1G6ZA

Solution structure of the clr4 chromo domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
ISSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure, domain features, and structural implications of mutants of the chromo domain from the fission yeast histone methyltransferase Clr4.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords CLR4 PROTEIN
total genus 7
structure length 70
sequence length 70
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2000-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g6zA00
4NW2A 4R9WA 3FPUB 1ZXTA 3KUPA 4XDXA 2X6LA 4X3UA 4CJ1B 4IUTA 1ILPA 2KUMA 1CA6A 5EQ0A 2K03A 4OIKA 3N52A 2FFKB 1F9PA 1MI2A 1PFMA 3LWEA 1WTQA 1DOMA 1SAPA 2B2WA 2KECA 4IUUA 5T1GA 2B2TA 4RWSC 1WD0A 4IUVA 4ZKBB 3I8ZA 1QG7A 5CORA 1PFBA 2B2UC 2KEDA 4ZKCB 1WTVA 2FINB 1RTOA 1BNZA 2EE1A 1EIHA 1B2TA 4ZAIA 1WVLA 4HEDA 2B2VA 1HA6A 3KBXA 2FJ2A 4XT3B 3I3CA 4R8IA 2IL8A 4QUCA 2M2LA 1S4ZA 2KEEA 1ESRA 4RA8A 1BO0A 1RHPA 1WTOA 1G2SA 1LV9A 1NAPA 1NR2A 1U4RA 1X32A 1O80A 2MJ8A 2N55A 2RA4A 4MHEA 2B2UA 5DNFA 1BBXC 1PFNA 1IL8A 1X3PA 2MPMA 5EPLA 2B2WC 1WTPA 5E4XA 1ML0D 2HCCA 1Q3LA 1RODA 2VXWA 4IURA 3GV3A 1F9QA 1EQTA 1AZQA 1HHVA 1PDQA 5EPJA 1O7ZA 4OIJA 4IUPA 1A15A 2B2YC 1XX8A 2JYOA 3F2UA 1G91A 2SDFA 5T1IA 1DOLA 2R3ZA 4HSVA 2NWGA 1F2LA 3Q6SA 1WD1A 1HRJA 1JE4A 1AP0A 3TN2A 1HFNA 3QO2A 2L11A 1ICWA 3FDTA 1AZPA 3MWYW 4X3SA 1G6ZA 1SDFA 1KNEA 2EPBA 2FMMA 1DOKA 4MN3A 1JICA 1MSGA 2J7ZA 1WTRA 4O42A 1IKLA 1WTXA 3DEPA 2Q8RE 1ILQA 2K01A 1EOTA 1CA5A 2B2TC 4RAUC 2RSOA 1GUWA 3G7LA 1QNKA 1J9OA 4LMQD 2MGSA 4IUQA 2X69A 2L1BA 3H91A 5COYA 1MGSA 2KVMA 2B2VC 2RSNA 1EIGA 3MTSA 3GV6A 4XT1B 1EL0A 4HAEA 2HDMA 3SVMA 2DY8A 1U4PA 1HFGA 2MP1A 1HUMA 2K05A 1SSOA 1U4MA 5CBAE 1B3AA 4X3KA 1G2TA 1RJTA 2B2YA 2DY7A 2JP1A 1U4LA 4CJ0B 1HUNA 3I90A 5EKIA 1NR4A 1VMCA 3TZDA 2X6GA 3DM1A 1B50A 4CJ2C 1J8IA 1X3QA 1IKMA 4U68A 5EPKA 1C8CA 2K28A 4ZLTF 1NCVA 2L9HA 4QUFA 1O7YA 5JJZA 1DZ1A 1B53A 4HCSA 1XYIA 1WTWA 1RTNA 3I91A 2D9UA 5D14A 5EJWA 2Q8TA 2L4NA 4UAIA 1F9SA 2FHTA 3UI2A 5E4WC 1KNAA 1MSHA 2K1BA 3R93A 4ZK9B 1E0BA 3IL8A 3P7JA 2HDLA 1M8AA 1PLFA 2L12A 2XIWA 1TVXA 2RVLA 5CBEE 5D65A 1QE6A 3D6WA 3IFDA 1BF4A 1VMPA 3HP3A 2N88A 3ONAB 1DONA 5CMDA 2BDNA 2HCIA 2EOTA 1CM9A 2NYZD 2H1EA 4X3TA 2CVRA 2HUGA 2K04A 4DN4M 5AFWA 2KOLA 1F9RA 2NZ1D 1B4OA 3DEOA
chains in the Genus database with same CATH superfamily
1Z6HA 4DR6Q 3C2PA 1QUQB 1W6JA 2HD3A 3KUPA 4RCNA 1VQKA 4AYBE 2IX0A 4KKUA 1CFMA 5EQ0A 4DK3C 4Q5VA 2O5JC 4ZUIA 2R92G 2EXZA 5C0XI 2XRSD 1IBMQ 4JPBW 2RKSA 2B2UC 4GLVB 4K5WA 4GOPA 2VNUD 1EY0A 3QWNA 2NVXB 2WKCA 4APVA 4HEDA 3S1NB 4JI0Q 1PTOH 1JORA 1SMXA 4H0LC 4R4TA 2CH4A 5IP9H 1IXRA 1M4VA 1HTLD 1WTOA 2B2UA 1SYDA 2B2WC 3QB3A 4IQZA 2A6HD 2TMPA 1E2WA 1F2MA 1BXTA 1SMYC 2ASBA 2PZWA 5HURA 3T1HL 3NEMA 3RMHA 1K8OA 1I4GA 4BY7H 3EJIA 5JJIA 4FF1A 4A3CH 1UE6A 1V1PA 1V1OA 2UU9Q 4DR4Q 1P16A 4GNXB 1G6ZA 2BE5C 4B3TQ 4A3GH 4C3IG 1PH3A 4O42A 5H1SE 3KLSX 1QVFA 2Q8RE 1GHJA 1EOTA 5FO9B 2IW3A 5CV9A 3OW2A 4PV1C 4BY1B 3S14B 1IBLL 1SR3A 4YIJA 3TQYA 1D2BA 4B3RQ 1I4RA 3ITPA 2E2DC 5ELBA 2K05A 1LTLA 1CI3M 4GKJQ 2A19A 3NP8A 1SYEA 1KAWA 1L0YB 2OF1A 3EROA 2UUCL 1NY4A 4BBRG 3OMCA 3OIQA 1EY6A 1I94Q 3GTJB 1HZAA 5JEAJ 1TIID 3RZDB 1XPUA 2E76C 3G6JB 3EA6A 1K8GA 1YIJA 1LT4D 3OW7A 4KD3A 4X65Q 4UPAA 3I55A 2JJQA 4QL5A 5D65A 2ICEC 2JA8H 3LGJA 1JB7A 4JI7Q 5C4JH 1EWCA 2HCIA 4V0BA 3C1FA 1CM9A 4ZYSA 3D3RA 1J6QA 2EZVA 4DR2L 2LSSA 1E1TA 3I4LA 3GD7A 4I7ZC 5I4DA 1OXUA 1SYGA 1KD1C 3PQIA 3UE1A 1EUJA 4OIKA 4J1MA 2ZTEA 3N52A 3ZYYX 1CZGA 1OXSC 2VUMH 3RZDH 1TWAH 1I4HA 1L0XB 1N36L 3MFGA 1EIHA 4FNFA 2CQAA 4KI0A 2MUYA 1SYFA 4FP5D 2A8VA 5ELNA 1STEA 4L5SA 4JW0A 4P72A 4CJ0B 3O13A 2FMCA 4DNRB 1D7QA 1HCZA 2DUDA 4TKOB 1BCPD 2F0TA 1PH7A 3I4NH 1HHVA 2ALYB 2WACA 2GA4B 1CSPA 1DCZA 2DNEA 2DGYA 4BY1H 1QJOA 4R4OA 5E7NA 2PI2E 4KD4A 1FJGQ 3OMGA 2UXCL 1NMFA 5EGTA 5EKLA 1N8RC 3MXNA 5CV6A 5C44B 3HOYB 4MN3A 2EYOA 2RQXA 3GTPH 3J80L 2K01A 1S5FD 1FGUA 5IP7H 1V1QA 1B8AA 1AFPA 4R4IA 1TQOA 1HR0W 5LL6X 4XT1B 5FO7B 1QNUA 4WJWA 2AMCB 4FDBA 2OQ0A 2WB1B 1IBML 4LFAQ 2OT2A 4XYQA 1ASYA 3TMEA 1VF5C 3KF8B 3CCLA 2JA5G 1IKMA 3J7AF 1C8CA 5IE8A 2B39A 2F0MA 1LYLA 3UDXA 4B9WA 5IT9E 1QZHA 2A6HC 1I4PA 3OOCA 3U58A 4OHJA 4ZK9B 1F9SA 4LF7Q 3R8BA 2CW0D 4CDFC 2XIWA 1EY8A 1JCKB 1VQ9A 3ONAB 4BWGB 1DONA 3S14H 3HOUH 2JK8A 4J8QA 3VYSA 1U0LA 3FKIG 3D4DA 2CVRA 4K6DA 4EQPA 1NBWA 4JI6L 3Q22A 2AWOA 3K7UC 4XQJA 4QJFA 1WTXA 2JA8B 1RIPA 4R9WA 4CJ1B 1HZ9A 1I6VC 4G57A 4PMWA 3KF6A 1WTQA 1E24A 3I7FA 3A0JA 3CQZH 2XN9C 2E2IH 5JVH3 3I8ZA 5IOCA 4V190 3UE0A 1MKHA 1TS3A 1PTOC 1JWSD 1K83B 5DM63 3TS2A 1RL2A 2YTVA 2XSCA 1TY2A 3J80i 1NUCA 1U5KA 5TSSA 2K7VA 4EQNA 1BBXC 4KY5A 2OXPA 3T1YL 2BH2A 1PFNA 4DV5L 4HIKA 3EQLC 1ASZA 1STGA 2ZXPA 3D4RA 1F77A 2YU9B 1AZQA 1V9PA 1X54A 2I5MX 1STHA 1GUNA 1VQFA 1KXLA 5T1IA 1TWCH 4JBJA 2K50A 5M5YB 1S3OA 2Z6BA 1AZPA 3MWYW 1YZ6A 1VQ7A 3NTKA 3CC4A 3OTOL 2JA6G 1SN8A 4ALPA 3K5NA 1OTCA 3CMAA 2K5WA 1QUQA 5J22A 2B2TC 3VA5A 1Q7YC 3QOJA 4U673 3QG1A 3A8JE 2JEBI 3NHHA 4L5RC 2GVAA 4ZCKA 2LKVA 3MA2B 4A3FG 2MP1A 1SSOA 3K7AB 1KTKA 4DR6L 1IW7C 5CBAE 4LFBL 4DV0L 1DYQA 2LS01 1E1OA 4EX5A 1F2YA 2EY1A 4J15A 3K8AA 3TZDA 5FLMG 3S1MH 1YNND 3E0JA 3T51B 3S1QH 5IGEA 4RGNA 1RD9D 4DXGA 2K5NA 5GAGC 5JJZA 1B53A 3K80C 5M3FH 2D9UA 4C3HB 5D14A 1WYDA 3RZOH 1E2VA 4UAIA 2R92H 1SNCA 1KNAA 4DV5Q 5CV5A 1VMPA 2K5QA 2ZJPA 3F8TA 2UUCQ 3H3VH 4BBSG 3ULLA 3NK9A 1OXXK 3BG3A 1VF7A 4WORA 4H7BA 1A8VA 4JCVE 1ET9A 2RF4A 4P71A 4RFBA 4B3RL 1N34Q 5IT9L 4PMBA 3H94A 1G51A 5FJ8G 4DV6L 2FFKB 2Z0SA 1VQ4A 4X6AH 4IUUA 2F0FA 4MIUA 3CU7A 4FXKC 5IYBG 2I5HA 4PMCA 1LACA 2R93G 5D3IB 1QVGA 1LO5D 3Q8DA 4DUZL 5CR3A 1FNVA 3ULPA 2IL8A 1B3QA 4QY7A 1VQJA 3K0XA 3I2ZA 4M1UB 4DV4Q 4RGMA 1K0SA 1X3PA 3H0GG 2MPMA 1WTPA 4YY3L 1UE1A 3HOVH 5C5LA 1JOOA 2DNCA 3S1NH 2E2JH 2VQEL 2SNSA 2A69D 1PXUA 4C3IB 1G91A 1LLRD 1S5ED 1Z7TA 4A3LH 4DFAA 1XNQL 3Q6SA 2FXQA 2F3WA 5ELOA 2UXDL 1HNXL 1HFNA 3A54A 1GOZA 4P74A 2EPBA 2EIFA 4KKTA 4DAVA 4FF2A 3HOWG 4QMGA 4DV1Q 2Z4HA 3PUZA 1PH9A 4RAUC 3JAME 3T16A 4CHTB 1EY4A 1VQBA 2LY7A 2QDLA 3CHBD 3PCOB 1II3A 3S2DH 2DJFC 4FVMA 1S5DD 4RHRA 3OTOQ 2VY3A 1RKNA 2B63G 4HTHA 3L2PA 1RJTA 4GN5A 2F0LA 2G9HD 4PZ8A 3CPWA 1HUNA 3E9HA 4A93B 4RMFA 4JI8L 3L7ZC 1N33L 1PH6A 1K9MC 1DZ1A 2B63B 2L0CA 3TP7A 3K57A 4A3KB 3S1MB 1VQHA 5IWAQ 4Y7NB 2I07B 1YNXA 5C44G 3HOYG 2HDLA 4DR1Q 4BS9A 5C4HA 1GUOA 1D5XC 4X64Q 5FLMH 1OXTA 2MQHA 3JAMc 2EOTA 4K8IA 1EQRA 1YVCA 2Q2HA 1EIFA 2O2LD 4LW1A 1JE5A 2BA0A 2I46A 2E74C 4KHPL 1BOSA 4NP5A 4A3MB 1XMQL 4HSPA 4LFBQ 1B9MA 2JE6I 5LMUL 1PFMA 5M5XH 1DOMA 2KECA 2B3GA 3PIPA 1Q1BA 4IUVA 4ZKBB 1E7ZA 1KRTA 3D6CA 4JI6Q 5G3LD 3CC2A 2BCOA 3E5SA 4DF7A 4KJNA 4WJ3M 2F0KA 4XT3B 2MO0A 4I7AA 3OYYA 4KMUC 2VQFQ 2ZXOA 3SGIA 1KRSA 2HHHQ 1U4RA 5IYDG 4QIWB 2A5HA 1YJNA 4Z9CB 2AQ1B 1BVSA 1FR3A 1BKBA 1IYVA 1BUVT 2R93B 4BXXG 2GN5A 1K73C 1VQNA 2OWOA 1LUZA 3P20A 1SNPA 4TSSA 3JAMi 4ZQ3A 2NVTB 5M3MB 3I72A 4A93H 3D0FA 2IWHA 1JJCB 1VQ5A 3T1YQ 2QF7A 1ICWA 3FDTA 4DAPA 1VQPA 4KHVA 4LUVA 1SDFA 2QDBA 3HKZB 4X66L 2R7ZB 5L37A 4BBRH 4HJ5A 1BCPB 3CAMA 3QOLA 3NQIA 3SXHA 1M1KC 3S15H 1HR0Q 1YJ9A 4LF8L 2R7DA 3TP5A 1TS5A 2K6AA 4HCEA 5JPNC 1IBLQ 1EIGA 5FJ8H 5IGBA 3SVMA 1N34L 4BY7G 2E75C 5KNBA 1QOHA 2JP1A 2KCCA 3I90A 1B50A 1S40A 1GHKA 4DV7L 4C3IH 4IUNA 5HGTA 4C1NI 1WOCA 3RLFA 4JBKA 3BDOA 1JJ2A 1YNNC 3EBEA 4QGUA 1XTCD 2OCEA 2NVQH 4HIOA 5C0XJ 1E0BA 1F2ZA 2BDOA 5ELEA 2C5CA 3U4ZA 4B08A 4LF7L 1EWHA 2Y0SB 2B63H 4L8JA 1HNZL 2SEBD 4L63B 2UXBQ 4R4CA 1YHBA 3VR3A 2E5LQ 1Q46A 4YWMA 5C3EH 3NBHA 4NW2A 2PQAA 3J7AV 2KUMA 3VR4A 2K03A 2ATWA 1C9OA 3LWEA 2Q8IB 3KLWA 4RWSC 1KHIA 5IGCA 3R2TA 1XTDA 2KEDA 5IODA 4JC0A 2D5DA 4KHPQ 2R7ZH 3KBXA 4R8IA 2K32A 1ESRA 3I4NB 4UY8C 2H5XA 2EVBA 1LV9A 2RA4A 3ULJA 3A56A 5EPLA 5KGUA 4LF4L 4GNXC 1RODA 1GVPA 1LTBD 3GV3A 4N8X1 1HXYD 2NN6G 2XVSA 3PO3H 1EY5A 2ZM6L 1CSQA 3M4QA 3URYA 2VUMG 3FP9A 1JC7A 1LT6D 4A3FH 3S9WA 1YNJC 4PQXA 3S16H 3TN2A 2B8FA 1TWGB 1PA6A 5ELCA 1DXMA 4A3DG 2FMMA 1MSGA 4POFA 1NMGA 1A3VA 1ILQA 2MFIA 1TWFH 3C46A 1PFSA 4JI5L 4FF3A 1Y69U 1L0WA 1PH8A 5M3FG 5M9OA 1TR5A 1MIUA 5IYCG 2KVMA 1SXTA 1PVOA 1IYUA 2VB3X 2EY2A 4HR7B 2TSSA 5FOBB 1O78A 4A93G 4A3MH 1DGSA 3J80c 1B3AA 4JI1L 3ND9A 4MZ9A 3DHQA 1LABA 2X6GA 1R9TB 4MTNA 2F3VA 1KDAA 3HKZE 3WDNA 2PW5A 3HKSA 5CV4A 2ZJQA 1H9KA 1VQCA 1Y14B 2N8NA 4CDEC 1UEAB 4PNYA 1Y8PB 3A8KE 1HH2P 1PLFA 2RVLA 1NNXA 1AW7A 5I2XA 1A3UA 2HHHL 3KFUA 2MHVA 1V1PB 3ZJYC 2ZM6Q 1X55A 3A55A 1CUKA 2IJ0A 3HG9A 1KABA 4LF9Q 2ZTDA 1D1KA 3RN5A 4F87A 2PMZB 3HS0C 4A3GG 3CCVA 4HMIA 1EFID 3G71A 4XDXA 5EAYA 3K7AH 3J81L 3J81j 1WFQA 3S2DB 4A3GB 2IY5B 4B9XA 4C2MH 2V4DA 3G4SA 1JMCA 2KBNA 4QF4A 2F0VA 2NBFA 4POGA 2XWBB 1I50B 1SJED 2A6ED 2WB1G 4DK6C 3NELA 1EY7A 2EJFC 4JOIA 1GM5A 5JJKA 1TU2B 3P1HA 3NQTA 2K5HA 1J5EQ 3MEFA 4IURA 2QILA 4ME3A 4Q0FA 1KLGD 4A3FB 3E0EA 3S17H 2ZXRA 4GLXA 2SOBA 5BN3A 3TRZA 5I6WA 3FVQA 1AP0A 4H02A 3J81i 2HIXA 1KNEA 2PPBC 1JICA 4NXNQ 1Y1VB 1PHJA 1HTPA 2VZAA 4C3JH 4G7ZC 1Y8OB 3GDEA 2X69A 3NENA 5FLXL 1MD2D 2O5IC 2PQAB 4YCVA 2SNMA 4ME5A 2F0QA 2IHFA 4KTAA 2QEJC 2JA7G 4KK7A 4DR7Q 5AJ3L 4GLAC 1R4PB 1C0AA 1HR0L 3HOZH 1R4QB 4CJ2C 2KHIA 4LF6L 1J8IA 3MXPA 1X3QA 1VQMA 3KDFB 1O7YA 2CFMA 3X3MA 1AH9A 4P2CB 2WIIB 2L15A 3E6ZX 2NVYH 3MXGA 1GUSA 4YY3Q 3PUXA 4DR1L 2RDGA 3UI2A 5E4WC 1EYCA 3CCSA 5IWAL 4DKAC 2F0IA 1G291 3PF4A 1TVXA 2NVQB 1PRTF 2L55A 5BN4A 4QIWE 1V43A 3BS1A 4UP9A 3F2BA 3S1QB 3S17B 1FNWA 2PO4A 5EBCA 1LM0A 4X62Q 1H95A 3VR6A 3H15A 2E2HB 3U4VA 3RD4A 3FPUB 4X3UA 3RR5A 1ILPA 1CA6A 1KL9A 4OXPA 1UE7A 4DR7L 4A3JB 2QKIC 4LUOA 5G3LF 1WD0A 4DK1A 4ODGA 2EYMA 5CORA 2OTLA 3UDFA 1TWFB 2KCNA 1FGBD 2OTJA 1S4ZA 1C4QA 1TS4A 4DR5Q 2RDFA 4C2MB 2PZUA 5JEAG 1DD2A 1FL0A 1EU4A 2ZJRA 4A3BB 2P5ZX 4WFN3 4QQBX 3V96A 2CCZA 3S16B 1O7ZA 4OIJA 1L1OB 1ET6A 4ULLA 2NN6I 2HT1A 2C35B 4JG2A 1QZGA 3RUZA 3H6MA 4ID6A 1CKNB 3PIP3 4TVAB 3WWVA 3GTMB 4JI4Q 4R4QA 4MNOA 3GTKB 4DV3L 1SE3A 1E22A 5M3MG 3KOJA 4UP7A 4AQYL 3GTOB 4IN3A 1WTRA 2EDGA 1K83H 1PV4A 2F4VQ 2A1AA 2DN8A 3EN2A 4LFCL 2E2IB 2MGSA 2ZT9C 3H91A 1DM0B 2K4KA 4K14A 1XMQQ 2B2VC 4A3EH 3GV6A 3MHBA 2JEAI 2D62A 2DY8A 2A6EC 4F88A 1RDPD 2QW7A 4A3LG 3HEJA 4NXNL 1I6HH 3I4MG 4X3KA 2KCTA 3IFTA 2B2YA 1U4LA 3FEWX 2Z6KA 1FYCA 5C3EB 1PYSB 1TXYA 4HIDA 1YITA 3HOUB 3PIOA 4JI3Q 2K28A 1NCVA 2RBMA 3WOEA 2XNAC 4LUZA 3GTGB 2L4NA 1SYCA 1PRTD 2XWJB 3DM3A 4A3EG 1BBWA 3IRBA 2EYPA 2I5LX 2OEOA 3K81C 4JI8Q 2AWNA 4ZRZA 2H1EA 5KEEA 5AFWA 3ER0A 4DA2A 2NZ1D 3SK6A 3M4YA 2XRQD 4K2KA 5IP7G 2KHSA 1LTSD 1T9HA 2V1CC 1A63A 1Q1EA 3T13A 4KN7C 1Q81C 1PTOD 5IYBH 2WV6D 3JAML 2H4OA 2BOSA 3K5OA 1Q90A 1PFBA 1ZEQX 3TDQA 4LF9L 1WTVA 1BNZA 1KLUD 1B2TA 1D6EC 2ES2A 4G7OC 4JI5Q 5J3BA 4N8FA 3L0OA 1SEBD 5ELDA 3ICEA 1HA6A 4FF4A 3I3CA 1KIXA 3PUWA 1WCMB 3I56A 1K3BC 1STYA 2UXDQ 3PMFA 1TWHB 1G2SA 1NAPA 3D6WA 3TBIB 1YNJD 3HOVG 3J80E 1UNSA 5E4XA 1Q3LA 2VXWA 1CKOA 3BVZA 3SK4A 4BY7B 4K5VA 4IUPA 1Q8IA 2AQ3B 1XX8A 2F0PA 1LTGD 4HSVA 1WD1A 1HRJA 2F3IA 4BBSH 4A3IG 4L5QA 2OQKA 3HOXB 1PTOB 3H0GH 2EYLA 3E9IA 3EFXD 3TS0A 5LMNL 3T4AC 1N33Q 1QNKA 2WAQB 5IIFA 1B7YB 3EVQA 3PGZA 4KLKA 3MTSA 4K5XA 5ELFA 5M5XB 1HQRD 3D4WA 4A3KG 5KRUA 5C4XH 1K0RA 1G2TA 1BDOA 1B70B 3AEVA 2VL6A 3DM1A 3FKIH 1Y1WB 4CDCC 1Q82C 4KN4C 3F2CA 1NSNS 4ZLTF 4AIMA 5JEAH 1CK1A 4HCSA 2O4XA 1RTNA 4BBRB 2B29A 2K75A 1WJJA 3UDGA 2RHSB 2FHTA 1MJCA 2WKDA 3NWSA 2K1BA 3N6RA 3IL8A 2IX1A 1I5FA 1OXVA 5E1FA 5CBEE 3GTJH 3T53B 4S3SA 4C3HH 3A7LA 4Y52H 4IFDI 2NVTH 3NWTA 2VQEQ 1I94L 3RNUA 1H9SA 2EQSA 3J81c 1JQYD 4A3JG 5LL6S 3A8IE 1H9JA 4KY6A 4CKEA 4JI2L 1KAAA 2IPKD 3V2TA 2ZTCA 1O7IA 1VQOA 3D31A 5C3XA 1ZYRD 5KYIA 1BR9A 2B2WA 2B2TA 4A3IB 4IZ8A 1EWIA 5DM73 4LF8Q 3SK5A 1NJIC 3I4OA 1HNWQ 1QB5D 2A69C 4QUCA 1BO0A 1CKMA 4QB4A 4BA1I 1SFOB 4UDUC 1Q12A 1C48A 2K5DA 2MNAA 4A3JH 4NMZA 3VYUA 4FXDA 1JOQA 1SNMA 1HJPA 4OWWB 1EYGA 1SBBB 3CCUA 1I3QH 2E2HH 2B2YC 4NXML 1Y1VG 2SDFA 3LX0A 4DAYA 2F0HA 2NWGA 4HIMA 1A62A 2F03A 1A2TA 4K2LA 4JI3L 4IPCA 3RLOA 4CDDC 2R7ZG 3I73A 1DOKA 1GUGA 3KLRA 2F0DA 2JA5H 1B9NA 4LNQA 2NVXH 2NVYB 5JPMC 2F0SA 5FLXc 1XMOQ 4DU9A 4L6TB 2JA6H 4IOAA 1GUWA 1IYJB 5JVG3 3BZDB 4LMQD 3S2HH 1HNWL 1MGSA 3PO3G 3F1ZA 4DR2Q 3K0YA 5BR8L 4DAMA 3F2DA 4OO1H 5LMUQ 2QEXA 5I9PA 2KA7A 3CRLC 2N3SA 2Z8LA 3CCJA 1EEID 4IFDJ 4NDXA 5IGDA 4K0KQ 4LWCA 3B6YA 2UXBL 2WINB 1XJVA 4MTKA 4N9PA 3QIAA 4G7HC 2E5LL 3KDFA 3OIPA 5C5MA 3ERSX 3I91A 1LT5D 4PZ7A 4C3JB 2F0EA 4PZ6A 2UXCQ 1LT3D 4UHVA 3K59A 1D5MC 1QE6A 1X56A 2K5VA 2WFWA 3QJYA 4ILWA 1EOVA 4IFDG 5FLXE 2JA6B 2E2JB 2G9DA 3BYTB 2PYKA 5I2YA 2G5DA 3L9AX 5BR8Q 4H13C 1ESFA 1PTOF 4OWXB 1IL2A 4FO2A 1JR0D 3W3AA 5T1GA 3M85A 5LMNQ 1XMOL 1SE8A 3OPOA 4OELB 3CRKC 3UDIA 2RCNA 1I3QB 3J7A5 4GZYC 4YWKA 2B2VA 1AEXA 2F52A 1GUTA 2I0QA 1JJGA 2F0JA 1XNRQ 3TREA 3NTHA 1CT1D 1X32A 1EU3A 4KY7A 2M00A 2N55A 2NTTA 1CZWA 3LWUA 5CC4A 4LF5L 3FMCA 1IL8A 3D8GA 5M5WH 3M9BA 4GS3A 4JK1C 4O2DA 1SLJA 4KKSA 1F9QA 4I65A 4O0AA 1SYBA 2WP8J 1IBKQ 1DOLA 4JYAL 4A3DB 2R3ZA 3S1RH 1JE4A 5DEHA 5KNDA 2L11A 3K6OA 4TRDA 2J0TD 1VQAA 2A73B 3BDLA 5M3MH 3J81E 1AE2A 5M3FB 3DEPA 4LFAL 5KIXA 4DV0Q 3GTMH 3GTQB 4QCLA 4DV7Q 2Q2IA 1ZYRC 3G7LA 1N36Q 1ENFA 3JC66 4IUQA 2L1BA 5COYA 1KC8C 2Z1CA 3E3XA 1H9RA 2EJGC 3GO5A 1R9TH 1U4PA 5DLQE 2BH8A 1VQIA 5CV7A 2EY6A 4A3DH 1A6XA 3I4MH 1W3SA 5LHY1 1XNQQ 5I9OA 1L1OA 2YTYA 4GKKQ 1LTAD 1XPOA 5C0XG 3DUZA 1UUPA 2JA9A 1PH1A 4ZUJA 3TP8A 4LF4Q 3T56B 3WOFA 1G8ZD 1BF4A 4NXMQ 3Q23A 5CMDA 2BDNA 3NSWA 1YJWA 1S5CD 2Y0SG 1IW7D 4A76A 5FO8B 4DR3L 2YYZA 1N32Q 2X6LA 4RHSA 4IUTA 3M3YH 4DK0A 3GQBA 3NBIA 1KDCA 2F0NA 4HMJA 1NE3A 4RGTA 1RCVD 2QA4A 3CPFA 4AYBB 2XGTA 3MXUA 4L5TA 1EQVA 3NBHB 1BBUA 1SE2A 1C7YA 4KJOA 1T5XD 5IGFA 1D1IA 3U50C 5K36H 2KEEA 4KHZA 4RA8A 3SR1A 1RHPA 5FK9C 4MHEA 3S24A 3BDCA 4DUYL 1XWEA 4OEMB 2KCMA 4GOPB 3BZCA 1Y8NB 1VQLA 3J7ZC 3MVVA 3ND8A 3RLNA 3H09A 3RN2A 1PH2A 2PI2A 1A15A 3F2UA 3KK7A 4P75A 4P73A 2RCFA 4DV4L 4DR5L 3GTOH 3G6EA 4JI1Q 1PZKD 3HZXA 4DPGA 1S72A 4NB3A 1W6KA 2JSOA 2Q2TA 3CXCA 4IJHA 3SK8A 4R1JA 1IZ6A 3HOXG 2JA5B 4DUZQ 2RSNA 4IPHA 1EY9A 3G48A 1AE3A 2C9OA 1HFGA 1U4MA 1X65A 2EYFA 1AN8A 1PH4A 1ICFB 3GTGH 1HPCA 4GN4B 5EKIA 4DV6Q 2PQEA 1BQQT 4C3JG 5C0XH 1I50H 4HJ9A 1Z47A 5EPKA 5EKKA 5BN5A 3HOZB 5C4JB 1PZID 3MAQA 2UU9L 4B3MQ 3R93A 3Q0AA 3C1EA 1TT2A 3DWPA 4PG3A 3HP3A 1TWCB 2JA8G 4GKKL 1GO3E 2NYZD 3IKJA 2YU9H 2HUGA 4DN4M 2KOLA 3BVGA 2K33A 4UP8A 4CGYB 3KJOA 1Q8KA 4RKLA 5HY6A 4DNTB 2Q2UA 4IPGA 1CQFA 2VQFL 3BZKA 3GTLH 2EYHA 3GTKH 1EYDA 1F9PA 1MI2A 4K6LA 3W5OA 1SAPA 4XTCS 3AB9A 2BA1A 4CBVA 4DV2Q 3OHXC 3AMUA 3FPPA 1RTOA 1ENAA 2NB0A 4ZAIA 1VQDA 3LNNA 1TWAB 1TS2A 2FJ2A 1EYAA 2VUMB 4JI4L 5C6AA 1NR2A 2PMZE 4F7XA 5HGQA 1HNZQ 2AUKA 1K8MA 1ML0D 4OWTB 5EPJA 2N78A 4JYAQ 3NTIA 1MBYA 4XXEA 1NTGA 2EY5A 2K14A 4CKCA 4YWLA 4BY1G 1MJEA 4B3ML 3I4MB 4HJ7A 2PZTA 2Z9HA 1EZ8A 5M5YH 4DNIA 4GNXA 1TWGH 5CGKA 3K5MA 5IYDH 3FHWA 4LF6Q 3SEBA 3H0GB 4OGQC 3J7YW 3VYRA 1PRTB 3SDZA 3TSSA 4EQ5A 3CMEA 4WRDA 1P8LA 4LAAA 4RH6A 4B3SQ 4GOPC 2NTSA 3KBGA 3KYHC 4C3HG 4ABNA 1VDZA 4JV5Q 5GAEC 1G6PA 4YHHQ 3DLLA 1M90C 3I70A 3HOUG 1I4QA 2F4VL 4B3TL 2MO1A 5KNCA 3S1RB 5C3EG 4IALA 4JI2Q 5A2QE 5J39A 1QVCA 5GQOA 3FRPB 3K5LA 2KJXA 4DAYB 1XYIA 4A3BG 1JB3A 1WTHA 2JA7B 3CCEA 5C44H 3HOYH 1XPRA 1TWHH 2HIVA 1UEBA 1WCMH 3NXWA 2B8GA 3BU2A 5J1ZA 1XXGA 4HN7A 2N88A 2CQOA 4BA2I 2K52A 1H9SB 4HJ8A 1D8LA 3CCQA 1K28A 4OONA 1B4OA 1X3GA 3R3OA 1ZXTA 3BYYB 4XQNA 4LK1C 1STAA 1O7LA 1SNOA 4YHHL 3A5UA 2UUAL 3HKZG 1ZKOA 1N9WA 2CHBD 1A0IA 1KDBA 3DXJC 4O1NA 3VDYA 1RF2D 2FINB 3STBD 5GADC 2EE1A 1ONLA 2CW0C 1WVLA 2DJGC 4HJAA 1Q86C 1K8AC 1VCIA 3CD6A 1O80A 3AFPA 1CKNA 3AYHB 1SROA 3CC7A 5IY0A 5KYLA 2HCCA 1B44D 2A68D 1LTID 1E3PA 4YCUA 5D3DA 1X3FA 2Y0SE 3AQQA 4FYDA 5ISRA 2N49A 5NUCA 5K5PA 1YBYA 3C3LA 1VQEA 3M4OH 1VQ6A 3HGBA 3H3VC 3U9OA 1W2BA 4X3SA 4A3EB 3PO2B 2AKWB 2Z4IA 2E8GA 1HZCA 2VS1A 2WB1E 3KJPA 2L5TA 3PIO3 2R92B 1STBA 2CH4W 3RZOB 1STNA 2XTIA 3HFZB 4LJZC 1CA5A 3S2HB 1A3TA 3A7AB 2PNRC 1I4XA 3DWQA 4JI0L 4BXXH 1J9OA 2QGQA 3MZ5A 2NN6H 3OWEB 2R93H 4XQQA 4A3CG 1HA5A 3OSOA 4CKBA 1HUMA 3M3YB 5IT9c 2PNHA 2UUAQ 2DY7A 4IFDH 1FD7D 1VQGA 3L3OC 2F0WA 3VA7A 4DV3Q 1A2UA 1UE5A 4JI7L 1NR4A 1VMCA 4DV1L 4IO9A 3DMUA 1YEZA 3KF8A 3DWAA 3R2IA 4C1NK 4J6HA 4R8NA 2AHOB 5M5WB 3NPPA 1BCPC 1FJGL 1YHAA 2D0OA 3P7JA 5C4XB 1SFOH 1VS0A 3ERQA 1GKHA 4A3MG 1IBKL 1GD7A 3BJUA 4DGZA 3IAYA 1XNRL 4X3TA 3U9SA 3PF5A 2LXJA 4KV6A 1T5EA 4XIGS 4IOCA 3TZUA 4A3IH 4B3SL 4GN3B 4NPSA 1IHZA 3MXNB 5C3WA 1JOKA 3HOXH 4GKJL 4JV5L 4E6IA 5FKAC 4OO1I 1OO9B 1PYBA 3CW2C 4TQUS 2R6GA 4A4IA 1L2FA 1PYWD 3V05A 2M9VA 1QG7A 5DAUA 4ZKCB 2IX3A 1LTTD 4X62L 2NUCA 1GXDC 5IGGA 2NZOA 3GTQH 1X3EA 5GROA 4JBWA 1GJXA 3PUVA 4DR3Q 2M2LA 1KQSA 1E2ZA 3W1GA 1PRTC 2MJ8A 4AQYQ 5DNFA 3HOWH 4DR4L 3PO2H 4M8AA 3A74A 2KENA 1QWYA 1SNQA 1EQTA 3PSIA 1PDQA 3QR8A 1Z9FA 3M4OB 2JYOA 3S15B 5CV8A 1Y1WH 1QCBD 2UUBQ 5JOBA 2J4XA 1SE4A 4G4KA 3HRZC 1UWVA 2F0OA 3HOWB 3AFQA 1SJHD 2NZHA 2J7ZA 5F2DA 3TEHB 4OL7A 5E3FA 1SNDA 1MHWC 3SHLA 1PZJD 2CKZB 4DXFA 4DV2L 1Y1VH 1UAPA 2F4IA 4C56C 2WAQE 4OO1G 1EL0A 3M7GA 2HDMA 2ICIA 2YTXA 4BBSB 2RDHA 4Y7NH 1SMYD 5CYUA 2KHJA 2GVBA 4X64L 3K58A 1B1ZA 2ID0A 4U68A 2L9HA 2QCPX 4RCOA 2LMCB 4QUFA 2A68C 1V8QA 1WTWA 2VW9A 2R7FA 4IPDA 5EJWA 1EIYB 4AYBG 2BE5D 1PMRA 3GTPB 1K3RA 4JVZA 3P75A 4EQOA 1MSHA 4X65L 3I4NG 4H44C 5A2QL 2L12A 2AUJD 2IHEA 2JA7H 2PW7A 2Z6KC 1J5EL 5K36G 5C4ZA 3T1HQ 1EZ6A 2EXDA 1U9RA 1BCPF 2F0UA 2K04A 1ENCA 1QILA 1JWUD 2EYJA 4OX9L 2HQLA 2D0PA 1FVIA 1CTMA 2VB2X 4YCWA 2ENBA 2F0GA 3NUCA 1X9NA 4JBMA 3CP0A 1EFWA 1HZBA 2RHQB 5AJ3Q 4A3KH 2CWPA 3CF5A 3OWFA 1H9MA 3PV0A 5IYCH 5A35A 2JQOA 4K8JA 3PUYA 5JJLA 1D5ZC 1YI2A 1PH5A 3X3NA 3HOVB 3MFYA 3STBC 1HNXQ 5EBDA 1DJRD 3NE5B 1LTRD 5IP9G 3CCMA 3GP7A 1CQVA 1CHPD 2IT1A 1EEFD 2F1MA 1SRUA 1Y1WG 2JN4A 2CWAA 1HQMC 2KQ3A 3KLSA 3FKIB 5JAVA 2UUBL 1F2LA 3W1BA 5GAHC 3QO2A 2D2CC 1JWMD 4IJLA 4F8MA 3W2DA 3M4PA 1I6HB 4N9TA 4LF5Q 4DUYQ 2YV5A 1IKLA 4FXGC 1L1OC 3PO2G 2WAQG 4K0KL 1YHQA 5I6YA 2RSOA 3TP6A 4EGVA 3KF6B 1TY0A 1TKWB 3CCRA 3EIVA 5LMNW 4A75A 3A5ZB 3VR5A 1JT8A 4HAEA 1WCMG 4OX9Q 4RKBA 1N32L 4EVOA 3GTLB 3M7NA 3MC0B 3HOZG 3H3VI 4X66Q 4RG1A 3MEHA 5C4XG 3VYTA 4LFCQ 2EJMA 3CKIB 3PO3B 2A74C 2AQ2B 4NKLA 2JXMB 2LXKA 2R61A 3CQZB 2Q8TA 4A3BH 3Q24A 3VR2A 3SE0A 1FNUA 1M8AA 1WI5A 4AH6A 2HQEA 1S5BD 1CHQD 3IFDA 2LFNA 4XYOA 2PCFB 4JOIC 4WJ4A 1VQ8A 3BVMA 4RGOS 1F9RA 3AU7A 1EQQA 1X6OA 3DEOA
chains in the Genus database with same CATH topology
1Z6HA 3C2PA 1W6JA 3KUPA 4RCNA 2IX0A 4KKUA 1CFMA 5EQ0A 4Q5VA 2O5JC 4ZUIA 2EXZA 5C0XI 2XRSD 2RKSA 2B2UC 4K5WA 2VNUD 1EY0A 3QWNA 2NVXB 2WKCA 3S1NB 4HEDA 1PTOH 1JORA 4H0LC 1M4VA 1HTLD 1WTOA 2B2UA 1SYDA 2B2WC 3QB3A 4IQZA 2A6HD 2TMPA 1E2WA 1F2MA 1BXTA 1SMYC 2PZWA 5HURA 3RMHA 1K8OA 1I4GA 3EJIA 4FF1A 1V1PA 1V1OA 1G6ZA 2BE5C 4C3IG 4O42A 3KLSX 2Q8RE 1GHJA 1EOTA 5FO9B 2IW3A 5CV9A 4PV1C 4BY1B 3S14B 4YIJA 1D2BA 1I4RA 3ITPA 2E2DC 5ELBA 2K05A 1CI3M 3NP8A 1SYEA 1L0YB 2OF1A 3EROA 3OMCA 3OIQA 1EY6A 3GTJB 5JEAJ 1TIID 3RZDB 2E76C 3G6JB 3EA6A 1LT4D 3OW7A 4KD3A 5D65A 2ICEC 1EWCA 2HCIA 4V0BA 3C1FA 1CM9A 4ZYSA 3D3RA 2EZVA 3I4LA 3GD7A 4I7ZC 5I4DA 1OXUA 1SYGA 4OIKA 4J1MA 3ZYYX 3N52A 1CZGA 1OXSC 1I4HA 1L0XB 3MFGA 1EIHA 4FNFA 2CQAA 4KI0A 2MUYA 1SYFA 4FP5D 1STEA 4CJ0B 3O13A 2FMCA 4DNRB 1HCZA 4TKOB 1BCPD 2F0TA 1HHVA 2WACA 2GA4B 1DCZA 2DNEA 1QJOA 4KD4A 3OMGA 5EGTA 5EKLA 3MXNA 5CV6A 5C44B 3HOYB 4MN3A 2EYOA 2RQXA 3J80L 2K01A 1S5FD 1AFPA 1TQOA 5LL6X 4XT1B 5FO7B 1QNUA 4WJWA 2WB1B 2OT2A 4XYQA 3TMEA 1VF5C 1IKMA 3J7AF 1C8CA 2B39A 2F0MA 4B9WA 5IT9E 2A6HC 1I4PA 3OOCA 4OHJA 4ZK9B 1F9SA 3R8BA 2CW0D 2XIWA 1EY8A 1JCKB 3ONAB 4BWGB 1DONA 4J8QA 3VYSA 3D4DA 2CVRA 4K6DA 4EQPA 3Q22A 2AWOA 4XQJA 1WTXA 2JA8B 4R9WA 4CJ1B 1I6VC 4G57A 4PMWA 1WTQA 2XN9C 5JVH3 3I8ZA 5IOCA 4V190 1TS3A 1PTOC 1JWSD 1K83B 5DM63 2XSCA 1TY2A 1NUCA 5TSSA 2K7VA 4EQNA 1BBXC 4KY5A 2OXPA 1PFNA 3EQLC 1STGA 2ZXPA 3D4RA 1F77A 2YU9B 1AZQA 1STHA 1GUNA 5T1IA 5M5YB 1AZPA 3MWYW 3NTKA 3K5NA 2K5WA 5J22A 2B2TC 3VA5A 3QOJA 4U673 3QG1A 3A8JE 2JEBI 3NHHA 2LKVA 3MA2B 2MP1A 1SSOA 3K7AB 1KTKA 1IW7C 5CBAE 1DYQA 2LS01 1F2YA 2EY1A 3TZDA 1YNND 3E0JA 3T51B 5IGEA 4RGNA 1RD9D 4DXGA 5JJZA 1B53A 2D9UA 4C3HB 5D14A 1E2VA 4UAIA 1SNCA 1KNAA 5CV5A 1VMPA 2K5QA 3NK9A 1OXXK 3BG3A 1VF7A 4WORA 4H7BA 1ET9A 4RFBA 5IT9L 4PMBA 3H94A 2FFKB 4IUUA 2F0FA 4MIUA 3CU7A 4FXKC 4PMCA 1LACA 5D3IB 1LO5D 5CR3A 1FNVA 2IL8A 4M1UB 4RGMA 1X3PA 2MPMA 1WTPA 5C5LA 1JOOA 2DNCA 2SNSA 2A69D 1PXUA 4C3IB 1G91A 1LLRD 1S5ED 1Z7TA 4DFAA 3Q6SA 2F3WA 1HFNA 3A54A 1GOZA 2EPBA 4KKTA 4DAVA 4FF2A 4QMGA 2Z4HA 3PUZA 4RAUC 3JAME 3T16A 4CHTB 1EY4A 2LY7A 3CHBD 1II3A 4FVMA 1S5DD 4RHRA 1RKNA 4HTHA 1RJTA 2F0LA 2G9HD 1HUNA 4A93B 3L7ZC 1DZ1A 2B63B 2L0CA 3TP7A 3K57A 4A3KB 3S1MB 4Y7NB 2I07B 2HDLA 4BS9A 5C4HA 1GUOA 1D5XC 1OXTA 2EOTA 4K8IA 2O2LD 2BA0A 2I46A 2E74C 1BOSA 4NP5A 4A3MB 4HSPA 1B9MA 2JE6I 1PFMA 1DOMA 2KECA 1Q1BA 4IUVA 4ZKBB 3D6CA 5G3LD 2BCOA 3E5SA 4DF7A 4KJNA 2F0KA 4XT3B 4KMUC 2ZXOA 1U4RA 4QIWB 2A5HA 4Z9CB 2AQ1B 1FR3A 1IYVA 1BUVT 2R93B 3P20A 1SNPA 4TSSA 2NVTB 4ZQ3A 5M3MB 3I72A 2IWHA 2QF7A 1ICWA 3FDTA 4DAPA 4KHVA 1SDFA 2QDBA 3HKZB 2R7ZB 1BCPB 3QOLA 3NQIA 3SXHA 3TP5A 1TS5A 2K6AA 4HCEA 5JPNC 1EIGA 5IGBA 3SVMA 2E75C 5KNBA 1QOHA 2JP1A 2KCCA 3I90A 1B50A 1GHKA 5HGTA 4IUNA 4C1NI 3RLFA 3BDOA 1YNNC 1XTCD 5C0XJ 1E0BA 1F2ZA 2BDOA 5ELEA 2C5CA 4B08A 1EWHA 2Y0SB 4L8JA 2SEBD 4L63B 3VR3A 3NBHA 4NW2A 3J7AV 2KUMA 3VR4A 2K03A 3LWEA 2Q8IB 4RWSC 5IGCA 3R2TA 2KEDA 5IODA 2D5DA 3KBXA 4R8IA 2K32A 1ESRA 3I4NB 2EVBA 1LV9A 2RA4A 3A56A 5EPLA 5KGUA 1RODA 1LTBD 3GV3A 1HXYD 2NN6G 2XVSA 1EY5A 3URYA 1JC7A 1LT6D 3S9WA 1YNJC 4PQXA 3TN2A 2B8FA 1TWGB 5ELCA 1DXMA 2FMMA 1MSGA 1A3VA 1ILQA 3C46A 4FF3A 1Y69U 5M9OA 1TR5A 2KVMA 1SXTA 1IYUA 2VB3X 2EY2A 4HR7B 2TSSA 5FOBB 1O78A 1B3AA 3ND9A 3DHQA 1LABA 2X6GA 1R9TB 2F3VA 1KDAA 3WDNA 2PW5A 5CV4A 1H9KA 1UEAB 4PNYA 1Y8PB 3A8KE 1PLFA 2RVLA 1AW7A 5I2XA 1A3UA 2MHVA 1V1PB 3A55A 2IJ0A 3HG9A 1KABA 1D1KA 4F87A 2PMZB 3HS0C 4HMIA 1EFID 4XDXA 3J81L 3S2DB 4A3GB 4B9XA 2V4DA 4QF4A 2F0VA 2NBFA 2XWBB 1I50B 1SJED 2A6ED 1EY7A 2EJFC 1TU2B 3P1HA 3NQTA 4IURA 2QILA 4Q0FA 1KLGD 4A3FB 2ZXRA 2SOBA 5BN3A 5I6WA 3FVQA 1AP0A 1KNEA 2PPBC 1JICA 1Y1VB 1HTPA 4G7ZC 1Y8OB 2X69A 5FLXL 1MD2D 2O5IC 2SNMA 4ME5A 2F0QA 4KTAA 2QEJC 4KK7A 1R4PB 1R4QB 4CJ2C 1J8IA 3MXPA 1X3QA 1O7YA 3X3MA 4P2CB 2WIIB 3E6ZX 3MXGA 1GUSA 3PUXA 2RDGA 3UI2A 5E4WC 1EYCA 2F0IA 1G291 1TVXA 2NVQB 1PRTF 2L55A 5BN4A 1V43A 3BS1A 3S1QB 3S17B 1FNWA 2PO4A 5EBCA 3VR6A 2E2HB 3RD4A 3FPUB 4X3UA 1ILPA 1CA6A 4A3JB 2QKIC 5G3LF 1WD0A 4DK1A 4ODGA 2EYMA 5CORA 1TWFB 2KCNA 1FGBD 1S4ZA 1C4QA 1TS4A 2RDFA 4C2MB 2PZUA 5JEAG 1DD2A 1EU4A 4A3BB 4WFN3 3V96A 3S16B 1O7ZA 4OIJA 1ET6A 4ULLA 2NN6I 3RUZA 3H6MA 4ID6A 3PIP3 3GTMB 3GTKB 1SE3A 3GTOB 4IN3A 1WTRA 2EDGA 2DN8A 2E2IB 2MGSA 2ZT9C 3H91A 1DM0B 4K14A 2B2VC 3GV6A 3MHBA 2JEAI 2D62A 2DY8A 2A6EC 4F88A 1RDPD 3HEJA 4X3KA 3IFTA 2B2YA 1U4LA 3FEWX 1FYCA 5C3EB 3HOUB 2K28A 1NCVA 2RBMA 3WOEA 2XNAC 3GTGB 2L4NA 1SYCA 1PRTD 2XWJB 2EYPA 2OEOA 2AWNA 4ZRZA 2H1EA 5KEEA 5AFWA 4DA2A 2NZ1D 3SK6A 3M4YA 2XRQD 4K2KA 2KHSA 1LTSD 1Q1EA 3T13A 4KN7C 1PTOD 2WV6D 3JAML 2H4OA 2BOSA 3K5OA 1Q90A 1PFBA 1ZEQX 3TDQA 1WTVA 1BNZA 1KLUD 1B2TA 1D6EC 4G7OC 1HA6A 1SEBD 5ELDA 4FF4A 3I3CA 3PUWA 1WCMB 1STYA 3PMFA 1TWHB 1G2SA 1NAPA 3D6WA 3TBIB 1YNJD 3J80E 1UNSA 5E4XA 1Q3LA 2VXWA 3BVZA 3SK4A 4BY7B 4K5VA 4IUPA 1Q8IA 2AQ3B 1XX8A 2F0PA 1LTGD 4HSVA 1WD1A 1HRJA 3HOXB 1PTOB 2EYLA 3EFXD 3T4AC 1QNKA 2WAQB 5IIFA 3EVQA 3MTSA 4K5XA 5ELFA 5M5XB 1HQRD 3D4WA 5KRUA 1G2TA 1BDOA 3DM1A 1Y1WB 4KN4C 1NSNS 4ZLTF 5JEAH 1CK1A 4HCSA 2O4XA 1RTNA 4BBRB 2FHTA 2WKDA 3NWSA 2K1BA 3N6RA 3IL8A 2IX1A 5E1FA 1OXVA 5CBEE 3T53B 4S3SA 3A7LA 4IFDI 3NWTA 1H9SA 1JQYD 5LL6S 3A8IE 1H9JA 4KY6A 4CKEA 1KAAA 2IPKD 3V2TA 3D31A 5C3XA 1ZYRD 5KYIA 1BR9A 2B2WA 2B2TA 4A3IB 4IZ8A 5DM73 3SK5A 1QB5D 2A69C 4QUCA 1BO0A 4QB4A 4BA1I 1SFOB 4UDUC 1Q12A 1C48A 2K5DA 4NMZA 3VYUA 4FXDA 1JOQA 1SNMA 1SBBB 2B2YC 2SDFA 3LX0A 4DAYA 2F0HA 2NWGA 2F03A 1A2TA 4K2LA 3I73A 1DOKA 1GUGA 3KLRA 2F0DA 1B9NA 2NVYB 5JPMC 2F0SA 4DU9A 4L6TB 1GUWA 5JVG3 3BZDB 4LMQD 1MGSA 3K0YA 4OO1H 5I9PA 2KA7A 3CRLC 2Z8LA 1EEID 4IFDJ 4NDXA 5IGDA 2WINB 4N9PA 3QIAA 4G7HC 3OIPA 5C5MA 3I91A 1LT5D 4C3JB 2F0EA 1LT3D 3K59A 1D5MC 1QE6A 3QJYA 4ILWA 4IFDG 5FLXE 2JA6B 2E2JB 2G9DA 3BYTB 2PYKA 5I2YA 3L9AX 4H13C 1ESFA 1PTOF 4FO2A 1JR0D 3W3AA 5T1GA 3M85A 3OPOA 3CRKC 1I3QB 4GZYC 2B2VA 1AEXA 1GUTA 2F0JA 3NTHA 1CT1D 1X32A 1EU3A 4KY7A 5CC4A 2M00A 2N55A 2NTTA 1CZWA 3LWUA 3FMCA 1IL8A 3D8GA 4JK1C 4KKSA 1F9QA 4I65A 1SYBA 2WP8J 1DOLA 4A3DB 2R3ZA 1JE4A 5DEHA 5KNDA 2L11A 3K6OA 4TRDA 2J0TD 2A73B 3BDLA 3J81E 5M3FB 3DEPA 5KIXA 3GTQB 4QCLA 1ZYRC 3G7LA 1ENFA 4IUQA 2L1BA 5COYA 2Z1CA 1H9RA 2EJGC 3GO5A 1U4PA 5CV7A 2EY6A 1A6XA 5LHY1 5I9OA 1LTAD 5C0XG 3DUZA 1UUPA 4ZUJA 3TP8A 3T56B 3WOFA 1G8ZD 1BF4A 3Q23A 5CMDA 2BDNA 3NSWA 1S5CD 1IW7D 5FO8B 2YYZA 2X6LA 4RHSA 4IUTA 4DK0A 3GQBA 2F0NA 1KDCA 3NBIA 4HMJA 4RGTA 1RCVD 4AYBB 3MXUA 1EQVA 1SE2A 4KJOA 1T5XD 5IGFA 1D1IA 5K36H 2KEEA 4KHZA 4RA8A 3SR1A 1RHPA 5FK9C 4MHEA 3BDCA 1XWEA 1Y8NB 3MVVA 3ND8A 3H09A 1A15A 3F2UA 3KK7A 1PZKD 3HZXA 1W6KA 2JSOA 3SK8A 2JA5B 2RSNA 1EY9A 2C9OA 1HFGA 1U4MA 2EYFA 1AN8A 1HPCA 5EKIA 2PQEA 1BQQT 4C3JG 5C0XH 1Z47A 5EPKA 5EKKA 5BN5A 3HOZB 5C4JB 1PZID 3MAQA 3R93A 3Q0AA 3C1EA 1TT2A 3DWPA 3HP3A 1TWCB 2NYZD 3IKJA 2HUGA 4DN4M 2KOLA 3BVGA 2K33A 4CGYB 4RKLA 4DNTB 1CQFA 2EYHA 1EYDA 1F9PA 1MI2A 4K6LA 1SAPA 4XTCS 3AB9A 2BA1A 4CBVA 3OHXC 3AMUA 3FPPA 1RTOA 1ENAA 2NB0A 4ZAIA 3LNNA 1TWAB 1TS2A 2FJ2A 1EYAA 2VUMB 5C6AA 1NR2A 4F7XA 2AUKA 1K8MA 1ML0D 5EPJA 3NTIA 1MBYA 4XXEA 2EY5A 4CKCA 3I4MB 2PZTA 1EZ8A 5CGKA 3K5MA 3SEBA 3H0GB 4OGQC 3J7YW 3VYRA 1PRTB 3SDZA 3TSSA 4WRDA 4LAAA 4RH6A 2NTSA 3KBGA 4C3HG 4ABNA 1VDZA 3I70A 1I4QA 5KNCA 3S1RB 4IALA 5A2QE 5J39A 3K5LA 3FRPB 2KJXA 1XYIA 1JB3A 2JA7B 3NXWA 2B8GA 5J1ZA 1XXGA 4HN7A 2N88A 4BA2I 1H9SB 1B4OA 3R3OA 1ZXTA 3BYYB 4XQNA 4LK1C 1STAA 1O7LA 1SNOA 1ZKOA 2CHBD 1KDBA 3DXJC 4O1NA 1RF2D 2FINB 2EE1A 1ONLA 2CW0C 1WVLA 1VCIA 1O80A 5KYLA 2HCCA 1B44D 2A68D 1LTID 5D3DA 4FYDA 5ISRA 5NUCA 5K5PA 3C3LA 3HGBA 3H3VC 3U9OA 4X3SA 4A3EB 3PO2B 2Z4IA 2L5TA 3PIO3 2R92B 1STBA 3RZOB 1STNA 4LJZC 1CA5A 3S2HB 1A3TA 3A7AB 2PNRC 1I4XA 3DWQA 1J9OA 3MZ5A 2NN6H 3OWEB 4XQQA 1HA5A 3OSOA 4CKBA 1HUMA 3M3YB 2DY7A 4IFDH 1FD7D 3L3OC 2F0WA 3VA7A 1A2UA 1NR4A 1VMCA 3DMUA 3KF8A 3DWAA 3R2IA 4C1NK 4J6HA 4R8NA 5M5WB 3NPPA 1BCPC 5C4XB 3P7JA 3ERQA 4DGZA 3IAYA 4X3TA 3U9SA 4KV6A 1T5EA 4XIGS 3TZUA 1IHZA 5C3WA 1JOKA 4E6IA 5FKAC 4OO1I 1OO9B 4TQUS 2R6GA 1PYWD 3V05A 2M9VA 1QG7A 5DAUA 4ZKCB 2IX3A 1LTTD 2NUCA 1GXDC 5IGGA 4JBWA 1GJXA 3PUVA 2M2LA 1E2ZA 1PRTC 2MJ8A 5DNFA 4M8AA 1QWYA 1SNQA 1EQTA 1PDQA 3M4OB 2JYOA 3S15B 5CV8A 1QCBD 5JOBA 2J4XA 1SE4A 4G4KA 3HRZC 2F0OA 3HOWB 1SJHD 2J7ZA 5F2DA 4OL7A 5E3FA 1SNDA 3SHLA 1PZJD 4DXFA 1UAPA 2F4IA 4C56C 4OO1G 1EL0A 3M7GA 2HDMA 2ICIA 4BBSB 2RDHA 1SMYD 5CYUA 3K58A 1B1ZA 2ID0A 4U68A 2L9HA 2QCPX 4RCOA 2LMCB 4QUFA 2A68C 1V8QA 1WTWA 5EJWA 2BE5D 1PMRA 3GTPB 4EQOA 3P75A 1MSHA 4H44C 5A2QL 2L12A 2AUJD 2PW7A 5K36G 5C4ZA 1EZ6A 1U9RA 1BCPF 2F0UA 2K04A 1ENCA 1QILA 1JWUD 2EYJA 1CTMA 2VB2X 2ENBA 2F0GA 3NUCA 3OWFA 1H9MA 3PV0A 5A35A 4K8JA 3PUYA 1D5ZC 3X3NA 3HOVB 3MFYA 5EBDA 1DJRD 3NE5B 1LTRD 3GP7A 1CQVA 1CHPD 2IT1A 1EEFD 2F1MA 1HQMC 2KQ3A 3KLSA 3FKIB 5JAVA 1F2LA 3QO2A 2D2CC 1JWMD 4F8MA 3W2DA 1I6HB 4N9TA 1IKLA 4FXGC 5I6YA 2RSOA 3TP6A 4EGVA 1TY0A 1TKWB 3VR5A 4HAEA 4RKBA 4EVOA 3GTLB 3M7NA 3MC0B 3MEHA 3VYTA 2EJMA 3CKIB 3PO3B 2A74C 2AQ2B 4NKLA 2JXMB 2R61A 3CQZB 2Q8TA 3Q24A 3VR2A 3SE0A 1FNUA 1M8AA 2HQEA 1S5BD 1CHQD 3IFDA 2LFNA 4XYOA 2PCFB 3BVMA 4RGOS 1F9RA 3AU7A 3DEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NW2 A;  4R9W A;  3FPU B;  1ZXT A;  3KUP A;  4XDX A;  2X6L A;  4X3U A;  4CJ1 B;  4IUT A;  1ILP A;  2KUM A;  1CA6 A;  5EQ0 A;  2K03 A;  4OIK A;  3N52 A;  2FFK B;  1F9P A;  1MI2 A;  1PFM A;  3LWE A;  1WTQ A;  1DOM A;  1SAP A;  2B2W A;  2KEC A;  4IUU A;  5T1G A;  2B2T A;  4RWS C;  1WD0 A;  4IUV A;  4ZKB B;  3I8Z A;  1QG7 A;  5COR A;  1PFB A;  2B2U C;  2KED A;  4ZKC B;  1WTV A;  2FIN B;  1RTO A;  1BNZ A;  2EE1 A;  1EIH A;  1B2T A;  4ZAI A;  1WVL A;  4HED A;  2B2V A;  1HA6 A;  3KBX A;  2FJ2 A;  4XT3 B;  3I3C A;  4R8I A;  2IL8 A;  4QUC A;  2M2L A;  1S4Z A;  2KEE A;  1ESR A;  4RA8 A;  1BO0 A;  1RHP A;  1WTO A;  1G2S A;  1LV9 A;  1NAP A;  1NR2 A;  1U4R A;  1X32 A;  1O80 A;  2MJ8 A;  2N55 A;  2RA4 A;  4MHE A;  2B2U A;  5DNF A;  1BBX C;  1PFN A;  1IL8 A;  1X3P A;  2MPM A;  5EPL A;  2B2W C;  1WTP A;  5E4X A;  1ML0 D;  2HCC A;  1Q3L A;  1ROD A;  2VXW A;  4IUR A;  3GV3 A;  1F9Q A;  1EQT A;  1AZQ A;  1HHV A;  1PDQ A;  5EPJ A;  1O7Z A;  4OIJ A;  4IUP A;  1A15 A;  2B2Y C;  1XX8 A;  2JYO A;  3F2U A;  1G91 A;  2SDF A;  5T1I A;  1DOL A;  2R3Z A;  4HSV A;  2NWG A;  1F2L A;  3Q6S A;  1WD1 A;  1HRJ A;  1JE4 A;  1AP0 A;  3TN2 A;  1HFN A;  3QO2 A;  2L11 A;  1ICW A;  3FDT A;  1AZP A;  3MWY W;  4X3S A;  1G6Z A;  1SDF A;  1KNE A;  2EPB A;  2FMM A;  1DOK A;  4MN3 A;  1JIC A;  1MSG A;  2J7Z A;  1WTR A;  4O42 A;  1IKL A;  1WTX A;  3DEP A;  2Q8R E;  1ILQ A;  2K01 A;  1EOT A;  1CA5 A;  2B2T C;  4RAU C;  2RSO A;  1GUW A;  3G7L A;  1QNK A;  1J9O A;  4LMQ D;  2MGS A;  4IUQ A;  2X69 A;  2L1B A;  3H91 A;  5COY A;  1MGS A;  2KVM A;  2B2V C;  2RSN A;  1EIG A;  3MTS A;  3GV6 A;  4XT1 B;  1EL0 A;  4HAE A;  2HDM A;  3SVM A;  2DY8 A;  1U4P A;  1HFG A;  2MP1 A;  1HUM A;  2K05 A;  1SSO A;  1U4M A;  5CBA E;  1B3A A;  4X3K A;  1G2T A;  1RJT A;  2B2Y A;  2DY7 A;  2JP1 A;  1U4L A;  4CJ0 B;  1HUN A;  3I90 A;  5EKI A;  1NR4 A;  1VMC A;  3TZD A;  2X6G A;  3DM1 A;  1B50 A;  4CJ2 C;  1J8I A;  1X3Q A;  1IKM A;  4U68 A;  5EPK A;  1C8C A;  2K28 A;  4ZLT F;  1NCV A;  2L9H A;  4QUF A;  1O7Y A;  5JJZ A;  1DZ1 A;  1B53 A;  4HCS A;  1XYI A;  1WTW A;  1RTN A;  3I91 A;  2D9U A;  5D14 A;  5EJW A;  2Q8T A;  2L4N A;  4UAI A;  1F9S A;  2FHT A;  3UI2 A;  5E4W C;  1KNA A;  1MSH A;  2K1B A;  3R93 A;  4ZK9 B;  1E0B A;  3IL8 A;  3P7J A;  2HDL A;  1M8A A;  1PLF A;  2L12 A;  2XIW A;  1TVX A;  2RVL A;  5CBE E;  5D65 A;  1QE6 A;  3D6W A;  3IFD A;  1BF4 A;  1VMP A;  3HP3 A;  2N88 A;  3ONA B;  1DON A;  5CMD A;  2BDN A;  2HCI A;  2EOT A;  1CM9 A;  2NYZ D;  2H1E A;  4X3T A;  2CVR A;  2HUG A;  2K04 A;  4DN4 M;  5AFW A;  2KOL A;  1F9R A;  2NZ1 D;  1B4O A;  3DEO A; 
#chains in the Genus database with same CATH topology
 1Z6H A;  4DR6 Q;  3C2P A;  1QUQ B;  1W6J A;  2HD3 A;  3KUP A;  4RCN A;  1VQK A;  4AYB E;  2IX0 A;  4KKU A;  1CFM A;  5EQ0 A;  4DK3 C;  4Q5V A;  2O5J C;  4ZUI A;  2R92 G;  2EXZ A;  5C0X I;  2XRS D;  1IBM Q;  4JPB W;  2RKS A;  2B2U C;  4GLV B;  4K5W A;  4GOP A;  2VNU D;  1EY0 A;  3QWN A;  2NVX B;  2WKC A;  4APV A;  4HED A;  3S1N B;  4JI0 Q;  1PTO H;  1JOR A;  1SMX A;  4H0L C;  4R4T A;  2CH4 A;  5IP9 H;  1IXR A;  1M4V A;  1HTL D;  1WTO A;  2B2U A;  1SYD A;  2B2W C;  3QB3 A;  4IQZ A;  2A6H D;  2TMP A;  1E2W A;  1F2M A;  1BXT A;  1SMY C;  2ASB A;  2PZW A;  5HUR A;  3T1H L;  3NEM A;  3RMH A;  1K8O A;  1I4G A;  4BY7 H;  3EJI A;  5JJI A;  4FF1 A;  4A3C H;  1UE6 A;  1V1P A;  1V1O A;  2UU9 Q;  4DR4 Q;  1P16 A;  4GNX B;  1G6Z A;  2BE5 C;  4B3T Q;  4A3G H;  4C3I G;  1PH3 A;  4O42 A;  5H1S E;  3KLS X;  1QVF A;  2Q8R E;  1GHJ A;  1EOT A;  5FO9 B;  2IW3 A;  5CV9 A;  3OW2 A;  4PV1 C;  4BY1 B;  3S14 B;  1IBL L;  1SR3 A;  4YIJ A;  3TQY A;  1D2B A;  4B3R Q;  1I4R A;  3ITP A;  2E2D C;  5ELB A;  2K05 A;  1LTL A;  1CI3 M;  4GKJ Q;  2A19 A;  3NP8 A;  1SYE A;  1KAW A;  1L0Y B;  2OF1 A;  3ERO A;  2UUC L;  1NY4 A;  4BBR G;  3OMC A;  3OIQ A;  1EY6 A;  1I94 Q;  3GTJ B;  1HZA A;  5JEA J;  1TII D;  3RZD B;  1XPU A;  2E76 C;  3G6J B;  3EA6 A;  1K8G A;  1YIJ A;  1LT4 D;  3OW7 A;  4KD3 A;  4X65 Q;  4UPA A;  3I55 A;  2JJQ A;  4QL5 A;  5D65 A;  2ICE C;  2JA8 H;  3LGJ A;  1JB7 A;  4JI7 Q;  5C4J H;  1EWC A;  2HCI A;  4V0B A;  3C1F A;  1CM9 A;  4ZYS A;  3D3R A;  1J6Q A;  2EZV A;  4DR2 L;  2LSS A;  1E1T A;  3I4L A;  3GD7 A;  4I7Z C;  5I4D A;  1OXU A;  1SYG A;  1KD1 C;  3PQI A;  3UE1 A;  1EUJ A;  4OIK A;  4J1M A;  2ZTE A;  3N52 A;  3ZYY X;  1CZG A;  1OXS C;  2VUM H;  3RZD H;  1TWA H;  1I4H A;  1L0X B;  1N36 L;  3MFG A;  1EIH A;  4FNF A;  2CQA A;  4KI0 A;  2MUY A;  1SYF A;  4FP5 D;  2A8V A;  5ELN A;  1STE A;  4L5S A;  4JW0 A;  4P72 A;  4CJ0 B;  3O13 A;  2FMC A;  4DNR B;  1D7Q A;  1HCZ A;  2DUD A;  4TKO B;  1BCP D;  2F0T A;  1PH7 A;  3I4N H;  1HHV A;  2ALY B;  2WAC A;  2GA4 B;  1CSP A;  1DCZ A;  2DNE A;  2DGY A;  4BY1 H;  1QJO A;  4R4O A;  5E7N A;  2PI2 E;  4KD4 A;  1FJG Q;  3OMG A;  2UXC L;  1NMF A;  5EGT A;  5EKL A;  1N8R C;  3MXN A;  5CV6 A;  5C44 B;  3HOY B;  4MN3 A;  2EYO A;  2RQX A;  3GTP H;  3J80 L;  2K01 A;  1S5F D;  1FGU A;  5IP7 H;  1V1Q A;  1B8A A;  1AFP A;  4R4I A;  1TQO A;  1HR0 W;  5LL6 X;  4XT1 B;  5FO7 B;  1QNU A;  4WJW A;  2AMC B;  4FDB A;  2OQ0 A;  2WB1 B;  1IBM L;  4LFA Q;  2OT2 A;  4XYQ A;  1ASY A;  3TME A;  1VF5 C;  3KF8 B;  3CCL A;  2JA5 G;  1IKM A;  3J7A F;  1C8C A;  5IE8 A;  2B39 A;  2F0M A;  1LYL A;  3UDX A;  4B9W A;  5IT9 E;  1QZH A;  2A6H C;  1I4P A;  3OOC A;  3U58 A;  4OHJ A;  4ZK9 B;  1F9S A;  4LF7 Q;  3R8B A;  2CW0 D;  4CDF C;  2XIW A;  1EY8 A;  1JCK B;  1VQ9 A;  3ONA B;  4BWG B;  1DON A;  3S14 H;  3HOU H;  2JK8 A;  4J8Q A;  3VYS A;  1U0L A;  3FKI G;  3D4D A;  2CVR A;  4K6D A;  4EQP A;  1NBW A;  4JI6 L;  3Q22 A;  2AWO A;  3K7U C;  4XQJ A;  4QJF A;  1WTX A;  2JA8 B;  1RIP A;  4R9W A;  4CJ1 B;  1HZ9 A;  1I6V C;  4G57 A;  4PMW A;  3KF6 A;  1WTQ A;  1E24 A;  3I7F A;  3A0J A;  3CQZ H;  2XN9 C;  2E2I H;  5JVH 3;  3I8Z A;  5IOC A;  4V19 0;  3UE0 A;  1MKH A;  1TS3 A;  1PTO C;  1JWS D;  1K83 B;  5DM6 3;  3TS2 A;  1RL2 A;  2YTV A;  2XSC A;  1TY2 A;  3J80 i;  1NUC A;  1U5K A;  5TSS A;  2K7V A;  4EQN A;  1BBX C;  4KY5 A;  2OXP A;  3T1Y L;  2BH2 A;  1PFN A;  4DV5 L;  4HIK A;  3EQL C;  1ASZ A;  1STG A;  2ZXP A;  3D4R A;  1F77 A;  2YU9 B;  1AZQ A;  1V9P A;  1X54 A;  2I5M X;  1STH A;  1GUN A;  1VQF A;  1KXL A;  5T1I A;  1TWC H;  4JBJ A;  2K50 A;  5M5Y B;  1S3O A;  2Z6B A;  1AZP A;  3MWY W;  1YZ6 A;  1VQ7 A;  3NTK A;  3CC4 A;  3OTO L;  2JA6 G;  1SN8 A;  4ALP A;  3K5N A;  1OTC A;  3CMA A;  2K5W A;  1QUQ A;  5J22 A;  2B2T C;  3VA5 A;  1Q7Y C;  3QOJ A;  4U67 3;  3QG1 A;  3A8J E;  2JEB I;  3NHH A;  4L5R C;  2GVA A;  4ZCK A;  2LKV A;  3MA2 B;  4A3F G;  2MP1 A;  1SSO A;  3K7A B;  1KTK A;  4DR6 L;  1IW7 C;  5CBA E;  4LFB L;  4DV0 L;  1DYQ A;  2LS0 1;  1E1O A;  4EX5 A;  1F2Y A;  2EY1 A;  4J15 A;  3K8A A;  3TZD A;  5FLM G;  3S1M H;  1YNN D;  3E0J A;  3T51 B;  3S1Q H;  5IGE A;  4RGN A;  1RD9 D;  4DXG A;  2K5N A;  5GAG C;  5JJZ A;  1B53 A;  3K80 C;  5M3F H;  2D9U A;  4C3H B;  5D14 A;  1WYD A;  3RZO H;  1E2V A;  4UAI A;  2R92 H;  1SNC A;  1KNA A;  4DV5 Q;  5CV5 A;  1VMP A;  2K5Q A;  2ZJP A;  3F8T A;  2UUC Q;  3H3V H;  4BBS G;  3ULL A;  3NK9 A;  1OXX K;  3BG3 A;  1VF7 A;  4WOR A;  4H7B A;  1A8V A;  4JCV E;  1ET9 A;  2RF4 A;  4P71 A;  4RFB A;  4B3R L;  1N34 Q;  5IT9 L;  4PMB A;  3H94 A;  1G51 A;  5FJ8 G;  4DV6 L;  2FFK B;  2Z0S A;  1VQ4 A;  4X6A H;  4IUU A;  2F0F A;  4MIU A;  3CU7 A;  4FXK C;  5IYB G;  2I5H A;  4PMC A;  1LAC A;  2R93 G;  5D3I B;  1QVG A;  1LO5 D;  3Q8D A;  4DUZ L;  5CR3 A;  1FNV A;  3ULP A;  2IL8 A;  1B3Q A;  4QY7 A;  1VQJ A;  3K0X A;  3I2Z A;  4M1U B;  4DV4 Q;  4RGM A;  1K0S A;  1X3P A;  3H0G G;  2MPM A;  1WTP A;  4YY3 L;  1UE1 A;  3HOV H;  5C5L A;  1JOO A;  2DNC A;  3S1N H;  2E2J H;  2VQE L;  2SNS A;  2A69 D;  1PXU A;  4C3I B;  1G91 A;  1LLR D;  1S5E D;  1Z7T A;  4A3L H;  4DFA A;  1XNQ L;  3Q6S A;  2FXQ A;  2F3W A;  5ELO A;  2UXD L;  1HNX L;  1HFN A;  3A54 A;  1GOZ A;  4P74 A;  2EPB A;  2EIF A;  4KKT A;  4DAV A;  4FF2 A;  3HOW G;  4QMG A;  4DV1 Q;  2Z4H A;  3PUZ A;  1PH9 A;  4RAU C;  3JAM E;  3T16 A;  4CHT B;  1EY4 A;  1VQB A;  2LY7 A;  2QDL A;  3CHB D;  3PCO B;  1II3 A;  3S2D H;  2DJF C;  4FVM A;  1S5D D;  4RHR A;  3OTO Q;  2VY3 A;  1RKN A;  2B63 G;  4HTH A;  3L2P A;  1RJT A;  4GN5 A;  2F0L A;  2G9H D;  4PZ8 A;  3CPW A;  1HUN A;  3E9H A;  4A93 B;  4RMF A;  4JI8 L;  3L7Z C;  1N33 L;  1PH6 A;  1K9M C;  1DZ1 A;  2B63 B;  2L0C A;  3TP7 A;  3K57 A;  4A3K B;  3S1M B;  1VQH A;  5IWA Q;  4Y7N B;  2I07 B;  1YNX A;  5C44 G;  3HOY G;  2HDL A;  4DR1 Q;  4BS9 A;  5C4H A;  1GUO A;  1D5X C;  4X64 Q;  5FLM H;  1OXT A;  2MQH A;  3JAM c;  2EOT A;  4K8I A;  1EQR A;  1YVC A;  2Q2H A;  1EIF A;  2O2L D;  4LW1 A;  1JE5 A;  2BA0 A;  2I46 A;  2E74 C;  4KHP L;  1BOS A;  4NP5 A;  4A3M B;  1XMQ L;  4HSP A;  4LFB Q;  1B9M A;  2JE6 I;  5LMU L;  1PFM A;  5M5X H;  1DOM A;  2KEC A;  2B3G A;  3PIP A;  1Q1B A;  4IUV A;  4ZKB B;  1E7Z A;  1KRT A;  3D6C A;  4JI6 Q;  5G3L D;  3CC2 A;  2BCO A;  3E5S A;  4DF7 A;  4KJN A;  4WJ3 M;  2F0K A;  4XT3 B;  2MO0 A;  4I7A A;  3OYY A;  4KMU C;  2VQF Q;  2ZXO A;  3SGI A;  1KRS A;  2HHH Q;  1U4R A;  5IYD G;  4QIW B;  2A5H A;  1YJN A;  4Z9C B;  2AQ1 B;  1BVS A;  1FR3 A;  1BKB A;  1IYV A;  1BUV T;  2R93 B;  4BXX G;  2GN5 A;  1K73 C;  1VQN A;  2OWO A;  1LUZ A;  3P20 A;  1SNP A;  4TSS A;  3JAM i;  4ZQ3 A;  2NVT B;  5M3M B;  3I72 A;  4A93 H;  3D0F A;  2IWH A;  1JJC B;  1VQ5 A;  3T1Y Q;  2QF7 A;  1ICW A;  3FDT A;  4DAP A;  1VQP A;  4KHV A;  4LUV A;  1SDF A;  2QDB A;  3HKZ B;  4X66 L;  2R7Z B;  5L37 A;  4BBR H;  4HJ5 A;  1BCP B;  3CAM A;  3QOL A;  3NQI A;  3SXH A;  1M1K C;  3S15 H;  1HR0 Q;  1YJ9 A;  4LF8 L;  2R7D A;  3TP5 A;  1TS5 A;  2K6A A;  4HCE A;  5JPN C;  1IBL Q;  1EIG A;  5FJ8 H;  5IGB A;  3SVM A;  1N34 L;  4BY7 G;  2E75 C;  5KNB A;  1QOH A;  2JP1 A;  2KCC A;  3I90 A;  1B50 A;  1S40 A;  1GHK A;  4DV7 L;  4C3I H;  4IUN A;  5HGT A;  4C1N I;  1WOC A;  3RLF A;  4JBK A;  3BDO A;  1JJ2 A;  1YNN C;  3EBE A;  4QGU A;  1XTC D;  2OCE A;  2NVQ H;  4HIO A;  5C0X J;  1E0B A;  1F2Z A;  2BDO A;  5ELE A;  2C5C A;  3U4Z A;  4B08 A;  4LF7 L;  1EWH A;  2Y0S B;  2B63 H;  4L8J A;  1HNZ L;  2SEB D;  4L63 B;  2UXB Q;  4R4C A;  1YHB A;  3VR3 A;  2E5L Q;  1Q46 A;  4YWM A;  5C3E H;  3NBH A;  4NW2 A;  2PQA A;  3J7A V;  2KUM A;  3VR4 A;  2K03 A;  2ATW A;  1C9O A;  3LWE A;  2Q8I B;  3KLW A;  4RWS C;  1KHI A;  5IGC A;  3R2T A;  1XTD A;  2KED A;  5IOD A;  4JC0 A;  2D5D A;  4KHP Q;  2R7Z H;  3KBX A;  4R8I A;  2K32 A;  1ESR A;  3I4N B;  4UY8 C;  2H5X A;  2EVB A;  1LV9 A;  2RA4 A;  3ULJ A;  3A56 A;  5EPL A;  5KGU A;  4LF4 L;  4GNX C;  1ROD A;  1GVP A;  1LTB D;  3GV3 A;  4N8X 1;  1HXY D;  2NN6 G;  2XVS A;  3PO3 H;  1EY5 A;  2ZM6 L;  1CSQ A;  3M4Q A;  3URY A;  2VUM G;  3FP9 A;  1JC7 A;  1LT6 D;  4A3F H;  3S9W A;  1YNJ C;  4PQX A;  3S16 H;  3TN2 A;  2B8F A;  1TWG B;  1PA6 A;  5ELC A;  1DXM A;  4A3D G;  2FMM A;  1MSG A;  4POF A;  1NMG A;  1A3V A;  1ILQ A;  2MFI A;  1TWF H;  3C46 A;  1PFS A;  4JI5 L;  4FF3 A;  1Y69 U;  1L0W A;  1PH8 A;  5M3F G;  5M9O A;  1TR5 A;  1MIU A;  5IYC G;  2KVM A;  1SXT A;  1PVO A;  1IYU A;  2VB3 X;  2EY2 A;  4HR7 B;  2TSS A;  5FOB B;  1O78 A;  4A93 G;  4A3M H;  1DGS A;  3J80 c;  1B3A A;  4JI1 L;  3ND9 A;  4MZ9 A;  3DHQ A;  1LAB A;  2X6G A;  1R9T B;  4MTN A;  2F3V A;  1KDA A;  3HKZ E;  3WDN A;  2PW5 A;  3HKS A;  5CV4 A;  2ZJQ A;  1H9K A;  1VQC A;  1Y14 B;  2N8N A;  4CDE C;  1UEA B;  4PNY A;  1Y8P B;  3A8K E;  1HH2 P;  1PLF A;  2RVL A;  1NNX A;  1AW7 A;  5I2X A;  1A3U A;  2HHH L;  3KFU A;  2MHV A;  1V1P B;  3ZJY C;  2ZM6 Q;  1X55 A;  3A55 A;  1CUK A;  2IJ0 A;  3HG9 A;  1KAB A;  4LF9 Q;  2ZTD A;  1D1K A;  3RN5 A;  4F87 A;  2PMZ B;  3HS0 C;  4A3G G;  3CCV A;  4HMI A;  1EFI D;  3G71 A;  4XDX A;  5EAY A;  3K7A H;  3J81 L;  3J81 j;  1WFQ A;  3S2D B;  4A3G B;  2IY5 B;  4B9X A;  4C2M H;  2V4D A;  3G4S A;  1JMC A;  2KBN A;  4QF4 A;  2F0V A;  2NBF A;  4POG A;  2XWB B;  1I50 B;  1SJE D;  2A6E D;  2WB1 G;  4DK6 C;  3NEL A;  1EY7 A;  2EJF C;  4JOI A;  1GM5 A;  5JJK A;  1TU2 B;  3P1H A;  3NQT A;  2K5H A;  1J5E Q;  3MEF A;  4IUR A;  2QIL A;  4ME3 A;  4Q0F A;  1KLG D;  4A3F B;  3E0E A;  3S17 H;  2ZXR A;  4GLX A;  2SOB A;  5BN3 A;  3TRZ A;  5I6W A;  3FVQ A;  1AP0 A;  4H02 A;  3J81 i;  2HIX A;  1KNE A;  2PPB C;  1JIC A;  4NXN Q;  1Y1V B;  1PHJ A;  1HTP A;  2VZA A;  4C3J H;  4G7Z C;  1Y8O B;  3GDE A;  2X69 A;  3NEN A;  5FLX L;  1MD2 D;  2O5I C;  2PQA B;  4YCV A;  2SNM A;  4ME5 A;  2F0Q A;  2IHF A;  4KTA A;  2QEJ C;  2JA7 G;  4KK7 A;  4DR7 Q;  5AJ3 L;  4GLA C;  1R4P B;  1C0A A;  1HR0 L;  3HOZ H;  1R4Q B;  4CJ2 C;  2KHI A;  4LF6 L;  1J8I A;  3MXP A;  1X3Q A;  1VQM A;  3KDF B;  1O7Y A;  2CFM A;  3X3M A;  1AH9 A;  4P2C B;  2WII B;  2L15 A;  3E6Z X;  2NVY H;  3MXG A;  1GUS A;  4YY3 Q;  3PUX A;  4DR1 L;  2RDG A;  3UI2 A;  5E4W C;  1EYC A;  3CCS A;  5IWA L;  4DKA C;  2F0I A;  1G29 1;  3PF4 A;  1TVX A;  2NVQ B;  1PRT F;  2L55 A;  5BN4 A;  4QIW E;  1V43 A;  3BS1 A;  4UP9 A;  3F2B A;  3S1Q B;  3S17 B;  1FNW A;  2PO4 A;  5EBC A;  1LM0 A;  4X62 Q;  1H95 A;  3VR6 A;  3H15 A;  2E2H B;  3U4V A;  3RD4 A;  3FPU B;  4X3U A;  3RR5 A;  1ILP A;  1CA6 A;  1KL9 A;  4OXP A;  1UE7 A;  4DR7 L;  4A3J B;  2QKI C;  4LUO A;  5G3L F;  1WD0 A;  4DK1 A;  4ODG A;  2EYM A;  5COR A;  2OTL A;  3UDF A;  1TWF B;  2KCN A;  1FGB D;  2OTJ A;  1S4Z A;  1C4Q A;  1TS4 A;  4DR5 Q;  2RDF A;  4C2M B;  2PZU A;  5JEA G;  1DD2 A;  1FL0 A;  1EU4 A;  2ZJR A;  4A3B B;  2P5Z X;  4WFN 3;  4QQB X;  3V96 A;  2CCZ A;  3S16 B;  1O7Z A;  4OIJ A;  1L1O B;  1ET6 A;  4ULL A;  2NN6 I;  2HT1 A;  2C35 B;  4JG2 A;  1QZG A;  3RUZ A;  3H6M A;  4ID6 A;  1CKN B;  3PIP 3;  4TVA B;  3WWV A;  3GTM B;  4JI4 Q;  4R4Q A;  4MNO A;  3GTK B;  4DV3 L;  1SE3 A;  1E22 A;  5M3M G;  3KOJ A;  4UP7 A;  4AQY L;  3GTO B;  4IN3 A;  1WTR A;  2EDG A;  1K83 H;  1PV4 A;  2F4V Q;  2A1A A;  2DN8 A;  3EN2 A;  4LFC L;  2E2I B;  2MGS A;  2ZT9 C;  3H91 A;  1DM0 B;  2K4K A;  4K14 A;  1XMQ Q;  2B2V C;  4A3E H;  3GV6 A;  3MHB A;  2JEA I;  2D62 A;  2DY8 A;  2A6E C;  4F88 A;  1RDP D;  2QW7 A;  4A3L G;  3HEJ A;  4NXN L;  1I6H H;  3I4M G;  4X3K A;  2KCT A;  3IFT A;  2B2Y A;  1U4L A;  3FEW X;  2Z6K A;  1FYC A;  5C3E B;  1PYS B;  1TXY A;  4HID A;  1YIT A;  3HOU B;  3PIO A;  4JI3 Q;  2K28 A;  1NCV A;  2RBM A;  3WOE A;  2XNA C;  4LUZ A;  3GTG B;  2L4N A;  1SYC A;  1PRT D;  2XWJ B;  3DM3 A;  4A3E G;  1BBW A;  3IRB A;  2EYP A;  2I5L X;  2OEO A;  3K81 C;  4JI8 Q;  2AWN A;  4ZRZ A;  2H1E A;  5KEE A;  5AFW A;  3ER0 A;  4DA2 A;  2NZ1 D;  3SK6 A;  3M4Y A;  2XRQ D;  4K2K A;  5IP7 G;  2KHS A;  1LTS D;  1T9H A;  2V1C C;  1A63 A;  1Q1E A;  3T13 A;  4KN7 C;  1Q81 C;  1PTO D;  5IYB H;  2WV6 D;  3JAM L;  2H4O A;  2BOS A;  3K5O A;  1Q90 A;  1PFB A;  1ZEQ X;  3TDQ A;  4LF9 L;  1WTV A;  1BNZ A;  1KLU D;  1B2T A;  1D6E C;  2ES2 A;  4G7O C;  4JI5 Q;  5J3B A;  4N8F A;  3L0O A;  1SEB D;  5ELD A;  3ICE A;  1HA6 A;  4FF4 A;  3I3C A;  1KIX A;  3PUW A;  1WCM B;  3I56 A;  1K3B C;  1STY A;  2UXD Q;  3PMF A;  1TWH B;  1G2S A;  1NAP A;  3D6W A;  3TBI B;  1YNJ D;  3HOV G;  3J80 E;  1UNS A;  5E4X A;  1Q3L A;  2VXW A;  1CKO A;  3BVZ A;  3SK4 A;  4BY7 B;  4K5V A;  4IUP A;  1Q8I A;  2AQ3 B;  1XX8 A;  2F0P A;  1LTG D;  4HSV A;  1WD1 A;  1HRJ A;  2F3I A;  4BBS H;  4A3I G;  4L5Q A;  2OQK A;  3HOX B;  1PTO B;  3H0G H;  2EYL A;  3E9I A;  3EFX D;  3TS0 A;  5LMN L;  3T4A C;  1N33 Q;  1QNK A;  2WAQ B;  5IIF A;  1B7Y B;  3EVQ A;  3PGZ A;  4KLK A;  3MTS A;  4K5X A;  5ELF A;  5M5X B;  1HQR D;  3D4W A;  4A3K G;  5KRU A;  5C4X H;  1K0R A;  1G2T A;  1BDO A;  1B70 B;  3AEV A;  2VL6 A;  3DM1 A;  3FKI H;  1Y1W B;  4CDC C;  1Q82 C;  4KN4 C;  3F2C A;  1NSN S;  4ZLT F;  4AIM A;  5JEA H;  1CK1 A;  4HCS A;  2O4X A;  1RTN A;  4BBR B;  2B29 A;  2K75 A;  1WJJ A;  3UDG A;  2RHS B;  2FHT A;  1MJC A;  2WKD A;  3NWS A;  2K1B A;  3N6R A;  3IL8 A;  2IX1 A;  1I5F A;  1OXV A;  5E1F A;  5CBE E;  3GTJ H;  3T53 B;  4S3S A;  4C3H H;  3A7L A;  4Y52 H;  4IFD I;  2NVT H;  3NWT A;  2VQE Q;  1I94 L;  3RNU A;  1H9S A;  2EQS A;  3J81 c;  1JQY D;  4A3J G;  5LL6 S;  3A8I E;  1H9J A;  4KY6 A;  4CKE A;  4JI2 L;  1KAA A;  2IPK D;  3V2T A;  2ZTC A;  1O7I A;  1VQO A;  3D31 A;  5C3X A;  1ZYR D;  5KYI A;  1BR9 A;  2B2W A;  2B2T A;  4A3I B;  4IZ8 A;  1EWI A;  5DM7 3;  4LF8 Q;  3SK5 A;  1NJI C;  3I4O A;  1HNW Q;  1QB5 D;  2A69 C;  4QUC A;  1BO0 A;  1CKM A;  4QB4 A;  4BA1 I;  1SFO B;  4UDU C;  1Q12 A;  1C48 A;  2K5D A;  2MNA A;  4A3J H;  4NMZ A;  3VYU A;  4FXD A;  1JOQ A;  1SNM A;  1HJP A;  4OWW B;  1EYG A;  1SBB B;  3CCU A;  1I3Q H;  2E2H H;  2B2Y C;  4NXM L;  1Y1V G;  2SDF A;  3LX0 A;  4DAY A;  2F0H A;  2NWG A;  4HIM A;  1A62 A;  2F03 A;  1A2T A;  4K2L A;  4JI3 L;  4IPC A;  3RLO A;  4CDD C;  2R7Z G;  3I73 A;  1DOK A;  1GUG A;  3KLR A;  2F0D A;  2JA5 H;  1B9N A;  4LNQ A;  2NVX H;  2NVY B;  5JPM C;  2F0S A;  5FLX c;  1XMO Q;  4DU9 A;  4L6T B;  2JA6 H;  4IOA A;  1GUW A;  1IYJ B;  5JVG 3;  3BZD B;  4LMQ D;  3S2H H;  1HNW L;  1MGS A;  3PO3 G;  3F1Z A;  4DR2 Q;  3K0Y A;  5BR8 L;  4DAM A;  3F2D A;  4OO1 H;  5LMU Q;  2QEX A;  5I9P A;  2KA7 A;  3CRL C;  2N3S A;  2Z8L A;  3CCJ A;  1EEI D;  4IFD J;  4NDX A;  5IGD A;  4K0K Q;  4LWC A;  3B6Y A;  2UXB L;  2WIN B;  1XJV A;  4MTK A;  4N9P A;  3QIA A;  4G7H C;  2E5L L;  3KDF A;  3OIP A;  5C5M A;  3ERS X;  3I91 A;  1LT5 D;  4PZ7 A;  4C3J B;  2F0E A;  4PZ6 A;  2UXC Q;  1LT3 D;  4UHV A;  3K59 A;  1D5M C;  1QE6 A;  1X56 A;  2K5V A;  2WFW A;  3QJY A;  4ILW A;  1EOV A;  4IFD G;  5FLX E;  2JA6 B;  2E2J B;  2G9D A;  3BYT B;  2PYK A;  5I2Y A;  2G5D A;  3L9A X;  5BR8 Q;  4H13 C;  1ESF A;  1PTO F;  4OWX B;  1IL2 A;  4FO2 A;  1JR0 D;  3W3A A;  5T1G A;  3M85 A;  5LMN Q;  1XMO L;  1SE8 A;  3OPO A;  4OEL B;  3CRK C;  3UDI A;  2RCN A;  1I3Q B;  3J7A 5;  4GZY C;  4YWK A;  2B2V A;  1AEX A;  2F52 A;  1GUT A;  2I0Q A;  1JJG A;  2F0J A;  1XNR Q;  3TRE A;  3NTH A;  1CT1 D;  1X32 A;  1EU3 A;  4KY7 A;  2M00 A;  2N55 A;  2NTT A;  1CZW A;  3LWU A;  5CC4 A;  4LF5 L;  3FMC A;  1IL8 A;  3D8G A;  5M5W H;  3M9B A;  4GS3 A;  4JK1 C;  4O2D A;  1SLJ A;  4KKS A;  1F9Q A;  4I65 A;  4O0A A;  1SYB A;  2WP8 J;  1IBK Q;  1DOL A;  4JYA L;  4A3D B;  2R3Z A;  3S1R H;  1JE4 A;  5DEH A;  5KND A;  2L11 A;  3K6O A;  4TRD A;  2J0T D;  1VQA A;  2A73 B;  3BDL A;  5M3M H;  3J81 E;  1AE2 A;  5M3F B;  3DEP A;  4LFA L;  5KIX A;  4DV0 Q;  3GTM H;  3GTQ B;  4QCL A;  4DV7 Q;  2Q2I A;  1ZYR C;  3G7L A;  1N36 Q;  1ENF A;  3JC6 6;  4IUQ A;  2L1B A;  5COY A;  1KC8 C;  2Z1C A;  3E3X A;  1H9R A;  2EJG C;  3GO5 A;  1R9T H;  1U4P A;  5DLQ E;  2BH8 A;  1VQI A;  5CV7 A;  2EY6 A;  4A3D H;  1A6X A;  3I4M H;  1W3S A;  5LHY 1;  1XNQ Q;  5I9O A;  1L1O A;  2YTY A;  4GKK Q;  1LTA D;  1XPO A;  5C0X G;  3DUZ A;  1UUP A;  2JA9 A;  1PH1 A;  4ZUJ A;  3TP8 A;  4LF4 Q;  3T56 B;  3WOF A;  1G8Z D;  1BF4 A;  4NXM Q;  3Q23 A;  5CMD A;  2BDN A;  3NSW A;  1YJW A;  1S5C D;  2Y0S G;  1IW7 D;  4A76 A;  5FO8 B;  4DR3 L;  2YYZ A;  1N32 Q;  2X6L A;  4RHS A;  4IUT A;  3M3Y H;  4DK0 A;  3GQB A;  3NBI A;  1KDC A;  2F0N A;  4HMJ A;  1NE3 A;  4RGT A;  1RCV D;  2QA4 A;  3CPF A;  4AYB B;  2XGT A;  3MXU A;  4L5T A;  1EQV A;  3NBH B;  1BBU A;  1SE2 A;  1C7Y A;  4KJO A;  1T5X D;  5IGF A;  1D1I A;  3U50 C;  5K36 H;  2KEE A;  4KHZ A;  4RA8 A;  3SR1 A;  1RHP A;  5FK9 C;  4MHE A;  3S24 A;  3BDC A;  4DUY L;  1XWE A;  4OEM B;  2KCM A;  4GOP B;  3BZC A;  1Y8N B;  1VQL A;  3J7Z C;  3MVV A;  3ND8 A;  3RLN A;  3H09 A;  3RN2 A;  1PH2 A;  2PI2 A;  1A15 A;  3F2U A;  3KK7 A;  4P75 A;  4P73 A;  2RCF A;  4DV4 L;  4DR5 L;  3GTO H;  3G6E A;  4JI1 Q;  1PZK D;  3HZX A;  4DPG A;  1S72 A;  4NB3 A;  1W6K A;  2JSO A;  2Q2T A;  3CXC A;  4IJH A;  3SK8 A;  4R1J A;  1IZ6 A;  3HOX G;  2JA5 B;  4DUZ Q;  2RSN A;  4IPH A;  1EY9 A;  3G48 A;  1AE3 A;  2C9O A;  1HFG A;  1U4M A;  1X65 A;  2EYF A;  1AN8 A;  1PH4 A;  1ICF B;  3GTG H;  1HPC A;  4GN4 B;  5EKI A;  4DV6 Q;  2PQE A;  1BQQ T;  4C3J G;  5C0X H;  1I50 H;  4HJ9 A;  1Z47 A;  5EPK A;  5EKK A;  5BN5 A;  3HOZ B;  5C4J B;  1PZI D;  3MAQ A;  2UU9 L;  4B3M Q;  3R93 A;  3Q0A A;  3C1E A;  1TT2 A;  3DWP A;  4PG3 A;  3HP3 A;  1TWC B;  2JA8 G;  4GKK L;  1GO3 E;  2NYZ D;  3IKJ A;  2YU9 H;  2HUG A;  4DN4 M;  2KOL A;  3BVG A;  2K33 A;  4UP8 A;  4CGY B;  3KJO A;  1Q8K A;  4RKL A;  5HY6 A;  4DNT B;  2Q2U A;  4IPG A;  1CQF A;  2VQF L;  3BZK A;  3GTL H;  2EYH A;  3GTK H;  1EYD A;  1F9P A;  1MI2 A;  4K6L A;  3W5O A;  1SAP A;  4XTC S;  3AB9 A;  2BA1 A;  4CBV A;  4DV2 Q;  3OHX C;  3AMU A;  3FPP A;  1RTO A;  1ENA A;  2NB0 A;  4ZAI A;  1VQD A;  3LNN A;  1TWA B;  1TS2 A;  2FJ2 A;  1EYA A;  2VUM B;  4JI4 L;  5C6A A;  1NR2 A;  2PMZ E;  4F7X A;  5HGQ A;  1HNZ Q;  2AUK A;  1K8M A;  1ML0 D;  4OWT B;  5EPJ A;  2N78 A;  4JYA Q;  3NTI A;  1MBY A;  4XXE A;  1NTG A;  2EY5 A;  2K14 A;  4CKC A;  4YWL A;  4BY1 G;  1MJE A;  4B3M L;  3I4M B;  4HJ7 A;  2PZT A;  2Z9H A;  1EZ8 A;  5M5Y H;  4DNI A;  4GNX A;  1TWG H;  5CGK A;  3K5M A;  5IYD H;  3FHW A;  4LF6 Q;  3SEB A;  3H0G B;  4OGQ C;  3J7Y W;  3VYR A;  1PRT B;  3SDZ A;  3TSS A;  4EQ5 A;  3CME A;  4WRD A;  1P8L A;  4LAA A;  4RH6 A;  4B3S Q;  4GOP C;  2NTS A;  3KBG A;  3KYH C;  4C3H G;  4ABN A;  1VDZ A;  4JV5 Q;  5GAE C;  1G6P A;  4YHH Q;  3DLL A;  1M90 C;  3I70 A;  3HOU G;  1I4Q A;  2F4V L;  4B3T L;  2MO1 A;  5KNC A;  3S1R B;  5C3E G;  4IAL A;  4JI2 Q;  5A2Q E;  5J39 A;  1QVC A;  5GQO A;  3FRP B;  3K5L A;  2KJX A;  4DAY B;  1XYI A;  4A3B G;  1JB3 A;  1WTH A;  2JA7 B;  3CCE A;  5C44 H;  3HOY H;  1XPR A;  1TWH H;  2HIV A;  1UEB A;  1WCM H;  3NXW A;  2B8G A;  3BU2 A;  5J1Z A;  1XXG A;  4HN7 A;  2N88 A;  2CQO A;  4BA2 I;  2K52 A;  1H9S B;  4HJ8 A;  1D8L A;  3CCQ A;  1K28 A;  4OON A;  1B4O A;  1X3G A;  3R3O A;  1ZXT A;  3BYY B;  4XQN A;  4LK1 C;  1STA A;  1O7L A;  1SNO A;  4YHH L;  3A5U A;  2UUA L;  3HKZ G;  1ZKO A;  1N9W A;  2CHB D;  1A0I A;  1KDB A;  3DXJ C;  4O1N A;  3VDY A;  1RF2 D;  2FIN B;  3STB D;  5GAD C;  2EE1 A;  1ONL A;  2CW0 C;  1WVL A;  2DJG C;  4HJA A;  1Q86 C;  1K8A C;  1VCI A;  3CD6 A;  1O80 A;  3AFP A;  1CKN A;  3AYH B;  1SRO A;  3CC7 A;  5IY0 A;  5KYL A;  2HCC A;  1B44 D;  2A68 D;  1LTI D;  1E3P A;  4YCU A;  5D3D A;  1X3F A;  2Y0S E;  3AQQ A;  4FYD A;  5ISR A;  2N49 A;  5NUC A;  5K5P A;  1YBY A;  3C3L A;  1VQE A;  3M4O H;  1VQ6 A;  3HGB A;  3H3V C;  3U9O A;  1W2B A;  4X3S A;  4A3E B;  3PO2 B;  2AKW B;  2Z4I A;  2E8G A;  1HZC A;  2VS1 A;  2WB1 E;  3KJP A;  2L5T A;  3PIO 3;  2R92 B;  1STB A;  2CH4 W;  3RZO B;  1STN A;  2XTI A;  3HFZ B;  4LJZ C;  1CA5 A;  3S2H B;  1A3T A;  3A7A B;  2PNR C;  1I4X A;  3DWQ A;  4JI0 L;  4BXX H;  1J9O A;  2QGQ A;  3MZ5 A;  2NN6 H;  3OWE B;  2R93 H;  4XQQ A;  4A3C G;  1HA5 A;  3OSO A;  4CKB A;  1HUM A;  3M3Y B;  5IT9 c;  2PNH A;  2UUA Q;  2DY7 A;  4IFD H;  1FD7 D;  1VQG A;  3L3O C;  2F0W A;  3VA7 A;  4DV3 Q;  1A2U A;  1UE5 A;  4JI7 L;  1NR4 A;  1VMC A;  4DV1 L;  4IO9 A;  3DMU A;  1YEZ A;  3KF8 A;  3DWA A;  3R2I A;  4C1N K;  4J6H A;  4R8N A;  2AHO B;  5M5W B;  3NPP A;  1BCP C;  1FJG L;  1YHA A;  2D0O A;  3P7J A;  5C4X B;  1SFO H;  1VS0 A;  3ERQ A;  1GKH A;  4A3M G;  1IBK L;  1GD7 A;  3BJU A;  4DGZ A;  3IAY A;  1XNR L;  4X3T A;  3U9S A;  3PF5 A;  2LXJ A;  4KV6 A;  1T5E A;  4XIG S;  4IOC A;  3TZU A;  4A3I H;  4B3S L;  4GN3 B;  4NPS A;  1IHZ A;  3MXN B;  5C3W A;  1JOK A;  3HOX H;  4GKJ L;  4JV5 L;  4E6I A;  5FKA C;  4OO1 I;  1OO9 B;  1PYB A;  3CW2 C;  4TQU S;  2R6G A;  4A4I A;  1L2F A;  1PYW D;  3V05 A;  2M9V A;  1QG7 A;  5DAU A;  4ZKC B;  2IX3 A;  1LTT D;  4X62 L;  2NUC A;  1GXD C;  5IGG A;  2NZO A;  3GTQ H;  1X3E A;  5GRO A;  4JBW A;  1GJX A;  3PUV A;  4DR3 Q;  2M2L A;  1KQS A;  1E2Z A;  3W1G A;  1PRT C;  2MJ8 A;  4AQY Q;  5DNF A;  3HOW H;  4DR4 L;  3PO2 H;  4M8A A;  3A74 A;  2KEN A;  1QWY A;  1SNQ A;  1EQT A;  3PSI A;  1PDQ A;  3QR8 A;  1Z9F A;  3M4O B;  2JYO A;  3S15 B;  5CV8 A;  1Y1W H;  1QCB D;  2UUB Q;  5JOB A;  2J4X A;  1SE4 A;  4G4K A;  3HRZ C;  1UWV A;  2F0O A;  3HOW B;  3AFQ A;  1SJH D;  2NZH A;  2J7Z A;  5F2D A;  3TEH B;  4OL7 A;  5E3F A;  1SND A;  1MHW C;  3SHL A;  1PZJ D;  2CKZ B;  4DXF A;  4DV2 L;  1Y1V H;  1UAP A;  2F4I A;  4C56 C;  2WAQ E;  4OO1 G;  1EL0 A;  3M7G A;  2HDM A;  2ICI A;  2YTX A;  4BBS B;  2RDH A;  4Y7N H;  1SMY D;  5CYU A;  2KHJ A;  2GVB A;  4X64 L;  3K58 A;  1B1Z A;  2ID0 A;  4U68 A;  2L9H A;  2QCP X;  4RCO A;  2LMC B;  4QUF A;  2A68 C;  1V8Q A;  1WTW A;  2VW9 A;  2R7F A;  4IPD A;  5EJW A;  1EIY B;  4AYB G;  2BE5 D;  1PMR A;  3GTP B;  1K3R A;  4JVZ A;  3P75 A;  4EQO A;  1MSH A;  4X65 L;  3I4N G;  4H44 C;  5A2Q L;  2L12 A;  2AUJ D;  2IHE A;  2JA7 H;  2PW7 A;  2Z6K C;  1J5E L;  5K36 G;  5C4Z A;  3T1H Q;  1EZ6 A;  2EXD A;  1U9R A;  1BCP F;  2F0U A;  2K04 A;  1ENC A;  1QIL A;  1JWU D;  2EYJ A;  4OX9 L;  2HQL A;  2D0P A;  1FVI A;  1CTM A;  2VB2 X;  4YCW A;  2ENB A;  2F0G A;  3NUC A;  1X9N A;  4JBM A;  3CP0 A;  1EFW A;  1HZB A;  2RHQ B;  5AJ3 Q;  4A3K H;  2CWP A;  3CF5 A;  3OWF A;  1H9M A;  3PV0 A;  5IYC H;  5A35 A;  2JQO A;  4K8J A;  3PUY A;  5JJL A;  1D5Z C;  1YI2 A;  1PH5 A;  3X3N A;  3HOV B;  3MFY A;  3STB C;  1HNX Q;  5EBD A;  1DJR D;  3NE5 B;  1LTR D;  5IP9 G;  3CCM A;  3GP7 A;  1CQV A;  1CHP D;  2IT1 A;  1EEF D;  2F1M A;  1SRU A;  1Y1W G;  2JN4 A;  2CWA A;  1HQM C;  2KQ3 A;  3KLS A;  3FKI B;  5JAV A;  2UUB L;  1F2L A;  3W1B A;  5GAH C;  3QO2 A;  2D2C C;  1JWM D;  4IJL A;  4F8M A;  3W2D A;  3M4P A;  1I6H B;  4N9T A;  4LF5 Q;  4DUY Q;  2YV5 A;  1IKL A;  4FXG C;  1L1O C;  3PO2 G;  2WAQ G;  4K0K L;  1YHQ A;  5I6Y A;  2RSO A;  3TP6 A;  4EGV A;  3KF6 B;  1TY0 A;  1TKW B;  3CCR A;  3EIV A;  5LMN W;  4A75 A;  3A5Z B;  3VR5 A;  1JT8 A;  4HAE A;  1WCM G;  4OX9 Q;  4RKB A;  1N32 L;  4EVO A;  3GTL B;  3M7N A;  3MC0 B;  3HOZ G;  3H3V I;  4X66 Q;  4RG1 A;  3MEH A;  5C4X G;  3VYT A;  4LFC Q;  2EJM A;  3CKI B;  3PO3 B;  2A74 C;  2AQ2 B;  4NKL A;  2JXM B;  2LXK A;  2R61 A;  3CQZ B;  2Q8T A;  4A3B H;  3Q24 A;  3VR2 A;  3SE0 A;  1FNU A;  1M8A A;  1WI5 A;  4AH6 A;  2HQE A;  1S5B D;  1CHQ D;  3IFD A;  2LFN A;  4XYO A;  2PCF B;  4JOI C;  4WJ4 A;  1VQ8 A;  3BVM A;  4RGO S;  1F9R A;  3AU7 A;  1EQQ A;  1X6O A;  3DEO A; 
#chains in the Genus database with same CATH homology
 1Z6H A;  3C2P A;  1W6J A;  3KUP A;  4RCN A;  2IX0 A;  4KKU A;  1CFM A;  5EQ0 A;  4Q5V A;  2O5J C;  4ZUI A;  2EXZ A;  5C0X I;  2XRS D;  2RKS A;  2B2U C;  4K5W A;  2VNU D;  1EY0 A;  3QWN A;  2NVX B;  2WKC A;  3S1N B;  4HED A;  1PTO H;  1JOR A;  4H0L C;  1M4V A;  1HTL D;  1WTO A;  2B2U A;  1SYD A;  2B2W C;  3QB3 A;  4IQZ A;  2A6H D;  2TMP A;  1E2W A;  1F2M A;  1BXT A;  1SMY C;  2PZW A;  5HUR A;  3RMH A;  1K8O A;  1I4G A;  3EJI A;  4FF1 A;  1V1P A;  1V1O A;  1G6Z A;  2BE5 C;  4C3I G;  4O42 A;  3KLS X;  2Q8R E;  1GHJ A;  1EOT A;  5FO9 B;  2IW3 A;  5CV9 A;  4PV1 C;  4BY1 B;  3S14 B;  4YIJ A;  1D2B A;  1I4R A;  3ITP A;  2E2D C;  5ELB A;  2K05 A;  1CI3 M;  3NP8 A;  1SYE A;  1L0Y B;  2OF1 A;  3ERO A;  3OMC A;  3OIQ A;  1EY6 A;  3GTJ B;  5JEA J;  1TII D;  3RZD B;  2E76 C;  3G6J B;  3EA6 A;  1LT4 D;  3OW7 A;  4KD3 A;  5D65 A;  2ICE C;  1EWC A;  2HCI A;  4V0B A;  3C1F A;  1CM9 A;  4ZYS A;  3D3R A;  2EZV A;  3I4L A;  3GD7 A;  4I7Z C;  5I4D A;  1OXU A;  1SYG A;  4OIK A;  4J1M A;  3ZYY X;  3N52 A;  1CZG A;  1OXS C;  1I4H A;  1L0X B;  3MFG A;  1EIH A;  4FNF A;  2CQA A;  4KI0 A;  2MUY A;  1SYF A;  4FP5 D;  1STE A;  4CJ0 B;  3O13 A;  2FMC A;  4DNR B;  1HCZ A;  4TKO B;  1BCP D;  2F0T A;  1HHV A;  2WAC A;  2GA4 B;  1DCZ A;  2DNE A;  1QJO A;  4KD4 A;  3OMG A;  5EGT A;  5EKL A;  3MXN A;  5CV6 A;  5C44 B;  3HOY B;  4MN3 A;  2EYO A;  2RQX A;  3J80 L;  2K01 A;  1S5F D;  1AFP A;  1TQO A;  5LL6 X;  4XT1 B;  5FO7 B;  1QNU A;  4WJW A;  2WB1 B;  2OT2 A;  4XYQ A;  3TME A;  1VF5 C;  1IKM A;  3J7A F;  1C8C A;  2B39 A;  2F0M A;  4B9W A;  5IT9 E;  2A6H C;  1I4P A;  3OOC A;  4OHJ A;  4ZK9 B;  1F9S A;  3R8B A;  2CW0 D;  2XIW A;  1EY8 A;  1JCK B;  3ONA B;  4BWG B;  1DON A;  4J8Q A;  3VYS A;  3D4D A;  2CVR A;  4K6D A;  4EQP A;  3Q22 A;  2AWO A;  4XQJ A;  1WTX A;  2JA8 B;  4R9W A;  4CJ1 B;  1I6V C;  4G57 A;  4PMW A;  1WTQ A;  2XN9 C;  5JVH 3;  3I8Z A;  5IOC A;  4V19 0;  1TS3 A;  1PTO C;  1JWS D;  1K83 B;  5DM6 3;  2XSC A;  1TY2 A;  1NUC A;  5TSS A;  2K7V A;  4EQN A;  1BBX C;  4KY5 A;  2OXP A;  1PFN A;  3EQL C;  1STG A;  2ZXP A;  3D4R A;  1F77 A;  2YU9 B;  1AZQ A;  1STH A;  1GUN A;  5T1I A;  5M5Y B;  1AZP A;  3MWY W;  3NTK A;  3K5N A;  2K5W A;  5J22 A;  2B2T C;  3VA5 A;  3QOJ A;  4U67 3;  3QG1 A;  3A8J E;  2JEB I;  3NHH A;  2LKV A;  3MA2 B;  2MP1 A;  1SSO A;  3K7A B;  1KTK A;  1IW7 C;  5CBA E;  1DYQ A;  2LS0 1;  1F2Y A;  2EY1 A;  3TZD A;  1YNN D;  3E0J A;  3T51 B;  5IGE A;  4RGN A;  1RD9 D;  4DXG A;  5JJZ A;  1B53 A;  2D9U A;  4C3H B;  5D14 A;  1E2V A;  4UAI A;  1SNC A;  1KNA A;  5CV5 A;  1VMP A;  2K5Q A;  3NK9 A;  1OXX K;  3BG3 A;  1VF7 A;  4WOR A;  4H7B A;  1ET9 A;  4RFB A;  5IT9 L;  4PMB A;  3H94 A;  2FFK B;  4IUU A;  2F0F A;  4MIU A;  3CU7 A;  4FXK C;  4PMC A;  1LAC A;  5D3I B;  1LO5 D;  5CR3 A;  1FNV A;  2IL8 A;  4M1U B;  4RGM A;  1X3P A;  2MPM A;  1WTP A;  5C5L A;  1JOO A;  2DNC A;  2SNS A;  2A69 D;  1PXU A;  4C3I B;  1G91 A;  1LLR D;  1S5E D;  1Z7T A;  4DFA A;  3Q6S A;  2F3W A;  1HFN A;  3A54 A;  1GOZ A;  2EPB A;  4KKT A;  4DAV A;  4FF2 A;  4QMG A;  2Z4H A;  3PUZ A;  4RAU C;  3JAM E;  3T16 A;  4CHT B;  1EY4 A;  2LY7 A;  3CHB D;  1II3 A;  4FVM A;  1S5D D;  4RHR A;  1RKN A;  4HTH A;  1RJT A;  2F0L A;  2G9H D;  1HUN A;  4A93 B;  3L7Z C;  1DZ1 A;  2B63 B;  2L0C A;  3TP7 A;  3K57 A;  4A3K B;  3S1M B;  4Y7N B;  2I07 B;  2HDL A;  4BS9 A;  5C4H A;  1GUO A;  1D5X C;  1OXT A;  2EOT A;  4K8I A;  2O2L D;  2BA0 A;  2I46 A;  2E74 C;  1BOS A;  4NP5 A;  4A3M B;  4HSP A;  1B9M A;  2JE6 I;  1PFM A;  1DOM A;  2KEC A;  1Q1B A;  4IUV A;  4ZKB B;  3D6C A;  5G3L D;  2BCO A;  3E5S A;  4DF7 A;  4KJN A;  2F0K A;  4XT3 B;  4KMU C;  2ZXO A;  1U4R A;  4QIW B;  2A5H A;  4Z9C B;  2AQ1 B;  1FR3 A;  1IYV A;  1BUV T;  2R93 B;  3P20 A;  1SNP A;  4TSS A;  2NVT B;  4ZQ3 A;  5M3M B;  3I72 A;  2IWH A;  2QF7 A;  1ICW A;  3FDT A;  4DAP A;  4KHV A;  1SDF A;  2QDB A;  3HKZ B;  2R7Z B;  1BCP B;  3QOL A;  3NQI A;  3SXH A;  3TP5 A;  1TS5 A;  2K6A A;  4HCE A;  5JPN C;  1EIG A;  5IGB A;  3SVM A;  2E75 C;  5KNB A;  1QOH A;  2JP1 A;  2KCC A;  3I90 A;  1B50 A;  1GHK A;  5HGT A;  4IUN A;  4C1N I;  3RLF A;  3BDO A;  1YNN C;  1XTC D;  5C0X J;  1E0B A;  1F2Z A;  2BDO A;  5ELE A;  2C5C A;  4B08 A;  1EWH A;  2Y0S B;  4L8J A;  2SEB D;  4L63 B;  3VR3 A;  3NBH A;  4NW2 A;  3J7A V;  2KUM A;  3VR4 A;  2K03 A;  3LWE A;  2Q8I B;  4RWS C;  5IGC A;  3R2T A;  2KED A;  5IOD A;  2D5D A;  3KBX A;  4R8I A;  2K32 A;  1ESR A;  3I4N B;  2EVB A;  1LV9 A;  2RA4 A;  3A56 A;  5EPL A;  5KGU A;  1ROD A;  1LTB D;  3GV3 A;  1HXY D;  2NN6 G;  2XVS A;  1EY5 A;  3URY A;  1JC7 A;  1LT6 D;  3S9W A;  1YNJ C;  4PQX A;  3TN2 A;  2B8F A;  1TWG B;  5ELC A;  1DXM A;  2FMM A;  1MSG A;  1A3V A;  1ILQ A;  3C46 A;  4FF3 A;  1Y69 U;  5M9O A;  1TR5 A;  2KVM A;  1SXT A;  1IYU A;  2VB3 X;  2EY2 A;  4HR7 B;  2TSS A;  5FOB B;  1O78 A;  1B3A A;  3ND9 A;  3DHQ A;  1LAB A;  2X6G A;  1R9T B;  2F3V A;  1KDA A;  3WDN A;  2PW5 A;  5CV4 A;  1H9K A;  1UEA B;  4PNY A;  1Y8P B;  3A8K E;  1PLF A;  2RVL A;  1AW7 A;  5I2X A;  1A3U A;  2MHV A;  1V1P B;  3A55 A;  2IJ0 A;  3HG9 A;  1KAB A;  1D1K A;  4F87 A;  2PMZ B;  3HS0 C;  4HMI A;  1EFI D;  4XDX A;  3J81 L;  3S2D B;  4A3G B;  4B9X A;  2V4D A;  4QF4 A;  2F0V A;  2NBF A;  2XWB B;  1I50 B;  1SJE D;  2A6E D;  1EY7 A;  2EJF C;  1TU2 B;  3P1H A;  3NQT A;  4IUR A;  2QIL A;  4Q0F A;  1KLG D;  4A3F B;  2ZXR A;  2SOB A;  5BN3 A;  5I6W A;  3FVQ A;  1AP0 A;  1KNE A;  2PPB C;  1JIC A;  1Y1V B;  1HTP A;  4G7Z C;  1Y8O B;  2X69 A;  5FLX L;  1MD2 D;  2O5I C;  2SNM A;  4ME5 A;  2F0Q A;  4KTA A;  2QEJ C;  4KK7 A;  1R4P B;  1R4Q B;  4CJ2 C;  1J8I A;  3MXP A;  1X3Q A;  1O7Y A;  3X3M A;  4P2C B;  2WII B;  3E6Z X;  3MXG A;  1GUS A;  3PUX A;  2RDG A;  3UI2 A;  5E4W C;  1EYC A;  2F0I A;  1G29 1;  1TVX A;  2NVQ B;  1PRT F;  2L55 A;  5BN4 A;  1V43 A;  3BS1 A;  3S1Q B;  3S17 B;  1FNW A;  2PO4 A;  5EBC A;  3VR6 A;  2E2H B;  3RD4 A;  3FPU B;  4X3U A;  1ILP A;  1CA6 A;  4A3J B;  2QKI C;  5G3L F;  1WD0 A;  4DK1 A;  4ODG A;  2EYM A;  5COR A;  1TWF B;  2KCN A;  1FGB D;  1S4Z A;  1C4Q A;  1TS4 A;  2RDF A;  4C2M B;  2PZU A;  5JEA G;  1DD2 A;  1EU4 A;  4A3B B;  4WFN 3;  3V96 A;  3S16 B;  1O7Z A;  4OIJ A;  1ET6 A;  4ULL A;  2NN6 I;  3RUZ A;  3H6M A;  4ID6 A;  3PIP 3;  3GTM B;  3GTK B;  1SE3 A;  3GTO B;  4IN3 A;  1WTR A;  2EDG A;  2DN8 A;  2E2I B;  2MGS A;  2ZT9 C;  3H91 A;  1DM0 B;  4K14 A;  2B2V C;  3GV6 A;  3MHB A;  2JEA I;  2D62 A;  2DY8 A;  2A6E C;  4F88 A;  1RDP D;  3HEJ A;  4X3K A;  3IFT A;  2B2Y A;  1U4L A;  3FEW X;  1FYC A;  5C3E B;  3HOU B;  2K28 A;  1NCV A;  2RBM A;  3WOE A;  2XNA C;  3GTG B;  2L4N A;  1SYC A;  1PRT D;  2XWJ B;  2EYP A;  2OEO A;  2AWN A;  4ZRZ A;  2H1E A;  5KEE A;  5AFW A;  4DA2 A;  2NZ1 D;  3SK6 A;  3M4Y A;  2XRQ D;  4K2K A;  2KHS A;  1LTS D;  1Q1E A;  3T13 A;  4KN7 C;  1PTO D;  2WV6 D;  3JAM L;  2H4O A;  2BOS A;  3K5O A;  1Q90 A;  1PFB A;  1ZEQ X;  3TDQ A;  1WTV A;  1BNZ A;  1KLU D;  1B2T A;  1D6E C;  4G7O C;  1HA6 A;  1SEB D;  5ELD A;  4FF4 A;  3I3C A;  3PUW A;  1WCM B;  1STY A;  3PMF A;  1TWH B;  1G2S A;  1NAP A;  3D6W A;  3TBI B;  1YNJ D;  3J80 E;  1UNS A;  5E4X A;  1Q3L A;  2VXW A;  3BVZ A;  3SK4 A;  4BY7 B;  4K5V A;  4IUP A;  1Q8I A;  2AQ3 B;  1XX8 A;  2F0P A;  1LTG D;  4HSV A;  1WD1 A;  1HRJ A;  3HOX B;  1PTO B;  2EYL A;  3EFX D;  3T4A C;  1QNK A;  2WAQ B;  5IIF A;  3EVQ A;  3MTS A;  4K5X A;  5ELF A;  5M5X B;  1HQR D;  3D4W A;  5KRU A;  1G2T A;  1BDO A;  3DM1 A;  1Y1W B;  4KN4 C;  1NSN S;  4ZLT F;  5JEA H;  1CK1 A;  4HCS A;  2O4X A;  1RTN A;  4BBR B;  2FHT A;  2WKD A;  3NWS A;  2K1B A;  3N6R A;  3IL8 A;  2IX1 A;  5E1F A;  1OXV A;  5CBE E;  3T53 B;  4S3S A;  3A7L A;  4IFD I;  3NWT A;  1H9S A;  1JQY D;  5LL6 S;  3A8I E;  1H9J A;  4KY6 A;  4CKE A;  1KAA A;  2IPK D;  3V2T A;  3D31 A;  5C3X A;  1ZYR D;  5KYI A;  1BR9 A;  2B2W A;  2B2T A;  4A3I B;  4IZ8 A;  5DM7 3;  3SK5 A;  1QB5 D;  2A69 C;  4QUC A;  1BO0 A;  4QB4 A;  4BA1 I;  1SFO B;  4UDU C;  1Q12 A;  1C48 A;  2K5D A;  4NMZ A;  3VYU A;  4FXD A;  1JOQ A;  1SNM A;  1SBB B;  2B2Y C;  2SDF A;  3LX0 A;  4DAY A;  2F0H A;  2NWG A;  2F03 A;  1A2T A;  4K2L A;  3I73 A;  1DOK A;  1GUG A;  3KLR A;  2F0D A;  1B9N A;  2NVY B;  5JPM C;  2F0S A;  4DU9 A;  4L6T B;  1GUW A;  5JVG 3;  3BZD B;  4LMQ D;  1MGS A;  3K0Y A;  4OO1 H;  5I9P A;  2KA7 A;  3CRL C;  2Z8L A;  1EEI D;  4IFD J;  4NDX A;  5IGD A;  2WIN B;  4N9P A;  3QIA A;  4G7H C;  3OIP A;  5C5M A;  3I91 A;  1LT5 D;  4C3J B;  2F0E A;  1LT3 D;  3K59 A;  1D5M C;  1QE6 A;  3QJY A;  4ILW A;  4IFD G;  5FLX E;  2JA6 B;  2E2J B;  2G9D A;  3BYT B;  2PYK A;  5I2Y A;  3L9A X;  4H13 C;  1ESF A;  1PTO F;  4FO2 A;  1JR0 D;  3W3A A;  5T1G A;  3M85 A;  3OPO A;  3CRK C;  1I3Q B;  4GZY C;  2B2V A;  1AEX A;  1GUT A;  2F0J A;  3NTH A;  1CT1 D;  1X32 A;  1EU3 A;  4KY7 A;  5CC4 A;  2M00 A;  2N55 A;  2NTT A;  1CZW A;  3LWU A;  3FMC A;  1IL8 A;  3D8G A;  4JK1 C;  4KKS A;  1F9Q A;  4I65 A;  1SYB A;  2WP8 J;  1DOL A;  4A3D B;  2R3Z A;  1JE4 A;  5DEH A;  5KND A;  2L11 A;  3K6O A;  4TRD A;  2J0T D;  2A73 B;  3BDL A;  3J81 E;  5M3F B;  3DEP A;  5KIX A;  3GTQ B;  4QCL A;  1ZYR C;  3G7L A;  1ENF A;  4IUQ A;  2L1B A;  5COY A;  2Z1C A;  1H9R A;  2EJG C;  3GO5 A;  1U4P A;  5CV7 A;  2EY6 A;  1A6X A;  5LHY 1;  5I9O A;  1LTA D;  5C0X G;  3DUZ A;  1UUP A;  4ZUJ A;  3TP8 A;  3T56 B;  3WOF A;  1G8Z D;  1BF4 A;  3Q23 A;  5CMD A;  2BDN A;  3NSW A;  1S5C D;  1IW7 D;  5FO8 B;  2YYZ A;  2X6L A;  4RHS A;  4IUT A;  4DK0 A;  3GQB A;  2F0N A;  1KDC A;  3NBI A;  4HMJ A;  4RGT A;  1RCV D;  4AYB B;  3MXU A;  1EQV A;  1SE2 A;  4KJO A;  1T5X D;  5IGF A;  1D1I A;  5K36 H;  2KEE A;  4KHZ A;  4RA8 A;  3SR1 A;  1RHP A;  5FK9 C;  4MHE A;  3BDC A;  1XWE A;  1Y8N B;  3MVV A;  3ND8 A;  3H09 A;  1A15 A;  3F2U A;  3KK7 A;  1PZK D;  3HZX A;  1W6K A;  2JSO A;  3SK8 A;  2JA5 B;  2RSN A;  1EY9 A;  2C9O A;  1HFG A;  1U4M A;  2EYF A;  1AN8 A;  1HPC A;  5EKI A;  2PQE A;  1BQQ T;  4C3J G;  5C0X H;  1Z47 A;  5EPK A;  5EKK A;  5BN5 A;  3HOZ B;  5C4J B;  1PZI D;  3MAQ A;  3R93 A;  3Q0A A;  3C1E A;  1TT2 A;  3DWP A;  3HP3 A;  1TWC B;  2NYZ D;  3IKJ A;  2HUG A;  4DN4 M;  2KOL A;  3BVG A;  2K33 A;  4CGY B;  4RKL A;  4DNT B;  1CQF A;  2EYH A;  1EYD A;  1F9P A;  1MI2 A;  4K6L A;  1SAP A;  4XTC S;  3AB9 A;  2BA1 A;  4CBV A;  3OHX C;  3AMU A;  3FPP A;  1RTO A;  1ENA A;  2NB0 A;  4ZAI A;  3LNN A;  1TWA B;  1TS2 A;  2FJ2 A;  1EYA A;  2VUM B;  5C6A A;  1NR2 A;  4F7X A;  2AUK A;  1K8M A;  1ML0 D;  5EPJ A;  3NTI A;  1MBY A;  4XXE A;  2EY5 A;  4CKC A;  3I4M B;  2PZT A;  1EZ8 A;  5CGK A;  3K5M A;  3SEB A;  3H0G B;  4OGQ C;  3J7Y W;  3VYR A;  1PRT B;  3SDZ A;  3TSS A;  4WRD A;  4LAA A;  4RH6 A;  2NTS A;  3KBG A;  4C3H G;  4ABN A;  1VDZ A;  3I70 A;  1I4Q A;  5KNC A;  3S1R B;  4IAL A;  5A2Q E;  5J39 A;  3K5L A;  3FRP B;  2KJX A;  1XYI A;  1JB3 A;  2JA7 B;  3NXW A;  2B8G A;  5J1Z A;  1XXG A;  4HN7 A;  2N88 A;  4BA2 I;  1H9S B;  1B4O A;  3R3O A;  1ZXT A;  3BYY B;  4XQN A;  4LK1 C;  1STA A;  1O7L A;  1SNO A;  1ZKO A;  2CHB D;  1KDB A;  3DXJ C;  4O1N A;  1RF2 D;  2FIN B;  2EE1 A;  1ONL A;  2CW0 C;  1WVL A;  1VCI A;  1O80 A;  5KYL A;  2HCC A;  1B44 D;  2A68 D;  1LTI D;  5D3D A;  4FYD A;  5ISR A;  5NUC A;  5K5P A;  3C3L A;  3HGB A;  3H3V C;  3U9O A;  4X3S A;  4A3E B;  3PO2 B;  2Z4I A;  2L5T A;  3PIO 3;  2R92 B;  1STB A;  3RZO B;  1STN A;  4LJZ C;  1CA5 A;  3S2H B;  1A3T A;  3A7A B;  2PNR C;  1I4X A;  3DWQ A;  1J9O A;  3MZ5 A;  2NN6 H;  3OWE B;  4XQQ A;  1HA5 A;  3OSO A;  4CKB A;  1HUM A;  3M3Y B;  2DY7 A;  4IFD H;  1FD7 D;  3L3O C;  2F0W A;  3VA7 A;  1A2U A;  1NR4 A;  1VMC A;  3DMU A;  3KF8 A;  3DWA A;  3R2I A;  4C1N K;  4J6H A;  4R8N A;  5M5W B;  3NPP A;  1BCP C;  5C4X B;  3P7J A;  3ERQ A;  4DGZ A;  3IAY A;  4X3T A;  3U9S A;  4KV6 A;  1T5E A;  4XIG S;  3TZU A;  1IHZ A;  5C3W A;  1JOK A;  4E6I A;  5FKA C;  4OO1 I;  1OO9 B;  4TQU S;  2R6G A;  1PYW D;  3V05 A;  2M9V A;  1QG7 A;  5DAU A;  4ZKC B;  2IX3 A;  1LTT D;  2NUC A;  1GXD C;  5IGG A;  4JBW A;  1GJX A;  3PUV A;  2M2L A;  1E2Z A;  1PRT C;  2MJ8 A;  5DNF A;  4M8A A;  1QWY A;  1SNQ A;  1EQT A;  1PDQ A;  3M4O B;  2JYO A;  3S15 B;  5CV8 A;  1QCB D;  5JOB A;  2J4X A;  1SE4 A;  4G4K A;  3HRZ C;  2F0O A;  3HOW B;  1SJH D;  2J7Z A;  5F2D A;  4OL7 A;  5E3F A;  1SND A;  3SHL A;  1PZJ D;  4DXF A;  1UAP A;  2F4I A;  4C56 C;  4OO1 G;  1EL0 A;  3M7G A;  2HDM A;  2ICI A;  4BBS B;  2RDH A;  1SMY D;  5CYU A;  3K58 A;  1B1Z A;  2ID0 A;  4U68 A;  2L9H A;  2QCP X;  4RCO A;  2LMC B;  4QUF A;  2A68 C;  1V8Q A;  1WTW A;  5EJW A;  2BE5 D;  1PMR A;  3GTP B;  4EQO A;  3P75 A;  1MSH A;  4H44 C;  5A2Q L;  2L12 A;  2AUJ D;  2PW7 A;  5K36 G;  5C4Z A;  1EZ6 A;  1U9R A;  1BCP F;  2F0U A;  2K04 A;  1ENC A;  1QIL A;  1JWU D;  2EYJ A;  1CTM A;  2VB2 X;  2ENB A;  2F0G A;  3NUC A;  3OWF A;  1H9M A;  3PV0 A;  5A35 A;  4K8J A;  3PUY A;  1D5Z C;  3X3N A;  3HOV B;  3MFY A;  5EBD A;  1DJR D;  3NE5 B;  1LTR D;  3GP7 A;  1CQV A;  1CHP D;  2IT1 A;  1EEF D;  2F1M A;  1HQM C;  2KQ3 A;  3KLS A;  3FKI B;  5JAV A;  1F2L A;  3QO2 A;  2D2C C;  1JWM D;  4F8M A;  3W2D A;  1I6H B;  4N9T A;  1IKL A;  4FXG C;  5I6Y A;  2RSO A;  3TP6 A;  4EGV A;  1TY0 A;  1TKW B;  3VR5 A;  4HAE A;  4RKB A;  4EVO A;  3GTL B;  3M7N A;  3MC0 B;  3MEH A;  3VYT A;  2EJM A;  3CKI B;  3PO3 B;  2A74 C;  2AQ2 B;  4NKL A;  2JXM B;  2R61 A;  3CQZ B;  2Q8T A;  3Q24 A;  3VR2 A;  3SE0 A;  1FNU A;  1M8A A;  2HQE A;  1S5B D;  1CHQ D;  3IFD A;  2LFN A;  4XYO A;  2PCF B;  3BVM A;  4RGO S;  1F9R A;  3AU7 A;  3DEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...