1WTRA

Hyperthermophile chromosomal protein sac7d single mutant m29a in complex with dna gcgatcgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtrA00
1DOKA 1E0BA 2B2TA 2HDMA 3F2UA 1HUNA 1IL8A 1J8IA 1NCVA 1XYIA 3GV3A 2JP1A 3DEPA 3HP3A 2HCCA 2J7ZA 3QO2A 1ILQA 3IFDA 5E4XA 2B2VC 5E4WC 1B3AA 1RJTA 2MGSA 2NYZD 1IKMA 1HRJA 1WTXA 2D9UA 3G7LA 3R93A 2B2VA 1VMPA 2FJ2A 4ZAIA 2B2YC 2K01A 3MTSA 2KEEA 2L4NA 4HEDA 1X32A 2DY7A 2B2YA 1PLFA 2IL8A 2X6LA 4XDXA 4X3TA 3P7JA 1O7ZA 2VXWA 4XT3B 3FPUB 2K1BA 5EKIA 2MPMA 4CJ0B 4UAIA 2DY8A 1G91A 5EPKA 1B2TA 1PDQA 1QG7A 2HUGA 3H91A 4X3SA 2NZ1D 1PFMA 1CM9A 1PFBA 4O42A 4IUQA 1F9RA 4ZKBB 5JJZA 4HSVA 1NR2A 2EE1A 4MHEA 2K03A 4ZLTF 1AZQA 2N88A 3TZDA 1HHVA 2L12A 4QUFA 1LV9A 1RTNA 2HDLA 1G2TA 2Q8TA 4U68A 3MWYW 4QUCA 2X69A 1U4RA 1F9PA 3LWEA 1XX8A 1BBXC 4X3KA 1EL0A 2RSNA 1GUWA 2EOTA 4RWSC 3I90A 3IL8A 4R9WA 1O80A 4LMQD 4OIJA 1MI2A 2K28A 1JICA 2K05A 2X6GA 3N52A 1WTVA 1DONA 1EOTA 1HA6A 1RHPA 1NR4A 1PFNA 2EPBA 1WVLA 1ICWA 1X3PA 1HUMA 4CJ2C 1BNZA 5EQ0A 1TVXA 4MN3A 1X3QA 3DEOA 1WTOA 2L11A 1AZPA 3KUPA 5CBAE 1G6ZA 1QNKA 2H1EA 4IUUA 1WTPA 1SSOA 2KECA 3SVMA 2KVMA 1WTRA 3TN2A 4OIKA 2R3ZA 3DM1A 1SAPA 5CBEE 4XT1B 3FDTA 2JYOA 5CMDA 1MSHA 1F9SA 1J9OA 1G2SA 1KNAA 2FMMA 1ILPA 1ZXTA 2B2UA 1U4PA 5T1IA 4X3UA 5EPLA 1B50A 3GV6A 1MSGA 1BF4A 2RA4A 1NAPA 1CA5A 1KNEA 5COYA 1ML0D 2B2UC 2RSOA 3KBXA 4DN4M 1C8CA 2MJ8A 2L1BA 4R8IA 5EPJA 1SDFA 2Q8RE 1VMCA 2RVLA 3D6WA 1WTQA 3I3CA 4HCSA 5D14A 4CJ1B 1EIHA 1EQTA 1RTOA 5AFWA 1EIGA 1WTWA 1IKLA 1QE6A 4HAEA 2B2WA 5EJWA 4RAUC 1HFGA 5CORA 2N55A 1B4OA 1JE4A 1M8AA 2NWGA 2FINB 1B53A 2B2WC 1RODA 1MGSA 1DOMA 4IUTA 2KOLA 2FFKB 3UI2A 1BO0A 2XIWA 1ESRA 1O7YA 1U4LA 1F2LA 4NW2A 4ZK9B 2L9HA 1HFNA 4IUVA 2HCIA 2CVRA 2K04A 3Q6SA 1Q3LA 1S4ZA 4RA8A 1DOLA 5T1GA 5D65A 4IUPA 2MP1A 2FHTA 4IURA 3I91A 1U4MA 5DNFA 2BDNA 1CA6A 2KUMA 2KEDA 2M2LA 1AP0A 4ZKCB 1DZ1A 1WD0A 1F9QA 2B2TC 1A15A 2SDFA 1WD1A 3I8ZA 3ONAB
chains in the Genus database with same CATH superfamily
2EZVA 1LTGD 5FJ8G 2QDLA 3S2HH 5C0XH 1HTPA 1T9HA 4C56C 3GTLB 4C3IG 4RHSA 4A3IB 2B2VA 3FP9A 1EY6A 4OL7A 4OXPA 3OPOA 1VQ5A 5M5YB 1U0LA 1K8GA 2RBMA 3NBIA 1AEXA 2R7ZG 3T1HQ 3VR6A 1Y1VH 3DM3A 1WFQA 1TIID 1ENFA 4O1NA 3ULPA 1QWYA 1D5XC 2BA1A 4A3CG 4KY6A 4J1MA 2Z4HA 1UAPA 1EWHA 1GUSA 1LACA 5IT9L 2NVXH 4MHEA 1KDBA 4YWMA 2K03A 3GDEA 2YU9H 2XRSD 1ZEQX 4C1NI 4C3HG 1YJWA 1XNRL 4FP5D 3RN2A 4L5SA 2RSNA 1JOQA 4R9WA 1S40A 2JA7H 1BCPB 3TMEA 3TREA 2F0OA 4R1JA 3CC2A 4C3HB 2ALYB 2K05A 2X6GA 4XQJA 2EDGA 1WVLA 3PO2G 1TWCB 2KJXA 3GTPB 4X62Q 4GOPA 1PYWD 5IWAL 1F2ZA 1LT4D 5C3EH 1D7QA 1WCMH 4KMUC 3HGBA 3PMFA 1M4VA 1SAPA 2L15A 2FMMA 2LFNA 1GUTA 4KHVA 4JBMA 1VQJA 3GO5A 2DJFC 1L1OB 1C8CA 2BCOA 3NWSA 1CHQD 1XMQQ 4A3IG 4MZ9A 3TP8A 1I6VC 2CW0D 4BWGB 3EVQA 1TWAH 3UE1A 5EGTA 4KJNA 2RHQB 4DR7Q 4HJ5A 1JE4A 3F2BA 4XTCS 3LGJA 3CCSA 3J80c 1PRTB 2A6ED 4JI3L 3VR2A 5GAGC 4K2KA 5I9OA 4A3GH 1EEID 4A3BB 5DLQE 1YNNC 4IUVA 3STBD 4UPAA 4KN4C 4BBRG 4X66Q 4KN7C 4DPGA 2VW9A 2IHEA 2M00A 3KLSX 3CXCA 5ELDA 4K2LA 2F4VL 1LTSD 1GXDC 1MJCA 1STYA 4JCVE 2MO1A 2WAQG 3RUZA 4GKKL 1IYJB 3DWAA 3K80C 4S3SA 1A3UA 1LO5D 1RJTA 2K32A 1K0SA 3HOUH 4ZAIA 4LUVA 5FO7B 2K01A 4HTHA 3M85A 2L4NA 1Q8IA 4JI3Q 1SR3A 1STAA 1I5FA 1PHJA 3PIOA 4JBKA 3CF5A 2MPMA 1KHIA 1XJVA 4A3BH 2IPKD 2B39A 5EPKA 2EJFC 3FVQA 1N34L 2ASBA 4DV4Q 2NN6H 3C1EA 4A3MB 3K5NA 2A1AA 1G2TA 4RH6A 3KF8B 1VQ7A 3HKSA 3BG3A 4DXFA 1RL2A 2RDHA 4ULLA 2JA6G 1SNCA 1JWMD 2MQHA 2F03A 4R4IA 3TBIB 3MXUA 1CZGA 3W1BA 3HS0C 1BVSA 5IWAQ 1DONA 1S5CD 2NB0A 2E2JB 3BDOA 1YEZA 3S16B 3DEOA 3FEWX 1Y8NB 1TQOA 1SNPA 1V1PA 1QNKA 1A6XA 1STBA 1PYBA 4IJHA 1BUVT 1A2UA 3I4MG 2R3ZA 4OWWB 1KC8C 4A93H 1V8QA 3B6YA 4YHHQ 1EEFD 1SYGA 2JA5G 4K8JA 1CKNB 1CA5A 4FO2A 4R8IA 3I4MB 3I4NH 3HOYH 4UP7A 4A3JG 3H3VC 4DR1L 1TWGH 5AJ3Q 2JA6B 5BN3A 2K75A 4A76A 2UUBQ 4UP8A 3FKIB 2PYKA 3CQZH 2R7FA 1GJXA 1DD2A 1B3QA 5T1GA 1FL0A 2FHTA 5DNFA 5IYDH 3UDXA 1CA6A 2WB1E 1A15A 3PQIA 2TSSA 3EBEA 2B2TA 3EROA 5M3MH 1IL8A 2F3WA 1YHQA 1XXGA 2JSOA 1GO3E 3I4MH 4JC0A 3H94A 2EJGC 5J1ZA 3GTKH 2NVTB 1EY0A 3R3OA 1TWGB 4J6HA 4HEDA 2OF1A 2K5QA 2BE5C 2CH4A 1PYSB 1G51A 1CTMA 3HOWH 5IP7H 2FXQA 3U58A 1LTBD 4ME5A 4DR5Q 2DNCA 4DV4L 5JEAH 2O2LD 1LM0A 4HMIA 2OXPA 4JI4L 4O42A 2NN6I 3CMEA 3I55A 4HSVA 5C4ZA 1N36Q 2BH2A 2SOBA 4QB4A 2EE1A 5DM73 4H13C 3K0YA 1HZCA 3U4ZA 1A0IA 4QUFA 3VA5A 5IYBG 3RLOA 3Q0AA 3QR8A 1E7ZA 4DK6C 3JAMi 4L63B 1N32Q 1Q8KA 1D6EC 1PH6A 3R2TA 4OGQC 5FO9B 1PH1A 1WJJA 1R4PB 1ET6A 2L0CA 2IJ0A 3S1RB 3J7AV 1CQFA 3TP6A 4V190 4E6IA 1AZPA 2R93B 3KUPA 3TQYA 2QF7A 5JVH3 2AHOB 1SNDA 3SVMA 2ID0A 3PIPA 1E2VA 1TWCH 4B3TL 4RGTA 2E8GA 3F1ZA 3GTPH 1CKOA 4JI5Q 2B2UA 1KQSA 1FNWA 5T1IA 4PZ8A 4CKCA 4JI2Q 1A3VA 3H6MA 3AFQA 3H0GG 3KBXA 1R9TH 1EIYB 4DV7Q 4BBSG 2HHHL 1S5BD 1ESFA 1PVOA 4AH6A 1WTWA 1UE1A 5EJWA 3PUVA 5IYCH 2N55A 3A55A 4JI6L 4IFDJ 4K0KL 1UE7A 2JA8G 1EY4A 3CPFA 4O2DA 2XIWA 1U4LA 2ES2A 2F0JA 1D8LA 4IO9A 2G9HD 1HXYD 5A2QL 3SK4A 3DMUA 2EYOA 5CV9A 2VZAA 1LT3D 1I50H 3VDYA 1S3OA 1F77A 1B3AA 1PH5A 1WI5A 2VQFQ 1C4QA 3KLRA 4YWLA 5IE8A 4LF4Q 2PQAB 1SE2A 3MTSA 2WP8J 1S5FD 3HZXA 3MC0B 1EYGA 2K4KA 4BY7G 3OSOA 2O5IC 1RD9D 3P7JA 4JI6Q 1O7ZA 2K1BA 4KKTA 5AJ3L 2F0KA 1B2TA 3H91A 1K3BC 1CM9A 2PW5A 2OTJA 2HHHQ 5E3FA 3FHWA 2F4IA 4UHVA 1STNA 4DV1L 1LV9A 3MEHA 4U68A 3CC7A 2Z1CA 1KL9A 1P16A 1TWHB 1SMYC 4KTAA 2IX0A 5IODA 4RWSC 4UP9A 1O80A 4A75A 2A5HA 3MXNA 5JEAJ 4OIJA 1YBYA 2B8FA 1JQYD 2F0WA 3FMCA 3R8BA 4HIDA 4FF3A 3S1QB 4DAPA 1X3PA 4NMZA 1K9MC 1BNZA 2VNUD 1HR0W 2KCNA 1PXUA 2Q2TA 4UY8C 1A62A 4JYAQ 1K8OA 4NB3A 1WTPA 1N32L 1SSOA 3QWNA 2KVMA 3LNNA 2L5TA 1TT2A 3E6ZX 3K58A 4QMGA 3T16A 4B9XA 4CBVA 2UU9Q 4BXXH 3DUZA 3Q23A 4X3UA 1STHA 2EYFA 4PV1C 2B2UC 5C4XB 4DA2A 5FLXE 1HR0L 2NBFA 3I3CA 4ZRZA 4A3DG 3ERQA 4CJ1B 3L3OC 4FF2A 1C0AA 4M8AA 4KJOA 4JI7Q 4FF1A 4A3JB 1NJIC 2F0HA 3CKIB 1DOMA 4LF6Q 2KOLA 3KDFA 1W2BA 1OXSC 4G7HC 3E5SA 4JW0A 2ZXRA 1DOLA 2JA5B 4IUPA 1I4GA 4LUZA 2KEDA 2WFWA 5TSSA 3MXNB 2D2CC 2B2TC 3SHLA 4DNRB 4X64Q 1EFWA 1NMGA 5D3DA 1QVGA 1XNQQ 2F0GA 2E5LL 3E0JA 3F2UA 2CH4W 5ELOA 1JOOA 3PGZA 1IBML 2MUYA 3NPPA 4A3GB 1FR3A 1Y8OB 1SYDA 4NXMQ 3DLLA 1PTOD 1SYCA 4A3EG 4AYBB 5H1SE 1Q86C 2R7DA 3VR3A 4ZYSA 5LMNL 1A8VA 3CRLC 4F88A 1NNXA 3VYSA 2B2YA 3LWUA 1X55A 4G57A 1Y1WG 4A3FH 2R92B 1VQHA 1EY7A 5JJZA 4N9TA 5IP7G 1HA5A 4A3DH 4QCLA 5KGUA 4ZLTF 1F2YA 5FLXL 4JI0L 2A69D 1TY2A 2E76C 1KAAA 1JT8A 1UWVA 1VQEA 3HOXG 3CCJA 1ENAA 2X69A 2I5HA 4DUYL 2GVAA 3D4DA 5EBCA 2XWJB 2XTIA 1V1OA 1I94Q 3AMUA 1H9RA 5I4DA 4DU9A 3K81C 1JICA 1IBLQ 4LFAL 1HA6A 2F0UA 4QQBX 4H0LC 1BCPD 4IUUA 1I94L 1NUCA 2KECA 1PRTD 3K7AB 4LF5L 4HN7A 2IX3A 4XT1B 4LUOA 2ZM6Q 4N8FA 4OO1I 2R93H 5GQOA 1LYLA 5EBDA 1U4PA 5ELBA 1TU2B 3M7GA 1AH9A 1DGSA 1V1QA 5COYA 2WB1G 2L1BA 4ID6A 5BN5A 2JE6I 2M9VA 1WTQA 1X3GA 1ASYA 2VUMH 1N34Q 1NBWA 2D5DA 3J81E 2A6EC 1EQQA 1KDCA 3S14H 4WORA 3W5OA 2Q2IA 3T1HL 2NVXB 1CI3M 1PTOF 2NN6G 1S72A 4IUTA 1LTTD 4A93G 1ESRA 4GLXA 2CHBD 2CVRA 2ZTCA 1A2TA 3WOFA 4JV5Q 3GTGH 1VCIA 2H5XA 1FYCA 4QY7A 1SFOH 4B3MQ 4GKJL 4H44C 5IGEA 3DWPA 1V1PB 2K5NA 2VL6A 2IWHA 1Y1WB 5M3FB 1XPOA 2DUDA 3V05A 2Q2HA 5K36G 2AMCB 1NCVA 2H4OA 1EU4A 3HOYG 3NQTA 2IT1A 3H3VI 1EQRA 2CKZB 2CW0C 1SE4A 3QO2A 3PF5A 3A5UA 3IAYA 3VR4A 2AKWB 3F8TA 2MGSA 3J80i 3PO2H 2O5JC 1WTXA 2PQEA 3GTMB 5BN4A 4K14A 2JXMB 4LF8Q 4L5RC 3SR1A 4AQYL 1EWIA 1F2MA 1FD7D 4XDXA 4X3TA 4WJ4A 4P75A 5E7NA 4XT3B 1AE3A 3C1FA 1PH8A 1NSNS 5KEEA 3ZYYX 2ZXPA 5C5LA 4QIWB 4LF9L 4HJ7A 4X3SA 2CQOA 2DJGC 3HKZE 4X65Q 4WJWA 2LXKA 4RHRA 2L12A 4KD4A 3F2CA 5M3FH 1XX8A 3K7UC 1BOSA 3KF6A 2EOTA 4A3DB 4DR6Q 4LMQD 3AQQA 1QVFA 4B3SL 4OELB 4BY1H 3TP7A 1X6OA 5EQ0A 3CMAA 5EAYA 2PPBC 5G3LF 5CBAE 1PRTC 1UUPA 4LFCQ 1VQBA 4DR4Q 1Z9FA 2OT2A 4GKJQ 5LMUL 2B29A 1FGUA 4C3IB 2I5MX 2EYMA 2EXZA 5EPLA 2I5LX 3A8KE 3OOCA 1XTDA 2UUAQ 1XMOL 2VQEQ 3FPPA 3HOVB 4P71A 3CCLA 2YYZA 3OHXC 4B3RL 1KLUD 2JA6H 2JEAI 1D5ZC 2PQAA 2YU9B 4GLAC 1FGBD 3BJUA 1II3A 2F0QA 1OO9B 4DKAC 4JI8L 2JJQA 1BO0A 4C3JG 4A3EB 1E1TA 4JBJA 3Q6SA 5JJLA 2J0TD 2K5DA 1VS0A 4A3JH 4BBRB 4OWXB 4JOIA 3GTJB 1K73C 1WOCA 3I73A 5IP9G 5I6YA 2K6AA 2NTSA 1X3EA 4FDBA 4DV2Q 4DV5L 4K5WA 2BDOA 4R4TA 1X56A 1EY9A 2ENBA 3HP3A 1SLJA 2E2HH 2J7ZA 4LWCA 1BKBA 3I72A 2JA7G 1IKMA 2VY3A 1DCZA 2YTXA 3G7LA 2HIXA 2B2YC 2LY7A 3ND9A 4NDXA 1KRSA 3X3MA 4ZUJA 5IOCA 3Q22A 4CGYB 2R6GA 1QUQB 3D6CA 1A3TA 2F3IA 2X6LA 5C4HA 3OTOQ 1LTID 3MXGA 1O7IA 3J81i 2YTVA 3OMGA 1IBKQ 2HUGA 3T1YQ 5ELCA 5F2DA 1LUZA 3K8AA 3BS1A 2RCFA 1O7LA 3D3RA 2HDLA 1QZHA 2XNAC 1UEAB 2BOSA 2F0DA 5JAVA 5C44H 3CW2C 4JI8Q 4BY7H 1QOHA 4NXML 1TS3A 4IFDI 5JPMC 2K28A 3SK6A 1WTVA 3GQBA 1B44D 2BE5D 3SEBA 4BBSH 1N9WA 2NTTA 3RZDB 2BH8A 4CJ2C 4LNQA 4B3RQ 4POFA 1NE3A 1BCPF 1Q1BA 4P2CB 2R92G 1YITA 2UUAL 1PH3A 3GD7A 2V4DA 2Y0SE 4L5QA 3NK9A 3TRZA 1B50A 1BBUA 4KKSA 1PH7A 3HOZB 1LTAD 1KTKA 3BYYB 4LFCL 3UE0A 3I70A 4ZUIA 1GVPA 1PH9A 1VMCA 4HR7B 3W2DA 3I4LA 2EY2A 1PH4A 5LMNW 3W3AA 4C2MH 4JI1Q 1N33Q 2J4XA 3HOXH 1SE8A 3MAQA 3VYTA 4BY1B 3BZDB 4KHPL 3UDFA 4DGZA 2K50A 4O0AA 1YHBA 3UI2A 3TSSA 4BBSB 3J80L 1Q90A 3L7ZC 1YI2A 3M3YB 3M4QA 1B9MA 3OMCA 3JAMc 3I91A 2PMZE 3PO3B 3T13A 2R7ZH 4MTKA 5M5XH 3W1GA 1MJEA 1EU3A 2NVQH 2D0PA 3MEFA 4N8X1 4PNYA 3PUZA 5C3XA 2JP1A 3G48A 2R93G 3IFDA 4RKBA 4A93B 2A19A 1PTOB 3KBGA 2D9UA 4HJAA 2K14A 3M4OH 1X3FA 2ZJPA 3S2HB 3PO2B 1IW7C 3RN5A 3STBC 4EQPA 1UE6A 1SRUA 2DY8A 4DR1Q 4K6LA 3L9AX 1ZKOA 1XPRA 1Q82C 1AW7A 1I6HH 3S17B 4IUQA 4XYOA 3KJPA 1VQ9A 1NR2A 1G8ZD 1QILA 1Y1VB 1U9RA 1VQDA 4YHHL 4DR2Q 2JN4A 4CDEC 1L1OC 1F9PA 3PIP3 2I0QA 1HPCA 1VF7A 3TZUA 3U4VA 1L0YB 1KDAA 2WACA 4LW1A 3FKIG 2NUCA 2A68D 3HFZB 4IOCA 5EKLA 1MI2A 3PUYA 2VS1A 1EY5A 1PFNA 3T1YL 1V9PA 1VQLA 4IN3A 3RMHA 1IYUA 3P1HA 4DV3L 1X9NA 1OXTA 3OTOL 4K6DA 4KY7A 1D1KA 3DM1A 1PFSA 5CBEE 2A74C 2ZM6L 2MNAA 4LF4L 1PA6A 1MSGA 2EYJA 2F0FA 2YV5A 4GNXA 2RSOA 3ICEA 2BA0A 4YCUA 1SNQA 1RKNA 3UDGA 4NXNL 1FJGQ 3ULJA 1QVCA 2LXJA 4A3KH 2EYPA 5IGFA 2B2WA 4IQZA 1YJ9A 5IT9c 1B4OA 1RODA 2EYLA 2B3GA 2F0MA 3A0JA 3ERSX 4NW2A 3NE5B 3CCUA 2HCIA 4A3KG 1O78A 1HZAA 5D65A 3BU2A 2KHIA 2KUMA 3DHQA 2KCTA 5IYCG 1WD1A 1H95A 1ICFB 4N9PA 1CZWA 2XVSA 1E2ZA 5L37A 3S1QH 4EQ5A 1C48A 3MFYA 3D0FA 1ILQA 4OO1H 5E4WC 2XRQD 4JI2L 3LX0A 1HRJA 1SN8A 1YNJC 4JI5L 5C44G 2Z6KC 2NVYH 4JG2A 4DV0L 1S5DD 1V43A 4IALA 1NTGA 2Z8LA 5CV7A 4M1UB 3OW2A 2F0TA 1UEBA 1XWEA 4LF7L 4C3JB 3BYTB 1PV4A 1VQKA 1KD1C 3T51B 5HURA 5IGBA 2PCFB 2ZJQA 3BVMA 4ZKBB 5LL6X 3CQZB 2IY5B 1RTNA 1HNZQ 4P74A 1UNSA 1D2BA 4OX9L 5KYIA 1I4QA 4P73A 1VQNA 4X3KA 4ZCKA 4WRDA 4DF7A 5ELFA 2JA5H 5KRUA 2OCEA 1Z47A 4X65L 1XPUA 3P20A 1VQCA 4DV6L 4YY3Q 2F0EA 2AQ1B 3KOJA 3D4WA 3CCRA 1SYBA 1WYDA 1YHAA 1OXXK 4Q5VA 2H1EA 2RCNA 3G6EA 4DFAA 4AQYQ 3TN2A 2F1MA 5CV6A 1JB7A 2E2JH 2UU9L 2IX1A 4RGOS 1MSHA 1XNRQ 1KNAA 3CP0A 1RF2D 3A8JE 3BDCA 3RLNA 2PZUA 1B8AA 1BR9A 1KIXA 3MXPA 1B9NA 3A7AB 2VUMB 4DUZL 1X54A 3S24A 1EIGA 2HD3A 1L0WA 1Z7TA 2EJMA 1QCBD 1A63A 2L55A 3MFGA 1STGA 4CDCC 3D8GA 3PUXA 1O7YA 1Q7YC 3A74A 4GN3B 3V2TA 1Q3LA 1IL2A 1H9KA 5JEAG 3GTLH 2TMPA 2UUBL 2SNMA 3OIQA 1F9QA 2HQEA 1H9MA 1Q81C 3VR5A 2QA4A 3H0GB 2I46A 4A3FG 4ILWA 1J8IA 5FO8B 3DEPA 3K59A 2HCCA 3WDNA 2UXBL 3I4OA 1HJPA 3S15H 3J81L 4PG3A 2NYZD 1UE5A 2Q8IB 1E24A 4KK7A 2V1CC 2KEEA 1PH2A 2N78A 1CFMA 4TRDA 2OTLA 2YTYA 2QGQA 2PZTA 5EKIA 1K83H 4FXGC 3QOJA 2MO0A 4FXDA 4PQXA 4K8IA 3SXHA 1PDQA 3BZKA 1NY4A 2R61A 2UXCQ 1VQMA 1EQVA 4JPBW 3KLWA 3AEVA 1K0RA 3HOWB 3H0GH 3MWYW 1U4RA 1PZJD 4Z9CB 2WB1B 3HOUG 1EL0A 1K28A 3GTGB 4XYQA 5CV4A 3QIAA 3PSIA 4CKEA 2N3SA 3J7A5 1RHPA 3R2IA 2Z9HA 1H9SB 2VB2X 3A5ZB 1HH2P 4DV6Q 3PO3G 1TVXA 4MN3A 1J5EL 4L6TB 5C0XI 2CWAA 3SK8A 3S2DB 4GN5A 4GOPC 1EYDA 1M90C 1C7YA 4RKLA 3FDTA 5CMDA 4OX9Q 1ILPA 1F9SA 1ZXTA 3H3VH 1X65A 3U50C 2K7VA 1RDPD 4DR4L 4X6AH 3NWTA 3Q8DA 2K5WA 3PIO3 3V96A 5A2QE 2E5LQ 4RCNA 3I7FA 1YJNA 1GM5A 2F4VQ 2R7ZB 3H15A 1XNQL 1HFGA 2JEBI 2B63B 2A8VA 2NWGA 1B53A 2B2WC 4J15A 4NPSA 1VQ8A 4BBRH 2A68C 2CCZA 1HFNA 1JJGA 4HSPA 3KJOA 4LF6L 5M3MB 3CU7A 3WWVA 3SDZA 4G7OC 5FK9C 4DAYB 4HIOA 4J8QA 1MBYA 2UXCL 3BZCA 4FNFA 1IXRA 4DK0A 5CYUA 3QB3A 1TS2A 3O13A 4YIJA 4A3IH 4NXNQ 3T4AC 2DN8A 1JC7A 1STEA 4DAYA 4LFBQ 3K5LA 1AN8A 2XSCA 3HEJA 1I4HA 4OONA 5DEHA 5GAEC 3NEMA 5C5MA 1JR0D 5ELEA 1W6KA 1HNXQ 2NZHA 1LTRD 5GROA 5LL6S 4R8NA 4QF4A 2VXWA 1TKWB 1AE2A 1E2WA 1OTCA 2NVYB 4NKLA 4F87A 1PFMA 3CD6A 1AFPA 1BXTA 3HOZH 2A6HC 4LAAA 1L1OA 5KNDA 1JCKB 1R4QB 2N88A 3TS0A 5C44B 4DR3Q 4JV5L 2WINB 4QUCA 1TWAB 1SFOB 2UUCQ 2D0OA 3BVZA 2QCPX 1ZYRC 5I6WA 4IPGA 4A3EH 1GKHA 4TQUS 1I6HB 2SEBD 2VB3X 3RZDH 3ZJYC 5IGDA 1EOTA 4KI0A 2PW7A 1NR4A 1ICWA 5I9PA 4DUZQ 5C4JH 5C3EB 3HKZG 3PO3H 1G6ZA 1T5XD 5ELNA 2FMCA 3S1MB 5KYLA 5CGKA 1LLRD 4IJLA 4R4OA 3K6OA 4ABNA 5K5PA 4DXGA 2LS01 5A35A 2PI2E 3S9WA 3HKZB 2E2DC 2HIVA 2F0PA 3RD4A 1NAPA 3UDIA 1KNEA 4DN4M 5HGTA 2RVLA 3CPWA 4C2MB 1CK1A 1SJHD 4K5VA 2QW7A 1I4XA 1EIHA 1SJED 4RG1A 5M9OA 4LFAQ 3L0OA 2ZTEA 4IOAA 1JORA 1HNXL 5CV8A 3EQLC 4RGNA 3M3YH 2MHVA 1HNWL 1MKHA 3U9SA 1F2LA 1B1ZA 4G7ZC 4RA8A 3CCVA 3NBHA 1Y8PB 2Q2UA 2GA4B 1DJRD 1DYQA 1U4MA 3RR5A 2M2LA 5J39A 4I7ZC 1OXVA 4MIUA 1WCMB 1FVIA 3KDFB 4H02A 1C9OA 1DOKA 2XGTA 1HUNA 1CKNA 3OW7A 2ZXOA 1VQAA 3AU7A 2AQ3B 3HRZC 3MHBA 3IFTA 3E9HA 3MVVA 4P72A 5JVG3 1E22A 1I3QH 1VQ4A 1H9JA 5BR8Q 3EFXD 2NZOA 4B3TQ 3J80E 1S5ED 3EIVA 4IPHA 4QGUA 1GOZA 1K8MA 3BVGA 4GS3A 4IUNA 4GNXB 2K33A 3FPUB 2ZJRA 4UAIA 1LTLA 3E9IA 3KK7A 1DM0B 1EYCA 3WOEA 1G91A 2NZ1D 2PZWA 3M4PA 2PNRC 3HOXB 2WIIB 1TY0A 1AZQA 2KHSA 3TS2A 5CC4A 4DV0Q 2E74C 5HY6A 1GHJA 4Y7NH 3IRBA 3C2PA 3PV0A 2AUKA 3IL8A 1VQFA 3J7AF 1SMYD 1Y1VG 1J5EQ 4EQOA 1IYVA 1L0XB 4U673 4DR5L 3NBHB 2C9OA 4H7BA 3GTJH 3SE0A 4BA1I 1EOVA 4OHJA 4MTNA 3RZOB 3QG1A 1Q1EA 5JOBA 1L2FA 2UUCL 1GHKA 3G4SA 3EA6A 4PMWA 4DR3L 3QOLA 3NTIA 3GV6A 3G71A 3M4OB 5J22A 4R4CA 2E2HB 3BDLA 4JYAL 2WV6D 1PMRA 1D5MC 1VQGA 4DV2L 5IY0A 4ME3A 2AUJD 3U9OA 2N49A 1TS5A 4HAEA 1TS4A 2RKSA 2O4XA 1Z6HA 5KNCA 2HQLA 3S17H 2Z6BA 2FFKB 1KLGD 4JBWA 1S4ZA 4IURA 3C46A 1DZ1A 2BDNA 4TKOB 1CSPA 4GZYC 3S14B 1G6PA 2ICIA 4OEMB 2SDFA 1E1OA 2EIFA 1TWFB 1ZYRD 3JC66 2HDMA 3M4YA 4FYDA 4HMJA 4DK3C 3CC4A 5DM63 5FJ8H 4RMFA 3GTKB 1I4RA 2VQEL 1JWUD 4B9WA 3NSWA 5LMNQ 1HZBA 5FLMH 1X32A 2B63G 4A3LG 1CT1D 3EN2A 4ALPA 1LABA 3MZ5A 4I65A 3FKIH 1QB5D 1FNVA 1CQVA 3VYRA 2KCCA 5FKAC 1F9RA 4A3MG 4KV6A 1YNXA 1CUKA 2EXDA 3JAME 1XTCD 3A8IE 3SGIA 1SROA 4EQNA 2KA7A 3HOVG 3E3XA 1Y14B 1GUGA 1GUOA 4KKUA 3ER0A 1CKMA 1VQIA 3I90A 1ONLA 5IGCA 1IHZA 4RCOA 1ENCA 3TP5A 3GP7A 1ASZA 1HUMA 4GLVB 4LF9Q 4B3SQ 1WTOA 5IP9H 1EIFA 5D3IB 5IT9E 2AQ2B 1Q46A 1WTRA 4LF8L 1NMFA 2KHJA 1J9OA 1G2SA 1HNWQ 2OQ0A 3S15B 3KFUA 4KHPQ 2B8GA 2OEOA 5KNBA 1KAWA 2MJ8A 3IKJA 5EPJA 5CV5A 2RHSB 1M1KC 4JI1L 1N33L 4HCSA 1YVCA 2JK8A 4PMBA 2Y0SG 3C3LA 1EQTA 2C5CA 1W6JA 4POGA 3OWEB 5CORA 3CHBD 1LT6D 1IZ6A 2FINB 5IYDG 4B3ML 4CHTB 1MGSA 1D1IA 4X66L 1JB3A 4A4IA 1KRTA 3VA7A 4JOIC 1SE3A 3RLFA 2PO4A 4C3JH 5M5WH 1PZID 1CHPD 1VQPA 1AP0A 4KD3A 2F0LA 4APVA 1HQMC 5IIFA 3S16H 4C1NK 1B7YB 2EYHA 4JI4Q 3GTOB 2CWPA 2K5HA 1WCMG 1H9SA 1XYIA 2G9DA 3S1RH 4DAVA 2ATWA 3S1NH 2WKCA 3HOYB 2WAQB 4A3LH 1R9TB 3NTHA 2IHFA 4FXKC 3PUWA 3DXJC 4KHZA 5K36H 5C4XG 3R93A 1G291 4CDDC 3KF6B 3NUCA 3S2DH 1QZGA 2DY7A 2PI2A 3K57A 1U5KA 2JA8H 3G6JB 4AYBE 4DK1A 2LSSA 5M5WB 1PFBA 1ET9A 3AFPA 1EZ8A 5C6AA 4BS9A 4G4KA 4EGVA 1HHVA 2G5DA 3AB9A 3I2ZA 3GTOH 2Q8TA 1CSQA 4R4QA 3KF8A 3HOZG 4LFBL 2NVTH 3D4RA 1SMXA 3NTKA 3CCEA 3X3NA 2SNSA 2OWOA 1HZ9A 2EPBA 4V0BA 4DV5Q 5EKKA 4IFDH 5JJKA 3TDQA 4OO1G 1YNJD 2A69C 1SYEA 4C3IH 4DV7L 2AWNA 4KY5A 3URYA 4FF4A 2F3VA 5C0XG 2HT1A 4XQNA 3L2PA 1Y69U 2LMCB 3NQIA 3ND8A 4A3GG 4BY1G 5C4XH 5LMUQ 4PZ7A 1SBBB 2RA4A 4JI0Q 1ML0D 3GTQB 4OWTB 5LHY1 4WFN3 4GKKQ 4YWKA 2VUMG 4GNXC 5I2YA 5D14A 1SYFA 1JE5A 4XIGS 2CQAA 4QJFA 1IKLA 4PZ6A 1QE6A 1PTOC 2F0NA 3CCMA 5C3WA 2P5ZX 1SEBD 1KABA 1EY8A 4HCEA 3HOWG 4F8MA 3ITPA 3I56A 1K83B 1BCPC 1QUQA 3DWQA 5C3EG 3Q24A 2XN9C 4DNTB 4ZKCB 3I4NG 1PZKD 2KQ3A 4LK1C 3ONAB 1IBMQ 3GTMH 3NP8A 1TXYA 4JK1C 1P8LA 5DAUA 1E3PA 1MD2D 5GAHC 3FRPB 1LT5D 4TSSA 5M3MG 3OYYA 3KLSA 2B2VC 1MHWC 4QL5A 5GADC 2Z4IA 1JMCA 1VMPA 5C0XJ 3SK5A 3A54A 1QJOA 1BDOA 2XWBB 3K5MA 2IL8A 4CDFC 2WKDA 1EYAA 4A3KB 2Z0SA 4X62L 4B08A 2LKVA 1HCZA 1PTOH 2PNHA 2WAQE 1HR0Q 4YCWA 3K0XA 4K5XA 4GOPB 3OWFA 5FLXc 2KBNA 4LF7Q 3H09A 1I50B 2RDFA 4RFBA 4HIKA 2JA8B 5FLMG 2B63H 2QEXA 5J3BA 3PF4A 4NP5A 2PMZB 1YIJA 3JAML 2GVBA 2UXBQ 2E75C 4DR7L 3NENA 3D31A 4A3MH 4DNIA 1Q12A 1TR5A 4BY7B 2F0VA 4ODGA 2L11A 3S1MH 3OIPA 4FVMA 1BBWA 2I07B 4A3FB 1PRTF 4Y7NB 1YNND 4XQQA 1SNMA 1IW7D 3J7YW 3NELA 4DV1Q 2RDGA 4UDUC 2E2IB 5M3FG 2UXDQ 3CAMA 5JPNC 4QIWE 3A56A 1TWHH 3EJIA 3D6WA 4Q0FA 1K3RA 4MNOA 4ZQ3A 1IBKL 1RTOA 5AFWA 3NXWA 1HQRD 4RAUC 2DGYA 4A3BG 2EVBA 4DAMA 2QKIC 4Y52H 2IW3A 5ISRA 5IYBH 3GTQH 4KLKA 3P75A 4ZK9B 1J6QA 4DUYQ 3N6RA 4F7XA 1SNOA 3F2DA 3J81j 2VQFL 4LF5Q 4JVZA 4EVOA 1FNUA 1Y1WH 4K0KQ 5G3LD 2RQXA 1VQOA 1VQ6A 3K7AH 3I8ZA 1KXLA 2JQOA 5KIXA 4BA2I 1E0BA 2K5VA 4YY3L 3VYUA 1MIUA 1JJ2A 3GV3A 1GUNA 2E2IH 1IBLL 2ZT9C 5E4XA 2UXDL 3K5OA 4CKBA 2Z6KA 4EX5A 2QDBA 2NVQB 3J81c 3CCQA 1BQQT 2MFIA 2FJ2A 2JA7B 4DR2L 1HNZL 1TWFH 3T56B 1PLFA 2ICEC 2K52A 4YCVA 5CR3A 2QEJC 4CJ0B 5C4JB 1DXMA 3HG9A 2QILA 1N8RC 1QG7A 4RGMA 1K8AC 2KCMA 3HOVH 3PCOB 3QJYA 4I7AA 5HGQA 2ZTDA 1RIPA 2DNEA 2Y0SB 4C3HH 1XMOQ 3TZDA 2EQSA 1B70B 2CFMA 5FOBB 1EUJA 5BR8L 3LWEA 1BBXC 4IZ8A 1T5EA 2C35B 2D62A 4L5TA 1GUWA 2KENA 1JWSD 3A7LA 4TVAB 1VDZA 2RF4A 3T53B 3RNUA 3N52A 1YZ6A 3KYHC 1N36L 4HJ8A 1VF5C 1QNUA 4XXEA 4BXXG 1SXTA 1X3QA 1XMQL 2EY1A 3MA2B 2EY6A 2R92H 2JA9A 4X64L 3RZOH 4DR6L 1I4PA 4OIKA 3M7NA 5E1FA 5NUCA 1GD7A 1WTHA 2JYOA 4IPCA 3I4NB 3TEHB 2EY5A 4AIMA 1RCVD 2F0IA 1EZ6A 4IPDA 1BF4A 1W3SA 4HJ9A 4JI7L 4IFDG 1SDFA 2Q8RE 2GN5A 4GN4B 5I2XA 1FJGL 1JJCB 1OXUA 2AWOA 5M5YH 5JJIA 3E0EA 4A3CH 3HOUB 3AYHB 4HIMA 1I3QB 1M8AA 1EWCA 5M5XB 4LJZC 2N8NA 2F0SA 2A6HD 4PMCA 1JOKA 2F52A 2OQKA 3NHHA 3ULLA 3S1NB 3M9BA 4L8JA 2L9HA 3J7ZC 4WJ3M 2K04A 2A73B 2MP1A 3CRKC 5IGGA 1HTLD 1EFID 1WD0A 4DV3Q 4AYBG
chains in the Genus database with same CATH topology
2EZVA 1LTGD 5C0XH 1HTPA 4C56C 3GTLB 4C3IG 4RHSA 4A3IB 2B2VA 1EY6A 4OL7A 3OPOA 5M5YB 2RBMA 3NBIA 1AEXA 3VR6A 1TIID 1ENFA 4O1NA 1QWYA 1D5XC 2BA1A 4KY6A 4J1MA 2Z4HA 1UAPA 1EWHA 1GUSA 1LACA 5IT9L 4MHEA 1KDBA 2K03A 2XRSD 1ZEQX 4C1NI 4C3HG 4FP5D 2RSNA 1JOQA 4R9WA 1BCPB 3TMEA 2F0OA 4C3HB 2X6GA 2K05A 4XQJA 2EDGA 1WVLA 1TWCB 2KJXA 3GTPB 1PYWD 1F2ZA 1LT4D 4KMUC 3HGBA 3PMFA 1M4VA 1SAPA 2FMMA 2LFNA 1GUTA 4KHVA 3GO5A 1C8CA 2BCOA 3NWSA 1CHQD 3TP8A 1I6VC 2CW0D 4BWGB 3EVQA 5EGTA 4KJNA 1JE4A 4XTCS 1PRTB 2A6ED 3VR2A 4K2KA 5I9OA 1EEID 4A3BB 1YNNC 4IUVA 4KN4C 4KN7C 2M00A 3KLSX 5ELDA 4K2LA 1LTSD 1GXDC 1STYA 3RUZA 3DWAA 4S3SA 1A3UA 1LO5D 1RJTA 2K32A 4ZAIA 5FO7B 2K01A 4HTHA 3M85A 2L4NA 1Q8IA 1STAA 2MPMA 2IPKD 2B39A 5EPKA 2EJFC 3FVQA 2NN6H 3C1EA 4A3MB 3K5NA 1G2TA 4RH6A 4DXFA 3BG3A 2RDHA 4ULLA 1SNCA 1JWMD 2F03A 3TBIB 3MXUA 1CZGA 3HS0C 1DONA 1S5CD 2NB0A 2E2JB 3BDOA 3S16B 3DEOA 3FEWX 1Y8NB 1TQOA 1SNPA 1V1PA 1QNKA 1A6XA 1STBA 1BUVT 1A2UA 2R3ZA 1V8QA 1EEFD 1SYGA 4K8JA 1CA5A 4FO2A 4R8IA 3I4MB 3H3VC 2JA6B 5BN3A 3FKIB 2PYKA 1GJXA 1DD2A 5T1GA 2FHTA 5DNFA 1CA6A 1A15A 2TSSA 2B2TA 3EROA 1IL8A 2F3WA 1XXGA 2JSOA 3H94A 2EJGC 5J1ZA 2NVTB 1EY0A 3R3OA 1TWGB 4J6HA 4HEDA 2OF1A 2K5QA 2BE5C 1CTMA 1LTBD 4ME5A 2DNCA 5JEAH 2O2LD 4HMIA 2OXPA 4O42A 2NN6I 4HSVA 5C4ZA 2SOBA 4QB4A 2EE1A 5DM73 4H13C 3K0YA 4QUFA 3VA5A 3Q0AA 4L63B 1D6EC 3R2TA 4OGQC 5FO9B 1R4PB 1ET6A 2L0CA 2IJ0A 3S1RB 3J7AV 1CQFA 3TP6A 4V190 4E6IA 1AZPA 2R93B 3KUPA 2QF7A 5JVH3 1SNDA 3SVMA 2ID0A 1E2VA 4RGTA 2B2UA 1FNWA 5T1IA 4CKCA 1A3VA 3H6MA 3KBXA 1S5BD 1ESFA 1WTWA 5EJWA 3PUVA 2N55A 3A55A 4IFDJ 1EY4A 2XIWA 1U4LA 2F0JA 2G9HD 1HXYD 5A2QL 3SK4A 3DMUA 2EYOA 5CV9A 1LT3D 1F77A 1B3AA 1C4QA 3KLRA 1SE2A 3MTSA 2WP8J 1S5FD 3HZXA 3MC0B 2O5IC 3OSOA 1RD9D 3P7JA 1O7ZA 2K1BA 4KKTA 2F0KA 1B2TA 3H91A 1CM9A 2PW5A 5E3FA 2F4IA 1STNA 1LV9A 3MEHA 4U68A 2Z1CA 1TWHB 1SMYC 4KTAA 2IX0A 5IODA 4RWSC 1O80A 2A5HA 3MXNA 5JEAJ 4OIJA 2B8FA 1JQYD 2F0WA 3FMCA 3R8BA 4FF3A 3S1QB 4DAPA 1X3PA 4NMZA 1BNZA 2VNUD 2KCNA 1PXUA 1K8OA 1WTPA 1SSOA 3QWNA 2KVMA 3LNNA 2L5TA 1TT2A 3E6ZX 3K58A 4QMGA 3T16A 4B9XA 4CBVA 3DUZA 3Q23A 4X3UA 1STHA 2EYFA 4PV1C 2B2UC 5C4XB 4DA2A 5FLXE 2NBFA 3I3CA 4ZRZA 3ERQA 4CJ1B 3L3OC 4FF2A 4M8AA 4KJOA 4FF1A 4A3JB 2F0HA 3CKIB 1DOMA 2KOLA 1OXSC 4G7HC 3E5SA 2ZXRA 1DOLA 2JA5B 4IUPA 1I4GA 2KEDA 5TSSA 3SHLA 2D2CC 2B2TC 4DNRB 5D3DA 2F0GA 3E0JA 3F2UA 1JOOA 2MUYA 3NPPA 4A3GB 1FR3A 1Y8OB 1SYDA 1PTOD 1SYCA 4AYBB 3VR3A 4ZYSA 3CRLC 4F88A 3VYSA 2B2YA 3LWUA 4G57A 2R92B 1EY7A 5JJZA 4N9TA 1HA5A 4QCLA 5KGUA 4ZLTF 1F2YA 5FLXL 2A69D 1TY2A 2E76C 1KAAA 1ENAA 2X69A 3D4DA 5EBCA 2XWJB 1V1OA 3AMUA 1H9RA 5I4DA 4DU9A 1HA6A 1JICA 2F0UA 4H0LC 1BCPD 4IUUA 1NUCA 2KECA 1PRTD 3K7AB 4HN7A 2IX3A 4XT1B 4OO1I 5EBDA 1U4PA 5ELBA 1TU2B 3M7GA 5COYA 2L1BA 4ID6A 5BN5A 2JE6I 2M9VA 1WTQA 2D5DA 3J81E 2A6EC 1KDCA 4WORA 2NVXB 1CI3M 1PTOF 2NN6G 4IUTA 1LTTD 1ESRA 2CHBD 2CVRA 3WOFA 1A2TA 1VCIA 1FYCA 4H44C 5IGEA 3DWPA 1V1PB 2IWHA 1Y1WB 5M3FB 3V05A 5K36G 1NCVA 2H4OA 1EU4A 3NQTA 2IT1A 2CW0C 3IAYA 3QO2A 1SE4A 3VR4A 2MGSA 2O5JC 1WTXA 2PQEA 3GTMB 5BN4A 4K14A 2JXMB 3SR1A 1F2MA 1FD7D 4XDXA 4X3TA 4XT3B 3C1FA 1NSNS 5KEEA 3ZYYX 2ZXPA 5C5LA 4QIWB 4X3SA 4WJWA 4RHRA 2L12A 4KD4A 1XX8A 1BOSA 2EOTA 4A3DB 4LMQD 3TP7A 5EQ0A 2PPBC 5G3LF 5CBAE 1PRTC 1UUPA 2OT2A 4C3IB 2EYMA 2EXZA 5EPLA 3A8KE 3OOCA 3FPPA 3HOVB 2YYZA 3OHXC 1KLUD 2JEAI 1D5ZC 2YU9B 1FGBD 1II3A 2F0QA 1OO9B 1BO0A 4C3JG 4A3EB 3Q6SA 2J0TD 2K5DA 4BBRB 3GTJB 3I73A 5I6YA 2K6AA 2NTSA 4K5WA 2BDOA 1EY9A 2ENBA 3HP3A 2J7ZA 3I72A 1IKMA 1DCZA 3G7LA 2B2YC 3Q22A 2LY7A 3ND9A 4NDXA 3X3MA 4ZUJA 5IOCA 4CGYB 2R6GA 3D6CA 1A3TA 2X6LA 5C4HA 1LTID 3MXGA 3OMGA 2HUGA 5ELCA 5F2DA 3BS1A 1O7LA 3D3RA 2HDLA 2XNAC 1UEAB 2BOSA 2F0DA 5JAVA 1QOHA 1TS3A 4IFDI 5JPMC 2K28A 3SK6A 1WTVA 3GQBA 1B44D 3SEBA 2BE5D 2NTTA 3RZDB 4CJ2C 1BCPF 1Q1BA 4P2CB 3GD7A 2V4DA 3NK9A 1B50A 4KKSA 3HOZB 1LTAD 1KTKA 3BYYB 3I70A 4ZUIA 1VMCA 4HR7B 3W2DA 3I4LA 2EY2A 3W3AA 2J4XA 3MAQA 3VYTA 4BY1B 3BZDB 4DGZA 3UI2A 3TSSA 4BBSB 3J80L 1Q90A 3L7ZC 3M3YB 1B9MA 3OMCA 3I91A 3PO3B 3T13A 1EU3A 4PNYA 3PUZA 5C3XA 2JP1A 3IFDA 4RKBA 4A93B 1PTOB 3KBGA 2D9UA 3S2HB 3PO2B 1IW7C 4EQPA 2DY8A 4K6LA 3L9AX 1ZKOA 1AW7A 3S17B 4IUQA 4XYOA 1NR2A 1G8ZD 1QILA 1Y1VB 1U9RA 1F9PA 3PIP3 1HPCA 1VF7A 3TZUA 1L0YB 1KDAA 2WACA 2NUCA 2A68D 5EKLA 1MI2A 3PUYA 1EY5A 1PFNA 4IN3A 3RMHA 1IYUA 3P1HA 1OXTA 4K6DA 4KY7A 1D1KA 3DM1A 5CBEE 2A74C 1MSGA 2EYJA 2F0FA 2RSOA 2BA0A 1SNQA 1RKNA 2EYPA 5IGFA 2B2WA 4IQZA 1B4OA 1RODA 2EYLA 2F0MA 4NW2A 3NE5B 2HCIA 1O78A 5D65A 2KUMA 3DHQA 1WD1A 4N9PA 1CZWA 2XVSA 1E2ZA 1C48A 3MFYA 1ILQA 4OO1H 5E4WC 2XRQD 3LX0A 1HRJA 1YNJC 1S5DD 1V43A 4IALA 2Z8LA 5CV7A 4M1UB 2F0TA 1XWEA 4C3JB 3BYTB 3T51B 5HURA 5IGBA 2PCFB 3BVMA 4ZKBB 5LL6X 3CQZB 1RTNA 1UNSA 1D2BA 5KYIA 1I4QA 4X3KA 4WRDA 4DF7A 5ELFA 5KRUA 1Z47A 3P20A 2F0EA 2AQ1B 3D4WA 1SYBA 1OXXK 4Q5VA 2H1EA 4DFAA 3TN2A 2F1MA 5CV6A 2IX1A 4RGOS 1MSHA 1KNAA 1RF2D 3A8JE 3BDCA 2PZUA 1BR9A 3MXPA 1B9NA 3A7AB 2VUMB 1EIGA 1Z7TA 2EJMA 1QCBD 2L55A 3MFGA 1STGA 3D8GA 3PUXA 1O7YA 3V2TA 1Q3LA 1H9KA 5JEAG 2TMPA 2SNMA 3OIQA 1F9QA 2HQEA 1H9MA 3VR5A 3H0GB 2I46A 4ILWA 1J8IA 5FO8B 3DEPA 3K59A 2HCCA 3WDNA 3J81L 2NYZD 2Q8IB 4KK7A 2KEEA 1CFMA 4TRDA 2PZTA 5EKIA 4FXGC 3QOJA 4FXDA 4PQXA 4K8IA 3SXHA 1PDQA 2R61A 1EQVA 3HOWB 3MWYW 1U4RA 1PZJD 4Z9CB 2WB1B 1EL0A 3GTGB 4XYQA 5CV4A 3QIAA 4CKEA 1RHPA 3R2IA 1H9SB 2VB2X 1TVXA 4MN3A 4L6TB 5C0XI 3SK8A 3S2DB 1EYDA 4RKLA 3FDTA 5CMDA 1ILPA 1F9SA 1ZXTA 2K7VA 1RDPD 3NWTA 2K5WA 3PIO3 3V96A 5A2QE 4RCNA 2R7ZB 1HFGA 2JEBI 2B63B 2NWGA 1B53A 2B2WC 2A68C 1HFNA 4HSPA 5M3MB 3CU7A 3SDZA 4G7OC 5FK9C 4J8QA 1MBYA 4FNFA 4DK0A 5CYUA 3QB3A 4YIJA 1TS2A 3O13A 3T4AC 2DN8A 1JC7A 1STEA 4DAYA 3K5LA 1AN8A 2XSCA 3HEJA 1I4HA 5DEHA 5C5MA 1JR0D 5ELEA 1W6KA 1LTRD 5LL6S 4R8NA 4QF4A 2VXWA 1TKWB 1E2WA 2NVYB 4NKLA 4F87A 1PFMA 1AFPA 1BXTA 2A6HC 4LAAA 5KNDA 1JCKB 1R4QB 2N88A 5C44B 2WINB 4QUCA 1TWAB 1SFOB 3BVZA 2QCPX 1ZYRC 5I6WA 4TQUS 1I6HB 2SEBD 2VB3X 5IGDA 1EOTA 4KI0A 2PW7A 1NR4A 1ICWA 5I9PA 5C3EB 1G6ZA 1T5XD 2FMCA 3S1MB 5KYLA 5CGKA 1LLRD 3K6OA 4ABNA 5K5PA 4DXGA 2LS01 5A35A 3S9WA 3HKZB 2E2DC 2F0PA 3RD4A 1NAPA 1KNEA 4DN4M 5HGTA 2RVLA 4C2MB 1CK1A 1SJHD 4K5VA 1I4XA 1EIHA 1SJED 5M9OA 1JORA 5CV8A 3EQLC 4RGNA 2MHVA 3U9SA 1F2LA 1B1ZA 4G7ZC 4RA8A 3NBHA 1Y8PB 2GA4B 1DJRD 1DYQA 1U4MA 5J39A 2M2LA 4I7ZC 1OXVA 4MIUA 1WCMB 1DOKA 1HUNA 3OW7A 2ZXOA 3AU7A 2AQ3B 3HRZC 3MHBA 3IFTA 3MVVA 5JVG3 1H9JA 3EFXD 3J80E 1S5ED 1GOZA 1K8MA 3BVGA 4IUNA 2K33A 3FPUB 4UAIA 3KK7A 1DM0B 1EYCA 3WOEA 1G91A 2NZ1D 2PZWA 2PNRC 3HOXB 2WIIB 1TY0A 1AZQA 2KHSA 5CC4A 2E74C 1GHJA 3C2PA 3PV0A 2AUKA 3IL8A 3J7AF 1SMYD 4EQOA 1IYVA 1L0XB 4U673 2C9OA 4H7BA 3SE0A 4BA1I 4OHJA 3RZOB 3QG1A 1Q1EA 5JOBA 1GHKA 3EA6A 4PMWA 3QOLA 3NTIA 3GV6A 3M4OB 5J22A 2E2HB 3BDLA 2WV6D 1PMRA 1D5MC 2AUJD 3U9OA 1TS5A 4HAEA 1TS4A 2RKSA 2O4XA 1Z6HA 5KNCA 2FFKB 1KLGD 4JBWA 1S4ZA 4IURA 3C46A 1DZ1A 2BDNA 4TKOB 4GZYC 3S14B 2ICIA 2SDFA 1TWFB 1ZYRD 2HDMA 3M4YA 4FYDA 4HMJA 5DM63 3GTKB 1I4RA 1JWUD 4B9WA 3NSWA 1X32A 1CT1D 1LABA 3MZ5A 4I65A 1QB5D 1FNVA 1CQVA 3VYRA 2KCCA 5FKAC 1F9RA 4KV6A 3JAME 1XTCD 3A8IE 4EQNA 2KA7A 1GUGA 1GUOA 4KKUA 3I90A 1ONLA 5IGCA 1IHZA 4RCOA 1ENCA 3TP5A 3GP7A 1HUMA 1WTOA 5D3IB 5IT9E 2AQ2B 1WTRA 1J9OA 1G2SA 3S15B 2B8GA 2OEOA 5KNBA 2MJ8A 3IKJA 5EPJA 5CV5A 4HCSA 4PMBA 3C3LA 1EQTA 2C5CA 1W6JA 3OWEB 5CORA 3CHBD 1LT6D 2FINB 4CHTB 1MGSA 1D1IA 1JB3A 3VA7A 1SE3A 3RLFA 2PO4A 1PZID 1CHPD 1AP0A 4KD3A 2F0LA 1HQMC 5IIFA 4C1NK 2EYHA 3GTOB 1H9SA 1XYIA 2G9DA 4DAVA 2WKCA 3HOYB 2WAQB 1R9TB 3NTHA 4FXKC 3PUWA 3DXJC 4KHZA 5K36H 3R93A 1G291 3NUCA 2DY7A 3K57A 3G6JB 4DK1A 5M5WB 1PFBA 1ET9A 1EZ8A 5C6AA 4BS9A 4G4KA 4EGVA 1HHVA 3AB9A 2Q8TA 3KF8A 3D4RA 3NTKA 3X3NA 2SNSA 2EPBA 4V0BA 5EKKA 4IFDH 3TDQA 4OO1G 1YNJD 2A69C 1SYEA 2AWNA 4KY5A 3URYA 4FF4A 2F3VA 5C0XG 4XQNA 1Y69U 2LMCB 3NQIA 3ND8A 1SBBB 2RA4A 1ML0D 3GTQB 5LHY1 4WFN3 5I2YA 5D14A 1SYFA 4XIGS 2CQAA 1IKLA 1QE6A 1PTOC 2F0NA 5C3WA 1SEBD 1KABA 1EY8A 4HCEA 4F8MA 3ITPA 1K83B 1BCPC 3DWQA 3Q24A 2XN9C 4DNTB 4ZKCB 1PZKD 2KQ3A 4LK1C 3ONAB 3NP8A 4JK1C 5DAUA 1MD2D 3FRPB 1LT5D 4TSSA 3KLSA 2B2VC 2Z4IA 1VMPA 5C0XJ 3SK5A 3A54A 1QJOA 1BDOA 2XWBB 3K5MA 2IL8A 2WKDA 1EYAA 4A3KB 4B08A 2LKVA 1HCZA 1PTOH 4K5XA 3OWFA 3H09A 1I50B 2RDFA 4RFBA 2JA8B 4NP5A 2PMZB 3JAML 2E75C 3D31A 1Q12A 1TR5A 4BY7B 2F0VA 4ODGA 2L11A 3OIPA 4FVMA 2I07B 4A3FB 1PRTF 4Y7NB 1YNND 4XQQA 1SNMA 1IW7D 3J7YW 2RDGA 4UDUC 2E2IB 5JPNC 3A56A 3EJIA 3D6WA 4Q0FA 4ZQ3A 1RTOA 5AFWA 3NXWA 1HQRD 4RAUC 2EVBA 2QKIC 2IW3A 5ISRA 3P75A 4ZK9B 3N6RA 4F7XA 1SNOA 4EVOA 1FNUA 5G3LD 2RQXA 3I8ZA 5KIXA 4BA2I 1E0BA 3VYUA 3GV3A 1GUNA 2ZT9C 5E4XA 3K5OA 4CKBA 2QDBA 2NVQB 1BQQT 2JA7B 2FJ2A 3T56B 1PLFA 2ICEC 5CR3A 2QEJC 4CJ0B 5C4JB 1DXMA 3HG9A 2QILA 1QG7A 4RGMA 3QJYA 2DNEA 2Y0SB 3TZDA 5FOBB 3LWEA 1BBXC 4IZ8A 1T5EA 2D62A 1GUWA 1JWSD 3A7LA 1VDZA 3T53B 3N52A 1VF5C 1QNUA 4XXEA 1SXTA 1X3QA 2EY1A 3MA2B 2EY6A 1I4PA 4OIKA 3M7NA 5E1FA 5NUCA 2JYOA 3I4NB 2EY5A 1RCVD 2F0IA 1EZ6A 1BF4A 4IFDG 1SDFA 2Q8RE 5I2XA 1OXUA 2AWOA 3HOUB 1I3QB 1M8AA 1EWCA 5M5XB 4LJZC 2F0SA 2A6HD 4PMCA 1JOKA 3NHHA 3S1NB 4L8JA 2L9HA 2K04A 2A73B 2MP1A 3CRKC 5IGGA 1HTLD 1EFID 1WD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOK A;  1E0B A;  2B2T A;  2HDM A;  3F2U A;  1HUN A;  1IL8 A;  1J8I A;  1NCV A;  1XYI A;  3GV3 A;  2JP1 A;  3DEP A;  3HP3 A;  2HCC A;  2J7Z A;  3QO2 A;  1ILQ A;  3IFD A;  5E4X A;  2B2V C;  5E4W C;  1B3A A;  1RJT A;  2MGS A;  2NYZ D;  1IKM A;  1HRJ A;  1WTX A;  2D9U A;  3G7L A;  3R93 A;  2B2V A;  1VMP A;  2FJ2 A;  4ZAI A;  2B2Y C;  2K01 A;  3MTS A;  2KEE A;  2L4N A;  4HED A;  1X32 A;  2DY7 A;  2B2Y A;  1PLF A;  2IL8 A;  2X6L A;  4XDX A;  4X3T A;  3P7J A;  1O7Z A;  2VXW A;  4XT3 B;  3FPU B;  2K1B A;  5EKI A;  2MPM A;  4CJ0 B;  4UAI A;  2DY8 A;  1G91 A;  5EPK A;  1B2T A;  1PDQ A;  1QG7 A;  2HUG A;  3H91 A;  4X3S A;  2NZ1 D;  1PFM A;  1CM9 A;  1PFB A;  4O42 A;  4IUQ A;  1F9R A;  4ZKB B;  5JJZ A;  4HSV A;  1NR2 A;  2EE1 A;  4MHE A;  2K03 A;  4ZLT F;  1AZQ A;  2N88 A;  3TZD A;  1HHV A;  2L12 A;  4QUF A;  1LV9 A;  1RTN A;  2HDL A;  1G2T A;  2Q8T A;  4U68 A;  3MWY W;  4QUC A;  2X69 A;  1U4R A;  1F9P A;  3LWE A;  1XX8 A;  1BBX C;  4X3K A;  1EL0 A;  2RSN A;  1GUW A;  2EOT A;  4RWS C;  3I90 A;  3IL8 A;  4R9W A;  1O80 A;  4LMQ D;  4OIJ A;  1MI2 A;  2K28 A;  1JIC A;  2K05 A;  2X6G A;  3N52 A;  1WTV A;  1DON A;  1EOT A;  1HA6 A;  1RHP A;  1NR4 A;  1PFN A;  2EPB A;  1WVL A;  1ICW A;  1X3P A;  1HUM A;  4CJ2 C;  1BNZ A;  5EQ0 A;  1TVX A;  4MN3 A;  1X3Q A;  3DEO A;  1WTO A;  2L11 A;  1AZP A;  3KUP A;  5CBA E;  1G6Z A;  1QNK A;  2H1E A;  4IUU A;  1WTP A;  1SSO A;  2KEC A;  3SVM A;  2KVM A;  1WTR A;  3TN2 A;  4OIK A;  2R3Z A;  3DM1 A;  1SAP A;  5CBE E;  4XT1 B;  3FDT A;  2JYO A;  5CMD A;  1MSH A;  1F9S A;  1J9O A;  1G2S A;  1KNA A;  2FMM A;  1ILP A;  1ZXT A;  2B2U A;  1U4P A;  5T1I A;  4X3U A;  5EPL A;  1B50 A;  3GV6 A;  1MSG A;  1BF4 A;  2RA4 A;  1NAP A;  1CA5 A;  1KNE A;  5COY A;  1ML0 D;  2B2U C;  2RSO A;  3KBX A;  4DN4 M;  1C8C A;  2MJ8 A;  2L1B A;  4R8I A;  5EPJ A;  1SDF A;  2Q8R E;  1VMC A;  2RVL A;  3D6W A;  1WTQ A;  3I3C A;  4HCS A;  5D14 A;  4CJ1 B;  1EIH A;  1EQT A;  1RTO A;  5AFW A;  1EIG A;  1WTW A;  1IKL A;  1QE6 A;  4HAE A;  2B2W A;  5EJW A;  4RAU C;  1HFG A;  5COR A;  2N55 A;  1B4O A;  1JE4 A;  1M8A A;  2NWG A;  2FIN B;  1B53 A;  2B2W C;  1ROD A;  1MGS A;  1DOM A;  4IUT A;  2KOL A;  2FFK B;  3UI2 A;  1BO0 A;  2XIW A;  1ESR A;  1O7Y A;  1U4L A;  1F2L A;  4NW2 A;  4ZK9 B;  2L9H A;  1HFN A;  4IUV A;  2HCI A;  2CVR A;  2K04 A;  3Q6S A;  1Q3L A;  1S4Z A;  4RA8 A;  1DOL A;  5T1G A;  5D65 A;  4IUP A;  2MP1 A;  2FHT A;  4IUR A;  3I91 A;  1U4M A;  5DNF A;  2BDN A;  1CA6 A;  2KUM A;  2KED A;  2M2L A;  1AP0 A;  4ZKC B;  1DZ1 A;  1WD0 A;  1F9Q A;  2B2T C;  1A15 A;  2SDF A;  1WD1 A;  3I8Z A;  3ONA B; 
#chains in the Genus database with same CATH topology
 2EZV A;  1LTG D;  5FJ8 G;  2QDL A;  3S2H H;  5C0X H;  1HTP A;  1T9H A;  4C56 C;  3GTL B;  4C3I G;  4RHS A;  4A3I B;  2B2V A;  3FP9 A;  1EY6 A;  4OL7 A;  4OXP A;  3OPO A;  1VQ5 A;  5M5Y B;  1U0L A;  1K8G A;  2RBM A;  3NBI A;  1AEX A;  2R7Z G;  3T1H Q;  3VR6 A;  1Y1V H;  3DM3 A;  1WFQ A;  1TII D;  1ENF A;  4O1N A;  3ULP A;  1QWY A;  1D5X C;  2BA1 A;  4A3C G;  4KY6 A;  4J1M A;  2Z4H A;  1UAP A;  1EWH A;  1GUS A;  1LAC A;  5IT9 L;  2NVX H;  4MHE A;  1KDB A;  4YWM A;  2K03 A;  3GDE A;  2YU9 H;  2XRS D;  1ZEQ X;  4C1N I;  4C3H G;  1YJW A;  1XNR L;  4FP5 D;  3RN2 A;  4L5S A;  2RSN A;  1JOQ A;  4R9W A;  1S40 A;  2JA7 H;  1BCP B;  3TME A;  3TRE A;  2F0O A;  4R1J A;  3CC2 A;  4C3H B;  2ALY B;  2K05 A;  2X6G A;  4XQJ A;  2EDG A;  1WVL A;  3PO2 G;  1TWC B;  2KJX A;  3GTP B;  4X62 Q;  4GOP A;  1PYW D;  5IWA L;  1F2Z A;  1LT4 D;  5C3E H;  1D7Q A;  1WCM H;  4KMU C;  3HGB A;  3PMF A;  1M4V A;  1SAP A;  2L15 A;  2FMM A;  2LFN A;  1GUT A;  4KHV A;  4JBM A;  1VQJ A;  3GO5 A;  2DJF C;  1L1O B;  1C8C A;  2BCO A;  3NWS A;  1CHQ D;  1XMQ Q;  4A3I G;  4MZ9 A;  3TP8 A;  1I6V C;  2CW0 D;  4BWG B;  3EVQ A;  1TWA H;  3UE1 A;  5EGT A;  4KJN A;  2RHQ B;  4DR7 Q;  4HJ5 A;  1JE4 A;  3F2B A;  4XTC S;  3LGJ A;  3CCS A;  3J80 c;  1PRT B;  2A6E D;  4JI3 L;  3VR2 A;  5GAG C;  4K2K A;  5I9O A;  4A3G H;  1EEI D;  4A3B B;  5DLQ E;  1YNN C;  4IUV A;  3STB D;  4UPA A;  4KN4 C;  4BBR G;  4X66 Q;  4KN7 C;  4DPG A;  2VW9 A;  2IHE A;  2M00 A;  3KLS X;  3CXC A;  5ELD A;  4K2L A;  2F4V L;  1LTS D;  1GXD C;  1MJC A;  1STY A;  4JCV E;  2MO1 A;  2WAQ G;  3RUZ A;  4GKK L;  1IYJ B;  3DWA A;  3K80 C;  4S3S A;  1A3U A;  1LO5 D;  1RJT A;  2K32 A;  1K0S A;  3HOU H;  4ZAI A;  4LUV A;  5FO7 B;  2K01 A;  4HTH A;  3M85 A;  2L4N A;  1Q8I A;  4JI3 Q;  1SR3 A;  1STA A;  1I5F A;  1PHJ A;  3PIO A;  4JBK A;  3CF5 A;  2MPM A;  1KHI A;  1XJV A;  4A3B H;  2IPK D;  2B39 A;  5EPK A;  2EJF C;  3FVQ A;  1N34 L;  2ASB A;  4DV4 Q;  2NN6 H;  3C1E A;  4A3M B;  3K5N A;  2A1A A;  1G2T A;  4RH6 A;  3KF8 B;  1VQ7 A;  3HKS A;  3BG3 A;  4DXF A;  1RL2 A;  2RDH A;  4ULL A;  2JA6 G;  1SNC A;  1JWM D;  2MQH A;  2F03 A;  4R4I A;  3TBI B;  3MXU A;  1CZG A;  3W1B A;  3HS0 C;  1BVS A;  5IWA Q;  1DON A;  1S5C D;  2NB0 A;  2E2J B;  3BDO A;  1YEZ A;  3S16 B;  3DEO A;  3FEW X;  1Y8N B;  1TQO A;  1SNP A;  1V1P A;  1QNK A;  1A6X A;  1STB A;  1PYB A;  4IJH A;  1BUV T;  1A2U A;  3I4M G;  2R3Z A;  4OWW B;  1KC8 C;  4A93 H;  1V8Q A;  3B6Y A;  4YHH Q;  1EEF D;  1SYG A;  2JA5 G;  4K8J A;  1CKN B;  1CA5 A;  4FO2 A;  4R8I A;  3I4M B;  3I4N H;  3HOY H;  4UP7 A;  4A3J G;  3H3V C;  4DR1 L;  1TWG H;  5AJ3 Q;  2JA6 B;  5BN3 A;  2K75 A;  4A76 A;  2UUB Q;  4UP8 A;  3FKI B;  2PYK A;  3CQZ H;  2R7F A;  1GJX A;  1DD2 A;  1B3Q A;  5T1G A;  1FL0 A;  2FHT A;  5DNF A;  5IYD H;  3UDX A;  1CA6 A;  2WB1 E;  1A15 A;  3PQI A;  2TSS A;  3EBE A;  2B2T A;  3ERO A;  5M3M H;  1IL8 A;  2F3W A;  1YHQ A;  1XXG A;  2JSO A;  1GO3 E;  3I4M H;  4JC0 A;  3H94 A;  2EJG C;  5J1Z A;  3GTK H;  2NVT B;  1EY0 A;  3R3O A;  1TWG B;  4J6H A;  4HED A;  2OF1 A;  2K5Q A;  2BE5 C;  2CH4 A;  1PYS B;  1G51 A;  1CTM A;  3HOW H;  5IP7 H;  2FXQ A;  3U58 A;  1LTB D;  4ME5 A;  4DR5 Q;  2DNC A;  4DV4 L;  5JEA H;  2O2L D;  1LM0 A;  4HMI A;  2OXP A;  4JI4 L;  4O42 A;  2NN6 I;  3CME A;  3I55 A;  4HSV A;  5C4Z A;  1N36 Q;  2BH2 A;  2SOB A;  4QB4 A;  2EE1 A;  5DM7 3;  4H13 C;  3K0Y A;  1HZC A;  3U4Z A;  1A0I A;  4QUF A;  3VA5 A;  5IYB G;  3RLO A;  3Q0A A;  3QR8 A;  1E7Z A;  4DK6 C;  3JAM i;  4L63 B;  1N32 Q;  1Q8K A;  1D6E C;  1PH6 A;  3R2T A;  4OGQ C;  5FO9 B;  1PH1 A;  1WJJ A;  1R4P B;  1ET6 A;  2L0C A;  2IJ0 A;  3S1R B;  3J7A V;  1CQF A;  3TP6 A;  4V19 0;  4E6I A;  1AZP A;  2R93 B;  3KUP A;  3TQY A;  2QF7 A;  5JVH 3;  2AHO B;  1SND A;  3SVM A;  2ID0 A;  3PIP A;  1E2V A;  1TWC H;  4B3T L;  4RGT A;  2E8G A;  3F1Z A;  3GTP H;  1CKO A;  4JI5 Q;  2B2U A;  1KQS A;  1FNW A;  5T1I A;  4PZ8 A;  4CKC A;  4JI2 Q;  1A3V A;  3H6M A;  3AFQ A;  3H0G G;  3KBX A;  1R9T H;  1EIY B;  4DV7 Q;  4BBS G;  2HHH L;  1S5B D;  1ESF A;  1PVO A;  4AH6 A;  1WTW A;  1UE1 A;  5EJW A;  3PUV A;  5IYC H;  2N55 A;  3A55 A;  4JI6 L;  4IFD J;  4K0K L;  1UE7 A;  2JA8 G;  1EY4 A;  3CPF A;  4O2D A;  2XIW A;  1U4L A;  2ES2 A;  2F0J A;  1D8L A;  4IO9 A;  2G9H D;  1HXY D;  5A2Q L;  3SK4 A;  3DMU A;  2EYO A;  5CV9 A;  2VZA A;  1LT3 D;  1I50 H;  3VDY A;  1S3O A;  1F77 A;  1B3A A;  1PH5 A;  1WI5 A;  2VQF Q;  1C4Q A;  3KLR A;  4YWL A;  5IE8 A;  4LF4 Q;  2PQA B;  1SE2 A;  3MTS A;  2WP8 J;  1S5F D;  3HZX A;  3MC0 B;  1EYG A;  2K4K A;  4BY7 G;  3OSO A;  2O5I C;  1RD9 D;  3P7J A;  4JI6 Q;  1O7Z A;  2K1B A;  4KKT A;  5AJ3 L;  2F0K A;  1B2T A;  3H91 A;  1K3B C;  1CM9 A;  2PW5 A;  2OTJ A;  2HHH Q;  5E3F A;  3FHW A;  2F4I A;  4UHV A;  1STN A;  4DV1 L;  1LV9 A;  3MEH A;  4U68 A;  3CC7 A;  2Z1C A;  1KL9 A;  1P16 A;  1TWH B;  1SMY C;  4KTA A;  2IX0 A;  5IOD A;  4RWS C;  4UP9 A;  1O80 A;  4A75 A;  2A5H A;  3MXN A;  5JEA J;  4OIJ A;  1YBY A;  2B8F A;  1JQY D;  2F0W A;  3FMC A;  3R8B A;  4HID A;  4FF3 A;  3S1Q B;  4DAP A;  1X3P A;  4NMZ A;  1K9M C;  1BNZ A;  2VNU D;  1HR0 W;  2KCN A;  1PXU A;  2Q2T A;  4UY8 C;  1A62 A;  4JYA Q;  1K8O A;  4NB3 A;  1WTP A;  1N32 L;  1SSO A;  3QWN A;  2KVM A;  3LNN A;  2L5T A;  1TT2 A;  3E6Z X;  3K58 A;  4QMG A;  3T16 A;  4B9X A;  4CBV A;  2UU9 Q;  4BXX H;  3DUZ A;  3Q23 A;  4X3U A;  1STH A;  2EYF A;  4PV1 C;  2B2U C;  5C4X B;  4DA2 A;  5FLX E;  1HR0 L;  2NBF A;  3I3C A;  4ZRZ A;  4A3D G;  3ERQ A;  4CJ1 B;  3L3O C;  4FF2 A;  1C0A A;  4M8A A;  4KJO A;  4JI7 Q;  4FF1 A;  4A3J B;  1NJI C;  2F0H A;  3CKI B;  1DOM A;  4LF6 Q;  2KOL A;  3KDF A;  1W2B A;  1OXS C;  4G7H C;  3E5S A;  4JW0 A;  2ZXR A;  1DOL A;  2JA5 B;  4IUP A;  1I4G A;  4LUZ A;  2KED A;  2WFW A;  5TSS A;  3MXN B;  2D2C C;  2B2T C;  3SHL A;  4DNR B;  4X64 Q;  1EFW A;  1NMG A;  5D3D A;  1QVG A;  1XNQ Q;  2F0G A;  2E5L L;  3E0J A;  3F2U A;  2CH4 W;  5ELO A;  1JOO A;  3PGZ A;  1IBM L;  2MUY A;  3NPP A;  4A3G B;  1FR3 A;  1Y8O B;  1SYD A;  4NXM Q;  3DLL A;  1PTO D;  1SYC A;  4A3E G;  4AYB B;  5H1S E;  1Q86 C;  2R7D A;  3VR3 A;  4ZYS A;  5LMN L;  1A8V A;  3CRL C;  4F88 A;  1NNX A;  3VYS A;  2B2Y A;  3LWU A;  1X55 A;  4G57 A;  1Y1W G;  4A3F H;  2R92 B;  1VQH A;  1EY7 A;  5JJZ A;  4N9T A;  5IP7 G;  1HA5 A;  4A3D H;  4QCL A;  5KGU A;  4ZLT F;  1F2Y A;  5FLX L;  4JI0 L;  2A69 D;  1TY2 A;  2E76 C;  1KAA A;  1JT8 A;  1UWV A;  1VQE A;  3HOX G;  3CCJ A;  1ENA A;  2X69 A;  2I5H A;  4DUY L;  2GVA A;  3D4D A;  5EBC A;  2XWJ B;  2XTI A;  1V1O A;  1I94 Q;  3AMU A;  1H9R A;  5I4D A;  4DU9 A;  3K81 C;  1JIC A;  1IBL Q;  4LFA L;  1HA6 A;  2F0U A;  4QQB X;  4H0L C;  1BCP D;  4IUU A;  1I94 L;  1NUC A;  2KEC A;  1PRT D;  3K7A B;  4LF5 L;  4HN7 A;  2IX3 A;  4XT1 B;  4LUO A;  2ZM6 Q;  4N8F A;  4OO1 I;  2R93 H;  5GQO A;  1LYL A;  5EBD A;  1U4P A;  5ELB A;  1TU2 B;  3M7G A;  1AH9 A;  1DGS A;  1V1Q A;  5COY A;  2WB1 G;  2L1B A;  4ID6 A;  5BN5 A;  2JE6 I;  2M9V A;  1WTQ A;  1X3G A;  1ASY A;  2VUM H;  1N34 Q;  1NBW A;  2D5D A;  3J81 E;  2A6E C;  1EQQ A;  1KDC A;  3S14 H;  4WOR A;  3W5O A;  2Q2I A;  3T1H L;  2NVX B;  1CI3 M;  1PTO F;  2NN6 G;  1S72 A;  4IUT A;  1LTT D;  4A93 G;  1ESR A;  4GLX A;  2CHB D;  2CVR A;  2ZTC A;  1A2T A;  3WOF A;  4JV5 Q;  3GTG H;  1VCI A;  2H5X A;  1FYC A;  4QY7 A;  1SFO H;  4B3M Q;  4GKJ L;  4H44 C;  5IGE A;  3DWP A;  1V1P B;  2K5N A;  2VL6 A;  2IWH A;  1Y1W B;  5M3F B;  1XPO A;  2DUD A;  3V05 A;  2Q2H A;  5K36 G;  2AMC B;  1NCV A;  2H4O A;  1EU4 A;  3HOY G;  3NQT A;  2IT1 A;  3H3V I;  1EQR A;  2CKZ B;  2CW0 C;  1SE4 A;  3QO2 A;  3PF5 A;  3A5U A;  3IAY A;  3VR4 A;  2AKW B;  3F8T A;  2MGS A;  3J80 i;  3PO2 H;  2O5J C;  1WTX A;  2PQE A;  3GTM B;  5BN4 A;  4K14 A;  2JXM B;  4LF8 Q;  4L5R C;  3SR1 A;  4AQY L;  1EWI A;  1F2M A;  1FD7 D;  4XDX A;  4X3T A;  4WJ4 A;  4P75 A;  5E7N A;  4XT3 B;  1AE3 A;  3C1F A;  1PH8 A;  1NSN S;  5KEE A;  3ZYY X;  2ZXP A;  5C5L A;  4QIW B;  4LF9 L;  4HJ7 A;  4X3S A;  2CQO A;  2DJG C;  3HKZ E;  4X65 Q;  4WJW A;  2LXK A;  4RHR A;  2L12 A;  4KD4 A;  3F2C A;  5M3F H;  1XX8 A;  3K7U C;  1BOS A;  3KF6 A;  2EOT A;  4A3D B;  4DR6 Q;  4LMQ D;  3AQQ A;  1QVF A;  4B3S L;  4OEL B;  4BY1 H;  3TP7 A;  1X6O A;  5EQ0 A;  3CMA A;  5EAY A;  2PPB C;  5G3L F;  5CBA E;  1PRT C;  1UUP A;  4LFC Q;  1VQB A;  4DR4 Q;  1Z9F A;  2OT2 A;  4GKJ Q;  5LMU L;  2B29 A;  1FGU A;  4C3I B;  2I5M X;  2EYM A;  2EXZ A;  5EPL A;  2I5L X;  3A8K E;  3OOC A;  1XTD A;  2UUA Q;  1XMO L;  2VQE Q;  3FPP A;  3HOV B;  4P71 A;  3CCL A;  2YYZ A;  3OHX C;  4B3R L;  1KLU D;  2JA6 H;  2JEA I;  1D5Z C;  2PQA A;  2YU9 B;  4GLA C;  1FGB D;  3BJU A;  1II3 A;  2F0Q A;  1OO9 B;  4DKA C;  4JI8 L;  2JJQ A;  1BO0 A;  4C3J G;  4A3E B;  1E1T A;  4JBJ A;  3Q6S A;  5JJL A;  2J0T D;  2K5D A;  1VS0 A;  4A3J H;  4BBR B;  4OWX B;  4JOI A;  3GTJ B;  1K73 C;  1WOC A;  3I73 A;  5IP9 G;  5I6Y A;  2K6A A;  2NTS A;  1X3E A;  4FDB A;  4DV2 Q;  4DV5 L;  4K5W A;  2BDO A;  4R4T A;  1X56 A;  1EY9 A;  2ENB A;  3HP3 A;  1SLJ A;  2E2H H;  2J7Z A;  4LWC A;  1BKB A;  3I72 A;  2JA7 G;  1IKM A;  2VY3 A;  1DCZ A;  2YTX A;  3G7L A;  2HIX A;  2B2Y C;  2LY7 A;  3ND9 A;  4NDX A;  1KRS A;  3X3M A;  4ZUJ A;  5IOC A;  3Q22 A;  4CGY B;  2R6G A;  1QUQ B;  3D6C A;  1A3T A;  2F3I A;  2X6L A;  5C4H A;  3OTO Q;  1LTI D;  3MXG A;  1O7I A;  3J81 i;  2YTV A;  3OMG A;  1IBK Q;  2HUG A;  3T1Y Q;  5ELC A;  5F2D A;  1LUZ A;  3K8A A;  3BS1 A;  2RCF A;  1O7L A;  3D3R A;  2HDL A;  1QZH A;  2XNA C;  1UEA B;  2BOS A;  2F0D A;  5JAV A;  5C44 H;  3CW2 C;  4JI8 Q;  4BY7 H;  1QOH A;  4NXM L;  1TS3 A;  4IFD I;  5JPM C;  2K28 A;  3SK6 A;  1WTV A;  3GQB A;  1B44 D;  2BE5 D;  3SEB A;  4BBS H;  1N9W A;  2NTT A;  3RZD B;  2BH8 A;  4CJ2 C;  4LNQ A;  4B3R Q;  4POF A;  1NE3 A;  1BCP F;  1Q1B A;  4P2C B;  2R92 G;  1YIT A;  2UUA L;  1PH3 A;  3GD7 A;  2V4D A;  2Y0S E;  4L5Q A;  3NK9 A;  3TRZ A;  1B50 A;  1BBU A;  4KKS A;  1PH7 A;  3HOZ B;  1LTA D;  1KTK A;  3BYY B;  4LFC L;  3UE0 A;  3I70 A;  4ZUI A;  1GVP A;  1PH9 A;  1VMC A;  4HR7 B;  3W2D A;  3I4L A;  2EY2 A;  1PH4 A;  5LMN W;  3W3A A;  4C2M H;  4JI1 Q;  1N33 Q;  2J4X A;  3HOX H;  1SE8 A;  3MAQ A;  3VYT A;  4BY1 B;  3BZD B;  4KHP L;  3UDF A;  4DGZ A;  2K50 A;  4O0A A;  1YHB A;  3UI2 A;  3TSS A;  4BBS B;  3J80 L;  1Q90 A;  3L7Z C;  1YI2 A;  3M3Y B;  3M4Q A;  1B9M A;  3OMC A;  3JAM c;  3I91 A;  2PMZ E;  3PO3 B;  3T13 A;  2R7Z H;  4MTK A;  5M5X H;  3W1G A;  1MJE A;  1EU3 A;  2NVQ H;  2D0P A;  3MEF A;  4N8X 1;  4PNY A;  3PUZ A;  5C3X A;  2JP1 A;  3G48 A;  2R93 G;  3IFD A;  4RKB A;  4A93 B;  2A19 A;  1PTO B;  3KBG A;  2D9U A;  4HJA A;  2K14 A;  3M4O H;  1X3F A;  2ZJP A;  3S2H B;  3PO2 B;  1IW7 C;  3RN5 A;  3STB C;  4EQP A;  1UE6 A;  1SRU A;  2DY8 A;  4DR1 Q;  4K6L A;  3L9A X;  1ZKO A;  1XPR A;  1Q82 C;  1AW7 A;  1I6H H;  3S17 B;  4IUQ A;  4XYO A;  3KJP A;  1VQ9 A;  1NR2 A;  1G8Z D;  1QIL A;  1Y1V B;  1U9R A;  1VQD A;  4YHH L;  4DR2 Q;  2JN4 A;  4CDE C;  1L1O C;  1F9P A;  3PIP 3;  2I0Q A;  1HPC A;  1VF7 A;  3TZU A;  3U4V A;  1L0Y B;  1KDA A;  2WAC A;  4LW1 A;  3FKI G;  2NUC A;  2A68 D;  3HFZ B;  4IOC A;  5EKL A;  1MI2 A;  3PUY A;  2VS1 A;  1EY5 A;  1PFN A;  3T1Y L;  1V9P A;  1VQL A;  4IN3 A;  3RMH A;  1IYU A;  3P1H A;  4DV3 L;  1X9N A;  1OXT A;  3OTO L;  4K6D A;  4KY7 A;  1D1K A;  3DM1 A;  1PFS A;  5CBE E;  2A74 C;  2ZM6 L;  2MNA A;  4LF4 L;  1PA6 A;  1MSG A;  2EYJ A;  2F0F A;  2YV5 A;  4GNX A;  2RSO A;  3ICE A;  2BA0 A;  4YCU A;  1SNQ A;  1RKN A;  3UDG A;  4NXN L;  1FJG Q;  3ULJ A;  1QVC A;  2LXJ A;  4A3K H;  2EYP A;  5IGF A;  2B2W A;  4IQZ A;  1YJ9 A;  5IT9 c;  1B4O A;  1ROD A;  2EYL A;  2B3G A;  2F0M A;  3A0J A;  3ERS X;  4NW2 A;  3NE5 B;  3CCU A;  2HCI A;  4A3K G;  1O78 A;  1HZA A;  5D65 A;  3BU2 A;  2KHI A;  2KUM A;  3DHQ A;  2KCT A;  5IYC G;  1WD1 A;  1H95 A;  1ICF B;  4N9P A;  1CZW A;  2XVS A;  1E2Z A;  5L37 A;  3S1Q H;  4EQ5 A;  1C48 A;  3MFY A;  3D0F A;  1ILQ A;  4OO1 H;  5E4W C;  2XRQ D;  4JI2 L;  3LX0 A;  1HRJ A;  1SN8 A;  1YNJ C;  4JI5 L;  5C44 G;  2Z6K C;  2NVY H;  4JG2 A;  4DV0 L;  1S5D D;  1V43 A;  4IAL A;  1NTG A;  2Z8L A;  5CV7 A;  4M1U B;  3OW2 A;  2F0T A;  1UEB A;  1XWE A;  4LF7 L;  4C3J B;  3BYT B;  1PV4 A;  1VQK A;  1KD1 C;  3T51 B;  5HUR A;  5IGB A;  2PCF B;  2ZJQ A;  3BVM A;  4ZKB B;  5LL6 X;  3CQZ B;  2IY5 B;  1RTN A;  1HNZ Q;  4P74 A;  1UNS A;  1D2B A;  4OX9 L;  5KYI A;  1I4Q A;  4P73 A;  1VQN A;  4X3K A;  4ZCK A;  4WRD A;  4DF7 A;  5ELF A;  2JA5 H;  5KRU A;  2OCE A;  1Z47 A;  4X65 L;  1XPU A;  3P20 A;  1VQC A;  4DV6 L;  4YY3 Q;  2F0E A;  2AQ1 B;  3KOJ A;  3D4W A;  3CCR A;  1SYB A;  1WYD A;  1YHA A;  1OXX K;  4Q5V A;  2H1E A;  2RCN A;  3G6E A;  4DFA A;  4AQY Q;  3TN2 A;  2F1M A;  5CV6 A;  1JB7 A;  2E2J H;  2UU9 L;  2IX1 A;  4RGO S;  1MSH A;  1XNR Q;  1KNA A;  3CP0 A;  1RF2 D;  3A8J E;  3BDC A;  3RLN A;  2PZU A;  1B8A A;  1BR9 A;  1KIX A;  3MXP A;  1B9N A;  3A7A B;  2VUM B;  4DUZ L;  1X54 A;  3S24 A;  1EIG A;  2HD3 A;  1L0W A;  1Z7T A;  2EJM A;  1QCB D;  1A63 A;  2L55 A;  3MFG A;  1STG A;  4CDC C;  3D8G A;  3PUX A;  1O7Y A;  1Q7Y C;  3A74 A;  4GN3 B;  3V2T A;  1Q3L A;  1IL2 A;  1H9K A;  5JEA G;  3GTL H;  2TMP A;  2UUB L;  2SNM A;  3OIQ A;  1F9Q A;  2HQE A;  1H9M A;  1Q81 C;  3VR5 A;  2QA4 A;  3H0G B;  2I46 A;  4A3F G;  4ILW A;  1J8I A;  5FO8 B;  3DEP A;  3K59 A;  2HCC A;  3WDN A;  2UXB L;  3I4O A;  1HJP A;  3S15 H;  3J81 L;  4PG3 A;  2NYZ D;  1UE5 A;  2Q8I B;  1E24 A;  4KK7 A;  2V1C C;  2KEE A;  1PH2 A;  2N78 A;  1CFM A;  4TRD A;  2OTL A;  2YTY A;  2QGQ A;  2PZT A;  5EKI A;  1K83 H;  4FXG C;  3QOJ A;  2MO0 A;  4FXD A;  4PQX A;  4K8I A;  3SXH A;  1PDQ A;  3BZK A;  1NY4 A;  2R61 A;  2UXC Q;  1VQM A;  1EQV A;  4JPB W;  3KLW A;  3AEV A;  1K0R A;  3HOW B;  3H0G H;  3MWY W;  1U4R A;  1PZJ D;  4Z9C B;  2WB1 B;  3HOU G;  1EL0 A;  1K28 A;  3GTG B;  4XYQ A;  5CV4 A;  3QIA A;  3PSI A;  4CKE A;  2N3S A;  3J7A 5;  1RHP A;  3R2I A;  2Z9H A;  1H9S B;  2VB2 X;  3A5Z B;  1HH2 P;  4DV6 Q;  3PO3 G;  1TVX A;  4MN3 A;  1J5E L;  4L6T B;  5C0X I;  2CWA A;  3SK8 A;  3S2D B;  4GN5 A;  4GOP C;  1EYD A;  1M90 C;  1C7Y A;  4RKL A;  3FDT A;  5CMD A;  4OX9 Q;  1ILP A;  1F9S A;  1ZXT A;  3H3V H;  1X65 A;  3U50 C;  2K7V A;  1RDP D;  4DR4 L;  4X6A H;  3NWT A;  3Q8D A;  2K5W A;  3PIO 3;  3V96 A;  5A2Q E;  2E5L Q;  4RCN A;  3I7F A;  1YJN A;  1GM5 A;  2F4V Q;  2R7Z B;  3H15 A;  1XNQ L;  1HFG A;  2JEB I;  2B63 B;  2A8V A;  2NWG A;  1B53 A;  2B2W C;  4J15 A;  4NPS A;  1VQ8 A;  4BBR H;  2A68 C;  2CCZ A;  1HFN A;  1JJG A;  4HSP A;  3KJO A;  4LF6 L;  5M3M B;  3CU7 A;  3WWV A;  3SDZ A;  4G7O C;  5FK9 C;  4DAY B;  4HIO A;  4J8Q A;  1MBY A;  2UXC L;  3BZC A;  4FNF A;  1IXR A;  4DK0 A;  5CYU A;  3QB3 A;  1TS2 A;  3O13 A;  4YIJ A;  4A3I H;  4NXN Q;  3T4A C;  2DN8 A;  1JC7 A;  1STE A;  4DAY A;  4LFB Q;  3K5L A;  1AN8 A;  2XSC A;  3HEJ A;  1I4H A;  4OON A;  5DEH A;  5GAE C;  3NEM A;  5C5M A;  1JR0 D;  5ELE A;  1W6K A;  1HNX Q;  2NZH A;  1LTR D;  5GRO A;  5LL6 S;  4R8N A;  4QF4 A;  2VXW A;  1TKW B;  1AE2 A;  1E2W A;  1OTC A;  2NVY B;  4NKL A;  4F87 A;  1PFM A;  3CD6 A;  1AFP A;  1BXT A;  3HOZ H;  2A6H C;  4LAA A;  1L1O A;  5KND A;  1JCK B;  1R4Q B;  2N88 A;  3TS0 A;  5C44 B;  4DR3 Q;  4JV5 L;  2WIN B;  4QUC A;  1TWA B;  1SFO B;  2UUC Q;  2D0O A;  3BVZ A;  2QCP X;  1ZYR C;  5I6W A;  4IPG A;  4A3E H;  1GKH A;  4TQU S;  1I6H B;  2SEB D;  2VB3 X;  3RZD H;  3ZJY C;  5IGD A;  1EOT A;  4KI0 A;  2PW7 A;  1NR4 A;  1ICW A;  5I9P A;  4DUZ Q;  5C4J H;  5C3E B;  3HKZ G;  3PO3 H;  1G6Z A;  1T5X D;  5ELN A;  2FMC A;  3S1M B;  5KYL A;  5CGK A;  1LLR D;  4IJL A;  4R4O A;  3K6O A;  4ABN A;  5K5P A;  4DXG A;  2LS0 1;  5A35 A;  2PI2 E;  3S9W A;  3HKZ B;  2E2D C;  2HIV A;  2F0P A;  3RD4 A;  1NAP A;  3UDI A;  1KNE A;  4DN4 M;  5HGT A;  2RVL A;  3CPW A;  4C2M B;  1CK1 A;  1SJH D;  4K5V A;  2QW7 A;  1I4X A;  1EIH A;  1SJE D;  4RG1 A;  5M9O A;  4LFA Q;  3L0O A;  2ZTE A;  4IOA A;  1JOR A;  1HNX L;  5CV8 A;  3EQL C;  4RGN A;  3M3Y H;  2MHV A;  1HNW L;  1MKH A;  3U9S A;  1F2L A;  1B1Z A;  4G7Z C;  4RA8 A;  3CCV A;  3NBH A;  1Y8P B;  2Q2U A;  2GA4 B;  1DJR D;  1DYQ A;  1U4M A;  3RR5 A;  2M2L A;  5J39 A;  4I7Z C;  1OXV A;  4MIU A;  1WCM B;  1FVI A;  3KDF B;  4H02 A;  1C9O A;  1DOK A;  2XGT A;  1HUN A;  1CKN A;  3OW7 A;  2ZXO A;  1VQA A;  3AU7 A;  2AQ3 B;  3HRZ C;  3MHB A;  3IFT A;  3E9H A;  3MVV A;  4P72 A;  5JVG 3;  1E22 A;  1I3Q H;  1VQ4 A;  1H9J A;  5BR8 Q;  3EFX D;  2NZO A;  4B3T Q;  3J80 E;  1S5E D;  3EIV A;  4IPH A;  4QGU A;  1GOZ A;  1K8M A;  3BVG A;  4GS3 A;  4IUN A;  4GNX B;  2K33 A;  3FPU B;  2ZJR A;  4UAI A;  1LTL A;  3E9I A;  3KK7 A;  1DM0 B;  1EYC A;  3WOE A;  1G91 A;  2NZ1 D;  2PZW A;  3M4P A;  2PNR C;  3HOX B;  2WII B;  1TY0 A;  1AZQ A;  2KHS A;  3TS2 A;  5CC4 A;  4DV0 Q;  2E74 C;  5HY6 A;  1GHJ A;  4Y7N H;  3IRB A;  3C2P A;  3PV0 A;  2AUK A;  3IL8 A;  1VQF A;  3J7A F;  1SMY D;  1Y1V G;  1J5E Q;  4EQO A;  1IYV A;  1L0X B;  4U67 3;  4DR5 L;  3NBH B;  2C9O A;  4H7B A;  3GTJ H;  3SE0 A;  4BA1 I;  1EOV A;  4OHJ A;  4MTN A;  3RZO B;  3QG1 A;  1Q1E A;  5JOB A;  1L2F A;  2UUC L;  1GHK A;  3G4S A;  3EA6 A;  4PMW A;  4DR3 L;  3QOL A;  3NTI A;  3GV6 A;  3G71 A;  3M4O B;  5J22 A;  4R4C A;  2E2H B;  3BDL A;  4JYA L;  2WV6 D;  1PMR A;  1D5M C;  1VQG A;  4DV2 L;  5IY0 A;  4ME3 A;  2AUJ D;  3U9O A;  2N49 A;  1TS5 A;  4HAE A;  1TS4 A;  2RKS A;  2O4X A;  1Z6H A;  5KNC A;  2HQL A;  3S17 H;  2Z6B A;  2FFK B;  1KLG D;  4JBW A;  1S4Z A;  4IUR A;  3C46 A;  1DZ1 A;  2BDN A;  4TKO B;  1CSP A;  4GZY C;  3S14 B;  1G6P A;  2ICI A;  4OEM B;  2SDF A;  1E1O A;  2EIF A;  1TWF B;  1ZYR D;  3JC6 6;  2HDM A;  3M4Y A;  4FYD A;  4HMJ A;  4DK3 C;  3CC4 A;  5DM6 3;  5FJ8 H;  4RMF A;  3GTK B;  1I4R A;  2VQE L;  1JWU D;  4B9W A;  3NSW A;  5LMN Q;  1HZB A;  5FLM H;  1X32 A;  2B63 G;  4A3L G;  1CT1 D;  3EN2 A;  4ALP A;  1LAB A;  3MZ5 A;  4I65 A;  3FKI H;  1QB5 D;  1FNV A;  1CQV A;  3VYR A;  2KCC A;  5FKA C;  1F9R A;  4A3M G;  4KV6 A;  1YNX A;  1CUK A;  2EXD A;  3JAM E;  1XTC D;  3A8I E;  3SGI A;  1SRO A;  4EQN A;  2KA7 A;  3HOV G;  3E3X A;  1Y14 B;  1GUG A;  1GUO A;  4KKU A;  3ER0 A;  1CKM A;  1VQI A;  3I90 A;  1ONL A;  5IGC A;  1IHZ A;  4RCO A;  1ENC A;  3TP5 A;  3GP7 A;  1ASZ A;  1HUM A;  4GLV B;  4LF9 Q;  4B3S Q;  1WTO A;  5IP9 H;  1EIF A;  5D3I B;  5IT9 E;  2AQ2 B;  1Q46 A;  1WTR A;  4LF8 L;  1NMF A;  2KHJ A;  1J9O A;  1G2S A;  1HNW Q;  2OQ0 A;  3S15 B;  3KFU A;  4KHP Q;  2B8G A;  2OEO A;  5KNB A;  1KAW A;  2MJ8 A;  3IKJ A;  5EPJ A;  5CV5 A;  2RHS B;  1M1K C;  4JI1 L;  1N33 L;  4HCS A;  1YVC A;  2JK8 A;  4PMB A;  2Y0S G;  3C3L A;  1EQT A;  2C5C A;  1W6J A;  4POG A;  3OWE B;  5COR A;  3CHB D;  1LT6 D;  1IZ6 A;  2FIN B;  5IYD G;  4B3M L;  4CHT B;  1MGS A;  1D1I A;  4X66 L;  1JB3 A;  4A4I A;  1KRT A;  3VA7 A;  4JOI C;  1SE3 A;  3RLF A;  2PO4 A;  4C3J H;  5M5W H;  1PZI D;  1CHP D;  1VQP A;  1AP0 A;  4KD3 A;  2F0L A;  4APV A;  1HQM C;  5IIF A;  3S16 H;  4C1N K;  1B7Y B;  2EYH A;  4JI4 Q;  3GTO B;  2CWP A;  2K5H A;  1WCM G;  1H9S A;  1XYI A;  2G9D A;  3S1R H;  4DAV A;  2ATW A;  3S1N H;  2WKC A;  3HOY B;  2WAQ B;  4A3L H;  1R9T B;  3NTH A;  2IHF A;  4FXK C;  3PUW A;  3DXJ C;  4KHZ A;  5K36 H;  5C4X G;  3R93 A;  1G29 1;  4CDD C;  3KF6 B;  3NUC A;  3S2D H;  1QZG A;  2DY7 A;  2PI2 A;  3K57 A;  1U5K A;  2JA8 H;  3G6J B;  4AYB E;  4DK1 A;  2LSS A;  5M5W B;  1PFB A;  1ET9 A;  3AFP A;  1EZ8 A;  5C6A A;  4BS9 A;  4G4K A;  4EGV A;  1HHV A;  2G5D A;  3AB9 A;  3I2Z A;  3GTO H;  2Q8T A;  1CSQ A;  4R4Q A;  3KF8 A;  3HOZ G;  4LFB L;  2NVT H;  3D4R A;  1SMX A;  3NTK A;  3CCE A;  3X3N A;  2SNS A;  2OWO A;  1HZ9 A;  2EPB A;  4V0B A;  4DV5 Q;  5EKK A;  4IFD H;  5JJK A;  3TDQ A;  4OO1 G;  1YNJ D;  2A69 C;  1SYE A;  4C3I H;  4DV7 L;  2AWN A;  4KY5 A;  3URY A;  4FF4 A;  2F3V A;  5C0X G;  2HT1 A;  4XQN A;  3L2P A;  1Y69 U;  2LMC B;  3NQI A;  3ND8 A;  4A3G G;  4BY1 G;  5C4X H;  5LMU Q;  4PZ7 A;  1SBB B;  2RA4 A;  4JI0 Q;  1ML0 D;  3GTQ B;  4OWT B;  5LHY 1;  4WFN 3;  4GKK Q;  4YWK A;  2VUM G;  4GNX C;  5I2Y A;  5D14 A;  1SYF A;  1JE5 A;  4XIG S;  2CQA A;  4QJF A;  1IKL A;  4PZ6 A;  1QE6 A;  1PTO C;  2F0N A;  3CCM A;  5C3W A;  2P5Z X;  1SEB D;  1KAB A;  1EY8 A;  4HCE A;  3HOW G;  4F8M A;  3ITP A;  3I56 A;  1K83 B;  1BCP C;  1QUQ A;  3DWQ A;  5C3E G;  3Q24 A;  2XN9 C;  4DNT B;  4ZKC B;  3I4N G;  1PZK D;  2KQ3 A;  4LK1 C;  3ONA B;  1IBM Q;  3GTM H;  3NP8 A;  1TXY A;  4JK1 C;  1P8L A;  5DAU A;  1E3P A;  1MD2 D;  5GAH C;  3FRP B;  1LT5 D;  4TSS A;  5M3M G;  3OYY A;  3KLS A;  2B2V C;  1MHW C;  4QL5 A;  5GAD C;  2Z4I A;  1JMC A;  1VMP A;  5C0X J;  3SK5 A;  3A54 A;  1QJO A;  1BDO A;  2XWB B;  3K5M A;  2IL8 A;  4CDF C;  2WKD A;  1EYA A;  4A3K B;  2Z0S A;  4X62 L;  4B08 A;  2LKV A;  1HCZ A;  1PTO H;  2PNH A;  2WAQ E;  1HR0 Q;  4YCW A;  3K0X A;  4K5X A;  4GOP B;  3OWF A;  5FLX c;  2KBN A;  4LF7 Q;  3H09 A;  1I50 B;  2RDF A;  4RFB A;  4HIK A;  2JA8 B;  5FLM G;  2B63 H;  2QEX A;  5J3B A;  3PF4 A;  4NP5 A;  2PMZ B;  1YIJ A;  3JAM L;  2GVB A;  2UXB Q;  2E75 C;  4DR7 L;  3NEN A;  3D31 A;  4A3M H;  4DNI A;  1Q12 A;  1TR5 A;  4BY7 B;  2F0V A;  4ODG A;  2L11 A;  3S1M H;  3OIP A;  4FVM A;  1BBW A;  2I07 B;  4A3F B;  1PRT F;  4Y7N B;  1YNN D;  4XQQ A;  1SNM A;  1IW7 D;  3J7Y W;  3NEL A;  4DV1 Q;  2RDG A;  4UDU C;  2E2I B;  5M3F G;  2UXD Q;  3CAM A;  5JPN C;  4QIW E;  3A56 A;  1TWH H;  3EJI A;  3D6W A;  4Q0F A;  1K3R A;  4MNO A;  4ZQ3 A;  1IBK L;  1RTO A;  5AFW A;  3NXW A;  1HQR D;  4RAU C;  2DGY A;  4A3B G;  2EVB A;  4DAM A;  2QKI C;  4Y52 H;  2IW3 A;  5ISR A;  5IYB H;  3GTQ H;  4KLK A;  3P75 A;  4ZK9 B;  1J6Q A;  4DUY Q;  3N6R A;  4F7X A;  1SNO A;  3F2D A;  3J81 j;  2VQF L;  4LF5 Q;  4JVZ A;  4EVO A;  1FNU A;  1Y1W H;  4K0K Q;  5G3L D;  2RQX A;  1VQO A;  1VQ6 A;  3K7A H;  3I8Z A;  1KXL A;  2JQO A;  5KIX A;  4BA2 I;  1E0B A;  2K5V A;  4YY3 L;  3VYU A;  1MIU A;  1JJ2 A;  3GV3 A;  1GUN A;  2E2I H;  1IBL L;  2ZT9 C;  5E4X A;  2UXD L;  3K5O A;  4CKB A;  2Z6K A;  4EX5 A;  2QDB A;  2NVQ B;  3J81 c;  3CCQ A;  1BQQ T;  2MFI A;  2FJ2 A;  2JA7 B;  4DR2 L;  1HNZ L;  1TWF H;  3T56 B;  1PLF A;  2ICE C;  2K52 A;  4YCV A;  5CR3 A;  2QEJ C;  4CJ0 B;  5C4J B;  1DXM A;  3HG9 A;  2QIL A;  1N8R C;  1QG7 A;  4RGM A;  1K8A C;  2KCM A;  3HOV H;  3PCO B;  3QJY A;  4I7A A;  5HGQ A;  2ZTD A;  1RIP A;  2DNE A;  2Y0S B;  4C3H H;  1XMO Q;  3TZD A;  2EQS A;  1B70 B;  2CFM A;  5FOB B;  1EUJ A;  5BR8 L;  3LWE A;  1BBX C;  4IZ8 A;  1T5E A;  2C35 B;  2D62 A;  4L5T A;  1GUW A;  2KEN A;  1JWS D;  3A7L A;  4TVA B;  1VDZ A;  2RF4 A;  3T53 B;  3RNU A;  3N52 A;  1YZ6 A;  3KYH C;  1N36 L;  4HJ8 A;  1VF5 C;  1QNU A;  4XXE A;  4BXX G;  1SXT A;  1X3Q A;  1XMQ L;  2EY1 A;  3MA2 B;  2EY6 A;  2R92 H;  2JA9 A;  4X64 L;  3RZO H;  4DR6 L;  1I4P A;  4OIK A;  3M7N A;  5E1F A;  5NUC A;  1GD7 A;  1WTH A;  2JYO A;  4IPC A;  3I4N B;  3TEH B;  2EY5 A;  4AIM A;  1RCV D;  2F0I A;  1EZ6 A;  4IPD A;  1BF4 A;  1W3S A;  4HJ9 A;  4JI7 L;  4IFD G;  1SDF A;  2Q8R E;  2GN5 A;  4GN4 B;  5I2X A;  1FJG L;  1JJC B;  1OXU A;  2AWO A;  5M5Y H;  5JJI A;  3E0E A;  4A3C H;  3HOU B;  3AYH B;  4HIM A;  1I3Q B;  1M8A A;  1EWC A;  5M5X B;  4LJZ C;  2N8N A;  2F0S A;  2A6H D;  4PMC A;  1JOK A;  2F52 A;  2OQK A;  3NHH A;  3ULL A;  3S1N B;  3M9B A;  4L8J A;  2L9H A;  3J7Z C;  4WJ3 M;  2K04 A;  2A73 B;  2MP1 A;  3CRK C;  5IGG A;  1HTL D;  1EFI D;  1WD0 A;  4DV3 Q;  4AYB G; 
#chains in the Genus database with same CATH homology
 2EZV A;  1LTG D;  5C0X H;  1HTP A;  4C56 C;  3GTL B;  4C3I G;  4RHS A;  4A3I B;  2B2V A;  1EY6 A;  4OL7 A;  3OPO A;  5M5Y B;  2RBM A;  3NBI A;  1AEX A;  3VR6 A;  1TII D;  1ENF A;  4O1N A;  1QWY A;  1D5X C;  2BA1 A;  4KY6 A;  4J1M A;  2Z4H A;  1UAP A;  1EWH A;  1GUS A;  1LAC A;  5IT9 L;  4MHE A;  1KDB A;  2K03 A;  2XRS D;  1ZEQ X;  4C1N I;  4C3H G;  4FP5 D;  2RSN A;  1JOQ A;  4R9W A;  1BCP B;  3TME A;  2F0O A;  4C3H B;  2X6G A;  2K05 A;  4XQJ A;  2EDG A;  1WVL A;  1TWC B;  2KJX A;  3GTP B;  1PYW D;  1F2Z A;  1LT4 D;  4KMU C;  3HGB A;  3PMF A;  1M4V A;  1SAP A;  2FMM A;  2LFN A;  1GUT A;  4KHV A;  3GO5 A;  1C8C A;  2BCO A;  3NWS A;  1CHQ D;  3TP8 A;  1I6V C;  2CW0 D;  4BWG B;  3EVQ A;  5EGT A;  4KJN A;  1JE4 A;  4XTC S;  1PRT B;  2A6E D;  3VR2 A;  4K2K A;  5I9O A;  1EEI D;  4A3B B;  1YNN C;  4IUV A;  4KN4 C;  4KN7 C;  2M00 A;  3KLS X;  5ELD A;  4K2L A;  1LTS D;  1GXD C;  1STY A;  3RUZ A;  3DWA A;  4S3S A;  1A3U A;  1LO5 D;  1RJT A;  2K32 A;  4ZAI A;  5FO7 B;  2K01 A;  4HTH A;  3M85 A;  2L4N A;  1Q8I A;  1STA A;  2MPM A;  2IPK D;  2B39 A;  5EPK A;  2EJF C;  3FVQ A;  2NN6 H;  3C1E A;  4A3M B;  3K5N A;  1G2T A;  4RH6 A;  4DXF A;  3BG3 A;  2RDH A;  4ULL A;  1SNC A;  1JWM D;  2F03 A;  3TBI B;  3MXU A;  1CZG A;  3HS0 C;  1DON A;  1S5C D;  2NB0 A;  2E2J B;  3BDO A;  3S16 B;  3DEO A;  3FEW X;  1Y8N B;  1TQO A;  1SNP A;  1V1P A;  1QNK A;  1A6X A;  1STB A;  1BUV T;  1A2U A;  2R3Z A;  1V8Q A;  1EEF D;  1SYG A;  4K8J A;  1CA5 A;  4FO2 A;  4R8I A;  3I4M B;  3H3V C;  2JA6 B;  5BN3 A;  3FKI B;  2PYK A;  1GJX A;  1DD2 A;  5T1G A;  2FHT A;  5DNF A;  1CA6 A;  1A15 A;  2TSS A;  2B2T A;  3ERO A;  1IL8 A;  2F3W A;  1XXG A;  2JSO A;  3H94 A;  2EJG C;  5J1Z A;  2NVT B;  1EY0 A;  3R3O A;  1TWG B;  4J6H A;  4HED A;  2OF1 A;  2K5Q A;  2BE5 C;  1CTM A;  1LTB D;  4ME5 A;  2DNC A;  5JEA H;  2O2L D;  4HMI A;  2OXP A;  4O42 A;  2NN6 I;  4HSV A;  5C4Z A;  2SOB A;  4QB4 A;  2EE1 A;  5DM7 3;  4H13 C;  3K0Y A;  4QUF A;  3VA5 A;  3Q0A A;  4L63 B;  1D6E C;  3R2T A;  4OGQ C;  5FO9 B;  1R4P B;  1ET6 A;  2L0C A;  2IJ0 A;  3S1R B;  3J7A V;  1CQF A;  3TP6 A;  4V19 0;  4E6I A;  1AZP A;  2R93 B;  3KUP A;  2QF7 A;  5JVH 3;  1SND A;  3SVM A;  2ID0 A;  1E2V A;  4RGT A;  2B2U A;  1FNW A;  5T1I A;  4CKC A;  1A3V A;  3H6M A;  3KBX A;  1S5B D;  1ESF A;  1WTW A;  5EJW A;  3PUV A;  2N55 A;  3A55 A;  4IFD J;  1EY4 A;  2XIW A;  1U4L A;  2F0J A;  2G9H D;  1HXY D;  5A2Q L;  3SK4 A;  3DMU A;  2EYO A;  5CV9 A;  1LT3 D;  1F77 A;  1B3A A;  1C4Q A;  3KLR A;  1SE2 A;  3MTS A;  2WP8 J;  1S5F D;  3HZX A;  3MC0 B;  2O5I C;  3OSO A;  1RD9 D;  3P7J A;  1O7Z A;  2K1B A;  4KKT A;  2F0K A;  1B2T A;  3H91 A;  1CM9 A;  2PW5 A;  5E3F A;  2F4I A;  1STN A;  1LV9 A;  3MEH A;  4U68 A;  2Z1C A;  1TWH B;  1SMY C;  4KTA A;  2IX0 A;  5IOD A;  4RWS C;  1O80 A;  2A5H A;  3MXN A;  5JEA J;  4OIJ A;  2B8F A;  1JQY D;  2F0W A;  3FMC A;  3R8B A;  4FF3 A;  3S1Q B;  4DAP A;  1X3P A;  4NMZ A;  1BNZ A;  2VNU D;  2KCN A;  1PXU A;  1K8O A;  1WTP A;  1SSO A;  3QWN A;  2KVM A;  3LNN A;  2L5T A;  1TT2 A;  3E6Z X;  3K58 A;  4QMG A;  3T16 A;  4B9X A;  4CBV A;  3DUZ A;  3Q23 A;  4X3U A;  1STH A;  2EYF A;  4PV1 C;  2B2U C;  5C4X B;  4DA2 A;  5FLX E;  2NBF A;  3I3C A;  4ZRZ A;  3ERQ A;  4CJ1 B;  3L3O C;  4FF2 A;  4M8A A;  4KJO A;  4FF1 A;  4A3J B;  2F0H A;  3CKI B;  1DOM A;  2KOL A;  1OXS C;  4G7H C;  3E5S A;  2ZXR A;  1DOL A;  2JA5 B;  4IUP A;  1I4G A;  2KED A;  5TSS A;  3SHL A;  2D2C C;  2B2T C;  4DNR B;  5D3D A;  2F0G A;  3E0J A;  3F2U A;  1JOO A;  2MUY A;  3NPP A;  4A3G B;  1FR3 A;  1Y8O B;  1SYD A;  1PTO D;  1SYC A;  4AYB B;  3VR3 A;  4ZYS A;  3CRL C;  4F88 A;  3VYS A;  2B2Y A;  3LWU A;  4G57 A;  2R92 B;  1EY7 A;  5JJZ A;  4N9T A;  1HA5 A;  4QCL A;  5KGU A;  4ZLT F;  1F2Y A;  5FLX L;  2A69 D;  1TY2 A;  2E76 C;  1KAA A;  1ENA A;  2X69 A;  3D4D A;  5EBC A;  2XWJ B;  1V1O A;  3AMU A;  1H9R A;  5I4D A;  4DU9 A;  1HA6 A;  1JIC A;  2F0U A;  4H0L C;  1BCP D;  4IUU A;  1NUC A;  2KEC A;  1PRT D;  3K7A B;  4HN7 A;  2IX3 A;  4XT1 B;  4OO1 I;  5EBD A;  1U4P A;  5ELB A;  1TU2 B;  3M7G A;  5COY A;  2L1B A;  4ID6 A;  5BN5 A;  2JE6 I;  2M9V A;  1WTQ A;  2D5D A;  3J81 E;  2A6E C;  1KDC A;  4WOR A;  2NVX B;  1CI3 M;  1PTO F;  2NN6 G;  4IUT A;  1LTT D;  1ESR A;  2CHB D;  2CVR A;  3WOF A;  1A2T A;  1VCI A;  1FYC A;  4H44 C;  5IGE A;  3DWP A;  1V1P B;  2IWH A;  1Y1W B;  5M3F B;  3V05 A;  5K36 G;  1NCV A;  2H4O A;  1EU4 A;  3NQT A;  2IT1 A;  2CW0 C;  3IAY A;  3QO2 A;  1SE4 A;  3VR4 A;  2MGS A;  2O5J C;  1WTX A;  2PQE A;  3GTM B;  5BN4 A;  4K14 A;  2JXM B;  3SR1 A;  1F2M A;  1FD7 D;  4XDX A;  4X3T A;  4XT3 B;  3C1F A;  1NSN S;  5KEE A;  3ZYY X;  2ZXP A;  5C5L A;  4QIW B;  4X3S A;  4WJW A;  4RHR A;  2L12 A;  4KD4 A;  1XX8 A;  1BOS A;  2EOT A;  4A3D B;  4LMQ D;  3TP7 A;  5EQ0 A;  2PPB C;  5G3L F;  5CBA E;  1PRT C;  1UUP A;  2OT2 A;  4C3I B;  2EYM A;  2EXZ A;  5EPL A;  3A8K E;  3OOC A;  3FPP A;  3HOV B;  2YYZ A;  3OHX C;  1KLU D;  2JEA I;  1D5Z C;  2YU9 B;  1FGB D;  1II3 A;  2F0Q A;  1OO9 B;  1BO0 A;  4C3J G;  4A3E B;  3Q6S A;  2J0T D;  2K5D A;  4BBR B;  3GTJ B;  3I73 A;  5I6Y A;  2K6A A;  2NTS A;  4K5W A;  2BDO A;  1EY9 A;  2ENB A;  3HP3 A;  2J7Z A;  3I72 A;  1IKM A;  1DCZ A;  3G7L A;  2B2Y C;  3Q22 A;  2LY7 A;  3ND9 A;  4NDX A;  3X3M A;  4ZUJ A;  5IOC A;  4CGY B;  2R6G A;  3D6C A;  1A3T A;  2X6L A;  5C4H A;  1LTI D;  3MXG A;  3OMG A;  2HUG A;  5ELC A;  5F2D A;  3BS1 A;  1O7L A;  3D3R A;  2HDL A;  2XNA C;  1UEA B;  2BOS A;  2F0D A;  5JAV A;  1QOH A;  1TS3 A;  4IFD I;  5JPM C;  2K28 A;  3SK6 A;  1WTV A;  3GQB A;  1B44 D;  3SEB A;  2BE5 D;  2NTT A;  3RZD B;  4CJ2 C;  1BCP F;  1Q1B A;  4P2C B;  3GD7 A;  2V4D A;  3NK9 A;  1B50 A;  4KKS A;  3HOZ B;  1LTA D;  1KTK A;  3BYY B;  3I70 A;  4ZUI A;  1VMC A;  4HR7 B;  3W2D A;  3I4L A;  2EY2 A;  3W3A A;  2J4X A;  3MAQ A;  3VYT A;  4BY1 B;  3BZD B;  4DGZ A;  3UI2 A;  3TSS A;  4BBS B;  3J80 L;  1Q90 A;  3L7Z C;  3M3Y B;  1B9M A;  3OMC A;  3I91 A;  3PO3 B;  3T13 A;  1EU3 A;  4PNY A;  3PUZ A;  5C3X A;  2JP1 A;  3IFD A;  4RKB A;  4A93 B;  1PTO B;  3KBG A;  2D9U A;  3S2H B;  3PO2 B;  1IW7 C;  4EQP A;  2DY8 A;  4K6L A;  3L9A X;  1ZKO A;  1AW7 A;  3S17 B;  4IUQ A;  4XYO A;  1NR2 A;  1G8Z D;  1QIL A;  1Y1V B;  1U9R A;  1F9P A;  3PIP 3;  1HPC A;  1VF7 A;  3TZU A;  1L0Y B;  1KDA A;  2WAC A;  2NUC A;  2A68 D;  5EKL A;  1MI2 A;  3PUY A;  1EY5 A;  1PFN A;  4IN3 A;  3RMH A;  1IYU A;  3P1H A;  1OXT A;  4K6D A;  4KY7 A;  1D1K A;  3DM1 A;  5CBE E;  2A74 C;  1MSG A;  2EYJ A;  2F0F A;  2RSO A;  2BA0 A;  1SNQ A;  1RKN A;  2EYP A;  5IGF A;  2B2W A;  4IQZ A;  1B4O A;  1ROD A;  2EYL A;  2F0M A;  4NW2 A;  3NE5 B;  2HCI A;  1O78 A;  5D65 A;  2KUM A;  3DHQ A;  1WD1 A;  4N9P A;  1CZW A;  2XVS A;  1E2Z A;  1C48 A;  3MFY A;  1ILQ A;  4OO1 H;  5E4W C;  2XRQ D;  3LX0 A;  1HRJ A;  1YNJ C;  1S5D D;  1V43 A;  4IAL A;  2Z8L A;  5CV7 A;  4M1U B;  2F0T A;  1XWE A;  4C3J B;  3BYT B;  3T51 B;  5HUR A;  5IGB A;  2PCF B;  3BVM A;  4ZKB B;  5LL6 X;  3CQZ B;  1RTN A;  1UNS A;  1D2B A;  5KYI A;  1I4Q A;  4X3K A;  4WRD A;  4DF7 A;  5ELF A;  5KRU A;  1Z47 A;  3P20 A;  2F0E A;  2AQ1 B;  3D4W A;  1SYB A;  1OXX K;  4Q5V A;  2H1E A;  4DFA A;  3TN2 A;  2F1M A;  5CV6 A;  2IX1 A;  4RGO S;  1MSH A;  1KNA A;  1RF2 D;  3A8J E;  3BDC A;  2PZU A;  1BR9 A;  3MXP A;  1B9N A;  3A7A B;  2VUM B;  1EIG A;  1Z7T A;  2EJM A;  1QCB D;  2L55 A;  3MFG A;  1STG A;  3D8G A;  3PUX A;  1O7Y A;  3V2T A;  1Q3L A;  1H9K A;  5JEA G;  2TMP A;  2SNM A;  3OIQ A;  1F9Q A;  2HQE A;  1H9M A;  3VR5 A;  3H0G B;  2I46 A;  4ILW A;  1J8I A;  5FO8 B;  3DEP A;  3K59 A;  2HCC A;  3WDN A;  3J81 L;  2NYZ D;  2Q8I B;  4KK7 A;  2KEE A;  1CFM A;  4TRD A;  2PZT A;  5EKI A;  4FXG C;  3QOJ A;  4FXD A;  4PQX A;  4K8I A;  3SXH A;  1PDQ A;  2R61 A;  1EQV A;  3HOW B;  3MWY W;  1U4R A;  1PZJ D;  4Z9C B;  2WB1 B;  1EL0 A;  3GTG B;  4XYQ A;  5CV4 A;  3QIA A;  4CKE A;  1RHP A;  3R2I A;  1H9S B;  2VB2 X;  1TVX A;  4MN3 A;  4L6T B;  5C0X I;  3SK8 A;  3S2D B;  1EYD A;  4RKL A;  3FDT A;  5CMD A;  1ILP A;  1F9S A;  1ZXT A;  2K7V A;  1RDP D;  3NWT A;  2K5W A;  3PIO 3;  3V96 A;  5A2Q E;  4RCN A;  2R7Z B;  1HFG A;  2JEB I;  2B63 B;  2NWG A;  1B53 A;  2B2W C;  2A68 C;  1HFN A;  4HSP A;  5M3M B;  3CU7 A;  3SDZ A;  4G7O C;  5FK9 C;  4J8Q A;  1MBY A;  4FNF A;  4DK0 A;  5CYU A;  3QB3 A;  4YIJ A;  1TS2 A;  3O13 A;  3T4A C;  2DN8 A;  1JC7 A;  1STE A;  4DAY A;  3K5L A;  1AN8 A;  2XSC A;  3HEJ A;  1I4H A;  5DEH A;  5C5M A;  1JR0 D;  5ELE A;  1W6K A;  1LTR D;  5LL6 S;  4R8N A;  4QF4 A;  2VXW A;  1TKW B;  1E2W A;  2NVY B;  4NKL A;  4F87 A;  1PFM A;  1AFP A;  1BXT A;  2A6H C;  4LAA A;  5KND A;  1JCK B;  1R4Q B;  2N88 A;  5C44 B;  2WIN B;  4QUC A;  1TWA B;  1SFO B;  3BVZ A;  2QCP X;  1ZYR C;  5I6W A;  4TQU S;  1I6H B;  2SEB D;  2VB3 X;  5IGD A;  1EOT A;  4KI0 A;  2PW7 A;  1NR4 A;  1ICW A;  5I9P A;  5C3E B;  1G6Z A;  1T5X D;  2FMC A;  3S1M B;  5KYL A;  5CGK A;  1LLR D;  3K6O A;  4ABN A;  5K5P A;  4DXG A;  2LS0 1;  5A35 A;  3S9W A;  3HKZ B;  2E2D C;  2F0P A;  3RD4 A;  1NAP A;  1KNE A;  4DN4 M;  5HGT A;  2RVL A;  4C2M B;  1CK1 A;  1SJH D;  4K5V A;  1I4X A;  1EIH A;  1SJE D;  5M9O A;  1JOR A;  5CV8 A;  3EQL C;  4RGN A;  2MHV A;  3U9S A;  1F2L A;  1B1Z A;  4G7Z C;  4RA8 A;  3NBH A;  1Y8P B;  2GA4 B;  1DJR D;  1DYQ A;  1U4M A;  5J39 A;  2M2L A;  4I7Z C;  1OXV A;  4MIU A;  1WCM B;  1DOK A;  1HUN A;  3OW7 A;  2ZXO A;  3AU7 A;  2AQ3 B;  3HRZ C;  3MHB A;  3IFT A;  3MVV A;  5JVG 3;  1H9J A;  3EFX D;  3J80 E;  1S5E D;  1GOZ A;  1K8M A;  3BVG A;  4IUN A;  2K33 A;  3FPU B;  4UAI A;  3KK7 A;  1DM0 B;  1EYC A;  3WOE A;  1G91 A;  2NZ1 D;  2PZW A;  2PNR C;  3HOX B;  2WII B;  1TY0 A;  1AZQ A;  2KHS A;  5CC4 A;  2E74 C;  1GHJ A;  3C2P A;  3PV0 A;  2AUK A;  3IL8 A;  3J7A F;  1SMY D;  4EQO A;  1IYV A;  1L0X B;  4U67 3;  2C9O A;  4H7B A;  3SE0 A;  4BA1 I;  4OHJ A;  3RZO B;  3QG1 A;  1Q1E A;  5JOB A;  1GHK A;  3EA6 A;  4PMW A;  3QOL A;  3NTI A;  3GV6 A;  3M4O B;  5J22 A;  2E2H B;  3BDL A;  2WV6 D;  1PMR A;  1D5M C;  2AUJ D;  3U9O A;  1TS5 A;  4HAE A;  1TS4 A;  2RKS A;  2O4X A;  1Z6H A;  5KNC A;  2FFK B;  1KLG D;  4JBW A;  1S4Z A;  4IUR A;  3C46 A;  1DZ1 A;  2BDN A;  4TKO B;  4GZY C;  3S14 B;  2ICI A;  2SDF A;  1TWF B;  1ZYR D;  2HDM A;  3M4Y A;  4FYD A;  4HMJ A;  5DM6 3;  3GTK B;  1I4R A;  1JWU D;  4B9W A;  3NSW A;  1X32 A;  1CT1 D;  1LAB A;  3MZ5 A;  4I65 A;  1QB5 D;  1FNV A;  1CQV A;  3VYR A;  2KCC A;  5FKA C;  1F9R A;  4KV6 A;  3JAM E;  1XTC D;  3A8I E;  4EQN A;  2KA7 A;  1GUG A;  1GUO A;  4KKU A;  3I90 A;  1ONL A;  5IGC A;  1IHZ A;  4RCO A;  1ENC A;  3TP5 A;  3GP7 A;  1HUM A;  1WTO A;  5D3I B;  5IT9 E;  2AQ2 B;  1WTR A;  1J9O A;  1G2S A;  3S15 B;  2B8G A;  2OEO A;  5KNB A;  2MJ8 A;  3IKJ A;  5EPJ A;  5CV5 A;  4HCS A;  4PMB A;  3C3L A;  1EQT A;  2C5C A;  1W6J A;  3OWE B;  5COR A;  3CHB D;  1LT6 D;  2FIN B;  4CHT B;  1MGS A;  1D1I A;  1JB3 A;  3VA7 A;  1SE3 A;  3RLF A;  2PO4 A;  1PZI D;  1CHP D;  1AP0 A;  4KD3 A;  2F0L A;  1HQM C;  5IIF A;  4C1N K;  2EYH A;  3GTO B;  1H9S A;  1XYI A;  2G9D A;  4DAV A;  2WKC A;  3HOY B;  2WAQ B;  1R9T B;  3NTH A;  4FXK C;  3PUW A;  3DXJ C;  4KHZ A;  5K36 H;  3R93 A;  1G29 1;  3NUC A;  2DY7 A;  3K57 A;  3G6J B;  4DK1 A;  5M5W B;  1PFB A;  1ET9 A;  1EZ8 A;  5C6A A;  4BS9 A;  4G4K A;  4EGV A;  1HHV A;  3AB9 A;  2Q8T A;  3KF8 A;  3D4R A;  3NTK A;  3X3N A;  2SNS A;  2EPB A;  4V0B A;  5EKK A;  4IFD H;  3TDQ A;  4OO1 G;  1YNJ D;  2A69 C;  1SYE A;  2AWN A;  4KY5 A;  3URY A;  4FF4 A;  2F3V A;  5C0X G;  4XQN A;  1Y69 U;  2LMC B;  3NQI A;  3ND8 A;  1SBB B;  2RA4 A;  1ML0 D;  3GTQ B;  5LHY 1;  4WFN 3;  5I2Y A;  5D14 A;  1SYF A;  4XIG S;  2CQA A;  1IKL A;  1QE6 A;  1PTO C;  2F0N A;  5C3W A;  1SEB D;  1KAB A;  1EY8 A;  4HCE A;  4F8M A;  3ITP A;  1K83 B;  1BCP C;  3DWQ A;  3Q24 A;  2XN9 C;  4DNT B;  4ZKC B;  1PZK D;  2KQ3 A;  4LK1 C;  3ONA B;  3NP8 A;  4JK1 C;  5DAU A;  1MD2 D;  3FRP B;  1LT5 D;  4TSS A;  3KLS A;  2B2V C;  2Z4I A;  1VMP A;  5C0X J;  3SK5 A;  3A54 A;  1QJO A;  1BDO A;  2XWB B;  3K5M A;  2IL8 A;  2WKD A;  1EYA A;  4A3K B;  4B08 A;  2LKV A;  1HCZ A;  1PTO H;  4K5X A;  3OWF A;  3H09 A;  1I50 B;  2RDF A;  4RFB A;  2JA8 B;  4NP5 A;  2PMZ B;  3JAM L;  2E75 C;  3D31 A;  1Q12 A;  1TR5 A;  4BY7 B;  2F0V A;  4ODG A;  2L11 A;  3OIP A;  4FVM A;  2I07 B;  4A3F B;  1PRT F;  4Y7N B;  1YNN D;  4XQQ A;  1SNM A;  1IW7 D;  3J7Y W;  2RDG A;  4UDU C;  2E2I B;  5JPN C;  3A56 A;  3EJI A;  3D6W A;  4Q0F A;  4ZQ3 A;  1RTO A;  5AFW A;  3NXW A;  1HQR D;  4RAU C;  2EVB A;  2QKI C;  2IW3 A;  5ISR A;  3P75 A;  4ZK9 B;  3N6R A;  4F7X A;  1SNO A;  4EVO A;  1FNU A;  5G3L D;  2RQX A;  3I8Z A;  5KIX A;  4BA2 I;  1E0B A;  3VYU A;  3GV3 A;  1GUN A;  2ZT9 C;  5E4X A;  3K5O A;  4CKB A;  2QDB A;  2NVQ B;  1BQQ T;  2JA7 B;  2FJ2 A;  3T56 B;  1PLF A;  2ICE C;  5CR3 A;  2QEJ C;  4CJ0 B;  5C4J B;  1DXM A;  3HG9 A;  2QIL A;  1QG7 A;  4RGM A;  3QJY A;  2DNE A;  2Y0S B;  3TZD A;  5FOB B;  3LWE A;  1BBX C;  4IZ8 A;  1T5E A;  2D62 A;  1GUW A;  1JWS D;  3A7L A;  1VDZ A;  3T53 B;  3N52 A;  1VF5 C;  1QNU A;  4XXE A;  1SXT A;  1X3Q A;  2EY1 A;  3MA2 B;  2EY6 A;  1I4P A;  4OIK A;  3M7N A;  5E1F A;  5NUC A;  2JYO A;  3I4N B;  2EY5 A;  1RCV D;  2F0I A;  1EZ6 A;  1BF4 A;  4IFD G;  1SDF A;  2Q8R E;  5I2X A;  1OXU A;  2AWO A;  3HOU B;  1I3Q B;  1M8A A;  1EWC A;  5M5X B;  4LJZ C;  2F0S A;  2A6H D;  4PMC A;  1JOK A;  3NHH A;  3S1N B;  4L8J A;  2L9H A;  2K04 A;  2A73 B;  2MP1 A;  3CRK C;  5IGG A;  1HTL D;  1EFI D;  1WD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...