1SNDA

Staphylococcal nuclease dimer containing a deletion of residues 114-119 complexed with calcium chloride and the competitive inhibitor deoxythymidine-3',5'-diphosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE DIMER
publication title One-step evolution of a dimer from a monomeric protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sndA00
5EKLA 3OWFA 2F0GA 3TP8A 5C6AA 5IGFA 1ENAA 2F0SA 2PW7A 3C1EA 4K2KA 4EVOA 2F0DA 1KDCA 4KJNA 5IGBA 1EYCA 1STHA 1SNOA 3EJIA 1EY6A 4EQOA 3U9OA 3QB3A 2LKVA 3MHBA 4ME5A 4N9PA 4PNYA 3RUZA 2F3VA 4J1MA 5CV4A 5KEEA 4IUNA 3DMUA 1SNMA 1STAA 1ENCA 4K5VA 1U9RA 2PYKA 2RBMA 4OL7A 4K8JA 4ZQ3A 4KHVA 5M9OA 3OSOA 4I65A 4ZUJA 4EQNA 2F0NA 2SOBA 3NP8A 5IODA 5CV8A 5NUCA 4KJOA 3SK6A 5IGGA 4DF7A 1EQVA 3NK9A 2M00A 2F0TA 3DHQA 4KY5A 3VA5A 5KYIA 2F0KA 1JOQA 2F0PA 1SNDA 1STYA 2PZWA 4NDXA 1RKNA 1SYFA 1SNQA 3OMGA 4K14A 1TR5A 5CV5A 4EQPA 5I6WA 5J22A 2RDFA 3HZXA 4H7BA 3S9WA 5CV9A 1IHZA 4ODGA 1NUCA 2SNSA 5CGKA 4DFAA 5DAUA 1EY5A 5CR3A 5IOCA 1A2TA 3MEHA 4K8IA 5CV7A 5K5PA 1EYAA 4J6HA 4KV6A 4K6DA 1EZ8A 2F0OA 2F0HA 1JOKA 2EY2A 4B9WA 3E5SA 3MVVA 4KD3A 5I9OA 5IGDA 3D6CA 2F0EA 3SK5A 4DU9A 5C3WA 4PMCA 2OXPA 2PZTA 2EYHA 4KY7A 2PZUA 4QF4A 3TP6A 5HURA 1A2UA 1KDBA 1EY8A 1F2YA 2PW5A 1II3A 1SYDA 5KIXA 2EYLA 1KDAA 1TQOA 4HMIA 4N9TA 4IZ8A 5C4ZA 4HMJA 2F0WA 2ENBA 2EYMA 3H6MA 2RKSA 1A3UA 5J39A 2EYJA 2NUCA 4QMGA 1SYBA 4NP5A 2F0JA 2F0IA 4F8MA 3NQTA 5CV6A 4RKBA 5IGEA 4F7XA 2EYPA 1A3VA 1STGA 3C1FA 4TRDA 3SK4A 1F2MA 5E1FA 1TT2A 5I9PA 3T16A 2F0QA 1NSNS 1STNA 2F0MA 2OF1A 2F0VA 3MXPA 3EROA 4ID6A 5C4HA 3P1HA 3D4WA 5KYLA 2EY5A 4KD4A 2WACA 4WRDA 4KY6A 5C5MA 2EXZA 4MIUA 2F3WA 4R8NA 1EY7A 4QB4A 5EKKA 1SYCA 5J1ZA 4ZUIA 1EY9A 5JOBA 5E3FA 5F2DA 2HQEA 3LX0A 3P75A 4G57A 4K2LA 3TP7A 3NXWA 2KHSA 4LAAA 3SR1A 4KTAA 4RKLA 2EY1A 2F0LA 3EVQA 3ITPA 4B9XA 5KGUA 1F2ZA 3BDLA 3D4DA 3TMEA 3R3OA 3TP5A 4HTHA 5CC4A 1KAAA 3T13A 4NKLA 2F0UA 3SK8A 3OMCA 3SHLA 4YIJA 3SXHA 5IIFA 1EY4A 3PMFA 3D8GA 3BDCA 5HGTA 1JOOA 1SYGA 2EYOA 3MZ5A 3HEJA 1SNPA 4WORA 2QDBA 3V2TA 1A3TA 5ISRA 3NHHA 3ERQA 4K5XA 4PMBA 1KABA 2SNMA 1EY0A 3QOJA 4NMZA 2F0FA 3NUCA 2EYFA 2OEOA 1EZ6A 4IALA 2EY6A 5JAVA 5KRUA 5C3XA 1AEXA 5EGTA 4DGZA 4E6IA 5DEHA 1SNCA 5C5LA 5IGCA 2PQEA 3QOLA 4K5WA 1SYEA 5I6YA 1STBA 4S3SA 2O4XA 1JORA 1EYDA 2KQ3A
chains in the Genus database with same CATH superfamily
4IPDA 1VQKA 4HIDA 2YU9H 3A7LA 2O2LD 4EVOA 2UUBQ 4Z9CB 3IAYA 1ICFB 1EYCA 1STHA 5IY0A 2HQLA 2LKVA 2BDNA 4HJ7A 2H4OA 4BWGB 4K8JA 5JEAG 3I8ZA 5M5YB 4R9WA 1CA5A 4RGMA 3J80E 2MPMA 5KYIA 2DNEA 1STYA 2ZTDA 1O7YA 2ID0A 3HKZG 4PQXA 2F3IA 1D8LA 3HRZC 3S1NH 4HCEA 1IBML 1A2TA 1XPOA 3TQYA 4UHVA 1ZYRD 2NVTH 1BVSA 5EKIA 5IT9E 2WAQG 3G4SA 1L0WA 4DXGA 1PV4A 1CTMA 2B63H 2VQFL 2A68D 3K5MA 4JC0A 4DKAC 4A3FB 1FGUA 4DV3L 4DV1L 2JSOA 5DNFA 1XMQL 4X66Q 4KLKA 3KFUA 3IFDA 3ND8A 1HFGA 5FLXE 4NP5A 2OQKA 3KLWA 2UXBQ 1EIFA 2IPKD 2UU9Q 3CQZB 1QJOA 1S40A 1Z9FA 3SK4A 1C48A 5E1FA 3K7AB 3T16A 1WTVA 4ZRZA 1LT3D 3X3MA 2Q2TA 2R93H 1X65A 2VZAA 4GS3A 1HA6A 1JJGA 5F2DA 2WFWA 4KTAA 4CJ0B 4NPSA 1CQFA 3KUPA 3T4AC 3ITPA 4DV6L 1LTRD 3MXNB 1Z47A 3CCRA 1VQAA 3HS0C 4G4KA 1OXUA 1AN8A 1UAPA 1OXVA 3CC2A 1GUOA 5E4WC 2HDLA 4JI6L 1NR4A 4UP7A 3QR8A 3TBIB 4WJ3M 2PQAB 3ERQA 2RCFA 4YWLA 1LT6D 2NTTA 4P73A 3GTLB 5ELCA 1EZ6A 5JAVA 3KLSA 3GTQH 4FO2A 3QIAA 3RMHA 5DM73 4RMFA 1SYEA 4NXMQ 2HT1A 1XPUA 1EYDA 1K3RA 2B2WC 4QUCA 4DV7L 2F0GA 4M8AA 2VXWA 3HOWH 3FKIG 2C5CA 1L0XB 3MHBA 4J1MA 3KF8A 4C56C 3CCQA 1ENCA 5IP7H 3G71A 2B8FA 1KNEA 1PH7A 2JA6G 1QUQB 2D5DA 2ZJQA 3M85A 5IODA 4KJOA 3F1ZA 1YZ6A 2X69A 2F0TA 3CD6A 2IHFA 3J80c 1XWEA 1LTID 3A7AB 2KEDA 2O5JC 4LF8L 3EBEA 2TSSA 1CI3M 4BXXH 4ZCKA 1EYGA 4BY1B 2Z8LA 2BOSA 5DAUA 4GKKQ 4K8IA 1HR0Q 4LF9Q 4KHPL 4DAYA 5IT9c 1B7YB 1LTSD 4Q0FA 3S16H 4MHEA 4ZLTF 2OXPA 4JI0L 3TP6A 1LO5D 2A69D 5HURA 1F2YA 2X6GA 4C3JG 4GZYC 1N32Q 4DAMA 2X6LA 5FO9B 2E2DC 3NTHA 1EEID 2F0JA 1V9PA 5FLXc 3VR5A 4O1NA 1PTOH 5FLMG 3NBHA 1IBKQ 2JEBI 4ALPA 3HOWB 1HH2P 1KAWA 5C5MA 3DWAA 4A3CH 1R4PB 2K5DA 4AQYL 3SR1A 4CDFC 1YHAA 1KHIA 1TU2B 1Z7TA 1J9OA 2N55A 3C2PA 1Q8IA 4GN4B 1V1OA 5CC4A 4P74A 2Y0SE 4BY1G 1XNRL 4YWMA 1EY4A 4BY7H 2EDGA 5CMDA 1U5KA 2NB0A 1CQVA 3QOJA 3E9IA 3NUCA 4NMZA 2K14A 2NTSA 3RLOA 5KRUA 2KCCA 4IURA 3KBXA 2CQOA 2MFIA 1RCVD 2RSOA 5TSSA 2HHHL 1Y1WH 1JORA 1PXUA 3H91A 4L63B 2KQ3A 5EKLA 4DR2Q 1EFID 2MP1A 1LTAD 2PW7A 4JBWA 4FXDA 1PYWD 2DJGC 1PRTF 3EJIA 1G51A 1S5BD 4H0LC 2CCZA 4IFDI 5KEEA 2QCPX 4IUNA 3VDYA 2NVQH 1KXLA 1RODA 5LMNL 2QGQA 1X6OA 3S1QB 1BR9A 1BUVT 1JWMD 3I2ZA 4A3DH 4B3ML 5T1IA 4QQBX 4PG3A 3SK6A 4DF7A 3DHQA 2K1BA 1EU4A 1A15A 2F0PA 1JICA 2P5ZX 3I7FA 1VQPA 1BBXC 4OELB 4BA2I 3GO5A 1XTCD 4EQPA 3WOFA 1HTLD 5CORA 1IHZA 2K75A 4GNXB 2Q2UA 4DFAA 3RLFA 5I2YA 3U4VA 5AJ3L 4KV6A 2AHOB 1QNUA 1A63A 1GJXA 4L5TA 4DNIA 3UDGA 3BDOA 1M8AA 1JE5A 1X55A 1QG7A 3KDFB 1KD1C 2UUAL 3AEVA 2N78A 3S1MH 1LABA 5KIXA 1DCZA 2F0WA 4JV5L 2UXDQ 2NUCA 4ZK9B 3DM3A 4CKCA 1NCVA 2D0OA 1HCZA 2HCIA 4PZ7A 3CCLA 4V190 5IYBH 3BJUA 1Y1WB 3NSWA 1MD2D 2VQFQ 4DUYL 1M90C 1GXDC 2PMZE 1IXRA 4ZUIA 4UPAA 4DA2A 3FP9A 1XMQQ 2NVQB 3ER0A 3EVQA 5GROA 1PH6A 3A5ZB 4A3DB 3OIPA 4LMQD 3DEPA 4L5SA 4GLXA 1BCPB 4A3BG 5FJ8H 2NN6G 2BE5C 5IYDG 1JOOA 3J81E 1CZWA 3F2CA 3T1HL 4B3TL 1VQNA 4K5XA 4BBRH 5FOBB 2CWPA 4IJHA 3NWTA 1E1TA 4JBKA 3GDEA 1S3OA 5C0XG 1STBA 1VMCA 3H09A 2C35B 4ZAIA 1X3FA 3S1MB 1D5ZC 1BKBA 3C1EA 1TWCB 1N33L 1D2BA 4JI6Q 4PNYA 1K0RA 3K5LA 2I5LX 4KN7C 2Z4HA 1CM9A 1XYIA 4MTNA 1G291 1W6JA 1SLJA 1JOQA 1HFNA 1LTGD 2BDOA 4NDXA 4DV7Q 1LTTD 2Q8RE 3MEFA 5J22A 2A73B 3S9WA 2B2TA 5KNCA 4QY7A 3FMCA 2G9DA 4RG1A 4UDUC 5CV7A 2I5HA 1CHQD 3AYHB 4KKUA 4LF6L 5G3LD 4AYBB 1H9SA 2BCOA 1XXGA 1EL0A 1PYBA 2EYHA 3NPPA 4LF8Q 2A5HA 1CSQA 4DK0A 1TQOA 2ZXOA 4IZ8A 1ILQA 1EUJA 1PH8A 3A54A 4BA1I 2JE6I 1DJRD 3CMEA 1DOMA 3PUZA 4C3HH 1HNZL 5K36H 4V0BA 1NR2A 2NYZD 4KHPQ 5IGEA 1U4MA 1JB3A 5I9PA 1BQQT 2K5QA 2Z4IA 3J7YW 5M3FB 3VA7A 4JI5Q 3TDQA 4OXPA 4JI0Q 3CRLC 1C0AA 4HCSA 1SYCA 2NWGA 5DLQE 2OT2A 2KEEA 2AMCB 3G48A 1N9WA 4G57A 2LS01 4L5RC 1VQGA 4A3IH 2N3SA 2B29A 1IBLQ 3S15H 3D4DA 5GADC 1PTOC 4LW1A 2F4VQ 4Y7NH 4OIKA 2JQOA 5LL6S 2K01A 1PRTD 4JCVE 3SHLA 4HIKA 1TWAH 1SE4A 4AYBG 1SNPA 3J7A5 5EAYA 4ME3A 3CAMA 1R9TB 4GNXC 2UUCQ 2EJGC 1F9SA 1V1QA 4AQYQ 1QCBD 1B3QA 3KK7A 4ILWA 2NVXH 1STEA 4DGZA 4JI2Q 4IUUA 2MO1A 2NVYH 1KNAA 1JJ2A 3KJOA 2HDMA 3CHBD 1BNZA 1CUKA 1I3QH 3STBC 4EQOA 4LF5Q 1EY6A 1L1OA 3I70A 4OWWB 2SEBD 5M3FG 3I4OA 4KKSA 1TWHH 1W2BA 4NXNQ 4JI8L 1YEZA 2EOTA 3NTIA 5CV8A 2HHHQ 1EQVA 3KYHC 1SROA 2ZT9C 4CGYB 2O5IC 2PZWA 1TR5A 1FGBD 3GP7A 4ODGA 4DUZL 4XQQA 2HIVA 2FMCA 2B2WA 1B70B 1GD7A 2BH2A 1RHPA 4LF4L 1E2WA 4Y7NB 5JEAH 1T5EA 1A6XA 3GTKH 1BCPC 1SR3A 5IGDA 1B9NA 1H95A 4ZKCB 4CHTB 3PO3G 3MTSA 5ELEA 3JAML 1EWIA 3GTGB 1VQDA 1TWAB 1YNNC 3NTKA 1DGSA 5IYCG 4N9TA 2M2LA 4UAIA 1UWVA 2ENBA 3EQLC 2RKSA 2EYJA 1Q1BA 2NVXB 2JP1A 4JI3Q 1VQFA 1PZID 4IO9A 5AJ3Q 2RSNA 3E3XA 3J80i 2R61A 3LWEA 1EOVA 4ID6A 2E2HB 2UUAQ 5GQOA 1I3QB 4KY6A 4FF4A 3GD7A 1PFSA 2R6GA 4MN3A 1I50B 2HQEA 4JV5Q 2B2UC 2K5HA 4M1UB 1TWHB 2I46A 1J5EL 2NN6I 4R4CA 3PIO3 1S72A 1XPRA 3R3OA 4CDEC 3BVMA 1HPCA 3OMCA 1PTOF 1TWGB 3L3OC 5I2XA 1VQCA 3JC66 2FXQA 2RHQB 2RDGA 2QDBA 5A2QE 5JVH3 1PH1A 1MGSA 3FPPA 1Q8KA 4DR3L 4DR4Q 2EE1A 3WWVA 3GTKB 5C5LA 2PQEA 3TS0A 1U4LA 3HKZB 3PIPA 4R8NA 2XSCA 4X64L 3D6WA 5IGBA 1BXTA 1NAPA 1I4HA 2L9HA 3H0GH 3SVMA 3T1HQ 2F03A 1KC8C 1SE8A 4KKTA 2Q8IB 4C3IB 3CW2C 4GOPC 2PYKA 2RBMA 3K57A 2IW3A 2YTXA 4A3MG 1G2SA 4U68A 3NP8A 4PV1C 4CKBA 4O0AA 4OWXB 3ICEA 5JJLA 2IX0A 1SYFA 2B2TC 3FKIH 3CQZH 3GTMB 4I7ZC 3K7AH 3RR5A 1N33Q 3R8BA 3R2TA 1JQYD 1U4RA 5IOCA 4OO1G 1FJGL 2RHSB 3URYA 2E5LQ 2JA6H 4DV5Q 4K6DA 4JOIA 2F0OA 2LSSA 1NE3A 2A6EC 4JYAL 2R92B 3SEBA 1KLUD 1MSGA 1YNJD 1YJ9A 3CCEA 5LMNW 1TY2A 4X62L 3KLRA 4A3KB 3U50C 4XYQA 1GHKA 5IP9G 3H6MA 3T53B 1EEFD 1C8CA 1B1ZA 2IX3A 1NMFA 3NQTA 4JVZA 3PQIA 5EBCA 1DM0B 4LF6Q 3GTLH 4LUVA 4C3IG 1SEBD 2JA5G 3MXNA 1DZ1A 1G8ZD 4A3GB 3HOVB 1LTBD 4C3JH 1EIGA 4ZKBB 3QG1A 1EY7A 2WB1E 3H0GB 3S14H 3I73A 2Q8TA 1QVCA 2R7DA 3PCOB 4DK1A 3I4NB 3U9OA 4QGUA 2EY1A 2XTIA 2UXCQ 2EIFA 3PIP3 3TMEA 2AUKA 3QO2A 1HNZQ 1ONLA 2PQAA 5FLMH 4HTHA 1VDZA 3D31A 4LFBL 4YIJA 5BR8Q 1SDFA 3FKIB 2VQEQ 4BS9A 1TY0A 2R92G 2G9HD 4WJ4A 2Z6KA 1X56A 1SFOH 4IPGA 3A5UA 2R3ZA 5H1SE 2SNMA 3S2DB 2QW7A 4LF7L 2QA4A 2JA6B 2EYFA 1VQ4A 4A3JG 4DNRB 1OXSC 5FLXL 4A3KG 1XNQL 3RN5A 1VQ9A 1YVCA 2N8NA 4BY1H 1PH2A 3OW7A 2A6HD 4JK1C 3QWNA 1K8AC 1QUQA 4OHJA 2ZXPA 1L1OC 5AFWA 1PA6A 2AQ2B 4N9PA 2B2YC 4A3GG 4IPHA 1HZBA 3HOVG 3GTJB 4GKJL 3H0GG 5CYUA 2F52A 4CDCC 4G7ZC 5IGGA 3I4NG 2JA8B 1I5FA 2ATWA 3ULPA 4C3JB 1KRTA 3ND9A 3WOEA 4C1NK 1D6EC 1L0YB 3S14B 2RDFA 3HZXA 2QKIC 2Y0SG 4UP9A 1ASZA 1Q12A 3GV3A 4DV0L 2PCFB 1UE6A 4I7AA 5I9OA 4JI1L 3C3LA 2KUMA 2EPBA 4DR7L 2E2IH 1BBWA 4OGQC 1SSOA 1BOSA 5D3DA 2AQ1B 3CCMA 3G7LA 1XMOQ 1K3BC 1KDAA 5C44B 2PO4A 1SFOB 3A0JA 2EYMA 3PUWA 5J3BA 4OONA 2EZVA 4JI4Q 1N34Q 1GUGA 2R7FA 5CV6A 1X3PA 4RKBA 1VS0A 2EYPA 1UE1A 2K03A 5D3IB 3Q23A 1G6ZA 1SJED 2WAQE 2SDFA 1AFPA 2E75C 5KYLA 2EY5A 3F2UA 2MGSA 2N88A 4RH6A 1ZKOA 2EQSA 1Y69U 4DAVA 3TP7A 2JA8G 1K0SA 4TQUS 2VB2X 1WTHA 3BS1A 1BBUA 1Q7YC 3ERSX 1HQRD 5COYA 3CCSA 3MFGA 4NKLA 1OTCA 3SK8A 4DK6C 4A3EB 1Q82C 3UDXA 3S1QH 1SMYC 3D8GA 5HGTA 3CKIB 2JEAI 2EJFC 1ZEQX 3STBD 1JMCA 2C9OA 5HY6A 4IN3A 1IYJB 1IYUA 1J5EQ 1RJTA 4E6IA 2WKCA 1O7ZA 5C44G 4A3BH 3K80C 1IW7C 3HOXG 1CKNA 1PFNA 2E2IB 2NN6H 5IYDH 3CCUA 4JI7L 3TP8A 2DNCA 1HZ9A 1HRJA 1KDCA 4KJNA 2IHEA 1I4XA 4EGVA 1PH9A 3RUZA 4L6TB 4CJ2C 1PHJA 1MI2A 2E76C 3T1YL 1VQ5A 4JPBW 1N36L 1Q1EA 4DR3Q 3UDIA 3KJPA 3OSOA 4EQNA 2F0NA 1VQEA 5C0XH 4GNXA 1PFBA 4HAEA 5C3EG 1NTGA 3GQBA 2LXJA 1SNDA 2NZOA 3J81i 4DR5Q 3OMGA 1O78A 3VYSA 3EFXD 4FP5D 1SBBB 4LFCL 5HGQA 2D62A 4AIMA 2JN4A 4A3EG 1RTNA 3WDNA 4JOIC 4UY8C 2N49A 3HOYB 2BA0A 2F0HA 4KI0A 1JOKA 2AQ3B 4HIMA 2VB3X 4CBVA 1ICWA 1CA6A 2RQXA 3S2HH 2F0EA 4DR6L 2XWJB 3U4ZA 4QF4A 1HHVA 1A2UA 3GV6A 1SYDA 4IUTA 4HMJA 1ENFA 1Q3LA 4A76A 3FRPB 1L2FA 3RZDB 4A3BB 3NE5B 3MXGA 1QZHA 1TT2A 1STNA 2I0QA 2F0VA 2GVBA 4ABNA 1SE2A 1FD7D 1SRUA 1VQ7A 2GVAA 3A8IE 4X62Q 4QB4A 3TZDA 3AFQA 5JOBA 3FEWX 1WJJA 4KHZA 3MAQA 2VUMG 1TWCH 2D2CC 1YI2A 4GN5A 4UP8A 5JEAJ 5LHY1 3DUZA 4NW2A 1K83B 4IFDJ 1IBMQ 2JYOA 3L7ZC 2Z9HA 3HOYG 1HZCA 1SE3A 4QIWB 1GUNA 4FNFA 2Z6KC 3HOZB 3I91A 4X65L 3NHHA 3NQIA 3I56A 3IRBA 4PMBA 2IT1A 5I4DA 1N8RC 4AH6A 1WD0A 3W1GA 4XQNA 4DV1Q 4DV3Q 1ZXTA 1HJPA 1AEXA 2L55A 4CDDC 5DEHA 3OTOL 4YCWA 1YITA 4CKEA 3S2HB 3QJYA 1YHQA 2B2UA 3K6OA 3VYRA 3OWFA 2B2VA 5C6AA 2IL8A 1ENAA 3PSIA 2MQHA 4XXEA 2CHBD 4O42A 1VQOA 1PVOA 4JG2A 3OWEB 4H02A 1WI5A 4K0KL 2RF4A 5GAHC 4HJ8A 2K5NA 1Q90A 1XNQQ 2SOBA 3NK9A 2KCMA 1RTOA 1V1PB 2F0KA 4RHSA 4DV6Q 1S5ED 4RFBA 2H5XA 5I6WA 3D3RA 1ZYRC 5EPKA 1VQBA 1T9HA 3E0EA 5M3FH 3MEHA 1QVFA 3M4QA 2FHTA 1VQJA 3HOZG 3K8AA 1C4QA 1FNUA 4XT3B 2R7ZG 4GKJQ 3K5OA 2FJ2A 3Q24A 5C3WA 4GOPA 2F1MA 4PMCA 2I07B 1FNVA 2M9VA 1BF4A 1B8AA 2NBFA 4OIJA 2MUYA 3TRZA 4MZ9A 2ZJPA 3J81j 1RD9D 5D14A 2K5WA 5DM63 3PO2B 2NZHA 4DV0Q 4XDXA 1PZJD 2JA7B 5GAEC 3CRKC 5C4JH 1R9TH 5JJKA 3PO3H 1WCMB 1HNWL 2XIWA 1F2MA 4JI1Q 3VYUA 5C4HA 1GUSA 3V05A 5M3MB 4KK7A 5IYCH 1S5FD 4XTCS 4BBSG 1DOKA 4K2LA 2K6AA 3BZDB 1RIPA 2AWNA 1HUMA 2XVSA 4A75A 2KCTA 1KAAA 1SJHD 1WOCA 2F0UA 3S24A 3SXHA 1CKMA 5EJWA 1SYGA 3S1RB 5EBDA 1NY4A 2A1AA 3HEJA 1EOTA 2CH4W 4WORA 5T1GA 3V2TA 1UE7A 4RGOS 3VR3A 1WFQA 4HIOA 4IALA 2QDLA 4L5QA 1Y1VB 3DWQA 1DXMA 1PZKD 1DD2A 1Y8OB 5JJZA 2K28A 1F9PA 3PO2G 4XIGS 4X66L 2CH4A 2JA7G 1EIHA 2NZ1D 4DNTB 3FVQA 4PMWA 3VR6A 2K50A 1WCMG 1SNOA 1O80A 4J15A 3CP0A 4RCNA 1LT5D 3GTGH 4F87A 4JBMA 5M3MG 2MNAA 3J81c 4ZQ3A 5C4JB 1HUNA 3PO3B 1E7ZA 4FYDA 1D1KA 1HXYD 4YCVA 4KY5A 4POFA 1V8QA 1LACA 3A55A 1FR3A 1RKNA 5CV5A 2IX1A 2Z6BA 3FDTA 4HJAA 1XNRQ 1MJEA 3PIOA 2I5MX 5LL6X 3M4PA 5CR3A 2E2HH 2Q2IA 3HGBA 4A3MH 1N36Q 1EZ8A 1I50H 1GVPA 1O7LA 2BH8A 1NBWA 1GM5A 2A69C 2B2YA 2RVLA 3Q22A 4QUFA 1KRSA 2PZUA 4HEDA 1Y1VG 4YCUA 1T5XD 1A8VA 5C4ZA 1TWGH 4LFCQ 4LNQA 4OO1H 1D7QA 1O7IA 1F9QA 1G2TA 3PV0A 5IE8A 4IOCA 4F7XA 3I4MG 1CK1A 3F2DA 2V1CC 1YJWA 2JXMB 1K8OA 4LJZC 5LMNQ 4DR6Q 1LTLA 1OXTA 1ML0D 4B3MQ 2FMMA 3OPOA 3RLNA 3K81C 5IP9H 1MSHA 5BN5A 3IKJA 3AU7A 3JAME 4DXFA 1B2TA 3RZOH 3NBIA 1V43A 3RD4A 3TZUA 2OTLA 1QWYA 1IW7D 3T13A 4C3IH 2JA5H 2KJXA 4TKOB 4IUQA 1HR0L 1GO3E 4R8IA 1KABA 3HG9A 4B3RL 1EY0A 2KOLA 3H15A 3GTMH 1K8MA 4A3MB 4R4TA 1ET9A 1J8IA 5C3XA 1SXTA 4K5WA 2O4XA 2B2VC 1JJCB 3KOJA 3T56B 1N32L 1FVIA 3BVGA 4IUPA 3CC4A 1TVXA 3A8JE 2R92H 1JWSD 1VF7A 3I3CA 3DM1A 2MHVA 4DUYQ 4P2CB 3GTPH 4ME5A 4X65Q 1EWCA 3BZKA 4AYBE 4GLVB 1GOZA 4A3JH 1ILPA 5L37A 1IBKL 4A3KH 5ELNA 1PRTB 1G6PA 5C0XI 1HTPA 5NUCA 5C4XB 4XT1B 4IOAA 5IWAL 2K33A 5JVG3 3CCVA 1VCIA 1E3PA 3TREA 1Q46A 3R2IA 1WVLA 1HNXL 3B6YA 1X54A 5D65A 4F88A 4A3GH 3RZOB 1DYQA 3HOVH 1TWFH 4TVAB 4K0KQ 2EVBA 2GA4B 3OOCA 4B3TQ 3E5SA 3I4NH 2IJ0A 4C2MH 1AZQA 2JA5B 4FXGC 3S17B 3T51B 2PNHA 1P8LA 1X3EA 3X3NA 4IJLA 3W5OA 2WV6D 3A56A 2D9UA 5EPLA 2PPBC 3H3VH 3E9HA 3Q6SA 2OCEA 2B39A 1PDQA 1ESFA 1PH5A 2OTJA 3S2DH 3J7AF 1WTQA 1YIJA 3LGJA 1TS4A 3HOUB 3HP3A 1LT4D 4LFAL 2L5TA 2EXZA 2KECA 1E2ZA 2HCCA 3GTPB 3SGIA 5JPNC 1WTRA 5C4XG 4RAUC 4B9XA 1BCPF 2DUDA 4LAAA 4DPGA 4RKLA 4A3JB 1ET6A 3W1BA 2F0LA 3JAMc 3M3YB 4A93B 4X3TA 2EJMA 1UE5A 3CPFA 3F8TA 1JWUD 1TS5A 1D5MC 3CU7A 1HNWQ 5IIFA 1AP0A 4POGA 4RGNA 3GTJH 1OXXK 3MZ5A 4R4QA 3KF6B 1JB7A 3ULLA 2JA8H 3J80L 2BE5D 3BYTB 1TWFB 4IFDG 4LWCA 1WTWA 1UNSA 2CVRA 4C2MB 2AUJD 1I4PA 3BG3A 1JC7A 2UXDL 2Y0SB 5IT9L 2L1BA 1TS2A 1XJVA 2F0DA 4HN7A 1RDPD 2WKDA 2ZTCA 1AE3A 3HOUG 1STAA 1UEAB 5C44H 1CSPA 3PF4A 4P75A 3I55A 4OX9L 2KHIA 3HOXH 2AWOA 3UDFA 1C9OA 3ULJA 3PUXA 2FFKB 1AW7A 4A93G 3TN2A 4K14A 3L9AX 4H7BA 2SNSA 1B9MA 4IPCA 1RF2D 1VMPA 2CWAA 3UE0A 4DR1L 1EQRA 2YU9B 3GTOH 4KD3A 3PGZA 5C3EH 1Z6HA 2PZTA 4X3KA 2KENA 1S5DD 1UEBA 1QOHA 2PW5A 2F4IA 3K0XA 3DLLA 4N8FA 4A3EH 1S5CD 3VYTA 5J39A 2VW9A 2CW0C 1DONA 4X3UA 3PUYA 2WIIB 1JT8A 3V96A 4DV2L 2F0QA 2F0MA 3I90A 3S1NB 4LUZA 2KA7A 4FF3A 3UI2A 5EQ0A 4JI8Q 2WACA 4XYOA 2NVTB 4A3FG 4JBJA 2F3WA 5EKKA 3BVZA 3D4RA 1RL2A 2DGYA 3LX0A 3P75A 2B63B 2YTYA 5A35A 2KBNA 5KNDA 5LMUL 1ESRA 1PRTC 3K58A 4X6AH 3HKZE 3HOXB 5BN4A 4DUZQ 2LMCB 1PTOD 4LF4Q 4A3LG 2K32A 1FYCA 3HFZB 2MO0A 3P20A 1Q81C 2PMZB 1KIXA 2G5DA 2VUMH 1F9RA 1Q86C 2R93B 3GTOB 4RWSC 1P16A 2IY5B 2MJ8A 5C3EB 1PFMA 1LLRD 4S3SA 3SDZA 3HOYH 3IL8A 2ZM6L 4HR7B 1CHPD 2J4XA 1K28A 3OIQA 5JPMC 3U58A 3QB3A 3K59A 2F3VA 4U673 1J6QA 4B3RQ 1SNMA 1B3AA 4JI5L 1DOLA 3MC0B 1CFMA 4RGTA 3NELA 2B63G 3PUVA 1U0LA 3VA5A 3MXUA 4PZ8A 1SAPA 3KF8B 3RZDH 2A8VA 2E8GA 4KMUC 5ELBA 2DY7A 1IBLL 5CV9A 2F4VL 3GTQB 2ZTEA 1C7YA 2H1EA 2K4KA 1M1KC 5FK9C 2BA1A 3MVVA 1EWHA 5G3LF 1VQ6A 3D6CA 4HSPA 4DU9A 1AH9A 2DJFC 4RCOA 5IWAQ 3O13A 2UUCL 1BCPD 2R93G 2LFNA 4A4IA 1KDBA 2J7ZA 3BU2A 1K83H 1II3A 1TS3A 4JI2L 4DAYB 1YNND 2VUMB 4OO1I 1HNXQ 1A3UA 4YHHL 1SYBA 2F0IA 4X64Q 3HOZH 2XN9C 2R7ZH 3KDFA 5M5WH 1E22A 5EPJA 1STGA 4TRDA 1TIID 4LF5L 1HA5A 2OF1A 3U9SA 3N52A 5FKAC 4FVMA 3MFYA 3AMUA 4WRDA 3P7JA 5GAGC 3TS2A 4NXNL 3I4LA 1EY9A 5E3FA 3H3VC 1YJNA 3TSSA 2KHSA 3S16B 1MBYA 3NBHB 2D0PA 1SN8A 3BDLA 3CPWA 1F2LA 1HQMC 4P71A 1EFWA 3UE1A 1FJGQ 2PI2A 3PMFA 1R4QB 3J7ZC 4JYAQ 1S4ZA 1VF5C 4IQZA 1CKNB 4BBSH 4LFAQ 4APVA 3HOWG 1Y8PB 3HKSA 5FO7B 5KNBA 1PTOB 2OEOA 4EQ5A 5IP7G 3VR4A 1WD1A 1GUTA 3QOLA 4HSVA 1I4GA 1H9MA 1LUZA 2OWOA 4OWTB 2VNUD 3M4OH 5IGFA 2LXKA 4YWKA 3J7AV 4JI3L 1QB5D 4C1NI 2OQ0A 3CC7A 1EU3A 1V1PA 1H9JA 4BXXG 5ELDA 1B53A 3DMUA 1HR0W 3NENA 3CXCA 4OL7A 1I94L 2R7ZB 4BY7B 4FXKC 5M5WB 4I65A 4ZUJA 2L15A 1PLFA 3LNNA 1IL8A 1LYLA 1E24A 2M00A 3PO2H 2HIXA 4FF1A 2JA7H 1KQSA 5ELOA 2TMPA 1WCMH 4PZ6A 1YNXA 2WP8J 2ZXRA 3KBGA 2JK8A 4DV4L 4LFBQ 5CGKA 1WYDA 1MHWC 4ULLA 5M3MH 1YNJC 4R1JA 2QF7A 1IKLA 2EY2A 3K7UC 4OX9Q 4LF7Q 3SE0A 1A62A 1H9KA 2A6ED 4KY7A 4BBSB 4DR4L 3AFPA 4KN4C 4CJ1B 2EYLA 4A3CG 2RCNA 4B08A 1A0IA 3H3VI 3S1RH 4GN3B 1TXYA 4F8MA 2B8GA 3AB9A 3VR2A 3J81L 2KVMA 2ZJRA 1W6KA 1QZGA 4DR1Q 1AE2A 3C1FA 3M7GA 2A68C 2YV5A 4LUOA 1NSNS 1IKMA 3M4OB 3EROA 3L2PA 3D4WA 1NNXA 1Y1VH 3L0OA 4RHRA 4BY7G 4KD4A 3A74A 1BO0A 1Y8NB 1BDOA 1YHBA 4B3SL 3CF5A 3NXWA 1I6VC 4YY3L 3F2BA 1VQMA 3CMAA 1F2ZA 3K5NA 1PH4A 1Y14B 1NJIC 2A19A 4QJFA 3TP5A 3I4MH 2K5VA 4MTKA 1Y1WG 2K05A 4DV2Q 1D5XC 1LV9A 2XGTA 4WFN3 2UUBL 3G6EA 1XTDA 1IL2A 2E5LL 2A74C 4DV5L 1FNWA 4DR7Q 1A3TA 3EN2A 4TSSA 1OO9B 1G91A 1B50A 2J0TD 1PH3A 2EXDA 5LMUQ 2A6HC 5JJIA 4R4OA 5EGTA 2CKZB 3W3AA 4O2DA 1SNCA 5IGCA 4QL5A 4A3DG 1QVGA 3I72A 5M5XH 1IZ6A 1U4PA 3W2DA 2F0SA 4EX5A 4K2KA 4HJ9A 4H13C 4P72A 4K6LA 3JAMi 4RA8A 5CV4A 4K5VA 3M7NA 2QEXA 1E1OA 3FPUB 4G7HC 2ES2A 2YYZA 2JJQA 1QNKA 4GLAC 2RA4A 1K9MC 4BBRB 4R4IA 4WJWA 5CBAE 2ZM6Q 1AZPA 2KCNA 2QEJC 2UXCL 4GOPB 4X3SA 1EQQA 1NUCA 1GUWA 2UXBL 1CZGA 2CW0D 5BR8L 4J6HA 2K7VA 2UU9L 2VQEL 4Y52H 3I4MB 4B9WA 5IYBG 1X3GA 2XNAC 2K04A 1PMRA 1B44D 5E7NA 1CKOA 1EY8A 1E2VA 1X32A 4HMIA 2Q2HA 1H9SB 4JI7Q 2K52A 2CFMA 1B4OA 2ICEC 3LWUA 1IYVA 3Q8DA 4DK3C 4QIWE 2L12A 3E6ZX 2ASBA 2CQAA 3T1YQ 5E4XA 4J8QA 5FJ8G 5M5XB 4JW0A 2XRQD 4OEMB 1X3QA 2WINB 4MIUA 1YBYA 2PI2E 4DAPA 2ALYB 1WTPA 4BBRG 1LM0A 2PNRC 1SMXA 1MIUA 1TKWB 1W3SA 4YHHQ 3M4YA 3N6RA 4NXML 5ELFA 2RDHA 3DEOA 5CBEE 3CCJA 4N8X1 1GHJA 1UUPA 4C3HB 5C4XH 2VY3A 1SMYD 2F0FA 2V4DA 2WB1B 5BN3A 2E2JH 1KLGD 2GN5A 1XMOL 1I6HH 1FL0A 1ASYA 1MKHA 3MWYW 4JI4L 4A3IB 3A8KE 1N34L 3RN2A 3R93A 3S15B 2LY7A 1EQTA 3EIVA 3E0JA 3S17H 4GKKL 4IFDH 4LF9L 1U9RA 1JR0D 1H9RA 4KHVA 5M9OA 3KLSX 1E0BA 4LK1C 1JCKB 3OW2A 1D1IA 2VS1A 3OHXC 3Q0AA 1L1OB 1QE6A 4Q5VA 2ICIA 1GKHA 1SNQA 1PYSB 2IWHA 2XRSD 1X9NA 2VL6A 1EIYB 3C46A 2NVYB 2L4NA 3HOUH 1EY5A 3PF5A 3M9BA 5K5PA 2Z0SA 1EYAA 3EA6A 1WTOA 4C3HG 2HD3A 1QILA 2DN8A 3NEMA 1I94Q 5K36G 1K73C 3G6JB 3H94A 4DN4M 3BYYB 1KTKA 1XX8A 3SK5A 3M3YH 1F77A 2WB1G 2Z1CA 4A93H 3RNUA 1I4RA 2KHJA 3OTOQ 4DV4Q 4HJ5A 4IUVA 4QMGA 5FO8B 3D0FA 3ONAB 4A3IG 2E2JB 1VQHA 1MJCA 3FHWA 2YTVA 1I6HB 4FDBA 3DWPA 1JE4A 5A2QL 1CT1D 1A3VA 5M5YH 3ZYYX 4G7OC 3MXPA 3IFTA 3P1HA 3BZCA 1K8GA 2HUGA 2XWBB 3ZJYC 1NMGA 5J1ZA 1VQLA 1WTXA 4ZYSA 2FINB 3NWSA 5ISRA 1HZAA 3K0YA 4MNOA 4QCLA 3KF6A 2B3GA 1VQ8A 2QILA 5KGUA 4H44C 2AKWB 3TEHB 2L11A 4DR5L 3OYYA 3DXJC 1KL9A 3MA2B 4DR2L 2DY8A 4L8JA 3BDCA 2EYOA 4A3FH 4FF2A 4XQJA 5C0XJ 2WAQB 1I4QA 2JA9A 1M4VA 4B3SQ 4YY3Q 3AQQA 2EY6A 2E74C 4NB3A 5I6YA 2L0CA 1VQIA 4A3LH
chains in the Genus database with same CATH topology
3A7LA 2O2LD 4EVOA 3IAYA 4Z9CB 1EYCA 1STHA 2LKVA 2BDNA 2H4OA 4BWGB 4K8JA 5JEAG 3I8ZA 5M5YB 4R9WA 1CA5A 4RGMA 3J80E 2MPMA 5KYIA 2DNEA 1STYA 1O7YA 2ID0A 4PQXA 3HRZC 4HCEA 1A2TA 1ZYRD 5EKIA 5IT9E 4DXGA 1CTMA 2A68D 3K5MA 4A3FB 2JSOA 5DNFA 3IFDA 3ND8A 1HFGA 5FLXE 4NP5A 2IPKD 3CQZB 1QJOA 3SK4A 1C48A 5E1FA 3K7AB 3T16A 1WTVA 4ZRZA 1LT3D 3X3MA 1HA6A 5F2DA 4KTAA 4CJ0B 1CQFA 3KUPA 3T4AC 3ITPA 1LTRD 1Z47A 3HS0C 4G4KA 1OXUA 1AN8A 1UAPA 1OXVA 1GUOA 5E4WC 2HDLA 1NR4A 3TBIB 3ERQA 1LT6D 2NTTA 3GTLB 5ELCA 1EZ6A 5JAVA 3KLSA 4FO2A 3QIAA 3RMHA 5DM73 1SYEA 1EYDA 2B2WC 4QUCA 2F0GA 4M8AA 2VXWA 2C5CA 1L0XB 3MHBA 4J1MA 3KF8A 4C56C 1ENCA 2B8FA 1KNEA 2D5DA 3M85A 5IODA 4KJOA 2X69A 2F0TA 1XWEA 1LTID 3A7AB 2KEDA 2O5JC 2TSSA 1CI3M 4BY1B 2Z8LA 2BOSA 5DAUA 4K8IA 4DAYA 1LTSD 4Q0FA 4MHEA 4ZLTF 2OXPA 3TP6A 1LO5D 2A69D 5HURA 1F2YA 2X6GA 4C3JG 4GZYC 2X6LA 5FO9B 2E2DC 3NTHA 1EEID 2F0JA 3VR5A 4O1NA 1PTOH 3NBHA 2JEBI 3HOWB 5C5MA 3DWAA 1R4PB 2K5DA 3SR1A 1TU2B 1Z7TA 1J9OA 2N55A 3C2PA 1Q8IA 1V1OA 5CC4A 1EY4A 2EDGA 5CMDA 2NB0A 1CQVA 3QOJA 4NMZA 3NUCA 2NTSA 5KRUA 2KCCA 4IURA 3KBXA 2RSOA 1RCVD 5TSSA 1JORA 1PXUA 3H91A 4L63B 2KQ3A 5EKLA 1EFID 2MP1A 1LTAD 2PW7A 4JBWA 4FXDA 1PYWD 1PRTF 3EJIA 1S5BD 4H0LC 4IFDI 5KEEA 2QCPX 4IUNA 1RODA 3S1QB 1BR9A 1BUVT 1JWMD 5T1IA 3SK6A 4DF7A 3DHQA 2K1BA 1EU4A 1A15A 2F0PA 1JICA 1BBXC 1K8OA 4BA2I 3GO5A 1XTCD 4EQPA 3WOFA 1HTLD 5CORA 1IHZA 4DFAA 3RLFA 5I2YA 4KV6A 1QNUA 1GJXA 3BDOA 1M8AA 1QG7A 1LABA 5KIXA 1DCZA 2F0WA 2NUCA 4ZK9B 4CKCA 1NCVA 2HCIA 1HCZA 4V190 1Y1WB 3NSWA 1MD2D 1GXDC 4ZUIA 4DA2A 2NVQB 3EVQA 4A3DB 3OIPA 4LMQD 3DEPA 1BCPB 2NN6G 2BE5C 1JOOA 3J81E 1CZWA 4K5XA 5FOBB 3NWTA 5C0XG 1STBA 1VMCA 3H09A 4ZAIA 3S1MB 1D5ZC 3C1EA 1TWCB 1D2BA 4PNYA 3K5LA 4KN7C 2Z4HA 1CM9A 1XYIA 1G291 1W6JA 1JOQA 1HFNA 1LTGD 2BDOA 4NDXA 1LTTD 2Q8RE 5J22A 2A73B 3S9WA 2B2TA 5KNCA 3FMCA 2G9DA 4UDUC 5CV7A 1CHQD 4KKUA 5G3LD 4AYBB 1H9SA 2BCOA 1XXGA 1EL0A 2EYHA 3NPPA 2A5HA 4DK0A 1TQOA 2ZXOA 4IZ8A 1ILQA 3A54A 4BA1I 2JE6I 1DJRD 1DOMA 3PUZA 5K36H 4V0BA 1NR2A 2NYZD 5IGEA 1U4MA 1JB3A 5I9PA 1BQQT 2K5QA 2Z4IA 3J7YW 5M3FB 3VA7A 3TDQA 3CRLC 4HCSA 1SYCA 2NWGA 2OT2A 2KEEA 4G57A 2LS01 3D4DA 1PTOC 4OIKA 5LL6S 2K01A 1PRTD 3SHLA 1SE4A 1SNPA 1R9TB 2EJGC 1F9SA 1QCBD 4ILWA 3KK7A 1STEA 4DGZA 4IUUA 1KNAA 2HDMA 3CHBD 1BNZA 4EQOA 1EY6A 3I70A 2SEBD 4KKSA 2EOTA 3NTIA 5CV8A 1EQVA 2ZT9C 4CGYB 2O5IC 2PZWA 1TR5A 1FGBD 3GP7A 4ODGA 4XQQA 2FMCA 2B2WA 1RHPA 1E2WA 4Y7NB 5JEAH 1T5EA 1A6XA 1BCPC 5IGDA 1B9NA 4ZKCB 4CHTB 3MTSA 5ELEA 3JAML 3GTGB 1TWAB 1YNNC 3NTKA 4N9TA 2M2LA 4UAIA 2ENBA 3EQLC 2RKSA 2EYJA 1Q1BA 2NVXB 2JP1A 1PZID 2RSNA 2R61A 3LWEA 4ID6A 2E2HB 1I3QB 4KY6A 4FF4A 3GD7A 2R6GA 4MN3A 1I50B 2HQEA 2B2UC 4M1UB 1TWHB 2I46A 2NN6I 3PIO3 3R3OA 3BVMA 1HPCA 3OMCA 1PTOF 1TWGB 3L3OC 5I2XA 2RDGA 2QDBA 5A2QE 5JVH3 1MGSA 3FPPA 2EE1A 3GTKB 5C5LA 2PQEA 1U4LA 3HKZB 4R8NA 2XSCA 3D6WA 5IGBA 1BXTA 1NAPA 1I4HA 2L9HA 3SVMA 2F03A 4KKTA 2Q8IB 4C3IB 2PYKA 2RBMA 3K57A 2IW3A 1G2SA 4U68A 3NP8A 4PV1C 4CKBA 2IX0A 1SYFA 2B2TC 3GTMB 4I7ZC 3R8BA 3R2TA 1JQYD 1U4RA 5IOCA 4OO1G 3URYA 4K6DA 2F0OA 2A6EC 2R92B 3SEBA 1KLUD 1MSGA 1YNJD 1TY2A 3KLRA 4A3KB 4XYQA 1GHKA 3H6MA 3T53B 1EEFD 1C8CA 1B1ZA 2IX3A 3NQTA 5EBCA 1DM0B 4C3IG 1SEBD 3MXNA 1DZ1A 1G8ZD 4A3GB 3HOVB 1LTBD 1EIGA 4ZKBB 3QG1A 1EY7A 3H0GB 3I73A 2Q8TA 4DK1A 3I4NB 3U9OA 2EY1A 3PIP3 3TMEA 2AUKA 3QO2A 1ONLA 4HTHA 1VDZA 3D31A 4YIJA 1SDFA 3FKIB 4BS9A 1TY0A 2G9HD 2R3ZA 2SNMA 3S2DB 2JA6B 2EYFA 4DNRB 1OXSC 5FLXL 3OW7A 2A6HD 4JK1C 3QWNA 4OHJA 2ZXPA 5AFWA 2AQ2B 4N9PA 2B2YC 3GTJB 5CYUA 4G7ZC 5IGGA 2JA8B 4C3JB 3ND9A 3WOEA 4C1NK 1D6EC 1L0YB 3S14B 2RDFA 3HZXA 2QKIC 1Q12A 3GV3A 2PCFB 5I9OA 3C3LA 2KUMA 2EPBA 4OGQC 1SSOA 1BOSA 5D3DA 2AQ1B 3G7LA 1KDAA 5C44B 2PO4A 1SFOB 2EYMA 3PUWA 2EZVA 1GUGA 5CV6A 1X3PA 4RKBA 2EYPA 2K03A 5D3IB 1G6ZA 3Q23A 1SJED 2SDFA 1AFPA 2E75C 5KYLA 2EY5A 3F2UA 2MGSA 2N88A 4RH6A 1ZKOA 1Y69U 4DAVA 3TP7A 4TQUS 2VB2X 3BS1A 1HQRD 5COYA 3MFGA 4NKLA 3SK8A 4A3EB 1SMYC 3D8GA 5HGTA 3CKIB 2JEAI 2EJFC 1ZEQX 2C9OA 4IN3A 1IYUA 1RJTA 4E6IA 2WKCA 1O7ZA 1IW7C 2E2IB 1PFNA 2NN6H 3TP8A 2DNCA 1HRJA 1KDCA 4KJNA 1I4XA 4EGVA 3RUZA 4L6TB 4CJ2C 1MI2A 2E76C 1Q1EA 3OSOA 4EQNA 2F0NA 5C0XH 1PFBA 4HAEA 3GQBA 1SNDA 3OMGA 1O78A 3VYSA 3EFXD 4FP5D 1SBBB 2D62A 1RTNA 3WDNA 3HOYB 2BA0A 2F0HA 4KI0A 1JOKA 2AQ3B 2VB3X 4CBVA 1ICWA 1CA6A 2RQXA 2F0EA 2XWJB 4QF4A 1HHVA 1A2UA 3GV6A 1SYDA 4IUTA 4HMJA 1ENFA 1Q3LA 3FRPB 3RZDB 4A3BB 3NE5B 3MXGA 1TT2A 1STNA 2F0VA 4ABNA 1SE2A 1FD7D 3A8IE 4QB4A 3TZDA 5JOBA 4KHZA 3FEWX 3MAQA 2D2CC 5JEAJ 5LHY1 3DUZA 4NW2A 1K83B 4IFDJ 2JYOA 3L7ZC 1SE3A 4QIWB 1GUNA 4FNFA 3HOZB 3I91A 3NHHA 3NQIA 4PMBA 5I4DA 2IT1A 1WD0A 4XQNA 1ZXTA 1AEXA 2L55A 5DEHA 3S2HB 4CKEA 3QJYA 2B2UA 3VYRA 3K6OA 3OWFA 2B2VA 5C6AA 2IL8A 1ENAA 4XXEA 2CHBD 4O42A 3OWEB 1Q90A 2SOBA 3NK9A 1RTOA 1V1PB 2F0KA 4RHSA 1S5ED 4RFBA 5I6WA 3D3RA 1ZYRC 5EPKA 3MEHA 2FHTA 4XT3B 1C4QA 1FNUA 3K5OA 2FJ2A 3Q24A 5C3WA 2F1MA 4PMCA 2I07B 1FNVA 2M9VA 1BF4A 2NBFA 4OIJA 2MUYA 1RD9D 5D14A 2K5WA 5DM63 3PO2B 4XDXA 1PZJD 2JA7B 3CRKC 1WCMB 2XIWA 1F2MA 3VYUA 5C4HA 1GUSA 3V05A 5M3MB 4KK7A 1S5FD 4XTCS 1DOKA 4K2LA 2K6AA 3BZDB 2AWNA 1HUMA 2XVSA 1KAAA 1SJHD 2F0UA 3SXHA 5EJWA 1SYGA 3S1RB 5EBDA 3HEJA 1EOTA 4WORA 5T1GA 3V2TA 4RGOS 3VR3A 4IALA 1Y1VB 3DWQA 1DXMA 1PZKD 1DD2A 1Y8OB 5JJZA 2K28A 1F9PA 4XIGS 1EIHA 2NZ1D 4DNTB 3FVQA 4PMWA 3VR6A 1SNOA 1O80A 4RCNA 1LT5D 4F87A 4ZQ3A 5C4JB 1HUNA 3PO3B 4FYDA 1D1KA 1HXYD 4KY5A 1V8QA 1LACA 3A55A 1FR3A 1RKNA 5CV5A 2IX1A 3FDTA 5LL6X 5CR3A 3HGBA 1EZ8A 1O7LA 2A69C 2B2YA 2RVLA 3Q22A 4QUFA 2PZUA 4HEDA 1T5XD 5C4ZA 4OO1H 1F9QA 1G2TA 3PV0A 4F7XA 1CK1A 2JXMB 4LJZC 1OXTA 1ML0D 2FMMA 3OPOA 1MSHA 5BN5A 3IKJA 3AU7A 3JAME 4DXFA 1B2TA 3NBIA 1V43A 3RD4A 3TZUA 1QWYA 1IW7D 3T13A 2KJXA 4TKOB 4IUQA 4R8IA 1KABA 3HG9A 1EY0A 2KOLA 1K8MA 4A3MB 1ET9A 1J8IA 5C3XA 1SXTA 4K5WA 2O4XA 2B2VC 3T56B 3BVGA 4IUPA 1TVXA 3A8JE 1JWSD 1VF7A 3I3CA 3DM1A 2MHVA 4P2CB 4ME5A 1EWCA 1GOZA 1ILPA 1PRTB 5C0XI 1HTPA 5NUCA 5C4XB 4XT1B 2K33A 5JVG3 1VCIA 1WVLA 3R2IA 5D65A 4F88A 3RZOB 1DYQA 2EVBA 2GA4B 3OOCA 3E5SA 2IJ0A 1AZQA 2JA5B 4FXGC 3S17B 3T51B 3X3NA 2WV6D 3A56A 2D9UA 5EPLA 2PPBC 3Q6SA 2B39A 1PDQA 1ESFA 3J7AF 1WTQA 1TS4A 3HOUB 3HP3A 1LT4D 2L5TA 2EXZA 2KECA 1E2ZA 2HCCA 3GTPB 5JPNC 1WTRA 4RAUC 4B9XA 1BCPF 4LAAA 4RKLA 4A3JB 1ET6A 2F0LA 3M3YB 4A93B 4X3TA 2EJMA 1JWUD 1TS5A 1D5MC 3CU7A 5IIFA 1AP0A 4RGNA 1OXXK 3MZ5A 3J80L 2BE5D 3BYTB 1TWFB 4IFDG 1WTWA 1UNSA 2CVRA 4C2MB 2AUJD 1I4PA 3BG3A 1JC7A 2Y0SB 5IT9L 2L1BA 1TS2A 2F0DA 4HN7A 1RDPD 2WKDA 1STAA 1UEAB 2AWOA 3PUXA 2FFKB 1AW7A 3TN2A 4K14A 3L9AX 4H7BA 2SNSA 1B9MA 1RF2D 1VMPA 2YU9B 4KD3A 1Z6HA 2PZTA 4X3KA 1S5DD 1QOHA 2PW5A 2F4IA 1S5CD 3VYTA 5J39A 2CW0C 1DONA 4X3UA 3PUYA 2WIIB 3V96A 2F0QA 2F0MA 3I90A 3S1NB 2KA7A 4FF3A 3UI2A 5EQ0A 2WACA 4XYOA 2NVTB 2F3WA 5EKKA 3BVZA 3D4RA 3LX0A 3P75A 2B63B 5A35A 5KNDA 1ESRA 1PRTC 3K58A 3HOXB 5BN4A 2LMCB 1PTOD 2K32A 1FYCA 3P20A 2PMZB 1F9RA 2R93B 3GTOB 4RWSC 2MJ8A 5C3EB 1PFMA 1LLRD 4S3SA 3SDZA 3IL8A 4HR7B 1CHPD 2J4XA 3OIQA 5JPMC 3QB3A 3K59A 2F3VA 4U673 1SNMA 1B3AA 1DOLA 3MC0B 1CFMA 4RGTA 3PUVA 3VA5A 3MXUA 1SAPA 4KMUC 5ELBA 2DY7A 5CV9A 3GTQB 2H1EA 5FK9C 2BA1A 3MVVA 1EWHA 5G3LF 3D6CA 4HSPA 4DU9A 4RCOA 3O13A 1BCPD 2LFNA 1KDBA 2J7ZA 1II3A 1TS3A 1YNND 2VUMB 4OO1I 1A3UA 1SYBA 2F0IA 2XN9C 5EPJA 1STGA 4TRDA 1TIID 1HA5A 2OF1A 3U9SA 3N52A 5FKAC 4FVMA 3MFYA 3AMUA 4WRDA 3P7JA 3I4LA 1EY9A 5E3FA 3H3VC 3TSSA 2KHSA 3S16B 1MBYA 3BDLA 1F2LA 1HQMC 3PMFA 1R4QB 1S4ZA 1VF5C 4IQZA 1Y8PB 5FO7B 5KNBA 1PTOB 2OEOA 3VR4A 1WD1A 1GUTA 3QOLA 4HSVA 1I4GA 1H9MA 2VNUD 5IGFA 3J7AV 1QB5D 4C1NI 1EU3A 1V1PA 1H9JA 5ELDA 1B53A 3DMUA 2R7ZB 4OL7A 4BY7B 4FXKC 5M5WB 4I65A 4ZUJA 1PLFA 3LNNA 1IL8A 2M00A 4FF1A 2TMPA 2WP8J 2ZXRA 3KBGA 5CGKA 4ULLA 1YNJC 2QF7A 1IKLA 2EY2A 3SE0A 1H9KA 2A6ED 4KY7A 4BBSB 4KN4C 4CJ1B 2EYLA 4B08A 4F8MA 2B8GA 3AB9A 3VR2A 3J81L 2KVMA 1W6KA 3C1FA 3M7GA 2A68C 1NSNS 1IKMA 3M4OB 3EROA 3D4WA 4RHRA 4KD4A 1BO0A 1Y8NB 1BDOA 3NXWA 1I6VC 1F2ZA 3K5NA 3TP5A 2K05A 1D5XC 1LV9A 4WFN3 2A74C 1FNWA 1A3TA 4TSSA 1OO9B 1G91A 1B50A 2J0TD 2A6HC 5EGTA 3W3AA 1SNCA 5IGCA 3I72A 1U4PA 3W2DA 2F0SA 4K2KA 4H13C 4K6LA 4RA8A 5CV4A 4K5VA 3M7NA 3FPUB 4G7HC 2YYZA 1QNKA 2RA4A 4BBRB 4WJWA 5CBAE 1AZPA 2KCNA 2QEJC 4X3SA 1NUCA 1GUWA 1CZGA 2CW0D 4J6HA 2K7VA 3I4MB 4B9WA 2XNAC 2K04A 1PMRA 1B44D 1EY8A 1E2VA 1X32A 4HMIA 1H9SB 1B4OA 2ICEC 3LWUA 1IYVA 2L12A 3E6ZX 2CQAA 5E4XA 4J8QA 5M5XB 2XRQD 1X3QA 2WINB 4MIUA 4DAPA 1WTPA 2PNRC 1TKWB 3M4YA 3N6RA 5ELFA 2RDHA 3DEOA 5CBEE 1GHJA 1UUPA 4C3HB 1SMYD 2F0FA 2V4DA 2WB1B 5BN3A 1KLGD 3MWYW 4A3IB 3A8KE 3R93A 3S15B 2LY7A 1EQTA 3E0JA 4IFDH 1U9RA 1JR0D 1H9RA 4KHVA 5M9OA 3KLSX 1E0BA 4LK1C 1JCKB 1D1IA 3OHXC 3Q0AA 1QE6A 4Q5VA 2ICIA 1SNQA 2IWHA 2XRSD 3C46A 2NVYB 2L4NA 1EY5A 5K5PA 1EYAA 3EA6A 1WTOA 4C3HG 1QILA 2DN8A 5K36G 3G6JB 3H94A 4DN4M 3BYYB 1KTKA 1XX8A 3SK5A 1F77A 2Z1CA 1I4RA 4IUVA 4QMGA 5FO8B 3ONAB 2E2JB 1I6HB 3DWPA 1JE4A 5A2QL 1CT1D 1A3VA 3ZYYX 4G7OC 3MXPA 3IFTA 3P1HA 2HUGA 2XWBB 5J1ZA 1WTXA 4ZYSA 2FINB 3NWSA 5ISRA 3K0YA 4QCLA 2QILA 5KGUA 4H44C 2L11A 3DXJC 3MA2B 2DY8A 4L8JA 3BDCA 2EYOA 4FF2A 4XQJA 5C0XJ 2WAQB 1I4QA 1M4VA 2EY6A 2E74C 5I6YA 2L0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKL A;  3OWF A;  2F0G A;  3TP8 A;  5C6A A;  5IGF A;  1ENA A;  2F0S A;  2PW7 A;  3C1E A;  4K2K A;  4EVO A;  2F0D A;  1KDC A;  4KJN A;  5IGB A;  1EYC A;  1STH A;  1SNO A;  3EJI A;  1EY6 A;  4EQO A;  3U9O A;  3QB3 A;  2LKV A;  3MHB A;  4ME5 A;  4N9P A;  4PNY A;  3RUZ A;  2F3V A;  4J1M A;  5CV4 A;  5KEE A;  4IUN A;  3DMU A;  1SNM A;  1STA A;  1ENC A;  4K5V A;  1U9R A;  2PYK A;  2RBM A;  4OL7 A;  4K8J A;  4ZQ3 A;  4KHV A;  5M9O A;  3OSO A;  4I65 A;  4ZUJ A;  4EQN A;  2F0N A;  2SOB A;  3NP8 A;  5IOD A;  5CV8 A;  5NUC A;  4KJO A;  3SK6 A;  5IGG A;  4DF7 A;  1EQV A;  3NK9 A;  2M00 A;  2F0T A;  3DHQ A;  4KY5 A;  3VA5 A;  5KYI A;  2F0K A;  1JOQ A;  2F0P A;  1SND A;  1STY A;  2PZW A;  4NDX A;  1RKN A;  1SYF A;  1SNQ A;  3OMG A;  4K14 A;  1TR5 A;  5CV5 A;  4EQP A;  5I6W A;  5J22 A;  2RDF A;  3HZX A;  4H7B A;  3S9W A;  5CV9 A;  1IHZ A;  4ODG A;  1NUC A;  2SNS A;  5CGK A;  4DFA A;  5DAU A;  1EY5 A;  5CR3 A;  5IOC A;  1A2T A;  3MEH A;  4K8I A;  5CV7 A;  5K5P A;  1EYA A;  4J6H A;  4KV6 A;  4K6D A;  1EZ8 A;  2F0O A;  2F0H A;  1JOK A;  2EY2 A;  4B9W A;  3E5S A;  3MVV A;  4KD3 A;  5I9O A;  5IGD A;  3D6C A;  2F0E A;  3SK5 A;  4DU9 A;  5C3W A;  4PMC A;  2OXP A;  2PZT A;  2EYH A;  4KY7 A;  2PZU A;  4QF4 A;  3TP6 A;  5HUR A;  1A2U A;  1KDB A;  1EY8 A;  1F2Y A;  2PW5 A;  1II3 A;  1SYD A;  5KIX A;  2EYL A;  1KDA A;  1TQO A;  4HMI A;  4N9T A;  4IZ8 A;  5C4Z A;  4HMJ A;  2F0W A;  2ENB A;  2EYM A;  3H6M A;  2RKS A;  1A3U A;  5J39 A;  2EYJ A;  2NUC A;  4QMG A;  1SYB A;  4NP5 A;  2F0J A;  2F0I A;  4F8M A;  3NQT A;  5CV6 A;  4RKB A;  5IGE A;  4F7X A;  2EYP A;  1A3V A;  1STG A;  3C1F A;  4TRD A;  3SK4 A;  1F2M A;  5E1F A;  1TT2 A;  5I9P A;  3T16 A;  2F0Q A;  1NSN S;  1STN A;  2F0M A;  2OF1 A;  2F0V A;  3MXP A;  3ERO A;  4ID6 A;  5C4H A;  3P1H A;  3D4W A;  5KYL A;  2EY5 A;  4KD4 A;  2WAC A;  4WRD A;  4KY6 A;  5C5M A;  2EXZ A;  4MIU A;  2F3W A;  4R8N A;  1EY7 A;  4QB4 A;  5EKK A;  1SYC A;  5J1Z A;  4ZUI A;  1EY9 A;  5JOB A;  5E3F A;  5F2D A;  2HQE A;  3LX0 A;  3P75 A;  4G57 A;  4K2L A;  3TP7 A;  3NXW A;  2KHS A;  4LAA A;  3SR1 A;  4KTA A;  4RKL A;  2EY1 A;  2F0L A;  3EVQ A;  3ITP A;  4B9X A;  5KGU A;  1F2Z A;  3BDL A;  3D4D A;  3TME A;  3R3O A;  3TP5 A;  4HTH A;  5CC4 A;  1KAA A;  3T13 A;  4NKL A;  2F0U A;  3SK8 A;  3OMC A;  3SHL A;  4YIJ A;  3SXH A;  5IIF A;  1EY4 A;  3PMF A;  3D8G A;  3BDC A;  5HGT A;  1JOO A;  1SYG A;  2EYO A;  3MZ5 A;  3HEJ A;  1SNP A;  4WOR A;  2QDB A;  3V2T A;  1A3T A;  5ISR A;  3NHH A;  3ERQ A;  4K5X A;  4PMB A;  1KAB A;  2SNM A;  1EY0 A;  3QOJ A;  4NMZ A;  2F0F A;  3NUC A;  2EYF A;  2OEO A;  1EZ6 A;  4IAL A;  2EY6 A;  5JAV A;  5KRU A;  5C3X A;  1AEX A;  5EGT A;  4DGZ A;  4E6I A;  5DEH A;  1SNC A;  5C5L A;  5IGC A;  2PQE A;  3QOL A;  4K5W A;  1SYE A;  5I6Y A;  1STB A;  4S3S A;  2O4X A;  1JOR A;  1EYD A;  2KQ3 A; 
#chains in the Genus database with same CATH topology
 4IPD A;  1VQK A;  4HID A;  2YU9 H;  3A7L A;  2O2L D;  4EVO A;  2UUB Q;  4Z9C B;  3IAY A;  1ICF B;  1EYC A;  1STH A;  5IY0 A;  2HQL A;  2LKV A;  2BDN A;  4HJ7 A;  2H4O A;  4BWG B;  4K8J A;  5JEA G;  3I8Z A;  5M5Y B;  4R9W A;  1CA5 A;  4RGM A;  3J80 E;  2MPM A;  5KYI A;  2DNE A;  1STY A;  2ZTD A;  1O7Y A;  2ID0 A;  3HKZ G;  4PQX A;  2F3I A;  1D8L A;  3HRZ C;  3S1N H;  4HCE A;  1IBM L;  1A2T A;  1XPO A;  3TQY A;  4UHV A;  1ZYR D;  2NVT H;  1BVS A;  5EKI A;  5IT9 E;  2WAQ G;  3G4S A;  1L0W A;  4DXG A;  1PV4 A;  1CTM A;  2B63 H;  2VQF L;  2A68 D;  3K5M A;  4JC0 A;  4DKA C;  4A3F B;  1FGU A;  4DV3 L;  4DV1 L;  2JSO A;  5DNF A;  1XMQ L;  4X66 Q;  4KLK A;  3KFU A;  3IFD A;  3ND8 A;  1HFG A;  5FLX E;  4NP5 A;  2OQK A;  3KLW A;  2UXB Q;  1EIF A;  2IPK D;  2UU9 Q;  3CQZ B;  1QJO A;  1S40 A;  1Z9F A;  3SK4 A;  1C48 A;  5E1F A;  3K7A B;  3T16 A;  1WTV A;  4ZRZ A;  1LT3 D;  3X3M A;  2Q2T A;  2R93 H;  1X65 A;  2VZA A;  4GS3 A;  1HA6 A;  1JJG A;  5F2D A;  2WFW A;  4KTA A;  4CJ0 B;  4NPS A;  1CQF A;  3KUP A;  3T4A C;  3ITP A;  4DV6 L;  1LTR D;  3MXN B;  1Z47 A;  3CCR A;  1VQA A;  3HS0 C;  4G4K A;  1OXU A;  1AN8 A;  1UAP A;  1OXV A;  3CC2 A;  1GUO A;  5E4W C;  2HDL A;  4JI6 L;  1NR4 A;  4UP7 A;  3QR8 A;  3TBI B;  4WJ3 M;  2PQA B;  3ERQ A;  2RCF A;  4YWL A;  1LT6 D;  2NTT A;  4P73 A;  3GTL B;  5ELC A;  1EZ6 A;  5JAV A;  3KLS A;  3GTQ H;  4FO2 A;  3QIA A;  3RMH A;  5DM7 3;  4RMF A;  1SYE A;  4NXM Q;  2HT1 A;  1XPU A;  1EYD A;  1K3R A;  2B2W C;  4QUC A;  4DV7 L;  2F0G A;  4M8A A;  2VXW A;  3HOW H;  3FKI G;  2C5C A;  1L0X B;  3MHB A;  4J1M A;  3KF8 A;  4C56 C;  3CCQ A;  1ENC A;  5IP7 H;  3G71 A;  2B8F A;  1KNE A;  1PH7 A;  2JA6 G;  1QUQ B;  2D5D A;  2ZJQ A;  3M85 A;  5IOD A;  4KJO A;  3F1Z A;  1YZ6 A;  2X69 A;  2F0T A;  3CD6 A;  2IHF A;  3J80 c;  1XWE A;  1LTI D;  3A7A B;  2KED A;  2O5J C;  4LF8 L;  3EBE A;  2TSS A;  1CI3 M;  4BXX H;  4ZCK A;  1EYG A;  4BY1 B;  2Z8L A;  2BOS A;  5DAU A;  4GKK Q;  4K8I A;  1HR0 Q;  4LF9 Q;  4KHP L;  4DAY A;  5IT9 c;  1B7Y B;  1LTS D;  4Q0F A;  3S16 H;  4MHE A;  4ZLT F;  2OXP A;  4JI0 L;  3TP6 A;  1LO5 D;  2A69 D;  5HUR A;  1F2Y A;  2X6G A;  4C3J G;  4GZY C;  1N32 Q;  4DAM A;  2X6L A;  5FO9 B;  2E2D C;  3NTH A;  1EEI D;  2F0J A;  1V9P A;  5FLX c;  3VR5 A;  4O1N A;  1PTO H;  5FLM G;  3NBH A;  1IBK Q;  2JEB I;  4ALP A;  3HOW B;  1HH2 P;  1KAW A;  5C5M A;  3DWA A;  4A3C H;  1R4P B;  2K5D A;  4AQY L;  3SR1 A;  4CDF C;  1YHA A;  1KHI A;  1TU2 B;  1Z7T A;  1J9O A;  2N55 A;  3C2P A;  1Q8I A;  4GN4 B;  1V1O A;  5CC4 A;  4P74 A;  2Y0S E;  4BY1 G;  1XNR L;  4YWM A;  1EY4 A;  4BY7 H;  2EDG A;  5CMD A;  1U5K A;  2NB0 A;  1CQV A;  3QOJ A;  3E9I A;  3NUC A;  4NMZ A;  2K14 A;  2NTS A;  3RLO A;  5KRU A;  2KCC A;  4IUR A;  3KBX A;  2CQO A;  2MFI A;  1RCV D;  2RSO A;  5TSS A;  2HHH L;  1Y1W H;  1JOR A;  1PXU A;  3H91 A;  4L63 B;  2KQ3 A;  5EKL A;  4DR2 Q;  1EFI D;  2MP1 A;  1LTA D;  2PW7 A;  4JBW A;  4FXD A;  1PYW D;  2DJG C;  1PRT F;  3EJI A;  1G51 A;  1S5B D;  4H0L C;  2CCZ A;  4IFD I;  5KEE A;  2QCP X;  4IUN A;  3VDY A;  2NVQ H;  1KXL A;  1ROD A;  5LMN L;  2QGQ A;  1X6O A;  3S1Q B;  1BR9 A;  1BUV T;  1JWM D;  3I2Z A;  4A3D H;  4B3M L;  5T1I A;  4QQB X;  4PG3 A;  3SK6 A;  4DF7 A;  3DHQ A;  2K1B A;  1EU4 A;  1A15 A;  2F0P A;  1JIC A;  2P5Z X;  3I7F A;  1VQP A;  1BBX C;  4OEL B;  4BA2 I;  3GO5 A;  1XTC D;  4EQP A;  3WOF A;  1HTL D;  5COR A;  1IHZ A;  2K75 A;  4GNX B;  2Q2U A;  4DFA A;  3RLF A;  5I2Y A;  3U4V A;  5AJ3 L;  4KV6 A;  2AHO B;  1QNU A;  1A63 A;  1GJX A;  4L5T A;  4DNI A;  3UDG A;  3BDO A;  1M8A A;  1JE5 A;  1X55 A;  1QG7 A;  3KDF B;  1KD1 C;  2UUA L;  3AEV A;  2N78 A;  3S1M H;  1LAB A;  5KIX A;  1DCZ A;  2F0W A;  4JV5 L;  2UXD Q;  2NUC A;  4ZK9 B;  3DM3 A;  4CKC A;  1NCV A;  2D0O A;  1HCZ A;  2HCI A;  4PZ7 A;  3CCL A;  4V19 0;  5IYB H;  3BJU A;  1Y1W B;  3NSW A;  1MD2 D;  2VQF Q;  4DUY L;  1M90 C;  1GXD C;  2PMZ E;  1IXR A;  4ZUI A;  4UPA A;  4DA2 A;  3FP9 A;  1XMQ Q;  2NVQ B;  3ER0 A;  3EVQ A;  5GRO A;  1PH6 A;  3A5Z B;  4A3D B;  3OIP A;  4LMQ D;  3DEP A;  4L5S A;  4GLX A;  1BCP B;  4A3B G;  5FJ8 H;  2NN6 G;  2BE5 C;  5IYD G;  1JOO A;  3J81 E;  1CZW A;  3F2C A;  3T1H L;  4B3T L;  1VQN A;  4K5X A;  4BBR H;  5FOB B;  2CWP A;  4IJH A;  3NWT A;  1E1T A;  4JBK A;  3GDE A;  1S3O A;  5C0X G;  1STB A;  1VMC A;  3H09 A;  2C35 B;  4ZAI A;  1X3F A;  3S1M B;  1D5Z C;  1BKB A;  3C1E A;  1TWC B;  1N33 L;  1D2B A;  4JI6 Q;  4PNY A;  1K0R A;  3K5L A;  2I5L X;  4KN7 C;  2Z4H A;  1CM9 A;  1XYI A;  4MTN A;  1G29 1;  1W6J A;  1SLJ A;  1JOQ A;  1HFN A;  1LTG D;  2BDO A;  4NDX A;  4DV7 Q;  1LTT D;  2Q8R E;  3MEF A;  5J22 A;  2A73 B;  3S9W A;  2B2T A;  5KNC A;  4QY7 A;  3FMC A;  2G9D A;  4RG1 A;  4UDU C;  5CV7 A;  2I5H A;  1CHQ D;  3AYH B;  4KKU A;  4LF6 L;  5G3L D;  4AYB B;  1H9S A;  2BCO A;  1XXG A;  1EL0 A;  1PYB A;  2EYH A;  3NPP A;  4LF8 Q;  2A5H A;  1CSQ A;  4DK0 A;  1TQO A;  2ZXO A;  4IZ8 A;  1ILQ A;  1EUJ A;  1PH8 A;  3A54 A;  4BA1 I;  2JE6 I;  1DJR D;  3CME A;  1DOM A;  3PUZ A;  4C3H H;  1HNZ L;  5K36 H;  4V0B A;  1NR2 A;  2NYZ D;  4KHP Q;  5IGE A;  1U4M A;  1JB3 A;  5I9P A;  1BQQ T;  2K5Q A;  2Z4I A;  3J7Y W;  5M3F B;  3VA7 A;  4JI5 Q;  3TDQ A;  4OXP A;  4JI0 Q;  3CRL C;  1C0A A;  4HCS A;  1SYC A;  2NWG A;  5DLQ E;  2OT2 A;  2KEE A;  2AMC B;  3G48 A;  1N9W A;  4G57 A;  2LS0 1;  4L5R C;  1VQG A;  4A3I H;  2N3S A;  2B29 A;  1IBL Q;  3S15 H;  3D4D A;  5GAD C;  1PTO C;  4LW1 A;  2F4V Q;  4Y7N H;  4OIK A;  2JQO A;  5LL6 S;  2K01 A;  1PRT D;  4JCV E;  3SHL A;  4HIK A;  1TWA H;  1SE4 A;  4AYB G;  1SNP A;  3J7A 5;  5EAY A;  4ME3 A;  3CAM A;  1R9T B;  4GNX C;  2UUC Q;  2EJG C;  1F9S A;  1V1Q A;  4AQY Q;  1QCB D;  1B3Q A;  3KK7 A;  4ILW A;  2NVX H;  1STE A;  4DGZ A;  4JI2 Q;  4IUU A;  2MO1 A;  2NVY H;  1KNA A;  1JJ2 A;  3KJO A;  2HDM A;  3CHB D;  1BNZ A;  1CUK A;  1I3Q H;  3STB C;  4EQO A;  4LF5 Q;  1EY6 A;  1L1O A;  3I70 A;  4OWW B;  2SEB D;  5M3F G;  3I4O A;  4KKS A;  1TWH H;  1W2B A;  4NXN Q;  4JI8 L;  1YEZ A;  2EOT A;  3NTI A;  5CV8 A;  2HHH Q;  1EQV A;  3KYH C;  1SRO A;  2ZT9 C;  4CGY B;  2O5I C;  2PZW A;  1TR5 A;  1FGB D;  3GP7 A;  4ODG A;  4DUZ L;  4XQQ A;  2HIV A;  2FMC A;  2B2W A;  1B70 B;  1GD7 A;  2BH2 A;  1RHP A;  4LF4 L;  1E2W A;  4Y7N B;  5JEA H;  1T5E A;  1A6X A;  3GTK H;  1BCP C;  1SR3 A;  5IGD A;  1B9N A;  1H95 A;  4ZKC B;  4CHT B;  3PO3 G;  3MTS A;  5ELE A;  3JAM L;  1EWI A;  3GTG B;  1VQD A;  1TWA B;  1YNN C;  3NTK A;  1DGS A;  5IYC G;  4N9T A;  2M2L A;  4UAI A;  1UWV A;  2ENB A;  3EQL C;  2RKS A;  2EYJ A;  1Q1B A;  2NVX B;  2JP1 A;  4JI3 Q;  1VQF A;  1PZI D;  4IO9 A;  5AJ3 Q;  2RSN A;  3E3X A;  3J80 i;  2R61 A;  3LWE A;  1EOV A;  4ID6 A;  2E2H B;  2UUA Q;  5GQO A;  1I3Q B;  4KY6 A;  4FF4 A;  3GD7 A;  1PFS A;  2R6G A;  4MN3 A;  1I50 B;  2HQE A;  4JV5 Q;  2B2U C;  2K5H A;  4M1U B;  1TWH B;  2I46 A;  1J5E L;  2NN6 I;  4R4C A;  3PIO 3;  1S72 A;  1XPR A;  3R3O A;  4CDE C;  3BVM A;  1HPC A;  3OMC A;  1PTO F;  1TWG B;  3L3O C;  5I2X A;  1VQC A;  3JC6 6;  2FXQ A;  2RHQ B;  2RDG A;  2QDB A;  5A2Q E;  5JVH 3;  1PH1 A;  1MGS A;  3FPP A;  1Q8K A;  4DR3 L;  4DR4 Q;  2EE1 A;  3WWV A;  3GTK B;  5C5L A;  2PQE A;  3TS0 A;  1U4L A;  3HKZ B;  3PIP A;  4R8N A;  2XSC A;  4X64 L;  3D6W A;  5IGB A;  1BXT A;  1NAP A;  1I4H A;  2L9H A;  3H0G H;  3SVM A;  3T1H Q;  2F03 A;  1KC8 C;  1SE8 A;  4KKT A;  2Q8I B;  4C3I B;  3CW2 C;  4GOP C;  2PYK A;  2RBM A;  3K57 A;  2IW3 A;  2YTX A;  4A3M G;  1G2S A;  4U68 A;  3NP8 A;  4PV1 C;  4CKB A;  4O0A A;  4OWX B;  3ICE A;  5JJL A;  2IX0 A;  1SYF A;  2B2T C;  3FKI H;  3CQZ H;  3GTM B;  4I7Z C;  3K7A H;  3RR5 A;  1N33 Q;  3R8B A;  3R2T A;  1JQY D;  1U4R A;  5IOC A;  4OO1 G;  1FJG L;  2RHS B;  3URY A;  2E5L Q;  2JA6 H;  4DV5 Q;  4K6D A;  4JOI A;  2F0O A;  2LSS A;  1NE3 A;  2A6E C;  4JYA L;  2R92 B;  3SEB A;  1KLU D;  1MSG A;  1YNJ D;  1YJ9 A;  3CCE A;  5LMN W;  1TY2 A;  4X62 L;  3KLR A;  4A3K B;  3U50 C;  4XYQ A;  1GHK A;  5IP9 G;  3H6M A;  3T53 B;  1EEF D;  1C8C A;  1B1Z A;  2IX3 A;  1NMF A;  3NQT A;  4JVZ A;  3PQI A;  5EBC A;  1DM0 B;  4LF6 Q;  3GTL H;  4LUV A;  4C3I G;  1SEB D;  2JA5 G;  3MXN A;  1DZ1 A;  1G8Z D;  4A3G B;  3HOV B;  1LTB D;  4C3J H;  1EIG A;  4ZKB B;  3QG1 A;  1EY7 A;  2WB1 E;  3H0G B;  3S14 H;  3I73 A;  2Q8T A;  1QVC A;  2R7D A;  3PCO B;  4DK1 A;  3I4N B;  3U9O A;  4QGU A;  2EY1 A;  2XTI A;  2UXC Q;  2EIF A;  3PIP 3;  3TME A;  2AUK A;  3QO2 A;  1HNZ Q;  1ONL A;  2PQA A;  5FLM H;  4HTH A;  1VDZ A;  3D31 A;  4LFB L;  4YIJ A;  5BR8 Q;  1SDF A;  3FKI B;  2VQE Q;  4BS9 A;  1TY0 A;  2R92 G;  2G9H D;  4WJ4 A;  2Z6K A;  1X56 A;  1SFO H;  4IPG A;  3A5U A;  2R3Z A;  5H1S E;  2SNM A;  3S2D B;  2QW7 A;  4LF7 L;  2QA4 A;  2JA6 B;  2EYF A;  1VQ4 A;  4A3J G;  4DNR B;  1OXS C;  5FLX L;  4A3K G;  1XNQ L;  3RN5 A;  1VQ9 A;  1YVC A;  2N8N A;  4BY1 H;  1PH2 A;  3OW7 A;  2A6H D;  4JK1 C;  3QWN A;  1K8A C;  1QUQ A;  4OHJ A;  2ZXP A;  1L1O C;  5AFW A;  1PA6 A;  2AQ2 B;  4N9P A;  2B2Y C;  4A3G G;  4IPH A;  1HZB A;  3HOV G;  3GTJ B;  4GKJ L;  3H0G G;  5CYU A;  2F52 A;  4CDC C;  4G7Z C;  5IGG A;  3I4N G;  2JA8 B;  1I5F A;  2ATW A;  3ULP A;  4C3J B;  1KRT A;  3ND9 A;  3WOE A;  4C1N K;  1D6E C;  1L0Y B;  3S14 B;  2RDF A;  3HZX A;  2QKI C;  2Y0S G;  4UP9 A;  1ASZ A;  1Q12 A;  3GV3 A;  4DV0 L;  2PCF B;  1UE6 A;  4I7A A;  5I9O A;  4JI1 L;  3C3L A;  2KUM A;  2EPB A;  4DR7 L;  2E2I H;  1BBW A;  4OGQ C;  1SSO A;  1BOS A;  5D3D A;  2AQ1 B;  3CCM A;  3G7L A;  1XMO Q;  1K3B C;  1KDA A;  5C44 B;  2PO4 A;  1SFO B;  3A0J A;  2EYM A;  3PUW A;  5J3B A;  4OON A;  2EZV A;  4JI4 Q;  1N34 Q;  1GUG A;  2R7F A;  5CV6 A;  1X3P A;  4RKB A;  1VS0 A;  2EYP A;  1UE1 A;  2K03 A;  5D3I B;  3Q23 A;  1G6Z A;  1SJE D;  2WAQ E;  2SDF A;  1AFP A;  2E75 C;  5KYL A;  2EY5 A;  3F2U A;  2MGS A;  2N88 A;  4RH6 A;  1ZKO A;  2EQS A;  1Y69 U;  4DAV A;  3TP7 A;  2JA8 G;  1K0S A;  4TQU S;  2VB2 X;  1WTH A;  3BS1 A;  1BBU A;  1Q7Y C;  3ERS X;  1HQR D;  5COY A;  3CCS A;  3MFG A;  4NKL A;  1OTC A;  3SK8 A;  4DK6 C;  4A3E B;  1Q82 C;  3UDX A;  3S1Q H;  1SMY C;  3D8G A;  5HGT A;  3CKI B;  2JEA I;  2EJF C;  1ZEQ X;  3STB D;  1JMC A;  2C9O A;  5HY6 A;  4IN3 A;  1IYJ B;  1IYU A;  1J5E Q;  1RJT A;  4E6I A;  2WKC A;  1O7Z A;  5C44 G;  4A3B H;  3K80 C;  1IW7 C;  3HOX G;  1CKN A;  1PFN A;  2E2I B;  2NN6 H;  5IYD H;  3CCU A;  4JI7 L;  3TP8 A;  2DNC A;  1HZ9 A;  1HRJ A;  1KDC A;  4KJN A;  2IHE A;  1I4X A;  4EGV A;  1PH9 A;  3RUZ A;  4L6T B;  4CJ2 C;  1PHJ A;  1MI2 A;  2E76 C;  3T1Y L;  1VQ5 A;  4JPB W;  1N36 L;  1Q1E A;  4DR3 Q;  3UDI A;  3KJP A;  3OSO A;  4EQN A;  2F0N A;  1VQE A;  5C0X H;  4GNX A;  1PFB A;  4HAE A;  5C3E G;  1NTG A;  3GQB A;  2LXJ A;  1SND A;  2NZO A;  3J81 i;  4DR5 Q;  3OMG A;  1O78 A;  3VYS A;  3EFX D;  4FP5 D;  1SBB B;  4LFC L;  5HGQ A;  2D62 A;  4AIM A;  2JN4 A;  4A3E G;  1RTN A;  3WDN A;  4JOI C;  4UY8 C;  2N49 A;  3HOY B;  2BA0 A;  2F0H A;  4KI0 A;  1JOK A;  2AQ3 B;  4HIM A;  2VB3 X;  4CBV A;  1ICW A;  1CA6 A;  2RQX A;  3S2H H;  2F0E A;  4DR6 L;  2XWJ B;  3U4Z A;  4QF4 A;  1HHV A;  1A2U A;  3GV6 A;  1SYD A;  4IUT A;  4HMJ A;  1ENF A;  1Q3L A;  4A76 A;  3FRP B;  1L2F A;  3RZD B;  4A3B B;  3NE5 B;  3MXG A;  1QZH A;  1TT2 A;  1STN A;  2I0Q A;  2F0V A;  2GVB A;  4ABN A;  1SE2 A;  1FD7 D;  1SRU A;  1VQ7 A;  2GVA A;  3A8I E;  4X62 Q;  4QB4 A;  3TZD A;  3AFQ A;  5JOB A;  3FEW X;  1WJJ A;  4KHZ A;  3MAQ A;  2VUM G;  1TWC H;  2D2C C;  1YI2 A;  4GN5 A;  4UP8 A;  5JEA J;  5LHY 1;  3DUZ A;  4NW2 A;  1K83 B;  4IFD J;  1IBM Q;  2JYO A;  3L7Z C;  2Z9H A;  3HOY G;  1HZC A;  1SE3 A;  4QIW B;  1GUN A;  4FNF A;  2Z6K C;  3HOZ B;  3I91 A;  4X65 L;  3NHH A;  3NQI A;  3I56 A;  3IRB A;  4PMB A;  2IT1 A;  5I4D A;  1N8R C;  4AH6 A;  1WD0 A;  3W1G A;  4XQN A;  4DV1 Q;  4DV3 Q;  1ZXT A;  1HJP A;  1AEX A;  2L55 A;  4CDD C;  5DEH A;  3OTO L;  4YCW A;  1YIT A;  4CKE A;  3S2H B;  3QJY A;  1YHQ A;  2B2U A;  3K6O A;  3VYR A;  3OWF A;  2B2V A;  5C6A A;  2IL8 A;  1ENA A;  3PSI A;  2MQH A;  4XXE A;  2CHB D;  4O42 A;  1VQO A;  1PVO A;  4JG2 A;  3OWE B;  4H02 A;  1WI5 A;  4K0K L;  2RF4 A;  5GAH C;  4HJ8 A;  2K5N A;  1Q90 A;  1XNQ Q;  2SOB A;  3NK9 A;  2KCM A;  1RTO A;  1V1P B;  2F0K A;  4RHS A;  4DV6 Q;  1S5E D;  4RFB A;  2H5X A;  5I6W A;  3D3R A;  1ZYR C;  5EPK A;  1VQB A;  1T9H A;  3E0E A;  5M3F H;  3MEH A;  1QVF A;  3M4Q A;  2FHT A;  1VQJ A;  3HOZ G;  3K8A A;  1C4Q A;  1FNU A;  4XT3 B;  2R7Z G;  4GKJ Q;  3K5O A;  2FJ2 A;  3Q24 A;  5C3W A;  4GOP A;  2F1M A;  4PMC A;  2I07 B;  1FNV A;  2M9V A;  1BF4 A;  1B8A A;  2NBF A;  4OIJ A;  2MUY A;  3TRZ A;  4MZ9 A;  2ZJP A;  3J81 j;  1RD9 D;  5D14 A;  2K5W A;  5DM6 3;  3PO2 B;  2NZH A;  4DV0 Q;  4XDX A;  1PZJ D;  2JA7 B;  5GAE C;  3CRK C;  5C4J H;  1R9T H;  5JJK A;  3PO3 H;  1WCM B;  1HNW L;  2XIW A;  1F2M A;  4JI1 Q;  3VYU A;  5C4H A;  1GUS A;  3V05 A;  5M3M B;  4KK7 A;  5IYC H;  1S5F D;  4XTC S;  4BBS G;  1DOK A;  4K2L A;  2K6A A;  3BZD B;  1RIP A;  2AWN A;  1HUM A;  2XVS A;  4A75 A;  2KCT A;  1KAA A;  1SJH D;  1WOC A;  2F0U A;  3S24 A;  3SXH A;  1CKM A;  5EJW A;  1SYG A;  3S1R B;  5EBD A;  1NY4 A;  2A1A A;  3HEJ A;  1EOT A;  2CH4 W;  4WOR A;  5T1G A;  3V2T A;  1UE7 A;  4RGO S;  3VR3 A;  1WFQ A;  4HIO A;  4IAL A;  2QDL A;  4L5Q A;  1Y1V B;  3DWQ A;  1DXM A;  1PZK D;  1DD2 A;  1Y8O B;  5JJZ A;  2K28 A;  1F9P A;  3PO2 G;  4XIG S;  4X66 L;  2CH4 A;  2JA7 G;  1EIH A;  2NZ1 D;  4DNT B;  3FVQ A;  4PMW A;  3VR6 A;  2K50 A;  1WCM G;  1SNO A;  1O80 A;  4J15 A;  3CP0 A;  4RCN A;  1LT5 D;  3GTG H;  4F87 A;  4JBM A;  5M3M G;  2MNA A;  3J81 c;  4ZQ3 A;  5C4J B;  1HUN A;  3PO3 B;  1E7Z A;  4FYD A;  1D1K A;  1HXY D;  4YCV A;  4KY5 A;  4POF A;  1V8Q A;  1LAC A;  3A55 A;  1FR3 A;  1RKN A;  5CV5 A;  2IX1 A;  2Z6B A;  3FDT A;  4HJA A;  1XNR Q;  1MJE A;  3PIO A;  2I5M X;  5LL6 X;  3M4P A;  5CR3 A;  2E2H H;  2Q2I A;  3HGB A;  4A3M H;  1N36 Q;  1EZ8 A;  1I50 H;  1GVP A;  1O7L A;  2BH8 A;  1NBW A;  1GM5 A;  2A69 C;  2B2Y A;  2RVL A;  3Q22 A;  4QUF A;  1KRS A;  2PZU A;  4HED A;  1Y1V G;  4YCU A;  1T5X D;  1A8V A;  5C4Z A;  1TWG H;  4LFC Q;  4LNQ A;  4OO1 H;  1D7Q A;  1O7I A;  1F9Q A;  1G2T A;  3PV0 A;  5IE8 A;  4IOC A;  4F7X A;  3I4M G;  1CK1 A;  3F2D A;  2V1C C;  1YJW A;  2JXM B;  1K8O A;  4LJZ C;  5LMN Q;  4DR6 Q;  1LTL A;  1OXT A;  1ML0 D;  4B3M Q;  2FMM A;  3OPO A;  3RLN A;  3K81 C;  5IP9 H;  1MSH A;  5BN5 A;  3IKJ A;  3AU7 A;  3JAM E;  4DXF A;  1B2T A;  3RZO H;  3NBI A;  1V43 A;  3RD4 A;  3TZU A;  2OTL A;  1QWY A;  1IW7 D;  3T13 A;  4C3I H;  2JA5 H;  2KJX A;  4TKO B;  4IUQ A;  1HR0 L;  1GO3 E;  4R8I A;  1KAB A;  3HG9 A;  4B3R L;  1EY0 A;  2KOL A;  3H15 A;  3GTM H;  1K8M A;  4A3M B;  4R4T A;  1ET9 A;  1J8I A;  5C3X A;  1SXT A;  4K5W A;  2O4X A;  2B2V C;  1JJC B;  3KOJ A;  3T56 B;  1N32 L;  1FVI A;  3BVG A;  4IUP A;  3CC4 A;  1TVX A;  3A8J E;  2R92 H;  1JWS D;  1VF7 A;  3I3C A;  3DM1 A;  2MHV A;  4DUY Q;  4P2C B;  3GTP H;  4ME5 A;  4X65 Q;  1EWC A;  3BZK A;  4AYB E;  4GLV B;  1GOZ A;  4A3J H;  1ILP A;  5L37 A;  1IBK L;  4A3K H;  5ELN A;  1PRT B;  1G6P A;  5C0X I;  1HTP A;  5NUC A;  5C4X B;  4XT1 B;  4IOA A;  5IWA L;  2K33 A;  5JVG 3;  3CCV A;  1VCI A;  1E3P A;  3TRE A;  1Q46 A;  3R2I A;  1WVL A;  1HNX L;  3B6Y A;  1X54 A;  5D65 A;  4F88 A;  4A3G H;  3RZO B;  1DYQ A;  3HOV H;  1TWF H;  4TVA B;  4K0K Q;  2EVB A;  2GA4 B;  3OOC A;  4B3T Q;  3E5S A;  3I4N H;  2IJ0 A;  4C2M H;  1AZQ A;  2JA5 B;  4FXG C;  3S17 B;  3T51 B;  2PNH A;  1P8L A;  1X3E A;  3X3N A;  4IJL A;  3W5O A;  2WV6 D;  3A56 A;  2D9U A;  5EPL A;  2PPB C;  3H3V H;  3E9H A;  3Q6S A;  2OCE A;  2B39 A;  1PDQ A;  1ESF A;  1PH5 A;  2OTJ A;  3S2D H;  3J7A F;  1WTQ A;  1YIJ A;  3LGJ A;  1TS4 A;  3HOU B;  3HP3 A;  1LT4 D;  4LFA L;  2L5T A;  2EXZ A;  2KEC A;  1E2Z A;  2HCC A;  3GTP B;  3SGI A;  5JPN C;  1WTR A;  5C4X G;  4RAU C;  4B9X A;  1BCP F;  2DUD A;  4LAA A;  4DPG A;  4RKL A;  4A3J B;  1ET6 A;  3W1B A;  2F0L A;  3JAM c;  3M3Y B;  4A93 B;  4X3T A;  2EJM A;  1UE5 A;  3CPF A;  3F8T A;  1JWU D;  1TS5 A;  1D5M C;  3CU7 A;  1HNW Q;  5IIF A;  1AP0 A;  4POG A;  4RGN A;  3GTJ H;  1OXX K;  3MZ5 A;  4R4Q A;  3KF6 B;  1JB7 A;  3ULL A;  2JA8 H;  3J80 L;  2BE5 D;  3BYT B;  1TWF B;  4IFD G;  4LWC A;  1WTW A;  1UNS A;  2CVR A;  4C2M B;  2AUJ D;  1I4P A;  3BG3 A;  1JC7 A;  2UXD L;  2Y0S B;  5IT9 L;  2L1B A;  1TS2 A;  1XJV A;  2F0D A;  4HN7 A;  1RDP D;  2WKD A;  2ZTC A;  1AE3 A;  3HOU G;  1STA A;  1UEA B;  5C44 H;  1CSP A;  3PF4 A;  4P75 A;  3I55 A;  4OX9 L;  2KHI A;  3HOX H;  2AWO A;  3UDF A;  1C9O A;  3ULJ A;  3PUX A;  2FFK B;  1AW7 A;  4A93 G;  3TN2 A;  4K14 A;  3L9A X;  4H7B A;  2SNS A;  1B9M A;  4IPC A;  1RF2 D;  1VMP A;  2CWA A;  3UE0 A;  4DR1 L;  1EQR A;  2YU9 B;  3GTO H;  4KD3 A;  3PGZ A;  5C3E H;  1Z6H A;  2PZT A;  4X3K A;  2KEN A;  1S5D D;  1UEB A;  1QOH A;  2PW5 A;  2F4I A;  3K0X A;  3DLL A;  4N8F A;  4A3E H;  1S5C D;  3VYT A;  5J39 A;  2VW9 A;  2CW0 C;  1DON A;  4X3U A;  3PUY A;  2WII B;  1JT8 A;  3V96 A;  4DV2 L;  2F0Q A;  2F0M A;  3I90 A;  3S1N B;  4LUZ A;  2KA7 A;  4FF3 A;  3UI2 A;  5EQ0 A;  4JI8 Q;  2WAC A;  4XYO A;  2NVT B;  4A3F G;  4JBJ A;  2F3W A;  5EKK A;  3BVZ A;  3D4R A;  1RL2 A;  2DGY A;  3LX0 A;  3P75 A;  2B63 B;  2YTY A;  5A35 A;  2KBN A;  5KND A;  5LMU L;  1ESR A;  1PRT C;  3K58 A;  4X6A H;  3HKZ E;  3HOX B;  5BN4 A;  4DUZ Q;  2LMC B;  1PTO D;  4LF4 Q;  4A3L G;  2K32 A;  1FYC A;  3HFZ B;  2MO0 A;  3P20 A;  1Q81 C;  2PMZ B;  1KIX A;  2G5D A;  2VUM H;  1F9R A;  1Q86 C;  2R93 B;  3GTO B;  4RWS C;  1P16 A;  2IY5 B;  2MJ8 A;  5C3E B;  1PFM A;  1LLR D;  4S3S A;  3SDZ A;  3HOY H;  3IL8 A;  2ZM6 L;  4HR7 B;  1CHP D;  2J4X A;  1K28 A;  3OIQ A;  5JPM C;  3U58 A;  3QB3 A;  3K59 A;  2F3V A;  4U67 3;  1J6Q A;  4B3R Q;  1SNM A;  1B3A A;  4JI5 L;  1DOL A;  3MC0 B;  1CFM A;  4RGT A;  3NEL A;  2B63 G;  3PUV A;  1U0L A;  3VA5 A;  3MXU A;  4PZ8 A;  1SAP A;  3KF8 B;  3RZD H;  2A8V A;  2E8G A;  4KMU C;  5ELB A;  2DY7 A;  1IBL L;  5CV9 A;  2F4V L;  3GTQ B;  2ZTE A;  1C7Y A;  2H1E A;  2K4K A;  1M1K C;  5FK9 C;  2BA1 A;  3MVV A;  1EWH A;  5G3L F;  1VQ6 A;  3D6C A;  4HSP A;  4DU9 A;  1AH9 A;  2DJF C;  4RCO A;  5IWA Q;  3O13 A;  2UUC L;  1BCP D;  2R93 G;  2LFN A;  4A4I A;  1KDB A;  2J7Z A;  3BU2 A;  1K83 H;  1II3 A;  1TS3 A;  4JI2 L;  4DAY B;  1YNN D;  2VUM B;  4OO1 I;  1HNX Q;  1A3U A;  4YHH L;  1SYB A;  2F0I A;  4X64 Q;  3HOZ H;  2XN9 C;  2R7Z H;  3KDF A;  5M5W H;  1E22 A;  5EPJ A;  1STG A;  4TRD A;  1TII D;  4LF5 L;  1HA5 A;  2OF1 A;  3U9S A;  3N52 A;  5FKA C;  4FVM A;  3MFY A;  3AMU A;  4WRD A;  3P7J A;  5GAG C;  3TS2 A;  4NXN L;  3I4L A;  1EY9 A;  5E3F A;  3H3V C;  1YJN A;  3TSS A;  2KHS A;  3S16 B;  1MBY A;  3NBH B;  2D0P A;  1SN8 A;  3BDL A;  3CPW A;  1F2L A;  1HQM C;  4P71 A;  1EFW A;  3UE1 A;  1FJG Q;  2PI2 A;  3PMF A;  1R4Q B;  3J7Z C;  4JYA Q;  1S4Z A;  1VF5 C;  4IQZ A;  1CKN B;  4BBS H;  4LFA Q;  4APV A;  3HOW G;  1Y8P B;  3HKS A;  5FO7 B;  5KNB A;  1PTO B;  2OEO A;  4EQ5 A;  5IP7 G;  3VR4 A;  1WD1 A;  1GUT A;  3QOL A;  4HSV A;  1I4G A;  1H9M A;  1LUZ A;  2OWO A;  4OWT B;  2VNU D;  3M4O H;  5IGF A;  2LXK A;  4YWK A;  3J7A V;  4JI3 L;  1QB5 D;  4C1N I;  2OQ0 A;  3CC7 A;  1EU3 A;  1V1P A;  1H9J A;  4BXX G;  5ELD A;  1B53 A;  3DMU A;  1HR0 W;  3NEN A;  3CXC A;  4OL7 A;  1I94 L;  2R7Z B;  4BY7 B;  4FXK C;  5M5W B;  4I65 A;  4ZUJ A;  2L15 A;  1PLF A;  3LNN A;  1IL8 A;  1LYL A;  1E24 A;  2M00 A;  3PO2 H;  2HIX A;  4FF1 A;  2JA7 H;  1KQS A;  5ELO A;  2TMP A;  1WCM H;  4PZ6 A;  1YNX A;  2WP8 J;  2ZXR A;  3KBG A;  2JK8 A;  4DV4 L;  4LFB Q;  5CGK A;  1WYD A;  1MHW C;  4ULL A;  5M3M H;  1YNJ C;  4R1J A;  2QF7 A;  1IKL A;  2EY2 A;  3K7U C;  4OX9 Q;  4LF7 Q;  3SE0 A;  1A62 A;  1H9K A;  2A6E D;  4KY7 A;  4BBS B;  4DR4 L;  3AFP A;  4KN4 C;  4CJ1 B;  2EYL A;  4A3C G;  2RCN A;  4B08 A;  1A0I A;  3H3V I;  3S1R H;  4GN3 B;  1TXY A;  4F8M A;  2B8G A;  3AB9 A;  3VR2 A;  3J81 L;  2KVM A;  2ZJR A;  1W6K A;  1QZG A;  4DR1 Q;  1AE2 A;  3C1F A;  3M7G A;  2A68 C;  2YV5 A;  4LUO A;  1NSN S;  1IKM A;  3M4O B;  3ERO A;  3L2P A;  3D4W A;  1NNX A;  1Y1V H;  3L0O A;  4RHR A;  4BY7 G;  4KD4 A;  3A74 A;  1BO0 A;  1Y8N B;  1BDO A;  1YHB A;  4B3S L;  3CF5 A;  3NXW A;  1I6V C;  4YY3 L;  3F2B A;  1VQM A;  3CMA A;  1F2Z A;  3K5N A;  1PH4 A;  1Y14 B;  1NJI C;  2A19 A;  4QJF A;  3TP5 A;  3I4M H;  2K5V A;  4MTK A;  1Y1W G;  2K05 A;  4DV2 Q;  1D5X C;  1LV9 A;  2XGT A;  4WFN 3;  2UUB L;  3G6E A;  1XTD A;  1IL2 A;  2E5L L;  2A74 C;  4DV5 L;  1FNW A;  4DR7 Q;  1A3T A;  3EN2 A;  4TSS A;  1OO9 B;  1G91 A;  1B50 A;  2J0T D;  1PH3 A;  2EXD A;  5LMU Q;  2A6H C;  5JJI A;  4R4O A;  5EGT A;  2CKZ B;  3W3A A;  4O2D A;  1SNC A;  5IGC A;  4QL5 A;  4A3D G;  1QVG A;  3I72 A;  5M5X H;  1IZ6 A;  1U4P A;  3W2D A;  2F0S A;  4EX5 A;  4K2K A;  4HJ9 A;  4H13 C;  4P72 A;  4K6L A;  3JAM i;  4RA8 A;  5CV4 A;  4K5V A;  3M7N A;  2QEX A;  1E1O A;  3FPU B;  4G7H C;  2ES2 A;  2YYZ A;  2JJQ A;  1QNK A;  4GLA C;  2RA4 A;  1K9M C;  4BBR B;  4R4I A;  4WJW A;  5CBA E;  2ZM6 Q;  1AZP A;  2KCN A;  2QEJ C;  2UXC L;  4GOP B;  4X3S A;  1EQQ A;  1NUC A;  1GUW A;  2UXB L;  1CZG A;  2CW0 D;  5BR8 L;  4J6H A;  2K7V A;  2UU9 L;  2VQE L;  4Y52 H;  3I4M B;  4B9W A;  5IYB G;  1X3G A;  2XNA C;  2K04 A;  1PMR A;  1B44 D;  5E7N A;  1CKO A;  1EY8 A;  1E2V A;  1X32 A;  4HMI A;  2Q2H A;  1H9S B;  4JI7 Q;  2K52 A;  2CFM A;  1B4O A;  2ICE C;  3LWU A;  1IYV A;  3Q8D A;  4DK3 C;  4QIW E;  2L12 A;  3E6Z X;  2ASB A;  2CQA A;  3T1Y Q;  5E4X A;  4J8Q A;  5FJ8 G;  5M5X B;  4JW0 A;  2XRQ D;  4OEM B;  1X3Q A;  2WIN B;  4MIU A;  1YBY A;  2PI2 E;  4DAP A;  2ALY B;  1WTP A;  4BBR G;  1LM0 A;  2PNR C;  1SMX A;  1MIU A;  1TKW B;  1W3S A;  4YHH Q;  3M4Y A;  3N6R A;  4NXM L;  5ELF A;  2RDH A;  3DEO A;  5CBE E;  3CCJ A;  4N8X 1;  1GHJ A;  1UUP A;  4C3H B;  5C4X H;  2VY3 A;  1SMY D;  2F0F A;  2V4D A;  2WB1 B;  5BN3 A;  2E2J H;  1KLG D;  2GN5 A;  1XMO L;  1I6H H;  1FL0 A;  1ASY A;  1MKH A;  3MWY W;  4JI4 L;  4A3I B;  3A8K E;  1N34 L;  3RN2 A;  3R93 A;  3S15 B;  2LY7 A;  1EQT A;  3EIV A;  3E0J A;  3S17 H;  4GKK L;  4IFD H;  4LF9 L;  1U9R A;  1JR0 D;  1H9R A;  4KHV A;  5M9O A;  3KLS X;  1E0B A;  4LK1 C;  1JCK B;  3OW2 A;  1D1I A;  2VS1 A;  3OHX C;  3Q0A A;  1L1O B;  1QE6 A;  4Q5V A;  2ICI A;  1GKH A;  1SNQ A;  1PYS B;  2IWH A;  2XRS D;  1X9N A;  2VL6 A;  1EIY B;  3C46 A;  2NVY B;  2L4N A;  3HOU H;  1EY5 A;  3PF5 A;  3M9B A;  5K5P A;  2Z0S A;  1EYA A;  3EA6 A;  1WTO A;  4C3H G;  2HD3 A;  1QIL A;  2DN8 A;  3NEM A;  1I94 Q;  5K36 G;  1K73 C;  3G6J B;  3H94 A;  4DN4 M;  3BYY B;  1KTK A;  1XX8 A;  3SK5 A;  3M3Y H;  1F77 A;  2WB1 G;  2Z1C A;  4A93 H;  3RNU A;  1I4R A;  2KHJ A;  3OTO Q;  4DV4 Q;  4HJ5 A;  4IUV A;  4QMG A;  5FO8 B;  3D0F A;  3ONA B;  4A3I G;  2E2J B;  1VQH A;  1MJC A;  3FHW A;  2YTV A;  1I6H B;  4FDB A;  3DWP A;  1JE4 A;  5A2Q L;  1CT1 D;  1A3V A;  5M5Y H;  3ZYY X;  4G7O C;  3MXP A;  3IFT A;  3P1H A;  3BZC A;  1K8G A;  2HUG A;  2XWB B;  3ZJY C;  1NMG A;  5J1Z A;  1VQL A;  1WTX A;  4ZYS A;  2FIN B;  3NWS A;  5ISR A;  1HZA A;  3K0Y A;  4MNO A;  4QCL A;  3KF6 A;  2B3G A;  1VQ8 A;  2QIL A;  5KGU A;  4H44 C;  2AKW B;  3TEH B;  2L11 A;  4DR5 L;  3OYY A;  3DXJ C;  1KL9 A;  3MA2 B;  4DR2 L;  2DY8 A;  4L8J A;  3BDC A;  2EYO A;  4A3F H;  4FF2 A;  4XQJ A;  5C0X J;  2WAQ B;  1I4Q A;  2JA9 A;  1M4V A;  4B3S Q;  4YY3 Q;  3AQQ A;  2EY6 A;  2E74 C;  4NB3 A;  5I6Y A;  2L0C A;  1VQI A;  4A3L H; 
#chains in the Genus database with same CATH homology
 3A7L A;  2O2L D;  4EVO A;  3IAY A;  4Z9C B;  1EYC A;  1STH A;  2LKV A;  2BDN A;  2H4O A;  4BWG B;  4K8J A;  5JEA G;  3I8Z A;  5M5Y B;  4R9W A;  1CA5 A;  4RGM A;  3J80 E;  2MPM A;  5KYI A;  2DNE A;  1STY A;  1O7Y A;  2ID0 A;  4PQX A;  3HRZ C;  4HCE A;  1A2T A;  1ZYR D;  5EKI A;  5IT9 E;  4DXG A;  1CTM A;  2A68 D;  3K5M A;  4A3F B;  2JSO A;  5DNF A;  3IFD A;  3ND8 A;  1HFG A;  5FLX E;  4NP5 A;  2IPK D;  3CQZ B;  1QJO A;  3SK4 A;  1C48 A;  5E1F A;  3K7A B;  3T16 A;  1WTV A;  4ZRZ A;  1LT3 D;  3X3M A;  1HA6 A;  5F2D A;  4KTA A;  4CJ0 B;  1CQF A;  3KUP A;  3T4A C;  3ITP A;  1LTR D;  1Z47 A;  3HS0 C;  4G4K A;  1OXU A;  1AN8 A;  1UAP A;  1OXV A;  1GUO A;  5E4W C;  2HDL A;  1NR4 A;  3TBI B;  3ERQ A;  1LT6 D;  2NTT A;  3GTL B;  5ELC A;  1EZ6 A;  5JAV A;  3KLS A;  4FO2 A;  3QIA A;  3RMH A;  5DM7 3;  1SYE A;  1EYD A;  2B2W C;  4QUC A;  2F0G A;  4M8A A;  2VXW A;  2C5C A;  1L0X B;  3MHB A;  4J1M A;  3KF8 A;  4C56 C;  1ENC A;  2B8F A;  1KNE A;  2D5D A;  3M85 A;  5IOD A;  4KJO A;  2X69 A;  2F0T A;  1XWE A;  1LTI D;  3A7A B;  2KED A;  2O5J C;  2TSS A;  1CI3 M;  4BY1 B;  2Z8L A;  2BOS A;  5DAU A;  4K8I A;  4DAY A;  1LTS D;  4Q0F A;  4MHE A;  4ZLT F;  2OXP A;  3TP6 A;  1LO5 D;  2A69 D;  5HUR A;  1F2Y A;  2X6G A;  4C3J G;  4GZY C;  2X6L A;  5FO9 B;  2E2D C;  3NTH A;  1EEI D;  2F0J A;  3VR5 A;  4O1N A;  1PTO H;  3NBH A;  2JEB I;  3HOW B;  5C5M A;  3DWA A;  1R4P B;  2K5D A;  3SR1 A;  1TU2 B;  1Z7T A;  1J9O A;  2N55 A;  3C2P A;  1Q8I A;  1V1O A;  5CC4 A;  1EY4 A;  2EDG A;  5CMD A;  2NB0 A;  1CQV A;  3QOJ A;  4NMZ A;  3NUC A;  2NTS A;  5KRU A;  2KCC A;  4IUR A;  3KBX A;  2RSO A;  1RCV D;  5TSS A;  1JOR A;  1PXU A;  3H91 A;  4L63 B;  2KQ3 A;  5EKL A;  1EFI D;  2MP1 A;  1LTA D;  2PW7 A;  4JBW A;  4FXD A;  1PYW D;  1PRT F;  3EJI A;  1S5B D;  4H0L C;  4IFD I;  5KEE A;  2QCP X;  4IUN A;  1ROD A;  3S1Q B;  1BR9 A;  1BUV T;  1JWM D;  5T1I A;  3SK6 A;  4DF7 A;  3DHQ A;  2K1B A;  1EU4 A;  1A15 A;  2F0P A;  1JIC A;  1BBX C;  1K8O A;  4BA2 I;  3GO5 A;  1XTC D;  4EQP A;  3WOF A;  1HTL D;  5COR A;  1IHZ A;  4DFA A;  3RLF A;  5I2Y A;  4KV6 A;  1QNU A;  1GJX A;  3BDO A;  1M8A A;  1QG7 A;  1LAB A;  5KIX A;  1DCZ A;  2F0W A;  2NUC A;  4ZK9 B;  4CKC A;  1NCV A;  2HCI A;  1HCZ A;  4V19 0;  1Y1W B;  3NSW A;  1MD2 D;  1GXD C;  4ZUI A;  4DA2 A;  2NVQ B;  3EVQ A;  4A3D B;  3OIP A;  4LMQ D;  3DEP A;  1BCP B;  2NN6 G;  2BE5 C;  1JOO A;  3J81 E;  1CZW A;  4K5X A;  5FOB B;  3NWT A;  5C0X G;  1STB A;  1VMC A;  3H09 A;  4ZAI A;  3S1M B;  1D5Z C;  3C1E A;  1TWC B;  1D2B A;  4PNY A;  3K5L A;  4KN7 C;  2Z4H A;  1CM9 A;  1XYI A;  1G29 1;  1W6J A;  1JOQ A;  1HFN A;  1LTG D;  2BDO A;  4NDX A;  1LTT D;  2Q8R E;  5J22 A;  2A73 B;  3S9W A;  2B2T A;  5KNC A;  3FMC A;  2G9D A;  4UDU C;  5CV7 A;  1CHQ D;  4KKU A;  5G3L D;  4AYB B;  1H9S A;  2BCO A;  1XXG A;  1EL0 A;  2EYH A;  3NPP A;  2A5H A;  4DK0 A;  1TQO A;  2ZXO A;  4IZ8 A;  1ILQ A;  3A54 A;  4BA1 I;  2JE6 I;  1DJR D;  1DOM A;  3PUZ A;  5K36 H;  4V0B A;  1NR2 A;  2NYZ D;  5IGE A;  1U4M A;  1JB3 A;  5I9P A;  1BQQ T;  2K5Q A;  2Z4I A;  3J7Y W;  5M3F B;  3VA7 A;  3TDQ A;  3CRL C;  4HCS A;  1SYC A;  2NWG A;  2OT2 A;  2KEE A;  4G57 A;  2LS0 1;  3D4D A;  1PTO C;  4OIK A;  5LL6 S;  2K01 A;  1PRT D;  3SHL A;  1SE4 A;  1SNP A;  1R9T B;  2EJG C;  1F9S A;  1QCB D;  4ILW A;  3KK7 A;  1STE A;  4DGZ A;  4IUU A;  1KNA A;  2HDM A;  3CHB D;  1BNZ A;  4EQO A;  1EY6 A;  3I70 A;  2SEB D;  4KKS A;  2EOT A;  3NTI A;  5CV8 A;  1EQV A;  2ZT9 C;  4CGY B;  2O5I C;  2PZW A;  1TR5 A;  1FGB D;  3GP7 A;  4ODG A;  4XQQ A;  2FMC A;  2B2W A;  1RHP A;  1E2W A;  4Y7N B;  5JEA H;  1T5E A;  1A6X A;  1BCP C;  5IGD A;  1B9N A;  4ZKC B;  4CHT B;  3MTS A;  5ELE A;  3JAM L;  3GTG B;  1TWA B;  1YNN C;  3NTK A;  4N9T A;  2M2L A;  4UAI A;  2ENB A;  3EQL C;  2RKS A;  2EYJ A;  1Q1B A;  2NVX B;  2JP1 A;  1PZI D;  2RSN A;  2R61 A;  3LWE A;  4ID6 A;  2E2H B;  1I3Q B;  4KY6 A;  4FF4 A;  3GD7 A;  2R6G A;  4MN3 A;  1I50 B;  2HQE A;  2B2U C;  4M1U B;  1TWH B;  2I46 A;  2NN6 I;  3PIO 3;  3R3O A;  3BVM A;  1HPC A;  3OMC A;  1PTO F;  1TWG B;  3L3O C;  5I2X A;  2RDG A;  2QDB A;  5A2Q E;  5JVH 3;  1MGS A;  3FPP A;  2EE1 A;  3GTK B;  5C5L A;  2PQE A;  1U4L A;  3HKZ B;  4R8N A;  2XSC A;  3D6W A;  5IGB A;  1BXT A;  1NAP A;  1I4H A;  2L9H A;  3SVM A;  2F03 A;  4KKT A;  2Q8I B;  4C3I B;  2PYK A;  2RBM A;  3K57 A;  2IW3 A;  1G2S A;  4U68 A;  3NP8 A;  4PV1 C;  4CKB A;  2IX0 A;  1SYF A;  2B2T C;  3GTM B;  4I7Z C;  3R8B A;  3R2T A;  1JQY D;  1U4R A;  5IOC A;  4OO1 G;  3URY A;  4K6D A;  2F0O A;  2A6E C;  2R92 B;  3SEB A;  1KLU D;  1MSG A;  1YNJ D;  1TY2 A;  3KLR A;  4A3K B;  4XYQ A;  1GHK A;  3H6M A;  3T53 B;  1EEF D;  1C8C A;  1B1Z A;  2IX3 A;  3NQT A;  5EBC A;  1DM0 B;  4C3I G;  1SEB D;  3MXN A;  1DZ1 A;  1G8Z D;  4A3G B;  3HOV B;  1LTB D;  1EIG A;  4ZKB B;  3QG1 A;  1EY7 A;  3H0G B;  3I73 A;  2Q8T A;  4DK1 A;  3I4N B;  3U9O A;  2EY1 A;  3PIP 3;  3TME A;  2AUK A;  3QO2 A;  1ONL A;  4HTH A;  1VDZ A;  3D31 A;  4YIJ A;  1SDF A;  3FKI B;  4BS9 A;  1TY0 A;  2G9H D;  2R3Z A;  2SNM A;  3S2D B;  2JA6 B;  2EYF A;  4DNR B;  1OXS C;  5FLX L;  3OW7 A;  2A6H D;  4JK1 C;  3QWN A;  4OHJ A;  2ZXP A;  5AFW A;  2AQ2 B;  4N9P A;  2B2Y C;  3GTJ B;  5CYU A;  4G7Z C;  5IGG A;  2JA8 B;  4C3J B;  3ND9 A;  3WOE A;  4C1N K;  1D6E C;  1L0Y B;  3S14 B;  2RDF A;  3HZX A;  2QKI C;  1Q12 A;  3GV3 A;  2PCF B;  5I9O A;  3C3L A;  2KUM A;  2EPB A;  4OGQ C;  1SSO A;  1BOS A;  5D3D A;  2AQ1 B;  3G7L A;  1KDA A;  5C44 B;  2PO4 A;  1SFO B;  2EYM A;  3PUW A;  2EZV A;  1GUG A;  5CV6 A;  1X3P A;  4RKB A;  2EYP A;  2K03 A;  5D3I B;  1G6Z A;  3Q23 A;  1SJE D;  2SDF A;  1AFP A;  2E75 C;  5KYL A;  2EY5 A;  3F2U A;  2MGS A;  2N88 A;  4RH6 A;  1ZKO A;  1Y69 U;  4DAV A;  3TP7 A;  4TQU S;  2VB2 X;  3BS1 A;  1HQR D;  5COY A;  3MFG A;  4NKL A;  3SK8 A;  4A3E B;  1SMY C;  3D8G A;  5HGT A;  3CKI B;  2JEA I;  2EJF C;  1ZEQ X;  2C9O A;  4IN3 A;  1IYU A;  1RJT A;  4E6I A;  2WKC A;  1O7Z A;  1IW7 C;  2E2I B;  1PFN A;  2NN6 H;  3TP8 A;  2DNC A;  1HRJ A;  1KDC A;  4KJN A;  1I4X A;  4EGV A;  3RUZ A;  4L6T B;  4CJ2 C;  1MI2 A;  2E76 C;  1Q1E A;  3OSO A;  4EQN A;  2F0N A;  5C0X H;  1PFB A;  4HAE A;  3GQB A;  1SND A;  3OMG A;  1O78 A;  3VYS A;  3EFX D;  4FP5 D;  1SBB B;  2D62 A;  1RTN A;  3WDN A;  3HOY B;  2BA0 A;  2F0H A;  4KI0 A;  1JOK A;  2AQ3 B;  2VB3 X;  4CBV A;  1ICW A;  1CA6 A;  2RQX A;  2F0E A;  2XWJ B;  4QF4 A;  1HHV A;  1A2U A;  3GV6 A;  1SYD A;  4IUT A;  4HMJ A;  1ENF A;  1Q3L A;  3FRP B;  3RZD B;  4A3B B;  3NE5 B;  3MXG A;  1TT2 A;  1STN A;  2F0V A;  4ABN A;  1SE2 A;  1FD7 D;  3A8I E;  4QB4 A;  3TZD A;  5JOB A;  4KHZ A;  3FEW X;  3MAQ A;  2D2C C;  5JEA J;  5LHY 1;  3DUZ A;  4NW2 A;  1K83 B;  4IFD J;  2JYO A;  3L7Z C;  1SE3 A;  4QIW B;  1GUN A;  4FNF A;  3HOZ B;  3I91 A;  3NHH A;  3NQI A;  4PMB A;  5I4D A;  2IT1 A;  1WD0 A;  4XQN A;  1ZXT A;  1AEX A;  2L55 A;  5DEH A;  3S2H B;  4CKE A;  3QJY A;  2B2U A;  3VYR A;  3K6O A;  3OWF A;  2B2V A;  5C6A A;  2IL8 A;  1ENA A;  4XXE A;  2CHB D;  4O42 A;  3OWE B;  1Q90 A;  2SOB A;  3NK9 A;  1RTO A;  1V1P B;  2F0K A;  4RHS A;  1S5E D;  4RFB A;  5I6W A;  3D3R A;  1ZYR C;  5EPK A;  3MEH A;  2FHT A;  4XT3 B;  1C4Q A;  1FNU A;  3K5O A;  2FJ2 A;  3Q24 A;  5C3W A;  2F1M A;  4PMC A;  2I07 B;  1FNV A;  2M9V A;  1BF4 A;  2NBF A;  4OIJ A;  2MUY A;  1RD9 D;  5D14 A;  2K5W A;  5DM6 3;  3PO2 B;  4XDX A;  1PZJ D;  2JA7 B;  3CRK C;  1WCM B;  2XIW A;  1F2M A;  3VYU A;  5C4H A;  1GUS A;  3V05 A;  5M3M B;  4KK7 A;  1S5F D;  4XTC S;  1DOK A;  4K2L A;  2K6A A;  3BZD B;  2AWN A;  1HUM A;  2XVS A;  1KAA A;  1SJH D;  2F0U A;  3SXH A;  5EJW A;  1SYG A;  3S1R B;  5EBD A;  3HEJ A;  1EOT A;  4WOR A;  5T1G A;  3V2T A;  4RGO S;  3VR3 A;  4IAL A;  1Y1V B;  3DWQ A;  1DXM A;  1PZK D;  1DD2 A;  1Y8O B;  5JJZ A;  2K28 A;  1F9P A;  4XIG S;  1EIH A;  2NZ1 D;  4DNT B;  3FVQ A;  4PMW A;  3VR6 A;  1SNO A;  1O80 A;  4RCN A;  1LT5 D;  4F87 A;  4ZQ3 A;  5C4J B;  1HUN A;  3PO3 B;  4FYD A;  1D1K A;  1HXY D;  4KY5 A;  1V8Q A;  1LAC A;  3A55 A;  1FR3 A;  1RKN A;  5CV5 A;  2IX1 A;  3FDT A;  5LL6 X;  5CR3 A;  3HGB A;  1EZ8 A;  1O7L A;  2A69 C;  2B2Y A;  2RVL A;  3Q22 A;  4QUF A;  2PZU A;  4HED A;  1T5X D;  5C4Z A;  4OO1 H;  1F9Q A;  1G2T A;  3PV0 A;  4F7X A;  1CK1 A;  2JXM B;  4LJZ C;  1OXT A;  1ML0 D;  2FMM A;  3OPO A;  1MSH A;  5BN5 A;  3IKJ A;  3AU7 A;  3JAM E;  4DXF A;  1B2T A;  3NBI A;  1V43 A;  3RD4 A;  3TZU A;  1QWY A;  1IW7 D;  3T13 A;  2KJX A;  4TKO B;  4IUQ A;  4R8I A;  1KAB A;  3HG9 A;  1EY0 A;  2KOL A;  1K8M A;  4A3M B;  1ET9 A;  1J8I A;  5C3X A;  1SXT A;  4K5W A;  2O4X A;  2B2V C;  3T56 B;  3BVG A;  4IUP A;  1TVX A;  3A8J E;  1JWS D;  1VF7 A;  3I3C A;  3DM1 A;  2MHV A;  4P2C B;  4ME5 A;  1EWC A;  1GOZ A;  1ILP A;  1PRT B;  5C0X I;  1HTP A;  5NUC A;  5C4X B;  4XT1 B;  2K33 A;  5JVG 3;  1VCI A;  1WVL A;  3R2I A;  5D65 A;  4F88 A;  3RZO B;  1DYQ A;  2EVB A;  2GA4 B;  3OOC A;  3E5S A;  2IJ0 A;  1AZQ A;  2JA5 B;  4FXG C;  3S17 B;  3T51 B;  3X3N A;  2WV6 D;  3A56 A;  2D9U A;  5EPL A;  2PPB C;  3Q6S A;  2B39 A;  1PDQ A;  1ESF A;  3J7A F;  1WTQ A;  1TS4 A;  3HOU B;  3HP3 A;  1LT4 D;  2L5T A;  2EXZ A;  2KEC A;  1E2Z A;  2HCC A;  3GTP B;  5JPN C;  1WTR A;  4RAU C;  4B9X A;  1BCP F;  4LAA A;  4RKL A;  4A3J B;  1ET6 A;  2F0L A;  3M3Y B;  4A93 B;  4X3T A;  2EJM A;  1JWU D;  1TS5 A;  1D5M C;  3CU7 A;  5IIF A;  1AP0 A;  4RGN A;  1OXX K;  3MZ5 A;  3J80 L;  2BE5 D;  3BYT B;  1TWF B;  4IFD G;  1WTW A;  1UNS A;  2CVR A;  4C2M B;  2AUJ D;  1I4P A;  3BG3 A;  1JC7 A;  2Y0S B;  5IT9 L;  2L1B A;  1TS2 A;  2F0D A;  4HN7 A;  1RDP D;  2WKD A;  1STA A;  1UEA B;  2AWO A;  3PUX A;  2FFK B;  1AW7 A;  3TN2 A;  4K14 A;  3L9A X;  4H7B A;  2SNS A;  1B9M A;  1RF2 D;  1VMP A;  2YU9 B;  4KD3 A;  1Z6H A;  2PZT A;  4X3K A;  1S5D D;  1QOH A;  2PW5 A;  2F4I A;  1S5C D;  3VYT A;  5J39 A;  2CW0 C;  1DON A;  4X3U A;  3PUY A;  2WII B;  3V96 A;  2F0Q A;  2F0M A;  3I90 A;  3S1N B;  2KA7 A;  4FF3 A;  3UI2 A;  5EQ0 A;  2WAC A;  4XYO A;  2NVT B;  2F3W A;  5EKK A;  3BVZ A;  3D4R A;  3LX0 A;  3P75 A;  2B63 B;  5A35 A;  5KND A;  1ESR A;  1PRT C;  3K58 A;  3HOX B;  5BN4 A;  2LMC B;  1PTO D;  2K32 A;  1FYC A;  3P20 A;  2PMZ B;  1F9R A;  2R93 B;  3GTO B;  4RWS C;  2MJ8 A;  5C3E B;  1PFM A;  1LLR D;  4S3S A;  3SDZ A;  3IL8 A;  4HR7 B;  1CHP D;  2J4X A;  3OIQ A;  5JPM C;  3QB3 A;  3K59 A;  2F3V A;  4U67 3;  1SNM A;  1B3A A;  1DOL A;  3MC0 B;  1CFM A;  4RGT A;  3PUV A;  3VA5 A;  3MXU A;  1SAP A;  4KMU C;  5ELB A;  2DY7 A;  5CV9 A;  3GTQ B;  2H1E A;  5FK9 C;  2BA1 A;  3MVV A;  1EWH A;  5G3L F;  3D6C A;  4HSP A;  4DU9 A;  4RCO A;  3O13 A;  1BCP D;  2LFN A;  1KDB A;  2J7Z A;  1II3 A;  1TS3 A;  1YNN D;  2VUM B;  4OO1 I;  1A3U A;  1SYB A;  2F0I A;  2XN9 C;  5EPJ A;  1STG A;  4TRD A;  1TII D;  1HA5 A;  2OF1 A;  3U9S A;  3N52 A;  5FKA C;  4FVM A;  3MFY A;  3AMU A;  4WRD A;  3P7J A;  3I4L A;  1EY9 A;  5E3F A;  3H3V C;  3TSS A;  2KHS A;  3S16 B;  1MBY A;  3BDL A;  1F2L A;  1HQM C;  3PMF A;  1R4Q B;  1S4Z A;  1VF5 C;  4IQZ A;  1Y8P B;  5FO7 B;  5KNB A;  1PTO B;  2OEO A;  3VR4 A;  1WD1 A;  1GUT A;  3QOL A;  4HSV A;  1I4G A;  1H9M A;  2VNU D;  5IGF A;  3J7A V;  1QB5 D;  4C1N I;  1EU3 A;  1V1P A;  1H9J A;  5ELD A;  1B53 A;  3DMU A;  2R7Z B;  4OL7 A;  4BY7 B;  4FXK C;  5M5W B;  4I65 A;  4ZUJ A;  1PLF A;  3LNN A;  1IL8 A;  2M00 A;  4FF1 A;  2TMP A;  2WP8 J;  2ZXR A;  3KBG A;  5CGK A;  4ULL A;  1YNJ C;  2QF7 A;  1IKL A;  2EY2 A;  3SE0 A;  1H9K A;  2A6E D;  4KY7 A;  4BBS B;  4KN4 C;  4CJ1 B;  2EYL A;  4B08 A;  4F8M A;  2B8G A;  3AB9 A;  3VR2 A;  3J81 L;  2KVM A;  1W6K A;  3C1F A;  3M7G A;  2A68 C;  1NSN S;  1IKM A;  3M4O B;  3ERO A;  3D4W A;  4RHR A;  4KD4 A;  1BO0 A;  1Y8N B;  1BDO A;  3NXW A;  1I6V C;  1F2Z A;  3K5N A;  3TP5 A;  2K05 A;  1D5X C;  1LV9 A;  4WFN 3;  2A74 C;  1FNW A;  1A3T A;  4TSS A;  1OO9 B;  1G91 A;  1B50 A;  2J0T D;  2A6H C;  5EGT A;  3W3A A;  1SNC A;  5IGC A;  3I72 A;  1U4P A;  3W2D A;  2F0S A;  4K2K A;  4H13 C;  4K6L A;  4RA8 A;  5CV4 A;  4K5V A;  3M7N A;  3FPU B;  4G7H C;  2YYZ A;  1QNK A;  2RA4 A;  4BBR B;  4WJW A;  5CBA E;  1AZP A;  2KCN A;  2QEJ C;  4X3S A;  1NUC A;  1GUW A;  1CZG A;  2CW0 D;  4J6H A;  2K7V A;  3I4M B;  4B9W A;  2XNA C;  2K04 A;  1PMR A;  1B44 D;  1EY8 A;  1E2V A;  1X32 A;  4HMI A;  1H9S B;  1B4O A;  2ICE C;  3LWU A;  1IYV A;  2L12 A;  3E6Z X;  2CQA A;  5E4X A;  4J8Q A;  5M5X B;  2XRQ D;  1X3Q A;  2WIN B;  4MIU A;  4DAP A;  1WTP A;  2PNR C;  1TKW B;  3M4Y A;  3N6R A;  5ELF A;  2RDH A;  3DEO A;  5CBE E;  1GHJ A;  1UUP A;  4C3H B;  1SMY D;  2F0F A;  2V4D A;  2WB1 B;  5BN3 A;  1KLG D;  3MWY W;  4A3I B;  3A8K E;  3R93 A;  3S15 B;  2LY7 A;  1EQT A;  3E0J A;  4IFD H;  1U9R A;  1JR0 D;  1H9R A;  4KHV A;  5M9O A;  3KLS X;  1E0B A;  4LK1 C;  1JCK B;  1D1I A;  3OHX C;  3Q0A A;  1QE6 A;  4Q5V A;  2ICI A;  1SNQ A;  2IWH A;  2XRS D;  3C46 A;  2NVY B;  2L4N A;  1EY5 A;  5K5P A;  1EYA A;  3EA6 A;  1WTO A;  4C3H G;  1QIL A;  2DN8 A;  5K36 G;  3G6J B;  3H94 A;  4DN4 M;  3BYY B;  1KTK A;  1XX8 A;  3SK5 A;  1F77 A;  2Z1C A;  1I4R A;  4IUV A;  4QMG A;  5FO8 B;  3ONA B;  2E2J B;  1I6H B;  3DWP A;  1JE4 A;  5A2Q L;  1CT1 D;  1A3V A;  3ZYY X;  4G7O C;  3MXP A;  3IFT A;  3P1H A;  2HUG A;  2XWB B;  5J1Z A;  1WTX A;  4ZYS A;  2FIN B;  3NWS A;  5ISR A;  3K0Y A;  4QCL A;  2QIL A;  5KGU A;  4H44 C;  2L11 A;  3DXJ C;  3MA2 B;  2DY8 A;  4L8J A;  3BDC A;  2EYO A;  4FF2 A;  4XQJ A;  5C0X J;  2WAQ B;  1I4Q A;  1M4V A;  2EY6 A;  2E74 C;  5I6Y A;  2L0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...