2E2IH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
134
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 17
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2iH00
1MJCA 5C4JH 2HHHL 1CKNA 4KLKA 1I3QH 4NB3A 1A62A 3J80i 3A5UA 2JA5H 3GTQH 1NBWA 3K0XA 5LMNL 4A3KH 3E9IA 1HZ9A 3EN2A 3K81C 3I4NH 2UXDQ 4FDBA 5IP9G 1YI2A 4DR1L 3T1YL 5IY0A 2Y0SG 4A3EG 1AE2A 3RN2A 2F3IA 4DR4Q 5M3FH 4Y7NH 1PH5A 4BY7H 2R7FA 5C3EH 3DLLA 2WAQG 3AFQA 4P75A 3E9HA 2Y0SE 1GVPA 1Q8KA 4P74A 1TWHH 1U5KA 3IRBA 5FJ8H 3CD6A 4DV6Q 3HFZB 2UXDL 1YVCA 3AYHB 2WAQE 4DV4L 4H02A 3FHWA 1U0LA 3B6YA 2MFIA 1LUZA 4GN3B 2Q2UA 4DR4L 1IYJB 3GTPH 1IBLQ 2UXCQ 3ULLA 4DAYB 1P8LA 5DLQE 4GN4B 3CCJA 1QZGA 1PA6A 3GD7A 1KHIA 2I0QA 3G4SA 1JE5A 2QEXA 4DV6L 4HJAA 4C3HH 4GKKQ 1XNRQ 1E1OA 1VQIA 2NVTH 4LWCA 4BA1I 4EQ5A 3KF8B 3FKIH 2UXCL 3M85A 1IBLL 3HOUG 1HZCA 1T9HA 4BBRG 2JA6G 4O2DA 3AEVA 4OXPA 3BZKA 3KJOA 3KLWA 3CC2A 3PUXA 4IOAA 3OW2A 2NVQH 3S17H 3ULJA 1X56A 2ES2A 4LUVA 4GKKL 4GLXA 4A3FH 1XNRL 4QQBX 4JI7Q 2QGQA 3KOJA 2NN6G 2Q2HA 3SGIA 4A3LH 4JI8Q 1QVFA 1VQCA 1WJJA 2K5NA 5GQOA 5ELOA 2K50A 2KCTA 2R7ZG 3G48A 4L5SA 1J5EQ 4A3MH 4POGA 4OO1I 2PMZE 5GADC 1FL0A 5E7NA 3PIPA 5C4XH 1XMOQ 2JA5G 2JE6I 3U4ZA 4A3KG 2HIVA 3I4NG 1CKNB 2AMCB 1SLJA 4LUOA 4JI7L 3VDYA 3AQQA 4PZ6A 4JI8L 4BY1G 1ASZA 1YHQA 5M3FG 4B3MQ 3RZDH 1V43A 4BY7G 2IT1A 3OYYA 5C3EG 1LYLA 4LFCQ 1J5EL 3CC7A 1UE7A 1R9TH 2NVXH 4DUZQ 3CF5A 2IY5B 2KHIA 2AKWB 1XMOL 4LF5Q 5FJ8G 1N34Q 4HIMA 2AWOA 3KYHC 1KIXA 4A3IG 4EX5A 2N8NA 2YTVA 1VQNA 4IFDI 1KAWA 3CMAA 5IYBH 1BBUA 4B3ML 1UEBA 4MZ9A 4L5RC 2OQKA 5M5WH 3GTGH 4LFCL 2KHJA 3GTKH 4BA2I 4IJLA 1EOVA 1B7YB 4DUZL 3JAMc 1IL2A 2RHQB 4LF5L 3K8AA 1N34L 5IP9H 4K0KQ 1S40A 4A75A 1K8GA 1Q86C 3STBC 3S14H 5AJ3Q 5EAYA 1B70B 1VCIA 4UP7A 4PZ8A 2R6GA 1KD1C 2GVAA 3A0JA 4JBKA 2K75A 4OWWB 3PUYA 1PFSA 1OXVA 1RL2A 5JJKA 3CCMA 3D0FA 2OQ0A 4P73A 1PYBA 5IYDG 4DV5Q 1JMCA 4A3FG 3L7ZC 3RZOH 4K0KL 2K5HA 3A74A 4A3LG 3KFUA 4OONA 1PVOA 2C35B 2ID0A 5AJ3L 1YJNA 2ZJQA 4R4QA 3TS2A 1W2BA 2ZTCA 2JA7H 1Y1WG 5C0XI 2R7DA 4A3MG 2A8VA 1XTDA 4XTCS 3U50C 1X65A 4KHZA 4DR6Q 4NXNQ 1HZBA 4DV5L 3RN5A 2QA4A 1S72A 3PO2H 1EIYB 4QL5A 3CP0A 1UE1A 1Y1VG 4DK6C 1MKHA 4LUZA 1RIPA 4APVA 4X66Q 4JI0L 1N9WA 4A4IA 3F2DA 1UE5A 1VQPA 1PH4A 3A5ZB 1O7IA 2K4KA 1TWCH 4YY3Q 3U58A 1IXRA 4NXNL 1PH8A 1BBWA 3PUVA 3JC66 4GS3A 5IYCH 3J81c 5JEAJ 4J15A 3CPFA 4UPAA 3ERSX 1CSPA 3NBHB 4LFAQ 1JT8A 5IYBG 1PH9A 1N32Q 4RG1A 1Q1EA 1YIJA 1SMXA 4X66L 4X62Q 1QVCA 3UDIA 4AH6A 1VQ7A 4IOCA 4YY3L 3TREA 4Y52H 4IFDJ 2N78A 1UE6A 1NJIC 1XJVA 4OO1G 4MNOA 1JJGA 2MQHA 2ASBA 4A3BH 4BY1H 1SN8A 1VQHA 1HNZQ 4LFAL 1OXUA 4YCWA 1N32L 3CCLA 2BA0A 3BZCA 2L15A 4NPSA 4X62L 2VZAA 1FVIA 1E3PA 2IHEA 3I2ZA 4A3IH 1PH2A 2FXQA 4JBMA 4LF8Q 4OWTB 4YWLA 2B63H 1PV4A 1VQ9A 2CCZA 1HNZL 3PO3H 4DR7Q 4JI4Q 1PH1A 1G6PA 1J6QA 2JA7G 4IFDG 4GKJQ 3HOYH 1AH9A 1E1TA 3RLFA 2D0OA 3MEFA 1L1OA 4HJ8A 3WWVA 3ZJYC 1VQ8A 4WJ4A 4AYBG 4QY7A 3LGJA 4LF8L 1LTLA 2EIFA 4A3DH 2ALYB 3PO2G 5C0XJ 3M3YH 4P72A 2VW9A 2R92H 1CSQA 4DR7L 4JI4L 2CWAA 3S2HH 2JQOA 2KENA 1CKOA 2K52A 1JJCB 4AYBE 4GKJL 3HOVG 4P71A 3TQYA 3OTOQ 4GLAC 2VUMH 5IYDH 3W5OA 1I5FA 2WP8J 4GOPA 1E7ZA 1VQEA 2E2HH 1N33Q 5IYCG 4C3IH 1K0RA 1IBKQ 4HJ7A 4DV3Q 1VQMA 4DK3C 5C44G 1X3FA 4JOIA 1WCMH 2XGTA 4IO9A 2R93H 1OXSC 1Y1WH 1L1OC 1I6HH 4QIWE 2I5MX 4JYAQ 2D62A 4IPDA 2OWOA 2EQSA 1YBYA 3PSIA 3OTOL 5C0XG 3CMEA 2IX0A 1N33L 4LNQA 1SFOH 1K3RA 3CCEA 4HIDA 1IBKL 4A3BG 1Y1VH 1VS0A 1VQJA 2A1AA 4DV3L 1TWAH 4PZ7A 3H0GH 5LMNW 4IJHA 1OXTA 2LXJA 4GOPC 4JYAL 3GTOH 3S1NH 2AHOB 4R4TA 1HZAA 5IP7H 1QZHA 2GVBA 3AFPA 2ZJPA 4NXMQ 4JOIC 2VL6A 4IPGA 2KCMA 4JBJA 1WYDA 3F8TA 2YYZA 1I50H 2B63G 3PO3G 1WI5A 4DV1Q 3PF5A 4JV5Q 2PNHA 1KRSA 5FLMH 3HOYG 2I5LX 3EIVA 4JI5Q 4NXML 4MTNA 4GLVB 4PMWA 3CCRA 2YV5A 3NELA 1VQLA 1KQSA 4A3DG 4LF6Q 1VQDA 1L1OB 4A3JH 2R92G 3TEHB 4L5QA 2ZTEA 4DV1L 1XPUA 3S16H 1G51A 4AQYQ 4JV5L 3KF6A 4YWKA 3STBD 2NZHA 4IPHA 4JG2A 3KDFA 1VQAA 4TVAB 5M3MH 3CCQA 3H3VI 4JI5L 3Q8DA 4DV7Q 1YHBA 1Q81C 5K36G 2VUMG 4R4CA 4JC0A 2R7ZH 1EUJA 2RHSB 3S2DH 4LF6L 5J3BA 1I94Q 5LMUQ 3RLOA 1XMQQ 2E8GA 1WCMG 4GOPB 2R93G 4AQYL 1PH6A 3UE1A 3J7ZC 5BR8Q 1X3GA 2F52A 2H5XA 3M7NA 1QUQA 2YTXA 4WJ3M 1C0AA 4DV7L 3GTJH 2BH8A 3K7AH 3HOXH 4A3GH 1C7YA 1NTGA 3J80c 3GO5A 4R4IA 1Q7YC 5LMUL 1XMQL 1I94L 2JA9A 1CKMA 3ER0A 1K83H 3H0GG 4RMFA 2UUBQ 3UDXA 2PI2E 5BR8L 3CCUA 3HOVH 3JAMi 3EBEA 1EIFA 5IP7G 2ZM6Q 4DR6L 3CQZH 3CCVA 1EFWA 4DV0Q 3H3VH 1XNQQ 2DUDA 2A19A 3RLNA 5C44H 3S24A 3F2CA 1VQBA 3CXCA 1XPOA 1K73C 1WFQA 3U4VA 5GAEC 1OXXK 4DR3Q 1VQ5A 3CAMA 4C2MH 4QJFA 5FLMG 4JCVE 1SROA 2JEAI 4OWXB 3CCSA 2ZM6L 1A63A 2CQOA 1M90C 2B3GA 3MXNB 3PUZA 2ZJRA 4POFA 1X9NA 4DV0L 1Z47A 1GM5A 1XNQL 3I4MH 4TQUS 2IX1A 3G6EA 3I4OA 3I56A 4A3JG 4GNXA 1KC8C 1V1QA 1TWGH 4LFBQ 3CW2C 2EXDA 5IE8A 4DR3L 4DUYQ 1K9MC 2YU9H 3HOWG 5H1SE 1KRTA 5JEAG 5M3MG 2N3SA 4KI0A 3KF6B 3S1RH 5JJLA 1Q82C 2OCEA 3KDFB 1X54A 1IBMQ 3J7A5 1DGSA 3PV0A 4BXXG 2IHFA 2YTYA 4JBWA 5GAGC 1Z9FA 1CUKA 4LFBL 1NY4A 4DV4Q 1SR3A 2JA8H 4DUYL 3PUWA 1EQQA 2E5LQ 3UDGA 3D31A 4GN5A 4LW1A 4LF4Q 1KXLA 4AIMA 4DPGA 2Q2TA 4PG3A 5HY6A 3K80C 3J81i 1VQFA 1QUQB 4GNXC 3ULPA 2UUCQ 1E22A 2CFMA 3HOXG 1YJWA 2VY3A 4DR2Q 4IPCA 1PHJA 1HR0Q 1IBML 4A3GG 5IWAQ 1ASYA 2NVYH 2XTIA 5HGQA 1LM0A 2KBNA 4OX9Q 4YCUA 1V9PA 4DNIA 2E5LL 2UXBQ 3I7FA 4LF4L 4DR5Q 1Y14B 1X6OA 4KHPQ 2E2JH 1W3SA 1PYSB 3CC4A 3PF4A 1VQOA 2UUCL 1KL9A 1OTCA 4HJ9A 4A93H 2VNUD 4ALPA 4UP8A 4DR2L 1HR0L 2RF4A 1D8LA 5IWAL 2LXKA 1JB7A 1WOCA 4OX9L 1FJGQ 3GTMH 1NE3A 1A0IA 3PCOB 3L0OA 3H15A 2UXBL 5M5YH 5M5XH 3UE0A 4DR5L 4JI3Q 4LF9Q 2BH2A 1L0WA 4KHPL 1EQRA 3DM3A 1FGUA 4DKAC 4UY8C 2VS1A 3I4MG 4O0AA 2V1CC 2UU9Q 4QGUA 4BBSH 3BU2A 3HKSA 1YJ9A 2K14A 1Q46A 3CPWA 1N36Q 1K8AC 2HQLA 1VQKA 1FJGL 1B8AA 4A3CH 3PGZA 1NMFA 3E0EA 4HJ5A 4GNXB 4X64Q 4YCVA 4JI3L 1YITA 1UWVA 2VQFQ 2UUAQ 4LF9L 1Q12A 3TRZA 1GO3E 2PQAA 3F1ZA 4DV2Q 3HOZH 4UP9A 2UU9L 2CWPA 3W1GA 5JJIA 4C3JH 2HIXA 4XIGS 1N36L 3GDEA 2BA1A 1S3OA 1YNXA 1N8RC 2JA8G 3S1MH 3M4OH 3W1BA 1P16A 1L2FA 2JK8A 1BKBA 4X64L 1M1KC 4HIKA 2UUAL 2VQFL 4ME3A 3KJPA 2MO0A 1HH2P 1EWIA 1GD7A 2JJQA 2ZTDA 3RR5A 4L5TA 4DV2L 1X55A 1SE8A 2AWNA 2DGYA 5ELNA 3HOWH 2VQEQ 3S1QH 2N49A 4B3TQ 4JI6Q 4LF7Q 1C9OA 3TS0A 3NEMA 1YEZA 1VQ4A 4A93G 2PI2A 3J81j 4BXXH 5GAHC 1JJ2A 1QVGA 2I5HA 4X65Q 1HNWQ 2VQEL 2D0PA 4A3EH 1A8VA 1G291 3HKZG 4B3TL 4R1JA 1HR0W 4JI6L 3GTLH 4LF7L 3FKIG 1AE3A 4YWMA 1XPRA 2Z6KA 2OTLA 4A76A 3HKZE 2E2IH 1HJPA 1VQ6A 2NN6I 3M9BA 4BBSG 1SRUA 1D7QA 3BJUA 5IT9c 4JI1Q 1GKHA 2NZOA 2WFWA 4X65L 4HIOA 4B3SQ 1HNWL 1E24A 4DAMA 3M4QA 3L2PA 3I55A 2MNAA 4A3CG 2GN5A 2RCNA 3RNUA 2Z0SA 4JI0Q 2HT1A 1H95A 3HOZG 4X6AH 2K5VA 1TWFH 5FLXc 4JI2Q 1NMGA 3S15H 2Q2IA 2UUBL 2F4VQ 3T1HQ 4B3RQ 5C4XG 4JI1L 3G71A 2PQAB 1PH7A 4B3SL 1HNXQ 1YHAA 2Z6KC 2WB1G 4YHHQ 1MIUA 3F2BA 1EYGA 2ATWA 1BVSA 3HOUH 2B29A 5GROA 2JA6H 4BBRH 2OTJA 2HHHQ 1X3EA 1IZ6A 2WB1E 3NENA 2LSSA 3PIOA 5LMNQ 4JI2L 3ICEA 4B3RL 1YZ6A 2F4VL 3T1HL 1TXYA 3K7UC 3M4PA 4R4OA 4DR1Q 3T1YQ 1VQGA 1HNXL 1PH3A 1Q1BA 3FP9A 3UDFA 4YHHL 1MJEA 2MO1A 2CKZB 2JEBI
chains in the Genus database with same CATH superfamily
5CV8A 4BWGB 4NB3A 1O7YA 2JA5H 3K0XA 3DM1A 1SYFA 3FMCA 5IP9G 1EY9A 1JICA 1AE2A 5L37A 1BCPF 3ZYYX 5M3FH 4KKTA 3DLLA 2WAQG 2A68D 4NP5A 4PQXA 3EVQA 2MGSA 3K5NA 3BZDB 5FJ8H 5HGTA 4DV6Q 2UXDL 1QOHA 4H02A 4CHTB 1LUZA 2EY2A 1Q90A 2Q2UA 5M5WB 1GUGA 2ENBA 4GN4B 1QZGA 1PA6A 1NR4A 4EQNA 4HJAA 2KJXA 1EY0A 2NVTH 4LWCA 4BA1I 2J7ZA 3KF8B 4EQ5A 5FO7B 2UXCL 3VR3A 3HOUG 1SYGA 1T9HA 4IUUA 1IYUA 3AEVA 3KLWA 3PUXA 4RCNA 3OW2A 3S17H 1EYDA 2RVLA 1LO5D 1VDZA 5CYUA 4LUVA 4GKKL 1XNRL 2QGQA 1CHQD 3KOJA 1VQCA 1WJJA 4KY5A 3G48A 1ET6A 1MSHA 1J5EQ 4OO1I 5E7NA 1LTRD 1XMOQ 2JE6I 4A3KG 3T51B 1EQVA 2EOTA 1TS2A 3MXPA 4N9PA 4JI8L 1K83B 1RTNA 3RZDH 4RHSA 5C3EG 1ICFB 1LYLA 4C1NK 2NVXH 2PW7A 2L12A 3CF5A 2KHIA 1RTOA 3NBHA 3CQZB 4HIMA 2EZVA 1B50A 2N8NA 5ELEA 1JOQA 1EY5A 2B8FA 1RDPD 4XT1B 1WTVA 4XYQA 1B3AA 4MZ9A 4L5RC 1SNOA 4LFCL 4HMJA 5G3LF 4BA2I 3JAMc 1N34L 5IP9H 1Z6HA 3JAME 1K8GA 3S14H 5AJ3Q 2A6HD 2MP1A 1E2WA 4MN3A 4UP7A 1O80A 3CCMA 3D0FA 5IYDG 1PYBA 3L7ZC 1BNZA 4UHVA 2ID0A 1YJNA 3TS2A 2D2CC 1Y1WG 5C0XI 4O42A 3HOYB 3A55A 4A3MG 1XTDA 1ZYRC 2O4XA 1V1PB 3IFTA 2WKDA 3JAML 1NSNS 2RDHA 2QA4A 4JVZA 4QL5A 1UE1A 1Y1VG 2NVYB 1MKHA 1F77A 4LUZA 1RIPA 4APVA 4A4IA 3F2DA 4PMBA 2JSOA 3AU7A 3A5ZB 3U58A 3CU7A 3FVQA 3I73A 4ID6A 3JC66 1JC7A 4MTKA 4UPAA 3ERSX 2B8GA 2K33A 4AH6A 3MVVA 1YNNC 3V96A 4YY3L 4IFDJ 1SYCA 2F0WA 1BCPC 3EROA 3KUPA 3CCLA 1K8MA 4NPSA 2VZAA 2IHEA 3I2ZA 2Q8IB 2AQ2B 3NSWA 3K58A 3HOZB 1I50B 2CCZA 3PO3H 1HNZL 4JI4Q 2L9HA 1SJED 1AZQA 3M4OB 1VQ8A 1EWCA 4LF8L 2EIFA 3TDQA 4A3JB 2VW9A 3S2HH 1CSQA 3KK7A 2LY7A 4RHRA 1PMRA 2JQOA 1JJCB 4TKOB 4NDXA 2DNEA 3OTOQ 2VUMH 5IYDH 5IGFA 2WP8J 3ITPA 5CMDA 1BOSA 1E7ZA 1VQEA 5IYCG 3NP8A 1IBKQ 4KD3A 5C44G 3C3LA 1X3FA 4JOIA 4OGQC 2R93H 1Y1WH 5FO8B 1I6HH 4A3EB 2I5MX 1TU2B 3WDNA 1FNUA 4A3GB 4LNQA 1SFOH 3CCEA 1S4ZA 4ODGA 4A3BG 1Y1VH 1VS0A 1TWAH 3H0GH 1CM9A 4IJHA 2G9DA 4B08A 5I6YA 4JYAL 3S1NH 1EEID 1PTOD 3HZXA 2KCMA 2YYZA 2K28A 4XT3B 1GHJA 2NYZD 1EU4A 2R61A 2WIIB 3EIVA 4G4KA 5K5PA 2JA6B 3NELA 1VQLA 3T16A 1CI3M 1L1OB 2KOLA 2LFNA 3TEHB 4DV1L 1XPUA 4AQYQ 3T56B 3KF6A 2EJMA 3STBD 3KDFA 4TVAB 5JEAH 2F03A 1LTAD 4JI5L 2K32A 3S1RB 3H3VI 4DNRB 3FPUB 1GHKA 1PZJD 2JA5B 1ZKOA 1ZXTA 5EJWA 1PH6A 2F52A 2YTXA 4XQNA 1C0AA 2B2YC 2MJ8A 1U4RA 3OMGA 3FRPB 1C7YA 1NTGA 4XQQA 1SYDA 5LMUL 1Y69U 1XMQL 2Q8TA 1CKMA 4RMFA 3UDXA 2IPKD 4ZLTF 3EBEA 3NWTA 1EIFA 1I6VC 2ZM6Q 1PFNA 5FK9C 1EFWA 4DV0Q 1STNA 2RDFA 3HEJA 5C44H 1VQBA 3VYTA 5A35A 2F0FA 5F2DA 5FLMG 4JCVE 5M5YB 4DF7A 3UI2A 2F0DA 2CQOA 2B2UC 2B3GA 3N6RA 4B9XA 1X9NA 1C48A 4WORA 3G6EA 4IUNA 3S17B 2JXMB 3K0YA 4GNXA 1HQRD 4LFBQ 4DR3L 3A8JE 5IE8A 4DUYQ 2N3SA 4K8IA 4ZAIA 3OWEB 1Q82C 2L0CA 4OEMB 3C1EA 3PV0A 4C3JB 4JBWA 1GUOA 3D4DA 1STHA 3S1MB 2IJ0A 3PUWA 2E5LQ 5E4XA 4AIMA 3RZDB 2Q2TA 3D4RA 3K80C 2UUCQ 1QUQB 3ULPA 1FNVA 2NVXB 2VY3A 1HR0Q 3LX0A 4DNTB 4LAAA 1LM0A 4OX9Q 1CZWA 3W3AA 3DWQA 2UXBQ 2AQ3B 4DR5Q 3WOFA 1Y14B 1STYA 1OTCA 5I9PA 3BVZA 1I4XA 1ZEQX 2M00A 1JB7A 1FJGQ 3H15A 3S14B 4JI3Q 2WAQB 3RMHA 3BYTB 4UY8C 2UU9Q 1CT1D 3HKSA 2K14A 1KNEA 5FO9B 3CPWA 1V1OA 1Q3LA 3MA2B 3R3OA 1NMFA 4X64Q 4KY6A 1A6XA 4LF9L 2B2VA 4IUVA 1JORA 1CZGA 3E3XA 1S3OA 4IURA 5JPMC 4YIJA 4DAPA 3HOUB 4HIKA 2F1MA 2VQFL 3KJPA 2JJQA 5CV5A 4L5TA 3C2PA 1X55A 3NUCA 4CKCA 1U9RA 4KKUA 2PMZB 2VQEQ 4LJZC 5KGUA 1B3QA 3S1QH 1QCBD 4JI6Q 5C4JB 1G2TA 4K5XA 3NEMA 1BR9A 1STEA 3J81j 1TQOA 1S5ED 4F8MA 4X65Q 5C3XA 5I4DA 2A6HC 4HTHA 1QE6A 1PLFA 3SK6A 4J6HA 3D8GA 4B3TL 5C3EB 4YWMA 1GUWA 2EY5A 2OTLA 3CHBD 4BBSG 3PQIA 1GKHA 4DAMA 3L2PA 3HGBA 2RBMA 2MNAA 2Z4IA 3PO3B 2XN9C 1X3PA 1X32A 2AQ1B 3HOZG 4X6AH 3VYSA 3S15H 4B3RQ 4KKSA 5KYIA 1JWUD 3KF8A 2UUBL 5C4XG 4JI1L 1PH7A 2PNRC 2QEJC 1YHAA 4QF4A 1BVSA 5T1IA 2HHHQ 1T5XD 2NVQB 2BDNA 4JI2L 2VUMB 3L9AX 3T1HL 1TXYA 1B9NA 1BCPD 4K2KA 1HNXL 1CTMA 2F0JA 1Q1BA 3BVGA 2BCOA 1Y1WB 2B2WC 4KLKA 1I3QH 1A62A 3J80i 5I2YA 1NBWA 5LMNL 2FFKB 3I4NH 3EN2A 2B2TA 2WACA 1YI2A 2XNAC 1SFOB 5KNBA 4A3EG 1NR2A 1Y1VB 2F3IA 1TWAB 4DR4Q 3H0GB 1DXMA 2PCFB 2Z9HA 1KABA 1SEBD 3E9HA 2Y0SE 2DJFC 1E2VA 1PDQA 1TWHH 1U5KA 3J7YW 3BVMA 3AYHB 4DV4L 4A3IB 1ET9A 3NTHA 2ZXRA 4K8JA 2QW7A 4K14A 3RD4A 2BDOA 2LS01 2K1BA 3GD7A 1KHIA 1JE5A 5AFWA 4C3HH 1E1OA 4HEDA 2KCNA 3A7LA 3M85A 1IBLL 1HZCA 2JA6G 4O2DA 3NXWA 4OXPA 3BZKA 1KDAA 3R93A 2ES2A 1SDFA 2NN6G 1RCVD 2Q2HA 1HFGA 4A3LH 2K5NA 1V1PA 2K7VA 2K50A 4NKLA 4L5SA 5GADC 1FL0A 3PIPA 3DWPA 5C4XH 2JA5G 2QCPX 3Q23A 3VR4A 2F0NA 2HIVA 1SMYC 4KN4C 4ZK9B 5C4ZA 3VA7A 4JI7L 1HFNA 2EDGA 3QB3A 3VDYA 3AQQA 4PZ6A 1VF7A 1Y8OB 4B3MQ 5M3FG 3HS0C 2EYOA 5G3LD 4ZYSA 1V43A 3CC7A 1UE7A 1R9TH 2F0HA 3ND8A 5FJ8G 3KYHC 4M1UB 4JPBW 4JK1C 1TY0A 1AFPA 5C44B 4IFDI 3SVMA 2JP1A 4E6IA 3GTGH 2OQKA 1WVLA 1B4OA 4IJLA 4I65A 1B7YB 4M8AA 3VR6A 4DUZL 1IL2A 2RHQB 3MAQA 4LF5L 3T13A 4OO1H 3BDCA 4ZUIA 1S40A 4A75A 1Q86C 5IGGA 2LKVA 3STBC 1HUMA 1ML0D 1VCIA 3CRLC 5KIXA 2HUGA 1KD1C 3A0JA 2R3ZA 2K75A 1IKMA 1RL2A 1OXVA 4RGOS 1RHPA 1FGBD 1T5EA 1UUPA 5JJKA 2OQ0A 4K0KL 3RZOH 3KFUA 4R4QA 1AW7A 1RJTA 4H7BA 4CGYB 4NXNQ 1HZBA 4DV5L 1S72A 4KMUC 1EIYB 1K3BC 2KA7A 3D4WA 1PH4A 3URYA 5NUCA 2JN4A 4N9TA 1TWCH 4CJ2C 1IXRA 1PH8A 4BS9A 2E2HB 1BBWA 3J81c 5JEAJ 4LFAQ 1PH9A 1N32Q 4RG1A 1Q1EA 1SMXA 4X66L 4X62Q 3VYRA 3OHXC 1QVCA 1VQ7A 3L3OC 1F9PA 2WKCA 5C0XH 2N78A 1UE6A 1NJIC 1A3UA 4MNOA 1JJGA 2ASBA 4CDDC 3TP5A 1SN8A 3VR2A 1OXUA 3MTSA 2L15A 1HXYD 3ERQA 1FVIA 2E74C 4JBMA 2VXWA 1W6KA 2B63H 1VQ9A 1PTOH 2I46A 2K5WA 3H94A 4IN3A 2EXZA 5IODA 1AZPA 2IW3A 4GKJQ 1E1TA 1A3VA 1L1OA 2CVRA 1SNCA 4R8IA 4A3DH 1LTLA 2ALYB 3H3VC 4P72A 2R92H 4DR7L 5EKKA 2KENA 4J8QA 2E76C 4AYBE 1NUCA 3OW7A 3S1QB 1ESFA 3HOVG 4P71A 3ND9A 5M9OA 5K36H 4GLAC 1I5FA 4NW2A 1AN8A 5J22A 3NBIA 4IO9A 1GUSA 1WCMH 3QO2A 1PFBA 3K57A 3QOLA 1LTSD 2D62A 3H6MA 2IX0A 1Y8NB 4CJ1B 1N33L 1K3RA 3TP7A 4HIDA 4FNFA 1VQJA 3D6WA 1CFMA 4DV3L 3TSSA 4PZ7A 3ONAB 2QDLA 3GTOH 1EIGA 4NXMQ 5IP7H 1A2UA 4Q5VA 2ZJPA 1WTOA 4JOIC 1UNSA 1IKLA 2HQEA 2KUMA 1WYDA 2HCCA 2OEOA 1RKNA 3S15B 3PO3G 3LNNA 3PF5A 2OXPA 1AEXA 1BQQT 2PPBC 3QR8A 1SE2A 2I5LX 2K5DA 3IL8A 4MTNA 4PMWA 3CCRA 2K6AA 2FJ2A 1KQSA 4LF6Q 2NZ1D 1VQDA 3TZUA 4CDFC 2DJGC 2ZTEA 1YNJC 1G51A 4JV5L 3KLSX 1I4HA 1LTGD 2FMMA 4JG2A 3LWUA 1F9SA 2VUMG 1RF2D 5TSSA 4JC0A 1EUJA 1I3QB 3SK5A 4FF2A 2XWJB 3I4NB 4GOPB 5CV4A 2R93G 1VF5C 3J7ZC 5BR8Q 1QUQA 4DV7L 5EGTA 1QB5D 2BH8A 4MHEA 3K7AH 2F3WA 3HOXH 1TT2A 1O78A 1Q7YC 1I94L 2JA9A 2PZTA 3ER0A 3H0GG 3MFYA 3RUZA 2UUBQ 3HOVH 3JAMi 4QUCA 4DR6L 1L0XB 1STBA 2IWHA 3QIAA 1ENCA 1M8AA 1XNQQ 3H3VH 2DUDA 2A19A 3P7JA 4ZKCB 4FP5D 3CAMA 4DXFA 3D3RA 3QWNA 4C2MH 2F0IA 4K2LA 3CCSA 3MXNB 3MFGA 1LV9A 4POFA 2IX1A 4BBSB 1C4QA 3I4OA 1SYBA 1KC8C 1EY4A 2F0SA 1MSGA 2DN8A 3CW2C 2EXDA 3OIQA 1K9MC 3HOWG 1JWMD 5BN3A 5JEAG 5JJLA 5IGDA 3J7A5 1IBMQ 5C4XB 1EY8A 2KCCA 5GAGC 2O5IC 1LABA 1GUTA 1GUNA 2F0MA 4DV4Q 2JA8H 1EQQA 2RDGA 3D31A 4LW1A 1I4GA 4LF4Q 1DOKA 4GNXC 2XRSD 5E4WC 1R9TB 2CFMA 5DM63 5IWAQ 1EFID 4HAEA 4KJOA 2KBNA 1CQVA 4YCUA 4O1NA 3I7FA 4CDEC 5C6AA 2FINB 1X6OA 4KHPQ 3CC4A 4A93H 1U4MA 2VNUD 4DR2L 2RF4A 1D8LA 3OMCA 2LXKA 5CGKA 5JJZA 1WOCA 1EY6A 3GTMH 1A0IA 4DK0A 3L0OA 2Z1CA 3GTLB 2PO4A 5M5XH 1JQYD 3DM3A 3D6CA 3E5SA 5CBEE 2E2IB 4O0AA 1F2MA 1PRTB 2I07B 4QGUA 1YJ9A 1SMYD 1N36Q 2HQLA 3P1HA 1VQKA 3RZOB 1B8AA 3MWYW 3DUZA 4A3CH 4HJ5A 3G6JB 2GA4B 1UWVA 1S5CD 3TRZA 1TIID 1GO3E 4OIKA 4UP9A 3W1GA 3DMUA 2HIXA 4XIGS 2F0OA 1YNXA 2RCFA 4XXEA 3W1BA 5LL6S 4B9WA 1L2FA 3F2UA 1M1KC 2UUAL 3RR5A 4DV2L 1DD2A 1TWCB 1SE8A 2EVBA 3HOWH 1R4PB 2B2VC 2OF1A 1S5BD 1G8ZD 1H9SB 1I4RA 1EL0A 2XRQD 1VQ4A 2PI2A 5I9OA 1HRJA 2Z4HA 1D2BA 2I5HA 2D0PA 1A8VA 5M3FB 1BO0A 4LF7L 3FKIG 3I4LA 1XPRA 4I7ZC 2LMCB 3HKZE 5D65A 4HCSA 1FR3A 3BJUA 4B3SQ 1HNWL 3M4QA 2B63B 1QNUA 1PTOB 1F9RA 4HCEA 4OHJA 4ULLA 4C56C 2HT1A 5ELFA 1JWSD 1H95A 1B53A 5FLXc 2F4VQ 1LTBD 4DFAA 4A3DB 2NVTB 2WB1G 4TSSA 3F2BA 1EYGA 4GZYC 4BBRH 3X3NA 2NTTA 5EPLA 1X3EA 3J7AF 1ENFA 2LSSA 2EJFC 1YZ6A 2F0PA 3NE5B 3K7UC 4WRDA 1SJHD 3GQBA 4KHVA 4YHHL 2MO1A 2CKZB 2R7ZH 1TR5A 1MJCA 5KRUA 1XXGA 5ISRA 3A5UA 3GTQH 1HZ9A 2UXDQ 4RAUC 4DR1L 2E75C 3T1YL 4S3SA 3RN2A 3T53B 5J39A 4Y7NH 1PH5A 4BY7H 1LT6D 3AFQA 1XYIA 3OPOA 4EVOA 1GVPA 4P74A 2C5CA 3CD6A 1HA6A 1VMCA 1YVCA 2WAQE 4P2CB 1XTCD 4UDUC 3FHWA 1U0LA 3B6YA 2MFIA 1KNAA 2UXCQ 3GTPH 4DAYB 1P8LA 5JVG3 1L0YB 5DLQE 4FF3A 2B2TC 3CCJA 1PRTF 3M7GA 4G7ZC 3FEWX 3BDLA 4DV6L 4GKKQ 1E0BA 1XNRQ 5LL6X 1LTID 1RODA 3FKIH 4IUQA 5JAVA 1D6EC 1LT4D 4IOAA 5IGBA 2CH4A 3ULJA 4DAVA 4GLXA 5I6WA 1MBYA 3NK9A 4A3FH 4QQBX 3SGIA 4JI8Q 2EYJA 3SXHA 3P20A 2F0VA 5ELOA 2KCTA 3OOCA 5DAUA 1TS3A 2PMZE 3I4NG 3U4ZA 1CKNB 2AMCB 1SLJA 3K7AB 4UAIA 3HOXB 4BY1G 5D14A 2PZWA 1ASZA 2MPMA 1SBBB 4LFCQ 1IHZA 1J5EL 3HOVB 3SK8A 2AKWB 4PNYA 1XMOL 1N34Q 2AWOA 2V4DA 4A3IG 1B1ZA 3SDZA 1EOTA 5FOBB 1STAA 2KVMA 1O7ZA 2M9VA 1JR0D 1LTTD 4V0BA 1BBUA 1YNJD 5IYBH 1H9JA 5M5WH 4C2MB 3GTKH 2AUJD 1J8IA 4CDCC 4FXDA 4C3HG 1JB3A 1PTOF 1EWHA 1BDOA 4WJWA 4PZ8A 2R6GA 2GVAA 3SE0A 4IUTA 3K59A 4P73A 4CJ0B 2CW0D 2K5HA 4A3LG 3IKJA 1PVOA 1XWEA 2E2DC 5AJ3L 2ZJQA 4FF1A 2ZTCA 2JA7H 1HA5A 4IFDH 3KBGA 2BOSA 2VB3X 1NNXA 2WINB 4XTCS 3U50C 1ILPA 1GOZA 1X65A 4KHZA 4DR6Q 4ZUJA 5D3DA 3PO2H 3S2HB 4DK6C 5T1GA 4JI0L 3DEPA 1UE5A 1VQPA 1O7IA 3R2TA 4YY3Q 4HR7B 3VA5A 5LHY1 3PUVA 4Q0FA 1TY2A 1CSPA 2R93B 2A73B 1I6HB 3GTMB 1SYEA 3UDIA 1WD1A 1G2SA 4OELB 4IOCA 5M5XB 3TREA 1MHWC 3T4AC 1IW7D 1XJVA 4OO1G 2XSCA 2MQHA 3NTIA 4BY1H 2L11A 1HNZQ 3BZCA 3BG3A 3S1NB 4RGNA 1E3PA 4RCOA 1PH2A 4A3IH 5D3IB 2FXQA 1GJXA 4EGVA 4LF8Q 2RKSA 4YWLA 1PH1A 2EYHA 3V05A 2D5DA 3HOYH 1AH9A 4N8FA 3RLFA 1I4QA 2TSSA 1MGSA 3ZJYC 1UEAB 2EPBA 2G5DA 1FNWA 5C4HA 3I72A 4JI4L 2IL8A 1G91A 1CKOA 3HOWB 2O2LD 1B2TA 3TQYA 1B44D 3W5OA 4GOPA 4LK1C 4C3IH 1K0RA 2J0TD 1L1OC 2EYLA 4QIWE 4G7HC 4JYAQ 2OWOA 2EQSA 1YBYA 3PSIA 5IGEA 3OTOL 3OIPA 4QB4A 5C0XG 5ELBA 1IBKL 1HPCA 1TS5A 5EPJA 3SEBA 1EY7A 1OXTA 2LXJA 3TMEA 2C9OA 4R4TA 1QNKA 2QDBA 4DA2A 2GVBA 1QZHA 2F0KA 2VL6A 4JBJA 3F8TA 2A74C 1I50H 3AB9A 2B63G 1MD2D 4FVMA 1DOMA 1WI5A 4F7XA 4DV1Q 5C5MA 1QJOA 1ICWA 2PNHA 5KNDA 1KRSA 1ESRA 3MXNA 2EYPA 4RKLA 4JI5Q 2RSOA 2H1EA 3SR1A 3IAYA 2YV5A 3DEOA 3R8BA 1B9MA 4A3DG 4A3JH 2R92G 3S16H 5EKIA 2DNCA 1SE3A 1TVXA 4PV1C 4IPHA 3CCQA 1VQAA 5M3MH 3Q8DA 1YHBA 5K36G 4R4CA 2MHVA 3S2DH 5J3BA 3GTQB 2VB2X 5LMUQ 1XMQQ 2E8GA 1WCMG 1HQMC 3A56A 4AQYL 1X3GA 4OIJA 3I8ZA 5BN5A 4KJNA 3GTJH 3QJYA 3C46A 5HURA 1ILQA 4A3GH 3J7AV 3GO5A 3SK4A 3CCUA 5DNFA 3GTPB 5IP7G 3RLNA 3S24A 3H91A 1WFQA 3V2TA 3J81E 3U4VA 3BYYB 4RGMA 5GAEC 2J4XA 4DR3Q 1SROA 3FKIB 2SNSA 2ZM6L 2QKIC 1A63A 4G57A 2ZJRA 2CQAA 3I4MH 4DV0L 1Z47A 2CHBD 2KHSA 3E6ZX 1DCZA 1TWGH 4A3FB 2YU9H 1SNPA 3EA6A 3I70A 5H1SE 1KRTA 4KI0A 3S1RH 2OCEA 3J81L 1D1IA 4FYDA 1X54A 1PZKD 1DGSA 4BXXG 2IHFA 2PYKA 2YTYA 1Z9FA 1SE4A 4LFBL 1SR3A 2WB1B 4DUYL 3UDGA 4WFN3 4GN5A 1KXLA 1NCVA 1S5FD 3TN2A 4PG3A 5HY6A 3J81i 3Q0AA 1VQFA 5CC4A 3HOXG 5JPNC 1DJRD 2NB0A 1ASYA 1EZ8A 2N55A 1H9SA 4DNIA 2E5LL 2E2JH 1PYSB 2F0QA 2UUCL 3GTKB 1D5MC 4ALPA 4UP8A 3PIO3 1HR0L 4OX9L 1NE3A 2UXBL 1PFMA 5M5YH 2P5ZX 4K6DA 3UE0A 4DR5L 4LF9Q 4I7AA 4K6LA 1EQRA 1FGUA 2VS1A 2V1CC 1SSOA 3BU2A 5CV6A 1Q46A 1XX8A 1FJGL 4RFBA 4JI3L 1YITA 2VQFQ 1SNQA 2JA7B 1Q12A 4KN7C 2UU9L 1WTQA 5JJIA 2F4IA 4C3JH 1K8OA 3NQIA 4AYBB 1F2ZA 5DEHA 1N8RC 3S1MH 2JA8G 1F2LA 2RQXA 3PO2B 3BDOA 4X64L 4ME3A 2NUCA 2MO0A 2SEBD 1GD7A 2ZTDA 5EQ0A 1Z7TA 4B3TQ 2KQ3A 2F0TA 4FXKC 5IIFA 3TS0A 3I90A 5A2QE 4A93G 1KLGD 4BXXH 5GAHC 2A69D 5BN4A 2QILA 3MZ5A 2VQEL 4BY1B 1G291 1D5XC 4FXGC 4R1JA 4JI6L 2Z6KA 4H44C 2CW0C 4A76A 1TWHB 4OL7A 1VQ6A 1HJPA 2NN6I 2HCIA 2X6GA 3A8KE 3M9BA 1SRUA 5CORA 3IFDA 5IT9c 4JI1Q 2NZOA 2RA4A 4X65L 1QG7A 4DAYA 1E24A 3I55A 2NWGA 4A3CG 4F87A 5IT9E 5A2QL 4XQJA 1D5ZC 1W6JA 2Z0SA 4JI0Q 4TRDA 1TWFH 2FHTA 4JI2Q 2Q2IA 4C3HB 3T1HQ 1BF4A 3G71A 2PQAB 4K5VA 1HNXQ 4NMZA 3NTKA 5J1ZA 2ATWA 3HOUH 2B29A 1KTKA 2B39A 3PIOA 5LMNQ 4B3RL 2X69A 5IT9L 2D9UA 3I91A 3M4PA 1VQGA 3Q22A 4C3IB 1PH3A 3FP9A 3TP8A 1MJEA 2H4OA 2SDFA 5C4JH 1IW7C 2L4NA 1CA6A 2XIWA 1CKNA 3OSOA 3K6OA 2HHHL 1EYAA 2IX3A 4A3KH 3E9IA 3K81C 4FDBA 4FO2A 5IY0A 2Y0SG 1JOKA 4ZKBB 1PRTD 2R7FA 5C3EH 4P75A 2Q8RE 1EQTA 1Q8KA 1SNMA 1WTXA 3IRBA 4HN7A 3HFZB 1G6ZA 1KDCA 5KEEA 3K5OA 4N8X1 1A3TA 4GN3B 3CKIB 4DR4L 1IYJB 4IALA 2EE1A 3ULLA 1K28A 1IBLQ 3GTGB 2MUYA 2QF7A 5IOCA 2I0QA 3G4SA 2QEXA 1HTPA 4RGTA 1VQIA 4IUPA 4JW0A 4XYOA 3S16B 4BBRG 3I3CA 4G7OC 3KJOA 3CC2A 5M3MB 2NVQH 1X56A 1GXDC 4JI7Q 3S2DB 1QVFA 2N88A 3NWSA 1K0SA 5GQOA 2R7ZG 4POGA 4A3MH 1CK1A 2AUKA 5IGCA 3GTJB 3Q24A 1DONA 4LUOA 4MIUA 2DY8A 1CQFA 1YHQA 4BY7G 2IT1A 3OYYA 4ZQ3A 2PQEA 4DUZQ 2IY5B 4LF5Q 2NTSA 1KIXA 4EX5A 5I2XA 1U4LA 1DZ1A 2YTVA 1VQNA 1KAWA 3CMAA 1IYVA 4B3ML 1UEBA 5CR3A 1F2YA 2KHJA 1EOVA 3K8AA 4X3UA 4K0KQ 3I4MB 4XDXA 3PMFA 5EAYA 5EPKA 1B70B 4HMIA 4HSVA 1TWGB 1H9RA 4R8NA 2YU9B 4JBKA 4OWWB 3PUYA 2TMPA 1PFSA 2XVSA 4L8JA 1JMCA 4DV5Q 4DU9A 4A3FG 3A74A 3A54A 4OONA 2C35B 3GV3A 1W2BA 1WD0A 2F0GA 1S5DD 2R7DA 2A8VA 2A6ED 1X3QA 1R4QB 3DXJC 3LWEA 2OT2A 3RN5A 2K05A 5FLXE 2HD3A 3X3MA 2R92B 3CP0A 3FPPA 2BE5D 2L5TA 4ILWA 4C1NI 3O13A 5KNCA 4X66Q 1N9WA 4CBVA 4DK1A 2K4KA 4NXNL 2E2JB 4GS3A 5IYCH 4J15A 3CPFA 1WCMB 2ZXPA 3NBHB 1JT8A 5IYBG 1YIJA 2KEEA 3HKZB 1EYCA 3GP7A 5FLXL 4Y52H 4A3BH 2EYMA 1VQHA 1J9OA 2A5HA 4LFAL 4YCWA 1N32L 1QWYA 1HHVA 2BA0A 4X62L 3GTOB 1O7LA 5CV7A 2EYFA 1UAPA 3MXGA 1TS4A 1PYWD 4OWTB 5COYA 4KK7A 1PV4A 4DR7Q 1G6PA 1J6QA 2JA7G 4IFDG 2A68C 4DN4M 5ELDA 2D0OA 3MEFA 3SHLA 4HJ8A 3WWVA 3A7AB 1LT3D 4WJ4A 3DWAA 4AYBG 4QY7A 3LGJA 2F0EA 4DXGA 3PO2G 5C0XJ 3M3YH 3AMUA 2CWAA 3R2IA 2K52A 1WTRA 2PW5A 3W2DA 4GKJL 4KY7A 3FDTA 5C5LA 3HG9A 3TBIB 2E2HH 1N33Q 4HJ7A 4DV3Q 1VQMA 4DK3C 2XGTA 3U9OA 1OXSC 3KBXA 1LACA 1PZID 4IPDA 1HTLD 1WTPA 3CMEA 1OO9B 3VR5A 2L1BA 1JCKB 2A1AA 4ME5A 5C3WA 5LMNW 1DOLA 4GOPC 2RSNA 2AHOB 3QG1A 1HZAA 2K03A 1EEFD 3AFPA 1MI2A 1ONLA 2K5QA 4IPGA 2FMCA 1CA5A 2XWBB 1TWFB 1SNDA 3OWFA 4JV5Q 1CHPD 1LT5D 3EJIA 5FLMH 3G7LA 4H13C 1I4PA 4X3SA 3HOYG 1DM0B 2SOBA 4NXML 1A15A 1ENAA 4GLVB 4U68A 3A8IE 4K5WA 4KV6A 5JVH3 1EZ6A 4QUFA 2B2YA 1KAAA 3M4YA 2KEDA 4L5QA 4X3KA 4YWKA 2NZHA 4V190 4DV7Q 1Q81C 2Z8LA 2A69C 2RHSB 4LF6L 4C3IG 4A3KB 1I94Q 3RLOA 4ZRZA 2JA8B 3UE1A 3H09A 3M7NA 2H5XA 1IL8A 3BS1A 4WJ3M 4KTAA 3U9SA 1FD7D 3S9WA 1ZYRD 3PIP3 3J80c 3MXUA 4R4IA 2B2UA 1K83H 2M2LA 3J80E 4CKEA 2PI2E 5BR8L 1PXUA 4R9WA 2O5JC 1SXTA 1KDBA 2ZXOA 4Z9CB 1KLUD 3K5MA 3CQZH 3CCVA 4A93B 3VYUA 4RH6A 5JOBA 1K73C 2SNMA 3CRKC 3F2CA 3CXCA 1XPOA 1EIHA 1OXXK 2EY6A 1VQ5A 4RA8A 4RKBA 4QJFA 2JEAI 4OWXB 1M90C 3PUZA 1AP0A 1GM5A 2EJGC 1XNQL 1YNND 4TQUS 2EY1A 4L6TB 3I56A 3J80L 4A3JG 4CKBA 1V1QA 5M3MG 4EQPA 5E1FA 2K01A 3KF6B 4A3MB 3KDFB 3HRZC 3Q6SA 1CUKA 1PRTC 5CBAE 1NY4A 1H9MA 1DYQA 4U673 4DPGA 1EU3A 1E22A 1YJWA 1H9KA 2CH4W 4DR2Q 4IPCA 1PHJA 1IBML 4A3GG 5E3FA 2NVYH 2XTIA 2L55A 1Q8IA 5HGQA 1V9PA 2WV6D 5DM73 4LF4L 5KYLA 1BCPB 1W3SA 3QOJA 3PF4A 1VQOA 3E0JA 1KL9A 4HJ9A 1WTHA 5IWAL 4PMCA 1II3A 4DGZA 2Y0SB 3NPPA 2ICIA 3PCOB 4IQZA 2Z6BA 2BH2A 1BUVT 1L0WA 4KHPL 4QCLA 4DKAC 3I4MG 2F0UA 4BBSH 2PZUA 3EFXD 1K8AC 3PGZA 3E0EA 1A2TA 4HSPA 4GNXB 4QMGA 5EBCA 4YCVA 3KLRA 2JYOA 2UUAQ 2NBFA 2PQAA 2X6LA 3F1ZA 4DV2Q 3HOZH 3NQTA 2CWPA 5EBDA 4EQOA 1STGA 2HDLA 3GDEA 1N36L 2BA1A 3M4OH 3MEHA 1P16A 2JK8A 1F9QA 3C1FA 3EQLC 1BKBA 5EKLA 4BBRB 1BBXC 1HH2P 1EWIA 1PTOC 1SAPA 3DHQA 3MHBA 1HUNA 5FKAC 2AWNA 2K04A 4RWSC 4ZCKA 2DGYA 4QIWB 5ELNA 3NHHA 4X3TA 5ELCA 1M4VA 2N49A 4L63B 2R7ZB 4LF7Q 1JOOA 1C9OA 4ABNA 1YEZA 1JJ2A 1QVGA 1HNWQ 4A3EH 4A3BB 3HKZG 4Y7NB 2F3VA 1TKWB 1HR0W 4BY7B 2HDMA 3KLSA 3GTLH 3TZDA 1AE3A 1Y8PB 2KECA 2G9HD 4IZ8A 5CV9A 2F0LA 2E2IH 1D7QA 4HIOA 2ZT9C 2WFWA 1FYCA 1VMPA 1NAPA 2A6EC 2GN5A 2RCNA 1D1KA 3RNUA 3K5LA 1WTWA 4KD4A 2K5VA 1NMGA 2B2WA 4C3JG 2BE5C 4B3SL 1RD9D 2Z6KC 4YHHQ 1MIUA 1BXTA 1QILA 4H0LC 4LMQD 3M3YB 1E2ZA 5GROA 2JA6H 4FF4A 2OTJA 1JE4A 1HCZA 1IZ6A 2WB1E 3NENA 1LLRD 3TP6A 3ICEA 1U4PA 2F4VL 3WOEA 2DY7A 1V8QA 4R4OA 4DR1Q 3T1YQ 2NN6H 3UDFA 3GV6A 3N52A 4J1MA 3P75A 1C8CA 4F88A 2ICEC 3HP3A 3MC0B 2JEBI
chains in the Genus database with same CATH topology
1MJCA 5C4JH 2HHHL 1CKNA 4KLKA 1I3QH 4NB3A 1A62A 3J80i 3A5UA 2JA5H 3GTQH 1NBWA 3K0XA 5LMNL 4A3KH 3E9IA 1HZ9A 3EN2A 3K81C 3I4NH 2UXDQ 4FDBA 5IP9G 1YI2A 4DR1L 3T1YL 5IY0A 2Y0SG 4A3EG 1AE2A 3RN2A 2F3IA 4DR4Q 5M3FH 4Y7NH 1PH5A 4BY7H 2R7FA 5C3EH 3DLLA 2WAQG 3AFQA 4P75A 3E9HA 2Y0SE 1GVPA 1Q8KA 4P74A 1TWHH 1U5KA 3IRBA 5FJ8H 3CD6A 4DV6Q 3HFZB 2UXDL 1YVCA 3AYHB 2WAQE 4DV4L 4H02A 3FHWA 1U0LA 3B6YA 2MFIA 1LUZA 4GN3B 2Q2UA 4DR4L 1IYJB 3GTPH 1IBLQ 2UXCQ 3ULLA 4DAYB 1P8LA 5DLQE 4GN4B 3CCJA 1QZGA 1PA6A 3GD7A 1KHIA 2I0QA 3G4SA 1JE5A 2QEXA 4DV6L 4HJAA 4C3HH 4GKKQ 1XNRQ 1E1OA 1VQIA 2NVTH 4LWCA 4BA1I 4EQ5A 3KF8B 3FKIH 2UXCL 3M85A 1IBLL 3HOUG 1HZCA 1T9HA 4BBRG 2JA6G 4O2DA 3AEVA 4OXPA 3BZKA 3KJOA 3KLWA 3CC2A 3PUXA 4IOAA 3OW2A 2NVQH 3S17H 3ULJA 1X56A 2ES2A 4LUVA 4GKKL 4GLXA 4A3FH 1XNRL 4QQBX 4JI7Q 2QGQA 3KOJA 2NN6G 2Q2HA 3SGIA 4A3LH 4JI8Q 1QVFA 1VQCA 1WJJA 2K5NA 5GQOA 5ELOA 2K50A 2KCTA 2R7ZG 3G48A 4L5SA 1J5EQ 4A3MH 4POGA 4OO1I 2PMZE 5GADC 1FL0A 5E7NA 3PIPA 5C4XH 1XMOQ 2JA5G 2JE6I 3U4ZA 4A3KG 2HIVA 3I4NG 1CKNB 2AMCB 1SLJA 4LUOA 4JI7L 3VDYA 3AQQA 4PZ6A 4JI8L 4BY1G 1ASZA 1YHQA 5M3FG 4B3MQ 3RZDH 1V43A 4BY7G 2IT1A 3OYYA 5C3EG 1LYLA 4LFCQ 1J5EL 3CC7A 1UE7A 1R9TH 2NVXH 4DUZQ 3CF5A 2IY5B 2KHIA 2AKWB 1XMOL 4LF5Q 5FJ8G 1N34Q 4HIMA 2AWOA 3KYHC 1KIXA 4A3IG 4EX5A 2N8NA 2YTVA 1VQNA 4IFDI 1KAWA 3CMAA 5IYBH 1BBUA 4B3ML 1UEBA 4MZ9A 4L5RC 2OQKA 5M5WH 3GTGH 4LFCL 2KHJA 3GTKH 4BA2I 4IJLA 1EOVA 1B7YB 4DUZL 3JAMc 1IL2A 2RHQB 4LF5L 3K8AA 1N34L 5IP9H 4K0KQ 1S40A 4A75A 1K8GA 1Q86C 3STBC 3S14H 5AJ3Q 5EAYA 1B70B 1VCIA 4UP7A 4PZ8A 2R6GA 1KD1C 2GVAA 3A0JA 4JBKA 2K75A 4OWWB 3PUYA 1PFSA 1OXVA 1RL2A 5JJKA 3CCMA 3D0FA 2OQ0A 4P73A 1PYBA 5IYDG 4DV5Q 1JMCA 4A3FG 3L7ZC 3RZOH 4K0KL 2K5HA 3A74A 4A3LG 3KFUA 4OONA 1PVOA 2C35B 2ID0A 5AJ3L 1YJNA 2ZJQA 4R4QA 3TS2A 1W2BA 2ZTCA 2JA7H 1Y1WG 5C0XI 2R7DA 4A3MG 2A8VA 1XTDA 4XTCS 3U50C 1X65A 4KHZA 4DR6Q 4NXNQ 1HZBA 4DV5L 3RN5A 2QA4A 1S72A 3PO2H 1EIYB 4QL5A 3CP0A 1UE1A 1Y1VG 4DK6C 1MKHA 4LUZA 1RIPA 4APVA 4X66Q 4JI0L 1N9WA 4A4IA 3F2DA 1UE5A 1VQPA 1PH4A 3A5ZB 1O7IA 2K4KA 1TWCH 4YY3Q 3U58A 1IXRA 4NXNL 1PH8A 1BBWA 3PUVA 3JC66 4GS3A 5IYCH 3J81c 5JEAJ 4J15A 3CPFA 4UPAA 3ERSX 1CSPA 3NBHB 4LFAQ 1JT8A 5IYBG 1PH9A 1N32Q 4RG1A 1Q1EA 1YIJA 1SMXA 4X66L 4X62Q 1QVCA 3UDIA 4AH6A 1VQ7A 4IOCA 4YY3L 3TREA 4Y52H 4IFDJ 2N78A 1UE6A 1NJIC 1XJVA 4OO1G 4MNOA 1JJGA 2MQHA 2ASBA 4A3BH 4BY1H 1SN8A 1VQHA 1HNZQ 4LFAL 1OXUA 4YCWA 1N32L 3CCLA 2BA0A 3BZCA 2L15A 4NPSA 4X62L 2VZAA 1FVIA 1E3PA 2IHEA 3I2ZA 4A3IH 1PH2A 2FXQA 4JBMA 4LF8Q 4OWTB 4YWLA 2B63H 1PV4A 1VQ9A 2CCZA 1HNZL 3PO3H 4DR7Q 4JI4Q 1PH1A 1G6PA 1J6QA 2JA7G 4IFDG 4GKJQ 3HOYH 1AH9A 1E1TA 3RLFA 2D0OA 3MEFA 1L1OA 4HJ8A 3WWVA 3ZJYC 1VQ8A 4WJ4A 4AYBG 4QY7A 3LGJA 4LF8L 1LTLA 2EIFA 4A3DH 2ALYB 3PO2G 5C0XJ 3M3YH 4P72A 2VW9A 2R92H 1CSQA 4DR7L 4JI4L 2CWAA 3S2HH 2JQOA 2KENA 1CKOA 2K52A 1JJCB 4AYBE 4GKJL 3HOVG 4P71A 3TQYA 3OTOQ 4GLAC 2VUMH 5IYDH 3W5OA 1I5FA 2WP8J 4GOPA 1E7ZA 1VQEA 2E2HH 1N33Q 5IYCG 4C3IH 1K0RA 1IBKQ 4HJ7A 4DV3Q 1VQMA 4DK3C 5C44G 1X3FA 4JOIA 1WCMH 2XGTA 4IO9A 2R93H 1OXSC 1Y1WH 1L1OC 1I6HH 4QIWE 2I5MX 4JYAQ 2D62A 4IPDA 2OWOA 2EQSA 1YBYA 3PSIA 3OTOL 5C0XG 3CMEA 2IX0A 1N33L 4LNQA 1SFOH 1K3RA 3CCEA 4HIDA 1IBKL 4A3BG 1Y1VH 1VS0A 1VQJA 2A1AA 4DV3L 1TWAH 4PZ7A 3H0GH 5LMNW 4IJHA 1OXTA 2LXJA 4GOPC 4JYAL 3GTOH 3S1NH 2AHOB 4R4TA 1HZAA 5IP7H 1QZHA 2GVBA 3AFPA 2ZJPA 4NXMQ 4JOIC 2VL6A 4IPGA 2KCMA 4JBJA 1WYDA 3F8TA 2YYZA 1I50H 2B63G 3PO3G 1WI5A 4DV1Q 3PF5A 4JV5Q 2PNHA 1KRSA 5FLMH 3HOYG 2I5LX 3EIVA 4JI5Q 4NXML 4MTNA 4GLVB 4PMWA 3CCRA 2YV5A 3NELA 1VQLA 1KQSA 4A3DG 4LF6Q 1VQDA 1L1OB 4A3JH 2R92G 3TEHB 4L5QA 2ZTEA 4DV1L 1XPUA 3S16H 1G51A 4AQYQ 4JV5L 3KF6A 4YWKA 3STBD 2NZHA 4IPHA 4JG2A 3KDFA 1VQAA 4TVAB 5M3MH 3CCQA 3H3VI 4JI5L 3Q8DA 4DV7Q 1YHBA 1Q81C 5K36G 2VUMG 4R4CA 4JC0A 2R7ZH 1EUJA 2RHSB 3S2DH 4LF6L 5J3BA 1I94Q 5LMUQ 3RLOA 1XMQQ 2E8GA 1WCMG 4GOPB 2R93G 4AQYL 1PH6A 3UE1A 3J7ZC 5BR8Q 1X3GA 2F52A 2H5XA 3M7NA 1QUQA 2YTXA 4WJ3M 1C0AA 4DV7L 3GTJH 2BH8A 3K7AH 3HOXH 4A3GH 1C7YA 1NTGA 3J80c 3GO5A 4R4IA 1Q7YC 5LMUL 1XMQL 1I94L 2JA9A 1CKMA 3ER0A 1K83H 3H0GG 4RMFA 2UUBQ 3UDXA 2PI2E 5BR8L 3CCUA 3HOVH 3JAMi 3EBEA 1EIFA 5IP7G 2ZM6Q 4DR6L 3CQZH 3CCVA 1EFWA 4DV0Q 3H3VH 1XNQQ 2DUDA 2A19A 3RLNA 5C44H 3S24A 3F2CA 1VQBA 3CXCA 1XPOA 1K73C 1WFQA 3U4VA 5GAEC 1OXXK 4DR3Q 1VQ5A 3CAMA 4C2MH 4QJFA 5FLMG 4JCVE 1SROA 2JEAI 4OWXB 3CCSA 2ZM6L 1A63A 2CQOA 1M90C 2B3GA 3MXNB 3PUZA 2ZJRA 4POFA 1X9NA 4DV0L 1Z47A 1GM5A 1XNQL 3I4MH 4TQUS 2IX1A 3G6EA 3I4OA 3I56A 4A3JG 4GNXA 1KC8C 1V1QA 1TWGH 4LFBQ 3CW2C 2EXDA 5IE8A 4DR3L 4DUYQ 1K9MC 2YU9H 3HOWG 5H1SE 1KRTA 5JEAG 5M3MG 2N3SA 4KI0A 3KF6B 3S1RH 5JJLA 1Q82C 2OCEA 3KDFB 1X54A 1IBMQ 3J7A5 1DGSA 3PV0A 4BXXG 2IHFA 2YTYA 4JBWA 5GAGC 1Z9FA 1CUKA 4LFBL 1NY4A 4DV4Q 1SR3A 2JA8H 4DUYL 3PUWA 1EQQA 2E5LQ 3UDGA 3D31A 4GN5A 4LW1A 4LF4Q 1KXLA 4AIMA 4DPGA 2Q2TA 4PG3A 5HY6A 3K80C 3J81i 1VQFA 1QUQB 4GNXC 3ULPA 2UUCQ 1E22A 2CFMA 3HOXG 1YJWA 2VY3A 4DR2Q 4IPCA 1PHJA 1HR0Q 1IBML 4A3GG 5IWAQ 1ASYA 2NVYH 2XTIA 5HGQA 1LM0A 2KBNA 4OX9Q 4YCUA 1V9PA 4DNIA 2E5LL 2UXBQ 3I7FA 4LF4L 4DR5Q 1Y14B 1X6OA 4KHPQ 2E2JH 1W3SA 1PYSB 3CC4A 3PF4A 1VQOA 2UUCL 1KL9A 1OTCA 4HJ9A 4A93H 2VNUD 4ALPA 4UP8A 4DR2L 1HR0L 2RF4A 1D8LA 5IWAL 2LXKA 1JB7A 1WOCA 4OX9L 1FJGQ 3GTMH 1NE3A 1A0IA 3PCOB 3L0OA 3H15A 2UXBL 5M5YH 5M5XH 3UE0A 4DR5L 4JI3Q 4LF9Q 2BH2A 1L0WA 4KHPL 1EQRA 3DM3A 1FGUA 4DKAC 4UY8C 2VS1A 3I4MG 4O0AA 2V1CC 2UU9Q 4QGUA 4BBSH 3BU2A 3HKSA 1YJ9A 2K14A 1Q46A 3CPWA 1N36Q 1K8AC 2HQLA 1VQKA 1FJGL 1B8AA 4A3CH 3PGZA 1NMFA 3E0EA 4HJ5A 4GNXB 4X64Q 4YCVA 4JI3L 1YITA 1UWVA 2VQFQ 2UUAQ 4LF9L 1Q12A 3TRZA 1GO3E 2PQAA 3F1ZA 4DV2Q 3HOZH 4UP9A 2UU9L 2CWPA 3W1GA 5JJIA 4C3JH 2HIXA 4XIGS 1N36L 3GDEA 2BA1A 1S3OA 1YNXA 1N8RC 2JA8G 3S1MH 3M4OH 3W1BA 1P16A 1L2FA 2JK8A 1BKBA 4X64L 1M1KC 4HIKA 2UUAL 2VQFL 4ME3A 3KJPA 2MO0A 1HH2P 1EWIA 1GD7A 2JJQA 2ZTDA 3RR5A 4L5TA 4DV2L 1X55A 1SE8A 2AWNA 2DGYA 5ELNA 3HOWH 2VQEQ 3S1QH 2N49A 4B3TQ 4JI6Q 4LF7Q 1C9OA 3TS0A 3NEMA 1YEZA 1VQ4A 4A93G 2PI2A 3J81j 4BXXH 5GAHC 1JJ2A 1QVGA 2I5HA 4X65Q 1HNWQ 2VQEL 2D0PA 4A3EH 1A8VA 1G291 3HKZG 4B3TL 4R1JA 1HR0W 4JI6L 3GTLH 4LF7L 3FKIG 1AE3A 4YWMA 1XPRA 2Z6KA 2OTLA 4A76A 3HKZE 2E2IH 1HJPA 1VQ6A 2NN6I 3M9BA 4BBSG 1SRUA 1D7QA 3BJUA 5IT9c 4JI1Q 1GKHA 2NZOA 2WFWA 4X65L 4HIOA 4B3SQ 1HNWL 1E24A 4DAMA 3M4QA 3L2PA 3I55A 2MNAA 4A3CG 2GN5A 2RCNA 3RNUA 2Z0SA 4JI0Q 2HT1A 1H95A 3HOZG 4X6AH 2K5VA 1TWFH 5FLXc 4JI2Q 1NMGA 3S15H 2Q2IA 2UUBL 2F4VQ 3T1HQ 4B3RQ 5C4XG 4JI1L 3G71A 2PQAB 1PH7A 4B3SL 1HNXQ 1YHAA 2Z6KC 2WB1G 4YHHQ 1MIUA 3F2BA 1EYGA 2ATWA 1BVSA 3HOUH 2B29A 5GROA 2JA6H 4BBRH 2OTJA 2HHHQ 1X3EA 1IZ6A 2WB1E 3NENA 2LSSA 3PIOA 5LMNQ 4JI2L 3ICEA 4B3RL 1YZ6A 2F4VL 3T1HL 1TXYA 3K7UC 3M4PA 4R4OA 4DR1Q 3T1YQ 1VQGA 1HNXL 1PH3A 1Q1BA 3FP9A 3UDFA 4YHHL 1MJEA 2MO1A 2CKZB 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJC A;  5C4J H;  2HHH L;  1CKN A;  4KLK A;  1I3Q H;  4NB3 A;  1A62 A;  3J80 i;  3A5U A;  2JA5 H;  3GTQ H;  1NBW A;  3K0X A;  5LMN L;  4A3K H;  3E9I A;  1HZ9 A;  3EN2 A;  3K81 C;  3I4N H;  2UXD Q;  4FDB A;  5IP9 G;  1YI2 A;  4DR1 L;  3T1Y L;  5IY0 A;  2Y0S G;  4A3E G;  1AE2 A;  3RN2 A;  2F3I A;  4DR4 Q;  5M3F H;  4Y7N H;  1PH5 A;  4BY7 H;  2R7F A;  5C3E H;  3DLL A;  2WAQ G;  3AFQ A;  4P75 A;  3E9H A;  2Y0S E;  1GVP A;  1Q8K A;  4P74 A;  1TWH H;  1U5K A;  3IRB A;  5FJ8 H;  3CD6 A;  4DV6 Q;  3HFZ B;  2UXD L;  1YVC A;  3AYH B;  2WAQ E;  4DV4 L;  4H02 A;  3FHW A;  1U0L A;  3B6Y A;  2MFI A;  1LUZ A;  4GN3 B;  2Q2U A;  4DR4 L;  1IYJ B;  3GTP H;  1IBL Q;  2UXC Q;  3ULL A;  4DAY B;  1P8L A;  5DLQ E;  4GN4 B;  3CCJ A;  1QZG A;  1PA6 A;  3GD7 A;  1KHI A;  2I0Q A;  3G4S A;  1JE5 A;  2QEX A;  4DV6 L;  4HJA A;  4C3H H;  4GKK Q;  1XNR Q;  1E1O A;  1VQI A;  2NVT H;  4LWC A;  4BA1 I;  4EQ5 A;  3KF8 B;  3FKI H;  2UXC L;  3M85 A;  1IBL L;  3HOU G;  1HZC A;  1T9H A;  4BBR G;  2JA6 G;  4O2D A;  3AEV A;  4OXP A;  3BZK A;  3KJO A;  3KLW A;  3CC2 A;  3PUX A;  4IOA A;  3OW2 A;  2NVQ H;  3S17 H;  3ULJ A;  1X56 A;  2ES2 A;  4LUV A;  4GKK L;  4GLX A;  4A3F H;  1XNR L;  4QQB X;  4JI7 Q;  2QGQ A;  3KOJ A;  2NN6 G;  2Q2H A;  3SGI A;  4A3L H;  4JI8 Q;  1QVF A;  1VQC A;  1WJJ A;  2K5N A;  5GQO A;  5ELO A;  2K50 A;  2KCT A;  2R7Z G;  3G48 A;  4L5S A;  1J5E Q;  4A3M H;  4POG A;  4OO1 I;  2PMZ E;  5GAD C;  1FL0 A;  5E7N A;  3PIP A;  5C4X H;  1XMO Q;  2JA5 G;  2JE6 I;  3U4Z A;  4A3K G;  2HIV A;  3I4N G;  1CKN B;  2AMC B;  1SLJ A;  4LUO A;  4JI7 L;  3VDY A;  3AQQ A;  4PZ6 A;  4JI8 L;  4BY1 G;  1ASZ A;  1YHQ A;  5M3F G;  4B3M Q;  3RZD H;  1V43 A;  4BY7 G;  2IT1 A;  3OYY A;  5C3E G;  1LYL A;  4LFC Q;  1J5E L;  3CC7 A;  1UE7 A;  1R9T H;  2NVX H;  4DUZ Q;  3CF5 A;  2IY5 B;  2KHI A;  2AKW B;  1XMO L;  4LF5 Q;  5FJ8 G;  1N34 Q;  4HIM A;  2AWO A;  3KYH C;  1KIX A;  4A3I G;  4EX5 A;  2N8N A;  2YTV A;  1VQN A;  4IFD I;  1KAW A;  3CMA A;  5IYB H;  1BBU A;  4B3M L;  1UEB A;  4MZ9 A;  4L5R C;  2OQK A;  5M5W H;  3GTG H;  4LFC L;  2KHJ A;  3GTK H;  4BA2 I;  4IJL A;  1EOV A;  1B7Y B;  4DUZ L;  3JAM c;  1IL2 A;  2RHQ B;  4LF5 L;  3K8A A;  1N34 L;  5IP9 H;  4K0K Q;  1S40 A;  4A75 A;  1K8G A;  1Q86 C;  3STB C;  3S14 H;  5AJ3 Q;  5EAY A;  1B70 B;  1VCI A;  4UP7 A;  4PZ8 A;  2R6G A;  1KD1 C;  2GVA A;  3A0J A;  4JBK A;  2K75 A;  4OWW B;  3PUY A;  1PFS A;  1OXV A;  1RL2 A;  5JJK A;  3CCM A;  3D0F A;  2OQ0 A;  4P73 A;  1PYB A;  5IYD G;  4DV5 Q;  1JMC A;  4A3F G;  3L7Z C;  3RZO H;  4K0K L;  2K5H A;  3A74 A;  4A3L G;  3KFU A;  4OON A;  1PVO A;  2C35 B;  2ID0 A;  5AJ3 L;  1YJN A;  2ZJQ A;  4R4Q A;  3TS2 A;  1W2B A;  2ZTC A;  2JA7 H;  1Y1W G;  5C0X I;  2R7D A;  4A3M G;  2A8V A;  1XTD A;  4XTC S;  3U50 C;  1X65 A;  4KHZ A;  4DR6 Q;  4NXN Q;  1HZB A;  4DV5 L;  3RN5 A;  2QA4 A;  1S72 A;  3PO2 H;  1EIY B;  4QL5 A;  3CP0 A;  1UE1 A;  1Y1V G;  4DK6 C;  1MKH A;  4LUZ A;  1RIP A;  4APV A;  4X66 Q;  4JI0 L;  1N9W A;  4A4I A;  3F2D A;  1UE5 A;  1VQP A;  1PH4 A;  3A5Z B;  1O7I A;  2K4K A;  1TWC H;  4YY3 Q;  3U58 A;  1IXR A;  4NXN L;  1PH8 A;  1BBW A;  3PUV A;  3JC6 6;  4GS3 A;  5IYC H;  3J81 c;  5JEA J;  4J15 A;  3CPF A;  4UPA A;  3ERS X;  1CSP A;  3NBH B;  4LFA Q;  1JT8 A;  5IYB G;  1PH9 A;  1N32 Q;  4RG1 A;  1Q1E A;  1YIJ A;  1SMX A;  4X66 L;  4X62 Q;  1QVC A;  3UDI A;  4AH6 A;  1VQ7 A;  4IOC A;  4YY3 L;  3TRE A;  4Y52 H;  4IFD J;  2N78 A;  1UE6 A;  1NJI C;  1XJV A;  4OO1 G;  4MNO A;  1JJG A;  2MQH A;  2ASB A;  4A3B H;  4BY1 H;  1SN8 A;  1VQH A;  1HNZ Q;  4LFA L;  1OXU A;  4YCW A;  1N32 L;  3CCL A;  2BA0 A;  3BZC A;  2L15 A;  4NPS A;  4X62 L;  2VZA A;  1FVI A;  1E3P A;  2IHE A;  3I2Z A;  4A3I H;  1PH2 A;  2FXQ A;  4JBM A;  4LF8 Q;  4OWT B;  4YWL A;  2B63 H;  1PV4 A;  1VQ9 A;  2CCZ A;  1HNZ L;  3PO3 H;  4DR7 Q;  4JI4 Q;  1PH1 A;  1G6P A;  1J6Q A;  2JA7 G;  4IFD G;  4GKJ Q;  3HOY H;  1AH9 A;  1E1T A;  3RLF A;  2D0O A;  3MEF A;  1L1O A;  4HJ8 A;  3WWV A;  3ZJY C;  1VQ8 A;  4WJ4 A;  4AYB G;  4QY7 A;  3LGJ A;  4LF8 L;  1LTL A;  2EIF A;  4A3D H;  2ALY B;  3PO2 G;  5C0X J;  3M3Y H;  4P72 A;  2VW9 A;  2R92 H;  1CSQ A;  4DR7 L;  4JI4 L;  2CWA A;  3S2H H;  2JQO A;  2KEN A;  1CKO A;  2K52 A;  1JJC B;  4AYB E;  4GKJ L;  3HOV G;  4P71 A;  3TQY A;  3OTO Q;  4GLA C;  2VUM H;  5IYD H;  3W5O A;  1I5F A;  2WP8 J;  4GOP A;  1E7Z A;  1VQE A;  2E2H H;  1N33 Q;  5IYC G;  4C3I H;  1K0R A;  1IBK Q;  4HJ7 A;  4DV3 Q;  1VQM A;  4DK3 C;  5C44 G;  1X3F A;  4JOI A;  1WCM H;  2XGT A;  4IO9 A;  2R93 H;  1OXS C;  1Y1W H;  1L1O C;  1I6H H;  4QIW E;  2I5M X;  4JYA Q;  2D62 A;  4IPD A;  2OWO A;  2EQS A;  1YBY A;  3PSI A;  3OTO L;  5C0X G;  3CME A;  2IX0 A;  1N33 L;  4LNQ A;  1SFO H;  1K3R A;  3CCE A;  4HID A;  1IBK L;  4A3B G;  1Y1V H;  1VS0 A;  1VQJ A;  2A1A A;  4DV3 L;  1TWA H;  4PZ7 A;  3H0G H;  5LMN W;  4IJH A;  1OXT A;  2LXJ A;  4GOP C;  4JYA L;  3GTO H;  3S1N H;  2AHO B;  4R4T A;  1HZA A;  5IP7 H;  1QZH A;  2GVB A;  3AFP A;  2ZJP A;  4NXM Q;  4JOI C;  2VL6 A;  4IPG A;  2KCM A;  4JBJ A;  1WYD A;  3F8T A;  2YYZ A;  1I50 H;  2B63 G;  3PO3 G;  1WI5 A;  4DV1 Q;  3PF5 A;  4JV5 Q;  2PNH A;  1KRS A;  5FLM H;  3HOY G;  2I5L X;  3EIV A;  4JI5 Q;  4NXM L;  4MTN A;  4GLV B;  4PMW A;  3CCR A;  2YV5 A;  3NEL A;  1VQL A;  1KQS A;  4A3D G;  4LF6 Q;  1VQD A;  1L1O B;  4A3J H;  2R92 G;  3TEH B;  4L5Q A;  2ZTE A;  4DV1 L;  1XPU A;  3S16 H;  1G51 A;  4AQY Q;  4JV5 L;  3KF6 A;  4YWK A;  3STB D;  2NZH A;  4IPH A;  4JG2 A;  3KDF A;  1VQA A;  4TVA B;  5M3M H;  3CCQ A;  3H3V I;  4JI5 L;  3Q8D A;  4DV7 Q;  1YHB A;  1Q81 C;  5K36 G;  2VUM G;  4R4C A;  4JC0 A;  2R7Z H;  1EUJ A;  2RHS B;  3S2D H;  4LF6 L;  5J3B A;  1I94 Q;  5LMU Q;  3RLO A;  1XMQ Q;  2E8G A;  1WCM G;  4GOP B;  2R93 G;  4AQY L;  1PH6 A;  3UE1 A;  3J7Z C;  5BR8 Q;  1X3G A;  2F52 A;  2H5X A;  3M7N A;  1QUQ A;  2YTX A;  4WJ3 M;  1C0A A;  4DV7 L;  3GTJ H;  2BH8 A;  3K7A H;  3HOX H;  4A3G H;  1C7Y A;  1NTG A;  3J80 c;  3GO5 A;  4R4I A;  1Q7Y C;  5LMU L;  1XMQ L;  1I94 L;  2JA9 A;  1CKM A;  3ER0 A;  1K83 H;  3H0G G;  4RMF A;  2UUB Q;  3UDX A;  2PI2 E;  5BR8 L;  3CCU A;  3HOV H;  3JAM i;  3EBE A;  1EIF A;  5IP7 G;  2ZM6 Q;  4DR6 L;  3CQZ H;  3CCV A;  1EFW A;  4DV0 Q;  3H3V H;  1XNQ Q;  2DUD A;  2A19 A;  3RLN A;  5C44 H;  3S24 A;  3F2C A;  1VQB A;  3CXC A;  1XPO A;  1K73 C;  1WFQ A;  3U4V A;  5GAE C;  1OXX K;  4DR3 Q;  1VQ5 A;  3CAM A;  4C2M H;  4QJF A;  5FLM G;  4JCV E;  1SRO A;  2JEA I;  4OWX B;  3CCS A;  2ZM6 L;  1A63 A;  2CQO A;  1M90 C;  2B3G A;  3MXN B;  3PUZ A;  2ZJR A;  4POF A;  1X9N A;  4DV0 L;  1Z47 A;  1GM5 A;  1XNQ L;  3I4M H;  4TQU S;  2IX1 A;  3G6E A;  3I4O A;  3I56 A;  4A3J G;  4GNX A;  1KC8 C;  1V1Q A;  1TWG H;  4LFB Q;  3CW2 C;  2EXD A;  5IE8 A;  4DR3 L;  4DUY Q;  1K9M C;  2YU9 H;  3HOW G;  5H1S E;  1KRT A;  5JEA G;  5M3M G;  2N3S A;  4KI0 A;  3KF6 B;  3S1R H;  5JJL A;  1Q82 C;  2OCE A;  3KDF B;  1X54 A;  1IBM Q;  3J7A 5;  1DGS A;  3PV0 A;  4BXX G;  2IHF A;  2YTY A;  4JBW A;  5GAG C;  1Z9F A;  1CUK A;  4LFB L;  1NY4 A;  4DV4 Q;  1SR3 A;  2JA8 H;  4DUY L;  3PUW A;  1EQQ A;  2E5L Q;  3UDG A;  3D31 A;  4GN5 A;  4LW1 A;  4LF4 Q;  1KXL A;  4AIM A;  4DPG A;  2Q2T A;  4PG3 A;  5HY6 A;  3K80 C;  3J81 i;  1VQF A;  1QUQ B;  4GNX C;  3ULP A;  2UUC Q;  1E22 A;  2CFM A;  3HOX G;  1YJW A;  2VY3 A;  4DR2 Q;  4IPC A;  1PHJ A;  1HR0 Q;  1IBM L;  4A3G G;  5IWA Q;  1ASY A;  2NVY H;  2XTI A;  5HGQ A;  1LM0 A;  2KBN A;  4OX9 Q;  4YCU A;  1V9P A;  4DNI A;  2E5L L;  2UXB Q;  3I7F A;  4LF4 L;  4DR5 Q;  1Y14 B;  1X6O A;  4KHP Q;  2E2J H;  1W3S A;  1PYS B;  3CC4 A;  3PF4 A;  1VQO A;  2UUC L;  1KL9 A;  1OTC A;  4HJ9 A;  4A93 H;  2VNU D;  4ALP A;  4UP8 A;  4DR2 L;  1HR0 L;  2RF4 A;  1D8L A;  5IWA L;  2LXK A;  1JB7 A;  1WOC A;  4OX9 L;  1FJG Q;  3GTM H;  1NE3 A;  1A0I A;  3PCO B;  3L0O A;  3H15 A;  2UXB L;  5M5Y H;  5M5X H;  3UE0 A;  4DR5 L;  4JI3 Q;  4LF9 Q;  2BH2 A;  1L0W A;  4KHP L;  1EQR A;  3DM3 A;  1FGU A;  4DKA C;  4UY8 C;  2VS1 A;  3I4M G;  4O0A A;  2V1C C;  2UU9 Q;  4QGU A;  4BBS H;  3BU2 A;  3HKS A;  1YJ9 A;  2K14 A;  1Q46 A;  3CPW A;  1N36 Q;  1K8A C;  2HQL A;  1VQK A;  1FJG L;  1B8A A;  4A3C H;  3PGZ A;  1NMF A;  3E0E A;  4HJ5 A;  4GNX B;  4X64 Q;  4YCV A;  4JI3 L;  1YIT A;  1UWV A;  2VQF Q;  2UUA Q;  4LF9 L;  1Q12 A;  3TRZ A;  1GO3 E;  2PQA A;  3F1Z A;  4DV2 Q;  3HOZ H;  4UP9 A;  2UU9 L;  2CWP A;  3W1G A;  5JJI A;  4C3J H;  2HIX A;  4XIG S;  1N36 L;  3GDE A;  2BA1 A;  1S3O A;  1YNX A;  1N8R C;  2JA8 G;  3S1M H;  3M4O H;  3W1B A;  1P16 A;  1L2F A;  2JK8 A;  1BKB A;  4X64 L;  1M1K C;  4HIK A;  2UUA L;  2VQF L;  4ME3 A;  3KJP A;  2MO0 A;  1HH2 P;  1EWI A;  1GD7 A;  2JJQ A;  2ZTD A;  3RR5 A;  4L5T A;  4DV2 L;  1X55 A;  1SE8 A;  2AWN A;  2DGY A;  5ELN A;  3HOW H;  2VQE Q;  3S1Q H;  2N49 A;  4B3T Q;  4JI6 Q;  4LF7 Q;  1C9O A;  3TS0 A;  3NEM A;  1YEZ A;  1VQ4 A;  4A93 G;  2PI2 A;  3J81 j;  4BXX H;  5GAH C;  1JJ2 A;  1QVG A;  2I5H A;  4X65 Q;  1HNW Q;  2VQE L;  2D0P A;  4A3E H;  1A8V A;  1G29 1;  3HKZ G;  4B3T L;  4R1J A;  1HR0 W;  4JI6 L;  3GTL H;  4LF7 L;  3FKI G;  1AE3 A;  4YWM A;  1XPR A;  2Z6K A;  2OTL A;  4A76 A;  3HKZ E;  2E2I H;  1HJP A;  1VQ6 A;  2NN6 I;  3M9B A;  4BBS G;  1SRU A;  1D7Q A;  3BJU A;  5IT9 c;  4JI1 Q;  1GKH A;  2NZO A;  2WFW A;  4X65 L;  4HIO A;  4B3S Q;  1HNW L;  1E24 A;  4DAM A;  3M4Q A;  3L2P A;  3I55 A;  2MNA A;  4A3C G;  2GN5 A;  2RCN A;  3RNU A;  2Z0S A;  4JI0 Q;  2HT1 A;  1H95 A;  3HOZ G;  4X6A H;  2K5V A;  1TWF H;  5FLX c;  4JI2 Q;  1NMG A;  3S15 H;  2Q2I A;  2UUB L;  2F4V Q;  3T1H Q;  4B3R Q;  5C4X G;  4JI1 L;  3G71 A;  2PQA B;  1PH7 A;  4B3S L;  1HNX Q;  1YHA A;  2Z6K C;  2WB1 G;  4YHH Q;  1MIU A;  3F2B A;  1EYG A;  2ATW A;  1BVS A;  3HOU H;  2B29 A;  5GRO A;  2JA6 H;  4BBR H;  2OTJ A;  2HHH Q;  1X3E A;  1IZ6 A;  2WB1 E;  3NEN A;  2LSS A;  3PIO A;  5LMN Q;  4JI2 L;  3ICE A;  4B3R L;  1YZ6 A;  2F4V L;  3T1H L;  1TXY A;  3K7U C;  3M4P A;  4R4O A;  4DR1 Q;  3T1Y Q;  1VQG A;  1HNX L;  1PH3 A;  1Q1B A;  3FP9 A;  3UDF A;  4YHH L;  1MJE A;  2MO1 A;  2CKZ B;  2JEB I; 
#chains in the Genus database with same CATH topology
 5CV8 A;  4BWG B;  4NB3 A;  1O7Y A;  2JA5 H;  3K0X A;  3DM1 A;  1SYF A;  3FMC A;  5IP9 G;  1EY9 A;  1JIC A;  1AE2 A;  5L37 A;  1BCP F;  3ZYY X;  5M3F H;  4KKT A;  3DLL A;  2WAQ G;  2A68 D;  4NP5 A;  4PQX A;  3EVQ A;  2MGS A;  3K5N A;  3BZD B;  5FJ8 H;  5HGT A;  4DV6 Q;  2UXD L;  1QOH A;  4H02 A;  4CHT B;  1LUZ A;  2EY2 A;  1Q90 A;  2Q2U A;  5M5W B;  1GUG A;  2ENB A;  4GN4 B;  1QZG A;  1PA6 A;  1NR4 A;  4EQN A;  4HJA A;  2KJX A;  1EY0 A;  2NVT H;  4LWC A;  4BA1 I;  2J7Z A;  3KF8 B;  4EQ5 A;  5FO7 B;  2UXC L;  3VR3 A;  3HOU G;  1SYG A;  1T9H A;  4IUU A;  1IYU A;  3AEV A;  3KLW A;  3PUX A;  4RCN A;  3OW2 A;  3S17 H;  1EYD A;  2RVL A;  1LO5 D;  1VDZ A;  5CYU A;  4LUV A;  4GKK L;  1XNR L;  2QGQ A;  1CHQ D;  3KOJ A;  1VQC A;  1WJJ A;  4KY5 A;  3G48 A;  1ET6 A;  1MSH A;  1J5E Q;  4OO1 I;  5E7N A;  1LTR D;  1XMO Q;  2JE6 I;  4A3K G;  3T51 B;  1EQV A;  2EOT A;  1TS2 A;  3MXP A;  4N9P A;  4JI8 L;  1K83 B;  1RTN A;  3RZD H;  4RHS A;  5C3E G;  1ICF B;  1LYL A;  4C1N K;  2NVX H;  2PW7 A;  2L12 A;  3CF5 A;  2KHI A;  1RTO A;  3NBH A;  3CQZ B;  4HIM A;  2EZV A;  1B50 A;  2N8N A;  5ELE A;  1JOQ A;  1EY5 A;  2B8F A;  1RDP D;  4XT1 B;  1WTV A;  4XYQ A;  1B3A A;  4MZ9 A;  4L5R C;  1SNO A;  4LFC L;  4HMJ A;  5G3L F;  4BA2 I;  3JAM c;  1N34 L;  5IP9 H;  1Z6H A;  3JAM E;  1K8G A;  3S14 H;  5AJ3 Q;  2A6H D;  2MP1 A;  1E2W A;  4MN3 A;  4UP7 A;  1O80 A;  3CCM A;  3D0F A;  5IYD G;  1PYB A;  3L7Z C;  1BNZ A;  4UHV A;  2ID0 A;  1YJN A;  3TS2 A;  2D2C C;  1Y1W G;  5C0X I;  4O42 A;  3HOY B;  3A55 A;  4A3M G;  1XTD A;  1ZYR C;  2O4X A;  1V1P B;  3IFT A;  2WKD A;  3JAM L;  1NSN S;  2RDH A;  2QA4 A;  4JVZ A;  4QL5 A;  1UE1 A;  1Y1V G;  2NVY B;  1MKH A;  1F77 A;  4LUZ A;  1RIP A;  4APV A;  4A4I A;  3F2D A;  4PMB A;  2JSO A;  3AU7 A;  3A5Z B;  3U58 A;  3CU7 A;  3FVQ A;  3I73 A;  4ID6 A;  3JC6 6;  1JC7 A;  4MTK A;  4UPA A;  3ERS X;  2B8G A;  2K33 A;  4AH6 A;  3MVV A;  1YNN C;  3V96 A;  4YY3 L;  4IFD J;  1SYC A;  2F0W A;  1BCP C;  3ERO A;  3KUP A;  3CCL A;  1K8M A;  4NPS A;  2VZA A;  2IHE A;  3I2Z A;  2Q8I B;  2AQ2 B;  3NSW A;  3K58 A;  3HOZ B;  1I50 B;  2CCZ A;  3PO3 H;  1HNZ L;  4JI4 Q;  2L9H A;  1SJE D;  1AZQ A;  3M4O B;  1VQ8 A;  1EWC A;  4LF8 L;  2EIF A;  3TDQ A;  4A3J B;  2VW9 A;  3S2H H;  1CSQ A;  3KK7 A;  2LY7 A;  4RHR A;  1PMR A;  2JQO A;  1JJC B;  4TKO B;  4NDX A;  2DNE A;  3OTO Q;  2VUM H;  5IYD H;  5IGF A;  2WP8 J;  3ITP A;  5CMD A;  1BOS A;  1E7Z A;  1VQE A;  5IYC G;  3NP8 A;  1IBK Q;  4KD3 A;  5C44 G;  3C3L A;  1X3F A;  4JOI A;  4OGQ C;  2R93 H;  1Y1W H;  5FO8 B;  1I6H H;  4A3E B;  2I5M X;  1TU2 B;  3WDN A;  1FNU A;  4A3G B;  4LNQ A;  1SFO H;  3CCE A;  1S4Z A;  4ODG A;  4A3B G;  1Y1V H;  1VS0 A;  1TWA H;  3H0G H;  1CM9 A;  4IJH A;  2G9D A;  4B08 A;  5I6Y A;  4JYA L;  3S1N H;  1EEI D;  1PTO D;  3HZX A;  2KCM A;  2YYZ A;  2K28 A;  4XT3 B;  1GHJ A;  2NYZ D;  1EU4 A;  2R61 A;  2WII B;  3EIV A;  4G4K A;  5K5P A;  2JA6 B;  3NEL A;  1VQL A;  3T16 A;  1CI3 M;  1L1O B;  2KOL A;  2LFN A;  3TEH B;  4DV1 L;  1XPU A;  4AQY Q;  3T56 B;  3KF6 A;  2EJM A;  3STB D;  3KDF A;  4TVA B;  5JEA H;  2F03 A;  1LTA D;  4JI5 L;  2K32 A;  3S1R B;  3H3V I;  4DNR B;  3FPU B;  1GHK A;  1PZJ D;  2JA5 B;  1ZKO A;  1ZXT A;  5EJW A;  1PH6 A;  2F52 A;  2YTX A;  4XQN A;  1C0A A;  2B2Y C;  2MJ8 A;  1U4R A;  3OMG A;  3FRP B;  1C7Y A;  1NTG A;  4XQQ A;  1SYD A;  5LMU L;  1Y69 U;  1XMQ L;  2Q8T A;  1CKM A;  4RMF A;  3UDX A;  2IPK D;  4ZLT F;  3EBE A;  3NWT A;  1EIF A;  1I6V C;  2ZM6 Q;  1PFN A;  5FK9 C;  1EFW A;  4DV0 Q;  1STN A;  2RDF A;  3HEJ A;  5C44 H;  1VQB A;  3VYT A;  5A35 A;  2F0F A;  5F2D A;  5FLM G;  4JCV E;  5M5Y B;  4DF7 A;  3UI2 A;  2F0D A;  2CQO A;  2B2U C;  2B3G A;  3N6R A;  4B9X A;  1X9N A;  1C48 A;  4WOR A;  3G6E A;  4IUN A;  3S17 B;  2JXM B;  3K0Y A;  4GNX A;  1HQR D;  4LFB Q;  4DR3 L;  3A8J E;  5IE8 A;  4DUY Q;  2N3S A;  4K8I A;  4ZAI A;  3OWE B;  1Q82 C;  2L0C A;  4OEM B;  3C1E A;  3PV0 A;  4C3J B;  4JBW A;  1GUO A;  3D4D A;  1STH A;  3S1M B;  2IJ0 A;  3PUW A;  2E5L Q;  5E4X A;  4AIM A;  3RZD B;  2Q2T A;  3D4R A;  3K80 C;  2UUC Q;  1QUQ B;  3ULP A;  1FNV A;  2NVX B;  2VY3 A;  1HR0 Q;  3LX0 A;  4DNT B;  4LAA A;  1LM0 A;  4OX9 Q;  1CZW A;  3W3A A;  3DWQ A;  2UXB Q;  2AQ3 B;  4DR5 Q;  3WOF A;  1Y14 B;  1STY A;  1OTC A;  5I9P A;  3BVZ A;  1I4X A;  1ZEQ X;  2M00 A;  1JB7 A;  1FJG Q;  3H15 A;  3S14 B;  4JI3 Q;  2WAQ B;  3RMH A;  3BYT B;  4UY8 C;  2UU9 Q;  1CT1 D;  3HKS A;  2K14 A;  1KNE A;  5FO9 B;  3CPW A;  1V1O A;  1Q3L A;  3MA2 B;  3R3O A;  1NMF A;  4X64 Q;  4KY6 A;  1A6X A;  4LF9 L;  2B2V A;  4IUV A;  1JOR A;  1CZG A;  3E3X A;  1S3O A;  4IUR A;  5JPM C;  4YIJ A;  4DAP A;  3HOU B;  4HIK A;  2F1M A;  2VQF L;  3KJP A;  2JJQ A;  5CV5 A;  4L5T A;  3C2P A;  1X55 A;  3NUC A;  4CKC A;  1U9R A;  4KKU A;  2PMZ B;  2VQE Q;  4LJZ C;  5KGU A;  1B3Q A;  3S1Q H;  1QCB D;  4JI6 Q;  5C4J B;  1G2T A;  4K5X A;  3NEM A;  1BR9 A;  1STE A;  3J81 j;  1TQO A;  1S5E D;  4F8M A;  4X65 Q;  5C3X A;  5I4D A;  2A6H C;  4HTH A;  1QE6 A;  1PLF A;  3SK6 A;  4J6H A;  3D8G A;  4B3T L;  5C3E B;  4YWM A;  1GUW A;  2EY5 A;  2OTL A;  3CHB D;  4BBS G;  3PQI A;  1GKH A;  4DAM A;  3L2P A;  3HGB A;  2RBM A;  2MNA A;  2Z4I A;  3PO3 B;  2XN9 C;  1X3P A;  1X32 A;  2AQ1 B;  3HOZ G;  4X6A H;  3VYS A;  3S15 H;  4B3R Q;  4KKS A;  5KYI A;  1JWU D;  3KF8 A;  2UUB L;  5C4X G;  4JI1 L;  1PH7 A;  2PNR C;  2QEJ C;  1YHA A;  4QF4 A;  1BVS A;  5T1I A;  2HHH Q;  1T5X D;  2NVQ B;  2BDN A;  4JI2 L;  2VUM B;  3L9A X;  3T1H L;  1TXY A;  1B9N A;  1BCP D;  4K2K A;  1HNX L;  1CTM A;  2F0J A;  1Q1B A;  3BVG A;  2BCO A;  1Y1W B;  2B2W C;  4KLK A;  1I3Q H;  1A62 A;  3J80 i;  5I2Y A;  1NBW A;  5LMN L;  2FFK B;  3I4N H;  3EN2 A;  2B2T A;  2WAC A;  1YI2 A;  2XNA C;  1SFO B;  5KNB A;  4A3E G;  1NR2 A;  1Y1V B;  2F3I A;  1TWA B;  4DR4 Q;  3H0G B;  1DXM A;  2PCF B;  2Z9H A;  1KAB A;  1SEB D;  3E9H A;  2Y0S E;  2DJF C;  1E2V A;  1PDQ A;  1TWH H;  1U5K A;  3J7Y W;  3BVM A;  3AYH B;  4DV4 L;  4A3I B;  1ET9 A;  3NTH A;  2ZXR A;  4K8J A;  2QW7 A;  4K14 A;  3RD4 A;  2BDO A;  2LS0 1;  2K1B A;  3GD7 A;  1KHI A;  1JE5 A;  5AFW A;  4C3H H;  1E1O A;  4HED A;  2KCN A;  3A7L A;  3M85 A;  1IBL L;  1HZC A;  2JA6 G;  4O2D A;  3NXW A;  4OXP A;  3BZK A;  1KDA A;  3R93 A;  2ES2 A;  1SDF A;  2NN6 G;  1RCV D;  2Q2H A;  1HFG A;  4A3L H;  2K5N A;  1V1P A;  2K7V A;  2K50 A;  4NKL A;  4L5S A;  5GAD C;  1FL0 A;  3PIP A;  3DWP A;  5C4X H;  2JA5 G;  2QCP X;  3Q23 A;  3VR4 A;  2F0N A;  2HIV A;  1SMY C;  4KN4 C;  4ZK9 B;  5C4Z A;  3VA7 A;  4JI7 L;  1HFN A;  2EDG A;  3QB3 A;  3VDY A;  3AQQ A;  4PZ6 A;  1VF7 A;  1Y8O B;  4B3M Q;  5M3F G;  3HS0 C;  2EYO A;  5G3L D;  4ZYS A;  1V43 A;  3CC7 A;  1UE7 A;  1R9T H;  2F0H A;  3ND8 A;  5FJ8 G;  3KYH C;  4M1U B;  4JPB W;  4JK1 C;  1TY0 A;  1AFP A;  5C44 B;  4IFD I;  3SVM A;  2JP1 A;  4E6I A;  3GTG H;  2OQK A;  1WVL A;  1B4O A;  4IJL A;  4I65 A;  1B7Y B;  4M8A A;  3VR6 A;  4DUZ L;  1IL2 A;  2RHQ B;  3MAQ A;  4LF5 L;  3T13 A;  4OO1 H;  3BDC A;  4ZUI A;  1S40 A;  4A75 A;  1Q86 C;  5IGG A;  2LKV A;  3STB C;  1HUM A;  1ML0 D;  1VCI A;  3CRL C;  5KIX A;  2HUG A;  1KD1 C;  3A0J A;  2R3Z A;  2K75 A;  1IKM A;  1RL2 A;  1OXV A;  4RGO S;  1RHP A;  1FGB D;  1T5E A;  1UUP A;  5JJK A;  2OQ0 A;  4K0K L;  3RZO H;  3KFU A;  4R4Q A;  1AW7 A;  1RJT A;  4H7B A;  4CGY B;  4NXN Q;  1HZB A;  4DV5 L;  1S72 A;  4KMU C;  1EIY B;  1K3B C;  2KA7 A;  3D4W A;  1PH4 A;  3URY A;  5NUC A;  2JN4 A;  4N9T A;  1TWC H;  4CJ2 C;  1IXR A;  1PH8 A;  4BS9 A;  2E2H B;  1BBW A;  3J81 c;  5JEA J;  4LFA Q;  1PH9 A;  1N32 Q;  4RG1 A;  1Q1E A;  1SMX A;  4X66 L;  4X62 Q;  3VYR A;  3OHX C;  1QVC A;  1VQ7 A;  3L3O C;  1F9P A;  2WKC A;  5C0X H;  2N78 A;  1UE6 A;  1NJI C;  1A3U A;  4MNO A;  1JJG A;  2ASB A;  4CDD C;  3TP5 A;  1SN8 A;  3VR2 A;  1OXU A;  3MTS A;  2L15 A;  1HXY D;  3ERQ A;  1FVI A;  2E74 C;  4JBM A;  2VXW A;  1W6K A;  2B63 H;  1VQ9 A;  1PTO H;  2I46 A;  2K5W A;  3H94 A;  4IN3 A;  2EXZ A;  5IOD A;  1AZP A;  2IW3 A;  4GKJ Q;  1E1T A;  1A3V A;  1L1O A;  2CVR A;  1SNC A;  4R8I A;  4A3D H;  1LTL A;  2ALY B;  3H3V C;  4P72 A;  2R92 H;  4DR7 L;  5EKK A;  2KEN A;  4J8Q A;  2E76 C;  4AYB E;  1NUC A;  3OW7 A;  3S1Q B;  1ESF A;  3HOV G;  4P71 A;  3ND9 A;  5M9O A;  5K36 H;  4GLA C;  1I5F A;  4NW2 A;  1AN8 A;  5J22 A;  3NBI A;  4IO9 A;  1GUS A;  1WCM H;  3QO2 A;  1PFB A;  3K57 A;  3QOL A;  1LTS D;  2D62 A;  3H6M A;  2IX0 A;  1Y8N B;  4CJ1 B;  1N33 L;  1K3R A;  3TP7 A;  4HID A;  4FNF A;  1VQJ A;  3D6W A;  1CFM A;  4DV3 L;  3TSS A;  4PZ7 A;  3ONA B;  2QDL A;  3GTO H;  1EIG A;  4NXM Q;  5IP7 H;  1A2U A;  4Q5V A;  2ZJP A;  1WTO A;  4JOI C;  1UNS A;  1IKL A;  2HQE A;  2KUM A;  1WYD A;  2HCC A;  2OEO A;  1RKN A;  3S15 B;  3PO3 G;  3LNN A;  3PF5 A;  2OXP A;  1AEX A;  1BQQ T;  2PPB C;  3QR8 A;  1SE2 A;  2I5L X;  2K5D A;  3IL8 A;  4MTN A;  4PMW A;  3CCR A;  2K6A A;  2FJ2 A;  1KQS A;  4LF6 Q;  2NZ1 D;  1VQD A;  3TZU A;  4CDF C;  2DJG C;  2ZTE A;  1YNJ C;  1G51 A;  4JV5 L;  3KLS X;  1I4H A;  1LTG D;  2FMM A;  4JG2 A;  3LWU A;  1F9S A;  2VUM G;  1RF2 D;  5TSS A;  4JC0 A;  1EUJ A;  1I3Q B;  3SK5 A;  4FF2 A;  2XWJ B;  3I4N B;  4GOP B;  5CV4 A;  2R93 G;  1VF5 C;  3J7Z C;  5BR8 Q;  1QUQ A;  4DV7 L;  5EGT A;  1QB5 D;  2BH8 A;  4MHE A;  3K7A H;  2F3W A;  3HOX H;  1TT2 A;  1O78 A;  1Q7Y C;  1I94 L;  2JA9 A;  2PZT A;  3ER0 A;  3H0G G;  3MFY A;  3RUZ A;  2UUB Q;  3HOV H;  3JAM i;  4QUC A;  4DR6 L;  1L0X B;  1STB A;  2IWH A;  3QIA A;  1ENC A;  1M8A A;  1XNQ Q;  3H3V H;  2DUD A;  2A19 A;  3P7J A;  4ZKC B;  4FP5 D;  3CAM A;  4DXF A;  3D3R A;  3QWN A;  4C2M H;  2F0I A;  4K2L A;  3CCS A;  3MXN B;  3MFG A;  1LV9 A;  4POF A;  2IX1 A;  4BBS B;  1C4Q A;  3I4O A;  1SYB A;  1KC8 C;  1EY4 A;  2F0S A;  1MSG A;  2DN8 A;  3CW2 C;  2EXD A;  3OIQ A;  1K9M C;  3HOW G;  1JWM D;  5BN3 A;  5JEA G;  5JJL A;  5IGD A;  3J7A 5;  1IBM Q;  5C4X B;  1EY8 A;  2KCC A;  5GAG C;  2O5I C;  1LAB A;  1GUT A;  1GUN A;  2F0M A;  4DV4 Q;  2JA8 H;  1EQQ A;  2RDG A;  3D31 A;  4LW1 A;  1I4G A;  4LF4 Q;  1DOK A;  4GNX C;  2XRS D;  5E4W C;  1R9T B;  2CFM A;  5DM6 3;  5IWA Q;  1EFI D;  4HAE A;  4KJO A;  2KBN A;  1CQV A;  4YCU A;  4O1N A;  3I7F A;  4CDE C;  5C6A A;  2FIN B;  1X6O A;  4KHP Q;  3CC4 A;  4A93 H;  1U4M A;  2VNU D;  4DR2 L;  2RF4 A;  1D8L A;  3OMC A;  2LXK A;  5CGK A;  5JJZ A;  1WOC A;  1EY6 A;  3GTM H;  1A0I A;  4DK0 A;  3L0O A;  2Z1C A;  3GTL B;  2PO4 A;  5M5X H;  1JQY D;  3DM3 A;  3D6C A;  3E5S A;  5CBE E;  2E2I B;  4O0A A;  1F2M A;  1PRT B;  2I07 B;  4QGU A;  1YJ9 A;  1SMY D;  1N36 Q;  2HQL A;  3P1H A;  1VQK A;  3RZO B;  1B8A A;  3MWY W;  3DUZ A;  4A3C H;  4HJ5 A;  3G6J B;  2GA4 B;  1UWV A;  1S5C D;  3TRZ A;  1TII D;  1GO3 E;  4OIK A;  4UP9 A;  3W1G A;  3DMU A;  2HIX A;  4XIG S;  2F0O A;  1YNX A;  2RCF A;  4XXE A;  3W1B A;  5LL6 S;  4B9W A;  1L2F A;  3F2U A;  1M1K C;  2UUA L;  3RR5 A;  4DV2 L;  1DD2 A;  1TWC B;  1SE8 A;  2EVB A;  3HOW H;  1R4P B;  2B2V C;  2OF1 A;  1S5B D;  1G8Z D;  1H9S B;  1I4R A;  1EL0 A;  2XRQ D;  1VQ4 A;  2PI2 A;  5I9O A;  1HRJ A;  2Z4H A;  1D2B A;  2I5H A;  2D0P A;  1A8V A;  5M3F B;  1BO0 A;  4LF7 L;  3FKI G;  3I4L A;  1XPR A;  4I7Z C;  2LMC B;  3HKZ E;  5D65 A;  4HCS A;  1FR3 A;  3BJU A;  4B3S Q;  1HNW L;  3M4Q A;  2B63 B;  1QNU A;  1PTO B;  1F9R A;  4HCE A;  4OHJ A;  4ULL A;  4C56 C;  2HT1 A;  5ELF A;  1JWS D;  1H95 A;  1B53 A;  5FLX c;  2F4V Q;  1LTB D;  4DFA A;  4A3D B;  2NVT B;  2WB1 G;  4TSS A;  3F2B A;  1EYG A;  4GZY C;  4BBR H;  3X3N A;  2NTT A;  5EPL A;  1X3E A;  3J7A F;  1ENF A;  2LSS A;  2EJF C;  1YZ6 A;  2F0P A;  3NE5 B;  3K7U C;  4WRD A;  1SJH D;  3GQB A;  4KHV A;  4YHH L;  2MO1 A;  2CKZ B;  2R7Z H;  1TR5 A;  1MJC A;  5KRU A;  1XXG A;  5ISR A;  3A5U A;  3GTQ H;  1HZ9 A;  2UXD Q;  4RAU C;  4DR1 L;  2E75 C;  3T1Y L;  4S3S A;  3RN2 A;  3T53 B;  5J39 A;  4Y7N H;  1PH5 A;  4BY7 H;  1LT6 D;  3AFQ A;  1XYI A;  3OPO A;  4EVO A;  1GVP A;  4P74 A;  2C5C A;  3CD6 A;  1HA6 A;  1VMC A;  1YVC A;  2WAQ E;  4P2C B;  1XTC D;  4UDU C;  3FHW A;  1U0L A;  3B6Y A;  2MFI A;  1KNA A;  2UXC Q;  3GTP H;  4DAY B;  1P8L A;  5JVG 3;  1L0Y B;  5DLQ E;  4FF3 A;  2B2T C;  3CCJ A;  1PRT F;  3M7G A;  4G7Z C;  3FEW X;  3BDL A;  4DV6 L;  4GKK Q;  1E0B A;  1XNR Q;  5LL6 X;  1LTI D;  1ROD A;  3FKI H;  4IUQ A;  5JAV A;  1D6E C;  1LT4 D;  4IOA A;  5IGB A;  2CH4 A;  3ULJ A;  4DAV A;  4GLX A;  5I6W A;  1MBY A;  3NK9 A;  4A3F H;  4QQB X;  3SGI A;  4JI8 Q;  2EYJ A;  3SXH A;  3P20 A;  2F0V A;  5ELO A;  2KCT A;  3OOC A;  5DAU A;  1TS3 A;  2PMZ E;  3I4N G;  3U4Z A;  1CKN B;  2AMC B;  1SLJ A;  3K7A B;  4UAI A;  3HOX B;  4BY1 G;  5D14 A;  2PZW A;  1ASZ A;  2MPM A;  1SBB B;  4LFC Q;  1IHZ A;  1J5E L;  3HOV B;  3SK8 A;  2AKW B;  4PNY A;  1XMO L;  1N34 Q;  2AWO A;  2V4D A;  4A3I G;  1B1Z A;  3SDZ A;  1EOT A;  5FOB B;  1STA A;  2KVM A;  1O7Z A;  2M9V A;  1JR0 D;  1LTT D;  4V0B A;  1BBU A;  1YNJ D;  5IYB H;  1H9J A;  5M5W H;  4C2M B;  3GTK H;  2AUJ D;  1J8I A;  4CDC C;  4FXD A;  4C3H G;  1JB3 A;  1PTO F;  1EWH A;  1BDO A;  4WJW A;  4PZ8 A;  2R6G A;  2GVA A;  3SE0 A;  4IUT A;  3K59 A;  4P73 A;  4CJ0 B;  2CW0 D;  2K5H A;  4A3L G;  3IKJ A;  1PVO A;  1XWE A;  2E2D C;  5AJ3 L;  2ZJQ A;  4FF1 A;  2ZTC A;  2JA7 H;  1HA5 A;  4IFD H;  3KBG A;  2BOS A;  2VB3 X;  1NNX A;  2WIN B;  4XTC S;  3U50 C;  1ILP A;  1GOZ A;  1X65 A;  4KHZ A;  4DR6 Q;  4ZUJ A;  5D3D A;  3PO2 H;  3S2H B;  4DK6 C;  5T1G A;  4JI0 L;  3DEP A;  1UE5 A;  1VQP A;  1O7I A;  3R2T A;  4YY3 Q;  4HR7 B;  3VA5 A;  5LHY 1;  3PUV A;  4Q0F A;  1TY2 A;  1CSP A;  2R93 B;  2A73 B;  1I6H B;  3GTM B;  1SYE A;  3UDI A;  1WD1 A;  1G2S A;  4OEL B;  4IOC A;  5M5X B;  3TRE A;  1MHW C;  3T4A C;  1IW7 D;  1XJV A;  4OO1 G;  2XSC A;  2MQH A;  3NTI A;  4BY1 H;  2L11 A;  1HNZ Q;  3BZC A;  3BG3 A;  3S1N B;  4RGN A;  1E3P A;  4RCO A;  1PH2 A;  4A3I H;  5D3I B;  2FXQ A;  1GJX A;  4EGV A;  4LF8 Q;  2RKS A;  4YWL A;  1PH1 A;  2EYH A;  3V05 A;  2D5D A;  3HOY H;  1AH9 A;  4N8F A;  3RLF A;  1I4Q A;  2TSS A;  1MGS A;  3ZJY C;  1UEA B;  2EPB A;  2G5D A;  1FNW A;  5C4H A;  3I72 A;  4JI4 L;  2IL8 A;  1G91 A;  1CKO A;  3HOW B;  2O2L D;  1B2T A;  3TQY A;  1B44 D;  3W5O A;  4GOP A;  4LK1 C;  4C3I H;  1K0R A;  2J0T D;  1L1O C;  2EYL A;  4QIW E;  4G7H C;  4JYA Q;  2OWO A;  2EQS A;  1YBY A;  3PSI A;  5IGE A;  3OTO L;  3OIP A;  4QB4 A;  5C0X G;  5ELB A;  1IBK L;  1HPC A;  1TS5 A;  5EPJ A;  3SEB A;  1EY7 A;  1OXT A;  2LXJ A;  3TME A;  2C9O A;  4R4T A;  1QNK A;  2QDB A;  4DA2 A;  2GVB A;  1QZH A;  2F0K A;  2VL6 A;  4JBJ A;  3F8T A;  2A74 C;  1I50 H;  3AB9 A;  2B63 G;  1MD2 D;  4FVM A;  1DOM A;  1WI5 A;  4F7X A;  4DV1 Q;  5C5M A;  1QJO A;  1ICW A;  2PNH A;  5KND A;  1KRS A;  1ESR A;  3MXN A;  2EYP A;  4RKL A;  4JI5 Q;  2RSO A;  2H1E A;  3SR1 A;  3IAY A;  2YV5 A;  3DEO A;  3R8B A;  1B9M A;  4A3D G;  4A3J H;  2R92 G;  3S16 H;  5EKI A;  2DNC A;  1SE3 A;  1TVX A;  4PV1 C;  4IPH A;  3CCQ A;  1VQA A;  5M3M H;  3Q8D A;  1YHB A;  5K36 G;  4R4C A;  2MHV A;  3S2D H;  5J3B A;  3GTQ B;  2VB2 X;  5LMU Q;  1XMQ Q;  2E8G A;  1WCM G;  1HQM C;  3A56 A;  4AQY L;  1X3G A;  4OIJ A;  3I8Z A;  5BN5 A;  4KJN A;  3GTJ H;  3QJY A;  3C46 A;  5HUR A;  1ILQ A;  4A3G H;  3J7A V;  3GO5 A;  3SK4 A;  3CCU A;  5DNF A;  3GTP B;  5IP7 G;  3RLN A;  3S24 A;  3H91 A;  1WFQ A;  3V2T A;  3J81 E;  3U4V A;  3BYY B;  4RGM A;  5GAE C;  2J4X A;  4DR3 Q;  1SRO A;  3FKI B;  2SNS A;  2ZM6 L;  2QKI C;  1A63 A;  4G57 A;  2ZJR A;  2CQA A;  3I4M H;  4DV0 L;  1Z47 A;  2CHB D;  2KHS A;  3E6Z X;  1DCZ A;  1TWG H;  4A3F B;  2YU9 H;  1SNP A;  3EA6 A;  3I70 A;  5H1S E;  1KRT A;  4KI0 A;  3S1R H;  2OCE A;  3J81 L;  1D1I A;  4FYD A;  1X54 A;  1PZK D;  1DGS A;  4BXX G;  2IHF A;  2PYK A;  2YTY A;  1Z9F A;  1SE4 A;  4LFB L;  1SR3 A;  2WB1 B;  4DUY L;  3UDG A;  4WFN 3;  4GN5 A;  1KXL A;  1NCV A;  1S5F D;  3TN2 A;  4PG3 A;  5HY6 A;  3J81 i;  3Q0A A;  1VQF A;  5CC4 A;  3HOX G;  5JPN C;  1DJR D;  2NB0 A;  1ASY A;  1EZ8 A;  2N55 A;  1H9S A;  4DNI A;  2E5L L;  2E2J H;  1PYS B;  2F0Q A;  2UUC L;  3GTK B;  1D5M C;  4ALP A;  4UP8 A;  3PIO 3;  1HR0 L;  4OX9 L;  1NE3 A;  2UXB L;  1PFM A;  5M5Y H;  2P5Z X;  4K6D A;  3UE0 A;  4DR5 L;  4LF9 Q;  4I7A A;  4K6L A;  1EQR A;  1FGU A;  2VS1 A;  2V1C C;  1SSO A;  3BU2 A;  5CV6 A;  1Q46 A;  1XX8 A;  1FJG L;  4RFB A;  4JI3 L;  1YIT A;  2VQF Q;  1SNQ A;  2JA7 B;  1Q12 A;  4KN7 C;  2UU9 L;  1WTQ A;  5JJI A;  2F4I A;  4C3J H;  1K8O A;  3NQI A;  4AYB B;  1F2Z A;  5DEH A;  1N8R C;  3S1M H;  2JA8 G;  1F2L A;  2RQX A;  3PO2 B;  3BDO A;  4X64 L;  4ME3 A;  2NUC A;  2MO0 A;  2SEB D;  1GD7 A;  2ZTD A;  5EQ0 A;  1Z7T A;  4B3T Q;  2KQ3 A;  2F0T A;  4FXK C;  5IIF A;  3TS0 A;  3I90 A;  5A2Q E;  4A93 G;  1KLG D;  4BXX H;  5GAH C;  2A69 D;  5BN4 A;  2QIL A;  3MZ5 A;  2VQE L;  4BY1 B;  1G29 1;  1D5X C;  4FXG C;  4R1J A;  4JI6 L;  2Z6K A;  4H44 C;  2CW0 C;  4A76 A;  1TWH B;  4OL7 A;  1VQ6 A;  1HJP A;  2NN6 I;  2HCI A;  2X6G A;  3A8K E;  3M9B A;  1SRU A;  5COR A;  3IFD A;  5IT9 c;  4JI1 Q;  2NZO A;  2RA4 A;  4X65 L;  1QG7 A;  4DAY A;  1E24 A;  3I55 A;  2NWG A;  4A3C G;  4F87 A;  5IT9 E;  5A2Q L;  4XQJ A;  1D5Z C;  1W6J A;  2Z0S A;  4JI0 Q;  4TRD A;  1TWF H;  2FHT A;  4JI2 Q;  2Q2I A;  4C3H B;  3T1H Q;  1BF4 A;  3G71 A;  2PQA B;  4K5V A;  1HNX Q;  4NMZ A;  3NTK A;  5J1Z A;  2ATW A;  3HOU H;  2B29 A;  1KTK A;  2B39 A;  3PIO A;  5LMN Q;  4B3R L;  2X69 A;  5IT9 L;  2D9U A;  3I91 A;  3M4P A;  1VQG A;  3Q22 A;  4C3I B;  1PH3 A;  3FP9 A;  3TP8 A;  1MJE A;  2H4O A;  2SDF A;  5C4J H;  1IW7 C;  2L4N A;  1CA6 A;  2XIW A;  1CKN A;  3OSO A;  3K6O A;  2HHH L;  1EYA A;  2IX3 A;  4A3K H;  3E9I A;  3K81 C;  4FDB A;  4FO2 A;  5IY0 A;  2Y0S G;  1JOK A;  4ZKB B;  1PRT D;  2R7F A;  5C3E H;  4P75 A;  2Q8R E;  1EQT A;  1Q8K A;  1SNM A;  1WTX A;  3IRB A;  4HN7 A;  3HFZ B;  1G6Z A;  1KDC A;  5KEE A;  3K5O A;  4N8X 1;  1A3T A;  4GN3 B;  3CKI B;  4DR4 L;  1IYJ B;  4IAL A;  2EE1 A;  3ULL A;  1K28 A;  1IBL Q;  3GTG B;  2MUY A;  2QF7 A;  5IOC A;  2I0Q A;  3G4S A;  2QEX A;  1HTP A;  4RGT A;  1VQI A;  4IUP A;  4JW0 A;  4XYO A;  3S16 B;  4BBR G;  3I3C A;  4G7O C;  3KJO A;  3CC2 A;  5M3M B;  2NVQ H;  1X56 A;  1GXD C;  4JI7 Q;  3S2D B;  1QVF A;  2N88 A;  3NWS A;  1K0S A;  5GQO A;  2R7Z G;  4POG A;  4A3M H;  1CK1 A;  2AUK A;  5IGC A;  3GTJ B;  3Q24 A;  1DON A;  4LUO A;  4MIU A;  2DY8 A;  1CQF A;  1YHQ A;  4BY7 G;  2IT1 A;  3OYY A;  4ZQ3 A;  2PQE A;  4DUZ Q;  2IY5 B;  4LF5 Q;  2NTS A;  1KIX A;  4EX5 A;  5I2X A;  1U4L A;  1DZ1 A;  2YTV A;  1VQN A;  1KAW A;  3CMA A;  1IYV A;  4B3M L;  1UEB A;  5CR3 A;  1F2Y A;  2KHJ A;  1EOV A;  3K8A A;  4X3U A;  4K0K Q;  3I4M B;  4XDX A;  3PMF A;  5EAY A;  5EPK A;  1B70 B;  4HMI A;  4HSV A;  1TWG B;  1H9R A;  4R8N A;  2YU9 B;  4JBK A;  4OWW B;  3PUY A;  2TMP A;  1PFS A;  2XVS A;  4L8J A;  1JMC A;  4DV5 Q;  4DU9 A;  4A3F G;  3A74 A;  3A54 A;  4OON A;  2C35 B;  3GV3 A;  1W2B A;  1WD0 A;  2F0G A;  1S5D D;  2R7D A;  2A8V A;  2A6E D;  1X3Q A;  1R4Q B;  3DXJ C;  3LWE A;  2OT2 A;  3RN5 A;  2K05 A;  5FLX E;  2HD3 A;  3X3M A;  2R92 B;  3CP0 A;  3FPP A;  2BE5 D;  2L5T A;  4ILW A;  4C1N I;  3O13 A;  5KNC A;  4X66 Q;  1N9W A;  4CBV A;  4DK1 A;  2K4K A;  4NXN L;  2E2J B;  4GS3 A;  5IYC H;  4J15 A;  3CPF A;  1WCM B;  2ZXP A;  3NBH B;  1JT8 A;  5IYB G;  1YIJ A;  2KEE A;  3HKZ B;  1EYC A;  3GP7 A;  5FLX L;  4Y52 H;  4A3B H;  2EYM A;  1VQH A;  1J9O A;  2A5H A;  4LFA L;  4YCW A;  1N32 L;  1QWY A;  1HHV A;  2BA0 A;  4X62 L;  3GTO B;  1O7L A;  5CV7 A;  2EYF A;  1UAP A;  3MXG A;  1TS4 A;  1PYW D;  4OWT B;  5COY A;  4KK7 A;  1PV4 A;  4DR7 Q;  1G6P A;  1J6Q A;  2JA7 G;  4IFD G;  2A68 C;  4DN4 M;  5ELD A;  2D0O A;  3MEF A;  3SHL A;  4HJ8 A;  3WWV A;  3A7A B;  1LT3 D;  4WJ4 A;  3DWA A;  4AYB G;  4QY7 A;  3LGJ A;  2F0E A;  4DXG A;  3PO2 G;  5C0X J;  3M3Y H;  3AMU A;  2CWA A;  3R2I A;  2K52 A;  1WTR A;  2PW5 A;  3W2D A;  4GKJ L;  4KY7 A;  3FDT A;  5C5L A;  3HG9 A;  3TBI B;  2E2H H;  1N33 Q;  4HJ7 A;  4DV3 Q;  1VQM A;  4DK3 C;  2XGT A;  3U9O A;  1OXS C;  3KBX A;  1LAC A;  1PZI D;  4IPD A;  1HTL D;  1WTP A;  3CME A;  1OO9 B;  3VR5 A;  2L1B A;  1JCK B;  2A1A A;  4ME5 A;  5C3W A;  5LMN W;  1DOL A;  4GOP C;  2RSN A;  2AHO B;  3QG1 A;  1HZA A;  2K03 A;  1EEF D;  3AFP A;  1MI2 A;  1ONL A;  2K5Q A;  4IPG A;  2FMC A;  1CA5 A;  2XWB B;  1TWF B;  1SND A;  3OWF A;  4JV5 Q;  1CHP D;  1LT5 D;  3EJI A;  5FLM H;  3G7L A;  4H13 C;  1I4P A;  4X3S A;  3HOY G;  1DM0 B;  2SOB A;  4NXM L;  1A15 A;  1ENA A;  4GLV B;  4U68 A;  3A8I E;  4K5W A;  4KV6 A;  5JVH 3;  1EZ6 A;  4QUF A;  2B2Y A;  1KAA A;  3M4Y A;  2KED A;  4L5Q A;  4X3K A;  4YWK A;  2NZH A;  4V19 0;  4DV7 Q;  1Q81 C;  2Z8L A;  2A69 C;  2RHS B;  4LF6 L;  4C3I G;  4A3K B;  1I94 Q;  3RLO A;  4ZRZ A;  2JA8 B;  3UE1 A;  3H09 A;  3M7N A;  2H5X A;  1IL8 A;  3BS1 A;  4WJ3 M;  4KTA A;  3U9S A;  1FD7 D;  3S9W A;  1ZYR D;  3PIP 3;  3J80 c;  3MXU A;  4R4I A;  2B2U A;  1K83 H;  2M2L A;  3J80 E;  4CKE A;  2PI2 E;  5BR8 L;  1PXU A;  4R9W A;  2O5J C;  1SXT A;  1KDB A;  2ZXO A;  4Z9C B;  1KLU D;  3K5M A;  3CQZ H;  3CCV A;  4A93 B;  3VYU A;  4RH6 A;  5JOB A;  1K73 C;  2SNM A;  3CRK C;  3F2C A;  3CXC A;  1XPO A;  1EIH A;  1OXX K;  2EY6 A;  1VQ5 A;  4RA8 A;  4RKB A;  4QJF A;  2JEA I;  4OWX B;  1M90 C;  3PUZ A;  1AP0 A;  1GM5 A;  2EJG C;  1XNQ L;  1YNN D;  4TQU S;  2EY1 A;  4L6T B;  3I56 A;  3J80 L;  4A3J G;  4CKB A;  1V1Q A;  5M3M G;  4EQP A;  5E1F A;  2K01 A;  3KF6 B;  4A3M B;  3KDF B;  3HRZ C;  3Q6S A;  1CUK A;  1PRT C;  5CBA E;  1NY4 A;  1H9M A;  1DYQ A;  4U67 3;  4DPG A;  1EU3 A;  1E22 A;  1YJW A;  1H9K A;  2CH4 W;  4DR2 Q;  4IPC A;  1PHJ A;  1IBM L;  4A3G G;  5E3F A;  2NVY H;  2XTI A;  2L55 A;  1Q8I A;  5HGQ A;  1V9P A;  2WV6 D;  5DM7 3;  4LF4 L;  5KYL A;  1BCP B;  1W3S A;  3QOJ A;  3PF4 A;  1VQO A;  3E0J A;  1KL9 A;  4HJ9 A;  1WTH A;  5IWA L;  4PMC A;  1II3 A;  4DGZ A;  2Y0S B;  3NPP A;  2ICI A;  3PCO B;  4IQZ A;  2Z6B A;  2BH2 A;  1BUV T;  1L0W A;  4KHP L;  4QCL A;  4DKA C;  3I4M G;  2F0U A;  4BBS H;  2PZU A;  3EFX D;  1K8A C;  3PGZ A;  3E0E A;  1A2T A;  4HSP A;  4GNX B;  4QMG A;  5EBC A;  4YCV A;  3KLR A;  2JYO A;  2UUA Q;  2NBF A;  2PQA A;  2X6L A;  3F1Z A;  4DV2 Q;  3HOZ H;  3NQT A;  2CWP A;  5EBD A;  4EQO A;  1STG A;  2HDL A;  3GDE A;  1N36 L;  2BA1 A;  3M4O H;  3MEH A;  1P16 A;  2JK8 A;  1F9Q A;  3C1F A;  3EQL C;  1BKB A;  5EKL A;  4BBR B;  1BBX C;  1HH2 P;  1EWI A;  1PTO C;  1SAP A;  3DHQ A;  3MHB A;  1HUN A;  5FKA C;  2AWN A;  2K04 A;  4RWS C;  4ZCK A;  2DGY A;  4QIW B;  5ELN A;  3NHH A;  4X3T A;  5ELC A;  1M4V A;  2N49 A;  4L63 B;  2R7Z B;  4LF7 Q;  1JOO A;  1C9O A;  4ABN A;  1YEZ A;  1JJ2 A;  1QVG A;  1HNW Q;  4A3E H;  4A3B B;  3HKZ G;  4Y7N B;  2F3V A;  1TKW B;  1HR0 W;  4BY7 B;  2HDM A;  3KLS A;  3GTL H;  3TZD A;  1AE3 A;  1Y8P B;  2KEC A;  2G9H D;  4IZ8 A;  5CV9 A;  2F0L A;  2E2I H;  1D7Q A;  4HIO A;  2ZT9 C;  2WFW A;  1FYC A;  1VMP A;  1NAP A;  2A6E C;  2GN5 A;  2RCN A;  1D1K A;  3RNU A;  3K5L A;  1WTW A;  4KD4 A;  2K5V A;  1NMG A;  2B2W A;  4C3J G;  2BE5 C;  4B3S L;  1RD9 D;  2Z6K C;  4YHH Q;  1MIU A;  1BXT A;  1QIL A;  4H0L C;  4LMQ D;  3M3Y B;  1E2Z A;  5GRO A;  2JA6 H;  4FF4 A;  2OTJ A;  1JE4 A;  1HCZ A;  1IZ6 A;  2WB1 E;  3NEN A;  1LLR D;  3TP6 A;  3ICE A;  1U4P A;  2F4V L;  3WOE A;  2DY7 A;  1V8Q A;  4R4O A;  4DR1 Q;  3T1Y Q;  2NN6 H;  3UDF A;  3GV6 A;  3N52 A;  4J1M A;  3P75 A;  1C8C A;  4F88 A;  2ICE C;  3HP3 A;  3MC0 B;  2JEB I; 
#chains in the Genus database with same CATH homology
 1MJC A;  5C4J H;  2HHH L;  1CKN A;  4KLK A;  1I3Q H;  4NB3 A;  1A62 A;  3J80 i;  3A5U A;  2JA5 H;  3GTQ H;  1NBW A;  3K0X A;  5LMN L;  4A3K H;  3E9I A;  1HZ9 A;  3EN2 A;  3K81 C;  3I4N H;  2UXD Q;  4FDB A;  5IP9 G;  1YI2 A;  4DR1 L;  3T1Y L;  5IY0 A;  2Y0S G;  4A3E G;  1AE2 A;  3RN2 A;  2F3I A;  4DR4 Q;  5M3F H;  4Y7N H;  1PH5 A;  4BY7 H;  2R7F A;  5C3E H;  3DLL A;  2WAQ G;  3AFQ A;  4P75 A;  3E9H A;  2Y0S E;  1GVP A;  1Q8K A;  4P74 A;  1TWH H;  1U5K A;  3IRB A;  5FJ8 H;  3CD6 A;  4DV6 Q;  3HFZ B;  2UXD L;  1YVC A;  3AYH B;  2WAQ E;  4DV4 L;  4H02 A;  3FHW A;  1U0L A;  3B6Y A;  2MFI A;  1LUZ A;  4GN3 B;  2Q2U A;  4DR4 L;  1IYJ B;  3GTP H;  1IBL Q;  2UXC Q;  3ULL A;  4DAY B;  1P8L A;  5DLQ E;  4GN4 B;  3CCJ A;  1QZG A;  1PA6 A;  3GD7 A;  1KHI A;  2I0Q A;  3G4S A;  1JE5 A;  2QEX A;  4DV6 L;  4HJA A;  4C3H H;  4GKK Q;  1XNR Q;  1E1O A;  1VQI A;  2NVT H;  4LWC A;  4BA1 I;  4EQ5 A;  3KF8 B;  3FKI H;  2UXC L;  3M85 A;  1IBL L;  3HOU G;  1HZC A;  1T9H A;  4BBR G;  2JA6 G;  4O2D A;  3AEV A;  4OXP A;  3BZK A;  3KJO A;  3KLW A;  3CC2 A;  3PUX A;  4IOA A;  3OW2 A;  2NVQ H;  3S17 H;  3ULJ A;  1X56 A;  2ES2 A;  4LUV A;  4GKK L;  4GLX A;  4A3F H;  1XNR L;  4QQB X;  4JI7 Q;  2QGQ A;  3KOJ A;  2NN6 G;  2Q2H A;  3SGI A;  4A3L H;  4JI8 Q;  1QVF A;  1VQC A;  1WJJ A;  2K5N A;  5GQO A;  5ELO A;  2K50 A;  2KCT A;  2R7Z G;  3G48 A;  4L5S A;  1J5E Q;  4A3M H;  4POG A;  4OO1 I;  2PMZ E;  5GAD C;  1FL0 A;  5E7N A;  3PIP A;  5C4X H;  1XMO Q;  2JA5 G;  2JE6 I;  3U4Z A;  4A3K G;  2HIV A;  3I4N G;  1CKN B;  2AMC B;  1SLJ A;  4LUO A;  4JI7 L;  3VDY A;  3AQQ A;  4PZ6 A;  4JI8 L;  4BY1 G;  1ASZ A;  1YHQ A;  5M3F G;  4B3M Q;  3RZD H;  1V43 A;  4BY7 G;  2IT1 A;  3OYY A;  5C3E G;  1LYL A;  4LFC Q;  1J5E L;  3CC7 A;  1UE7 A;  1R9T H;  2NVX H;  4DUZ Q;  3CF5 A;  2IY5 B;  2KHI A;  2AKW B;  1XMO L;  4LF5 Q;  5FJ8 G;  1N34 Q;  4HIM A;  2AWO A;  3KYH C;  1KIX A;  4A3I G;  4EX5 A;  2N8N A;  2YTV A;  1VQN A;  4IFD I;  1KAW A;  3CMA A;  5IYB H;  1BBU A;  4B3M L;  1UEB A;  4MZ9 A;  4L5R C;  2OQK A;  5M5W H;  3GTG H;  4LFC L;  2KHJ A;  3GTK H;  4BA2 I;  4IJL A;  1EOV A;  1B7Y B;  4DUZ L;  3JAM c;  1IL2 A;  2RHQ B;  4LF5 L;  3K8A A;  1N34 L;  5IP9 H;  4K0K Q;  1S40 A;  4A75 A;  1K8G A;  1Q86 C;  3STB C;  3S14 H;  5AJ3 Q;  5EAY A;  1B70 B;  1VCI A;  4UP7 A;  4PZ8 A;  2R6G A;  1KD1 C;  2GVA A;  3A0J A;  4JBK A;  2K75 A;  4OWW B;  3PUY A;  1PFS A;  1OXV A;  1RL2 A;  5JJK A;  3CCM A;  3D0F A;  2OQ0 A;  4P73 A;  1PYB A;  5IYD G;  4DV5 Q;  1JMC A;  4A3F G;  3L7Z C;  3RZO H;  4K0K L;  2K5H A;  3A74 A;  4A3L G;  3KFU A;  4OON A;  1PVO A;  2C35 B;  2ID0 A;  5AJ3 L;  1YJN A;  2ZJQ A;  4R4Q A;  3TS2 A;  1W2B A;  2ZTC A;  2JA7 H;  1Y1W G;  5C0X I;  2R7D A;  4A3M G;  2A8V A;  1XTD A;  4XTC S;  3U50 C;  1X65 A;  4KHZ A;  4DR6 Q;  4NXN Q;  1HZB A;  4DV5 L;  3RN5 A;  2QA4 A;  1S72 A;  3PO2 H;  1EIY B;  4QL5 A;  3CP0 A;  1UE1 A;  1Y1V G;  4DK6 C;  1MKH A;  4LUZ A;  1RIP A;  4APV A;  4X66 Q;  4JI0 L;  1N9W A;  4A4I A;  3F2D A;  1UE5 A;  1VQP A;  1PH4 A;  3A5Z B;  1O7I A;  2K4K A;  1TWC H;  4YY3 Q;  3U58 A;  1IXR A;  4NXN L;  1PH8 A;  1BBW A;  3PUV A;  3JC6 6;  4GS3 A;  5IYC H;  3J81 c;  5JEA J;  4J15 A;  3CPF A;  4UPA A;  3ERS X;  1CSP A;  3NBH B;  4LFA Q;  1JT8 A;  5IYB G;  1PH9 A;  1N32 Q;  4RG1 A;  1Q1E A;  1YIJ A;  1SMX A;  4X66 L;  4X62 Q;  1QVC A;  3UDI A;  4AH6 A;  1VQ7 A;  4IOC A;  4YY3 L;  3TRE A;  4Y52 H;  4IFD J;  2N78 A;  1UE6 A;  1NJI C;  1XJV A;  4OO1 G;  4MNO A;  1JJG A;  2MQH A;  2ASB A;  4A3B H;  4BY1 H;  1SN8 A;  1VQH A;  1HNZ Q;  4LFA L;  1OXU A;  4YCW A;  1N32 L;  3CCL A;  2BA0 A;  3BZC A;  2L15 A;  4NPS A;  4X62 L;  2VZA A;  1FVI A;  1E3P A;  2IHE A;  3I2Z A;  4A3I H;  1PH2 A;  2FXQ A;  4JBM A;  4LF8 Q;  4OWT B;  4YWL A;  2B63 H;  1PV4 A;  1VQ9 A;  2CCZ A;  1HNZ L;  3PO3 H;  4DR7 Q;  4JI4 Q;  1PH1 A;  1G6P A;  1J6Q A;  2JA7 G;  4IFD G;  4GKJ Q;  3HOY H;  1AH9 A;  1E1T A;  3RLF A;  2D0O A;  3MEF A;  1L1O A;  4HJ8 A;  3WWV A;  3ZJY C;  1VQ8 A;  4WJ4 A;  4AYB G;  4QY7 A;  3LGJ A;  4LF8 L;  1LTL A;  2EIF A;  4A3D H;  2ALY B;  3PO2 G;  5C0X J;  3M3Y H;  4P72 A;  2VW9 A;  2R92 H;  1CSQ A;  4DR7 L;  4JI4 L;  2CWA A;  3S2H H;  2JQO A;  2KEN A;  1CKO A;  2K52 A;  1JJC B;  4AYB E;  4GKJ L;  3HOV G;  4P71 A;  3TQY A;  3OTO Q;  4GLA C;  2VUM H;  5IYD H;  3W5O A;  1I5F A;  2WP8 J;  4GOP A;  1E7Z A;  1VQE A;  2E2H H;  1N33 Q;  5IYC G;  4C3I H;  1K0R A;  1IBK Q;  4HJ7 A;  4DV3 Q;  1VQM A;  4DK3 C;  5C44 G;  1X3F A;  4JOI A;  1WCM H;  2XGT A;  4IO9 A;  2R93 H;  1OXS C;  1Y1W H;  1L1O C;  1I6H H;  4QIW E;  2I5M X;  4JYA Q;  2D62 A;  4IPD A;  2OWO A;  2EQS A;  1YBY A;  3PSI A;  3OTO L;  5C0X G;  3CME A;  2IX0 A;  1N33 L;  4LNQ A;  1SFO H;  1K3R A;  3CCE A;  4HID A;  1IBK L;  4A3B G;  1Y1V H;  1VS0 A;  1VQJ A;  2A1A A;  4DV3 L;  1TWA H;  4PZ7 A;  3H0G H;  5LMN W;  4IJH A;  1OXT A;  2LXJ A;  4GOP C;  4JYA L;  3GTO H;  3S1N H;  2AHO B;  4R4T A;  1HZA A;  5IP7 H;  1QZH A;  2GVB A;  3AFP A;  2ZJP A;  4NXM Q;  4JOI C;  2VL6 A;  4IPG A;  2KCM A;  4JBJ A;  1WYD A;  3F8T A;  2YYZ A;  1I50 H;  2B63 G;  3PO3 G;  1WI5 A;  4DV1 Q;  3PF5 A;  4JV5 Q;  2PNH A;  1KRS A;  5FLM H;  3HOY G;  2I5L X;  3EIV A;  4JI5 Q;  4NXM L;  4MTN A;  4GLV B;  4PMW A;  3CCR A;  2YV5 A;  3NEL A;  1VQL A;  1KQS A;  4A3D G;  4LF6 Q;  1VQD A;  1L1O B;  4A3J H;  2R92 G;  3TEH B;  4L5Q A;  2ZTE A;  4DV1 L;  1XPU A;  3S16 H;  1G51 A;  4AQY Q;  4JV5 L;  3KF6 A;  4YWK A;  3STB D;  2NZH A;  4IPH A;  4JG2 A;  3KDF A;  1VQA A;  4TVA B;  5M3M H;  3CCQ A;  3H3V I;  4JI5 L;  3Q8D A;  4DV7 Q;  1YHB A;  1Q81 C;  5K36 G;  2VUM G;  4R4C A;  4JC0 A;  2R7Z H;  1EUJ A;  2RHS B;  3S2D H;  4LF6 L;  5J3B A;  1I94 Q;  5LMU Q;  3RLO A;  1XMQ Q;  2E8G A;  1WCM G;  4GOP B;  2R93 G;  4AQY L;  1PH6 A;  3UE1 A;  3J7Z C;  5BR8 Q;  1X3G A;  2F52 A;  2H5X A;  3M7N A;  1QUQ A;  2YTX A;  4WJ3 M;  1C0A A;  4DV7 L;  3GTJ H;  2BH8 A;  3K7A H;  3HOX H;  4A3G H;  1C7Y A;  1NTG A;  3J80 c;  3GO5 A;  4R4I A;  1Q7Y C;  5LMU L;  1XMQ L;  1I94 L;  2JA9 A;  1CKM A;  3ER0 A;  1K83 H;  3H0G G;  4RMF A;  2UUB Q;  3UDX A;  2PI2 E;  5BR8 L;  3CCU A;  3HOV H;  3JAM i;  3EBE A;  1EIF A;  5IP7 G;  2ZM6 Q;  4DR6 L;  3CQZ H;  3CCV A;  1EFW A;  4DV0 Q;  3H3V H;  1XNQ Q;  2DUD A;  2A19 A;  3RLN A;  5C44 H;  3S24 A;  3F2C A;  1VQB A;  3CXC A;  1XPO A;  1K73 C;  1WFQ A;  3U4V A;  5GAE C;  1OXX K;  4DR3 Q;  1VQ5 A;  3CAM A;  4C2M H;  4QJF A;  5FLM G;  4JCV E;  1SRO A;  2JEA I;  4OWX B;  3CCS A;  2ZM6 L;  1A63 A;  2CQO A;  1M90 C;  2B3G A;  3MXN B;  3PUZ A;  2ZJR A;  4POF A;  1X9N A;  4DV0 L;  1Z47 A;  1GM5 A;  1XNQ L;  3I4M H;  4TQU S;  2IX1 A;  3G6E A;  3I4O A;  3I56 A;  4A3J G;  4GNX A;  1KC8 C;  1V1Q A;  1TWG H;  4LFB Q;  3CW2 C;  2EXD A;  5IE8 A;  4DR3 L;  4DUY Q;  1K9M C;  2YU9 H;  3HOW G;  5H1S E;  1KRT A;  5JEA G;  5M3M G;  2N3S A;  4KI0 A;  3KF6 B;  3S1R H;  5JJL A;  1Q82 C;  2OCE A;  3KDF B;  1X54 A;  1IBM Q;  3J7A 5;  1DGS A;  3PV0 A;  4BXX G;  2IHF A;  2YTY A;  4JBW A;  5GAG C;  1Z9F A;  1CUK A;  4LFB L;  1NY4 A;  4DV4 Q;  1SR3 A;  2JA8 H;  4DUY L;  3PUW A;  1EQQ A;  2E5L Q;  3UDG A;  3D31 A;  4GN5 A;  4LW1 A;  4LF4 Q;  1KXL A;  4AIM A;  4DPG A;  2Q2T A;  4PG3 A;  5HY6 A;  3K80 C;  3J81 i;  1VQF A;  1QUQ B;  4GNX C;  3ULP A;  2UUC Q;  1E22 A;  2CFM A;  3HOX G;  1YJW A;  2VY3 A;  4DR2 Q;  4IPC A;  1PHJ A;  1HR0 Q;  1IBM L;  4A3G G;  5IWA Q;  1ASY A;  2NVY H;  2XTI A;  5HGQ A;  1LM0 A;  2KBN A;  4OX9 Q;  4YCU A;  1V9P A;  4DNI A;  2E5L L;  2UXB Q;  3I7F A;  4LF4 L;  4DR5 Q;  1Y14 B;  1X6O A;  4KHP Q;  2E2J H;  1W3S A;  1PYS B;  3CC4 A;  3PF4 A;  1VQO A;  2UUC L;  1KL9 A;  1OTC A;  4HJ9 A;  4A93 H;  2VNU D;  4ALP A;  4UP8 A;  4DR2 L;  1HR0 L;  2RF4 A;  1D8L A;  5IWA L;  2LXK A;  1JB7 A;  1WOC A;  4OX9 L;  1FJG Q;  3GTM H;  1NE3 A;  1A0I A;  3PCO B;  3L0O A;  3H15 A;  2UXB L;  5M5Y H;  5M5X H;  3UE0 A;  4DR5 L;  4JI3 Q;  4LF9 Q;  2BH2 A;  1L0W A;  4KHP L;  1EQR A;  3DM3 A;  1FGU A;  4DKA C;  4UY8 C;  2VS1 A;  3I4M G;  4O0A A;  2V1C C;  2UU9 Q;  4QGU A;  4BBS H;  3BU2 A;  3HKS A;  1YJ9 A;  2K14 A;  1Q46 A;  3CPW A;  1N36 Q;  1K8A C;  2HQL A;  1VQK A;  1FJG L;  1B8A A;  4A3C H;  3PGZ A;  1NMF A;  3E0E A;  4HJ5 A;  4GNX B;  4X64 Q;  4YCV A;  4JI3 L;  1YIT A;  1UWV A;  2VQF Q;  2UUA Q;  4LF9 L;  1Q12 A;  3TRZ A;  1GO3 E;  2PQA A;  3F1Z A;  4DV2 Q;  3HOZ H;  4UP9 A;  2UU9 L;  2CWP A;  3W1G A;  5JJI A;  4C3J H;  2HIX A;  4XIG S;  1N36 L;  3GDE A;  2BA1 A;  1S3O A;  1YNX A;  1N8R C;  2JA8 G;  3S1M H;  3M4O H;  3W1B A;  1P16 A;  1L2F A;  2JK8 A;  1BKB A;  4X64 L;  1M1K C;  4HIK A;  2UUA L;  2VQF L;  4ME3 A;  3KJP A;  2MO0 A;  1HH2 P;  1EWI A;  1GD7 A;  2JJQ A;  2ZTD A;  3RR5 A;  4L5T A;  4DV2 L;  1X55 A;  1SE8 A;  2AWN A;  2DGY A;  5ELN A;  3HOW H;  2VQE Q;  3S1Q H;  2N49 A;  4B3T Q;  4JI6 Q;  4LF7 Q;  1C9O A;  3TS0 A;  3NEM A;  1YEZ A;  1VQ4 A;  4A93 G;  2PI2 A;  3J81 j;  4BXX H;  5GAH C;  1JJ2 A;  1QVG A;  2I5H A;  4X65 Q;  1HNW Q;  2VQE L;  2D0P A;  4A3E H;  1A8V A;  1G29 1;  3HKZ G;  4B3T L;  4R1J A;  1HR0 W;  4JI6 L;  3GTL H;  4LF7 L;  3FKI G;  1AE3 A;  4YWM A;  1XPR A;  2Z6K A;  2OTL A;  4A76 A;  3HKZ E;  2E2I H;  1HJP A;  1VQ6 A;  2NN6 I;  3M9B A;  4BBS G;  1SRU A;  1D7Q A;  3BJU A;  5IT9 c;  4JI1 Q;  1GKH A;  2NZO A;  2WFW A;  4X65 L;  4HIO A;  4B3S Q;  1HNW L;  1E24 A;  4DAM A;  3M4Q A;  3L2P A;  3I55 A;  2MNA A;  4A3C G;  2GN5 A;  2RCN A;  3RNU A;  2Z0S A;  4JI0 Q;  2HT1 A;  1H95 A;  3HOZ G;  4X6A H;  2K5V A;  1TWF H;  5FLX c;  4JI2 Q;  1NMG A;  3S15 H;  2Q2I A;  2UUB L;  2F4V Q;  3T1H Q;  4B3R Q;  5C4X G;  4JI1 L;  3G71 A;  2PQA B;  1PH7 A;  4B3S L;  1HNX Q;  1YHA A;  2Z6K C;  2WB1 G;  4YHH Q;  1MIU A;  3F2B A;  1EYG A;  2ATW A;  1BVS A;  3HOU H;  2B29 A;  5GRO A;  2JA6 H;  4BBR H;  2OTJ A;  2HHH Q;  1X3E A;  1IZ6 A;  2WB1 E;  3NEN A;  2LSS A;  3PIO A;  5LMN Q;  4JI2 L;  3ICE A;  4B3R L;  1YZ6 A;  2F4V L;  3T1H L;  1TXY A;  3K7U C;  3M4P A;  4R4O A;  4DR1 Q;  3T1Y Q;  1VQG A;  1HNX L;  1PH3 A;  1Q1B A;  3FP9 A;  3UDF A;  4YHH L;  1MJE A;  2MO1 A;  2CKZ B;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...