3ONAB

The secret domain in complex with cx3cl1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
CNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumour necrosis factor receptor
publication title Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor
pubmed doi rcsb
source organism Ectromelia virus
molecule tags Viral protein/cytokine
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3onaB00
1SAPA 3R93A 2KECA 1QNKA 2NYZD 3UI2A 4X3TA 4XT1B 4LMQD 1KNEA 3FDTA 4OIKA 4X3SA 1G6ZA 2L11A 2HCIA 1B4OA 2K04A 5T1IA 2KOLA 4CJ2C 1U4PA 3TZDA 4U68A 4ZAIA 2EE1A 1O80A 2N88A 1EQTA 1BF4A 3I3CA 2BDNA 2XIWA 2HCCA 5AFWA 1F9RA 3LWEA 2B2TC 2K1BA 1PDQA 4RAUC 1AZPA 1VMCA 3DEPA 4CJ1B 1WTXA 1NR2A 1QG7A 4UAIA 3GV6A 1M8AA 3GV3A 4XT3B 1BO0A 1B53A 1U4RA 2J7ZA 5CBAE 5CBEE 4HEDA 3I90A 1WTWA 1XYIA 1WD0A 1EOTA 2B2UA 1WTRA 1PFBA 2B2YA 1X3QA 4ZKCB 4DN4M 1TVXA 4CJ0B 1SDFA 3IL8A 1O7ZA 2MJ8A 3P7JA 2B2TA 4IUUA 1DONA 4IUVA 4QUFA 1WTOA 2MP1A 4HCSA 1G2SA 1LV9A 1PFMA 2X6LA 3DM1A 4RWSC 3MTSA 5EKIA 2FINB 5EQ0A 1WD1A 1HHVA 2L4NA 5D65A 1CM9A 4R9WA 5D14A 3F2UA 5EPJA 2NWGA 4NW2A 1B2TA 1PFNA 2X69A 2H1EA 2B2UC 1WVLA 1F9PA 1ML0D 2B2VA 2B2YC 3QO2A 2L1BA 5COYA 1WTQA 4O42A 2N55A 1DZ1A 1MI2A 1F2LA 1EIHA 1IL8A 2RSOA 5DNFA 3DEOA 4RA8A 4ZKBB 2L9HA 1XX8A 2M2LA 2Q8RE 2HDLA 3D6WA 1MSGA 1J8IA 2RVLA 4ZLTF 2FFKB 1C8CA 4OIJA 1HFNA 1ESRA 5CMDA 2RA4A 2DY7A 1KNAA 2MGSA 2FHTA 1O7YA 3Q6SA 3KBXA 1B3AA 5EPLA 2DY8A 2Q8TA 1ZXTA 1RJTA 2D9UA 2IL8A 5EJWA 2FMMA 1HFGA 1ICWA 2HUGA 1S4ZA 2K28A 2R3ZA 3TN2A 1HA6A 2B2VC 1BBXC 1E0BA 1RTOA 2K01A 1CA6A 1ILPA 3KUPA 1JE4A 3HP3A 3SVMA 2JYOA 1F9SA 3I8ZA 4MHEA 4IUTA 3G7LA 1NAPA 1Q3LA 1DOLA 1A15A 5CORA 1EL0A 4HSVA 1MSHA 1NCVA 2X6GA 1MGSA 1X32A 1X3PA 2B2WA 1RODA 2K03A 1WTVA 1F9QA 2L12A 4HAEA 2KEEA 1G91A 2EOTA 1U4MA 2KEDA 1BNZA 1IKLA 3FPUB 1DOMA 1JICA 1GUWA 2K05A 1AZQA 1DOKA 2KVMA 3IFDA 2JP1A 4X3UA 4XDXA 5E4XA 4ZK9B 5EPKA 2EPBA 2FJ2A 2NZ1D 1B50A 1IKMA 2SDFA 1EIGA 1WTPA 1QE6A 4IURA 4IUPA 4MN3A 5E4WC 3H91A 4IUQA 2RSNA 2CVRA 2KUMA 2VXWA 3N52A 1AP0A 1ILQA 1RHPA 1PLFA 5T1GA 1HUNA 1CA5A 2B2WC 2MPMA 1VMPA 2HDMA 4R8IA 4X3KA 1NR4A 5JJZA 4QUCA 3I91A 1RTNA 1G2TA 1J9OA 3MWYW 1HUMA 3ONAB 1HRJA 1SSOA 1U4LA
chains in the Genus database with same CATH superfamily
3NUCA 3ULJA 2AWNA 5BN4A 2E76C 2Z6KC 2UUCL 1V1QA 3K57A 2R7ZB 2UUAL 1D5MC 3SEBA 5D3IB 4DR5L 4G7HC 4C3IH 5IGCA 4OONA 1N36L 1WFQA 4IJLA 4DAVA 3PO3G 4X6AH 1RIPA 3DXJC 1HTPA 5LMUQ 2EQSA 4IQZA 4A3IB 3R8BA 2RKSA 1A63A 4A93G 3D4WA 3S1NH 5DEHA 1EY7A 3C1EA 1XPUA 3GTGH 3A55A 4LF9L 4BBSH 1B53A 2J7ZA 1I4PA 2HIVA 1HQMC 3OYYA 1R4QB 2B39A 3IL8A 2MJ8A 3Q23A 4ZRZA 4ALPA 3CU7A 1W6KA 4EGVA 1FR3A 1PTOF 2F0EA 3BU2A 1PH2A 2Q2UA 4ILWA 1IL2A 2VB3X 5GAGC 2CW0D 4FXKC 3VA7A 1SR3A 2QDLA 1OO9B 4RMFA 3WOFA 1MBYA 1JOKA 4U673 1HZAA 3VYTA 3V96A 4DR3L 5GROA 2IL8A 2HUGA 1I4RA 1N34L 3EROA 1TS3A 4R4QA 4UP9A 3J7A5 2JYOA 3MFYA 3GTMB 5FO7B 3T1YQ 2Z9HA 4LFBL 4J8QA 2NVTH 1QB5D 3HOXB 3A74A 1BKBA 1D2BA 4GN5A 2JA6G 1NJIC 3MA2B 1BNZA 3A7LA 2KHSA 2Q2IA 3PSIA 2XTIA 1I6VC 3BYTB 4LJZC 2WKCA 4YWLA 1KD1C 5C0XJ 1OXUA 4K2KA 4MN3A 5D3DA 5IT9E 5ELEA 3G6JB 2RDGA 2YYZA 3MXNB 4GS3A 3K5LA 1QILA 3U58A 1U0LA 2O5IC 1A3UA 3VR5A 5C44G 4HJ5A 1RTNA 4KJOA 1HR0W 3H3VC 2EY5A 3MXNA 1G2TA 1FYCA 3PGZA 4GN4B 4DF7A 3HOUB 2GVAA 1Y1WH 1HZBA 2QW7A 2EYHA 3A8JE 1KLUD 1NBWA 5G3LF 3RN2A 2F0QA 3PO2H 1E1OA 1I4QA 4K8IA 1XMQQ 5IOCA 1G6PA 5IWAQ 2Z8LA 3I4OA 4C3HB 2F3VA 1T9HA 1KTKA 4KKUA 4POGA 4X62L 3GTJH 1EZ6A 4WJ3M 4HJ8A 5C4XG 3E9HA 2PZUA 4C3IB 3K0YA 1IBML 3HOYH 3C1FA 1Y1VG 4R4OA 4KMUC 1OXVA 3SK6A 4DUYL 1WD0A 1PH6A 2KENA 2Z6BA 1LTLA 3NPPA 4G4KA 4AQYL 3S1NB 3M4QA 4H44C 5FLXL 3GTGB 4J6HA 4BBSB 3CC4A 1I4XA 1LV9A 3H15A 1PFMA 3S2HH 1RD9D 3G6EA 4PMBA 2QGQA 2B2UC 4IPGA 2B2YC 4A3EG 1O7IA 3OOCA 3CCSA 3T1HL 2A74C 1QCBD 4JI8Q 3S9WA 4CKEA 3OW7A 2LXJA 2HDLA 2FFKB 4DV2L 1HNZL 1HFNA 1CUKA 1PH7A 5IGGA 3I4NH 2F0PA 3NP8A 4WJWA 1JMCA 2A19A 1JC7A 1D5XC 2Q2HA 2PNRC 4A3LH 4OL7A 5E3FA 3KUPA 4KV6A 1E22A 2UXDQ 2QCPX 1LTAD 4KK7A 1MGSA 1V8QA 4H7BA 2M00A 4QF4A 4DV3L 4HJAA 1DOMA 4BA2I 2CFMA 1CQFA 1YNNC 3NELA 2Q8IB 1MHWC 2NVTB 1AEXA 1BR9A 5LMNL 2NZHA 2PQEA 3HOVG 4RGNA 2K5HA 3RZDH 1DCZA 4ZQ3A 5CV6A 2JN4A 2B2WC 1SYFA 1VMPA 1KABA 1YNND 5I9PA 3PO3H 4ZUJA 3S1QH 1ICFB 3QOJA 2RBMA 1PA6A 1V1OA 2O2LD 1CKNB 2EJFC 1Y69U 1EIYB 2VY3A 4GKJQ 2F0LA 1FD7D 1CKNA 2ID0A 2OXPA 5KEEA 1EWHA 3CCLA 3AEVA 4JI2Q 3RNUA 1KAWA 1KL9A 3OTOL 2YV5A 4TQUS 4B3TL 1K73C 1UNSA 5JJIA 1OXTA 1CK1A 2UUCQ 1Q81C 2XWJB 2NN6G 5ELNA 4YIJA 1EQQA 2EYLA 3GTJB 2YTXA 4YY3L 2ZJPA 4DN4M 4DR5Q 3H3VI 3X3MA 3RR5A 3HOYB 5JPNC 2EYMA 4PG3A 1MIUA 2IX3A 2D0OA 2EJMA 3FKIH 2OQKA 3MXGA 2IWHA 5HGQA 1WTOA 3CC7A 1L0WA 1F2ZA 1H9JA 1B44D 2FINB 1M90C 1K8AC 1HQRD 2F0HA 2HIXA 3PUXA 3MHBA 1PRTF 2NWGA 3ND8A 1NTGA 1PFSA 3F8TA 3DWAA 2F4IA 1LYLA 4XTCS 4DXFA 1WVLA 3KOJA 3PUZA 1X3GA 4Q0FA 1LTSD 3BZCA 4IFDG 1UEBA 4A3BB 4RA8A 3TP8A 2M2LA 3WOEA 2R61A 3QWNA 1EEFD 2RA4A 3PQIA 4MTKA 2JA6H 1BVSA 4X64Q 4RGOS 3TN2A 1PH4A 5IIFA 4XQJA 1I50H 2NUCA 2K52A 2AHOB 1B9MA 4IUTA 1TWGB 2QILA 4FF3A 1KHIA 1IYUA 3M3YH 1LACA 4JI4L 2K03A 4B9WA 5C44H 3J7AF 2EOTA 3KFUA 3PF4A 2LS01 2K50A 1DOKA 3M7GA 4OO1H 1VDZA 2RQXA 3VA5A 3VDYA 3L9AX 4FF4A 2EVBA 2I07B 3X3NA 4O1NA 1K3BC 2VXWA 4K5WA 1PH3A 3J80c 1W6JA 5CV9A 5DM73 3CMAA 5EKKA 5C4XH 3RZDB 1QZGA 4QIWB 4LUZA 3B6YA 4J1MA 3PO3B 4IZ8A 3K7UC 1LTBD 1SE3A 1X3EA 1RCVD 4C56C 5IP7G 5ELBA 3UDGA 1VQ5A 1X6OA 4A93B 4PV1C 5IE8A 3C2PA 2ICIA 1JWMD 3EVQA 3CRKC 4JK1C 1TXYA 1PYSB 2BDOA 2JXMB 5M5XB 1SE4A 1WTXA 1B8AA 3CW2C 2XGTA 4PZ6A 5CBEE 1XYIA 1STEA 3FMCA 4A3EH 4DV7Q 1YI2A 3OWEB 1PH9A 3WDNA 1I4HA 1K9MC 3IFTA 1HR0L 3M4PA 3RLFA 1N9WA 2GN5A 5EGTA 1DONA 1PYWD 2F0MA 3ITPA 4OWXB 2ZM6L 1Q82C 1LUZA 4JI0L 5M3FH 2B3GA 1PV4A 1WYDA 2F0FA 1IYJB 1SNDA 2N8NA 4GOPC 3N6RA 2G9HD 4DNTB 4AQYQ 1EIHA 3CQZH 2XNAC 1GUGA 3URYA 2BOSA 3W3AA 2JA5H 4ZLTF 1D6EC 2PYKA 1TQOA 1SBBB 1KNAA 2RF4A 5EBCA 1CHPD 1EYCA 4L5SA 3GTLH 3UE0A 4GZYC 2B2VC 4FO2A 4DV1Q 1SE2A 1E0BA 1XJVA 3I7FA 2R6GA 2JA6B 3T4AC 3T1HQ 3G7LA 1I50B 1LM0A 1K3RA 2KEDA 4K6DA 2WKDA 4FF1A 3FPUB 3FP9A 2PMZB 4DUZQ 4DK1A 3BDCA 5C4JH 1MJEA 3M3YB 4JVZA 5EPKA 5C44B 3JAMc 3E0JA 1B50A 3I56A 2IX0A 4FXGC 3AMUA 3VR3A 1SYBA 1SJED 5JEAH 5T1GA 4DU9A 5IT9L 2R92G 1W3SA 1JORA 1T5EA 1AN8A 2J0TD 1EWIA 3K59A 3PF5A 3F2BA 1J6QA 1VQ7A 2F03A 3STBC 2VQFL 2HT1A 3G4SA 5FK9C 5LMNQ 1VQMA 3RN5A 4OX9L 1U4PA 5C4XB 5I9OA 1BQQT 4YWKA 2N88A 4A4IA 2SNSA 3AFQA 4EQNA 2BDNA 1Y1VB 4AIMA 4PNYA 3BYYB 4HN7A 3U9OA 1VQLA 3M4YA 5IP9G 3GV3A 1Q1EA 3W1BA 4JBMA 5JAVA 4GLAC 4ID6A 2EYOA 4CBVA 3V2TA 1SNMA 4OEMB 4YHHL 4IFDH 1TY2A 3OTOQ 4KY7A 5FO8B 4R4TA 1GKHA 4ZCKA 4LF8L 5IGBA 4B3TQ 1WD1A 4DNRB 4A3EB 1CZGA 1EFID 3M9BA 4LUOA 5D65A 3SXHA 3P1HA 4ULLA 4B3RL 1XNQL 3QJYA 2JA7H 4A3FH 1S5FD 1Y1WG 4O42A 3TRZA 4YY3Q 4Q5VA 1IBKL 2IHEA 1MI2A 3J81c 1QWYA 4UPAA 3PO2G 4ZKBB 1YJNA 4K0KQ 1MD2D 3OIPA 4YCWA 3U9SA 3DM3A 2FHTA 3Q6SA 3KBXA 3K58A 3CQZB 2PZWA 4R4IA 2JA5B 1S72A 3KLWA 1LT6D 1FNVA 4FVMA 1V1PB 4HR7B 1F9SA 5FKAC 4BBRH 3PUWA 4P74A 5K36G 1V1PA 4BY1G 1E24A 3CMEA 5C0XI 1K83B 1F9QA 4DR4L 3HOVB 1LTRD 5K5PA 3AU7A 1A2TA 4R4CA 1A0IA 1FL0A 2B29A 4KHZA 4QIWE 1BCPC 1EOVA 3I4MG 1Q46A 4JG2A 5IP7H 4C1NI 1SYGA 1Z6HA 3ER0A 3OIQA 2RSNA 4HMJA 4B3MQ 2CVRA 1ILQA 4UP7A 1HUNA 4OXPA 2UXCQ 1BCPD 2DUDA 3VR6A 4CKBA 1HUMA 3S2DH 4HJ9A 3R93A 3A7AB 2KECA 1JB3A 1XTDA 4LFAQ 2KCMA 1HZ9A 2A73B 4EQ5A 3BZDB 4DV0L 3C46A 3I4NG 1J5EQ 2VB2X 5H1SE 3M85A 2E2HH 4A3LG 3T56B 4A3CG 1DM0B 1SYDA 1F9RA 3LWEA 3CCUA 4RAUC 5AJ3L 2BH8A 4G7OC 1NR2A 2WINB 1ONLA 1EZ8A 1HNWL 1QVCA 4NMZA 3BDOA 5IYBH 1KXLA 4PQXA 1XMOQ 2F1MA 3TQYA 3EQLC 1E2WA 1PFBA 4ZKCB 4L5TA 3ERSX 4KHVA 2Z4IA 1FGBD 2F3WA 2K5NA 4LF4Q 4LF5L 4FNFA 2AMCB 3AYHB 2Z1CA 3JC66 5CYUA 1PH8A 2L0CA 2SNMA 1JE5A 2BA1A 2EIFA 1DD2A 2OF1A 4UY8C 1HR0Q 3SHLA 3CPWA 1TY0A 1JJGA 1LT4D 4JI0Q 5J39A 2LMCB 1Q7YC 3Q0AA 2PMZE 2DY8A 1N32L 3H3VH 1SEBD 1TWHB 2PNHA 5C3XA 4HMIA 4J15A 3RLNA 1BBXC 1D1KA 1A62A 1C48A 1UEAB 1P16A 3RZOH 4KN7C 5F2DA 2RHQB 1EL0A 2A68C 2R92H 3JAMi 4HAEA 2I5LX 4X66L 3FKIG 1AH9A 2CCZA 4X3UA 1ET9A 3CCMA 2A68D 3CPFA 5ELFA 3UDFA 1TWFH 3D4RA 3GDEA 4LF7Q 2F0OA 1CA5A 1VQNA 1IZ6A 4JBWA 1SLJA 2CH4W 4B08A 1FJGL 1STBA 1KNEA 1EY9A 5IP9H 1B70B 2ZXOA 3TREA 4V0BA 3S2DB 1TIID 3KF8A 1YBYA 2EE1A 2F52A 3EFXD 1CTMA 5CV8A 1O80A 1Q8IA 1XTCD 1SN8A 5IGDA 3KJOA 3HOWG 1KQSA 2B2TC 3D0FA 1RKNA 4NB3A 4GLVB 4DK3C 3F1ZA 2E2HB 2EJGC 4JI5L 1N33Q 1EUJA 3CAMA 2VQFQ 1QJOA 3I90A 1EY4A 4H02A 1YITA 2UUBL 4OX9Q 2KCCA 3K5MA 4OO1G 2GVBA 4Z9CB 2K5WA 4IUVA 4RHSA 4ZYSA 2X6LA 4GN3B 1ASZA 3MTSA 2L4NA 3KF6B 1EYDA 2R7FA 4QJFA 4F88A 3H0GG 3J81i 2F4VL 5M9OA 5KYIA 1BUVT 3KF6A 3HS0C 4F7XA 2RCFA 4L63B 1AW7A 1F9PA 5COYA 5CV5A 1EIFA 5ISRA 3TS0A 4NXNL 5K36H 4YHHQ 2K6AA 5I6WA 5FJ8H 4BY1H 2L9HA 4OIJA 3BG3A 1WTHA 4OELB 1HNXQ 1JQYD 1AE2A 2DY7A 4JBJA 2MGSA 4JW0A 2CHBD 1PTOC 4JV5L 5EJWA 2R3ZA 1XNQQ 4I7AA 3I4MH 1EQVA 1JJCB 1CA6A 4P71A 1YNJC 4QMGA 3TP7A 4BY7H 4OWWB 1A15A 1GOZA 2E2IH 1X3PA 2WAQG 1FNWA 1BBWA 3L7ZC 3J81j 1G91A 4KI0A 3GTKH 1GVPA 2A6HC 4XDXA 5M3FG 5NUCA 2R92B 3AFPA 4RGTA 4IURA 4IUPA 5E4WC 2WACA 2OTJA 1E7ZA 2IX1A 2R93G 4A3CH 2AUJD 1VQIA 4X3KA 1LO5D 4DR4Q 4DAMA 4E6IA 1QNKA 4HCEA 1BXTA 4X3TA 4Y7NH 1TWFB 3QOLA 2JA5G 4X3SA 3R2TA 4DR7Q 4B9XA 4G7ZC 1TS5A 2HCIA 1EWCA 4MZ9A 3L3OC 5CV4A 3K8AA 2ZXPA 4RKLA 4NXMQ 4F87A 3DWQA 2EY1A 3NQIA 2RCNA 1VQKA 5FLMH 4WJ4A 2O4XA 2N49A 3BS1A 2QEXA 4QQBX 2HQLA 1IBLL 5KRUA 1UAPA 3TS2A 2NTSA 3ULPA 1PMRA 3R3OA 4V190 1SMYC 2B2UA 1K8OA 2XRQD 2B2YA 2PZTA 3I2ZA 1GUTA 3NXWA 2L55A 3P7JA 4JYAQ 2K4KA 1LLRD 1VQHA 4QUFA 5JEAG 3MXUA 5G3LD 1Y1WB 5AJ3Q 3CP0A 1CM9A 3F2UA 1G51A 1HNWQ 1YJ9A 2HQEA 3WWVA 3PO2B 5JEAJ 4K5VA 2CKZB 3Q24A 3PUYA 4KHPL 1EEID 2YTVA 1HPCA 2UUAQ 2AKWB 3S1MH 2RDFA 2B63H 3GTQH 4I65A 4LW1A 3BVGA 3CCQA 3P75A 4RKBA 4C2MH 2IJ0A 2IPKD 1N36Q 4FXDA 1O7YA 4FDBA 1VS0A 3I70A 1ZXTA 1H9KA 4XYQA 2FMMA 1HFGA 4BY1B 1HA6A 3HRZC 4DR6L 1X55A 3I55A 3ERQA 1U5KA 5EKLA 1JE4A 2MQHA 4PMWA 1B1ZA 1SNCA 3K5OA 4LF9Q 3J7YW 3GTOH 2ZTEA 2B2WA 1X32A 3I4MB 3T51B 4A3MG 4RCNA 3S2HB 1VQGA 4A76A 1N8RC 2I5MX 4KY6A 5E1FA 5CC4A 1L1OC 2KVMA 1N32Q 2KCTA 2E2IB 4IFDJ 1D1IA 2EPBA 5JOBA 1XPRA 4OWTB 3HKZG 1QE6A 2F0UA 4RFBA 1BOSA 3GTKB 2F0SA 4P2CB 2JA7G 4A3FG 1TWCH 3FHWA 2K7VA 2MHVA 1NR4A 3CKIB 3HOWH 4KD3A 3I4NB 2QEJC 3HEJA 3NWSA 3HGBA 4GNXC 4AH6A 4MNOA 1VQBA 3E5SA 2BCOA 4TKOB 2AWOA 4DR3Q 1RF2D 1D7QA 3W5OA 3KK7A 2E2JH 4Y7NB 1N34Q 1GUNA 5M5WH 1EQTA 1EU3A 1BF4A 1Z9FA 2OQ0A 4JI1L 4BBRG 2K1BA 1CSQA 2EXDA 3SK8A 2E5LL 2Z4HA 4LFBQ 4DKAC 1TS2A 2MO0A 4CJ1B 4JOIC 1QG7A 4UAIA 2MFIA 2KJXA 2F0VA 3H0GH 4K6LA 2NVQH 1BO0A 4JC0A 1YHAA 3K81C 3S24A 2PQAB 3LGJA 1AFPA 3D4DA 4QY7A 4CJ0B 2PQAA 3S1QB 4IUUA 2VNUD 4K14A 4RWSC 5A2QE 4QGUA 3T53B 5FLXc 2DNEA 5JJKA 1YEZA 3ULLA 3KJPA 3PUVA 2JA8G 4LF6L 2SOBA 2FMCA 2J4XA 1LABA 1VQ8A 2K33A 2RSOA 4PMCA 5DNFA 2UU9L 3TBIB 1GXDC 2MNAA 1MSGA 1C8CA 4IN3A 4NDXA 3Q8DA 1TU2B 3S1MB 4DV6L 1B3AA 4N8X1 2A69C 4X62Q 2K28A 3S16H 3FPPA 1PRTC 3F2CA 3VYRA 3F2DA 4C2MB 1IBMQ 1SNOA 5LMUL 1GM5A 3GO5A 1S3OA 5I4DA 5IYBG 1DOLA 3FKIB 2R93H 4DUYQ 2R7DA 1JWSD 2PPBC 2KEEA 3J80E 2ASBA 3UE1A 1JICA 5J3BA 1C9OA 3GTOB 4JV5Q 5ELOA 2OTLA 4DV4L 1UE7A 2SDFA 4N9PA 4KKTA 3MZ5A 1KAAA 1BDOA 4QUCA 5C5MA 3A0JA 3TSSA 1X3FA 3UI2A 1GUSA 1PVOA 4Y52H 4DV2Q 4F8MA 3CD6A 1HNZQ 4EQPA 3RD4A 1Z7TA 2K04A 3HOWB 2I46A 3NHHA 2KOLA 4C1NK 4APVA 4LUVA 1PH1A 3TZUA 1GD7A 2RDHA 5A35A 4LAAA 2XIWA 1Y8PB 1HA5A 2AQ2B 2C9OA 3FRPB 3HOZH 3W2DA 1PYBA 2E2JB 2Z0SA 3NTKA 3QIAA 4H13C 4KLKA 2HHHL 4AYBG 1DJRD 5M5WB 4GOPB 5CGKA 4JPBW 4DV3Q 1K28A 3CCRA 4DPGA 3G71A 4TVAB 4GOPA 1A6XA 4QCLA 2PCFB 2LKVA 1CHQD 3NTIA 3H0GB 3SK5A 2NVQB 3A54A 2F0NA 3J7AV 4A3KH 3ND9A 2E74C 1SMXA 3K5NA 2F0GA 2G9DA 2WV6D 3MVVA 3STBD 1M1KC 4R9WA 1STHA 3GTPH 4EQOA 1R9TH 2F0DA 2NVYH 4LK1C 3EN2A 1V43A 1Y8NB 2B8GA 2B2VA 2N55A 1SXTA 5M3MG 2NB0A 4A3MH 3H09A 1KRTA 3ZJYC 1Q12A 3KLSX 3CF5A 4HIDA 5EAYA 2Q8TA 4CDDC 3TMEA 1K0RA 2WAQB 4EX5A 2R7ZH 2K01A 1EY5A 3VR2A 1LT5D 1JT8A 4RH6A 1Q3LA 1S5ED 3JAME 1C4QA 5M3FB 1G8ZD 3K7AH 3S16B 4DGZA 3E0EA 4DR2L 1PZJD 1VQ6A 2R93B 3IFDA 2WIIB 4DK0A 5KIXA 2VL6A 4N9TA 1EIGA 4XIGS 3GP7A 4CDCC 3H91A 2IHFA 4IPCA 5JJLA 2I0QA 4R8IA 1STNA 1HRJA 1UE5A 4NPSA 1MKHA 2D5DA 4NP5A 1SSOA 2NYZD 5FJ8G 4LNQA 4BWGB 1SYCA 3GTLB 3MXPA 1KDAA 2JSOA 3A8IE 1D8LA 3D8GA 2CQAA 1VQOA 2VUMG 1W2BA 4CJ2C 4YWMA 3J80i 4ZAIA 3V05A 3LX0A 2BE5C 1EYAA 5C3EG 2HCCA 2A5HA 4BY7G 1WCMH 1ET6A 1CI3M 1VMCA 2P5ZX 5C4JB 4O2DA 2HD3A 3OMGA 4JI4Q 4OHJA 2BE5D 4KY5A 3I73A 2UXDL 1X65A 1UWVA 2LY7A 4L8JA 2ZT9C 2AUKA 4CGYB 1WTRA 2JA8H 1A3TA 3PCOB 1LTID 2K5VA 2KA7A 2A6EC 3HFZB 4A3JG 3GTMH 4XQNA 2XWBB 4X65L 4P75A 3J81E 2D0PA 3CCJA 2A6ED 2IW3A 1QVFA 4HIKA 4GKKL 2CWAA 3A5UA 2X69A 2WB1G 1CSPA 5C4HA 3HKSA 4G57A 3NBIA 2SEBD 3ICEA 3I72A 4A3GG 5BR8L 3GTPB 1IL8A 1R9TB 2NVYB 3D3RA 3D6WA 2CWPA 3KBGA 3SDZA 5FLMG 1I3QH 1BCPB 1XPOA 3HOUH 4JI2L 1VCIA 4A3MB 4HTHA 1WOCA 1XNRL 1ILPA 1II3A 3HP3A 4P72A 5FO9B 1UUPA 5FOBB 4HSVA 5ELCA 2VQEL 2UU9Q 2X6GA 4C3HH 2H5XA 2L12A 3NSWA 1DYQA 3HKZB 2PO4A 2Q2TA 2Y0SG 5DLQE 3SE0A 1CT1D 2OWOA 4DV6Q 1YIJA 1GUWA 2JA7B 4A3FB 4OGQC 2ZM6Q 1X54A 3OHXC 3K7AB 2LSSA 5JPMC 4IUQA 1VQ9A 3E9IA 3OPOA 3PMFA 5JJZA 1FVIA 1J9OA 1KDCA 2B63G 5JVG3 3FVQA 5IT9c 4OIKA 1L0XB 1VQDA 1G6ZA 1CKMA 3NK9A 1YZ6A 4DV4Q 4BBRB 2NZOA 3BJUA 2Z6KA 2CW0C 1LT3D 3I3CA 3J7ZC 4FYDA 5C6AA 2ZXRA 4X64L 4DR1L 5EBDA 3NE5B 1M4VA 1S40A 3IKJA 4MTNA 2NVXH 4K8JA 3MC0B 1YHBA 3SR1A 1M8AA 3KLSA 2L5TA 3H6MA 3DWPA 4WORA 2O5JC 1C0AA 3EIVA 3EBEA 1EOTA 1WCMB 1KDBA 1A8VA 3EA6A 1PTOH 1X3QA 2XVSA 5TSSA 1Z47A 4JI6L 3TP6A 3I4LA 3KF8B 5M5YH 4RCOA 2ALYB 5M3MH 3BVZA 3VYUA 1YVCA 3DLLA 2JA8B 3EJIA 4CHTB 1EY8A 4P73A 1X56A 2HHHQ 3FEWX 2NN6I 5A2QL 1OTCA 2WAQE 3A8KE 1WTQA 2K75A 2EDGA 2LXKA 4C3JH 5C0XG 1JCKB 2JA9A 1J8IA 1STAA 4IOAA 5CMDA 2E75C 1GHJA 3O13A 3AB9A 2XRSD 2QF7A 4B3SL 3K0XA 2M9VA 5JVH3 1I3QB 3U50C 1KIXA 4IFDI 1P8LA 3U4VA 4HIOA 1B3QA 3PIOA 5IGFA 4DV7L 5IODA 3J80L 4LF8Q 1NNXA 2VUMH 3CC2A 5KNDA 3TEHB 5I6YA 4B3RQ 2TMPA 2KUMA 1AP0A 3ZYYX 3VYSA 1IXRA 5C3EH 4DAPA 2GA4B 1IBKQ 2B2TA 1PTOD 2OT2A 1Q1BA 1H9MA 1JWUD 4LMQD 4DR2Q 1VQEA 2L11A 1A2UA 4CDFC 4WFN3 3RZOB 1YNJD 2ATWA 3TZDA 1H95A 3G48A 1C7YA 4FF2A 2QKIC 1F77A 5IY0A 2DJFC 4A3JH 3H94A 4POFA 5CR3A 4AYBB 2XSCA 4A3BH 2K5DA 5AFWA 1S5DD 5IYDH 1PDQA 3RLOA 4WRDA 4DV1L 2A6HD 1U9RA 1ENAA 4TSSA 1QZHA 4IUNA 4XT3B 4MIUA 1UE6A 4HEDA 1WTWA 3L2PA 3TDQA 1XXGA 4A3GH 4I7ZC 2NVXB 1SDFA 3S17H 4DUZL 1SJHD 2BA0A 1Q8KA 1TWGH 3BZKA 2DNCA 4M1UB 1TS4A 5EQ0A 5EKIA 5IYCH 2OEOA 1PTOB 3U4ZA 2NBFA 3PIO3 1E1TA 5D14A 2EXZA 5EPJA 5M5YB 2YU9H 4NW2A 4ABNA 5M3MB 2QA4A 3OW2A 4JI7L 1B2TA 1B9NA 2PI2A 3IRBA 3QO2A 5C4ZA 3NWTA 4O0AA 4DV0Q 5GQOA 2CQOA 2RVLA 1NSNS 5I2XA 4JI3L 4X65Q 1DGSA 3E3XA 3HKZE 1KC8C 4HIMA 1HZCA 4NKLA 4C3JB 3CCEA 5EPLA 1RJTA 3S1RH 3HOZG 4IOCA 3KLRA 4GKKQ 1SMYD 1RDPD 4A3DG 5DM63 2EZVA 5BR8Q 2E2DC 4BA1I 1NCVA 4H0LC 1SRUA 4A93H 1AE3A 4CKCA 1FNUA 4QL5A 3JAML 2C35B 1I5FA 1IKLA 2AQ3B 2RHSB 4DV5L 5L37A 4A3KG 3T16A 4IO9A 3HZXA 5M5XH 4DXGA 1ENCA 2JP1A 4ZK9B 4LF5Q 3S14H 2UXBL 4RG1A 3S15H 4IPDA 1IKMA 1NMGA 1TR5A 1XNRQ 3N52A 3M7NA 1PLFA 3PV0A 2VQEQ 3A56A 1I4GA 4LFCL 1NMFA 3I91A 2VUMB 1ZEQX 2VW9A 1IYVA 2KCNA 4XT1B 1ESFA 4ZUIA 1STGA 1A3VA 4L5RC 3NENA 5C3EB 1B4OA 3CXCA 4CDEC 5T1IA 5J22A 4JBKA 4K0KL 4BY7B 3UDXA 3QG1A 2R7ZG 5KNCA 2EY6A 2AQ1B 4RGMA 2BH2A 2D2CC 1I6HH 4K2LA 5LL6X 2EYJA 4BXXG 1HXYD 2MUYA 3DEPA 4A3JB 1I94L 1PXUA 3NEMA 3MEHA 1K8GA 1U4RA 4X66Q 5CBAE 4A3IG 5LHY1 2D62A 1TKWB 2H4OA 2ZTCA 5HGTA 1QVGA 4EVOA 2KHIA 1SE8A 5C0XH 2EYFA 2WB1B 2MP1A 5C3WA 1HJPA 4R1JA 4DR1Q 1H9RA 4JCVE 4ME5A 1K8MA 1DXMA 4DAYB 4A3GB 1SNQA 3J81L 4B3ML 3S17B 4DAYA 3Q22A 4L6TB 2UXCL 1ML0D 1FJGQ 2ICEC 2ENBA 5BN3A 1DZ1A 1B7YB 4JI6Q 2YU9B 1XX8A 3A5ZB 2Q8RE 2V4DA 4LFAL 1K0SA 3E6ZX 1ESRA 4BS9A 1L1OB 1J5EL 4M8AA 2I5HA 1GUOA 1WCMG 1L1OA 1ICWA 1EQRA 2K14A 1SFOH 1CFMA 5KYLA 1RTOA 1ENFA 5GAEC 4ME3A 4JI5Q 3RMHA 3DHQA 3SK4A 3MFGA 3OWFA 2Y0SB 5DAUA 3S1RB 4DK6C 2UUBQ 1E2VA 1RL2A 2DJGC 1RODA 1V9PA 4KKSA 3L0OA 1FGUA 3MAQA 1TWAH 4GNXB 1Y1VH 1U4MA 4A75A 1XMOL 3M4OH 4GNXA 1X9NA 2IY5B 1VQAA 3HOXG 2OCEA 4KJNA 2K5QA 1ZKOA 2F4VQ 4B3SQ 1EYGA 4LF4L 2B63B 3GTQB 1O78A 2KBNA 3GQBA 1S5BD 1VQ4A 1PH5A 2MPMA 3DMUA 4AYBE 2HDMA 3R2IA 3S14B 3S15B 1JOOA 4LWCA 3QR8A 1SAPA 4NXNQ 2A69D 1F2MA 2KHJA 1QNUA 3FDTA 4JOIA 3UDIA 1YHQA 1PRTD 2JK8A 2MO1A 4RHRA 2JEBI 3DUZA 3GD7A 2YTYA 1STYA 3PIPA 1GHKA 3HOUG 3SGIA 3HG9A 1O7LA 2N3SA 1E3PA 1L0YB 2QDBA 4DFAA 1Y14B 1S5CD 2NTTA 3K80C 2PW7A 1E2ZA 1HCZA 4L5QA 2V1CC 1SYEA 1CKOA 4C3HG 2PI2E 2DGYA 1OXXK 3GV6A 4UHVA 3CHBD 2C5CA 4UP8A 1VQFA 1HTLD 2CH4A 1I6HB 3P20A 5FLXE 1TWCB 4C3IG 1BBUA 4KTAA 1TVXA 1LTTD 2K32A 4YCVA 2ZTDA 1G2SA 3DM1A 3BVMA 1Y8OB 1K83H 1NUCA 3HOVH 1YNXA 2JE6I 3BDLA 2LFNA 1GJXA 1IW7C 3C3LA 1PRTB 4BBSG 1MJCA 1JJ2A 4LF7L 5C5LA 4A3DH 2EY2A 2L1BA 2ZJQA 1VQCA 1SNPA 3T1YL 1F2LA 1IW7D 1QUQB 3DEOA 4DNIA 1QUQA 3VR4A 2FXQA 1BCPF 5ELDA 4R8NA 3SVMA 1KLGD 1NE3A 1S4ZA 2PW5A 4JI7Q 1CZWA 4XYOA 2E8GA 2ZJRA 1IBLQ 4PZ7A 1VQJA 3OSOA 3PIP3 4K5XA 4HSPA 4UDUC 5CORA 1MSHA 1EY0A 5GAHC 1N33L 4PZ8A 1WTVA 1L2FA 1SFOB 1NY4A 3KYHC 4JI3Q 2NN6H 2EYPA 2VS1A 4XQQA 2WFWA 5HURA 1T5XD 4IJHA 1AZQA 2N78A 1IHZA 2NZ1D 1TWAB 1WTPA 1XMQL 1XWEA 1OXSC 1UE1A 2F0TA 5IWAL 1PHJA 3M4OB 1RHPA 1JB7A 5LL6S 1Q86C 3OMCA 4KHPQ 3ONAB 4C3JG 1U4LA 3W1GA 2L15A 3LNNA 4BXXH 1SROA 4KN4C 4DV5Q 2A8VA 3TP5A 5GADC 1H9SB 2VZAA 1ZYRC 4ODGA 2UXBQ 3IAYA 1H9SA 2F0KA 4A3IH 1D5ZC 4U68A 1HNXL 4HJ7A 2TSSA 4DR6Q 1ZYRD 4LFCQ 2WB1E 5E7NA 1Q90A 2G5DA 3D6CA 1AZPA 3D31A 1VQPA 1VF7A 2A1AA 4FP5D 3NQTA 2B8FA 3QB3A 1KRSA 1TWHH 1GO3E 5BN5A 1EY6A 3RUZA 1WI5A 4JI8L 2IT1A 2KQ3A 4N8FA 1O7ZA 4QB4A 1HH2P 1EFWA 4XXEA 4HCSA 5CV7A 1HHVA 4DA2A 3HOYG 5KNBA 1I94Q 2WP8J 2F0JA 1PFNA 2H1EA 1ASYA 5I2YA 5LMNW 2JEAI 4OO1I 2Y0SE 5HY6A 2F0WA 4KD4A 2JQOA 3HOZB 4S3SA 2DN8A 3T13A 4DR7L 4A3DB 3KDFB 1TT2A 3LWUA 4GLXA 2F0IA 3KDFA 1WJJA 4NXML 4A3BG 4JI1Q 5IYDG 4YCUA 2D9UA 1EU4A 2F3IA 2JJQA 3HOXH 2E5LQ 3AQQA 3NBHB 1F2YA 1PZKD 3MEFA 3NBHA 3I8ZA 4MHEA 3K6OA 1NAPA 1JOQA 5KGUA 4A3KB 3CCVA 1VF5C 5J1ZA 4IPHA 2K05A 1YJWA 1LTGD 5IYCG 4TRDA 4GKJL 5E4XA 1CQVA 2FJ2A 1QOHA 2XN9C 4JYAL 3CRLC 1G291 1PZID 1JR0D 1R4PB 3NTHA 4IALA 4LF6Q 5IGEA 3MWYW 2ES2A
chains in the Genus database with same CATH topology
3NUCA 2AWNA 5BN4A 2E76C 3K57A 2R7ZB 1D5MC 3SEBA 5D3IB 4G7HC 5IGCA 4DAVA 3DXJC 1HTPA 4IQZA 4A3IB 3R8BA 2RKSA 3D4WA 5DEHA 1EY7A 3C1EA 3A55A 1B53A 2J7ZA 1I4PA 1HQMC 1R4QB 2B39A 3IL8A 2MJ8A 3Q23A 4ZRZA 3CU7A 1W6KA 4EGVA 1FR3A 1PTOF 2F0EA 4ILWA 2VB3X 2CW0D 4FXKC 3VA7A 1OO9B 3WOFA 1MBYA 1JOKA 4U673 3VYTA 3V96A 2IL8A 2HUGA 1I4RA 3EROA 1TS3A 2JYOA 3MFYA 3GTMB 5FO7B 4J8QA 1QB5D 3HOXB 1D2BA 3MA2B 1BNZA 3A7LA 2KHSA 1I6VC 3BYTB 4LJZC 2WKCA 5C0XJ 1OXUA 4K2KA 4MN3A 5D3DA 5IT9E 5ELEA 3G6JB 2RDGA 2YYZA 3K5LA 1QILA 2O5IC 1A3UA 3VR5A 1RTNA 4KJOA 3H3VC 1G2TA 2EY5A 3MXNA 1FYCA 4DF7A 3HOUB 2EYHA 3A8JE 1KLUD 5G3LF 2F0QA 1I4QA 4K8IA 5IOCA 2Z8LA 4C3HB 2F3VA 1KTKA 4KKUA 1EZ6A 2PZUA 4C3IB 3K0YA 3C1FA 4KMUC 1OXVA 3SK6A 1WD0A 3NPPA 4G4KA 3S1NB 4H44C 5FLXL 3GTGB 4J6HA 4BBSB 1I4XA 1LV9A 1PFMA 1RD9D 4PMBA 2B2UC 2B2YC 3OOCA 2A74C 1QCBD 3S9WA 4CKEA 3OW7A 2HDLA 2FFKB 1HFNA 5IGGA 2F0PA 3NP8A 4WJWA 1JC7A 1D5XC 2PNRC 4OL7A 5E3FA 3KUPA 4KV6A 2QCPX 1LTAD 4KK7A 1MGSA 1V8QA 4H7BA 2M00A 4QF4A 1DOMA 4BA2I 1CQFA 1YNNC 2Q8IB 2NVTB 1AEXA 1BR9A 2PQEA 4RGNA 1DCZA 4ZQ3A 5CV6A 2B2WC 1SYFA 1VMPA 1KABA 1YNND 5I9PA 4ZUJA 3QOJA 2RBMA 1V1OA 2O2LD 2EJFC 1Y69U 2F0LA 1FD7D 2ID0A 2OXPA 5KEEA 1EWHA 4TQUS 1UNSA 1OXTA 1CK1A 2XWJB 2NN6G 4YIJA 3GTJB 2EYLA 4DN4M 3X3MA 3HOYB 5JPNC 2EYMA 2IX3A 2EJMA 3MXGA 2IWHA 1WTOA 1F2ZA 1H9JA 1B44D 2FINB 1HQRD 2F0HA 3PUXA 3MHBA 1PRTF 2NWGA 3ND8A 4DXFA 2F4IA 3DWAA 4XTCS 1WVLA 3PUZA 4Q0FA 1LTSD 4IFDG 4A3BB 4RA8A 3TP8A 2M2LA 3WOEA 2R61A 3QWNA 1EEFD 2RA4A 4RGOS 3TN2A 5IIFA 4XQJA 2NUCA 1B9MA 4IUTA 1TWGB 2QILA 4FF3A 1IYUA 1LACA 2K03A 4B9WA 3J7AF 2EOTA 2LS01 3M7GA 1DOKA 4OO1H 1VDZA 2RQXA 3VA5A 3L9AX 4FF4A 2EVBA 2I07B 3X3NA 4O1NA 2VXWA 4K5WA 1W6JA 5CV9A 5DM73 5EKKA 3RZDB 4QIWB 4J1MA 3PO3B 4IZ8A 1LTBD 1SE3A 1RCVD 4C56C 5ELBA 4A93B 4PV1C 3C2PA 2ICIA 1JWMD 3EVQA 3CRKC 4JK1C 2BDOA 2JXMB 5M5XB 1SE4A 1WTXA 5CBEE 1XYIA 1STEA 3FMCA 3OWEB 3WDNA 1I4HA 3IFTA 3RLFA 1DONA 5EGTA 1PYWD 2F0MA 3ITPA 2F0FA 1SNDA 3N6RA 2G9HD 4DNTB 1EIHA 2XNAC 1GUGA 3URYA 2BOSA 3W3AA 4ZLTF 1D6EC 2PYKA 1TQOA 1SBBB 1KNAA 5EBCA 1CHPD 1EYCA 4GZYC 2B2VC 4FO2A 1SE2A 1E0BA 2JA6B 2R6GA 3T4AC 3G7LA 1I50B 2KEDA 4K6DA 2WKDA 4FF1A 3FPUB 2PMZB 4DK1A 3BDCA 3M3YB 5EPKA 5C44B 3E0JA 1B50A 2IX0A 4FXGC 3AMUA 3VR3A 1SYBA 1SJED 5JEAH 5T1GA 4DU9A 5IT9L 1JORA 1T5EA 1AN8A 2J0TD 3K59A 2F03A 5FK9C 1U4PA 5C4XB 5I9OA 1BQQT 2N88A 2SNSA 4EQNA 2BDNA 1Y1VB 4PNYA 3BYYB 4HN7A 3U9OA 3M4YA 3GV3A 1Q1EA 5JAVA 4ID6A 2EYOA 4CBVA 3V2TA 1SNMA 4IFDH 1TY2A 4KY7A 5FO8B 5IGBA 1WD1A 4DNRB 4A3EB 1CZGA 1EFID 5D65A 3SXHA 3P1HA 4ULLA 3QJYA 1S5FD 4O42A 4Q5VA 1MI2A 1QWYA 4ZKBB 1MD2D 3OIPA 3U9SA 2FHTA 3Q6SA 3KBXA 3K58A 3CQZB 2PZWA 2JA5B 1LT6D 1FNVA 4FVMA 1V1PB 4HR7B 1F9SA 5FKAC 3PUWA 5K36G 1V1PA 5C0XI 1K83B 1F9QA 3HOVB 1LTRD 5K5PA 3AU7A 1A2TA 4KHZA 1BCPC 4C1NI 1SYGA 1Z6HA 3OIQA 2RSNA 4HMJA 2CVRA 1ILQA 1HUNA 1BCPD 3VR6A 4CKBA 1HUMA 3R93A 3A7AB 2KECA 1JB3A 2A73B 3BZDB 3C46A 2VB2X 3M85A 3T56B 1DM0B 1SYDA 1F9RA 3LWEA 4RAUC 4G7OC 1NR2A 2WINB 1ONLA 1EZ8A 4NMZA 3BDOA 4PQXA 2F1MA 3EQLC 1E2WA 1PFBA 4ZKCB 4KHVA 2Z4IA 1FGBD 2F3WA 4FNFA 2Z1CA 5CYUA 2L0CA 2SNMA 2BA1A 1DD2A 2OF1A 3SHLA 1TY0A 1LT4D 5J39A 2LMCB 3Q0AA 2DY8A 1SEBD 1TWHB 5C3XA 4HMIA 1BBXC 1D1KA 1C48A 1UEAB 4KN7C 5F2DA 1EL0A 2A68C 4HAEA 4X3UA 1ET9A 2A68D 5ELFA 3D4RA 2F0OA 1CA5A 4JBWA 4B08A 1STBA 1KNEA 1EY9A 2ZXOA 4V0BA 3S2DB 1TIID 3KF8A 2EE1A 3EFXD 1CTMA 5CV8A 1O80A 1Q8IA 1XTCD 5IGDA 2B2TC 1RKNA 2E2HB 2EJGC 1QJOA 3I90A 1EY4A 2KCCA 3K5MA 4OO1G 4Z9CB 2K5WA 4IUVA 4RHSA 4ZYSA 2X6LA 3MTSA 2L4NA 1EYDA 4F88A 5M9OA 5KYIA 1BUVT 3HS0C 4F7XA 4L63B 1AW7A 1F9PA 5COYA 5CV5A 5ISRA 5K36H 2K6AA 5I6WA 2L9HA 4OIJA 3BG3A 1JQYD 2DY7A 2MGSA 2CHBD 1PTOC 5EJWA 2R3ZA 1EQVA 1CA6A 1YNJC 4QMGA 3TP7A 1A15A 1GOZA 1X3PA 1FNWA 3L7ZC 1G91A 4KI0A 2A6HC 4XDXA 5NUCA 2R92B 4RGTA 4IURA 4IUPA 5E4WC 2WACA 2IX1A 2AUJD 4X3KA 1LO5D 4E6IA 1QNKA 4HCEA 1BXTA 4X3TA 1TWFB 3QOLA 4X3SA 3R2TA 4B9XA 4G7ZC 1TS5A 2HCIA 1EWCA 3L3OC 5CV4A 2ZXPA 4RKLA 4F87A 3DWQA 2EY1A 3NQIA 2O4XA 3BS1A 5KRUA 1UAPA 2NTSA 1PMRA 3R3OA 4V190 1SMYC 2B2UA 1K8OA 2XRQD 2B2YA 2PZTA 1GUTA 3NXWA 2L55A 3P7JA 1LLRD 4QUFA 5JEAG 3MXUA 5G3LD 1Y1WB 1CM9A 3F2UA 2HQEA 3PO2B 5JEAJ 4K5VA 3Q24A 3PUYA 1EEID 1HPCA 2RDFA 4I65A 3BVGA 3P75A 4RKBA 2IJ0A 2IPKD 4FXDA 1O7YA 3I70A 1ZXTA 1H9KA 4XYQA 2FMMA 1HFGA 4BY1B 1HA6A 3HRZC 3ERQA 5EKLA 1JE4A 4PMWA 1B1ZA 1SNCA 3K5OA 3J7YW 2B2WA 1X32A 3I4MB 3T51B 4RCNA 3S2HB 4KY6A 5E1FA 5CC4A 2KVMA 2E2IB 4IFDJ 1D1IA 2EPBA 5JOBA 1QE6A 2F0UA 4RFBA 1BOSA 3GTKB 2F0SA 4P2CB 2K7VA 2MHVA 1NR4A 3CKIB 4KD3A 3I4NB 2QEJC 3HEJA 3NWSA 3HGBA 3E5SA 4TKOB 2BCOA 2AWOA 1RF2D 3KK7A 4Y7NB 1GUNA 1EQTA 1EU3A 1BF4A 2K1BA 3SK8A 2Z4HA 1TS2A 4CJ1B 1QG7A 4UAIA 2KJXA 2F0VA 4K6LA 1BO0A 1AFPA 3D4DA 4CJ0B 3S1QB 4IUUA 2VNUD 4K14A 4RWSC 5A2QE 3T53B 2DNEA 3PUVA 2SOBA 2FMCA 2J4XA 1LABA 2K33A 2RSOA 4PMCA 5DNFA 3TBIB 1GXDC 1MSGA 1C8CA 4IN3A 4NDXA 1TU2B 3S1MB 1B3AA 2A69C 2K28A 3FPPA 1PRTC 3VYRA 4C2MB 1SNOA 3GO5A 5I4DA 1DOLA 3FKIB 1JWSD 2PPBC 2KEEA 3J80E 1JICA 3GTOB 2SDFA 4N9PA 4KKTA 3MZ5A 1KAAA 1BDOA 4QUCA 5C5MA 3TSSA 3UI2A 1GUSA 4F8MA 4EQPA 3RD4A 1Z7TA 2K04A 3HOWB 2I46A 3NHHA 2KOLA 4C1NK 3TZUA 2RDHA 5A35A 4LAAA 2XIWA 1Y8PB 1HA5A 2AQ2B 2C9OA 3FRPB 3W2DA 2E2JB 3NTKA 3QIAA 4H13C 1DJRD 5M5WB 5CGKA 1A6XA 4QCLA 2PCFB 2LKVA 1CHQD 3NTIA 3H0GB 3SK5A 2NVQB 3A54A 2F0NA 3J7AV 3ND9A 2E74C 3K5NA 2F0GA 2G9DA 2WV6D 3MVVA 4R9WA 1STHA 4EQOA 2F0DA 4LK1C 1V43A 1Y8NB 2B8GA 2B2VA 2N55A 1SXTA 2NB0A 3H09A 1Q12A 3KLSX 2Q8TA 3TMEA 2WAQB 2K01A 1EY5A 3VR2A 1LT5D 4RH6A 1Q3LA 1S5ED 3JAME 1C4QA 5M3FB 1G8ZD 3S16B 4DGZA 1PZJD 2R93B 3IFDA 2WIIB 4DK0A 5KIXA 4N9TA 1EIGA 4XIGS 3GP7A 3H91A 4R8IA 1STNA 1HRJA 2D5DA 4NP5A 1SSOA 2NYZD 4BWGB 1SYCA 3GTLB 3MXPA 1KDAA 2JSOA 3A8IE 3D8GA 2CQAA 4CJ2C 4ZAIA 3V05A 3LX0A 2BE5C 1EYAA 2HCCA 2A5HA 1ET6A 1CI3M 1VMCA 5C4JB 3OMGA 4OHJA 2BE5D 4KY5A 3I73A 2LY7A 4L8JA 2ZT9C 2AUKA 4CGYB 1WTRA 1A3TA 1LTID 2KA7A 2A6EC 4XQNA 2XWBB 3J81E 2A6ED 2IW3A 2X69A 5C4HA 4G57A 3NBIA 2SEBD 3I72A 3GTPB 1IL8A 1R9TB 2NVYB 3D3RA 3D6WA 3KBGA 3SDZA 1BCPB 1VCIA 4A3MB 4HTHA 1ILPA 1II3A 3HP3A 5FO9B 1UUPA 5FOBB 4HSVA 5ELCA 2X6GA 2L12A 3NSWA 1DYQA 3HKZB 2PO4A 3SE0A 1CT1D 1GUWA 2JA7B 4A3FB 4OGQC 3OHXC 3K7AB 5JPMC 4IUQA 3OPOA 3PMFA 5JJZA 1J9OA 1KDCA 5JVG3 3FVQA 4OIKA 1L0XB 1G6ZA 3NK9A 4BBRB 2CW0C 1LT3D 3I3CA 4FYDA 5C6AA 2ZXRA 5EBDA 3NE5B 1M4VA 3IKJA 4K8JA 3MC0B 3SR1A 1M8AA 3KLSA 2L5TA 3H6MA 3DWPA 4WORA 2O5JC 1EOTA 1WCMB 1KDBA 1PTOH 3EA6A 1X3QA 2XVSA 5TSSA 1Z47A 3TP6A 3I4LA 4RCOA 3BVZA 3VYUA 2JA8B 3EJIA 4CHTB 1EY8A 3FEWX 2NN6I 5A2QL 3A8KE 1WTQA 2EDGA 5C0XG 1JCKB 1J8IA 1STAA 5CMDA 2E75C 1GHJA 3O13A 3AB9A 2XRSD 2QF7A 2M9VA 5JVH3 1I3QB 4IFDI 5IGFA 5IODA 3J80L 5KNDA 5I6YA 2TMPA 2KUMA 1AP0A 3ZYYX 3VYSA 4DAPA 2GA4B 2B2TA 1PTOD 2OT2A 1Q1BA 1H9MA 1JWUD 4LMQD 2L11A 1A2UA 4WFN3 3RZOB 1YNJD 3TZDA 4FF2A 2QKIC 1F77A 3H94A 5CR3A 4AYBB 2XSCA 2K5DA 5AFWA 1S5DD 1PDQA 4WRDA 2A6HD 1U9RA 1ENAA 4TSSA 4IUNA 4XT3B 4MIUA 4HEDA 1WTWA 3TDQA 1XXGA 4I7ZC 2NVXB 1SDFA 1SJHD 2BA0A 2DNCA 4M1UB 1TS4A 5EQ0A 5EKIA 2OEOA 1PTOB 2NBFA 3PIO3 5D14A 2EXZA 5EPJA 5M5YB 4NW2A 4ABNA 5M3MB 1B2TA 1B9NA 3QO2A 5C4ZA 3NWTA 2RVLA 1NSNS 5I2XA 4NKLA 4C3JB 5EPLA 1RJTA 3KLRA 1SMYD 1RDPD 5DM63 2EZVA 2E2DC 4BA1I 1NCVA 4H0LC 4CKCA 1FNUA 3JAML 1IKLA 2AQ3B 3T16A 3HZXA 4DXGA 1ENCA 2JP1A 4ZK9B 1IKMA 1TR5A 3N52A 3M7NA 1PLFA 3PV0A 3A56A 1I4GA 3I91A 2VUMB 1ZEQX 1IYVA 2KCNA 4XT1B 1ESFA 4ZUIA 1STGA 1A3VA 5C3EB 1B4OA 5T1IA 5J22A 4BY7B 3QG1A 5KNCA 2EY6A 2AQ1B 4RGMA 2D2CC 4K2LA 5LL6X 2EYJA 1HXYD 2MUYA 3DEPA 4A3JB 1PXUA 3MEHA 1U4RA 5CBAE 5LHY1 2D62A 1TKWB 2H4OA 5HGTA 4EVOA 5C0XH 2EYFA 2WB1B 2MP1A 5C3WA 1H9RA 4ME5A 1K8MA 1DXMA 4A3GB 1SNQA 3J81L 3S17B 4DAYA 3Q22A 4L6TB 1ML0D 2ICEC 2ENBA 5BN3A 1DZ1A 2YU9B 1XX8A 2Q8RE 2V4DA 3E6ZX 1ESRA 4BS9A 4M8AA 1GUOA 1ICWA 1CFMA 5KYLA 1RTOA 1ENFA 3RMHA 3DHQA 3SK4A 3MFGA 3OWFA 2Y0SB 5DAUA 3S1RB 1E2VA 4KKSA 1RODA 3MAQA 1U4MA 4KJNA 2K5QA 1ZKOA 2B63B 3GTQB 1O78A 3GQBA 1S5BD 2MPMA 3DMUA 3S14B 2HDMA 3R2IA 3S15B 1JOOA 1SAPA 2A69D 1F2MA 1QNUA 3FDTA 1PRTD 4RHRA 2JEBI 3DUZA 3GD7A 1STYA 1GHKA 3HG9A 1O7LA 1L0YB 2QDBA 4DFAA 1S5CD 2NTTA 2PW7A 1E2ZA 1HCZA 1SYEA 4C3HG 3GV6A 1OXXK 3CHBD 2C5CA 1HTLD 1I6HB 3P20A 5FLXE 1TWCB 4C3IG 4KTAA 1TVXA 1LTTD 2K32A 1G2SA 3DM1A 3BVMA 1Y8OB 1NUCA 2JE6I 3BDLA 2LFNA 1GJXA 1IW7C 3C3LA 1PRTB 5C5LA 2EY2A 2L1BA 1SNPA 1F2LA 1IW7D 3DEOA 3VR4A 1BCPF 5ELDA 4R8NA 3SVMA 1KLGD 2PW5A 1S4ZA 1CZWA 4XYOA 3OSOA 3PIP3 4K5XA 4HSPA 4UDUC 5CORA 1MSHA 1EY0A 1WTVA 1SFOB 2NN6H 2EYPA 4XQQA 5HURA 1T5XD 1AZQA 1IHZA 2NZ1D 1TWAB 1WTPA 1XWEA 1OXSC 2F0TA 3M4OB 1RHPA 5LL6S 3OMCA 3ONAB 4C3JG 1U4LA 3LNNA 4KN4C 3TP5A 1H9SB 1ZYRC 4ODGA 3IAYA 1H9SA 2F0KA 1D5ZC 4U68A 2TSSA 1ZYRD 1Q90A 3D6CA 1AZPA 3D31A 1VF7A 4FP5D 3NQTA 2B8FA 3QB3A 5BN5A 1EY6A 3RUZA 2IT1A 2KQ3A 1O7ZA 4QB4A 4XXEA 4HCSA 5CV7A 1HHVA 4DA2A 5KNBA 2WP8J 2F0JA 1PFNA 2H1EA 5I2YA 2JEAI 4OO1I 2F0WA 4KD4A 3HOZB 4S3SA 2DN8A 3T13A 4A3DB 1TT2A 3LWUA 2F0IA 2D9UA 1EU4A 1F2YA 1PZKD 3NBHA 3I8ZA 4MHEA 3K6OA 1NAPA 1JOQA 5KGUA 4A3KB 1VF5C 5J1ZA 2K05A 1LTGD 4TRDA 5E4XA 1CQVA 2FJ2A 1QOHA 2XN9C 3CRLC 1G291 1PZID 1JR0D 1R4PB 3NTHA 4IALA 5IGEA 3MWYW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAP A;  3R93 A;  2KEC A;  1QNK A;  2NYZ D;  3UI2 A;  4X3T A;  4XT1 B;  4LMQ D;  1KNE A;  3FDT A;  4OIK A;  4X3S A;  1G6Z A;  2L11 A;  2HCI A;  1B4O A;  2K04 A;  5T1I A;  2KOL A;  4CJ2 C;  1U4P A;  3TZD A;  4U68 A;  4ZAI A;  2EE1 A;  1O80 A;  2N88 A;  1EQT A;  1BF4 A;  3I3C A;  2BDN A;  2XIW A;  2HCC A;  5AFW A;  1F9R A;  3LWE A;  2B2T C;  2K1B A;  1PDQ A;  4RAU C;  1AZP A;  1VMC A;  3DEP A;  4CJ1 B;  1WTX A;  1NR2 A;  1QG7 A;  4UAI A;  3GV6 A;  1M8A A;  3GV3 A;  4XT3 B;  1BO0 A;  1B53 A;  1U4R A;  2J7Z A;  5CBA E;  5CBE E;  4HED A;  3I90 A;  1WTW A;  1XYI A;  1WD0 A;  1EOT A;  2B2U A;  1WTR A;  1PFB A;  2B2Y A;  1X3Q A;  4ZKC B;  4DN4 M;  1TVX A;  4CJ0 B;  1SDF A;  3IL8 A;  1O7Z A;  2MJ8 A;  3P7J A;  2B2T A;  4IUU A;  1DON A;  4IUV A;  4QUF A;  1WTO A;  2MP1 A;  4HCS A;  1G2S A;  1LV9 A;  1PFM A;  2X6L A;  3DM1 A;  4RWS C;  3MTS A;  5EKI A;  2FIN B;  5EQ0 A;  1WD1 A;  1HHV A;  2L4N A;  5D65 A;  1CM9 A;  4R9W A;  5D14 A;  3F2U A;  5EPJ A;  2NWG A;  4NW2 A;  1B2T A;  1PFN A;  2X69 A;  2H1E A;  2B2U C;  1WVL A;  1F9P A;  1ML0 D;  2B2V A;  2B2Y C;  3QO2 A;  2L1B A;  5COY A;  1WTQ A;  4O42 A;  2N55 A;  1DZ1 A;  1MI2 A;  1F2L A;  1EIH A;  1IL8 A;  2RSO A;  5DNF A;  3DEO A;  4RA8 A;  4ZKB B;  2L9H A;  1XX8 A;  2M2L A;  2Q8R E;  2HDL A;  3D6W A;  1MSG A;  1J8I A;  2RVL A;  4ZLT F;  2FFK B;  1C8C A;  4OIJ A;  1HFN A;  1ESR A;  5CMD A;  2RA4 A;  2DY7 A;  1KNA A;  2MGS A;  2FHT A;  1O7Y A;  3Q6S A;  3KBX A;  1B3A A;  5EPL A;  2DY8 A;  2Q8T A;  1ZXT A;  1RJT A;  2D9U A;  2IL8 A;  5EJW A;  2FMM A;  1HFG A;  1ICW A;  2HUG A;  1S4Z A;  2K28 A;  2R3Z A;  3TN2 A;  1HA6 A;  2B2V C;  1BBX C;  1E0B A;  1RTO A;  2K01 A;  1CA6 A;  1ILP A;  3KUP A;  1JE4 A;  3HP3 A;  3SVM A;  2JYO A;  1F9S A;  3I8Z A;  4MHE A;  4IUT A;  3G7L A;  1NAP A;  1Q3L A;  1DOL A;  1A15 A;  5COR A;  1EL0 A;  4HSV A;  1MSH A;  1NCV A;  2X6G A;  1MGS A;  1X32 A;  1X3P A;  2B2W A;  1ROD A;  2K03 A;  1WTV A;  1F9Q A;  2L12 A;  4HAE A;  2KEE A;  1G91 A;  2EOT A;  1U4M A;  2KED A;  1BNZ A;  1IKL A;  3FPU B;  1DOM A;  1JIC A;  1GUW A;  2K05 A;  1AZQ A;  1DOK A;  2KVM A;  3IFD A;  2JP1 A;  4X3U A;  4XDX A;  5E4X A;  4ZK9 B;  5EPK A;  2EPB A;  2FJ2 A;  2NZ1 D;  1B50 A;  1IKM A;  2SDF A;  1EIG A;  1WTP A;  1QE6 A;  4IUR A;  4IUP A;  4MN3 A;  5E4W C;  3H91 A;  4IUQ A;  2RSN A;  2CVR A;  2KUM A;  2VXW A;  3N52 A;  1AP0 A;  1ILQ A;  1RHP A;  1PLF A;  5T1G A;  1HUN A;  1CA5 A;  2B2W C;  2MPM A;  1VMP A;  2HDM A;  4R8I A;  4X3K A;  1NR4 A;  5JJZ A;  4QUC A;  3I91 A;  1RTN A;  1G2T A;  1J9O A;  3MWY W;  1HUM A;  3ONA B;  1HRJ A;  1SSO A;  1U4L A; 
#chains in the Genus database with same CATH topology
 3NUC A;  3ULJ A;  2AWN A;  5BN4 A;  2E76 C;  2Z6K C;  2UUC L;  1V1Q A;  3K57 A;  2R7Z B;  2UUA L;  1D5M C;  3SEB A;  5D3I B;  4DR5 L;  4G7H C;  4C3I H;  5IGC A;  4OON A;  1N36 L;  1WFQ A;  4IJL A;  4DAV A;  3PO3 G;  4X6A H;  1RIP A;  3DXJ C;  1HTP A;  5LMU Q;  2EQS A;  4IQZ A;  4A3I B;  3R8B A;  2RKS A;  1A63 A;  4A93 G;  3D4W A;  3S1N H;  5DEH A;  1EY7 A;  3C1E A;  1XPU A;  3GTG H;  3A55 A;  4LF9 L;  4BBS H;  1B53 A;  2J7Z A;  1I4P A;  2HIV A;  1HQM C;  3OYY A;  1R4Q B;  2B39 A;  3IL8 A;  2MJ8 A;  3Q23 A;  4ZRZ A;  4ALP A;  3CU7 A;  1W6K A;  4EGV A;  1FR3 A;  1PTO F;  2F0E A;  3BU2 A;  1PH2 A;  2Q2U A;  4ILW A;  1IL2 A;  2VB3 X;  5GAG C;  2CW0 D;  4FXK C;  3VA7 A;  1SR3 A;  2QDL A;  1OO9 B;  4RMF A;  3WOF A;  1MBY A;  1JOK A;  4U67 3;  1HZA A;  3VYT A;  3V96 A;  4DR3 L;  5GRO A;  2IL8 A;  2HUG A;  1I4R A;  1N34 L;  3ERO A;  1TS3 A;  4R4Q A;  4UP9 A;  3J7A 5;  2JYO A;  3MFY A;  3GTM B;  5FO7 B;  3T1Y Q;  2Z9H A;  4LFB L;  4J8Q A;  2NVT H;  1QB5 D;  3HOX B;  3A74 A;  1BKB A;  1D2B A;  4GN5 A;  2JA6 G;  1NJI C;  3MA2 B;  1BNZ A;  3A7L A;  2KHS A;  2Q2I A;  3PSI A;  2XTI A;  1I6V C;  3BYT B;  4LJZ C;  2WKC A;  4YWL A;  1KD1 C;  5C0X J;  1OXU A;  4K2K A;  4MN3 A;  5D3D A;  5IT9 E;  5ELE A;  3G6J B;  2RDG A;  2YYZ A;  3MXN B;  4GS3 A;  3K5L A;  1QIL A;  3U58 A;  1U0L A;  2O5I C;  1A3U A;  3VR5 A;  5C44 G;  4HJ5 A;  1RTN A;  4KJO A;  1HR0 W;  3H3V C;  2EY5 A;  3MXN A;  1G2T A;  1FYC A;  3PGZ A;  4GN4 B;  4DF7 A;  3HOU B;  2GVA A;  1Y1W H;  1HZB A;  2QW7 A;  2EYH A;  3A8J E;  1KLU D;  1NBW A;  5G3L F;  3RN2 A;  2F0Q A;  3PO2 H;  1E1O A;  1I4Q A;  4K8I A;  1XMQ Q;  5IOC A;  1G6P A;  5IWA Q;  2Z8L A;  3I4O A;  4C3H B;  2F3V A;  1T9H A;  1KTK A;  4KKU A;  4POG A;  4X62 L;  3GTJ H;  1EZ6 A;  4WJ3 M;  4HJ8 A;  5C4X G;  3E9H A;  2PZU A;  4C3I B;  3K0Y A;  1IBM L;  3HOY H;  3C1F A;  1Y1V G;  4R4O A;  4KMU C;  1OXV A;  3SK6 A;  4DUY L;  1WD0 A;  1PH6 A;  2KEN A;  2Z6B A;  1LTL A;  3NPP A;  4G4K A;  4AQY L;  3S1N B;  3M4Q A;  4H44 C;  5FLX L;  3GTG B;  4J6H A;  4BBS B;  3CC4 A;  1I4X A;  1LV9 A;  3H15 A;  1PFM A;  3S2H H;  1RD9 D;  3G6E A;  4PMB A;  2QGQ A;  2B2U C;  4IPG A;  2B2Y C;  4A3E G;  1O7I A;  3OOC A;  3CCS A;  3T1H L;  2A74 C;  1QCB D;  4JI8 Q;  3S9W A;  4CKE A;  3OW7 A;  2LXJ A;  2HDL A;  2FFK B;  4DV2 L;  1HNZ L;  1HFN A;  1CUK A;  1PH7 A;  5IGG A;  3I4N H;  2F0P A;  3NP8 A;  4WJW A;  1JMC A;  2A19 A;  1JC7 A;  1D5X C;  2Q2H A;  2PNR C;  4A3L H;  4OL7 A;  5E3F A;  3KUP A;  4KV6 A;  1E22 A;  2UXD Q;  2QCP X;  1LTA D;  4KK7 A;  1MGS A;  1V8Q A;  4H7B A;  2M00 A;  4QF4 A;  4DV3 L;  4HJA A;  1DOM A;  4BA2 I;  2CFM A;  1CQF A;  1YNN C;  3NEL A;  2Q8I B;  1MHW C;  2NVT B;  1AEX A;  1BR9 A;  5LMN L;  2NZH A;  2PQE A;  3HOV G;  4RGN A;  2K5H A;  3RZD H;  1DCZ A;  4ZQ3 A;  5CV6 A;  2JN4 A;  2B2W C;  1SYF A;  1VMP A;  1KAB A;  1YNN D;  5I9P A;  3PO3 H;  4ZUJ A;  3S1Q H;  1ICF B;  3QOJ A;  2RBM A;  1PA6 A;  1V1O A;  2O2L D;  1CKN B;  2EJF C;  1Y69 U;  1EIY B;  2VY3 A;  4GKJ Q;  2F0L A;  1FD7 D;  1CKN A;  2ID0 A;  2OXP A;  5KEE A;  1EWH A;  3CCL A;  3AEV A;  4JI2 Q;  3RNU A;  1KAW A;  1KL9 A;  3OTO L;  2YV5 A;  4TQU S;  4B3T L;  1K73 C;  1UNS A;  5JJI A;  1OXT A;  1CK1 A;  2UUC Q;  1Q81 C;  2XWJ B;  2NN6 G;  5ELN A;  4YIJ A;  1EQQ A;  2EYL A;  3GTJ B;  2YTX A;  4YY3 L;  2ZJP A;  4DN4 M;  4DR5 Q;  3H3V I;  3X3M A;  3RR5 A;  3HOY B;  5JPN C;  2EYM A;  4PG3 A;  1MIU A;  2IX3 A;  2D0O A;  2EJM A;  3FKI H;  2OQK A;  3MXG A;  2IWH A;  5HGQ A;  1WTO A;  3CC7 A;  1L0W A;  1F2Z A;  1H9J A;  1B44 D;  2FIN B;  1M90 C;  1K8A C;  1HQR D;  2F0H A;  2HIX A;  3PUX A;  3MHB A;  1PRT F;  2NWG A;  3ND8 A;  1NTG A;  1PFS A;  3F8T A;  3DWA A;  2F4I A;  1LYL A;  4XTC S;  4DXF A;  1WVL A;  3KOJ A;  3PUZ A;  1X3G A;  4Q0F A;  1LTS D;  3BZC A;  4IFD G;  1UEB A;  4A3B B;  4RA8 A;  3TP8 A;  2M2L A;  3WOE A;  2R61 A;  3QWN A;  1EEF D;  2RA4 A;  3PQI A;  4MTK A;  2JA6 H;  1BVS A;  4X64 Q;  4RGO S;  3TN2 A;  1PH4 A;  5IIF A;  4XQJ A;  1I50 H;  2NUC A;  2K52 A;  2AHO B;  1B9M A;  4IUT A;  1TWG B;  2QIL A;  4FF3 A;  1KHI A;  1IYU A;  3M3Y H;  1LAC A;  4JI4 L;  2K03 A;  4B9W A;  5C44 H;  3J7A F;  2EOT A;  3KFU A;  3PF4 A;  2LS0 1;  2K50 A;  1DOK A;  3M7G A;  4OO1 H;  1VDZ A;  2RQX A;  3VA5 A;  3VDY A;  3L9A X;  4FF4 A;  2EVB A;  2I07 B;  3X3N A;  4O1N A;  1K3B C;  2VXW A;  4K5W A;  1PH3 A;  3J80 c;  1W6J A;  5CV9 A;  5DM7 3;  3CMA A;  5EKK A;  5C4X H;  3RZD B;  1QZG A;  4QIW B;  4LUZ A;  3B6Y A;  4J1M A;  3PO3 B;  4IZ8 A;  3K7U C;  1LTB D;  1SE3 A;  1X3E A;  1RCV D;  4C56 C;  5IP7 G;  5ELB A;  3UDG A;  1VQ5 A;  1X6O A;  4A93 B;  4PV1 C;  5IE8 A;  3C2P A;  2ICI A;  1JWM D;  3EVQ A;  3CRK C;  4JK1 C;  1TXY A;  1PYS B;  2BDO A;  2JXM B;  5M5X B;  1SE4 A;  1WTX A;  1B8A A;  3CW2 C;  2XGT A;  4PZ6 A;  5CBE E;  1XYI A;  1STE A;  3FMC A;  4A3E H;  4DV7 Q;  1YI2 A;  3OWE B;  1PH9 A;  3WDN A;  1I4H A;  1K9M C;  3IFT A;  1HR0 L;  3M4P A;  3RLF A;  1N9W A;  2GN5 A;  5EGT A;  1DON A;  1PYW D;  2F0M A;  3ITP A;  4OWX B;  2ZM6 L;  1Q82 C;  1LUZ A;  4JI0 L;  5M3F H;  2B3G A;  1PV4 A;  1WYD A;  2F0F A;  1IYJ B;  1SND A;  2N8N A;  4GOP C;  3N6R A;  2G9H D;  4DNT B;  4AQY Q;  1EIH A;  3CQZ H;  2XNA C;  1GUG A;  3URY A;  2BOS A;  3W3A A;  2JA5 H;  4ZLT F;  1D6E C;  2PYK A;  1TQO A;  1SBB B;  1KNA A;  2RF4 A;  5EBC A;  1CHP D;  1EYC A;  4L5S A;  3GTL H;  3UE0 A;  4GZY C;  2B2V C;  4FO2 A;  4DV1 Q;  1SE2 A;  1E0B A;  1XJV A;  3I7F A;  2R6G A;  2JA6 B;  3T4A C;  3T1H Q;  3G7L A;  1I50 B;  1LM0 A;  1K3R A;  2KED A;  4K6D A;  2WKD A;  4FF1 A;  3FPU B;  3FP9 A;  2PMZ B;  4DUZ Q;  4DK1 A;  3BDC A;  5C4J H;  1MJE A;  3M3Y B;  4JVZ A;  5EPK A;  5C44 B;  3JAM c;  3E0J A;  1B50 A;  3I56 A;  2IX0 A;  4FXG C;  3AMU A;  3VR3 A;  1SYB A;  1SJE D;  5JEA H;  5T1G A;  4DU9 A;  5IT9 L;  2R92 G;  1W3S A;  1JOR A;  1T5E A;  1AN8 A;  2J0T D;  1EWI A;  3K59 A;  3PF5 A;  3F2B A;  1J6Q A;  1VQ7 A;  2F03 A;  3STB C;  2VQF L;  2HT1 A;  3G4S A;  5FK9 C;  5LMN Q;  1VQM A;  3RN5 A;  4OX9 L;  1U4P A;  5C4X B;  5I9O A;  1BQQ T;  4YWK A;  2N88 A;  4A4I A;  2SNS A;  3AFQ A;  4EQN A;  2BDN A;  1Y1V B;  4AIM A;  4PNY A;  3BYY B;  4HN7 A;  3U9O A;  1VQL A;  3M4Y A;  5IP9 G;  3GV3 A;  1Q1E A;  3W1B A;  4JBM A;  5JAV A;  4GLA C;  4ID6 A;  2EYO A;  4CBV A;  3V2T A;  1SNM A;  4OEM B;  4YHH L;  4IFD H;  1TY2 A;  3OTO Q;  4KY7 A;  5FO8 B;  4R4T A;  1GKH A;  4ZCK A;  4LF8 L;  5IGB A;  4B3T Q;  1WD1 A;  4DNR B;  4A3E B;  1CZG A;  1EFI D;  3M9B A;  4LUO A;  5D65 A;  3SXH A;  3P1H A;  4ULL A;  4B3R L;  1XNQ L;  3QJY A;  2JA7 H;  4A3F H;  1S5F D;  1Y1W G;  4O42 A;  3TRZ A;  4YY3 Q;  4Q5V A;  1IBK L;  2IHE A;  1MI2 A;  3J81 c;  1QWY A;  4UPA A;  3PO2 G;  4ZKB B;  1YJN A;  4K0K Q;  1MD2 D;  3OIP A;  4YCW A;  3U9S A;  3DM3 A;  2FHT A;  3Q6S A;  3KBX A;  3K58 A;  3CQZ B;  2PZW A;  4R4I A;  2JA5 B;  1S72 A;  3KLW A;  1LT6 D;  1FNV A;  4FVM A;  1V1P B;  4HR7 B;  1F9S A;  5FKA C;  4BBR H;  3PUW A;  4P74 A;  5K36 G;  1V1P A;  4BY1 G;  1E24 A;  3CME A;  5C0X I;  1K83 B;  1F9Q A;  4DR4 L;  3HOV B;  1LTR D;  5K5P A;  3AU7 A;  1A2T A;  4R4C A;  1A0I A;  1FL0 A;  2B29 A;  4KHZ A;  4QIW E;  1BCP C;  1EOV A;  3I4M G;  1Q46 A;  4JG2 A;  5IP7 H;  4C1N I;  1SYG A;  1Z6H A;  3ER0 A;  3OIQ A;  2RSN A;  4HMJ A;  4B3M Q;  2CVR A;  1ILQ A;  4UP7 A;  1HUN A;  4OXP A;  2UXC Q;  1BCP D;  2DUD A;  3VR6 A;  4CKB A;  1HUM A;  3S2D H;  4HJ9 A;  3R93 A;  3A7A B;  2KEC A;  1JB3 A;  1XTD A;  4LFA Q;  2KCM A;  1HZ9 A;  2A73 B;  4EQ5 A;  3BZD B;  4DV0 L;  3C46 A;  3I4N G;  1J5E Q;  2VB2 X;  5H1S E;  3M85 A;  2E2H H;  4A3L G;  3T56 B;  4A3C G;  1DM0 B;  1SYD A;  1F9R A;  3LWE A;  3CCU A;  4RAU C;  5AJ3 L;  2BH8 A;  4G7O C;  1NR2 A;  2WIN B;  1ONL A;  1EZ8 A;  1HNW L;  1QVC A;  4NMZ A;  3BDO A;  5IYB H;  1KXL A;  4PQX A;  1XMO Q;  2F1M A;  3TQY A;  3EQL C;  1E2W A;  1PFB A;  4ZKC B;  4L5T A;  3ERS X;  4KHV A;  2Z4I A;  1FGB D;  2F3W A;  2K5N A;  4LF4 Q;  4LF5 L;  4FNF A;  2AMC B;  3AYH B;  2Z1C A;  3JC6 6;  5CYU A;  1PH8 A;  2L0C A;  2SNM A;  1JE5 A;  2BA1 A;  2EIF A;  1DD2 A;  2OF1 A;  4UY8 C;  1HR0 Q;  3SHL A;  3CPW A;  1TY0 A;  1JJG A;  1LT4 D;  4JI0 Q;  5J39 A;  2LMC B;  1Q7Y C;  3Q0A A;  2PMZ E;  2DY8 A;  1N32 L;  3H3V H;  1SEB D;  1TWH B;  2PNH A;  5C3X A;  4HMI A;  4J15 A;  3RLN A;  1BBX C;  1D1K A;  1A62 A;  1C48 A;  1UEA B;  1P16 A;  3RZO H;  4KN7 C;  5F2D A;  2RHQ B;  1EL0 A;  2A68 C;  2R92 H;  3JAM i;  4HAE A;  2I5L X;  4X66 L;  3FKI G;  1AH9 A;  2CCZ A;  4X3U A;  1ET9 A;  3CCM A;  2A68 D;  3CPF A;  5ELF A;  3UDF A;  1TWF H;  3D4R A;  3GDE A;  4LF7 Q;  2F0O A;  1CA5 A;  1VQN A;  1IZ6 A;  4JBW A;  1SLJ A;  2CH4 W;  4B08 A;  1FJG L;  1STB A;  1KNE A;  1EY9 A;  5IP9 H;  1B70 B;  2ZXO A;  3TRE A;  4V0B A;  3S2D B;  1TII D;  3KF8 A;  1YBY A;  2EE1 A;  2F52 A;  3EFX D;  1CTM A;  5CV8 A;  1O80 A;  1Q8I A;  1XTC D;  1SN8 A;  5IGD A;  3KJO A;  3HOW G;  1KQS A;  2B2T C;  3D0F A;  1RKN A;  4NB3 A;  4GLV B;  4DK3 C;  3F1Z A;  2E2H B;  2EJG C;  4JI5 L;  1N33 Q;  1EUJ A;  3CAM A;  2VQF Q;  1QJO A;  3I90 A;  1EY4 A;  4H02 A;  1YIT A;  2UUB L;  4OX9 Q;  2KCC A;  3K5M A;  4OO1 G;  2GVB A;  4Z9C B;  2K5W A;  4IUV A;  4RHS A;  4ZYS A;  2X6L A;  4GN3 B;  1ASZ A;  3MTS A;  2L4N A;  3KF6 B;  1EYD A;  2R7F A;  4QJF A;  4F88 A;  3H0G G;  3J81 i;  2F4V L;  5M9O A;  5KYI A;  1BUV T;  3KF6 A;  3HS0 C;  4F7X A;  2RCF A;  4L63 B;  1AW7 A;  1F9P A;  5COY A;  5CV5 A;  1EIF A;  5ISR A;  3TS0 A;  4NXN L;  5K36 H;  4YHH Q;  2K6A A;  5I6W A;  5FJ8 H;  4BY1 H;  2L9H A;  4OIJ A;  3BG3 A;  1WTH A;  4OEL B;  1HNX Q;  1JQY D;  1AE2 A;  2DY7 A;  4JBJ A;  2MGS A;  4JW0 A;  2CHB D;  1PTO C;  4JV5 L;  5EJW A;  2R3Z A;  1XNQ Q;  4I7A A;  3I4M H;  1EQV A;  1JJC B;  1CA6 A;  4P71 A;  1YNJ C;  4QMG A;  3TP7 A;  4BY7 H;  4OWW B;  1A15 A;  1GOZ A;  2E2I H;  1X3P A;  2WAQ G;  1FNW A;  1BBW A;  3L7Z C;  3J81 j;  1G91 A;  4KI0 A;  3GTK H;  1GVP A;  2A6H C;  4XDX A;  5M3F G;  5NUC A;  2R92 B;  3AFP A;  4RGT A;  4IUR A;  4IUP A;  5E4W C;  2WAC A;  2OTJ A;  1E7Z A;  2IX1 A;  2R93 G;  4A3C H;  2AUJ D;  1VQI A;  4X3K A;  1LO5 D;  4DR4 Q;  4DAM A;  4E6I A;  1QNK A;  4HCE A;  1BXT A;  4X3T A;  4Y7N H;  1TWF B;  3QOL A;  2JA5 G;  4X3S A;  3R2T A;  4DR7 Q;  4B9X A;  4G7Z C;  1TS5 A;  2HCI A;  1EWC A;  4MZ9 A;  3L3O C;  5CV4 A;  3K8A A;  2ZXP A;  4RKL A;  4NXM Q;  4F87 A;  3DWQ A;  2EY1 A;  3NQI A;  2RCN A;  1VQK A;  5FLM H;  4WJ4 A;  2O4X A;  2N49 A;  3BS1 A;  2QEX A;  4QQB X;  2HQL A;  1IBL L;  5KRU A;  1UAP A;  3TS2 A;  2NTS A;  3ULP A;  1PMR A;  3R3O A;  4V19 0;  1SMY C;  2B2U A;  1K8O A;  2XRQ D;  2B2Y A;  2PZT A;  3I2Z A;  1GUT A;  3NXW A;  2L55 A;  3P7J A;  4JYA Q;  2K4K A;  1LLR D;  1VQH A;  4QUF A;  5JEA G;  3MXU A;  5G3L D;  1Y1W B;  5AJ3 Q;  3CP0 A;  1CM9 A;  3F2U A;  1G51 A;  1HNW Q;  1YJ9 A;  2HQE A;  3WWV A;  3PO2 B;  5JEA J;  4K5V A;  2CKZ B;  3Q24 A;  3PUY A;  4KHP L;  1EEI D;  2YTV A;  1HPC A;  2UUA Q;  2AKW B;  3S1M H;  2RDF A;  2B63 H;  3GTQ H;  4I65 A;  4LW1 A;  3BVG A;  3CCQ A;  3P75 A;  4RKB A;  4C2M H;  2IJ0 A;  2IPK D;  1N36 Q;  4FXD A;  1O7Y A;  4FDB A;  1VS0 A;  3I70 A;  1ZXT A;  1H9K A;  4XYQ A;  2FMM A;  1HFG A;  4BY1 B;  1HA6 A;  3HRZ C;  4DR6 L;  1X55 A;  3I55 A;  3ERQ A;  1U5K A;  5EKL A;  1JE4 A;  2MQH A;  4PMW A;  1B1Z A;  1SNC A;  3K5O A;  4LF9 Q;  3J7Y W;  3GTO H;  2ZTE A;  2B2W A;  1X32 A;  3I4M B;  3T51 B;  4A3M G;  4RCN A;  3S2H B;  1VQG A;  4A76 A;  1N8R C;  2I5M X;  4KY6 A;  5E1F A;  5CC4 A;  1L1O C;  2KVM A;  1N32 Q;  2KCT A;  2E2I B;  4IFD J;  1D1I A;  2EPB A;  5JOB A;  1XPR A;  4OWT B;  3HKZ G;  1QE6 A;  2F0U A;  4RFB A;  1BOS A;  3GTK B;  2F0S A;  4P2C B;  2JA7 G;  4A3F G;  1TWC H;  3FHW A;  2K7V A;  2MHV A;  1NR4 A;  3CKI B;  3HOW H;  4KD3 A;  3I4N B;  2QEJ C;  3HEJ A;  3NWS A;  3HGB A;  4GNX C;  4AH6 A;  4MNO A;  1VQB A;  3E5S A;  2BCO A;  4TKO B;  2AWO A;  4DR3 Q;  1RF2 D;  1D7Q A;  3W5O A;  3KK7 A;  2E2J H;  4Y7N B;  1N34 Q;  1GUN A;  5M5W H;  1EQT A;  1EU3 A;  1BF4 A;  1Z9F A;  2OQ0 A;  4JI1 L;  4BBR G;  2K1B A;  1CSQ A;  2EXD A;  3SK8 A;  2E5L L;  2Z4H A;  4LFB Q;  4DKA C;  1TS2 A;  2MO0 A;  4CJ1 B;  4JOI C;  1QG7 A;  4UAI A;  2MFI A;  2KJX A;  2F0V A;  3H0G H;  4K6L A;  2NVQ H;  1BO0 A;  4JC0 A;  1YHA A;  3K81 C;  3S24 A;  2PQA B;  3LGJ A;  1AFP A;  3D4D A;  4QY7 A;  4CJ0 B;  2PQA A;  3S1Q B;  4IUU A;  2VNU D;  4K14 A;  4RWS C;  5A2Q E;  4QGU A;  3T53 B;  5FLX c;  2DNE A;  5JJK A;  1YEZ A;  3ULL A;  3KJP A;  3PUV A;  2JA8 G;  4LF6 L;  2SOB A;  2FMC A;  2J4X A;  1LAB A;  1VQ8 A;  2K33 A;  2RSO A;  4PMC A;  5DNF A;  2UU9 L;  3TBI B;  1GXD C;  2MNA A;  1MSG A;  1C8C A;  4IN3 A;  4NDX A;  3Q8D A;  1TU2 B;  3S1M B;  4DV6 L;  1B3A A;  4N8X 1;  2A69 C;  4X62 Q;  2K28 A;  3S16 H;  3FPP A;  1PRT C;  3F2C A;  3VYR A;  3F2D A;  4C2M B;  1IBM Q;  1SNO A;  5LMU L;  1GM5 A;  3GO5 A;  1S3O A;  5I4D A;  5IYB G;  1DOL A;  3FKI B;  2R93 H;  4DUY Q;  2R7D A;  1JWS D;  2PPB C;  2KEE A;  3J80 E;  2ASB A;  3UE1 A;  1JIC A;  5J3B A;  1C9O A;  3GTO B;  4JV5 Q;  5ELO A;  2OTL A;  4DV4 L;  1UE7 A;  2SDF A;  4N9P A;  4KKT A;  3MZ5 A;  1KAA A;  1BDO A;  4QUC A;  5C5M A;  3A0J A;  3TSS A;  1X3F A;  3UI2 A;  1GUS A;  1PVO A;  4Y52 H;  4DV2 Q;  4F8M A;  3CD6 A;  1HNZ Q;  4EQP A;  3RD4 A;  1Z7T A;  2K04 A;  3HOW B;  2I46 A;  3NHH A;  2KOL A;  4C1N K;  4APV A;  4LUV A;  1PH1 A;  3TZU A;  1GD7 A;  2RDH A;  5A35 A;  4LAA A;  2XIW A;  1Y8P B;  1HA5 A;  2AQ2 B;  2C9O A;  3FRP B;  3HOZ H;  3W2D A;  1PYB A;  2E2J B;  2Z0S A;  3NTK A;  3QIA A;  4H13 C;  4KLK A;  2HHH L;  4AYB G;  1DJR D;  5M5W B;  4GOP B;  5CGK A;  4JPB W;  4DV3 Q;  1K28 A;  3CCR A;  4DPG A;  3G71 A;  4TVA B;  4GOP A;  1A6X A;  4QCL A;  2PCF B;  2LKV A;  1CHQ D;  3NTI A;  3H0G B;  3SK5 A;  2NVQ B;  3A54 A;  2F0N A;  3J7A V;  4A3K H;  3ND9 A;  2E74 C;  1SMX A;  3K5N A;  2F0G A;  2G9D A;  2WV6 D;  3MVV A;  3STB D;  1M1K C;  4R9W A;  1STH A;  3GTP H;  4EQO A;  1R9T H;  2F0D A;  2NVY H;  4LK1 C;  3EN2 A;  1V43 A;  1Y8N B;  2B8G A;  2B2V A;  2N55 A;  1SXT A;  5M3M G;  2NB0 A;  4A3M H;  3H09 A;  1KRT A;  3ZJY C;  1Q12 A;  3KLS X;  3CF5 A;  4HID A;  5EAY A;  2Q8T A;  4CDD C;  3TME A;  1K0R A;  2WAQ B;  4EX5 A;  2R7Z H;  2K01 A;  1EY5 A;  3VR2 A;  1LT5 D;  1JT8 A;  4RH6 A;  1Q3L A;  1S5E D;  3JAM E;  1C4Q A;  5M3F B;  1G8Z D;  3K7A H;  3S16 B;  4DGZ A;  3E0E A;  4DR2 L;  1PZJ D;  1VQ6 A;  2R93 B;  3IFD A;  2WII B;  4DK0 A;  5KIX A;  2VL6 A;  4N9T A;  1EIG A;  4XIG S;  3GP7 A;  4CDC C;  3H91 A;  2IHF A;  4IPC A;  5JJL A;  2I0Q A;  4R8I A;  1STN A;  1HRJ A;  1UE5 A;  4NPS A;  1MKH A;  2D5D A;  4NP5 A;  1SSO A;  2NYZ D;  5FJ8 G;  4LNQ A;  4BWG B;  1SYC A;  3GTL B;  3MXP A;  1KDA A;  2JSO A;  3A8I E;  1D8L A;  3D8G A;  2CQA A;  1VQO A;  2VUM G;  1W2B A;  4CJ2 C;  4YWM A;  3J80 i;  4ZAI A;  3V05 A;  3LX0 A;  2BE5 C;  1EYA A;  5C3E G;  2HCC A;  2A5H A;  4BY7 G;  1WCM H;  1ET6 A;  1CI3 M;  1VMC A;  2P5Z X;  5C4J B;  4O2D A;  2HD3 A;  3OMG A;  4JI4 Q;  4OHJ A;  2BE5 D;  4KY5 A;  3I73 A;  2UXD L;  1X65 A;  1UWV A;  2LY7 A;  4L8J A;  2ZT9 C;  2AUK A;  4CGY B;  1WTR A;  2JA8 H;  1A3T A;  3PCO B;  1LTI D;  2K5V A;  2KA7 A;  2A6E C;  3HFZ B;  4A3J G;  3GTM H;  4XQN A;  2XWB B;  4X65 L;  4P75 A;  3J81 E;  2D0P A;  3CCJ A;  2A6E D;  2IW3 A;  1QVF A;  4HIK A;  4GKK L;  2CWA A;  3A5U A;  2X69 A;  2WB1 G;  1CSP A;  5C4H A;  3HKS A;  4G57 A;  3NBI A;  2SEB D;  3ICE A;  3I72 A;  4A3G G;  5BR8 L;  3GTP B;  1IL8 A;  1R9T B;  2NVY B;  3D3R A;  3D6W A;  2CWP A;  3KBG A;  3SDZ A;  5FLM G;  1I3Q H;  1BCP B;  1XPO A;  3HOU H;  4JI2 L;  1VCI A;  4A3M B;  4HTH A;  1WOC A;  1XNR L;  1ILP A;  1II3 A;  3HP3 A;  4P72 A;  5FO9 B;  1UUP A;  5FOB B;  4HSV A;  5ELC A;  2VQE L;  2UU9 Q;  2X6G A;  4C3H H;  2H5X A;  2L12 A;  3NSW A;  1DYQ A;  3HKZ B;  2PO4 A;  2Q2T A;  2Y0S G;  5DLQ E;  3SE0 A;  1CT1 D;  2OWO A;  4DV6 Q;  1YIJ A;  1GUW A;  2JA7 B;  4A3F B;  4OGQ C;  2ZM6 Q;  1X54 A;  3OHX C;  3K7A B;  2LSS A;  5JPM C;  4IUQ A;  1VQ9 A;  3E9I A;  3OPO A;  3PMF A;  5JJZ A;  1FVI A;  1J9O A;  1KDC A;  2B63 G;  5JVG 3;  3FVQ A;  5IT9 c;  4OIK A;  1L0X B;  1VQD A;  1G6Z A;  1CKM A;  3NK9 A;  1YZ6 A;  4DV4 Q;  4BBR B;  2NZO A;  3BJU A;  2Z6K A;  2CW0 C;  1LT3 D;  3I3C A;  3J7Z C;  4FYD A;  5C6A A;  2ZXR A;  4X64 L;  4DR1 L;  5EBD A;  3NE5 B;  1M4V A;  1S40 A;  3IKJ A;  4MTN A;  2NVX H;  4K8J A;  3MC0 B;  1YHB A;  3SR1 A;  1M8A A;  3KLS A;  2L5T A;  3H6M A;  3DWP A;  4WOR A;  2O5J C;  1C0A A;  3EIV A;  3EBE A;  1EOT A;  1WCM B;  1KDB A;  1A8V A;  3EA6 A;  1PTO H;  1X3Q A;  2XVS A;  5TSS A;  1Z47 A;  4JI6 L;  3TP6 A;  3I4L A;  3KF8 B;  5M5Y H;  4RCO A;  2ALY B;  5M3M H;  3BVZ A;  3VYU A;  1YVC A;  3DLL A;  2JA8 B;  3EJI A;  4CHT B;  1EY8 A;  4P73 A;  1X56 A;  2HHH Q;  3FEW X;  2NN6 I;  5A2Q L;  1OTC A;  2WAQ E;  3A8K E;  1WTQ A;  2K75 A;  2EDG A;  2LXK A;  4C3J H;  5C0X G;  1JCK B;  2JA9 A;  1J8I A;  1STA A;  4IOA A;  5CMD A;  2E75 C;  1GHJ A;  3O13 A;  3AB9 A;  2XRS D;  2QF7 A;  4B3S L;  3K0X A;  2M9V A;  5JVH 3;  1I3Q B;  3U50 C;  1KIX A;  4IFD I;  1P8L A;  3U4V A;  4HIO A;  1B3Q A;  3PIO A;  5IGF A;  4DV7 L;  5IOD A;  3J80 L;  4LF8 Q;  1NNX A;  2VUM H;  3CC2 A;  5KND A;  3TEH B;  5I6Y A;  4B3R Q;  2TMP A;  2KUM A;  1AP0 A;  3ZYY X;  3VYS A;  1IXR A;  5C3E H;  4DAP A;  2GA4 B;  1IBK Q;  2B2T A;  1PTO D;  2OT2 A;  1Q1B A;  1H9M A;  1JWU D;  4LMQ D;  4DR2 Q;  1VQE A;  2L11 A;  1A2U A;  4CDF C;  4WFN 3;  3RZO B;  1YNJ D;  2ATW A;  3TZD A;  1H95 A;  3G48 A;  1C7Y A;  4FF2 A;  2QKI C;  1F77 A;  5IY0 A;  2DJF C;  4A3J H;  3H94 A;  4POF A;  5CR3 A;  4AYB B;  2XSC A;  4A3B H;  2K5D A;  5AFW A;  1S5D D;  5IYD H;  1PDQ A;  3RLO A;  4WRD A;  4DV1 L;  2A6H D;  1U9R A;  1ENA A;  4TSS A;  1QZH A;  4IUN A;  4XT3 B;  4MIU A;  1UE6 A;  4HED A;  1WTW A;  3L2P A;  3TDQ A;  1XXG A;  4A3G H;  4I7Z C;  2NVX B;  1SDF A;  3S17 H;  4DUZ L;  1SJH D;  2BA0 A;  1Q8K A;  1TWG H;  3BZK A;  2DNC A;  4M1U B;  1TS4 A;  5EQ0 A;  5EKI A;  5IYC H;  2OEO A;  1PTO B;  3U4Z A;  2NBF A;  3PIO 3;  1E1T A;  5D14 A;  2EXZ A;  5EPJ A;  5M5Y B;  2YU9 H;  4NW2 A;  4ABN A;  5M3M B;  2QA4 A;  3OW2 A;  4JI7 L;  1B2T A;  1B9N A;  2PI2 A;  3IRB A;  3QO2 A;  5C4Z A;  3NWT A;  4O0A A;  4DV0 Q;  5GQO A;  2CQO A;  2RVL A;  1NSN S;  5I2X A;  4JI3 L;  4X65 Q;  1DGS A;  3E3X A;  3HKZ E;  1KC8 C;  4HIM A;  1HZC A;  4NKL A;  4C3J B;  3CCE A;  5EPL A;  1RJT A;  3S1R H;  3HOZ G;  4IOC A;  3KLR A;  4GKK Q;  1SMY D;  1RDP D;  4A3D G;  5DM6 3;  2EZV A;  5BR8 Q;  2E2D C;  4BA1 I;  1NCV A;  4H0L C;  1SRU A;  4A93 H;  1AE3 A;  4CKC A;  1FNU A;  4QL5 A;  3JAM L;  2C35 B;  1I5F A;  1IKL A;  2AQ3 B;  2RHS B;  4DV5 L;  5L37 A;  4A3K G;  3T16 A;  4IO9 A;  3HZX A;  5M5X H;  4DXG A;  1ENC A;  2JP1 A;  4ZK9 B;  4LF5 Q;  3S14 H;  2UXB L;  4RG1 A;  3S15 H;  4IPD A;  1IKM A;  1NMG A;  1TR5 A;  1XNR Q;  3N52 A;  3M7N A;  1PLF A;  3PV0 A;  2VQE Q;  3A56 A;  1I4G A;  4LFC L;  1NMF A;  3I91 A;  2VUM B;  1ZEQ X;  2VW9 A;  1IYV A;  2KCN A;  4XT1 B;  1ESF A;  4ZUI A;  1STG A;  1A3V A;  4L5R C;  3NEN A;  5C3E B;  1B4O A;  3CXC A;  4CDE C;  5T1I A;  5J22 A;  4JBK A;  4K0K L;  4BY7 B;  3UDX A;  3QG1 A;  2R7Z G;  5KNC A;  2EY6 A;  2AQ1 B;  4RGM A;  2BH2 A;  2D2C C;  1I6H H;  4K2L A;  5LL6 X;  2EYJ A;  4BXX G;  1HXY D;  2MUY A;  3DEP A;  4A3J B;  1I94 L;  1PXU A;  3NEM A;  3MEH A;  1K8G A;  1U4R A;  4X66 Q;  5CBA E;  4A3I G;  5LHY 1;  2D62 A;  1TKW B;  2H4O A;  2ZTC A;  5HGT A;  1QVG A;  4EVO A;  2KHI A;  1SE8 A;  5C0X H;  2EYF A;  2WB1 B;  2MP1 A;  5C3W A;  1HJP A;  4R1J A;  4DR1 Q;  1H9R A;  4JCV E;  4ME5 A;  1K8M A;  1DXM A;  4DAY B;  4A3G B;  1SNQ A;  3J81 L;  4B3M L;  3S17 B;  4DAY A;  3Q22 A;  4L6T B;  2UXC L;  1ML0 D;  1FJG Q;  2ICE C;  2ENB A;  5BN3 A;  1DZ1 A;  1B7Y B;  4JI6 Q;  2YU9 B;  1XX8 A;  3A5Z B;  2Q8R E;  2V4D A;  4LFA L;  1K0S A;  3E6Z X;  1ESR A;  4BS9 A;  1L1O B;  1J5E L;  4M8A A;  2I5H A;  1GUO A;  1WCM G;  1L1O A;  1ICW A;  1EQR A;  2K14 A;  1SFO H;  1CFM A;  5KYL A;  1RTO A;  1ENF A;  5GAE C;  4ME3 A;  4JI5 Q;  3RMH A;  3DHQ A;  3SK4 A;  3MFG A;  3OWF A;  2Y0S B;  5DAU A;  3S1R B;  4DK6 C;  2UUB Q;  1E2V A;  1RL2 A;  2DJG C;  1ROD A;  1V9P A;  4KKS A;  3L0O A;  1FGU A;  3MAQ A;  1TWA H;  4GNX B;  1Y1V H;  1U4M A;  4A75 A;  1XMO L;  3M4O H;  4GNX A;  1X9N A;  2IY5 B;  1VQA A;  3HOX G;  2OCE A;  4KJN A;  2K5Q A;  1ZKO A;  2F4V Q;  4B3S Q;  1EYG A;  4LF4 L;  2B63 B;  3GTQ B;  1O78 A;  2KBN A;  3GQB A;  1S5B D;  1VQ4 A;  1PH5 A;  2MPM A;  3DMU A;  4AYB E;  2HDM A;  3R2I A;  3S14 B;  3S15 B;  1JOO A;  4LWC A;  3QR8 A;  1SAP A;  4NXN Q;  2A69 D;  1F2M A;  2KHJ A;  1QNU A;  3FDT A;  4JOI A;  3UDI A;  1YHQ A;  1PRT D;  2JK8 A;  2MO1 A;  4RHR A;  2JEB I;  3DUZ A;  3GD7 A;  2YTY A;  1STY A;  3PIP A;  1GHK A;  3HOU G;  3SGI A;  3HG9 A;  1O7L A;  2N3S A;  1E3P A;  1L0Y B;  2QDB A;  4DFA A;  1Y14 B;  1S5C D;  2NTT A;  3K80 C;  2PW7 A;  1E2Z A;  1HCZ A;  4L5Q A;  2V1C C;  1SYE A;  1CKO A;  4C3H G;  2PI2 E;  2DGY A;  1OXX K;  3GV6 A;  4UHV A;  3CHB D;  2C5C A;  4UP8 A;  1VQF A;  1HTL D;  2CH4 A;  1I6H B;  3P20 A;  5FLX E;  1TWC B;  4C3I G;  1BBU A;  4KTA A;  1TVX A;  1LTT D;  2K32 A;  4YCV A;  2ZTD A;  1G2S A;  3DM1 A;  3BVM A;  1Y8O B;  1K83 H;  1NUC A;  3HOV H;  1YNX A;  2JE6 I;  3BDL A;  2LFN A;  1GJX A;  1IW7 C;  3C3L A;  1PRT B;  4BBS G;  1MJC A;  1JJ2 A;  4LF7 L;  5C5L A;  4A3D H;  2EY2 A;  2L1B A;  2ZJQ A;  1VQC A;  1SNP A;  3T1Y L;  1F2L A;  1IW7 D;  1QUQ B;  3DEO A;  4DNI A;  1QUQ A;  3VR4 A;  2FXQ A;  1BCP F;  5ELD A;  4R8N A;  3SVM A;  1KLG D;  1NE3 A;  1S4Z A;  2PW5 A;  4JI7 Q;  1CZW A;  4XYO A;  2E8G A;  2ZJR A;  1IBL Q;  4PZ7 A;  1VQJ A;  3OSO A;  3PIP 3;  4K5X A;  4HSP A;  4UDU C;  5COR A;  1MSH A;  1EY0 A;  5GAH C;  1N33 L;  4PZ8 A;  1WTV A;  1L2F A;  1SFO B;  1NY4 A;  3KYH C;  4JI3 Q;  2NN6 H;  2EYP A;  2VS1 A;  4XQQ A;  2WFW A;  5HUR A;  1T5X D;  4IJH A;  1AZQ A;  2N78 A;  1IHZ A;  2NZ1 D;  1TWA B;  1WTP A;  1XMQ L;  1XWE A;  1OXS C;  1UE1 A;  2F0T A;  5IWA L;  1PHJ A;  3M4O B;  1RHP A;  1JB7 A;  5LL6 S;  1Q86 C;  3OMC A;  4KHP Q;  3ONA B;  4C3J G;  1U4L A;  3W1G A;  2L15 A;  3LNN A;  4BXX H;  1SRO A;  4KN4 C;  4DV5 Q;  2A8V A;  3TP5 A;  5GAD C;  1H9S B;  2VZA A;  1ZYR C;  4ODG A;  2UXB Q;  3IAY A;  1H9S A;  2F0K A;  4A3I H;  1D5Z C;  4U68 A;  1HNX L;  4HJ7 A;  2TSS A;  4DR6 Q;  1ZYR D;  4LFC Q;  2WB1 E;  5E7N A;  1Q90 A;  2G5D A;  3D6C A;  1AZP A;  3D31 A;  1VQP A;  1VF7 A;  2A1A A;  4FP5 D;  3NQT A;  2B8F A;  3QB3 A;  1KRS A;  1TWH H;  1GO3 E;  5BN5 A;  1EY6 A;  3RUZ A;  1WI5 A;  4JI8 L;  2IT1 A;  2KQ3 A;  4N8F A;  1O7Z A;  4QB4 A;  1HH2 P;  1EFW A;  4XXE A;  4HCS A;  5CV7 A;  1HHV A;  4DA2 A;  3HOY G;  5KNB A;  1I94 Q;  2WP8 J;  2F0J A;  1PFN A;  2H1E A;  1ASY A;  5I2Y A;  5LMN W;  2JEA I;  4OO1 I;  2Y0S E;  5HY6 A;  2F0W A;  4KD4 A;  2JQO A;  3HOZ B;  4S3S A;  2DN8 A;  3T13 A;  4DR7 L;  4A3D B;  3KDF B;  1TT2 A;  3LWU A;  4GLX A;  2F0I A;  3KDF A;  1WJJ A;  4NXM L;  4A3B G;  4JI1 Q;  5IYD G;  4YCU A;  2D9U A;  1EU4 A;  2F3I A;  2JJQ A;  3HOX H;  2E5L Q;  3AQQ A;  3NBH B;  1F2Y A;  1PZK D;  3MEF A;  3NBH A;  3I8Z A;  4MHE A;  3K6O A;  1NAP A;  1JOQ A;  5KGU A;  4A3K B;  3CCV A;  1VF5 C;  5J1Z A;  4IPH A;  2K05 A;  1YJW A;  1LTG D;  5IYC G;  4TRD A;  4GKJ L;  5E4X A;  1CQV A;  2FJ2 A;  1QOH A;  2XN9 C;  4JYA L;  3CRL C;  1G29 1;  1PZI D;  1JR0 D;  1R4P B;  3NTH A;  4IAL A;  4LF6 Q;  5IGE A;  3MWY W;  2ES2 A; 
#chains in the Genus database with same CATH homology
 3NUC A;  2AWN A;  5BN4 A;  2E76 C;  3K57 A;  2R7Z B;  1D5M C;  3SEB A;  5D3I B;  4G7H C;  5IGC A;  4DAV A;  3DXJ C;  1HTP A;  4IQZ A;  4A3I B;  3R8B A;  2RKS A;  3D4W A;  5DEH A;  1EY7 A;  3C1E A;  3A55 A;  1B53 A;  2J7Z A;  1I4P A;  1HQM C;  1R4Q B;  2B39 A;  3IL8 A;  2MJ8 A;  3Q23 A;  4ZRZ A;  3CU7 A;  1W6K A;  4EGV A;  1FR3 A;  1PTO F;  2F0E A;  4ILW A;  2VB3 X;  2CW0 D;  4FXK C;  3VA7 A;  1OO9 B;  3WOF A;  1MBY A;  1JOK A;  4U67 3;  3VYT A;  3V96 A;  2IL8 A;  2HUG A;  1I4R A;  3ERO A;  1TS3 A;  2JYO A;  3MFY A;  3GTM B;  5FO7 B;  4J8Q A;  1QB5 D;  3HOX B;  1D2B A;  3MA2 B;  1BNZ A;  3A7L A;  2KHS A;  1I6V C;  3BYT B;  4LJZ C;  2WKC A;  5C0X J;  1OXU A;  4K2K A;  4MN3 A;  5D3D A;  5IT9 E;  5ELE A;  3G6J B;  2RDG A;  2YYZ A;  3K5L A;  1QIL A;  2O5I C;  1A3U A;  3VR5 A;  1RTN A;  4KJO A;  3H3V C;  1G2T A;  2EY5 A;  3MXN A;  1FYC A;  4DF7 A;  3HOU B;  2EYH A;  3A8J E;  1KLU D;  5G3L F;  2F0Q A;  1I4Q A;  4K8I A;  5IOC A;  2Z8L A;  4C3H B;  2F3V A;  1KTK A;  4KKU A;  1EZ6 A;  2PZU A;  4C3I B;  3K0Y A;  3C1F A;  4KMU C;  1OXV A;  3SK6 A;  1WD0 A;  3NPP A;  4G4K A;  3S1N B;  4H44 C;  5FLX L;  3GTG B;  4J6H A;  4BBS B;  1I4X A;  1LV9 A;  1PFM A;  1RD9 D;  4PMB A;  2B2U C;  2B2Y C;  3OOC A;  2A74 C;  1QCB D;  3S9W A;  4CKE A;  3OW7 A;  2HDL A;  2FFK B;  1HFN A;  5IGG A;  2F0P A;  3NP8 A;  4WJW A;  1JC7 A;  1D5X C;  2PNR C;  4OL7 A;  5E3F A;  3KUP A;  4KV6 A;  2QCP X;  1LTA D;  4KK7 A;  1MGS A;  1V8Q A;  4H7B A;  2M00 A;  4QF4 A;  1DOM A;  4BA2 I;  1CQF A;  1YNN C;  2Q8I B;  2NVT B;  1AEX A;  1BR9 A;  2PQE A;  4RGN A;  1DCZ A;  4ZQ3 A;  5CV6 A;  2B2W C;  1SYF A;  1VMP A;  1KAB A;  1YNN D;  5I9P A;  4ZUJ A;  3QOJ A;  2RBM A;  1V1O A;  2O2L D;  2EJF C;  1Y69 U;  2F0L A;  1FD7 D;  2ID0 A;  2OXP A;  5KEE A;  1EWH A;  4TQU S;  1UNS A;  1OXT A;  1CK1 A;  2XWJ B;  2NN6 G;  4YIJ A;  3GTJ B;  2EYL A;  4DN4 M;  3X3M A;  3HOY B;  5JPN C;  2EYM A;  2IX3 A;  2EJM A;  3MXG A;  2IWH A;  1WTO A;  1F2Z A;  1H9J A;  1B44 D;  2FIN B;  1HQR D;  2F0H A;  3PUX A;  3MHB A;  1PRT F;  2NWG A;  3ND8 A;  4DXF A;  2F4I A;  3DWA A;  4XTC S;  1WVL A;  3PUZ A;  4Q0F A;  1LTS D;  4IFD G;  4A3B B;  4RA8 A;  3TP8 A;  2M2L A;  3WOE A;  2R61 A;  3QWN A;  1EEF D;  2RA4 A;  4RGO S;  3TN2 A;  5IIF A;  4XQJ A;  2NUC A;  1B9M A;  4IUT A;  1TWG B;  2QIL A;  4FF3 A;  1IYU A;  1LAC A;  2K03 A;  4B9W A;  3J7A F;  2EOT A;  2LS0 1;  3M7G A;  1DOK A;  4OO1 H;  1VDZ A;  2RQX A;  3VA5 A;  3L9A X;  4FF4 A;  2EVB A;  2I07 B;  3X3N A;  4O1N A;  2VXW A;  4K5W A;  1W6J A;  5CV9 A;  5DM7 3;  5EKK A;  3RZD B;  4QIW B;  4J1M A;  3PO3 B;  4IZ8 A;  1LTB D;  1SE3 A;  1RCV D;  4C56 C;  5ELB A;  4A93 B;  4PV1 C;  3C2P A;  2ICI A;  1JWM D;  3EVQ A;  3CRK C;  4JK1 C;  2BDO A;  2JXM B;  5M5X B;  1SE4 A;  1WTX A;  5CBE E;  1XYI A;  1STE A;  3FMC A;  3OWE B;  3WDN A;  1I4H A;  3IFT A;  3RLF A;  1DON A;  5EGT A;  1PYW D;  2F0M A;  3ITP A;  2F0F A;  1SND A;  3N6R A;  2G9H D;  4DNT B;  1EIH A;  2XNA C;  1GUG A;  3URY A;  2BOS A;  3W3A A;  4ZLT F;  1D6E C;  2PYK A;  1TQO A;  1SBB B;  1KNA A;  5EBC A;  1CHP D;  1EYC A;  4GZY C;  2B2V C;  4FO2 A;  1SE2 A;  1E0B A;  2JA6 B;  2R6G A;  3T4A C;  3G7L A;  1I50 B;  2KED A;  4K6D A;  2WKD A;  4FF1 A;  3FPU B;  2PMZ B;  4DK1 A;  3BDC A;  3M3Y B;  5EPK A;  5C44 B;  3E0J A;  1B50 A;  2IX0 A;  4FXG C;  3AMU A;  3VR3 A;  1SYB A;  1SJE D;  5JEA H;  5T1G A;  4DU9 A;  5IT9 L;  1JOR A;  1T5E A;  1AN8 A;  2J0T D;  3K59 A;  2F03 A;  5FK9 C;  1U4P A;  5C4X B;  5I9O A;  1BQQ T;  2N88 A;  2SNS A;  4EQN A;  2BDN A;  1Y1V B;  4PNY A;  3BYY B;  4HN7 A;  3U9O A;  3M4Y A;  3GV3 A;  1Q1E A;  5JAV A;  4ID6 A;  2EYO A;  4CBV A;  3V2T A;  1SNM A;  4IFD H;  1TY2 A;  4KY7 A;  5FO8 B;  5IGB A;  1WD1 A;  4DNR B;  4A3E B;  1CZG A;  1EFI D;  5D65 A;  3SXH A;  3P1H A;  4ULL A;  3QJY A;  1S5F D;  4O42 A;  4Q5V A;  1MI2 A;  1QWY A;  4ZKB B;  1MD2 D;  3OIP A;  3U9S A;  2FHT A;  3Q6S A;  3KBX A;  3K58 A;  3CQZ B;  2PZW A;  2JA5 B;  1LT6 D;  1FNV A;  4FVM A;  1V1P B;  4HR7 B;  1F9S A;  5FKA C;  3PUW A;  5K36 G;  1V1P A;  5C0X I;  1K83 B;  1F9Q A;  3HOV B;  1LTR D;  5K5P A;  3AU7 A;  1A2T A;  4KHZ A;  1BCP C;  4C1N I;  1SYG A;  1Z6H A;  3OIQ A;  2RSN A;  4HMJ A;  2CVR A;  1ILQ A;  1HUN A;  1BCP D;  3VR6 A;  4CKB A;  1HUM A;  3R93 A;  3A7A B;  2KEC A;  1JB3 A;  2A73 B;  3BZD B;  3C46 A;  2VB2 X;  3M85 A;  3T56 B;  1DM0 B;  1SYD A;  1F9R A;  3LWE A;  4RAU C;  4G7O C;  1NR2 A;  2WIN B;  1ONL A;  1EZ8 A;  4NMZ A;  3BDO A;  4PQX A;  2F1M A;  3EQL C;  1E2W A;  1PFB A;  4ZKC B;  4KHV A;  2Z4I A;  1FGB D;  2F3W A;  4FNF A;  2Z1C A;  5CYU A;  2L0C A;  2SNM A;  2BA1 A;  1DD2 A;  2OF1 A;  3SHL A;  1TY0 A;  1LT4 D;  5J39 A;  2LMC B;  3Q0A A;  2DY8 A;  1SEB D;  1TWH B;  5C3X A;  4HMI A;  1BBX C;  1D1K A;  1C48 A;  1UEA B;  4KN7 C;  5F2D A;  1EL0 A;  2A68 C;  4HAE A;  4X3U A;  1ET9 A;  2A68 D;  5ELF A;  3D4R A;  2F0O A;  1CA5 A;  4JBW A;  4B08 A;  1STB A;  1KNE A;  1EY9 A;  2ZXO A;  4V0B A;  3S2D B;  1TII D;  3KF8 A;  2EE1 A;  3EFX D;  1CTM A;  5CV8 A;  1O80 A;  1Q8I A;  1XTC D;  5IGD A;  2B2T C;  1RKN A;  2E2H B;  2EJG C;  1QJO A;  3I90 A;  1EY4 A;  2KCC A;  3K5M A;  4OO1 G;  4Z9C B;  2K5W A;  4IUV A;  4RHS A;  4ZYS A;  2X6L A;  3MTS A;  2L4N A;  1EYD A;  4F88 A;  5M9O A;  5KYI A;  1BUV T;  3HS0 C;  4F7X A;  4L63 B;  1AW7 A;  1F9P A;  5COY A;  5CV5 A;  5ISR A;  5K36 H;  2K6A A;  5I6W A;  2L9H A;  4OIJ A;  3BG3 A;  1JQY D;  2DY7 A;  2MGS A;  2CHB D;  1PTO C;  5EJW A;  2R3Z A;  1EQV A;  1CA6 A;  1YNJ C;  4QMG A;  3TP7 A;  1A15 A;  1GOZ A;  1X3P A;  1FNW A;  3L7Z C;  1G91 A;  4KI0 A;  2A6H C;  4XDX A;  5NUC A;  2R92 B;  4RGT A;  4IUR A;  4IUP A;  5E4W C;  2WAC A;  2IX1 A;  2AUJ D;  4X3K A;  1LO5 D;  4E6I A;  1QNK A;  4HCE A;  1BXT A;  4X3T A;  1TWF B;  3QOL A;  4X3S A;  3R2T A;  4B9X A;  4G7Z C;  1TS5 A;  2HCI A;  1EWC A;  3L3O C;  5CV4 A;  2ZXP A;  4RKL A;  4F87 A;  3DWQ A;  2EY1 A;  3NQI A;  2O4X A;  3BS1 A;  5KRU A;  1UAP A;  2NTS A;  1PMR A;  3R3O A;  4V19 0;  1SMY C;  2B2U A;  1K8O A;  2XRQ D;  2B2Y A;  2PZT A;  1GUT A;  3NXW A;  2L55 A;  3P7J A;  1LLR D;  4QUF A;  5JEA G;  3MXU A;  5G3L D;  1Y1W B;  1CM9 A;  3F2U A;  2HQE A;  3PO2 B;  5JEA J;  4K5V A;  3Q24 A;  3PUY A;  1EEI D;  1HPC A;  2RDF A;  4I65 A;  3BVG A;  3P75 A;  4RKB A;  2IJ0 A;  2IPK D;  4FXD A;  1O7Y A;  3I70 A;  1ZXT A;  1H9K A;  4XYQ A;  2FMM A;  1HFG A;  4BY1 B;  1HA6 A;  3HRZ C;  3ERQ A;  5EKL A;  1JE4 A;  4PMW A;  1B1Z A;  1SNC A;  3K5O A;  3J7Y W;  2B2W A;  1X32 A;  3I4M B;  3T51 B;  4RCN A;  3S2H B;  4KY6 A;  5E1F A;  5CC4 A;  2KVM A;  2E2I B;  4IFD J;  1D1I A;  2EPB A;  5JOB A;  1QE6 A;  2F0U A;  4RFB A;  1BOS A;  3GTK B;  2F0S A;  4P2C B;  2K7V A;  2MHV A;  1NR4 A;  3CKI B;  4KD3 A;  3I4N B;  2QEJ C;  3HEJ A;  3NWS A;  3HGB A;  3E5S A;  4TKO B;  2BCO A;  2AWO A;  1RF2 D;  3KK7 A;  4Y7N B;  1GUN A;  1EQT A;  1EU3 A;  1BF4 A;  2K1B A;  3SK8 A;  2Z4H A;  1TS2 A;  4CJ1 B;  1QG7 A;  4UAI A;  2KJX A;  2F0V A;  4K6L A;  1BO0 A;  1AFP A;  3D4D A;  4CJ0 B;  3S1Q B;  4IUU A;  2VNU D;  4K14 A;  4RWS C;  5A2Q E;  3T53 B;  2DNE A;  3PUV A;  2SOB A;  2FMC A;  2J4X A;  1LAB A;  2K33 A;  2RSO A;  4PMC A;  5DNF A;  3TBI B;  1GXD C;  1MSG A;  1C8C A;  4IN3 A;  4NDX A;  1TU2 B;  3S1M B;  1B3A A;  2A69 C;  2K28 A;  3FPP A;  1PRT C;  3VYR A;  4C2M B;  1SNO A;  3GO5 A;  5I4D A;  1DOL A;  3FKI B;  1JWS D;  2PPB C;  2KEE A;  3J80 E;  1JIC A;  3GTO B;  2SDF A;  4N9P A;  4KKT A;  3MZ5 A;  1KAA A;  1BDO A;  4QUC A;  5C5M A;  3TSS A;  3UI2 A;  1GUS A;  4F8M A;  4EQP A;  3RD4 A;  1Z7T A;  2K04 A;  3HOW B;  2I46 A;  3NHH A;  2KOL A;  4C1N K;  3TZU A;  2RDH A;  5A35 A;  4LAA A;  2XIW A;  1Y8P B;  1HA5 A;  2AQ2 B;  2C9O A;  3FRP B;  3W2D A;  2E2J B;  3NTK A;  3QIA A;  4H13 C;  1DJR D;  5M5W B;  5CGK A;  1A6X A;  4QCL A;  2PCF B;  2LKV A;  1CHQ D;  3NTI A;  3H0G B;  3SK5 A;  2NVQ B;  3A54 A;  2F0N A;  3J7A V;  3ND9 A;  2E74 C;  3K5N A;  2F0G A;  2G9D A;  2WV6 D;  3MVV A;  4R9W A;  1STH A;  4EQO A;  2F0D A;  4LK1 C;  1V43 A;  1Y8N B;  2B8G A;  2B2V A;  2N55 A;  1SXT A;  2NB0 A;  3H09 A;  1Q12 A;  3KLS X;  2Q8T A;  3TME A;  2WAQ B;  2K01 A;  1EY5 A;  3VR2 A;  1LT5 D;  4RH6 A;  1Q3L A;  1S5E D;  3JAM E;  1C4Q A;  5M3F B;  1G8Z D;  3S16 B;  4DGZ A;  1PZJ D;  2R93 B;  3IFD A;  2WII B;  4DK0 A;  5KIX A;  4N9T A;  1EIG A;  4XIG S;  3GP7 A;  3H91 A;  4R8I A;  1STN A;  1HRJ A;  2D5D A;  4NP5 A;  1SSO A;  2NYZ D;  4BWG B;  1SYC A;  3GTL B;  3MXP A;  1KDA A;  2JSO A;  3A8I E;  3D8G A;  2CQA A;  4CJ2 C;  4ZAI A;  3V05 A;  3LX0 A;  2BE5 C;  1EYA A;  2HCC A;  2A5H A;  1ET6 A;  1CI3 M;  1VMC A;  5C4J B;  3OMG A;  4OHJ A;  2BE5 D;  4KY5 A;  3I73 A;  2LY7 A;  4L8J A;  2ZT9 C;  2AUK A;  4CGY B;  1WTR A;  1A3T A;  1LTI D;  2KA7 A;  2A6E C;  4XQN A;  2XWB B;  3J81 E;  2A6E D;  2IW3 A;  2X69 A;  5C4H A;  4G57 A;  3NBI A;  2SEB D;  3I72 A;  3GTP B;  1IL8 A;  1R9T B;  2NVY B;  3D3R A;  3D6W A;  3KBG A;  3SDZ A;  1BCP B;  1VCI A;  4A3M B;  4HTH A;  1ILP A;  1II3 A;  3HP3 A;  5FO9 B;  1UUP A;  5FOB B;  4HSV A;  5ELC A;  2X6G A;  2L12 A;  3NSW A;  1DYQ A;  3HKZ B;  2PO4 A;  3SE0 A;  1CT1 D;  1GUW A;  2JA7 B;  4A3F B;  4OGQ C;  3OHX C;  3K7A B;  5JPM C;  4IUQ A;  3OPO A;  3PMF A;  5JJZ A;  1J9O A;  1KDC A;  5JVG 3;  3FVQ A;  4OIK A;  1L0X B;  1G6Z A;  3NK9 A;  4BBR B;  2CW0 C;  1LT3 D;  3I3C A;  4FYD A;  5C6A A;  2ZXR A;  5EBD A;  3NE5 B;  1M4V A;  3IKJ A;  4K8J A;  3MC0 B;  3SR1 A;  1M8A A;  3KLS A;  2L5T A;  3H6M A;  3DWP A;  4WOR A;  2O5J C;  1EOT A;  1WCM B;  1KDB A;  1PTO H;  3EA6 A;  1X3Q A;  2XVS A;  5TSS A;  1Z47 A;  3TP6 A;  3I4L A;  4RCO A;  3BVZ A;  3VYU A;  2JA8 B;  3EJI A;  4CHT B;  1EY8 A;  3FEW X;  2NN6 I;  5A2Q L;  3A8K E;  1WTQ A;  2EDG A;  5C0X G;  1JCK B;  1J8I A;  1STA A;  5CMD A;  2E75 C;  1GHJ A;  3O13 A;  3AB9 A;  2XRS D;  2QF7 A;  2M9V A;  5JVH 3;  1I3Q B;  4IFD I;  5IGF A;  5IOD A;  3J80 L;  5KND A;  5I6Y A;  2TMP A;  2KUM A;  1AP0 A;  3ZYY X;  3VYS A;  4DAP A;  2GA4 B;  2B2T A;  1PTO D;  2OT2 A;  1Q1B A;  1H9M A;  1JWU D;  4LMQ D;  2L11 A;  1A2U A;  4WFN 3;  3RZO B;  1YNJ D;  3TZD A;  4FF2 A;  2QKI C;  1F77 A;  3H94 A;  5CR3 A;  4AYB B;  2XSC A;  2K5D A;  5AFW A;  1S5D D;  1PDQ A;  4WRD A;  2A6H D;  1U9R A;  1ENA A;  4TSS A;  4IUN A;  4XT3 B;  4MIU A;  4HED A;  1WTW A;  3TDQ A;  1XXG A;  4I7Z C;  2NVX B;  1SDF A;  1SJH D;  2BA0 A;  2DNC A;  4M1U B;  1TS4 A;  5EQ0 A;  5EKI A;  2OEO A;  1PTO B;  2NBF A;  3PIO 3;  5D14 A;  2EXZ A;  5EPJ A;  5M5Y B;  4NW2 A;  4ABN A;  5M3M B;  1B2T A;  1B9N A;  3QO2 A;  5C4Z A;  3NWT A;  2RVL A;  1NSN S;  5I2X A;  4NKL A;  4C3J B;  5EPL A;  1RJT A;  3KLR A;  1SMY D;  1RDP D;  5DM6 3;  2EZV A;  2E2D C;  4BA1 I;  1NCV A;  4H0L C;  4CKC A;  1FNU A;  3JAM L;  1IKL A;  2AQ3 B;  3T16 A;  3HZX A;  4DXG A;  1ENC A;  2JP1 A;  4ZK9 B;  1IKM A;  1TR5 A;  3N52 A;  3M7N A;  1PLF A;  3PV0 A;  3A56 A;  1I4G A;  3I91 A;  2VUM B;  1ZEQ X;  1IYV A;  2KCN A;  4XT1 B;  1ESF A;  4ZUI A;  1STG A;  1A3V A;  5C3E B;  1B4O A;  5T1I A;  5J22 A;  4BY7 B;  3QG1 A;  5KNC A;  2EY6 A;  2AQ1 B;  4RGM A;  2D2C C;  4K2L A;  5LL6 X;  2EYJ A;  1HXY D;  2MUY A;  3DEP A;  4A3J B;  1PXU A;  3MEH A;  1U4R A;  5CBA E;  5LHY 1;  2D62 A;  1TKW B;  2H4O A;  5HGT A;  4EVO A;  5C0X H;  2EYF A;  2WB1 B;  2MP1 A;  5C3W A;  1H9R A;  4ME5 A;  1K8M A;  1DXM A;  4A3G B;  1SNQ A;  3J81 L;  3S17 B;  4DAY A;  3Q22 A;  4L6T B;  1ML0 D;  2ICE C;  2ENB A;  5BN3 A;  1DZ1 A;  2YU9 B;  1XX8 A;  2Q8R E;  2V4D A;  3E6Z X;  1ESR A;  4BS9 A;  4M8A A;  1GUO A;  1ICW A;  1CFM A;  5KYL A;  1RTO A;  1ENF A;  3RMH A;  3DHQ A;  3SK4 A;  3MFG A;  3OWF A;  2Y0S B;  5DAU A;  3S1R B;  1E2V A;  4KKS A;  1ROD A;  3MAQ A;  1U4M A;  4KJN A;  2K5Q A;  1ZKO A;  2B63 B;  3GTQ B;  1O78 A;  3GQB A;  1S5B D;  2MPM A;  3DMU A;  3S14 B;  2HDM A;  3R2I A;  3S15 B;  1JOO A;  1SAP A;  2A69 D;  1F2M A;  1QNU A;  3FDT A;  1PRT D;  4RHR A;  2JEB I;  3DUZ A;  3GD7 A;  1STY A;  1GHK A;  3HG9 A;  1O7L A;  1L0Y B;  2QDB A;  4DFA A;  1S5C D;  2NTT A;  2PW7 A;  1E2Z A;  1HCZ A;  1SYE A;  4C3H G;  3GV6 A;  1OXX K;  3CHB D;  2C5C A;  1HTL D;  1I6H B;  3P20 A;  5FLX E;  1TWC B;  4C3I G;  4KTA A;  1TVX A;  1LTT D;  2K32 A;  1G2S A;  3DM1 A;  3BVM A;  1Y8O B;  1NUC A;  2JE6 I;  3BDL A;  2LFN A;  1GJX A;  1IW7 C;  3C3L A;  1PRT B;  5C5L A;  2EY2 A;  2L1B A;  1SNP A;  1F2L A;  1IW7 D;  3DEO A;  3VR4 A;  1BCP F;  5ELD A;  4R8N A;  3SVM A;  1KLG D;  2PW5 A;  1S4Z A;  1CZW A;  4XYO A;  3OSO A;  3PIP 3;  4K5X A;  4HSP A;  4UDU C;  5COR A;  1MSH A;  1EY0 A;  1WTV A;  1SFO B;  2NN6 H;  2EYP A;  4XQQ A;  5HUR A;  1T5X D;  1AZQ A;  1IHZ A;  2NZ1 D;  1TWA B;  1WTP A;  1XWE A;  1OXS C;  2F0T A;  3M4O B;  1RHP A;  5LL6 S;  3OMC A;  3ONA B;  4C3J G;  1U4L A;  3LNN A;  4KN4 C;  3TP5 A;  1H9S B;  1ZYR C;  4ODG A;  3IAY A;  1H9S A;  2F0K A;  1D5Z C;  4U68 A;  2TSS A;  1ZYR D;  1Q90 A;  3D6C A;  1AZP A;  3D31 A;  1VF7 A;  4FP5 D;  3NQT A;  2B8F A;  3QB3 A;  5BN5 A;  1EY6 A;  3RUZ A;  2IT1 A;  2KQ3 A;  1O7Z A;  4QB4 A;  4XXE A;  4HCS A;  5CV7 A;  1HHV A;  4DA2 A;  5KNB A;  2WP8 J;  2F0J A;  1PFN A;  2H1E A;  5I2Y A;  2JEA I;  4OO1 I;  2F0W A;  4KD4 A;  3HOZ B;  4S3S A;  2DN8 A;  3T13 A;  4A3D B;  1TT2 A;  3LWU A;  2F0I A;  2D9U A;  1EU4 A;  1F2Y A;  1PZK D;  3NBH A;  3I8Z A;  4MHE A;  3K6O A;  1NAP A;  1JOQ A;  5KGU A;  4A3K B;  1VF5 C;  5J1Z A;  2K05 A;  1LTG D;  4TRD A;  5E4X A;  1CQV A;  2FJ2 A;  1QOH A;  2XN9 C;  3CRL C;  1G29 1;  1PZI D;  1JR0 D;  1R4P B;  3NTH A;  4IAL A;  5IGE A;  3MWY W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...