54A 3S2DB 1TT2A 2XVSA 4KY5A 2A19A 1RF2D 2X6GA 4HR7B 3C3LA 1KIXA 2NVTH 2Y0SB 1ZXTA 4N9PA 3QOLA 4C3JG 2MUYA 3U9OA 4MN3A 4V0BA 2CCZA 2ENBA 2Q8TA 4C3IB 3CC7A 2PI2E 3X3NA 4DR3Q 2F52A 1MJCA 1CKNB 4A3MB 2VL6A 1TQOA 3QJYA 4QUFA 2CW0D 2E5LQ 1C48A 4JI8Q 3ULJA 4IUNA 2EJFC 1QB5D 1TS2A 2A74C 3NK9A 4PMWA 1SYDA 4FP5D 2K01A 4BY1B 1TXYA 1HA6A 1E0BA 4U68A 1I4PA 1K8GA 4PQXA 4CDEC 5C0XI 1RJTA 2Z6KA 1SE3A 4L5SA 3MFYA 1V9PA 5EGTA 1TIID 1AP0A 4C3HH 5EAYA 2ZTDA 4HN7A 3CRLC 5FLMH 4B3RL 2WAQE 4DR3L 3S1RB 4GKJQ 4KD3A 4LWCA 1NSNS 4R4CA 2E5LL 5HY6A 3FP9A 4IOAA 4JI8L 3HP3A 2KCCA 2B63B 1YIJA 4DXGA 4DU9A 4QIWB 1CZGA 2VQFQ 2F0KA 1SBBB 1FJGQ 1QUQA 3K0YA 1Y1WG 3CCVA 4XDXA 3FKIH 4X3UA 1KHIA 1PTOH 5IODA 2RDFA 3K7AB 3NTHA 1JB3A 3LWUA 4A3IG 3J7A5 3KDFB 5DM73 4GKJL 4J1MA 1WI5A 2F0TA 1VQDA 2CHBD 3DMUA 1QOHA 3H3VH 2EY5A 3HZXA 4LAAA 3NP8A 3ER0A 5AFWA 1EY0A 2JA5B 4ABNA 1J9OA 2VQFL 1V43A 4M8AA 5M5YH 4POFA 1IZ6A 1FJGL 1EYDA 2BA0A 1ICFB 3BDOA 3P1HA 4JW0A 3STBD 2KOLA 5A35A 1WD0A 3M7NA 5DAUA 3SK4A 1L0XB 2LSSA 1SEBD 1EUJA 3A5UA 4A93B 3KLSA 3K80C 4EQNA 2A6HD 1PTOF 4G7OC 1K8OA 4HJ7A 4CGYB 3S16H 1AZPA 2K4KA 4B08A 1HNZQ 2BE5D 3K57A 5IYBG 5M3FB 3B6YA 5M9OA 4LF6Q 1YNJD 4DKAC 1H9JA 3W2DA 3J7ZC 2RQXA 2EYHA 4CKBA 1MSGA 4J6HA 1RHPA 5CBAE 4HJAA 3NEMA 1CI3M 2XSCA 1A0IA 2IL8A 1CQVA 4JI3Q 1IW7D 4RMFA 4OELB 2P5ZX 3H94A 4FF3A 5C6AA 3I56A 1AEXA 3HOWH 4C3HG 4QL5A 2K5DA 5FLMG 2ID0A 4YWKA 1HNZL 4YCUA 2IHFA 3PF4A 1STBA 2EQSA 4FF2A 1EEID 4A3JH 1CFMA 1YJWA 1BDOA 1TWAH 1BUVT 2Z9HA 4E6IA 1SMXA 1X3FA 2F0LA 3HOVH 3KLSX 2E2HB 1KNAA 3WOFA 3MAQA 3EROA 1BQQT 2F0PA 3MFGA 3FKIG 3ERQA 2XTIA 5LMUQ 3I3CA 1U4MA 3H15A 2J0TD 3S15H 1EQTA 3S2DH 2ES2A 5I6WA 1LT6D 2R7DA 3I2ZA 2JA6G 1VMPA 4ODGA 4JI2Q 4A3KH 3PO2G 1ASZA 3FDTA 4CKCA 1JORA 1RCVD 5LMUL 4QGUA 5E7NA 2L4NA 3G71A 3S9WA 4IUPA 1QILA 1U4LA 4RA8A 2JSOA 3BS1A 3AFPA 2NTTA 3PUXA 1VMCA 4LJZC 4LNQA 3NTIA 4BY1H 3MA2B 1E1OA 4PNYA 2Q8IB 3W5OA 1AE3A 1I4GA 1JWUD 3NQIA 1ZEQX 2L11A 4FXGC 3P7JA 3CCRA 4JI2L 2HDLA 1Q46A 3HKZE 1E2ZA 1YJ9A 1VQ6A 4GKKQ 3LNNA 5DLQE 3S1RH 1CSQA 1H9MA 4K5VA 2GVBA 4K8IA 1Q86C 3VYSA 1JE5A 2A6EC 2IWHA 1X3PA 1TWGB 1SNCA 1XTDA 3KOJA 2O5JC 1Y1VG 1PXUA 3PSIA 4A3JG 2OT2A 5HGQA 2OTLA 1BCPB 5E4WC 4GKKL 4QJFA 4HMJA 1L2FA 1K3BC 4DR2L 1V1PB 1M1KC 3H91A 2C5CA 3K5MA 1XYIA 3EJIA 2PNRC 4DAVA 3BDCA 1EY9A 2NVXB 4A3GB 2AQ2B 1Y8PB 3STBC 2VY3A 2JA5H 1ZYRD 4Y7NB 1L1OB 2F4VQ 2G9DA 3E3XA 1IYVA 1KL9A 1HCZA 3SDZA 2Y0SG 4CJ0B 4A93H 1VQCA 3AMUA 1E3PA 2ZJPA 3PO3B 1UE7A 2UUCQ 3T51B 2BE5C 3OPOA 5IT9L 1GM5A 3K81C 4GZYC 3HKZB 4C3IG 1OXUA 2DUDA 1YNJC 2I5LX 1PRTB 1BBWA 3D0FA 3K58A 4A3MG 1KLUD 3A74A 5M3FH 1EFID 2AQ3B 4IUQA 4EQPA 4B3TQ 4DR7Q 3A8KE 5G3LF 1VQOA 1IL2A 1K28A 4JG2A 1BBUA 4R9WA 1FVIA 1TVXA 3I4NH 2K32A 4BY1G 4GNXB 5C3XA 3F2BA 1VQPA 1KDAA 3P75A 5NUCA 2LKVA 2HIXA 5FJ8H 3JAMi 3A56A 4OEMB 2WB1B 2UUCL 2NBFA 3D3RA 4WORA 1I50B 3T1HQ 2RCNA 3IAYA 2AQ1B 2QF7A 3W1GA 3MXPA 4N8FA 3CPFA 5IWAQ 4HCSA 2F0JA 4DR7L 3KYHC 3P20A 1GVPA 4OGQC 2B63G 3VYTA 1SR3A 3TP5A 4NKLA 3ULPA 2UXCL 3TN2A 1I6HH 1EYCA 3Q6SA 2KHJA 2IHEA 2K1BA 4LF7Q 2E2HH 3ULLA 1F9PA 2WIIB 2DY7A 2L5TA 4RH6A 5C5MA 1BR9A 5C4HA 4ZQ3A 1V1QA 1KQSA 1ENFA 3T1HL 1UE5A 2RHSB 1DGSA 5IOCA 1J5EQ 2D5DA 4ZUJA 3G48A 2ZM6Q
chains in the Genus database with same CATH topology
4WJWA 2IW3A 1FNUA 3HOXB 5EKLA 5FLXL 1SMYD 3NTKA 3I91A 4RCOA 3VR6A 3M4OB 4X3TA 1CK1A 1WTQA 2OF1A 3HOUB 1YNNC 1I4QA 3RD4A 3GV6A 3KF8A 1B9MA 3NQTA 2RVLA 1ILPA 4G4KA 1A2UA 3OIQA 1DOLA 1RKNA 5EPLA 3NXWA 3IKJA 3S2HB 5CMDA 2J7ZA 4KJNA 1SYBA 3FVQA 5FO7B 2F4IA 3BVZA 2B2YC 2M00A 5BN4A 1UAPA 3V96A 5ELBA 2M2LA 5D3IB 2B2VA 5KNDA 1VDZA 2LFNA 4ULLA 1PYWD 4IFDH 2D2CC 3OWEB 4KJOA 2L9HA 1ML0D 1BXTA 1VCIA 1SDFA 4I65A 3TDQA 2F0IA 3HS0C 1BO0A 4IUUA 2B2YA 5HGTA 1SYGA 2IX1A 1F9RA 1IHZA 5JEAG 1TY2A 2XIWA 3VR5A 4ZLTF 4KTAA 1GUSA 5E3FA 4PMCA 5EPJA 1PTOB 2NZ1D 2DY8A 1EY7A 3Q24A 3ONAB 2V4DA 3QB3A 2EVBA 3KBGA 1IL8A 1T5XD 2O4XA 3KLRA 4FNFA 1F2MA 1WD1A 1SE2A 3SXHA 5M5YB 1ESFA 1B3AA 3N6RA 1Z6HA 3GTPB 2FHTA 3J80E 3J7AV 1HUMA 3S16B 2VXWA 3J81E 3K5LA 2DNEA 1G6ZA 1R4QB 4I7ZC 1TS3A 4BA2I 4MIUA 3MZ5A 2J4XA 2K28A 4RCNA 4G57A 5C0XH 4CHTB 1O78A 2HCIA 3HOWB 3DEPA 3EA6A 2DNCA 3TZDA 4EGVA 4DGZA 4L8JA 2KHSA 3MWYW 4V190 3GTGB 3RZOB 2VUMB 4KI0A 1SJHD 2K03A 4HMIA 3CU7A 4IUTA 2WACA 2HUGA 3HOVB 2F0HA 2F0QA 1EU4A 3EQLC 4N9TA 1QNUA 5ELEA 3MXGA 2HQEA 3GTKB 1OO9B 1HFGA 1TY0A 3DWPA 2F3WA 4RKBA 1UNSA 2TMPA 4FF1A 2Q8RE 2EZVA 1MBYA 1HQMC 2F0GA 2H4OA 1A15A 5EJWA 4OIKA 4RFBA 4FYDA 1DM0B 3ND8A 3Q23A 1H9KA 5CGKA 4A3KB 4K2LA 1PZKD 4EVOA 3E0JA 1Y8OB 1ENAA 2EYOA 4IQZA 5CV6A 5JEAJ 4TQUS 1QJOA 1QCBD 3QOJA 3H0GB 3M3YB 2SDFA 2XNAC 3TZUA 5J39A 4S3SA 2HDMA 3TP8A 5JPNC 5CV7A 5LHY1 4FO2A 3MXUA 2AUJD 2NB0A 2C9OA 1JR0D 1LABA 5DM63 3SVMA 4CJ1B 1S5FD 3DUZA 5C5LA 1HUNA 1EIGA 3BYTB 1SNDA 3DXJC 2A6ED 1XWEA 2F0WA 4L6TB 3FPPA 1ENCA 3V05A 4IFDJ 1HFNA 3NPPA 1X3QA 4DAYA 1TR5A 2KECA 2KUMA 1PLFA 2IJ0A 2F0VA 3R93A 5KGUA 5ELFA 1A6XA 1JQYD 1STYA 3R2TA 3SK6A 4LK1C 2A69C 1MI2A 2WP8J 1SAPA 2SEBD 1U9RA 4J8QA 1Z7TA 4IZ8A 3SEBA 1EY8A 1RTOA 1EWCA 3GV3A 3CRKC 1Q1EA 2F0DA 2WAQB 1HHVA 3Q0AA 5J22A 1STEA 3RMHA 3S1MB 1U4RA 5M5XB 3I4NB 2EY1A 3A7AB 1Y69U 5DEHA 1XTCD 5EQ0A 5IGGA 5IIFA 1PRTC 1K83B 4P2CB 1AZQA 3OIPA 2NUCA 1LTSD 2B2WC 3RZDB 1A3TA 1I4RA 1EZ8A 5DNFA 3A8JE 2AUKA 1I6HB 1OXXK 2QEJC 1G2SA 5JOBA 3FRPB 5I4DA 4HAEA 3QIAA 4YIJA 3I4MB 1JCKB 2EYFA 1AW7A 1F9SA 1B53A 1U4PA 5EPKA 4XYQA 1I4HA 3E6ZX 3HEJA 2EE1A 3NSWA 1GHJA 3VYRA 2PW5A 1R9TB 1MGSA 3LX0A 2B2WA 1QE6A 5KIXA 3OOCA 2PYKA 1SNOA 3PV0A 3C1FA 2HCCA 1SXTA 2ZXPA 4C2MB 2KEDA 1STAA 1LT4D 4PV1C 4A3BB 1YNND 2PZTA 2H1EA 4KKUA 2MHVA 1KAAA 4XIGS 1WTRA 4ZKBB 2L12A 1D5MC 4Z9CB 2QDBA 4XQQA 2N88A 4PMBA 4OO1I 1H9RA 1HRJA 5FKAC 1Q3LA 5CORA 1GUGA 1LLRD 4DA2A 1CTMA 4XQJA 3ZYYX 2YYZA 5FK9C 4X3SA 2EYPA 4AYBB 3M85A 3G6JB 3CHBD 4KN4C 1HTLD 4XT1B 1B9NA 2JE6I 1X32A 1EY6A 5COYA 4EQOA 1ONLA 1DYQA 2ICIA 2JEBI 5BN3A 4RGOS 2JA7B 4C56C 2EDGA 3JAME 3DM1A 1A3UA 1OXVA 4CKEA 3KK7A 2RSOA 1LO5D 5J1ZA 1WTWA 2XRSD 5F2DA 1Q12A 4KN7C 5C4ZA 3E5SA 4IURA 2Z4HA 3NHHA 1FYCA 3R3OA 4KHVA 1ICWA 3X3MA 1SYEA 1F2LA 5K36H 3S1QB 3DWAA 4G7HC 3I8ZA 2PZWA 4R8IA 4F7XA 2MPMA 3CQZB 1PTOC 2IT1A 4QCLA 1B4OA 4K6DA 2NTSA 1OXSC 2E2JB 3H3VC 3O13A 1JICA 2BDOA 5BN5A 1KDCA 5D14A 4M1UB 2X69A 1TKWB 2VNUD 1I4XA 5JJZA 2DN8A 3WOEA 2F03A 1RDPD 2KEEA 1UUPA 2MJ8A 1H9SA 1PFNA 1HXYD 3OW7A 1S5BD 2WKCA 1SYCA 1NCVA 5KNBA 2YU9B 5FO8B 3PIO3 2KVMA 3K5OA 4DK0A 1IKMA 2E2DC 1E2VA 2NVQB 3V2TA 1J8IA 2NN6I 5JVH3 3D4DA 4R8NA 4ZAIA 1Z47A 3Q22A 3EFXD 1A3VA 2E2IB 2FMMA 2K5WA 5K36G 1G291 2WKDA 2B2TC 3ND9A 3S1NB 1G2TA 3QWNA 5M3MB 4NMZA 1KNEA 4X3KA 2PMZB 1LTGD 1OXTA 1LTRD 4ZYSA 2MP1A 4BBRB 1II3A 4KMUC 3BVGA 1PFMA 1B50A 4RGTA 1SJED 5JVG3 3D31A 2B39A 2BA1A 1TWFB 4RGNA 3QO2A 5I6YA 1EY5A 1HQRD 4KHZA 5D65A 2B2UC 1BF4A 4ID6A 2K7VA 2AWOA 1PZJD 1O80A 1D2BA 5TSSA 3C46A 3VR4A 2WV6D 2R7ZB 3K5NA 4HCEA 5CYUA 3D6WA 3VYUA 3DWQA 3D8GA 1W6JA 2K33A 5KNCA 3BYYB 1Q1BA 3NUCA 1BBXC 1LTBD 5EBCA 1TWCB 1GHKA 1G8ZD 2EY6A 4DK1A 1FNWA 2A69D 1ZKOA 2F0UA 3GTMB 2B2UA 1DD2A 4IFDG 2QILA 3GO5A 4RHRA 1BCPD 1SNPA 2N55A 2SNMA 2OXPA 3URYA 1QNKA 1JWMD 3TP6A 3SHLA 2FFKB 1JE4A 3NWTA 1VF7A 2A5HA 3G7LA 1HA5A 3PUYA 4JK1C 1STHA 1SFOB 3HOZB 1TU2B 4ZK9B 5I2YA 3S14B 2EYJA 2VB3X 2ZT9C 3GQBA 1DOKA 3AU7A 1PRTD 4K14A 2EYLA 3PUVA 3D6CA 4ZUIA 3VR3A 4FF4A 1K8MA 5IGDA 1O7LA 3HRZC 4RGMA 1EL0A 3PUWA 1RTNA 4A3FB 3GTQB 1LV9A 3SR1A 1FD7D 3OHXC 3RLFA 3J7YW 4XQNA 5C4JB 1B1ZA 1S5ED 1DCZA 1AN8A 2A68C 2JEAI 5IGCA 1HPCA 4NDXA 5CV5A 1GUTA 1JC7A 5CC4A 1SE4A 3J7AF 1STNA 3FPUB 3VA7A 1LACA 1D1KA 2TSSA 1M8AA 3J80L 1IYUA 2XRQD 1EOTA 3J81L 1S5DD 1LT3D 3N52A 2FJ2A 2NWGA 2F0FA 5C44B 5C0XG 4ILWA 1B44D 3I73A 3GTLB 2QKIC 2D9UA 2D62A 2PQEA 2JA8B 5M5WB 3MTSA 1CA5A 2ICEC 1XX8A 1JWSD 1L0YB 4RAUC 3R2IA 3L7ZC 3T53B 1GOZA 1NR4A 5C3WA 4BY7B 2LS01 2OEOA 3UI2A 4QF4A 5I2XA 3M7GA 4Q0FA 1B2TA 1PMRA 3H6MA 2IX0A 1TS4A 1DONA 4FXDA 1BCPC 1CHQD 1WTVA 1O7YA 2B8GA 4DNTB 2M9VA 1EQVA 4NW2A 4H0LC 1TWHB 3K6OA 4C1NK 3IFDA 2K6AA 2RKSA 4BS9A 2R92B 1ET9A 1KLGD 1ILQA 2E74C 3MHBA 2I07B 1LTAD 4F88A 3VA5A 2X6LA 1ESRA 3VR2A 3U9SA 4XT3B 1CQFA 1KTKA 5KEEA 4Q5VA 2SOBA 1V1PA 2WINB 4RKLA 4OO1H 2RDHA 4IN3A 4IUVA 5CR3A 3M4YA 5HURA 4XYOA 3LWEA 2R93B 1WCMB 1PTOD 5K5PA 4LMQD 4DF7A 1VF5C 1DJRD 3NWSA 5IGBA 3IFTA 1T5EA 1GUNA 1F9QA 4ZRZA 5I9OA 4MHEA 3DEOA 4DN4M 1CT1D 5C0XJ 5CV9A 4DAPA 4K5WA 3A7LA 2MGSA 4F8MA 5IT9E 1FR3A 3I70A 1WVLA 1F2ZA 4WRDA 1KDBA 5C3EB 1SYFA 2F0MA 1QG7A 2A73B 2CW0C 2EY2A 2LMCB 3SE0A 5FOBB 2EXZA 4K5XA 2R3ZA 4KKTA 5ISRA 3GD7A 3C2PA 3TSSA 5ELDA 3C1EA 3EVQA 1F2YA 5JAVA 1M4VA 4BWGB 1STGA 4H13C 4KD4A 1PZID 2K5QA 5LL6X 4OO1G 5C4XB 2RSNA 1NUCA 1V8QA 3HOYB 4QUCA 5EKKA 1DZ1A 3OSOA 1NAPA 2F0NA 2E76C 3T4AC 2B8FA 3NBHA 2IX3A 4RHSA 3S17B 2EOTA 1DXMA 4A3DB 5FLXE 2IPKD 1D6EC 2LY7A 4K6LA 2F0OA 4KV6A 3T16A 2BCOA 2JXMB 3D4RA 5A2QE 4KY6A 3NBIA 3K59A 4OHJA 2L0CA 2A6HC 1DOMA 4L63B 3SK5A 1S4ZA 1Y8NB 3TMEA 4OIJA 1SNQA 4C1NI 2NN6H 4ME5A 2VB2X 4BBSB 1R4PB 1EYAA 1IW7C 3L9AX 5E1FA 4KY7A 3BVMA 2EPBA 3A55A 4B9XA 4A3EB 4DNRB 2XWJB 3I72A 4HSVA 4XTCS 1ET6A 4K8JA 1SSOA 1EEFD 1I6VC 5KYIA 4C3JB 3NE5B 2KQ3A 1D1IA 3GP7A 3PMFA 5G3LD 1V1OA 5LL6S 2NVYB 3RUZA 4XXEA 2BOSA 3GTJB 3I90A 2EYMA 1NR2A 5ELCA 1I3QB 2GA4B 5JPMC 5EBDA 4F87A 4H7BA 4HTHA 3GTOB 2RDGA 3R8BA 1QWYA 2FMCA 4FXKC 3JAML 2RA4A 2K05A 4H44C 1PFBA 5D3DA 2ZXRA 5IGFA 5I9PA 3ITPA 5A2QL 5JEAH 1S5CD 1Q90A 3H09A 3OMCA 4U673 2XWBB 4JBWA 1WTOA 3HGBA 2B2VC 5FO9B 2NN6G 2Z1CA 1Y1WB 2XN9C 2PPBC 2QCPX 1WTPA 5E4XA 4A3IB 4FVMA 2O2LD 2EJMA 2F0SA 2JP1A 3CKIB 1CZWA 3A8IE 1MSHA 1EWHA 4RWSC 2E75C 1SNMA 2A68D 2NVTB 3I4LA 1BNZA 2EJGC 3W3AA 4O42A 5T1GA 2F1MA 1CM9A 1AFPA 3IL8A 2Z8LA 4IALA 4DXFA 4UDUC 2NYZD 2B2TA 1CA6A 4G7ZC 1FGBD 1IKLA 1D5ZC 1ZYRC 4UAIA 4TRDA 3TBIB 1RODA 2G9HD 3F2UA 1JOOA 5IGEA 2AWNA 5CV8A 3T13A 4ZKCB 4C3HB 3OMGA 3MC0B 2BDNA 1BCPF 1XXGA 1TS5A 5CV4A 1LT5D 2K04A 1EU3A 4CBVA 5KRUA 1EZ6A 3FEWX 4QMGA 1G91A 4K2KA 1RD9D 3KBXA 3BG3A 3TP7A 3QG1A 1EY4A 2F0EA 1F77A 1CHPD 1H9SB 1Q8IA 3MVVA 3FKIB 4KKSA 3MEHA 3HG9A 1EIHA 1WTXA 3T56B 3FMCA 2I46A 1C4QA 1O7ZA 1GXDC 1GJXA 1PDQA 1LTID 3D4WA 2CVRA 5EKIA 4KK7A 1PRTF 2JA6B 3OWFA 1GUWA 2PCFB 3PO2B 2FINB 4IFDI 3KUPA 4O1NA 4HSPA 2R61A 1HTPA 1E2WA 3BZDB 3PUZA 4BA1I 2PO4A 3WDNA 1LTTD 2L1BA 1D5XC 2Z4IA 4HEDA 1BOSA 2KJXA 2PZUA 1SMYC 1A2TA 1FNVA 4TSSA 4DFAA 3L3OC 5KYLA 4B9WA 2KCNA 4TKOB 4WFN3 2R6GA 3MXNA 2KA7A 2PW7A 2JYOA 2O5IC 1MD2D 3DHQA 1W6KA 1Y1VB 1UEAB 4A3JB 1C8CA 1TWAB 4QB4A 1GUOA 3AB9A 2L55A 5CBEE 2RBMA 4CJ2C 3BDLA 4OL7A 3SK8A 1KABA 1JOQA 2CQAA 2ZXOA 4NP5A 5T1IA 1JOKA 3S15B 3PIP3 2F3VA 2SNSA 3A54A 3S2DB 1TT2A 2XVSA 4KY5A 1RF2D 2X6GA 4HR7B 3C3LA 2Y0SB 1ZXTA 4N9PA 3QOLA 4C3JG 2MUYA 3U9OA 4MN3A 4V0BA 2ENBA 2Q8TA 4C3IB 3X3NA 4A3MB 1TQOA 3QJYA 4QUFA 2CW0D 1C48A 4IUNA 2EJFC 1QB5D 1TS2A 4PMWA 2A74C 3NK9A 1SYDA 4FP5D 2K01A 4BY1B 1HA6A 1E0BA 4U68A 1I4PA 4PQXA 5C0XI 1RJTA 1SE3A 3MFYA 5EGTA 1TIID 1AP0A 4HN7A 3CRLC 3S1RB 4KD3A 1NSNS 3HP3A 2KCCA 2B63B 4DXGA 4DU9A 4QIWB 1CZGA 2F0KA 1SBBB 3K0YA 4XDXA 4X3UA 1PTOH 5IODA 2RDFA 3K7AB 3NTHA 1JB3A 3LWUA 5DM73 4J1MA 2F0TA 2CHBD 3DMUA 1QOHA 2EY5A 3HZXA 4LAAA 3NP8A 5AFWA 1EY0A 2JA5B 4ABNA 1J9OA 1V43A 4M8AA 1EYDA 2BA0A 3BDOA 3P1HA 1WD0A 3M7NA 2KOLA 5A35A 5DAUA 3SK4A 1L0XB 1SEBD 4A93B 3KLSA 4EQNA 2A6HD 1PTOF 4G7OC 1K8OA 4CGYB 1AZPA 4B08A 2BE5D 3K57A 5M3FB 5M9OA 1YNJD 1H9JA 3W2DA 2RQXA 2EYHA 4CKBA 1MSGA 4J6HA 1RHPA 5CBAE 1CI3M 2XSCA 2IL8A 1CQVA 1IW7D 3H94A 4FF3A 5C6AA 1AEXA 4C3HG 2K5DA 2ID0A 1STBA 4FF2A 1EEID 1CFMA 1BDOA 1BUVT 4E6IA 2F0LA 3KLSX 2E2HB 1KNAA 3WOFA 3MAQA 3EROA 1BQQT 2F0PA 3MFGA 3ERQA 3I3CA 1U4MA 2J0TD 1EQTA 5I6WA 1LT6D 1VMPA 4ODGA 3FDTA 4CKCA 1JORA 1RCVD 2L4NA 3S9WA 4IUPA 1QILA 1U4LA 4RA8A 2JSOA 3BS1A 2NTTA 3PUXA 1VMCA 4LJZC 3NTIA 3MA2B 4PNYA 2Q8IB 1I4GA 1JWUD 3NQIA 1ZEQX 2L11A 4FXGC 3P7JA 2HDLA 1E2ZA 3LNNA 1H9MA 4K5VA 4K8IA 3VYSA 2A6EC 2IWHA 1X3PA 1TWGB 1SNCA 2O5JC 1PXUA 2OT2A 1BCPB 5E4WC 4HMJA 1V1PB 3H91A 2C5CA 3K5MA 1XYIA 3EJIA 2PNRC 4DAVA 3BDCA 1EY9A 2NVXB 4A3GB 2AQ2B 1Y8PB 1ZYRD 4Y7NB 2G9DA 1IYVA 1HCZA 3SDZA 4CJ0B 3AMUA 3PO3B 3T51B 2BE5C 3OPOA 5IT9L 4GZYC 3HKZB 4C3IG 1OXUA 1YNJC 1PRTB 3K58A 1KLUD 1EFID 2AQ3B 4IUQA 4EQPA 3A8KE 5G3LF 4R9WA 1TVXA 2K32A 5C3XA 1KDAA 3P75A 5NUCA 2LKVA 3A56A 2WB1B 2NBFA 3D3RA 4WORA 1I50B 3IAYA 2AQ1B 2QF7A 3MXPA 4HCSA 2F0JA 3P20A 4OGQC 3VYTA 3TP5A 4NKLA 3TN2A 1EYCA 3Q6SA 2K1BA 1F9PA 5C5MA 2WIIB 2DY7A 2L5TA 4RH6A 1BR9A 5C4HA 4ZQ3A 1ENFA 5IOCA 2D5DA 4ZUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9R A;  1STH A;  3D4W A;  4IZ8 A;  5EKL A;  1EY8 A;  1TQO A;  1KAA A;  5C6A A;  2F3W A;  4RKB A;  1AEX A;  2EYJ A;  2PZW A;  5I9O A;  3OWF A;  4IUN A;  2F0G A;  4F7X A;  2F0D A;  4KTA A;  4HMJ A;  3SK5 A;  3TME A;  3NK9 A;  4K14 A;  5CV9 A;  1SNQ A;  1SYD A;  2F0S A;  2EYL A;  5E3F A;  5C3W A;  3D6C A;  4PMC A;  4K5W A;  2QDB A;  1STB A;  4DGZ A;  4K6D A;  1II3 A;  4ZUI A;  5J22 A;  5HGT A;  2OEO A;  3EJI A;  4ME5 A;  4F8M A;  4QF4 A;  3BDC A;  1EY9 A;  5CGK A;  2OF1 A;  5EGT A;  4PMB A;  1EY7 A;  2EY1 A;  4K2L A;  4E6I A;  5IGD A;  2F0L A;  1F2Z A;  3H6M A;  1EYA A;  4EVO A;  4WRD A;  1KDB A;  1SNM A;  3QB3 A;  1ENA A;  3ERO A;  4KY7 A;  2EYO A;  5DEH A;  2F0P A;  1SYF A;  2F0M A;  3NQT A;  4KD3 A;  2EY2 A;  2PZU A;  5CV6 A;  1NSN S;  5I6Y A;  3ERQ A;  1A2T A;  2O4X A;  5IGG A;  1A2U A;  4B9X A;  1F2M A;  1EY5 A;  2EXZ A;  1RKN A;  1EQV A;  3QOJ A;  1KDC A;  3NXW A;  4DFA A;  5IIF A;  3SXH A;  2EYP A;  4ID6 A;  4K5X A;  4B9W A;  4DU9 A;  3SR1 A;  5KYL A;  5ISR A;  4K8J A;  4S3S A;  5J39 A;  2NUC A;  2F0K A;  2RKS A;  5I6W A;  3TP8 A;  4KJN A;  5CV7 A;  4IAL A;  2PW7 A;  3C1E A;  1A3T A;  3EVQ A;  1SYB A;  5KYI A;  4EQP A;  1F2Y A;  5JAV A;  1EZ8 A;  3MHB A;  1STG A;  5IOD A;  2RDF A;  1EY6 A;  1SYC A;  4ODG A;  3DHQ A;  4TRD A;  4KD4 A;  2KQ3 A;  4EQO A;  2M00 A;  5JOB A;  5IGC A;  1JOR A;  4NDX A;  1JOO A;  4J1M A;  3PMF A;  5CV5 A;  3D8G A;  3VA5 A;  5C3X A;  5IGE A;  2F0T A;  5CC4 A;  1KDA A;  3DMU A;  3RUZ A;  3P75 A;  3S9W A;  1STN A;  2LKV A;  5NUC A;  2EY5 A;  3HZX A;  4LAA A;  4MIU A;  5CV8 A;  3MZ5 A;  3T13 A;  5C5L A;  3NUC A;  3V2T A;  4YIJ A;  4QB4 A;  1NUC A;  2EYF A;  4WOR A;  1A3U A;  3OMG A;  3NP8 A;  1EY0 A;  1SND A;  3D4D A;  4G57 A;  4R8N A;  5KEE A;  2EY6 A;  3MXP A;  2EYM A;  2F0W A;  2RBM A;  5EKK A;  1EYD A;  5CV4 A;  2SOB A;  3OSO A;  5J1Z A;  3P1H A;  4KJO A;  2F0N A;  3BDL A;  4OL7 A;  4RKL A;  4PNY A;  5DAU A;  3SK4 A;  5E1F A;  3SK8 A;  1KAB A;  3HEJ A;  2F0U A;  2F0J A;  1JOQ A;  4H7B A;  5F2D A;  1A3V A;  2F0F A;  1ENC A;  4HTH A;  1SNP A;  4KY6 A;  1EZ6 A;  4NP5 A;  5KRU A;  5C4Z A;  2PW5 A;  3E5S A;  4QMG A;  2SNM A;  4K2K A;  2OXP A;  1JOK A;  4EQN A;  3LX0 A;  5CR3 A;  3TP7 A;  3TP5 A;  2KHS A;  4I65 A;  4NKL A;  2F3V A;  2SNS A;  1EY4 A;  3NHH A;  1TR5 A;  2F0E A;  5HUR A;  1EYC A;  1TT2 A;  2F0I A;  5IGF A;  4KY5 A;  5KIX A;  2PYK A;  3TP6 A;  2F0V A;  3SHL A;  5KGU A;  5I9P A;  1SNO A;  3ITP A;  3R3O A;  3C1F A;  3MVV A;  4KHV A;  5C5M A;  4K5V A;  5K5P A;  5M9O A;  1STY A;  2PQE A;  1SYE A;  4HMI A;  3MEH A;  3SK6 A;  5C4H A;  4N9P A;  4K8I A;  2WAC A;  3QOL A;  4ZQ3 A;  2F0O A;  3OMC A;  4DF7 A;  4KV6 A;  4NMZ A;  2EYH A;  3T16 A;  1SYG A;  3U9O A;  5IOC A;  2F0H A;  2F0Q A;  1STA A;  4J6H A;  4ZUJ A;  5IGB A;  4N9T A;  1IHZ A;  1SNC A;  2HQE A;  2ENB A;  2PZT A; 
#chains in the Genus database with same CATH topology
 5IWA L;  4WJW A;  2IW3 A;  1FNU A;  3HOX B;  1G51 A;  5EKL A;  5FLX L;  2K5V A;  1SMY D;  3NTK A;  1Q7Y C;  3I91 A;  2JA5 G;  4RCO A;  1R9T H;  3VR6 A;  1PYS B;  3OTO Q;  3M4O B;  4K0K Q;  3MEF A;  1YIT A;  4X3T A;  3NBH B;  4LUO A;  3J80 c;  4A93 G;  1CK1 A;  2I5H A;  1WTQ A;  2OF1 A;  5IYC G;  3J81 c;  2ZJR A;  3HOU B;  2Z6B A;  1YNN C;  2K50 A;  3A0J A;  1J5E L;  1I4Q A;  3RD4 A;  4JCV E;  3GV6 A;  2ZM6 L;  3KF8 A;  1B9M A;  4DR5 Q;  4C2M H;  4JVZ A;  3NQT A;  5M3F G;  2RVL A;  3CPW A;  4G4K A;  1ILP A;  1E1T A;  1A2U A;  3OIQ A;  1N34 L;  1DOL A;  1RKN A;  5EPL A;  3NXW A;  3IKJ A;  1CKM A;  3S2H B;  5CMD A;  1HR0 Q;  2J7Z A;  3OTO L;  2LXJ A;  4HIO A;  4KJN A;  5FJ8 G;  4UY8 C;  1SYB A;  2UUB Q;  3FVQ A;  5FO7 B;  2F4I A;  1EQR A;  4DR5 L;  4L5R C;  1Y14 B;  3BVZ A;  1HZ9 A;  2B2Y C;  4A75 A;  2DJF C;  2M00 A;  5BN4 A;  2BH2 A;  1UAP A;  3V96 A;  5ELB A;  2M2L A;  5D3I B;  2B2V A;  5KND A;  1VDZ A;  2LFN A;  4ULL A;  1PYW D;  4IFD H;  2D2C C;  3BU2 A;  3OWE B;  1YHA A;  4KJO A;  4AQY Q;  2L9H A;  2UUB L;  1VQ4 A;  3I7F A;  3F2C A;  1ML0 D;  3U4V A;  4IOC A;  1BXT A;  1VCI A;  2MQH A;  1SDF A;  4I65 A;  3TDQ A;  2F0I A;  3HS0 C;  4H02 A;  1BO0 A;  4IUU A;  2B2Y A;  5HGT A;  2JA7 H;  1SYG A;  3PO3 H;  3HFZ B;  3OYY A;  2IX1 A;  1F9R A;  1IHZ A;  4A4I A;  5JEA G;  4AQY L;  1TY2 A;  2OQ0 A;  2XIW A;  3VR5 A;  4ZLT F;  4JI1 Q;  4GLX A;  4KTA A;  3TQY A;  1GUS A;  5E3F A;  4PMC A;  3AQQ A;  5EPJ A;  4LFC Q;  1PTO B;  2NZ1 D;  3TRE A;  2DY8 A;  1EY7 A;  3Q24 A;  3ONA B;  3RNU A;  2V4D A;  3QB3 A;  1VQG A;  2EVB A;  3KBG A;  5IP9 H;  4JI1 L;  2PQA A;  1IL8 A;  1T5X D;  2O4X A;  3KLR A;  4FNF A;  1F2M A;  3PGZ A;  4DUY Q;  1WD1 A;  1SE2 A;  3CCS A;  3SXH A;  5M5Y B;  1ESF A;  1B3A A;  3N6R A;  3CCE A;  5GAH C;  1QVF A;  4LFC L;  1NMG A;  1Z6H A;  3GTP B;  2FHT A;  3J80 E;  3J7A V;  1HUM A;  3S16 B;  2VXW A;  3J81 E;  3K5L A;  1UWV A;  2DNE A;  1G6Z A;  2E2J H;  1R4Q B;  1ASY A;  4I7Z C;  1TS3 A;  4BA2 I;  1JMC A;  3HOX H;  4MIU A;  4DUY L;  3MZ5 A;  4A3G G;  2J4X A;  1XNQ Q;  2K28 A;  4RCN A;  1N32 Q;  4G57 A;  4WJ3 M;  2OCE A;  1HR0 W;  2B29 A;  4MTK A;  5C0X H;  3M4O H;  4CHT B;  1O78 A;  1LTL A;  2HCI A;  3HOW B;  3DEP A;  3EA6 A;  4P74 A;  2DNC A;  2Z0S A;  3PO3 G;  4DV1 Q;  3HOU H;  3TZD A;  4EGV A;  1PA6 A;  3J81 j;  4DGZ A;  4L8J A;  2KHS A;  3MWY W;  3HKZ G;  3F1Z A;  1SLJ A;  4V19 0;  3CCQ A;  3GTG B;  3RZO B;  2VUM B;  4KI0 A;  1VQN A;  1SJH D;  2K03 A;  1XNQ L;  4HMI A;  3CD6 A;  3CU7 A;  3QR8 A;  2WAC A;  4IUT A;  1N32 L;  3CMA A;  3S24 A;  2HUG A;  3HOV B;  2F0H A;  2F0Q A;  1EU4 A;  3EQL C;  1PH7 A;  4N9T A;  1QNU A;  5ELE A;  3MXG A;  2HQE A;  3GTK B;  1OO9 B;  4OON A;  1VQL A;  1HFG A;  1TY0 A;  4B3S Q;  3DWP A;  2WB1 G;  2F3W A;  4P72 A;  4RKB A;  4DV1 L;  2D0P A;  1UNS A;  2TMP A;  4FF1 A;  2Q8R E;  2EZV A;  2E2I H;  1MBY A;  1N36 Q;  1HQM C;  2F0G A;  2H4O A;  5IP7 H;  1A15 A;  1AH9 A;  1K73 C;  5EJW A;  4DV3 Q;  4OIK A;  4RFB A;  4FYD A;  4LF9 L;  1DM0 B;  3ND8 A;  2AHO B;  3Q23 A;  1H9K A;  4JYA Q;  5CGK A;  4A3K B;  3S1N H;  4PZ6 A;  4K2L A;  3CF5 A;  1T9H A;  1PZK D;  4B3R Q;  4EVO A;  3E0J A;  1Y8O B;  1ENA A;  2EYO A;  4B3S L;  4IQZ A;  5CV6 A;  3I4O A;  3KJO A;  5JEA J;  4TQU S;  1VQJ A;  1QJO A;  1QCB D;  4X65 Q;  3QOJ A;  4R4I A;  3H0G B;  1N36 L;  3M3Y B;  2SDF A;  2XNA C;  3TZU A;  4DV3 L;  5J39 A;  4S3S A;  4DV4 Q;  3HOX G;  2HDM A;  3RLN A;  3TP8 A;  5JPN C;  5CV7 A;  5LHY 1;  4FO2 A;  4JYA L;  3MXU A;  2AUJ D;  4BBR H;  2NB0 A;  2C9O A;  4JI7 Q;  4IJL A;  2MNA A;  1JR0 D;  1YHB A;  1LAB A;  4DV6 Q;  5DM6 3;  3SVM A;  4CJ1 B;  1S5F D;  1C7Y A;  4X65 L;  3DUZ A;  1TWF H;  2FXQ A;  5C5L A;  3HOU G;  1HUN A;  1EIG A;  3BYT B;  1SND A;  3DLL A;  3DXJ C;  2A6E D;  1XWE A;  2F0W A;  4DV4 L;  4L6T B;  4CDC C;  4LFB L;  4DK6 C;  3M9B A;  1RIP A;  1YI2 A;  1Q81 C;  3E9H A;  1U0L A;  3FPP A;  1ENC A;  5J3B A;  3V05 A;  4JI7 L;  3AEV A;  4R4T A;  4YHH Q;  4IFD J;  2G5D A;  4DV6 L;  3NPP A;  4NPS A;  1HFN A;  1X3Q A;  4DAY A;  2R7Z H;  1TR5 A;  2KEC A;  1X9N A;  2KUM A;  3MXN B;  1PLF A;  4MZ9 A;  2IJ0 A;  2F0V A;  3R93 A;  5KGU A;  5ELF A;  4PZ7 A;  1A6X A;  1JQY D;  1STY A;  1H95 A;  3R2T A;  3SK6 A;  4LK1 C;  4DR6 Q;  2A69 C;  4QY7 A;  1MI2 A;  2WP8 J;  1SAP A;  2ASB A;  4YWM A;  2SEB D;  1U9R A;  1TWC H;  4J8Q A;  1Z7T A;  4IZ8 A;  3SEB A;  3UDX A;  1EY8 A;  4LW1 A;  1RTO A;  1HNX Q;  1EWC A;  4YHH L;  3GV3 A;  3GTP H;  3CRK C;  4A3L H;  1Q1E A;  2F0D A;  4GOP C;  2WAQ B;  1HHV A;  3Q0A A;  5J22 A;  2CH4 W;  1STE A;  3RMH A;  3S1M B;  1P8L A;  1U4R A;  1L1O C;  4YWL A;  5M5X B;  4DR6 L;  1P16 A;  3I4N B;  2EY1 A;  3A7A B;  1SE8 A;  1Y69 U;  2VQE L;  5DEH A;  4ZCK A;  1A63 A;  1XTC D;  1HNX L;  5EQ0 A;  5IGG A;  3JAM c;  3HOZ H;  4JOI C;  5IIF A;  2QA4 A;  1PRT C;  1K83 B;  4P2C B;  4X62 Q;  1AZQ A;  3OIP A;  2D0O A;  2NUC A;  3GTG H;  3RZO H;  2VUM H;  1LTS D;  2B2W C;  4PZ8 A;  3RZD B;  1A3T A;  1I4R A;  1Z9F A;  4GOP A;  1EZ8 A;  1PH6 A;  5DNF A;  4BXX H;  3A8J E;  2AUK A;  1I6H B;  1OXX K;  2QEJ C;  1G2S A;  4GNX C;  4KHP Q;  5JOB A;  1PH1 A;  4JI5 Q;  3GTK H;  2GVA A;  1K8A C;  4JV5 Q;  3FRP B;  1HNW Q;  5I4D A;  4HAE A;  3QIA A;  4YIJ A;  3I4M B;  1JCK B;  5GRO A;  2EYF A;  1AW7 A;  4A3F H;  1F9S A;  4X62 L;  3PCO B;  1B53 A;  2CWP A;  1U4P A;  5EPK A;  5LMN Q;  4XYQ A;  1I4H A;  3E6Z X;  3HEJ A;  2EE1 A;  3NSW A;  1GHJ A;  3VYR A;  3TS0 A;  2PW5 A;  1R9T B;  2RCF A;  1MGS A;  4AYB E;  4DNI A;  5C4J H;  4KHP L;  3LX0 A;  3DM3 A;  4JI5 L;  2B2W A;  4JV5 L;  1EYG A;  1QE6 A;  5KIX A;  3OOC A;  4TVA B;  2PYK A;  1XNR Q;  1I5F A;  1HNW L;  1SNO A;  3PV0 A;  4X66 Q;  3C1F A;  2HCC A;  1SXT A;  1PH3 A;  4A3L G;  3H0G H;  4L5Q A;  2ZXP A;  2CKZ B;  4C2M B;  1IBM Q;  4R1J A;  2KED A;  1STA A;  1LT4 D;  4PV1 C;  4A3B B;  1B7Y B;  1K0R A;  3M3Y H;  1YNN D;  4O2D A;  1SRU A;  5LMN L;  2PZT A;  1IBL Q;  2H1E A;  3K8A A;  2HHH L;  4KKU A;  2MHV A;  4J15 A;  1KAA A;  4XIG S;  3SGI A;  1PVO A;  1WTR A;  1B3Q A;  4ZKB B;  2L12 A;  1D5M C;  1G6P A;  5C44 H;  4Z9C B;  4DR2 Q;  2AKW B;  1XNR L;  4X66 L;  1FGU A;  2QDB A;  4XQQ A;  3HOW G;  3TEH B;  2N88 A;  1IBM L;  4PMB A;  4OO1 I;  1H9R A;  1HRJ A;  2JA8 H;  5FKA C;  4DV0 Q;  1IBL L;  4DUZ L;  1Q3L A;  5COR A;  2VUM G;  1GUG A;  1LLR D;  4UPA A;  3KLW A;  4DA2 A;  1CTM A;  4XQJ A;  3ZYY X;  2YYZ A;  5FK9 C;  3HOV G;  4X3S A;  2EYP A;  4AYB B;  3K7U C;  3M85 A;  3G6J B;  3CHB D;  4KN4 C;  1HTL D;  1VQM A;  1PHJ A;  4XT1 B;  1B9N A;  2JE6 I;  4BY7 H;  1YBY A;  1X32 A;  1PH8 A;  1EY6 A;  4DV0 L;  5COY A;  4EQO A;  4OWW B;  1ONL A;  1DYQ A;  1PH5 A;  1N9W A;  2ICI A;  2JEB I;  5BN3 A;  4RGO S;  2JA7 B;  1IYJ B;  2I0Q A;  4C56 C;  4A3K G;  4CDD C;  4NXM Q;  2EDG A;  3OW2 A;  3JAM E;  3DM1 A;  1A3U A;  1BKB A;  1OXV A;  4CKE A;  1TWH H;  3KK7 A;  2RSO A;  3CC4 A;  3KF6 A;  1LO5 D;  5J1Z A;  1WTW A;  4GS3 A;  1LYL A;  2VW9 A;  2XRS D;  1VS0 A;  5F2D A;  1Q12 A;  3H0G G;  3S1M H;  4KN7 C;  5C4Z A;  3E5S A;  5M5X H;  1VQH A;  4IUR A;  4P71 A;  3KJP A;  2Z4H A;  2UXC Q;  3NHH A;  1FYC A;  3PIO A;  1E7Z A;  3R3O A;  4KHV A;  1ICW A;  4NXM L;  3PQI A;  2KHI A;  3X3M A;  1SYE A;  2ZTE A;  1YVC A;  1F2L A;  5K36 H;  3S1Q B;  3DWA A;  4P73 A;  1K83 H;  2QGQ A;  4G7H C;  5LMN W;  3RZD H;  3I8Z A;  2PZW A;  4R8I A;  1WJJ A;  4F7X A;  1YNX A;  2MPM A;  3CQZ B;  1PTO C;  1Q8K A;  2IT1 A;  2N8N A;  2EXD A;  4QCL A;  1B4O A;  4K6D A;  2R93 H;  2Q2T A;  1CKO A;  3RLO A;  2NTS A;  1OXS C;  2E2J B;  3I4M H;  3H3V C;  4DAM A;  3O13 A;  2HT1 A;  2ZTC A;  1JIC A;  4UP9 A;  1E22 A;  4A3C H;  2BDO A;  1XPO A;  1N34 Q;  1VQF A;  5BN5 A;  1KDC A;  5D14 A;  4M1U B;  1QVC A;  1TKW B;  2X69 A;  2VNU D;  1I4X A;  5JJZ A;  2DN8 A;  3VDY A;  3WOE A;  2F03 A;  1RDP D;  1HZA A;  2KEE A;  3AFQ A;  3CME A;  5L37 A;  1HH2 P;  1Q82 C;  1UUP A;  2PMZ E;  2MJ8 A;  1H9S A;  1PFN A;  1HXY D;  3OW7 A;  1OTC A;  2MO0 A;  1S5B D;  2WKC A;  1SYC A;  1NCV A;  2WAQ G;  5KNB A;  2YU9 B;  4A3B H;  5FO8 B;  3PIO 3;  2KVM A;  3K5O A;  4DK0 A;  1IKM A;  2E2D C;  5C3E H;  1E2V A;  2K75 A;  4OWX B;  2NVQ B;  1EWI A;  1AE2 A;  3V2T A;  1J8I A;  2NN6 I;  3I4N G;  1K9M C;  5JVH 3;  1M90 C;  3D4D A;  4R8N A;  4ZAI A;  1Z47 A;  3Q22 A;  1PYB A;  2MO1 A;  3EFX D;  3TRZ A;  3TS2 A;  1A3V A;  2E2I B;  3PF5 A;  2FMM A;  2VS1 A;  2K5W A;  4A76 A;  5K36 G;  1G29 1;  2WKD A;  2B2T C;  1VQE A;  5IYD H;  3ND9 A;  1W3S A;  4OWT B;  2OQK A;  3S1N B;  4LFA Q;  1KAW A;  1G2T A;  3QWN A;  1EFW A;  1D8L A;  2EIF A;  5M3M B;  2IY5 B;  3L2P A;  4NMZ A;  2JN4 A;  1KNE A;  4X3K A;  1YEZ A;  3HOY H;  4YY3 Q;  2PMZ B;  1LTG D;  4JI6 Q;  1OXT A;  2JA9 A;  1LTR D;  1YZ6 A;  4HIM A;  3UDG A;  4A3C G;  2CH4 A;  4ZYS A;  2MP1 A;  4BBR B;  4LFA L;  4A3D H;  1II3 A;  4KMU C;  4DK3 C;  3BVG A;  1PFM A;  4EQ5 A;  4RGT A;  1SJE D;  5JVG 3;  1B50 A;  3D31 A;  1XMO Q;  2B39 A;  1U5K A;  2BA1 A;  1TWF B;  4RGN A;  3QO2 A;  5I6Y A;  4YY3 L;  2UXB Q;  3CCJ A;  4JI6 L;  1B8A A;  3E0E A;  1A8V A;  1EY5 A;  1HQR D;  4KHZ A;  5D65 A;  2QW7 A;  2B2U C;  1BF4 A;  4ID6 A;  4A3B G;  2K7V A;  4P75 A;  3UE0 A;  2AWO A;  1PZJ D;  1VQI A;  1O80 A;  1D2B A;  1RL2 A;  5TSS A;  1PV4 A;  2F3I A;  2RF4 A;  1EIY B;  3C46 A;  3VR4 A;  2WV6 D;  3ICE A;  2R7Z B;  1MJE A;  3K5N A;  1XMO L;  4HCE A;  5CYU A;  3D6W A;  3VYU A;  3DWQ A;  3S1Q H;  2UXB L;  3D8G A;  1W6J A;  2K33 A;  5KNC A;  5H1S E;  4OXP A;  3UE1 A;  1QZH A;  1CKN A;  3BYY B;  1Q1B A;  3NUC A;  1BBX C;  4IPG A;  1LTB D;  3G4S A;  5EBC A;  5IYD G;  1TWC B;  4Y52 H;  1GHK A;  1G8Z D;  2EY6 A;  4DK1 A;  1FNW A;  2A69 D;  3CQZ H;  1D7Q A;  1ZKO A;  2F0U A;  3GTM B;  2B2U A;  1DD2 A;  4IFD G;  2QIL A;  3GO5 A;  4RHR A;  1BCP D;  1SNP A;  4YCV A;  2N55 A;  2SNM A;  4AYB G;  1QZG A;  2OXP A;  3NEN A;  3URY A;  1PH2 A;  1QNK A;  4C3J H;  1JWM D;  3TP6 A;  3SHL A;  3PIP A;  2FFK B;  1JE4 A;  3NWT A;  1JB7 A;  1VF7 A;  2A5H A;  1GO3 E;  5AJ3 Q;  1KXL A;  3G7L A;  1HA5 A;  3PUY A;  4JK1 C;  3GTJ H;  1STH A;  1SFO B;  3HOZ B;  1TU2 B;  2JA7 G;  1I3Q H;  4ZK9 B;  5I2Y A;  3S14 B;  2EYJ A;  4FDB A;  2QEX A;  3RN2 A;  2VB3 X;  2ZT9 C;  3GQB A;  1DOK A;  3AU7 A;  2A8V A;  1PRT D;  4K14 A;  2YU9 H;  2EYL A;  3PUV A;  3D6C A;  1LUZ A;  3KDF A;  1S72 A;  4ZUI A;  3KFU A;  3VR3 A;  4LF9 Q;  2PI2 A;  4FF4 A;  2NVQ H;  1X3E A;  5AJ3 L;  1K8M A;  2A1A A;  3J81 i;  5IGD A;  1YHQ A;  1O7L A;  3HRZ C;  4RGM A;  3CCL A;  1EL0 A;  3PUW A;  1X65 A;  4NB3 A;  3I55 A;  1UE6 A;  1RTN A;  4JC0 A;  2KCM A;  5IY0 A;  4A3F B;  3GTQ B;  1LV9 A;  1NNX A;  4GLA C;  4GLV B;  3U4Z A;  3ZJY C;  3SR1 A;  1FD7 D;  5IP9 G;  3GDE A;  3OHX C;  3RLF A;  3J7Y W;  4A3I H;  4XQN A;  2Q2H A;  5C4J B;  1B1Z A;  4IO9 A;  4L5T A;  1S5E D;  5M3M H;  1DCZ A;  1AN8 A;  2PNH A;  3UDF A;  2A68 C;  2Z6K C;  2JEA I;  5IGC A;  1HPC A;  4NDX A;  5CV5 A;  1GUT A;  1JC7 A;  5CC4 A;  1SE4 A;  3J7A F;  1STN A;  1GD7 A;  3FPU B;  3VA7 A;  1LAC A;  4EX5 A;  1D1K A;  2TSS A;  1M8A A;  3J80 L;  1UE1 A;  1IYU A;  1N33 Q;  2YTV A;  2XRQ D;  1EOT A;  3J81 L;  1S5D D;  1LT3 D;  2PQA B;  3N52 A;  4LFB Q;  2FJ2 A;  1PH9 A;  2NWG A;  2F0F A;  3CAM A;  4R4Q A;  3W1B A;  5IYB H;  5C44 B;  4GN3 B;  5C0X G;  4JI4 Q;  4ILW A;  1B44 D;  3I73 A;  3GTL B;  2QKI C;  2D9U A;  2ATW A;  2B3G A;  2D62 A;  5IT9 c;  2PQE A;  2JA8 B;  4QQB X;  3E9I A;  5M5W B;  1N33 L;  2L15 A;  2QDL A;  3MTS A;  1CA5 A;  3CC2 A;  2ICE C;  2YV5 A;  1XX8 A;  1EIF A;  1JWS D;  1EOV A;  1VQ8 A;  1L0Y B;  4RAU C;  4LUZ A;  1VQ7 A;  4LF4 Q;  4JI4 L;  3R2I A;  3A5Z B;  4DR4 Q;  3L7Z C;  3T53 B;  1GOZ A;  1NR4 A;  2K5H A;  2YTY A;  5C3W A;  4BY7 B;  4UP7 A;  2LS0 1;  2YTX A;  2OEO A;  3UI2 A;  4QF4 A;  5I2X A;  5IP7 G;  1YJN A;  3M7G A;  4Q0F A;  1B2T A;  3CP0 A;  1PMR A;  3H6M A;  2IX0 A;  1TS4 A;  1DON A;  4FXD A;  2VQE Q;  1BCP C;  1CHQ D;  4O0A A;  4LF5 Q;  2ALY B;  1WTV A;  3CXC A;  1O7Y A;  2B8G A;  4DNT B;  2M9V A;  1UEB A;  4LF4 L;  3GTM H;  1JJG A;  1EQV A;  4NW2 A;  5M3M G;  4DR4 L;  4H0L C;  1TWH B;  3K6O A;  4C1N K;  2JA6 H;  1MKH A;  3IFD A;  2K6A A;  5JJK A;  3PO2 H;  3NEL A;  2RKS A;  4BS9 A;  2R92 B;  1ET9 A;  1PH4 A;  1KLG D;  1ILQ A;  2E74 C;  1L0W A;  3K0X A;  3MHB A;  2I07 B;  5FLX c;  4RG1 A;  3F8T A;  4LF5 L;  1LTA D;  4F88 A;  4LF8 Q;  4HJ9 A;  1C0A A;  3VA5 A;  4BBR G;  2X6L A;  1SFO H;  1ESR A;  3VR2 A;  3S14 H;  1NMF A;  3U9S A;  4XT3 B;  5BR8 Q;  1CQF A;  1KRS A;  1KTK A;  5KEE A;  4HJ8 A;  4Q5V A;  2SOB A;  1V1P A;  2WIN B;  4RKL A;  4X64 Q;  4OO1 H;  2RDH A;  4HID A;  1J6Q A;  2LXK A;  2AMC B;  4IN3 A;  2K52 A;  4IUV A;  5CR3 A;  3M4Y A;  5HUR A;  4LF8 L;  4JBM A;  4XYO A;  2JJQ A;  3LWE A;  2R93 B;  1WCM B;  1L1O A;  1PTO D;  2HIV A;  5K5P A;  4LMQ D;  4LF6 L;  1NY4 A;  1X56 A;  1Y1V H;  5BR8 L;  2R7Z G;  4DF7 A;  3GTQ H;  1VF5 C;  1DJR D;  3NWS A;  5ELO A;  5IGB A;  1N8R C;  3IFT A;  4X64 L;  1HZC A;  1T5E A;  1FL0 A;  4JOI A;  4JI3 L;  4B3M Q;  1GUN A;  1S40 A;  2HHH Q;  1NE3 A;  1F9Q A;  4ZRZ A;  5I9O A;  4MHE A;  3DEO A;  3H3V I;  4DN4 M;  1CT1 D;  1QUQ B;  5C0X J;  5CV9 A;  1VQ9 A;  4DAP A;  4GN4 B;  4K5W A;  3A7L A;  4GNX A;  2MGS A;  4F8M A;  2E8G A;  1XPR A;  1C9O A;  4YCW A;  5IT9 E;  4DAY B;  1JT8 A;  1FR3 A;  3I70 A;  1WVL A;  1F2Z A;  4DUZ Q;  4WRD A;  1KDB A;  4B3M L;  5C3E B;  2ZJQ A;  1SYF A;  2F0M A;  1QG7 A;  2A73 B;  2CW0 C;  2EY2 A;  2LMC B;  4C3I H;  1VQ5 A;  3SE0 A;  5FOB B;  2EXZ A;  1VQA A;  4A3M H;  1GKH A;  4JBJ A;  4K5X A;  2R3Z A;  1MIU A;  4KKT A;  5ISR A;  1X6O A;  3GD7 A;  3GTL H;  3CW2 C;  3HOZ G;  3C2P A;  3TSS A;  5ELD A;  2DJG C;  3C1E A;  4PG3 A;  3EVQ A;  5GQO A;  1VQK A;  1F2Y A;  5JAV A;  1M4V A;  4BWG B;  1STG A;  4H13 C;  4N8X 1;  5M5W H;  2CQO A;  2RHQ B;  4KD4 A;  3EBE A;  1PZI D;  2K5Q A;  5LL6 X;  4OO1 G;  2N3S A;  4BXX G;  1CSP A;  3CCU A;  5GAE C;  5C4X B;  2RSN A;  1NUC A;  1KRT A;  1V8Q A;  2B63 H;  1IBK Q;  4WJ4 A;  1WTH A;  4DPG A;  3HOY B;  4QUC A;  5EKK A;  1DZ1 A;  3OSO A;  4IPC A;  1NAP A;  2F0N A;  2N49 A;  4DV5 Q;  4A3F G;  2E76 C;  4JPB W;  3T4A C;  4DV2 Q;  2B8F A;  2WB1 E;  3NBH A;  2IX3 A;  4RHS A;  3S17 B;  2EOT A;  2MFI A;  3K7A H;  1DXM A;  2R7F A;  4LUV A;  4A3D B;  5FLX E;  4ALP A;  2IPK D;  2OWO A;  1HZB A;  4GOP B;  1D6E C;  2NZO A;  2LY7 A;  4K6L A;  2F0O A;  4KV6 A;  2JK8 A;  3T16 A;  1IBK L;  2BCO A;  2HD3 A;  2JXM B;  3D4R A;  1WYD A;  5A2Q E;  4KY6 A;  3NBI A;  3K59 A;  4OHJ A;  4DV5 L;  2R92 H;  2L0C A;  4DV2 L;  1X3G A;  4KLK A;  2A6H C;  1DOM A;  3Q8D A;  4L63 B;  3SK5 A;  5IYC H;  1S4Z A;  1VQB A;  1Y8N B;  4OIJ A;  3TME A;  1SN8 A;  1SNQ A;  4JBK A;  2XGT A;  4C1N I;  2NN6 H;  2CFM A;  4ME5 A;  2VB2 X;  4BBS B;  5C44 G;  1K0S A;  3UDI A;  3F2D A;  1R4P B;  2WFW A;  2F4V L;  1EYA A;  1IW7 C;  3L9A X;  4KY7 A;  5E1F A;  3BVM A;  2EPB A;  1NTG A;  3A55 A;  1SRO A;  2JQO A;  4B9X A;  2JA8 G;  3IRB A;  4A3E B;  1K3R A;  3ERS X;  4DNR B;  2XWJ B;  3I72 A;  4HSV A;  4XTC S;  4OX9 Q;  1ET6 A;  4K8J A;  1SSO A;  1WCM H;  1EEF D;  5GAG C;  1I6V C;  3BJU A;  5KYI A;  4B3T L;  1KD1 C;  4C3J B;  2BH8 A;  3RN5 A;  3NE5 B;  2KQ3 A;  1I94 Q;  3AYH B;  1D1I A;  3GP7 A;  3PMF A;  4BY7 G;  5G3L D;  1V1O A;  5LL6 S;  2NVY B;  3RUZ A;  4OX9 L;  3CCM A;  1XJV A;  4XXE A;  2BOS A;  3GTJ B;  3I90 A;  2EYM A;  1NR2 A;  5ELC A;  3T1Y Q;  1I3Q B;  2GA4 B;  4X6A H;  5JPM C;  4APV A;  5EBD A;  4F87 A;  4H7B A;  4HTH A;  3GTO B;  1EQQ A;  1KC8 C;  1I94 L;  2VZA A;  2RDG A;  1QWY A;  2FMC A;  3R8B A;  4FXK C;  3JAM L;  2RA4 A;  2K05 A;  4H44 C;  1PFB A;  5D3D A;  2ZXR A;  5IGF A;  4LF7 L;  2R92 G;  5I9P A;  3ITP A;  4HJ5 A;  2K5N A;  4UHV A;  5A2Q L;  5JEA H;  1S5C D;  1X55 A;  1Q90 A;  3H09 A;  3OMC A;  4U67 3;  2XWB B;  4JBW A;  3T1Y L;  1WTO A;  3HGB A;  2B2V C;  5FO9 B;  2NN6 G;  4GN5 A;  3L0O A;  2KBN A;  2Z1C A;  4IPD A;  1Y1W B;  1WFQ A;  3U58 A;  2XN9 C;  2PPB C;  2QCP X;  1WTP A;  5E4X A;  3G6E A;  3KF6 B;  4A3I B;  1O7I A;  2O2L D;  2EJM A;  2H5X A;  4FVM A;  2F0S A;  2JP1 A;  3M4P A;  4K0K L;  1E24 A;  3CKI B;  1CZW A;  3A8I E;  1MSH A;  1EWH A;  5C4X H;  4RWS C;  4DR1 Q;  2E75 C;  2N78 A;  2R93 G;  1WCM G;  1SNM A;  2A68 D;  1TWG H;  2NVT B;  3I4M G;  3FHW A;  3I4L A;  1QVG A;  1W2B A;  1BNZ A;  2EJG C;  3W3A A;  4O42 A;  4HIK A;  1HR0 L;  5T1G A;  2F1M A;  1CM9 A;  1NBW A;  3S17 H;  1AFP A;  1LM0 A;  3IL8 A;  2Z8L A;  4IAL A;  4DXF A;  4UDU C;  4R4O A;  2NYZ D;  2B2T A;  1CA6 A;  5IE8 A;  4G7Z C;  1FGB D;  4DR1 L;  1IKL A;  1D5Z C;  1ZYR C;  3EN2 A;  2NZH A;  4UAI A;  4AH6 A;  2NVX H;  4TRD A;  3TBI B;  4A3G H;  1ROD A;  2G9H D;  3F2U A;  1JOO A;  3JC6 6;  5IGE A;  4Y7N H;  4UP8 A;  2AWN A;  1JJ2 A;  5CV8 A;  3LGJ A;  3T13 A;  1PFS A;  4ZKC B;  4MTN A;  4C3H B;  3OMG A;  4ME3 A;  3MC0 B;  5C3E G;  2BDN A;  1BCP F;  1XXG A;  1TS5 A;  5CV4 A;  1LT5 D;  2K04 A;  1EU3 A;  4CBV A;  5KRU A;  1XPU A;  3BZK A;  1EZ6 A;  3FEW X;  4QMG A;  4BBS H;  1G91 A;  4K2K A;  4POG A;  1RD9 D;  3KBX A;  3BG3 A;  2I5M X;  3TP7 A;  3QG1 A;  1EY4 A;  2F0E A;  1F77 A;  1CHP D;  1H9S B;  1Q8I A;  2DGY A;  3BZC A;  4CDF C;  3MVV A;  3FKI B;  4KKS A;  1B70 B;  3MEH A;  3KF8 B;  4A3E H;  2GN5 A;  3HG9 A;  1EIH A;  1WTX A;  2V1C C;  3FMC A;  2I46 A;  1O7Z A;  1I50 H;  1C4Q A;  1GXD C;  3T56 B;  2K14 A;  1GJX A;  1PDQ A;  1LTI D;  3D4W A;  3HKS A;  4MNO A;  2CVR A;  5EKI A;  4KK7 A;  5C4X G;  1PRT F;  2JA6 B;  3OWF A;  1GUW A;  2PCF B;  1X54 A;  1CUK A;  3PO2 B;  3HOY G;  1S3O A;  2KCT A;  2FIN B;  4AIM A;  4IFD I;  4NXN Q;  3KUP A;  4O1N A;  4HSP A;  2R61 A;  2NVY H;  2Q2I A;  1HTP A;  1E2W A;  3BZD B;  3PUZ A;  4BA1 I;  1BVS A;  1HJP A;  2PO4 A;  3WDN A;  1XMQ Q;  2CWA A;  1LTT D;  2L1B A;  4A3D G;  1D5X C;  2Z4I A;  4HED A;  4I7A A;  1BOS A;  2UXD Q;  2KJX A;  2PZU A;  1SMY C;  5JJI A;  2Y0S E;  1A2T A;  2UU9 Q;  1A62 A;  1FNV A;  2Q2U A;  4TSS A;  4DFA A;  3GTO H;  3L3O C;  3U50 C;  3M4Q A;  5KYL A;  4B9W A;  2KCN A;  4NXN L;  4TKO B;  4WFN 3;  2R6G A;  2OTJ A;  5ELN A;  3MXN A;  2C35 B;  2KA7 A;  2PW7 A;  4JI0 Q;  3J80 i;  2JYO A;  4DV7 Q;  1WOC A;  1XMQ L;  3RR5 A;  2O5I C;  2UUA Q;  1MD2 D;  3DHQ A;  1IXR A;  5JJL A;  2UXD L;  1W6K A;  1Y1V B;  1UEA B;  4IPH A;  2UU9 L;  4A3J B;  1C8C A;  2KEN A;  1Y1W H;  4BBS G;  1TWA B;  4QB4 A;  1GUO A;  1NJI C;  3AB9 A;  2L55 A;  3EIV A;  5CBE E;  4IJH A;  3S2H H;  2RBM A;  1JJC B;  2HQL A;  5GAD C;  4CJ2 C;  4JI0 L;  3BDL A;  4OL7 A;  3SK8 A;  3WWV A;  4DV7 L;  1KAB A;  1JOQ A;  4A3E G;  2CQA A;  2ZXO A;  4NP5 A;  2UUA L;  5T1I A;  1JOK A;  4QIW E;  3S15 B;  1MHW C;  3PIP 3;  2F3V A;  2SNS A;  3A54 A;  3S2D B;  1TT2 A;  2XVS A;  4KY5 A;  2A19 A;  1RF2 D;  2X6G A;  4HR7 B;  3C3L A;  1KIX A;  2NVT H;  2Y0S B;  1ZXT A;  4N9P A;  3QOL A;  4C3J G;  2MUY A;  3U9O A;  4MN3 A;  4V0B A;  2CCZ A;  2ENB A;  2Q8T A;  4C3I B;  3CC7 A;  2PI2 E;  3X3N A;  4DR3 Q;  2F52 A;  1MJC A;  1CKN B;  4A3M B;  2VL6 A;  1TQO A;  3QJY A;  4QUF A;  2CW0 D;  2E5L Q;  1C48 A;  4JI8 Q;  3ULJ A;  4IUN A;  2EJF C;  1QB5 D;  1TS2 A;  2A74 C;  3NK9 A;  4PMW A;  1SYD A;  4FP5 D;  2K01 A;  4BY1 B;  1TXY A;  1HA6 A;  1E0B A;  4U68 A;  1I4P A;  1K8G A;  4PQX A;  4CDE C;  5C0X I;  1RJT A;  2Z6K A;  1SE3 A;  4L5S A;  3MFY A;  1V9P A;  5EGT A;  1TII D;  1AP0 A;  4C3H H;  5EAY A;  2ZTD A;  4HN7 A;  3CRL C;  5FLM H;  4B3R L;  2WAQ E;  4DR3 L;  3S1R B;  4GKJ Q;  4KD3 A;  4LWC A;  1NSN S;  4R4C A;  2E5L L;  5HY6 A;  3FP9 A;  4IOA A;  4JI8 L;  3HP3 A;  2KCC A;  2B63 B;  1YIJ A;  4DXG A;  4DU9 A;  4QIW B;  1CZG A;  2VQF Q;  2F0K A;  1SBB B;  1FJG Q;  1QUQ A;  3K0Y A;  1Y1W G;  3CCV A;  4XDX A;  3FKI H;  4X3U A;  1KHI A;  1PTO H;  5IOD A;  2RDF A;  3K7A B;  3NTH A;  1JB3 A;  3LWU A;  4A3I G;  3J7A 5;  3KDF B;  5DM7 3;  4GKJ L;  4J1M A;  1WI5 A;  2F0T A;  1VQD A;  2CHB D;  3DMU A;  1QOH A;  3H3V H;  2EY5 A;  3HZX A;  4LAA A;  3NP8 A;  3ER0 A;  5AFW A;  1EY0 A;  2JA5 B;  4ABN A;  1J9O A;  2VQF L;  1V43 A;  4M8A A;  5M5Y H;  4POF A;  1IZ6 A;  1FJG L;  1EYD A;  2BA0 A;  1ICF B;  3BDO A;  3P1H A;  4JW0 A;  3STB D;  2KOL A;  5A35 A;  1WD0 A;  3M7N A;  5DAU A;  3SK4 A;  1L0X B;  2LSS A;  1SEB D;  1EUJ A;  3A5U A;  4A93 B;  3KLS A;  3K80 C;  4EQN A;  2A6H D;  1PTO F;  4G7O C;  1K8O A;  4HJ7 A;  4CGY B;  3S16 H;  1AZP A;  2K4K A;  4B08 A;  1HNZ Q;  2BE5 D;  3K57 A;  5IYB G;  5M3F B;  3B6Y A;  5M9O A;  4LF6 Q;  1YNJ D;  4DKA C;  1H9J A;  3W2D A;  3J7Z C;  2RQX A;  2EYH A;  4CKB A;  1MSG A;  4J6H A;  1RHP A;  5CBA E;  4HJA A;  3NEM A;  1CI3 M;  2XSC A;  1A0I A;  2IL8 A;  1CQV A;  4JI3 Q;  1IW7 D;  4RMF A;  4OEL B;  2P5Z X;  3H94 A;  4FF3 A;  5C6A A;  3I56 A;  1AEX A;  3HOW H;  4C3H G;  4QL5 A;  2K5D A;  5FLM G;  2ID0 A;  4YWK A;  1HNZ L;  4YCU A;  2IHF A;  3PF4 A;  1STB A;  2EQS A;  4FF2 A;  1EEI D;  4A3J H;  1CFM A;  1YJW A;  1BDO A;  1TWA H;  1BUV T;  2Z9H A;  4E6I A;  1SMX A;  1X3F A;  2F0L A;  3HOV H;  3KLS X;  2E2H B;  1KNA A;  3WOF A;  3MAQ A;  3ERO A;  1BQQ T;  2F0P A;  3MFG A;  3FKI G;  3ERQ A;  2XTI A;  5LMU Q;  3I3C A;  1U4M A;  3H15 A;  2J0T D;  3S15 H;  1EQT A;  3S2D H;  2ES2 A;  5I6W A;  1LT6 D;  2R7D A;  3I2Z A;  2JA6 G;  1VMP A;  4ODG A;  4JI2 Q;  4A3K H;  3PO2 G;  1ASZ A;  3FDT A;  4CKC A;  1JOR A;  1RCV D;  5LMU L;  4QGU A;  5E7N A;  2L4N A;  3G71 A;  3S9W A;  4IUP A;  1QIL A;  1U4L A;  4RA8 A;  2JSO A;  3BS1 A;  3AFP A;  2NTT A;  3PUX A;  1VMC A;  4LJZ C;  4LNQ A;  3NTI A;  4BY1 H;  3MA2 B;  1E1O A;  4PNY A;  2Q8I B;  3W5O A;  1AE3 A;  1I4G A;  1JWU D;  3NQI A;  1ZEQ X;  2L11 A;  4FXG C;  3P7J A;  3CCR A;  4JI2 L;  2HDL A;  1Q46 A;  3HKZ E;  1E2Z A;  1YJ9 A;  1VQ6 A;  4GKK Q;  3LNN A;  5DLQ E;  3S1R H;  1CSQ A;  1H9M A;  4K5V A;  2GVB A;  4K8I A;  1Q86 C;  3VYS A;  1JE5 A;  2A6E C;  2IWH A;  1X3P A;  1TWG B;  1SNC A;  1XTD A;  3KOJ A;  2O5J C;  1Y1V G;  1PXU A;  3PSI A;  4A3J G;  2OT2 A;  5HGQ A;  2OTL A;  1BCP B;  5E4W C;  4GKK L;  4QJF A;  4HMJ A;  1L2F A;  1K3B C;  4DR2 L;  1V1P B;  1M1K C;  3H91 A;  2C5C A;  3K5M A;  1XYI A;  3EJI A;  2PNR C;  4DAV A;  3BDC A;  1EY9 A;  2NVX B;  4A3G B;  2AQ2 B;  1Y8P B;  3STB C;  2VY3 A;  2JA5 H;  1ZYR D;  4Y7N B;  1L1O B;  2F4V Q;  2G9D A;  3E3X A;  1IYV A;  1KL9 A;  1HCZ A;  3SDZ A;  2Y0S G;  4CJ0 B;  4A93 H;  1VQC A;  3AMU A;  1E3P A;  2ZJP A;  3PO3 B;  1UE7 A;  2UUC Q;  3T51 B;  2BE5 C;  3OPO A;  5IT9 L;  1GM5 A;  3K81 C;  4GZY C;  3HKZ B;  4C3I G;  1OXU A;  2DUD A;  1YNJ C;  2I5L X;  1PRT B;  1BBW A;  3D0F A;  3K58 A;  4A3M G;  1KLU D;  3A74 A;  5M3F H;  1EFI D;  2AQ3 B;  4IUQ A;  4EQP A;  4B3T Q;  4DR7 Q;  3A8K E;  5G3L F;  1VQO A;  1IL2 A;  1K28 A;  4JG2 A;  1BBU A;  4R9W A;  1FVI A;  1TVX A;  3I4N H;  2K32 A;  4BY1 G;  4GNX B;  5C3X A;  3F2B A;  1VQP A;  1KDA A;  3P75 A;  5NUC A;  2LKV A;  2HIX A;  5FJ8 H;  3JAM i;  3A56 A;  4OEM B;  2WB1 B;  2UUC L;  2NBF A;  3D3R A;  4WOR A;  1I50 B;  3T1H Q;  2RCN A;  3IAY A;  2AQ1 B;  2QF7 A;  3W1G A;  3MXP A;  4N8F A;  3CPF A;  5IWA Q;  4HCS A;  2F0J A;  4DR7 L;  3KYH C;  3P20 A;  1GVP A;  4OGQ C;  2B63 G;  3VYT A;  1SR3 A;  3TP5 A;  4NKL A;  3ULP A;  2UXC L;  3TN2 A;  1I6H H;  1EYC A;  3Q6S A;  2KHJ A;  2IHE A;  2K1B A;  4LF7 Q;  2E2H H;  3ULL A;  1F9P A;  2WII B;  2DY7 A;  2L5T A;  4RH6 A;  5C5M A;  1BR9 A;  5C4H A;  4ZQ3 A;  1V1Q A;  1KQS A;  1ENF A;  3T1H L;  1UE5 A;  2RHS B;  1DGS A;  5IOC A;  1J5E Q;  2D5D A;  4ZUJ A;  3G48 A;  2ZM6 Q; 
#chains in the Genus database with same CATH homology
 4WJW A;  2IW3 A;  1FNU A;  3HOX B;  5EKL A;  5FLX L;  1SMY D;  3NTK A;  3I91 A;  4RCO A;  3VR6 A;  3M4O B;  4X3T A;  1CK1 A;  1WTQ A;  2OF1 A;  3HOU B;  1YNN C;  1I4Q A;  3RD4 A;  3GV6 A;  3KF8 A;  1B9M A;  3NQT A;  2RVL A;  1ILP A;  4G4K A;  1A2U A;  3OIQ A;  1DOL A;  1RKN A;  5EPL A;  3NXW A;  3IKJ A;  3S2H B;  5CMD A;  2J7Z A;  4KJN A;  1SYB A;  3FVQ A;  5FO7 B;  2F4I A;  3BVZ A;  2B2Y C;  2M00 A;  5BN4 A;  1UAP A;  3V96 A;  5ELB A;  2M2L A;  5D3I B;  2B2V A;  5KND A;  1VDZ A;  2LFN A;  4ULL A;  1PYW D;  4IFD H;  2D2C C;  3OWE B;  4KJO A;  2L9H A;  1ML0 D;  1BXT A;  1VCI A;  1SDF A;  4I65 A;  3TDQ A;  2F0I A;  3HS0 C;  1BO0 A;  4IUU A;  2B2Y A;  5HGT A;  1SYG A;  2IX1 A;  1F9R A;  1IHZ A;  5JEA G;  1TY2 A;  2XIW A;  3VR5 A;  4ZLT F;  4KTA A;  1GUS A;  5E3F A;  4PMC A;  5EPJ A;  1PTO B;  2NZ1 D;  2DY8 A;  1EY7 A;  3Q24 A;  3ONA B;  2V4D A;  3QB3 A;  2EVB A;  3KBG A;  1IL8 A;  1T5X D;  2O4X A;  3KLR A;  4FNF A;  1F2M A;  1WD1 A;  1SE2 A;  3SXH A;  5M5Y B;  1ESF A;  1B3A A;  3N6R A;  1Z6H A;  3GTP B;  2FHT A;  3J80 E;  3J7A V;  1HUM A;  3S16 B;  2VXW A;  3J81 E;  3K5L A;  2DNE A;  1G6Z A;  1R4Q B;  4I7Z C;  1TS3 A;  4BA2 I;  4MIU A;  3MZ5 A;  2J4X A;  2K28 A;  4RCN A;  4G57 A;  5C0X H;  4CHT B;  1O78 A;  2HCI A;  3HOW B;  3DEP A;  3EA6 A;  2DNC A;  3TZD A;  4EGV A;  4DGZ A;  4L8J A;  2KHS A;  3MWY W;  4V19 0;  3GTG B;  3RZO B;  2VUM B;  4KI0 A;  1SJH D;  2K03 A;  4HMI A;  3CU7 A;  4IUT A;  2WAC A;  2HUG A;  3HOV B;  2F0H A;  2F0Q A;  1EU4 A;  3EQL C;  4N9T A;  1QNU A;  5ELE A;  3MXG A;  2HQE A;  3GTK B;  1OO9 B;  1HFG A;  1TY0 A;  3DWP A;  2F3W A;  4RKB A;  1UNS A;  2TMP A;  4FF1 A;  2Q8R E;  2EZV A;  1MBY A;  1HQM C;  2F0G A;  2H4O A;  1A15 A;  5EJW A;  4OIK A;  4RFB A;  4FYD A;  1DM0 B;  3ND8 A;  3Q23 A;  1H9K A;  5CGK A;  4A3K B;  4K2L A;  1PZK D;  4EVO A;  3E0J A;  1Y8O B;  1ENA A;  2EYO A;  4IQZ A;  5CV6 A;  5JEA J;  4TQU S;  1QJO A;  1QCB D;  3QOJ A;  3H0G B;  3M3Y B;  2SDF A;  2XNA C;  3TZU A;  5J39 A;  4S3S A;  2HDM A;  3TP8 A;  5JPN C;  5CV7 A;  5LHY 1;  4FO2 A;  3MXU A;  2AUJ D;  2NB0 A;  2C9O A;  1JR0 D;  1LAB A;  5DM6 3;  3SVM A;  4CJ1 B;  1S5F D;  3DUZ A;  5C5L A;  1HUN A;  1EIG A;  3BYT B;  1SND A;  3DXJ C;  2A6E D;  1XWE A;  2F0W A;  4L6T B;  3FPP A;  1ENC A;  3V05 A;  4IFD J;  1HFN A;  3NPP A;  1X3Q A;  4DAY A;  1TR5 A;  2KEC A;  2KUM A;  1PLF A;  2IJ0 A;  2F0V A;  3R93 A;  5KGU A;  5ELF A;  1A6X A;  1JQY D;  1STY A;  3R2T A;  3SK6 A;  4LK1 C;  2A69 C;  1MI2 A;  2WP8 J;  1SAP A;  2SEB D;  1U9R A;  4J8Q A;  1Z7T A;  4IZ8 A;  3SEB A;  1EY8 A;  1RTO A;  1EWC A;  3GV3 A;  3CRK C;  1Q1E A;  2F0D A;  2WAQ B;  1HHV A;  3Q0A A;  5J22 A;  1STE A;  3RMH A;  3S1M B;  1U4R A;  5M5X B;  3I4N B;  2EY1 A;  3A7A B;  1Y69 U;  5DEH A;  1XTC D;  5EQ0 A;  5IGG A;  5IIF A;  1PRT C;  1K83 B;  4P2C B;  1AZQ A;  3OIP A;  2NUC A;  1LTS D;  2B2W C;  3RZD B;  1A3T A;  1I4R A;  1EZ8 A;  5DNF A;  3A8J E;  2AUK A;  1I6H B;  1OXX K;  2QEJ C;  1G2S A;  5JOB A;  3FRP B;  5I4D A;  4HAE A;  3QIA A;  4YIJ A;  3I4M B;  1JCK B;  2EYF A;  1AW7 A;  1F9S A;  1B53 A;  1U4P A;  5EPK A;  4XYQ A;  1I4H A;  3E6Z X;  3HEJ A;  2EE1 A;  3NSW A;  1GHJ A;  3VYR A;  2PW5 A;  1R9T B;  1MGS A;  3LX0 A;  2B2W A;  1QE6 A;  5KIX A;  3OOC A;  2PYK A;  1SNO A;  3PV0 A;  3C1F A;  2HCC A;  1SXT A;  2ZXP A;  4C2M B;  2KED A;  1STA A;  1LT4 D;  4PV1 C;  4A3B B;  1YNN D;  2PZT A;  2H1E A;  4KKU A;  2MHV A;  1KAA A;  4XIG S;  1WTR A;  4ZKB B;  2L12 A;  1D5M C;  4Z9C B;  2QDB A;  4XQQ A;  2N88 A;  4PMB A;  4OO1 I;  1H9R A;  1HRJ A;  5FKA C;  1Q3L A;  5COR A;  1GUG A;  1LLR D;  4DA2 A;  1CTM A;  4XQJ A;  3ZYY X;  2YYZ A;  5FK9 C;  4X3S A;  2EYP A;  4AYB B;  3M85 A;  3G6J B;  3CHB D;  4KN4 C;  1HTL D;  4XT1 B;  1B9N A;  2JE6 I;  1X32 A;  1EY6 A;  5COY A;  4EQO A;  1ONL A;  1DYQ A;  2ICI A;  2JEB I;  5BN3 A;  4RGO S;  2JA7 B;  4C56 C;  2EDG A;  3JAM E;  3DM1 A;  1A3U A;  1OXV A;  4CKE A;  3KK7 A;  2RSO A;  1LO5 D;  5J1Z A;  1WTW A;  2XRS D;  5F2D A;  1Q12 A;  4KN7 C;  5C4Z A;  3E5S A;  4IUR A;  2Z4H A;  3NHH A;  1FYC A;  3R3O A;  4KHV A;  1ICW A;  3X3M A;  1SYE A;  1F2L A;  5K36 H;  3S1Q B;  3DWA A;  4G7H C;  3I8Z A;  2PZW A;  4R8I A;  4F7X A;  2MPM A;  3CQZ B;  1PTO C;  2IT1 A;  4QCL A;  1B4O A;  4K6D A;  2NTS A;  1OXS C;  2E2J B;  3H3V C;  3O13 A;  1JIC A;  2BDO A;  5BN5 A;  1KDC A;  5D14 A;  4M1U B;  2X69 A;  1TKW B;  2VNU D;  1I4X A;  5JJZ A;  2DN8 A;  3WOE A;  2F03 A;  1RDP D;  2KEE A;  1UUP A;  2MJ8 A;  1H9S A;  1PFN A;  1HXY D;  3OW7 A;  1S5B D;  2WKC A;  1SYC A;  1NCV A;  5KNB A;  2YU9 B;  5FO8 B;  3PIO 3;  2KVM A;  3K5O A;  4DK0 A;  1IKM A;  2E2D C;  1E2V A;  2NVQ B;  3V2T A;  1J8I A;  2NN6 I;  5JVH 3;  3D4D A;  4R8N A;  4ZAI A;  1Z47 A;  3Q22 A;  3EFX D;  1A3V A;  2E2I B;  2FMM A;  2K5W A;  5K36 G;  1G29 1;  2WKD A;  2B2T C;  3ND9 A;  3S1N B;  1G2T A;  3QWN A;  5M3M B;  4NMZ A;  1KNE A;  4X3K A;  2PMZ B;  1LTG D;  1OXT A;  1LTR D;  4ZYS A;  2MP1 A;  4BBR B;  1II3 A;  4KMU C;  3BVG A;  1PFM A;  1B50 A;  4RGT A;  1SJE D;  5JVG 3;  3D31 A;  2B39 A;  2BA1 A;  1TWF B;  4RGN A;  3QO2 A;  5I6Y A;  1EY5 A;  1HQR D;  4KHZ A;  5D65 A;  2B2U C;  1BF4 A;  4ID6 A;  2K7V A;  2AWO A;  1PZJ D;  1O80 A;  1D2B A;  5TSS A;  3C46 A;  3VR4 A;  2WV6 D;  2R7Z B;  3K5N A;  4HCE A;  5CYU A;  3D6W A;  3VYU A;  3DWQ A;  3D8G A;  1W6J A;  2K33 A;  5KNC A;  3BYY B;  1Q1B A;  3NUC A;  1BBX C;  1LTB D;  5EBC A;  1TWC B;  1GHK A;  1G8Z D;  2EY6 A;  4DK1 A;  1FNW A;  2A69 D;  1ZKO A;  2F0U A;  3GTM B;  2B2U A;  1DD2 A;  4IFD G;  2QIL A;  3GO5 A;  4RHR A;  1BCP D;  1SNP A;  2N55 A;  2SNM A;  2OXP A;  3URY A;  1QNK A;  1JWM D;  3TP6 A;  3SHL A;  2FFK B;  1JE4 A;  3NWT A;  1VF7 A;  2A5H A;  3G7L A;  1HA5 A;  3PUY A;  4JK1 C;  1STH A;  1SFO B;  3HOZ B;  1TU2 B;  4ZK9 B;  5I2Y A;  3S14 B;  2EYJ A;  2VB3 X;  2ZT9 C;  3GQB A;  1DOK A;  3AU7 A;  1PRT D;  4K14 A;  2EYL A;  3PUV A;  3D6C A;  4ZUI A;  3VR3 A;  4FF4 A;  1K8M A;  5IGD A;  1O7L A;  3HRZ C;  4RGM A;  1EL0 A;  3PUW A;  1RTN A;  4A3F B;  3GTQ B;  1LV9 A;  3SR1 A;  1FD7 D;  3OHX C;  3RLF A;  3J7Y W;  4XQN A;  5C4J B;  1B1Z A;  1S5E D;  1DCZ A;  1AN8 A;  2A68 C;  2JEA I;  5IGC A;  1HPC A;  4NDX A;  5CV5 A;  1GUT A;  1JC7 A;  5CC4 A;  1SE4 A;  3J7A F;  1STN A;  3FPU B;  3VA7 A;  1LAC A;  1D1K A;  2TSS A;  1M8A A;  3J80 L;  1IYU A;  2XRQ D;  1EOT A;  3J81 L;  1S5D D;  1LT3 D;  3N52 A;  2FJ2 A;  2NWG A;  2F0F A;  5C44 B;  5C0X G;  4ILW A;  1B44 D;  3I73 A;  3GTL B;  2QKI C;  2D9U A;  2D62 A;  2PQE A;  2JA8 B;  5M5W B;  3MTS A;  1CA5 A;  2ICE C;  1XX8 A;  1JWS D;  1L0Y B;  4RAU C;  3R2I A;  3L7Z C;  3T53 B;  1GOZ A;  1NR4 A;  5C3W A;  4BY7 B;  2LS0 1;  2OEO A;  3UI2 A;  4QF4 A;  5I2X A;  3M7G A;  4Q0F A;  1B2T A;  1PMR A;  3H6M A;  2IX0 A;  1TS4 A;  1DON A;  4FXD A;  1BCP C;  1CHQ D;  1WTV A;  1O7Y A;  2B8G A;  4DNT B;  2M9V A;  1EQV A;  4NW2 A;  4H0L C;  1TWH B;  3K6O A;  4C1N K;  3IFD A;  2K6A A;  2RKS A;  4BS9 A;  2R92 B;  1ET9 A;  1KLG D;  1ILQ A;  2E74 C;  3MHB A;  2I07 B;  1LTA D;  4F88 A;  3VA5 A;  2X6L A;  1ESR A;  3VR2 A;  3U9S A;  4XT3 B;  1CQF A;  1KTK A;  5KEE A;  4Q5V A;  2SOB A;  1V1P A;  2WIN B;  4RKL A;  4OO1 H;  2RDH A;  4IN3 A;  4IUV A;  5CR3 A;  3M4Y A;  5HUR A;  4XYO A;  3LWE A;  2R93 B;  1WCM B;  1PTO D;  5K5P A;  4LMQ D;  4DF7 A;  1VF5 C;  1DJR D;  3NWS A;  5IGB A;  3IFT A;  1T5E A;  1GUN A;  1F9Q A;  4ZRZ A;  5I9O A;  4MHE A;  3DEO A;  4DN4 M;  1CT1 D;  5C0X J;  5CV9 A;  4DAP A;  4K5W A;  3A7L A;  2MGS A;  4F8M A;  5IT9 E;  1FR3 A;  3I70 A;  1WVL A;  1F2Z A;  4WRD A;  1KDB A;  5C3E B;  1SYF A;  2F0M A;  1QG7 A;  2A73 B;  2CW0 C;  2EY2 A;  2LMC B;  3SE0 A;  5FOB B;  2EXZ A;  4K5X A;  2R3Z A;  4KKT A;  5ISR A;  3GD7 A;  3C2P A;  3TSS A;  5ELD A;  3C1E A;  3EVQ A;  1F2Y A;  5JAV A;  1M4V A;  4BWG B;  1STG A;  4H13 C;  4KD4 A;  1PZI D;  2K5Q A;  5LL6 X;  4OO1 G;  5C4X B;  2RSN A;  1NUC A;  1V8Q A;  3HOY B;  4QUC A;  5EKK A;  1DZ1 A;  3OSO A;  1NAP A;  2F0N A;  2E76 C;  3T4A C;  2B8F A;  3NBH A;  2IX3 A;  4RHS A;  3S17 B;  2EOT A;  1DXM A;  4A3D B;  5FLX E;  2IPK D;  1D6E C;  2LY7 A;  4K6L A;  2F0O A;  4KV6 A;  3T16 A;  2BCO A;  2JXM B;  3D4R A;  5A2Q E;  4KY6 A;  3NBI A;  3K59 A;  4OHJ A;  2L0C A;  2A6H C;  1DOM A;  4L63 B;  3SK5 A;  1S4Z A;  1Y8N B;  3TME A;  4OIJ A;  1SNQ A;  4C1N I;  2NN6 H;  4ME5 A;  2VB2 X;  4BBS B;  1R4P B;  1EYA A;  1IW7 C;  3L9A X;  5E1F A;  4KY7 A;  3BVM A;  2EPB A;  3A55 A;  4B9X A;  4A3E B;  4DNR B;  2XWJ B;  3I72 A;  4HSV A;  4XTC S;  1ET6 A;  4K8J A;  1SSO A;  1EEF D;  1I6V C;  5KYI A;  4C3J B;  3NE5 B;  2KQ3 A;  1D1I A;  3GP7 A;  3PMF A;  5G3L D;  1V1O A;  5LL6 S;  2NVY B;  3RUZ A;  4XXE A;  2BOS A;  3GTJ B;  3I90 A;  2EYM A;  1NR2 A;  5ELC A;  1I3Q B;  2GA4 B;  5JPM C;  5EBD A;  4F87 A;  4H7B A;  4HTH A;  3GTO B;  2RDG A;  3R8B A;  1QWY A;  2FMC A;  4FXK C;  3JAM L;  2RA4 A;  2K05 A;  4H44 C;  1PFB A;  5D3D A;  2ZXR A;  5IGF A;  5I9P A;  3ITP A;  5A2Q L;  5JEA H;  1S5C D;  1Q90 A;  3H09 A;  3OMC A;  4U67 3;  2XWB B;  4JBW A;  1WTO A;  3HGB A;  2B2V C;  5FO9 B;  2NN6 G;  2Z1C A;  1Y1W B;  2XN9 C;  2PPB C;  2QCP X;  1WTP A;  5E4X A;  4A3I B;  4FVM A;  2O2L D;  2EJM A;  2F0S A;  2JP1 A;  3CKI B;  1CZW A;  3A8I E;  1MSH A;  1EWH A;  4RWS C;  2E75 C;  1SNM A;  2A68 D;  2NVT B;  3I4L A;  1BNZ A;  2EJG C;  3W3A A;  4O42 A;  5T1G A;  2F1M A;  1CM9 A;  1AFP A;  3IL8 A;  2Z8L A;  4IAL A;  4DXF A;  4UDU C;  2NYZ D;  2B2T A;  1CA6 A;  4G7Z C;  1FGB D;  1IKL A;  1D5Z C;  1ZYR C;  4UAI A;  4TRD A;  3TBI B;  1ROD A;  2G9H D;  3F2U A;  1JOO A;  5IGE A;  2AWN A;  5CV8 A;  3T13 A;  4ZKC B;  4C3H B;  3OMG A;  3MC0 B;  2BDN A;  1BCP F;  1XXG A;  1TS5 A;  5CV4 A;  1LT5 D;  2K04 A;  1EU3 A;  4CBV A;  5KRU A;  1EZ6 A;  3FEW X;  4QMG A;  1G91 A;  4K2K A;  1RD9 D;  3KBX A;  3BG3 A;  3TP7 A;  3QG1 A;  1EY4 A;  2F0E A;  1F77 A;  1CHP D;  1H9S B;  1Q8I A;  3MVV A;  3FKI B;  4KKS A;  3MEH A;  3HG9 A;  1EIH A;  1WTX A;  3T56 B;  3FMC A;  2I46 A;  1C4Q A;  1O7Z A;  1GXD C;  1GJX A;  1PDQ A;  1LTI D;  3D4W A;  2CVR A;  5EKI A;  4KK7 A;  1PRT F;  2JA6 B;  3OWF A;  1GUW A;  2PCF B;  3PO2 B;  2FIN B;  4IFD I;  3KUP A;  4O1N A;  4HSP A;  2R61 A;  1HTP A;  1E2W A;  3BZD B;  3PUZ A;  4BA1 I;  2PO4 A;  3WDN A;  1LTT D;  2L1B A;  1D5X C;  2Z4I A;  4HED A;  1BOS A;  2KJX A;  2PZU A;  1SMY C;  1A2T A;  1FNV A;  4TSS A;  4DFA A;  3L3O C;  5KYL A;  4B9W A;  2KCN A;  4TKO B;  4WFN 3;  2R6G A;  3MXN A;  2KA7 A;  2PW7 A;  2JYO A;  2O5I C;  1MD2 D;  3DHQ A;  1W6K A;  1Y1V B;  1UEA B;  4A3J B;  1C8C A;  1TWA B;  4QB4 A;  1GUO A;  3AB9 A;  2L55 A;  5CBE E;  2RBM A;  4CJ2 C;  3BDL A;  4OL7 A;  3SK8 A;  1KAB A;  1JOQ A;  2CQA A;  2ZXO A;  4NP5 A;  5T1I A;  1JOK A;  3S15 B;  3PIP 3;  2F3V A;  2SNS A;  3A54 A;  3S2D B;  1TT2 A;  2XVS A;  4KY5 A;  1RF2 D;  2X6G A;  4HR7 B;  3C3L A;  2Y0S B;  1ZXT A;  4N9P A;  3QOL A;  4C3J G;  2MUY A;  3U9O A;  4MN3 A;  4V0B A;  2ENB A;  2Q8T A;  4C3I B;  3X3N A;  4A3M B;  1TQO A;  3QJY A;  4QUF A;  2CW0 D;  1C48 A;  4IUN A;  2EJF C;  1QB5 D;  1TS2 A;  4PMW A;  2A74 C;  3NK9 A;  1SYD A;  4FP5 D;  2K01 A;  4BY1 B;  1HA6 A;  1E0B A;  4U68 A;  1I4P A;  4PQX A;  5C0X I;  1RJT A;  1SE3 A;  3MFY A;  5EGT A;  1TII D;  1AP0 A;  4HN7 A;  3CRL C;  3S1R B;  4KD3 A;  1NSN S;  3HP3 A;  2KCC A;  2B63 B;  4DXG A;  4DU9 A;  4QIW B;  1CZG A;  2F0K A;  1SBB B;  3K0Y A;  4XDX A;  4X3U A;  1PTO H;  5IOD A;  2RDF A;  3K7A B;  3NTH A;  1JB3 A;  3LWU A;  5DM7 3;  4J1M A;  2F0T A;  2CHB D;  3DMU A;  1QOH A;  2EY5 A;  3HZX A;  4LAA A;  3NP8 A;  5AFW A;  1EY0 A;  2JA5 B;  4ABN A;  1J9O A;  1V43 A;  4M8A A;  1EYD A;  2BA0 A;  3BDO A;  3P1H A;  1WD0 A;  3M7N A;  2KOL A;  5A35 A;  5DAU A;  3SK4 A;  1L0X B;  1SEB D;  4A93 B;  3KLS A;  4EQN A;  2A6H D;  1PTO F;  4G7O C;  1K8O A;  4CGY B;  1AZP A;  4B08 A;  2BE5 D;  3K57 A;  5M3F B;  5M9O A;  1YNJ D;  1H9J A;  3W2D A;  2RQX A;  2EYH A;  4CKB A;  1MSG A;  4J6H A;  1RHP A;  5CBA E;  1CI3 M;  2XSC A;  2IL8 A;  1CQV A;  1IW7 D;  3H94 A;  4FF3 A;  5C6A A;  1AEX A;  4C3H G;  2K5D A;  2ID0 A;  1STB A;  4FF2 A;  1EEI D;  1CFM A;  1BDO A;  1BUV T;  4E6I A;  2F0L A;  3KLS X;  2E2H B;  1KNA A;  3WOF A;  3MAQ A;  3ERO A;  1BQQ T;  2F0P A;  3MFG A;  3ERQ A;  3I3C A;  1U4M A;  2J0T D;  1EQT A;  5I6W A;  1LT6 D;  1VMP A;  4ODG A;  3FDT A;  4CKC A;  1JOR A;  1RCV D;  2L4N A;  3S9W A;  4IUP A;  1QIL A;  1U4L A;  4RA8 A;  2JSO A;  3BS1 A;  2NTT A;  3PUX A;  1VMC A;  4LJZ C;  3NTI A;  3MA2 B;  4PNY A;  2Q8I B;  1I4G A;  1JWU D;  3NQI A;  1ZEQ X;  2L11 A;  4FXG C;  3P7J A;  2HDL A;  1E2Z A;  3LNN A;  1H9M A;  4K5V A;  4K8I A;  3VYS A;  2A6E C;  2IWH A;  1X3P A;  1TWG B;  1SNC A;  2O5J C;  1PXU A;  2OT2 A;  1BCP B;  5E4W C;  4HMJ A;  1V1P B;  3H91 A;  2C5C A;  3K5M A;  1XYI A;  3EJI A;  2PNR C;  4DAV A;  3BDC A;  1EY9 A;  2NVX B;  4A3G B;  2AQ2 B;  1Y8P B;  1ZYR D;  4Y7N B;  2G9D A;  1IYV A;  1HCZ A;  3SDZ A;  4CJ0 B;  3AMU A;  3PO3 B;  3T51 B;  2BE5 C;  3OPO A;  5IT9 L;  4GZY C;  3HKZ B;  4C3I G;  1OXU A;  1YNJ C;  1PRT B;  3K58 A;  1KLU D;  1EFI D;  2AQ3 B;  4IUQ A;  4EQP A;  3A8K E;  5G3L F;  4R9W A;  1TVX A;  2K32 A;  5C3X A;  1KDA A;  3P75 A;  5NUC A;  2LKV A;  3A56 A;  2WB1 B;  2NBF A;  3D3R A;  4WOR A;  1I50 B;  3IAY A;  2AQ1 B;  2QF7 A;  3MXP A;  4HCS A;  2F0J A;  3P20 A;  4OGQ C;  3VYT A;  3TP5 A;  4NKL A;  3TN2 A;  1EYC A;  3Q6S A;  2K1B A;  1F9P A;  5C5M A;  2WII B;  2DY7 A;  2L5T A;  4RH6 A;  1BR9 A;  5C4H A;  4ZQ3 A;  1ENF A;  5IOC A;  2D5D A;  4ZUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...