1Q12A

Crystal structure of the atp-bound e. coli malk
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
b'VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q12A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q12A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q12A01
3H84A 4A3KH 1F2TB 2VHQA 4B71A 2FDCA 1E2JA 3SE0A 1Q7YC 1DAKA 2QGZA 4IOKA 2G83A 2PL3A 2W2XA 5H1YA 4IJLA 3J81k 1QF9A 3EA0A 2XITA 2HCBA 3C41J 1ZNZA 2WSMA 4KLNA 4LWZA 4URWR 1XMIA 3M0EA 5AJ3L 1QHIA 3OESA 1JAHA 4BWYA 4Q1FA 2CWAA 2R92H 3S2HH 4DC9A 2RGGA 2OTLA 2IYYA 5DE3A 1N36Q 2ZJ8A 4HAWA 4AG5A 1YZNA 3WMEA 4BECA 3I62A 2A30A 5M3FG 4BBSH 4B35A 4PV1C 3TW8B 3K53A 5KYKA 4ZKEA 1YVCA 2ZYUX 4TSFA 2I5MX 1UE6A 1AS3A 1X65A 2B8TA 4A2QA 2PQAA 1EIYB 1XPUA 1IXZA 2ZRGA 4DDVA 4U5XA 4DAYB 1WCMH 3M4QA 3CC4A 5FUWA 2ZRLA 4AYXA 3LXRA 5J4HA 4D25A 1IXSB 5JJIA 1CBUA 4A3GG 1XU4A 1ZU5A 1FFHA 3WBJA 3R9XA 4OJQA 2VO1A 4A3JH 4A3IG 5B64A 4GKKQ 3CC2A 1Q86C 2RKOA 2V6IA 3ZIAD 4BE7B 5EJEA 3ER0A 3DVLA 1KDOA 1FYCA 2V4ZA 3OTOL 2VH5R 4IFEA 4JS0A 2FSFA 2IYZA 1CKNA 3E70C 3A58B 5M5WH 1HR0W 2GETA 2OQKA 2NZJA 2Z4SA 5FL3A 2K50A 1SHKA 2UVQA 4H9GA 2GCPA 4GP7A 2UXBL 4YDSA 2WVJA 4DR5Q 4KSBA 1ZKOA 1X54A 1P5ZB 1II8B 4IXNA 6Q21A 3KQHA 1NN0A 2IEZA 1YNXA 2C9YA 3U3JA 4O0MA 4DLXA 4LV8B 1JQJC 4YWLA 4H1UA 4G0NA 3FFAA 4JLAA 3TQFA 1DCZA 4H44C 2FX3A 5LMNL 3L7ZC 2XZOA 3CAMA 3SR0A 4RZXA 4BY7H 4FMBB 3KL4A 3TH5A 4OONA 2J0UA 4JV5Q 2ZXUA 3GTLH 2EFGA 1CRQA 1XPOA 3MGCA 2JA6G 3RRZA 3CMAA 4JBMA 4QBIA 3EZ6A 4C9BA 4Z8XA 3U44A 3PUZA 4GL2A 4LFCQ 3FPAA 4XIGS 3AVQA 5G3YA 5AUOB 4QM6A 4IPDA 4DKXA 2ERXA 3TRFA 5L8VA 1OYWA 1EWQA 4Q21A 3IIMA 2Q2UA 2Q2HA 2ONKA 2VP5A 1Y1WG 1PH5A 3N2EA 3R20A 1P2VA 4W5HA 4NYIQ 2G6BA 1YRBA 5HTKA 1CJTC 2QMUA 1OB5A 2LMCB 1NKTA 3S1NH 2OLKA 2XXAA 1W2BA 1TEVA 2JE6I 3D7MA 3VTKA 4H1VA 4A92A 3MRSA 3L82B 4C7OB 3J80c 1JPNA 1UEJA 1NN5A 1Y69U 2DWQA 3C5CA 4L8GA 2R62A 5DH9A 4O3MA 1EFCA 2NVTH 5D3MB 4PC1A 4GSYA 5JSZB 5GROA 3F3YA 4DEXA 2FXQA 4R4OA 1XMVA 4TYQA 2LXJA 2QM8A 2C9OA 1P4SA 3A36A 4NU0A 2KHIA 1VKJA 5BW8A 2NMVA 1K8OA 4R1JA 3K80C 2SHKA 2F3IA 3U7FB 5TXGA 2N49A 5BWMA 3M4OH 4QM7A 3RANA 1JEDA 2R93G 5KO2A 5FLXc 4DV3L 2GJKA 1E24A 3FKIH 1E2QA 1SXJB 1M7GA 3EIQA 1IN7A 4GNKA 3WP1B 3QKUA 1MABA 3BJIC 1NVUQ 3GLFA 2REXB 3LY5A 2JLXA 2Q9CA 2W2VA 4Y0AA 3RRNA 3CRVA 3QF7A 4KBGA 4LC0A 2PZFA 2ONJA 3M3YH 3E1SA 3CNLA 3MJRA 4GOPC 2IF0A 1HR0Q 1BDOA 3CM0A 1MKHA 1NVVQ 2OFWA 5FR2A 5BYJA 2VL7A 5SZHB 4KI0A 2QP9X 2Q2TA 5IY0A 2AWNA 4O2LA 5CYPA 1VQLA 4GOPA 3OEEA 5JEAG 2ZSDA 3KB1A 2OT3B 3A1UA 5TVKA 4HLDA 1W48A 3AP2A 3ASZA 1BOFA 2C9CA 2DNCA 4YWKA 1J5EL 3WMGA 2OAP1 1FW6A 3GJ8A 1Z6HA 4TL9A 4RG1A 1PH4A 1ZM7A 4Z8YA 1Z6TA 3KJIA 5JEDA 1KL9A 3EIEA 3HR8A 2QL6A 4DV4L 1D5CA 5FLMH 2ZJ5A 1E1QA 2D2FA 1Q20A 3MG9A 3HGBA 1TWCH 3NXSA 3HU3A 2L0XA 4B6FA 4JZKA 2QPAA 1EOVA 3V00A 3TGPA 3A74A 4FMDF 3O47A 5KSPA 3TUZC 3CCUA 1UBEA 2UUCL 2GBLC 3OW2A 3CRKC 1QRAA 3F5FA 3CCVA 3GEIA 3MWJA 1LF0A 5KSYA 4G5RA 1N33L 2XEXA 1KNXA 2F1JA 2VQEQ 2BEKA 4LUCA 1HZBA 2GXSA 1YEZA 2J7KA 2X8AA 2HYIC 2C78A 3PJRA 2QU8A 1GRQA 4QG7A 4JLKA 1K6MA 1XXHE 4I7ZC 4DV2L 2YNMA 3RLNA 4DR4L 2CMKA 1ZD8A 2HT6A 2C98A 4KJZA 2BHRA 1G6OA 2A6ED 1DO0A 2FZLA 4I1VA 4PC2A 1TKWB 4GN4B 3Q85A 2IX3A 4FDBA 1R10A 2ZAMA 1P62B 3CWZA 3ECCA 5FBLB 4IEIA 5CB8A 2B7CA 4RCZA 2YTYA 2QAGA 2BA1A 3J81i 5IHPA 1KHIA 5FOSA 4OK3A 1J99A 1Z63A 2HUPA 2WPDA 2J3EA 5C4MA 1P6XA 5JZVA 3QF4A 4KO8A 4A3CG 2B7BA 1JR6A 1CKOA 1G7SA 1HV8A 1CJMA 3C14C 3IGFA 3IEVA 1NG1A 3BRWD 5DYGA 4O25A 3K0EA 4KLKA 1IN5A 3U9SA 2YJTD 3QEJA 2VHCA 4DSTA 1CKNB 3KF8B 2LCFA 3QG1A 3DPUA 1VECA 4M21A 3E9IA 5F9HA 1IJEA 2JLRA 1JI0A 4FMCB 1GUSA 1GP2A 2DY1A 1XTKA 2EYQA 2ZI9A 3IEUA 4OHVA 3TQYA 1RYFA 3B8HA 3UDIA 4GLXA 4RMFA 3H15A 3V9PA 4X8MA 1G8FA 4NCHA 4Q1EA 1I2MA 3E9HA 3HYTA 4A2WA 5TV2A 4YHHQ 4TLAA 4UPAA 1P73A 1E9EA 4HLQB 5EP2A 2FV8A 1EYGA 2GJAA 4LV6A 1W2HA 1YHQA 1SVIA 2VUMH 4A4DA 4QHSA 4PHHA 1VYVA 3J81j 2JA7H 3TSOA 1DG1G 5CM9C 1YRAA 3GDEA 2KSQA 3I1FA 1X6VA 4BBRH 1Q12A 1KK2A 1NVWQ 3DKPA 1FPMA 1SKYB 2BM0A 1KRTA 2KI5A 3N5CA 3T5DA 1XEFA 5F9FA 4LV5B 4B3TQ 1G41A 2W2TA 3THYA 1FUUA 1SMXA 3ZVLA 2VP4A 4K0KQ 4DR5L 5CJ2A 2JLWA 3O8CA 4JVNA 4OO1H 1IQPA 1HQYE 2IBMA 3EARA 3VX4A 4C4PA 4ZPXA 4MGKR 4YY3Q 2X77A 3CF2A 3IO5A 1FGUA 2J7PA 1H8ED 4D4LA 3M4YA 3SQWA 1JJCB 2A68D 4JI0L 4A3EG 4D4JA 4ZDKA 3ICQB 2ZE8A 1Z9FA 2D0PA 3TAUA 2MFIA 1HCZA 3I2ZA 1MJEA 2ATWA 3IHLA 1XMOQ 2YC4C 4MKGA 1TMKA 1XNJA 1CSQA 4DDWA 1UDWA 4OWWB 5GADC 1Q1ZA 3LX8A 2ZEJA 4XSHA 3OIUA 4DVGA 2RGAA 4QJ3A 1E9AA 5M5YH 4ITRC 2A3RA 4LFCL 3CPWA 1P2SA 2FSGA 3LDAA 4JLOA 1HA3A 1JQLB 4FCVA 3STBD 3QJYA 1YZUA 1NNEA 1GUTA 4OQNA 1H8HD 2R7ZG 4JI3Q 2ZTCA 4A93G 1E69A 3FMOB 1M7HA 4BZPA 4LW1A 2GVDC 5GJCA 3PV0A 1P7CA 4R4TA 3QENA 4JI2L 2BMJA 2UZIR 4ME3A 1IZ6A 1GL9B 3AP1A 1GUOA 5IYCH 4Q4JA 1UBGA 1O3YA 1MV5A 2WJGA 3ADCA 5IYBG 4JBKA 4IOMA 2Z0SA 2F4VQ 3PO3H 3KZ1E 4AC9A 2ZRHA 4JT4A 4URYR 1AKEA 1CR1A 2HF8A 3SYNA 5LDDC 4Q47A 1M1YE 1Z83A 221PA 1YZTA 2HEIA 4OHWA 2QAJA 3RC3A 2CE7A 4D4KA 1IYVA 4R4IA 4JLBA 3PITA 5KSZA 3X1WA 4DR7L 2QMEA 1Q3HA 1Z0AA 5C4GB 2OCEA 1E99A 4QOSA 1GAJA 3UG6A 1HNZQ 3UDGA 1FX0A 2CDNA 4PQRA 1T6NA 2NN6G 4OL0A 4GNXC 1MO5A 1OH5A 2QF7A 3W6PA 4GMXA 1K8AC 1BMFA 4A8JB 1SROA 4FWIB 1A1VA 1IJFA 5KPDA 4GNXA 1D8TA 4I1UA 4IJHA 2YZ2A 4FXPA 1BBUA 1GKIA 4V0KA 3VQTA 3PGZA 1GL7A 4LYHA 3JVUA 3GLIA 1OLOA 2JJ2D 1FJGL 1M74A 1WYDA 1IAQA 1B7YB 1JPJA 4QNRA 3J7ZC 5A35A 3AFQA 2JA8G 2DFNA 1B70B 2OG2A 3B1WA 1TF2A 4IHQA 3RRYA 1IBKL 1EG7A 2BM1A 3C7KA 2ZE6A 2REOA 1XTIA 3WNCA 2FEOA 2OV2A 1N34Q 2CL0X 2FA9A 2JJQA 5C44G 4X8HA 1VQPA 3UMSA 1L1OC 2BMFA 4TYNA 4EQ6B 4RCYA 2NIPA 1G5RA 4ARZB 5BN4A 1I50H 2CHQA 2C5LA 2VLIA 3QY0A 4FI3C 3KLRA 1L1OA 4W5JA 5EXPA 1RJ9B 3HOUH 1PYBA 4V03A 3KQKA 3RNLA 1T9HA 4F7WA 2FPKA 4GPTA 1XMQQ 2OBLA 2ZR0A 4C0BA 2QA5A 3OFND 4PPNA 3LWNA 4IVRA 4E09A 4A3MH 2F9MA 2CLCX 4HZUA 1ZUHA 2XOKD 3SJAA 1HZAA 1KDTA 2XX3A 1RC8A 1KJWA 3KKPA 4FIDA 2K4KA 2CCGA 2ZSBA 4X66Q 1Z22A 3UIEA 2JASA 1Q1QA 5TDHA 4D80A 3LBNA 4O2DA 2AHOA 5CK5A 5DI3B 2F55A 2H5XA 4ASUA 2DWPA 2NO0A 3QKSA 4DUZL 3R8CA 4BUJA 2O8DA 2GDJA 1ZUIA 3R9WA 1R5NA 4E22A 1U0LA 5GVSA 5B58C 1QZXA 3MAAC 1Z0JA 3U44B 4DR1L 3MD0A 4FMCF 3CBQA 4MTNA 4NPSA 1M1KC 4B44A 4XWOA 2XJ4A 5G40A 5CM8B 4H02A 1A7JA 3IQXA 2MMCA 2XZPA 3PSIA 2X2FA 3W1BA 2XTIA 1VQ7A 1U0JA 4L5QA 4NE2A 4QBFA 5EQTA 3DO6A 2IW3A 3BERA 3HPQA 4UXIA 4BRUA 1VHTA 1V5WA 2P67A 1FP6A 4B75A 3THYB 1YZLA 1CJUC 1E2PA 2WJYA 4J0QA 1NN3A 4V0NA 1GVPA 1KY3A 5DIFA 3JC66 4DWJA 3KKOA 2OQ0A 1GJXA 2VQFQ 1G9XA 1XJQA 4LPKA 3TSZA 4KHPL 2O8FA 3VKWA 1R2QA 4LUVA 1J8YF 2MSCB 3BH7A 4P73A 1U9IA 5LB4A 1RPZA 1LABA 1CULC 1VTKA 5BXQC 4AYTA 4CEIA 2X2EA 1GUAA 4JKYA 4JBYA 1IBLQ 3C5HA 3T1TA 1KMHB 3U3OA 1KGDA 4HI0E 1Z07A 1WBDA 4ACBA 5M3FH 3LVQE 4TLEA 1NI3A 2F6RA 1A0IA 4X64Q 3BDOA 2XTNA 2ZITA 3SJBA 2DGYA 2AUJD 3NE5B 1YHBA 2HXSA 1OT3A 1JR3E 5FH9A 2G9NA 3AVOA 2D7DA 4GKJQ 1W0JD 3Q3JB 4OJKA 3NIBA 2OWOA 5DSZA 1VIYA 4BGDA 3BB4A 1VCIA 5AUNB 4LF8L 2JATA 4A3GH 2E5LL 2BWJA 3B85A 4X8OA 4DV1Q 1IW7D 3B9PA 1GD7A 3WMFA 4KMUC 4A3IH 1FL9A 2AD5A 3IPXA 1U5KA 3NKVA 1G7TA 2K5UA 2JEBI 3S24A 1N25A 3TREA 3RS4A 2GKSA 1NLFA 521PA 4IQZA 1NJFA 3SJCA 2WKRA 1M8PA 1WE2A 4HUTA 1AK2A 3A5ZB 1XXHB 1OV4A 4AKEA 1LFDB 2ORVA 4UNQA 1N3BA 1JB7A 4XWAA 3RSLA 5JCZA 1SULA 4PQYA 3NEYA 3TS0A 5FOXA 4RY2A 5LMNW 2PZGA 4JI3L 4QY7A 3G71A 4IFDJ 1WRBA 2QQ0A 5EZ5A 1P2UA 4QFMA 5KSOA 2WOJA 2NO9A 4F92B 2UXCQ 1AN0A 3FMPB 3QE0A 1Z8FA 5FI1B 3T56B 4IPCA 3IBGA 3TBKA 2J1LA 2EFDB 3AVUA 4P72A 1ZAKA 4BLPA 821PA 1LACA 3ETLA 5FPSA 4Z51A 4LF5L 1FX0B 1N6IA 1OIWA 3C15C 2CJWA 4MYHA 5K8IA 4IOAA 4A0FA 4JSYA 2GJSA 1NF3A 4PC7A 1I4TD 1KHTA 2R6FA 4JVLA 2L15A 4OYHA 4DRZA 2C35B 4PAMA 1UKVY 5AJ3Q 2A5DA 5DO9A 5J5CA 1Q46A 1P60A 2R6GA 4P71A 3AF0A 4LUZA 1YKSA 5A5GA 4NXNL 2V1XA 2PT5A 3OIVA 4M1TA 3EX7C 4A6PA 2WAYA 3QIAA 4R98A 4YMSA 1P72A 3O8DA 2QA4A 1XJ0A 3EQLC 5C0XI 3B7GA 5JLJA 3LX5A 3DLLA 2O8BB 3GTPH 1YE8A 3FMIA 2VNUD 2GXAA 4RD4A 4MRVA 1F3OA 1OH7A 1FTSA 3CW2C 3QOFA 1S9HA 2BC9A 1Z0KA 1Y1VG 2H16A 3NBHB 2Q3HA 2WHXA 2ZJQA 4L5TA 4L9WA 2XTZA 3U3RA 2O5JC 4TQAA 4DSOA 3CW2A 1JALA 1EUJA 1F2UA 3OTOQ 4TL6A 2ZSAA 2GF9A 2R93H 2ZT9C 1UM8A 3SOPA 2ZRNA 4EPRA 2B63G 1D9ZA 2FGJA 2IC5A 5K8TA 3NBYC 1ZM4A 5EE5B 1KZ7B 1XCMA 5BN5A 3DXJC 2UXBQ 1IBRA 4HAZA 4RD3A 2F1IA 1M7BA 2NVQH 4A3FG 3U3KA 2AHOB 5H1SE 1KRSA 3MCAA 4JKIA 2E75C 3I4MG 3T5GA 2OSBA 4BZQA 1VYTA 2N3SA 2EVBA 1N9WA 1G3MA 2O8DB 5JEAH 3ZJYC 2OZEA 1W7AA 4C2UA 2VA8A 3UE1A 1MH1A 5LMNQ 3BE4A 1UPTA 4ZI2A 3EC1A 4ALPA 2F3RA 4DNTB 3BH6A 3JAMi 4O0AA 1WP9A 2F9LA 2HIXA 1TWHH 1V1QA 2ZE7A 3GJ6A 4D82A 3L0SA 4US0R 1VQIA 4AWXA 2D2EA 1X56A 3BC1A 4IKEA 2BE5C 1VDZA 3BK7A 3CIOA 4UXJA 1J6QA 1IL2A 1Z6AA 4FN5A 5KOYA 1DARA 2YWGA 1BVSA 4WZ6A 1KOFA 1GVNB 1LVGA 1S9DA 2Y8EA 2ZJPA 3T35A 3ZZTA 4BFZA 4HDOB 4KSCA 4S35A 1QUQA 5L3QA 1PH7A 1YZ6A 4B47A 1KSFX 2O52A 2Q21A 3T51B 4HR7B 3VR2A 2C77A 4JLJA 1E1TA 1K73C 4BLTA 4JI6L 4ZV4A 3NH6A 1J90A 3TNFA 4WW0A 2YU9H 5CITA 5BYKA 4TZ6A 2NO1A 1SN8A 1DE0A 2QMHA 5FPKA 2RGDA 4HIDA 2WJHA 1GO3E 4LF6Q 2WB1E 4JLPA 4PPGA 4C30A 3G82C 5E7IA 1J2JA 2OBMA 2RGCA 3L0PA 4NZYA 5IT5A 4LPSA 2IX1A 3FHCB 2PI2A 4DLTA 2AL7A 5C4XG 1XCGB 2IUSA 3HDTA 2A5JA 4HAUA 4MITA 4UXHA 5JS7A 2Q3MA 3DEFA 3OAAA 3MUFA 4KN4C 4RFVA 3W34A 1ETUA 4HLCA 3RS3A 2KENA 3TSWA 4DV3Q 4RFSB 1A4RA 1I2DA 2DPXA 2MO1A 1OIVA 3G5UA 2ZTEA 3TKLA 4DNRB 1VQ9A 1IN6A 1Q21A 2JJ1A 4DLUA 1OTCA 1EESA 3U6KA 4DKAC 5CYOA 1EQRA 1TXYA 3L0OA 2A5GA 1CR0A 2QPTA 3THWA 3EG5A 2V9PA 4DK6C 2ATVA 4MH0R 4A3BG 2UUBQ 4TTPA 4EKDA 3B13B 1R0ZA 2QQEA 3NHBA 3SC3A 2ZI6A 4GDFA 1GM5A 1A2KC 2V3CC 5AJWA 3H3VH 3T34A 1E9FA 1QHGA 4M22A 2IXFA 2KA7A 3NELA 1G4UR 1H8EA 3A1WA 1V43A 3IHWA 3MLEA 4M8NE 1I3QH 5JCPA 2BVNA 1G19A 1Z0IA 2PMZE 1J5EQ 1OJLA 1GG2A 1OSNA 1SKYE 3FP9A 4WZBE 5K8UA 2AUKA 2EVWX 4DV7L 3BU2A 1QVAA 1E2EA 1AIPA 1VPLA 4KBFA 2CE2X 2NPIA 3ZS9A 2WP8J 4OI1A 2R7DA 3BAFA 2ZJOA 1DAIA 3A4MA 4OKSA 4BFUA 1DPFA 2FEMA 4G5SA 2BIFA 1LNZA 4WA7A 1GKHA 4DV4Q 4OO1I 1VHLA 3STBC 2J45A 2V6JA 1TUIA 1HYQA 2PLFA 4NHOA 4BFSA 5FOWA 1N6KA 3L0IB 1US8A 1XFAA 3GO5A 1EFHA 2P3SA 5TY0A 2UUCQ 3K0AB 1X3FA 3CX6A 4QGFA 1E0JA 1H8HA 1RW4A 4AYBG 2Z0MA 4LHXA 2DB3A 1PH3A 2GWHA 4IDPA 3LNNA 3KXLA 2HHHL 3IIJA 2ODBA 4OHXA 4UNSA 4JI5L 4UP8A 1VQ4A 1ODFA 3T1QA 4G1UC 1CKMA 1QBKC 1MIUA 2HIVA 1I4LD 3A8KE 4DV2Q 1P75A 1KAOA 4PZLA 4DR4Q 1NN1A 4Q9LA 4B2LA 4AKGA 2LKDA 4RKEA 4YXWD 2QM7A 2ZTSA 4GOXA 3I4OA 4IOLA 5FBRB 2PNHA 4CF7A 4ZI3A 4HSEA 4PC3A 2RH5A 5LBIA 1IM2A 4ABYA 3KDFA 1YR8A 3CRLC 3BFVA 4OQXA 1JB1A 1TU2B 1JJ7A 4LYFA 1E6CA 1Y14B 1FQKA 4LRWA 4P32A 3RABA 5J47A 2WTUA 4FD2A 2AD1A 1UFQA 1XP8A 2JK8A 2EJMA 2B29A 4DCTA 2Y0SE 1KI6A 4PO1A 2OE2A 3S16H 1YR7A 3AGPA 1W44A 4CEHA 2H92A 4C0AC 1W5TA 4XH9B 1XD9A 1G8YA 2QT1A 4JL5A 1GSIA 2X19A 2CL6X 2XJ9A 3QKRB 5EUQB 1R0WA 4C3ZA 4LYAA 1F2UB 3G48A 2BDTA 4TMZA 1S3GA 2C96A 1ZP6A 4WBSA 5FR1A 1KSJA 2J0QA 1A8VA 5GQOA 1ZYUA 4L5BA 4Q4HA 4AKHA 1PA6A 1TQ6A 4BRWA 2VHTA 2ZI3A 5IYBH 1VQOA 4G7HC 4PZZA 5H70A 5TB5A 3GLHA 3L2OB 4WJ3M 4POAA 2JJ2A 3ZQJA 2ZM6L 4NKRA 3U7EB 1OF1A 2O5IC 2WIBA 4NH0A 4N0DA 1IYJB 3TE6A 4DCSA 4F4JA 3AKEA 2O8CA 4DCVA 2IS4A 1NG9A 2XGJA 2J9RA 3DM9B 4MKHA 1G51A 3CX8A 4HJ7A 2IUUA 4BZXA 5L3VA 4FINA 3D0FA 2W83A 4OK5A 4UQOA 2NN6H 3ZH9B 5IYDG 2P5SA 3ZD6A 4CEJA 3SDZA 5AJYA 3TAHA 1J8MF 4C0HA 5ELOA 4QHYA 4P4SB 2B8GA 2E1RA 3TZUA 1IN8A 2GNOA 3B1VA 3OFNA 4POFA 2RGNA 4JI0Q 3UKDA 4DV0Q 3A6PC 5EP3A 2XOKA 4OQMA 5J4VA 1KAGA 3EZFA 3T12A 5EUMA 1ZMXA 1W2GA 1S4QA 4LBYA 4DCNA 1OFTA 3K70B 2BV3A 2C2HA 1XCPA 1BBWA 1VMAA 2YTVA 2WAXA 2GZHA 2LKCA 2GVAA 4BXXG 5L3RA 2IWRA 3VA7A 1H9JA 4B33A 1N0VC 1C4OA 4JI4L 4QHTA 3SN6A 3ZVMA 5C44H 3LV8A 1TL7C 1AKYA 1VCMA 3KLWA 4QGUA 1XPRA 4Q1BA 4LSGA 4P33A 2KCCA 8OHMA 1NMXA 1S0UA 3IKJA 1RVDA 1WCV1 2RHMA 5KDLA 3ULPA 3PVSA 1KY2A 4XSGA 1QZHA 4IOCA 2A2ZA 4NYJR 2A19A 1U99A 4JI2Q 1Z7TA 3NBZC 5FBWB 1W36B 1LUZA 4YCVA 4DV6Q 4Q00A 1K83H 2PT7A 3RWOA 5EE9A 4LF6L 3TUJC 3J80i 2D06A 4ZIRA 4AQYL 1XDBA 3TQCA 3CR7A 2CKZB 1AQYA 3CR8A 1Z08A 2GAAA 1E4YA 2DCUA 4RVCA 4YMWA 1W47A 1VG0B 3AF3A 2OXCA 1WJJA 4D6PA 4GRAA 1OFUX 4B34A 5C0XH 4JL6A 4XVQA 5FTLA 3VNVA 4Q48A 2JLYA 2GRJA 3KTAA 3CNNA 1G7CA 2BOVA 2WWHA 3A1SA 2ZI7A 1P9NA 3OE7A 4UKDA 2J46A 3K9HA 4HDCA 3V4FA 4DR3L 2VF8A 4DR7Q 4KITB 1VQAA 3I4NG 2CLDX 4QJ5A 2GA8A 5J4LA 1A82A 3S17H 3HOWG 1M6NA 2FPMA 5F3WB 1WOCA 3BORA 1EFRD 3WDNA 4HAVA 4UNPA 3NDBB 3EPHA 1WMSA 2UUBL 1E1RD 3F0TA 1VG1A 3HR7A 3H94A 4PHFA 4Q1DA 1NP6A 5IK2A 1I6VC 1KSGA 2P0EA 1W0JA 1KSHA 3KQNA 1AQUA 2O8EA 1G8HA 1CXZA 4RSGA 2NTYC 1U81A 4DJTA 3QG5A 5A4JA 1ZU4A 2ZUCA 1QVCA 5DI9A 1FJGQ 1S1CA 1EIFA 4DV5L 2IA5A 3LLMA 1GUNA 1VQEA 1YIJA 3CLVA 3EASA 4PSKA 3R7WB 4Z54A 1IBKQ 2ES2A 1HE1C 2P5TB 4B2IA 4LJ9A 4LJ5A 1Q1EA 5FTJA 4P75A 3GFPA 2IXGA 3B9QA 4BLRA 1PUIA 1A6XA 4CGZA 1CI3M 4EJSC 4H0LC 2OLJA 1PV4A 2XSZA 3WHKA 1S3OA 3PENA 5JHHB 2ZJ2A 2N46A 5FL7A 5JI3E 1NJIC 1FL0A 2KCMA 3U50C 4TT3D 4I81A 4EJSA 3TW4A 1WF3A 4WIAA 3PUVA 1NVXQ 2HXYA 3SEAA 2QP4A 1G291 2ATXA 2EFEB 4MQBA 4EPYA 4D26A 4LUOA 3KYHC 2QE7D 4BY1H 2FJUA 4LK2A 1EK0A 3DOEA 3SFZA 4LFAL 4PZ7A 2MSDB 4HAXA 1ZNXA 3OHMA 2XNDD 1II9A 5IP7G 2DFKB 3RLOA 2IYXA 2DUDA 1B9MA 1UBCA 2YWFA 3K9LA 2ODNA 1CR4A 1Z28A 1ZVQA 3CUEF 4TWZA 3HOVG 2FH5B 1O7IA 2IHYA 2QAGC 2RHSB 1R9TH 4BFTA 2PQAB 3GEEA 4MUAA 1UE1A 1NMFA 4DUZQ 2YWEA 5JWRA 2NZHA 2XGTA 4CEIB 1IY2A 3RYTC 5ELXA 2E8GA 1JR3D 4IDQA 3GLHB 5FI0B 3SQXA 3TK1A 3VNUA 1GHJA 4DR1Q 3TUIC 1GDDA 3F2BA 2A78A 2A5YB 2WSSD 4OWTB 4G5OA 4F93B 4LDJA 1BYIA 2FZ4A 2CVHA 2JCSA 2ZROA 2DFLA 3TR5A 1S72A 3H2YA 1L8QA 3PIRA 1DO2A 3IILA 2P2LA 1N32L 5AK0A 3FWYA 1MRNA 3M85A 2EU8A 1DAFA 1HH2P 1MO6A 1N0WA 3ZVNA 3BWDD 5CK4A 1D8LA 1Y8NB 3J81c 5KNDA 2GCOA 5IT9c 3LBIA 2PJRA 4GZYC 5EE1A 3T61A 4D0GA 3CCLA 2I3BA 4EUNA 4KHPQ 5E95A 1OKKA 3Q72A 3LWUA 1Q1BA 4JI1Q 2FE4A 4C0LA 2GAOA 4IVPA 4PAOA 121PA 4A1FA 3HOZG 5JJLA 2G77B 4CIDA 4XWKA 3H0KA 4XVUA 3UATA 2YYZA 3K0FA 3P27A 3TLXA 1HQCA 2N42A 3I3SR 3ND9A 3OF5A 4I1SA 4LHZA 5IP9G 3RN2A 2J0UB 2H7VA 4HIKA 1EFUA 5KUTA 1OHHD 1SVKA 1VS0A 3QXXA 3CRQA 1H95A 3HWSA 3NC1C 1BKDR 5CLQA 4KVAA 1ZW6A 2Q6TA 1QHXA 2HYDA 4TYPA 2QEXA 1CP2A 2WWFA 1X3EA 2WWGA 2IX0A 3OW7A 3S15H 4A3DH 4KLZA 2D7CA 1IBMQ 4PQFA 4HDQB 2EQSA 4LF8Q 5FJ8G 2E5LQ 1VQJA 4DV0L 3SI7A 1II0A 3S14H 3FTQA 5FUYA 2RF4A 1W36D 2E76C 2GVBA 4N0EA 2XXAB 3CPFA 4KFRA 1LTLA 4HEJA 4MGYR 4E03A 1RE0A 1SMYC 1E2FA 1E79D 2W6ID 3OYYA 1EWIA 3C8UA 3PEVA 3G0HA 1VQGA 2BCJQ 2B63H 4YLGA 4OI0A 1VCOA 1KI1A 2ZREA 4IFDG 2YC2C 3Q7QA 2WJIA 3W9YA 2CBZA 5M3MG 3I8XA 5B57C 1IOZA 1AS0A 4QJFA 1XEXA 3W8NA 1L4YA 1E1OA 3VX3A 1SXJD 1ZCAA 1XB2A 2Z6KC 4JBJA 5AJVB 4TLDA 3I4MH 1TUEA 3B6EA 5FUVA 3U2QA 1E7ZA 4M1MA 4AD8A 2Z6KA 4DV6L 1E9DA 1O7LA 3GFTA 3LAWA 3NWJA 4LCBA 4Q4LA 1UWVA 1RRGA 4DEYA 1MABB 1U90A 1WA5A 1S3SA 2HT1A 4A3LH 1WQ1R 4X62L 5FFMA 4LF5Q 1E3PA 1BH2A 1E2DA 1TF7A 1XTRA 1Z29A 4YC7A 1XEWX 2FFQA 3A4NA 4R2HA 2FWRA 2JXMB 3CZPA 2ORWA 1TADA 1QVFA 3WY9A 4EFLA 1TNDA 2YVUA 1NLYA 5K36G 1JAIA 4GOPB 3QXJA 1T3SA 2N1BA 2GVZC 4DK1A 1CIPA 3MSXA 4BBSG 4UJ3A 2BH8A 3CD6A 3IBYA 1ONLA 1QHYA 3MXUA 1NY4A 1UADA 2AK2A 2KBFA 1DADA 1GKYA 2F3TA 4NXNQ 2FGKA 2UXDL 2QEQA 4DR2L 2GZDA 3AF2A 3LW7A 2DNEA 5GAGC 1P9RA 2BMEA 2TMKA 1C9OA 1F6BA 3MJHA 1WCMG 5KNBA 3EW9A 1YJNA 5M04A 3CO5A 3GLFB 1RRCA 4AY2A 2RB4A 2ZPTX 2IYTA 3PCRB 2VL6A 4C3JH 2WJVA 4HATA 3T1HL 2F43A 3H86A 4C0JA 4M1YA 1EX6A 4ZDWA 1R5OA 1FZQA 5DLQE 1ELOA 3THOA 1CUKA 4CZ2A 4HJAA 4NCJA 4DBLC 4D0LB 1XD2A 3ULJA 2OXRA 4Z1MA 1U94A 1P9WA 2CHGA 3QXHA 3PO2G 1R4AA 3EIVA 4GOKA 3ZLJA 3CQZH 4UP7A 3B6YA 3IQWA 1SKQA 3LD9A 2EJGC 2K75A 2ZVQX 4JI7Q 3CPJB 2KWIA 2YWHA 1N5JA 3NC0C 5EAYA 3H3VI 3CCRA 3QBTA 3AVTA 3HOYH 5HY6A 3CNOA 4K8OA 1IXRC 2IHFA 3QKTA 4WZAE 1PLJA 4GMDA 3U7GA 4PTLA 1IXRA 4J15A 4NP6A 4OBEA 3P1JA 1GHKA 5JRZA 5A0FA 1XF9A 3AB9A 2K14A 4BY7G 2QAGB 3QSYA 4LC1A 4KN7C 1N5IA 1H9RA 5JEAJ 2JA5G 2AX4A 4NL4H 2H18A 2JAQA 2ASBA 3HKZG 1JJVA 1KKLA 1X3SA 1ZNWA 1HZCA 2ZSEA 4II7A 2PX0A 3QF4B 4DLVA 4F91B 5LMUL 2E2JH 3OEHD 4R7ZA 2R6CA 4C3HH 4LOAA 1I5FA 3WWVA 4MGIR 1PHJA 3N6RA 1YR6A 3AVPA 1IHUA 3VR3A 2F52A 1S1MA 2G0TA 3BIFA 4GS3A 3GLGA 3BG3A 4DT1A 2PNRC 3HPRA 5HE9A 5HKKD 4Q4AA 1X8KA 2ANCA 5GJVC 5LD2C 4U02A 1LTQA 1R6BX 2ASEA 3A8IE 1ZUNB 1GUGA 3FDIA 4I99A 4JI6Q 2V7QD 2ZRIA 4P0TA 3VR6A 3AVVA 1EWHA 1NBME 2G1JA 2W00A 2YOFA 3CCEA 1N0UA 1X8JA 2BBOA 4W5WA 2Z6VA 3CCMA 4HJ5A 4OX9L 1CEEA 3AP3A 1L2TA 3EXAA 1UKYA 1C1YA 3VR1A 4A2PA 1X1SA 2QP3A 1C9KA 1H65A 4DB4A 3BFXA 4HJ9A 3U3MA 4JOIA 2ZS7A 3PEWA 2BA0A 1R8QA 4BA2I 1HNXL 3GTGH 1U9IC 1PFSA 1DOAA 2IT1A 1GZSA 4A75A 1M34E 1G3UA 1P3JA 3SZRA 3ZIAA 1CU1A 1E2KA 3KOJA 4JI1L 4MYUA 2E74C 2FPLA 3TIFA 3PUWA 1LV7A 4QQBX 1N8RC 4LF7L 2Q2IA 4R4CA 3CX7A 2VP0A 1OE0A 2E87A 3AB3A 2OTJA 1HUQA 4DK0A 1COWD 1LW7A 3AVWA 4AKIA 2DWOA 3EN2A 3A4LA 3U60B 3G6EA 1S2MA 3GCGA 4M53A 2O0KA 3UMFA 2DFTA 4JMPA 1EFTA 4ERNA 2OCAA 1T3HA 3B60A 2BBSA 1LF5A 1AGRA 4URXR 4HB2A 2H1LA 2H8KA 1JNYA 1IBML 4LZZA 1U8AA 2IHBA 4Q9KA 4B6EA 2JEOA 1E32A 3FB4A 1PLLA 1KD1C 4DV7Q 2ID0A 3VAAA 2CL7X 5FLMG 1KI7A 1SVOA 1YVDA 2BJVA 1MKYA 2IK8A 2ZSFA 3A0JA 4KYUA 4AURA 2NN6I 4TTRA 2FOLA 1T3LA 4TL8A 4Q4JB 4YMUA 5HPYB 1YBYA 4B3DA 3LXXA 5ELNA 1EQQA 3ZQ6A 1Q3TA 3IUYA 4DLSA 2F1MA 3LQQA 1Q0UA 3OEED 3H0GG 2OILA 4AK9A 1UEIA 1OXTA 1Z2AA 4JBWA 5L3SA 2WJJA 2HHHQ 3QEOA 4LHVA 4DZZA 2I5LX 1XZPA 4JI5Q 1XWIA 2RHDA 1JEEA 4OHZA 721PA 2GJ8A 2AKWB 1KQSA 2E2HH 4JYAL 3HU1A 3MWYW 2ZI5A 1A5TA 5CIWA 4LF9L 3A7AB 2XTMA 4YDHB 4LJ6A 1RL2A 3M9BA 5J40A 1ZIPA 2CW0C 2PI2E 1HT2E 1KK1A 3KFXA 3GTJH 3I56A 4URUR 4WJ4A 2MQHA 4TTQA 2A69D 2KBNA 2JA6H 4CT4B 2AKAB 2R9VA 3WXMA 2UU9L 3QVUA 3S1AA 3GJ0A 3MWKA 3FPPA 4LNQA 5EXXA 1WXQA 4GNXB 1OH6A 4HUQA 3GFOA 4H13C 5D3QA 4YONB 3Q5DA 3S1RH 2ODEA 3K09C 1WDTA 5EE0A 3EBEA 1T5LA 2YOHA 3GLIB 1Y1WH 2YKGA 1SVLA 2A6HD 1G5PA 3WYGA 5CDFE 1KIMA 2PBRA 3K09A 2RGBA 2WMNB 1GNQA 5SZKB 1EFRA 4M1OA 4JJKA 4EPWA 1IYUA 1KC8C 2BKEA 3EZ7A 1X6OA 4EPXA 2HF9A 1YZGA 1HTPA 2VZAA 1E1RA 2JA1A 1G20E 3UXMA 2ZS8A 3NH9A 3L2PA 5IWAL 4XTRA 4R4QA 4B48A 1H9SA 4QL5A 4V0MA 4LFBL 4PMWA 3VDYA 3GJ7A 3MXNB 1L1OB 5JECA 2ZM6Q 5GADl 2R7FA 2JA7G 2WPDD 2QGQA 1VIAA 2ZRBA 1V9PA 1H9MA 3AYHB 4BBRG 1AH9A 1F2TA 1YR9A 2D4HA 4B43A 4YQFA 4QGHA 1KMQA 3EPLA 4QGAA 1XRJA 1E2MA 3O8BA 3WNBA 2G0NA 4HZUB 4U7DA 3FFBA 3KKMA 4B3SL 4PZ6A 4JI7L 3QXCA 3I4NH 3RDPA 4AH6A 3REGA 4X8LA 4JBXA 2ZIAA 3D4RA 2WAQG 1W5SA 4MRPA 2OEPA 5HZKA 2V55B 3MFYA 1PLKA 4QIWE 4DHEA 4TT3A 1PH2A 1I94L 3K7AH 1VQNA 3DOFA 3GLGB 2QE7A 2R65A 3PF5A 1K5DA 2NO7A 3EWAA 3QKSB 4C3IH 3QVVA 4ZO4A 4DT1B 2AN9A 3J7A5 2WIAA 1B0UA 4HIOA 3M6AA 3IFTA 2XNDA 4WAUA 2QY9A 3SBDA 3K8YA 3PF4A 5JMTA 3CH5A 1XJCA 2E9SA 2A6EC 4Q9HA 1SRUA 5FOUA 2WWXA 3VR5A 1FQJA 3U58A 2L5TA 2X1VA 1UF9A 3A37A 3R9IA 5LD2B 1IY0A 1G4AE 2VP9A 4JLMA 4P3YA 1ZNYA 4M1WA 4RD2A 3ICEA 3KKNA 4LJYA 2O0JA 4KODA 4JSTA 4ILEA 3JVVA 4AI6A 1Q44A 3GTOH 1YZQA 2IYSA 3PQCA 2YV5A 2B92A 1ZM9A 2K52A 4JI4Q 3KJEA 4WVFA 5FOVA 5JI2E 4C2MH 4QJ4A 3UANA 4TL7A 5EP4A 2VPPA 3RHFA 2KB0A 3O8RA 3D3QA 1G16A 1VQMA 5AJXA 1VF7A 4A0GA 1K8RA 3KXKA 5IYCG 3JAMc 2O8FB 3KJGA 4B2PA 4MZ9A 1XX6A 2JLQA 1YJ5A 3I32A 4HAYA 4LBWA 4EQ5A 3PO3G 2QN6A 2GCNA 4NYJQ 3W5JA 5JWOA 3ZD7A 1Y8PB 5IP7H 4AQYQ 3LQRA 2OM2A 4IRUB 2GESA 1GILA 1E94E 1PH9A 2OUKA 4PR0A 4HB3A 2AK3A 1P16A 4DK3C 1II8A 3QPWA 4RD6A 3R8FA 4OWXB 3GLHE 1V8QA 1X55A 3VU9A 4AIIA 2VS1A 4FW9A 4LJ8A 2A1AA 2NGRA 1K5GA 4TYWA 5C0XJ 4HB4A 3KUCA 3GJXC 1PH6A 4QXAA 1W49A 2R6AA 3QQ5A 3UE0A 1DS6A 4KFUA 3X1YA 4DR3Q 4KKUA 3L43A 4BPBA 3P32A 3Q5EA 3I73A 2ZRAA 3RZOH 4BLQA 4IDHA 4PFSA 5IDVA 3ULLA 1XNQL 4A3CH 4IO9A 2Z43A 3KXIA 3WRYC 1CTQA 4LYJA 1NE3A 1E0AA 1OHHA 5EP1A 3FOZA 3HOXG 4MGZR 4A6XA 1PZNA 3M7NA 1U8ZA 5KDOA 4B3RL 1R8SA 4GBMA 2A68C 2K5VA 2HJVA 2RHQB 3ZZUA 1BS1A 1G7RA 2BBTA 3CP0A 2P6RA 2WICA 3IRBA 2EFHB 1KK0A 2RCNA 2NZ8A 5JWHA 4DV5Q 3PUYA 1ONBA 4US2R 2IWHA 4YMTA 3I4LA 1U8YA 4C7OA 1CF4A 3CONA 3VR4A 4IDOA 3G4SA 3AV0B 2ZJRA 5D3MA 4M2LA 4WXRA 1PH8A 2GEVA 2VSXA 1GKUB 5E4FA 3KJHA 4QL3A 5JSZA 2NVXH 1E79A 3QXSA 4QBGB 3SYKA 4GP6A 3UG7A 2QPOA 3TS2A 2WFWA 1M2OB 1A62A 4KFTA 1BMFD 3NEJA 3T15A 2K32A 1KO8A 5IP9H 1Z47A 1YITA 1SXJC 3LFUA 1Y63A 1OIXA 2CJWB 4Q18A 2KBEA 3RWMB 421PA 2GEDA 2G3YA 3W3AA 1SXJA 1R0XA 1DBSA 2NO6A 4DLYA 2QRZA 3FKSD 2H17A 1KIXA 4LFAQ 3W3ZB 3KX2A 2I5HA 1YHAA 3BZCA 4Q7MB 5FJ8H 4A3EH 1ZYRC 1GRRA 2EDGA 3T1YL 3CRRA 2ZUDA 1N6HA 4LX0A 3GD7A 2IS6A 3D6TB 4TMKA 2UZ3A 1RIPA 4JC0A 4JI8L 3B78A 4DAMA 3F2DA 5DISB 3C16C 2ERYA 2HLDD 1LS1A 5AWFC 4JG2A 2JJ8A 3QPVA 4IFBA 1CR2A 1Z5ZA 3N2IA 4Q66C 3N70A 3KFVA 1MO3A 4LBZA 2QT0A 4TLCA 5M3MH 4N1AA 1SR3A 2RGXA 3CF6R 5CLLA 1N6PA 2O0HA 2PMDA 2CK3D 4IOJA 2FN4A 4WOPA 1G17A 2BCGY 3NBXX 2R7ZH 4ON9A 4EDHA 4ZDIA 2BJWA 1LYLA 4A93H 2OFXA 2WWIA 2ZJYA 5DYIA 3AM1A 2CFMA 1CJKC 3GTMH 1W0KD 1ZD1A 3BGWA 2C99A 4KU4A 4Q03A 3WNDA 1Z3IX 3X1ZA 1TWGH 2EFCB 3A7LA 1JT8A 4L15A 2RMKA 4AYBE 1MJCA 1S40A 1K8MA 1N32Q 4NYMR 5C3EG 1Z6XA 3REFA 3I8SA 3U61B 3WRXC 1Z6GA 2ZRCA 4TQ9A 1NIJA 3W6OA 2V1UA 3KKQA 1FTNA 3W6NA 4ASUD 1M90C 3GLFE 2ZR7A 4PANA 3MEFA 1BKBA 5JS8A 4HJ8A 3Q9LA 1L2FA 4X65L 1TQ2A 4NCIA 5JHGB 1JJ2A 1E0KA 4DR6L 4KHZA 2GK6A 3U5ZB 5K36H 1S8FA 4DLRA 5LPNA 2IHEA 2LXKA 1FNMA 4NXML 1OB2A 1KO4A 4UJ5A 1VQDA 2ZVPX 1DXMA 2ZYTX 3FMFA 2ZRDA 1PYSB 2IYQA 2RAPA 1Q22A 4RJLA 1E2VA 2AR7A 4B3FX 4KKSA 2XNSA 2ZTDA 3AF1A 3AUXA 1RYHA 2D3WA 4URZR 2RGNC 4ZCIA 4QKQA 2UUAQ 4A9AA 2N8NA 5HGQA 1ESNA 3L8YA 3K81C 1D6JA 4CDGA 1HNWL 3SHWA 5L3QB 2AWOA 1QUQB 1NY6A 2D74A 1G6HA 1VCNA 2K33A 3EPKA 3BFKA 4DUGD 4BFVA 1I4DD 5E7NA 4B3ML 2OCBA 3K9GA 3OEHA 2GEUA 4NDZA 2D5DA 3Q8XB 1AE3A 5DN6D 2JA8H 3PO2H 1W4CA 2I0QA 4IW3B 1KI4A 1P61B 4LF4L 2J5XA 2ALYB 2C95A 4HB0A 3RNUA 4ESHA 5HKKA 5HR5A 3UMRA 5KTYA 4L5SA 4DDUA 3VU9B 1TF5A 5EZ6B 2QRNA 1YU9A 3AQ4A 5DHFA 2V7QA 1YQTA 3ZDQA 2PCFB 2JGNA 1W4BA 3GJ3A 4EIWA 3FYHA 4L16A 2VEDA 3BZKA 3K1JA 4ZCMA 2PX3A 3BH0A 3RZDH 1YJ9A 2JA5H 1QHSA 2WWWA 3I5XA 2WKPA 4IPHA 2HJGA 1D2NA 2PJZA 1E2NA 1XBTA 4X62Q 1X9NA 2ZJBA 3A8TA 1O78A 1QVRA 1CFMA 1G3IA 2CXXA 3W1GA 2F1HA 2ZJZA 4PXAA 3THWB 3GMTA 1SVWA 5G41A 1FMJA 3RR5A 1RKBA 5JJKA 5B2ZA 1Z0DA 1FMLA 4DB2A 1NSTA 4DUYL 1ZD9A 2EW1A 3PEUA 1D9XA 2WBLC 4RZ2A 1WB9A 2JQOA 3OOCA 1DG3A 1T5IA 3A8JE 4KXFB 1RRPA 2XAUA 4OK6A 1SVMA 4UNRA 3THXA 3TVTA 3HJNA 1J70A 2UXDQ 4DR2Q 1G21E 3AVYA 4QC2A 2C8VA 3RS2A 3HKSA 1XTSA 2W6JD 1COWA 2IL1A 4BFXA 4DSUA 4A0RA 5F98A 1FVIA 1X1RA 2NPFA 1QVGA 2HDNB 1ZINA 3U4QA 1WBBA 3ADBA 1XJVA 3T1HQ 2OCPA 2CNWD 3DMNA 3WBKA 2CCKA 3TRZA 3UDXA 1IW7C 1US8B 3HYRA 4MYCA 3UK6A 3E5HA 1I6HH 2QG6A 2P65A 2YOGA 5LB2A 1UJ2A 4MDEA 1OXSC 2AFHE 2AXPA 1HZ9A 1IONA 2VW9A 2ZM5A 4Q01A 4ACAA 2N78A 4Q9IA 2ZETA 2F7SA 2WOOA 3LVRE 5E7JA 4JLVA 3SHFA 4TMVA 2WMOB 3ZZ0A 1NBMD 4KKTA 2KHJA 4G7ZC 1Q81C 2B6HA 2VF7A 5FOTA 5G53C 5J4KA 1T0JB 4OQLA 3KDFB 1VQCA 2A9KA 3LA6A 3K0CC 4URVR 5FBVB 4B3BA 1CLUA 1EX7A 2JIZD 3DHWC 2ZU6A 1N5KA 5JFGA 4AIMA 1E2IA 2QSZA 3CZQA 1KI6B 3D8BA 3K0CA 2MNAA 4ZKDA 4A8JC 3RC8A 4KVGA 3T53B 2ZRMA 2DR3A 3PFIA 4PHGA 3K8AA 4CEHB 1DEKA 4MRSA 3PIOA 1NIPA 3RS0A 5LMUQ 2A69C 3VHXA 4A8JA 4NBSA 2KCTA 1CKEA 4NTZA 4A0HA 4P74A 1N6LA 4MKIA 4F38A 3WYAA 4M9ZA 3BB3A 5FTNA 3IIKA 4ZCLA 2O8CB 1KI8A 3FHWA 2VP2A 5CJPA 4BA1I 4Q7LA 2VSFA 4TMXA 5HZHA 4Q4HB 2Z4RA 4PPQA 4PHTA 2R44A 1X8LA 5KDDA 2A6HC 3Q8DA 3FMCA 2VYFA 2VY3A 3S2DH 3A5UA 2GBLA 3U6BA 1F5NA 3B82A 4BLSA 3H0GH 1MRSA 2GN5A 1QDEA 3F1ZA 2VRWA 1KKMA 4NMMA 3B1YA 2JDID 3JZAA 2JLVA 3LLUA 3WP0A 4EQ6A 4ARZA 4OX9Q 3B5JA 3CF0A 1RFLA 1Q8KA 1RJ9A 2GF0A 1UAAA 1WI5A 1SE8A 5JBQA 3GLIE 2BDOA 2BE5D 1YNJC 5HCNA 1HNXQ 1W4RA 1AS2A 4GT1A 3VMFA 4CEJB 4CYMA 1DAMA 2J59A 2Q0HA 2JLZA 1TEXA 1NBWA 1N36L 2CLSA 3FKQA 3PR1A 3Q7PA 3QNUA 1SVSA 4D81A 3K70D 1ASYA 2UKDA 1AZSC 2V1CC 4LF7Q 1VG9B 1E9SA 2CHVA 4IXMA 1GITA 3ZS8A 5DI3A 4KFSA 4BASA 1MR3F 3RSOA 4PZ8A 2Q9BA 2FSIA 2ZU0C 4M9XA 4BFWA 4NB3A 2K5NA 1HURA 4C0SA 3K9NA 4DIEA 4L4UA 2PCLA 1YNNC 2VTKA 1OXVA 2UUAL 1GNPA 1QHNA 4M1KA 4V0LA 1E3MA 3LGJA 3OAAD 4E07A 1XEWY 1ANKA 2FNAA 3EA5A 2BBWA 4GI7A 4IDNA 2EIFA 1AE2A 4GKKL 2FSHA 4MRNA 5DNYB 1DVRA 3A1TA 1LY1A 3FVQA 1MOZA 2AFIE 4XD7D 5AJZA 5KHOC 1L4UA 3EZ2A 1Y1VH 3LNCA 4QGGA 4LBVA 3AKCA 4Q5IA 2MMGA 2YTXA 3KUDA 4Q02A 2JJ1D 1B9NA 3RS7A 3KB2A 2GTPA 1JMCA 2EXDA 3KF6A 2GILA 1XTDA 1KO5A 3GLGE 2IYLD 2W0MA 1G5TA 3THXB 1GNRA 4LJAA 1E2LA 1G3RA 4IEEA 4B74A 4ZIRB 1FR3A 1DD2A 3DM5A 2R2AA 4KYIB 1G8GA 2EJFC 2V8OA 1E9CA 4HZIA 3H1TA 5E3HA 4JJZA 3CCSA 1DGSA 4A3FH 3SU8A 1ZIOA 1E2HA 4B3CA 3RRMA 4Q9JA 1KJYA 4A3KG 2J0VA 3M1IA 3KTAB 1HY3A 4YCUA 1KMHA 4L8JA 1KTVA 2IF2A 2XB2A 4JYAQ 3E0EA 2P6NA 4Q1CA 2QSYA 4UY8C 3K7UC 4JV5L 4LF9Q 1QHHA 1RZ3A 1HPCA 2E2IH 1W1WA 2F1RA 1UE5A 3KJPA 2ORIA 5TARA 2RGEA 5GJWC 3DZDA 2LSSA 3DZ8A 2XB4A 3EZ9A 5CB6A 5GAHC 4FCWA 1EXMA 1FOEB 1VQFA 2P6UA 2DHRA 1ASZA 2C03A 2VIIA 4JYCA 2UU9Q 3DM3A 3U4QB 2R92G 4NYIR 5FTMA 4DXAA 3EIHA 4P4TA 2A8VA 5GVRA 1JJGA 1N5LA 2O8EB 3RLFA 3M4PA 1U98A 3PEYA 2PEYA 1X3GA 1CRPA 3DKVA 2B21A 4TVAB 3QUSA 2BMDA 3TVDA 1HH4A 1XMSA 3I92A 3UDFA 1CS4C 3IPYA 1PUJA 4LY6A 2ZRFA 4IPGA 3OZXA 4A36A 5GJBA 1H9KA 4XOIA 3U4VA 1R0YA 5C1BA 1TTTA 1XXHA 4B3GA 3T1VA 4OGQC 3P4YA 4MA4A 4W9MC 5M5XH 1T0HB 4A3JG 1ZJ6A 3LBHA 1OH8A 4GZMA 1C7YA 1E4VA 5FUXA 1T8UA 2QNRA 5IWAQ 4DIDA 2ZQ5A 1S96A 3SS8A 4Q1AA 4EJSB 4LFBQ 5C4XH 4OQFA 2IS1A 3K0SA 4EPVA 2FF7A 5K8LA 5FBQB 4HYYA 3ADDA 5IRCD 4C0QC 1VQBA 2NZOA 3NTUA 4MRRA 2KJQA 1PMRA 1E2WA 5C2JB 1NY5A 4TN1A 1U0HC 5H8WA 4B3SQ 1FUKA 2J41A 4RD0A 3CKLA 1XNRQ 4F4CA 1NVVR 4EPTA 1E22A 1E96A 1GRNA 2WV9A 2C04A 1E0SA 4PSVA 1HR0L 2A7QA 4TSFD 5SZJA 3I61A 4LI0A 1YJWA 4AYWA 1I94Q 2ZR9A 3I5YA 4OI4A 3ZVRA 1AZTA 4K81B 1JE5A 5FTKA 2NVYH 4A3BH 3HOXH 1TQ4A 3KQLA 3AQQA 3BOSA 1UKZA 1ZCBA 3GPLA 5C46F 4LWCA 3FKSA 4FCTA 4NONA 4NCKA 2IXEA 4B76A 2IYUA 3FHTA 2NOAA 2EYUA 1IY1A 2IY5B 1N6NA 4TZ0A 2DN8A 3S1MH 4UNNA 2REBA 3SNHA 2GXUA 2QGNA 1UDXA 2GJ9A 4Y0VA 4YXWA 1QG4A 5F2EA 1HE8B 2FFHA 5HCIA 1Z6YA 2O8BA 3I7FA 2K5HA 3KDSE 1YZKA 2R6DA 3IO3A 1OXXK 2VHUA 3X1XA 1L7VC 1YHNA 1B8AA 2PPBC 2CEAA 2WKQA 3TMKA 5DGXA 4D2IA 2Z5FA 3VKHA 1HTWA 4EX5A 1KI3A 1RIFA 2HLDA 3B1ZA 2GHIA 2JLSA 2CVFA 1KO7A 1W3SA 3ZGXA 1EFWA 1K9MC 1NLZA 5ANRB 3NBFA 3TEHB 1AGPA 2VQEL 4YMVA 2GCOB 1K8GA 4LK1C 2CK3A 4EFNA 1GOTA 1DAEA 3U4ZA 2KE5A 2QTHA 2VP6A 3CH4B 3NDPA 4ESVA 4D4MA 1AM4D 4OHYA 1W0KA 1T8TA 4PPFA 1U2RA 2DBYA 1GWNA 1KNQA 4S2EA 3P26A 4PX9A 3K0FB 2J0SA 3DDCA 4JOIC 3AUYA 5C0XG 4MDFA 3F8TA 4IFDI 4JYBA 4I4LA 4V0ME 2ZYWX 2VSOA 2IS2A 1AA9A 2QBYA 2IYVA 1NJGA 2AXNA 5EE3A 4JLDA 2AMCB 1BIFA 1KZGB 3HKZE 1A63A 3FKIG 2IYWA 3ONWA 4X6AH 5AUPB 1IN4A 1XZQA 3GJ5A 1JXMA 3MWLA 2GXQA 3RS5A 2I1VB 2JLUA 2OO7A 4N3NA 1KK3A 4TMTA 3CXCA 3LRPA 4V0OA 3T06B 3GJ4A 1TWFH 2IUTA 2ODWA 3BB1A 1NSFA 1VQKA 2I4IA 4JK1C 1XNQQ 1VQHA 5HE8A 4JVSB 1TX4B 3WHLA 4P4UA 2OAQ1 3KF6B 4RZ3A 1E9RA 1QG2A 2ZUBA 4B3RQ 3LH5A 2GK7A 2V54A 5C3EH 4KV9A 2ZS9A 4APVA 3RN5A 3CF5A 1NMYA 3L8ZA 4YHHL 4RZUA 3SBEA 1XEXB 4DUGA 1D7QA 1CSPA 5UKDA 3OE7D 1OFHA 2QZ4A 1O87A 1UBFA 3A1VA 2Z83A 4M4SA 4CW7A 2EQBA 1GTVA 4HLUC 4BEJA 5DN6A 1DELA 1P2TA 4JCVE 2HV8A 2OFOA 1DTSA 3CWQA 4JIMA 1BYUA 4PZYA 1BO6A 2Q8IB 1NL3A 4R2IA 3QI2A 1QHHB 1Q82C 2PH1A 4B3TL 4HLUA 2JA9A 4BFYA 2Q3FA 3EC2A 4MYTA 4K0KL 3AFPA 2WWYA 3F2CA 2FFBA 4BY1G 4HIMA 3SYLA 4GN5A 5IK2D 3W5OA 2OESA 1UKEA 5DLQC 3QBVA 1PH1A 1GIAA 2FMXA 4YY3L 1F48A 1DAHA 3BXZA 4O2RA 1NMGA 4RFSA 3TR0A 5IYDH 2IYRA 2CWPA 4PAQA 4G01B 3UWOA 2WM9B 2G1KA 3NENA 1TAGA 3T1OA 4B3XA 3LW8A 4CVNA 3HP1A 4R9UC 1KYIA 1KI9A 4LHWA 4PG3A 2FU5C 2QMOA 3FE2A 2BH2A 4Q7JB 5DHAA 5SZIA 1XMOL 3JZMA 1F60A 1KAWA 4NCNA 3PXGA 3T1YQ 3QPUA 4DLZA 4ZDJA 4WXPA 3D31A 1JXOA 4G5GA 1UE7A 1G1MA 1ZC3A 1ZM3A 2ANBA 4JT2A 1E1QD 1T91A 5KU1A 4JI8Q 2XSZD 4TKOB 4RCNA 2B3GA 1N6RA 3FGNA 3AEZA 4TLBA 5BR8Q 5FL7D 1OPXA 4BXXH 4EFMA 5G3ZA 2F43B 5TMPA 2D0OA 4V02A 2ZAOA 4A82A 5CIQA 2Q9AA 1CTMA 2OCYC 1RRFA 5BN3A 1XMJA 4F4IA 3W90A 4A4IA 3AEVA 1XD2B 2AKYA 1R7RA 4R71A 2W6JA 4B73A 3ERSX 2ZANA 3EAQA 1OXUA 3X1DA 4OI2A 2D62A 2V4DA 4KAXA 1G8PA 2F4VL 1E2ZA 2PEZA 3K0AA 1AJEA 4LJZC 3EWSA 1EWRA 2CNWA 4NYMQ 2ZRKA 4C2TA 4XTCS 1LS6A 5JRJA 2NQ2C 2LWIA 3V4RA 3DL0A 2VUMG 5FPYA 2K7VA 4PO9A 4Q19A 2OBNA 5P21A 4X65Q 2A5FA 4DR6Q 2G88A 2MO0A 5AR1A 4BEBA 4C0KA 2GZAA 2I1QA 3PCOB 3CPHA 4CT5A 5C18A 4NXMQ 3GEHA 621PA 2QROA 1HNZL 3ZYCA 1Y3AA 2QORA 1ZC4A 3X2SA 3BBPA 3PG5A 4MUBA 2D2CC 1XNRL 1PVOA 4OO1G 1MO4A 1NBMA 4PSAA 2FG5A 4DLWA 3HOWH 1GFIA 4G5QA 1J7KA 4DPGA 4US1R 4A3DG 4TMWA 2QTFA 3NG1A 1SXJE 3CRW1 3HU2A 4TQUS 1G18A 1HNWQ 5J3BA 2JIZA 4XJXA 4BQSA 1R5BA 4KCGA 3KQUA 2PLRA 4QNMA 4Q4AB 3QKRA 5FPTA 1OKKD 3UPUA 3AKDA 2EWVA 4B3MQ 2BEJA 4JL8A 3ASYA 3CB4A 4QBHA 3PIPA 1LM0A 1MT0A 1N34L 3ND8A 1L0WA 3WYFA 3P20A 3GQBA 1GL6A 2YINC 5GAEC 3OIWA 5H68A 4LF4Q 1HEIA 5KNCA 4M9QA 5E7MA 5EXSA 1VYUA 4L9SA 2WB1G 3UWKA 2HCJB 1YI2A 2QENA 1OYYA 4RKFA 2WZQA 1JR3A 2QBYB 4AG6A 1XMQL 2J7PD 2YHSA 1TU4A 1HT1E 2ZRJA 3BJUA 1FNNA 2WAQE 1W4AA 1TPZA 2VQSA 1Q90A 3SGIA 2WSSA 4GZLA 4A15A 2JDIA 1KO1A 4A3LG 2PCJA 4MKFA 3ZJYA 3U7HB 2W58A 3TJZA 4Q7KA 4X66L 5BQ5A 1G3QA 1NKSA 1T5EA 2CCJA 2W0SA 4IJMA 2B8FA 1X86B 4OXPA 2MSEB 1KXLA 3B2EA 4BLOA 4GLAC 3VFDA 3LO5A 1E98A 4YCWA 4G3XA 4PO8A 1QZGA 1EGAA 1E2GA 4P4SA 3CRMA 3E2IA 1LB1B 3HOVH 1KJZA 1NTGA 4DUYQ 1ZBDA 1HQMC 2CQOA 1P8LA 4K46A 3VHLB 3K70C 4Y7NH 2ZRPA 1D2EA 3H4MA 1N6OA 4GOJA 1TWAH 4GN3B 4JLNA 1TU3A 4JVMA 2ZYVX 4EAQA 3SJZA 2ZE5A 5FPHA 2QUZA 2PMKA 4XVRA 1SLJA 1JECA 5IF9A 2J87A 3FHOA 3K0XA 5AUQA 3CCJA 2H5EA 1VG8A 5EXTA 3NVAA 1Z2CA 4QRHA 3P4XA 4IVQA 4PC6A 2HQLA 1XD8A 1SHZA 1KDRA 3C4JA 1WFQA 1C0AA 1G6PA 1A2BA 1KI2A 1SQ5A 3MMPA 1HJPA 3PUXA 1SZPA 4DDTA 1W36C 1Q57A 3KFUA 2VQFL 1UEBA 1N2CE 1ZRHA 3RVBA 3GP8A 1B23P 4XD7A 1CJVC 4B32A 1XTQA 1VQ5A 1Z0FA 4M9SA 5L3SB 4G7OC 1NMZA 3CPEA 3W8RA 1IBLL 1OFIA 4POGA 2IEYA 3HOYG 3SFVA 2W6IA 5KPJA 2QI9C 1SGWA 1T4GA 3KJOA 3HFZB 3HOZH 1W46A 3AKYA 3BS4A 4I1OA 4RD1A 5CDFA 3RAPR 2OHFA 1NRJB 4X64L 3HOUG 3DMDA 1E9BA 3NHAA 2R8RA 3AF4A 4LGMA 1G64A 1VQ6A 3EPJA 2JEAI 4LHYA 3W5IA 2BKUA 2VBCA 3GTQH 4GKJL 4LJ7A 1D2MA 1Y8OB 1DAGA 4A3MG 1XTJA 3S1AB 4CRWB 5C4JH 4GFDA 1K3RA 5JEEA 4P31A 2VHJA 4D0NA 3AVXA 4HUQB 4DV1L 5B30A 1ESMA 4Z1MD 1K0RA 2PZEA 3B1XA 2CCZA 2FFAA 2ZJAA 3S1QH 2O5VA 2Y0SG 4E5UA 4UP9A 1PJRA 4FWTA 2NG1A 4DNIA 2B8WA 4GLVB 2QTVB 2H57A 3GTKH 2DYKA 1QJOA 1SFOH 3AH8A 3NEMA 4YWMA 4U00A 4DCUA 3CMEA 5IE8A 5J4YA 4M1SA 1Z06A 5BR8L 4W7SA 1JBKA 2ECKA 3ADKA 3BD9A 4DSNA 3IDQA 4NPHA 1FP7A 4Y52H 2ZI4A 2XZLA 4IFDH 3OPOA 3I55A 1N33Q 1TQDA 3CC7A 2EWWA 1H9SB 3OIYA 3R7WA 3VKGA 4A76A 4LJ4A 1ZM2A 4FMDB 4L5RC 1VF5C 4M0LA 4MNOA 3CCQA 3AGQA 4TYYA 3I72A 1KDPA 1OW3B 2UXCL 1VQ8A
chains in the Genus database with same CATH superfamily
1EDDA 1UMCB 4WORA 3N87A 3OZBA 1PRTD 4XRGA 2O20A 4KLNA 1MXHA 1X8XA 1XC7A 1MX5A 5CH3A 1XZJA 2OTLA 2RGGA 4BQNA 1ZQ1A 1YVCA 4G8DA 3N07A 1ZXBA 2B8TA 3UT6A 3PHHA 1SU6A 3WZ2A 1CIJA 5GPBA 2V4ZA 2DMRA 2H0AA 1Z8NA 3E4DA 3RFVA 3CZMA 1EG2A 4Q39A 4GP7A 1F6WA 1NV9A 1RE1A 5TVGA 3F7NA 5IKMA 4J4BA 3M81A 4HDKA 3O4VA 3RG2A 4JLAA 2J9YB 1XAJA 3FNEA 2NUTA 3D64A 8AT1A 4OB8A 1GT91 3ZGOA 2Q2HA 3TF5A 1PH5A 1N92A 4YRBA 2OLKA 3MRSA 5DH9A 1NN5A 1Y69U 3IA7A 5MGBA 3CZ9A 2B2WA 2Y3IA 3BXHA 4GYKA 4FF4A 4ZVOA 4FUQA 1X38A 1N3LA 4JP1A 3GLFA 3LY5A 1PYDA 2DU8A 3CNLA 3IEPA 1DOMA 2QP9X 3FYTA 1ULAA 5CVEA 3IUSA 1JAYA 2QTMA 4AY5A 4NW2A 4BBRB 1U1GA 1PH4A 3UICA 2VXWA 5BV2P 2HCCA 4DV4L 2D2FA 3WK7A 1KOJA 3PK0A 4MVCA 4H4CA 1JLLA 4AJLA 2EZ4A 4DR4L 1F8UA 4N0QA 2QYHA 1TKWB 5IVKA 3BXOA 4HKTA 4N82A 2BA1A 3R5HA 2X9VA 5FOSA 4F85A 1Z63A 3OZSA 2F0UA 5DX8A 2AF3C 4A10A 4YMLA 3R5FA 3DBLB 4FDAA 4KLKA 2OENG 4FMCB 1GUSA 3KZCA 1W29A 2JK0A 3WGVA 3IODA 3UQYS 4TLAA 1EYGA 2K5WA 1BJKA 3J81j 2LFNA 3NB0A 2BM0A 3FRPB 3BWYA 3N5CA 4WZBB 2P6MA 1DP4A 1FUUA 3ZHSA 4BAUA 1KC3A 1YQDA 3EPPA 2LE0A 5FNVB 4JI0L 3TAUA 5FWDA 3ZY5A 1XNJA 2VHZA 2ONCA 5JTTA 3OIUA 1CA5A 3SMVA 4XGKA 2R7ZG 3TSSA 1PZID 4BZPA 2IYPA 2C2XA 3AP1A 2GD0A 4FYMA 1WTCA 5K05A 3ABOB 3BDCA 1WTXA 1CDEA 2CZCA 1TYAE 5T4HA 2ZRQA 2NN6G 1ACMA 5CBPB 1NW9B 2YMQA 5F1PA 1IJFA 2WHPB 4X1KB 2FWPA 4V0KA 3VQTA 3ETCA 2JJ2D 1BCSA 2FP4B 5KCMA 1TMOA 2WYUA 5BN4A 4S1PA 3RYIA 4DNPA 2ZBQA 2HPZA 3WB0A 3PX2A 2G25A 2R5FA 4PGFA 1TFRA 3K2QA 4CF4A 5ELEA 2PWBA 5BR4A 4PYOA 2NO0A 4MI6A 1VBNA 4JJ6A 1JDNA 4BQPA 1G60A 4K6GA 4X66B 3QLUC 1TUBB 4PG4A 3TYXA 1RD4A 2MMCA 1QYIA 4L5QA 4RV4A 4ADSG 4B75A 1E1LA 1QCDA 1X74A 3UJ7A 4HDAA 1WZ2A 2IGTA 4IUUA 4ECEA 4Z2AA 3X3MA 2MSCB 4I9NA 1CULC 2O7SA 1BXKA 1HMYA 4BNDA 1KMHB 4TLEA 2F6RA 2OP1A 4FYHA 3SJBA 4KXVA 2WU3A 3DHEA 1BAPA 1P5HA 1W0JD 5AUNB 2HO5A 4J4HA 2Q5JA 3GJTA 1VBMA 4XPIB 5ALTA 4A91A 2WKRA 2QTWB 3WI7A 4CM7A 3PCTA 3LRXA 1TO1E 5ITZA 5ERGB 2FINB 4OP2A 3T56B 5C1PA 1LACA 5FPSA 3C15C 3M34A 3FWHA 1T13A 3PGMA 3Q24A 5IAEA 1QIEA 1KL7A 2V1XA 3VPBA 3SZLA 4W1RA 1ZH4A 4XUGB 2K01A 4ZRDA 2NVOA 1EVIA 1S9HA 2ZJQA 1KOGA 3IJEB 2P79A 2CDBA 2P4SA 3B6IA 4TL6A 1UM8A 4LQ4A 2EZTA 3OZCA 2IC5A 2B61A 3WRWA 1R0CA 3MFQA 1NVTA 4EO9A 4JKIA 1G3MA 2ZB7A 1Y4UA 1UPTA 4HWTA 4D82A 1V1QA 3GDHA 3D4IA 5IT9A 4FN5A 1TIPA 3WLQA 1HDOA 4NFHA 4JJEA 4B47A 5K0ZA 4HLNA 4MKXA 5LQUA 5AO9A 2QMHA 1SFRA 3CIFA 5E7IA 3VAZA 5KMGA 2I7VA 1FXUA 2QJFA 1MQAA 4IFTA 1ETUA 4HLCA 4ZCKA 3CZCA 2QPTA 2HMAA 1VKRA 3THWA 4FGUA 2P11A 3NHBA 1X0VA 2ZI6A 1QPZA 2IXFA 4ZAGA 2GT1A 3GU3A 3MLEA 2RKBA 2ZXRA 1T6ZA 5DCUA 2C0QA 3FP9A 2MYTA 2TMDA 4KLCA 1QVAA 4OO1I 3STBC 2QVLA 2XW6A 3AI7A 3CX6A 3FPJA 1E0JA 4MA5A 1PH3A 4LAAA 4BHTA 1RXSA 2BGUA 1GQQA 2HK9A 1YB7A 4PC3A 3A2NA 4LYFA 1QUFA 5AHXA 2ZCJA 5BSUA 5BY2A 4CEHA 3AEKB 1YV9A 5KYTA 4DV2B 3TEMA 3ILXA 4KQ2A 3VR6D 1Z7EA 3G9UA 1SJ9A 1ZHHA 3PQ2A 5FR1A 4Y7CA 4F9EA 2VHTA 3AFIA 3A4TA 1O5OA 1OF1A 3K9CA 5K4AA 3QFHA 1ACLA 2RHTA 1NURA 2XGJA 1WV0A 1GV0A 3TTWA 5LSAA 3RVRA 2PY6A 3BG5A 4EB0A 5J4VA 2FR8A 4XI9A 1I5EA 3UC9A 2GZHA 1E1CA 5L3RA 4JI4L 4DF3A 1M2WA 5C44H 3GRYA 1Q7BA 1D1TA 1NMXA 3SVTA 3WISA 2C2ZA 2O2YA 4L76A 4KE9A 5DYTA 1QZ3A 3RWOA 4BKPA 3U37A 1YA6A 3HCEA 1T3ZA 1H66A 3BXXA 1G6Q1 1Y82A 4KRFA 1CY8A 4XVQA 5AI0A 5GM2A 4XOUA 1HL3A 5I7FA 2RGYA 2H85A 2X6QA 1Q1GA 3V8BA 3WDNA 2DR2A 3ZV6A 1ESFA 2X58A 3WWZA 1VG1A 1KSGA 3KQNA 1EB9A 4RSGA 3C3BA 5EPEA 2EYLA 1RPAA 3CLVA 1P7WA 4JUAA 2SNIE 4MNTA 4CGZA 1YRHA 5KWIA 4BX0A 4GX0A 1NVXQ 2CNDA 2O54A 3DOEA 3BEDA 2ICIA 1A04A 2DUDA 1TVXA 5KTKA 3CUEF 3I12A 4EF6A 1SOVA 2XE4A 4H18A 3E3OA 1UT6A 2PQAB 3RBAA 1JBEA 1N1GA 2WR8A 1GHJA 2A78A 3ETNA 4MAMA 3ABQB 2X9LA 3M5PA 6ABPA 1W73A 2V7PA 3JQBA 2PJRA 5CVCA 3Q72A 3JWHA 3BK2A 4ROTA 3LT1A 2FMIA 4KMSA 4RK0A 4HIKA 1SQFA 1SOAA 1P19A 2W11A 1DZ3A 4HDQB 1CSEE 1OXMA 1M83A 4KXLA 1RE0A 2W6CX 5TR9A 4CMBA 3V80A 2FJPA 2FN7A 5T7BA 1VCOA 4QLOA 1Q8IA 2XWBB 1XB2A 2Z6KC 3H9JA 8ATCA 4AD8A 3GFTA 1FC0A 4PVCA 1FD7D 1BR9A 4DEYA 2Y0BA 1WA5A 1E3PA 3WB2A 3PIIA 4OAOA 4WXMA 1TADA 4YIKA 4QLAA 3QXJA 4EW3A 5IEJA 4DK1A 1M6EX 3LW7A 5JBIA 1NVBA 1P9RA 2BMEA 2OORA 3LUGA 2IYTA 2C7PA 1GTL1 4JBLA 3M83A 3QEMA 4P86A 1XWFA 4A03A 4NXNB 4D0LB 2CHGA 1V4VA 1VYHA 3MUOA 3V8EA 5IGGA 2YWHA 3AVTA 5FWYB 3PZBA 4WZAE 3H5TA 2W2QA 4PTLA 2LDBA 4DCGA 3D2AA 1ZUD1 5JEAJ 3EMBA 4U9HS 5DM0A 2VT6A 4C3HH 1YKGA 1EP1B 3VKUA 1YR6A 2Q2VA 3VR3A 3PUHA 1S1MA 1AHPA 4GS3A 1ZDMA 2R00A 4H35A 4UHKA 5LD2C 1YJCA 4OV6B 1J2EA 3MWEA 2G1JA 3CCMA 1MAWA 2HLNA 1SOMA 4DB4A 3U3MA 2WP0A 3UAYA 4FDTA 1HNXL 1P3JA 1C7EA 4JI6B 5ERXA 3U17A 1LV7A 1P29A 3CX7A 5E4YA 4AKIA 4KO2S 4YQEA 1ONNA 4FILA 1IQ0A 4E4RA 1BXTA 5C7IO 4JWTA 3ZCPA 4QXQA 1EWVA 2OXIA 1U8AA 1ML0D 2ID0A 3DEOA 1SVOA 2HJSA 4BWFB 4MVJG 4AURA 1CQPA 3FN4A 3AR5A 4ZO8A 4WD3A 3TMYA 2Z58A 3HU1A 2O6LA 2IZ1A 3DULA 1FYVA 3A7AB 5GZ6A 1PT7A 4BV3A 2X0KA 2RHWA 1U3TA 4Q7QA 4ZJYA 1E58A 4YONB 4RYLA 3LX0A 1U9YA 3GCDA 4TWJA 4QUBA 4KE6A 2GZ1A 2AZTA 3E53A 4NLLA 5DLYA 2JA7G 1C9NA 3AYHB 1K3TA 1E2MA 3QXCA 3IOEA 5HZKA 3K7AH 3JATB 4CMEC 2AN9A 4C29A 4YRDA 1GR1A 3CH5A 4WRRA 3GY0A 5ICSA 2L5TA 1X3LA 3TTYA 5AFSA 5K0EA 1HDZA 2WJ4A 4RVHA 3GNLA 1P1RA 3M4JA 4QJ4A 3UANA 1EYDA 2A92A 3GT3A 3UAVA 5HG0A 4ZV9A 4AZ0A 3U3DA 1EFAA 1QGED 2YJ6A 2MINA 1P16A 3R8FA 3K5LA 3NP7A 1NCVA 1EK2A 5M3MB 5I8WA 2E4WA 5EWLA 3HRKA 4DR3Q 2GARA 3RODA 5TSDA 1M2EA 5BOVA 5MN6A 1E0AA 1CTQA 4LJRA 4FGKA 2H5LA 4GBMA 2RHQB 1EVQA 1KF0A 4ER3A 4EO4A 2JA2A 3NXWA 4NMXB 1AF4A 4QL3A 5A1TA 4QBGB 2WFWA 3D6HA 1T2UA 2CJWB 4F5WA 5IUKC 1LUAA 1IHDA 2EDGA 3TXXA 5KHLB 2IOFK 4QPJC 3QPVA 1MO3A 4TLCA 4C87A 1A98A 4J90A 2XGSA 4ON9A 3ROMA 5CYGA 2BJWA 5DSXA 1AY0A 1TWGH 1QYDA 2JAPA 1C48A 1ZR2A 2BM8A 5IF3A 1H2XA 4ASUD 1M90C 4MP6A 2X0NA 2NO4A 4B3HA 3SR3A 1TQ2A 5CT5A 2B2UC 3D5TA 2IYQA 5C1IA 1Q22A 4L02A 4KKSA 4UBJA 1I6HB 3M4OB 3ROXA 1D6JA 4AULA 5CPBA 2CVOA 1KQOA 1SBCA 5SICE 3OSZA 2I0QA 1KI4A 5KJFA 2W98A 1X94A 3N2GB 4ESHA 2XDWA 4QUCA 1TF5A 1KIFA 1STGA 5CCEA 3D81A 1YJ9A 4PV7A 2CLLB 2PJZA 3A8TA 1O78A 3K6JA 4MR9B 3STHA 3G85A 3EDOA 5AVYA 4DB2A 4KUEA 3H83A 4RORA 4DLAA 1ZR4A 4ZQHA 1BO0A 2JQOA 3QPDA 4KXFB 4UNRA 1G21E 3ZGYA 2ZIXA 4V2IA 5ECDA 2N47A 3V8PA 1FVIA 3BGSA 4HPWA 4CU2A 2H4ZA 2E89A 3GROA 1DFGA 1ISHA 2A0FA 1BN6A 1M1NA 4I65A 3SDBA 1QFJA 2PMFA 1OXSC 2R11A 3CXUA 3SR1A 3WRVA 2F7SA 2WOOA 1NBMD 2F8SA 2ZUWA 4G7ZC 3T0FA 1TUGA 1VL8A 5KTPA 5FBVB 5C8XA 1E2IA 1EFPB 2MNAA 3PFIA 1RWXA 1DPGA 3PDJA 4RABA 4A8JA 5JJ5A 4DA9A 4F38A 2FPXA 3TFWA 4ZCLA 5K8VA 4QYIA 2H2HA 5K8JB 6CHYA 3LZCA 1V5IA 4WNAA 4DE5A 3KAKA 3BMNB 1WTAA 2BE5D 5T8KC 2G4CA 1V3TA 3EQ9A 4BS9A 4FKMA 4TSSA 1IXKA 4IXMA 4D9CA 4L4SA 5EPKA 1KMMA 4L4UA 5DXJA 5HWSA 3F4LA 3PF9A 4L0QA 1B8NA 2H3HA 3OAAD 4CT0A 4GKKL 2FSHA 1LY1A 5KHOC 4LF7B 1RHUA 3H6MA 2JJ1D 4JFAA 3O38A 3HKDA 5GOTA 4HZIA 1DGSA 4A3FH 4LW8A 3IVRA 4K6LA 3JD3A 2PKEA 4FOTA 2QSYA 4R4JA 2ORIA 4EYGA 4E14A 1I0IA 2MYNA 3OT1B 5B1EA 1Z2DA 3C7CB 3WLOA 1Q19A 2X6LA 4DXAA 3P2IA 5KKAA 3NAMA 3DVRX 4AUNA 4UULA 2ZXOA 1CS4C 2J32A 2FWIA 3T9BA 4QUJA 3C6KA 3T1VA 5IC6A 4LY3A 3BDLA 1E18A 2PXHA 1WXWA 3RU7A 1GFWA 1YQUA 2CMHA 1RCVD 3FA2A 3C3DA 1TW2A 1I94Q 4K81B 3E2PA 2ZT8A 1C2TA 4RETA 2EYUA 1N6NA 4UNNA 4B3SB 2GD6A 3I7FA 1YZKA 3C6ZA 3X1XA 3PHGA 4D2IA 2WKQA 1OTHA 2HLDA 1BWSA 4BBJA 1IIBA 1E8DA 1I6KA 4WLUA 1MA0A 1RKVA 2H4XA 1TI7A 1E3DA 3O7MA 1U4RA 3GARA 1RHRA 3UK1A 2BAGA 4ZYUA 4MA0A 4GOMD 5I3CA 4TTJA 2I1VB 4TMTA 1B4OA 3L07A 4WJZA 3WQSB 2R8ZA 1WVGA 2AXEA 3ABSB 4HN4B 4B3RQ 3NJ4A 1XO1A 4HR7A 5CEJA 4EVOA 3K5MA 2W43A 5UKDA 4XYGA 3SF0A 3A6LA 2HV8A 3JYOA 2Q8IB 1VJTA 4ZTZB 3AFNA 5EQFA 3IEIA 2O8VA 5EUBA 3VO8A 1KYIA 1KI9A 3N8DA 4LWQA 2ISSD 1DQYA 2ZG6A 4G5GA 1G1MA 5SV2A 1NPDA 4AG3A 2ZIZA 1E4EB 4TLBA 3AEQA 4IJ5A 4WESA 4DW8A 4V02A 2J85A 5IVIA 5FO1A 4F3YA 1KYZA 4QWWA 3MTSA 4MB0A 2F8TA 4B73A 3ERSX 3G0IA 1LFAA 1G8PA 4GMFA 1ADBA 1Y3FE 4LEIA 2NQ2C 1OTXA 4B3IA 5F7JA 3RIHA 2K7VA 2KUMA 1NBIA 4JU9A 3M89A 3ELWA 3HBMA 2D2CC 5A5VA 4A3DG 3V32A 3LPNA 1G18A 4QNMA 4K5WA 1UBOS 3MOSA 3CX4A 2EJVA 2QW7A 3WYFA 1VOTA 5ESDA 3G2MA 3AJEA 3QOXA 1YI2A 3RJ5A 5JE8A 1S2GA 1QH9A 2C5FA 4X9XA 2EYMA 2JDIA 4MKFA 4Q7KA 4E5NA 4QOIA 2DFVA 3FVRA 3DA8A 4P4SA 1QZGA 1ADCA 3CRMA 4KTVE 2RGUA 3HOVH 1PRYA 1HQMC 3F7MA 5HUJA 1KR5A 1U80A 4ZHQF 1HE2A 3PQIA 3CCJA 3D6FA 5IWCA 4IVQA 4D43A 2B35A 5CNKA 4DDTA 2VQFL 3R6LA 4XD7A 3VYTA 1OFIA 2W6IA 5CU7A 4MW1A 3K8QA 4A27A 2YXBA 1Y8OB 2CQAA 4OAPA 4X7MA 3CZRA 4RTJA 1VGQA 1QKKA 1U31A 3BXFA 3WAKA 5GOZA 2GA4B 1JBKA 3GTLB 1F2TB 4KGZA 2XRFA 5D3ZA 3C8DA 1DAKA 5HUHA 4ZPJA 1AB6A 2WSMA 8GPBA 3SIXA 3S2HH 2FETA 4CDDC 3LY8A 1H1LA 1YZNA 1EK6A 1O03A 1AS3A 4A2QA 1EIYB 1XPUA 1OJ7A 3LXRA 2MJ8A 1Q7EA 2R5NA 2ZQZA 4BVLA 4A3IG 1PTOH 3H2GA 1V11A 1KDBA 2XTAA 1CKNA 3ILYA 1I8TA 1KR2A 2VJPA 3OOWA 2Z4SA 3L6DA 3PQ6A 1FJXA 2QYSA 3TTTA 3U3JA 3K0KA 4ALLA 1F51E 1HNNA 5LMNL 3KL4A 4LJLA 4BKQA 2EFGA 1KARA 4JBMA 4YJ2A 5G3YA 4D8WA 4QM6A 3R41A 4R8MA 2PXXA 4KN6A 3B2NA 4NYIQ 3CUTA 3ORFA 3VTKA 5IDXA 3L82B 1J0DA 4O3MA 2NVTH 2O1WA 4ESOA 5B7GA 4NU0A 4KZPA 1K8OA 3K80C 4AP6A 2F3IA 3JZIA 3WDLA 5G0UA 1ZGCA 2QRVB 4WGFA 1C50A 3WNQA 3HJUA 3RJMA 2BL4A 1LWOA 2W2VA 1DBIA 3DTTA 2JLXA 3MJRA 5ADVA 2G5DA 5BVGA 3QVKA 4C3IG 2YVQA 2BZ0A 3A1UA 3CLHA 2OAP1 4RG1A 1QONA 1ARZA 3UN1A 2PO5A 1D5CA 2ZJ5A 3NXSA 4B6FA 1LGYA 3HU3A 2L0XA 4CTKA 4OHJA 1EOVA 3ZVKA 5CC4A 3O47A 3V5NA 3TUZC 3F5FA 4WQMA 1K5PA 4A1OA 2B34A 4JWKA 3D3KA 2VQEQ 1W8DA 1K0FA 3DMGA 2IX3A 1K5HA 4AZ3A 1EKXA 1EDOA 1M4VA 2ZAMA 1ZCFA 3LT5A 2QAGA 1SB8A 2HUPA 2NUBA 3IEVA 5DYGA 2YJTD 2BFFA 3IAUA 2Q4BA 4F86A 1PT8A 3TZKA 4F3CA 1D1IA 3H15A 4XQEA 1RD9D 1I2MA 5EP2A 5IT4A 3HXPA 4IBOA 1O9HA 4B3TQ 4K9SA 2NTSA 3THYA 2Q3DA 5KYWA 2EX0A 3ZBTA 1SBHA 1J42A 3NVDA 4DIKA 4KXXA 3KKKA 3VR0A 5JAOA 3GBPA 2JGDA 1YI0A 4ITRC 1LSOA 5AH0A 1A9RA 4FCVA 5EYPA 1QOZA 1F06A 1M67A 2ZTCA 2AX3A 3UXYA 4YXFA 3DV0B 4L75A 1K68A 1C9DB 2F4VQ 4TS4A 5EKKA 1X14A 4IQ8A 3EZYA 2JHFA 5KSZA 1GSAA 3P4UA 1U4PA 3KXDA 3LKVA 4FWIB 2B0JA 5KPDA 4BDSA 5EHIA 3UNXA 1CLEA 2JW5A 1HNZB 3I5MA 3C7KA 2REOA 2FEOA 2CL0X 5EHGA 3EDRA 3V34A 1L1OC 1CUFA 4P5EA 4RU1A 1I50H 4UEJA 3WSVA 1ZITA 3EEBA 2BEUB