3ONAB

The secret domain in complex with cx3cl1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
CNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/cytokine
molecule keywords Tumour necrosis factor receptor
publication title Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor
pubmed doi rcsb
source organism Ectromelia virus
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3onaB00
1EOTA 3DM1A 3I90A 1NCVA 4DN4M 1RODA 4ZLTF 1J8IA 1F9RA 3I8ZA 3P7JA 2NZ1D 4HEDA 1CM9A 5CBEE 1NR4A 1MSHA 1ICWA 1B53A 4X3KA 2B2YC 3I3CA 2BDNA 1G6ZA 2SDFA 1B4OA 4OIJA 2K03A 1IKLA 3MWYW 1A15A 1MI2A 1BF4A 1VMCA 1NR2A 2KEDA 5EPKA 2NYZD 1X3PA 2L12A 2X6GA 1AP0A 1J9OA 1WTWA 5D65A 5EKIA 1G2SA 1MSGA 4QUCA 4R8IA 1WVLA 1B3AA 4XDXA 1B2TA 1DONA 2H1EA 1ILPA 1X32A 1RJTA 2RSNA 3G7LA 1WTOA 2N55A 2XIWA 1BBXC 4RWSC 1HUMA 1WTVA 4IUUA 2MJ8A 1XYIA 3HP3A 1U4LA 1XX8A 3TZDA 4X3UA 4HAEA 4O42A 1E0BA 5EPLA 1U4PA 4IUPA 2B2TA 2B2VC 2FMMA 1JE4A 2DY7A 2KUMA 3I91A 2EE1A 2CVRA 3UI2A 1WTXA 1SAPA 4CJ0B 4MN3A 1M8AA 1SSOA 2HCIA 2L11A 4XT1B 5E4XA 1WTRA 1VMPA 2RSOA 4HSVA 4RAUC 1KNEA 4ZKBB 4ZKCB 2B2WC 2FJ2A 2MGSA 1GUWA 1O80A 1QE6A 2L1BA 3F2UA 1TVXA 5D14A 2J7ZA 3KBXA 3N52A 2B2YA 1F9SA 5CMDA 2MPMA 4IUVA 2KECA 3H91A 5AFWA 3DEOA 3FPUB 5T1IA 1EL0A 2K28A 2EOTA 2FINB 3LWEA 1ZXTA 2K01A 2RVLA 4QUFA 1CA6A 2FFKB 2NWGA 3IL8A 1WTQA 2K1BA 1CA5A 2JP1A 2Q8TA 2VXWA 4CJ1B 2EPBA 1DOLA 3GV6A 4OIKA 4UAIA 5E4WC 2X69A 1C8CA 4U68A 3Q6SA 1HA6A 1HUNA 1S4ZA 4X3TA 1F9PA 1KNAA 1U4RA 4HCSA 2HCCA 2B2UC 1HFGA 2KEEA 2D9UA 4X3SA 1QNKA 5JJZA 2B2VA 2Q8RE 3MTSA 2HDMA 3QO2A 3TN2A 1EIHA 1MGSA 4LMQD 1U4MA 4ZK9B 1Q3LA 4IUTA 1X3QA 5T1GA 1G2TA 5CBAE 1O7YA 1RTOA 3D6WA 1AZPA 4MHEA 1SDFA 2B2WA 2N88A 5EQ0A 4ZAIA 1HHVA 4IUQA 3SVMA 1DOKA 1AZQA 5COYA 1F2LA 1BNZA 5EJWA 1JICA 1QG7A 1RHPA 1DZ1A 1PDQA 2MP1A 5DNFA 1BO0A 1ML0D 1IKMA 1DOMA 1IL8A 2K04A 1B50A 2DY8A 3DEPA 1ILQA 1O7ZA 4XT3B 1PFBA 4IURA 4NW2A 2M2LA 2HUGA 1LV9A 3FDTA 5CORA 4R9WA 1RTNA 1HFNA 1HRJA 3GV3A 4CJ2C 5EPJA 2HDLA 1ESRA 2L4NA 2RA4A 1F9QA 2JYOA 1EQTA 2K05A 3R93A 2L9HA 2B2UA 1G91A 1NAPA 2B2TC 1PFMA 2FHTA 3ONAB 2X6LA 1PLFA 1WTPA 3IFDA 1WD0A 2R3ZA 2KVMA 3KUPA 2KOLA 1EIGA 2IL8A 4RA8A 1PFNA 1WD1A
chains in the Genus database with same CATH superfamily
1I4QA 5C4XH 4GLAC 2KCTA 2WP8J 3M4OH 1D1KA 4K6LA 2K5DA 1CM9A 5ELCA 5ELOA 1B53A 3H94A 4X3KA 1XJVA 3GP7A 3T56B 4WFN3 2DGYA 3HS0C 4H13C 2Z4HA 1RJTA 4K8IA 2ZM6Q 4DV4L 1Q8KA 5LMUL 5A2QE 1PH9A 1RDPD 2B29A 4O0AA 4O42A 1TXYA 4A76A 4NXNQ 2NN6I 2VS1A 5ELEA 1GM5A 1CQVA 4A3FG 4B3RQ 1B44D 3SK4A 2Z6KC 3CD6A 2MFIA 2B2WC 3TRZA 3CHBD 2LFNA 2ZJRA 4JBWA 4IPGA 3I73A 2IJ0A 2RCFA 4X66L 3J81j 3CP0A 4KKSA 4A3FH 2JK8A 3FPUB 3HOUH 3T4AC 4OWWB 1EYCA 4I7ZC 2K01A 4A3JG 3E6ZX 4IO9A 3TQYA 2SOBA 1AE2A 1MHWC 5I4DA 4CJ1B 4A3BB 4DR6L 2R93G 1JJGA 5F2DA 5C4JH 2EY1A 4CKEA 1HXYD 1IYVA 4X3TA 2E2IH 3S16H 2WKDA 1TU2B 5IGFA 1HH2P 3FPPA 3F2CA 4A3JH 3R2IA 4JI4Q 2HDMA 1HR0Q 3S2DB 1PRTF 1EYDA 2DN8A 2E5LQ 1X3QA 1EFWA 4KTAA 1S40A 1AZPA 2A8VA 1QOHA 2JEBI 1SDFA 2IPKD 2RKSA 5FO9B 1OXUA 3ND9A 1YBYA 1PHJA 1YITA 1KLUD 4HMJA 1O78A 2LSSA 4OL7A 1UWVA 2OXPA 3CCRA 3OPOA 2UUBQ 1PFBA 4JCVE 3GTKB 3HKZB 3V96A 3RN5A 2K05A 1VQHA 1X65A 2IX3A 1PYBA 3CQZH 4JOIA 2ICEC 1ET6A 4DR2Q 1Q46A 2QGQA 4YWMA 1PH4A 1VS0A 2F0QA 4A3GB 4MNOA 4N9PA 4FXGC 2O5IC 1ENCA 2M00A 1PZJD 4ZLTF 4C2MB 1K8MA 1L0XB 2E8GA 1E2WA 2FMCA 1UE5A 1JB7A 1A15A 1TS5A 5GAHC 1JR0D 1IBML 4DAVA 1XNQQ 3KLRA 1PTOF 3P20A 3TREA 3V05A 1B2TA 1ILPA 3QG1A 2VQFQ 4A3DG 1HUMA 4BBSB 2RDGA 2Y0SE 1U4LA 3I4LA 5I6WA 1V8QA 2QEXA 3R8BA 4DAPA 4ZCKA 1U0LA 3S14H 2UUCQ 3I91A 4XQJA 2CVRA 4J6HA 1ASYA 1L0WA 1Q12A 3VDYA 2A6HD 3NELA 3NTIA 2F03A 1D5ZC 4HSVA 5ELBA 4LK1C 3I4MB 2I5HA 1JJCB 5C4HA 1BUVT 3KBXA 4DV1L 3H91A 5M5YH 3D4RA 2OT2A 1EOVA 3RZDB 4L5RC 1M1KC 2EOTA 1WTQA 3P75A 4OELB 1DOLA 4DNIA 1YHAA 2EXZA 3UDFA 2K7VA 3A7AB 4NDXA 3PO2G 2PNRC 5AJ3Q 1H9KA 2KEEA 1W2BA 2ENBA 1PV4A 1SNOA 1V1PA 4LFAL 5BN5A 4FVMA 1Q81C 3K8AA 4L63B 2BA0A 4NXMQ 4JI6Q 3PO2H 2F3VA 2RHSB 4ZUJA 1DOKA 2QEJC 4O2DA 2B63G 3KF8B 1N8RC 2NVQB 1MIUA 3AEVA 3TDQA 5CV6A 2F0HA 3KDFB 4BXXG 2BH8A 3QWNA 1GO3E 1I94Q 3MXNB 1C4QA 1SMXA 3BVGA 2NVYH 2B63H 1RTNA 5C4XB 3PUZA 1O7IA 4ID6A 1HNZL 3M4OB 1CTMA 4M8AA 4BXXH 2ICIA 2RF4A 1NAPA 1GOZA 1U9RA 1H9RA 2YYZA 1Y8PB 4E6IA 4UHVA 4EGVA 4PQXA 4RH6A 4DV5Q 2EDGA 1XMOL 4IZ8A 5KNDA 3NHHA 2VQEQ 4Q0FA 1F9RA 3M85A 2NZ1D 3GTLH 1H9SA 2D2CC 2JQOA 1PH8A 2DUDA 3SE0A 4F87A 1STNA 1TKWB 2X6GA 3UE0A 1TS4A 5EBCA 4R8IA 1A6XA 2B8FA 3OMCA 3DXJC 5JOBA 3B6YA 4BY7G 2Z1CA 4BS9A 1L1OC 3OW2A 4JBKA 1JE4A 1NMGA 3VR6A 3HOUB 2EY6A 4KV6A 1Y1WG 2JN4A 2L11A 3J7YW 4LF5Q 4FP5D 3HFZB 4DR3Q 1K73C 5C4JB 3G6JB 1VMPA 4HJ8A 4BY7H 3HEJA 1L1OB 2E2IB 3A55A 2LKVA 4CKBA 3F2UA 5D14A 1PRTD 4JC0A 4A3JB 1Y1WH 3RR5A 3VYSA 3E5SA 3SR1A 3IAYA 2ZTDA 2FINB 2QA4A 3QOJA 3GTJH 2MUYA 3QR8A 2F0IA 2G9DA 1EY5A 2O2LD 3CF5A 1Y1VG 2X69A 1T5EA 2F0DA 1VF7A 4DNRB 2B2VA 3BVMA 4ZUIA 4DAMA 1J5EL 3ER0A 1MGSA 5C5MA 1U4MA 3S17H 3QJYA 4S3SA 1X6OA 4JV5Q 1FYCA 1Y1VH 1JORA 3TBIB 1O7YA 4HIKA 3BZDB 1K0SA 1X3GA 4YWLA 3PIOA 4CDCC 1RF2D 2NB0A 1SE8A 3CQZB 3K5NA 4KHPQ 1DXMA 3PUWA 4R4CA 2AWOA 3K5OA 4OONA 1EY0A 2ID0A 3C2PA 2HUGA 1SMYC 1X9NA 1HR0W 1HFNA 1SYFA 3CPFA 4DUYL 3NK9A 1F9QA 1LTGD 5JVH3 2FXQA 3CC7A 2B2UA 3VYTA 1PTOD 3QOLA 1DGSA 2Q2HA 4LF9L 4RCOA 4GLVB 2NVXB 4L5QA 3KUPA 3TEHB 2IL8A 2NZHA 1F77A 2JXMB 3VA7A 2EVBA 3K5LA 3CW2C 3R3OA 1EYGA 3BDCA 4HEDA 4J8QA 4UP9A 3S14B 2JA8H 5KRUA 1HZ9A 1KXLA 1NR2A 2YTXA 4LJZC 4DV0L 1T5XD 1YI2A 2L12A 5C3XA 3ICEA 2AQ3B 1N33L 1WVLA 1DONA 1EYAA 5C3WA 3U4ZA 3D8GA 3TMEA 3AMUA 2I46A 1CQFA 5KIXA 1JMCA 2NBFA 5M5YB 2DY7A 1GHJA 1VCIA 4JI0L 4B9XA 2HQLA 1IBMQ 1H95A 4HR7B 4UP7A 2AWNA 2WAQG 3FVQA 1Q1BA 2AQ2B 3KK7A 1XTDA 1TWFH 3Q24A 4B3ML 1RKNA 5DAUA 1HNWQ 2NUCA 4DA2A 4X65L 2UXBL 4A3KB 3M4PA 3FP9A 2K14A 4KLKA 1YEZA 1V9PA 3HZXA 2R61A 1C7YA 4FF3A 4YIJA 2A69D 2RDHA 1EIFA 2IX0A 4ZK9B 1Q82C 2QDBA 1LT6D 4U673 2F0VA 4JVZA 1EQQA 4LF4L 2BH2A 2NVYB 1RTOA 2B63B 3D6WA 3K7UC 2K6AA 4IUQA 1OXVA 4DR5L 4JI3Q 3AU7A 1VQIA 4BWGB 5M3FG 4R4TA 3ULLA 2MP1A 3L2PA 3KLWA 3M4YA 1I4HA 3FMCA 5HURA 1TT2A 2EYLA 2WFWA 2DY8A 2H5XA 4PMBA 4XT3B 2K75A 2H4OA 4K5VA 1GXDC 1SE3A 1NTGA 5M3FH 3MC0B 5IP7G 3ZJYC 3JAMc 4A3LG 2L4NA 4B3SQ 2I07B 2G5DA 2ATWA 2A19A 3W3AA 3J7AF 1EZ6A 3STBC 2CH4W 4K8JA 4OWXB 5IP7H 3TP7A 2F0GA 1EIGA 4LFBL 1SXTA 1WCMH 3K58A 1M90C 1EOTA 3JAMi 3NE5B 4X62L 4DN4M 3S2DH 4DV7L 1EY9A 3I3CA 1G6ZA 1B4OA 2Z0SA 3S1QH 2ES2A 1IBLQ 2A6EC 3HKZG 1K9MC 1B3AA 1RCVD 3ULJA 3W5OA 4BY7B 1K83B 5HGTA 2XVSA 4N8X1 4IUUA 3MA2B 2NTTA 1G6PA 1P8LA 5EPLA 1Y1WB 2FMMA 4DR4L 4JW0A 4LFCQ 3A0JA 2EJMA 1HA5A 1QVGA 3HOVB 2JSOA 4MN3A 1FNUA 5IOCA 3GTJB 1IL2A 1B70B 4A3GG 3K80C 5KEEA 1CFMA 3MEHA 2RSOA 3AB9A 4BA2I 5FKAC 1BKBA 4RGNA 4RMFA 5JJIA 2F0UA 3UDGA 3N52A 4UDUC 1P16A 5CYUA 3CCUA 4A3GH 2EIFA 1GJXA 1Y1VB 4C2MH 1HTLD 3HOXB 4J1MA 4X64L 2E2JH 1QNUA 4BBSG 5G3LF 1LUZA 5FJ8G 4DF7A 3CU7A 1PZID 4IFDG 2XGTA 4YY3L 1DM0B 1BBWA 3OWEB 1LTLA 3J80c 3GTMH 4GKJQ 3J7A5 2JE6I 1QJOA 3QO2A 3AQQA 1Q3LA 1SRUA 4BBSH 3LWUA 5FJ8H 2PYKA 3JAME 3CXCA 4IFDH 2UXDL 2VNUD 1XMQL 3NBHA 2WB1B 3J80i 1BO0A 2L5TA 5ELNA 4JI1L 1IKMA 4N9TA 2F0WA 2F1MA 4G7ZC 1VQJA 4XXEA 1O7ZA 3SK6A 3K57A 1IW7D 3CMAA 1SNMA 5CC4A 1XNRL 5CV9A 4ABNA 3PF5A 2Z4IA 2K5WA 3RZDH 2HQEA 1JT8A 2MHVA 2JA8B 1KLGD 4ZQ3A 1CHPD 4NB3A 1N32Q 3QIAA 4DV6Q 4GNXC 2JA7H 1QUQA 2F0NA 4IALA 4K14A 4OX9L 4A75A 1V43A 1QVCA 3H0GG 5M5WH 4DUYQ 3ND8A 4HIOA 2PMZB 1BR9A 3DM3A 3UDXA 1MSHA 3DWAA 3T16A 1KQSA 4AYBB 2B2YC 3LGJA 4DNTB 2E75C 4GNXB 1I50H 3PUXA 1WTWA 2ASBA 4JI7Q 3H0GH 3TS0A 4C3HH 1X32A 3HOZB 1D8LA 2XIWA 1W6KA 1VDZA 1EWIA 2ZXRA 3T13A 2V1CC 1UEBA 3TP6A 1PH7A 1F2MA 4KJNA 4UP8A 5GADC 2C5CA 5LMNL 2WAQB 5NUCA 4C1NK 2PQEA 4IQZA 3FKIG 1NJIC 2SNMA 4JYAL 1K8OA 1KDCA 3KF6A 1GUWA 1QE6A 2CHBD 2KHJA 3CRLC 3J80E 5CV5A 4I65A 4DV3Q 3FKIH 4LF7L 4DR7L 1EY7A 3RNUA 5E4WC 1VQ7A 1D5XC 3C3LA 1FL0A 5IYDG 2HCCA 4B3MQ 4XQNA 1N36L 3P1HA 5I2YA 3VYUA 1QNKA 3HOUG 1BDOA 3TN2A 3NWSA 4R4OA 3GTPH 3RD4A 2OQ0A 2PQAB 1OXTA 3OOCA 2QW7A 4PV1C 1EIYB 5M3FB 2JA9A 4JBJA 5IYDH 1DD2A 1LABA 3R2TA 1F2LA 3TP8A 1O7LA 1Y8OB 4FF2A 1TR5A 4ZYSA 1YJNA 4CGYB 1KC8C 1ILQA 5LL6X 3H3VH 1VQAA 2EY5A 4DUZL 1WJJA 4PZ7A 1WCMB 5EKLA 3JAML 4CJ2C 3OTOL 4DR1L 2ZT9C 3KF6B 4R4QA 2F0TA 3BVZA 3G48A 1EWCA 1KAWA 2XWBB 4OEMB 4K0KL 4B9WA 3S1QB 2FHTA 4BY1G 4JI8Q 4N8FA 2R3ZA 4DV2L 1EQRA 2F4VQ 3M3YH 1KIXA 1JB3A 2RHQB 2CQAA 4MIUA 4F7XA 1PTOH 4BY1H 1VQCA 1E2ZA 2CW0D 3I55A 2N49A 1EQVA 1STYA 3HG9A 2A6HC 2B8GA 1WTHA 3HKSA 4LFBQ 4LUZA 1LTTD 2V4DA 3Q22A 4GOPA 5C0XG 5GROA 4KY7A 1VQPA 4LUVA 1E0BA 2XRSD 4DV7Q 1NE3A 1UAPA 2B2TA 4RGOS 4IN3A 2BE5D 4XTCS 3CC4A 5G3LD 3NTHA 2E2JB 5C0XH 3M7GA 1LTSD 3ERSX 4IJLA 1I3QB 1A2TA 1I4GA 1PXUA 1N34L 4NPSA 1UUPA 2VZAA 1STGA 2UU9Q 1II3A 5JEAG 3GTMB 2NTSA 4AQYQ 1F9SA 2NVXH 4IUVA 5J3BA 4BA1I 3LWEA 4MTNA 2R7DA 1CA6A 1TS2A 2R6GA 3K7AB 4QIWE 2Q8TA 4G7OC 4JI5Q 1SR3A 4GKKQ 4HN7A 1SYGA 2O4XA 5FLMG 5JEAH 4IOAA 1Z47A 2K52A 3J80L 4JOIC 4X3SA 2Q8RE 2EY2A 3MTSA 1STAA 1T9HA 2OQKA 5FLMH 2LXKA 4KD3A 4MHEA 4ZAIA 4HJ9A 4YHHQ 1CT1D 1I4XA 4ME3A 5DNFA 2I0QA 5FLXc 1IL8A 3TSSA 4KK7A 4A3KG 2ZJQA 3VA5A 1STBA 4LF8Q 1L2FA 2IT1A 3KFUA 2JA7B 3CCVA 2PZTA 3FDTA 1LV9A 5CORA 4DK0A 1NNXA 2LXJA 4WJWA 5M5WB 2OTLA 2EYHA 2N8NA 3T1HL 4A3KH 1V1QA 4DAYA 2AUKA 2RCNA 1XMQQ 1QVFA 1WYDA 1X55A 1I50B 3IFTA 2X6LA 4XIGS 3VR2A 3H0GB 4C3HB 1PFNA 1RIPA 1XNRQ 1NCVA 2PCFB 1J6QA 1UE6A 1NR4A 1Q1EA 5DM73 2BOSA 4XYQA 3MWYW 1MI2A 5KYIA 1ESFA 1ICFB 1PA6A 5CV4A 1Q8IA 4ME5A 4R1JA 4AH6A 4TVAB 2IW3A 5IWAQ 3U9SA 1E3PA 1K28A 3TZDA 1H9JA 1IZ6A 1PRTC 4I7AA 4IUPA 5KNCA 1HTPA 3FKIB 3DWQA 1B9NA 4QMGA 4XT1B 2JA6H 4IFDI 1CZWA 4ZKCB 1E22A 3I4NB 1PH1A 1PRTB 3AYHB 2L55A 2Y0SB 2KQ3A 1LYLA 1V1PB 2J7ZA 3W1BA 3BYYB 4DAYB 1CKNA 1EL0A 3GTPB 3PIPA 3KLSA 3T1YL 2A68D 2GA4B 4OXPA 2A1AA 1YJ9A 4UAIA 2F0PA 2YV5A 3H3VC 3NP8A 2EYFA 2SNSA 4POGA 2F52A 4IUNA 1PMRA 3SDZA 1I6VC 1KNAA 2WIIB 3NXWA 2DJFC 3I7FA 2XN9C 2ZTCA 3HOVG 1K83H 1FVIA 1HNXL 4LF7Q 5IT9c 3JC66 4DV4Q 5C4ZA 2EYJA 5LMUQ 3ULPA 4JI2L 3H6MA 4L5SA 1TS3A 1VQ9A 3C1FA 5COYA 4L6TB 1QG7A 3NSWA 4QF4A 3X3NA 3HOVH 1PDQA 1X56A 2CWAA 3WOFA 2HIVA 1ML0D 4TSSA 5JPMC 4B3TL 1PTOC 1A63A 4P75A 1XTCD 2AHOB 2K5HA 1R9TH 4C3IG 1GUOA 3MXGA 3W1GA 3HOXG 4H02A 1S5CD 4PNYA 3M3YB 4A3MG 3U9OA 4X66Q 2HDLA 1H9SB 3A5UA 5JAVA 3BU2A 3RMHA 2ZJPA 2GVAA 1PTOB 4JK1C 3X3MA 2UXCL 4BY1B 2O5JC 2KJXA 3MXPA 2MO1A 3VYRA 4C3IH 3HOXH 4RGTA 4DR6Q 3KJPA 4A3MH 4LUOA 4WRDA 2ALYB 1K3RA 4KY5A 1A3UA 1B9MA 2I5MX 1CZGA 1Z7TA 2WB1G 2PZUA 4A93B 4K0KQ 2KEDA 3TP5A 4DK3C 1QZHA 2N55A 4FYDA 1WTVA 1I5FA 3PO3B 4EQOA 3GQBA 2JA8G 2RQXA 1YNXA 1I6HH 1FR3A 1U4PA 1ZKOA 2B2VC 2KUMA 3K59A 3URYA 3CRKC 1S5BD 2F0OA 2E2DC 1KAAA 1BCPF 1AH9A 1O80A 1AW7A 2D5DA 4AYBG 3K0XA 4HIDA 2D0PA 2A69C 2D0OA 3H3VI 2UUAL 2Q2TA 1OO9B 2HD3A 2K33A 1EEFD 3HOZG 2K4KA 1GD7A 2PO4A 2D62A 1NY4A 5I6YA 1B3QA 1XPUA 2WV6D 2B2UC 3PUYA 4CDFC 2PPBC 4RFBA 4F8MA 1FGUA 3HOZH 3K0YA 1NBWA 3S2HH 1VQOA 4YWKA 5IGEA 1LM0A 1JOOA 2YTVA 1JWUD 4ALPA 1VQ4A 3TZUA 1YNND 2J4XA 3T51B 2OWOA 1JICA 2P5ZX 2IWHA 2ZM6L 4F88A 5I9OA 3ITPA 3MVVA 4GLXA 1VQ8A 4RG1A 1C48A 5EPJA 1ESRA 4DV1Q 2RA4A 3RN2A 4B3RL 5FO7B 1EZ8A 4LWCA 4TKOB 2VB2X 4LF6L 1SNCA 3NQTA 5C0XJ 1C0AA 3EROA 4PZ6A 1LT5D 3QB3A 1EU3A 5C0XI 1XPOA 4KKTA 3N6RA 1A3VA 3HRZC 2EXDA 4XYOA 3GTGH 4Y52H 4P2CB 3O13A 1ZYRD 3DMUA 1RODA 1S5ED 2XRQD 5LHY1 4LFAQ 1G291 1FNVA 4FF1A 2K03A 1BF4A 4FO2A 1E24A 2CKZB 2WINB 1X54A 5EPKA 5C44G 1YNJD 4QCLA 1WCMG 3OWFA 2JA6B 1HR0L 2F0EA 3DHQA 1WTOA 1QB5D 4QB4A 2VUMB 2LY7A 5L37A 2EYPA 1S3OA 3OHXC 1XYIA 1GUGA 5C44H 1GUNA 5CGKA 1CUKA 1LTID 5DEHA 2HCIA 2XNAC 5E4XA 1HNZQ 4NMZA 2A5HA 4RAUC 3CC2A 4WJ3M 5GAGC 4CDDC 1EU4A 2ZXPA 3SGIA 2NZOA 5IE8A 4QGUA 4KKUA 5IODA 1XMOQ 4DR2L 2VXWA 3NEMA 4LW1A 2EPBA 4OIKA 4L5TA 1C8CA 1BXTA 2IHFA 3MHBA 3Q6SA 3FEWX 1U4RA 3EVQA 1YVCA 4LMQD 1R9TB 1I4RA 4DPGA 1IW7C 1W3SA 2KCCA 5IP9G 1XNQL 1E7ZA 4G57A 1M4VA 4UPAA 1TWAH 4C3IB 3DUZA 2VQFL 5LL6S 2KCNA 2BDOA 1B50A 1I3QH 1PZKD 2R7ZH 4A3MB 5IP9H 1HNXQ 3NWTA 4IPCA 3SEBA 1WFQA 2WAQE 3PMFA 1LLRD 2JYOA 5H1SE 5A35A 2VB3X 3RLOA 3K7AH 3BS1A 4WJ4A 1PFMA 2E74C 1L0YB 1WD0A 2MNAA 1FGBD 3RLNA 5I2XA 4RA8A 2YTYA 1WD1A 1GKHA 1J5EQ 4K5WA 1VQEA 3F8TA 2VL6A 3CCJA 1I6HB 1ICWA 2QDLA 2SDFA 1IKLA 1C9OA 5AJ3L 2JA7G 3KLSX 1A3TA 5M3MB 1BCPD 1MSGA 4GN4B 4G4KA 2A73B 5C3EG 2F3WA 4KHZA 3BZKA 2MJ8A 1I4PA 4NXML 3TS2A 4JI6L 1KTKA 1IYJB 1HQRD 1PYSB 4KHVA 2F0FA 3CAMA 1WTXA 3HGBA 1SAPA 1EEID 4HIMA 4C3HG 3A8JE 5C3EH 4UY8C 1CSPA 1PFSA 1ONLA 2KENA 3I70A 1I94L 2FJ2A 1SYEA 4V190 3H15A 1ET9A 4LF9Q 2JA5G 3CCQA 3GTQH 5IGGA 3KYHC 1D1IA 2K28A 3DLLA 2AUJD 5JJKA 2K1BA 4A3EG 3S2HB 3NBHB 4Y7NH 3E9HA 4FXDA 1RD9D 2JA5H 5CV8A 4DV0Q 1HFGA 4DV5L 3K6OA 3DWPA 4BBRG 5JJZA 1N33Q 1F2ZA 2MO0A 3E3XA 3OSOA 1EIHA 4A3EH 1TWHB 1BVSA 1YHBA 2L0CA 2Z8LA 4KY6A 2Z6KA 3HKZE 3I4NG 2EQSA 2B2WA 1B1ZA 1KL9A 2Y0SG 4BBRH 1LTRD 1DZ1A 4JI0Q 3AFPA 2JEAI 1VQNA 2K04A 1PH2A 1QUQB 3I4NH 3OMGA 3RZOH 3GTOB 4NW2A 3I56A 3S1MH 3GTGB 4A4IA 3MEFA 1IYUA 3GV3A 3VR5A 4LF5L 2OEOA 4DR3L 1VQFA 2QILA 1E1TA 4X65Q 4DFAA 2UXBQ 1EY6A 4PG3A 2CW0C 1SYDA 2EYMA 2DNEA 1DJRD 3C46A 1D5MC 3PF4A 4A3IG 4LNQA 2KOLA 1HZBA 1UEAB 3DM1A 4IPHA 1SROA 3LX0A 4ILWA 5C44B 2BDNA 4LF4Q 4WORA 4A3IH 2BE5C 4NP5A 4P74A 4LF6Q 4PZ8A 1HZAA 1EWHA 5EKIA 4DR5Q 1G2SA 4B08A 4XDXA 3PSIA 3G7LA 4JV5L 4MTKA 1CI3M 4X3UA 5M5XB 3EIVA 2Z6BA 5FOBB 1CKOA 3S1NH 1JWSD 2LMCB 3SK5A 3GD7A 2EJGC 4ZRZA 4CKCA 5ELDA 1M8AA 1SEBD 1JQYD 4EQPA 1FD7D 4KHPL 4XQQA 5E3FA 1G8ZD 4OWTB 2R93H 3PIP3 5DM63 1Y8NB 3HOWG 4P72A 1LTAD 2F0LA 4DXGA 5ELFA 4RHRA 3SXHA 2TMPA 3BDLA 4A93G 3G4SA 4OGQC 2RBMA 1JC7A 1N9WA 4EVOA 5T1IA 4CHTB 3S15B 2ZXOA 1ZXTA 4HSPA 4HJ7A 4X62Q 2FFKB 2CWPA 4OHJA 1KDAA 3HOWH 1PVOA 2OTJA 3D3RA 4A93H 2GN5A 3PO3G 3BZCA 2QKIC 1HA6A 1TWAB 2B3GA 2D9UA 1ASZA 1X3EA 2R7ZB 3WWVA 1NSNS 4POFA 2K5QA 1UNSA 3PO3H 2QF7A 2KHIA 3SVMA 4DR4Q 1B8AA 1ENAA 2KCMA 2R92B 1S5DD 1HQMC 2J0TD 1A8VA 2AMCB 4HCEA 2EYOA 3LNNA 1H9MA 1QCBD 4PMWA 3E0JA 2QCPX 2DNCA 3HOYG 4GOPC 2K32A 3VR3A 3PIO3 3Q23A 2IY5B 4L8JA 2G9HD 2B2TC 3KF8A 3KOJA 1JJ2A 4X64Q 1LT4D 3ONAB 4OO1G 2F4IA 1HNWL 1PLFA 3A8KE 3I72A 3KDFA 3HOYH 4GOPB 4CDEC 2E2HH 4YY3Q 5C5LA 3M9BA 2TSSA 4J15A 2XTIA 1D7QA 3MXNA 3A56A 1XWEA 1TWGB 3Q0AA 4A3DH 1PH6A 1QILA 1TWCH 4C3JG 4OO1H 1HJPA 5BN3A 2OCEA 1AP0A 1X3PA 5A2QL 2Z9HA 5C3EB 3VR4A 2UXDQ 2H1EA 2RSNA 3J7ZC 4JI1Q 4A3CG 3ZYYX 1BBUA 3NPPA 4C3JH 1XX8A 3U4VA 1TY2A 4JI3L 4TRDA 3GTQB 3RUZA 2DJGC 2A68C 2RDFA 3EA6A 2XSCA 4A3CH 4PMCA 3UDIA 1CK1A 4Y7NB 1KDBA 1D2BA 2JA5B 2KBNA 1HZCA 1MKHA 5EBDA 5CMDA 3PQIA 4B3SL 1KABA 4Z9CB 4A3EB 3DEOA 2L15A 1S5FD 2JA6G 2RVLA 3KJOA 3NTKA 4OX9Q 5CR3A 2JP1A 3S1RH 1IHZA 1DYQA 2NVTB 3GV6A 2VUMG 5JJLA 3GO5A 5IGCA 3PCOB 4BBRB 5IGDA 4IJHA 4IFDJ 1Z9FA 3WDNA 2K5NA 1L1OA 5IYCG 1VQ6A 1JE5A 4RKBA 2C35B 2VUMH 5D3IB 5CV7A 3RZOB 4IUTA 4K6DA 5T1GA 5J1ZA 3S1MB 3FHWA 4QIWB 1A62A 1KRSA 3GDEA 5EQ0A 1IBLL 1BOSA 2N3SA 5JPNC 5IYCH 1QZGA 3NENA 5LMNQ 4X6AH 2YU9H 4FDBA 4GS3A 1OTCA 3J81c 4JYAQ 1AE3A 4KI0A 3MXUA 2WACA 5FLXE 2M2LA 4LFCL 5BR8L 1SYCA 2EJFC 1OXSC 4KJOA 1NUCA 1VQMA 1XPRA 5DLQE 4DR7Q 1VQKA 4KN4C 5D3DA 4A3IB 4QL5A 3J81i 5K36G 1PH3A 1JOQA 3L7ZC 5EKKA 2LS01 3I4OA 1LACA 1SE4A 4A3FB 4FXKC 1JWMD 2HIXA 1N36Q 5J39A 3D6CA 5K36H 5CBEE 1STEA 3U58A 5KNBA 2PW5A 3S1NB 4DKAC 1TY0A 4P71A 2PW7A 2NYZD 4YCWA 4GKJL 1Y14B 3S16B 5KYLA 3CCEA 2R93B 4RWSC 1FJGL 2F0SA 1UE7A 2OF1A 4HJAA 3RLFA 1CKNB 3BDOA 2AQ1B 4MZ9A 1KHIA 1YHQA 4KMUC 1Y69U 2EE1A 4DUZQ 2PNHA 5FO8B 3E9IA 1WOCA 1SSOA 3OTOQ 3HOWB 4DR1Q 4RGMA 1WTRA 4JG2A 3A74A 1S72A 4GN5A 1EY8A 1ENFA 5IIFA 2KA7A 4DXFA 5TSSA 4EQNA 1CSQA 4DV2Q 2EZVA 3A8IE 2CQOA 3NBIA 4CBVA 5M3MG 3S9WA 3IL8A 1TIID 4HMIA 4DU9A 1SE2A 2F0MA 1PYWD 3OW7A 2NN6G 1N32L 1GHKA 2HHHL 2F0KA 1W6JA 4DGZA 1A2UA 4DV6L 2E76C 4DK1A 5BN4A 1HUNA 1YNNC 1F9PA 2CFMA 1TQOA 5J22A 5M3MH 1LO5D 3J81E 1GUSA 1LT3D 1K0RA 2NN6H 1R4PB 3G71A 1BQQT 2N88A 1VQ5A 3J7AV 1HHVA 5IT9E 3M4QA 4JI7L 5EJWA 4DK6C 3IRBA 1K3BC 3A5ZB 1SLJA 1DOMA 3CCSA 1IBKL 5I9PA 1F2YA 3DEPA 4NKLA 4IURA 3HOYB 1N34Q 3FRPB 1SBBB 3OIPA 4IPDA 2E2HB 3EJIA 4JPBW 4EX5A 1PH5A 2JJQA 1ZYRC 2VW9A 5HGQA 4A3DB 1DCZA 2L9HA 1TWCB 5C6AA 3A7LA 3D4DA 2I5LX 3G6EA 3V2TA 1WTPA 3IFDA 4HTHA 3F2DA 1YNJC 1SFOH 1SMYD 4DV3L 1GUTA 3R93A 5FLXL 1UE1A 1EY4A 4C56C 4C3JB 1J8IA 1TWHH 1SN8A 2XWJB 3PV0A 3W2DA 2GVBA 4H44C 4R4IA 4NXNL 4Q5VA 1VQGA 1VMCA 1OXXK 1SNPA 1QWYA 3BJUA 1J9OA 4HJ5A 3C1EA 1JCKB 3EBEA 2WKCA 4HAEA 3PO2B 3GTOH 3F2BA 1AEXA 3A54A 3I2ZA 4CJ0B 2PZWA 1VQLA 1X3FA 3S1RB 4RHSA 3T1HQ 4ZKBB 5M9OA 4QY7A 3E0EA 2R7FA 3OYYA 5GAEC 1HCZA 5JEAJ 4JI4L 3K5MA 2MPMA 5AFWA 2KECA 4KD4A 2SEBD 2MQHA 1CHQD 4QUFA 1D6EC 2N78A 5ISRA 2E5LL 1WI5A 4YCVA 1VQDA 1MBYA 4JI8L 4A3BG 2AKWB 3MFGA 2F4VL 1SNDA 4K5XA 4HCSA 1XXGA 1AN8A 2WB1E 1KD1C 2YU9B 1HPCA 3CKIB 3OIQA 2A74C 4C1NI 4K2KA 2UUBL 4JBMA 3GTLB 4A3BH 2CCZA 3NUCA 4EQ5A 5CBAE 1YJWA 3BYTB 5M5XH 1G2TA 1Z6HA 5FK9C 3MFYA 5EAYA 2IX1A 1VQBA 3SK8A 1RHPA 4A3LH 3T53B 4OO1I 1MJEA 2CH4A 1AFPA 3J81L 3EN2A 1STHA 3KBGA 1SJHD 3F1ZA 1JOKA 2ZTEA 4R9WA 3SHLA 3L0OA 1HRJA 1NMFA 3CCLA 1EQTA 2PMZE 4RKLA 5IT9L 1CKMA 3S15H 1EUJA 4AYBE 3T1YQ 2R7ZG 3L9AX 3EQLC 2UU9L 5LMNW 4AQYL 2KVMA 1BCPC 1SYBA 2PI2E 3CCMA 1G91A 1MD2D 2HT1A 3GTKH 2C9OA 4FNFA 5BR8Q 1R4QB 3I90A 4JI5L 3P7JA 3I8ZA 2R92G 4GKKL 1Q86C 3BG3A 2UUCL 2F3IA 3ERQA 3S24A 4P73A 3STBD 4OIJA 1Q7YC 1K8GA 1BCPB 4JI2Q 5E7NA 4KN7C 5D65A 4QUCA 3AFQA 2R92H 3PUVA 3S17B 4ULLA 1BBXC 1G51A 4B3TQ 3HP3A 1IXRA 4TQUS 4FF4A 1EFID 5IYBG 5JVG3 4YHHL 2K50A 3UI2A 3EFXD 4H0LC 3D31A 2A6ED 3MZ5A 2B39A 3IKJA 1V1OA 4GNXA 5E1FA 1YZ6A 4LF8L 1KNEA 1RL2A 2UXCQ 4O1NA 5IYBH 3NQIA 2MGSA 5KGUA 4R8NA 1FJGQ 4K2LA 2PI2A 2L1BA 3I4MG 1TVXA 2B2YA 5HY6A 1U5KA 5EGTA 4V0BA 2NWGA 1CA5A 2Q2UA 1YIJA 1TWGH 4RCNA 2Q8IB 3I4MH 4U68A 1E1OA 3D4WA 1S4ZA 4G7HC 1SJED 2K5VA 4H7BA 4M1UB 2IHEA 5IY0A 2BCOA 3K81C 4QJFA 3WOEA 2VY3A 3UE1A 1K8AC 3CPWA 4ODGA 1B7YB 4GN3B 2HHHQ 1E2VA 1AZQA 1FNWA 1BNZA 1KRTA 4QQBX 2M9VA 3Q8DA 1A0IA 5IWAL 3PGZA 5IGBA 4APVA 2F0JA 4AIMA 4IOCA 1ZEQX 1SFOB 5GQOA 4LAAA 2BA1A 2PQAA 1GVPA 1VF5C 2VQEL 4GZYC 5C4XG 1Q90A 3H09A 1SNQA 2KHSA 3CMEA 2UUAQ 2NVQH 3D0FA 5K5PA 2NVTH 1TWFB 1IBKQ 2Q2IA 3U50C 3MAQA 1LTBD 4YCUA 1MJCA 3M7NA 3L3OC
chains in the Genus database with same CATH topology
1I4QA 2WP8J 1D1KA 4K6LA 2K5DA 1CM9A 5ELCA 1B53A 3H94A 4X3KA 3GP7A 3T56B 4WFN3 3HS0C 4H13C 2Z4HA 1RJTA 4K8IA 5A2QE 1RDPD 4O42A 2NN6I 5ELEA 1CQVA 1B44D 3SK4A 2B2WC 3CHBD 2LFNA 4JBWA 3I73A 2IJ0A 4KKSA 3FPUB 3T4AC 1EYCA 4I7ZC 2K01A 3E6ZX 4A3BB 5I4DA 2SOBA 4CJ1B 5F2DA 2EY1A 4CKEA 1HXYD 1IYVA 4X3TA 2WKDA 1TU2B 5IGFA 3FPPA 3R2IA 2HDMA 3S2DB 1PRTF 1EYDA 2DN8A 1X3QA 4KTAA 1AZPA 1QOHA 2JEBI 1SDFA 2IPKD 2RKSA 5FO9B 1OXUA 3ND9A 1KLUD 4HMJA 1O78A 4OL7A 2OXPA 3OPOA 1PFBA 3GTKB 3HKZB 3V96A 2K05A 2IX3A 2ICEC 1ET6A 2F0QA 4A3GB 4N9PA 4FXGC 2O5IC 1ENCA 2M00A 1PZJD 4ZLTF 4C2MB 1K8MA 1L0XB 1E2WA 2FMCA 1A15A 1TS5A 1JR0D 4DAVA 3KLRA 1PTOF 3P20A 3V05A 1B2TA 1ILPA 3QG1A 1HUMA 4BBSB 2RDGA 1U4LA 3I4LA 5I6WA 1V8QA 3R8BA 4DAPA 3I91A 4XQJA 2CVRA 4J6HA 1Q12A 2A6HD 3NTIA 2F03A 1D5ZC 4HSVA 5ELBA 4LK1C 3I4MB 5C4HA 1BUVT 3KBXA 3H91A 3D4RA 2OT2A 3RZDB 2EOTA 1WTQA 3P75A 1DOLA 2EXZA 2K7VA 3A7AB 4NDXA 2PNRC 1H9KA 2KEEA 2ENBA 1SNOA 1V1PA 5BN5A 4FVMA 4L63B 2BA0A 2F3VA 4ZUJA 1DOKA 2QEJC 2NVQB 3TDQA 5CV6A 2F0HA 3QWNA 1C4QA 3BVGA 1RTNA 5C4XB 3PUZA 4ID6A 3M4OB 1CTMA 4M8AA 2ICIA 1NAPA 1GOZA 1U9RA 1H9RA 2YYZA 1Y8PB 4E6IA 4EGVA 4PQXA 4RH6A 2EDGA 4IZ8A 5KNDA 3NHHA 4Q0FA 1F9RA 3M85A 2NZ1D 1H9SA 2D2CC 3SE0A 4F87A 1STNA 1TKWB 2X6GA 1TS4A 5EBCA 4R8IA 1A6XA 2B8FA 3OMCA 3DXJC 5JOBA 2Z1CA 4BS9A 1JE4A 3VR6A 3HOUB 2EY6A 4KV6A 3J7YW 2L11A 4FP5D 5C4JB 3G6JB 1VMPA 3HEJA 2E2IB 3A55A 2LKVA 4CKBA 3F2UA 5D14A 1PRTD 4A3JB 3VYSA 3IAYA 3E5SA 3SR1A 2FINB 3QOJA 2MUYA 2F0IA 2G9DA 1EY5A 2O2LD 2X69A 1T5EA 2F0DA 1VF7A 4DNRB 2B2VA 3BVMA 4ZUIA 1MGSA 5C5MA 1U4MA 3QJYA 4S3SA 1FYCA 1JORA 3TBIB 1O7YA 3BZDB 1RF2D 2NB0A 3CQZB 3K5NA 1DXMA 3PUWA 2AWOA 3K5OA 1EY0A 2ID0A 3C2PA 2HUGA 1SMYC 1HFNA 1SYFA 3NK9A 1F9QA 1LTGD 5JVH3 2B2UA 3VYTA 1PTOD 3QOLA 4RCOA 2NVXB 3KUPA 2IL8A 1F77A 2JXMB 3VA7A 2EVBA 3K5LA 3R3OA 3BDCA 4HEDA 4J8QA 3S14B 5KRUA 1NR2A 4LJZC 1T5XD 2L12A 5C3XA 2AQ3B 1WVLA 1DONA 1EYAA 5C3WA 3D8GA 3TMEA 3AMUA 2I46A 1CQFA 5KIXA 2NBFA 5M5YB 2DY7A 1GHJA 1VCIA 4B9XA 4HR7B 2AWNA 3FVQA 1Q1BA 2AQ2B 3KK7A 3Q24A 1RKNA 5DAUA 2NUCA 4DA2A 4A3KB 3HZXA 2R61A 4FF3A 4YIJA 2A69D 2RDHA 2IX0A 4ZK9B 2QDBA 1LT6D 4U673 2F0VA 2NVYB 1RTOA 2B63B 3D6WA 2K6AA 4IUQA 1OXVA 3AU7A 4BWGB 2MP1A 3M4YA 1I4HA 3FMCA 5HURA 1TT2A 2EYLA 2DY8A 4PMBA 4XT3B 2H4OA 4K5VA 1GXDC 1SE3A 3MC0B 2L4NA 2I07B 3W3AA 3J7AF 1EZ6A 4K8JA 3TP7A 2F0GA 1EIGA 1SXTA 3K58A 1EOTA 3NE5B 4DN4M 1EY9A 3I3CA 1G6ZA 1B4OA 2A6EC 1B3AA 1RCVD 4BY7B 1K83B 5HGTA 2XVSA 4IUUA 3MA2B 2NTTA 5EPLA 1Y1WB 2FMMA 2EJMA 1HA5A 3HOVB 2JSOA 4MN3A 1FNUA 5IOCA 3GTJB 5KEEA 1CFMA 3MEHA 2RSOA 3AB9A 4BA2I 5FKAC 4RGNA 2F0UA 3N52A 4UDUC 5CYUA 1GJXA 1Y1VB 1HTLD 3HOXB 4J1MA 1QNUA 5G3LF 4DF7A 3CU7A 1PZID 4IFDG 1DM0B 3OWEB 2JE6I 1QJOA 3QO2A 1Q3LA 3LWUA 2PYKA 3JAME 4IFDH 2VNUD 3NBHA 2WB1B 1BO0A 2L5TA 1IKMA 4N9TA 2F0WA 2F1MA 4G7ZC 4XXEA 1O7ZA 3SK6A 3K57A 1IW7D 1SNMA 5CC4A 5CV9A 4ABNA 2Z4IA 2K5WA 2HQEA 2MHVA 2JA8B 1KLGD 4ZQ3A 1CHPD 3QIAA 2F0NA 4IALA 4K14A 1V43A 3ND8A 2PMZB 1BR9A 1MSHA 3DWAA 3T16A 4AYBB 2B2YC 4DNTB 2E75C 3PUXA 1WTWA 1X32A 3HOZB 2XIWA 1W6KA 1VDZA 2ZXRA 3T13A 3TP6A 1F2MA 4KJNA 2C5CA 2WAQB 5NUCA 4C1NK 2PQEA 4IQZA 2SNMA 1K8OA 1KDCA 1GUWA 1QE6A 2CHBD 3CRLC 3J80E 5CV5A 4I65A 1EY7A 5E4WC 1D5XC 3C3LA 2HCCA 4XQNA 3P1HA 5I2YA 3VYUA 1QNKA 1BDOA 3TN2A 3NWSA 3RD4A 1OXTA 3OOCA 4PV1C 5M3FB 1DD2A 1LABA 3R2TA 1F2LA 3TP8A 1O7LA 1Y8OB 4FF2A 1TR5A 4ZYSA 4CGYB 1ILQA 5LL6X 2EY5A 1WCMB 5EKLA 3JAML 4CJ2C 2ZT9C 2F0TA 3BVZA 1EWCA 2XWBB 4B9WA 3S1QB 2FHTA 2R3ZA 1JB3A 2CQAA 4MIUA 4F7XA 1PTOH 1E2ZA 2CW0D 1EQVA 1STYA 3HG9A 2A6HC 2B8GA 1LTTD 2V4DA 3Q22A 5C0XG 4KY7A 1E0BA 2XRSD 2B2TA 1UAPA 4RGOS 4IN3A 2BE5D 4XTCS 5G3LD 3NTHA 2E2JB 5C0XH 3M7GA 1LTSD 1I3QB 1A2TA 1I4GA 1PXUA 1UUPA 1STGA 1II3A 5JEAG 3GTMB 2NTSA 1F9SA 4IUVA 4BA1I 3LWEA 1CA6A 1TS2A 2R6GA 3K7AB 2Q8TA 4G7OC 4HN7A 1SYGA 2O4XA 5JEAH 1Z47A 3J80L 4X3SA 2Q8RE 2EY2A 3MTSA 1STAA 4KD3A 4MHEA 4ZAIA 1CT1D 1I4XA 5DNFA 1IL8A 3TSSA 4KK7A 3VA5A 1STBA 2IT1A 2JA7B 2PZTA 3FDTA 1LV9A 5CORA 4DK0A 4WJWA 5M5WB 2EYHA 4DAYA 2AUKA 1I50B 3IFTA 2X6LA 4XIGS 3VR2A 3H0GB 4C3HB 1PFNA 1NCVA 2PCFB 1NR4A 1Q1EA 5DM73 2BOSA 4XYQA 3MWYW 1MI2A 5KYIA 1ESFA 5CV4A 1Q8IA 4ME5A 2IW3A 3U9SA 3TZDA 1H9JA 1PRTC 4IUPA 5KNCA 1HTPA 3FKIB 3DWQA 1B9NA 4QMGA 4XT1B 4IFDI 1CZWA 4ZKCB 3I4NB 1PRTB 2L55A 2Y0SB 2KQ3A 1V1PB 2J7ZA 3BYYB 1EL0A 3GTPB 3KLSA 2A68D 2GA4B 4UAIA 2F0PA 3H3VC 2EYFA 3NP8A 2SNSA 4IUNA 1PMRA 3SDZA 1I6VC 1KNAA 2WIIB 3NXWA 2XN9C 5C4ZA 2EYJA 3H6MA 1TS3A 3C1FA 5COYA 4L6TB 1QG7A 3NSWA 4QF4A 3X3NA 1PDQA 3WOFA 1ML0D 4TSSA 5JPMC 1PTOC 1XTCD 4C3IG 1GUOA 3MXGA 1S5CD 4PNYA 3M3YB 3U9OA 2HDLA 1H9SB 5JAVA 3RMHA 2O5JC 1PTOB 4JK1C 3X3MA 4BY1B 2KJXA 3MXPA 3VYRA 4RGTA 4WRDA 4KY5A 1A3UA 1B9MA 1CZGA 1Z7TA 2PZUA 4A93B 2KEDA 3TP5A 2N55A 4FYDA 1WTVA 3PO3B 4EQOA 3GQBA 2RQXA 1FR3A 1U4PA 1ZKOA 2B2VC 2KUMA 3K59A 3URYA 3CRKC 1S5BD 2F0OA 2E2DC 1KAAA 1BCPF 1O80A 1AW7A 2D5DA 2A69C 1OO9B 2K33A 1EEFD 2PO4A 2D62A 5I6YA 2WV6D 2B2UC 3PUYA 2PPBC 4RFBA 4F8MA 3K0YA 5IGEA 1JOOA 1JWUD 3TZUA 1YNND 2J4XA 3T51B 1JICA 2IWHA 4F88A 5I9OA 3ITPA 3MVVA 1C48A 5EPJA 1ESRA 2RA4A 5FO7B 1EZ8A 4TKOB 2VB2X 1SNCA 3NQTA 5C0XJ 3EROA 1LT5D 3QB3A 1EU3A 5C0XI 4KKTA 3N6RA 1A3VA 3HRZC 4XYOA 4P2CB 3O13A 1ZYRD 3DMUA 1RODA 1S5ED 2XRQD 5LHY1 1G291 1FNVA 4FF1A 2K03A 1BF4A 4FO2A 2WINB 5EPKA 1YNJD 4QCLA 3OWFA 2JA6B 2F0EA 3DHQA 1WTOA 1QB5D 4QB4A 2VUMB 2LY7A 2EYPA 3OHXC 1XYIA 1GUGA 1GUNA 5CGKA 1LTID 5DEHA 2HCIA 2XNAC 5E4XA 4NMZA 2A5HA 4RAUC 1EU4A 2ZXPA 4KKUA 5IODA 2VXWA 2EPBA 4OIKA 1C8CA 1BXTA 3MHBA 3Q6SA 3FEWX 1U4RA 3EVQA 4LMQD 1R9TB 1I4RA 1IW7C 2KCCA 4G57A 1M4VA 4C3IB 3DUZA 5LL6S 2KCNA 2BDOA 1B50A 1PZKD 4A3MB 3NWTA 3SEBA 3PMFA 1LLRD 2JYOA 5A35A 2VB3X 3BS1A 1PFMA 2E74C 1L0YB 1WD0A 1FGBD 5I2XA 4RA8A 1WD1A 4K5WA 1I6HB 1ICWA 2SDFA 1IKLA 3KLSX 1A3TA 5M3MB 1BCPD 1MSGA 4G4KA 2A73B 2F3WA 4KHZA 2MJ8A 1I4PA 1KTKA 1HQRD 4KHVA 2F0FA 1WTXA 3HGBA 1SAPA 1EEID 4C3HG 3A8JE 1ONLA 3I70A 2FJ2A 1SYEA 4V190 1ET9A 5IGGA 1D1IA 2K28A 2AUJD 2K1BA 3S2HB 4FXDA 1RD9D 5CV8A 1HFGA 3K6OA 5JJZA 3DWPA 1F2ZA 3OSOA 1EIHA 1TWHB 2L0CA 2Z8LA 4KY6A 2B2WA 1B1ZA 1LTRD 1DZ1A 2JEAI 2K04A 3OMGA 3GTOB 4NW2A 3GTGB 1IYUA 3GV3A 3VR5A 2OEOA 2QILA 4DFAA 1EY6A 2CW0C 1SYDA 2EYMA 2DNEA 1DJRD 3C46A 1D5MC 2KOLA 1UEAB 3DM1A 3LX0A 4ILWA 5C44B 2BDNA 4WORA 2BE5C 4NP5A 1EWHA 5EKIA 1G2SA 4B08A 4XDXA 3G7LA 1CI3M 4X3UA 5M5XB 5FOBB 1JWSD 2LMCB 3SK5A 3GD7A 2EJGC 4ZRZA 4CKCA 4EQPA 5ELDA 1M8AA 1JQYD 1SEBD 1FD7D 4XQQA 5E3FA 1G8ZD 3PIP3 5DM63 1Y8NB 1LTAD 2F0LA 4DXGA 5ELFA 4RHRA 3SXHA 2TMPA 3BDLA 4OGQC 2RBMA 1JC7A 4EVOA 5T1IA 4CHTB 3S15B 2ZXOA 1ZXTA 4HSPA 2FFKB 4OHJA 1KDAA 3D3RA 2QKIC 1HA6A 1TWAB 2D9UA 2R7ZB 1NSNS 2K5QA 1UNSA 2QF7A 3SVMA 1ENAA 2R92B 1S5DD 1HQMC 2J0TD 4HCEA 2EYOA 3LNNA 1H9MA 1QCBD 4PMWA 3E0JA 2QCPX 2DNCA 2K32A 3VR3A 3PIO3 3Q23A 4L8JA 2G9HD 2B2TC 3KF8A 1LT4D 3ONAB 4OO1G 2F4IA 1PLFA 3A8KE 3I72A 5C5LA 2TSSA 3MXNA 3A56A 1XWEA 1TWGB 3Q0AA 1QILA 4C3JG 4OO1H 5BN3A 1AP0A 1X3PA 5A2QL 5C3EB 3VR4A 2H1EA 2RSNA 3ZYYX 3NPPA 1XX8A 1TY2A 4TRDA 3GTQB 3RUZA 2A68C 2RDFA 3EA6A 2XSCA 4PMCA 1CK1A 4Y7NB 1KDBA 1D2BA 2JA5B 5EBDA 5CMDA 1KABA 4Z9CB 4A3EB 3DEOA 1S5FD 2RVLA 3NTKA 5CR3A 2JP1A 1IHZA 1DYQA 2NVTB 3GV6A 3GO5A 5IGCA 4BBRB 5IGDA 4IFDJ 3WDNA 4RKBA 5D3IB 5CV7A 3RZOB 4IUTA 4K6DA 5T1GA 5J1ZA 3S1MB 4QIWB 5EQ0A 1BOSA 5JPNC 4KI0A 3MXUA 2WACA 5FLXE 2M2LA 1SYCA 2EJFC 1OXSC 4KJOA 1NUCA 4KN4C 5D3DA 4A3IB 5K36G 1JOQA 3L7ZC 5EKKA 2LS01 1LACA 1SE4A 4A3FB 4FXKC 1JWMD 5J39A 3D6CA 5K36H 5CBEE 1STEA 5KNBA 2PW5A 3S1NB 1TY0A 2PW7A 2NYZD 3S16B 5KYLA 2R93B 4RWSC 2F0SA 2OF1A 3RLFA 3BDOA 2AQ1B 4KMUC 1Y69U 2EE1A 5FO8B 1SSOA 3HOWB 4RGMA 1WTRA 1EY8A 1ENFA 5IIFA 2KA7A 4DXFA 5TSSA 4EQNA 2EZVA 3A8IE 3NBIA 4CBVA 3S9WA 3IL8A 1TIID 4HMIA 4DU9A 1SE2A 2F0MA 1PYWD 3OW7A 2NN6G 1GHKA 2F0KA 1W6JA 4DGZA 1A2UA 2E76C 4DK1A 5BN4A 1HUNA 1YNNC 1F9PA 1TQOA 5J22A 1LO5D 3J81E 1GUSA 1LT3D 2NN6H 1R4PB 1BQQT 2N88A 1HHVA 3J7AV 5IT9E 5EJWA 1DOMA 5I9PA 1F2YA 3DEPA 4NKLA 4IURA 3HOYB 3FRPB 1SBBB 3OIPA 2E2HB 3EJIA 1ZYRC 4A3DB 1DCZA 2L9HA 1TWCB 5C6AA 3A7LA 3D4DA 3V2TA 1WTPA 3IFDA 4HTHA 1YNJC 1SMYD 1GUTA 3R93A 5FLXL 1EY4A 4C56C 4C3JB 1J8IA 2XWJB 3PV0A 3W2DA 4H44C 4Q5VA 1VMCA 1OXXK 1SNPA 1QWYA 1J9OA 3C1EA 1JCKB 2WKCA 4HAEA 3PO2B 1AEXA 3A54A 4CJ0B 2PZWA 3S1RB 4RHSA 4ZKBB 5M9OA 1HCZA 5JEAJ 3K5MA 2MPMA 5AFWA 2KECA 4KD4A 2SEBD 1CHQD 4QUFA 1D6EC 5ISRA 1MBYA 3MFGA 1SNDA 4K5XA 4HCSA 1XXGA 1AN8A 2YU9B 1HPCA 3CKIB 3OIQA 2A74C 4C1NI 4K2KA 3GTLB 3NUCA 5CBAE 1G2TA 3BYTB 1Z6HA 5FK9C 3MFYA 2IX1A 3SK8A 1RHPA 3T53B 4OO1I 1AFPA 3J81L 1STHA 3KBGA 1SJHD 1JOKA 4R9WA 3SHLA 1HRJA 1EQTA 4RKLA 5IT9L 3L9AX 3EQLC 2KVMA 1BCPC 1SYBA 1G91A 1MD2D 2C9OA 4FNFA 1R4QB 3I90A 3P7JA 3I8ZA 3BG3A 3ERQA 4OIJA 1BCPB 4KN7C 5D65A 4QUCA 3PUVA 3S17B 4ULLA 1BBXC 3HP3A 4TQUS 4FF4A 1EFID 5JVG3 3UI2A 3EFXD 4H0LC 3D31A 2A6ED 3MZ5A 2B39A 3IKJA 1V1OA 5E1FA 1KNEA 4O1NA 3NQIA 2MGSA 5KGUA 4R8NA 4K2LA 2L1BA 1TVXA 2B2YA 5EGTA 4V0BA 2NWGA 1CA5A 4RCNA 2Q8IB 4U68A 4G7HC 3D4WA 1S4ZA 1SJED 4H7BA 4M1UB 2BCOA 3WOEA 4ODGA 1E2VA 1AZQA 1FNWA 1BNZA 2M9VA 5IGBA 2F0JA 1ZEQX 1SFOB 4LAAA 2BA1A 1VF5C 4GZYC 1Q90A 3H09A 1SNQA 2KHSA 5K5PA 1TWFB 3MAQA 1LTBD 3M7NA 3L3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOT A;  3DM1 A;  3I90 A;  1NCV A;  4DN4 M;  1ROD A;  4ZLT F;  1J8I A;  1F9R A;  3I8Z A;  3P7J A;  2NZ1 D;  4HED A;  1CM9 A;  5CBE E;  1NR4 A;  1MSH A;  1ICW A;  1B53 A;  4X3K A;  2B2Y C;  3I3C A;  2BDN A;  1G6Z A;  2SDF A;  1B4O A;  4OIJ A;  2K03 A;  1IKL A;  3MWY W;  1A15 A;  1MI2 A;  1BF4 A;  1VMC A;  1NR2 A;  2KED A;  5EPK A;  2NYZ D;  1X3P A;  2L12 A;  2X6G A;  1AP0 A;  1J9O A;  1WTW A;  5D65 A;  5EKI A;  1G2S A;  1MSG A;  4QUC A;  4R8I A;  1WVL A;  1B3A A;  4XDX A;  1B2T A;  1DON A;  2H1E A;  1ILP A;  1X32 A;  1RJT A;  2RSN A;  3G7L A;  1WTO A;  2N55 A;  2XIW A;  1BBX C;  4RWS C;  1HUM A;  1WTV A;  4IUU A;  2MJ8 A;  1XYI A;  3HP3 A;  1U4L A;  1XX8 A;  3TZD A;  4X3U A;  4HAE A;  4O42 A;  1E0B A;  5EPL A;  1U4P A;  4IUP A;  2B2T A;  2B2V C;  2FMM A;  1JE4 A;  2DY7 A;  2KUM A;  3I91 A;  2EE1 A;  2CVR A;  3UI2 A;  1WTX A;  1SAP A;  4CJ0 B;  4MN3 A;  1M8A A;  1SSO A;  2HCI A;  2L11 A;  4XT1 B;  5E4X A;  1WTR A;  1VMP A;  2RSO A;  4HSV A;  4RAU C;  1KNE A;  4ZKB B;  4ZKC B;  2B2W C;  2FJ2 A;  2MGS A;  1GUW A;  1O80 A;  1QE6 A;  2L1B A;  3F2U A;  1TVX A;  5D14 A;  2J7Z A;  3KBX A;  3N52 A;  2B2Y A;  1F9S A;  5CMD A;  2MPM A;  4IUV A;  2KEC A;  3H91 A;  5AFW A;  3DEO A;  3FPU B;  5T1I A;  1EL0 A;  2K28 A;  2EOT A;  2FIN B;  3LWE A;  1ZXT A;  2K01 A;  2RVL A;  4QUF A;  1CA6 A;  2FFK B;  2NWG A;  3IL8 A;  1WTQ A;  2K1B A;  1CA5 A;  2JP1 A;  2Q8T A;  2VXW A;  4CJ1 B;  2EPB A;  1DOL A;  3GV6 A;  4OIK A;  4UAI A;  5E4W C;  2X69 A;  1C8C A;  4U68 A;  3Q6S A;  1HA6 A;  1HUN A;  1S4Z A;  4X3T A;  1F9P A;  1KNA A;  1U4R A;  4HCS A;  2HCC A;  2B2U C;  1HFG A;  2KEE A;  2D9U A;  4X3S A;  1QNK A;  5JJZ A;  2B2V A;  2Q8R E;  3MTS A;  2HDM A;  3QO2 A;  3TN2 A;  1EIH A;  1MGS A;  4LMQ D;  1U4M A;  4ZK9 B;  1Q3L A;  4IUT A;  1X3Q A;  5T1G A;  1G2T A;  5CBA E;  1O7Y A;  1RTO A;  3D6W A;  1AZP A;  4MHE A;  1SDF A;  2B2W A;  2N88 A;  5EQ0 A;  4ZAI A;  1HHV A;  4IUQ A;  3SVM A;  1DOK A;  1AZQ A;  5COY A;  1F2L A;  1BNZ A;  5EJW A;  1JIC A;  1QG7 A;  1RHP A;  1DZ1 A;  1PDQ A;  2MP1 A;  5DNF A;  1BO0 A;  1ML0 D;  1IKM A;  1DOM A;  1IL8 A;  2K04 A;  1B50 A;  2DY8 A;  3DEP A;  1ILQ A;  1O7Z A;  4XT3 B;  1PFB A;  4IUR A;  4NW2 A;  2M2L A;  2HUG A;  1LV9 A;  3FDT A;  5COR A;  4R9W A;  1RTN A;  1HFN A;  1HRJ A;  3GV3 A;  4CJ2 C;  5EPJ A;  2HDL A;  1ESR A;  2L4N A;  2RA4 A;  1F9Q A;  2JYO A;  1EQT A;  2K05 A;  3R93 A;  2L9H A;  2B2U A;  1G91 A;  1NAP A;  2B2T C;  1PFM A;  2FHT A;  3ONA B;  2X6L A;  1PLF A;  1WTP A;  3IFD A;  1WD0 A;  2R3Z A;  2KVM A;  3KUP A;  2KOL A;  1EIG A;  2IL8 A;  4RA8 A;  1PFN A;  1WD1 A; 
#chains in the Genus database with same CATH topology
 1I4Q A;  5C4X H;  4GLA C;  2KCT A;  2WP8 J;  3M4O H;  1D1K A;  4K6L A;  2K5D A;  1CM9 A;  5ELC A;  5ELO A;  1B53 A;  3H94 A;  4X3K A;  1XJV A;  3GP7 A;  3T56 B;  4WFN 3;  2DGY A;  3HS0 C;  4H13 C;  2Z4H A;  1RJT A;  4K8I A;  2ZM6 Q;  4DV4 L;  1Q8K A;  5LMU L;  5A2Q E;  1PH9 A;  1RDP D;  2B29 A;  4O0A A;  4O42 A;  1TXY A;  4A76 A;  4NXN Q;  2NN6 I;  2VS1 A;  5ELE A;  1GM5 A;  1CQV A;  4A3F G;  4B3R Q;  1B44 D;  3SK4 A;  2Z6K C;  3CD6 A;  2MFI A;  2B2W C;  3TRZ A;  3CHB D;  2LFN A;  2ZJR A;  4JBW A;  4IPG A;  3I73 A;  2IJ0 A;  2RCF A;  4X66 L;  3J81 j;  3CP0 A;  4KKS A;  4A3F H;  2JK8 A;  3FPU B;  3HOU H;  3T4A C;  4OWW B;  1EYC A;  4I7Z C;  2K01 A;  4A3J G;  3E6Z X;  4IO9 A;  3TQY A;  2SOB A;  1AE2 A;  1MHW C;  5I4D A;  4CJ1 B;  4A3B B;  4DR6 L;  2R93 G;  1JJG A;  5F2D A;  5C4J H;  2EY1 A;  4CKE A;  1HXY D;  1IYV A;  4X3T A;  2E2I H;  3S16 H;  2WKD A;  1TU2 B;  5IGF A;  1HH2 P;  3FPP A;  3F2C A;  4A3J H;  3R2I A;  4JI4 Q;  2HDM A;  1HR0 Q;  3S2D B;  1PRT F;  1EYD A;  2DN8 A;  2E5L Q;  1X3Q A;  1EFW A;  4KTA A;  1S40 A;  1AZP A;  2A8V A;  1QOH A;  2JEB I;  1SDF A;  2IPK D;  2RKS A;  5FO9 B;  1OXU A;  3ND9 A;  1YBY A;  1PHJ A;  1YIT A;  1KLU D;  4HMJ A;  1O78 A;  2LSS A;  4OL7 A;  1UWV A;  2OXP A;  3CCR A;  3OPO A;  2UUB Q;  1PFB A;  4JCV E;  3GTK B;  3HKZ B;  3V96 A;  3RN5 A;  2K05 A;  1VQH A;  1X65 A;  2IX3 A;  1PYB A;  3CQZ H;  4JOI A;  2ICE C;  1ET6 A;  4DR2 Q;  1Q46 A;  2QGQ A;  4YWM A;  1PH4 A;  1VS0 A;  2F0Q A;  4A3G B;  4MNO A;  4N9P A;  4FXG C;  2O5I C;  1ENC A;  2M00 A;  1PZJ D;  4ZLT F;  4C2M B;  1K8M A;  1L0X B;  2E8G A;  1E2W A;  2FMC A;  1UE5 A;  1JB7 A;  1A15 A;  1TS5 A;  5GAH C;  1JR0 D;  1IBM L;  4DAV A;  1XNQ Q;  3KLR A;  1PTO F;  3P20 A;  3TRE A;  3V05 A;  1B2T A;  1ILP A;  3QG1 A;  2VQF Q;  4A3D G;  1HUM A;  4BBS B;  2RDG A;  2Y0S E;  1U4L A;  3I4L A;  5I6W A;  1V8Q A;  2QEX A;  3R8B A;  4DAP A;  4ZCK A;  1U0L A;  3S14 H;  2UUC Q;  3I91 A;  4XQJ A;  2CVR A;  4J6H A;  1ASY A;  1L0W A;  1Q12 A;  3VDY A;  2A6H D;  3NEL A;  3NTI A;  2F03 A;  1D5Z C;  4HSV A;  5ELB A;  4LK1 C;  3I4M B;  2I5H A;  1JJC B;  5C4H A;  1BUV T;  3KBX A;  4DV1 L;  3H91 A;  5M5Y H;  3D4R A;  2OT2 A;  1EOV A;  3RZD B;  4L5R C;  1M1K C;  2EOT A;  1WTQ A;  3P75 A;  4OEL B;  1DOL A;  4DNI A;  1YHA A;  2EXZ A;  3UDF A;  2K7V A;  3A7A B;  4NDX A;  3PO2 G;  2PNR C;  5AJ3 Q;  1H9K A;  2KEE A;  1W2B A;  2ENB A;  1PV4 A;  1SNO A;  1V1P A;  4LFA L;  5BN5 A;  4FVM A;  1Q81 C;  3K8A A;  4L63 B;  2BA0 A;  4NXM Q;  4JI6 Q;  3PO2 H;  2F3V A;  2RHS B;  4ZUJ A;  1DOK A;  2QEJ C;  4O2D A;  2B63 G;  3KF8 B;  1N8R C;  2NVQ B;  1MIU A;  3AEV A;  3TDQ A;  5CV6 A;  2F0H A;  3KDF B;  4BXX G;  2BH8 A;  3QWN A;  1GO3 E;  1I94 Q;  3MXN B;  1C4Q A;  1SMX A;  3BVG A;  2NVY H;  2B63 H;  1RTN A;  5C4X B;  3PUZ A;  1O7I A;  4ID6 A;  1HNZ L;  3M4O B;  1CTM A;  4M8A A;  4BXX H;  2ICI A;  2RF4 A;  1NAP A;  1GOZ A;  1U9R A;  1H9R A;  2YYZ A;  1Y8P B;  4E6I A;  4UHV A;  4EGV A;  4PQX A;  4RH6 A;  4DV5 Q;  2EDG A;  1XMO L;  4IZ8 A;  5KND A;  3NHH A;  2VQE Q;  4Q0F A;  1F9R A;  3M85 A;  2NZ1 D;  3GTL H;  1H9S A;  2D2C C;  2JQO A;  1PH8 A;  2DUD A;  3SE0 A;  4F87 A;  1STN A;  1TKW B;  2X6G A;  3UE0 A;  1TS4 A;  5EBC A;  4R8I A;  1A6X A;  2B8F A;  3OMC A;  3DXJ C;  5JOB A;  3B6Y A;  4BY7 G;  2Z1C A;  4BS9 A;  1L1O C;  3OW2 A;  4JBK A;  1JE4 A;  1NMG A;  3VR6 A;  3HOU B;  2EY6 A;  4KV6 A;  1Y1W G;  2JN4 A;  2L11 A;  3J7Y W;  4LF5 Q;  4FP5 D;  3HFZ B;  4DR3 Q;  1K73 C;  5C4J B;  3G6J B;  1VMP A;  4HJ8 A;  4BY7 H;  3HEJ A;  1L1O B;  2E2I B;  3A55 A;  2LKV A;  4CKB A;  3F2U A;  5D14 A;  1PRT D;  4JC0 A;  4A3J B;  1Y1W H;  3RR5 A;  3VYS A;  3E5S A;  3SR1 A;  3IAY A;  2ZTD A;  2FIN B;  2QA4 A;  3QOJ A;  3GTJ H;  2MUY A;  3QR8 A;  2F0I A;  2G9D A;  1EY5 A;  2O2L D;  3CF5 A;  1Y1V G;  2X69 A;  1T5E A;  2F0D A;  1VF7 A;  4DNR B;  2B2V A;  3BVM A;  4ZUI A;  4DAM A;  1J5E L;  3ER0 A;  1MGS A;  5C5M A;  1U4M A;  3S17 H;  3QJY A;  4S3S A;  1X6O A;  4JV5 Q;  1FYC A;  1Y1V H;  1JOR A;  3TBI B;  1O7Y A;  4HIK A;  3BZD B;  1K0S A;  1X3G A;  4YWL A;  3PIO A;  4CDC C;  1RF2 D;  2NB0 A;  1SE8 A;  3CQZ B;  3K5N A;  4KHP Q;  1DXM A;  3PUW A;  4R4C A;  2AWO A;  3K5O A;  4OON A;  1EY0 A;  2ID0 A;  3C2P A;  2HUG A;  1SMY C;  1X9N A;  1HR0 W;  1HFN A;  1SYF A;  3CPF A;  4DUY L;  3NK9 A;  1F9Q A;  1LTG D;  5JVH 3;  2FXQ A;  3CC7 A;  2B2U A;  3VYT A;  1PTO D;  3QOL A;  1DGS A;  2Q2H A;  4LF9 L;  4RCO A;  4GLV B;  2NVX B;  4L5Q A;  3KUP A;  3TEH B;  2IL8 A;  2NZH A;  1F77 A;  2JXM B;  3VA7 A;  2EVB A;  3K5L A;  3CW2 C;  3R3O A;  1EYG A;  3BDC A;  4HED A;  4J8Q A;  4UP9 A;  3S14 B;  2JA8 H;  5KRU A;  1HZ9 A;  1KXL A;  1NR2 A;  2YTX A;  4LJZ C;  4DV0 L;  1T5X D;  1YI2 A;  2L12 A;  5C3X A;  3ICE A;  2AQ3 B;  1N33 L;  1WVL A;  1DON A;  1EYA A;  5C3W A;  3U4Z A;  3D8G A;  3TME A;  3AMU A;  2I46 A;  1CQF A;  5KIX A;  1JMC A;  2NBF A;  5M5Y B;  2DY7 A;  1GHJ A;  1VCI A;  4JI0 L;  4B9X A;  2HQL A;  1IBM Q;  1H95 A;  4HR7 B;  4UP7 A;  2AWN A;  2WAQ G;  3FVQ A;  1Q1B A;  2AQ2 B;  3KK7 A;  1XTD A;  1TWF H;  3Q24 A;  4B3M L;  1RKN A;  5DAU A;  1HNW Q;  2NUC A;  4DA2 A;  4X65 L;  2UXB L;  4A3K B;  3M4P A;  3FP9 A;  2K14 A;  4KLK A;  1YEZ A;  1V9P A;  3HZX A;  2R61 A;  1C7Y A;  4FF3 A;  4YIJ A;  2A69 D;  2RDH A;  1EIF A;  2IX0 A;  4ZK9 B;  1Q82 C;  2QDB A;  1LT6 D;  4U67 3;  2F0V A;  4JVZ A;  1EQQ A;  4LF4 L;  2BH2 A;  2NVY B;  1RTO A;  2B63 B;  3D6W A;  3K7U C;  2K6A A;  4IUQ A;  1OXV A;  4DR5 L;  4JI3 Q;  3AU7 A;  1VQI A;  4BWG B;  5M3F G;  4R4T A;  3ULL A;  2MP1 A;  3L2P A;  3KLW A;  3M4Y A;  1I4H A;  3FMC A;  5HUR A;  1TT2 A;  2EYL A;  2WFW A;  2DY8 A;  2H5X A;  4PMB A;  4XT3 B;  2K75 A;  2H4O A;  4K5V A;  1GXD C;  1SE3 A;  1NTG A;  5M3F H;  3MC0 B;  5IP7 G;  3ZJY C;  3JAM c;  4A3L G;  2L4N A;  4B3S Q;  2I07 B;  2G5D A;  2ATW A;  2A19 A;  3W3A A;  3J7A F;  1EZ6 A;  3STB C;  2CH4 W;  4K8J A;  4OWX B;  5IP7 H;  3TP7 A;  2F0G A;  1EIG A;  4LFB L;  1SXT A;  1WCM H;  3K58 A;  1M90 C;  1EOT A;  3JAM i;  3NE5 B;  4X62 L;  4DN4 M;  3S2D H;  4DV7 L;  1EY9 A;  3I3C A;  1G6Z A;  1B4O A;  2Z0S A;  3S1Q H;  2ES2 A;  1IBL Q;  2A6E C;  3HKZ G;  1K9M C;  1B3A A;  1RCV D;  3ULJ A;  3W5O A;  4BY7 B;  1K83 B;  5HGT A;  2XVS A;  4N8X 1;  4IUU A;  3MA2 B;  2NTT A;  1G6P A;  1P8L A;  5EPL A;  1Y1W B;  2FMM A;  4DR4 L;  4JW0 A;  4LFC Q;  3A0J A;  2EJM A;  1HA5 A;  1QVG A;  3HOV B;  2JSO A;  4MN3 A;  1FNU A;  5IOC A;  3GTJ B;  1IL2 A;  1B70 B;  4A3G G;  3K80 C;  5KEE A;  1CFM A;  3MEH A;  2RSO A;  3AB9 A;  4BA2 I;  5FKA C;  1BKB A;  4RGN A;  4RMF A;  5JJI A;  2F0U A;  3UDG A;  3N52 A;  4UDU C;  1P16 A;  5CYU A;  3CCU A;  4A3G H;  2EIF A;  1GJX A;  1Y1V B;  4C2M H;  1HTL D;  3HOX B;  4J1M A;  4X64 L;  2E2J H;  1QNU A;  4BBS G;  5G3L F;  1LUZ A;  5FJ8 G;  4DF7 A;  3CU7 A;  1PZI D;  4IFD G;  2XGT A;  4YY3 L;  1DM0 B;  1BBW A;  3OWE B;  1LTL A;  3J80 c;  3GTM H;  4GKJ Q;  3J7A 5;  2JE6 I;  1QJO A;  3QO2 A;  3AQQ A;  1Q3L A;  1SRU A;  4BBS H;  3LWU A;  5FJ8 H;  2PYK A;  3JAM E;  3CXC A;  4IFD H;  2UXD L;  2VNU D;  1XMQ L;  3NBH A;  2WB1 B;  3J80 i;  1BO0 A;  2L5T A;  5ELN A;  4JI1 L;  1IKM A;  4N9T A;  2F0W A;  2F1M A;  4G7Z C;  1VQJ A;  4XXE A;  1O7Z A;  3SK6 A;  3K57 A;  1IW7 D;  3CMA A;  1SNM A;  5CC4 A;  1XNR L;  5CV9 A;  4ABN A;  3PF5 A;  2Z4I A;  2K5W A;  3RZD H;  2HQE A;  1JT8 A;  2MHV A;  2JA8 B;  1KLG D;  4ZQ3 A;  1CHP D;  4NB3 A;  1N32 Q;  3QIA A;  4DV6 Q;  4GNX C;  2JA7 H;  1QUQ A;  2F0N A;  4IAL A;  4K14 A;  4OX9 L;  4A75 A;  1V43 A;  1QVC A;  3H0G G;  5M5W H;  4DUY Q;  3ND8 A;  4HIO A;  2PMZ B;  1BR9 A;  3DM3 A;  3UDX A;  1MSH A;  3DWA A;  3T16 A;  1KQS A;  4AYB B;  2B2Y C;  3LGJ A;  4DNT B;  2E75 C;  4GNX B;  1I50 H;  3PUX A;  1WTW A;  2ASB A;  4JI7 Q;  3H0G H;  3TS0 A;  4C3H H;  1X32 A;  3HOZ B;  1D8L A;  2XIW A;  1W6K A;  1VDZ A;  1EWI A;  2ZXR A;  3T13 A;  2V1C C;  1UEB A;  3TP6 A;  1PH7 A;  1F2M A;  4KJN A;  4UP8 A;  5GAD C;  2C5C A;  5LMN L;  2WAQ B;  5NUC A;  4C1N K;  2PQE A;  4IQZ A;  3FKI G;  1NJI C;  2SNM A;  4JYA L;  1K8O A;  1KDC A;  3KF6 A;  1GUW A;  1QE6 A;  2CHB D;  2KHJ A;  3CRL C;  3J80 E;  5CV5 A;  4I65 A;  4DV3 Q;  3FKI H;  4LF7 L;  4DR7 L;  1EY7 A;  3RNU A;  5E4W C;  1VQ7 A;  1D5X C;  3C3L A;  1FL0 A;  5IYD G;  2HCC A;  4B3M Q;  4XQN A;  1N36 L;  3P1H A;  5I2Y A;  3VYU A;  1QNK A;  3HOU G;  1BDO A;  3TN2 A;  3NWS A;  4R4O A;  3GTP H;  3RD4 A;  2OQ0 A;  2PQA B;  1OXT A;  3OOC A;  2QW7 A;  4PV1 C;  1EIY B;  5M3F B;  2JA9 A;  4JBJ A;  5IYD H;  1DD2 A;  1LAB A;  3R2T A;  1F2L A;  3TP8 A;  1O7L A;  1Y8O B;  4FF2 A;  1TR5 A;  4ZYS A;  1YJN A;  4CGY B;  1KC8 C;  1ILQ A;  5LL6 X;  3H3V H;  1VQA A;  2EY5 A;  4DUZ L;  1WJJ A;  4PZ7 A;  1WCM B;  5EKL A;  3JAM L;  4CJ2 C;  3OTO L;  4DR1 L;  2ZT9 C;  3KF6 B;  4R4Q A;  2F0T A;  3BVZ A;  3G48 A;  1EWC A;  1KAW A;  2XWB B;  4OEM B;  4K0K L;  4B9W A;  3S1Q B;  2FHT A;  4BY1 G;  4JI8 Q;  4N8F A;  2R3Z A;  4DV2 L;  1EQR A;  2F4V Q;  3M3Y H;  1KIX A;  1JB3 A;  2RHQ B;  2CQA A;  4MIU A;  4F7X A;  1PTO H;  4BY1 H;  1VQC A;  1E2Z A;  2CW0 D;  3I55 A;  2N49 A;  1EQV A;  1STY A;  3HG9 A;  2A6H C;  2B8G A;  1WTH A;  3HKS A;  4LFB Q;  4LUZ A;  1LTT D;  2V4D A;  3Q22 A;  4GOP A;  5C0X G;  5GRO A;  4KY7 A;  1VQP A;  4LUV A;  1E0B A;  2XRS D;  4DV7 Q;  1NE3 A;  1UAP A;  2B2T A;  4RGO S;  4IN3 A;  2BE5 D;  4XTC S;  3CC4 A;  5G3L D;  3NTH A;  2E2J B;  5C0X H;  3M7G A;  1LTS D;  3ERS X;  4IJL A;  1I3Q B;  1A2T A;  1I4G A;  1PXU A;  1N34 L;  4NPS A;  1UUP A;  2VZA A;  1STG A;  2UU9 Q;  1II3 A;  5JEA G;  3GTM B;  2NTS A;  4AQY Q;  1F9S A;  2NVX H;  4IUV A;  5J3B A;  4BA1 I;  3LWE A;  4MTN A;  2R7D A;  1CA6 A;  1TS2 A;  2R6G A;  3K7A B;  4QIW E;  2Q8T A;  4G7O C;  4JI5 Q;  1SR3 A;  4GKK Q;  4HN7 A;  1SYG A;  2O4X A;  5FLM G;  5JEA H;  4IOA A;  1Z47 A;  2K52 A;  3J80 L;  4JOI C;  4X3S A;  2Q8R E;  2EY2 A;  3MTS A;  1STA A;  1T9H A;  2OQK A;  5FLM H;  2LXK A;  4KD3 A;  4MHE A;  4ZAI A;  4HJ9 A;  4YHH Q;  1CT1 D;  1I4X A;  4ME3 A;  5DNF A;  2I0Q A;  5FLX c;  1IL8 A;  3TSS A;  4KK7 A;  4A3K G;  2ZJQ A;  3VA5 A;  1STB A;  4LF8 Q;  1L2F A;  2IT1 A;  3KFU A;  2JA7 B;  3CCV A;  2PZT A;  3FDT A;  1LV9 A;  5COR A;  4DK0 A;  1NNX A;  2LXJ A;  4WJW A;  5M5W B;  2OTL A;  2EYH A;  2N8N A;  3T1H L;  4A3K H;  1V1Q A;  4DAY A;  2AUK A;  2RCN A;  1XMQ Q;  1QVF A;  1WYD A;  1X55 A;  1I50 B;  3IFT A;  2X6L A;  4XIG S;  3VR2 A;  3H0G B;  4C3H B;  1PFN A;  1RIP A;  1XNR Q;  1NCV A;  2PCF B;  1J6Q A;  1UE6 A;  1NR4 A;  1Q1E A;  5DM7 3;  2BOS A;  4XYQ A;  3MWY W;  1MI2 A;  5KYI A;  1ESF A;  1ICF B;  1PA6 A;  5CV4 A;  1Q8I A;  4ME5 A;  4R1J A;  4AH6 A;  4TVA B;  2IW3 A;  5IWA Q;  3U9S A;  1E3P A;  1K28 A;  3TZD A;  1H9J A;  1IZ6 A;  1PRT C;  4I7A A;  4IUP A;  5KNC A;  1HTP A;  3FKI B;  3DWQ A;  1B9N A;  4QMG A;  4XT1 B;  2JA6 H;  4IFD I;  1CZW A;  4ZKC B;  1E22 A;  3I4N B;  1PH1 A;  1PRT B;  3AYH B;  2L55 A;  2Y0S B;  2KQ3 A;  1LYL A;  1V1P B;  2J7Z A;  3W1B A;  3BYY B;  4DAY B;  1CKN A;  1EL0 A;  3GTP B;  3PIP A;  3KLS A;  3T1Y L;  2A68 D;  2GA4 B;  4OXP A;  2A1A A;  1YJ9 A;  4UAI A;  2F0P A;  2YV5 A;  3H3V C;  3NP8 A;  2EYF A;  2SNS A;  4POG A;  2F52 A;  4IUN A;  1PMR A;  3SDZ A;  1I6V C;  1KNA A;  2WII B;  3NXW A;  2DJF C;  3I7F A;  2XN9 C;  2ZTC A;  3HOV G;  1K83 H;  1FVI A;  1HNX L;  4LF7 Q;  5IT9 c;  3JC6 6;  4DV4 Q;  5C4Z A;  2EYJ A;  5LMU Q;  3ULP A;  4JI2 L;  3H6M A;  4L5S A;  1TS3 A;  1VQ9 A;  3C1F A;  5COY A;  4L6T B;  1QG7 A;  3NSW A;  4QF4 A;  3X3N A;  3HOV H;  1PDQ A;  1X56 A;  2CWA A;  3WOF A;  2HIV A;  1ML0 D;  4TSS A;  5JPM C;  4B3T L;  1PTO C;  1A63 A;  4P75 A;  1XTC D;  2AHO B;  2K5H A;  1R9T H;  4C3I G;  1GUO A;  3MXG A;  3W1G A;  3HOX G;  4H02 A;  1S5C D;  4PNY A;  3M3Y B;  4A3M G;  3U9O A;  4X66 Q;  2HDL A;  1H9S B;  3A5U A;  5JAV A;  3BU2 A;  3RMH A;  2ZJP A;  2GVA A;  1PTO B;  4JK1 C;  3X3M A;  2UXC L;  4BY1 B;  2O5J C;  2KJX A;  3MXP A;  2MO1 A;  3VYR A;  4C3I H;  3HOX H;  4RGT A;  4DR6 Q;  3KJP A;  4A3M H;  4LUO A;  4WRD A;  2ALY B;  1K3R A;  4KY5 A;  1A3U A;  1B9M A;  2I5M X;  1CZG A;  1Z7T A;  2WB1 G;  2PZU A;  4A93 B;  4K0K Q;  2KED A;  3TP5 A;  4DK3 C;  1QZH A;  2N55 A;  4FYD A;  1WTV A;  1I5F A;  3PO3 B;  4EQO A;  3GQB A;  2JA8 G;  2RQX A;  1YNX A;  1I6H H;  1FR3 A;  1U4P A;  1ZKO A;  2B2V C;  2KUM A;  3K59 A;  3URY A;  3CRK C;  1S5B D;  2F0O A;  2E2D C;  1KAA A;  1BCP F;  1AH9 A;  1O80 A;  1AW7 A;  2D5D A;  4AYB G;  3K0X A;  4HID A;  2D0P A;  2A69 C;  2D0O A;  3H3V I;  2UUA L;  2Q2T A;  1OO9 B;  2HD3 A;  2K33 A;  1EEF D;  3HOZ G;  2K4K A;  1GD7 A;  2PO4 A;  2D62 A;  1NY4 A;  5I6Y A;  1B3Q A;  1XPU A;  2WV6 D;  2B2U C;  3PUY A;  4CDF C;  2PPB C;  4RFB A;  4F8M A;  1FGU A;  3HOZ H;  3K0Y A;  1NBW A;  3S2H H;  1VQO A;  4YWK A;  5IGE A;  1LM0 A;  1JOO A;  2YTV A;  1JWU D;  4ALP A;  1VQ4 A;  3TZU A;  1YNN D;  2J4X A;  3T51 B;  2OWO A;  1JIC A;  2P5Z X;  2IWH A;  2ZM6 L;  4F88 A;  5I9O A;  3ITP A;  3MVV A;  4GLX A;  1VQ8 A;  4RG1 A;  1C48 A;  5EPJ A;  1ESR A;  4DV1 Q;  2RA4 A;  3RN2 A;  4B3R L;  5FO7 B;  1EZ8 A;  4LWC A;  4TKO B;  2VB2 X;  4LF6 L;  1SNC A;  3NQT A;  5C0X J;  1C0A A;  3ERO A;  4PZ6 A;  1LT5 D;  3QB3 A;  1EU3 A;  5C0X I;  1XPO A;  4KKT A;  3N6R A;  1A3V A;  3HRZ C;  2EXD A;  4XYO A;  3GTG H;  4Y52 H;  4P2C B;  3O13 A;  1ZYR D;  3DMU A;  1ROD A;  1S5E D;  2XRQ D;  5LHY 1;  4LFA Q;  1G29 1;  1FNV A;  4FF1 A;  2K03 A;  1BF4 A;  4FO2 A;  1E24 A;  2CKZ B;  2WIN B;  1X54 A;  5EPK A;  5C44 G;  1YNJ D;  4QCL A;  1WCM G;  3OWF A;  2JA6 B;  1HR0 L;  2F0E A;  3DHQ A;  1WTO A;  1QB5 D;  4QB4 A;  2VUM B;  2LY7 A;  5L37 A;  2EYP A;  1S3O A;  3OHX C;  1XYI A;  1GUG A;  5C44 H;  1GUN A;  5CGK A;  1CUK A;  1LTI D;  5DEH A;  2HCI A;  2XNA C;  5E4X A;  1HNZ Q;  4NMZ A;  2A5H A;  4RAU C;  3CC2 A;  4WJ3 M;  5GAG C;  4CDD C;  1EU4 A;  2ZXP A;  3SGI A;  2NZO A;  5IE8 A;  4QGU A;  4KKU A;  5IOD A;  1XMO Q;  4DR2 L;  2VXW A;  3NEM A;  4LW1 A;  2EPB A;  4OIK A;  4L5T A;  1C8C A;  1BXT A;  2IHF A;  3MHB A;  3Q6S A;  3FEW X;  1U4R A;  3EVQ A;  1YVC A;  4LMQ D;  1R9T B;  1I4R A;  4DPG A;  1IW7 C;  1W3S A;  2KCC A;  5IP9 G;  1XNQ L;  1E7Z A;  4G57 A;  1M4V A;  4UPA A;  1TWA H;  4C3I B;  3DUZ A;  2VQF L;  5LL6 S;  2KCN A;  2BDO A;  1B50 A;  1I3Q H;  1PZK D;  2R7Z H;  4A3M B;  5IP9 H;  1HNX Q;  3NWT A;  4IPC A;  3SEB A;  1WFQ A;  2WAQ E;  3PMF A;  1LLR D;  2JYO A;  5H1S E;  5A35 A;  2VB3 X;  3RLO A;  3K7A H;  3BS1 A;  4WJ4 A;  1PFM A;  2E74 C;  1L0Y B;  1WD0 A;  2MNA A;  1FGB D;  3RLN A;  5I2X A;  4RA8 A;  2YTY A;  1WD1 A;  1GKH A;  1J5E Q;  4K5W A;  1VQE A;  3F8T A;  2VL6 A;  3CCJ A;  1I6H B;  1ICW A;  2QDL A;  2SDF A;  1IKL A;  1C9O A;  5AJ3 L;  2JA7 G;  3KLS X;  1A3T A;  5M3M B;  1BCP D;  1MSG A;  4GN4 B;  4G4K A;  2A73 B;  5C3E G;  2F3W A;  4KHZ A;  3BZK A;  2MJ8 A;  1I4P A;  4NXM L;  3TS2 A;  4JI6 L;  1KTK A;  1IYJ B;  1HQR D;  1PYS B;  4KHV A;  2F0F A;  3CAM A;  1WTX A;  3HGB A;  1SAP A;  1EEI D;  4HIM A;  4C3H G;  3A8J E;  5C3E H;  4UY8 C;  1CSP A;  1PFS A;  1ONL A;  2KEN A;  3I70 A;  1I94 L;  2FJ2 A;  1SYE A;  4V19 0;  3H15 A;  1ET9 A;  4LF9 Q;  2JA5 G;  3CCQ A;  3GTQ H;  5IGG A;  3KYH C;  1D1I A;  2K28 A;  3DLL A;  2AUJ D;  5JJK A;  2K1B A;  4A3E G;  3S2H B;  3NBH B;  4Y7N H;  3E9H A;  4FXD A;  1RD9 D;  2JA5 H;  5CV8 A;  4DV0 Q;  1HFG A;  4DV5 L;  3K6O A;  3DWP A;  4BBR G;  5JJZ A;  1N33 Q;  1F2Z A;  2MO0 A;  3E3X A;  3OSO A;  1EIH A;  4A3E H;  1TWH B;  1BVS A;  1YHB A;  2L0C A;  2Z8L A;  4KY6 A;  2Z6K A;  3HKZ E;  3I4N G;  2EQS A;  2B2W A;  1B1Z A;  1KL9 A;  2Y0S G;  4BBR H;  1LTR D;  1DZ1 A;  4JI0 Q;  3AFP A;  2JEA I;  1VQN A;  2K04 A;  1PH2 A;  1QUQ B;  3I4N H;  3OMG A;  3RZO H;  3GTO B;  4NW2 A;  3I56 A;  3S1M H;  3GTG B;  4A4I A;  3MEF A;  1IYU A;  3GV3 A;  3VR5 A;  4LF5 L;  2OEO A;  4DR3 L;  1VQF A;  2QIL A;  1E1T A;  4X65 Q;  4DFA A;  2UXB Q;  1EY6 A;  4PG3 A;  2CW0 C;  1SYD A;  2EYM A;  2DNE A;  1DJR D;  3C46 A;  1D5M C;  3PF4 A;  4A3I G;  4LNQ A;  2KOL A;  1HZB A;  1UEA B;  3DM1 A;  4IPH A;  1SRO A;  3LX0 A;  4ILW A;  5C44 B;  2BDN A;  4LF4 Q;  4WOR A;  4A3I H;  2BE5 C;  4NP5 A;  4P74 A;  4LF6 Q;  4PZ8 A;  1HZA A;  1EWH A;  5EKI A;  4DR5 Q;  1G2S A;  4B08 A;  4XDX A;  3PSI A;  3G7L A;  4JV5 L;  4MTK A;  1CI3 M;  4X3U A;  5M5X B;  3EIV A;  2Z6B A;  5FOB B;  1CKO A;  3S1N H;  1JWS D;  2LMC B;  3SK5 A;  3GD7 A;  2EJG C;  4ZRZ A;  4CKC A;  5ELD A;  1M8A A;  1SEB D;  1JQY D;  4EQP A;  1FD7 D;  4KHP L;  4XQQ A;  5E3F A;  1G8Z D;  4OWT B;  2R93 H;  3PIP 3;  5DM6 3;  1Y8N B;  3HOW G;  4P72 A;  1LTA D;  2F0L A;  4DXG A;  5ELF A;  4RHR A;  3SXH A;  2TMP A;  3BDL A;  4A93 G;  3G4S A;  4OGQ C;  2RBM A;  1JC7 A;  1N9W A;  4EVO A;  5T1I A;  4CHT B;  3S15 B;  2ZXO A;  1ZXT A;  4HSP A;  4HJ7 A;  4X62 Q;  2FFK B;  2CWP A;  4OHJ A;  1KDA A;  3HOW H;  1PVO A;  2OTJ A;  3D3R A;  4A93 H;  2GN5 A;  3PO3 G;  3BZC A;  2QKI C;  1HA6 A;  1TWA B;  2B3G A;  2D9U A;  1ASZ A;  1X3E A;  2R7Z B;  3WWV A;  1NSN S;  4POF A;  2K5Q A;  1UNS A;  3PO3 H;  2QF7 A;  2KHI A;  3SVM A;  4DR4 Q;  1B8A A;  1ENA A;  2KCM A;  2R92 B;  1S5D D;  1HQM C;  2J0T D;  1A8V A;  2AMC B;  4HCE A;  2EYO A;  3LNN A;  1H9M A;  1QCB D;  4PMW A;  3E0J A;  2QCP X;  2DNC A;  3HOY G;  4GOP C;  2K32 A;  3VR3 A;  3PIO 3;  3Q23 A;  2IY5 B;  4L8J A;  2G9H D;  2B2T C;  3KF8 A;  3KOJ A;  1JJ2 A;  4X64 Q;  1LT4 D;  3ONA B;  4OO1 G;  2F4I A;  1HNW L;  1PLF A;  3A8K E;  3I72 A;  3KDF A;  3HOY H;  4GOP B;  4CDE C;  2E2H H;  4YY3 Q;  5C5L A;  3M9B A;  2TSS A;  4J15 A;  2XTI A;  1D7Q A;  3MXN A;  3A56 A;  1XWE A;  1TWG B;  3Q0A A;  4A3D H;  1PH6 A;  1QIL A;  1TWC H;  4C3J G;  4OO1 H;  1HJP A;  5BN3 A;  2OCE A;  1AP0 A;  1X3P A;  5A2Q L;  2Z9H A;  5C3E B;  3VR4 A;  2UXD Q;  2H1E A;  2RSN A;  3J7Z C;  4JI1 Q;  4A3C G;  3ZYY X;  1BBU A;  3NPP A;  4C3J H;  1XX8 A;  3U4V A;  1TY2 A;  4JI3 L;  4TRD A;  3GTQ B;  3RUZ A;  2DJG C;  2A68 C;  2RDF A;  3EA6 A;  2XSC A;  4A3C H;  4PMC A;  3UDI A;  1CK1 A;  4Y7N B;  1KDB A;  1D2B A;  2JA5 B;  2KBN A;  1HZC A;  1MKH A;  5EBD A;  5CMD A;  3PQI A;  4B3S L;  1KAB A;  4Z9C B;  4A3E B;  3DEO A;  2L15 A;  1S5F D;  2JA6 G;  2RVL A;  3KJO A;  3NTK A;  4OX9 Q;  5CR3 A;  2JP1 A;  3S1R H;  1IHZ A;  1DYQ A;  2NVT B;  3GV6 A;  2VUM G;  5JJL A;  3GO5 A;  5IGC A;  3PCO B;  4BBR B;  5IGD A;  4IJH A;  4IFD J;  1Z9F A;  3WDN A;  2K5N A;  1L1O A;  5IYC G;  1VQ6 A;  1JE5 A;  4RKB A;  2C35 B;  2VUM H;  5D3I B;  5CV7 A;  3RZO B;  4IUT A;  4K6D A;  5T1G A;  5J1Z A;  3S1M B;  3FHW A;  4QIW B;  1A62 A;  1KRS A;  3GDE A;  5EQ0 A;  1IBL L;  1BOS A;  2N3S A;  5JPN C;  5IYC H;  1QZG A;  3NEN A;  5LMN Q;  4X6A H;  2YU9 H;  4FDB A;  4GS3 A;  1OTC A;  3J81 c;  4JYA Q;  1AE3 A;  4KI0 A;  3MXU A;  2WAC A;  5FLX E;  2M2L A;  4LFC L;  5BR8 L;  1SYC A;  2EJF C;  1OXS C;  4KJO A;  1NUC A;  1VQM A;  1XPR A;  5DLQ E;  4DR7 Q;  1VQK A;  4KN4 C;  5D3D A;  4A3I B;  4QL5 A;  3J81 i;  5K36 G;  1PH3 A;  1JOQ A;  3L7Z C;  5EKK A;  2LS0 1;  3I4O A;  1LAC A;  1SE4 A;  4A3F B;  4FXK C;  1JWM D;  2HIX A;  1N36 Q;  5J39 A;  3D6C A;  5K36 H;  5CBE E;  1STE A;  3U58 A;  5KNB A;  2PW5 A;  3S1N B;  4DKA C;  1TY0 A;  4P71 A;  2PW7 A;  2NYZ D;  4YCW A;  4GKJ L;  1Y14 B;  3S16 B;  5KYL A;  3CCE A;  2R93 B;  4RWS C;  1FJG L;  2F0S A;  1UE7 A;  2OF1 A;  4HJA A;  3RLF A;  1CKN B;  3BDO A;  2AQ1 B;  4MZ9 A;  1KHI A;  1YHQ A;  4KMU C;  1Y69 U;  2EE1 A;  4DUZ Q;  2PNH A;  5FO8 B;  3E9I A;  1WOC A;  1SSO A;  3OTO Q;  3HOW B;  4DR1 Q;  4RGM A;  1WTR A;  4JG2 A;  3A74 A;  1S72 A;  4GN5 A;  1EY8 A;  1ENF A;  5IIF A;  2KA7 A;  4DXF A;  5TSS A;  4EQN A;  1CSQ A;  4DV2 Q;  2EZV A;  3A8I E;  2CQO A;  3NBI A;  4CBV A;  5M3M G;  3S9W A;  3IL8 A;  1TII D;  4HMI A;  4DU9 A;  1SE2 A;  2F0M A;  1PYW D;  3OW7 A;  2NN6 G;  1N32 L;  1GHK A;  2HHH L;  2F0K A;  1W6J A;  4DGZ A;  1A2U A;  4DV6 L;  2E76 C;  4DK1 A;  5BN4 A;  1HUN A;  1YNN C;  1F9P A;  2CFM A;  1TQO A;  5J22 A;  5M3M H;  1LO5 D;  3J81 E;  1GUS A;  1LT3 D;  1K0R A;  2NN6 H;  1R4P B;  3G71 A;  1BQQ T;  2N88 A;  1VQ5 A;  3J7A V;  1HHV A;  5IT9 E;  3M4Q A;  4JI7 L;  5EJW A;  4DK6 C;  3IRB A;  1K3B C;  3A5Z B;  1SLJ A;  1DOM A;  3CCS A;  1IBK L;  5I9P A;  1F2Y A;  3DEP A;  4NKL A;  4IUR A;  3HOY B;  1N34 Q;  3FRP B;  1SBB B;  3OIP A;  4IPD A;  2E2H B;  3EJI A;  4JPB W;  4EX5 A;  1PH5 A;  2JJQ A;  1ZYR C;  2VW9 A;  5HGQ A;  4A3D B;  1DCZ A;  2L9H A;  1TWC B;  5C6A A;  3A7L A;  3D4D A;  2I5L X;  3G6E A;  3V2T A;  1WTP A;  3IFD A;  4HTH A;  3F2D A;  1YNJ C;  1SFO H;  1SMY D;  4DV3 L;  1GUT A;  3R93 A;  5FLX L;  1UE1 A;  1EY4 A;  4C56 C;  4C3J B;  1J8I A;  1TWH H;  1SN8 A;  2XWJ B;  3PV0 A;  3W2D A;  2GVB A;  4H44 C;  4R4I A;  4NXN L;  4Q5V A;  1VQG A;  1VMC A;  1OXX K;  1SNP A;  1QWY A;  3BJU A;  1J9O A;  4HJ5 A;  3C1E A;  1JCK B;  3EBE A;  2WKC A;  4HAE A;  3PO2 B;  3GTO H;  3F2B A;  1AEX A;  3A54 A;  3I2Z A;  4CJ0 B;  2PZW A;  1VQL A;  1X3F A;  3S1R B;  4RHS A;  3T1H Q;  4ZKB B;  5M9O A;  4QY7 A;  3E0E A;  2R7F A;  3OYY A;  5GAE C;  1HCZ A;  5JEA J;  4JI4 L;  3K5M A;  2MPM A;  5AFW A;  2KEC A;  4KD4 A;  2SEB D;  2MQH A;  1CHQ D;  4QUF A;  1D6E C;  2N78 A;  5ISR A;  2E5L L;  1WI5 A;  4YCV A;  1VQD A;  1MBY A;  4JI8 L;  4A3B G;  2AKW B;  3MFG A;  2F4V L;  1SND A;  4K5X A;  4HCS A;  1XXG A;  1AN8 A;  2WB1 E;  1KD1 C;  2YU9 B;  1HPC A;  3CKI B;  3OIQ A;  2A74 C;  4C1N I;  4K2K A;  2UUB L;  4JBM A;  3GTL B;  4A3B H;  2CCZ A;  3NUC A;  4EQ5 A;  5CBA E;  1YJW A;  3BYT B;  5M5X H;  1G2T A;  1Z6H A;  5FK9 C;  3MFY A;  5EAY A;  2IX1 A;  1VQB A;  3SK8 A;  1RHP A;  4A3L H;  3T53 B;  4OO1 I;  1MJE A;  2CH4 A;  1AFP A;  3J81 L;  3EN2 A;  1STH A;  3KBG A;  1SJH D;  3F1Z A;  1JOK A;  2ZTE A;  4R9W A;  3SHL A;  3L0O A;  1HRJ A;  1NMF A;  3CCL A;  1EQT A;  2PMZ E;  4RKL A;  5IT9 L;  1CKM A;  3S15 H;  1EUJ A;  4AYB E;  3T1Y Q;  2R7Z G;  3L9A X;  3EQL C;  2UU9 L;  5LMN W;  4AQY L;  2KVM A;  1BCP C;  1SYB A;  2PI2 E;  3CCM A;  1G91 A;  1MD2 D;  2HT1 A;  3GTK H;  2C9O A;  4FNF A;  5BR8 Q;  1R4Q B;  3I90 A;  4JI5 L;  3P7J A;  3I8Z A;  2R92 G;  4GKK L;  1Q86 C;  3BG3 A;  2UUC L;  2F3I A;  3ERQ A;  3S24 A;  4P73 A;  3STB D;  4OIJ A;  1Q7Y C;  1K8G A;  1BCP B;  4JI2 Q;  5E7N A;  4KN7 C;  5D65 A;  4QUC A;  3AFQ A;  2R92 H;  3PUV A;  3S17 B;  4ULL A;  1BBX C;  1G51 A;  4B3T Q;  3HP3 A;  1IXR A;  4TQU S;  4FF4 A;  1EFI D;  5IYB G;  5JVG 3;  4YHH L;  2K50 A;  3UI2 A;  3EFX D;  4H0L C;  3D31 A;  2A6E D;  3MZ5 A;  2B39 A;  3IKJ A;  1V1O A;  4GNX A;  5E1F A;  1YZ6 A;  4LF8 L;  1KNE A;  1RL2 A;  2UXC Q;  4O1N A;  5IYB H;  3NQI A;  2MGS A;  5KGU A;  4R8N A;  1FJG Q;  4K2L A;  2PI2 A;  2L1B A;  3I4M G;  1TVX A;  2B2Y A;  5HY6 A;  1U5K A;  5EGT A;  4V0B A;  2NWG A;  1CA5 A;  2Q2U A;  1YIJ A;  1TWG H;  4RCN A;  2Q8I B;  3I4M H;  4U68 A;  1E1O A;  3D4W A;  1S4Z A;  4G7H C;  1SJE D;  2K5V A;  4H7B A;  4M1U B;  2IHE A;  5IY0 A;  2BCO A;  3K81 C;  4QJF A;  3WOE A;  2VY3 A;  3UE1 A;  1K8A C;  3CPW A;  4ODG A;  1B7Y B;  4GN3 B;  2HHH Q;  1E2V A;  1AZQ A;  1FNW A;  1BNZ A;  1KRT A;  4QQB X;  2M9V A;  3Q8D A;  1A0I A;  5IWA L;  3PGZ A;  5IGB A;  4APV A;  2F0J A;  4AIM A;  4IOC A;  1ZEQ X;  1SFO B;  5GQO A;  4LAA A;  2BA1 A;  2PQA A;  1GVP A;  1VF5 C;  2VQE L;  4GZY C;  5C4X G;  1Q90 A;  3H09 A;  1SNQ A;  2KHS A;  3CME A;  2UUA Q;  2NVQ H;  3D0F A;  5K5P A;  2NVT H;  1TWF B;  1IBK Q;  2Q2I A;  3U50 C;  3MAQ A;  1LTB D;  4YCU A;  1MJC A;  3M7N A;  3L3O C; 
#chains in the Genus database with same CATH homology
 1I4Q A;  2WP8 J;  1D1K A;  4K6L A;  2K5D A;  1CM9 A;  5ELC A;  1B53 A;  3H94 A;  4X3K A;  3GP7 A;  3T56 B;  4WFN 3;  3HS0 C;  4H13 C;  2Z4H A;  1RJT A;  4K8I A;  5A2Q E;  1RDP D;  4O42 A;  2NN6 I;  5ELE A;  1CQV A;  1B44 D;  3SK4 A;  2B2W C;  3CHB D;  2LFN A;  4JBW A;  3I73 A;  2IJ0 A;  4KKS A;  3FPU B;  3T4A C;  1EYC A;  4I7Z C;  2K01 A;  3E6Z X;  4A3B B;  5I4D A;  2SOB A;  4CJ1 B;  5F2D A;  2EY1 A;  4CKE A;  1HXY D;  1IYV A;  4X3T A;  2WKD A;  1TU2 B;  5IGF A;  3FPP A;  3R2I A;  2HDM A;  3S2D B;  1PRT F;  1EYD A;  2DN8 A;  1X3Q A;  4KTA A;  1AZP A;  1QOH A;  2JEB I;  1SDF A;  2IPK D;  2RKS A;  5FO9 B;  1OXU A;  3ND9 A;  1KLU D;  4HMJ A;  1O78 A;  4OL7 A;  2OXP A;  3OPO A;  1PFB A;  3GTK B;  3HKZ B;  3V96 A;  2K05 A;  2IX3 A;  2ICE C;  1ET6 A;  2F0Q A;  4A3G B;  4N9P A;  4FXG C;  2O5I C;  1ENC A;  2M00 A;  1PZJ D;  4ZLT F;  4C2M B;  1K8M A;  1L0X B;  1E2W A;  2FMC A;  1A15 A;  1TS5 A;  1JR0 D;  4DAV A;  3KLR A;  1PTO F;  3P20 A;  3V05 A;  1B2T A;  1ILP A;  3QG1 A;  1HUM A;  4BBS B;  2RDG A;  1U4L A;  3I4L A;  5I6W A;  1V8Q A;  3R8B A;  4DAP A;  3I91 A;  4XQJ A;  2CVR A;  4J6H A;  1Q12 A;  2A6H D;  3NTI A;  2F03 A;  1D5Z C;  4HSV A;  5ELB A;  4LK1 C;  3I4M B;  5C4H A;  1BUV T;  3KBX A;  3H91 A;  3D4R A;  2OT2 A;  3RZD B;  2EOT A;  1WTQ A;  3P75 A;  1DOL A;  2EXZ A;  2K7V A;  3A7A B;  4NDX A;  2PNR C;  1H9K A;  2KEE A;  2ENB A;  1SNO A;  1V1P A;  5BN5 A;  4FVM A;  4L63 B;  2BA0 A;  2F3V A;  4ZUJ A;  1DOK A;  2QEJ C;  2NVQ B;  3TDQ A;  5CV6 A;  2F0H A;  3QWN A;  1C4Q A;  3BVG A;  1RTN A;  5C4X B;  3PUZ A;  4ID6 A;  3M4O B;  1CTM A;  4M8A A;  2ICI A;  1NAP A;  1GOZ A;  1U9R A;  1H9R A;  2YYZ A;  1Y8P B;  4E6I A;  4EGV A;  4PQX A;  4RH6 A;  2EDG A;  4IZ8 A;  5KND A;  3NHH A;  4Q0F A;  1F9R A;  3M85 A;  2NZ1 D;  1H9S A;  2D2C C;  3SE0 A;  4F87 A;  1STN A;  1TKW B;  2X6G A;  1TS4 A;  5EBC A;  4R8I A;  1A6X A;  2B8F A;  3OMC A;  3DXJ C;  5JOB A;  2Z1C A;  4BS9 A;  1JE4 A;  3VR6 A;  3HOU B;  2EY6 A;  4KV6 A;  3J7Y W;  2L11 A;  4FP5 D;  5C4J B;  3G6J B;  1VMP A;  3HEJ A;  2E2I B;  3A55 A;  2LKV A;  4CKB A;  3F2U A;  5D14 A;  1PRT D;  4A3J B;  3VYS A;  3IAY A;  3E5S A;  3SR1 A;  2FIN B;  3QOJ A;  2MUY A;  2F0I A;  2G9D A;  1EY5 A;  2O2L D;  2X69 A;  1T5E A;  2F0D A;  1VF7 A;  4DNR B;  2B2V A;  3BVM A;  4ZUI A;  1MGS A;  5C5M A;  1U4M A;  3QJY A;  4S3S A;  1FYC A;  1JOR A;  3TBI B;  1O7Y A;  3BZD B;  1RF2 D;  2NB0 A;  3CQZ B;  3K5N A;  1DXM A;  3PUW A;  2AWO A;  3K5O A;  1EY0 A;  2ID0 A;  3C2P A;  2HUG A;  1SMY C;  1HFN A;  1SYF A;  3NK9 A;  1F9Q A;  1LTG D;  5JVH 3;  2B2U A;  3VYT A;  1PTO D;  3QOL A;  4RCO A;  2NVX B;  3KUP A;  2IL8 A;  1F77 A;  2JXM B;  3VA7 A;  2EVB A;  3K5L A;  3R3O A;  3BDC A;  4HED A;  4J8Q A;  3S14 B;  5KRU A;  1NR2 A;  4LJZ C;  1T5X D;  2L12 A;  5C3X A;  2AQ3 B;  1WVL A;  1DON A;  1EYA A;  5C3W A;  3D8G A;  3TME A;  3AMU A;  2I46 A;  1CQF A;  5KIX A;  2NBF A;  5M5Y B;  2DY7 A;  1GHJ A;  1VCI A;  4B9X A;  4HR7 B;  2AWN A;  3FVQ A;  1Q1B A;  2AQ2 B;  3KK7 A;  3Q24 A;  1RKN A;  5DAU A;  2NUC A;  4DA2 A;  4A3K B;  3HZX A;  2R61 A;  4FF3 A;  4YIJ A;  2A69 D;  2RDH A;  2IX0 A;  4ZK9 B;  2QDB A;  1LT6 D;  4U67 3;  2F0V A;  2NVY B;  1RTO A;  2B63 B;  3D6W A;  2K6A A;  4IUQ A;  1OXV A;  3AU7 A;  4BWG B;  2MP1 A;  3M4Y A;  1I4H A;  3FMC A;  5HUR A;  1TT2 A;  2EYL A;  2DY8 A;  4PMB A;  4XT3 B;  2H4O A;  4K5V A;  1GXD C;  1SE3 A;  3MC0 B;  2L4N A;  2I07 B;  3W3A A;  3J7A F;  1EZ6 A;  4K8J A;  3TP7 A;  2F0G A;  1EIG A;  1SXT A;  3K58 A;  1EOT A;  3NE5 B;  4DN4 M;  1EY9 A;  3I3C A;  1G6Z A;  1B4O A;  2A6E C;  1B3A A;  1RCV D;  4BY7 B;  1K83 B;  5HGT A;  2XVS A;  4IUU A;  3MA2 B;  2NTT A;  5EPL A;  1Y1W B;  2FMM A;  2EJM A;  1HA5 A;  3HOV B;  2JSO A;  4MN3 A;  1FNU A;  5IOC A;  3GTJ B;  5KEE A;  1CFM A;  3MEH A;  2RSO A;  3AB9 A;  4BA2 I;  5FKA C;  4RGN A;  2F0U A;  3N52 A;  4UDU C;  5CYU A;  1GJX A;  1Y1V B;  1HTL D;  3HOX B;  4J1M A;  1QNU A;  5G3L F;  4DF7 A;  3CU7 A;  1PZI D;  4IFD G;  1DM0 B;  3OWE B;  2JE6 I;  1QJO A;  3QO2 A;  1Q3L A;  3LWU A;  2PYK A;  3JAM E;  4IFD H;  2VNU D;  3NBH A;  2WB1 B;  1BO0 A;  2L5T A;  1IKM A;  4N9T A;  2F0W A;  2F1M A;  4G7Z C;  4XXE A;  1O7Z A;  3SK6 A;  3K57 A;  1IW7 D;  1SNM A;  5CC4 A;  5CV9 A;  4ABN A;  2Z4I A;  2K5W A;  2HQE A;  2MHV A;  2JA8 B;  1KLG D;  4ZQ3 A;  1CHP D;  3QIA A;  2F0N A;  4IAL A;  4K14 A;  1V43 A;  3ND8 A;  2PMZ B;  1BR9 A;  1MSH A;  3DWA A;  3T16 A;  4AYB B;  2B2Y C;  4DNT B;  2E75 C;  3PUX A;  1WTW A;  1X32 A;  3HOZ B;  2XIW A;  1W6K A;  1VDZ A;  2ZXR A;  3T13 A;  3TP6 A;  1F2M A;  4KJN A;  2C5C A;  2WAQ B;  5NUC A;  4C1N K;  2PQE A;  4IQZ A;  2SNM A;  1K8O A;  1KDC A;  1GUW A;  1QE6 A;  2CHB D;  3CRL C;  3J80 E;  5CV5 A;  4I65 A;  1EY7 A;  5E4W C;  1D5X C;  3C3L A;  2HCC A;  4XQN A;  3P1H A;  5I2Y A;  3VYU A;  1QNK A;  1BDO A;  3TN2 A;  3NWS A;  3RD4 A;  1OXT A;  3OOC A;  4PV1 C;  5M3F B;  1DD2 A;  1LAB A;  3R2T A;  1F2L A;  3TP8 A;  1O7L A;  1Y8O B;  4FF2 A;  1TR5 A;  4ZYS A;  4CGY B;  1ILQ A;  5LL6 X;  2EY5 A;  1WCM B;  5EKL A;  3JAM L;  4CJ2 C;  2ZT9 C;  2F0T A;  3BVZ A;  1EWC A;  2XWB B;  4B9W A;  3S1Q B;  2FHT A;  2R3Z A;  1JB3 A;  2CQA A;  4MIU A;  4F7X A;  1PTO H;  1E2Z A;  2CW0 D;  1EQV A;  1STY A;  3HG9 A;  2A6H C;  2B8G A;  1LTT D;  2V4D A;  3Q22 A;  5C0X G;  4KY7 A;  1E0B A;  2XRS D;  2B2T A;  1UAP A;  4RGO S;  4IN3 A;  2BE5 D;  4XTC S;  5G3L D;  3NTH A;  2E2J B;  5C0X H;  3M7G A;  1LTS D;  1I3Q B;  1A2T A;  1I4G A;  1PXU A;  1UUP A;  1STG A;  1II3 A;  5JEA G;  3GTM B;  2NTS A;  1F9S A;  4IUV A;  4BA1 I;  3LWE A;  1CA6 A;  1TS2 A;  2R6G A;  3K7A B;  2Q8T A;  4G7O C;  4HN7 A;  1SYG A;  2O4X A;  5JEA H;  1Z47 A;  3J80 L;  4X3S A;  2Q8R E;  2EY2 A;  3MTS A;  1STA A;  4KD3 A;  4MHE A;  4ZAI A;  1CT1 D;  1I4X A;  5DNF A;  1IL8 A;  3TSS A;  4KK7 A;  3VA5 A;  1STB A;  2IT1 A;  2JA7 B;  2PZT A;  3FDT A;  1LV9 A;  5COR A;  4DK0 A;  4WJW A;  5M5W B;  2EYH A;  4DAY A;  2AUK A;  1I50 B;  3IFT A;  2X6L A;  4XIG S;  3VR2 A;  3H0G B;  4C3H B;  1PFN A;  1NCV A;  2PCF B;  1NR4 A;  1Q1E A;  5DM7 3;  2BOS A;  4XYQ A;  3MWY W;  1MI2 A;  5KYI A;  1ESF A;  5CV4 A;  1Q8I A;  4ME5 A;  2IW3 A;  3U9S A;  3TZD A;  1H9J A;  1PRT C;  4IUP A;  5KNC A;  1HTP A;  3FKI B;  3DWQ A;  1B9N A;  4QMG A;  4XT1 B;  4IFD I;  1CZW A;  4ZKC B;  3I4N B;  1PRT B;  2L55 A;  2Y0S B;  2KQ3 A;  1V1P B;  2J7Z A;  3BYY B;  1EL0 A;  3GTP B;  3KLS A;  2A68 D;  2GA4 B;  4UAI A;  2F0P A;  3H3V C;  2EYF A;  3NP8 A;  2SNS A;  4IUN A;  1PMR A;  3SDZ A;  1I6V C;  1KNA A;  2WII B;  3NXW A;  2XN9 C;  5C4Z A;  2EYJ A;  3H6M A;  1TS3 A;  3C1F A;  5COY A;  4L6T B;  1QG7 A;  3NSW A;  4QF4 A;  3X3N A;  1PDQ A;  3WOF A;  1ML0 D;  4TSS A;  5JPM C;  1PTO C;  1XTC D;  4C3I G;  1GUO A;  3MXG A;  1S5C D;  4PNY A;  3M3Y B;  3U9O A;  2HDL A;  1H9S B;  5JAV A;  3RMH A;  2O5J C;  1PTO B;  4JK1 C;  3X3M A;  4BY1 B;  2KJX A;  3MXP A;  3VYR A;  4RGT A;  4WRD A;  4KY5 A;  1A3U A;  1B9M A;  1CZG A;  1Z7T A;  2PZU A;  4A93 B;  2KED A;  3TP5 A;  2N55 A;  4FYD A;  1WTV A;  3PO3 B;  4EQO A;  3GQB A;  2RQX A;  1FR3 A;  1U4P A;  1ZKO A;  2B2V C;  2KUM A;  3K59 A;  3URY A;  3CRK C;  1S5B D;  2F0O A;  2E2D C;  1KAA A;  1BCP F;  1O80 A;  1AW7 A;  2D5D A;  2A69 C;  1OO9 B;  2K33 A;  1EEF D;  2PO4 A;  2D62 A;  5I6Y A;  2WV6 D;  2B2U C;  3PUY A;  2PPB C;  4RFB A;  4F8M A;  3K0Y A;  5IGE A;  1JOO A;  1JWU D;  3TZU A;  1YNN D;  2J4X A;  3T51 B;  1JIC A;  2IWH A;  4F88 A;  5I9O A;  3ITP A;  3MVV A;  1C48 A;  5EPJ A;  1ESR A;  2RA4 A;  5FO7 B;  1EZ8 A;  4TKO B;  2VB2 X;  1SNC A;  3NQT A;  5C0X J;  3ERO A;  1LT5 D;  3QB3 A;  1EU3 A;  5C0X I;  4KKT A;  3N6R A;  1A3V A;  3HRZ C;  4XYO A;  4P2C B;  3O13 A;  1ZYR D;  3DMU A;  1ROD A;  1S5E D;  2XRQ D;  5LHY 1;  1G29 1;  1FNV A;  4FF1 A;  2K03 A;  1BF4 A;  4FO2 A;  2WIN B;  5EPK A;  1YNJ D;  4QCL A;  3OWF A;  2JA6 B;  2F0E A;  3DHQ A;  1WTO A;  1QB5 D;  4QB4 A;  2VUM B;  2LY7 A;  2EYP A;  3OHX C;  1XYI A;  1GUG A;  1GUN A;  5CGK A;  1LTI D;  5DEH A;  2HCI A;  2XNA C;  5E4X A;  4NMZ A;  2A5H A;  4RAU C;  1EU4 A;  2ZXP A;  4KKU A;  5IOD A;  2VXW A;  2EPB A;  4OIK A;  1C8C A;  1BXT A;  3MHB A;  3Q6S A;  3FEW X;  1U4R A;  3EVQ A;  4LMQ D;  1R9T B;  1I4R A;  1IW7 C;  2KCC A;  4G57 A;  1M4V A;  4C3I B;  3DUZ A;  5LL6 S;  2KCN A;  2BDO A;  1B50 A;  1PZK D;  4A3M B;  3NWT A;  3SEB A;  3PMF A;  1LLR D;  2JYO A;  5A35 A;  2VB3 X;  3BS1 A;  1PFM A;  2E74 C;  1L0Y B;  1WD0 A;  1FGB D;  5I2X A;  4RA8 A;  1WD1 A;  4K5W A;  1I6H B;  1ICW A;  2SDF A;  1IKL A;  3KLS X;  1A3T A;  5M3M B;  1BCP D;  1MSG A;  4G4K A;  2A73 B;  2F3W A;  4KHZ A;  2MJ8 A;  1I4P A;  1KTK A;  1HQR D;  4KHV A;  2F0F A;  1WTX A;  3HGB A;  1SAP A;  1EEI D;  4C3H G;  3A8J E;  1ONL A;  3I70 A;  2FJ2 A;  1SYE A;  4V19 0;  1ET9 A;  5IGG A;  1D1I A;  2K28 A;  2AUJ D;  2K1B A;  3S2H B;  4FXD A;  1RD9 D;  5CV8 A;  1HFG A;  3K6O A;  5JJZ A;  3DWP A;  1F2Z A;  3OSO A;  1EIH A;  1TWH B;  2L0C A;  2Z8L A;  4KY6 A;  2B2W A;  1B1Z A;  1LTR D;  1DZ1 A;  2JEA I;  2K04 A;  3OMG A;  3GTO B;  4NW2 A;  3GTG B;  1IYU A;  3GV3 A;  3VR5 A;  2OEO A;  2QIL A;  4DFA A;  1EY6 A;  2CW0 C;  1SYD A;  2EYM A;  2DNE A;  1DJR D;  3C46 A;  1D5M C;  2KOL A;  1UEA B;  3DM1 A;  3LX0 A;  4ILW A;  5C44 B;  2BDN A;  4WOR A;  2BE5 C;  4NP5 A;  1EWH A;  5EKI A;  1G2S A;  4B08 A;  4XDX A;  3G7L A;  1CI3 M;  4X3U A;  5M5X B;  5FOB B;  1JWS D;  2LMC B;  3SK5 A;  3GD7 A;  2EJG C;  4ZRZ A;  4CKC A;  4EQP A;  5ELD A;  1M8A A;  1JQY D;  1SEB D;  1FD7 D;  4XQQ A;  5E3F A;  1G8Z D;  3PIP 3;  5DM6 3;  1Y8N B;  1LTA D;  2F0L A;  4DXG A;  5ELF A;  4RHR A;  3SXH A;  2TMP A;  3BDL A;  4OGQ C;  2RBM A;  1JC7 A;  4EVO A;  5T1I A;  4CHT B;  3S15 B;  2ZXO A;  1ZXT A;  4HSP A;  2FFK B;  4OHJ A;  1KDA A;  3D3R A;  2QKI C;  1HA6 A;  1TWA B;  2D9U A;  2R7Z B;  1NSN S;  2K5Q A;  1UNS A;  2QF7 A;  3SVM A;  1ENA A;  2R92 B;  1S5D D;  1HQM C;  2J0T D;  4HCE A;  2EYO A;  3LNN A;  1H9M A;  1QCB D;  4PMW A;  3E0J A;  2QCP X;  2DNC A;  2K32 A;  3VR3 A;  3PIO 3;  3Q23 A;  4L8J A;  2G9H D;  2B2T C;  3KF8 A;  1LT4 D;  3ONA B;  4OO1 G;  2F4I A;  1PLF A;  3A8K E;  3I72 A;  5C5L A;  2TSS A;  3MXN A;  3A56 A;  1XWE A;  1TWG B;  3Q0A A;  1QIL A;  4C3J G;  4OO1 H;  5BN3 A;  1AP0 A;  1X3P A;  5A2Q L;  5C3E B;  3VR4 A;  2H1E A;  2RSN A;  3ZYY X;  3NPP A;  1XX8 A;  1TY2 A;  4TRD A;  3GTQ B;  3RUZ A;  2A68 C;  2RDF A;  3EA6 A;  2XSC A;  4PMC A;  1CK1 A;  4Y7N B;  1KDB A;  1D2B A;  2JA5 B;  5EBD A;  5CMD A;  1KAB A;  4Z9C B;  4A3E B;  3DEO A;  1S5F D;  2RVL A;  3NTK A;  5CR3 A;  2JP1 A;  1IHZ A;  1DYQ A;  2NVT B;  3GV6 A;  3GO5 A;  5IGC A;  4BBR B;  5IGD A;  4IFD J;  3WDN A;  4RKB A;  5D3I B;  5CV7 A;  3RZO B;  4IUT A;  4K6D A;  5T1G A;  5J1Z A;  3S1M B;  4QIW B;  5EQ0 A;  1BOS A;  5JPN C;  4KI0 A;  3MXU A;  2WAC A;  5FLX E;  2M2L A;  1SYC A;  2EJF C;  1OXS C;  4KJO A;  1NUC A;  4KN4 C;  5D3D A;  4A3I B;  5K36 G;  1JOQ A;  3L7Z C;  5EKK A;  2LS0 1;  1LAC A;  1SE4 A;  4A3F B;  4FXK C;  1JWM D;  5J39 A;  3D6C A;  5K36 H;  5CBE E;  1STE A;  5KNB A;  2PW5 A;  3S1N B;  1TY0 A;  2PW7 A;  2NYZ D;  3S16 B;  5KYL A;  2R93 B;  4RWS C;  2F0S A;  2OF1 A;  3RLF A;  3BDO A;  2AQ1 B;  4KMU C;  1Y69 U;  2EE1 A;  5FO8 B;  1SSO A;  3HOW B;  4RGM A;  1WTR A;  1EY8 A;  1ENF A;  5IIF A;  2KA7 A;  4DXF A;  5TSS A;  4EQN A;  2EZV A;  3A8I E;  3NBI A;  4CBV A;  3S9W A;  3IL8 A;  1TII D;  4HMI A;  4DU9 A;  1SE2 A;  2F0M A;  1PYW D;  3OW7 A;  2NN6 G;  1GHK A;  2F0K A;  1W6J A;  4DGZ A;  1A2U A;  2E76 C;  4DK1 A;  5BN4 A;  1HUN A;  1YNN C;  1F9P A;  1TQO A;  5J22 A;  1LO5 D;  3J81 E;  1GUS A;  1LT3 D;  2NN6 H;  1R4P B;  1BQQ T;  2N88 A;  1HHV A;  3J7A V;  5IT9 E;  5EJW A;  1DOM A;  5I9P A;  1F2Y A;  3DEP A;  4NKL A;  4IUR A;  3HOY B;  3FRP B;  1SBB B;  3OIP A;  2E2H B;  3EJI A;  1ZYR C;  4A3D B;  1DCZ A;  2L9H A;  1TWC B;  5C6A A;  3A7L A;  3D4D A;  3V2T A;  1WTP A;  3IFD A;  4HTH A;  1YNJ C;  1SMY D;  1GUT A;  3R93 A;  5FLX L;  1EY4 A;  4C56 C;  4C3J B;  1J8I A;  2XWJ B;  3PV0 A;  3W2D A;  4H44 C;  4Q5V A;  1VMC A;  1OXX K;  1SNP A;  1QWY A;  1J9O A;  3C1E A;  1JCK B;  2WKC A;  4HAE A;  3PO2 B;  1AEX A;  3A54 A;  4CJ0 B;  2PZW A;  3S1R B;  4RHS A;  4ZKB B;  5M9O A;  1HCZ A;  5JEA J;  3K5M A;  2MPM A;  5AFW A;  2KEC A;  4KD4 A;  2SEB D;  1CHQ D;  4QUF A;  1D6E C;  5ISR A;  1MBY A;  3MFG A;  1SND A;  4K5X A;  4HCS A;  1XXG A;  1AN8 A;  2YU9 B;  1HPC A;  3CKI B;  3OIQ A;  2A74 C;  4C1N I;  4K2K A;  3GTL B;  3NUC A;  5CBA E;  1G2T A;  3BYT B;  1Z6H A;  5FK9 C;  3MFY A;  2IX1 A;  3SK8 A;  1RHP A;  3T53 B;  4OO1 I;  1AFP A;  3J81 L;  1STH A;  3KBG A;  1SJH D;  1JOK A;  4R9W A;  3SHL A;  1HRJ A;  1EQT A;  4RKL A;  5IT9 L;  3L9A X;  3EQL C;  2KVM A;  1BCP C;  1SYB A;  1G91 A;  1MD2 D;  2C9O A;  4FNF A;  1R4Q B;  3I90 A;  3P7J A;  3I8Z A;  3BG3 A;  3ERQ A;  4OIJ A;  1BCP B;  4KN7 C;  5D65 A;  4QUC A;  3PUV A;  3S17 B;  4ULL A;  1BBX C;  3HP3 A;  4TQU S;  4FF4 A;  1EFI D;  5JVG 3;  3UI2 A;  3EFX D;  4H0L C;  3D31 A;  2A6E D;  3MZ5 A;  2B39 A;  3IKJ A;  1V1O A;  5E1F A;  1KNE A;  4O1N A;  3NQI A;  2MGS A;  5KGU A;  4R8N A;  4K2L A;  2L1B A;  1TVX A;  2B2Y A;  5EGT A;  4V0B A;  2NWG A;  1CA5 A;  4RCN A;  2Q8I B;  4U68 A;  4G7H C;  3D4W A;  1S4Z A;  1SJE D;  4H7B A;  4M1U B;  2BCO A;  3WOE A;  4ODG A;  1E2V A;  1AZQ A;  1FNW A;  1BNZ A;  2M9V A;  5IGB A;  2F0J A;  1ZEQ X;  1SFO B;  4LAA A;  2BA1 A;  1VF5 C;  4GZY C;  1Q90 A;  3H09 A;  1SNQ A;  2KHS A;  5K5P A;  1TWF B;  3MAQ A;  1LTB D;  3M7N A;  3L3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...