3ONAB

The secret domain in complex with cx3cl1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
CNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumour necrosis factor receptor
publication title Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Viral protein/cytokine
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3onaB00
1XYIA 2EOTA 3DEPA 1F2LA 2B2UA 2IL8A 5EPJA 4NW2A 2KECA 4QUCA 2KVMA 4U68A 2HCIA 2MPMA 1WD0A 1ILPA 2L9HA 2HDLA 1WTVA 2N88A 1PDQA 2FMMA 1PFMA 1M8AA 1S4ZA 1RHPA 1NCVA 2K04A 4X3KA 2FJ2A 2K1BA 2R3ZA 4ZK9B 1B2TA 3IFDA 2J7ZA 1DOKA 5CBAE 1ZXTA 2VXWA 3Q6SA 4IUUA 1HFGA 1NAPA 2HDMA 2NYZD 1F9QA 1MI2A 1BF4A 2N55A 1X3PA 2B2UC 1EL0A 2BDNA 1F9PA 3G7LA 4O42A 1AZQA 2JYOA 2K03A 1XX8A 3H91A 3TN2A 1WTQA 1ILQA 3I91A 1IKMA 1VMPA 1TVXA 2B2YA 3I8ZA 2L1BA 1QG7A 4LMQD 4MHEA 1WD1A 1BO0A 1MGSA 2NWGA 1U4PA 2DY7A 1BBXC 1WVLA 1ICWA 2FFKB 1HUMA 2HUGA 2K01A 1QNKA 3I90A 4HCSA 4RWSC 5E4XA 2M2LA 1RODA 1NR4A 4R9WA 1B50A 5EKIA 4RA8A 1AP0A 5D14A 2JP1A 2L11A 2SDFA 1WTWA 1Q3LA 2FINB 2RSOA 2B2VC 1DONA 3DEOA 2HCCA 3D6WA 3LWEA 1G6ZA 1G2TA 1SDFA 2B2YC 1HA6A 2K05A 1KNAA 1SSOA 4CJ2C 3ONAB 4X3UA 3N52A 1ML0D 1LV9A 1MSGA 1O7ZA 1C8CA 4OIKA 1CA6A 2X6GA 2B2VA 1RJTA 2MJ8A 5CBEE 1J9OA 1JICA 1DOMA 2B2TC 3DM1A 3QO2A 5EPKA 5T1IA 1J8IA 1IL8A 2EPBA 4CJ1B 1DOLA 1G2SA 3GV3A 1EIHA 1HRJA 1EOTA 3MWYW 3KBXA 3KUPA 5AFWA 4ZKCB 1RTNA 5JJZA 4RAUC 2FHTA 2L4NA 5EPLA 2KOLA 1WTRA 1VMCA 1HHVA 3SVMA 2B2TA 2RVLA 1G91A 4ZLTF 1O80A 3TZDA 1GUWA 1WTPA 2K28A 4X3SA 1X32A 1PFNA 3F2UA 2NZ1D 2XIWA 2Q8TA 2KUMA 1NR2A 1RTOA 2X69A 5D65A 3R93A 3MTSA 1CM9A 3P7JA 4R8IA 3UI2A 1F9SA 1O7YA 5EJWA 4ZAIA 1B53A 1AZPA 5CMDA 4QUFA 3IL8A 1HFNA 4IUVA 4DN4M 3HP3A 4ZKBB 1QE6A 2KEEA 1U4RA 2MP1A 4XDXA 4XT1B 2X6LA 2B2WC 1KNEA 2CVRA 1B3AA 4IUQA 1U4MA 4HAEA 1SAPA 1X3QA 5DNFA 5EQ0A 1PFBA 2Q8RE 4UAIA 1IKLA 2DY8A 1CA5A 4XT3B 3FPUB 5T1GA 1B4OA 1JE4A 2RSNA 1E0BA 5CORA 1A15A 5E4WC 3I3CA 1HUNA 1ESRA 1EIGA 4MN3A 2RA4A 2B2WA 1U4LA 4HEDA 1DZ1A 5COYA 1MSHA 2L12A 1EQTA 4IUTA 1BNZA 2KEDA 3GV6A 4CJ0B 1WTXA 1PLFA 4OIJA 2EE1A 2H1EA 2MGSA 4IURA 4IUPA 1WTOA 4X3TA 2D9UA 1F9RA 3FDTA 4HSVA
chains in the Genus database with same CATH superfamily
3ZJYC 4NW2A 4HTHA 2WINB 1E3PA 3E9HA 4BA2I 4E6IA 3IFTA 1NUCA 4DR1L 3S2HH 1K0RA 4X64Q 4JI1Q 2K1BA 2UXBQ 2CWPA 4LJZC 3MHBA 3I4MG 4DR7Q 4P73A 3M4YA 1YIJA 3TRZA 1VQPA 1TY0A 1AN8A 1MI2A 4JI0L 1EL0A 1PZID 1VQ4A 2YYZA 2F0SA 3H91A 1XX8A 3VYUA 2R93G 2D62A 4A3GH 1U0LA 5GQOA 1BCPD 4F87A 2IW3A 3S2DH 4X64L 4JI1L 2XGTA 1G291 3FVQA 4DR7L 1EUJA 2I5HA 2OTJA 2C5CA 2JXMB 2M2LA 3DHQA 1E1OA 3HRZC 1A0IA 1YVCA 2JP1A 4K14A 4A3EG 3DEOA 3D6WA 1M90C 3HOUH 1JJGA 1HA6A 2K05A 3PCOB 1FNUA 5FO8B 5BN3A 2WAQE 5CV5A 3MFYA 1JMCA 1STHA 2X6GA 4OO1G 1GD7A 1FR3A 2DJGC 1DOMA 3CRLC 1KC8C 1Q1EA 4DXFA 4EX5A 3PO3G 2R61A 4BY1B 3NWTA 2QW7A 5ELOA 2KOLA 1TWHH 1HHVA 3W2DA 5M5WB 4LF5L 3PIPA 3HOZB 2Y0SG 1QCBD 2F0NA 1GUNA 2VB3X 3K5NA 1E1TA 1F9SA 5IP9G 1SE3A 4PMBA 1F2MA 2A74C 2K5DA 2YTYA 1Y1VB 1TWAB 3JAMi 2X6LA 4C3HG 4K5VA 2B29A 1PZKD 1OXUA 4FO2A 4DA2A 2DY8A 5GAGC 4V0BA 1Y14B 2F0IA 3H3VI 1VQ5A 2JA9A 1OO9B 2IT1A 4GN5A 3TP7A 3P75A 4ABNA 5COYA 1OTCA 4IUTA 4KHPQ 4A3LG 3S9WA 3H09A 5IYCH 4GLAC 4DK1A 4H0LC 1GO3E 2DJFC 3KJOA 5ELFA 4KKSA 5FLMH 3S14H 3E0JA 1Y1WG 2ALYB 1H9MA 1PRTF 2L5TA 4K8IA 5KGUA 2NVXH 1ILPA 4PZ6A 1M8AA 4RG1A 2FMCA 4X3KA 2D0OA 1GUOA 4YCWA 5HGQA 3PF5A 1YNJD 3Q6SA 2NZOA 2F0QA 1NAPA 3TQYA 1TS5A 1WCMB 1XNRL 1CKOA 2F3VA 2CCZA 4WJ4A 4O42A 1VQHA 4JVZA 5LMUL 4A3FB 1I4HA 1LTTD 2B2YA 4XIGS 1HJPA 4L5TA 5LMNQ 2EYHA 2RDHA 3H15A 3CCUA 4RWSC 5M3MH 2Y0SE 1ENFA 5L37A 1WTWA 2I07B 1VQJA 5IYDH 1EY0A 4GN4B 5JEAH 2NVTH 3GTKH 3QOJA 2ES2A 1V1OA 1EYAA 1XPRA 4EGVA 3S1QB 5LMNL 3ONAB 2HIXA 2RHQB 3PSIA 3A8IE 4FXKC 4CKEA 1VQ8A 5T1IA 2SOBA 5D3IB 3CW2C 1DOLA 2RBMA 1EWHA 3U4ZA 3GTQB 3J80L 3K59A 2D0PA 2AWNA 2OXPA 1HXYD 3KUPA 4JOIC 5IT9L 5C0XJ 1EWIA 1JE5A 3OIPA 2RVLA 1P8LA 2DNCA 3I4NB 4A3MB 2OEOA 1KLUD 1TQOA 3F2UA 3QG1A 1YITA 5IP7H 1NSNS 1O7YA 4PZ8A 3J81i 2O2LD 1VQMA 3CHBD 2ICEC 4QMGA 3NBIA 2KHIA 3QWNA 2IWHA 3AYHB 2E2IB 2RQXA 4V190 2E2JH 2XSCA 4N8FA 3KF6A 1V1PA 4MN3A 2N8NA 4HEDA 4A3BB 3J7A5 2WACA 4CJ0B 2EE1A 3A55A 3ITPA 4YWKA 4LF4Q 4HSVA 1LTAD 3NTHA 3CQZH 3S15B 1FL0A 1A3UA 2HDLA 2L15A 3MVVA 3UE1A 4GLXA 2B63B 4RMFA 1W3SA 3TEHB 3W3AA 1J5EQ 4NXNQ 1YZ6A 4IOAA 5FLXE 2R3ZA 4GNXB 5C5MA 4DNTB 3RMHA 2HQEA 4LF4L 3EBEA 1F9QA 3E6ZX 1I4XA 1QJOA 3STBC 2E2DC 3X3NA 4FF4A 1ILQA 1X56A 3HOZG 4G7OC 2GA4B 1BBXC 2K6AA 1QVFA 1BXTA 4UP8A 3C1FA 4LAAA 1A63A 4K6DA 1G2TA 1B7YB 1IL2A 3FHWA 1EEID 1VQKA 1CA6A 1A8VA 3S17H 4X65Q 2BH2A 3KBXA 3S1NH 2VS1A 2A8VA 2L4NA 1IBMQ 3I4MH 4LFBQ 2F0MA 1PH5A 2IHFA 2ASBA 1B1ZA 1B70B 3SEBA 2ENBA 3ULLA 3PIP3 4EQOA 3MXPA 3HOWB 5ELBA 4OX9Q 2ZJRA 3MAQA 1B53A 1AZPA 3MXUA 3PMFA 1GUGA 4L5QA 4DN4M 4LFBL 3CKIB 3HOYB 2JA6B 1D8LA 3SHLA 1U4RA 4MTKA 2Z6KC 2AUJD 3H6MA 1SAPA 3NTIA 2R92G 4DR3Q 4B3TQ 1OXTA 2QGQA 4A3DB 4KK7A 1SYGA 4RKBA 5GAHC 4AIMA 3NQIA 1MSHA 1JJ2A 5IGCA 2BDOA 5JOBA 4OO1H 3GTLB 4OIJA 2UU9Q 1S5DD 4N9PA 1HPCA 3TSSA 3RLFA 1TS3A 4DR3L 4B3TL 4QIWB 5I6YA 3TMEA 3PO3H 2KHSA 4NMZA 3J80E 4IUNA 2ICIA 3EVQA 1HR0Q 3SGIA 2RCFA 4POFA 1UE6A 3VR3A 3PQIA 1S4ZA 4L63B 1NCVA 1SFOB 2FJ2A 5ELNA 3JAME 5JEAJ 3HOXG 1E2ZA 3O13A 1XPOA 4XQNA 1PV4A 3J7AF 1SYBA 2EYPA 1ZKOA 5IP9H 4ZUIA 1K83B 1HR0L 4YIJA 1XWEA 2XRQD 1I3QB 1PTOB 3HKSA 3KDFA 4C3HH 3R2IA 3S16H 2Z0SA 3K7AH 2NVQH 1D7QA 2MFIA 1L0YB 2UUCQ 3NELA 1B3QA 1M4VA 2F0JA 1AW7A 4K5XA 4GZYC 4Q5VA 1Z47A 5CGKA 1AP0A 2LMCB 3S24A 1G6ZA 1K3BC 3LWEA 4O0AA 3RLOA 1V8QA 3GTPB 4A3LH 3CCMA 1N36L 1LTGD 2KENA 1SSOA 1PH6A 1QUQA 5IY0A 1C8CA 3UDIA 2F3IA 2UUCL 2MJ8A 3M7NA 1Y1WH 3S1RH 1L1OA 3DM1A 2A6ED 1J8IA 1VF7A 4B3RQ 1MBYA 1YHBA 3GV3A 1EIHA 1PRTC 3MWYW 4A3BG 4HR7B 4UP7A 2Z4HA 1SJHD 1JB3A 3H0GB 2P5ZX 3TZDA 4A3JB 2IX3A 3HOVB 1UE5A 3K80C 1DJRD 1YNXA 1NR2A 2X69A 1XNQQ 4B3RL 1BBUA 4JI8L 3NSWA 2LXJA 3PGZA 1VQBA 4IUVA 4DGZA 1PFSA 1XMOL 2MP1A 2VUMG 2L0CA 4KJNA 1H95A 5M5XB 3RZDH 4X6AH 5EQ0A 1JR0D 3ERQA 1IXRA 1XNQL 4FVMA 4AQYL 3OW7A 4F88A 3I3CA 4RHSA 4BY7H 3EN2A 1BR9A 3TS2A 1VQ6A 2VB2X 3GTGH 3KF6B 4BBRG 1V1PB 1LTLA 2NZHA 4LUZA 3EFXD 3ULPA 4HJAA 1K0SA 2ZTDA 1D5ZC 5HGTA 4JK1C 2RKSA 2MNAA 3CC4A 1F2LA 3S1MB 1SYEA 2KECA 4YY3L 2EJFC 3OSOA 4GN3B 3TP5A 4DUYL 2AQ2B 5CV9A 2ZXRA 2CH4A 2OT2A 3CCJA 5KRUA 1SNDA 3CMEA 4A3IH 1L0XB 2HDMA 5F2DA 1BF4A 4KY7A 2F0WA 3MZ5A 2B2UC 2E75C 3U9OA 3VR4A 2UXCQ 1SE8A 1WD1A 5I9OA 4MHEA 1STGA 1TR5A 2K7VA 4A93B 2ID0A 3GTMH 1MD2D 1B50A 1SNQA 4K6LA 3I55A 2YU9B 1HZCA 2BOSA 1XPUA 4LF6Q 3CRKC 3F8TA 2UXCL 3VR2A 2AWOA 4HJ5A 1JQYD 1F77A 3I70A 4HJ8A 3HOYG 4JOIA 5LL6S 3GQBA 4LF7Q 4LFCL 4IPCA 3CCQA 4Z9CB 1C7YA 1BCPF 5BR8L 4IFDI 1HZ9A 1D5MC 3MFGA 2EVBA 4A3DG 5E3FA 3Q23A 4LF6L 2VQEQ 3CCEA 3WOEA 1UEAB 2RF4A 4JYAQ 2F0VA 2UXDL 4JC0A 1XXGA 2PQEA 4DK3C 2A69C 4LF7L 4DF7A 2YV5A 4KD3A 5IYBH 2WKDA 5EPLA 5DAUA 4WJWA 4C3IG 3A5ZB 1LABA 3MA2B 3CCVA 4IJHA 1Q12A 3NXWA 2VQEL 1K9MC 4K5WA 4Y7NB 4HIKA 4JYAL 2F0PA 2Z6BA 3PO2G 1B9MA 3CD6A 4IPDA 3PUYA 1V9PA 3KLSX 3T1HQ 4JW0A 3HKZE 2N78A 1TWFH 5ISRA 4ALPA 1G51A 5DNFA 5BN4A 4JI7L 1S5BD 1JE4A 1A15A 4ZUJA 5A2QE 3RD4A 1IHZA 1SROA 3A74A 4MNOA 3OWEB 1EY9A 3VR6A 3T1HL 4K2KA 4I7ZC 1VQIA 1TWGB 2D9UA 4P2CB 4C3JG 4AYBE 1CKMA 4LNQA 4DAPA 1HNWL 2H5XA 2AKWB 4ME3A 2F0UA 2NVYB 1WTVA 3NPPA 2XVSA 2HD3A 1GOZA 1X65A 1GUSA 4HMIA 4ZK9B 3FKIG 2J7ZA 3U58A 2VXWA 2K5QA 4IUUA 4UDUC 4JG2A 1H9JA 1TWCB 4C2MH 1RKNA 3CPFA 2F52A 5M5YH 4G7ZC 4FF2A 4A3KB 1EYCA 3TN2A 1K8OA 1IKMA 2EYJA 4M1UB 3QR8A 1T9HA 4A3JG 4QGUA 2UUBQ 2NWGA 4MTNA 2RDGA 1EIYB 4R1JA 2R92H 1RDPD 2K32A 3KDFB 2H4OA 4GNXA 4XQJA 3RN5A 1GHJA 3EIVA 5D14A 3BDLA 1PH2A 2RSOA 1Q1BA 1LO5D 3R2TA 1SDFA 2UUBL 1L0WA 3GTJH 2F0LA 2C9OA 4OL7A 4LF8Q 1O7ZA 1VQLA 2OQKA 2A5HA 3K0YA 1KL9A 1RJTA 1QUQB 1ICFB 1I6HH 3LNNA 1LT6D 5IWAQ 4JI5Q 2UXBL 5K5PA 4C1NK 1L1OB 5LMNW 5JVG3 5IGBA 3HOXH 3QB3A 4OXPA 4LF8L 3SVMA 4I7AA 1O80A 3RZOB 1LM0A 4DV7Q 1VQNA 2DGYA 1MIUA 2HT1A 2F1MA 4JI2Q 1PFNA 1IYVA 3U9SA 4JI5L 3UI2A 2QEXA 4XXEA 3OMCA 5CMDA 1SMYC 3P1HA 4GS3A 1NNXA 2F0HA 4YWLA 2PQAA 4F8MA 4DV7L 2PPBC 2JA8B 4JI2L 5CV4A 3OHXC 1G8ZD 1R4PB 4PMCA 3MEFA 5E1FA 3URYA 2F03A 5CV8A 4EQPA 3D4DA 2ZJQA 1PH8A 3K5LA 1DZ1A 2A6HC 1EQTA 4I65A 4KMUC 5BN5A 3P20A 3J80i 1TT2A 3MXGA 1FYCA 2DNEA 4OEMB 4YCVA 1EY4A 1MHWC 4RGOS 2PI2A 1H9KA 3RLNA 3SK5A 4ID6A 2SNMA 1A3VA 1UE7A 4B3SQ 2K04A 3HZXA 2J4XA 4PQXA 2AHOB 4UP9A 2BA1A 2Z1CA 3JC66 4HCEA 1PYBA 3STBD 5C4ZA 1X54A 1QZHA 1WTQA 1LUZA 2XWBB 3PUWA 1HUNA 2R7FA 2UUAQ 2VUMH 2XRSD 3RNUA 3GO5A 3OYYA 2M9VA 1V43A 3FEWX 5FOBB 5JVH3 2JA5G 1IBLQ 1JWMD 1QB5D 1SYDA 1NR4A 4IN3A 4R9WA 4BXXH 2EXZA 1OXXK 1T5EA 4KHZA 4KHPL 4BBSB 5KYLA 5DM63 3E0EA 2A19A 1BCPB 4BBRH 2UUAL 3D8GA 1B9NA 5C4XG 1EY7A 2F0EA 3PUZA 4OIKA 1QZGA 1IBLL 3TZUA 2F0GA 2B2VA 2JEBI 4DV6Q 1XJVA 4RCNA 2LXKA 3GTOB 3OWFA 4DV2Q 2IY5B 5C3EG 1PTOF 1N34Q 4HJ7A 2B2TA 5C6AA 2R7ZG 1N9WA 2K28A 5JPMC 2MO0A 3UDXA 1LT4D 2B8GA 5D65A 3OW2A 3RN2A 3VA7A 1D6EC 4DV2L 3AMUA 4J15A 3S2HB 4U673 1I94Q 1N34L 1IZ6A 3IL8A 5LHY1 1D5XC 4N8X1 3HP3A 4XT1B 5G3LD 1RL2A 2B2WC 3EROA 2JA7H 2HHHQ 1X9NA 3QOLA 1U9RA 4A3GB 2RSNA 2SEBD 3S2DB 5K36G 1I94L 1TY2A 4C1NI 4KLKA 3QIAA 4DV1Q 1JT8A 2KCMA 3BJUA 2JE6I 2MQHA 4A3DH 2N49A 1EYGA 2K5HA 3M4OH 4R4CA 3DM3A 2KCCA 2HHHL 5M3FH 3HOUB 2B2UA 2IL8A 5EPJA 1PYWD 4F7XA 3CC2A 5I9PA 1I50H 1UE1A 4DAVA 4JI3Q 3D3RA 3JAMc 1PH1A 2KQ3A 1PFMA 4C3IH 3AB9A 4J8QA 3OPOA 3SK8A 3IFDA 2G9HD 4KHVA 5C44H 1Q8KA 3KOJA 3L0OA 3T4AC 1WFQA 2B3GA 2LSSA 2C35B 3CF5A 3PO2H 3M9BA 2LY7A 4JI3L 3LX0A 4A3CG 1DYQA 2K03A 4G57A 3T53B 5I6WA 1TWHB 3E5SA 4LMQD 4P71A 4ME5A 4JBKA 2F4IA 3G4SA 3K58A 2FFKB 3NK9A 5C3XA 2A1AA 1BKBA 2K5WA 1S72A 1STEA 3NQTA 5C3WA 4TVAB 2FINB 1OXSC 3U4VA 2AQ3B 2EYOA 1DONA 1EEFD 2KA7A 2PMZB 3A7LA 2ZTEA 1GJXA 2EY5A 4R4OA 1MSGA 4C3JH 4BY1G 4PV1C 3M7GA 3A56A 1CZWA 2EY1A 2L55A 5C4JH 3L2PA 4NXNL 1J5EL 3R8BA 2WKCA 3PF4A 1Q90A 4KV6A 2PW7A 3DUZA 2QILA 1PRTD 3TP8A 1E7ZA 5AFWA 3FKIH 4OONA 3BVGA 3ER0A 2PNHA 4CDFC 1GUWA 1WTPA 4X3SA 1VQ9A 1J6QA 1ENAA 4IZ8A 3S14B 2Q8IB 2KUMA 1RTOA 1Y1VG 2NVXB 2ATWA 1Y8OB 1JOKA 4LWCA 3RUZA 2KEEA 1MKHA 1UEBA 1IYJB 4HAEA 1GXDC 2K4KA 3BDOA 1HTLD 1SXTA 3W5OA 3NENA 4UAIA 1KAAA 2PQAB 1IW7C 1E2WA 1B4OA 1YJNA 1RCVD 1ESRA 2RA4A 3CCSA 1U4LA 1EY5A 2L12A 4FXGC 1DM0B 2KJXA 5M3MB 4WFN3 2KHJA 2R93H 1A62A 4X65L 2IX0A 3J81c 2NVTB 1IBML 3GTKB 5I2XA 4H13C 2BCOA 1N33Q 3NEMA 4A76A 3J81L 2VQFQ 4FF1A 1WCMG 1PDQA 3SDZA 1D1KA 1EWCA 1KDCA 3FMCA 4KI0A 4A3EH 1RHPA 3C46A 5AJ3Q 4XTCS 4APVA 1DOKA 4OX9L 4A3FG 4B08A 4A75A 2CQAA 2LKVA 1Q7YC 4M8AA 2AMCB 1N33L 2VQFL 2ZT9C 2WB1B 3I8ZA 3V05A 1KQSA 2L1BA 1QG7A 5AJ3L 4LF9Q 3M3YH 1MGSA 1H9SA 3B6YA 4B9XA 1SEBD 1WVLA 1ICWA 4OHJA 3K5OA 5A35A 5E4XA 5IT9E 4DFAA 5IOCA 1YBYA 1R9TH 1D2BA 2UU9L 3BU2A 2EDGA 4LF9L 1PH3A 1K3RA 2NTTA 3N52A 1YNNC 3KFUA 1HZAA 3ND8A 2JK8A 1LTID 2E2JB 2OQ0A 2NBFA 4BA1I 3I4NG 1IL8A 4A3MG 1HQMC 1F2ZA 3NP8A 1ONLA 3A8KE 1A2TA 1FVIA 2F0FA 3E9IA 4GKKQ 2A69D 2FHTA 2CHBD 3D31A 1FNVA 4LFAQ 2JJQA 3F1ZA 4LW1A 2VZAA 1SBBB 2IJ0A 3CQZB 3HOUG 1QVCA 3R93A 1VS0A 3P7JA 1FJGQ 5CC4A 1EU4A 2O5JC 1K8GA 3J7YW 3FP9A 1I4QA 2FXQA 3D0FA 3CU7A 3BS1A 1UNSA 2JA5H 3E3XA 5JJKA 1HFNA 2E8GA 4ZKBB 1LLRD 4XDXA 1O7IA 2PYKA 5KIXA 1HCZA 3DXJC 4JPBW 5HY6A 1QILA 1AEXA 2ZJPA 2QKIC 5IODA 1FJGL 4NP5A 2WAQB 1S3OA 1EIGA 1EY8A 5C4XH 1U5KA 1C48A 1GM5A 3KF8A 1BNZA 1Q81C 3BYYB 2KEDA 2I46A 2H1EA 3T16A 3G48A 2B63G 2E2HH 1TIID 4G7HC 1XYIA 1T5XD 3DEPA 3AU7A 4QUCA 4DNRB 5C3EH 2CW0C 1EZ8A 3H3VH 2R7ZH 1PTOC 3MXNA 3OMGA 4ZRZA 2QCPX 4JBJA 4DPGA 1X3FA 1FGBD 1A2UA 1NMFA 3S17B 2K14A 1F9PA 3DLLA 3S1NB 5GROA 3I4MB 1C4QA 1P16A 2AUKA 1WOCA 1BO0A 4NPSA 3VDYA 4YWMA 3UDFA 1CSPA 4ULLA 2QA4A 3TBIB 4IPGA 3IRBA 1UWVA 4GOPC 1K8AC 2TMPA 3PUVA 3PUXA 2L11A 1JORA 3NE5B 4CDCC 5FKAC 2JQOA 3L9AX 1PVOA 3K5MA 1ML0D 1KABA 3SR1A 2GVAA 4K2LA 1K8MA 2K50A 4JBMA 1CHPD 5EPKA 1SYCA 4HJ9A 1CFMA 4CJ1B 3C2PA 5M9OA 2WFWA 5JJZA 3HOWG 4O2DA 1VMCA 3ERSX 3T13A 4WJ3M 3PO3B 1I6VC 3Q0AA 3NBHA 2JA6G 3WWVA 4A3CH 5D3DA 1L2FA 5EBCA 1GKHA 3W1BA 4HMJA 3EQLC 2A73B 3K0XA 3GP7A 1FGUA 2Y0SB 1E2VA 3KLSA 1SMYD 4J1MA 2NN6I 5IGGA 1SLJA 2OTLA 4QQBX 4QY7A 3L3OC 3I72A 2Q2UA 1XMQQ 1XTCD 4Y52H 1Z9FA 4ZYSA 4YCUA 2Q2TA 3K7UC 2ZM6Q 1LT5D 2WB1G 5E4WC 4C3HB 1O7LA 3S16B 4N9TA 1GHKA 3K7AB 1PH4A 2NVQB 4BY1H 1VQCA 2A6HD 2QDLA 5FO7B 1EQVA 3G6EA 1W2BA 1PLFA 2WIIB 3C1EA 1XMQL 2F3WA 3Q24A 5M5WH 3HOZH 2F0OA 1UUPA 2E5LQ 1YJWA 3A7AB 4P72A 3GDEA 2OWOA 1CI3M 1JJCB 3G6JB 1QVGA 1B2TA 2VY3A 4JV5Q 5CBAE 1Y1WB 3S1RB 3OTOQ 1Y1VH 1TWAH 1HTPA 2N55A 1N8RC 3H94A 1EQRA 2BDNA 3AQQA 4IFDG 2E5LL 2NN6G 2V4DA 1KAWA 4JV5L 4OWTB 4IJLA 5I4DA 4DV4Q 1PXUA 1QNKA 3OTOL 2EYLA 3TREA 1H9SB 1NE3A 5JJIA 1LACA 3I73A 2EIFA 4XYOA 1RD9D 4JI6Q 1Q86C 3DMUA 3D4WA 2KBNA 4IO9A 2B39A 3M4QA 3RZDB 2K75A 1HNXQ 1PHJA 2PZTA 3H0GG 2LFNA 5KEEA 4BY7B 1WCMH 3HOVG 1SE4A 4IALA 1GVPA 2KCNA 4EVOA 2BE5C 3GTGB 2RDFA 4KY6A 4QIWE 4RAUC 4WORA 4RGTA 4A3FH 3VA5A 5C5LA 2DUDA 1HNXL 3HS0C 3EA6A 2XIWA 4R8IA 4DV5Q 1E22A 2G5DA 3DWPA 4P74A 2IPKD 4JI0Q 2TSSA 3WDNA 3T51B 4DV3Q 1II3A 4A3IB 2ZXPA 1SRUA 3X3MA 1HQRD 3S1QH 3OOCA 3H3VC 1LTSD 1U4MA 1V1QA 3T56B 3ULJA 4DV5L 3D4RA 5T1GA 4RHRA 1VDZA 1CT1D 3BG3A 2Z6KA 3GTQH 4DV3L 4OWXB 3GTMB 3HGBA 2LS01 3NUCA 5IWAL 1WTXA 1G6PA 4ODGA 1WTOA 3KF8B 3I4NH 4A3MH 1VQDA 3FDTA 5G3LF 1IBKQ 4POGA 1TS2A 4TRDA 3SXHA 3VYTA 1WD0A 4L8JA 4WRDA 1X6OA 4EQ5A 1NJIC 1CKNA 1HZBA 1I4PA 5DEHA 3SK6A 3MXNB 1IBKL 2CH4W 1YEZA 1WJJA 3RR5A 1EZ6A 2CWAA 3K8AA 4FNFA 4A93G 2E2IH 4LK1C 3CCRA 4LF5Q 2JYOA 4NKLA 1KRTA 4Q0FA 3F2BA 5J22A 5GAEC 1QNUA 4DUZQ 4A3BH 3I90A 5KYIA 5FLXc 4QL5A 5EGTA 1W6JA 4FF3A 2B8FA 1ZYRC 2XNAC 1JC7A 5FLXL 2A68C 1JWUD 4DKAC 3KYHC 1L1OC 1BVSA 2QDBA 3S15H 1BOSA 1TWFB 4UHVA 5DLQE 2B63H 4DUZL 4K0KQ 1CQFA 1CSQA 1Q82C 4L6TB 2PZUA 1CHQD 2VW9A 4CGYB 4B3SL 2EY6A 4RGMA 1EOTA 2NB0A 1RTNA 4NB3A 3I4LA 3KLRA 2CQOA 4K0KL 5IGFA 1EFWA 4NDXA 1FD7D 3TP6A 3AFQA 1SNPA 4H7BA 3CMAA 2JEAI 4XQQA 1MJEA 3KK7A 5CV7A 3NBHB 5GADC 5C4HA 1XNRQ 4TKOB 5FK9C 3V2TA 4DK0A 1QE6A 4MZ9A 3I2ZA 1KNEA 5KNDA 2I5LX 1SR3A 1B3AA 1MJCA 4C2MB 5KNBA 5LMUQ 4L5SA 1Q8IA 1BUVT 5M5YB 1IW7D 4PNYA 3BZCA 2GVBA 3UDGA 1YI2A 1CQVA 3MC0B 4DV6L 2Z8LA 2R92B 4HIMA 4DAYA 4DR2Q 4QCLA 4IURA 4IUPA 5EBDA 2J0TD 2EOTA 1ENCA 3HOWH 1EIFA 3GTJB 2N88A 1HNZQ 2D5DA 5H1SE 4DR2L 4A3KG 3HOYH 3FPPA 2JA6H 1I6HB 4BY7G 1X3PA 2AQ1B 3VYSA 3G7LA 4GOPA 3HG9A 1AZQA 3DWQA 4TQUS 3HOXB 2M00A 3GD7A 1BCPC 3K57A 3J80c 5IT9c 1KIXA 1HNZL 1PMRA 5I2YA 4UY8C 2WP8J 5J1ZA 1S5CD 2XTIA 2N3SA 1TU2B 1TKWB 4JCVE 3GTLH 3KBGA 1PH9A 1BDOA 1A6XA 1I5FA 4DV1L 4FYDA 5KNCA 1PYSB 1Q3LA 3BVMA 3JAML 3CP0A 2F4VQ 3K6OA 3D6CA 1AE3A 1ZEQX 4IQZA 4K8JA 4A3IG 1YNND 1VQFA 1VF5C 1SFOH 5CBEE 1CK1A 1J9OA 1JICA 4DNIA 1HH2P 2K5NA 4IOCA 2F4VL 3UE0A 1DXMA 1YJ9A 1K83H 3VR5A 4QB4A 2Q2IA 1VQGA 1I3QH 1PTOH 1HR0W 4R8NA 2PW5A 2XWJB 2CFMA 1X32A 3PIOA 4IFDH 4QJFA 4KY5A 4ZCKA 2Q8TA 3WOFA 2NN6H 1QWYA 2JA8G 2SNSA 3T1YQ 2BA0A 4QUFA 2OF1A 4DR6Q 4JBWA 3GTPH 3L7ZC 1K73C 3I56A 2ZXOA 5J39A 4IUQA 3TS0A 2HQLA 2JSOA 4FP5D 1JOQA 2EJGC 5IYBG 5CORA 5FJ8G 3T1YL 2VUMB 1NTGA 3CAMA 1KD1C 1ASZA 2XN9C 5C0XI 4DR6L 3W1GA 1X3EA 1X55A 3BDCA 3GV6A 1STYA 1KLGD 5DM73 1PH7A 1E24A 2F0DA 1VQ7A 3H0GH 1AE2A 1F9RA 4B9WA 4A3JH 3HOVH 4BS9A 4BBRB 4ILWA 4U68A 2HCIA 2CW0D 2RCNA 3PV0A 3M85A 5CYUA 3CXCA 4ZQ3A 2I0QA 4HIDA 2EJMA 1PTOD 3I4OA 1EOVA 3F2CA 1YNJC 1CZGA 1JWSD 1EFID 1ZXTA 4HSPA 1HFGA 1CKNB 2NUCA 2NYZD 1XTDA 1BQQT 5M5XH 3KJPA 2QEJC 3HKZB 1ET9A 4GNXC 4IPHA 1STNA 1IYUA 3I91A 4PMWA 1VMPA 4BBSG 1KTKA 4X66Q 1D1IA 4DK6C 1HUMA 3OIQA 4DAMA 4CBVA 4H02A 4DU9A 4HIOA 1LTRD 5IGDA 4PG3A 2ZTCA 3LWUA 4CDEC 5C0XG 2HCCA 1S40A 3S1MH 1VQEA 4AYBB 4TSSA 5FO9B 4X66L 4CJ2C 2NTSA 3U50C 3HFZB 2JA7B 1EYDA 2Z9HA 3ZYYX 1SMXA 2EQSA 2EYFA 1LTBD 2EPBA 2PO4A 4B3MQ 3ND9A 3V96A 4CKBA 3M4OB 2BH8A 5EAYA 5E7NA 1VQAA 3AFPA 5M3FB 1DD2A 4A93H 1KXLA 1I50B 1Z7TA 4KKTA 4EQNA 2YU9H 4B3ML 1PRTB 4G4KA 5EJWA 3NTKA 4QF4A 4C56C 4C3IB 1K28A 1B8AA 2RHSB 4A3GG 5C44B 1R4QB 1A3TA 2CVRA 3VYRA 2HIVA 3PO2B 2Q8RE 1CA5A 3CCLA 3A54A 1RF2D 1E0BA 4S3SA 1CTMA 2KCTA 1C0AA 2DN8A 1KDBA 4R4QA 1B44D 3AEVA 1N36Q 4DAYB 1F2YA 4XYQA 4GKKL 3BVZA 4LFAL 3A8JE 4KN4C 4Y7NH 1I4GA 3NWSA 2L9HA 4OGQC 2QF7A 4C3JB 3A0JA 1EQQA 5C4JB 5A2QL 1WI5A 2F0TA 1NY4A 1QOHA 2E74C 1LT3D 3FKIB 2K52A 1UAPA 1M1KC 3BZDB 1O78A 4GOPB 4RH6A 1U4PA 4JI8Q 2DY7A 2EYMA 2I5MX 1TWGH 1XMOQ 4RA8A 2SDFA 1X3GA 2B2VC 1SN8A 4IFDJ 2B2YC 3IAYA 1S5ED 1KRSA 4R4TA 2NVYH 3EJIA 4AQYQ 4X3UA 1LV9A 4FXDA 3R3OA 5IYCG 1JB7A 3QJYA 2B2TC 2IHEA 3QO2A 5IIFA 4JI4Q 3J7ZC 1HA5A 2EY2A 3J81j 1TWCH 1SNCA 4DR4Q 3G71A 1TS4A 2YTVA 5IGEA 5FLMG 2BE5D 1GUTA 1NBWA 4ZKCB 5HURA 1N32Q 4BWGB 2R93B 4A3KH 4UPAA 1WTRA 4BXXG 5K36H 4YY3Q 1EY6A 1G91A 4ZLTF 3MEHA 1NMGA 3CC7A 5NUCA 4DUYQ 4JI4L 2NZ1D 1I4RA 1Q46A 4PZ7A 4DR4L 3MTSA 1CM9A 3PIO3 5JJLA 1WYDA 4A3EB 1N32L 4DV0Q 1PZJD 3KLWA 1STBA 3IKJA 3J81E 1AH9A 1CUKA 4X62Q 1KDAA 5CR3A 3HKZG 1Y8PB 1SE2A 3DWAA 5M3MG 1Y8NB 1SNMA 1RIPA 4KTAA 2VNUD 2PNRC 5JAVA 3M3YB 4DV0L 2B2WA 5IYDG 2CKZB 4R4IA 5JEAG 2IX1A 2MO1A 3NHHA 3F2DA 4L5RC 1FNWA 1JCKB 2MGSA 4X62L 1WTHA 1R9TB 4X3TA 3LGJA 3Q8DA 3RZOH 4LFCQ 5EKLA 2PMZE 1ET6A 4RGNA 4DR5Q 1S5FD 2KVMA 5BR8Q 4AYBG 2JN4A 2MPMA 1SJED 2Z4IA 1SNOA 3BYTB 2FMMA 3BZKA 4YHHQ 2JA7G 2O5IC 2PZWA 2UXDQ 5JPNC 2JA8H 4DR5L 4KJOA 4KKUA 2K5VA 2V1CC 1ASYA 1JOOA 5IP7G 4YHHL 1BBWA 1TVXA 3J7AV 3I7FA 2ZM6L 4O1NA 4LUVA 5ELCA 5M3FG 4OWWB 2HUGA 3FRPB 2K01A 4HCSA 2MHVA 3SE0A 1RODA 4HN7A 3A5UA 5EKIA 5FJ8H 4MIUA 2G9DA 1ZYRD 1H9RA 3SK4A 4A4IA 1Y69U 1DCZA 2A68D 5CV6A 1Z6HA 2JA5B 2Q2HA 5ELDA 5C44G 4JI7Q 1KHIA 4GLVB 2MUYA 1KNAA 1EU3A 4CDDC 2PCFB 5EKKA 1PA6A 5TSSA 2O4XA 4OELB 1STAA 4RCOA 2D2CC 2YTXA 2A6EC 5C4XB 1G2SA 1SYFA 3Q22A 1HRJA 2R6GA 4RKLA 4J6HA 2R7DA 2F0KA 3TDQA 5LL6X 1YHAA 4NXMQ 2EXDA 1ESFA 1HNWQ 2E76C 1LYLA 3K81C 3HEJA 4GKJQ 2E2HB 1DGSA 2WV6D 5C3EB 2PI2E 5ELEA 3CPWA 1C9OA 4KD4A 4ZAIA 4DV4L 2R7ZB 4BBSH 1W6KA 3M4PA 4DXGA 4NXML 1VCIA 2WAQG 4CHTB 4P75A 3N6RA 4RFBA 4GKJL 1AFPA 4AH6A 1YHQA 4H44C 1X3QA 2WB1E 4JI6L 1PFBA 1IKLA 2VL6A 4FDBA 5C0XH 4XT3B 3FPUB 4KN7C 2EZVA 5IE8A 1TXYA 3GTOH 2GN5A 4DR1Q 1OXVA 2OCEA 3C3LA 3ICEA 2K33A 5J3BA 1VQOA 4CKCA 4LUOA 4OO1I
chains in the Genus database with same CATH topology
4NW2A 4HTHA 2WINB 4BA2I 4E6IA 3IFTA 1NUCA 2K1BA 4LJZC 3MHBA 3M4YA 1TY0A 1AN8A 1MI2A 1EL0A 1PZID 2YYZA 2F0SA 3H91A 1XX8A 3VYUA 2D62A 1BCPD 4F87A 2IW3A 1G291 3FVQA 2C5CA 2JXMB 2M2LA 3DHQA 3HRZC 2JP1A 4K14A 3DEOA 3D6WA 1HA6A 2K05A 1FNUA 5FO8B 5BN3A 5CV5A 3MFYA 1STHA 2X6GA 4OO1G 1FR3A 1DOMA 3CRLC 1Q1EA 4DXFA 2R61A 4BY1B 3NWTA 2KOLA 1HHVA 3W2DA 5M5WB 3HOZB 1QCBD 2F0NA 1GUNA 2VB3X 3K5NA 1F9SA 1SE3A 4PMBA 1F2MA 2A74C 2K5DA 1Y1VB 1TWAB 2X6LA 4C3HG 4K5VA 1PZKD 1OXUA 4FO2A 4DA2A 2DY8A 4V0BA 2F0IA 1OO9B 2IT1A 4ABNA 3TP7A 3P75A 5COYA 4IUTA 3S9WA 3H09A 4DK1A 4H0LC 5ELFA 4KKSA 3E0JA 1H9MA 1PRTF 2L5TA 4K8IA 5KGUA 1ILPA 1M8AA 2FMCA 4X3KA 1GUOA 1YNJD 3Q6SA 2F0QA 1NAPA 1TS5A 1WCMB 2F3VA 4O42A 4A3FB 1I4HA 1LTTD 2B2YA 4XIGS 2EYHA 2RDHA 4RWSC 1ENFA 1WTWA 2I07B 1EY0A 5JEAH 3QOJA 1V1OA 1EYAA 4EGVA 3S1QB 3ONAB 3A8IE 4FXKC 4CKEA 5T1IA 2SOBA 5D3IB 1DOLA 2RBMA 1EWHA 3GTQB 3J80L 3K59A 2OXPA 2AWNA 1HXYD 3KUPA 5IT9L 5C0XJ 3OIPA 2RVLA 2DNCA 3I4NB 4A3MB 2OEOA 1KLUD 1TQOA 3F2UA 3QG1A 1NSNS 1O7YA 2O2LD 3CHBD 2ICEC 4QMGA 3NBIA 3QWNA 2IWHA 2E2IB 2RQXA 4V190 2XSCA 1V1PA 4MN3A 4HEDA 4A3BB 2WACA 4CJ0B 2EE1A 3A55A 3ITPA 4HSVA 1LTAD 3NTHA 3S15B 1A3UA 2HDLA 3MVVA 2B63B 3W3AA 5FLXE 2R3ZA 5C5MA 4DNTB 3RMHA 2HQEA 1F9QA 3E6ZX 1I4XA 1QJOA 2E2DC 3X3NA 4FF4A 1ILQA 4G7OC 2GA4B 1BBXC 2K6AA 1BXTA 3C1FA 4LAAA 4K6DA 1G2TA 1EEID 1CA6A 3KBXA 2L4NA 2F0MA 1B1ZA 3SEBA 2ENBA 3PIP3 4EQOA 3MXPA 3HOWB 5ELBA 3MAQA 1B53A 1AZPA 3MXUA 3PMFA 1GUGA 4DN4M 3CKIB 3HOYB 2JA6B 3SHLA 1U4RA 2AUJD 3H6MA 1SAPA 3NTIA 1OXTA 4A3DB 4KK7A 1SYGA 4RKBA 3NQIA 1MSHA 5IGCA 2BDOA 5JOBA 4OO1H 3GTLB 4OIJA 1S5DD 4N9PA 1HPCA 3TSSA 3RLFA 1TS3A 4QIWB 5I6YA 3TMEA 2KHSA 4NMZA 3J80E 4IUNA 2ICIA 3EVQA 3VR3A 1S4ZA 4L63B 1NCVA 1SFOB 2FJ2A 3JAME 5JEAJ 1E2ZA 3O13A 4XQNA 3J7AF 1SYBA 2EYPA 1ZKOA 4ZUIA 1K83B 4YIJA 1XWEA 2XRQD 1I3QB 1PTOB 3R2IA 1L0YB 1M4VA 2F0JA 1AW7A 4K5XA 4GZYC 4Q5VA 1Z47A 5CGKA 1AP0A 2LMCB 1G6ZA 3LWEA 1V8QA 3GTPB 1LTGD 1SSOA 1C8CA 2MJ8A 3M7NA 3DM1A 2A6ED 1J8IA 1VF7A 1MBYA 3GV3A 1EIHA 1PRTC 3MWYW 4HR7B 2Z4HA 1SJHD 1JB3A 3H0GB 3TZDA 4A3JB 2IX3A 3HOVB 1DJRD 1NR2A 2X69A 3NSWA 4IUVA 4DGZA 2MP1A 2L0CA 4KJNA 5M5XB 5EQ0A 1JR0D 3ERQA 4FVMA 3OW7A 4F88A 3I3CA 4RHSA 1BR9A 2VB2X 1V1PB 3EFXD 1D5ZC 5HGTA 4JK1C 2RKSA 1F2LA 3S1MB 1SYEA 2KECA 2EJFC 3OSOA 3TP5A 2AQ2B 5CV9A 2ZXRA 2OT2A 5KRUA 1SNDA 1L0XB 2HDMA 5F2DA 1BF4A 4KY7A 2F0WA 3MZ5A 2B2UC 2E75C 3U9OA 3VR4A 1WD1A 5I9OA 4MHEA 1STGA 1TR5A 2K7VA 4A93B 2ID0A 1MD2D 1B50A 1SNQA 4K6LA 2YU9B 2BOSA 3CRKC 3VR2A 2AWOA 1JQYD 1F77A 3I70A 5LL6S 3GQBA 4Z9CB 1BCPF 4IFDI 1D5MC 3MFGA 2EVBA 5E3FA 3Q23A 3WOEA 1UEAB 2F0VA 1XXGA 2PQEA 2A69C 4DF7A 4KD3A 2WKDA 5EPLA 5DAUA 4WJWA 4C3IG 1LABA 3MA2B 1Q12A 3NXWA 4K5WA 4Y7NB 2F0PA 1B9MA 3PUYA 3KLSX 5ISRA 5DNFA 5BN4A 1S5BD 1JE4A 1A15A 4ZUJA 5A2QE 3RD4A 1IHZA 3OWEB 1EY9A 3VR6A 4K2KA 4I7ZC 1TWGB 2D9UA 4P2CB 4C3JG 4DAPA 2F0UA 2NVYB 1WTVA 3NPPA 2XVSA 1GOZA 1GUSA 4HMIA 4ZK9B 2J7ZA 4IUUA 2K5QA 2VXWA 4UDUC 1H9JA 1TWCB 1RKNA 4G7ZC 4FF2A 4A3KB 1EYCA 3TN2A 1K8OA 1IKMA 2EYJA 4M1UB 2NWGA 2RDGA 1RDPD 2K32A 2H4OA 4XQJA 1GHJA 5D14A 3BDLA 2RSOA 1Q1BA 1LO5D 3R2TA 1SDFA 2F0LA 2C9OA 4OL7A 1O7ZA 2A5HA 3K0YA 1RJTA 3LNNA 1LT6D 5K5PA 4C1NK 5JVG3 5IGBA 3QB3A 3SVMA 1O80A 3RZOB 2F1MA 1PFNA 1IYVA 3U9SA 3UI2A 4XXEA 3OMCA 5CMDA 1SMYC 3P1HA 2F0HA 4F8MA 2PPBC 2JA8B 5CV4A 3OHXC 1G8ZD 1R4PB 4PMCA 5E1FA 3URYA 2F03A 5CV8A 4EQPA 3D4DA 3K5LA 1DZ1A 2A6HC 1EQTA 4I65A 4KMUC 5BN5A 3P20A 1TT2A 3MXGA 1FYCA 2DNEA 1EY4A 4RGOS 1H9KA 3SK5A 4ID6A 2SNMA 1A3VA 2K04A 3HZXA 2J4XA 4PQXA 2BA1A 2Z1CA 4HCEA 5C4ZA 1WTQA 2XWBB 3PUWA 1HUNA 2XRSD 3GO5A 2M9VA 1V43A 3FEWX 5FOBB 5JVH3 1JWMD 1QB5D 1SYDA 1NR4A 4IN3A 4R9WA 2EXZA 1OXXK 1T5EA 4KHZA 4BBSB 5KYLA 5DM63 1BCPB 3D8GA 1B9NA 1EY7A 2F0EA 3PUZA 4OIKA 3TZUA 2F0GA 2B2VA 2JEBI 4RCNA 3GTOB 3OWFA 1PTOF 2B2TA 5C6AA 2K28A 5JPMC 1LT4D 2B8GA 5D65A 3VA7A 1D6EC 3AMUA 3S2HB 4U673 3IL8A 5LHY1 1D5XC 3HP3A 4XT1B 5G3LD 2B2WC 3EROA 3QOLA 1U9RA 4A3GB 2RSNA 2SEBD 3S2DB 5K36G 1TY2A 4C1NI 3QIAA 2JE6I 2KCCA 3HOUB 2B2UA 2IL8A 5EPJA 1PYWD 4F7XA 5I9PA 4DAVA 3D3RA 2KQ3A 1PFMA 3AB9A 4J8QA 3OPOA 3SK8A 3IFDA 2G9HD 4KHVA 3T4AC 2LY7A 3LX0A 1DYQA 2K03A 4G57A 3T53B 5I6WA 1TWHB 3E5SA 4LMQD 4ME5A 2F4IA 3K58A 2FFKB 3NK9A 5C3XA 2K5WA 1STEA 3NQTA 5C3WA 2FINB 1OXSC 1DONA 2AQ3B 2EYOA 1EEFD 2KA7A 2PMZB 3A7LA 1GJXA 2EY5A 1MSGA 4PV1C 3M7GA 3A56A 1CZWA 2EY1A 2L55A 3R8BA 2WKCA 1Q90A 4KV6A 2PW7A 3DUZA 2QILA 1PRTD 3TP8A 5AFWA 3BVGA 1GUWA 1WTPA 4X3SA 1ENAA 4IZ8A 3S14B 2Q8IB 2KUMA 1RTOA 2NVXB 1Y8OB 1JOKA 3RUZA 2KEEA 4HAEA 1GXDC 3BDOA 1HTLD 1SXTA 4UAIA 1KAAA 1IW7C 1E2WA 1B4OA 1RCVD 1ESRA 2RA4A 1U4LA 1EY5A 2L12A 4FXGC 1DM0B 2KJXA 5M3MB 4WFN3 2IX0A 2NVTB 3GTKB 5I2XA 4H13C 2BCOA 3J81L 4FF1A 1PDQA 3SDZA 1D1KA 1EWCA 1KDCA 3FMCA 4KI0A 3C46A 1RHPA 4XTCS 1DOKA 4B08A 2CQAA 2LKVA 4M8AA 2ZT9C 2WB1B 3I8ZA 3V05A 2L1BA 1QG7A 1MGSA 1H9SA 4B9XA 1SEBD 1WVLA 1ICWA 4OHJA 3K5OA 5A35A 5E4XA 5IT9E 4DFAA 5IOCA 1D2BA 2EDGA 2NTTA 3N52A 1YNNC 3ND8A 1LTID 2E2JB 2NBFA 4BA1I 1IL8A 1HQMC 1F2ZA 3NP8A 1ONLA 3A8KE 1A2TA 2F0FA 2A69D 2FHTA 2CHBD 3D31A 1FNVA 1SBBB 2IJ0A 3CQZB 3R93A 3P7JA 5CC4A 1EU4A 2O5JC 3J7YW 1I4QA 3CU7A 3BS1A 1UNSA 1HFNA 4ZKBB 1LLRD 4XDXA 2PYKA 5KIXA 1HCZA 3DXJC 1QILA 1AEXA 2QKIC 5IODA 4NP5A 2WAQB 1EIGA 1EY8A 1C48A 3KF8A 1BNZA 3BYYB 2KEDA 2I46A 2H1EA 3T16A 1TIID 4G7HC 1XYIA 1T5XD 3DEPA 3AU7A 4QUCA 4DNRB 2CW0C 1EZ8A 1PTOC 3MXNA 3OMGA 4ZRZA 2QCPX 1FGBD 1A2UA 3S17B 1F9PA 3S1NB 3I4MB 1C4QA 2AUKA 1BO0A 4ULLA 3TBIB 2TMPA 3PUVA 3PUXA 2L11A 1JORA 3NE5B 5FKAC 3L9AX 3K5MA 1ML0D 1KABA 3SR1A 4K2LA 1K8MA 1CHPD 5EPKA 1SYCA 1CFMA 4CJ1B 3C2PA 5M9OA 5JJZA 1VMCA 3T13A 3PO3B 1I6VC 3Q0AA 3NBHA 5D3DA 5EBCA 4HMJA 3EQLC 2A73B 3GP7A 2Y0SB 1E2VA 3KLSA 1SMYD 4J1MA 2NN6I 5IGGA 3L3OC 3I72A 1XTCD 4ZYSA 1LT5D 5E4WC 4C3HB 1O7LA 3S16B 4N9TA 1GHKA 3K7AB 2NVQB 2A6HD 5FO7B 1EQVA 1PLFA 2WIIB 3C1EA 2F3WA 3Q24A 2F0OA 1UUPA 3A7AB 1CI3M 3G6JB 1B2TA 5CBAE 1Y1WB 3S1RB 1HTPA 2N55A 3H94A 2BDNA 4IFDG 2NN6G 2V4DA 5I4DA 1PXUA 1QNKA 2EYLA 1H9SB 1LACA 3I73A 4XYOA 1RD9D 3DMUA 3D4WA 2B39A 3RZDB 2PZTA 2LFNA 5KEEA 4BY7B 1SE4A 4IALA 2KCNA 4EVOA 2BE5C 3GTGB 2RDFA 4KY6A 4RAUC 4WORA 4RGTA 3VA5A 5C5LA 3HS0C 3EA6A 2XIWA 4R8IA 3DWPA 2IPKD 2TSSA 3WDNA 3T51B 1II3A 4A3IB 2ZXPA 3X3MA 1HQRD 3OOCA 3H3VC 1LTSD 1U4MA 3T56B 3D4RA 5T1GA 4RHRA 1VDZA 1CT1D 3BG3A 3GTMB 3HGBA 2LS01 3NUCA 1WTXA 4ODGA 1WTOA 5G3LF 3FDTA 1TS2A 4TRDA 3SXHA 3VYTA 1WD0A 4L8JA 4WRDA 1I4PA 5DEHA 3SK6A 1EZ6A 4FNFA 4LK1C 2JYOA 4NKLA 4Q0FA 5J22A 1QNUA 3I90A 5KYIA 5EGTA 1W6JA 4FF3A 2B8FA 1ZYRC 2XNAC 1JC7A 5FLXL 2A68C 1JWUD 2QDBA 1BOSA 1TWFB 1CQFA 4L6TB 2PZUA 1CHQD 4CGYB 2EY6A 4RGMA 1EOTA 2NB0A 1RTNA 3I4LA 3KLRA 5IGFA 4NDXA 1FD7D 3TP6A 1SNPA 4H7BA 2JEAI 4XQQA 3KK7A 5CV7A 5C4HA 4TKOB 5FK9C 3V2TA 4DK0A 1QE6A 5KNDA 1KNEA 4C2MB 5KNBA 1B3AA 1Q8IA 1BUVT 5M5YB 1IW7D 4PNYA 1CQVA 3MC0B 2Z8LA 2R92B 4DAYA 4QCLA 4IURA 4IUPA 5EBDA 2J0TD 2EOTA 1ENCA 3GTJB 2N88A 2D5DA 3FPPA 1I6HB 1X3PA 2AQ1B 3VYSA 3G7LA 3HG9A 1AZQA 3DWQA 4TQUS 3HOXB 2M00A 3GD7A 1BCPC 3K57A 1PMRA 5I2YA 2WP8J 5J1ZA 1S5CD 1TU2B 1TKWB 3KBGA 1BDOA 1A6XA 4FYDA 5KNCA 1Q3LA 3BVMA 3JAML 3K6OA 3D6CA 4IQZA 1ZEQX 4K8JA 1YNND 1VF5C 5CBEE 1CK1A 1J9OA 1JICA 1DXMA 3VR5A 4QB4A 1PTOH 4R8NA 2PW5A 2XWJB 1X32A 4IFDH 4KY5A 2Q8TA 3WOFA 2NN6H 1QWYA 2SNSA 2BA0A 4QUFA 2OF1A 4JBWA 3L7ZC 2ZXOA 5J39A 4IUQA 2JSOA 4FP5D 1JOQA 2EJGC 5CORA 2VUMB 2XN9C 5C0XI 3BDCA 3GV6A 1STYA 1KLGD 5DM73 2F0DA 1F9RA 4B9WA 4BS9A 4BBRB 4ILWA 4U68A 2HCIA 2CW0D 3PV0A 3M85A 5CYUA 4ZQ3A 2EJMA 1PTOD 1YNJC 1CZGA 1JWSD 1EFID 1ZXTA 4HSPA 1HFGA 2NUCA 2NYZD 1BQQT 2QEJC 3HKZB 1ET9A 1STNA 1IYUA 3I91A 4PMWA 1VMPA 1KTKA 1D1IA 1HUMA 3OIQA 4CBVA 4DU9A 1LTRD 5IGDA 3LWUA 5C0XG 2HCCA 4AYBB 4TSSA 5FO9B 4CJ2C 2NTSA 2JA7B 1EYDA 3ZYYX 2EYFA 1LTBD 2EPBA 2PO4A 3ND9A 3V96A 4CKBA 3M4OB 5M3FB 1DD2A 1I50B 1Z7TA 4KKTA 4EQNA 1PRTB 4G4KA 5EJWA 3NTKA 4QF4A 4C56C 4C3IB 5C44B 1R4QB 1A3TA 2CVRA 3VYRA 3PO2B 2Q8RE 1CA5A 3A54A 1RF2D 1E0BA 4S3SA 1CTMA 2DN8A 1KDBA 1B44D 1F2YA 4XYQA 3BVZA 3A8JE 4KN4C 1I4GA 3NWSA 2L9HA 4OGQC 2QF7A 4C3JB 5C4JB 5A2QL 2F0TA 1QOHA 2E74C 1LT3D 3FKIB 1UAPA 3BZDB 1O78A 4RH6A 1U4PA 2DY7A 2EYMA 4RA8A 2SDFA 2B2VC 4IFDJ 2B2YC 3IAYA 1S5ED 3EJIA 4X3UA 1LV9A 4FXDA 3R3OA 3QJYA 2B2TC 3QO2A 5IIFA 1HA5A 2EY2A 1SNCA 1TS4A 5IGEA 2BE5D 1GUTA 4ZKCB 5HURA 4BWGB 2R93B 1WTRA 5K36H 1EY6A 1G91A 4ZLTF 3MEHA 5NUCA 2NZ1D 1I4RA 3MTSA 1CM9A 3PIO3 4A3EB 1PZJD 1STBA 3IKJA 3J81E 1KDAA 5CR3A 1Y8PB 1SE2A 3DWAA 1Y8NB 1SNMA 4KTAA 2VNUD 2PNRC 5JAVA 3M3YB 2B2WA 5JEAG 2IX1A 3NHHA 1FNWA 1JCKB 2MGSA 1R9TB 4X3TA 5EKLA 1ET6A 4RGNA 1S5FD 2KVMA 2MPMA 1SJED 2Z4IA 1SNOA 3BYTB 2FMMA 2O5IC 2PZWA 5JPNC 4KJOA 4KKUA 1JOOA 1TVXA 3J7AV 4O1NA 5ELCA 2HUGA 3FRPB 2K01A 4HCSA 2MHVA 3SE0A 1RODA 4HN7A 5EKIA 4MIUA 2G9DA 1ZYRD 1H9RA 3SK4A 1Y69U 1DCZA 2A68D 5CV6A 1Z6HA 2JA5B 5ELDA 2MUYA 1KNAA 1EU3A 2PCFB 5EKKA 5TSSA 2O4XA 1STAA 4RCOA 2D2CC 2A6EC 5C4XB 1G2SA 1SYFA 3Q22A 1HRJA 2R6GA 4RKLA 4J6HA 2F0KA 3TDQA 5LL6X 1ESFA 2E76C 2E2HB 3HEJA 5C3EB 2WV6D 5ELEA 4KD4A 4ZAIA 2R7ZB 1W6KA 4DXGA 1VCIA 4CHTB 3N6RA 4RFBA 1AFPA 4H44C 1X3QA 1PFBA 1IKLA 5C0XH 4XT3B 3FPUB 4KN7C 2EZVA 1OXVA 3C3LA 2K33A 4CKCA 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XYI A;  2EOT A;  3DEP A;  1F2L A;  2B2U A;  2IL8 A;  5EPJ A;  4NW2 A;  2KEC A;  4QUC A;  2KVM A;  4U68 A;  2HCI A;  2MPM A;  1WD0 A;  1ILP A;  2L9H A;  2HDL A;  1WTV A;  2N88 A;  1PDQ A;  2FMM A;  1PFM A;  1M8A A;  1S4Z A;  1RHP A;  1NCV A;  2K04 A;  4X3K A;  2FJ2 A;  2K1B A;  2R3Z A;  4ZK9 B;  1B2T A;  3IFD A;  2J7Z A;  1DOK A;  5CBA E;  1ZXT A;  2VXW A;  3Q6S A;  4IUU A;  1HFG A;  1NAP A;  2HDM A;  2NYZ D;  1F9Q A;  1MI2 A;  1BF4 A;  2N55 A;  1X3P A;  2B2U C;  1EL0 A;  2BDN A;  1F9P A;  3G7L A;  4O42 A;  1AZQ A;  2JYO A;  2K03 A;  1XX8 A;  3H91 A;  3TN2 A;  1WTQ A;  1ILQ A;  3I91 A;  1IKM A;  1VMP A;  1TVX A;  2B2Y A;  3I8Z A;  2L1B A;  1QG7 A;  4LMQ D;  4MHE A;  1WD1 A;  1BO0 A;  1MGS A;  2NWG A;  1U4P A;  2DY7 A;  1BBX C;  1WVL A;  1ICW A;  2FFK B;  1HUM A;  2HUG A;  2K01 A;  1QNK A;  3I90 A;  4HCS A;  4RWS C;  5E4X A;  2M2L A;  1ROD A;  1NR4 A;  4R9W A;  1B50 A;  5EKI A;  4RA8 A;  1AP0 A;  5D14 A;  2JP1 A;  2L11 A;  2SDF A;  1WTW A;  1Q3L A;  2FIN B;  2RSO A;  2B2V C;  1DON A;  3DEO A;  2HCC A;  3D6W A;  3LWE A;  1G6Z A;  1G2T A;  1SDF A;  2B2Y C;  1HA6 A;  2K05 A;  1KNA A;  1SSO A;  4CJ2 C;  3ONA B;  4X3U A;  3N52 A;  1ML0 D;  1LV9 A;  1MSG A;  1O7Z A;  1C8C A;  4OIK A;  1CA6 A;  2X6G A;  2B2V A;  1RJT A;  2MJ8 A;  5CBE E;  1J9O A;  1JIC A;  1DOM A;  2B2T C;  3DM1 A;  3QO2 A;  5EPK A;  5T1I A;  1J8I A;  1IL8 A;  2EPB A;  4CJ1 B;  1DOL A;  1G2S A;  3GV3 A;  1EIH A;  1HRJ A;  1EOT A;  3MWY W;  3KBX A;  3KUP A;  5AFW A;  4ZKC B;  1RTN A;  5JJZ A;  4RAU C;  2FHT A;  2L4N A;  5EPL A;  2KOL A;  1WTR A;  1VMC A;  1HHV A;  3SVM A;  2B2T A;  2RVL A;  1G91 A;  4ZLT F;  1O80 A;  3TZD A;  1GUW A;  1WTP A;  2K28 A;  4X3S A;  1X32 A;  1PFN A;  3F2U A;  2NZ1 D;  2XIW A;  2Q8T A;  2KUM A;  1NR2 A;  1RTO A;  2X69 A;  5D65 A;  3R93 A;  3MTS A;  1CM9 A;  3P7J A;  4R8I A;  3UI2 A;  1F9S A;  1O7Y A;  5EJW A;  4ZAI A;  1B53 A;  1AZP A;  5CMD A;  4QUF A;  3IL8 A;  1HFN A;  4IUV A;  4DN4 M;  3HP3 A;  4ZKB B;  1QE6 A;  2KEE A;  1U4R A;  2MP1 A;  4XDX A;  4XT1 B;  2X6L A;  2B2W C;  1KNE A;  2CVR A;  1B3A A;  4IUQ A;  1U4M A;  4HAE A;  1SAP A;  1X3Q A;  5DNF A;  5EQ0 A;  1PFB A;  2Q8R E;  4UAI A;  1IKL A;  2DY8 A;  1CA5 A;  4XT3 B;  3FPU B;  5T1G A;  1B4O A;  1JE4 A;  2RSN A;  1E0B A;  5COR A;  1A15 A;  5E4W C;  3I3C A;  1HUN A;  1ESR A;  1EIG A;  4MN3 A;  2RA4 A;  2B2W A;  1U4L A;  4HED A;  1DZ1 A;  5COY A;  1MSH A;  2L12 A;  1EQT A;  4IUT A;  1BNZ A;  2KED A;  3GV6 A;  4CJ0 B;  1WTX A;  1PLF A;  4OIJ A;  2EE1 A;  2H1E A;  2MGS A;  4IUR A;  4IUP A;  1WTO A;  4X3T A;  2D9U A;  1F9R A;  3FDT A;  4HSV A; 
#chains in the Genus database with same CATH topology
 3ZJY C;  4NW2 A;  4HTH A;  2WIN B;  1E3P A;  3E9H A;  4BA2 I;  4E6I A;  3IFT A;  1NUC A;  4DR1 L;  3S2H H;  1K0R A;  4X64 Q;  4JI1 Q;  2K1B A;  2UXB Q;  2CWP A;  4LJZ C;  3MHB A;  3I4M G;  4DR7 Q;  4P73 A;  3M4Y A;  1YIJ A;  3TRZ A;  1VQP A;  1TY0 A;  1AN8 A;  1MI2 A;  4JI0 L;  1EL0 A;  1PZI D;  1VQ4 A;  2YYZ A;  2F0S A;  3H91 A;  1XX8 A;  3VYU A;  2R93 G;  2D62 A;  4A3G H;  1U0L A;  5GQO A;  1BCP D;  4F87 A;  2IW3 A;  3S2D H;  4X64 L;  4JI1 L;  2XGT A;  1G29 1;  3FVQ A;  4DR7 L;  1EUJ A;  2I5H A;  2OTJ A;  2C5C A;  2JXM B;  2M2L A;  3DHQ A;  1E1O A;  3HRZ C;  1A0I A;  1YVC A;  2JP1 A;  4K14 A;  4A3E G;  3DEO A;  3D6W A;  1M90 C;  3HOU H;  1JJG A;  1HA6 A;  2K05 A;  3PCO B;  1FNU A;  5FO8 B;  5BN3 A;  2WAQ E;  5CV5 A;  3MFY A;  1JMC A;  1STH A;  2X6G A;  4OO1 G;  1GD7 A;  1FR3 A;  2DJG C;  1DOM A;  3CRL C;  1KC8 C;  1Q1E A;  4DXF A;  4EX5 A;  3PO3 G;  2R61 A;  4BY1 B;  3NWT A;  2QW7 A;  5ELO A;  2KOL A;  1TWH H;  1HHV A;  3W2D A;  5M5W B;  4LF5 L;  3PIP A;  3HOZ B;  2Y0S G;  1QCB D;  2F0N A;  1GUN A;  2VB3 X;  3K5N A;  1E1T A;  1F9S A;  5IP9 G;  1SE3 A;  4PMB A;  1F2M A;  2A74 C;  2K5D A;  2YTY A;  1Y1V B;  1TWA B;  3JAM i;  2X6L A;  4C3H G;  4K5V A;  2B29 A;  1PZK D;  1OXU A;  4FO2 A;  4DA2 A;  2DY8 A;  5GAG C;  4V0B A;  1Y14 B;  2F0I A;  3H3V I;  1VQ5 A;  2JA9 A;  1OO9 B;  2IT1 A;  4GN5 A;  3TP7 A;  3P75 A;  4ABN A;  5COY A;  1OTC A;  4IUT A;  4KHP Q;  4A3L G;  3S9W A;  3H09 A;  5IYC H;  4GLA C;  4DK1 A;  4H0L C;  1GO3 E;  2DJF C;  3KJO A;  5ELF A;  4KKS A;  5FLM H;  3S14 H;  3E0J A;  1Y1W G;  2ALY B;  1H9M A;  1PRT F;  2L5T A;  4K8I A;  5KGU A;  2NVX H;  1ILP A;  4PZ6 A;  1M8A A;  4RG1 A;  2FMC A;  4X3K A;  2D0O A;  1GUO A;  4YCW A;  5HGQ A;  3PF5 A;  1YNJ D;  3Q6S A;  2NZO A;  2F0Q A;  1NAP A;  3TQY A;  1TS5 A;  1WCM B;  1XNR L;  1CKO A;  2F3V A;  2CCZ A;  4WJ4 A;  4O42 A;  1VQH A;  4JVZ A;  5LMU L;  4A3F B;  1I4H A;  1LTT D;  2B2Y A;  4XIG S;  1HJP A;  4L5T A;  5LMN Q;  2EYH A;  2RDH A;  3H15 A;  3CCU A;  4RWS C;  5M3M H;  2Y0S E;  1ENF A;  5L37 A;  1WTW A;  2I07 B;  1VQJ A;  5IYD H;  1EY0 A;  4GN4 B;  5JEA H;  2NVT H;  3GTK H;  3QOJ A;  2ES2 A;  1V1O A;  1EYA A;  1XPR A;  4EGV A;  3S1Q B;  5LMN L;  3ONA B;  2HIX A;  2RHQ B;  3PSI A;  3A8I E;  4FXK C;  4CKE A;  1VQ8 A;  5T1I A;  2SOB A;  5D3I B;  3CW2 C;  1DOL A;  2RBM A;  1EWH A;  3U4Z A;  3GTQ B;  3J80 L;  3K59 A;  2D0P A;  2AWN A;  2OXP A;  1HXY D;  3KUP A;  4JOI C;  5IT9 L;  5C0X J;  1EWI A;  1JE5 A;  3OIP A;  2RVL A;  1P8L A;  2DNC A;  3I4N B;  4A3M B;  2OEO A;  1KLU D;  1TQO A;  3F2U A;  3QG1 A;  1YIT A;  5IP7 H;  1NSN S;  1O7Y A;  4PZ8 A;  3J81 i;  2O2L D;  1VQM A;  3CHB D;  2ICE C;  4QMG A;  3NBI A;  2KHI A;  3QWN A;  2IWH A;  3AYH B;  2E2I B;  2RQX A;  4V19 0;  2E2J H;  2XSC A;  4N8F A;  3KF6 A;  1V1P A;  4MN3 A;  2N8N A;  4HED A;  4A3B B;  3J7A 5;  2WAC A;  4CJ0 B;  2EE1 A;  3A55 A;  3ITP A;  4YWK A;  4LF4 Q;  4HSV A;  1LTA D;  3NTH A;  3CQZ H;  3S15 B;  1FL0 A;  1A3U A;  2HDL A;  2L15 A;  3MVV A;  3UE1 A;  4GLX A;  2B63 B;  4RMF A;  1W3S A;  3TEH B;  3W3A A;  1J5E Q;  4NXN Q;  1YZ6 A;  4IOA A;  5FLX E;  2R3Z A;  4GNX B;  5C5M A;  4DNT B;  3RMH A;  2HQE A;  4LF4 L;  3EBE A;  1F9Q A;  3E6Z X;  1I4X A;  1QJO A;  3STB C;  2E2D C;  3X3N A;  4FF4 A;  1ILQ A;  1X56 A;  3HOZ G;  4G7O C;  2GA4 B;  1BBX C;  2K6A A;  1QVF A;  1BXT A;  4UP8 A;  3C1F A;  4LAA A;  1A63 A;  4K6D A;  1G2T A;  1B7Y B;  1IL2 A;  3FHW A;  1EEI D;  1VQK A;  1CA6 A;  1A8V A;  3S17 H;  4X65 Q;  2BH2 A;  3KBX A;  3S1N H;  2VS1 A;  2A8V A;  2L4N A;  1IBM Q;  3I4M H;  4LFB Q;  2F0M A;  1PH5 A;  2IHF A;  2ASB A;  1B1Z A;  1B70 B;  3SEB A;  2ENB A;  3ULL A;  3PIP 3;  4EQO A;  3MXP A;  3HOW B;  5ELB A;  4OX9 Q;  2ZJR A;  3MAQ A;  1B53 A;  1AZP A;  3MXU A;  3PMF A;  1GUG A;  4L5Q A;  4DN4 M;  4LFB L;  3CKI B;  3HOY B;  2JA6 B;  1D8L A;  3SHL A;  1U4R A;  4MTK A;  2Z6K C;  2AUJ D;  3H6M A;  1SAP A;  3NTI A;  2R92 G;  4DR3 Q;  4B3T Q;  1OXT A;  2QGQ A;  4A3D B;  4KK7 A;  1SYG A;  4RKB A;  5GAH C;  4AIM A;  3NQI A;  1MSH A;  1JJ2 A;  5IGC A;  2BDO A;  5JOB A;  4OO1 H;  3GTL B;  4OIJ A;  2UU9 Q;  1S5D D;  4N9P A;  1HPC A;  3TSS A;  3RLF A;  1TS3 A;  4DR3 L;  4B3T L;  4QIW B;  5I6Y A;  3TME A;  3PO3 H;  2KHS A;  4NMZ A;  3J80 E;  4IUN A;  2ICI A;  3EVQ A;  1HR0 Q;  3SGI A;  2RCF A;  4POF A;  1UE6 A;  3VR3 A;  3PQI A;  1S4Z A;  4L63 B;  1NCV A;  1SFO B;  2FJ2 A;  5ELN A;  3JAM E;  5JEA J;  3HOX G;  1E2Z A;  3O13 A;  1XPO A;  4XQN A;  1PV4 A;  3J7A F;  1SYB A;  2EYP A;  1ZKO A;  5IP9 H;  4ZUI A;  1K83 B;  1HR0 L;  4YIJ A;  1XWE A;  2XRQ D;  1I3Q B;  1PTO B;  3HKS A;  3KDF A;  4C3H H;  3R2I A;  3S16 H;  2Z0S A;  3K7A H;  2NVQ H;  1D7Q A;  2MFI A;  1L0Y B;  2UUC Q;  3NEL A;  1B3Q A;  1M4V A;  2F0J A;  1AW7 A;  4K5X A;  4GZY C;  4Q5V A;  1Z47 A;  5CGK A;  1AP0 A;  2LMC B;  3S24 A;  1G6Z A;  1K3B C;  3LWE A;  4O0A A;  3RLO A;  1V8Q A;  3GTP B;  4A3L H;  3CCM A;  1N36 L;  1LTG D;  2KEN A;  1SSO A;  1PH6 A;  1QUQ A;  5IY0 A;  1C8C A;  3UDI A;  2F3I A;  2UUC L;  2MJ8 A;  3M7N A;  1Y1W H;  3S1R H;  1L1O A;  3DM1 A;  2A6E D;  1J8I A;  1VF7 A;  4B3R Q;  1MBY A;  1YHB A;  3GV3 A;  1EIH A;  1PRT C;  3MWY W;  4A3B G;  4HR7 B;  4UP7 A;  2Z4H A;  1SJH D;  1JB3 A;  3H0G B;  2P5Z X;  3TZD A;  4A3J B;  2IX3 A;  3HOV B;  1UE5 A;  3K80 C;  1DJR D;  1YNX A;  1NR2 A;  2X69 A;  1XNQ Q;  4B3R L;  1BBU A;  4JI8 L;  3NSW A;  2LXJ A;  3PGZ A;  1VQB A;  4IUV A;  4DGZ A;  1PFS A;  1XMO L;  2MP1 A;  2VUM G;  2L0C A;  4KJN A;  1H95 A;  5M5X B;  3RZD H;  4X6A H;  5EQ0 A;  1JR0 D;  3ERQ A;  1IXR A;  1XNQ L;  4FVM A;  4AQY L;  3OW7 A;  4F88 A;  3I3C A;  4RHS A;  4BY7 H;  3EN2 A;  1BR9 A;  3TS2 A;  1VQ6 A;  2VB2 X;  3GTG H;  3KF6 B;  4BBR G;  1V1P B;  1LTL A;  2NZH A;  4LUZ A;  3EFX D;  3ULP A;  4HJA A;  1K0S A;  2ZTD A;  1D5Z C;  5HGT A;  4JK1 C;  2RKS A;  2MNA A;  3CC4 A;  1F2L A;  3S1M B;  1SYE A;  2KEC A;  4YY3 L;  2EJF C;  3OSO A;  4GN3 B;  3TP5 A;  4DUY L;  2AQ2 B;  5CV9 A;  2ZXR A;  2CH4 A;  2OT2 A;  3CCJ A;  5KRU A;  1SND A;  3CME A;  4A3I H;  1L0X B;  2HDM A;  5F2D A;  1BF4 A;  4KY7 A;  2F0W A;  3MZ5 A;  2B2U C;  2E75 C;  3U9O A;  3VR4 A;  2UXC Q;  1SE8 A;  1WD1 A;  5I9O A;  4MHE A;  1STG A;  1TR5 A;  2K7V A;  4A93 B;  2ID0 A;  3GTM H;  1MD2 D;  1B50 A;  1SNQ A;  4K6L A;  3I55 A;  2YU9 B;  1HZC A;  2BOS A;  1XPU A;  4LF6 Q;  3CRK C;  3F8T A;  2UXC L;  3VR2 A;  2AWO A;  4HJ5 A;  1JQY D;  1F77 A;  3I70 A;  4HJ8 A;  3HOY G;  4JOI A;  5LL6 S;  3GQB A;  4LF7 Q;  4LFC L;  4IPC A;  3CCQ A;  4Z9C B;  1C7Y A;  1BCP F;  5BR8 L;  4IFD I;  1HZ9 A;  1D5M C;  3MFG A;  2EVB A;  4A3D G;  5E3F A;  3Q23 A;  4LF6 L;  2VQE Q;  3CCE A;  3WOE A;  1UEA B;  2RF4 A;  4JYA Q;  2F0V A;  2UXD L;  4JC0 A;  1XXG A;  2PQE A;  4DK3 C;  2A69 C;  4LF7 L;  4DF7 A;  2YV5 A;  4KD3 A;  5IYB H;  2WKD A;  5EPL A;  5DAU A;  4WJW A;  4C3I G;  3A5Z B;  1LAB A;  3MA2 B;  3CCV A;  4IJH A;  1Q12 A;  3NXW A;  2VQE L;  1K9M C;  4K5W A;  4Y7N B;  4HIK A;  4JYA L;  2F0P A;  2Z6B A;  3PO2 G;  1B9M A;  3CD6 A;  4IPD A;  3PUY A;  1V9P A;  3KLS X;  3T1H Q;  4JW0 A;  3HKZ E;  2N78 A;  1TWF H;  5ISR A;  4ALP A;  1G51 A;  5DNF A;  5BN4 A;  4JI7 L;  1S5B D;  1JE4 A;  1A15 A;  4ZUJ A;  5A2Q E;  3RD4 A;  1IHZ A;  1SRO A;  3A74 A;  4MNO A;  3OWE B;  1EY9 A;  3VR6 A;  3T1H L;  4K2K A;  4I7Z C;  1VQI A;  1TWG B;  2D9U A;  4P2C B;  4C3J G;  4AYB E;  1CKM A;  4LNQ A;  4DAP A;  1HNW L;  2H5X A;  2AKW B;  4ME3 A;  2F0U A;  2NVY B;  1WTV A;  3NPP A;  2XVS A;  2HD3 A;  1GOZ A;  1X65 A;  1GUS A;  4HMI A;  4ZK9 B;  3FKI G;  2J7Z A;  3U58 A;  2VXW A;  2K5Q A;  4IUU A;  4UDU C;  4JG2 A;  1H9J A;  1TWC B;  4C2M H;  1RKN A;  3CPF A;  2F52 A;  5M5Y H;  4G7Z C;  4FF2 A;  4A3K B;  1EYC A;  3TN2 A;  1K8O A;  1IKM A;  2EYJ A;  4M1U B;  3QR8 A;  1T9H A;  4A3J G;  4QGU A;  2UUB Q;  2NWG A;  4MTN A;  2RDG A;  1EIY B;  4R1J A;  2R92 H;  1RDP D;  2K32 A;  3KDF B;  2H4O A;  4GNX A;  4XQJ A;  3RN5 A;  1GHJ A;  3EIV A;  5D14 A;  3BDL A;  1PH2 A;  2RSO A;  1Q1B A;  1LO5 D;  3R2T A;  1SDF A;  2UUB L;  1L0W A;  3GTJ H;  2F0L A;  2C9O A;  4OL7 A;  4LF8 Q;  1O7Z A;  1VQL A;  2OQK A;  2A5H A;  3K0Y A;  1KL9 A;  1RJT A;  1QUQ B;  1ICF B;  1I6H H;  3LNN A;  1LT6 D;  5IWA Q;  4JI5 Q;  2UXB L;  5K5P A;  4C1N K;  1L1O B;  5LMN W;  5JVG 3;  5IGB A;  3HOX H;  3QB3 A;  4OXP A;  4LF8 L;  3SVM A;  4I7A A;  1O80 A;  3RZO B;  1LM0 A;  4DV7 Q;  1VQN A;  2DGY A;  1MIU A;  2HT1 A;  2F1M A;  4JI2 Q;  1PFN A;  1IYV A;  3U9S A;  4JI5 L;  3UI2 A;  2QEX A;  4XXE A;  3OMC A;  5CMD A;  1SMY C;  3P1H A;  4GS3 A;  1NNX A;  2F0H A;  4YWL A;  2PQA A;  4F8M A;  4DV7 L;  2PPB C;  2JA8 B;  4JI2 L;  5CV4 A;  3OHX C;  1G8Z D;  1R4P B;  4PMC A;  3MEF A;  5E1F A;  3URY A;  2F03 A;  5CV8 A;  4EQP A;  3D4D A;  2ZJQ A;  1PH8 A;  3K5L A;  1DZ1 A;  2A6H C;  1EQT A;  4I65 A;  4KMU C;  5BN5 A;  3P20 A;  3J80 i;  1TT2 A;  3MXG A;  1FYC A;  2DNE A;  4OEM B;  4YCV A;  1EY4 A;  1MHW C;  4RGO S;  2PI2 A;  1H9K A;  3RLN A;  3SK5 A;  4ID6 A;  2SNM A;  1A3V A;  1UE7 A;  4B3S Q;  2K04 A;  3HZX A;  2J4X A;  4PQX A;  2AHO B;  4UP9 A;  2BA1 A;  2Z1C A;  3JC6 6;  4HCE A;  1PYB A;  3STB D;  5C4Z A;  1X54 A;  1QZH A;  1WTQ A;  1LUZ A;  2XWB B;  3PUW A;  1HUN A;  2R7F A;  2UUA Q;  2VUM H;  2XRS D;  3RNU A;  3GO5 A;  3OYY A;  2M9V A;  1V43 A;  3FEW X;  5FOB B;  5JVH 3;  2JA5 G;  1IBL Q;  1JWM D;  1QB5 D;  1SYD A;  1NR4 A;  4IN3 A;  4R9W A;  4BXX H;  2EXZ A;  1OXX K;  1T5E A;  4KHZ A;  4KHP L;  4BBS B;  5KYL A;  5DM6 3;  3E0E A;  2A19 A;  1BCP B;  4BBR H;  2UUA L;  3D8G A;  1B9N A;  5C4X G;  1EY7 A;  2F0E A;  3PUZ A;  4OIK A;  1QZG A;  1IBL L;  3TZU A;  2F0G A;  2B2V A;  2JEB I;  4DV6 Q;  1XJV A;  4RCN A;  2LXK A;  3GTO B;  3OWF A;  4DV2 Q;  2IY5 B;  5C3E G;  1PTO F;  1N34 Q;  4HJ7 A;  2B2T A;  5C6A A;  2R7Z G;  1N9W A;  2K28 A;  5JPM C;  2MO0 A;  3UDX A;  1LT4 D;  2B8G A;  5D65 A;  3OW2 A;  3RN2 A;  3VA7 A;  1D6E C;  4DV2 L;  3AMU A;  4J15 A;  3S2H B;  4U67 3;  1I94 Q;  1N34 L;  1IZ6 A;  3IL8 A;  5LHY 1;  1D5X C;  4N8X 1;  3HP3 A;  4XT1 B;  5G3L D;  1RL2 A;  2B2W C;  3ERO A;  2JA7 H;  2HHH Q;  1X9N A;  3QOL A;  1U9R A;  4A3G B;  2RSN A;  2SEB D;  3S2D B;  5K36 G;  1I94 L;  1TY2 A;  4C1N I;  4KLK A;  3QIA A;  4DV1 Q;  1JT8 A;  2KCM A;  3BJU A;  2JE6 I;  2MQH A;  4A3D H;  2N49 A;  1EYG A;  2K5H A;  3M4O H;  4R4C A;  3DM3 A;  2KCC A;  2HHH L;  5M3F H;  3HOU B;  2B2U A;  2IL8 A;  5EPJ A;  1PYW D;  4F7X A;  3CC2 A;  5I9P A;  1I50 H;  1UE1 A;  4DAV A;  4JI3 Q;  3D3R A;  3JAM c;  1PH1 A;  2KQ3 A;  1PFM A;  4C3I H;  3AB9 A;  4J8Q A;  3OPO A;  3SK8 A;  3IFD A;  2G9H D;  4KHV A;  5C44 H;  1Q8K A;  3KOJ A;  3L0O A;  3T4A C;  1WFQ A;  2B3G A;  2LSS A;  2C35 B;  3CF5 A;  3PO2 H;  3M9B A;  2LY7 A;  4JI3 L;  3LX0 A;  4A3C G;  1DYQ A;  2K03 A;  4G57 A;  3T53 B;  5I6W A;  1TWH B;  3E5S A;  4LMQ D;  4P71 A;  4ME5 A;  4JBK A;  2F4I A;  3G4S A;  3K58 A;  2FFK B;  3NK9 A;  5C3X A;  2A1A A;  1BKB A;  2K5W A;  1S72 A;  1STE A;  3NQT A;  5C3W A;  4TVA B;  2FIN B;  1OXS C;  3U4V A;  2AQ3 B;  2EYO A;  1DON A;  1EEF D;  2KA7 A;  2PMZ B;  3A7L A;  2ZTE A;  1GJX A;  2EY5 A;  4R4O A;  1MSG A;  4C3J H;  4BY1 G;  4PV1 C;  3M7G A;  3A56 A;  1CZW A;  2EY1 A;  2L55 A;  5C4J H;  3L2P A;  4NXN L;  1J5E L;  3R8B A;  2WKC A;  3PF4 A;  1Q90 A;  4KV6 A;  2PW7 A;  3DUZ A;  2QIL A;  1PRT D;  3TP8 A;  1E7Z A;  5AFW A;  3FKI H;  4OON A;  3BVG A;  3ER0 A;  2PNH A;  4CDF C;  1GUW A;  1WTP A;  4X3S A;  1VQ9 A;  1J6Q A;  1ENA A;  4IZ8 A;  3S14 B;  2Q8I B;  2KUM A;  1RTO A;  1Y1V G;  2NVX B;  2ATW A;  1Y8O B;  1JOK A;  4LWC A;  3RUZ A;  2KEE A;  1MKH A;  1UEB A;  1IYJ B;  4HAE A;  1GXD C;  2K4K A;  3BDO A;  1HTL D;  1SXT A;  3W5O A;  3NEN A;  4UAI A;  1KAA A;  2PQA B;  1IW7 C;  1E2W A;  1B4O A;  1YJN A;  1RCV D;  1ESR A;  2RA4 A;  3CCS A;  1U4L A;  1EY5 A;  2L12 A;  4FXG C;  1DM0 B;  2KJX A;  5M3M B;  4WFN 3;  2KHJ A;  2R93 H;  1A62 A;  4X65 L;  2IX0 A;  3J81 c;  2NVT B;  1IBM L;  3GTK B;  5I2X A;  4H13 C;  2BCO A;  1N33 Q;  3NEM A;  4A76 A;  3J81 L;  2VQF Q;  4FF1 A;  1WCM G;  1PDQ A;  3SDZ A;  1D1K A;  1EWC A;  1KDC A;  3FMC A;  4KI0 A;  4A3E H;  1RHP A;  3C46 A;  5AJ3 Q;  4XTC S;  4APV A;  1DOK A;  4OX9 L;  4A3F G;  4B08 A;  4A75 A;  2CQA A;  2LKV A;  1Q7Y C;  4M8A A;  2AMC B;  1N33 L;  2VQF L;  2ZT9 C;  2WB1 B;  3I8Z A;  3V05 A;  1KQS A;  2L1B A;  1QG7 A;  5AJ3 L;  4LF9 Q;  3M3Y H;  1MGS A;  1H9S A;  3B6Y A;  4B9X A;  1SEB D;  1WVL A;  1ICW A;  4OHJ A;  3K5O A;  5A35 A;  5E4X A;  5IT9 E;  4DFA A;  5IOC A;  1YBY A;  1R9T H;  1D2B A;  2UU9 L;  3BU2 A;  2EDG A;  4LF9 L;  1PH3 A;  1K3R A;  2NTT A;  3N52 A;  1YNN C;  3KFU A;  1HZA A;  3ND8 A;  2JK8 A;  1LTI D;  2E2J B;  2OQ0 A;  2NBF A;  4BA1 I;  3I4N G;  1IL8 A;  4A3M G;  1HQM C;  1F2Z A;  3NP8 A;  1ONL A;  3A8K E;  1A2T A;  1FVI A;  2F0F A;  3E9I A;  4GKK Q;  2A69 D;  2FHT A;  2CHB D;  3D31 A;  1FNV A;  4LFA Q;  2JJQ A;  3F1Z A;  4LW1 A;  2VZA A;  1SBB B;  2IJ0 A;  3CQZ B;  3HOU G;  1QVC A;  3R93 A;  1VS0 A;  3P7J A;  1FJG Q;  5CC4 A;  1EU4 A;  2O5J C;  1K8G A;  3J7Y W;  3FP9 A;  1I4Q A;  2FXQ A;  3D0F A;  3CU7 A;  3BS1 A;  1UNS A;  2JA5 H;  3E3X A;  5JJK A;  1HFN A;  2E8G A;  4ZKB B;  1LLR D;  4XDX A;  1O7I A;  2PYK A;  5KIX A;  1HCZ A;  3DXJ C;  4JPB W;  5HY6 A;  1QIL A;  1AEX A;  2ZJP A;  2QKI C;  5IOD A;  1FJG L;  4NP5 A;  2WAQ B;  1S3O A;  1EIG A;  1EY8 A;  5C4X H;  1U5K A;  1C48 A;  1GM5 A;  3KF8 A;  1BNZ A;  1Q81 C;  3BYY B;  2KED A;  2I46 A;  2H1E A;  3T16 A;  3G48 A;  2B63 G;  2E2H H;  1TII D;  4G7H C;  1XYI A;  1T5X D;  3DEP A;  3AU7 A;  4QUC A;  4DNR B;  5C3E H;  2CW0 C;  1EZ8 A;  3H3V H;  2R7Z H;  1PTO C;  3MXN A;  3OMG A;  4ZRZ A;  2QCP X;  4JBJ A;  4DPG A;  1X3F A;  1FGB D;  1A2U A;  1NMF A;  3S17 B;  2K14 A;  1F9P A;  3DLL A;  3S1N B;  5GRO A;  3I4M B;  1C4Q A;  1P16 A;  2AUK A;  1WOC A;  1BO0 A;  4NPS A;  3VDY A;  4YWM A;  3UDF A;  1CSP A;  4ULL A;  2QA4 A;  3TBI B;  4IPG A;  3IRB A;  1UWV A;  4GOP C;  1K8A C;  2TMP A;  3PUV A;  3PUX A;  2L11 A;  1JOR A;  3NE5 B;  4CDC C;  5FKA C;  2JQO A;  3L9A X;  1PVO A;  3K5M A;  1ML0 D;  1KAB A;  3SR1 A;  2GVA A;  4K2L A;  1K8M A;  2K50 A;  4JBM A;  1CHP D;  5EPK A;  1SYC A;  4HJ9 A;  1CFM A;  4CJ1 B;  3C2P A;  5M9O A;  2WFW A;  5JJZ A;  3HOW G;  4O2D A;  1VMC A;  3ERS X;  3T13 A;  4WJ3 M;  3PO3 B;  1I6V C;  3Q0A A;  3NBH A;  2JA6 G;  3WWV A;  4A3C H;  5D3D A;  1L2F A;  5EBC A;  1GKH A;  3W1B A;  4HMJ A;  3EQL C;  2A73 B;  3K0X A;  3GP7 A;  1FGU A;  2Y0S B;  1E2V A;  3KLS A;  1SMY D;  4J1M A;  2NN6 I;  5IGG A;  1SLJ A;  2OTL A;  4QQB X;  4QY7 A;  3L3O C;  3I72 A;  2Q2U A;  1XMQ Q;  1XTC D;  4Y52 H;  1Z9F A;  4ZYS A;  4YCU A;  2Q2T A;  3K7U C;  2ZM6 Q;  1LT5 D;  2WB1 G;  5E4W C;  4C3H B;  1O7L A;  3S16 B;  4N9T A;  1GHK A;  3K7A B;  1PH4 A;  2NVQ B;  4BY1 H;  1VQC A;  2A6H D;  2QDL A;  5FO7 B;  1EQV A;  3G6E A;  1W2B A;  1PLF A;  2WII B;  3C1E A;  1XMQ L;  2F3W A;  3Q24 A;  5M5W H;  3HOZ H;  2F0O A;  1UUP A;  2E5L Q;  1YJW A;  3A7A B;  4P72 A;  3GDE A;  2OWO A;  1CI3 M;  1JJC B;  3G6J B;  1QVG A;  1B2T A;  2VY3 A;  4JV5 Q;  5CBA E;  1Y1W B;  3S1R B;  3OTO Q;  1Y1V H;  1TWA H;  1HTP A;  2N55 A;  1N8R C;  3H94 A;  1EQR A;  2BDN A;  3AQQ A;  4IFD G;  2E5L L;  2NN6 G;  2V4D A;  1KAW A;  4JV5 L;  4OWT B;  4IJL A;  5I4D A;  4DV4 Q;  1PXU A;  1QNK A;  3OTO L;  2EYL A;  3TRE A;  1H9S B;  1NE3 A;  5JJI A;  1LAC A;  3I73 A;  2EIF A;  4XYO A;  1RD9 D;  4JI6 Q;  1Q86 C;  3DMU A;  3D4W A;  2KBN A;  4IO9 A;  2B39 A;  3M4Q A;  3RZD B;  2K75 A;  1HNX Q;  1PHJ A;  2PZT A;  3H0G G;  2LFN A;  5KEE A;  4BY7 B;  1WCM H;  3HOV G;  1SE4 A;  4IAL A;  1GVP A;  2KCN A;  4EVO A;  2BE5 C;  3GTG B;  2RDF A;  4KY6 A;  4QIW E;  4RAU C;  4WOR A;  4RGT A;  4A3F H;  3VA5 A;  5C5L A;  2DUD A;  1HNX L;  3HS0 C;  3EA6 A;  2XIW A;  4R8I A;  4DV5 Q;  1E22 A;  2G5D A;  3DWP A;  4P74 A;  2IPK D;  4JI0 Q;  2TSS A;  3WDN A;  3T51 B;  4DV3 Q;  1II3 A;  4A3I B;  2ZXP A;  1SRU A;  3X3M A;  1HQR D;  3S1Q H;  3OOC A;  3H3V C;  1LTS D;  1U4M A;  1V1Q A;  3T56 B;  3ULJ A;  4DV5 L;  3D4R A;  5T1G A;  4RHR A;  1VDZ A;  1CT1 D;  3BG3 A;  2Z6K A;  3GTQ H;  4DV3 L;  4OWX B;  3GTM B;  3HGB A;  2LS0 1;  3NUC A;  5IWA L;  1WTX A;  1G6P A;  4ODG A;  1WTO A;  3KF8 B;  3I4N H;  4A3M H;  1VQD A;  3FDT A;  5G3L F;  1IBK Q;  4POG A;  1TS2 A;  4TRD A;  3SXH A;  3VYT A;  1WD0 A;  4L8J A;  4WRD A;  1X6O A;  4EQ5 A;  1NJI C;  1CKN A;  1HZB A;  1I4P A;  5DEH A;  3SK6 A;  3MXN B;  1IBK L;  2CH4 W;  1YEZ A;  1WJJ A;  3RR5 A;  1EZ6 A;  2CWA A;  3K8A A;  4FNF A;  4A93 G;  2E2I H;  4LK1 C;  3CCR A;  4LF5 Q;  2JYO A;  4NKL A;  1KRT A;  4Q0F A;  3F2B A;  5J22 A;  5GAE C;  1QNU A;  4DUZ Q;  4A3B H;  3I90 A;  5KYI A;  5FLX c;  4QL5 A;  5EGT A;  1W6J A;  4FF3 A;  2B8F A;  1ZYR C;  2XNA C;  1JC7 A;  5FLX L;  2A68 C;  1JWU D;  4DKA C;  3KYH C;  1L1O C;  1BVS A;  2QDB A;  3S15 H;  1BOS A;  1TWF B;  4UHV A;  5DLQ E;  2B63 H;  4DUZ L;  4K0K Q;  1CQF A;  1CSQ A;  1Q82 C;  4L6T B;  2PZU A;  1CHQ D;  2VW9 A;  4CGY B;  4B3S L;  2EY6 A;  4RGM A;  1EOT A;  2NB0 A;  1RTN A;  4NB3 A;  3I4L A;  3KLR A;  2CQO A;  4K0K L;  5IGF A;  1EFW A;  4NDX A;  1FD7 D;  3TP6 A;  3AFQ A;  1SNP A;  4H7B A;  3CMA A;  2JEA I;  4XQQ A;  1MJE A;  3KK7 A;  5CV7 A;  3NBH B;  5GAD C;  5C4H A;  1XNR Q;  4TKO B;  5FK9 C;  3V2T A;  4DK0 A;  1QE6 A;  4MZ9 A;  3I2Z A;  1KNE A;  5KND A;  2I5L X;  1SR3 A;  1B3A A;  1MJC A;  4C2M B;  5KNB A;  5LMU Q;  4L5S A;  1Q8I A;  1BUV T;  5M5Y B;  1IW7 D;  4PNY A;  3BZC A;  2GVB A;  3UDG A;  1YI2 A;  1CQV A;  3MC0 B;  4DV6 L;  2Z8L A;  2R92 B;  4HIM A;  4DAY A;  4DR2 Q;  4QCL A;  4IUR A;  4IUP A;  5EBD A;  2J0T D;  2EOT A;  1ENC A;  3HOW H;  1EIF A;  3GTJ B;  2N88 A;  1HNZ Q;  2D5D A;  5H1S E;  4DR2 L;  4A3K G;  3HOY H;  3FPP A;  2JA6 H;  1I6H B;  4BY7 G;  1X3P A;  2AQ1 B;  3VYS A;  3G7L A;  4GOP A;  3HG9 A;  1AZQ A;  3DWQ A;  4TQU S;  3HOX B;  2M00 A;  3GD7 A;  1BCP C;  3K57 A;  3J80 c;  5IT9 c;  1KIX A;  1HNZ L;  1PMR A;  5I2Y A;  4UY8 C;  2WP8 J;  5J1Z A;  1S5C D;  2XTI A;  2N3S A;  1TU2 B;  1TKW B;  4JCV E;  3GTL H;  3KBG A;  1PH9 A;  1BDO A;  1A6X A;  1I5F A;  4DV1 L;  4FYD A;  5KNC A;  1PYS B;  1Q3L A;  3BVM A;  3JAM L;  3CP0 A;  2F4V Q;  3K6O A;  3D6C A;  1AE3 A;  1ZEQ X;  4IQZ A;  4K8J A;  4A3I G;  1YNN D;  1VQF A;  1VF5 C;  1SFO H;  5CBE E;  1CK1 A;  1J9O A;  1JIC A;  4DNI A;  1HH2 P;  2K5N A;  4IOC A;  2F4V L;  3UE0 A;  1DXM A;  1YJ9 A;  1K83 H;  3VR5 A;  4QB4 A;  2Q2I A;  1VQG A;  1I3Q H;  1PTO H;  1HR0 W;  4R8N A;  2PW5 A;  2XWJ B;  2CFM A;  1X32 A;  3PIO A;  4IFD H;  4QJF A;  4KY5 A;  4ZCK A;  2Q8T A;  3WOF A;  2NN6 H;  1QWY A;  2JA8 G;  2SNS A;  3T1Y Q;  2BA0 A;  4QUF A;  2OF1 A;  4DR6 Q;  4JBW A;  3GTP H;  3L7Z C;  1K73 C;  3I56 A;  2ZXO A;  5J39 A;  4IUQ A;  3TS0 A;  2HQL A;  2JSO A;  4FP5 D;  1JOQ A;  2EJG C;  5IYB G;  5COR A;  5FJ8 G;  3T1Y L;  2VUM B;  1NTG A;  3CAM A;  1KD1 C;  1ASZ A;  2XN9 C;  5C0X I;  4DR6 L;  3W1G A;  1X3E A;  1X55 A;  3BDC A;  3GV6 A;  1STY A;  1KLG D;  5DM7 3;  1PH7 A;  1E24 A;  2F0D A;  1VQ7 A;  3H0G H;  1AE2 A;  1F9R A;  4B9W A;  4A3J H;  3HOV H;  4BS9 A;  4BBR B;  4ILW A;  4U68 A;  2HCI A;  2CW0 D;  2RCN A;  3PV0 A;  3M85 A;  5CYU A;  3CXC A;  4ZQ3 A;  2I0Q A;  4HID A;  2EJM A;  1PTO D;  3I4O A;  1EOV A;  3F2C A;  1YNJ C;  1CZG A;  1JWS D;  1EFI D;  1ZXT A;  4HSP A;  1HFG A;  1CKN B;  2NUC A;  2NYZ D;  1XTD A;  1BQQ T;  5M5X H;  3KJP A;  2QEJ C;  3HKZ B;  1ET9 A;  4GNX C;  4IPH A;  1STN A;  1IYU A;  3I91 A;  4PMW A;  1VMP A;  4BBS G;  1KTK A;  4X66 Q;  1D1I A;  4DK6 C;  1HUM A;  3OIQ A;  4DAM A;  4CBV A;  4H02 A;  4DU9 A;  4HIO A;  1LTR D;  5IGD A;  4PG3 A;  2ZTC A;  3LWU A;  4CDE C;  5C0X G;  2HCC A;  1S40 A;  3S1M H;  1VQE A;  4AYB B;  4TSS A;  5FO9 B;  4X66 L;  4CJ2 C;  2NTS A;  3U50 C;  3HFZ B;  2JA7 B;  1EYD A;  2Z9H A;  3ZYY X;  1SMX A;  2EQS A;  2EYF A;  1LTB D;  2EPB A;  2PO4 A;  4B3M Q;  3ND9 A;  3V96 A;  4CKB A;  3M4O B;  2BH8 A;  5EAY A;  5E7N A;  1VQA A;  3AFP A;  5M3F B;  1DD2 A;  4A93 H;  1KXL A;  1I50 B;  1Z7T A;  4KKT A;  4EQN A;  2YU9 H;  4B3M L;  1PRT B;  4G4K A;  5EJW A;  3NTK A;  4QF4 A;  4C56 C;  4C3I B;  1K28 A;  1B8A A;  2RHS B;  4A3G G;  5C44 B;  1R4Q B;  1A3T A;  2CVR A;  3VYR A;  2HIV A;  3PO2 B;  2Q8R E;  1CA5 A;  3CCL A;  3A54 A;  1RF2 D;  1E0B A;  4S3S A;  1CTM A;  2KCT A;  1C0A A;  2DN8 A;  1KDB A;  4R4Q A;  1B44 D;  3AEV A;  1N36 Q;  4DAY B;  1F2Y A;  4XYQ A;  4GKK L;  3BVZ A;  4LFA L;  3A8J E;  4KN4 C;  4Y7N H;  1I4G A;  3NWS A;  2L9H A;  4OGQ C;  2QF7 A;  4C3J B;  3A0J A;  1EQQ A;  5C4J B;  5A2Q L;  1WI5 A;  2F0T A;  1NY4 A;  1QOH A;  2E74 C;  1LT3 D;  3FKI B;  2K52 A;  1UAP A;  1M1K C;  3BZD B;  1O78 A;  4GOP B;  4RH6 A;  1U4P A;  4JI8 Q;  2DY7 A;  2EYM A;  2I5M X;  1TWG H;  1XMO Q;  4RA8 A;  2SDF A;  1X3G A;  2B2V C;  1SN8 A;  4IFD J;  2B2Y C;  3IAY A;  1S5E D;  1KRS A;  4R4T A;  2NVY H;  3EJI A;  4AQY Q;  4X3U A;  1LV9 A;  4FXD A;  3R3O A;  5IYC G;  1JB7 A;  3QJY A;  2B2T C;  2IHE A;  3QO2 A;  5IIF A;  4JI4 Q;  3J7Z C;  1HA5 A;  2EY2 A;  3J81 j;  1TWC H;  1SNC A;  4DR4 Q;  3G71 A;  1TS4 A;  2YTV A;  5IGE A;  5FLM G;  2BE5 D;  1GUT A;  1NBW A;  4ZKC B;  5HUR A;  1N32 Q;  4BWG B;  2R93 B;  4A3K H;  4UPA A;  1WTR A;  4BXX G;  5K36 H;  4YY3 Q;  1EY6 A;  1G91 A;  4ZLT F;  3MEH A;  1NMG A;  3CC7 A;  5NUC A;  4DUY Q;  4JI4 L;  2NZ1 D;  1I4R A;  1Q46 A;  4PZ7 A;  4DR4 L;  3MTS A;  1CM9 A;  3PIO 3;  5JJL A;  1WYD A;  4A3E B;  1N32 L;  4DV0 Q;  1PZJ D;  3KLW A;  1STB A;  3IKJ A;  3J81 E;  1AH9 A;  1CUK A;  4X62 Q;  1KDA A;  5CR3 A;  3HKZ G;  1Y8P B;  1SE2 A;  3DWA A;  5M3M G;  1Y8N B;  1SNM A;  1RIP A;  4KTA A;  2VNU D;  2PNR C;  5JAV A;  3M3Y B;  4DV0 L;  2B2W A;  5IYD G;  2CKZ B;  4R4I A;  5JEA G;  2IX1 A;  2MO1 A;  3NHH A;  3F2D A;  4L5R C;  1FNW A;  1JCK B;  2MGS A;  4X62 L;  1WTH A;  1R9T B;  4X3T A;  3LGJ A;  3Q8D A;  3RZO H;  4LFC Q;  5EKL A;  2PMZ E;  1ET6 A;  4RGN A;  4DR5 Q;  1S5F D;  2KVM A;  5BR8 Q;  4AYB G;  2JN4 A;  2MPM A;  1SJE D;  2Z4I A;  1SNO A;  3BYT B;  2FMM A;  3BZK A;  4YHH Q;  2JA7 G;  2O5I C;  2PZW A;  2UXD Q;  5JPN C;  2JA8 H;  4DR5 L;  4KJO A;  4KKU A;  2K5V A;  2V1C C;  1ASY A;  1JOO A;  5IP7 G;  4YHH L;  1BBW A;  1TVX A;  3J7A V;  3I7F A;  2ZM6 L;  4O1N A;  4LUV A;  5ELC A;  5M3F G;  4OWW B;  2HUG A;  3FRP B;  2K01 A;  4HCS A;  2MHV A;  3SE0 A;  1ROD A;  4HN7 A;  3A5U A;  5EKI A;  5FJ8 H;  4MIU A;  2G9D A;  1ZYR D;  1H9R A;  3SK4 A;  4A4I A;  1Y69 U;  1DCZ A;  2A68 D;  5CV6 A;  1Z6H A;  2JA5 B;  2Q2H A;  5ELD A;  5C44 G;  4JI7 Q;  1KHI A;  4GLV B;  2MUY A;  1KNA A;  1EU3 A;  4CDD C;  2PCF B;  5EKK A;  1PA6 A;  5TSS A;  2O4X A;  4OEL B;  1STA A;  4RCO A;  2D2C C;  2YTX A;  2A6E C;  5C4X B;  1G2S A;  1SYF A;  3Q22 A;  1HRJ A;  2R6G A;  4RKL A;  4J6H A;  2R7D A;  2F0K A;  3TDQ A;  5LL6 X;  1YHA A;  4NXM Q;  2EXD A;  1ESF A;  1HNW Q;  2E76 C;  1LYL A;  3K81 C;  3HEJ A;  4GKJ Q;  2E2H B;  1DGS A;  2WV6 D;  5C3E B;  2PI2 E;  5ELE A;  3CPW A;  1C9O A;  4KD4 A;  4ZAI A;  4DV4 L;  2R7Z B;  4BBS H;  1W6K A;  3M4P A;  4DXG A;  4NXM L;  1VCI A;  2WAQ G;  4CHT B;  4P75 A;  3N6R A;  4RFB A;  4GKJ L;  1AFP A;  4AH6 A;  1YHQ A;  4H44 C;  1X3Q A;  2WB1 E;  4JI6 L;  1PFB A;  1IKL A;  2VL6 A;  4FDB A;  5C0X H;  4XT3 B;  3FPU B;  4KN7 C;  2EZV A;  5IE8 A;  1TXY A;  3GTO H;  2GN5 A;  4DR1 Q;  1OXV A;  2OCE A;  3C3L A;  3ICE A;  2K33 A;  5J3B A;  1VQO A;  4CKC A;  4LUO A;  4OO1 I; 
#chains in the Genus database with same CATH homology
 4NW2 A;  4HTH A;  2WIN B;  4BA2 I;  4E6I A;  3IFT A;  1NUC A;  2K1B A;  4LJZ C;  3MHB A;  3M4Y A;  1TY0 A;  1AN8 A;  1MI2 A;  1EL0 A;  1PZI D;  2YYZ A;  2F0S A;  3H91 A;  1XX8 A;  3VYU A;  2D62 A;  1BCP D;  4F87 A;  2IW3 A;  1G29 1;  3FVQ A;  2C5C A;  2JXM B;  2M2L A;  3DHQ A;  3HRZ C;  2JP1 A;  4K14 A;  3DEO A;  3D6W A;  1HA6 A;  2K05 A;  1FNU A;  5FO8 B;  5BN3 A;  5CV5 A;  3MFY A;  1STH A;  2X6G A;  4OO1 G;  1FR3 A;  1DOM A;  3CRL C;  1Q1E A;  4DXF A;  2R61 A;  4BY1 B;  3NWT A;  2KOL A;  1HHV A;  3W2D A;  5M5W B;  3HOZ B;  1QCB D;  2F0N A;  1GUN A;  2VB3 X;  3K5N A;  1F9S A;  1SE3 A;  4PMB A;  1F2M A;  2A74 C;  2K5D A;  1Y1V B;  1TWA B;  2X6L A;  4C3H G;  4K5V A;  1PZK D;  1OXU A;  4FO2 A;  4DA2 A;  2DY8 A;  4V0B A;  2F0I A;  1OO9 B;  2IT1 A;  4ABN A;  3TP7 A;  3P75 A;  5COY A;  4IUT A;  3S9W A;  3H09 A;  4DK1 A;  4H0L C;  5ELF A;  4KKS A;  3E0J A;  1H9M A;  1PRT F;  2L5T A;  4K8I A;  5KGU A;  1ILP A;  1M8A A;  2FMC A;  4X3K A;  1GUO A;  1YNJ D;  3Q6S A;  2F0Q A;  1NAP A;  1TS5 A;  1WCM B;  2F3V A;  4O42 A;  4A3F B;  1I4H A;  1LTT D;  2B2Y A;  4XIG S;  2EYH A;  2RDH A;  4RWS C;  1ENF A;  1WTW A;  2I07 B;  1EY0 A;  5JEA H;  3QOJ A;  1V1O A;  1EYA A;  4EGV A;  3S1Q B;  3ONA B;  3A8I E;  4FXK C;  4CKE A;  5T1I A;  2SOB A;  5D3I B;  1DOL A;  2RBM A;  1EWH A;  3GTQ B;  3J80 L;  3K59 A;  2OXP A;  2AWN A;  1HXY D;  3KUP A;  5IT9 L;  5C0X J;  3OIP A;  2RVL A;  2DNC A;  3I4N B;  4A3M B;  2OEO A;  1KLU D;  1TQO A;  3F2U A;  3QG1 A;  1NSN S;  1O7Y A;  2O2L D;  3CHB D;  2ICE C;  4QMG A;  3NBI A;  3QWN A;  2IWH A;  2E2I B;  2RQX A;  4V19 0;  2XSC A;  1V1P A;  4MN3 A;  4HED A;  4A3B B;  2WAC A;  4CJ0 B;  2EE1 A;  3A55 A;  3ITP A;  4HSV A;  1LTA D;  3NTH A;  3S15 B;  1A3U A;  2HDL A;  3MVV A;  2B63 B;  3W3A A;  5FLX E;  2R3Z A;  5C5M A;  4DNT B;  3RMH A;  2HQE A;  1F9Q A;  3E6Z X;  1I4X A;  1QJO A;  2E2D C;  3X3N A;  4FF4 A;  1ILQ A;  4G7O C;  2GA4 B;  1BBX C;  2K6A A;  1BXT A;  3C1F A;  4LAA A;  4K6D A;  1G2T A;  1EEI D;  1CA6 A;  3KBX A;  2L4N A;  2F0M A;  1B1Z A;  3SEB A;  2ENB A;  3PIP 3;  4EQO A;  3MXP A;  3HOW B;  5ELB A;  3MAQ A;  1B53 A;  1AZP A;  3MXU A;  3PMF A;  1GUG A;  4DN4 M;  3CKI B;  3HOY B;  2JA6 B;  3SHL A;  1U4R A;  2AUJ D;  3H6M A;  1SAP A;  3NTI A;  1OXT A;  4A3D B;  4KK7 A;  1SYG A;  4RKB A;  3NQI A;  1MSH A;  5IGC A;  2BDO A;  5JOB A;  4OO1 H;  3GTL B;  4OIJ A;  1S5D D;  4N9P A;  1HPC A;  3TSS A;  3RLF A;  1TS3 A;  4QIW B;  5I6Y A;  3TME A;  2KHS A;  4NMZ A;  3J80 E;  4IUN A;  2ICI A;  3EVQ A;  3VR3 A;  1S4Z A;  4L63 B;  1NCV A;  1SFO B;  2FJ2 A;  3JAM E;  5JEA J;  1E2Z A;  3O13 A;  4XQN A;  3J7A F;  1SYB A;  2EYP A;  1ZKO A;  4ZUI A;  1K83 B;  4YIJ A;  1XWE A;  2XRQ D;  1I3Q B;  1PTO B;  3R2I A;  1L0Y B;  1M4V A;  2F0J A;  1AW7 A;  4K5X A;  4GZY C;  4Q5V A;  1Z47 A;  5CGK A;  1AP0 A;  2LMC B;  1G6Z A;  3LWE A;  1V8Q A;  3GTP B;  1LTG D;  1SSO A;  1C8C A;  2MJ8 A;  3M7N A;  3DM1 A;  2A6E D;  1J8I A;  1VF7 A;  1MBY A;  3GV3 A;  1EIH A;  1PRT C;  3MWY W;  4HR7 B;  2Z4H A;  1SJH D;  1JB3 A;  3H0G B;  3TZD A;  4A3J B;  2IX3 A;  3HOV B;  1DJR D;  1NR2 A;  2X69 A;  3NSW A;  4IUV A;  4DGZ A;  2MP1 A;  2L0C A;  4KJN A;  5M5X B;  5EQ0 A;  1JR0 D;  3ERQ A;  4FVM A;  3OW7 A;  4F88 A;  3I3C A;  4RHS A;  1BR9 A;  2VB2 X;  1V1P B;  3EFX D;  1D5Z C;  5HGT A;  4JK1 C;  2RKS A;  1F2L A;  3S1M B;  1SYE A;  2KEC A;  2EJF C;  3OSO A;  3TP5 A;  2AQ2 B;  5CV9 A;  2ZXR A;  2OT2 A;  5KRU A;  1SND A;  1L0X B;  2HDM A;  5F2D A;  1BF4 A;  4KY7 A;  2F0W A;  3MZ5 A;  2B2U C;  2E75 C;  3U9O A;  3VR4 A;  1WD1 A;  5I9O A;  4MHE A;  1STG A;  1TR5 A;  2K7V A;  4A93 B;  2ID0 A;  1MD2 D;  1B50 A;  1SNQ A;  4K6L A;  2YU9 B;  2BOS A;  3CRK C;  3VR2 A;  2AWO A;  1JQY D;  1F77 A;  3I70 A;  5LL6 S;  3GQB A;  4Z9C B;  1BCP F;  4IFD I;  1D5M C;  3MFG A;  2EVB A;  5E3F A;  3Q23 A;  3WOE A;  1UEA B;  2F0V A;  1XXG A;  2PQE A;  2A69 C;  4DF7 A;  4KD3 A;  2WKD A;  5EPL A;  5DAU A;  4WJW A;  4C3I G;  1LAB A;  3MA2 B;  1Q12 A;  3NXW A;  4K5W A;  4Y7N B;  2F0P A;  1B9M A;  3PUY A;  3KLS X;  5ISR A;  5DNF A;  5BN4 A;  1S5B D;  1JE4 A;  1A15 A;  4ZUJ A;  5A2Q E;  3RD4 A;  1IHZ A;  3OWE B;  1EY9 A;  3VR6 A;  4K2K A;  4I7Z C;  1TWG B;  2D9U A;  4P2C B;  4C3J G;  4DAP A;  2F0U A;  2NVY B;  1WTV A;  3NPP A;  2XVS A;  1GOZ A;  1GUS A;  4HMI A;  4ZK9 B;  2J7Z A;  4IUU A;  2K5Q A;  2VXW A;  4UDU C;  1H9J A;  1TWC B;  1RKN A;  4G7Z C;  4FF2 A;  4A3K B;  1EYC A;  3TN2 A;  1K8O A;  1IKM A;  2EYJ A;  4M1U B;  2NWG A;  2RDG A;  1RDP D;  2K32 A;  2H4O A;  4XQJ A;  1GHJ A;  5D14 A;  3BDL A;  2RSO A;  1Q1B A;  1LO5 D;  3R2T A;  1SDF A;  2F0L A;  2C9O A;  4OL7 A;  1O7Z A;  2A5H A;  3K0Y A;  1RJT A;  3LNN A;  1LT6 D;  5K5P A;  4C1N K;  5JVG 3;  5IGB A;  3QB3 A;  3SVM A;  1O80 A;  3RZO B;  2F1M A;  1PFN A;  1IYV A;  3U9S A;  3UI2 A;  4XXE A;  3OMC A;  5CMD A;  1SMY C;  3P1H A;  2F0H A;  4F8M A;  2PPB C;  2JA8 B;  5CV4 A;  3OHX C;  1G8Z D;  1R4P B;  4PMC A;  5E1F A;  3URY A;  2F03 A;  5CV8 A;  4EQP A;  3D4D A;  3K5L A;  1DZ1 A;  2A6H C;  1EQT A;  4I65 A;  4KMU C;  5BN5 A;  3P20 A;  1TT2 A;  3MXG A;  1FYC A;  2DNE A;  1EY4 A;  4RGO S;  1H9K A;  3SK5 A;  4ID6 A;  2SNM A;  1A3V A;  2K04 A;  3HZX A;  2J4X A;  4PQX A;  2BA1 A;  2Z1C A;  4HCE A;  5C4Z A;  1WTQ A;  2XWB B;  3PUW A;  1HUN A;  2XRS D;  3GO5 A;  2M9V A;  1V43 A;  3FEW X;  5FOB B;  5JVH 3;  1JWM D;  1QB5 D;  1SYD A;  1NR4 A;  4IN3 A;  4R9W A;  2EXZ A;  1OXX K;  1T5E A;  4KHZ A;  4BBS B;  5KYL A;  5DM6 3;  1BCP B;  3D8G A;  1B9N A;  1EY7 A;  2F0E A;  3PUZ A;  4OIK A;  3TZU A;  2F0G A;  2B2V A;  2JEB I;  4RCN A;  3GTO B;  3OWF A;  1PTO F;  2B2T A;  5C6A A;  2K28 A;  5JPM C;  1LT4 D;  2B8G A;  5D65 A;  3VA7 A;  1D6E C;  3AMU A;  3S2H B;  4U67 3;  3IL8 A;  5LHY 1;  1D5X C;  3HP3 A;  4XT1 B;  5G3L D;  2B2W C;  3ERO A;  3QOL A;  1U9R A;  4A3G B;  2RSN A;  2SEB D;  3S2D B;  5K36 G;  1TY2 A;  4C1N I;  3QIA A;  2JE6 I;  2KCC A;  3HOU B;  2B2U A;  2IL8 A;  5EPJ A;  1PYW D;  4F7X A;  5I9P A;  4DAV A;  3D3R A;  2KQ3 A;  1PFM A;  3AB9 A;  4J8Q A;  3OPO A;  3SK8 A;  3IFD A;  2G9H D;  4KHV A;  3T4A C;  2LY7 A;  3LX0 A;  1DYQ A;  2K03 A;  4G57 A;  3T53 B;  5I6W A;  1TWH B;  3E5S A;  4LMQ D;  4ME5 A;  2F4I A;  3K58 A;  2FFK B;  3NK9 A;  5C3X A;  2K5W A;  1STE A;  3NQT A;  5C3W A;  2FIN B;  1OXS C;  1DON A;  2AQ3 B;  2EYO A;  1EEF D;  2KA7 A;  2PMZ B;  3A7L A;  1GJX A;  2EY5 A;  1MSG A;  4PV1 C;  3M7G A;  3A56 A;  1CZW A;  2EY1 A;  2L55 A;  3R8B A;  2WKC A;  1Q90 A;  4KV6 A;  2PW7 A;  3DUZ A;  2QIL A;  1PRT D;  3TP8 A;  5AFW A;  3BVG A;  1GUW A;  1WTP A;  4X3S A;  1ENA A;  4IZ8 A;  3S14 B;  2Q8I B;  2KUM A;  1RTO A;  2NVX B;  1Y8O B;  1JOK A;  3RUZ A;  2KEE A;  4HAE A;  1GXD C;  3BDO A;  1HTL D;  1SXT A;  4UAI A;  1KAA A;  1IW7 C;  1E2W A;  1B4O A;  1RCV D;  1ESR A;  2RA4 A;  1U4L A;  1EY5 A;  2L12 A;  4FXG C;  1DM0 B;  2KJX A;  5M3M B;  4WFN 3;  2IX0 A;  2NVT B;  3GTK B;  5I2X A;  4H13 C;  2BCO A;  3J81 L;  4FF1 A;  1PDQ A;  3SDZ A;  1D1K A;  1EWC A;  1KDC A;  3FMC A;  4KI0 A;  3C46 A;  1RHP A;  4XTC S;  1DOK A;  4B08 A;  2CQA A;  2LKV A;  4M8A A;  2ZT9 C;  2WB1 B;  3I8Z A;  3V05 A;  2L1B A;  1QG7 A;  1MGS A;  1H9S A;  4B9X A;  1SEB D;  1WVL A;  1ICW A;  4OHJ A;  3K5O A;  5A35 A;  5E4X A;  5IT9 E;  4DFA A;  5IOC A;  1D2B A;  2EDG A;  2NTT A;  3N52 A;  1YNN C;  3ND8 A;  1LTI D;  2E2J B;  2NBF A;  4BA1 I;  1IL8 A;  1HQM C;  1F2Z A;  3NP8 A;  1ONL A;  3A8K E;  1A2T A;  2F0F A;  2A69 D;  2FHT A;  2CHB D;  3D31 A;  1FNV A;  1SBB B;  2IJ0 A;  3CQZ B;  3R93 A;  3P7J A;  5CC4 A;  1EU4 A;  2O5J C;  3J7Y W;  1I4Q A;  3CU7 A;  3BS1 A;  1UNS A;  1HFN A;  4ZKB B;  1LLR D;  4XDX A;  2PYK A;  5KIX A;  1HCZ A;  3DXJ C;  1QIL A;  1AEX A;  2QKI C;  5IOD A;  4NP5 A;  2WAQ B;  1EIG A;  1EY8 A;  1C48 A;  3KF8 A;  1BNZ A;  3BYY B;  2KED A;  2I46 A;  2H1E A;  3T16 A;  1TII D;  4G7H C;  1XYI A;  1T5X D;  3DEP A;  3AU7 A;  4QUC A;  4DNR B;  2CW0 C;  1EZ8 A;  1PTO C;  3MXN A;  3OMG A;  4ZRZ A;  2QCP X;  1FGB D;  1A2U A;  3S17 B;  1F9P A;  3S1N B;  3I4M B;  1C4Q A;  2AUK A;  1BO0 A;  4ULL A;  3TBI B;  2TMP A;  3PUV A;  3PUX A;  2L11 A;  1JOR A;  3NE5 B;  5FKA C;  3L9A X;  3K5M A;  1ML0 D;  1KAB A;  3SR1 A;  4K2L A;  1K8M A;  1CHP D;  5EPK A;  1SYC A;  1CFM A;  4CJ1 B;  3C2P A;  5M9O A;  5JJZ A;  1VMC A;  3T13 A;  3PO3 B;  1I6V C;  3Q0A A;  3NBH A;  5D3D A;  5EBC A;  4HMJ A;  3EQL C;  2A73 B;  3GP7 A;  2Y0S B;  1E2V A;  3KLS A;  1SMY D;  4J1M A;  2NN6 I;  5IGG A;  3L3O C;  3I72 A;  1XTC D;  4ZYS A;  1LT5 D;  5E4W C;  4C3H B;  1O7L A;  3S16 B;  4N9T A;  1GHK A;  3K7A B;  2NVQ B;  2A6H D;  5FO7 B;  1EQV A;  1PLF A;  2WII B;  3C1E A;  2F3W A;  3Q24 A;  2F0O A;  1UUP A;  3A7A B;  1CI3 M;  3G6J B;  1B2T A;  5CBA E;  1Y1W B;  3S1R B;  1HTP A;  2N55 A;  3H94 A;  2BDN A;  4IFD G;  2NN6 G;  2V4D A;  5I4D A;  1PXU A;  1QNK A;  2EYL A;  1H9S B;  1LAC A;  3I73 A;  4XYO A;  1RD9 D;  3DMU A;  3D4W A;  2B39 A;  3RZD B;  2PZT A;  2LFN A;  5KEE A;  4BY7 B;  1SE4 A;  4IAL A;  2KCN A;  4EVO A;  2BE5 C;  3GTG B;  2RDF A;  4KY6 A;  4RAU C;  4WOR A;  4RGT A;  3VA5 A;  5C5L A;  3HS0 C;  3EA6 A;  2XIW A;  4R8I A;  3DWP A;  2IPK D;  2TSS A;  3WDN A;  3T51 B;  1II3 A;  4A3I B;  2ZXP A;  3X3M A;  1HQR D;  3OOC A;  3H3V C;  1LTS D;  1U4M A;  3T56 B;  3D4R A;  5T1G A;  4RHR A;  1VDZ A;  1CT1 D;  3BG3 A;  3GTM B;  3HGB A;  2LS0 1;  3NUC A;  1WTX A;  4ODG A;  1WTO A;  5G3L F;  3FDT A;  1TS2 A;  4TRD A;  3SXH A;  3VYT A;  1WD0 A;  4L8J A;  4WRD A;  1I4P A;  5DEH A;  3SK6 A;  1EZ6 A;  4FNF A;  4LK1 C;  2JYO A;  4NKL A;  4Q0F A;  5J22 A;  1QNU A;  3I90 A;  5KYI A;  5EGT A;  1W6J A;  4FF3 A;  2B8F A;  1ZYR C;  2XNA C;  1JC7 A;  5FLX L;  2A68 C;  1JWU D;  2QDB A;  1BOS A;  1TWF B;  1CQF A;  4L6T B;  2PZU A;  1CHQ D;  4CGY B;  2EY6 A;  4RGM A;  1EOT A;  2NB0 A;  1RTN A;  3I4L A;  3KLR A;  5IGF A;  4NDX A;  1FD7 D;  3TP6 A;  1SNP A;  4H7B A;  2JEA I;  4XQQ A;  3KK7 A;  5CV7 A;  5C4H A;  4TKO B;  5FK9 C;  3V2T A;  4DK0 A;  1QE6 A;  5KND A;  1KNE A;  4C2M B;  5KNB A;  1B3A A;  1Q8I A;  1BUV T;  5M5Y B;  1IW7 D;  4PNY A;  1CQV A;  3MC0 B;  2Z8L A;  2R92 B;  4DAY A;  4QCL A;  4IUR A;  4IUP A;  5EBD A;  2J0T D;  2EOT A;  1ENC A;  3GTJ B;  2N88 A;  2D5D A;  3FPP A;  1I6H B;  1X3P A;  2AQ1 B;  3VYS A;  3G7L A;  3HG9 A;  1AZQ A;  3DWQ A;  4TQU S;  3HOX B;  2M00 A;  3GD7 A;  1BCP C;  3K57 A;  1PMR A;  5I2Y A;  2WP8 J;  5J1Z A;  1S5C D;  1TU2 B;  1TKW B;  3KBG A;  1BDO A;  1A6X A;  4FYD A;  5KNC A;  1Q3L A;  3BVM A;  3JAM L;  3K6O A;  3D6C A;  4IQZ A;  1ZEQ X;  4K8J A;  1YNN D;  1VF5 C;  5CBE E;  1CK1 A;  1J9O A;  1JIC A;  1DXM A;  3VR5 A;  4QB4 A;  1PTO H;  4R8N A;  2PW5 A;  2XWJ B;  1X32 A;  4IFD H;  4KY5 A;  2Q8T A;  3WOF A;  2NN6 H;  1QWY A;  2SNS A;  2BA0 A;  4QUF A;  2OF1 A;  4JBW A;  3L7Z C;  2ZXO A;  5J39 A;  4IUQ A;  2JSO A;  4FP5 D;  1JOQ A;  2EJG C;  5COR A;  2VUM B;  2XN9 C;  5C0X I;  3BDC A;  3GV6 A;  1STY A;  1KLG D;  5DM7 3;  2F0D A;  1F9R A;  4B9W A;  4BS9 A;  4BBR B;  4ILW A;  4U68 A;  2HCI A;  2CW0 D;  3PV0 A;  3M85 A;  5CYU A;  4ZQ3 A;  2EJM A;  1PTO D;  1YNJ C;  1CZG A;  1JWS D;  1EFI D;  1ZXT A;  4HSP A;  1HFG A;  2NUC A;  2NYZ D;  1BQQ T;  2QEJ C;  3HKZ B;  1ET9 A;  1STN A;  1IYU A;  3I91 A;  4PMW A;  1VMP A;  1KTK A;  1D1I A;  1HUM A;  3OIQ A;  4CBV A;  4DU9 A;  1LTR D;  5IGD A;  3LWU A;  5C0X G;  2HCC A;  4AYB B;  4TSS A;  5FO9 B;  4CJ2 C;  2NTS A;  2JA7 B;  1EYD A;  3ZYY X;  2EYF A;  1LTB D;  2EPB A;  2PO4 A;  3ND9 A;  3V96 A;  4CKB A;  3M4O B;  5M3F B;  1DD2 A;  1I50 B;  1Z7T A;  4KKT A;  4EQN A;  1PRT B;  4G4K A;  5EJW A;  3NTK A;  4QF4 A;  4C56 C;  4C3I B;  5C44 B;  1R4Q B;  1A3T A;  2CVR A;  3VYR A;  3PO2 B;  2Q8R E;  1CA5 A;  3A54 A;  1RF2 D;  1E0B A;  4S3S A;  1CTM A;  2DN8 A;  1KDB A;  1B44 D;  1F2Y A;  4XYQ A;  3BVZ A;  3A8J E;  4KN4 C;  1I4G A;  3NWS A;  2L9H A;  4OGQ C;  2QF7 A;  4C3J B;  5C4J B;  5A2Q L;  2F0T A;  1QOH A;  2E74 C;  1LT3 D;  3FKI B;  1UAP A;  3BZD B;  1O78 A;  4RH6 A;  1U4P A;  2DY7 A;  2EYM A;  4RA8 A;  2SDF A;  2B2V C;  4IFD J;  2B2Y C;  3IAY A;  1S5E D;  3EJI A;  4X3U A;  1LV9 A;  4FXD A;  3R3O A;  3QJY A;  2B2T C;  3QO2 A;  5IIF A;  1HA5 A;  2EY2 A;  1SNC A;  1TS4 A;  5IGE A;  2BE5 D;  1GUT A;  4ZKC B;  5HUR A;  4BWG B;  2R93 B;  1WTR A;  5K36 H;  1EY6 A;  1G91 A;  4ZLT F;  3MEH A;  5NUC A;  2NZ1 D;  1I4R A;  3MTS A;  1CM9 A;  3PIO 3;  4A3E B;  1PZJ D;  1STB A;  3IKJ A;  3J81 E;  1KDA A;  5CR3 A;  1Y8P B;  1SE2 A;  3DWA A;  1Y8N B;  1SNM A;  4KTA A;  2VNU D;  2PNR C;  5JAV A;  3M3Y B;  2B2W A;  5JEA G;  2IX1 A;  3NHH A;  1FNW A;  1JCK B;  2MGS A;  1R9T B;  4X3T A;  5EKL A;  1ET6 A;  4RGN A;  1S5F D;  2KVM A;  2MPM A;  1SJE D;  2Z4I A;  1SNO A;  3BYT B;  2FMM A;  2O5I C;  2PZW A;  5JPN C;  4KJO A;  4KKU A;  1JOO A;  1TVX A;  3J7A V;  4O1N A;  5ELC A;  2HUG A;  3FRP B;  2K01 A;  4HCS A;  2MHV A;  3SE0 A;  1ROD A;  4HN7 A;  5EKI A;  4MIU A;  2G9D A;  1ZYR D;  1H9R A;  3SK4 A;  1Y69 U;  1DCZ A;  2A68 D;  5CV6 A;  1Z6H A;  2JA5 B;  5ELD A;  2MUY A;  1KNA A;  1EU3 A;  2PCF B;  5EKK A;  5TSS A;  2O4X A;  1STA A;  4RCO A;  2D2C C;  2A6E C;  5C4X B;  1G2S A;  1SYF A;  3Q22 A;  1HRJ A;  2R6G A;  4RKL A;  4J6H A;  2F0K A;  3TDQ A;  5LL6 X;  1ESF A;  2E76 C;  2E2H B;  3HEJ A;  5C3E B;  2WV6 D;  5ELE A;  4KD4 A;  4ZAI A;  2R7Z B;  1W6K A;  4DXG A;  1VCI A;  4CHT B;  3N6R A;  4RFB A;  1AFP A;  4H44 C;  1X3Q A;  1PFB A;  1IKL A;  5C0X H;  4XT3 B;  3FPU B;  4KN7 C;  2EZV A;  1OXV A;  3C3L A;  2K33 A;  4CKC A;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...