1Q12A

Crystal structure of the atp-bound e. coli malk
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q12A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q12A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q12A01
2PEZA 4GS3A 1IBRA 2JLWA 3KDSE 4ESHA 1XTJA 4GMDA 3UMFA 2DN8A 4GOPA 2BMEA 4GZYC 2LMCB 1IY2A 5L3VA 2F7SA 3T1TA 3ZD7A 4EJSB 3M4YA 2GILA 3FFAA 4JYCA 1VQAA 2MMCA 4RD6A 4AI6A 1VCNA 4HB4A 3HOWH 3SDZA 1G20E 3MXNB 5JS8A 1NY4A 5G53C 2ORIA 3OFNA 1HZCA 4R4CA 2KBNA 3QKRB 1AGRA 1WCMH 5TARA 3U3JA 1AIPA 3RZOH 4XTCS 1EXMA 1ZRHA 2PEYA 4R98A 1CULC 4D4LA 1WBDA 2PQAB 4UXJA 1IW7C 2D0OA 3B1WA 2BHRA 2CVHA 2ES2A 1KO1A 2GEUA 1DD2A 3JVUA 3R9IA 3GJ7A 1XTKA 3PIPA 2B8TA 4G5GA 2WKQA 2NQ2C 1KGDA 4L9SA 5JEAH 1Y1VG 4IOAA 1HZ9A 3KJIA 1YVDA 1QHHB 4H1UA 5C3EG 3A4MA 2NO0A 2I1QA 3DZ8A 2A5JA 1ZW6A 4YDHB 2GJAA 1KO4A 2A6HD 1VQGA 1YRAA 2GVDC 1MV5A 3AF0A 4C3JH 4PZLA 5FBQB 3ZQ6A 3MFYA 4A3EG 4B3SL 4MTNA 4ME3A 3RS2A 5EXXA 5K36H 2J9RA 3BB3A 1B9MA 4OJKA 3HR8A 1A6XA 4JT4A 4D25A 2AD5A 2LWIA 1Q20A 1TU3A 4RCZA 2WZQA 1HNZL 1E2IA 1K83H 1KK3A 4S2EA 1VCIA 4A3GH 5FPKA 3J7ZC 4P31A 3L0IB 1CKMA 4QL3A 1Q3TA 1HZAA 2YWGA 4URXR 4WIAA 1TWFH 2JA9A 2N1BA 3DKPA 3THXB 1GOTA 1CIPA 2YOFA 3I1FA 4B3RQ 2V55B 4NONA 5UKDA 1W2GA 4ZV4A 3SQXA 3T56B 4DK0A 2QNRA 4PPQA 3NXSA 3OEEA 3MRSA 3QF4A 4IPHA 3IEUA 5DI9A 4DV1L 2X8AA 3KXLA 4HB3A 3TW8B 3WWVA 3LBNA 5FBVB 3P26A 1J70A 2HXSA 2QG6A 4JI6L 5JHHB 1K8RA 3HOZG 1R7RA 4CVNA 3FVQA 3MJHA 1MR3F 2OESA 3P4XA 4ILEA 1TAGA 3F5FA 2B8WA 4PPFA 2ERXA 2VL7A 4FMDF 5CB6A 4PX9A 3F1ZA 1CKNA 2IXGA 3Q72A 4JBMA 4A4IA 3OEED 3R20A 3LBHA 4WXPA 4QM7A 4LSGA 2I5HA 5BN4A 5FLMH 1TEVA 4Q66C 4GKKL 2WB1E 1O7IA 4FCTA 4JLJA 3RS7A 3HU1A 4NCHA 1G6HA 3K8AA 1XJVA 2MO1A 4HJ8A 1R0ZA 2K4KA 1QHSA 4JLPA 2Q2HA 2DR3A 5DISB 4ASUA 1Z2CA 4Q9HA 4JI6Q 2BWJA 1XMQL 2A68D 4XVQA 3ZYCA 2GF0A 3CBQA 5TXGA 1ZMXA 1GUNA 1LF0A 2JIZA 2VUMG 4FW9A 2FOLA 4JLDA 5KTYA 2GZHA 3EN2A 1IL2A 2F4VQ 1BYUA 1KZGB 4DPGA 4QFMA 1Z6TA 1O3YA 1WCMG 1CR0A 4ASUD 4DJTA 4ZCMA 3I92A 3QBTA 1J8MF 4G7OC 421PA 4E09A 1BBWA 1DAIA 1YZKA 2QROA 3KUDA 4JYBA 4BZXA 4OI1A 5AJYA 1U8AA 2D4HA 2XZLA 3GLHE 3D6TB 1T91A 4X62L 1E9BA 3UXMA 2BC9A 4CEIB 1JJCB 1XTDA 4Q19A 2IA5A 4CW7A 4ACBA 5KNCA 5JEAG 1W4CA 2J41A 4KVGA 5L3SA 2QRNA 1EQRA 3AVQA 3QI2A 3IFTA 4HJ9A 4MKGA 5EP2A 2VP2A 4DV3Q 1H8EA 3WXMA 1VQ4A 1AKEA 1SXJD 1VECA 2ZJ2A 1BDOA 3QF7A 4LV5B 2CK3A 3THWA 4JJZA 3F2DA 4NXMQ 1VPLA 2O8EA 3KKMA 2DHRA 1VQFA 1JXMA 5M3FH 1XU4A 4LYJA 2VPPA 4DAYB 3NBZC 3BH0A 2XZPA 5CM8B 1G19A 3C5HA 3FMFA 1H8ED 2CL7X 1TQ4A 3OYYA 1SXJA 1YZNA 1F2UB 3MD0A 1M34E 4NCJA 4NE2A 4B71A 1X3EA 2A19A 4KYIB 5LMNW 5FUYA 4YWMA 1DTSA 2VYFA 2EQSA 3FKSA 3HU3A 4JI8L 2YC4C 3OIVA 2IYTA 1A2KC 4JLBA 2CDNA 2QQEA 1I5FA 1GILA 2DFNA 3EASA 3OAAA 4I1SA 2CCKA 1JB1A 5JMTA 1FX0A 2CNWD 2IYSA 4LJ7A 621PA 3L7ZC 2QA5A 2ZM5A 3I62A 2GJKA 2EYUA 3J80i 2G1JA 4C9BA 1YJNA 1N8RC 4UP9A 4M1WA 3SOPA 2R92G 1YI2A 3CUEF 4BRUA 3FKSD 1FTSA 4LOAA 5KSYA 4HZUA 3WRXC 3LY5A 5AUPB 2PMZE 1EYGA 1KJYA 5CLLA 2PL3A 2ZU0C 3A6PC 3E5HA 1ONLA 3HGBA 4IFDI 4KAXA 2PT5A 3RNUA 3O8RA 2IYRA 2W6ID 2CQOA 1PLKA 2CHGA 3IPYA 2BJWA 4ON9A 3NE5B 4OQMA 3Q85A 3BRWD 3ECCA 2HIVA 3THXA 5H8WA 5GQOA 2R7ZH 3I4OA 2VS1A 4DSOA 4C3ZA 2NO1A 1ESNA 1ZCAA 1N6KA 2P0EA 2UU9L 2W6IA 5FBWB 1QZGA 4G7HC 1QG4A 2ZRFA 4Y0AA 4YWKA 3KQUA 5ELXA 4Q4JB 4UP7A 4JYAL 3CCUA 1OB2A 3CAMA 1YHQA 1E0KA 4LF4Q 1Q1ZA 1U90A 1T8TA 5SZJA 2HLDA 4YMUA 3LW7A 2OUKA 3CZQA 2IUTA 4BWYA 4JSYA 1P60A 3B8HA 1Z9FA 5FL3A 4DLZA 1UWVA 4X6AH 2FSGA 4DKXA 4DVGA 2F52A 4RZ3A 2ZSEA 2KCTA 5FPHA 2UZ3A 2IWRA 1BMFA 1E9CA 1UKZA 2BEKA 2W0MA 2ZTDA 2AKYA 1BO6A 1VTKA 4LV8B 3TAUA 4DHEA 4KCGA 1G3IA 3PUYA 2HYIC 5TDHA 3B9QA 2EWVA 1H9JA 3VX4A 3FHOA 3W5IA 1SVWA 1UDWA 2G77B 2E5LL 2GBLC 4OI0A 1CU1A 1U9IA 1KIXA 4JI5L 2GETA 1J6QA 1OH8A 3UANA 1H9SB 2ANCA 5M04A 4LUCA 3SQWA 1Y1WG 1W2BA 3EPLA 3CWZA 4M4SA 1NSTA 4HDCA 3K09A 5C4GB 4YXWD 1ZUIA 5HY6A 4JIMA 4KITB 4TVAB 5JRZA 2A6EC 1ZCBA 3CR8A 4D4MA 4DUZQ 3K0AB 1VQ6A 5BN3A 1NJIC 3CM0A 3UE1A 4KBFA 4U5XA 3SN6A 3QOFA 1P2VA 3NHBA 1YBYA 4LZZA 2EIFA 1EFRD 1OIXA 3T06B 2EJFC 3W1BA 1HR0L 3QG5A 1NNEA 1OV4A 2OE2A 2VW9A 2QM8A 2CCZA 1KSFX 1OFTA 4DR4L 4DLXA 1AE2A 2J7PA 5J4YA 1M7GA 1OH6A 3CNNA 3Q5EA 1XNJA 2ZVQX 4YY3Q 4UNPA 4A3JH 1EFWA 1H9MA 4LF7Q 3PO2H 3EWAA 1NKTA 4FD2A 1BOFA 3BDOA 5KPDA 4C0AC 1GUOA 2K32A 4A3IH 4R71A 4DDWA 4B76A 4GPTA 2XTNA 4XH9B 2PCJA 4WAUA 5AJVB 1C9KA 2QSYA 1S1MA 3CR7A 4TLDA 4D2IA 3NIBA 3QBVA 2A7QA 5KHOC 3CMAA 1QHHA 4GI7A 3FOZA 2MQHA 1GZSA 4A3FH 4DUYL 1AZSC 1W46A 4DAMA 3HOVH 4RD3A 1M1KC 4D6PA 4MUAA 4R4OA 1QHIA 2HUPA 1BVSA 1M6NA 1VG9B 3QUSA 5H70A 1ELOA 4UPAA 3I3SR 2G9NA 3W90A 2WP8J 3VKGA 3T34A 1N5JA 3QENA 2D06A 3TRFA 2GXAA 1HZBA 3A5ZB 1KY2A 2GVZC 3LXXA 4Q18A 1EG7A 4NDZA 1ANKA 1OFHA 1XXHA 3CRLC 2ATXA 2N46A 2HJVA 2UUAQ 2OQKA 1J7KA 2OCAA 4DNIA 1XRJA 2GXSA 4JI3Q 2ZS8A 2NVQH 4MKHA 4WZ6A 1N0WA 3Q7PA 4EFMA 4DB4A 1QBKC 4LCBA 4LX0A 4W5JA 4XJXA 1KHTA 4F7WA 3G5UA 4BLTA 3KQNA 3EPKA 1ZM7A 2OG2A 2WB1G 1IOZA 4K0KQ 2YWHA 1WFQA 1A82A 1ASZA 1KY3A 4OHVA 4M9QA 4X65L 1FP7A 4DDVA 1IBMQ 4UQOA 1S96A 2XX3A 5BR8Q 1GKIA 3CPFA 1PH1A 2F1RA 3P4YA 1N6LA 2J1LA 4MITA 1HPCA 3AYHB 1DAEA 1EIFA 1IN6A 4B74A 2OAQ1 3GLGE 2V6IA 4APVA 3EWSA 2BDOA 1OW3B 5JHGB 1EWIA 3CO5A 2YOGA 3W6NA 1NG1A 5FOSA 4GN3B 1YEZA 2H92A 1XB2A 1OYWA 1GVPA 3OPOA 4QM6A 4L8GA 3U4ZA 1KI6A 3BD9A 2D7DA 4A8JA 2ZRBA 2O0JA 4EDHA 4LHXA 3MLEA 4JI2Q 3THOA 4PPNA 1KAOA 1N6HA 1Z0DA 3W8NA 3HYRA 3ADCA 1PLLA 1XMSA 1CSPA 5DH9A 3FKQA 1W0KA 2IYQA 1G291 3ER0A 2J5XA 2JJ2A 5D3MA 4KLKA 4TLBA 4X65Q 4MRRA 3AVPA 3MJRA 3C4JA 4IXMA 1K6MA 3HYTA 4DCNA 1UEIA 1EFUA 4L5RC 3T1QA 2ZU6A 4A3JG 1KNXA 1MKYA 2W0SA 1FTNA 1MH1A 5IWAL 1HT1E 2G88A 3U9SA 4DV2L 3KTAB 3NWJA 3CC4A 3RYTC 2QPOA 5JSZA 1PUIA 8OHMA 4TYWA 4LC1A 3WHLA 5BN5A 1VQCA 5JWHA 5C1BA 3B1ZA 4URYR 4AURA 1X6VA 3CCLA 3L0PA 5KO2A 1V43A 5FPTA 3TZUA 3A4NA 1V9PA 1E4YA 3TQFA 1W36D 4MUBA 4C2MH 1NF3A 3STBC 3AM1A 2IXFA 3OEHD 3K0XA 4W9MC 1DG3A 4QNRA 3IQXA 4OXPA 4BFSA 1XCMA 1HH4A 3AP2A 4NHOA 4DLWA 5FOWA 1NBWA 1AS3A 3U44B 2KI5A 1ZNZA 1NL3A 4JVLA 4JZKA 1PH3A 4P3YA 2BKUA 5DHFA 1SR3A 1N32Q 3MWLA 5GADl 1SGWA 3QY0A 2O5JC 2WSMA 5HZHA 2VBCA 1E3MA 3I7FA 2P65A 4BECA 1CR4A 1GRRA 2Z6VA 1WCV1 3C41J 4DKAC 3K0AA 1KTVA 2QAGA 3WRYC 2JIZD 5IE8A 2FPMA 4B3FX 4M1KA 1KC8C 4FMBB 1RJ9B 3JC66 2H5EA 3Q8XB 1WDTA 2EFCB 2JA1A 1P9WA 4DLTA 4IOJA 1E2KA 4GKKQ 5M3MG 2XNSA 3UATA 4D0NA 1OH5A 5F9HA 4LBYA 4L5BA 4A0RA 3RANA 1ZU5A 4A3DG 2QP4A 4OO1I 1VG1A 2WKRA 4AWXA 3LO5A 4C3HH 2JLYA 1AGPA 2B7BA 1X54A 3S1NH 1JQJC 4Q5IA 2AN9A 4DCUA 3GJ5A 4G5OA 3TGPA 2AK3A 5DSZA 3ERSX 3K0CC 1JXOA 1G7RA 1KDRA 5G40A 4TQAA 5CYOA 4GLXA 1Q86C 2VF7A 1KD1C 4O2RA 3OOCA 3PSIA 3I73A 1XD2A 4NMMA 5FLXc 4JI3L 4I4LA 1O87A 2JJ8A 4X64Q 2ZR0A 1Y14B 3B60A 4PAMA 4DV7L 1Y3AA 2IS2A 5JJLA 3GFTA 1UE5A 3M4PA 4P71A 3ZIAD 1P6XA 1IM2A 5C0XI 2VSFA 4BBRH 4B3SQ 1DS6A 1EFHA 2W2TA 3KKPA 1PYBA 3TK1A 3DOFA 4BFZA 2PZGA 1TPZA 2ZE7A 1CR1A 1GAJA 1IYUA 4Q1DA 5EE1A 2O52A 1DAMA 3T51B 3SE0A 3EPJA 2WICA 1PV4A 2WKPA 1SULA 2Z0SA 1I2DA 2WOOA 2Y0SG 3KF6A 4DV0L 1J99A 2XNDD 1H8HA 2UXCQ 2OV2A 3O8DA 3OW2A 2Q2TA 4Q4AB 2X77A 3AFPA 4XTRA 2EFEB 2MSCB 1E1OA 4B32A 3A5UA 2ZAMA 1JALA 2NN6G 1EOVA 1S40A 4Q1FA 5IYCH 1EUJA 1G5RA 3CQZH 2CLCX 1IXRC 4IPGA 2R92H 2CNWA 1NY5A 1QVRA 2WWHA 2C2HA 3LH5A 3W34A 2IS1A 3BB4A 3BH6A 2IWHA 2ZRLA 3HJNA 1QRAA 5FI0B 4DR6Q 1US8B 2GESA 2Y8EA 5DIFA 5BQ5A 3KLRA 2JJ1A 4V0OA 5KDLA 3KFVA 5KDOA 3THWB 1D2MA 1NVWQ 1Z22A 1W44A 1D5CA 2EFGA 5GROA 3ASZA 221PA 3M1IA 4IOLA 4C0JA 4DT1A 2G3YA 2YC2C 2BBOA 2P5TB 5F98A 5IP7G 2PJZA 1B7YB 4QQBX 2GRJA 1OFUX 3KLWA 3SR0A 2REBA 4LHZA 5EE0A 2KBEA 1VIYA 4H0LC 4CGZA 1L2TA 4DR2L 3ASYA 4DSTA 4B2IA 3PUZA 1T0JB 4CEIA 5TVKA 1A8VA 1W0JD 4AG6A 1EQQA 1QJOA 1X3GA 2AWOA 1CJKC 2WAQG 1FJGL 1FOEB 1KZ7B 2CLSA 3PVSA 5EP4A 4A3BG 2W58A 3SEAA 4FMCF 3AF1A 1U81A 1GRQA 4M1TA 3A36A 1E32A 3RDPA 3OFND 1IAQA 4B2PA 1G16A 2RHQB 2QEXA 1NJFA 1SXJE 2NGRA 1Q3HA 4I1OA 2RHSB 3L0OA 3FGNA 2P3SA 3TKLA 2BMDA 2YYZA 1W0JA 4QHTA 4JLMA 1RZ3A 2K50A 1TQDA 4ESVA 2QTVB 2IYUA 3IBGA 1AQYA 4IFBA 1DADA 1NLYA 1CBUA 2G83A 3FYHA 3EBEA 1VYTA 4TWZA 4FI3C 4P33A 2QAJA 1K8AC 5HTKA 2O8EB 1B70B 1YNNC 2UXDQ 3THYB 2QN6A 4JI0Q 1CLUA 1Y1WH 2QE7D 4UP8A 2MNAA 3SHFA 1NG9A 4PSAA 3CMEA 5FR2A 1YE8A 1QUQB 4L5SA 1NP6A 4R9UC 1L0WA 3BBPA 4OWTB 4LI0A 3AQ4A 3RAPR 2PI2E 4A9AA 1IYJB 4AIMA 3S24A 4EQ6B 2H16A 3LV8A 3CPHA 2QEQA 4BBRG 5A35A 2C5LA 1IW7D 4HUQB 3C15C 2O0HA 3TUIC 3QVUA 2BH8A 3AP3A 4HLUC 3B1XA 1XXHB 4YQFA 1ZNXA 2EW1A 5FPYA 2AWNA 3GJ8A 5IY0A 3PQCA 4A36A 1GDDA 2O8DB 2LKDA 4DUYQ 4Q9LA 1CI3M 2O8FA 4IVPA 3EIQA 4RZXA 2K14A 4RMFA 4A3IG 3CRRA 3T61A 3L0SA 4MKIA 3VKWA 2A6HC 4DLSA 4EJSC 3H2YA 4TYQA 3GLIA 1RE0A 2NO6A 2ZJOA 4A15A 2IHBA 5IWAQ 1GL6A 2ZR9A 5TV2A 5IHPA 3Q3JB 5EQTA 3CIOA 1SVOA 1PJRA 4QJ4A 3S15H 2F4VL 3WMGA 3C7KA 4LF9L 4TMKA 4TT3A 4Q7MB 4Z54A 4L15A 4JBYA 4YY3L 1AS0A 3A8IE 3EA5A 4XSHA 4F93B 721PA 4P4SA 5AJWA 2K5HA 1R5BA 4XWAA 1G6PA 1Z63A 1G8HA 4JI2L 1WE2A 1LF5A 1P61B 2IEYA 2FGJA 1WB9A 3LLUA 1GD7A 1FVIA 4KMUC 2KCMA 3M3YH 1D6JA 4DK1A 5F2EA 1LUZA 2GHIA 4QBIA 2WMNB 4GSYA 4PO8A 4XVRA 4DV7Q 2REXB 3AKEA 2R6FA 1JE5A 2NPIA 4EFLA 1T3LA 4JI7Q 4MDEA 1E79A 3Q7QA 4QNMA 1U0HC 3A37A 4PC2A 3H15A 1Q1EA 3I4NH 2AHOA 5DLQC 2KHIA 2RAPA 2CXXA 1MABA 2BA1A 4POFA 2YTYA 4HUQA 5JLJA 2F1JA 2A9KA 4C30A 1UBFA 4GP7A 3K0SA 2D7CA 4JVMA 2R6AA 2ZQ5A 3VFDA 2RGCA 4R1JA 2PZEA 2GK7A 2V1CC 1R0YA 2ZPTX 1FR3A 4NXNL 2R93G 3T15A 3AEZA 3QQ5A 1EWHA 3WBKA 2FE4A 2N3SA 2GK6A 1AH9A 3CCEA 2K52A 1FMLA 5G3YA 1ZD8A 1PA6A 4ITRC 4LHWA 1T5LA 1E0JA 3SYLA 2CK3D 1HYQA 4LK2A 2GKSA 1FL9A 1P5ZB 2FFHA 1FQJA 4O25A 4B6FA 4XOIA 5C4JH 1HY3A 5KPJA 2HXYA 4G7ZC 4M8NE 2BA0A 2A5YB 3EIEA 3K0EA 5BYKA 3U7HB 2ZJ8A 1L4YA 2QGNA 4DUGA 4AKEA 1M90C 2FGKA 4PC7A 1E69A 3B2EA 2OCEA 1LM0A 4TL6A 2JJ2D 1L1OA 4WZAE 3R9XA 2J46A 2WJHA 2OM2A 2F43B 1Z0IA 2IX1A 3AEVA 2ZI3A 1P7CA 2ZEJA 4YHHL 4RD0A 2Q3MA 3C8UA 4EPTA 1RW4A 4X64L 1PVOA 4GNXC 1IBKL 3H0KA 1SE8A 1W5TA 2A2ZA 4PC6A 1C0AA 2MO0A 5CIWA 4B34A 4CF7A 1E2EA 3RWOA 3KKOA 1CJVC 1L1OB 4MYCA 1KYIA 3PITA 4WJ4A 4KVAA 1XEWY 4GP6A 4A93H 2X2EA 1KRTA 1J90A 5EP1A 3VR1A 3ETLA 4OK5A 3NC1C 2KA7A 1LW7A 3V9PA 1VQ7A 4KHPQ 3ZH9B 5CITA 4V0LA 4HLDA 4KFRA 1G21E 1LY1A 1N6NA 4FIDA 2BM0A 2ZI6A 3AVVA 4LUOA 4NPHA 3LFUA 1PFSA 4LF5L 1V5WA 1VQPA 2UUCL 3F0TA 1CJTC 3GTOH 2CCJA 3GJ6A 3QNUA 3CF0A 5M5WH 2XGJA 3MSXA 3DO6A 4RZ2A 5J4LA 1YRBA 2HF9A 3LGJA 3B1YA 3K1JA 2CHVA 4HB0A 1XJCA 2DFLA 4C7OB 5LMNL 5M3MH 2ZTEA 2J0QA 3T1VA 2FSIA 3FDIA 3H94A 2BH2A 4Q47A 1Q81C 3TAHA 5DNYB 4UNSA 4RCYA 4A3DH 1SN8A 3TUZC 2CJWA 1XEXA 3GLGB 1JPJA 3BXZA 2EJMA 1SVMA 4FCWA 2QP9X 2QTFA 3CWQA 4E07A 4HEJA 1IONA 1SMYC 4X8LA 1KL9A 4LJZC 4K0KL 1YJWA 2E75C 4FN5A 4PFSA 4OHWA 3AVWA 4AC9A 1E1QA 2VSOA 1J8YF 2J0UB 1K3RA 1L2FA 1VG8A 4G0NA 1N34Q 2ZYTX 2YKGA 3NBYC 4IOKA 2X1VA 2K75A 4QBHA 3U50C 1DCZA 2R93H 3GEIA 5JZVA 4UNNA 4DR3L 4K46A 3A1SA 4FWIB 2Q9BA 2EJGC 3KQLA 2IEZA 3TS2A 1K8MA 2Z6KC 4PHFA 2IC5A 2I1VB 4I99A 4O2LA 2IS6A 4PV1C 2YINC 3K70C 1W36B 1HH2P 4YXWA 2ZR7A 3NEYA 4LUZA 2CE2X 2QMEA 3CKLA 3FE2A 2XB4A 3GJ3A 3SJAA 1WBBA 2XTIA 4AKHA 3TMKA 1X8KA 3VR5A 1OTCA 3DOEA 3U2QA 3KTAA 3RRYA 2NVTH 2DGYA 1OIVA 3DHWC 4YLGA 4MGKR 3GEHA 1HURA 2VIIA 1YNJC 2ZI9A 4DCTA 2IS4A 1L7VC 2H8KA 5J47A 1AE3A 2W6JA 3T5GA 3HOYG 4TMZA 1RL2A 4A3LH 3DPUA 5FTJA 4HB2A 1MIUA 3TBKA 2XJ4A 1VQNA 5TB5A 4QGAA 2ATWA 1HEIA 4OQXA 5CK5A 1E2VA 3AFQA 4TMWA 1GRNA 2CKZB 5FFMA 3KDFA 3I4LA 2OBNA 1AM4D 5BR8L 4IDQA 2ATVA 1W1WA 2ZYUX 4X8MA 1N36L 2QL6A 5LMUQ 2JJ1D 3CZPA 4JLNA 1NVXQ 3RS4A 4BLSA 4KN7C 1BBUA 1CKNB 2QZ4A 2PPBC 3T1OA 1SLJA 2WAQE 1QHNA 2O8CB 4RG1A 2R6CA 4LYFA 2X2FA 3WP0A 2YWEA 1YNXA 2O5VA 1QF9A 4F4JA 3ZJYC 4OX9Q 1PH2A 3GTGH 1FL0A 4JBXA 1DGSA 4PQRA 4BBSH 3DVLA 1ZU4A 1GG2A 2CEAA 3JVVA 5IYBG 2R6GA 4AQYL 4OWXB 3P1JA 2RKOA 1K5DA 1IXZA 1EX6A 1R8QA 2F43A 3I8XA 4PC3A 3AUXA 1R10A 1TKWB 4DR1Q 3KJOA 4TMXA 1GP2A 4JKIA 2ZE6A 1XMOL 3GTMH 5FOUA 1N6PA 4CRWB 1VQKA 3GLIE 1WXQA 4IFEA 4IPCA 3EPHA 2Q2IA 4IVQA 2FEMA 4Y0VA 1D2EA 3KKNA 2WMOB 3AF4A 4QG7A 4GKJL 1AS2A 4KLNA 1TF5A 3OTOQ 1G4UR 1AN0A 1T0HB 2UXBL 1XNQQ 3M9BA 2WIBA 1S4QA 1TF2A 3QXCA 3E9HA 5FJ8G 2B3GA 1ASYA 3SC3A 4W5HA 2LXKA 3NBXX 5KOYA 2F3TA 4LBVA 3QKTA 1FPMA 2EFDB 4JYAQ 4MYHA 4DC9A 4R4IA 3TS0A 4HZIA 3U3OA 2RGEA 2GTPA 3G48A 2WIAA 3K9GA 1SHKA 2JLUA 4X66Q 2K7VA 2RGXA 1CRPA 3BFVA 4QGUA 1I50H 5DYIA 1HA3A 3PUXA 1XTIA 2G0NA 4TZ6A 4ZI3A 1G3QA 1M1YE 5FPSA 4B43A 4AKGA 2YZ2A 4RD4A 3BAFA 1UJ2A 3B78A 4WW0A 3C5CA 1NMZA 1LABA 2JAQA 2EXDA 2OBLA 4RFSA 3O8CA 1YIJA 5GVRA 3M4QA 2CLDX 1OB5A 3VHLB 2C78A 3D31A 3K9LA 1XMVA 5FL7A 3W9YA 3V4FA 1S8FA 2ZANA 5BWMA 2R8RA 2Q9AA 1E2DA 3RRMA 5HKKA 2R2AA 3S17H 3CH4B 4MYUA 2H57A 2EYQA 2FMXA 1YITA 2J45A 3UDXA 4MZ9A 1CJMA 2NZJA 4FINA 4A0HA 3U60B 3EX7C 2EVWX 3CPWA 1R0XA 1S2MA 2ZE5A 1CRQA 3OE7D 3GLIB 2GBLA 1RVDA 4TL9A 5EUMA 3UE0A 2QP3A 4GRAA 3ND8A 4YMTA 3GQBA 1SVSA 1XTQA 2Q6TA 3TH5A 2ZRNA 3W8RA 1A7JA 4TT3D 1R5NA 1Z83A 3A8KE 5M5YH 2DB3A 3R7WA 3CC2A 1SXJB 1UPTA 4IEIA 4F38A 4KSBA 3AVUA 2J7KA 3L8ZA 1DAFA 2F3RA 2KENA 1VYUA 2FFBA 1E1TA 2ZREA 2R6DA 2PLRA 2C9OA 4C0QC 4M1YA 1X8JA 3LA6A 4IDOA 4PHTA 2FDCA 1G4AE 3EZFA 3GPLA 4TN1A 2C98A 4E03A 1T9HA 2JQOA 1VCOA 2ID0A 2ODEA 4BASA 3TRZA 3EZ7A 3UKDA 2OILA 4E22A 3U7FB 2P2LA 1HNXL 3B6YA 2QY9A 5FOXA 3KJEA 3RLFA 2VHCA 1PZNA 5C46F 1E79D 1E9AA 5IF9A 1AJEA 1QZXA 3AF2A 4LNQA 3FP9A 1YHNA 3GJ0A 3U6KA 1HNXQ 3CXCA 4LF8L 1XZPA 3PUWA 4DDTA 3THYA 1A2BA 4PMWA 3K7UC 3K9NA 4OQNA 4GLVB 4ABYA 1BYIA 3VDYA 1NN1A 2IX0A 1WA5A 1E9DA 1A5TA 3WYGA 4IQZA 3GTKH 3HPRA 4Q00A 1ZKOA 1CP2A 2W83A 5J40A 5L8VA 1MO3A 1PH6A 3ZQJA 2UUCQ 4JLVA 2IYXA 1VQEA 3U3MA 4M53A 2IX3A 2GNOA 1T5IA 1GUSA 4IOMA 3I55A 4OQLA 4JOIA 5EXTA 3ULJA 2NVYH 3UDIA 2QI9C 2BOVA 1ZIPA 4DV6Q 3B1VA 5FTNA 3X1ZA 5JWOA 1E9FA 4WXRA 1NY6A 3ZD6A 1M7BA 3FFBA 3VR2A 1N9WA 3ZIAA 4CEHB 2JA7G 5K36G 1UF9A 4ACAA 3M7NA 1WQ1R 3PEWA 5GJBA 4OK6A 4LJYA 1HE8B 2RGNC 4UY8C 2ZI7A 3TR0A 4IW3B 3AGQA 5K8LA 4DWJA 5GAHC 4GOPC 2Q21A 2JEBI 3BERA 3FKIH 2NTYC 3HKZE 1T4GA 2RHDA 4JBJA 1C4OA 2OLKA 3CCSA 2JLSA 2JLQA 5C2JB 2R7DA 4R2HA 3GEEA 4PANA 2G0TA 3DM9B 4DLUA 5B30A 2JLVA 1FNNA 3BH7A 5EE3A 2UZIR 1COWD 3AGPA 4A93G 3MXUA 4P4SB 4TQUS 1P75A 1VYVA 4ZDJA 3IRBA 3N5CA 4DV1Q 3WP1B 1JI0A 1NRJB 4BLRA 4BXXH 4PO9A 3KQKA 4GZLA 3EIHA 3B6EA 4B3RL 2E2IH 2AFIE 4OO1G 2Y0SE 2A5FA 3ULLA 3GLHB 4YDSA 1QHGA 4D26A 4MRNA 4URWR 2A6ED 2WHXA 1GUGA 1P2SA 1AQUA 3E1SA 1IY1A 4LBZA 4V0KA 1PH8A 4AQYQ 3VMFA 4MNOA 1RYFA 1KJWA 2J3EA 5FI1B 5BYJA 3WMFA 3E2IA 3QPWA 4ZCIA 1JAIA 2UXBQ 1II8B 2WJJA 4QJ5A 3SHWA 3TSZA 3G71A 4K8OA 4NP6A 1LVGA 4JI1L 1N6OA 1YZQA 1I3QH 2ZM6Q 1E94E 4GT1A 3LW8A 1W4BA 2JA5G 1TUIA 3MGCA 2N42A 3RR5A 3EAQA 5F9FA 1JT8A 3ZZUA 1TEXA 1X55A 4Q21A 5C3EH 2OXRA 4Y7NH 2VP0A 2VHUA 3NDBB 1Q7YC 2H1LA 1EWQA 2Q8IB 4DNTB 4Q4HB 3WYAA 1E0SA 1E9EA 1T5EA 1LB1B 2XTMA 4A3EH 3I8SA 1E1QD 3LLMA 3L2OB 5GAGC 1K5GA 1MRSA 1MKHA 3BIFA 3IILA 2C8VA 1AZTA 1IBLQ 2D5DA 1NJGA 4KODA 3BFXA 4F4CA 4OHYA 5SZKB 3QKRA 2HLDD 2DYKA 4N0DA 4BFTA 2EQBA 3A1WA 2YNMA 1N6RA 1T8UA 5IT9c 2HF8A 2QE7A 4PC1A 2QA4A 2GJ9A 1F2TA 1NTGA 2OFWA 2QSZA 2YJTD 3KB1A 1KI7A 3ZVRA 1BS1A 4CEJA 1TL7C 4H13C 3QXXA 1VF7A 4Q48A 2GDJA 3RN2A 4A6PA 1G7SA 1OF1A 4Q1EA 2Z83A 4IDNA 1F5NA 1E2FA 1SVIA 4DEYA 1SQ5A 4RFVA 2OLJA 5E7MA 4A3MH 4EIWA 4A2PA 1JR6A 1MJEA 2VA8A 4HJAA 2JJQA 4H9GA 2A30A 1CJUC 2AX4A 4KI0A 2BBTA 4EX5A 4BEJA 4BY7G 1KK1A 5CYPA 1GFIA 2QQ0A 4NXNQ 4D0LB 1Z6YA 2O5IC 4RJLA 2V9PA 2Q3FA 4B73A 1GITA 4QRHA 2QENA 1EK0A 1LS6A 3H1TA 4ALPA 1CR2A 2WPDA 3WNBA 2ZRGA 3NC0C 3M4OH 1IJFA 2P5SA 2DNEA 2AXPA 3W3ZB 1TMKA 1G7TA 2F6RA 1EFRA 4C0LA 3K81C 1UBGA 2JGNA 4RKFA 3K09C 3I4MG 1OHHA 1SKYB 4DR1L 2WWGA 4HDOB 3I5XA 3H0GG 1RKBA 4P4UA 1KI2A 2FFQA 3MWJA 4MRPA 4A2QA 4WZBE 5F3WB 1W47A 1JR3A 2CL0X 2YOHA 5L3QA 1TXYA 1U0JA 2Z5FA 2XB2A 1IN8A 1CFMA 4H44C 1N5IA 1JJ7A 3H86A 4TYNA 2YU9H 2ZJBA 3NEMA 4PPGA 4ZDWA 3WNDA 4LK1C 1S3OA 3F2CA 1D8LA 1UKVY 4S35A 5P21A 5HR5A 2ZRCA 4PXAA 2F1IA 2J0UA 2ZSFA 4A1FA 4JKYA 1JBKA 4I7ZC 3HOWG 1JR3D 4Q9JA 2VL6A 3OESA 2WWIA 4PZ7A 4DV6L 1FFHA 1G3RA 1Z0JA 2NO9A 4OBEA 2IUUA 1N36Q 3J7A5 1ZYUA 2HDNB 4LF9Q 1DG1G 1G5PA 4AIIA 3UMSA 3QIAA 4D0GA 4QC2A 4BA2I 1KKLA 1ZYRC 5AJ3L 1Z29A 2GEVA 2AUKA 1DOAA 2JEAI 2J0SA 3WDNA 1YZTA 2DPXA 2QU8A 2F9MA 3CD6A 2XJ9A 2GWHA 4M0LA 3R8FA 1S9HA 2B92A 5KNBA 2BCJQ 2VF8A 3LBIA 4ARZA 2H7VA 4KXFB 2JA6G 4L5TA 3H3VH 4YMWA 4R4QA 4B3XA 3HKZG 4QJ3A 1X6OA 1W36C 4RFSB 3K70B 3AP1A 4KN4C 2OQ0A 5FJ8H 3PO3H 1E2GA 4LRWA 3NHAA 3S1QH 2PLFA 4NB3A 1HQYE 3OHMA 2O8DA 2IUSA 1FNMA 2C96A 1N25A 1EGAA 4B6EA 2IHEA 1G64A 2WV9A 2ZS9A 4U00A 3TUJC 3U4QB 1NIPA 2DBYA 3TR5A 4PZ8A 1KMHA 1J5EQ 2MMGA 4BLQA 3ADDA 4HI0E 4B3ML 3EG5A 3UDFA 3K7AH 5B58C 2VO1A 3BE4A 4AD8A 1D8TA 1JEEA 5JSZB 4KJZA 1FW6A 4YCVA 2HJGA 4B3TL 3B82A 2QUZA 3HU2A 1ZBDA 1GHJA 4NU0A 2V3CC 2J87A 3Q8DA 4IJMA 3SZRA 2DUDA 3IIKA 3CF6R 3PG5A 4A3MG 1G5TA 2WWFA 4QBGB 3RN5A 2GAAA 2WJVA 4LGMA 4L9WA 1ZUHA 2ZTSA 1Z8FA 3IHWA 4OWWB 3T1YQ 4YHHQ 2NZ8A 3PUVA 2XAUA 4GNXB 1II9A 1YR7A 121PA 1JR3E 2AUJD 4BFUA 3W3AA 1LTQA 1N3BA 1S1CA 4LJ6A 5H1YA 4L4UA 3MMPA 1EX7A 5GJWC 5E7IA 5HKKD 5K8UA 2CWAA 1G3MA 3I5YA 1XP8A 3PF5A 1SVLA 4C0KA 1G8YA 4QJFA 2HCJB 2R7ZG 2QGZA 2OAP1 2Z4SA 3B5JA 5J4KA 3OE7A 3IUYA 2ZJ5A 4P75A 1TWAH 5LMNQ 4JC0A 4DRZA 4PZYA 1KI4A 1U8ZA 5DGXA 4DIEA 2ALYB 1R6BX 4C4PA 1IXSB 1OSNA 2P6NA 1UFQA 2C35B 1LYLA 4ZKDA 4OX9L 2Z0MA 1D9XA 1X1RA 1ETUA 5HPYB 4NKRA 2UUBL 4K81B 1FQKA 2BCGY 1C9OA 5HZKA 4KKSA 1QDEA 1NSFA 3ZLJA 3G82C 1X65A 2NG1A 4A2WA 3LNCA 2A78A 1JJVA 2A5GA 4X66L 1TNDA 4M9SA 4CIDA 2VP5A 1I4LD 2ZRJA 4F91B 1KMHB 2A8VA 1R0WA 2R44A 1R8SA 1X3FA 3LX5A 2AKAB 2ZVPX 3CCMA 3DZDA 1UBEA 1GNQA 3CRKC 3EC2A 2JA8H 4O0AA 1W49A 4JI7L 1YR6A 3QJYA 1Z6GA 5ELOA 2LCFA 2V6JA 1ZM2A 1G8GA 2KSQA 2FZLA 1YJ9A 2QRZA 4JMPA 2ORWA 4MYTA 3RSLA 2GVAA 3GTJH 2ZYWX 3PO3G 1D7QA 5K8IA 3JZAA 4A3GG 3UPUA 4LFCQ 1OLOA 2D62A 1NLZA 1UBCA 1X86B 2NIPA 2RH5A 3CW2A 4HIOA 2WWXA 521PA 4LFBQ 1ZNWA 1DVRA 1E99A 4UNQA 3UIEA 3DXJC 1N32L 2IHYA 4NYIR 1E7ZA 4QHYA 2CWPA 1XFAA 1VHTA 1HNWL 4PHHA 4TZ0A 1PH7A 1KAGA 1XMOQ 1M7HA 5CLQA 1IQPA 1PMRA 1S3GA 1HTPA 3EW9A 1ODFA 4J15A 1RRPA 2G6BA 1I6HH 4F92B 1KO8A 3HOZH 2KCCA 1IYVA 4V0ME 2VEDA 1F2UA 1A0IA 2OT3B 5DLQE 3LNNA 2AL7A 4YWLA 2E2HH 3IKJA 3TVDA 1XNRQ 4QKQA 3D8BA 4A4DA 4DR3Q 1E9SA 5FLMG 1SVKA 5D3MB 3M85A 2O8FB 2JCSA 1VF5C 1RIPA 4JI0L 5EXPA 4URVR 3EQLC 1W48A 3QEJA 4D80A 2TMKA 3A7LA 1N0UA 1UM8A 3IO5A 1JB7A 3RS0A 3CCVA 2ODWA 3S1RH 3HOVG 4NYMR 1TUEA 4GN4B 1SXJC 2F55A 1UKEA 4KKTA 4JK1C 5J4HA 2ZAOA 1O7LA 1YR9A 3ZDQA 5L3RA 2QGQA 4TL8A 1N6IA 5B2ZA 1KI9A 3BWDD 2VUMH 4KO8A 1XDBA 5AR1A 5LD2B 4AK9A 3V4RA 1U9IC 4JVNA 5FTLA 4TYYA 3S16H 3VNUA 3GFPA 2WFWA 4HSEA 5CIQA 4CEHA 1E96A 2XNDA 1H8HD 3FMIA 1JPNA 4DIDA 3LRPA 4EQ5A 1ZD9A 2HHHQ 2RB4A 4PO1A 2CHQA 2BE5C 2FFAA 1CSQA 4IJLA 2Q9CA 3ADKA 3PGZA 5B64A 4X8OA 4LF5Q 2UXDL 2FSFA 2PT7A 3FWYA 5GJVC 2AFHE 3RABA 1XD8A 3IIMA 1WJJA 4JI4L 1ESMA 4Q7LA 1TQ6A 2VHQA 4IEEA 3J81i 4JV5Q 2WTUA 2BMFA 5KU1A 2HT6A 1VDZA 1GJXA 1NI3A 3C14C 1E98A 4BFXA 4TTRA 2J0VA 4P32A 5FUXA 1E2PA 3B7GA 3AVXA 1ZVQA 3J80c 1IJEA 2EDGA 3SU8A 4B35A 2ZSDA 1S72A 1F60A 3WBJA 1KDOA 2E2JH 1ZP6A 2V8OA 1H65A 2JEOA 2JA8G 2IY5B 4PSVA 3I32A 2UUAL 2E9SA 4FDBA 4P4TA 4JLOA 1JQLB 1HQMC 5M3FG 4JT2A 4Q03A 1N34L 3PCRB 4Q4HA 3ZGXA 4TLEA 1MOZA 4KV9A 2D0PA 4LF8Q 2OCYC 3WMEA 4LBWA 3REGA 1DO2A 4KFTA 2QT1A 1HT2E 3X1XA 4R4TA 3NVAA 1K9MC 1OPXA 2A69C 3PEVA 4M21A 4JBKA 4MA4A 4Q1AA 5TY0A 1IZ6A 4NZYA 5L3QB 3KQHA 2DFTA 5DHAA 3U3KA 3VU9B 1EFTA 3BZCA 1KJZA 2A3RA 1GSIA 4EPXA 5EP3A 5FR1A 1II8A 4M1MA 5EAYA 4IJHA 4KLZA 2L5TA 1XBTA 4DR6L 1GNRA 1G6OA 1NN5A 2XOKD 3C16C 3QPUA 2VQEL 2PH1A 3KXKA 3RWMB 4A3CH 1ZAKA 1ZM4A 5KSZA 1RFLA 2B21A 2BBWA 2OXCA 5JEDA 4BLOA 1EIYB 4B48A 3RLOA 1VQHA 4US0R 4DDUA 4FXPA 4JCVE 1IBML 3D0FA 4MRSA 3F8TA 1HUQA 2XOKA 3DMDA 2HIXA 3EZ2A 4DR5L 1SROA 1Z2AA 2ZRMA 4L16A 5FL7D 3IPXA 1YJ5A 1PH4A 1ZJ6A 1N33L 4TTQA 1GL9B 1QHYA 2JK8A 1YHAA 2VQFL 1P2UA 3M0EA 1HR0Q 4M1SA 4PZZA 4Q9KA 4CT4B 2IYVA 3QKSA 5IYCG 3G4SA 3PF4A 3BK7A 3A8TA 4TYPA 4HAUA 2IYLD 5E95A 1ZM9A 2QT0A 4Z1MD 2PBRA 1YZLA 1YZ6A 1IBKQ 1RC8A 1ZC3A 3LX8A 4KKUA 1X8LA 3W5OA 1CUKA 4JOIC 1FJGQ 1K8GA 4A3FG 1KXLA 5IYDH 2IYWA 2UVQA 1VQ9A 4RKEA 3IO3A 1XWIA 1OIWA 2ERYA 5JBQA 1Z08A 4DR2Q 3ND9A 2FZ4A 3QKSB 5DYGA 3U61B 1VQMA 4X8HA 3TIFA 1QVCA 2HCBA 3FHTA 2V1UA 2E5LQ 4OHXA 1YKSA 1N33Q 1VKJA 2C04A 1E2NA 3LWUA 3NEJA 2SHKA 2N49A 1SKQA 1SRUA 2B7CA 3U7GA 4EQ6A 1Y8OB 2PZFA 2L15A 2OFOA 1JAHA 2WJYA 3BJUA 4B44A 1XD9A 4LFAL 2IBMA 2P67A 4DK3C 4BE7B 1E2WA 2YTVA 1JMCA 2N8NA 1WRBA 2FJUA 3E9IA 3NBHB 1K0RA 4HIKA 1G1MA 1P73A 1KK2A 1XX6A 1XEXB 3GLGA 3QSYA 1O78A 3OTOL 3GJXC 2OSBA 4GKJQ 1OE0A 3R8CA 3A58B 1OFIA 4EPVA 1VQLA 2X19A 3EC1A 3OAAD 4US1R 4YONB 3W6OA 1KMQA 3KFXA 2IW3A 5JJKA 1PUJA 1RRGA 1XJQA 1F2TB 2F9LA 4BZPA 3KFUA 5FH9A 2O8BA 4NYMQ 3LXRA 2EWWA 4DR7Q 2FN4A 2C77A 1VQ5A 2ZRPA 1GWNA 3IHLA 4FMCB 5AUNB 3FMCA 2NVXH 1MJCA 4LWCA 3CRQA 4HIDA 3FHCB 5CDFE 4BFYA 3KDFB 1VQ8A 1W5SA 4N3NA 2B8GA 3PO2G 5DN6D 4EKDA 1Z5ZA 4Z8XA 4P73A 3OW7A 1OXVA 3PCOB 1KDPA 2ASEA 3HPQA 4LWZA 2QAGC 4XSGA 1V8QA 2D74A 2JDIA 4I1VA 3CLVA 3TQYA 2ANBA 1OJLA 2H18A 4YC7A 3W5JA 2H5XA 1RYHA 4KYUA 3RSOA 1JECA 4A3CG 4ZO4A 1NVUQ 4BA1I 2JLXA 2HV8A 4PAQA 3KJHA 4LC0A 2CW0C 2ZE8A 4WOPA 3H3VI 1NMXA 1FUKA 5DN6A 4L5QA 1MT0A 2ZSBA 1NBMD 1OH7A 3W6PA 4HAXA 5LMUL 3CRMA 4NYIQ 3A1VA 2DWOA 2XTZA 4AYXA 3A1UA 4LPKA 4EUNA 1E2MA 2WSSD 5C44H 4HIMA 1KSHA 4JV5L 2W2VA 2RGNA 2MSEB 3G0HA 5GADC 4LPSA 3ZVMA 3K0CA 4GZMA 1FX0B 4C0BA 3X1WA 1TU2B 3REFA 4DUGD 4EPRA 1KAWA 1PH5A 2A69D 5KSPA 2VP4A 1CTMA 1I94Q 1NBMA 1NVVQ 4A3KH 2VNUD 5IK2A 2W00A 3RVBA 1RRCA 3AVTA 4B3GA 5FBLB 1HJPA 1KK0A 3GLFB 3BZKA 5CJPA 4OK3A 4DLVA 2WSSA 5JI3E 1HR0W 3LQQA 2R7FA 3PR1A 4Q4AA 4ZCLA 1EFCA 4NXML 1R4AA 4YMSA 4HATA 5KNDA 2DWQA 1DAGA 1YR8A 2Z43A 1M8PA 2CL6X 2FX3A 1L1OC 2OCPA 1NIJA 3W1GA 3CB4A 2BEJA 2FF7A 4KHZA 1J2JA 3G6EA 1LTLA 2D3WA 4GDFA 3O8BA 2AHOB 4AYWA 2CJWB 1G8FA 2VTKA 4D81A 1TWHH 2FNAA 4W5WA 4GNKA 1OXXK 4P72A 4F4IA 1UKYA 4PG3A 1G41A 3AKDA 3SBDA 4C2UA 3GJ4A 3ZZTA 3I72A 1CS4C 1QUQA 1PLJA 1PYSB 3TREA 1NN3A 1E24A 1DAKA 3CH5A 4DLRA 5L3SB 2ONJA 2BJVA 3SJBA 3P27A 4P0TA 1MABB 3I4NG 1P2TA 1XCGB 4LHYA 2AKWB 3HKSA 3SGIA 1GKUB 4DV2Q 3SJZA 3ZS8A 4LFAQ 4UNRA 3RC8A 1F48A 1DO0A 3I61A 1YHBA 4JL5A 3IDQA 3GTLH 2XSZA 3UG6A 1W4AA 3WYFA 3ULPA 1YZUA 2CBZA 3KZ1E 1RIFA 2ZRKA 4A0FA 1XF9A 1JJGA 1N0VC 1XMQQ 3LDAA 5GJCA 2HEIA 3HWSA 5IDVA 5E7NA 1P9RA 2BMJA 2NZOA 4HR7B 2ZJRA 3IQWA 3ONWA 3VNVA 3KYHC 2JATA 2QORA 2C95A 4ZDKA 5EJEA 3U3RA 4HDQB 2YVUA 3NENA 1BKDR 2YV5A 1U8YA 5IT5A 2ZUCA 4JJKA 5LBIA 1DEKA 2YWFA 4RSGA 1N2CE 1K73C 3TSWA 4LW1A 1XEFA 1DBSA 5EE5B 4QGFA 1Z28A 3DDCA 2E76C 5AWFC 3SI7A 2OZEA 5KUTA 4NCKA 2CE7A 2W2XA 4GLAC 4KSCA 4JI5Q 4PZ6A 2PCLA 4DBLC 1LS1A 4M22A 1HCZA 2DCUA 2FXQA 1YZGA 4CDGA 3QXSA 2VP6A 3J81k 1GKYA 3A0JA 2FU5C 3L2PA 3NKVA 2XXAB 2NMVA 3A74A 1XTSA 4G01B 5H68A 4A76A 1LNZA 6Q21A 2GXQA 3VR4A 2NN6H 4X62Q 1N5LA 2GXUA 3CPEA 2V4DA 4C0SA 1G17A 2WPDD 1ZINA 3NG1A 5C18A 2CMKA 4L8JA 1MRNA 2JLZA 5C4MA 4A3KG 2GCOA 3K53A 1IHUA 2FEOA 4G5SA 3B13B 1DPFA 4Q01A 3NTUA 3R7WB 2K33A 1OKKD 5GAEC 1CTQA 1OHHD 1XXHE 3S14H 1IXRA 5CJ2A 1X9NA 3L82B 4HYYA 1TTTA 2UU9Q 2VH5R 4DR7L 1R5OA 2ORVA 2WBLC 3AVYA 1TF7A 2REOA 1EESA 4MDFA 4C2TA 2WVJA 5LB2A 4QXAA 4BQSA 5JFGA 1RJ9A 5IRCD 2VP9A 1OKKA 5TMPA 4LFCL 2E87A 4HLUA 1GTVA 3P20A 2FWRA 3VU9A 5A0FA 3DL0A 4XIGS 2FPKA 4A3BH 3DMNA 5DO9A 5J5CA 2XZOA 3PV0A 2B63H 5JJIA 3PIRA 3X2SA 2RCNA 4BY1G 3IIJA 4BRWA 3GFOA 3A4LA 1CF4A 2QBYA 4IFDJ 3CRW1 4Q4LA 1KI1A 2FG5A 4A92A 3KX2A 4LYHA 1Q1BA 2GJ8A 3GCGA 4TMVA 4QGHA 4O0MA 2AXNA 5EZ5A 2KE5A 4PQFA 4ZDIA 1JJ2A 2ZJPA 4D82A 1R2QA 1Y69U 3PEYA 1OXTA 5E3HA 5JRJA 3R9WA 2PI2A 2PQAA 3JAMi 3PEUA 5ELNA 4DR4Q 4MGZR 2XEXA 4NL4H 3ZJYA 1BKBA 1M74A 4I81A 2ZETA 4BFVA 1KO7A 2LSSA 2QMHA 2FH5B 1UE7A 2ZI5A 3HOXH 2JE6I 3DM5A 2FSHA 3CX7A 4OJQA 4A8JB 3RLNA 3KXIA 1RPZA 4O3MA 3E0EA 4JVSB 1XTRA 3OEHA 1VMAA 2V4ZA 2OO7A 1E0AA 1KI3A 4NTZA 1E6CA 2CCGA 2B6HA 4QBFA 1I94L 2QM7A 3MG9A 3OF5A 4PTLA 2C03A 5FTMA 4V02A 4V03A 3MEFA 2I3BA 3EXAA 3K0FA 2VHTA 1KQSA 4ZPXA 4R2IA 3S1MH 4AKIA 2NOAA 2HYDA 4DR5Q 3GMTA 3IEVA 1NE3A 2AMCB 3CRVA 1U94A 4PAOA 3TQCA 1DARA 1JNYA 1XEWX 1G51A 4DB2A 3VHXA 1VCMA 2IXEA 1ZUNB 2L0XA 4HAYA 3BJIC 4EAQA 1U98A 5IP7H 4EFNA 5FTKA 3HFZB 4YCUA 3FTQA 4A3LG 2IF2A 4BPBA 2ZTCA 1H95A 5FUVA 2VQEQ 1GHKA 2GF9A 3TE6A 4A75A 1Q22A 3RS5A 2ZJAA 4C3IH 3U4QA 1E2LA 1VG0B 4NYJQ 1ONBA 2VY3A 5IYDG 2RGDA 3M6AA 5HCNA 2RGGA 1TU4A 3QE0A 5G3ZA 5DE3A 3U6BA 2VQSA 1GM5A 4V0MA 1E4VA 3T5DA 4DSNA 2KHJA 1II0A 4MH0R 4B3MQ 3WNCA 1AKYA 1Q44A 4Q1CA 2ZUBA 3E70C 2E74C 1CKOA 4DV3L 4DCSA 5J4VA 1XZQA 5AJZA 4IFDG 3KF8B 3OIWA 4G3XA 4GN5A 4LUVA 3T53B 5AUQA 3D7MA 1B9NA 4LJ4A 2FA9A 2Q0HA 4HUTA 4GOPB 3GP8A 1P4SA 4BBSG 3B9PA 2VHJA 3KB2A 4TKOB 2PCFB 4GNXA 1NVVR 4A0GA 1OXUA 4XVUA 3GLFE 4GL2A 5KDDA 2B63G 3MAAC 4P74A 3BOSA 4LF6L 3S2HH 2VSXA 4QGGA 3U5ZB 3RRZA 4UXHA 2ZRIA 2WWYA 3K0FB 4HLQB 2OTJA 2GZAA 1Q46A 2V7QD 3LVRE 3PFIA 3N2IA 2NZHA 4H1VA 4RVCA 4JBWA 1Z3IX 4QY7A 4TTPA 5FOVA 2ZROA 4ZKEA 3BG3A 4ZIRA 4MRVA 1I4TD 4Q4JA 5LPNA 4DSUA 2JASA 1KI6B 4TL7A 1B0UA 1K8OA 4Y52H 1T6NA 1LFDB 1UEJA 1Z47A 5JCZA 1BH2A 1GKHA 3A7AB 1NMGA 4HAWA 4IVRA 3TSOA 1UE1A 1KDTA 3NH6A 4LY6A 5HE8A 1VQDA 3CX8A 4JI4Q 1YQTA 3CCQA 2EFHB 4QL5A 1VQOA 2GZDA 2V7QA 3FHWA 2ZRAA 1C7YA 3D3QA 3NH9A 4OONA 1E2QA 3MUFA 4MQBA 4RZUA 3F2BA 3RS3A 2ECKA 3OIUA 5BW8A 2AK2A 4HAVA 2E8GA 3HOXG 3L8YA 1Z7TA 4DV5Q 2FPLA 2NPFA 5ANRB 2XXAA 2XGTA 3GD7A 2V1XA 2ZUDA 5JI2E 2WOJA 4A82A 3BORA 2PJRA 4POGA 1SKYE 4MKFA 1XNQL 2GA8A 3AB9A 1F3OA 2OHFA 2WM9B 3BU2A 3OIYA 3N2EA 3TEHB 4AYBE 5C4XH 1G3UA 2JDID 2WJGA 2BV3A 1NMYA 1VQJA 1WP9A 3QXHA 2YTXA 4HJ7A 4XWOA 3KF6B 2GCNA 2CFMA 2QMOA 5AUOB 4EPYA 4LFBL 2R62A 1VS0A 4UJ3A 3WY9A 2ZYVX 3UDGA 1A4RA 4JG2A 4KFSA 2IK8A 5C44G 3CC7A 3QEOA 2OEPA 1FYCA 3T35A 3GLHA 2ZM6L 3NDPA 4JI1Q 2QMUA 3AQQA 4NPSA 4YCWA 1H9KA 4OYHA 3CP0A 1GNPA 3CNOA 4C0HA 3QXJA 1Z0KA 4G5QA 3SNHA 5CM9C 5JEAJ 3KL4A 4TLAA 1M2OB 4ARZB 1SHZA 2Z6KA 3L43A 3U44A 1AK2A 3H4MA 2K5UA 4XD7A 2MSDB 3I2ZA 2DNCA 4LF4L 2PX3A 4GOXA 1XD2B 3ICQB 2O8BB 2FV8A 5IYBH 3ICEA 4FMDB 1DELA 2UXCL 2VRWA 3FPAA 1XPUA 4DV0Q 4A8JC 2D2EA 4B75A 4BZQA 2I5MX 4LF7L 4O2DA 4JLKA 4BUJA 2V54A 3GO5A 3BB1A 3BC1A 1JEDA 3SYKA 3SJCA 4BGDA 1Q0UA 4OL0A 2ASBA 4UJ5A 2LKCA 4JS0A 5JECA 1IN4A 3VA7A 3S2DH 3QPVA 4XD7D 5C0XJ 5B57C 4Z8YA 5D3QA 4IFDH 2F1HA 4GBMA 4LDJA 3VQTA 4AY2A 1PHJA 1COWA 1U2RA 1WF3A 3CF2A 5LB4A 3HOUH 3AH8A 2AD1A 2A1AA 4DUZL 1TQ2A 1IN5A 2IHFA 2PMKA 4HLCA 2EVBA 1I4DD 2OCBA 1KO5A 4JL6A 4UKDA 4ERNA 1P9NA 1XPRA 1V1QA 4FCVA 4CYMA 2E1RA 2ZRDA 1YVCA 2HQLA 4KFUA 5IP9G 4TSFA 5SZHB 4IKEA 3HDTA 1I2MA 4H02A 2C9YA 2K5VA 4WVFA 1HE1C 5AK0A 3AKYA 2VQFQ 3TW4A 2J59A 4U7DA 4W7SA 3KOJA 4GFDA 3Q9LA 4WBSA 4AH6A 3AUYA 1A62A 1B8AA 3U58A 4IXNA 5E4FA 4D4JA 5A4JA 5CB8A 4CEJB 3RZDH 1E9RA 2BE5D 3RNLA 1NLFA 1P72A 4OQFA 1WYDA 3GDEA 1IY0A 4LJ8A 5EZ6B 4TSFD 5KSOA 1UAAA 2ZRHA 2ZJYA 1W3SA 5HE9A 2BKEA 4DEXA 4EPWA 4NCNA 2JXMB 1XJ0A 4URUR 1Z06A 2GEDA 2ODNA 2DY1A 3AKCA 4LYAA 1Y8NB 1FP6A 3EZ9A 4TQ9A 2HHHL 1KI8A 3CPJB 3SYNA 1NBME 1UE6A 1GO3E 1ZIOA 2Z4RA 4B3DA 5FBRB 2ZXUA 1LV7A 4JL8A 3GTQH 4DK6C 1Q21A 2H17A 5A5GA 4XWKA 4DLYA 4URZR 3SFZA 2N78A 4DZZA 4KBGA 4IPDA 1H9SA 1MO6A 3VAAA 5C4XG 2G1KA 4BLPA 1KRSA 1D9ZA 1UADA 1J5EL 2IF0A 4LV6A 4Q02A 3SBEA 4AYTA 5LD2C 2JA7H 1G8PA 3ZS9A 4M9XA 1RRFA 5HGQA 5C0XH 1SMXA 4US2R 1S3SA 1XPOA 2DFKB 3QKUA 4RY2A 1SZPA 3ZZ0A 1VQIA 2ZJZA 3K9HA 1US8A 4NH0A 3FKIG 2VLIA 2IT1A 3P32A 3F3YA 3ZVLA 2IL1A 3WHKA 5JWRA 3GLFA 4TLCA 3TNFA 1QVFA 3FMPB 3JZMA 1Z07A 1YU9A 3DKVA 2JLRA 4HZUB 5FOTA 2QBYB 1OXSC 4DNRB 2ZITA 5KYKA 5FUWA 4Q7KA 4PHGA 3T12A 2I4IA 3IBYA 3CW2C 2KBFA 3K70D 2IYZA 4IHQA 3U4VA 4AYBG 3UG7A 1DE0A 1FUUA 1U0LA 3N70A 4Z1MA 3PJRA 5DI3A 2O0KA 4BEBA 1HNWQ 4KHPL 4JI8Q 2OTLA 2OFXA 1OT3A 2D2CC 3CF5A 4IO9A 3VTKA 4DV4L 4GOKA 1H9RA 4OO1H 4HJ5A 3KJGA 3KJPA 4YMVA 3BS4A 4B3CA 4R7ZA 2GJSA 5K8TA 4CT5A 5EE9A 5J3BA 3A8JE 3T1HL 1P16A 3LQRA 4UXIA 3VX3A 1UDXA 2F1MA 2KWIA 3HOUG 2AR7A 5E7JA 2PNRC 5JEEA 4BY1H 2PX0A 4NYJR 3UWOA 1NKSA 1ZD1A 1Q90A 2NO7A 1D2NA 5IP9H 2EU8A 1WMSA 4II7A 4QOSA 3J81c 4BFWA 5AJ3Q 2JA5H 2Q2UA 1GL7A 1GVNB 3IGFA 1Y8PB 4LHVA 3NBFA 3KKQA 4N1AA 4OI2A 4Q7JB 2OWOA 4AG5A 1Z6AA 3Q5DA 3ZVNA 3UK6A 1HTWA 1FGUA 1Z0AA 3B85A 4LJAA 3QG1A 1A1VA 1TWCH 1W7AA 4C7OA 4EJSA 4PSKA 1KOFA 5JS7A 2I5LX 4G1UC 4NBSA 4IDPA 1NMFA 2A5DA 1VHLA 4LJ5A 3STBD 1W0KD 1XNRL 1KSGA 1S9DA 2GAOA 1AA9A 1QG2A 1G9XA 3AF3A 3O47A 3RRNA 4B33A 3J81j 1HNZQ 2C9CA 2QTHA 4GMXA 2R9VA 2QF7A 1E2HA 4M9ZA 5DI3B 3UWKA 2QAGB 2OBMA 3X1YA 3HOYH 3VR6A 1Z6XA 3CX6A 2UKDA 1C1YA 2R65A 3CCRA 4TMTA 1P3JA 1R9TH 3A1TA 3D4RA 3CONA 2IYYA 1X1SA 4G5RA 4A6XA 3KUCA 4IDHA 3JAMc 3EZ6A 3LVQE 3MCAA 2BIFA 1XCPA 4U02A 2ODBA 5CDFA 2P6RA 5C0XG 4WJ3M 821PA 1QVAA 1KHIA 1DAHA 1P8LA 1FZQA 2ZIAA 2WAYA 4BXXG 1KNQA 1QZHA 1T3SA 3PENA 4JLAA 5HCIA 2O8CA 2GVBA 1X3SA 2GCOB 4NCIA 3CCJA 4M2LA 4MGIR 4KU4A 4RD2A 1A63A 3X1DA 1ZNYA 3RC3A 3CNLA 2QPTA 3PIOA 2ZSAA 2RF4A 3NELA 3T1HQ 3QVVA 4OGQC 3DEFA 4B3TQ 4ZIRB 2DWPA 3VR3A 2GCPA 1VIAA 2D2FA 3U7EB 2NN6I 5IK2D 3FPPA 2GN5A 1MO4A 1Z6HA 2WAXA 2C99A 4IRUB 4RCNA 1EWRA 3S1AA 2WJIA 1Q1QA 4Q9IA 4DT1B 1I6VC 3I4MH 1FMJA 3UMRA 2BDTA 4POAA 3RHFA 3VKHA 3EA0A 3LWNA 5JCPA 2ZI4A 4J0QA 3H84A 2UUBQ 5G41A 4WA7A 1IBLL 4IOCA 3PXGA 2P6UA 3V00A 1ZC4A 2BVNA 2PMDA 3K8YA 1N5KA 4HAZA 1QVGA 1BMFD 4LJ9A 4Q1BA 2MFIA 1E2ZA 4D4KA 5CK4A 2BBSA 3HR7A 5EUQB 1XMIA 3QF4B 2HT1A 1NN0A 4JSTA 5EXSA 5AJXA 4M1OA 3N6RA 1Y1VH 3FB4A 3LD9A 3HP1A 3SFVA 4GOJA 1XMJA 2B29A 1SFOH 2QPAA 3BGWA 2BM1A 3TVTA 3DM3A 1U5KA 4DV4Q 3DLLA 1E3PA 1TX4B 3BFKA 3TLXA 3K80C 4OI4A 1VQBA 1QHXA 1ZM3A 2KB0A 2RGAA 1DXMA 3OZXA 5SZIA 1UEBA 2RGBA 3EIVA 5H1SE 2W6JD 4I1UA 1F6BA 4OHZA 2B8FA 4N0EA 2F3IA 5LDDC 1KIMA 1Q12A 4DXAA 4FWTA 2JA6H 1Q57A 1Z0FA 2K5NA 1P62B 2KJQA 3T1YL 1MO5A 2XSZD 1GUTA 5M5XH 4E5UA 1L4UA 5GVSA 1T3HA 4DV5L 1HQCA 4V0NA 2A68C 3EARA 1W2HA 1IN7A 3AV0B 1OYYA 1BIFA 1KSJA 1Q82C 1S0UA 3LAWA 1E1RD 3TJZA 2J7PD 4CZ2A 4BY7H 3ADBA 1G7CA 2WWWA 1LACA 4QIWE 2Q3HA 4PQYA 2ZJQA 3MWKA 4RD1A 1G18A 1GIAA 4B2LA 1PH9A 3S1AB 3AB3A 3SS8A 2ZT9C 2PNHA 1B23P 2VZAA 1WOCA 1TWGH 4DCVA 1KKMA 2CVFA 3FMOB 1TADA 1W4RA 2RMKA 4MGYR 4B47A 1E1RA 3GTPH 1HV8A 1L8QA 2I0QA 1X56A 1WI5A 1Y63A 1CKEA 2ZS7A 1E22A 4OKSA 4PR0A 4ZI2A 5BXQC 4Z51A 1E2JA 1Q8KA 3MWYW 2RHMA 3AVOA 3H0GH 2YHSA 1CEEA 1GUAA 4QHSA 4LF6Q 1CXZA 3I56A 1U99A 4B3BA 2ONKA 2XITA 2LXJA
chains in the Genus database with same CATH superfamily
2ZIGA 5EZYF 3SJ7A 4GS3A 1U1CA 5KUTA 2WD7A 2JHFA 2YW2A 3EF0A 3O74A 4LS3A 4GOPA 2ZIUB 5EWMB 4X65B 2IOHA 3ZD7A 3M4YA 4TXLA 2ZZKA 2E5LB 1VQAA 1YB5A 1VCNA 1EA5A 4NP5A 1QZUA 1G20E 1SZCA 3REQA 3MXNB 5EZYB 1NY4A 2G1UA 1LTGD 2CXRA 2YX1A 4G9BA 1CUWA 5G53C 5K1ZA 1HNXB 4QCLA 4D41A 4A0SA 1NUHA 4FB4A 5TARA 3BVZA 1SUWA 3A6KA 3RZOH 1EXMA 3HXTA 2XQIA 2PEYA 4K9LA 4R98A 4NCAA 2Z08A 2Y93A 4CMHA 4UW9A 4FOTA 2BM9A 1ORWA 4QUKA 3B1WA 2CVHA 4RKYA 2ES2A 1KO1A 4DM7A 2K5WA 3R9IA 3ROKA 5AVZA 1Q83A 2OMKA 1SOVA 2B8TA 4XQGA 5M3MB 1YSCA 4F5WA 1OV6A 2I4RA 3RNOA 5DU2A 1LCIA 2B1RA 4L9SA 4OX9Y 5GWXA 5JEAH 1QCYA 3ZGLA 1JG7A 2JIQA 2V5UA 3KJIA 2ORYA 3DDSA 5CLIA 4H18A 3A6DA 4GRDA 4PFQA 4LZAA 3DZ8A 2A5JA 4WKNA 4PN7A 1RYNA 1ITZA 1V5IA 1PJSA 1FGBD 4UQLA 2QK4A 1Z73A 5FAKA 1RC1A 3MFYA 3CJTA 1TZJA 5DM73 4FVMA 1CRWG 4IWNA 4UEWA 4J1QA 5E4XA 1XDZA 4LIPD 5H16A 3RS2A 2J9RA 2XMPA 1CUAA 2LWIA 3S2YA 3PEEA 1HNZL 1E2IA 2WG0A 3EDYA 5FPKA 3QE9Y 1RI5A 1IWBB 4P31A 1D5ZC 4QL3A 1Q3TA 1A3CA 1OBVA 2LD4A 1JCKB 3DEJA 3H3FA 3EXFA 3DKPA 2N1BA 3BMCA 3CT6A 3CPSA 4G97A 3HXKA 4PTZA 4RA9B 1CIPA 2B35A 3OZUA 4DSAA 1W2GA 2OHGA 2VT6A 4DK0A 3G59A 4MR8B 1KE1A 2F0MA 1ODSA 3MRSA 1L9KA 2OHVA 2YY5A 3D64A 3GFQA 4GEGA 1QONA 1PNQA 2VPXA 3ENZA 1AHNA 2W2PA 3DE1X 3KZCA 4YH1A 3WWVA 2WINI 3BMQB 3LBNA 4V24A 5FBVB 3VHQA 3DVSX 3W78A 3J7TA 1YFKA 1B73A 3HOZG 1JR2A 2II6A 4UHCA 8GPBA 2J3DA 2CFOA 1X3PA 4GBGA 4CF3A 2OESA 1CQWA 3LUHA 1LLUA 1YC5A 3CEMA 3P4XA 4G1MB 4H4DA 2B8WA 1Z82A 4IQ8A 4FMDF 2XLCA 3INNA 5CB6A 1PHRA 3CUWA 1ZQ1A 3ZWPA 3KOOA 3AIIA 3EGVA 2I5HA 5BN4A 1TEVA 3U4MA 3L6CA 1SNOA 1O4VA 1XVVA 2H48A 1D6EC 2FUCA 3H5VA 1YS1X 1KAMA 3RTDA 4MGHA 3BPSA 2F00A 4NCHA 5C8VA 3KYJB 1XJVA 1UPCA 2MO1A 1J7JA 3MJEA 3B52X 4HBZA 4B5LA 3RJ5A 4HJ8A 1RXEA 1R0ZA 5C5LA 1OUMA 3V4VB 3VVMA 2Q2HA 1U7OA 5DISB 1SEVA 2C2XA 4ASUA 1LTTD 3C6QA 1EFVB 3PHIA 1ZH6A 5TXGA 1YR2A 1LJLA 1ZMXA 2WM3A 3OKPA 3NBQA 3NBKA 1LF0A 1DT3A 1D2RA 2FOLA 3OVMA 3IEKA 3VTFA 1FBTA 1EQUA 2GZHA 5DW3A 1KZGB 2F4VQ 5HIKA 4H60A 2VJAA 4A3JB 2J3JA 4Q24A 1XAGA 4DA0A 4E6PA 2Q9UA 2AX3A 3E15A 3EHEA 2GD6A 3IMFA 4OJNA 5IDXA 2GM4A 2QZZA 3H2ZA 2O06A 1JWMD 4TXNA 2XR1A 4UM5A 1V7ZA 2FDRA 4TVSA 2BR5A 1YZKA 2QROA 4MOWA 4OSOA 4WH0A 4OI1A 4RKLA 3EXIA 2D4HA 2Q5CA 3EZXA 1T2EA 4GAEA 3GLHE 5C9ZA 1O5OA 2JIBA 1T91A 5ALWA 2L19A 3JCZA 2OXPA 1W76A 1EOTA 1EXWA 5LP6B 1XTPA 4KSYA 2Z09A 3A9RA 4YAJA 3UW3A 5ADUS 4KIUA 4XIYA 2I7DA 5KNCA 1QC5B 1W4CA 2J41A 4BN0A 2BGWA 4LXTA 1YGYA 4X84A 1UBNA 3QA9A 1THZA 4IIBA 3U3XA 4CI9A 2VP2A 3DE3X 5T41A 2GYYA 1AKEA 1VECA 4Y6SA 4WOCA 2ZJ2A 1BDOA 3JARA 3VNSA 3WAKA 1BHO1 2CK3A 4MUNA 2QYOA 3F2DA 5TGDA 1SG0A 1E3DA 3BZUA 4G1CA 4WNCA 1QP4A 1VQFA 1X92A 4INAA 2YJ6A 5KNCD 4XXHA 1XU4A 4B3IA 3DUZA 2J5QA 3BH0A 3SR4A 2Q49A 1G19A 3PF9A 2DM6A 1H8ED 3FNFA 2CL7X 2OZPA 1SXJA 1KYZA 1F2UB 2XY4A 1RLUA 2X22A 1QOZA 1J9OA 3HYCA 4RBNA 2A19A 3BDIA 3ZLVA 4YWMA 1PKEA 3OLVA 3HU3A 1KP3A 2CZQA 1N57A 1P45A 2YC4C 3VR6D 2IYTA 4MR9A 5IT0A 4QQKA 1I5FA 1GILA 1QFXA 1QGDA 1ULAA 2DFNA 4HRVA 5K51A 5BR8B 5DXJA 1C0LA 4DTIA 4U7FA 2DERA 3L7ZC 1VRCA 3EDMA 2BKXA 1F17A 2HU5A 4MVXA 4QPNA 5D8DA 3OPYI 3ZE1B 3ESQA 3CUEF 4EF5A 1GRVA 2JI9A 5CB4B 3D6AA 2Z1DA 1QH0A 5AD1A 2LY7A 2PMZE 1Y98A 1Q92A 3VJRA 4EW3A 1ONLA 3HGBA 4IFDI 4KAXA 2PT5A 3RNUA 2BL4A 4Y30A 3O8RA 2VNJA 1XT6A 1RZRD 2VXBA 4U7GA 4OQMA 4Y2XA 3OQIB 3T5TA 2PANA 1FE8A 5HMLA 4U2KA 1NNLA 4RHUA 2OBBA 1WCIA 3RAFC 4QRIA 9GPBA 4KKXB 1I30A 2BD0A 1TVXA 2O2LD 3I4OA 2VS1A 1LQUA 3FZGA 3JQGA 5ILQA 3GAFA 3VDQA 1R0RE 1ESNA 2P0EA 3IULA 1PJBA 2HWWA 5AHRA 1R0SA 2H0QA 1H5QA 4IO0A 1QZGA 3R8XA 1EQTA 1EXVA 4CDEC 1WW2A 4Q4JB 4CIAA 4KO4S 2M9VA 3CAMA 4LF4Q 1JWUD 1DXHA 1Q1ZA 2BFWA 1PYDA 1KZ6A 2HLDA 1YJXA 4Q9NA 4UZEA 4JSYA 5SY4A 3VZBA 1JXQA 1L1FA 1YJCA 4XX0A 1UWVA 1K6EA 1XALA 2FSGA 2Y67A 2F52A 3PL1A 2ZSEA 3QLTA 3OJLA 4IJ5A 2UZ3A 4RWEA 1ZUWA 3ZE7A 5ABPA 1E9CA 1FU7A 1GGMA 3EQZA 1EEFD 1UKZA 2CB0A 3KOWA 2W2MA 3F74A 1NYTA 3LQKA 4AN1A 2X9QA 4FF1A 5BSTA 1G3IA 3PUYA 1G20B 1NM5A 3AT1A 2I65A 4K87A 2HYIC 5TDHA 4MSUA 4QSMA 3VX4A 1PS0A 1I7DA 4RK0A 3A54A 1UWKA 3RT9A 1EWCA 3C1UA 1JP7A 1UDWA 2GBLC 1DJLA 1CEYA 1O6CA 1YR3A 4HJXA 2XE8A 4JI5L 2JGRA 3BMNA 4C1NK 1OH8A 1I0IA 1BXKA 2AI2A 2IOYA 3BUSA 1Y1WG 3UYKA 1W2BA 3T7EA 3EPLA 4R7GA 1PIWA 1CA6A 2I87A 4D8WA 5J1TB 1BW9A 1KORA 2PQ2A 4HGRA 5AW8A 1ZCBA 3CR8A 5F2OA 4OVKA 4D4MA 5BR4A 2Z8ZA 3LCMA 4U5XA 4E14A 2IKQA 1P2VA 3K5OA 1XSEA 3KHTA 4LZZA 4HADA 4J2OA 2EIFA 1OIXA 4DRXA 3FNIA 3KG2A 1HR0L 3QG5A 1E4EA 1BXZA 4L5JA 3LGXA 1KSFX 1OFTA 3ER8A 2GK3A 3CNNA 1XNJA 2ZVQX 3E81A 1MZVA 4U1RA 5ECYA 1WXIA 4A3JH 4QOFA 2NU7B 5JYCA 4MUHA 1CDZA 3PO2B 4JEUA 2ILVA 1UK8A 1FUYB 4MS4A 3E8MA 4C0AC 1BAPA 1CZRA 1U7TA 3BILA 4OLBA 3NPMA 1M4VA 4Z4CA 1EX1A 2LBPA 4WVLA 1Z2NX 1CF2O 2CVOA 4XH9B 2RCFA 1UWCA 2ODTX 1GSHA 3PXBA 3GC6A 1C9KA 4YI3A 1ZOOA 2ZYSA 5JSKA 1T29A 2P6PA 3NIBA 3TMAA 2YFHA 1RBQA 3IJEB 3OX2A 5JH7F 1GZSA 3EE6A 3RFFA 1FSFA 1WVLA 4A3FH 1L3IA 1QYXA 3WSWA 1BFUA 3HOVH 1M1KC 1TT5B 2BGJA 3EXG1 1XTCD 3D54D 2HUPA 4C4RA 1BVSA 1FDSA 1VG9B 2VNKA 1I3LA 1K66A 4I9GA 4O1MA 4S12A 4ZVOA 2IV2X 2O3QA 4BGEA 3T5AA 3PFBA 1GPAA 3RIHA 1NOKA 2XNHA 2YCBA 3OY7A 2XTAA 1QGAA 3ECAA 2I3GA 3PE3A 4RH3A 3TRFA 1T5OA 1RCVD 3UYLA 2GXAA 4KXMA 2GVZC 3LXXA 4OUDB 3VBEA 1CNMA 1EG7A 4NDZA 2CNBA 2PGDA 4C21A 4FBLA 4DF7A 1FCJA 5ALPA 1J7KA 2OQKA 1T8YA 1UCFA 3PFFA 2GXSA 2C7BA 1KEVA 3CEJA 2NVQH 1R0CA 4A36A 1N0WA 4F2DA 1E4EB 3IQIX 2ASVA 2BDUA 4XQ0A 4XJXA 2GBCA 1Q7EA 2FB9A 2PMBA 1JFTA 1NE2A 2KLHA 4IJVA 5G3LF 4CDMA 2MTBA 3ZWQA 3RHSA 3K0YA 1IOZA 1UDCA 3F9IA 3VZQA 4DPLA 3WWEA 1C50A 5H5JA 1N5RA 4X65L 3EN0A 5JSYA 3UJPA 4HQOA 1S96A 2XX3A 3DBLB 3ZWXA 1GKIA 1PH1A 1GQ2A 4XM2A 2QN1A 1N6LA 2JD1A 3PSAA 1HPCA 2YCLA 1EIFA 4B40A 3AM3A 4KQ6A 1XDGA 1Z8NA 2V6IA 3EWSA 3ZHXA 1OW3B 2GVNA 4G5YA 3QLJA 1SD5A 4YRBA 2BF4A 3FD8A 4YAGA 3W2DA 4H2DA 2JK1A 4XYBA 2PY6A 1FFYA 5FLKA 3U4ZA 4DJFC 1BJRE 3HZZA 1F0NA 5KNBH 2ZRBA 3O8NA 1AE1A 3MLEA 2VOJA 4PPNA 1BROA 1H85A 5D14A 1PLLA 1XMSA 1CSPA 4P92A 3FKQA 2IYQA 3EODA 1R88A 3NHJA 1ZVMA 4TLBA 3UAZA 1YFLA 1I5OA 2V5AA 1JFSA 3EFOA 4IXMA 1VB3A 1K6MA 1O7ZA 4C0WA 2F64A 1VPEA 2HAEA 3CNQS 2H1OA 3IUJA 4U673 2L18A 4Q9AA 2W0SA 3ZU5A 1MH1A 3MEQA 2P9HA 3DTTA 3NWJA 4NX2A 3RYTC 1DWPA 4CTKA 2YV3A 3WJ2A 1PUIA 4MYDA 4RFBA 1D5MC 3ZDCA 4TYWA 3Q6NA 4LC1A 2C5AA 2R86A 2FUEA 1A71A 5M9OA 1T35A 2AQ3B 1XR3A 3EDRA 1QOPB 3G9QA 1X6VA 4JLUA 2A5HA 1C1HA 1J5XA 1V43A 1O95D 3ABIA 3L4BA 5TRTA 3T1YB 1E4YA 3D0KA 3TQFA 5GONB 1W36D 4C2MH 1NF3A 1RCUA 3GNLA 2E82A 1TRKA 2Y0DA 2V6BA 1AMUA 4P22A 4F3CA 3ED5A 1HH4A 5KYUB 3LL7A 3PF8A 4N5NA 4XUCA 3S14B 5CFPA 3U44B 2ZCJA 4MQMA 1ZNZA 3D8RA 4WLFA 1MBZA 4EFDA 5DHFA 1Z2PX 2BKUA 1N32Q 4FZ3A 2O5JC 2C00A 1QX4A 2Q8RE 2FDXA 3I7FA 3P52A 5LZ7A 3U13A 4BNLA 5EQ0A 2P65A 1CR4A 1GRRA 4QDXA 4Y9TA 4DV6B 4MVJD 1PBTA 1KTVA 4CDCC 1F3LA 2D4AA 4D9GA 2AFVA 1KC8C 4FMBB 3JC66 3N8GA 2JA1A 2VZLA 3ETJA 1P9WA 3MA2B 2N75A 4PZPA 3G7LA 3BCUA 3SZMA 2KMLA 2QHXA 3VH2A 3WGLA 4I5DA 3DAHA 1MAWA 1JG6A 5AICA 2A9VA 5C8YA 3RANA 1KOJA 3ZWAA 2WG2A 2Q4OA 5EMNA 1DKQA 4ER7A 5F51A 3PWSA 1AGPA 3BCHA 3R23A 3HKBB 1AGYA 2AN9A 4HDMA 4L0DA 1OAOA 4P3XA 2L1BA 3CIFA 3G13A 1G7RA 4Y7CA 5CYOA 1PRTD 1UMDA 3PXCX 3LYUA 1JEQA 4GLBA 4G09A 5HGJA 4DQ0A 5B53A 1HE4A 2J9ZB 4B4KA 5IZCC 1I6MA 4JB3A 3DPIA 4C07A 4CHGA 5JISA 4UMVA 1P7PA 4JI3L 4S1PA 5DEOA 4I4LA 1BDBA 5B6PA 1HYEA 3W4IA 3B60A 4M87A 2RI1A 2WJ4A 4TUYF 1M0SA 3QLVA 1QAOA 3R0VA 1NHGA 1B4OA 2QUHA 3M5DA 4MQLA 1YOVA 4LMRA 2DEUA 2VSFA 1DOMA 1GT6A 4B3SQ 1DS6A 1EFHA 2W2TA 5KVCA 4XE5A 2A67A 2C2WA 1H2RS 4LRQA 3WZMA 1TPZA 1X3LA 2Q0SA 4Q1DA 4RV4A 4Y6RA 4DZTA 1DAMA 2WICA 5EEGA 4YJ3B 1VJ1A 5D51S 1H5NA 2JAXA 3NWPA 3NALA 4KQHA 3KF6A 2R85A 1P0CA 1H8HA 3U1TA 4B85A 4E31A 2VDJA 2X77A 4JFRA 1TPYA 5KAPA 4XTRA 1RAIA 1PD1A 1SSOA 2ZAMA 2V6FA 3Q3EA 4N18A 1M54A 5AYVA 1G5RA 1EUJA 1Y8CA 4HJRA 4OGFA 1IXRC 2D5LA 2WWHA 4OHVA 1H94A 1NY5A 2JLAA 1IOLA 2NLOA 3NQ41 3UQZA 5FI0B 5CBPA 1JYFA 1WKBA 3E1KA 2GESA 2Y8EA 4YN3A 1ZIYA 1EM8A 1O6ZA 4NS4A 1BE6A 3EGCA 2X7HA 3LUAA 5J5AA 2Q8QA 4K9NA 1BRTA 4YMTA 5HGXA 3THWB 1DONA 3M1IA 4DT1A 2EFGA 9LDTA 4MI6A 3BQMB 2PFKA 2YXLA 2PJZA 5G1PA 1UP6A 4Y7NB 4MIEA 4BHTA 2YXDA 1DAOA 2REBA 3N2ZB 3NV9A 4HGQA 1EP3B 5EE0A 4HVAA 3Q3IA 1L2TA 3ZQ4A 1VE6A 5TVKA 1SHLA 3S1NB 1W0JD 4ZMRA 4AG6A 2XF8A 1EQQA 1QJOA 1KZ7B 1RABA 4IRMA 2ZFUA 4PLYA 3TJMA 4F4FA 4E5VA 4A3BG 1QH1A 1LT6D 1U81A 3CZ9A 2JFGA 4M1TA 4N3GA 2CW0D 3A36A 3ROGA 3LUDA 3OFND 1KFCB 1G16A 5CVDA 1VBMA 2NGRA 3IAM6 2KCNA 2V6MA 2RHSB 3IA2A 3BMCB 4D3XA 1U8EA 2CWWA 3PJEA 3TKLA 2QTWB 1OI3A 4HUTA 2D54A 4K05A 1TQDA 1G91A 4LMQD 1YS2X 2QTVB 3AUFA 4RHSA 1AQYA 1DU4A 3EIOA 3JQDA 1DADA 3LCUA 3PPYA 4IFBA 1CBUA 3W6UA 3DE6X 3HNRA 1OBFO 3ABSB 4P33A 3RU2A 1JE4A 2BH9A 4OP2A 3ZYYX 3HB7A 4WBNA 1I1NA 1B70B 1DZ1A 4LF6B 2O8EB 4RAQA 4E70A 1RTKA 2QN6A 1DT5A 5EJAA 3S7TA 1CLUA 3H5TA 1SVUA 2XB8A 3OH8A 5CA0F 4ENQA 3ERCA 1JBEA 3DTVA 4LFAB 3CMEA 3RYCB 4R9UC 2O5RA 4TWJA 1L0WA 3V1KA 1L1EA 5A4IS 5JPCA 2Y1OA 1HXYD 2PI2E 4A9AA 3PICA 2WFMA 4XZ3A 5DKFA 2JGDB 3ZI0A 4EZEA 3A2NA 2VRBA 4JOQA 1I4PA 2FJ2A 2PRJA 3G79A 3O8OA 1F2DA 4HUQB 4LE1A 3L1JA 4YO7A 3V48A 3WLLA 3ZXIA 3C15C 3TUIC 5J2TA 5AXCA 1HX7A 3QVUA 3AP3A 3BD8A 2BEUB 4EYSA 5KC9A 1IBMB 3A28A 4JHXA 3DMUA 3D4WA 4LNHA 4YQFA 1XAJA 4OMUA 1FP4A 1KBQA 4PXSA 5FPYA 4F1WA 4ZQCB 3PQCA 3X1MA 1GDDA 1IPFA 4DUYQ 1EVJA 1CI3M 4Q9LA 1JEAA 4R8MA 2K14A 1FMTA 1VA4A 2WWTA 3ELUA 3CRRA 3FCEA 1QG7A 1VLHA 3QX3A 4WJWA 3JRWA 3T61A 2W4MA 1RQGA 3L0SA 3ONFA 4MKIA 1MG0A 5JAZA 1DJOA 1JDZA 2MPMA 2GS9A 2XGOA 3A1EA 3P4UA 2J6HA 2PUCA 5FEUA 3HDHA 1T9GS 2IP1A 2IHBA 5IWAQ 2RBKA 3C6ZA 3ETHA 4MVWA 1I5EA 2ZR9A 1AF4A 1VZ3A 3L8CA 3QMMA 5IHPA 1CEQA 1PJRA 5EGNA 4QJ4A 4PSDA 4DCPA 1Q1AA 3N2KB 3C7KA 3GFBA 1U3FA 4BVKA 2BFPA 4F93B 3QO2A 1AS0A 1QYIA 4BZZA 2FQXA 3OZIA 5CX1B 2OA0A 2VNSA 2K5HA 1R5BA 3ICVA 4YB8A 1Z63A 3V80A 1VB5A 1P61B 2B9EA 3LLUA 3TB6A 3W5SA 1FVIA 2KCMA 1JQEA 1QO0D 3DFZA 3FGPA 4HQNA 3BYTB 4EMUA 1CNEA 5F2EA 3IAHA 3V1NA 2R4QA 3SIRA 2WMNB 4GSYA 2QRHA 4OMCA 1V8FA 4DV7Q 1DC6A 2PBZA 2X40A 3AKEA 5J3JA 4NSNA 5T8KC 2MOKA 2R6FA 2Q0QA 2KS6A 1I4HA 1KNAA 4X3SA 2WUEA 2CLOB