1G6ZA

Solution structure of the clr4 chromo domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
ISSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CLR4 PROTEIN
publication title Solution structure, domain features, and structural implications of mutants of the chromo domain from the fission yeast histone methyltransferase Clr4.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 7
structure length 70
sequence length 70
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g6zA00
1WD1A 2X6LA 1AZPA 4CJ1B 4U68A 1AP0A 1VMPA 1JICA 1EOTA 2B2YA 1WVLA 1DONA 1F2LA 2B2UA 4ZAIA 2J7ZA 1X3QA 2RSOA 2KVMA 2EE1A 2JYOA 2K01A 4IUTA 1JE4A 1U4LA 3LWEA 5EPJA 2DY7A 2L4NA 1O7ZA 2D9UA 4MHEA 3G7LA 1B4OA 3F2UA 1MSGA 2XIWA 1SDFA 2R3ZA 3SVMA 1AZQA 2IL8A 4XT3B 2MP1A 5CORA 1IL8A 1Q3LA 1RODA 3FPUB 1QE6A 3HP3A 1ILQA 5DNFA 4MN3A 4HCSA 3R93A 1DOKA 2KUMA 1BNZA 5JJZA 2NYZD 2HDMA 2X69A 3GV6A 3KBXA 1G6ZA 3QO2A 1U4MA 1HUNA 1G2SA 1WD0A 4X3SA 3N52A 4X3KA 2NZ1D 1DOLA 2NWGA 1HHVA 4X3UA 1NR4A 4ZKCB 4RWSC 4DN4M 5CBAE 1XYIA 1RTOA 1KNAA 2FHTA 4RA8A 1X32A 1WTPA 2B2WC 1O7YA 2Q8TA 1SSOA 2RVLA 1C8CA 1B2TA 4XDXA 1NAPA 2HUGA 2JP1A 2KOLA 2KECA 4IUPA 2FMMA 2K28A 2N55A 1MSHA 1ICWA 2M2LA 5AFWA 2HDLA 1PLFA 2MPMA 1MGSA 1QNKA 2FINB 3I8ZA 3KUPA 1WTQA 2Q8RE 1MI2A 1PFNA 2DY8A 2EOTA 2B2TC 3DEPA 1EQTA 4CJ0B 1WTVA 2BDNA 1ILPA 1BBXC 4HSVA 2B2VC 1WTOA 4ZKBB 5EKIA 2K05A 5D14A 1HRJA 1DZ1A 1M8AA 1LV9A 3MTSA 5EJWA 3GV3A 5CMDA 1RTNA 1VMCA 1U4PA 4IUVA 5EPKA 5D65A 3TZDA 1HA6A 2K04A 2KEEA 2MJ8A 3UI2A 1EL0A 1HFNA 1B50A 4QUFA 3P7JA 1G2TA 1PFMA 1XX8A 3D6WA 2RA4A 2EPBA 1BO0A 1CM9A 1KNEA 2B2WA 1DOMA 2HCCA 2L1BA 1J9OA 3DEOA 4RAUC 1TVXA 5EQ0A 4XT1B 2X6GA 1O80A 1HFGA 1S4ZA 2L11A 1F9QA 5T1IA 5T1GA 1WTRA 1F9PA 3TN2A 2L9HA 1E0BA 1WTXA 2CVRA 3ONAB 1GUWA 1NR2A 1B53A 3MWYW 4X3TA 2FFKB 1A15A 4IURA 1HUMA 4OIJA 4IUUA 1ESRA 2B2VA 1NCVA 2RSNA 3I3CA 5CBEE 2B2YC 4LMQD 3I90A 2B2UC 2FJ2A 2H1EA 3IL8A 1G91A 4IUQA 2VXWA 1CA6A 1RHPA 3H91A 2MGSA 1X3PA 4O42A 5EPLA 1ZXTA 4UAIA 4R9WA 5E4XA 4ZLTF 1J8IA 5COYA 1PFBA 4R8IA 1F9SA 2KEDA 3Q6SA 4OIKA 1CA5A 1IKMA 1PDQA 4CJ2C 3FDTA 1EIGA 1RJTA 2N88A 2HCIA 3I91A 1BF4A 1WTWA 4HEDA 3DM1A 4HAEA 1ML0D 1F9RA 1U4RA 2K1BA 2SDFA 1B3AA 1SAPA 2K03A 4NW2A 5E4WC 4ZK9B 1IKLA 1QG7A 1EIHA 2B2TA 3IFDA 4QUCA 2L12A
chains in the Genus database with same CATH superfamily
4UHVA 3J81L 3HOUH 2O2LD 4LF4L 1IW7D 2LKVA 4M8AA 1CT1D 4JV5Q 1G51A 4O0AA 1TWCH 4DK0A 3NPPA 4X66L 3HZXA 5DNFA 3VA5A 4A3GG 1KC8C 3JAMi 1SE4A 4OWWB 4KN4C 4O2DA 2NVXB 2K5HA 4XQNA 3GTJH 4X3KA 4C3HB 3DWPA 4DV1L 3M4OH 2RHSB 2F0DA 4ZUJA 1Y1WB 2I0QA 2FHTA 2JA7B 4A3IH 3MXPA 1SN8A 2RVLA 1S5ED 1B2TA 4DV5Q 3DM3A 1SR3A 3X3NA 3IKJA 1OXXK 4KHVA 4NKLA 1GUSA 2E76C 1PH4A 3W1GA 3A54A 3DWQA 2IY5B 2K04A 2DUDA 1B50A 3U4VA 2HT1A 2NN6G 3CD6A 2F0VA 5FO9B 1JWUD 4LF9L 4KKUA 4FF4A 2G9DA 4OL7A 5GAHC 2WB1G 3TQYA 3CQZB 4YY3Q 1HQMC 4DV4L 3J7AF 4EQ5A 2NVYB 2XGTA 1PA6A 4LF8Q 3RMHA 3A0JA 1JJGA 3GTQH 4LF7L 3CPWA 4E6IA 3KYHC 1AE3A 5EKKA 4GNXA 2I5MX 1HTPA 2Z6BA 4B9XA 4A3MH 2WV6D 1PDQA 4N8FA 1I94L 1VQCA 3S9WA 2CWPA 3SHLA 1GM5A 1PZJD 4IZ8A 1A6XA 1SJED 1E2VA 4NMZA 1U5KA 4NW2A 1B3AA 2K03A 5G3LD 1YNXA 1CQVA 2LMCB 3IFDA 3J81E 2A5HA 4C2MB 4DUZL 1AP0A 4U68A 1KDCA 5ELFA 3QJYA 1YJNA 1JORA 1L1OC 3M4OB 5FJ8H 1Q8KA 3LWEA 2N3SA 4C3IG 3F2DA 4H02A 2XIWA 3TS2A 1RD9D 1EWHA 3Q24A 1II3A 1GD7A 3ICEA 1Q3LA 2WAQB 3PO2G 4R4CA 2F3WA 1TS3A 2ZXOA 1V1PB 2I5HA 3I4MH 1RCVD 1I4RA 5IWAQ 3JAMc 1U4MA 1Z6HA 4A75A 4GKJL 3N52A 1SRUA 1NMGA 1BUVT 5IYBG 1HNZL 3NWTA 3KLRA 3PGZA 4QF4A 1C8CA 3PUYA 2E2IH 1NE3A 2G9HD 2E75C 3HOYG 3KDFB 4L5SA 1BKBA 2O5IC 4BBRG 1Y1VG 4CDDC 2SOBA 3RLFA 4OXPA 3SEBA 2E2HH 1MI2A 1V1QA 3I4NB 1WTOA 1EY4A 3K0YA 3VR4A 1GJXA 2A6HD 4ZUIA 2EYHA 5C4JH 5D65A 3H15A 4X6AH 5G3LF 1Z47A 2K5VA 2NZOA 2R93H 1R9TH 2F0TA 4JI4Q 3E9HA 4B3RL 3F2CA 3N6RA 4R4QA 1O80A 3T1YL 1BBUA 2HQEA 1I4HA 2YTXA 4R4OA 4KKSA 1B53A 1GHKA 4OO1H 1HUMA 1YNNC 5C3XA 4POFA 3VR2A 4K5VA 4QIWB 3LNNA 3CKIB 2WACA 1DD2A 2H1EA 3K6OA 1SEBD 2JEBI 2QEXA 3CCRA 1WCMB 2KENA 4F7XA 3PUXA 1Q12A 1F9SA 5C5LA 3UE0A 1HR0L 1ZYRD 4K14A 1X56A 1CUKA 5ELCA 3HOZB 5JVG3 1WTWA 3DM1A 4A3EH 3S14B 1EOVA 1IBKQ 4X66Q 2JA6H 1HH2P 3M4QA 2B2TA 1HNXL 1CTMA 1VQOA 3I4MB 1JICA 1EOTA 1HXYD 1D1IA 1F2LA 2KVMA 1BCPB 5JEAG 1I4PA 3NE5B 4DV1Q 1CKNB 1PH8A 4MZ9A 3PCOB 1UNSA 4EX5A 1RKNA 1HTLD 1TWAB 1PTOC 3R93A 4M1UB 2PCFB 3H0GG 2NYZD 2E2HB 3NENA 3H94A 3C1EA 1LUZA 1S5DD 2V4DA 4C3JG 2OQ0A 4DR4L 4K6DA 4A3JB 5J1ZA 4CDEC 4A3DH 3MFYA 3NUCA 1O7YA 1K8GA 1JWMD 3ITPA 3T53B 4RCOA 1I4QA 3RZOB 2JA5B 2I07B 3FHWA 5DLQE 1WTQA 1PH2A 4LF9Q 2EDGA 2WINB 1PFNA 3L7ZC 5E7NA 4MTNA 2VQEQ 4QQBX 5D14A 4PMBA 5ELEA 4GS3A 1YHQA 3S1RB 3EFXD 3TZDA 2WAQE 1HA5A 3P7JA 4LF7Q 5IYCH 2HD3A 4C3HG 4JOIA 2VUMG 1EEFD 2K6AA 2L1BA 1Y1WG 4XYQA 2WIIB 1JJ2A 2JA7G 2KQ3A 3H3VH 1EQVA 1Q1EA 2L9HA 3PV0A 3BU2A 4Q5VA 2DN8A 1I94Q 4HMJA 5IGFA 5DAUA 1CFMA 2F3VA 2NN6H 3J7AV 3F1ZA 2IW3A 2KHJA 3EROA 3I3CA 3BZCA 4CDCC 1N36Q 2JA6B 4IPCA 1RHPA 3H91A 1EEID 4I65A 1S40A 4DV0L 4ODGA 1WJJA 2QILA 3STBD 4DUZQ 3GTPH 4JYAL 4LFBL 5E4XA 1V1PA 4KV6A 2XVSA 4LUZA 1EIGA 4JI8Q 3KJPA 5IP7G 1YHBA 1IBML 4KD3A 2YU9H 5JPNC 4XTCS 4QY7A 1YI2A 2Z6KA 2PMZB 2ES2A 1EZ8A 4QUFA 3KDFA 4FF1A 1AZPA 5AJ3Q 2SNMA 3T56B 1PMRA 4GKJQ 3S16H 1JE4A 1JOOA 2DY7A 3CXCA 1FGUA 3PF4A 1HNZQ 5KIXA 4A3GB 1IL2A 4DR2L 3FPUB 3J81i 1E22A 1E24A 2I5LX 4KD4A 4QMGA 2ZJPA 3OHXC 3L9AX 3O13A 3K59A 3GDEA 4C3IH 5JVH3 2NZ1D 5BN5A 1H9RA 1CHPD 1H9KA 2RCFA 3JAME 1SE8A 3C3LA 1IZ6A 3PO2H 2PO4A 1KRTA 1MKHA 1AH9A 4K8IA 1N34L 1NAPA 2JP1A 3K58A 1YJ9A 2JJQA 1VDZA 2F0JA 2EXDA 4H0LC 4DK3C 4B3RQ 3PO3B 3KUPA 3KLSX 4H44C 1QVGA 1LT4D 2DY8A 5IYBH 4JPBW 2KBNA 3HG9A 3MEFA 5IYDH 3SGIA 4DGZA 2UUAL 1NTGA 3M7GA 4DV6L 5TSSA 5CMDA 3T1HL 3PUZA 4PG3A 4BBRH 1Y1VH 3S1NB 3UI2A 3LWUA 1QWYA 1DYQA 4B3SQ 3EVQA 1U0LA 2WB1B 4BXXG 5CV6A 5GADC 4RAUC 2HIVA 3GTPB 4IFDI 2OTJA 3PSIA 3A5ZB 2CVRA 1HR0Q 2R61A 4FVMA 1ET9A 3K5OA 2RF4A 1CKNA 2AHOB 5GAGC 4HCEA 3I4NG 1XNQL 1XMOL 5JJKA 1GUNA 2L55A 3HKZG 3EN2A 1CA6A 3RLNA 3A7LA 1VS0A 2PQAB 2ZT9C 4WJWA 4EQOA 4ZLTF 1MD2D 5M3FB 3R3OA 4R8IA 1DXMA 3S16B 2MUYA 5M5WB 3L0OA 1PV4A 1F9RA 5FK9C 5E4WC 4A3KB 1EIHA 2PI2E 1VQFA 4QUCA 3A56A 2F4VL 3SK5A 1VMPA 1BXTA 1LT3D 3KF8B 4O1NA 4ABNA 2EY6A 4ZAIA 2K75A 4C3IB 1QILA 1PRTD 4KJNA 5LL6S 1IW7C 3DWAA 3CF5A 1GUGA 1O7ZA 1IYUA 1LTAD 2D9UA 3PIP3 2DNCA 1BQQT 3CU7A 1BCPD 4DUYL 4XT3B 3PUWA 1WCMG 1VQIA 1W2BA 4KY7A 5HY6A 4DR7Q 4RGNA 4FP5D 5K5PA 1TKWB 5CV8A 2PI2A 1NNXA 2DJGC 3HOZG 3HOWB 5JEAH 3NEMA 2KCTA 4PZ8A 5CC4A 1KL9A 5JJIA 1H9JA 5H1SE 5CBAE 1V1OA 1RTOA 1K8AC 3HOYB 3D31A 1Y1VB 2QGQA 4DAYA 3H0GH 4IUPA 4IPGA 4CKCA 2FMMA 3NTHA 5I9PA 1VQDA 3DUZA 1XWEA 1SNDA 3S2DB 3EIVA 4C3JH 3EQLC 3PQIA 5CV7A 2EJGC 2KHIA 2VNUD 3FP9A 1N8RC 5I4DA 3VYTA 3NQTA 5C4XG 1LTRD 2VZAA 1XX8A 2AWOA 4BS9A 4GLAC 1TVXA 4DV0Q 1TS4A 2EYOA 2X6GA 3K8AA 4A3JG 1AFPA 4JYAQ 1X55A 4LFBQ 3OIQA 1E0BA 1PRTF 1ASZA 5KYIA 3GTOH 5A35A 5FKAC 4IURA 1L0YB 1IBMQ 2JA5G 4A3CG 1BCPF 2EY1A 1B3QA 1UE7A 4JI3L 4C3HH 2IWHA 3W1BA 3NTKA 4P74A 2O5JC 1IYVA 3H09A 1Y1WH 3BYYB 2JA7H 1N32L 2MGSA 4O42A 5GROA 3KLSA 2L5TA 2UUBL 4IFDG 4HJ9A 1K83B 4OIKA 1YVCA 4I7AA 1SNQA 2VS1A 2IX1A 2QW7A 4NP5A 1LTLA 4V190 5IGCA 3L2PA 3D4RA 3QB3A 1SYDA 3VYRA 4KY5A 3HOXB 3QIAA 1CQFA 4DR2Q 1S72A 4KHPL 2WB1E 2PNHA 3E9IA 3I2ZA 4DR1L 2P5ZX 2JA9A 3FMCA 2ZXPA 4IUNA 4CGYB 4DR3L 3SK4A 1X3QA 5IP7H 2Z4IA 3HRZC 4UP9A 3F2UA 4GOPC 1K73C 2XTIA 5IGBA 5IODA 3KF6A 2MP1A 1L0WA 1N34Q 3B6YA 1IYJB 4PZ7A 1KQSA 3D4WA 5I2XA 1K8MA 2JK8A 2F0NA 4L5TA 3AFQA 2O4XA 2ASBA 1FVIA 3TZUA 1J5EQ 4DKAC 4X3SA 1AW7A 5J39A 1JOQA 1EIFA 5I2YA 2UUAQ 4DV6Q 3T1HQ 3SDZA 1VQ7A 1GVPA 3L3OC 4CHTB 1YBYA 5CR3A 2EIFA 1D7QA 1ICWA 4LJZC 4DNRB 2N49A 5HGTA 2Y0SB 1K28A 1QNKA 5HGQA 1Z9FA 2HHHQ 1ZEQX 3DEPA 5ISRA 3WOFA 2PQAA 2Q8IB 1JJCB 1BBXC 4DV7Q 2LFNA 4C2MH 3GTOB 1M8AA 1LV9A 3CAMA 2B39A 1E1OA 1RTNA 3PIOA 1SMYD 4JI2L 4HSPA 2A6HC 2VUMB 1ET6A 2PQEA 4F8MA 2D0PA 2WKCA 1XNQQ 4PMWA 1XMOQ 2EQSA 3H6MA 4IPDA 2K5WA 3UDIA 3HKSA 4HIOA 4RFBA 3KF8A 2VY3A 3BYTB 5LMUQ 3W3AA 4G57A 1K3BC 2EYLA 4I7ZC 1L1OB 5FOBB 3PO3G 1I6VC 4BXXH 3GO5A 3FKIB 4EGVA 1KAWA 1TU2B 5EPLA 2QDLA 3QOLA 3NWSA 5CV4A 2ATWA 2F4VQ 2MHVA 1N9WA 1JOKA 1LLRD 3RR5A 3WDNA 4UDUC 3CC2A 2E8GA 2CW0D 3A8KE 3PIPA 3I4NH 1XTCD 1S5BD 2B29A 1ML0D 2SEBD 4LFCL 4DUYQ 4A4IA 2F0LA 3M4YA 5T1GA 1PTOH 4JBKA 2B2YA 2K52A 1EQQA 2RSOA 1PYBA 3SK8A 1M90C 5IE8A 4K5WA 3BDCA 1C48A 4DR5L 3A55A 4IJHA 1GOZA 1B7YB 2JXMB 4RCNA 2D2CC 3VYSA 5M3FG 1QE6A 1EWIA 5C4ZA 3A8JE 1BNZA 2K4KA 2B63G 1M4VA 2HDMA 2K7VA 4F88A 3GP7A 1SNOA 4A3KG 1WCMH 4AQYL 1B1ZA 1FNVA 1C7YA 1X54A 1EY0A 1UEBA 2IPKD 1B70B 3G6JB 2F0GA 3OSOA 3OTOL 1SBBB 2H4OA 1TS2A 4RKBA 3FEWX 3HOZH 2K28A 3MXGA 2VB2X 1DCZA 4JI5Q 1MGSA 3RUZA 3S14H 5C3EG 1NSNS 4AYBE 2B2TC 4XQQA 5IY0A 2B2VC 4TQUS 1K8OA 4FNFA 5IT9c 2ZJRA 4L5RC 4JC0A 1YITA 2Q2IA 3E3XA 4JI3Q 3HOWG 1EL0A 5C0XI 2JEAI 4DAMA 2EYFA 4YWKA 1N33L 1N32Q 1X3GA 4JCVE 1YIJA 1TWAH 1K3RA 3TP5A 2AQ2B 1R4PB 2UUBQ 1HPCA 1B44D 2IHFA 2XNAC 3OWFA 3TP7A 2E2JB 1NR2A 4LUOA 2AWNA 5M5XH 4KLKA 3CP0A 3HKZB 1ENFA 5C4XH 3I55A 1JR0D 1D1KA 1IHZA 1HCZA 1K0SA 2B2UC 1W3SA 2FJ2A 5FO8B 4A3JH 4NB3A 4JBMA 4KHPQ 2Z9HA 3RLOA 1PTOB 1PH5A 4MTKA 4YHHL 4OX9L 3I72A 4DR1Q 5E1FA 1PFBA 3STBC 2F0OA 4IQZA 4DR3Q 3RZOH 2JA5H 1SROA 4A3CH 2YTYA 5K36H 1QOHA 5F2DA 5IOCA 4JBJA 3VDYA 2XRSD 1VQNA 1TXYA 4WFN3 4HJ7A 4HEDA 4A3BG 2UXBQ 1LABA 1LTGD 1EY9A 3TDQA 3OYYA 1SYEA 2XSCA 4IFDH 4BY1G 2VL6A 3S1RH 4OGQC 4TRDA 3K5MA 2JA8B 1XMQQ 2UXCQ 4Z9CB 4IUTA 3V2TA 1HZ9A 3TS0A 1KTKA 4LF4Q 1CSQA 2KCCA 3F2BA 2IL8A 1JMCA 2Z0SA 3HP3A 4BA2I 1MIUA 4HCSA 3KBXA 3J7YW 1SFOH 3QG1A 4DXFA 3U9OA 5M9OA 1UEAB 4GZYC 3RN5A 2ZXRA 4DV3L 1SYGA 1CHQD 3HOXG 1DOLA 1H9MA 5KNBA 1Q8IA 5KGUA 4NPSA 2R7ZG 1L1OA 2R92B 1DM0B 1EY5A 4JI2Q 2ZJQA 1RIPA 3U9SA 2M2LA 3AYHB 2G5DA 2C5CA 1YJWA 4FF2A 2AQ1B 2Z6KC 4OONA 5JJLA 1FYCA 4LF6L 3S1QB 2BA1A 4A3LG 1T5EA 5EKIA 2NVQB 4X62L 4DK6C 4A93G 1EIYB 5M5XB 2NVTH 5C4XB 1EQRA 3V05A 5EPKA 1EY8A 3QWNA 1HFNA 4XXEA 4JK1C 4HJ8A 2UUCL 5IT9L 1NBWA 2EPBA 4A3GH 3MXNB 2HCCA 4XT1B 2L11A 1FNWA 4TSSA 1S3OA 4ILWA 5ELBA 3NK9A 2ZM6L 1PXUA 3C1FA 2EY5A 2FFKB 4OIJA 5CV9A 5C44G 2Y0SG 5C0XG 3A7AB 1XPRA 4PZ6A 4K5XA 4DPGA 4LFCQ 4IOCA 4OEMB 4DV4Q 2B3GA 4IUQA 4G7ZC 1X3PA 3SR1A 2F03A 2LY7A 3NHHA 3MZ5A 3ERQA 2D0OA 5LMNL 1TWGH 5JEAJ 1VQBA 4R1JA 5KRUA 1IKMA 3PO3H 3G6EA 1BF4A 3I91A 4DR5Q 2CKZB 3LGJA 2K1BA 4A3FG 1A0IA 3TEHB 2Z8LA 1IKLA 1QG7A 1SYCA 1A3TA 1SFOB 1V8QA 2QEJC 3S1NH 4BY7G 3EJIA 4WORA 4TVAB 1I3QH 3G4SA 3K7AH 4CBVA 4R8NA 3CCJA 3S15B 3FKIG 1PRTC 4AQYQ 2R7FA 3HKZE 1OXTA 4GN5A 5CORA 3GD7A 4HR7B 4UY8C 1X3EA 5JAVA 1VQ5A 3BJUA 3MXUA 5JJZA 2BDOA 1S5CD 1P16A 3D8GA 4IO9A 4QJFA 1OXVA 4EQNA 2N78A 2NWGA 4OWXB 3J7ZC 4X3UA 2NVTB 4DN4M 3RZDB 1E2WA 3M3YH 3BZKA 5M3FH 1QVCA 1EYCA 2B2WC 2Q8TA 2YV5A 5M5WH 2ENBA 4L63B 1MSHA 4NXNL 1A3UA 4QIWE 1HR0W 1EYAA 1PLFA 3V96A 4A3KH 4CJ0B 4HJAA 1EQTA 3OPOA 5IGEA 2K05A 3R8BA 3M4PA 1SXTA 1KRSA 1LTID 2A68D 1GXDC 5IGDA 3CCVA 3GTKH 3VA7A 1EFID 3KOJA 1VQKA 5IT9E 3GTMH 1JC7A 1TS5A 1EZ6A 2F3IA 3HOUG 1Z7TA 1J9OA 2ZTEA 3G48A 5EQ0A 1S4ZA 4YHHQ 2D5DA 1TWGB 2R7DA 1NY4A 4TKOB 3TN2A 1LACA 2M9VA 3DXJC 4X3TA 3HOWH 3MVVA 3T1YQ 4IUUA 1A2TA 3BDOA 1NCVA 3HOVG 2LSSA 2K32A 2QF7A 3SE0A 4ZYSA 3HOYH 1OO9B 3I70A 4DF7A 3K57A 1Q1BA 1I4GA 4LW1A 1I3QB 3K7AB 2F0KA 2VQFL 1NJIC 2NTTA 4N8X1 1CA5A 2BH8A 1PTOD 5IGGA 1I6HB 2AUJD 2QA4A 4G7OC 2WFWA 3S2DH 4A3IG 1XPOA 3VR5A 3W5OA 3PF5A 3S17B 4YCWA 2D62A 1KAAA 1KABA 3PIO3 1WD1A 3X3MA 1DGSA 5BN3A 4G7HC 1STYA 1DONA 4IOAA 1GO3E 4R4TA 2J0TD 2PW7A 1HNXQ 5CGKA 4DV3Q 1U4LA 1QZGA 1EYDA 4A3BH 3M3YB 1PHJA 1MSGA 2ICEC 4GKKL 1E7ZA 1JE5A 2B63B 4Q0FA 4BY1H 3J80c 3EBEA 3OMGA 5EAYA 1QUQB 4RKLA 1ENCA 2KCMA 2X69A 1A2UA 3NTIA 1QCBD 2KCNA 2CH4A 1TWFH 2IJ0A 4LF6Q 1ESFA 5EBDA 2PZTA 4N9TA 1GHJA 4KI0A 5JPMC 1MBYA 1KNAA 5C5MA 1K83H 2A73B 1YNJD 3GTKB 1CKMA 2JA8G 3GTMB 3K5LA 5GAEC 4DR4Q 2I46A 1U9RA 5C3EB 2N55A 4LK1C 3ZYYX 3D4DA 3HOXH 2EOTA 1ASYA 4LFAL 4A3MG 2C35B 1UUPA 5C3WA 1PTOF 4K0KL 2WKDA 1Q86C 3D6CA 1OXUA 1LTTD 3MTSA 1HNWL 2ZM6Q 1PH9A 1CZWA 3S2HB 1PVOA 4HIMA 3T4AC 5BN4A 1SMYC 3BZDB 2CWAA 1AE2A 1BVSA 2F0MA 1CM9A 1UE5A 2ZTCA 4A3LH 2F4IA 4DNTB 2PMZE 1SJHD 1HFGA 3KFUA 1LT5D 4A93H 4LF8L 2R92G 5LMNQ 1VQ6A 3OMCA 4ZRZA 3K81C 2F1MA 4FYDA 5FLMG 1X6OA 4J1MA 1H9SB 4GOPB 4JG2A 3I90A 3IL8A 4OELB 1ICFB 4NXML 4ZQ3A 2IHEA 1QNUA 1STBA 3P20A 4BWGB 2XN9C 4UAIA 5EKLA 4CDFC 3GTGB 2L15A 4A3BB 1T9HA 4CJ2C 2F0EA 5C44H 4DNIA 5C0XH 2CCZA 2EY2A 2A8VA 3UDFA 4BY1B 3TP8A 2CW0C 4HAEA 5JOBA 3PUVA 1E2ZA 1L2FA 4GLVB 2Q2TA 4PMCA 1EWCA 1AN8A 4PNYA 4RG1A 3T13A 2VUMH 1TWFB 2GVBA 1CI3M 5ELNA 2JQOA 2BE5D 1TIID 1TWHB 2PW5A 2L4NA 2F0WA 3TMEA 1UAPA 2K5DA 1SDFA 4JBWA 4EVOA 5LHY1 1PH7A 4P2CB 3TREA 3LX0A 3NSWA 4JI6L 3J80L 2MNAA 2NB0A 2PZWA 1B9MA 2F0PA 1KDBA 2EVBA 3FKIH 3QO2A 4RGMA 2R7ZB 2PYKA 2MO0A 1MJEA 4OO1G 3I7FA 3GTLB 1PYWD 1W6JA 2NBFA 4XDXA 4KY6A 2OT2A 5E3FA 3A8IE 1KXLA 5I6YA 4DAPA 2FINB 1LM0A 4A93B 4HSVA 1HRJA 4C56C 5EJWA 3GV3A 4Y7NH 3IAYA 4JI4L 1VMCA 4IUVA 2F0IA 1FGBD 4P72A 4Y52H 1RDPD 4JI1L 4GNXC 4K6LA 4KJOA 4IFDJ 2RKSA 5C6AA 3I4OA 5T1IA 4L6TB 4FXDA 1L0XB 1SE2A 2EYPA 5C44B 1JCKB 2IX3A 4U673 2XWBB 4QB4A 5IP9G 2RSNA 1FR3A 1ONLA 1MHWC 5J22A 2RHQB 4RGTA 2VXWA 1QUQA 1TQOA 4MIUA 1AEXA 1Q90A 2CFMA 3SXHA 4X65L 1SNPA 3Q6SA 1IBKL 4AIMA 5DM73 4A3FB 3HOVH 2RDGA 4A3DG 4GKKQ 5L37A 3CC7A 1SAPA 2AQ3B 4DA2A 4BY7B 2A1AA 3E0EA 4RWSC 3U50C 1VQEA 4H13C 4PV1C 5M5YH 4CJ1B 1VQ4A 2CHBD 3CRLC 2FMCA 2GA4B 2PPBC 2UXDL 5BR8L 3VYUA 4YWLA 1B4OA 3AU7A 1QZHA 2R3ZA 3SVMA 1VQGA 3S1MH 3NELA 1R4QB 2E2JH 1K9MC 1SNCA 5IYCG 4HMIA 1ZYRC 3CHBD 3HGBA 3J80E 2IX0A 3J81j 3BDLA 2A6ED 4ZCKA 3OOCA 1I50B 1YEZA 2F0QA 1TY0A 1DJRD 2JSOA 3JC66 4LFAQ 4X64L 2ID0A 1BOSA 2BOSA 4K0KQ 4Y7NB 3CMEA 1FJGL 1VQJA 4RA8A 1NUCA 2OCEA 1HNWQ 3K5NA 1STNA 2A69D 2KECA 2LS01 4QL5A 2SNSA 5HURA 1H9SA 4GOPA 4DK1A 2VQEL 5D3DA 1TR5A 2DGYA 2DNEA 3MEHA 1WI5A 2Z1CA 2BDNA 2OF1A 4ZKBB 2F0FA 3NQIA 4R4IA 1C4QA 4ME5A 2OTLA 3GQBA 4B3TL 1DZ1A 3AB9A 2JA8H 4XYOA 1VF7A 1LTBD 1Y8OB 4KMUC 3HOUB 3CCUA 2YYZA 1IBLL 4RHSA 1G2TA 1PFMA 2NUCA 5FLXL 1KNEA 4RGOS 4NXMQ 3F8TA 5ELDA 1LT6D 3U58A 1TWCB 4FXGC 3OIPA 1N36L 2A19A 3HOVB 1W6KA 3Q22A 1O7LA 3MWYW 1FNUA 1ESRA 1GUTA 1Y69U 5KNCA 2AKWB 1VQPA 3CMAA 3GTJB 3ULLA 2L0CA 3FRPB 5M5YB 2R92H 3A5UA 4JI8L 3KLWA 2ALYB 4POGA 4A3IB 1J8IA 3M9BA 5COYA 3S24A 5FLMH 1H95A 4LF5L 1GKHA 4GN4B 4YCVA 4FO2A 1C9OA 1STHA 3FVQA 1D8LA 3CCMA 3S1QH 3S1MB 2OQKA 5AJ3L 2NVQH 1WFQA 4RH6A 3D0FA 1S5FD 4KTAA 1GUOA 4DXGA 3ER0A 1SMXA 2VW9A 4JI6Q 1ZKOA 4GLXA 3BS1A 4F87A 5IYDG 2JYOA 4C1NK 4B9WA 2Y0SE 4FF3A 2EZVA 4V0BA 4MHEA 1O7IA 2C9OA 2FXQA 1LYLA 1M1KC 3Q8DA 3NXWA 3HEJA 1SLJA 1XPUA 1EYGA 3MAQA 3GV6A 4K8JA 1JT8A 4PQXA 1PZKD 2LXKA 3GTQB 3BG3A 2UU9L 1NR4A 2J4XA 1ENAA 4JOIC 1IXRA 4K2KA 1BBWA 1SSOA 3BVGA 3D3RA 3BVZA 4JI1Q 5AFWA 1QVFA 4A3MB 3C46A 1RF2D 2MPMA 4HIKA 3I8ZA 3DLLA 2Z4HA 3ZJYC 5KYLA 3CW2C 1ILPA 3E0JA 4IALA 2B8FA 3CRKC 2MQHA 2V1CC 4B08A 2K5NA 2A74C 4S3SA 4B3SL 1KLUD 4OHJA 5I9OA 4UP8A 5IIFA 3OW7A 1HA6A 2KEEA 1MJCA 4XQJA 4DV2L 3S15H 2A68C 4BBSG 1G8ZD 2XRQD 5FLXE 3M7NA 1B8AA 1BR9A 3D6WA 2RA4A 2E2DC 2K50A 1DOMA 3DEOA 1JB7A 4DR6L 2CQOA 5M3MG 4X65Q 4FDBA 1STGA 3ONAB 5D3IB 3RD4A 1A15A 1EUJA 1PRTB 2B2VA 5CBEE 4LMQD 2XWJB 3RZDH 1LO5D 1EY7A 3ULJA 3QOJA 2PZUA 4R9WA 4AYBG 3I73A 1X9NA 4KKTA 2Q2UA 1VQLA 2E2IB 2RDFA 5IP9H 5KEEA 2UXDQ 1RJTA 3I56A 5BR8Q 2QKIC 2BH2A 1LTSD 3K80C 2SDFA 4YIJA 3U4ZA 1OXSC 3MC0B 4ZK9B 2F0SA 3IFTA 2X6LA 1HZAA 4HTHA 4J6HA 2OEOA 2K5QA 2B2UA 3JAML 1VQMA 5C4JB 3OWEB 4ALPA 4DR7L 2GVAA 4X64Q 1XNRL 2R93B 1R9TB 5CV5A 3G7LA 3UDXA 1CSPA 2Q2HA 1FJGQ 4J15A 1AZQA 1Q82C 4HIDA 1RODA 4A76A 3AQQA 4P75A 1ILQA 2WP8J 4MN3A 3I4LA 1YZ6A 3TRZA 2F0HA 3BVMA 2GN5A 1KHIA 3VR6A 1HUNA 2E5LL 4JI0L 1Y8NB 3HS0C 1E1TA 1STAA 4ZKCB 1FD7D 1E3PA 4B3TQ 1XYIA 1QJOA 1I5FA 4UP7A 3OW2A 1X32A 1WTPA 4L8JA 5LL6X 2OWOA 1I6HH 1EU3A 1YNJC 3J80i 1IBLQ 4IPHA 1PH6A 1Q7YC 3S17H 1BCPC 3AFPA 4KK7A 5DM63 3OTOQ 2LXJA 1WYDA 4DAYB 4A3EB 2BA0A 2K33A 4WJ4A 2OXPA 3TP6A 1VQAA 5C0XJ 4B3ML 1PH1A 2MJ8A 3WWVA 4CKEA 1PFSA 5A2QL 3KBGA 3W2DA 4AH6A 2B63H 1VF5C 4WRDA 4G4KA 1WTRA 1F9QA 4JW0A 2AUKA 3UDGA 1N33Q 3WOEA 2ZTDA 4LF5Q 1YNND 5KNDA 1KD1C 4FXKC 4IJLA 2F52A 2EYMA 3E5SA 3CCQA 1X65A 2PNRC 1ZXTA 1Y14B 2KJXA 4YWMA 1CZGA 4DAVA 2F0UA 5C4HA 2TSSA 3T51B 4A3DB 5C3EH 3TSSA 2CQAA 1CKOA 1A8VA 2HQLA 2E74C 3A74A 4APVA 1Q46A 4JVZA 4OX9Q 4HJ5A 1O78A 2EXZA 1Y8PB 4ME3A 2EYJA 3S2HH 3T16A 1HZCA 1WVLA 1A62A 2RQXA 2J7ZA 3NP8A 4ULLA 4CKBA 1WOCA 4P73A 5EPJA 4JI7L 1C0AA 4QCLA 2UU9Q 2BE5C 4LNQA 4RHRA 1F2YA 5CYUA 2EJFC 3MHBA 3NBHB 1DOKA 1J5EL 2TMPA 2KHSA 2WAQG 3URYA 1QB5D 1D5MC 3K7UC 1G6ZA 3KF6B 1G2SA 2KA7A 1WD0A 3J7A5 3DHQA 4LWCA 4JV5L 1FL0A 1HJPA 3GTGH 1X3FA 1XJVA 1G6PA 2HHHL 2HUGA 3CPFA 2HIXA 4DV2Q 1F2ZA 3R2IA 5LMNW 4DV7L 4OO1I 2R6GA 4J8QA 2HDLA 4QGUA 1VCIA 3FPPA 2Q8RE 2K14A 3MA2B 1WTVA 1UE6A 2YU9B 4N9PA 4DR6Q 2IT1A 1SYBA 3KJOA 3MXNA 1SNMA 4K2LA 1KLGD 2JN4A 5A2QE 2ICIA 4DV5L 2CH4W 1TWHH 4X62Q 3C2PA 1D5ZC 4HN7A 5LMUL 3G71A 2B2WA 3CCLA 1D5XC 3P1HA 1T5XD 1V43A 1NMFA 3UE1A 3M85A 2UUCQ 1XTDA 2RBMA 5ELOA 1KDAA 2QDBA 3KK7A 1GUWA 4BBSH 3AEVA 4KN7C 1A63A 1CK1A 2R7ZH 2M00A 4LUVA 1WTHA 1EU4A 3H3VC 1K0RA 4C1NI 3GTLH 5M3MH 5J3BA 4KHZA 3VR3A 3PO2B 3R2TA 1SE3A 2KEDA 4YY3L 3CCEA 2YTVA 2MO1A 4GN3B 2N88A 1XNRQ 5FJ8G 4H7BA 1JQYD 1D6EC 1D2BA 2NTSA 1VQHA 3J81c 1U4RA 4UPAA 3E6ZX 3ULPA 4WJ3M 3K0XA 1P8LA 1PZID 2DJFC 1VQ9A 4RMFA 3EA6A 3CCSA 1F77A 1OTCA 3Q23A 1EFWA 2BCOA 1TY2A 5GQOA 2EE1A 2K01A 2E5LQ 4BBRB 4JI0Q 5EGTA 3I4MG 3HFZB 1UE1A 2QCPX 4LAAA 3DMUA 4IN3A 1IL8A 3MFGA 2KUMA 1J6QA 2N8NA 4GNXB 1Q81C 3PMFA 2A6EC 2MFIA 4YCUA 1V9PA 4NDXA 1HHVA 3P75A 3H3VI 4JI5L 1RL2A 4B3MQ 5EBCA 2KOLA 3QR8A 4A3FH 2A69C 4MNOA 3SK6A 2NN6I 4DFAA 2R93G 5IWAL 1I4XA 4BY7H 2VB3X 5K36G 2NVXH 3IRBA 1JWSD 1JB3A 1YHAA 4EQPA 1PH3A 4NXNQ 2JE6I 4BBSB 2AMCB 3RN2A 2RCNA 1U4PA 1B9NA 1G291 3NBIA 1HQRD 2H5XA 1BO0A 5M3MB 1F2MA 1TT2A 5FO7B 1F9PA 2RDHA 1PYSB 3ND8A 3TBIB 3CC4A 1WTXA 4L5QA 1I50H 3RNUA 2B8GA 4DU9A 4XIGS 2B2YC 2NZHA 4AYBB 5FLXc 4A3EG 3NBHA 1G91A 1STEA 2JA6G 5I6WA 5DEHA 3AMUA 1A3VA 1UWVA 3ERSX 1VQ8A 2UXBL 4P71A 4BA1I 3H0GB 1BDOA 3FDTA 3CQZH 4ID6A 4JI7Q 2HCIA 2EJMA 2NVYH 2VQFQ 1SYFA 1EY6A 1HZBA 4OWTB 1XMQL 2UXCL 1KIXA 3Q0AA 4C3JB 5NUCA 1XXGA 3ND9A 2L12A
chains in the Genus database with same CATH topology
3J81L 2O2LD 1IW7D 2LKVA 4M8AA 1CT1D 4DK0A 3NPPA 3HZXA 5DNFA 3VA5A 1SE4A 4KN4C 2NVXB 4XQNA 4X3KA 4C3HB 3DWPA 2F0DA 4ZUJA 1Y1WB 2FHTA 2JA7B 3MXPA 2RVLA 1S5ED 1B2TA 3X3NA 3IKJA 1OXXK 4KHVA 4NKLA 1GUSA 2E76C 3A54A 3DWQA 2K04A 1B50A 2NN6G 2F0VA 5FO9B 1JWUD 4KKUA 4FF4A 2G9DA 4OL7A 3CQZB 1HQMC 3J7AF 2NVYB 3RMHA 4E6IA 5EKKA 1HTPA 4B9XA 2WV6D 1PDQA 3S9WA 3SHLA 1PZJD 4IZ8A 1A6XA 1SJED 1E2VA 4NMZA 5G3LD 4NW2A 1B3AA 2K03A 1CQVA 2LMCB 3IFDA 3J81E 2A5HA 4C2MB 1AP0A 4U68A 1KDCA 5ELFA 3QJYA 1JORA 3M4OB 3LWEA 4C3IG 2XIWA 1RD9D 1EWHA 3Q24A 1II3A 1Q3LA 2WAQB 2F3WA 1TS3A 2ZXOA 1V1PB 1RCVD 1I4RA 1U4MA 1Z6HA 3N52A 1BUVT 3NWTA 3KLRA 4QF4A 1C8CA 3PUYA 2G9HD 2E75C 2O5IC 2SOBA 3RLFA 3SEBA 1MI2A 3I4NB 1WTOA 1EY4A 3K0YA 3VR4A 1GJXA 2A6HD 4ZUIA 2EYHA 5D65A 5G3LF 1Z47A 2F0TA 3N6RA 1O80A 2HQEA 1I4HA 4KKSA 1B53A 1GHKA 4OO1H 1HUMA 1YNNC 5C3XA 3VR2A 4K5VA 4QIWB 3LNNA 3CKIB 2WACA 1DD2A 2H1EA 3K6OA 1SEBD 2JEBI 1WCMB 4F7XA 3PUXA 1Q12A 1F9SA 5C5LA 1ZYRD 4K14A 5ELCA 3HOZB 5JVG3 1WTWA 3DM1A 3S14B 2B2TA 1CTMA 3I4MB 1JICA 1EOTA 1HXYD 1D1IA 1F2LA 2KVMA 1BCPB 5JEAG 1I4PA 3NE5B 1UNSA 1RKNA 1HTLD 1TWAB 1PTOC 3R93A 4M1UB 2PCFB 2NYZD 2E2HB 3H94A 3C1EA 1S5DD 2V4DA 4C3JG 4K6DA 4A3JB 5J1ZA 3MFYA 3NUCA 1O7YA 1JWMD 3ITPA 3T53B 4RCOA 1I4QA 3RZOB 2JA5B 2I07B 1WTQA 2EDGA 2WINB 1PFNA 3L7ZC 5D14A 4PMBA 5ELEA 3S1RB 3EFXD 3TZDA 1HA5A 3P7JA 4C3HG 1EEFD 2K6AA 2L1BA 4XYQA 2WIIB 2KQ3A 1EQVA 1Q1EA 2L9HA 3PV0A 4Q5VA 2DN8A 4HMJA 5IGFA 5DAUA 1CFMA 2F3VA 2NN6H 3J7AV 2IW3A 3I3CA 3EROA 2JA6B 1RHPA 3H91A 1EEID 4I65A 4ODGA 2QILA 5E4XA 1V1PA 4KV6A 2XVSA 1EIGA 4KD3A 5JPNC 4XTCS 2PMZB 1EZ8A 4QUFA 4FF1A 1AZPA 2SNMA 3T56B 1PMRA 1JE4A 1JOOA 2DY7A 5KIXA 4A3GB 3FPUB 4KD4A 4QMGA 3OHXC 3L9AX 3O13A 3K59A 5JVH3 2NZ1D 5BN5A 1H9RA 1CHPD 1H9KA 3JAME 3C3LA 2PO4A 4K8IA 1NAPA 2JP1A 3K58A 1VDZA 2F0JA 4H0LC 3PO3B 3KUPA 3KLSX 4H44C 1LT4D 2DY8A 3HG9A 4DGZA 3M7GA 5TSSA 5CMDA 3PUZA 3S1NB 3UI2A 3LWUA 1QWYA 1DYQA 3EVQA 2WB1B 5CV6A 4RAUC 3GTPB 4IFDI 2CVRA 2R61A 4FVMA 1ET9A 3K5OA 4HCEA 1GUNA 2L55A 1CA6A 3A7LA 2ZT9C 4WJWA 4EQOA 4ZLTF 1MD2D 5M3FB 3R3OA 4R8IA 1DXMA 3S16B 2MUYA 5M5WB 1F9RA 5FK9C 5E4WC 4A3KB 1EIHA 4QUCA 3A56A 3SK5A 1VMPA 1BXTA 1LT3D 4O1NA 4ABNA 2EY6A 4ZAIA 4C3IB 1QILA 1PRTD 4KJNA 5LL6S 1IW7C 3DWAA 1GUGA 1O7ZA 1IYUA 1LTAD 2D9UA 3PIP3 2DNCA 1BQQT 3CU7A 1BCPD 4XT3B 3PUWA 4KY7A 4RGNA 4FP5D 5K5PA 1TKWB 5CV8A 3HOWB 5JEAH 5CC4A 1H9JA 5CBAE 1V1OA 1RTOA 3HOYB 3D31A 1Y1VB 4DAYA 4IUPA 4CKCA 2FMMA 3NTHA 5I9PA 3DUZA 1XWEA 1SNDA 3S2DB 3EQLC 5CV7A 2EJGC 2VNUD 5I4DA 3VYTA 3NQTA 1LTRD 1XX8A 2AWOA 4BS9A 1TVXA 1TS4A 2EYOA 2X6GA 1AFPA 3OIQA 1E0BA 1PRTF 5KYIA 5A35A 5FKAC 4IURA 1L0YB 1BCPF 2EY1A 2IWHA 3NTKA 2O5JC 1IYVA 3H09A 3BYYB 2MGSA 4O42A 3KLSA 2L5TA 4IFDG 1K83B 4OIKA 1SNQA 2IX1A 4NP5A 4V190 5IGCA 3D4RA 3QB3A 1SYDA 3VYRA 4KY5A 3HOXB 3QIAA 1CQFA 3FMCA 2ZXPA 4IUNA 4CGYB 3SK4A 1X3QA 2Z4IA 3HRZC 3F2UA 5IGBA 5IODA 2MP1A 3D4WA 5I2XA 1K8MA 2F0NA 2O4XA 3TZUA 4X3SA 1AW7A 5J39A 1JOQA 5I2YA 3SDZA 3L3OC 4CHTB 5CR3A 1ICWA 4LJZC 4DNRB 5HGTA 2Y0SB 1QNKA 1ZEQX 3DEPA 5ISRA 3WOFA 2Q8IB 1BBXC 2LFNA 3GTOB 1M8AA 1LV9A 2B39A 1RTNA 1SMYD 4HSPA 2A6HC 2VUMB 1ET6A 2PQEA 4F8MA 2WKCA 4PMWA 3H6MA 2K5WA 4RFBA 3KF8A 3BYTB 3W3AA 4G57A 2EYLA 4I7ZC 5FOBB 1I6VC 3GO5A 3FKIB 4EGVA 1TU2B 5EPLA 3NWSA 3QOLA 5CV4A 2MHVA 1JOKA 1LLRD 3WDNA 4UDUC 2CW0D 3A8KE 1XTCD 1S5BD 1ML0D 2SEBD 2F0LA 3M4YA 5T1GA 1PTOH 2B2YA 2RSOA 3SK8A 4K5WA 3BDCA 1C48A 3A55A 1GOZA 2JXMB 4RCNA 2D2CC 3VYSA 1QE6A 5C4ZA 3A8JE 1BNZA 1M4VA 2HDMA 2K7VA 4F88A 3GP7A 1SNOA 1B1ZA 1FNVA 1EY0A 2IPKD 3G6JB 2F0GA 3OSOA 1SBBB 2H4OA 1TS2A 4RKBA 3FEWX 2K28A 3MXGA 2VB2X 1DCZA 1MGSA 3RUZA 1NSNS 2B2TC 4XQQA 2B2VC 4TQUS 1K8OA 4FNFA 1EL0A 5C0XI 2JEAI 2EYFA 3TP5A 2AQ2B 1R4PB 1HPCA 1B44D 2XNAC 3OWFA 3TP7A 2E2JB 1NR2A 2AWNA 3HKZB 1ENFA 1JR0D 1D1KA 1IHZA 1HCZA 2B2UC 2FJ2A 5FO8B 1PTOB 3I72A 5E1FA 1PFBA 2F0OA 4IQZA 5K36H 1QOHA 5F2DA 5IOCA 2XRSD 4WFN3 4HEDA 1LABA 1LTGD 1EY9A 3TDQA 1SYEA 2XSCA 4IFDH 4OGQC 4TRDA 3K5MA 2JA8B 4Z9CB 4IUTA 3V2TA 1KTKA 2KCCA 2IL8A 3HP3A 4BA2I 4HCSA 3KBXA 3J7YW 3QG1A 4DXFA 3U9OA 5M9OA 1UEAB 4GZYC 2ZXRA 1SYGA 1CHQD 1DOLA 1H9MA 5KNBA 1Q8IA 5KGUA 2R92B 1DM0B 1EY5A 3U9SA 2M2LA 2C5CA 4FF2A 2AQ1B 1FYCA 3S1QB 2BA1A 1T5EA 5EKIA 2NVQB 5M5XB 5C4XB 3V05A 5EPKA 1EY8A 3QWNA 1HFNA 4XXEA 4JK1C 5IT9L 2EPBA 2HCCA 4XT1B 2L11A 1FNWA 4TSSA 4ILWA 5ELBA 3NK9A 1PXUA 3C1FA 2EY5A 2FFKB 4OIJA 5CV9A 5C0XG 3A7AB 4K5XA 4IUQA 4G7ZC 1X3PA 3SR1A 2F03A 2LY7A 3NHHA 3MZ5A 3ERQA 5JEAJ 1IKMA 5KRUA 1BF4A 3I91A 2K1BA 2Z8LA 1IKLA 1QG7A 1SYCA 1A3TA 1SFOB 1V8QA 2QEJC 3EJIA 4WORA 4CBVA 4R8NA 3S15B 1PRTC 1OXTA 5CORA 3GD7A 4HR7B 5JAVA 3MXUA 5JJZA 2BDOA 1S5CD 3D8GA 1OXVA 4EQNA 2NWGA 4X3UA 2NVTB 4DN4M 3RZDB 1E2WA 1EYCA 2B2WC 2Q8TA 2ENBA 4L63B 1MSHA 1A3UA 1EYAA 1PLFA 3V96A 4CJ0B 1EQTA 3OPOA 5IGEA 2K05A 3R8BA 1SXTA 1LTID 2A68D 1GXDC 5IGDA 3VA7A 1EFID 5IT9E 1JC7A 1TS5A 1EZ6A 1Z7TA 1J9OA 5EQ0A 1S4ZA 2D5DA 1TWGB 4TKOB 3TN2A 1LACA 2M9VA 3DXJC 4X3TA 3MVVA 4IUUA 1A2TA 3BDOA 1NCVA 2K32A 2QF7A 3SE0A 4ZYSA 1OO9B 3I70A 4DF7A 3K57A 1Q1BA 1I4GA 1I3QB 3K7AB 2F0KA 2NTTA 1CA5A 1PTOD 5IGGA 1I6HB 2AUJD 4G7OC 3VR5A 3S17B 2D62A 1KAAA 1KABA 3PIO3 1WD1A 3X3MA 5BN3A 4G7HC 1STYA 1DONA 2J0TD 2PW7A 5CGKA 1U4LA 1EYDA 3M3YB 1MSGA 2ICEC 2B63B 4Q0FA 3OMGA 4RKLA 1ENCA 2X69A 1A2UA 3NTIA 1QCBD 2KCNA 2IJ0A 1ESFA 5EBDA 2PZTA 4N9TA 1GHJA 4KI0A 5JPMC 1MBYA 1KNAA 5C5MA 2A73B 1YNJD 3GTKB 3GTMB 3K5LA 2I46A 1U9RA 5C3EB 2N55A 4LK1C 3ZYYX 3D4DA 2EOTA 1UUPA 5C3WA 1PTOF 2WKDA 3D6CA 1OXUA 1LTTD 3MTSA 1CZWA 3S2HB 3T4AC 5BN4A 1SMYC 3BZDB 2F0MA 1CM9A 2F4IA 4DNTB 1SJHD 1HFGA 1LT5D 3OMCA 4ZRZA 2F1MA 4FYDA 4J1MA 1H9SB 3I90A 3IL8A 4ZQ3A 1QNUA 1STBA 3P20A 4BWGB 2XN9C 4UAIA 5EKLA 3GTGB 4A3BB 4CJ2C 2F0EA 5C0XH 2EY2A 4BY1B 3TP8A 2CW0C 4HAEA 5JOBA 3PUVA 1E2ZA 4PMCA 1EWCA 1AN8A 4PNYA 3T13A 1TWFB 1CI3M 2BE5D 1TIID 1TWHB 2PW5A 2L4NA 2F0WA 3TMEA 1UAPA 2K5DA 1SDFA 4JBWA 4EVOA 5LHY1 4P2CB 3LX0A 3NSWA 3J80L 2NB0A 2PZWA 1B9MA 2F0PA 1KDBA 2EVBA 3QO2A 4RGMA 2R7ZB 2PYKA 4OO1G 3GTLB 1PYWD 1W6JA 2NBFA 4XDXA 4KY6A 2OT2A 5E3FA 3A8IE 5I6YA 4DAPA 2FINB 4A93B 4HSVA 1HRJA 4C56C 5EJWA 3GV3A 3IAYA 1VMCA 4IUVA 2F0IA 1FGBD 1RDPD 4K6LA 4KJOA 4IFDJ 2RKSA 5C6AA 5T1IA 4L6TB 4FXDA 1L0XB 1SE2A 2EYPA 5C44B 1JCKB 2IX3A 4U673 2XWBB 4QB4A 2RSNA 1FR3A 1ONLA 5J22A 4RGTA 2VXWA 1TQOA 4MIUA 1AEXA 1Q90A 3SXHA 1SNPA 3Q6SA 5DM73 4A3FB 2RDGA 1SAPA 2AQ3B 4DA2A 4BY7B 4RWSC 4H13C 4PV1C 4CJ1B 2CHBD 3CRLC 2FMCA 2GA4B 2PPBC 3VYUA 1B4OA 3AU7A 2R3ZA 3SVMA 1R4QB 1SNCA 4HMIA 1ZYRC 3CHBD 3HGBA 3J80E 2IX0A 3BDLA 2A6ED 3OOCA 1I50B 2F0QA 1TY0A 1DJRD 2JSOA 2ID0A 1BOSA 2BOSA 4Y7NB 4RA8A 1NUCA 3K5NA 1STNA 2A69D 2KECA 2LS01 2SNSA 5HURA 1H9SA 4DK1A 5D3DA 1TR5A 2DNEA 3MEHA 2Z1CA 2BDNA 2OF1A 4ZKBB 2F0FA 3NQIA 1DZ1A 1C4QA 4ME5A 3GQBA 3AB9A 4XYOA 1VF7A 1LTBD 1Y8OB 4KMUC 3HOUB 2YYZA 4RHSA 1G2TA 1PFMA 2NUCA 5FLXL 1KNEA 4RGOS 5ELDA 1LT6D 1TWCB 4FXGC 3OIPA 3HOVB 1W6KA 3Q22A 1O7LA 3MWYW 1FNUA 1ESRA 1GUTA 1Y69U 5KNCA 3GTJB 2L0CA 3FRPB 5M5YB 4A3IB 1J8IA 5COYA 4FO2A 1STHA 3FVQA 3S1MB 4RH6A 1S5FD 4KTAA 1GUOA 4DXGA 1ZKOA 3BS1A 4F87A 2JYOA 4C1NK 4B9WA 4FF3A 2EZVA 4V0BA 4MHEA 2C9OA 3NXWA 3HEJA 3MAQA 3GV6A 4K8JA 4PQXA 1PZKD 3GTQB 3BG3A 1NR4A 2J4XA 1ENAA 4K2KA 1SSOA 3BVGA 3D3RA 3BVZA 5AFWA 4A3MB 3C46A 1RF2D 2MPMA 3I8ZA 2Z4HA 5KYLA 1ILPA 3E0JA 4IALA 2B8FA 3CRKC 4B08A 2A74C 4S3SA 1KLUD 4OHJA 5I9OA 5IIFA 3OW7A 1HA6A 2KEEA 4XQJA 2A68C 1G8ZD 2XRQD 5FLXE 3M7NA 1BR9A 3D6WA 2RA4A 2E2DC 1DOMA 3DEOA 1STGA 3ONAB 5D3IB 3RD4A 1A15A 1PRTB 2B2VA 5CBEE 4LMQD 2XWJB 1LO5D 1EY7A 3QOJA 2PZUA 4R9WA 3I73A 4KKTA 2E2IB 2RDFA 5KEEA 1RJTA 2QKIC 1LTSD 2SDFA 4YIJA 1OXSC 3MC0B 4ZK9B 2F0SA 3IFTA 2X6LA 4HTHA 4J6HA 2OEOA 2K5QA 2B2UA 3JAML 5C4JB 3OWEB 2R93B 1R9TB 5CV5A 3G7LA 1AZQA 1RODA 1ILQA 2WP8J 4MN3A 3I4LA 2F0HA 3BVMA 3VR6A 1HUNA 1Y8NB 3HS0C 1STAA 4ZKCB 1FD7D 1XYIA 1QJOA 1X32A 1WTPA 4L8JA 5LL6X 1EU3A 1YNJC 1BCPC 4KK7A 5DM63 4A3EB 2BA0A 2K33A 2OXPA 3TP6A 5C0XJ 2MJ8A 4CKEA 5A2QL 3KBGA 3W2DA 1VF5C 4WRDA 4G4KA 1WTRA 1F9QA 2AUKA 3WOEA 1YNND 5KNDA 4FXKC 2EYMA 3E5SA 2PNRC 1ZXTA 4DAVA 2KJXA 1CZGA 2F0UA 5C4HA 2TSSA 3T51B 4A3DB 3TSSA 2CQAA 2E74C 1O78A 2EXZA 1Y8PB 2EYJA 3T16A 1WVLA 2RQXA 2J7ZA 3NP8A 4ULLA 4CKBA 5EPJA 4QCLA 2BE5C 4RHRA 1F2YA 5CYUA 2EJFC 3MHBA 1DOKA 2TMPA 2KHSA 3URYA 1QB5D 1D5MC 1G6ZA 1G2SA 2KA7A 1WD0A 3DHQA 2HUGA 1F2ZA 3R2IA 4OO1I 2R6GA 4J8QA 2HDLA 1VCIA 3FPPA 2Q8RE 3MA2B 1WTVA 2YU9B 4N9PA 2IT1A 1SYBA 3MXNA 1SNMA 4K2LA 1KLGD 5A2QE 2ICIA 3C2PA 1D5ZC 4HN7A 2B2WA 1D5XC 3P1HA 1T5XD 1V43A 3M85A 2RBMA 1KDAA 2QDBA 3KK7A 1GUWA 4KN7C 1CK1A 2M00A 1EU4A 3H3VC 4C1NI 4KHZA 3VR3A 3PO2B 3R2TA 1SE3A 2KEDA 2N88A 4H7BA 1JQYD 1D6EC 1D2BA 2NTSA 1U4RA 3E6ZX 1PZID 3EA6A 1F77A 3Q23A 2BCOA 1TY2A 2EE1A 2K01A 4BBRB 5EGTA 2QCPX 4LAAA 3DMUA 4IN3A 1IL8A 3MFGA 2KUMA 3PMFA 2A6EC 4NDXA 1HHVA 3P75A 5EBCA 2KOLA 2A69C 3SK6A 2NN6I 4DFAA 1I4XA 2VB3X 5K36G 1JWSD 1JB3A 4EQPA 2JE6I 4BBSB 1U4PA 1B9NA 1G291 3NBIA 1HQRD 1BO0A 5M3MB 1F2MA 1TT2A 5FO7B 1F9PA 2RDHA 3ND8A 3TBIB 1WTXA 2B8GA 4DU9A 4XIGS 2B2YC 4AYBB 1G91A 3NBHA 1STEA 5I6WA 5DEHA 3AMUA 1A3VA 4BA1I 3H0GB 1BDOA 3FDTA 4ID6A 2HCIA 2EJMA 1SYFA 1EY6A 3Q0AA 4C3JB 5NUCA 1XXGA 3ND9A 2L12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD1 A;  2X6L A;  1AZP A;  4CJ1 B;  4U68 A;  1AP0 A;  1VMP A;  1JIC A;  1EOT A;  2B2Y A;  1WVL A;  1DON A;  1F2L A;  2B2U A;  4ZAI A;  2J7Z A;  1X3Q A;  2RSO A;  2KVM A;  2EE1 A;  2JYO A;  2K01 A;  4IUT A;  1JE4 A;  1U4L A;  3LWE A;  5EPJ A;  2DY7 A;  2L4N A;  1O7Z A;  2D9U A;  4MHE A;  3G7L A;  1B4O A;  3F2U A;  1MSG A;  2XIW A;  1SDF A;  2R3Z A;  3SVM A;  1AZQ A;  2IL8 A;  4XT3 B;  2MP1 A;  5COR A;  1IL8 A;  1Q3L A;  1ROD A;  3FPU B;  1QE6 A;  3HP3 A;  1ILQ A;  5DNF A;  4MN3 A;  4HCS A;  3R93 A;  1DOK A;  2KUM A;  1BNZ A;  5JJZ A;  2NYZ D;  2HDM A;  2X69 A;  3GV6 A;  3KBX A;  1G6Z A;  3QO2 A;  1U4M A;  1HUN A;  1G2S A;  1WD0 A;  4X3S A;  3N52 A;  4X3K A;  2NZ1 D;  1DOL A;  2NWG A;  1HHV A;  4X3U A;  1NR4 A;  4ZKC B;  4RWS C;  4DN4 M;  5CBA E;  1XYI A;  1RTO A;  1KNA A;  2FHT A;  4RA8 A;  1X32 A;  1WTP A;  2B2W C;  1O7Y A;  2Q8T A;  1SSO A;  2RVL A;  1C8C A;  1B2T A;  4XDX A;  1NAP A;  2HUG A;  2JP1 A;  2KOL A;  2KEC A;  4IUP A;  2FMM A;  2K28 A;  2N55 A;  1MSH A;  1ICW A;  2M2L A;  5AFW A;  2HDL A;  1PLF A;  2MPM A;  1MGS A;  1QNK A;  2FIN B;  3I8Z A;  3KUP A;  1WTQ A;  2Q8R E;  1MI2 A;  1PFN A;  2DY8 A;  2EOT A;  2B2T C;  3DEP A;  1EQT A;  4CJ0 B;  1WTV A;  2BDN A;  1ILP A;  1BBX C;  4HSV A;  2B2V C;  1WTO A;  4ZKB B;  5EKI A;  2K05 A;  5D14 A;  1HRJ A;  1DZ1 A;  1M8A A;  1LV9 A;  3MTS A;  5EJW A;  3GV3 A;  5CMD A;  1RTN A;  1VMC A;  1U4P A;  4IUV A;  5EPK A;  5D65 A;  3TZD A;  1HA6 A;  2K04 A;  2KEE A;  2MJ8 A;  3UI2 A;  1EL0 A;  1HFN A;  1B50 A;  4QUF A;  3P7J A;  1G2T A;  1PFM A;  1XX8 A;  3D6W A;  2RA4 A;  2EPB A;  1BO0 A;  1CM9 A;  1KNE A;  2B2W A;  1DOM A;  2HCC A;  2L1B A;  1J9O A;  3DEO A;  4RAU C;  1TVX A;  5EQ0 A;  4XT1 B;  2X6G A;  1O80 A;  1HFG A;  1S4Z A;  2L11 A;  1F9Q A;  5T1I A;  5T1G A;  1WTR A;  1F9P A;  3TN2 A;  2L9H A;  1E0B A;  1WTX A;  2CVR A;  3ONA B;  1GUW A;  1NR2 A;  1B53 A;  3MWY W;  4X3T A;  2FFK B;  1A15 A;  4IUR A;  1HUM A;  4OIJ A;  4IUU A;  1ESR A;  2B2V A;  1NCV A;  2RSN A;  3I3C A;  5CBE E;  2B2Y C;  4LMQ D;  3I90 A;  2B2U C;  2FJ2 A;  2H1E A;  3IL8 A;  1G91 A;  4IUQ A;  2VXW A;  1CA6 A;  1RHP A;  3H91 A;  2MGS A;  1X3P A;  4O42 A;  5EPL A;  1ZXT A;  4UAI A;  4R9W A;  5E4X A;  4ZLT F;  1J8I A;  5COY A;  1PFB A;  4R8I A;  1F9S A;  2KED A;  3Q6S A;  4OIK A;  1CA5 A;  1IKM A;  1PDQ A;  4CJ2 C;  3FDT A;  1EIG A;  1RJT A;  2N88 A;  2HCI A;  3I91 A;  1BF4 A;  1WTW A;  4HED A;  3DM1 A;  4HAE A;  1ML0 D;  1F9R A;  1U4R A;  2K1B A;  2SDF A;  1B3A A;  1SAP A;  2K03 A;  4NW2 A;  5E4W C;  4ZK9 B;  1IKL A;  1QG7 A;  1EIH A;  2B2T A;  3IFD A;  4QUC A;  2L12 A; 
#chains in the Genus database with same CATH topology
 4UHV A;  3J81 L;  3HOU H;  2O2L D;  4LF4 L;  1IW7 D;  2LKV A;  4M8A A;  1CT1 D;  4JV5 Q;  1G51 A;  4O0A A;  1TWC H;  4DK0 A;  3NPP A;  4X66 L;  3HZX A;  5DNF A;  3VA5 A;  4A3G G;  1KC8 C;  3JAM i;  1SE4 A;  4OWW B;  4KN4 C;  4O2D A;  2NVX B;  2K5H A;  4XQN A;  3GTJ H;  4X3K A;  4C3H B;  3DWP A;  4DV1 L;  3M4O H;  2RHS B;  2F0D A;  4ZUJ A;  1Y1W B;  2I0Q A;  2FHT A;  2JA7 B;  4A3I H;  3MXP A;  1SN8 A;  2RVL A;  1S5E D;  1B2T A;  4DV5 Q;  3DM3 A;  1SR3 A;  3X3N A;  3IKJ A;  1OXX K;  4KHV A;  4NKL A;  1GUS A;  2E76 C;  1PH4 A;  3W1G A;  3A54 A;  3DWQ A;  2IY5 B;  2K04 A;  2DUD A;  1B50 A;  3U4V A;  2HT1 A;  2NN6 G;  3CD6 A;  2F0V A;  5FO9 B;  1JWU D;  4LF9 L;  4KKU A;  4FF4 A;  2G9D A;  4OL7 A;  5GAH C;  2WB1 G;  3TQY A;  3CQZ B;  4YY3 Q;  1HQM C;  4DV4 L;  3J7A F;  4EQ5 A;  2NVY B;  2XGT A;  1PA6 A;  4LF8 Q;  3RMH A;  3A0J A;  1JJG A;  3GTQ H;  4LF7 L;  3CPW A;  4E6I A;  3KYH C;  1AE3 A;  5EKK A;  4GNX A;  2I5M X;  1HTP A;  2Z6B A;  4B9X A;  4A3M H;  2WV6 D;  1PDQ A;  4N8F A;  1I94 L;  1VQC A;  3S9W A;  2CWP A;  3SHL A;  1GM5 A;  1PZJ D;  4IZ8 A;  1A6X A;  1SJE D;  1E2V A;  4NMZ A;  1U5K A;  4NW2 A;  1B3A A;  2K03 A;  5G3L D;  1YNX A;  1CQV A;  2LMC B;  3IFD A;  3J81 E;  2A5H A;  4C2M B;  4DUZ L;  1AP0 A;  4U68 A;  1KDC A;  5ELF A;  3QJY A;  1YJN A;  1JOR A;  1L1O C;  3M4O B;  5FJ8 H;  1Q8K A;  3LWE A;  2N3S A;  4C3I G;  3F2D A;  4H02 A;  2XIW A;  3TS2 A;  1RD9 D;  1EWH A;  3Q24 A;  1II3 A;  1GD7 A;  3ICE A;  1Q3L A;  2WAQ B;  3PO2 G;  4R4C A;  2F3W A;  1TS3 A;  2ZXO A;  1V1P B;  2I5H A;  3I4M H;  1RCV D;  1I4R A;  5IWA Q;  3JAM c;  1U4M A;  1Z6H A;  4A75 A;  4GKJ L;  3N52 A;  1SRU A;  1NMG A;  1BUV T;  5IYB G;  1HNZ L;  3NWT A;  3KLR A;  3PGZ A;  4QF4 A;  1C8C A;  3PUY A;  2E2I H;  1NE3 A;  2G9H D;  2E75 C;  3HOY G;  3KDF B;  4L5S A;  1BKB A;  2O5I C;  4BBR G;  1Y1V G;  4CDD C;  2SOB A;  3RLF A;  4OXP A;  3SEB A;  2E2H H;  1MI2 A;  1V1Q A;  3I4N B;  1WTO A;  1EY4 A;  3K0Y A;  3VR4 A;  1GJX A;  2A6H D;  4ZUI A;  2EYH A;  5C4J H;  5D65 A;  3H15 A;  4X6A H;  5G3L F;  1Z47 A;  2K5V A;  2NZO A;  2R93 H;  1R9T H;  2F0T A;  4JI4 Q;  3E9H A;  4B3R L;  3F2C A;  3N6R A;  4R4Q A;  1O80 A;  3T1Y L;  1BBU A;  2HQE A;  1I4H A;  2YTX A;  4R4O A;  4KKS A;  1B53 A;  1GHK A;  4OO1 H;  1HUM A;  1YNN C;  5C3X A;  4POF A;  3VR2 A;  4K5V A;  4QIW B;  3LNN A;  3CKI B;  2WAC A;  1DD2 A;  2H1E A;  3K6O A;  1SEB D;  2JEB I;  2QEX A;  3CCR A;  1WCM B;  2KEN A;  4F7X A;  3PUX A;  1Q12 A;  1F9S A;  5C5L A;  3UE0 A;  1HR0 L;  1ZYR D;  4K14 A;  1X56 A;  1CUK A;  5ELC A;  3HOZ B;  5JVG 3;  1WTW A;  3DM1 A;  4A3E H;  3S14 B;  1EOV A;  1IBK Q;  4X66 Q;  2JA6 H;  1HH2 P;  3M4Q A;  2B2T A;  1HNX L;  1CTM A;  1VQO A;  3I4M B;  1JIC A;  1EOT A;  1HXY D;  1D1I A;  1F2L A;  2KVM A;  1BCP B;  5JEA G;  1I4P A;  3NE5 B;  4DV1 Q;  1CKN B;  1PH8 A;  4MZ9 A;  3PCO B;  1UNS A;  4EX5 A;  1RKN A;  1HTL D;  1TWA B;  1PTO C;  3R93 A;  4M1U B;  2PCF B;  3H0G G;  2NYZ D;  2E2H B;  3NEN A;  3H94 A;  3C1E A;  1LUZ A;  1S5D D;  2V4D A;  4C3J G;  2OQ0 A;  4DR4 L;  4K6D A;  4A3J B;  5J1Z A;  4CDE C;  4A3D H;  3MFY A;  3NUC A;  1O7Y A;  1K8G A;  1JWM D;  3ITP A;  3T53 B;  4RCO A;  1I4Q A;  3RZO B;  2JA5 B;  2I07 B;  3FHW A;  5DLQ E;  1WTQ A;  1PH2 A;  4LF9 Q;  2EDG A;  2WIN B;  1PFN A;  3L7Z C;  5E7N A;  4MTN A;  2VQE Q;  4QQB X;  5D14 A;  4PMB A;  5ELE A;  4GS3 A;  1YHQ A;  3S1R B;  3EFX D;  3TZD A;  2WAQ E;  1HA5 A;  3P7J A;  4LF7 Q;  5IYC H;  2HD3 A;  4C3H G;  4JOI A;  2VUM G;  1EEF D;  2K6A A;  2L1B A;  1Y1W G;  4XYQ A;  2WII B;  1JJ2 A;  2JA7 G;  2KQ3 A;  3H3V H;  1EQV A;  1Q1E A;  2L9H A;  3PV0 A;  3BU2 A;  4Q5V A;  2DN8 A;  1I94 Q;  4HMJ A;  5IGF A;  5DAU A;  1CFM A;  2F3V A;  2NN6 H;  3J7A V;  3F1Z A;  2IW3 A;  2KHJ A;  3ERO A;  3I3C A;  3BZC A;  4CDC C;  1N36 Q;  2JA6 B;  4IPC A;  1RHP A;  3H91 A;  1EEI D;  4I65 A;  1S40 A;  4DV0 L;  4ODG A;  1WJJ A;  2QIL A;  3STB D;  4DUZ Q;  3GTP H;  4JYA L;  4LFB L;  5E4X A;  1V1P A;  4KV6 A;  2XVS A;  4LUZ A;  1EIG A;  4JI8 Q;  3KJP A;  5IP7 G;  1YHB A;  1IBM L;  4KD3 A;  2YU9 H;  5JPN C;  4XTC S;  4QY7 A;  1YI2 A;  2Z6K A;  2PMZ B;  2ES2 A;  1EZ8 A;  4QUF A;  3KDF A;  4FF1 A;  1AZP A;  5AJ3 Q;  2SNM A;  3T56 B;  1PMR A;  4GKJ Q;  3S16 H;  1JE4 A;  1JOO A;  2DY7 A;  3CXC A;  1FGU A;  3PF4 A;  1HNZ Q;  5KIX A;  4A3G B;  1IL2 A;  4DR2 L;  3FPU B;  3J81 i;  1E22 A;  1E24 A;  2I5L X;  4KD4 A;  4QMG A;  2ZJP A;  3OHX C;  3L9A X;  3O13 A;  3K59 A;  3GDE A;  4C3I H;  5JVH 3;  2NZ1 D;  5BN5 A;  1H9R A;  1CHP D;  1H9K A;  2RCF A;  3JAM E;  1SE8 A;  3C3L A;  1IZ6 A;  3PO2 H;  2PO4 A;  1KRT A;  1MKH A;  1AH9 A;  4K8I A;  1N34 L;  1NAP A;  2JP1 A;  3K58 A;  1YJ9 A;  2JJQ A;  1VDZ A;  2F0J A;  2EXD A;  4H0L C;  4DK3 C;  4B3R Q;  3PO3 B;  3KUP A;  3KLS X;  4H44 C;  1QVG A;  1LT4 D;  2DY8 A;  5IYB H;  4JPB W;  2KBN A;  3HG9 A;  3MEF A;  5IYD H;  3SGI A;  4DGZ A;  2UUA L;  1NTG A;  3M7G A;  4DV6 L;  5TSS A;  5CMD A;  3T1H L;  3PUZ A;  4PG3 A;  4BBR H;  1Y1V H;  3S1N B;  3UI2 A;  3LWU A;  1QWY A;  1DYQ A;  4B3S Q;  3EVQ A;  1U0L A;  2WB1 B;  4BXX G;  5CV6 A;  5GAD C;  4RAU C;  2HIV A;  3GTP B;  4IFD I;  2OTJ A;  3PSI A;  3A5Z B;  2CVR A;  1HR0 Q;  2R61 A;  4FVM A;  1ET9 A;  3K5O A;  2RF4 A;  1CKN A;  2AHO B;  5GAG C;  4HCE A;  3I4N G;  1XNQ L;  1XMO L;  5JJK A;  1GUN A;  2L55 A;  3HKZ G;  3EN2 A;  1CA6 A;  3RLN A;  3A7L A;  1VS0 A;  2PQA B;  2ZT9 C;  4WJW A;  4EQO A;  4ZLT F;  1MD2 D;  5M3F B;  3R3O A;  4R8I A;  1DXM A;  3S16 B;  2MUY A;  5M5W B;  3L0O A;  1PV4 A;  1F9R A;  5FK9 C;  5E4W C;  4A3K B;  1EIH A;  2PI2 E;  1VQF A;  4QUC A;  3A56 A;  2F4V L;  3SK5 A;  1VMP A;  1BXT A;  1LT3 D;  3KF8 B;  4O1N A;  4ABN A;  2EY6 A;  4ZAI A;  2K75 A;  4C3I B;  1QIL A;  1PRT D;  4KJN A;  5LL6 S;  1IW7 C;  3DWA A;  3CF5 A;  1GUG A;  1O7Z A;  1IYU A;  1LTA D;  2D9U A;  3PIP 3;  2DNC A;  1BQQ T;  3CU7 A;  1BCP D;  4DUY L;  4XT3 B;  3PUW A;  1WCM G;  1VQI A;  1W2B A;  4KY7 A;  5HY6 A;  4DR7 Q;  4RGN A;  4FP5 D;  5K5P A;  1TKW B;  5CV8 A;  2PI2 A;  1NNX A;  2DJG C;  3HOZ G;  3HOW B;  5JEA H;  3NEM A;  2KCT A;  4PZ8 A;  5CC4 A;  1KL9 A;  5JJI A;  1H9J A;  5H1S E;  5CBA E;  1V1O A;  1RTO A;  1K8A C;  3HOY B;  3D31 A;  1Y1V B;  2QGQ A;  4DAY A;  3H0G H;  4IUP A;  4IPG A;  4CKC A;  2FMM A;  3NTH A;  5I9P A;  1VQD A;  3DUZ A;  1XWE A;  1SND A;  3S2D B;  3EIV A;  4C3J H;  3EQL C;  3PQI A;  5CV7 A;  2EJG C;  2KHI A;  2VNU D;  3FP9 A;  1N8R C;  5I4D A;  3VYT A;  3NQT A;  5C4X G;  1LTR D;  2VZA A;  1XX8 A;  2AWO A;  4BS9 A;  4GLA C;  1TVX A;  4DV0 Q;  1TS4 A;  2EYO A;  2X6G A;  3K8A A;  4A3J G;  1AFP A;  4JYA Q;  1X55 A;  4LFB Q;  3OIQ A;  1E0B A;  1PRT F;  1ASZ A;  5KYI A;  3GTO H;  5A35 A;  5FKA C;  4IUR A;  1L0Y B;  1IBM Q;  2JA5 G;  4A3C G;  1BCP F;  2EY1 A;  1B3Q A;  1UE7 A;  4JI3 L;  4C3H H;  2IWH A;  3W1B A;  3NTK A;  4P74 A;  2O5J C;  1IYV A;  3H09 A;  1Y1W H;  3BYY B;  2JA7 H;  1N32 L;  2MGS A;  4O42 A;  5GRO A;  3KLS A;  2L5T A;  2UUB L;  4IFD G;  4HJ9 A;  1K83 B;  4OIK A;  1YVC A;  4I7A A;  1SNQ A;  2VS1 A;  2IX1 A;  2QW7 A;  4NP5 A;  1LTL A;  4V19 0;  5IGC A;  3L2P A;  3D4R A;  3QB3 A;  1SYD A;  3VYR A;  4KY5 A;  3HOX B;  3QIA A;  1CQF A;  4DR2 Q;  1S72 A;  4KHP L;  2WB1 E;  2PNH A;  3E9I A;  3I2Z A;  4DR1 L;  2P5Z X;  2JA9 A;  3FMC A;  2ZXP A;  4IUN A;  4CGY B;  4DR3 L;  3SK4 A;  1X3Q A;  5IP7 H;  2Z4I A;  3HRZ C;  4UP9 A;  3F2U A;  4GOP C;  1K73 C;  2XTI A;  5IGB A;  5IOD A;  3KF6 A;  2MP1 A;  1L0W A;  1N34 Q;  3B6Y A;  1IYJ B;  4PZ7 A;  1KQS A;  3D4W A;  5I2X A;  1K8M A;  2JK8 A;  2F0N A;  4L5T A;  3AFQ A;  2O4X A;  2ASB A;  1FVI A;  3TZU A;  1J5E Q;  4DKA C;  4X3S A;  1AW7 A;  5J39 A;  1JOQ A;  1EIF A;  5I2Y A;  2UUA Q;  4DV6 Q;  3T1H Q;  3SDZ A;  1VQ7 A;  1GVP A;  3L3O C;  4CHT B;  1YBY A;  5CR3 A;  2EIF A;  1D7Q A;  1ICW A;  4LJZ C;  4DNR B;  2N49 A;  5HGT A;  2Y0S B;  1K28 A;  1QNK A;  5HGQ A;  1Z9F A;  2HHH Q;  1ZEQ X;  3DEP A;  5ISR A;  3WOF A;  2PQA A;  2Q8I B;  1JJC B;  1BBX C;  4DV7 Q;  2LFN A;  4C2M H;  3GTO B;  1M8A A;  1LV9 A;  3CAM A;  2B39 A;  1E1O A;  1RTN A;  3PIO A;  1SMY D;  4JI2 L;  4HSP A;  2A6H C;  2VUM B;  1ET6 A;  2PQE A;  4F8M A;  2D0P A;  2WKC A;  1XNQ Q;  4PMW A;  1XMO Q;  2EQS A;  3H6M A;  4IPD A;  2K5W A;  3UDI A;  3HKS A;  4HIO A;  4RFB A;  3KF8 A;  2VY3 A;  3BYT B;  5LMU Q;  3W3A A;  4G57 A;  1K3B C;  2EYL A;  4I7Z C;  1L1O B;  5FOB B;  3PO3 G;  1I6V C;  4BXX H;  3GO5 A;  3FKI B;  4EGV A;  1KAW A;  1TU2 B;  5EPL A;  2QDL A;  3QOL A;  3NWS A;  5CV4 A;  2ATW A;  2F4V Q;  2MHV A;  1N9W A;  1JOK A;  1LLR D;  3RR5 A;  3WDN A;  4UDU C;  3CC2 A;  2E8G A;  2CW0 D;  3A8K E;  3PIP A;  3I4N H;  1XTC D;  1S5B D;  2B29 A;  1ML0 D;  2SEB D;  4LFC L;  4DUY Q;  4A4I A;  2F0L A;  3M4Y A;  5T1G A;  1PTO H;  4JBK A;  2B2Y A;  2K52 A;  1EQQ A;  2RSO A;  1PYB A;  3SK8 A;  1M90 C;  5IE8 A;  4K5W A;  3BDC A;  1C48 A;  4DR5 L;  3A55 A;  4IJH A;  1GOZ A;  1B7Y B;  2JXM B;  4RCN A;  2D2C C;  3VYS A;  5M3F G;  1QE6 A;  1EWI A;  5C4Z A;  3A8J E;  1BNZ A;  2K4K A;  2B63 G;  1M4V A;  2HDM A;  2K7V A;  4F88 A;  3GP7 A;  1SNO A;  4A3K G;  1WCM H;  4AQY L;  1B1Z A;  1FNV A;  1C7Y A;  1X54 A;  1EY0 A;  1UEB A;  2IPK D;  1B70 B;  3G6J B;  2F0G A;  3OSO A;  3OTO L;  1SBB B;  2H4O A;  1TS2 A;  4RKB A;  3FEW X;  3HOZ H;  2K28 A;  3MXG A;  2VB2 X;  1DCZ A;  4JI5 Q;  1MGS A;  3RUZ A;  3S14 H;  5C3E G;  1NSN S;  4AYB E;  2B2T C;  4XQQ A;  5IY0 A;  2B2V C;  4TQU S;  1K8O A;  4FNF A;  5IT9 c;  2ZJR A;  4L5R C;  4JC0 A;  1YIT A;  2Q2I A;  3E3X A;  4JI3 Q;  3HOW G;  1EL0 A;  5C0X I;  2JEA I;  4DAM A;  2EYF A;  4YWK A;  1N33 L;  1N32 Q;  1X3G A;  4JCV E;  1YIJ A;  1TWA H;  1K3R A;  3TP5 A;  2AQ2 B;  1R4P B;  2UUB Q;  1HPC A;  1B44 D;  2IHF A;  2XNA C;  3OWF A;  3TP7 A;  2E2J B;  1NR2 A;  4LUO A;  2AWN A;  5M5X H;  4KLK A;  3CP0 A;  3HKZ B;  1ENF A;  5C4X H;  3I55 A;  1JR0 D;  1D1K A;  1IHZ A;  1HCZ A;  1K0S A;  2B2U C;  1W3S A;  2FJ2 A;  5FO8 B;  4A3J H;  4NB3 A;  4JBM A;  4KHP Q;  2Z9H A;  3RLO A;  1PTO B;  1PH5 A;  4MTK A;  4YHH L;  4OX9 L;  3I72 A;  4DR1 Q;  5E1F A;  1PFB A;  3STB C;  2F0O A;  4IQZ A;  4DR3 Q;  3RZO H;  2JA5 H;  1SRO A;  4A3C H;  2YTY A;  5K36 H;  1QOH A;  5F2D A;  5IOC A;  4JBJ A;  3VDY A;  2XRS D;  1VQN A;  1TXY A;  4WFN 3;  4HJ7 A;  4HED A;  4A3B G;  2UXB Q;  1LAB A;  1LTG D;  1EY9 A;  3TDQ A;  3OYY A;  1SYE A;  2XSC A;  4IFD H;  4BY1 G;  2VL6 A;  3S1R H;  4OGQ C;  4TRD A;  3K5M A;  2JA8 B;  1XMQ Q;  2UXC Q;  4Z9C B;  4IUT A;  3V2T A;  1HZ9 A;  3TS0 A;  1KTK A;  4LF4 Q;  1CSQ A;  2KCC A;  3F2B A;  2IL8 A;  1JMC A;  2Z0S A;  3HP3 A;  4BA2 I;  1MIU A;  4HCS A;  3KBX A;  3J7Y W;  1SFO H;  3QG1 A;  4DXF A;  3U9O A;  5M9O A;  1UEA B;  4GZY C;  3RN5 A;  2ZXR A;  4DV3 L;  1SYG A;  1CHQ D;  3HOX G;  1DOL A;  1H9M A;  5KNB A;  1Q8I A;  5KGU A;  4NPS A;  2R7Z G;  1L1O A;  2R92 B;  1DM0 B;  1EY5 A;  4JI2 Q;  2ZJQ A;  1RIP A;  3U9S A;  2M2L A;  3AYH B;  2G5D A;  2C5C A;  1YJW A;  4FF2 A;  2AQ1 B;  2Z6K C;  4OON A;  5JJL A;  1FYC A;  4LF6 L;  3S1Q B;  2BA1 A;  4A3L G;  1T5E A;  5EKI A;  2NVQ B;  4X62 L;  4DK6 C;  4A93 G;  1EIY B;  5M5X B;  2NVT H;  5C4X B;  1EQR A;  3V05 A;  5EPK A;  1EY8 A;  3QWN A;  1HFN A;  4XXE A;  4JK1 C;  4HJ8 A;  2UUC L;  5IT9 L;  1NBW A;  2EPB A;  4A3G H;  3MXN B;  2HCC A;  4XT1 B;  2L11 A;  1FNW A;  4TSS A;  1S3O A;  4ILW A;  5ELB A;  3NK9 A;  2ZM6 L;  1PXU A;  3C1F A;  2EY5 A;  2FFK B;  4OIJ A;  5CV9 A;  5C44 G;  2Y0S G;  5C0X G;  3A7A B;  1XPR A;  4PZ6 A;  4K5X A;  4DPG A;  4LFC Q;  4IOC A;  4OEM B;  4DV4 Q;  2B3G A;  4IUQ A;  4G7Z C;  1X3P A;  3SR1 A;  2F03 A;  2LY7 A;  3NHH A;  3MZ5 A;  3ERQ A;  2D0O A;  5LMN L;  1TWG H;  5JEA J;  1VQB A;  4R1J A;  5KRU A;  1IKM A;  3PO3 H;  3G6E A;  1BF4 A;  3I91 A;  4DR5 Q;  2CKZ B;  3LGJ A;  2K1B A;  4A3F G;  1A0I A;  3TEH B;  2Z8L A;  1IKL A;  1QG7 A;  1SYC A;  1A3T A;  1SFO B;  1V8Q A;  2QEJ C;  3S1N H;  4BY7 G;  3EJI A;  4WOR A;  4TVA B;  1I3Q H;  3G4S A;  3K7A H;  4CBV A;  4R8N A;  3CCJ A;  3S15 B;  3FKI G;  1PRT C;  4AQY Q;  2R7F A;  3HKZ E;  1OXT A;  4GN5 A;  5COR A;  3GD7 A;  4HR7 B;  4UY8 C;  1X3E A;  5JAV A;  1VQ5 A;  3BJU A;  3MXU A;  5JJZ A;  2BDO A;  1S5C D;  1P16 A;  3D8G A;  4IO9 A;  4QJF A;  1OXV A;  4EQN A;  2N78 A;  2NWG A;  4OWX B;  3J7Z C;  4X3U A;  2NVT B;  4DN4 M;  3RZD B;  1E2W A;  3M3Y H;  3BZK A;  5M3F H;  1QVC A;  1EYC A;  2B2W C;  2Q8T A;  2YV5 A;  5M5W H;  2ENB A;  4L63 B;  1MSH A;  4NXN L;  1A3U A;  4QIW E;  1HR0 W;  1EYA A;  1PLF A;  3V96 A;  4A3K H;  4CJ0 B;  4HJA A;  1EQT A;  3OPO A;  5IGE A;  2K05 A;  3R8B A;  3M4P A;  1SXT A;  1KRS A;  1LTI D;  2A68 D;  1GXD C;  5IGD A;  3CCV A;  3GTK H;  3VA7 A;  1EFI D;  3KOJ A;  1VQK A;  5IT9 E;  3GTM H;  1JC7 A;  1TS5 A;  1EZ6 A;  2F3I A;  3HOU G;  1Z7T A;  1J9O A;  2ZTE A;  3G48 A;  5EQ0 A;  1S4Z A;  4YHH Q;  2D5D A;  1TWG B;  2R7D A;  1NY4 A;  4TKO B;  3TN2 A;  1LAC A;  2M9V A;  3DXJ C;  4X3T A;  3HOW H;  3MVV A;  3T1Y Q;  4IUU A;  1A2T A;  3BDO A;  1NCV A;  3HOV G;  2LSS A;  2K32 A;  2QF7 A;  3SE0 A;  4ZYS A;  3HOY H;  1OO9 B;  3I70 A;  4DF7 A;  3K57 A;  1Q1B A;  1I4G A;  4LW1 A;  1I3Q B;  3K7A B;  2F0K A;  2VQF L;  1NJI C;  2NTT A;  4N8X 1;  1CA5 A;  2BH8 A;  1PTO D;  5IGG A;  1I6H B;  2AUJ D;  2QA4 A;  4G7O C;  2WFW A;  3S2D H;  4A3I G;  1XPO A;  3VR5 A;  3W5O A;  3PF5 A;  3S17 B;  4YCW A;  2D62 A;  1KAA A;  1KAB A;  3PIO 3;  1WD1 A;  3X3M A;  1DGS A;  5BN3 A;  4G7H C;  1STY A;  1DON A;  4IOA A;  1GO3 E;  4R4T A;  2J0T D;  2PW7 A;  1HNX Q;  5CGK A;  4DV3 Q;  1U4L A;  1QZG A;  1EYD A;  4A3B H;  3M3Y B;  1PHJ A;  1MSG A;  2ICE C;  4GKK L;  1E7Z A;  1JE5 A;  2B63 B;  4Q0F A;  4BY1 H;  3J80 c;  3EBE A;  3OMG A;  5EAY A;  1QUQ B;  4RKL A;  1ENC A;  2KCM A;  2X69 A;  1A2U A;  3NTI A;  1QCB D;  2KCN A;  2CH4 A;  1TWF H;  2IJ0 A;  4LF6 Q;  1ESF A;  5EBD A;  2PZT A;  4N9T A;  1GHJ A;  4KI0 A;  5JPM C;  1MBY A;  1KNA A;  5C5M A;  1K83 H;  2A73 B;  1YNJ D;  3GTK B;  1CKM A;  2JA8 G;  3GTM B;  3K5L A;  5GAE C;  4DR4 Q;  2I46 A;  1U9R A;  5C3E B;  2N55 A;  4LK1 C;  3ZYY X;  3D4D A;  3HOX H;  2EOT A;  1ASY A;  4LFA L;  4A3M G;  2C35 B;  1UUP A;  5C3W A;  1PTO F;  4K0K L;  2WKD A;  1Q86 C;  3D6C A;  1OXU A;  1LTT D;  3MTS A;  1HNW L;  2ZM6 Q;  1PH9 A;  1CZW A;  3S2H B;  1PVO A;  4HIM A;  3T4A C;  5BN4 A;  1SMY C;  3BZD B;  2CWA A;  1AE2 A;  1BVS A;  2F0M A;  1CM9 A;  1UE5 A;  2ZTC A;  4A3L H;  2F4I A;  4DNT B;  2PMZ E;  1SJH D;  1HFG A;  3KFU A;  1LT5 D;  4A93 H;  4LF8 L;  2R92 G;  5LMN Q;  1VQ6 A;  3OMC A;  4ZRZ A;  3K81 C;  2F1M A;  4FYD A;  5FLM G;  1X6O A;  4J1M A;  1H9S B;  4GOP B;  4JG2 A;  3I90 A;  3IL8 A;  4OEL B;  1ICF B;  4NXM L;  4ZQ3 A;  2IHE A;  1QNU A;  1STB A;  3P20 A;  4BWG B;  2XN9 C;  4UAI A;  5EKL A;  4CDF C;  3GTG B;  2L15 A;  4A3B B;  1T9H A;  4CJ2 C;  2F0E A;  5C44 H;  4DNI A;  5C0X H;  2CCZ A;  2EY2 A;  2A8V A;  3UDF A;  4BY1 B;  3TP8 A;  2CW0 C;  4HAE A;  5JOB A;  3PUV A;  1E2Z A;  1L2F A;  4GLV B;  2Q2T A;  4PMC A;  1EWC A;  1AN8 A;  4PNY A;  4RG1 A;  3T13 A;  2VUM H;  1TWF B;  2GVB A;  1CI3 M;  5ELN A;  2JQO A;  2BE5 D;  1TII D;  1TWH B;  2PW5 A;  2L4N A;  2F0W A;  3TME A;  1UAP A;  2K5D A;  1SDF A;  4JBW A;  4EVO A;  5LHY 1;  1PH7 A;  4P2C B;  3TRE A;  3LX0 A;  3NSW A;  4JI6 L;  3J80 L;  2MNA A;  2NB0 A;  2PZW A;  1B9M A;  2F0P A;  1KDB A;  2EVB A;  3FKI H;  3QO2 A;  4RGM A;  2R7Z B;  2PYK A;  2MO0 A;  1MJE A;  4OO1 G;  3I7F A;  3GTL B;  1PYW D;  1W6J A;  2NBF A;  4XDX A;  4KY6 A;  2OT2 A;  5E3F A;  3A8I E;  1KXL A;  5I6Y A;  4DAP A;  2FIN B;  1LM0 A;  4A93 B;  4HSV A;  1HRJ A;  4C56 C;  5EJW A;  3GV3 A;  4Y7N H;  3IAY A;  4JI4 L;  1VMC A;  4IUV A;  2F0I A;  1FGB D;  4P72 A;  4Y52 H;  1RDP D;  4JI1 L;  4GNX C;  4K6L A;  4KJO A;  4IFD J;  2RKS A;  5C6A A;  3I4O A;  5T1I A;  4L6T B;  4FXD A;  1L0X B;  1SE2 A;  2EYP A;  5C44 B;  1JCK B;  2IX3 A;  4U67 3;  2XWB B;  4QB4 A;  5IP9 G;  2RSN A;  1FR3 A;  1ONL A;  1MHW C;  5J22 A;  2RHQ B;  4RGT A;  2VXW A;  1QUQ A;  1TQO A;  4MIU A;  1AEX A;  1Q90 A;  2CFM A;  3SXH A;  4X65 L;  1SNP A;  3Q6S A;  1IBK L;  4AIM A;  5DM7 3;  4A3F B;  3HOV H;  2RDG A;  4A3D G;  4GKK Q;  5L37 A;  3CC7 A;  1SAP A;  2AQ3 B;  4DA2 A;  4BY7 B;  2A1A A;  3E0E A;  4RWS C;  3U50 C;  1VQE A;  4H13 C;  4PV1 C;  5M5Y H;  4CJ1 B;  1VQ4 A;  2CHB D;  3CRL C;  2FMC A;  2GA4 B;  2PPB C;  2UXD L;  5BR8 L;  3VYU A;  4YWL A;  1B4O A;  3AU7 A;  1QZH A;  2R3Z A;  3SVM A;  1VQG A;  3S1M H;  3NEL A;  1R4Q B;  2E2J H;  1K9M C;  1SNC A;  5IYC G;  4HMI A;  1ZYR C;  3CHB D;  3HGB A;  3J80 E;  2IX0 A;  3J81 j;  3BDL A;  2A6E D;  4ZCK A;  3OOC A;  1I50 B;  1YEZ A;  2F0Q A;  1TY0 A;  1DJR D;  2JSO A;  3JC6 6;  4LFA Q;  4X64 L;  2ID0 A;  1BOS A;  2BOS A;  4K0K Q;  4Y7N B;  3CME A;  1FJG L;  1VQJ A;  4RA8 A;  1NUC A;  2OCE A;  1HNW Q;  3K5N A;  1STN A;  2A69 D;  2KEC A;  2LS0 1;  4QL5 A;  2SNS A;  5HUR A;  1H9S A;  4GOP A;  4DK1 A;  2VQE L;  5D3D A;  1TR5 A;  2DGY A;  2DNE A;  3MEH A;  1WI5 A;  2Z1C A;  2BDN A;  2OF1 A;  4ZKB B;  2F0F A;  3NQI A;  4R4I A;  1C4Q A;  4ME5 A;  2OTL A;  3GQB A;  4B3T L;  1DZ1 A;  3AB9 A;  2JA8 H;  4XYO A;  1VF7 A;  1LTB D;  1Y8O B;  4KMU C;  3HOU B;  3CCU A;  2YYZ A;  1IBL L;  4RHS A;  1G2T A;  1PFM A;  2NUC A;  5FLX L;  1KNE A;  4RGO S;  4NXM Q;  3F8T A;  5ELD A;  1LT6 D;  3U58 A;  1TWC B;  4FXG C;  3OIP A;  1N36 L;  2A19 A;  3HOV B;  1W6K A;  3Q22 A;  1O7L A;  3MWY W;  1FNU A;  1ESR A;  1GUT A;  1Y69 U;  5KNC A;  2AKW B;  1VQP A;  3CMA A;  3GTJ B;  3ULL A;  2L0C A;  3FRP B;  5M5Y B;  2R92 H;  3A5U A;  4JI8 L;  3KLW A;  2ALY B;  4POG A;  4A3I B;  1J8I A;  3M9B A;  5COY A;  3S24 A;  5FLM H;  1H95 A;  4LF5 L;  1GKH A;  4GN4 B;  4YCV A;  4FO2 A;  1C9O A;  1STH A;  3FVQ A;  1D8L A;  3CCM A;  3S1Q H;  3S1M B;  2OQK A;  5AJ3 L;  2NVQ H;  1WFQ A;  4RH6 A;  3D0F A;  1S5F D;  4KTA A;  1GUO A;  4DXG A;  3ER0 A;  1SMX A;  2VW9 A;  4JI6 Q;  1ZKO A;  4GLX A;  3BS1 A;  4F87 A;  5IYD G;  2JYO A;  4C1N K;  4B9W A;  2Y0S E;  4FF3 A;  2EZV A;  4V0B A;  4MHE A;  1O7I A;  2C9O A;  2FXQ A;  1LYL A;  1M1K C;  3Q8D A;  3NXW A;  3HEJ A;  1SLJ A;  1XPU A;  1EYG A;  3MAQ A;  3GV6 A;  4K8J A;  1JT8 A;  4PQX A;  1PZK D;  2LXK A;  3GTQ B;  3BG3 A;  2UU9 L;  1NR4 A;  2J4X A;  1ENA A;  4JOI C;  1IXR A;  4K2K A;  1BBW A;  1SSO A;  3BVG A;  3D3R A;  3BVZ A;  4JI1 Q;  5AFW A;  1QVF A;  4A3M B;  3C46 A;  1RF2 D;  2MPM A;  4HIK A;  3I8Z A;  3DLL A;  2Z4H A;  3ZJY C;  5KYL A;  3CW2 C;  1ILP A;  3E0J A;  4IAL A;  2B8F A;  3CRK C;  2MQH A;  2V1C C;  4B08 A;  2K5N A;  2A74 C;  4S3S A;  4B3S L;  1KLU D;  4OHJ A;  5I9O A;  4UP8 A;  5IIF A;  3OW7 A;  1HA6 A;  2KEE A;  1MJC A;  4XQJ A;  4DV2 L;  3S15 H;  2A68 C;  4BBS G;  1G8Z D;  2XRQ D;  5FLX E;  3M7N A;  1B8A A;  1BR9 A;  3D6W A;  2RA4 A;  2E2D C;  2K50 A;  1DOM A;  3DEO A;  1JB7 A;  4DR6 L;  2CQO A;  5M3M G;  4X65 Q;  4FDB A;  1STG A;  3ONA B;  5D3I B;  3RD4 A;  1A15 A;  1EUJ A;  1PRT B;  2B2V A;  5CBE E;  4LMQ D;  2XWJ B;  3RZD H;  1LO5 D;  1EY7 A;  3ULJ A;  3QOJ A;  2PZU A;  4R9W A;  4AYB G;  3I73 A;  1X9N A;  4KKT A;  2Q2U A;  1VQL A;  2E2I B;  2RDF A;  5IP9 H;  5KEE A;  2UXD Q;  1RJT A;  3I56 A;  5BR8 Q;  2QKI C;  2BH2 A;  1LTS D;  3K80 C;  2SDF A;  4YIJ A;  3U4Z A;  1OXS C;  3MC0 B;  4ZK9 B;  2F0S A;  3IFT A;  2X6L A;  1HZA A;  4HTH A;  4J6H A;  2OEO A;  2K5Q A;  2B2U A;  3JAM L;  1VQM A;  5C4J B;  3OWE B;  4ALP A;  4DR7 L;  2GVA A;  4X64 Q;  1XNR L;  2R93 B;  1R9T B;  5CV5 A;  3G7L A;  3UDX A;  1CSP A;  2Q2H A;  1FJG Q;  4J15 A;  1AZQ A;  1Q82 C;  4HID A;  1ROD A;  4A76 A;  3AQQ A;  4P75 A;  1ILQ A;  2WP8 J;  4MN3 A;  3I4L A;  1YZ6 A;  3TRZ A;  2F0H A;  3BVM A;  2GN5 A;  1KHI A;  3VR6 A;  1HUN A;  2E5L L;  4JI0 L;  1Y8N B;  3HS0 C;  1E1T A;  1STA A;  4ZKC B;  1FD7 D;  1E3P A;  4B3T Q;  1XYI A;  1QJO A;  1I5F A;  4UP7 A;  3OW2 A;  1X32 A;  1WTP A;  4L8J A;  5LL6 X;  2OWO A;  1I6H H;  1EU3 A;  1YNJ C;  3J80 i;  1IBL Q;  4IPH A;  1PH6 A;  1Q7Y C;  3S17 H;  1BCP C;  3AFP A;  4KK7 A;  5DM6 3;  3OTO Q;  2LXJ A;  1WYD A;  4DAY B;  4A3E B;  2BA0 A;  2K33 A;  4WJ4 A;  2OXP A;  3TP6 A;  1VQA A;  5C0X J;  4B3M L;  1PH1 A;  2MJ8 A;  3WWV A;  4CKE A;  1PFS A;  5A2Q L;  3KBG A;  3W2D A;  4AH6 A;  2B63 H;  1VF5 C;  4WRD A;  4G4K A;  1WTR A;  1F9Q A;  4JW0 A;  2AUK A;  3UDG A;  1N33 Q;  3WOE A;  2ZTD A;  4LF5 Q;  1YNN D;  5KND A;  1KD1 C;  4FXK C;  4IJL A;  2F52 A;  2EYM A;  3E5S A;  3CCQ A;  1X65 A;  2PNR C;  1ZXT A;  1Y14 B;  2KJX A;  4YWM A;  1CZG A;  4DAV A;  2F0U A;  5C4H A;  2TSS A;  3T51 B;  4A3D B;  5C3E H;  3TSS A;  2CQA A;  1CKO A;  1A8V A;  2HQL A;  2E74 C;  3A74 A;  4APV A;  1Q46 A;  4JVZ A;  4OX9 Q;  4HJ5 A;  1O78 A;  2EXZ A;  1Y8P B;  4ME3 A;  2EYJ A;  3S2H H;  3T16 A;  1HZC A;  1WVL A;  1A62 A;  2RQX A;  2J7Z A;  3NP8 A;  4ULL A;  4CKB A;  1WOC A;  4P73 A;  5EPJ A;  4JI7 L;  1C0A A;  4QCL A;  2UU9 Q;  2BE5 C;  4LNQ A;  4RHR A;  1F2Y A;  5CYU A;  2EJF C;  3MHB A;  3NBH B;  1DOK A;  1J5E L;  2TMP A;  2KHS A;  2WAQ G;  3URY A;  1QB5 D;  1D5M C;  3K7U C;  1G6Z A;  3KF6 B;  1G2S A;  2KA7 A;  1WD0 A;  3J7A 5;  3DHQ A;  4LWC A;  4JV5 L;  1FL0 A;  1HJP A;  3GTG H;  1X3F A;  1XJV A;  1G6P A;  2HHH L;  2HUG A;  3CPF A;  2HIX A;  4DV2 Q;  1F2Z A;  3R2I A;  5LMN W;  4DV7 L;  4OO1 I;  2R6G A;  4J8Q A;  2HDL A;  4QGU A;  1VCI A;  3FPP A;  2Q8R E;  2K14 A;  3MA2 B;  1WTV A;  1UE6 A;  2YU9 B;  4N9P A;  4DR6 Q;  2IT1 A;  1SYB A;  3KJO A;  3MXN A;  1SNM A;  4K2L A;  1KLG D;  2JN4 A;  5A2Q E;  2ICI A;  4DV5 L;  2CH4 W;  1TWH H;  4X62 Q;  3C2P A;  1D5Z C;  4HN7 A;  5LMU L;  3G71 A;  2B2W A;  3CCL A;  1D5X C;  3P1H A;  1T5X D;  1V43 A;  1NMF A;  3UE1 A;  3M85 A;  2UUC Q;  1XTD A;  2RBM A;  5ELO A;  1KDA A;  2QDB A;  3KK7 A;  1GUW A;  4BBS H;  3AEV A;  4KN7 C;  1A63 A;  1CK1 A;  2R7Z H;  2M00 A;  4LUV A;  1WTH A;  1EU4 A;  3H3V C;  1K0R A;  4C1N I;  3GTL H;  5M3M H;  5J3B A;  4KHZ A;  3VR3 A;  3PO2 B;  3R2T A;  1SE3 A;  2KED A;  4YY3 L;  3CCE A;  2YTV A;  2MO1 A;  4GN3 B;  2N88 A;  1XNR Q;  5FJ8 G;  4H7B A;  1JQY D;  1D6E C;  1D2B A;  2NTS A;  1VQH A;  3J81 c;  1U4R A;  4UPA A;  3E6Z X;  3ULP A;  4WJ3 M;  3K0X A;  1P8L A;  1PZI D;  2DJF C;  1VQ9 A;  4RMF A;  3EA6 A;  3CCS A;  1F77 A;  1OTC A;  3Q23 A;  1EFW A;  2BCO A;  1TY2 A;  5GQO A;  2EE1 A;  2K01 A;  2E5L Q;  4BBR B;  4JI0 Q;  5EGT A;  3I4M G;  3HFZ B;  1UE1 A;  2QCP X;  4LAA A;  3DMU A;  4IN3 A;  1IL8 A;  3MFG A;  2KUM A;  1J6Q A;  2N8N A;  4GNX B;  1Q81 C;  3PMF A;  2A6E C;  2MFI A;  4YCU A;  1V9P A;  4NDX A;  1HHV A;  3P75 A;  3H3V I;  4JI5 L;  1RL2 A;  4B3M Q;  5EBC A;  2KOL A;  3QR8 A;  4A3F H;  2A69 C;  4MNO A;  3SK6 A;  2NN6 I;  4DFA A;  2R93 G;  5IWA L;  1I4X A;  4BY7 H;  2VB3 X;  5K36 G;  2NVX H;  3IRB A;  1JWS D;  1JB3 A;  1YHA A;  4EQP A;  1PH3 A;  4NXN Q;  2JE6 I;  4BBS B;  2AMC B;  3RN2 A;  2RCN A;  1U4P A;  1B9N A;  1G29 1;  3NBI A;  1HQR D;  2H5X A;  1BO0 A;  5M3M B;  1F2M A;  1TT2 A;  5FO7 B;  1F9P A;  2RDH A;  1PYS B;  3ND8 A;  3TBI B;  3CC4 A;  1WTX A;  4L5Q A;  1I50 H;  3RNU A;  2B8G A;  4DU9 A;  4XIG S;  2B2Y C;  2NZH A;  4AYB B;  5FLX c;  4A3E G;  3NBH A;  1G91 A;  1STE A;  2JA6 G;  5I6W A;  5DEH A;  3AMU A;  1A3V A;  1UWV A;  3ERS X;  1VQ8 A;  2UXB L;  4P71 A;  4BA1 I;  3H0G B;  1BDO A;  3FDT A;  3CQZ H;  4ID6 A;  4JI7 Q;  2HCI A;  2EJM A;  2NVY H;  2VQF Q;  1SYF A;  1EY6 A;  1HZB A;  4OWT B;  1XMQ L;  2UXC L;  1KIX A;  3Q0A A;  4C3J B;  5NUC A;  1XXG A;  3ND9 A;  2L12 A; 
#chains in the Genus database with same CATH homology
 3J81 L;  2O2L D;  1IW7 D;  2LKV A;  4M8A A;  1CT1 D;  4DK0 A;  3NPP A;  3HZX A;  5DNF A;  3VA5 A;  1SE4 A;  4KN4 C;  2NVX B;  4XQN A;  4X3K A;  4C3H B;  3DWP A;  2F0D A;  4ZUJ A;  1Y1W B;  2FHT A;  2JA7 B;  3MXP A;  2RVL A;  1S5E D;  1B2T A;  3X3N A;  3IKJ A;  1OXX K;  4KHV A;  4NKL A;  1GUS A;  2E76 C;  3A54 A;  3DWQ A;  2K04 A;  1B50 A;  2NN6 G;  2F0V A;  5FO9 B;  1JWU D;  4KKU A;  4FF4 A;  2G9D A;  4OL7 A;  3CQZ B;  1HQM C;  3J7A F;  2NVY B;  3RMH A;  4E6I A;  5EKK A;  1HTP A;  4B9X A;  2WV6 D;  1PDQ A;  3S9W A;  3SHL A;  1PZJ D;  4IZ8 A;  1A6X A;  1SJE D;  1E2V A;  4NMZ A;  5G3L D;  4NW2 A;  1B3A A;  2K03 A;  1CQV A;  2LMC B;  3IFD A;  3J81 E;  2A5H A;  4C2M B;  1AP0 A;  4U68 A;  1KDC A;  5ELF A;  3QJY A;  1JOR A;  3M4O B;  3LWE A;  4C3I G;  2XIW A;  1RD9 D;  1EWH A;  3Q24 A;  1II3 A;  1Q3L A;  2WAQ B;  2F3W A;  1TS3 A;  2ZXO A;  1V1P B;  1RCV D;  1I4R A;  1U4M A;  1Z6H A;  3N52 A;  1BUV T;  3NWT A;  3KLR A;  4QF4 A;  1C8C A;  3PUY A;  2G9H D;  2E75 C;  2O5I C;  2SOB A;  3RLF A;  3SEB A;  1MI2 A;  3I4N B;  1WTO A;  1EY4 A;  3K0Y A;  3VR4 A;  1GJX A;  2A6H D;  4ZUI A;  2EYH A;  5D65 A;  5G3L F;  1Z47 A;  2F0T A;  3N6R A;  1O80 A;  2HQE A;  1I4H A;  4KKS A;  1B53 A;  1GHK A;  4OO1 H;  1HUM A;  1YNN C;  5C3X A;  3VR2 A;  4K5V A;  4QIW B;  3LNN A;  3CKI B;  2WAC A;  1DD2 A;  2H1E A;  3K6O A;  1SEB D;  2JEB I;  1WCM B;  4F7X A;  3PUX A;  1Q12 A;  1F9S A;  5C5L A;  1ZYR D;  4K14 A;  5ELC A;  3HOZ B;  5JVG 3;  1WTW A;  3DM1 A;  3S14 B;  2B2T A;  1CTM A;  3I4M B;  1JIC A;  1EOT A;  1HXY D;  1D1I A;  1F2L A;  2KVM A;  1BCP B;  5JEA G;  1I4P A;  3NE5 B;  1UNS A;  1RKN A;  1HTL D;  1TWA B;  1PTO C;  3R93 A;  4M1U B;  2PCF B;  2NYZ D;  2E2H B;  3H94 A;  3C1E A;  1S5D D;  2V4D A;  4C3J G;  4K6D A;  4A3J B;  5J1Z A;  3MFY A;  3NUC A;  1O7Y A;  1JWM D;  3ITP A;  3T53 B;  4RCO A;  1I4Q A;  3RZO B;  2JA5 B;  2I07 B;  1WTQ A;  2EDG A;  2WIN B;  1PFN A;  3L7Z C;  5D14 A;  4PMB A;  5ELE A;  3S1R B;  3EFX D;  3TZD A;  1HA5 A;  3P7J A;  4C3H G;  1EEF D;  2K6A A;  2L1B A;  4XYQ A;  2WII B;  2KQ3 A;  1EQV A;  1Q1E A;  2L9H A;  3PV0 A;  4Q5V A;  2DN8 A;  4HMJ A;  5IGF A;  5DAU A;  1CFM A;  2F3V A;  2NN6 H;  3J7A V;  2IW3 A;  3I3C A;  3ERO A;  2JA6 B;  1RHP A;  3H91 A;  1EEI D;  4I65 A;  4ODG A;  2QIL A;  5E4X A;  1V1P A;  4KV6 A;  2XVS A;  1EIG A;  4KD3 A;  5JPN C;  4XTC S;  2PMZ B;  1EZ8 A;  4QUF A;  4FF1 A;  1AZP A;  2SNM A;  3T56 B;  1PMR A;  1JE4 A;  1JOO A;  2DY7 A;  5KIX A;  4A3G B;  3FPU B;  4KD4 A;  4QMG A;  3OHX C;  3L9A X;  3O13 A;  3K59 A;  5JVH 3;  2NZ1 D;  5BN5 A;  1H9R A;  1CHP D;  1H9K A;  3JAM E;  3C3L A;  2PO4 A;  4K8I A;  1NAP A;  2JP1 A;  3K58 A;  1VDZ A;  2F0J A;  4H0L C;  3PO3 B;  3KUP A;  3KLS X;  4H44 C;  1LT4 D;  2DY8 A;  3HG9 A;  4DGZ A;  3M7G A;  5TSS A;  5CMD A;  3PUZ A;  3S1N B;  3UI2 A;  3LWU A;  1QWY A;  1DYQ A;  3EVQ A;  2WB1 B;  5CV6 A;  4RAU C;  3GTP B;  4IFD I;  2CVR A;  2R61 A;  4FVM A;  1ET9 A;  3K5O A;  4HCE A;  1GUN A;  2L55 A;  1CA6 A;  3A7L A;  2ZT9 C;  4WJW A;  4EQO A;  4ZLT F;  1MD2 D;  5M3F B;  3R3O A;  4R8I A;  1DXM A;  3S16 B;  2MUY A;  5M5W B;  1F9R A;  5FK9 C;  5E4W C;  4A3K B;  1EIH A;  4QUC A;  3A56 A;  3SK5 A;  1VMP A;  1BXT A;  1LT3 D;  4O1N A;  4ABN A;  2EY6 A;  4ZAI A;  4C3I B;  1QIL A;  1PRT D;  4KJN A;  5LL6 S;  1IW7 C;  3DWA A;  1GUG A;  1O7Z A;  1IYU A;  1LTA D;  2D9U A;  3PIP 3;  2DNC A;  1BQQ T;  3CU7 A;  1BCP D;  4XT3 B;  3PUW A;  4KY7 A;  4RGN A;  4FP5 D;  5K5P A;  1TKW B;  5CV8 A;  3HOW B;  5JEA H;  5CC4 A;  1H9J A;  5CBA E;  1V1O A;  1RTO A;  3HOY B;  3D31 A;  1Y1V B;  4DAY A;  4IUP A;  4CKC A;  2FMM A;  3NTH A;  5I9P A;  3DUZ A;  1XWE A;  1SND A;  3S2D B;  3EQL C;  5CV7 A;  2EJG C;  2VNU D;  5I4D A;  3VYT A;  3NQT A;  1LTR D;  1XX8 A;  2AWO A;  4BS9 A;  1TVX A;  1TS4 A;  2EYO A;  2X6G A;  1AFP A;  3OIQ A;  1E0B A;  1PRT F;  5KYI A;  5A35 A;  5FKA C;  4IUR A;  1L0Y B;  1BCP F;  2EY1 A;  2IWH A;  3NTK A;  2O5J C;  1IYV A;  3H09 A;  3BYY B;  2MGS A;  4O42 A;  3KLS A;  2L5T A;  4IFD G;  1K83 B;  4OIK A;  1SNQ A;  2IX1 A;  4NP5 A;  4V19 0;  5IGC A;  3D4R A;  3QB3 A;  1SYD A;  3VYR A;  4KY5 A;  3HOX B;  3QIA A;  1CQF A;  3FMC A;  2ZXP A;  4IUN A;  4CGY B;  3SK4 A;  1X3Q A;  2Z4I A;  3HRZ C;  3F2U A;  5IGB A;  5IOD A;  2MP1 A;  3D4W A;  5I2X A;  1K8M A;  2F0N A;  2O4X A;  3TZU A;  4X3S A;  1AW7 A;  5J39 A;  1JOQ A;  5I2Y A;  3SDZ A;  3L3O C;  4CHT B;  5CR3 A;  1ICW A;  4LJZ C;  4DNR B;  5HGT A;  2Y0S B;  1QNK A;  1ZEQ X;  3DEP A;  5ISR A;  3WOF A;  2Q8I B;  1BBX C;  2LFN A;  3GTO B;  1M8A A;  1LV9 A;  2B39 A;  1RTN A;  1SMY D;  4HSP A;  2A6H C;  2VUM B;  1ET6 A;  2PQE A;  4F8M A;  2WKC A;  4PMW A;  3H6M A;  2K5W A;  4RFB A;  3KF8 A;  3BYT B;  3W3A A;  4G57 A;  2EYL A;  4I7Z C;  5FOB B;  1I6V C;  3GO5 A;  3FKI B;  4EGV A;  1TU2 B;  5EPL A;  3NWS A;  3QOL A;  5CV4 A;  2MHV A;  1JOK A;  1LLR D;  3WDN A;  4UDU C;  2CW0 D;  3A8K E;  1XTC D;  1S5B D;  1ML0 D;  2SEB D;  2F0L A;  3M4Y A;  5T1G A;  1PTO H;  2B2Y A;  2RSO A;  3SK8 A;  4K5W A;  3BDC A;  1C48 A;  3A55 A;  1GOZ A;  2JXM B;  4RCN A;  2D2C C;  3VYS A;  1QE6 A;  5C4Z A;  3A8J E;  1BNZ A;  1M4V A;  2HDM A;  2K7V A;  4F88 A;  3GP7 A;  1SNO A;  1B1Z A;  1FNV A;  1EY0 A;  2IPK D;  3G6J B;  2F0G A;  3OSO A;  1SBB B;  2H4O A;  1TS2 A;  4RKB A;  3FEW X;  2K28 A;  3MXG A;  2VB2 X;  1DCZ A;  1MGS A;  3RUZ A;  1NSN S;  2B2T C;  4XQQ A;  2B2V C;  4TQU S;  1K8O A;  4FNF A;  1EL0 A;  5C0X I;  2JEA I;  2EYF A;  3TP5 A;  2AQ2 B;  1R4P B;  1HPC A;  1B44 D;  2XNA C;  3OWF A;  3TP7 A;  2E2J B;  1NR2 A;  2AWN A;  3HKZ B;  1ENF A;  1JR0 D;  1D1K A;  1IHZ A;  1HCZ A;  2B2U C;  2FJ2 A;  5FO8 B;  1PTO B;  3I72 A;  5E1F A;  1PFB A;  2F0O A;  4IQZ A;  5K36 H;  1QOH A;  5F2D A;  5IOC A;  2XRS D;  4WFN 3;  4HED A;  1LAB A;  1LTG D;  1EY9 A;  3TDQ A;  1SYE A;  2XSC A;  4IFD H;  4OGQ C;  4TRD A;  3K5M A;  2JA8 B;  4Z9C B;  4IUT A;  3V2T A;  1KTK A;  2KCC A;  2IL8 A;  3HP3 A;  4BA2 I;  4HCS A;  3KBX A;  3J7Y W;  3QG1 A;  4DXF A;  3U9O A;  5M9O A;  1UEA B;  4GZY C;  2ZXR A;  1SYG A;  1CHQ D;  1DOL A;  1H9M A;  5KNB A;  1Q8I A;  5KGU A;  2R92 B;  1DM0 B;  1EY5 A;  3U9S A;  2M2L A;  2C5C A;  4FF2 A;  2AQ1 B;  1FYC A;  3S1Q B;  2BA1 A;  1T5E A;  5EKI A;  2NVQ B;  5M5X B;  5C4X B;  3V05 A;  5EPK A;  1EY8 A;  3QWN A;  1HFN A;  4XXE A;  4JK1 C;  5IT9 L;  2EPB A;  2HCC A;  4XT1 B;  2L11 A;  1FNW A;  4TSS A;  4ILW A;  5ELB A;  3NK9 A;  1PXU A;  3C1F A;  2EY5 A;  2FFK B;  4OIJ A;  5CV9 A;  5C0X G;  3A7A B;  4K5X A;  4IUQ A;  4G7Z C;  1X3P A;  3SR1 A;  2F03 A;  2LY7 A;  3NHH A;  3MZ5 A;  3ERQ A;  5JEA J;  1IKM A;  5KRU A;  1BF4 A;  3I91 A;  2K1B A;  2Z8L A;  1IKL A;  1QG7 A;  1SYC A;  1A3T A;  1SFO B;  1V8Q A;  2QEJ C;  3EJI A;  4WOR A;  4CBV A;  4R8N A;  3S15 B;  1PRT C;  1OXT A;  5COR A;  3GD7 A;  4HR7 B;  5JAV A;  3MXU A;  5JJZ A;  2BDO A;  1S5C D;  3D8G A;  1OXV A;  4EQN A;  2NWG A;  4X3U A;  2NVT B;  4DN4 M;  3RZD B;  1E2W A;  1EYC A;  2B2W C;  2Q8T A;  2ENB A;  4L63 B;  1MSH A;  1A3U A;  1EYA A;  1PLF A;  3V96 A;  4CJ0 B;  1EQT A;  3OPO A;  5IGE A;  2K05 A;  3R8B A;  1SXT A;  1LTI D;  2A68 D;  1GXD C;  5IGD A;  3VA7 A;  1EFI D;  5IT9 E;  1JC7 A;  1TS5 A;  1EZ6 A;  1Z7T A;  1J9O A;  5EQ0 A;  1S4Z A;  2D5D A;  1TWG B;  4TKO B;  3TN2 A;  1LAC A;  2M9V A;  3DXJ C;  4X3T A;  3MVV A;  4IUU A;  1A2T A;  3BDO A;  1NCV A;  2K32 A;  2QF7 A;  3SE0 A;  4ZYS A;  1OO9 B;  3I70 A;  4DF7 A;  3K57 A;  1Q1B A;  1I4G A;  1I3Q B;  3K7A B;  2F0K A;  2NTT A;  1CA5 A;  1PTO D;  5IGG A;  1I6H B;  2AUJ D;  4G7O C;  3VR5 A;  3S17 B;  2D62 A;  1KAA A;  1KAB A;  3PIO 3;  1WD1 A;  3X3M A;  5BN3 A;  4G7H C;  1STY A;  1DON A;  2J0T D;  2PW7 A;  5CGK A;  1U4L A;  1EYD A;  3M3Y B;  1MSG A;  2ICE C;  2B63 B;  4Q0F A;  3OMG A;  4RKL A;  1ENC A;  2X69 A;  1A2U A;  3NTI A;  1QCB D;  2KCN A;  2IJ0 A;  1ESF A;  5EBD A;  2PZT A;  4N9T A;  1GHJ A;  4KI0 A;  5JPM C;  1MBY A;  1KNA A;  5C5M A;  2A73 B;  1YNJ D;  3GTK B;  3GTM B;  3K5L A;  2I46 A;  1U9R A;  5C3E B;  2N55 A;  4LK1 C;  3ZYY X;  3D4D A;  2EOT A;  1UUP A;  5C3W A;  1PTO F;  2WKD A;  3D6C A;  1OXU A;  1LTT D;  3MTS A;  1CZW A;  3S2H B;  3T4A C;  5BN4 A;  1SMY C;  3BZD B;  2F0M A;  1CM9 A;  2F4I A;  4DNT B;  1SJH D;  1HFG A;  1LT5 D;  3OMC A;  4ZRZ A;  2F1M A;  4FYD A;  4J1M A;  1H9S B;  3I90 A;  3IL8 A;  4ZQ3 A;  1QNU A;  1STB A;  3P20 A;  4BWG B;  2XN9 C;  4UAI A;  5EKL A;  3GTG B;  4A3B B;  4CJ2 C;  2F0E A;  5C0X H;  2EY2 A;  4BY1 B;  3TP8 A;  2CW0 C;  4HAE A;  5JOB A;  3PUV A;  1E2Z A;  4PMC A;  1EWC A;  1AN8 A;  4PNY A;  3T13 A;  1TWF B;  1CI3 M;  2BE5 D;  1TII D;  1TWH B;  2PW5 A;  2L4N A;  2F0W A;  3TME A;  1UAP A;  2K5D A;  1SDF A;  4JBW A;  4EVO A;  5LHY 1;  4P2C B;  3LX0 A;  3NSW A;  3J80 L;  2NB0 A;  2PZW A;  1B9M A;  2F0P A;  1KDB A;  2EVB A;  3QO2 A;  4RGM A;  2R7Z B;  2PYK A;  4OO1 G;  3GTL B;  1PYW D;  1W6J A;  2NBF A;  4XDX A;  4KY6 A;  2OT2 A;  5E3F A;  3A8I E;  5I6Y A;  4DAP A;  2FIN B;  4A93 B;  4HSV A;  1HRJ A;  4C56 C;  5EJW A;  3GV3 A;  3IAY A;  1VMC A;  4IUV A;  2F0I A;  1FGB D;  1RDP D;  4K6L A;  4KJO A;  4IFD J;  2RKS A;  5C6A A;  5T1I A;  4L6T B;  4FXD A;  1L0X B;  1SE2 A;  2EYP A;  5C44 B;  1JCK B;  2IX3 A;  4U67 3;  2XWB B;  4QB4 A;  2RSN A;  1FR3 A;  1ONL A;  5J22 A;  4RGT A;  2VXW A;  1TQO A;  4MIU A;  1AEX A;  1Q90 A;  3SXH A;  1SNP A;  3Q6S A;  5DM7 3;  4A3F B;  2RDG A;  1SAP A;  2AQ3 B;  4DA2 A;  4BY7 B;  4RWS C;  4H13 C;  4PV1 C;  4CJ1 B;  2CHB D;  3CRL C;  2FMC A;  2GA4 B;  2PPB C;  3VYU A;  1B4O A;  3AU7 A;  2R3Z A;  3SVM A;  1R4Q B;  1SNC A;  4HMI A;  1ZYR C;  3CHB D;  3HGB A;  3J80 E;  2IX0 A;  3BDL A;  2A6E D;  3OOC A;  1I50 B;  2F0Q A;  1TY0 A;  1DJR D;  2JSO A;  2ID0 A;  1BOS A;  2BOS A;  4Y7N B;  4RA8 A;  1NUC A;  3K5N A;  1STN A;  2A69 D;  2KEC A;  2LS0 1;  2SNS A;  5HUR A;  1H9S A;  4DK1 A;  5D3D A;  1TR5 A;  2DNE A;  3MEH A;  2Z1C A;  2BDN A;  2OF1 A;  4ZKB B;  2F0F A;  3NQI A;  1DZ1 A;  1C4Q A;  4ME5 A;  3GQB A;  3AB9 A;  4XYO A;  1VF7 A;  1LTB D;  1Y8O B;  4KMU C;  3HOU B;  2YYZ A;  4RHS A;  1G2T A;  1PFM A;  2NUC A;  5FLX L;  1KNE A;  4RGO S;  5ELD A;  1LT6 D;  1TWC B;  4FXG C;  3OIP A;  3HOV B;  1W6K A;  3Q22 A;  1O7L A;  3MWY W;  1FNU A;  1ESR A;  1GUT A;  1Y69 U;  5KNC A;  3GTJ B;  2L0C A;  3FRP B;  5M5Y B;  4A3I B;  1J8I A;  5COY A;  4FO2 A;  1STH A;  3FVQ A;  3S1M B;  4RH6 A;  1S5F D;  4KTA A;  1GUO A;  4DXG A;  1ZKO A;  3BS1 A;  4F87 A;  2JYO A;  4C1N K;  4B9W A;  4FF3 A;  2EZV A;  4V0B A;  4MHE A;  2C9O A;  3NXW A;  3HEJ A;  3MAQ A;  3GV6 A;  4K8J A;  4PQX A;  1PZK D;  3GTQ B;  3BG3 A;  1NR4 A;  2J4X A;  1ENA A;  4K2K A;  1SSO A;  3BVG A;  3D3R A;  3BVZ A;  5AFW A;  4A3M B;  3C46 A;  1RF2 D;  2MPM A;  3I8Z A;  2Z4H A;  5KYL A;  1ILP A;  3E0J A;  4IAL A;  2B8F A;  3CRK C;  4B08 A;  2A74 C;  4S3S A;  1KLU D;  4OHJ A;  5I9O A;  5IIF A;  3OW7 A;  1HA6 A;  2KEE A;  4XQJ A;  2A68 C;  1G8Z D;  2XRQ D;  5FLX E;  3M7N A;  1BR9 A;  3D6W A;  2RA4 A;  2E2D C;  1DOM A;  3DEO A;  1STG A;  3ONA B;  5D3I B;  3RD4 A;  1A15 A;  1PRT B;  2B2V A;  5CBE E;  4LMQ D;  2XWJ B;  1LO5 D;  1EY7 A;  3QOJ A;  2PZU A;  4R9W A;  3I73 A;  4KKT A;  2E2I B;  2RDF A;  5KEE A;  1RJT A;  2QKI C;  1LTS D;  2SDF A;  4YIJ A;  1OXS C;  3MC0 B;  4ZK9 B;  2F0S A;  3IFT A;  2X6L A;  4HTH A;  4J6H A;  2OEO A;  2K5Q A;  2B2U A;  3JAM L;  5C4J B;  3OWE B;  2R93 B;  1R9T B;  5CV5 A;  3G7L A;  1AZQ A;  1ROD A;  1ILQ A;  2WP8 J;  4MN3 A;  3I4L A;  2F0H A;  3BVM A;  3VR6 A;  1HUN A;  1Y8N B;  3HS0 C;  1STA A;  4ZKC B;  1FD7 D;  1XYI A;  1QJO A;  1X32 A;  1WTP A;  4L8J A;  5LL6 X;  1EU3 A;  1YNJ C;  1BCP C;  4KK7 A;  5DM6 3;  4A3E B;  2BA0 A;  2K33 A;  2OXP A;  3TP6 A;  5C0X J;  2MJ8 A;  4CKE A;  5A2Q L;  3KBG A;  3W2D A;  1VF5 C;  4WRD A;  4G4K A;  1WTR A;  1F9Q A;  2AUK A;  3WOE A;  1YNN D;  5KND A;  4FXK C;  2EYM A;  3E5S A;  2PNR C;  1ZXT A;  4DAV A;  2KJX A;  1CZG A;  2F0U A;  5C4H A;  2TSS A;  3T51 B;  4A3D B;  3TSS A;  2CQA A;  2E74 C;  1O78 A;  2EXZ A;  1Y8P B;  2EYJ A;  3T16 A;  1WVL A;  2RQX A;  2J7Z A;  3NP8 A;  4ULL A;  4CKB A;  5EPJ A;  4QCL A;  2BE5 C;  4RHR A;  1F2Y A;  5CYU A;  2EJF C;  3MHB A;  1DOK A;  2TMP A;  2KHS A;  3URY A;  1QB5 D;  1D5M C;  1G6Z A;  1G2S A;  2KA7 A;  1WD0 A;  3DHQ A;  2HUG A;  1F2Z A;  3R2I A;  4OO1 I;  2R6G A;  4J8Q A;  2HDL A;  1VCI A;  3FPP A;  2Q8R E;  3MA2 B;  1WTV A;  2YU9 B;  4N9P A;  2IT1 A;  1SYB A;  3MXN A;  1SNM A;  4K2L A;  1KLG D;  5A2Q E;  2ICI A;  3C2P A;  1D5Z C;  4HN7 A;  2B2W A;  1D5X C;  3P1H A;  1T5X D;  1V43 A;  3M85 A;  2RBM A;  1KDA A;  2QDB A;  3KK7 A;  1GUW A;  4KN7 C;  1CK1 A;  2M00 A;  1EU4 A;  3H3V C;  4C1N I;  4KHZ A;  3VR3 A;  3PO2 B;  3R2T A;  1SE3 A;  2KED A;  2N88 A;  4H7B A;  1JQY D;  1D6E C;  1D2B A;  2NTS A;  1U4R A;  3E6Z X;  1PZI D;  3EA6 A;  1F77 A;  3Q23 A;  2BCO A;  1TY2 A;  2EE1 A;  2K01 A;  4BBR B;  5EGT A;  2QCP X;  4LAA A;  3DMU A;  4IN3 A;  1IL8 A;  3MFG A;  2KUM A;  3PMF A;  2A6E C;  4NDX A;  1HHV A;  3P75 A;  5EBC A;  2KOL A;  2A69 C;  3SK6 A;  2NN6 I;  4DFA A;  1I4X A;  2VB3 X;  5K36 G;  1JWS D;  1JB3 A;  4EQP A;  2JE6 I;  4BBS B;  1U4P A;  1B9N A;  1G29 1;  3NBI A;  1HQR D;  1BO0 A;  5M3M B;  1F2M A;  1TT2 A;  5FO7 B;  1F9P A;  2RDH A;  3ND8 A;  3TBI B;  1WTX A;  2B8G A;  4DU9 A;  4XIG S;  2B2Y C;  4AYB B;  1G91 A;  3NBH A;  1STE A;  5I6W A;  5DEH A;  3AMU A;  1A3V A;  4BA1 I;  3H0G B;  1BDO A;  3FDT A;  4ID6 A;  2HCI A;  2EJM A;  1SYF A;  1EY6 A;  3Q0A A;  4C3J B;  5NUC A;  1XXG A;  3ND9 A;  2L12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...