1SNDA

Staphylococcal nuclease dimer containing a deletion of residues 114-119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE DIMER
publication title One-step evolution of a dimer from a monomeric protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sndA00
1ENAA 5IOCA 3SHLA 2PZUA 1SNOA 2OXPA 1TR5A 4LAAA 2KHSA 3HEJA 4QF4A 5CV4A 5KEEA 1EYAA 4WRDA 5HURA 5CV9A 1SYFA 2EYLA 4K2LA 4K8IA 2F0WA 5NUCA 2F0FA 1KDAA 1SYBA 4KTAA 2EYHA 4PNYA 4EQPA 4ZQ3A 3QOLA 5CV8A 2O4XA 4J6HA 1EY8A 3C1EA 5I9PA 3BDLA 4ZUIA 3R3OA 3VA5A 4B9WA 2EY5A 5J22A 3V2TA 3QOJA 2F0KA 4YIJA 4KHVA 5C4ZA 2ENBA 2SNSA 5C5MA 1II3A 2EYOA 2SOBA 4DF7A 3P1HA 1KAAA 1KDCA 5IIFA 2F0IA 2EYMA 3EJIA 1SNDA 3LX0A 4RKBA 2EYPA 1EZ6A 3OWFA 4ZUJA 5IGFA 5ISRA 3D6CA 5J39A 3D4DA 5M9OA 5C3WA 5IGBA 1STBA 3HZXA 4K2KA 1A2UA 5HGTA 1SYEA 3D4WA 3NXWA 1RKNA 5CV6A 5I6YA 1ENCA 2F0PA 2F0MA 4IALA 3RUZA 3DHQA 4QMGA 3TP8A 2PZWA 1EY4A 1KDBA 3E5SA 1F2MA 2F0NA 2F0DA 5EGTA 2M00A 1TQOA 3TP6A 5I9OA 4ID6A 2KQ3A 2OF1A 3MZ5A 5IGEA 5JOBA 1STYA 3SK6A 5KYIA 4EVOA 4K6DA 1EYDA 5KYLA 4I65A 1STNA 1SYDA 2OEOA 4ME5A 3PMFA 5CC4A 2EYJA 4PMBA 1STGA 1SYCA 1JOKA 1JORA 2F0EA 3SK5A 3EROA 4DU9A 4N9TA 3H6MA 2F0QA 1SNMA 3SXHA 4EQNA 2F0GA 2QDBA 5C4HA 1F2ZA 2F3WA 3ITPA 4KV6A 4WORA 3TP7A 1SNQA 5J1ZA 2F0UA 3QB3A 4H7BA 1EY0A 4KJOA 3TP5A 3D8GA 2LKVA 5IGGA 4F8MA 4RKLA 5DAUA 5KGUA 5KRUA 1EQVA 2PQEA 4OL7A 3OSOA 5EKKA 3C1FA 4S3SA 1NUCA 2EY2A 4B9XA 1EYCA 5IGDA 4EQOA 5I6WA 4HMIA 5E1FA 1EY9A 1AEXA 2RDFA 1STAA 2HQEA 1A3VA 4PMCA 4KJNA 5C6AA 2EYFA 5IODA 4ODGA 4K5XA 3T13A 2F0HA 2PW7A 3NUCA 3ERQA 3MVVA 3NP8A 3OMCA 2SNMA 4IZ8A 4KD3A 5EKLA 4TRDA 5CR3A 2EY6A 2NUCA 4N9PA 4KY6A 3NQTA 3SK4A 2RKSA 4K14A 3T16A 3BDCA 1SNPA 4IUNA 4NMZA 1TT2A 5DEHA 1A2TA 4J1MA 3NHHA 3S9WA 1IHZA 4NDXA 4K8JA 1EY5A 1KABA 2PW5A 4R8NA 5K5PA 1EY6A 1SNCA 4K5WA 1F2YA 1JOOA 5KIXA 2F0SA 3MEHA 4KY7A 4G57A 4KY5A 4DGZA 5JAVA 2F0LA 2PZTA 2PYKA 3MHBA 1U9RA 4HMJA 2F0TA 5E3FA 4MIUA 3P75A 3U9OA 3NK9A 2RBMA 5CV5A 3EVQA 4QB4A 2F0JA 3SK8A 1A3UA 5CGKA 4NP5A 3OMGA 4HTHA 2F0OA 1JOQA 4KD4A 3DMUA 1NSNS 5C5LA 2F3VA 3TMEA 5F2DA 4NKLA 1A3TA 1EY7A 1SYGA 2F0VA 3SR1A 4F7XA 1EZ8A 5C3XA 5IGCA 4K5VA 2EY1A 4DFAA 2EXZA 3MXPA 1STHA 2WACA 5CV7A 4E6IA
chains in the Genus database with same CATH superfamily
1NMGA 5IOCA 4NPSA 5I4DA 1TR5A 3JAMi 4DR1L 2KCTA 1CZGA 4FVMA 1CKOA 1XMQQ 4JBKA 5NUCA 2F0WA 5FLXc 3SEBA 1LTID 2EYHA 4ZQ3A 4P72A 1LT5D 4L5QA 1KHIA 5GAGC 3J80L 4X65Q 4FDBA 4GN4B 3BZDB 2ZTDA 5IYBG 2SNSA 2K50A 5C5MA 4RHRA 3DM3A 1CK1A 3F8TA 1X6OA 3EJIA 2XIWA 4A3KH 1VF7A 2EYPA 3S1MH 2K05A 2CCZA 4QQBX 2IX0A 3L3OC 1W2BA 1FNVA 1MI2A 1K0RA 2A74C 2K03A 1PH7A 1TIID 5FK9C 3E5SA 4ID6A 1SE3A 1VQEA 2E2HH 3SK6A 3BJUA 3IKJA 1VQMA 2OQ0A 3W1GA 3M4OH 5ELNA 3S2HH 4QIWE 4JI1L 2B63B 1PTOB 3EROA 2CQOA 1D2BA 4ALPA 1AZPA 2K01A 2HHHQ 1SNQA 1EEID 4OO1G 3I73A 4Q0FA 5LHY1 2QA4A 1Q81C 1QILA 2I5HA 4B9XA 1YJ9A 3M9BA 5IGDA 4A3GG 4L8JA 1IBML 1CM9A 1E1TA 1T5EA 4HMIA 1EY9A 4OX9L 2RDFA 2FMCA 3RMHA 4C1NK 1N36Q 1O78A 4HIOA 2EY6A 5GAEC 1TY2A 3A74A 2UXBL 3M7GA 1RDPD 2PO4A 1G2TA 3E0EA 5IY0A 2PW5A 4XDXA 1EY6A 4C2MB 2B2TA 1UEBA 5C0XJ 1HTPA 1H9RA 2FMMA 4QUCA 2EJFC 5CV5A 1OXUA 2EDGA 1QNKA 5CGKA 3OMGA 1Z47A 5C5LA 2JA5H 4IO9A 1SYGA 2Z1CA 1G51A 2O2LD 3KOJA 1VQ8A 2RDGA 4C3HG 1R9TH 2KCMA 1JJ2A 2K33A 3BVMA 2A68C 4DR7Q 1SYBA 3NE5B 1MJEA 1VS0A 3FPUB 4G7ZC 4LF7L 5KNBA 3VDYA 4MTKA 2NZ1D 5CBAE 2E2IB 4DN4M 1K83B 2SOBA 4P2CB 3ONAB 3S2DH 5IGFA 2UUAQ 4JYAL 3I4NB 2CKZB 1PTOD 2Z6KA 5KNDA 1Y8PB 2FINB 4DAPA 1CUKA 2ASBA 2D62A 3HRZC 2AWNA 1SN8A 1PH1A 1GO3E 2NB0A 1XPUA 1HNWL 3I4MG 2RDHA 3A8JE 3CCEA 1TWGH 2CWPA 4HSPA 4HSVA 3I72A 4UP9A 1JMCA 2A5HA 3GTPB 3SK5A 1H9MA 1YNND 1X56A 1WCMB 3CMAA 5M3MB 2ZXOA 1EY0A 3DXJC 2JYOA 3H0GH 3GTGB 4DR5Q 4B3TL 2DNEA 3NWTA 5KRUA 4V190 2A8VA 3K81C 5C3EH 3OSOA 4JBJA 4IJLA 1E24A 4R9WA 2XWJB 3K6OA 1JICA 1VQ5A 1STAA 2HQEA 5C44H 1EIYB 5LL6X 1A62A 1IZ6A 1PFSA 3IRBA 3T13A 1Y69U 2XSCA 1X65A 3S15B 4JI6L 3ZYYX 2ID0A 4TRDA 5CR3A 2NUCA 4DAYB 2CH4W 3TDQA 3TZDA 4KHZA 4B3MQ 4LK1C 4A3CH 2F4VQ 4JI3Q 1V9PA 3J80c 3HOZG 1YI2A 2K5HA 5D14A 2PMZE 4DGZA 4HJ5A 1HQRD 5EKIA 2K4KA 1L1OC 1ILQA 4BXXH 3ULJA 1OTCA 3MFGA 1GD7A 1M4VA 3UDXA 2GN5A 3A5ZB 5J3BA 3J80i 3PIP3 4IOCA 1NBWA 4E6IA 3J7AV 1I5FA 3EN2A 3U4VA 2F03A 2HDLA 2L4NA 2RF4A 3T1YQ 1Y1WB 5IT9c 1AW7A 4JI8L 4DR6L 5GROA 3TN2A 3C1EA 3DWAA 1NR2A 3CF5A 3GTKH 1EWCA 4BY7H 4DR1Q 1HZCA 2DJFC 1KDCA 1PMRA 3RZOB 2EYMA 2K52A 3RNUA 2X69A 2H1EA 4IPDA 1ONLA 4GOPC 1OXSC 1SYEA 3KBXA 3AFQA 3R2TA 2E76C 2AKWB 1NMFA 5I6YA 3S14H 1XTCD 2F0PA 3RUZA 1HZAA 1A63A 1DCZA 1SMYD 4FF3A 5IWAQ 3MZ5A 3VR5A 1N33L 4KI0A 4A3BG 5KNCA 1SYCA 3N6RA 1IXRA 3U4ZA 1VCIA 1N8RC 3GTOB 4GS3A 1EWHA 3TP5A 4TVAB 3ND8A 4F88A 1L0WA 2NVQH 3LWEA 1U5KA 3JAME 4BBSB 1CT1D 1JE4A 4S3SA 4IUPA 3GTMB 4DR4Q 3S17B 4JI1Q 3M4YA 3S1RB 4YWMA 4TSSA 2N55A 3SDZA 1VQCA 2L1BA 4DKAC 3OIQA 1A6XA 3HGBA 3NELA 2KJXA 5IYCG 2Q2HA 4A3JB 3GO5A 1VQIA 3NP8A 3M3YB 1BKBA 3I90A 1A0IA 2YU9B 2E75C 4YHHL 4KY6A 3ZJYC 1IBMQ 3SK4A 1PV4A 1AFPA 3A5UA 1Q8KA 4OX9Q 5CMDA 1ICFB 1EOTA 1KQSA 2QCPX 4XYOA 5M5XB 4UHVA 1TS2A 2Z0SA 3KJPA 2AUJD 4LF5L 4A3MG 2VUMH 2ZTCA 3MXNA 2YTXA 3PUWA 1J9OA 2A1AA 3CW2C 5TSSA 3DMUA 4NKLA 2NVYH 2F0VA 2K14A 4HIKA 1I6VC 1C9OA 2VZAA 1C48A 1AE3A 4XYQA 2EXDA 1MKHA 1DZ1A 4YWKA 3KLSA 3ULLA 1S5ED 1JB7A 3HOWB 2ES2A 2O4XA 5EBDA 3PUVA 1XX8A 3FKIH 4BY1B 3RR5A 1VQLA 2Q8RE 2MGSA 3PO3G 4RKBA 3PO2G 3D4DA 2R7ZH 3GTLH 2F1MA 5HGTA 2F52A 1I94Q 5CV6A 3S1NH 2R92B 2F0MA 3K7AH 4H13C 1PTOC 1X3QA 2B2WC 3GTJH 4ZYSA 4XQNA 2NWGA 2KQ3A 1IBLL 4XIGS 1ET9A 1PYSB 3Q24A 4JYAQ 1S4ZA 3MFYA 1EFID 3CC2A 1HA5A 4ME5A 2UUCL 2OTJA 2UXCL 2Z4HA 5IP7G 3EIVA 4I7ZC 1SNMA 2JA8B 1QCBD 4KKSA 3ITPA 1PRTD 1HNWQ 4RGMA 4XQQA 2F0UA 2JEBI 2LKVA 4GZYC 1E0BA 4L5TA 1U4RA 1MBYA 1YNNC 2QGQA 1SE8A 1AZQA 5C4XB 2YYZA 1MSGA 2RHQB 1HTLD 1SAPA 2N49A 3QR8A 4LFAL 2VW9A 4ODGA 4OO1I 5JEAJ 2SDFA 3X3MA 4IUQA 1K9MC 1WTPA 1F2LA 4LF6L 1VQGA 4K14A 3T16A 2L9HA 3NHHA 4R4CA 5FKAC 4A3LH 2HCCA 5JJKA 4IUUA 1EIGA 4DXGA 2K5QA 4JI6Q 1K8AC 1BF4A 1WOCA 5BN3A 4DK1A 3Q22A 4NXNL 1LM0A 4IQZA 2RBMA 5FO7B 1Q1EA 4NP5A 3SE0A 4A75A 4XQJA 1DYQA 3F1ZA 2L55A 1KD1C 2I0QA 2D0PA 1Q86C 1EFWA 3PGZA 2MO0A 2K75A 1GVPA 4LAAA 3HEJA 2HCIA 3R93A 1UEAB 1K73C 5CV9A 1RCVD 2EYLA 3D6WA 3CKIB 2IT1A 1U0LA 1E2WA 1KLUD 5DLQE 5JVG3 2Z4IA 4FO2A 1V43A 4ZUIA 1SE2A 3QOJA 2F0KA 4R4QA 4EGVA 3PSIA 1ZXTA 3GD7A 3J7ZC 3HOXG 2K28A 4JI8Q 3PUZA 4BA2I 1TWHB 4OONA 1X54A 1A2UA 1CZWA 1I6HB 2DUDA 3GP7A 4IALA 1BCPB 3DHQA 1ET6A 5AFWA 3MXNB 5KIXA 3PV0A 5KYLA 3HOYG 1SMYC 1Q82C 1STGA 4A3DG 1WTWA 3RZDH 2FJ2A 2WINB 3NSWA 3C46A 1TS3A 5M5WH 1I4GA 4C3IH 3CCJA 5J22A 2JXMB 1CSQA 1F9SA 1E7ZA 3MXUA 4N8X1 1N33Q 1RL2A 2VQFL 2E2JH 4FXGC 1EYCA 1TWAB 1AEXA 3KK7A 2PW7A 4DV1L 2HUGA 1PLFA 4RGNA 2HDMA 3F2UA 4IZ8A 2J7ZA 3I4NG 1D8LA 2KA7A 3DWPA 3NQTA 1QNUA 5ELEA 1E22A 4IUNA 3GDEA 1HR0Q 2IWHA 2MQHA 2B2UA 1KABA 3IFDA 1BR9A 1ENFA 3FRPB 4QCLA 2XTIA 4IFDH 2MO1A 1PTOH 1CA6A 2B63H 4YHHQ 3A7AB 2BCOA 3K5NA 1EEFD 1PH5A 3N52A 5G3LF 1Y8NB 2KCNA 1WCMG 1EU4A 3IL8A 5M3MG 3BZKA 1I4RA 1Y1VH 2EXZA 3KDFA 3A8IE 2OTLA 5K36H 3UE0A 2KHSA 1BXTA 4WRDA 5HURA 1NY4A 1I3QB 1X32A 4JPBW 3LNNA 3OTOL 1HNZL 2DGYA 1VQ4A 1EQQA 2J4XA 1EUJA 1BCPD 1MJCA 2E2DC 4L6TB 1EY8A 1IKMA 2JA7B 1E2VA 1JC7A 2WIIB 3K58A 2LS01 1DOMA 1N9WA 4HEDA 2JP1A 1L0XB 2EYOA 5FOBB 2B29A 4ZLTF 1G8ZD 4JI7L 2A6HD 2PI2E 3E6ZX 2I46A 1WD0A 2F3IA 3HZXA 1PYWD 4K2KA 3T4AC 3PF4A 4QJFA 2BH8A 1SDFA 4CDFC 3CHBD 3TP8A 1VQNA 5C4JH 1IKLA 4RCNA 1D5ZC 2CH4A 2H5XA 4TKOB 1TWCH 4DK3C 4A3FG 4HCSA 1LT3D 1SXTA 4PMBA 3GTQH 4CJ2C 4G7OC 4GLVB 4YY3L 2E5LL 3M4QA 3S1QH 3NTHA 2JA6H 1N34L 5EPKA 3ND9A 1VMPA 1IBLQ 4UAIA 4DAYA 3AU7A 4C3JG 1Y1WG 4A93H 2ZTEA 2UUCQ 5IYDH 4CKBA 1PRTC 3C1FA 2UXCQ 2Z6KC 2NVTB 1GJXA 2KVMA 4MZ9A 4O0AA 1OXVA 4RAUC 4P71A 3WOFA 1K83H 4A3IH 1DOLA 1B8AA 5M3FH 4GNXB 2WKDA 2QF7A 1B3AA 5IT9L 2VL6A 4A3EH 1YHBA 4O1NA 1YJWA 1WD1A 3J81E 4JI5L 1BBXC 2IHEA 2KECA 2R93B 4NMZA 2JQOA 4ME3A 3K5MA 4LFAQ 4NDXA 2DY7A 1LUZA 4QGUA 2Q2UA 4KY5A 2E8GA 4AYBB 3GTPH 2VNUD 4OEMB 4LF6Q 2I5MX 1JJCB 3HOUH 5FLMG 1XMOL 2RVLA 4DUYL 2NVXH 4JBMA 2EY1A 1DXMA 1EQTA 1G6PA 3BDOA 3L9AX 2N3SA 1BOSA 4BBSG 2UUBL 4NXNQ 5LMUQ 4APVA 3HOVG 3HOXB 1GUGA 3U58A 2EJMA 2XVSA 1LABA 1T5XD 3STBC 2YTYA 1SSOA 2GVBA 4LF4L 2B2YA 4LUOA 4A3JG 2FXQA 1BBWA 5I9PA 3V05A 2CFMA 1GUTA 4XXEA 1B1ZA 4POFA 3HOYB 2P5ZX 1PH4A 2DY8A 3H3VC 2N78A 3E3XA 2K32A 3D6CA 3ULPA 2EQSA 4A3DB 3BZCA 4ZCKA 3G71A 2Q8TA 1RJTA 4MTNA 2Y0SB 2O5JC 3CAMA 4X3TA 3ER0A 3TP6A 4X6AH 3RD4A 4PZ7A 2WB1G 4K6DA 4HJAA 5IYBH 2L11A 3PMFA 1WI5A 2RCNA 3AQQA 3G48A 3KDFB 1GUWA 3MWYW 4DV4L 5M5YH 4LNQA 2L12A 2PNHA 1WTRA 1OXTA 2VB2X 3IAYA 4RKLA 4A3KB 5KGUA 3HOWG 3S1MB 2Q2TA 1JR0D 4K6LA 1U4PA 4LUVA 4BY1G 5C0XI 4GKJL 4ILWA 1VQBA 4P74A 4DK0A 1B53A 2E2HB 4IFDJ 2VQFQ 4HCEA 3S24A 3M4OB 3S2HB 2WKCA 1G6ZA 2VB3X 5JJIA 2R92G 1LTRD 1YHAA 4DV1Q 4A3GH 1B9NA 4KKUA 2PCFB 1U4MA 3PQIA 2AQ3B 4LJZC 5JAVA 2PYKA 2KUMA 3MHBA 5GADC 1S40A 4MIUA 2IHFA 1K0SA 1F9PA 1FGBD 1JOQA 2JA8G 1HA6A 1TKWB 1E2ZA 1Q46A 1HFNA 2PPBC 2NN6I 4BBRG 1WYDA 4HIMA 1DJRD 4CKEA 1WJJA 1STHA 3F2BA 3WOEA 3SHLA 5C4XG 4CBVA 1FJGL 4OWXB 1MD2D 3S1RH 2FFKB 4AQYL 3HFZB 3QG1A 4WJ4A 1XWEA 4HJ8A 1D1KA 4EQPA 5JEAH 2CVRA 3M3YH 2A73B 5CV8A 4QUFA 3BDLA 1XNQL 1JJGA 4YIJA 1K28A 2RHSB 1Y14B 1CFMA 1C4QA 2AMCB 2LMCB 3FDTA 1BCPC 3UDIA 4A3FB 4PZ8A 2HT1A 4JI2L 2WP8J 4JW0A 3OTOQ 1HNZQ 1X3GA 4A4IA 1I50H 4LMQD 2JA5B 1B44D 5C3WA 1FL0A 4G7HC 2V4DA 3I3CA 4C3HH 1JB3A 3NXWA 2A6HC 1QVCA 3H91A 4IPCA 4C3JB 1EY4A 3O13A 5HY6A 5EGTA 5I9OA 5BN4A 1V1QA 4NXML 4GKKL 1R9TB 4JI7Q 3D31A 5JOBA 1JWSD 3BU2A 3W5OA 3U50C 3GV3A 2B8GA 1IYJB 3K0YA 4Y7NH 2BDNA 2EYJA 1P8LA 1WTVA 2Q2IA 2F0QA 1T9HA 1D1IA 4JOIA 2CW0D 5A35A 2NZHA 3D8GA 3S2DB 3T51B 4EQ5A 2PQEA 3RLNA 1Q8IA 3CMEA 1TS4A 2E5LQ 3I4MH 3CCRA 2L5TA 4RMFA 1N34Q 2L15A 4K5XA 1JWUD 3T53B 2KCCA 5A2QE 2UXDL 1TWGB 1CA5A 3TQYA 4V0BA 4DV3L 2MP1A 3BYTB 2VY3A 3HKZE 2ZXPA 3H3VH 1IHZA 1PFNA 4K8JA 1EY5A 4LF9L 4R8NA 3NPPA 1K8GA 1SR3A 4M8AA 3H0GB 3MEHA 4KN7C 4ZKBB 3HOVB 3F2DA 2PZTA 1NTGA 3NBIA 5C3EB 3B6YA 4QL5A 1SFOH 1PTOF 1LV9A 3VR4A 2IX3A 5C44B 2ALYB 4LFCL 2ZJRA 2F3VA 3OW2A 5F2DA 4R4IA 1EZ8A 2CHBD 5IGCA 1C8CA 3M7NA 2JE6I 3HOZH 1Z6HA 1SYFA 5FLXE 1V1OA 1VF5C 4IPGA 3DUZA 1O7ZA 1JQYD 1V1PA 5DM63 2AUKA 4J15A 4DUYQ 4GLAC 5ELDA 2R7DA 2XN9C 1I4HA 3VA5A 3R3OA 3EA6A 1HZ9A 3C3LA 2UUBQ 2WB1B 2UXBQ 4FF1A 5LL6S 1KAAA 4DV7L 2YTVA 1N32L 2J0TD 4LF4Q 1L1OA 3QIAA 4RCOA 5LMNW 2WAQE 4LWCA 4X62L 2KENA 1S3OA 5IP9G 5KYIA 1EL0A 1HUNA 3CQZH 3VA7A 3D3RA 1EIFA 2QDLA 5E4XA 3GTKB 3SXHA 2Q8IB 4BY7B 1M1KC 3NBHA 3J81c 1AP0A 4KV6A 1GKHA 4DAVA 5J1ZA 3J81j 4JC0A 3Q6SA 1Q12A 4LF7Q 4GN5A 1VQAA 2VQEL 1STEA 4H02A 2JA7G 1DONA 4DV4Q 3S14B 1SJED 1EQRA 4JI0L 4FXKC 2X6GA 3U9SA 4CDCC 1LTBD 4A3BH 3EQLC 1D5XC 4QIWB 4JVZA 2JSOA 3OMCA 2JJQA 1BVSA 4IJHA 2KHIA 3UE1A 4EX5A 5EKLA 1H9SA 2EPBA 1I6HH 1DOKA 3UDGA 4N9PA 4X65L 1UAPA 1Q90A 4BBRB 2O5IC 2NTSA 4FXDA 1PXUA 5C0XG 2OWOA 4GKJQ 3S16H 1PH6A 4NW2A 1IL2A 2G9HD 2F0SA 1VQKA 2NVQB 3CRLC 2A6ED 1UE5A 1VQPA 5IYCH 4FNFA 3JAML 3AMUA 4U68A 4B3TQ 2DN8A 1EY7A 2VXWA 4HN7A 3SR1A 5C3XA 3NEMA 4K5VA 4TQUS 5E7NA 3J7YW 4OWTB 1YVCA 3W2DA 2QW7A 4PMWA 5ELOA 4DR2L 3A7LA 1LTTD 1YNXA 1WTOA 1EWIA 1RIPA 4M1UB 1L2FA 1RTNA 1NJIC 4A3MH 3QWNA 2NN6G 3I2ZA 2XRSD 5EJWA 1TXYA 3CRKC 2B2UC 3CP0A 2B3GA 1R4PB 3KJOA 4KHVA 2VUMB 1FJGQ 4AQYQ 1XPOA 5I2XA 2R93G 1BO0A 3K57A 1Q1BA 1DM0B 2NVYB 3KFUA 3RLFA 5IGBA 1STBA 3UI2A 1GHKA 1XNQQ 1R4QB 4AYBG 4C1NI 3UDFA 1AH9A 1RF2D 1XPRA 2C35B 1QVGA 4ABNA 5IGEA 3I70A 4JI2Q 1JE5A 4P75A 1X55A 4CDEC 2OEOA 1QJOA 2KOLA 1K8OA 1VMCA 2CQAA 2L0CA 1CQFA 2K04A 4B3SL 2QEJC 3PO3H 2CWAA 1TS5A 2MPMA 3FKIB 3KBGA 4QY7A 2QDBA 5E4WC 4CJ1B 1GM5A 3PO2H 2F4IA 1RODA 2DJGC 3TP7A 4GNXA 4NXMQ 2AQ1B 4DV6L 2EVBA 5K5PA 3QB3A 1WTQA 4DR6Q 3G6JB 2LY7A 3WDNA 3TS0A 1V1PB 2LFNA 5EKKA 2CW0C 2R7ZB 2TSSA 1JCKB 2EY2A 3GTLB 3Q8DA 5JJLA 5E1FA 3K7AB 4G4KA 3AB9A 3H15A 5DNFA 3GTJB 4DK6C 2XWBB 3NUCA 1QB5D 1KXLA 1Q3LA 2MFIA 5IP7H 5FO8B 1J5EL 4KD3A 5FJ8G 3A54A 1L1OB 4U673 2BA0A 3PUYA 2MJ8A 1EOVA 2Y0SG 3J80E 1NAPA 1PH2A 1LTLA 3BYYB 2UUAL 4OWWB 2QEXA 4K0KL 3CPWA 4L63B 2UXDQ 1LLRD 2NYZD 1TU2B 3ICEA 2F0TA 1HZBA 4DV3Q 4MN3A 4FP5D 3VYUA 4XTCS 1PZKD 3NWSA 1HNXL 1EYGA 3NBHB 4OIKA 4GLXA 4LF9Q 1XJVA 1ICWA 1K3BC 2IY5B 1IYUA 4A3KG 2WACA 3D0FA 5CV7A 2EJGC 2B8FA 3G6EA 1X9NA 2OXPA 2ZJQA 5CV4A 2PMZB 3HG9A 1HHVA 1KC8C 1LO5D 3G7LA 1CI3M 2G5DA 2OT2A 2B2VA 1PRTF 2EY5A 4B9WA 3FPPA 1H9SB 3K80C 4R4TA 4RA8A 5IIFA 2EZVA 2F0IA 1SNDA 1M90C 5J39A 1EZ6A 5ISRA 1K3RA 1PYBA 3RN5A 4LF5Q 4RFBA 1HQMC 4OGQC 3GQBA 4ULLA 2KEEA 1QG7A 1PDQA 1RD9D 2K5NA 1RHPA 4DV7Q 2XGTA 2XNAC 1N32Q 4BS9A 1STNA 3VR3A 4JV5L 1VQJA 2B2TC 4UP8A 2B2YC 2Z8LA 3H6MA 2PQAB 3HKSA 3I4LA 2M9VA 3HOXH 5C4HA 2F3WA 3OHXC 5JVH3 4X62Q 4H7BA 4C2MH 1W6JA 3A0JA 4H44C 1VQHA 5DAUA 3CXCA 2EIFA 2WFWA 1EQVA 1LTAD 3JAMc 4CHTB 1C0AA 1SEBD 4EQOA 5T1GA 5I6WA 1SMXA 2UU9L 2KEDA 1P16A 1WVLA 3HOYH 2EYFA 3GV6A 2F0HA 3KLWA 4A3DH 4YCUA 2B39A 1VQ9A 2JA5G 5D3DA 3VYTA 1S5CD 2VQEQ 4JI0Q 3RZDB 3NTIA 5H1SE 1Q7YC 2K6AA 5M5WB 4DA2A 4C3IB 3DEOA 4FF2A 3L0OA 1PH9A 4KY7A 1IW7D 2F0LA 5D3IB 2EE1A 5E3FA 3L7ZC 1VDZA 3P75A 2E2IH 2E2JB 4JI4L 5BR8L 1FNUA 3EFXD 3HS0C 1WTXA 4KMUC 1QUQA 2LXKA 3I4NH 5IWAL 2A6EC 3T1HL 1CTMA 3CCQA 1UUPA 2SEBD 3L2PA 1YJNA 1O7IA 1ASZA 1SRUA 3R2IA 1PFMA 3CCLA 3OYYA 3MC0B 3TRZA 3V2TA 4DR2Q 4DR4L 1II3A 1SLJA 1WCMH 4O2DA 5M3MH 1GHJA 3FEWX 3ERSX 3GTGH 4B3RL 1TWFB 4XT1B 4OHJA 5DM73 3C2PA 4PV1C 5T1IA 4H0LC 3H0GG 2X6LA 1Y1VB 2WAQB 3OPOA 1MHWC 5HGQA 4KHPL 1LTSD 3G4SA 5C3EG 2PZWA 1CKNA 1F2MA 3DEPA 1PH8A 1IBKL 3LWUA 4HR7B 3S15H 3CCVA 4EVOA 5C44G 1CQVA 1K8MA 1EU3A 2BE5D 4DV0L 3KUPA 1CHQD 1JOKA 1JORA 3I8ZA 2JEAI 4N9TA 4JG2A 4HIDA 2K1BA 4HAEA 2D0OA 4A3CG 4WORA 3OW7A 4F8MA 1ZKOA 4BWGB 3Q0AA 4NB3A 3NQIA 2R3ZA 1H95A 1NUCA 4DAMA 5LMNL 5JEAG 2OQKA 4B3SQ 1CKMA 5EPLA 1ASYA 3MEFA 5L37A 2K5VA 1KNEA 4A3FH 1A3VA 3PF5A 3M85A 5C4JB 3J7A5 1OO9B 3TBIB 4DV6Q 4BXXG 1WTHA 2IPKD 1TWCB 2M2LA 1U4LA 2MHVA 2R6GA 3GTQB 1KLGD 4CJ0B 4I7AA 4C3JH 1Y1WH 1BCPF 2JA6B 3S1QB 2D5DA 5IE8A 1BQQT 1SNCA 3MXGA 3M4PA 1B2TA 3JC66 4JOIC 1J5EQ 4A93B 4X3SA 4HMJA 1I94L 1HXYD 3FMCA 3NK9A 4UPAA 2RQXA 1G2SA 3I56A 3RZOH 4KD4A 2BH2A 4HJ9A 4A3IB 3LGJA 4BY7G 4GN3B 3F2CA 4DXFA 1YNJD 1F9QA 4JCVE 4K0KQ 3K59A 5M3FB 2HQLA 1QE6A 4PZ6A 2PI2A 2PZUA 1SNOA 4QF4A 4OO1H 4A3EB 3Q23A 2C9OA 1L0YB 1HNXQ 1CHPD 1KDAA 4PNYA 3K8AA 3W3AA 3VR6A 2Z6BA 3J81L 1BNZA 4ZKCB 1PA6A 2ZM6L 1TY0A 5FLMH 4PQXA 3GTOH 2HIVA 5COYA 1XNRL 2PNRC 1X3EA 4JK1C 3HOUB 4BBSH 2EOTA 3S17H 1IYVA 3GTMH 3HOVH 2NVXB 3VR2A 4IOAA 3E9HA 1HRJA 4OIJA 3CC7A 3CCMA 1PZID 2MUYA 2M00A 4A3JH 4FF4A 2OF1A 2IW3A 4KKTA 1QUQB 4PG3A 3DLLA 2XRQD 4I65A 1SYDA 2IJ0A 2YU9H 3K5LA 3VYRA 4LFBL 1QWYA 1W3SA 3H09A 4IFDI 3K0XA 1DD2A 1UE1A 5ELFA 5M5XH 5IGGA 2E74C 1W6KA 3VYSA 1F9RA 4JV5Q 1B3QA 1UNSA 4IURA 1Y8OB 5AJ3L 1IL8A 5JPNC 2VUMG 4WFN3 1M8AA 1JT8A 2RSNA 4ZK9B 1J6QA 4LF8L 5JJZA 1ZYRD 2ICIA 3QJYA 1SROA 4YWLA 1NE3A 4X64L 1GUSA 2UU9Q 3BDCA 1LT6D 1JWMD 3K5OA 1PVOA 3S9WA 2IX1A 5M5YB 2ATWA 4POGA 1CKNB 3HOWH 2NZOA 4K5WA 3I91A 4R4OA 1JOOA 2AWOA 4G57A 1XXGA 4YY3Q 2DNCA 4BY1H 2BA1A 1X3FA 3EVQA 3I7FA 1IW7C 1PFBA 2F0OA 3FKIG 1NSNS 4X3KA 5EPJA 3X3NA 2WV6D 1QVFA 3BG3A 4RG1A 2R92H 1EIHA 1ENAA 2NTTA 2R7ZG 4JI4Q 5BR8Q 3PIPA 4KN4C 4K8IA 1YHQA 1LTGD 4CGYB 2BDOA 4KTAA 4IUTA 2KBNA 3J7AF 3QOLA 3KLRA 3T1HQ 1LT4D 4A3GB 4DUZL 4RWSC 3BVZA 3FP9A 4JI5Q 4DV2L 5C4ZA 2ENBA 5FO9B 2JA8H 4Q5VA 1QZHA 1MGSA 3RLOA 4BBRH 1VQDA 1HPCA 2A69D 1BUVT 2N8NA 3LX0A 3OWFA 1FR3A 4DV5L 5C4XH 5BN5A 1VQ7A 4MHEA 5D65A 3D4WA 1ENCA 2ZT9C 1G91A 1KDBA 2JN4A 1XMOQ 4A76A 1HR0L 1KIXA 4B3RQ 1STYA 4HJ7A 4DR3L 1KNAA 5CORA 5CC4A 1YBYA 1PRTB 2R7FA 3KF6A 4X66L 4DU9A 4KHPQ 1YEZA 3OOCA 1KRSA 1A8VA 2BE5C 2F0GA 3PIO3 1F2ZA 1IBKQ 4FYDA 2IL8A 3SGIA 1UWVA 1FNWA 4CKCA 2LXJA 1I50B 1RTOA 4DV0Q 4XT3B 4A3LG 1F77A 4C3HB 2AHOB 2BOSA 4Z9CB 4PMCA 4AYBE 5IODA 4J8QA 1ML0D 3DM1A 2LSSA 4Y7NB 5LMNQ 2RCFA 4ZAIA 1PH3A 3PUXA 3BS1A 1WFQA 5DEHA 4J1MA 3H94A 3PIOA 1F2YA 4GNXC 2KHJA 1V8QA 3E0JA 1I4XA 1NR4A 1FVIA 3SK8A 1BBUA 3I4MB 1ESFA 1XMQL 4MNOA 4GOPA 1KL9A 3TMEA 1XYIA 1A3TA 4F7XA 1TWHH 3J81i 1ILPA 4OELB 4DNRB 5GQOA 3MXPA 1Z9FA 3TS2A 1YNJC 3CD6A 1EYAA 1B50A 3KF8A 4KK7A 4BA1I 5A2QL 2F0FA 2Y0SE 4WJWA 4DPGA 3AYHB 3OIPA 4J6HA 1D5MC 3EBEA 4UP7A 3TEHB 2D9UA 3BVGA 1B4OA 3HKZG 3DWQA 1YITA 2RSOA 4DNIA 1SFOB 2V1CC 4DF7A 3V96A 1LYLA 1VQFA 4ZUJA 2FHTA 1VQ6A 4C3IG 4DNTB 2PQAA 5G3LD 4YCWA 4RGOS 1GUNA 1TWAH 2A19A 3W1BA 1YZ6A 2ZM6Q 5EQ0A 1LACA 5ELCA 1B70B 2F0NA 3HOZB 2F0DA 1VQOA 4OXPA 2HHHL 1XNRQ 3AEVA 4B08A 1S5FD 3KYHC 4O42A 1Z7TA 1OXXK 2B2VC 5FLXL 1UE6A 1TVXA 4IN3A 3CC4A 3FVQA 1QZGA 1CSPA 1SE4A 2JA9A 1O7LA 1N36L 4KJOA 4Y52H 4JBWA 3MAQA 4OL7A 2R61A 2K5WA 3I4OA 4LFBQ 4ZRZA 5IP9H 5LMUL 1YIJA 5EAYA 4IFDG 2B63G 3E9IA 3CU7A 2I5LX 1D7QA 4RGTA 2JK8A 4WJ3M 4P73A 3ERQA 3MVVA 2G9DA 3FHWA 3TREA 3T56B 3SVMA 1C7YA 3CQZB 3HP3A 1MSHA 3STBD 4IUVA 1Y1VG 2RKSA 2WAQG 1SNPA 4GKKQ 1I3QH 1ZYRC 4R1JA 5AJ3Q 5K36G 4L5RC 5ELBA 1MIUA 4LF8Q 2AQ2B 4X3UA 1GOZA 2JA7H 2HD3A 1KRTA 1S5BD 1HFGA 3S1NB 2GVAA 4R8IA 3KF6B 4X64Q 2TMPA 4N8FA 2F0JA 2Z9HA 1A3UA 1FD7D 2VS1A 1SJHD 2K5DA 1NCVA 4DR7L 3TZUA 4A3BB 1I4QA 2ICEC 4LW1A 1E3PA 3AFPA 2B2WA 2A68D 3CPFA 5C0XH 5KEEA 2HIXA 1J8IA 4K2LA 4UDUC 1KTKA 4AH6A 3I55A 3S16B 2QILA 5I2YA 3A55A 4KLKA 3WWVA 3RN2A 4C56C 5GAHC 1G291 3MA2B 3P1HA 3P20A 1S72A 2JA6G 2OCEA 5CBEE 1NNXA 5M9OA 1B9MA 2QKIC 2A69C 4AIMA 4DUZQ 2NVTH 2ZJPA 1RKNA 4IPHA 5EBCA 1AE2A 4A93G 4DV2Q 4QMGA 1ESRA 5IYDG 5IT9E 1I4PA 1XTDA 2NN6H 4LFCQ 1HR0W 1TQOA 4DR5L 2I07B 1HUMA 1EYDA 4GOPB 4A3IG 3H3VI 4DV5Q 4A3MB 1HJPA 3A56A 3PCOB 3TSSA 2MNAA 2F0EA 5M3FG 1FGUA 2R93H 4RHSA 4RH6A 4EQNA 1D6EC 4A3EG 4CDDC 3KF8B 4DFAA 4DR3Q 3D4RA 3R8BA 3P7JA 4B3ML 1H9KA 3K7UC 4X66Q 2RA4A 2F4VL 4JI3L 1PHJA 4KJNA 1FYCA 2GA4B 5C6AA 2C5CA 1GUOA 1HCZA 4UY8C 1PZJD 1TWFH 3KLSX 2SNMA 4YCVA 5CYUA 3HOUG 3QO2A 3OWEB 1E1OA 4L5SA 3PO3B 1TT2A 1O7YA 1O80A 1A2TA 2N88A 3IFTA 2NBFA 3PO2B 2H4OA 3CCUA 1H9JA 1SBBB 1ZEQX 1A15A 1BDOA 2K7VA 3CCSA 1U9RA 1AN8A 2ZXRA 2D2CC 5JPMC 3MTSA 1HH2P 1UE7A 2YV5A 3U9OA 1S5DD 3NTKA 4QB4A 3T1YL 4HTHA 3URYA 5FJ8H 1KAWA 1DGSA 1QOHA 2WB1E 3A8KE 1X3PA 4LUZA 1GXDC 3HKZB 3NENA 4F87A 1B7YB
chains in the Genus database with same CATH topology
5IOCA 5I4DA 1TR5A 1CZGA 4FVMA 5NUCA 2F0WA 3SEBA 1LTID 2EYHA 4ZQ3A 1LT5D 3J80L 3BZDB 2SNSA 5C5MA 4RHRA 1CK1A 3EJIA 2XIWA 1VF7A 2EYPA 2K05A 2IX0A 3L3OC 1FNVA 1MI2A 2A74C 2K03A 1TIID 5FK9C 3E5SA 4ID6A 1SE3A 3SK6A 3IKJA 2B63B 1PTOB 3EROA 1D2BA 1AZPA 2K01A 1SNQA 1EEID 4OO1G 3I73A 4Q0FA 5LHY1 1QILA 4B9XA 5IGDA 4L8JA 1CM9A 4HMIA 1T5EA 1EY9A 2RDFA 2FMCA 3RMHA 4C1NK 1O78A 2EY6A 1TY2A 3M7GA 1RDPD 2PO4A 1G2TA 2PW5A 4XDXA 1EY6A 4C2MB 2B2TA 5C0XJ 1HTPA 1H9RA 2FMMA 4QUCA 2EJFC 5CV5A 1OXUA 2EDGA 1QNKA 5CGKA 3OMGA 1Z47A 5C5LA 1SYGA 2Z1CA 2O2LD 2RDGA 4C3HG 2K33A 3BVMA 2A68C 1SYBA 3NE5B 3FPUB 4G7ZC 5KNBA 2NZ1D 5CBAE 2E2IB 4DN4M 1K83B 2SOBA 4P2CB 3ONAB 5IGFA 3I4NB 1PTOD 5KNDA 1Y8PB 2FINB 4DAPA 2D62A 3HRZC 2AWNA 2NB0A 2RDHA 3A8JE 4HSPA 4HSVA 3I72A 2A5HA 3GTPB 3SK5A 1H9MA 1YNND 1WCMB 5M3MB 2ZXOA 1EY0A 3DXJC 2JYOA 3GTGB 2DNEA 3NWTA 5KRUA 4V190 3OSOA 4R9WA 2XWJB 3K6OA 1JICA 1STAA 2HQEA 5LL6X 3T13A 1Y69U 2XSCA 3S15B 3ZYYX 2ID0A 4TRDA 5CR3A 2NUCA 3TDQA 3TZDA 4KHZA 4LK1C 5D14A 4DGZA 1HQRD 5EKIA 1ILQA 3MFGA 1M4VA 3PIP3 4E6IA 3J7AV 2F03A 2HDLA 2L4NA 1Y1WB 1AW7A 3TN2A 3C1EA 3DWAA 1NR2A 1EWCA 1KDCA 1PMRA 3RZOB 2EYMA 2X69A 2H1EA 1ONLA 1OXSC 1SYEA 3KBXA 3R2TA 2E76C 5I6YA 1XTCD 2F0PA 3RUZA 1DCZA 1SMYD 4FF3A 3MZ5A 3VR5A 4KI0A 5KNCA 1SYCA 3N6RA 1VCIA 3GTOB 1EWHA 3TP5A 3ND8A 4F88A 3LWEA 3JAME 4BBSB 1CT1D 1JE4A 4S3SA 4IUPA 3GTMB 3S17B 3M4YA 3S1RB 4TSSA 2N55A 3SDZA 2L1BA 1A6XA 3OIQA 3HGBA 2KJXA 4A3JB 3GO5A 3NP8A 3M3YB 3I90A 2YU9B 2E75C 4KY6A 3SK4A 1AFPA 5CMDA 1EOTA 2QCPX 4XYOA 5M5XB 1TS2A 2AUJD 3MXNA 3PUWA 1J9OA 5TSSA 3DMUA 4NKLA 2F0VA 1I6VC 1C48A 4XYQA 1DZ1A 3KLSA 1S5ED 3HOWB 2O4XA 5EBDA 3PUVA 1XX8A 4BY1B 2Q8RE 2MGSA 4RKBA 3D4DA 2F1MA 5HGTA 5CV6A 2R92B 2F0MA 4H13C 1PTOC 1X3QA 2B2WC 4ZYSA 4XQNA 2NWGA 2KQ3A 4XIGS 1ET9A 3Q24A 1S4ZA 3MFYA 1EFID 1HA5A 4ME5A 2Z4HA 4I7ZC 1SNMA 2JA8B 1QCBD 4KKSA 3ITPA 1PRTD 4RGMA 4XQQA 2F0UA 2JEBI 2LKVA 4GZYC 1E0BA 1U4RA 1MBYA 1YNNC 1AZQA 5C4XB 2YYZA 1MSGA 1HTLD 1SAPA 4ODGA 4OO1I 5JEAJ 2SDFA 3X3MA 4IUQA 1WTPA 1F2LA 4K14A 3T16A 2L9HA 3NHHA 5FKAC 2HCCA 4IUUA 1EIGA 4DXGA 2K5QA 1BF4A 5BN3A 4DK1A 3Q22A 4IQZA 2RBMA 5FO7B 1Q1EA 4NP5A 3SE0A 4XQJA 1DYQA 2L55A 4LAAA 3HEJA 2HCIA 3R93A 1UEAB 5CV9A 1RCVD 2EYLA 3D6WA 3CKIB 2IT1A 1E2WA 1KLUD 5JVG3 2Z4IA 4FO2A 1V43A 4ZUIA 1SE2A 3QOJA 2F0KA 4EGVA 1ZXTA 3GD7A 2K28A 3PUZA 4BA2I 1TWHB 1A2UA 1CZWA 1I6HB 3GP7A 4IALA 1BCPB 3DHQA 1ET6A 5AFWA 5KIXA 3PV0A 5KYLA 1SMYC 1STGA 1WTWA 2FJ2A 2WINB 3NSWA 3C46A 1TS3A 1I4GA 5J22A 2JXMB 1F9SA 3MXUA 4FXGC 1EYCA 1TWAB 1AEXA 3KK7A 2PW7A 2HUGA 1PLFA 4RGNA 2HDMA 3F2UA 4IZ8A 2J7ZA 2KA7A 3DWPA 3NQTA 1QNUA 5ELEA 4IUNA 2IWHA 2B2UA 1KABA 3IFDA 1BR9A 1ENFA 3FRPB 4QCLA 4IFDH 1PTOH 1CA6A 3A7AB 2BCOA 3K5NA 1EEFD 3N52A 5G3LF 1Y8NB 2KCNA 1EU4A 3IL8A 1I4RA 2EXZA 3A8IE 5K36H 2KHSA 1BXTA 4WRDA 5HURA 1I3QB 1X32A 3LNNA 2J4XA 1BCPD 2E2DC 4L6TB 1EY8A 1IKMA 2JA7B 1E2VA 1JC7A 2WIIB 3K58A 2LS01 1DOMA 4HEDA 1L0XB 2EYOA 2JP1A 5FOBB 4ZLTF 1G8ZD 2A6HD 3E6ZX 2I46A 1WD0A 3HZXA 1PYWD 4K2KA 3T4AC 1SDFA 3CHBD 3TP8A 1IKLA 4RCNA 1D5ZC 4TKOB 4HCSA 1LT3D 1SXTA 4PMBA 4G7OC 4CJ2C 3NTHA 5EPKA 3ND9A 1VMPA 4UAIA 4DAYA 3AU7A 4C3JG 4CKBA 1PRTC 3C1FA 2NVTB 1GJXA 2KVMA 1OXVA 4RAUC 3WOFA 1DOLA 2WKDA 2QF7A 1B3AA 5IT9L 4O1NA 1WD1A 3J81E 1BBXC 2KECA 2R93B 4NMZA 3K5MA 4NDXA 2DY7A 4KY5A 4AYBB 2VNUD 2RVLA 2EY1A 1DXMA 1EQTA 3BDOA 3L9AX 1BOSA 3HOXB 1GUGA 2EJMA 2XVSA 1LABA 1T5XD 1SSOA 2B2YA 5I9PA 3V05A 1GUTA 4XXEA 1B1ZA 3HOYB 3H3VC 2DY8A 2K32A 3D6CA 4A3DB 2Q8TA 1RJTA 2Y0SB 2O5JC 4X3TA 3TP6A 3RD4A 4K6DA 2L11A 3PMFA 1GUWA 3MWYW 2L12A 1WTRA 1OXTA 2VB2X 3IAYA 4RKLA 4A3KB 5KGUA 3S1MB 1JR0D 4K6LA 1U4PA 5C0XI 4ILWA 4DK0A 1B53A 2E2HB 4IFDJ 4HCEA 3M4OB 3S2HB 2WKCA 1G6ZA 2VB3X 1LTRD 1B9NA 4KKUA 2PCFB 1U4MA 2AQ3B 4LJZC 5JAVA 2PYKA 2KUMA 3MHBA 4MIUA 1F9PA 1FGBD 1JOQA 1HA6A 1TKWB 1E2ZA 1HFNA 2PPBC 2NN6I 1DJRD 4CKEA 1STHA 3WOEA 3SHLA 4CBVA 1MD2D 2FFKB 3QG1A 1XWEA 1D1KA 4EQPA 5JEAH 2CVRA 2A73B 5CV8A 4QUFA 3BDLA 4YIJA 1CFMA 1C4QA 2LMCB 3FDTA 1BCPC 4A3FB 2WP8J 4LMQD 2JA5B 1B44D 5C3WA 4G7HC 2V4DA 3I3CA 1JB3A 3NXWA 2A6HC 3H91A 4C3JB 1EY4A 3O13A 5EGTA 5I9OA 5BN4A 1R9TB 3D31A 5JOBA 1JWSD 3GV3A 2B8GA 3K0YA 2BDNA 2EYJA 1WTVA 2F0QA 1D1IA 2CW0D 5A35A 3D8GA 3S2DB 3T51B 2PQEA 1Q8IA 1TS4A 2L5TA 4K5XA 1JWUD 3T53B 2KCCA 5A2QE 1TWGB 1CA5A 4V0BA 2MP1A 3BYTB 2ZXPA 1IHZA 1PFNA 4K8JA 1EY5A 4R8NA 3NPPA 4M8AA 3H0GB 3MEHA 4KN7C 4ZKBB 3HOVB 2PZTA 3NBIA 5C3EB 1PTOF 1LV9A 3VR4A 2IX3A 5C44B 2F3VA 5F2DA 1EZ8A 2CHBD 5IGCA 1C8CA 3M7NA 2JE6I 1Z6HA 1SYFA 5FLXE 1V1OA 1VF5C 3DUZA 1O7ZA 1JQYD 1V1PA 5DM63 2AUKA 5ELDA 2XN9C 1I4HA 3VA5A 3R3OA 3EA6A 3C3LA 2WB1B 4FF1A 5LL6S 1KAAA 2J0TD 3QIAA 4RCOA 1EL0A 5KYIA 1HUNA 3VA7A 3D3RA 5E4XA 3GTKB 3SXHA 2Q8IB 4BY7B 1AP0A 3NBHA 4KV6A 4DAVA 5J1ZA 3Q6SA 1Q12A 1STEA 1DONA 3S14B 1SJED 4FXKC 2X6GA 3U9SA 1LTBD 3EQLC 1D5XC 4QIWB 2JSOA 3OMCA 5EKLA 1H9SA 2EPBA 1DOKA 4N9PA 1UAPA 1Q90A 4BBRB 2O5IC 2NTSA 4FXDA 1PXUA 5C0XG 4NW2A 2G9HD 2F0SA 2NVQB 3CRLC 2A6ED 4FNFA 3JAML 3AMUA 4U68A 2DN8A 1EY7A 2VXWA 4HN7A 3SR1A 5C3XA 4K5VA 4TQUS 3J7YW 3W2DA 4PMWA 3A7LA 1LTTD 1WTOA 4M1UB 1RTNA 3QWNA 2NN6G 2XRSD 5EJWA 3CRKC 2B2UC 1R4PB 4KHVA 2VUMB 5I2XA 1BO0A 3K57A 1Q1BA 1DM0B 2NVYB 3RLFA 5IGBA 1STBA 3UI2A 1GHKA 1R4QB 4C1NI 1RF2D 4ABNA 5IGEA 3I70A 2OEOA 1QJOA 2KOLA 1K8OA 1VMCA 2CQAA 2L0CA 1CQFA 2K04A 2QEJC 1TS5A 2MPMA 3FKIB 3KBGA 5E4WC 2QDBA 4CJ1B 2F4IA 1RODA 3TP7A 2AQ1B 1WTQA 2EVBA 5K5PA 3QB3A 3G6JB 2LY7A 3WDNA 1V1PB 2LFNA 5EKKA 2CW0C 2R7ZB 2TSSA 1JCKB 2EY2A 3GTLB 5E1FA 3K7AB 4G4KA 3AB9A 5DNFA 3GTJB 2XWBB 3NUCA 1QB5D 1Q3LA 5FO8B 4KD3A 3A54A 4U673 2BA0A 3PUYA 2MJ8A 3J80E 1NAPA 3BYYB 4L63B 1LLRD 2NYZD 1TU2B 2F0TA 4MN3A 4FP5D 3VYUA 4XTCS 1PZKD 3NWSA 4OIKA 1ICWA 1IYUA 2WACA 5CV7A 2EJGC 2B8FA 2OXPA 5CV4A 2PMZB 3HG9A 1HHVA 1LO5D 3G7LA 1CI3M 2OT2A 2B2VA 1PRTF 2EY5A 4B9WA 3FPPA 1H9SB 4RA8A 5IIFA 2EZVA 2F0IA 1SNDA 5J39A 1EZ6A 5ISRA 4RFBA 1HQMC 4OGQC 3GQBA 4ULLA 2KEEA 1QG7A 1PDQA 1RD9D 1RHPA 2XNAC 4BS9A 1STNA 3VR3A 2B2TC 2B2YC 2Z8LA 3H6MA 3I4LA 2M9VA 5C4HA 2F3WA 3OHXC 5JVH3 4H7BA 1W6JA 4H44C 5DAUA 1EQVA 1LTAD 4CHTB 1SEBD 4EQOA 5T1GA 5I6WA 2KEDA 1WVLA 2EYFA 3GV6A 2F0HA 2B39A 5D3DA 3VYTA 1S5CD 3RZDB 3NTIA 2K6AA 5M5WB 4DA2A 4C3IB 3DEOA 4FF2A 4KY7A 1IW7D 2F0LA 5D3IB 2EE1A 5E3FA 3L7ZC 1VDZA 3P75A 2E2JB 1FNUA 3EFXD 3HS0C 1WTXA 4KMUC 2A6EC 1CTMA 1UUPA 2SEBD 3R2IA 1PFMA 3MC0B 3V2TA 1II3A 1GHJA 3FEWX 1TWFB 4XT1B 4OHJA 5DM73 3C2PA 4PV1C 5T1IA 4H0LC 2X6LA 1Y1VB 2WAQB 3OPOA 1LTSD 2PZWA 1F2MA 3DEPA 3LWUA 4HR7B 4EVOA 1CQVA 1K8MA 1EU3A 2BE5D 3KUPA 1CHQD 1JOKA 1JORA 3I8ZA 2JEAI 4N9TA 2K1BA 4HAEA 4WORA 3OW7A 4F8MA 1ZKOA 4BWGB 3Q0AA 3NQIA 2R3ZA 1NUCA 5JEAG 5EPLA 1KNEA 1A3VA 3M85A 5C4JB 1OO9B 3TBIB 2IPKD 1TWCB 2M2LA 1U4LA 2MHVA 2R6GA 3GTQB 1KLGD 4CJ0B 1BCPF 2JA6B 3S1QB 2D5DA 1BQQT 1SNCA 3MXGA 1B2TA 4A93B 4X3SA 4HMJA 1HXYD 3FMCA 3NK9A 2RQXA 1G2SA 4KD4A 4A3IB 4DXFA 1YNJD 1F9QA 3K59A 5M3FB 1QE6A 2PZUA 1SNOA 4QF4A 4OO1H 4A3EB 3Q23A 2C9OA 1L0YB 1CHPD 1KDAA 4PNYA 3W3AA 3VR6A 3J81L 1BNZA 4ZKCB 1TY0A 4PQXA 5COYA 2PNRC 4JK1C 3HOUB 2EOTA 1IYVA 2NVXB 3VR2A 1HRJA 4OIJA 1PZID 2MUYA 2M00A 4FF4A 2OF1A 2IW3A 4KKTA 2XRQD 4I65A 1SYDA 2IJ0A 3K5LA 3VYRA 1QWYA 3H09A 4IFDI 1DD2A 5ELFA 5IGGA 2E74C 1W6KA 3VYSA 1F9RA 1UNSA 4IURA 1Y8OB 1IL8A 5JPNC 4WFN3 1M8AA 2RSNA 4ZK9B 5JJZA 1ZYRD 2ICIA 3QJYA 1GUSA 3BDCA 1LT6D 1JWMD 3K5OA 5M5YB 3S9WA 2IX1A 4K5WA 3I91A 1JOOA 2AWOA 4G57A 1XXGA 2DNCA 2BA1A 3EVQA 1IW7C 1PFBA 2F0OA 1NSNS 4X3KA 5EPJA 3X3NA 2WV6D 3BG3A 1EIHA 1ENAA 2NTTA 4KN4C 4K8IA 1LTGD 4CGYB 2BDOA 4KTAA 4IUTA 3J7AF 3QOLA 3KLRA 1LT4D 4A3GB 4RWSC 3BVZA 5C4ZA 2ENBA 5FO9B 4Q5VA 1MGSA 1HPCA 2A69D 1BUVT 3LX0A 3OWFA 1FR3A 5BN5A 4MHEA 5D65A 3D4WA 1ENCA 2ZT9C 1G91A 1KDBA 1STYA 1KNAA 5CC4A 5CORA 1PRTB 4DU9A 3OOCA 2BE5C 2F0GA 3PIO3 1F2ZA 4FYDA 2IL8A 1FNWA 4CKCA 1I50B 1RTOA 4XT3B 1F77A 4C3HB 2BOSA 4Z9CB 4PMCA 5IODA 4J8QA 1ML0D 3DM1A 4Y7NB 4ZAIA 3PUXA 3BS1A 5DEHA 4J1MA 3H94A 1F2YA 1V8QA 3E0JA 1I4XA 1NR4A 3SK8A 3I4MB 1ESFA 3TMEA 1XYIA 1A3TA 4F7XA 1ILPA 4DNRB 3MXPA 1YNJC 1B50A 1EYAA 3KF8A 4KK7A 4BA1I 5A2QL 2F0FA 4WJWA 3OIPA 4J6HA 1D5MC 2D9UA 3BVGA 1B4OA 3DWQA 2RSOA 1SFOB 4DF7A 3V96A 4ZUJA 2FHTA 4C3IG 4DNTB 5G3LD 4RGOS 1GUNA 5EQ0A 1LACA 5ELCA 2F0NA 3HOZB 2F0DA 4B08A 1S5FD 4O42A 1Z7TA 1OXXK 2B2VC 5FLXL 1TVXA 4IN3A 3FVQA 1SE4A 1O7LA 4KJOA 4JBWA 3MAQA 4OL7A 2R61A 2K5WA 4ZRZA 4IFDG 3CU7A 4RGTA 3ERQA 3MVVA 2G9DA 3T56B 3SVMA 3CQZB 3HP3A 1MSHA 4IUVA 2RKSA 1SNPA 1ZYRC 5K36G 5ELBA 2AQ2B 4X3UA 1GOZA 1S5BD 1HFGA 3S1NB 4R8IA 2TMPA 2F0JA 1A3UA 1FD7D 1SJHD 2K5DA 1NCVA 3TZUA 4A3BB 1I4QA 2ICEC 2B2WA 2A68D 5C0XH 5KEEA 1J8IA 4K2LA 4UDUC 1KTKA 3S16B 2QILA 5I2YA 3A55A 4C56C 1G291 3MA2B 3P1HA 3P20A 5CBEE 5M9OA 1B9MA 2QKIC 2A69C 1RKNA 5EBCA 4QMGA 1ESRA 5IT9E 1I4PA 2NN6H 1TQOA 2I07B 1HUMA 1EYDA 4A3MB 3A56A 3TSSA 2F0EA 4RHSA 4RH6A 4EQNA 1D6EC 4DFAA 3D4RA 3R8BA 3P7JA 1H9KA 2RA4A 4KJNA 1FYCA 2GA4B 5C6AA 2C5CA 1GUOA 1HCZA 1PZJD 3KLSX 2SNMA 5CYUA 3QO2A 3OWEB 3PO3B 1TT2A 1O7YA 1O80A 1A2TA 2N88A 3IFTA 2NBFA 3PO2B 2H4OA 1H9JA 1SBBB 1ZEQX 1A15A 1BDOA 2K7VA 1U9RA 1AN8A 2ZXRA 2D2CC 5JPMC 3MTSA 3U9OA 1S5DD 3NTKA 4QB4A 4HTHA 3URYA 1QOHA 3A8KE 1X3PA 1GXDC 3HKZB 4F87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENA A;  5IOC A;  3SHL A;  2PZU A;  1SNO A;  2OXP A;  1TR5 A;  4LAA A;  2KHS A;  3HEJ A;  4QF4 A;  5CV4 A;  5KEE A;  1EYA A;  4WRD A;  5HUR A;  5CV9 A;  1SYF A;  2EYL A;  4K2L A;  4K8I A;  2F0W A;  5NUC A;  2F0F A;  1KDA A;  1SYB A;  4KTA A;  2EYH A;  4PNY A;  4EQP A;  4ZQ3 A;  3QOL A;  5CV8 A;  2O4X A;  4J6H A;  1EY8 A;  3C1E A;  5I9P A;  3BDL A;  4ZUI A;  3R3O A;  3VA5 A;  4B9W A;  2EY5 A;  5J22 A;  3V2T A;  3QOJ A;  2F0K A;  4YIJ A;  4KHV A;  5C4Z A;  2ENB A;  2SNS A;  5C5M A;  1II3 A;  2EYO A;  2SOB A;  4DF7 A;  3P1H A;  1KAA A;  1KDC A;  5IIF A;  2F0I A;  2EYM A;  3EJI A;  1SND A;  3LX0 A;  4RKB A;  2EYP A;  1EZ6 A;  3OWF A;  4ZUJ A;  5IGF A;  5ISR A;  3D6C A;  5J39 A;  3D4D A;  5M9O A;  5C3W A;  5IGB A;  1STB A;  3HZX A;  4K2K A;  1A2U A;  5HGT A;  1SYE A;  3D4W A;  3NXW A;  1RKN A;  5CV6 A;  5I6Y A;  1ENC A;  2F0P A;  2F0M A;  4IAL A;  3RUZ A;  3DHQ A;  4QMG A;  3TP8 A;  2PZW A;  1EY4 A;  1KDB A;  3E5S A;  1F2M A;  2F0N A;  2F0D A;  5EGT A;  2M00 A;  1TQO A;  3TP6 A;  5I9O A;  4ID6 A;  2KQ3 A;  2OF1 A;  3MZ5 A;  5IGE A;  5JOB A;  1STY A;  3SK6 A;  5KYI A;  4EVO A;  4K6D A;  1EYD A;  5KYL A;  4I65 A;  1STN A;  1SYD A;  2OEO A;  4ME5 A;  3PMF A;  5CC4 A;  2EYJ A;  4PMB A;  1STG A;  1SYC A;  1JOK A;  1JOR A;  2F0E A;  3SK5 A;  3ERO A;  4DU9 A;  4N9T A;  3H6M A;  2F0Q A;  1SNM A;  3SXH A;  4EQN A;  2F0G A;  2QDB A;  5C4H A;  1F2Z A;  2F3W A;  3ITP A;  4KV6 A;  4WOR A;  3TP7 A;  1SNQ A;  5J1Z A;  2F0U A;  3QB3 A;  4H7B A;  1EY0 A;  4KJO A;  3TP5 A;  3D8G A;  2LKV A;  5IGG A;  4F8M A;  4RKL A;  5DAU A;  5KGU A;  5KRU A;  1EQV A;  2PQE A;  4OL7 A;  3OSO A;  5EKK A;  3C1F A;  4S3S A;  1NUC A;  2EY2 A;  4B9X A;  1EYC A;  5IGD A;  4EQO A;  5I6W A;  4HMI A;  5E1F A;  1EY9 A;  1AEX A;  2RDF A;  1STA A;  2HQE A;  1A3V A;  4PMC A;  4KJN A;  5C6A A;  2EYF A;  5IOD A;  4ODG A;  4K5X A;  3T13 A;  2F0H A;  2PW7 A;  3NUC A;  3ERQ A;  3MVV A;  3NP8 A;  3OMC A;  2SNM A;  4IZ8 A;  4KD3 A;  5EKL A;  4TRD A;  5CR3 A;  2EY6 A;  2NUC A;  4N9P A;  4KY6 A;  3NQT A;  3SK4 A;  2RKS A;  4K14 A;  3T16 A;  3BDC A;  1SNP A;  4IUN A;  4NMZ A;  1TT2 A;  5DEH A;  1A2T A;  4J1M A;  3NHH A;  3S9W A;  1IHZ A;  4NDX A;  4K8J A;  1EY5 A;  1KAB A;  2PW5 A;  4R8N A;  5K5P A;  1EY6 A;  1SNC A;  4K5W A;  1F2Y A;  1JOO A;  5KIX A;  2F0S A;  3MEH A;  4KY7 A;  4G57 A;  4KY5 A;  4DGZ A;  5JAV A;  2F0L A;  2PZT A;  2PYK A;  3MHB A;  1U9R A;  4HMJ A;  2F0T A;  5E3F A;  4MIU A;  3P75 A;  3U9O A;  3NK9 A;  2RBM A;  5CV5 A;  3EVQ A;  4QB4 A;  2F0J A;  3SK8 A;  1A3U A;  5CGK A;  4NP5 A;  3OMG A;  4HTH A;  2F0O A;  1JOQ A;  4KD4 A;  3DMU A;  1NSN S;  5C5L A;  2F3V A;  3TME A;  5F2D A;  4NKL A;  1A3T A;  1EY7 A;  1SYG A;  2F0V A;  3SR1 A;  4F7X A;  1EZ8 A;  5C3X A;  5IGC A;  4K5V A;  2EY1 A;  4DFA A;  2EXZ A;  3MXP A;  1STH A;  2WAC A;  5CV7 A;  4E6I A; 
#chains in the Genus database with same CATH topology
 1NMG A;  5IOC A;  4NPS A;  5I4D A;  1TR5 A;  3JAM i;  4DR1 L;  2KCT A;  1CZG A;  4FVM A;  1CKO A;  1XMQ Q;  4JBK A;  5NUC A;  2F0W A;  5FLX c;  3SEB A;  1LTI D;  2EYH A;  4ZQ3 A;  4P72 A;  1LT5 D;  4L5Q A;  1KHI A;  5GAG C;  3J80 L;  4X65 Q;  4FDB A;  4GN4 B;  3BZD B;  2ZTD A;  5IYB G;  2SNS A;  2K50 A;  5C5M A;  4RHR A;  3DM3 A;  1CK1 A;  3F8T A;  1X6O A;  3EJI A;  2XIW A;  4A3K H;  1VF7 A;  2EYP A;  3S1M H;  2K05 A;  2CCZ A;  4QQB X;  2IX0 A;  3L3O C;  1W2B A;  1FNV A;  1MI2 A;  1K0R A;  2A74 C;  2K03 A;  1PH7 A;  1TII D;  5FK9 C;  3E5S A;  4ID6 A;  1SE3 A;  1VQE A;  2E2H H;  3SK6 A;  3BJU A;  3IKJ A;  1VQM A;  2OQ0 A;  3W1G A;  3M4O H;  5ELN A;  3S2H H;  4QIW E;  4JI1 L;  2B63 B;  1PTO B;  3ERO A;  2CQO A;  1D2B A;  4ALP A;  1AZP A;  2K01 A;  2HHH Q;  1SNQ A;  1EEI D;  4OO1 G;  3I73 A;  4Q0F A;  5LHY 1;  2QA4 A;  1Q81 C;  1QIL A;  2I5H A;  4B9X A;  1YJ9 A;  3M9B A;  5IGD A;  4A3G G;  4L8J A;  1IBM L;  1CM9 A;  1E1T A;  1T5E A;  4HMI A;  1EY9 A;  4OX9 L;  2RDF A;  2FMC A;  3RMH A;  4C1N K;  1N36 Q;  1O78 A;  4HIO A;  2EY6 A;  5GAE C;  1TY2 A;  3A74 A;  2UXB L;  3M7G A;  1RDP D;  2PO4 A;  1G2T A;  3E0E A;  5IY0 A;  2PW5 A;  4XDX A;  1EY6 A;  4C2M B;  2B2T A;  1UEB A;  5C0X J;  1HTP A;  1H9R A;  2FMM A;  4QUC A;  2EJF C;  5CV5 A;  1OXU A;  2EDG A;  1QNK A;  5CGK A;  3OMG A;  1Z47 A;  5C5L A;  2JA5 H;  4IO9 A;  1SYG A;  2Z1C A;  1G51 A;  2O2L D;  3KOJ A;  1VQ8 A;  2RDG A;  4C3H G;  1R9T H;  2KCM A;  1JJ2 A;  2K33 A;  3BVM A;  2A68 C;  4DR7 Q;  1SYB A;  3NE5 B;  1MJE A;  1VS0 A;  3FPU B;  4G7Z C;  4LF7 L;  5KNB A;  3VDY A;  4MTK A;  2NZ1 D;  5CBA E;  2E2I B;  4DN4 M;  1K83 B;  2SOB A;  4P2C B;  3ONA B;  3S2D H;  5IGF A;  2UUA Q;  4JYA L;  3I4N B;  2CKZ B;  1PTO D;  2Z6K A;  5KND A;  1Y8P B;  2FIN B;  4DAP A;  1CUK A;  2ASB A;  2D62 A;  3HRZ C;  2AWN A;  1SN8 A;  1PH1 A;  1GO3 E;  2NB0 A;  1XPU A;  1HNW L;  3I4M G;  2RDH A;  3A8J E;  3CCE A;  1TWG H;  2CWP A;  4HSP A;  4HSV A;  3I72 A;  4UP9 A;  1JMC A;  2A5H A;  3GTP B;  3SK5 A;  1H9M A;  1YNN D;  1X56 A;  1WCM B;  3CMA A;  5M3M B;  2ZXO A;  1EY0 A;  3DXJ C;  2JYO A;  3H0G H;  3GTG B;  4DR5 Q;  4B3T L;  2DNE A;  3NWT A;  5KRU A;  4V19 0;  2A8V A;  3K81 C;  5C3E H;  3OSO A;  4JBJ A;  4IJL A;  1E24 A;  4R9W A;  2XWJ B;  3K6O A;  1JIC A;  1VQ5 A;  1STA A;  2HQE A;  5C44 H;  1EIY B;  5LL6 X;  1A62 A;  1IZ6 A;  1PFS A;  3IRB A;  3T13 A;  1Y69 U;  2XSC A;  1X65 A;  3S15 B;  4JI6 L;  3ZYY X;  2ID0 A;  4TRD A;  5CR3 A;  2NUC A;  4DAY B;  2CH4 W;  3TDQ A;  3TZD A;  4KHZ A;  4B3M Q;  4LK1 C;  4A3C H;  2F4V Q;  4JI3 Q;  1V9P A;  3J80 c;  3HOZ G;  1YI2 A;  2K5H A;  5D14 A;  2PMZ E;  4DGZ A;  4HJ5 A;  1HQR D;  5EKI A;  2K4K A;  1L1O C;  1ILQ A;  4BXX H;  3ULJ A;  1OTC A;  3MFG A;  1GD7 A;  1M4V A;  3UDX A;  2GN5 A;  3A5Z B;  5J3B A;  3J80 i;  3PIP 3;  4IOC A;  1NBW A;  4E6I A;  3J7A V;  1I5F A;  3EN2 A;  3U4V A;  2F03 A;  2HDL A;  2L4N A;  2RF4 A;  3T1Y Q;  1Y1W B;  5IT9 c;  1AW7 A;  4JI8 L;  4DR6 L;  5GRO A;  3TN2 A;  3C1E A;  3DWA A;  1NR2 A;  3CF5 A;  3GTK H;  1EWC A;  4BY7 H;  4DR1 Q;  1HZC A;  2DJF C;  1KDC A;  1PMR A;  3RZO B;  2EYM A;  2K52 A;  3RNU A;  2X69 A;  2H1E A;  4IPD A;  1ONL A;  4GOP C;  1OXS C;  1SYE A;  3KBX A;  3AFQ A;  3R2T A;  2E76 C;  2AKW B;  1NMF A;  5I6Y A;  3S14 H;  1XTC D;  2F0P A;  3RUZ A;  1HZA A;  1A63 A;  1DCZ A;  1SMY D;  4FF3 A;  5IWA Q;  3MZ5 A;  3VR5 A;  1N33 L;  4KI0 A;  4A3B G;  5KNC A;  1SYC A;  3N6R A;  1IXR A;  3U4Z A;  1VCI A;  1N8R C;  3GTO B;  4GS3 A;  1EWH A;  3TP5 A;  4TVA B;  3ND8 A;  4F88 A;  1L0W A;  2NVQ H;  3LWE A;  1U5K A;  3JAM E;  4BBS B;  1CT1 D;  1JE4 A;  4S3S A;  4IUP A;  3GTM B;  4DR4 Q;  3S17 B;  4JI1 Q;  3M4Y A;  3S1R B;  4YWM A;  4TSS A;  2N55 A;  3SDZ A;  1VQC A;  2L1B A;  4DKA C;  3OIQ A;  1A6X A;  3HGB A;  3NEL A;  2KJX A;  5IYC G;  2Q2H A;  4A3J B;  3GO5 A;  1VQI A;  3NP8 A;  3M3Y B;  1BKB A;  3I90 A;  1A0I A;  2YU9 B;  2E75 C;  4YHH L;  4KY6 A;  3ZJY C;  1IBM Q;  3SK4 A;  1PV4 A;  1AFP A;  3A5U A;  1Q8K A;  4OX9 Q;  5CMD A;  1ICF B;  1EOT A;  1KQS A;  2QCP X;  4XYO A;  5M5X B;  4UHV A;  1TS2 A;  2Z0S A;  3KJP A;  2AUJ D;  4LF5 L;  4A3M G;  2VUM H;  2ZTC A;  3MXN A;  2YTX A;  3PUW A;  1J9O A;  2A1A A;  3CW2 C;  5TSS A;  3DMU A;  4NKL A;  2NVY H;  2F0V A;  2K14 A;  4HIK A;  1I6V C;  1C9O A;  2VZA A;  1C48 A;  1AE3 A;  4XYQ A;  2EXD A;  1MKH A;  1DZ1 A;  4YWK A;  3KLS A;  3ULL A;  1S5E D;  1JB7 A;  3HOW B;  2ES2 A;  2O4X A;  5EBD A;  3PUV A;  1XX8 A;  3FKI H;  4BY1 B;  3RR5 A;  1VQL A;  2Q8R E;  2MGS A;  3PO3 G;  4RKB A;  3PO2 G;  3D4D A;  2R7Z H;  3GTL H;  2F1M A;  5HGT A;  2F52 A;  1I94 Q;  5CV6 A;  3S1N H;  2R92 B;  2F0M A;  3K7A H;  4H13 C;  1PTO C;  1X3Q A;  2B2W C;  3GTJ H;  4ZYS A;  4XQN A;  2NWG A;  2KQ3 A;  1IBL L;  4XIG S;  1ET9 A;  1PYS B;  3Q24 A;  4JYA Q;  1S4Z A;  3MFY A;  1EFI D;  3CC2 A;  1HA5 A;  4ME5 A;  2UUC L;  2OTJ A;  2UXC L;  2Z4H A;  5IP7 G;  3EIV A;  4I7Z C;  1SNM A;  2JA8 B;  1QCB D;  4KKS A;  3ITP A;  1PRT D;  1HNW Q;  4RGM A;  4XQQ A;  2F0U A;  2JEB I;  2LKV A;  4GZY C;  1E0B A;  4L5T A;  1U4R A;  1MBY A;  1YNN C;  2QGQ A;  1SE8 A;  1AZQ A;  5C4X B;  2YYZ A;  1MSG A;  2RHQ B;  1HTL D;  1SAP A;  2N49 A;  3QR8 A;  4LFA L;  2VW9 A;  4ODG A;  4OO1 I;  5JEA J;  2SDF A;  3X3M A;  4IUQ A;  1K9M C;  1WTP A;  1F2L A;  4LF6 L;  1VQG A;  4K14 A;  3T16 A;  2L9H A;  3NHH A;  4R4C A;  5FKA C;  4A3L H;  2HCC A;  5JJK A;  4IUU A;  1EIG A;  4DXG A;  2K5Q A;  4JI6 Q;  1K8A C;  1BF4 A;  1WOC A;  5BN3 A;  4DK1 A;  3Q22 A;  4NXN L;  1LM0 A;  4IQZ A;  2RBM A;  5FO7 B;  1Q1E A;  4NP5 A;  3SE0 A;  4A75 A;  4XQJ A;  1DYQ A;  3F1Z A;  2L55 A;  1KD1 C;  2I0Q A;  2D0P A;  1Q86 C;  1EFW A;  3PGZ A;  2MO0 A;  2K75 A;  1GVP A;  4LAA A;  3HEJ A;  2HCI A;  3R93 A;  1UEA B;  1K73 C;  5CV9 A;  1RCV D;  2EYL A;  3D6W A;  3CKI B;  2IT1 A;  1U0L A;  1E2W A;  1KLU D;  5DLQ E;  5JVG 3;  2Z4I A;  4FO2 A;  1V43 A;  4ZUI A;  1SE2 A;  3QOJ A;  2F0K A;  4R4Q A;  4EGV A;  3PSI A;  1ZXT A;  3GD7 A;  3J7Z C;  3HOX G;  2K28 A;  4JI8 Q;  3PUZ A;  4BA2 I;  1TWH B;  4OON A;  1X54 A;  1A2U A;  1CZW A;  1I6H B;  2DUD A;  3GP7 A;  4IAL A;  1BCP B;  3DHQ A;  1ET6 A;  5AFW A;  3MXN B;  5KIX A;  3PV0 A;  5KYL A;  3HOY G;  1SMY C;  1Q82 C;  1STG A;  4A3D G;  1WTW A;  3RZD H;  2FJ2 A;  2WIN B;  3NSW A;  3C46 A;  1TS3 A;  5M5W H;  1I4G A;  4C3I H;  3CCJ A;  5J22 A;  2JXM B;  1CSQ A;  1F9S A;  1E7Z A;  3MXU A;  4N8X 1;  1N33 Q;  1RL2 A;  2VQF L;  2E2J H;  4FXG C;  1EYC A;  1TWA B;  1AEX A;  3KK7 A;  2PW7 A;  4DV1 L;  2HUG A;  1PLF A;  4RGN A;  2HDM A;  3F2U A;  4IZ8 A;  2J7Z A;  3I4N G;  1D8L A;  2KA7 A;  3DWP A;  3NQT A;  1QNU A;  5ELE A;  1E22 A;  4IUN A;  3GDE A;  1HR0 Q;  2IWH A;  2MQH A;  2B2U A;  1KAB A;  3IFD A;  1BR9 A;  1ENF A;  3FRP B;  4QCL A;  2XTI A;  4IFD H;  2MO1 A;  1PTO H;  1CA6 A;  2B63 H;  4YHH Q;  3A7A B;  2BCO A;  3K5N A;  1EEF D;  1PH5 A;  3N52 A;  5G3L F;  1Y8N B;  2KCN A;  1WCM G;  1EU4 A;  3IL8 A;  5M3M G;  3BZK A;  1I4R A;  1Y1V H;  2EXZ A;  3KDF A;  3A8I E;  2OTL A;  5K36 H;  3UE0 A;  2KHS A;  1BXT A;  4WRD A;  5HUR A;  1NY4 A;  1I3Q B;  1X32 A;  4JPB W;  3LNN A;  3OTO L;  1HNZ L;  2DGY A;  1VQ4 A;  1EQQ A;  2J4X A;  1EUJ A;  1BCP D;  1MJC A;  2E2D C;  4L6T B;  1EY8 A;  1IKM A;  2JA7 B;  1E2V A;  1JC7 A;  2WII B;  3K58 A;  2LS0 1;  1DOM A;  1N9W A;  4HED A;  2JP1 A;  1L0X B;  2EYO A;  5FOB B;  2B29 A;  4ZLT F;  1G8Z D;  4JI7 L;  2A6H D;  2PI2 E;  3E6Z X;  2I46 A;  1WD0 A;  2F3I A;  3HZX A;  1PYW D;  4K2K A;  3T4A C;  3PF4 A;  4QJF A;  2BH8 A;  1SDF A;  4CDF C;  3CHB D;  3TP8 A;  1VQN A;  5C4J H;  1IKL A;  4RCN A;  1D5Z C;  2CH4 A;  2H5X A;  4TKO B;  1TWC H;  4DK3 C;  4A3F G;  4HCS A;  1LT3 D;  1SXT A;  4PMB A;  3GTQ H;  4CJ2 C;  4G7O C;  4GLV B;  4YY3 L;  2E5L L;  3M4Q A;  3S1Q H;  3NTH A;  2JA6 H;  1N34 L;  5EPK A;  3ND9 A;  1VMP A;  1IBL Q;  4UAI A;  4DAY A;  3AU7 A;  4C3J G;  1Y1W G;  4A93 H;  2ZTE A;  2UUC Q;  5IYD H;  4CKB A;  1PRT C;  3C1F A;  2UXC Q;  2Z6K C;  2NVT B;  1GJX A;  2KVM A;  4MZ9 A;  4O0A A;  1OXV A;  4RAU C;  4P71 A;  3WOF A;  1K83 H;  4A3I H;  1DOL A;  1B8A A;  5M3F H;  4GNX B;  2WKD A;  2QF7 A;  1B3A A;  5IT9 L;  2VL6 A;  4A3E H;  1YHB A;  4O1N A;  1YJW A;  1WD1 A;  3J81 E;  4JI5 L;  1BBX C;  2IHE A;  2KEC A;  2R93 B;  4NMZ A;  2JQO A;  4ME3 A;  3K5M A;  4LFA Q;  4NDX A;  2DY7 A;  1LUZ A;  4QGU A;  2Q2U A;  4KY5 A;  2E8G A;  4AYB B;  3GTP H;  2VNU D;  4OEM B;  4LF6 Q;  2I5M X;  1JJC B;  3HOU H;  5FLM G;  1XMO L;  2RVL A;  4DUY L;  2NVX H;  4JBM A;  2EY1 A;  1DXM A;  1EQT A;  1G6P A;  3BDO A;  3L9A X;  2N3S A;  1BOS A;  4BBS G;  2UUB L;  4NXN Q;  5LMU Q;  4APV A;  3HOV G;  3HOX B;  1GUG A;  3U58 A;  2EJM A;  2XVS A;  1LAB A;  1T5X D;  3STB C;  2YTY A;  1SSO A;  2GVB A;  4LF4 L;  2B2Y A;  4LUO A;  4A3J G;  2FXQ A;  1BBW A;  5I9P A;  3V05 A;  2CFM A;  1GUT A;  4XXE A;  1B1Z A;  4POF A;  3HOY B;  2P5Z X;  1PH4 A;  2DY8 A;  3H3V C;  2N78 A;  3E3X A;  2K32 A;  3D6C A;  3ULP A;  2EQS A;  4A3D B;  3BZC A;  4ZCK A;  3G71 A;  2Q8T A;  1RJT A;  4MTN A;  2Y0S B;  2O5J C;  3CAM A;  4X3T A;  3ER0 A;  3TP6 A;  4X6A H;  3RD4 A;  4PZ7 A;  2WB1 G;  4K6D A;  4HJA A;  5IYB H;  2L11 A;  3PMF A;  1WI5 A;  2RCN A;  3AQQ A;  3G48 A;  3KDF B;  1GUW A;  3MWY W;  4DV4 L;  5M5Y H;  4LNQ A;  2L12 A;  2PNH A;  1WTR A;  1OXT A;  2VB2 X;  3IAY A;  4RKL A;  4A3K B;  5KGU A;  3HOW G;  3S1M B;  2Q2T A;  1JR0 D;  4K6L A;  1U4P A;  4LUV A;  4BY1 G;  5C0X I;  4GKJ L;  4ILW A;  1VQB A;  4P74 A;  4DK0 A;  1B53 A;  2E2H B;  4IFD J;  2VQF Q;  4HCE A;  3S24 A;  3M4O B;  3S2H B;  2WKC A;  1G6Z A;  2VB3 X;  5JJI A;  2R92 G;  1LTR D;  1YHA A;  4DV1 Q;  4A3G H;  1B9N A;  4KKU A;  2PCF B;  1U4M A;  3PQI A;  2AQ3 B;  4LJZ C;  5JAV A;  2PYK A;  2KUM A;  3MHB A;  5GAD C;  1S40 A;  4MIU A;  2IHF A;  1K0S A;  1F9P A;  1FGB D;  1JOQ A;  2JA8 G;  1HA6 A;  1TKW B;  1E2Z A;  1Q46 A;  1HFN A;  2PPB C;  2NN6 I;  4BBR G;  1WYD A;  4HIM A;  1DJR D;  4CKE A;  1WJJ A;  1STH A;  3F2B A;  3WOE A;  3SHL A;  5C4X G;  4CBV A;  1FJG L;  4OWX B;  1MD2 D;  3S1R H;  2FFK B;  4AQY L;  3HFZ B;  3QG1 A;  4WJ4 A;  1XWE A;  4HJ8 A;  1D1K A;  4EQP A;  5JEA H;  2CVR A;  3M3Y H;  2A73 B;  5CV8 A;  4QUF A;  3BDL A;  1XNQ L;  1JJG A;  4YIJ A;  1K28 A;  2RHS B;  1Y14 B;  1CFM A;  1C4Q A;  2AMC B;  2LMC B;  3FDT A;  1BCP C;  3UDI A;  4A3F B;  4PZ8 A;  2HT1 A;  4JI2 L;  2WP8 J;  4JW0 A;  3OTO Q;  1HNZ Q;  1X3G A;  4A4I A;  1I50 H;  4LMQ D;  2JA5 B;  1B44 D;  5C3W A;  1FL0 A;  4G7H C;  2V4D A;  3I3C A;  4C3H H;  1JB3 A;  3NXW A;  2A6H C;  1QVC A;  3H91 A;  4IPC A;  4C3J B;  1EY4 A;  3O13 A;  5HY6 A;  5EGT A;  5I9O A;  5BN4 A;  1V1Q A;  4NXM L;  4GKK L;  1R9T B;  4JI7 Q;  3D31 A;  5JOB A;  1JWS D;  3BU2 A;  3W5O A;  3U50 C;  3GV3 A;  2B8G A;  1IYJ B;  3K0Y A;  4Y7N H;  2BDN A;  2EYJ A;  1P8L A;  1WTV A;  2Q2I A;  2F0Q A;  1T9H A;  1D1I A;  4JOI A;  2CW0 D;  5A35 A;  2NZH A;  3D8G A;  3S2D B;  3T51 B;  4EQ5 A;  2PQE A;  3RLN A;  1Q8I A;  3CME A;  1TS4 A;  2E5L Q;  3I4M H;  3CCR A;  2L5T A;  4RMF A;  1N34 Q;  2L15 A;  4K5X A;  1JWU D;  3T53 B;  2KCC A;  5A2Q E;  2UXD L;  1TWG B;  1CA5 A;  3TQY A;  4V0B A;  4DV3 L;  2MP1 A;  3BYT B;  2VY3 A;  3HKZ E;  2ZXP A;  3H3V H;  1IHZ A;  1PFN A;  4K8J A;  1EY5 A;  4LF9 L;  4R8N A;  3NPP A;  1K8G A;  1SR3 A;  4M8A A;  3H0G B;  3MEH A;  4KN7 C;  4ZKB B;  3HOV B;  3F2D A;  2PZT A;  1NTG A;  3NBI A;  5C3E B;  3B6Y A;  4QL5 A;  1SFO H;  1PTO F;  1LV9 A;  3VR4 A;  2IX3 A;  5C44 B;  2ALY B;  4LFC L;  2ZJR A;  2F3V A;  3OW2 A;  5F2D A;  4R4I A;  1EZ8 A;  2CHB D;  5IGC A;  1C8C A;  3M7N A;  2JE6 I;  3HOZ H;  1Z6H A;  1SYF A;  5FLX E;  1V1O A;  1VF5 C;  4IPG A;  3DUZ A;  1O7Z A;  1JQY D;  1V1P A;  5DM6 3;  2AUK A;  4J15 A;  4DUY Q;  4GLA C;  5ELD A;  2R7D A;  2XN9 C;  1I4H A;  3VA5 A;  3R3O A;  3EA6 A;  1HZ9 A;  3C3L A;  2UUB Q;  2WB1 B;  2UXB Q;  4FF1 A;  5LL6 S;  1KAA A;  4DV7 L;  2YTV A;  1N32 L;  2J0T D;  4LF4 Q;  1L1O A;  3QIA A;  4RCO A;  5LMN W;  2WAQ E;  4LWC A;  4X62 L;  2KEN A;  1S3O A;  5IP9 G;  5KYI A;  1EL0 A;  1HUN A;  3CQZ H;  3VA7 A;  3D3R A;  1EIF A;  2QDL A;  5E4X A;  3GTK B;  3SXH A;  2Q8I B;  4BY7 B;  1M1K C;  3NBH A;  3J81 c;  1AP0 A;  4KV6 A;  1GKH A;  4DAV A;  5J1Z A;  3J81 j;  4JC0 A;  3Q6S A;  1Q12 A;  4LF7 Q;  4GN5 A;  1VQA A;  2VQE L;  1STE A;  4H02 A;  2JA7 G;  1DON A;  4DV4 Q;  3S14 B;  1SJE D;  1EQR A;  4JI0 L;  4FXK C;  2X6G A;  3U9S A;  4CDC C;  1LTB D;  4A3B H;  3EQL C;  1D5X C;  4QIW B;  4JVZ A;  2JSO A;  3OMC A;  2JJQ A;  1BVS A;  4IJH A;  2KHI A;  3UE1 A;  4EX5 A;  5EKL A;  1H9S A;  2EPB A;  1I6H H;  1DOK A;  3UDG A;  4N9P A;  4X65 L;  1UAP A;  1Q90 A;  4BBR B;  2O5I C;  2NTS A;  4FXD A;  1PXU A;  5C0X G;  2OWO A;  4GKJ Q;  3S16 H;  1PH6 A;  4NW2 A;  1IL2 A;  2G9H D;  2F0S A;  1VQK A;  2NVQ B;  3CRL C;  2A6E D;  1UE5 A;  1VQP A;  5IYC H;  4FNF A;  3JAM L;  3AMU A;  4U68 A;  4B3T Q;  2DN8 A;  1EY7 A;  2VXW A;  4HN7 A;  3SR1 A;  5C3X A;  3NEM A;  4K5V A;  4TQU S;  5E7N A;  3J7Y W;  4OWT B;  1YVC A;  3W2D A;  2QW7 A;  4PMW A;  5ELO A;  4DR2 L;  3A7L A;  1LTT D;  1YNX A;  1WTO A;  1EWI A;  1RIP A;  4M1U B;  1L2F A;  1RTN A;  1NJI C;  4A3M H;  3QWN A;  2NN6 G;  3I2Z A;  2XRS D;  5EJW A;  1TXY A;  3CRK C;  2B2U C;  3CP0 A;  2B3G A;  1R4P B;  3KJO A;  4KHV A;  2VUM B;  1FJG Q;  4AQY Q;  1XPO A;  5I2X A;  2R93 G;  1BO0 A;  3K57 A;  1Q1B A;  1DM0 B;  2NVY B;  3KFU A;  3RLF A;  5IGB A;  1STB A;  3UI2 A;  1GHK A;  1XNQ Q;  1R4Q B;  4AYB G;  4C1N I;  3UDF A;  1AH9 A;  1RF2 D;  1XPR A;  2C35 B;  1QVG A;  4ABN A;  5IGE A;  3I70 A;  4JI2 Q;  1JE5 A;  4P75 A;  1X55 A;  4CDE C;  2OEO A;  1QJO A;  2KOL A;  1K8O A;  1VMC A;  2CQA A;  2L0C A;  1CQF A;  2K04 A;  4B3S L;  2QEJ C;  3PO3 H;  2CWA A;  1TS5 A;  2MPM A;  3FKI B;  3KBG A;  4QY7 A;  2QDB A;  5E4W C;  4CJ1 B;  1GM5 A;  3PO2 H;  2F4I A;  1ROD A;  2DJG C;  3TP7 A;  4GNX A;  4NXM Q;  2AQ1 B;  4DV6 L;  2EVB A;  5K5P A;  3QB3 A;  1WTQ A;  4DR6 Q;  3G6J B;  2LY7 A;  3WDN A;  3TS0 A;  1V1P B;  2LFN A;  5EKK A;  2CW0 C;  2R7Z B;  2TSS A;  1JCK B;  2EY2 A;  3GTL B;  3Q8D A;  5JJL A;  5E1F A;  3K7A B;  4G4K A;  3AB9 A;  3H15 A;  5DNF A;  3GTJ B;  4DK6 C;  2XWB B;  3NUC A;  1QB5 D;  1KXL A;  1Q3L A;  2MFI A;  5IP7 H;  5FO8 B;  1J5E L;  4KD3 A;  5FJ8 G;  3A54 A;  1L1O B;  4U67 3;  2BA0 A;  3PUY A;  2MJ8 A;  1EOV A;  2Y0S G;  3J80 E;  1NAP A;  1PH2 A;  1LTL A;  3BYY B;  2UUA L;  4OWW B;  2QEX A;  4K0K L;  3CPW A;  4L63 B;  2UXD Q;  1LLR D;  2NYZ D;  1TU2 B;  3ICE A;  2F0T A;  1HZB A;  4DV3 Q;  4MN3 A;  4FP5 D;  3VYU A;  4XTC S;  1PZK D;  3NWS A;  1HNX L;  1EYG A;  3NBH B;  4OIK A;  4GLX A;  4LF9 Q;  1XJV A;  1ICW A;  1K3B C;  2IY5 B;  1IYU A;  4A3K G;  2WAC A;  3D0F A;  5CV7 A;  2EJG C;  2B8F A;  3G6E A;  1X9N A;  2OXP A;  2ZJQ A;  5CV4 A;  2PMZ B;  3HG9 A;  1HHV A;  1KC8 C;  1LO5 D;  3G7L A;  1CI3 M;  2G5D A;  2OT2 A;  2B2V A;  1PRT F;  2EY5 A;  4B9W A;  3FPP A;  1H9S B;  3K80 C;  4R4T A;  4RA8 A;  5IIF A;  2EZV A;  2F0I A;  1SND A;  1M90 C;  5J39 A;  1EZ6 A;  5ISR A;  1K3R A;  1PYB A;  3RN5 A;  4LF5 Q;  4RFB A;  1HQM C;  4OGQ C;  3GQB A;  4ULL A;  2KEE A;  1QG7 A;  1PDQ A;  1RD9 D;  2K5N A;  1RHP A;  4DV7 Q;  2XGT A;  2XNA C;  1N32 Q;  4BS9 A;  1STN A;  3VR3 A;  4JV5 L;  1VQJ A;  2B2T C;  4UP8 A;  2B2Y C;  2Z8L A;  3H6M A;  2PQA B;  3HKS A;  3I4L A;  2M9V A;  3HOX H;  5C4H A;  2F3W A;  3OHX C;  5JVH 3;  4X62 Q;  4H7B A;  4C2M H;  1W6J A;  3A0J A;  4H44 C;  1VQH A;  5DAU A;  3CXC A;  2EIF A;  2WFW A;  1EQV A;  1LTA D;  3JAM c;  4CHT B;  1C0A A;  1SEB D;  4EQO A;  5T1G A;  5I6W A;  1SMX A;  2UU9 L;  2KED A;  1P16 A;  1WVL A;  3HOY H;  2EYF A;  3GV6 A;  2F0H A;  3KLW A;  4A3D H;  4YCU A;  2B39 A;  1VQ9 A;  2JA5 G;  5D3D A;  3VYT A;  1S5C D;  2VQE Q;  4JI0 Q;  3RZD B;  3NTI A;  5H1S E;  1Q7Y C;  2K6A A;  5M5W B;  4DA2 A;  4C3I B;  3DEO A;  4FF2 A;  3L0O A;  1PH9 A;  4KY7 A;  1IW7 D;  2F0L A;  5D3I B;  2EE1 A;  5E3F A;  3L7Z C;  1VDZ A;  3P75 A;  2E2I H;  2E2J B;  4JI4 L;  5BR8 L;  1FNU A;  3EFX D;  3HS0 C;  1WTX A;  4KMU C;  1QUQ A;  2LXK A;  3I4N H;  5IWA L;  2A6E C;  3T1H L;  1CTM A;  3CCQ A;  1UUP A;  2SEB D;  3L2P A;  1YJN A;  1O7I A;  1ASZ A;  1SRU A;  3R2I A;  1PFM A;  3CCL A;  3OYY A;  3MC0 B;  3TRZ A;  3V2T A;  4DR2 Q;  4DR4 L;  1II3 A;  1SLJ A;  1WCM H;  4O2D A;  5M3M H;  1GHJ A;  3FEW X;  3ERS X;  3GTG H;  4B3R L;  1TWF B;  4XT1 B;  4OHJ A;  5DM7 3;  3C2P A;  4PV1 C;  5T1I A;  4H0L C;  3H0G G;  2X6L A;  1Y1V B;  2WAQ B;  3OPO A;  1MHW C;  5HGQ A;  4KHP L;  1LTS D;  3G4S A;  5C3E G;  2PZW A;  1CKN A;  1F2M A;  3DEP A;  1PH8 A;  1IBK L;  3LWU A;  4HR7 B;  3S15 H;  3CCV A;  4EVO A;  5C44 G;  1CQV A;  1K8M A;  1EU3 A;  2BE5 D;  4DV0 L;  3KUP A;  1CHQ D;  1JOK A;  1JOR A;  3I8Z A;  2JEA I;  4N9T A;  4JG2 A;  4HID A;  2K1B A;  4HAE A;  2D0O A;  4A3C G;  4WOR A;  3OW7 A;  4F8M A;  1ZKO A;  4BWG B;  3Q0A A;  4NB3 A;  3NQI A;  2R3Z A;  1H95 A;  1NUC A;  4DAM A;  5LMN L;  5JEA G;  2OQK A;  4B3S Q;  1CKM A;  5EPL A;  1ASY A;  3MEF A;  5L37 A;  2K5V A;  1KNE A;  4A3F H;  1A3V A;  3PF5 A;  3M85 A;  5C4J B;  3J7A 5;  1OO9 B;  3TBI B;  4DV6 Q;  4BXX G;  1WTH A;  2IPK D;  1TWC B;  2M2L A;  1U4L A;  2MHV A;  2R6G A;  3GTQ B;  1KLG D;  4CJ0 B;  4I7A A;  4C3J H;  1Y1W H;  1BCP F;  2JA6 B;  3S1Q B;  2D5D A;  5IE8 A;  1BQQ T;  1SNC A;  3MXG A;  3M4P A;  1B2T A;  3JC6 6;  4JOI C;  1J5E Q;  4A93 B;  4X3S A;  4HMJ A;  1I94 L;  1HXY D;  3FMC A;  3NK9 A;  4UPA A;  2RQX A;  1G2S A;  3I56 A;  3RZO H;  4KD4 A;  2BH2 A;  4HJ9 A;  4A3I B;  3LGJ A;  4BY7 G;  4GN3 B;  3F2C A;  4DXF A;  1YNJ D;  1F9Q A;  4JCV E;  4K0K Q;  3K59 A;  5M3F B;  2HQL A;  1QE6 A;  4PZ6 A;  2PI2 A;  2PZU A;  1SNO A;  4QF4 A;  4OO1 H;  4A3E B;  3Q23 A;  2C9O A;  1L0Y B;  1HNX Q;  1CHP D;  1KDA A;  4PNY A;  3K8A A;  3W3A A;  3VR6 A;  2Z6B A;  3J81 L;  1BNZ A;  4ZKC B;  1PA6 A;  2ZM6 L;  1TY0 A;  5FLM H;  4PQX A;  3GTO H;  2HIV A;  5COY A;  1XNR L;  2PNR C;  1X3E A;  4JK1 C;  3HOU B;  4BBS H;  2EOT A;  3S17 H;  1IYV A;  3GTM H;  3HOV H;  2NVX B;  3VR2 A;  4IOA A;  3E9H A;  1HRJ A;  4OIJ A;  3CC7 A;  3CCM A;  1PZI D;  2MUY A;  2M00 A;  4A3J H;  4FF4 A;  2OF1 A;  2IW3 A;  4KKT A;  1QUQ B;  4PG3 A;  3DLL A;  2XRQ D;  4I65 A;  1SYD A;  2IJ0 A;  2YU9 H;  3K5L A;  3VYR A;  4LFB L;  1QWY A;  1W3S A;  3H09 A;  4IFD I;  3K0X A;  1DD2 A;  1UE1 A;  5ELF A;  5M5X H;  5IGG A;  2E74 C;  1W6K A;  3VYS A;  1F9R A;  4JV5 Q;  1B3Q A;  1UNS A;  4IUR A;  1Y8O B;  5AJ3 L;  1IL8 A;  5JPN C;  2VUM G;  4WFN 3;  1M8A A;  1JT8 A;  2RSN A;  4ZK9 B;  1J6Q A;  4LF8 L;  5JJZ A;  1ZYR D;  2ICI A;  3QJY A;  1SRO A;  4YWL A;  1NE3 A;  4X64 L;  1GUS A;  2UU9 Q;  3BDC A;  1LT6 D;  1JWM D;  3K5O A;  1PVO A;  3S9W A;  2IX1 A;  5M5Y B;  2ATW A;  4POG A;  1CKN B;  3HOW H;  2NZO A;  4K5W A;  3I91 A;  4R4O A;  1JOO A;  2AWO A;  4G57 A;  1XXG A;  4YY3 Q;  2DNC A;  4BY1 H;  2BA1 A;  1X3F A;  3EVQ A;  3I7F A;  1IW7 C;  1PFB A;  2F0O A;  3FKI G;  1NSN S;  4X3K A;  5EPJ A;  3X3N A;  2WV6 D;  1QVF A;  3BG3 A;  4RG1 A;  2R92 H;  1EIH A;  1ENA A;  2NTT A;  2R7Z G;  4JI4 Q;  5BR8 Q;  3PIP A;  4KN4 C;  4K8I A;  1YHQ A;  1LTG D;  4CGY B;  2BDO A;  4KTA A;  4IUT A;  2KBN A;  3J7A F;  3QOL A;  3KLR A;  3T1H Q;  1LT4 D;  4A3G B;  4DUZ L;  4RWS C;  3BVZ A;  3FP9 A;  4JI5 Q;  4DV2 L;  5C4Z A;  2ENB A;  5FO9 B;  2JA8 H;  4Q5V A;  1QZH A;  1MGS A;  3RLO A;  4BBR H;  1VQD A;  1HPC A;  2A69 D;  1BUV T;  2N8N A;  3LX0 A;  3OWF A;  1FR3 A;  4DV5 L;  5C4X H;  5BN5 A;  1VQ7 A;  4MHE A;  5D65 A;  3D4W A;  1ENC A;  2ZT9 C;  1G91 A;  1KDB A;  2JN4 A;  1XMO Q;  4A76 A;  1HR0 L;  1KIX A;  4B3R Q;  1STY A;  4HJ7 A;  4DR3 L;  1KNA A;  5COR A;  5CC4 A;  1YBY A;  1PRT B;  2R7F A;  3KF6 A;  4X66 L;  4DU9 A;  4KHP Q;  1YEZ A;  3OOC A;  1KRS A;  1A8V A;  2BE5 C;  2F0G A;  3PIO 3;  1F2Z A;  1IBK Q;  4FYD A;  2IL8 A;  3SGI A;  1UWV A;  1FNW A;  4CKC A;  2LXJ A;  1I50 B;  1RTO A;  4DV0 Q;  4XT3 B;  4A3L G;  1F77 A;  4C3H B;  2AHO B;  2BOS A;  4Z9C B;  4PMC A;  4AYB E;  5IOD A;  4J8Q A;  1ML0 D;  3DM1 A;  2LSS A;  4Y7N B;  5LMN Q;  2RCF A;  4ZAI A;  1PH3 A;  3PUX A;  3BS1 A;  1WFQ A;  5DEH A;  4J1M A;  3H94 A;  3PIO A;  1F2Y A;  4GNX C;  2KHJ A;  1V8Q A;  3E0J A;  1I4X A;  1NR4 A;  1FVI A;  3SK8 A;  1BBU A;  3I4M B;  1ESF A;  1XMQ L;  4MNO A;  4GOP A;  1KL9 A;  3TME A;  1XYI A;  1A3T A;  4F7X A;  1TWH H;  3J81 i;  1ILP A;  4OEL B;  4DNR B;  5GQO A;  3MXP A;  1Z9F A;  3TS2 A;  1YNJ C;  3CD6 A;  1EYA A;  1B50 A;  3KF8 A;  4KK7 A;  4BA1 I;  5A2Q L;  2F0F A;  2Y0S E;  4WJW A;  4DPG A;  3AYH B;  3OIP A;  4J6H A;  1D5M C;  3EBE A;  4UP7 A;  3TEH B;  2D9U A;  3BVG A;  1B4O A;  3HKZ G;  3DWQ A;  1YIT A;  2RSO A;  4DNI A;  1SFO B;  2V1C C;  4DF7 A;  3V96 A;  1LYL A;  1VQF A;  4ZUJ A;  2FHT A;  1VQ6 A;  4C3I G;  4DNT B;  2PQA A;  5G3L D;  4YCW A;  4RGO S;  1GUN A;  1TWA H;  2A19 A;  3W1B A;  1YZ6 A;  2ZM6 Q;  5EQ0 A;  1LAC A;  5ELC A;  1B70 B;  2F0N A;  3HOZ B;  2F0D A;  1VQO A;  4OXP A;  2HHH L;  1XNR Q;  3AEV A;  4B08 A;  1S5F D;  3KYH C;  4O42 A;  1Z7T A;  1OXX K;  2B2V C;  5FLX L;  1UE6 A;  1TVX A;  4IN3 A;  3CC4 A;  3FVQ A;  1QZG A;  1CSP A;  1SE4 A;  2JA9 A;  1O7L A;  1N36 L;  4KJO A;  4Y52 H;  4JBW A;  3MAQ A;  4OL7 A;  2R61 A;  2K5W A;  3I4O A;  4LFB Q;  4ZRZ A;  5IP9 H;  5LMU L;  1YIJ A;  5EAY A;  4IFD G;  2B63 G;  3E9I A;  3CU7 A;  2I5L X;  1D7Q A;  4RGT A;  2JK8 A;  4WJ3 M;  4P73 A;  3ERQ A;  3MVV A;  2G9D A;  3FHW A;  3TRE A;  3T56 B;  3SVM A;  1C7Y A;  3CQZ B;  3HP3 A;  1MSH A;  3STB D;  4IUV A;  1Y1V G;  2RKS A;  2WAQ G;  1SNP A;  4GKK Q;  1I3Q H;  1ZYR C;  4R1J A;  5AJ3 Q;  5K36 G;  4L5R C;  5ELB A;  1MIU A;  4LF8 Q;  2AQ2 B;  4X3U A;  1GOZ A;  2JA7 H;  2HD3 A;  1KRT A;  1S5B D;  1HFG A;  3S1N B;  2GVA A;  4R8I A;  3KF6 B;  4X64 Q;  2TMP A;  4N8F A;  2F0J A;  2Z9H A;  1A3U A;  1FD7 D;  2VS1 A;  1SJH D;  2K5D A;  1NCV A;  4DR7 L;  3TZU A;  4A3B B;  1I4Q A;  2ICE C;  4LW1 A;  1E3P A;  3AFP A;  2B2W A;  2A68 D;  3CPF A;  5C0X H;  5KEE A;  2HIX A;  1J8I A;  4K2L A;  4UDU C;  1KTK A;  4AH6 A;  3I55 A;  3S16 B;  2QIL A;  5I2Y A;  3A55 A;  4KLK A;  3WWV A;  3RN2 A;  4C56 C;  5GAH C;  1G29 1;  3MA2 B;  3P1H A;  3P20 A;  1S72 A;  2JA6 G;  2OCE A;  5CBE E;  1NNX A;  5M9O A;  1B9M A;  2QKI C;  2A69 C;  4AIM A;  4DUZ Q;  2NVT H;  2ZJP A;  1RKN A;  4IPH A;  5EBC A;  1AE2 A;  4A93 G;  4DV2 Q;  4QMG A;  1ESR A;  5IYD G;  5IT9 E;  1I4P A;  1XTD A;  2NN6 H;  4LFC Q;  1HR0 W;  1TQO A;  4DR5 L;  2I07 B;  1HUM A;  1EYD A;  4GOP B;  4A3I G;  3H3V I;  4DV5 Q;  4A3M B;  1HJP A;  3A56 A;  3PCO B;  3TSS A;  2MNA A;  2F0E A;  5M3F G;  1FGU A;  2R93 H;  4RHS A;  4RH6 A;  4EQN A;  1D6E C;  4A3E G;  4CDD C;  3KF8 B;  4DFA A;  4DR3 Q;  3D4R A;  3R8B A;  3P7J A;  4B3M L;  1H9K A;  3K7U C;  4X66 Q;  2RA4 A;  2F4V L;  4JI3 L;  1PHJ A;  4KJN A;  1FYC A;  2GA4 B;  5C6A A;  2C5C A;  1GUO A;  1HCZ A;  4UY8 C;  1PZJ D;  1TWF H;  3KLS X;  2SNM A;  4YCV A;  5CYU A;  3HOU G;  3QO2 A;  3OWE B;  1E1O A;  4L5S A;  3PO3 B;  1TT2 A;  1O7Y A;  1O80 A;  1A2T A;  2N88 A;  3IFT A;  2NBF A;  3PO2 B;  2H4O A;  3CCU A;  1H9J A;  1SBB B;  1ZEQ X;  1A15 A;  1BDO A;  2K7V A;  3CCS A;  1U9R A;  1AN8 A;  2ZXR A;  2D2C C;  5JPM C;  3MTS A;  1HH2 P;  1UE7 A;  2YV5 A;  3U9O A;  1S5D D;  3NTK A;  4QB4 A;  3T1Y L;  4HTH A;  3URY A;  5FJ8 H;  1KAW A;  1DGS A;  1QOH A;  2WB1 E;  3A8K E;  1X3P A;  4LUZ A;  1GXD C;  3HKZ B;  3NEN A;  4F87 A;  1B7Y B; 
#chains in the Genus database with same CATH homology
 5IOC A;  5I4D A;  1TR5 A;  1CZG A;  4FVM A;  5NUC A;  2F0W A;  3SEB A;  1LTI D;  2EYH A;  4ZQ3 A;  1LT5 D;  3J80 L;  3BZD B;  2SNS A;  5C5M A;  4RHR A;  1CK1 A;  3EJI A;  2XIW A;  1VF7 A;  2EYP A;  2K05 A;  2IX0 A;  3L3O C;  1FNV A;  1MI2 A;  2A74 C;  2K03 A;  1TII D;  5FK9 C;  3E5S A;  4ID6 A;  1SE3 A;  3SK6 A;  3IKJ A;  2B63 B;  1PTO B;  3ERO A;  1D2B A;  1AZP A;  2K01 A;  1SNQ A;  1EEI D;  4OO1 G;  3I73 A;  4Q0F A;  5LHY 1;  1QIL A;  4B9X A;  5IGD A;  4L8J A;  1CM9 A;  4HMI A;  1T5E A;  1EY9 A;  2RDF A;  2FMC A;  3RMH A;  4C1N K;  1O78 A;  2EY6 A;  1TY2 A;  3M7G A;  1RDP D;  2PO4 A;  1G2T A;  2PW5 A;  4XDX A;  1EY6 A;  4C2M B;  2B2T A;  5C0X J;  1HTP A;  1H9R A;  2FMM A;  4QUC A;  2EJF C;  5CV5 A;  1OXU A;  2EDG A;  1QNK A;  5CGK A;  3OMG A;  1Z47 A;  5C5L A;  1SYG A;  2Z1C A;  2O2L D;  2RDG A;  4C3H G;  2K33 A;  3BVM A;  2A68 C;  1SYB A;  3NE5 B;  3FPU B;  4G7Z C;  5KNB A;  2NZ1 D;  5CBA E;  2E2I B;  4DN4 M;  1K83 B;  2SOB A;  4P2C B;  3ONA B;  5IGF A;  3I4N B;  1PTO D;  5KND A;  1Y8P B;  2FIN B;  4DAP A;  2D62 A;  3HRZ C;  2AWN A;  2NB0 A;  2RDH A;  3A8J E;  4HSP A;  4HSV A;  3I72 A;  2A5H A;  3GTP B;  3SK5 A;  1H9M A;  1YNN D;  1WCM B;  5M3M B;  2ZXO A;  1EY0 A;  3DXJ C;  2JYO A;  3GTG B;  2DNE A;  3NWT A;  5KRU A;  4V19 0;  3OSO A;  4R9W A;  2XWJ B;  3K6O A;  1JIC A;  1STA A;  2HQE A;  5LL6 X;  3T13 A;  1Y69 U;  2XSC A;  3S15 B;  3ZYY X;  2ID0 A;  4TRD A;  5CR3 A;  2NUC A;  3TDQ A;  3TZD A;  4KHZ A;  4LK1 C;  5D14 A;  4DGZ A;  1HQR D;  5EKI A;  1ILQ A;  3MFG A;  1M4V A;  3PIP 3;  4E6I A;  3J7A V;  2F03 A;  2HDL A;  2L4N A;  1Y1W B;  1AW7 A;  3TN2 A;  3C1E A;  3DWA A;  1NR2 A;  1EWC A;  1KDC A;  1PMR A;  3RZO B;  2EYM A;  2X69 A;  2H1E A;  1ONL A;  1OXS C;  1SYE A;  3KBX A;  3R2T A;  2E76 C;  5I6Y A;  1XTC D;  2F0P A;  3RUZ A;  1DCZ A;  1SMY D;  4FF3 A;  3MZ5 A;  3VR5 A;  4KI0 A;  5KNC A;  1SYC A;  3N6R A;  1VCI A;  3GTO B;  1EWH A;  3TP5 A;  3ND8 A;  4F88 A;  3LWE A;  3JAM E;  4BBS B;  1CT1 D;  1JE4 A;  4S3S A;  4IUP A;  3GTM B;  3S17 B;  3M4Y A;  3S1R B;  4TSS A;  2N55 A;  3SDZ A;  2L1B A;  1A6X A;  3OIQ A;  3HGB A;  2KJX A;  4A3J B;  3GO5 A;  3NP8 A;  3M3Y B;  3I90 A;  2YU9 B;  2E75 C;  4KY6 A;  3SK4 A;  1AFP A;  5CMD A;  1EOT A;  2QCP X;  4XYO A;  5M5X B;  1TS2 A;  2AUJ D;  3MXN A;  3PUW A;  1J9O A;  5TSS A;  3DMU A;  4NKL A;  2F0V A;  1I6V C;  1C48 A;  4XYQ A;  1DZ1 A;  3KLS A;  1S5E D;  3HOW B;  2O4X A;  5EBD A;  3PUV A;  1XX8 A;  4BY1 B;  2Q8R E;  2MGS A;  4RKB A;  3D4D A;  2F1M A;  5HGT A;  5CV6 A;  2R92 B;  2F0M A;  4H13 C;  1PTO C;  1X3Q A;  2B2W C;  4ZYS A;  4XQN A;  2NWG A;  2KQ3 A;  4XIG S;  1ET9 A;  3Q24 A;  1S4Z A;  3MFY A;  1EFI D;  1HA5 A;  4ME5 A;  2Z4H A;  4I7Z C;  1SNM A;  2JA8 B;  1QCB D;  4KKS A;  3ITP A;  1PRT D;  4RGM A;  4XQQ A;  2F0U A;  2JEB I;  2LKV A;  4GZY C;  1E0B A;  1U4R A;  1MBY A;  1YNN C;  1AZQ A;  5C4X B;  2YYZ A;  1MSG A;  1HTL D;  1SAP A;  4ODG A;  4OO1 I;  5JEA J;  2SDF A;  3X3M A;  4IUQ A;  1WTP A;  1F2L A;  4K14 A;  3T16 A;  2L9H A;  3NHH A;  5FKA C;  2HCC A;  4IUU A;  1EIG A;  4DXG A;  2K5Q A;  1BF4 A;  5BN3 A;  4DK1 A;  3Q22 A;  4IQZ A;  2RBM A;  5FO7 B;  1Q1E A;  4NP5 A;  3SE0 A;  4XQJ A;  1DYQ A;  2L55 A;  4LAA A;  3HEJ A;  2HCI A;  3R93 A;  1UEA B;  5CV9 A;  1RCV D;  2EYL A;  3D6W A;  3CKI B;  2IT1 A;  1E2W A;  1KLU D;  5JVG 3;  2Z4I A;  4FO2 A;  1V43 A;  4ZUI A;  1SE2 A;  3QOJ A;  2F0K A;  4EGV A;  1ZXT A;  3GD7 A;  2K28 A;  3PUZ A;  4BA2 I;  1TWH B;  1A2U A;  1CZW A;  1I6H B;  3GP7 A;  4IAL A;  1BCP B;  3DHQ A;  1ET6 A;  5AFW A;  5KIX A;  3PV0 A;  5KYL A;  1SMY C;  1STG A;  1WTW A;  2FJ2 A;  2WIN B;  3NSW A;  3C46 A;  1TS3 A;  1I4G A;  5J22 A;  2JXM B;  1F9S A;  3MXU A;  4FXG C;  1EYC A;  1TWA B;  1AEX A;  3KK7 A;  2PW7 A;  2HUG A;  1PLF A;  4RGN A;  2HDM A;  3F2U A;  4IZ8 A;  2J7Z A;  2KA7 A;  3DWP A;  3NQT A;  1QNU A;  5ELE A;  4IUN A;  2IWH A;  2B2U A;  1KAB A;  3IFD A;  1BR9 A;  1ENF A;  3FRP B;  4QCL A;  4IFD H;  1PTO H;  1CA6 A;  3A7A B;  2BCO A;  3K5N A;  1EEF D;  3N52 A;  5G3L F;  1Y8N B;  2KCN A;  1EU4 A;  3IL8 A;  1I4R A;  2EXZ A;  3A8I E;  5K36 H;  2KHS A;  1BXT A;  4WRD A;  5HUR A;  1I3Q B;  1X32 A;  3LNN A;  2J4X A;  1BCP D;  2E2D C;  4L6T B;  1EY8 A;  1IKM A;  2JA7 B;  1E2V A;  1JC7 A;  2WII B;  3K58 A;  2LS0 1;  1DOM A;  4HED A;  1L0X B;  2EYO A;  2JP1 A;  5FOB B;  4ZLT F;  1G8Z D;  2A6H D;  3E6Z X;  2I46 A;  1WD0 A;  3HZX A;  1PYW D;  4K2K A;  3T4A C;  1SDF A;  3CHB D;  3TP8 A;  1IKL A;  4RCN A;  1D5Z C;  4TKO B;  4HCS A;  1LT3 D;  1SXT A;  4PMB A;  4G7O C;  4CJ2 C;  3NTH A;  5EPK A;  3ND9 A;  1VMP A;  4UAI A;  4DAY A;  3AU7 A;  4C3J G;  4CKB A;  1PRT C;  3C1F A;  2NVT B;  1GJX A;  2KVM A;  1OXV A;  4RAU C;  3WOF A;  1DOL A;  2WKD A;  2QF7 A;  1B3A A;  5IT9 L;  4O1N A;  1WD1 A;  3J81 E;  1BBX C;  2KEC A;  2R93 B;  4NMZ A;  3K5M A;  4NDX A;  2DY7 A;  4KY5 A;  4AYB B;  2VNU D;  2RVL A;  2EY1 A;  1DXM A;  1EQT A;  3BDO A;  3L9A X;  1BOS A;  3HOX B;  1GUG A;  2EJM A;  2XVS A;  1LAB A;  1T5X D;  1SSO A;  2B2Y A;  5I9P A;  3V05 A;  1GUT A;  4XXE A;  1B1Z A;  3HOY B;  3H3V C;  2DY8 A;  2K32 A;  3D6C A;  4A3D B;  2Q8T A;  1RJT A;  2Y0S B;  2O5J C;  4X3T A;  3TP6 A;  3RD4 A;  4K6D A;  2L11 A;  3PMF A;  1GUW A;  3MWY W;  2L12 A;  1WTR A;  1OXT A;  2VB2 X;  3IAY A;  4RKL A;  4A3K B;  5KGU A;  3S1M B;  1JR0 D;  4K6L A;  1U4P A;  5C0X I;  4ILW A;  4DK0 A;  1B53 A;  2E2H B;  4IFD J;  4HCE A;  3M4O B;  3S2H B;  2WKC A;  1G6Z A;  2VB3 X;  1LTR D;  1B9N A;  4KKU A;  2PCF B;  1U4M A;  2AQ3 B;  4LJZ C;  5JAV A;  2PYK A;  2KUM A;  3MHB A;  4MIU A;  1F9P A;  1FGB D;  1JOQ A;  1HA6 A;  1TKW B;  1E2Z A;  1HFN A;  2PPB C;  2NN6 I;  1DJR D;  4CKE A;  1STH A;  3WOE A;  3SHL A;  4CBV A;  1MD2 D;  2FFK B;  3QG1 A;  1XWE A;  1D1K A;  4EQP A;  5JEA H;  2CVR A;  2A73 B;  5CV8 A;  4QUF A;  3BDL A;  4YIJ A;  1CFM A;  1C4Q A;  2LMC B;  3FDT A;  1BCP C;  4A3F B;  2WP8 J;  4LMQ D;  2JA5 B;  1B44 D;  5C3W A;  4G7H C;  2V4D A;  3I3C A;  1JB3 A;  3NXW A;  2A6H C;  3H91 A;  4C3J B;  1EY4 A;  3O13 A;  5EGT A;  5I9O A;  5BN4 A;  1R9T B;  3D31 A;  5JOB A;  1JWS D;  3GV3 A;  2B8G A;  3K0Y A;  2BDN A;  2EYJ A;  1WTV A;  2F0Q A;  1D1I A;  2CW0 D;  5A35 A;  3D8G A;  3S2D B;  3T51 B;  2PQE A;  1Q8I A;  1TS4 A;  2L5T A;  4K5X A;  1JWU D;  3T53 B;  2KCC A;  5A2Q E;  1TWG B;  1CA5 A;  4V0B A;  2MP1 A;  3BYT B;  2ZXP A;  1IHZ A;  1PFN A;  4K8J A;  1EY5 A;  4R8N A;  3NPP A;  4M8A A;  3H0G B;  3MEH A;  4KN7 C;  4ZKB B;  3HOV B;  2PZT A;  3NBI A;  5C3E B;  1PTO F;  1LV9 A;  3VR4 A;  2IX3 A;  5C44 B;  2F3V A;  5F2D A;  1EZ8 A;  2CHB D;  5IGC A;  1C8C A;  3M7N A;  2JE6 I;  1Z6H A;  1SYF A;  5FLX E;  1V1O A;  1VF5 C;  3DUZ A;  1O7Z A;  1JQY D;  1V1P A;  5DM6 3;  2AUK A;  5ELD A;  2XN9 C;  1I4H A;  3VA5 A;  3R3O A;  3EA6 A;  3C3L A;  2WB1 B;  4FF1 A;  5LL6 S;  1KAA A;  2J0T D;  3QIA A;  4RCO A;  1EL0 A;  5KYI A;  1HUN A;  3VA7 A;  3D3R A;  5E4X A;  3GTK B;  3SXH A;  2Q8I B;  4BY7 B;  1AP0 A;  3NBH A;  4KV6 A;  4DAV A;  5J1Z A;  3Q6S A;  1Q12 A;  1STE A;  1DON A;  3S14 B;  1SJE D;  4FXK C;  2X6G A;  3U9S A;  1LTB D;  3EQL C;  1D5X C;  4QIW B;  2JSO A;  3OMC A;  5EKL A;  1H9S A;  2EPB A;  1DOK A;  4N9P A;  1UAP A;  1Q90 A;  4BBR B;  2O5I C;  2NTS A;  4FXD A;  1PXU A;  5C0X G;  4NW2 A;  2G9H D;  2F0S A;  2NVQ B;  3CRL C;  2A6E D;  4FNF A;  3JAM L;  3AMU A;  4U68 A;  2DN8 A;  1EY7 A;  2VXW A;  4HN7 A;  3SR1 A;  5C3X A;  4K5V A;  4TQU S;  3J7Y W;  3W2D A;  4PMW A;  3A7L A;  1LTT D;  1WTO A;  4M1U B;  1RTN A;  3QWN A;  2NN6 G;  2XRS D;  5EJW A;  3CRK C;  2B2U C;  1R4P B;  4KHV A;  2VUM B;  5I2X A;  1BO0 A;  3K57 A;  1Q1B A;  1DM0 B;  2NVY B;  3RLF A;  5IGB A;  1STB A;  3UI2 A;  1GHK A;  1R4Q B;  4C1N I;  1RF2 D;  4ABN A;  5IGE A;  3I70 A;  2OEO A;  1QJO A;  2KOL A;  1K8O A;  1VMC A;  2CQA A;  2L0C A;  1CQF A;  2K04 A;  2QEJ C;  1TS5 A;  2MPM A;  3FKI B;  3KBG A;  5E4W C;  2QDB A;  4CJ1 B;  2F4I A;  1ROD A;  3TP7 A;  2AQ1 B;  1WTQ A;  2EVB A;  5K5P A;  3QB3 A;  3G6J B;  2LY7 A;  3WDN A;  1V1P B;  2LFN A;  5EKK A;  2CW0 C;  2R7Z B;  2TSS A;  1JCK B;  2EY2 A;  3GTL B;  5E1F A;  3K7A B;  4G4K A;  3AB9 A;  5DNF A;  3GTJ B;  2XWB B;  3NUC A;  1QB5 D;  1Q3L A;  5FO8 B;  4KD3 A;  3A54 A;  4U67 3;  2BA0 A;  3PUY A;  2MJ8 A;  3J80 E;  1NAP A;  3BYY B;  4L63 B;  1LLR D;  2NYZ D;  1TU2 B;  2F0T A;  4MN3 A;  4FP5 D;  3VYU A;  4XTC S;  1PZK D;  3NWS A;  4OIK A;  1ICW A;  1IYU A;  2WAC A;  5CV7 A;  2EJG C;  2B8F A;  2OXP A;  5CV4 A;  2PMZ B;  3HG9 A;  1HHV A;  1LO5 D;  3G7L A;  1CI3 M;  2OT2 A;  2B2V A;  1PRT F;  2EY5 A;  4B9W A;  3FPP A;  1H9S B;  4RA8 A;  5IIF A;  2EZV A;  2F0I A;  1SND A;  5J39 A;  1EZ6 A;  5ISR A;  4RFB A;  1HQM C;  4OGQ C;  3GQB A;  4ULL A;  2KEE A;  1QG7 A;  1PDQ A;  1RD9 D;  1RHP A;  2XNA C;  4BS9 A;  1STN A;  3VR3 A;  2B2T C;  2B2Y C;  2Z8L A;  3H6M A;  3I4L A;  2M9V A;  5C4H A;  2F3W A;  3OHX C;  5JVH 3;  4H7B A;  1W6J A;  4H44 C;  5DAU A;  1EQV A;  1LTA D;  4CHT B;  1SEB D;  4EQO A;  5T1G A;  5I6W A;  2KED A;  1WVL A;  2EYF A;  3GV6 A;  2F0H A;  2B39 A;  5D3D A;  3VYT A;  1S5C D;  3RZD B;  3NTI A;  2K6A A;  5M5W B;  4DA2 A;  4C3I B;  3DEO A;  4FF2 A;  4KY7 A;  1IW7 D;  2F0L A;  5D3I B;  2EE1 A;  5E3F A;  3L7Z C;  1VDZ A;  3P75 A;  2E2J B;  1FNU A;  3EFX D;  3HS0 C;  1WTX A;  4KMU C;  2A6E C;  1CTM A;  1UUP A;  2SEB D;  3R2I A;  1PFM A;  3MC0 B;  3V2T A;  1II3 A;  1GHJ A;  3FEW X;  1TWF B;  4XT1 B;  4OHJ A;  5DM7 3;  3C2P A;  4PV1 C;  5T1I A;  4H0L C;  2X6L A;  1Y1V B;  2WAQ B;  3OPO A;  1LTS D;  2PZW A;  1F2M A;  3DEP A;  3LWU A;  4HR7 B;  4EVO A;  1CQV A;  1K8M A;  1EU3 A;  2BE5 D;  3KUP A;  1CHQ D;  1JOK A;  1JOR A;  3I8Z A;  2JEA I;  4N9T A;  2K1B A;  4HAE A;  4WOR A;  3OW7 A;  4F8M A;  1ZKO A;  4BWG B;  3Q0A A;  3NQI A;  2R3Z A;  1NUC A;  5JEA G;  5EPL A;  1KNE A;  1A3V A;  3M85 A;  5C4J B;  1OO9 B;  3TBI B;  2IPK D;  1TWC B;  2M2L A;  1U4L A;  2MHV A;  2R6G A;  3GTQ B;  1KLG D;  4CJ0 B;  1BCP F;  2JA6 B;  3S1Q B;  2D5D A;  1BQQ T;  1SNC A;  3MXG A;  1B2T A;  4A93 B;  4X3S A;  4HMJ A;  1HXY D;  3FMC A;  3NK9 A;  2RQX A;  1G2S A;  4KD4 A;  4A3I B;  4DXF A;  1YNJ D;  1F9Q A;  3K59 A;  5M3F B;  1QE6 A;  2PZU A;  1SNO A;  4QF4 A;  4OO1 H;  4A3E B;  3Q23 A;  2C9O A;  1L0Y B;  1CHP D;  1KDA A;  4PNY A;  3W3A A;  3VR6 A;  3J81 L;  1BNZ A;  4ZKC B;  1TY0 A;  4PQX A;  5COY A;  2PNR C;  4JK1 C;  3HOU B;  2EOT A;  1IYV A;  2NVX B;  3VR2 A;  1HRJ A;  4OIJ A;  1PZI D;  2MUY A;  2M00 A;  4FF4 A;  2OF1 A;  2IW3 A;  4KKT A;  2XRQ D;  4I65 A;  1SYD A;  2IJ0 A;  3K5L A;  3VYR A;  1QWY A;  3H09 A;  4IFD I;  1DD2 A;  5ELF A;  5IGG A;  2E74 C;  1W6K A;  3VYS A;  1F9R A;  1UNS A;  4IUR A;  1Y8O B;  1IL8 A;  5JPN C;  4WFN 3;  1M8A A;  2RSN A;  4ZK9 B;  5JJZ A;  1ZYR D;  2ICI A;  3QJY A;  1GUS A;  3BDC A;  1LT6 D;  1JWM D;  3K5O A;  5M5Y B;  3S9W A;  2IX1 A;  4K5W A;  3I91 A;  1JOO A;  2AWO A;  4G57 A;  1XXG A;  2DNC A;  2BA1 A;  3EVQ A;  1IW7 C;  1PFB A;  2F0O A;  1NSN S;  4X3K A;  5EPJ A;  3X3N A;  2WV6 D;  3BG3 A;  1EIH A;  1ENA A;  2NTT A;  4KN4 C;  4K8I A;  1LTG D;  4CGY B;  2BDO A;  4KTA A;  4IUT A;  3J7A F;  3QOL A;  3KLR A;  1LT4 D;  4A3G B;  4RWS C;  3BVZ A;  5C4Z A;  2ENB A;  5FO9 B;  4Q5V A;  1MGS A;  1HPC A;  2A69 D;  1BUV T;  3LX0 A;  3OWF A;  1FR3 A;  5BN5 A;  4MHE A;  5D65 A;  3D4W A;  1ENC A;  2ZT9 C;  1G91 A;  1KDB A;  1STY A;  1KNA A;  5CC4 A;  5COR A;  1PRT B;  4DU9 A;  3OOC A;  2BE5 C;  2F0G A;  3PIO 3;  1F2Z A;  4FYD A;  2IL8 A;  1FNW A;  4CKC A;  1I50 B;  1RTO A;  4XT3 B;  1F77 A;  4C3H B;  2BOS A;  4Z9C B;  4PMC A;  5IOD A;  4J8Q A;  1ML0 D;  3DM1 A;  4Y7N B;  4ZAI A;  3PUX A;  3BS1 A;  5DEH A;  4J1M A;  3H94 A;  1F2Y A;  1V8Q A;  3E0J A;  1I4X A;  1NR4 A;  3SK8 A;  3I4M B;  1ESF A;  3TME A;  1XYI A;  1A3T A;  4F7X A;  1ILP A;  4DNR B;  3MXP A;  1YNJ C;  1B50 A;  1EYA A;  3KF8 A;  4KK7 A;  4BA1 I;  5A2Q L;  2F0F A;  4WJW A;  3OIP A;  4J6H A;  1D5M C;  2D9U A;  3BVG A;  1B4O A;  3DWQ A;  2RSO A;  1SFO B;  4DF7 A;  3V96 A;  4ZUJ A;  2FHT A;  4C3I G;  4DNT B;  5G3L D;  4RGO S;  1GUN A;  5EQ0 A;  1LAC A;  5ELC A;  2F0N A;  3HOZ B;  2F0D A;  4B08 A;  1S5F D;  4O42 A;  1Z7T A;  1OXX K;  2B2V C;  5FLX L;  1TVX A;  4IN3 A;  3FVQ A;  1SE4 A;  1O7L A;  4KJO A;  4JBW A;  3MAQ A;  4OL7 A;  2R61 A;  2K5W A;  4ZRZ A;  4IFD G;  3CU7 A;  4RGT A;  3ERQ A;  3MVV A;  2G9D A;  3T56 B;  3SVM A;  3CQZ B;  3HP3 A;  1MSH A;  4IUV A;  2RKS A;  1SNP A;  1ZYR C;  5K36 G;  5ELB A;  2AQ2 B;  4X3U A;  1GOZ A;  1S5B D;  1HFG A;  3S1N B;  4R8I A;  2TMP A;  2F0J A;  1A3U A;  1FD7 D;  1SJH D;  2K5D A;  1NCV A;  3TZU A;  4A3B B;  1I4Q A;  2ICE C;  2B2W A;  2A68 D;  5C0X H;  5KEE A;  1J8I A;  4K2L A;  4UDU C;  1KTK A;  3S16 B;  2QIL A;  5I2Y A;  3A55 A;  4C56 C;  1G29 1;  3MA2 B;  3P1H A;  3P20 A;  5CBE E;  5M9O A;  1B9M A;  2QKI C;  2A69 C;  1RKN A;  5EBC A;  4QMG A;  1ESR A;  5IT9 E;  1I4P A;  2NN6 H;  1TQO A;  2I07 B;  1HUM A;  1EYD A;  4A3M B;  3A56 A;  3TSS A;  2F0E A;  4RHS A;  4RH6 A;  4EQN A;  1D6E C;  4DFA A;  3D4R A;  3R8B A;  3P7J A;  1H9K A;  2RA4 A;  4KJN A;  1FYC A;  2GA4 B;  5C6A A;  2C5C A;  1GUO A;  1HCZ A;  1PZJ D;  3KLS X;  2SNM A;  5CYU A;  3QO2 A;  3OWE B;  3PO3 B;  1TT2 A;  1O7Y A;  1O80 A;  1A2T A;  2N88 A;  3IFT A;  2NBF A;  3PO2 B;  2H4O A;  1H9J A;  1SBB B;  1ZEQ X;  1A15 A;  1BDO A;  2K7V A;  1U9R A;  1AN8 A;  2ZXR A;  2D2C C;  5JPM C;  3MTS A;  3U9O A;  1S5D D;  3NTK A;  4QB4 A;  4HTH A;  3URY A;  1QOH A;  3A8K E;  1X3P A;  1GXD C;  3HKZ B;  4F87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...