1Q12A

Crystal structure of the atp-bound e. coli malk
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q12A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q12A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q12A01
1YI2A 4YDSA 2VH5R 4MRRA 3PEWA 1CR4A 2BM0A 2H8KA 3KKOA 3U7HB 2RGBA 4BEBA 3IILA 1MO5A 5G53C 5C46F 4BUJA 1N6IA 2IYQA 2ZJAA 2GJAA 3A8IE 2A68D 3K7AH 2F7SA 2JA8H 3T1HQ 2X19A 4DR5Q 3DKPA 4TQ9A 3TGPA 1W2HA 3IPXA 1XFAA 2XTZA 3PUVA 1M2OB 4TL9A 3EPLA 3DKVA 4NHOA 3KF6A 2BBSA 2B3GA 2JLSA 2CLCX 2CKZB 2ZRPA 2XGJA 4H02A 2D7CA 3S2DH 1PH8A 1NVVR 2WWWA 4BZPA 1O87A 3BH0A 4C3ZA 1P8LA 2J7PA 3E1SA 1GDDA 3BH7A 2D5DA 1MRNA 1ZNZA 3LXXA 4NZYA 3NE5B 4D0GA 1VQBA 3F2DA 1N0WA 2NO7A 2DGYA 3U4QA 2IW3A 5BQ5A 1ONBA 2BE5C 2VZAA 1ZM2A 4GFDA 3GFPA 2ZJQA 4DR3L 3WRXC 1DADA 2J3EA 3CRLC 3KTAB 4S35A 3RNLA 3MWLA 3EPHA 1XRJA 4Z51A 1SQ5A 2QA4A 2QT0A 4RD1A 4ZPXA 1N25A 4BBSG 2JJ2A 1BKBA 5JJKA 3K9NA 1ZKOA 1SXJA 5IYBH 4UNRA 2IUTA 3IQWA 1RRFA 4A6XA 4DK1A 4PO9A 2Q9CA 2UZ3A 3Q3JB 3QKSA 4TLCA 3T5DA 3CF5A 1CS4C 3U5ZB 5AJVB 4A3KH 2YVUA 2IA5A 3E70C 2DWPA 3F3YA 1YZQA 4IFDH 4A3DH 2HQLA 1KAGA 2QRZA 1FR3A 1ZNXA 2CL0X 2RGNA 3BWDD 4LBZA 3SEAA 3SOPA 2UUCQ 1W4AA 2ZJYA 2HUPA 3CAMA 1Y3AA 2P67A 4WZBE 2QMUA 3LV8A 3NHBA 4GOJA 1G17A 4DV3L 3IKJA 3E0EA 3L43A 1P6XA 2QTFA 4GOPC 2PH1A 2QP9X 3MSXA 1G7RA 3OHMA 4QL3A 2KBNA 1DVRA 4DR6Q 2FPMA 2ZRAA 1DAEA 3MRSA 2G88A 5EE0A 2BJVA 3VR4A 2XNSA 1VCNA 3OESA 2EFGA 1HQMC 3KLRA 4GI7A 1AA9A 4DIEA 2HCJB 4R4IA 2E9SA 3QE0A 3HOZG 2G1KA 3WYAA 3TSZA 4QGFA 4DSTA 1COWD 2O8FB 4PAQA 4X6AH 2VIIA 4Q1FA 1CKEA 4IVRA 2A68C 4WZAE 1M34E 4GRAA 1TEVA 2MSCB 4R4OA 4F4JA 5FBRB 3S1AA 1XPRA 1CF4A 1E2WA 2PMDA 1KMHB 4DUGD 2XAUA 4HB0A 1EFRA 2DNEA 3E9IA 3FMPB 3LBIA 2AHOA 3ICQB 2QBYB 5C4GB 4ABYA 5KDDA 3MXNB 4YMVA 1YNNC 4ARZA 2V1UA 1MR3F 3I4NG 3EIEA 2BC9A 1EIFA 2GZAA 5TDHA 1G8FA 4MDEA 1OFUX 1CKOA 1YQTA 2RCNA 3K0AB 5FBWB 3VA7A 3HKZG 4OI1A 4DSOA 4MYHA 4OWWB 2P2LA 3CONA 2Z6KA 3MG9A 4JL8A 4JI3L 1P2UA 5KTYA 3FWYA 3FMCA 4G7OC 1QVAA 3QQ5A 1FJGQ 4DDUA 1SLJA 1KAOA 4RY2A 3M7NA 4A3EH 1IBMQ 4F4CA 2I1QA 3NEYA 2G1JA 2P0EA 4M1OA 1E99A 3UK6A 4Z1MD 1XNJA 2VRWA 1VG0B 2ZYUX 1E3PA 4JMPA 5L3SA 1W48A 2XTMA 3UE1A 5IE8A 1OH5A 3AUXA 2WKPA 4YMUA 1S3OA 1GITA 2P65A 2VSXA 2A6EC 4J0QA 2YC4C 3GTJH 3GJ7A 4BBRH 5J3BA 2CCJA 3B2EA 4RFSA 1YBYA 3SQXA 1G291 3BD9A 1JBKA 3TQYA 4JI8L 1ZYUA 3EARA 2E87A 2P6UA 1PUIA 3I72A 3RYTC 1E2FA 2DPXA 3GJ6A 3O47A 1Q8KA 2H17A 3CLVA 1HZ9A 1PH5A 2OTJA 4A2PA 4ASUA 1N3BA 5FH9A 2E2HH 4DNIA 4FDBA 5GADC 1DPFA 1KSGA 3N2IA 1GRRA 4NCJA 2OHFA 4M1KA 4DKXA 3QI2A 1N5LA 2A19A 4Q1CA 3TR0A 4AYTA 5B30A 2ZSAA 5EP2A 1IYJB 1FQKA 2WKRA 4LC1A 4B3BA 5JWHA 4N1AA 1ZW6A 1CXZA 2QAGB 1W0JD 2V1CC 3F2CA 2EJGC 3B6YA 1EGAA 1GP2A 1ZRHA 2QP3A 2OXCA 2QU8A 3RABA 1KI2A 3KKPA 4B32A 1J99A 4M53A 3PUZA 1QHIA 4BEJA 1RJ9A 2GTPA 4DCSA 5JS7A 2H16A 4UJ3A 3RRZA 3WY9A 4OO1I 4MUAA 1M74A 4RZ3A 4TSFA 1II9A 4PPGA 3THXB 2NVQH 4DR6L 1TUEA 2XJ9A 3SYNA 1UDXA 1OH8A 4HAXA 1G8HA 3IUYA 3OZXA 2HIVA 1S96A 2ANBA 4F38A 5B57C 4GL2A 1KY2A 3J7ZC 2R92G 2GEUA 2ZROA 1R0XA 2PT7A 4L9WA 4LY6A 1KI7A 2CE2X 4W5HA 4AYWA 3M4OH 3PSIA 2NO9A 2QMEA 3DDCA 2ZQ5A 4QFMA 3BFXA 2F9MA 4DCVA 2GCOA 4LF9Q 2WJIA 1HNZL 3AKDA 2IX0A 5CK4A 2QI9C 5FPTA 1BVSA 1JEEA 2CL7X 4BLSA 5CDFE 4D25A 4K0KL 1QDEA 3I4NH 2EXDA 4XIGS 2JE6I 1F2TB 1LV7A 3PCRB 1Y63A 4LZZA 2YOHA 1GUAA 1U81A 1ZBDA 1Y1VH 2EWVA 1CR0A 3OPOA 4KLNA 2QM7A 2ZJ2A 3VMFA 2RGXA 4IJHA 1NY5A 2EQBA 3UANA 2VSFA 1Y8PB 4RCNA 2IF2A 4KLKA 5HKKA 3K1JA 4E03A 4PO8A 4TMWA 5A4JA 2J7KA 3VR5A 1KRSA 1HNZQ 1BBWA 3NBFA 4US2R 2H5EA 2F1MA 2JEBI 2VP6A 2J0QA 4TWZA 1N6OA 1WCMG 1S9DA 3PIOA 1N32Q 3STBD 4MNOA 2B8FA 2YTYA 2BMFA 2CQOA 3VDYA 1TQ4A 2IF0A 1SROA 1PA6A 2ORVA 3CCVA 2GEVA 3KXLA 4FN5A 4GP7A 4YXWA 3BDOA 4R1JA 1S72A 4JL6A 5AUQA 4PPFA 3A1WA 3THYA 4RG1A 3B1ZA 2EYQA 3BU2A 3ZJYC 4A3JH 4BGDA 3O8CA 4APVA 1VQAA 3FMFA 4L16A 3RRMA 4QHSA 2JJQA 1IXZA 1CJVC 1JAIA 4RCZA 1ZD1A 3AEZA 1N34L 3CRW1 3LQRA 3J80i 5CYPA 4YHHQ 5CK5A 1JPNA 1WQ1R 3TLXA 2BCGY 1VYUA 1OHHA 2ZEJA 1CJUC 3K0FB 4MGZR 4WXRA 4JVMA 4A92A 4DC9A 1GL6A 4HIMA 4EX5A 2Z0SA 1Z6YA 1WE2A 2CCKA 3VHXA 1KO4A 1N34Q 4IEIA 5SZHB 1QVCA 2OQ0A 1K8RA 2F1IA 3IRBA 5FBLB 1QUQA 2ZI6A 1UE1A 4DV4Q 4NCIA 5D3QA 4Q66C 3VHLB 1TU2B 1KNXA 2IHFA 4MH0R 1JJVA 1JQJC 4GNXC 4LW1A 2OFWA 2QQ0A 2ZR7A 5FL7A 4GDFA 3SYLA 1ZUIA 5IYCG 5BWMA 4C7OA 2BBWA 2CJWA 1PHJA 2R44A 4PQRA 4Q9IA 1EIYB 4CEHA 3EWAA 4BFWA 1GAJA 5BR8Q 3HOZH 4KBGA 1GHJA 4YC7A 2DN8A 2ZXUA 4Q00A 3PV0A 3T12A 3BAFA 2K75A 2ZE5A 1JT8A 4KVAA 3MGCA 1EX6A 4D6PA 4YCVA 4BLPA 2WTUA 4ZI2A 4RKFA 1JB1A 3U7FB 1FQJA 2JJ8A 2CCZA 4C0KA 4DHEA 3A37A 3PCOB 1ODFA 4GZMA 4JVNA 1TXYA 1Q20A 3OE7D 4U7DA 1OLOA 3S1MH 5A5GA 4G5GA 1K6MA 1Z0AA 4KO8A 3CPWA 5JECA 4JG2A 4PSKA 3CPFA 2HYIC 1RL2A 4LF9L 1T3LA 1B0UA 2GAAA 1RYHA 3FOZA 4DV0L 2W6JA 2ZI5A 2IS1A 3W5JA 4B3MQ 3RZOH 3A7LA 3OFND 5FL3A 2Q8IB 4A8JB 4OGQC 2WFWA 1U8YA 4HAZA 1WF3A 1OH6A 3S2HH 4GMDA 4OYHA 2UUBQ 2HT1A 1Z6XA 2F1JA 1HNWL 3CPHA 5LMNQ 3EG5A 1EFWA 3FP9A 2WKQA 3MWJA 1XMOL 1Y1WG 3EZ6A 4BFVA 3W34A 5M3FH 2HHHL 2JJ2D 3WBJA 3PIRA 3H0KA 2K50A 3K0AA 1Q1EA 4NXNL 2EFHB 2WJYA 2JLWA 4M9XA 1V1QA 4WIAA 2WV9A 4S2EA 3SJBA 1PH2A 1E9EA 2CDNA 2JLUA 3QPWA 3CMEA 3NBHB 5TMPA 1CBUA 4LI0A 2CHVA 4QBGB 3X1ZA 4FCTA 4L9SA 4TMZA 2F43A 1KSHA 1KO1A 3B1VA 1K9MC 3K53A 4TMXA 1SXJC 1Z0DA 1XTKA 4Q47A 4URZR 4HAYA 3OIUA 4ZKEA 3T1TA 3QEOA 1J70A 2O52A 2ODNA 2V54A 1XJVA 1G9XA 1ZCBA 2NN6G 3JAMc 4H9GA 3FKIH 4JI8Q 2JA7H 2I5LX 1EK0A 3PO3G 2A78A 4ZDWA 5EE9A 2XITA 3A1VA 3IO5A 1MO4A 1XB2A 2FZ4A 2WOJA 2YTVA 2C03A 3LY5A 1E2EA 1N5JA 4W7SA 3KL4A 4BXXG 1RE0A 2FE4A 5EE5B 1CR1A 3EZ9A 2PX3A 2F52A 2HCBA 4I1UA 2JA5G 4XSHA 1VQCA 2BA0A 3BRWD 4ZDIA 2GXAA 4UXJA 1MO6A 3H3VI 3HU2A 1G1MA 4XD7A 1XEXB 4MKFA 5M5XH 2ZI9A 1AQYA 4GN4B 5KNDA 2ZUDA 3C15C 4JI6Q 1Q22A 4DK0A 1VQEA 3U6BA 1GOTA 1C1YA 3ETLA 1TU4A 4G5OA 4P4SB 1XTRA 3WYFA 3PJRA 4GMXA 5IWAQ 2PI2A 5B2ZA 4B3CA 1BOFA 2GAOA 2IYUA 2H18A 3X1DA 4M1MA 2IEZA 4R98A 3NEMA 1ASYA 4D0NA 4WXPA 2AMCB 1E0KA 1KZGB 4EIWA 2K32A 4O0AA 1VQKA 1W36D 1N32L 2E8GA 3OTOL 3MEFA 1K5DA 4DT1B 2EJMA 4ZDJA 1YR8A 5AUPB 1CRPA 4GKJL 1GL9B 1NY6A 4TYWA 3HOVH 1WCV1 4JOIC 1IYVA 3SBDA 3CQZH 4BRWA 2CLDX 1ESNA 2K5VA 4II7A 1AK2A 1YJ5A 2ZJRA 1YNXA 4O2LA 2FEOA 2HIXA 2HLDD 4AH6A 1OT3A 1OTCA 1S0UA 4PSVA 5C0XJ 4NYIQ 4A3IG 2VS1A 1ZC4A 4L5RC 3S1QH 2QM8A 5LMUQ 2R65A 1J5EL 4FI3C 5JEAG 1P73A 1Z0KA 4XSGA 1HY3A 4YMWA 3ZIAD 1XTDA 1DAIA 5AWFC 3Q7PA 4AWXA 1ZIPA 2JCSA 3U7GA 3QF4B 3U4QB 3CNNA 4L5SA 5C0XH 4OHXA 2J7PD 4LSGA 3AUYA 4OKSA 4YXWD 1E1RD 4PV1C 2MQHA 3AQQA 4AQYL 3G5UA 1CTQA 1TWGH 1IJFA 5C4XH 4HIOA 2IT1A 4JLMA 2ZT9C 3FHCB 5DSZA 3OE7A 2GBLA 4A3IH 3TR5A 2ZJ8A 3IIMA 4QIWE 4R4TA 1NMGA 1UBGA 2WSSD 4LF7Q 1VHTA 1BMFD 3BE4A 4X8LA 3RWOA 2QGZA 3N6RA 4QY7A 4C2TA 3NC1C 1FPMA 2B21A 4V02A 5KSPA 3NELA 1YZ6A 3D0FA 3TRZA 1SVKA 3BB3A 5HZKA 1J90A 4UPAA 1QUQB 3QJYA 1OF1A 2NZJA 3CF6R 3JVUA 2FSFA 4ZIRB 2PNRC 2C5LA 2OESA 2PLRA 4ZO4A 2ZIAA 2NO1A 1YJNA 3K8AA 2A2ZA 2QE7A 2AX4A 1CLUA 1FTNA 4YHHL 1E2VA 1IBML 4P73A 2ZI3A 3QKRA 1XMOQ 1R7RA 3AP2A 2BBOA 1N33Q 2YC2C 3JVVA 3ZQ6A 1KKMA 2VP0A 4HYYA 1UWVA 3KLWA 4QGAA 5H70A 1XD9A 1OXTA 3GMTA 3R8CA 2N42A 1PFSA 4Z1MA 1B70B 1AZTA 1BDOA 1E2IA 4D4LA 4JYCA 3KFXA 1HYQA 4AG6A 3WHLA 4XVQA 2Z83A 1R5NA 4IHQA 4PC6A 1KIMA 4B6EA 4U02A 2HYDA 4Q4JA 4B3SL 5IYDG 4NYMQ 4XTRA 2C9OA 4PC3A 2NPIA 1I6HH 2CVFA 3FYHA 4OK6A 3GO5A 3SFZA 3DZDA 2EFEB 2LWIA 3AB3A 1D5CA 3GLGE 4B33A 2I4IA 4AY2A 4DR1L 1Q57A 3W6PA 2GKSA 3H15A 1JR3D 2ZRLA 4O2RA 4POFA 1IXRC 1HT2E 2ONKA 1DS6A 2GESA 2K5NA 2QG6A 2QORA 3KF6B 4EPTA 4OHYA 2NN6I 2RHSB 1NF3A 3KDSE 1KDOA 1OE0A 1DTSA 4ESVA 4L5QA 5L3QA 3OF5A 1P9RA 2VBCA 1YVDA 3WDNA 4K8OA 4UKDA 5C44H 2B8WA 1YVCA 2R6FA 3H2YA 1I94L 1SKQA 2W00A 1V9PA 5FOSA 4XVUA 1XF9A 3SHFA 1G7SA 4JI0L 4Q1DA 2WWXA 4H44C 4TSFD 5AJ3L 1TWHH 2HF9A 3DMNA 4MA4A 1NBME 3B6EA 2WICA 3KUCA 4LJAA 4CW7A 3RC8A 4R2IA 4F91B 3IO3A 1IW7C 2C2HA 3AF0A 1K5GA 2Q21A 4JVLA 4DVGA 3NEJA 5K8IA 2OQKA 1G6PA 4A3LH 1GSIA 1Q44A 4B3RQ 1QHSA 1DG3A 2OLKA 3NKVA 1MKHA 1G64A 3GTOH 2O0JA 3FDIA 2FX3A 2KSQA 4DWJA 1MOZA 2ZAMA 3IHWA 4DUYQ 3CR7A 2WBLC 4DKAC 4LFBL 3NVAA 4KHPQ 4ASUD 1WFQA 3DM3A 2YZ2A 5FBVB 2HEIA 4MKHA 2GA8A 4CT5A 3LXRA 4DZZA 2A6HD 3SE0A 4A93G 1HEIA 2FFBA 5DN6A 3OOCA 2CNWD 3TSOA 4EJSB 1RC8A 2ERYA 1YZLA 4DRZA 1OW3B 4IO9A 5K36H 2Q0HA 3HOUG 1DO2A 4AD8A 2KCTA 1O78A 1EWQA 1CEEA 3J81k 4YQFA 3ERSX 4JL5A 4W5JA 2GVAA 4PZ8A 3SBEA 3JAMi 4PZZA 1T91A 4KCGA 1VQLA 3AV0B 1G21E 4OQXA 3THWB 5J5CA 2OCEA 3VR2A 1XEWX 4RZ2A 1W0JA 4WA7A 4DUYL 1JQLB 1NKTA 1ANKA 4K46A 1N6HA 1VG1A 1TUIA 3IFTA 4B35A 1N6RA 2NQ2C 3QVVA 3ZZTA 3MJHA 2FJUA 2KWIA 5IYBG 3G71A 2NGRA 2W2VA 3HDTA 1Q3TA 4FMDF 2DY1A 2XSZD 1E3MA 2N49A 2R7ZH 1IOZA 3KZ1E 5AK0A 3BZCA 2VQEL 1MT0A 4QBHA 1VQ9A 4MDFA 4DR4L 1KDPA 3KJOA 1X56A 4BA2I 5JWOA 1KDRA 1I4LD 1Q21A 4BECA 3ZLJA 2CFMA 2XX3A 4D82A 1ZNWA 2XTIA 4YWMA 2WWHA 1DOAA 2QRNA 1N0VC 2F55A 2ZR0A 4Q7KA 5CIWA 3WMGA 3CC7A 5IHPA 1GKUB 4JYAL 2B8TA 1W5SA 1L2FA 4IQZA 2GN5A 3SGIA 2J9RA 2X2FA 4JSTA 3T1VA 3GEIA 4QJ4A 4PC7A 3WMFA 5FJ8G 2BMJA 4TVAB 2WMNB 4JZKA 4F4IA 4C3HH 4R71A 3CPJB 3AVTA 4HDQB 3CF0A 1VYVA 3VKWA 4X62Q 2Q6TA 4LF5Q 4JI1Q 2JDIA 1U8AA 2QY9A 3WNCA 4X65L 5LMUL 4C4PA 1KK0A 4DDWA 3ZD7A 2WAQE 4V03A 4KKTA 2IYLD 4DV2L 5FOVA 3RRYA 3ICEA 3EIVA 5IYDH 3Q9LA 3RWMB 6Q21A 3I92A 1II0A 2C77A 1GNRA 5A35A 2C8VA 3N70A 4HEJA 2BDTA 3D8BA 1UM8A 4TLDA 4B76A 4B3SQ 4HLCA 3BJIC 3QPUA 5AJ3Q 3MD0A 4IFBA 1Y1VG 1NN5A 2K33A 1E4VA 2LXKA 1NJIC 3HU1A 4OX9L 1YHNA 2CNWA 2LCFA 1CU1A 1YE8A 3R9XA 1HQCA 4ZCLA 4A3FG 4D81A 3AGQA 1YR7A 4Q7LA 3ADBA 3TQCA 3DM9B 1M7GA 2ASEA 4BBRG 1AM4D 4IRUB 2JA6G 4GKKQ 3PEUA 4XVRA 3K80C 2JIZA 3OFNA 1L4YA 1LS1A 4JIMA 5KHOC 4QKQA 2IS6A 1W36B 4A93H 1KL9A 4RD0A 5F3WB 3QKSB 5IP9H 1VQ6A 3KKMA 1X8LA 3CCMA 3MFYA 2DUDA 1ZUNB 1FL9A 2JEAI 3CCEA 2OCAA 3M85A 3F5FA 1ZM9A 2UXDL 1R4AA 3A8TA 3DVLA 2O5VA 1SXJE 1ZM7A 3Q7QA 4XJXA 2J0VA 4F92B 1KI1A 1YJ9A 4Q5IA 2VNUD 1ZD8A 3KTAA 3EN2A 2UZIR 1VQJA 1NMZA 3ADKA 1LTLA 4WW0A 2ZAOA 3P26A 4DXAA 1PMRA 4JI0Q 1XD8A 2ZU6A 1H8ED 4JLBA 2RGCA 3X1YA 2JGNA 1T5LA 4OHVA 1XWIA 2IYYA 3UDGA 3PENA 4HZUA 4KSCA 1JE5A 5FTKA 2F3RA 1N33L 2EU8A 1JJ7A 1MJCA 3U3KA 4DLZA 4UJ5A 4OK5A 4DLYA 5JRJA 3LGJA 2QNRA 5G40A 4JI2L 2GILA 1JR6A 3RNUA 4GN5A 2CHGA 1QZHA 2HHHQ 3NH9A 1Y14B 3I5XA 4B71A 2PNHA 3D3QA 3ECCA 3PR1A 4LJYA 1PH9A 5L3RA 4BFYA 2JLZA 2DYKA 2B7BA 2E76C 5FOTA 4B44A 4GPTA 5GJCA 1G6OA 1E9CA 3WHKA 4C0JA 4IOKA 3THYB 5E7IA 4EDHA 1L0WA 4E07A 4QXAA 2I5HA 1LTQA 1NTGA 1NY4A 1A2KC 2LKCA 1L1OA 1P2SA 2GCNA 2WIAA 2NVXH 4H13C 3CX8A 3PEVA 3I55A 1D9XA 1GVPA 1CSPA 4KYUA 4V0ME 1ZM4A 4NP6A 3R9IA 1X8JA 4GNXA 2A8VA 4JYBA 1KXLA 5EXSA 3ZYCA 1SR3A 4GS3A 4NB3A 2D2FA 3LFUA 1F60A 2C95A 2RGNC 2L0XA 2Q2UA 4KITB 5FR1A 3L82B 1K8AC 2BKEA 2HJGA 3SS8A 5TVKA 2IY5B 3VR6A 1E79A 3AB9A 4M22A 3KXKA 3HOWH 4WJ4A 4P32A 3OYYA 4FINA 1I5FA 2C96A 3LW8A 4TLAA 3I4MG 4LFAQ 1G4UR 3CR8A 3LH5A 1W46A 2YKGA 1U0JA 2A7QA 1UKYA 1BIFA 2OILA 2UKDA 4RZUA 3I8XA 4DV0Q 1U90A 1HJPA 5ELNA 3A4LA 1E2JA 3TKLA 4I7ZC 3LBNA 2GCPA 3RS5A 4Z8YA 2PMKA 4EJSC 4V0LA 1QG4A 3K0CA 2JQOA 1VCMA 1R6BX 5BXQC 4OI0A 2CLSA 2FGKA 1M6NA 3BBPA 1IHUA 4M1SA 4EUNA 4LYFA 3G4SA 2W6IA 3GJ0A 4B3RL 1DGSA 1NIPA 2DCUA 4Y0VA 4LF6Q 3X2SA 2OCBA 3PFIA 4OQLA 1W4CA 1I6VC 1FX0A 2ZJOA 4HAUA 2VHJA 3MJRA 1UBEA 1RJ9B 4AKHA 2KCCA 1X86B 4AK9A 1D8TA 1NG1A 1P16A 5HY6A 5BN4A 1UE5A 2QMHA 3CO5A 4BFTA 4A3KG 4C0BA 3TUZC 1FGUA 3HFZB 1B9NA 4HR7B 1XNRQ 1MH1A 1US8A 2WAYA 1G8PA 4LJ7A 5AJZA 3T15A 2ZM5A 1HR0Q 2D2EA 2V6IA 4TTPA 4BZQA 3IQXA 3TVDA 2DHRA 2J59A 4TT3D 4D4MA 4LUVA 3MXUA 4TQUS 3QY0A 1SMXA 2L15A 1VQ8A 1WOCA 1TADA 4KFSA 4IOLA 2AL7A 5AUOB 1M7BA 1Q46A 1HQYE 2RF4A 2ZRDA 2HXSA 3PGZA 1W0KD 1GKIA 4ZKDA 2PX0A 3B78A 4TYQA 3N2EA 4R2HA 1A1VA 3NWJA 1JMCA 2R6GA 2GZDA 1WBBA 1C4OA 4DK6C 5D3MA 1WBDA 3I2ZA 2O8EB 3M4YA 2ZANA 3I56A 1OYWA 2MMGA 1VDZA 4L15A 3LAWA 3QXHA 1AS3A 3C7KA 2R8RA 4H1UA 4NU0A 1MABA 2JJ1D 3NHAA 4HB2A 3SJAA 5LDDC 1R2QA 1YHAA 2IXEA 3G0HA 2Z4RA 2JA8G 1GNPA 2WSSA 4LX0A 1E0SA 1VQMA 4JI4L 3UATA 3PXGA 1DAKA 4BRUA 3C5CA 4IDHA 1MKYA 3IBGA 4MRVA 2UU9Q 5EE1A 2UUAL 5C0XG 1D7QA 2C9CA 2P6NA 4E22A 4HJ9A 3OW2A 3H0GH 1E1QD 4GT1A 3WNBA 4DEXA 4MGYR 8OHMA 1LFDB 4NCHA 5CM9C 4A1FA 2NO6A 2QTVB 3CH5A 1OKKA 2IL1A 4CYMA 1DAFA 3HGBA 3FGNA 4IOAA 4GOPB 1K83H 4NXNQ 3RRNA 4P72A 5EXXA 4A3GH 4JI2Q 5E7MA 4X62L 1YR6A 4ILEA 5LPNA 2VP4A 3TSWA 2WAXA 2W58A 2BH8A 3I3SR 3EW9A 1KKLA 3BG3A 3AVPA 4FMBB 4LHXA 3PVSA 3I73A 1XXHE 5DIFA 5LMNL 1Z22A 4LNQA 1EUJA 1SVSA 4JT4A 2VUMG 2MO1A 5JSZB 2Z6KC 2A5JA 3O8RA 1W36C 2BE5D 3EA0A 1V43A 2PLFA 4TLEA 2K4KA 1YKSA 4LK2A 2RHDA 4I1OA 3ZDQA 2IS2A 1XP8A 1NN0A 3KQKA 2C78A 1CKNA 2OAQ1 4PR0A 3B1WA 4LJ9A 4A3MG 1DAMA 3HKZE 1GKHA 2R93G 2O8DA 4TYYA 1FW6A 1T0HB 3ULLA 3RLOA 4OHWA 2JLQA 1B23P 1TTTA 1ZU4A 3UKDA 5JJLA 3S1RH 3I7FA 1G41A 1ZJ6A 2BOVA 2DBYA 3B9QA 3THOA 2MNAA 2P6RA 5E95A 4DV1L 5GROA 4M9QA 3PQCA 1GL7A 3T1YQ 2WZQA 4PAMA 1G4AE 1U0LA 4JI5L 2I3BA 1LABA 2AFHE 5C3EG 1HA3A 1LW7A 4JBMA 2VW9A 1BH2A 4QJ5A 3ZZ0A 4ERNA 1W7AA 2AR7A 3QG1A 5AR1A 3RANA 1CULC 5HR5A 3A1UA 2FXQA 3RS7A 2L5TA 1RW4A 5FLMH 3CIOA 4R4QA 5H1YA 2RGEA 2JLYA 2OBMA 3KJEA 4BPBA 5GAHC 1TX4B 1EESA 3ZVNA 2AHOB 1YITA 2JASA 4EPXA 4FIDA 3LX8A 5LD2B 1VQ4A 1R8QA 3D7MA 3ZVRA 1AE2A 3HP1A 4PPQA 2XGTA 3Q8DA 4IVQA 4OXPA 5C4JH 3QSYA 1E2DA 1TF2A 3NH6A 3R7WB 3TS2A 4HJ7A 4DV2Q 3VR3A 2OCPA 1BYIA 3A0JA 3ASZA 2O8DB 3B1XA 4MKIA 3KQNA 3QNUA 4B43A 3QBVA 3B60A 4N0EA 3VKGA 4P4UA 4Q01A 1ZAKA 3VR1A 2XB2A 2KHIA 2H92A 2KHJA 3TNFA 3T61A 2D0OA 3IIJA 5DN6D 5EJEA 2XTNA 4Q02A 4JYAQ 5E3HA 3FMIA 1VECA 3PEYA 5KDOA 3KKNA 3T1QA 5HCIA 2ZRNA 1IQPA 4MZ9A 4LUOA 4RD4A 2V7QA 2QUZA 4OWXB 4JV5Q 4V0NA 3RAPR 3KJIA 1OSNA 4Q1AA 4PHGA 3GLGB 1OXUA 1KRTA 4RMFA 4A8JA 1VQOA 1QZXA 2AK2A 4LPKA 1D2NA 2IYZA 1R5OA 1RRPA 2WVJA 5FI0B 1PYBA 1CUKA 4GNXB 2JJ1A 4QGHA 1IXRA 4US1R 1VQNA 1TAGA 1AGRA 2DWOA 4LRWA 1Q1ZA 1M7HA 5E7NA 1N8RC 2QAJA 4BZXA 3U50C 1SXJB 4TMVA 3V00A 2G6BA 3FFAA 1CP2A 3O8DA 4I81A 2H57A 4A76A 3OIYA 2D4HA 1N6NA 1KK2A 4IFEA 4LHWA 1OH7A 821PA 2PCFB 4YWLA 1HNWQ 4GZLA 1UEIA 1X9NA 4LF4Q 2A5DA 1JI0A 4OQMA 2BMDA 4GNKA 5C18A 1CJMA 3QVUA 2O5JC 5D3MB 2ODEA 3W6NA 3OEHA 3NTUA 1SVOA 1R0YA 3CNLA 1U5KA 1IBLQ 2J0UA 2NTYC 1LVGA 3DMDA 4WJ3M 3UDXA 3FKSA 1VKJA 2V9PA 4N3NA 1Z08A 3N5CA 2PI2E 5KSOA 2FSHA 1AQUA 4R7ZA 3WNDA 1LF5A 3EPKA 2GRJA 1DARA 2O0HA 3K70C 2UXDQ 1WB9A 1N0UA 1H9MA 4LF4L 2MO0A 4X66Q 4DV6Q 5J4YA 1ZU5A 3HKSA 1H8EA 2BA1A 2R92H 4DR2Q 3P4YA 4HDCA 2B6HA 1MRSA 3ADCA 2B92A 1GO3E 4B73A 1KGDA 1NSTA 4XWOA 4Q4AB 4NCNA 4P3YA 5H8WA 3L0IB 1XEFA 1R0ZA 2VP9A 1L8QA 3B82A 3CPEA 1ELOA 1VCIA 1E9DA 2XOKD 1Z7TA 4POGA 3J7A5 1FMJA 4AC9A 2JA6H 5L8VA 1T4GA 3CRMA 4H1VA 4QJ3A 4MYUA 1QVRA 3X1WA 4AURA 4G7ZC 4LOAA 1TKWB 3K81C 1DAGA 2F1HA 3MCAA 5FR2A 5LBIA 2CWAA 3RSOA 1A6XA 4FMDB 1ZM3A 1IM2A 1RVDA 1C0AA 3RN5A 1P4SA 1RRGA 1X6VA 2IYWA 2V7QD 4HZIA 4LPSA 3A6PC 3HYTA 2D74A 4X8HA 3X1XA 1S40A 1G6HA 4IOMA 2EQSA 2AKAB 2OM2A 2R9VA 4A3BH 3BB4A 4Q7MB 4CEHB 4IPDA 3AGPA 4LYHA 4PFSA 3ZZUA 3LRPA 4ZDKA 2IK8A 2OWOA 2UXBL 1E2PA 3CZPA 3SJCA 4CZ2A 4CF7A 1GUGA 1O7LA 2O5IC 3PIPA 1G18A 1JJ2A 1OIVA 2FWRA 3EWSA 4A2QA 4ZCIA 1HTPA 4G5RA 1J5EQ 2PCJA 2NZOA 3RN2A 4A2WA 1D2MA 3IHLA 1HE8B 5DI3B 2REXB 5B64A 2Q2HA 4NPHA 1H9JA 4HAWA 2GJSA 5HTKA 1DG1G 2JAQA 4UP9A 5TXGA 2V3CC 1Y8NB 2EIFA 4A0RA 2XNDA 2D7DA 5EP1A 4HZUB 2ZSBA 2HXYA 1HURA 1D6JA 1Z6AA 4A3EG 2IWRA 3KQLA 1VQIA 1E2MA 1Z2AA 4C9BA 3GLFA 5F9HA 3SU8A 4OX9Q 4QNMA 4LUZA 4Q4JB 5G3ZA 4TTRA 1SVMA 1DBSA 2D62A 5C3EH 1A63A 3U9SA 4B48A 4QM6A 5GQOA 1WDTA 3U58A 5G3YA 3P20A 3M9BA 5DHFA 1VHLA 3RS0A 2FDCA 1GJXA 1X3EA 3TK1A 1CJTC 4Y52H 2YNMA 4HDOB 2G3YA 3PO2G 4LF5L 4QHYA 2G0TA 1IJEA 2NOAA 3RSLA 2OBLA 1OV4A 3ULJA 3QKRB 2UXBQ 1IY2A 5LB2A 3W5IA 2YWEA 1JR3A 4X64L 1FL0A 3OIVA 1DCZA 3DXJC 4A3MH 2OSBA 4LBWA 4KFRA 2F6RA 4JLKA 3WBKA 4UP8A 1XTIA 4LBYA 2E1RA 4PC2A 3TUJC 3KYHC 1JNYA 4QOSA 1XEWY 1IBRA 4B3GA 1I50H 2BVNA 4HIKA 3TS0A 3VNVA 3MWKA 1BYUA 3L0PA 4OI2A 1U8ZA 4PANA 4BWYA 1IXSB 2BEKA 4HJ5A 1KDTA 3K0EA 3TIFA 4JJZA 5KU1A 1P75A 2D0PA 1XCMA 3CC2A 1FVIA 1JJGA 2JK8A 2PZFA 3QF7A 4DCNA 1P60A 2VQEQ 4JLVA 2D2CC 5IDVA 2AKWB 2ZVPX 3GTLH 5FUVA 4NKRA 2K14A 3CCJA 2X1VA 1KTVA 2ZYVX 1P3JA 4YY3Q 2VO1A 1U0HC 3A7AB 3Q5DA 1JEDA 5F2EA 4RKEA 1FNMA 2GK6A 1KAWA 1X6OA 1E98A 2WOOA 4A8JC 3H94A 1X55A 3FFBA 3KB2A 4GOKA 4DR2L 1JAHA 1PLLA 1Z6GA 1VS0A 4NPSA 1Z06A 1SN8A 1VQGA 2ODWA 3CB4A 4DV5Q 4B34A 2CL6X 2GHIA 2GVZC 3CW2A 1E1OA 1KJYA 4WOPA 4Q9HA 3C5HA 3W5OA 2A3RA 3SYKA 4BLRA 2XXAA 2XEXA 121PA 1QZGA 2VL7A 1NVUQ 1QHXA 2XZLA 1X54A 1SVWA 1Z6TA 3I4OA 4DAMA 2HJVA 2Q9BA 5CB6A 1S8FA 1GRNA 1T3HA 3MLEA 4QBIA 2DFLA 1XXHA 4C3IH 3B9PA 2GEDA 3RS4A 2PEZA 5JEAH 2ZJBA 1KI3A 3RR5A 1UE7A 3B13B 2VYFA 1SE8A 3FKQA 3GLHB 5JZVA 3K0XA 5J40A 2ZR9A 3GLIA 4Q48A 3GPLA 3AF3A 3LNCA 3GLFE 1MV5A 5JHGB 2CE7A 1AE3A 4L5TA 1B8AA 4M1WA 2FSGA 2P5TB 4EFLA 4JBYA 2QBYA 3H4MA 1J8YF 3T51B 1M90C 1L4UA 2LKDA 3QKUA 5JI3E 1K8OA 2VUMH 1Q90A 1E0JA 1FJGL 1F3OA 3K0FA 4JLPA 3QXJA 1VQHA 2W6JD 5M3FG 2WMOB 5IK2A 4U5XA 4DSNA 1XEXA 3ZVMA 3KQUA 4LFCL 1E24A 4EPWA 3NXSA 4KAXA 2BH2A 1E9RA 1KQSA 2F9LA 4HLDA 1R10A 2W2TA 2KJQA 1W3SA 2XSZA 4JS0A 3A1SA 4IFDI 3U44A 1VF5C 4RJLA 1HZBA 3I4LA 2QSZA 1IY1A 2GWHA 3ZS9A 2AD1A 1TEXA 1Z47A 1U98A 3H1TA 3NBZC 4HLUA 2Q3MA 3KKQA 4Y7NH 4PZLA 4IFDG 4OONA 1NKSA 2OEPA 3CMAA 1XMQQ 3DL0A 1EYGA 1IBKL 2JDID 5IY0A 3P1JA 4TYNA 3LQQA 4KFTA 2ZREA 2BCJQ 1T0JB 4M4SA 1ZD9A 2HLDA 5FPKA 4R4CA 1F6BA 3BIFA 3LO5A 1KI9A 4LF6L 4FXPA 5M5YH 3HYRA 4ESHA 1KJWA 1G16A 2GVBA 1NRJB 1S2MA 1WMSA 1M1KC 4CT4B 5KNCA 2JLXA 2ID0A 1GZSA 3EAQA 4MUBA 2VHTA 3B7GA 3V9PA 3LD9A 3HU3A 2CBZA 3AVXA 3R9WA 1ZVQA 1U9IA 2NG1A 4G7HC 5CJ2A 4M9SA 5EP3A 221PA 1G19A 1JECA 2DR3A 2GETA 2QGNA 4KFUA 1MIUA 2E2JH 3W1BA 1RZ3A 1GVNB 1U99A 4DV3Q 3TQFA 4W9MC 1LNZA 2VHUA 2WHXA 2Z0MA 3MAAC 4IVPA 4W5WA 3BH6A 3M0EA 3K8YA 2ODBA 3PITA 2YV5A 4A36A 3K9GA 4PO1A 1Z2CA 2A6ED 5FPHA 4P33A 4LV8B 1XX6A 4R9UC 3H86A 4B2LA 2A9KA 2GF0A 3IEVA 1G8YA 3E2IA 2KBEA 4H0LC 1QHHA 5HGQA 3THXA 2D06A 1OIXA 3SJZA 4QL5A 3I5YA 2MMCA 1ZCAA 1NG9A 4A3CG 1HT1E 3NBXX 1GUNA 5EQTA 3ONWA 4DUZQ 3CC4A 3A74A 1NVWQ 3Q5EA 2BDOA 3KJPA 4KLZA 1NLFA 1T5IA 2H5XA 3GTGH 2H7VA 2QP4A 2YWGA 2NO0A 1UBCA 1X65A 1H8HA 4G01B 3TVTA 4B2IA 2ZRBA 2J0UB 1FZQA 3DZ8A 4O25A 1XZQA 4EFMA 4GLAC 2YU9H 2JLVA 3DOFA 1RRCA 3K70B 2BIFA 1TQ6A 2W6ID 3FTQA 4Q9JA 2NPFA 4A4DA 1G3RA 4KVGA 3B85A 1JJCB 2DWQA 1I4TD 1AH9A 2FNAA 2OBNA 5KYKA 4A75A 3NBYC 1PYSB 3C41J 4KXFB 2JEOA 4PAOA 2EDGA 2QROA 1A8VA 1E22A 3U4ZA 1XJQA 2OG2A 2I5MX 5CYOA 3F1ZA 5HKKD 2IUSA 1OPXA 2IHEA 1MJEA 1S1CA 1OYYA 5DISB 1VCOA 4JI6L 2WJHA 5FPSA 2AWOA 2NIPA 3ER0A 4BY1H 1D8LA 1NSFA 4BFSA 2MFIA 1X1SA 1F5NA 1KD1C 4O3MA 1L1OB 4A3FH 1XU4A 1WA5A 3OW7A 4PXAA 4YONB 2K52A 3SC3A 3I4MH 2RGGA 3GJ3A 2IX1A 3AFQA 3ASYA 1KZ7B 2OXRA 5JEAJ 3SNHA 1IZ6A 4JT2A 4JKIA 2PZGA 1E2KA 3K9HA 4JBKA 3QEJA 3W8NA 4A82A 4B3FX 4DB4A 3GLGA 1E6CA 5FUXA 4A0FA 4D4KA 5EXPA 2FG5A 1R5BA 4YDHB 1CJKC 4JVSB 3PO2H 1G7CA 4RD3A 2ZSDA 4J15A 4OO1G 3UE0A 3KX2A 1Q12A 2IXFA 3A1TA 3EBEA 3OTOQ 4US0R 3WYGA 4LF8Q 1HV8A 4QJFA 4HIDA 2UVQA 4QNRA 1KK3A 5EXTA 1YNJC 5SZJA 1K8GA 3V4FA 4DB2A 5LB4A 2GNOA 2QAGA 4BY7G 1FP6A 1JR3E 1O3YA 4TTQA 3TBKA 3K9LA 4DLTA 2WJJA 4AI6A 2PMZE 5J4VA 1C7YA 1KNQA 3CXCA 1OFHA 1GILA 1VMAA 1YR9A 5EUMA 5FOXA 3GP8A 1Z6HA 3FHWA 4GLVB 1PVOA 2CVHA 4O0MA 4TMTA 1T5EA 3CW2C 1GM5A 4DLWA 3C4JA 3KOJA 4V0MA 1IN5A 4MITA 3CCSA 1PH3A 3IDQA 4HI0E 1KI4A 4ZV4A 1KJZA 5E4FA 4K81B 621PA 1J8MF 4LHYA 3G82C 3EPJA 4C0LA 5H1SE 1FX0B 1Y1WH 2GBLC 4C0AC 2AD5A 2UUAQ 5FLXc 2ATXA 3ZQJA 2K5UA 2X2EA 4GKJQ 1W4RA 1E2ZA 2JA1A 1TL7C 4WZ6A 4DK3C 1H8HD 521PA 2AUKA 5K8TA 1UJ2A 2VA8A 4UQOA 5BW8A 3W3AA 3RZDH 1ZP6A 5CJPA 5CB8A 4LV6A 4HUQB 1S4QA 4L8GA 5JI2E 3EZ2A 3SHWA 2ZJPA 4JI5Q 1OHHD 2ANCA 3QUSA 3WRYC 4MGIR 2J41A 2GJ9A 1PLJA 2O0KA 3M4PA 2A6HC 3J80c 2RHMA 3VFDA 4URVR 2ZM6Q 2QEQA 4D80A 3A4NA 2VY3A 5DO9A 4HSEA 4X65Q 3W90A 5JMTA 3U60B 1NN1A 2HF8A 4PQFA 1RYFA 2PT5A 1X3SA 4KODA 4TYPA 3TE6A 4TL6A 3CUEF 2ZJZA 3ZH9B 3KJHA 2ZYTX 3M1IA 4LGMA 4OJQA 1E9SA 2B7CA 4D26A 2DFKB 2O8BA 3QIAA 3TUIC 3F0TA 4I4LA 3ZIAA 3P32A 4PMWA 4UY8C 3AVYA 2W83A 1CR2A 2WM9B 5IP9G 4Q03A 4RFSB 2VQFL 4KBFA 2QGQA 3GFOA 1GD7A 5GAEC 1AJEA 1IONA 1N5IA 1NI3A 4LJ8A 3TW8B 1K73C 1CKNB 5DNYB 1K0RA 3M3YH 1P72A 4B74A 4NXMQ 4TMKA 1L1OC 3IPYA 4DR4Q 3UMRA 1CIPA 1SKYE 2ONJA 1H65A 3U44B 3RS3A 3WXMA 4DAYB 1E0AA 3KDFA 5ANRB 4KI0A 4F93B 3QXSA 1DD2A 4X64Q 2BM1A 4E5UA 4A15A 2DFNA 3IEUA 3T5GA 4Y0AA 2Z6VA 1NMXA 2VTKA 1F2UB 1KSFX 2WWIA 3BC1A 3LA6A 1HUQA 1W2GA 5M04A 4BLQA 3FVQA 3IIKA 4C2UA 1YEZA 1OB5A 2G0NA 4CDGA 1YZUA 2MSDB 2X77A 1Z83A 1LY1A 5GADl 2WP8J 2WWFA 1CTMA 4DR3Q 3I8SA 4URUR 1OXXK 2ZRIA 3GLIB 5FUYA 2BEJA 2N78A 4KU4A 2OLJA 1HR0L 2DFTA 4XD7D 4YCUA 2P3SA 5FUWA 721PA 2Q2TA 2B8GA 1SFOH 2R6AA 1YRBA 3EZFA 2YOFA 2ZS8A 4ON9A 1BKDR 4UNQA 1IY0A 1H9RA 2KB0A 4NE2A 3KB1A 2OE2A 4QQBX 1M1YE 1TQ2A 5JEDA 3CRRA 2VHCA 3DHWC 5G41A 2N46A 2VP5A 4YCWA 1N6KA 2IXGA 3QENA 4LFBQ 2FGJA 4Q4LA 5M3MG 4ZI3A 2GJKA 3FHTA 4Q7JB 2EYUA 5SZKB 1NE3A 2RGAA 4URWR 3T34A 2V6JA 3UIEA 1A82A 1EFCA 1I2DA 4IPHA 1EFTA 3D6TB 1EFHA 3VKHA 4Q19A 4GKKL 4HJ8A 2PPBC 1G51A 1KK1A 1Z0IA 4BBSH 5IK2D 3BOSA 3NDBB 5HE8A 3EC2A 4HJAA 3S14H 2GVDC 4DCTA 3I62A 2BMEA 1YZGA 1HH4A 3AF4A 3LLMA 4DR7Q 3OIWA 4M2LA 2Q3HA 3GLHE 4IJMA 2LXJA 1EOVA 3EXAA 3ZD6A 1QVGA 1CKMA 3L0OA 4Z54A 5M3MH 2DNCA 1PH7A 1XDBA 2OTLA 2GXUA 3OAAD 3PUYA 3HPRA 2AXNA 3ADDA 1NMYA 3DPUA 4KN4C 1COWA 1ZIOA 2V1XA 4PHTA 4XWAA 3EX7C 4HUTA 2N8NA 1KO5A 3U3JA 1A0IA 1T9HA 3CP0A 1IN8A 1QHHB 2C98A 3AEVA 4DV7L 1FUUA 4XH9B 1T8UA 1NLZA 3HOUH 5FLMG 1F48A 1XTJA 1EX7A 2KA7A 2R6DA 1PH6A 3P4XA 1HZCA 1E4YA 3R20A 4AIIA 2WJGA 1E9FA 3Q8XB 5IT5A 2E2IH 3KF8B 1UPTA 3AKCA 4P4TA 3FKSD 4GSYA 2W2XA 4I1SA 3RDPA 2PQAA 2IHYA 4YY3L 4CEJA 4GBMA 3THWA 5F9FA 1W2BA 1XTQA 4BFXA 1R0WA 2ECKA 5SZIA 3TJZA 1U2RA 1HE1C 4DDVA 4LCBA 4X66L 4EAQA 2FSIA 3LVRE 4OQFA 3RVBA 2FA9A 5KO2A 1II8B 2ZPTX 2NVTH 1L7VC 4NYMR 1HPCA 1I3QH 2ZSEA 3AVUA 1QRAA 4RZXA 1DELA 2K5HA 1K3RA 2QA5A 5JLJA 2PJZA 3SDZA 1IBLL 5JBQA 4A3LG 3F8TA 3NIBA 3K0SA 2IUUA 4AKGA 1OFTA 1WP9A 1GUOA 1EWHA 4UXHA 4DSUA 2XJ4A 1G3QA 5F98A 2XOKA 1KI6A 3A5UA 3CX6A 1H95A 3PF5A 5K8LA 1C9OA 2D3WA 3QOFA 2H1LA 2E74C 3R8FA 2RB4A 1Q3HA 4ITRC 4PZYA 1B7YB 3A8JE 3DM5A 4WAUA 2QSYA 2WWGA 5J4HA 4QBFA 4YMSA 4PZ6A 5ELXA 4LWCA 3HOVG 3K0CC 3VU9B 4JI1L 3K09A 3TREA 4LBVA 5FJ8H 5C44G 5DI3A 3VX3A 3BZKA 3NENA 2A5YB 2EW1A 4HLUC 5KPJA 1NL3A 2Y0SG 4M1YA 4ACBA 2J0SA 2ZUBA 2CJWB 5DE3A 3K7UC 3HJNA 1II8A 2C04A 2R2AA 2UXCQ 4NMMA 4EPRA 3RS2A 3AYHB 1W49A 2O8BB 3AKYA 1P2VA 2FN4A 3AQ4A 3CNOA 5IF9A 2G77B 4BY7H 3U6KA 4DLUA 421PA 3LWNA 3T56B 4TZ0A 3P27A 1XPUA 4JV5L 2ERXA 4P75A 2YJTD 1P2TA 2PEYA 4QG7A 4Z8XA 3TMKA 4TN1A 2IYXA 1B9MA 4A3CH 1HH2P 1TWFH 3RLNA 3FHOA 1JB7A 1VPLA 2R7ZG 4IDQA 2VPPA 2AWNA 4CVNA 4BA1I 3V4RA 1NVVQ 4LFCQ 1J6QA 4DV5L 4NDZA 1E32A 5BN3A 2C99A 2NZHA 2VLIA 2VF8A 1KYIA 2X8AA 1LB1B 1U9IC 3GDEA 3S1NH 1KSJA 5JFGA 3PUWA 4MQBA 3PO3H 3A5ZB 4LV5B 5IT9c 2VSOA 5HE9A 2EVBA 4DR5L 1PZNA 1XXHB 1G3IA 3WP1B 2BHRA 2QN6A 1H9SA 4ALPA 1W44A 2ZETA 3AP3A 4DR1Q 3EC1A 1OXVA 4PHHA 4UXIA 4C0SA 4CGZA 4EQ6A 4NYIR 2ZS9A 4BY1G 3SN6A 1NVXQ 5GVSA 4L5BA 2FMXA 1P9NA 4G0NA 1H9KA 3SI7A 2OO7A 4GLXA 2V4ZA 3DLLA 1VYTA 3T53B 5FFMA 1E2NA 4IJLA 1KO7A 3L2OB 4POAA 1SVIA 2OAP1 2QEXA 4QGUA 2CK3D 4TKOB 4G1UC 5KSZA 3EZ7A 1OXSC 2E5LL 1W1WA 2WJVA 2V4DA 3B5JA 2DB3A 4PG3A 1XMJA 3BGWA 1JPJA 4DT1A 3H84A 3M6AA 4DEYA 4QGGA 2J5XA 4RCYA 1NIJA 1VF7A 1IN7A 3CZQA 1X8KA 3HOYG 5CIQA 1KIXA 1Z63A 4FWIB 3GTKH 4D2IA 4DBLC 3CD6A 1A62A 1LS6A 4OO1H 3LDAA 3LW7A 3HOXH 5DHAA 1SKYB 5DGXA 1FP7A 5DYIA 4QC2A 4TL7A 1XMIA 4E09A 5B58C 2IHBA 3DO6A 1KO8A 3EQLC 4BLOA 2ZRMA 1HTWA 3WWVA 3FPAA 1EG7A 1XPOA 2SHKA 3FKIG 2JA7G 3Q72A 4NYJQ 1P61B 2RH5A 5CLQA 1YZNA 3W1GA 1QHYA 2YINC 4OJKA 1N36Q 4QHTA 3W8RA 2B63H 1GIAA 2R62A 4JSYA 2EJFC 2P5SA 1YIJA 4RSGA 1XNQQ 1NMFA 4AYBG 3QXCA 3CCUA 5DLQC 3ZS8A 1I94Q 4LHVA 3DOEA 3VQTA 3GD7A 4NYJR 3UXMA 4BASA 1MABB 2XZPA 1KI6B 1RIFA 3BFKA 2ZTCA 1Q82C 3AF2A 5JJIA 4MKGA 2OUKA 5TV2A 5K8UA 1KHIA 4MRNA 1Q1QA 4X8OA 4EPYA 4KJZA 3F2BA 2B63G 1W47A 3G48A 3U4VA 4FMCB 3REGA 2YYZA 5TB5A 3KQHA 2O8EA 1NP6A 2JATA 3CKLA 2O8FA 4OBEA 3ND9A 4DLRA 3L0SA 3AM1A 4GN3B 2R7FA 3UDFA 4KMUC 1QVFA 1QHGA 2F4VL 2RMKA 2XNDD 3CX7A 2AXPA 1X1RA 4EQ5A 4TL8A 5C1BA 2FV8A 4A3BG 3J81i 1E1TA 4DLVA 1N9WA 1TWCH 3U2QA 2OFOA 3VNUA 3S16H 5LMNW 4CEJB 1IYUA 3GFTA 1P7CA 2QTHA 2WAQG 2PZEA 3EA5A 4JJKA 5JHHB 1AGPA 3E9HA 3A8KE 2F1RA 4IW3B 1ONLA 4YMTA 2WWYA 3CRKC 5IWAL 3GJXC 4IPCA 2CK3A 1VG9B 3TH5A 4AIMA 3VTKA 5JWRA 4F7WA 1F2UA 4KHPL 3DEFA 4M8NE 4EFNA 1ESMA 2NN6H 2AUJD 2EWWA 2ZRFA 4JLOA 2PBRA 3AKEA 2YHSA 1NN3A 3PF4A 3RLFA 1UEBA 2EFCB 3GLHA 1GG2A 4G5QA 2QQEA 4M0LA 3S17H 3ZGXA 3D31A 1SGWA 1TF5A 4M21A 3KDFB 2CHQA 4MGKR 4UNSA 1PLKA 1BBUA 1Q1BA 3CRVA 3B1YA 4CIDA 3O8BA 3KJGA 3S1AB 4AKIA 1VTKA 4MYTA 4NBSA 5IRCD 1GHKA 2ZTEA 5GAGC 1E79D 3U7EB 2ATWA 2PL3A 3FB4A 2KCMA 3BJUA 1JXMA 4A0HA 3QXXA 3CWQA 1EXMA 2Z5FA 3TZUA 4MRPA 2O8CA 4PC1A 3W9YA 3I61A 1SULA 1TU3A 1YJWA 2ZRHA 4B47A 4MRSA 4JC0A 2J46A 5EZ5A 4JOIA 1NBWA 1VQFA 1Q81C 2F43B 2Q2IA 2ZS7A 1S3SA 4YLGA 4A0GA 3LVQE 2CW0C 5JEEA 4DNRB 2ZYWX 1DXMA 1SHZA 2ZRGA 2Q3FA 3AVOA 2NZ8A 4I99A 3HOXG 4NTZA 1GNQA 2ZITA 3AH8A 1Q7YC 3UMSA 4DCUA 3CCQA 1R9TH 5FPYA 3AVQA 4LUCA 3T1HL 1PUJA 1GKYA 1IL2A 1W5TA 2IBMA 5GVRA 2ZM6L 1G3MA 2R6CA 2ZE8A 2IS4A 2ZE6A 4JI7Q 2FU5C 4B2PA 3C14C 4EKDA 2I1VB 2ZI7A 3AVWA 3GCGA 5J47A 3U3MA 1WI5A 3BERA 4U00A 3K09C 2UUBL 2A69D 2KE5A 2TMKA 4ZCMA 5JCZA 1X3GA 2FFQA 1TWAH 1DEKA 2QMOA 4NH0A 5FOWA 1UKVY 4IOJA 3WP0A 2GDJA 3T1OA 2VQSA 2J45A 4G3XA 1DE0A 4Q4HB 3AVVA 1EWRA 2VQFQ 4Q4HA 2GK7A 1A7JA 2RGDA 4LFAL 2WSMA 2ZRJA 3BS4A 4FW9A 4HATA 3OAAA 1FUKA 1MO3A 2JIZD 4LYAA 4A4IA 4TQAA 2GXSA 5UKDA 4BFZA 5C2JB 4FCVA 4OI4A 1T6NA 2ES2A 1VIYA 5GJWC 1SRUA 1UKZA 1A4RA 1E96A 1IAQA 3E5HA 1T8TA 5CM8B 1C9KA 4N0DA 2A5FA 3SZRA 1OFIA 5IYCH 2J87A 3BK7A 3W3ZB 3BXZA 5KOYA 3GLFB 4DUZL 1FNNA 1SHKA 5L3QB 4Q4AA 3U61B 1GRQA 4IKEA 5JRZA 1IN6A 3GQBA 2FPKA 1Z28A 4DV6L 4BXXH 3RHFA 4C2MH 2YWFA 4M1TA 1LYLA 4DNTB 1ZC3A 4LHZA 5GJVC 4LJZC 5BR8L 1G8GA 1RPZA 2Z4SA 4LWZA 1FFHA 4P74A 2Y0SE 5BN5A 1F2TA 2BWJA 3M4QA 2GZHA 2KI5A 3OEED 4LJ4A 1OIWA 3MMPA 3PG5A 5EE3A 3A36A 4BLTA 3L2PA 4HLQB 1NBMD 1YZTA 4IDPA 4P31A 1QHNA 1BO6A 1Z3IX 2ZE7A 5HCNA 2O8CB 2CMKA 1Z0JA 2WIBA 4IEEA 5BYKA 5J4KA 4L8JA 4DUGA 4JBXA 5J4LA 3KFUA 2AN9A 2PQAB 2CWPA 2Q9AA 1XZPA 2WPDA 4GP6A 3R7WA 3TAUA 4JLJA 1US8B 5DI9A 4BFUA 1N6LA 1Z29A 2AK3A 1G3UA 5L3SB 1TF7A 4IFDJ 2QPOA 4C0QC 2ATVA 3HR7A 3QBTA 1V5WA 3LX5A 5KSYA 1WYDA 4JBWA 1WCMH 4DV1Q 3ULPA 2FFHA 1GUSA 3W6OA 1T3SA 5CLLA 4XWKA 5EUQB 5M5WH 1YHQA 3ZVLA 1UEJA 1JALA 1Z07A 4KV9A 3ND8A 3TEHB 1FOEB 1E2HA 2ZJ5A 3GEHA 1PH4A 4KN7C 3AP1A 5TY0A 1E7ZA 2ZRCA 4PTLA 4UNNA 5C4MA 2R93H 1AKEA 3L8ZA 4RD6A 3VU9A 1TQDA 4BQSA 4D0LB 1W4BA 1XBTA 1PH1A 2I0QA 1PJRA 4LJ5A 4B3DA 3IBYA 4ACAA 1UE6A 3D4RA 3SQWA 3GTQH 2PCLA 2IEYA 3STBC 1FTSA 3BORA 1XNRL 1JXOA 5L3VA 2J1LA 1AIPA 4V0KA 4IXNA 4PHFA 3L7ZC 4PPNA 2QE7D 1Y69U 4PQYA 4WVFA 5FTJA 3Q85A 3LWUA 5EP4A 5KNBA 1LM0A 1G5PA 1KOFA 1UDWA 4JLNA 2IYSA 2ZUCA 3I1FA 4PZ7A 1TMKA 2HT6A 1KHTA 1J2JA 4O2DA 4A9AA 3TRFA 4AG5A 1EQRA 3T1YL 1RFLA 5FI1B 2Y8EA 1DO0A 2XZOA 2N1BA 3BFVA 2OFXA 2EVWX 5CDFA 3LLUA 5A0FA 3OEHD 4LJ6A 1SMYC 3K70D 4I1VA 3HWSA 4K0KQ 1EFUA 1G5RA 3EASA 3GEEA 1AKYA 3H0GG 5FBQB 1IW7D 4DJTA 5JS8A 4B3TL 2CCGA 1TPZA 3REFA 2VF7A 5C0XI 1QJOA 5TARA 1XJCA 2ORWA 2K7VA 3G6EA 4ME3A 1YRAA 4JLDA 4Q18A 4GZYC 4PX9A 4GOPA 2QENA 3CH4B 2QZ4A 4Q9LA 3H3VH 3JZMA 5EAYA 1CI3M 4DV4L 1LF0A 3C8UA 2AKYA 4LDJA 1ZMXA 2ZVQX 4KHZA 1S1MA 3CCRA 1RIPA 3HR8A 4C3JH 2RKOA 2R7DA 4IDOA 3SFVA 2GJ8A 4CRWB 3J81j 2LMCB 1VQ5A 5AUNB 2WPDD 3GJ5A 1ZYRC 3A4MA 1V8QA 2V8OA 3C16C 3TAHA 2OT3B 5KUTA 1Q0UA 3CRQA 4P4SA 1KMHA 4NCKA 2ZTSA 5E7JA 3SR0A 3QF4A 2OZEA 2AFIE 5K36G 1XJ0A 3KFVA 3PUXA 1SZPA 1WXQA 1AS0A 4A3JG 1A2BA 1E9BA 1Z9FA 1EFRD 3AF1A 2MSEB 3FE2A 1D2EA 1XMQL 3GJ8A 4DLSA 2XXAB 2FF7A 1E1QA 1E2LA 4P0TA 2IC5A 5FOUA 4CEIA 1BMFA 4DDTA 2ASBA 3UWOA 2E75C 1Q86C 1E1RA 4MYCA 3S24A 4OQNA 1N6PA 4TZ6A 4DR7L 3T06B 2VEDA 1Y8OB 1W0KA 4A3DG 4G5SA 4AQYQ 1ZNYA 3B8HA 4HB3A 1PV4A 4UNPA 3CF2A 4URYR 3HPQA 5DH9A 3U3RA 2NVYH 2BV3A 4BE7B 3UWKA 1N2CE 4C30A 2FOLA 2EFDB 4D4JA 2QF7A 5KDLA 1P5ZB 3KXIA 2ZSFA 3OEEA 5GJBA 1P62B 3VX4A 4EQ6B 2A69C 3LNNA 2LSSA 1IN4A 2FEMA 1XMSA 2BJWA 3CM0A 4QRHA 4TLBA 4WBSA 3U3OA 4ZIRA 2ZU0C 1AN0A 1CFMA 4DPGA 1VG8A 2CEAA 2GF9A 4Q1EA 4RFVA 1O7IA 4UP7A 5FTMA 5KPDA 3EIHA 1GUTA 5AJXA 1XD2A 4C0HA 2JLRA 3S15H 2HV8A 2YTXA 1AS2A 2W0SA 1XD2B 4NONA 4NL4H 2JA9A 4URXR 2Z43A 4KSBA 4DIDA 2IX3A 2IYTA 1WJJA 1BS1A 4X8MA 4B3ML 5ELOA 4JI4Q 4PSAA 1NNEA 2FFAA 2ZRKA 4ARZB 3J81c 1XMVA 3JZAA 4A6PA 3IGFA 4A3GG 1E2GA 2QAGC 4TT3A 1VQPA 4B3TQ 2G9NA 5HZHA 3NDPA 2BKUA 2IYRA 3MWYW 1OKKD 3NG1A 1OJLA 1G20E 2F3IA 1RKBA 4AYXA 4KKUA 5HPYB 1ASZA 2A1AA 1KY3A 1XCGB 3HOWG 1G5TA 3GTPH 4JI7L 3QG5A 4RVCA 2F4VQ 5FTLA 2KBFA 5C4XG 3CBQA 2C35B 1Z5ZA 5CITA 2N3SA 2REOA 1UFQA 3CWZA 5EZ6B 2G83A 3BB1A 1UF9A 4AKEA 3GLIE 2PJRA 5AJYA 3WMEA 1HR0W 4HB4A 1HCZA 2GXQA 4QM7A 4CEIB 1NBMA 3CCLA 4Q21A 4NXML 2A5GA 2ALYB 1NJFA 4B3XA 5JSZA 1J7KA 1UBFA 5H68A 3RC3A 2ZI4A 1UAAA 4IXMA 4JLAA 5LD2C 1YZKA 4JK1C 3FMOB 4LF8L 1E69A 1XNQL 4DLXA 1SXJD 2ORIA 1I4DD 5IP7H 1N36L 5DLQE 1QF9A 1D9ZA 4HAVA 4JKYA 3GJ4A 4OK3A 4HUQA 1Z8FA 2F3TA 2REBA 3KUDA 3LBHA 2IWHA 1VIAA 2RHQB 3JC66 4LC0A 4C7OB 2VL6A 4FWTA 3AFPA 5P21A 2UXCL 4XTCS 2QPAA 1CSQA 1OB2A 1KI8A 4KKSA 1Z0FA 2WB1G 4JBJA 3TW4A 5IP7G 1LACA 2FH5B 2YOGA 2RAPA 1EQQA 1GFIA 4FD2A 1K8MA 1HNXL 1TNDA 2KENA 1GWNA 1HZAA 1IBKQ 1FMLA 4JI3Q 4KYIB 4M9ZA 4EPVA 1VQ7A 2YWHA 4P71A 2UU9L 2V55B 1S9HA 3A58B 4LK1C 4IDNA 4JCVE 3UDIA 4V0OA 5AJWA 3FPPA 2QL6A 4EJSA 1ZUHA 3QPVA 2BBTA 3GTMH 1SVLA 1L2TA 1UKEA 2CXXA 2JA5H 4OHZA 1QBKC 2ZTDA 1XCPA 4Q9KA 3MUFA 3ZJYA 4IPGA 1YHBA 4GOXA 3NC0C 1NLYA 1FYCA 1E94E 1ZINA 1G7TA 2C9YA 1ETUA 3UG6A 1U94A 2UUCL 1S3GA 3HOYH 1P9WA 4YWKA 1KMQA 4MTNA 1AZSC 1YU9A 4FMCF 4L4UA 2OCYC 4OWTB 5DYGA 2FPLA 2OV2A 1E2QA 2NMVA 1VQDA 3L8YA 4FCWA 3T35A 2IYVA 1HNXQ 4B75A 1LUZA 3UG7A 4XOIA 2WB1E 1M8PA 2FZLA 1WRBA 3UMFA 1H9SB 1KC8C 2QT1A 2XB4A 2HDNB 3UPUA 5JCPA 4OL0A 2VHQA 2VP2A 4RD2A 3EIQA 4IOCA 4DV7Q 3VAAA 2E5LQ 1X3FA 2QPTA 1NJGA 1QG2A 1R8SA 1E9AA 3I32A 4LYJA 5FL7D 5FTNA 1A5TA 1XTSA 5BYJA 2JXMB 2W0MA 4LF7L 1N5KA 2B29A 4AYBE 1UADA 4B6FA 3QKTA 2GCOB 1DAHA 2A30A 1GTVA 1EWIA 1I2MA 1CRQA 4Q1BA
chains in the Genus database with same CATH superfamily
4AM8A 4MRRA 1BXZA 1T29A 4J16A 5CDTA 1JU4A 2NT3A 2HF2A 2RGBA 3LT1A 1UZMA 5G53C 5C46F 1DU4A 3GPIA 3P4UA 5CGQB 3DDHA 1XQ9A 2B39A 4ES6A 2GJAA 2A68D 2HRZA 1JKFA 5I3CA 4FF2A 4ZOQI 2VDPB 4OTZA 1G42A 4AT1A 4PN3A 3DKVA 2NQ8A 1C9NA 3NIFB 4AMUA 1SE2A 2B3GA 1KA9H 3OLYA 5KU1A 2WJ6A 2XPCA 2XGJA 3M4NA 4H02A 2WWWA 3S2DH 1PH8A 1MX9A 4R3NA 4BZPA 4DDMA 5L6LB 1UKAA 2P69A 1P8LA 3DD1A 3HFRA 2BDUA 3A9WA 3E1SA 3OEWA 5T4EA 1MRNA 5K0EA 2WA2A 1ZNZA 1G8SA 3LXXA 1ULBA 4NZYA 4CQLA 3NE5B 4D0GA 1VQBA 3F2DA 1N0WA 2NO7A 3A6EA 2Z1CA 3MBIA 4CLOB 2W42A 3U4QA 2IW3A 2EOTA 1ONBA 5BQ5A 3T9DA 2VZAA 3VO9A 3K6JA 3FOFC 3EROA 3WLPA 2ZJQA 1H1LB 4JB3A 1JB3A 4S35A 3T7TA 1T9CA 4WD3A 1N7IA 4RDCA 4ZVTA 4DQUA 4YAGA 1KMCA 5BQPA 2P0AA 1HEUA 3JPYA 3TZEA 4B0PA 8ADHA 5ELDA 4S1OA 4ZPXA 3TNJA 1Y8QB 1KY4A 3QTBA 1BKBA 2VNKA 4JXKA 4UNRA 5IYBH 5FHQA 1ZJWA 4E94A 4KUEA 1FXUA 5TSDA 3D43A 1FFGA 2OMKA 2JH8A 1NP3A 3NJRA 1ZEQX 4JXZA 3WGLA 3MHTA 3NP8A 4ARIA 3EQ7A 1B3QA 1YZQA 4IFDH 1YNJD 1KAGA 2RGNA 3BWDD 3EFEA 4PNPA 3PFGA 3NWOA 3SOPA 3DD5A 1ZAYA 1W4AA 2RHHA 4Q37A 5FI5A 2PN1A 3KLMX 4MWEA 3NVMB 4CJ0B 2QMUA 1GG9A 1SCKA 3AQIA 3G2JA 4KQ1A 3IUQA 4ZT7A 3SZOA 3L46A 2A1UB 3RTDA 1WOYA 3EY9A 1L7EA 3L43A 1P6XA 2R8OA 1QKJA 3OQVA 4EJ0A 2XB9A 3MSXA 3DO5A 1EX9A 1DVRA 4UBKA 3N8HA 3GRRA 2W2PA 2XNSA 2JW5A 4LMRA 3FI9A 3QGMA 3OESA 2NB0A 1ONNA 3LC0A 2BFCA 4PCLA 1JAXA 1NAIA 3I6BA 2K2WA 4GI7A 4RESA 5H7XA 2EP7A 3K2EA 3L1IA 4QG3A 4RTNA 3DQQA 2HCJB 3ENNA 1C80A 5KYUB 2G1KA 5HNKA 3TSZA 4QGFA 4UCWA 3SYRA 5AXBA 1K4KA 3BTUA 5TQ2B 3GDGA 1H5QA 5AKKA 3ZU2A 3N2ZB 1MHWC 4IVRA 4Q1FA 2A68C 4WZAE 4R8RA 3VPDA 2OENG 4GRAA 4F4JA 2MSCB 4R4OA 2CXNA 3DBLA 3HV2A 5CHEA 4COOA 3S1AA 4R84A 3KPYA 4DUGD 2DNEA 3E9IA 4CHTB 3QVMA 4S1PA 4I5GA 1A5ZA 5JS1A 3E9MA 4QYMA 4LXIA 3BZDB 3VRHA 1FRVA 4IDGA 3VA5A 2WIDA 2V1UA 1MR3F 5ALIA 2R5WA 3ZDZB 3IEPA 1VL5A 3EIEA 3ST7A 2GZAA 4KIUA 4PTYA 1YS6A 1S5CD 4B6PA 1JHMA 1KFKB 1BXGA 1ZOSA 2VT7A 4IJVA 1YZHA 4RW0A 1JQEA 3NTKA 3K0AB 5D5QA 1XKQA 3DDUA 1BCPF 5HF8A 4JI3L 1P2UA 3FWYA 1QVAA 3K30A 1QE6A 1EDZA 1ITZA 1XWFA 4DAYA 5IKXA 3D1VA 3NPMA 4Z1MD 1EJBA 2QLFA 2VRWA 4NU8X 3FH0A 4MR8A 1BEUB 3M6IA 1G2QA 3AHJA 2B4RO 5IE8A 2OCKA 2H9YA 3DAYA 2HHLA 4YMUA 1S3OA 3QV2A 4W5RA 4KHPB 2QLNA 2A6EC 1JHQA 5KYLA 1U4PA 3H8SA 3SVLA 5A0TA 3OTHA 2GGSA 1HA6A 1ZGJA 1A7AA 3SQXA 2X0FA 1JBKA 3TQYA 3FWZA 2E87A 4PIPA 1PUIA 3I72A 1Y5RA 3FGZA 3OSUA 1I3QB 4TTTS 1Q8KA 1LI5A 2H17A 4JJEA 4A2PA 3OMLA 1CB0A 4HC4A 4FGLA 3QVKA 4PPYA 1JFVA 5GADC 2DWUA 1KSGA 1GPKA 3K05A 2AYZA 1AZWA 2OB2A 3LGSA 1UPAA 2PS1A 1WPRA 1JDBC 3LUJA 2AJDA 2V5UA 2Q4OA 3QI2A 3MA0A 1LLDA 4X92A 4AYTA 1OZGA 3FPJA 1IDOA 3H7IA 1UJCA 1FQKA 2D59A 2PXXA 4LTMA 4OQZA 5LQSA 4B82A 4ZYLA 1MHPA 5TNXA 3SSOA 3S1MB 3TQTA 5I9PA 2V1CC 3F2CA 2EJGC 1X7WB 1GP2A 2QP3A 1J23A 1V9CA 3KSUA 5FWAA 5JNVA 2DP4E 4B32A 1NBAA 3A2NA 4BNGA 1EZ1A 1JILA 3Q3GE 1CQIB 4UJ3A 3N6XA 2Q3BA 3M2PA 2FZ5A 4YS6A 1TWCB 4RZ3A 2GQ0A 1IVYA 3DE7X 1IEVA 2Z9DA 4HH0A 4PPGA 3HXMA 5A2GA 3V2HA 2WQZA 1IBLB 1LPPA 1XQ1A 3HCAA 5H3CA 3VXKA 1FIUA 3RQIA 1ABBA 3CUWA 5B57C 3PLRA 4O2BA 4L9WA 1CV2A 1OZAA 3V7UA 2H9AA 1EZ6A 3CQZB 1IIBA 1NDUA 2SNIE 2NO9A 3IVGA 3W5CA 1C8BA 1USWA 4NMHA 4MCIA 4CV1A 4DBLE 5HYVA 1J25A 1PG0A 1BRTA 1QRRA 2B98A 2GEBA 2VI5A 3AEUB 3AKDA 3LWZA 2G17A 2QAIA 2CL7X 2YWXA 2HFKA 5IP5A 3FRIA 3NGLA 4BCCA 1QDEA 3UGJA 3H2KA 2EXDA 3OTOB 1L7XA 1PR0A 1D7AA 2I2DA 2XUJA 4F3RA 1QGOA 1Y63A 1JFRA 2FQ1A 2YOHA 3ISTA 3A6DA 2EHDA 2MSKA 4MB2A 4WEOA 1Y1VH 5KNDH 4LA4A 4QTYA 1CF9A 2P9JA 2ZJ2A 3NYWA 2EZVA 3SCZA 3VMFA 1W6JA 4K1LA 2P77A 2V7EA 4KMOA 3MHPA 3VNBA 4RCNA 2YMQA 4KLKA 4OIJA 1X1QA 2GFIA 4HEHA 4F8YA 3DWFA 5I8PA 1BKYA 4R9RA 5TPWA 1XMOB 3JW8A 1HNZQ 1GDHA 4TWBA 4US2R 4ER5A 2SNMA 1CS0A 3AT1A 2VP6A 2FVYA 4QCLA 3SX0A 1N6OA 2G28A 2W2OA 3LQ1A 2BMFA 3STBD 4MNOA 3H6KA 2YTYA 4NOKA 4OHOA 1WNTA 5TX7A 3V1YA 2OYRA 4YXWA 3VR1A 1RADA 3K2BA 4Q9AA 3LBAA 1O96A 3TLMA 4A1OA 3U7FB 3OMWA 1PT5A 3A1WA 3FLAA 4RG1A 5FTWA 2EYQA 3RS4A 2XRYA 3M5DA 3L1VA 3H5OA 3RRMA 3FMFA 4N0QA 3F4BA 5A9SB 4TGLA 4FFLA 2XCUA 3G68A 5CYPA 3HRKA 1DCKA 1EM8A 2PKRA 3OWFA 4G84A 4Z2YA 4AJOA 5I9NA 4L0MA 2QQFA 1OHHA 1B0PA 1CJUC 2EY6A 4A92A 4DC9A 2XRFA 3L9XA 1WE2A 1Q6YA 2Z8ZA 3URYA 5H80A 1KO4A 5KAMA 3VHXA 4RUKA 3H05A 5A02A 1K8RA 4CM5A 1AXEA 2FW1A 3JASB 3NTLA 1YK1A 4FGSA 4NCIA 1TU2B 1BROA 1KNXA 2IHFA 1VFNA 1Y4ZA 2JFWA 1F9RA 1JQJC 2OBYA 2OV4A 2OFWA 1B2TA 2QQ0A 2VDWA 1QM5A 3H9QA 3M6FA 4RLSA 5HJ2A 3LHDA 5BWMA 2CJWA 1FRNA 3AJ8A 1PHJA 3IQDB 2P9HA 1QS0B 3KOZA 4XM0A 3SC6A 3E0QA 5JANA 4PQRA 3UB4A 4Q9IA 3WGYA 2E2IB 1JG2A 4ZQ3A 5E6UB 1IBCA 1GQOA 3VNRA 1Q16A 2HUGA 3KVNA 2RJOA 4RK4A 1L5GB 1EZ4A 2BZGA 3WJ7A 2D5CA 2DN8A 3PV0A 3WNVA 4BUZA 1KQNA 3T12A 4DPLA 2ZE5A 4JCCA 3WLMA 2RAVA 1YFZA 2I4MA 2WLSA 3A2MA 3GGSA 3A37A 3PCOB 3IPLA 3SE7A 1TXYA 1B0ZA 3A2LA 3B6KA 3BXEA 2YH2A 3DMRA 4EDFA 1ZKDA 4M1EA 4UAJA 4KO8A 3CPWA 1HWYA 3BUSA 1GCOA 1VIMA 4YP1A 5JECA 3T1YB 1GRVA 3CPFA 1VJTA 1W87A 4Y6OA 5K0NA 1RL2A 1T3LA 5JSFA 1CUYA 4RJJA 4BP1A 1ULZA 1UDBA 4DV0L 3NQIA 1VHDA 5DHUA 3BRQA 2H65A 3FETA 4NECA 4DIUA 3CZMA 3NFYA 3NNSA 5EI5A 3RASA 3RREA 3W5JA 4BLVA 2PD6A 3P2YA 3BHJA 4L1KA 4QATA 5FL3A 2Q8IB 4UTVA 4OUDB 3CW9A 3IAM6 5BT9A 3ZIDA 5LMNQ 2AR0A 2XYVA 4GECA 4AO7A 1ZOIA 5BSHA 2C0QA 1TA4A 5CT6A 1TAUA 1E66A 1EFVB 3I6YA 3K0KA 5FOBB 3O1LA 4L27A 4O1IA 5CH3A 5FLXL 2EFHB 2YBEA 2JLWA 1JFTA 1ZHOA 3SDSA 3OKCA 3GYBA 3DL4A 5K05A 1PH2A 1E9EA 2DFDA 4RTKA 3QPWA 1K8ZB 4DV4B 4HWGA 2CFIA 3AETA 3RUEA 3CSDA 4QBGB 4L9SA 2F43A 2BDEA 1GA4A 3TFQA 621PA 2QKIC 4URZR 1QGDA 1T9BA 1ZGZA 4HAYA 2XMSA 4ZKEA 1OWNA 4CJ2C 1U9CA 4Y6GB 5M5YB 1MB4A 3NBUA 3QEOA 3OO1A 4A8TA 3T1TA 5D00A 2V54A 2A4KA 2GD1O 2HMYB 1G9XA 1ZCBA 1NXQA 3FG9A 3M81A 4UVHA 2XF8A 3ZV7A 2I5LX 4RO0A 5E4JA 1NQXA 2FQQA 2XITA 2QRLA 4C4XA 3PWZA 1MO4A 4CEHB 4A8HA 4DY6A 4Z9FA 3PGJA 1C1DA 3KL4A 4D9EA 2HGSA 2JA5G 3TTSA 4F4UA 2BA0A 4FD3A 4YMGA 3AIKA 2GXAA 3ZUGA 5THQA 4WBNA 2EKLA 1XEXB 1F9SA 4U7HA 3J80L 1AQYA 4BFWA 3HB9A 1ZISA 5BV1A 4GX1A 2WJZB 1PZID 1TU4A 2PUCA 2I6TA 1XTRA 2Z9HA 4GMXA 4FS8A 5JW6A 1DOLA 5DOZA 5B2ZA 4CMEA 1BOFA 4D5GA 3L6EA 4UHKA 1GHTA 1VBMA 2CN1A 1C7IA 4W9RA 2AMCB 4WXPA 1KZGB 3CNBA 1D1QA 1NZJA 4M0PA 4KXUA 4E5MA 3RD4A 2WFLA 1N32L 2GYUA 3WX0A 3GJSA 5HUHA 2X15A 5JNUA 4NBLA 3PWKA 1BWPA 4TYWA 2F8SA 1T4CA 1NW6A 1WCV1 4JOIC 4MV4A 4ZVRA 3SBDA 3U3XA 4B85A 3WSWA 2BW0A 4GR4A 5E7QA 4BRWA 2K5VA 1AK2A 1AEXA 3D4BA 1YJ5A 1T1JA 1YNXA 4ZP1A 3BRCA 4D98A 2HLDD 4D6XA 1KH3A 5JCJD 1S0UA 4PFQA 5IGFA 5C0XJ 4OB6A 5BWCA 2H31A 4J76A 3S1QH 3EA4A 1U5BA 3ETEA 5LMUQ 2ID8A 2R65A 5LM3A 3F49S 3DBIA 3QX3A 3TDQA 2XUKA 3INTA 3H8JA 2WYUA 4BVKA 5AWFC 1TYDE 3A28A 3VSAA 4TS3A 3G59A 4L9RA 1EE1A 1C0PA 4RY0A 4FKMA 4L75A 4URFA 3JQDA 1WBJB 4LSGA 2J7PD 5DX0A 4OKSA 2C57A 3K73O 2BFBA 3HY4A 1IJFA 4UAUA 1SKUA 4LEIA 3FLMA 4J2OA 1UOOA 5C4XH 3UF0A 4E1VA 4YMLA 3ED5A 2NUAB 5M29A 2ZT9C 3FHCB 4UBJA 4ROSA 3WBFA 1UOPA 3ICWA 2JFFA 3ZBUA 3GW8A 1LBTA 1L8LA 1R64A 4CTKA 4JW0A 1X74A 4QIWE 4RIHA 3Q0IA 4X8LA 1GTL1 1BMFD 2YCBA 4PZPA 2E18A 4J7UA 3DMUA 2EYHA 1PT7A 1PJ8A 2DOKA 2VATA 3CT4A 4G24A 4AW9A 3IIIA 4D02A 3FYUB 3NELA 5HZKA 4A3GB 3SHTA 1TJ5A 3WWCA 4TVSA 1QUQB 4I4IA 1OF1A 5G1OA 2IHTA 2QS9A 3CF6R 3PXBA 4A93B 5LQCA 1ZH0A 4DUZB 1L5HB 2C5LA 1UXKA 2PLRA 4ZO4A 2LY7A 1B7GO 1NR2A 2NO1A 2A2ZA 2ZIAA 4RXUA 2DQKA 2Y2VA 4EY7A 4I6GA 3ZHRA 4YHHL 1PNVA 1U3DA 1E2VA 2C0CA 4P73A 5C4HA 1R7RA 5KQRA 4L4ZA 3JTEA 3TBHA 1VHQA 2VP0A 3KUXA 1UWVA 2MINB 1B8UA 3D4OA 4NOJA 1XD9A 3JQQA 4RNDB 1OXTA 4O4HB 5H70A 1PFSA 1Z88A 2I99A 1AZTA 1C41A 4IGIA 3PDIA 4CCAA 2ZPAA 3FSGD 1HETA 1U28C 4LQCA 2B3DA 1M2FA 3WHLA 2IPAB 3LBFA 3H75A 3IMEA 2FPOA 3IS3A 1JWLA 1WKVA 4Q34A 4KXVA 3PQFA 3PEYA 4RPHA 3VDXA 4IM7A 1BQ4A 5JRDS 1NLUA 2IEIA 4NYMQ 3KC2A 4XTRA 3W5VA 4CLRB 3C97A 2QTMA 3DONA 1Y4UA 5AOVA 1OAKA 1UIMA 3D3NA 1SNYA 4J91A 3OLXA 3UUFA 1F0NA 1XMPA 4B33A 2VZ8A 4DR1L 1XRMA 2UVPB 1V2GA 3HVRA 1XYIA 4FYDA 3DNPA 4TXMA 1HT2E 3U4CA 1RHJA 5BSUA 1KOJA 2GESA 2K5NA 2QTBA 3KF6B 2WILA 3KDAA 5BV0A 3KDSE 3RVSA 2VOEA 1QPGA 4EA6A 2F8MA 1QFJA 5JAMA 1DTSA 4ESVA 5JYEA 1H0HA 3GRCA 3W9UA 4Z4GA 4OKIA 2QTAA 3NTQA 4F9FA 1YFJA 4B7ZA 1PNRA 5C44H 1S4MA 2R6FA 2IDJA 1DOZA 1G7SA 4JI0L 2EBWA 5DJ5A 4ZZIA 4U39A 4FWBA 4H44C 1TIPA 2C3UA 3IP7A 2PUEA 5D86A 4Y2TA 3KOUA 1SD1A 5CCXA 2JFXA 1NBME 4MA4A 2KJXA 3QXGA 2ZIEA 5JBIA 1XNRB 2XQIA 2Q5CA 4G41A 4DJAA 1SCUB 5DLEA 1U7XA 4D8YA 3OG9A 3QFHA 4ZAXA 3RSFA 3T4PA 4OYYA 4F1KA 1G6PA 4M99A 4D4IA 3JQCA 3OX3A 4BC0A 3EIFA 2AOWA 4OKNA 4WWHA 1G64A 4HAIA 3FDIA 4OCZA 5ALMA 3SBXA 1MOZA 2ZAMA 1ICEA 1E8MA 4OBWA 3WA6A 2PYIA 4HS9A 4LFBL 1NQVA 3KAKA 4ASUD 1PTOH 1WFQA 2HEIA 2X9LA 2CF5A 5FJIA 4PO3X 3HNOA 2ZSHA 3K5HA 5E2IA 4GGMX 1RD9D 1J2EA 4DZZA 3SHVA 3OOCA 2HWYA 1XX8A 3F1LA 4EG1A 3MYRA 5CFRA 1OASA 2R87A 4IO9A 3BL6A 3JS5A 3PDHA 4LRXA 5DBFA 1LLQA 2Q0HA 4EG0A 1AHNA 1DO2A 1O78A 1Y80A 1CEEA 4C1NI 1T13A 3HCDA 3ERSX 3DZCA 3GB9A 4JL5A 1ECCA 4RJIA 4UUPA 4WV3A 1P80A 5JAZA 1QP4A 1WVGA 4EHFA 3AV0B 5B5SA 3A6ZA 2ZUFA 2UUAB 5J5CA 2A67A 1XVIA 3VR2A 4RZ2A 2ATCA 5J5AA 2PGIA 4DUYL 2ZWVA 1ANKA 1FXSA 3WB9A 1JJAA 1SCBA 2VZ9A 3ILHA 1PL8A 1I10A 2NQ2C 2L9HA 2FMKA 3GZ4A 3MJHA 2PFGA 3EYWA 5IT9L 5C6AA 2R8XA 3P97A 4OXYA 4CFZA 2WJ3A 3HDTA 1FFBA 2XSZD 1Y7PA 2E0IA 3KZ1E 1IOZA 5AW2A 3DWIA 5KWVA 5F1PA 3PXEA 2HK7A 4MDFA 1B2LA 4AS3A 1J07A 3I5MA 3KJOA 4GMGA 4CHGA 4GR5A 4V1CA 3IAYA 2B2VC 1B74A 1YGPA 2BGKA 2CGEA 3IQIX 4FE3A 4JEIA 4G9EA 4M38A 4BO1A 4EELA 5H16A 3K92A 1B44D 5T64A 5ALYA 2GN2A 2CFMA 1LPAB 2E48A 3PIP3 1QIIA 2W43A 3G2HA 2WWHA 4CDRA 2QRNA 2G70A 3SR1A 4A8PA 3I4NB 3WLKX 1B16A 1NXVA 1RWXA 3H1GA 4I9HA 3U7QA 4MV5A 2B2WC 4JYAL 3R23A 3WMGA 3EDQA 3SQLA 3WGKA 4IQZA 1NPYA 4JSTA 3AHFA 3T1VA 2VZLA 3GFGA 3HN7A 4QJ4A 5AJUA 1ECBA 3WMFA 4OELB 2I67A 4R71A 1Q0LA 3HLKA 4F4IA 3CPJB 4HDQB 3CF0A 1MX5A 4LZAA 4X62Q 2I54A 1B1AA 2D0IA 3OZFA 4CG2A 4JI1Q 5AKZA 2JDIA 2QY9A 5JAIA 1TS5A 4X65L 1VE7A 1R0LA 1M8FA 3BCHA 2RVLA 1AXGA 2P3QA 4K9PA 5FOVA 1T0IA 3Q9LA 5AK5A 4CU2A 4MWDA 1X13A 4WUVA 2C8VA 4ZQIA 2DEUA 1ESDA 4N9WA 3D8BA 3BK2A 2C61A 2YHUA 4HO1X 4P4LA 1QGED 2C29D 2PTHA 3TZHA 5DN9A 3H99A 3I0MA 1JDSA 1FCJA 4IFBA 4CIWA 6ABPA 1NN5A