1SNDA

Staphylococcal nuclease dimer containing a deletion of residues 114-119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One-step evolution of a dimer from a monomeric protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE DIMER
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sndA00
4KD4A 2F0WA 4KY7A 5CV6A 1EYDA 3VA5A 5CV5A 5I6YA 4EQNA 3ITPA 1RKNA 3C1EA 5KRUA 2OEOA 4YIJA 3MHBA 4PMCA 4S3SA 1ENAA 3SK5A 1EY8A 3T13A 5I9OA 2PZTA 1KDAA 1SNOA 2RKSA 5E3FA 2QDBA 1F2YA 2PYKA 5J1ZA 3TMEA 2F0NA 3BDLA 1KDCA 2EY6A 3TP6A 3H6MA 3SK6A 4G57A 4DU9A 4B9XA 3OMCA 3MXPA 2SNMA 2PW7A 5J22A 5KYIA 2KHSA 1JOKA 1EYCA 1EY5A 3DHQA 1SYCA 3HEJA 5EKKA 1SNMA 1F2MA 1TT2A 2F0QA 3NK9A 4ODGA 4EQOA 2NUCA 3SR1A 5IGCA 4PMBA 4B9WA 5C4HA 1EQVA 1IHZA 5CC4A 4NKLA 5IGBA 4I65A 4HTHA 5CR3A 1A3VA 4QMGA 2ENBA 4KY6A 5CV7A 3TP5A 1KDBA 1SYEA 3OSOA 4IUNA 2EYPA 2F0SA 2EYLA 4K8IA 1STNA 5K5PA 3NXWA 1A3UA 4NMZA 2F0KA 3EROA 1SYDA 4K14A 5EGTA 4IZ8A 5I6WA 2OF1A 2KQ3A 5C4ZA 3D6CA 5IGGA 1SYGA 5I9PA 5CV4A 1EY0A 5IGDA 5KEEA 5M9OA 2F0UA 5C5LA 5IGEA 5KYLA 3DMUA 1SNCA 2WACA 2F0DA 2F3VA 3OMGA 2PW5A 1SNDA 3MEHA 2EYFA 4DGZA 4K8JA 5IOCA 4RKLA 5NUCA 2EYOA 1JOQA 2OXPA 4TRDA 5IIFA 3LX0A 4J6HA 2F0EA 4K5VA 1STGA 4H7BA 4KD3A 4N9TA 5CGKA 2EY5A 2LKVA 3SHLA 3ERQA 4F7XA 2F0LA 3D4DA 4OL7A 5CV8A 1EY6A 4IALA 4QB4A 5C3WA 4EQPA 5JAVA 3NQTA 3QOJA 4ZUIA 1TQOA 2EY2A 5C5MA 1EZ8A 4LAAA 1ENCA 1F2ZA 2EY1A 4RKBA 3MVVA 3P75A 3NHHA 4E6IA 2PZWA 5C6AA 4K5WA 1SNPA 3HZXA 3S9WA 1KAAA 1EY4A 2EYHA 1STBA 2F0FA 5HURA 2F0JA 5C3XA 4WORA 4KY5A 2SOBA 3TP7A 1STHA 1SYFA 3QOLA 3EVQA 2PZUA 4K6DA 4ZUJA 5ISRA 4DFAA 1JORA 4ID6A 3P1HA 4KV6A 4QF4A 3NP8A 3U9OA 2F0TA 2F0GA 5EKLA 1SYBA 4WRDA 5KGUA 2PQEA 3NUCA 2EXZA 2RDFA 1NUCA 4KTAA 4KHVA 1STYA 1II3A 2F0HA 4N9PA 4NP5A 4F8MA 5HGTA 5KIXA 5DEHA 1JOOA 3EJIA 3MZ5A 3RUZA 3C1FA 2F3WA 5IGFA 1EYAA 1EY9A 4HMJA 4NDXA 5JOBA 5DAUA 3SK8A 3T16A 3D4WA 1TR5A 2RBMA 2EYMA 4HMIA 5CV9A 2HQEA 4EVOA 1EZ6A 3BDCA 4MIUA 2SNSA 3OWFA 4R8NA 2F0IA 4ZQ3A 4K2KA 3SK4A 1EY7A 4K5XA 4DF7A 5J39A 1NSNS 4KJNA 1U9RA 2F0VA 1A2UA 5IODA 1A3TA 3D8GA 4K2LA 4ME5A 3PMFA 2F0MA 1STAA 5E1FA 4KJOA 4J1MA 3TP8A 5F2DA 2F0OA 2M00A 2EYJA 3SXHA 1A2TA 1KABA 1SNQA 2F0PA 2O4XA 4PNYA 3R3OA 3V2TA 3QB3A 3E5SA 1AEXA
chains in the Genus database with same CATH superfamily
1F9SA 5FLMH 3SVMA 1A15A 1R9TH 1PH2A 4DR5L 3MXGA 4XYOA 3C46A 4HJ9A 5IYBG 1F2YA 1VQ7A 2IHEA 1Q7YC 3NENA 4ILWA 4HJ7A 2AHOB 3CXCA 2ID0A 2OWOA 4OO1I 2XN9C 3G4SA 1HFNA 2E5LQ 1NAPA 2E2HB 3A55A 2ALYB 1B3QA 1Z47A 2LXJA 2E8GA 4EX5A 3J7ZC 4FXDA 1IBKQ 1X3GA 2BCOA 1SJED 5ELDA 1K0SA 1PHJA 3A74A 1SYEA 4JCVE 3TZDA 4K8IA 4GKKQ 3PIO3 3M3YB 1LT6D 2L0CA 1VQKA 4XQQA 2E2JB 5C3EH 5M5XH 4A4IA 1PA6A 1BCPD 4C3JB 1I4GA 1G8ZD 3E0JA 3OMGA 4LFCL 1SNDA 2M9VA 5DM73 2F0EA 1X3FA 1C4QA 3SHLA 3BYTB 3ERQA 3BVGA 4IUPA 5FO8B 1CA5A 1LTBD 1D7QA 4KHPL 4NW2A 1HRJA 3HOYB 1LLRD 3LWUA 1EU3A 4LF8L 3J7AF 3TP7A 3M7GA 3CC4A 2PZUA 2PO4A 4Q0FA 3W1GA 3ULLA 4DV2Q 4PZ8A 4C1NI 1N34L 3J7A5 5KGUA 1WTWA 2UXCQ 2RDFA 2E2DC 3N52A 1STYA 2OQ0A 5T1IA 1JOOA 2RDGA 5M3FG 1CQVA 5M5WB 1ET6A 4M8AA 3OWFA 4R8NA 4KJNA 1A2UA 1R9TB 2EIFA 4ME5A 4L5QA 3RZOB 5G3LD 1E7ZA 3Q24A 1PTOD 4DK6C 1BXTA 2M00A 1UEAB 3UDFA 1G291 3GTPB 2BDOA 2BA1A 4QB4A 1E22A 2L4NA 1PZJD 4KD4A 5IP7H 4A3JB 3HOWG 2KECA 1QWYA 4KKSA 1VQ9A 1CSQA 2EDGA 2PZTA 4CDFC 2IX3A 3F8TA 3H6MA 2NVTH 1NE3A 4OO1H 4DU9A 2I07B 1XTCD 4X64L 3GTLB 5D65A 4JBWA 2ZJPA 5M5XB 4OHJA 1U4LA 4JYAL 5C0XJ 4BXXH 2NUCA 2LSSA 4N8X1 1EL0A 1IW7D 1PXUA 3CF5A 2KCTA 2V1CC 5CC4A 4H0LC 3GTJB 1VMCA 5IWAQ 1OTCA 3CCVA 3WOFA 1K73C 1W3SA 1VQ5A 4XYQA 1TWAH 5FOBB 1TIID 4GZYC 4AIMA 1J5EQ 2NZHA 3D6CA 2PMZB 2DN8A 3L3OC 4X62L 5IGEA 2N8NA 3HOYH 1EU4A 1X54A 3MEHA 4DGZA 4IUTA 3P20A 4RKLA 1BF4A 3ICEA 1XPRA 3KLRA 4J6HA 3I7FA 4CDEC 2UXDL 5FLXL 2Q2UA 5CGKA 3K58A 2GA4B 4F7XA 2NVXB 3D4DA 3FRPB 2BH8A 4DAMA 1HJPA 2RSNA 4EQPA 1EIFA 2CH4W 3I3CA 2RDHA 1KNEA 1GKHA 3MVVA 4WJWA 5C44G 4G7ZC 3D31A 4A3KB 1EY4A 2EYHA 1STBA 3VYRA 2F0JA 3VR6A 2YTYA 1WD1A 3FVQA 3PUZA 1TWFH 3FKIB 4QGUA 3J81L 4V0BA 2JA9A 1B8AA 2K5NA 3CCUA 1F9RA 1QVCA 3UDIA 4IPHA 2VS1A 1KAWA 3D4WA 1TR5A 2EYMA 2WKCA 5FO9B 1NSNS 1PV4A 1DM0B 3MTSA 4FVMA 4R4OA 2PPBC 4A76A 4JI7L 5EBDA 1SMYD 3ER0A 1EYGA 3A5ZB 4RA8A 4KLKA 2YU9B 1UE6A 2YTVA 1KLGD 1BKBA 1HCZA 1RKNA 2B2UA 4BY1G 4LFCQ 3L7ZC 1WTRA 3OW2A 3FEWX 1Y8NB 1RTOA 4OO1G 2H1EA 5J1ZA 2JA7H 2DUDA 1A62A 3RR5A 1YNND 3TS0A 2EZVA 1ZYRD 5LL6S 4RFBA 5EKKA 4A3MB 1F2MA 3FP9A 2F0QA 3S15H 2UXDQ 5IP9H 1B2TA 2PCFB 2A6ED 3TN2A 5CV7A 4LW1A 4DPGA 1B9NA 1SJHD 4TVAB 2RHSB 1WYDA 3CCEA 4DV6Q 3NBIA 4IQZA 1PH1A 1NMGA 2F0UA 2CQAA 2DNEA 4B08A 5M5YB 3K7UC 3AFPA 1RJTA 4IUQA 4CKBA 1T5XD 2EYOA 4JI4Q 3URYA 4H7BA 1AZQA 3S14H 2EY5A 1QJOA 5LHY1 2Z4IA 3B6YA 3T1HL 1PTOH 1YNJD 1V9PA 1TQOA 3I70A 4RWSC 2FFKB 4DV7Q 1FNVA 1I4QA 4RCOA 4FNFA 1JWUD 3W1BA 4JPBW 5C3XA 1JWMD 4C3JH 2RQXA 4IFDH 1SMXA 4GNXA 3K6OA 1M90C 4QF4A 2F0GA 1BCPB 3NBHB 5DM63 2L9HA 4DR6L 3VR2A 1A6XA 3S1NH 4NPSA 3NEMA 1PRTF 3EJIA 2G9DA 1EY9A 1H9JA 4LUVA 4NDXA 5DAUA 2ES2A 4C2MH 4JI3Q 5M3MG 1HNWQ 2B8GA 3BDCA 5C0XG 2EPBA 2K5QA 4MIUA 2QEJC 3CD6A 5IYCG 1DOMA 1TWHH 1YZ6A 2YU9H 1U9RA 3EFXD 4C56C 4JBKA 3D8GA 4XXEA 2F0MA 1RCVD 1S5ED 2UUBL 1LO5D 2F0OA 3S24A 2EYJA 1QILA 3E9IA 3R3OA 4PV1C 3E5SA 4DUZQ 5CV6A 5G3LF 3ITPA 1K8OA 4YCVA 1TU2B 4L6TB 4NXNQ 2JA7G 1HNXQ 4CDCC 4GKJL 3Q0AA 3I4NB 4JI6L 3GTQH 5FLXE 3H3VH 2CW0D 2EJFC 2KEDA 3K5MA 3MXPA 3W5OA 5LMNW 3R93A 4K0KL 2KJXA 4EQOA 4JOIA 2G5DA 5E7NA 1S40A 2VW9A 5C4HA 2E76C 2HHHL 4ZKCB 2FMCA 2EOTA 2K1BA 4HTHA 4JBMA 2ZXPA 3H15A 4JI8L 2NZOA 4B3SL 3S2DH 1WFQA 1ASYA 2IX0A 2OF1A 3IRBA 2QGQA 1V43A 3I4OA 4ULLA 2JA6B 3U4ZA 3DMUA 2VQFQ 1LTTD 3IFTA 2Z4HA 3I2ZA 2EYFA 4LFAQ 3VDYA 2NN6G 1JOQA 1E3PA 1S5DD 4KD3A 3RZDB 1SE2A 3MXUA 2EY2A 3KBGA 4RAUC 1F2ZA 1OXXK 2JEBI 4KHPQ 1UE7A 1Y1VB 5JJIA 4HIDA 1LACA 2NYZD 4K5WA 3R2TA 3S1QB 1KAAA 2XWBB 2F0FA 3FMCA 4IFDG 3M4OH 5CYUA 4X66L 1PZID 3OIQA 4KY5A 2ZJQA 3M4PA 1SFOB 1VQNA 3CC2A 1PH3A 4JK1C 1O78A 5EKLA 3AMUA 4UP9A 2GVBA 3TRZA 4MN3A 1CHQD 5J22A 1SR3A 1XMOL 5DEHA 4DR4Q 2MP1A 4A3FH 2VB3X 1Q46A 3U9SA 3MXNB 5JVH3 4CJ2C 2RBMA 1I5FA 1RODA 4JI6Q 1EZ6A 1MIUA 4X6AH 4YY3L 2PNHA 2KUMA 4DF7A 2ZM6L 3G6EA 4A3EG 3BS1A 3FKIH 3I4LA 2HD3A 4BBSH 4KJOA 1QG7A 3A5UA 4J1MA 1BVSA 2VY3A 5LMUQ 2UXCL 1KABA 2F0PA 4GLAC 3O13A 2VQEQ 4KMUC 5AJ3L 4DN4M 1EYDA 2PNRC 1HR0L 2VL6A 4YIJA 1FGUA 4HR7B 3X3MA 4DV5L 3NELA 3T13A 3PO3G 4H02A 2R7FA 2PYKA 2B29A 2F0NA 2EY6A 2N55A 2NZ1D 4LUOA 1A0IA 3J81i 5CBAE 4PQXA 4WJ4A 5GAEC 2SNMA 4DAVA 1PH4A 4DR3L 4P71A 5KYIA 3V05A 4BY7H 4XQNA 5D14A 4A3DH 1DONA 3DLLA 3PO2H 1EOVA 4YWLA 1VDZA 3TEHB 1CUKA 5IGCA 1PLFA 4DR5Q 4OONA 2GVAA 4NKLA 3Q23A 2K01A 4ABNA 2A19A 2N88A 3J81E 2E2IB 4X66Q 1STNA 3NTHA 3NXWA 1YJNA 1TY0A 2AQ2B 1PZKD 3W2DA 2O2LD 5C5LA 1CZGA 1B7YB 2WACA 1Y14B 3HS0C 2GN5A 2P5ZX 4RCNA 3AU7A 5IWAL 3ONAB 2BE5C 3WDNA 1WTXA 2F4VQ 4MZ9A 3CCMA 2D9UA 2WINB 3MFGA 3WWVA 2TMPA 3E0EA 2VZAA 3BYYB 4ZUIA 3BJUA 4U673 1BQQT 4A3EH 4AYBB 3CCQA 1H9SB 1NR4A 1S4ZA 2JE6I 3NPPA 1IBLQ 1BCPC 1QZGA 4KK7A 4B3TL 4JI1L 4QIWB 3VYUA 1LTAD 5I2YA 2UU9L 1QOHA 1B44D 1G2SA 2B8FA 4R4TA 4HJ5A 4K6LA 4LF8Q 3PSIA 1HFGA 3H0GH 3DEPA 3QR8A 2EXDA 2WB1G 4ZAIA 2LMCB 4UY8C 2HDLA 1Z6HA 1WTOA 5IYCH 1G91A 2B2YC 4DV0L 4L8JA 3J80E 1ENFA 3NQIA 2NVTB 3DUZA 3CC7A 1LTSD 2QKIC 2AQ1B 2XNAC 1WTVA 2L11A 4B3SQ 1O7YA 3A7AB 4A3MG 1K28A 4OWTB 2Z9HA 5KRUA 1R4QB 1U5KA 4CDDC 4NXMQ 2A5HA 3SK5A 3TBIB 5JEAG 2QDBA 2AQ3B 1Z7TA 2NTTA 3KLWA 4G57A 1EEFD 1VQCA 3PO2G 1V1PB 2PW7A 1I94L 2AUKA 2QDLA 4IPCA 3T1YQ 2XGTA 2XRSD 3M4QA 4ODGA 2D2CC 1XMQL 1H9RA 1IHZA 4BBRB 4A3CH 4JI5L 2B2VA 1X6OA 4DV3L 2OT2A 1Z9FA 2JJQA 4NMZA 2F0KA 3GTGB 1SYDA 2CQOA 2A8VA 4J15A 2NN6I 4JV5Q 1SNCA 2F3VA 1NTGA 1L0WA 2L12A 1VQPA 4A3GH 2HIVA 3NWTA 1R4PB 2RCNA 2B39A 4N9TA 3P7JA 3GP7A 2K32A 4BA1I 4KKTA 3M4YA 3Q8DA 3G48A 5BN5A 3PCOB 5C5MA 4LUZA 1EZ8A 4KKUA 4RKBA 3IAYA 2B2YA 4C3IH 1Y8OB 4L5TA 3S9WA 3H09A 4JG2A 1HR0W 1HUMA 2UXBQ 3STBD 5M3MB 1GD7A 3EBEA 2MFIA 2WB1E 5C44H 3CPWA 3I55A 4OELB 1N32Q 4IN3A 1VCIA 3TDQA 1HZAA 1I6HH 3RZDH 3OIPA 1VQAA 3G71A 5C4XH 2IWHA 3U4VA 4DNIA 4C3HG 1KNAA 3M85A 4HSPA 2E74C 1AN8A 1GM5A 1VF5C 5JEAH 4CKEA 1JICA 2SNSA 1GUWA 4ZQ3A 1BR9A 2JA7B 3MFYA 2ZJRA 3RLFA 3PMFA 4OWXB 4DUYQ 3Q22A 2E2HH 1STAA 3BZKA 1BDOA 1D5XC 2AMCB 5EKIA 4Y7NH 4DR6Q 4CGYB 1PH6A 4A3MH 2B63B 1SLJA 4DNRB 5ISRA 1WTPA 3BU2A 1WD0A 1LYLA 3KJOA 2KVMA 5BN4A 1XPOA 2JA5G 3ZJYC 1XMQQ 2VNUD 4I7ZC 1J6QA 2HDMA 1S3OA 4GOPB 2D0PA 4DV1L 2DY7A 1N33L 1NJIC 1H9KA 4O1NA 4P74A 1IYUA 3VR4A 5C4JH 3T53B 4JI7Q 4BBSB 4B9XA 3J81c 4FO2A 1NNXA 2OQKA 2FINB 4C3HH 1RD9D 3ZYYX 3K80C 2I5HA 4A3IB 2MNAA 4B9WA 1EQVA 4QL5A 1PDQA 3OTOQ 1K83H 1X55A 4FP5D 1PTOC 2L5TA 1NR2A 2WAQB 1STEA 3TP5A 3H91A 1HNZQ 1A3UA 4G7OC 3J80i 1Y1WG 3HOZG 4PZ7A 2ZT9C 1Y1VG 2MJ8A 2K5VA 3UDGA 4G7HC 4APVA 2UU9Q 2KCNA 4A3DB 4K5VA 1JR0D 3U50C 1Q8IA 4U68A 5FK9C 5GROA 3SDZA 3GTGH 1O80A 3K7AH 5LMNQ 1HZCA 3HOVG 3LNNA 5KNBA 5E4WC 5JAVA 2KENA 2MHVA 1CTMA 3FDTA 3EQLC 1YHBA 2K05A 2B2WC 1KIXA 4JI4L 4LJZC 2N78A 3TQYA 1ONLA 1JORA 2CKZB 4KV6A 3L2PA 3NP8A 5JEAJ 3PUXA 2K04A 2KHJA 1NUCA 3D3RA 5KIXA 1XX8A 1EQQA 3JAMi 5GAHC 1AFPA 2CVRA 2VB2X 2LY7A 1HHVA 5JOBA 4Y7NB 2R92B 2F0IA 3KF8B 3S1MB 2ZXOA 1MSHA 4PZ6A 3QWNA 4X64Q 1EIYB 5IT9L 3H3VC 2XIWA 2ZTEA 3I73A 3HOUH 1OXUA 5HY6A 3GTLH 1VS0A 3KK7A 1CHPD 2MGSA 1G6ZA 4JC0A 3PF5A 1N36L 1PRTC 1X32A 1VQLA 3CRLC 1T9HA 2Y0SB 4LF5Q 5EAYA 1EIHA 3NWSA 4JVZA 4HIMA 3EA6A 2PQAA 3G7LA 4A75A 1P16A 4FXKC 1FNUA 1Q1BA 1WI5A 1MD2D 5DLQE 3OMCA 2BE5D 5LMNL 3KLSX 2AKWB 3GTMB 1WOCA 3SR1A 4PMBA 3PGZA 4GN4B 3T4AC 3OSOA 1QE6A 2Q8TA 1E2VA 3D4RA 2CH4A 3PUWA 4IZ8A 3K7AB 1GUTA 3H94A 5IGGA 2JA8B 4AYBG 1RTNA 4A3IH 1QZHA 3F2CA 2O5IC 1KHIA 4A3JG 3HOWB 1B3AA 4DXGA 2X6GA 1ICFB 1GVPA 1PFMA 1E2ZA 4RH6A 4HJAA 2F0LA 2F4VL 4FYDA 3OW7A 3K0XA 2WB1B 3V96A 3ND8A 3MEFA 2NVQH 1G6PA 1N8RC 3NHHA 1SNPA 4DK1A 1EFWA 2Y0SE 1SN8A 4R1JA 4DV2L 5CBEE 1YJWA 3AEVA 2B2TC 2IHFA 1L1OA 1N36Q 1SYBA 2JA5H 4F87A 2A69D 4F8MA 3H3VI 3I72A 2RHQB 3QIAA 3MZ5A 2IJ0A 4HEDA 1ICWA 4IPGA 1SE8A 2F1MA 3NBHA 1A8VA 4A93G 4G4KA 3RMHA 2LFNA 5CV9A 1GUNA 2A6HC 1VF7A 1FGBD 1YHQA 3TSSA 1E2WA 4NB3A 1L0YB 1Q82C 5J39A 4M1UB 1OO9B 5IODA 3S17H 3OWEB 4LFBQ 2VQFL 1LT3D 3OYYA 1XMOQ 4DAYB 1IYJB 4LF7L 1ILQA 3PO2B 1OXTA 1CZWA 2A73B 4GOPC 4WRDA 3S15B 3FPUB 1QB5D 1LTLA 3S2HB 1SMYC 2R7DA 3HOUB 2R93B 1AE2A 2AUJD 2ZXRA 4ZRZA 4DV0Q 1SNOA 3CU7A 4ZYSA 5C0XH 3J81j 1JB3A 5D3IB 3GV3A 4Y52H 1EWIA 4R4CA 5HGQA 3HOXH 4CJ1B 4DV7L 3TS2A 4A3BH 3DHQA 1EY5A 4FF1A 3ERSX 2VUMH 3UE0A 1XWEA 2G9HD 2Z0SA 2A69C 2XVSA 3X3NA 2PI2E 3L0OA 4BY7G 1YEZA 1VQMA 2X69A 2DGYA 4AQYL 2ZTDA 1D5MC 1B53A 2B3GA 1I4RA 1TS2A 3VA7A 2F4IA 1XNQQ 1AZPA 4ALPA 3DM3A 2MO0A 5KEEA 1EY0A 2L1BA 1SXTA 3E6ZX 2IX1A 2MPMA 3MAQA 5IY0A 4BY1H 1JE4A 3BZCA 3CMEA 4HN7A 1UUPA 1K8AC 4TKOB 1KXLA 5BR8L 1L1OB 3JAME 2LKVA 3T1YL 2AWNA 4OL7A 3LWEA 4KHZA 3SE0A 4F88A 1CK1A 5IE8A 3NTKA 3LGJA 1VMPA 4JV5L 3OOCA 2EY1A 2D62A 1J9OA 4RMFA 4E6IA 5C6AA 3VYSA 3K5OA 1NBWA 4GKJQ 1ESRA 1EWCA 4EQ5A 2SOBA 2K7VA 4JI2L 3EVQA 2MO1A 4ZUJA 4X3TA 1IZ6A 3RN2A 2M2LA 2PMZE 1PFNA 3K0YA 4FXGC 1II3A 1Y8PB 3S16B 2F3IA 3H0GG 2IW3A 1U4RA 1TWFB 2B63G 3J7YW 3KF8A 2HQEA 3VR5A 2KA7A 4DK0A 2TSSA 2JA5B 4OXPA 2BA0A 4DXFA 3M7NA 1B50A 1XXGA 4OIKA 4PNYA 4YWMA 3V2TA 1I3QH 1LTGD 4FF2A 1WCMB 2EQSA 3I8ZA 1VQDA 4BBRH 2K14A 2KEEA 2RVLA 4S3SA 3GO5A 5FO7B 4UDUC 1B9MA 1B4OA 1TXYA 1C9OA 2NTSA 5KNCA 3TP6A 1Y1WB 1UE5A 2A68C 3HOZB 2UUAL 1QVGA 1I6VC 1ILPA 1V1OA 1HQRD 4QUFA 3S2HH 2MUYA 1D8LA 1EUJA 2K6AA 1K8GA 4A3DG 5BR8Q 4AH6A 4R4QA 5IGBA 4JOIC 3A54A 1KDBA 1V1PA 5FJ8G 1HTPA 4IUNA 2EYPA 1DOKA 4JI0L 4X62Q 4DV6L 1JT8A 5C4ZA 1PTOB 2H5XA 1I4HA 1HH2P 1LUZA 3WOEA 5KYLA 1H9SA 3RD4A 2F0DA 3W3AA 2R6GA 5ELBA 4K8JA 3S1RB 4JI2Q 3M3YH 4A3GG 2D0OA 1CSPA 2JQOA 5EQ0A 4XQJA 3R8BA 3RLNA 1YI2A 3M9BA 4TSSA 2A6HD 3KF6B 1VQ6A 2DJFC 2NVYB 3S16H 2EE1A 2R92G 3GDEA 3QOLA 5GADC 3GD7A 4O2DA 2WKDA 4C2MB 4HJ8A 4BXXG 3PO3H 3I56A 3P1HA 1YNXA 1VQOA 3QG1A 3AB9A 3HP3A 5IP9G 4YWKA 2UXBL 2EXZA 2I5MX 2YV5A 1ET9A 1GHJA 3RZOH 3BVMA 4O0AA 1FJGL 3HKZB 1GJXA 3CP0A 2Z6BA 2JA6G 2IY5B 4C3IB 4HMIA 2HHHQ 3K59A 2DY8A 2EJMA 1EY7A 1VQBA 4K5XA 1I3QB 1IL8A 4XIGS 1UEBA 4UAIA 3KDFB 1WTQA 1A3TA 3TZUA 3GV6A 1OXSC 4IJLA 4GNXC 5M5WH 3OPOA 1DZ1A 3KUPA 1IBML 1XNQL 1FYCA 3VYTA 1GUOA 1EOTA 4JI0Q 4DNTB 2DJGC 4WFN3 4CKCA 1ZXTA 1AP0A 3A8KE 1JB7A 4P73A 5E3FA 3DWAA 4R4IA 3K81C 2K75A 3RN5A 3GTJH 3BDLA 4ZCKA 2FJ2A 1TWAB 1A63A 1H9MA 1SE3A 1N33Q 3I4NH 3BVZA 3UE1A 4RHRA 5COYA 1Y1WH 4ZK9B 1CQFA 3HOZH 1NCVA 1Q8KA 4RGNA 4A3EB 1FVIA 4LNQA 3JAMc 2NVXH 1BNZA 5M3FB 4P75A 2ATWA 1JJGA 1JJCB 1ZEQX 1QVFA 5NUCA 2OXPA 5I4DA 3SGIA 3LX0A 2NVYH 3PUYA 4MTKA 3ND9A 4IURA 2QCPX 3PO3B 2IPKD 3L9AX 4HCEA 1C48A 1PTOF 2FMMA 4X3UA 3HRZC 1ENCA 3G6JB 3S1RH 1GUSA 2R92H 1RIPA 4L5RC 1I4PA 2QEXA 3STBC 2C35B 4DV1Q 4DV5Q 4A3FB 1Q1EA 4OEMB 1K3RA 1U4MA 2WV6D 1BBWA 3U9OA 2BH2A 3HOVH 1M4VA 1HQMC 4NP5A 5IYDH 5HGTA 3J80c 1W6KA 3M4OB 2A1AA 5TSSA 3RUZA 5CMDA 3HKSA 4X3SA 1G2TA 1UAPA 4EVOA 1YJ9A 1PH7A 4K2KA 4MNOA 2H4OA 3CW2C 1JWSD 3IFDA 1FL0A 3E9HA 5DNFA 1PYBA 1HNWL 2R93G 4RG1A 1UNSA 2UUAQ 1HA6A 2HIXA 4FF4A 2HUGA 5LMUL 2HCIA 1IW7C 4QQBX 5FLMG 1A2TA 1SNQA 3I91A 3QB3A 1SRUA 3VA5A 2FXQA 1HR0Q 4BY7B 1HXYD 3C1EA 1ENAA 4OIJA 3PQIA 5EPKA 3U58A 3C2PA 1Q86C 2MQHA 3NSWA 1SEBD 1J8IA 4A3KG 2XSCA 1RHPA 4LFBL 4EGVA 5CORA 1LABA 4DR1Q 1RL2A 1SNMA 5M3FH 2K52A 3NK9A 4HIOA 3FKIG 1E1TA 3DM1A 3Q6SA 4B3ML 5ELNA 5FKAC 1XPUA 1GUGA 4LF9Q 2F0SA 3S14B 2R7ZG 2DNCA 1JMCA 3FPPA 4UP8A 5I9PA 1UE1A 4GLXA 5M3MH 4KN7C 3F1ZA 4Z9CB 3BZDB 1PFSA 1E0BA 5ELFA 5IIFA 5JJKA 2UUCQ 1X3EA 1O7ZA 4HCSA 3A8IE 3J80L 2QF7A 1SROA 4OGQC 5AFWA 3KF6A 1X9NA 1DGSA 3H0GB 1JJ2A 3J7AV 3S1NB 1GO3E 2JA8H 2Z1CA 4I7AA 1PH8A 2YTXA 1STHA 1SYFA 4V190 3S17B 3T56B 3OHXC 3HOWH 4DV4Q 4BBRG 1C7YA 1IBKL 1MI2A 1GOZA 4XT3B 4DR4L 3I4MG 3NE5B 4N9PA 3HGBA 3K5LA 5IGFA 2NVQB 1DJRD 1JCKB 1CI3M 2CFMA 4QCLA 2PI2A 2ZM6Q 4JI5Q 1TWGH 3C3LA 3KDFA 5JJLA 4LMQD 4YCWA 1SBBB 5C0XI 1YNNC 2A68D 2R7ZH 1X3PA 1QUQB 1L0XB 4DR1L 2PQAB 2WFWA 1TVXA 1YHAA 2CWPA 4N8FA 4A3BB 3TP8A 2NB0A 5F2DA 3VR3A 3CCJA 4J8QA 3K5NA 1O7IA 3KOJA 2O4XA 2SDFA 1ZKOA 1JQYD 5I6YA 2WIIB 1VQJA 2OEOA 3MHBA 1CM9A 4PMCA 4BS9A 3D0FA 1CT1D 5I2XA 5AJ3Q 1EY8A 1VQ4A 1QUQA 2K5HA 2RKSA 5C3EB 5BN3A 3QO2A 2Z8LA 4DR3Q 4RGTA 1FNWA 4LF6L 2B2VC 2XRQD 2LS01 1D6EC 3MA2B 3HEJA 3DWQA 1DXMA 4FF3A 4RHSA 5CR3A 3UDXA 4A3GB 4LWCA 2R61A 4XDXA 2F52A 2QA4A 1Q3LA 3AQQA 2R93H 1XNRQ 2C5CA 4DR2L 3CRKC 3EROA 5EGTA 3JC66 1AW7A 3GTKB 1B70B 2NWGA 2R3ZA 2EJGC 4L5SA 5EJWA 1YITA 2PW5A 5GAGC 2SEBD 3F2BA 1D1KA 4TRDA 2KCMA 2IL8A 4MTNA 4YHHL 4P2CB 2JN4A 1HZ9A 2JK8A 3S2DB 3HOXG 1CA6A 2A6EC 1IKMA 5C3WA 1M1KC 3NQTA 1WVLA 3A8JE 4PG3A 2VUMG 1VQHA 2J0TD 1HA5A 1PFBA 3HKZG 1KLUD 4C3IG 5K36G 2C9OA 3S1MH 4LF5L 3A7LA 4DFAA 4POGA 4P72A 1DOLA 4B3TQ 3PF4A 5J3BA 4JI1Q 3I4NG 4C1NK 4RGOS 2WAQG 5E4XA 2F0HA 4JI8Q 1MSGA 4A3JH 3C1FA 1EYAA 1KRSA 4AQYQ 1VQGA 1KTKA 3K8AA 5JJZA 4IFDJ 1K9MC 5C4XB 2K33A 2JYOA 5IYDG 2E5LL 1HZBA 1FJGQ 3KYHC 1WJJA 3HOVB 1PYWD 3HKZE 1RF2D 1LTRD 1U0LA 4R8IA 2NBFA 2Q8RE 4QUCA 5JVG3 4UP7A 1Q81C 2CCZA 1MBYA 1YIJA 4NXML 2F0WA 1MKHA 2WAQE 4BA2I 1X3QA 1KDAA 1BOSA 1YNJC 3SEBA 3TMEA 4KN4C 4LF4Q 3SK6A 3K57A 1QCBD 4GKKL 1D1IA 1SAPA 2N49A 2E2IH 1NMFA 1EWHA 2KHSA 5IP7G 1PH9A 1CFMA 1EQRA 4B3RL 1EEID 1TT2A 4IUVA 1U4PA 1WCMH 4DR7L 4DAPA 4QMGA 3CCRA 1XTDA 3QJYA 1PYSB 4DUZL 4O42A 4FDBA 2Q2HA 1X56A 2B2TA 1W2BA 1F9PA 2RA4A 4GOPA 3D6WA 1E1OA 2XWJB 5I6WA 3EIVA 5CV4A 5M9OA 1QNKA 3AYHB 1HNXL 4A93H 1P8LA 1PVOA 5IOCA 2OTLA 4A3FG 4ZLTF 3PIP3 5JPNC 1S5FD 2Y0SG 4H13C 4CBVA 1STGA 1X65A 4UPAA 2YYZA 4AYBE 1CKNB 2B2WA 1EY6A 5ELCA 1C8CA 4CJ0B 1BBXC 3HG9A 1XYIA 4C3JG 5HURA 4WORA 2K5DA 5ELOA 1N34Q 1LTID 5IYBH 3I4MH 1DD2A 2L15A 3CKIB 2BDNA 1BBUA 2PQEA 2WP8J 3HOYG 1Q90A 4QJFA 3PUVA 2F3WA 1CKMA 4MHEA 4IOCA 2JA8G 1W6JA 3T16A 3GTOB 1LM0A 3CAMA 1ESFA 3S1QH 2CW0C 4QY7A 4X3KA 1HUNA 1EIGA 4R9WA 2JP1A 2F0VA 2K5WA 2ICIA 2XTIA 1IKLA 5A2QL 4LF4L 5E1FA 1N9WA 3T1HQ 2Z6KC 1AE3A 1VQIA 3SXHA 4DR2Q 5EPJA 1PMRA 2CWAA 2I46A 1IYVA 1SE4A 3CHBD 1MGSA 1AEXA 1K0RA 2Q8IB 4DKAC 4UHVA 1MHWC 1BUVT 1EFID 4DR7Q 1TWGB 2E75C 1D2BA 4GN3B 5I9OA 2Q2IA 3GTMH 4GS3A 2RF4A 4H44C 4KI0A 1AH9A 2R7ZB 2I5LX 5M5YH 1FR3A 2KOLA 1F9QA 4DA2A 2N3SA 3CQZH 1SYCA 3OTOL 2D5DA 4BWGB 2IT1A 4YHHQ 4A93B 2QILA 4YY3Q 2X6LA 1LV9A 1ZYRC 2OTJA 4I65A 1GXDC 5K36H 2ENBA 5K5PA 1E24A 3CPFA 4IJHA 4K14A 2BOSA 5FJ8H 2O5JC 1I4XA 1SYGA 1MJCA 1LT5D 1HNZL 1VQ8A 3MC0B 3F2UA 2KHIA 3IL8A 4YCUA 4OX9Q 1PRTB 3DXJC 1S5BD 1KRTA 2UUCL 3ULPA 5CV8A 3UI2A 1IBMQ 3HOUG 1L2FA 4TQUS 3N6RA 3QOJA 5D3DA 4DAYA 3I4MB 3ULJA 3KFUA 3P75A 1L1OC 2PZWA 2HCCA 3PV0A 1KL9A 1VQEA 3HZXA 3CMAA 1TWCH 3GTKH 3A0JA 5A35A 1K8MA 3DEOA 2CHBD 4IOAA 3F2DA 3CCSA 3GTOH 3PIOA 4IFDI 1N32L 4ID6A 2F0TA 2FHTA 2HT1A 3NUCA 1I50H 1Q12A 2Z6KA 3MWYW 4QIWE 2OCEA 4DK3C 1HTLD 2UUBQ 4A3BG 4WJ3M 4HIKA 3PIPA 5C44B 2K50A 1PRTD 5L37A 3AFQA 3I90A 4X65L 1F2LA 2B63H 1I6HB 1BCPF 4NXNL 4RGMA 4B3RQ 3T51B 2V4DA 4LFAL 4GN5A 2L55A 1XJVA 5C3EG 5JPMC 1RDPD 2K03A 5KNDA 4LK1C 2K28A 2VXWA 1TS3A 3IKJA 4LF7Q 3KJPA 3CCLA 1YBYA 2JSOA 5C4JB 4KY7A 5H1SE 5CV5A 3BG3A 3BDOA 4EQNA 4IPDA 1SDFA 3CQZB 1KD1C 1D5ZC 3JAML 1ASZA 1C0AA 2HQLA 1SSOA 1TWHB 2LXKA 5LL6X 1IBLL 1TS4A 4K0KQ 4HAEA 2KCCA 4HSVA 2J7ZA 1KDCA 4ME3A 2JA6H 1K3BC 1CKNA 1G51A 1UWVA 1DCZA 3R2IA 4GLVB 1HPCA 1JOKA 1EYCA 1T5EA 1B1ZA 1NY4A 2J4XA 4IO9A 1WTHA 4BY1B 1PH5A 4OX9L 3TREA 1A3VA 1GHKA 1ML0D 3KBXA 4KY6A 1S72A 4A3LG 3HOXB 2EYLA 4LF6Q 1KQSA 1Y1VH 2JXMB 4C3HB 4A3KH 1IXRA 2VUMB 2KQ3A 4Q5VA 5IGDA 2A74C 4PMWA 1XNRL 1DYQA 3GTQB 4DUYL 4XTCS 4LF9L 1IL2A 1TS5A 2B2UC 1V1QA 1MJEA 1K83B 4IUUA 1TY2A 5EBCA 4JBJA 1WCMG 5FLXc 4A3CG 2VQEL 4JYAQ 1S5CD 2Q2TA 2K4KA 1F77A 1I94Q 2E2JH 2F03A 4X65Q 1Y69U 4IALA 3DWPA 2I0QA 1BO0A 4JI3L 4LAAA 2KBNA 1V8QA 4ZKBB 1I50B 2ASBA 3HFZB 3FHWA 4OWWB 1O7LA 1J5EL 4L63B 5EPLA 4DV3Q 5A2QE 1LT4D 2RCFA 2AWOA 5GQOA 5IT9c 3RLOA 2JEAI 4K6DA 1FD7D 5ELEA 4CHTB 4POFA 3MXNA 5C4XG 2ICEC 1QNUA 1CKOA 4KTAA 4KHVA 4BBSG 3E3XA 1TWCB 5T1GA 1M8AA 2RSOA 1VQFA 3GQBA 2NN6H 4DV4L 4HMJA 1JE5A 2EVBA 3SK8A 3EN2A 4B3MQ 4A3IG 4JW0A 3SK4A 3GTPH 4A3LH 2ZTCA 1JC7A 4XT1B 1SFOH 1EQTA 3A56A 1YVCA 4K2LA 1OXVA 3KLSA 5IT9E 3NTIA 1KC8C 1TKWB 1H95A 2QW7A 3RNUA 4GNXB
chains in the Genus database with same CATH topology
1F9SA 3SVMA 1A15A 3MXGA 4XYOA 3C46A 1F2YA 4ILWA 2ID0A 4OO1I 2XN9C 1HFNA 1NAPA 2E2HB 3A55A 1Z47A 4FXDA 2BCOA 1SJED 5ELDA 1SYEA 3TZDA 4K8IA 3PIO3 3M3YB 1LT6D 2L0CA 4XQQA 2E2JB 1BCPD 4C3JB 1I4GA 1G8ZD 3E0JA 3OMGA 1SNDA 2M9VA 5DM73 2F0EA 1C4QA 3SHLA 3BYTB 3ERQA 3BVGA 4IUPA 5FO8B 1CA5A 1LTBD 1HRJA 4NW2A 3HOYB 1LLRD 3LWUA 1EU3A 3J7AF 3TP7A 3M7GA 2PZUA 2PO4A 4Q0FA 4C1NI 5KGUA 1WTWA 2RDFA 2E2DC 3N52A 1STYA 5T1IA 1JOOA 2RDGA 1CQVA 5M5WB 1ET6A 4M8AA 3OWFA 4R8NA 4KJNA 1A2UA 1R9TB 4ME5A 3RZOB 5G3LD 3Q24A 1PTOD 1BXTA 2M00A 1UEAB 1G291 3GTPB 2BDOA 2BA1A 4QB4A 2L4NA 4A3JB 1PZJD 4KD4A 2KECA 1QWYA 4KKSA 2EDGA 2PZTA 2IX3A 3H6MA 4OO1H 4DU9A 2I07B 1XTCD 3GTLB 5D65A 4JBWA 5M5XB 4OHJA 1U4LA 5C0XJ 2NUCA 1EL0A 1IW7D 1PXUA 5CC4A 4H0LC 3GTJB 1VMCA 3WOFA 4XYQA 5FOBB 1TIID 4GZYC 3D6CA 2PMZB 2DN8A 3L3OC 5IGEA 1EU4A 3MEHA 4DGZA 4IUTA 3P20A 4RKLA 1BF4A 3KLRA 4J6HA 5FLXL 5CGKA 3K58A 2GA4B 4F7XA 2NVXB 3D4DA 3FRPB 2RSNA 4EQPA 3I3CA 2RDHA 1KNEA 3MVVA 4WJWA 4G7ZC 3D31A 4A3KB 1EY4A 2EYHA 1STBA 3VYRA 2F0JA 3VR6A 1WD1A 3FVQA 3PUZA 3FKIB 3J81L 4V0BA 1F9RA 3D4WA 1TR5A 2EYMA 2WKCA 5FO9B 1NSNS 1DM0B 3MTSA 4FVMA 2PPBC 5EBDA 1SMYD 4RA8A 2YU9B 1KLGD 1HCZA 1RKNA 2B2UA 3L7ZC 1WTRA 3FEWX 1Y8NB 1RTOA 4OO1G 2H1EA 5J1ZA 1YNND 2EZVA 1ZYRD 5LL6S 4RFBA 5EKKA 4A3MB 1F2MA 2F0QA 1B2TA 2PCFB 2A6ED 3TN2A 5CV7A 1B9NA 1SJHD 3NBIA 4IQZA 2F0UA 2CQAA 2DNEA 4B08A 5M5YB 1RJTA 4IUQA 4CKBA 1T5XD 2EYOA 3URYA 4H7BA 1AZQA 2EY5A 1QJOA 5LHY1 2Z4IA 1PTOH 1YNJD 1TQOA 3I70A 4RWSC 2FFKB 1FNVA 1I4QA 4RCOA 4FNFA 1JWUD 5C3XA 1JWMD 2RQXA 4IFDH 3K6OA 4QF4A 2F0GA 1BCPB 5DM63 2L9HA 3VR2A 1A6XA 1PRTF 3EJIA 2G9DA 1EY9A 1H9JA 4NDXA 5DAUA 2B8GA 3BDCA 5C0XG 2EPBA 2K5QA 4MIUA 2QEJC 1DOMA 1U9RA 3EFXD 4C56C 3D8GA 4XXEA 2F0MA 1RCVD 1S5ED 1LO5D 2F0OA 2EYJA 1QILA 3R3OA 4PV1C 3E5SA 5CV6A 5G3LF 3ITPA 1K8OA 1TU2B 4L6TB 3Q0AA 3I4NB 5FLXE 2CW0D 2EJFC 2KEDA 3K5MA 3MXPA 3R93A 2KJXA 4EQOA 5C4HA 2E76C 4ZKCB 2FMCA 2EOTA 2K1BA 4HTHA 2ZXPA 2IX0A 2OF1A 1V43A 4ULLA 2JA6B 3DMUA 1LTTD 3IFTA 2Z4HA 2EYFA 2NN6G 1JOQA 1S5DD 4KD3A 3RZDB 1SE2A 3MXUA 2EY2A 3KBGA 4RAUC 1F2ZA 1OXXK 2JEBI 1Y1VB 1LACA 2NYZD 4K5WA 3R2TA 3S1QB 1KAAA 2XWBB 2F0FA 3FMCA 4IFDG 5CYUA 1PZID 3OIQA 4KY5A 1SFOB 4JK1C 1O78A 5EKLA 3AMUA 4MN3A 1CHQD 5J22A 5DEHA 2MP1A 2VB3X 3U9SA 5JVH3 4CJ2C 2RBMA 1RODA 1EZ6A 2KUMA 4DF7A 3BS1A 3I4LA 4KJOA 1QG7A 4J1MA 1KABA 2F0PA 3O13A 4KMUC 4DN4M 1EYDA 2PNRC 4YIJA 4HR7B 3X3MA 3T13A 2PYKA 2F0NA 2EY6A 2N55A 2NZ1D 5CBAE 4PQXA 2SNMA 4DAVA 5KYIA 3V05A 4XQNA 5D14A 1DONA 1VDZA 5IGCA 1PLFA 4NKLA 3Q23A 2K01A 4ABNA 2N88A 3J81E 2E2IB 1STNA 3NTHA 3NXWA 1TY0A 2AQ2B 1PZKD 3W2DA 2O2LD 5C5LA 1CZGA 2WACA 3HS0C 4RCNA 3AU7A 3ONAB 2BE5C 3WDNA 1WTXA 2D9UA 2WINB 3MFGA 2TMPA 3BYYB 4ZUIA 4U673 1BQQT 4AYBB 1H9SB 1NR4A 1S4ZA 2JE6I 3NPPA 1BCPC 4KK7A 4QIWB 3VYUA 1LTAD 5I2YA 1QOHA 1B44D 1G2SA 2B8FA 4K6LA 1HFGA 3DEPA 4ZAIA 2LMCB 2HDLA 1Z6HA 1WTOA 1G91A 2B2YC 4L8JA 3J80E 1ENFA 3NQIA 2NVTB 3DUZA 1LTSD 2QKIC 2AQ1B 2XNAC 1WTVA 2L11A 1O7YA 3A7AB 5KRUA 1R4QB 2A5HA 3SK5A 3TBIB 5JEAG 2QDBA 2AQ3B 1Z7TA 2NTTA 4G57A 1EEFD 1V1PB 2PW7A 2AUKA 2XRSD 4ODGA 2D2CC 1H9RA 1IHZA 4BBRB 2B2VA 2OT2A 4NMZA 2F0KA 3GTGB 1SYDA 2NN6I 1SNCA 2F3VA 2L12A 3NWTA 1R4PB 2B39A 4N9TA 3P7JA 3GP7A 2K32A 4BA1I 4KKTA 3M4YA 5BN5A 5C5MA 1EZ8A 4KKUA 4RKBA 3IAYA 2B2YA 1Y8OB 3S9WA 3H09A 1HUMA 5M3MB 4IN3A 1VCIA 3TDQA 3OIPA 2IWHA 4C3HG 1KNAA 3M85A 4HSPA 2E74C 1AN8A 1VF5C 5JEAH 4CKEA 1JICA 2SNSA 1GUWA 4ZQ3A 1BR9A 2JA7B 3MFYA 3RLFA 3PMFA 3Q22A 1STAA 1BDOA 1D5XC 5EKIA 4CGYB 2B63B 4DNRB 5ISRA 1WTPA 1WD0A 2KVMA 5BN4A 2VNUD 4I7ZC 2HDMA 2DY7A 1H9KA 4O1NA 1IYUA 3VR4A 3T53B 4BBSB 4B9XA 4FO2A 2FINB 1RD9D 3ZYYX 4A3IB 4B9WA 1EQVA 1PDQA 4FP5D 1PTOC 2L5TA 1NR2A 2WAQB 1STEA 3TP5A 3H91A 1A3UA 4G7OC 2ZT9C 2MJ8A 4G7HC 2KCNA 4A3DB 4K5VA 1JR0D 1Q8IA 4U68A 5FK9C 3SDZA 1O80A 3LNNA 5KNBA 5E4WC 5JAVA 2MHVA 1CTMA 3FDTA 3EQLC 2K05A 2B2WC 4LJZC 1ONLA 1JORA 4KV6A 3NP8A 5JEAJ 3PUXA 2K04A 1NUCA 3D3RA 5KIXA 1XX8A 1AFPA 2CVRA 2VB2X 2LY7A 1HHVA 5JOBA 4Y7NB 2R92B 2F0IA 3S1MB 2ZXOA 1MSHA 3QWNA 5IT9L 3H3VC 2XIWA 3I73A 1OXUA 3KK7A 1CHPD 2MGSA 1G6ZA 1PRTC 1X32A 3CRLC 2Y0SB 1EIHA 3NWSA 3EA6A 3G7LA 4FXKC 1FNUA 1Q1BA 1MD2D 3OMCA 2BE5D 3KLSX 3GTMB 3SR1A 4PMBA 3T4AC 3OSOA 1QE6A 2Q8TA 1E2VA 3D4RA 3PUWA 3K7AB 4IZ8A 1GUTA 3H94A 5IGGA 2JA8B 1RTNA 2O5IC 3HOWB 1B3AA 4DXGA 2X6GA 1PFMA 1E2ZA 4RH6A 2F0LA 4FYDA 3OW7A 2WB1B 3V96A 3ND8A 3NHHA 1SNPA 4DK1A 5CBEE 2B2TC 1SYBA 4F87A 2A69D 4F8MA 3I72A 3QIAA 3MZ5A 2IJ0A 4HEDA 1ICWA 2F1MA 3NBHA 4G4KA 3RMHA 2LFNA 5CV9A 1GUNA 2A6HC 1VF7A 1FGBD 3TSSA 1E2WA 1L0YB 5J39A 4M1UB 1OO9B 5IODA 3OWEB 1LT3D 1ILQA 3PO2B 1OXTA 1CZWA 2A73B 4WRDA 3S15B 3FPUB 1QB5D 3S2HB 1SMYC 3HOUB 2R93B 2AUJD 2ZXRA 4ZRZA 1SNOA 3CU7A 4ZYSA 5C0XH 1JB3A 5D3IB 3GV3A 4CJ1B 3DHQA 1EY5A 4FF1A 1XWEA 2G9HD 2A69C 2XVSA 3X3NA 2X69A 1D5MC 1B53A 1I4RA 1TS2A 3VA7A 2F4IA 1AZPA 5KEEA 1EY0A 2L1BA 1SXTA 3E6ZX 2IX1A 2MPMA 3MAQA 1JE4A 4HN7A 1UUPA 4TKOB 3JAME 2LKVA 2AWNA 4OL7A 3LWEA 4KHZA 3SE0A 4F88A 1CK1A 3NTKA 1VMPA 3OOCA 2EY1A 2D62A 1J9OA 4E6IA 5C6AA 3VYSA 3K5OA 1ESRA 1EWCA 2SOBA 2K7VA 3EVQA 4ZUJA 4X3TA 2M2LA 1PFNA 3K0YA 4FXGC 1II3A 1Y8PB 3S16B 2IW3A 1U4RA 1TWFB 3J7YW 3KF8A 2HQEA 3VR5A 2KA7A 4DK0A 2TSSA 2JA5B 2BA0A 4DXFA 3M7NA 1B50A 1XXGA 4OIKA 4PNYA 3V2TA 1LTGD 4FF2A 1WCMB 3I8ZA 2KEEA 2RVLA 4S3SA 3GO5A 5FO7B 4UDUC 1B9MA 1B4OA 2NTSA 5KNCA 3TP6A 1Y1WB 3HOZB 2A68C 1I6VC 1ILPA 1V1OA 1HQRD 4QUFA 2MUYA 2K6AA 5IGBA 3A54A 1KDBA 1V1PA 1HTPA 4IUNA 2EYPA 1DOKA 5C4ZA 1PTOB 1I4HA 3WOEA 5KYLA 1H9SA 3RD4A 2F0DA 3W3AA 2R6GA 5ELBA 4K8JA 3S1RB 5EQ0A 4XQJA 3R8BA 4TSSA 2A6HD 2NVYB 2EE1A 3QOLA 3GD7A 2WKDA 4C2MB 3P1HA 3QG1A 3AB9A 3HP3A 2EXZA 1ET9A 1GHJA 3BVMA 3HKZB 1GJXA 4C3IB 4HMIA 3K59A 2DY8A 2EJMA 1EY7A 4K5XA 1I3QB 1IL8A 4XIGS 4UAIA 1WTQA 1A3TA 3TZUA 3GV6A 1OXSC 3OPOA 1DZ1A 3KUPA 1FYCA 3VYTA 1GUOA 1EOTA 4DNTB 4WFN3 4CKCA 1ZXTA 1AP0A 3A8KE 5E3FA 3DWAA 3BDLA 2FJ2A 1TWAB 1H9MA 1SE3A 3BVZA 4RHRA 5COYA 4ZK9B 1CQFA 1NCVA 4RGNA 4A3EB 1BNZA 5M3FB 1ZEQX 5NUCA 2OXPA 5I4DA 3LX0A 3PUYA 3ND9A 4IURA 2QCPX 3PO3B 2IPKD 3L9AX 1C48A 1PTOF 4HCEA 2FMMA 4X3UA 3HRZC 1ENCA 3G6JB 1GUSA 1I4PA 4A3FB 1Q1EA 1U4MA 2WV6D 3U9OA 1M4VA 1HQMC 4NP5A 5HGTA 1W6KA 3M4OB 5TSSA 3RUZA 5CMDA 4X3SA 1G2TA 1UAPA 4EVOA 4K2KA 2H4OA 1JWSD 3IFDA 5DNFA 1UNSA 1HA6A 4FF4A 2HUGA 2HCIA 1IW7C 1A2TA 1SNQA 3I91A 3QB3A 3VA5A 4BY7B 1HXYD 3C1EA 1ENAA 4OIJA 5EPKA 3C2PA 3NSWA 1SEBD 1J8IA 2XSCA 1RHPA 4EGVA 5CORA 1LABA 1SNMA 3NK9A 3DM1A 3Q6SA 5FKAC 1GUGA 2F0SA 3S14B 2DNCA 3FPPA 5I9PA 4KN7C 4Z9CB 3BZDB 1E0BA 5ELFA 5IIFA 1O7ZA 4HCSA 3A8IE 3J80L 2QF7A 4OGQC 5AFWA 3H0GB 3J7AV 3S1NB 2Z1CA 4V190 1STHA 1SYFA 3S17B 3T56B 3OHXC 1MI2A 1GOZA 4XT3B 3NE5B 4N9PA 3HGBA 3K5LA 5IGFA 2NVQB 1DJRD 1JCKB 1CI3M 4QCLA 3C3LA 4LMQD 1SBBB 5C0XI 1YNNC 2A68D 1X3PA 1L0XB 1TVXA 4A3BB 3TP8A 2NB0A 5F2DA 3VR3A 4J8QA 3K5NA 2O4XA 2SDFA 1ZKOA 1JQYD 5I6YA 2WIIB 2OEOA 3MHBA 1CM9A 4PMCA 4BS9A 5I2XA 1CT1D 1EY8A 2RKSA 5C3EB 5BN3A 3QO2A 2Z8LA 4RGTA 1FNWA 2B2VC 2XRQD 2LS01 1D6EC 3MA2B 3HEJA 3DWQA 1DXMA 4FF3A 4RHSA 5CR3A 4A3GB 2R61A 4XDXA 1Q3LA 2C5CA 3CRKC 3EROA 5EGTA 1AW7A 3GTKB 2NWGA 2R3ZA 2EJGC 5EJWA 2PW5A 2SEBD 1D1KA 4TRDA 2IL8A 4P2CB 3S2DB 1CA6A 2A6EC 1IKMA 5C3WA 3NQTA 1WVLA 3A8JE 2J0TD 1HA5A 1PFBA 1KLUD 4C3IG 5K36G 2C9OA 3A7LA 4DFAA 1DOLA 4C1NK 4RGOS 5E4XA 2F0HA 1MSGA 3C1FA 1EYAA 1KTKA 5JJZA 4IFDJ 5C4XB 2K33A 2JYOA 3HOVB 1PYWD 1RF2D 1LTRD 4R8IA 2NBFA 2Q8RE 4QUCA 5JVG3 1MBYA 2F0WA 4BA2I 1X3QA 1KDAA 1BOSA 1YNJC 3SEBA 3TMEA 4KN4C 3SK6A 3K57A 1QCBD 1D1IA 1SAPA 1EWHA 2KHSA 1CFMA 1EEID 1TT2A 4IUVA 1U4PA 4DAPA 4QMGA 3QJYA 4O42A 2B2TA 1F9PA 2RA4A 3D6WA 5I6WA 2XWJB 5CV4A 5M9OA 1QNKA 5IOCA 4ZLTF 3PIP3 5JPNC 1S5FD 4H13C 4CBVA 1STGA 2YYZA 2B2WA 1EY6A 5ELCA 1C8CA 4CJ0B 1BBXC 3HG9A 1XYIA 4C3JG 5HURA 4WORA 2K5DA 1LTID 1DD2A 3CKIB 2BDNA 2PQEA 2WP8J 1Q90A 3PUVA 2F3WA 4MHEA 1W6JA 3T16A 3GTOB 1ESFA 2CW0C 4X3KA 1HUNA 1EIGA 4R9WA 2JP1A 2F0VA 2K5WA 2ICIA 1IKLA 5A2QL 5E1FA 3SXHA 5EPJA 1PMRA 1IYVA 2I46A 1SE4A 3CHBD 1MGSA 1AEXA 2Q8IB 1BUVT 1EFID 1TWGB 2E75C 1D2BA 5I9OA 4H44C 4KI0A 2R7ZB 1FR3A 2KOLA 1F9QA 4DA2A 1SYCA 2D5DA 4BWGB 2IT1A 4A93B 2QILA 2X6LA 1LV9A 1ZYRC 4I65A 1GXDC 5K36H 2ENBA 5K5PA 4K14A 2O5JC 2BOSA 1I4XA 1SYGA 1LT5D 3MC0B 3F2UA 3IL8A 1PRTB 3DXJC 1S5BD 5CV8A 3UI2A 4TQUS 5D3DA 3I4MB 3N6RA 3QOJA 4DAYA 3P75A 2PZWA 2HCCA 3PV0A 3HZXA 5A35A 1K8MA 3DEOA 2CHBD 4IFDI 4ID6A 2F0TA 2FHTA 3NUCA 1Q12A 3MWYW 1HTLD 5C44B 1PRTD 3I90A 1F2LA 1I6HB 1BCPF 4RGMA 3T51B 2V4DA 2L55A 5JPMC 1RDPD 2K03A 5KNDA 4LK1C 2K28A 2VXWA 1TS3A 3IKJA 2JSOA 5C4JB 4KY7A 5CV5A 3BG3A 3BDOA 4EQNA 1SDFA 3CQZB 1D5ZC 3JAML 1SSOA 1TWHB 5LL6X 1TS4A 4HAEA 2KCCA 4HSVA 2J7ZA 1KDCA 3R2IA 1DCZA 1HPCA 1JOKA 1EYCA 1T5EA 1B1ZA 2J4XA 4BY1B 1A3VA 1GHKA 1ML0D 3KBXA 4KY6A 3HOXB 2EYLA 2JXMB 4C3HB 2VUMB 2KQ3A 4Q5VA 5IGDA 2A74C 4PMWA 3GTQB 1DYQA 4XTCS 1TS5A 2B2UC 1K83B 4IUUA 1TY2A 5EBCA 1S5CD 1F77A 2F03A 1Y69U 4IALA 3DWPA 1BO0A 4LAAA 1V8QA 4ZKBB 1I50B 1O7LA 4L63B 5EPLA 5A2QE 1LT4D 2AWOA 2JEAI 4K6DA 1FD7D 5ELEA 4CHTB 3MXNA 2ICEC 1QNUA 4KTAA 4KHVA 1TWCB 5T1GA 1M8AA 2RSOA 3GQBA 2NN6H 4HMJA 2EVBA 3SK8A 3SK4A 1JC7A 4XT1B 1EQTA 3A56A 4K2LA 1OXVA 3KLSA 5IT9E 3NTIA 1TKWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD4 A;  2F0W A;  4KY7 A;  5CV6 A;  1EYD A;  3VA5 A;  5CV5 A;  5I6Y A;  4EQN A;  3ITP A;  1RKN A;  3C1E A;  5KRU A;  2OEO A;  4YIJ A;  3MHB A;  4PMC A;  4S3S A;  1ENA A;  3SK5 A;  1EY8 A;  3T13 A;  5I9O A;  2PZT A;  1KDA A;  1SNO A;  2RKS A;  5E3F A;  2QDB A;  1F2Y A;  2PYK A;  5J1Z A;  3TME A;  2F0N A;  3BDL A;  1KDC A;  2EY6 A;  3TP6 A;  3H6M A;  3SK6 A;  4G57 A;  4DU9 A;  4B9X A;  3OMC A;  3MXP A;  2SNM A;  2PW7 A;  5J22 A;  5KYI A;  2KHS A;  1JOK A;  1EYC A;  1EY5 A;  3DHQ A;  1SYC A;  3HEJ A;  5EKK A;  1SNM A;  1F2M A;  1TT2 A;  2F0Q A;  3NK9 A;  4ODG A;  4EQO A;  2NUC A;  3SR1 A;  5IGC A;  4PMB A;  4B9W A;  5C4H A;  1EQV A;  1IHZ A;  5CC4 A;  4NKL A;  5IGB A;  4I65 A;  4HTH A;  5CR3 A;  1A3V A;  4QMG A;  2ENB A;  4KY6 A;  5CV7 A;  3TP5 A;  1KDB A;  1SYE A;  3OSO A;  4IUN A;  2EYP A;  2F0S A;  2EYL A;  4K8I A;  1STN A;  5K5P A;  3NXW A;  1A3U A;  4NMZ A;  2F0K A;  3ERO A;  1SYD A;  4K14 A;  5EGT A;  4IZ8 A;  5I6W A;  2OF1 A;  2KQ3 A;  5C4Z A;  3D6C A;  5IGG A;  1SYG A;  5I9P A;  5CV4 A;  1EY0 A;  5IGD A;  5KEE A;  5M9O A;  2F0U A;  5C5L A;  5IGE A;  5KYL A;  3DMU A;  1SNC A;  2WAC A;  2F0D A;  2F3V A;  3OMG A;  2PW5 A;  1SND A;  3MEH A;  2EYF A;  4DGZ A;  4K8J A;  5IOC A;  4RKL A;  5NUC A;  2EYO A;  1JOQ A;  2OXP A;  4TRD A;  5IIF A;  3LX0 A;  4J6H A;  2F0E A;  4K5V A;  1STG A;  4H7B A;  4KD3 A;  4N9T A;  5CGK A;  2EY5 A;  2LKV A;  3SHL A;  3ERQ A;  4F7X A;  2F0L A;  3D4D A;  4OL7 A;  5CV8 A;  1EY6 A;  4IAL A;  4QB4 A;  5C3W A;  4EQP A;  5JAV A;  3NQT A;  3QOJ A;  4ZUI A;  1TQO A;  2EY2 A;  5C5M A;  1EZ8 A;  4LAA A;  1ENC A;  1F2Z A;  2EY1 A;  4RKB A;  3MVV A;  3P75 A;  3NHH A;  4E6I A;  2PZW A;  5C6A A;  4K5W A;  1SNP A;  3HZX A;  3S9W A;  1KAA A;  1EY4 A;  2EYH A;  1STB A;  2F0F A;  5HUR A;  2F0J A;  5C3X A;  4WOR A;  4KY5 A;  2SOB A;  3TP7 A;  1STH A;  1SYF A;  3QOL A;  3EVQ A;  2PZU A;  4K6D A;  4ZUJ A;  5ISR A;  4DFA A;  1JOR A;  4ID6 A;  3P1H A;  4KV6 A;  4QF4 A;  3NP8 A;  3U9O A;  2F0T A;  2F0G A;  5EKL A;  1SYB A;  4WRD A;  5KGU A;  2PQE A;  3NUC A;  2EXZ A;  2RDF A;  1NUC A;  4KTA A;  4KHV A;  1STY A;  1II3 A;  2F0H A;  4N9P A;  4NP5 A;  4F8M A;  5HGT A;  5KIX A;  5DEH A;  1JOO A;  3EJI A;  3MZ5 A;  3RUZ A;  3C1F A;  2F3W A;  5IGF A;  1EYA A;  1EY9 A;  4HMJ A;  4NDX A;  5JOB A;  5DAU A;  3SK8 A;  3T16 A;  3D4W A;  1TR5 A;  2RBM A;  2EYM A;  4HMI A;  5CV9 A;  2HQE A;  4EVO A;  1EZ6 A;  3BDC A;  4MIU A;  2SNS A;  3OWF A;  4R8N A;  2F0I A;  4ZQ3 A;  4K2K A;  3SK4 A;  1EY7 A;  4K5X A;  4DF7 A;  5J39 A;  1NSN S;  4KJN A;  1U9R A;  2F0V A;  1A2U A;  5IOD A;  1A3T A;  3D8G A;  4K2L A;  4ME5 A;  3PMF A;  2F0M A;  1STA A;  5E1F A;  4KJO A;  4J1M A;  3TP8 A;  5F2D A;  2F0O A;  2M00 A;  2EYJ A;  3SXH A;  1A2T A;  1KAB A;  1SNQ A;  2F0P A;  2O4X A;  4PNY A;  3R3O A;  3V2T A;  3QB3 A;  3E5S A;  1AEX A; 
#chains in the Genus database with same CATH topology
 1F9S A;  5FLM H;  3SVM A;  1A15 A;  1R9T H;  1PH2 A;  4DR5 L;  3MXG A;  4XYO A;  3C46 A;  4HJ9 A;  5IYB G;  1F2Y A;  1VQ7 A;  2IHE A;  1Q7Y C;  3NEN A;  4ILW A;  4HJ7 A;  2AHO B;  3CXC A;  2ID0 A;  2OWO A;  4OO1 I;  2XN9 C;  3G4S A;  1HFN A;  2E5L Q;  1NAP A;  2E2H B;  3A55 A;  2ALY B;  1B3Q A;  1Z47 A;  2LXJ A;  2E8G A;  4EX5 A;  3J7Z C;  4FXD A;  1IBK Q;  1X3G A;  2BCO A;  1SJE D;  5ELD A;  1K0S A;  1PHJ A;  3A74 A;  1SYE A;  4JCV E;  3TZD A;  4K8I A;  4GKK Q;  3PIO 3;  3M3Y B;  1LT6 D;  2L0C A;  1VQK A;  4XQQ A;  2E2J B;  5C3E H;  5M5X H;  4A4I A;  1PA6 A;  1BCP D;  4C3J B;  1I4G A;  1G8Z D;  3E0J A;  3OMG A;  4LFC L;  1SND A;  2M9V A;  5DM7 3;  2F0E A;  1X3F A;  1C4Q A;  3SHL A;  3BYT B;  3ERQ A;  3BVG A;  4IUP A;  5FO8 B;  1CA5 A;  1LTB D;  1D7Q A;  4KHP L;  4NW2 A;  1HRJ A;  3HOY B;  1LLR D;  3LWU A;  1EU3 A;  4LF8 L;  3J7A F;  3TP7 A;  3M7G A;  3CC4 A;  2PZU A;  2PO4 A;  4Q0F A;  3W1G A;  3ULL A;  4DV2 Q;  4PZ8 A;  4C1N I;  1N34 L;  3J7A 5;  5KGU A;  1WTW A;  2UXC Q;  2RDF A;  2E2D C;  3N52 A;  1STY A;  2OQ0 A;  5T1I A;  1JOO A;  2RDG A;  5M3F G;  1CQV A;  5M5W B;  1ET6 A;  4M8A A;  3OWF A;  4R8N A;  4KJN A;  1A2U A;  1R9T B;  2EIF A;  4ME5 A;  4L5Q A;  3RZO B;  5G3L D;  1E7Z A;  3Q24 A;  1PTO D;  4DK6 C;  1BXT A;  2M00 A;  1UEA B;  3UDF A;  1G29 1;  3GTP B;  2BDO A;  2BA1 A;  4QB4 A;  1E22 A;  2L4N A;  1PZJ D;  4KD4 A;  5IP7 H;  4A3J B;  3HOW G;  2KEC A;  1QWY A;  4KKS A;  1VQ9 A;  1CSQ A;  2EDG A;  2PZT A;  4CDF C;  2IX3 A;  3F8T A;  3H6M A;  2NVT H;  1NE3 A;  4OO1 H;  4DU9 A;  2I07 B;  1XTC D;  4X64 L;  3GTL B;  5D65 A;  4JBW A;  2ZJP A;  5M5X B;  4OHJ A;  1U4L A;  4JYA L;  5C0X J;  4BXX H;  2NUC A;  2LSS A;  4N8X 1;  1EL0 A;  1IW7 D;  1PXU A;  3CF5 A;  2KCT A;  2V1C C;  5CC4 A;  4H0L C;  3GTJ B;  1VMC A;  5IWA Q;  1OTC A;  3CCV A;  3WOF A;  1K73 C;  1W3S A;  1VQ5 A;  4XYQ A;  1TWA H;  5FOB B;  1TII D;  4GZY C;  4AIM A;  1J5E Q;  2NZH A;  3D6C A;  2PMZ B;  2DN8 A;  3L3O C;  4X62 L;  5IGE A;  2N8N A;  3HOY H;  1EU4 A;  1X54 A;  3MEH A;  4DGZ A;  4IUT A;  3P20 A;  4RKL A;  1BF4 A;  3ICE A;  1XPR A;  3KLR A;  4J6H A;  3I7F A;  4CDE C;  2UXD L;  5FLX L;  2Q2U A;  5CGK A;  3K58 A;  2GA4 B;  4F7X A;  2NVX B;  3D4D A;  3FRP B;  2BH8 A;  4DAM A;  1HJP A;  2RSN A;  4EQP A;  1EIF A;  2CH4 W;  3I3C A;  2RDH A;  1KNE A;  1GKH A;  3MVV A;  4WJW A;  5C44 G;  4G7Z C;  3D31 A;  4A3K B;  1EY4 A;  2EYH A;  1STB A;  3VYR A;  2F0J A;  3VR6 A;  2YTY A;  1WD1 A;  3FVQ A;  3PUZ A;  1TWF H;  3FKI B;  4QGU A;  3J81 L;  4V0B A;  2JA9 A;  1B8A A;  2K5N A;  3CCU A;  1F9R A;  1QVC A;  3UDI A;  4IPH A;  2VS1 A;  1KAW A;  3D4W A;  1TR5 A;  2EYM A;  2WKC A;  5FO9 B;  1NSN S;  1PV4 A;  1DM0 B;  3MTS A;  4FVM A;  4R4O A;  2PPB C;  4A76 A;  4JI7 L;  5EBD A;  1SMY D;  3ER0 A;  1EYG A;  3A5Z B;  4RA8 A;  4KLK A;  2YU9 B;  1UE6 A;  2YTV A;  1KLG D;  1BKB A;  1HCZ A;  1RKN A;  2B2U A;  4BY1 G;  4LFC Q;  3L7Z C;  1WTR A;  3OW2 A;  3FEW X;  1Y8N B;  1RTO A;  4OO1 G;  2H1E A;  5J1Z A;  2JA7 H;  2DUD A;  1A62 A;  3RR5 A;  1YNN D;  3TS0 A;  2EZV A;  1ZYR D;  5LL6 S;  4RFB A;  5EKK A;  4A3M B;  1F2M A;  3FP9 A;  2F0Q A;  3S15 H;  2UXD Q;  5IP9 H;  1B2T A;  2PCF B;  2A6E D;  3TN2 A;  5CV7 A;  4LW1 A;  4DPG A;  1B9N A;  1SJH D;  4TVA B;  2RHS B;  1WYD A;  3CCE A;  4DV6 Q;  3NBI A;  4IQZ A;  1PH1 A;  1NMG A;  2F0U A;  2CQA A;  2DNE A;  4B08 A;  5M5Y B;  3K7U C;  3AFP A;  1RJT A;  4IUQ A;  4CKB A;  1T5X D;  2EYO A;  4JI4 Q;  3URY A;  4H7B A;  1AZQ A;  3S14 H;  2EY5 A;  1QJO A;  5LHY 1;  2Z4I A;  3B6Y A;  3T1H L;  1PTO H;  1YNJ D;  1V9P A;  1TQO A;  3I70 A;  4RWS C;  2FFK B;  4DV7 Q;  1FNV A;  1I4Q A;  4RCO A;  4FNF A;  1JWU D;  3W1B A;  4JPB W;  5C3X A;  1JWM D;  4C3J H;  2RQX A;  4IFD H;  1SMX A;  4GNX A;  3K6O A;  1M90 C;  4QF4 A;  2F0G A;  1BCP B;  3NBH B;  5DM6 3;  2L9H A;  4DR6 L;  3VR2 A;  1A6X A;  3S1N H;  4NPS A;  3NEM A;  1PRT F;  3EJI A;  2G9D A;  1EY9 A;  1H9J A;  4LUV A;  4NDX A;  5DAU A;  2ES2 A;  4C2M H;  4JI3 Q;  5M3M G;  1HNW Q;  2B8G A;  3BDC A;  5C0X G;  2EPB A;  2K5Q A;  4MIU A;  2QEJ C;  3CD6 A;  5IYC G;  1DOM A;  1TWH H;  1YZ6 A;  2YU9 H;  1U9R A;  3EFX D;  4C56 C;  4JBK A;  3D8G A;  4XXE A;  2F0M A;  1RCV D;  1S5E D;  2UUB L;  1LO5 D;  2F0O A;  3S24 A;  2EYJ A;  1QIL A;  3E9I A;  3R3O A;  4PV1 C;  3E5S A;  4DUZ Q;  5CV6 A;  5G3L F;  3ITP A;  1K8O A;  4YCV A;  1TU2 B;  4L6T B;  4NXN Q;  2JA7 G;  1HNX Q;  4CDC C;  4GKJ L;  3Q0A A;  3I4N B;  4JI6 L;  3GTQ H;  5FLX E;  3H3V H;  2CW0 D;  2EJF C;  2KED A;  3K5M A;  3MXP A;  3W5O A;  5LMN W;  3R93 A;  4K0K L;  2KJX A;  4EQO A;  4JOI A;  2G5D A;  5E7N A;  1S40 A;  2VW9 A;  5C4H A;  2E76 C;  2HHH L;  4ZKC B;  2FMC A;  2EOT A;  2K1B A;  4HTH A;  4JBM A;  2ZXP A;  3H15 A;  4JI8 L;  2NZO A;  4B3S L;  3S2D H;  1WFQ A;  1ASY A;  2IX0 A;  2OF1 A;  3IRB A;  2QGQ A;  1V43 A;  3I4O A;  4ULL A;  2JA6 B;  3U4Z A;  3DMU A;  2VQF Q;  1LTT D;  3IFT A;  2Z4H A;  3I2Z A;  2EYF A;  4LFA Q;  3VDY A;  2NN6 G;  1JOQ A;  1E3P A;  1S5D D;  4KD3 A;  3RZD B;  1SE2 A;  3MXU A;  2EY2 A;  3KBG A;  4RAU C;  1F2Z A;  1OXX K;  2JEB I;  4KHP Q;  1UE7 A;  1Y1V B;  5JJI A;  4HID A;  1LAC A;  2NYZ D;  4K5W A;  3R2T A;  3S1Q B;  1KAA A;  2XWB B;  2F0F A;  3FMC A;  4IFD G;  3M4O H;  5CYU A;  4X66 L;  1PZI D;  3OIQ A;  4KY5 A;  2ZJQ A;  3M4P A;  1SFO B;  1VQN A;  3CC2 A;  1PH3 A;  4JK1 C;  1O78 A;  5EKL A;  3AMU A;  4UP9 A;  2GVB A;  3TRZ A;  4MN3 A;  1CHQ D;  5J22 A;  1SR3 A;  1XMO L;  5DEH A;  4DR4 Q;  2MP1 A;  4A3F H;  2VB3 X;  1Q46 A;  3U9S A;  3MXN B;  5JVH 3;  4CJ2 C;  2RBM A;  1I5F A;  1ROD A;  4JI6 Q;  1EZ6 A;  1MIU A;  4X6A H;  4YY3 L;  2PNH A;  2KUM A;  4DF7 A;  2ZM6 L;  3G6E A;  4A3E G;  3BS1 A;  3FKI H;  3I4L A;  2HD3 A;  4BBS H;  4KJO A;  1QG7 A;  3A5U A;  4J1M A;  1BVS A;  2VY3 A;  5LMU Q;  2UXC L;  1KAB A;  2F0P A;  4GLA C;  3O13 A;  2VQE Q;  4KMU C;  5AJ3 L;  4DN4 M;  1EYD A;  2PNR C;  1HR0 L;  2VL6 A;  4YIJ A;  1FGU A;  4HR7 B;  3X3M A;  4DV5 L;  3NEL A;  3T13 A;  3PO3 G;  4H02 A;  2R7F A;  2PYK A;  2B29 A;  2F0N A;  2EY6 A;  2N55 A;  2NZ1 D;  4LUO A;  1A0I A;  3J81 i;  5CBA E;  4PQX A;  4WJ4 A;  5GAE C;  2SNM A;  4DAV A;  1PH4 A;  4DR3 L;  4P71 A;  5KYI A;  3V05 A;  4BY7 H;  4XQN A;  5D14 A;  4A3D H;  1DON A;  3DLL A;  3PO2 H;  1EOV A;  4YWL A;  1VDZ A;  3TEH B;  1CUK A;  5IGC A;  1PLF A;  4DR5 Q;  4OON A;  2GVA A;  4NKL A;  3Q23 A;  2K01 A;  4ABN A;  2A19 A;  2N88 A;  3J81 E;  2E2I B;  4X66 Q;  1STN A;  3NTH A;  3NXW A;  1YJN A;  1TY0 A;  2AQ2 B;  1PZK D;  3W2D A;  2O2L D;  5C5L A;  1CZG A;  1B7Y B;  2WAC A;  1Y14 B;  3HS0 C;  2GN5 A;  2P5Z X;  4RCN A;  3AU7 A;  5IWA L;  3ONA B;  2BE5 C;  3WDN A;  1WTX A;  2F4V Q;  4MZ9 A;  3CCM A;  2D9U A;  2WIN B;  3MFG A;  3WWV A;  2TMP A;  3E0E A;  2VZA A;  3BYY B;  4ZUI A;  3BJU A;  4U67 3;  1BQQ T;  4A3E H;  4AYB B;  3CCQ A;  1H9S B;  1NR4 A;  1S4Z A;  2JE6 I;  3NPP A;  1IBL Q;  1BCP C;  1QZG A;  4KK7 A;  4B3T L;  4JI1 L;  4QIW B;  3VYU A;  1LTA D;  5I2Y A;  2UU9 L;  1QOH A;  1B44 D;  1G2S A;  2B8F A;  4R4T A;  4HJ5 A;  4K6L A;  4LF8 Q;  3PSI A;  1HFG A;  3H0G H;  3DEP A;  3QR8 A;  2EXD A;  2WB1 G;  4ZAI A;  2LMC B;  4UY8 C;  2HDL A;  1Z6H A;  1WTO A;  5IYC H;  1G91 A;  2B2Y C;  4DV0 L;  4L8J A;  3J80 E;  1ENF A;  3NQI A;  2NVT B;  3DUZ A;  3CC7 A;  1LTS D;  2QKI C;  2AQ1 B;  2XNA C;  1WTV A;  2L11 A;  4B3S Q;  1O7Y A;  3A7A B;  4A3M G;  1K28 A;  4OWT B;  2Z9H A;  5KRU A;  1R4Q B;  1U5K A;  4CDD C;  4NXM Q;  2A5H A;  3SK5 A;  3TBI B;  5JEA G;  2QDB A;  2AQ3 B;  1Z7T A;  2NTT A;  3KLW A;  4G57 A;  1EEF D;  1VQC A;  3PO2 G;  1V1P B;  2PW7 A;  1I94 L;  2AUK A;  2QDL A;  4IPC A;  3T1Y Q;  2XGT A;  2XRS D;  3M4Q A;  4ODG A;  2D2C C;  1XMQ L;  1H9R A;  1IHZ A;  4BBR B;  4A3C H;  4JI5 L;  2B2V A;  1X6O A;  4DV3 L;  2OT2 A;  1Z9F A;  2JJQ A;  4NMZ A;  2F0K A;  3GTG B;  1SYD A;  2CQO A;  2A8V A;  4J15 A;  2NN6 I;  4JV5 Q;  1SNC A;  2F3V A;  1NTG A;  1L0W A;  2L12 A;  1VQP A;  4A3G H;  2HIV A;  3NWT A;  1R4P B;  2RCN A;  2B39 A;  4N9T A;  3P7J A;  3GP7 A;  2K32 A;  4BA1 I;  4KKT A;  3M4Y A;  3Q8D A;  3G48 A;  5BN5 A;  3PCO B;  5C5M A;  4LUZ A;  1EZ8 A;  4KKU A;  4RKB A;  3IAY A;  2B2Y A;  4C3I H;  1Y8O B;  4L5T A;  3S9W A;  3H09 A;  4JG2 A;  1HR0 W;  1HUM A;  2UXB Q;  3STB D;  5M3M B;  1GD7 A;  3EBE A;  2MFI A;  2WB1 E;  5C44 H;  3CPW A;  3I55 A;  4OEL B;  1N32 Q;  4IN3 A;  1VCI A;  3TDQ A;  1HZA A;  1I6H H;  3RZD H;  3OIP A;  1VQA A;  3G71 A;  5C4X H;  2IWH A;  3U4V A;  4DNI A;  4C3H G;  1KNA A;  3M85 A;  4HSP A;  2E74 C;  1AN8 A;  1GM5 A;  1VF5 C;  5JEA H;  4CKE A;  1JIC A;  2SNS A;  1GUW A;  4ZQ3 A;  1BR9 A;  2JA7 B;  3MFY A;  2ZJR A;  3RLF A;  3PMF A;  4OWX B;  4DUY Q;  3Q22 A;  2E2H H;  1STA A;  3BZK A;  1BDO A;  1D5X C;  2AMC B;  5EKI A;  4Y7N H;  4DR6 Q;  4CGY B;  1PH6 A;  4A3M H;  2B63 B;  1SLJ A;  4DNR B;  5ISR A;  1WTP A;  3BU2 A;  1WD0 A;  1LYL A;  3KJO A;  2KVM A;  5BN4 A;  1XPO A;  2JA5 G;  3ZJY C;  1XMQ Q;  2VNU D;  4I7Z C;  1J6Q A;  2HDM A;  1S3O A;  4GOP B;  2D0P A;  4DV1 L;  2DY7 A;  1N33 L;  1NJI C;  1H9K A;  4O1N A;  4P74 A;  1IYU A;  3VR4 A;  5C4J H;  3T53 B;  4JI7 Q;  4BBS B;  4B9X A;  3J81 c;  4FO2 A;  1NNX A;  2OQK A;  2FIN B;  4C3H H;  1RD9 D;  3ZYY X;  3K80 C;  2I5H A;  4A3I B;  2MNA A;  4B9W A;  1EQV A;  4QL5 A;  1PDQ A;  3OTO Q;  1K83 H;  1X55 A;  4FP5 D;  1PTO C;  2L5T A;  1NR2 A;  2WAQ B;  1STE A;  3TP5 A;  3H91 A;  1HNZ Q;  1A3U A;  4G7O C;  3J80 i;  1Y1W G;  3HOZ G;  4PZ7 A;  2ZT9 C;  1Y1V G;  2MJ8 A;  2K5V A;  3UDG A;  4G7H C;  4APV A;  2UU9 Q;  2KCN A;  4A3D B;  4K5V A;  1JR0 D;  3U50 C;  1Q8I A;  4U68 A;  5FK9 C;  5GRO A;  3SDZ A;  3GTG H;  1O80 A;  3K7A H;  5LMN Q;  1HZC A;  3HOV G;  3LNN A;  5KNB A;  5E4W C;  5JAV A;  2KEN A;  2MHV A;  1CTM A;  3FDT A;  3EQL C;  1YHB A;  2K05 A;  2B2W C;  1KIX A;  4JI4 L;  4LJZ C;  2N78 A;  3TQY A;  1ONL A;  1JOR A;  2CKZ B;  4KV6 A;  3L2P A;  3NP8 A;  5JEA J;  3PUX A;  2K04 A;  2KHJ A;  1NUC A;  3D3R A;  5KIX A;  1XX8 A;  1EQQ A;  3JAM i;  5GAH C;  1AFP A;  2CVR A;  2VB2 X;  2LY7 A;  1HHV A;  5JOB A;  4Y7N B;  2R92 B;  2F0I A;  3KF8 B;  3S1M B;  2ZXO A;  1MSH A;  4PZ6 A;  3QWN A;  4X64 Q;  1EIY B;  5IT9 L;  3H3V C;  2XIW A;  2ZTE A;  3I73 A;  3HOU H;  1OXU A;  5HY6 A;  3GTL H;  1VS0 A;  3KK7 A;  1CHP D;  2MGS A;  1G6Z A;  4JC0 A;  3PF5 A;  1N36 L;  1PRT C;  1X32 A;  1VQL A;  3CRL C;  1T9H A;  2Y0S B;  4LF5 Q;  5EAY A;  1EIH A;  3NWS A;  4JVZ A;  4HIM A;  3EA6 A;  2PQA A;  3G7L A;  4A75 A;  1P16 A;  4FXK C;  1FNU A;  1Q1B A;  1WI5 A;  1MD2 D;  5DLQ E;  3OMC A;  2BE5 D;  5LMN L;  3KLS X;  2AKW B;  3GTM B;  1WOC A;  3SR1 A;  4PMB A;  3PGZ A;  4GN4 B;  3T4A C;  3OSO A;  1QE6 A;  2Q8T A;  1E2V A;  3D4R A;  2CH4 A;  3PUW A;  4IZ8 A;  3K7A B;  1GUT A;  3H94 A;  5IGG A;  2JA8 B;  4AYB G;  1RTN A;  4A3I H;  1QZH A;  3F2C A;  2O5I C;  1KHI A;  4A3J G;  3HOW B;  1B3A A;  4DXG A;  2X6G A;  1ICF B;  1GVP A;  1PFM A;  1E2Z A;  4RH6 A;  4HJA A;  2F0L A;  2F4V L;  4FYD A;  3OW7 A;  3K0X A;  2WB1 B;  3V96 A;  3ND8 A;  3MEF A;  2NVQ H;  1G6P A;  1N8R C;  3NHH A;  1SNP A;  4DK1 A;  1EFW A;  2Y0S E;  1SN8 A;  4R1J A;  4DV2 L;  5CBE E;  1YJW A;  3AEV A;  2B2T C;  2IHF A;  1L1O A;  1N36 Q;  1SYB A;  2JA5 H;  4F87 A;  2A69 D;  4F8M A;  3H3V I;  3I72 A;  2RHQ B;  3QIA A;  3MZ5 A;  2IJ0 A;  4HED A;  1ICW A;  4IPG A;  1SE8 A;  2F1M A;  3NBH A;  1A8V A;  4A93 G;  4G4K A;  3RMH A;  2LFN A;  5CV9 A;  1GUN A;  2A6H C;  1VF7 A;  1FGB D;  1YHQ A;  3TSS A;  1E2W A;  4NB3 A;  1L0Y B;  1Q82 C;  5J39 A;  4M1U B;  1OO9 B;  5IOD A;  3S17 H;  3OWE B;  4LFB Q;  2VQF L;  1LT3 D;  3OYY A;  1XMO Q;  4DAY B;  1IYJ B;  4LF7 L;  1ILQ A;  3PO2 B;  1OXT A;  1CZW A;  2A73 B;  4GOP C;  4WRD A;  3S15 B;  3FPU B;  1QB5 D;  1LTL A;  3S2H B;  1SMY C;  2R7D A;  3HOU B;  2R93 B;  1AE2 A;  2AUJ D;  2ZXR A;  4ZRZ A;  4DV0 Q;  1SNO A;  3CU7 A;  4ZYS A;  5C0X H;  3J81 j;  1JB3 A;  5D3I B;  3GV3 A;  4Y52 H;  1EWI A;  4R4C A;  5HGQ A;  3HOX H;  4CJ1 B;  4DV7 L;  3TS2 A;  4A3B H;  3DHQ A;  1EY5 A;  4FF1 A;  3ERS X;  2VUM H;  3UE0 A;  1XWE A;  2G9H D;  2Z0S A;  2A69 C;  2XVS A;  3X3N A;  2PI2 E;  3L0O A;  4BY7 G;  1YEZ A;  1VQM A;  2X69 A;  2DGY A;  4AQY L;  2ZTD A;  1D5M C;  1B53 A;  2B3G A;  1I4R A;  1TS2 A;  3VA7 A;  2F4I A;  1XNQ Q;  1AZP A;  4ALP A;  3DM3 A;  2MO0 A;  5KEE A;  1EY0 A;  2L1B A;  1SXT A;  3E6Z X;  2IX1 A;  2MPM A;  3MAQ A;  5IY0 A;  4BY1 H;  1JE4 A;  3BZC A;  3CME A;  4HN7 A;  1UUP A;  1K8A C;  4TKO B;  1KXL A;  5BR8 L;  1L1O B;  3JAM E;  2LKV A;  3T1Y L;  2AWN A;  4OL7 A;  3LWE A;  4KHZ A;  3SE0 A;  4F88 A;  1CK1 A;  5IE8 A;  3NTK A;  3LGJ A;  1VMP A;  4JV5 L;  3OOC A;  2EY1 A;  2D62 A;  1J9O A;  4RMF A;  4E6I A;  5C6A A;  3VYS A;  3K5O A;  1NBW A;  4GKJ Q;  1ESR A;  1EWC A;  4EQ5 A;  2SOB A;  2K7V A;  4JI2 L;  3EVQ A;  2MO1 A;  4ZUJ A;  4X3T A;  1IZ6 A;  3RN2 A;  2M2L A;  2PMZ E;  1PFN A;  3K0Y A;  4FXG C;  1II3 A;  1Y8P B;  3S16 B;  2F3I A;  3H0G G;  2IW3 A;  1U4R A;  1TWF B;  2B63 G;  3J7Y W;  3KF8 A;  2HQE A;  3VR5 A;  2KA7 A;  4DK0 A;  2TSS A;  2JA5 B;  4OXP A;  2BA0 A;  4DXF A;  3M7N A;  1B50 A;  1XXG A;  4OIK A;  4PNY A;  4YWM A;  3V2T A;  1I3Q H;  1LTG D;  4FF2 A;  1WCM B;  2EQS A;  3I8Z A;  1VQD A;  4BBR H;  2K14 A;  2KEE A;  2RVL A;  4S3S A;  3GO5 A;  5FO7 B;  4UDU C;  1B9M A;  1B4O A;  1TXY A;  1C9O A;  2NTS A;  5KNC A;  3TP6 A;  1Y1W B;  1UE5 A;  2A68 C;  3HOZ B;  2UUA L;  1QVG A;  1I6V C;  1ILP A;  1V1O A;  1HQR D;  4QUF A;  3S2H H;  2MUY A;  1D8L A;  1EUJ A;  2K6A A;  1K8G A;  4A3D G;  5BR8 Q;  4AH6 A;  4R4Q A;  5IGB A;  4JOI C;  3A54 A;  1KDB A;  1V1P A;  5FJ8 G;  1HTP A;  4IUN A;  2EYP A;  1DOK A;  4JI0 L;  4X62 Q;  4DV6 L;  1JT8 A;  5C4Z A;  1PTO B;  2H5X A;  1I4H A;  1HH2 P;  1LUZ A;  3WOE A;  5KYL A;  1H9S A;  3RD4 A;  2F0D A;  3W3A A;  2R6G A;  5ELB A;  4K8J A;  3S1R B;  4JI2 Q;  3M3Y H;  4A3G G;  2D0O A;  1CSP A;  2JQO A;  5EQ0 A;  4XQJ A;  3R8B A;  3RLN A;  1YI2 A;  3M9B A;  4TSS A;  2A6H D;  3KF6 B;  1VQ6 A;  2DJF C;  2NVY B;  3S16 H;  2EE1 A;  2R92 G;  3GDE A;  3QOL A;  5GAD C;  3GD7 A;  4O2D A;  2WKD A;  4C2M B;  4HJ8 A;  4BXX G;  3PO3 H;  3I56 A;  3P1H A;  1YNX A;  1VQO A;  3QG1 A;  3AB9 A;  3HP3 A;  5IP9 G;  4YWK A;  2UXB L;  2EXZ A;  2I5M X;  2YV5 A;  1ET9 A;  1GHJ A;  3RZO H;  3BVM A;  4O0A A;  1FJG L;  3HKZ B;  1GJX A;  3CP0 A;  2Z6B A;  2JA6 G;  2IY5 B;  4C3I B;  4HMI A;  2HHH Q;  3K59 A;  2DY8 A;  2EJM A;  1EY7 A;  1VQB A;  4K5X A;  1I3Q B;  1IL8 A;  4XIG S;  1UEB A;  4UAI A;  3KDF B;  1WTQ A;  1A3T A;  3TZU A;  3GV6 A;  1OXS C;  4IJL A;  4GNX C;  5M5W H;  3OPO A;  1DZ1 A;  3KUP A;  1IBM L;  1XNQ L;  1FYC A;  3VYT A;  1GUO A;  1EOT A;  4JI0 Q;  4DNT B;  2DJG C;  4WFN 3;  4CKC A;  1ZXT A;  1AP0 A;  3A8K E;  1JB7 A;  4P73 A;  5E3F A;  3DWA A;  4R4I A;  3K81 C;  2K75 A;  3RN5 A;  3GTJ H;  3BDL A;  4ZCK A;  2FJ2 A;  1TWA B;  1A63 A;  1H9M A;  1SE3 A;  1N33 Q;  3I4N H;  3BVZ A;  3UE1 A;  4RHR A;  5COY A;  1Y1W H;  4ZK9 B;  1CQF A;  3HOZ H;  1NCV A;  1Q8K A;  4RGN A;  4A3E B;  1FVI A;  4LNQ A;  3JAM c;  2NVX H;  1BNZ A;  5M3F B;  4P75 A;  2ATW A;  1JJG A;  1JJC B;  1ZEQ X;  1QVF A;  5NUC A;  2OXP A;  5I4D A;  3SGI A;  3LX0 A;  2NVY H;  3PUY A;  4MTK A;  3ND9 A;  4IUR A;  2QCP X;  3PO3 B;  2IPK D;  3L9A X;  4HCE A;  1C48 A;  1PTO F;  2FMM A;  4X3U A;  3HRZ C;  1ENC A;  3G6J B;  3S1R H;  1GUS A;  2R92 H;  1RIP A;  4L5R C;  1I4P A;  2QEX A;  3STB C;  2C35 B;  4DV1 Q;  4DV5 Q;  4A3F B;  1Q1E A;  4OEM B;  1K3R A;  1U4M A;  2WV6 D;  1BBW A;  3U9O A;  2BH2 A;  3HOV H;  1M4V A;  1HQM C;  4NP5 A;  5IYD H;  5HGT A;  3J80 c;  1W6K A;  3M4O B;  2A1A A;  5TSS A;  3RUZ A;  5CMD A;  3HKS A;  4X3S A;  1G2T A;  1UAP A;  4EVO A;  1YJ9 A;  1PH7 A;  4K2K A;  4MNO A;  2H4O A;  3CW2 C;  1JWS D;  3IFD A;  1FL0 A;  3E9H A;  5DNF A;  1PYB A;  1HNW L;  2R93 G;  4RG1 A;  1UNS A;  2UUA Q;  1HA6 A;  2HIX A;  4FF4 A;  2HUG A;  5LMU L;  2HCI A;  1IW7 C;  4QQB X;  5FLM G;  1A2T A;  1SNQ A;  3I91 A;  3QB3 A;  1SRU A;  3VA5 A;  2FXQ A;  1HR0 Q;  4BY7 B;  1HXY D;  3C1E A;  1ENA A;  4OIJ A;  3PQI A;  5EPK A;  3U58 A;  3C2P A;  1Q86 C;  2MQH A;  3NSW A;  1SEB D;  1J8I A;  4A3K G;  2XSC A;  1RHP A;  4LFB L;  4EGV A;  5COR A;  1LAB A;  4DR1 Q;  1RL2 A;  1SNM A;  5M3F H;  2K52 A;  3NK9 A;  4HIO A;  3FKI G;  1E1T A;  3DM1 A;  3Q6S A;  4B3M L;  5ELN A;  5FKA C;  1XPU A;  1GUG A;  4LF9 Q;  2F0S A;  3S14 B;  2R7Z G;  2DNC A;  1JMC A;  3FPP A;  4UP8 A;  5I9P A;  1UE1 A;  4GLX A;  5M3M H;  4KN7 C;  3F1Z A;  4Z9C B;  3BZD B;  1PFS A;  1E0B A;  5ELF A;  5IIF A;  5JJK A;  2UUC Q;  1X3E A;  1O7Z A;  4HCS A;  3A8I E;  3J80 L;  2QF7 A;  1SRO A;  4OGQ C;  5AFW A;  3KF6 A;  1X9N A;  1DGS A;  3H0G B;  1JJ2 A;  3J7A V;  3S1N B;  1GO3 E;  2JA8 H;  2Z1C A;  4I7A A;  1PH8 A;  2YTX A;  1STH A;  1SYF A;  4V19 0;  3S17 B;  3T56 B;  3OHX C;  3HOW H;  4DV4 Q;  4BBR G;  1C7Y A;  1IBK L;  1MI2 A;  1GOZ A;  4XT3 B;  4DR4 L;  3I4M G;  3NE5 B;  4N9P A;  3HGB A;  3K5L A;  5IGF A;  2NVQ B;  1DJR D;  1JCK B;  1CI3 M;  2CFM A;  4QCL A;  2PI2 A;  2ZM6 Q;  4JI5 Q;  1TWG H;  3C3L A;  3KDF A;  5JJL A;  4LMQ D;  4YCW A;  1SBB B;  5C0X I;  1YNN C;  2A68 D;  2R7Z H;  1X3P A;  1QUQ B;  1L0X B;  4DR1 L;  2PQA B;  2WFW A;  1TVX A;  1YHA A;  2CWP A;  4N8F A;  4A3B B;  3TP8 A;  2NB0 A;  5F2D A;  3VR3 A;  3CCJ A;  4J8Q A;  3K5N A;  1O7I A;  3KOJ A;  2O4X A;  2SDF A;  1ZKO A;  1JQY D;  5I6Y A;  2WII B;  1VQJ A;  2OEO A;  3MHB A;  1CM9 A;  4PMC A;  4BS9 A;  3D0F A;  1CT1 D;  5I2X A;  5AJ3 Q;  1EY8 A;  1VQ4 A;  1QUQ A;  2K5H A;  2RKS A;  5C3E B;  5BN3 A;  3QO2 A;  2Z8L A;  4DR3 Q;  4RGT A;  1FNW A;  4LF6 L;  2B2V C;  2XRQ D;  2LS0 1;  1D6E C;  3MA2 B;  3HEJ A;  3DWQ A;  1DXM A;  4FF3 A;  4RHS A;  5CR3 A;  3UDX A;  4A3G B;  4LWC A;  2R61 A;  4XDX A;  2F52 A;  2QA4 A;  1Q3L A;  3AQQ A;  2R93 H;  1XNR Q;  2C5C A;  4DR2 L;  3CRK C;  3ERO A;  5EGT A;  3JC6 6;  1AW7 A;  3GTK B;  1B70 B;  2NWG A;  2R3Z A;  2EJG C;  4L5S A;  5EJW A;  1YIT A;  2PW5 A;  5GAG C;  2SEB D;  3F2B A;  1D1K A;  4TRD A;  2KCM A;  2IL8 A;  4MTN A;  4YHH L;  4P2C B;  2JN4 A;  1HZ9 A;  2JK8 A;  3S2D B;  3HOX G;  1CA6 A;  2A6E C;  1IKM A;  5C3W A;  1M1K C;  3NQT A;  1WVL A;  3A8J E;  4PG3 A;  2VUM G;  1VQH A;  2J0T D;  1HA5 A;  1PFB A;  3HKZ G;  1KLU D;  4C3I G;  5K36 G;  2C9O A;  3S1M H;  4LF5 L;  3A7L A;  4DFA A;  4POG A;  4P72 A;  1DOL A;  4B3T Q;  3PF4 A;  5J3B A;  4JI1 Q;  3I4N G;  4C1N K;  4RGO S;  2WAQ G;  5E4X A;  2F0H A;  4JI8 Q;  1MSG A;  4A3J H;  3C1F A;  1EYA A;  1KRS A;  4AQY Q;  1VQG A;  1KTK A;  3K8A A;  5JJZ A;  4IFD J;  1K9M C;  5C4X B;  2K33 A;  2JYO A;  5IYD G;  2E5L L;  1HZB A;  1FJG Q;  3KYH C;  1WJJ A;  3HOV B;  1PYW D;  3HKZ E;  1RF2 D;  1LTR D;  1U0L A;  4R8I A;  2NBF A;  2Q8R E;  4QUC A;  5JVG 3;  4UP7 A;  1Q81 C;  2CCZ A;  1MBY A;  1YIJ A;  4NXM L;  2F0W A;  1MKH A;  2WAQ E;  4BA2 I;  1X3Q A;  1KDA A;  1BOS A;  1YNJ C;  3SEB A;  3TME A;  4KN4 C;  4LF4 Q;  3SK6 A;  3K57 A;  1QCB D;  4GKK L;  1D1I A;  1SAP A;  2N49 A;  2E2I H;  1NMF A;  1EWH A;  2KHS A;  5IP7 G;  1PH9 A;  1CFM A;  1EQR A;  4B3R L;  1EEI D;  1TT2 A;  4IUV A;  1U4P A;  1WCM H;  4DR7 L;  4DAP A;  4QMG A;  3CCR A;  1XTD A;  3QJY A;  1PYS B;  4DUZ L;  4O42 A;  4FDB A;  2Q2H A;  1X56 A;  2B2T A;  1W2B A;  1F9P A;  2RA4 A;  4GOP A;  3D6W A;  1E1O A;  2XWJ B;  5I6W A;  3EIV A;  5CV4 A;  5M9O A;  1QNK A;  3AYH B;  1HNX L;  4A93 H;  1P8L A;  1PVO A;  5IOC A;  2OTL A;  4A3F G;  4ZLT F;  3PIP 3;  5JPN C;  1S5F D;  2Y0S G;  4H13 C;  4CBV A;  1STG A;  1X65 A;  4UPA A;  2YYZ A;  4AYB E;  1CKN B;  2B2W A;  1EY6 A;  5ELC A;  1C8C A;  4CJ0 B;  1BBX C;  3HG9 A;  1XYI A;  4C3J G;  5HUR A;  4WOR A;  2K5D A;  5ELO A;  1N34 Q;  1LTI D;  5IYB H;  3I4M H;  1DD2 A;  2L15 A;  3CKI B;  2BDN A;  1BBU A;  2PQE A;  2WP8 J;  3HOY G;  1Q90 A;  4QJF A;  3PUV A;  2F3W A;  1CKM A;  4MHE A;  4IOC A;  2JA8 G;  1W6J A;  3T16 A;  3GTO B;  1LM0 A;  3CAM A;  1ESF A;  3S1Q H;  2CW0 C;  4QY7 A;  4X3K A;  1HUN A;  1EIG A;  4R9W A;  2JP1 A;  2F0V A;  2K5W A;  2ICI A;  2XTI A;  1IKL A;  5A2Q L;  4LF4 L;  5E1F A;  1N9W A;  3T1H Q;  2Z6K C;  1AE3 A;  1VQI A;  3SXH A;  4DR2 Q;  5EPJ A;  1PMR A;  2CWA A;  2I46 A;  1IYV A;  1SE4 A;  3CHB D;  1MGS A;  1AEX A;  1K0R A;  2Q8I B;  4DKA C;  4UHV A;  1MHW C;  1BUV T;  1EFI D;  4DR7 Q;  1TWG B;  2E75 C;  1D2B A;  4GN3 B;  5I9O A;  2Q2I A;  3GTM H;  4GS3 A;  2RF4 A;  4H44 C;  4KI0 A;  1AH9 A;  2R7Z B;  2I5L X;  5M5Y H;  1FR3 A;  2KOL A;  1F9Q A;  4DA2 A;  2N3S A;  3CQZ H;  1SYC A;  3OTO L;  2D5D A;  4BWG B;  2IT1 A;  4YHH Q;  4A93 B;  2QIL A;  4YY3 Q;  2X6L A;  1LV9 A;  1ZYR C;  2OTJ A;  4I65 A;  1GXD C;  5K36 H;  2ENB A;  5K5P A;  1E24 A;  3CPF A;  4IJH A;  4K14 A;  2BOS A;  5FJ8 H;  2O5J C;  1I4X A;  1SYG A;  1MJC A;  1LT5 D;  1HNZ L;  1VQ8 A;  3MC0 B;  3F2U A;  2KHI A;  3IL8 A;  4YCU A;  4OX9 Q;  1PRT B;  3DXJ C;  1S5B D;  1KRT A;  2UUC L;  3ULP A;  5CV8 A;  3UI2 A;  1IBM Q;  3HOU G;  1L2F A;  4TQU S;  3N6R A;  3QOJ A;  5D3D A;  4DAY A;  3I4M B;  3ULJ A;  3KFU A;  3P75 A;  1L1O C;  2PZW A;  2HCC A;  3PV0 A;  1KL9 A;  1VQE A;  3HZX A;  3CMA A;  1TWC H;  3GTK H;  3A0J A;  5A35 A;  1K8M A;  3DEO A;  2CHB D;  4IOA A;  3F2D A;  3CCS A;  3GTO H;  3PIO A;  4IFD I;  1N32 L;  4ID6 A;  2F0T A;  2FHT A;  2HT1 A;  3NUC A;  1I50 H;  1Q12 A;  2Z6K A;  3MWY W;  4QIW E;  2OCE A;  4DK3 C;  1HTL D;  2UUB Q;  4A3B G;  4WJ3 M;  4HIK A;  3PIP A;  5C44 B;  2K50 A;  1PRT D;  5L37 A;  3AFQ A;  3I90 A;  4X65 L;  1F2L A;  2B63 H;  1I6H B;  1BCP F;  4NXN L;  4RGM A;  4B3R Q;  3T51 B;  2V4D A;  4LFA L;  4GN5 A;  2L55 A;  1XJV A;  5C3E G;  5JPM C;  1RDP D;  2K03 A;  5KND A;  4LK1 C;  2K28 A;  2VXW A;  1TS3 A;  3IKJ A;  4LF7 Q;  3KJP A;  3CCL A;  1YBY A;  2JSO A;  5C4J B;  4KY7 A;  5H1S E;  5CV5 A;  3BG3 A;  3BDO A;  4EQN A;  4IPD A;  1SDF A;  3CQZ B;  1KD1 C;  1D5Z C;  3JAM L;  1ASZ A;  1C0A A;  2HQL A;  1SSO A;  1TWH B;  2LXK A;  5LL6 X;  1IBL L;  1TS4 A;  4K0K Q;  4HAE A;  2KCC A;  4HSV A;  2J7Z A;  1KDC A;  4ME3 A;  2JA6 H;  1K3B C;  1CKN A;  1G51 A;  1UWV A;  1DCZ A;  3R2I A;  4GLV B;  1HPC A;  1JOK A;  1EYC A;  1T5E A;  1B1Z A;  1NY4 A;  2J4X A;  4IO9 A;  1WTH A;  4BY1 B;  1PH5 A;  4OX9 L;  3TRE A;  1A3V A;  1GHK A;  1ML0 D;  3KBX A;  4KY6 A;  1S72 A;  4A3L G;  3HOX B;  2EYL A;  4LF6 Q;  1KQS A;  1Y1V H;  2JXM B;  4C3H B;  4A3K H;  1IXR A;  2VUM B;  2KQ3 A;  4Q5V A;  5IGD A;  2A74 C;  4PMW A;  1XNR L;  1DYQ A;  3GTQ B;  4DUY L;  4XTC S;  4LF9 L;  1IL2 A;  1TS5 A;  2B2U C;  1V1Q A;  1MJE A;  1K83 B;  4IUU A;  1TY2 A;  5EBC A;  4JBJ A;  1WCM G;  5FLX c;  4A3C G;  2VQE L;  4JYA Q;  1S5C D;  2Q2T A;  2K4K A;  1F77 A;  1I94 Q;  2E2J H;  2F03 A;  4X65 Q;  1Y69 U;  4IAL A;  3DWP A;  2I0Q A;  1BO0 A;  4JI3 L;  4LAA A;  2KBN A;  1V8Q A;  4ZKB B;  1I50 B;  2ASB A;  3HFZ B;  3FHW A;  4OWW B;  1O7L A;  1J5E L;  4L63 B;  5EPL A;  4DV3 Q;  5A2Q E;  1LT4 D;  2RCF A;  2AWO A;  5GQO A;  5IT9 c;  3RLO A;  2JEA I;  4K6D A;  1FD7 D;  5ELE A;  4CHT B;  4POF A;  3MXN A;  5C4X G;  2ICE C;  1QNU A;  1CKO A;  4KTA A;  4KHV A;  4BBS G;  3E3X A;  1TWC B;  5T1G A;  1M8A A;  2RSO A;  1VQF A;  3GQB A;  2NN6 H;  4DV4 L;  4HMJ A;  1JE5 A;  2EVB A;  3SK8 A;  3EN2 A;  4B3M Q;  4A3I G;  4JW0 A;  3SK4 A;  3GTP H;  4A3L H;  2ZTC A;  1JC7 A;  4XT1 B;  1SFO H;  1EQT A;  3A56 A;  1YVC A;  4K2L A;  1OXV A;  3KLS A;  5IT9 E;  3NTI A;  1KC8 C;  1TKW B;  1H95 A;  2QW7 A;  3RNU A;  4GNX B; 
#chains in the Genus database with same CATH homology
 1F9S A;  3SVM A;  1A15 A;  3MXG A;  4XYO A;  3C46 A;  1F2Y A;  4ILW A;  2ID0 A;  4OO1 I;  2XN9 C;  1HFN A;  1NAP A;  2E2H B;  3A55 A;  1Z47 A;  4FXD A;  2BCO A;  1SJE D;  5ELD A;  1SYE A;  3TZD A;  4K8I A;  3PIO 3;  3M3Y B;  1LT6 D;  2L0C A;  4XQQ A;  2E2J B;  1BCP D;  4C3J B;  1I4G A;  1G8Z D;  3E0J A;  3OMG A;  1SND A;  2M9V A;  5DM7 3;  2F0E A;  1C4Q A;  3SHL A;  3BYT B;  3ERQ A;  3BVG A;  4IUP A;  5FO8 B;  1CA5 A;  1LTB D;  1HRJ A;  4NW2 A;  3HOY B;  1LLR D;  3LWU A;  1EU3 A;  3J7A F;  3TP7 A;  3M7G A;  2PZU A;  2PO4 A;  4Q0F A;  4C1N I;  5KGU A;  1WTW A;  2RDF A;  2E2D C;  3N52 A;  1STY A;  5T1I A;  1JOO A;  2RDG A;  1CQV A;  5M5W B;  1ET6 A;  4M8A A;  3OWF A;  4R8N A;  4KJN A;  1A2U A;  1R9T B;  4ME5 A;  3RZO B;  5G3L D;  3Q24 A;  1PTO D;  1BXT A;  2M00 A;  1UEA B;  1G29 1;  3GTP B;  2BDO A;  2BA1 A;  4QB4 A;  2L4N A;  4A3J B;  1PZJ D;  4KD4 A;  2KEC A;  1QWY A;  4KKS A;  2EDG A;  2PZT A;  2IX3 A;  3H6M A;  4OO1 H;  4DU9 A;  2I07 B;  1XTC D;  3GTL B;  5D65 A;  4JBW A;  5M5X B;  4OHJ A;  1U4L A;  5C0X J;  2NUC A;  1EL0 A;  1IW7 D;  1PXU A;  5CC4 A;  4H0L C;  3GTJ B;  1VMC A;  3WOF A;  4XYQ A;  5FOB B;  1TII D;  4GZY C;  3D6C A;  2PMZ B;  2DN8 A;  3L3O C;  5IGE A;  1EU4 A;  3MEH A;  4DGZ A;  4IUT A;  3P20 A;  4RKL A;  1BF4 A;  3KLR A;  4J6H A;  5FLX L;  5CGK A;  3K58 A;  2GA4 B;  4F7X A;  2NVX B;  3D4D A;  3FRP B;  2RSN A;  4EQP A;  3I3C A;  2RDH A;  1KNE A;  3MVV A;  4WJW A;  4G7Z C;  3D31 A;  4A3K B;  1EY4 A;  2EYH A;  1STB A;  3VYR A;  2F0J A;  3VR6 A;  1WD1 A;  3FVQ A;  3PUZ A;  3FKI B;  3J81 L;  4V0B A;  1F9R A;  3D4W A;  1TR5 A;  2EYM A;  2WKC A;  5FO9 B;  1NSN S;  1DM0 B;  3MTS A;  4FVM A;  2PPB C;  5EBD A;  1SMY D;  4RA8 A;  2YU9 B;  1KLG D;  1HCZ A;  1RKN A;  2B2U A;  3L7Z C;  1WTR A;  3FEW X;  1Y8N B;  1RTO A;  4OO1 G;  2H1E A;  5J1Z A;  1YNN D;  2EZV A;  1ZYR D;  5LL6 S;  4RFB A;  5EKK A;  4A3M B;  1F2M A;  2F0Q A;  1B2T A;  2PCF B;  2A6E D;  3TN2 A;  5CV7 A;  1B9N A;  1SJH D;  3NBI A;  4IQZ A;  2F0U A;  2CQA A;  2DNE A;  4B08 A;  5M5Y B;  1RJT A;  4IUQ A;  4CKB A;  1T5X D;  2EYO A;  3URY A;  4H7B A;  1AZQ A;  2EY5 A;  1QJO A;  5LHY 1;  2Z4I A;  1PTO H;  1YNJ D;  1TQO A;  3I70 A;  4RWS C;  2FFK B;  1FNV A;  1I4Q A;  4RCO A;  4FNF A;  1JWU D;  5C3X A;  1JWM D;  2RQX A;  4IFD H;  3K6O A;  4QF4 A;  2F0G A;  1BCP B;  5DM6 3;  2L9H A;  3VR2 A;  1A6X A;  1PRT F;  3EJI A;  2G9D A;  1EY9 A;  1H9J A;  4NDX A;  5DAU A;  2B8G A;  3BDC A;  5C0X G;  2EPB A;  2K5Q A;  4MIU A;  2QEJ C;  1DOM A;  1U9R A;  3EFX D;  4C56 C;  3D8G A;  4XXE A;  2F0M A;  1RCV D;  1S5E D;  1LO5 D;  2F0O A;  2EYJ A;  1QIL A;  3R3O A;  4PV1 C;  3E5S A;  5CV6 A;  5G3L F;  3ITP A;  1K8O A;  1TU2 B;  4L6T B;  3Q0A A;  3I4N B;  5FLX E;  2CW0 D;  2EJF C;  2KED A;  3K5M A;  3MXP A;  3R93 A;  2KJX A;  4EQO A;  5C4H A;  2E76 C;  4ZKC B;  2FMC A;  2EOT A;  2K1B A;  4HTH A;  2ZXP A;  2IX0 A;  2OF1 A;  1V43 A;  4ULL A;  2JA6 B;  3DMU A;  1LTT D;  3IFT A;  2Z4H A;  2EYF A;  2NN6 G;  1JOQ A;  1S5D D;  4KD3 A;  3RZD B;  1SE2 A;  3MXU A;  2EY2 A;  3KBG A;  4RAU C;  1F2Z A;  1OXX K;  2JEB I;  1Y1V B;  1LAC A;  2NYZ D;  4K5W A;  3R2T A;  3S1Q B;  1KAA A;  2XWB B;  2F0F A;  3FMC A;  4IFD G;  5CYU A;  1PZI D;  3OIQ A;  4KY5 A;  1SFO B;  4JK1 C;  1O78 A;  5EKL A;  3AMU A;  4MN3 A;  1CHQ D;  5J22 A;  5DEH A;  2MP1 A;  2VB3 X;  3U9S A;  5JVH 3;  4CJ2 C;  2RBM A;  1ROD A;  1EZ6 A;  2KUM A;  4DF7 A;  3BS1 A;  3I4L A;  4KJO A;  1QG7 A;  4J1M A;  1KAB A;  2F0P A;  3O13 A;  4KMU C;  4DN4 M;  1EYD A;  2PNR C;  4YIJ A;  4HR7 B;  3X3M A;  3T13 A;  2PYK A;  2F0N A;  2EY6 A;  2N55 A;  2NZ1 D;  5CBA E;  4PQX A;  2SNM A;  4DAV A;  5KYI A;  3V05 A;  4XQN A;  5D14 A;  1DON A;  1VDZ A;  5IGC A;  1PLF A;  4NKL A;  3Q23 A;  2K01 A;  4ABN A;  2N88 A;  3J81 E;  2E2I B;  1STN A;  3NTH A;  3NXW A;  1TY0 A;  2AQ2 B;  1PZK D;  3W2D A;  2O2L D;  5C5L A;  1CZG A;  2WAC A;  3HS0 C;  4RCN A;  3AU7 A;  3ONA B;  2BE5 C;  3WDN A;  1WTX A;  2D9U A;  2WIN B;  3MFG A;  2TMP A;  3BYY B;  4ZUI A;  4U67 3;  1BQQ T;  4AYB B;  1H9S B;  1NR4 A;  1S4Z A;  2JE6 I;  3NPP A;  1BCP C;  4KK7 A;  4QIW B;  3VYU A;  1LTA D;  5I2Y A;  1QOH A;  1B44 D;  1G2S A;  2B8F A;  4K6L A;  1HFG A;  3DEP A;  4ZAI A;  2LMC B;  2HDL A;  1Z6H A;  1WTO A;  1G91 A;  2B2Y C;  4L8J A;  3J80 E;  1ENF A;  3NQI A;  2NVT B;  3DUZ A;  1LTS D;  2QKI C;  2AQ1 B;  2XNA C;  1WTV A;  2L11 A;  1O7Y A;  3A7A B;  5KRU A;  1R4Q B;  2A5H A;  3SK5 A;  3TBI B;  5JEA G;  2QDB A;  2AQ3 B;  1Z7T A;  2NTT A;  4G57 A;  1EEF D;  1V1P B;  2PW7 A;  2AUK A;  2XRS D;  4ODG A;  2D2C C;  1H9R A;  1IHZ A;  4BBR B;  2B2V A;  2OT2 A;  4NMZ A;  2F0K A;  3GTG B;  1SYD A;  2NN6 I;  1SNC A;  2F3V A;  2L12 A;  3NWT A;  1R4P B;  2B39 A;  4N9T A;  3P7J A;  3GP7 A;  2K32 A;  4BA1 I;  4KKT A;  3M4Y A;  5BN5 A;  5C5M A;  1EZ8 A;  4KKU A;  4RKB A;  3IAY A;  2B2Y A;  1Y8O B;  3S9W A;  3H09 A;  1HUM A;  5M3M B;  4IN3 A;  1VCI A;  3TDQ A;  3OIP A;  2IWH A;  4C3H G;  1KNA A;  3M85 A;  4HSP A;  2E74 C;  1AN8 A;  1VF5 C;  5JEA H;  4CKE A;  1JIC A;  2SNS A;  1GUW A;  4ZQ3 A;  1BR9 A;  2JA7 B;  3MFY A;  3RLF A;  3PMF A;  3Q22 A;  1STA A;  1BDO A;  1D5X C;  5EKI A;  4CGY B;  2B63 B;  4DNR B;  5ISR A;  1WTP A;  1WD0 A;  2KVM A;  5BN4 A;  2VNU D;  4I7Z C;  2HDM A;  2DY7 A;  1H9K A;  4O1N A;  1IYU A;  3VR4 A;  3T53 B;  4BBS B;  4B9X A;  4FO2 A;  2FIN B;  1RD9 D;  3ZYY X;  4A3I B;  4B9W A;  1EQV A;  1PDQ A;  4FP5 D;  1PTO C;  2L5T A;  1NR2 A;  2WAQ B;  1STE A;  3TP5 A;  3H91 A;  1A3U A;  4G7O C;  2ZT9 C;  2MJ8 A;  4G7H C;  2KCN A;  4A3D B;  4K5V A;  1JR0 D;  1Q8I A;  4U68 A;  5FK9 C;  3SDZ A;  1O80 A;  3LNN A;  5KNB A;  5E4W C;  5JAV A;  2MHV A;  1CTM A;  3FDT A;  3EQL C;  2K05 A;  2B2W C;  4LJZ C;  1ONL A;  1JOR A;  4KV6 A;  3NP8 A;  5JEA J;  3PUX A;  2K04 A;  1NUC A;  3D3R A;  5KIX A;  1XX8 A;  1AFP A;  2CVR A;  2VB2 X;  2LY7 A;  1HHV A;  5JOB A;  4Y7N B;  2R92 B;  2F0I A;  3S1M B;  2ZXO A;  1MSH A;  3QWN A;  5IT9 L;  3H3V C;  2XIW A;  3I73 A;  1OXU A;  3KK7 A;  1CHP D;  2MGS A;  1G6Z A;  1PRT C;  1X32 A;  3CRL C;  2Y0S B;  1EIH A;  3NWS A;  3EA6 A;  3G7L A;  4FXK C;  1FNU A;  1Q1B A;  1MD2 D;  3OMC A;  2BE5 D;  3KLS X;  3GTM B;  3SR1 A;  4PMB A;  3T4A C;  3OSO A;  1QE6 A;  2Q8T A;  1E2V A;  3D4R A;  3PUW A;  3K7A B;  4IZ8 A;  1GUT A;  3H94 A;  5IGG A;  2JA8 B;  1RTN A;  2O5I C;  3HOW B;  1B3A A;  4DXG A;  2X6G A;  1PFM A;  1E2Z A;  4RH6 A;  2F0L A;  4FYD A;  3OW7 A;  2WB1 B;  3V96 A;  3ND8 A;  3NHH A;  1SNP A;  4DK1 A;  5CBE E;  2B2T C;  1SYB A;  4F87 A;  2A69 D;  4F8M A;  3I72 A;  3QIA A;  3MZ5 A;  2IJ0 A;  4HED A;  1ICW A;  2F1M A;  3NBH A;  4G4K A;  3RMH A;  2LFN A;  5CV9 A;  1GUN A;  2A6H C;  1VF7 A;  1FGB D;  3TSS A;  1E2W A;  1L0Y B;  5J39 A;  4M1U B;  1OO9 B;  5IOD A;  3OWE B;  1LT3 D;  1ILQ A;  3PO2 B;  1OXT A;  1CZW A;  2A73 B;  4WRD A;  3S15 B;  3FPU B;  1QB5 D;  3S2H B;  1SMY C;  3HOU B;  2R93 B;  2AUJ D;  2ZXR A;  4ZRZ A;  1SNO A;  3CU7 A;  4ZYS A;  5C0X H;  1JB3 A;  5D3I B;  3GV3 A;  4CJ1 B;  3DHQ A;  1EY5 A;  4FF1 A;  1XWE A;  2G9H D;  2A69 C;  2XVS A;  3X3N A;  2X69 A;  1D5M C;  1B53 A;  1I4R A;  1TS2 A;  3VA7 A;  2F4I A;  1AZP A;  5KEE A;  1EY0 A;  2L1B A;  1SXT A;  3E6Z X;  2IX1 A;  2MPM A;  3MAQ A;  1JE4 A;  4HN7 A;  1UUP A;  4TKO B;  3JAM E;  2LKV A;  2AWN A;  4OL7 A;  3LWE A;  4KHZ A;  3SE0 A;  4F88 A;  1CK1 A;  3NTK A;  1VMP A;  3OOC A;  2EY1 A;  2D62 A;  1J9O A;  4E6I A;  5C6A A;  3VYS A;  3K5O A;  1ESR A;  1EWC A;  2SOB A;  2K7V A;  3EVQ A;  4ZUJ A;  4X3T A;  2M2L A;  1PFN A;  3K0Y A;  4FXG C;  1II3 A;  1Y8P B;  3S16 B;  2IW3 A;  1U4R A;  1TWF B;  3J7Y W;  3KF8 A;  2HQE A;  3VR5 A;  2KA7 A;  4DK0 A;  2TSS A;  2JA5 B;  2BA0 A;  4DXF A;  3M7N A;  1B50 A;  1XXG A;  4OIK A;  4PNY A;  3V2T A;  1LTG D;  4FF2 A;  1WCM B;  3I8Z A;  2KEE A;  2RVL A;  4S3S A;  3GO5 A;  5FO7 B;  4UDU C;  1B9M A;  1B4O A;  2NTS A;  5KNC A;  3TP6 A;  1Y1W B;  3HOZ B;  2A68 C;  1I6V C;  1ILP A;  1V1O A;  1HQR D;  4QUF A;  2MUY A;  2K6A A;  5IGB A;  3A54 A;  1KDB A;  1V1P A;  1HTP A;  4IUN A;  2EYP A;  1DOK A;  5C4Z A;  1PTO B;  1I4H A;  3WOE A;  5KYL A;  1H9S A;  3RD4 A;  2F0D A;  3W3A A;  2R6G A;  5ELB A;  4K8J A;  3S1R B;  5EQ0 A;  4XQJ A;  3R8B A;  4TSS A;  2A6H D;  2NVY B;  2EE1 A;  3QOL A;  3GD7 A;  2WKD A;  4C2M B;  3P1H A;  3QG1 A;  3AB9 A;  3HP3 A;  2EXZ A;  1ET9 A;  1GHJ A;  3BVM A;  3HKZ B;  1GJX A;  4C3I B;  4HMI A;  3K59 A;  2DY8 A;  2EJM A;  1EY7 A;  4K5X A;  1I3Q B;  1IL8 A;  4XIG S;  4UAI A;  1WTQ A;  1A3T A;  3TZU A;  3GV6 A;  1OXS C;  3OPO A;  1DZ1 A;  3KUP A;  1FYC A;  3VYT A;  1GUO A;  1EOT A;  4DNT B;  4WFN 3;  4CKC A;  1ZXT A;  1AP0 A;  3A8K E;  5E3F A;  3DWA A;  3BDL A;  2FJ2 A;  1TWA B;  1H9M A;  1SE3 A;  3BVZ A;  4RHR A;  5COY A;  4ZK9 B;  1CQF A;  1NCV A;  4RGN A;  4A3E B;  1BNZ A;  5M3F B;  1ZEQ X;  5NUC A;  2OXP A;  5I4D A;  3LX0 A;  3PUY A;  3ND9 A;  4IUR A;  2QCP X;  3PO3 B;  2IPK D;  3L9A X;  1C48 A;  1PTO F;  4HCE A;  2FMM A;  4X3U A;  3HRZ C;  1ENC A;  3G6J B;  1GUS A;  1I4P A;  4A3F B;  1Q1E A;  1U4M A;  2WV6 D;  3U9O A;  1M4V A;  1HQM C;  4NP5 A;  5HGT A;  1W6K A;  3M4O B;  5TSS A;  3RUZ A;  5CMD A;  4X3S A;  1G2T A;  1UAP A;  4EVO A;  4K2K A;  2H4O A;  1JWS D;  3IFD A;  5DNF A;  1UNS A;  1HA6 A;  4FF4 A;  2HUG A;  2HCI A;  1IW7 C;  1A2T A;  1SNQ A;  3I91 A;  3QB3 A;  3VA5 A;  4BY7 B;  1HXY D;  3C1E A;  1ENA A;  4OIJ A;  5EPK A;  3C2P A;  3NSW A;  1SEB D;  1J8I A;  2XSC A;  1RHP A;  4EGV A;  5COR A;  1LAB A;  1SNM A;  3NK9 A;  3DM1 A;  3Q6S A;  5FKA C;  1GUG A;  2F0S A;  3S14 B;  2DNC A;  3FPP A;  5I9P A;  4KN7 C;  4Z9C B;  3BZD B;  1E0B A;  5ELF A;  5IIF A;  1O7Z A;  4HCS A;  3A8I E;  3J80 L;  2QF7 A;  4OGQ C;  5AFW A;  3H0G B;  3J7A V;  3S1N B;  2Z1C A;  4V19 0;  1STH A;  1SYF A;  3S17 B;  3T56 B;  3OHX C;  1MI2 A;  1GOZ A;  4XT3 B;  3NE5 B;  4N9P A;  3HGB A;  3K5L A;  5IGF A;  2NVQ B;  1DJR D;  1JCK B;  1CI3 M;  4QCL A;  3C3L A;  4LMQ D;  1SBB B;  5C0X I;  1YNN C;  2A68 D;  1X3P A;  1L0X B;  1TVX A;  4A3B B;  3TP8 A;  2NB0 A;  5F2D A;  3VR3 A;  4J8Q A;  3K5N A;  2O4X A;  2SDF A;  1ZKO A;  1JQY D;  5I6Y A;  2WII B;  2OEO A;  3MHB A;  1CM9 A;  4PMC A;  4BS9 A;  5I2X A;  1CT1 D;  1EY8 A;  2RKS A;  5C3E B;  5BN3 A;  3QO2 A;  2Z8L A;  4RGT A;  1FNW A;  2B2V C;  2XRQ D;  2LS0 1;  1D6E C;  3MA2 B;  3HEJ A;  3DWQ A;  1DXM A;  4FF3 A;  4RHS A;  5CR3 A;  4A3G B;  2R61 A;  4XDX A;  1Q3L A;  2C5C A;  3CRK C;  3ERO A;  5EGT A;  1AW7 A;  3GTK B;  2NWG A;  2R3Z A;  2EJG C;  5EJW A;  2PW5 A;  2SEB D;  1D1K A;  4TRD A;  2IL8 A;  4P2C B;  3S2D B;  1CA6 A;  2A6E C;  1IKM A;  5C3W A;  3NQT A;  1WVL A;  3A8J E;  2J0T D;  1HA5 A;  1PFB A;  1KLU D;  4C3I G;  5K36 G;  2C9O A;  3A7L A;  4DFA A;  1DOL A;  4C1N K;  4RGO S;  5E4X A;  2F0H A;  1MSG A;  3C1F A;  1EYA A;  1KTK A;  5JJZ A;  4IFD J;  5C4X B;  2K33 A;  2JYO A;  3HOV B;  1PYW D;  1RF2 D;  1LTR D;  4R8I A;  2NBF A;  2Q8R E;  4QUC A;  5JVG 3;  1MBY A;  2F0W A;  4BA2 I;  1X3Q A;  1KDA A;  1BOS A;  1YNJ C;  3SEB A;  3TME A;  4KN4 C;  3SK6 A;  3K57 A;  1QCB D;  1D1I A;  1SAP A;  1EWH A;  2KHS A;  1CFM A;  1EEI D;  1TT2 A;  4IUV A;  1U4P A;  4DAP A;  4QMG A;  3QJY A;  4O42 A;  2B2T A;  1F9P A;  2RA4 A;  3D6W A;  5I6W A;  2XWJ B;  5CV4 A;  5M9O A;  1QNK A;  5IOC A;  4ZLT F;  3PIP 3;  5JPN C;  1S5F D;  4H13 C;  4CBV A;  1STG A;  2YYZ A;  2B2W A;  1EY6 A;  5ELC A;  1C8C A;  4CJ0 B;  1BBX C;  3HG9 A;  1XYI A;  4C3J G;  5HUR A;  4WOR A;  2K5D A;  1LTI D;  1DD2 A;  3CKI B;  2BDN A;  2PQE A;  2WP8 J;  1Q90 A;  3PUV A;  2F3W A;  4MHE A;  1W6J A;  3T16 A;  3GTO B;  1ESF A;  2CW0 C;  4X3K A;  1HUN A;  1EIG A;  4R9W A;  2JP1 A;  2F0V A;  2K5W A;  2ICI A;  1IKL A;  5A2Q L;  5E1F A;  3SXH A;  5EPJ A;  1PMR A;  1IYV A;  2I46 A;  1SE4 A;  3CHB D;  1MGS A;  1AEX A;  2Q8I B;  1BUV T;  1EFI D;  1TWG B;  2E75 C;  1D2B A;  5I9O A;  4H44 C;  4KI0 A;  2R7Z B;  1FR3 A;  2KOL A;  1F9Q A;  4DA2 A;  1SYC A;  2D5D A;  4BWG B;  2IT1 A;  4A93 B;  2QIL A;  2X6L A;  1LV9 A;  1ZYR C;  4I65 A;  1GXD C;  5K36 H;  2ENB A;  5K5P A;  4K14 A;  2O5J C;  2BOS A;  1I4X A;  1SYG A;  1LT5 D;  3MC0 B;  3F2U A;  3IL8 A;  1PRT B;  3DXJ C;  1S5B D;  5CV8 A;  3UI2 A;  4TQU S;  5D3D A;  3I4M B;  3N6R A;  3QOJ A;  4DAY A;  3P75 A;  2PZW A;  2HCC A;  3PV0 A;  3HZX A;  5A35 A;  1K8M A;  3DEO A;  2CHB D;  4IFD I;  4ID6 A;  2F0T A;  2FHT A;  3NUC A;  1Q12 A;  3MWY W;  1HTL D;  5C44 B;  1PRT D;  3I90 A;  1F2L A;  1I6H B;  1BCP F;  4RGM A;  3T51 B;  2V4D A;  2L55 A;  5JPM C;  1RDP D;  2K03 A;  5KND A;  4LK1 C;  2K28 A;  2VXW A;  1TS3 A;  3IKJ A;  2JSO A;  5C4J B;  4KY7 A;  5CV5 A;  3BG3 A;  3BDO A;  4EQN A;  1SDF A;  3CQZ B;  1D5Z C;  3JAM L;  1SSO A;  1TWH B;  5LL6 X;  1TS4 A;  4HAE A;  2KCC A;  4HSV A;  2J7Z A;  1KDC A;  3R2I A;  1DCZ A;  1HPC A;  1JOK A;  1EYC A;  1T5E A;  1B1Z A;  2J4X A;  4BY1 B;  1A3V A;  1GHK A;  1ML0 D;  3KBX A;  4KY6 A;  3HOX B;  2EYL A;  2JXM B;  4C3H B;  2VUM B;  2KQ3 A;  4Q5V A;  5IGD A;  2A74 C;  4PMW A;  3GTQ B;  1DYQ A;  4XTC S;  1TS5 A;  2B2U C;  1K83 B;  4IUU A;  1TY2 A;  5EBC A;  1S5C D;  1F77 A;  2F03 A;  1Y69 U;  4IAL A;  3DWP A;  1BO0 A;  4LAA A;  1V8Q A;  4ZKB B;  1I50 B;  1O7L A;  4L63 B;  5EPL A;  5A2Q E;  1LT4 D;  2AWO A;  2JEA I;  4K6D A;  1FD7 D;  5ELE A;  4CHT B;  3MXN A;  2ICE C;  1QNU A;  4KTA A;  4KHV A;  1TWC B;  5T1G A;  1M8A A;  2RSO A;  3GQB A;  2NN6 H;  4HMJ A;  2EVB A;  3SK8 A;  3SK4 A;  1JC7 A;  4XT1 B;  1EQT A;  3A56 A;  4K2L A;  1OXV A;  3KLS A;  5IT9 E;  3NTI A;  1TKW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...