2E2IH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
134
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 17
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2iH00
1J6QA 1UWVA 4JC0A 4IPDA 5FLMG 4JI2Q 2JA7H 2DGYA 4DR1L 5IP9H 4IO9A 1VQAA 2PQAB 5LMNL 1N34L 4YWLA 3HOUH 1I6HH 2HHHQ 1NE3A 2WB1G 1JJ2A 3KYHC 3PSIA 2UUBL 3M85A 5C4XH 4L5RC 2Q2HA 2XTIA 1JT8A 3CCJA 1NY4A 3F2CA 2Y0SE 5IWAL 1W2BA 4IOCA 1XMQQ 4LF6Q 3H3VI 1TWCH 3EIVA 4AQYQ 1HZCA 5IP7G 2WP8J 1FGUA 1XPRA 4ALPA 1HNZQ 1KQSA 4L5SA 3J80i 3HOWH 1YEZA 1K73C 1Y14B 4IJHA 4JCVE 1PH2A 1PH4A 5IYDH 4IFDG 1SMXA 2JEBI 1XNRL 2E2HH 5IY0A 2PI2A 3F2DA 1VQ9A 4A3BG 1A0IA 2WFWA 5BR8Q 4A3JG 1J5EL 1JB7A 2MO0A 4X66L 3NEMA 5HGQA 4X62L 2ASBA 3HOXG 1LM0A 4A3MH 3UDXA 1YJWA 3OTOL 4LF4Q 5GAGC 4KI0A 4OO1G 1YIJA 1IYJB 1R9TH 3BU2A 4RG1A 1Q1EA 3PUWA 5HY6A 1N36L 1NMFA 4UPAA 4UY8C 3PO2G 4B3MQ 1IBMQ 2KCTA 4JI5Q 1VQCA 3E9HA 4JI2L 1KD1C 5GADC 3CAMA 1Q12A 1VQNA 1CUKA 2HIXA 1VS0A 2OQKA 1IBKQ 3M4PA 1Q8KA 4PZ8A 1EYGA 1VQ7A 2IX1A 2HHHL 1CSQA 1NTGA 1SLJA 2E2JH 5EAYA 4DV0Q 1IL2A 3I4MH 2R6GA 4LUZA 2JA9A 4DK6C 4IOAA 4A3DH 3CCEA 1SRUA 3S1NH 3U50C 4BBSH 1P16A 1VCIA 2N8NA 2WB1E 4JI3Q 3RZOH 4WJ4A 3GO5A 3RR5A 1FL0A 4PMWA 4DAMA 1E7ZA 4JI6Q 1XMQL 4LF6L 1C9OA 1SE8A 2RCNA 4AQYL 4R4CA 1HNZL 2JA8H 1VQDA 3I4OA 5M5XH 4JI0Q 2NVQH 2EQSA 4KLKA 3CD6A 3CCRA 3BJUA 2GVAA 1TWAH 4KHPQ 1V43A 5BR8L 1CKNA 3J81i 4JI1Q 4HJAA 4BY7G 2N49A 1HJPA 2WAQG 3AYHB 1G6PA 3HOUG 3T1YQ 3MXNB 3JAMc 1QUQB 2VQEQ 1WI5A 4LW1A 3GTGH 1YHQA 4LF4L 5ELNA 5JJIA 3CMEA 1Q82C 2KCMA 3A5UA 1EIYB 4HJ9A 3I56A 2OQ0A 4A3EH 1X6OA 3I7FA 5C4JH 1IBML 4B3ML 2OTJA 4IPHA 4JI5L 3OW2A 2YV5A 4GLVB 2PI2E 1OXUA 3EN2A 4BY1G 3RLOA 3AFPA 1IBKL 2B3GA 4IJLA 4R4OA 1OTCA 3HKSA 2I5HA 4DV0L 3GTJH 2Y0SG 3DM3A 1VQIA 1XNQQ 2N78A 1XJVA 2B63H 3RZDH 4JI3L 3W1GA 4B3SQ 4JI6L 5C0XI 1OXTA 2MQHA 3S14H 3FHWA 4HJ8A 3GDEA 4YY3Q 2V1CC 2R93H 2MO1A 4LFAQ 4LF9Q 1V9PA 3L0OA 4DAYB 1BBUA 2D0OA 4EX5A 1PH3A 3I4NH 4B3RQ 1KL9A 2ALYB 2K4KA 4NXMQ 1X3GA 1YI2A 1PH1A 4A4IA 2OWOA 3U58A 4JI0L 2F4VQ 4OX9Q 1AE2A 4JBJA 1TWFH 3J7A5 1LTLA 1I5FA 1A63A 4KHPL 2ZJQA 4A3GG 3K80C 4JI1L 1VQKA 1VQ5A 3GTMH 1Q46A 3T1YL 2VW9A 2K75A 3G4SA 2VQEL 4DUYQ 4LUVA 3ZJYC 3CPWA 3U4VA 3I4MG 3PO3G 2YYZA 2I5MX 3Q8DA 4R4TA 4DR4Q 1MJCA 1YBYA 3CW2C 5E7NA 4C3JH 1PYSB 4Y7NH 1PYBA 4X6AH 5IYBG 1TXYA 3IRBA 4JOIA 5M3MH 4DUZQ 2UXDQ 3D0FA 4A3FH 1K8GA 2VL6A 1D8LA 1GD7A 1TWHH 4A3LG 2R7FA 4DKAC 1FVIA 4PG3A 3TREA 2JA8G 1UE6A 2AKWB 2CWPA 4YCVA 1EQQA 4H02A 3H0GH 1EWIA 2NZOA 4TVAB 3ERSX 2LXJA 3PGZA 1XNQL 2XGTA 1VQHA 4B3SL 2BH2A 4A93H 1GO3E 2OCEA 5C3EH 1SROA 2VNUD 3CMAA 4YY3L 4LFAL 4LF9L 2JEAI 1EQRA 2YTVA 3HOYG 5C0XJ 4B3RL 2KHIA 1CSPA 4NXML 5JEAJ 3B6YA 1BKBA 5M3FH 2F4VL 3PIOA 2KENA 2IY5B 4OX9L 3J81c 3PUYA 2ZTDA 4GN3B 4A3EG 3U4ZA 3HKZG 2UXCQ 2DUDA 4OWWB 1YVCA 4PZ6A 3CC4A 3TEHB 3UDIA 1JMCA 1Z9FA 1IBLQ 4UP9A 1KC8C 3FP9A 5IE8A 3KFUA 4BBRG 1EUJA 2QEXA 4R4IA 4DR6Q 1TWGH 4C2MH 4DUYL 3RN2A 3GD7A 3M7NA 2UXBQ 4GNXA 4KHZA 4DPGA 1CKNB 2BH8A 3S1RH 4A3KG 1JE5A 2I5LX 1ASZA 2L15A 4C3IH 1Q81C 2E8GA 3S2DH 1WYDA 2YTXA 4QGUA 1HR0W 2B63G 4DR4L 2QGQA 3S1MH 1HH2P 5GAEC 4AIMA 1Y1VH 2YU9H 1RL2A 2R92H 4DR2Q 1M1KC 4NPSA 1KXLA 2UXDL 4DUZL 3TRZA 1VQBA 1OXSC 4A75A 4GOPB 1QVFA 1I50H 3KLWA 3CPFA 3L7ZC 4JBKA 2R7ZH 3ER0A 1E22A 3G48A 3CCQA 4DR5Q 1PFSA 1NJIC 3M3YH 1VQPA 2UUAQ 4LF7Q 1Q1BA 1K0RA 3DLLA 3STBC 2Q2TA 4DR3Q 4BXXG 3FKIH 2UU9Q 2E5LQ 4YCUA 4P71A 1SR3A 1B7YB 1U0LA 2GVBA 2K52A 3KDFA 5FJ8H 4GKKQ 1VQJA 4AYBE 3CCVA 4NXNQ 4YCWA 4YWKA 1VQEA 4A3IG 5IYCG 4JI8Q 3K81C 2K5VA 3AQQA 4XTCS 2H5XA 3HOVH 3GTOH 1YJNA 2UXCL 3J7ZC 5LMNW 3S2HH 3PF5A 1PVOA 5M3MG 2VQFQ 1IBLL 3LGJA 2NZHA 4A3FG 2JA7G 5IP9G 1WOCA 1UE5A 3HKZE 2JA5H 2FXQA 4O0AA 4DR6L 2PMZE 1A62A 3AFQA 3CCLA 1HNWQ 2UXBL 2RHSB 2ZTCA 5C4XG 3H0GG 4J15A 2UUCQ 1VQGA 5DLQE 2N3SA 1N8RC 5C3EG 1N33Q 5LMUQ 5FLXc 4DR2L 3UDGA 3GTKH 2BA0A 2CCZA 4P75A 1LUZA 4QIWE 3TS0A 2E2IH 1PA6A 4C3HH 4DV3Q 4DK3C 2D62A 3S16H 4DR5L 3HOWG 3W5OA 5IYDG 2NVTH 2UUAL 4LF7L 1WJJA 2EIFA 4APVA 4DR3L 3K0XA 1X56A 4HIMA 2UU9L 2E5LL 1YJ9A 5IP7H 1L1OA 4LF8Q 4K0KQ 1FJGQ 2RF4A 4GKKL 2GN5A 4NXNL 2Z0SA 2Z6KA 2HIVA 4A3MG 4JI8L 3PUZA 3PUVA 4MNOA 4WJ3M 4A3BH 3MEFA 4A3JH 1YNXA 1Y1VG 1W3SA 2CKZB 1QVCA 2AWOA 1M90C 1K9MC 2VQFL 3HOXH 3G6EA 4GOPC 1E1OA 2MFIA 5J3BA 3L2PA 4DV6Q 1HNWL 5JJKA 4DV7Q 4LFCQ 3CXCA 1D7QA 4JG2A 1CKOA 1NMGA 2K50A 1A8VA 3A0JA 4X64Q 3PO2H 1G291 1P8LA 4IPCA 4P74A 3RN5A 2UUCL 2HT1A 4BBSG 3BZCA 1XTDA 4A3DG 3ULPA 1N33L 5LMUL 2VUMH 3FKIG 1VQ8A 2D0PA 2JA6H 1JJGA 4POFA 3HFZB 5M5WH 1X55A 3I2ZA 3S17H 1PH5A 3K7UC 5C44H 1Q86C 1XPUA 3AEVA 4DV3L 2LSSA 3TQYA 1S40A 2EXDA 1QUQA 1OXXK 1YHBA 4DNIA 3M4OH 5K36G 4GN4B 4LF8L 1MIUA 4AYBG 1X3EA 4NB3A 1Q7YC 1FJGL 4GN5A 4K0KL 3H15A 3EBEA 3PIPA 2AMCB 1C0AA 4L5TA 3H3VH 1GVPA 4BA2I 3KOJA 1PHJA 4L5QA 3CCMA 4R1JA 5C0XG 3CF5A 3KDFB 1H95A 5JEAG 3A74A 1I94Q 3CP0A 4JI4Q 4BY7H 4PZ7A 2CWAA 3CQZH 1Y1WH 1X9NA 1WCMH 3PCOB 1BVSA 4DV6L 4JI7Q 2QA4A 1KHIA 3W1BA 1HZAA 1MKHA 4JOIC 3E9IA 4OWTB 2HQLA 4LFCL 4DV7L 4DV4Q 3KF8B 2KBNA 2A1AA 4X64L 2I0QA 1X65A 1E1TA 2IHEA 3PF4A 4A3CH 2LXKA 2VS1A 4DV2Q 4BY1H 4GKJQ 1EOVA 3T1HQ 2K5NA 2CFMA 3NELA 2ZJPA 4A76A 5M5YH 2R93G 1KAWA 3SGIA 3PV0A 1HZ9A 2B29A 4IFDJ 4Y52H 2JQOA 3I4NG 5GAHC 2JE6I 1UE1A 5IT9c 2ID0A 2A8VA 1L2FA 4LUOA 3GTQH 3KF6A 5AJ3Q 3HOZH 3KJOA 2F3IA 3UDFA 4QJFA 1YITA 1UE7A 1PH7A 4DV1Q 4X65Q 1IXRA 1N32Q 4P73A 1UEBA 2IX0A 3CCSA 3OYYA 2K5HA 1HZBA 3F1ZA 1XMOQ 3ICEA 1X3FA 1VQOA 2NVYH 4XIGS 1SFOH 1L1OB 1IZ6A 2PQAA 2Q2IA 5H1SE 4GNXC 1K8AC 2ZM6Q 4A3GH 2VUMG 3KJPA 1I94L 2JA6G 4JI4L 4GLXA 1YHAA 4LF5Q 4B3TQ 4DV5Q 3PO3H 5C44G 4HJ7A 4JI7L 2JK8A 4MZ9A 4DV4L 1PV4A 1MJEA 1N9WA 2MNAA 1VQLA 4DR7Q 3GTLH 1PH6A 4HIDA 1PH9A 3RLNA 1EIFA 1VQ4A 2NN6I 1E24A 3F8TA 1VQ6A 4HIOA 2PNHA 4DV2L 5IYBH 5FLMH 1XPOA 3T1HL 1HR0Q 4JBMA 4JYAQ 4GKJL 4A93G 4FDBA 1DGSA 4A3LH 1NBWA 4ME3A 3E0EA 2K14A 4QL5A 4LFBQ 1U5KA 4IPGA 4P72A 2BA1A 1PH8A 4LNQA 3CCUA 2CQOA 1GKHA 5M3FG 2R7DA 5AJ3L 1AE3A 1K83H 5ELOA 2OTLA 2C35B 3NENA 4GS3A 4DV1L 3NBHB 4JV5Q 1X54A 1N36Q 4OONA 4X65L 1Y1WG 3HOYH 1L0WA 1N32L 1WCMG 4YHHQ 4BA1I 1Z47A 4LWCA 1HNXQ 1T9HA 1KRTA 1XMOL 2AHOB 2ES2A 1S3OA 1YZ6A 3GTPH 3S15H 1S72A 3S24A 2JJQA 3BZKA 4GOPA 3M9BA 1QVGA 3JC66 4A3CG 2ZM6L 2NVXH 4DR1Q 1SN8A 1GM5A 1OXVA 3I55A 1CKMA 4BBRH 1VQFA 4LF5L 4B3TL 5LMNQ 1N34Q 2R92G 2IHFA 2RHQB 3RLFA 4DV5L 1EFWA 4MTNA 1VQMA 3M4QA 3VDYA 1K3RA 4JBWA 4A3KH 1C7YA 2IT1A 2UUBQ 4POGA 3K7AH 1B70B 5GQOA 1JJCB 2KHJA 1BBWA 2R7ZG 4QY7A 4DR7L 2VY3A 3HOZG 3STBD 4O2DA 4HJ5A 4TQUS 1LYLA 5IWAQ 3J80c 1HR0L 1ASYA 4JYAL 4GNXB 4IFDI 3A5ZB 3F2BA 1B8AA 1E3PA 4EQ5A 2ZTEA 4AH6A 3CC2A 2NN6G 4OXPA 5JJLA 2ZJRA 2F52A 5GROA 5FJ8G 2Q2UA 1AH9A 4LFBL 1G51A 4QQBX 1L1OC 3RNUA 4RMFA 1QZGA 3J81j 3G71A 1KRSA 4R4QA 3WWVA 3HOVG 2AWNA 1XNRQ 3S1QH 4YWMA 1V1QA 3ULLA 4OWXB 4BXXH 2Z6KC 4UP8A 3CC7A 4HIKA 1J5EQ 4OO1I 2ATWA 4JV5L 4X66Q 3KF6B 1QZHA 4X62Q 1RIPA 3PUXA 3ULJA 3UE0A 4YHHL 4A3IH 1O7IA 3D31A 1HNXL 2JA5G 2WAQE 5IYCH 4UP7A 3OTOQ 1I3QH 2YTYA 2A19A 3K8AA 3JAMi 4GLAC 1WFQA 3TS2A 1KIXA 2VZAA 3UE1A
chains in the Genus database with same CATH superfamily
2VUMB 2XRQD 1UWVA 4IPDA 5FLMG 4H44C 4F8MA 5FO9B 4DR1L 3S17B 4IO9A 2RSNA 5LMNL 4YWLA 1G8ZD 2XRSD 3SVMA 1JT8A 3CCJA 1NY4A 2CQAA 2Y0SE 3CHBD 1W2BA 1XMQQ 4LF6Q 3GV3A 2BDNA 4AQYQ 2K33A 3U9SA 2PW5A 4G7HC 1YEZA 1PH4A 2JEBI 2A6EC 1VQ9A 4A3JG 2BCOA 3I70A 1MSGA 2B2VA 1YJWA 5GAGC 1R9TH 1IYJB 5BN3A 1Q1EA 3BVZA 5HY6A 1NMFA 2H1EA 1E2ZA 5IGBA 2F0UA 1Y8PB 4DN4M 1VS0A 4DK0A 1SMYC 1QNUA 2EYMA 1SLJA 4DV0Q 4K2KA 1FNVA 1LTGD 4ABNA 3U50C 1P16A 1VCIA 2N8NA 2WB1E 4P2CB 3RR5A 4JI6Q 1E7ZA 5EJWA 5M9OA 3WOFA 5M5XH 1TY2A 4JI0Q 5FK9C 3ITPA 3CCRA 3BJUA 2GVAA 4KHPQ 5BR8L 1CKNA 3J81i 4HJAA 2N49A 2K1BA 5CV8A 2I07B 2XN9C 5C0XH 3GP7A 2WIIB 3A5UA 1EIYB 3I56A 4O42A 3I7FA 4JI5L 1SYFA 2PI2E 3P7JA 3EN2A 3VYUA 3T53B 1B2TA 1IBKL 1LTRD 4OELB 4CKBA 3I8ZA 2Y0SG 3DM3A 3RZDH 1EFID 4JI3L 3D4RA 5C0XI 4HJ8A 2V1CC 2MO1A 4LFAQ 3L0OA 3I4NH 3S15B 1IKMA 2F0EA 2KVMA 2K4KA 3K5MA 1B9NA 1PH1A 2F4VQ 3U58A 4JW0A 2NVXB 1AE2A 5DEHA 1LTLA 2ZJQA 5E3FA 1GXDC 1B1ZA 1Q46A 2VW9A 1LT5D 4DUYQ 3ZJYC 4IURA 1CZWA 2QF7A 3R93A 2B2TC 4X6AH 1ILQA 5IYBG 4A3FH 1K8GA 2OXPA 2FMCA 5CORA 1TWHH 4DKAC 4PG3A 4JPBW 1UE6A 4YCVA 4B9XA 1XNQL 2NZOA 2K04A 5CV7A 2F0TA 4A93H 4KKSA 4CJ1B 5CV5A 4C1NK 5C0XJ 1LTAD 2KHIA 5M3FH 3LNNA 4K5VA 4OX9L 2JN4A 1V1PB 1AP0A 3H91A 4HTHA 2DUDA 4WORA 3CQZB 1Z9FA 1NSNS 3HP3A 5IE8A 4R4IA 4DR6Q 5KNCA 4GNXA 4KHZA 3IFDA 4A3KG 1JE5A 2E8GA 1VF7A 3D8GA 2YTXA 2Z9HA 1TWCB 2B2UA 2YU9H 5EKIA 1Y1VH 4DR2Q 4NPSA 2UXDL 4ZLTF 3TRZA 3HOWB 1VQBA 1OXSC 4A75A 4HCSA 5KYLA 3CPFA 3L7ZC 2K5QA 4DR5Q 2E2HB 1HHVA 1VQPA 4LF7Q 2A69C 5I2XA 1VF5C 4DR3Q 2Q2TA 4YCUA 2GVBA 3IAYA 4GKKQ 1RKNA 1VQJA 2NVYB 3CCVA 4YWKA 5IYCG 1J9OA 2H5XA 1G6ZA 1YJNA 4A3GB 3J7ZC 5LMNW 4DNTB 1PDQA 1DJRD 2I46A 3KF8A 3LGJA 1F2ZA 3ND9A 2Q8IB 4A3FG 5IP9G 1UE5A 3HKZE 5I4DA 1HNWQ 2UXBL 1Q90A 5D14A 1SSOA 3NE5B 2K5WA 5C4XG 4G4KA 5DLQE 1A2TA 2N3SA 4S3SA 5FLXc 2E76C 2PZTA 3GTKH 2JA8B 2BA0A 2JXMB 3H3VC 4P75A 4QIWE 1LT3D 5KGUA 3TZDA 5CGKA 2A6ED 3RMHA 2Z6BA 1JE4A 4OHJA 1EU3A 4CDDC 1BOSA 1GUOA 4APVA 2HDLA 1F77A 1X56A 2D9UA 1YJ9A 1L1OA 3GTGB 2RF4A 2Z8LA 1JC7A 4YIJA 4A3EB 4JI8L 3PUVA 3BVGA 4UHVA 4A3BH 1ET9A 1Y1VG 2CKZB 1SMYD 3G6EA 3L2PA 3O13A 4Z9CB 3J80L 2B63B 3PO2H 4FF3A 3SK4A 3S14B 1XTDA 1B3AA 2N55A 2VUMH 5EQ0A 1X55A 3S17H 1XPUA 2LSSA 3NBHA 1STYA 2EXDA 1GUTA 1H9MA 1YHBA 2FFKB 2EVBA 3C3LA 4LF8L 4X3SA 1FJGL 4GN5A 2EDGA 3H15A 1EY8A 2AMCB 3URYA 1TIID 3KOJA 3CCMA 5COYA 3I72A 5JOBA 2IWHA 3CP0A 4BY7H 3J7AF 4ZYSA 4KMUC 4JI7Q 1KDAA 2QA4A 1KHIA 3NUCA 3QO2A 2A74C 3W1BA 1HZAA 1MKHA 3H0GB 4OWTB 4LFCL 1SYCA 2KBNA 4X64L 1IL8A 2F0LA 1X65A 3KBXA 3MZ5A 3VR4A 2IHEA 5C3EB 3VA5A 1FR3A 3FVQA 2K5NA 5KRUA 1KABA 3NTKA 1S5DD 2B29A 1TT2A 2JQOA 5NUCA 3NHHA 1UE1A 3LWUA 1KLGD 2A8VA 2F0SA 3GTQH 2DNEA 3KF6A 1WTOA 5AJ3Q 4RAUC 1EL0A 5T1IA 3J81E 4QJFA 4DV1Q 4X65Q 1F2MA 1H9JA 4P73A 1Z7TA 1UEBA 2LY7A 3S1RB 2K5HA 3F1ZA 4CHTB 1PZID 1X3FA 1R9TB 4XIGS 1TY0A 3I91A 2NTTA 1EIHA 3K5OA 2VUMG 1YHAA 4I7AA 4HJ7A 1J8IA 2RVLA 2EPBA 1PV4A 4DV4L 1MJEA 3HGBA 3VR6A 1PH6A 4HIDA 1BNZA 3GTLH 2AUKA 1EIFA 1E24A 3F8TA 1RD9D 4GKJL 3MAQA 3T1HL 1HR0Q 4OGQC 2MGSA 2E74C 4XT3B 4A3LH 3TDQA 1G2SA 2K14A 4B9WA 2CQOA 2MPMA 1JWMD 3JAML 4WRDA 1EZ8A 2JA5B 4JV5Q 1X54A 5A35A 1JWUD 1N32L 4KY7A 1HNXQ 1KRTA 4J6HA 4HN7A 3L3OC 5HURA 5A2QL 3S15H 3K58A 3S24A 4N8FA 4GOPA 1SNPA 3JC66 4KK7A 2ZM6L 2NVXH 3NBIA 3R2IA 4ILWA 2P5ZX 4DAPA 4C3HB 1Y69U 4DV5L 3ERQA 1C7YA 2EJGC 2IT1A 2UUBQ 3K7AH 2B2TA 2A69D 4KJOA 3RZDB 3OPOA 3MEHA 4JYAL 1SNOA 2O2LD 4GNXB 2F4IA 1L0XB 4IFDI 3I4NB 1GUWA 3F2BA 1B8AA 2FMMA 4AH6A 4OXPA 5JJLA 5GROA 3Q24A 1QZGA 4C56C 3J81j 2AWNA 3S1QH 4YWMA 2VB3X 2G5DA 5ELDA 4O1NA 3UI2A 1IYUA 4OO1I 4X66Q 1LTID 3TSSA 3FRPB 1KAAA 2K32A 4YHHL 5EKKA 4A3IH 2F0QA 3OTOQ 4UP7A 3MWYW 4PV1C 4FF1A 2A19A 3K8AA 3FP9A 1HTLD 1KIXA 3UE1A 1J6QA 2B8FA 2EYLA 5AFWA 4JC0A 2PZUA 2JA7H 2DY8A 2F0GA 1VDZA 1VQAA 1N34L 3D4DA 5BN4A 3NSWA 4LAAA 1RCVD 2HHHQ 3KYHC 3PSIA 1CTMA 2XTIA 4A93B 1QE6A 1F9SA 4QUCA 4QUFA 4B08A 3H3VI 1UNSA 3SK6A 4IOCA 1TWCH 3KUPA 1S4ZA 3C2PA 3NK9A 1FGUA 5D65A 1HNZQ 1LTTD 1KQSA 5M3FB 4L5SA 3HOWH 5IYDH 1K73C 4IJHA 4JCVE 4IFDG 4LMQD 1QCBD 2MP1A 3R8BA 2E2HH 1H9SB 2AUJD 1A0IA 2WFWA 2MO0A 4X62L 1VMCA 3HOXG 1HCZA 3T4AC 2PNRC 4JVZA 1O78A 2EE1A 3UDXA 4LF4Q 4ZRZA 4KI0A 4OO1G 3NP8A 3DMUA 2HQEA 4UPAA 2YU9B 1AEXA 1IBMQ 1U4LA 4JI2L 1KD1C 5GADC 5IODA 1VQNA 3C46A 5DM73 3M4PA 1Q8KA 1VQ7A 1Q3LA 5EAYA 1LLRD 1RDPD 2R6GA 1WTPA 4IOAA 4A3DH 3E3XA 5C3WA 1E0BA 1EIGA 3GO5A 4DAMA 1FL0A 1C48A 1HA5A 3BG3A 1V1PA 2ZXOA 1SYBA 1ESFA 4R4CA 2JA8H 4L6TB 2ICIA 2K6AA 3LX0A 3OHXC 4DK1A 1STAA 3QR8A 5K36H 2CW0C 2EYPA 3DXJC 3SR1A 3MXGA 1G6PA 4FXKC 4I7ZC 3T1YQ 4K5XA 2VQEQ 1WI5A 2FHTA 4CKEA 3GTGH 5EPKA 4F87A 5ELNA 5JJIA 3CMEA 2F0JA 5JEAH 4HJ9A 3G7LA 4A3EH 4B3ML 4IPHA 2RDGA 3D6WA 4GLVB 1EYDA 3AFPA 3OMGA 2MUYA 1G2TA 2B3GA 4R4OA 3CRLC 4N8X1 3A54A 2N78A 1XJVA 2B63H 3W1GA 1EQTA 2R93H 2ICEC 3S14H 4X3KA 3GDEA 4YY3Q 5CR3A 1BBUA 1SE2A 4EX5A 3JAME 1PH3A 4B3RQ 1KL9A 1X3GA 4FF2A 3MXPA 4A4IA 2F1MA 4A3BB 4JBJA 2WINB 1A63A 4ZKBB 1EY6A 4A3GG 1QNKA 3K80C 4JI1L 3GTMH 2SDFA 2K75A 4LUVA 3PO2B 3Q8DA 4R4TA 2QCPX 1NUCA 4DR4Q 5E7NA 4Y7NH 1GOZA 1PYBA 2F0NA 4DFAA 4IALA 5C3XA 4DUZQ 3D0FA 2M00A 2JA8G 1FVIA 1BF4A 5T1GA 1K28A 3H0GH 1EWIA 4EQPA 1ILPA 3PGZA 2K01A 2XGTA 4B3SL 5C3EH 1SROA 1CT1D 2VNUD 4CDEC 4LF9L 2JEAI 1EQRA 4NXML 5JEAJ 3B6YA 1ENAA 3PIOA 2KENA 4ZQ3A 3J81c 4A3EG 2ZTDA 3U4ZA 4BY7B 1GHJA 4EQNA 3UDIA 3HOUB 3BZDB 2LMCB 1KC8C 1EUJA 3F2UA 4DPGA 1PZKD 3S1RH 2I5LX 1O7YA 2L15A 1M4VA 1Q81C 1E2WA 2B63G 4XQNA 2QGQA 1PLFA 2B8GA 3AB9A 4IUTA 1I4XA 3GQBA 3OWFA 1CZGA 4GOPB 1D1KA 3KLWA 2XNAC 2R7ZH 1SYGA 3GTQB 1E22A 4XQJA 3M3YH 4HR7B 5JVG3 1K0RA 4IUVA 1WTWA 1XTCD 2UU9Q 4P71A 2G9HD 1SJHD 3IKJA 2K52A 2DN8A 5FJ8H 4NXNQ 3KK7A 3HOVH 4XTCS 2KECA 2J4XA 2A68C 2UXCL 3S2HH 4ID6A 1PVOA 1TS3A 2VQFQ 1IBLL 1JICA 1JCKB 1WOCA 5D3DA 2JA5H 3I4MB 2FXQA 4O0AA 2E2JB 2EYHA 1JOKA 3AFQA 2RHSB 1II3A 3GTLB 5FO8B 3H0GG 4J15A 2UUCQ 2PPBC 3I90A 1HTPA 2K28A 1WTRA 5C3EG 1RTOA 5LMUQ 2EYOA 2E2IH 1LUZA 2F0KA 1NCVA 5EGTA 2NVQB 4C3HH 1FYCA 4DK3C 3S16H 1DM0B 1QG7A 2UUAL 3VYTA 4RKBA 2EYJA 1STBA 3K0XA 5IGEA 2E5LL 5IP7H 4K0KQ 2BOSA 1S5FD 3OIPA 3W3AA 1EY7A 5ISRA 2Z0SA 1LTSD 3PUZA 3H09A 1BXTA 1S5BD 2KQ3A 4MNOA 4MN3A 2N88A 4WJ3M 5JAVA 2QW7A 1M90C 1STHA 2BE5C 1I6VC 4GOPC 1E1OA 4DV6Q 1X3QA 5JJKA 3V05A 4KKTA 4DV7Q 3K7AB 1CKOA 2K5DA 3RN5A 1P8LA 2HT1A 1HQRD 2L55A 1N33L 1VQ8A 4HAEA 1IKLA 1Q86C 3AEVA 4DV3L 3TQYA 1UUPA 1TWFB 2PCFB 1V1OA 2CW0D 3S1QB 1XX8A 1LABA 1TS5A 1DOMA 4ME5A 4M1UB 3M4OH 4GN4B 1MGSA 5KYIA 1O7ZA 2VXWA 3PIP3 4A3IB 3EBEA 3PIPA 4LJZC 1LT4D 5C0XG 3KDFB 1DONA 3M4YA 3A74A 2JA7B 3IL8A 4PZ7A 5CYUA 2CWAA 1CM9A 2KUMA 4C3HG 2WKCA 5J1ZA 3DUZA 2HQLA 1K0SA 3IFTA 1TS4A 2E75C 5CV6A 2Z4HA 3PF4A 3SXHA 4DV2Q 4BY1H 1EOVA 2QDBA 3NELA 3SK5A 3PV0A 2OF1A 1HZ9A 4Y52H 3I4NG 2MJ8A 5GAHC 2JE6I 2FJ2A 3MVVA 1O7LA 5IT9c 2JSOA 4LUOA 3QIAA 1JQYD 4RGTA 1DOKA 5IGDA 3KJOA 4QCLA 2F3IA 1YITA 4UDUC 5LHY1 2RDFA 1TWGB 5IGGA 3V2TA 4G57A 2IX0A 1EU4A 3OYYA 4C3IB 1XMOQ 3ICEA 4KN4C 2NYZD 2V4DA 3QOJA 3K59A 1IZ6A 4N9PA 5BN5A 1WTVA 2F0PA 1A3TA 1I94L 4JI4L 2KA7A 2F0MA 1I50B 4LF5Q 4B3TQ 1PMRA 3PO3H 1A6XA 4ZUJA 2MHVA 4PMCA 2EY5A 2JK8A 4A3DB 1N9WA 2MNAA 4DR7Q 1EWCA 1CA6A 3FKIB 1JOOA 2XWJB 4HIOA 1WVLA 1XPOA 4A93G 1TKWB 2O5IC 1JWSD 4KY5A 4RH6A 3E0EA 4QL5A 1H9SA 1U4MA 1U5KA 1D1IA 4LNQA 5M3FG 4K5WA 5ELOA 1EY0A 3ZYYX 4AYBB 4OONA 3HOYH 1K3BC 1L0WA 4BA1I 1Z47A 4LWCA 4RKLA 4FF4A 3E5SA 1JB3A 1KDCA 2M9VA 1D2BA 3BZKA 3M9BA 1HRJA 2PMZB 3RUZA 3A8IE 4DR1Q 1OXVA 3I55A 1CKMA 4BBRH 5LMNQ 1AZQA 1M8AA 2RHQB 3SDZA 3AU7A 3EFXD 4MTNA 3M4QA 3T16A 5GQOA 1B70B 1K8OA 4QY7A 2VY3A 5CV9A 3HEJA 3DEPA 4HJ5A 4TQUS 2R93B 1ASYA 3OSOA 3A5ZB 3RD4A 2ZTEA 3KLSX 2ZJRA 4LFBL 4QQBX 2A68D 5K5PA 5I2YA 1KRSA 4R4QA 4OWXB 4BXXH 2Z1CA 3CC7A 2R61A 2ATWA 3A55A 1RIPA 3GTMB 3D4WA 5L37A 2IX3A 5HGTA 3JAMi 4GLAC 4Y7NB 3TS2A 1CHPD 2JA6B 3EVQA 2NZ1D 1ZKOA 2DGYA 3P75A 2PQAB 3HOUH 1A15A 1BDOA 3FMCA 3VR5A 2WV6D 1TS2A 1CK1A 3HRZC 5IWAL 1HUMA 3EIVA 1KNAA 1V8QA 1HZCA 2WP8J 2OEOA 2DJGC 4QB4A 2NBFA 4L63B 3DWQA 4HEDA 2Q8TA 1PH2A 1Y8NB 1SMXA 3CRKC 1XNRL 1RJTA 5IY0A 3F2DA 2BE5D 4A3BG 5BR8Q 1J5EL 1LT6D 1GUSA 1H9RA 3I3CA 4A3MH 5G3LF 3TP5A 4C1NI 3BU2A 1EEID 1N36L 4UY8C 1D5XC 1CA5A 3PO2G 4CBVA 2KCTA 4LK1C 4JI5Q 1VQCA 3E9HA 2IL8A 3MC0B 2OQKA 3HZXA 1IBKQ 5FKAC 2R7ZB 4KV6A 1CSQA 1NTGA 1F9RA 1EQVA 4CKCA 2E2JH 1IL2A 3I4MH 3M3YB 3A56A 1DXMA 4DK6C 1F2LA 4BBSH 4H0LC 2ZT9C 4JI3Q 4IUUA 4PMWA 1XYIA 1XMQL 4LF6L 4OL7A 1C9OA 2RCNA 4AQYL 1STNA 3HOVB 3I4OA 4HSVA 2HCCA 2NVQH 2EQSA 4KLKA 3CD6A 3S2HB 1TWAH 4U673 1V43A 1A2UA 4BY7G 3AYHB 3HOUG 3MXNB 1QILA 1QOHA 3A8KE 5F2DA 5FLXL 2KCMA 4PNYA 2XSCA 3MXUA 1X6OA 3R3OA 5C4JH 3OW2A 1MI2A 2YV5A 1OXUA 3RLOA 1BO0A 4RHSA 3BS1A 2WB1B 2E2IB 3HKSA 3S16B 2I5HA 4DV0L 1XNQQ 1VQIA 4X3TA 3AMUA 1IW7D 4JI6L 3J7YW 1V9PA 4DAYB 2D0OA 2ALYB 4JI0L 4EGVA 4OX9Q 1HQMC 1TWFH 1STEA 3J7A5 1Y8OB 4KHPL 1PRTB 4V190 5ELCA 5FOBB 1VQ5A 2B2YC 1UEAB 2X6GA 3I4MG 1PFBA 2YYZA 2NB0A 1ML0D 5IIFA 1MJCA 1YBYA 3CW2C 1PYSB 3FDTA 1TXYA 3IRBA 2UXDQ 3J80E 1GD7A 4A3LG 2R7FA 4ZKCB 3TREA 2AKWB 1T5XD 4KD4A 3OW7A 4H02A 2TSSA 3ERSX 1PRTF 3M4OB 1Q8IA 2J0TD 3HS0C 1RF2D 1B44D 3PQIA 3CMAA 1IHZA 4LFAL 2YTVA 1I3QB 1CSPA 1BKBA 2K03A 2F4VL 2IY5B 4GN3B 3N52A 1I4GA 4OWWB 1YVCA 2WAQB 3TEHB 1JMCA 1XXGA 4WFN3 3KFUA 2QEXA 2UXBQ 1TWGH 4DUYL 3RN2A 2BH8A 1CI3M 4C3IH 2D5DA 1WYDA 4QGUA 2X6LA 4BY1B 2SNSA 1HH2P 5GAEC 4AIMA 2R92H 3D6CA 4GZYC 1KXLA 5IGCA 2B2WC 1ONLA 1I50H 2HD3A 4JBKA 3ER0A 3CU7A 2F0FA 1NJIC 1JR0D 5I9OA 1SNDA 4EQOA 1PRTC 5DM63 3STBC 5CBAE 3FKIH 4CJ2C 1VMPA 4FVMA 2NN6H 1ICWA 1U0LA 3KDFA 1C8CA 2HCIA 4AYBE 4A3IG 1WTQA 4CDFC 4JI8Q 2K5VA 3AQQA 5CMDA 3OOCA 5JVH3 3PF5A 2JA7G 3PO3B 3U9OA 4RCOA 1D5MC 4DR6L 2PMZE 1A62A 1HA6A 4J8QA 4IQZA 2ZTCA 3RZOB 2BDOA 1Z6HA 1VQGA 1ENCA 4H7BA 1N8RC 4J1MA 4DR2L 1U9RA 3UDGA 3TZUA 1ZYRD 3TS0A 4DR5L 3HOWG 3A7AB 5IYDG 2NVTH 4LF7L 4DXGA 2EIFA 4DR3L 4HIMA 4LF8Q 3HOYB 1FJGQ 1BQQT 4GKKL 2GN5A 4JK1C 4C3IG 3HKZB 1SYEA 1SNMA 4ZCKA 1PYWD 1F2YA 2AQ3B 4A3JH 1W3SA 1STGA 1QVCA 2AWOA 4BBRB 5A2QE 2RA4A 5DNFA 1HNWL 5LL6X 4LFCQ 3CXCA 4NMZA 1D7QA 3KLRA 1NMGA 4KKUA 1DOLA 1A8VA 3VYSA 4X64Q 4QIWB 4P74A 4A3DG 3TP7A 2Z4IA 3BZCA 3ULPA 1SNQA 3FKIG 2JA6H 4NKLA 4MHEA 4OIJA 3HFZB 1E2VA 1PH5A 3K7UC 5CC4A 2XWBB 4QF4A 1QUQA 2SEBD 4FYDA 4ZAIA 5K36G 3DWPA 2ENBA 3VR3A 4CDCC 1MIUA 3I4LA 4AYBG 4NB3A 5G3LD 3PMFA 4FXDA 5IGFA 1C0AA 1GVPA 4C3JB 1EYCA 1PHJA 3PIO3 4R1JA 2R3ZA 1H95A 5JEAG 5M3MB 3OMCA 2EZVA 2C5CA 2F0IA 1X9NA 3PCOB 4RA8A 2X69A 4TKOB 4TSSA 3P1HA 2PYKA 2C9OA 3E9IA 4JOIC 4DV4Q 1LO5D 2A1AA 2I0QA 5C6AA 4XQQA 2VS1A 2LFNA 4GKJQ 3T1HQ 2CFMA 4K8JA 2ZJPA 4A76A 5M5YH 2R93G 3SGIA 2CH4A 2NTSA 2LKVA 1U4PA 1B3QA 2ID0A 2K05A 3J7AV 4BWGB 3TP6A 5I6YA 1MHWC 1SE3A 3UDFA 1UE7A 1PH7A 3Q22A 4C2MB 2VB2X 1N32Q 1FNUA 3CCSA 3ONAB 2O4XA 4A3MB 3S2DB 1EY9A 2RDHA 4IUPA 1I4RA 3S1MB 1SFOH 2KOLA 2PQAA 2Q2IA 2RBMA 3BYYB 2ZM6Q 4V0BA 3KJPA 2JA6G 3I73A 4GLXA 2PQEA 4NP5A 4G7ZC 2D2CC 4DV5Q 4JI7L 3M7GA 1ZEQX 5IOCA 4BBSB 1SAPA 3Q6SA 4MIUA 4RGOS 3RLNA 1BCPB 1VQ6A 2PNHA 5IYBH 4FO2A 1EY5A 4JBMA 1SEBD 1YNJC 4JYAQ 4FDBA 3X3MA 3DWAA 3HG9A 2EOTA 1AZPA 5EPJA 3GTOB 5KNBA 2BA1A 3K5LA 1O80A 2KCCA 1F9QA 4FXGC 5AJ3L 1K83H 1TWAB 2OTLA 2C35B 4DV1L 1N36Q 4X65L 2QKIC 2PO4A 4YHHQ 5E4XA 1T9HA 3Q23A 2AHOB 1YZ6A 1LACA 1S72A 1BCPF 1CQVA 1GJXA 2F0DA 5C4JB 2L5TA 2B2YA 1DCZA 4EVOA 1SN8A 2M2LA 2F0HA 1VQFA 1N34Q 3E6ZX 1R4QB 4DXFA 3RLFA 1EFWA 4A3KH 1K3RA 4JBWA 3QWNA 2R7ZG 1JJCB 1BBWA 1PRTD 3OIQA 4IUQA 3STBD 4DU9A 2NUCA 1LYLA 3J80c 3NWSA 1HR0L 4TRDA 1GUNA 1WTHA 2XIWA 4FNFA 4RGMA 2Q2UA 5FJ8G 1AH9A 1G51A 4RMFA 1CHQD 3G71A 3WWVA 3HOVG 1RODA 3MXNA 3HOXB 3QOLA 2Z6KC 4HIKA 1EWHA 4JV5L 1QZHA 4X62Q 1HFGA 3ULJA 3UE0A 2KJXA 1O7IA 4BS9A 2ZXRA 1HNXL 2WAQE 5IYCH 2JA5G 1I3QH 2YTYA 1NR4A 3NEMA 1WFQA 4K2LA 2VZAA 1BCPC 4UAIA 4DF7A 5I6WA 5M5WB 4JI2Q 4WJWA 1F9PA 1SJED 5IP9H 5C44B 1EEFD 3SK8A 1A3VA 1I6HH 1NE3A 2WB1G 1JJ2A 2UUBL 3M85A 5C4XH 4L5RC 2Q2HA 4NW2A 4DAYA 3F2CA 1ESRA 2B2WA 5C4HA 3OWEB 3WDNA 3J81L 5IP7G 1XPRA 4ALPA 3J80i 1A3UA 4G7OC 5J39A 1Y14B 3K57A 5D3IB 1Y1WB 2PI2A 3L9AX 3BDOA 1JB7A 1WCMB 4PMBA 4X66L 5HGQA 3NQIA 2PW7A 4NDXA 2ASBA 1LM0A 2KCNA 4ZK9B 1IW7C 3T56B 2PZWA 3OTOL 5EKLA 1YIJA 3Q0AA 4RG1A 2A5HA 3K6OA 3PUWA 4XYOA 4B3MQ 1PTOH 2R92B 1S5ED 3CAMA 1Q12A 1BUVT 1CUKA 2HIXA 4PZ8A 1EYGA 2IX1A 1ET6A 1PTOD 2HHHL 3HOZB 4LUZA 2JA9A 3CCEA 1SRUA 3S1NH 1I4PA 2LS01 4XYQA 3RZOH 3NTIA 4WJ4A 1WTXA 5JPMC 2K7VA 1SE8A 1SYDA 3BVMA 4IN3A 2RKSA 4RFBA 1HNZL 1VQDA 3P20A 3N6RA 3NTHA 4N9TA 1PFNA 1B4OA 1SDFA 3QG1A 4JI1Q 1HJPA 2WAQG 4M8AA 1EY4A 3JAMc 1QUQB 4LW1A 1YHQA 3EJIA 4LF4L 1Q82C 3KLSA 1TQOA 2OQ0A 1QB5D 3TMEA 2OTJA 1IBML 1HXYD 2L12A 4BY1G 5ELEA 4IJLA 5I9PA 1OTCA 4HMIA 4KJNA 2L9HA 3GTJH 2NVTB 1DZ1A 1HFNA 4B3SQ 5C4ZA 1OXTA 2MQHA 3TN2A 3FHWA 2SOBA 3SE0A 3GTPB 4LF9Q 1CFMA 3QJYA 5ELFA 4NXMQ 1YI2A 2OWOA 3H6MA 4I65A 1FD7D 1EOTA 3E0JA 4A3JB 1I5FA 2EY6A 3TP8A 2F3WA 1ICFB 1VQKA 3T1YL 3G4SA 2VQEL 3PO3G 3CPWA 4E6IA 3T51B 3U4VA 3H94A 1U4RA 2I5MX 2JP1A 4C3JH 1YNJD 3MA2B 4KN7C 3BDCA 4OIKA 2GA4B 2H4OA 4JOIA 5M3MH 1NNXA 2VL6A 1D8LA 2ZXPA 2AQ1B 1YNNC 4CGYB 2HDMA 2CWPA 3BDLA 1EQQA 3NQTA 4TVAB 2KEDA 2BH2A 2LXJA 1R4PB 1VQHA 1GO3E 2OCEA 3DEOA 2A6HC 1EZ6A 4YY3L 5J22A 3HOYG 3VYRA 4B3RL 2QDLA 4KTAA 1X3PA 1HPCA 1ZYRC 5EBCA 3PUYA 1CQFA 2F3VA 3HKZG 2UXCQ 4PZ6A 2OT2A 2Q8RE 2F0OA 3CC4A 1IBLQ 4UP9A 1QJOA 3ND8A 4BBRG 4XXEA 1TU2B 4C2MH 3GD7A 3M7NA 2AQ2B 3EROA 1CKNB 3S2DH 1ASZA 1D5ZC 4DR4L 1HR0W 5EPLA 2EY1A 3S1MH 2RCFA 5EBDA 4R8IA 5C5LA 1RL2A 5IT9L 5M5YB 1M1KC 4DUZL 3K0YA 2F03A 2A73B 1SE4A 1QVFA 2Y0SB 4K6LA 3G48A 3CCQA 1PFSA 1W6JA 2UUAQ 1Q1BA 5TSSA 3DLLA 2QEJC 4BXXG 2E5LQ 1SR3A 1B7YB 1MSHA 1PFMA 1S5CD 2IJ0A 1GUGA 4YCWA 1BCPD 1VQEA 3S9WA 1SFOB 3K81C 3GTOH 4PQXA 1C4QA 4C3JG 4DGZA 2B2VC 2KEEA 4F7XA 4MTKA 4IZ8A 1L0YB 5M3MG 2NZHA 3DHQA 4XDXA 4RWSC 3CCLA 1IYVA 4RHRA 1BBXC 1WD0A 1BR9A 1N33Q 3FEWX 1LV9A 2L11A 5M5XB 2CCZA 4L8JA 1PA6A 4DV3Q 2D62A 1NR2A 3QB3A 3W5OA 1K83B 3D3RA 1WJJA 1ZXTA 2DJFC 4QMGA 2UU9L 1JOQA 2QILA 1SXTA 1W6KA 2RQXA 1WD1A 3G6JB 4IUNA 3GV6A 4NXNL 1G91A 2F0WA 5FO7B 2HIVA 2Z6KA 4A3MG 4IFDH 2L1BA 1FNWA 1MD2D 3MEFA 1YNXA 2L0CA 5JJZA 1K9MC 1QWYA 3HOXH 3EQLC 2VQFL 2MFIA 5J3BA 4A3KB 1B9MA 4OO1H 5LL6S 4JG2A 2K50A 4U68A 1HUNA 3A0JA 1KNEA 1G291 4H13C 4IPCA 2UUCL 4BBSG 4XT1B 3SHLA 5LMUL 2D0PA 1JJGA 4DA2A 3R2TA 4POFA 5M5WH 1RTNA 3I2ZA 5C44H 4OEMB 1S40A 2KHSA 3V96A 3X3NA 1OXXK 4HMJA 4DNIA 4Q5VA 1H9KA 1ENFA 1PZJD 3A8JE 1X3EA 3T13A 3W2DA 1Q7YC 4K0KL 4R8NA 4ZUIA 4Q0FA 4L5TA 3H3VH 5C5MA 4BA2I 4DNRB 4L5QA 2SNMA 1DD2A 3CF5A 4A3FB 1I94Q 4JI4Q 1TWHB 3CQZH 1Y1WH 5CBEE 1SBBB 1I6HB 1SNCA 1WCMH 4DV6L 1BVSA 2B39A 1OO9B 3LWEA 4DV7L 4KD3A 5C4XB 3KF8B 1E1TA 4K6DA 3VR2A 4A3CH 2LXKA 1NAPA 1TVXA 1KAWA 3KBGA 4IFDJ 3CKIB 1MBYA 1L2FA 3NWTA 1AFPA 3HOZH 4HCEA 1IXRA 1K8MA 1X32A 3TBIB 3A7LA 1HZBA 2FINB 1VQOA 2L4NA 2IPKD 2NVYH 4F88A 1D6EC 1L1OB 1Y1VB 5H1SE 1PTOB 4GNXC 2G9DA 1K8AC 4A3GH 4RGNA 2DNCA 1YNND 5CV4A 2B2UC 2F0VA 4FP5D 3WOEA 3C1FA 1AN8A 5C44G 1LTBD 2J7ZA 5IT9E 1B53A 4MZ9A 1PXUA 2WACA 1VQLA 2NWGA 3S1NB 1EYAA 4K8IA 1PH9A 1VQ4A 2A6HD 2EY2A 2NN6I 3MHBA 3MFYA 4DV2L 5FLMH 3K5NA 1DYQA 1JORA 2IW3A 4CJ0B 2JYOA 1DGSA 2CHBD 1FGBD 1NBWA 4ME3A 5DAUA 2CVRA 4LFBQ 3MTSA 4IPGA 4P72A 5E4WC 4DAVA 1PH8A 3CCUA 1GKHA 1PTOF 2R7DA 1AE3A 3VA7A 1UAPA 1GHKA 3NENA 4ODGA 4GS3A 5KNDA 3NBHB 2EJFC 5ELBA 1Y1WG 1WCMG 5E1FA 5KEEA 1XMOL 3GTPH 2O5JC 3SEBA 1S3OA 2ES2A 2EYFA 2JJQA 1KTKA 2XVSA 1QVGA 4A3CG 3GTKB 1TR5A 5JPNC 1KLUD 1GM5A 2HUGA 3BYTB 5FLXE 2R92G 4LF5L 4B3TL 3MFGA 2IHFA 2EXZA 1VQMA 3VDYA 3EA6A 4POGA 3GTJB 2E2DC 2KHJA 4DR7L 3FPPA 3HOZG 2DY7A 4O2DA 1T5EA 5IWAQ 3FPUB 1RHPA 4K14A 1E3PA 2RSOA 4EQ5A 3CC2A 1I4HA 2NN6G 2F52A 3C1EA 2CH4W 1L1OC 3DM1A 3RNUA 2EJMA 5KIXA 1PTOC 1XWEA 1XNRQ 1V1QA 3ULLA 1B50A 4UP8A 1J5EQ 3NXWA 3KF6B 3PUXA 1KDBA 2WKDA 4KY6A 3NPPA 4X3UA 3D31A 2TMPA 1I4QA 4RCNA 4KHVA 4HSPA 4ULLA 1AW7A 4R9WA
chains in the Genus database with same CATH topology
1J6QA 1UWVA 4JC0A 4IPDA 5FLMG 4JI2Q 2JA7H 2DGYA 4DR1L 5IP9H 4IO9A 1VQAA 2PQAB 5LMNL 1N34L 4YWLA 3HOUH 1I6HH 2HHHQ 1NE3A 2WB1G 1JJ2A 3KYHC 3PSIA 2UUBL 3M85A 5C4XH 4L5RC 2Q2HA 2XTIA 1JT8A 3CCJA 1NY4A 3F2CA 2Y0SE 5IWAL 1W2BA 4IOCA 1XMQQ 4LF6Q 3H3VI 1TWCH 3EIVA 4AQYQ 1HZCA 5IP7G 2WP8J 1FGUA 1XPRA 4ALPA 1HNZQ 1KQSA 4L5SA 3J80i 3HOWH 1YEZA 1K73C 1Y14B 4IJHA 4JCVE 1PH2A 1PH4A 5IYDH 4IFDG 1SMXA 2JEBI 1XNRL 2E2HH 5IY0A 2PI2A 3F2DA 1VQ9A 4A3BG 1A0IA 2WFWA 5BR8Q 4A3JG 1J5EL 1JB7A 2MO0A 4X66L 3NEMA 5HGQA 4X62L 2ASBA 3HOXG 1LM0A 4A3MH 3UDXA 1YJWA 3OTOL 4LF4Q 5GAGC 4KI0A 4OO1G 1YIJA 1IYJB 1R9TH 3BU2A 4RG1A 1Q1EA 3PUWA 5HY6A 1N36L 1NMFA 4UPAA 4UY8C 3PO2G 4B3MQ 1IBMQ 2KCTA 4JI5Q 1VQCA 3E9HA 4JI2L 1KD1C 5GADC 3CAMA 1Q12A 1VQNA 1CUKA 2HIXA 1VS0A 2OQKA 1IBKQ 3M4PA 1Q8KA 4PZ8A 1EYGA 1VQ7A 2IX1A 2HHHL 1CSQA 1NTGA 1SLJA 2E2JH 5EAYA 4DV0Q 1IL2A 3I4MH 2R6GA 4LUZA 2JA9A 4DK6C 4IOAA 4A3DH 3CCEA 1SRUA 3S1NH 3U50C 4BBSH 1P16A 1VCIA 2N8NA 2WB1E 4JI3Q 3RZOH 4WJ4A 3GO5A 3RR5A 1FL0A 4PMWA 4DAMA 1E7ZA 4JI6Q 1XMQL 4LF6L 1C9OA 1SE8A 2RCNA 4AQYL 4R4CA 1HNZL 2JA8H 1VQDA 3I4OA 5M5XH 4JI0Q 2NVQH 2EQSA 4KLKA 3CD6A 3CCRA 3BJUA 2GVAA 1TWAH 4KHPQ 1V43A 5BR8L 1CKNA 3J81i 4JI1Q 4HJAA 4BY7G 2N49A 1HJPA 2WAQG 3AYHB 1G6PA 3HOUG 3T1YQ 3MXNB 3JAMc 1QUQB 2VQEQ 1WI5A 4LW1A 3GTGH 1YHQA 4LF4L 5ELNA 5JJIA 3CMEA 1Q82C 2KCMA 3A5UA 1EIYB 4HJ9A 3I56A 2OQ0A 4A3EH 1X6OA 3I7FA 5C4JH 1IBML 4B3ML 2OTJA 4IPHA 4JI5L 3OW2A 2YV5A 4GLVB 2PI2E 1OXUA 3EN2A 4BY1G 3RLOA 3AFPA 1IBKL 2B3GA 4IJLA 4R4OA 1OTCA 3HKSA 2I5HA 4DV0L 3GTJH 2Y0SG 3DM3A 1VQIA 1XNQQ 2N78A 1XJVA 2B63H 3RZDH 4JI3L 3W1GA 4B3SQ 4JI6L 5C0XI 1OXTA 2MQHA 3S14H 3FHWA 4HJ8A 3GDEA 4YY3Q 2V1CC 2R93H 2MO1A 4LFAQ 4LF9Q 1V9PA 3L0OA 4DAYB 1BBUA 2D0OA 4EX5A 1PH3A 3I4NH 4B3RQ 1KL9A 2ALYB 2K4KA 4NXMQ 1X3GA 1YI2A 1PH1A 4A4IA 2OWOA 3U58A 4JI0L 2F4VQ 4OX9Q 1AE2A 4JBJA 1TWFH 3J7A5 1LTLA 1I5FA 1A63A 4KHPL 2ZJQA 4A3GG 3K80C 4JI1L 1VQKA 1VQ5A 3GTMH 1Q46A 3T1YL 2VW9A 2K75A 3G4SA 2VQEL 4DUYQ 4LUVA 3ZJYC 3CPWA 3U4VA 3I4MG 3PO3G 2YYZA 2I5MX 3Q8DA 4R4TA 4DR4Q 1MJCA 1YBYA 3CW2C 5E7NA 4C3JH 1PYSB 4Y7NH 1PYBA 4X6AH 5IYBG 1TXYA 3IRBA 4JOIA 5M3MH 4DUZQ 2UXDQ 3D0FA 4A3FH 1K8GA 2VL6A 1D8LA 1GD7A 1TWHH 4A3LG 2R7FA 4DKAC 1FVIA 4PG3A 3TREA 2JA8G 1UE6A 2AKWB 2CWPA 4YCVA 1EQQA 4H02A 3H0GH 1EWIA 2NZOA 4TVAB 3ERSX 2LXJA 3PGZA 1XNQL 2XGTA 1VQHA 4B3SL 2BH2A 4A93H 1GO3E 2OCEA 5C3EH 1SROA 2VNUD 3CMAA 4YY3L 4LFAL 4LF9L 2JEAI 1EQRA 2YTVA 3HOYG 5C0XJ 4B3RL 2KHIA 1CSPA 4NXML 5JEAJ 3B6YA 1BKBA 5M3FH 2F4VL 3PIOA 2KENA 2IY5B 4OX9L 3J81c 3PUYA 2ZTDA 4GN3B 4A3EG 3U4ZA 3HKZG 2UXCQ 2DUDA 4OWWB 1YVCA 4PZ6A 3CC4A 3TEHB 3UDIA 1JMCA 1Z9FA 1IBLQ 4UP9A 1KC8C 3FP9A 5IE8A 3KFUA 4BBRG 1EUJA 2QEXA 4R4IA 4DR6Q 1TWGH 4C2MH 4DUYL 3RN2A 3GD7A 3M7NA 2UXBQ 4GNXA 4KHZA 4DPGA 1CKNB 2BH8A 3S1RH 4A3KG 1JE5A 2I5LX 1ASZA 2L15A 4C3IH 1Q81C 2E8GA 3S2DH 1WYDA 2YTXA 4QGUA 1HR0W 2B63G 4DR4L 2QGQA 3S1MH 1HH2P 5GAEC 4AIMA 1Y1VH 2YU9H 1RL2A 2R92H 4DR2Q 1M1KC 4NPSA 1KXLA 2UXDL 4DUZL 3TRZA 1VQBA 1OXSC 4A75A 4GOPB 1QVFA 1I50H 3KLWA 3CPFA 3L7ZC 4JBKA 2R7ZH 3ER0A 1E22A 3G48A 3CCQA 4DR5Q 1PFSA 1NJIC 3M3YH 1VQPA 2UUAQ 4LF7Q 1Q1BA 1K0RA 3DLLA 3STBC 2Q2TA 4DR3Q 4BXXG 3FKIH 2UU9Q 2E5LQ 4YCUA 4P71A 1SR3A 1B7YB 1U0LA 2GVBA 2K52A 3KDFA 5FJ8H 4GKKQ 1VQJA 4AYBE 3CCVA 4NXNQ 4YCWA 4YWKA 1VQEA 4A3IG 5IYCG 4JI8Q 3K81C 2K5VA 3AQQA 4XTCS 2H5XA 3HOVH 3GTOH 1YJNA 2UXCL 3J7ZC 5LMNW 3S2HH 3PF5A 1PVOA 5M3MG 2VQFQ 1IBLL 3LGJA 2NZHA 4A3FG 2JA7G 5IP9G 1WOCA 1UE5A 3HKZE 2JA5H 2FXQA 4O0AA 4DR6L 2PMZE 1A62A 3AFQA 3CCLA 1HNWQ 2UXBL 2RHSB 2ZTCA 5C4XG 3H0GG 4J15A 2UUCQ 1VQGA 5DLQE 2N3SA 1N8RC 5C3EG 1N33Q 5LMUQ 5FLXc 4DR2L 3UDGA 3GTKH 2BA0A 2CCZA 4P75A 1LUZA 4QIWE 3TS0A 2E2IH 1PA6A 4C3HH 4DV3Q 4DK3C 2D62A 3S16H 4DR5L 3HOWG 3W5OA 5IYDG 2NVTH 2UUAL 4LF7L 1WJJA 2EIFA 4APVA 4DR3L 3K0XA 1X56A 4HIMA 2UU9L 2E5LL 1YJ9A 5IP7H 1L1OA 4LF8Q 4K0KQ 1FJGQ 2RF4A 4GKKL 2GN5A 4NXNL 2Z0SA 2Z6KA 2HIVA 4A3MG 4JI8L 3PUZA 3PUVA 4MNOA 4WJ3M 4A3BH 3MEFA 4A3JH 1YNXA 1Y1VG 1W3SA 2CKZB 1QVCA 2AWOA 1M90C 1K9MC 2VQFL 3HOXH 3G6EA 4GOPC 1E1OA 2MFIA 5J3BA 3L2PA 4DV6Q 1HNWL 5JJKA 4DV7Q 4LFCQ 3CXCA 1D7QA 4JG2A 1CKOA 1NMGA 2K50A 1A8VA 3A0JA 4X64Q 3PO2H 1G291 1P8LA 4IPCA 4P74A 3RN5A 2UUCL 2HT1A 4BBSG 3BZCA 1XTDA 4A3DG 3ULPA 1N33L 5LMUL 2VUMH 3FKIG 1VQ8A 2D0PA 2JA6H 1JJGA 4POFA 3HFZB 5M5WH 1X55A 3I2ZA 3S17H 1PH5A 3K7UC 5C44H 1Q86C 1XPUA 3AEVA 4DV3L 2LSSA 3TQYA 1S40A 2EXDA 1QUQA 1OXXK 1YHBA 4DNIA 3M4OH 5K36G 4GN4B 4LF8L 1MIUA 4AYBG 1X3EA 4NB3A 1Q7YC 1FJGL 4GN5A 4K0KL 3H15A 3EBEA 3PIPA 2AMCB 1C0AA 4L5TA 3H3VH 1GVPA 4BA2I 3KOJA 1PHJA 4L5QA 3CCMA 4R1JA 5C0XG 3CF5A 3KDFB 1H95A 5JEAG 3A74A 1I94Q 3CP0A 4JI4Q 4BY7H 4PZ7A 2CWAA 3CQZH 1Y1WH 1X9NA 1WCMH 3PCOB 1BVSA 4DV6L 4JI7Q 2QA4A 1KHIA 3W1BA 1HZAA 1MKHA 4JOIC 3E9IA 4OWTB 2HQLA 4LFCL 4DV7L 4DV4Q 3KF8B 2KBNA 2A1AA 4X64L 2I0QA 1X65A 1E1TA 2IHEA 3PF4A 4A3CH 2LXKA 2VS1A 4DV2Q 4BY1H 4GKJQ 1EOVA 3T1HQ 2K5NA 2CFMA 3NELA 2ZJPA 4A76A 5M5YH 2R93G 1KAWA 3SGIA 3PV0A 1HZ9A 2B29A 4IFDJ 4Y52H 2JQOA 3I4NG 5GAHC 2JE6I 1UE1A 5IT9c 2ID0A 2A8VA 1L2FA 4LUOA 3GTQH 3KF6A 5AJ3Q 3HOZH 3KJOA 2F3IA 3UDFA 4QJFA 1YITA 1UE7A 1PH7A 4DV1Q 4X65Q 1IXRA 1N32Q 4P73A 1UEBA 2IX0A 3CCSA 3OYYA 2K5HA 1HZBA 3F1ZA 1XMOQ 3ICEA 1X3FA 1VQOA 2NVYH 4XIGS 1SFOH 1L1OB 1IZ6A 2PQAA 2Q2IA 5H1SE 4GNXC 1K8AC 2ZM6Q 4A3GH 2VUMG 3KJPA 1I94L 2JA6G 4JI4L 4GLXA 1YHAA 4LF5Q 4B3TQ 4DV5Q 3PO3H 5C44G 4HJ7A 4JI7L 2JK8A 4MZ9A 4DV4L 1PV4A 1MJEA 1N9WA 2MNAA 1VQLA 4DR7Q 3GTLH 1PH6A 4HIDA 1PH9A 3RLNA 1EIFA 1VQ4A 2NN6I 1E24A 3F8TA 1VQ6A 4HIOA 2PNHA 4DV2L 5IYBH 5FLMH 1XPOA 3T1HL 1HR0Q 4JBMA 4JYAQ 4GKJL 4A93G 4FDBA 1DGSA 4A3LH 1NBWA 4ME3A 3E0EA 2K14A 4QL5A 4LFBQ 1U5KA 4IPGA 4P72A 2BA1A 1PH8A 4LNQA 3CCUA 2CQOA 1GKHA 5M3FG 2R7DA 5AJ3L 1AE3A 1K83H 5ELOA 2OTLA 2C35B 3NENA 4GS3A 4DV1L 3NBHB 4JV5Q 1X54A 1N36Q 4OONA 4X65L 1Y1WG 3HOYH 1L0WA 1N32L 1WCMG 4YHHQ 4BA1I 1Z47A 4LWCA 1HNXQ 1T9HA 1KRTA 1XMOL 2AHOB 2ES2A 1S3OA 1YZ6A 3GTPH 3S15H 1S72A 3S24A 2JJQA 3BZKA 4GOPA 3M9BA 1QVGA 3JC66 4A3CG 2ZM6L 2NVXH 4DR1Q 1SN8A 1GM5A 1OXVA 3I55A 1CKMA 4BBRH 1VQFA 4LF5L 4B3TL 5LMNQ 1N34Q 2R92G 2IHFA 2RHQB 3RLFA 4DV5L 1EFWA 4MTNA 1VQMA 3M4QA 3VDYA 1K3RA 4JBWA 4A3KH 1C7YA 2IT1A 2UUBQ 4POGA 3K7AH 1B70B 5GQOA 1JJCB 2KHJA 1BBWA 2R7ZG 4QY7A 4DR7L 2VY3A 3HOZG 3STBD 4O2DA 4HJ5A 4TQUS 1LYLA 5IWAQ 3J80c 1HR0L 1ASYA 4JYAL 4GNXB 4IFDI 3A5ZB 3F2BA 1B8AA 1E3PA 4EQ5A 2ZTEA 4AH6A 3CC2A 2NN6G 4OXPA 5JJLA 2ZJRA 2F52A 5GROA 5FJ8G 2Q2UA 1AH9A 4LFBL 1G51A 4QQBX 1L1OC 3RNUA 4RMFA 1QZGA 3J81j 3G71A 1KRSA 4R4QA 3WWVA 3HOVG 2AWNA 1XNRQ 3S1QH 4YWMA 1V1QA 3ULLA 4OWXB 4BXXH 2Z6KC 4UP8A 3CC7A 4HIKA 1J5EQ 4OO1I 2ATWA 4JV5L 4X66Q 3KF6B 1QZHA 4X62Q 1RIPA 3PUXA 3ULJA 3UE0A 4YHHL 4A3IH 1O7IA 3D31A 1HNXL 2JA5G 2WAQE 5IYCH 4UP7A 3OTOQ 1I3QH 2YTYA 2A19A 3K8AA 3JAMi 4GLAC 1WFQA 3TS2A 1KIXA 2VZAA 3UE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  1UWV A;  4JC0 A;  4IPD A;  5FLM G;  4JI2 Q;  2JA7 H;  2DGY A;  4DR1 L;  5IP9 H;  4IO9 A;  1VQA A;  2PQA B;  5LMN L;  1N34 L;  4YWL A;  3HOU H;  1I6H H;  2HHH Q;  1NE3 A;  2WB1 G;  1JJ2 A;  3KYH C;  3PSI A;  2UUB L;  3M85 A;  5C4X H;  4L5R C;  2Q2H A;  2XTI A;  1JT8 A;  3CCJ A;  1NY4 A;  3F2C A;  2Y0S E;  5IWA L;  1W2B A;  4IOC A;  1XMQ Q;  4LF6 Q;  3H3V I;  1TWC H;  3EIV A;  4AQY Q;  1HZC A;  5IP7 G;  2WP8 J;  1FGU A;  1XPR A;  4ALP A;  1HNZ Q;  1KQS A;  4L5S A;  3J80 i;  3HOW H;  1YEZ A;  1K73 C;  1Y14 B;  4IJH A;  4JCV E;  1PH2 A;  1PH4 A;  5IYD H;  4IFD G;  1SMX A;  2JEB I;  1XNR L;  2E2H H;  5IY0 A;  2PI2 A;  3F2D A;  1VQ9 A;  4A3B G;  1A0I A;  2WFW A;  5BR8 Q;  4A3J G;  1J5E L;  1JB7 A;  2MO0 A;  4X66 L;  3NEM A;  5HGQ A;  4X62 L;  2ASB A;  3HOX G;  1LM0 A;  4A3M H;  3UDX A;  1YJW A;  3OTO L;  4LF4 Q;  5GAG C;  4KI0 A;  4OO1 G;  1YIJ A;  1IYJ B;  1R9T H;  3BU2 A;  4RG1 A;  1Q1E A;  3PUW A;  5HY6 A;  1N36 L;  1NMF A;  4UPA A;  4UY8 C;  3PO2 G;  4B3M Q;  1IBM Q;  2KCT A;  4JI5 Q;  1VQC A;  3E9H A;  4JI2 L;  1KD1 C;  5GAD C;  3CAM A;  1Q12 A;  1VQN A;  1CUK A;  2HIX A;  1VS0 A;  2OQK A;  1IBK Q;  3M4P A;  1Q8K A;  4PZ8 A;  1EYG A;  1VQ7 A;  2IX1 A;  2HHH L;  1CSQ A;  1NTG A;  1SLJ A;  2E2J H;  5EAY A;  4DV0 Q;  1IL2 A;  3I4M H;  2R6G A;  4LUZ A;  2JA9 A;  4DK6 C;  4IOA A;  4A3D H;  3CCE A;  1SRU A;  3S1N H;  3U50 C;  4BBS H;  1P16 A;  1VCI A;  2N8N A;  2WB1 E;  4JI3 Q;  3RZO H;  4WJ4 A;  3GO5 A;  3RR5 A;  1FL0 A;  4PMW A;  4DAM A;  1E7Z A;  4JI6 Q;  1XMQ L;  4LF6 L;  1C9O A;  1SE8 A;  2RCN A;  4AQY L;  4R4C A;  1HNZ L;  2JA8 H;  1VQD A;  3I4O A;  5M5X H;  4JI0 Q;  2NVQ H;  2EQS A;  4KLK A;  3CD6 A;  3CCR A;  3BJU A;  2GVA A;  1TWA H;  4KHP Q;  1V43 A;  5BR8 L;  1CKN A;  3J81 i;  4JI1 Q;  4HJA A;  4BY7 G;  2N49 A;  1HJP A;  2WAQ G;  3AYH B;  1G6P A;  3HOU G;  3T1Y Q;  3MXN B;  3JAM c;  1QUQ B;  2VQE Q;  1WI5 A;  4LW1 A;  3GTG H;  1YHQ A;  4LF4 L;  5ELN A;  5JJI A;  3CME A;  1Q82 C;  2KCM A;  3A5U A;  1EIY B;  4HJ9 A;  3I56 A;  2OQ0 A;  4A3E H;  1X6O A;  3I7F A;  5C4J H;  1IBM L;  4B3M L;  2OTJ A;  4IPH A;  4JI5 L;  3OW2 A;  2YV5 A;  4GLV B;  2PI2 E;  1OXU A;  3EN2 A;  4BY1 G;  3RLO A;  3AFP A;  1IBK L;  2B3G A;  4IJL A;  4R4O A;  1OTC A;  3HKS A;  2I5H A;  4DV0 L;  3GTJ H;  2Y0S G;  3DM3 A;  1VQI A;  1XNQ Q;  2N78 A;  1XJV A;  2B63 H;  3RZD H;  4JI3 L;  3W1G A;  4B3S Q;  4JI6 L;  5C0X I;  1OXT A;  2MQH A;  3S14 H;  3FHW A;  4HJ8 A;  3GDE A;  4YY3 Q;  2V1C C;  2R93 H;  2MO1 A;  4LFA Q;  4LF9 Q;  1V9P A;  3L0O A;  4DAY B;  1BBU A;  2D0O A;  4EX5 A;  1PH3 A;  3I4N H;  4B3R Q;  1KL9 A;  2ALY B;  2K4K A;  4NXM Q;  1X3G A;  1YI2 A;  1PH1 A;  4A4I A;  2OWO A;  3U58 A;  4JI0 L;  2F4V Q;  4OX9 Q;  1AE2 A;  4JBJ A;  1TWF H;  3J7A 5;  1LTL A;  1I5F A;  1A63 A;  4KHP L;  2ZJQ A;  4A3G G;  3K80 C;  4JI1 L;  1VQK A;  1VQ5 A;  3GTM H;  1Q46 A;  3T1Y L;  2VW9 A;  2K75 A;  3G4S A;  2VQE L;  4DUY Q;  4LUV A;  3ZJY C;  3CPW A;  3U4V A;  3I4M G;  3PO3 G;  2YYZ A;  2I5M X;  3Q8D A;  4R4T A;  4DR4 Q;  1MJC A;  1YBY A;  3CW2 C;  5E7N A;  4C3J H;  1PYS B;  4Y7N H;  1PYB A;  4X6A H;  5IYB G;  1TXY A;  3IRB A;  4JOI A;  5M3M H;  4DUZ Q;  2UXD Q;  3D0F A;  4A3F H;  1K8G A;  2VL6 A;  1D8L A;  1GD7 A;  1TWH H;  4A3L G;  2R7F A;  4DKA C;  1FVI A;  4PG3 A;  3TRE A;  2JA8 G;  1UE6 A;  2AKW B;  2CWP A;  4YCV A;  1EQQ A;  4H02 A;  3H0G H;  1EWI A;  2NZO A;  4TVA B;  3ERS X;  2LXJ A;  3PGZ A;  1XNQ L;  2XGT A;  1VQH A;  4B3S L;  2BH2 A;  4A93 H;  1GO3 E;  2OCE A;  5C3E H;  1SRO A;  2VNU D;  3CMA A;  4YY3 L;  4LFA L;  4LF9 L;  2JEA I;  1EQR A;  2YTV A;  3HOY G;  5C0X J;  4B3R L;  2KHI A;  1CSP A;  4NXM L;  5JEA J;  3B6Y A;  1BKB A;  5M3F H;  2F4V L;  3PIO A;  2KEN A;  2IY5 B;  4OX9 L;  3J81 c;  3PUY A;  2ZTD A;  4GN3 B;  4A3E G;  3U4Z A;  3HKZ G;  2UXC Q;  2DUD A;  4OWW B;  1YVC A;  4PZ6 A;  3CC4 A;  3TEH B;  3UDI A;  1JMC A;  1Z9F A;  1IBL Q;  4UP9 A;  1KC8 C;  3FP9 A;  5IE8 A;  3KFU A;  4BBR G;  1EUJ A;  2QEX A;  4R4I A;  4DR6 Q;  1TWG H;  4C2M H;  4DUY L;  3RN2 A;  3GD7 A;  3M7N A;  2UXB Q;  4GNX A;  4KHZ A;  4DPG A;  1CKN B;  2BH8 A;  3S1R H;  4A3K G;  1JE5 A;  2I5L X;  1ASZ A;  2L15 A;  4C3I H;  1Q81 C;  2E8G A;  3S2D H;  1WYD A;  2YTX A;  4QGU A;  1HR0 W;  2B63 G;  4DR4 L;  2QGQ A;  3S1M H;  1HH2 P;  5GAE C;  4AIM A;  1Y1V H;  2YU9 H;  1RL2 A;  2R92 H;  4DR2 Q;  1M1K C;  4NPS A;  1KXL A;  2UXD L;  4DUZ L;  3TRZ A;  1VQB A;  1OXS C;  4A75 A;  4GOP B;  1QVF A;  1I50 H;  3KLW A;  3CPF A;  3L7Z C;  4JBK A;  2R7Z H;  3ER0 A;  1E22 A;  3G48 A;  3CCQ A;  4DR5 Q;  1PFS A;  1NJI C;  3M3Y H;  1VQP A;  2UUA Q;  4LF7 Q;  1Q1B A;  1K0R A;  3DLL A;  3STB C;  2Q2T A;  4DR3 Q;  4BXX G;  3FKI H;  2UU9 Q;  2E5L Q;  4YCU A;  4P71 A;  1SR3 A;  1B7Y B;  1U0L A;  2GVB A;  2K52 A;  3KDF A;  5FJ8 H;  4GKK Q;  1VQJ A;  4AYB E;  3CCV A;  4NXN Q;  4YCW A;  4YWK A;  1VQE A;  4A3I G;  5IYC G;  4JI8 Q;  3K81 C;  2K5V A;  3AQQ A;  4XTC S;  2H5X A;  3HOV H;  3GTO H;  1YJN A;  2UXC L;  3J7Z C;  5LMN W;  3S2H H;  3PF5 A;  1PVO A;  5M3M G;  2VQF Q;  1IBL L;  3LGJ A;  2NZH A;  4A3F G;  2JA7 G;  5IP9 G;  1WOC A;  1UE5 A;  3HKZ E;  2JA5 H;  2FXQ A;  4O0A A;  4DR6 L;  2PMZ E;  1A62 A;  3AFQ A;  3CCL A;  1HNW Q;  2UXB L;  2RHS B;  2ZTC A;  5C4X G;  3H0G G;  4J15 A;  2UUC Q;  1VQG A;  5DLQ E;  2N3S A;  1N8R C;  5C3E G;  1N33 Q;  5LMU Q;  5FLX c;  4DR2 L;  3UDG A;  3GTK H;  2BA0 A;  2CCZ A;  4P75 A;  1LUZ A;  4QIW E;  3TS0 A;  2E2I H;  1PA6 A;  4C3H H;  4DV3 Q;  4DK3 C;  2D62 A;  3S16 H;  4DR5 L;  3HOW G;  3W5O A;  5IYD G;  2NVT H;  2UUA L;  4LF7 L;  1WJJ A;  2EIF A;  4APV A;  4DR3 L;  3K0X A;  1X56 A;  4HIM A;  2UU9 L;  2E5L L;  1YJ9 A;  5IP7 H;  1L1O A;  4LF8 Q;  4K0K Q;  1FJG Q;  2RF4 A;  4GKK L;  2GN5 A;  4NXN L;  2Z0S A;  2Z6K A;  2HIV A;  4A3M G;  4JI8 L;  3PUZ A;  3PUV A;  4MNO A;  4WJ3 M;  4A3B H;  3MEF A;  4A3J H;  1YNX A;  1Y1V G;  1W3S A;  2CKZ B;  1QVC A;  2AWO A;  1M90 C;  1K9M C;  2VQF L;  3HOX H;  3G6E A;  4GOP C;  1E1O A;  2MFI A;  5J3B A;  3L2P A;  4DV6 Q;  1HNW L;  5JJK A;  4DV7 Q;  4LFC Q;  3CXC A;  1D7Q A;  4JG2 A;  1CKO A;  1NMG A;  2K50 A;  1A8V A;  3A0J A;  4X64 Q;  3PO2 H;  1G29 1;  1P8L A;  4IPC A;  4P74 A;  3RN5 A;  2UUC L;  2HT1 A;  4BBS G;  3BZC A;  1XTD A;  4A3D G;  3ULP A;  1N33 L;  5LMU L;  2VUM H;  3FKI G;  1VQ8 A;  2D0P A;  2JA6 H;  1JJG A;  4POF A;  3HFZ B;  5M5W H;  1X55 A;  3I2Z A;  3S17 H;  1PH5 A;  3K7U C;  5C44 H;  1Q86 C;  1XPU A;  3AEV A;  4DV3 L;  2LSS A;  3TQY A;  1S40 A;  2EXD A;  1QUQ A;  1OXX K;  1YHB A;  4DNI A;  3M4O H;  5K36 G;  4GN4 B;  4LF8 L;  1MIU A;  4AYB G;  1X3E A;  4NB3 A;  1Q7Y C;  1FJG L;  4GN5 A;  4K0K L;  3H15 A;  3EBE A;  3PIP A;  2AMC B;  1C0A A;  4L5T A;  3H3V H;  1GVP A;  4BA2 I;  3KOJ A;  1PHJ A;  4L5Q A;  3CCM A;  4R1J A;  5C0X G;  3CF5 A;  3KDF B;  1H95 A;  5JEA G;  3A74 A;  1I94 Q;  3CP0 A;  4JI4 Q;  4BY7 H;  4PZ7 A;  2CWA A;  3CQZ H;  1Y1W H;  1X9N A;  1WCM H;  3PCO B;  1BVS A;  4DV6 L;  4JI7 Q;  2QA4 A;  1KHI A;  3W1B A;  1HZA A;  1MKH A;  4JOI C;  3E9I A;  4OWT B;  2HQL A;  4LFC L;  4DV7 L;  4DV4 Q;  3KF8 B;  2KBN A;  2A1A A;  4X64 L;  2I0Q A;  1X65 A;  1E1T A;  2IHE A;  3PF4 A;  4A3C H;  2LXK A;  2VS1 A;  4DV2 Q;  4BY1 H;  4GKJ Q;  1EOV A;  3T1H Q;  2K5N A;  2CFM A;  3NEL A;  2ZJP A;  4A76 A;  5M5Y H;  2R93 G;  1KAW A;  3SGI A;  3PV0 A;  1HZ9 A;  2B29 A;  4IFD J;  4Y52 H;  2JQO A;  3I4N G;  5GAH C;  2JE6 I;  1UE1 A;  5IT9 c;  2ID0 A;  2A8V A;  1L2F A;  4LUO A;  3GTQ H;  3KF6 A;  5AJ3 Q;  3HOZ H;  3KJO A;  2F3I A;  3UDF A;  4QJF A;  1YIT A;  1UE7 A;  1PH7 A;  4DV1 Q;  4X65 Q;  1IXR A;  1N32 Q;  4P73 A;  1UEB A;  2IX0 A;  3CCS A;  3OYY A;  2K5H A;  1HZB A;  3F1Z A;  1XMO Q;  3ICE A;  1X3F A;  1VQO A;  2NVY H;  4XIG S;  1SFO H;  1L1O B;  1IZ6 A;  2PQA A;  2Q2I A;  5H1S E;  4GNX C;  1K8A C;  2ZM6 Q;  4A3G H;  2VUM G;  3KJP A;  1I94 L;  2JA6 G;  4JI4 L;  4GLX A;  1YHA A;  4LF5 Q;  4B3T Q;  4DV5 Q;  3PO3 H;  5C44 G;  4HJ7 A;  4JI7 L;  2JK8 A;  4MZ9 A;  4DV4 L;  1PV4 A;  1MJE A;  1N9W A;  2MNA A;  1VQL A;  4DR7 Q;  3GTL H;  1PH6 A;  4HID A;  1PH9 A;  3RLN A;  1EIF A;  1VQ4 A;  2NN6 I;  1E24 A;  3F8T A;  1VQ6 A;  4HIO A;  2PNH A;  4DV2 L;  5IYB H;  5FLM H;  1XPO A;  3T1H L;  1HR0 Q;  4JBM A;  4JYA Q;  4GKJ L;  4A93 G;  4FDB A;  1DGS A;  4A3L H;  1NBW A;  4ME3 A;  3E0E A;  2K14 A;  4QL5 A;  4LFB Q;  1U5K A;  4IPG A;  4P72 A;  2BA1 A;  1PH8 A;  4LNQ A;  3CCU A;  2CQO A;  1GKH A;  5M3F G;  2R7D A;  5AJ3 L;  1AE3 A;  1K83 H;  5ELO A;  2OTL A;  2C35 B;  3NEN A;  4GS3 A;  4DV1 L;  3NBH B;  4JV5 Q;  1X54 A;  1N36 Q;  4OON A;  4X65 L;  1Y1W G;  3HOY H;  1L0W A;  1N32 L;  1WCM G;  4YHH Q;  4BA1 I;  1Z47 A;  4LWC A;  1HNX Q;  1T9H A;  1KRT A;  1XMO L;  2AHO B;  2ES2 A;  1S3O A;  1YZ6 A;  3GTP H;  3S15 H;  1S72 A;  3S24 A;  2JJQ A;  3BZK A;  4GOP A;  3M9B A;  1QVG A;  3JC6 6;  4A3C G;  2ZM6 L;  2NVX H;  4DR1 Q;  1SN8 A;  1GM5 A;  1OXV A;  3I55 A;  1CKM A;  4BBR H;  1VQF A;  4LF5 L;  4B3T L;  5LMN Q;  1N34 Q;  2R92 G;  2IHF A;  2RHQ B;  3RLF A;  4DV5 L;  1EFW A;  4MTN A;  1VQM A;  3M4Q A;  3VDY A;  1K3R A;  4JBW A;  4A3K H;  1C7Y A;  2IT1 A;  2UUB Q;  4POG A;  3K7A H;  1B70 B;  5GQO A;  1JJC B;  2KHJ A;  1BBW A;  2R7Z G;  4QY7 A;  4DR7 L;  2VY3 A;  3HOZ G;  3STB D;  4O2D A;  4HJ5 A;  4TQU S;  1LYL A;  5IWA Q;  3J80 c;  1HR0 L;  1ASY A;  4JYA L;  4GNX B;  4IFD I;  3A5Z B;  3F2B A;  1B8A A;  1E3P A;  4EQ5 A;  2ZTE A;  4AH6 A;  3CC2 A;  2NN6 G;  4OXP A;  5JJL A;  2ZJR A;  2F52 A;  5GRO A;  5FJ8 G;  2Q2U A;  1AH9 A;  4LFB L;  1G51 A;  4QQB X;  1L1O C;  3RNU A;  4RMF A;  1QZG A;  3J81 j;  3G71 A;  1KRS A;  4R4Q A;  3WWV A;  3HOV G;  2AWN A;  1XNR Q;  3S1Q H;  4YWM A;  1V1Q A;  3ULL A;  4OWX B;  4BXX H;  2Z6K C;  4UP8 A;  3CC7 A;  4HIK A;  1J5E Q;  4OO1 I;  2ATW A;  4JV5 L;  4X66 Q;  3KF6 B;  1QZH A;  4X62 Q;  1RIP A;  3PUX A;  3ULJ A;  3UE0 A;  4YHH L;  4A3I H;  1O7I A;  3D31 A;  1HNX L;  2JA5 G;  2WAQ E;  5IYC H;  4UP7 A;  3OTO Q;  1I3Q H;  2YTY A;  2A19 A;  3K8A A;  3JAM i;  4GLA C;  1WFQ A;  3TS2 A;  1KIX A;  2VZA A;  3UE1 A; 
#chains in the Genus database with same CATH topology
 2VUM B;  2XRQ D;  1UWV A;  4IPD A;  5FLM G;  4H44 C;  4F8M A;  5FO9 B;  4DR1 L;  3S17 B;  4IO9 A;  2RSN A;  5LMN L;  4YWL A;  1G8Z D;  2XRS D;  3SVM A;  1JT8 A;  3CCJ A;  1NY4 A;  2CQA A;  2Y0S E;  3CHB D;  1W2B A;  1XMQ Q;  4LF6 Q;  3GV3 A;  2BDN A;  4AQY Q;  2K33 A;  3U9S A;  2PW5 A;  4G7H C;  1YEZ A;  1PH4 A;  2JEB I;  2A6E C;  1VQ9 A;  4A3J G;  2BCO A;  3I70 A;  1MSG A;  2B2V A;  1YJW A;  5GAG C;  1R9T H;  1IYJ B;  5BN3 A;  1Q1E A;  3BVZ A;  5HY6 A;  1NMF A;  2H1E A;  1E2Z A;  5IGB A;  2F0U A;  1Y8P B;  4DN4 M;  1VS0 A;  4DK0 A;  1SMY C;  1QNU A;  2EYM A;  1SLJ A;  4DV0 Q;  4K2K A;  1FNV A;  1LTG D;  4ABN A;  3U50 C;  1P16 A;  1VCI A;  2N8N A;  2WB1 E;  4P2C B;  3RR5 A;  4JI6 Q;  1E7Z A;  5EJW A;  5M9O A;  3WOF A;  5M5X H;  1TY2 A;  4JI0 Q;  5FK9 C;  3ITP A;  3CCR A;  3BJU A;  2GVA A;  4KHP Q;  5BR8 L;  1CKN A;  3J81 i;  4HJA A;  2N49 A;  2K1B A;  5CV8 A;  2I07 B;  2XN9 C;  5C0X H;  3GP7 A;  2WII B;  3A5U A;  1EIY B;  3I56 A;  4O42 A;  3I7F A;  4JI5 L;  1SYF A;  2PI2 E;  3P7J A;  3EN2 A;  3VYU A;  3T53 B;  1B2T A;  1IBK L;  1LTR D;  4OEL B;  4CKB A;  3I8Z A;  2Y0S G;  3DM3 A;  3RZD H;  1EFI D;  4JI3 L;  3D4R A;  5C0X I;  4HJ8 A;  2V1C C;  2MO1 A;  4LFA Q;  3L0O A;  3I4N H;  3S15 B;  1IKM A;  2F0E A;  2KVM A;  2K4K A;  3K5M A;  1B9N A;  1PH1 A;  2F4V Q;  3U58 A;  4JW0 A;  2NVX B;  1AE2 A;  5DEH A;  1LTL A;  2ZJQ A;  5E3F A;  1GXD C;  1B1Z A;  1Q46 A;  2VW9 A;  1LT5 D;  4DUY Q;  3ZJY C;  4IUR A;  1CZW A;  2QF7 A;  3R93 A;  2B2T C;  4X6A H;  1ILQ A;  5IYB G;  4A3F H;  1K8G A;  2OXP A;  2FMC A;  5COR A;  1TWH H;  4DKA C;  4PG3 A;  4JPB W;  1UE6 A;  4YCV A;  4B9X A;  1XNQ L;  2NZO A;  2K04 A;  5CV7 A;  2F0T A;  4A93 H;  4KKS A;  4CJ1 B;  5CV5 A;  4C1N K;  5C0X J;  1LTA D;  2KHI A;  5M3F H;  3LNN A;  4K5V A;  4OX9 L;  2JN4 A;  1V1P B;  1AP0 A;  3H91 A;  4HTH A;  2DUD A;  4WOR A;  3CQZ B;  1Z9F A;  1NSN S;  3HP3 A;  5IE8 A;  4R4I A;  4DR6 Q;  5KNC A;  4GNX A;  4KHZ A;  3IFD A;  4A3K G;  1JE5 A;  2E8G A;  1VF7 A;  3D8G A;  2YTX A;  2Z9H A;  1TWC B;  2B2U A;  2YU9 H;  5EKI A;  1Y1V H;  4DR2 Q;  4NPS A;  2UXD L;  4ZLT F;  3TRZ A;  3HOW B;  1VQB A;  1OXS C;  4A75 A;  4HCS A;  5KYL A;  3CPF A;  3L7Z C;  2K5Q A;  4DR5 Q;  2E2H B;  1HHV A;  1VQP A;  4LF7 Q;  2A69 C;  5I2X A;  1VF5 C;  4DR3 Q;  2Q2T A;  4YCU A;  2GVB A;  3IAY A;  4GKK Q;  1RKN A;  1VQJ A;  2NVY B;  3CCV A;  4YWK A;  5IYC G;  1J9O A;  2H5X A;  1G6Z A;  1YJN A;  4A3G B;  3J7Z C;  5LMN W;  4DNT B;  1PDQ A;  1DJR D;  2I46 A;  3KF8 A;  3LGJ A;  1F2Z A;  3ND9 A;  2Q8I B;  4A3F G;  5IP9 G;  1UE5 A;  3HKZ E;  5I4D A;  1HNW Q;  2UXB L;  1Q90 A;  5D14 A;  1SSO A;  3NE5 B;  2K5W A;  5C4X G;  4G4K A;  5DLQ E;  1A2T A;  2N3S A;  4S3S A;  5FLX c;  2E76 C;  2PZT A;  3GTK H;  2JA8 B;  2BA0 A;  2JXM B;  3H3V C;  4P75 A;  4QIW E;  1LT3 D;  5KGU A;  3TZD A;  5CGK A;  2A6E D;  3RMH A;  2Z6B A;  1JE4 A;  4OHJ A;  1EU3 A;  4CDD C;  1BOS A;  1GUO A;  4APV A;  2HDL A;  1F77 A;  1X56 A;  2D9U A;  1YJ9 A;  1L1O A;  3GTG B;  2RF4 A;  2Z8L A;  1JC7 A;  4YIJ A;  4A3E B;  4JI8 L;  3PUV A;  3BVG A;  4UHV A;  4A3B H;  1ET9 A;  1Y1V G;  2CKZ B;  1SMY D;  3G6E A;  3L2P A;  3O13 A;  4Z9C B;  3J80 L;  2B63 B;  3PO2 H;  4FF3 A;  3SK4 A;  3S14 B;  1XTD A;  1B3A A;  2N55 A;  2VUM H;  5EQ0 A;  1X55 A;  3S17 H;  1XPU A;  2LSS A;  3NBH A;  1STY A;  2EXD A;  1GUT A;  1H9M A;  1YHB A;  2FFK B;  2EVB A;  3C3L A;  4LF8 L;  4X3S A;  1FJG L;  4GN5 A;  2EDG A;  3H15 A;  1EY8 A;  2AMC B;  3URY A;  1TII D;  3KOJ A;  3CCM A;  5COY A;  3I72 A;  5JOB A;  2IWH A;  3CP0 A;  4BY7 H;  3J7A F;  4ZYS A;  4KMU C;  4JI7 Q;  1KDA A;  2QA4 A;  1KHI A;  3NUC A;  3QO2 A;  2A74 C;  3W1B A;  1HZA A;  1MKH A;  3H0G B;  4OWT B;  4LFC L;  1SYC A;  2KBN A;  4X64 L;  1IL8 A;  2F0L A;  1X65 A;  3KBX A;  3MZ5 A;  3VR4 A;  2IHE A;  5C3E B;  3VA5 A;  1FR3 A;  3FVQ A;  2K5N A;  5KRU A;  1KAB A;  3NTK A;  1S5D D;  2B29 A;  1TT2 A;  2JQO A;  5NUC A;  3NHH A;  1UE1 A;  3LWU A;  1KLG D;  2A8V A;  2F0S A;  3GTQ H;  2DNE A;  3KF6 A;  1WTO A;  5AJ3 Q;  4RAU C;  1EL0 A;  5T1I A;  3J81 E;  4QJF A;  4DV1 Q;  4X65 Q;  1F2M A;  1H9J A;  4P73 A;  1Z7T A;  1UEB A;  2LY7 A;  3S1R B;  2K5H A;  3F1Z A;  4CHT B;  1PZI D;  1X3F A;  1R9T B;  4XIG S;  1TY0 A;  3I91 A;  2NTT A;  1EIH A;  3K5O A;  2VUM G;  1YHA A;  4I7A A;  4HJ7 A;  1J8I A;  2RVL A;  2EPB A;  1PV4 A;  4DV4 L;  1MJE A;  3HGB A;  3VR6 A;  1PH6 A;  4HID A;  1BNZ A;  3GTL H;  2AUK A;  1EIF A;  1E24 A;  3F8T A;  1RD9 D;  4GKJ L;  3MAQ A;  3T1H L;  1HR0 Q;  4OGQ C;  2MGS A;  2E74 C;  4XT3 B;  4A3L H;  3TDQ A;  1G2S A;  2K14 A;  4B9W A;  2CQO A;  2MPM A;  1JWM D;  3JAM L;  4WRD A;  1EZ8 A;  2JA5 B;  4JV5 Q;  1X54 A;  5A35 A;  1JWU D;  1N32 L;  4KY7 A;  1HNX Q;  1KRT A;  4J6H A;  4HN7 A;  3L3O C;  5HUR A;  5A2Q L;  3S15 H;  3K58 A;  3S24 A;  4N8F A;  4GOP A;  1SNP A;  3JC6 6;  4KK7 A;  2ZM6 L;  2NVX H;  3NBI A;  3R2I A;  4ILW A;  2P5Z X;  4DAP A;  4C3H B;  1Y69 U;  4DV5 L;  3ERQ A;  1C7Y A;  2EJG C;  2IT1 A;  2UUB Q;  3K7A H;  2B2T A;  2A69 D;  4KJO A;  3RZD B;  3OPO A;  3MEH A;  4JYA L;  1SNO A;  2O2L D;  4GNX B;  2F4I A;  1L0X B;  4IFD I;  3I4N B;  1GUW A;  3F2B A;  1B8A A;  2FMM A;  4AH6 A;  4OXP A;  5JJL A;  5GRO A;  3Q24 A;  1QZG A;  4C56 C;  3J81 j;  2AWN A;  3S1Q H;  4YWM A;  2VB3 X;  2G5D A;  5ELD A;  4O1N A;  3UI2 A;  1IYU A;  4OO1 I;  4X66 Q;  1LTI D;  3TSS A;  3FRP B;  1KAA A;  2K32 A;  4YHH L;  5EKK A;  4A3I H;  2F0Q A;  3OTO Q;  4UP7 A;  3MWY W;  4PV1 C;  4FF1 A;  2A19 A;  3K8A A;  3FP9 A;  1HTL D;  1KIX A;  3UE1 A;  1J6Q A;  2B8F A;  2EYL A;  5AFW A;  4JC0 A;  2PZU A;  2JA7 H;  2DY8 A;  2F0G A;  1VDZ A;  1VQA A;  1N34 L;  3D4D A;  5BN4 A;  3NSW A;  4LAA A;  1RCV D;  2HHH Q;  3KYH C;  3PSI A;  1CTM A;  2XTI A;  4A93 B;  1QE6 A;  1F9S A;  4QUC A;  4QUF A;  4B08 A;  3H3V I;  1UNS A;  3SK6 A;  4IOC A;  1TWC H;  3KUP A;  1S4Z A;  3C2P A;  3NK9 A;  1FGU A;  5D65 A;  1HNZ Q;  1LTT D;  1KQS A;  5M3F B;  4L5S A;  3HOW H;  5IYD H;  1K73 C;  4IJH A;  4JCV E;  4IFD G;  4LMQ D;  1QCB D;  2MP1 A;  3R8B A;  2E2H H;  1H9S B;  2AUJ D;  1A0I A;  2WFW A;  2MO0 A;  4X62 L;  1VMC A;  3HOX G;  1HCZ A;  3T4A C;  2PNR C;  4JVZ A;  1O78 A;  2EE1 A;  3UDX A;  4LF4 Q;  4ZRZ A;  4KI0 A;  4OO1 G;  3NP8 A;  3DMU A;  2HQE A;  4UPA A;  2YU9 B;  1AEX A;  1IBM Q;  1U4L A;  4JI2 L;  1KD1 C;  5GAD C;  5IOD A;  1VQN A;  3C46 A;  5DM7 3;  3M4P A;  1Q8K A;  1VQ7 A;  1Q3L A;  5EAY A;  1LLR D;  1RDP D;  2R6G A;  1WTP A;  4IOA A;  4A3D H;  3E3X A;  5C3W A;  1E0B A;  1EIG A;  3GO5 A;  4DAM A;  1FL0 A;  1C48 A;  1HA5 A;  3BG3 A;  1V1P A;  2ZXO A;  1SYB A;  1ESF A;  4R4C A;  2JA8 H;  4L6T B;  2ICI A;  2K6A A;  3LX0 A;  3OHX C;  4DK1 A;  1STA A;  3QR8 A;  5K36 H;  2CW0 C;  2EYP A;  3DXJ C;  3SR1 A;  3MXG A;  1G6P A;  4FXK C;  4I7Z C;  3T1Y Q;  4K5X A;  2VQE Q;  1WI5 A;  2FHT A;  4CKE A;  3GTG H;  5EPK A;  4F87 A;  5ELN A;  5JJI A;  3CME A;  2F0J A;  5JEA H;  4HJ9 A;  3G7L A;  4A3E H;  4B3M L;  4IPH A;  2RDG A;  3D6W A;  4GLV B;  1EYD A;  3AFP A;  3OMG A;  2MUY A;  1G2T A;  2B3G A;  4R4O A;  3CRL C;  4N8X 1;  3A54 A;  2N78 A;  1XJV A;  2B63 H;  3W1G A;  1EQT A;  2R93 H;  2ICE C;  3S14 H;  4X3K A;  3GDE A;  4YY3 Q;  5CR3 A;  1BBU A;  1SE2 A;  4EX5 A;  3JAM E;  1PH3 A;  4B3R Q;  1KL9 A;  1X3G A;  4FF2 A;  3MXP A;  4A4I A;  2F1M A;  4A3B B;  4JBJ A;  2WIN B;  1A63 A;  4ZKB B;  1EY6 A;  4A3G G;  1QNK A;  3K80 C;  4JI1 L;  3GTM H;  2SDF A;  2K75 A;  4LUV A;  3PO2 B;  3Q8D A;  4R4T A;  2QCP X;  1NUC A;  4DR4 Q;  5E7N A;  4Y7N H;  1GOZ A;  1PYB A;  2F0N A;  4DFA A;  4IAL A;  5C3X A;  4DUZ Q;  3D0F A;  2M00 A;  2JA8 G;  1FVI A;  1BF4 A;  5T1G A;  1K28 A;  3H0G H;  1EWI A;  4EQP A;  1ILP A;  3PGZ A;  2K01 A;  2XGT A;  4B3S L;  5C3E H;  1SRO A;  1CT1 D;  2VNU D;  4CDE C;  4LF9 L;  2JEA I;  1EQR A;  4NXM L;  5JEA J;  3B6Y A;  1ENA A;  3PIO A;  2KEN A;  4ZQ3 A;  3J81 c;  4A3E G;  2ZTD A;  3U4Z A;  4BY7 B;  1GHJ A;  4EQN A;  3UDI A;  3HOU B;  3BZD B;  2LMC B;  1KC8 C;  1EUJ A;  3F2U A;  4DPG A;  1PZK D;  3S1R H;  2I5L X;  1O7Y A;  2L15 A;  1M4V A;  1Q81 C;  1E2W A;  2B63 G;  4XQN A;  2QGQ A;  1PLF A;  2B8G A;  3AB9 A;  4IUT A;  1I4X A;  3GQB A;  3OWF A;  1CZG A;  4GOP B;  1D1K A;  3KLW A;  2XNA C;  2R7Z H;  1SYG A;  3GTQ B;  1E22 A;  4XQJ A;  3M3Y H;  4HR7 B;  5JVG 3;  1K0R A;  4IUV A;  1WTW A;  1XTC D;  2UU9 Q;  4P71 A;  2G9H D;  1SJH D;  3IKJ A;  2K52 A;  2DN8 A;  5FJ8 H;  4NXN Q;  3KK7 A;  3HOV H;  4XTC S;  2KEC A;  2J4X A;  2A68 C;  2UXC L;  3S2H H;  4ID6 A;  1PVO A;  1TS3 A;  2VQF Q;  1IBL L;  1JIC A;  1JCK B;  1WOC A;  5D3D A;  2JA5 H;  3I4M B;  2FXQ A;  4O0A A;  2E2J B;  2EYH A;  1JOK A;  3AFQ A;  2RHS B;  1II3 A;  3GTL B;  5FO8 B;  3H0G G;  4J15 A;  2UUC Q;  2PPB C;  3I90 A;  1HTP A;  2K28 A;  1WTR A;  5C3E G;  1RTO A;  5LMU Q;  2EYO A;  2E2I H;  1LUZ A;  2F0K A;  1NCV A;  5EGT A;  2NVQ B;  4C3H H;  1FYC A;  4DK3 C;  3S16 H;  1DM0 B;  1QG7 A;  2UUA L;  3VYT A;  4RKB A;  2EYJ A;  1STB A;  3K0X A;  5IGE A;  2E5L L;  5IP7 H;  4K0K Q;  2BOS A;  1S5F D;  3OIP A;  3W3A A;  1EY7 A;  5ISR A;  2Z0S A;  1LTS D;  3PUZ A;  3H09 A;  1BXT A;  1S5B D;  2KQ3 A;  4MNO A;  4MN3 A;  2N88 A;  4WJ3 M;  5JAV A;  2QW7 A;  1M90 C;  1STH A;  2BE5 C;  1I6V C;  4GOP C;  1E1O A;  4DV6 Q;  1X3Q A;  5JJK A;  3V05 A;  4KKT A;  4DV7 Q;  3K7A B;  1CKO A;  2K5D A;  3RN5 A;  1P8L A;  2HT1 A;  1HQR D;  2L55 A;  1N33 L;  1VQ8 A;  4HAE A;  1IKL A;  1Q86 C;  3AEV A;  4DV3 L;  3TQY A;  1UUP A;  1TWF B;  2PCF B;  1V1O A;  2CW0 D;  3S1Q B;  1XX8 A;  1LAB A;  1TS5 A;  1DOM A;  4ME5 A;  4M1U B;  3M4O H;  4GN4 B;  1MGS A;  5KYI A;  1O7Z A;  2VXW A;  3PIP 3;  4A3I B;  3EBE A;  3PIP A;  4LJZ C;  1LT4 D;  5C0X G;  3KDF B;  1DON A;  3M4Y A;  3A74 A;  2JA7 B;  3IL8 A;  4PZ7 A;  5CYU A;  2CWA A;  1CM9 A;  2KUM A;  4C3H G;  2WKC A;  5J1Z A;  3DUZ A;  2HQL A;  1K0S A;  3IFT A;  1TS4 A;  2E75 C;  5CV6 A;  2Z4H A;  3PF4 A;  3SXH A;  4DV2 Q;  4BY1 H;  1EOV A;  2QDB A;  3NEL A;  3SK5 A;  3PV0 A;  2OF1 A;  1HZ9 A;  4Y52 H;  3I4N G;  2MJ8 A;  5GAH C;  2JE6 I;  2FJ2 A;  3MVV A;  1O7L A;  5IT9 c;  2JSO A;  4LUO A;  3QIA A;  1JQY D;  4RGT A;  1DOK A;  5IGD A;  3KJO A;  4QCL A;  2F3I A;  1YIT A;  4UDU C;  5LHY 1;  2RDF A;  1TWG B;  5IGG A;  3V2T A;  4G57 A;  2IX0 A;  1EU4 A;  3OYY A;  4C3I B;  1XMO Q;  3ICE A;  4KN4 C;  2NYZ D;  2V4D A;  3QOJ A;  3K59 A;  1IZ6 A;  4N9P A;  5BN5 A;  1WTV A;  2F0P A;  1A3T A;  1I94 L;  4JI4 L;  2KA7 A;  2F0M A;  1I50 B;  4LF5 Q;  4B3T Q;  1PMR A;  3PO3 H;  1A6X A;  4ZUJ A;  2MHV A;  4PMC A;  2EY5 A;  2JK8 A;  4A3D B;  1N9W A;  2MNA A;  4DR7 Q;  1EWC A;  1CA6 A;  3FKI B;  1JOO A;  2XWJ B;  4HIO A;  1WVL A;  1XPO A;  4A93 G;  1TKW B;  2O5I C;  1JWS D;  4KY5 A;  4RH6 A;  3E0E A;  4QL5 A;  1H9S A;  1U4M A;  1U5K A;  1D1I A;  4LNQ A;  5M3F G;  4K5W A;  5ELO A;  1EY0 A;  3ZYY X;  4AYB B;  4OON A;  3HOY H;  1K3B C;  1L0W A;  4BA1 I;  1Z47 A;  4LWC A;  4RKL A;  4FF4 A;  3E5S A;  1JB3 A;  1KDC A;  2M9V A;  1D2B A;  3BZK A;  3M9B A;  1HRJ A;  2PMZ B;  3RUZ A;  3A8I E;  4DR1 Q;  1OXV A;  3I55 A;  1CKM A;  4BBR H;  5LMN Q;  1AZQ A;  1M8A A;  2RHQ B;  3SDZ A;  3AU7 A;  3EFX D;  4MTN A;  3M4Q A;  3T16 A;  5GQO A;  1B70 B;  1K8O A;  4QY7 A;  2VY3 A;  5CV9 A;  3HEJ A;  3DEP A;  4HJ5 A;  4TQU S;  2R93 B;  1ASY A;  3OSO A;  3A5Z B;  3RD4 A;  2ZTE A;  3KLS X;  2ZJR A;  4LFB L;  4QQB X;  2A68 D;  5K5P A;  5I2Y A;  1KRS A;  4R4Q A;  4OWX B;  4BXX H;  2Z1C A;  3CC7 A;  2R61 A;  2ATW A;  3A55 A;  1RIP A;  3GTM B;  3D4W A;  5L37 A;  2IX3 A;  5HGT A;  3JAM i;  4GLA C;  4Y7N B;  3TS2 A;  1CHP D;  2JA6 B;  3EVQ A;  2NZ1 D;  1ZKO A;  2DGY A;  3P75 A;  2PQA B;  3HOU H;  1A15 A;  1BDO A;  3FMC A;  3VR5 A;  2WV6 D;  1TS2 A;  1CK1 A;  3HRZ C;  5IWA L;  1HUM A;  3EIV A;  1KNA A;  1V8Q A;  1HZC A;  2WP8 J;  2OEO A;  2DJG C;  4QB4 A;  2NBF A;  4L63 B;  3DWQ A;  4HED A;  2Q8T A;  1PH2 A;  1Y8N B;  1SMX A;  3CRK C;  1XNR L;  1RJT A;  5IY0 A;  3F2D A;  2BE5 D;  4A3B G;  5BR8 Q;  1J5E L;  1LT6 D;  1GUS A;  1H9R A;  3I3C A;  4A3M H;  5G3L F;  3TP5 A;  4C1N I;  3BU2 A;  1EEI D;  1N36 L;  4UY8 C;  1D5X C;  1CA5 A;  3PO2 G;  4CBV A;  2KCT A;  4LK1 C;  4JI5 Q;  1VQC A;  3E9H A;  2IL8 A;  3MC0 B;  2OQK A;  3HZX A;  1IBK Q;  5FKA C;  2R7Z B;  4KV6 A;  1CSQ A;  1NTG A;  1F9R A;  1EQV A;  4CKC A;  2E2J H;  1IL2 A;  3I4M H;  3M3Y B;  3A56 A;  1DXM A;  4DK6 C;  1F2L A;  4BBS H;  4H0L C;  2ZT9 C;  4JI3 Q;  4IUU A;  4PMW A;  1XYI A;  1XMQ L;  4LF6 L;  4OL7 A;  1C9O A;  2RCN A;  4AQY L;  1STN A;  3HOV B;  3I4O A;  4HSV A;  2HCC A;  2NVQ H;  2EQS A;  4KLK A;  3CD6 A;  3S2H B;  1TWA H;  4U67 3;  1V43 A;  1A2U A;  4BY7 G;  3AYH B;  3HOU G;  3MXN B;  1QIL A;  1QOH A;  3A8K E;  5F2D A;  5FLX L;  2KCM A;  4PNY A;  2XSC A;  3MXU A;  1X6O A;  3R3O A;  5C4J H;  3OW2 A;  1MI2 A;  2YV5 A;  1OXU A;  3RLO A;  1BO0 A;  4RHS A;  3BS1 A;  2WB1 B;  2E2I B;  3HKS A;  3S16 B;  2I5H A;  4DV0 L;  1XNQ Q;  1VQI A;  4X3T A;  3AMU A;  1IW7 D;  4JI6 L;  3J7Y W;  1V9P A;  4DAY B;  2D0O A;  2ALY B;  4JI0 L;  4EGV A;  4OX9 Q;  1HQM C;  1TWF H;  1STE A;  3J7A 5;  1Y8O B;  4KHP L;  1PRT B;  4V19 0;  5ELC A;  5FOB B;  1VQ5 A;  2B2Y C;  1UEA B;  2X6G A;  3I4M G;  1PFB A;  2YYZ A;  2NB0 A;  1ML0 D;  5IIF A;  1MJC A;  1YBY A;  3CW2 C;  1PYS B;  3FDT A;  1TXY A;  3IRB A;  2UXD Q;  3J80 E;  1GD7 A;  4A3L G;  2R7F A;  4ZKC B;  3TRE A;  2AKW B;  1T5X D;  4KD4 A;  3OW7 A;  4H02 A;  2TSS A;  3ERS X;  1PRT F;  3M4O B;  1Q8I A;  2J0T D;  3HS0 C;  1RF2 D;  1B44 D;  3PQI A;  3CMA A;  1IHZ A;  4LFA L;  2YTV A;  1I3Q B;  1CSP A;  1BKB A;  2K03 A;  2F4V L;  2IY5 B;  4GN3 B;  3N52 A;  1I4G A;  4OWW B;  1YVC A;  2WAQ B;  3TEH B;  1JMC A;  1XXG A;  4WFN 3;  3KFU A;  2QEX A;  2UXB Q;  1TWG H;  4DUY L;  3RN2 A;  2BH8 A;  1CI3 M;  4C3I H;  2D5D A;  1WYD A;  4QGU A;  2X6L A;  4BY1 B;  2SNS A;  1HH2 P;  5GAE C;  4AIM A;  2R92 H;  3D6C A;  4GZY C;  1KXL A;  5IGC A;  2B2W C;  1ONL A;  1I50 H;  2HD3 A;  4JBK A;  3ER0 A;  3CU7 A;  2F0F A;  1NJI C;  1JR0 D;  5I9O A;  1SND A;  4EQO A;  1PRT C;  5DM6 3;  3STB C;  5CBA E;  3FKI H;  4CJ2 C;  1VMP A;  4FVM A;  2NN6 H;  1ICW A;  1U0L A;  3KDF A;  1C8C A;  2HCI A;  4AYB E;  4A3I G;  1WTQ A;  4CDF C;  4JI8 Q;  2K5V A;  3AQQ A;  5CMD A;  3OOC A;  5JVH 3;  3PF5 A;  2JA7 G;  3PO3 B;  3U9O A;  4RCO A;  1D5M C;  4DR6 L;  2PMZ E;  1A62 A;  1HA6 A;  4J8Q A;  4IQZ A;  2ZTC A;  3RZO B;  2BDO A;  1Z6H A;  1VQG A;  1ENC A;  4H7B A;  1N8R C;  4J1M A;  4DR2 L;  1U9R A;  3UDG A;  3TZU A;  1ZYR D;  3TS0 A;  4DR5 L;  3HOW G;  3A7A B;  5IYD G;  2NVT H;  4LF7 L;  4DXG A;  2EIF A;  4DR3 L;  4HIM A;  4LF8 Q;  3HOY B;  1FJG Q;  1BQQ T;  4GKK L;  2GN5 A;  4JK1 C;  4C3I G;  3HKZ B;  1SYE A;  1SNM A;  4ZCK A;  1PYW D;  1F2Y A;  2AQ3 B;  4A3J H;  1W3S A;  1STG A;  1QVC A;  2AWO A;  4BBR B;  5A2Q E;  2RA4 A;  5DNF A;  1HNW L;  5LL6 X;  4LFC Q;  3CXC A;  4NMZ A;  1D7Q A;  3KLR A;  1NMG A;  4KKU A;  1DOL A;  1A8V A;  3VYS A;  4X64 Q;  4QIW B;  4P74 A;  4A3D G;  3TP7 A;  2Z4I A;  3BZC A;  3ULP A;  1SNQ A;  3FKI G;  2JA6 H;  4NKL A;  4MHE A;  4OIJ A;  3HFZ B;  1E2V A;  1PH5 A;  3K7U C;  5CC4 A;  2XWB B;  4QF4 A;  1QUQ A;  2SEB D;  4FYD A;  4ZAI A;  5K36 G;  3DWP A;  2ENB A;  3VR3 A;  4CDC C;  1MIU A;  3I4L A;  4AYB G;  4NB3 A;  5G3L D;  3PMF A;  4FXD A;  5IGF A;  1C0A A;  1GVP A;  4C3J B;  1EYC A;  1PHJ A;  3PIO 3;  4R1J A;  2R3Z A;  1H95 A;  5JEA G;  5M3M B;  3OMC A;  2EZV A;  2C5C A;  2F0I A;  1X9N A;  3PCO B;  4RA8 A;  2X69 A;  4TKO B;  4TSS A;  3P1H A;  2PYK A;  2C9O A;  3E9I A;  4JOI C;  4DV4 Q;  1LO5 D;  2A1A A;  2I0Q A;  5C6A A;  4XQQ A;  2VS1 A;  2LFN A;  4GKJ Q;  3T1H Q;  2CFM A;  4K8J A;  2ZJP A;  4A76 A;  5M5Y H;  2R93 G;  3SGI A;  2CH4 A;  2NTS A;  2LKV A;  1U4P A;  1B3Q A;  2ID0 A;  2K05 A;  3J7A V;  4BWG B;  3TP6 A;  5I6Y A;  1MHW C;  1SE3 A;  3UDF A;  1UE7 A;  1PH7 A;  3Q22 A;  4C2M B;  2VB2 X;  1N32 Q;  1FNU A;  3CCS A;  3ONA B;  2O4X A;  4A3M B;  3S2D B;  1EY9 A;  2RDH A;  4IUP A;  1I4R A;  3S1M B;  1SFO H;  2KOL A;  2PQA A;  2Q2I A;  2RBM A;  3BYY B;  2ZM6 Q;  4V0B A;  3KJP A;  2JA6 G;  3I73 A;  4GLX A;  2PQE A;  4NP5 A;  4G7Z C;  2D2C C;  4DV5 Q;  4JI7 L;  3M7G A;  1ZEQ X;  5IOC A;  4BBS B;  1SAP A;  3Q6S A;  4MIU A;  4RGO S;  3RLN A;  1BCP B;  1VQ6 A;  2PNH A;  5IYB H;  4FO2 A;  1EY5 A;  4JBM A;  1SEB D;  1YNJ C;  4JYA Q;  4FDB A;  3X3M A;  3DWA A;  3HG9 A;  2EOT A;  1AZP A;  5EPJ A;  3GTO B;  5KNB A;  2BA1 A;  3K5L A;  1O80 A;  2KCC A;  1F9Q A;  4FXG C;  5AJ3 L;  1K83 H;  1TWA B;  2OTL A;  2C35 B;  4DV1 L;  1N36 Q;  4X65 L;  2QKI C;  2PO4 A;  4YHH Q;  5E4X A;  1T9H A;  3Q23 A;  2AHO B;  1YZ6 A;  1LAC A;  1S72 A;  1BCP F;  1CQV A;  1GJX A;  2F0D A;  5C4J B;  2L5T A;  2B2Y A;  1DCZ A;  4EVO A;  1SN8 A;  2M2L A;  2F0H A;  1VQF A;  1N34 Q;  3E6Z X;  1R4Q B;  4DXF A;  3RLF A;  1EFW A;  4A3K H;  1K3R A;  4JBW A;  3QWN A;  2R7Z G;  1JJC B;  1BBW A;  1PRT D;  3OIQ A;  4IUQ A;  3STB D;  4DU9 A;  2NUC A;  1LYL A;  3J80 c;  3NWS A;  1HR0 L;  4TRD A;  1GUN A;  1WTH A;  2XIW A;  4FNF A;  4RGM A;  2Q2U A;  5FJ8 G;  1AH9 A;  1G51 A;  4RMF A;  1CHQ D;  3G71 A;  3WWV A;  3HOV G;  1ROD A;  3MXN A;  3HOX B;  3QOL A;  2Z6K C;  4HIK A;  1EWH A;  4JV5 L;  1QZH A;  4X62 Q;  1HFG A;  3ULJ A;  3UE0 A;  2KJX A;  1O7I A;  4BS9 A;  2ZXR A;  1HNX L;  2WAQ E;  5IYC H;  2JA5 G;  1I3Q H;  2YTY A;  1NR4 A;  3NEM A;  1WFQ A;  4K2L A;  2VZA A;  1BCP C;  4UAI A;  4DF7 A;  5I6W A;  5M5W B;  4JI2 Q;  4WJW A;  1F9P A;  1SJE D;  5IP9 H;  5C44 B;  1EEF D;  3SK8 A;  1A3V A;  1I6H H;  1NE3 A;  2WB1 G;  1JJ2 A;  2UUB L;  3M85 A;  5C4X H;  4L5R C;  2Q2H A;  4NW2 A;  4DAY A;  3F2C A;  1ESR A;  2B2W A;  5C4H A;  3OWE B;  3WDN A;  3J81 L;  5IP7 G;  1XPR A;  4ALP A;  3J80 i;  1A3U A;  4G7O C;  5J39 A;  1Y14 B;  3K57 A;  5D3I B;  1Y1W B;  2PI2 A;  3L9A X;  3BDO A;  1JB7 A;  1WCM B;  4PMB A;  4X66 L;  5HGQ A;  3NQI A;  2PW7 A;  4NDX A;  2ASB A;  1LM0 A;  2KCN A;  4ZK9 B;  1IW7 C;  3T56 B;  2PZW A;  3OTO L;  5EKL A;  1YIJ A;  3Q0A A;  4RG1 A;  2A5H A;  3K6O A;  3PUW A;  4XYO A;  4B3M Q;  1PTO H;  2R92 B;  1S5E D;  3CAM A;  1Q12 A;  1BUV T;  1CUK A;  2HIX A;  4PZ8 A;  1EYG A;  2IX1 A;  1ET6 A;  1PTO D;  2HHH L;  3HOZ B;  4LUZ A;  2JA9 A;  3CCE A;  1SRU A;  3S1N H;  1I4P A;  2LS0 1;  4XYQ A;  3RZO H;  3NTI A;  4WJ4 A;  1WTX A;  5JPM C;  2K7V A;  1SE8 A;  1SYD A;  3BVM A;  4IN3 A;  2RKS A;  4RFB A;  1HNZ L;  1VQD A;  3P20 A;  3N6R A;  3NTH A;  4N9T A;  1PFN A;  1B4O A;  1SDF A;  3QG1 A;  4JI1 Q;  1HJP A;  2WAQ G;  4M8A A;  1EY4 A;  3JAM c;  1QUQ B;  4LW1 A;  1YHQ A;  3EJI A;  4LF4 L;  1Q82 C;  3KLS A;  1TQO A;  2OQ0 A;  1QB5 D;  3TME A;  2OTJ A;  1IBM L;  1HXY D;  2L12 A;  4BY1 G;  5ELE A;  4IJL A;  5I9P A;  1OTC A;  4HMI A;  4KJN A;  2L9H A;  3GTJ H;  2NVT B;  1DZ1 A;  1HFN A;  4B3S Q;  5C4Z A;  1OXT A;  2MQH A;  3TN2 A;  3FHW A;  2SOB A;  3SE0 A;  3GTP B;  4LF9 Q;  1CFM A;  3QJY A;  5ELF A;  4NXM Q;  1YI2 A;  2OWO A;  3H6M A;  4I65 A;  1FD7 D;  1EOT A;  3E0J A;  4A3J B;  1I5F A;  2EY6 A;  3TP8 A;  2F3W A;  1ICF B;  1VQK A;  3T1Y L;  3G4S A;  2VQE L;  3PO3 G;  3CPW A;  4E6I A;  3T51 B;  3U4V A;  3H94 A;  1U4R A;  2I5M X;  2JP1 A;  4C3J H;  1YNJ D;  3MA2 B;  4KN7 C;  3BDC A;  4OIK A;  2GA4 B;  2H4O A;  4JOI A;  5M3M H;  1NNX A;  2VL6 A;  1D8L A;  2ZXP A;  2AQ1 B;  1YNN C;  4CGY B;  2HDM A;  2CWP A;  3BDL A;  1EQQ A;  3NQT A;  4TVA B;  2KED A;  2BH2 A;  2LXJ A;  1R4P B;  1VQH A;  1GO3 E;  2OCE A;  3DEO A;  2A6H C;  1EZ6 A;  4YY3 L;  5J22 A;  3HOY G;  3VYR A;  4B3R L;  2QDL A;  4KTA A;  1X3P A;  1HPC A;  1ZYR C;  5EBC A;  3PUY A;  1CQF A;  2F3V A;  3HKZ G;  2UXC Q;  4PZ6 A;  2OT2 A;  2Q8R E;  2F0O A;  3CC4 A;  1IBL Q;  4UP9 A;  1QJO A;  3ND8 A;  4BBR G;  4XXE A;  1TU2 B;  4C2M H;  3GD7 A;  3M7N A;  2AQ2 B;  3ERO A;  1CKN B;  3S2D H;  1ASZ A;  1D5Z C;  4DR4 L;  1HR0 W;  5EPL A;  2EY1 A;  3S1M H;  2RCF A;  5EBD A;  4R8I A;  5C5L A;  1RL2 A;  5IT9 L;  5M5Y B;  1M1K C;  4DUZ L;  3K0Y A;  2F03 A;  2A73 B;  1SE4 A;  1QVF A;  2Y0S B;  4K6L A;  3G48 A;  3CCQ A;  1PFS A;  1W6J A;  2UUA Q;  1Q1B A;  5TSS A;  3DLL A;  2QEJ C;  4BXX G;  2E5L Q;  1SR3 A;  1B7Y B;  1MSH A;  1PFM A;  1S5C D;  2IJ0 A;  1GUG A;  4YCW A;  1BCP D;  1VQE A;  3S9W A;  1SFO B;  3K81 C;  3GTO H;  4PQX A;  1C4Q A;  4C3J G;  4DGZ A;  2B2V C;  2KEE A;  4F7X A;  4MTK A;  4IZ8 A;  1L0Y B;  5M3M G;  2NZH A;  3DHQ A;  4XDX A;  4RWS C;  3CCL A;  1IYV A;  4RHR A;  1BBX C;  1WD0 A;  1BR9 A;  1N33 Q;  3FEW X;  1LV9 A;  2L11 A;  5M5X B;  2CCZ A;  4L8J A;  1PA6 A;  4DV3 Q;  2D62 A;  1NR2 A;  3QB3 A;  3W5O A;  1K83 B;  3D3R A;  1WJJ A;  1ZXT A;  2DJF C;  4QMG A;  2UU9 L;  1JOQ A;  2QIL A;  1SXT A;  1W6K A;  2RQX A;  1WD1 A;  3G6J B;  4IUN A;  3GV6 A;  4NXN L;  1G91 A;  2F0W A;  5FO7 B;  2HIV A;  2Z6K A;  4A3M G;  4IFD H;  2L1B A;  1FNW A;  1MD2 D;  3MEF A;  1YNX A;  2L0C A;  5JJZ A;  1K9M C;  1QWY A;  3HOX H;  3EQL C;  2VQF L;  2MFI A;  5J3B A;  4A3K B;  1B9M A;  4OO1 H;  5LL6 S;  4JG2 A;  2K50 A;  4U68 A;  1HUN A;  3A0J A;  1KNE A;  1G29 1;  4H13 C;  4IPC A;  2UUC L;  4BBS G;  4XT1 B;  3SHL A;  5LMU L;  2D0P A;  1JJG A;  4DA2 A;  3R2T A;  4POF A;  5M5W H;  1RTN A;  3I2Z A;  5C44 H;  4OEM B;  1S40 A;  2KHS A;  3V96 A;  3X3N A;  1OXX K;  4HMJ A;  4DNI A;  4Q5V A;  1H9K A;  1ENF A;  1PZJ D;  3A8J E;  1X3E A;  3T13 A;  3W2D A;  1Q7Y C;  4K0K L;  4R8N A;  4ZUI A;  4Q0F A;  4L5T A;  3H3V H;  5C5M A;  4BA2 I;  4DNR B;  4L5Q A;  2SNM A;  1DD2 A;  3CF5 A;  4A3F B;  1I94 Q;  4JI4 Q;  1TWH B;  3CQZ H;  1Y1W H;  5CBE E;  1SBB B;  1I6H B;  1SNC A;  1WCM H;  4DV6 L;  1BVS A;  2B39 A;  1OO9 B;  3LWE A;  4DV7 L;  4KD3 A;  5C4X B;  3KF8 B;  1E1T A;  4K6D A;  3VR2 A;  4A3C H;  2LXK A;  1NAP A;  1TVX A;  1KAW A;  3KBG A;  4IFD J;  3CKI B;  1MBY A;  1L2F A;  3NWT A;  1AFP A;  3HOZ H;  4HCE A;  1IXR A;  1K8M A;  1X32 A;  3TBI B;  3A7L A;  1HZB A;  2FIN B;  1VQO A;  2L4N A;  2IPK D;  2NVY H;  4F88 A;  1D6E C;  1L1O B;  1Y1V B;  5H1S E;  1PTO B;  4GNX C;  2G9D A;  1K8A C;  4A3G H;  4RGN A;  2DNC A;  1YNN D;  5CV4 A;  2B2U C;  2F0V A;  4FP5 D;  3WOE A;  3C1F A;  1AN8 A;  5C44 G;  1LTB D;  2J7Z A;  5IT9 E;  1B53 A;  4MZ9 A;  1PXU A;  2WAC A;  1VQL A;  2NWG A;  3S1N B;  1EYA A;  4K8I A;  1PH9 A;  1VQ4 A;  2A6H D;  2EY2 A;  2NN6 I;  3MHB A;  3MFY A;  4DV2 L;  5FLM H;  3K5N A;  1DYQ A;  1JOR A;  2IW3 A;  4CJ0 B;  2JYO A;  1DGS A;  2CHB D;  1FGB D;  1NBW A;  4ME3 A;  5DAU A;  2CVR A;  4LFB Q;  3MTS A;  4IPG A;  4P72 A;  5E4W C;  4DAV A;  1PH8 A;  3CCU A;  1GKH A;  1PTO F;  2R7D A;  1AE3 A;  3VA7 A;  1UAP A;  1GHK A;  3NEN A;  4ODG A;  4GS3 A;  5KND A;  3NBH B;  2EJF C;  5ELB A;  1Y1W G;  1WCM G;  5E1F A;  5KEE A;  1XMO L;  3GTP H;  2O5J C;  3SEB A;  1S3O A;  2ES2 A;  2EYF A;  2JJQ A;  1KTK A;  2XVS A;  1QVG A;  4A3C G;  3GTK B;  1TR5 A;  5JPN C;  1KLU D;  1GM5 A;  2HUG A;  3BYT B;  5FLX E;  2R92 G;  4LF5 L;  4B3T L;  3MFG A;  2IHF A;  2EXZ A;  1VQM A;  3VDY A;  3EA6 A;  4POG A;  3GTJ B;  2E2D C;  2KHJ A;  4DR7 L;  3FPP A;  3HOZ G;  2DY7 A;  4O2D A;  1T5E A;  5IWA Q;  3FPU B;  1RHP A;  4K14 A;  1E3P A;  2RSO A;  4EQ5 A;  3CC2 A;  1I4H A;  2NN6 G;  2F52 A;  3C1E A;  2CH4 W;  1L1O C;  3DM1 A;  3RNU A;  2EJM A;  5KIX A;  1PTO C;  1XWE A;  1XNR Q;  1V1Q A;  3ULL A;  1B50 A;  4UP8 A;  1J5E Q;  3NXW A;  3KF6 B;  3PUX A;  1KDB A;  2WKD A;  4KY6 A;  3NPP A;  4X3U A;  3D31 A;  2TMP A;  1I4Q A;  4RCN A;  4KHV A;  4HSP A;  4ULL A;  1AW7 A;  4R9W A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  1UWV A;  4JC0 A;  4IPD A;  5FLM G;  4JI2 Q;  2JA7 H;  2DGY A;  4DR1 L;  5IP9 H;  4IO9 A;  1VQA A;  2PQA B;  5LMN L;  1N34 L;  4YWL A;  3HOU H;  1I6H H;  2HHH Q;  1NE3 A;  2WB1 G;  1JJ2 A;  3KYH C;  3PSI A;  2UUB L;  3M85 A;  5C4X H;  4L5R C;  2Q2H A;  2XTI A;  1JT8 A;  3CCJ A;  1NY4 A;  3F2C A;  2Y0S E;  5IWA L;  1W2B A;  4IOC A;  1XMQ Q;  4LF6 Q;  3H3V I;  1TWC H;  3EIV A;  4AQY Q;  1HZC A;  5IP7 G;  2WP8 J;  1FGU A;  1XPR A;  4ALP A;  1HNZ Q;  1KQS A;  4L5S A;  3J80 i;  3HOW H;  1YEZ A;  1K73 C;  1Y14 B;  4IJH A;  4JCV E;  1PH2 A;  1PH4 A;  5IYD H;  4IFD G;  1SMX A;  2JEB I;  1XNR L;  2E2H H;  5IY0 A;  2PI2 A;  3F2D A;  1VQ9 A;  4A3B G;  1A0I A;  2WFW A;  5BR8 Q;  4A3J G;  1J5E L;  1JB7 A;  2MO0 A;  4X66 L;  3NEM A;  5HGQ A;  4X62 L;  2ASB A;  3HOX G;  1LM0 A;  4A3M H;  3UDX A;  1YJW A;  3OTO L;  4LF4 Q;  5GAG C;  4KI0 A;  4OO1 G;  1YIJ A;  1IYJ B;  1R9T H;  3BU2 A;  4RG1 A;  1Q1E A;  3PUW A;  5HY6 A;  1N36 L;  1NMF A;  4UPA A;  4UY8 C;  3PO2 G;  4B3M Q;  1IBM Q;  2KCT A;  4JI5 Q;  1VQC A;  3E9H A;  4JI2 L;  1KD1 C;  5GAD C;  3CAM A;  1Q12 A;  1VQN A;  1CUK A;  2HIX A;  1VS0 A;  2OQK A;  1IBK Q;  3M4P A;  1Q8K A;  4PZ8 A;  1EYG A;  1VQ7 A;  2IX1 A;  2HHH L;  1CSQ A;  1NTG A;  1SLJ A;  2E2J H;  5EAY A;  4DV0 Q;  1IL2 A;  3I4M H;  2R6G A;  4LUZ A;  2JA9 A;  4DK6 C;  4IOA A;  4A3D H;  3CCE A;  1SRU A;  3S1N H;  3U50 C;  4BBS H;  1P16 A;  1VCI A;  2N8N A;  2WB1 E;  4JI3 Q;  3RZO H;  4WJ4 A;  3GO5 A;  3RR5 A;  1FL0 A;  4PMW A;  4DAM A;  1E7Z A;  4JI6 Q;  1XMQ L;  4LF6 L;  1C9O A;  1SE8 A;  2RCN A;  4AQY L;  4R4C A;  1HNZ L;  2JA8 H;  1VQD A;  3I4O A;  5M5X H;  4JI0 Q;  2NVQ H;  2EQS A;  4KLK A;  3CD6 A;  3CCR A;  3BJU A;  2GVA A;  1TWA H;  4KHP Q;  1V43 A;  5BR8 L;  1CKN A;  3J81 i;  4JI1 Q;  4HJA A;  4BY7 G;  2N49 A;  1HJP A;  2WAQ G;  3AYH B;  1G6P A;  3HOU G;  3T1Y Q;  3MXN B;  3JAM c;  1QUQ B;  2VQE Q;  1WI5 A;  4LW1 A;  3GTG H;  1YHQ A;  4LF4 L;  5ELN A;  5JJI A;  3CME A;  1Q82 C;  2KCM A;  3A5U A;  1EIY B;  4HJ9 A;  3I56 A;  2OQ0 A;  4A3E H;  1X6O A;  3I7F A;  5C4J H;  1IBM L;  4B3M L;  2OTJ A;  4IPH A;  4JI5 L;  3OW2 A;  2YV5 A;  4GLV B;  2PI2 E;  1OXU A;  3EN2 A;  4BY1 G;  3RLO A;  3AFP A;  1IBK L;  2B3G A;  4IJL A;  4R4O A;  1OTC A;  3HKS A;  2I5H A;  4DV0 L;  3GTJ H;  2Y0S G;  3DM3 A;  1VQI A;  1XNQ Q;  2N78 A;  1XJV A;  2B63 H;  3RZD H;  4JI3 L;  3W1G A;  4B3S Q;  4JI6 L;  5C0X I;  1OXT A;  2MQH A;  3S14 H;  3FHW A;  4HJ8 A;  3GDE A;  4YY3 Q;  2V1C C;  2R93 H;  2MO1 A;  4LFA Q;  4LF9 Q;  1V9P A;  3L0O A;  4DAY B;  1BBU A;  2D0O A;  4EX5 A;  1PH3 A;  3I4N H;  4B3R Q;  1KL9 A;  2ALY B;  2K4K A;  4NXM Q;  1X3G A;  1YI2 A;  1PH1 A;  4A4I A;  2OWO A;  3U58 A;  4JI0 L;  2F4V Q;  4OX9 Q;  1AE2 A;  4JBJ A;  1TWF H;  3J7A 5;  1LTL A;  1I5F A;  1A63 A;  4KHP L;  2ZJQ A;  4A3G G;  3K80 C;  4JI1 L;  1VQK A;  1VQ5 A;  3GTM H;  1Q46 A;  3T1Y L;  2VW9 A;  2K75 A;  3G4S A;  2VQE L;  4DUY Q;  4LUV A;  3ZJY C;  3CPW A;  3U4V A;  3I4M G;  3PO3 G;  2YYZ A;  2I5M X;  3Q8D A;  4R4T A;  4DR4 Q;  1MJC A;  1YBY A;  3CW2 C;  5E7N A;  4C3J H;  1PYS B;  4Y7N H;  1PYB A;  4X6A H;  5IYB G;  1TXY A;  3IRB A;  4JOI A;  5M3M H;  4DUZ Q;  2UXD Q;  3D0F A;  4A3F H;  1K8G A;  2VL6 A;  1D8L A;  1GD7 A;  1TWH H;  4A3L G;  2R7F A;  4DKA C;  1FVI A;  4PG3 A;  3TRE A;  2JA8 G;  1UE6 A;  2AKW B;  2CWP A;  4YCV A;  1EQQ A;  4H02 A;  3H0G H;  1EWI A;  2NZO A;  4TVA B;  3ERS X;  2LXJ A;  3PGZ A;  1XNQ L;  2XGT A;  1VQH A;  4B3S L;  2BH2 A;  4A93 H;  1GO3 E;  2OCE A;  5C3E H;  1SRO A;  2VNU D;  3CMA A;  4YY3 L;  4LFA L;  4LF9 L;  2JEA I;  1EQR A;  2YTV A;  3HOY G;  5C0X J;  4B3R L;  2KHI A;  1CSP A;  4NXM L;  5JEA J;  3B6Y A;  1BKB A;  5M3F H;  2F4V L;  3PIO A;  2KEN A;  2IY5 B;  4OX9 L;  3J81 c;  3PUY A;  2ZTD A;  4GN3 B;  4A3E G;  3U4Z A;  3HKZ G;  2UXC Q;  2DUD A;  4OWW B;  1YVC A;  4PZ6 A;  3CC4 A;  3TEH B;  3UDI A;  1JMC A;  1Z9F A;  1IBL Q;  4UP9 A;  1KC8 C;  3FP9 A;  5IE8 A;  3KFU A;  4BBR G;  1EUJ A;  2QEX A;  4R4I A;  4DR6 Q;  1TWG H;  4C2M H;  4DUY L;  3RN2 A;  3GD7 A;  3M7N A;  2UXB Q;  4GNX A;  4KHZ A;  4DPG A;  1CKN B;  2BH8 A;  3S1R H;  4A3K G;  1JE5 A;  2I5L X;  1ASZ A;  2L15 A;  4C3I H;  1Q81 C;  2E8G A;  3S2D H;  1WYD A;  2YTX A;  4QGU A;  1HR0 W;  2B63 G;  4DR4 L;  2QGQ A;  3S1M H;  1HH2 P;  5GAE C;  4AIM A;  1Y1V H;  2YU9 H;  1RL2 A;  2R92 H;  4DR2 Q;  1M1K C;  4NPS A;  1KXL A;  2UXD L;  4DUZ L;  3TRZ A;  1VQB A;  1OXS C;  4A75 A;  4GOP B;  1QVF A;  1I50 H;  3KLW A;  3CPF A;  3L7Z C;  4JBK A;  2R7Z H;  3ER0 A;  1E22 A;  3G48 A;  3CCQ A;  4DR5 Q;  1PFS A;  1NJI C;  3M3Y H;  1VQP A;  2UUA Q;  4LF7 Q;  1Q1B A;  1K0R A;  3DLL A;  3STB C;  2Q2T A;  4DR3 Q;  4BXX G;  3FKI H;  2UU9 Q;  2E5L Q;  4YCU A;  4P71 A;  1SR3 A;  1B7Y B;  1U0L A;  2GVB A;  2K52 A;  3KDF A;  5FJ8 H;  4GKK Q;  1VQJ A;  4AYB E;  3CCV A;  4NXN Q;  4YCW A;  4YWK A;  1VQE A;  4A3I G;  5IYC G;  4JI8 Q;  3K81 C;  2K5V A;  3AQQ A;  4XTC S;  2H5X A;  3HOV H;  3GTO H;  1YJN A;  2UXC L;  3J7Z C;  5LMN W;  3S2H H;  3PF5 A;  1PVO A;  5M3M G;  2VQF Q;  1IBL L;  3LGJ A;  2NZH A;  4A3F G;  2JA7 G;  5IP9 G;  1WOC A;  1UE5 A;  3HKZ E;  2JA5 H;  2FXQ A;  4O0A A;  4DR6 L;  2PMZ E;  1A62 A;  3AFQ A;  3CCL A;  1HNW Q;  2UXB L;  2RHS B;  2ZTC A;  5C4X G;  3H0G G;  4J15 A;  2UUC Q;  1VQG A;  5DLQ E;  2N3S A;  1N8R C;  5C3E G;  1N33 Q;  5LMU Q;  5FLX c;  4DR2 L;  3UDG A;  3GTK H;  2BA0 A;  2CCZ A;  4P75 A;  1LUZ A;  4QIW E;  3TS0 A;  2E2I H;  1PA6 A;  4C3H H;  4DV3 Q;  4DK3 C;  2D62 A;  3S16 H;  4DR5 L;  3HOW G;  3W5O A;  5IYD G;  2NVT H;  2UUA L;  4LF7 L;  1WJJ A;  2EIF A;  4APV A;  4DR3 L;  3K0X A;  1X56 A;  4HIM A;  2UU9 L;  2E5L L;  1YJ9 A;  5IP7 H;  1L1O A;  4LF8 Q;  4K0K Q;  1FJG Q;  2RF4 A;  4GKK L;  2GN5 A;  4NXN L;  2Z0S A;  2Z6K A;  2HIV A;  4A3M G;  4JI8 L;  3PUZ A;  3PUV A;  4MNO A;  4WJ3 M;  4A3B H;  3MEF A;  4A3J H;  1YNX A;  1Y1V G;  1W3S A;  2CKZ B;  1QVC A;  2AWO A;  1M90 C;  1K9M C;  2VQF L;  3HOX H;  3G6E A;  4GOP C;  1E1O A;  2MFI A;  5J3B A;  3L2P A;  4DV6 Q;  1HNW L;  5JJK A;  4DV7 Q;  4LFC Q;  3CXC A;  1D7Q A;  4JG2 A;  1CKO A;  1NMG A;  2K50 A;  1A8V A;  3A0J A;  4X64 Q;  3PO2 H;  1G29 1;  1P8L A;  4IPC A;  4P74 A;  3RN5 A;  2UUC L;  2HT1 A;  4BBS G;  3BZC A;  1XTD A;  4A3D G;  3ULP A;  1N33 L;  5LMU L;  2VUM H;  3FKI G;  1VQ8 A;  2D0P A;  2JA6 H;  1JJG A;  4POF A;  3HFZ B;  5M5W H;  1X55 A;  3I2Z A;  3S17 H;  1PH5 A;  3K7U C;  5C44 H;  1Q86 C;  1XPU A;  3AEV A;  4DV3 L;  2LSS A;  3TQY A;  1S40 A;  2EXD A;  1QUQ A;  1OXX K;  1YHB A;  4DNI A;  3M4O H;  5K36 G;  4GN4 B;  4LF8 L;  1MIU A;  4AYB G;  1X3E A;  4NB3 A;  1Q7Y C;  1FJG L;  4GN5 A;  4K0K L;  3H15 A;  3EBE A;  3PIP A;  2AMC B;  1C0A A;  4L5T A;  3H3V H;  1GVP A;  4BA2 I;  3KOJ A;  1PHJ A;  4L5Q A;  3CCM A;  4R1J A;  5C0X G;  3CF5 A;  3KDF B;  1H95 A;  5JEA G;  3A74 A;  1I94 Q;  3CP0 A;  4JI4 Q;  4BY7 H;  4PZ7 A;  2CWA A;  3CQZ H;  1Y1W H;  1X9N A;  1WCM H;  3PCO B;  1BVS A;  4DV6 L;  4JI7 Q;  2QA4 A;  1KHI A;  3W1B A;  1HZA A;  1MKH A;  4JOI C;  3E9I A;  4OWT B;  2HQL A;  4LFC L;  4DV7 L;  4DV4 Q;  3KF8 B;  2KBN A;  2A1A A;  4X64 L;  2I0Q A;  1X65 A;  1E1T A;  2IHE A;  3PF4 A;  4A3C H;  2LXK A;  2VS1 A;  4DV2 Q;  4BY1 H;  4GKJ Q;  1EOV A;  3T1H Q;  2K5N A;  2CFM A;  3NEL A;  2ZJP A;  4A76 A;  5M5Y H;  2R93 G;  1KAW A;  3SGI A;  3PV0 A;  1HZ9 A;  2B29 A;  4IFD J;  4Y52 H;  2JQO A;  3I4N G;  5GAH C;  2JE6 I;  1UE1 A;  5IT9 c;  2ID0 A;  2A8V A;  1L2F A;  4LUO A;  3GTQ H;  3KF6 A;  5AJ3 Q;  3HOZ H;  3KJO A;  2F3I A;  3UDF A;  4QJF A;  1YIT A;  1UE7 A;  1PH7 A;  4DV1 Q;  4X65 Q;  1IXR A;  1N32 Q;  4P73 A;  1UEB A;  2IX0 A;  3CCS A;  3OYY A;  2K5H A;  1HZB A;  3F1Z A;  1XMO Q;  3ICE A;  1X3F A;  1VQO A;  2NVY H;  4XIG S;  1SFO H;  1L1O B;  1IZ6 A;  2PQA A;  2Q2I A;  5H1S E;  4GNX C;  1K8A C;  2ZM6 Q;  4A3G H;  2VUM G;  3KJP A;  1I94 L;  2JA6 G;  4JI4 L;  4GLX A;  1YHA A;  4LF5 Q;  4B3T Q;  4DV5 Q;  3PO3 H;  5C44 G;  4HJ7 A;  4JI7 L;  2JK8 A;  4MZ9 A;  4DV4 L;  1PV4 A;  1MJE A;  1N9W A;  2MNA A;  1VQL A;  4DR7 Q;  3GTL H;  1PH6 A;  4HID A;  1PH9 A;  3RLN A;  1EIF A;  1VQ4 A;  2NN6 I;  1E24 A;  3F8T A;  1VQ6 A;  4HIO A;  2PNH A;  4DV2 L;  5IYB H;  5FLM H;  1XPO A;  3T1H L;  1HR0 Q;  4JBM A;  4JYA Q;  4GKJ L;  4A93 G;  4FDB A;  1DGS A;  4A3L H;  1NBW A;  4ME3 A;  3E0E A;  2K14 A;  4QL5 A;  4LFB Q;  1U5K A;  4IPG A;  4P72 A;  2BA1 A;  1PH8 A;  4LNQ A;  3CCU A;  2CQO A;  1GKH A;  5M3F G;  2R7D A;  5AJ3 L;  1AE3 A;  1K83 H;  5ELO A;  2OTL A;  2C35 B;  3NEN A;  4GS3 A;  4DV1 L;  3NBH B;  4JV5 Q;  1X54 A;  1N36 Q;  4OON A;  4X65 L;  1Y1W G;  3HOY H;  1L0W A;  1N32 L;  1WCM G;  4YHH Q;  4BA1 I;  1Z47 A;  4LWC A;  1HNX Q;  1T9H A;  1KRT A;  1XMO L;  2AHO B;  2ES2 A;  1S3O A;  1YZ6 A;  3GTP H;  3S15 H;  1S72 A;  3S24 A;  2JJQ A;  3BZK A;  4GOP A;  3M9B A;  1QVG A;  3JC6 6;  4A3C G;  2ZM6 L;  2NVX H;  4DR1 Q;  1SN8 A;  1GM5 A;  1OXV A;  3I55 A;  1CKM A;  4BBR H;  1VQF A;  4LF5 L;  4B3T L;  5LMN Q;  1N34 Q;  2R92 G;  2IHF A;  2RHQ B;  3RLF A;  4DV5 L;  1EFW A;  4MTN A;  1VQM A;  3M4Q A;  3VDY A;  1K3R A;  4JBW A;  4A3K H;  1C7Y A;  2IT1 A;  2UUB Q;  4POG A;  3K7A H;  1B70 B;  5GQO A;  1JJC B;  2KHJ A;  1BBW A;  2R7Z G;  4QY7 A;  4DR7 L;  2VY3 A;  3HOZ G;  3STB D;  4O2D A;  4HJ5 A;  4TQU S;  1LYL A;  5IWA Q;  3J80 c;  1HR0 L;  1ASY A;  4JYA L;  4GNX B;  4IFD I;  3A5Z B;  3F2B A;  1B8A A;  1E3P A;  4EQ5 A;  2ZTE A;  4AH6 A;  3CC2 A;  2NN6 G;  4OXP A;  5JJL A;  2ZJR A;  2F52 A;  5GRO A;  5FJ8 G;  2Q2U A;  1AH9 A;  4LFB L;  1G51 A;  4QQB X;  1L1O C;  3RNU A;  4RMF A;  1QZG A;  3J81 j;  3G71 A;  1KRS A;  4R4Q A;  3WWV A;  3HOV G;  2AWN A;  1XNR Q;  3S1Q H;  4YWM A;  1V1Q A;  3ULL A;  4OWX B;  4BXX H;  2Z6K C;  4UP8 A;  3CC7 A;  4HIK A;  1J5E Q;  4OO1 I;  2ATW A;  4JV5 L;  4X66 Q;  3KF6 B;  1QZH A;  4X62 Q;  1RIP A;  3PUX A;  3ULJ A;  3UE0 A;  4YHH L;  4A3I H;  1O7I A;  3D31 A;  1HNX L;  2JA5 G;  2WAQ E;  5IYC H;  4UP7 A;  3OTO Q;  1I3Q H;  2YTY A;  2A19 A;  3K8A A;  3JAM i;  4GLA C;  1WFQ A;  3TS2 A;  1KIX A;  2VZA A;  3UE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...