3ONAB

The secret domain in complex with cx3cl1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'CNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumour necrosis factor receptor
molecule tags Viral protein/cytokine
source organism Ectromelia virus
publication title Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor
pubmed doi rcsb
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3onaB00
4ZK9B 1B3AA 4XT3B 3UI2A 4X3KA 4HAEA 1SSOA 1F9RA 2K03A 1B53A 1XX8A 4RA8A 1DONA 3TZDA 1KNEA 5CBAE 1WD0A 3I3CA 1EIHA 4IUVA 1DOLA 1HFGA 2R3ZA 1RTOA 1EIGA 1NCVA 5EQ0A 2H1EA 1ILPA 1B4OA 1MSHA 2NYZD 1IKLA 4IUTA 1B50A 1PDQA 1WD1A 5CMDA 1WTRA 2KUMA 2L12A 1CA6A 1JICA 2RSNA 1U4PA 1GUWA 3DEPA 2B2VC 1F9SA 3ONAB 3D6WA 3SVMA 1RJTA 2JP1A 1G2TA 2L11A 1QNKA 3FPUB 2B2WC 1PLFA 2B2WA 1WTPA 3R93A 1E0BA 1PFNA 2MJ8A 1MI2A 2RA4A 3GV6A 4CJ2C 1RHPA 2SDFA 4IUPA 2KOLA 2NZ1D 2B2UA 4NW2A 1WTVA 1CM9A 1J9OA 2KEDA 1WVLA 1PFBA 1G91A 2MPMA 2HDMA 1NR2A 1VMPA 3G7LA 4O42A 5EKIA 1WTWA 1LV9A 2FMMA 1BF4A 2CVRA 1DZ1A 4XDXA 4R8IA 3IFDA 1IKMA 2RVLA 4DN4M 5E4WC 2JYOA 3Q6SA 4CJ0B 2DY8A 1B2TA 4ZKBB 1ESRA 1G6ZA 4RWSC 1NR4A 4R9WA 1O80A 2N88A 2EE1A 4HCSA 4ZKCB 1HHVA 4QUFA 1CA5A 1EL0A 1X3PA 1O7ZA 2B2YC 2EOTA 2RSOA 1WTQA 1VMCA 1AZQA 3N52A 1MSGA 1KNAA 2MP1A 3DM1A 5COYA 1ML0D 4MN3A 3LWEA 1ZXTA 1X3QA 5T1IA 4OIKA 4ZAIA 2K05A 1F2LA 2K28A 1F9QA 1BBXC 1PFMA 3KBXA 3FDTA 4X3UA 1C8CA 1EQTA 1X32A 2N55A 2D9UA 2B2VA 2K01A 4HEDA 4HSVA 3I91A 1HA6A 4RAUC 1J8IA 4LMQD 2KEEA 3H91A 1QE6A 2MGSA 4UAIA 1A15A 4CJ1B 1SDFA 5E4XA 2L9HA 1BO0A 2FHTA 1Q3LA 2M2LA 2XIWA 3QO2A 2X6GA 1U4RA 1AZPA 1HUNA 1NAPA 4U68A 3MWYW 2B2UC 2EPBA 4QUCA 5D14A 1M8AA 2HCCA 2HUGA 3F2UA 5DNFA 3DEOA 1WTXA 1QG7A 4IUQA 3MTSA 1WTOA 1F9PA 2B2TC 3IL8A 4IURA 1DOKA 5CORA 3HP3A 3GV3A 2IL8A 4IUUA 5EPKA 2K04A 2FINB 3I90A 2HCIA 1G2SA 1HRJA 2FFKB 5D65A 2HDLA 4XT1B 1IL8A 1MGSA 1O7YA 2DY7A 1HUMA 2J7ZA 2NWGA 1RTNA 2KVMA 2VXWA 4OIJA 4X3SA 5AFWA 1BNZA 2X6LA 1HFNA 4X3TA 1ICWA 2KECA 2FJ2A 1RODA 1U4LA 5EPLA 3P7JA 5T1GA 1TVXA 4ZLTF 1AP0A 1JE4A 5JJZA 1XYIA 2K1BA 1U4MA 3TN2A 1ILQA 5EPJA 1DOMA 2Q8RE 3I8ZA 2B2TA 3KUPA 2BDNA 2L1BA 1EOTA 5CBEE 2B2YA 4MHEA 1S4ZA 2X69A 2L4NA 2Q8TA 5EJWA 1SAPA
chains in the Genus database with same CATH superfamily
3CXCA 5CV4A 2XVSA 4ILWA 3F2CA 2TSSA 5C4HA 1LTAD 3DUZA 3RZDB 2JA8B 3F1ZA 3M4OH 3RD4A 5CYUA 4AYBE 2AQ3B 1KLUD 1PTOF 5ELNA 2XRSD 4DR6L 2VL6A 2UUAQ 3GDEA 1STYA 4PV1C 4JI6Q 4OEMB 3ND9A 3AU7A 3P20A 1BBUA 4IUPA 2O4XA 1LT3D 5EKKA 3OTOL 3CCMA 1OO9B 2HDMA 1TWGH 4P73A 3I56A 4NXNL 1DZ1A 1SNMA 2H4OA 1ESFA 1GKHA 1HR0Q 2DY8A 4HCSA 5IGBA 5FKAC 4KMUC 3SHLA 2NVXB 1X3PA 1QNUA 1EY5A 4KHPQ 1XJVA 2HD3A 3G48A 1MSGA 1YHBA 4PQXA 3PF5A 2EY1A 4P2CB 4DV3Q 3HOYG 1JCKB 3LWEA 3I4MH 2A6HC 5M5XB 3WOEA 4BA2I 3RN2A 5IGDA 5FO8B 4DAPA 4LFAQ 1CSQA 1H9SB 5JEAJ 2NVYB 1L1OB 4ZUIA 2CWPA 3I7FA 3U4VA 3S1NH 1PH7A 1CKNA 2EJMA 1SYCA 3J7AF 1B9MA 2M2LA 5IGGA 4Q5VA 4UP9A 1SNPA 1SBBB 3URYA 1KD1C 4XQQA 1D1KA 1TWFH 4IUQA 3K7UC 3H0GB 3CD6A 3GV3A 1BCPD 1V9PA 1QCBD 5G3LD 4DAYA 2WP8J 3AYHB 4OX9Q 1CQFA 3CC4A 2EZVA 4R4OA 5F2DA 3I72A 3I4NB 4PZ6A 4Y7NB 2OF1A 4IPHA 4X3TA 4AQYL 3AMUA 4YWMA 1CSPA 1DM0B 1MD2D 1JE4A 3L3OC 4ID6A 1E7ZA 4DK0A 1Q81C 3SR1A 3HOYH 4EQOA 4FXKC 4ZQ3A 2NVYH 2Q8TA 4DR4Q 2R7FA 3S15B 2E2IH 2RHQB 1SMYC 1EIYB 3NTHA 3V05A 5JJLA 3BYYB 3I3CA 5M9OA 4TQUS 3FKIB 1K73C 5EQ0A 1ILPA 5I2YA 4M8AA 1QJOA 4IUTA 1L1OC 2CW0C 4C3JB 2RSNA 4FF3A 2Y0SB 2HQEA 4A93H 1B7YB 2JP1A 4JI6L 1TWGB 1IL2A 4JI3Q 1Y69U 2F0QA 2V1CC 3NBHB 3S14H 1WTVA 4DR2Q 2BDOA 3M7GA 5FJ8G 3MXUA 2MPMA 4BY7B 5IE8A 1EZ8A 3PUXA 5J22A 3VR2A 5E4WC 1DYQA 1Q1BA 2MFIA 5HURA 3PUYA 4KKUA 3NTKA 3I4MB 1I6HB 4DV0Q 2A1AA 2Z4HA 3MC0B 5ELOA 5ELFA 1K3RA 4DR1Q 3HOXG 2JA8H 3MZ5A 3KFUA 2R7ZH 1F2LA 4LFAL 1F9QA 4NXML 5CV8A 3A7LA 2F0DA 4GOPB 1BUVT 1DXMA 1A6XA 5IP9G 5CV6A 1STBA 5FJ8H 4JI5L 1SE4A 2OQ0A 5LMNL 2NTSA 3HEJA 3MWYW 4DR3Q 1PH5A 4C56C 3W3AA 1SMYD 2JK8A 2K4KA 1JOOA 1NSNS 4DXGA 4OX9L 1X3FA 2C35B 1KL9A 3S16H 1SR3A 2AWOA 1JORA 3KDFB 2LXJA 2E2IB 4X3SA 2E2DC 2O5JC 2F0KA 1RODA 5FLMG 2JJQA 4LF9L 1BCPB 2XWJB 1XYIA 4QMGA 4MNOA 4ODGA 1N36L 2QDBA 4A3MB 3KJPA 1VDZA 1VQLA 4X66L 3S1NB 4L63B 4HJ9A 2L0CA 2DJFC 3W1BA 1STAA 3J7AV 1UUPA 5EBDA 1STHA 1FNUA 4XT3B 1D6EC 3OYYA 4JI1Q 2F4VL 1ZYRD 5I6WA 4FF4A 3EROA 4N9PA 1Q12A 1N32Q 3D8GA 1HZAA 3EN2A 3F8TA 1Z47A 2NVXH 4BY7H 2IHFA 4YIJA 2B63G 2OTJA 2NN6G 1XTCD 4ZYSA 2QW7A 3IFTA 4B9WA 3H3VH 2L11A 1UE1A 1BBWA 2CFMA 4LF4Q 2E5LQ 1EY0A 1A2TA 4B3TL 1PXUA 1A8VA 2R7ZB 1PFBA 3DM3A 1BF4A 2P5ZX 4APVA 1UE5A 2DJGC 2JYOA 4CJ0B 3D6CA 1O80A 2NZHA 4IOAA 1D1IA 2R7ZG 4EVOA 4IFDH 1KTKA 1AW7A 1PH4A 3MXGA 2WV6D 3KF8A 2WINB 2XWBB 1STNA 2A68D 1TWCB 1ASZA 3QOLA 2UXDQ 5AJ3Q 1EQTA 3NXWA 4HSVA 1JC7A 4LMQD 2L9HA 1O7IA 2FHTA 1VQ4A 2X6GA 1KIXA 4DR6Q 1HUNA 3MFGA 5C3EH 3NPPA 3K58A 1TWAH 1TY0A 4ZUJA 3T1HQ 3ERSX 1IBML 3MTSA 5E7NA 4RKBA 3H0GH 1IXRA 4A93G 1EYDA 2IX3A 1JWUD 4LF5Q 3H09A 1VQMA 5D65A 2ZTDA 4K8JA 2R93G 1G6PA 4DV2Q 2I46A 2PQEA 4G7HC 5IGEA 1HFNA 1SYBA 3UDIA 3HOXB 2KENA 5EPLA 5T1GA 4DNTB 4EGVA 4A3KB 1D7QA 3TN2A 1EWCA 1OXXK 1TWHH 3STBD 2BDNA 4OL7A 1EOTA 1DJRD 3NQTA 3RLNA 1TXYA 1Q8IA 1TU2B 1JWSD 4NP5A 1SSOA 1TT2A 4LW1A 2HQLA 2K03A 1B53A 1X56A 3VYTA 2K5VA 3PO2G 3HOVB 2EY5A 1VQCA 1E2VA 2VW9A 2E2JH 2H1EA 3CRKC 1TWFB 4UY8C 2NBFA 1VQJA 1B50A 2ZXPA 1PDQA 3HS0C 1WD1A 4C3HH 2RBMA 3CCJA 5C4XB 3PO2B 4BBRB 3L2PA 2K33A 2YTXA 1QNKA 1UAPA 3CQZH 1IYVA 4X6AH 1YNNC 2B29A 5NUCA 1AE2A 2B63H 3LNNA 5LMNW 2D5DA 2KEDA 4G4KA 5C0XI 1XPUA 3AQQA 4OO1I 2XSCA 1VQKA 1U9RA 1LV9A 4GKKQ 4QF4A 4LFBL 1H9RA 1E2WA 2F0MA 2RF4A 1JOQA 1GHKA 1ESRA 2QKIC 2F1MA 3HKZB 2UU9L 4MZ9A 1K8OA 5IT9c 1VMCA 3KK7A 3NEMA 3PUVA 3CF5A 1X3QA 5C44B 1Y1VB 5BN4A 3JAMi 2QEXA 2D9UA 3GTQB 2BA1A 3EBEA 1A3UA 2L55A 1J8IA 1XXGA 4UDUC 3N6RA 1R4PB 4WORA 5M3MG 3HOUB 1Y1VG 1LYLA 1EY8A 1STEA 3DMUA 3KLSX 1LT6D 4G57A 5JEAH 4QUCA 3IAYA 4RCNA 1C48A 5JOBA 3VR5A 3ITPA 5KNBA 3GD7A 4ZCKA 2E2JB 3AFPA 4YHHL 3S1MB 5M3MB 1JQYD 1SJED 1BXTA 1E2ZA 4KHZA 1BDOA 3VR3A 4LUZA 1QB5D 1VQ9A 3ZJYC 3K0YA 1ENAA 4A3EG 1PTOD 3SGIA 4DV4L 1LO5D 1KLGD 4K5WA 4HR7B 4JI8L 2X6LA 1D5MC 3A5UA 4EQPA 4POFA 5M5WH 4X64Q 1IW7D 1OXSC 1GOZA 4L5RC 1ET6A 2Q8RE 2NN6I 2ZTEA 1YJNA 2F0OA 3STBC 4KY6A 2B2TA 4JI7L 1GD7A 5IT9L 1S4ZA 1QILA 1HZCA 2Z8LA 2OQKA 3PF4A 1FJGL 2TMPA 4BWGB 1LTSD 3PO3G 1PRTD 2LMCB 3V2TA 3F2DA 2IWHA 2R93H 4FDBA 4P72A 2ASBA 1I50B 1IYUA 1V1PB 1GUWA 5GADC 4A3GH 1KAAA 1STGA 2RCFA 2UXCQ 3R93A 4CDEC 1D5ZC 4BBRH 2AKWB 2DN8A 1ENCA 4B3ML 2B2UA 2F3IA 1LTGD 4A3KG 1XPRA 2R61A 3WWVA 3PSIA 4RMFA 2N78A 4R8IA 1WCMB 3TP8A 1I4RA 5GROA 3LX0A 1SEBD 5IT9E 2CW0D 5A35A 4FXDA 4A3MH 2K28A 1K8GA 3S15H 4A3BH 1B8AA 1ZYRC 2K52A 1Q82C 3TP5A 3BZCA 1N33Q 3A8JE 2B2VA 2PCFB 3A7AB 2EY2A 1SMXA 4UPAA 4KD4A 4UAIA 3J7ZC 1IW7C 2F0WA 1HNWL 4LF7L 2ZJPA 1HR0W 2A8VA 4IOCA 1V8QA 2F0VA 4OHJA 4KKTA 5C4ZA 3DEOA 1UWVA 3Q8DA 1XPOA 1R9TH 1G8ZD 2E74C 4GZYC 3J81i 1CKNB 2UUBL 2AUKA 5IOCA 5C3EB 2FFKB 3OMCA 4DGZA 1DGSA 4GNXC 1YBYA 4DAYB 1UE7A 4KHPL 2QDLA 2QA4A 1KRSA 2K6AA 3Q24A 2UXBL 2EQSA 5C44G 2OEOA 2Z6KA 1PH3A 3HG9A 4CKBA 1IBLQ 3H15A 5D3DA 4HJAA 1CQVA 3W1GA 1HNZQ 3OHXC 4AIMA 5HGTA 1U5KA 2JN4A 5M5YB 1NMGA 4LAAA 3GTGH 1Q86C 3A56A 3VYUA 4L5TA 4WJ3M 5KGUA 5FLMH 3TP6A 1B9NA 3IRBA 2L5TA 3WDNA 4G7OC 1FR3A 3A74A 1ZEQX 1X3GA 3NENA 1YHAA 4DV7Q 2KUMA 1XMQL 2L12A 3M7NA 2I5HA 5I9OA 4X65L 5BR8L 1JB3A 3GQBA 2B2VC 2NUCA 1VQEA 3D6WA 3Q23A 1LTLA 1B70B 1J5EQ 2WAQG 1WTPA 1PFNA 2AQ2B 3TP7A 3EQLC 1S5DD 3GTOH 2NVQB 2UUBQ 3K7AH 5IP9H 1TS3A 2ZTCA 4RCOA 4LF4L 1HR0L 4DN4M 3BDLA 1HH2P 4NMZA 1N36Q 4R9WA 2JXMB 1QUQB 4DUYQ 1X9NA 2Y0SE 1EL0A 3KYHC 3ICEA 3PO3B 5JVH3 4EX5A 1Q8KA 4OWXB 5GAGC 3HFZB 1MIUA 1ASYA 5DEHA 2CQOA 4BY1B 3D4RA 3C1FA 1N32L 3M3YB 2ICEC 4A76A 3S14B 3BVGA 2BA0A 3I4NH 2A69C 4LF7Q 2EJFC 3C46A 4Y52H 1SN8A 2XIWA 1JWMD 1PYBA 1HTPA 3TEHB 4U673 4A3DH 1LM0A 3S16B 4LUVA 1TR5A 2WIIB 3V96A 4CDFC 5C3WA 4OWTB 1CK1A 1KAWA 1PH6A 3LWUA 3HP3A 1SE8A 4DK1A 4JBKA 2AHOB 3TMEA 3I55A 3OWFA 3GTMH 3AFQA 2Z1CA 4IO9A 4RGNA 1RTNA 1F2ZA 1QOHA 2KVMA 3QB3A 4FXGC 3BZDB 2KJXA 1T9HA 2QILA 3P7JA 1LTID 5FLXE 5M5YH 1U4MA 2RKSA 4CGYB 1SROA 2R92G 3CCEA 3S1QH 2PZTA 5IYCG 3KDFA 3I70A 2L4NA 1C0AA 5EJWA 1SAPA 2BE5C 4K14A 4V190 1RDPD 2F4VQ 3G6JB 4A3FH 3HKSA 2R92B 4MIUA 4OO1H 3L9AX 1WD0A 3DWAA 3GP7A 2HT1A 1BR9A 2MHVA 5C5LA 1HFGA 2ES2A 4FYDA 1EIGA 3FKIG 4CKEA 1YITA 3OSOA 1B4OA 1MSHA 1W6KA 1XMQQ 3EJIA 3NWTA 1SXTA 2WB1G 3J81j 5KEEA 3NWSA 5K5PA 1OXUA 1LACA 3E9HA 2JA7G 4J8QA 3OMGA 4A93B 2UUCL 3S2HB 2WB1B 1SLJA 1L1OA 1FD7D 3S24A 4DV2L 3G7LA 4O42A 1PYSB 4A4IA 1EQRA 4L5SA 2YTYA 4XDXA 5IODA 5FLXL 3S17H 4PMCA 1RIPA 1GO3E 2N88A 2EE1A 3S9WA 1FGUA 3I4MG 4BXXG 2F0JA 1MKHA 2BOSA 2MP1A 1HXYD 4IPDA 4O1NA 3M4QA 2GVAA 3JC66 1NTGA 2K05A 1KC8C 2HIXA 3I4LA 3BG3A 5KYIA 5GAHC 3SEBA 2SNSA 1HCZA 1LTRD 1SRUA 3U58A 3U50C 3J81L 4BBSH 2WAQB 4JI5Q 1AZPA 1E22A 4U68A 4JYAQ 1RD9D 5C4XG 4PMWA 3CRLC 2VNUD 4CHTB 1WTOA 3KLWA 3KF6B 5M3FH 2ZJQA 2G5DA 5IY0A 1K8MA 4X62Q 3CMAA 4DR7Q 2F0HA 2WACA 2YV5A 5BN5A 2H5XA 3T56B 5AFWA 3R3OA 3I73A 5C0XH 3QJYA 3KBGA 2KQ3A 2VS1A 2Z6BA 5JJIA 3JAMc 2KCMA 3E0EA 1PV4A 1JMCA 3HKZG 1Q46A 5EBCA 2QF7A 4DV3L 2EJGC 4QQBX 3A54A 4E6IA 4J1MA 2ALYB 5CV9A 5DM73 1DD2A 4JI0L 3UI2A 1F9RA 3HOWH 2K5HA 2XN9C 1PRTC 5I2XA 3FVQA 1SFOB 4IUVA 3K81C 1JB7A 2R6GA 3K57A 1PMRA 1EU3A 4L8JA 3CCUA 2VUMH 1WTHA 1OTCA 1XNQL 1II3A 4GS3A 4MTNA 4A3CH 3RMHA 3HOUG 4B3RL 1TKWB 5M3FB 4A3LG 1G2TA 1EY7A 2JA6G 2Q2HA 4JI2Q 1V1QA 2B2WC 3CQZB 2JA6H 1E0BA 1HNXL 3NELA 3RUZA 4C1NK 4LFCQ 2NZ1D 2IJ0A 2CCZA 1YVCA 5IYDG 4WJWA 3A55A 2VUMG 5ELDA 5C5MA 2A68C 2FMMA 4JI4L 1HTLD 4DK3C 1IKMA 2B8GA 3HOVH 3Q6SA 5FOBB 4DR2L 3PIP3 5CV5A 4A3JG 2WB1E 2KHJA 2VUMB 2VY3A 1O7ZA 4OXPA 1PTOB 1KNAA 4IZ8A 2IPKD 4DR4L 3GTJH 3D3RA 3U9OA 2Q2IA 5DAUA 2QGQA 2OT2A 5AJ3L 3F2BA 3H3VC 4JPBW 1L0YB 1I5FA 4HEDA 4JG2A 4JOIA 1JE5A 1KDAA 2GVBA 4AYBG 1BQQT 3J80L 1QE6A 3M4YA 4QGUA 1MJEA 3MXNA 4JCVE 3U4ZA 3QO2A 3BVMA 2FXQA 4R1JA 3TREA 5E1FA 1PA6A 2HUGA 3P75A 4LF8Q 1F9PA 4IJHA 4NXNQ 1LABA 4A75A 4QIWE 3MHBA 5EPKA 1A62A 3T1YQ 2EYOA 3TDQA 1EYCA 1GM5A 1I6VC 3MEFA 1NUCA 3Q0AA 1HJPA 3NE5B 2K5QA 3E3XA 2JEBI 4B3SL 5K36H 3A8IE 1HZ9A 3K5LA 1MHWC 2EY6A 1A3TA 4XYQA 4MHEA 3A0JA 2GA4B 4HAEA 2ATWA 2YU9H 4XYOA 1DONA 4RA8A 5TSSA 4DF7A 4KV6A 4AH6A 5IYBH 3T51B 4NPSA 3DLLA 3ZYYX 1H9MA 3GTMB 4DUZQ 4DFAA 4H7BA 4DPGA 2A19A 5DLQE 1Y1WH 2K5DA 2NTTA 2XRQD 1FYCA 3IKJA 3SDZA 1KRTA 4R4TA 2F03A 1PLFA 2MJ8A 5L37A 1LLRD 3CHBD 3W5OA 2PMZE 4X65Q 1Y14B 2F0UA 2NZOA 3E5SA 3EVQA 3QR8A 1WVLA 1CZWA 2G9HD 3MFYA 3ND8A 1YJ9A 3W2DA 3CCLA 4K5XA 1YIJA 3T13A 3IFDA 1OXVA 1U0LA 2A5HA 1TWCH 1KXLA 4ULLA 1B2TA 3CAMA 4KN7C 4ZKCB 1SNDA 3MAQA 2MQHA 4C2MH 2EOTA 1VQIA 4IALA 4IPGA 3S1RB 1JJCB 1PRTB 2PNHA 2KBNA 2E2HH 1D2BA 5HY6A 4FF1A 2KHSA 1LTTD 3JAME 2JA6B 3H91A 2NVQH 1B44D 3DWQA 3PIPA 1WFQA 1PHJA 5CC4A 3IL8A 1DOKA 3J80E 2EDGA 1UE6A 1VQ5A 2EIFA 2RHSB 3DXJC 4ALPA 4IUUA 3VA5A 1YNJC 2K04A 2FINB 4GKJQ 3PMFA 1G2SA 4DR5Q 4K6LA 3FEWX 2F52A 4K2LA 4A3EB 4DV0L 3UE0A 4C3IG 2NWGA 1GUNA 4JI3L 4A3IH 2JA5H 4NB3A 1EWIA 2KECA 2A69D 4DR1L 3J80i 1AP0A 1TVXA 4ZRZA 4A3DB 4R4IA 3QIAA 1SE3A 1IBKL 5ELEA 2VQEL 1L2FA 1XMOQ 2IHEA 4FVMA 3D4DA 4YCUA 1XTDA 3TZDA 4BY1G 3NBIA 5CBAE 5LMUL 5C0XG 1RTOA 3GTKH 4JOIC 1VQPA 3T53B 1B1ZA 4KI0A 3H3VI 2AMCB 1VQHA 2WKDA 2J4XA 2CHBD 3FP9A 2MUYA 2OCEA 1Y1WG 4C3JH 4M1UB 3HOZH 3KOJA 5KNDA 1VMPA 4FP5D 4YWLA 5IYBG 4X66Q 2GN5A 2RVLA 3SXHA 4BY1H 3FMCA 1WCMG 4H13C 4WRDA 4JI1L 4RGOS 1Q90A 3N52A 1NY4A 2I5MX 5ISRA 2LY7A 1BCPC 4N9TA 1A3VA 1HA5A 2JSOA 1OXTA 3FDTA 4UHVA 2IW3A 3QOJA 4F8MA 2WKCA 2PNRC 4N8X1 4R4QA 4A3IG 4C3IH 2ZJRA 3OIQA 1SDFA 2MO0A 1I4GA 4Q0FA 4DXFA 5LHY1 2N49A 3PIO3 1PYWD 5D14A 4XQJA 3CPWA 2UUAL 3D0FA 3RZOH 1GUSA 3GTKB 4RG1A 2JA9A 5EKLA 5C0XJ 3QWNA 4GKJL 2IX1A 4G7ZC 1QZGA 1JT8A 1Z6HA 1HPCA 1EQQA 1R9TB 3NHHA 1PZKD 4BS9A 1VQNA 2PI2E 1EZ6A 4YWKA 1FVIA 4YY3L 1XMOL 4LF5L 2A74C 5JJZA 1E24A 2PZWA 1ILQA 2QCPX 2XTIA 3DWPA 1DOMA 1SNQA 1EY9A 4LK1C 3KUPA 5LL6S 5IYCH 2L1BA 1CKOA 5JJKA 2B2YA 2DNCA 1B3AA 5D3IB 1WOCA 1PH8A 4Y7NH 1EYGA 3ULLA 1S5CD 4CKCA 4QJFA 4PZ7A 3GTPB 4FO2A 4DV1Q 3PV0A 4P74A 3T16A 4K0KQ 1DCZA 2PZUA 2UXDL 1R4QB 1T5XD 4I7AA 1F9SA 3VDYA 1RJTA 4K2KA 3R2IA 5DM63 4A3GG 4C3IB 2B2WA 3S2DB 4HSPA 4ME5A 4DR7L 2BH2A 3R2TA 3TZUA 2KOLA 1LT5D 1SNCA 4P71A 4OWWB 4A3DG 1CM9A 1TS4A 1SNOA 5EKIA 4K8IA 4C1NI 2E2HB 1S3OA 1JJGA 1RL2A 2RDFA 1GUGA 2EYLA 1G6ZA 1KQSA 1FL0A 2EYHA 3OW2A 4H0LC 3L0OA 1AZQA 3SE0A 2F0TA 3KJOA 1PH2A 3DHQA 3MEHA 2IY5B 3NBHA 1WCMH 3KBXA 2VZAA 1GUOA 1YNND 1HA6A 3O13A 4GNXA 2KEEA 4V0BA 2PPBC 3HOZG 3J81c 1VF5C 1Q3LA 4JYAL 1NAPA 2SOBA 4GN4B 2EPBA 3CW2C 2NB0A 3PUZA 3VA7A 3M4PA 5C3XA 3TS2A 2B2TC 5FO7B 5C4XH 4RKLA 3KLSA 5JEAG 1K83H 1JJ2A 2AUJD 2YU9B 1V1PA 1IL8A 4CDDC 1O7YA 4DNRB 2CQAA 1F2YA 4GLXA 1LTBD 1RF2D 4A3JB 4KD3A 3A5ZB 5H1SE 5I6YA 4R8NA 4HJ8A 3CU7A 5CBEE 4A3IB 5E3FA 4NDXA 4X64L 2F0IA 1K0SA 4XQNA 1EU4A 3NTIA 4C2MB 4HIMA 1GXDC 4X3KA 1KHIA 5EGTA 1I3QH 1N33L 4F7XA 1KNEA 3BDCA 3NSWA 1TY2A 1DOLA 1S5BD 3GO5A 2A73B 1HNZL 2HHHQ 4DV5L 5GAEC 1X3EA 3GTLB 2DNEA 4X62L 1N34L 2B3GA 2VQFQ 4JK1C 4S3SA 4DA2A 1BVSA 2KA7A 1CT1D 1U4PA 3BVZA 1W6JA 3SVMA 5FLXc 2Q8IB 1FNWA 5JPNC 1QVGA 4A3LH 2R7DA 1EIFA 2BCOA 1MI2A 3D4WA 4J6HA 1LT4D 2N8NA 2JA7B 1YZ6A 3OW7A 4NW2A 4C3HG 2F0LA 1CZGA 3S2DH 2IX0A 5IWAQ 1NR2A 4KY7A 3GTJB 2RDGA 1CI3M 2A6ED 4NKLA 4GKKL 2ICIA 4LFBQ 4I7ZC 2O2LD 3BZKA 1M4VA 2Z9HA 1PVOA 4RWSC 5LL6X 1AN8A 1WJJA 2E8GA 2RSOA 1YNXA 2B2YC 2ENBA 3K5NA 1ML0D 4MN3A 3HRZC 3SK5A 4HMJA 4OIKA 4ZAIA 1YEZA 3CPFA 2F4IA 4A3JH 1PFMA 4OONA 2D62A 2N55A 3VR4A 5JVG3 1Y8OB 3PQIA 2M00A 2K75A 4A3GB 4JI0Q 2ZXRA 5CV7A 4HCEA 3ULJA 1HQRD 2EXDA 3S2HH 1I50H 1ZKOA 2MO1A 2B2UC 1A0IA 3EA6A 4YCWA 1H9JA 2VQFL 1PH9A 3HZXA 3NK9A 4YHHQ 4IURA 5CORA 4TKOB 1UNSA 5I4DA 1SFOH 4LUOA 2BE5D 4ME3A 3I90A 2OTLA 3AEVA 1Y8PB 2IT1A 3E6ZX 4IUNA 1D8LA 1NNXA 4WFN3 2ID0A 4LNQA 2I07B 4OIJA 4JW0A 3T4AC 4BBSG 4DNIA 4RGMA 2FJ2A 3AB9A 3MVVA 4ABNA 1SYFA 1TIID 4ZLTF 2PQAA 4DR5L 3P1HA 3I8ZA 1PH1A 4JI4Q 3C3LA 3KLRA 4JBWA 4IJLA 4H02A 1S5FD 4XIGS 1UEBA 5IGCA 1SYDA 2PMZB 4KKSA 1FJGQ 4F88A 3VR6A 2JQOA 1NCVA 4HIDA 4DUZL 3K0XA 1EEFD 4EQNA 4FNFA 3OPOA 1S40A 4PMBA 3ER0A 1CA6A 4Z9CB 4JV5Q 3DEPA 2JA7H 3ONAB 4TRDA 5M3FG 1EUJA 3D31A 3FRPB 3SK6A 5A2QE 3K7AB 1HNWQ 2RA4A 4HTHA 4IQZA 3MA2B 2ZM6Q 2PYKA 1H95A 3B6YA 4QIWB 2L15A 1K28A 1Y1VH 2Z0SA 3K80C 4PZ8A 4B3SQ 3H6MA 5KRUA 2K32A 1C7YA 1EY6A 2LFNA 3KF6A 2J0TD 3PUWA 2VB3X 4RFBA 3M9BA 4ZKBB 4GLAC 4DU9A 1CA5A 4DV4Q 1CKMA 3S17B 1VQ8A 2K7VA 3E9IA 1K8AC 2B8FA 3K6OA 4I65A 1S72A 1QVCA 1UEAB 5IGFA 2R92H 4BXXH 4A3FB 4B9XA 1BBXC 1K9MC 3PGZA 4YCVA 1L0WA 1I4HA 1EOVA 4RAUC 2KCCA 4JVZA 3FHWA 4AYBB 4HIKA 1BO0A 3GTOB 1EFID 3I2ZA 3VYRA 4LJZC 4HJ7A 4C3HB 1PZID 1QWYA 3F2UA 5C4JB 1QG7A 2XNAC 3GTPH 1VQAA 2RCNA 2IL8A 1I4PA 2HIVA 3HOWB 4KHVA 2C9OA 1E1OA 3J7A5 1RKNA 4A3CG 3OIPA 4KJNA 4DUYL 4CBVA 1VF7A 2DY7A 2VXWA 1BNZA 1M1KC 1NMFA 3HOWG 4LF6Q 5HGQA 1U4LA 4AQYQ 1TWHB 2LKVA 3GTGB 1EWHA 3TSSA 2ZXOA 3I4OA 5EPJA 1IBLL 1BCPF 2EYMA 5G3LF 3HOYB 4K6DA 1B3QA 3K5MA 3BYTB 4A3BB 2CH4W 2FMCA 1TS2A 5LMNQ 4O0AA 1XX8A 4EQ5A 2F3VA 4TVAB 2F0NA 2JEAI 1C9OA 3OOCA 1H9KA 2R3ZA 3S1RH 3HGBA 3PCOB 1A2UA 3M85A 3RZOB 1I6HH 2K14A 1ICFB 4NXMQ 4TSSA 3PIOA 4B3MQ 1JICA 1CFMA 3OTOQ 5BR8Q 1RCVD 5JPMC 3H0GG 3TQYA 3TS0A 3FPUB 4B08A 1PZJD 1T5EA 4BBSB 1Q7YC 1G291 1NBWA 3JAML 2ZT9C 5KNCA 4LWCA 4L6TB 1HZBA 1J9OA 5C6AA 4B3TQ 1G91A 1VQFA 4PNYA 1WTWA 3I4NG 4XTCS 1Z9FA 4DKAC 1P8LA 3MXNB 1Y8NB 2SNMA 4GN5A 1N8RC 1NR4A 1XWEA 4QUFA 1SE2A 2PW7A 3K8AA 2RDHA 3TBIB 1EFWA 2CH4A 3OWEB 1MBYA 1YNJD 5EAYA 1VQOA 3DM1A 5COYA 2D0PA 4HIOA 1I94Q 2UXBQ 2WFWA 3S1QB 4GN3B 2AWNA 5T1IA 4IFDG 5K36G 1EQVA 4GLVB 2B39A 1P16A 2F0EA 3CKIB 4DV7L 2VQEQ 2CKZB 2E75C 1KABA 4JBJA 2EXZA 4LF8L 4KK7A 5J39A 1YHQA 1VQ6A 1F2MA 1X6OA 4A3EH 4PG3A 4C3JG 1G51A 1U4RA 1N9WA 5KYLA 2VB2X 4JC0A 3RNUA 3T1YL 3BU2A 1PFSA 5DNFA 2N3SA 2F3WA 1GHJA 1Z7TA 3NUCA 4IFDI 1NJIC 5CGKA 3BDOA 1QZHA 1FGBD 1IYJB 1S5ED 4DV6Q 4H44C 1HRJA 2R93B 1K0RA 2HDLA 2PW5A 4XT1B 5IWAL 4BY7G 2J7ZA 1HUMA 3FKIH 4QB4A 1CTMA 4OO1G 4UP8A 4QL5A 4A3FG 1TS5A 5JAVA 1E1TA 3UE1A 5FO9B 4DAVA 3CP0A 4POGA 2JA5B 1GUTA 4GOPC 2X69A 4N8FA 3K5OA 1J6QA 4P75A 4ZK9B 4O2DA 3HOVG 2KHIA 1EIHA 1ONLA 2JA5G 2CWAA 1PTOH 3BS1A 4RHRA 4RH6A 5IYDH 3UDXA 2NYZD 3HOZB 5CMDA 1IZ6A 3L7ZC 1JR0D 2O5IC 4KN4C 4KLKA 2OXPA 2EYJA 3CCVA 4DV5Q 2JE6I 5C4JH 3CCRA 1VQDA 1Q1EA 3GV6A 4CJ2C 1K3BC 2A6HD 4HJ5A 1N34Q 4RGTA 2E5LL 3HOUH 1O78A 3G6EA 2YYZA 1Y1WB 1IBMQ 3ERQA 5GQOA 2CVRA 2D2CC 3PO3H 2PO4A 4MTKA 1NE3A 4A3BG 2DGYA 4FF2A 2KCTA 4A3MG 2RQXA 3C2PA 1CHQD 4DAMA 1VQ7A 3RLFA 1I94L 2G9DA 1XNRQ 1AE3A 3CC2A 3RZDH 3ULPA 1MJCA 2A6EC 4K0KL 1H9SA 4X3UA 3X3MA 1C8CA 1X32A 5CR3A 4HN7A 2K01A 3CCSA 4B3RQ 1HQMC 1VQBA 4OGQC 1JOKA 1KDCA 3I91A 2F0PA 1AH9A 2MGSA 1A15A 3Q22A 1C4QA 2I0QA 2B63B 5IP7H 3EIVA 4UP7A 1M8AA 2HCCA 1WTXA 2EVBA 1I4XA 2E76C 4QY7A 3SK4A 4DV1L 1J5EL 2Q2UA 5IIFA 3J80c 4DV6L 4JBMA 2PI2A 2K50A 3RLOA 5I9PA 2K5NA 3J7YW 1D5XC 1X65A 2F0FA 1PTOC 4J15A 2UU9Q 5KIXA 5M3MH 1IBKQ 2LSSA 4JI2L 1FNVA 2AQ1B 1SYEA 1I4QA 1W3SA 5ELBA 5ELCA 5FK9C 5M5WB 2MNAA 2NVTH 3MXPA 2SEBD 3NP8A 3WOFA 1BKBA 3FPPA 1XNRL 3VYSA 3H94A 4IN3A 5C44H 2D0OA 1YJWA 4KTAA 3EFXD 3QG1A 1V1OA 2V4DA 2EYFA 2PQAB 3G4SA 1TQOA 1GVPA 1L0XB 1IKLA 2BH8A 3G71A 1WTRA 2XGTA 4GNXB 4DR3L 3LGJA 1SYGA 4OELB 5LMUQ 4CDCC 1EEID 2F0GA 1TWAB 2EYPA 4LFCL 3GTQH 1HNXQ 5J1ZA 1RHPA 2NN6H 2SDFA 1X55A 4JV5L 3A8KE 4DK6C 1X54A 5J3BA 5M5XH 1ENFA 1M90C 2K5WA 1SJHD 4XXEA 4IFDJ 4LF6L 1E3PA 3RN5A 3PO2H 1O7LA 4IPCA 3SK8A 4LF9Q 4WJ4A 1HHVA 2F0SA 1WTQA 4GOPA 2Z6KC 4JI8Q 2OWOA 2WAQE 3U9SA 3CMEA 4KJOA 2M9VA 1ZXTA 3KF8B 1WI5A 1IHZA 3X3NA 4KY5A 4JI7Q 3C1EA 3UDGA 3T1HL 2NVTB 3TRZA 2YTVA 1V43A 4R4CA 2I5LX 3R8BA 3E0JA 4CJ1B 5E4XA 4K5VA 2KCNA 3RR5A 3CC7A 4A3KH 1A63A 1AEXA 4QCLA 1QUQA 4BBRG 1EY4A 5BN3A 1K83B 4BA1I 2Q2TA 5A2QL 4F87A 2HHHL 3J81E 1QVFA 3S1MH 1XNQQ 1VS0A 3M4OB 1KDBA 2ZM6L 1EYAA 5C3EG 2UUCQ 2HCIA 5IP7G 3GTLH 2Y0SG 4RHSA 1LUZA 3BJUA 1MGSA 2LXKA 2UXCL 1PRTF 1ICWA 2Z4IA 1I3QB 1ET9A 3UDFA 1AFPA 1CUKA 2C5CA 2DUDA 3NQIA 3CCQA 1YI2A 2K1BA 2QEJC 2LS01 3K59A 1VQGA 1WYDA 3HOXH 3HKZE 2JA8G 1GJXA 1BOSA 4L5QA 1CHPD 4HMIA 1F77A 3M3YH 1W2BA 1VCIA 4YY3Q
chains in the Genus database with same CATH topology
5CV4A 2XVSA 4ILWA 2TSSA 5C4HA 1LTAD 3DUZA 3RZDB 2JA8B 3RD4A 5CYUA 2AQ3B 1KLUD 1PTOF 2XRSD 1STYA 4PV1C 3ND9A 3AU7A 3P20A 4IUPA 2O4XA 1LT3D 5EKKA 1OO9B 2HDMA 1DZ1A 1SNMA 2H4OA 1ESFA 2DY8A 4HCSA 5IGBA 5FKAC 4KMUC 3SHLA 2NVXB 1X3PA 1QNUA 1EY5A 1MSGA 4PQXA 2EY1A 4P2CB 1JCKB 3LWEA 2A6HC 5M5XB 3WOEA 4BA2I 5IGDA 5FO8B 4DAPA 1H9SB 5JEAJ 2NVYB 4ZUIA 2EJMA 1SYCA 3J7AF 1B9MA 2M2LA 5IGGA 4Q5VA 1SNPA 1SBBB 3URYA 4XQQA 1D1KA 4IUQA 3H0GB 3GV3A 1BCPD 5G3LD 1QCBD 4DAYA 2WP8J 1CQFA 2EZVA 5F2DA 3I72A 3I4NB 4Y7NB 2OF1A 4X3TA 3AMUA 1DM0B 1MD2D 1JE4A 3L3OC 4ID6A 4DK0A 3SR1A 4EQOA 4FXKC 4ZQ3A 2Q8TA 3S15B 1SMYC 3NTHA 3V05A 3BYYB 3I3CA 5M9OA 4TQUS 3FKIB 5EQ0A 1ILPA 5I2YA 4M8AA 1QJOA 4IUTA 2CW0C 4C3JB 2RSNA 4FF3A 2Y0SB 2HQEA 2JP1A 1TWGB 1Y69U 2F0QA 1WTVA 2BDOA 3M7GA 3MXUA 2MPMA 4BY7B 1EZ8A 3PUXA 5J22A 3VR2A 5E4WC 1DYQA 1Q1BA 5HURA 3PUYA 4KKUA 3NTKA 3I4MB 1I6HB 2Z4HA 3MC0B 5ELFA 3MZ5A 1F2LA 1F9QA 5CV8A 3A7LA 2F0DA 1BUVT 1DXMA 1A6XA 5CV6A 1STBA 1SE4A 2NTSA 3HEJA 3MWYW 4C56C 3W3AA 1SMYD 1JOOA 1NSNS 4DXGA 1JORA 2AWOA 2E2IB 4X3SA 2E2DC 2O5JC 2F0KA 1RODA 1BCPB 2XWJB 1XYIA 4QMGA 4ODGA 2QDBA 4A3MB 1VDZA 3S1NB 4L63B 2L0CA 1STAA 3J7AV 1UUPA 5EBDA 1STHA 1FNUA 4XT3B 1D6EC 1ZYRD 5I6WA 4FF4A 3EROA 4N9PA 1Q12A 3D8GA 1Z47A 4YIJA 2NN6G 1XTCD 4ZYSA 3IFTA 4B9WA 2L11A 1EY0A 1A2TA 1PXUA 2R7ZB 1PFBA 1BF4A 2JYOA 4CJ0B 3D6CA 1O80A 1D1IA 4EVOA 4IFDH 1KTKA 1AW7A 3MXGA 2WV6D 3KF8A 2WINB 2XWBB 1STNA 2A68D 1TWCB 3QOLA 1EQTA 3NXWA 4HSVA 1JC7A 4LMQD 2L9HA 2FHTA 2X6GA 1HUNA 3MFGA 3NPPA 3K58A 1TY0A 4ZUJA 3MTSA 4RKBA 1EYDA 2IX3A 1JWUD 3H09A 5D65A 4K8JA 2I46A 2PQEA 4G7HC 5IGEA 1HFNA 1SYBA 3HOXB 5EPLA 5T1GA 4DNTB 4EGVA 4A3KB 3TN2A 1EWCA 1OXXK 2BDNA 4OL7A 1EOTA 1DJRD 3NQTA 1Q8IA 1TU2B 1JWSD 4NP5A 1SSOA 1TT2A 2K03A 1B53A 3VYTA 3HOVB 2EY5A 1E2VA 2H1EA 3CRKC 1TWFB 2NBFA 1B50A 2ZXPA 1PDQA 3HS0C 1WD1A 2RBMA 5C4XB 3PO2B 4BBRB 2K33A 1QNKA 1UAPA 1IYVA 1YNNC 5NUCA 3LNNA 2D5DA 2KEDA 4G4KA 5C0XI 4OO1I 2XSCA 1U9RA 1LV9A 4QF4A 1H9RA 1E2WA 2F0MA 1JOQA 1GHKA 1ESRA 2QKIC 2F1MA 3HKZB 1K8OA 1VMCA 3KK7A 3PUVA 1X3QA 5C44B 1Y1VB 5BN4A 2D9UA 3GTQB 2BA1A 1A3UA 2L55A 1J8IA 1XXGA 4UDUC 3N6RA 1R4PB 4WORA 3HOUB 1EY8A 1STEA 3DMUA 3KLSX 1LT6D 4G57A 5JEAH 3IAYA 4QUCA 4RCNA 1C48A 5JOBA 3VR5A 3ITPA 5KNBA 3GD7A 2E2JB 3S1MB 5M3MB 1JQYD 1SJED 1BXTA 1E2ZA 4KHZA 1BDOA 3VR3A 1QB5D 3K0YA 1ENAA 1PTOD 1LO5D 1KLGD 4K5WA 4HR7B 2X6LA 1D5MC 4EQPA 1IW7D 1OXSC 1GOZA 1ET6A 2Q8RE 2NN6I 2F0OA 4KY6A 2B2TA 5IT9L 1S4ZA 1QILA 2Z8LA 2TMPA 4BWGB 1LTSD 1PRTD 2LMCB 3V2TA 2IWHA 1I50B 1IYUA 1V1PB 1GUWA 1KAAA 1STGA 3R93A 1D5ZC 2DN8A 1ENCA 2B2UA 1LTGD 2R61A 4R8IA 1WCMB 3TP8A 1I4RA 3LX0A 1SEBD 5IT9E 2CW0D 5A35A 4FXDA 2K28A 1ZYRC 3TP5A 3A8JE 2B2VA 2PCFB 3A7AB 2EY2A 4KD4A 4UAIA 1IW7C 2F0WA 1V8QA 2F0VA 4OHJA 4KKTA 5C4ZA 3DEOA 1G8ZD 2E74C 4GZYC 2AUKA 5IOCA 5C3EB 2FFKB 3OMCA 4DGZA 2K6AA 3Q24A 2OEOA 3HG9A 4CKBA 5D3DA 1CQVA 3OHXC 5HGTA 5M5YB 4LAAA 3A56A 3VYUA 5KGUA 3TP6A 1B9NA 2L5TA 3WDNA 4G7OC 1FR3A 1ZEQX 2KUMA 2L12A 3M7NA 5I9OA 1JB3A 3GQBA 2B2VC 2NUCA 3D6WA 3Q23A 1WTPA 1PFNA 2AQ2B 3TP7A 3EQLC 1S5DD 2NVQB 1TS3A 4RCOA 4DN4M 3BDLA 4NMZA 4R9WA 2JXMB 1EL0A 3PO3B 5JVH3 5DEHA 4BY1B 3D4RA 3C1FA 3M3YB 2ICEC 3S14B 3BVGA 2BA0A 2A69C 2EJFC 3C46A 2XIWA 1JWMD 1HTPA 4U673 3S16B 1TR5A 2WIIB 3V96A 5C3WA 1CK1A 3LWUA 3HP3A 4DK1A 3TMEA 3OWFA 2Z1CA 4RGNA 1RTNA 1F2ZA 1QOHA 2KVMA 3QB3A 4FXGC 3BZDB 2KJXA 2QILA 3P7JA 1LTID 5FLXE 1U4MA 2RKSA 4CGYB 2PZTA 3I70A 2L4NA 5EJWA 1SAPA 2BE5C 4K14A 4V190 1RDPD 3G6JB 2R92B 4MIUA 4OO1H 3L9AX 1WD0A 3DWAA 3GP7A 1BR9A 2MHVA 5C5LA 1HFGA 4FYDA 1EIGA 4CKEA 3OSOA 1B4OA 1MSHA 1W6KA 3EJIA 3NWTA 1SXTA 5KEEA 3NWSA 5K5PA 1OXUA 1LACA 4J8QA 3OMGA 4A93B 3S2HB 2WB1B 1FD7D 3G7LA 4O42A 4XDXA 5IODA 5FLXL 4PMCA 2N88A 2EE1A 3S9WA 2F0JA 2BOSA 2MP1A 1HXYD 4O1NA 2K05A 3I4LA 3BG3A 5KYIA 3SEBA 2SNSA 1HCZA 1LTRD 3J81L 2WAQB 1AZPA 4U68A 1RD9D 4PMWA 3CRLC 2VNUD 4CHTB 1WTOA 1K8MA 2F0HA 2WACA 5BN5A 3T56B 5AFWA 3R3OA 3I73A 5C0XH 3QJYA 3KBGA 2KQ3A 5EBCA 2QF7A 2EJGC 3A54A 4E6IA 4J1MA 5CV9A 5DM73 1DD2A 3UI2A 1F9RA 2XN9C 1PRTC 5I2XA 3FVQA 1SFOB 4IUVA 2R6GA 3K57A 1PMRA 1EU3A 4L8JA 1II3A 3RMHA 1TKWB 5M3FB 1G2TA 1EY7A 2B2WC 3CQZB 1E0BA 3RUZA 4C1NK 2NZ1D 2IJ0A 4WJWA 3A55A 5C5MA 5ELDA 2A68C 2FMMA 1HTLD 1IKMA 2B8GA 3Q6SA 5FOBB 3PIP3 5CV5A 2VUMB 1O7ZA 1PTOB 1KNAA 4IZ8A 2IPKD 3D3RA 3U9OA 5DAUA 2OT2A 3H3VC 1L0YB 4HEDA 1KDAA 1BQQT 3J80L 1QE6A 3M4YA 3MXNA 3QO2A 3BVMA 5E1FA 2HUGA 3P75A 1F9PA 1LABA 3MHBA 5EPKA 2EYOA 3TDQA 1EYCA 1I6VC 1NUCA 3Q0AA 3NE5B 2K5QA 2JEBI 5K36H 3A8IE 3K5LA 2EY6A 1A3TA 4XYQA 4MHEA 2GA4B 4HAEA 4XYOA 1DONA 4RA8A 5TSSA 4DF7A 4KV6A 3T51B 3ZYYX 1H9MA 3GTMB 4DFAA 4H7BA 2K5DA 2NTTA 2XRQD 1FYCA 3IKJA 3SDZA 2F03A 1PLFA 2MJ8A 1LLRD 3CHBD 2F0UA 3E5SA 3EVQA 1WVLA 1CZWA 2G9HD 3MFYA 3ND8A 3W2DA 4K5XA 3T13A 3IFDA 1OXVA 2A5HA 4ULLA 1B2TA 4KN7C 4ZKCB 1SNDA 3MAQA 2EOTA 4IALA 3S1RB 1PRTB 1D2BA 4FF1A 2KHSA 1LTTD 3JAME 2JA6B 3H91A 1B44D 3DWQA 5CC4A 3IL8A 1DOKA 3J80E 2EDGA 3DXJC 4IUUA 3VA5A 1YNJC 2K04A 2FINB 3PMFA 1G2SA 4K6LA 3FEWX 4A3EB 4K2LA 4C3IG 2NWGA 1GUNA 2KECA 2A69D 1AP0A 1TVXA 4ZRZA 4A3DB 3QIAA 1SE3A 5ELEA 4FVMA 3D4DA 3TZDA 3NBIA 5CBAE 5C0XG 1RTOA 3T53B 1B1ZA 4KI0A 2WKDA 2J4XA 2CHBD 2MUYA 4M1UB 5KNDA 1VMPA 4FP5D 2RVLA 3SXHA 3FMCA 4H13C 4WRDA 4RGOS 1Q90A 3N52A 5ISRA 2LY7A 1BCPC 4N9TA 1A3VA 1HA5A 2JSOA 1OXTA 3FDTA 4F8MA 2IW3A 3QOJA 2WKCA 2PNRC 3OIQA 1SDFA 1I4GA 4Q0FA 4DXFA 5LHY1 3PIO3 1PYWD 5D14A 4XQJA 1GUSA 3GTKB 5EKLA 5C0XJ 3QWNA 2IX1A 4G7ZC 1Z6HA 1HPCA 1R9TB 3NHHA 1PZKD 4BS9A 1EZ6A 2A74C 5JJZA 2PZWA 1ILQA 2QCPX 3DWPA 1DOMA 1SNQA 1EY9A 4LK1C 3KUPA 5LL6S 2L1BA 2B2YA 2DNCA 1B3AA 5D3IB 1S5CD 4CKCA 3GTPB 4FO2A 3PV0A 3T16A 1DCZA 2PZUA 1R4QB 1T5XD 1F9SA 1RJTA 4K2KA 3R2IA 5DM63 4C3IB 2B2WA 3S2DB 4HSPA 4ME5A 3R2TA 3TZUA 2KOLA 1LT5D 1SNCA 1CM9A 1TS4A 1SNOA 5EKIA 4K8IA 4C1NI 2E2HB 2RDFA 1GUGA 2EYLA 1G6ZA 2EYHA 4H0LC 1AZQA 3SE0A 2F0TA 3DHQA 3MEHA 3NBHA 3KBXA 1GUOA 1YNND 1HA6A 3O13A 2KEEA 4V0BA 2PPBC 1VF5C 1Q3LA 1NAPA 2SOBA 2EPBA 2NB0A 3PUZA 3VA7A 5C3XA 2B2TC 5FO7B 4RKLA 3KLSA 5JEAG 2AUJD 2YU9B 1V1PA 1IL8A 1O7YA 4DNRB 2CQAA 1F2YA 1LTBD 1RF2D 4A3JB 4KD3A 5I6YA 4R8NA 3CU7A 5CBEE 4A3IB 5E3FA 4NDXA 2F0IA 4XQNA 1EU4A 3NTIA 4C2MB 1GXDC 4X3KA 5EGTA 4F7XA 1KNEA 3BDCA 3NSWA 1TY2A 1DOLA 1S5BD 3GO5A 2A73B 3GTLB 2DNEA 4JK1C 4S3SA 4DA2A 2KA7A 1CT1D 1U4PA 3BVZA 1W6JA 3SVMA 2Q8IB 1FNWA 5JPNC 2BCOA 3D4WA 1MI2A 4J6HA 1LT4D 2JA7B 3OW7A 4NW2A 4C3HG 2F0LA 1CZGA 2IX0A 1NR2A 3GTJB 4KY7A 2RDGA 1CI3M 2A6ED 4NKLA 2ICIA 4I7ZC 2O2LD 1M4VA 4RWSC 5LL6X 1AN8A 2RSOA 2B2YC 2ENBA 3K5NA 1ML0D 4MN3A 3HRZC 3SK5A 4HMJA 4OIKA 4ZAIA 2F4IA 1PFMA 2D62A 2N55A 3VR4A 5JVG3 1Y8OB 2M00A 4A3GB 2ZXRA 5CV7A 4HCEA 1HQRD 1ZKOA 2B2UC 3EA6A 1H9JA 3HZXA 3NK9A 4IURA 5CORA 4TKOB 1UNSA 5I4DA 2BE5D 3I90A 1Y8PB 2IT1A 3E6ZX 4IUNA 4WFN3 2ID0A 2I07B 4OIJA 3T4AC 4RGMA 2FJ2A 3AB9A 3MVVA 4ABNA 1SYFA 1TIID 4ZLTF 3I8ZA 3P1HA 3C3LA 3KLRA 4JBWA 1S5FD 4XIGS 5IGCA 1SYDA 2PMZB 4KKSA 4F88A 3VR6A 1NCVA 1EEFD 4EQNA 4FNFA 3OPOA 4PMBA 1CA6A 4Z9CB 3DEPA 3ONAB 4TRDA 3FRPB 3D31A 3SK6A 5A2QE 3K7AB 2RA4A 4HTHA 4IQZA 3MA2B 2PYKA 4QIWB 3H6MA 5KRUA 2K32A 1EY6A 2LFNA 2J0TD 3PUWA 2VB3X 4RFBA 4ZKBB 4DU9A 1CA5A 3S17B 2K7VA 2B8FA 3K6OA 4I65A 1UEAB 5IGFA 4A3FB 4B9XA 1BBXC 1I4HA 4RAUC 2KCCA 4AYBB 1BO0A 3GTOB 1EFID 3VYRA 4LJZC 4C3HB 1PZID 1QWYA 3F2UA 5C4JB 1QG7A 2XNAC 2IL8A 1I4PA 3HOWB 4KHVA 2C9OA 1RKNA 3OIPA 4KJNA 4CBVA 1VF7A 2DY7A 2VXWA 1BNZA 1U4LA 1TWHB 2LKVA 3GTGB 1EWHA 3TSSA 2ZXOA 5EPJA 1BCPF 5G3LF 3HOYB 1VCIA 4K6DA 3K5MA 3BYTB 4A3BB 2FMCA 1TS2A 1XX8A 2F3VA 2F0NA 2JEAI 3OOCA 1H9KA 2R3ZA 3HGBA 1A2UA 3M85A 3RZOB 4TSSA 1JICA 1CFMA 1RCVD 5JPMC 3FPUB 4B08A 1PZJD 1T5EA 4BBSB 1G291 3JAML 2ZT9C 5KNCA 4L6TB 5C6AA 1J9OA 1G91A 4PNYA 1WTWA 4XTCS 1Y8NB 2SNMA 1NR4A 1XWEA 4QUFA 1SE2A 2PW7A 2RDHA 3TBIB 3OWEB 1MBYA 1YNJD 3DM1A 5COYA 3S1QB 5T1IA 2AWNA 4IFDG 5K36G 1EQVA 2B39A 2F0EA 3CKIB 2E75C 1KABA 2EXZA 4KK7A 5J39A 1F2MA 4C3JG 1U4RA 5KYLA 2VB2X 5DNFA 2F3WA 1GHJA 1Z7TA 3NUCA 4IFDI 5CGKA 3BDOA 1FGBD 1S5ED 4H44C 1HRJA 2R93B 2HDLA 2PW5A 4XT1B 2J7ZA 1HUMA 4QB4A 1CTMA 4OO1G 1TS5A 5JAVA 5FO9B 4DAVA 2JA5B 1GUTA 2X69A 3K5OA 4ZK9B 1EIHA 1ONLA 1PTOH 3BS1A 4RHRA 4RH6A 2NYZD 3HOZB 5CMDA 3L7ZC 1JR0D 2O5IC 4KN4C 2OXPA 2EYJA 2JE6I 1Q1EA 3GV6A 4CJ2C 2A6HD 4RGTA 1O78A 1Y1WB 2YYZA 3ERQA 2CVRA 2D2CC 2PO4A 4FF2A 3C2PA 2RQXA 1CHQD 3RLFA 2G9DA 2A6EC 1H9SA 4X3UA 3X3MA 1C8CA 1X32A 5CR3A 4HN7A 2K01A 1HQMC 4OGQC 1JOKA 1KDCA 3I91A 2F0PA 2MGSA 1A15A 3Q22A 1C4QA 2B63B 1M8AA 2HCCA 1WTXA 2EVBA 1I4XA 2E76C 3SK4A 5IIFA 5I9PA 3J7YW 1D5XC 2F0FA 1PTOC 5KIXA 1FNVA 2AQ1B 1SYEA 1I4QA 5ELBA 5ELCA 5FK9C 5M5WB 3MXPA 2SEBD 3NP8A 3WOFA 3FPPA 3VYSA 3H94A 4IN3A 4KTAA 3EFXD 3QG1A 1V1OA 2V4DA 2EYFA 1TQOA 1L0XB 1IKLA 1WTRA 1SYGA 1EEID 2F0GA 1TWAB 2EYPA 5J1ZA 1RHPA 2NN6H 2SDFA 3A8KE 1ENFA 2K5WA 4XXEA 1SJHD 4IFDJ 1O7LA 3SK8A 1HHVA 2F0SA 1WTQA 3U9SA 4KJOA 2M9VA 1ZXTA 1IHZA 3X3NA 4KY5A 3C1EA 2NVTB 1V43A 3R8BA 4CJ1B 3E0JA 5E4XA 4K5VA 2KCNA 1AEXA 4QCLA 5BN3A 1EY4A 1K83B 4BA1I 5A2QL 4F87A 3J81E 3M4OB 1KDBA 1EYAA 2HCIA 4RHSA 1MGSA 1PRTF 1ICWA 2Z4IA 1I3QB 1ET9A 1AFPA 2C5CA 3NQIA 2K1BA 2QEJC 2LS01 3K59A 1GJXA 1BOSA 1CHPD 4HMIA 1F77A 2EYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK9 B;  1B3A A;  4XT3 B;  3UI2 A;  4X3K A;  4HAE A;  1SSO A;  1F9R A;  2K03 A;  1B53 A;  1XX8 A;  4RA8 A;  1DON A;  3TZD A;  1KNE A;  5CBA E;  1WD0 A;  3I3C A;  1EIH A;  4IUV A;  1DOL A;  1HFG A;  2R3Z A;  1RTO A;  1EIG A;  1NCV A;  5EQ0 A;  2H1E A;  1ILP A;  1B4O A;  1MSH A;  2NYZ D;  1IKL A;  4IUT A;  1B50 A;  1PDQ A;  1WD1 A;  5CMD A;  1WTR A;  2KUM A;  2L12 A;  1CA6 A;  1JIC A;  2RSN A;  1U4P A;  1GUW A;  3DEP A;  2B2V C;  1F9S A;  3ONA B;  3D6W A;  3SVM A;  1RJT A;  2JP1 A;  1G2T A;  2L11 A;  1QNK A;  3FPU B;  2B2W C;  1PLF A;  2B2W A;  1WTP A;  3R93 A;  1E0B A;  1PFN A;  2MJ8 A;  1MI2 A;  2RA4 A;  3GV6 A;  4CJ2 C;  1RHP A;  2SDF A;  4IUP A;  2KOL A;  2NZ1 D;  2B2U A;  4NW2 A;  1WTV A;  1CM9 A;  1J9O A;  2KED A;  1WVL A;  1PFB A;  1G91 A;  2MPM A;  2HDM A;  1NR2 A;  1VMP A;  3G7L A;  4O42 A;  5EKI A;  1WTW A;  1LV9 A;  2FMM A;  1BF4 A;  2CVR A;  1DZ1 A;  4XDX A;  4R8I A;  3IFD A;  1IKM A;  2RVL A;  4DN4 M;  5E4W C;  2JYO A;  3Q6S A;  4CJ0 B;  2DY8 A;  1B2T A;  4ZKB B;  1ESR A;  1G6Z A;  4RWS C;  1NR4 A;  4R9W A;  1O80 A;  2N88 A;  2EE1 A;  4HCS A;  4ZKC B;  1HHV A;  4QUF A;  1CA5 A;  1EL0 A;  1X3P A;  1O7Z A;  2B2Y C;  2EOT A;  2RSO A;  1WTQ A;  1VMC A;  1AZQ A;  3N52 A;  1MSG A;  1KNA A;  2MP1 A;  3DM1 A;  5COY A;  1ML0 D;  4MN3 A;  3LWE A;  1ZXT A;  1X3Q A;  5T1I A;  4OIK A;  4ZAI A;  2K05 A;  1F2L A;  2K28 A;  1F9Q A;  1BBX C;  1PFM A;  3KBX A;  3FDT A;  4X3U A;  1C8C A;  1EQT A;  1X32 A;  2N55 A;  2D9U A;  2B2V A;  2K01 A;  4HED A;  4HSV A;  3I91 A;  1HA6 A;  4RAU C;  1J8I A;  4LMQ D;  2KEE A;  3H91 A;  1QE6 A;  2MGS A;  4UAI A;  1A15 A;  4CJ1 B;  1SDF A;  5E4X A;  2L9H A;  1BO0 A;  2FHT A;  1Q3L A;  2M2L A;  2XIW A;  3QO2 A;  2X6G A;  1U4R A;  1AZP A;  1HUN A;  1NAP A;  4U68 A;  3MWY W;  2B2U C;  2EPB A;  4QUC A;  5D14 A;  1M8A A;  2HCC A;  2HUG A;  3F2U A;  5DNF A;  3DEO A;  1WTX A;  1QG7 A;  4IUQ A;  3MTS A;  1WTO A;  1F9P A;  2B2T C;  3IL8 A;  4IUR A;  1DOK A;  5COR A;  3HP3 A;  3GV3 A;  2IL8 A;  4IUU A;  5EPK A;  2K04 A;  2FIN B;  3I90 A;  2HCI A;  1G2S A;  1HRJ A;  2FFK B;  5D65 A;  2HDL A;  4XT1 B;  1IL8 A;  1MGS A;  1O7Y A;  2DY7 A;  1HUM A;  2J7Z A;  2NWG A;  1RTN A;  2KVM A;  2VXW A;  4OIJ A;  4X3S A;  5AFW A;  1BNZ A;  2X6L A;  1HFN A;  4X3T A;  1ICW A;  2KEC A;  2FJ2 A;  1ROD A;  1U4L A;  5EPL A;  3P7J A;  5T1G A;  1TVX A;  4ZLT F;  1AP0 A;  1JE4 A;  5JJZ A;  1XYI A;  2K1B A;  1U4M A;  3TN2 A;  1ILQ A;  5EPJ A;  1DOM A;  2Q8R E;  3I8Z A;  2B2T A;  3KUP A;  2BDN A;  2L1B A;  1EOT A;  5CBE E;  2B2Y A;  4MHE A;  1S4Z A;  2X69 A;  2L4N A;  2Q8T A;  5EJW A;  1SAP A; 
#chains in the Genus database with same CATH topology
 3CXC A;  5CV4 A;  2XVS A;  4ILW A;  3F2C A;  2TSS A;  5C4H A;  1LTA D;  3DUZ A;  3RZD B;  2JA8 B;  3F1Z A;  3M4O H;  3RD4 A;  5CYU A;  4AYB E;  2AQ3 B;  1KLU D;  1PTO F;  5ELN A;  2XRS D;  4DR6 L;  2VL6 A;  2UUA Q;  3GDE A;  1STY A;  4PV1 C;  4JI6 Q;  4OEM B;  3ND9 A;  3AU7 A;  3P20 A;  1BBU A;  4IUP A;  2O4X A;  1LT3 D;  5EKK A;  3OTO L;  3CCM A;  1OO9 B;  2HDM A;  1TWG H;  4P73 A;  3I56 A;  4NXN L;  1DZ1 A;  1SNM A;  2H4O A;  1ESF A;  1GKH A;  1HR0 Q;  2DY8 A;  4HCS A;  5IGB A;  5FKA C;  4KMU C;  3SHL A;  2NVX B;  1X3P A;  1QNU A;  1EY5 A;  4KHP Q;  1XJV A;  2HD3 A;  3G48 A;  1MSG A;  1YHB A;  4PQX A;  3PF5 A;  2EY1 A;  4P2C B;  4DV3 Q;  3HOY G;  1JCK B;  3LWE A;  3I4M H;  2A6H C;  5M5X B;  3WOE A;  4BA2 I;  3RN2 A;  5IGD A;  5FO8 B;  4DAP A;  4LFA Q;  1CSQ A;  1H9S B;  5JEA J;  2NVY B;  1L1O B;  4ZUI A;  2CWP A;  3I7F A;  3U4V A;  3S1N H;  1PH7 A;  1CKN A;  2EJM A;  1SYC A;  3J7A F;  1B9M A;  2M2L A;  5IGG A;  4Q5V A;  4UP9 A;  1SNP A;  1SBB B;  3URY A;  1KD1 C;  4XQQ A;  1D1K A;  1TWF H;  4IUQ A;  3K7U C;  3H0G B;  3CD6 A;  3GV3 A;  1BCP D;  1V9P A;  1QCB D;  5G3L D;  4DAY A;  2WP8 J;  3AYH B;  4OX9 Q;  1CQF A;  3CC4 A;  2EZV A;  4R4O A;  5F2D A;  3I72 A;  3I4N B;  4PZ6 A;  4Y7N B;  2OF1 A;  4IPH A;  4X3T A;  4AQY L;  3AMU A;  4YWM A;  1CSP A;  1DM0 B;  1MD2 D;  1JE4 A;  3L3O C;  4ID6 A;  1E7Z A;  4DK0 A;  1Q81 C;  3SR1 A;  3HOY H;  4EQO A;  4FXK C;  4ZQ3 A;  2NVY H;  2Q8T A;  4DR4 Q;  2R7F A;  3S15 B;  2E2I H;  2RHQ B;  1SMY C;  1EIY B;  3NTH A;  3V05 A;  5JJL A;  3BYY B;  3I3C A;  5M9O A;  4TQU S;  3FKI B;  1K73 C;  5EQ0 A;  1ILP A;  5I2Y A;  4M8A A;  1QJO A;  4IUT A;  1L1O C;  2CW0 C;  4C3J B;  2RSN A;  4FF3 A;  2Y0S B;  2HQE A;  4A93 H;  1B7Y B;  2JP1 A;  4JI6 L;  1TWG B;  1IL2 A;  4JI3 Q;  1Y69 U;  2F0Q A;  2V1C C;  3NBH B;  3S14 H;  1WTV A;  4DR2 Q;  2BDO A;  3M7G A;  5FJ8 G;  3MXU A;  2MPM A;  4BY7 B;  5IE8 A;  1EZ8 A;  3PUX A;  5J22 A;  3VR2 A;  5E4W C;  1DYQ A;  1Q1B A;  2MFI A;  5HUR A;  3PUY A;  4KKU A;  3NTK A;  3I4M B;  1I6H B;  4DV0 Q;  2A1A A;  2Z4H A;  3MC0 B;  5ELO A;  5ELF A;  1K3R A;  4DR1 Q;  3HOX G;  2JA8 H;  3MZ5 A;  3KFU A;  2R7Z H;  1F2L A;  4LFA L;  1F9Q A;  4NXM L;  5CV8 A;  3A7L A;  2F0D A;  4GOP B;  1BUV T;  1DXM A;  1A6X A;  5IP9 G;  5CV6 A;  1STB A;  5FJ8 H;  4JI5 L;  1SE4 A;  2OQ0 A;  5LMN L;  2NTS A;  3HEJ A;  3MWY W;  4DR3 Q;  1PH5 A;  4C56 C;  3W3A A;  1SMY D;  2JK8 A;  2K4K A;  1JOO A;  1NSN S;  4DXG A;  4OX9 L;  1X3F A;  2C35 B;  1KL9 A;  3S16 H;  1SR3 A;  2AWO A;  1JOR A;  3KDF B;  2LXJ A;  2E2I B;  4X3S A;  2E2D C;  2O5J C;  2F0K A;  1ROD A;  5FLM G;  2JJQ A;  4LF9 L;  1BCP B;  2XWJ B;  1XYI A;  4QMG A;  4MNO A;  4ODG A;  1N36 L;  2QDB A;  4A3M B;  3KJP A;  1VDZ A;  1VQL A;  4X66 L;  3S1N B;  4L63 B;  4HJ9 A;  2L0C A;  2DJF C;  3W1B A;  1STA A;  3J7A V;  1UUP A;  5EBD A;  1STH A;  1FNU A;  4XT3 B;  1D6E C;  3OYY A;  4JI1 Q;  2F4V L;  1ZYR D;  5I6W A;  4FF4 A;  3ERO A;  4N9P A;  1Q12 A;  1N32 Q;  3D8G A;  1HZA A;  3EN2 A;  3F8T A;  1Z47 A;  2NVX H;  4BY7 H;  2IHF A;  4YIJ A;  2B63 G;  2OTJ A;  2NN6 G;  1XTC D;  4ZYS A;  2QW7 A;  3IFT A;  4B9W A;  3H3V H;  2L11 A;  1UE1 A;  1BBW A;  2CFM A;  4LF4 Q;  2E5L Q;  1EY0 A;  1A2T A;  4B3T L;  1PXU A;  1A8V A;  2R7Z B;  1PFB A;  3DM3 A;  1BF4 A;  2P5Z X;  4APV A;  1UE5 A;  2DJG C;  2JYO A;  4CJ0 B;  3D6C A;  1O80 A;  2NZH A;  4IOA A;  1D1I A;  2R7Z G;  4EVO A;  4IFD H;  1KTK A;  1AW7 A;  1PH4 A;  3MXG A;  2WV6 D;  3KF8 A;  2WIN B;  2XWB B;  1STN A;  2A68 D;  1TWC B;  1ASZ A;  3QOL A;  2UXD Q;  5AJ3 Q;  1EQT A;  3NXW A;  4HSV A;  1JC7 A;  4LMQ D;  2L9H A;  1O7I A;  2FHT A;  1VQ4 A;  2X6G A;  1KIX A;  4DR6 Q;  1HUN A;  3MFG A;  5C3E H;  3NPP A;  3K58 A;  1TWA H;  1TY0 A;  4ZUJ A;  3T1H Q;  3ERS X;  1IBM L;  3MTS A;  5E7N A;  4RKB A;  3H0G H;  1IXR A;  4A93 G;  1EYD A;  2IX3 A;  1JWU D;  4LF5 Q;  3H09 A;  1VQM A;  5D65 A;  2ZTD A;  4K8J A;  2R93 G;  1G6P A;  4DV2 Q;  2I46 A;  2PQE A;  4G7H C;  5IGE A;  1HFN A;  1SYB A;  3UDI A;  3HOX B;  2KEN A;  5EPL A;  5T1G A;  4DNT B;  4EGV A;  4A3K B;  1D7Q A;  3TN2 A;  1EWC A;  1OXX K;  1TWH H;  3STB D;  2BDN A;  4OL7 A;  1EOT A;  1DJR D;  3NQT A;  3RLN A;  1TXY A;  1Q8I A;  1TU2 B;  1JWS D;  4NP5 A;  1SSO A;  1TT2 A;  4LW1 A;  2HQL A;  2K03 A;  1B53 A;  1X56 A;  3VYT A;  2K5V A;  3PO2 G;  3HOV B;  2EY5 A;  1VQC A;  1E2V A;  2VW9 A;  2E2J H;  2H1E A;  3CRK C;  1TWF B;  4UY8 C;  2NBF A;  1VQJ A;  1B50 A;  2ZXP A;  1PDQ A;  3HS0 C;  1WD1 A;  4C3H H;  2RBM A;  3CCJ A;  5C4X B;  3PO2 B;  4BBR B;  3L2P A;  2K33 A;  2YTX A;  1QNK A;  1UAP A;  3CQZ H;  1IYV A;  4X6A H;  1YNN C;  2B29 A;  5NUC A;  1AE2 A;  2B63 H;  3LNN A;  5LMN W;  2D5D A;  2KED A;  4G4K A;  5C0X I;  1XPU A;  3AQQ A;  4OO1 I;  2XSC A;  1VQK A;  1U9R A;  1LV9 A;  4GKK Q;  4QF4 A;  4LFB L;  1H9R A;  1E2W A;  2F0M A;  2RF4 A;  1JOQ A;  1GHK A;  1ESR A;  2QKI C;  2F1M A;  3HKZ B;  2UU9 L;  4MZ9 A;  1K8O A;  5IT9 c;  1VMC A;  3KK7 A;  3NEM A;  3PUV A;  3CF5 A;  1X3Q A;  5C44 B;  1Y1V B;  5BN4 A;  3JAM i;  2QEX A;  2D9U A;  3GTQ B;  2BA1 A;  3EBE A;  1A3U A;  2L55 A;  1J8I A;  1XXG A;  4UDU C;  3N6R A;  1R4P B;  4WOR A;  5M3M G;  3HOU B;  1Y1V G;  1LYL A;  1EY8 A;  1STE A;  3DMU A;  3KLS X;  1LT6 D;  4G57 A;  5JEA H;  4QUC A;  3IAY A;  4RCN A;  1C48 A;  5JOB A;  3VR5 A;  3ITP A;  5KNB A;  3GD7 A;  4ZCK A;  2E2J B;  3AFP A;  4YHH L;  3S1M B;  5M3M B;  1JQY D;  1SJE D;  1BXT A;  1E2Z A;  4KHZ A;  1BDO A;  3VR3 A;  4LUZ A;  1QB5 D;  1VQ9 A;  3ZJY C;  3K0Y A;  1ENA A;  4A3E G;  1PTO D;  3SGI A;  4DV4 L;  1LO5 D;  1KLG D;  4K5W A;  4HR7 B;  4JI8 L;  2X6L A;  1D5M C;  3A5U A;  4EQP A;  4POF A;  5M5W H;  4X64 Q;  1IW7 D;  1OXS C;  1GOZ A;  4L5R C;  1ET6 A;  2Q8R E;  2NN6 I;  2ZTE A;  1YJN A;  2F0O A;  3STB C;  4KY6 A;  2B2T A;  4JI7 L;  1GD7 A;  5IT9 L;  1S4Z A;  1QIL A;  1HZC A;  2Z8L A;  2OQK A;  3PF4 A;  1FJG L;  2TMP A;  4BWG B;  1LTS D;  3PO3 G;  1PRT D;  2LMC B;  3V2T A;  3F2D A;  2IWH A;  2R93 H;  4FDB A;  4P72 A;  2ASB A;  1I50 B;  1IYU A;  1V1P B;  1GUW A;  5GAD C;  4A3G H;  1KAA A;  1STG A;  2RCF A;  2UXC Q;  3R93 A;  4CDE C;  1D5Z C;  4BBR H;  2AKW B;  2DN8 A;  1ENC A;  4B3M L;  2B2U A;  2F3I A;  1LTG D;  4A3K G;  1XPR A;  2R61 A;  3WWV A;  3PSI A;  4RMF A;  2N78 A;  4R8I A;  1WCM B;  3TP8 A;  1I4R A;  5GRO A;  3LX0 A;  1SEB D;  5IT9 E;  2CW0 D;  5A35 A;  4FXD A;  4A3M H;  2K28 A;  1K8G A;  3S15 H;  4A3B H;  1B8A A;  1ZYR C;  2K52 A;  1Q82 C;  3TP5 A;  3BZC A;  1N33 Q;  3A8J E;  2B2V A;  2PCF B;  3A7A B;  2EY2 A;  1SMX A;  4UPA A;  4KD4 A;  4UAI A;  3J7Z C;  1IW7 C;  2F0W A;  1HNW L;  4LF7 L;  2ZJP A;  1HR0 W;  2A8V A;  4IOC A;  1V8Q A;  2F0V A;  4OHJ A;  4KKT A;  5C4Z A;  3DEO A;  1UWV A;  3Q8D A;  1XPO A;  1R9T H;  1G8Z D;  2E74 C;  4GZY C;  3J81 i;  1CKN B;  2UUB L;  2AUK A;  5IOC A;  5C3E B;  2FFK B;  3OMC A;  4DGZ A;  1DGS A;  4GNX C;  1YBY A;  4DAY B;  1UE7 A;  4KHP L;  2QDL A;  2QA4 A;  1KRS A;  2K6A A;  3Q24 A;  2UXB L;  2EQS A;  5C44 G;  2OEO A;  2Z6K A;  1PH3 A;  3HG9 A;  4CKB A;  1IBL Q;  3H15 A;  5D3D A;  4HJA A;  1CQV A;  3W1G A;  1HNZ Q;  3OHX C;  4AIM A;  5HGT A;  1U5K A;  2JN4 A;  5M5Y B;  1NMG A;  4LAA A;  3GTG H;  1Q86 C;  3A56 A;  3VYU A;  4L5T A;  4WJ3 M;  5KGU A;  5FLM H;  3TP6 A;  1B9N A;  3IRB A;  2L5T A;  3WDN A;  4G7O C;  1FR3 A;  3A74 A;  1ZEQ X;  1X3G A;  3NEN A;  1YHA A;  4DV7 Q;  2KUM A;  1XMQ L;  2L12 A;  3M7N A;  2I5H A;  5I9O A;  4X65 L;  5BR8 L;  1JB3 A;  3GQB A;  2B2V C;  2NUC A;  1VQE A;  3D6W A;  3Q23 A;  1LTL A;  1B70 B;  1J5E Q;  2WAQ G;  1WTP A;  1PFN A;  2AQ2 B;  3TP7 A;  3EQL C;  1S5D D;  3GTO H;  2NVQ B;  2UUB Q;  3K7A H;  5IP9 H;  1TS3 A;  2ZTC A;  4RCO A;  4LF4 L;  1HR0 L;  4DN4 M;  3BDL A;  1HH2 P;  4NMZ A;  1N36 Q;  4R9W A;  2JXM B;  1QUQ B;  4DUY Q;  1X9N A;  2Y0S E;  1EL0 A;  3KYH C;  3ICE A;  3PO3 B;  5JVH 3;  4EX5 A;  1Q8K A;  4OWX B;  5GAG C;  3HFZ B;  1MIU A;  1ASY A;  5DEH A;  2CQO A;  4BY1 B;  3D4R A;  3C1F A;  1N32 L;  3M3Y B;  2ICE C;  4A76 A;  3S14 B;  3BVG A;  2BA0 A;  3I4N H;  2A69 C;  4LF7 Q;  2EJF C;  3C46 A;  4Y52 H;  1SN8 A;  2XIW A;  1JWM D;  1PYB A;  1HTP A;  3TEH B;  4U67 3;  4A3D H;  1LM0 A;  3S16 B;  4LUV A;  1TR5 A;  2WII B;  3V96 A;  4CDF C;  5C3W A;  4OWT B;  1CK1 A;  1KAW A;  1PH6 A;  3LWU A;  3HP3 A;  1SE8 A;  4DK1 A;  4JBK A;  2AHO B;  3TME A;  3I55 A;  3OWF A;  3GTM H;  3AFQ A;  2Z1C A;  4IO9 A;  4RGN A;  1RTN A;  1F2Z A;  1QOH A;  2KVM A;  3QB3 A;  4FXG C;  3BZD B;  2KJX A;  1T9H A;  2QIL A;  3P7J A;  1LTI D;  5FLX E;  5M5Y H;  1U4M A;  2RKS A;  4CGY B;  1SRO A;  2R92 G;  3CCE A;  3S1Q H;  2PZT A;  5IYC G;  3KDF A;  3I70 A;  2L4N A;  1C0A A;  5EJW A;  1SAP A;  2BE5 C;  4K14 A;  4V19 0;  1RDP D;  2F4V Q;  3G6J B;  4A3F H;  3HKS A;  2R92 B;  4MIU A;  4OO1 H;  3L9A X;  1WD0 A;  3DWA A;  3GP7 A;  2HT1 A;  1BR9 A;  2MHV A;  5C5L A;  1HFG A;  2ES2 A;  4FYD A;  1EIG A;  3FKI G;  4CKE A;  1YIT A;  3OSO A;  1B4O A;  1MSH A;  1W6K A;  1XMQ Q;  3EJI A;  3NWT A;  1SXT A;  2WB1 G;  3J81 j;  5KEE A;  3NWS A;  5K5P A;  1OXU A;  1LAC A;  3E9H A;  2JA7 G;  4J8Q A;  3OMG A;  4A93 B;  2UUC L;  3S2H B;  2WB1 B;  1SLJ A;  1L1O A;  1FD7 D;  3S24 A;  4DV2 L;  3G7L A;  4O42 A;  1PYS B;  4A4I A;  1EQR A;  4L5S A;  2YTY A;  4XDX A;  5IOD A;  5FLX L;  3S17 H;  4PMC A;  1RIP A;  1GO3 E;  2N88 A;  2EE1 A;  3S9W A;  1FGU A;  3I4M G;  4BXX G;  2F0J A;  1MKH A;  2BOS A;  2MP1 A;  1HXY D;  4IPD A;  4O1N A;  3M4Q A;  2GVA A;  3JC6 6;  1NTG A;  2K05 A;  1KC8 C;  2HIX A;  3I4L A;  3BG3 A;  5KYI A;  5GAH C;  3SEB A;  2SNS A;  1HCZ A;  1LTR D;  1SRU A;  3U58 A;  3U50 C;  3J81 L;  4BBS H;  2WAQ B;  4JI5 Q;  1AZP A;  1E22 A;  4U68 A;  4JYA Q;  1RD9 D;  5C4X G;  4PMW A;  3CRL C;  2VNU D;  4CHT B;  1WTO A;  3KLW A;  3KF6 B;  5M3F H;  2ZJQ A;  2G5D A;  5IY0 A;  1K8M A;  4X62 Q;  3CMA A;  4DR7 Q;  2F0H A;  2WAC A;  2YV5 A;  5BN5 A;  2H5X A;  3T56 B;  5AFW A;  3R3O A;  3I73 A;  5C0X H;  3QJY A;  3KBG A;  2KQ3 A;  2VS1 A;  2Z6B A;  5JJI A;  3JAM c;  2KCM A;  3E0E A;  1PV4 A;  1JMC A;  3HKZ G;  1Q46 A;  5EBC A;  2QF7 A;  4DV3 L;  2EJG C;  4QQB X;  3A54 A;  4E6I A;  4J1M A;  2ALY B;  5CV9 A;  5DM7 3;  1DD2 A;  4JI0 L;  3UI2 A;  1F9R A;  3HOW H;  2K5H A;  2XN9 C;  1PRT C;  5I2X A;  3FVQ A;  1SFO B;  4IUV A;  3K81 C;  1JB7 A;  2R6G A;  3K57 A;  1PMR A;  1EU3 A;  4L8J A;  3CCU A;  2VUM H;  1WTH A;  1OTC A;  1XNQ L;  1II3 A;  4GS3 A;  4MTN A;  4A3C H;  3RMH A;  3HOU G;  4B3R L;  1TKW B;  5M3F B;  4A3L G;  1G2T A;  1EY7 A;  2JA6 G;  2Q2H A;  4JI2 Q;  1V1Q A;  2B2W C;  3CQZ B;  2JA6 H;  1E0B A;  1HNX L;  3NEL A;  3RUZ A;  4C1N K;  4LFC Q;  2NZ1 D;  2IJ0 A;  2CCZ A;  1YVC A;  5IYD G;  4WJW A;  3A55 A;  2VUM G;  5ELD A;  5C5M A;  2A68 C;  2FMM A;  4JI4 L;  1HTL D;  4DK3 C;  1IKM A;  2B8G A;  3HOV H;  3Q6S A;  5FOB B;  4DR2 L;  3PIP 3;  5CV5 A;  4A3J G;  2WB1 E;  2KHJ A;  2VUM B;  2VY3 A;  1O7Z A;  4OXP A;  1PTO B;  1KNA A;  4IZ8 A;  2IPK D;  4DR4 L;  3GTJ H;  3D3R A;  3U9O A;  2Q2I A;  5DAU A;  2QGQ A;  2OT2 A;  5AJ3 L;  3F2B A;  3H3V C;  4JPB W;  1L0Y B;  1I5F A;  4HED A;  4JG2 A;  4JOI A;  1JE5 A;  1KDA A;  2GVB A;  4AYB G;  1BQQ T;  3J80 L;  1QE6 A;  3M4Y A;  4QGU A;  1MJE A;  3MXN A;  4JCV E;  3U4Z A;  3QO2 A;  3BVM A;  2FXQ A;  4R1J A;  3TRE A;  5E1F A;  1PA6 A;  2HUG A;  3P75 A;  4LF8 Q;  1F9P A;  4IJH A;  4NXN Q;  1LAB A;  4A75 A;  4QIW E;  3MHB A;  5EPK A;  1A62 A;  3T1Y Q;  2EYO A;  3TDQ A;  1EYC A;  1GM5 A;  1I6V C;  3MEF A;  1NUC A;  3Q0A A;  1HJP A;  3NE5 B;  2K5Q A;  3E3X A;  2JEB I;  4B3S L;  5K36 H;  3A8I E;  1HZ9 A;  3K5L A;  1MHW C;  2EY6 A;  1A3T A;  4XYQ A;  4MHE A;  3A0J A;  2GA4 B;  4HAE A;  2ATW A;  2YU9 H;  4XYO A;  1DON A;  4RA8 A;  5TSS A;  4DF7 A;  4KV6 A;  4AH6 A;  5IYB H;  3T51 B;  4NPS A;  3DLL A;  3ZYY X;  1H9M A;  3GTM B;  4DUZ Q;  4DFA A;  4H7B A;  4DPG A;  2A19 A;  5DLQ E;  1Y1W H;  2K5D A;  2NTT A;  2XRQ D;  1FYC A;  3IKJ A;  3SDZ A;  1KRT A;  4R4T A;  2F03 A;  1PLF A;  2MJ8 A;  5L37 A;  1LLR D;  3CHB D;  3W5O A;  2PMZ E;  4X65 Q;  1Y14 B;  2F0U A;  2NZO A;  3E5S A;  3EVQ A;  3QR8 A;  1WVL A;  1CZW A;  2G9H D;  3MFY A;  3ND8 A;  1YJ9 A;  3W2D A;  3CCL A;  4K5X A;  1YIJ A;  3T13 A;  3IFD A;  1OXV A;  1U0L A;  2A5H A;  1TWC H;  1KXL A;  4ULL A;  1B2T A;  3CAM A;  4KN7 C;  4ZKC B;  1SND A;  3MAQ A;  2MQH A;  4C2M H;  2EOT A;  1VQI A;  4IAL A;  4IPG A;  3S1R B;  1JJC B;  1PRT B;  2PNH A;  2KBN A;  2E2H H;  1D2B A;  5HY6 A;  4FF1 A;  2KHS A;  1LTT D;  3JAM E;  2JA6 B;  3H91 A;  2NVQ H;  1B44 D;  3DWQ A;  3PIP A;  1WFQ A;  1PHJ A;  5CC4 A;  3IL8 A;  1DOK A;  3J80 E;  2EDG A;  1UE6 A;  1VQ5 A;  2EIF A;  2RHS B;  3DXJ C;  4ALP A;  4IUU A;  3VA5 A;  1YNJ C;  2K04 A;  2FIN B;  4GKJ Q;  3PMF A;  1G2S A;  4DR5 Q;  4K6L A;  3FEW X;  2F52 A;  4K2L A;  4A3E B;  4DV0 L;  3UE0 A;  4C3I G;  2NWG A;  1GUN A;  4JI3 L;  4A3I H;  2JA5 H;  4NB3 A;  1EWI A;  2KEC A;  2A69 D;  4DR1 L;  3J80 i;  1AP0 A;  1TVX A;  4ZRZ A;  4A3D B;  4R4I A;  3QIA A;  1SE3 A;  1IBK L;  5ELE A;  2VQE L;  1L2F A;  1XMO Q;  2IHE A;  4FVM A;  3D4D A;  4YCU A;  1XTD A;  3TZD A;  4BY1 G;  3NBI A;  5CBA E;  5LMU L;  5C0X G;  1RTO A;  3GTK H;  4JOI C;  1VQP A;  3T53 B;  1B1Z A;  4KI0 A;  3H3V I;  2AMC B;  1VQH A;  2WKD A;  2J4X A;  2CHB D;  3FP9 A;  2MUY A;  2OCE A;  1Y1W G;  4C3J H;  4M1U B;  3HOZ H;  3KOJ A;  5KND A;  1VMP A;  4FP5 D;  4YWL A;  5IYB G;  4X66 Q;  2GN5 A;  2RVL A;  3SXH A;  4BY1 H;  3FMC A;  1WCM G;  4H13 C;  4WRD A;  4JI1 L;  4RGO S;  1Q90 A;  3N52 A;  1NY4 A;  2I5M X;  5ISR A;  2LY7 A;  1BCP C;  4N9T A;  1A3V A;  1HA5 A;  2JSO A;  1OXT A;  3FDT A;  4UHV A;  2IW3 A;  3QOJ A;  4F8M A;  2WKC A;  2PNR C;  4N8X 1;  4R4Q A;  4A3I G;  4C3I H;  2ZJR A;  3OIQ A;  1SDF A;  2MO0 A;  1I4G A;  4Q0F A;  4DXF A;  5LHY 1;  2N49 A;  3PIO 3;  1PYW D;  5D14 A;  4XQJ A;  3CPW A;  2UUA L;  3D0F A;  3RZO H;  1GUS A;  3GTK B;  4RG1 A;  2JA9 A;  5EKL A;  5C0X J;  3QWN A;  4GKJ L;  2IX1 A;  4G7Z C;  1QZG A;  1JT8 A;  1Z6H A;  1HPC A;  1EQQ A;  1R9T B;  3NHH A;  1PZK D;  4BS9 A;  1VQN A;  2PI2 E;  1EZ6 A;  4YWK A;  1FVI A;  4YY3 L;  1XMO L;  4LF5 L;  2A74 C;  5JJZ A;  1E24 A;  2PZW A;  1ILQ A;  2QCP X;  2XTI A;  3DWP A;  1DOM A;  1SNQ A;  1EY9 A;  4LK1 C;  3KUP A;  5LL6 S;  5IYC H;  2L1B A;  1CKO A;  5JJK A;  2B2Y A;  2DNC A;  1B3A A;  5D3I B;  1WOC A;  1PH8 A;  4Y7N H;  1EYG A;  3ULL A;  1S5C D;  4CKC A;  4QJF A;  4PZ7 A;  3GTP B;  4FO2 A;  4DV1 Q;  3PV0 A;  4P74 A;  3T16 A;  4K0K Q;  1DCZ A;  2PZU A;  2UXD L;  1R4Q B;  1T5X D;  4I7A A;  1F9S A;  3VDY A;  1RJT A;  4K2K A;  3R2I A;  5DM6 3;  4A3G G;  4C3I B;  2B2W A;  3S2D B;  4HSP A;  4ME5 A;  4DR7 L;  2BH2 A;  3R2T A;  3TZU A;  2KOL A;  1LT5 D;  1SNC A;  4P71 A;  4OWW B;  4A3D G;  1CM9 A;  1TS4 A;  1SNO A;  5EKI A;  4K8I A;  4C1N I;  2E2H B;  1S3O A;  1JJG A;  1RL2 A;  2RDF A;  1GUG A;  2EYL A;  1G6Z A;  1KQS A;  1FL0 A;  2EYH A;  3OW2 A;  4H0L C;  3L0O A;  1AZQ A;  3SE0 A;  2F0T A;  3KJO A;  1PH2 A;  3DHQ A;  3MEH A;  2IY5 B;  3NBH A;  1WCM H;  3KBX A;  2VZA A;  1GUO A;  1YNN D;  1HA6 A;  3O13 A;  4GNX A;  2KEE A;  4V0B A;  2PPB C;  3HOZ G;  3J81 c;  1VF5 C;  1Q3L A;  4JYA L;  1NAP A;  2SOB A;  4GN4 B;  2EPB A;  3CW2 C;  2NB0 A;  3PUZ A;  3VA7 A;  3M4P A;  5C3X A;  3TS2 A;  2B2T C;  5FO7 B;  5C4X H;  4RKL A;  3KLS A;  5JEA G;  1K83 H;  1JJ2 A;  2AUJ D;  2YU9 B;  1V1P A;  1IL8 A;  4CDD C;  1O7Y A;  4DNR B;  2CQA A;  1F2Y A;  4GLX A;  1LTB D;  1RF2 D;  4A3J B;  4KD3 A;  3A5Z B;  5H1S E;  5I6Y A;  4R8N A;  4HJ8 A;  3CU7 A;  5CBE E;  4A3I B;  5E3F A;  4NDX A;  4X64 L;  2F0I A;  1K0S A;  4XQN A;  1EU4 A;  3NTI A;  4C2M B;  4HIM A;  1GXD C;  4X3K A;  1KHI A;  5EGT A;  1I3Q H;  1N33 L;  4F7X A;  1KNE A;  3BDC A;  3NSW A;  1TY2 A;  1DOL A;  1S5B D;  3GO5 A;  2A73 B;  1HNZ L;  2HHH Q;  4DV5 L;  5GAE C;  1X3E A;  3GTL B;  2DNE A;  4X62 L;  1N34 L;  2B3G A;  2VQF Q;  4JK1 C;  4S3S A;  4DA2 A;  1BVS A;  2KA7 A;  1CT1 D;  1U4P A;  3BVZ A;  1W6J A;  3SVM A;  5FLX c;  2Q8I B;  1FNW A;  5JPN C;  1QVG A;  4A3L H;  2R7D A;  1EIF A;  2BCO A;  1MI2 A;  3D4W A;  4J6H A;  1LT4 D;  2N8N A;  2JA7 B;  1YZ6 A;  3OW7 A;  4NW2 A;  4C3H G;  2F0L A;  1CZG A;  3S2D H;  2IX0 A;  5IWA Q;  1NR2 A;  4KY7 A;  3GTJ B;  2RDG A;  1CI3 M;  2A6E D;  4NKL A;  4GKK L;  2ICI A;  4LFB Q;  4I7Z C;  2O2L D;  3BZK A;  1M4V A;  2Z9H A;  1PVO A;  4RWS C;  5LL6 X;  1AN8 A;  1WJJ A;  2E8G A;  2RSO A;  1YNX A;  2B2Y C;  2ENB A;  3K5N A;  1ML0 D;  4MN3 A;  3HRZ C;  3SK5 A;  4HMJ A;  4OIK A;  4ZAI A;  1YEZ A;  3CPF A;  2F4I A;  4A3J H;  1PFM A;  4OON A;  2D62 A;  2N55 A;  3VR4 A;  5JVG 3;  1Y8O B;  3PQI A;  2M00 A;  2K75 A;  4A3G B;  4JI0 Q;  2ZXR A;  5CV7 A;  4HCE A;  3ULJ A;  1HQR D;  2EXD A;  3S2H H;  1I50 H;  1ZKO A;  2MO1 A;  2B2U C;  1A0I A;  3EA6 A;  4YCW A;  1H9J A;  2VQF L;  1PH9 A;  3HZX A;  3NK9 A;  4YHH Q;  4IUR A;  5COR A;  4TKO B;  1UNS A;  5I4D A;  1SFO H;  4LUO A;  2BE5 D;  4ME3 A;  3I90 A;  2OTL A;  3AEV A;  1Y8P B;  2IT1 A;  3E6Z X;  4IUN A;  1D8L A;  1NNX A;  4WFN 3;  2ID0 A;  4LNQ A;  2I07 B;  4OIJ A;  4JW0 A;  3T4A C;  4BBS G;  4DNI A;  4RGM A;  2FJ2 A;  3AB9 A;  3MVV A;  4ABN A;  1SYF A;  1TII D;  4ZLT F;  2PQA A;  4DR5 L;  3P1H A;  3I8Z A;  1PH1 A;  4JI4 Q;  3C3L A;  3KLR A;  4JBW A;  4IJL A;  4H02 A;  1S5F D;  4XIG S;  1UEB A;  5IGC A;  1SYD A;  2PMZ B;  4KKS A;  1FJG Q;  4F88 A;  3VR6 A;  2JQO A;  1NCV A;  4HID A;  4DUZ L;  3K0X A;  1EEF D;  4EQN A;  4FNF A;  3OPO A;  1S40 A;  4PMB A;  3ER0 A;  1CA6 A;  4Z9C B;  4JV5 Q;  3DEP A;  2JA7 H;  3ONA B;  4TRD A;  5M3F G;  1EUJ A;  3D31 A;  3FRP B;  3SK6 A;  5A2Q E;  3K7A B;  1HNW Q;  2RA4 A;  4HTH A;  4IQZ A;  3MA2 B;  2ZM6 Q;  2PYK A;  1H95 A;  3B6Y A;  4QIW B;  2L15 A;  1K28 A;  1Y1V H;  2Z0S A;  3K80 C;  4PZ8 A;  4B3S Q;  3H6M A;  5KRU A;  2K32 A;  1C7Y A;  1EY6 A;  2LFN A;  3KF6 A;  2J0T D;  3PUW A;  2VB3 X;  4RFB A;  3M9B A;  4ZKB B;  4GLA C;  4DU9 A;  1CA5 A;  4DV4 Q;  1CKM A;  3S17 B;  1VQ8 A;  2K7V A;  3E9I A;  1K8A C;  2B8F A;  3K6O A;  4I65 A;  1S72 A;  1QVC A;  1UEA B;  5IGF A;  2R92 H;  4BXX H;  4A3F B;  4B9X A;  1BBX C;  1K9M C;  3PGZ A;  4YCV A;  1L0W A;  1I4H A;  1EOV A;  4RAU C;  2KCC A;  4JVZ A;  3FHW A;  4AYB B;  4HIK A;  1BO0 A;  3GTO B;  1EFI D;  3I2Z A;  3VYR A;  4LJZ C;  4HJ7 A;  4C3H B;  1PZI D;  1QWY A;  3F2U A;  5C4J B;  1QG7 A;  2XNA C;  3GTP H;  1VQA A;  2RCN A;  2IL8 A;  1I4P A;  2HIV A;  3HOW B;  4KHV A;  2C9O A;  1E1O A;  3J7A 5;  1RKN A;  4A3C G;  3OIP A;  4KJN A;  4DUY L;  4CBV A;  1VF7 A;  2DY7 A;  2VXW A;  1BNZ A;  1M1K C;  1NMF A;  3HOW G;  4LF6 Q;  5HGQ A;  1U4L A;  4AQY Q;  1TWH B;  2LKV A;  3GTG B;  1EWH A;  3TSS A;  2ZXO A;  3I4O A;  5EPJ A;  1IBL L;  1BCP F;  2EYM A;  5G3L F;  3HOY B;  4K6D A;  1B3Q A;  3K5M A;  3BYT B;  4A3B B;  2CH4 W;  2FMC A;  1TS2 A;  5LMN Q;  4O0A A;  1XX8 A;  4EQ5 A;  2F3V A;  4TVA B;  2F0N A;  2JEA I;  1C9O A;  3OOC A;  1H9K A;  2R3Z A;  3S1R H;  3HGB A;  3PCO B;  1A2U A;  3M85 A;  3RZO B;  1I6H H;  2K14 A;  1ICF B;  4NXM Q;  4TSS A;  3PIO A;  4B3M Q;  1JIC A;  1CFM A;  3OTO Q;  5BR8 Q;  1RCV D;  5JPM C;  3H0G G;  3TQY A;  3TS0 A;  3FPU B;  4B08 A;  1PZJ D;  1T5E A;  4BBS B;  1Q7Y C;  1G29 1;  1NBW A;  3JAM L;  2ZT9 C;  5KNC A;  4LWC A;  4L6T B;  1HZB A;  1J9O A;  5C6A A;  4B3T Q;  1G91 A;  1VQF A;  4PNY A;  1WTW A;  3I4N G;  4XTC S;  1Z9F A;  4DKA C;  1P8L A;  3MXN B;  1Y8N B;  2SNM A;  4GN5 A;  1N8R C;  1NR4 A;  1XWE A;  4QUF A;  1SE2 A;  2PW7 A;  3K8A A;  2RDH A;  3TBI B;  1EFW A;  2CH4 A;  3OWE B;  1MBY A;  1YNJ D;  5EAY A;  1VQO A;  3DM1 A;  5COY A;  2D0P A;  4HIO A;  1I94 Q;  2UXB Q;  2WFW A;  3S1Q B;  4GN3 B;  2AWN A;  5T1I A;  4IFD G;  5K36 G;  1EQV A;  4GLV B;  2B39 A;  1P16 A;  2F0E A;  3CKI B;  4DV7 L;  2VQE Q;  2CKZ B;  2E75 C;  1KAB A;  4JBJ A;  2EXZ A;  4LF8 L;  4KK7 A;  5J39 A;  1YHQ A;  1VQ6 A;  1F2M A;  1X6O A;  4A3E H;  4PG3 A;  4C3J G;  1G51 A;  1U4R A;  1N9W A;  5KYL A;  2VB2 X;  4JC0 A;  3RNU A;  3T1Y L;  3BU2 A;  1PFS A;  5DNF A;  2N3S A;  2F3W A;  1GHJ A;  1Z7T A;  3NUC A;  4IFD I;  1NJI C;  5CGK A;  3BDO A;  1QZH A;  1FGB D;  1IYJ B;  1S5E D;  4DV6 Q;  4H44 C;  1HRJ A;  2R93 B;  1K0R A;  2HDL A;  2PW5 A;  4XT1 B;  5IWA L;  4BY7 G;  2J7Z A;  1HUM A;  3FKI H;  4QB4 A;  1CTM A;  4OO1 G;  4UP8 A;  4QL5 A;  4A3F G;  1TS5 A;  5JAV A;  1E1T A;  3UE1 A;  5FO9 B;  4DAV A;  3CP0 A;  4POG A;  2JA5 B;  1GUT A;  4GOP C;  2X69 A;  4N8F A;  3K5O A;  1J6Q A;  4P75 A;  4ZK9 B;  4O2D A;  3HOV G;  2KHI A;  1EIH A;  1ONL A;  2JA5 G;  2CWA A;  1PTO H;  3BS1 A;  4RHR A;  4RH6 A;  5IYD H;  3UDX A;  2NYZ D;  3HOZ B;  5CMD A;  1IZ6 A;  3L7Z C;  1JR0 D;  2O5I C;  4KN4 C;  4KLK A;  2OXP A;  2EYJ A;  3CCV A;  4DV5 Q;  2JE6 I;  5C4J H;  3CCR A;  1VQD A;  1Q1E A;  3GV6 A;  4CJ2 C;  1K3B C;  2A6H D;  4HJ5 A;  1N34 Q;  4RGT A;  2E5L L;  3HOU H;  1O78 A;  3G6E A;  2YYZ A;  1Y1W B;  1IBM Q;  3ERQ A;  5GQO A;  2CVR A;  2D2C C;  3PO3 H;  2PO4 A;  4MTK A;  1NE3 A;  4A3B G;  2DGY A;  4FF2 A;  2KCT A;  4A3M G;  2RQX A;  3C2P A;  1CHQ D;  4DAM A;  1VQ7 A;  3RLF A;  1I94 L;  2G9D A;  1XNR Q;  1AE3 A;  3CC2 A;  3RZD H;  3ULP A;  1MJC A;  2A6E C;  4K0K L;  1H9S A;  4X3U A;  3X3M A;  1C8C A;  1X32 A;  5CR3 A;  4HN7 A;  2K01 A;  3CCS A;  4B3R Q;  1HQM C;  1VQB A;  4OGQ C;  1JOK A;  1KDC A;  3I91 A;  2F0P A;  1AH9 A;  2MGS A;  1A15 A;  3Q22 A;  1C4Q A;  2I0Q A;  2B63 B;  5IP7 H;  3EIV A;  4UP7 A;  1M8A A;  2HCC A;  1WTX A;  2EVB A;  1I4X A;  2E76 C;  4QY7 A;  3SK4 A;  4DV1 L;  1J5E L;  2Q2U A;  5IIF A;  3J80 c;  4DV6 L;  4JBM A;  2PI2 A;  2K50 A;  3RLO A;  5I9P A;  2K5N A;  3J7Y W;  1D5X C;  1X65 A;  2F0F A;  1PTO C;  4J15 A;  2UU9 Q;  5KIX A;  5M3M H;  1IBK Q;  2LSS A;  4JI2 L;  1FNV A;  2AQ1 B;  1SYE A;  1I4Q A;  1W3S A;  5ELB A;  5ELC A;  5FK9 C;  5M5W B;  2MNA A;  2NVT H;  3MXP A;  2SEB D;  3NP8 A;  3WOF A;  1BKB A;  3FPP A;  1XNR L;  3VYS A;  3H94 A;  4IN3 A;  5C44 H;  2D0O A;  1YJW A;  4KTA A;  3EFX D;  3QG1 A;  1V1O A;  2V4D A;  2EYF A;  2PQA B;  3G4S A;  1TQO A;  1GVP A;  1L0X B;  1IKL A;  2BH8 A;  3G71 A;  1WTR A;  2XGT A;  4GNX B;  4DR3 L;  3LGJ A;  1SYG A;  4OEL B;  5LMU Q;  4CDC C;  1EEI D;  2F0G A;  1TWA B;  2EYP A;  4LFC L;  3GTQ H;  1HNX Q;  5J1Z A;  1RHP A;  2NN6 H;  2SDF A;  1X55 A;  4JV5 L;  3A8K E;  4DK6 C;  1X54 A;  5J3B A;  5M5X H;  1ENF A;  1M90 C;  2K5W A;  1SJH D;  4XXE A;  4IFD J;  4LF6 L;  1E3P A;  3RN5 A;  3PO2 H;  1O7L A;  4IPC A;  3SK8 A;  4LF9 Q;  4WJ4 A;  1HHV A;  2F0S A;  1WTQ A;  4GOP A;  2Z6K C;  4JI8 Q;  2OWO A;  2WAQ E;  3U9S A;  3CME A;  4KJO A;  2M9V A;  1ZXT A;  3KF8 B;  1WI5 A;  1IHZ A;  3X3N A;  4KY5 A;  4JI7 Q;  3C1E A;  3UDG A;  3T1H L;  2NVT B;  3TRZ A;  2YTV A;  1V43 A;  4R4C A;  2I5L X;  3R8B A;  3E0J A;  4CJ1 B;  5E4X A;  4K5V A;  2KCN A;  3RR5 A;  3CC7 A;  4A3K H;  1A63 A;  1AEX A;  4QCL A;  1QUQ A;  4BBR G;  1EY4 A;  5BN3 A;  1K83 B;  4BA1 I;  2Q2T A;  5A2Q L;  4F87 A;  2HHH L;  3J81 E;  1QVF A;  3S1M H;  1XNQ Q;  1VS0 A;  3M4O B;  1KDB A;  2ZM6 L;  1EYA A;  5C3E G;  2UUC Q;  2HCI A;  5IP7 G;  3GTL H;  2Y0S G;  4RHS A;  1LUZ A;  3BJU A;  1MGS A;  2LXK A;  2UXC L;  1PRT F;  1ICW A;  2Z4I A;  1I3Q B;  1ET9 A;  3UDF A;  1AFP A;  1CUK A;  2C5C A;  2DUD A;  3NQI A;  3CCQ A;  1YI2 A;  2K1B A;  2QEJ C;  2LS0 1;  3K59 A;  1VQG A;  1WYD A;  3HOX H;  3HKZ E;  2JA8 G;  1GJX A;  1BOS A;  4L5Q A;  1CHP D;  4HMI A;  1F77 A;  3M3Y H;  1W2B A;  1VCI A;  4YY3 Q; 
#chains in the Genus database with same CATH homology
 5CV4 A;  2XVS A;  4ILW A;  2TSS A;  5C4H A;  1LTA D;  3DUZ A;  3RZD B;  2JA8 B;  3RD4 A;  5CYU A;  2AQ3 B;  1KLU D;  1PTO F;  2XRS D;  1STY A;  4PV1 C;  3ND9 A;  3AU7 A;  3P20 A;  4IUP A;  2O4X A;  1LT3 D;  5EKK A;  1OO9 B;  2HDM A;  1DZ1 A;  1SNM A;  2H4O A;  1ESF A;  2DY8 A;  4HCS A;  5IGB A;  5FKA C;  4KMU C;  3SHL A;  2NVX B;  1X3P A;  1QNU A;  1EY5 A;  1MSG A;  4PQX A;  2EY1 A;  4P2C B;  1JCK B;  3LWE A;  2A6H C;  5M5X B;  3WOE A;  4BA2 I;  5IGD A;  5FO8 B;  4DAP A;  1H9S B;  5JEA J;  2NVY B;  4ZUI A;  2EJM A;  1SYC A;  3J7A F;  1B9M A;  2M2L A;  5IGG A;  4Q5V A;  1SNP A;  1SBB B;  3URY A;  4XQQ A;  1D1K A;  4IUQ A;  3H0G B;  3GV3 A;  1BCP D;  5G3L D;  1QCB D;  4DAY A;  2WP8 J;  1CQF A;  2EZV A;  5F2D A;  3I72 A;  3I4N B;  4Y7N B;  2OF1 A;  4X3T A;  3AMU A;  1DM0 B;  1MD2 D;  1JE4 A;  3L3O C;  4ID6 A;  4DK0 A;  3SR1 A;  4EQO A;  4FXK C;  4ZQ3 A;  2Q8T A;  3S15 B;  1SMY C;  3NTH A;  3V05 A;  3BYY B;  3I3C A;  5M9O A;  4TQU S;  3FKI B;  5EQ0 A;  1ILP A;  5I2Y A;  4M8A A;  1QJO A;  4IUT A;  2CW0 C;  4C3J B;  2RSN A;  4FF3 A;  2Y0S B;  2HQE A;  2JP1 A;  1TWG B;  1Y69 U;  2F0Q A;  1WTV A;  2BDO A;  3M7G A;  3MXU A;  2MPM A;  4BY7 B;  1EZ8 A;  3PUX A;  5J22 A;  3VR2 A;  5E4W C;  1DYQ A;  1Q1B A;  5HUR A;  3PUY A;  4KKU A;  3NTK A;  3I4M B;  1I6H B;  2Z4H A;  3MC0 B;  5ELF A;  3MZ5 A;  1F2L A;  1F9Q A;  5CV8 A;  3A7L A;  2F0D A;  1BUV T;  1DXM A;  1A6X A;  5CV6 A;  1STB A;  1SE4 A;  2NTS A;  3HEJ A;  3MWY W;  4C56 C;  3W3A A;  1SMY D;  1JOO A;  1NSN S;  4DXG A;  1JOR A;  2AWO A;  2E2I B;  4X3S A;  2E2D C;  2O5J C;  2F0K A;  1ROD A;  1BCP B;  2XWJ B;  1XYI A;  4QMG A;  4ODG A;  2QDB A;  4A3M B;  1VDZ A;  3S1N B;  4L63 B;  2L0C A;  1STA A;  3J7A V;  1UUP A;  5EBD A;  1STH A;  1FNU A;  4XT3 B;  1D6E C;  1ZYR D;  5I6W A;  4FF4 A;  3ERO A;  4N9P A;  1Q12 A;  3D8G A;  1Z47 A;  4YIJ A;  2NN6 G;  1XTC D;  4ZYS A;  3IFT A;  4B9W A;  2L11 A;  1EY0 A;  1A2T A;  1PXU A;  2R7Z B;  1PFB A;  1BF4 A;  2JYO A;  4CJ0 B;  3D6C A;  1O80 A;  1D1I A;  4EVO A;  4IFD H;  1KTK A;  1AW7 A;  3MXG A;  2WV6 D;  3KF8 A;  2WIN B;  2XWB B;  1STN A;  2A68 D;  1TWC B;  3QOL A;  1EQT A;  3NXW A;  4HSV A;  1JC7 A;  4LMQ D;  2L9H A;  2FHT A;  2X6G A;  1HUN A;  3MFG A;  3NPP A;  3K58 A;  1TY0 A;  4ZUJ A;  3MTS A;  4RKB A;  1EYD A;  2IX3 A;  1JWU D;  3H09 A;  5D65 A;  4K8J A;  2I46 A;  2PQE A;  4G7H C;  5IGE A;  1HFN A;  1SYB A;  3HOX B;  5EPL A;  5T1G A;  4DNT B;  4EGV A;  4A3K B;  3TN2 A;  1EWC A;  1OXX K;  2BDN A;  4OL7 A;  1EOT A;  1DJR D;  3NQT A;  1Q8I A;  1TU2 B;  1JWS D;  4NP5 A;  1SSO A;  1TT2 A;  2K03 A;  1B53 A;  3VYT A;  3HOV B;  2EY5 A;  1E2V A;  2H1E A;  3CRK C;  1TWF B;  2NBF A;  1B50 A;  2ZXP A;  1PDQ A;  3HS0 C;  1WD1 A;  2RBM A;  5C4X B;  3PO2 B;  4BBR B;  2K33 A;  1QNK A;  1UAP A;  1IYV A;  1YNN C;  5NUC A;  3LNN A;  2D5D A;  2KED A;  4G4K A;  5C0X I;  4OO1 I;  2XSC A;  1U9R A;  1LV9 A;  4QF4 A;  1H9R A;  1E2W A;  2F0M A;  1JOQ A;  1GHK A;  1ESR A;  2QKI C;  2F1M A;  3HKZ B;  1K8O A;  1VMC A;  3KK7 A;  3PUV A;  1X3Q A;  5C44 B;  1Y1V B;  5BN4 A;  2D9U A;  3GTQ B;  2BA1 A;  1A3U A;  2L55 A;  1J8I A;  1XXG A;  4UDU C;  3N6R A;  1R4P B;  4WOR A;  3HOU B;  1EY8 A;  1STE A;  3DMU A;  3KLS X;  1LT6 D;  4G57 A;  5JEA H;  3IAY A;  4QUC A;  4RCN A;  1C48 A;  5JOB A;  3VR5 A;  3ITP A;  5KNB A;  3GD7 A;  2E2J B;  3S1M B;  5M3M B;  1JQY D;  1SJE D;  1BXT A;  1E2Z A;  4KHZ A;  1BDO A;  3VR3 A;  1QB5 D;  3K0Y A;  1ENA A;  1PTO D;  1LO5 D;  1KLG D;  4K5W A;  4HR7 B;  2X6L A;  1D5M C;  4EQP A;  1IW7 D;  1OXS C;  1GOZ A;  1ET6 A;  2Q8R E;  2NN6 I;  2F0O A;  4KY6 A;  2B2T A;  5IT9 L;  1S4Z A;  1QIL A;  2Z8L A;  2TMP A;  4BWG B;  1LTS D;  1PRT D;  2LMC B;  3V2T A;  2IWH A;  1I50 B;  1IYU A;  1V1P B;  1GUW A;  1KAA A;  1STG A;  3R93 A;  1D5Z C;  2DN8 A;  1ENC A;  2B2U A;  1LTG D;  2R61 A;  4R8I A;  1WCM B;  3TP8 A;  1I4R A;  3LX0 A;  1SEB D;  5IT9 E;  2CW0 D;  5A35 A;  4FXD A;  2K28 A;  1ZYR C;  3TP5 A;  3A8J E;  2B2V A;  2PCF B;  3A7A B;  2EY2 A;  4KD4 A;  4UAI A;  1IW7 C;  2F0W A;  1V8Q A;  2F0V A;  4OHJ A;  4KKT A;  5C4Z A;  3DEO A;  1G8Z D;  2E74 C;  4GZY C;  2AUK A;  5IOC A;  5C3E B;  2FFK B;  3OMC A;  4DGZ A;  2K6A A;  3Q24 A;  2OEO A;  3HG9 A;  4CKB A;  5D3D A;  1CQV A;  3OHX C;  5HGT A;  5M5Y B;  4LAA A;  3A56 A;  3VYU A;  5KGU A;  3TP6 A;  1B9N A;  2L5T A;  3WDN A;  4G7O C;  1FR3 A;  1ZEQ X;  2KUM A;  2L12 A;  3M7N A;  5I9O A;  1JB3 A;  3GQB A;  2B2V C;  2NUC A;  3D6W A;  3Q23 A;  1WTP A;  1PFN A;  2AQ2 B;  3TP7 A;  3EQL C;  1S5D D;  2NVQ B;  1TS3 A;  4RCO A;  4DN4 M;  3BDL A;  4NMZ A;  4R9W A;  2JXM B;  1EL0 A;  3PO3 B;  5JVH 3;  5DEH A;  4BY1 B;  3D4R A;  3C1F A;  3M3Y B;  2ICE C;  3S14 B;  3BVG A;  2BA0 A;  2A69 C;  2EJF C;  3C46 A;  2XIW A;  1JWM D;  1HTP A;  4U67 3;  3S16 B;  1TR5 A;  2WII B;  3V96 A;  5C3W A;  1CK1 A;  3LWU A;  3HP3 A;  4DK1 A;  3TME A;  3OWF A;  2Z1C A;  4RGN A;  1RTN A;  1F2Z A;  1QOH A;  2KVM A;  3QB3 A;  4FXG C;  3BZD B;  2KJX A;  2QIL A;  3P7J A;  1LTI D;  5FLX E;  1U4M A;  2RKS A;  4CGY B;  2PZT A;  3I70 A;  2L4N A;  5EJW A;  1SAP A;  2BE5 C;  4K14 A;  4V19 0;  1RDP D;  3G6J B;  2R92 B;  4MIU A;  4OO1 H;  3L9A X;  1WD0 A;  3DWA A;  3GP7 A;  1BR9 A;  2MHV A;  5C5L A;  1HFG A;  4FYD A;  1EIG A;  4CKE A;  3OSO A;  1B4O A;  1MSH A;  1W6K A;  3EJI A;  3NWT A;  1SXT A;  5KEE A;  3NWS A;  5K5P A;  1OXU A;  1LAC A;  4J8Q A;  3OMG A;  4A93 B;  3S2H B;  2WB1 B;  1FD7 D;  3G7L A;  4O42 A;  4XDX A;  5IOD A;  5FLX L;  4PMC A;  2N88 A;  2EE1 A;  3S9W A;  2F0J A;  2BOS A;  2MP1 A;  1HXY D;  4O1N A;  2K05 A;  3I4L A;  3BG3 A;  5KYI A;  3SEB A;  2SNS A;  1HCZ A;  1LTR D;  3J81 L;  2WAQ B;  1AZP A;  4U68 A;  1RD9 D;  4PMW A;  3CRL C;  2VNU D;  4CHT B;  1WTO A;  1K8M A;  2F0H A;  2WAC A;  5BN5 A;  3T56 B;  5AFW A;  3R3O A;  3I73 A;  5C0X H;  3QJY A;  3KBG A;  2KQ3 A;  5EBC A;  2QF7 A;  2EJG C;  3A54 A;  4E6I A;  4J1M A;  5CV9 A;  5DM7 3;  1DD2 A;  3UI2 A;  1F9R A;  2XN9 C;  1PRT C;  5I2X A;  3FVQ A;  1SFO B;  4IUV A;  2R6G A;  3K57 A;  1PMR A;  1EU3 A;  4L8J A;  1II3 A;  3RMH A;  1TKW B;  5M3F B;  1G2T A;  1EY7 A;  2B2W C;  3CQZ B;  1E0B A;  3RUZ A;  4C1N K;  2NZ1 D;  2IJ0 A;  4WJW A;  3A55 A;  5C5M A;  5ELD A;  2A68 C;  2FMM A;  1HTL D;  1IKM A;  2B8G A;  3Q6S A;  5FOB B;  3PIP 3;  5CV5 A;  2VUM B;  1O7Z A;  1PTO B;  1KNA A;  4IZ8 A;  2IPK D;  3D3R A;  3U9O A;  5DAU A;  2OT2 A;  3H3V C;  1L0Y B;  4HED A;  1KDA A;  1BQQ T;  3J80 L;  1QE6 A;  3M4Y A;  3MXN A;  3QO2 A;  3BVM A;  5E1F A;  2HUG A;  3P75 A;  1F9P A;  1LAB A;  3MHB A;  5EPK A;  2EYO A;  3TDQ A;  1EYC A;  1I6V C;  1NUC A;  3Q0A A;  3NE5 B;  2K5Q A;  2JEB I;  5K36 H;  3A8I E;  3K5L A;  2EY6 A;  1A3T A;  4XYQ A;  4MHE A;  2GA4 B;  4HAE A;  4XYO A;  1DON A;  4RA8 A;  5TSS A;  4DF7 A;  4KV6 A;  3T51 B;  3ZYY X;  1H9M A;  3GTM B;  4DFA A;  4H7B A;  2K5D A;  2NTT A;  2XRQ D;  1FYC A;  3IKJ A;  3SDZ A;  2F03 A;  1PLF A;  2MJ8 A;  1LLR D;  3CHB D;  2F0U A;  3E5S A;  3EVQ A;  1WVL A;  1CZW A;  2G9H D;  3MFY A;  3ND8 A;  3W2D A;  4K5X A;  3T13 A;  3IFD A;  1OXV A;  2A5H A;  4ULL A;  1B2T A;  4KN7 C;  4ZKC B;  1SND A;  3MAQ A;  2EOT A;  4IAL A;  3S1R B;  1PRT B;  1D2B A;  4FF1 A;  2KHS A;  1LTT D;  3JAM E;  2JA6 B;  3H91 A;  1B44 D;  3DWQ A;  5CC4 A;  3IL8 A;  1DOK A;  3J80 E;  2EDG A;  3DXJ C;  4IUU A;  3VA5 A;  1YNJ C;  2K04 A;  2FIN B;  3PMF A;  1G2S A;  4K6L A;  3FEW X;  4A3E B;  4K2L A;  4C3I G;  2NWG A;  1GUN A;  2KEC A;  2A69 D;  1AP0 A;  1TVX A;  4ZRZ A;  4A3D B;  3QIA A;  1SE3 A;  5ELE A;  4FVM A;  3D4D A;  3TZD A;  3NBI A;  5CBA E;  5C0X G;  1RTO A;  3T53 B;  1B1Z A;  4KI0 A;  2WKD A;  2J4X A;  2CHB D;  2MUY A;  4M1U B;  5KND A;  1VMP A;  4FP5 D;  2RVL A;  3SXH A;  3FMC A;  4H13 C;  4WRD A;  4RGO S;  1Q90 A;  3N52 A;  5ISR A;  2LY7 A;  1BCP C;  4N9T A;  1A3V A;  1HA5 A;  2JSO A;  1OXT A;  3FDT A;  4F8M A;  2IW3 A;  3QOJ A;  2WKC A;  2PNR C;  3OIQ A;  1SDF A;  1I4G A;  4Q0F A;  4DXF A;  5LHY 1;  3PIO 3;  1PYW D;  5D14 A;  4XQJ A;  1GUS A;  3GTK B;  5EKL A;  5C0X J;  3QWN A;  2IX1 A;  4G7Z C;  1Z6H A;  1HPC A;  1R9T B;  3NHH A;  1PZK D;  4BS9 A;  1EZ6 A;  2A74 C;  5JJZ A;  2PZW A;  1ILQ A;  2QCP X;  3DWP A;  1DOM A;  1SNQ A;  1EY9 A;  4LK1 C;  3KUP A;  5LL6 S;  2L1B A;  2B2Y A;  2DNC A;  1B3A A;  5D3I B;  1S5C D;  4CKC A;  3GTP B;  4FO2 A;  3PV0 A;  3T16 A;  1DCZ A;  2PZU A;  1R4Q B;  1T5X D;  1F9S A;  1RJT A;  4K2K A;  3R2I A;  5DM6 3;  4C3I B;  2B2W A;  3S2D B;  4HSP A;  4ME5 A;  3R2T A;  3TZU A;  2KOL A;  1LT5 D;  1SNC A;  1CM9 A;  1TS4 A;  1SNO A;  5EKI A;  4K8I A;  4C1N I;  2E2H B;  2RDF A;  1GUG A;  2EYL A;  1G6Z A;  2EYH A;  4H0L C;  1AZQ A;  3SE0 A;  2F0T A;  3DHQ A;  3MEH A;  3NBH A;  3KBX A;  1GUO A;  1YNN D;  1HA6 A;  3O13 A;  2KEE A;  4V0B A;  2PPB C;  1VF5 C;  1Q3L A;  1NAP A;  2SOB A;  2EPB A;  2NB0 A;  3PUZ A;  3VA7 A;  5C3X A;  2B2T C;  5FO7 B;  4RKL A;  3KLS A;  5JEA G;  2AUJ D;  2YU9 B;  1V1P A;  1IL8 A;  1O7Y A;  4DNR B;  2CQA A;  1F2Y A;  1LTB D;  1RF2 D;  4A3J B;  4KD3 A;  5I6Y A;  4R8N A;  3CU7 A;  5CBE E;  4A3I B;  5E3F A;  4NDX A;  2F0I A;  4XQN A;  1EU4 A;  3NTI A;  4C2M B;  1GXD C;  4X3K A;  5EGT A;  4F7X A;  1KNE A;  3BDC A;  3NSW A;  1TY2 A;  1DOL A;  1S5B D;  3GO5 A;  2A73 B;  3GTL B;  2DNE A;  4JK1 C;  4S3S A;  4DA2 A;  2KA7 A;  1CT1 D;  1U4P A;  3BVZ A;  1W6J A;  3SVM A;  2Q8I B;  1FNW A;  5JPN C;  2BCO A;  3D4W A;  1MI2 A;  4J6H A;  1LT4 D;  2JA7 B;  3OW7 A;  4NW2 A;  4C3H G;  2F0L A;  1CZG A;  2IX0 A;  1NR2 A;  3GTJ B;  4KY7 A;  2RDG A;  1CI3 M;  2A6E D;  4NKL A;  2ICI A;  4I7Z C;  2O2L D;  1M4V A;  4RWS C;  5LL6 X;  1AN8 A;  2RSO A;  2B2Y C;  2ENB A;  3K5N A;  1ML0 D;  4MN3 A;  3HRZ C;  3SK5 A;  4HMJ A;  4OIK A;  4ZAI A;  2F4I A;  1PFM A;  2D62 A;  2N55 A;  3VR4 A;  5JVG 3;  1Y8O B;  2M00 A;  4A3G B;  2ZXR A;  5CV7 A;  4HCE A;  1HQR D;  1ZKO A;  2B2U C;  3EA6 A;  1H9J A;  3HZX A;  3NK9 A;  4IUR A;  5COR A;  4TKO B;  1UNS A;  5I4D A;  2BE5 D;  3I90 A;  1Y8P B;  2IT1 A;  3E6Z X;  4IUN A;  4WFN 3;  2ID0 A;  2I07 B;  4OIJ A;  3T4A C;  4RGM A;  2FJ2 A;  3AB9 A;  3MVV A;  4ABN A;  1SYF A;  1TII D;  4ZLT F;  3I8Z A;  3P1H A;  3C3L A;  3KLR A;  4JBW A;  1S5F D;  4XIG S;  5IGC A;  1SYD A;  2PMZ B;  4KKS A;  4F88 A;  3VR6 A;  1NCV A;  1EEF D;  4EQN A;  4FNF A;  3OPO A;  4PMB A;  1CA6 A;  4Z9C B;  3DEP A;  3ONA B;  4TRD A;  3FRP B;  3D31 A;  3SK6 A;  5A2Q E;  3K7A B;  2RA4 A;  4HTH A;  4IQZ A;  3MA2 B;  2PYK A;  4QIW B;  3H6M A;  5KRU A;  2K32 A;  1EY6 A;  2LFN A;  2J0T D;  3PUW A;  2VB3 X;  4RFB A;  4ZKB B;  4DU9 A;  1CA5 A;  3S17 B;  2K7V A;  2B8F A;  3K6O A;  4I65 A;  1UEA B;  5IGF A;  4A3F B;  4B9X A;  1BBX C;  1I4H A;  4RAU C;  2KCC A;  4AYB B;  1BO0 A;  3GTO B;  1EFI D;  3VYR A;  4LJZ C;  4C3H B;  1PZI D;  1QWY A;  3F2U A;  5C4J B;  1QG7 A;  2XNA C;  2IL8 A;  1I4P A;  3HOW B;  4KHV A;  2C9O A;  1RKN A;  3OIP A;  4KJN A;  4CBV A;  1VF7 A;  2DY7 A;  2VXW A;  1BNZ A;  1U4L A;  1TWH B;  2LKV A;  3GTG B;  1EWH A;  3TSS A;  2ZXO A;  5EPJ A;  1BCP F;  5G3L F;  3HOY B;  1VCI A;  4K6D A;  3K5M A;  3BYT B;  4A3B B;  2FMC A;  1TS2 A;  1XX8 A;  2F3V A;  2F0N A;  2JEA I;  3OOC A;  1H9K A;  2R3Z A;  3HGB A;  1A2U A;  3M85 A;  3RZO B;  4TSS A;  1JIC A;  1CFM A;  1RCV D;  5JPM C;  3FPU B;  4B08 A;  1PZJ D;  1T5E A;  4BBS B;  1G29 1;  3JAM L;  2ZT9 C;  5KNC A;  4L6T B;  5C6A A;  1J9O A;  1G91 A;  4PNY A;  1WTW A;  4XTC S;  1Y8N B;  2SNM A;  1NR4 A;  1XWE A;  4QUF A;  1SE2 A;  2PW7 A;  2RDH A;  3TBI B;  3OWE B;  1MBY A;  1YNJ D;  3DM1 A;  5COY A;  3S1Q B;  5T1I A;  2AWN A;  4IFD G;  5K36 G;  1EQV A;  2B39 A;  2F0E A;  3CKI B;  2E75 C;  1KAB A;  2EXZ A;  4KK7 A;  5J39 A;  1F2M A;  4C3J G;  1U4R A;  5KYL A;  2VB2 X;  5DNF A;  2F3W A;  1GHJ A;  1Z7T A;  3NUC A;  4IFD I;  5CGK A;  3BDO A;  1FGB D;  1S5E D;  4H44 C;  1HRJ A;  2R93 B;  2HDL A;  2PW5 A;  4XT1 B;  2J7Z A;  1HUM A;  4QB4 A;  1CTM A;  4OO1 G;  1TS5 A;  5JAV A;  5FO9 B;  4DAV A;  2JA5 B;  1GUT A;  2X69 A;  3K5O A;  4ZK9 B;  1EIH A;  1ONL A;  1PTO H;  3BS1 A;  4RHR A;  4RH6 A;  2NYZ D;  3HOZ B;  5CMD A;  3L7Z C;  1JR0 D;  2O5I C;  4KN4 C;  2OXP A;  2EYJ A;  2JE6 I;  1Q1E A;  3GV6 A;  4CJ2 C;  2A6H D;  4RGT A;  1O78 A;  1Y1W B;  2YYZ A;  3ERQ A;  2CVR A;  2D2C C;  2PO4 A;  4FF2 A;  3C2P A;  2RQX A;  1CHQ D;  3RLF A;  2G9D A;  2A6E C;  1H9S A;  4X3U A;  3X3M A;  1C8C A;  1X32 A;  5CR3 A;  4HN7 A;  2K01 A;  1HQM C;  4OGQ C;  1JOK A;  1KDC A;  3I91 A;  2F0P A;  2MGS A;  1A15 A;  3Q22 A;  1C4Q A;  2B63 B;  1M8A A;  2HCC A;  1WTX A;  2EVB A;  1I4X A;  2E76 C;  3SK4 A;  5IIF A;  5I9P A;  3J7Y W;  1D5X C;  2F0F A;  1PTO C;  5KIX A;  1FNV A;  2AQ1 B;  1SYE A;  1I4Q A;  5ELB A;  5ELC A;  5FK9 C;  5M5W B;  3MXP A;  2SEB D;  3NP8 A;  3WOF A;  3FPP A;  3VYS A;  3H94 A;  4IN3 A;  4KTA A;  3EFX D;  3QG1 A;  1V1O A;  2V4D A;  2EYF A;  1TQO A;  1L0X B;  1IKL A;  1WTR A;  1SYG A;  1EEI D;  2F0G A;  1TWA B;  2EYP A;  5J1Z A;  1RHP A;  2NN6 H;  2SDF A;  3A8K E;  1ENF A;  2K5W A;  4XXE A;  1SJH D;  4IFD J;  1O7L A;  3SK8 A;  1HHV A;  2F0S A;  1WTQ A;  3U9S A;  4KJO A;  2M9V A;  1ZXT A;  1IHZ A;  3X3N A;  4KY5 A;  3C1E A;  2NVT B;  1V43 A;  3R8B A;  4CJ1 B;  3E0J A;  5E4X A;  4K5V A;  2KCN A;  1AEX A;  4QCL A;  5BN3 A;  1EY4 A;  1K83 B;  4BA1 I;  5A2Q L;  4F87 A;  3J81 E;  3M4O B;  1KDB A;  1EYA A;  2HCI A;  4RHS A;  1MGS A;  1PRT F;  1ICW A;  2Z4I A;  1I3Q B;  1ET9 A;  1AFP A;  2C5C A;  3NQI A;  2K1B A;  2QEJ C;  2LS0 1;  3K59 A;  1GJX A;  1BOS A;  1CHP D;  4HMI A;  1F77 A;  2EYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...