1Q12A

Crystal structure of the atp-bound e. coli malk
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q12A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q12A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q12A01
1E0JA 3F2CA 4WVFA 3S14H 3QEOA 4P71A 5FUXA 1ZM2A 2NO1A 4B48A 3TGPA 4BFYA 2GZHA 1UKVY 1AH9A 3RANA 4X66Q 2BMFA 3AF4A 1X8KA 2UXBQ 1I4LD 2ZU0C 5E7MA 2PT5A 4OQXA 1IBKL 4JI5Q 2RHDA 2AK2A 1CR0A 4I4LA 1XD2B 2FEMA 1N6PA 4LJ6A 4WOPA 3SR0A 1KMHB 2IEZA 3ZVRA 4DWJA 4CEJA 2AHOA 3B6YA 4QHYA 5CYPA 2ZM5A 1W1WA 1N25A 3DMNA 4DRZA 3IEVA 3R7WA 2J0UB 3HOVH 3U3KA 3EZFA 4PPFA 2IY5B 3LNCA 4ACAA 2RHSB 2DGYA 3ETLA 1OXVA 2CK3D 4EPVA 4NXMQ 2XTIA 2F4VQ 4L16A 1N6OA 3RRNA 2Y0SE 1H8HA 3BS4A 5EXXA 2CCZA 1RPZA 4JYAQ 1XTRA 2IW3A 4QQBX 1S4QA 2VUMH 1OIXA 4OQFA 3EA5A 2GEDA 1P5ZB 2P2LA 4GOXA 4AYTA 2B63H 4DV7L 1ZVQA 2MMGA 4GOJA 4OI4A 4Q9JA 4DV0Q 1X3EA 1J70A 3HPRA 1VQDA 4FD2A 2AX4A 3GLGB 4MQBA 4LYJA 4MUBA 4Y52H 3PEUA 4Q7JB 4KLKA 4M2LA 2VHCA 1XNRL 5J4KA 5HY6A 2FGJA 2GILA 5IYCG 1NG1A 4MKHA 4UQOA 4GP7A 1GL9B 3R9WA 1DG1G 1FR3A 2A5FA 3K81C 1QHGA 3TSZA 2Z0MA 2ZQ5A 1XTQA 4OHXA 3THYA 2GF0A 3OAAD 5LD2B 4W7SA 2IT1A 2KCCA 2GAOA 3NEYA 3EWAA 4DR2Q 1RJ9A 2NZHA 4HAXA 5AUQA 5BR8Q 2H17A 4CDGA 2GXSA 1Q3TA 1YR8A 2FE4A 5FUWA 4CEJB 2ONKA 2CCKA 2JLVA 1WA5A 2IUUA 3K9NA 4JLOA 4DR6Q 5F3WB 1E22A 1L8QA 2QI9C 1I4TD 1GO3E 2MO0A 4PQFA 4D80A 1YZUA 4HI0E 4GZYC 3BB4A 1UKZA 4L15A 1N32L 1N6IA 4WXPA 4JSTA 4DV3L 1JEDA 2C98A 3FGNA 2VNUD 1YJWA 1G8GA 4QGGA 1TU4A 3G6EA 3V00A 3MWKA 1Z5ZA 2HLDD 2IYSA 4QJFA 3A1TA 1K0RA 2XXAB 2BIFA 3UDFA 3A1WA 2OT3B 1PLLA 4IPHA 1A4RA 2QMHA 5AUPB 4TYYA 2E75C 1AJEA 4ZIRA 1WF3A 2PMZE 2HF9A 2B8FA 2RGCA 2V8OA 5KTYA 4PMWA 3TUZC 4II7A 3BE4A 3V9PA 1N6RA 4TYPA 1YRAA 3K0CC 2C96A 4LJ9A 1Q20A 3CW2C 5CJPA 2REOA 2N42A 1GRQA 4KFRA 4TQAA 3RSOA 3EX7C 1A2KC 2GESA 3FHOA 3FOZA 3EA0A 1J5EQ 3RLNA 3J80c 1YJ5A 2HHHL 2ZR7A 3Q5DA 1NKTA 4MZ9A 4JI1Q 2E2JH 4NP6A 3HKSA 4QBGB 1JECA 4W5WA 1P2UA 1Q0UA 2EW1A 3SOPA 4D4KA 3ND9A 3GTPH 1A8VA 4YMWA 5GROA 3SYKA 3PUXA 2KBFA 2B29A 3S1RH 1LYLA 1VIYA 2WAYA 3W6PA 2IYUA 4JLKA 1OFHA 2JA6G 1NMGA 4B3TL 1GNRA 3D7MA 4C30A 3EC2A 3GJ8A 3HFZB 4MYCA 4YLGA 4EAQA 4DNTB 3CC2A 1DAEA 1TWAH 1DG3A 2PBRA 3NBHB 2G9NA 2JGNA 1YKSA 4KHPQ 1UPTA 1SXJC 4PPGA 3QKRB 4DV4L 4QY7A 4DUZL 1KK1A 4LPKA 1KDPA 5FL7D 4BFTA 2VPPA 2ZRNA 2IS2A 1PH4A 2QORA 3DZ8A 4A75A 3TS0A 4DBLC 2QAGA 1N0UA 1ZD1A 2ZM6L 2ZSBA 1KDOA 4N3NA 5C4XH 2QZ4A 4OI2A 2Y8EA 1KO8A 1GHKA 1FOEB 1KYIA 3L82B 2JA5G 1QVCA 4BLRA 3BFVA 1UF9A 4DCSA 5GADl 4JJZA 2O8EB 2IBMA 4GLVB 2OESA 4A3DH 4DSOA 3KJIA 2BE5C 4BBSH 2GEUA 2O8CB 5C44H 2E5LQ 5J47A 5M5XH 4R4QA 2ZI7A 2QE7D 4EQ6B 4IVPA 4Z8YA 1OB5A 3RNLA 2G6BA 1WDTA 3A4NA 3IPYA 1E2GA 4B32A 3KF6A 2FPLA 1AGRA 2ATWA 1PH2A 4RCZA 3HOWH 5C0XI 2X2FA 4QBIA 2N8NA 4LBWA 3I8SA 1PFSA 1EQQA 1COWA 1MJEA 4RD0A 4BRWA 2V4DA 1KRSA 4MNOA 1Z6TA 4P72A 2C9YA 1N9WA 4JKIA 3RABA 4R4IA 3U3RA 3TNFA 3QUSA 1X3GA 3KQKA 4DXAA 1QZXA 4ILEA 2OCAA 3ZZTA 1SVIA 1TWCH 1FTSA 2UU9Q 1XD8A 2DPXA 2ZTSA 3BH7A 2K33A 2ZSFA 3E2IA 3JZMA 1Y63A 5IDVA 4HB0A 1GOTA 2FSIA 2MFIA 4QIWE 2OCYC 4B3GA 3PXGA 3EBEA 4JL5A 3ICQB 1FGUA 2GA8A 2VQFL 4PC2A 4BE7B 3U58A 3G4SA 2ZI3A 3Q72A 1WRBA 1Q1EA 2QEXA 3RN2A 1XTSA 1UFQA 3GQBA 4GPTA 4M22A 4MRNA 3T1HQ 3ZIAD 2CHQA 1W7AA 2ZE5A 4B34A 1ZRHA 4HJ5A 3L2OB 1VMAA 2PEZA 3I4MG 4BXXG 1L2FA 2NZ8A 1T91A 4IFBA 1X65A 1GUTA 5L3SB 3T1YL 4M4SA 1KY3A 4MRVA 5CIQA 3D4RA 2ES2A 3IILA 4M9QA 4A3BG 4OK3A 3SN6A 2EIFA 5GQOA 3QY0A 4X8HA 4GN4B 3GTQH 4N1AA 1EK0A 4ME3A 3MG9A 4KMUC 3S24A 4B33A 3M4PA 4BZXA 2HXYA 4H1UA 2GDJA 2QGZA 3FE2A 3N6RA 1T0JB 2ZJOA 5M04A 5IP9G 1UE7A 4AYXA 2W6JD 3OEHA 3UKDA 2J0QA 2OCEA 1F2TB 3PO3G 1GZSA 1N6KA 4DSTA 1UBFA 4IKEA 1G64A 5JEAG 4QKQA 5BN4A 1HNXL 1HNZL 3Q85A 5IT9c 3K70D 4LF9Q 4PV1C 1YZ6A 3I4NH 3TJZA 2ZI6A 4JBMA 3ONWA 4KODA 3FKIG 2L0XA 5EXTA 3NE5B 2WSSD 4C7OB 4PHHA 2P6UA 3C41J 4U7DA 2R65A 4BEJA 3I4OA 3KYHC 4J0QA 1NVVR 3VTKA 2VA8A 2OE2A 1Q46A 2HIVA 1XNQQ 4JLAA 2CNWA 1IQPA 4X6AH 2CL6X 3UDGA 4BA1I 1TF5A 4A3EG 4XH9B 3KQHA 1V9PA 4IOAA 1IN5A 4FMDB 5CB6A 3FMCA 2IYRA 3H1TA 4X62L 4AC9A 1X3SA 4ON9A 3ADDA 2NVXH 3CZPA 2JA7H 1DO2A 3B1YA 2ZU6A 4JSYA 3KQLA 1VQGA 2VZAA 3VMFA 2WKQA 2EYQA 4BEBA 1E2VA 2BHRA 2VP4A 5JEEA 4JOIA 2W58A 3WNCA 4KSBA 4PX9A 5JHHB 3U6BA 5JEAJ 1S9DA 1HR0W 1W5SA 2ZI9A 3LY5A 3LXRA 3BG3A 4NTZA 3SE0A 1NF3A 1R4AA 1TWFH 1JQJC 3GD7A 1X1RA 2CK3A 2WJVA 4IXNA 3C14C 3AVPA 3LWUA 2C8VA 3T35A 4A3LH 3A4MA 3IUYA 1AIPA 2OZEA 1IN7A 1IBKQ 4PZLA 2D2EA 2VRWA 4B44A 2NN6I 3JAMi 3NEJA 1V8QA 1PYBA 1NVXQ 4DT1B 3ZVLA 3D8BA 1FUUA 1ODFA 5KNCA 4KBFA 1U98A 4X8LA 4Q4JA 4RMFA 1N33Q 2J0SA 4LF4L 1K73C 3H0GH 3PIRA 4LC1A 2J5XA 4IDNA 4A3CG 5CDFE 1QZGA 1HNWL 3BXZA 3K9LA 1N5JA 3EZ2A 5C4JH 1DXMA 4GMXA 4DV7Q 4PPNA 1FYCA 4WIAA 3CRKC 2MQHA 4DPGA 2OFXA 2RAPA 2XNSA 4LJ7A 2XB2A 1UEJA 3ADCA 1FNNA 4Z1MD 1W36C 2JK8A 1JT8A 1IN8A 1D9XA 4KV9A 4OBEA 4ITRC 5AJZA 5LB4A 2ZRKA 3REGA 5LDDC 1Q44A 3T1TA 4HAZA 3EW9A 3CAMA 3UPUA 2ATVA 4P4SA 1BVSA 2GCOA 3S2DH 3WRXC 5TDHA 5KHOC 2LSSA 2YWFA 3SNHA 1GFIA 1U0HC 3RRZA 1IJEA 5P21A 4MGYR 1LABA 2WP8J 2JQOA 2ZAOA 4A3FH 4IXMA 2GTPA 2CVHA 2OCPA 3AP1A 3SS8A 1UDXA 5EJEA 1CXZA 5DHFA 4B47A 3QNUA 4QBHA 2ZSAA 4B71A 1Z0JA 5AJVB 2ZRJA 1QVFA 3FVQA 1G291 1Q21A 1AQUA 1UBEA 5LMUL 2IS4A 2PCFB 1KK3A 2QPOA 3GTLH 1LM0A 1FP6A 1YHNA 2HLDA 3KXIA 1XB2A 1JI0A 2UZ3A 3BZCA 1QRAA 3DL0A 3K53A 3GLFA 1NY5A 2H1LA 2ZRAA 1ZU5A 1OPXA 3HKZG 4HAWA 1HR0L 4NE2A 2AD5A 5FI0B 621PA 4O0MA 1TADA 4RJLA 2BCJQ 3S1QH 2P5SA 2Z83A 1EG7A 4Q66C 1N32Q 3B1XA 3CWZA 4Q7KA 5H70A 4LF5L 4DV3Q 2W6IA 1XJVA 2ZRIA 4AWXA 1NN5A 1OF1A 2JE6I 2H7VA 4NBSA 3HOXH 2GF9A 2A69D 4GOPB 2Q21A 3QPUA 4LOAA 2Z5FA 5FR2A 4H9GA 1VQPA 3IHWA 4LCBA 4O2RA 4PQRA 4V0MA 1YNJC 2O8BA 1L1OC 4HJ8A 1KO1A 3T1OA 3CMAA 5GJVC 1ZBDA 5H1SE 3BH0A 2E8GA 3LLMA 5IRCD 1HT1E 1PJRA 3HGBA 5HE8A 2ID0A 4C0AC 5EE5B 2A6ED 2WAQE 2J46A 2JJQA 1DAHA 4GNXA 4L4UA 5TXGA 4HZIA 4PPQA 3SYLA 4DAMA 2B8WA 3LBNA 1Y1WG 1W5TA 2HCJB 2Z4RA 4R98A 1KHTA 3WY9A 2PQAA 1W0KD 1YZKA 1IM2A 1EFHA 1Z83A 1HT2E 1KAWA 2AR7A 1E7ZA 2P65A 1LV7A 3AKCA 1TQ4A 3KUCA 4AYBG 2HHHQ 3PENA 4HIKA 4Q1FA 4RD4A 3ICEA 3S2HH 2BJWA 1XZQA 3FDIA 2PZGA 4IFEA 1IYJB 3TMKA 1UADA 5ELOA 1FUKA 1G3RA 2NG1A 1CP2A 2IYWA 4DV5Q 4B3DA 4DUYQ 2B92A 5FL7A 2NVTH 4MGKR 3AVUA 3B6EA 1XMIA 5LMNQ 1EFWA 2V7QD 1VS0A 1X86B 3FB4A 1LY1A 2OTJA 2GXQA 2F7SA 4Q18A 4B3TQ 4K0KL 2WBLC 2JASA 1OJLA 3ADBA 2ZPTX 3RLOA 3R20A 3C15C 4V02A 3GLIE 4QJ5A 2ZTDA 1FL0A 2W2XA 1QJOA 4DV4Q 2C99A 2F9MA 2IXFA 1E24A 1NVVQ 3STBC 1AS2A 3AF0A 2UUBL 4KXFB 1I4DD 2ZXUA 4LUCA 4LUOA 2C35B 3SQXA 4LFAQ 1MRSA 4PAQA 2ZM6Q 4A6PA 3KF8B 4BASA 2L15A 4Q47A 4HIOA 2JA8H 1NY6A 2PLRA 4RCYA 3NBZC 1EWQA 1XCPA 4LYHA 1IW7D 2QUZA 4JC0A 1FL9A 3LNNA 4G5GA 1G7CA 1KNXA 4PAOA 1VQLA 2OILA 2SHKA 2IC5A 4R2HA 3E0EA 3CRLC 1E69A 1D8LA 3BGWA 5HKKA 4OGQC 1YJNA 4HUQA 4BWYA 5JSZB 3W34A 4OWTB 3B13B 5BW8A 2ZROA 1KI8A 4X8MA 1CR4A 3RRMA 3X1YA 2GXAA 3AQQA 3GLHE 4HDQB 4URUR 2Q9AA 1SKYB 3R9IA 1M90C 3W3AA 4DVGA 3CCQA 2VEDA 3W5JA 4G7OC 2VSXA 4BQSA 3HOYH 1KI6B 3I8XA 5EE9A 3ZD6A 1ZM3A 1J7KA 4CYMA 4AKGA 4IEIA 4LW1A 2YINC 5CLQA 3FMPB 3K8YA 4Y0AA 3KJPA 1OE0A 3J80i 1XP8A 2CLCX 4CIDA 4E5UA 2B21A 1G18A 4NHOA 4OQLA 3T61A 1CJUC 4TWZA 4L5TA 1OH6A 1J8YF 1KHIA 2BV3A 2O0HA 4NH0A 3EPLA 1EOVA 4DK3C 1FJGL 3CWQA 3LO5A 4QJ4A 3WYFA 2WJYA 2VQFQ 3H4MA 3RR5A 2BBTA 5C0XG 1US8B 3GEIA 5B58C 2ZS7A 2D74A 4I99A 2NOAA 2OCBA 1E9SA 1LS1A 3FHTA 1PYSB 4M9XA 3MWLA 4A8JC 2DB3A 1VYTA 4XWOA 1HZAA 1HQCA 1P72A 2QENA 4A4IA 4YCWA 2KBEA 2OAP1 2QTFA 3TSOA 5JFGA 2PJRA 4X64L 3DM3A 1PH1A 2Q2TA 1F48A 4Q7LA 2W2TA 3WYGA 1KI3A 4YQFA 3T1YQ 4POAA 1XXHE 3W90A 3GDEA 1D8TA 1TQDA 1IYVA 2IF2A 1RIPA 1H95A 2J9RA 2J45A 4A93G 2VLIA 1JAIA 2WSSA 5E3HA 1P60A 4C3JH 3P26A 3NENA 4XD7D 3ZDQA 1GL7A 3HWSA 3KDFB 3AEZA 2NO0A 1HUQA 1U8YA 1P7CA 4OXPA 1NL3A 2IX1A 2NPIA 2O5JC 2CLSA 3HYTA 5JWOA 1HNZQ 1GL6A 2PI2E 3O47A 4PC6A 2WWFA 5HE9A 4B2PA 1NN0A 2ZJZA 2WMNB 3JVUA 4GOKA 4BFSA 4FWIB 4Y7NH 3THOA 1KL9A 5IF9A 1YNNC 5JJLA 1GKIA 2ASBA 4LFCL 1P9WA 4Q1BA 4N0DA 1E6CA 2F1IA 3GFTA 3LH5A 2LXKA 5IWAL 4HDOB 3FPPA 1MH1A 1R10A 4AIMA 1VQOA 1GTVA 3CD6A 1Z0FA 2W0MA 4LV5B 1GUSA 2DWPA 4OHZA 1NNEA 2GWHA 4AY2A 4HB3A 4KN4C 2LXJA 4X62Q 1G6OA 1EYGA 3SU8A 2BBWA 2J0VA 4F92B 3U3OA 3THXA 3EPHA 2R9VA 3H94A 1VQAA 2KHIA 2IYXA 4E07A 1G8PA 1P2TA 4JOIC 3DO6A 4RVCA 4OX9Q 1JJGA 1XTIA 2ODBA 1UJ2A 1XEXB 3A0JA 1QZHA 1TU3A 3FYHA 1OV4A 3L0SA 1YHBA 1VCNA 2H92A 4F7WA 4OWXB 2YWHA 1YZQA 2R44A 2CE2X 1CKMA 5GJWC 2JDIA 1PV4A 2A68D 2D7CA 3FWYA 5C18A 2QT1A 3CM0A 1E2QA 3H84A 5G53C 1SVLA 2EWVA 4A3LG 4Z1MA 3P20A 4AK9A 1JAHA 3GTKH 3TRZA 2ASEA 2W2VA 5LBIA 2F1MA 5ELXA 3SHWA 1S8FA 1PMRA 1H9MA 1TQ2A 2BEKA 4LF4Q 3X1XA 3KQNA 1K9MC 4JLMA 4G1UC 4EPWA 4DCNA 3QBTA 2R2AA 2ZUBA 1CI3M 3TS2A 4WJ3M 3K0XA 2RGDA 3KKOA 1AN0A 2GK6A 4JI4L 3N70A 5AUNB 4L8JA 5C4GB 3O8RA 1LUZA 3IQXA 3HYRA 3NDBB 4YC7A 3A4LA 1CSQA 5K36G 5FTKA 1GHJA 4AD8A 2NN6G 1SLJA 1ZUIA 1T5LA 4IDPA 2ALYB 5AUOB 4DV6L 4NYMR 4JJKA 1YQTA 1QHHA 1W48A 1MABB 1J90A 1S96A 4KN7C 221PA 2OFOA 2W0SA 2N1BA 4LV6A 2GRJA 3CNNA 4IFDH 4NDZA 2JLWA 1B7YB 2K14A 2G83A 4TLCA 4JYCA 1S2MA 3G71A 2AKYA 3K8AA 3KFXA 2QL6A 4IJHA 1S1CA 3VKWA 3TAHA 3W8NA 3CCLA 1XMOQ 1SVSA 5B64A 3OIUA 5JJIA 1PZNA 2IHYA 3GMTA 5F2EA 2GK7A 5HCNA 4TYNA 4ZI3A 1XCGB 3ZJYA 1GG2A 2ZRGA 2O8DB 2VSOA 5HGQA 3OW2A 1SVOA 3KDFA 3G0HA 5BN3A 2ODWA 4P3YA 3WYAA 4JK1C 1CLUA 2AFHE 1Q22A 3AVQA 1W36B 3TIFA 4EPTA 2VP9A 5IP7G 1HR0Q 3MSXA 1A82A 1JJVA 5JWRA 5DI9A 1VQNA 1U9IC 2CFMA 2WAXA 3IKJA 1IOZA 2D2CC 4DV1L 2ZVQX 4NMMA 2V1CC 1J2JA 4LSGA 4AQYL 1OHHD 3K0FA 4B3CA 1OFUX 3GLHB 3WP1B 2F52A 2KA7A 4P74A 2QBYA 4FDBA 2FH5B 3C4JA 3KTAB 1MIUA 1MOZA 1CTQA 1W0KA 4FINA 1ZJ6A 2QMEA 4QNRA 2Q2HA 5DI3B 4A2PA 4LYAA 4H0LC 2GBLA 4IPCA 1CKNA 5LB2A 3BD9A 3LBIA 1YE8A 1QUQB 1YHQA 1WE2A 2OV2A 4ABYA 5KPJA 3U5ZB 4TZ6A 2RGAA 1G7TA 3BC1A 4CEHB 1E1OA 1M1YE 2A6HC 1JE5A 4JI3L 2ZRFA 3IBYA 1LF0A 2QG6A 4DDUA 3UDXA 1M8PA 4GNXC 4UNQA 1Z07A 3CNLA 3TRFA 4DLZA 2N3SA 3TSWA 5JCZA 4HIMA 5M3FH 1QVGA 4JI0L 3B60A 4EKDA 2WVJA 3M7NA 2CEAA 3AP3A 1FQKA 3IPXA 3AM1A 3DVLA 2ZSDA 4GNKA 3CCUA 2R92H 4U5XA 2ERYA 5TY0A 1W4RA 4PZYA 1H9KA 1D6JA 5FBQB 4AYWA 3PO2G 1GNPA 3L0IB 2ZJAA 1G8YA 3RS4A 1D2MA 4JBJA 1M6NA 1T5IA 2A78A 2GEVA 3KJEA 4TSFD 3ZYCA 1Z08A 1L1OB 1Z63A 2IUTA 3DHWC 3G5UA 4BFWA 1P2VA 5D3MB 2EQSA 2JJ2D 1OKKD 1HE1C 1XXHB 1HZCA 4CF7A 3GPLA 2AKAB 3IFTA 1X9NA 2BVNA 4NL4H 4KSCA 3THWA 3AGQA 1A1VA 2RGNA 1LS6A 2E76C 3A1UA 3QF7A 4L8GA 4URYR 2FSFA 3X1DA 1NTGA 3ZZUA 2ZJ2A 2UUAL 5IYDH 4DLYA 1RYHA 2ZE6A 4EFNA 3VR2A 3AF1A 4QNMA 1Y1VH 1VTKA 1N36Q 1KDRA 3PIPA 1XPOA 4Q9IA 2GN5A 2UUBQ 4LBYA 1PH6A 1NBMD 5AJYA 5JZVA 1DEKA 3QQ5A 4TL9A 2WWYA 1E2WA 2CKZB 4RKEA 4EJSA 4DB2A 2MO1A 1TEXA 4PAMA 1B23P 3QBVA 4G5QA 4I1VA 4ZDJA 4GS3A 1O7LA 1YVCA 4DR1L 5FLMG 3GLIA 3WBJA 1DOAA 3UE0A 2F3IA 1Z0DA 3JZAA 2ZJRA 2MMCA 4RZ2A 4HATA 1VYUA 4IJLA 1OFIA 3ASZA 4KCGA 4AKIA 3CBQA 4PHGA 3GEEA 4V0LA 5AWFC 5FPTA 1ZM7A 1AE3A 1RC8A 2OLKA 3PEVA 1E79D 2YOGA 3A8TA 2IYVA 2E87A 1VIAA 1U8AA 2GAAA 4TQ9A 1ZCAA 5FPKA 1SMYC 1T8UA 1TWHH 3FFAA 2FA9A 4Q9LA 3UK6A 1U2RA 5EP4A 3CCMA 2QSZA 1RKBA 5FOVA 4DNIA 4YHHL 2OXCA 2X77A 3JC66 1DS6A 1YNXA 4PC1A 1GKUB 1A2BA 4H44C 4LWCA 2UUCQ 1MKYA 1II8A 1RZ3A 1ZCBA 2J41A 5EP1A 3RS7A 4LI0A 2YWEA 5ANRB 2QQEA 2ZRBA 3RS3A 2ZVPX 4JBKA 1NLZA 4F38A 4LUZA 4A15A 1VQHA 1XDBA 4K81B 2HXSA 3M1IA 3U44A 5JHGB 4Q4HB 3FKQA 4DLSA 4UJ3A 3PUVA 3CCEA 4KFTA 2X2EA 2JAQA 2VQEL 3CP0A 1W2GA 2PCJA 2BA0A 2NPFA 5DYIA 1NMFA 2F55A 1SMXA 3DXJC 2YWGA 1ZYUA 1IY2A 2ZT9C 5GAGC 5JJKA 4FW9A 1N34Q 1F2UB 2Q9BA 4NYMQ 5FOSA 1TMKA 3CNOA 2BWJA 4C0JA 4R4CA 4KHZA 1MR3F 1PH9A 4LF7Q 1VQEA 2RHQB 4O2DA 4UP7A 2J7PD 2BH2A 3AH8A 2FN4A 3U50C 1KI1A 1HE8B 5EP2A 3K70C 4LY6A 2CCJA 3M9BA 2R7ZG 2O8FB 2PCLA 3RC3A 5C46F 1E32A 2AUKA 5H68A 3T51B 2ZJPA 3X1WA 4QM7A 4ALPA 3CRRA 3VR3A 4JBXA 3LW7A 3K0AB 3UMSA 4IJMA 2LMCB 1E1TA 4JI6Q 1EFRD 5FPSA 1GRRA 5EAYA 4ARZB 4IVQA 3VKGA 1P9NA 3EC1A 4A3JG 1XD2A 3OEED 1UKEA 1QG4A 1NJIC 1KMHA 2WKPA 3QF4B 4A8JB 4D25A 3ZVMA 1B9MA 1A62A 4TMKA 4L9WA 2J0UA 3RSLA 4W5JA 4E03A 4J15A 4A3MH 3OF5A 5M5WH 3A6PC 4C2MH 1O3YA 1R0ZA 4URXR 3FFBA 2IF0A 4UXJA 4YONB 4C0SA 1P9RA 2QGNA 1HZ9A 3CH5A 5IWAQ 3Q8DA 4S35A 4JI8Q 1I6HH 3JVVA 4CEIB 3KJHA 3ER0A 4X65L 2O5VA 5GJCA 5F9FA 1Y8PB 3VDYA 2ZITA 3BAFA 2JEBI 3VAAA 5J4VA 3GLGA 5M3MG 3OIYA 4B3ML 1K8AC 3PUYA 1TQ6A 2OO7A 4C2UA 5FTNA 4DLTA 2R93H 5HPYB 3PCOB 1Z29A 2H16A 2VTKA 2GCNA 1SFOH 3RDPA 2D3WA 5EZ5A 3AVTA 3AVWA 3BZKA 4HJ9A 3KZ1E 5KOYA 3I73A 5L3VA 3C7KA 1X6OA 4A0RA 1W2BA 5KDLA 4BY7H 2FFAA 1OXTA 1MKHA 2D5DA 3HOZH 4JT2A 3TE6A 1ZMXA 4IOJA 2EWWA 2Q6TA 1CR1A 2O5IC 3LA6A 4LK2A 4JYBA 1YZLA 4UNSA 3A5ZB 3KKNA 1VQFA 3KB1A 1A63A 1S0UA 2B7CA 1GKHA 1GILA 1A7JA 4A3KH 2HT1A 1NMXA 2FPMA 2CLDX 4M1MA 6Q21A 2AK3A 2V9PA 4GDFA 3RS0A 5DN6D 2YTVA 4RFSB 1VF5C 4Q4AB 3CRVA 1WP9A 4DAYB 4BBRG 2E2HH 4UXIA 2JA9A 4OK5A 5IYBG 5FR1A 2IYTA 1Q3HA 2Z6KA 3BK7A 2K75A 3GFOA 3SJBA 5SZJA 1KZ7B 1DBSA 4I7ZC 5FOTA 2Z0SA 4LUVA 3WMGA 2CMKA 2R62A 2DFLA 2F9LA 4U00A 1YR9A 1LB1B 2XOKD 2IYQA 3NKVA 1G51A 2ZJYA 2XXAA 1J99A 4G5SA 3FPAA 4JI7L 1VQ5A 5KNBA 3EN2A 2GJKA 3LDAA 1ZW6A 1OXUA 3I62A 1YVDA 1IZ6A 4AH6A 3EPKA 2XTNA 2EFHB 3A1VA 5C3EH 1W47A 4QL5A 1ONLA 2VP5A 1EGAA 2GJAA 4Q00A 1XJCA 1E9EA 4M1SA 1U99A 3GTOH 2DN8A 5FPYA 2F1RA 1P75A 4DNRB 3T5DA 2QRNA 1OHHA 1I94Q 2C2HA 1WQ1R 4CW7A 4TL7A 2BMDA 2R7FA 1OYWA 2LKCA 5J5CA 4DV2L 2FEOA 2NO7A 3ZJYC 3BWDD 2KI5A 1YR7A 1M7GA 4A3IG 1KNQA 5DISB 5GVRA 1HJPA 3S16H 1AKEA 1DE0A 1XD9A 5IT5A 5JI2E 5DO9A 2JCSA 2WWGA 5A4JA 1W4BA 4WXRA 5C2JB 1BKDR 4B3BA 4Q1CA 4DR4L 3HOUH 1Q57A 1E9BA 1N6NA 3GJ4A 3EZ9A 1GDDA 3P1JA 4YMSA 3EQLC 4AQYQ 4AIIA 3QIAA 2A7QA 2G3YA 4OHVA 1F5NA 2AN9A 3EIHA 3S17H 1YJ9A 4KAXA 4MUAA 1XMQL 1QF9A 1UDWA 5IHPA 5FJ8G 3OZXA 4GI7A 4M21A 2ONJA 4RZUA 3ZS9A 3OE7D 3M3YH 1KO7A 3Q5EA 5G3YA 2YVUA 3QKRA 2ANBA 2JLYA 1UAAA 4WJ4A 3HDTA 1LTLA 2YYZA 5FH9A 1II9A 3A7AB 1TEVA 1XEWY 2ODNA 1V1QA 4NONA 3QXJA 3IO3A 4Y0VA 3QXCA 4XOIA 1VQ8A 4TSFA 1RW4A 5FOUA 3LX8A 2BM0A 1VG9B 1SXJE 2DWOA 4Q03A 4HZUB 5IY0A 1SKYE 3B1WA 3MWJA 1Q7YC 3SI7A 4C0HA 2K52A 1OKKA 4F91B 2O8EA 1CU1A 2PMDA 1EFTA 2QM8A 3A8JE 3QPWA 1XNJA 4LJAA 5G3ZA 4JI2L 2P5TB 2VH5R 3MD0A 2O8CA 1XMJA 2CJWB 2EVWX 2IUSA 3EZ7A 2G77B 2XNDD 4P31A 2VHTA 3SBDA 4EQ6A 4A3GH 4XVRA 5DH9A 1E2ZA 4I1SA 4JVSB 1WFQA 2DUDA 2ZYUX 3UXMA 5L3QB 3R8FA 4QRHA 1HCZA 1NBMA 5K8TA 4D4MA 2O0KA 4WA7A 5J4LA 1NE3A 2ZTEA 3SQWA 2VSFA 3M0EA 3MJRA 2IX3A 3F2BA 1N5IA 3TQCA 4EX5A 1EWRA 2JJ8A 5CIWA 3J81j 1BO6A 2Q3MA 4L5RC 2RCNA 5J4HA 3WBKA 2DNCA 3UMRA 5HZHA 1E9FA 2RGNC 2UUAQ 3CX7A 1EUJA 2L5TA 5BQ5A 1UWVA 1WCMH 4GLXA 1D5CA 1E9AA 2C95A 1B0UA 4OKSA 3CCRA 4B3XA 2B3GA 5M5YH 3B5JA 2IWHA 4JL6A 3T12A 1Z22A 1A6XA 3VU9B 3HOVG 3BOSA 2UXDL 2OUKA 1E79A 4BY1H 4HSEA 2WWWA 2Z4SA 4PANA 1E99A 1E4YA 2YJTD 3OAAA 1NRJB 2G1JA 4PHTA 1SRUA 2ZTCA 1QVRA 2VUMG 3PQCA 5UKDA 3QKUA 1KIMA 4AKEA 4MRPA 1XNRQ 2B63G 1NVWQ 5HTKA 3RYTC 5LD2C 4XVUA 2DHRA 1V5WA 1QHIA 3OFND 2BE5D 1MO4A 3IO5A 3E70C 2ZI5A 3E9HA 2BC9A 2ZJ8A 4KFUA 2QEQA 1IHUA 4QGFA 4OQMA 3WMEA 5L3SA 4ZCLA 1VQ9A 1E1RD 4D4JA 2CWPA 1NLYA 3RHFA 4Q48A 3IEUA 1LF5A 3GJ5A 2ORVA 4BFUA 4OI0A 1C9OA 3HPQA 1IN6A 4CGZA 3AVVA 2PLFA 4Q19A 1SVMA 2CVFA 3X2SA 4TQUS 1VQKA 3WHLA 3I4LA 3OYYA 4IPDA 1ZP6A 1IONA 4L5BA 1JR3E 4Z51A 3DM5A 4YHHQ 4LF8L 2OG2A 3B2EA 2HIXA 1F2TA 1G17A 2FDCA 3W5OA 1ELOA 3RZOH 2HYIC 4TYWA 4DR7L 1ZC4A 3QI2A 1DCZA 1IYUA 1UE6A 2EFDB 3KB2A 4A36A 1G21E 4TVAB 3VX4A 4C0KA 4MKFA 4C7OA 4U02A 4G7HC 3GJ7A 1W44A 4C3HH 2J7PA 3N5CA 4IHQA 4MYHA 3ULLA 3KFUA 2XSZD 1QG2A 4POFA 3CMEA 1H9SB 5G41A 2IEYA 3CR8A 1NKSA 1OLOA 3BIFA 2VQEQ 1GUAA 2IYZA 2V1UA 3RWOA 3I5XA 1WJJA 1G41A 1UBGA 1NJFA 4KVGA 4DB4A 1E2IA 3H3VH 1KKLA 3KL4A 4PQYA 1EFRA 1FX0B 4CRWB 1MV5A 4K46A 2QBYB 2K50A 2OM2A 4KKTA 5B30A 3OEEA 1JR3D 1R5NA 4EPRA 1XTDA 1E2FA 1KSJA 3BFXA 1W46A 3CF6R 2H18A 4ASUD 2K4KA 2ZUCA 3GJ6A 4C3ZA 5BN5A 1EWIA 2GNOA 2I5MX 1Y69U 3R8CA 5GJBA 1SVKA 2WOJA 3KOJA 5DLQC 4TLAA 1Q86C 5DGXA 3K9GA 1MO3A 2XITA 2XGJA 2WTUA 1YU9A 4D0NA 1PHJA 4LBVA 4GBMA 1ZINA 4LRWA 3WNBA 2AD1A 1YHAA 3NELA 4YCVA 3NWJA 4UY8C 1KJYA 4DT1A 2KWIA 3D0FA 3J81c 2ZS8A 4TMVA 1L4YA 5DHAA 1TUIA 4GRAA 1Z0AA 4NZYA 1UE5A 2PZFA 4DEYA 2BA1A 2QU8A 421PA 4KITB 3TUJC 1G6PA 1W3SA 4XTRA 2CL7X 2JLRA 1OYYA 4LK1C 2WICA 1OSNA 1IBLL 1H8ED 4X65Q 2JJ1D 3TH5A 4QM6A 4DUZQ 3TLXA 4HAYA 4KLNA 3WRYC 1DAKA 3U4QB 3QVVA 2CDNA 2Y0SG 2QE7A 1N5KA 2NZOA 3G48A 4QL3A 2UXBL 3K0EA 2QAGC 4OO1H 2MSCB 2C5LA 4A2WA 4QXAA 5HR5A 4JI5L 1PLKA 3Q8XB 4DK1A 4G3XA 1LNZA 4HLQB 3EAQA 5DN6A 1VQ4A 2GJ8A 4DIDA 3LVQE 3MWYW 4MA4A 4URWR 3MXUA 4UNNA 4HAVA 1GUOA 5C4XG 2QNRA 4JVLA 2REBA 2ZEJA 4LJYA 5DYGA 5JS7A 1E2HA 2JA1A 4OHWA 5CYOA 1P73A 3MGCA 2Q2IA 1KI7A 5SZHB 4FMCB 4LX0A 4JYAL 1SXJB 4KO8A 4A3DG 4D26A 4GFDA 2WZQA 3IIKA 2IS1A 4BBSG 3AB9A 2A5DA 1VCMA 2XJ9A 4PO1A 5C44G 3CF0A 3O8CA 5IYCH 1CJVC 4HAUA 5EE3A 4RKFA 1FMLA 3U2QA 2NZJA 1U8ZA 3LD9A 5KSPA 2D7DA 2NTYC 1D7QA 3MCAA 4NCNA 1N5LA 1NBWA 3HOWG 1EQRA 1G7SA 2FFHA 3DMDA 3B8HA 4L9SA 3ZIAA 1ZNYA 3AB3A 3DEFA 3I92A 4DDWA 5CITA 4QFMA 4RSGA 3LW8A 2NVQH 1GUNA 4GOPA 1JXOA 1K8RA 1YEZA 2YU9H 2WWXA 3AKDA 4PHFA 3FKSD 1YZNA 1W36D 1U0JA 2MSDB 4JI7Q 3K1JA 4NYJR 1E96A 4JLJA 4R4OA 4AI6A 4DR2L 5J4YA 1Z2AA 1HTPA 5BR8L 4OJKA 4ZO4A 3NHBA 2NIPA 1GD7A 4JS0A 3SEAA 1BKBA 5CM8B 2ERXA 1Y8NB 3TW4A 4A1FA 2W6JA 4Q5IA 3TQYA 1BBWA 3DOEA 3QKSA 4I81A 3PEWA 2R8RA 2RKOA 3MLEA 2ZYWX 1KI2A 4JMPA 4BA2I 2A19A 3UIEA 1UM8A 4YMUA 3U60B 4ACBA 1WBDA 2AXPA 4EUNA 1QHNA 4PZ8A 2JLSA 3AFPA 1QHXA 1CR2A 1ZUNB 2ZI4A 3K0SA 1P4SA 2IHEA 3ULPA 1R7RA 3L0PA 2JEAI 3L8ZA 3K80C 4JVNA 3OE7A 1XZPA 1RE0A 1ZD8A 3U3MA 1XMSA 2A1AA 3LAWA 3L8YA 1VQ7A 3L0OA 3M6AA 3X1ZA 1BOFA 2QPAA 4UPAA 2MNAA 1IY1A 1VHLA 2PX3A 4LPSA 4WBSA 4BFZA 2RHMA 3CF5A 3QKSB 3S1AB 3T1VA 3UWKA 4BZPA 1HNXQ 5C0XJ 1BYIA 3DZDA 4ESVA 4PO8A 3RNUA 1SKQA 3CW2A 1DAFA 2V6JA 4AG5A 2IS6A 3L7ZC 5GAEC 2GJSA 2P67A 1XJQA 4BFVA 3VKHA 4YY3L 4XIGS 5GVSA 3NHAA 1R0XA 3MRSA 3I4NG 4C0BA 4KLZA 3TAUA 4YCUA 2XNDA 3E5HA 4CZ2A 1DGSA 1HYQA 2C78A 5E7JA 2OHFA 4BUJA 3ASYA 2QMOA 4FCTA 3I56A 1PUJA 1AGPA 2JA6H 3WNDA 2CQOA 4O0AA 3PIOA 1C9KA 1HTWA 2WWIA 3QG5A 4TL8A 4V03A 4A0GA 1ZC3A 4R1JA 2QN6A 1G3IA 1GWNA 3W3ZB 3ZVNA 2YOHA 3E1SA 2KHJA 4JI2Q 2VS1A 4JBWA 2ORIA 5A5GA 2JA7G 5BYKA 5JSZA 1KO5A 4DKAC 2XB4A 1NG9A 3OHMA 1E0SA 1Q1ZA 2A5YB 2F43B 3QVUA 1VCIA 1YZTA 1JMCA 2Z43A 3PITA 3SGIA 4G5RA 2GZAA 1E9CA 3QKTA 3VHXA 4A3GG 1KI6A 2PT7A 1MJCA 5BYJA 1BIFA 2GETA 1TTTA 1XEWX 2O0JA 3AP2A 5AJWA 3T34A 5JRZA 4WZ6A 4YDHB 3AGPA 2PX0A 2FSHA 4MYUA 1L4UA 1VECA 2P6NA 5C1BA 1BMFD 1FNMA 2H5XA 4NCKA 4E09A 5HKKD 1WB9A 3F1ZA 3AV0B 3CPFA 4LNQA 2ZRMA 1B70B 1HZBA 3OFNA 2RGXA 4IDHA 4LV8B 3STBD 2GVAA 2VF8A 1IBRA 1HNWQ 1E94E 4M1WA 2A30A 2OAQ1 3AF2A 2E1RA 3V4RA 1E1RA 2FSGA 1Z6XA 1PUIA 2DBYA 4IFDI 2ORWA 2VHQA 3EXAA 3NIBA 3OW7A 1US8A 3HP1A 3P27A 3H0GG 4PTLA 3UATA 3AVXA 4TYQA 4TT3D 3H86A 4PC7A 3CO5A 2EXDA 1P16A 1CFMA 2RH5A 5CDFA 4Q1EA 3TW8B 1LACA 2ZYVX 5FUYA 1OB2A 4LF6L 3R9XA 4JV5L 2UZIR 4F4JA 4B6FA 2AHOB 5DIFA 4M9SA 4Q1DA 3O8DA 5K8UA 3FTQA 5JWHA 3R7WB 4B3RL 2JLZA 4DLUA 1DPFA 1KZGB 4PG3A 3Q7QA 3Q9LA 2N78A 3MUFA 3I72A 3HU1A 3A8IE 2XX3A 1X3FA 1Y8OB 4IQZA 5AJ3L 1O87A 2A5GA 1Z6AA 2PNRC 5EP3A 5LMUQ 4A3FG 1E2MA 2O52A 3D6TB 1G8HA 2OBLA 3CPHA 2RGBA 1RRFA 4IVRA 1KGDA 3CC7A 2BEJA 2OSBA 5KUTA 1Y14B 2DCUA 3I4MH 2FNAA 1NN1A 4BXXH 1Z0KA 1KXLA 2HV8A 2X19A 2YKGA 2WM9B 1EXMA 1RFLA 3CRW1 3RC8A 3JAMc 4TLDA 3TVDA 4OK6A 4HB2A 1II0A 5TMPA 4A3BH 2HJGA 2FMXA 1G19A 4LF5Q 2B8TA 5CK4A 4P73A 3VR4A 4BECA 1FZQA 5IP9H 1DARA 2QY9A 3MAAC 1P2SA 4M8NE 1Q12A 1NJGA 4P33A 3THYB 121PA 2RGGA 2D0OA 1RVDA 3BERA 3PO3H 2F1JA 1KKMA 5JEAH 3IDQA 3F3YA 4NYJQ 1EFCA 3HKZE 1I50H 4F4IA 1RJ9B 3HOXG 3TREA 2QP9X 3AUYA 3GFPA 2AUJD 3OTOL 3AVOA 4B76A 5JMTA 2VF7A 3FKIH 1OT3A 3AVYA 2RF4A 4RD6A 2E2IH 1CEEA 3IQWA 1G16A 3U7GA 3GCGA 4APVA 1K8GA 1VDZA 2V7QA 1AM4D 4KFSA 1VKJA 1G6HA 5TVKA 1XEXA 4DZZA 2ECKA 2W00A 3OPOA 1KRTA 3P4YA 3CCJA 4A3EH 2WSMA 5H1YA 1HA3A 3MFYA 2I5LX 1KK0A 3B1ZA 3PEYA 2I4IA 5FBWB 2PJZA 1H8EA 2JJ1A 1KDTA 5F98A 3BU2A 1LFDB 2BJVA 3I2ZA 3RVBA 4DLVA 1CULC 4DHEA 1KAGA 4PR0A 2IXEA 3ZGXA 2QA4A 4Q01A 3ECCA 4ZIRB 1DVRA 3EIQA 2QF7A 3NBYC 4LZZA 5JBQA 4K0KQ 2JLUA 4LGMA 4HUTA 2KE5A 4AYBE 2YC2C 3T15A 2ZRPA 3K09A 3ZD7A 3TR0A 2GXUA 4JLVA 2G0NA 3B78A 4Z54A 1XTJA 4KU4A 3IBGA 1VYVA 1IBLQ 4DLRA 3I5YA 2ZUDA 2F3TA 3HR7A 1XF9A 3SFZA 2CNWD 3OIVA 1LTQA 1SGWA 4BLTA 3I55A 2BDOA 1G5PA 1UBCA 5EXPA 4HLUA 1WYDA 4HLDA 4ZDKA 3AKYA 1R5BA 1T8TA 4E22A 1OTCA 4RG1A 3MEFA 4LJZC 1DADA 1R5OA 3SHFA 4LYFA 4OHYA 2HT6A 2WJIA 4B35A 2CE7A 3C16C 3QENA 1MABA 1KOFA 1NIJA 3LRPA 2ZR0A 5DNYB 1CTMA 4A3CH 3U9SA 1K8MA 4C3IH 1S1MA 8OHMA 1DAGA 4GZLA 3RN5A 3T56B 1I6VC 2WOOA 3W8RA 4OO1G 3K9HA 1T5EA 2JA8G 4M0LA 4M9ZA 1GM5A 4PFSA 1N33L 3M4YA 3DLLA 1OIVA 1SHKA 4FCVA 4FMDF 4QOSA 5FTMA 4DCVA 2EYUA 5JCPA 1E2KA 3KLRA 1KJWA 2WIBA 1AZSC 2EQBA 3TBKA 1TXYA 1J8MF 2O8DA 2RMKA 2WB1E 3NVAA 1GRNA 2LWIA 3RZDH 1G3MA 3FKSA 1N3BA 1Z7TA 4C2TA 2K5UA 5IE8A 2NVYH 2ZRLA 4ZCMA 2G1KA 2BH8A 3SC3A 2QAGB 1LW7A 3NEMA 2I5HA 2IHFA 2DFKB 2DR3A 2AXNA 3W5IA 3PV0A 2OQ0A 1X6VA 3S15H 3SZRA 3GLHA 4M1KA 3HOYG 3KJOA 3KTAA 1RRCA 2N49A 1SHZA 1X54A 4MYTA 3BB1A 1PH8A 3GLFE 5LMNW 5DI3A 4Q9HA 4C0LA 4GOPC 1KQSA 3GTJH 1FJGQ 3PR1A 1QUQA 3C5HA 4QC2A 2CCGA 4ZDIA 4HJAA 4PZ6A 4CEHA 3N2EA 4D82A 2Q2UA 2ZRHA 3PVSA 3KF6B 3J81i 2RB4A 4FXPA 1VQBA 1T9HA 1XFAA 2D06A 2HJVA 4XD7A 4Z8XA 2EVBA 1QHYA 2QA5A 2IHBA 2GCPA 4X64Q 1VPLA 2Z6VA 4V0ME 2CHGA 4EPXA 3U6KA 2WAQG 1FFHA 1GJXA 1CS4C 1TWGH 1M7HA 2GKSA 4HB4A 3PUZA 1ASYA 1W49A 2A8VA 2VBCA 3QJYA 3F5FA 4V0OA 4JG2A 1UKYA 5FTLA 1VG1A 2FGKA 4GKKL 2VP6A 4UKDA 3UWOA 4ERNA 2PH1A 1CRPA 2PMKA 5FBVB 4DDVA 4KYIB 4ZCIA 4GLAC 3QXXA 4IDOA 1L1OA 1QHSA 5FUVA 1JNYA 3W6NA 1CUKA 1SROA 1N6LA 1P3JA 4UP9A 3FP9A 1Y1WH 5D3MA 4GN3B 4B3SL 2ANCA 2IK8A 4HYYA 4PZZA 3C8UA 2QGQA 3CUEF 1XXHA 5ELNA 3S1MH 2WHXA 3K7AH 3KDSE 4FMBB 5K8IA 4P4UA 1VQJA 4H02A 1U94A 3W9YA 3AYHB 4LBZA 2EDGA 4OWWB 1KSFX 3DM9B 2W6ID 3UG7A 5JI3E 1R0WA 1KD1C 4LFCQ 3AFQA 1UEBA 4YY3Q 3GTGH 2IX0A 1R8SA 2FG5A 2OFWA 3RS2A 4X8OA 2KCMA 4DK6C 2A9KA 1JJCB 1JXMA 1JJ2A 1XTKA 4D2IA 1G9XA 3ULJA 4EQ5A 2XZLA 4MDEA 2A6HD 2PI2A 4ESHA 3PG5A 4RFVA 1RYFA 2YZ2A 4DV5L 3HJNA 4DUYL 4HJ7A 1JPJA 5DE3A 2J3EA 2KBNA 1P8LA 2IA5A 3AUXA 1SULA 1S3SA 4OI1A 4ZV4A 5LMNL 1I2MA 3KFVA 1F60A 3M4OH 1C0AA 4PSVA 4TTQA 1GSIA 4ZKEA 1F6BA 3DDCA 1G3QA 1P61B 1ESNA 4KBGA 4DCUA 2AMCB 4RZ3A 1BMFA 3I1FA 3I32A 4LWZA 3IRBA 1M7BA 2NQ2C 1E1QD 1PLJA 1WXQA 3GJXC 1TF7A 4DCTA 2GVBA 5A0FA 4DJTA 1EIYB 3CPJB 1IXRA 1Q81C 5GADC 3EIEA 3WWVA 1V43A 2WIAA 1E2NA 3ZS8A 4A76A 2I1VB 5C4MA 3HU3A 2QT0A 2D62A 4FI3C 2DFNA 1TX4B 4LFAL 3LQQA 2XZOA 4TT3A 4GKJL 2R6DA 5AK0A 1KTVA 2I0QA 1S3OA 3CLVA 3SBEA 1G1MA 4JBYA 1H65A 1KK2A 2OBNA 2VIIA 5SZIA 4IOCA 3WHKA 1IN4A 2EJFC 4QGHA 2FPKA 3QOFA 2DWQA 2QM7A 1L2TA 1NI3A 2BKEA 1B8AA 1TF2A 5EUQB 4JI4Q 2ZRCA 4LHVA 4Q4HA 3ZQ6A 3TK1A 2KB0A 1H9JA 1NY4A 2HYDA 4LHXA 4R71A 3AEVA 2K5NA 5HCIA 1HH2P 3KXKA 5J3BA 2BBOA 4JL8A 2JXMB 3CPEA 4DV6Q 1E2DA 1QVAA 2GJ9A 3CONA 2OTLA 1F2UA 3T06B 3M85A 2JEOA 1EFUA 4DK0A 2WJHA 4K8OA 4LJ4A 4CT5A 5KU1A 4LF6Q 1CSPA 4JV5Q 1G5RA 1UE1A 1E2PA 1PH3A 2FX3A 2KENA 2V55B 1OIWA 2XTMA 2HEIA 3NH9A 4NPHA 1E3PA 3VFDA 4B3RQ 4RCNA 3W1GA 1M2OB 3B7GA 1OW3B 3J81k 3QXSA 2ZJ5A 2O8FA 2KSQA 3EASA 4Q4JB 5C0XH 4YMVA 4OONA 4QGUA 4H13C 5AJ3Q 3U61B 4BLSA 4IFDG 3FHWA 3N2IA 4XWKA 4W5HA 3F8TA 3WMFA 1S9HA 3K0AA 4QHSA 2PNHA 1R2QA 3LQRA 4ZDWA 3W6OA 2A69C 4LHZA 4NYIR 4RD3A 2NO9A 4ARZA 4YWLA 4YXWD 4DR3L 3UMFA 3QF4A 1W2HA 3FMOB 4A8JA 4URVR 3WXMA 1E2JA 1S40A 1VG8A 5B2ZA 4B6EA 5JEDA 2ZSEA 1SZPA 1XMVA 4DV1Q 2EFCB 2NGRA 4FMCF 4M1TA 3OIWA 2A6EC 4P4SB 2GCOB 4A93H 1Z3IX 4DLWA 3H2YA 2C77A 1IL2A 3O8BA 4V0NA 4XVQA 4HDCA 2QTVB 4MRSA 3RAPR 5E7IA 1B9NA 4CEIA 5KSYA 4DKXA 1JEEA 2GBLC 3B9PA 4Q02A 2BM1A 2VHJA 2HQLA 2ZE7A 4JI3Q 2OWOA 3OTOQ 2WFWA 4IFDJ 1I2DA 4AKHA 2BMJA 3A5UA 4CVNA 4Q7MB 1T6NA 3CCVA 1Z6YA 1ZNZA 2P0EA 3QG1A 4IRUB 3ND8A 4Q4LA 3GLFB 1W0JD 2OEPA 3A36A 4I1UA 1EWHA 1KI9A 4JI0Q 1KO4A 2JJ2A 2QSYA 3REFA 3ERSX 1U0LA 2YC4C 2BKUA 1IXSB 1RL2A 2C04A 1MRNA 4BFXA 2D0PA 1X1SA 4PZ7A 2FJUA 4BLQA 5JRJA 3B85A 2Q3HA 3LFUA 5KYKA 3J7A5 4NXNL 1R6BX 5M3FG 4OYHA 4QGAA 3I7FA 3BBPA 5CJ2A 2XTZA 2H5EA 2VW9A 2EU8A 2R92G 2O8BB 1WOCA 4FIDA 2UXCL 3CX6A 4GMDA 4TMXA 4A2QA 3BRWD 2PPBC 1W4AA 3BB3A 1G8FA 4QBFA 4RFSA 5KSOA 4JIMA 1X8LA 4Q4AA 2NMVA 4GNXB 2ZJQA 1T3LA 2QRZA 2WPDD 4Q21A 3PJRA 1FPMA 1ESMA 1R8QA 4RZXA 2J87A 4XWAA 3K09C 3CIOA 5IK2D 4BLOA 2OXRA 2QQ0A 2PQAB 3IGFA 1IW7C 1H9RA 2VL6A 1SXJD 4R7ZA 1JJ7A 3LLUA 2A3RA 4NCHA 4OX9L 2K5HA 1Z28A 3IIJA 4A0FA 2ODEA 1WBBA 1XX6A 1FVIA 3WDNA 5IYDG 2I1QA 4HLUC 4IDQA 4RD1A 4IPGA 1HEIA 1RIFA 1Y1VG 4G0NA 3L43A 4EJSC 4A82A 2B6HA 4DR1Q 4B73A 4XTCS 3UG6A 4DC9A 1GUGA 4XJXA 1VHTA 4BRUA 1VF7A 1XPRA 2VL7A 1TU2B 1QBKC 3CR7A 1BYUA 3NXSA 5D3QA 1FP7A 4C9BA 4FWTA 4GL2A 1PH5A 1ZAKA 1EIFA 2OLJA 1KY2A 4QHTA 5KDDA 4O2LA 4M1OA 1ZUHA 4WZBE 4KVAA 2G88A 2QPTA 5K36H 1ETUA 4US0R 2QP3A 4G7ZC 3RRYA 2NN6H 3U4ZA 1ANKA 4R9UC 3U7EB 2E74C 2YTYA 5FLXc 3PF5A 1G4AE 2IL1A 4S2EA 5TV2A 1O78A 2JDID 3B9QA 2WWHA 4WW0A 5AR1A 2TMKA 3L2PA 4Q9KA 4KI0A 1GP2A 1M34E 1N0VC 2REXB 4LFBL 3A37A 1PA6A 3HU2A 5A35A 3GP8A 1DTSA 1N0WA 4GT1A 3PSIA 2FZLA 5H8WA 1TPZA 2G0TA 2JATA 2P3SA 2A2ZA 2IYLD 4D6PA 1SE8A 3NC0C 1CJKC 3H3VI 2QTHA 2ZS9A 1JQLB 4WZAE 2E9SA 2QP4A 1U5KA 3TUIC 3TEHB 1NMYA 4P32A 2JIZD 1XMOL 4HUQB 1XCMA 1L7VC 1AE2A 3W1BA 4DR5L 1DO0A 1TNDA 3P32A 4XSHA 5IP7H 1WI5A 4NB3A 3BORA 4D0GA 2IWRA 2XGTA 2B8GA 2DFTA 3Q7PA 5L3RA 2CL0X 4TKOB 1P62B 2ZRDA 1AQYA 5CK5A 4A0HA 4MGZR 1YZGA 4HZUA 3IIMA 2IXGA 3M4QA 3C5CA 1U9IA 1X55A 1GNQA 2R6CA 3QPVA 1IBML 1LVGA 4H1VA 1K3RA 1X56A 2AKWB 4LHYA 5EE0A 4PO9A 2UKDA 4TN1A 2CJWA 2CBZA 4MGIR 4GKKQ 4YDSA 2PL3A 1EX6A 3CF2A 3V4FA 1NP6A 3LBHA 1L0WA 2EJGC 3T1QA 4US1R 3A58B 2KCTA 1ZU4A 5L3QA 5EXSA 4NPSA 1AS3A 4MITA 4ZKDA 1ZIPA 3KKPA 4DIEA 4B3SQ 4NYIQ 4V0KA 1OH5A 1XU4A 2A5JA 1Z6GA 1YR6A 2ZREA 1KSHA 3AKEA 1TKWB 2R7DA 1VQ6A 2BMEA 2HCBA 4DSNA 1HPCA 4DUGD 4HR7B 1M74A 4KKUA 5SZKB 3EIVA 3VR1A 1PH7A 1R0YA 3MXNB 1ZIOA 1JB7A 3KXLA 3OESA 4OQNA 4RD2A 4CT4B 1N8RC 3D31A 1E98A 3PO2H 2C9OA 1NSTA 1HH4A 1Z47A 3DPUA 3AF3A 3D3QA 3PCRB 3T53B 1DD2A 4OO1I 3K70B 4DLXA 3S1NH 1YIJA 1CKEA 1FTNA 1KI4A 1VQIA 1IXZA 1OFTA 3VU9A 4A3MG 2K7VA 1NLFA 5LPNA 1Z6HA 1I3QH 3H0KA 1E1QA 5L8VA 5FI1B 4IEEA 4X66L 3SFVA 5E4FA 2FU5C 4TLBA 4B3MQ 5EQTA 1NIPA 1OXSC 3KX2A 5FL3A 2FFQA 2V1XA 4JLDA 5CLLA 3B82A 4LJ5A 3LGJA 4HIDA 2F3RA 3EARA 3LXXA 2F1HA 2A68C 1QDEA 4US2R 1FMJA 2YV5A 4GZMA 5BWMA 1T0HB 4G01B 4URZR 2JLQA 3U7HB 2GVZC 4LDJA 2R93G 3WP0A 2MSEB 4B74A 2AWNA 4PSAA 1W4CA 1Z2CA 1JPNA 2K32A 3AQ4A 1D2EA 721PA 4NXML 1KSGA 1N36L 2F4VL 2J7KA 2Q0HA 4A92A 3VA7A 5FLMH 5J40A 4R2IA 1IXRC 3QXHA 2JLXA 2FFBA 4B2IA 1DAIA 2ZR9A 3GTMH 1TL7C 4GP6A 2ZJBA 1T3HA 2V6IA 1Z9FA 2WKRA 2XOKA 3RWMB 2XAUA 5KNDA 4DV0L 4BY7G 4GKJQ 2WB1G 2ATXA 3HOZG 3CZQA 1TUEA 1JR6A 1YBYA 1NSFA 2UVQA 4TTPA 1GKYA 1D9ZA 4JLPA 2BBSA 3I3SR 2V4ZA 2D4HA 4MDFA 4YWMA 4QG7A 521PA 3KLWA 3Q3JB 4QJ3A 3THXB 4P0TA 1SR3A 4C4PA 1BDOA 2V3CC 3NDPA 4A3KG 1XRJA 3DKVA 4MKIA 3TR5A 1H8HD 2Z6KC 1ZM4A 4RY2A 3UE1A 4DSUA 1H9SA 1K8OA 1XBTA 3KQUA 3ADKA 1ZKOA 3CC4A 3T5GA 1MO5A 4KKSA 1AS0A 1ZM9A 4MH0R 4DDTA 1YRBA 3MMPA 2LKDA 2GHIA 3LVRE 1GIAA 1FX0A 2GZDA 2VY3A 3CX8A 4UP8A 2I3BA 1E4VA 1K6MA 2R6FA 4TMZA 1ONBA 3TVTA 1IAQA 2HDNB 4YXWA 4JT4A 3I61A 1E0KA 2AFIE 2ZETA 5E95A 2Q8IB 2UUCL 4DR6L 2C9CA 2VP2A 3SDZA 2YTXA 4LC0A 2EJMA 1RRPA 5DSZA 1U81A 2OQKA 1OH8A 1O7IA 3ZH9B 5C3EG 1N6HA 1ZYRC 5FFMA 1ASZA 3RS5A 5KSZA 5BXQC 5KO2A 4BPBA 4DV2Q 3BFKA 2ZE8A 3SYNA 4JZKA 1CJTC 3NG1A 4N0EA 3CB4A 4Q1AA 4DR3Q 2XEXA 3U3JA 2EFGA 2NO6A 4ZPXA 4DR4Q 4TLEA 4POGA 4IW3B 1KIXA 1XEFA 5EUMA 3PUWA 4W9MC 3FMIA 3NC1C 1OH7A 4PXAA 3BDOA 4HLCA 2R7ZH 5DLQE 1N34L 5GAHC 1QHHB 1S3GA 4AG6A 1CKOA 2R6AA 5CM9C 4DEXA 2CXXA 1NVUQ 3K0CA 3NH6A 4LF7L 1I5FA 1W0JA 2YHSA 1XMQQ 3HOUG 3NBFA 4M53A 4MKGA 3SJCA 1SVWA 1K83H 1EX7A 2FWRA 1G20E 4MTNA 1E9RA 2WMOB 1BBUA 4G5OA 1J5EL 4KYUA 5B57C 3VNUA 4A3JH 3OOCA 3U4QA 2WJJA 4OJQA 1E2LA 1CF4A 1KAOA 4JI1L 1N2CE 1A5TA 3ZZ0A 3CRMA 3P4XA 4JI6L 2Q9CA 4IOKA 3CPWA 3CCSA 1K5DA 3UDIA 1GVPA 2DYKA 4BGDA 1GITA 1XJ0A 3HR8A 5KPDA 3KKQA 1MO6A 3KJGA 3GEHA 1C7YA 3FHCB 1ZD9A 5FOXA 4NU0A 1IJFA 5JS8A 3GLGE 2ZANA 1S72A 1DELA 2WPDA 5HZKA 3EPJA 1VG0B 3K0FB 3KKMA 1WCV1 4B43A 2VYFA 5JLJA 3A1SA 2VHUA 5IK2A 4OL0A 1G3UA 1T4GA 4NXNQ 5M3MH 4R4TA 3EG5A 5FTJA 3VHLB 1G7RA 1SXJA 4JI8L 3FMFA 4KHPL 1CKNB 2ZYTX 821PA 2UXCQ 3GJ3A 1MT0A 4JCVE 2WV9A 2DNEA 2JA5H 5FBRB 1AK2A 2W83A 1Q8KA 2IYYA 3DOFA 2V54A 4TMWA 2CHVA 2CWAA 1JALA 4TMTA 2OBMA 4AURA 1UEIA 2FXQA 3IHLA 3PGZA 1GAJA 1Q1BA 2FF7A 3E9IA 4B3FX 1AKYA 4D0LB 4EFLA 4F4CA 3VQTA 4LJ8A 4EDHA 2BOVA 4A4DA 2J1LA 1Z06A 3CQZH 1M1KC 2E5LL 2UXDQ 1NN3A 1P6XA 4LHWA 1G4UR 3GJ0A 1WCMG 1XWIA 4JKYA 2X8AA 1CBUA 3RLFA 2FOLA 4BBRH 3G82C 4JLNA 1GVNB 5G40A 1R9TH 5IYBH 4IO9A 1Q82C 4TL6A 1CJMA 2CW0C 3H15A 2EFEB 4BY1G 1AA9A 1TAGA 1Q90A 4XSGA 3TZUA 2QROA 1U90A 1C4OA 4FN5A 1IY0A 4PSKA 1J6QA 4MRRA 3THWB 4TZ0A 3VNVA 5CB8A 2H57A 4NCJA 3NTUA 1SQ5A 4EPYA 2UU9L 2PZEA 5K8LA 3MJHA 3CH4B 4O3MA 1D2NA 1C1YA 2QAJA 1E9DA 4D81A 2BCGY 4ZI2A 2F6RA 4D4LA 3TKLA 2D2FA 1NMZA 2QMUA 2JIZA 1PVOA 2XSZA 3B1VA 5EE1A 4UNRA 1COWD 1ZNXA 2HF8A 4LF8Q 1YITA 4LFBQ 1OXXK 2K5VA 1KC8C 2BDTA 4JLBA 4EJSB 3S1AA 3ZQJA 3J7ZC 1XPUA 2X1VA 1G5TA 3GO5A 4DR7Q 3GLIB 4KJZA 2ZAMA 4UJ5A 3T1HL 4M1YA 2AL7A 4PC3A 1VQMA 4NCIA 4A6XA 3LWNA 3VR5A 2ZIAA 4I1OA 3K7UC 3QE0A 2YNMA 4YMTA 1E3MA 1FQJA 1JR3A 2VQSA 3BJUA 4A3IH 3TQFA 5TARA 1FW6A 3F0TA 2WJGA 3LV8A 3KUDA 1A0IA 2C03A 4DR5Q 4GSYA 4HEJA 3SJAA 4ASUA 1I94L 1WMSA 1Z8FA 5F9HA 4IOLA 2RGEA 4UNPA 1DAMA 4P4TA 3QSYA 4FCWA 3U7FB 3A7LA 2H8KA 2PEYA 2N46A 3BJIC 3SJZA 1KJZA 1Q1QA 4O25A 3ZLJA 1EESA 4F93B 2FV8A 5JECA 2DY1A 4JVMA 5KDOA 2XZPA 3A8KE 2HUPA 3PFIA 4C0QC 1AZTA 4TTRA 5E7NA 5EZ6B 2AWOA 2GVDC 5FJ8H 2Q3FA 2XJ4A 4BLPA 1IBMQ 3BH6A 1YI2A 5AJXA 4BZQA 1HURA 1SN8A 1RRGA 5FOWA 4DUGA 4EIWA 1II8B 1F3OA 3EWSA 4LF9L 5FBLB 3EZ6A 3LX5A 1KMQA 1CIPA 4L5SA 5FPHA 1VCOA 1X8JA 3QEJA 4B2LA 2P6RA 3A74A 4A9AA 4B75A 2F43A 2B7BA 1Y3AA 1Z0IA 1BS1A 1ZNWA 4GN5A 2VP0A 1CRQA 1HQYE 3CKLA 3U44B 4P75A 2VO1A 5TB5A 1E2EA 2LCFA 1XNQL 3DKPA 3CXCA 3OEHD 1K5GA 4EFMA 2J59A 1HQMC 2FZ4A 2R6GA 3U4VA 1T3SA 3CRQA 4YWKA 1BH2A 1JBKA 2YOFA 3UANA 1E0AA 4L5QA 3VR6A 4IOMA 3VX3A 3PF4A 4WAUA 1VQCA 1NBME 3NBXX 4NKRA 1JB1A 1HV8A 4UXHA 1HY3A 3F2DA 2KJQA
chains in the Genus database with same CATH superfamily
3WL4A 3C98A 2CZCA 3AF4A 1TCUA 4DAPA 4OQXA 3GVCA 4HCSA 4LJ6A 2GAIA 4RVGA 1NBIA 3JYQA 2X5NA 2P9ZA 1N2JA 1SNMA 1XTRA 2IW3A 2P2LA 4GC9A 3V8RA 3L18A 1X3EA 2P8JA 5J4KA 1TVCA 4KD4A 5IYCG 2LDXA 3Q6NA 5FJJA 2LIVA 1RS0A 3TSZA 5CA0B 3LTEA 5KCZA 2O3UA 3I04M 3K9NA 3OKAA 2RHHA 3L3OC 4AMBA 1KMMA 3MWKA 1Y4SA 1KEEA 3WGJA 1VGQA 1AHHA 4QZVA 4M37A 2HRRA 3PQIA 3QVGB 3IVGA 3Q8WA 4BNFA 2P5UA 2EKZA 1HTTA 3E0JA 2W8BB 3CUKA 1JECA 2EW1A 2WUEA 4BCDA 3W6PA 4B3TL 1Q1GA 3CC2A 1ZGHA 1KK1A 4EMUA 2VPPA 2W2QA 1PH4A 4N6GA 2ZSBA 5C4XH 5B3JA 1KYIA 1FOEB 3S68A 4JJZA 3OUTA 4DSOA 2F1KA 2QTCA 2QTRA 4CM9A 3KF6A 2FPLA 4YA6A 3VPGA 3T3OA 4LBWA 4KZPA 4BRWA 2QWXA 1U0TA 1EX1A 3VGPA 3U3RA 2B8NA 3TNFA 1DJRD 3IX7A 4JBLA 2KLHA 1BBXC 3E2IA 2K33A 2E2JB 1F8UA 2EKDA 4IHAA 1Z33A 5EQDA 3KDPA 2QEXA 3GQBA 4ZCSA 3EFHA 4XUEA 4LSZA 3V3TA 2YMLA 5IKEA 3AXTA 3FRIA 4MRVA 3NHUA 1IWPB 1FMTA 4N1AA 4NG5A 3EUAA 3DHVA 3TNYA 2R48A 1YHZA 2W6JD 1F2TB 4DNOA 5F1KA 3K70D 5C44B 3I4NH 1CT1D 4JBMA 1B43A 2P6UA 4AJ2A 1T26A 3I4OA 3KYHC 3X44A 4U7JA 3HOWB 1ZRMA 3LYUA 4FU0A 4H4EA 1V9PA 1CDDA 3EFOA 1RC1A 1DO2A 2VZAA 3T5MA 4YAOA 5JCXA 2P0AA 1BS9A 3BG3A 1DCTA 1C7IA 4A3LH 2M32A 1DV1A 1RLTA 1ZW1A 4MR7A 2VRWA 2Q1TA 4FX5A 4GR4A 3HEMA 3OECA 4LC1A 3FCXA 5DGTA 1I2AA 2XN9C 2VPXA 3PNMA 2OOSA 3EZ2A 3DFZA 1Y34E 3GJRA 3KE9A 1UEJA 4TXLA 1FNNA 1Q44A 5KYTA 1Q0TA 2W48A 1EHYA 2AOTB 4FFWA 4NESA 5JISA 1IEVA 5LYJA 4Q3AA 5DHFA 3SEZA 4D9FA 5LMUL 1V1PB 1KK3A 2CV1A 3WZLA 3K53A 1JU3A 1DKLA 1WZIA 2ZVJA 1FB5A 4NBVA 4ZO9A 1NHWA 1EG7A 3AONB 2RAVA 1YDFA 1MGOA 3PMFA 1AQIA 4J7CA 4GOPB 4QYMA 4C20A 2W2KB 1CK4A 5EIOA 3JWPA 4RH6A 1MB0A 3E9DA 1RCVD 3K8ZA 3FVWA 5C4JB 3DLCA 1E7ZA 3KUCA 1TQ4A 1Z9BA 3MMXA 1CF2O 1TU0A 1FU7A 4MJLA 5AW0A 3UMGA 1E1LA 4A3FB 2OTJA 4DV4B 3DKRA 4EUFA 3FJ1A 2W2XA 4X3CA 3A3PA 2F9MA 5M2QA 2JCBA 1JSXA 3DEZA 4CKXA 4LUOA 4YJKA 4HIOA 3RC1A 2IH2A 3QELA 4LMBA 4G5GA 4X7PA 1EWYA 3UGKA 3AQQA 3T8YA 3FA2A 4PW0A 1L3BA 3RC7A 1XKQA 4RIIA 1B0AA 4ER0A 2NV2B 3FMPB 2FUG6 1Z75A 2BR4A 4G8CA 4DN4M 1X2EA 1OH6A 1J0DA 4FE7A 1CNMA 1P2GA 4QEKA 4LS3A 4HAIA 1TYEB 2ZBGA 1BJKA 3GI1A 3NGMA 4ZOCA 1P7YA 4WJLA 1H2AS 2WT9A 4LG1A 4PC6A 4XX0B 2WWFA 5HE9A 3BRWA 4C3OB 3IUQA 3L5KA 1KL9A 1Y3HA 4MUEA 2G9DA 2NTTA 4LFCL 5FORA 4AU1A 1ZOIA 3FPPA 4AIMA 1GTVA 2Z9HA 4PEVA 4X62Q 1P2DA 2W7TA 2J0VA 3O7WA 2CNLA 2K2QB 4MVJF 2YN0A 4PWYA 4G1MB 1EFAA 1YHBA 1H2HA 2AQ2B 3ESCA 2FPXA 4D44A 5DM70 5JNUA 4CU2A 1GUZA 4FZJA 1E2QA 3DMHA 1SVLA 5AHXA 2WG0A 3GTKH 2HDLA 1CT9A 3KQNA 1H6BA 2QXTA 4EPWA 4DCNA 1WD5A 5A5VA 4WBNA 5FLXL 1UBHS 1ZUIA 1ESDA 3C3YA 1W48A 1MZPA 4IS2A 4JYCA 1ST3A 4CMEC 4DIOA 2ZRGA 3OW2A 3F71A 1PTJA 2CJPA 2FJPA 3E0QA 4AI6A 4AQYL 4G9GA 4LYAA 1W52X 1EK2A 5JPMC 1ZQ9A 1FNCA 1MIOA 1E1OA 2ZRFA 4L2IB 3V42A 3R6LA 4UCFA 2CWWA 5BURA 2B4QA 2A33A 4I55B 5M3FH 3DMUA 3KIPA 3IPXA 2Z98A 2JS7A 2ZBFA 1SBHA 4JOBA 4D9NA 1MQ9A 4RKRA 4UCQA 5AP9A 1RM3A 4MVCA 1QYRA 4MVJM 1EDBA 2B34A 4WKCA 3A1UA 2L1BA 3QF7A 2PVSA 5DWVA 4DLYA 1WB4A 5BSUA 2AUMA 2UUBQ 4LBYA 3C3LA 1PH6A 4UU0A 2WP0A 3TBHA 2FCAA 5FLMG 1GTG1 1O1YA 2V7GA 3UE0A 3TP8A 2ZJRA 3AJ9A 4LI3X 1L7MA 5T67A 3PEVA 3EUFA 1SMYC 4W9RA 4D57A 1IY8A 3IXQA 3E9CA 1ZHOA 5LJLA 1DIHA 1Z39A 5E3FA 1RZ3A 5EP1A 2ZVPX 3P96A 4QOJA 1KP9A 1ADCA 4EOGA 1RIIA 1F7VA 3N75A 3HZOA 1NMFA 1YOBA 1H3EA 1R4MB 1TMKA 3B48A 2FPGA 3AH8A 1JSRA 5KB3A 3U50C 4CKCB 2Q7OE 3FPJA 3PT5A 3VR3A 2Q1SA 2OY0A 1Q6YA 2JI4A 5CRIA 2N1MA 4EEZA 4A3MH 3ZD9A 2AXEA 4C2MH 3RUZA 4QBTA 1TWHB 3Q8DA 3M5DA 2E85A 1G6Q1 3D8HA 2F67A 3GPBA 3GXOA 3QFHA 3OIYA 2J9YB 4DLTA 5HPYB 3O95A 1Z29A 3COJA 5CD9A 3TXXA 3VDNB 1FY2A 3N28A 5HSGA 1ZMBA 1YZLA 3HN2A 3KKNA 2DAPA 5HIJA 1GILA 3FNBA 3H9EO 3WYNA 1WP9A 4BNIA 2K75A 1UJNA 2D1FA 3SC2B 4P82A 1S2IA 3B1JA 3FPAA 4CF4A 1OXBB 3EN2A 1E89A 1SE4A 3IAHA 4DMCA 2XQIA 2Y3IA 3IRVA 1WPXA 3L8DA 3T5DA 2QRNA 2FWJA 4YR9A 1EDDA 1SFOB 4B3BA 5HKAA 1RHUA 2ON6A 4JEMA 3JR3A 4AZWA 1QF9A 4G9BA 3OTOB 5JZ9A 4ZWNA 4NFSA 1G8JA 4ZYYA 4TSFA 1WHSA 1SKYE 4YS6A 4F91B 2K52A 1OKKA 4LJAA 4CL2A 1L5ZA 2Y1CA 3WTBA 1JHUA 2IOHA 3STWA 2YZMA 2FWMX 4KJNA 2JG3A 1M8FA 1FFGA 2UUAB 3AFHA 3RE1A 3CIFA 3WBKA 3UWSA 1MXHA 1NPTO 1USGA 5CMLA 1C7ZA 1A6XA 4MV0A 3A9SA 3IQDB 2QLLA 1E99A 2PRSA 4KWEA 4J07A 3BSFA 4MRPA 3RSSA 1FTWA 1MLDA 3OZCA 3Q8LA 2WFLA 3QVLA 2QEQA 1E1RD 3H4IA 2RSLA 1LF5A 4DQ0A 4FC6A 4HX5A 3F47A 2XNKA 4LF8L 3B2EA 4BUZA 3M9LA 1V39A 5FYQA 1G2OA 4Y6LA 3U0BA 4XSVA 2UZ4A 1DQNA 3MRVA 2M1XA 3CR8A 3B53X 2VQEQ 4EW6A 4YV2A 1T8WA 1AK1A 3C4VA 3IKLA 1RWOA 3OEEA 3ZN2A 1E2FA 1ZSYA 4EFKA 3KLSX 3IPLA 1NUPA 4FEYA 2XGJA 2KMLA 2IVZA 4ND7A 3SBXA 3TECE 4H4DA 1T4MA 3K9QO 1T8SA 2WSBA 3FSJX 2V65A 1CUGA 4EGSA 3I01M 2QE7A 4PLGA 2C5LA 2CMGA 2BFNA 4Z2YA 3I9V6 3C43A 1BXZA 4OLHA 5C4XG 5C81A 3MGCA 2G1PA 4D26A 3Q7TA 1SIBE 3RFUA 3IIKA 4FONA 2MINA 1Q84A 4R81A 4MWTA 4P2CB 3ZIAA 3HWRA 3ICPA 3OFVA 2FCRA 2NAFA 5J4YA 1NJ6A 3BE5A 4QQFA 3SEAA 2ERXA 1Y8NB 4UULA 3F78A 1YB4A 2A19A 1LUAA 1TVEA 1XKTA 1KFEB 2HHLA 1XZPA 2JD1A 1JW9B 1PGPA 2AC7A 1XQ9A 3TOXA 1ND6A 3V8EA 3BTVA 4NZPA 4LZJA 1TS5A 1NX6A 2G8NA 4XIGS 5JXGA 1R0XA 2CXSA 3I4NG 3S9WA 4BX3A 1N7HA 4CCYB 4YI5A 3FRJA 4NXNB 4HVCA 3TPCA 1P9OA 5D6NA 5I9IA 3U19A 3HEBA 5JAMA 4FHZA 1NT4A 4DC0A 4HQ6A 3A2KA 4CM4B 1KI6A 1UJBA 4QDJA 4F2WA 3ME5A 2PX0A 2IS6A 2AI1A 4EYGA 1TO6A 3AM4A 1PQYA 3DKKA 3FLAA 1ODIA 4K5VA 1QZZA 1IFXA 2DUJA 4IX1A 3AIKA 3R9XA 1ZFNA 4K9DA 4PLYA 3PTLA 5K8UA 3SBOA 4BYMA 1F5SA 5EP3A 1Z6AA 5I9TA 2D59A 3OLZA 3NOQA 3KSUA 4FM9A 1YB6A 1EXMA 3K5IA 2HJGA 2JFUA 3IKVA 1EE9A 1LC3A 1LPBB 3K6SB 1J09A 3BERA 1WTHA 2BCOA 2AMLA 3HKZE 4OHRA 3DF7A 4GR9A 1R64A 4XIYA 3QTLA 3I2KA 1PJ8A 3NLLA 1JDNA 4BWVA 2C5SA 4HJRA 2WSMA 3EVZA 1D4ZA 1OBHA 2IP1A 3MWGA 1L5RA 3CLTC 2WTNA 2ZYAA 1XDZA 3CJQA 1WKCA 2Q5FA 3WB9A 4HLUA 1WYDA 3EVDA 1OTCA 1R5OA 2DJGC 2CE7A 4ZCPA 3C16C 4IV5A 1YRWA 5DNYB 2Z3VA 3FWPA 1ISSA 3QE9Y 3HKDA 3Q3CA 1W581 3M4YA 2VVTA 4IDAA 2RK4A 1IXKA 4O63O 3TTUA 1C8KA 4MQFB 1JQEA 4Z9FA 5DCWA 3MZ0A 1A2QA 4PZPA 3M8KA 1PH8A 5LMNW 3SHVA 5IZCA 2Q6KA 3IAYA 3FVTA 4E3ZA 1C80A 1LT5D 1TPYA 2IIPA 3C8ZA 2CHGA 1UPXA 1K66A 1M6HA 2OD2A 3HM9A 4IV0A 2ANCA 3CGGA 3GLQA 4FMBB 1PT5A 4H02A 2V9CA 3DM9B 4L9AA 3FB1A 2Y27A 1YBVA 9MHTA 4R1PA 5IKOA 3RASA 3UAVA 4QQKA 4DV5L 2YTZA 1Y6FA 1IQUA 4J0EA 5JAIA 5CXSA 4CUZA 1CC1S 2Z30A 3FPHA 4EKYA 3DWFA 1NW8A 3GLVA 3WOFA 1W9MA 2AE2A 3BE8A 3UNXA 3C6YA 2O7SA 2R11A 3C70A 4KDEA 4GKJL 4MEAA 3KLOA 3CLVA 1F2VA 1FNUA 4CG0A 4KQHA 3MQ2A 3W8EA 1L2TA 4IUUA 3ZQ6A 2ZRCA 1BQ3A 1KBOA 1ZJYA 4B4WA 5HCIA 3KTFA 1Y1KE 5LQKA 2UU9B 3MQFA 2IIBA 3OTQA 4BEWA 3LGXA 4KPFC 4K05A 4OL9A 2I3AA 1KJQA 4RIFA 4JGGA 1ESFA 3ZXXA 1PFKA 4CODB 1D5XC 2PNHA 1JT2A 1U4PA 2GVNA 1TZCA 2J4FA 3RFXA 1SNPA 3LY9A 1GUFA 5EHQA 1T10A 4WCDA 3TTSA 3OZBA 2HHAA 2A0UA 1N7GA 2JAHA 4DKXA 2IKSA 1EEHA 4Q1VA 2OWOA 2JLCA 3AL0C 2ZWAA 2OQIA 3ZW7A 1TYBE 3UXEA 1FSSA 1U0LA 1MRNA 1IM5A 2QRLA 3D6MA 4UCWA 4XLZA 1FLVA 1RAAA 2TSSA 5M3FG 2AOWA 1YO6A 5F2KA 3OBBA 3OQIB 5IXYA 4EYKA 1J20A 1W4AA 4Q15A 4RFSA 2DR0A 2IYOA 4BLOA 4RK6A 1SUEA 4R7ZA 4OHUA 3RUDA 3WK7A 3IIJA 1EGQA 3TZKA 3C6XA 3R1IA 2B6HA 3PWKA 4DR1Q 4B73A 4XJXA 1T5OA 2FPPA 3D8SA 3NXSA 4C9BA 2NSJA 3PFNA 2QPTA 5K36H 3BJRA 1SVUA 2A35A 1O03A 4Q9KA 5CYGA 5AOAA 2C9ZA 1PA6A 1V3UA 3GP8A 1DTSA 4K03A 4N18A 1H2WA 4XWTA 1BXTA 3A31A 4HUQB 4XYEA 1G9SA 4UM8B 4CN8A 2JLBA 1AQYA 1EYZA 1YZGA 5JS1A 1U9IA 4DS3A 2FWPA 4A5SA 2CJWA 4Y6GB 3NJ8A 4LE1A 3I2IA 4DPLA 3N5KA 4ZK2A 2Y4OA 3KKPA 4V0KA 1B44D 2H9AA 2JCYA 3MS4A 4PNPA 3GN1A 2QRPA 4ARVA 3SK5A 2C9OA 1ST2A 1KI4A 1K7EB 4A3MG 2M2IA 1PTOF 1QYXA 5EERA 2FU5C 1QHEA 2IGBA 4A73A 3LXXA 4Z49A 5BWMA 1ZH4A 4EVIA 4BNUA 1GG9A 1U2GA 2CJFA 5CBKA 1X1EA 2RDGA 4R2IA 4RPLA 1F3LA 4IJVA 1RHQA 2Y1WA 3HNRA 1DHTA 2IQ5A 4P0TA 3E9NA 4YJHB 1K8OA 4QO8A 4CR6A 1ZM9A 1YRBA 2Z8LA 5DOZA 1QVZA 4YT4A 1K6MA 4TMZA 1WETA 5G3LD 3U13A 4DR6L 1L3CA 2OQKA 2FTKE 5C8XA 4P6VF 1JSCA 5BXQC 4MWDA 4RVFA 3RSZA 2WJ3A 2D1TA 5BN1A 1KIXA 3PC2A 3I6BA 3DVSX 4W5QA 3ZYZA 1WMBA 3H9QA 2X4DA 3HADA 4P98A 4OMCA 1WAMA 1XLWA 1BXRA 1O9BA 3Q15C 4KGDA 4WZAB 5L45A 1FSGA 1QH8A 1RXYA 4PYIA 2QBYB 4B43A 3GAMA 1G3UA 3VHLB 4KHPL 1F77A 3S4YA 4JB3A 1C1HA 4DYVA 4NWIA 4LJKA 5E1FA 4XPIB 1Q1BA 2FF7A 3IB3A 4TXHA 4A4DA 2EERA 4NRDA 4QGSA 5AT1A 4WD3A 4TL6A 5I7WA 4XSGA 3THWB 2N47A 5AM2A 1AMOA 3LA8A 5TQ0A 4EPYA 3LSTA 3MJHA 2V6GA 4FUTA 3VPCA 4QPJC 3EGDA 1DTWA 2BDTA 5AW5A 3GO5A 3ELDA 2ZAMA 2VJLA 1XMOB 1NYQA 1FW6A 1A0IA 1Z8FA 2JA5B 4IOLA 4ZVNA 2ZAGA 4C3UA 4PNYA 5AQEA 5GOTA 3ZEIA 2F3PA 4BO1A 4RGMA 3GGDA 1P1CA 1NSNS 4BBRB 1ZNWA 2HQOA 3AFNA 2CXPA 3OEHD 2IGTA 5LR6A 3IAAA 4I4NA 1JG7A 4D9IA 2BOSA 2DG2A 2HX1A 2DVMA 4L85A 4WNCA 3ROQA 3OJFA 1YMVA 1L7BA 2W6NA 4MW6A 3FPUB 4OHCA 1I4LD 1XSEA 4JI5Q 4COOA 4Z6KA 2Q5OA 3DBHB 3B6YA 4LXHA 1W1WA 4DRZA 4I19A 3O2QB 4G4SP 3LNCA 1RPZA 1RHRA 2Y0SE 1T1GA 2CN1A 3ZKWA 4L95C 3OVMA 1SK8A 4KAJA 2AX4A 4BX9A 1N2SA 2XQFA 1XNRL 3II6X 1NT2A 1HK7A 2XKAA 2IT1A 1A9XB 2YWJA 1ZJ4A 1L5MA 1MW8X 1E22A 5FNVF 3S14B 3K0YA 4P34A 4AZ0A 1FS4A 3E7XA 4DV3L 3FGNA 2VNUD 3AR5A 4E4RA 4F85A 4FP5D 2RCYA 3A1WA 2OT3B 4NV0A 1WF3A 2HF9A 2A9JA 4LOHA 3K0CC 1JA1A 4LJ9A 4KFRA 3HY3A 1KORA 3EA0A 1E3WA 1UBNA 1NKTA 1OROA 2H4FA 3HKSA 3HA7A 1DEAA 3VZSA 3PPVA 3THSA 2C84A 4JLKA 1GSAA 4CJ0B 1LDBA 3ZBQA 3K96A 4L07A 4FJ0A 4FCCA 1K4MA 4S24A 1GD1O 2WACA 3JZDA 4TSKA 1CUUA 1ZD1A 4ZC8A 1ACMA 2IBMA 3T99A 1BDJA 4BBSH 2XH8A 5H83A 4ZV9A 3BK2A 3A4NA 2RC6A 3OZGA 2ATWA 3BYTB 4UFNA 1Z6TA 4OTZA 3EDYA 1CNEA 3QUSA 2XOEA 4FMPA 4RM2A 3BH7A 5K3AA 2YMMA 1JDVA 2FPUA 5FB3A 3ZCXA 1P8JA 4JVZA 4ZOAA 4F60A 4PC2A 1DQSA 4PAGA 4X0EA 3K1ZA 1YJQA 2C58A 2UUPA 2FSPA 4ERXA 1KZHA 4HOYA 2I7TA 3IILA 1PZGA 3BZDB 4KO1S 4O5AA 2UVPA 3PNQA 4UE6A 2MGSA 1T5TA 9GPBA 1L8XA 2ZKLA 3GZTB 3QWFA 3KQHA 3HBJA 1T9DA 3P71T 4LF9Q 3GX1A 4GGMX 4UBOA 2DPGA 3L1VA 1QC5B 4Z5XA 1H2YA 4LDRA 4U2FA 1O4VA 3LT4A 1R4NA 4O33A 5U1PA 2QLMA 1NM5C 4IOAA 1A04A 1IULA 3NIWA 4IJ5A 1MB3A 5EIFA 3G23A 4XD2A 3ZDXB 4MRAA 1E3TA 2DQSA 2PMZB 2C8VA 5CEFA 3CVXA 3A4MA 4F11A 2G76A 1UR5A 4BJ6A 1G8ZD 5KNCA 5TF4A 1U98A 2J0SA 1N33Q 2V7VA 4DV7B 2ZWMA 4WECA 5KOJB 2D54A 2MQHA 4DPGA 4WIAA 2WB2A 2PMWB 4ZREA 3MLAA 1DXYA 4H1WA 3L8GA 1LABA 1ZH6A 4NJEB 4IIUA