1WTRA

Hyperthermophile chromosomal protein sac7d single mutant m29a in complex with dna gcgatcgc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtrA00
1DOKA 1QG7A 4RA8A 5CBAE 2HDLA 2HUGA 1ZXTA 1B3AA 1RTNA 3FDTA 1HHVA 1NR2A 1Q3LA 2KUMA 4HEDA 4NW2A 4R9WA 2B2YA 4X3KA 1X3PA 1DOLA 5CMDA 1WTVA 1WTRA 1CM9A 5EPJA 2X69A 2MP1A 1XYIA 1B2TA 1HRJA 1ML0D 2B2UA 1BO0A 1O7YA 1VMCA 1IL8A 2RSNA 1TVXA 1PFMA 2B2VC 1G91A 2Q8TA 4XDXA 1EOTA 1MI2A 1GUWA 1MGSA 1JE4A 1F9SA 2CVRA 4X3SA 1WTQA 2L4NA 2NYZD 1WTXA 3MWYW 1HUMA 1WTPA 1U4PA 1U4LA 1AP0A 2KEDA 1C8CA 1ESRA 4IUQA 2BDNA 4RWSC 2B2TC 1AZQA 1EL0A 3KBXA 1HFNA 4ZKCB 1IKLA 2K04A 2K1BA 3IL8A 2N88A 2L12A 4X3UA 5AFWA 2J7ZA 3D6WA 2MJ8A 2L9HA 4ZKBB 4HAEA 2X6LA 1CA5A 1IKMA 5T1IA 1G2TA 2HDMA 1WTOA 2EE1A 3SVMA 3F2UA 5D14A 1U4RA 3LWEA 1WD1A 1HA6A 2R3ZA 1B53A 2RSOA 2M2LA 2JYOA 3G7LA 5CORA 1G2SA 2NZ1D 2JP1A 2K01A 1KNAA 1PLFA 1SDFA 5E4XA 1RJTA 1EIHA 2Q8RE 2FFKB 1E0BA 1O7ZA 1KNEA 4XT3B 3I3CA 1SAPA 5EKIA 2DY7A 1JICA 1SSOA 2MGSA 2NWGA 3I8ZA 4QUFA 4R8IA 2DY8A 2L11A 4UAIA 1MSHA 5EJWA 3I90A 1ILQA 2B2WC 3P7JA 2B2VA 4CJ1B 2K05A 4ZLTF 1B50A 5E4WC 1RTOA 4IUPA 4IURA 2HCCA 3HP3A 4U68A 4DN4M 1J8IA 1F9RA 1VMPA 3QO2A 4OIJA 2KOLA 5T1GA 4QUCA 1DOMA 5DNFA 3N52A 1QE6A 1AZPA 1X32A 2FMMA 2KECA 5EPKA 5EPLA 1EIGA 1NCVA 2X6GA 2B2TA 4IUUA 1WTWA 1CA6A 2FHTA 3DM1A 1U4MA 5COYA 2B2YC 2RA4A 1WD0A 4O42A 4HCSA 2H1EA 4CJ2C 4HSVA 1ILPA 4X3TA 1QNKA 1BNZA 2B2UC 2D9UA 1J9OA 4MHEA 4OIKA 2K03A 1A15A 2EPBA 1XX8A 2VXWA 1HUNA 1NAPA 3Q6SA 1BBXC 3I91A 3DEOA 3TN2A 2KEEA 2KVMA 3FPUB 1B4OA 2FJ2A 2EOTA 2RVLA 3ONAB 5CBEE 1PDQA 1BF4A 1PFNA 2XIWA 1S4ZA 2IL8A 1EQTA 2HCIA 1PFBA 4IUVA 3R93A 3GV3A 1WVLA 1HFGA 4XT1B 1F9QA 3H91A 1DZ1A 1ICWA 4IUTA 3IFDA 2SDFA 1M8AA 1NR4A 2B2WA 4ZK9B 1DONA 2FINB 1O80A 1F2LA 1X3QA 2MPMA 3GV6A 4RAUC 1RHPA 4MN3A 3TZDA 1G6ZA 5D65A 4LMQD 3DEPA 2L1BA 1RODA 3KUPA 1MSGA 3MTSA 1F9PA 5JJZA 1LV9A 2N55A 3UI2A 4ZAIA 2K28A 5EQ0A 4CJ0B
chains in the Genus database with same CATH superfamily
1RDPD 1UE1A 2QDBA 1PZJD 1B3AA 1KHIA 3FKIH 4DK3C 4HEDA 2ZM6Q 4X3KA 4A3FB 4G7OC 3GTKB 4H0LC 1UE5A 3AB9A 3M3YH 3MXNA 1S72A 3JAML 2PCFB 4LF6L 3QOJA 4JBMA 3T16A 4C1NI 3Q24A 1SBBB 1CKNA 1KAAA 2SNSA 4OXPA 2AHOB 2OXPA 5EKLA 3S1MH 1AP0A 5JVH3 3GTGB 3AMUA 1GO3E 1IKLA 2NN6I 1VF5C 3RN5A 3S15H 3CCUA 3KLSA 2J7ZA 3D6WA 1EWCA 3HG9A 3HOUB 2ZJQA 1SMYD 3V05A 5HGTA 1DYQA 2RSOA 4A3CG 4K6LA 2M2LA 1J6QA 3E0JA 4A3JG 1I6VC 3Q23A 2B39A 3HKZG 1YI2A 2JA7B 1OXUA 2K7VA 5A35A 1I4GA 1JICA 1I4QA 3DWQA 5M5YB 2A68C 2PQEA 4DV7L 3OTOL 1XPUA 5EJWA 2Q2HA 2B2VA 2BA1A 2G9HD 4B3TL 1STYA 1VQOA 2AQ1B 1YNJC 1L0WA 3HOYH 2R7DA 1A3TA 2F0JA 1HNZQ 1MJCA 5FJ8H 4PZ8A 1HCZA 2NTSA 4DK6C 5J39A 3GDEA 4BA1I 4JI6Q 3HKZE 1L1OB 1HNXL 1PH8A 1JJ2A 1K8GA 2LSSA 1JB3A 2B2UC 2D9UA 3DM3A 2R7ZB 3J81j 4A3MG 3TN2A 4IPGA 5DM63 3OYYA 3PIOA 1PYSB 3E3XA 5JOBA 3TZUA 4K0KL 1STNA 5IWAL 1STBA 5EBCA 1PA6A 5C5LA 2NVYH 1LTRD 1UNSA 1SXTA 1JJGA 4V0BA 1QG7A 1R9TB 1VQNA 3OMCA 3RNUA 4CHTB 2B2YA 3S1RH 1EU3A 2F52A 2KJXA 5IGDA 4A3CH 1LTID 1QUQA 1SLJA 4EQPA 3K6OA 2E5LQ 4A3JH 5IP9G 5LMNW 1HZAA 1MI2A 4KHZA 4ALPA 1WTQA 4OO1H 2NYZD 5C4XB 3MWYW 3R2TA 1BVSA 1PH6A 4P73A 2JXMB 4ID6A 3KK7A 2KEDA 1SYBA 5KNBA 3K5LA 4A93B 1EL0A 1N9WA 2A6HC 1NTGA 2K1BA 4POGA 4GKJQ 4KMUC 4ILWA 4BS9A 2EIFA 4LF9Q 2PI2A 1EY8A 4HAEA 5LMUQ 3GTPB 1RL2A 4R4IA 1FNVA 5M5WH 1PRTD 1Q8KA 4LFCQ 1OTCA 2CWAA 4DR1Q 3P20A 3D0FA 2JP1A 2F0UA 4A3EG 4FXKC 3U4ZA 2R92G 1CSPA 3HOVG 1SSOA 4HJ9A 3PUXA 3H0GB 4N9PA 4FVMA 3P75A 5DM73 1TWAB 2Y0SG 4EQNA 3S9WA 2A68D 3X3MA 4DAMA 2ZM6L 4F7XA 3WOFA 3NUCA 2D62A 3PSIA 4FF2A 3UDXA 2XWJB 3KJPA 4JI4Q 3HOWB 1G8ZD 1TXYA 2PMZB 2VL6A 3B6YA 5EPLA 1WTWA 4JV5L 5EAYA 3VR5A 2A6EC 1HXYD 4LF4Q 3HOZG 1IW7C 5COYA 3A5UA 1G291 4O42A 1KL9A 2PW5A 1KDCA 4ZUJA 3CCQA 3AU7A 4A3LG 2IX1A 1SNDA 1LYLA 1VQCA 1BBXC 4YHHQ 2Y0SE 3IKJA 3EVQA 1A0IA 2BH2A 2NB0A 2C5CA 4FP5D 1MIUA 1CHPD 2F1MA 4IQZA 4IUVA 2E74C 1HFGA 1VQFA 4X66Q 2EZVA 4P75A 4C3IG 4FXGC 4DNRB 3GTOH 2FINB 1H9SA 1F2LA 4EX5A 1EYAA 5LMNQ 2VUMB 1CKNB 4DV2L 4LJZC 1MSGA 1LV9A 3MTSA 1LT5D 1C48A 5EQ0A 5IYBH 1EYCA 1B7YB 3GQBA 1BBUA 4DR7L 5I9PA 1UE6A 3EN2A 4GNXC 1KRTA 3CW2C 1HNZL 3CKIB 1VMCA 4FYDA 4RGOS 4A3EH 2CHBD 4YWMA 5M3MB 3RZOB 2NVTB 5KNCA 2G5DA 2R92H 3HOVH 2ZJPA 3A8KE 4JI6L 2YYZA 1LT4D 2N8NA 1VQ9A 2LFNA 1T5EA 3KYHC 3NWSA 2BDNA 2F0PA 1AZQA 2YU9H 4JOIC 1E2ZA 4A3IG 3NWTA 2O4XA 1KD1C 3I7FA 1LM0A 2A69C 1N36Q 3KF8B 2PYKA 2A6HD 5IGEA 4HIOA 3HOZH 4CKEA 4GOPA 1VQPA 4R1JA 3T53B 2B8GA 2E2HB 1TY2A 1ZYRD 1Q8IA 4DGZA 4P71A 1AEXA 2F0EA 1WCMB 2EJMA 1RTOA 5L37A 1GVPA 2NVXH 4RFBA 3QO2A 3NTHA 1W6KA 1AE3A 1MD2D 3CCLA 1CT1D 4C3IH 3I4MB 3PMFA 3URYA 1NMGA 1PTOH 4MIUA 3HOXG 2E5LL 5IGFA 1HNWQ 4YY3L 4FNFA 4TSSA 5ELCA 1LTGD 3ULLA 1EZ8A 5C44G 3A56A 1OXVA 3DWPA 3PO3H 3X3NA 1K8MA 4DAYA 2KHJA 1A8VA 3DEOA 2K14A 5FO9B 4PMCA 3PIP3 4KN7C 4ODGA 4BXXH 5DAUA 4GKJL 3TMEA 2HCIA 4XQQA 1X65A 3D6CA 5LMUL 1MKHA 4APVA 5JEAG 1FD7D 2B8FA 1N8RC 4LFCL 2B2WA 4OL7A 4DR1L 1O80A 1BCPC 1Q1BA 2DUDA 5CBAE 4A3IH 3EQLC 5LHY1 3QB3A 1EIYB 1ESFA 3E9HA 1C0AA 1U5KA 2XRSD 1Q3LA 2DJGC 2XVSA 3GTMB 4A3DG 1Y1WB 4DR6Q 5FLMH 1ASZA 4Y7NH 4DV0L 4C3JB 3BZKA 2CW0C 2J4XA 2WAQB 4JI1Q 3HFZB 1YBYA 2JEBI 4JI4L 3I56A 1EU4A 2OWOA 4GNXA 1JE4A 2CH4W 1TY0A 5I4DA 2F0GA 1D5XC 2HD3A 3T1HQ 2K50A 1EOVA 2K5NA 1AE2A 2Z6KC 1Y1VG 2ZTCA 5J22A 3J80c 2B3GA 5I9OA 2N88A 4YHHL 4HN7A 1A2TA 1HZ9A 3D4DA 4H7BA 5JJKA 1GUOA 3HOXH 5C3EG 1M1KC 1GM5A 1ASYA 1KC8C 2JYOA 1J5EL 5CORA 1PTOC 5C44H 1NSNS 2K32A 1R4QB 4RCOA 4OX9Q 4LAAA 4P2CB 2I5LX 1JT8A 2I5HA 3I8ZA 4C2MH 5ELBA 5CGKA 4OWTB 4OWWB 2JA6B 1XNQL 2AKWB 2HQLA 3BU2A 4X6AH 2ZT9C 1EQQA 1E2WA 2IX3A 5JEAH 1LTBD 5IT9c 1VQ5A 4K2KA 4IUUA 1EEID 5IGBA 1TKWB 1FYCA 2OTLA 3P1HA 2VS1A 1H9SB 3FKIB 5BN4A 3G4SA 1TWHH 1NE3A 2CQOA 5BN3A 3T1YQ 3KOJA 1BUVT 4A3DH 3M3YB 1H9JA 3R3OA 5C5MA 1GXDC 2FJ2A 3I70A 1PYWD 4Z9CB 2I5MX 2C9OA 2WB1G 1KAWA 2EYHA 3A0JA 3CP0A 2TSSA 3QR8A 4GLXA 3S1MB 4LF6Q 2F0DA 1IBLQ 1IXRA 1KABA 4RAUC 4UP8A 2ASBA 5IT9E 4BBRH 2N55A 3J7AF 3S15B 1BXTA 1BQQT 4UP9A 1EY4A 1K0SA 2RDGA 1FJGQ 1H9KA 1II3A 1CI3M 1B9MA 3EROA 5C3EH 4LUZA 3RMHA 1IYVA 5EPJA 2WB1E 5EKKA 2OTJA 1BKBA 4X62L 2J0TD 1YEZA 1I50B 1VQLA 2CW0D 1EUJA 4RCNA 2AQ3B 4GOPB 1GUNA 1E1TA 5IGCA 1WTXA 1HNWL 4DV6Q 2R7FA 2GVBA 1HUMA 2NVQB 1A3VA 3HOYB 2IPKD 3L2PA 2XNAC 2IY5B 2EYJA 4DV7Q 3OTOQ 5M3FG 4DUZL 3ER0A 3A7LA 1SYCA 1Y14B 2RBMA 4XYOA 1E7ZA 4CDDC 4ZQ3A 2Z0SA 1XTDA 3BDCA 5T1IA 4JPBW 4LFBQ 3VYRA 4A3GG 3HZXA 1JB7A 4R4TA 3DWAA 3G7LA 1N34Q 1SDFA 3L0OA 2F0WA 2MGSA 1LTSD 2DY8A 1V1OA 1TWFH 3A54A 4DAYB 1J8IA 2ZXRA 2Z6BA 1SMYC 1TS4A 3QG1A 1JORA 4DR6L 3J81i 4L5QA 1QE6A 2P5ZX 1QZHA 1TS3A 1CSQA 2MNAA 2NVYB 3AFQA 1UE7A 4JI1L 5IYDG 2F0SA 5KEEA 4DK0A 4AIMA 2CQAA 2MQHA 4JCVE 3CD6A 4OIKA 1HZBA 4M8AA 1AW7A 4LUOA 3BVGA 2F0MA 5E7NA 4XT1B 3H91A 4TRDA 1LT3D 1SNCA 3HGBA 1BR9A 1JOOA 4OELB 1S5BD 5JPMC 2HHHL 1PFSA 4HIKA 2QEXA 1FGUA 1BCPF 1NMFA 2MHVA 2EJGC 3TZDA 5D65A 3GP7A 4DU9A 3D8GA 4NXML 4OX9L 4B9WA 4GNXB 4A3BG 1ET9A 4K5VA 5CV9A 1H9MA 3SDZA 1GHKA 4RGTA 5I2XA 4XTCS 1HQRD 1JMCA 2KUMA 1CKOA 4NMZA 5C4JH 4G7ZC 1S3OA 3WDNA 2FMCA 4A3GH 2MP1A 1D2BA 3SGIA 4J15A 1JOQA 2O5IC 2WFWA 2F4VL 3BVZA 1U0LA 4DPGA 1X54A 3I55A 3GTJH 1YNXA 2I46A 4IO9A 5FLXc 3K5OA 3S17H 1G51A 4RWSC 4CBVA 3T1YL 1A63A 2A5HA 1Y8PB 2K04A 2L12A 2VZAA 4BY1G 1KIXA 2DNEA 1TT2A 1G2TA 1B44D 1OXSC 3D4RA 2F0LA 2L55A 2AWOA 3F2CA 1R4PB 3LWEA 5IYDH 4JV5Q 1VQGA 1ZKOA 5JPNC 3U9SA 1PLFA 1PTOF 1IBLL 2Z1CA 2I0QA 2DY7A 4R8IA 1EFID 4AQYL 2EYMA 4WORA 1KRSA 3UE0A 4LK1C 3M9BA 1FJGL 1HA5A 2K05A 2HCCA 5FO8B 4LNQA 1D1IA 5FLXE 4FF4A 4YCUA 1PRTC 2B63G 2KECA 2B2TA 5HGQA 3PO2B 1DM0B 3CPFA 1A2UA 3BDLA 4QGUA 2H1EA 4DV2Q 2JSOA 3SR1A 4DV6L 3GTLB 3K5NA 1OXXK 1BNZA 2F0FA 5C0XH 1HZCA 3G6JB 2K03A 1QWYA 1TWGH 2R93G 4KI0A 4DR7Q 2EPBA 5J1ZA 5IP7G 1D6EC 5KNDA 3KF8A 4QB4A 3FPUB 1B4OA 1VQDA 4RKBA 3UDIA 4A3EB 2NUCA 1A62A 1BCPB 2XIWA 2IL8A 4HMIA 2VB2X 3VA7A 3HOVB 1SNOA 4PG3A 3G6EA 4LFBL 4RHSA 3M4OH 1EIFA 2MFIA 2JEAI 4HJ7A 1X3QA 2UUCQ 3I4OA 1PMRA 1TR5A 1N34L 2YU9B 2PO4A 1PV4A 3UI2A 4Y52H 3CF5A 1CUKA 2PNRC 1C9OA 1KLGD 4N9TA 3AEVA 4J1MA 4ME5A 2OQKA 1PH1A 3KLSX 1ICFB 5I6YA 4FF1A 4LF5Q 3BZDB 3NBHA 4GLVB 2ZTEA 3A74A 4JC0A 4IFDJ 2RSNA 3S24A 4IALA 5CV8A 3S2HH 2Q8TA 3TQYA 1GUWA 2E2JH 3MFGA 2QF7A 1M90C 4UDUC 4JK1C 1JR0D 1Z9FA 2NVXB 3QJYA 4B3RQ 1JJCB 2NTTA 2KCNA 4ZCKA 1PTOB 1T9HA 2XGTA 4NB3A 1CA5A 2JE6I 5JJLA 4EVOA 5D14A 3PUWA 5DLQE 1YHAA 3A8JE 3PO3B 1GD7A 1QOHA 2UUBQ 1YITA 3D31A 4O1NA 2VQEL 2EYPA 4YY3Q 4A3FG 1KNAA 4POFA 4XQNA 2AQ2B 4DUYL 2Z9HA 3L7ZC 1KNEA 4UHVA 2LMCB 4WFN3 1GKHA 2F3IA 2L11A 3HS0C 4KHVA 5ELOA 1L0XB 1KXLA 4IURA 4OIJA 3J80L 4DR4Q 2E2IH 3UDGA 3W1BA 3AFPA 4DV5Q 1QJOA 3M4PA 1DGSA 1UEBA 5I2YA 4A3IB 1X6OA 5ELDA 4I65A 1SJED 3ITPA 1KDBA 3CRKC 1H95A 1ZYRC 3HOUG 1ILPA 1BDOA 2NZOA 1VQJA 1Z47A 4A3MH 4N8X1 2RF4A 4N8FA 4OWXB 4Y7NB 4BBSB 3M7GA 2HIXA 3J81c 2KEEA 3ONAB 3O13A 3NQIA 1EQTA 3T13A 4DV0Q 5IT9L 4KKUA 3CCJA 2HT1A 3EA6A 3TP7A 5JEAJ 1XPOA 2K33A 4C3HB 5KIXA 5C0XI 1TS2A 3DEPA 2E76C 1K9MC 3K7AB 4HCEA 4CJ0B 3S2DH 1SFOB 1ZXTA 3S16B 4XYQA 1VS0A 4DR3Q 2EDGA 4B08A 1ML0D 2B2UA 3DXJC 2R7ZG 1RKNA 2A74C 5IP9H 4DV1L 3K80C 1I6HH 4BWGB 1J5EQ 3J81E 4C2MB 1EWHA 2Z4HA 3CCEA 3BDOA 1IL2A 2JQOA 1YVCA 1BOSA 1IBML 2G9DA 4A3KB 1XNQQ 2BH8A 4OEMB 1E3PA 2L9HA 3E5SA 2LS01 3TP8A 2H5XA 2EE1A 3SVMA 1XMQL 4IJLA 3HOUH 1XTCD 1TWHB 2BDOA 4KTAA 4PZ6A 4KV6A 4RG1A 4A3DB 2UUCL 2N3SA 4UPAA 1O7ZA 2IT1A 1VQMA 5GROA 3IAYA 3ZJYC 3EIVA 5LL6X 5BN5A 3NQTA 4YCVA 5C4XG 5C4HA 4LF5L 1PRTF 1AZPA 1X3FA 2CFMA 4JBKA 4BBRB 4B3SQ 5ELFA 4PMWA 1U4MA 2Q8IB 1XPRA 1D5MC 5E3FA 3SEBA 1DXMA 4CJ2C 1JC7A 1TIID 3FMCA 4A3LH 4X3TA 4JI0Q 4GN3B 1I3QH 1SE4A 3H3VH 5GAHC 5LL6S 4NDXA 3FEWX 2HIVA 2ICIA 3WOEA 4B3RL 2PZWA 1C4QA 4F8MA 4DR2Q 2BE5C 3R93A 3H0GG 1WI5A 4X62Q 5C6AA 4EGVA 2UU9Q 3ERQA 1SNPA 3GTQH 4IUTA 3CCVA 1N32L 5EBDA 3NBHB 3MZ5A 3ZYYX 2UUBL 3GV6A 2RDFA 4MN3A 2TMPA 2N78A 1X56A 1XXGA 4HIDA 1SR3A 3FP9A 4IJHA 3HOWG 1P8LA 4HSPA 1DOKA 4RA8A 3K0YA 4R4OA 4DUZQ 2HDLA 5AJ3Q 2ENBA 3S14H 3F2DA 2QA4A 3J7A5 1JOKA 4PNYA 1GOZA 1FGBD 1RCVD 4DR4L 3K58A 1CK1A 4DV5L 4L8JA 5CV6A 4YWLA 5TSSA 4CDFC 3I2ZA 2F0TA 1TWFB 1N33Q 2PMZE 3RLNA 1Y69U 3ICEA 2VUMG 4JI3Q 2D5DA 4K8JA 1CHQD 5BR8Q 3LGJA 2YTVA 3PUVA 2HDMA 3R2IA 3SE0A 4TQUS 4B9XA 1IBKQ 4JI2L 3BYYB 1LACA 1HA6A 1K0RA 1VQ7A 3UE1A 4QJFA 4KD4A 3EJIA 3A5ZB 4TKOB 5HY6A 3OMGA 2EXDA 4XT3B 1CZWA 3I3CA 3SHLA 2F0QA 4MTNA 1BBWA 1PRTB 2RDHA 3NXWA 5FLXL 3H3VC 4OONA 3CC2A 1JCKB 1L1OC 1CKMA 4HMJA 3STBD 2DNCA 1YNNC 3H0GH 4BY7G 1F9RA 4DR3L 2RHQB 1I4RA 3NHHA 1LO5D 3N52A 1VQKA 5FKAC 4LF8Q 1Q1EA 1S5CD 1VQ6A 4JOIA 2HHHQ 3I4NG 1Y8NB 1PZID 1WD0A 3PF4A 2OQ0A 1F2ZA 3KFUA 4NXMQ 1D8LA 1K3RA 4KY5A 5IIFA 1VQ8A 1J9OA 2EYFA 5C4JB 1YZ6A 4YIJA 4KHPL 4A3GB 1NBWA 1QCBD 4G4KA 2EXZA 2JA5G 3DLLA 2H4OA 3OW2A 1E1OA 1GUSA 1S4ZA 1EYDA 4IPDA 4KY7A 3H09A 1LTAD 2Q2UA 4L63B 1EY7A 4IN3A 1P16A 3VYTA 1EQRA 4Q0FA 1WCMG 2BE5D 3FHWA 3C1FA 2SNMA 2F4VQ 5H1SE 1YHBA 4OGQC 3S17B 1VDZA 5JAVA 4JI7L 1NJIC 5GADC 1SRUA 3OSOA 3H3VI 3I4MG 5JJZA 3ERSX 1F2MA 3NTKA 4NKLA 3Q8DA 4CJ1B 1DOLA 5C0XJ 1U9RA 1WTRA 4F88A 1T5XD 2ES2A 1CTMA 1E2VA 1LLRD 4HIMA 4WRDA 1PH7A 1SYEA 4A4IA 5G3LD 3CCMA 4UP7A 1SN8A 5FOBB 4B3SL 1PZKD 4JG2A 2UUAQ 2L4NA 4LW1A 3VDYA 2UXDL 4DAPA 3G71A 4JI0L 4AYBB 4AQYQ 4DA2A 4NXNL 1Y1VH 2RKSA 4BY7H 2F0OA 4LWCA 3TS0A 2K75A 2ZTDA 2V1CC 2A1AA 3IL8A 4PV1C 4WJWA 4IOCA 5AFWA 1AN8A 2MJ8A 3RR5A 2X6LA 2M00A 4DR2L 3CHBD 3I4NH 5D3IB 1U4RA 4GN4B 2F3VA 2I07B 2R3ZA 3MA2B 2ICEC 3TSSA 2UU9L 1GUTA 3C1EA 2AUKA 4GS3A 4DKAC 4GKKL 1TWGB 1Y1WG 2O2LD 1RJTA 2UXCQ 1E0BA 3K59A 2GVAA 2JA5H 2WAQG 1JQYD 3TP6A 3P7JA 1ILQA 1GUGA 1EQVA 2KCCA 3VYUA 2F3WA 5AJ3L 3I73A 3MEFA 3HP3A 3MXPA 2KOLA 4ME3A 2IX0A 1OO9B 1YNND 5DNFA 4QL5A 5EPKA 1QVFA 2DJFC 1NCVA 1K83H 2Z6KA 4DK1A 1C7YA 1AFPA 2UXBL 1HR0Q 1Z7TA 4AH6A 3CQZH 2WAQE 2PI2E 4MHEA 3S1NH 2MO1A 1N33L 1K28A 1SNMA 1XX8A 2KHSA 1I4XA 3I91A 4JI3L 5BR8L 3OPOA 2LY7A 2PPBC 3S2HB 2E2JB 4KJOA 4RMFA 3CCRA 5M9OA 1IBKL 1ICWA 3IFDA 4G7HC 2JA6G 2JN4A 4GN5A 1S5FD 1EY5A 3F8TA 1O7IA 4K8IA 2MUYA 2L1BA 1LT6D 4O2DA 3NK9A 3U58A 4H44C 3S1RB 4ZRZA 1YJ9A 1HJPA 2SEBD 4KN4C 4H02A 2F03A 1TQOA 1RTNA 3D3RA 2PNHA 3KBGA 4R9WA 2F0NA 3FKIG 2GA4B 3J81L 4A3JB 4LF7Q 3SK8A 3HKZB 5G3LF 1DJRD 1HTPA 4LFAQ 2QCPX 4RGNA 4LF8L 2B2VC 1G91A 2VQEQ 1EOTA 1VQHA 2K5HA 3U50C 5HURA 4X3SA 5IYCG 1ENAA 2OF1A 3M85A 4DUYQ 1GHJA 2JK8A 5IGGA 3PIPA 4HJ8A 1GJXA 3M4QA 5M3FH 1U4PA 1U4LA 3M7NA 3L3OC 2YTYA 1SE2A 4LUVA 1CZGA 5M5WB 3HEJA 3D4WA 1NY4A 2RCFA 4WJ4A 3JC66 1SMXA 3HKSA 1V1QA 1W6JA 3MXUA 1V9PA 1E22A 2A19A 4A3MB 1K8AC 4R8NA 5E4XA 3CC7A 5IODA 4QQBX 2LXJA 2SOBA 3TEHB 1L2FA 1VCIA 3BG3A 3T56B 2EYOA 4CDEC 1MSHA 4KKSA 4R4CA 2NZHA 2KENA 5T1GA 3E0EA 2VNUD 1WTHA 2QILA 3HOYG 5A2QE 1WJJA 2FMMA 2JA8G 3K5MA 1TWCH 1PH3A 1DD2A 1CA6A 1FVIA 1RIPA 3G48A 3S2DB 3JAMi 2B2YC 1MHWC 2D2CC 2UUAL 3AYHB 5IE8A 2IJ0A 1E24A 1UWVA 4P72A 1PH4A 1ONLA 4I7ZC 1A15A 2WACA 2O5JC 1A6XA 1I6HB 2VQFQ 1PFNA 2VW9A 3GTOB 3GV3A 3M4YA 4DV1Q 3SK5A 3U9OA 3OWEB 5IYCH 5FK9C 3RN2A 1SE8A 1DONA 3MC0B 4A3BH 3SXHA 1DCZA 3W5OA 1RHPA 3PQIA 1STAA 4LMQD 3S1QH 3KUPA 4PMBA 1EY0A 3PUYA 2UXCL 1IBMQ 4QIWE 3FRPB 3MAQA 4KY6A 5J3BA 4EQ5A 4MNOA 2A8VA 3CRLC 5KYIA 1HHVA 1X3PA 3CMAA 4H13C 2EJFC 2X69A 1B2TA 1D1KA 1KDAA 5CC4A 2R92B 4RH6A 1XMQQ 3A7AB 4JBJA 3TP5A 2BOSA 1TVXA 4JI8L 4ZUIA 3SK4A 2Y0SB 2KA7A 3NELA 1I50H 1K8OA 1HR0L 1WTPA 1YIJA 2PW7A 4OO1G 2F0IA 1B8AA 4IUQA 4J6HA 3L9AX 4IPHA 1V8QA 5IOCA 3LWUA 2EVBA 2RHSB 4BY1H 2NVQH 4ZKCB 1EYGA 4CKBA 3HOZB 2WIIB 3BYTB 1QZGA 1QVCA 2JA8H 3ND8A 1CFMA 2L5TA 3FVQA 1B70B 3DHQA 2JJQA 1I3QB 2NZ1D 3OIQA 2RQXA 2ALYB 1LTTD 1I4PA 4K5XA 3SK6A 4C56C 2F0HA 1SYGA 4CDCC 1SAPA 5EKIA 2NWGA 1FNUA 1Q12A 4UAIA 1W3SA 3K81C 4C3IB 3GTQB 3IRBA 2R6GA 1YHQA 2L0CA 4IUPA 5M5XH 4DN4M 1VMPA 2BA0A 4HJAA 1MJEA 4ZYSA 2B63H 4LF7L 1HQMC 2D0PA 4K2LA 3VR4A 1N32Q 1X32A 2WV6D 3CC4A 2X6GA 4EQOA 3KF6B 4NPSA 4LFAL 5GQOA 4DAVA 3CAMA 3S14B 1QNKA 2R93H 3RZDH 5IP7H 3E9IA 1SYFA 3T51B 1HUNA 1X9NA 2FXQA 1XWEA 2WINB 2EOTA 3PV0A 1BF4A 2V4DA 2KHIA 3J80i 1PFBA 1DZ1A 1Q90A 1TS5A 2MO0A 2Q2TA 4X64L 2SDFA 4M1UB 1ZEQX 2MPMA 3AQQA 3NP8A 1QILA 1CQFA 3OW7A 5KYLA 1K3BC 3QIAA 4GOPC 3PO2G 5IYBG 2HUGA 4JBWA 4B3MQ 1I4HA 4OHJA 2F4IA 2QGQA 3KDFA 2CWPA 1CM9A 1KTKA 2JA7G 3T4AC 4QY7A 2BCOA 4JI2Q 1IYJB 4IZ8A 1BO0A 4DV3Q 2K52A 3RD4A 4XQJA 3ULPA 4RKLA 3TRZA 1Q81C 2CCZA 4XIGS 3N6RA 4FDBA 4P74A 1PYBA 3TBIB 3RUZA 1QNUA 1XNRQ 1HFNA 3KLRA 4JVZA 3V2TA 3HOXB 4MZ9A 4X3UA 3C46A 1W2BA 2VQFL 1YNJD 4K5WA 1S40A 2DN8A 5C44B 2K5VA 1WD1A 5FO7B 1V1PB 1I5FA 4A3FH 3Q22A 3GTKH 1Q86C 3DMUA 3PF5A 4F87A 1KQSA 4GLAC 2KCMA 3U4VA 3MXGA 4A75A 4DXFA 3CCSA 4KHPQ 3I90A 2B2WC 2PQAA 4U68A 5C4ZA 2K5DA 3GTGH 2WP8J 4QUCA 1DOMA 3VR6A 3MXNB 5CR3A 1PVOA 2EQSA 4KKTA 2QKIC 4L5SA 4JI7Q 4HCSA 1PH9A 1XMOQ 3PO2H 3OIPA 1VQIA 1HPCA 2F0KA 3GD7A 2VXWA 1O7LA 2AWNA 3F1ZA 1NAPA 3STBC 2JA7H 3GTLH 3OWFA 3K7UC 4J8QA 4KLKA 1D5ZC 1PDQA 5M5YH 1NNXA 2AMCB 3DUZA 1SE3A 1Y8OB 5KGUA 4IFDG 1STHA 4BXXG 3JAMc 3NPPA 4NP5A 3H15A 4A93G 4GZYC 5I6WA 5JJIA 1Y1VB 4BY7B 1YJNA 1AH9A 3TREA 2UXDQ 2WKCA 4V190 1QVGA 4NXNQ 3ULJA 1ENCA 4FF3A 5C3EB 1HH2P 4X65Q 2E75C 5ELNA 3I4NB 4NW2A 4R4QA 1WTVA 1B3QA 1WYDA 4ABNA 1X3GA 4IOAA 2R7ZH 2R61A 1SJHD 3OOCA 1XYIA 4JI5Q 5FLMG 2A73B 2B29A 4BBSG 4OO1I 3K8AA 4E6IA 3RLOA 2JA5B 4GKKQ 2XRQD 2CVRA 3JAME 1YJWA 1LABA 4DR5Q 4C3HG 1L0YB 2QDLA 2M9VA 5D3DA 1RD9D 4KD3A 1K83B 2EY1A 3V96A 1PH2A 1R9TH 3MHBA 3H94A 2XTIA 1X55A 3C3LA 1JE5A 1CQVA 1PHJA 1B53A 4A76A 2IW3A 3CQZB 3WWVA 4TVAB 3S1NB 2UXBQ 2A6ED 1IW7D 4I7AA 2FFKB 5CYUA 2WB1B 2IHFA 4QUFA 1V43A 3BVMA 1B1ZA 5C4XH 5A2QL 4K6DA 4S3SA 4G57A 2E2DC 2OCEA 4IFDH 2L15A 4B3ML 4JYAQ 3HRZC 5KRUA 1ET6A 4LF9L 2PZUA 4A93H 1LTLA 5C3XA 3EBEA 4A3KG 1QUQB 2N49A 1EIGA 4DV3L 4IUNA 3DM1A 1EY6A 2QEJC 4YCWA 5E1FA 3GTPH 2RA4A 4IPCA 3OHXC 4HSVA 1VQ4A 3J7YW 3W3AA 2EYLA 3PO3G 1G6PA 4RGMA 1XNRL 1S5ED 4CGYB 4HR7B 2AUJD 5M3MG 2WKDA 1F2YA 4L6TB 1PXUA 4KK7A 4DFAA 4BBSH 1TWAH 2PZTA 3KDFB 1F9QA 1I94Q 1VQAA 1M8AA 1NR4A 5M3FB 3GO5A 4LF4L 5EGTA 2XWBB 4QF4A 4XXEA 2ATWA 3R8BA 3FPPA 4QMGA 3HOWH 1F9PA 4KJNA 2K28A 4C3HH 3CMEA 2IWHA 4BBRG 1EWIA 1KLUD 4DNIA 3FDTA 1SEBD 3K7AH 1SFOH 2A69D 3S16H 4U673 1UEAB 1O7YA 3GTJB 1B9NA 1QB5D 4X66L 3NENA 2KCTA 4DV4Q 3LNNA 1JWUD 3E6ZX 5K5PA 1MGSA 5LMNL 3K0XA 1HR0W 1EEFD 1O78A 1D7QA 1XMOL 1FNWA 3PUZA 4MTKA 3C2PA 2VUMH 1C8CA 5JVG3 2KQ3A 3KBXA 2GN5A 4O0AA 5CV5A 1TWCB 4A3KH 1IKMA 4ZKBB 4PZ7A 2PQAB 2D0OA 2EY2A 2C35B 2VB3X 3PCOB 3VR3A 4FXDA 3VR2A 2NN6G 2LXKA 3NE5B 3MVVA 3J80E 1PH5A 1G2SA 2Z8LA 1VQEA 2K01A 4UY8C 2EY6A 1LUZA 2XN9C 2CKZB 4HTHA 1IYUA 3RZOH 5M3MH 1A3UA 1VF7A 2NVTH 3W2DA 4DXGA 3KJOA 4X65L 2K5WA 4C1NK 2OEOA 5E4WC 4YWKA 1N36L 3IFTA 5GAEC 4QCLA 4A3BB 3KLWA 2K6AA 4JI5L 3S1QB 4DNTB 2FHTA 2LKVA 2ID0A 2K5QA 4L5TA 3PIO3 1NUCA 1BCPD 5K36G 2VY3A 4C3JG 1HTLD 3ND9A 2OT2A 4IFDI 2E2HH 3TS2A 3Q6SA 4BA2I 3W1GA 4ULLA 4DR5L 1JWSD 2K4KA 5ELEA 3CXCA 4PQXA 1Q7YC 2RVLA 5CBEE 5ISRA 3M4OB 1WVLA 4Q5VA 1WCMH 3Q0AA 1Q82C 2YV5A 4JI8Q 1STEA 3PGZA 4ZK9B 2E8GA 1L1OA 3I4MH 1G6ZA 1F77A 4BY1B 1X3EA 4ZAIA 1VQBA 3VYSA 2JA8B 2ZXOA 1K73C 4B3TQ 1ENFA 5DEHA 1S5DD 1NR2A 5CMDA 3H6MA 4JYAL 5GAGC 3MFYA 3BZCA 1STGA 2NN6H 1HRJA 4QIWB 2F0VA 3KF6A 3CPWA 1IL8A 3K57A 1PFMA 1IHZA 4FO2A 4XDXA 3QOLA 1F9SA 1HNXQ 3NBIA 1M4VA 1OXTA 1PTOD 4DF7A 1EFWA 3I72A 5NUCA 5M5XB 1ESRA 2B63B 2B2TC 5CV7A 1Q46A 3A55A 4CKCA 3QWNA 2QW7A 1WTOA 4RHRA 3F2UA 4K0KQ 1UUPA 3GTMH 1I94L 5IWAQ 4HJ5A 2R93B 1Y1WH 1WOCA 3RZDB 5IY0A 5K36H 4C3JH 1XJVA 1EIHA 1IZ6A 2Q8RE 5C3WA 1FR3A 3NEMA 3T1HL 3TDQA 2HQEA 3J7AV 1FL0A 1SYDA 2KBNA 4ZLTF 2E2IB 1B50A 2Z4IA 2XSCA 1JWMD 3EFXD 2ZJRA 4L5RC 3CU7A 1EY9A 4WJ3M 3A8IE 4AYBG 1UAPA 2NBFA 2Q2IA 4X64Q 2IHEA 3LX0A 1Z6HA 1RF2D 3UDFA 2CH4A 1WFQA 2DGYA 1H9RA 4DV4L 5CV4A 4K14A 3BS1A 3I4LA 1SNQA 2YTXA 3J7ZC 1EZ6A 1TU2B 5C0XG 2JA9A 2KVMA 3RLFA 1SROA 2RCNA 3VA5A 4AYBE 2EY5A 3NSWA 4JW0A 2JA6H 1V1PA 3MEHA 3NTIA 3BJUA 5FJ8G 3F2BA 2ZXPA 5F2DA 1RODA 1MBYA
chains in the Genus database with same CATH topology
1RDPD 2QDBA 1PZJD 1B3AA 4HEDA 4X3KA 4A3FB 4G7OC 3GTKB 4H0LC 3AB9A 3MXNA 3JAML 2PCFB 3QOJA 3T16A 4C1NI 3Q24A 1SBBB 1KAAA 2SNSA 2OXPA 5EKLA 1AP0A 5JVH3 3GTGB 3AMUA 1IKLA 2NN6I 1VF5C 3KLSA 2J7ZA 3D6WA 1EWCA 3HG9A 3HOUB 1SMYD 3V05A 5HGTA 1DYQA 2RSOA 4K6LA 2M2LA 3E0JA 1I6VC 3Q23A 2B39A 2JA7B 1OXUA 2K7VA 5A35A 1I4GA 1JICA 1I4QA 3DWQA 5M5YB 2A68C 2PQEA 5EJWA 2B2VA 2BA1A 2G9HD 1STYA 2AQ1B 1YNJC 1A3TA 2F0JA 1HCZA 2NTSA 5J39A 4BA1I 1JB3A 2B2UC 2D9UA 2R7ZB 3TN2A 5DM63 5JOBA 3TZUA 1STNA 1STBA 5EBCA 5C5LA 1LTRD 1UNSA 1SXTA 4V0BA 1QG7A 1R9TB 3OMCA 4CHTB 2B2YA 1EU3A 2KJXA 5IGDA 1LTID 4EQPA 3K6OA 1MI2A 4KHZA 1WTQA 4OO1H 2NYZD 5C4XB 3MWYW 3R2TA 2JXMB 4ID6A 3KK7A 2KEDA 1SYBA 5KNBA 3K5LA 4A93B 1EL0A 2A6HC 2K1BA 4KMUC 4ILWA 4BS9A 4HAEA 1EY8A 3GTPB 1FNVA 1PRTD 3P20A 2JP1A 2F0UA 4FXKC 1SSOA 3PUXA 3H0GB 4N9PA 4FVMA 3P75A 5DM73 1TWAB 4EQNA 3S9WA 2A68D 3X3MA 4F7XA 3WOFA 3NUCA 2D62A 4FF2A 2XWJB 3HOWB 1G8ZD 2PMZB 5EPLA 1WTWA 3VR5A 2A6EC 1HXYD 1IW7C 5COYA 1G291 4O42A 2PW5A 1KDCA 4ZUJA 3AU7A 2IX1A 1SNDA 1BBXC 3IKJA 3EVQA 2NB0A 2C5CA 4FP5D 1CHPD 2F1MA 4IQZA 4IUVA 2E74C 1HFGA 2EZVA 4C3IG 4FXGC 4DNRB 2FINB 1H9SA 1F2LA 2VUMB 1EYAA 4LJZC 1MSGA 1LV9A 3MTSA 1LT5D 1C48A 5EQ0A 1EYCA 3GQBA 5I9PA 3CKIB 1VMCA 4FYDA 4RGOS 2CHBD 5M3MB 3RZOB 2NVTB 5KNCA 3A8KE 2YYZA 1LT4D 2LFNA 1T5EA 3NWSA 2BDNA 2F0PA 1AZQA 1E2ZA 3NWTA 2O4XA 2A69C 2PYKA 2A6HD 5IGEA 4CKEA 3T53B 2B8GA 2E2HB 1TY2A 1ZYRD 1Q8IA 4DGZA 1AEXA 2F0EA 1WCMB 2EJMA 1RTOA 4RFBA 3QO2A 3NTHA 1W6KA 1MD2D 1CT1D 3I4MB 3PMFA 3URYA 1PTOH 4MIUA 5IGFA 4FNFA 4TSSA 5ELCA 1LTGD 1EZ8A 3A56A 1OXVA 3DWPA 3X3NA 1K8MA 4DAYA 3DEOA 5FO9B 4PMCA 3PIP3 4KN7C 4ODGA 5DAUA 3TMEA 2HCIA 4XQQA 3D6CA 5JEAG 1FD7D 2B8FA 2B2WA 4OL7A 1BCPC 1O80A 1Q1BA 5CBAE 3EQLC 5LHY1 3QB3A 1ESFA 2XRSD 1Q3LA 2XVSA 3GTMB 1Y1WB 4C3JB 2CW0C 2J4XA 2WAQB 2JEBI 1EU4A 1JE4A 1TY0A 5I4DA 2F0GA 1D5XC 5J22A 5I9OA 2N88A 4HN7A 1A2TA 3D4DA 4H7BA 1GUOA 2JYOA 5CORA 1PTOC 1NSNS 2K32A 1R4QB 4RCOA 4LAAA 4P2CB 3I8ZA 5ELBA 5CGKA 2JA6B 2ZT9C 1E2WA 2IX3A 5JEAH 1LTBD 4K2KA 4IUUA 1EEID 5IGBA 1TKWB 1FYCA 3P1HA 3FKIB 1H9SB 5BN4A 5BN3A 1BUVT 3M3YB 1H9JA 3R3OA 5C5MA 1GXDC 2FJ2A 3I70A 1PYWD 4Z9CB 2C9OA 2EYHA 3S1MB 2TSSA 2F0DA 1KABA 4RAUC 5IT9E 2N55A 3J7AF 3S15B 1BXTA 1BQQT 1EY4A 2RDGA 1H9KA 1II3A 1CI3M 1B9MA 3EROA 3RMHA 1IYVA 5EPJA 5EKKA 2J0TD 1I50B 2CW0D 4RCNA 2AQ3B 1GUNA 1WTXA 5IGCA 1HUMA 2NVQB 1A3VA 3HOYB 2IPKD 2XNAC 2EYJA 3A7LA 1SYCA 2RBMA 4XYOA 4ZQ3A 3BDCA 5T1IA 3VYRA 3HZXA 3DWAA 3G7LA 1SDFA 2F0WA 2MGSA 1LTSD 2DY8A 1V1OA 3A54A 1J8IA 2ZXRA 1SMYC 1TS4A 3QG1A 1JORA 1QE6A 1TS3A 2NVYB 2F0SA 5KEEA 4DK0A 2CQAA 4OIKA 4M8AA 1AW7A 3BVGA 2F0MA 4XT1B 3H91A 4TRDA 1LT3D 1SNCA 3HGBA 1BR9A 1JOOA 5JPMC 1S5BD 1BCPF 2MHVA 2EJGC 3TZDA 5D65A 3GP7A 4DU9A 3D8GA 4B9WA 1ET9A 4K5VA 5CV9A 1H9MA 3SDZA 1GHKA 4RGTA 5I2XA 4XTCS 1HQRD 2KUMA 4NMZA 4G7ZC 3WDNA 2FMCA 2MP1A 1D2BA 1JOQA 2O5IC 3BVZA 2I46A 3K5OA 4RWSC 4CBVA 2A5HA 1Y8PB 2K04A 2L12A 2DNEA 1TT2A 1G2TA 1B44D 1OXSC 3D4RA 2F0LA 2L55A 2AWOA 1R4PB 3LWEA 1ZKOA 5JPNC 3U9SA 1PLFA 1PTOF 2Z1CA 2DY7A 4R8IA 1EFID 2EYMA 4WORA 4LK1C 1HA5A 2K05A 2HCCA 5FO8B 1D1IA 5FLXE 4FF4A 1PRTC 2KECA 2B2TA 3PO2B 1DM0B 1A2UA 3BDLA 2H1EA 2JSOA 3SR1A 3GTLB 3K5NA 1OXXK 1BNZA 2F0FA 5C0XH 3G6JB 2K03A 1QWYA 4KI0A 2EPBA 5J1ZA 1D6EC 5KNDA 3KF8A 4QB4A 3FPUB 1B4OA 4RKBA 4A3EB 2NUCA 1BCPB 2XIWA 2IL8A 4HMIA 2VB2X 3VA7A 3HOVB 1SNOA 4RHSA 2JEAI 1X3QA 1PMRA 1TR5A 2YU9B 2PO4A 3UI2A 2PNRC 1KLGD 4N9TA 4J1MA 4ME5A 3KLSX 5I6YA 4FF1A 3BZDB 3NBHA 4IFDJ 2RSNA 4IALA 5CV8A 2Q8TA 1GUWA 3MFGA 2QF7A 4UDUC 4JK1C 1JR0D 2NVXB 3QJYA 2NTTA 2KCNA 1PTOB 1CA5A 2JE6I 4EVOA 5D14A 3PUWA 3A8JE 3PO3B 1QOHA 3D31A 4O1NA 2EYPA 1KNAA 4XQNA 2AQ2B 3L7ZC 1KNEA 2LMCB 4WFN3 2L11A 3HS0C 4KHVA 1L0XB 4IURA 4OIJA 3J80L 1QJOA 5I2YA 4A3IB 5ELDA 4I65A 1SJED 3ITPA 1KDBA 3CRKC 1ZYRC 1ILPA 1BDOA 1Z47A 4Y7NB 4BBSB 3M7GA 2KEEA 3ONAB 3O13A 3NQIA 1EQTA 3T13A 5IT9L 4KKUA 3EA6A 3TP7A 5JEAJ 2K33A 4C3HB 5KIXA 5C0XI 1TS2A 3DEPA 2E76C 3K7AB 4HCEA 4CJ0B 1SFOB 1ZXTA 3S16B 4XYQA 2EDGA 4B08A 1ML0D 2B2UA 3DXJC 1RKNA 2A74C 4BWGB 3J81E 4C2MB 1EWHA 2Z4HA 3BDOA 1BOSA 2G9DA 4A3KB 2L9HA 3E5SA 2LS01 3TP8A 2EE1A 3SVMA 1XTCD 1TWHB 2BDOA 4KTAA 4KV6A 4A3DB 1O7ZA 2IT1A 3IAYA 5LL6X 5BN5A 3NQTA 5C4HA 1PRTF 1AZPA 4BBRB 5ELFA 4PMWA 1U4MA 2Q8IB 1D5MC 5E3FA 3SEBA 1DXMA 4CJ2C 1JC7A 1TIID 3FMCA 4X3TA 1SE4A 5LL6S 4NDXA 3FEWX 2ICIA 3WOEA 2PZWA 1C4QA 4F8MA 2BE5C 3R93A 5C6AA 4EGVA 3ERQA 1SNPA 4IUTA 5EBDA 3MZ5A 3ZYYX 3GV6A 2RDFA 4MN3A 2TMPA 1XXGA 4HSPA 1DOKA 4RA8A 3K0YA 2HDLA 2ENBA 1JOKA 4PNYA 1GOZA 1FGBD 1RCVD 3K58A 1CK1A 4L8JA 5CV6A 5TSSA 2F0TA 1TWFB 1Y69U 2D5DA 4K8JA 1CHQD 3PUVA 2HDMA 3R2IA 3SE0A 4TQUS 4B9XA 3BYYB 1LACA 1HA6A 4KD4A 3EJIA 4TKOB 3OMGA 4XT3B 1CZWA 3I3CA 3SHLA 2F0QA 5FLXL 1PRTB 2RDHA 3NXWA 3H3VC 1JCKB 4HMJA 2DNCA 1YNNC 1F9RA 1I4RA 3NHHA 1LO5D 3N52A 5FKAC 1Q1EA 1S5CD 1Y8NB 1PZID 1WD0A 1F2ZA 4KY5A 5IIFA 1J9OA 2EYFA 5C4JB 4YIJA 4A3GB 1QCBD 4G4KA 2EXZA 2H4OA 1GUSA 1S4ZA 1EYDA 4KY7A 3H09A 1LTAD 4L63B 1EY7A 4IN3A 3VYTA 4Q0FA 2BE5D 3C1FA 2SNMA 4OGQC 3S17B 1VDZA 5JAVA 3OSOA 5JJZA 1F2MA 3NTKA 4NKLA 4CJ1B 1DOLA 5C0XJ 1U9RA 1WTRA 4F88A 1T5XD 1CTMA 1E2VA 1LLRD 4WRDA 1SYEA 5G3LD 5FOBB 1PZKD 2L4NA 4DAPA 4AYBB 4DA2A 2RKSA 2F0OA 4PV1C 3IL8A 4WJWA 5AFWA 1AN8A 2MJ8A 2X6LA 2M00A 3CHBD 5D3IB 1U4RA 2F3VA 2I07B 2R3ZA 3MA2B 2ICEC 3TSSA 1GUTA 3C1EA 2AUKA 1TWGB 2O2LD 1RJTA 1E0BA 3K59A 1JQYD 3TP6A 1ILQA 1GUGA 1EQVA 2KCCA 3P7JA 3VYUA 2F3WA 3I73A 3HP3A 3MXPA 2KOLA 2IX0A 1OO9B 1YNND 5DNFA 5EPKA 1NCVA 4DK1A 1AFPA 1Z7TA 4MHEA 1SNMA 1XX8A 2KHSA 1I4XA 3I91A 3OPOA 2LY7A 2PPBC 3S2HB 2E2JB 4KJOA 5M9OA 1ICWA 3IFDA 4G7HC 1S5FD 1EY5A 4K8IA 2MUYA 2L1BA 1LT6D 3NK9A 4H44C 3S1RB 4ZRZA 2SEBD 4KN4C 2F03A 1TQOA 1RTNA 3D3RA 3KBGA 4R9WA 2F0NA 2GA4B 3J81L 4A3JB 3SK8A 3HKZB 5G3LF 1DJRD 1HTPA 2QCPX 4RGNA 2B2VC 1G91A 1EOTA 5HURA 4X3SA 1ENAA 2OF1A 3M85A 1GHJA 5IGGA 1GJXA 1U4PA 1U4LA 3M7NA 3L3OC 1SE2A 1CZGA 5M5WB 3HEJA 3D4WA 1W6JA 3MXUA 4A3MB 4R8NA 5E4XA 5IODA 2SOBA 1VCIA 3BG3A 3T56B 2EYOA 1MSHA 4KKSA 5T1GA 2VNUD 2QILA 5A2QE 2FMMA 3K5MA 1DD2A 1CA6A 3S2DB 2B2YC 2D2CC 2IJ0A 1ONLA 4I7ZC 1A15A 2WACA 2O5JC 1A6XA 1I6HB 1PFNA 3GTOB 3GV3A 3M4YA 3SK5A 3U9OA 3OWEB 5FK9C 1DONA 3MC0B 3SXHA 1DCZA 1RHPA 4LMQD 1STAA 3KUPA 4PMBA 1EY0A 3PUYA 3FRPB 3MAQA 4KY6A 3CRLC 5KYIA 1HHVA 1X3PA 4H13C 2EJFC 2X69A 1B2TA 5CC4A 1D1KA 1KDAA 2R92B 4RH6A 3A7AB 3TP5A 2BOSA 1TVXA 4ZUIA 3SK4A 2Y0SB 2KA7A 1K8OA 1WTPA 4OO1G 2PW7A 2F0IA 4IUQA 4J6HA 3L9AX 1V8QA 5IOCA 3LWUA 2EVBA 4ZKCB 4CKBA 3HOZB 2WIIB 3BYTB 3ND8A 1CFMA 2L5TA 3FVQA 3DHQA 1I3QB 2NZ1D 3OIQA 2RQXA 1LTTD 1I4PA 4K5XA 3SK6A 4C56C 2F0HA 1SYGA 1SAPA 5EKIA 2NWGA 1FNUA 1Q12A 4UAIA 4C3IB 3GTQB 2R6GA 2L0CA 4IUPA 4DN4M 1VMPA 2BA0A 4ZYSA 1HQMC 4K2LA 3VR4A 1X32A 2WV6D 2X6GA 4EQOA 4DAVA 3S14B 1QNKA 1SYFA 3T51B 1HUNA 1XWEA 2WINB 2EOTA 3PV0A 1BF4A 2V4DA 1PFBA 1DZ1A 1Q90A 1TS5A 2SDFA 4M1UB 1ZEQX 2MPMA 3NP8A 1QILA 1CQFA 3OW7A 5KYLA 3QIAA 2HUGA 4JBWA 1I4HA 4OHJA 2F4IA 1CM9A 1KTKA 3T4AC 2BCOA 4IZ8A 1BO0A 3RD4A 4XQJA 4RKLA 4XIGS 3N6RA 3TBIB 3RUZA 1QNUA 1HFNA 3KLRA 3V2TA 3HOXB 4X3UA 3C46A 1YNJD 4K5WA 2DN8A 5C44B 1WD1A 5FO7B 1V1PB 3Q22A 3DMUA 4F87A 3MXGA 4DXFA 3I90A 2B2WC 4U68A 5C4ZA 2K5DA 2WP8J 4QUCA 1DOMA 3VR6A 5CR3A 4KKTA 2QKIC 4HCSA 3OIPA 1HPCA 2F0KA 3GD7A 2VXWA 1O7LA 2AWNA 1NAPA 3OWFA 4J8QA 1D5ZC 1PDQA 3DUZA 1SE3A 1Y8OB 5KGUA 4IFDG 1STHA 3NPPA 4NP5A 4GZYC 5I6WA 1Y1VB 4BY7B 2WKCA 4V190 1ENCA 4FF3A 5C3EB 2E75C 3I4NB 4NW2A 1WTVA 4ABNA 2R61A 1SJHD 3OOCA 1XYIA 2A73B 4OO1I 4E6IA 2JA5B 2XRQD 2CVRA 3JAME 1LABA 4C3HG 1L0YB 2M9VA 5D3DA 1RD9D 4KD3A 1K83B 2EY1A 3V96A 3MHBA 3H94A 3C3LA 1CQVA 1B53A 2IW3A 3CQZB 3S1NB 2A6ED 1IW7D 2FFKB 5CYUA 2WB1B 4QUFA 1V43A 3BVMA 1B1ZA 5A2QL 4K6DA 4S3SA 4G57A 2E2DC 4IFDH 3HRZC 5KRUA 1ET6A 2PZUA 5C3XA 1EIGA 4IUNA 3DM1A 1EY6A 2QEJC 5E1FA 2RA4A 3OHXC 4HSVA 3J7YW 3W3AA 2EYLA 4RGMA 1S5ED 4CGYB 4HR7B 2AUJD 2WKDA 1F2YA 4L6TB 1PXUA 4KK7A 4DFAA 2PZTA 1F9QA 1M8AA 1NR4A 5M3FB 3GO5A 4XXEA 2XWBB 4QF4A 5EGTA 3R8BA 3FPPA 4QMGA 1F9PA 4KJNA 2K28A 2IWHA 1KLUD 3FDTA 1SEBD 2A69D 4U673 1UEAB 1O7YA 3GTJB 1B9NA 1QB5D 3LNNA 1JWUD 3E6ZX 5K5PA 1MGSA 1EEFD 1O78A 1FNWA 3PUZA 3C2PA 1C8CA 5JVG3 2KQ3A 3KBXA 5CV5A 1TWCB 1IKMA 4ZKBB 2EY2A 2VB3X 3VR3A 4FXDA 3VR2A 2NN6G 3NE5B 3MVVA 3J80E 1G2SA 2Z8LA 2K01A 2EY6A 2XN9C 4HTHA 1IYUA 1A3UA 1VF7A 3W2DA 4DXGA 2K5WA 4C1NK 2OEOA 5E4WC 3IFTA 4QCLA 4A3BB 2K6AA 3S1QB 4DNTB 2FHTA 2LKVA 2ID0A 2K5QA 3PIO3 1NUCA 1BCPD 5K36G 4C3JG 1HTLD 3ND9A 2OT2A 4IFDI 3Q6SA 4BA2I 4ULLA 1JWSD 5ELEA 4PQXA 2RVLA 5CBEE 5ISRA 3M4OB 1WVLA 4Q5VA 3Q0AA 1STEA 4ZK9B 1G6ZA 1F77A 4BY1B 4ZAIA 3VYSA 2JA8B 2ZXOA 1ENFA 5DEHA 1S5DD 1NR2A 5CMDA 3H6MA 3MFYA 1STGA 2NN6H 1HRJA 4QIWB 2F0VA 1IL8A 3K57A 1PFMA 1IHZA 4FO2A 4XDXA 3QOLA 1F9SA 3NBIA 1M4VA 1OXTA 1PTOD 4DF7A 3I72A 5NUCA 5M5XB 1ESRA 2B63B 2B2TC 5CV7A 3A55A 4CKCA 3QWNA 1WTOA 4RHRA 3F2UA 1UUPA 2R93B 3RZDB 5K36H 1EIHA 5C3WA 2Q8RE 1FR3A 3TDQA 2HQEA 3J7AV 1SYDA 2E2IB 4ZLTF 1B50A 2Z4IA 2XSCA 1JWMD 3EFXD 3CU7A 1EY9A 3A8IE 1UAPA 2NBFA 3LX0A 1Z6HA 1RF2D 1H9RA 5CV4A 4K14A 3BS1A 3I4LA 1SNQA 1EZ6A 1TU2B 5C0XG 2KVMA 3RLFA 3VA5A 2EY5A 3NSWA 1V1PA 3MEHA 3NTIA 2ZXPA 5F2DA 1RODA 1MBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOK A;  1QG7 A;  4RA8 A;  5CBA E;  2HDL A;  2HUG A;  1ZXT A;  1B3A A;  1RTN A;  3FDT A;  1HHV A;  1NR2 A;  1Q3L A;  2KUM A;  4HED A;  4NW2 A;  4R9W A;  2B2Y A;  4X3K A;  1X3P A;  1DOL A;  5CMD A;  1WTV A;  1WTR A;  1CM9 A;  5EPJ A;  2X69 A;  2MP1 A;  1XYI A;  1B2T A;  1HRJ A;  1ML0 D;  2B2U A;  1BO0 A;  1O7Y A;  1VMC A;  1IL8 A;  2RSN A;  1TVX A;  1PFM A;  2B2V C;  1G91 A;  2Q8T A;  4XDX A;  1EOT A;  1MI2 A;  1GUW A;  1MGS A;  1JE4 A;  1F9S A;  2CVR A;  4X3S A;  1WTQ A;  2L4N A;  2NYZ D;  1WTX A;  3MWY W;  1HUM A;  1WTP A;  1U4P A;  1U4L A;  1AP0 A;  2KED A;  1C8C A;  1ESR A;  4IUQ A;  2BDN A;  4RWS C;  2B2T C;  1AZQ A;  1EL0 A;  3KBX A;  1HFN A;  4ZKC B;  1IKL A;  2K04 A;  2K1B A;  3IL8 A;  2N88 A;  2L12 A;  4X3U A;  5AFW A;  2J7Z A;  3D6W A;  2MJ8 A;  2L9H A;  4ZKB B;  4HAE A;  2X6L A;  1CA5 A;  1IKM A;  5T1I A;  1G2T A;  2HDM A;  1WTO A;  2EE1 A;  3SVM A;  3F2U A;  5D14 A;  1U4R A;  3LWE A;  1WD1 A;  1HA6 A;  2R3Z A;  1B53 A;  2RSO A;  2M2L A;  2JYO A;  3G7L A;  5COR A;  1G2S A;  2NZ1 D;  2JP1 A;  2K01 A;  1KNA A;  1PLF A;  1SDF A;  5E4X A;  1RJT A;  1EIH A;  2Q8R E;  2FFK B;  1E0B A;  1O7Z A;  1KNE A;  4XT3 B;  3I3C A;  1SAP A;  5EKI A;  2DY7 A;  1JIC A;  1SSO A;  2MGS A;  2NWG A;  3I8Z A;  4QUF A;  4R8I A;  2DY8 A;  2L11 A;  4UAI A;  1MSH A;  5EJW A;  3I90 A;  1ILQ A;  2B2W C;  3P7J A;  2B2V A;  4CJ1 B;  2K05 A;  4ZLT F;  1B50 A;  5E4W C;  1RTO A;  4IUP A;  4IUR A;  2HCC A;  3HP3 A;  4U68 A;  4DN4 M;  1J8I A;  1F9R A;  1VMP A;  3QO2 A;  4OIJ A;  2KOL A;  5T1G A;  4QUC A;  1DOM A;  5DNF A;  3N52 A;  1QE6 A;  1AZP A;  1X32 A;  2FMM A;  2KEC A;  5EPK A;  5EPL A;  1EIG A;  1NCV A;  2X6G A;  2B2T A;  4IUU A;  1WTW A;  1CA6 A;  2FHT A;  3DM1 A;  1U4M A;  5COY A;  2B2Y C;  2RA4 A;  1WD0 A;  4O42 A;  4HCS A;  2H1E A;  4CJ2 C;  4HSV A;  1ILP A;  4X3T A;  1QNK A;  1BNZ A;  2B2U C;  2D9U A;  1J9O A;  4MHE A;  4OIK A;  2K03 A;  1A15 A;  2EPB A;  1XX8 A;  2VXW A;  1HUN A;  1NAP A;  3Q6S A;  1BBX C;  3I91 A;  3DEO A;  3TN2 A;  2KEE A;  2KVM A;  3FPU B;  1B4O A;  2FJ2 A;  2EOT A;  2RVL A;  3ONA B;  5CBE E;  1PDQ A;  1BF4 A;  1PFN A;  2XIW A;  1S4Z A;  2IL8 A;  1EQT A;  2HCI A;  1PFB A;  4IUV A;  3R93 A;  3GV3 A;  1WVL A;  1HFG A;  4XT1 B;  1F9Q A;  3H91 A;  1DZ1 A;  1ICW A;  4IUT A;  3IFD A;  2SDF A;  1M8A A;  1NR4 A;  2B2W A;  4ZK9 B;  1DON A;  2FIN B;  1O80 A;  1F2L A;  1X3Q A;  2MPM A;  3GV6 A;  4RAU C;  1RHP A;  4MN3 A;  3TZD A;  1G6Z A;  5D65 A;  4LMQ D;  3DEP A;  2L1B A;  1ROD A;  3KUP A;  1MSG A;  3MTS A;  1F9P A;  5JJZ A;  1LV9 A;  2N55 A;  3UI2 A;  4ZAI A;  2K28 A;  5EQ0 A;  4CJ0 B; 
#chains in the Genus database with same CATH topology
 1RDP D;  1UE1 A;  2QDB A;  1PZJ D;  1B3A A;  1KHI A;  3FKI H;  4DK3 C;  4HED A;  2ZM6 Q;  4X3K A;  4A3F B;  4G7O C;  3GTK B;  4H0L C;  1UE5 A;  3AB9 A;  3M3Y H;  3MXN A;  1S72 A;  3JAM L;  2PCF B;  4LF6 L;  3QOJ A;  4JBM A;  3T16 A;  4C1N I;  3Q24 A;  1SBB B;  1CKN A;  1KAA A;  2SNS A;  4OXP A;  2AHO B;  2OXP A;  5EKL A;  3S1M H;  1AP0 A;  5JVH 3;  3GTG B;  3AMU A;  1GO3 E;  1IKL A;  2NN6 I;  1VF5 C;  3RN5 A;  3S15 H;  3CCU A;  3KLS A;  2J7Z A;  3D6W A;  1EWC A;  3HG9 A;  3HOU B;  2ZJQ A;  1SMY D;  3V05 A;  5HGT A;  1DYQ A;  2RSO A;  4A3C G;  4K6L A;  2M2L A;  1J6Q A;  3E0J A;  4A3J G;  1I6V C;  3Q23 A;  2B39 A;  3HKZ G;  1YI2 A;  2JA7 B;  1OXU A;  2K7V A;  5A35 A;  1I4G A;  1JIC A;  1I4Q A;  3DWQ A;  5M5Y B;  2A68 C;  2PQE A;  4DV7 L;  3OTO L;  1XPU A;  5EJW A;  2Q2H A;  2B2V A;  2BA1 A;  2G9H D;  4B3T L;  1STY A;  1VQO A;  2AQ1 B;  1YNJ C;  1L0W A;  3HOY H;  2R7D A;  1A3T A;  2F0J A;  1HNZ Q;  1MJC A;  5FJ8 H;  4PZ8 A;  1HCZ A;  2NTS A;  4DK6 C;  5J39 A;  3GDE A;  4BA1 I;  4JI6 Q;  3HKZ E;  1L1O B;  1HNX L;  1PH8 A;  1JJ2 A;  1K8G A;  2LSS A;  1JB3 A;  2B2U C;  2D9U A;  3DM3 A;  2R7Z B;  3J81 j;  4A3M G;  3TN2 A;  4IPG A;  5DM6 3;  3OYY A;  3PIO A;  1PYS B;  3E3X A;  5JOB A;  3TZU A;  4K0K L;  1STN A;  5IWA L;  1STB A;  5EBC A;  1PA6 A;  5C5L A;  2NVY H;  1LTR D;  1UNS A;  1SXT A;  1JJG A;  4V0B A;  1QG7 A;  1R9T B;  1VQN A;  3OMC A;  3RNU A;  4CHT B;  2B2Y A;  3S1R H;  1EU3 A;  2F52 A;  2KJX A;  5IGD A;  4A3C H;  1LTI D;  1QUQ A;  1SLJ A;  4EQP A;  3K6O A;  2E5L Q;  4A3J H;  5IP9 G;  5LMN W;  1HZA A;  1MI2 A;  4KHZ A;  4ALP A;  1WTQ A;  4OO1 H;  2NYZ D;  5C4X B;  3MWY W;  3R2T A;  1BVS A;  1PH6 A;  4P73 A;  2JXM B;  4ID6 A;  3KK7 A;  2KED A;  1SYB A;  5KNB A;  3K5L A;  4A93 B;  1EL0 A;  1N9W A;  2A6H C;  1NTG A;  2K1B A;  4POG A;  4GKJ Q;  4KMU C;  4ILW A;  4BS9 A;  2EIF A;  4LF9 Q;  2PI2 A;  1EY8 A;  4HAE A;  5LMU Q;  3GTP B;  1RL2 A;  4R4I A;  1FNV A;  5M5W H;  1PRT D;  1Q8K A;  4LFC Q;  1OTC A;  2CWA A;  4DR1 Q;  3P20 A;  3D0F A;  2JP1 A;  2F0U A;  4A3E G;  4FXK C;  3U4Z A;  2R92 G;  1CSP A;  3HOV G;  1SSO A;  4HJ9 A;  3PUX A;  3H0G B;  4N9P A;  4FVM A;  3P75 A;  5DM7 3;  1TWA B;  2Y0S G;  4EQN A;  3S9W A;  2A68 D;  3X3M A;  4DAM A;  2ZM6 L;  4F7X A;  3WOF A;  3NUC A;  2D62 A;  3PSI A;  4FF2 A;  3UDX A;  2XWJ B;  3KJP A;  4JI4 Q;  3HOW B;  1G8Z D;  1TXY A;  2PMZ B;  2VL6 A;  3B6Y A;  5EPL A;  1WTW A;  4JV5 L;  5EAY A;  3VR5 A;  2A6E C;  1HXY D;  4LF4 Q;  3HOZ G;  1IW7 C;  5COY A;  3A5U A;  1G29 1;  4O42 A;  1KL9 A;  2PW5 A;  1KDC A;  4ZUJ A;  3CCQ A;  3AU7 A;  4A3L G;  2IX1 A;  1SND A;  1LYL A;  1VQC A;  1BBX C;  4YHH Q;  2Y0S E;  3IKJ A;  3EVQ A;  1A0I A;  2BH2 A;  2NB0 A;  2C5C A;  4FP5 D;  1MIU A;  1CHP D;  2F1M A;  4IQZ A;  4IUV A;  2E74 C;  1HFG A;  1VQF A;  4X66 Q;  2EZV A;  4P75 A;  4C3I G;  4FXG C;  4DNR B;  3GTO H;  2FIN B;  1H9S A;  1F2L A;  4EX5 A;  1EYA A;  5LMN Q;  2VUM B;  1CKN B;  4DV2 L;  4LJZ C;  1MSG A;  1LV9 A;  3MTS A;  1LT5 D;  1C48 A;  5EQ0 A;  5IYB H;  1EYC A;  1B7Y B;  3GQB A;  1BBU A;  4DR7 L;  5I9P A;  1UE6 A;  3EN2 A;  4GNX C;  1KRT A;  3CW2 C;  1HNZ L;  3CKI B;  1VMC A;  4FYD A;  4RGO S;  4A3E H;  2CHB D;  4YWM A;  5M3M B;  3RZO B;  2NVT B;  5KNC A;  2G5D A;  2R92 H;  3HOV H;  2ZJP A;  3A8K E;  4JI6 L;  2YYZ A;  1LT4 D;  2N8N A;  1VQ9 A;  2LFN A;  1T5E A;  3KYH C;  3NWS A;  2BDN A;  2F0P A;  1AZQ A;  2YU9 H;  4JOI C;  1E2Z A;  4A3I G;  3NWT A;  2O4X A;  1KD1 C;  3I7F A;  1LM0 A;  2A69 C;  1N36 Q;  3KF8 B;  2PYK A;  2A6H D;  5IGE A;  4HIO A;  3HOZ H;  4CKE A;  4GOP A;  1VQP A;  4R1J A;  3T53 B;  2B8G A;  2E2H B;  1TY2 A;  1ZYR D;  1Q8I A;  4DGZ A;  4P71 A;  1AEX A;  2F0E A;  1WCM B;  2EJM A;  1RTO A;  5L37 A;  1GVP A;  2NVX H;  4RFB A;  3QO2 A;  3NTH A;  1W6K A;  1AE3 A;  1MD2 D;  3CCL A;  1CT1 D;  4C3I H;  3I4M B;  3PMF A;  3URY A;  1NMG A;  1PTO H;  4MIU A;  3HOX G;  2E5L L;  5IGF A;  1HNW Q;  4YY3 L;  4FNF A;  4TSS A;  5ELC A;  1LTG D;  3ULL A;  1EZ8 A;  5C44 G;  3A56 A;  1OXV A;  3DWP A;  3PO3 H;  3X3N A;  1K8M A;  4DAY A;  2KHJ A;  1A8V A;  3DEO A;  2K14 A;  5FO9 B;  4PMC A;  3PIP 3;  4KN7 C;  4ODG A;  4BXX H;  5DAU A;  4GKJ L;  3TME A;  2HCI A;  4XQQ A;  1X65 A;  3D6C A;  5LMU L;  1MKH A;  4APV A;  5JEA G;  1FD7 D;  2B8F A;  1N8R C;  4LFC L;  2B2W A;  4OL7 A;  4DR1 L;  1O80 A;  1BCP C;  1Q1B A;  2DUD A;  5CBA E;  4A3I H;  3EQL C;  5LHY 1;  3QB3 A;  1EIY B;  1ESF A;  3E9H A;  1C0A A;  1U5K A;  2XRS D;  1Q3L A;  2DJG C;  2XVS A;  3GTM B;  4A3D G;  1Y1W B;  4DR6 Q;  5FLM H;  1ASZ A;  4Y7N H;  4DV0 L;  4C3J B;  3BZK A;  2CW0 C;  2J4X A;  2WAQ B;  4JI1 Q;  3HFZ B;  1YBY A;  2JEB I;  4JI4 L;  3I56 A;  1EU4 A;  2OWO A;  4GNX A;  1JE4 A;  2CH4 W;  1TY0 A;  5I4D A;  2F0G A;  1D5X C;  2HD3 A;  3T1H Q;  2K50 A;  1EOV A;  2K5N A;  1AE2 A;  2Z6K C;  1Y1V G;  2ZTC A;  5J22 A;  3J80 c;  2B3G A;  5I9O A;  2N88 A;  4YHH L;  4HN7 A;  1A2T A;  1HZ9 A;  3D4D A;  4H7B A;  5JJK A;  1GUO A;  3HOX H;  5C3E G;  1M1K C;  1GM5 A;  1ASY A;  1KC8 C;  2JYO A;  1J5E L;  5COR A;  1PTO C;  5C44 H;  1NSN S;  2K32 A;  1R4Q B;  4RCO A;  4OX9 Q;  4LAA A;  4P2C B;  2I5L X;  1JT8 A;  2I5H A;  3I8Z A;  4C2M H;  5ELB A;  5CGK A;  4OWT B;  4OWW B;  2JA6 B;  1XNQ L;  2AKW B;  2HQL A;  3BU2 A;  4X6A H;  2ZT9 C;  1EQQ A;  1E2W A;  2IX3 A;  5JEA H;  1LTB D;  5IT9 c;  1VQ5 A;  4K2K A;  4IUU A;  1EEI D;  5IGB A;  1TKW B;  1FYC A;  2OTL A;  3P1H A;  2VS1 A;  1H9S B;  3FKI B;  5BN4 A;  3G4S A;  1TWH H;  1NE3 A;  2CQO A;  5BN3 A;  3T1Y Q;  3KOJ A;  1BUV T;  4A3D H;  3M3Y B;  1H9J A;  3R3O A;  5C5M A;  1GXD C;  2FJ2 A;  3I70 A;  1PYW D;  4Z9C B;  2I5M X;  2C9O A;  2WB1 G;  1KAW A;  2EYH A;  3A0J A;  3CP0 A;  2TSS A;  3QR8 A;  4GLX A;  3S1M B;  4LF6 Q;  2F0D A;  1IBL Q;  1IXR A;  1KAB A;  4RAU C;  4UP8 A;  2ASB A;  5IT9 E;  4BBR H;  2N55 A;  3J7A F;  3S15 B;  1BXT A;  1BQQ T;  4UP9 A;  1EY4 A;  1K0S A;  2RDG A;  1FJG Q;  1H9K A;  1II3 A;  1CI3 M;  1B9M A;  3ERO A;  5C3E H;  4LUZ A;  3RMH A;  1IYV A;  5EPJ A;  2WB1 E;  5EKK A;  2OTJ A;  1BKB A;  4X62 L;  2J0T D;  1YEZ A;  1I50 B;  1VQL A;  2CW0 D;  1EUJ A;  4RCN A;  2AQ3 B;  4GOP B;  1GUN A;  1E1T A;  5IGC A;  1WTX A;  1HNW L;  4DV6 Q;  2R7F A;  2GVB A;  1HUM A;  2NVQ B;  1A3V A;  3HOY B;  2IPK D;  3L2P A;  2XNA C;  2IY5 B;  2EYJ A;  4DV7 Q;  3OTO Q;  5M3F G;  4DUZ L;  3ER0 A;  3A7L A;  1SYC A;  1Y14 B;  2RBM A;  4XYO A;  1E7Z A;  4CDD C;  4ZQ3 A;  2Z0S A;  1XTD A;  3BDC A;  5T1I A;  4JPB W;  4LFB Q;  3VYR A;  4A3G G;  3HZX A;  1JB7 A;  4R4T A;  3DWA A;  3G7L A;  1N34 Q;  1SDF A;  3L0O A;  2F0W A;  2MGS A;  1LTS D;  2DY8 A;  1V1O A;  1TWF H;  3A54 A;  4DAY B;  1J8I A;  2ZXR A;  2Z6B A;  1SMY C;  1TS4 A;  3QG1 A;  1JOR A;  4DR6 L;  3J81 i;  4L5Q A;  1QE6 A;  2P5Z X;  1QZH A;  1TS3 A;  1CSQ A;  2MNA A;  2NVY B;  3AFQ A;  1UE7 A;  4JI1 L;  5IYD G;  2F0S A;  5KEE A;  4DK0 A;  4AIM A;  2CQA A;  2MQH A;  4JCV E;  3CD6 A;  4OIK A;  1HZB A;  4M8A A;  1AW7 A;  4LUO A;  3BVG A;  2F0M A;  5E7N A;  4XT1 B;  3H91 A;  4TRD A;  1LT3 D;  1SNC A;  3HGB A;  1BR9 A;  1JOO A;  4OEL B;  1S5B D;  5JPM C;  2HHH L;  1PFS A;  4HIK A;  2QEX A;  1FGU A;  1BCP F;  1NMF A;  2MHV A;  2EJG C;  3TZD A;  5D65 A;  3GP7 A;  4DU9 A;  3D8G A;  4NXM L;  4OX9 L;  4B9W A;  4GNX B;  4A3B G;  1ET9 A;  4K5V A;  5CV9 A;  1H9M A;  3SDZ A;  1GHK A;  4RGT A;  5I2X A;  4XTC S;  1HQR D;  1JMC A;  2KUM A;  1CKO A;  4NMZ A;  5C4J H;  4G7Z C;  1S3O A;  3WDN A;  2FMC A;  4A3G H;  2MP1 A;  1D2B A;  3SGI A;  4J15 A;  1JOQ A;  2O5I C;  2WFW A;  2F4V L;  3BVZ A;  1U0L A;  4DPG A;  1X54 A;  3I55 A;  3GTJ H;  1YNX A;  2I46 A;  4IO9 A;  5FLX c;  3K5O A;  3S17 H;  1G51 A;  4RWS C;  4CBV A;  3T1Y L;  1A63 A;  2A5H A;  1Y8P B;  2K04 A;  2L12 A;  2VZA A;  4BY1 G;  1KIX A;  2DNE A;  1TT2 A;  1G2T A;  1B44 D;  1OXS C;  3D4R A;  2F0L A;  2L55 A;  2AWO A;  3F2C A;  1R4P B;  3LWE A;  5IYD H;  4JV5 Q;  1VQG A;  1ZKO A;  5JPN C;  3U9S A;  1PLF A;  1PTO F;  1IBL L;  2Z1C A;  2I0Q A;  2DY7 A;  4R8I A;  1EFI D;  4AQY L;  2EYM A;  4WOR A;  1KRS A;  3UE0 A;  4LK1 C;  3M9B A;  1FJG L;  1HA5 A;  2K05 A;  2HCC A;  5FO8 B;  4LNQ A;  1D1I A;  5FLX E;  4FF4 A;  4YCU A;  1PRT C;  2B63 G;  2KEC A;  2B2T A;  5HGQ A;  3PO2 B;  1DM0 B;  3CPF A;  1A2U A;  3BDL A;  4QGU A;  2H1E A;  4DV2 Q;  2JSO A;  3SR1 A;  4DV6 L;  3GTL B;  3K5N A;  1OXX K;  1BNZ A;  2F0F A;  5C0X H;  1HZC A;  3G6J B;  2K03 A;  1QWY A;  1TWG H;  2R93 G;  4KI0 A;  4DR7 Q;  2EPB A;  5J1Z A;  5IP7 G;  1D6E C;  5KND A;  3KF8 A;  4QB4 A;  3FPU B;  1B4O A;  1VQD A;  4RKB A;  3UDI A;  4A3E B;  2NUC A;  1A62 A;  1BCP B;  2XIW A;  2IL8 A;  4HMI A;  2VB2 X;  3VA7 A;  3HOV B;  1SNO A;  4PG3 A;  3G6E A;  4LFB L;  4RHS A;  3M4O H;  1EIF A;  2MFI A;  2JEA I;  4HJ7 A;  1X3Q A;  2UUC Q;  3I4O A;  1PMR A;  1TR5 A;  1N34 L;  2YU9 B;  2PO4 A;  1PV4 A;  3UI2 A;  4Y52 H;  3CF5 A;  1CUK A;  2PNR C;  1C9O A;  1KLG D;  4N9T A;  3AEV A;  4J1M A;  4ME5 A;  2OQK A;  1PH1 A;  3KLS X;  1ICF B;  5I6Y A;  4FF1 A;  4LF5 Q;  3BZD B;  3NBH A;  4GLV B;  2ZTE A;  3A74 A;  4JC0 A;  4IFD J;  2RSN A;  3S24 A;  4IAL A;  5CV8 A;  3S2H H;  2Q8T A;  3TQY A;  1GUW A;  2E2J H;  3MFG A;  2QF7 A;  1M90 C;  4UDU C;  4JK1 C;  1JR0 D;  1Z9F A;  2NVX B;  3QJY A;  4B3R Q;  1JJC B;  2NTT A;  2KCN A;  4ZCK A;  1PTO B;  1T9H A;  2XGT A;  4NB3 A;  1CA5 A;  2JE6 I;  5JJL A;  4EVO A;  5D14 A;  3PUW A;  5DLQ E;  1YHA A;  3A8J E;  3PO3 B;  1GD7 A;  1QOH A;  2UUB Q;  1YIT A;  3D31 A;  4O1N A;  2VQE L;  2EYP A;  4YY3 Q;  4A3F G;  1KNA A;  4POF A;  4XQN A;  2AQ2 B;  4DUY L;  2Z9H A;  3L7Z C;  1KNE A;  4UHV A;  2LMC B;  4WFN 3;  1GKH A;  2F3I A;  2L11 A;  3HS0 C;  4KHV A;  5ELO A;  1L0X B;  1KXL A;  4IUR A;  4OIJ A;  3J80 L;  4DR4 Q;  2E2I H;  3UDG A;  3W1B A;  3AFP A;  4DV5 Q;  1QJO A;  3M4P A;  1DGS A;  1UEB A;  5I2Y A;  4A3I B;  1X6O A;  5ELD A;  4I65 A;  1SJE D;  3ITP A;  1KDB A;  3CRK C;  1H95 A;  1ZYR C;  3HOU G;  1ILP A;  1BDO A;  2NZO A;  1VQJ A;  1Z47 A;  4A3M H;  4N8X 1;  2RF4 A;  4N8F A;  4OWX B;  4Y7N B;  4BBS B;  3M7G A;  2HIX A;  3J81 c;  2KEE A;  3ONA B;  3O13 A;  3NQI A;  1EQT A;  3T13 A;  4DV0 Q;  5IT9 L;  4KKU A;  3CCJ A;  2HT1 A;  3EA6 A;  3TP7 A;  5JEA J;  1XPO A;  2K33 A;  4C3H B;  5KIX A;  5C0X I;  1TS2 A;  3DEP A;  2E76 C;  1K9M C;  3K7A B;  4HCE A;  4CJ0 B;  3S2D H;  1SFO B;  1ZXT A;  3S16 B;  4XYQ A;  1VS0 A;  4DR3 Q;  2EDG A;  4B08 A;  1ML0 D;  2B2U A;  3DXJ C;  2R7Z G;  1RKN A;  2A74 C;  5IP9 H;  4DV1 L;  3K80 C;  1I6H H;  4BWG B;  1J5E Q;  3J81 E;  4C2M B;  1EWH A;  2Z4H A;  3CCE A;  3BDO A;  1IL2 A;  2JQO A;  1YVC A;  1BOS A;  1IBM L;  2G9D A;  4A3K B;  1XNQ Q;  2BH8 A;  4OEM B;  1E3P A;  2L9H A;  3E5S A;  2LS0 1;  3TP8 A;  2H5X A;  2EE1 A;  3SVM A;  1XMQ L;  4IJL A;  3HOU H;  1XTC D;  1TWH B;  2BDO A;  4KTA A;  4PZ6 A;  4KV6 A;  4RG1 A;  4A3D B;  2UUC L;  2N3S A;  4UPA A;  1O7Z A;  2IT1 A;  1VQM A;  5GRO A;  3IAY A;  3ZJY C;  3EIV A;  5LL6 X;  5BN5 A;  3NQT A;  4YCV A;  5C4X G;  5C4H A;  4LF5 L;  1PRT F;  1AZP A;  1X3F A;  2CFM A;  4JBK A;  4BBR B;  4B3S Q;  5ELF A;  4PMW A;  1U4M A;  2Q8I B;  1XPR A;  1D5M C;  5E3F A;  3SEB A;  1DXM A;  4CJ2 C;  1JC7 A;  1TII D;  3FMC A;  4A3L H;  4X3T A;  4JI0 Q;  4GN3 B;  1I3Q H;  1SE4 A;  3H3V H;  5GAH C;  5LL6 S;  4NDX A;  3FEW X;  2HIV A;  2ICI A;  3WOE A;  4B3R L;  2PZW A;  1C4Q A;  4F8M A;  4DR2 Q;  2BE5 C;  3R93 A;  3H0G G;  1WI5 A;  4X62 Q;  5C6A A;  4EGV A;  2UU9 Q;  3ERQ A;  1SNP A;  3GTQ H;  4IUT A;  3CCV A;  1N32 L;  5EBD A;  3NBH B;  3MZ5 A;  3ZYY X;  2UUB L;  3GV6 A;  2RDF A;  4MN3 A;  2TMP A;  2N78 A;  1X56 A;  1XXG A;  4HID A;  1SR3 A;  3FP9 A;  4IJH A;  3HOW G;  1P8L A;  4HSP A;  1DOK A;  4RA8 A;  3K0Y A;  4R4O A;  4DUZ Q;  2HDL A;  5AJ3 Q;  2ENB A;  3S14 H;  3F2D A;  2QA4 A;  3J7A 5;  1JOK A;  4PNY A;  1GOZ A;  1FGB D;  1RCV D;  4DR4 L;  3K58 A;  1CK1 A;  4DV5 L;  4L8J A;  5CV6 A;  4YWL A;  5TSS A;  4CDF C;  3I2Z A;  2F0T A;  1TWF B;  1N33 Q;  2PMZ E;  3RLN A;  1Y69 U;  3ICE A;  2VUM G;  4JI3 Q;  2D5D A;  4K8J A;  1CHQ D;  5BR8 Q;  3LGJ A;  2YTV A;  3PUV A;  2HDM A;  3R2I A;  3SE0 A;  4TQU S;  4B9X A;  1IBK Q;  4JI2 L;  3BYY B;  1LAC A;  1HA6 A;  1K0R A;  1VQ7 A;  3UE1 A;  4QJF A;  4KD4 A;  3EJI A;  3A5Z B;  4TKO B;  5HY6 A;  3OMG A;  2EXD A;  4XT3 B;  1CZW A;  3I3C A;  3SHL A;  2F0Q A;  4MTN A;  1BBW A;  1PRT B;  2RDH A;  3NXW A;  5FLX L;  3H3V C;  4OON A;  3CC2 A;  1JCK B;  1L1O C;  1CKM A;  4HMJ A;  3STB D;  2DNC A;  1YNN C;  3H0G H;  4BY7 G;  1F9R A;  4DR3 L;  2RHQ B;  1I4R A;  3NHH A;  1LO5 D;  3N52 A;  1VQK A;  5FKA C;  4LF8 Q;  1Q1E A;  1S5C D;  1VQ6 A;  4JOI A;  2HHH Q;  3I4N G;  1Y8N B;  1PZI D;  1WD0 A;  3PF4 A;  2OQ0 A;  1F2Z A;  3KFU A;  4NXM Q;  1D8L A;  1K3R A;  4KY5 A;  5IIF A;  1VQ8 A;  1J9O A;  2EYF A;  5C4J B;  1YZ6 A;  4YIJ A;  4KHP L;  4A3G B;  1NBW A;  1QCB D;  4G4K A;  2EXZ A;  2JA5 G;  3DLL A;  2H4O A;  3OW2 A;  1E1O A;  1GUS A;  1S4Z A;  1EYD A;  4IPD A;  4KY7 A;  3H09 A;  1LTA D;  2Q2U A;  4L63 B;  1EY7 A;  4IN3 A;  1P16 A;  3VYT A;  1EQR A;  4Q0F A;  1WCM G;  2BE5 D;  3FHW A;  3C1F A;  2SNM A;  2F4V Q;  5H1S E;  1YHB A;  4OGQ C;  3S17 B;  1VDZ A;  5JAV A;  4JI7 L;  1NJI C;  5GAD C;  1SRU A;  3OSO A;  3H3V I;  3I4M G;  5JJZ A;  3ERS X;  1F2M A;  3NTK A;  4NKL A;  3Q8D A;  4CJ1 B;  1DOL A;  5C0X J;  1U9R A;  1WTR A;  4F88 A;  1T5X D;  2ES2 A;  1CTM A;  1E2V A;  1LLR D;  4HIM A;  4WRD A;  1PH7 A;  1SYE A;  4A4I A;  5G3L D;  3CCM A;  4UP7 A;  1SN8 A;  5FOB B;  4B3S L;  1PZK D;  4JG2 A;  2UUA Q;  2L4N A;  4LW1 A;  3VDY A;  2UXD L;  4DAP A;  3G71 A;  4JI0 L;  4AYB B;  4AQY Q;  4DA2 A;  4NXN L;  1Y1V H;  2RKS A;  4BY7 H;  2F0O A;  4LWC A;  3TS0 A;  2K75 A;  2ZTD A;  2V1C C;  2A1A A;  3IL8 A;  4PV1 C;  4WJW A;  4IOC A;  5AFW A;  1AN8 A;  2MJ8 A;  3RR5 A;  2X6L A;  2M00 A;  4DR2 L;  3CHB D;  3I4N H;  5D3I B;  1U4R A;  4GN4 B;  2F3V A;  2I07 B;  2R3Z A;  3MA2 B;  2ICE C;  3TSS A;  2UU9 L;  1GUT A;  3C1E A;  2AUK A;  4GS3 A;  4DKA C;  4GKK L;  1TWG B;  1Y1W G;  2O2L D;  1RJT A;  2UXC Q;  1E0B A;  3K59 A;  2GVA A;  2JA5 H;  2WAQ G;  1JQY D;  3TP6 A;  3P7J A;  1ILQ A;  1GUG A;  1EQV A;  2KCC A;  3VYU A;  2F3W A;  5AJ3 L;  3I73 A;  3MEF A;  3HP3 A;  3MXP A;  2KOL A;  4ME3 A;  2IX0 A;  1OO9 B;  1YNN D;  5DNF A;  4QL5 A;  5EPK A;  1QVF A;  2DJF C;  1NCV A;  1K83 H;  2Z6K A;  4DK1 A;  1C7Y A;  1AFP A;  2UXB L;  1HR0 Q;  1Z7T A;  4AH6 A;  3CQZ H;  2WAQ E;  2PI2 E;  4MHE A;  3S1N H;  2MO1 A;  1N33 L;  1K28 A;  1SNM A;  1XX8 A;  2KHS A;  1I4X A;  3I91 A;  4JI3 L;  5BR8 L;  3OPO A;  2LY7 A;  2PPB C;  3S2H B;  2E2J B;  4KJO A;  4RMF A;  3CCR A;  5M9O A;  1IBK L;  1ICW A;  3IFD A;  4G7H C;  2JA6 G;  2JN4 A;  4GN5 A;  1S5F D;  1EY5 A;  3F8T A;  1O7I A;  4K8I A;  2MUY A;  2L1B A;  1LT6 D;  4O2D A;  3NK9 A;  3U58 A;  4H44 C;  3S1R B;  4ZRZ A;  1YJ9 A;  1HJP A;  2SEB D;  4KN4 C;  4H02 A;  2F03 A;  1TQO A;  1RTN A;  3D3R A;  2PNH A;  3KBG A;  4R9W A;  2F0N A;  3FKI G;  2GA4 B;  3J81 L;  4A3J B;  4LF7 Q;  3SK8 A;  3HKZ B;  5G3L F;  1DJR D;  1HTP A;  4LFA Q;  2QCP X;  4RGN A;  4LF8 L;  2B2V C;  1G91 A;  2VQE Q;  1EOT A;  1VQH A;  2K5H A;  3U50 C;  5HUR A;  4X3S A;  5IYC G;  1ENA A;  2OF1 A;  3M85 A;  4DUY Q;  1GHJ A;  2JK8 A;  5IGG A;  3PIP A;  4HJ8 A;  1GJX A;  3M4Q A;  5M3F H;  1U4P A;  1U4L A;  3M7N A;  3L3O C;  2YTY A;  1SE2 A;  4LUV A;  1CZG A;  5M5W B;  3HEJ A;  3D4W A;  1NY4 A;  2RCF A;  4WJ4 A;  3JC6 6;  1SMX A;  3HKS A;  1V1Q A;  1W6J A;  3MXU A;  1V9P A;  1E22 A;  2A19 A;  4A3M B;  1K8A C;  4R8N A;  5E4X A;  3CC7 A;  5IOD A;  4QQB X;  2LXJ A;  2SOB A;  3TEH B;  1L2F A;  1VCI A;  3BG3 A;  3T56 B;  2EYO A;  4CDE C;  1MSH A;  4KKS A;  4R4C A;  2NZH A;  2KEN A;  5T1G A;  3E0E A;  2VNU D;  1WTH A;  2QIL A;  3HOY G;  5A2Q E;  1WJJ A;  2FMM A;  2JA8 G;  3K5M A;  1TWC H;  1PH3 A;  1DD2 A;  1CA6 A;  1FVI A;  1RIP A;  3G48 A;  3S2D B;  3JAM i;  2B2Y C;  1MHW C;  2D2C C;  2UUA L;  3AYH B;  5IE8 A;  2IJ0 A;  1E24 A;  1UWV A;  4P72 A;  1PH4 A;  1ONL A;  4I7Z C;  1A15 A;  2WAC A;  2O5J C;  1A6X A;  1I6H B;  2VQF Q;  1PFN A;  2VW9 A;  3GTO B;  3GV3 A;  3M4Y A;  4DV1 Q;  3SK5 A;  3U9O A;  3OWE B;  5IYC H;  5FK9 C;  3RN2 A;  1SE8 A;  1DON A;  3MC0 B;  4A3B H;  3SXH A;  1DCZ A;  3W5O A;  1RHP A;  3PQI A;  1STA A;  4LMQ D;  3S1Q H;  3KUP A;  4PMB A;  1EY0 A;  3PUY A;  2UXC L;  1IBM Q;  4QIW E;  3FRP B;  3MAQ A;  4KY6 A;  5J3B A;  4EQ5 A;  4MNO A;  2A8V A;  3CRL C;  5KYI A;  1HHV A;  1X3P A;  3CMA A;  4H13 C;  2EJF C;  2X69 A;  1B2T A;  1D1K A;  1KDA A;  5CC4 A;  2R92 B;  4RH6 A;  1XMQ Q;  3A7A B;  4JBJ A;  3TP5 A;  2BOS A;  1TVX A;  4JI8 L;  4ZUI A;  3SK4 A;  2Y0S B;  2KA7 A;  3NEL A;  1I50 H;  1K8O A;  1HR0 L;  1WTP A;  1YIJ A;  2PW7 A;  4OO1 G;  2F0I A;  1B8A A;  4IUQ A;  4J6H A;  3L9A X;  4IPH A;  1V8Q A;  5IOC A;  3LWU A;  2EVB A;  2RHS B;  4BY1 H;  2NVQ H;  4ZKC B;  1EYG A;  4CKB A;  3HOZ B;  2WII B;  3BYT B;  1QZG A;  1QVC A;  2JA8 H;  3ND8 A;  1CFM A;  2L5T A;  3FVQ A;  1B70 B;  3DHQ A;  2JJQ A;  1I3Q B;  2NZ1 D;  3OIQ A;  2RQX A;  2ALY B;  1LTT D;  1I4P A;  4K5X A;  3SK6 A;  4C56 C;  2F0H A;  1SYG A;  4CDC C;  1SAP A;  5EKI A;  2NWG A;  1FNU A;  1Q12 A;  4UAI A;  1W3S A;  3K81 C;  4C3I B;  3GTQ B;  3IRB A;  2R6G A;  1YHQ A;  2L0C A;  4IUP A;  5M5X H;  4DN4 M;  1VMP A;  2BA0 A;  4HJA A;  1MJE A;  4ZYS A;  2B63 H;  4LF7 L;  1HQM C;  2D0P A;  4K2L A;  3VR4 A;  1N32 Q;  1X32 A;  2WV6 D;  3CC4 A;  2X6G A;  4EQO A;  3KF6 B;  4NPS A;  4LFA L;  5GQO A;  4DAV A;  3CAM A;  3S14 B;  1QNK A;  2R93 H;  3RZD H;  5IP7 H;  3E9I A;  1SYF A;  3T51 B;  1HUN A;  1X9N A;  2FXQ A;  1XWE A;  2WIN B;  2EOT A;  3PV0 A;  1BF4 A;  2V4D A;  2KHI A;  3J80 i;  1PFB A;  1DZ1 A;  1Q90 A;  1TS5 A;  2MO0 A;  2Q2T A;  4X64 L;  2SDF A;  4M1U B;  1ZEQ X;  2MPM A;  3AQQ A;  3NP8 A;  1QIL A;  1CQF A;  3OW7 A;  5KYL A;  1K3B C;  3QIA A;  4GOP C;  3PO2 G;  5IYB G;  2HUG A;  4JBW A;  4B3M Q;  1I4H A;  4OHJ A;  2F4I A;  2QGQ A;  3KDF A;  2CWP A;  1CM9 A;  1KTK A;  2JA7 G;  3T4A C;  4QY7 A;  2BCO A;  4JI2 Q;  1IYJ B;  4IZ8 A;  1BO0 A;  4DV3 Q;  2K52 A;  3RD4 A;  4XQJ A;  3ULP A;  4RKL A;  3TRZ A;  1Q81 C;  2CCZ A;  4XIG S;  3N6R A;  4FDB A;  4P74 A;  1PYB A;  3TBI B;  3RUZ A;  1QNU A;  1XNR Q;  1HFN A;  3KLR A;  4JVZ A;  3V2T A;  3HOX B;  4MZ9 A;  4X3U A;  3C46 A;  1W2B A;  2VQF L;  1YNJ D;  4K5W A;  1S40 A;  2DN8 A;  5C44 B;  2K5V A;  1WD1 A;  5FO7 B;  1V1P B;  1I5F A;  4A3F H;  3Q22 A;  3GTK H;  1Q86 C;  3DMU A;  3PF5 A;  4F87 A;  1KQS A;  4GLA C;  2KCM A;  3U4V A;  3MXG A;  4A75 A;  4DXF A;  3CCS A;  4KHP Q;  3I90 A;  2B2W C;  2PQA A;  4U68 A;  5C4Z A;  2K5D A;  3GTG H;  2WP8 J;  4QUC A;  1DOM A;  3VR6 A;  3MXN B;  5CR3 A;  1PVO A;  2EQS A;  4KKT A;  2QKI C;  4L5S A;  4JI7 Q;  4HCS A;  1PH9 A;  1XMO Q;  3PO2 H;  3OIP A;  1VQI A;  1HPC A;  2F0K A;  3GD7 A;  2VXW A;  1O7L A;  2AWN A;  3F1Z A;  1NAP A;  3STB C;  2JA7 H;  3GTL H;  3OWF A;  3K7U C;  4J8Q A;  4KLK A;  1D5Z C;  1PDQ A;  5M5Y H;  1NNX A;  2AMC B;  3DUZ A;  1SE3 A;  1Y8O B;  5KGU A;  4IFD G;  1STH A;  4BXX G;  3JAM c;  3NPP A;  4NP5 A;  3H15 A;  4A93 G;  4GZY C;  5I6W A;  5JJI A;  1Y1V B;  4BY7 B;  1YJN A;  1AH9 A;  3TRE A;  2UXD Q;  2WKC A;  4V19 0;  1QVG A;  4NXN Q;  3ULJ A;  1ENC A;  4FF3 A;  5C3E B;  1HH2 P;  4X65 Q;  2E75 C;  5ELN A;  3I4N B;  4NW2 A;  4R4Q A;  1WTV A;  1B3Q A;  1WYD A;  4ABN A;  1X3G A;  4IOA A;  2R7Z H;  2R61 A;  1SJH D;  3OOC A;  1XYI A;  4JI5 Q;  5FLM G;  2A73 B;  2B29 A;  4BBS G;  4OO1 I;  3K8A A;  4E6I A;  3RLO A;  2JA5 B;  4GKK Q;  2XRQ D;  2CVR A;  3JAM E;  1YJW A;  1LAB A;  4DR5 Q;  4C3H G;  1L0Y B;  2QDL A;  2M9V A;  5D3D A;  1RD9 D;  4KD3 A;  1K83 B;  2EY1 A;  3V96 A;  1PH2 A;  1R9T H;  3MHB A;  3H94 A;  2XTI A;  1X55 A;  3C3L A;  1JE5 A;  1CQV A;  1PHJ A;  1B53 A;  4A76 A;  2IW3 A;  3CQZ B;  3WWV A;  4TVA B;  3S1N B;  2UXB Q;  2A6E D;  1IW7 D;  4I7A A;  2FFK B;  5CYU A;  2WB1 B;  2IHF A;  4QUF A;  1V43 A;  3BVM A;  1B1Z A;  5C4X H;  5A2Q L;  4K6D A;  4S3S A;  4G57 A;  2E2D C;  2OCE A;  4IFD H;  2L15 A;  4B3M L;  4JYA Q;  3HRZ C;  5KRU A;  1ET6 A;  4LF9 L;  2PZU A;  4A93 H;  1LTL A;  5C3X A;  3EBE A;  4A3K G;  1QUQ B;  2N49 A;  1EIG A;  4DV3 L;  4IUN A;  3DM1 A;  1EY6 A;  2QEJ C;  4YCW A;  5E1F A;  3GTP H;  2RA4 A;  4IPC A;  3OHX C;  4HSV A;  1VQ4 A;  3J7Y W;  3W3A A;  2EYL A;  3PO3 G;  1G6P A;  4RGM A;  1XNR L;  1S5E D;  4CGY B;  4HR7 B;  2AUJ D;  5M3M G;  2WKD A;  1F2Y A;  4L6T B;  1PXU A;  4KK7 A;  4DFA A;  4BBS H;  1TWA H;  2PZT A;  3KDF B;  1F9Q A;  1I94 Q;  1VQA A;  1M8A A;  1NR4 A;  5M3F B;  3GO5 A;  4LF4 L;  5EGT A;  2XWB B;  4QF4 A;  4XXE A;  2ATW A;  3R8B A;  3FPP A;  4QMG A;  3HOW H;  1F9P A;  4KJN A;  2K28 A;  4C3H H;  3CME A;  2IWH A;  4BBR G;  1EWI A;  1KLU D;  4DNI A;  3FDT A;  1SEB D;  3K7A H;  1SFO H;  2A69 D;  3S16 H;  4U67 3;  1UEA B;  1O7Y A;  3GTJ B;  1B9N A;  1QB5 D;  4X66 L;  3NEN A;  2KCT A;  4DV4 Q;  3LNN A;  1JWU D;  3E6Z X;  5K5P A;  1MGS A;  5LMN L;  3K0X A;  1HR0 W;  1EEF D;  1O78 A;  1D7Q A;  1XMO L;  1FNW A;  3PUZ A;  4MTK A;  3C2P A;  2VUM H;  1C8C A;  5JVG 3;  2KQ3 A;  3KBX A;  2GN5 A;  4O0A A;  5CV5 A;  1TWC B;  4A3K H;  1IKM A;  4ZKB B;  4PZ7 A;  2PQA B;  2D0O A;  2EY2 A;  2C35 B;  2VB3 X;  3PCO B;  3VR3 A;  4FXD A;  3VR2 A;  2NN6 G;  2LXK A;  3NE5 B;  3MVV A;  3J80 E;  1PH5 A;  1G2S A;  2Z8L A;  1VQE A;  2K01 A;  4UY8 C;  2EY6 A;  1LUZ A;  2XN9 C;  2CKZ B;  4HTH A;  1IYU A;  3RZO H;  5M3M H;  1A3U A;  1VF7 A;  2NVT H;  3W2D A;  4DXG A;  3KJO A;  4X65 L;  2K5W A;  4C1N K;  2OEO A;  5E4W C;  4YWK A;  1N36 L;  3IFT A;  5GAE C;  4QCL A;  4A3B B;  3KLW A;  2K6A A;  4JI5 L;  3S1Q B;  4DNT B;  2FHT A;  2LKV A;  2ID0 A;  2K5Q A;  4L5T A;  3PIO 3;  1NUC A;  1BCP D;  5K36 G;  2VY3 A;  4C3J G;  1HTL D;  3ND9 A;  2OT2 A;  4IFD I;  2E2H H;  3TS2 A;  3Q6S A;  4BA2 I;  3W1G A;  4ULL A;  4DR5 L;  1JWS D;  2K4K A;  5ELE A;  3CXC A;  4PQX A;  1Q7Y C;  2RVL A;  5CBE E;  5ISR A;  3M4O B;  1WVL A;  4Q5V A;  1WCM H;  3Q0A A;  1Q82 C;  2YV5 A;  4JI8 Q;  1STE A;  3PGZ A;  4ZK9 B;  2E8G A;  1L1O A;  3I4M H;  1G6Z A;  1F77 A;  4BY1 B;  1X3E A;  4ZAI A;  1VQB A;  3VYS A;  2JA8 B;  2ZXO A;  1K73 C;  4B3T Q;  1ENF A;  5DEH A;  1S5D D;  1NR2 A;  5CMD A;  3H6M A;  4JYA L;  5GAG C;  3MFY A;  3BZC A;  1STG A;  2NN6 H;  1HRJ A;  4QIW B;  2F0V A;  3KF6 A;  3CPW A;  1IL8 A;  3K57 A;  1PFM A;  1IHZ A;  4FO2 A;  4XDX A;  3QOL A;  1F9S A;  1HNX Q;  3NBI A;  1M4V A;  1OXT A;  1PTO D;  4DF7 A;  1EFW A;  3I72 A;  5NUC A;  5M5X B;  1ESR A;  2B63 B;  2B2T C;  5CV7 A;  1Q46 A;  3A55 A;  4CKC A;  3QWN A;  2QW7 A;  1WTO A;  4RHR A;  3F2U A;  4K0K Q;  1UUP A;  3GTM H;  1I94 L;  5IWA Q;  4HJ5 A;  2R93 B;  1Y1W H;  1WOC A;  3RZD B;  5IY0 A;  5K36 H;  4C3J H;  1XJV A;  1EIH A;  1IZ6 A;  2Q8R E;  5C3W A;  1FR3 A;  3NEM A;  3T1H L;  3TDQ A;  2HQE A;  3J7A V;  1FL0 A;  1SYD A;  2KBN A;  4ZLT F;  2E2I B;  1B50 A;  2Z4I A;  2XSC A;  1JWM D;  3EFX D;  2ZJR A;  4L5R C;  3CU7 A;  1EY9 A;  4WJ3 M;  3A8I E;  4AYB G;  1UAP A;  2NBF A;  2Q2I A;  4X64 Q;  2IHE A;  3LX0 A;  1Z6H A;  1RF2 D;  3UDF A;  2CH4 A;  1WFQ A;  2DGY A;  1H9R A;  4DV4 L;  5CV4 A;  4K14 A;  3BS1 A;  3I4L A;  1SNQ A;  2YTX A;  3J7Z C;  1EZ6 A;  1TU2 B;  5C0X G;  2JA9 A;  2KVM A;  3RLF A;  1SRO A;  2RCN A;  3VA5 A;  4AYB E;  2EY5 A;  3NSW A;  4JW0 A;  2JA6 H;  1V1P A;  3MEH A;  3NTI A;  3BJU A;  5FJ8 G;  3F2B A;  2ZXP A;  5F2D A;  1ROD A;  1MBY A; 
#chains in the Genus database with same CATH homology
 1RDP D;  2QDB A;  1PZJ D;  1B3A A;  4HED A;  4X3K A;  4A3F B;  4G7O C;  3GTK B;  4H0L C;  3AB9 A;  3MXN A;  3JAM L;  2PCF B;  3QOJ A;  3T16 A;  4C1N I;  3Q24 A;  1SBB B;  1KAA A;  2SNS A;  2OXP A;  5EKL A;  1AP0 A;  5JVH 3;  3GTG B;  3AMU A;  1IKL A;  2NN6 I;  1VF5 C;  3KLS A;  2J7Z A;  3D6W A;  1EWC A;  3HG9 A;  3HOU B;  1SMY D;  3V05 A;  5HGT A;  1DYQ A;  2RSO A;  4K6L A;  2M2L A;  3E0J A;  1I6V C;  3Q23 A;  2B39 A;  2JA7 B;  1OXU A;  2K7V A;  5A35 A;  1I4G A;  1JIC A;  1I4Q A;  3DWQ A;  5M5Y B;  2A68 C;  2PQE A;  5EJW A;  2B2V A;  2BA1 A;  2G9H D;  1STY A;  2AQ1 B;  1YNJ C;  1A3T A;  2F0J A;  1HCZ A;  2NTS A;  5J39 A;  4BA1 I;  1JB3 A;  2B2U C;  2D9U A;  2R7Z B;  3TN2 A;  5DM6 3;  5JOB A;  3TZU A;  1STN A;  1STB A;  5EBC A;  5C5L A;  1LTR D;  1UNS A;  1SXT A;  4V0B A;  1QG7 A;  1R9T B;  3OMC A;  4CHT B;  2B2Y A;  1EU3 A;  2KJX A;  5IGD A;  1LTI D;  4EQP A;  3K6O A;  1MI2 A;  4KHZ A;  1WTQ A;  4OO1 H;  2NYZ D;  5C4X B;  3MWY W;  3R2T A;  2JXM B;  4ID6 A;  3KK7 A;  2KED A;  1SYB A;  5KNB A;  3K5L A;  4A93 B;  1EL0 A;  2A6H C;  2K1B A;  4KMU C;  4ILW A;  4BS9 A;  4HAE A;  1EY8 A;  3GTP B;  1FNV A;  1PRT D;  3P20 A;  2JP1 A;  2F0U A;  4FXK C;  1SSO A;  3PUX A;  3H0G B;  4N9P A;  4FVM A;  3P75 A;  5DM7 3;  1TWA B;  4EQN A;  3S9W A;  2A68 D;  3X3M A;  4F7X A;  3WOF A;  3NUC A;  2D62 A;  4FF2 A;  2XWJ B;  3HOW B;  1G8Z D;  2PMZ B;  5EPL A;  1WTW A;  3VR5 A;  2A6E C;  1HXY D;  1IW7 C;  5COY A;  1G29 1;  4O42 A;  2PW5 A;  1KDC A;  4ZUJ A;  3AU7 A;  2IX1 A;  1SND A;  1BBX C;  3IKJ A;  3EVQ A;  2NB0 A;  2C5C A;  4FP5 D;  1CHP D;  2F1M A;  4IQZ A;  4IUV A;  2E74 C;  1HFG A;  2EZV A;  4C3I G;  4FXG C;  4DNR B;  2FIN B;  1H9S A;  1F2L A;  2VUM B;  1EYA A;  4LJZ C;  1MSG A;  1LV9 A;  3MTS A;  1LT5 D;  1C48 A;  5EQ0 A;  1EYC A;  3GQB A;  5I9P A;  3CKI B;  1VMC A;  4FYD A;  4RGO S;  2CHB D;  5M3M B;  3RZO B;  2NVT B;  5KNC A;  3A8K E;  2YYZ A;  1LT4 D;  2LFN A;  1T5E A;  3NWS A;  2BDN A;  2F0P A;  1AZQ A;  1E2Z A;  3NWT A;  2O4X A;  2A69 C;  2PYK A;  2A6H D;  5IGE A;  4CKE A;  3T53 B;  2B8G A;  2E2H B;  1TY2 A;  1ZYR D;  1Q8I A;  4DGZ A;  1AEX A;  2F0E A;  1WCM B;  2EJM A;  1RTO A;  4RFB A;  3QO2 A;  3NTH A;  1W6K A;  1MD2 D;  1CT1 D;  3I4M B;  3PMF A;  3URY A;  1PTO H;  4MIU A;  5IGF A;  4FNF A;  4TSS A;  5ELC A;  1LTG D;  1EZ8 A;  3A56 A;  1OXV A;  3DWP A;  3X3N A;  1K8M A;  4DAY A;  3DEO A;  5FO9 B;  4PMC A;  3PIP 3;  4KN7 C;  4ODG A;  5DAU A;  3TME A;  2HCI A;  4XQQ A;  3D6C A;  5JEA G;  1FD7 D;  2B8F A;  2B2W A;  4OL7 A;  1BCP C;  1O80 A;  1Q1B A;  5CBA E;  3EQL C;  5LHY 1;  3QB3 A;  1ESF A;  2XRS D;  1Q3L A;  2XVS A;  3GTM B;  1Y1W B;  4C3J B;  2CW0 C;  2J4X A;  2WAQ B;  2JEB I;  1EU4 A;  1JE4 A;  1TY0 A;  5I4D A;  2F0G A;  1D5X C;  5J22 A;  5I9O A;  2N88 A;  4HN7 A;  1A2T A;  3D4D A;  4H7B A;  1GUO A;  2JYO A;  5COR A;  1PTO C;  1NSN S;  2K32 A;  1R4Q B;  4RCO A;  4LAA A;  4P2C B;  3I8Z A;  5ELB A;  5CGK A;  2JA6 B;  2ZT9 C;  1E2W A;  2IX3 A;  5JEA H;  1LTB D;  4K2K A;  4IUU A;  1EEI D;  5IGB A;  1TKW B;  1FYC A;  3P1H A;  3FKI B;  1H9S B;  5BN4 A;  5BN3 A;  1BUV T;  3M3Y B;  1H9J A;  3R3O A;  5C5M A;  1GXD C;  2FJ2 A;  3I70 A;  1PYW D;  4Z9C B;  2C9O A;  2EYH A;  3S1M B;  2TSS A;  2F0D A;  1KAB A;  4RAU C;  5IT9 E;  2N55 A;  3J7A F;  3S15 B;  1BXT A;  1BQQ T;  1EY4 A;  2RDG A;  1H9K A;  1II3 A;  1CI3 M;  1B9M A;  3ERO A;  3RMH A;  1IYV A;  5EPJ A;  5EKK A;  2J0T D;  1I50 B;  2CW0 D;  4RCN A;  2AQ3 B;  1GUN A;  1WTX A;  5IGC A;  1HUM A;  2NVQ B;  1A3V A;  3HOY B;  2IPK D;  2XNA C;  2EYJ A;  3A7L A;  1SYC A;  2RBM A;  4XYO A;  4ZQ3 A;  3BDC A;  5T1I A;  3VYR A;  3HZX A;  3DWA A;  3G7L A;  1SDF A;  2F0W A;  2MGS A;  1LTS D;  2DY8 A;  1V1O A;  3A54 A;  1J8I A;  2ZXR A;  1SMY C;  1TS4 A;  3QG1 A;  1JOR A;  1QE6 A;  1TS3 A;  2NVY B;  2F0S A;  5KEE A;  4DK0 A;  2CQA A;  4OIK A;  4M8A A;  1AW7 A;  3BVG A;  2F0M A;  4XT1 B;  3H91 A;  4TRD A;  1LT3 D;  1SNC A;  3HGB A;  1BR9 A;  1JOO A;  5JPM C;  1S5B D;  1BCP F;  2MHV A;  2EJG C;  3TZD A;  5D65 A;  3GP7 A;  4DU9 A;  3D8G A;  4B9W A;  1ET9 A;  4K5V A;  5CV9 A;  1H9M A;  3SDZ A;  1GHK A;  4RGT A;  5I2X A;  4XTC S;  1HQR D;  2KUM A;  4NMZ A;  4G7Z C;  3WDN A;  2FMC A;  2MP1 A;  1D2B A;  1JOQ A;  2O5I C;  3BVZ A;  2I46 A;  3K5O A;  4RWS C;  4CBV A;  2A5H A;  1Y8P B;  2K04 A;  2L12 A;  2DNE A;  1TT2 A;  1G2T A;  1B44 D;  1OXS C;  3D4R A;  2F0L A;  2L55 A;  2AWO A;  1R4P B;  3LWE A;  1ZKO A;  5JPN C;  3U9S A;  1PLF A;  1PTO F;  2Z1C A;  2DY7 A;  4R8I A;  1EFI D;  2EYM A;  4WOR A;  4LK1 C;  1HA5 A;  2K05 A;  2HCC A;  5FO8 B;  1D1I A;  5FLX E;  4FF4 A;  1PRT C;  2KEC A;  2B2T A;  3PO2 B;  1DM0 B;  1A2U A;  3BDL A;  2H1E A;  2JSO A;  3SR1 A;  3GTL B;  3K5N A;  1OXX K;  1BNZ A;  2F0F A;  5C0X H;  3G6J B;  2K03 A;  1QWY A;  4KI0 A;  2EPB A;  5J1Z A;  1D6E C;  5KND A;  3KF8 A;  4QB4 A;  3FPU B;  1B4O A;  4RKB A;  4A3E B;  2NUC A;  1BCP B;  2XIW A;  2IL8 A;  4HMI A;  2VB2 X;  3VA7 A;  3HOV B;  1SNO A;  4RHS A;  2JEA I;  1X3Q A;  1PMR A;  1TR5 A;  2YU9 B;  2PO4 A;  3UI2 A;  2PNR C;  1KLG D;  4N9T A;  4J1M A;  4ME5 A;  3KLS X;  5I6Y A;  4FF1 A;  3BZD B;  3NBH A;  4IFD J;  2RSN A;  4IAL A;  5CV8 A;  2Q8T A;  1GUW A;  3MFG A;  2QF7 A;  4UDU C;  4JK1 C;  1JR0 D;  2NVX B;  3QJY A;  2NTT A;  2KCN A;  1PTO B;  1CA5 A;  2JE6 I;  4EVO A;  5D14 A;  3PUW A;  3A8J E;  3PO3 B;  1QOH A;  3D31 A;  4O1N A;  2EYP A;  1KNA A;  4XQN A;  2AQ2 B;  3L7Z C;  1KNE A;  2LMC B;  4WFN 3;  2L11 A;  3HS0 C;  4KHV A;  1L0X B;  4IUR A;  4OIJ A;  3J80 L;  1QJO A;  5I2Y A;  4A3I B;  5ELD A;  4I65 A;  1SJE D;  3ITP A;  1KDB A;  3CRK C;  1ZYR C;  1ILP A;  1BDO A;  1Z47 A;  4Y7N B;  4BBS B;  3M7G A;  2KEE A;  3ONA B;  3O13 A;  3NQI A;  1EQT A;  3T13 A;  5IT9 L;  4KKU A;  3EA6 A;  3TP7 A;  5JEA J;  2K33 A;  4C3H B;  5KIX A;  5C0X I;  1TS2 A;  3DEP A;  2E76 C;  3K7A B;  4HCE A;  4CJ0 B;  1SFO B;  1ZXT A;  3S16 B;  4XYQ A;  2EDG A;  4B08 A;  1ML0 D;  2B2U A;  3DXJ C;  1RKN A;  2A74 C;  4BWG B;  3J81 E;  4C2M B;  1EWH A;  2Z4H A;  3BDO A;  1BOS A;  2G9D A;  4A3K B;  2L9H A;  3E5S A;  2LS0 1;  3TP8 A;  2EE1 A;  3SVM A;  1XTC D;  1TWH B;  2BDO A;  4KTA A;  4KV6 A;  4A3D B;  1O7Z A;  2IT1 A;  3IAY A;  5LL6 X;  5BN5 A;  3NQT A;  5C4H A;  1PRT F;  1AZP A;  4BBR B;  5ELF A;  4PMW A;  1U4M A;  2Q8I B;  1D5M C;  5E3F A;  3SEB A;  1DXM A;  4CJ2 C;  1JC7 A;  1TII D;  3FMC A;  4X3T A;  1SE4 A;  5LL6 S;  4NDX A;  3FEW X;  2ICI A;  3WOE A;  2PZW A;  1C4Q A;  4F8M A;  2BE5 C;  3R93 A;  5C6A A;  4EGV A;  3ERQ A;  1SNP A;  4IUT A;  5EBD A;  3MZ5 A;  3ZYY X;  3GV6 A;  2RDF A;  4MN3 A;  2TMP A;  1XXG A;  4HSP A;  1DOK A;  4RA8 A;  3K0Y A;  2HDL A;  2ENB A;  1JOK A;  4PNY A;  1GOZ A;  1FGB D;  1RCV D;  3K58 A;  1CK1 A;  4L8J A;  5CV6 A;  5TSS A;  2F0T A;  1TWF B;  1Y69 U;  2D5D A;  4K8J A;  1CHQ D;  3PUV A;  2HDM A;  3R2I A;  3SE0 A;  4TQU S;  4B9X A;  3BYY B;  1LAC A;  1HA6 A;  4KD4 A;  3EJI A;  4TKO B;  3OMG A;  4XT3 B;  1CZW A;  3I3C A;  3SHL A;  2F0Q A;  5FLX L;  1PRT B;  2RDH A;  3NXW A;  3H3V C;  1JCK B;  4HMJ A;  2DNC A;  1YNN C;  1F9R A;  1I4R A;  3NHH A;  1LO5 D;  3N52 A;  5FKA C;  1Q1E A;  1S5C D;  1Y8N B;  1PZI D;  1WD0 A;  1F2Z A;  4KY5 A;  5IIF A;  1J9O A;  2EYF A;  5C4J B;  4YIJ A;  4A3G B;  1QCB D;  4G4K A;  2EXZ A;  2H4O A;  1GUS A;  1S4Z A;  1EYD A;  4KY7 A;  3H09 A;  1LTA D;  4L63 B;  1EY7 A;  4IN3 A;  3VYT A;  4Q0F A;  2BE5 D;  3C1F A;  2SNM A;  4OGQ C;  3S17 B;  1VDZ A;  5JAV A;  3OSO A;  5JJZ A;  1F2M A;  3NTK A;  4NKL A;  4CJ1 B;  1DOL A;  5C0X J;  1U9R A;  1WTR A;  4F88 A;  1T5X D;  1CTM A;  1E2V A;  1LLR D;  4WRD A;  1SYE A;  5G3L D;  5FOB B;  1PZK D;  2L4N A;  4DAP A;  4AYB B;  4DA2 A;  2RKS A;  2F0O A;  4PV1 C;  3IL8 A;  4WJW A;  5AFW A;  1AN8 A;  2MJ8 A;  2X6L A;  2M00 A;  3CHB D;  5D3I B;  1U4R A;  2F3V A;  2I07 B;  2R3Z A;  3MA2 B;  2ICE C;  3TSS A;  1GUT A;  3C1E A;  2AUK A;  1TWG B;  2O2L D;  1RJT A;  1E0B A;  3K59 A;  1JQY D;  3TP6 A;  1ILQ A;  1GUG A;  1EQV A;  2KCC A;  3P7J A;  3VYU A;  2F3W A;  3I73 A;  3HP3 A;  3MXP A;  2KOL A;  2IX0 A;  1OO9 B;  1YNN D;  5DNF A;  5EPK A;  1NCV A;  4DK1 A;  1AFP A;  1Z7T A;  4MHE A;  1SNM A;  1XX8 A;  2KHS A;  1I4X A;  3I91 A;  3OPO A;  2LY7 A;  2PPB C;  3S2H B;  2E2J B;  4KJO A;  5M9O A;  1ICW A;  3IFD A;  4G7H C;  1S5F D;  1EY5 A;  4K8I A;  2MUY A;  2L1B A;  1LT6 D;  3NK9 A;  4H44 C;  3S1R B;  4ZRZ A;  2SEB D;  4KN4 C;  2F03 A;  1TQO A;  1RTN A;  3D3R A;  3KBG A;  4R9W A;  2F0N A;  2GA4 B;  3J81 L;  4A3J B;  3SK8 A;  3HKZ B;  5G3L F;  1DJR D;  1HTP A;  2QCP X;  4RGN A;  2B2V C;  1G91 A;  1EOT A;  5HUR A;  4X3S A;  1ENA A;  2OF1 A;  3M85 A;  1GHJ A;  5IGG A;  1GJX A;  1U4P A;  1U4L A;  3M7N A;  3L3O C;  1SE2 A;  1CZG A;  5M5W B;  3HEJ A;  3D4W A;  1W6J A;  3MXU A;  4A3M B;  4R8N A;  5E4X A;  5IOD A;  2SOB A;  1VCI A;  3BG3 A;  3T56 B;  2EYO A;  1MSH A;  4KKS A;  5T1G A;  2VNU D;  2QIL A;  5A2Q E;  2FMM A;  3K5M A;  1DD2 A;  1CA6 A;  3S2D B;  2B2Y C;  2D2C C;  2IJ0 A;  1ONL A;  4I7Z C;  1A15 A;  2WAC A;  2O5J C;  1A6X A;  1I6H B;  1PFN A;  3GTO B;  3GV3 A;  3M4Y A;  3SK5 A;  3U9O A;  3OWE B;  5FK9 C;  1DON A;  3MC0 B;  3SXH A;  1DCZ A;  1RHP A;  4LMQ D;  1STA A;  3KUP A;  4PMB A;  1EY0 A;  3PUY A;  3FRP B;  3MAQ A;  4KY6 A;  3CRL C;  5KYI A;  1HHV A;  1X3P A;  4H13 C;  2EJF C;  2X69 A;  1B2T A;  5CC4 A;  1D1K A;  1KDA A;  2R92 B;  4RH6 A;  3A7A B;  3TP5 A;  2BOS A;  1TVX A;  4ZUI A;  3SK4 A;  2Y0S B;  2KA7 A;  1K8O A;  1WTP A;  4OO1 G;  2PW7 A;  2F0I A;  4IUQ A;  4J6H A;  3L9A X;  1V8Q A;  5IOC A;  3LWU A;  2EVB A;  4ZKC B;  4CKB A;  3HOZ B;  2WII B;  3BYT B;  3ND8 A;  1CFM A;  2L5T A;  3FVQ A;  3DHQ A;  1I3Q B;  2NZ1 D;  3OIQ A;  2RQX A;  1LTT D;  1I4P A;  4K5X A;  3SK6 A;  4C56 C;  2F0H A;  1SYG A;  1SAP A;  5EKI A;  2NWG A;  1FNU A;  1Q12 A;  4UAI A;  4C3I B;  3GTQ B;  2R6G A;  2L0C A;  4IUP A;  4DN4 M;  1VMP A;  2BA0 A;  4ZYS A;  1HQM C;  4K2L A;  3VR4 A;  1X32 A;  2WV6 D;  2X6G A;  4EQO A;  4DAV A;  3S14 B;  1QNK A;  1SYF A;  3T51 B;  1HUN A;  1XWE A;  2WIN B;  2EOT A;  3PV0 A;  1BF4 A;  2V4D A;  1PFB A;  1DZ1 A;  1Q90 A;  1TS5 A;  2SDF A;  4M1U B;  1ZEQ X;  2MPM A;  3NP8 A;  1QIL A;  1CQF A;  3OW7 A;  5KYL A;  3QIA A;  2HUG A;  4JBW A;  1I4H A;  4OHJ A;  2F4I A;  1CM9 A;  1KTK A;  3T4A C;  2BCO A;  4IZ8 A;  1BO0 A;  3RD4 A;  4XQJ A;  4RKL A;  4XIG S;  3N6R A;  3TBI B;  3RUZ A;  1QNU A;  1HFN A;  3KLR A;  3V2T A;  3HOX B;  4X3U A;  3C46 A;  1YNJ D;  4K5W A;  2DN8 A;  5C44 B;  1WD1 A;  5FO7 B;  1V1P B;  3Q22 A;  3DMU A;  4F87 A;  3MXG A;  4DXF A;  3I90 A;  2B2W C;  4U68 A;  5C4Z A;  2K5D A;  2WP8 J;  4QUC A;  1DOM A;  3VR6 A;  5CR3 A;  4KKT A;  2QKI C;  4HCS A;  3OIP A;  1HPC A;  2F0K A;  3GD7 A;  2VXW A;  1O7L A;  2AWN A;  1NAP A;  3OWF A;  4J8Q A;  1D5Z C;  1PDQ A;  3DUZ A;  1SE3 A;  1Y8O B;  5KGU A;  4IFD G;  1STH A;  3NPP A;  4NP5 A;  4GZY C;  5I6W A;  1Y1V B;  4BY7 B;  2WKC A;  4V19 0;  1ENC A;  4FF3 A;  5C3E B;  2E75 C;  3I4N B;  4NW2 A;  1WTV A;  4ABN A;  2R61 A;  1SJH D;  3OOC A;  1XYI A;  2A73 B;  4OO1 I;  4E6I A;  2JA5 B;  2XRQ D;  2CVR A;  3JAM E;  1LAB A;  4C3H G;  1L0Y B;  2M9V A;  5D3D A;  1RD9 D;  4KD3 A;  1K83 B;  2EY1 A;  3V96 A;  3MHB A;  3H94 A;  3C3L A;  1CQV A;  1B53 A;  2IW3 A;  3CQZ B;  3S1N B;  2A6E D;  1IW7 D;  2FFK B;  5CYU A;  2WB1 B;  4QUF A;  1V43 A;  3BVM A;  1B1Z A;  5A2Q L;  4K6D A;  4S3S A;  4G57 A;  2E2D C;  4IFD H;  3HRZ C;  5KRU A;  1ET6 A;  2PZU A;  5C3X A;  1EIG A;  4IUN A;  3DM1 A;  1EY6 A;  2QEJ C;  5E1F A;  2RA4 A;  3OHX C;  4HSV A;  3J7Y W;  3W3A A;  2EYL A;  4RGM A;  1S5E D;  4CGY B;  4HR7 B;  2AUJ D;  2WKD A;  1F2Y A;  4L6T B;  1PXU A;  4KK7 A;  4DFA A;  2PZT A;  1F9Q A;  1M8A A;  1NR4 A;  5M3F B;  3GO5 A;  4XXE A;  2XWB B;  4QF4 A;  5EGT A;  3R8B A;  3FPP A;  4QMG A;  1F9P A;  4KJN A;  2K28 A;  2IWH A;  1KLU D;  3FDT A;  1SEB D;  2A69 D;  4U67 3;  1UEA B;  1O7Y A;  3GTJ B;  1B9N A;  1QB5 D;  3LNN A;  1JWU D;  3E6Z X;  5K5P A;  1MGS A;  1EEF D;  1O78 A;  1FNW A;  3PUZ A;  3C2P A;  1C8C A;  5JVG 3;  2KQ3 A;  3KBX A;  5CV5 A;  1TWC B;  1IKM A;  4ZKB B;  2EY2 A;  2VB3 X;  3VR3 A;  4FXD A;  3VR2 A;  2NN6 G;  3NE5 B;  3MVV A;  3J80 E;  1G2S A;  2Z8L A;  2K01 A;  2EY6 A;  2XN9 C;  4HTH A;  1IYU A;  1A3U A;  1VF7 A;  3W2D A;  4DXG A;  2K5W A;  4C1N K;  2OEO A;  5E4W C;  3IFT A;  4QCL A;  4A3B B;  2K6A A;  3S1Q B;  4DNT B;  2FHT A;  2LKV A;  2ID0 A;  2K5Q A;  3PIO 3;  1NUC A;  1BCP D;  5K36 G;  4C3J G;  1HTL D;  3ND9 A;  2OT2 A;  4IFD I;  3Q6S A;  4BA2 I;  4ULL A;  1JWS D;  5ELE A;  4PQX A;  2RVL A;  5CBE E;  5ISR A;  3M4O B;  1WVL A;  4Q5V A;  3Q0A A;  1STE A;  4ZK9 B;  1G6Z A;  1F77 A;  4BY1 B;  4ZAI A;  3VYS A;  2JA8 B;  2ZXO A;  1ENF A;  5DEH A;  1S5D D;  1NR2 A;  5CMD A;  3H6M A;  3MFY A;  1STG A;  2NN6 H;  1HRJ A;  4QIW B;  2F0V A;  1IL8 A;  3K57 A;  1PFM A;  1IHZ A;  4FO2 A;  4XDX A;  3QOL A;  1F9S A;  3NBI A;  1M4V A;  1OXT A;  1PTO D;  4DF7 A;  3I72 A;  5NUC A;  5M5X B;  1ESR A;  2B63 B;  2B2T C;  5CV7 A;  3A55 A;  4CKC A;  3QWN A;  1WTO A;  4RHR A;  3F2U A;  1UUP A;  2R93 B;  3RZD B;  5K36 H;  1EIH A;  5C3W A;  2Q8R E;  1FR3 A;  3TDQ A;  2HQE A;  3J7A V;  1SYD A;  2E2I B;  4ZLT F;  1B50 A;  2Z4I A;  2XSC A;  1JWM D;  3EFX D;  3CU7 A;  1EY9 A;  3A8I E;  1UAP A;  2NBF A;  3LX0 A;  1Z6H A;  1RF2 D;  1H9R A;  5CV4 A;  4K14 A;  3BS1 A;  3I4L A;  1SNQ A;  1EZ6 A;  1TU2 B;  5C0X G;  2KVM A;  3RLF A;  3VA5 A;  2EY5 A;  3NSW A;  1V1P A;  3MEH A;  3NTI A;  2ZXP A;  5F2D A;  1ROD A;  1MBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...