1SNDA

Staphylococcal nuclease dimer containing a deletion of residues 114-119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE DIMER
publication title One-step evolution of a dimer from a monomeric protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sndA00
4I65A 3S9WA 5IODA 4IALA 2EYJA 2F0FA 3T16A 4KHVA 2OF1A 4S3SA 1EY4A 5I6YA 1EYCA 1STNA 2PYKA 3PMFA 5CV8A 5JOBA 1EY8A 3R3OA 3OMCA 3LX0A 3P75A 2F0KA 1STYA 4EVOA 5HURA 4K2KA 3EVQA 1KAAA 5IGFA 2NUCA 4KD4A 1SNQA 2F0GA 2F0EA 2ENBA 4J6HA 5E3FA 1EY5A 1SYCA 2PZTA 5IIFA 3RUZA 4NMZA 3TP7A 1TQOA 2F0OA 2F0VA 2KHSA 4DU9A 5CV9A 3ITPA 1STBA 2F0JA 2F0SA 4LAAA 4N9TA 4F8MA 2RDFA 1EQVA 5KEEA 4K8IA 3OWFA 3NK9A 3EJIA 3D4WA 3SR1A 4KJNA 3V2TA 2EYOA 3MZ5A 1TT2A 4R8NA 4PNYA 2EYPA 2SOBA 5CV5A 2F0NA 5HGTA 2F0WA 4WORA 2SNSA 5I6WA 1SYGA 5IOCA 1JORA 3P1HA 1A3TA 1JOQA 4WRDA 1EYAA 1AEXA 1NSNS 2EYHA 3NHHA 4HMIA 4HTHA 4EQNA 4K5XA 3VA5A 4B9XA 2EYLA 2F0PA 5C4ZA 5CV7A 2F0LA 2EY5A 2SNMA 2F0HA 3MXPA 4KJOA 4NDXA 5C5MA 4E6IA 1EY0A 2F0QA 3NQTA 5EKLA 3SK6A 4K6DA 5C4HA 2F3VA 1EY6A 1SNDA 1JOKA 3MVVA 3NXWA 4ID6A 2PW7A 3EROA 4NP5A 5C5LA 4EQOA 5KGUA 2QDBA 1RKNA 2KQ3A 1IHZA 3ERQA 3OMGA 4N9PA 2HQEA 3TP6A 3NP8A 4DF7A 5ISRA 1SYEA 3SK5A 2LKVA 3C1EA 1EY9A 3H6MA 4KV6A 3D6CA 4KY6A 5IGDA 4K2LA 5K5PA 2RKSA 5KYIA 3D8GA 4H7BA 1A3VA 4QMGA 5I9OA 2EY1A 1A2UA 2EYFA 2F0MA 4OL7A 1SNCA 2EXZA 4EQPA 1KABA 5C6AA 4ZUJA 3E5SA 4QB4A 5DAUA 1KDAA 2PQEA 5IGCA 4K14A 4KD3A 4QF4A 1SYDA 5KRUA 3SK4A 3NUCA 5DEHA 2F0TA 3HZXA 3BDCA 5CC4A 5J1ZA 5E1FA 4ODGA 5EKKA 5C3WA 4RKBA 2F0UA 5IGGA 1F2YA 5CV6A 5KYLA 4B9WA 4ZUIA 1F2ZA 5CGKA 1F2MA 5EGTA 3U9OA 3C1FA 5JAVA 1II3A 1A3UA 4ME5A 1NUCA 3T13A 3TP8A 5IGEA 3SK8A 1STHA 2OEOA 4KY7A 5NUCA 3BDLA 1EZ6A 4DFAA 5CR3A 5I9PA 1ENCA 4PMCA 2F3WA 4NKLA 4F7XA 1EZ8A 1KDBA 4KTAA 4KY5A 4J1MA 3MEHA 1SYBA 2PZWA 4DGZA 5M9OA 2O4XA 3D4DA 3MHBA 4K8JA 4TRDA 4MIUA 1TR5A 4G57A 4YIJA 2PZUA 1SNPA 1STAA 5F2DA 4K5WA 1A2TA 2RBMA 3QOLA 3SXHA 1U9RA 3OSOA 3TMEA 5C3XA 1ENAA 2OXPA 4ZQ3A 2EY2A 4IUNA 1KDCA 3QB3A 4RKLA 1SNMA 5KIXA 4IZ8A 4K5VA 1EYDA 1SYFA 2WACA 2EYMA 5CV4A 2F0IA 1JOOA 3QOJA 1STGA 5J22A 5IGBA 3DMUA 3DHQA 1SNOA 3HEJA 2EY6A 5J39A 1EY7A 4PMBA 3TP5A 3SHLA 2PW5A 2F0DA 2M00A 4HMJA
chains in the Genus database with same CATH superfamily
1NE3A 5IODA 4G7ZC 1TWFH 1HNWQ 3M7GA 1PTOH 4X62Q 5M3FH 1FL0A 3A74A 2KEEA 5JOBA 1EY8A 3I4NH 3JAML 4EVOA 1CHPD 1H9MA 1BDOA 1WYDA 3CC4A 5LMUL 3KUPA 4OONA 1WFQA 1N34Q 3RZOB 1SYCA 1CA5A 1YZ6A 4NMZA 4K0KQ 4JOIA 4YWKA 2I0QA 2QDLA 3K5NA 2BE5D 1JWSD 3K5OA 1G91A 4KJNA 2ID0A 2QKIC 1QZHA 3BG3A 2LMCB 3D6WA 4B3SL 1A3TA 1EYAA 1X54A 5K36G 3AFQA 3GTGH 4FP5D 4F88A 4DV3L 1PH1A 1TKWB 5HY6A 2MQHA 3FVQA 1M90C 2PCFB 2BDOA 3M4YA 4GN3B 3R2TA 3ERQA 1F9RA 2B2YA 4KV6A 1VF7A 2L12A 3J80L 1BXTA 5EKIA 1VQ4A 4H02A 1A2UA 2KCMA 4JI6Q 1O80A 3K80C 1Q86C 2D5DA 3S2HB 1U4LA 2JEAI 5LMNW 4JI4L 4XQQA 2RVLA 2E5LQ 3Q0AA 4OHJA 4DK1A 4RAUC 3NSWA 4ODGA 1BBXC 2ZJPA 1HNZL 3X3NA 4LW1A 4QJFA 1O78A 2MJ8A 1CA6A 4RGOS 3E0EA 4BXXH 3T1HL 3RR5A 3PUXA 4AYBB 1N36L 1EWCA 1DOKA 1G2SA 1QWYA 4JG2A 3TZDA 4JI1Q 1NMFA 3S1RH 1Q12A 4TRDA 3F1ZA 4MN3A 4G57A 3TREA 4IUPA 4DR4L 4R1JA 3K8AA 3J81c 2VQFL 5FLMG 1A2TA 3K57A 4J15A 3BU2A 4HCSA 2NB0A 4A3IB 4BWGB 4OWXB 2Z8LA 4A3JG 1IW7C 2M2LA 1X32A 4U673 2C35B 1IBMQ 2QILA 2V4DA 3DMUA 4A75A 4PMBA 1LT4D 2B63B 4I7ZC 1LV9A 5C3EH 1XNRQ 3S9WA 1O7ZA 2K5HA 4AYBE 1HNXL 1V1OA 3S15B 2DY8A 5CV8A 4OGQC 3LNNA 1PH7A 2RDHA 5HURA 3I3CA 1VQNA 4KD4A 2OQ0A 1HR0L 4C3IG 4A3KH 2NVXB 4YHHQ 3I4LA 4BY7B 1CQVA 3HOXB 5CV9A 4A93G 1STBA 2F0SA 1S40A 3FHWA 3HRZC 2QF7A 3H09A 3EFXD 4IPDA 4CJ0B 2ICEC 1EU4A 2AUJD 4A3EG 4P72A 1B70B 1CZGA 2BH2A 3BYTB 4A3DB 3FRPB 4DNTB 4B9XA 1XMOQ 1CHQD 5C5MA 1AZQA 2F0QA 3HKZG 1DGSA 3EROA 4A3GH 3M4PA 3HOWG 1X3FA 4XQJA 1IZ6A 3MWYW 4KN4C 1OXUA 1KHIA 5K5PA 5FKAC 2BE5C 2RDGA 3QO2A 2PNRC 1GVPA 1V43A 5DEHA 3JAME 2F0TA 4TSSA 5ELFA 2ZJRA 3J81L 1B44D 1KC8C 4RKBA 5IGGA 3M85A 5CV6A 1UUPA 3AFPA 3HOYH 3HOVG 1VQ9A 1I6HH 1OTCA 1S5CD 4IURA 4DAMA 3K5LA 5EPJA 4XT3B 1E0BA 1STEA 1TWCH 4DV5Q 4JI8Q 1CTMA 1KRSA 2HCCA 3GTJB 3Q22A 1HZBA 4B3RQ 1VQKA 2DGYA 4JK1C 4CHTB 1LO5D 3CHBD 4IFDG 1ENFA 4DR7L 5F2DA 3X3MA 2PPBC 1ENAA 5C0XG 2WKDA 5DM73 5C4XB 3PV0A 3S1NH 5BN5A 4N8FA 1EEID 1DOLA 2A69D 1PDQA 3A5UA 3QOJA 1WTVA 3G6JB 5ELOA 1SXTA 1PFMA 2EJFC 2F1MA 2HIXA 3LGJA 5KYLA 3J80E 1UNSA 3OHXC 2WINB 1C48A 2AQ2B 1GOZA 4DR1L 4L8JA 3W1GA 1VQAA 1YBYA 1YHBA 2LY7A 2R6GA 1PH3A 1MD2D 1QJOA 1NAPA 5D14A 3KOJA 4O1NA 5FO9B 1B4OA 3K59A 2NN6H 5E3FA 3BYYB 4ZLTF 3D0FA 1EUJA 5IYDG 3PO2H 4Q0FA 2YTXA 5BR8Q 1A0IA 3UE1A 3GTMH 4A3BH 4K6LA 5IT9c 4A3CG 1GKHA 5D65A 2VB2X 4FXGC 1PFBA 1JORA 1HRJA 1NNXA 4RGNA 3L2PA 5EPLA 5LMNQ 3NHHA 2BA1A 1HTPA 2NN6I 1JWUD 4RCOA 3A0JA 4UPAA 5JEAG 5C4HA 1WTQA 2RF4A 1K0RA 4DUZL 4JW0A 2K32A 2EIFA 2CH4W 1HFGA 3TP6A 1XNQL 3H3VI 4CDDC 4UP7A 1PTOF 1FD7D 2EYFA 4HEDA 1ET9A 3C3LA 3E3XA 2XN9C 4GNXC 2I07B 1K83H 1PYWD 1CKNA 1ZKOA 2CHBD 4X66L 1TWHB 4DXGA 3I70A 1F2YA 2JA8B 1V1PA 4ZUIA 1GXDC 2PI2A 5EGTA 3S17B 2F52A 3WDNA 1HTLD 3D4RA 4DV7Q 5JJKA 3BJUA 3M3YB 1PLFA 4YCVA 2JQOA 1JB3A 2F3WA 3IKJA 4MZ9A 4KTAA 2YYZA 1HUMA 5EBCA 3RNUA 1XMQL 2CFMA 4LFAL 2XWJB 5C0XJ 1SBBB 4GOPA 3FKIB 2VL6A 2RBMA 3SXHA 3KF6B 3GTPH 4AYBG 2OXPA 3KBXA 3GTQB 4JYAL 1JJCB 1EFWA 1B1ZA 5CV4A 1HQRD 1WTOA 3W3AA 5J22A 4XQNA 1QVGA 2EY6A 1LTRD 1N32L 2EXDA 4JBKA 1IBKL 2AQ3B 3CQZH 4I65A 2EJGC 5IT9L 3BDOA 5I6YA 4A3IG 5M5WH 3S2DH 2F0KA 2L11A 2A6ED 4J8QA 4K2KA 1CKNB 4FVMA 1KAAA 4GLXA 2R93H 1V1PB 2J0TD 3N6RA 3J81E 1W6JA 3A8IE 2B63G 2B2TA 3CRKC 2PNHA 3U58A 4KKUA 1JMCA 2E76C 3MTSA 5A35A 2DN8A 4RGMA 2SEBD 2A69C 3A8KE 4RHSA 3PO3H 5I6WA 5C44H 4ME3A 5KNDA 2OT2A 5JEAJ 2KJXA 1HA6A 4GOPB 2EYLA 4BY7G 1FJGQ 2EY5A 3HOXG 2QA4A 3SK6A 3NQTA 4DR2L 1O7IA 2D2CC 5C5LA 1AZPA 1LTSD 2EVBA 3M4OB 4JBMA 1KAWA 1IHZA 4YCUA 1VQ8A 2YU9H 4LF8Q 4A3DG 2PI2E 2R7ZB 3D6CA 5KYIA 1IBLL 2XVSA 3HKSA 4H7BA 1A3VA 2IX1A 1DYQA 3VA7A 4R4TA 2LFNA 4IOCA 4X62L 1D5MC 1I94Q 3OIPA 4FXDA 5FJ8G 3SK4A 2NWGA 2KOLA 4XTCS 5EBDA 4DV6L 4DR5Q 1HZCA 2K33A 4LF7Q 4IUVA 5CYUA 1EIFA 4V0BA 4ZK9B 1N34L 1CKOA 2D0PA 1XPUA 1A15A 3RZDB 4R4IA 3T56B 4A3FB 1X3GA 1P8LA 1STHA 2F03A 4LJZC 5H1SE 1Y8OB 1BCPF 3DWPA 2EDGA 1E22A 4DGZA 4BBRB 4ZKBB 3TBIB 5BN3A 4LF9Q 5FOBB 1EWHA 2RA4A 3A7LA 3RN5A 4ZYSA 5EQ0A 5C3XA 2VW9A 4ZQ3A 2V1CC 4JI0L 3GTOB 3CF5A 1ZXTA 1EYDA 4O42A 4JOIC 1LABA 1U4RA 2IL8A 3KLSX 4OWWB 2UXDQ 4A3MB 2PW5A 5E1FA 4LUOA 1CFMA 3I4MH 2B29A 2OF1A 2K01A 3S16B 5C4XG 4OO1H 3OMCA 1L0XB 2KCCA 4HIMA 4B3MQ 2E5LL 1YJWA 3TP7A 2F0OA 1Q8IA 1Y8NB 3TN2A 2I5LX 4K8IA 3OWFA 4HSPA 5KNBA 3AQQA 1Q90A 3VR5A 4OO1I 2LS01 4JI1L 3WOFA 1VQFA 2EYHA 3C46A 2DJFC 4HMIA 3CW2C 3J81j 2P5ZX 1GUSA 3AYHB 2Y0SB 2ZTEA 1X6OA 3GQBA 1YNJC 1FR3A 2A6EC 2F4IA 1IYJB 4G4KA 3NTKA 3NP8A 5M5YB 1V9PA 1QZGA 3VR4A 3DM1A 1E2VA 4M1UB 4FF1A 3NBIA 1VQEA 1VQBA 3TEHB 1XNRL 2B39A 5IT9E 1D5XC 3A5ZB 2Z4HA 2A68D 4LF5Q 3UDIA 4LF6L 1OXSC 1ICWA 1AN8A 4JI3Q 3P20A 2F0UA 2K5DA 1MJCA 2Y0SE 2UUBQ 5JAVA 4YHHL 1Y1WB 1EWIA 3I7FA 1YITA 3SK8A 5FLXL 1LACA 1VQ7A 3CCVA 4IJLA 3TZUA 1TWFB 5M3FB 4BBSH 3RLOA 3ERSX 3ND9A 1PZJD 3HKZE 3QR8A 3I4NB 4K8JA 3NE5B 2JA8G 4ZCKA 1Q1BA 2WFWA 3F2BA 1C7YA 1SNPA 3CCRA 3OOCA 4K5WA 1XMOL 3NTIA 1LTID 2A74C 2VQEQ 3Q23A 3Q24A 5IWAL 1SYFA 1BR9A 1PXUA 1U0LA 4XIGS 1KNEA 2JSOA 5GROA 1N8RC 4UHVA 3FKIG 2CQAA 4OIKA 4C3JH 5EKKA 3H3VC 2K6AA 1GUTA 1ESFA 1TS3A 3EN2A 4IQZA 4EGVA 3P7JA 2QEXA 1MBYA 3GTGB 4C56C 5TSSA 4LNQA 2JP1A 3J7A5 3L0OA 1YIJA 2F0GA 2JN4A 4RA8A 3MEFA 4DR3Q 4PMWA 2RCNA 4DV1Q 1WTRA 1FNWA 2F0JA 3JAMi 2CW0D 3MFYA 1A62A 4PZ7A 2G5DA 5J3BA 3NK9A 5ELCA 4ILWA 1ASYA 1A6XA 2F0NA 4JI8L 1QNKA 3WWVA 1NSNS 2L15A 5C4ZA 1L0WA 5D3DA 3A8JE 3GO5A 1NCVA 1VQJA 2XNAC 3MFGA 1FVIA 5EKLA 5JPMC 1JOKA 2R61A 1KL9A 3MVVA 4ID6A 4PZ8A 3RLNA 1D6EC 1AFPA 4N9PA 4HJ5A 1PH6A 3S1RB 1CI3M 2VB3X 4CKBA 2F4VL 3PCOB 3U9SA 3G7LA 3CP0A 3J80i 4WJWA 4R4QA 3FP9A 4LFCL 2HUGA 2R7ZG 3H0GH 1HHVA 2A73B 2Q2UA 3PQIA 5C3EB 1VDZA 4IJHA 5BR8L 3BDLA 4NPSA 5COYA 2UU9Q 1B53A 3M9BA 3G4SA 2WAQB 3ER0A 5LMNL 4BY1H 4A3KB 4A3FG 4XT1B 2NBFA 5AJ3Q 1S5DD 2A68C 2EY2A 2KEDA 4DV0Q 1ICFB 1J5EQ 1IL2A 5GQOA 1RF2D 4BBRG 1FNUA 3DXJC 4FNFA 3CAMA 5E7NA 1DJRD 3F2DA 3TP8A 1Q8KA 3T16A 4JCVE 3IRBA 4Y7NH 1YEZA 1OO9B 1EYCA 3OYYA 4JI7Q 2F0EA 2WAQE 3CCEA 4P75A 3EA6A 1N33Q 3I56A 1YI2A 4A3MG 1AW7A 4EX5A 3VYUA 3CMEA 1HPCA 4RH6A 1OXTA 4ALPA 1PRTF 5FLXE 4DV7L 1KD1C 4HR7B 2AKWB 2EYPA 1XJVA 1JQYD 1JOQA 1JT8A 5E4WC 1W2BA 1I4PA 1LTLA 4JC0A 1X9NA 2YTYA 2WIIB 3W1BA 3HOYB 1EY0A 1LT3D 1LUZA 1I6HB 3VDYA 2M9VA 5A2QL 4AQYL 3TS0A 1I4GA 1TWCB 5L37A 5JJLA 3UDGA 1BO0A 1SYEA 1TY2A 4LFBQ 1WCMH 2RKSA 2VNUD 3D8GA 2JEBI 3PIPA 2CW0C 2JA7H 5ELEA 1WD0A 2Y0SG 2QW7A 2MO1A 4OL7A 1RTNA 4DUYQ 1CQFA 4ZUJA 1PHJA 1ESRA 2PO4A 5IGCA 4DPGA 1H9JA 1I4RA 1XTCD 4YY3Q 2JA5H 2AWNA 3ZYYX 1G51A 3AB9A 4GOPC 3S1NB 2UXCQ 4DV2Q 3A54A 1NUCA 3PUYA 4A3LG 4OELB 3MXGA 4B3TQ 1HA5A 1EZ6A 3GTKH 1PTOD 3KLSA 2HHHQ 2PZWA 4XYOA 3RN2A 1NR2A 1BOSA 3I8ZA 3NELA 2R92H 1F9QA 4X3UA 1STAA 1Y1WG 4R9WA 1XPOA 3KLRA 2E2HH 3PO2B 4P2CB 4HIOA 3NWTA 5M3FG 4N8X1 2B2TC 3GTMB 4IZ8A 4QQBX 3VYTA 4A3BB 1CSQA 3I4NG 1LLRD 1VQDA 4MTNA 4LF8L 5J39A 1SSOA 3SHLA 3OW2A 3ITPA 3IFTA 1G2TA 3A56A 3NBHA 2N78A 3P75A 4DAVA 3KJOA 1Y69U 2A5HA 3K7AH 2LXJA 4KKSA 1PV4A 1J8IA 3I55A 1I4XA 4CDCC 1VMCA 3K5MA 4LF7L 1D8LA 1Q3LA 1KRTA 2Z6BA 1PFSA 3RUZA 3QG1A 3DWQA 2KHIA 3I4OA 1LTGD 1MI2A 4LF4Q 1BF4A 4MHEA 3VR6A 4C2MH 3DEOA 3EBEA 1V1QA 2FMMA 1WI5A 4IPCA 2F0WA 5IYCH 1G6PA 1Z7TA 1K83B 4GLAC 4P73A 4K5XA 4LF9L 2RHSB 2JK8A 4NDXA 1B7YB 1WJJA 3PIOA 1TWGH 3MAQA 1TS4A 3S1MB 2B2UA 4K6DA 4X3KA 3GV6A 2IWHA 4YWLA 3NXWA 5IP7G 2Z4IA 4GKJL 4X3SA 4TKOB 3PIP3 4NXNQ 2LKVA 2BA0A 1EY9A 1Y1VH 2JYOA 4B3SQ 5IYBH 1K9MC 2EY1A 3NBHB 1X3EA 1K8AC 4BXXG 3KYHC 1M1KC 2PQEA 4DV3Q 3GTPB 3CCQA 4QF4A 1VQLA 2G9DA 3S24A 3PUZA 3EIVA 4B3ML 1X56A 4C3HH 1O7LA 2AHOB 2AMCB 3OTOQ 3CPWA 3E0JA 3CQZB 1F2LA 2K04A 3T1YL 3U4VA 1FGUA 3ICEA 5M5WB 1GJXA 4OXPA 2KA7A 3S2DB 4JI4Q 1VQCA 2AWOA 4YIJA 2R93B 3A55A 1ILQA 1K3BC 1OXVA 4DXFA 3IL8A 1CUKA 2J7ZA 5C3EG 2QEJC 5A2QE 1J6QA 3I90A 5JPNC 5KIXA 2VUMH 4K5VA 1KXLA 2KUMA 2PMZB 4DR6Q 3G48A 1SDFA 2F0IA 1N36Q 3PO3B 1E7ZA 1STGA 2Q2HA 5IGBA 3NWSA 2WAQG 3QJYA 2GVBA 5C44B 2L1BA 4U68A 4A3KG 2X6LA 1PTOC 4F87A 1NY4A 2DNCA 4OX9Q 2JE6I 1EY4A 2IY5B 5CMDA 4FDBA 3AMUA 2WB1B 3LX0A 1AE2A 1XYIA 2UUAQ 4XXEA 2ZM6Q 2YU9B 4JI3L 3SDZA 2MP1A 1QUQA 3HOZH 4GLVB 4DU9A 1YNND 2ZXPA 1SJHD 3BVZA 2RDFA 4OIJA 4X65L 4POFA 1ZYRD 2L0CA 2KENA 4DA2A 3V2TA 3MZ5A 2PMZE 4PNYA 1SMXA 5M3MH 1SYGA 1Z9FA 4JVZA 2C9OA 1X65A 2NVTH 1WTPA 1I4HA 3HOUH 1IL8A 1YNJD 2NYZD 3MXPA 4KJOA 2E2DC 5FO7B 3F2CA 1QVCA 1XXGA 2H4OA 1LTTD 1R9TH 1GO3E 2PW7A 1GUWA 1VMPA 1JICA 4DF7A 1RODA 2HQEA 1SJED 2EE1A 2CCZA 4K2LA 5JVH3 2JA9A 1AE3A 3HOYG 1P16A 1HXYD 4JI5Q 3V05A 2MPMA 5DM63 1SNCA 2EXZA 1XWEA 4QB4A 4G7OC 4KHPL 4RG1A 4KD3A 3KLWA 3TSSA 1UAPA 1WOCA 4IOAA 3NENA 1LYLA 1KTKA 1QUQB 3WOEA 4POGA 4L6TB 1K28A 1II3A 1A3UA 3T13A 1UEAB 4DV1L 3QIAA 1QE6A 3L3OC 3S17H 1DM0B 3I4MB 5KNCA 4BA2I 2AUKA 4J1MA 2L9HA 2NZ1D 4CKEA 1SE4A 2PZUA 1HNWL 3DUZA 3GV3A 4QL5A 1MSGA 4UDUC 1U9RA 1HJPA 3UE0A 3PUVA 3QB3A 4AH6A 1Z6HA 2PQAA 3H15A 2NZOA 2EYMA 4PQXA 4R4OA 1TWAH 5M5XH 4K0KL 1R4PB 4A4IA 1ASZA 3DHQA 2JA6H 1YVCA 2NN6G 1E1TA 2F0DA 3KF8A 4L5TA 2RSNA 3IAYA 4S3SA 3PO2G 4GS3A 3R3OA 2O2LD 3W5OA 4JBWA 1JE5A 4A3BG 3TQYA 1VQGA 2ENBA 2K5QA 1VQHA 2N49A 3H91A 2F0VA 2NVQH 4UAIA 2HDLA 3BVGA 2Q8IB 4Q5VA 3PF4A 1E1OA 1PA6A 5G3LD 2IHEA 1RDPD 5HGTA 3PUWA 1A63A 4CJ2C 1K8OA 4GZYC 3P1HA 4HIKA 2UU9L 5T1GA 1I3QH 3R8BA 1AEXA 2WKCA 1SFOH 1RD9D 2F0PA 4JI6L 1NMGA 4XYQA 3OPOA 3NEMA 5I2XA 1B9MA 1NR4A 2PQAB 1TU2B 2CVRA 1VS0A 5IY0A 2OTJA 5K36H 4WJ3M 4H13C 1DOMA 3L7ZC 3GTLH 4BBSB 4IPHA 1YNNC 3KF8B 1TY0A 2XIWA 2E8GA 2GVAA 1ZYRC 1K8GA 3CCUA 2L55A 3STBD 3GDEA 4K14A 2X6GA 3HZXA 3V96A 2HCIA 5CBAE 2XRQD 1SRUA 1JJ2A 2K4KA 1XNQQ 3SVMA 1VQ6A 3U9OA 2K5VA 1K8MA 1N33L 1X55A 1UE1A 4HJ8A 3OWEB 4C3JB 2N8NA 1B8AA 4HN7A 2Z6KA 3I91A 5CR3A 5HGQA 4GN5A 1G6ZA 4KI0A 1IBML 2XSCA 2NTSA 1YNXA 3F8TA 2EJMA 2CWPA 1GUNA 2YTVA 1EL0A 2X69A 4BBRH 2RHQB 4H44C 4CKCA 1VCIA 3T53B 2DJGC 4FYDA 5I4DA 1I50H 3M7NA 1JWMD 3UI2A 2HDMA 3HEJA 3CCSA 2R93G 1EY7A 2ZXRA 5FLMH 4LFBL 1O7YA 1PTOB 1T5XD 1XMQQ 1JC7A 1HQMC 4QCLA 2JXMB 4A3MH 4IPGA 4FF3A 1Z47A 1CK1A 2KECA 1S5FD 1RJTA 4A3JH 4ZRZA 5JJIA 2ZJQA 3CPFA 1NBWA 5IGFA 5FO8B 2NUCA 4YY3L 3PO3G 2E2IH 2WP8J 5C44G 2PZTA 2UXCL 4DV2L 1SMYD 1A8VA 4LAAA 1HFNA 1IBKQ 1CSPA 4HJAA 1QOHA 2BDNA 3SR1A 3S1QH 3HP3A 1DD2A 3I2ZA 4GKKQ 2UXBQ 4C3IH 3G6EA 2B2WA 2L4NA 4A93H 2ALYB 2F0LA 3KDFA 2A1AA 2F0HA 3H0GB 1WD1A 3MXUA 3K58A 1D2BA 2Z1CA 1L0YB 3S14H 3UDFA 4A3EH 4JPBW 1FGBD 2G9HD 4CBVA 4DNRB 1XX8A 3SK5A 1QCBD 2FFKB 1W6KA 5IGDA 4KMUC 1YHQA 2BH8A 1R4QB 1DONA 4UP8A 2Z9HA 1WTWA 1PYSB 4DV5L 4BY1B 1EQRA 1JR0D 1Q7YC 4Y52H 1KABA 5DAUA 4B3RL 4YCWA 3KBGA 3HOWH 3KFUA 3HFZB 1MKHA 1SYDA 1WVLA 2CWAA 1G8ZD 5CC4A 5J1ZA 3O13A 3ZJYC 1OXXK 1TS5A 2KHJA 1PMRA 3K6OA 4PZ6A 4ME5A 2IX3A 4V190 4CJ1B 1IBLQ 5C4JH 1J9OA 2A19A 4DFAA 1QG7A 2D9UA 4PMCA 4Y7NB 4LF4L 5LL6X 1EZ8A 4KK7A 3LWUA 1B3QA 3MXNA 1KIXA 3HOVH 4DV6Q 3KJPA 3KDFB 2K75A 2NVYH 1T5EA 3LWEA 2K28A 1YJNA 1VQ5A 1GUGA 4LK1C 3STBC 1IYUA 3I4MG 2SDFA 1RIPA 4OO1G 2QCPX 4DV4Q 4IFDH 4NW2A 4IN3A 4NXNL 4LUZA 4NXMQ 3KK7A 1GD7A 3U4ZA 2XRSD 4CGYB 5C0XH 1D1IA 1H9RA 4KLKA 3E6ZX 3Q6SA 3ND8A 3U50C 2H5XA 3EVQA 5FK9C 1ONLA 2IW3A 4JI0Q 4GN4B 4IFDI 2B2UC 5IIFA 1I4QA 2MNAA 4RFBA 4MNOA 1LM0A 1WCMB 1RTOA 1BCPB 2JA7B 2MO0A 5KEEA 3CMAA 3OTOL 5C0XI 4QUFA 3EJIA 2E2JH 4CDEC 3MXNB 3J7ZC 2B2VC 3FPPA 5IP7H 5DNFA 2JA5B 1MHWC 1CKMA 1YHAA 5IYDH 1I6VC 3VYSA 1HZAA 4RWSC 2FXQA 3K0YA 4ZKCB 1MJEA 2BOSA 4A3CH 4A3GB 2E74C 5KGUA 2XGTA 3DWAA 3GTKB 1MSHA 3RZOH 1AH9A 2KCTA 1EOTA 1S3OA 1SMYC 2MUYA 1HH2P 2YV5A 1X3PA 3C1EA 5AFWA 4DR6L 1TS2A 2K5WA 3ULLA 5JEAH 2R92B 4QMGA 1PVOA 4DN4M 2AQ1B 2B8GA 3Q8DA 4EQPA 3DLLA 1EIHA 3E5SA 4OX9L 4IUQA 2IJ0A 1KDAA 2E2HB 5KRUA 3NUCA 1PZKD 4BBSG 2UUAL 3RD4A 1G291 2A6HD 4P74A 2ZM6L 3AU7A 1TVXA 4HCEA 1IYVA 2Q8RE 1I5FA 4DK3C 3SGIA 2J4XA 2FMCA 3NPPA 2Z0SA 1PRTC 3VYRA 1IXRA 1ENCA 2ASBA 1E3PA 2GA4B 4HAEA 4KY5A 2EQSA 4EQ5A 2O4XA 3D4DA 3K7AB 2ATWA 4LF6Q 5EJWA 1VQPA 1L1OA 4QIWB 4AIMA 3OSOA 4C3JG 3S2HH 1JCKB 2DY7A 1HR0W 1M8AA 1SAPA 1EEFD 3MA2B 3J7AF 1SEBD 2HIVA 2Q8TA 4C2MB 3D31A 2H1EA 2OQKA 1VQIA 2K05A 4QUCA 1ZEQX 4HSVA 3J81i 1KQSA 3HG9A 3CC2A 2XWBB 1TWGB 3RMHA 4JI5L 5BN4A 5GADC 3A7AB 1STYA 3MC0B 3T51B 1QILA 5IP9G 5ELBA 1FJGL 3BS1A 5IWAQ 2ZTCA 1GHKA 4JV5Q 1Y1VB 3QWNA 5IE8A 4QIWE 4A3IH 3TRZA 1LTAD 1V8QA 1E2ZA 1FYCA 4XDXA 2K7VA 2EYOA 1ML0D 1Y8PB 1EYGA 4RGTA 2B63H 2Q2TA 3TS2A 4HTHA 1D7QA 1DXMA 1L1OB 2EPBA 1W3SA 4E6IA 4P71A 3S15H 1I94L 1B9NA 1PFNA 1K73C 1SROA 4C3HB 1EY6A 4DR5L 3CKIB 4NP5A 2ICIA 4JI2Q 2UUCQ 1F9PA 1RKNA 4DAYA 4X6AH 3R93A 5ISRA 4X64Q 2NVXH 1IKLA 4BY7H 2D62A 5DLQE 3HOXH 3FMCA 1TXYA 3H0GG 4APVA 2VXWA 3VR2A 1K3RA 3GD7A 1SN8A 5LMUQ 4A3DH 2VUMB 1EIGA 2N55A 4B9WA 2OCEA 1F2MA 1N9WA 1K0SA 4BY1G 2OEOA 3J7AV 4KY7A 1U4MA 5I2YA 5FJ8H 1VQOA 2F4VQ 1C0AA 4DKAC 5D3IB 1RHPA 2B2VA 2JJQA 4IUUA 3MEHA 2UXDL 2Q2IA 5CORA 1MGSA 2MGSA 3CCJA 2FHTA 4LFCQ 2HT1A 2B8FA 4FF2A 1PYBA 3HOZB 2LSSA 3K0XA 3ONAB 2GN5A 4DAYB 2OTLA 2A6HC 4KHZA 4IO9A 1E24A 3NQIA 2ZT9C 1F9SA 5M3MB 4ABNA 2NVTB 4BS9A 4DK6C 3H3VH 3HOUB 2EYJA 2F0FA 4JBJA 2OWOA 4KHVA 3L9AX 3GTJH 3PMFA 5ELDA 4R8IA 1LTBD 1R9TB 4O0AA 1BKBA 3CU7A 3KF6A 2D0OA 1HNZQ 1QB5D 3T1HQ 1RCVD 1S72A 1BCPD 5C4XH 1PH9A 2WV6D 3AEVA 4R8NA 5GAGC 3H94A 2SOBA 4WRDA 4DR4Q 1BQQT 4C1NK 2IX0A 4ZAIA 4EQNA 2VQFQ 3VA5A 2C5CA 5CV7A 2SNMA 1WCMG 1JE4A 2JA7G 3VR3A 4LF5L 2EOTA 4EQOA 3S1MH 1JJGA 2KQ3A 3OMGA 4UP9A 1BNZA 3IFDA 2JA5G 2UUBL 4Z9CB 4IFDJ 3H6MA 1C9OA 3SEBA 2B3GA 2TMPA 2Z6KC 3CCMA 2I5HA 1HNXQ 1YJ9A 2K1BA 2DNEA 4WFN3 5C6AA 4A3GG 1QNUA 3M4QA 1H9SA 3PIO3 1D5ZC 3I72A 4CDFC 3BDCA 1HR0Q 4AQYQ 1MIUA 4WJ4A 2E75C 4LUVA 1CZWA 2WB1E 1TWAB 5M5XB 3ULPA 2CH4A 2VQEL 4OWTB 3C1FA 2R92G 2R7FA 2JA6B 3BZCA 4FO2A 1PRTB 4HJ9A 5NUCA 1U4PA 1DCZA 5I9PA 3G71A 4O2DA 4TVAB 1KDBA 1S4ZA 3ULJA 2RSOA 1E2WA 4GKKL 2UXBL 3E9HA 5E4XA 1EOVA 1Q1EA 1XTDA 2VY3A 1KLGD 1EIYB 2NVQB 2ZXOA 3PGZA 1KDCA 2I5MX 1SNMA 2LXKA 4DR3L 1TWHH 3C2PA 3CXCA 4HJ7A 2JA8H 3BZKA 1JOOA 3HGBA 4FXKC 1EQQA 3W2DA 3JC66 1I3QB 2ZTDA 4HMJA 3M3YH 1XPRA 2DUDA 1SFOB 4IALA 4YWMA 1H9SB 1UEBA 1LT5D 3BVMA 2PYKA 2B2WC 1GM5A 2K5NA 1Q81C 1CM9A 1ILPA 1NJIC 3FKIH 4J6HA 5IYCG 1PH4A 4BA1I 3EQLC 3GTLB 4QY7A 2VS1A 3PSIA 1TQOA 1PH5A 1VQMA 2KHSA 3RLFA 3GTQH 5EAYA 4F8MA 2A8VA 4N9TA 4L63B 1EQVA 3PF5A 1TT2A 1UE5A 1WTXA 1UE6A 4DR7Q 2BCOA 4LWCA 2IT1A 4PV1C 4ULLA 4PG3A 1Y1VG 2R3ZA 3T4AC 1C8CA 1CT1D 5IYBG 4TQUS 1JB7A 2HQLA 5LHY1 2F3VA 4X3TA 2QDBA 3CCLA 4L5RC 3URYA 2FINB 1SE2A 3BZDB 4DV4L 4KY6A 4QGUA 5JJZA 5JVG3 1BCPC 2TSSA 4NXML 5I9OA 4DR1Q 3R2IA 4C3HG 1DZ1A 3K81C 2QGQA 1I50B 3FPUB 1S5BD 1M4VA 3N52A 3F2UA 1U5KA 3I73A 5C3WA 3CC7A 4A76A 1C4QA 3J7YW 4GKJQ 4DNIA 1B2TA 3DM3A 2EZVA 2CQOA 1F2ZA 5FLXc 5AJ3L 1EQTA 3DEPA 1X3QA 4KN7C 4DV0L 5IGEA 1J5EL 3M4OH 1SR3A 1BBUA 1ET6A 1WTHA 2R7ZH 5GAHC 1BVSA 4A3JB 2VUMG 4MIUA 1PH2A 4GNXA 1TR5A 3CRLC 2K14A 1TIID 2E2IB 4DK0A 4JI7L 4DUZQ 4IUNA 4IUTA 1BBWA 3S1QB 4LMQD 3OIQA 4H0LC 2K03A 3T1YQ 1IKMA 1H9KA 2B2YC 2IPKD 4C1NI 4C3IB 3TP5A 3RZDH 4A3FH 1PH8A 2R7DA 2M00A 4A93B 3HOZG 1Q46A 2RCFA 4RCNA 5CBEE 5T1IA 4HIDA 2O5IC 1STNA 4B08A 2HD3A 2MHVA 1PZID 3S14B 4I7AA 4X66Q 5GAEC 4A3EB 1SNQA 3HS0C 5M3MG 1EY5A 1Q82C 1NTGA 2L5TA 4UY8C 3UDXA 2K50A 3HOUG 3SE0A 3HKZB 3D3RA 3GTOH 3D4WA 4R4CA 5EPKA 5CV5A 3HOWB 4WORA 2SNSA 5IOCA 1GHJA 4LFAQ 4GNXB 1H95A 1KLUD 3JAMc 4RMFA 2I46A 4DUYL 4MTKA 3S16H 1KNAA 4JYAQ 1SNDA 5C4JB 2FJ2A 2KCNA 4X65Q 1L2FA 4L5QA 1EFID 4OEMB 4G7HC 3B6YA 1N32Q 4DAPA 2WB1G 3HOVB 4B3TL 2NVYB 1F77A 2F0MA 2XTIA 2HHHL 2K52A 2NTTA 1FNVA 1UE7A 3OW7A 4NB3A 1T9HA 2IHFA 3GP7A 4RHRA 1HCZA 2N3SA 1SE3A 3K7UC 1L1OC 1IW7D 1HZ9A 3E9IA 5CGKA 1SLJA 2ES2A 4JV5L 1PRTD 3J80c 2KVMA 1S5ED 3TDQA 4NKLA 4F7XA 5M5YH 4FF4A 1B50A 1SYBA 5G3LF 2NZHA 5M9OA 4KHPQ 3MHBA 2KBNA 1RL2A 1EU3A 1D1KA 4L5SA 3CD6A 4A3LH 2N88A 2VZAA 3NTHA 3QOLA 5ELNA 4DR2Q 3FEWX 2JA6G 3FDTA 3TMEA 2RQXA 1QVFA 5LL6S 1SE8A 4RKLA 4KKTA 2O5JC 4JI2L 2WACA 1LT6D 1GUOA 2UUCL 2MFIA 2E2JB 1UWVA 1AP0A 2F3IA 1SNOA 4X64L 1VF5C 4M8AA 1Y1WH 5IP9H 1B3AA 2CKZB 1HUNA 1BUVT 1Y14B
chains in the Genus database with same CATH topology
5IODA 4G7ZC 3M7GA 1PTOH 2KEEA 5JOBA 1EY8A 3JAML 4EVOA 1CHPD 1H9MA 1BDOA 3KUPA 3RZOB 1SYCA 1CA5A 4NMZA 3K5NA 2BE5D 1JWSD 3K5OA 1G91A 4KJNA 2ID0A 2QKIC 3BG3A 2LMCB 3D6WA 1A3TA 1EYAA 5K36G 4FP5D 4F88A 1TKWB 3FVQA 2PCFB 2BDOA 3M4YA 3R2TA 3ERQA 1F9RA 2B2YA 4KV6A 1VF7A 2L12A 3J80L 1BXTA 5EKIA 1A2UA 1O80A 2D5DA 3S2HB 1U4LA 2JEAI 4XQQA 2RVLA 3Q0AA 4OHJA 4DK1A 4RAUC 3NSWA 4ODGA 1BBXC 3X3NA 1O78A 2MJ8A 1CA6A 4RGOS 3PUXA 4AYBB 1EWCA 1DOKA 1G2SA 1QWYA 3TZDA 1Q12A 4TRDA 4MN3A 4G57A 4IUPA 1A2TA 3K57A 4HCSA 2NB0A 4A3IB 4BWGB 2Z8LA 1IW7C 2M2LA 1X32A 4U673 2QILA 2V4DA 3DMUA 4PMBA 1LT4D 2B63B 4I7ZC 1LV9A 3S9WA 1O7ZA 1V1OA 3S15B 2DY8A 5CV8A 4OGQC 3LNNA 2RDHA 5HURA 3I3CA 4KD4A 4C3IG 2NVXB 3I4LA 4BY7B 1CQVA 3HOXB 5CV9A 1STBA 2F0SA 3HRZC 2QF7A 3H09A 3EFXD 4CJ0B 2ICEC 1EU4A 2AUJD 1CZGA 3BYTB 4A3DB 3FRPB 4DNTB 4B9XA 1CHQD 5C5MA 1AZQA 2F0QA 3EROA 4XQJA 3MWYW 4KN4C 1OXUA 5K5PA 5FKAC 2BE5C 2RDGA 3QO2A 2PNRC 1V43A 5DEHA 3JAME 2F0TA 4TSSA 5ELFA 3J81L 1B44D 4RKBA 5IGGA 3M85A 5CV6A 1UUPA 1S5CD 4IURA 3K5LA 5EPJA 4XT3B 1E0BA 1STEA 1CTMA 2HCCA 3GTJB 3Q22A 4JK1C 4CHTB 1LO5D 3CHBD 4IFDG 1ENFA 5F2DA 3X3MA 2PPBC 1ENAA 5C0XG 2WKDA 5DM73 5C4XB 3PV0A 5BN5A 1EEID 1DOLA 2A69D 1PDQA 3QOJA 1WTVA 3G6JB 1SXTA 1PFMA 2EJFC 2F1MA 5KYLA 3J80E 1UNSA 3OHXC 2WINB 1C48A 2AQ2B 1GOZA 4L8JA 2LY7A 2R6GA 1MD2D 1QJOA 1NAPA 5D14A 4O1NA 5FO9B 1B4OA 3K59A 2NN6H 5E3FA 3BYYB 4ZLTF 4Q0FA 4K6LA 5D65A 2VB2X 4FXGC 1PFBA 1JORA 1HRJA 4RGNA 5EPLA 3NHHA 2BA1A 1HTPA 2NN6I 1JWUD 4RCOA 5JEAG 5C4HA 1WTQA 2K32A 1HFGA 3TP6A 1PTOF 1FD7D 2EYFA 4HEDA 1ET9A 3C3LA 2XN9C 2I07B 1PYWD 1ZKOA 2CHBD 1TWHB 4DXGA 3I70A 1F2YA 2JA8B 1V1PA 4ZUIA 1GXDC 5EGTA 3S17B 3WDNA 1HTLD 3D4RA 3M3YB 1PLFA 1JB3A 2F3WA 3IKJA 4KTAA 2YYZA 1HUMA 5EBCA 2XWJB 5C0XJ 1SBBB 3FKIB 2RBMA 3SXHA 2OXPA 3KBXA 3GTQB 1B1ZA 5CV4A 1HQRD 1WTOA 3W3AA 5J22A 4XQNA 2EY6A 1LTRD 2AQ3B 4I65A 2EJGC 5IT9L 3BDOA 5I6YA 2F0KA 2L11A 2A6ED 4J8QA 4K2KA 4FVMA 1KAAA 1V1PB 2J0TD 3N6RA 3J81E 1W6JA 3A8IE 2B2TA 3CRKC 4KKUA 2E76C 3MTSA 5A35A 2DN8A 4RGMA 2SEBD 2A69C 3A8KE 4RHSA 5I6WA 5KNDA 2OT2A 5JEAJ 2KJXA 1HA6A 2EYLA 2EY5A 3SK6A 3NQTA 2D2CC 5C5LA 1AZPA 1LTSD 2EVBA 3M4OB 1IHZA 2R7ZB 3D6CA 5KYIA 2XVSA 4H7BA 1A3VA 2IX1A 1DYQA 3VA7A 2LFNA 1D5MC 3OIPA 4FXDA 3SK4A 2NWGA 2KOLA 4XTCS 5EBDA 2K33A 4IUVA 5CYUA 4V0BA 4ZK9B 1A15A 3RZDB 3T56B 4A3FB 1STHA 2F03A 4LJZC 1Y8OB 1BCPF 3DWPA 2EDGA 4DGZA 4BBRB 4ZKBB 3TBIB 5BN3A 5FOBB 1EWHA 2RA4A 3A7LA 4ZYSA 5EQ0A 5C3XA 4ZQ3A 3GTOB 1ZXTA 1EYDA 4O42A 1LABA 1U4RA 2IL8A 3KLSX 4A3MB 2PW5A 5E1FA 1CFMA 2OF1A 2K01A 3S16B 4OO1H 3OMCA 1L0XB 2KCCA 3TP7A 2F0OA 1Q8IA 1Y8NB 3TN2A 4K8IA 3OWFA 4HSPA 5KNBA 1Q90A 3VR5A 4OO1I 2LS01 3WOFA 3C46A 2EYHA 4HMIA 1GUSA 2Y0SB 3GQBA 1YNJC 1FR3A 2A6EC 2F4IA 4G4KA 3NTKA 3NP8A 5M5YB 3VR4A 3DM1A 1E2VA 4M1UB 4FF1A 3NBIA 2B39A 5IT9E 1D5XC 2Z4HA 2A68D 1OXSC 1ICWA 1AN8A 3P20A 2F0UA 2K5DA 5JAVA 1Y1WB 3SK8A 5FLXL 1LACA 3TZUA 1TWFB 5M3FB 3ND9A 1PZJD 3I4NB 4K8JA 3NE5B 1Q1BA 1SNPA 3OOCA 4K5WA 3NTIA 1LTID 2A74C 3Q23A 3Q24A 1SYFA 1BR9A 1PXUA 4XIGS 1KNEA 2JSOA 4OIKA 2CQAA 5EKKA 3H3VC 2K6AA 1GUTA 1ESFA 1TS3A 4IQZA 4EGVA 3P7JA 1MBYA 3GTGB 4C56C 5TSSA 2JP1A 2F0GA 4RA8A 4PMWA 1WTRA 1FNWA 2F0JA 2CW0D 3MFYA 3NK9A 5ELCA 4ILWA 1A6XA 2F0NA 1QNKA 1NSNS 5C4ZA 5D3DA 3A8JE 3GO5A 1NCVA 3MFGA 2XNAC 5EKLA 5JPMC 1JOKA 2R61A 3MVVA 4ID6A 1D6EC 1AFPA 4N9PA 3S1RB 1CI3M 2VB3X 4CKBA 3U9SA 3G7LA 4WJWA 2HUGA 1HHVA 2A73B 5C3EB 1VDZA 3BDLA 5COYA 1B53A 2WAQB 4A3KB 4XT1B 2NBFA 1S5DD 2A68C 2EY2A 2KEDA 1RF2D 1FNUA 3DXJC 4FNFA 1DJRD 3TP8A 3T16A 1OO9B 1EYCA 2F0EA 3EA6A 1AW7A 3VYUA 1HPCA 4RH6A 1OXTA 1PRTF 5FLXE 4HR7B 2EYPA 1JQYD 1JOQA 5E4WC 1I4PA 2WIIB 3HOYB 1EY0A 1LT3D 1I6HB 2M9VA 5A2QL 1I4GA 1TWCB 1BO0A 1SYEA 1TY2A 2RKSA 2VNUD 3D8GA 2JEBI 2CW0C 5ELEA 1WD0A 4OL7A 1RTNA 1CQFA 4ZUJA 1ESRA 2PO4A 5IGCA 1H9JA 1I4RA 1XTCD 2AWNA 3ZYYX 3AB9A 3S1NB 3A54A 1NUCA 3PUYA 3MXGA 1HA5A 1EZ6A 1PTOD 3KLSA 2PZWA 4XYOA 1NR2A 1BOSA 3I8ZA 1F9QA 4X3UA 1STAA 4R9WA 3KLRA 3PO2B 4P2CB 3NWTA 2B2TC 3GTMB 4IZ8A 3VYTA 4A3BB 1LLRD 5J39A 1SSOA 3SHLA 3ITPA 3IFTA 1G2TA 3A56A 3NBHA 3P75A 4DAVA 1Y69U 2A5HA 4KKSA 1J8IA 1I4XA 1VMCA 3K5MA 1Q3LA 3RUZA 3QG1A 3DWQA 1LTGD 1MI2A 1BF4A 4MHEA 3VR6A 3DEOA 2FMMA 2F0WA 1Z7TA 1K83B 4K5XA 4NDXA 3MAQA 1TS4A 3S1MB 2B2UA 4K6DA 4X3KA 3GV6A 2IWHA 3NXWA 2Z4IA 4X3SA 4TKOB 3PIP3 2LKVA 2BA0A 1EY9A 2JYOA 2EY1A 2PQEA 3GTPB 4QF4A 2G9DA 3PUZA 1O7LA 3E0JA 3CQZB 1F2LA 2K04A 5M5WB 1GJXA 2KA7A 3S2DB 2AWOA 4YIJA 2R93B 3A55A 1ILQA 1OXVA 4DXFA 3IL8A 2J7ZA 2QEJC 5A2QE 5JPNC 3I90A 5KIXA 4K5VA 2KUMA 2PMZB 1SDFA 2F0IA 3PO3B 1STGA 5IGBA 3NWSA 3QJYA 5C44B 2L1BA 4U68A 2X6LA 1PTOC 4F87A 2DNCA 2JE6I 1EY4A 5CMDA 3AMUA 2WB1B 3LX0A 1XYIA 4XXEA 2YU9B 3SDZA 2MP1A 4DU9A 1YNND 2ZXPA 1SJHD 3BVZA 2RDFA 4OIJA 1ZYRD 2L0CA 4DA2A 3V2TA 3MZ5A 4PNYA 1SYGA 2C9OA 1WTPA 1I4HA 1IL8A 1YNJD 2NYZD 3MXPA 4KJOA 2E2DC 5FO7B 1XXGA 2H4OA 1LTTD 2PW7A 1GUWA 1VMPA 1JICA 4DF7A 1RODA 2HQEA 1SJED 2EE1A 4K2LA 5JVH3 1HXYD 3V05A 2MPMA 5DM63 1SNCA 2EXZA 1XWEA 4QB4A 4G7OC 4KD3A 3TSSA 1UAPA 1KTKA 3WOEA 4L6TB 1II3A 1A3UA 3T13A 1UEAB 3QIAA 1QE6A 3L3OC 1DM0B 3I4MB 5KNCA 4BA2I 2AUKA 4J1MA 2L9HA 2NZ1D 4CKEA 1SE4A 2PZUA 3DUZA 3GV3A 1MSGA 4UDUC 1U9RA 3PUVA 3QB3A 1Z6HA 2EYMA 4PQXA 1R4PB 3DHQA 2NN6G 2F0DA 3KF8A 2RSNA 3IAYA 4S3SA 3R3OA 2O2LD 4JBWA 2ENBA 2K5QA 3H91A 2F0VA 4UAIA 2HDLA 3BVGA 2Q8IB 4Q5VA 5G3LD 1RDPD 5HGTA 3PUWA 4CJ2C 1K8OA 4GZYC 3P1HA 5T1GA 3R8BA 1AEXA 2WKCA 1RD9D 2F0PA 4XYQA 3OPOA 5I2XA 1B9MA 1NR4A 1TU2B 2CVRA 5K36H 4H13C 1DOMA 3L7ZC 4BBSB 1YNNC 1TY0A 2XIWA 1ZYRC 2L55A 4K14A 2X6GA 3HZXA 3V96A 2HCIA 5CBAE 2XRQD 3SVMA 3U9OA 1K8MA 3OWEB 4C3JB 4HN7A 3I91A 5CR3A 1G6ZA 4KI0A 2XSCA 2NTSA 2EJMA 1GUNA 1EL0A 2X69A 4H44C 4CKCA 1VCIA 3T53B 4FYDA 5I4DA 3M7NA 1JWMD 3UI2A 2HDMA 3HEJA 1EY7A 2ZXRA 1PTOB 1O7YA 1T5XD 1JC7A 1HQMC 4QCLA 2JXMB 4FF3A 1Z47A 1CK1A 2KECA 1S5FD 1RJTA 4ZRZA 5IGFA 5FO8B 2NUCA 2WP8J 2PZTA 1SMYD 4LAAA 1HFNA 1QOHA 2BDNA 3SR1A 3HP3A 1DD2A 2B2WA 2L4NA 2F0LA 2F0HA 3H0GB 1WD1A 3MXUA 3K58A 1D2BA 2Z1CA 1L0YB 1FGBD 2G9HD 4CBVA 4DNRB 1XX8A 3SK5A 1QCBD 2FFKB 1W6KA 5IGDA 4KMUC 1DONA 1R4QB 1WTWA 4BY1B 1JR0D 1KABA 5DAUA 3KBGA 1SYDA 1WVLA 1G8ZD 5CC4A 5J1ZA 3O13A 1OXXK 1TS5A 1PMRA 3K6OA 4ME5A 2IX3A 4V190 4CJ1B 1J9OA 4DFAA 1QG7A 2D9UA 4PMCA 4Y7NB 5LL6X 1EZ8A 4KK7A 3LWUA 3MXNA 1T5EA 3LWEA 2K28A 1GUGA 4LK1C 1IYUA 2SDFA 4OO1G 2QCPX 4IFDH 4NW2A 4IN3A 3KK7A 2XRSD 4CGYB 5C0XH 1D1IA 1H9RA 3E6ZX 3Q6SA 3ND8A 3EVQA 5FK9C 1ONLA 2IW3A 4IFDI 2B2UC 5IIFA 1I4QA 4RFBA 1WCMB 1RTOA 1BCPB 2JA7B 5KEEA 5C0XI 4QUFA 3EJIA 2B2VC 3FPPA 5DNFA 2JA5B 1I6VC 3VYSA 4RWSC 3K0YA 4ZKCB 2BOSA 4A3GB 2E74C 5KGUA 3DWAA 3GTKB 1MSHA 1EOTA 1SMYC 2MUYA 3C1EA 5AFWA 1X3PA 1TS2A 2K5WA 5JEAH 2R92B 4QMGA 4DN4M 2AQ1B 2B8GA 4EQPA 1EIHA 3E5SA 4IUQA 2IJ0A 1KDAA 2E2HB 5KRUA 3NUCA 1PZKD 3RD4A 1G291 2A6HD 3AU7A 1TVXA 4HCEA 1IYVA 2Q8RE 2J4XA 3VYRA 3NPPA 2FMCA 1PRTC 1ENCA 2GA4B 4HAEA 4KY5A 2O4XA 3D4DA 3K7AB 5EJWA 4QIWB 4C3JG 3OSOA 1JCKB 2DY7A 1M8AA 1SAPA 1EEFD 3MA2B 3J7AF 1SEBD 2Q8TA 4C2MB 3D31A 2H1EA 2K05A 4QUCA 1ZEQX 4HSVA 3HG9A 2XWBB 1TWGB 3RMHA 5BN4A 3A7AB 1STYA 3MC0B 3T51B 1QILA 5ELBA 3BS1A 1GHKA 1Y1VB 3QWNA 1LTAD 1V8QA 1E2ZA 1FYCA 4XDXA 2K7VA 2EYOA 1ML0D 1Y8PB 4RGTA 4HTHA 1DXMA 2EPBA 4E6IA 1B9NA 1PFNA 4C3HB 1EY6A 3CKIB 4NP5A 2ICIA 1F9PA 1RKNA 4DAYA 3R93A 5ISRA 1IKLA 2D62A 3FMCA 2VXWA 3VR2A 3GD7A 2VUMB 1EIGA 2N55A 4B9WA 1F2MA 2OEOA 3J7AV 4KY7A 1U4MA 5I2YA 5D3IB 1RHPA 2B2VA 4IUUA 3MEHA 5CORA 1MGSA 2MGSA 2FHTA 2B8FA 4FF2A 3HOZB 3ONAB 2A6HC 4KHZA 3NQIA 2ZT9C 1F9SA 5M3MB 4ABNA 2NVTB 4BS9A 3HOUB 2EYJA 2F0FA 4KHVA 3L9AX 3PMFA 5ELDA 4R8IA 1LTBD 1R9TB 3CU7A 1QB5D 1RCVD 1BCPD 2WV6D 4R8NA 3H94A 2SOBA 4WRDA 1BQQT 4C1NK 2IX0A 4ZAIA 4EQNA 3VA5A 2C5CA 5CV7A 2SNMA 1JE4A 3VR3A 2EOTA 4EQOA 2KQ3A 3OMGA 1BNZA 3IFDA 4Z9CB 4IFDJ 3H6MA 3SEBA 2TMPA 2K1BA 2DNEA 4WFN3 5C6AA 1QNUA 3PIO3 1H9SA 1D5ZC 3I72A 3BDCA 2E75C 1CZWA 1TWAB 5M5XB 3C1FA 2JA6B 4FO2A 1PRTB 5NUCA 1U4PA 1DCZA 5I9PA 1KDBA 1S4ZA 2RSOA 1E2WA 5E4XA 1Q1EA 1KLGD 2NVQB 2ZXOA 1KDCA 1SNMA 3C2PA 3HGBA 1JOOA 4FXKC 3W2DA 1I3QB 4HMJA 1SFOB 4IALA 1H9SB 1LT5D 3BVMA 2PYKA 2B2WC 1CM9A 1ILPA 4J6HA 4BA1I 3EQLC 3GTLB 1TQOA 2KHSA 3RLFA 4F8MA 4N9TA 4L63B 1EQVA 1TT2A 1WTXA 2BCOA 2IT1A 4PV1C 4ULLA 2R3ZA 3T4AC 1C8CA 1CT1D 4TQUS 5LHY1 2F3VA 4X3TA 2QDBA 3URYA 2FINB 1SE2A 3BZDB 4KY6A 5JJZA 5JVG3 1BCPC 2TSSA 5I9OA 3R2IA 4C3HG 1DZ1A 1I50B 3FPUB 1S5BD 1M4VA 3N52A 3F2UA 3I73A 5C3WA 1C4QA 3J7YW 1B2TA 2EZVA 1F2ZA 1EQTA 3DEPA 1X3QA 4KN7C 5IGEA 1ET6A 4A3JB 4MIUA 1TR5A 3CRLC 1TIID 2E2IB 4DK0A 4IUNA 4IUTA 3S1QB 4LMQD 3OIQA 4H0LC 2K03A 1IKMA 1H9KA 2B2YC 2IPKD 4C1NI 4C3IB 3TP5A 2M00A 4A93B 4RCNA 5CBEE 5T1IA 2O5IC 1STNA 4B08A 2MHVA 1PZID 3S14B 4A3EB 1SNQA 3HS0C 1EY5A 2L5TA 3SE0A 3HKZB 3D3RA 3D4WA 5EPKA 5CV5A 3HOWB 4WORA 2SNSA 5IOCA 1GHJA 1KLUD 2I46A 1KNAA 1SNDA 5C4JB 2FJ2A 2KCNA 4G7HC 1EFID 4DAPA 3HOVB 2NVYB 1F77A 2F0MA 2NTTA 1FNVA 3OW7A 3GP7A 4RHRA 1HCZA 1SE3A 1IW7D 5CGKA 1PRTD 2KVMA 1S5ED 3TDQA 4NKLA 4F7XA 4FF4A 1B50A 1SYBA 5G3LF 5M9OA 3MHBA 1EU3A 1D1KA 2N88A 3NTHA 3QOLA 3FEWX 3FDTA 3TMEA 2RQXA 5LL6S 4RKLA 4KKTA 2O5JC 2WACA 1LT6D 1GUOA 2E2JB 1AP0A 1SNOA 1VF5C 4M8AA 1B3AA 1HUNA 1BUVT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I65 A;  3S9W A;  5IOD A;  4IAL A;  2EYJ A;  2F0F A;  3T16 A;  4KHV A;  2OF1 A;  4S3S A;  1EY4 A;  5I6Y A;  1EYC A;  1STN A;  2PYK A;  3PMF A;  5CV8 A;  5JOB A;  1EY8 A;  3R3O A;  3OMC A;  3LX0 A;  3P75 A;  2F0K A;  1STY A;  4EVO A;  5HUR A;  4K2K A;  3EVQ A;  1KAA A;  5IGF A;  2NUC A;  4KD4 A;  1SNQ A;  2F0G A;  2F0E A;  2ENB A;  4J6H A;  5E3F A;  1EY5 A;  1SYC A;  2PZT A;  5IIF A;  3RUZ A;  4NMZ A;  3TP7 A;  1TQO A;  2F0O A;  2F0V A;  2KHS A;  4DU9 A;  5CV9 A;  3ITP A;  1STB A;  2F0J A;  2F0S A;  4LAA A;  4N9T A;  4F8M A;  2RDF A;  1EQV A;  5KEE A;  4K8I A;  3OWF A;  3NK9 A;  3EJI A;  3D4W A;  3SR1 A;  4KJN A;  3V2T A;  2EYO A;  3MZ5 A;  1TT2 A;  4R8N A;  4PNY A;  2EYP A;  2SOB A;  5CV5 A;  2F0N A;  5HGT A;  2F0W A;  4WOR A;  2SNS A;  5I6W A;  1SYG A;  5IOC A;  1JOR A;  3P1H A;  1A3T A;  1JOQ A;  4WRD A;  1EYA A;  1AEX A;  1NSN S;  2EYH A;  3NHH A;  4HMI A;  4HTH A;  4EQN A;  4K5X A;  3VA5 A;  4B9X A;  2EYL A;  2F0P A;  5C4Z A;  5CV7 A;  2F0L A;  2EY5 A;  2SNM A;  2F0H A;  3MXP A;  4KJO A;  4NDX A;  5C5M A;  4E6I A;  1EY0 A;  2F0Q A;  3NQT A;  5EKL A;  3SK6 A;  4K6D A;  5C4H A;  2F3V A;  1EY6 A;  1SND A;  1JOK A;  3MVV A;  3NXW A;  4ID6 A;  2PW7 A;  3ERO A;  4NP5 A;  5C5L A;  4EQO A;  5KGU A;  2QDB A;  1RKN A;  2KQ3 A;  1IHZ A;  3ERQ A;  3OMG A;  4N9P A;  2HQE A;  3TP6 A;  3NP8 A;  4DF7 A;  5ISR A;  1SYE A;  3SK5 A;  2LKV A;  3C1E A;  1EY9 A;  3H6M A;  4KV6 A;  3D6C A;  4KY6 A;  5IGD A;  4K2L A;  5K5P A;  2RKS A;  5KYI A;  3D8G A;  4H7B A;  1A3V A;  4QMG A;  5I9O A;  2EY1 A;  1A2U A;  2EYF A;  2F0M A;  4OL7 A;  1SNC A;  2EXZ A;  4EQP A;  1KAB A;  5C6A A;  4ZUJ A;  3E5S A;  4QB4 A;  5DAU A;  1KDA A;  2PQE A;  5IGC A;  4K14 A;  4KD3 A;  4QF4 A;  1SYD A;  5KRU A;  3SK4 A;  3NUC A;  5DEH A;  2F0T A;  3HZX A;  3BDC A;  5CC4 A;  5J1Z A;  5E1F A;  4ODG A;  5EKK A;  5C3W A;  4RKB A;  2F0U A;  5IGG A;  1F2Y A;  5CV6 A;  5KYL A;  4B9W A;  4ZUI A;  1F2Z A;  5CGK A;  1F2M A;  5EGT A;  3U9O A;  3C1F A;  5JAV A;  1II3 A;  1A3U A;  4ME5 A;  1NUC A;  3T13 A;  3TP8 A;  5IGE A;  3SK8 A;  1STH A;  2OEO A;  4KY7 A;  5NUC A;  3BDL A;  1EZ6 A;  4DFA A;  5CR3 A;  5I9P A;  1ENC A;  4PMC A;  2F3W A;  4NKL A;  4F7X A;  1EZ8 A;  1KDB A;  4KTA A;  4KY5 A;  4J1M A;  3MEH A;  1SYB A;  2PZW A;  4DGZ A;  5M9O A;  2O4X A;  3D4D A;  3MHB A;  4K8J A;  4TRD A;  4MIU A;  1TR5 A;  4G57 A;  4YIJ A;  2PZU A;  1SNP A;  1STA A;  5F2D A;  4K5W A;  1A2T A;  2RBM A;  3QOL A;  3SXH A;  1U9R A;  3OSO A;  3TME A;  5C3X A;  1ENA A;  2OXP A;  4ZQ3 A;  2EY2 A;  4IUN A;  1KDC A;  3QB3 A;  4RKL A;  1SNM A;  5KIX A;  4IZ8 A;  4K5V A;  1EYD A;  1SYF A;  2WAC A;  2EYM A;  5CV4 A;  2F0I A;  1JOO A;  3QOJ A;  1STG A;  5J22 A;  5IGB A;  3DMU A;  3DHQ A;  1SNO A;  3HEJ A;  2EY6 A;  5J39 A;  1EY7 A;  4PMB A;  3TP5 A;  3SHL A;  2PW5 A;  2F0D A;  2M00 A;  4HMJ A; 
#chains in the Genus database with same CATH topology
 1NE3 A;  5IOD A;  4G7Z C;  1TWF H;  1HNW Q;  3M7G A;  1PTO H;  4X62 Q;  5M3F H;  1FL0 A;  3A74 A;  2KEE A;  5JOB A;  1EY8 A;  3I4N H;  3JAM L;  4EVO A;  1CHP D;  1H9M A;  1BDO A;  1WYD A;  3CC4 A;  5LMU L;  3KUP A;  4OON A;  1WFQ A;  1N34 Q;  3RZO B;  1SYC A;  1CA5 A;  1YZ6 A;  4NMZ A;  4K0K Q;  4JOI A;  4YWK A;  2I0Q A;  2QDL A;  3K5N A;  2BE5 D;  1JWS D;  3K5O A;  1G91 A;  4KJN A;  2ID0 A;  2QKI C;  1QZH A;  3BG3 A;  2LMC B;  3D6W A;  4B3S L;  1A3T A;  1EYA A;  1X54 A;  5K36 G;  3AFQ A;  3GTG H;  4FP5 D;  4F88 A;  4DV3 L;  1PH1 A;  1TKW B;  5HY6 A;  2MQH A;  3FVQ A;  1M90 C;  2PCF B;  2BDO A;  3M4Y A;  4GN3 B;  3R2T A;  3ERQ A;  1F9R A;  2B2Y A;  4KV6 A;  1VF7 A;  2L12 A;  3J80 L;  1BXT A;  5EKI A;  1VQ4 A;  4H02 A;  1A2U A;  2KCM A;  4JI6 Q;  1O80 A;  3K80 C;  1Q86 C;  2D5D A;  3S2H B;  1U4L A;  2JEA I;  5LMN W;  4JI4 L;  4XQQ A;  2RVL A;  2E5L Q;  3Q0A A;  4OHJ A;  4DK1 A;  4RAU C;  3NSW A;  4ODG A;  1BBX C;  2ZJP A;  1HNZ L;  3X3N A;  4LW1 A;  4QJF A;  1O78 A;  2MJ8 A;  1CA6 A;  4RGO S;  3E0E A;  4BXX H;  3T1H L;  3RR5 A;  3PUX A;  4AYB B;  1N36 L;  1EWC A;  1DOK A;  1G2S A;  1QWY A;  4JG2 A;  3TZD A;  4JI1 Q;  1NMF A;  3S1R H;  1Q12 A;  4TRD A;  3F1Z A;  4MN3 A;  4G57 A;  3TRE A;  4IUP A;  4DR4 L;  4R1J A;  3K8A A;  3J81 c;  2VQF L;  5FLM G;  1A2T A;  3K57 A;  4J15 A;  3BU2 A;  4HCS A;  2NB0 A;  4A3I B;  4BWG B;  4OWX B;  2Z8L A;  4A3J G;  1IW7 C;  2M2L A;  1X32 A;  4U67 3;  2C35 B;  1IBM Q;  2QIL A;  2V4D A;  3DMU A;  4A75 A;  4PMB A;  1LT4 D;  2B63 B;  4I7Z C;  1LV9 A;  5C3E H;  1XNR Q;  3S9W A;  1O7Z A;  2K5H A;  4AYB E;  1HNX L;  1V1O A;  3S15 B;  2DY8 A;  5CV8 A;  4OGQ C;  3LNN A;  1PH7 A;  2RDH A;  5HUR A;  3I3C A;  1VQN A;  4KD4 A;  2OQ0 A;  1HR0 L;  4C3I G;  4A3K H;  2NVX B;  4YHH Q;  3I4L A;  4BY7 B;  1CQV A;  3HOX B;  5CV9 A;  4A93 G;  1STB A;  2F0S A;  1S40 A;  3FHW A;  3HRZ C;  2QF7 A;  3H09 A;  3EFX D;  4IPD A;  4CJ0 B;  2ICE C;  1EU4 A;  2AUJ D;  4A3E G;  4P72 A;  1B70 B;  1CZG A;  2BH2 A;  3BYT B;  4A3D B;  3FRP B;  4DNT B;  4B9X A;  1XMO Q;  1CHQ D;  5C5M A;  1AZQ A;  2F0Q A;  3HKZ G;  1DGS A;  3ERO A;  4A3G H;  3M4P A;  3HOW G;  1X3F A;  4XQJ A;  1IZ6 A;  3MWY W;  4KN4 C;  1OXU A;  1KHI A;  5K5P A;  5FKA C;  2BE5 C;  2RDG A;  3QO2 A;  2PNR C;  1GVP A;  1V43 A;  5DEH A;  3JAM E;  2F0T A;  4TSS A;  5ELF A;  2ZJR A;  3J81 L;  1B44 D;  1KC8 C;  4RKB A;  5IGG A;  3M85 A;  5CV6 A;  1UUP A;  3AFP A;  3HOY H;  3HOV G;  1VQ9 A;  1I6H H;  1OTC A;  1S5C D;  4IUR A;  4DAM A;  3K5L A;  5EPJ A;  4XT3 B;  1E0B A;  1STE A;  1TWC H;  4DV5 Q;  4JI8 Q;  1CTM A;  1KRS A;  2HCC A;  3GTJ B;  3Q22 A;  1HZB A;  4B3R Q;  1VQK A;  2DGY A;  4JK1 C;  4CHT B;  1LO5 D;  3CHB D;  4IFD G;  1ENF A;  4DR7 L;  5F2D A;  3X3M A;  2PPB C;  1ENA A;  5C0X G;  2WKD A;  5DM7 3;  5C4X B;  3PV0 A;  3S1N H;  5BN5 A;  4N8F A;  1EEI D;  1DOL A;  2A69 D;  1PDQ A;  3A5U A;  3QOJ A;  1WTV A;  3G6J B;  5ELO A;  1SXT A;  1PFM A;  2EJF C;  2F1M A;  2HIX A;  3LGJ A;  5KYL A;  3J80 E;  1UNS A;  3OHX C;  2WIN B;  1C48 A;  2AQ2 B;  1GOZ A;  4DR1 L;  4L8J A;  3W1G A;  1VQA A;  1YBY A;  1YHB A;  2LY7 A;  2R6G A;  1PH3 A;  1MD2 D;  1QJO A;  1NAP A;  5D14 A;  3KOJ A;  4O1N A;  5FO9 B;  1B4O A;  3K59 A;  2NN6 H;  5E3F A;  3BYY B;  4ZLT F;  3D0F A;  1EUJ A;  5IYD G;  3PO2 H;  4Q0F A;  2YTX A;  5BR8 Q;  1A0I A;  3UE1 A;  3GTM H;  4A3B H;  4K6L A;  5IT9 c;  4A3C G;  1GKH A;  5D65 A;  2VB2 X;  4FXG C;  1PFB A;  1JOR A;  1HRJ A;  1NNX A;  4RGN A;  3L2P A;  5EPL A;  5LMN Q;  3NHH A;  2BA1 A;  1HTP A;  2NN6 I;  1JWU D;  4RCO A;  3A0J A;  4UPA A;  5JEA G;  5C4H A;  1WTQ A;  2RF4 A;  1K0R A;  4DUZ L;  4JW0 A;  2K32 A;  2EIF A;  2CH4 W;  1HFG A;  3TP6 A;  1XNQ L;  3H3V I;  4CDD C;  4UP7 A;  1PTO F;  1FD7 D;  2EYF A;  4HED A;  1ET9 A;  3C3L A;  3E3X A;  2XN9 C;  4GNX C;  2I07 B;  1K83 H;  1PYW D;  1CKN A;  1ZKO A;  2CHB D;  4X66 L;  1TWH B;  4DXG A;  3I70 A;  1F2Y A;  2JA8 B;  1V1P A;  4ZUI A;  1GXD C;  2PI2 A;  5EGT A;  3S17 B;  2F52 A;  3WDN A;  1HTL D;  3D4R A;  4DV7 Q;  5JJK A;  3BJU A;  3M3Y B;  1PLF A;  4YCV A;  2JQO A;  1JB3 A;  2F3W A;  3IKJ A;  4MZ9 A;  4KTA A;  2YYZ A;  1HUM A;  5EBC A;  3RNU A;  1XMQ L;  2CFM A;  4LFA L;  2XWJ B;  5C0X J;  1SBB B;  4GOP A;  3FKI B;  2VL6 A;  2RBM A;  3SXH A;  3KF6 B;  3GTP H;  4AYB G;  2OXP A;  3KBX A;  3GTQ B;  4JYA L;  1JJC B;  1EFW A;  1B1Z A;  5CV4 A;  1HQR D;  1WTO A;  3W3A A;  5J22 A;  4XQN A;  1QVG A;  2EY6 A;  1LTR D;  1N32 L;  2EXD A;  4JBK A;  1IBK L;  2AQ3 B;  3CQZ H;  4I65 A;  2EJG C;  5IT9 L;  3BDO A;  5I6Y A;  4A3I G;  5M5W H;  3S2D H;  2F0K A;  2L11 A;  2A6E D;  4J8Q A;  4K2K A;  1CKN B;  4FVM A;  1KAA A;  4GLX A;  2R93 H;  1V1P B;  2J0T D;  3N6R A;  3J81 E;  1W6J A;  3A8I E;  2B63 G;  2B2T A;  3CRK C;  2PNH A;  3U58 A;  4KKU A;  1JMC A;  2E76 C;  3MTS A;  5A35 A;  2DN8 A;  4RGM A;  2SEB D;  2A69 C;  3A8K E;  4RHS A;  3PO3 H;  5I6W A;  5C44 H;  4ME3 A;  5KND A;  2OT2 A;  5JEA J;  2KJX A;  1HA6 A;  4GOP B;  2EYL A;  4BY7 G;  1FJG Q;  2EY5 A;  3HOX G;  2QA4 A;  3SK6 A;  3NQT A;  4DR2 L;  1O7I A;  2D2C C;  5C5L A;  1AZP A;  1LTS D;  2EVB A;  3M4O B;  4JBM A;  1KAW A;  1IHZ A;  4YCU A;  1VQ8 A;  2YU9 H;  4LF8 Q;  4A3D G;  2PI2 E;  2R7Z B;  3D6C A;  5KYI A;  1IBL L;  2XVS A;  3HKS A;  4H7B A;  1A3V A;  2IX1 A;  1DYQ A;  3VA7 A;  4R4T A;  2LFN A;  4IOC A;  4X62 L;  1D5M C;  1I94 Q;  3OIP A;  4FXD A;  5FJ8 G;  3SK4 A;  2NWG A;  2KOL A;  4XTC S;  5EBD A;  4DV6 L;  4DR5 Q;  1HZC A;  2K33 A;  4LF7 Q;  4IUV A;  5CYU A;  1EIF A;  4V0B A;  4ZK9 B;  1N34 L;  1CKO A;  2D0P A;  1XPU A;  1A15 A;  3RZD B;  4R4I A;  3T56 B;  4A3F B;  1X3G A;  1P8L A;  1STH A;  2F03 A;  4LJZ C;  5H1S E;  1Y8O B;  1BCP F;  3DWP A;  2EDG A;  1E22 A;  4DGZ A;  4BBR B;  4ZKB B;  3TBI B;  5BN3 A;  4LF9 Q;  5FOB B;  1EWH A;  2RA4 A;  3A7L A;  3RN5 A;  4ZYS A;  5EQ0 A;  5C3X A;  2VW9 A;  4ZQ3 A;  2V1C C;  4JI0 L;  3GTO B;  3CF5 A;  1ZXT A;  1EYD A;  4O42 A;  4JOI C;  1LAB A;  1U4R A;  2IL8 A;  3KLS X;  4OWW B;  2UXD Q;  4A3M B;  2PW5 A;  5E1F A;  4LUO A;  1CFM A;  3I4M H;  2B29 A;  2OF1 A;  2K01 A;  3S16 B;  5C4X G;  4OO1 H;  3OMC A;  1L0X B;  2KCC A;  4HIM A;  4B3M Q;  2E5L L;  1YJW A;  3TP7 A;  2F0O A;  1Q8I A;  1Y8N B;  3TN2 A;  2I5L X;  4K8I A;  3OWF A;  4HSP A;  5KNB A;  3AQQ A;  1Q90 A;  3VR5 A;  4OO1 I;  2LS0 1;  4JI1 L;  3WOF A;  1VQF A;  2EYH A;  3C46 A;  2DJF C;  4HMI A;  3CW2 C;  3J81 j;  2P5Z X;  1GUS A;  3AYH B;  2Y0S B;  2ZTE A;  1X6O A;  3GQB A;  1YNJ C;  1FR3 A;  2A6E C;  2F4I A;  1IYJ B;  4G4K A;  3NTK A;  3NP8 A;  5M5Y B;  1V9P A;  1QZG A;  3VR4 A;  3DM1 A;  1E2V A;  4M1U B;  4FF1 A;  3NBI A;  1VQE A;  1VQB A;  3TEH B;  1XNR L;  2B39 A;  5IT9 E;  1D5X C;  3A5Z B;  2Z4H A;  2A68 D;  4LF5 Q;  3UDI A;  4LF6 L;  1OXS C;  1ICW A;  1AN8 A;  4JI3 Q;  3P20 A;  2F0U A;  2K5D A;  1MJC A;  2Y0S E;  2UUB Q;  5JAV A;  4YHH L;  1Y1W B;  1EWI A;  3I7F A;  1YIT A;  3SK8 A;  5FLX L;  1LAC A;  1VQ7 A;  3CCV A;  4IJL A;  3TZU A;  1TWF B;  5M3F B;  4BBS H;  3RLO A;  3ERS X;  3ND9 A;  1PZJ D;  3HKZ E;  3QR8 A;  3I4N B;  4K8J A;  3NE5 B;  2JA8 G;  4ZCK A;  1Q1B A;  2WFW A;  3F2B A;  1C7Y A;  1SNP A;  3CCR A;  3OOC A;  4K5W A;  1XMO L;  3NTI A;  1LTI D;  2A74 C;  2VQE Q;  3Q23 A;  3Q24 A;  5IWA L;  1SYF A;  1BR9 A;  1PXU A;  1U0L A;  4XIG S;  1KNE A;  2JSO A;  5GRO A;  1N8R C;  4UHV A;  3FKI G;  2CQA A;  4OIK A;  4C3J H;  5EKK A;  3H3V C;  2K6A A;  1GUT A;  1ESF A;  1TS3 A;  3EN2 A;  4IQZ A;  4EGV A;  3P7J A;  2QEX A;  1MBY A;  3GTG B;  4C56 C;  5TSS A;  4LNQ A;  2JP1 A;  3J7A 5;  3L0O A;  1YIJ A;  2F0G A;  2JN4 A;  4RA8 A;  3MEF A;  4DR3 Q;  4PMW A;  2RCN A;  4DV1 Q;  1WTR A;  1FNW A;  2F0J A;  3JAM i;  2CW0 D;  3MFY A;  1A62 A;  4PZ7 A;  2G5D A;  5J3B A;  3NK9 A;  5ELC A;  4ILW A;  1ASY A;  1A6X A;  2F0N A;  4JI8 L;  1QNK A;  3WWV A;  1NSN S;  2L15 A;  5C4Z A;  1L0W A;  5D3D A;  3A8J E;  3GO5 A;  1NCV A;  1VQJ A;  2XNA C;  3MFG A;  1FVI A;  5EKL A;  5JPM C;  1JOK A;  2R61 A;  1KL9 A;  3MVV A;  4ID6 A;  4PZ8 A;  3RLN A;  1D6E C;  1AFP A;  4N9P A;  4HJ5 A;  1PH6 A;  3S1R B;  1CI3 M;  2VB3 X;  4CKB A;  2F4V L;  3PCO B;  3U9S A;  3G7L A;  3CP0 A;  3J80 i;  4WJW A;  4R4Q A;  3FP9 A;  4LFC L;  2HUG A;  2R7Z G;  3H0G H;  1HHV A;  2A73 B;  2Q2U A;  3PQI A;  5C3E B;  1VDZ A;  4IJH A;  5BR8 L;  3BDL A;  4NPS A;  5COY A;  2UU9 Q;  1B53 A;  3M9B A;  3G4S A;  2WAQ B;  3ER0 A;  5LMN L;  4BY1 H;  4A3K B;  4A3F G;  4XT1 B;  2NBF A;  5AJ3 Q;  1S5D D;  2A68 C;  2EY2 A;  2KED A;  4DV0 Q;  1ICF B;  1J5E Q;  1IL2 A;  5GQO A;  1RF2 D;  4BBR G;  1FNU A;  3DXJ C;  4FNF A;  3CAM A;  5E7N A;  1DJR D;  3F2D A;  3TP8 A;  1Q8K A;  3T16 A;  4JCV E;  3IRB A;  4Y7N H;  1YEZ A;  1OO9 B;  1EYC A;  3OYY A;  4JI7 Q;  2F0E A;  2WAQ E;  3CCE A;  4P75 A;  3EA6 A;  1N33 Q;  3I56 A;  1YI2 A;  4A3M G;  1AW7 A;  4EX5 A;  3VYU A;  3CME A;  1HPC A;  4RH6 A;  1OXT A;  4ALP A;  1PRT F;  5FLX E;  4DV7 L;  1KD1 C;  4HR7 B;  2AKW B;  2EYP A;  1XJV A;  1JQY D;  1JOQ A;  1JT8 A;  5E4W C;  1W2B A;  1I4P A;  1LTL A;  4JC0 A;  1X9N A;  2YTY A;  2WII B;  3W1B A;  3HOY B;  1EY0 A;  1LT3 D;  1LUZ A;  1I6H B;  3VDY A;  2M9V A;  5A2Q L;  4AQY L;  3TS0 A;  1I4G A;  1TWC B;  5L37 A;  5JJL A;  3UDG A;  1BO0 A;  1SYE A;  1TY2 A;  4LFB Q;  1WCM H;  2RKS A;  2VNU D;  3D8G A;  2JEB I;  3PIP A;  2CW0 C;  2JA7 H;  5ELE A;  1WD0 A;  2Y0S G;  2QW7 A;  2MO1 A;  4OL7 A;  1RTN A;  4DUY Q;  1CQF A;  4ZUJ A;  1PHJ A;  1ESR A;  2PO4 A;  5IGC A;  4DPG A;  1H9J A;  1I4R A;  1XTC D;  4YY3 Q;  2JA5 H;  2AWN A;  3ZYY X;  1G51 A;  3AB9 A;  4GOP C;  3S1N B;  2UXC Q;  4DV2 Q;  3A54 A;  1NUC A;  3PUY A;  4A3L G;  4OEL B;  3MXG A;  4B3T Q;  1HA5 A;  1EZ6 A;  3GTK H;  1PTO D;  3KLS A;  2HHH Q;  2PZW A;  4XYO A;  3RN2 A;  1NR2 A;  1BOS A;  3I8Z A;  3NEL A;  2R92 H;  1F9Q A;  4X3U A;  1STA A;  1Y1W G;  4R9W A;  1XPO A;  3KLR A;  2E2H H;  3PO2 B;  4P2C B;  4HIO A;  3NWT A;  5M3F G;  4N8X 1;  2B2T C;  3GTM B;  4IZ8 A;  4QQB X;  3VYT A;  4A3B B;  1CSQ A;  3I4N G;  1LLR D;  1VQD A;  4MTN A;  4LF8 L;  5J39 A;  1SSO A;  3SHL A;  3OW2 A;  3ITP A;  3IFT A;  1G2T A;  3A56 A;  3NBH A;  2N78 A;  3P75 A;  4DAV A;  3KJO A;  1Y69 U;  2A5H A;  3K7A H;  2LXJ A;  4KKS A;  1PV4 A;  1J8I A;  3I55 A;  1I4X A;  4CDC C;  1VMC A;  3K5M A;  4LF7 L;  1D8L A;  1Q3L A;  1KRT A;  2Z6B A;  1PFS A;  3RUZ A;  3QG1 A;  3DWQ A;  2KHI A;  3I4O A;  1LTG D;  1MI2 A;  4LF4 Q;  1BF4 A;  4MHE A;  3VR6 A;  4C2M H;  3DEO A;  3EBE A;  1V1Q A;  2FMM A;  1WI5 A;  4IPC A;  2F0W A;  5IYC H;  1G6P A;  1Z7T A;  1K83 B;  4GLA C;  4P73 A;  4K5X A;  4LF9 L;  2RHS B;  2JK8 A;  4NDX A;  1B7Y B;  1WJJ A;  3PIO A;  1TWG H;  3MAQ A;  1TS4 A;  3S1M B;  2B2U A;  4K6D A;  4X3K A;  3GV6 A;  2IWH A;  4YWL A;  3NXW A;  5IP7 G;  2Z4I A;  4GKJ L;  4X3S A;  4TKO B;  3PIP 3;  4NXN Q;  2LKV A;  2BA0 A;  1EY9 A;  1Y1V H;  2JYO A;  4B3S Q;  5IYB H;  1K9M C;  2EY1 A;  3NBH B;  1X3E A;  1K8A C;  4BXX G;  3KYH C;  1M1K C;  2PQE A;  4DV3 Q;  3GTP B;  3CCQ A;  4QF4 A;  1VQL A;  2G9D A;  3S24 A;  3PUZ A;  3EIV A;  4B3M L;  1X56 A;  4C3H H;  1O7L A;  2AHO B;  2AMC B;  3OTO Q;  3CPW A;  3E0J A;  3CQZ B;  1F2L A;  2K04 A;  3T1Y L;  3U4V A;  1FGU A;  3ICE A;  5M5W B;  1GJX A;  4OXP A;  2KA7 A;  3S2D B;  4JI4 Q;  1VQC A;  2AWO A;  4YIJ A;  2R93 B;  3A55 A;  1ILQ A;  1K3B C;  1OXV A;  4DXF A;  3IL8 A;  1CUK A;  2J7Z A;  5C3E G;  2QEJ C;  5A2Q E;  1J6Q A;  3I90 A;  5JPN C;  5KIX A;  2VUM H;  4K5V A;  1KXL A;  2KUM A;  2PMZ B;  4DR6 Q;  3G48 A;  1SDF A;  2F0I A;  1N36 Q;  3PO3 B;  1E7Z A;  1STG A;  2Q2H A;  5IGB A;  3NWS A;  2WAQ G;  3QJY A;  2GVB A;  5C44 B;  2L1B A;  4U68 A;  4A3K G;  2X6L A;  1PTO C;  4F87 A;  1NY4 A;  2DNC A;  4OX9 Q;  2JE6 I;  1EY4 A;  2IY5 B;  5CMD A;  4FDB A;  3AMU A;  2WB1 B;  3LX0 A;  1AE2 A;  1XYI A;  2UUA Q;  4XXE A;  2ZM6 Q;  2YU9 B;  4JI3 L;  3SDZ A;  2MP1 A;  1QUQ A;  3HOZ H;  4GLV B;  4DU9 A;  1YNN D;  2ZXP A;  1SJH D;  3BVZ A;  2RDF A;  4OIJ A;  4X65 L;  4POF A;  1ZYR D;  2L0C A;  2KEN A;  4DA2 A;  3V2T A;  3MZ5 A;  2PMZ E;  4PNY A;  1SMX A;  5M3M H;  1SYG A;  1Z9F A;  4JVZ A;  2C9O A;  1X65 A;  2NVT H;  1WTP A;  1I4H A;  3HOU H;  1IL8 A;  1YNJ D;  2NYZ D;  3MXP A;  4KJO A;  2E2D C;  5FO7 B;  3F2C A;  1QVC A;  1XXG A;  2H4O A;  1LTT D;  1R9T H;  1GO3 E;  2PW7 A;  1GUW A;  1VMP A;  1JIC A;  4DF7 A;  1ROD A;  2HQE A;  1SJE D;  2EE1 A;  2CCZ A;  4K2L A;  5JVH 3;  2JA9 A;  1AE3 A;  3HOY G;  1P16 A;  1HXY D;  4JI5 Q;  3V05 A;  2MPM A;  5DM6 3;  1SNC A;  2EXZ A;  1XWE A;  4QB4 A;  4G7O C;  4KHP L;  4RG1 A;  4KD3 A;  3KLW A;  3TSS A;  1UAP A;  1WOC A;  4IOA A;  3NEN A;  1LYL A;  1KTK A;  1QUQ B;  3WOE A;  4POG A;  4L6T B;  1K28 A;  1II3 A;  1A3U A;  3T13 A;  1UEA B;  4DV1 L;  3QIA A;  1QE6 A;  3L3O C;  3S17 H;  1DM0 B;  3I4M B;  5KNC A;  4BA2 I;  2AUK A;  4J1M A;  2L9H A;  2NZ1 D;  4CKE A;  1SE4 A;  2PZU A;  1HNW L;  3DUZ A;  3GV3 A;  4QL5 A;  1MSG A;  4UDU C;  1U9R A;  1HJP A;  3UE0 A;  3PUV A;  3QB3 A;  4AH6 A;  1Z6H A;  2PQA A;  3H15 A;  2NZO A;  2EYM A;  4PQX A;  4R4O A;  1TWA H;  5M5X H;  4K0K L;  1R4P B;  4A4I A;  1ASZ A;  3DHQ A;  2JA6 H;  1YVC A;  2NN6 G;  1E1T A;  2F0D A;  3KF8 A;  4L5T A;  2RSN A;  3IAY A;  4S3S A;  3PO2 G;  4GS3 A;  3R3O A;  2O2L D;  3W5O A;  4JBW A;  1JE5 A;  4A3B G;  3TQY A;  1VQG A;  2ENB A;  2K5Q A;  1VQH A;  2N49 A;  3H91 A;  2F0V A;  2NVQ H;  4UAI A;  2HDL A;  3BVG A;  2Q8I B;  4Q5V A;  3PF4 A;  1E1O A;  1PA6 A;  5G3L D;  2IHE A;  1RDP D;  5HGT A;  3PUW A;  1A63 A;  4CJ2 C;  1K8O A;  4GZY C;  3P1H A;  4HIK A;  2UU9 L;  5T1G A;  1I3Q H;  3R8B A;  1AEX A;  2WKC A;  1SFO H;  1RD9 D;  2F0P A;  4JI6 L;  1NMG A;  4XYQ A;  3OPO A;  3NEM A;  5I2X A;  1B9M A;  1NR4 A;  2PQA B;  1TU2 B;  2CVR A;  1VS0 A;  5IY0 A;  2OTJ A;  5K36 H;  4WJ3 M;  4H13 C;  1DOM A;  3L7Z C;  3GTL H;  4BBS B;  4IPH A;  1YNN C;  3KF8 B;  1TY0 A;  2XIW A;  2E8G A;  2GVA A;  1ZYR C;  1K8G A;  3CCU A;  2L55 A;  3STB D;  3GDE A;  4K14 A;  2X6G A;  3HZX A;  3V96 A;  2HCI A;  5CBA E;  2XRQ D;  1SRU A;  1JJ2 A;  2K4K A;  1XNQ Q;  3SVM A;  1VQ6 A;  3U9O A;  2K5V A;  1K8M A;  1N33 L;  1X55 A;  1UE1 A;  4HJ8 A;  3OWE B;  4C3J B;  2N8N A;  1B8A A;  4HN7 A;  2Z6K A;  3I91 A;  5CR3 A;  5HGQ A;  4GN5 A;  1G6Z A;  4KI0 A;  1IBM L;  2XSC A;  2NTS A;  1YNX A;  3F8T A;  2EJM A;  2CWP A;  1GUN A;  2YTV A;  1EL0 A;  2X69 A;  4BBR H;  2RHQ B;  4H44 C;  4CKC A;  1VCI A;  3T53 B;  2DJG C;  4FYD A;  5I4D A;  1I50 H;  3M7N A;  1JWM D;  3UI2 A;  2HDM A;  3HEJ A;  3CCS A;  2R93 G;  1EY7 A;  2ZXR A;  5FLM H;  4LFB L;  1O7Y A;  1PTO B;  1T5X D;  1XMQ Q;  1JC7 A;  1HQM C;  4QCL A;  2JXM B;  4A3M H;  4IPG A;  4FF3 A;  1Z47 A;  1CK1 A;  2KEC A;  1S5F D;  1RJT A;  4A3J H;  4ZRZ A;  5JJI A;  2ZJQ A;  3CPF A;  1NBW A;  5IGF A;  5FO8 B;  2NUC A;  4YY3 L;  3PO3 G;  2E2I H;  2WP8 J;  5C44 G;  2PZT A;  2UXC L;  4DV2 L;  1SMY D;  1A8V A;  4LAA A;  1HFN A;  1IBK Q;  1CSP A;  4HJA A;  1QOH A;  2BDN A;  3SR1 A;  3S1Q H;  3HP3 A;  1DD2 A;  3I2Z A;  4GKK Q;  2UXB Q;  4C3I H;  3G6E A;  2B2W A;  2L4N A;  4A93 H;  2ALY B;  2F0L A;  3KDF A;  2A1A A;  2F0H A;  3H0G B;  1WD1 A;  3MXU A;  3K58 A;  1D2B A;  2Z1C A;  1L0Y B;  3S14 H;  3UDF A;  4A3E H;  4JPB W;  1FGB D;  2G9H D;  4CBV A;  4DNR B;  1XX8 A;  3SK5 A;  1QCB D;  2FFK B;  1W6K A;  5IGD A;  4KMU C;  1YHQ A;  2BH8 A;  1R4Q B;  1DON A;  4UP8 A;  2Z9H A;  1WTW A;  1PYS B;  4DV5 L;  4BY1 B;  1EQR A;  1JR0 D;  1Q7Y C;  4Y52 H;  1KAB A;  5DAU A;  4B3R L;  4YCW A;  3KBG A;  3HOW H;  3KFU A;  3HFZ B;  1MKH A;  1SYD A;  1WVL A;  2CWA A;  1G8Z D;  5CC4 A;  5J1Z A;  3O13 A;  3ZJY C;  1OXX K;  1TS5 A;  2KHJ A;  1PMR A;  3K6O A;  4PZ6 A;  4ME5 A;  2IX3 A;  4V19 0;  4CJ1 B;  1IBL Q;  5C4J H;  1J9O A;  2A19 A;  4DFA A;  1QG7 A;  2D9U A;  4PMC A;  4Y7N B;  4LF4 L;  5LL6 X;  1EZ8 A;  4KK7 A;  3LWU A;  1B3Q A;  3MXN A;  1KIX A;  3HOV H;  4DV6 Q;  3KJP A;  3KDF B;  2K75 A;  2NVY H;  1T5E A;  3LWE A;  2K28 A;  1YJN A;  1VQ5 A;  1GUG A;  4LK1 C;  3STB C;  1IYU A;  3I4M G;  2SDF A;  1RIP A;  4OO1 G;  2QCP X;  4DV4 Q;  4IFD H;  4NW2 A;  4IN3 A;  4NXN L;  4LUZ A;  4NXM Q;  3KK7 A;  1GD7 A;  3U4Z A;  2XRS D;  4CGY B;  5C0X H;  1D1I A;  1H9R A;  4KLK A;  3E6Z X;  3Q6S A;  3ND8 A;  3U50 C;  2H5X A;  3EVQ A;  5FK9 C;  1ONL A;  2IW3 A;  4JI0 Q;  4GN4 B;  4IFD I;  2B2U C;  5IIF A;  1I4Q A;  2MNA A;  4RFB A;  4MNO A;  1LM0 A;  1WCM B;  1RTO A;  1BCP B;  2JA7 B;  2MO0 A;  5KEE A;  3CMA A;  3OTO L;  5C0X I;  4QUF A;  3EJI A;  2E2J H;  4CDE C;  3MXN B;  3J7Z C;  2B2V C;  3FPP A;  5IP7 H;  5DNF A;  2JA5 B;  1MHW C;  1CKM A;  1YHA A;  5IYD H;  1I6V C;  3VYS A;  1HZA A;  4RWS C;  2FXQ A;  3K0Y A;  4ZKC B;  1MJE A;  2BOS A;  4A3C H;  4A3G B;  2E74 C;  5KGU A;  2XGT A;  3DWA A;  3GTK B;  1MSH A;  3RZO H;  1AH9 A;  2KCT A;  1EOT A;  1S3O A;  1SMY C;  2MUY A;  1HH2 P;  2YV5 A;  1X3P A;  3C1E A;  5AFW A;  4DR6 L;  1TS2 A;  2K5W A;  3ULL A;  5JEA H;  2R92 B;  4QMG A;  1PVO A;  4DN4 M;  2AQ1 B;  2B8G A;  3Q8D A;  4EQP A;  3DLL A;  1EIH A;  3E5S A;  4OX9 L;  4IUQ A;  2IJ0 A;  1KDA A;  2E2H B;  5KRU A;  3NUC A;  1PZK D;  4BBS G;  2UUA L;  3RD4 A;  1G29 1;  2A6H D;  4P74 A;  2ZM6 L;  3AU7 A;  1TVX A;  4HCE A;  1IYV A;  2Q8R E;  1I5F A;  4DK3 C;  3SGI A;  2J4X A;  2FMC A;  3NPP A;  2Z0S A;  1PRT C;  3VYR A;  1IXR A;  1ENC A;  2ASB A;  1E3P A;  2GA4 B;  4HAE A;  4KY5 A;  2EQS A;  4EQ5 A;  2O4X A;  3D4D A;  3K7A B;  2ATW A;  4LF6 Q;  5EJW A;  1VQP A;  1L1O A;  4QIW B;  4AIM A;  3OSO A;  4C3J G;  3S2H H;  1JCK B;  2DY7 A;  1HR0 W;  1M8A A;  1SAP A;  1EEF D;  3MA2 B;  3J7A F;  1SEB D;  2HIV A;  2Q8T A;  4C2M B;  3D31 A;  2H1E A;  2OQK A;  1VQI A;  2K05 A;  4QUC A;  1ZEQ X;  4HSV A;  3J81 i;  1KQS A;  3HG9 A;  3CC2 A;  2XWB B;  1TWG B;  3RMH A;  4JI5 L;  5BN4 A;  5GAD C;  3A7A B;  1STY A;  3MC0 B;  3T51 B;  1QIL A;  5IP9 G;  5ELB A;  1FJG L;  3BS1 A;  5IWA Q;  2ZTC A;  1GHK A;  4JV5 Q;  1Y1V B;  3QWN A;  5IE8 A;  4QIW E;  4A3I H;  3TRZ A;  1LTA D;  1V8Q A;  1E2Z A;  1FYC A;  4XDX A;  2K7V A;  2EYO A;  1ML0 D;  1Y8P B;  1EYG A;  4RGT A;  2B63 H;  2Q2T A;  3TS2 A;  4HTH A;  1D7Q A;  1DXM A;  1L1O B;  2EPB A;  1W3S A;  4E6I A;  4P71 A;  3S15 H;  1I94 L;  1B9N A;  1PFN A;  1K73 C;  1SRO A;  4C3H B;  1EY6 A;  4DR5 L;  3CKI B;  4NP5 A;  2ICI A;  4JI2 Q;  2UUC Q;  1F9P A;  1RKN A;  4DAY A;  4X6A H;  3R93 A;  5ISR A;  4X64 Q;  2NVX H;  1IKL A;  4BY7 H;  2D62 A;  5DLQ E;  3HOX H;  3FMC A;  1TXY A;  3H0G G;  4APV A;  2VXW A;  3VR2 A;  1K3R A;  3GD7 A;  1SN8 A;  5LMU Q;  4A3D H;  2VUM B;  1EIG A;  2N55 A;  4B9W A;  2OCE A;  1F2M A;  1N9W A;  1K0S A;  4BY1 G;  2OEO A;  3J7A V;  4KY7 A;  1U4M A;  5I2Y A;  5FJ8 H;  1VQO A;  2F4V Q;  1C0A A;  4DKA C;  5D3I B;  1RHP A;  2B2V A;  2JJQ A;  4IUU A;  3MEH A;  2UXD L;  2Q2I A;  5COR A;  1MGS A;  2MGS A;  3CCJ A;  2FHT A;  4LFC Q;  2HT1 A;  2B8F A;  4FF2 A;  1PYB A;  3HOZ B;  2LSS A;  3K0X A;  3ONA B;  2GN5 A;  4DAY B;  2OTL A;  2A6H C;  4KHZ A;  4IO9 A;  1E24 A;  3NQI A;  2ZT9 C;  1F9S A;  5M3M B;  4ABN A;  2NVT B;  4BS9 A;  4DK6 C;  3H3V H;  3HOU B;  2EYJ A;  2F0F A;  4JBJ A;  2OWO A;  4KHV A;  3L9A X;  3GTJ H;  3PMF A;  5ELD A;  4R8I A;  1LTB D;  1R9T B;  4O0A A;  1BKB A;  3CU7 A;  3KF6 A;  2D0O A;  1HNZ Q;  1QB5 D;  3T1H Q;  1RCV D;  1S72 A;  1BCP D;  5C4X H;  1PH9 A;  2WV6 D;  3AEV A;  4R8N A;  5GAG C;  3H94 A;  2SOB A;  4WRD A;  4DR4 Q;  1BQQ T;  4C1N K;  2IX0 A;  4ZAI A;  4EQN A;  2VQF Q;  3VA5 A;  2C5C A;  5CV7 A;  2SNM A;  1WCM G;  1JE4 A;  2JA7 G;  3VR3 A;  4LF5 L;  2EOT A;  4EQO A;  3S1M H;  1JJG A;  2KQ3 A;  3OMG A;  4UP9 A;  1BNZ A;  3IFD A;  2JA5 G;  2UUB L;  4Z9C B;  4IFD J;  3H6M A;  1C9O A;  3SEB A;  2B3G A;  2TMP A;  2Z6K C;  3CCM A;  2I5H A;  1HNX Q;  1YJ9 A;  2K1B A;  2DNE A;  4WFN 3;  5C6A A;  4A3G G;  1QNU A;  3M4Q A;  1H9S A;  3PIO 3;  1D5Z C;  3I72 A;  4CDF C;  3BDC A;  1HR0 Q;  4AQY Q;  1MIU A;  4WJ4 A;  2E75 C;  4LUV A;  1CZW A;  2WB1 E;  1TWA B;  5M5X B;  3ULP A;  2CH4 A;  2VQE L;  4OWT B;  3C1F A;  2R92 G;  2R7F A;  2JA6 B;  3BZC A;  4FO2 A;  1PRT B;  4HJ9 A;  5NUC A;  1U4P A;  1DCZ A;  5I9P A;  3G71 A;  4O2D A;  4TVA B;  1KDB A;  1S4Z A;  3ULJ A;  2RSO A;  1E2W A;  4GKK L;  2UXB L;  3E9H A;  5E4X A;  1EOV A;  1Q1E A;  1XTD A;  2VY3 A;  1KLG D;  1EIY B;  2NVQ B;  2ZXO A;  3PGZ A;  1KDC A;  2I5M X;  1SNM A;  2LXK A;  4DR3 L;  1TWH H;  3C2P A;  3CXC A;  4HJ7 A;  2JA8 H;  3BZK A;  1JOO A;  3HGB A;  4FXK C;  1EQQ A;  3W2D A;  3JC6 6;  1I3Q B;  2ZTD A;  4HMJ A;  3M3Y H;  1XPR A;  2DUD A;  1SFO B;  4IAL A;  4YWM A;  1H9S B;  1UEB A;  1LT5 D;  3BVM A;  2PYK A;  2B2W C;  1GM5 A;  2K5N A;  1Q81 C;  1CM9 A;  1ILP A;  1NJI C;  3FKI H;  4J6H A;  5IYC G;  1PH4 A;  4BA1 I;  3EQL C;  3GTL B;  4QY7 A;  2VS1 A;  3PSI A;  1TQO A;  1PH5 A;  1VQM A;  2KHS A;  3RLF A;  3GTQ H;  5EAY A;  4F8M A;  2A8V A;  4N9T A;  4L63 B;  1EQV A;  3PF5 A;  1TT2 A;  1UE5 A;  1WTX A;  1UE6 A;  4DR7 Q;  2BCO A;  4LWC A;  2IT1 A;  4PV1 C;  4ULL A;  4PG3 A;  1Y1V G;  2R3Z A;  3T4A C;  1C8C A;  1CT1 D;  5IYB G;  4TQU S;  1JB7 A;  2HQL A;  5LHY 1;  2F3V A;  4X3T A;  2QDB A;  3CCL A;  4L5R C;  3URY A;  2FIN B;  1SE2 A;  3BZD B;  4DV4 L;  4KY6 A;  4QGU A;  5JJZ A;  5JVG 3;  1BCP C;  2TSS A;  4NXM L;  5I9O A;  4DR1 Q;  3R2I A;  4C3H G;  1DZ1 A;  3K81 C;  2QGQ A;  1I50 B;  3FPU B;  1S5B D;  1M4V A;  3N52 A;  3F2U A;  1U5K A;  3I73 A;  5C3W A;  3CC7 A;  4A76 A;  1C4Q A;  3J7Y W;  4GKJ Q;  4DNI A;  1B2T A;  3DM3 A;  2EZV A;  2CQO A;  1F2Z A;  5FLX c;  5AJ3 L;  1EQT A;  3DEP A;  1X3Q A;  4KN7 C;  4DV0 L;  5IGE A;  1J5E L;  3M4O H;  1SR3 A;  1BBU A;  1ET6 A;  1WTH A;  2R7Z H;  5GAH C;  1BVS A;  4A3J B;  2VUM G;  4MIU A;  1PH2 A;  4GNX A;  1TR5 A;  3CRL C;  2K14 A;  1TII D;  2E2I B;  4DK0 A;  4JI7 L;  4DUZ Q;  4IUN A;  4IUT A;  1BBW A;  3S1Q B;  4LMQ D;  3OIQ A;  4H0L C;  2K03 A;  3T1Y Q;  1IKM A;  1H9K A;  2B2Y C;  2IPK D;  4C1N I;  4C3I B;  3TP5 A;  3RZD H;  4A3F H;  1PH8 A;  2R7D A;  2M00 A;  4A93 B;  3HOZ G;  1Q46 A;  2RCF A;  4RCN A;  5CBE E;  5T1I A;  4HID A;  2O5I C;  1STN A;  4B08 A;  2HD3 A;  2MHV A;  1PZI D;  3S14 B;  4I7A A;  4X66 Q;  5GAE C;  4A3E B;  1SNQ A;  3HS0 C;  5M3M G;  1EY5 A;  1Q82 C;  1NTG A;  2L5T A;  4UY8 C;  3UDX A;  2K50 A;  3HOU G;  3SE0 A;  3HKZ B;  3D3R A;  3GTO H;  3D4W A;  4R4C A;  5EPK A;  5CV5 A;  3HOW B;  4WOR A;  2SNS A;  5IOC A;  1GHJ A;  4LFA Q;  4GNX B;  1H95 A;  1KLU D;  3JAM c;  4RMF A;  2I46 A;  4DUY L;  4MTK A;  3S16 H;  1KNA A;  4JYA Q;  1SND A;  5C4J B;  2FJ2 A;  2KCN A;  4X65 Q;  1L2F A;  4L5Q A;  1EFI D;  4OEM B;  4G7H C;  3B6Y A;  1N32 Q;  4DAP A;  2WB1 G;  3HOV B;  4B3T L;  2NVY B;  1F77 A;  2F0M A;  2XTI A;  2HHH L;  2K52 A;  2NTT A;  1FNV A;  1UE7 A;  3OW7 A;  4NB3 A;  1T9H A;  2IHF A;  3GP7 A;  4RHR A;  1HCZ A;  2N3S A;  1SE3 A;  3K7U C;  1L1O C;  1IW7 D;  1HZ9 A;  3E9I A;  5CGK A;  1SLJ A;  2ES2 A;  4JV5 L;  1PRT D;  3J80 c;  2KVM A;  1S5E D;  3TDQ A;  4NKL A;  4F7X A;  5M5Y H;  4FF4 A;  1B50 A;  1SYB A;  5G3L F;  2NZH A;  5M9O A;  4KHP Q;  3MHB A;  2KBN A;  1RL2 A;  1EU3 A;  1D1K A;  4L5S A;  3CD6 A;  4A3L H;  2N88 A;  2VZA A;  3NTH A;  3QOL A;  5ELN A;  4DR2 Q;  3FEW X;  2JA6 G;  3FDT A;  3TME A;  2RQX A;  1QVF A;  5LL6 S;  1SE8 A;  4RKL A;  4KKT A;  2O5J C;  4JI2 L;  2WAC A;  1LT6 D;  1GUO A;  2UUC L;  2MFI A;  2E2J B;  1UWV A;  1AP0 A;  2F3I A;  1SNO A;  4X64 L;  1VF5 C;  4M8A A;  1Y1W H;  5IP9 H;  1B3A A;  2CKZ B;  1HUN A;  1BUV T;  1Y14 B; 
#chains in the Genus database with same CATH homology
 5IOD A;  4G7Z C;  3M7G A;  1PTO H;  2KEE A;  5JOB A;  1EY8 A;  3JAM L;  4EVO A;  1CHP D;  1H9M A;  1BDO A;  3KUP A;  3RZO B;  1SYC A;  1CA5 A;  4NMZ A;  3K5N A;  2BE5 D;  1JWS D;  3K5O A;  1G91 A;  4KJN A;  2ID0 A;  2QKI C;  3BG3 A;  2LMC B;  3D6W A;  1A3T A;  1EYA A;  5K36 G;  4FP5 D;  4F88 A;  1TKW B;  3FVQ A;  2PCF B;  2BDO A;  3M4Y A;  3R2T A;  3ERQ A;  1F9R A;  2B2Y A;  4KV6 A;  1VF7 A;  2L12 A;  3J80 L;  1BXT A;  5EKI A;  1A2U A;  1O80 A;  2D5D A;  3S2H B;  1U4L A;  2JEA I;  4XQQ A;  2RVL A;  3Q0A A;  4OHJ A;  4DK1 A;  4RAU C;  3NSW A;  4ODG A;  1BBX C;  3X3N A;  1O78 A;  2MJ8 A;  1CA6 A;  4RGO S;  3PUX A;  4AYB B;  1EWC A;  1DOK A;  1G2S A;  1QWY A;  3TZD A;  1Q12 A;  4TRD A;  4MN3 A;  4G57 A;  4IUP A;  1A2T A;  3K57 A;  4HCS A;  2NB0 A;  4A3I B;  4BWG B;  2Z8L A;  1IW7 C;  2M2L A;  1X32 A;  4U67 3;  2QIL A;  2V4D A;  3DMU A;  4PMB A;  1LT4 D;  2B63 B;  4I7Z C;  1LV9 A;  3S9W A;  1O7Z A;  1V1O A;  3S15 B;  2DY8 A;  5CV8 A;  4OGQ C;  3LNN A;  2RDH A;  5HUR A;  3I3C A;  4KD4 A;  4C3I G;  2NVX B;  3I4L A;  4BY7 B;  1CQV A;  3HOX B;  5CV9 A;  1STB A;  2F0S A;  3HRZ C;  2QF7 A;  3H09 A;  3EFX D;  4CJ0 B;  2ICE C;  1EU4 A;  2AUJ D;  1CZG A;  3BYT B;  4A3D B;  3FRP B;  4DNT B;  4B9X A;  1CHQ D;  5C5M A;  1AZQ A;  2F0Q A;  3ERO A;  4XQJ A;  3MWY W;  4KN4 C;  1OXU A;  5K5P A;  5FKA C;  2BE5 C;  2RDG A;  3QO2 A;  2PNR C;  1V43 A;  5DEH A;  3JAM E;  2F0T A;  4TSS A;  5ELF A;  3J81 L;  1B44 D;  4RKB A;  5IGG A;  3M85 A;  5CV6 A;  1UUP A;  1S5C D;  4IUR A;  3K5L A;  5EPJ A;  4XT3 B;  1E0B A;  1STE A;  1CTM A;  2HCC A;  3GTJ B;  3Q22 A;  4JK1 C;  4CHT B;  1LO5 D;  3CHB D;  4IFD G;  1ENF A;  5F2D A;  3X3M A;  2PPB C;  1ENA A;  5C0X G;  2WKD A;  5DM7 3;  5C4X B;  3PV0 A;  5BN5 A;  1EEI D;  1DOL A;  2A69 D;  1PDQ A;  3QOJ A;  1WTV A;  3G6J B;  1SXT A;  1PFM A;  2EJF C;  2F1M A;  5KYL A;  3J80 E;  1UNS A;  3OHX C;  2WIN B;  1C48 A;  2AQ2 B;  1GOZ A;  4L8J A;  2LY7 A;  2R6G A;  1MD2 D;  1QJO A;  1NAP A;  5D14 A;  4O1N A;  5FO9 B;  1B4O A;  3K59 A;  2NN6 H;  5E3F A;  3BYY B;  4ZLT F;  4Q0F A;  4K6L A;  5D65 A;  2VB2 X;  4FXG C;  1PFB A;  1JOR A;  1HRJ A;  4RGN A;  5EPL A;  3NHH A;  2BA1 A;  1HTP A;  2NN6 I;  1JWU D;  4RCO A;  5JEA G;  5C4H A;  1WTQ A;  2K32 A;  1HFG A;  3TP6 A;  1PTO F;  1FD7 D;  2EYF A;  4HED A;  1ET9 A;  3C3L A;  2XN9 C;  2I07 B;  1PYW D;  1ZKO A;  2CHB D;  1TWH B;  4DXG A;  3I70 A;  1F2Y A;  2JA8 B;  1V1P A;  4ZUI A;  1GXD C;  5EGT A;  3S17 B;  3WDN A;  1HTL D;  3D4R A;  3M3Y B;  1PLF A;  1JB3 A;  2F3W A;  3IKJ A;  4KTA A;  2YYZ A;  1HUM A;  5EBC A;  2XWJ B;  5C0X J;  1SBB B;  3FKI B;  2RBM A;  3SXH A;  2OXP A;  3KBX A;  3GTQ B;  1B1Z A;  5CV4 A;  1HQR D;  1WTO A;  3W3A A;  5J22 A;  4XQN A;  2EY6 A;  1LTR D;  2AQ3 B;  4I65 A;  2EJG C;  5IT9 L;  3BDO A;  5I6Y A;  2F0K A;  2L11 A;  2A6E D;  4J8Q A;  4K2K A;  4FVM A;  1KAA A;  1V1P B;  2J0T D;  3N6R A;  3J81 E;  1W6J A;  3A8I E;  2B2T A;  3CRK C;  4KKU A;  2E76 C;  3MTS A;  5A35 A;  2DN8 A;  4RGM A;  2SEB D;  2A69 C;  3A8K E;  4RHS A;  5I6W A;  5KND A;  2OT2 A;  5JEA J;  2KJX A;  1HA6 A;  2EYL A;  2EY5 A;  3SK6 A;  3NQT A;  2D2C C;  5C5L A;  1AZP A;  1LTS D;  2EVB A;  3M4O B;  1IHZ A;  2R7Z B;  3D6C A;  5KYI A;  2XVS A;  4H7B A;  1A3V A;  2IX1 A;  1DYQ A;  3VA7 A;  2LFN A;  1D5M C;  3OIP A;  4FXD A;  3SK4 A;  2NWG A;  2KOL A;  4XTC S;  5EBD A;  2K33 A;  4IUV A;  5CYU A;  4V0B A;  4ZK9 B;  1A15 A;  3RZD B;  3T56 B;  4A3F B;  1STH A;  2F03 A;  4LJZ C;  1Y8O B;  1BCP F;  3DWP A;  2EDG A;  4DGZ A;  4BBR B;  4ZKB B;  3TBI B;  5BN3 A;  5FOB B;  1EWH A;  2RA4 A;  3A7L A;  4ZYS A;  5EQ0 A;  5C3X A;  4ZQ3 A;  3GTO B;  1ZXT A;  1EYD A;  4O42 A;  1LAB A;  1U4R A;  2IL8 A;  3KLS X;  4A3M B;  2PW5 A;  5E1F A;  1CFM A;  2OF1 A;  2K01 A;  3S16 B;  4OO1 H;  3OMC A;  1L0X B;  2KCC A;  3TP7 A;  2F0O A;  1Q8I A;  1Y8N B;  3TN2 A;  4K8I A;  3OWF A;  4HSP A;  5KNB A;  1Q90 A;  3VR5 A;  4OO1 I;  2LS0 1;  3WOF A;  3C46 A;  2EYH A;  4HMI A;  1GUS A;  2Y0S B;  3GQB A;  1YNJ C;  1FR3 A;  2A6E C;  2F4I A;  4G4K A;  3NTK A;  3NP8 A;  5M5Y B;  3VR4 A;  3DM1 A;  1E2V A;  4M1U B;  4FF1 A;  3NBI A;  2B39 A;  5IT9 E;  1D5X C;  2Z4H A;  2A68 D;  1OXS C;  1ICW A;  1AN8 A;  3P20 A;  2F0U A;  2K5D A;  5JAV A;  1Y1W B;  3SK8 A;  5FLX L;  1LAC A;  3TZU A;  1TWF B;  5M3F B;  3ND9 A;  1PZJ D;  3I4N B;  4K8J A;  3NE5 B;  1Q1B A;  1SNP A;  3OOC A;  4K5W A;  3NTI A;  1LTI D;  2A74 C;  3Q23 A;  3Q24 A;  1SYF A;  1BR9 A;  1PXU A;  4XIG S;  1KNE A;  2JSO A;  4OIK A;  2CQA A;  5EKK A;  3H3V C;  2K6A A;  1GUT A;  1ESF A;  1TS3 A;  4IQZ A;  4EGV A;  3P7J A;  1MBY A;  3GTG B;  4C56 C;  5TSS A;  2JP1 A;  2F0G A;  4RA8 A;  4PMW A;  1WTR A;  1FNW A;  2F0J A;  2CW0 D;  3MFY A;  3NK9 A;  5ELC A;  4ILW A;  1A6X A;  2F0N A;  1QNK A;  1NSN S;  5C4Z A;  5D3D A;  3A8J E;  3GO5 A;  1NCV A;  3MFG A;  2XNA C;  5EKL A;  5JPM C;  1JOK A;  2R61 A;  3MVV A;  4ID6 A;  1D6E C;  1AFP A;  4N9P A;  3S1R B;  1CI3 M;  2VB3 X;  4CKB A;  3U9S A;  3G7L A;  4WJW A;  2HUG A;  1HHV A;  2A73 B;  5C3E B;  1VDZ A;  3BDL A;  5COY A;  1B53 A;  2WAQ B;  4A3K B;  4XT1 B;  2NBF A;  1S5D D;  2A68 C;  2EY2 A;  2KED A;  1RF2 D;  1FNU A;  3DXJ C;  4FNF A;  1DJR D;  3TP8 A;  3T16 A;  1OO9 B;  1EYC A;  2F0E A;  3EA6 A;  1AW7 A;  3VYU A;  1HPC A;  4RH6 A;  1OXT A;  1PRT F;  5FLX E;  4HR7 B;  2EYP A;  1JQY D;  1JOQ A;  5E4W C;  1I4P A;  2WII B;  3HOY B;  1EY0 A;  1LT3 D;  1I6H B;  2M9V A;  5A2Q L;  1I4G A;  1TWC B;  1BO0 A;  1SYE A;  1TY2 A;  2RKS A;  2VNU D;  3D8G A;  2JEB I;  2CW0 C;  5ELE A;  1WD0 A;  4OL7 A;  1RTN A;  1CQF A;  4ZUJ A;  1ESR A;  2PO4 A;  5IGC A;  1H9J A;  1I4R A;  1XTC D;  2AWN A;  3ZYY X;  3AB9 A;  3S1N B;  3A54 A;  1NUC A;  3PUY A;  3MXG A;  1HA5 A;  1EZ6 A;  1PTO D;  3KLS A;  2PZW A;  4XYO A;  1NR2 A;  1BOS A;  3I8Z A;  1F9Q A;  4X3U A;  1STA A;  4R9W A;  3KLR A;  3PO2 B;  4P2C B;  3NWT A;  2B2T C;  3GTM B;  4IZ8 A;  3VYT A;  4A3B B;  1LLR D;  5J39 A;  1SSO A;  3SHL A;  3ITP A;  3IFT A;  1G2T A;  3A56 A;  3NBH A;  3P75 A;  4DAV A;  1Y69 U;  2A5H A;  4KKS A;  1J8I A;  1I4X A;  1VMC A;  3K5M A;  1Q3L A;  3RUZ A;  3QG1 A;  3DWQ A;  1LTG D;  1MI2 A;  1BF4 A;  4MHE A;  3VR6 A;  3DEO A;  2FMM A;  2F0W A;  1Z7T A;  1K83 B;  4K5X A;  4NDX A;  3MAQ A;  1TS4 A;  3S1M B;  2B2U A;  4K6D A;  4X3K A;  3GV6 A;  2IWH A;  3NXW A;  2Z4I A;  4X3S A;  4TKO B;  3PIP 3;  2LKV A;  2BA0 A;  1EY9 A;  2JYO A;  2EY1 A;  2PQE A;  3GTP B;  4QF4 A;  2G9D A;  3PUZ A;  1O7L A;  3E0J A;  3CQZ B;  1F2L A;  2K04 A;  5M5W B;  1GJX A;  2KA7 A;  3S2D B;  2AWO A;  4YIJ A;  2R93 B;  3A55 A;  1ILQ A;  1OXV A;  4DXF A;  3IL8 A;  2J7Z A;  2QEJ C;  5A2Q E;  5JPN C;  3I90 A;  5KIX A;  4K5V A;  2KUM A;  2PMZ B;  1SDF A;  2F0I A;  3PO3 B;  1STG A;  5IGB A;  3NWS A;  3QJY A;  5C44 B;  2L1B A;  4U68 A;  2X6L A;  1PTO C;  4F87 A;  2DNC A;  2JE6 I;  1EY4 A;  5CMD A;  3AMU A;  2WB1 B;  3LX0 A;  1XYI A;  4XXE A;  2YU9 B;  3SDZ A;  2MP1 A;  4DU9 A;  1YNN D;  2ZXP A;  1SJH D;  3BVZ A;  2RDF A;  4OIJ A;  1ZYR D;  2L0C A;  4DA2 A;  3V2T A;  3MZ5 A;  4PNY A;  1SYG A;  2C9O A;  1WTP A;  1I4H A;  1IL8 A;  1YNJ D;  2NYZ D;  3MXP A;  4KJO A;  2E2D C;  5FO7 B;  1XXG A;  2H4O A;  1LTT D;  2PW7 A;  1GUW A;  1VMP A;  1JIC A;  4DF7 A;  1ROD A;  2HQE A;  1SJE D;  2EE1 A;  4K2L A;  5JVH 3;  1HXY D;  3V05 A;  2MPM A;  5DM6 3;  1SNC A;  2EXZ A;  1XWE A;  4QB4 A;  4G7O C;  4KD3 A;  3TSS A;  1UAP A;  1KTK A;  3WOE A;  4L6T B;  1II3 A;  1A3U A;  3T13 A;  1UEA B;  3QIA A;  1QE6 A;  3L3O C;  1DM0 B;  3I4M B;  5KNC A;  4BA2 I;  2AUK A;  4J1M A;  2L9H A;  2NZ1 D;  4CKE A;  1SE4 A;  2PZU A;  3DUZ A;  3GV3 A;  1MSG A;  4UDU C;  1U9R A;  3PUV A;  3QB3 A;  1Z6H A;  2EYM A;  4PQX A;  1R4P B;  3DHQ A;  2NN6 G;  2F0D A;  3KF8 A;  2RSN A;  3IAY A;  4S3S A;  3R3O A;  2O2L D;  4JBW A;  2ENB A;  2K5Q A;  3H91 A;  2F0V A;  4UAI A;  2HDL A;  3BVG A;  2Q8I B;  4Q5V A;  5G3L D;  1RDP D;  5HGT A;  3PUW A;  4CJ2 C;  1K8O A;  4GZY C;  3P1H A;  5T1G A;  3R8B A;  1AEX A;  2WKC A;  1RD9 D;  2F0P A;  4XYQ A;  3OPO A;  5I2X A;  1B9M A;  1NR4 A;  1TU2 B;  2CVR A;  5K36 H;  4H13 C;  1DOM A;  3L7Z C;  4BBS B;  1YNN C;  1TY0 A;  2XIW A;  1ZYR C;  2L55 A;  4K14 A;  2X6G A;  3HZX A;  3V96 A;  2HCI A;  5CBA E;  2XRQ D;  3SVM A;  3U9O A;  1K8M A;  3OWE B;  4C3J B;  4HN7 A;  3I91 A;  5CR3 A;  1G6Z A;  4KI0 A;  2XSC A;  2NTS A;  2EJM A;  1GUN A;  1EL0 A;  2X69 A;  4H44 C;  4CKC A;  1VCI A;  3T53 B;  4FYD A;  5I4D A;  3M7N A;  1JWM D;  3UI2 A;  2HDM A;  3HEJ A;  1EY7 A;  2ZXR A;  1PTO B;  1O7Y A;  1T5X D;  1JC7 A;  1HQM C;  4QCL A;  2JXM B;  4FF3 A;  1Z47 A;  1CK1 A;  2KEC A;  1S5F D;  1RJT A;  4ZRZ A;  5IGF A;  5FO8 B;  2NUC A;  2WP8 J;  2PZT A;  1SMY D;  4LAA A;  1HFN A;  1QOH A;  2BDN A;  3SR1 A;  3HP3 A;  1DD2 A;  2B2W A;  2L4N A;  2F0L A;  2F0H A;  3H0G B;  1WD1 A;  3MXU A;  3K58 A;  1D2B A;  2Z1C A;  1L0Y B;  1FGB D;  2G9H D;  4CBV A;  4DNR B;  1XX8 A;  3SK5 A;  1QCB D;  2FFK B;  1W6K A;  5IGD A;  4KMU C;  1DON A;  1R4Q B;  1WTW A;  4BY1 B;  1JR0 D;  1KAB A;  5DAU A;  3KBG A;  1SYD A;  1WVL A;  1G8Z D;  5CC4 A;  5J1Z A;  3O13 A;  1OXX K;  1TS5 A;  1PMR A;  3K6O A;  4ME5 A;  2IX3 A;  4V19 0;  4CJ1 B;  1J9O A;  4DFA A;  1QG7 A;  2D9U A;  4PMC A;  4Y7N B;  5LL6 X;  1EZ8 A;  4KK7 A;  3LWU A;  3MXN A;  1T5E A;  3LWE A;  2K28 A;  1GUG A;  4LK1 C;  1IYU A;  2SDF A;  4OO1 G;  2QCP X;  4IFD H;  4NW2 A;  4IN3 A;  3KK7 A;  2XRS D;  4CGY B;  5C0X H;  1D1I A;  1H9R A;  3E6Z X;  3Q6S A;  3ND8 A;  3EVQ A;  5FK9 C;  1ONL A;  2IW3 A;  4IFD I;  2B2U C;  5IIF A;  1I4Q A;  4RFB A;  1WCM B;  1RTO A;  1BCP B;  2JA7 B;  5KEE A;  5C0X I;  4QUF A;  3EJI A;  2B2V C;  3FPP A;  5DNF A;  2JA5 B;  1I6V C;  3VYS A;  4RWS C;  3K0Y A;  4ZKC B;  2BOS A;  4A3G B;  2E74 C;  5KGU A;  3DWA A;  3GTK B;  1MSH A;  1EOT A;  1SMY C;  2MUY A;  3C1E A;  5AFW A;  1X3P A;  1TS2 A;  2K5W A;  5JEA H;  2R92 B;  4QMG A;  4DN4 M;  2AQ1 B;  2B8G A;  4EQP A;  1EIH A;  3E5S A;  4IUQ A;  2IJ0 A;  1KDA A;  2E2H B;  5KRU A;  3NUC A;  1PZK D;  3RD4 A;  1G29 1;  2A6H D;  3AU7 A;  1TVX A;  4HCE A;  1IYV A;  2Q8R E;  2J4X A;  3VYR A;  3NPP A;  2FMC A;  1PRT C;  1ENC A;  2GA4 B;  4HAE A;  4KY5 A;  2O4X A;  3D4D A;  3K7A B;  5EJW A;  4QIW B;  4C3J G;  3OSO A;  1JCK B;  2DY7 A;  1M8A A;  1SAP A;  1EEF D;  3MA2 B;  3J7A F;  1SEB D;  2Q8T A;  4C2M B;  3D31 A;  2H1E A;  2K05 A;  4QUC A;  1ZEQ X;  4HSV A;  3HG9 A;  2XWB B;  1TWG B;  3RMH A;  5BN4 A;  3A7A B;  1STY A;  3MC0 B;  3T51 B;  1QIL A;  5ELB A;  3BS1 A;  1GHK A;  1Y1V B;  3QWN A;  1LTA D;  1V8Q A;  1E2Z A;  1FYC A;  4XDX A;  2K7V A;  2EYO A;  1ML0 D;  1Y8P B;  4RGT A;  4HTH A;  1DXM A;  2EPB A;  4E6I A;  1B9N A;  1PFN A;  4C3H B;  1EY6 A;  3CKI B;  4NP5 A;  2ICI A;  1F9P A;  1RKN A;  4DAY A;  3R93 A;  5ISR A;  1IKL A;  2D62 A;  3FMC A;  2VXW A;  3VR2 A;  3GD7 A;  2VUM B;  1EIG A;  2N55 A;  4B9W A;  1F2M A;  2OEO A;  3J7A V;  4KY7 A;  1U4M A;  5I2Y A;  5D3I B;  1RHP A;  2B2V A;  4IUU A;  3MEH A;  5COR A;  1MGS A;  2MGS A;  2FHT A;  2B8F A;  4FF2 A;  3HOZ B;  3ONA B;  2A6H C;  4KHZ A;  3NQI A;  2ZT9 C;  1F9S A;  5M3M B;  4ABN A;  2NVT B;  4BS9 A;  3HOU B;  2EYJ A;  2F0F A;  4KHV A;  3L9A X;  3PMF A;  5ELD A;  4R8I A;  1LTB D;  1R9T B;  3CU7 A;  1QB5 D;  1RCV D;  1BCP D;  2WV6 D;  4R8N A;  3H94 A;  2SOB A;  4WRD A;  1BQQ T;  4C1N K;  2IX0 A;  4ZAI A;  4EQN A;  3VA5 A;  2C5C A;  5CV7 A;  2SNM A;  1JE4 A;  3VR3 A;  2EOT A;  4EQO A;  2KQ3 A;  3OMG A;  1BNZ A;  3IFD A;  4Z9C B;  4IFD J;  3H6M A;  3SEB A;  2TMP A;  2K1B A;  2DNE A;  4WFN 3;  5C6A A;  1QNU A;  3PIO 3;  1H9S A;  1D5Z C;  3I72 A;  3BDC A;  2E75 C;  1CZW A;  1TWA B;  5M5X B;  3C1F A;  2JA6 B;  4FO2 A;  1PRT B;  5NUC A;  1U4P A;  1DCZ A;  5I9P A;  1KDB A;  1S4Z A;  2RSO A;  1E2W A;  5E4X A;  1Q1E A;  1KLG D;  2NVQ B;  2ZXO A;  1KDC A;  1SNM A;  3C2P A;  3HGB A;  1JOO A;  4FXK C;  3W2D A;  1I3Q B;  4HMJ A;  1SFO B;  4IAL A;  1H9S B;  1LT5 D;  3BVM A;  2PYK A;  2B2W C;  1CM9 A;  1ILP A;  4J6H A;  4BA1 I;  3EQL C;  3GTL B;  1TQO A;  2KHS A;  3RLF A;  4F8M A;  4N9T A;  4L63 B;  1EQV A;  1TT2 A;  1WTX A;  2BCO A;  2IT1 A;  4PV1 C;  4ULL A;  2R3Z A;  3T4A C;  1C8C A;  1CT1 D;  4TQU S;  5LHY 1;  2F3V A;  4X3T A;  2QDB A;  3URY A;  2FIN B;  1SE2 A;  3BZD B;  4KY6 A;  5JJZ A;  5JVG 3;  1BCP C;  2TSS A;  5I9O A;  3R2I A;  4C3H G;  1DZ1 A;  1I50 B;  3FPU B;  1S5B D;  1M4V A;  3N52 A;  3F2U A;  3I73 A;  5C3W A;  1C4Q A;  3J7Y W;  1B2T A;  2EZV A;  1F2Z A;  1EQT A;  3DEP A;  1X3Q A;  4KN7 C;  5IGE A;  1ET6 A;  4A3J B;  4MIU A;  1TR5 A;  3CRL C;  1TII D;  2E2I B;  4DK0 A;  4IUN A;  4IUT A;  3S1Q B;  4LMQ D;  3OIQ A;  4H0L C;  2K03 A;  1IKM A;  1H9K A;  2B2Y C;  2IPK D;  4C1N I;  4C3I B;  3TP5 A;  2M00 A;  4A93 B;  4RCN A;  5CBE E;  5T1I A;  2O5I C;  1STN A;  4B08 A;  2MHV A;  1PZI D;  3S14 B;  4A3E B;  1SNQ A;  3HS0 C;  1EY5 A;  2L5T A;  3SE0 A;  3HKZ B;  3D3R A;  3D4W A;  5EPK A;  5CV5 A;  3HOW B;  4WOR A;  2SNS A;  5IOC A;  1GHJ A;  1KLU D;  2I46 A;  1KNA A;  1SND A;  5C4J B;  2FJ2 A;  2KCN A;  4G7H C;  1EFI D;  4DAP A;  3HOV B;  2NVY B;  1F77 A;  2F0M A;  2NTT A;  1FNV A;  3OW7 A;  3GP7 A;  4RHR A;  1HCZ A;  1SE3 A;  1IW7 D;  5CGK A;  1PRT D;  2KVM A;  1S5E D;  3TDQ A;  4NKL A;  4F7X A;  4FF4 A;  1B50 A;  1SYB A;  5G3L F;  5M9O A;  3MHB A;  1EU3 A;  1D1K A;  2N88 A;  3NTH A;  3QOL A;  3FEW X;  3FDT A;  3TME A;  2RQX A;  5LL6 S;  4RKL A;  4KKT A;  2O5J C;  2WAC A;  1LT6 D;  1GUO A;  2E2J B;  1AP0 A;  1SNO A;  1VF5 C;  4M8A A;  1B3A A;  1HUN A;  1BUV T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...