2E2IH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
134
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 17
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2iH00
1JB7A 1CSPA 1YBYA 3G48A 1HR0L 1VQHA 1T9HA 3CW2C 1UE6A 3J7ZC 4OXPA 3T1HQ 4X65L 3KF6B 2NVYH 2N8NA 3I55A 3CPWA 3HKZG 4JI1Q 4IPHA 4A3BH 2UXBL 1K83H 4P71A 1FVIA 2WFWA 5M3FH 4LFBL 5FLMH 2VNUD 1CKNA 4A3JG 2R7ZH 1VQEA 1EYGA 4H02A 1HZCA 1VQFA 1Q1EA 3PUWA 2ID0A 2CQOA 2C35B 3PUZA 3PGZA 3RNUA 1G51A 2K75A 1TWCH 3HKSA 1I94Q 4LNQA 3S1QH 1KIXA 1BBWA 3U50C 1N32L 3F2BA 1GD7A 1OXVA 2L15A 3CF5A 2CKZB 4A3CG 3OW2A 2DGYA 5M5WH 2IT1A 4YWMA 3JAMi 3J7A5 2JA6G 1HR0Q 1P8LA 1YJNA 4DR7L 1MJEA 2R93H 4WJ4A 4X65Q 2Z0SA 1Q12A 3GTLH 1VQMA 3DM3A 4IFDI 4GS3A 3K81C 3PCOB 3KJOA 2UXBQ 5IYDH 4LFBQ 2IHEA 4ALPA 2KHIA 3M9BA 4A3MH 5IP7H 3K80C 2DUDA 4Y7NH 4BA1I 4QGUA 1SE8A 2ZTCA 5M5YH 3RLOA 4DR6L 4LFAL 4MTNA 2NZOA 5JEAG 3VDYA 3KFUA 1BVSA 2XTIA 4BBSH 1HH2P 5IYCG 4DV1Q 4OO1G 3L0OA 1U0LA 1WFQA 2CWPA 5IP9H 3CXCA 4DV7L 1K73C 1Q8KA 2AMCB 4GOPB 2Q2TA 4DR1L 4JI8L 1GM5A 4HIOA 3UDIA 3CMAA 4A3KH 2R7FA 3FKIH 5IY0A 4LF7Q 3M4OH 4IFDJ 3BJUA 2B29A 4YWLA 1M1KC 4JI4L 3PF5A 3M4PA 4YCUA 3CCUA 5M3FG 5GROA 5FLMG 2JA9A 4OWWB 1Q86C 1JT8A 3J80i 4A3EG 3TRZA 5IE8A 3E9IA 3HOYG 4DV0L 1GKHA 4JOIC 2VL6A 4KHPQ 1OXTA 3S16H 2Y0SE 1IBKL 4HIKA 4DR1Q 4YCVA 2ZJRA 1XMOQ 4P72A 3BU2A 3F8TA 1PA6A 4OWXB 2JA7H 3D0FA 1X65A 1YHBA 4XIGS 3CCVA 1Q82C 2K4KA 4JI4Q 4DPGA 1NMGA 4YWKA 1YHAA 3AFQA 2OWOA 4IOAA 4NXMQ 1KAWA 1XPOA 3EN2A 5IP7G 3MXNB 3MEFA 1PH1A 1PH9A 3RR5A 4AIMA 1VQ5A 1O7IA 4HIDA 3T1YL 5ELOA 1XPRA 5LMUL 3H15A 5IYBG 2RCNA 3I4MH 2F3IA 1VQJA 3GD7A 2UXDQ 1RL2A 5C4XG 1VQAA 4JI3L 2NVQH 1PYSB 4X62L 1VQDA 2NVXH 4PG3A 5GADC 1NJIC 1VQKA 4XTCS 4NXNL 3STBD 4YY3Q 1NTGA 4R4IA 4A3IH 2AHOB 4A3JH 1PH3A 1KD1C 1HNXQ 3J80c 4POGA 4JYAL 5K36G 2AWNA 5JJIA 4DV3L 2PMZE 4B3MQ 3CCEA 1IXRA 3T1YQ 4LF8L 2R7DA 4ME3A 5LMUQ 3UDGA 2BA1A 4IFDG 3CCRA 1R9TH 1U5KA 2UU9Q 1QUQA 2WB1G 1MJCA 2YU9H 1NBWA 2K14A 3HOVG 3GO5A 2ZJQA 4GKJQ 1W3SA 2JA6H 2VUMG 1X56A 4HJ7A 1AE2A 4IPDA 1A63A 1IL2A 5GQOA 4X62Q 2IY5B 3BZKA 3IRBA 2MO1A 5FLXc 2GN5A 5JEAJ 2JA7G 3T1HL 3E9HA 3I2ZA 2VY3A 3ZJYC 4X64L 1TWGH 3NEMA 5FJ8G 2E5LQ 1LM0A 3AFPA 4B3SQ 3DLLA 4JYAQ 4OWTB 1YJWA 2JQOA 4LF8Q 4HJAA 2HIVA 3TS0A 4JI6Q 4GN4B 1L1OC 1L0WA 2YV5A 3CC4A 1YVCA 4IPCA 4QIWE 5C3EG 3I7FA 1L2FA 3S1NH 4DR4L 1QVCA 2QEXA 3HFZB 3S2HH 4B3RQ 3M7NA 4JOIA 1GVPA 2UXCQ 3FP9A 4UPAA 4X64Q 1S3OA 4LF4L 3UE1A 4LF6Q 4L5QA 2KHJA 3U58A 4A3IG 4GNXC 1UEBA 1UE7A 1X55A 3F1ZA 1Y1WH 3CCLA 2YTVA 3NBHB 2UUCQ 4A3EH 4QL5A 3HOYH 3PIOA 4P75A 4DV1L 3I4OA 1XJVA 2A19A 4K0KL 2MFIA 1KHIA 4LFCQ 4DR4Q 1HNWQ 1EQRA 3PSIA 1SRUA 3GTPH 1B8AA 1YNXA 2F4VQ 1N33L 4LF7L 2UUBL 5M3MH 1IBLQ 3BZCA 3PIPA 4LF4Q 2Q2UA 2MO0A 1C9OA 2I5MX 1V43A 2IHFA 1PVOA 1X6OA 2LSSA 5HY6A 3Q8DA 4AYBE 1VQOA 5IWAQ 5C0XI 1EIYB 4QJFA 3K0XA 4DR5Q 1CKNB 4NB3A 2KENA 4RG1A 3A5UA 1TWFH 3CAMA 5IYBH 2AWOA 3CCJA 4BY7G 3G4SA 3M3YH 1UE5A 4L5RC 4KHPL 4K0KQ 1YI2A 4DNIA 4AQYQ 1X3GA 1NE3A 1EIFA 2JA5G 1LTLA 1AE3A 3KLWA 5C4XH 1XMOL 4A3LH 4IPGA 3GTQH 2F52A 4IJHA 4EX5A 1N33Q 1VCIA 4DV6Q 3WWVA 3KJPA 2UUBQ 4JI7Q 3L2PA 1DGSA 1K3RA 1YITA 1I6HH 1YEZA 1M90C 4A3DG 4YHHQ 3U4VA 5C0XJ 4NXML 5E7NA 2K5NA 1Y1WG 1CKMA 1CUKA 1SROA 1Q46A 3S1RH 4R4OA 4JCVE 1X3FA 2BA0A 3H0GH 5LMNW 2HHHL 1WCMG 3HOVH 3HOZG 2Q2HA 3ER0A 2UXDL 2VUMH 4OX9Q 4JG2A 4DR2L 4DKAC 2IX1A 1IYJB 1L1OA 1IZ6A 1WYDA 3RLNA 3KOJA 1QZHA 1K9MC 3S17H 5FJ8H 5M3MG 1N9WA 2MNAA 1XNRQ 1RIPA 2NN6I 4O0AA 4UP8A 4YY3L 1VQPA 3KF8B 2A8VA 1HNXL 3J81j 1UE1A 2V1CC 5GAEC 1X54A 1S40A 4C3IH 4B3ML 3S15H 1PH5A 2HHHQ 2B63G 1K8GA 1H95A 2UU9L 3CC2A 4HJ5A 2D0PA 4GNXA 1EWIA 4PMWA 5C44G 3E0EA 5C3EH 3TEHB 1VQ7A 4UP7A 2Q2IA 4GKKL 1EUJA 2H5XA 4BBRG 4DR2Q 1YIJA 4A3LG 3U4ZA 4GKJL 1G6PA 1S72A 1D8LA 2LXJA 5GAGC 5GAHC 4O2DA 3HOXG 1PH7A 3CPFA 2E2IH 3GTGH 2PQAA 2D62A 2RF4A 4LUVA 1HZAA 4B3SL 2E5LL 3KDFA 4GOPC 1FJGQ 3RZDH 4DK6C 1I3QH 3S24A 1LUZA 2IX0A 4QY7A 3G71A 5JJLA 2I5HA 2QGQA 1C7YA 1HR0W 1VQLA 5EAYA 2PI2A 3S2DH 4A3GG 3HOWH 4JI6L 3H0GG 3S1MH 4JC0A 2GVAA 4A76A 5C0XG 2UUAQ 3TREA 5JJKA 3I4NG 1BKBA 4BXXG 1E22A 4GNXB 3FHWA 4APVA 1SFOH 1EFWA 4TQUS 1VQ9A 4B3RL 2PNHA 1VQNA 3KYHC 2UXCL 3PF4A 2ATWA 4DAMA 3ERSX 2VQFQ 2MQHA 1Q81C 1N36Q 1ASYA 4LF6L 1D7QA 2B3GA 5J3BA 3W1GA 4OONA 4R4TA 4BA2I 1QVFA 2R92H 2OTLA 1Y1VH 2EQSA 2UUCL 4BY7H 4PZ6A 3RN2A 4J15A 1HZBA 1B7YB 1Z47A 3W1BA 3A74A 3KF6A 5DLQE 4UP9A 2JA5H 1TXYA 4C2MH 4C3JH 5AJ3L 1QUQB 4LFCL 4HJ8A 1JMCA 1A62A 1KL9A 2ASBA 1HNWL 1BBUA 4PZ8A 2ZM6Q 2YTYA 1XTDA 3H3VI 1FGUA 4JI2Q 2BH2A 2F4VL 4LWCA 4KI0A 1MIUA 1IBLL 2D0OA 4A3DH 1YZ6A 3CP0A 2XGTA 3J81c 5BR8Q 5ELNA 3RN5A 1QVGA 5IWAL 4DR5L 2VZAA 2WAQE 4AYBG 5IT9c 2KCMA 4DUZQ 3ULPA 2WB1E 2K5HA 1WCMH 1P16A 4LF5Q 1VQ8A 3HOZH 2A1AA 2K52A 3HOWG 3PO3G 1UWVA 2NN6G 1WJJA 4JBMA 3GTKH 3M4QA 3D31A 2CWAA 5AJ3Q 3NENA 4DV5L 2I0QA 4AQYL 1XPUA 3F2DA 1X9NA 1B70B 3UDFA 4X66Q 2ZTEA 1E1OA 3CC7A 4DV6L 1PH2A 1PH8A 1JJ2A 2ES2A 2JEBI 3W5OA 4JI7L 3RLFA 3S14H 1JJGA 2JE6I 1V9PA 2WP8J 4YHHL 3F2CA 3A5ZB 3L7ZC 4DR3L 3GTJH 3CMEA 3H3VH 2E8GA 4LUOA 2HIXA 4GLXA 2R92G 1NY4A 1Y1VG 1Z9FA 1KC8C 1HJPA 1J6QA 2B63H 2JEAI 4DV2L 4GOPA 2OQ0A 1WOCA 2Z6KC 3CQZH 4NPSA 5C44H 3PO2G 1IBML 3LGJA 4DAYB 4DV5Q 4WJ3M 4BBRH 1PH6A 3CD6A 4OX9L 1N34L 1MKHA 3TQYA 2Y0SG 3HOXH 4BY1H 2EXDA 1SN8A 4TVAB 4DK3C 3HKZE 1PFSA 4AH6A 3I56A 4A93G 4JBJA 3GDEA 4Y52H 4LF9L 1SMXA 3AYHB 3K8AA 4P73A 4RMFA 4JI5L 1XNRL 1V1QA 1HNZL 2ZTDA 3EBEA 2VW9A 4DR3Q 1SLJA 3OTOL 2HT1A 2N49A 4L5TA 4GKKQ 4A3FH 1N32Q 2BH8A 3UE0A 1ASZA 4A3GH 2PI2E 5H1SE 1GO3E 4DV2Q 4L5SA 3A0JA 2JA8H 3GTMH 1EQQA 1IBMQ 3HOUG 4KLKA 3I4NH 1OTCA 1N34Q 4QQBX 2LXKA 3UDXA 1VQCA 1VS0A 3PUVA 4GN5A 1I5FA 3G6EA 1N8RC 4DR7Q 1JE5A 1W2BA 2E2JH 2YYZA 4DV4L 1OXSC 1XMQL 1WI5A 4JBKA 4LF9Q 4JI5Q 2NVTH 1JJCB 4A3BG 1HZ9A 2N78A 3EIVA 1HNZQ 4LUZA 1SR3A 3OTOQ 3RZOH 1VQIA 1FJGL 3NELA 4IO9A 2R7ZG 2RHQB 4DR6Q 4LFAQ 2OTJA 3CCMA 1E3PA 4P74A 4PZ7A 1VQ4A 3PUXA 1PYBA 4DV7Q 2QA4A 1I50H 1X3EA 1E7ZA 4GLVB 3JAMc 4B3TL 4C3HH 4MZ9A 2OCEA 4KHZA 3CCQA 2UUAL 4JI8Q 4POFA 5C4JH 4X6AH 3PUYA 3STBC 2R6GA 4BY1G 4DV4Q 2I5LX 2R93G 1XMQQ 3JC66 3CCSA 2E2HH 4HJ9A 4YCWA 2ZJPA 4IOCA 5IYDG 1L1OB 2VQFL 3ICEA 1N36L 1Y14B 2JJQA 4HIMA 4A3MG 2K5VA 2OQKA 4R4QA 2RHSB 3J81i 1CKOA 4JI0L 1TWHH 4MNOA 4A3FG 1K0RA 1VQGA 4IJLA 4DV0Q 1A8VA 3PV0A 1PV4A 1OXUA 4B3TQ 3PO3H 4BBSG 1J5EL 1CSQA 2JA8G 1VQ6A 3ULLA 4EQ5A 5IP9G 4A75A 1IBKQ 1NMFA 4DUYL 2ALYB 2N3SA 2ZM6L 1E24A 5LMNL 2Z6KA 2KBNA 4FDBA 1KRSA 4A3KG 3FKIG 4JI2L 1EOVA 2HQLA 4GN3B 2K50A 4JBWA 4OO1I 1A0IA 1K8AC 4UY8C 2VQEL 1VQBA 4JV5L 1AH9A 3K7UC 4A4IA 2EIFA 2PQAB 5BR8L 2NZHA 4JI0Q 5HGQA 3KDFB 1LYLA 4DUZL 1PH4A 4GLAC 2WAQG 1PHJA 1OXXK 4BXXH 4LF5L 1J5EQ 2KCTA 3PO2H 2CCZA 4A3CH 1KRTA 2JK8A 1G291 1XNQL 5M5XH 4DUYQ 4JI3Q 4R1JA 2GVBA 4X66L 1FL0A 5LMNQ 1YHQA 1Q7YC 4A93H 2VS1A 1KQSA 1KXLA 2YTXA 4LW1A 2AKWB 3AEVA 4NXNQ 4JI1L 2VQEQ 4JV5Q 3TS2A 4R4CA 3M85A 1E1TA 4DV3Q 3AQQA 3SGIA 1QZGA 1TWAH 3GTOH 1C0AA 5IYCH 1I94L 2FXQA 3HOUH 3I4MG 3ULJA 1XNQQ 1Q1BA 3B6YA 2CFMA 3K7AH 3OYYA 1YJ9A
chains in the Genus database with same CATH superfamily
3EFXD 1CSPA 1YBYA 3G48A 3UI2A 1T9HA 3CW2C 3S2HB 4OXPA 3I55A 4A3BH 4P71A 1TS2A 2WFWA 2R7ZH 1K3BC 4H02A 1W6JA 3PUWA 4GKKL 2C35B 3PGZA 3DEOA 1G51A 1PDQA 2K75A 5C5MA 3RNUA 1N32L 3GP7A 4CDDC 1PRTC 2EYFA 5FO8B 5I6WA 3OW7A 1CQFA 3JAMi 4CJ2C 3J7A5 3I4LA 4NW2A 1HR0Q 1P8LA 1NR4A 1RJTA 4X65Q 2Z0SA 4IFDI 3DM3A 5IYDH 4GS3A 3K81C 4KKSA 2UXBQ 2F0OA 4ALPA 2KHIA 5E4XA 2OT2A 1MBYA 5M3MB 5IP7H 4RWSC 1SE8A 4KKTA 4MTNA 2XTIA 1QNUA 5IYCG 2CWPA 5EQ0A 5T1GA 4DR1L 4TKOB 1GM5A 2O4XA 4HIOA 5T1IA 3M4OH 2J0TD 3FKIH 5IY0A 4IFDJ 3BJUA 2B29A 1M1KC 3M4OB 3PF5A 3M4PA 3CCUA 2EYLA 2L55A 1QILA 2OXPA 5IGDA 2JA9A 2PZTA 1EWCA 3NWTA 5IE8A 1AZPA 3E9IA 3HOYG 1WD0A 1GKHA 3S1RB 4QMGA 1C8CA 4KHPQ 2R3ZA 3S16H 1I6VC 3AB9A 4HIKA 1XX8A 4L8JA 2EY6A 1FNWA 4OWXB 2IWHA 1BBXC 2N88A 2BOSA 4JI4Q 4N8FA 1YHAA 1BDOA 2LS01 2OWOA 3U9OA 4ZCKA 3R2TA 1LTAD 1PZID 3MXNB 3MEFA 1ET6A 3SK5A 4HIDA 1VQ5A 5LMUL 3H15A 2RCNA 4C3IB 2F3IA 2RA4A 3R8BA 3BS1A 2NYZD 5C4XG 4RH6A 3NE5B 1Q3LA 2B2VC 4X62L 5LL6X 2B2UC 1NJIC 3EVQA 1U4MA 1HA5A 4QUCA 1VMCA 3J80c 4JYAL 1S4ZA 2PMZE 2PNRC 3T1YQ 4ME3A 4IFDG 4HTHA 1QUQA 2L12A 1MJCA 4RHRA 5KRUA 3GO5A 1BOSA 3S2DB 4HJ7A 1AE2A 4IPDA 4HN7A 1IL2A 2JA7G 1SFOB 3T1HL 2A73B 4FO2A 1GUTA 3I2ZA 2VY3A 4X64L 5IGGA 4B3SQ 3AFPA 1BCPB 3DLLA 3AMUA 1SE2A 3KBGA 1SNPA 1V1PA 5EPJA 5JEAH 1YJWA 3DWPA 1V1OA 3V2TA 4JI6Q 4BY7B 1II3A 1Y8PB 2RBMA 1WTQA 1O7LA 3DHQA 1QVCA 1HQRD 3PMFA 3M7NA 1R4PB 2Q8RE 2UXCQ 3FP9A 4LF4L 3UE1A 2LY7A 2KHJA 3U58A 4XDXA 3R2IA 1EY0A 3MC0B 1Y1WH 3T16A 3IFDA 1RD9D 4K2LA 4DAYA 2XNAC 3IAYA 1G2SA 2EXZA 4G7ZC 1XJVA 3A7LA 3PSIA 3GTPH 3GTKB 1B8AA 3FPPA 1VDZA 4FYDA 4IUUA 4LF7L 3PIP3 2JSOA 5IGCA 4KN4C 3HGBA 3NWSA 3Q8DA 1EIYB 1CKNB 2F0QA 4NB3A 3K57A 3A5UA 1TWFH 2AWOA 3OIQA 3CCJA 3QR8A 4FP5D 3G4SA 2B63B 1YI2A 1FNVA 1EIFA 2F0PA 3CQZB 3Q0AA 1D1KA 1WTHA 1IKLA 1B2TA 1D6EC 4IJHA 1N33Q 1CQVA 4DV6Q 3WWVA 1IYUA 2UUBQ 3I72A 1DGSA 3KF8A 4DK0A 1YITA 1YEZA 4ULLA 4YHHQ 3U4VA 3E0JA 1Q46A 5D14A 1EY9A 3H0GH 1I4RA 3X3NA 2UXDL 3H0GB 2VUMH 4DK1A 1ILQA 4JG2A 4DR2L 1AEXA 1WYDA 4RHSA 4QIWB 3KOJA 3RLNA 3NQIA 5FJ8H 5M3MG 2FHTA 5C3WA 2E2JB 1HXYD 2NN6I 4YY3L 4CKEA 3KF8B 1HNXL 3Q22A 1LTID 2C5CA 2R61A 5GAEC 2KJXA 5JAVA 1BXTA 1BF4A 3S15H 1EYAA 1PH5A 2Z9HA 1H95A 2UU9L 1O80A 1E0BA 3A8KE 3D4RA 4GNXA 4PMWA 4CDCC 5C44G 1QE6A 3E0EA 5C3EH 3BDLA 1I50B 1EUJA 2H5XA 4A3LG 4GKJL 1G6PA 5GAGC 1PH7A 4PMBA 4G57A 3MAQA 1SAPA 4CKBA 2PQAA 4LUVA 3RZDH 2F0GA 5C4HA 1LUZA 2IX0A 5JJLA 1EY8A 1STAA 1C7YA 1HR0W 5EAYA 4A3GG 3HOWH 2EY2A 2GVAA 3I4NG 4GNXB 4APVA 1M4VA 2PNHA 4CKCA 1T5XD 3C1EA 3ERSX 2VQFQ 1ASYA 1N36Q 1STYA 4OONA 4R4TA 4BA2I 4DU9A 1QVFA 5C5LA 1Y1VH 4EQOA 5IGFA 4XT1B 3W1BA 3A74A 1RF2D 2V4DA 4UP9A 3A8IE 1TXYA 4HJ8A 5IT9L 4C3JH 4LFCL 1JMCA 1BBUA 1KDAA 1KLUD 1PMRA 5FKAC 1G8ZD 2F4VL 4LWCA 1XWEA 3RMHA 4A93B 4A3DH 1TR5A 1VMPA 4ZKCB 1SNDA 1ENAA 3KUPA 5IWAL 4AYBG 3ULPA 2KCMA 3PIO3 4DUZQ 2WB1E 2K5HA 1WCMH 4HCSA 1AN8A 4LF5Q 3HOZH 1MGSA 5J22A 1F2MA 1NSNS 4E6IA 1UWVA 2NN6G 1A63A 3GTMH 2CWAA 3NENA 3VYRA 3GV6A 2EDGA 1B70B 3UDFA 3KLSA 4WRDA 3BDCA 1PH2A 5ELDA 5ELBA 2CQAA 2NVYB 3F2CA 4DR3L 1K83B 3CMEA 2EOTA 3QIAA 1A3UA 1Z7TA 4KY7A 2JEAI 4DV2L 1EQVA 1WOCA 4NPSA 1TWCB 3L3OC 1BCPC 3LGJA 1D5MC 4H7BA 3HOXH 4BY1H 1CTMA 2EXDA 4DK3C 3K0YA 1XYIA 4LF9L 1SMXA 3AYHB 1VF7A 3K8AA 4P73A 1XNRL 1HNZL 1EOTA 1SMYC 1SDFA 1SYCA 1TS4A 4A3MB 4Y7NB 1ASZA 3K5LA 1K8MA 3E5SA 4L5SA 2AUKA 4QF4A 3H09A 4BBSB 3O13A 1OTCA 1N34Q 4QQBX 2LXKA 3PUVA 4DR7Q 1TY2A 1JE5A 4DV4L 3J7AV 1WI5A 4JI5Q 2NVTH 1JJCB 1CI3M 1EIGA 1HZ9A 2N78A 4LUZA 3RZOH 4IO9A 3CCMA 4PZ7A 2MPMA 3K5OA 1EWHA 3TZDA 2F0MA 1BQQT 3PUYA 2HDMA 4WFN3 1TIID 2ZJPA 2RVLA 2X69A 2E74C 1D1IA 4R4QA 5J39A 1HPCA 1TWHH 2VB2X 5IIFA 5IP9G 4A75A 1IBKQ 1SJHD 4FDBA 1KRSA 2CHBD 1K8AC 3QJYA 4KY5A 5CR3A 3K7UC 2F0EA 2IW3A 5BR8L 1B9MA 4MTKA 4A3IB 1O7YA 1PH4A 5K5PA 4WJWA 2WAQG 1PHJA 4BXXH 3PO2H 2CCZA 1IKMA 4FXGC 2JN4A 2A6ED 1WD1A 1SYBA 1R9TB 2YU9B 2EYHA 1FL0A 4JW0A 1A2TA 3P7JA 1KXLA 2YTXA 2AKWB 4NXNQ 4JV5Q 1RKNA 1LABA 3TP8A 1S5FD 1YNJC 1TWGB 1E1TA 1PZJD 1QZGA 1TWAH 1SYEA 5IGEA 5IYCH 1SE4A 2FXQA 5CV7A 2TMPA 3DEPA 1XNQQ 1Q1BA 4RKBA 4S3SA 2CFMA 3KF6B 3OYYA 3FPUB 1HR0L 2F0UA 2SDFA 3S1NB 1UE6A 4X65L 3CPWA 3HKZG 5EBDA 2UXBL 2DY7A 1FVIA 2PZUA 4B9WA 2VNUD 4A3JG 2B8GA 1JB3A 1EYGA 3Q6SA 1FD7D 1Q1EA 4LNQA 4ODGA 1I94Q 1BBWA 3U50C 2QKIC 4HEDA 3HOYB 2L15A 1LT4D 4J6HA 2DGYA 5M5WH 3C2PA 4YWMA 2DN8A 2JA6G 3A55A 3MFGA 1MJEA 2R93H 3I91A 3I8ZA 4LFBQ 3M9BA 4F7XA 2DUDA 4QGUA 5M5YH 4LFAL 2B2UA 1PZKD 3VDYA 3KFUA 1BVSA 1E2VA 3W2DA 1WFQA 4DV7L 1HFGA 1Q8KA 3M3YB 2AMCB 4GOPB 1UEAB 3A54A 2Q2TA 2CW0D 3UDIA 4A3KH 5C4XB 3GTQB 4YWLA 4JI4L 5CMDA 5GROA 5FLMG 4ZRZA 2B2YC 1I6HB 1EU4A 4IFDH 1JT8A 4A3EG 3TRZA 4JOIC 1KTKA 2A6HC 1MSHA 2DJFC 1LV9A 4LAAA 1ESFA 4YCVA 5KGUA 4P72A 2XN9C 3OHXC 2JA7H 3D0FA 2A5HA 1X65A 2KOLA 4JPBW 3LX0A 1NMGA 4YWKA 2P5ZX 3AFQA 3C1FA 4IOAA 4NXMQ 1KAWA 5CBEE 3S17B 3T51B 3TN2A 3EN2A 2NZ1D 4F87A 2EJMA 2JXMB 3A56A 3RR5A 1O7IA 3T1YL 5ELOA 2SEBD 4K6DA 2L9HA 2TSSA 3I4MH 1VQJA 2D5DA 5EKLA 1VQAA 4JI3L 2NVQH 4XQJA 1VQDA 1H9SA 4CHTB 2NVXH 1PTOD 5GADC 4KTAA 1GUSA 1NTGA 2Z1CA 3STBD 1PH3A 4POGA 5EBCA 1EZ6A 5FLXL 5A35A 1B44D 5I2YA 4DV3L 2ICIA 2R7DA 3HOVG 2K14A 4DGZA 1R4QB 1L0YB 1X56A 1K8OA 4KD3A 4R8NA 3BZKA 3E9HA 1E2WA 2Z6BA 2E5LQ 4IZ8A 1HA6A 2Z4HA 2RDHA 5CV8A 4LF8Q 4DXFA 5FOBB 2R92B 2L11A 1S5CD 2YV5A 2NTSA 4H44C 4IPCA 2F0LA 2KVMA 3I7FA 2AQ2B 3S2HH 4B3RQ 2F3VA 1GVPA 2Y0SB 4LJZC 4K6LA 4UPAA 1S3OA 5A2QE 4L5QA 4A3IG 1X55A 3CCLA 4HSPA 3NBHB 2UUCQ 1TU2B 3PIOA 5KNBA 5J1ZA 2B2WC 4DV1L 5COYA 3LNNA 2MFIA 4DR4Q 3LWUA 1SRUA 3EA6A 5D3DA 1YNXA 2PZWA 1N33L 2UUBL 5M3MH 1IBLQ 5ELCA 1A3TA 2MO0A 2I5MX 4EQPA 2F0JA 2LSSA 3D4WA 5EPKA 4QB4A 1VQOA 4DR5Q 5I6YA 1JQYD 5IYBH 1EL0A 1CHPD 3I3CA 4K0KQ 4NP5A 1NE3A 2JA5G 4A3LH 1LTLA 1AE3A 5C44B 1XMOL 3Q23A 3PQIA 5CORA 4CJ1B 3KJPA 1K3RA 2A74C 1B9NA 1CHQD 5K36H 5E7NA 1CKMA 1CUKA 1SROA 5TSSA 3V96A 3S1RH 2HCIA 4R4OA 2HD3A 1X3FA 4A3FB 4A3GB 5AFWA 4K5XA 3TSSA 4EQNA 3A7AB 4FF4A 3I4NB 2IX1A 1L1OA 2A68C 1QZHA 1UAPA 1Y8OB 3OSOA 1CA5A 1VF5C 4K8JA 4UP8A 2A8VA 2QDBA 3R3OA 1LLRD 1S40A 4C3IH 4B3ML 2HHHQ 2D2CC 1K8GA 3CC2A 2BE5C 2A69C 2NB0A 1VQ7A 2NBFA 4BBRG 4C1NK 4IUNA 3U4ZA 2N55A 5GAHC 5C4JB 3CPFA 3D6CA 3QWNA 3N6RA 1EYDA 4RGNA 4GOPC 3S24A 1I4QA 4QY7A 2QDLA 3G71A 1ML0D 4RKLA 3BG3A 4AYBB 1VQLA 3MHBA 3S2DH 2G9HD 2NN6H 4N8X1 1KABA 3VR6A 5I9PA 5JJKA 1E22A 3HRZC 1SFOH 4TQUS 4CDEC 1VQNA 2L4NA 1A15A 3PF4A 1SNCA 3A8JE 4IUVA 5FLXE 1Q81C 4LF6L 4ME5A 1TY0A 5J3BA 3W1GA 2OTLA 3D8GA 4BY7H 4DXGA 3J81L 4IURA 3TZUA 4NDXA 1ZYRD 4EVOA 3TP7A 1QUQB 1HNWL 1KL9A 4G4KA 2ZM6Q 3H3VI 1FGUA 2G9DA 4JI2Q 5G3LF 2M2LA 1F9PA 5ISRA 1KDBA 2J4XA 3RN5A 1QVGA 2BDNA 2VZAA 1F2YA 3K59A 1P16A 1VQ8A 1V1PB 2EYJA 3PO3G 3GTKH 3W3AA 4U673 2FFKB 4AQYL 4QUFA 1WTOA 4X66Q 1JJ2A 4JI7L 2F0DA 2JE6I 1SXTA 2D9UA 3A5ZB 3TP6A 5M3FB 2HDLA 4GLXA 2R92G 5IGBA 1KC8C 2B63H 1J6QA 4RCOA 2BCOA 3VYUA 1EY5A 2Z6KC 3CQZH 3S1QB 4DAYB 4DV5Q 3CD6A 4OX9L 1N34L 1MKHA 2RDFA 2Y0SG 2EJGC 3OOCA 4N9PA 3I90A 4U68A 1S5ED 4JI5L 5I2XA 3GTLB 1V1QA 5ELFA 2HT1A 2WINB 3EROA 1GXDC 4L5TA 5FK9C 4GKKQ 1N32Q 5E3FA 4KN7C 4FF1A 1CZGA 3HOUG 4KLKA 3P1HA 3UDXA 1N8RC 3R93A 1ET9A 4J8QA 1DONA 1W2BA 2E2JH 2YYZA 1RTNA 3JAML 4KY6A 4A3BG 1X3PA 3HS0C 4RA8A 4Q0FA 1FJGL 2DJGC 3MXGA 2R7ZG 1G91A 2OTJA 1E3PA 3NP8A 2CH4A 3VR3A 3VR5A 3PUXA 1LT5D 4ZAIA 1PYBA 1I50H 2RCFA 2WAQB 3IFTA 4MZ9A 2OCEA 4KHZA 2UUAL 1K0SA 4POFA 4X6AH 2F0NA 3NK9A 4HAEA 3H3VC 1LTRD 3GQBA 3CCSA 1TQOA 5IYDG 3ICEA 4G7HC 2JJQA 3MFYA 2BDOA 1BCPF 1F9QA 1CKOA 4DNTB 1ESRA 4MNOA 4A3FG 1VQGA 1A8VA 3PV0A 4B3TQ 3C3LA 4FXDA 3IKJA 3ULLA 4RCNA 3EJIA 4I7AA 1E24A 2B8FA 1SYGA 2KBNA 3FKIG 1EOVA 3CRLC 4B08A 2E2DC 2MJ8A 4UY8C 3HKZB 4JV5L 2EIFA 3URYA 1JR0D 2PQAB 3SDZA 5DM73 3GTOB 4A3JB 1LYLA 4GLAC 1OXXK 2K01A 1DOMA 3RUZA 2KCTA 3QO2A 1XNQL 4C3HG 1SYDA 1BO0A 2JP1A 5LMNQ 1Q7YC 4A93H 2JA6B 2VS1A 1JOQA 2F0TA 5BN3A 2VQEQ 3TS2A 4RFBA 4IN3A 3M85A 1U4RA 1NAPA 2M9VA 3SGIA 5M9OA 1QCBD 1I94L 1D2BA 2FMMA 2B2TA 3B6YA 1ZKOA 2RSOA 1JB7A 1ILPA 1X3QA 5EPLA 1VQHA 3J7ZC 3T1HQ 4KD4A 2NVYH 4IPHA 3NSWA 1K83H 4LFBL 1I4GA 5FLMH 4V0BA 4ID6A 1VQEA 1VQFA 2CQOA 1TWCH 4A3EB 2F0VA 2FJ2A 1TKWB 4TSSA 4A3CG 1G6ZA 3OW2A 2M00A 3ZYYX 4WJ4A 1Q12A 5HGTA 1VQMA 3MXUA 4IUPA 4A3MH 4K14A 4Y7NH 4BA1I 1WTRA 3TDQA 3Q24A 1PLFA 2ZTCA 1Y8NB 3MEHA 4DR6L 5JEAG 2MHVA 4BBSH 1HH2P 1FR3A 4C1NI 1U0LA 2SNSA 1W6KA 3SK8A 5DNFA 4JI8L 5C3XA 1T5EA 1ZEQX 2GA4B 3G7LA 3CMAA 4LF7Q 1KNAA 3TP5A 3VA5A 5M3FG 1M8AA 4OWWB 1JC7A 1TT2A 4MN3A 4DV0L 1ICWA 2VL6A 1OXTA 2I07B 3HOVB 2ZJRA 2O5JC 4ABNA 3F8TA 1YHBA 4XIGS 3L9AX 4UHVA 1PFBA 4H13C 4EGVA 5IOCA 3CCVA 1CK1A 1EQTA 3G6JB 1PH1A 2WIIB 5KNDA 2F0SA 3J80L 3GD7A 2UXDQ 4MHEA 1FNUA 1RL2A 1SEBD 2QEJC 1JWUD 1VQKA 4XTCS 4YY3Q 3DMUA 4A3IH 4R4IA 3GTGB 1HNXQ 2IJ0A 3H94A 4NMZA 2E2IB 1Y69U 1DD2A 1GHJA 2AWNA 5JJIA 3WOFA 2KEEA 4LF8L 1I3QB 3UDGA 2DNCA 1R9TH 2UU9Q 2YU9H 1NBWA 1NCVA 2ZJQA 1GHKA 1ZXTA 4GKJQ 1W3SA 2VUMG 3S1MB 5DM63 2RKSA 5GQOA 2IY5B 2MO1A 2GN5A 2WKDA 1TWGH 5FJ8G 3E3XA 3K6OA 1XTCD 3D3RA 4OWTB 1EY6A 4HJAA 2HIVA 2CVRA 5IT9E 3TS0A 2K05A 4IUTA 4B9XA 1YVCA 4QIWE 5C3EG 2L0CA 1L2FA 3S1NH 4DR4L 2QW7A 3HFZB 2JA5B 4C2MB 1I4HA 1HQMC 2QCPX 1PFNA 1YNND 3MZ5A 3NHHA 4GNXC 1UEBA 1UE7A 3F1ZA 2F4IA 5DAUA 3DWAA 3OPOA 2RDGA 3BYYB 3HOYH 4P75A 2K03A 1IW7D 3I4OA 2A19A 4K0KL 1KHIA 3SR1A 4DAPA 4LFCQ 2NTTA 1EQRA 2F0IA 3KLRA 1JOKA 2Z8LA 2F4VQ 2K33A 3C46A 3LWEA 3BZCA 3PIPA 1F2ZA 1C9OA 1V43A 4L63B 4OEMB 4KHVA 5HY6A 4CJ0B 1EEFD 2B2VA 5IWAQ 4ZUJA 4FNFA 5C0XI 4ZKBB 3S14B 1PTOB 4RG1A 1EZ8A 3GTJB 3VR2A 2KQ3A 3M3YH 4L5RC 4KHPL 3SVMA 3J7AF 4DNIA 1PRTD 1X3GA 5C4XH 4C3JG 4IPGA 3GTQH 2F52A 4BBRB 3FVQA 2FMCA 3NTKA 4EX5A 1VCIA 1CA6A 3OWFA 3QOJA 3L2PA 1S5DD 5E1FA 4KMUC 1I6HH 1M90C 4A3DG 5LL6S 5C0XJ 3T56B 3KK7A 4XXEA 5KIXA 1HTLD 5LMNW 2BA0A 2HHHL 1WCMG 3HOZG 2K04A 2JA8B 4WORA 3M4YA 4DKAC 1IYJB 1IZ6A 2EY5A 1WTPA 1K9MC 3S17H 1XNRQ 1RIPA 1VQPA 1IYVA 5ELEA 5JVH3 3J81j 1UE1A 2V1CC 5JPNC 1X54A 1RCVD 4O42A 4HJ5A 1DM0B 1EWIA 1HRJA 3TEHB 4UP7A 1AW7A 2Q2IA 1YIJA 1S72A 3NQTA 1D8LA 1JWMD 3HOXG 4M8AA 4O2DA 2HUGA 2RF4A 2SNMA 2A68D 4B3SL 1B50A 3KDFA 4JK1C 2E2HB 1Q8IA 4DK6C 3J80E 2I5HA 1JE4A 3VR4A 4JI6L 5EJWA 1WVLA 5C0XG 3PO3B 5KYLA 3HG9A 3FHWA 5CV4A 4RGMA 1VQ9A 1GUOA 2Z4IA 2PYKA 2VB3X 2UXCL 1LACA 4FVMA 2ATWA 4DAMA 4UAIA 5NUCA 1D7QA 1H9SB 1GUNA 1MI2A 3KBXA 4IQZA 4XQQA 2R92H 1S5BD 2EQSA 3V05A 1JWSD 3RN2A 4QCLA 4J15A 3OIPA 1B7YB 4RGTA 1EY4A 5E4WC 2MP1A 1FGBD 3BVMA 4GZYC 4BS9A 2PW7A 4PZ8A 4XYOA 4R8IA 2BH2A 3CU7A 1SE3A 2XRSD 4CDFC 1DCZA 1YZ6A 3CP0A 2XGTA 1PFMA 3ONAB 4OIJA 3M7GA 5BR8Q 3D6WA 2L5TA 3VA7A 5IT9c 3HP3A 4OGQC 4OHJA 1BNZA 2PW5A 4HR7B 1CM9A 5BN4A 2K52A 4JBMA 1WJJA 2IL8A 1JOOA 5AJ3Q 4DV5L 2I0QA 3HOUB 1X9NA 2OEOA 3SK6A 2ZTEA 3K7AB 2AUJD 1SYFA 4DV6L 2ES2A 1JJGA 4O1NA 1V9PA 4A3BB 3E6ZX 4YHHL 3BDOA 3L7ZC 3ERQA 3H3VH 2EPBA 2E8GA 4LUOA 1NY4A 1Z9FA 2R7ZB 4PNYA 2VXWA 4BXXG 2OQ0A 5C44H 3PO2G 2CW0C 4XQNA 1PH6A 2KA7A 4LMQD 3TQYA 4TVAB 1SN8A 4BWGB 5BN5A 4AH6A 3I56A 4CBVA 2ZTDA 3EBEA 1SLJA 2X6LA 1C4QA 4A3FH 2BH8A 3UE0A 4A3GH 2PI2E 5H1SE 1STHA 3DUZA 1EQQA 1IBMQ 3I4NH 4R9WA 2QF7A 1VQCA 4GN5A 3BVGA 1WTXA 1OXSC 2MUYA 3FKIB 4K2KA 3MXNA 2X6GA 1SR3A 4X3TA 3OTOQ 1VQIA 2ZXRA 2LFNA 2RHQB 4P2CB 4LFAQ 4Q5VA 4P74A 1D5ZC 4DV7Q 4B3TL 1X3EA 4GLVB 2ZXOA 4I65A 3K5MA 4C3HH 2WB1B 5C4JH 3S16B 3MWYW 4C3HB 1PTOC 3NTHA 3STBC 2R6GA 2I5LX 2R93G 1H9RA 1XMQQ 1G2TA 4H0LC 2O2LD 1L1OB 2VQFL 1STNA 1N36L 2LKVA 4HIMA 2OQKA 3OWEB 4RAUC 4ZLTF 2MGSA 1LT6D 5G3LD 1O78A 1CSQA 4PV1C 2JA8G 5FO9B 1NMFA 2KCCA 1Z6HA 2N3SA 3SK4A 5LMNL 4A3KG 3SEBA 2HQLA 1V8QA 4GN3B 2K50A 1A6XA 2EY1A 4OO1I 2VQEL 1VQBA 1AH9A 4A4IA 2CH4W 1B3AA 4JI0Q 5HGQA 3D4DA 2FINB 4KJNA 4DUZL 1I4XA 1LT3D 4IALA 4LF5L 1J5EQ 4A3CH 1KRTA 3MTSA 1G291 4DUYQ 4HMJA 3T53B 3K5NA 4JI3Q 2GVBA 1KQSA 4LW1A 3AEVA 3ND8A 4R4CA 4DFAA 4DV3Q 4TRDA 1STBA 5JVG3 1EIHA 3NBIA 3I4MG 3ULJA 4LK1C 2DNEA 1F9SA 2QILA 1DOKA 3N52A 2Q2UA 2N8NA 4JI1Q 5M3FH 3I70A 1CKNA 3VYSA 1QB5D 2K5DA 2KECA 1KLGD 1HZCA 1SNMA 2ID0A 3HEJA 3PUZA 1Y1WB 3HKSA 3S1QH 1KIXA 5C6AA 1RTOA 3F2BA 1GD7A 3NXWA 1OXVA 4OELB 2DY8A 1EY7A 3CF5A 2CKZB 2IT1A 1YJNA 4DR7L 1IL8A 1ICFB 3GTLH 3GTPB 3PCOB 3KJOA 3QOLA 2IHEA 1AP0A 1LO5D 3K80C 3RLOA 3HZXA 2NZOA 2PPBC 4DV1Q 4OO1G 3L0OA 5IP9H 1F2LA 1TWFB 3CXCA 1K73C 1IHZA 4YIJA 1BCPD 2KEDA 2R7FA 4HMIA 3X3MA 1QOHA 4DAVA 1TVXA 3RD4A 5CC4A 5LHY1 4YCUA 2LMCB 1KNEA 4NKLA 5CV6A 1Q86C 3J80i 1SMYD 2EVBA 1WTWA 1QNKA 2C9OA 2PCFB 3CRKC 2Y0SE 1IBKL 4DR1Q 1XMOQ 4FF2A 3BU2A 1PA6A 2VUMB 1Q82C 2K4KA 2K7VA 5IODA 1E2ZA 4DPGA 1O7ZA 3CHBD 1XPOA 1Q90A 3VYTA 5IP7G 1EFID 3DWQA 3WDNA 1PH9A 1C48A 4AIMA 1XPRA 1RHPA 5IYBG 3S15B 3S9WA 3FRPB 2JYOA 5C3EB 1PYSB 2RSNA 4I7ZC 4PG3A 3CKIB 4NXNL 4A3JH 3GTOH 3ND9A 2AHOB 1KD1C 2L1BA 2RQXA 3SHLA 5K36G 3DXJC 4B3MQ 3CCEA 1IXRA 3RZDB 5LMUQ 2BA1A 1ZYRC 3CCRA 1U5KA 2WB1G 4ZK9B 1BUVT 2F03A 1B4OA 1J9OA 3HOWB 2JA6H 4G7OC 4CGYB 1RODA 4X62Q 3IRBA 3MA2B 5FLXc 5JEAJ 1D5XC 2EE1A 3ZJYC 3NEMA 1LM0A 4JYAQ 3J81E 1HUMA 1QG7A 2XVSA 2JQOA 4C3IG 4HSVA 1GOZA 5CBAE 1Y1VB 4GN4B 1L1OC 4L6TB 2B2YA 1L0WA 3CC4A 1QJOA 2QEXA 4M1UB 4RGOS 4JOIA 4C3JB 5CV9A 4X64Q 1U9RA 4LF6Q 2K5QA 3F2UA 1TS5A 4A3DB 2YTVA 4A3EH 4QL5A 5KNCA 1YNJD 2E76C 3AU7A 1H9MA 4F8MA 2K6AA 1WCMB 3OMCA 4K8IA 5EKIA 3HOZB 1HNWQ 2G5DA 3GTMB 3T13A 2H1EA 1SSOA 4LF4Q 5D65A 2IHFA 1PVOA 1X6OA 2ZT9C 2EYOA 4AYBE 2XSCA 4QJFA 3K0XA 5C4ZA 4PQXA 2KENA 1DZ1A 1GUGA 3CAMA 4BY7G 1LTSD 5JOBA 4KK7A 1JICA 1UE5A 2KUMA 2XWJB 4AQYQ 3KLWA 2K32A 5JJZA 1H9KA 4UDUC 3K58A 1F9RA 2AQ3B 5HURA 4JI7Q 3HOXB 1MHWC 4BY1B 1AFPA 4C56C 3BZDB 2K1BA 3NTIA 4NXML 2K5NA 1Y1WG 2J7ZA 3FMCA 3NUCA 5FO7B 4JCVE 3HOVH 2Q2HA 2PQEA 5C0XH 3ER0A 1STEA 3TBIB 4OX9Q 3JAME 2WV6D 3EQLC 3WOEA 4DA2A 2I46A 1N9WA 2MNAA 4O0AA 2NVTB 5KEEA 3RZOB 2F0WA 4KJOA 1B53A 2B63G 2D0PA 1UUPA 5CV5A 4DR2Q 1NNXA 2A6HD 2LXJA 2B2WA 1HCZA 2E2IH 3GTGH 2EYPA 1UNSA 2D62A 2Q8IB 1HZAA 2E5LL 1QWYA 1SNQA 1FJGQ 1I3QH 2KCNA 1LTGD 1MD2D 2KHSA 2K5WA 3BVZA 1EU3A 1ENFA 2QGQA 3DM1A 2AQ1B 1NUCA 1JORA 4F88A 2PI2A 2F0KA 4X3KA 1TWHB 1SJED 3H0GG 3S1MH 4JC0A 2OF1A 4A76A 2IX3A 3ITPA 2UUAQ 3TREA 1BKBA 2SOBA 1EFWA 4XYQA 4B3RL 1U4PA 2F3WA 2F1MA 3KYHC 3H6MA 1PRTB 2MQHA 4N9TA 1DOLA 3QG1A 2B3GA 2NWGA 2UUCL 4PZ6A 2EZVA 2H4OA 1HZBA 4K5VA 1Z47A 5DLQE 3KF6A 4IUQA 2JA5H 3SE0A 3GV3A 4C2MH 5I4DA 5AJ3L 2ASBA 3PO2B 1A62A 1ENCA 2YTYA 1XTDA 1KDCA 4KI0A 1MIUA 5F2DA 1TS3A 1IBLL 1DYQA 2D0OA 1RDPD 5L37A 3J81c 1HHVA 1LTTD 5ELNA 5A2QL 4KKUA 4DR5L 2WAQE 1GJXA 1PYWD 1B1ZA 4DN4M 2A1AA 3MVVA 3HOWG 1TWAB 3M4QA 3D31A 1XPUA 3F2DA 1X32A 5DEHA 1CT1D 1E1OA 3CC7A 1PH8A 4XT3B 1JCKB 2JEBI 3W5OA 3RLFA 3S14H 2WP8J 1PTOH 3GTJH 2HIXA 1U4LA 1Y1VG 1HJPA 1I4PA 1FYCA 1PXUA 4GOPA 2PMZB 1IBML 4WJ3M 4BBRH 1SBBB 1A2UA 1STGA 3BYTB 1HUNA 5M5WB 3HKZE 1PFSA 4A93G 4ZUIA 4JBJA 3GDEA 4HCEA 4Y52H 4DNRB 2R93B 4RMFA 3P75A 1HFNA 1NR2A 2VW9A 4DR3Q 1ONLA 3OTOL 2N49A 4Z9CB 4X3SA 5KYIA 1GO3E 4DV2Q 5M5YB 3A0JA 2JA8H 4DF7A 4FXKC 3J7YW 2F0HA 1VS0A 4V190 4PMCA 1I5FA 1EYCA 3G6EA 1LTBD 5D3IB 1B3QA 2Q8TA 4JBKA 1XMQL 4LF9Q 4A3KB 1HNZQ 3EIVA 1AZQA 2B39A 1L0XB 2PO4A 3NELA 3TMEA 2B2TC 2ICEC 3NPPA 4DR6Q 1K28A 1VQ4A 3MXPA 4ZQ3A 3QB3A 2QA4A 1E7ZA 5CGKA 2E75C 5CYUA 3JAMc 3CCQA 4JI8Q 1HTPA 1A3VA 3SXHA 4JVZA 2ZXPA 4DV4Q 4BY1G 5I9OA 1J8IA 3JC66 2E2HH 4HJ9A 2IPKD 4YCWA 4MIUA 5EGTA 1PRTF 5EKKA 4IOCA 2JA7B 1Y14B 2HQEA 3T4AC 4KV6A 4A3MG 2K5VA 1DXMA 1CFMA 4OL7A 2RHSB 3J81i 1CZWA 4JI0L 1BR9A 2A6EC 1K0RA 4IJLA 4DV0Q 1PV4A 1EEID 1F77A 1OXUA 2O5IC 3PO3H 2WACA 1MSGA 3OMGA 1J5EL 4BBSG 1WTVA 1VQ6A 4EQ5A 3I4MB 4J1MA 2ALYB 2A69D 2BE5D 4OIKA 4DUYL 2ENBA 2NUCA 2ZM6L 2Z6KA 5JPMC 4JI2L 2NVQB 4JBWA 1A0IA 1XXGA 2NVXB 3U9SA 2XRQD 2EJFC 2NZHA 1H9JA 2F0FA 4K5WA 3KDFB 4ZYSA 3FEWX 4X3UA 2K28A 3KLSX 2JK8A 2XWBB 5M5XH 1YNNC 2EYMA 1GUWA 4R1JA 4X66L 5M5XB 2XIWA 1YHQA 3FDTA 4JI1L 1SNOA 4ILWA 3NBHA 3P20A 1IW7C 3AQQA 3IL8A 1C0AA 2WKCA 1PTOF 4OO1H 1KAAA 3HOUH 4FF3A 1OO9B 1DJRD 2HCCA 3I73A 3H91A 3K7AH 1YJ9A
chains in the Genus database with same CATH topology
1JB7A 1CSPA 1YBYA 3G48A 1HR0L 1VQHA 1T9HA 3CW2C 1UE6A 3J7ZC 4OXPA 3T1HQ 4X65L 3KF6B 2NVYH 2N8NA 3I55A 3CPWA 3HKZG 4JI1Q 4IPHA 4A3BH 2UXBL 1K83H 4P71A 1FVIA 2WFWA 5M3FH 4LFBL 5FLMH 2VNUD 1CKNA 4A3JG 2R7ZH 1VQEA 1EYGA 4H02A 1HZCA 1VQFA 1Q1EA 3PUWA 2ID0A 2CQOA 2C35B 3PUZA 3PGZA 3RNUA 1G51A 2K75A 1TWCH 3HKSA 1I94Q 4LNQA 3S1QH 1KIXA 1BBWA 3U50C 1N32L 3F2BA 1GD7A 1OXVA 2L15A 3CF5A 2CKZB 4A3CG 3OW2A 2DGYA 5M5WH 2IT1A 4YWMA 3JAMi 3J7A5 2JA6G 1HR0Q 1P8LA 1YJNA 4DR7L 1MJEA 2R93H 4WJ4A 4X65Q 2Z0SA 1Q12A 3GTLH 1VQMA 3DM3A 4IFDI 4GS3A 3K81C 3PCOB 3KJOA 2UXBQ 5IYDH 4LFBQ 2IHEA 4ALPA 2KHIA 3M9BA 4A3MH 5IP7H 3K80C 2DUDA 4Y7NH 4BA1I 4QGUA 1SE8A 2ZTCA 5M5YH 3RLOA 4DR6L 4LFAL 4MTNA 2NZOA 5JEAG 3VDYA 3KFUA 1BVSA 2XTIA 4BBSH 1HH2P 5IYCG 4DV1Q 4OO1G 3L0OA 1U0LA 1WFQA 2CWPA 5IP9H 3CXCA 4DV7L 1K73C 1Q8KA 2AMCB 4GOPB 2Q2TA 4DR1L 4JI8L 1GM5A 4HIOA 3UDIA 3CMAA 4A3KH 2R7FA 3FKIH 5IY0A 4LF7Q 3M4OH 4IFDJ 3BJUA 2B29A 4YWLA 1M1KC 4JI4L 3PF5A 3M4PA 4YCUA 3CCUA 5M3FG 5GROA 5FLMG 2JA9A 4OWWB 1Q86C 1JT8A 3J80i 4A3EG 3TRZA 5IE8A 3E9IA 3HOYG 4DV0L 1GKHA 4JOIC 2VL6A 4KHPQ 1OXTA 3S16H 2Y0SE 1IBKL 4HIKA 4DR1Q 4YCVA 2ZJRA 1XMOQ 4P72A 3BU2A 3F8TA 1PA6A 4OWXB 2JA7H 3D0FA 1X65A 1YHBA 4XIGS 3CCVA 1Q82C 2K4KA 4JI4Q 4DPGA 1NMGA 4YWKA 1YHAA 3AFQA 2OWOA 4IOAA 4NXMQ 1KAWA 1XPOA 3EN2A 5IP7G 3MXNB 3MEFA 1PH1A 1PH9A 3RR5A 4AIMA 1VQ5A 1O7IA 4HIDA 3T1YL 5ELOA 1XPRA 5LMUL 3H15A 5IYBG 2RCNA 3I4MH 2F3IA 1VQJA 3GD7A 2UXDQ 1RL2A 5C4XG 1VQAA 4JI3L 2NVQH 1PYSB 4X62L 1VQDA 2NVXH 4PG3A 5GADC 1NJIC 1VQKA 4XTCS 4NXNL 3STBD 4YY3Q 1NTGA 4R4IA 4A3IH 2AHOB 4A3JH 1PH3A 1KD1C 1HNXQ 3J80c 4POGA 4JYAL 5K36G 2AWNA 5JJIA 4DV3L 2PMZE 4B3MQ 3CCEA 1IXRA 3T1YQ 4LF8L 2R7DA 4ME3A 5LMUQ 3UDGA 2BA1A 4IFDG 3CCRA 1R9TH 1U5KA 2UU9Q 1QUQA 2WB1G 1MJCA 2YU9H 1NBWA 2K14A 3HOVG 3GO5A 2ZJQA 4GKJQ 1W3SA 2JA6H 2VUMG 1X56A 4HJ7A 1AE2A 4IPDA 1A63A 1IL2A 5GQOA 4X62Q 2IY5B 3BZKA 3IRBA 2MO1A 5FLXc 2GN5A 5JEAJ 2JA7G 3T1HL 3E9HA 3I2ZA 2VY3A 3ZJYC 4X64L 1TWGH 3NEMA 5FJ8G 2E5LQ 1LM0A 3AFPA 4B3SQ 3DLLA 4JYAQ 4OWTB 1YJWA 2JQOA 4LF8Q 4HJAA 2HIVA 3TS0A 4JI6Q 4GN4B 1L1OC 1L0WA 2YV5A 3CC4A 1YVCA 4IPCA 4QIWE 5C3EG 3I7FA 1L2FA 3S1NH 4DR4L 1QVCA 2QEXA 3HFZB 3S2HH 4B3RQ 3M7NA 4JOIA 1GVPA 2UXCQ 3FP9A 4UPAA 4X64Q 1S3OA 4LF4L 3UE1A 4LF6Q 4L5QA 2KHJA 3U58A 4A3IG 4GNXC 1UEBA 1UE7A 1X55A 3F1ZA 1Y1WH 3CCLA 2YTVA 3NBHB 2UUCQ 4A3EH 4QL5A 3HOYH 3PIOA 4P75A 4DV1L 3I4OA 1XJVA 2A19A 4K0KL 2MFIA 1KHIA 4LFCQ 4DR4Q 1HNWQ 1EQRA 3PSIA 1SRUA 3GTPH 1B8AA 1YNXA 2F4VQ 1N33L 4LF7L 2UUBL 5M3MH 1IBLQ 3BZCA 3PIPA 4LF4Q 2Q2UA 2MO0A 1C9OA 2I5MX 1V43A 2IHFA 1PVOA 1X6OA 2LSSA 5HY6A 3Q8DA 4AYBE 1VQOA 5IWAQ 5C0XI 1EIYB 4QJFA 3K0XA 4DR5Q 1CKNB 4NB3A 2KENA 4RG1A 3A5UA 1TWFH 3CAMA 5IYBH 2AWOA 3CCJA 4BY7G 3G4SA 3M3YH 1UE5A 4L5RC 4KHPL 4K0KQ 1YI2A 4DNIA 4AQYQ 1X3GA 1NE3A 1EIFA 2JA5G 1LTLA 1AE3A 3KLWA 5C4XH 1XMOL 4A3LH 4IPGA 3GTQH 2F52A 4IJHA 4EX5A 1N33Q 1VCIA 4DV6Q 3WWVA 3KJPA 2UUBQ 4JI7Q 3L2PA 1DGSA 1K3RA 1YITA 1I6HH 1YEZA 1M90C 4A3DG 4YHHQ 3U4VA 5C0XJ 4NXML 5E7NA 2K5NA 1Y1WG 1CKMA 1CUKA 1SROA 1Q46A 3S1RH 4R4OA 4JCVE 1X3FA 2BA0A 3H0GH 5LMNW 2HHHL 1WCMG 3HOVH 3HOZG 2Q2HA 3ER0A 2UXDL 2VUMH 4OX9Q 4JG2A 4DR2L 4DKAC 2IX1A 1IYJB 1L1OA 1IZ6A 1WYDA 3RLNA 3KOJA 1QZHA 1K9MC 3S17H 5FJ8H 5M3MG 1N9WA 2MNAA 1XNRQ 1RIPA 2NN6I 4O0AA 4UP8A 4YY3L 1VQPA 3KF8B 2A8VA 1HNXL 3J81j 1UE1A 2V1CC 5GAEC 1X54A 1S40A 4C3IH 4B3ML 3S15H 1PH5A 2HHHQ 2B63G 1K8GA 1H95A 2UU9L 3CC2A 4HJ5A 2D0PA 4GNXA 1EWIA 4PMWA 5C44G 3E0EA 5C3EH 3TEHB 1VQ7A 4UP7A 2Q2IA 4GKKL 1EUJA 2H5XA 4BBRG 4DR2Q 1YIJA 4A3LG 3U4ZA 4GKJL 1G6PA 1S72A 1D8LA 2LXJA 5GAGC 5GAHC 4O2DA 3HOXG 1PH7A 3CPFA 2E2IH 3GTGH 2PQAA 2D62A 2RF4A 4LUVA 1HZAA 4B3SL 2E5LL 3KDFA 4GOPC 1FJGQ 3RZDH 4DK6C 1I3QH 3S24A 1LUZA 2IX0A 4QY7A 3G71A 5JJLA 2I5HA 2QGQA 1C7YA 1HR0W 1VQLA 5EAYA 2PI2A 3S2DH 4A3GG 3HOWH 4JI6L 3H0GG 3S1MH 4JC0A 2GVAA 4A76A 5C0XG 2UUAQ 3TREA 5JJKA 3I4NG 1BKBA 4BXXG 1E22A 4GNXB 3FHWA 4APVA 1SFOH 1EFWA 4TQUS 1VQ9A 4B3RL 2PNHA 1VQNA 3KYHC 2UXCL 3PF4A 2ATWA 4DAMA 3ERSX 2VQFQ 2MQHA 1Q81C 1N36Q 1ASYA 4LF6L 1D7QA 2B3GA 5J3BA 3W1GA 4OONA 4R4TA 4BA2I 1QVFA 2R92H 2OTLA 1Y1VH 2EQSA 2UUCL 4BY7H 4PZ6A 3RN2A 4J15A 1HZBA 1B7YB 1Z47A 3W1BA 3A74A 3KF6A 5DLQE 4UP9A 2JA5H 1TXYA 4C2MH 4C3JH 5AJ3L 1QUQB 4LFCL 4HJ8A 1JMCA 1A62A 1KL9A 2ASBA 1HNWL 1BBUA 4PZ8A 2ZM6Q 2YTYA 1XTDA 3H3VI 1FGUA 4JI2Q 2BH2A 2F4VL 4LWCA 4KI0A 1MIUA 1IBLL 2D0OA 4A3DH 1YZ6A 3CP0A 2XGTA 3J81c 5BR8Q 5ELNA 3RN5A 1QVGA 5IWAL 4DR5L 2VZAA 2WAQE 4AYBG 5IT9c 2KCMA 4DUZQ 3ULPA 2WB1E 2K5HA 1WCMH 1P16A 4LF5Q 1VQ8A 3HOZH 2A1AA 2K52A 3HOWG 3PO3G 1UWVA 2NN6G 1WJJA 4JBMA 3GTKH 3M4QA 3D31A 2CWAA 5AJ3Q 3NENA 4DV5L 2I0QA 4AQYL 1XPUA 3F2DA 1X9NA 1B70B 3UDFA 4X66Q 2ZTEA 1E1OA 3CC7A 4DV6L 1PH2A 1PH8A 1JJ2A 2ES2A 2JEBI 3W5OA 4JI7L 3RLFA 3S14H 1JJGA 2JE6I 1V9PA 2WP8J 4YHHL 3F2CA 3A5ZB 3L7ZC 4DR3L 3GTJH 3CMEA 3H3VH 2E8GA 4LUOA 2HIXA 4GLXA 2R92G 1NY4A 1Y1VG 1Z9FA 1KC8C 1HJPA 1J6QA 2B63H 2JEAI 4DV2L 4GOPA 2OQ0A 1WOCA 2Z6KC 3CQZH 4NPSA 5C44H 3PO2G 1IBML 3LGJA 4DAYB 4DV5Q 4WJ3M 4BBRH 1PH6A 3CD6A 4OX9L 1N34L 1MKHA 3TQYA 2Y0SG 3HOXH 4BY1H 2EXDA 1SN8A 4TVAB 4DK3C 3HKZE 1PFSA 4AH6A 3I56A 4A93G 4JBJA 3GDEA 4Y52H 4LF9L 1SMXA 3AYHB 3K8AA 4P73A 4RMFA 4JI5L 1XNRL 1V1QA 1HNZL 2ZTDA 3EBEA 2VW9A 4DR3Q 1SLJA 3OTOL 2HT1A 2N49A 4L5TA 4GKKQ 4A3FH 1N32Q 2BH8A 3UE0A 1ASZA 4A3GH 2PI2E 5H1SE 1GO3E 4DV2Q 4L5SA 3A0JA 2JA8H 3GTMH 1EQQA 1IBMQ 3HOUG 4KLKA 3I4NH 1OTCA 1N34Q 4QQBX 2LXKA 3UDXA 1VQCA 1VS0A 3PUVA 4GN5A 1I5FA 3G6EA 1N8RC 4DR7Q 1JE5A 1W2BA 2E2JH 2YYZA 4DV4L 1OXSC 1XMQL 1WI5A 4JBKA 4LF9Q 4JI5Q 2NVTH 1JJCB 4A3BG 1HZ9A 2N78A 3EIVA 1HNZQ 4LUZA 1SR3A 3OTOQ 3RZOH 1VQIA 1FJGL 3NELA 4IO9A 2R7ZG 2RHQB 4DR6Q 4LFAQ 2OTJA 3CCMA 1E3PA 4P74A 4PZ7A 1VQ4A 3PUXA 1PYBA 4DV7Q 2QA4A 1I50H 1X3EA 1E7ZA 4GLVB 3JAMc 4B3TL 4C3HH 4MZ9A 2OCEA 4KHZA 3CCQA 2UUAL 4JI8Q 4POFA 5C4JH 4X6AH 3PUYA 3STBC 2R6GA 4BY1G 4DV4Q 2I5LX 2R93G 1XMQQ 3JC66 3CCSA 2E2HH 4HJ9A 4YCWA 2ZJPA 4IOCA 5IYDG 1L1OB 2VQFL 3ICEA 1N36L 1Y14B 2JJQA 4HIMA 4A3MG 2K5VA 2OQKA 4R4QA 2RHSB 3J81i 1CKOA 4JI0L 1TWHH 4MNOA 4A3FG 1K0RA 1VQGA 4IJLA 4DV0Q 1A8VA 3PV0A 1PV4A 1OXUA 4B3TQ 3PO3H 4BBSG 1J5EL 1CSQA 2JA8G 1VQ6A 3ULLA 4EQ5A 5IP9G 4A75A 1IBKQ 1NMFA 4DUYL 2ALYB 2N3SA 2ZM6L 1E24A 5LMNL 2Z6KA 2KBNA 4FDBA 1KRSA 4A3KG 3FKIG 4JI2L 1EOVA 2HQLA 4GN3B 2K50A 4JBWA 4OO1I 1A0IA 1K8AC 4UY8C 2VQEL 1VQBA 4JV5L 1AH9A 3K7UC 4A4IA 2EIFA 2PQAB 5BR8L 2NZHA 4JI0Q 5HGQA 3KDFB 1LYLA 4DUZL 1PH4A 4GLAC 2WAQG 1PHJA 1OXXK 4BXXH 4LF5L 1J5EQ 2KCTA 3PO2H 2CCZA 4A3CH 1KRTA 2JK8A 1G291 1XNQL 5M5XH 4DUYQ 4JI3Q 4R1JA 2GVBA 4X66L 1FL0A 5LMNQ 1YHQA 1Q7YC 4A93H 2VS1A 1KQSA 1KXLA 2YTXA 4LW1A 2AKWB 3AEVA 4NXNQ 4JI1L 2VQEQ 4JV5Q 3TS2A 4R4CA 3M85A 1E1TA 4DV3Q 3AQQA 3SGIA 1QZGA 1TWAH 3GTOH 1C0AA 5IYCH 1I94L 2FXQA 3HOUH 3I4MG 3ULJA 1XNQQ 1Q1BA 3B6YA 2CFMA 3K7AH 3OYYA 1YJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB7 A;  1CSP A;  1YBY A;  3G48 A;  1HR0 L;  1VQH A;  1T9H A;  3CW2 C;  1UE6 A;  3J7Z C;  4OXP A;  3T1H Q;  4X65 L;  3KF6 B;  2NVY H;  2N8N A;  3I55 A;  3CPW A;  3HKZ G;  4JI1 Q;  4IPH A;  4A3B H;  2UXB L;  1K83 H;  4P71 A;  1FVI A;  2WFW A;  5M3F H;  4LFB L;  5FLM H;  2VNU D;  1CKN A;  4A3J G;  2R7Z H;  1VQE A;  1EYG A;  4H02 A;  1HZC A;  1VQF A;  1Q1E A;  3PUW A;  2ID0 A;  2CQO A;  2C35 B;  3PUZ A;  3PGZ A;  3RNU A;  1G51 A;  2K75 A;  1TWC H;  3HKS A;  1I94 Q;  4LNQ A;  3S1Q H;  1KIX A;  1BBW A;  3U50 C;  1N32 L;  3F2B A;  1GD7 A;  1OXV A;  2L15 A;  3CF5 A;  2CKZ B;  4A3C G;  3OW2 A;  2DGY A;  5M5W H;  2IT1 A;  4YWM A;  3JAM i;  3J7A 5;  2JA6 G;  1HR0 Q;  1P8L A;  1YJN A;  4DR7 L;  1MJE A;  2R93 H;  4WJ4 A;  4X65 Q;  2Z0S A;  1Q12 A;  3GTL H;  1VQM A;  3DM3 A;  4IFD I;  4GS3 A;  3K81 C;  3PCO B;  3KJO A;  2UXB Q;  5IYD H;  4LFB Q;  2IHE A;  4ALP A;  2KHI A;  3M9B A;  4A3M H;  5IP7 H;  3K80 C;  2DUD A;  4Y7N H;  4BA1 I;  4QGU A;  1SE8 A;  2ZTC A;  5M5Y H;  3RLO A;  4DR6 L;  4LFA L;  4MTN A;  2NZO A;  5JEA G;  3VDY A;  3KFU A;  1BVS A;  2XTI A;  4BBS H;  1HH2 P;  5IYC G;  4DV1 Q;  4OO1 G;  3L0O A;  1U0L A;  1WFQ A;  2CWP A;  5IP9 H;  3CXC A;  4DV7 L;  1K73 C;  1Q8K A;  2AMC B;  4GOP B;  2Q2T A;  4DR1 L;  4JI8 L;  1GM5 A;  4HIO A;  3UDI A;  3CMA A;  4A3K H;  2R7F A;  3FKI H;  5IY0 A;  4LF7 Q;  3M4O H;  4IFD J;  3BJU A;  2B29 A;  4YWL A;  1M1K C;  4JI4 L;  3PF5 A;  3M4P A;  4YCU A;  3CCU A;  5M3F G;  5GRO A;  5FLM G;  2JA9 A;  4OWW B;  1Q86 C;  1JT8 A;  3J80 i;  4A3E G;  3TRZ A;  5IE8 A;  3E9I A;  3HOY G;  4DV0 L;  1GKH A;  4JOI C;  2VL6 A;  4KHP Q;  1OXT A;  3S16 H;  2Y0S E;  1IBK L;  4HIK A;  4DR1 Q;  4YCV A;  2ZJR A;  1XMO Q;  4P72 A;  3BU2 A;  3F8T A;  1PA6 A;  4OWX B;  2JA7 H;  3D0F A;  1X65 A;  1YHB A;  4XIG S;  3CCV A;  1Q82 C;  2K4K A;  4JI4 Q;  4DPG A;  1NMG A;  4YWK A;  1YHA A;  3AFQ A;  2OWO A;  4IOA A;  4NXM Q;  1KAW A;  1XPO A;  3EN2 A;  5IP7 G;  3MXN B;  3MEF A;  1PH1 A;  1PH9 A;  3RR5 A;  4AIM A;  1VQ5 A;  1O7I A;  4HID A;  3T1Y L;  5ELO A;  1XPR A;  5LMU L;  3H15 A;  5IYB G;  2RCN A;  3I4M H;  2F3I A;  1VQJ A;  3GD7 A;  2UXD Q;  1RL2 A;  5C4X G;  1VQA A;  4JI3 L;  2NVQ H;  1PYS B;  4X62 L;  1VQD A;  2NVX H;  4PG3 A;  5GAD C;  1NJI C;  1VQK A;  4XTC S;  4NXN L;  3STB D;  4YY3 Q;  1NTG A;  4R4I A;  4A3I H;  2AHO B;  4A3J H;  1PH3 A;  1KD1 C;  1HNX Q;  3J80 c;  4POG A;  4JYA L;  5K36 G;  2AWN A;  5JJI A;  4DV3 L;  2PMZ E;  4B3M Q;  3CCE A;  1IXR A;  3T1Y Q;  4LF8 L;  2R7D A;  4ME3 A;  5LMU Q;  3UDG A;  2BA1 A;  4IFD G;  3CCR A;  1R9T H;  1U5K A;  2UU9 Q;  1QUQ A;  2WB1 G;  1MJC A;  2YU9 H;  1NBW A;  2K14 A;  3HOV G;  3GO5 A;  2ZJQ A;  4GKJ Q;  1W3S A;  2JA6 H;  2VUM G;  1X56 A;  4HJ7 A;  1AE2 A;  4IPD A;  1A63 A;  1IL2 A;  5GQO A;  4X62 Q;  2IY5 B;  3BZK A;  3IRB A;  2MO1 A;  5FLX c;  2GN5 A;  5JEA J;  2JA7 G;  3T1H L;  3E9H A;  3I2Z A;  2VY3 A;  3ZJY C;  4X64 L;  1TWG H;  3NEM A;  5FJ8 G;  2E5L Q;  1LM0 A;  3AFP A;  4B3S Q;  3DLL A;  4JYA Q;  4OWT B;  1YJW A;  2JQO A;  4LF8 Q;  4HJA A;  2HIV A;  3TS0 A;  4JI6 Q;  4GN4 B;  1L1O C;  1L0W A;  2YV5 A;  3CC4 A;  1YVC A;  4IPC A;  4QIW E;  5C3E G;  3I7F A;  1L2F A;  3S1N H;  4DR4 L;  1QVC A;  2QEX A;  3HFZ B;  3S2H H;  4B3R Q;  3M7N A;  4JOI A;  1GVP A;  2UXC Q;  3FP9 A;  4UPA A;  4X64 Q;  1S3O A;  4LF4 L;  3UE1 A;  4LF6 Q;  4L5Q A;  2KHJ A;  3U58 A;  4A3I G;  4GNX C;  1UEB A;  1UE7 A;  1X55 A;  3F1Z A;  1Y1W H;  3CCL A;  2YTV A;  3NBH B;  2UUC Q;  4A3E H;  4QL5 A;  3HOY H;  3PIO A;  4P75 A;  4DV1 L;  3I4O A;  1XJV A;  2A19 A;  4K0K L;  2MFI A;  1KHI A;  4LFC Q;  4DR4 Q;  1HNW Q;  1EQR A;  3PSI A;  1SRU A;  3GTP H;  1B8A A;  1YNX A;  2F4V Q;  1N33 L;  4LF7 L;  2UUB L;  5M3M H;  1IBL Q;  3BZC A;  3PIP A;  4LF4 Q;  2Q2U A;  2MO0 A;  1C9O A;  2I5M X;  1V43 A;  2IHF A;  1PVO A;  1X6O A;  2LSS A;  5HY6 A;  3Q8D A;  4AYB E;  1VQO A;  5IWA Q;  5C0X I;  1EIY B;  4QJF A;  3K0X A;  4DR5 Q;  1CKN B;  4NB3 A;  2KEN A;  4RG1 A;  3A5U A;  1TWF H;  3CAM A;  5IYB H;  2AWO A;  3CCJ A;  4BY7 G;  3G4S A;  3M3Y H;  1UE5 A;  4L5R C;  4KHP L;  4K0K Q;  1YI2 A;  4DNI A;  4AQY Q;  1X3G A;  1NE3 A;  1EIF A;  2JA5 G;  1LTL A;  1AE3 A;  3KLW A;  5C4X H;  1XMO L;  4A3L H;  4IPG A;  3GTQ H;  2F52 A;  4IJH A;  4EX5 A;  1N33 Q;  1VCI A;  4DV6 Q;  3WWV A;  3KJP A;  2UUB Q;  4JI7 Q;  3L2P A;  1DGS A;  1K3R A;  1YIT A;  1I6H H;  1YEZ A;  1M90 C;  4A3D G;  4YHH Q;  3U4V A;  5C0X J;  4NXM L;  5E7N A;  2K5N A;  1Y1W G;  1CKM A;  1CUK A;  1SRO A;  1Q46 A;  3S1R H;  4R4O A;  4JCV E;  1X3F A;  2BA0 A;  3H0G H;  5LMN W;  2HHH L;  1WCM G;  3HOV H;  3HOZ G;  2Q2H A;  3ER0 A;  2UXD L;  2VUM H;  4OX9 Q;  4JG2 A;  4DR2 L;  4DKA C;  2IX1 A;  1IYJ B;  1L1O A;  1IZ6 A;  1WYD A;  3RLN A;  3KOJ A;  1QZH A;  1K9M C;  3S17 H;  5FJ8 H;  5M3M G;  1N9W A;  2MNA A;  1XNR Q;  1RIP A;  2NN6 I;  4O0A A;  4UP8 A;  4YY3 L;  1VQP A;  3KF8 B;  2A8V A;  1HNX L;  3J81 j;  1UE1 A;  2V1C C;  5GAE C;  1X54 A;  1S40 A;  4C3I H;  4B3M L;  3S15 H;  1PH5 A;  2HHH Q;  2B63 G;  1K8G A;  1H95 A;  2UU9 L;  3CC2 A;  4HJ5 A;  2D0P A;  4GNX A;  1EWI A;  4PMW A;  5C44 G;  3E0E A;  5C3E H;  3TEH B;  1VQ7 A;  4UP7 A;  2Q2I A;  4GKK L;  1EUJ A;  2H5X A;  4BBR G;  4DR2 Q;  1YIJ A;  4A3L G;  3U4Z A;  4GKJ L;  1G6P A;  1S72 A;  1D8L A;  2LXJ A;  5GAG C;  5GAH C;  4O2D A;  3HOX G;  1PH7 A;  3CPF A;  2E2I H;  3GTG H;  2PQA A;  2D62 A;  2RF4 A;  4LUV A;  1HZA A;  4B3S L;  2E5L L;  3KDF A;  4GOP C;  1FJG Q;  3RZD H;  4DK6 C;  1I3Q H;  3S24 A;  1LUZ A;  2IX0 A;  4QY7 A;  3G71 A;  5JJL A;  2I5H A;  2QGQ A;  1C7Y A;  1HR0 W;  1VQL A;  5EAY A;  2PI2 A;  3S2D H;  4A3G G;  3HOW H;  4JI6 L;  3H0G G;  3S1M H;  4JC0 A;  2GVA A;  4A76 A;  5C0X G;  2UUA Q;  3TRE A;  5JJK A;  3I4N G;  1BKB A;  4BXX G;  1E22 A;  4GNX B;  3FHW A;  4APV A;  1SFO H;  1EFW A;  4TQU S;  1VQ9 A;  4B3R L;  2PNH A;  1VQN A;  3KYH C;  2UXC L;  3PF4 A;  2ATW A;  4DAM A;  3ERS X;  2VQF Q;  2MQH A;  1Q81 C;  1N36 Q;  1ASY A;  4LF6 L;  1D7Q A;  2B3G A;  5J3B A;  3W1G A;  4OON A;  4R4T A;  4BA2 I;  1QVF A;  2R92 H;  2OTL A;  1Y1V H;  2EQS A;  2UUC L;  4BY7 H;  4PZ6 A;  3RN2 A;  4J15 A;  1HZB A;  1B7Y B;  1Z47 A;  3W1B A;  3A74 A;  3KF6 A;  5DLQ E;  4UP9 A;  2JA5 H;  1TXY A;  4C2M H;  4C3J H;  5AJ3 L;  1QUQ B;  4LFC L;  4HJ8 A;  1JMC A;  1A62 A;  1KL9 A;  2ASB A;  1HNW L;  1BBU A;  4PZ8 A;  2ZM6 Q;  2YTY A;  1XTD A;  3H3V I;  1FGU A;  4JI2 Q;  2BH2 A;  2F4V L;  4LWC A;  4KI0 A;  1MIU A;  1IBL L;  2D0O A;  4A3D H;  1YZ6 A;  3CP0 A;  2XGT A;  3J81 c;  5BR8 Q;  5ELN A;  3RN5 A;  1QVG A;  5IWA L;  4DR5 L;  2VZA A;  2WAQ E;  4AYB G;  5IT9 c;  2KCM A;  4DUZ Q;  3ULP A;  2WB1 E;  2K5H A;  1WCM H;  1P16 A;  4LF5 Q;  1VQ8 A;  3HOZ H;  2A1A A;  2K52 A;  3HOW G;  3PO3 G;  1UWV A;  2NN6 G;  1WJJ A;  4JBM A;  3GTK H;  3M4Q A;  3D31 A;  2CWA A;  5AJ3 Q;  3NEN A;  4DV5 L;  2I0Q A;  4AQY L;  1XPU A;  3F2D A;  1X9N A;  1B70 B;  3UDF A;  4X66 Q;  2ZTE A;  1E1O A;  3CC7 A;  4DV6 L;  1PH2 A;  1PH8 A;  1JJ2 A;  2ES2 A;  2JEB I;  3W5O A;  4JI7 L;  3RLF A;  3S14 H;  1JJG A;  2JE6 I;  1V9P A;  2WP8 J;  4YHH L;  3F2C A;  3A5Z B;  3L7Z C;  4DR3 L;  3GTJ H;  3CME A;  3H3V H;  2E8G A;  4LUO A;  2HIX A;  4GLX A;  2R92 G;  1NY4 A;  1Y1V G;  1Z9F A;  1KC8 C;  1HJP A;  1J6Q A;  2B63 H;  2JEA I;  4DV2 L;  4GOP A;  2OQ0 A;  1WOC A;  2Z6K C;  3CQZ H;  4NPS A;  5C44 H;  3PO2 G;  1IBM L;  3LGJ A;  4DAY B;  4DV5 Q;  4WJ3 M;  4BBR H;  1PH6 A;  3CD6 A;  4OX9 L;  1N34 L;  1MKH A;  3TQY A;  2Y0S G;  3HOX H;  4BY1 H;  2EXD A;  1SN8 A;  4TVA B;  4DK3 C;  3HKZ E;  1PFS A;  4AH6 A;  3I56 A;  4A93 G;  4JBJ A;  3GDE A;  4Y52 H;  4LF9 L;  1SMX A;  3AYH B;  3K8A A;  4P73 A;  4RMF A;  4JI5 L;  1XNR L;  1V1Q A;  1HNZ L;  2ZTD A;  3EBE A;  2VW9 A;  4DR3 Q;  1SLJ A;  3OTO L;  2HT1 A;  2N49 A;  4L5T A;  4GKK Q;  4A3F H;  1N32 Q;  2BH8 A;  3UE0 A;  1ASZ A;  4A3G H;  2PI2 E;  5H1S E;  1GO3 E;  4DV2 Q;  4L5S A;  3A0J A;  2JA8 H;  3GTM H;  1EQQ A;  1IBM Q;  3HOU G;  4KLK A;  3I4N H;  1OTC A;  1N34 Q;  4QQB X;  2LXK A;  3UDX A;  1VQC A;  1VS0 A;  3PUV A;  4GN5 A;  1I5F A;  3G6E A;  1N8R C;  4DR7 Q;  1JE5 A;  1W2B A;  2E2J H;  2YYZ A;  4DV4 L;  1OXS C;  1XMQ L;  1WI5 A;  4JBK A;  4LF9 Q;  4JI5 Q;  2NVT H;  1JJC B;  4A3B G;  1HZ9 A;  2N78 A;  3EIV A;  1HNZ Q;  4LUZ A;  1SR3 A;  3OTO Q;  3RZO H;  1VQI A;  1FJG L;  3NEL A;  4IO9 A;  2R7Z G;  2RHQ B;  4DR6 Q;  4LFA Q;  2OTJ A;  3CCM A;  1E3P A;  4P74 A;  4PZ7 A;  1VQ4 A;  3PUX A;  1PYB A;  4DV7 Q;  2QA4 A;  1I50 H;  1X3E A;  1E7Z A;  4GLV B;  3JAM c;  4B3T L;  4C3H H;  4MZ9 A;  2OCE A;  4KHZ A;  3CCQ A;  2UUA L;  4JI8 Q;  4POF A;  5C4J H;  4X6A H;  3PUY A;  3STB C;  2R6G A;  4BY1 G;  4DV4 Q;  2I5L X;  2R93 G;  1XMQ Q;  3JC6 6;  3CCS A;  2E2H H;  4HJ9 A;  4YCW A;  2ZJP A;  4IOC A;  5IYD G;  1L1O B;  2VQF L;  3ICE A;  1N36 L;  1Y14 B;  2JJQ A;  4HIM A;  4A3M G;  2K5V A;  2OQK A;  4R4Q A;  2RHS B;  3J81 i;  1CKO A;  4JI0 L;  1TWH H;  4MNO A;  4A3F G;  1K0R A;  1VQG A;  4IJL A;  4DV0 Q;  1A8V A;  3PV0 A;  1PV4 A;  1OXU A;  4B3T Q;  3PO3 H;  4BBS G;  1J5E L;  1CSQ A;  2JA8 G;  1VQ6 A;  3ULL A;  4EQ5 A;  5IP9 G;  4A75 A;  1IBK Q;  1NMF A;  4DUY L;  2ALY B;  2N3S A;  2ZM6 L;  1E24 A;  5LMN L;  2Z6K A;  2KBN A;  4FDB A;  1KRS A;  4A3K G;  3FKI G;  4JI2 L;  1EOV A;  2HQL A;  4GN3 B;  2K50 A;  4JBW A;  4OO1 I;  1A0I A;  1K8A C;  4UY8 C;  2VQE L;  1VQB A;  4JV5 L;  1AH9 A;  3K7U C;  4A4I A;  2EIF A;  2PQA B;  5BR8 L;  2NZH A;  4JI0 Q;  5HGQ A;  3KDF B;  1LYL A;  4DUZ L;  1PH4 A;  4GLA C;  2WAQ G;  1PHJ A;  1OXX K;  4BXX H;  4LF5 L;  1J5E Q;  2KCT A;  3PO2 H;  2CCZ A;  4A3C H;  1KRT A;  2JK8 A;  1G29 1;  1XNQ L;  5M5X H;  4DUY Q;  4JI3 Q;  4R1J A;  2GVB A;  4X66 L;  1FL0 A;  5LMN Q;  1YHQ A;  1Q7Y C;  4A93 H;  2VS1 A;  1KQS A;  1KXL A;  2YTX A;  4LW1 A;  2AKW B;  3AEV A;  4NXN Q;  4JI1 L;  2VQE Q;  4JV5 Q;  3TS2 A;  4R4C A;  3M85 A;  1E1T A;  4DV3 Q;  3AQQ A;  3SGI A;  1QZG A;  1TWA H;  3GTO H;  1C0A A;  5IYC H;  1I94 L;  2FXQ A;  3HOU H;  3I4M G;  3ULJ A;  1XNQ Q;  1Q1B A;  3B6Y A;  2CFM A;  3K7A H;  3OYY A;  1YJ9 A; 
#chains in the Genus database with same CATH topology
 3EFX D;  1CSP A;  1YBY A;  3G48 A;  3UI2 A;  1T9H A;  3CW2 C;  3S2H B;  4OXP A;  3I55 A;  4A3B H;  4P71 A;  1TS2 A;  2WFW A;  2R7Z H;  1K3B C;  4H02 A;  1W6J A;  3PUW A;  4GKK L;  2C35 B;  3PGZ A;  3DEO A;  1G51 A;  1PDQ A;  2K75 A;  5C5M A;  3RNU A;  1N32 L;  3GP7 A;  4CDD C;  1PRT C;  2EYF A;  5FO8 B;  5I6W A;  3OW7 A;  1CQF A;  3JAM i;  4CJ2 C;  3J7A 5;  3I4L A;  4NW2 A;  1HR0 Q;  1P8L A;  1NR4 A;  1RJT A;  4X65 Q;  2Z0S A;  4IFD I;  3DM3 A;  5IYD H;  4GS3 A;  3K81 C;  4KKS A;  2UXB Q;  2F0O A;  4ALP A;  2KHI A;  5E4X A;  2OT2 A;  1MBY A;  5M3M B;  5IP7 H;  4RWS C;  1SE8 A;  4KKT A;  4MTN A;  2XTI A;  1QNU A;  5IYC G;  2CWP A;  5EQ0 A;  5T1G A;  4DR1 L;  4TKO B;  1GM5 A;  2O4X A;  4HIO A;  5T1I A;  3M4O H;  2J0T D;  3FKI H;  5IY0 A;  4IFD J;  3BJU A;  2B29 A;  1M1K C;  3M4O B;  3PF5 A;  3M4P A;  3CCU A;  2EYL A;  2L55 A;  1QIL A;  2OXP A;  5IGD A;  2JA9 A;  2PZT A;  1EWC A;  3NWT A;  5IE8 A;  1AZP A;  3E9I A;  3HOY G;  1WD0 A;  1GKH A;  3S1R B;  4QMG A;  1C8C A;  4KHP Q;  2R3Z A;  3S16 H;  1I6V C;  3AB9 A;  4HIK A;  1XX8 A;  4L8J A;  2EY6 A;  1FNW A;  4OWX B;  2IWH A;  1BBX C;  2N88 A;  2BOS A;  4JI4 Q;  4N8F A;  1YHA A;  1BDO A;  2LS0 1;  2OWO A;  3U9O A;  4ZCK A;  3R2T A;  1LTA D;  1PZI D;  3MXN B;  3MEF A;  1ET6 A;  3SK5 A;  4HID A;  1VQ5 A;  5LMU L;  3H15 A;  2RCN A;  4C3I B;  2F3I A;  2RA4 A;  3R8B A;  3BS1 A;  2NYZ D;  5C4X G;  4RH6 A;  3NE5 B;  1Q3L A;  2B2V C;  4X62 L;  5LL6 X;  2B2U C;  1NJI C;  3EVQ A;  1U4M A;  1HA5 A;  4QUC A;  1VMC A;  3J80 c;  4JYA L;  1S4Z A;  2PMZ E;  2PNR C;  3T1Y Q;  4ME3 A;  4IFD G;  4HTH A;  1QUQ A;  2L12 A;  1MJC A;  4RHR A;  5KRU A;  3GO5 A;  1BOS A;  3S2D B;  4HJ7 A;  1AE2 A;  4IPD A;  4HN7 A;  1IL2 A;  2JA7 G;  1SFO B;  3T1H L;  2A73 B;  4FO2 A;  1GUT A;  3I2Z A;  2VY3 A;  4X64 L;  5IGG A;  4B3S Q;  3AFP A;  1BCP B;  3DLL A;  3AMU A;  1SE2 A;  3KBG A;  1SNP A;  1V1P A;  5EPJ A;  5JEA H;  1YJW A;  3DWP A;  1V1O A;  3V2T A;  4JI6 Q;  4BY7 B;  1II3 A;  1Y8P B;  2RBM A;  1WTQ A;  1O7L A;  3DHQ A;  1QVC A;  1HQR D;  3PMF A;  3M7N A;  1R4P B;  2Q8R E;  2UXC Q;  3FP9 A;  4LF4 L;  3UE1 A;  2LY7 A;  2KHJ A;  3U58 A;  4XDX A;  3R2I A;  1EY0 A;  3MC0 B;  1Y1W H;  3T16 A;  3IFD A;  1RD9 D;  4K2L A;  4DAY A;  2XNA C;  3IAY A;  1G2S A;  2EXZ A;  4G7Z C;  1XJV A;  3A7L A;  3PSI A;  3GTP H;  3GTK B;  1B8A A;  3FPP A;  1VDZ A;  4FYD A;  4IUU A;  4LF7 L;  3PIP 3;  2JSO A;  5IGC A;  4KN4 C;  3HGB A;  3NWS A;  3Q8D A;  1EIY B;  1CKN B;  2F0Q A;  4NB3 A;  3K57 A;  3A5U A;  1TWF H;  2AWO A;  3OIQ A;  3CCJ A;  3QR8 A;  4FP5 D;  3G4S A;  2B63 B;  1YI2 A;  1FNV A;  1EIF A;  2F0P A;  3CQZ B;  3Q0A A;  1D1K A;  1WTH A;  1IKL A;  1B2T A;  1D6E C;  4IJH A;  1N33 Q;  1CQV A;  4DV6 Q;  3WWV A;  1IYU A;  2UUB Q;  3I72 A;  1DGS A;  3KF8 A;  4DK0 A;  1YIT A;  1YEZ A;  4ULL A;  4YHH Q;  3U4V A;  3E0J A;  1Q46 A;  5D14 A;  1EY9 A;  3H0G H;  1I4R A;  3X3N A;  2UXD L;  3H0G B;  2VUM H;  4DK1 A;  1ILQ A;  4JG2 A;  4DR2 L;  1AEX A;  1WYD A;  4RHS A;  4QIW B;  3KOJ A;  3RLN A;  3NQI A;  5FJ8 H;  5M3M G;  2FHT A;  5C3W A;  2E2J B;  1HXY D;  2NN6 I;  4YY3 L;  4CKE A;  3KF8 B;  1HNX L;  3Q22 A;  1LTI D;  2C5C A;  2R61 A;  5GAE C;  2KJX A;  5JAV A;  1BXT A;  1BF4 A;  3S15 H;  1EYA A;  1PH5 A;  2Z9H A;  1H95 A;  2UU9 L;  1O80 A;  1E0B A;  3A8K E;  3D4R A;  4GNX A;  4PMW A;  4CDC C;  5C44 G;  1QE6 A;  3E0E A;  5C3E H;  3BDL A;  1I50 B;  1EUJ A;  2H5X A;  4A3L G;  4GKJ L;  1G6P A;  5GAG C;  1PH7 A;  4PMB A;  4G57 A;  3MAQ A;  1SAP A;  4CKB A;  2PQA A;  4LUV A;  3RZD H;  2F0G A;  5C4H A;  1LUZ A;  2IX0 A;  5JJL A;  1EY8 A;  1STA A;  1C7Y A;  1HR0 W;  5EAY A;  4A3G G;  3HOW H;  2EY2 A;  2GVA A;  3I4N G;  4GNX B;  4APV A;  1M4V A;  2PNH A;  4CKC A;  1T5X D;  3C1E A;  3ERS X;  2VQF Q;  1ASY A;  1N36 Q;  1STY A;  4OON A;  4R4T A;  4BA2 I;  4DU9 A;  1QVF A;  5C5L A;  1Y1V H;  4EQO A;  5IGF A;  4XT1 B;  3W1B A;  3A74 A;  1RF2 D;  2V4D A;  4UP9 A;  3A8I E;  1TXY A;  4HJ8 A;  5IT9 L;  4C3J H;  4LFC L;  1JMC A;  1BBU A;  1KDA A;  1KLU D;  1PMR A;  5FKA C;  1G8Z D;  2F4V L;  4LWC A;  1XWE A;  3RMH A;  4A93 B;  4A3D H;  1TR5 A;  1VMP A;  4ZKC B;  1SND A;  1ENA A;  3KUP A;  5IWA L;  4AYB G;  3ULP A;  2KCM A;  3PIO 3;  4DUZ Q;  2WB1 E;  2K5H A;  1WCM H;  4HCS A;  1AN8 A;  4LF5 Q;  3HOZ H;  1MGS A;  5J22 A;  1F2M A;  1NSN S;  4E6I A;  1UWV A;  2NN6 G;  1A63 A;  3GTM H;  2CWA A;  3NEN A;  3VYR A;  3GV6 A;  2EDG A;  1B70 B;  3UDF A;  3KLS A;  4WRD A;  3BDC A;  1PH2 A;  5ELD A;  5ELB A;  2CQA A;  2NVY B;  3F2C A;  4DR3 L;  1K83 B;  3CME A;  2EOT A;  3QIA A;  1A3U A;  1Z7T A;  4KY7 A;  2JEA I;  4DV2 L;  1EQV A;  1WOC A;  4NPS A;  1TWC B;  3L3O C;  1BCP C;  3LGJ A;  1D5M C;  4H7B A;  3HOX H;  4BY1 H;  1CTM A;  2EXD A;  4DK3 C;  3K0Y A;  1XYI A;  4LF9 L;  1SMX A;  3AYH B;  1VF7 A;  3K8A A;  4P73 A;  1XNR L;  1HNZ L;  1EOT A;  1SMY C;  1SDF A;  1SYC A;  1TS4 A;  4A3M B;  4Y7N B;  1ASZ A;  3K5L A;  1K8M A;  3E5S A;  4L5S A;  2AUK A;  4QF4 A;  3H09 A;  4BBS B;  3O13 A;  1OTC A;  1N34 Q;  4QQB X;  2LXK A;  3PUV A;  4DR7 Q;  1TY2 A;  1JE5 A;  4DV4 L;  3J7A V;  1WI5 A;  4JI5 Q;  2NVT H;  1JJC B;  1CI3 M;  1EIG A;  1HZ9 A;  2N78 A;  4LUZ A;  3RZO H;  4IO9 A;  3CCM A;  4PZ7 A;  2MPM A;  3K5O A;  1EWH A;  3TZD A;  2F0M A;  1BQQ T;  3PUY A;  2HDM A;  4WFN 3;  1TII D;  2ZJP A;  2RVL A;  2X69 A;  2E74 C;  1D1I A;  4R4Q A;  5J39 A;  1HPC A;  1TWH H;  2VB2 X;  5IIF A;  5IP9 G;  4A75 A;  1IBK Q;  1SJH D;  4FDB A;  1KRS A;  2CHB D;  1K8A C;  3QJY A;  4KY5 A;  5CR3 A;  3K7U C;  2F0E A;  2IW3 A;  5BR8 L;  1B9M A;  4MTK A;  4A3I B;  1O7Y A;  1PH4 A;  5K5P A;  4WJW A;  2WAQ G;  1PHJ A;  4BXX H;  3PO2 H;  2CCZ A;  1IKM A;  4FXG C;  2JN4 A;  2A6E D;  1WD1 A;  1SYB A;  1R9T B;  2YU9 B;  2EYH A;  1FL0 A;  4JW0 A;  1A2T A;  3P7J A;  1KXL A;  2YTX A;  2AKW B;  4NXN Q;  4JV5 Q;  1RKN A;  1LAB A;  3TP8 A;  1S5F D;  1YNJ C;  1TWG B;  1E1T A;  1PZJ D;  1QZG A;  1TWA H;  1SYE A;  5IGE A;  5IYC H;  1SE4 A;  2FXQ A;  5CV7 A;  2TMP A;  3DEP A;  1XNQ Q;  1Q1B A;  4RKB A;  4S3S A;  2CFM A;  3KF6 B;  3OYY A;  3FPU B;  1HR0 L;  2F0U A;  2SDF A;  3S1N B;  1UE6 A;  4X65 L;  3CPW A;  3HKZ G;  5EBD A;  2UXB L;  2DY7 A;  1FVI A;  2PZU A;  4B9W A;  2VNU D;  4A3J G;  2B8G A;  1JB3 A;  1EYG A;  3Q6S A;  1FD7 D;  1Q1E A;  4LNQ A;  4ODG A;  1I94 Q;  1BBW A;  3U50 C;  2QKI C;  4HED A;  3HOY B;  2L15 A;  1LT4 D;  4J6H A;  2DGY A;  5M5W H;  3C2P A;  4YWM A;  2DN8 A;  2JA6 G;  3A55 A;  3MFG A;  1MJE A;  2R93 H;  3I91 A;  3I8Z A;  4LFB Q;  3M9B A;  4F7X A;  2DUD A;  4QGU A;  5M5Y H;  4LFA L;  2B2U A;  1PZK D;  3VDY A;  3KFU A;  1BVS A;  1E2V A;  3W2D A;  1WFQ A;  4DV7 L;  1HFG A;  1Q8K A;  3M3Y B;  2AMC B;  4GOP B;  1UEA B;  3A54 A;  2Q2T A;  2CW0 D;  3UDI A;  4A3K H;  5C4X B;  3GTQ B;  4YWL A;  4JI4 L;  5CMD A;  5GRO A;  5FLM G;  4ZRZ A;  2B2Y C;  1I6H B;  1EU4 A;  4IFD H;  1JT8 A;  4A3E G;  3TRZ A;  4JOI C;  1KTK A;  2A6H C;  1MSH A;  2DJF C;  1LV9 A;  4LAA A;  1ESF A;  4YCV A;  5KGU A;  4P72 A;  2XN9 C;  3OHX C;  2JA7 H;  3D0F A;  2A5H A;  1X65 A;  2KOL A;  4JPB W;  3LX0 A;  1NMG A;  4YWK A;  2P5Z X;  3AFQ A;  3C1F A;  4IOA A;  4NXM Q;  1KAW A;  5CBE E;  3S17 B;  3T51 B;  3TN2 A;  3EN2 A;  2NZ1 D;  4F87 A;  2EJM A;  2JXM B;  3A56 A;  3RR5 A;  1O7I A;  3T1Y L;  5ELO A;  2SEB D;  4K6D A;  2L9H A;  2TSS A;  3I4M H;  1VQJ A;  2D5D A;  5EKL A;  1VQA A;  4JI3 L;  2NVQ H;  4XQJ A;  1VQD A;  1H9S A;  4CHT B;  2NVX H;  1PTO D;  5GAD C;  4KTA A;  1GUS A;  1NTG A;  2Z1C A;  3STB D;  1PH3 A;  4POG A;  5EBC A;  1EZ6 A;  5FLX L;  5A35 A;  1B44 D;  5I2Y A;  4DV3 L;  2ICI A;  2R7D A;  3HOV G;  2K14 A;  4DGZ A;  1R4Q B;  1L0Y B;  1X56 A;  1K8O A;  4KD3 A;  4R8N A;  3BZK A;  3E9H A;  1E2W A;  2Z6B A;  2E5L Q;  4IZ8 A;  1HA6 A;  2Z4H A;  2RDH A;  5CV8 A;  4LF8 Q;  4DXF A;  5FOB B;  2R92 B;  2L11 A;  1S5C D;  2YV5 A;  2NTS A;  4H44 C;  4IPC A;  2F0L A;  2KVM A;  3I7F A;  2AQ2 B;  3S2H H;  4B3R Q;  2F3V A;  1GVP A;  2Y0S B;  4LJZ C;  4K6L A;  4UPA A;  1S3O A;  5A2Q E;  4L5Q A;  4A3I G;  1X55 A;  3CCL A;  4HSP A;  3NBH B;  2UUC Q;  1TU2 B;  3PIO A;  5KNB A;  5J1Z A;  2B2W C;  4DV1 L;  5COY A;  3LNN A;  2MFI A;  4DR4 Q;  3LWU A;  1SRU A;  3EA6 A;  5D3D A;  1YNX A;  2PZW A;  1N33 L;  2UUB L;  5M3M H;  1IBL Q;  5ELC A;  1A3T A;  2MO0 A;  2I5M X;  4EQP A;  2F0J A;  2LSS A;  3D4W A;  5EPK A;  4QB4 A;  1VQO A;  4DR5 Q;  5I6Y A;  1JQY D;  5IYB H;  1EL0 A;  1CHP D;  3I3C A;  4K0K Q;  4NP5 A;  1NE3 A;  2JA5 G;  4A3L H;  1LTL A;  1AE3 A;  5C44 B;  1XMO L;  3Q23 A;  3PQI A;  5COR A;  4CJ1 B;  3KJP A;  1K3R A;  2A74 C;  1B9N A;  1CHQ D;  5K36 H;  5E7N A;  1CKM A;  1CUK A;  1SRO A;  5TSS A;  3V96 A;  3S1R H;  2HCI A;  4R4O A;  2HD3 A;  1X3F A;  4A3F B;  4A3G B;  5AFW A;  4K5X A;  3TSS A;  4EQN A;  3A7A B;  4FF4 A;  3I4N B;  2IX1 A;  1L1O A;  2A68 C;  1QZH A;  1UAP A;  1Y8O B;  3OSO A;  1CA5 A;  1VF5 C;  4K8J A;  4UP8 A;  2A8V A;  2QDB A;  3R3O A;  1LLR D;  1S40 A;  4C3I H;  4B3M L;  2HHH Q;  2D2C C;  1K8G A;  3CC2 A;  2BE5 C;  2A69 C;  2NB0 A;  1VQ7 A;  2NBF A;  4BBR G;  4C1N K;  4IUN A;  3U4Z A;  2N55 A;  5GAH C;  5C4J B;  3CPF A;  3D6C A;  3QWN A;  3N6R A;  1EYD A;  4RGN A;  4GOP C;  3S24 A;  1I4Q A;  4QY7 A;  2QDL A;  3G71 A;  1ML0 D;  4RKL A;  3BG3 A;  4AYB B;  1VQL A;  3MHB A;  3S2D H;  2G9H D;  2NN6 H;  4N8X 1;  1KAB A;  3VR6 A;  5I9P A;  5JJK A;  1E22 A;  3HRZ C;  1SFO H;  4TQU S;  4CDE C;  1VQN A;  2L4N A;  1A15 A;  3PF4 A;  1SNC A;  3A8J E;  4IUV A;  5FLX E;  1Q81 C;  4LF6 L;  4ME5 A;  1TY0 A;  5J3B A;  3W1G A;  2OTL A;  3D8G A;  4BY7 H;  4DXG A;  3J81 L;  4IUR A;  3TZU A;  4NDX A;  1ZYR D;  4EVO A;  3TP7 A;  1QUQ B;  1HNW L;  1KL9 A;  4G4K A;  2ZM6 Q;  3H3V I;  1FGU A;  2G9D A;  4JI2 Q;  5G3L F;  2M2L A;  1F9P A;  5ISR A;  1KDB A;  2J4X A;  3RN5 A;  1QVG A;  2BDN A;  2VZA A;  1F2Y A;  3K59 A;  1P16 A;  1VQ8 A;  1V1P B;  2EYJ A;  3PO3 G;  3GTK H;  3W3A A;  4U67 3;  2FFK B;  4AQY L;  4QUF A;  1WTO A;  4X66 Q;  1JJ2 A;  4JI7 L;  2F0D A;  2JE6 I;  1SXT A;  2D9U A;  3A5Z B;  3TP6 A;  5M3F B;  2HDL A;  4GLX A;  2R92 G;  5IGB A;  1KC8 C;  2B63 H;  1J6Q A;  4RCO A;  2BCO A;  3VYU A;  1EY5 A;  2Z6K C;  3CQZ H;  3S1Q B;  4DAY B;  4DV5 Q;  3CD6 A;  4OX9 L;  1N34 L;  1MKH A;  2RDF A;  2Y0S G;  2EJG C;  3OOC A;  4N9P A;  3I90 A;  4U68 A;  1S5E D;  4JI5 L;  5I2X A;  3GTL B;  1V1Q A;  5ELF A;  2HT1 A;  2WIN B;  3ERO A;  1GXD C;  4L5T A;  5FK9 C;  4GKK Q;  1N32 Q;  5E3F A;  4KN7 C;  4FF1 A;  1CZG A;  3HOU G;  4KLK A;  3P1H A;  3UDX A;  1N8R C;  3R93 A;  1ET9 A;  4J8Q A;  1DON A;  1W2B A;  2E2J H;  2YYZ A;  1RTN A;  3JAM L;  4KY6 A;  4A3B G;  1X3P A;  3HS0 C;  4RA8 A;  4Q0F A;  1FJG L;  2DJG C;  3MXG A;  2R7Z G;  1G91 A;  2OTJ A;  1E3P A;  3NP8 A;  2CH4 A;  3VR3 A;  3VR5 A;  3PUX A;  1LT5 D;  4ZAI A;  1PYB A;  1I50 H;  2RCF A;  2WAQ B;  3IFT A;  4MZ9 A;  2OCE A;  4KHZ A;  2UUA L;  1K0S A;  4POF A;  4X6A H;  2F0N A;  3NK9 A;  4HAE A;  3H3V C;  1LTR D;  3GQB A;  3CCS A;  1TQO A;  5IYD G;  3ICE A;  4G7H C;  2JJQ A;  3MFY A;  2BDO A;  1BCP F;  1F9Q A;  1CKO A;  4DNT B;  1ESR A;  4MNO A;  4A3F G;  1VQG A;  1A8V A;  3PV0 A;  4B3T Q;  3C3L A;  4FXD A;  3IKJ A;  3ULL A;  4RCN A;  3EJI A;  4I7A A;  1E24 A;  2B8F A;  1SYG A;  2KBN A;  3FKI G;  1EOV A;  3CRL C;  4B08 A;  2E2D C;  2MJ8 A;  4UY8 C;  3HKZ B;  4JV5 L;  2EIF A;  3URY A;  1JR0 D;  2PQA B;  3SDZ A;  5DM7 3;  3GTO B;  4A3J B;  1LYL A;  4GLA C;  1OXX K;  2K01 A;  1DOM A;  3RUZ A;  2KCT A;  3QO2 A;  1XNQ L;  4C3H G;  1SYD A;  1BO0 A;  2JP1 A;  5LMN Q;  1Q7Y C;  4A93 H;  2JA6 B;  2VS1 A;  1JOQ A;  2F0T A;  5BN3 A;  2VQE Q;  3TS2 A;  4RFB A;  4IN3 A;  3M85 A;  1U4R A;  1NAP A;  2M9V A;  3SGI A;  5M9O A;  1QCB D;  1I94 L;  1D2B A;  2FMM A;  2B2T A;  3B6Y A;  1ZKO A;  2RSO A;  1JB7 A;  1ILP A;  1X3Q A;  5EPL A;  1VQH A;  3J7Z C;  3T1H Q;  4KD4 A;  2NVY H;  4IPH A;  3NSW A;  1K83 H;  4LFB L;  1I4G A;  5FLM H;  4V0B A;  4ID6 A;  1VQE A;  1VQF A;  2CQO A;  1TWC H;  4A3E B;  2F0V A;  2FJ2 A;  1TKW B;  4TSS A;  4A3C G;  1G6Z A;  3OW2 A;  2M00 A;  3ZYY X;  4WJ4 A;  1Q12 A;  5HGT A;  1VQM A;  3MXU A;  4IUP A;  4A3M H;  4K14 A;  4Y7N H;  4BA1 I;  1WTR A;  3TDQ A;  3Q24 A;  1PLF A;  2ZTC A;  1Y8N B;  3MEH A;  4DR6 L;  5JEA G;  2MHV A;  4BBS H;  1HH2 P;  1FR3 A;  4C1N I;  1U0L A;  2SNS A;  1W6K A;  3SK8 A;  5DNF A;  4JI8 L;  5C3X A;  1T5E A;  1ZEQ X;  2GA4 B;  3G7L A;  3CMA A;  4LF7 Q;  1KNA A;  3TP5 A;  3VA5 A;  5M3F G;  1M8A A;  4OWW B;  1JC7 A;  1TT2 A;  4MN3 A;  4DV0 L;  1ICW A;  2VL6 A;  1OXT A;  2I07 B;  3HOV B;  2ZJR A;  2O5J C;  4ABN A;  3F8T A;  1YHB A;  4XIG S;  3L9A X;  4UHV A;  1PFB A;  4H13 C;  4EGV A;  5IOC A;  3CCV A;  1CK1 A;  1EQT A;  3G6J B;  1PH1 A;  2WII B;  5KND A;  2F0S A;  3J80 L;  3GD7 A;  2UXD Q;  4MHE A;  1FNU A;  1RL2 A;  1SEB D;  2QEJ C;  1JWU D;  1VQK A;  4XTC S;  4YY3 Q;  3DMU A;  4A3I H;  4R4I A;  3GTG B;  1HNX Q;  2IJ0 A;  3H94 A;  4NMZ A;  2E2I B;  1Y69 U;  1DD2 A;  1GHJ A;  2AWN A;  5JJI A;  3WOF A;  2KEE A;  4LF8 L;  1I3Q B;  3UDG A;  2DNC A;  1R9T H;  2UU9 Q;  2YU9 H;  1NBW A;  1NCV A;  2ZJQ A;  1GHK A;  1ZXT A;  4GKJ Q;  1W3S A;  2VUM G;  3S1M B;  5DM6 3;  2RKS A;  5GQO A;  2IY5 B;  2MO1 A;  2GN5 A;  2WKD A;  1TWG H;  5FJ8 G;  3E3X A;  3K6O A;  1XTC D;  3D3R A;  4OWT B;  1EY6 A;  4HJA A;  2HIV A;  2CVR A;  5IT9 E;  3TS0 A;  2K05 A;  4IUT A;  4B9X A;  1YVC A;  4QIW E;  5C3E G;  2L0C A;  1L2F A;  3S1N H;  4DR4 L;  2QW7 A;  3HFZ B;  2JA5 B;  4C2M B;  1I4H A;  1HQM C;  2QCP X;  1PFN A;  1YNN D;  3MZ5 A;  3NHH A;  4GNX C;  1UEB A;  1UE7 A;  3F1Z A;  2F4I A;  5DAU A;  3DWA A;  3OPO A;  2RDG A;  3BYY B;  3HOY H;  4P75 A;  2K03 A;  1IW7 D;  3I4O A;  2A19 A;  4K0K L;  1KHI A;  3SR1 A;  4DAP A;  4LFC Q;  2NTT A;  1EQR A;  2F0I A;  3KLR A;  1JOK A;  2Z8L A;  2F4V Q;  2K33 A;  3C46 A;  3LWE A;  3BZC A;  3PIP A;  1F2Z A;  1C9O A;  1V43 A;  4L63 B;  4OEM B;  4KHV A;  5HY6 A;  4CJ0 B;  1EEF D;  2B2V A;  5IWA Q;  4ZUJ A;  4FNF A;  5C0X I;  4ZKB B;  3S14 B;  1PTO B;  4RG1 A;  1EZ8 A;  3GTJ B;  3VR2 A;  2KQ3 A;  3M3Y H;  4L5R C;  4KHP L;  3SVM A;  3J7A F;  4DNI A;  1PRT D;  1X3G A;  5C4X H;  4C3J G;  4IPG A;  3GTQ H;  2F52 A;  4BBR B;  3FVQ A;  2FMC A;  3NTK A;  4EX5 A;  1VCI A;  1CA6 A;  3OWF A;  3QOJ A;  3L2P A;  1S5D D;  5E1F A;  4KMU C;  1I6H H;  1M90 C;  4A3D G;  5LL6 S;  5C0X J;  3T56 B;  3KK7 A;  4XXE A;  5KIX A;  1HTL D;  5LMN W;  2BA0 A;  2HHH L;  1WCM G;  3HOZ G;  2K04 A;  2JA8 B;  4WOR A;  3M4Y A;  4DKA C;  1IYJ B;  1IZ6 A;  2EY5 A;  1WTP A;  1K9M C;  3S17 H;  1XNR Q;  1RIP A;  1VQP A;  1IYV A;  5ELE A;  5JVH 3;  3J81 j;  1UE1 A;  2V1C C;  5JPN C;  1X54 A;  1RCV D;  4O42 A;  4HJ5 A;  1DM0 B;  1EWI A;  1HRJ A;  3TEH B;  4UP7 A;  1AW7 A;  2Q2I A;  1YIJ A;  1S72 A;  3NQT A;  1D8L A;  1JWM D;  3HOX G;  4M8A A;  4O2D A;  2HUG A;  2RF4 A;  2SNM A;  2A68 D;  4B3S L;  1B50 A;  3KDF A;  4JK1 C;  2E2H B;  1Q8I A;  4DK6 C;  3J80 E;  2I5H A;  1JE4 A;  3VR4 A;  4JI6 L;  5EJW A;  1WVL A;  5C0X G;  3PO3 B;  5KYL A;  3HG9 A;  3FHW A;  5CV4 A;  4RGM A;  1VQ9 A;  1GUO A;  2Z4I A;  2PYK A;  2VB3 X;  2UXC L;  1LAC A;  4FVM A;  2ATW A;  4DAM A;  4UAI A;  5NUC A;  1D7Q A;  1H9S B;  1GUN A;  1MI2 A;  3KBX A;  4IQZ A;  4XQQ A;  2R92 H;  1S5B D;  2EQS A;  3V05 A;  1JWS D;  3RN2 A;  4QCL A;  4J15 A;  3OIP A;  1B7Y B;  4RGT A;  1EY4 A;  5E4W C;  2MP1 A;  1FGB D;  3BVM A;  4GZY C;  4BS9 A;  2PW7 A;  4PZ8 A;  4XYO A;  4R8I A;  2BH2 A;  3CU7 A;  1SE3 A;  2XRS D;  4CDF C;  1DCZ A;  1YZ6 A;  3CP0 A;  2XGT A;  1PFM A;  3ONA B;  4OIJ A;  3M7G A;  5BR8 Q;  3D6W A;  2L5T A;  3VA7 A;  5IT9 c;  3HP3 A;  4OGQ C;  4OHJ A;  1BNZ A;  2PW5 A;  4HR7 B;  1CM9 A;  5BN4 A;  2K52 A;  4JBM A;  1WJJ A;  2IL8 A;  1JOO A;  5AJ3 Q;  4DV5 L;  2I0Q A;  3HOU B;  1X9N A;  2OEO A;  3SK6 A;  2ZTE A;  3K7A B;  2AUJ D;  1SYF A;  4DV6 L;  2ES2 A;  1JJG A;  4O1N A;  1V9P A;  4A3B B;  3E6Z X;  4YHH L;  3BDO A;  3L7Z C;  3ERQ A;  3H3V H;  2EPB A;  2E8G A;  4LUO A;  1NY4 A;  1Z9F A;  2R7Z B;  4PNY A;  2VXW A;  4BXX G;  2OQ0 A;  5C44 H;  3PO2 G;  2CW0 C;  4XQN A;  1PH6 A;  2KA7 A;  4LMQ D;  3TQY A;  4TVA B;  1SN8 A;  4BWG B;  5BN5 A;  4AH6 A;  3I56 A;  4CBV A;  2ZTD A;  3EBE A;  1SLJ A;  2X6L A;  1C4Q A;  4A3F H;  2BH8 A;  3UE0 A;  4A3G H;  2PI2 E;  5H1S E;  1STH A;  3DUZ A;  1EQQ A;  1IBM Q;  3I4N H;  4R9W A;  2QF7 A;  1VQC A;  4GN5 A;  3BVG A;  1WTX A;  1OXS C;  2MUY A;  3FKI B;  4K2K A;  3MXN A;  2X6G A;  1SR3 A;  4X3T A;  3OTO Q;  1VQI A;  2ZXR A;  2LFN A;  2RHQ B;  4P2C B;  4LFA Q;  4Q5V A;  4P74 A;  1D5Z C;  4DV7 Q;  4B3T L;  1X3E A;  4GLV B;  2ZXO A;  4I65 A;  3K5M A;  4C3H H;  2WB1 B;  5C4J H;  3S16 B;  3MWY W;  4C3H B;  1PTO C;  3NTH A;  3STB C;  2R6G A;  2I5L X;  2R93 G;  1H9R A;  1XMQ Q;  1G2T A;  4H0L C;  2O2L D;  1L1O B;  2VQF L;  1STN A;  1N36 L;  2LKV A;  4HIM A;  2OQK A;  3OWE B;  4RAU C;  4ZLT F;  2MGS A;  1LT6 D;  5G3L D;  1O78 A;  1CSQ A;  4PV1 C;  2JA8 G;  5FO9 B;  1NMF A;  2KCC A;  1Z6H A;  2N3S A;  3SK4 A;  5LMN L;  4A3K G;  3SEB A;  2HQL A;  1V8Q A;  4GN3 B;  2K50 A;  1A6X A;  2EY1 A;  4OO1 I;  2VQE L;  1VQB A;  1AH9 A;  4A4I A;  2CH4 W;  1B3A A;  4JI0 Q;  5HGQ A;  3D4D A;  2FIN B;  4KJN A;  4DUZ L;  1I4X A;  1LT3 D;  4IAL A;  4LF5 L;  1J5E Q;  4A3C H;  1KRT A;  3MTS A;  1G29 1;  4DUY Q;  4HMJ A;  3T53 B;  3K5N A;  4JI3 Q;  2GVB A;  1KQS A;  4LW1 A;  3AEV A;  3ND8 A;  4R4C A;  4DFA A;  4DV3 Q;  4TRD A;  1STB A;  5JVG 3;  1EIH A;  3NBI A;  3I4M G;  3ULJ A;  4LK1 C;  2DNE A;  1F9S A;  2QIL A;  1DOK A;  3N52 A;  2Q2U A;  2N8N A;  4JI1 Q;  5M3F H;  3I70 A;  1CKN A;  3VYS A;  1QB5 D;  2K5D A;  2KEC A;  1KLG D;  1HZC A;  1SNM A;  2ID0 A;  3HEJ A;  3PUZ A;  1Y1W B;  3HKS A;  3S1Q H;  1KIX A;  5C6A A;  1RTO A;  3F2B A;  1GD7 A;  3NXW A;  1OXV A;  4OEL B;  2DY8 A;  1EY7 A;  3CF5 A;  2CKZ B;  2IT1 A;  1YJN A;  4DR7 L;  1IL8 A;  1ICF B;  3GTL H;  3GTP B;  3PCO B;  3KJO A;  3QOL A;  2IHE A;  1AP0 A;  1LO5 D;  3K80 C;  3RLO A;  3HZX A;  2NZO A;  2PPB C;  4DV1 Q;  4OO1 G;  3L0O A;  5IP9 H;  1F2L A;  1TWF B;  3CXC A;  1K73 C;  1IHZ A;  4YIJ A;  1BCP D;  2KED A;  2R7F A;  4HMI A;  3X3M A;  1QOH A;  4DAV A;  1TVX A;  3RD4 A;  5CC4 A;  5LHY 1;  4YCU A;  2LMC B;  1KNE A;  4NKL A;  5CV6 A;  1Q86 C;  3J80 i;  1SMY D;  2EVB A;  1WTW A;  1QNK A;  2C9O A;  2PCF B;  3CRK C;  2Y0S E;  1IBK L;  4DR1 Q;  1XMO Q;  4FF2 A;  3BU2 A;  1PA6 A;  2VUM B;  1Q82 C;  2K4K A;  2K7V A;  5IOD A;  1E2Z A;  4DPG A;  1O7Z A;  3CHB D;  1XPO A;  1Q90 A;  3VYT A;  5IP7 G;  1EFI D;  3DWQ A;  3WDN A;  1PH9 A;  1C48 A;  4AIM A;  1XPR A;  1RHP A;  5IYB G;  3S15 B;  3S9W A;  3FRP B;  2JYO A;  5C3E B;  1PYS B;  2RSN A;  4I7Z C;  4PG3 A;  3CKI B;  4NXN L;  4A3J H;  3GTO H;  3ND9 A;  2AHO B;  1KD1 C;  2L1B A;  2RQX A;  3SHL A;  5K36 G;  3DXJ C;  4B3M Q;  3CCE A;  1IXR A;  3RZD B;  5LMU Q;  2BA1 A;  1ZYR C;  3CCR A;  1U5K A;  2WB1 G;  4ZK9 B;  1BUV T;  2F03 A;  1B4O A;  1J9O A;  3HOW B;  2JA6 H;  4G7O C;  4CGY B;  1ROD A;  4X62 Q;  3IRB A;  3MA2 B;  5FLX c;  5JEA J;  1D5X C;  2EE1 A;  3ZJY C;  3NEM A;  1LM0 A;  4JYA Q;  3J81 E;  1HUM A;  1QG7 A;  2XVS A;  2JQO A;  4C3I G;  4HSV A;  1GOZ A;  5CBA E;  1Y1V B;  4GN4 B;  1L1O C;  4L6T B;  2B2Y A;  1L0W A;  3CC4 A;  1QJO A;  2QEX A;  4M1U B;  4RGO S;  4JOI A;  4C3J B;  5CV9 A;  4X64 Q;  1U9R A;  4LF6 Q;  2K5Q A;  3F2U A;  1TS5 A;  4A3D B;  2YTV A;  4A3E H;  4QL5 A;  5KNC A;  1YNJ D;  2E76 C;  3AU7 A;  1H9M A;  4F8M A;  2K6A A;  1WCM B;  3OMC A;  4K8I A;  5EKI A;  3HOZ B;  1HNW Q;  2G5D A;  3GTM B;  3T13 A;  2H1E A;  1SSO A;  4LF4 Q;  5D65 A;  2IHF A;  1PVO A;  1X6O A;  2ZT9 C;  2EYO A;  4AYB E;  2XSC A;  4QJF A;  3K0X A;  5C4Z A;  4PQX A;  2KEN A;  1DZ1 A;  1GUG A;  3CAM A;  4BY7 G;  1LTS D;  5JOB A;  4KK7 A;  1JIC A;  1UE5 A;  2KUM A;  2XWJ B;  4AQY Q;  3KLW A;  2K32 A;  5JJZ A;  1H9K A;  4UDU C;  3K58 A;  1F9R A;  2AQ3 B;  5HUR A;  4JI7 Q;  3HOX B;  1MHW C;  4BY1 B;  1AFP A;  4C56 C;  3BZD B;  2K1B A;  3NTI A;  4NXM L;  2K5N A;  1Y1W G;  2J7Z A;  3FMC A;  3NUC A;  5FO7 B;  4JCV E;  3HOV H;  2Q2H A;  2PQE A;  5C0X H;  3ER0 A;  1STE A;  3TBI B;  4OX9 Q;  3JAM E;  2WV6 D;  3EQL C;  3WOE A;  4DA2 A;  2I46 A;  1N9W A;  2MNA A;  4O0A A;  2NVT B;  5KEE A;  3RZO B;  2F0W A;  4KJO A;  1B53 A;  2B63 G;  2D0P A;  1UUP A;  5CV5 A;  4DR2 Q;  1NNX A;  2A6H D;  2LXJ A;  2B2W A;  1HCZ A;  2E2I H;  3GTG H;  2EYP A;  1UNS A;  2D62 A;  2Q8I B;  1HZA A;  2E5L L;  1QWY A;  1SNQ A;  1FJG Q;  1I3Q H;  2KCN A;  1LTG D;  1MD2 D;  2KHS A;  2K5W A;  3BVZ A;  1EU3 A;  1ENF A;  2QGQ A;  3DM1 A;  2AQ1 B;  1NUC A;  1JOR A;  4F88 A;  2PI2 A;  2F0K A;  4X3K A;  1TWH B;  1SJE D;  3H0G G;  3S1M H;  4JC0 A;  2OF1 A;  4A76 A;  2IX3 A;  3ITP A;  2UUA Q;  3TRE A;  1BKB A;  2SOB A;  1EFW A;  4XYQ A;  4B3R L;  1U4P A;  2F3W A;  2F1M A;  3KYH C;  3H6M A;  1PRT B;  2MQH A;  4N9T A;  1DOL A;  3QG1 A;  2B3G A;  2NWG A;  2UUC L;  4PZ6 A;  2EZV A;  2H4O A;  1HZB A;  4K5V A;  1Z47 A;  5DLQ E;  3KF6 A;  4IUQ A;  2JA5 H;  3SE0 A;  3GV3 A;  4C2M H;  5I4D A;  5AJ3 L;  2ASB A;  3PO2 B;  1A62 A;  1ENC A;  2YTY A;  1XTD A;  1KDC A;  4KI0 A;  1MIU A;  5F2D A;  1TS3 A;  1IBL L;  1DYQ A;  2D0O A;  1RDP D;  5L37 A;  3J81 c;  1HHV A;  1LTT D;  5ELN A;  5A2Q L;  4KKU A;  4DR5 L;  2WAQ E;  1GJX A;  1PYW D;  1B1Z A;  4DN4 M;  2A1A A;  3MVV A;  3HOW G;  1TWA B;  3M4Q A;  3D31 A;  1XPU A;  3F2D A;  1X32 A;  5DEH A;  1CT1 D;  1E1O A;  3CC7 A;  1PH8 A;  4XT3 B;  1JCK B;  2JEB I;  3W5O A;  3RLF A;  3S14 H;  2WP8 J;  1PTO H;  3GTJ H;  2HIX A;  1U4L A;  1Y1V G;  1HJP A;  1I4P A;  1FYC A;  1PXU A;  4GOP A;  2PMZ B;  1IBM L;  4WJ3 M;  4BBR H;  1SBB B;  1A2U A;  1STG A;  3BYT B;  1HUN A;  5M5W B;  3HKZ E;  1PFS A;  4A93 G;  4ZUI A;  4JBJ A;  3GDE A;  4HCE A;  4Y52 H;  4DNR B;  2R93 B;  4RMF A;  3P75 A;  1HFN A;  1NR2 A;  2VW9 A;  4DR3 Q;  1ONL A;  3OTO L;  2N49 A;  4Z9C B;  4X3S A;  5KYI A;  1GO3 E;  4DV2 Q;  5M5Y B;  3A0J A;  2JA8 H;  4DF7 A;  4FXK C;  3J7Y W;  2F0H A;  1VS0 A;  4V19 0;  4PMC A;  1I5F A;  1EYC A;  3G6E A;  1LTB D;  5D3I B;  1B3Q A;  2Q8T A;  4JBK A;  1XMQ L;  4LF9 Q;  4A3K B;  1HNZ Q;  3EIV A;  1AZQ A;  2B39 A;  1L0X B;  2PO4 A;  3NEL A;  3TME A;  2B2T C;  2ICE C;  3NPP A;  4DR6 Q;  1K28 A;  1VQ4 A;  3MXP A;  4ZQ3 A;  3QB3 A;  2QA4 A;  1E7Z A;  5CGK A;  2E75 C;  5CYU A;  3JAM c;  3CCQ A;  4JI8 Q;  1HTP A;  1A3V A;  3SXH A;  4JVZ A;  2ZXP A;  4DV4 Q;  4BY1 G;  5I9O A;  1J8I A;  3JC6 6;  2E2H H;  4HJ9 A;  2IPK D;  4YCW A;  4MIU A;  5EGT A;  1PRT F;  5EKK A;  4IOC A;  2JA7 B;  1Y14 B;  2HQE A;  3T4A C;  4KV6 A;  4A3M G;  2K5V A;  1DXM A;  1CFM A;  4OL7 A;  2RHS B;  3J81 i;  1CZW A;  4JI0 L;  1BR9 A;  2A6E C;  1K0R A;  4IJL A;  4DV0 Q;  1PV4 A;  1EEI D;  1F77 A;  1OXU A;  2O5I C;  3PO3 H;  2WAC A;  1MSG A;  3OMG A;  1J5E L;  4BBS G;  1WTV A;  1VQ6 A;  4EQ5 A;  3I4M B;  4J1M A;  2ALY B;  2A69 D;  2BE5 D;  4OIK A;  4DUY L;  2ENB A;  2NUC A;  2ZM6 L;  2Z6K A;  5JPM C;  4JI2 L;  2NVQ B;  4JBW A;  1A0I A;  1XXG A;  2NVX B;  3U9S A;  2XRQ D;  2EJF C;  2NZH A;  1H9J A;  2F0F A;  4K5W A;  3KDF B;  4ZYS A;  3FEW X;  4X3U A;  2K28 A;  3KLS X;  2JK8 A;  2XWB B;  5M5X H;  1YNN C;  2EYM A;  1GUW A;  4R1J A;  4X66 L;  5M5X B;  2XIW A;  1YHQ A;  3FDT A;  4JI1 L;  1SNO A;  4ILW A;  3NBH A;  3P20 A;  1IW7 C;  3AQQ A;  3IL8 A;  1C0A A;  2WKC A;  1PTO F;  4OO1 H;  1KAA A;  3HOU H;  4FF3 A;  1OO9 B;  1DJR D;  2HCC A;  3I73 A;  3H91 A;  3K7A H;  1YJ9 A; 
#chains in the Genus database with same CATH homology
 1JB7 A;  1CSP A;  1YBY A;  3G48 A;  1HR0 L;  1VQH A;  1T9H A;  3CW2 C;  1UE6 A;  3J7Z C;  4OXP A;  3T1H Q;  4X65 L;  3KF6 B;  2NVY H;  2N8N A;  3I55 A;  3CPW A;  3HKZ G;  4JI1 Q;  4IPH A;  4A3B H;  2UXB L;  1K83 H;  4P71 A;  1FVI A;  2WFW A;  5M3F H;  4LFB L;  5FLM H;  2VNU D;  1CKN A;  4A3J G;  2R7Z H;  1VQE A;  1EYG A;  4H02 A;  1HZC A;  1VQF A;  1Q1E A;  3PUW A;  2ID0 A;  2CQO A;  2C35 B;  3PUZ A;  3PGZ A;  3RNU A;  1G51 A;  2K75 A;  1TWC H;  3HKS A;  1I94 Q;  4LNQ A;  3S1Q H;  1KIX A;  1BBW A;  3U50 C;  1N32 L;  3F2B A;  1GD7 A;  1OXV A;  2L15 A;  3CF5 A;  2CKZ B;  4A3C G;  3OW2 A;  2DGY A;  5M5W H;  2IT1 A;  4YWM A;  3JAM i;  3J7A 5;  2JA6 G;  1HR0 Q;  1P8L A;  1YJN A;  4DR7 L;  1MJE A;  2R93 H;  4WJ4 A;  4X65 Q;  2Z0S A;  1Q12 A;  3GTL H;  1VQM A;  3DM3 A;  4IFD I;  4GS3 A;  3K81 C;  3PCO B;  3KJO A;  2UXB Q;  5IYD H;  4LFB Q;  2IHE A;  4ALP A;  2KHI A;  3M9B A;  4A3M H;  5IP7 H;  3K80 C;  2DUD A;  4Y7N H;  4BA1 I;  4QGU A;  1SE8 A;  2ZTC A;  5M5Y H;  3RLO A;  4DR6 L;  4LFA L;  4MTN A;  2NZO A;  5JEA G;  3VDY A;  3KFU A;  1BVS A;  2XTI A;  4BBS H;  1HH2 P;  5IYC G;  4DV1 Q;  4OO1 G;  3L0O A;  1U0L A;  1WFQ A;  2CWP A;  5IP9 H;  3CXC A;  4DV7 L;  1K73 C;  1Q8K A;  2AMC B;  4GOP B;  2Q2T A;  4DR1 L;  4JI8 L;  1GM5 A;  4HIO A;  3UDI A;  3CMA A;  4A3K H;  2R7F A;  3FKI H;  5IY0 A;  4LF7 Q;  3M4O H;  4IFD J;  3BJU A;  2B29 A;  4YWL A;  1M1K C;  4JI4 L;  3PF5 A;  3M4P A;  4YCU A;  3CCU A;  5M3F G;  5GRO A;  5FLM G;  2JA9 A;  4OWW B;  1Q86 C;  1JT8 A;  3J80 i;  4A3E G;  3TRZ A;  5IE8 A;  3E9I A;  3HOY G;  4DV0 L;  1GKH A;  4JOI C;  2VL6 A;  4KHP Q;  1OXT A;  3S16 H;  2Y0S E;  1IBK L;  4HIK A;  4DR1 Q;  4YCV A;  2ZJR A;  1XMO Q;  4P72 A;  3BU2 A;  3F8T A;  1PA6 A;  4OWX B;  2JA7 H;  3D0F A;  1X65 A;  1YHB A;  4XIG S;  3CCV A;  1Q82 C;  2K4K A;  4JI4 Q;  4DPG A;  1NMG A;  4YWK A;  1YHA A;  3AFQ A;  2OWO A;  4IOA A;  4NXM Q;  1KAW A;  1XPO A;  3EN2 A;  5IP7 G;  3MXN B;  3MEF A;  1PH1 A;  1PH9 A;  3RR5 A;  4AIM A;  1VQ5 A;  1O7I A;  4HID A;  3T1Y L;  5ELO A;  1XPR A;  5LMU L;  3H15 A;  5IYB G;  2RCN A;  3I4M H;  2F3I A;  1VQJ A;  3GD7 A;  2UXD Q;  1RL2 A;  5C4X G;  1VQA A;  4JI3 L;  2NVQ H;  1PYS B;  4X62 L;  1VQD A;  2NVX H;  4PG3 A;  5GAD C;  1NJI C;  1VQK A;  4XTC S;  4NXN L;  3STB D;  4YY3 Q;  1NTG A;  4R4I A;  4A3I H;  2AHO B;  4A3J H;  1PH3 A;  1KD1 C;  1HNX Q;  3J80 c;  4POG A;  4JYA L;  5K36 G;  2AWN A;  5JJI A;  4DV3 L;  2PMZ E;  4B3M Q;  3CCE A;  1IXR A;  3T1Y Q;  4LF8 L;  2R7D A;  4ME3 A;  5LMU Q;  3UDG A;  2BA1 A;  4IFD G;  3CCR A;  1R9T H;  1U5K A;  2UU9 Q;  1QUQ A;  2WB1 G;  1MJC A;  2YU9 H;  1NBW A;  2K14 A;  3HOV G;  3GO5 A;  2ZJQ A;  4GKJ Q;  1W3S A;  2JA6 H;  2VUM G;  1X56 A;  4HJ7 A;  1AE2 A;  4IPD A;  1A63 A;  1IL2 A;  5GQO A;  4X62 Q;  2IY5 B;  3BZK A;  3IRB A;  2MO1 A;  5FLX c;  2GN5 A;  5JEA J;  2JA7 G;  3T1H L;  3E9H A;  3I2Z A;  2VY3 A;  3ZJY C;  4X64 L;  1TWG H;  3NEM A;  5FJ8 G;  2E5L Q;  1LM0 A;  3AFP A;  4B3S Q;  3DLL A;  4JYA Q;  4OWT B;  1YJW A;  2JQO A;  4LF8 Q;  4HJA A;  2HIV A;  3TS0 A;  4JI6 Q;  4GN4 B;  1L1O C;  1L0W A;  2YV5 A;  3CC4 A;  1YVC A;  4IPC A;  4QIW E;  5C3E G;  3I7F A;  1L2F A;  3S1N H;  4DR4 L;  1QVC A;  2QEX A;  3HFZ B;  3S2H H;  4B3R Q;  3M7N A;  4JOI A;  1GVP A;  2UXC Q;  3FP9 A;  4UPA A;  4X64 Q;  1S3O A;  4LF4 L;  3UE1 A;  4LF6 Q;  4L5Q A;  2KHJ A;  3U58 A;  4A3I G;  4GNX C;  1UEB A;  1UE7 A;  1X55 A;  3F1Z A;  1Y1W H;  3CCL A;  2YTV A;  3NBH B;  2UUC Q;  4A3E H;  4QL5 A;  3HOY H;  3PIO A;  4P75 A;  4DV1 L;  3I4O A;  1XJV A;  2A19 A;  4K0K L;  2MFI A;  1KHI A;  4LFC Q;  4DR4 Q;  1HNW Q;  1EQR A;  3PSI A;  1SRU A;  3GTP H;  1B8A A;  1YNX A;  2F4V Q;  1N33 L;  4LF7 L;  2UUB L;  5M3M H;  1IBL Q;  3BZC A;  3PIP A;  4LF4 Q;  2Q2U A;  2MO0 A;  1C9O A;  2I5M X;  1V43 A;  2IHF A;  1PVO A;  1X6O A;  2LSS A;  5HY6 A;  3Q8D A;  4AYB E;  1VQO A;  5IWA Q;  5C0X I;  1EIY B;  4QJF A;  3K0X A;  4DR5 Q;  1CKN B;  4NB3 A;  2KEN A;  4RG1 A;  3A5U A;  1TWF H;  3CAM A;  5IYB H;  2AWO A;  3CCJ A;  4BY7 G;  3G4S A;  3M3Y H;  1UE5 A;  4L5R C;  4KHP L;  4K0K Q;  1YI2 A;  4DNI A;  4AQY Q;  1X3G A;  1NE3 A;  1EIF A;  2JA5 G;  1LTL A;  1AE3 A;  3KLW A;  5C4X H;  1XMO L;  4A3L H;  4IPG A;  3GTQ H;  2F52 A;  4IJH A;  4EX5 A;  1N33 Q;  1VCI A;  4DV6 Q;  3WWV A;  3KJP A;  2UUB Q;  4JI7 Q;  3L2P A;  1DGS A;  1K3R A;  1YIT A;  1I6H H;  1YEZ A;  1M90 C;  4A3D G;  4YHH Q;  3U4V A;  5C0X J;  4NXM L;  5E7N A;  2K5N A;  1Y1W G;  1CKM A;  1CUK A;  1SRO A;  1Q46 A;  3S1R H;  4R4O A;  4JCV E;  1X3F A;  2BA0 A;  3H0G H;  5LMN W;  2HHH L;  1WCM G;  3HOV H;  3HOZ G;  2Q2H A;  3ER0 A;  2UXD L;  2VUM H;  4OX9 Q;  4JG2 A;  4DR2 L;  4DKA C;  2IX1 A;  1IYJ B;  1L1O A;  1IZ6 A;  1WYD A;  3RLN A;  3KOJ A;  1QZH A;  1K9M C;  3S17 H;  5FJ8 H;  5M3M G;  1N9W A;  2MNA A;  1XNR Q;  1RIP A;  2NN6 I;  4O0A A;  4UP8 A;  4YY3 L;  1VQP A;  3KF8 B;  2A8V A;  1HNX L;  3J81 j;  1UE1 A;  2V1C C;  5GAE C;  1X54 A;  1S40 A;  4C3I H;  4B3M L;  3S15 H;  1PH5 A;  2HHH Q;  2B63 G;  1K8G A;  1H95 A;  2UU9 L;  3CC2 A;  4HJ5 A;  2D0P A;  4GNX A;  1EWI A;  4PMW A;  5C44 G;  3E0E A;  5C3E H;  3TEH B;  1VQ7 A;  4UP7 A;  2Q2I A;  4GKK L;  1EUJ A;  2H5X A;  4BBR G;  4DR2 Q;  1YIJ A;  4A3L G;  3U4Z A;  4GKJ L;  1G6P A;  1S72 A;  1D8L A;  2LXJ A;  5GAG C;  5GAH C;  4O2D A;  3HOX G;  1PH7 A;  3CPF A;  2E2I H;  3GTG H;  2PQA A;  2D62 A;  2RF4 A;  4LUV A;  1HZA A;  4B3S L;  2E5L L;  3KDF A;  4GOP C;  1FJG Q;  3RZD H;  4DK6 C;  1I3Q H;  3S24 A;  1LUZ A;  2IX0 A;  4QY7 A;  3G71 A;  5JJL A;  2I5H A;  2QGQ A;  1C7Y A;  1HR0 W;  1VQL A;  5EAY A;  2PI2 A;  3S2D H;  4A3G G;  3HOW H;  4JI6 L;  3H0G G;  3S1M H;  4JC0 A;  2GVA A;  4A76 A;  5C0X G;  2UUA Q;  3TRE A;  5JJK A;  3I4N G;  1BKB A;  4BXX G;  1E22 A;  4GNX B;  3FHW A;  4APV A;  1SFO H;  1EFW A;  4TQU S;  1VQ9 A;  4B3R L;  2PNH A;  1VQN A;  3KYH C;  2UXC L;  3PF4 A;  2ATW A;  4DAM A;  3ERS X;  2VQF Q;  2MQH A;  1Q81 C;  1N36 Q;  1ASY A;  4LF6 L;  1D7Q A;  2B3G A;  5J3B A;  3W1G A;  4OON A;  4R4T A;  4BA2 I;  1QVF A;  2R92 H;  2OTL A;  1Y1V H;  2EQS A;  2UUC L;  4BY7 H;  4PZ6 A;  3RN2 A;  4J15 A;  1HZB A;  1B7Y B;  1Z47 A;  3W1B A;  3A74 A;  3KF6 A;  5DLQ E;  4UP9 A;  2JA5 H;  1TXY A;  4C2M H;  4C3J H;  5AJ3 L;  1QUQ B;  4LFC L;  4HJ8 A;  1JMC A;  1A62 A;  1KL9 A;  2ASB A;  1HNW L;  1BBU A;  4PZ8 A;  2ZM6 Q;  2YTY A;  1XTD A;  3H3V I;  1FGU A;  4JI2 Q;  2BH2 A;  2F4V L;  4LWC A;  4KI0 A;  1MIU A;  1IBL L;  2D0O A;  4A3D H;  1YZ6 A;  3CP0 A;  2XGT A;  3J81 c;  5BR8 Q;  5ELN A;  3RN5 A;  1QVG A;  5IWA L;  4DR5 L;  2VZA A;  2WAQ E;  4AYB G;  5IT9 c;  2KCM A;  4DUZ Q;  3ULP A;  2WB1 E;  2K5H A;  1WCM H;  1P16 A;  4LF5 Q;  1VQ8 A;  3HOZ H;  2A1A A;  2K52 A;  3HOW G;  3PO3 G;  1UWV A;  2NN6 G;  1WJJ A;  4JBM A;  3GTK H;  3M4Q A;  3D31 A;  2CWA A;  5AJ3 Q;  3NEN A;  4DV5 L;  2I0Q A;  4AQY L;  1XPU A;  3F2D A;  1X9N A;  1B70 B;  3UDF A;  4X66 Q;  2ZTE A;  1E1O A;  3CC7 A;  4DV6 L;  1PH2 A;  1PH8 A;  1JJ2 A;  2ES2 A;  2JEB I;  3W5O A;  4JI7 L;  3RLF A;  3S14 H;  1JJG A;  2JE6 I;  1V9P A;  2WP8 J;  4YHH L;  3F2C A;  3A5Z B;  3L7Z C;  4DR3 L;  3GTJ H;  3CME A;  3H3V H;  2E8G A;  4LUO A;  2HIX A;  4GLX A;  2R92 G;  1NY4 A;  1Y1V G;  1Z9F A;  1KC8 C;  1HJP A;  1J6Q A;  2B63 H;  2JEA I;  4DV2 L;  4GOP A;  2OQ0 A;  1WOC A;  2Z6K C;  3CQZ H;  4NPS A;  5C44 H;  3PO2 G;  1IBM L;  3LGJ A;  4DAY B;  4DV5 Q;  4WJ3 M;  4BBR H;  1PH6 A;  3CD6 A;  4OX9 L;  1N34 L;  1MKH A;  3TQY A;  2Y0S G;  3HOX H;  4BY1 H;  2EXD A;  1SN8 A;  4TVA B;  4DK3 C;  3HKZ E;  1PFS A;  4AH6 A;  3I56 A;  4A93 G;  4JBJ A;  3GDE A;  4Y52 H;  4LF9 L;  1SMX A;  3AYH B;  3K8A A;  4P73 A;  4RMF A;  4JI5 L;  1XNR L;  1V1Q A;  1HNZ L;  2ZTD A;  3EBE A;  2VW9 A;  4DR3 Q;  1SLJ A;  3OTO L;  2HT1 A;  2N49 A;  4L5T A;  4GKK Q;  4A3F H;  1N32 Q;  2BH8 A;  3UE0 A;  1ASZ A;  4A3G H;  2PI2 E;  5H1S E;  1GO3 E;  4DV2 Q;  4L5S A;  3A0J A;  2JA8 H;  3GTM H;  1EQQ A;  1IBM Q;  3HOU G;  4KLK A;  3I4N H;  1OTC A;  1N34 Q;  4QQB X;  2LXK A;  3UDX A;  1VQC A;  1VS0 A;  3PUV A;  4GN5 A;  1I5F A;  3G6E A;  1N8R C;  4DR7 Q;  1JE5 A;  1W2B A;  2E2J H;  2YYZ A;  4DV4 L;  1OXS C;  1XMQ L;  1WI5 A;  4JBK A;  4LF9 Q;  4JI5 Q;  2NVT H;  1JJC B;  4A3B G;  1HZ9 A;  2N78 A;  3EIV A;  1HNZ Q;  4LUZ A;  1SR3 A;  3OTO Q;  3RZO H;  1VQI A;  1FJG L;  3NEL A;  4IO9 A;  2R7Z G;  2RHQ B;  4DR6 Q;  4LFA Q;  2OTJ A;  3CCM A;  1E3P A;  4P74 A;  4PZ7 A;  1VQ4 A;  3PUX A;  1PYB A;  4DV7 Q;  2QA4 A;  1I50 H;  1X3E A;  1E7Z A;  4GLV B;  3JAM c;  4B3T L;  4C3H H;  4MZ9 A;  2OCE A;  4KHZ A;  3CCQ A;  2UUA L;  4JI8 Q;  4POF A;  5C4J H;  4X6A H;  3PUY A;  3STB C;  2R6G A;  4BY1 G;  4DV4 Q;  2I5L X;  2R93 G;  1XMQ Q;  3JC6 6;  3CCS A;  2E2H H;  4HJ9 A;  4YCW A;  2ZJP A;  4IOC A;  5IYD G;  1L1O B;  2VQF L;  3ICE A;  1N36 L;  1Y14 B;  2JJQ A;  4HIM A;  4A3M G;  2K5V A;  2OQK A;  4R4Q A;  2RHS B;  3J81 i;  1CKO A;  4JI0 L;  1TWH H;  4MNO A;  4A3F G;  1K0R A;  1VQG A;  4IJL A;  4DV0 Q;  1A8V A;  3PV0 A;  1PV4 A;  1OXU A;  4B3T Q;  3PO3 H;  4BBS G;  1J5E L;  1CSQ A;  2JA8 G;  1VQ6 A;  3ULL A;  4EQ5 A;  5IP9 G;  4A75 A;  1IBK Q;  1NMF A;  4DUY L;  2ALY B;  2N3S A;  2ZM6 L;  1E24 A;  5LMN L;  2Z6K A;  2KBN A;  4FDB A;  1KRS A;  4A3K G;  3FKI G;  4JI2 L;  1EOV A;  2HQL A;  4GN3 B;  2K50 A;  4JBW A;  4OO1 I;  1A0I A;  1K8A C;  4UY8 C;  2VQE L;  1VQB A;  4JV5 L;  1AH9 A;  3K7U C;  4A4I A;  2EIF A;  2PQA B;  5BR8 L;  2NZH A;  4JI0 Q;  5HGQ A;  3KDF B;  1LYL A;  4DUZ L;  1PH4 A;  4GLA C;  2WAQ G;  1PHJ A;  1OXX K;  4BXX H;  4LF5 L;  1J5E Q;  2KCT A;  3PO2 H;  2CCZ A;  4A3C H;  1KRT A;  2JK8 A;  1G29 1;  1XNQ L;  5M5X H;  4DUY Q;  4JI3 Q;  4R1J A;  2GVB A;  4X66 L;  1FL0 A;  5LMN Q;  1YHQ A;  1Q7Y C;  4A93 H;  2VS1 A;  1KQS A;  1KXL A;  2YTX A;  4LW1 A;  2AKW B;  3AEV A;  4NXN Q;  4JI1 L;  2VQE Q;  4JV5 Q;  3TS2 A;  4R4C A;  3M85 A;  1E1T A;  4DV3 Q;  3AQQ A;  3SGI A;  1QZG A;  1TWA H;  3GTO H;  1C0A A;  5IYC H;  1I94 L;  2FXQ A;  3HOU H;  3I4M G;  3ULJ A;  1XNQ Q;  1Q1B A;  3B6Y A;  2CFM A;  3K7A H;  3OYY A;  1YJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...