1G6ZA

Solution structure of the clr4 chromo domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
ISSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLR4 PROTEIN
publication title Solution structure, domain features, and structural implications of mutants of the chromo domain from the fission yeast histone methyltransferase Clr4.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 7
structure length 70
sequence length 70
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g6zA00
1F9PA 4OIKA 4X3KA 1G2SA 1PFBA 1DOKA 5EJWA 1C8CA 1EIGA 3GV6A 2J7ZA 2K03A 4NW2A 4CJ2C 4ZLTF 2NZ1D 2IL8A 2R3ZA 4HEDA 1VMCA 3Q6SA 1AZQA 1J9OA 1ML0D 4U68A 1O7ZA 2HCCA 1BO0A 1QNKA 2K04A 2MGSA 1WTVA 2K05A 2CVRA 2FMMA 4R8IA 1ESRA 2B2TC 4O42A 1WVLA 1XX8A 2EOTA 1JE4A 1HRJA 4DN4M 1TVXA 1KNAA 2K01A 1VMPA 3IFDA 1U4LA 2DY7A 4ZK9B 1B53A 1WTOA 2MP1A 4OIJA 2Q8RE 2B2TA 1WTQA 3N52A 2HCIA 2EPBA 1B50A 2X69A 2B2UA 1O80A 2L9HA 4UAIA 1AZPA 1SDFA 1F9QA 3R93A 1WD1A 2B2WA 4IURA 4IUVA 5E4WC 1F9RA 2NYZD 1HUNA 5EPKA 2FINB 2RSOA 4ZKBB 1IKLA 3F2UA 1U4MA 1PFNA 1DOMA 1O7YA 2HDLA 2KOLA 1U4PA 4IUTA 2HUGA 3DEOA 1EQTA 2FJ2A 3I90A 5EKIA 3FPUB 1WTWA 4ZAIA 1CA6A 2Q8TA 1A15A 5CBEE 1DOLA 2SDFA 2RVLA 5CBAE 3TN2A 1KNEA 1G6ZA 3I8ZA 4RWSC 1XYIA 1B2TA 1HFGA 2L4NA 1E0BA 2MJ8A 1EOTA 2FHTA 4LMQD 4X3SA 1MSHA 3HP3A 3TZDA 1AP0A 1EIHA 3MWYW 2KEDA 2NWGA 1WTXA 1IKMA 2B2VC 2KUMA 1ZXTA 1HUMA 5CORA 1HA6A 1Q3LA 1X3PA 1GUWA 1F2LA 1NR2A 1S4ZA 5T1GA 1PFMA 2EE1A 2K28A 1BF4A 1NR4A 1G91A 4ZKCB 2HDMA 3LWEA 4QUFA 1BBXC 1CM9A 1MSGA 5EPLA 3DM1A 3I3CA 1QE6A 1NAPA 5COYA 2B2YC 2D9UA 2FFKB 1X3QA 4XDXA 1NCVA 1WD0A 3FDTA 3P7JA 5EPJA 1RTNA 3H91A 1ILPA 5D14A 1RHPA 1B4OA 2H1EA 2M2LA 1B3AA 3DEPA 5D65A 2KVMA 1JICA 1LV9A 2L12A 4HAEA 1BNZA 4QUCA 1QG7A 3MTSA 1X32A 5AFWA 1DONA 2N55A 1HFNA 1IL8A 2RSNA 2XIWA 1M8AA 1WTRA 1HHVA 2JYOA 1CA5A 1MI2A 5DNFA 1MGSA 3G7LA 1SAPA 3KUPA 3D6WA 4HSVA 4X3UA 4CJ1B 1J8IA 2JP1A 1DZ1A 1RODA 3QO2A 1PDQA 2L1BA 4RA8A 2MPMA 1SSOA 2N88A 5T1IA 2B2VA 3UI2A 1RTOA 1WTPA 3GV3A 3IL8A 1G2TA 4IUQA 4XT3B 1RJTA 2BDNA 3KBXA 2K1BA 2X6LA 4MHEA 4IUUA 3SVMA 1F9SA 1ILQA 1U4RA 2B2UC 2KEEA 5CMDA 1EL0A 1PLFA 2KECA 2VXWA 2B2YA 2L11A 2X6GA 4MN3A 5E4XA 2B2WC 3I91A 4CJ0B 4IUPA 4RAUC 2RA4A 5EQ0A 4R9WA 1ICWA 4X3TA 3ONAB 5JJZA 4XT1B 2DY8A 4HCSA
chains in the Genus database with same CATH superfamily
3DHQA 1BVSA 4AYBB 2B8GA 4BY7B 4KK7A 2K5NA 4GLVB 1NSNS 2K03A 2ZJQA 2QEXA 3BZCA 1F2YA 2K4KA 4LF9L 1HPCA 1SNDA 5CYUA 4NXML 4APVA 2MGSA 1YZ6A 3OPOA 2R92B 1Q8IA 4HSPA 4BY1G 1Y8NB 1E1OA 1D1IA 4UDUC 3TMEA 3T51B 2DJGC 3SK5A 1F9RA 4IJHA 2PQAB 3NK9A 1LT4D 5IYDH 4DNRB 2PQEA 3RZOH 1L0YB 2CKZB 1SJED 5ELEA 1M90C 5ISRA 4I65A 1VQMA 3T16A 2L0CA 1GUNA 1ZKOA 5IGCA 3HKZB 2OF1A 2L5TA 5KIXA 2NVTB 2F0VA 2DGYA 1TY2A 2OTLA 2NWGA 4AYBG 2AWNA 1V9PA 2G9DA 4OELB 2K28A 4R4CA 1MJCA 1EFWA 2IX3A 3MXPA 4X62Q 3K5OA 2R7ZH 3CMEA 5COYA 2B63H 5IP9G 2NN6G 2QF7A 1G6PA 3R3OA 1TWAB 1Y1WB 2R92G 1HNWQ 3DEPA 1EY7A 5D65A 1FGUA 2HD3A 4A3EG 1HNZL 2CCZA 1WTHA 1XJVA 2XIWA 4JG2A 1WTRA 4JI2Q 4C2MB 3CCQA 4P74A 3D6WA 4X3UA 2D5DA 3LNNA 3IKJA 1PXUA 2O2LD 3VYSA 5M3MH 4DA2A 4A3CH 4N8X1 1CHPD 1Z6HA 3ICEA 3GV3A 3IL8A 4QJFA 1K73C 3S17H 5M5YB 1EOVA 2D62A 4X62L 3I56A 2K1BA 4ZYSA 1E22A 3I4MH 3KLRA 2X6GA 2WAQB 4DF7A 2ZM6Q 4HIMA 4G7HC 3PSIA 1SNPA 1PH2A 1XWEA 4R9WA 3VR3A 3VDYA 1NMFA 3I4OA 4LFCQ 3KK7A 4ID6A 4RKBA 1XPRA 1PFBA 4XXEA 4JI2L 4LF6Q 1AN8A 2Z6KC 1BBUA 1V43A 5C5MA 3S16H 2K50A 5GAEC 4BWGB 1L0XB 5DLQE 4ABNA 1LTGD 1WOCA 1KAWA 4K14A 1ASZA 2EOTA 4BY1H 2RKSA 4R4QA 3N52A 4LFBQ 3JAMc 1PTOH 3G48A 4FF2A 1QB5D 2ZM6L 3ND9A 1I4RA 1YNJC 1WD1A 5E4WC 5EPKA 2QGQA 1FGBD 2JA6G 1EYCA 4LF6L 4H0LC 3K5NA 2I0QA 4JI5L 4ZAIA 3I55A 2L15A 2EY5A 1G51A 4BY7H 1PRTD 2L55A 1ICFB 4Y52H 3ULJA 2JEAI 1XNQQ 3NTIA 3HP3A 1VQBA 2XN9C 3H15A 4KY6A 1I6VC 1E2WA 1Q3LA 1UNSA 4EGVA 4LFBL 1NR2A 2F0GA 4PNYA 3J80i 5IP9H 1XMOQ 2NN6H 3MZ5A 2ZXOA 1T9HA 2C35B 1SFOB 2R92H 1OO9B 2SNMA 2F0KA 4HR7B 4GKKQ 1Y14B 1JJ2A 4XDXA 4A3EH 4HMIA 4XQNA 1EZ6A 4B3MQ 5JEAG 3Q24A 3S1NB 2A5HA 2KVMA 4A93G 3JAML 4JC0A 4QUCA 4J6HA 1D8LA 3UDFA 2HQLA 2Q2UA 3ULPA 3NEMA 4CDFC 3NHHA 1DJRD 1BKBA 3NTHA 1LTID 2PNHA 3S2DB 1SAPA 3HOVG 3W1BA 1JWSD 3TZUA 2OEOA 1XMOL 2XSCA 4IUNA 2MO1A 1WCMG 3RMHA 4NXNQ 2NVTH 2EY6A 1VQIA 2A68D 4GKKL 1F9SA 1AW7A 1N36L 1C7YA 3TBIB 4B9XA 3OSOA 5AJ3Q 4B3ML 4Q0FA 4YHHQ 1LYLA 4LWCA 1VQHA 4HMJA 4IPDA 3NWTA 2PO4A 4X3TA 2LKVA 3F2BA 4OIKA 3C2PA 2JSOA 1TWAH 4KD3A 1Y1WH 3WOEA 2E2HB 1SNCA 5FLXE 4A3BB 3CC2A 4IO9A 4RHRA 1B7YB 2PW7A 4A3LG 3KDFB 3BJUA 4A3FB 2GVAA 4C2MH 3H94A 4NXNL 5IYCG 2NB0A 1RD9D 1SYEA 3RR5A 5M5WB 1KXLA 2BE5D 4GN4B 2O5JC 4OIJA 2BH2A 1I50B 2JA6H 1F9QA 2VUMG 1Q82C 1JE5A 4O1NA 4UP8A 4U673 5KNBA 2EYPA 1M4VA 1W2BA 4KMUC 5C0XH 5EKIA 5CBEE 4J15A 2EJGC 3VYUA 4X6AH 2RCFA 4UPAA 4A3KB 3H3VI 1B2TA 3T1YQ 1F77A 2Z6BA 1YIJA 2VNUD 3M7NA 5I6WA 1MD2D 1KIXA 4PMWA 2Z8LA 1HA6A 1YBYA 3E3XA 4CKCA 1K83H 3CHBD 3DLLA 5JEAH 1SE4A 1CSPA 3F2DA 4A93H 1SYBA 2PZTA 2E76C 2EY1A 3K57A 1B3AA 3CCLA 3HOXB 3HOVH 5AFWA 3TP8A 4CDEC 2RSNA 4OX9Q 1M8AA 4NB3A 3CKIB 2RDHA 1MGSA 1XXGA 1Z7TA 3PCOB 2UXBQ 3GP7A 5IT9c 1W3SA 1CFMA 4CHTB 1RTOA 1XNRQ 4JW0A 4A3DB 2YTVA 2UUBQ 1SE2A 3TS0A 5CV7A 3UDGA 2N8NA 1K8GA 2VS1A 3CQZH 3ER0A 4MN3A 4DR7L 1LTSD 2OT2A 3CAMA 1TWCH 1CKNB 3AU7A 3T56B 1KC8C 2QILA 2JA8G 2AQ3B 2DY8A 1I4HA 5A2QE 2CWPA 4LF7L 4ZLTF 3E5SA 4EQ5A 4HEDA 1F2ZA 4A3LH 1ZEQX 1KL9A 2A1AA 2A74C 4K5WA 1LO5D 5C4JH 5ELOA 1SN8A 3S1RB 3S1MB 3KFUA 2IW3A 4ME5A 1XNRL 4QIWE 1TWGB 3S2DH 3S14B 2HQEA 2IHFA 3RD4A 2K01A 2UUBL 3HEJA 5GQOA 4DR1Q 3CD6A 3QG1A 2B2TA 1Y1VG 1AE2A 3J80E 1EY4A 1L2FA 2Z4IA 2F03A 1A63A 2F0OA 5IT9L 1FR3A 3MEHA 4JVZA 3KF8A 2Q2TA 3HOWG 1ET6A 1RF2D 1VS0A 3R2TA 3M4OB 3FVQA 5E1FA 1OXTA 4LUZA 2F4IA 5C3EB 1R9TH 2K6AA 2E2HH 1RDPD 4IZ8A 1LTBD 5H1SE 3CW2C 2JA5B 5M3FG 4BA2I 4DR1L 2B2VC 1YI2A 4NP5A 1G91A 2EE1A 2PZWA 2PZUA 1JOQA 5JVG3 5EKKA 1MSGA 3JC66 2B2YC 1EIYB 1FNWA 2A6HD 3Q8DA 4UP7A 4XYOA 2R93B 3RNUA 1I50H 2WB1G 4X66L 2E74C 1SMYD 3K5LA 2VB2X 1TXYA 1HNXQ 1D1KA 1MIUA 1QG7A 1W6JA 2OWOA 1HFNA 3BYYB 3A7AB 4KV6A 4ULLA 2PMZB 2V1CC 1QUQA 4IFDG 1BCPC 1PDQA 3K0YA 4DV3Q 3P20A 1LTLA 3A5UA 4JI1L 3Q22A 1NY4A 1G291 2AKWB 3GTMH 2Y0SE 1R4PB 2XRQD 3L0OA 2BA1A 4C56C 2RBMA 2JA5G 2AWOA 2SOBA 3I7FA 4H02A 4HN7A 4PV1C 2AMCB 1HNXL 2ASBA 1VQ8A 3L7ZC 1I94L 3RLNA 1DOKA 4GOPC 1DYQA 4V0BA 2R6GA 4YIJA 1EY0A 2IL8A 3QOJA 3FKIG 3VYTA 5LL6X 2NVXH 3FMCA 4DV3L 2A68C 5IGBA 1HR0Q 4QB4A 3ITPA 1WVLA 1Y1VH 5ELBA 4L8JA 3EA6A 2Q8RE 2KQ3A 3W2DA 1O80A 2MO0A 1KTKA 1LABA 4DV4Q 4IOCA 1WYDA 1K8AC 4A3DH 2B2WA 4IUVA 4G7OC 5IP7G 1VF7A 2UUCQ 2RSOA 1PTOC 1VQDA 2K5QA 2KOLA 1XTDA 3FPPA 2NZHA 2F0WA 3U9SA 3I90A 2QW7A 3F1ZA 5C4XG 5KNDA 2ZT9C 1QWYA 4DAYA 1A15A 1AEXA 1STHA 1TWFB 2RVLA 1A2TA 5M3FH 4RWSC 4C3IG 5FLMH 1GVPA 5C4HA 1JQYD 4RGTA 3D3RA 5J1ZA 2BE5C 2B63B 1EOTA 1EY5A 3E9IA 2RDGA 1XPUA 3VR4A 1AE3A 4FP5D 1ZXTA 5DAUA 3S1RH 1F2LA 1PFMA 4GNXC 1VQOA 3GTGB 3S1MH 4ZKCB 4B3SL 4GZYC 5IYBG 3HFZB 4DV4L 1O7IA 1BCPB 5KEEA 3S14H 1EU3A 3OIPA 4JBKA 3P1HA 2FFKB 2H4OA 1RL2A 1RTNA 1XPOA 1RHPA 1SE8A 2H1EA 5CGKA 2LFNA 3J7AV 2IPKD 3KLSA 1N34Q 3S17B 4GS3A 3VA7A 4IFDH 1GXDC 3F8TA 1RKNA 3GTQB 2JYOA 2LXJA 1N32L 3I4MB 3T13A 1UAPA 4KTAA 4GOPB 4A3MG 2LMCB 3JAMi 2UU9L 4J1MA 1S5DD 4FDBA 3G71A 1MBYA 1STBA 2N78A 3A54A 4E6IA 2EYOA 3CRLC 2JA5H 5GAHC 1EWCA 4X64Q 5F2DA 1PA6A 4FYDA 4JV5Q 2F0QA 4YY3L 1PH1A 5JVH3 1ENAA 1Q86C 4JI7L 2F0HA 4OWWB 2JA9A 1BBXC 3NBHB 4HCSA 1PV4A 2K5VA 4BY1B 4X3KA 1PH4A 2A6EC 4NW2A 1H95A 3OW7A 4LF9Q 1TQOA 5CV5A 4DUZL 4NXMQ 1PTOB 3D8GA 3I72A 1EEID 2MFIA 4A3JG 2MHVA 1PH8A 3EIVA 1VQEA 3DWQA 1P8LA 3HGBA 2UXCQ 1EY8A 1TVXA 4M1UB 1B53A 4DAVA 1C0AA 5IP7H 1X3EA 2OXPA 4DU9A 2X69A 3QJYA 3NUCA 4NKLA 4OWXB 1STAA 1SDFA 4GLXA 4RGNA 3IAYA 1QZHA 3S24A 1I3QB 4X65Q 1II3A 3DWAA 3SE0A 2MNAA 3V96A 3F2UA 2CHBD 4POFA 4C3IH 4RH6A 1KHIA 3IRBA 1JJGA 4ILWA 3RLFA 1YNNC 1DOLA 2XNAC 1BDOA 4DK3C 5DEHA 1X56A 3OMGA 3STBD 3J7A5 1E7ZA 4BBRG 3IFTA 2UXCL 4FXKC 4A3EB 3GTLH 1GUWA 5T1GA 1VQJA 1Q1BA 2F0LA 4WJ4A 1JCKB 2KHIA 4PG3A 4QUFA 5HGTA 1NAPA 3J7AF 4X65L 3GTPH 1WD0A 1ILPA 1HNZQ 2XRSD 1SLJA 1CUKA 1H9JA 3NWSA 5BN3A 5IODA 1OXUA 5LMUQ 1IL8A 1KD1C 4RKLA 4A3MH 4DR4L 3DMUA 3ND8A 3KUPA 4QY7A 4CJ1B 4HSVA 2Z9HA 1RODA 1R4QB 1SXTA 1GUOA 1DGSA 4OHJA 1TWFH 2D0PA 3I4LA 4IPCA 2A6HC 3ZYYX 2EXDA 2BDNA 2NTTA 4JOIC 2LY7A 2MQHA 2Z0SA 4DR3Q 2NVQH 1TS3A 1EQVA 2L11A 1ENFA 3L3OC 3GTGH 1P16A 4YCWA 5KRUA 3W1GA 3CCJA 3LX0A 2EYHA 3J81i 1KAAA 3NTKA 1B9NA 1F9PA 5LMUL 3NELA 1M1KC 2V4DA 3MVVA 1CKOA 3QB3A 4IALA 4A3JH 2NZ1D 1IYVA 3Q6SA 1HH2P 1UEBA 4EX5A 1AH9A 3UDXA 5C0XJ 3CPFA 2JA6B 2K33A 2CWAA 2UXDL 2CVRA 2FMMA 4DR5L 4R8IA 4DXGA 1XX8A 4N9PA 5GROA 1JE4A 3GTQH 5CV6A 3IFDA 5FO8B 4DV0Q 4CKEA 4DR3L 4V190 4JI4Q 4HIDA 1D5XC 4EQNA 3TRZA 1U9RA 1Y8PB 3MXNA 1AZPA 4IPHA 5FKAC 2K52A 2AQ1B 3GTKB 1VQKA 4GN3B 2K32A 5JEAJ 1SYDA 4JI5Q 3URYA 1EQTA 4LUVA 1EEFD 4BBRH 1D5MC 1K83B 3S9WA 3MXGA 4R4TA 3AEVA 4A93B 2Y0SG 1T5EA 3X3NA 2PW5A 4DV0L 1CTMA 1YHAA 4JI4L 1VQAA 3LWEA 3JAME 3HOVB 5EGTA 1SNMA 1W6KA 1QE6A 3I3CA 4POGA 1C48A 3NXWA 1ZYRD 4QGUA 1WCMB 2ZTDA 3H91A 4GKJL 3CXCA 1J6QA 1B4OA 2M2LA 1PH9A 2JA7G 2AUKA 1GHKA 1EU4A 1BNZA 4LW1A 4DNIA 4ZCKA 1NUCA 1I3QH 4CBVA 3QWNA 3VYRA 4P73A 4RHSA 1U5KA 2B8FA 3CQZB 3V2TA 3SEBA 2N88A 5T1IA 1TWCB 3Q0AA 1V1PB 3CCMA 3CPWA 1A3UA 3F2CA 5IE8A 1G2TA 1YHQA 1N36Q 1I5FA 2K5WA 1SJHD 2KCMA 2EY2A 2F0TA 1B9MA 5FJ8G 3M85A 2OQKA 5C4JB 4OWTB 3LGJA 1UEAB 1A62A 4NPSA 5C0XI 1GOZA 3AFPA 2ATWA 2KBNA 5EAYA 3CCVA 3I2ZA 3S2HB 4NMZA 5CR3A 2I5HA 1C8CA 1YVCA 2ZTCA 3GV6A 3M4PA 4CJ2C 2UUAQ 2C5CA 2VUMB 1E2VA 1GUSA 2R3ZA 4F88A 3L2PA 5IWAL 3OW2A 1AZQA 2JXMB 1PH5A 4AH6A 1I6HH 2K04A 4FXDA 4YWMA 2PMZE 1JB3A 4C3JG 4L63B 2YV5A 5D3IB 4ZUIA 3K7AH 2B2UA 2KA7A 5IGFA 3TEHB 1R9TB 4IN3A 1HUNA 2XGTA 3PMFA 1OTCA 1Q1EA 5LHY1 2HDLA 2PYKA 1V1OA 1VQ4A 2UUAL 2CQOA 3FPUB 3WOFA 1CA6A 3BYTB 3GTOH 3I8ZA 3P75A 2CFMA 1L1OC 2A69C 3MFGA 2EZVA 4CKBA 2KEDA 3A5ZB 2QDLA 3AQQA 1BF4A 3ERQA 2XWBB 3QIAA 1K3BC 4P71A 4YCVA 4GN5A 4FF1A 1PH7A 4KN7C 3PO2G 3BDLA 5G3LF 4A3GG 3BS1A 1JJCB 3PUWA 3M9BA 1X65A 5IIFA 3STBC 3J81E 2IHEA 3PIO3 4G57A 3GTKH 1KLUD 4JI6L 3S1QB 3T53B 1S5CD 2WFWA 3GTMB 3L9AX 2R7DA 1DZ1A 2JA8B 2F0EA 4QF4A 1FL0A 1A3TA 3KLWA 3KF6B 1D2BA 2E8GA 3UI2A 1J5EL 1FYCA 5FJ8H 4LFAQ 4JBWA 3H6MA 3M4QA 1ILQA 1IHZA 4F7XA 2ALYB 4DR7Q 4Q5VA 4G4KA 5C44G 1JOOA 1XTCD 5M5XH 2NVXB 3EROA 2M00A 1X9NA 2EXZA 3AFQA 1ICWA 3CCRA 5JJZA 4LF7Q 5CC4A 2HHHL 1HA5A 1Y1VB 2EYMA 3J81j 1AFPA 1WCMH 2NUCA 1S5BD 1B3QA 4Y7NH 4FXGC 1WJJA 3T1HL 1D7QA 4C1NK 2E2JB 3B6YA 3EVQA 2YYZA 4C3JH 3HOWB 3M3YB 1WTVA 4ZQ3A 2F3VA 4WORA 5IT9E 3RUZA 4F8MA 2LSSA 4LFAL 2BOSA 4KN4C 2RDFA 1G8ZD 2DY7A 1MJEA 3SK4A 1IW7D 2JEBI 4TSSA 4JI8Q 4BBSG 2HCIA 2EPBA 4K2KA 1L1OB 2PCFB 5M3FB 3GDEA 3E9HA 5C3XA 2F0FA 4ZKBB 3DM3A 2ES2A 1Q12A 4PZ6A 1U4MA 1PYBA 2IT1A 2JJQA 5IYCH 3EQLC 1LT3D 1QVGA 1H9SA 1TS2A 1DXMA 1FNUA 3S2HH 5TSSA 2N3SA 4HJAA 2WB1B 2L4NA 4K8IA 4A75A 2VUMH 3EJIA 3X3MA 2K75A 1AP0A 3TZDA 2KCCA 5I9OA 2A8VA 1LTAD 1IKMA 3KBGA 4JI8L 1S4ZA 3QR8A 3PO2H 2HDMA 2GVBA 2VW9A 1PH3A 1QILA 3H3VH 3RN2A 1SROA 1KDBA 3BVMA 4P75A 1NNXA 1Z47A 2FMCA 5EPJA 1EQQA 3M7GA 2PNRC 4X66Q 4KI0A 4A3IG 4HIKA 4N9TA 1PYWD 2L12A 4AYBE 4QCLA 1DONA 3VR2A 4UHVA 4I7ZC 1BQQT 1PYSB 3DUZA 3KF8B 1TWHB 2NVYB 5BN4A 3PF4A 2MPMA 4DV7Q 4JI1Q 2F0UA 1WTPA 1D5ZC 2VQFQ 3I70A 3FKIB 2P5ZX 5C44H 4M8AA 3H0GG 3RN5A 2IY5B 4TQUS 1PRTC 2B2WC 5JPMC 2QEJC 1L0WA 4TVAB 4RAUC 1MHWC 2RA4A 2EDGA 1I94Q 2EQSA 1EIGA 1VQNA 3SHLA 4RCOA 1IYJB 1IL2A 1FJGQ 3PO3G 3HKZE 2HCCA 1A0IA 4DV7L 1X3FA 1QNKA 2I07B 4LF5Q 1OXVA 3S1QH 1TU2B 4N8FA 2YU9H 2VQFL 5C4XB 5HURA 1HCZA 1KNAA 2JA8H 4C3IB 1FNVA 1IZ6A 4ODGA 1QUQB 3K6OA 4KHVA 2L9HA 3UDIA 3GTJH 2VQEQ 1VQ9A 3I4NG 3FHWA 4DK1A 3OOCA 1CQVA 1PVOA 3GTLB 2EJFC 4IFDI 1OXXK 2FJ2A 3K58A 1QOHA 2QA4A 1FJGL 5CBAE 3G6JB 4LF5L 1EFID 1HFGA 3H09A 1IYUA 3GTPB 3EN2A 4IPGA 4O0AA 3RLOA 4EQOA 4F87A 5IY0A 2E2JH 2KUMA 5G3LD 3HOUG 1C9OA 4L5SA 4B3SQ 3HOWH 3HOYG 1TS5A 3M3YH 4LJZC 2ICEC 2F3WA 1HXYD 1NJIC 4KJOA 4A3IH 2F0PA 2VQEL 5IOCA 3KLSX 2D9UA 2WAQE 3CMAA 4A3MB 1ASYA 3C46A 1KABA 4OO1G 3TSSA 4QL5A 3A55A 4C3HG 4DV6L 1EY9A 2CW0D 5JJKA 2N55A 4C1NI 1PRTB 1CKMA 4L5QA 1JWUD 1N32Q 2XWJB 4DFAA 1YNJD 5DNFA 3CCEA 1EWIA 3TP6A 2NVQB 2F3IA 3QO2A 5KYLA 3M4YA 2HIXA 1PFSA 1Q7YC 2UU9Q 4IOAA 2CH4A 3TP7A 4RMFA 3KYHC 5ELCA 4XT3B 4KKSA 2MUYA 4YY3Q 4A3JB 4JI7Q 2VXWA 1HQMC 4H44C 5C6AA 1X54A 3S15H 1STYA 2YTXA 1VCIA 3K0XA 5ELDA 3MAQA 4DV1L 2OTJA 4MNOA 5GAGC 1HR0W 3PO3H 5J39A 4G7ZC 1NE3A 4DUZQ 4KKTA 3R2IA 1SRUA 3QOLA 4DGZA 5I6YA 4FVMA 4JK1C 3CP0A 4A76A 3PIOA 1YHBA 2K05A 5FO9B 4TKOB 1K28A 1ESRA 1TWHH 2NVYH 4DN4M 2ID0A 2O4XA 4GLAC 1T5XD 4K6DA 1Y8OB 4K8JA 4BBRB 1EYAA 2N49A 2RHQB 4HIOA 3FKIH 1KRTA 2RHSB 3HKSA 2FINB 1STGA 2R61A 1C4QA 3WDNA 3K80C 1BR9A 2VY3A 1LACA 2ZXPA 4FF4A 1LTRD 2Q8TA 2ZXRA 1BCPF 1Q90A 1SBBB 1SR3A 5D3DA 3K81C 4LNQA 3HOYH 3AB9A 2FHTA 4OONA 1YITA 4B3TQ 2IX1A 1Q8KA 4QIWB 2F0DA 5EBDA 3N6RA 2JQOA 5C4XH 5LMNW 4GNXB 4OO1H 4R1JA 1K8OA 4DAMA 5M3MG 3RZDH 2HIVA 4KLKA 4QMGA 2I46A 3T4AC 1CSQA 4DR4Q 3FP9A 4HCEA 5IYBH 3PV0A 3BZKA 4B3TL 4H7BA 3UE1A 3J7YW 1VDZA 1LLRD 1QNUA 1GM5A 1IBKQ 2Q8IB 2PQAA 3TS2A 1F2MA 3PQIA 4IUUA 2LS01 3WWVA 2K5DA 3VR5A 2OQ0A 2F0MA 4DUYQ 1N9WA 4KY5A 3R8BA 1PTOF 4DPGA 1KDCA 4FO2A 4OGQC 2NBFA 1I6HB 4K0KL 1J8IA 5J3BA 1PZID 4MTKA 2ZTEA 2DNEA 4LK1C 3K5MA 4ALPA 3K7AB 1VQGA 2UXDQ 1Q81C 4B08A 4DR5Q 2TMPA 1IBKL 3J7ZC 3BVZA 2G9HD 1SMYC 1VMPA 4DUYL 1U4LA 4ZK9B 4XTCS 2E75C 2I5MX 4CDCC 5JPNC 4BY7G 1E3PA 2Y0SB 4LUOA 4XQQA 3GTOB 1IBLQ 1NMGA 3OWEB 4DV2Q 4A4IA 2D2CC 4RGOS 1I4XA 3U9OA 1VQCA 4UP9A 2TSSA 3TN2A 1TKWB 2NN6I 1YEZA 2JA7B 1E0BA 4L6TB 1EIHA 2NZOA 4JI0Q 5CV9A 5J22A 1HUMA 3NP8A 3C1FA 1UWVA 3OTOQ 3D4RA 2E5LQ 5ELNA 3UE0A 1IBLL 1NBWA 3C3LA 1UE5A 4LF8Q 3DM1A 4DV2L 4GKJQ 2SEBD 1NCVA 4JBJA 3H3VC 3D4DA 3D0FA 3HKZG 4XYQA 1HNWL 3DWPA 1GD7A 2D0OA 3AMUA 4HJ7A 3MXNB 1X32A 3OWFA 1O78A 1KQSA 1EWHA 4DK6C 1HHVA 1TY0A 1CA5A 4JI0L 1SMXA 2JP1A 2Z4HA 4WFN3 1SSOA 5M5XB 3OTOL 5KYIA 2E5LL 1DD2A 1MKHA 2WB1E 1VQ7A 1Y1WG 2KHSA 1EYDA 1HZBA 1RJTA 2WKDA 4LF8L 2X6LA 4FF3A 3U4ZA 2QCPX 3SVMA 2B2UC 5NUCA 5CMDA 1YJNA 4K5XA 4Y7NB 1HZ9A 2KECA 2CW0C 3E6ZX 1LT6D 3PUXA 4CJ0B 5DM63 4JOIA 4C3JB 4DK0A 2K7VA 3LWUA 4IJLA 4LFCL 3EBEA 4S3SA 2F52A 5EJWA 2DUDA 5E3FA 4J8QA 5IWAQ 1SNOA 5GADC 1XMQQ 3MA2B 3E0EA 5C4ZA 4K6LA 5LL6S 2KCNA 3A0JA 1V1PA 2WACA 2WAQG 5C0XG 1HRJA 5BN5A 1K8MA 3NPPA 3A8JE 1S72A 4EVOA 2J0TD 1EZ8A 1B50A 2DNCA 1KDAA 3R93A 3HZXA 3K7UC 1BCPD 2EIFA 3CCUA 4OXPA 2F0SA 4EQPA 3D4WA 5HGQA 4BXXG 1O7YA 2ENBA 4KHPQ 3G4SA 4JI3Q 5HY6A 3CCSA 1XMQL 2Z6KA 4HTHA 1K0SA 3OIQA 3PO2B 2SDFA 1KNEA 4A3GB 1G6ZA 2ZJPA 2M9VA 2Z1CA 1XYIA 1MSHA 3K59A 1EQRA 4FNFA 4KY7A 3A7LA 1N8RC 1XNQL 2JK8A 1HTPA 3PUYA 5JJIA 1E24A 3CRKC 4PMCA 1PMRA 3E0JA 2KHJA 5EPLA 5FO7B 5KGUA 3CF5A 4ME3A 5C3WA 3PIP3 5IGGA 1JB7A 4MTNA 4KHPL 4K5VA 1LM0A 4JI3L 5JOBA 1YNXA 1VQ6A 4HAEA 4HJ9A 3MTSA 4JI6Q 3KDFA 2K14A 1BOSA 3I73A 2NTSA 4ZUJA 5C44B 3SGIA 5FLXc 5K36G 3ULLA 5BR8Q 3G7LA 4MZ9A 1PZKD 1PTOD 1K9MC 2RQXA 1J5EQ 1K3RA 1HZCA 2JA7H 1JWMD 1B8AA 3KBXA 4K2LA 1GO3E 4JPBW 1S40A 2CQAA 2KJXA 1IXRA 1RIPA 4ZRZA 1IBMQ 1U4RA 1Z9FA 3VA5A 1PLFA 4PMBA 1VQPA 2EYLA 5AJ3L 2F4VQ 2HHHQ 1FVIA 4YHHL 1TIID 4KD4A 5M5YH 3MEFA 1S5ED 2YU9B 4BBSB 4H13C 1X6OA 4BA1I 1EYGA 2F0IA 2VZAA 3T1HQ 2PI2E 5BR8L 1E1TA 5M9OA 1VMCA 1ML0D 4OL7A 3J81c 3KF6A 1BO0A 2E2IB 4KHZA 1A6XA 3GTJB 2B2TC 4O42A 2AUJD 4DXFA 1IBML 5FLXL 1WTOA 4PQXA 1DM0B 2MP1A 1QCBD 1WTQA 1EUJA 1H9MA 2F1MA 3Q23A 4BXXH 1H9KA 2F4VL 4R8NA 2DJFC 2VL6A 1E2ZA 3SK6A 1STNA 1D6EC 4A3BG 1DOMA 1PH6A 2KCTA 4L5TA 4A3FG 2K5HA 3D6CA 4B3RQ 3HOZB 2O5IC 1CQFA 3DXJC 2XVSA 1DCZA 1UE1A 4YWKA 4A3IB 1JOKA 2B39A 5JAVA 4R4OA 4X3SA 4WJWA 3T1YL 5L37A 2A6ED 1CKNA 1L1OA 4OEMB 2J4XA 2IJ0A 3J81L 2RCNA 3KOJA 1CM9A 1KLGD 2WV6D 1X3QA 1LTTD 4A3KG 1O7LA 5D14A 1JR0D 1K0RA 1JICA 1LV9A 4B3RL 5K36H 3H0GB 1V1QA 1SFOH 4DR6Q 3BDOA 1LUZA 4IFDJ 4WRDA 4OX9L 1A8VA 1Y69U 3S1NH 3S15B 2L1BA 1CZWA 3GO5A 3K8AA 2ZJRA 1RCVD 1H9SB 2UXBL 1V8QA 4PZ8A 4A3GH 1SNQA 2JN4A 3NQTA 3BZDB 4IUQA 3PF5A 1YNND 4MHEA 3HOZG 2Q2IA 3PO3B 2ICIA 3HOXG 2KEEA 5CV4A 3J80c 3TP5A 2CH4W 4JYAQ 4CDDC 5E4XA 1SE3A 3BDCA 3I91A 3SDZA 1X3GA 4DR2Q 4IUPA 5EQ0A 5E7NA 1QVCA 2AQ2B 3ONAB 4JBMA 2LXKA 4XT1B 4DR6L 1G2SA 2J7ZA 5A35A 3MC0B 3OHXC 4A3DG 3GQBA 3I4NB 2OCEA 3SR1A 1O7ZA 1OXSC 2PPBC 3HG9A 3KJPA 3FRPB 5A2QL 4BS9A 1ZYRC 2EYJA 4RCNA 1HJPA 3MHBA 3PUZA 4MIUA 2E2DC 3SXHA 1LT5D 2WP8J 4JYAL 4A3BH 4P2CB 5FLMG 4P72A 5FK9C 1VQLA 2R7FA 2BDOA 4DR2L 1GUTA 4XIGS 3PUVA 1WFQA 4A3FH 3HOUB 2NYZD 5KNCA 1BBWA 3HOYB 3NSWA 1IKLA 1PFNA 5M5WH 1QJOA 1U4PA 4LF4Q 2HUGA 2SNSA 3J80L 1HZAA 2AHOB 2EJMA 2Q2HA 4XQJA 1ESFA 1HQRD 2WINB 3U4VA 1VQ5A 4BBSH 1SYCA 3FEWX 2EYFA 1VQFA 4C3HB 4LMQD 4DNTB 4B9WA 1SEBD 5ELFA 4JCVE 3RZDB 2E2IH 2DN8A 5I4DA 2WKCA 3BG3A 1NR4A 1CK1A 2QKIC 4A3KH 3CC7A 2BCOA 1U0LA 4RG1A 3FDTA 3P7JA 2G5DA 1GHJA 4YCUA 1EY6A 3V05A 5C3EG 4DV6Q 4LF4L 3U58A 2BH8A 3C1EA 1JORA 1Q46A 3CC4A 1SYGA 1UE7A 2A19A 1GUGA 1H9RA 1YJWA 1SYFA 1STEA 1BXTA 1I4PA 3HOZH 3NBIA 4HJ8A 4TRDA 2B2VA 3HOXH 4WJ3M 2R93G 1B70B 1TT2A 3HRZC 1I4QA 3A74A 1B44D 4I7AA 2VB3X 2B2YA 4KJNA 5K5PA 2PI2A 4L5RC 4DV1Q 5I2YA 1TS4A 3RZOB 3U50C 3G6EA 2YTYA 4IQZA 2GA4B 3A8KE 3PIPA 3BVGA 4HJ5A 4PZ7A 2H5XA 1J9OA 4DAYB 1FD7D 3H0GH 4U68A 1X55A 5I2XA 5JJLA 1CT1D 1ENCA 5C5LA 2B29A 4DV5Q 4LAAA 1HR0L 2R7ZB 5FOBB 4OO1I 5IGDA 2XTIA 1N33Q 3ZJYC 1BUVT 3HS0C 2FXQA 4UAIA 3TDQA 2IX0A 3NENA 2C9OA 2JE6I 4IURA 1YJ9A 1UUPA 3MFYA 2RF4A 2QDBA 3W5OA 1TWGH 1QVFA 4Z9CB 2BA0A 5EKLA 3SK8A 2UUCL 1JC7A 4IUTA 2EVBA 3DEOA 1WTWA 4QQBX 4GOPA 3CU7A 5IYDG 1WI5A 3PGZA 1GJXA 5M3MB 5LMNQ 1ET9A 4DV5L 2MJ8A 4NDXA 1S3OA 2I5LX 5EBCA 4UY8C 1EIFA 3MWYW 3I4NH 1TR5A 3O13A 1WTXA 3TREA 3VR6A 5CORA 1N33L 3M4OH 1X3PA 1A3VA 3W3AA 4AQYQ 3EFXD 4DAPA 1B1ZA 2F0JA 3NBHA 1PRTF 5C3EH 3KJOA 1VF5C 3MXUA 1KRSA 1PZJD 5I9PA 3BU2A 4O2DA 2R7ZG 3OYYA 3S16B 4AIMA 5IGEA 2B63G 4RFBA 4DKAC 4CGYB 1HTLD 3HOUH 4KKUA 5LMNL 1IW7C 2A73B 1N34L 1JT8A 3OMCA 3NQIA 2F0NA 1MI2A 1ONLA 3GD7A 2R93H 1UE6A 3A56A 3A8IE 2WIIB 4RA8A 2IWHA 4YWLA 1S5FD 2B3GA 4AQYL 1A2UA 5CV8A 5DM73 4C3HH 4GNXA 2GN5A 1I4GA 2KENA 1PHJA 3TQYA 4R4IA 4A3CG 1EL0A 1QZGA 1JMCA 1CI3M 3NE5B 4X64L 2A69D 2HT1A 3ERSX 4K0KQ 1CHQD 3D31A 4RGMA 4JV5L 1GKHA 1NTGA 3AYHB 3I4MG 1CZGA
chains in the Genus database with same CATH topology
3DHQA 4AYBB 4BY7B 2B8GA 4KK7A 1NSNS 2K03A 1F2YA 1HPCA 1SNDA 5CYUA 2MGSA 3OPOA 2R92B 1Q8IA 4HSPA 1Y8NB 1D1IA 4UDUC 3TMEA 3T51B 3SK5A 1F9RA 3NK9A 1LT4D 4DNRB 2PQEA 1L0YB 1SJED 5ELEA 5ISRA 4I65A 3T16A 2L0CA 1GUNA 1ZKOA 5IGCA 3HKZB 2OF1A 2L5TA 5KIXA 2NVTB 2F0VA 1TY2A 2NWGA 2AWNA 2G9DA 2K28A 2IX3A 3MXPA 3K5OA 5COYA 2NN6G 2QF7A 3R3OA 1TWAB 1Y1WB 3DEPA 1EY7A 5D65A 2XIWA 1WTRA 4C2MB 3D6WA 4X3UA 2D5DA 3LNNA 3IKJA 1PXUA 2O2LD 3VYSA 4DA2A 1CHPD 1Z6HA 3GV3A 3IL8A 5M5YB 2D62A 2K1BA 4ZYSA 3KLRA 2X6GA 2WAQB 4DF7A 4G7HC 1SNPA 1XWEA 4R9WA 3VR3A 3KK7A 4ID6A 4RKBA 1PFBA 4XXEA 1AN8A 1V43A 5C5MA 4BWGB 1L0XB 4ABNA 1LTGD 4K14A 2EOTA 2RKSA 3N52A 1PTOH 4FF2A 1QB5D 3ND9A 1I4RA 1YNJC 1WD1A 5E4WC 5EPKA 1FGBD 1EYCA 4H0LC 3K5NA 4ZAIA 2EY5A 1PRTD 2L55A 2JEAI 3NTIA 3HP3A 2XN9C 4KY6A 1I6VC 1E2WA 1Q3LA 1UNSA 4EGVA 1NR2A 2F0GA 4PNYA 2NN6H 3MZ5A 2ZXOA 1SFOB 1OO9B 2SNMA 2F0KA 4HR7B 4XDXA 4HMIA 4XQNA 1EZ6A 5JEAG 3Q24A 3S1NB 2A5HA 2KVMA 3JAML 4QUCA 4J6HA 3NHHA 1DJRD 3NTHA 1LTID 3S2DB 1SAPA 1JWSD 3TZUA 2OEOA 2XSCA 4IUNA 3RMHA 2EY6A 2A68D 1F9SA 1AW7A 3TBIB 4B9XA 3OSOA 4Q0FA 4HMJA 3NWTA 2PO4A 4X3TA 2LKVA 4OIKA 3C2PA 2JSOA 4KD3A 2E2HB 3WOEA 1SNCA 5FLXE 4A3BB 4RHRA 2PW7A 4A3FB 3H94A 2NB0A 1RD9D 1SYEA 5M5WB 2BE5D 2O5JC 4OIJA 1I50B 1F9QA 4O1NA 4U673 5KNBA 2EYPA 1M4VA 4KMUC 5C0XH 5EKIA 5CBEE 3VYUA 2EJGC 4A3KB 1B2TA 1F77A 2VNUD 3M7NA 5I6WA 1MD2D 4PMWA 2Z8LA 1HA6A 4CKCA 3CHBD 5JEAH 1SE4A 1SYBA 2PZTA 2E76C 2EY1A 3K57A 1B3AA 3HOXB 5AFWA 3TP8A 2RSNA 1M8AA 3CKIB 2RDHA 1MGSA 1XXGA 1Z7TA 3GP7A 1CFMA 4CHTB 1RTOA 4A3DB 1SE2A 5CV7A 4MN3A 1LTSD 2OT2A 3AU7A 3T56B 2QILA 2AQ3B 2DY8A 1I4HA 5A2QE 4ZLTF 3E5SA 4HEDA 1F2ZA 1ZEQX 4K5WA 2A74C 1LO5D 3S1RB 3S1MB 2IW3A 4ME5A 1TWGB 3S14B 2HQEA 3RD4A 2K01A 3HEJA 3QG1A 2B2TA 3J80E 1EY4A 2Z4IA 2F03A 2F0OA 5IT9L 1FR3A 3MEHA 3KF8A 1ET6A 1RF2D 3R2TA 3M4OB 3FVQA 5E1FA 1OXTA 2F4IA 5C3EB 2K6AA 1RDPD 4IZ8A 1LTBD 2JA5B 4BA2I 2B2VC 4NP5A 1G91A 2EE1A 2PZWA 2PZUA 1JOQA 5JVG3 5EKKA 1MSGA 2B2YC 1FNWA 2A6HD 4XYOA 2R93B 2E74C 1SMYD 3K5LA 2VB2X 1D1KA 1QG7A 1W6JA 1HFNA 3BYYB 3A7AB 4KV6A 4ULLA 2PMZB 4IFDG 1BCPC 1PDQA 3K0YA 3P20A 3Q22A 1G291 1R4PB 2XRQD 2BA1A 4C56C 2RBMA 2AWOA 2SOBA 4HN7A 4PV1C 3L7ZC 1DOKA 1DYQA 4V0BA 2R6GA 4YIJA 1EY0A 2IL8A 3QOJA 3VYTA 5LL6X 3FMCA 2A68C 5IGBA 4QB4A 3ITPA 1WVLA 5ELBA 4L8JA 3EA6A 2Q8RE 2KQ3A 3W2DA 1O80A 1KTKA 1LABA 2B2WA 4IUVA 4G7OC 1VF7A 2RSOA 1PTOC 2K5QA 2KOLA 3FPPA 2F0WA 3U9SA 3I90A 5KNDA 2ZT9C 1QWYA 4DAYA 1A15A 1AEXA 1STHA 1TWFB 2RVLA 1A2TA 4RWSC 4C3IG 5C4HA 1JQYD 4RGTA 3D3RA 5J1ZA 2BE5C 2B63B 1EOTA 1EY5A 2RDGA 3VR4A 4FP5D 1ZXTA 5DAUA 1F2LA 1PFMA 3GTGB 4ZKCB 4GZYC 1BCPB 5KEEA 1EU3A 3OIPA 3P1HA 2FFKB 2H4OA 1RTNA 1RHPA 5CGKA 2H1EA 2LFNA 3J7AV 2IPKD 3KLSA 3S17B 3VA7A 4IFDH 1GXDC 1RKNA 3GTQB 2JYOA 3I4MB 3T13A 1UAPA 4KTAA 2LMCB 4J1MA 1S5DD 1MBYA 1STBA 3A54A 4E6IA 2EYOA 3CRLC 1EWCA 5F2DA 4FYDA 2F0QA 5JVH3 1ENAA 2F0HA 1BBXC 4HCSA 4BY1B 4X3KA 2A6EC 4NW2A 3OW7A 1TQOA 5CV5A 1PTOB 3D8GA 3I72A 1EEID 2MHVA 3DWQA 3HGBA 1EY8A 1TVXA 4M1UB 1B53A 4DAVA 2OXPA 4DU9A 2X69A 3QJYA 3NUCA 4NKLA 1STAA 1SDFA 4RGNA 3IAYA 1I3QB 1II3A 3DWAA 3SE0A 3V96A 3F2UA 2CHBD 4RH6A 4ILWA 3RLFA 1YNNC 1DOLA 2XNAC 1BDOA 5DEHA 3OMGA 3IFTA 4FXKC 4A3EB 1GUWA 5T1GA 1Q1BA 2F0LA 1JCKB 4QUFA 5HGTA 1NAPA 3J7AF 1WD0A 1ILPA 2XRSD 1H9JA 3NWSA 5BN3A 5IODA 1OXUA 1IL8A 4RKLA 3DMUA 3ND8A 3KUPA 4CJ1B 4HSVA 1RODA 1R4QB 1SXTA 1GUOA 4OHJA 3I4LA 2A6HC 3ZYYX 2BDNA 2NTTA 2LY7A 1TS3A 1EQVA 2L11A 1ENFA 3L3OC 5KRUA 3LX0A 2EYHA 1KAAA 3NTKA 1B9NA 1F9PA 2V4DA 3MVVA 3QB3A 4IALA 2NZ1D 1IYVA 3Q6SA 5C0XJ 2JA6B 2K33A 2CVRA 2FMMA 4R8IA 4DXGA 1XX8A 4N9PA 1JE4A 5CV6A 3IFDA 5FO8B 4CKEA 4V190 1D5XC 4EQNA 1U9RA 1Y8PB 3MXNA 1AZPA 5FKAC 2AQ1B 3GTKB 2K32A 5JEAJ 1SYDA 3URYA 1EQTA 1EEFD 1D5MC 1K83B 3S9WA 3MXGA 4A93B 1T5EA 3X3NA 2PW5A 1CTMA 3LWEA 3JAME 3HOVB 5EGTA 1SNMA 1W6KA 1QE6A 3I3CA 1C48A 3NXWA 1ZYRD 1WCMB 3H91A 1B4OA 2M2LA 2AUKA 1GHKA 1EU4A 1BNZA 1NUCA 4CBVA 3QWNA 3VYRA 4RHSA 2B8FA 3CQZB 3V2TA 3SEBA 2N88A 5T1IA 1TWCB 3Q0AA 1V1PB 1A3UA 1G2TA 2K5WA 1SJHD 2EY2A 2F0TA 1B9MA 3M85A 5C4JB 1UEAB 5C0XI 1GOZA 3S2HB 4NMZA 5CR3A 1C8CA 3GV6A 4CJ2C 2VUMB 2C5CA 1E2VA 1GUSA 2R3ZA 4F88A 1AZQA 2JXMB 2K04A 4FXDA 1JB3A 4C3JG 4L63B 5D3IB 4ZUIA 2B2UA 2KA7A 5IGFA 1R9TB 4IN3A 1HUNA 3PMFA 1Q1EA 5LHY1 2HDLA 2PYKA 1V1OA 3FPUB 3WOFA 1CA6A 3BYTB 3I8ZA 3P75A 2A69C 3MFGA 2EZVA 4CKBA 2KEDA 1BF4A 3ERQA 2XWBB 3QIAA 4FF1A 4KN7C 3BDLA 5G3LF 3BS1A 3PUWA 5IIFA 3J81E 3PIO3 4G57A 1KLUD 3S1QB 3T53B 1S5CD 3GTMB 3L9AX 1DZ1A 2JA8B 2F0EA 4QF4A 1A3TA 1D2BA 3UI2A 1FYCA 4JBWA 3H6MA 1ILQA 1IHZA 4F7XA 4Q5VA 4G4KA 1JOOA 1XTCD 2NVXB 3EROA 2M00A 2EXZA 1ICWA 5JJZA 5CC4A 1HA5A 1Y1VB 2EYMA 1AFPA 2NUCA 1S5BD 4FXGC 4C1NK 2E2JB 3EVQA 2YYZA 3HOWB 3M3YB 1WTVA 4ZQ3A 2F3VA 4WORA 5IT9E 3RUZA 4F8MA 2BOSA 4KN4C 2RDFA 1G8ZD 2DY7A 3SK4A 1IW7D 2JEBI 4TSSA 2HCIA 2EPBA 4K2KA 2PCFB 5M3FB 5C3XA 2F0FA 4ZKBB 1Q12A 1U4MA 2IT1A 3EQLC 1LT3D 1H9SA 1TS2A 1DXMA 1FNUA 5TSSA 2WB1B 2L4NA 4K8IA 3EJIA 3X3MA 1AP0A 3TZDA 2KCCA 5I9OA 1LTAD 1IKMA 3KBGA 1S4ZA 2HDMA 1QILA 1KDBA 3BVMA 1Z47A 2FMCA 5EPJA 3M7GA 2PNRC 4KI0A 4N9TA 1PYWD 2L12A 4QCLA 1DONA 3VR2A 4I7ZC 1BQQT 3DUZA 5BN4A 1TWHB 2NVYB 2MPMA 2F0UA 1WTPA 1D5ZC 3I70A 3FKIB 4M8AA 4TQUS 1PRTC 2B2WC 5JPMC 2QEJC 4RAUC 2RA4A 2EDGA 1EIGA 3SHLA 4RCOA 2HCCA 1QNKA 2I07B 1OXVA 1TU2B 5C4XB 5HURA 1HCZA 1KNAA 4C3IB 1FNVA 4ODGA 3K6OA 4KHVA 2L9HA 4DK1A 3OOCA 1CQVA 3GTLB 2EJFC 4IFDI 1OXXK 2FJ2A 3K58A 1QOHA 5CBAE 3G6JB 1EFID 1HFGA 3H09A 1IYUA 3GTPB 4EQOA 4F87A 2KUMA 5G3LD 1TS5A 4LJZC 2ICEC 2F3WA 1HXYD 4KJOA 2F0PA 5IOCA 3KLSX 2D9UA 4A3MB 3C46A 1KABA 4OO1G 3TSSA 3A55A 4C3HG 1EY9A 2CW0D 2N55A 4C1NI 1PRTB 1JWUD 2XWJB 4DFAA 1YNJD 5DNFA 3TP6A 2NVQB 3QO2A 5KYLA 3M4YA 3TP7A 5ELCA 4XT3B 4KKSA 2MUYA 4A3JB 2VXWA 1HQMC 4H44C 5C6AA 1STYA 1VCIA 5ELDA 3MAQA 5J39A 4G7ZC 4KKTA 3R2IA 3QOLA 4DGZA 5I6YA 4FVMA 4JK1C 2K05A 5FO9B 4TKOB 1ESRA 4DN4M 2ID0A 2O4XA 1T5XD 4K6DA 1Y8OB 4K8JA 4BBRB 1EYAA 2FINB 1STGA 2R61A 1C4QA 3WDNA 1BR9A 1LACA 2ZXPA 4FF4A 1LTRD 2Q8TA 2ZXRA 1BCPF 1Q90A 1SBBB 5D3DA 3AB9A 2FHTA 2IX1A 4QIWB 2F0DA 5EBDA 3N6RA 4OO1H 1K8OA 4QMGA 2I46A 3T4AC 4HCEA 3PV0A 4H7BA 3J7YW 1VDZA 1LLRD 1QNUA 2Q8IB 1F2MA 4IUUA 2LS01 2K5DA 3VR5A 2F0MA 4KY5A 3R8BA 1PTOF 1KDCA 4FO2A 4OGQC 2NBFA 1I6HB 1J8IA 1PZID 2DNEA 4LK1C 3K5MA 3K7AB 4B08A 2TMPA 3BVZA 2G9HD 1SMYC 1VMPA 1U4LA 4ZK9B 4XTCS 2E75C 5JPNC 2Y0SB 4XQQA 3GTOB 3OWEB 2D2CC 4RGOS 1I4XA 3U9OA 2TSSA 3TN2A 1TKWB 2NN6I 2JA7B 1E0BA 4L6TB 1EIHA 5CV9A 5J22A 1HUMA 3NP8A 3C1FA 3D4RA 3C3LA 3DM1A 2SEBD 1NCVA 3H3VC 3D4DA 4XYQA 3DWPA 3AMUA 1X32A 3OWFA 1O78A 1EWHA 1HHVA 1TY0A 1CA5A 2JP1A 2Z4HA 4WFN3 1SSOA 5M5XB 5KYIA 1DD2A 2KHSA 1EYDA 1RJTA 4FF3A 2WKDA 2X6LA 2QCPX 3SVMA 2B2UC 5NUCA 5CMDA 4K5XA 4Y7NB 2KECA 2CW0C 3E6ZX 1LT6D 3PUXA 4CJ0B 5DM63 4C3JB 4DK0A 2K7VA 3LWUA 4S3SA 5EJWA 5E3FA 4J8QA 1SNOA 3MA2B 5C4ZA 4K6LA 5LL6S 2KCNA 1V1PA 2WACA 5C0XG 1HRJA 5BN5A 1K8MA 3NPPA 3A8JE 4EVOA 2J0TD 1EZ8A 1B50A 2DNCA 1KDAA 3R93A 3HZXA 1BCPD 2F0SA 4EQPA 3D4WA 1O7YA 2ENBA 4HTHA 3OIQA 3PO2B 2SDFA 1KNEA 4A3GB 1G6ZA 2M9VA 2Z1CA 1XYIA 1MSHA 3K59A 4FNFA 4KY7A 3A7LA 1HTPA 3PUYA 3CRKC 4PMCA 1PMRA 3E0JA 5EPLA 5FO7B 5KGUA 5C3WA 3PIP3 5IGGA 4K5VA 5JOBA 4HAEA 3MTSA 1BOSA 3I73A 2NTSA 4ZUJA 5C44B 5K36G 3G7LA 1PZKD 1PTOD 2RQXA 1JWMD 3KBXA 4K2LA 2CQAA 2KJXA 4ZRZA 1U4RA 3VA5A 1PLFA 4PMBA 2EYLA 1TIID 4KD4A 1S5ED 2YU9B 4BBSB 4H13C 4BA1I 2F0IA 5M9OA 1VMCA 1ML0D 4OL7A 1BO0A 2E2IB 4KHZA 1A6XA 3GTJB 2B2TC 4O42A 2AUJD 4DXFA 5FLXL 1WTOA 4PQXA 1DM0B 2MP1A 1QCBD 1WTQA 1H9MA 2F1MA 3Q23A 1H9KA 4R8NA 1E2ZA 3SK6A 1STNA 1D6EC 1DOMA 3D6CA 3HOZB 2O5IC 1CQFA 3DXJC 2XVSA 1DCZA 4A3IB 1JOKA 2B39A 5JAVA 4X3SA 4WJWA 2A6ED 2J4XA 2IJ0A 3J81L 1CM9A 1KLGD 2WV6D 1X3QA 1LTTD 1O7LA 5D14A 1JR0D 1JICA 1LV9A 5K36H 3H0GB 3BDOA 4IFDJ 4WRDA 1Y69U 3S15B 2L1BA 1CZWA 3GO5A 1RCVD 1H9SB 1V8QA 1SNQA 3NQTA 3BZDB 4IUQA 1YNND 4MHEA 3PO3B 2ICIA 2KEEA 5CV4A 3TP5A 5E4XA 1SE3A 3BDCA 3I91A 3SDZA 4IUPA 5EQ0A 2AQ2B 3ONAB 4XT1B 1G2SA 2J7ZA 5A35A 3MC0B 3OHXC 3GQBA 3I4NB 3SR1A 1O7ZA 1OXSC 2PPBC 3HG9A 3FRPB 5A2QL 4BS9A 1ZYRC 2EYJA 4RCNA 3MHBA 3PUZA 4MIUA 3SXHA 2E2DC 1LT5D 2WP8J 4P2CB 5FK9C 2BDOA 1GUTA 4XIGS 3PUVA 3HOUB 2NYZD 5KNCA 3HOYB 3NSWA 1IKLA 1PFNA 1QJOA 1U4PA 2HUGA 2SNSA 3J80L 2EJMA 4XQJA 1ESFA 1HQRD 2WINB 1SYCA 3FEWX 2EYFA 4C3HB 4LMQD 4DNTB 4B9WA 1SEBD 5ELFA 3RZDB 2DN8A 5I4DA 2WKCA 3BG3A 1NR4A 1CK1A 2QKIC 2BCOA 3FDTA 3P7JA 1GHJA 1EY6A 3V05A 3C1EA 1JORA 1SYGA 1GUGA 1H9RA 1SYFA 1STEA 1BXTA 1I4PA 3NBIA 4TRDA 2B2VA 1TT2A 3HRZC 1I4QA 1B44D 2VB3X 2B2YA 4KJNA 5K5PA 5I2YA 1TS4A 3RZOB 4IQZA 2GA4B 3A8KE 3BVGA 1J9OA 1FD7D 4U68A 5I2XA 1CT1D 1ENCA 5C5LA 4LAAA 2R7ZB 5FOBB 4OO1I 5IGDA 1BUVT 3HS0C 4UAIA 3TDQA 2IX0A 2C9OA 2JE6I 4IURA 1UUPA 3MFYA 2QDBA 4Z9CB 2BA0A 5EKLA 3SK8A 1JC7A 4IUTA 2EVBA 3DEOA 1WTWA 3CU7A 1GJXA 5M3MB 1ET9A 2MJ8A 4NDXA 5EBCA 3MWYW 1TR5A 3O13A 1WTXA 3VR6A 5CORA 1X3PA 1A3VA 3W3AA 3EFXD 4DAPA 1B1ZA 2F0JA 3NBHA 1PRTF 1VF5C 3MXUA 1PZJD 5I9PA 3S16B 5IGEA 4RFBA 4CGYB 1HTLD 4KKUA 1IW7C 2A73B 3OMCA 3NQIA 2F0NA 1MI2A 1ONLA 3GD7A 3A56A 3A8IE 2WIIB 4RA8A 2IWHA 1S5FD 1A2UA 5CV8A 5DM73 1I4GA 1EL0A 1CI3M 3NE5B 2A69D 1CHQD 3D31A 4RGMA 1CZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9P A;  4OIK A;  4X3K A;  1G2S A;  1PFB A;  1DOK A;  5EJW A;  1C8C A;  1EIG A;  3GV6 A;  2J7Z A;  2K03 A;  4NW2 A;  4CJ2 C;  4ZLT F;  2NZ1 D;  2IL8 A;  2R3Z A;  4HED A;  1VMC A;  3Q6S A;  1AZQ A;  1J9O A;  1ML0 D;  4U68 A;  1O7Z A;  2HCC A;  1BO0 A;  1QNK A;  2K04 A;  2MGS A;  1WTV A;  2K05 A;  2CVR A;  2FMM A;  4R8I A;  1ESR A;  2B2T C;  4O42 A;  1WVL A;  1XX8 A;  2EOT A;  1JE4 A;  1HRJ A;  4DN4 M;  1TVX A;  1KNA A;  2K01 A;  1VMP A;  3IFD A;  1U4L A;  2DY7 A;  4ZK9 B;  1B53 A;  1WTO A;  2MP1 A;  4OIJ A;  2Q8R E;  2B2T A;  1WTQ A;  3N52 A;  2HCI A;  2EPB A;  1B50 A;  2X69 A;  2B2U A;  1O80 A;  2L9H A;  4UAI A;  1AZP A;  1SDF A;  1F9Q A;  3R93 A;  1WD1 A;  2B2W A;  4IUR A;  4IUV A;  5E4W C;  1F9R A;  2NYZ D;  1HUN A;  5EPK A;  2FIN B;  2RSO A;  4ZKB B;  1IKL A;  3F2U A;  1U4M A;  1PFN A;  1DOM A;  1O7Y A;  2HDL A;  2KOL A;  1U4P A;  4IUT A;  2HUG A;  3DEO A;  1EQT A;  2FJ2 A;  3I90 A;  5EKI A;  3FPU B;  1WTW A;  4ZAI A;  1CA6 A;  2Q8T A;  1A15 A;  5CBE E;  1DOL A;  2SDF A;  2RVL A;  5CBA E;  3TN2 A;  1KNE A;  1G6Z A;  3I8Z A;  4RWS C;  1XYI A;  1B2T A;  1HFG A;  2L4N A;  1E0B A;  2MJ8 A;  1EOT A;  2FHT A;  4LMQ D;  4X3S A;  1MSH A;  3HP3 A;  3TZD A;  1AP0 A;  1EIH A;  3MWY W;  2KED A;  2NWG A;  1WTX A;  1IKM A;  2B2V C;  2KUM A;  1ZXT A;  1HUM A;  5COR A;  1HA6 A;  1Q3L A;  1X3P A;  1GUW A;  1F2L A;  1NR2 A;  1S4Z A;  5T1G A;  1PFM A;  2EE1 A;  2K28 A;  1BF4 A;  1NR4 A;  1G91 A;  4ZKC B;  2HDM A;  3LWE A;  4QUF A;  1BBX C;  1CM9 A;  1MSG A;  5EPL A;  3DM1 A;  3I3C A;  1QE6 A;  1NAP A;  5COY A;  2B2Y C;  2D9U A;  2FFK B;  1X3Q A;  4XDX A;  1NCV A;  1WD0 A;  3FDT A;  3P7J A;  5EPJ A;  1RTN A;  3H91 A;  1ILP A;  5D14 A;  1RHP A;  1B4O A;  2H1E A;  2M2L A;  1B3A A;  3DEP A;  5D65 A;  2KVM A;  1JIC A;  1LV9 A;  2L12 A;  4HAE A;  1BNZ A;  4QUC A;  1QG7 A;  3MTS A;  1X32 A;  5AFW A;  1DON A;  2N55 A;  1HFN A;  1IL8 A;  2RSN A;  2XIW A;  1M8A A;  1WTR A;  1HHV A;  2JYO A;  1CA5 A;  1MI2 A;  5DNF A;  1MGS A;  3G7L A;  1SAP A;  3KUP A;  3D6W A;  4HSV A;  4X3U A;  4CJ1 B;  1J8I A;  2JP1 A;  1DZ1 A;  1ROD A;  3QO2 A;  1PDQ A;  2L1B A;  4RA8 A;  2MPM A;  1SSO A;  2N88 A;  5T1I A;  2B2V A;  3UI2 A;  1RTO A;  1WTP A;  3GV3 A;  3IL8 A;  1G2T A;  4IUQ A;  4XT3 B;  1RJT A;  2BDN A;  3KBX A;  2K1B A;  2X6L A;  4MHE A;  4IUU A;  3SVM A;  1F9S A;  1ILQ A;  1U4R A;  2B2U C;  2KEE A;  5CMD A;  1EL0 A;  1PLF A;  2KEC A;  2VXW A;  2B2Y A;  2L11 A;  2X6G A;  4MN3 A;  5E4X A;  2B2W C;  3I91 A;  4CJ0 B;  4IUP A;  4RAU C;  2RA4 A;  5EQ0 A;  4R9W A;  1ICW A;  4X3T A;  3ONA B;  5JJZ A;  4XT1 B;  2DY8 A;  4HCS A; 
#chains in the Genus database with same CATH topology
 3DHQ A;  1BVS A;  4AYB B;  2B8G A;  4BY7 B;  4KK7 A;  2K5N A;  4GLV B;  1NSN S;  2K03 A;  2ZJQ A;  2QEX A;  3BZC A;  1F2Y A;  2K4K A;  4LF9 L;  1HPC A;  1SND A;  5CYU A;  4NXM L;  4APV A;  2MGS A;  1YZ6 A;  3OPO A;  2R92 B;  1Q8I A;  4HSP A;  4BY1 G;  1Y8N B;  1E1O A;  1D1I A;  4UDU C;  3TME A;  3T51 B;  2DJG C;  3SK5 A;  1F9R A;  4IJH A;  2PQA B;  3NK9 A;  1LT4 D;  5IYD H;  4DNR B;  2PQE A;  3RZO H;  1L0Y B;  2CKZ B;  1SJE D;  5ELE A;  1M90 C;  5ISR A;  4I65 A;  1VQM A;  3T16 A;  2L0C A;  1GUN A;  1ZKO A;  5IGC A;  3HKZ B;  2OF1 A;  2L5T A;  5KIX A;  2NVT B;  2F0V A;  2DGY A;  1TY2 A;  2OTL A;  2NWG A;  4AYB G;  2AWN A;  1V9P A;  2G9D A;  4OEL B;  2K28 A;  4R4C A;  1MJC A;  1EFW A;  2IX3 A;  3MXP A;  4X62 Q;  3K5O A;  2R7Z H;  3CME A;  5COY A;  2B63 H;  5IP9 G;  2NN6 G;  2QF7 A;  1G6P A;  3R3O A;  1TWA B;  1Y1W B;  2R92 G;  1HNW Q;  3DEP A;  1EY7 A;  5D65 A;  1FGU A;  2HD3 A;  4A3E G;  1HNZ L;  2CCZ A;  1WTH A;  1XJV A;  2XIW A;  4JG2 A;  1WTR A;  4JI2 Q;  4C2M B;  3CCQ A;  4P74 A;  3D6W A;  4X3U A;  2D5D A;  3LNN A;  3IKJ A;  1PXU A;  2O2L D;  3VYS A;  5M3M H;  4DA2 A;  4A3C H;  4N8X 1;  1CHP D;  1Z6H A;  3ICE A;  3GV3 A;  3IL8 A;  4QJF A;  1K73 C;  3S17 H;  5M5Y B;  1EOV A;  2D62 A;  4X62 L;  3I56 A;  2K1B A;  4ZYS A;  1E22 A;  3I4M H;  3KLR A;  2X6G A;  2WAQ B;  4DF7 A;  2ZM6 Q;  4HIM A;  4G7H C;  3PSI A;  1SNP A;  1PH2 A;  1XWE A;  4R9W A;  3VR3 A;  3VDY A;  1NMF A;  3I4O A;  4LFC Q;  3KK7 A;  4ID6 A;  4RKB A;  1XPR A;  1PFB A;  4XXE A;  4JI2 L;  4LF6 Q;  1AN8 A;  2Z6K C;  1BBU A;  1V43 A;  5C5M A;  3S16 H;  2K50 A;  5GAE C;  4BWG B;  1L0X B;  5DLQ E;  4ABN A;  1LTG D;  1WOC A;  1KAW A;  4K14 A;  1ASZ A;  2EOT A;  4BY1 H;  2RKS A;  4R4Q A;  3N52 A;  4LFB Q;  3JAM c;  1PTO H;  3G48 A;  4FF2 A;  1QB5 D;  2ZM6 L;  3ND9 A;  1I4R A;  1YNJ C;  1WD1 A;  5E4W C;  5EPK A;  2QGQ A;  1FGB D;  2JA6 G;  1EYC A;  4LF6 L;  4H0L C;  3K5N A;  2I0Q A;  4JI5 L;  4ZAI A;  3I55 A;  2L15 A;  2EY5 A;  1G51 A;  4BY7 H;  1PRT D;  2L55 A;  1ICF B;  4Y52 H;  3ULJ A;  2JEA I;  1XNQ Q;  3NTI A;  3HP3 A;  1VQB A;  2XN9 C;  3H15 A;  4KY6 A;  1I6V C;  1E2W A;  1Q3L A;  1UNS A;  4EGV A;  4LFB L;  1NR2 A;  2F0G A;  4PNY A;  3J80 i;  5IP9 H;  1XMO Q;  2NN6 H;  3MZ5 A;  2ZXO A;  1T9H A;  2C35 B;  1SFO B;  2R92 H;  1OO9 B;  2SNM A;  2F0K A;  4HR7 B;  4GKK Q;  1Y14 B;  1JJ2 A;  4XDX A;  4A3E H;  4HMI A;  4XQN A;  1EZ6 A;  4B3M Q;  5JEA G;  3Q24 A;  3S1N B;  2A5H A;  2KVM A;  4A93 G;  3JAM L;  4JC0 A;  4QUC A;  4J6H A;  1D8L A;  3UDF A;  2HQL A;  2Q2U A;  3ULP A;  3NEM A;  4CDF C;  3NHH A;  1DJR D;  1BKB A;  3NTH A;  1LTI D;  2PNH A;  3S2D B;  1SAP A;  3HOV G;  3W1B A;  1JWS D;  3TZU A;  2OEO A;  1XMO L;  2XSC A;  4IUN A;  2MO1 A;  1WCM G;  3RMH A;  4NXN Q;  2NVT H;  2EY6 A;  1VQI A;  2A68 D;  4GKK L;  1F9S A;  1AW7 A;  1N36 L;  1C7Y A;  3TBI B;  4B9X A;  3OSO A;  5AJ3 Q;  4B3M L;  4Q0F A;  4YHH Q;  1LYL A;  4LWC A;  1VQH A;  4HMJ A;  4IPD A;  3NWT A;  2PO4 A;  4X3T A;  2LKV A;  3F2B A;  4OIK A;  3C2P A;  2JSO A;  1TWA H;  4KD3 A;  1Y1W H;  3WOE A;  2E2H B;  1SNC A;  5FLX E;  4A3B B;  3CC2 A;  4IO9 A;  4RHR A;  1B7Y B;  2PW7 A;  4A3L G;  3KDF B;  3BJU A;  4A3F B;  2GVA A;  4C2M H;  3H94 A;  4NXN L;  5IYC G;  2NB0 A;  1RD9 D;  1SYE A;  3RR5 A;  5M5W B;  1KXL A;  2BE5 D;  4GN4 B;  2O5J C;  4OIJ A;  2BH2 A;  1I50 B;  2JA6 H;  1F9Q A;  2VUM G;  1Q82 C;  1JE5 A;  4O1N A;  4UP8 A;  4U67 3;  5KNB A;  2EYP A;  1M4V A;  1W2B A;  4KMU C;  5C0X H;  5EKI A;  5CBE E;  4J15 A;  2EJG C;  3VYU A;  4X6A H;  2RCF A;  4UPA A;  4A3K B;  3H3V I;  1B2T A;  3T1Y Q;  1F77 A;  2Z6B A;  1YIJ A;  2VNU D;  3M7N A;  5I6W A;  1MD2 D;  1KIX A;  4PMW A;  2Z8L A;  1HA6 A;  1YBY A;  3E3X A;  4CKC A;  1K83 H;  3CHB D;  3DLL A;  5JEA H;  1SE4 A;  1CSP A;  3F2D A;  4A93 H;  1SYB A;  2PZT A;  2E76 C;  2EY1 A;  3K57 A;  1B3A A;  3CCL A;  3HOX B;  3HOV H;  5AFW A;  3TP8 A;  4CDE C;  2RSN A;  4OX9 Q;  1M8A A;  4NB3 A;  3CKI B;  2RDH A;  1MGS A;  1XXG A;  1Z7T A;  3PCO B;  2UXB Q;  3GP7 A;  5IT9 c;  1W3S A;  1CFM A;  4CHT B;  1RTO A;  1XNR Q;  4JW0 A;  4A3D B;  2YTV A;  2UUB Q;  1SE2 A;  3TS0 A;  5CV7 A;  3UDG A;  2N8N A;  1K8G A;  2VS1 A;  3CQZ H;  3ER0 A;  4MN3 A;  4DR7 L;  1LTS D;  2OT2 A;  3CAM A;  1TWC H;  1CKN B;  3AU7 A;  3T56 B;  1KC8 C;  2QIL A;  2JA8 G;  2AQ3 B;  2DY8 A;  1I4H A;  5A2Q E;  2CWP A;  4LF7 L;  4ZLT F;  3E5S A;  4EQ5 A;  4HED A;  1F2Z A;  4A3L H;  1ZEQ X;  1KL9 A;  2A1A A;  2A74 C;  4K5W A;  1LO5 D;  5C4J H;  5ELO A;  1SN8 A;  3S1R B;  3S1M B;  3KFU A;  2IW3 A;  4ME5 A;  1XNR L;  4QIW E;  1TWG B;  3S2D H;  3S14 B;  2HQE A;  2IHF A;  3RD4 A;  2K01 A;  2UUB L;  3HEJ A;  5GQO A;  4DR1 Q;  3CD6 A;  3QG1 A;  2B2T A;  1Y1V G;  1AE2 A;  3J80 E;  1EY4 A;  1L2F A;  2Z4I A;  2F03 A;  1A63 A;  2F0O A;  5IT9 L;  1FR3 A;  3MEH A;  4JVZ A;  3KF8 A;  2Q2T A;  3HOW G;  1ET6 A;  1RF2 D;  1VS0 A;  3R2T A;  3M4O B;  3FVQ A;  5E1F A;  1OXT A;  4LUZ A;  2F4I A;  5C3E B;  1R9T H;  2K6A A;  2E2H H;  1RDP D;  4IZ8 A;  1LTB D;  5H1S E;  3CW2 C;  2JA5 B;  5M3F G;  4BA2 I;  4DR1 L;  2B2V C;  1YI2 A;  4NP5 A;  1G91 A;  2EE1 A;  2PZW A;  2PZU A;  1JOQ A;  5JVG 3;  5EKK A;  1MSG A;  3JC6 6;  2B2Y C;  1EIY B;  1FNW A;  2A6H D;  3Q8D A;  4UP7 A;  4XYO A;  2R93 B;  3RNU A;  1I50 H;  2WB1 G;  4X66 L;  2E74 C;  1SMY D;  3K5L A;  2VB2 X;  1TXY A;  1HNX Q;  1D1K A;  1MIU A;  1QG7 A;  1W6J A;  2OWO A;  1HFN A;  3BYY B;  3A7A B;  4KV6 A;  4ULL A;  2PMZ B;  2V1C C;  1QUQ A;  4IFD G;  1BCP C;  1PDQ A;  3K0Y A;  4DV3 Q;  3P20 A;  1LTL A;  3A5U A;  4JI1 L;  3Q22 A;  1NY4 A;  1G29 1;  2AKW B;  3GTM H;  2Y0S E;  1R4P B;  2XRQ D;  3L0O A;  2BA1 A;  4C56 C;  2RBM A;  2JA5 G;  2AWO A;  2SOB A;  3I7F A;  4H02 A;  4HN7 A;  4PV1 C;  2AMC B;  1HNX L;  2ASB A;  1VQ8 A;  3L7Z C;  1I94 L;  3RLN A;  1DOK A;  4GOP C;  1DYQ A;  4V0B A;  2R6G A;  4YIJ A;  1EY0 A;  2IL8 A;  3QOJ A;  3FKI G;  3VYT A;  5LL6 X;  2NVX H;  3FMC A;  4DV3 L;  2A68 C;  5IGB A;  1HR0 Q;  4QB4 A;  3ITP A;  1WVL A;  1Y1V H;  5ELB A;  4L8J A;  3EA6 A;  2Q8R E;  2KQ3 A;  3W2D A;  1O80 A;  2MO0 A;  1KTK A;  1LAB A;  4DV4 Q;  4IOC A;  1WYD A;  1K8A C;  4A3D H;  2B2W A;  4IUV A;  4G7O C;  5IP7 G;  1VF7 A;  2UUC Q;  2RSO A;  1PTO C;  1VQD A;  2K5Q A;  2KOL A;  1XTD A;  3FPP A;  2NZH A;  2F0W A;  3U9S A;  3I90 A;  2QW7 A;  3F1Z A;  5C4X G;  5KND A;  2ZT9 C;  1QWY A;  4DAY A;  1A15 A;  1AEX A;  1STH A;  1TWF B;  2RVL A;  1A2T A;  5M3F H;  4RWS C;  4C3I G;  5FLM H;  1GVP A;  5C4H A;  1JQY D;  4RGT A;  3D3R A;  5J1Z A;  2BE5 C;  2B63 B;  1EOT A;  1EY5 A;  3E9I A;  2RDG A;  1XPU A;  3VR4 A;  1AE3 A;  4FP5 D;  1ZXT A;  5DAU A;  3S1R H;  1F2L A;  1PFM A;  4GNX C;  1VQO A;  3GTG B;  3S1M H;  4ZKC B;  4B3S L;  4GZY C;  5IYB G;  3HFZ B;  4DV4 L;  1O7I A;  1BCP B;  5KEE A;  3S14 H;  1EU3 A;  3OIP A;  4JBK A;  3P1H A;  2FFK B;  2H4O A;  1RL2 A;  1RTN A;  1XPO A;  1RHP A;  1SE8 A;  2H1E A;  5CGK A;  2LFN A;  3J7A V;  2IPK D;  3KLS A;  1N34 Q;  3S17 B;  4GS3 A;  3VA7 A;  4IFD H;  1GXD C;  3F8T A;  1RKN A;  3GTQ B;  2JYO A;  2LXJ A;  1N32 L;  3I4M B;  3T13 A;  1UAP A;  4KTA A;  4GOP B;  4A3M G;  2LMC B;  3JAM i;  2UU9 L;  4J1M A;  1S5D D;  4FDB A;  3G71 A;  1MBY A;  1STB A;  2N78 A;  3A54 A;  4E6I A;  2EYO A;  3CRL C;  2JA5 H;  5GAH C;  1EWC A;  4X64 Q;  5F2D A;  1PA6 A;  4FYD A;  4JV5 Q;  2F0Q A;  4YY3 L;  1PH1 A;  5JVH 3;  1ENA A;  1Q86 C;  4JI7 L;  2F0H A;  4OWW B;  2JA9 A;  1BBX C;  3NBH B;  4HCS A;  1PV4 A;  2K5V A;  4BY1 B;  4X3K A;  1PH4 A;  2A6E C;  4NW2 A;  1H95 A;  3OW7 A;  4LF9 Q;  1TQO A;  5CV5 A;  4DUZ L;  4NXM Q;  1PTO B;  3D8G A;  3I72 A;  1EEI D;  2MFI A;  4A3J G;  2MHV A;  1PH8 A;  3EIV A;  1VQE A;  3DWQ A;  1P8L A;  3HGB A;  2UXC Q;  1EY8 A;  1TVX A;  4M1U B;  1B53 A;  4DAV A;  1C0A A;  5IP7 H;  1X3E A;  2OXP A;  4DU9 A;  2X69 A;  3QJY A;  3NUC A;  4NKL A;  4OWX B;  1STA A;  1SDF A;  4GLX A;  4RGN A;  3IAY A;  1QZH A;  3S24 A;  1I3Q B;  4X65 Q;  1II3 A;  3DWA A;  3SE0 A;  2MNA A;  3V96 A;  3F2U A;  2CHB D;  4POF A;  4C3I H;  4RH6 A;  1KHI A;  3IRB A;  1JJG A;  4ILW A;  3RLF A;  1YNN C;  1DOL A;  2XNA C;  1BDO A;  4DK3 C;  5DEH A;  1X56 A;  3OMG A;  3STB D;  3J7A 5;  1E7Z A;  4BBR G;  3IFT A;  2UXC L;  4FXK C;  4A3E B;  3GTL H;  1GUW A;  5T1G A;  1VQJ A;  1Q1B A;  2F0L A;  4WJ4 A;  1JCK B;  2KHI A;  4PG3 A;  4QUF A;  5HGT A;  1NAP A;  3J7A F;  4X65 L;  3GTP H;  1WD0 A;  1ILP A;  1HNZ Q;  2XRS D;  1SLJ A;  1CUK A;  1H9J A;  3NWS A;  5BN3 A;  5IOD A;  1OXU A;  5LMU Q;  1IL8 A;  1KD1 C;  4RKL A;  4A3M H;  4DR4 L;  3DMU A;  3ND8 A;  3KUP A;  4QY7 A;  4CJ1 B;  4HSV A;  2Z9H A;  1ROD A;  1R4Q B;  1SXT A;  1GUO A;  1DGS A;  4OHJ A;  1TWF H;  2D0P A;  3I4L A;  4IPC A;  2A6H C;  3ZYY X;  2EXD A;  2BDN A;  2NTT A;  4JOI C;  2LY7 A;  2MQH A;  2Z0S A;  4DR3 Q;  2NVQ H;  1TS3 A;  1EQV A;  2L11 A;  1ENF A;  3L3O C;  3GTG H;  1P16 A;  4YCW A;  5KRU A;  3W1G A;  3CCJ A;  3LX0 A;  2EYH A;  3J81 i;  1KAA A;  3NTK A;  1B9N A;  1F9P A;  5LMU L;  3NEL A;  1M1K C;  2V4D A;  3MVV A;  1CKO A;  3QB3 A;  4IAL A;  4A3J H;  2NZ1 D;  1IYV A;  3Q6S A;  1HH2 P;  1UEB A;  4EX5 A;  1AH9 A;  3UDX A;  5C0X J;  3CPF A;  2JA6 B;  2K33 A;  2CWA A;  2UXD L;  2CVR A;  2FMM A;  4DR5 L;  4R8I A;  4DXG A;  1XX8 A;  4N9P A;  5GRO A;  1JE4 A;  3GTQ H;  5CV6 A;  3IFD A;  5FO8 B;  4DV0 Q;  4CKE A;  4DR3 L;  4V19 0;  4JI4 Q;  4HID A;  1D5X C;  4EQN A;  3TRZ A;  1U9R A;  1Y8P B;  3MXN A;  1AZP A;  4IPH A;  5FKA C;  2K52 A;  2AQ1 B;  3GTK B;  1VQK A;  4GN3 B;  2K32 A;  5JEA J;  1SYD A;  4JI5 Q;  3URY A;  1EQT A;  4LUV A;  1EEF D;  4BBR H;  1D5M C;  1K83 B;  3S9W A;  3MXG A;  4R4T A;  3AEV A;  4A93 B;  2Y0S G;  1T5E A;  3X3N A;  2PW5 A;  4DV0 L;  1CTM A;  1YHA A;  4JI4 L;  1VQA A;  3LWE A;  3JAM E;  3HOV B;  5EGT A;  1SNM A;  1W6K A;  1QE6 A;  3I3C A;  4POG A;  1C48 A;  3NXW A;  1ZYR D;  4QGU A;  1WCM B;  2ZTD A;  3H91 A;  4GKJ L;  3CXC A;  1J6Q A;  1B4O A;  2M2L A;  1PH9 A;  2JA7 G;  2AUK A;  1GHK A;  1EU4 A;  1BNZ A;  4LW1 A;  4DNI A;  4ZCK A;  1NUC A;  1I3Q H;  4CBV A;  3QWN A;  3VYR A;  4P73 A;  4RHS A;  1U5K A;  2B8F A;  3CQZ B;  3V2T A;  3SEB A;  2N88 A;  5T1I A;  1TWC B;  3Q0A A;  1V1P B;  3CCM A;  3CPW A;  1A3U A;  3F2C A;  5IE8 A;  1G2T A;  1YHQ A;  1N36 Q;  1I5F A;  2K5W A;  1SJH D;  2KCM A;  2EY2 A;  2F0T A;  1B9M A;  5FJ8 G;  3M85 A;  2OQK A;  5C4J B;  4OWT B;  3LGJ A;  1UEA B;  1A62 A;  4NPS A;  5C0X I;  1GOZ A;  3AFP A;  2ATW A;  2KBN A;  5EAY A;  3CCV A;  3I2Z A;  3S2H B;  4NMZ A;  5CR3 A;  2I5H A;  1C8C A;  1YVC A;  2ZTC A;  3GV6 A;  3M4P A;  4CJ2 C;  2UUA Q;  2C5C A;  2VUM B;  1E2V A;  1GUS A;  2R3Z A;  4F88 A;  3L2P A;  5IWA L;  3OW2 A;  1AZQ A;  2JXM B;  1PH5 A;  4AH6 A;  1I6H H;  2K04 A;  4FXD A;  4YWM A;  2PMZ E;  1JB3 A;  4C3J G;  4L63 B;  2YV5 A;  5D3I B;  4ZUI A;  3K7A H;  2B2U A;  2KA7 A;  5IGF A;  3TEH B;  1R9T B;  4IN3 A;  1HUN A;  2XGT A;  3PMF A;  1OTC A;  1Q1E A;  5LHY 1;  2HDL A;  2PYK A;  1V1O A;  1VQ4 A;  2UUA L;  2CQO A;  3FPU B;  3WOF A;  1CA6 A;  3BYT B;  3GTO H;  3I8Z A;  3P75 A;  2CFM A;  1L1O C;  2A69 C;  3MFG A;  2EZV A;  4CKB A;  2KED A;  3A5Z B;  2QDL A;  3AQQ A;  1BF4 A;  3ERQ A;  2XWB B;  3QIA A;  1K3B C;  4P71 A;  4YCV A;  4GN5 A;  4FF1 A;  1PH7 A;  4KN7 C;  3PO2 G;  3BDL A;  5G3L F;  4A3G G;  3BS1 A;  1JJC B;  3PUW A;  3M9B A;  1X65 A;  5IIF A;  3STB C;  3J81 E;  2IHE A;  3PIO 3;  4G57 A;  3GTK H;  1KLU D;  4JI6 L;  3S1Q B;  3T53 B;  1S5C D;  2WFW A;  3GTM B;  3L9A X;  2R7D A;  1DZ1 A;  2JA8 B;  2F0E A;  4QF4 A;  1FL0 A;  1A3T A;  3KLW A;  3KF6 B;  1D2B A;  2E8G A;  3UI2 A;  1J5E L;  1FYC A;  5FJ8 H;  4LFA Q;  4JBW A;  3H6M A;  3M4Q A;  1ILQ A;  1IHZ A;  4F7X A;  2ALY B;  4DR7 Q;  4Q5V A;  4G4K A;  5C44 G;  1JOO A;  1XTC D;  5M5X H;  2NVX B;  3ERO A;  2M00 A;  1X9N A;  2EXZ A;  3AFQ A;  1ICW A;  3CCR A;  5JJZ A;  4LF7 Q;  5CC4 A;  2HHH L;  1HA5 A;  1Y1V B;  2EYM A;  3J81 j;  1AFP A;  1WCM H;  2NUC A;  1S5B D;  1B3Q A;  4Y7N H;  4FXG C;  1WJJ A;  3T1H L;  1D7Q A;  4C1N K;  2E2J B;  3B6Y A;  3EVQ A;  2YYZ A;  4C3J H;  3HOW B;  3M3Y B;  1WTV A;  4ZQ3 A;  2F3V A;  4WOR A;  5IT9 E;  3RUZ A;  4F8M A;  2LSS A;  4LFA L;  2BOS A;  4KN4 C;  2RDF A;  1G8Z D;  2DY7 A;  1MJE A;  3SK4 A;  1IW7 D;  2JEB I;  4TSS A;  4JI8 Q;  4BBS G;  2HCI A;  2EPB A;  4K2K A;  1L1O B;  2PCF B;  5M3F B;  3GDE A;  3E9H A;  5C3X A;  2F0F A;  4ZKB B;  3DM3 A;  2ES2 A;  1Q12 A;  4PZ6 A;  1U4M A;  1PYB A;  2IT1 A;  2JJQ A;  5IYC H;  3EQL C;  1LT3 D;  1QVG A;  1H9S A;  1TS2 A;  1DXM A;  1FNU A;  3S2H H;  5TSS A;  2N3S A;  4HJA A;  2WB1 B;  2L4N A;  4K8I A;  4A75 A;  2VUM H;  3EJI A;  3X3M A;  2K75 A;  1AP0 A;  3TZD A;  2KCC A;  5I9O A;  2A8V A;  1LTA D;  1IKM A;  3KBG A;  4JI8 L;  1S4Z A;  3QR8 A;  3PO2 H;  2HDM A;  2GVB A;  2VW9 A;  1PH3 A;  1QIL A;  3H3V H;  3RN2 A;  1SRO A;  1KDB A;  3BVM A;  4P75 A;  1NNX A;  1Z47 A;  2FMC A;  5EPJ A;  1EQQ A;  3M7G A;  2PNR C;  4X66 Q;  4KI0 A;  4A3I G;  4HIK A;  4N9T A;  1PYW D;  2L12 A;  4AYB E;  4QCL A;  1DON A;  3VR2 A;  4UHV A;  4I7Z C;  1BQQ T;  1PYS B;  3DUZ A;  3KF8 B;  1TWH B;  2NVY B;  5BN4 A;  3PF4 A;  2MPM A;  4DV7 Q;  4JI1 Q;  2F0U A;  1WTP A;  1D5Z C;  2VQF Q;  3I70 A;  3FKI B;  2P5Z X;  5C44 H;  4M8A A;  3H0G G;  3RN5 A;  2IY5 B;  4TQU S;  1PRT C;  2B2W C;  5JPM C;  2QEJ C;  1L0W A;  4TVA B;  4RAU C;  1MHW C;  2RA4 A;  2EDG A;  1I94 Q;  2EQS A;  1EIG A;  1VQN A;  3SHL A;  4RCO A;  1IYJ B;  1IL2 A;  1FJG Q;  3PO3 G;  3HKZ E;  2HCC A;  1A0I A;  4DV7 L;  1X3F A;  1QNK A;  2I07 B;  4LF5 Q;  1OXV A;  3S1Q H;  1TU2 B;  4N8F A;  2YU9 H;  2VQF L;  5C4X B;  5HUR A;  1HCZ A;  1KNA A;  2JA8 H;  4C3I B;  1FNV A;  1IZ6 A;  4ODG A;  1QUQ B;  3K6O A;  4KHV A;  2L9H A;  3UDI A;  3GTJ H;  2VQE Q;  1VQ9 A;  3I4N G;  3FHW A;  4DK1 A;  3OOC A;  1CQV A;  1PVO A;  3GTL B;  2EJF C;  4IFD I;  1OXX K;  2FJ2 A;  3K58 A;  1QOH A;  2QA4 A;  1FJG L;  5CBA E;  3G6J B;  4LF5 L;  1EFI D;  1HFG A;  3H09 A;  1IYU A;  3GTP B;  3EN2 A;  4IPG A;  4O0A A;  3RLO A;  4EQO A;  4F87 A;  5IY0 A;  2E2J H;  2KUM A;  5G3L D;  3HOU G;  1C9O A;  4L5S A;  4B3S Q;  3HOW H;  3HOY G;  1TS5 A;  3M3Y H;  4LJZ C;  2ICE C;  2F3W A;  1HXY D;  1NJI C;  4KJO A;  4A3I H;  2F0P A;  2VQE L;  5IOC A;  3KLS X;  2D9U A;  2WAQ E;  3CMA A;  4A3M B;  1ASY A;  3C46 A;  1KAB A;  4OO1 G;  3TSS A;  4QL5 A;  3A55 A;  4C3H G;  4DV6 L;  1EY9 A;  2CW0 D;  5JJK A;  2N55 A;  4C1N I;  1PRT B;  1CKM A;  4L5Q A;  1JWU D;  1N32 Q;  2XWJ B;  4DFA A;  1YNJ D;  5DNF A;  3CCE A;  1EWI A;  3TP6 A;  2NVQ B;  2F3I A;  3QO2 A;  5KYL A;  3M4Y A;  2HIX A;  1PFS A;  1Q7Y C;  2UU9 Q;  4IOA A;  2CH4 A;  3TP7 A;  4RMF A;  3KYH C;  5ELC A;  4XT3 B;  4KKS A;  2MUY A;  4YY3 Q;  4A3J B;  4JI7 Q;  2VXW A;  1HQM C;  4H44 C;  5C6A A;  1X54 A;  3S15 H;  1STY A;  2YTX A;  1VCI A;  3K0X A;  5ELD A;  3MAQ A;  4DV1 L;  2OTJ A;  4MNO A;  5GAG C;  1HR0 W;  3PO3 H;  5J39 A;  4G7Z C;  1NE3 A;  4DUZ Q;  4KKT A;  3R2I A;  1SRU A;  3QOL A;  4DGZ A;  5I6Y A;  4FVM A;  4JK1 C;  3CP0 A;  4A76 A;  3PIO A;  1YHB A;  2K05 A;  5FO9 B;  4TKO B;  1K28 A;  1ESR A;  1TWH H;  2NVY H;  4DN4 M;  2ID0 A;  2O4X A;  4GLA C;  1T5X D;  4K6D A;  1Y8O B;  4K8J A;  4BBR B;  1EYA A;  2N49 A;  2RHQ B;  4HIO A;  3FKI H;  1KRT A;  2RHS B;  3HKS A;  2FIN B;  1STG A;  2R61 A;  1C4Q A;  3WDN A;  3K80 C;  1BR9 A;  2VY3 A;  1LAC A;  2ZXP A;  4FF4 A;  1LTR D;  2Q8T A;  2ZXR A;  1BCP F;  1Q90 A;  1SBB B;  1SR3 A;  5D3D A;  3K81 C;  4LNQ A;  3HOY H;  3AB9 A;  2FHT A;  4OON A;  1YIT A;  4B3T Q;  2IX1 A;  1Q8K A;  4QIW B;  2F0D A;  5EBD A;  3N6R A;  2JQO A;  5C4X H;  5LMN W;  4GNX B;  4OO1 H;  4R1J A;  1K8O A;  4DAM A;  5M3M G;  3RZD H;  2HIV A;  4KLK A;  4QMG A;  2I46 A;  3T4A C;  1CSQ A;  4DR4 Q;  3FP9 A;  4HCE A;  5IYB H;  3PV0 A;  3BZK A;  4B3T L;  4H7B A;  3UE1 A;  3J7Y W;  1VDZ A;  1LLR D;  1QNU A;  1GM5 A;  1IBK Q;  2Q8I B;  2PQA A;  3TS2 A;  1F2M A;  3PQI A;  4IUU A;  2LS0 1;  3WWV A;  2K5D A;  3VR5 A;  2OQ0 A;  2F0M A;  4DUY Q;  1N9W A;  4KY5 A;  3R8B A;  1PTO F;  4DPG A;  1KDC A;  4FO2 A;  4OGQ C;  2NBF A;  1I6H B;  4K0K L;  1J8I A;  5J3B A;  1PZI D;  4MTK A;  2ZTE A;  2DNE A;  4LK1 C;  3K5M A;  4ALP A;  3K7A B;  1VQG A;  2UXD Q;  1Q81 C;  4B08 A;  4DR5 Q;  2TMP A;  1IBK L;  3J7Z C;  3BVZ A;  2G9H D;  1SMY C;  1VMP A;  4DUY L;  1U4L A;  4ZK9 B;  4XTC S;  2E75 C;  2I5M X;  4CDC C;  5JPN C;  4BY7 G;  1E3P A;  2Y0S B;  4LUO A;  4XQQ A;  3GTO B;  1IBL Q;  1NMG A;  3OWE B;  4DV2 Q;  4A4I A;  2D2C C;  4RGO S;  1I4X A;  3U9O A;  1VQC A;  4UP9 A;  2TSS A;  3TN2 A;  1TKW B;  2NN6 I;  1YEZ A;  2JA7 B;  1E0B A;  4L6T B;  1EIH A;  2NZO A;  4JI0 Q;  5CV9 A;  5J22 A;  1HUM A;  3NP8 A;  3C1F A;  1UWV A;  3OTO Q;  3D4R A;  2E5L Q;  5ELN A;  3UE0 A;  1IBL L;  1NBW A;  3C3L A;  1UE5 A;  4LF8 Q;  3DM1 A;  4DV2 L;  4GKJ Q;  2SEB D;  1NCV A;  4JBJ A;  3H3V C;  3D4D A;  3D0F A;  3HKZ G;  4XYQ A;  1HNW L;  3DWP A;  1GD7 A;  2D0O A;  3AMU A;  4HJ7 A;  3MXN B;  1X32 A;  3OWF A;  1O78 A;  1KQS A;  1EWH A;  4DK6 C;  1HHV A;  1TY0 A;  1CA5 A;  4JI0 L;  1SMX A;  2JP1 A;  2Z4H A;  4WFN 3;  1SSO A;  5M5X B;  3OTO L;  5KYI A;  2E5L L;  1DD2 A;  1MKH A;  2WB1 E;  1VQ7 A;  1Y1W G;  2KHS A;  1EYD A;  1HZB A;  1RJT A;  2WKD A;  4LF8 L;  2X6L A;  4FF3 A;  3U4Z A;  2QCP X;  3SVM A;  2B2U C;  5NUC A;  5CMD A;  1YJN A;  4K5X A;  4Y7N B;  1HZ9 A;  2KEC A;  2CW0 C;  3E6Z X;  1LT6 D;  3PUX A;  4CJ0 B;  5DM6 3;  4JOI A;  4C3J B;  4DK0 A;  2K7V A;  3LWU A;  4IJL A;  4LFC L;  3EBE A;  4S3S A;  2F52 A;  5EJW A;  2DUD A;  5E3F A;  4J8Q A;  5IWA Q;  1SNO A;  5GAD C;  1XMQ Q;  3MA2 B;  3E0E A;  5C4Z A;  4K6L A;  5LL6 S;  2KCN A;  3A0J A;  1V1P A;  2WAC A;  2WAQ G;  5C0X G;  1HRJ A;  5BN5 A;  1K8M A;  3NPP A;  3A8J E;  1S72 A;  4EVO A;  2J0T D;  1EZ8 A;  1B50 A;  2DNC A;  1KDA A;  3R93 A;  3HZX A;  3K7U C;  1BCP D;  2EIF A;  3CCU A;  4OXP A;  2F0S A;  4EQP A;  3D4W A;  5HGQ A;  4BXX G;  1O7Y A;  2ENB A;  4KHP Q;  3G4S A;  4JI3 Q;  5HY6 A;  3CCS A;  1XMQ L;  2Z6K A;  4HTH A;  1K0S A;  3OIQ A;  3PO2 B;  2SDF A;  1KNE A;  4A3G B;  1G6Z A;  2ZJP A;  2M9V A;  2Z1C A;  1XYI A;  1MSH A;  3K59 A;  1EQR A;  4FNF A;  4KY7 A;  3A7L A;  1N8R C;  1XNQ L;  2JK8 A;  1HTP A;  3PUY A;  5JJI A;  1E24 A;  3CRK C;  4PMC A;  1PMR A;  3E0J A;  2KHJ A;  5EPL A;  5FO7 B;  5KGU A;  3CF5 A;  4ME3 A;  5C3W A;  3PIP 3;  5IGG A;  1JB7 A;  4MTN A;  4KHP L;  4K5V A;  1LM0 A;  4JI3 L;  5JOB A;  1YNX A;  1VQ6 A;  4HAE A;  4HJ9 A;  3MTS A;  4JI6 Q;  3KDF A;  2K14 A;  1BOS A;  3I73 A;  2NTS A;  4ZUJ A;  5C44 B;  3SGI A;  5FLX c;  5K36 G;  3ULL A;  5BR8 Q;  3G7L A;  4MZ9 A;  1PZK D;  1PTO D;  1K9M C;  2RQX A;  1J5E Q;  1K3R A;  1HZC A;  2JA7 H;  1JWM D;  1B8A A;  3KBX A;  4K2L A;  1GO3 E;  4JPB W;  1S40 A;  2CQA A;  2KJX A;  1IXR A;  1RIP A;  4ZRZ A;  1IBM Q;  1U4R A;  1Z9F A;  3VA5 A;  1PLF A;  4PMB A;  1VQP A;  2EYL A;  5AJ3 L;  2F4V Q;  2HHH Q;  1FVI A;  4YHH L;  1TII D;  4KD4 A;  5M5Y H;  3MEF A;  1S5E D;  2YU9 B;  4BBS B;  4H13 C;  1X6O A;  4BA1 I;  1EYG A;  2F0I A;  2VZA A;  3T1H Q;  2PI2 E;  5BR8 L;  1E1T A;  5M9O A;  1VMC A;  1ML0 D;  4OL7 A;  3J81 c;  3KF6 A;  1BO0 A;  2E2I B;  4KHZ A;  1A6X A;  3GTJ B;  2B2T C;  4O42 A;  2AUJ D;  4DXF A;  1IBM L;  5FLX L;  1WTO A;  4PQX A;  1DM0 B;  2MP1 A;  1QCB D;  1WTQ A;  1EUJ A;  1H9M A;  2F1M A;  3Q23 A;  4BXX H;  1H9K A;  2F4V L;  4R8N A;  2DJF C;  2VL6 A;  1E2Z A;  3SK6 A;  1STN A;  1D6E C;  4A3B G;  1DOM A;  1PH6 A;  2KCT A;  4L5T A;  4A3F G;  2K5H A;  3D6C A;  4B3R Q;  3HOZ B;  2O5I C;  1CQF A;  3DXJ C;  2XVS A;  1DCZ A;  1UE1 A;  4YWK A;  4A3I B;  1JOK A;  2B39 A;  5JAV A;  4R4O A;  4X3S A;  4WJW A;  3T1Y L;  5L37 A;  2A6E D;  1CKN A;  1L1O A;  4OEM B;  2J4X A;  2IJ0 A;  3J81 L;  2RCN A;  3KOJ A;  1CM9 A;  1KLG D;  2WV6 D;  1X3Q A;  1LTT D;  4A3K G;  1O7L A;  5D14 A;  1JR0 D;  1K0R A;  1JIC A;  1LV9 A;  4B3R L;  5K36 H;  3H0G B;  1V1Q A;  1SFO H;  4DR6 Q;  3BDO A;  1LUZ A;  4IFD J;  4WRD A;  4OX9 L;  1A8V A;  1Y69 U;  3S1N H;  3S15 B;  2L1B A;  1CZW A;  3GO5 A;  3K8A A;  2ZJR A;  1RCV D;  1H9S B;  2UXB L;  1V8Q A;  4PZ8 A;  4A3G H;  1SNQ A;  2JN4 A;  3NQT A;  3BZD B;  4IUQ A;  3PF5 A;  1YNN D;  4MHE A;  3HOZ G;  2Q2I A;  3PO3 B;  2ICI A;  3HOX G;  2KEE A;  5CV4 A;  3J80 c;  3TP5 A;  2CH4 W;  4JYA Q;  4CDD C;  5E4X A;  1SE3 A;  3BDC A;  3I91 A;  3SDZ A;  1X3G A;  4DR2 Q;  4IUP A;  5EQ0 A;  5E7N A;  1QVC A;  2AQ2 B;  3ONA B;  4JBM A;  2LXK A;  4XT1 B;  4DR6 L;  1G2S A;  2J7Z A;  5A35 A;  3MC0 B;  3OHX C;  4A3D G;  3GQB A;  3I4N B;  2OCE A;  3SR1 A;  1O7Z A;  1OXS C;  2PPB C;  3HG9 A;  3KJP A;  3FRP B;  5A2Q L;  4BS9 A;  1ZYR C;  2EYJ A;  4RCN A;  1HJP A;  3MHB A;  3PUZ A;  4MIU A;  2E2D C;  3SXH A;  1LT5 D;  2WP8 J;  4JYA L;  4A3B H;  4P2C B;  5FLM G;  4P72 A;  5FK9 C;  1VQL A;  2R7F A;  2BDO A;  4DR2 L;  1GUT A;  4XIG S;  3PUV A;  1WFQ A;  4A3F H;  3HOU B;  2NYZ D;  5KNC A;  1BBW A;  3HOY B;  3NSW A;  1IKL A;  1PFN A;  5M5W H;  1QJO A;  1U4P A;  4LF4 Q;  2HUG A;  2SNS A;  3J80 L;  1HZA A;  2AHO B;  2EJM A;  2Q2H A;  4XQJ A;  1ESF A;  1HQR D;  2WIN B;  3U4V A;  1VQ5 A;  4BBS H;  1SYC A;  3FEW X;  2EYF A;  1VQF A;  4C3H B;  4LMQ D;  4DNT B;  4B9W A;  1SEB D;  5ELF A;  4JCV E;  3RZD B;  2E2I H;  2DN8 A;  5I4D A;  2WKC A;  3BG3 A;  1NR4 A;  1CK1 A;  2QKI C;  4A3K H;  3CC7 A;  2BCO A;  1U0L A;  4RG1 A;  3FDT A;  3P7J A;  2G5D A;  1GHJ A;  4YCU A;  1EY6 A;  3V05 A;  5C3E G;  4DV6 Q;  4LF4 L;  3U58 A;  2BH8 A;  3C1E A;  1JOR A;  1Q46 A;  3CC4 A;  1SYG A;  1UE7 A;  2A19 A;  1GUG A;  1H9R A;  1YJW A;  1SYF A;  1STE A;  1BXT A;  1I4P A;  3HOZ H;  3NBI A;  4HJ8 A;  4TRD A;  2B2V A;  3HOX H;  4WJ3 M;  2R93 G;  1B70 B;  1TT2 A;  3HRZ C;  1I4Q A;  3A74 A;  1B44 D;  4I7A A;  2VB3 X;  2B2Y A;  4KJN A;  5K5P A;  2PI2 A;  4L5R C;  4DV1 Q;  5I2Y A;  1TS4 A;  3RZO B;  3U50 C;  3G6E A;  2YTY A;  4IQZ A;  2GA4 B;  3A8K E;  3PIP A;  3BVG A;  4HJ5 A;  4PZ7 A;  2H5X A;  1J9O A;  4DAY B;  1FD7 D;  3H0G H;  4U68 A;  1X55 A;  5I2X A;  5JJL A;  1CT1 D;  1ENC A;  5C5L A;  2B29 A;  4DV5 Q;  4LAA A;  1HR0 L;  2R7Z B;  5FOB B;  4OO1 I;  5IGD A;  2XTI A;  1N33 Q;  3ZJY C;  1BUV T;  3HS0 C;  2FXQ A;  4UAI A;  3TDQ A;  2IX0 A;  3NEN A;  2C9O A;  2JE6 I;  4IUR A;  1YJ9 A;  1UUP A;  3MFY A;  2RF4 A;  2QDB A;  3W5O A;  1TWG H;  1QVF A;  4Z9C B;  2BA0 A;  5EKL A;  3SK8 A;  2UUC L;  1JC7 A;  4IUT A;  2EVB A;  3DEO A;  1WTW A;  4QQB X;  4GOP A;  3CU7 A;  5IYD G;  1WI5 A;  3PGZ A;  1GJX A;  5M3M B;  5LMN Q;  1ET9 A;  4DV5 L;  2MJ8 A;  4NDX A;  1S3O A;  2I5L X;  5EBC A;  4UY8 C;  1EIF A;  3MWY W;  3I4N H;  1TR5 A;  3O13 A;  1WTX A;  3TRE A;  3VR6 A;  5COR A;  1N33 L;  3M4O H;  1X3P A;  1A3V A;  3W3A A;  4AQY Q;  3EFX D;  4DAP A;  1B1Z A;  2F0J A;  3NBH A;  1PRT F;  5C3E H;  3KJO A;  1VF5 C;  3MXU A;  1KRS A;  1PZJ D;  5I9P A;  3BU2 A;  4O2D A;  2R7Z G;  3OYY A;  3S16 B;  4AIM A;  5IGE A;  2B63 G;  4RFB A;  4DKA C;  4CGY B;  1HTL D;  3HOU H;  4KKU A;  5LMN L;  1IW7 C;  2A73 B;  1N34 L;  1JT8 A;  3OMC A;  3NQI A;  2F0N A;  1MI2 A;  1ONL A;  3GD7 A;  2R93 H;  1UE6 A;  3A56 A;  3A8I E;  2WII B;  4RA8 A;  2IWH A;  4YWL A;  1S5F D;  2B3G A;  4AQY L;  1A2U A;  5CV8 A;  5DM7 3;  4C3H H;  4GNX A;  2GN5 A;  1I4G A;  2KEN A;  1PHJ A;  3TQY A;  4R4I A;  4A3C G;  1EL0 A;  1QZG A;  1JMC A;  1CI3 M;  3NE5 B;  4X64 L;  2A69 D;  2HT1 A;  3ERS X;  4K0K Q;  1CHQ D;  3D31 A;  4RGM A;  4JV5 L;  1GKH A;  1NTG A;  3AYH B;  3I4M G;  1CZG A; 
#chains in the Genus database with same CATH homology
 3DHQ A;  4AYB B;  4BY7 B;  2B8G A;  4KK7 A;  1NSN S;  2K03 A;  1F2Y A;  1HPC A;  1SND A;  5CYU A;  2MGS A;  3OPO A;  2R92 B;  1Q8I A;  4HSP A;  1Y8N B;  1D1I A;  4UDU C;  3TME A;  3T51 B;  3SK5 A;  1F9R A;  3NK9 A;  1LT4 D;  4DNR B;  2PQE A;  1L0Y B;  1SJE D;  5ELE A;  5ISR A;  4I65 A;  3T16 A;  2L0C A;  1GUN A;  1ZKO A;  5IGC A;  3HKZ B;  2OF1 A;  2L5T A;  5KIX A;  2NVT B;  2F0V A;  1TY2 A;  2NWG A;  2AWN A;  2G9D A;  2K28 A;  2IX3 A;  3MXP A;  3K5O A;  5COY A;  2NN6 G;  2QF7 A;  3R3O A;  1TWA B;  1Y1W B;  3DEP A;  1EY7 A;  5D65 A;  2XIW A;  1WTR A;  4C2M B;  3D6W A;  4X3U A;  2D5D A;  3LNN A;  3IKJ A;  1PXU A;  2O2L D;  3VYS A;  4DA2 A;  1CHP D;  1Z6H A;  3GV3 A;  3IL8 A;  5M5Y B;  2D62 A;  2K1B A;  4ZYS A;  3KLR A;  2X6G A;  2WAQ B;  4DF7 A;  4G7H C;  1SNP A;  1XWE A;  4R9W A;  3VR3 A;  3KK7 A;  4ID6 A;  4RKB A;  1PFB A;  4XXE A;  1AN8 A;  1V43 A;  5C5M A;  4BWG B;  1L0X B;  4ABN A;  1LTG D;  4K14 A;  2EOT A;  2RKS A;  3N52 A;  1PTO H;  4FF2 A;  1QB5 D;  3ND9 A;  1I4R A;  1YNJ C;  1WD1 A;  5E4W C;  5EPK A;  1FGB D;  1EYC A;  4H0L C;  3K5N A;  4ZAI A;  2EY5 A;  1PRT D;  2L55 A;  2JEA I;  3NTI A;  3HP3 A;  2XN9 C;  4KY6 A;  1I6V C;  1E2W A;  1Q3L A;  1UNS A;  4EGV A;  1NR2 A;  2F0G A;  4PNY A;  2NN6 H;  3MZ5 A;  2ZXO A;  1SFO B;  1OO9 B;  2SNM A;  2F0K A;  4HR7 B;  4XDX A;  4HMI A;  4XQN A;  1EZ6 A;  5JEA G;  3Q24 A;  3S1N B;  2A5H A;  2KVM A;  3JAM L;  4QUC A;  4J6H A;  3NHH A;  1DJR D;  3NTH A;  1LTI D;  3S2D B;  1SAP A;  1JWS D;  3TZU A;  2OEO A;  2XSC A;  4IUN A;  3RMH A;  2EY6 A;  2A68 D;  1F9S A;  1AW7 A;  3TBI B;  4B9X A;  3OSO A;  4Q0F A;  4HMJ A;  3NWT A;  2PO4 A;  4X3T A;  2LKV A;  4OIK A;  3C2P A;  2JSO A;  4KD3 A;  2E2H B;  3WOE A;  1SNC A;  5FLX E;  4A3B B;  4RHR A;  2PW7 A;  4A3F B;  3H94 A;  2NB0 A;  1RD9 D;  1SYE A;  5M5W B;  2BE5 D;  2O5J C;  4OIJ A;  1I50 B;  1F9Q A;  4O1N A;  4U67 3;  5KNB A;  2EYP A;  1M4V A;  4KMU C;  5C0X H;  5EKI A;  5CBE E;  3VYU A;  2EJG C;  4A3K B;  1B2T A;  1F77 A;  2VNU D;  3M7N A;  5I6W A;  1MD2 D;  4PMW A;  2Z8L A;  1HA6 A;  4CKC A;  3CHB D;  5JEA H;  1SE4 A;  1SYB A;  2PZT A;  2E76 C;  2EY1 A;  3K57 A;  1B3A A;  3HOX B;  5AFW A;  3TP8 A;  2RSN A;  1M8A A;  3CKI B;  2RDH A;  1MGS A;  1XXG A;  1Z7T A;  3GP7 A;  1CFM A;  4CHT B;  1RTO A;  4A3D B;  1SE2 A;  5CV7 A;  4MN3 A;  1LTS D;  2OT2 A;  3AU7 A;  3T56 B;  2QIL A;  2AQ3 B;  2DY8 A;  1I4H A;  5A2Q E;  4ZLT F;  3E5S A;  4HED A;  1F2Z A;  1ZEQ X;  4K5W A;  2A74 C;  1LO5 D;  3S1R B;  3S1M B;  2IW3 A;  4ME5 A;  1TWG B;  3S14 B;  2HQE A;  3RD4 A;  2K01 A;  3HEJ A;  3QG1 A;  2B2T A;  3J80 E;  1EY4 A;  2Z4I A;  2F03 A;  2F0O A;  5IT9 L;  1FR3 A;  3MEH A;  3KF8 A;  1ET6 A;  1RF2 D;  3R2T A;  3M4O B;  3FVQ A;  5E1F A;  1OXT A;  2F4I A;  5C3E B;  2K6A A;  1RDP D;  4IZ8 A;  1LTB D;  2JA5 B;  4BA2 I;  2B2V C;  4NP5 A;  1G91 A;  2EE1 A;  2PZW A;  2PZU A;  1JOQ A;  5JVG 3;  5EKK A;  1MSG A;  2B2Y C;  1FNW A;  2A6H D;  4XYO A;  2R93 B;  2E74 C;  1SMY D;  3K5L A;  2VB2 X;  1D1K A;  1QG7 A;  1W6J A;  1HFN A;  3BYY B;  3A7A B;  4KV6 A;  4ULL A;  2PMZ B;  4IFD G;  1BCP C;  1PDQ A;  3K0Y A;  3P20 A;  3Q22 A;  1G29 1;  1R4P B;  2XRQ D;  2BA1 A;  4C56 C;  2RBM A;  2AWO A;  2SOB A;  4HN7 A;  4PV1 C;  3L7Z C;  1DOK A;  1DYQ A;  4V0B A;  2R6G A;  4YIJ A;  1EY0 A;  2IL8 A;  3QOJ A;  3VYT A;  5LL6 X;  3FMC A;  2A68 C;  5IGB A;  4QB4 A;  3ITP A;  1WVL A;  5ELB A;  4L8J A;  3EA6 A;  2Q8R E;  2KQ3 A;  3W2D A;  1O80 A;  1KTK A;  1LAB A;  2B2W A;  4IUV A;  4G7O C;  1VF7 A;  2RSO A;  1PTO C;  2K5Q A;  2KOL A;  3FPP A;  2F0W A;  3U9S A;  3I90 A;  5KND A;  2ZT9 C;  1QWY A;  4DAY A;  1A15 A;  1AEX A;  1STH A;  1TWF B;  2RVL A;  1A2T A;  4RWS C;  4C3I G;  5C4H A;  1JQY D;  4RGT A;  3D3R A;  5J1Z A;  2BE5 C;  2B63 B;  1EOT A;  1EY5 A;  2RDG A;  3VR4 A;  4FP5 D;  1ZXT A;  5DAU A;  1F2L A;  1PFM A;  3GTG B;  4ZKC B;  4GZY C;  1BCP B;  5KEE A;  1EU3 A;  3OIP A;  3P1H A;  2FFK B;  2H4O A;  1RTN A;  1RHP A;  5CGK A;  2H1E A;  2LFN A;  3J7A V;  2IPK D;  3KLS A;  3S17 B;  3VA7 A;  4IFD H;  1GXD C;  1RKN A;  3GTQ B;  2JYO A;  3I4M B;  3T13 A;  1UAP A;  4KTA A;  2LMC B;  4J1M A;  1S5D D;  1MBY A;  1STB A;  3A54 A;  4E6I A;  2EYO A;  3CRL C;  1EWC A;  5F2D A;  4FYD A;  2F0Q A;  5JVH 3;  1ENA A;  2F0H A;  1BBX C;  4HCS A;  4BY1 B;  4X3K A;  2A6E C;  4NW2 A;  3OW7 A;  1TQO A;  5CV5 A;  1PTO B;  3D8G A;  3I72 A;  1EEI D;  2MHV A;  3DWQ A;  3HGB A;  1EY8 A;  1TVX A;  4M1U B;  1B53 A;  4DAV A;  2OXP A;  4DU9 A;  2X69 A;  3QJY A;  3NUC A;  4NKL A;  1STA A;  1SDF A;  4RGN A;  3IAY A;  1I3Q B;  1II3 A;  3DWA A;  3SE0 A;  3V96 A;  3F2U A;  2CHB D;  4RH6 A;  4ILW A;  3RLF A;  1YNN C;  1DOL A;  2XNA C;  1BDO A;  5DEH A;  3OMG A;  3IFT A;  4FXK C;  4A3E B;  1GUW A;  5T1G A;  1Q1B A;  2F0L A;  1JCK B;  4QUF A;  5HGT A;  1NAP A;  3J7A F;  1WD0 A;  1ILP A;  2XRS D;  1H9J A;  3NWS A;  5BN3 A;  5IOD A;  1OXU A;  1IL8 A;  4RKL A;  3DMU A;  3ND8 A;  3KUP A;  4CJ1 B;  4HSV A;  1ROD A;  1R4Q B;  1SXT A;  1GUO A;  4OHJ A;  3I4L A;  2A6H C;  3ZYY X;  2BDN A;  2NTT A;  2LY7 A;  1TS3 A;  1EQV A;  2L11 A;  1ENF A;  3L3O C;  5KRU A;  3LX0 A;  2EYH A;  1KAA A;  3NTK A;  1B9N A;  1F9P A;  2V4D A;  3MVV A;  3QB3 A;  4IAL A;  2NZ1 D;  1IYV A;  3Q6S A;  5C0X J;  2JA6 B;  2K33 A;  2CVR A;  2FMM A;  4R8I A;  4DXG A;  1XX8 A;  4N9P A;  1JE4 A;  5CV6 A;  3IFD A;  5FO8 B;  4CKE A;  4V19 0;  1D5X C;  4EQN A;  1U9R A;  1Y8P B;  3MXN A;  1AZP A;  5FKA C;  2AQ1 B;  3GTK B;  2K32 A;  5JEA J;  1SYD A;  3URY A;  1EQT A;  1EEF D;  1D5M C;  1K83 B;  3S9W A;  3MXG A;  4A93 B;  1T5E A;  3X3N A;  2PW5 A;  1CTM A;  3LWE A;  3JAM E;  3HOV B;  5EGT A;  1SNM A;  1W6K A;  1QE6 A;  3I3C A;  1C48 A;  3NXW A;  1ZYR D;  1WCM B;  3H91 A;  1B4O A;  2M2L A;  2AUK A;  1GHK A;  1EU4 A;  1BNZ A;  1NUC A;  4CBV A;  3QWN A;  3VYR A;  4RHS A;  2B8F A;  3CQZ B;  3V2T A;  3SEB A;  2N88 A;  5T1I A;  1TWC B;  3Q0A A;  1V1P B;  1A3U A;  1G2T A;  2K5W A;  1SJH D;  2EY2 A;  2F0T A;  1B9M A;  3M85 A;  5C4J B;  1UEA B;  5C0X I;  1GOZ A;  3S2H B;  4NMZ A;  5CR3 A;  1C8C A;  3GV6 A;  4CJ2 C;  2VUM B;  2C5C A;  1E2V A;  1GUS A;  2R3Z A;  4F88 A;  1AZQ A;  2JXM B;  2K04 A;  4FXD A;  1JB3 A;  4C3J G;  4L63 B;  5D3I B;  4ZUI A;  2B2U A;  2KA7 A;  5IGF A;  1R9T B;  4IN3 A;  1HUN A;  3PMF A;  1Q1E A;  5LHY 1;  2HDL A;  2PYK A;  1V1O A;  3FPU B;  3WOF A;  1CA6 A;  3BYT B;  3I8Z A;  3P75 A;  2A69 C;  3MFG A;  2EZV A;  4CKB A;  2KED A;  1BF4 A;  3ERQ A;  2XWB B;  3QIA A;  4FF1 A;  4KN7 C;  3BDL A;  5G3L F;  3BS1 A;  3PUW A;  5IIF A;  3J81 E;  3PIO 3;  4G57 A;  1KLU D;  3S1Q B;  3T53 B;  1S5C D;  3GTM B;  3L9A X;  1DZ1 A;  2JA8 B;  2F0E A;  4QF4 A;  1A3T A;  1D2B A;  3UI2 A;  1FYC A;  4JBW A;  3H6M A;  1ILQ A;  1IHZ A;  4F7X A;  4Q5V A;  4G4K A;  1JOO A;  1XTC D;  2NVX B;  3ERO A;  2M00 A;  2EXZ A;  1ICW A;  5JJZ A;  5CC4 A;  1HA5 A;  1Y1V B;  2EYM A;  1AFP A;  2NUC A;  1S5B D;  4FXG C;  4C1N K;  2E2J B;  3EVQ A;  2YYZ A;  3HOW B;  3M3Y B;  1WTV A;  4ZQ3 A;  2F3V A;  4WOR A;  5IT9 E;  3RUZ A;  4F8M A;  2BOS A;  4KN4 C;  2RDF A;  1G8Z D;  2DY7 A;  3SK4 A;  1IW7 D;  2JEB I;  4TSS A;  2HCI A;  2EPB A;  4K2K A;  2PCF B;  5M3F B;  5C3X A;  2F0F A;  4ZKB B;  1Q12 A;  1U4M A;  2IT1 A;  3EQL C;  1LT3 D;  1H9S A;  1TS2 A;  1DXM A;  1FNU A;  5TSS A;  2WB1 B;  2L4N A;  4K8I A;  3EJI A;  3X3M A;  1AP0 A;  3TZD A;  2KCC A;  5I9O A;  1LTA D;  1IKM A;  3KBG A;  1S4Z A;  2HDM A;  1QIL A;  1KDB A;  3BVM A;  1Z47 A;  2FMC A;  5EPJ A;  3M7G A;  2PNR C;  4KI0 A;  4N9T A;  1PYW D;  2L12 A;  4QCL A;  1DON A;  3VR2 A;  4I7Z C;  1BQQ T;  3DUZ A;  5BN4 A;  1TWH B;  2NVY B;  2MPM A;  2F0U A;  1WTP A;  1D5Z C;  3I70 A;  3FKI B;  4M8A A;  4TQU S;  1PRT C;  2B2W C;  5JPM C;  2QEJ C;  4RAU C;  2RA4 A;  2EDG A;  1EIG A;  3SHL A;  4RCO A;  2HCC A;  1QNK A;  2I07 B;  1OXV A;  1TU2 B;  5C4X B;  5HUR A;  1HCZ A;  1KNA A;  4C3I B;  1FNV A;  4ODG A;  3K6O A;  4KHV A;  2L9H A;  4DK1 A;  3OOC A;  1CQV A;  3GTL B;  2EJF C;  4IFD I;  1OXX K;  2FJ2 A;  3K58 A;  1QOH A;  5CBA E;  3G6J B;  1EFI D;  1HFG A;  3H09 A;  1IYU A;  3GTP B;  4EQO A;  4F87 A;  2KUM A;  5G3L D;  1TS5 A;  4LJZ C;  2ICE C;  2F3W A;  1HXY D;  4KJO A;  2F0P A;  5IOC A;  3KLS X;  2D9U A;  4A3M B;  3C46 A;  1KAB A;  4OO1 G;  3TSS A;  3A55 A;  4C3H G;  1EY9 A;  2CW0 D;  2N55 A;  4C1N I;  1PRT B;  1JWU D;  2XWJ B;  4DFA A;  1YNJ D;  5DNF A;  3TP6 A;  2NVQ B;  3QO2 A;  5KYL A;  3M4Y A;  3TP7 A;  5ELC A;  4XT3 B;  4KKS A;  2MUY A;  4A3J B;  2VXW A;  1HQM C;  4H44 C;  5C6A A;  1STY A;  1VCI A;  5ELD A;  3MAQ A;  5J39 A;  4G7Z C;  4KKT A;  3R2I A;  3QOL A;  4DGZ A;  5I6Y A;  4FVM A;  4JK1 C;  2K05 A;  5FO9 B;  4TKO B;  1ESR A;  4DN4 M;  2ID0 A;  2O4X A;  1T5X D;  4K6D A;  1Y8O B;  4K8J A;  4BBR B;  1EYA A;  2FIN B;  1STG A;  2R61 A;  1C4Q A;  3WDN A;  1BR9 A;  1LAC A;  2ZXP A;  4FF4 A;  1LTR D;  2Q8T A;  2ZXR A;  1BCP F;  1Q90 A;  1SBB B;  5D3D A;  3AB9 A;  2FHT A;  2IX1 A;  4QIW B;  2F0D A;  5EBD A;  3N6R A;  4OO1 H;  1K8O A;  4QMG A;  2I46 A;  3T4A C;  4HCE A;  3PV0 A;  4H7B A;  3J7Y W;  1VDZ A;  1LLR D;  1QNU A;  2Q8I B;  1F2M A;  4IUU A;  2LS0 1;  2K5D A;  3VR5 A;  2F0M A;  4KY5 A;  3R8B A;  1PTO F;  1KDC A;  4FO2 A;  4OGQ C;  2NBF A;  1I6H B;  1J8I A;  1PZI D;  2DNE A;  4LK1 C;  3K5M A;  3K7A B;  4B08 A;  2TMP A;  3BVZ A;  2G9H D;  1SMY C;  1VMP A;  1U4L A;  4ZK9 B;  4XTC S;  2E75 C;  5JPN C;  2Y0S B;  4XQQ A;  3GTO B;  3OWE B;  2D2C C;  4RGO S;  1I4X A;  3U9O A;  2TSS A;  3TN2 A;  1TKW B;  2NN6 I;  2JA7 B;  1E0B A;  4L6T B;  1EIH A;  5CV9 A;  5J22 A;  1HUM A;  3NP8 A;  3C1F A;  3D4R A;  3C3L A;  3DM1 A;  2SEB D;  1NCV A;  3H3V C;  3D4D A;  4XYQ A;  3DWP A;  3AMU A;  1X32 A;  3OWF A;  1O78 A;  1EWH A;  1HHV A;  1TY0 A;  1CA5 A;  2JP1 A;  2Z4H A;  4WFN 3;  1SSO A;  5M5X B;  5KYI A;  1DD2 A;  2KHS A;  1EYD A;  1RJT A;  4FF3 A;  2WKD A;  2X6L A;  2QCP X;  3SVM A;  2B2U C;  5NUC A;  5CMD A;  4K5X A;  4Y7N B;  2KEC A;  2CW0 C;  3E6Z X;  1LT6 D;  3PUX A;  4CJ0 B;  5DM6 3;  4C3J B;  4DK0 A;  2K7V A;  3LWU A;  4S3S A;  5EJW A;  5E3F A;  4J8Q A;  1SNO A;  3MA2 B;  5C4Z A;  4K6L A;  5LL6 S;  2KCN A;  1V1P A;  2WAC A;  5C0X G;  1HRJ A;  5BN5 A;  1K8M A;  3NPP A;  3A8J E;  4EVO A;  2J0T D;  1EZ8 A;  1B50 A;  2DNC A;  1KDA A;  3R93 A;  3HZX A;  1BCP D;  2F0S A;  4EQP A;  3D4W A;  1O7Y A;  2ENB A;  4HTH A;  3OIQ A;  3PO2 B;  2SDF A;  1KNE A;  4A3G B;  1G6Z A;  2M9V A;  2Z1C A;  1XYI A;  1MSH A;  3K59 A;  4FNF A;  4KY7 A;  3A7L A;  1HTP A;  3PUY A;  3CRK C;  4PMC A;  1PMR A;  3E0J A;  5EPL A;  5FO7 B;  5KGU A;  5C3W A;  3PIP 3;  5IGG A;  4K5V A;  5JOB A;  4HAE A;  3MTS A;  1BOS A;  3I73 A;  2NTS A;  4ZUJ A;  5C44 B;  5K36 G;  3G7L A;  1PZK D;  1PTO D;  2RQX A;  1JWM D;  3KBX A;  4K2L A;  2CQA A;  2KJX A;  4ZRZ A;  1U4R A;  3VA5 A;  1PLF A;  4PMB A;  2EYL A;  1TII D;  4KD4 A;  1S5E D;  2YU9 B;  4BBS B;  4H13 C;  4BA1 I;  2F0I A;  5M9O A;  1VMC A;  1ML0 D;  4OL7 A;  1BO0 A;  2E2I B;  4KHZ A;  1A6X A;  3GTJ B;  2B2T C;  4O42 A;  2AUJ D;  4DXF A;  5FLX L;  1WTO A;  4PQX A;  1DM0 B;  2MP1 A;  1QCB D;  1WTQ A;  1H9M A;  2F1M A;  3Q23 A;  1H9K A;  4R8N A;  1E2Z A;  3SK6 A;  1STN A;  1D6E C;  1DOM A;  3D6C A;  3HOZ B;  2O5I C;  1CQF A;  3DXJ C;  2XVS A;  1DCZ A;  4A3I B;  1JOK A;  2B39 A;  5JAV A;  4X3S A;  4WJW A;  2A6E D;  2J4X A;  2IJ0 A;  3J81 L;  1CM9 A;  1KLG D;  2WV6 D;  1X3Q A;  1LTT D;  1O7L A;  5D14 A;  1JR0 D;  1JIC A;  1LV9 A;  5K36 H;  3H0G B;  3BDO A;  4IFD J;  4WRD A;  1Y69 U;  3S15 B;  2L1B A;  1CZW A;  3GO5 A;  1RCV D;  1H9S B;  1V8Q A;  1SNQ A;  3NQT A;  3BZD B;  4IUQ A;  1YNN D;  4MHE A;  3PO3 B;  2ICI A;  2KEE A;  5CV4 A;  3TP5 A;  5E4X A;  1SE3 A;  3BDC A;  3I91 A;  3SDZ A;  4IUP A;  5EQ0 A;  2AQ2 B;  3ONA B;  4XT1 B;  1G2S A;  2J7Z A;  5A35 A;  3MC0 B;  3OHX C;  3GQB A;  3I4N B;  3SR1 A;  1O7Z A;  1OXS C;  2PPB C;  3HG9 A;  3FRP B;  5A2Q L;  4BS9 A;  1ZYR C;  2EYJ A;  4RCN A;  3MHB A;  3PUZ A;  4MIU A;  3SXH A;  2E2D C;  1LT5 D;  2WP8 J;  4P2C B;  5FK9 C;  2BDO A;  1GUT A;  4XIG S;  3PUV A;  3HOU B;  2NYZ D;  5KNC A;  3HOY B;  3NSW A;  1IKL A;  1PFN A;  1QJO A;  1U4P A;  2HUG A;  2SNS A;  3J80 L;  2EJM A;  4XQJ A;  1ESF A;  1HQR D;  2WIN B;  1SYC A;  3FEW X;  2EYF A;  4C3H B;  4LMQ D;  4DNT B;  4B9W A;  1SEB D;  5ELF A;  3RZD B;  2DN8 A;  5I4D A;  2WKC A;  3BG3 A;  1NR4 A;  1CK1 A;  2QKI C;  2BCO A;  3FDT A;  3P7J A;  1GHJ A;  1EY6 A;  3V05 A;  3C1E A;  1JOR A;  1SYG A;  1GUG A;  1H9R A;  1SYF A;  1STE A;  1BXT A;  1I4P A;  3NBI A;  4TRD A;  2B2V A;  1TT2 A;  3HRZ C;  1I4Q A;  1B44 D;  2VB3 X;  2B2Y A;  4KJN A;  5K5P A;  5I2Y A;  1TS4 A;  3RZO B;  4IQZ A;  2GA4 B;  3A8K E;  3BVG A;  1J9O A;  1FD7 D;  4U68 A;  5I2X A;  1CT1 D;  1ENC A;  5C5L A;  4LAA A;  2R7Z B;  5FOB B;  4OO1 I;  5IGD A;  1BUV T;  3HS0 C;  4UAI A;  3TDQ A;  2IX0 A;  2C9O A;  2JE6 I;  4IUR A;  1UUP A;  3MFY A;  2QDB A;  4Z9C B;  2BA0 A;  5EKL A;  3SK8 A;  1JC7 A;  4IUT A;  2EVB A;  3DEO A;  1WTW A;  3CU7 A;  1GJX A;  5M3M B;  1ET9 A;  2MJ8 A;  4NDX A;  5EBC A;  3MWY W;  1TR5 A;  3O13 A;  1WTX A;  3VR6 A;  5COR A;  1X3P A;  1A3V A;  3W3A A;  3EFX D;  4DAP A;  1B1Z A;  2F0J A;  3NBH A;  1PRT F;  1VF5 C;  3MXU A;  1PZJ D;  5I9P A;  3S16 B;  5IGE A;  4RFB A;  4CGY B;  1HTL D;  4KKU A;  1IW7 C;  2A73 B;  3OMC A;  3NQI A;  2F0N A;  1MI2 A;  1ONL A;  3GD7 A;  3A56 A;  3A8I E;  2WII B;  4RA8 A;  2IWH A;  1S5F D;  1A2U A;  5CV8 A;  5DM7 3;  1I4G A;  1EL0 A;  1CI3 M;  3NE5 B;  2A69 D;  1CHQ D;  3D31 A;  4RGM A;  1CZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...