1Q12A

Crystal structure of the atp-bound e. coli malk
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q12A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q12A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q12A01
2PPBC 1N5JA 2JDID 2RAPA 4GLVB 3SN6A 1CKOA 1ZNYA 4AG5A 1VQDA 4A93G 1RVDA 4Q4LA 1SHZA 1YE8A 3PUZA 4X66L 2DHRA 1TQ2A 2IT1A 4AI6A 5E7MA 2UXDQ 1X3SA 2R44A 1ZCAA 2GKSA 2RHQB 3R8CA 5LMUQ 3HWSA 3T1HL 5EE5B 3UATA 4IPCA 5AUQA 5FTNA 3N5CA 2WJGA 1XDBA 1A5TA 1IJEA 4BLRA 3VKHA 2NVTH 1KK1A 1NG1A 1ZC3A 2Q0HA 4TKOB 4X65L 5FFMA 4AD8A 4BFYA 1RRCA 4YWLA 5D3QA 4UNNA 5FTMA 5DYGA 3EIVA 1G5TA 3CR7A 5FOSA 5FPTA 3TR0A 1VDZA 4D82A 4AYBG 4DR3L 2H7VA 3IBGA 1W4RA 1G51A 1TTTA 4P4SA 3NBYC 2B8FA 1E6CA 2ZRKA 4A0RA 3OEHA 1N6HA 3ADDA 1C4OA 2RGDA 1N5LA 5FUXA 3UKDA 1U9IC 2OEPA 2AUJD 3AVVA 4XH9B 1FTSA 5JI2E 2C04A 2WP8J 3PIRA 4PX9A 5LMNQ 4QHYA 2IYXA 2REXB 4A75A 3AVPA 1BKDR 1D9XA 2X2EA 3C4JA 3SYKA 3U6KA 4PZ6A 2WB1G 4C2TA 4W5WA 3SJAA 1KMHB 2OM2A 4KLKA 5KDOA 2H17A 1QG4A 2C35B 4KI0A 3H1TA 4GKJQ 1FUUA 3GO5A 4L9WA 2WM9B 1XU4A 1XCPA 4GP7A 3HOUH 1Y1WH 2MO0A 1OH6A 4O0MA 3BK7A 2QMUA 4NCHA 4DSNA 4YMVA 1R0ZA 3DPUA 2HJGA 2NZOA 1X54A 1C9OA 2P65A 2ZVQX 3S16H 2BDOA 5GADC 1FQKA 2PX3A 3QEJA 4XSGA 3RZDH 1P61B 1XD2B 3EIQA 4AKHA 2PEYA 1XTSA 2GVBA 4DCVA 3H3VI 2F43B 1N33Q 2ZRHA 1SZPA 2O8DB 1XZQA 2KHIA 2FNAA 1ZINA 2ZE5A 4KAXA 4PR0A 1XPOA 3RWOA 3E9HA 3GDEA 2UXDL 4URXR 2GZHA 1J6QA 2WWFA 3D6TB 4QM6A 5L3SA 5LMUL 1TF7A 2CVHA 3IGFA 2Q3MA 3Q7QA 3LLMA 1G8GA 3VTKA 1N9WA 4TYPA 3KOJA 1ODFA 1H9SA 2R93G 1WF3A 2H92A 2VHCA 2XJ9A 1FR3A 1NKTA 2RGBA 4LHWA 4LBZA 2IYSA 2A5FA 4Q7KA 1Z0IA 1T91A 1HE8B 4JLVA 1US8B 1OYWA 3CONA 1II9A 4NCNA 4B75A 5JMTA 1N2CE 2J0SA 2IK8A 4QJ5A 2ZANA 3EN2A 3VHLB 1Q20A 3EWSA 1TF2A 2EXDA 4BA2I 2MSCB 2C96A 2FWRA 5IK2D 5C4JH 2HT6A 4EFNA 4XWAA 4YY3Q 2FU5C 3DM5A 6Q21A 3SYLA 4NONA 1W4AA 1KAGA 5LMNL 1Z08A 3K0FA 3Q72A 4MRRA 4LF7Q 1X3FA 4X6AH 3FWYA 3GTJH 5BN5A 3AVWA 4L5BA 2CLCX 1FVIA 1UKEA 2QRZA 3BE4A 1KI6A 3PUXA 3QKUA 4IDPA 1AIPA 3QOFA 5JWHA 1QVAA 5C18A 2R7ZG 1YHQA 1XF9A 1U90A 3LNCA 3AKEA 5FBVB 2Q9CA 2O8FB 1E79A 1ZMXA 1XTDA 4GKJL 1F6BA 3GFPA 2HCJB 4Q03A 4BLOA 1ASYA 3B1ZA 2BEJA 4ILEA 2WAXA 3CRRA 4EFMA 3GLGB 2DWQA 4Z54A 2J7PD 4BFWA 1E3MA 4RZ3A 3VAAA 3I92A 3A1SA 2HYDA 1VQNA 3OZXA 3U3KA 3UE1A 1D8TA 4V0NA 2JLUA 1CIPA 4JJKA 2OLKA 2Z4SA 4PC6A 5ANRB 3D3QA 3WWVA 2ATWA 3WDNA 1NIJA 2JGNA 4IVPA 3CCQA 3DZ8A 2DFNA 4MKIA 1I5FA 2D06A 3MSXA 4P31A 1OTCA 4L5RC 2Q2HA 1PH2A 1N33L 4TTQA 3HKZE 4MQBA 4APVA 2REOA 1AS3A 2VHQA 3CZPA 2ZRDA 2RGAA 4UPAA 3ZS9A 3L2OB 1H8HD 3RNUA 1N6RA 1TEVA 3AUYA 3CBQA 4II7A 5HY6A 2R9VA 4Z1MD 1D9ZA 2CMKA 4U7DA 2C03A 1N5KA 2AK2A 2IHYA 2OO7A 4LK1C 3MD0A 1BS1A 3QQ5A 5LD2B 1M34E 4A3IG 1DBSA 5AJ3Q 2ZI5A 2OQKA 4IPGA 1II8A 4V03A 3CQZH 2VLIA 5HKKA 3H4MA 5LB2A 2NGRA 2WWHA 4HJ5A 1GUNA 1EFCA 3K09C 4BLQA 4URUR 1U9IA 4A15A 4B73A 5EAYA 1E69A 4ALPA 4DT1B 1G8YA 3N2EA 2E75C 1I4LD 1NF3A 1OLOA 5TY0A 2ZXUA 3H15A 2QA4A 3B82A 1XEWY 2DFLA 3LFUA 4PV1C 2PT7A 1VQ7A 1L7VC 4UQOA 4YY3L 1Q46A 5FUWA 2OG2A 5FH9A 3RS2A 2R8RA 1R8SA 2GRJA 3RN5A 1H95A 3CX8A 2ZRGA 5D3MB 2J9RA 5GJCA 3W90A 3KQNA 4LF7L 1WBDA 2BMFA 2E87A 1G41A 2ZRNA 2BMJA 4GOXA 5F9HA 1G1MA 4UNPA 2YWFA 3KQLA 3ZS8A 4A3CG 1B0UA 1XTJA 2W58A 1ESNA 3KJOA 4V0OA 1P9NA 1W4CA 1OFHA 4QQBX 5C4XG 4IFDG 4DLSA 4EIWA 5E95A 2ZRPA 5IYDG 4I7ZC 1VYUA 1H65A 1T0HB 4KFTA 1K8OA 2WAQG 1Z29A 2A5JA 3M4OH 5CLQA 4OQMA 3CX6A 3GLIB 5ELNA 1H8ED 1PZNA 2FPMA 3EPHA 5DN6A 2AXPA 1PH5A 4ZDJA 5JHGB 1Z83A 1VQPA 2PNRC 2UXBQ 821PA 1A2KC 1RE0A 4TQ9A 4G5RA 2UUBQ 4IDOA 5IT9c 2G1JA 2R6GA 1SQ5A 2OCPA 2V6JA 2JLQA 4A3LH 3TGPA 1Z07A 4QHTA 2J46A 3ULLA 3M6AA 3T56B 2A6HD 3FMIA 4C0LA 3PENA 3IFTA 1NMYA 1XFAA 3E0EA 1RRPA 3BZCA 1WYDA 3J80c 4LY6A 1KGDA 1U0HC 1TADA 1ZUNB 1Y3AA 1XMQQ 2GESA 2VP0A 1DCZA 5AJ3L 3GQBA 4NDZA 5JEAG 1NY5A 4PZZA 4GPTA 4NP6A 2O0KA 2QI9C 2WWGA 2BH8A 4TL8A 1ZC4A 3EPKA 3GTGH 1W5TA 1KD1C 2VTKA 1N5IA 3LAWA 4DB2A 5FPSA 3QKSA 4QGFA 2GK6A 3K7AH 1X1SA 3DO6A 4NPSA 1Z47A 2A78A 2OCAA 3K70C 3EZFA 4PC7A 4CW7A 2O8BA 5KOYA 3AH8A 2JK8A 2EFGA 3LRPA 3W5JA 1WI5A 4RKFA 4M21A 2PH1A 3AKCA 3ZD6A 3W5OA 2ZYVX 1N6KA 3BBPA 5FR1A 3L0IB 1QHHB 4URVR 2FEMA 3AVQA 4TTRA 2QBYB 3KXLA 5IYCG 1M8PA 2RGXA 2CKZB 4G0NA 4URYR 1JBKA 1KO5A 3CR8A 3K8YA 4HDCA 2UUAQ 4DV0Q 1DO0A 1ZVQA 4R4CA 2PCFB 3MWJA 1TAGA 3VFDA 2KWIA 1DVRA 1PUIA 1D2EA 3MGCA 3PR1A 4KMUC 1JB7A 2A7QA 2SHKA 2GNOA 4KLNA 3OAAA 2F1JA 2BBWA 4UNRA 3KQHA 4ITRC 3THYB 3T5DA 4UP9A 3ASYA 3FMPB 4R4IA 2JE6I 2Q9AA 4YXWA 4HLQB 4J15A 1NBMD 4P33A 1E1QA 4Q4HA 3CLVA 4EJSC 5IRCD 3HGBA 4AYWA 1UFQA 2UXBL 4AIMA 1GNPA 1Z3IX 2UUBL 5C0XG 4YCWA 1E2NA 3CD6A 1NJFA 1A63A 4TQAA 4X8MA 3RRNA 2GXAA 4AKIA 4D2IA 1FW6A 2BOVA 2QEQA 4L15A 4BWYA 4KU4A 5M3MG 3LBHA 3X2SA 3QENA 4JJZA 1I4TD 4ASUA 1GRQA 1XMVA 4V0MA 1XCGB 5J40A 4BFUA 3JC66 5DI9A 3TIFA 4PAOA 1ZD1A 4B6EA 4B74A 4A2WA 2AHOA 1NN5A 3M0EA 4DZZA 5B58C 2EW1A 5E7IA 3HOZH 1P2VA 3KX2A 1Z63A 1XMQL 1HPCA 2MMCA 4LFCQ 5EXXA 4HAYA 3TH5A 1PVOA 1SVMA 2EFDB 4MTNA 3I73A 4A0HA 5M04A 4S35A 3IPYA 1D5CA 1DPFA 1LVGA 2OT3B 4BEBA 3BWDD 2XNDD 2PT5A 2N8NA 4BEJA 1N34Q 4QL5A 5IE8A 3GLFB 2BKUA 3WXMA 3IIJA 3TLXA 3HKSA 2OFOA 1Q81C 1VHLA 1ZM7A 3Q85A 3EASA 4ZDWA 2H16A 4P32A 5JJIA 4CT4B 2WJJA 4ZIRB 5JHHB 1HZAA 2MSDB 1XJVA 4LF8Q 1HQMC 2GZAA 1R9TH 3L0SA 4I4LA 3B60A 4MGKR 4QJ3A 2FPLA 4DBLC 3A74A 4XWOA 1VQIA 2WFWA 2CCZA 2KJQA 1ZM3A 3KDSE 1W0KD 2IHEA 3H2YA 5ELOA 1P7CA 2W00A 2JEAI 5IHPA 5L3QB 4B34A 4DV0L 2FSIA 2IS4A 2JCSA 1HE1C 4G3XA 3LXRA 1GKUB 2GBLC 1I6HH 1GTVA 2YWGA 2J45A 3TJZA 1TWHH 1IN5A 2PLFA 3L0PA 4F92B 4KVGA 1WJJA 1G4AE 2A6EC 3KKMA 3RYTC 1RRGA 2JJ2D 3F2BA 2B8GA 2H5EA 2KA7A 3LH5A 1KNXA 1KQSA 3H86A 5FBRB 3TRZA 1LTQA 2YKGA 2QP4A 4LRWA 4A3EH 5FR2A 1E2IA 1LYLA 2KCCA 4RD1A 4ZDKA 4G1UC 3TAHA 2EYQA 4IRUB 3A4LA 2EVBA 5FLXc 1LW7A 4EQ5A 2ZJQA 1ZNXA 2Z43A 3DHWC 3T34A 1U99A 1SR3A 4JIMA 2WMNB 3D7MA 4W7SA 3R8FA 1CF4A 3O8CA 3U50C 1SXJD 5AK0A 1LTLA 3ZJYC 4JLOA 1SXJB 4LFCL 2NO7A 5BWMA 1MRNA 1AE3A 2EWVA 4GRAA 2GF0A 1KAOA 1DOAA 2BE5C 4QNMA 5E4FA 4OKSA 3RSOA 1OH8A 1XEXA 1YZNA 3TSZA 2JA6G 1WCV1 3CF6R 1PFSA 4PPGA 5G40A 1N34L 2ZROA 3ETLA 1R8QA 3W3ZB 2ZT9C 3I61A 4M4SA 4RSGA 1KHTA 4LJYA 5AUPB 5HZKA 4TYYA 2IBMA 1KL9A 2ATXA 3HOXG 2VPPA 3PO2H 5SZHB 2IUTA 1KDPA 2BKEA 2CCJA 3UMSA 4XOIA 4LHZA 1KNQA 2BMDA 3FKIG 2ZS9A 4DLZA 2L0XA 1IXRC 4LF8L 1GNRA 4DR6Q 3TRFA 4KXFB 1RIFA 2Z83A 3T1VA 1NSFA 2WIAA 1KI3A 1LS1A 5EE1A 3UIEA 4F4IA 5B30A 1CKNA 1N36Q 5DLQC 4DPGA 3THXB 3QF7A 3KTAB 1B7YB 1VQJA 3KF6A 1T3LA 1Z6GA 2ODBA 3FGNA 3HU1A 4I1VA 4ZI2A 2C95A 3V00A 3KJIA 2N49A 2ODEA 4AH6A 1G7RA 1YZLA 3CC2A 4JI4Q 3FFAA 3C7KA 2WSSD 4P4TA 4PTLA 4M9QA 3SU8A 3HP1A 4EJSA 4FN5A 2CLSA 1MO3A 4G7HC 1T5EA 2GDJA 3MXUA 3R7WA 5KTYA 1TQ4A 5AJXA 2GK7A 4TZ0A 4Q4JA 1W1WA 1WDTA 2ZRMA 1RPZA 3TEHB 4QBFA 3SBDA 3LO5A 1CRPA 2IEZA 1NVWQ 2AD1A 1Z0KA 2BIFA 1BKBA 4JI7Q 2V7QA 3IO3A 1Z2AA 4HB4A 2IWHA 4DSOA 2N3SA 3V4FA 1GL7A 1YZTA 3B78A 3BB1A 3QG5A 3PJRA 2GCOB 2GXQA 3RLOA 3HOWH 1HYQA 1YZGA 2ECKA 2ZSAA 3B9QA 4X8HA 3A0JA 3RS4A 4AYTA 2KHJA 2W6IA 2R7DA 2VBCA 4KFSA 2NIPA 2NVYH 4YQFA 4U00A 3AFQA 2EJMA 3TUJC 4M1WA 4FMDB 3M4YA 2FFBA 1JAIA 3G6EA 1SMXA 3I8SA 3PVSA 3TVTA 1O3YA 2ZTSA 1QG2A 2A68C 1M7HA 3SDZA 2GN5A 3PG5A 3JAMc 4BLSA 1Q44A 3WYAA 3SJBA 2O5VA 3PEUA 5J4KA 4G01B 1J8MF 3S17H 2Q8IB 2WOOA 3GP8A 1P8LA 1E2WA 4N1AA 1OSNA 4PHFA 1AS2A 2H57A 1XNQQ 3ONWA 2EJFC 3E9IA 4H9GA 2AR7A 2FZ4A 5FBQB 3K0CC 1KO4A 1E79D 1KI1A 1M7BA 2J59A 3GJ7A 3IIKA 2QNRA 2XXAB 4DAYB 1VQ4A 1J90A 5GROA 3UG7A 1AN0A 1IONA 2MMGA 1CI3M 4DR6L 4W9MC 1LF0A 3U3JA 5BN4A 1FOEB 4JI5Q 4DUGA 2B21A 1KYIA 4C9BA 1N36L 5DHFA 2BBOA 1NL3A 2WJHA 4TSFA 1EFRA 2D7DA 2X19A 4LUOA 3I3SR 521PA 1E9BA 1M90C 2GBLA 4XD7A 4DR4Q 4LV5B 2DFKB 1H9RA 2PBRA 3N2IA 4JI4L 4WJ4A 4K46A 3B5JA 1GILA 3EQLC 1G6HA 4LJ4A 1S3GA 2G9NA 1K5DA 5HCIA 1HT1E 1IOZA 1KK2A 2QT1A 5FUYA 3MRSA 3O8BA 3JZMA 3CWQA 4URWR 5C44G 1NP6A 4GT1A 4P0TA 2Z6KC 3CNNA 1HTPA 2Z0SA 2FSFA 1NSTA 3TNFA 3QJYA 4GOPB 4JI7L 2DFTA 1EYGA 4WBSA 4DR5Q 1X1RA 4K81B 3T61A 2JA8G 3C15C 4DJTA 3RDPA 5AJWA 4GOKA 5FBLB 1E0KA 2YVUA 4HZUB 5DISB 1Y14B 1KY3A 4OO1I 3W6OA 1VKJA 1N6OA 3VMFA 4EX5A 3IQXA 5JSZA 5JFGA 5IT5A 3KB2A 2DN8A 3W1BA 2Q21A 4OXPA 4PC2A 1AGPA 1GRRA 3CXCA 3KXKA 2VW9A 2YV5A 3I4NH 3AP3A 4DV3Q 4A3DG 3K80C 5CM9C 1IM2A 2P67A 5FI0B 3LNNA 1FMLA 3EPLA 3STBC 5JJLA 1N6LA 2ZAMA 3GJ4A 2JLXA 1HJPA 1PA6A 5AJYA 4PXAA 4W5JA 3DM3A 3NBHB 1NIPA 4EPRA 3EX7C 1OHHA 4M1SA 1FMJA 4UJ5A 2ZTEA 1XNQL 2CE7A 1IN7A 2BJWA 1IXRA 4XVQA 3KDFA 4A3JH 1KIXA 4JLKA 1PMRA 4IJLA 2PZEA 4QG7A 3HOVG 2F9MA 1E2VA 1NJIC 1E9FA 2OTLA 1HR0W 3G82C 4GBMA 4GS3A 1KKMA 3R20A 4JI5L 4M1OA 1E98A 3HYTA 4EFLA 4HIMA 5DN6D 3HOYG 3E1SA 1T3HA 2A69C 3IKJA 2N78A 1OB5A 1NKSA 2J3EA 3T1QA 3TVDA 1QHIA 1XNJA 1G8HA 1HH2P 3B1XA 3M7NA 1F2TA 4RFSA 1MH1A 4ARZB 4DR4L 3PCOB 2G83A 4NXMQ 2J41A 2HHHQ 2QGQA 3AEVA 4HAWA 3T1OA 2C9YA 1K8AC 1E1TA 4LUVA 1J2JA 3K0XA 3BAFA 4NBSA 4DLWA 4LJAA 1EWIA 1VG0B 3QKRA 3UK6A 2NVXH 3P27A 4IEIA 4HJ8A 2ZI3A 1K3RA 3B9PA 4IOAA 3QSYA 4CEIA 2B63G 2ZRJA 4A8JC 1LB1B 4JOIC 3OFND 2GVDC 1SVLA 1W4BA 4C7OA 3CC7A 4A3MH 2VL6A 4DR5L 1AA9A 1X8LA 2QROA 5UKDA 4B3RQ 3DVLA 2MNAA 2VSXA 1GL9B 3DXJC 1JJ2A 3K9HA 2JA7G 1X8KA 3H0KA 2IWRA 4GNXA 2AFHE 1Q1BA 3MEFA 4DC9A 4HUQA 2ZREA 4AYBE 4XSHA 5GJBA 3BRWD 1T4GA 2ASBA 2FG5A 3BIFA 2VEDA 4Y0VA 3QNUA 4NL4H 2BA1A 2J87A 1KI8A 2CL7X 2HUPA 2ZM6Q 1FZQA 4DRZA 3GLHE 2O8EA 4R71A 5J4HA 4QIWE 1G3MA 1WCMG 2QTHA 4DV1Q 4Q9HA 4D80A 2YC2C 4YMSA 3TBKA 4DV3L 1IQPA 2G0TA 5A5GA 4I1OA 5SZIA 4LF6Q 1GKIA 1HNXQ 2BEKA 2TMKA 3K0AB 3I7FA 2AKYA 2QAGC 4C30A 3ZD7A 3OW7A 1XMSA 4DLYA 1QVFA 5FOTA 1Q3TA 4OHYA 2PX0A 1X6VA 3K0CA 4XJXA 1Z6HA 2WB1E 3P26A 1KXLA 3KJHA 3QIAA 3DOEA 1Q3HA 1UADA 3ASZA 3UXMA 1VPLA 1IY2A 1XRJA 1VCMA 2WV9A 1CR0A 1GIAA 1K9MC 1P9RA 4I99A 2VNUD 1GG2A 2GHIA 1Z6XA 4PSAA 3CO5A 5KO2A 3L2PA 3HFZB 1A62A 3FDIA 5HCNA 2VUMH 1E1RA 1PH7A 4Y52H 1XPUA 3BGWA 4UJ3A 5AWFC 1ONBA 1ZJ6A 1QZGA 4Q66C 4Z8XA 4CEHB 5EP3A 1YZQA 2AD5A 3A8JE 4PQYA 2HDNB 5G3YA 4NXML 1WMSA 4EQ6B 1JR3D 2WHXA 2HHHL 2OV2A 4P3YA 5A0FA 3LXXA 2C78A 5FTJA 4FWTA 3U4QB 4B3GA 2I5MX 1VQBA 1GRNA 1VIYA 3NEMA 3F0TA 4ASUD 1CJTC 2V55B 3SEAA 4AKGA 2HF8A 4AWXA 1VECA 3BU2A 2O8CA 1PH8A 3M4PA 1FX0B 2KSQA 1UWVA 1EFWA 3GD7A 1TPZA 3LWNA 2NG1A 1YR9A 3ZDQA 2QTVB 1VG9B 3KFVA 4WZAE 2PEZA 3T12A 5M5YH 1KTVA 5KPDA 1HQYE 2MFIA 2EWWA 1YKSA 2JIZA 1F3OA 3LDAA 4NHOA 4B3RL 1S4QA 2RGNA 4Q9IA 4WJ3M 5FPYA 5JECA 4F4CA 2EQBA 2EIFA 3BORA 4CZ2A 3VNVA 2WJYA 1JQLB 1XTQA 3AF2A 5M5WH 4O2LA 4TL9A 4CEJA 4Q18A 3EC1A 4MZ9A 1NG9A 1BOFA 1PLKA 5TVKA 4OHZA 1I6VC 3VDYA 3W1GA 2ANBA 2P5TB 2ZE6A 3K9GA 4GOJA 4QRHA 5DI3A 1IXSB 1RYFA 1Y1WG 2ZM6L 1KRSA 3CH5A 4GSYA 4ZPXA 2RHSB 1AQUA 4KVAA 3UMFA 1QUQB 4DV1L 3DKPA 4O3MA 2AWOA 3BXZA 3NBFA 4JKYA 3GJ0A 3WNCA 5KDDA 4LF6L 5IP7H 1HNXL 1X8JA 2VH5R 1NVUQ 1G8FA 5TMPA 1R0XA 4BY1H 3J7A5 4DDTA 1KHIA 3THWA 1NLZA 5EP2A 4BBSH 1X56A 2A5YB 2WBLC 1AGRA 2F3RA 1KJWA 1R2QA 1E32A 1TUIA 1KO7A 4POGA 2ZR9A 1PYSB 4XTRA 5G41A 4D25A 4ZDIA 1S1MA 4TMZA 4RY2A 2HEIA 4OI4A 1BMFA 2FGJA 2ZJ5A 1X86B 4POAA 4BFTA 1Z0AA 4JZKA 1A6XA 1G19A 4R98A 1PH4A 2PCJA 2VS1A 2VZAA 3W6NA 4LWZA 3W34A 2WWWA 4WOPA 1W0JD 2OCYC 3IO5A 3GEEA 3IHWA 1L4UA 3RRZA 1CUKA 1YIJA 2BCGY 2FX3A 4A8JA 4EPYA 1G5RA 5H8WA 4JOIA 3FHTA 3ZYCA 4BGDA 1IN4A 4TMXA 721PA 4MDEA 4H1UA 3I5YA 1ZIOA 1F5NA 4Q4AA 4LZZA 1NMXA 3TKLA 3L0OA 2YTYA 2GF9A 1ZKOA 4PFSA 3QF4B 4U02A 4TT3A 3U61B 2FF7A 2VSOA 2ZRIA 4QXAA 4A4IA 5JBQA 4AK9A 1CR1A 1TF5A 1W46A 1KY2A 3BS4A 2R2AA 5H1YA 5SZKB 5J4YA 3K70D 4GMXA 1VQ5A 4B32A 1VQAA 4DUZQ 2CE2X 1YITA 3CCSA 1JJVA 1GDDA 5CJPA 3G5UA 4P4UA 4M8NE 5CDFA 3NELA 4FMBB 4OL0A 3OE7A 1U0LA 3IPXA 4DKXA 2FV8A 2Q3HA 5EZ6B 1XMIA 1EIFA 2QAGA 2NOAA 2FDCA 4IOLA 3GPLA 1JECA 1XB2A 3LW8A 3REGA 4F7WA 3B1WA 1DEKA 3F5FA 2QE7A 4HJAA 2WOJA 4DDVA 4IPHA 4AKEA 4BZXA 1EWRA 4CRWB 5EUQB 4E22A 1U8YA 2ZJYA 1AZSC 1CJUC 1W47A 1BVSA 1P62B 2CJWB 4HB3A 2WJIA 4KFUA 2XTNA 4LJ7A 4TN1A 2Q3FA 2VHTA 2IA5A 2NN6G 3F8TA 2EVWX 1ZU5A 2FJUA 2WAQE 1L8QA 3PF5A 3TAUA 3S1MH 1W49A 3P1JA 1QDEA 1UEJA 2RF4A 2FSHA 1ZD9A 1MRSA 1G3UA 2EFHB 4CF7A 1WE2A 2VL7A 2ZR0A 2K7VA 3GTQH 2WKRA 3QKTA 3WBKA 1VQEA 3ZZUA 1OKKA 1Y63A 4O0AA 3KJPA 3HPRA 4FCTA 2CL6X 1ZUHA 4DLXA 4RJLA 2PQAB 4C0KA 1IL2A 1JI0A 2ALYB 4N0EA 4CIDA 1OV4A 2QPTA 1Q90A 2D3WA 2XSZA 1D6JA 3EIEA 3HPQA 2QL6A 1S9HA 2V4ZA 3A1WA 4GN4B 2JEBI 3BFKA 4JT4A 4QFMA 1RRFA 2VHUA 1N6PA 3I8XA 1IBLQ 1F48A 2UVQA 4DCTA 4OWXB 3G0HA 1FNNA 1QBKC 2QN6A 2Z5FA 3C41J 3ERSX 4KYUA 4FMCF 3NEJA 1W36C 5EUMA 1NLFA 1RJ9B 3FYHA 3Q8DA 4YONB 1JJGA 3J80i 4RD6A 4OO1H 4GN5A 3CMEA 2CWPA 1T3SA 4TVAB 1L1OB 1XXHB 4RD2A 1WBBA 4DUZL 2ZIAA 3ZZTA 2ZJ8A 3R9WA 4BZQA 2ZTCA 5ELXA 5CB6A 1XP8A 3B13B 4DR7Q 3CH4B 5BQ5A 3A8IE 1E24A 1WA5A 3GEIA 3DOFA 4LJ9A 3AVTA 1E2DA 4NH0A 4ESHA 4HI0E 4AIIA 4B3TQ 4JYCA 4FW9A 2OAP1 3CZQA 4DUYQ 4BXXH 3QBVA 4TMWA 2A2ZA 4TSFD 2HYIC 3OYYA 421PA 1P2TA 3RC3A 4A3LG 3NXSA 2DWPA 4XD7D 2Q9BA 4IVQA 4JBJA 2CNWA 2IUUA 4DK0A 3LX8A 2I1VB 2QENA 2X77A 1GHJA 4KKSA 3GTOH 2NZJA 2QP3A 2GXUA 4DCUA 1Y1VH 1HEIA 3C5CA 4UXJA 1LF5A 3VQTA 4C0JA 3AF4A 3PSIA 1COWA 5GJWC 1KDTA 4GFDA 4IKEA 4BRUA 3SJCA 3T53B 4KN4C 2WWIA 3KKPA 1WQ1R 1TQ6A 3B8HA 3DKVA 4C0AC 4H13C 1QJOA 3BH6A 4X62Q 1DS6A 5AJVB 2C9CA 3ZIAA 3EW9A 1CS4C 3CM0A 1Z5ZA 5DLQE 1F2UB 2NZHA 1Z0JA 3OW2A 2NPFA 2WAYA 5KYKA 3SGIA 4NCJA 1Q12A 3UDGA 2A9KA 4GLXA 1UEBA 4UP7A 4MUAA 1Z6YA 3W5IA 1N0VC 8OHMA 2BE5D 4PO8A 1IBLL 4A6XA 3QVUA 4OWWB 3HR8A 1YVDA 2CHQA 3TW4A 5KSOA 4Y7NH 1DE0A 2F3IA 3J81c 2V54A 3A8TA 3AUXA 2P6NA 1UPTA 3QXHA 4LBWA 5J4VA 3AF1A 2V3CC 3T1TA 2I3BA 4WAUA 2IEYA 2IYLD 4B76A 3P4YA 1YNXA 2ZSFA 4JSTA 3A7AB 5L8VA 2A5GA 4KN7C 3A5UA 1GUAA 2CCGA 1TL7C 1DELA 2YOFA 3K9LA 4DR7L 2JLRA 2DB3A 4LF4Q 3VR1A 2P6RA 1UKVY 2R7FA 5KU1A 2WPDA 5B57C 5HPYB 3SZRA 2C9OA 1JJ7A 1ESMA 3BJIC 4B3TL 5AUOB 1NVXQ 4D0GA 2QTFA 4DUYL 1XEFA 2BHRA 5AUNB 4YCVA 2JASA 3QPWA 3ZVNA 2ZJ2A 3S1AB 1GO3E 5GAGC 3MG9A 4D4MA 4JI2Q 2GVAA 1XD8A 4PQFA 2J0UB 1ZYUA 1G3RA 3ZGXA 5K36H 2QA5A 2UUCQ 3TREA 2ZYWX 4TLEA 3OEED 1P16A 3HOZG 1QVCA 3H94A 2WJVA 3BD9A 1TNDA 1OXTA 3VA7A 4MGYR 5LB4A 2GZDA 1VYVA 2G88A 3HKZG 4A3FG 4IFEA 3SFZA 4D4JA 4LF5Q 2PMZE 4DB4A 3UDFA 4I81A 3VX3A 3ICQB 1W7AA 1Q21A 4CGZA 2H8KA 2CFMA 2FGKA 4B3DA 1HV8A 2ORIA 3L43A 1GVPA 4X62L 2B7BA 4I1SA 2OE2A 4KBFA 5KSPA 4TYNA 4B71A 4RCYA 1RKBA 3GTMH 3UG6A 1V9PA 1U5KA 1KDRA 4GN3B 1YZKA 2A68D 3VKWA 1SLJA 3EC2A 2V6IA 3GJ3A 3MLEA 3GLHA 4GL2A 1FFHA 3DM9B 4GMDA 2ZTDA 2F4VQ 2OWOA 1IW7C 3U44A 3LD9A 3HDTA 1E9SA 2P0EA 2RKOA 2R6FA 4JMPA 1DD2A 5FOVA 3X1YA 1YZUA 1E2LA 2WZQA 4B48A 3FVQA 3LBIA 1UE1A 1IN8A 4JG2A 1OIWA 3FKSA 5IYBH 4Q01A 1AE2A 1C9KA 3UMRA 3OIWA 4NCIA 1U98A 4MDFA 2O52A 2EFEB 4LYFA 1K8MA 5KPJA 4DNRB 1CJVC 1J99A 1E99A 1IY1A 4LF4L 1BDOA 2KENA 1HTWA 3MWYW 4LPSA 3V4RA 5JEAH 4A92A 2ZJBA 2O0HA 1G5PA 2QSZA 4HIKA 2BCJQ 1UDWA 2A30A 3BH0A 1UKYA 3NHBA 3IQWA 4MGIR 1CLUA 5G53C 1XTKA 1IBMQ 3UDXA 1EUJA 4IFBA 4LUCA 3GJXC 1HY3A 4A3EG 1YNNC 3OTOQ 5C4GB 2B92A 1MOZA 1DAHA 3RS0A 1JJCB 2W6JD 4JI2L 1BH2A 4TMVA 4EKDA 2IS6A 4HB2A 2UUCL 1Q1EA 2V1XA 2QGNA 2QT0A 3A4MA 4M1YA 3WP0A 5FTLA 2ODNA 1A2BA 2EYUA 4DXAA 1MO4A 2JDIA 3RLFA 2F6RA 4B3SQ 1G20E 1M7GA 3PUWA 2FEOA 2ORVA 4LF5L 5CM8B 4BFXA 4YHHQ 2ZVPX 1GUTA 2ODWA 1E2MA 3ZQ6A 2UUAL 1R5BA 5JWRA 1T0JB 1RZ3A 4E03A 3CCJA 1L4YA 4A3GH 3L82B 2CDNA 4L16A 3EAQA 1SN8A 1E94E 1NLYA 1E4YA 1H9KA 5KNBA 3KQKA 3PO2G 2ZAOA 1PV4A 4NMMA 2L15A 2PJZA 3WHKA 2OXCA 1MKHA 3IRBA 2F4VL 1E9CA 1XWIA 3KJGA 5LD2C 5KHOC 3U2QA 1NY4A 5KSYA 2Y8EA 1O78A 4D4KA 1TU3A 2ZYUX 1Q1ZA 3FMFA 3JVVA 4HAUA 1VIAA 4XVUA 1EIYB 2B8TA 3EZ6A 3DEFA 1PLLA 2CXXA 1VQMA 4JI3Q 1CR2A 3AVUA 4YMTA 2QU8A 3IILA 3OEHD 4P4SB 4B3BA 4ZCLA 3JAMi 3Q7PA 1Z22A 3A5ZB 4M2LA 4OBEA 3U3RA 4IQZA 1XZPA 4DV5Q 3FTQA 3LA6A 1FUKA 1K5GA 4O25A 4FCWA 4BASA 1ZP6A 2A69D 2JA5H 4AURA 2XX3A 2IX3A 1KMHA 1SVWA 3C14C 4HAXA 2OHFA 4NCKA 2CHVA 1IBML 4IOCA 1MKYA 1HZBA 1G6OA 1E9DA 1K6MA 1VQFA 3BDOA 4LUZA 1QHXA 5TARA 4EAQA 4JBWA 1JPJA 1PH3A 3HOWG 1VCOA 3OTOL 4GLAC 1RFLA 3O8DA 4LC0A 3HU3A 3W9YA 1S1CA 3KKNA 1SKYB 1KJZA 3MJRA 1P60A 2RMKA 4JI0Q 3NEYA 4HSEA 4JVLA 5CDFE 5HZHA 3I1FA 4LI0A 1CSQA 4RD4A 1XD2A 3TSOA 2FXQA 3KQUA 1E9RA 3QY0A 2JJ1A 4MA4A 5K8TA 2Y0SG 3S24A 2D0OA 4B3SL 1GUOA 2F43A 1XMOQ 4Q00A 4QGHA 4A82A 2O8DA 3A37A 4YHHL 3CRLC 1DAGA 1VQCA 2DUDA 1YR8A 4MRPA 4B3FX 1VQ9A 4DR2Q 3I4OA 2OBNA 4MYHA 3CCMA 4ZV4A 3SNHA 4OI2A 2D0PA 3GTKH 2ES2A 2XOKA 1L2TA 5DHAA 5JRJA 2E5LQ 2A6HC 5L3SB 4PANA 1FNMA 3ND9A 1ONLA 2YWHA 4CVNA 3OE7D 4W5HA 1JALA 4Q1DA 5IP9H 4MITA 1US8A 2GJ8A 2YHSA 1H9SB 2QPOA 4UXIA 3K9NA 2PNHA 1AJEA 3U9SA 1QHNA 2QGZA 3UWOA 1EWQA 4MGZR 3I4MH 5FJ8H 2J5XA 3B2EA 2QE7D 3RHFA 5IK2A 4JI3L 4DK6C 3AYHB 4BBRH 4PZYA 2WKPA 4KFRA 2B7CA 4OQFA 1Q7YC 4WA7A 5LMNW 4DV7Q 1IN6A 1GNQA 3OOCA 5F3WB 2ZUDA 4GNXC 2E2IH 5JRZA 4KITB 1B9MA 3S1NH 4DV5L 1UEIA 3RNLA 4YMWA 3GEHA 1E96A 3K0FB 3WMFA 2F1HA 2CCKA 3LQRA 4QBGB 2VA8A 3J7ZC 3S1QH 2O8FA 1KI6B 3FOZA 3AVYA 1PYBA 2LKDA 3VR5A 4DV6Q 3KF8B 2GJ9A 4B2LA 3PEWA 4QGGA 1OFUX 2F9LA 4KSCA 5BYKA 3GLGA 4JI0L 5FLMH 2J7PA 1AZTA 4C3HH 1M1KC 2E1RA 2IYZA 3HYRA 3AGPA 4B2IA 5B64A 2D74A 4LDJA 2XSZD 1G291 3K7UC 4LYHA 1IBRA 1NTGA 2N42A 2K50A 4R4TA 3I4NG 1Z28A 1QVGA 2WICA 5EE3A 2R6DA 4LYAA 1Z2CA 5EZ5A 5AR1A 1XMOL 4Q48A 2BVNA 2DY1A 3QXSA 1GP2A 4OQXA 4Q7JB 4B35A 3KYHC 1E0AA 1UE7A 4OHWA 4DR2L 2FZLA 1I2DA 5C3EH 1CP2A 4WZBE 1H8HA 4Z1MA 1VG8A 4IPDA 4R7ZA 3SHFA 4A6PA 1G16A 1R0YA 1U2RA 4RZ2A 1Y8OB 4LV6A 4LJ6A 1JQJC 2JXMB 4A3JG 2E5LL 1F60A 1W5SA 2P5SA 1N25A 3H84A 3PEVA 4JC0A 2VY3A 3AP2A 2BC9A 5M3FH 4WZ6A 3ZLJA 1E1OA 1IZ6A 3S15H 5IY0A 4BY7H 3VR3A 1MT0A 2WMOB 5HTKA 3IEUA 4KHPQ 4KSBA 3VHXA 2VHJA 2NMVA 4DT1A 1XPRA 1U0JA 3PV0A 4DIEA 4NYMR 4Z8YA 1II8B 2QQ0A 3RS7A 5HKKD 2FOLA 2RH5A 3O8RA 4E07A 3F2DA 4G5GA 2ZQ5A 3WNBA 5BXQC 1WXQA 3J81j 2I4IA 4PAMA 3CX7A 2RGNC 2ZE7A 1KSJA 4BFSA 2PMKA 4DV7L 4G7OC 1IXZA 5FUVA 1CTQA 1KAWA 5D3MA 2BJVA 3LWUA 1DG1G 1MR3F 4MKHA 4PO1A 1Z7TA 4IDQA 3X1WA 3FKQA 4TMKA 4LK2A 3FPAA 3A36A 4BRWA 2WWXA 3PUYA 4DLRA 1COWD 4JL8A 2HT1A 2I5HA 3KUDA 4A3MG 1I94Q 1A82A 4Q02A 4Y0AA 1K8RA 1OJLA 3RN2A 1Z6AA 1LM0A 4TLBA 5JEEA 1T5LA 5CITA 4OQNA 2VYFA 4BUJA 2K75A 4UP8A 4DV6L 1A4RA 4X8LA 5BYJA 1RIPA 3TE6A 3GLIA 4QHSA 4K0KQ 1RL2A 1G8PA 2AXNA 1KI9A 5IDVA 1H8EA 3ZIAD 2IYWA 2AMCB 4HYYA 1TXYA 5FL7D 4A2PA 2X2FA 1Q82C 4Q7MB 1P4SA 2QM8A 2IS2A 3VKGA 3CPHA 4RKEA 3H0GH 3GMTA 1G18A 1OYYA 4LHXA 3D8BA 4OI1A 3PCRB 3WP1B 4ABYA 4JI8Q 3NC1C 1K8GA 4LW1A 4JI6Q 3BC1A 3AQ4A 1XJCA 3B85A 4NU0A 2L5TA 3Q8XB 3WRXC 4FCVA 2G0NA 1SVKA 2AUKA 4O2RA 5J47A 4A2QA 1V1QA 3CCUA 2AX4A 5K8LA 3RRMA 121PA 5IF9A 4RZXA 4N3NA 3CW2C 2XB4A 2LSSA 4LX0A 2J1LA 2DGYA 2HJVA 2IUSA 2VP9A 3WHLA 2YNMA 2E8GA 1CEEA 1PLJA 3PF4A 3Q3JB 4HLCA 5EJEA 2CLDX 3EZ2A 4XTCS 2VUMG 1TX4B 5H1SE 4KHPL 2NO0A 3U7HB 1V8QA 1Q22A 1V5WA 2FPKA 5EP4A 4TLCA 3E2IA 2G6BA 4C2MH 3LV8A 4UNSA 3NTUA 1EFTA 1JPNA 4DEYA 2YINC 1IY0A 4DNIA 1DAMA 2F3TA 3PO3H 1S96A 2NVQH 3QKSB 3QXJA 3VX4A 1KRTA 2QAJA 1W48A 3ER0A 5J3BA 1AK2A 1CTMA 4EDHA 4HZIA 5CK4A 4DNTB 3U58A 3LQQA 1QHHA 2O8BB 4H02A 2AN9A 4PSKA 2IL1A 2I0QA 2IF0A 4KV9A 1G3IA 2QBYA 2CQOA 3CCVA 2OLJA 2XAUA 2QPAA 2ZJAA 1NMGA 4C0BA 2VRWA 1I94L 5HE8A 4A3BH 2YOGA 3VU9A 1TQDA 2RGCA 1GOTA 5L3RA 5GAHC 4OK5A 1QRAA 3BB3A 5FL7A 5GVSA 3THYA 5IWAQ 1Y8PB 3KKOA 5HGQA 3S14H 3FMCA 3WBJA 1N6NA 1OXUA 4GDFA 2X1VA 4AQYQ 1D7QA 4LBVA 5H68A 3OAAD 4X64Q 1NBMA 1P9WA 4IXNA 1ZM9A 3RVBA 4BA1I 1DXMA 2GEUA 2K4KA 4YMUA 3FHCB 4KCGA 3PEYA 2ZE8A 1FJGQ 4CDGA 4BFZA 4YXWD 1E2ZA 1MO6A 2IYTA 1EX6A 1GKHA 1E1QD 1NN0A 3Q9LA 5CIWA 2ZJOA 4Q4HB 4TWZA 4YLGA 4WIAA 5JS7A 1W36D 1Q1QA 1OB2A 2XEXA 2BBTA 3CWZA 1W36B 1E9EA 3W3AA 4JI8L 2HIXA 5IP7G 2R62A 2ZUBA 4UNQA 4IFDI 4BY1G 2LKCA 3V9PA 4OJKA 3X1DA 4P71A 2NO9A 4LNQA 4M1TA 4BBSG 4RCNA 4DCSA 1IAQA 4QL3A 3WNDA 1E2QA 3T5GA 2R65A 3CRVA 4JSYA 4HATA 4NPHA 1YI2A 2N1BA 3HJNA 3CKLA 2JA1A 3GFOA 1JT8A 5DGXA 1VCIA 1M2OB 2ZPTX 4RD0A 3NWJA 2AHOB 1UJ2A 5P21A 5TB5A 2R92H 2VP5A 2GJKA 1AQYA 2FH5B 4UY8C 1S8FA 1KJYA 5CJ2A 2XNDA 3PIPA 1RW4A 1UBEA 3GLFA 1WFQA 1IHUA 3X1ZA 3NG1A 2EU8A 3E5HA 4DV2Q 1X9NA 4LC1A 1NN1A 1T8UA 2GJSA 4YWMA 3EARA 3U7FB 2C99A 2ZITA 4ZIRA 1SRUA 3HOUG 1R0WA 3RANA 2W2XA 1NVVR 3S2DH 2JEOA 2N46A 4AYXA 1NJGA 1CU1A 2R6CA 4Q1CA 1LY1A 5J4LA 4OK6A 4URZR 3UANA 1G7TA 3OHMA 2FA9A 1QHSA 3OPOA 3A6PC 3BZKA 1D2NA 2NTYC 1GZSA 1UF9A 4JYBA 3TK1A 2K52A 5L3QA 1ZRHA 2OESA 3VR2A 4LHYA 4F93B 4QGAA 3A8KE 1TUEA 3U5ZB 2D5DA 1E7ZA 1J7KA 3SC3A 2C5LA 4L8JA 2GCNA 3EA5A 4Q21A 5JWOA 5IWAL 2CK3A 3GJ6A 4MNOA 1AH9A 4TMTA 1CRQA 1PH9A 3RLNA 3W8NA 4AQYL 2ZJZA 1CXZA 2GVZC 1OPXA 4X64L 3GTLH 1AKEA 3EIHA 4HAVA 1N0UA 1G7SA 5EXTA 2GA8A 1CKMA 4Q1FA 5E3HA 2JJ2A 4MKGA 2NPIA 1FJGL 4M53A 5B2ZA 2WTUA 3THOA 2UU9Q 3F1ZA 4LJZC 2AFIE 4GOPC 2OTJA 2GJAA 4WW0A 4Q7LA 3CW2A 4OX9Q 3N6RA 5DYIA 1W3SA 4A3KH 3EWAA 1I2MA 3SQXA 3TQFA 1K73C 1E2HA 3M3YH 4B3MQ 1LFDB 3UE0A 2OBMA 3K53A 1JE5A 1IJFA 2F1RA 1SXJA 4C4PA 1BYUA 4J0QA 4MYUA 2GAOA 3Q5DA 1HT2E 1B8AA 1FGUA 2E76C 1BYIA 5C0XI 3X1XA 1GWNA 4DV4Q 3BB4A 3I2ZA 5E7NA 4A93H 2JLYA 2IYYA 2KBNA 3K8AA 5JI3E 5EP1A 4DV2L 2W2VA 3T51B 4C0QC 3PUVA 1NE3A 1XEXB 3K70B 4G5OA 1LNZA 4LCBA 5EE0A 4QGUA 2ONJA 2JLWA 2B8WA 4P75A 3KKQA 1SKQA 1JB1A 3QVVA 4A0GA 5BR8Q 3BFVA 2ANCA 3K1JA 2F7SA 2Q6TA 3QEOA 4NKRA 1NRJB 2GEVA 3KTAA 3THXA 2QP9X 4HAZA 3CRMA 4HIOA 2E9SA 3I62A 2AKAB 1G17A 1YQTA 5FL3A 2JJ1D 2D2CC 3DZDA 1CKNB 2BWJA 3EZ9A 2RHDA 4QJ4A 2WKQA 4WVFA 3KF6B 2WSSA 4JKIA 3G71A 2K33A 1CBUA 1E2PA 2OFWA 3GJ8A 2ZJRA 2RB4A 3JZAA 1Y69U 1KO1A 4Q47A 3TZUA 1TWFH 4GZYC 2IS1A 4OO1G 2IXEA 1W2BA 1QVRA 3FE2A 4P74A 4OYHA 1HZ9A 4DVGA 4QJFA 3T15A 2ZI7A 4EJSB 5KNDA 1J5EQ 3JVUA 2XOKD 1A0IA 2H5XA 1IW7D 1TMKA 4TL6A 3R7WB 4BPBA 4JLNA 4Q4JB 1KOFA 2BV3A 4M0LA 1W2GA 1YR7A 2UU9L 2F1IA 4OHXA 3RS5A 3WMGA 2GCOA 3TSWA 4UKDA 1Y8NB 2QRNA 2V7QD 1UM8A 1Z6TA 4KO8A 2PL3A 2JA9A 2HF9A 4IJMA 4BXXG 2CBZA 1V43A 1LV7A 3T35A 4OX9L 4US1R 2VP6A 3W8RA 3GLGE 3CRQA 5EXSA 2XZOA 2ZRLA 3CAMA 3L7ZC 1JXMA 2G3YA 2W6ID 4Q1AA 4B3ML 2LXKA 1ANKA 2PMDA 4IDHA 1JEDA 2W0MA 3NBZC 1PHJA 1E9AA 2FFQA 4LFBQ 2ERYA 3J81i 1GKYA 1VF7A 2NQ2C 1Y1VG 1PH1A 4M9SA 2IC5A 3VU9B 1CJKC 3NKVA 3U7EB 2QEXA 4A36A 4DV4L 2QSYA 2VF7A 3NIBA 1XXHE 1SGWA 3NBXX 2ORWA 2QUZA 1SMYC 2ZETA 3LW7A 4IOKA 1M1YE 1Z9FA 3U4VA 2DNCA 2OCEA 1KI2A 1MV5A 3SI7A 1FPMA 4B43A 3CC4A 1DAKA 3N70A 3AEZA 1QHGA 2GETA 4C2UA 2XXAA 3T06B 4LFAQ 1CKEA 1UBGA 1YHNA 4LJ5A 4PHGA 5BR8L 4PC1A 4O2DA 2R93H 1HA3A 1EQQA 4MRNA 4PHHA 3G48A 1UKZA 1W44A 3CMAA 3M85A 1Q57A 2HXYA 2F55A 5F9FA 2AWNA 3CNLA 2K5NA 4DUGD 4ACBA 1HR0Q 2Z0MA 3Q5EA 4IDNA 5FPHA 3LGJA 2K5VA 2QMEA 1EFRD 1E2GA 1DAFA 4US0R 1VQLA 3SJZA 4POFA 4F91B 4XWKA 1G21E 2HLDA 2CL0X 2PI2A 2HV8A 5BW8A 1XNRQ 2EFCB 4OONA 2QMHA 3MUFA 1YVCA 4PZ8A 1JEEA 2AKWB 4NYMQ 3IEVA 1ZIPA 4HDQB 2C98A 4R4QA 2NN6H 2A6ED 2A1AA 1GITA 4WXRA 4D81A 1J5EL 2XZLA 4C0SA 2QZ4A 5JCPA 3L8YA 3M9BA 4GOPA 1FL9A 1FL0A 1S2MA 2RGEA 4YDHB 1EXMA 3EG5A 1XMJA 5TV2A 4ZI3A 3A58B 2V4DA 3W6PA 4HZUA 4JLPA 2R7ZH 4KBGA 3BFXA 4MRVA 1FYCA 2A3RA 3D31A 3TMKA 1TKWB 3GLIE 4RG1A 2A5DA 4DEXA 4AY2A 4HJ9A 1EFHA 3HU2A 1Q8KA 3AVXA 1EESA 1OT3A 5DSZA 2XGTA 2IHBA 4M9XA 1R4AA 1YHAA 3LY5A 5JSZB 5K36G 3MFYA 4LFBL 1DAEA 1XBTA 2G77B 2IYRA 4B33A 4PZLA 5CYOA 2PJRA 4IOJA 4RD3A 3IUYA 3PXGA 1DGSA 4Q5IA 3CRKC 3PQCA 5KSZA 3ADCA 1U81A 5CYPA 4FD2A 4LBYA 3SFVA 4FDBA 3LBNA 1D2MA 5KDLA 4DDUA 2WIBA 1TWAH 3VR4A 2NO1A 3OESA 3QXXA 5SZJA 2QQEA 4MYCA 4BQSA 1TWGH 2W2TA 4ZCIA 1AM4D 2JATA 4B6FA 5JCZA 5CK5A 1BBWA 4OWTB 1OHHD 4OHVA 2B6HA 1E2EA 1UAAA 2P6UA 2V1UA 1DADA 4A9AA 3DDCA 4IFDJ 3S1RH 4LFAL 2ZU6A 3KDFB 4GNKA 4US2R 1NMZA 4OJQA 4A3IH 4C0HA 1X65A 4YWKA 3KUCA 1C7YA 4FMDF 4ACAA 1TEXA 5FPKA 3CB4A 4DLUA 1S40A 2A8VA 4R2IA 3I4LA 2JJ8A 1SULA 4NYJQ 5FOUA 4ARZA 1HR0L 3ND8A 3PFIA 3GFTA 1EWHA 1HNWQ 2VQSA 3CCLA 2RHMA 2K32A 4L5QA 1OE0A 1OFIA 2YC4C 5IYBG 1XNRL 1F2TB 1M6NA 2VSFA 2GWHA 4NTZA 4RFSB 4JVSB 2B29A 3CF2A 1HCZA 3IBYA 1MJEA 4HUTA 2IYUA 1ELOA 3QKRB 3NDPA 3KB1A 5FOXA 3QI2A 1YRAA 1E3PA 4CEIB 4PZ7A 5C46F 1HUQA 2D2EA 4A3CH 1SVIA 4TZ6A 1YRBA 3I72A 4C7OB 4GKKQ 4M1KA 3BG3A 4PMWA 5JEAJ 1BIFA 1ETUA 3QPVA 5C4XH 4IFDH 4KYIB 3WMEA 2YWEA 4F38A 5IYDH 4RMFA 4GI7A 1E2FA 5H70A 1GSIA 4LYJA 4GNXB 4TYQA 2F52A 1NBME 4DLVA 4PQRA 4HUQB 4V02A 1P2SA 4D0LB 4EPXA 4EPTA 1GL6A 3KXIA 1JMCA 1PUJA 1XJ0A 1GJXA 1RYHA 2QY9A 2OFXA 1MABB 2O8EB 3K0AA 4IHQA 3LLUA 4FXPA 5DNYB 2I5LX 5LBIA 4G5QA 4D4LA 2BM0A 4F4JA 4RVCA 3AF0A 2ZU0C 4L8GA 2UKDA 1TU4A 2CWAA 2ZM5A 4DK3C 1IYVA 1EFUA 1VMAA 4S2EA 3CCRA 2ZJPA 4R4OA 2D4HA 4PPFA 2XGJA 4A3GG 5FOWA 1WOCA 1D8LA 4MYTA 5FBWB 1K0RA 4HJ7A 2XTIA 2WVJA 5E7JA 5FI1B 3ADBA 4NXNQ 3TQYA 3OIVA 3OIYA 4DLTA 2YZ2A 5CB8A 2XZPA 3K0EA 5GQOA 4JCVE 4CEHA 4ME3A 3AM1A 3D0FA 1E1RD 3GLFE 2KBEA 3C16C 3SR0A 2V9PA 3WYFA 4EQ6A 1HNWL 1ZBDA 1XX6A 2XTZA 5C0XJ 3UDIA 2Y0SE 1HQCA 1JR3A 4V0KA 4QKQA 3U4QA 4KODA 1X55A 1EG7A 4P72A 1BO6A 4KHZA 1B70B 2UZ3A 2A19A 1GVNB 1FX0A 2I1QA 1DARA 3SQWA 5DIFA 1SE8A 4B3XA 5GADl 5BN3A 1GD7A 3SBEA 4QM7A 1KDOA 4Q19A 3CNOA 2QMOA 1YJWA 3CPJB 4XVRA 1S3SA 4NYIR 3NHAA 2O8CB 3K09A 3U4ZA 3CP0A 4A3FH 5IYCH 3BH7A 1NVVQ 2JA5G 1YJ5A 1T9HA 2Z6VA 2OUKA 3WRYC 4M1MA 2ONKA 4GKKL 3F3YA 4B2PA 3KLRA 4DKAC 4JBMA 2JIZD 1SVOA 3BOSA 4HR7B 4IEEA 4JL5A 3ICEA 4Q1EA 2DR3A 3ZZ0A 3C5HA 1HH4A 1NI3A 1U8ZA 3I56A 3EXAA 2Q2TA 2PZGA 3LVQE 4JBXA 1H9MA 1OIXA 2K5HA 1L1OC 1KC8C 4CEJB 4YDSA 1UBFA 1QUQA 4PSVA 5DI3B 4JI1Q 1HNZQ 1XJQA 4DHEA 1P3JA 2PCLA 4I1UA 1U8AA 1KKLA 1Z06A 2D2FA 1E22A 3A1VA 4MH0R 5K8IA 3U60B 4B47A 4JLAA 4LV8B 1CFMA 1GUGA 3STBD 5C0XH 1TWCH 1XTIA 2QM7A 3AB3A 3I32A 2FFHA 1E2KA 2REBA 5FTKA 2ZR7A 4L5TA 1ZW6A 2DCUA 1E4VA 4DAMA 3C8UA 3PIOA 2KBFA 4HDOB 4IVRA 4OQLA 5M3MH 1KO8A 2Z4RA 1JXOA 3FB4A 4JLJA 3ZVRA 1FP7A 1N32Q 2C8VA 2J0QA 3THWB 1JR6A 2YTVA 1P73A 1SROA 3NH6A 5GAEC 1DG3A 1SXJE 1BBUA 1YHBA 2CK3D 2QORA 2MO1A 4GP6A 3TW8B 4NXNL 3T1YQ 4BLTA 1W2HA 2JQOA 3RC8A 1VF5C 2KCTA 1UE6A 3B1VA 4FMCB 4E5UA 3CCEA 1ZM4A 1VHTA 2J0VA 3KJEA 5IP9G 3FHWA 1VQ6A 1OW3B 2PLRA 1BMFD 2W0SA 3AKYA 3MMPA 4E09A 2O5JC 4HIDA 4MRSA 2WWYA 1E0JA 1W0JA 4ZKDA 2IHFA 1YZ6A 3H3VH 1T6NA 1SKYE 1WP9A 3DMDA 4PC3A 5TXGA 3I4MG 5FJ8G 5F98A 3NDBB 1X3GA 1KI7A 3IDQA 4FINA 4JBYA 4JYAQ 4LHVA 2YJTD 4NB3A 4FIDA 3D4RA 4BBRG 1ZUIA 1CR4A 1XCMA 3ULJA 1AKYA 4DDWA 4A8JB 1M74A 4X8OA 1OXVA 1R5NA 1EK0A 2LXJA 1DTSA 2JAQA 3QF4A 4OI0A 2IW3A 3ZVMA 5JEDA 1P2UA 4Q4AB 2ID0A 2C2HA 3MCAA 1R7RA 4LJ8A 4CT5A 5C1BA 1KSFX 1LACA 4DWJA 3M4QA 1VQOA 4TT3D 3LX5A 4AC9A 3P20A 1P75A 2OILA 1NN3A 5AJZA 2IXFA 1UDXA 2OAQ1 4BLPA 5L3VA 1Q0UA 1VQHA 1WRBA 4ON9A 4TQUS 1NBWA 3K81C 4H44C 1GFIA 3AVOA 2KB0A 3BERA 4H1VA 4R9UC 4C3IH 1HURA 1H9JA 4HB0A 5FLMG 5HE9A 3FPPA 4JI1L 1HNZL 1OIVA 4A1FA 2OZEA 4LSGA 5DO9A 2GEDA 4NZYA 3RSLA 2NZ8A 2DPXA 3EBEA 2AL7A 2XJ4A 4MUBA 3DLLA 1DO2A 2QAGB 4JLBA 3CUEF 3FFBA 1NY6A 1Z0DA 1JAHA 1JNYA 1KMQA 3SYNA 2CJWA 1N32L 4IW3B 3QE0A 1KSHA 3AV0B 2OXRA 5C3EG 3E70C 1O7IA 3RS3A 2EJGC 2YYZA 1N8RC 2LMCB 5KNCA 1VQ8A 2JLZA 2CHGA 1LABA 3T1YL 3A1TA 3AGQA 3M1IA 4ESVA 2JLSA 1NNEA 3K0SA 5M3FG 2D62A 3ULPA 1PH6A 4BY7G 3AFPA 4P73A 1GAJA 1ZU4A 3KL4A 2XB2A 2GTPA 3KZ1E 2JA6H 4DSTA 4L5SA 2VIIA 221PA 1G6PA 2HCBA 5EXPA 4ERNA 3EPJA 2UZIR 2PQAA 2H1LA 1OKKD 4TLDA 1OF1A 2ZI9A 4YCUA 2W83A 3TUIC 1B9NA 4JYAL 2C77A 4ZCMA 3HOXH 4BFVA 4ZO4A 2IYQA 1NMFA 2KE5A 2RGGA 1KK3A 3CF5A 3HR7A 3R9IA 3FKIH 3MXNB 1VQKA 4DK1A 2DWOA 2GCPA 1WB9A 2G1KA 4TTPA 5C4MA 3P32A 4JK1C 4QC2A 1IBKQ 3NH9A 3SHWA 1Z0FA 2QG6A 3ADKA 4HLUC 3REFA 2OCBA 3AQQA 3F2CA 3RZOH 1G7CA 2NO6A 1RJ9A 4JL6A 4C3ZA 3CPFA 1UBCA 4A4DA 1SVSA 3G4SA 1XXHA 1L1OA 4PG3A 2PI2E 3KFXA 2AK3A 3IIMA 4A0FA 4QBIA 3NE5B 1MJCA 1SHKA 4EPVA 4D26A 4CYMA 4Q9JA 4Q9KA 1J8YF 2V8OA 5EQTA 2MQHA 1Z8FA 4Z51A 1OH5A 5JJKA 3R9XA 1N0WA 2ZRBA 3B7GA 1C1YA 4DR1Q 2ZYTX 4KLZA 2ZSEA 4DSUA 1G4UR 2CVFA 1P5ZB 1OXXK 2VP4A 3RR5A 2VQFQ 1VS0A 1IYUA 3FMOB 1OFTA 2O0JA 3ECCA 5LDDC 1DAIA 2CW0C 4C3JH 2DYKA 3H0GG 3KLWA 4IOMA 2CEAA 1EQRA 2YOHA 2DBYA 3OF5A 1A1VA 3ZH9B 3B6YA 3AB9A 3GJ5A 3TQCA 1L0WA 3MWLA 5G3ZA 2BA0A 2VF8A 4MKFA 4LF9Q 2OQ0A 4RZUA 2HLDD 4HLDA 3UWKA 4JBKA 1HZCA 2CNWD 1FP6A 3I55A 4G5SA 2BDTA 2UXCQ 3O47A 3MJHA 1RC8A 4Q9LA 3I5XA 4V0LA 4B44A 5TDHA 4DCNA 5A4JA 4OGQC 5DH9A 4DIDA 2EQSA 4ZKEA 3S2HH 1EX7A 2XTMA 3AF3A 2FN4A 4Q1BA 3CIOA 3NVAA 1S72A 4TLAA 3CPEA 3WY9A 3A4NA 3WYGA 1OXSC 2MSEB 4N0DA 4D0NA 4QNRA 4LOAA 2ZRCA 2GAAA 3LVRE 1F2UA 1UE5A 5JZVA 3SE0A 3QXCA 1XD9A 1ZD8A 2JLVA 5CLLA 4TL7A 1IYJB 1I50H 1T8TA 2NN6I 1VCNA 2IXGA 3PO3G 3ZJYA 5JS8A 1E2JA 2K5UA 2X8AA 2DNEA 2B3GA 1G9XA 4HEJA 4IXMA 3CPWA 5J5CA 3VR6A 2ZS8A 4JS0A 1IBKL 3QG1A 2R6AA 2BM1A 2D7CA 1YNJC 1YEZA 4JLDA 4JVNA 1AS0A 3MAAC 5GJVC 1MO5A 3U3MA 1CSPA 4FI3C 2FFAA 2ATVA 1ZCBA 4BECA 3U7GA 3ZVLA 3RABA 5K8UA 3TR5A 2HIVA 4JV5Q 4A3BG 1KZGB 1O7LA 3GTPH 1YU9A 1CULC 1VTKA 3FHOA 2ZUCA 4H0LC 2V1CC 2JJQA 2ZEJA 5C44H 4A76A 3QPUA 2H18A 4DR1L 3CF0A 4LPKA 1T5IA 4NYJR 4EUNA 1YR6A 2VO1A 4QY7A 1MIUA 4R1JA 2VQFL 5CIQA 2VP2A 4TYWA 1SXJC 2FE4A 2JA8H 2WPDD 4NE2A 4YC7A 2EDGA 4KJZA 3J81k 1G64A 4B3CA 5LPNA 3S1AA 3RWMB 1YJ9A 1A7JA 1KZ7B 4BE7B 1U94A 2VQEQ 5F2EA 2J0UA 1ZYRC 4LF9L 1QF9A 3AP1A 3QBTA 4PHTA 2IF2A 4EPWA 1O87A 5KUTA 3EZ7A 3U6BA 4UXHA 1KSGA 2KCMA 1SFOH 4QBHA 3A7LA 2UXCL 2BH2A 1KK0A 3OEEA 2XNSA 2RCNA 1KIMA 1S0UA 2LWIA 2OSBA 3ZQJA 2K14A 4A3DH 1XEWX 1PJRA 4QOSA 3A1UA 1C0AA 1N6IA 1B23P 2WSMA 2R92G 2ASEA 1EOVA 3CRW1 5C2JB 1P6XA 4JVMA 1E0SA 2O5IC 1FQJA 3EA0A 4GZLA 4PPQA 4X66Q 4LWCA 1GHKA 1X3EA 2Q2UA 2ZI6A 2P3SA 1EGAA 2PZFA 4K0KL 2KI5A 3T1HQ 1K83H 1QZHA 3HOVH 2FSGA 621PA 4AG6A 3RAPR 3NENA 1J70A 4HLUA 1S3OA 1MABA 2J7KA 1OH7A 4JLMA 1Q86C 1R5OA 3QUSA 1YJNA 2IY5B 4PO9A 4PPNA 2IX0A 1VYTA 3BJUA 4X65Q 3HOYH 1TU2B 1S9DA 2LCFA 3GLHB 2E2JH 3DL0A 1N3BA 3PITA 2QF7A 4PAQA 2HQLA 4KKUA 1I4DD 5EE9A 2YTXA 3RRYA 3U44B 1VQGA 1ASZA 2E2HH 1JR3E 2F1MA 4DR3Q 4JI6L 2IYVA 2ZRFA 2YU9H 3B6EA 4LGMA 4U5XA 1ZNZA 4JV5L 4G7ZC 1II0A 4V0ME 4FWIB 4K8OA 3FKSD 4M22A 1I3QH 2BMEA 2ERXA 3P4XA 1LS6A 1L2FA 1X6OA 4BZPA 4RFVA 1A8VA 3IHLA 2B63H 4L4UA 4D6PA 2IX1A 3OFNA 4RCZA 4JT2A 5M5XH 5JLJA 5DE3A 1R6BX 3MWKA 1CJMA 1ZM2A 2GILA 2ZRAA 3GCGA 3AKDA 3SOPA 1ZAKA 3TS2A 4GZMA 2BBSA 3B1YA 4WXPA 4OK3A 2ZI4A 2E74C 3FP9A 3PGZA 2JA7H 3L8ZA 3DMNA 4NYIQ 4R2HA 2Q2IA 2P2LA 3U3OA 4IO9A 1FTNA 4L9SA 5A35A 2ZSDA 2W6JA 1YBYA 4XIGS 4IJHA 2VQEL 2HXSA 3KFUA 1GM5A 1G3QA 3OIUA 4A3KG 4M9ZA 1LUZA 4KKTA 1KI4A 3VNUA 2Z6KA 1R10A 1VG1A 3TUZC 2ZSBA 1WCMH 3SS8A 1QZXA 1XTRA 3NC0C 2XITA 3TS0A 1ZNWA 2FMXA 1GUSA 2GXSA 1QHYA 1P72A 2OBLA 5HR5A 1W0KA 5GVRA 3UPUA 2ZS7A
chains in the Genus database with same CATH superfamily
5J9FA 4Z6KA 4GLVB 3KOXA 5EKDA 4X45A 1P1IA 3ROFA 1EGMB 3PDIB 1YMVA 3R93A 5F5NA 1T0IA 1A2UA 3G0DA 2GPNA 3ZK9A 1MHTA 3H2ZA 5LU9A 2ZJFA 5BWNA 4HGNA 4QQNA 3EZLA 4QTTB 4N9QA 1WAMA 1XVIA 1KRXA 2Q3BA 4DN6A 1DJMA 3NFYA 4PZ6A 2LPMA 5JH7F 5KDOA 5DASA 1W9HA 1Z5VA 1Y1WH 5ELDA 3UPTA 3U1VA 1EVLA 1XZQA 5KTTA 5J63A 3D6TB 2VDJA 4C7JA 1N9WA 2QTMA 3WLAA 4XJTA 4LHWA 4YQZA 1US8B 3U13A 4ALKA 2VTBA 2JC3A 3OU2A 5KWIA 2B35A 4U673 2O14A 2FWRA 5IK2D 3Q72A 4XM0A 3PFWO 4MWOA 5IGFA 2CVZA 3KF8A 3OECA 1Q3LA 5FBVB 3FH0A 3B1ZA 3ANYB 5I2YA 4RZ3A 2YY6A 2Z4SA 2PX6A 3FMVA 3WDNA 2ATIA 4P31A 5KNBH 3LPAA 5FT9A 4MQBA 2REOA 1QX4A 2K7ZA 5CB4B 3WYBA 1V8BA 1JU3A 4UAJA 2XD4A 2ZB4A 2Y67A 5LB2A 4LFAB 3D4PA 1U9IA 3L9AX 1EH5A 5FA8A 3F2IA 3N2EA 1HXHA 4R1UA 5FV4A 3GJZA 5FH9A 4FZ3A 4LF7L 1OROA 1HDCA 5I7OA 5C4XG 4IS3A 5EC8A 5DHSA 1FSZA 2ZBEA 3KT0A 1I7SB 3SK0A 1EYAA 3NJ8A 4BCDA 3E5SA 1SQ5A 1ORTA 1Y1QA 4DYDA 2X42A 4QHTA 5U4XA 3IFTA 5EESA 2YW2A 3VOSA 4RY0A 2O5CA 3FEWX 4UEOA 4N0PA 4IO0A 4LA4A 3TZHA 4ZI5A 1Z47A 2OZPA 4WBNB 2ADMA 3W5JA 2YL2A 3WTBA 1ZAYA 1ZVQA 4S1OA 4PEVA 1G59A 2GNOA 3THYB 3SMQA 5IGCA 4CMHA 4R4IA 3BRSA 4ZKCB 4QE3A 1FNSA 1AN9A 4DYHA 1U4OA 4X8MA 4M8IA 2GXAA 3RRNA 2BOVA 1BQ4A 1PBTA 4KVZA 2DJ5A 3HOZH 3PRJA 1HPCA 4LFCQ 2WYWA 3TZQA 5J2UF 4BNLA 3IPYA 4R2MA 2OXEA 3BWDD 5KU7A 3RC2A 2SCUB 2X7HA 4PU0A 1M6EX 4Q3BA 1IUOA 3MWFA 3A6EA 1R0LA 4XB2A 5BN1A 3G88A 3JYNA 4LIPD 1QH8A 3PTAA 1H2ZA 1HE1C 4GXNA 3I01M 1XZDA 1IN5A 4C3IG 4GLBA 5KHLB 3II6X 3D1LA 2D5BA 3BHJA 1LEHA 2YX1A 4B4UA 2VDRB 2EVBA 3KWMA 3LYHA 2HK6A 5C37A 2GCEA 3KEQA 4IZOA 2OO5A 3IV7A 2WMNB 1CF4A 2GF0A 2HRQA 2XMGA 5JSYA 4EJMA 1PS9A 1Q84A 2C4WA 4LJYA 2W22A 3T3PB 2JAHA 3R44A 4DLZA 1WV1A 3T1VA 5DLQC 2JP1A 3HU1A 1C8CA 4OMFG 2PX4A 3JWGA 1V3TA 3HP1A 4GUDA 2XYHA 1LSOA 4RGYA 2BOSA 5KTOA 2GMWA 2V7QA 4JI7Q 1HFEL 2JI4A 4RFBA 2ZKLA 3P9IA 3AT1A 2Q4RA 3W1WA 2XGOA 1Z4IA 3PSAA 2VLBA 1NZJA 2PD6A 3LO8A 3SDZA 1ZHOA 2BHNA 2X4DA 2GBPA 2RHRA 3SC2A 4EY3A 4MRAA 2BSAA 1AN0A 3U3JA 4LDRA 4DUGA 1KYIA 1I3QB 2NU7A 3OZDA 5KAPA 4K5VA 1FYVA 3K6SA 1PFKA 2JEYA 3QJYA 2DFTA 2Q9UA 2ZXFA 4K81B 4EL5A 4GOKA 3FDJA 1WCMB 4PIMA 2C4VA 2C00A 2CXQA 4EX5A 3TIVA 5K09A 2DN8A 4RTMA 5KX5B 4DJAA 2P8SA 2OENG 5K6TA 4PWYA 4CDNA 2NVTB 4MO9A 3UAVA 1OVMA 1KIXA 4EHHA 4M1ZA 1BE0A 4QPJC 1L5VA 2H2FA 1K7XB 3IKJA 1P2GA 4DR4L 1JSXA 5NUCA 4HAWA 5D3KA 1LH0A 1QH1B 2DSNA 3N2GB 2ZI3A 4HQKA 4ZCKA 3HJHA 1SC9A 4IR7A 2FK8A 1Y6JA 4F3RA 1X8KA 3AIIA 3B5EA 1TU0A 1PUXA 3IDOA 1A98A 1HNXQ 5FOTA 4FHGA 1WMDA 3EK2A 4YRDA 2CLEB 4MCHA 1K9MC 3H0CA 5CGZA 4OP3A 1Z6XA 2PFSA 5LXTA 5KO2A 2RH8A 2XCIA 1XPUA 3K5IA 4MEAA 3W8DA 3CNHA 3JYPA 2V55B 1VECA 1G4HA 2EG5A 4XQ9A 1HQYE 2WILA 3L92A 2JIZA 2Y92A 2RGNA 3T9AA 4ID6A 5AM5A 4DTCA 3W1GA 4RHCA 3K9GA 2GB4A 2G82A 1AQUA 2I91A 4TWBA 2PUGA 2FKNA 4JASB 2NU8B 1Z37A 4FNOA 3CQZB 3CLUC 3K0HA 3C4QA 1PR6A 1S1MA 5AO9A 1Z0AA 1UCFA 4RH6A 2PCJA 4GR5A 2OCYC 5C7IO 4UDNA 2J5QA 3HACA 2BI4A 5EQFA 1DKOA 1G5RA 4IIJF 4M0DA 2WI8A 1B44D 1ZIOA 4KR3A 1O95D 5CBAE 4KB5A 2EBFX 5AQEA 4WK6A 1TUGA 1YITA 4KSYA 4LECA 5CDFA 4FMBB 3OWHA 4QUIA 3EODA 4PG4A 4IOLA 3GPLA 2XTJA 4HJAA 4DDVA 2NYUA 1SD1A 3VSBA 3TD6A 4TN1A 4MARA 4G07A 5C32A 3RBZA 2WAQE 3TAUA 3S1MH 4C08A 2FSHA 4G65A 4R6XA 5BPHA 4C4OA 3TLAA 5LUAA 2XCOA 5EMHA 4N0EA 3N28A 1OV4A 1HSOA 3Q11A 4HX2A 2VPYA 4YP0A 5JBIA 2PBLA 4OHMA 1BA3A 4CNQA 3JYHA 3VYTA 1YL5A 3DEIA 3OM0A 2ZJ8A 5CB6A 1CY8A 4PLYA 2XYVA 3WL3A 4M0MA 3DOFA 4Q9DA 3D4OA 3RC3A 2Q9BA 3I9OA 4IZ8A 4FR0A 4HNUA 4HEHA 2LE0A 1COWA 4KQ9A 1K8XB 5F21A 1E1CA 4M7OA 4DNPA 3F96A 3IDAA 2H59A 1BDJA 3ANSA 3QNWA 2A9KA 1QAMA 5I7RA 3MJ4A 4RIEA 5HIIA 5DTQA 3EMDA 4LBWA 4JITA 2IEYA 4EI7A 4JSTA 2UYQA 1GUAA 2YV1A 1V1PB 5C5CA 2EJCA 5KU1A 2J3KA 4AO6A 1UODA 1ZY2A 3V34A 2F62A 4ZYSA 2QN2A 1F17A 3MG9A 2P79A 4IIEA 2QCPX 3SSOA 4I2NA 3SK8A 1QVCA 3H94A 5GADl 2W43A 3U1TA 3BSFA 2PQMA 3ICQB 3N86A 4FOSA 2KJXA 1T10A 1KY5A 2OCKA 3IHKA 2HMWA 1XDUA 4TV9A 1SLJA 4PLGA 4E5MA 2QL7A 4NJOA 2IH5A 1YZUA 1VJTA 2PUWA 4DNRB 1PNVA 5JNSA 3K0KA 2Y4NA 4LE0A 1CRLA 4FOPA 2OR3A 1DAHA 5ES3A 2RBMA 2VHEA 2EYUA 5BNWA 4LRYA 1G20E 5HCUA 3PUWA 2ZVPX 5DJ5A 1L0XB 3JD1A 3PVZA 1R0RE 1VPWA 3O4RA 1GZ6A 3L01A 3WHKA 1N34B 1T9BA 1OI3A 2QUKA 3L0BA 1PLLA 2H2AA 3TSYA 3WR5A 3A0RB 3RAEC 3Q7SA 4B3BA 4ZCLA 4B4KA 4I50A 4OBEA 2FUEA 4FCWA 1ZP6A 1VGQA 3C14C 2OHFA 3ZQUA 1H2FA 3RVRA 4EAQA 1JPJA 3HA3A 1KTKA 1KJZA 3CF4A 1RJGA 4JYAB 3WWEA 2Z1MA 1P0QA 4UVGA 4CG1A 4WFQA 4OI2A 1A15A 4N3BA 5CVVA 3GJYA 2BDEA 4YQEA 3RIEA 3D5TA 1W94A 2X3YA 5IK2A 2VTBB 1EU4A 3LSYA 3AYHB 2AN5A 3FR7A 2TSYB 3QLEA 1VA4A 4C2MB 2UVPA 4F87A 1BCRA 2V97A 4O2BA 4FX5A 3KF8B 4PRKA 1RAHA 1K28A 1UDAA 2IYZA 1O03A 2OGTA 2N42A 3L7MA 1NPDA 2HA2A 2FZLA 1L5SA 1Y3DE 1R0YA 3H84A 3MA2B 4JC0A 4RE6A 4MV7A 5HIAA 1XNQB 3F97A 3IJEB 1PTKA 3VHXA 4OLFA 3CJTA 3E7FA 1LLFA 4BY9E 2RGNC 1IVYA 2ZE7A 1IHYA 1IBCA 5E8RA 1KAWA 3X1WA 3CLHA 3B1JA 1SKBA 4X54A 2DLCX 4LGVA 1ML0D 3RN2A 1SEPA 5FWNA 3FOFC 4Q6BA 4DR5B 1OBVA 4CQLA 3B3GA 1G18A 3D8BA 2CZCA 1DHRA 1RLMA 2AUKA 5H3HA 3RRMA 3KWJA 2HIMA 2LW7A 2WT9A 3MRTA 1NUTA 2HJVA 2VP9A 1GUYA 1GQOA 2CLDX 4XTCS 1Z3CA 3P96A 4WORA 1AE1A 4C2MH 5C8DA 1F51E 4HG2A 4PSKA 2IL1A 1GLGA 3CCVA 2QPAA 2BI8A 1KETA 2G1UA 2ZJAA 2DSTA 3VU9A 1D2CA 4O5AA 3PLNA 1FYFA 3MEQA 4L50A 3LY9A 5K6AA 1W5EA 4FQ5A 3DOUA 4G5HA 3ER6A 4BFZA 2IYTA 4YHBA 1N8KA 1Q1QA 4IFDI 3B2NA 1HNNA 3HKBA 4XX0A 1E5TA 2C3MA 4ND7A 3L7OA 3CKLA 1JT8A 3HFGA 2DMRA 2R92H 2GJKA 3S2FA 2OC4A 1RW4A 1EB9A 3VPAA 5AXCA 1NN1A 2KMLA 2H9IA 1IUPA 4OJNA 4Q1CA 1ISJA 4JXZA 2EATA 3I6QA 4J75A 1FFGA 3UXHA 2PPVA 2GCNA 1QH8B 1PI3A 3I5MA 4YIJA 2O3UA 3C5EA 3ABQB 4XI9A 5A06A 3WMXA 3QX3A 1N92A 3THOA 3GPCA 5C1OA 2VAMA 3MB5A 1IUKA 1I2MA 1E2HA 4XJVA 5CD1A 5F51A 1JE5A 4IEFB 3A6GA 1K98A 2Q45A 3QFHA 3BB4A 2BCOA 3U81A 1SE3A 1O5IA 1QQBA 2FWJA 5IVIA 2WHPA 3SEFA 4HAZA 3I62A 4EHLA 3HDGA 1Q6YA 4BVFA 4JKIA 3QXSA 2K33A 4DJDC 4OEHA 4YMGA 5EJ7A 2PZJA 1HZ9A 3Q8MA 5MN5A 4FDMA 4OHXA 4DUZB 1KBQA 1Z6TA 4KWEA 2A0KA 3ZGYA 5AW1A 1SJ9A 1NW6A 2YV3A 2XZOA 1K8QA 2PMDA 1I8TA 4KE9A 4LFBQ 4ZCRA 1D4AA 2A9FA 5BSVA 3DCNA 1KAAA 4MCIA 3BMXA 3O4GA 1E6KA 1QHGA 3SC2B 2R8PA 2BH9A 4LSWA 4PS0A 3VC7A 5U4QA 4OHOA 2AUNA 3AR2A 1JQBA 4ACBA 1HR0Q 3Q5EA 2GA4B 4YNBA 2NU7B 2EFCB 1ZIPA 3T5TA 4PFJA 3K6SB 3BWVA 1PXUA 3O8QA 1FYCA 3S8YA 1XZKA 1GSOA 4QODA 4B3TB 1O1YA 4M9XA 3GI1A 2ODAA 5LM3A 4IOJA 5CYGA 4RACA 4FD2A 1VYHA 4JPBW 2ZDGA 1DYQA 1FU7A 4HS9A 4OWTB 2C3YA 3KR2A 1SJED 5LDHA 2ZLBA 4GNKA 1USUA 2PLNA 1X65A 1A95A 5KQPA 1TEXA 2A8VA 4R2IA 1E61A 3V8MA 2YQ5A 3CCLA 4YJ2A 2WE7A 5IYBG 2VSFA 3RHSA 2G80A 2JI9A 3PNLA 2BL4A 1CEQA 1HCZA 3PQ7A 1GR1A 1GZVA 3G02A 2QSJA 4RTNA 3NOXA 4IFDH 5EGTA 3SK4A 4GI7A 5LU8A 2DBZA 2QW0X 1PUJA 2X6GA 4IYJA 2P2NA 3SQOA 4D9EA 1KP9A 2ZM5A 4Q39A 5AFWA 1UH5A 2HMSA 5LP6A 2WYVA 4FHFA 5LXTB 3RU7A 4CEHA 4BMZA 1VL6A 1YA6A 5B3AA 3LWEA 3FPCA 4INZA 2OWEA 5A4AA 1H5NA 3AIKA 3IMGA 3WWDA 1FD7D 3EUFA 3WLFA 3BH7A 1EFID 1YJ5A 5MFZA 1B8UA 4ZEOA 4JBMA 1KVQA 3NR2A 1O97D 4JL5A 4FO2A 5EKUA 1NI3A 4AICA 1VBFA 5KCZA 4JI1Q 1RPZA 4MH0R 2OYCA 3IUBA 1CFMA 3AB3A 5FTKA 4OHKA 1FBTA 2KBFA 3N8KA 1UXOA 1EK2A 1FP7A 2RJ3A 2OP0A 4DVJA 4BLTA 4H7JA 2JHPA 1SNQA 3P0HA 4YRRA 3CCEA 2XKAA 1VQ6A 5A03A 4BYMA 3PE6A 5KRUA 2JKZA 5DX0A 2EYOA 2PR2A 4U7JA 3BQ9A 1O95A 4MJLA 3ON5A 4HDAA 4OI0A 2X22A 1R7RA 1I24A 4NQRA 4CT5A 3LX5A 2IXDA 4PRZA 3S1LA 1C4WA 1SBZA 3UA4A 2N1MA 1DCTA 1QC5A 2WJ4A 1YRWA 4GLOA 1HNZL 3STTA 2OZEA 3FNQA 2I6FA 3VKVA 3EBEA 3P8ZA 3JYOA 3EGDA 2GAJA 4OEMB 1BGWA 2CJWA 1WIWA 5C3EG 4MMZB 1FFXA 1TJ3A 2JLZA 1YS4A 2QZJA 3A1TA 1UXHA 3WFIA 4ESVA 2XUFA 3IEXA 5DX8A 5NLLA 3AFPA 1AD2A 1YCHA 221PA 3OZBA 4DOMA 4LOHA 2ZI9A 4JYPA 1EK1A 2IZ6A 2KE5A 3T3OA 1OWNA 1WB9A 4KQ1A 2NWGA 5K6AC 1GAQA 2QG6A 1K66A 4G8JA 1OBCA 4DV7B 4GHWA 4DJFC 1H2XA 2WG2A 5JAVA 3G4SA 1I3MA 1L1OA 3L0DA 3IIMA 4GF5A 1N0HA 4X1YA 5CNJA 3VYTB 1DQZA 2O05A 1N0WA 2P4HX 3MAGA 4L0QA 4DSUA 1PG5A 3WKAA 3ZWOA 3QSGA 2CDRA 4IM7A 5LDDC 4OGFA 1DZ1A 1PD1A 3HNOA 4AKTA 3GOQA 3COYA 2JA7B 1JLRA 4ERXA 4DIDA 1JUDA 3F6BX 1GEGA 1E1CB 2XKBA 5JOQA 5DRTA 1Z4JA 2H1SA 2QXYA 3JWPA 1FS6A 1NYLA 2B3GA 1TJPB 3UHPA 3IAYA 3GTPH 3DB1A 1RD9D 3STHA 2JJQA 4KC0A 1P1JA 4NYJR 4EYQA 4DR1L 1NQTA 3CHYA 4N4AA 4M54A 4DM4A 1U8UA 3ACBA 3J81k 3HJUA 4TRRA 3QBTA 1L1RA 3C1AA 4A93B 2RCNA 4AP5A 2ZSJA 2FVYA 3USZA 3CRW1 3I6MA 2O5IC 3RBVA 4PPQA 1E89A 3ORQA 1RWKA 1VRCA 3T1HQ 1ZICA 1HEYA 3NQ41 2YN2A 1R5OA 3Q40A 1MC8A 4TV9B 4X65Q 1N3BA 3RVLA 5DLEA 4KKUA 3AU8A 1OILA 1ZJYA 2IYVA 4C04A 3HCOA 3WK9A 2XVMA 3OZWA 1GNLA 2B63H 2QTTA 3VV2A 3WSWA 3EVTA 4RCZA 3WIEA 3PCXA 1RQ2A 4QTZA 4WXPA 2JA7H 3AYXB 1AZWA 1WEKA 3RYFA 1G3QA 4OSPA 2KUMA 4A3KG 3OQ6A 3IAM1 2ZSBA 3BIJA 3O3MB 3R4VA 1CJBA 2WHYA 2E1PA 3SHOA 2QX6A 3TP5A 1I1NA 3K4HA 2ZS7A 2O1WA 4X66L 1JDTA 2R93B 2R44A 4MWDA 2GKSA 3WLEA 2X40A 4IPCA 3STWA 3VKHA 1NG1A 3GJSA 3ZV5A 2WJPA 1ZITA 3EIVA 5FOSA 1V37A 3U0BA 4N5IX 5FWDA 4GXRA 5JYBA 1QMPA 4I50B 2H54A 2QVYX 4GGOA 1EVJA 3SZGA 4OIMA 2O2HA 4GP7A 3GNTA 3HDYA 3CVUA 2NZOA 1LLUA 2PX3A 4XSGA 3UGJA 1NJ8A 4D9JA 2ZG6A 3F4LA 1PZGA 4KAXA 3H3FA 2VPXA 2GZHA 4P8RA 1T5SA 4TV8A 5C3MA 4DMCA 1TJ5A 1OXMA 4LBZA 4D9MA 4EP1A 2B2WC 4JLVA 1OAOA 1M8FA 3JQGA 4JXJA 3K92A 1HLPA 1ETHA 2R7AA 3I12A 4UBNA 1OZAA 3U80A 4B7CA 2HT6A 4KUGA 4MIYA 2PFKA 3IDSA 3KV3O 3DL2A 4RU1A 3PXBA 1UPXA 1M2FA 2UVPB 5CXSA 3WLIA 1BCRB 2HD4A 3CCCA 3KOYA 3DQQA 1XTDA 4O2BB 3H3XA 3WMWA 3PI6A 2WAXA 3Q7IA 2DWQA 3EVEA 4BFWA 3FM9A 2M6RA 2IRWA 5LP6C 1SU4A 4B81A 4G0VA 1CUEA 1V7CA 3EE6A 1H2EA 2C03A 5HRAA 1JKFA 5K7SA 1DBSA 1VL5A 4IH9A 3ZWKA 3OLWA 3SLRA 2I6XA 2NGRA 1JG1A 3WSTA 3VHXB 1A5AB 5FBHA 2OQ2A 4G0PA 4A3FB 3LWZA 4Y9UA 4KDCA 5D3ZA 3G6KA 4RSRA 2VCHA 1VCHA 4JGGA 4DLSA 4X3CA 3CZMA 1PR0A 1PZNA 3EWIA 2FPMA 2Y0BA 2CFIA 3DVQX 4LOIA 4I1YA 5CURA 4L78A 2PNRC 1UJMA 3ME5A 4CQLB 2PQ2A 3L07A 4X6UA 3RUHA 2NQTA 1JJBA 2XCLA 1Q0HA 1Q0PA 4NDZA 4NG5A 4PZZA 2VVTA 3RK4A 3KKKA 4LF4B 1ZGJA 3DL4A 1TKBA 4MVJG 4N8X1 2YFKA 4IJUA 3NHFA 1KO5A 3EH2A 3VU9B 4AJEA 3NKLA 3PU6A 2AJTA 4F72A 1YV9A 3HGBA 4D8TA 4EDFA 1NZDA 3DJYA 1NJFA 4AKIA 3BIXA 1NR1A 2B4KA 2PG3A 1ZI6A 3GIDA 2R25B 3HKBB 3BL5A 4XX0B 3K72B 2AHOA 2NUTA 3ZTTA