3A8JE

Crystal structure of et-ehred complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
126
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
total genus 32
structure length 126
sequence length 127
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8jE00
4IFDH 1E2ZA 2A6HD 1GUSA 4OO1G 4KKSA 4GZYC 2K7VA 1OXTA 2CW0C 3QIAA 2PNRC 2KA7A 3EQLC 1YNNC 1PMRA 4OGQC 3A8KE 2EDGA 3VR2A 3SE0A 1Y8OB 5JEAH 3VR5A 2EVBA 3PUYA 4H0LC 1CTMA 1OXVA 5KNDA 3I73A 3N6RA 1Q12A 3MFYA 2DNCA 3T51B 2B8GA 4DNTB 1TKWB 2F1MA 3D4RA 1E2VA 3A7LA 4JBWA 2DN8A 3M4YA 4L8JA 1Q90A 2O5IC 1OXXK 1H9SB 2E76C 1I6VC 3PUXA 5K36G 5JEAG 4KKTA 1O7LA 1GHJA 2D62A 4DK1A 5BN4A 1VDZA 1B9NA 1VCIA 3GQBA 1Q1BA 3T53B 3MXUA 2BA1A 5BN5A 1GUGA 3FPPA 3PUWA 4XTCS 4OO1H 2A69D 2BA0A 3D31A 1LACA 3M7NA 4IQZA 1GUNA 4KHZA 2A6HC 1Y8NB 2AWOA 4BA1I 3I72A 2D5DA 4KN4C 1HTPA 1T5EA 3OW7A 3QJYA 4KI0A 1H9RA 3SDZA 3TZUA 1HPCA 1Y8PB 1DXMA 1SMYC 1H9JA 3KLRA 3GD7A 3OOCA 1GUTA 1GHKA 5KNCA 2A68D 3PUVA 3WDNA 4HR7B 2NN6G 4KKUA 1O78A 1GJXA 2O5JC 2V4DA 5A35A 2EJGC 1FR3A 1QJOA 3QG1A 2KCCA 2BDOA 1DD2A 2BE5D 3IFTA 3BDOA 3A8IE 3DXJC 2A68C 2JE6I 3ND8A 3VA7A 4DK0A 4G7HC 2A6ED 3CRLC 1V43A 4G7ZC 2A69C 2D2CC 4LK1C 1CFMA 3HGBA 1IW7D 3P20A 1DCZA 2JEBI 2JXMB 3VR4A 3A8JE 2E74C 3PUZA 1VF7A 4TKOB 2JEAI 1ZKOA 4KMUC 2K33A 2QF7A 3FMCA 3RLFA 1HCZA 2AUKA 1H9KA 4H13C 3I4LA 1IYUA 2PCFB 2YYZA 1ONLA 1ZYRC 3ND9A 2EJMA 3LWUA 1B9MA 1CI3M 4PV1C 1OXSC 3A7AB 4XIGS 2NN6H 2Q8IB 1K8MA 4H44C 2K32A 2R6GA 1HQMC 3T56B 3H94A 2LMCB 1V8QA 1H9SA 4JK1C 4IFDG 4BA2I 4DNRB 1K8OA 3CRKC 3BG3A 2A6EC 1YNJC 4KN7C 1IYVA 2EJFC 3IKJA 3LNNA 5BN3A 1BDOA 1OXUA 2L5TA 5C0XG 1Y69U 2B8FA 1TU2B 1A6XA 4I7ZC 4G7OC 1IW7C 1Q1EA 5K36H 1H9MA 1Z6HA 3VR6A 3NE5B 1G291 3M85A 2AUJD 2PPBC 1GUOA 3W3AA 5KNBA 1Z7TA 2DNEA 4LJZC 1E2WA 2BE5C 3U9SA 3VR3A 1EWHA 2NN6I 4RCNA 3L7ZC 2IT1A 2ZT9C 5C0XH 2E75C 1VF5C 3PV0A 3OPOA 1LABA 4TQUS 3AB9A 1FYCA
chains in the Genus database with same CATH superfamily
3SK4A 2A73B 3EQLC 1YNNC 4N8FA 2AMCB 2D9UA 2EYPA 5ELCA 3GTQB 2R7ZB 2H5XA 4DAVA 4PG3A 2FXQA 1HZBA 2EIFA 1LT5D 2MP1A 1HZ9A 3T51B 4LFCQ 3FKIB 5FO8B 3V96A 5LHY1 1LT6D 2SEBD 1LUZA 1HFNA 2A74C 4L8JA 3K7UC 5IGCA 5JEAG 3GTJH 3J7A5 1B9NA 1CKNA 1VCIA 3GQBA 1Q1BA 3FPPA 1TWHH 3FEWX 4QUCA 4Z9CB 1HTPA 4ME3A 2E2IB 2JA8B 4POGA 3A5ZB 5FO7B 1VS0A 3M4QA 1SNMA 1FNWA 2VZAA 4A3CG 2KBNA 4DAYB 1GJXA 1QNUA 1SJED 4H02A 4OEMB 1VQKA 3GTJB 2QCPX 2N78A 2JJQA 3MZ5A 1CZGA 1N9WA 1V43A 4DV2Q 4YCVA 1MSHA 3HP3A 4TSSA 1X32A 1LTSD 4P73A 4IPHA 5AJ3L 1AE3A 1D5XC 5LMUQ 5IY0A 5C4JB 4PMWA 1F9RA 4AIMA 5E4XA 5T1GA 2F0SA 2CQOA 3CCJA 1NBWA 3U58A 2MJ8A 2IPKD 3D6WA 4YWKA 2Q8IB 4IUNA 4TRDA 2DY7A 4A3IG 1LV9A 2K32A 3KF8A 5M3MG 5IGBA 2NBFA 4BXXG 2LFNA 4DNRB 1SNCA 4S3SA 4IUVA 3D4WA 2CWPA 4X3UA 1U5KA 1STBA 4Q0FA 4B3TL 3RLNA 3I8ZA 4J8QA 4GKJL 2NTTA 4X6AH 1D5ZC 1YNND 4RFBA 3OWEB 2HD3A 5IGDA 5KNBA 1ILPA 3NELA 3VDYA 1GD7A 4OIJA 1BCPD 1I6HB 2HIVA 1PFBA 2IT1A 2JQOA 4R9WA 2J4XA 3OPOA 3UDXA 4XQNA 2JYOA 4OO1G 2BDNA 3QB3A 1ESRA 1PRTF 5EQ0A 4MTNA 3JAML 2EYLA 1D7QA 1VQ6A 4JBWA 3NWTA 3T1YL 2KHJA 5GROA 3SR1A 2K5WA 1I6HH 1STYA 2XNAC 5BN5A 5JOBA 3D31A 3M7NA 1Q82C 3PSIA 4BBRB 4KN4C 1C9OA 3KLWA 3KLRA 1B50A 1IBMQ 1TXYA 2E2JH 4WJWA 1Y1WH 5ISRA 4JI4L 2ENBA 3BYTB 1PRTC 2A5HA 2I5LX 1PH3A 3IFTA 3BDOA 1SJHD 2WKDA 2RA4A 2I0QA 2JE6I 3KDFB 5M5WB 4AYBG 1IBKL 3DM3A 1T9HA 1HR0Q 1T5XD 4HCEA 4DR3Q 1L1OA 5IT9c 1CFMA 1F9PA 2CH4W 5JAVA 5DAUA 1F2ZA 4ZYSA 1JJ2A 3JAMi 4A3DH 1HH2P 3S1NB 2E2JB 4DV4Q 1G8ZD 4HJ7A 2AUKA 4FDBA 2JN4A 5I6YA 3VYTA 1G2SA 2K5HA 1TQOA 1K3RA 5M5WH 4K5VA 5EJWA 2HDLA 3EROA 3OIPA 1Y1VG 2PW5A 4DXGA 4JOIC 2A8VA 3C1EA 1N36L 2F0QA 3BZCA 4X64L 4JG2A 1YNJC 3IKJA 3LNNA 1C7YA 3J7AV 4A3DB 2K5QA 4U673 2DUDA 1ET6A 1M1KC 4BY1B 5GAEC 4BBSG 1EIYB 1TWAH 1BCPF 4CJ1B 2KUMA 2NZ1D 5IGFA 1R9TH 4EQNA 1O7YA 3SGIA 4X62Q 1MIUA 3PV0A 1BQQT 1B2TA 3PQIA 2CCZA 4L5RC 1KABA 3N52A 3S1QB 1OXTA 3D3RA 2EDGA 1DOLA 2Z0SA 1L0XB 4WRDA 3VR5A 4H0LC 2PMZE 4XDXA 3MXNB 1Z9FA 3R8BA 4B3RL 4NW2A 3D4RA 2HT1A 4DAPA 1X3FA 3NQTA 4BBSB 2EYFA 3L2PA 4XQQA 2O5IC 1XTCD 1K3BC 3K6OA 4XYOA 4HJ8A 3F2DA 2VUMG 1SLJA 4CKBA 3S1QH 3PUWA 4ZUIA 1G51A 4IUQA 4CGYB 4A93B 2H1EA 3S1RB 2Z9HA 1DXMA 1KDCA 4N8X1 4LF9Q 2EOTA 4KHVA 1PH4A 1KRSA 1WTPA 1X3EA 3FKIG 3QOLA 5A35A 1XNRQ 2RDGA 4DR7Q 2C5CA 3SXHA 1VQIA 1GOZA 1HFGA 3MXGA 3H15A 1RD9D 1EU3A 4X3KA 3PF4A 1JICA 4LF6L 4AYBB 2NZHA 1IW7D 3I4NH 1S5BD 2DJGC 1ZXTA 2B2TC 2HQLA 1KRTA 2QA4A 4CJ2C 4LF7L 1Q86C 2IWHA 3MFGA 3MVVA 4IFDJ 3I2ZA 4LF8L 3E5SA 1HXYD 3PMFA 5EKLA 4POFA 4ZQ3A 1PV4A 3R3OA 5IIFA 4H13C 5FKAC 2KQ3A 4J1MA 4IUUA 2XVSA 3QOJA 3BS1A 4A3BB 4FF4A 3GO5A 3S14B 3A0JA 4DXFA 3W1GA 2L55A 2F0JA 3S2HH 2I07B 4XQJA 1U4PA 2EJFC 5C44H 3UI2A 3HS0C 3ONAB 4RKBA 2NVQH 1QE6A 3H0GH 1HNXQ 2AUJD 4N9TA 1VQMA 1KD1C 1WVLA 2PPBC 3TP7A 3UDIA 4WFN3 1MGSA 4IPDA 2K1BA 4FF1A 2N3SA 2IW3A 4C3IH 3K0YA 4K6DA 1XJVA 1VF5C 1IL8A 5M3FG 3C2PA 3S2HB 1AP0A 4PQXA 4GKKQ 3PF5A 2F0MA 1SR3A 1XYIA 3S24A 4MTKA 2JP1A 3D4DA 3SE0A 4JI6L 3H0GB 2FMCA 1SBBB 3K7AB 3GTMB 4X66Q 2PQEA 3KJPA 1EQVA 1MI2A 4P75A 2K5DA 4OONA 2E76C 4C3IB 1I4PA 1UEBA 3H6MA 1PH9A 2JA7B 2MPMA 3JC66 4DR1L 3T53B 1KQSA 2L9HA 4Y7NB 1B7YB 4ZK9B 5LMNL 1RODA 2XN9C 2Z6KA 3I72A 4RWSC 3W2DA 5HURA 4C3HH 1CA5A 1H9RA 1UAPA 1FD7D 2FHTA 3OOCA 3K7AH 3GD7A 1KHIA 3OIQA 1NSNS 1EOVA 3I4MG 4IOAA 5DM73 1M90C 1JE5A 1D2BA 4DV0L 5IODA 4WJ4A 1XPOA 4A3LH 1Q8KA 2UXDQ 5FK9C 4F88A 4RH6A 5IYDG 4IJHA 3CCSA 5CBAE 3TS2A 4JCVE 4BBRH 4CKEA 1HNXL 4RMFA 4K6LA 2Z6KC 3E9IA 2J0TD 1O7IA 4EQPA 2JEAI 2F0PA 4A3LG 3TP8A 2K33A 2IHEA 1EYDA 4KJNA 3MXNA 1G2TA 1I4HA 4UHVA 2UXCQ 1ZEQX 4H7BA 2PZTA 4QUFA 5JVH3 1ZYRD 2VY3A 2RSNA 5ELOA 3C1FA 4CBVA 1NR4A 4CDFC 1S5DD 3Q8DA 1A2UA 5T1IA 1VQDA 3BDLA 1X3QA 4QY7A 3S1NH 4KLKA 4QIWE 1IW7C 3MHBA 1VQ4A 1G291 2K03A 3NXWA 2E2HH 3EIVA 5FO9B 3DEOA 2K01A 3HZXA 2ZM6Q 2JA5B 5C44G 4EQ5A 3U4ZA 3HOWB 5HGTA 3K5NA 1PTOF 1PZJD 1XXGA 3TP5A 5LL6S 3S2DB 4JI8Q 1FNUA 3HOZH 5C6AA 4ZKCB 1SE8A 5TSSA 2VQEQ 2E2IH 1C8CA 4UY8C 1QZHA 4BY1H 5ELBA 1TWAB 5IP7G 2YV5A 4X64Q 1E1TA 2GA4B 3SVMA 4NDXA 2B2YA 5C3EB 4B3RQ 2JA5H 2MFIA 1IBLQ 4C1NI 2EXDA 2EYOA 5DNFA 1PZKD 3F2CA 3BU2A 3HOZB 4M1UB 3NEMA 2HHHQ 4MZ9A 1VQ9A 4QJFA 1Y8PB 2CH4A 3AU7A 3KF6B 1IBKQ 2N8NA 3K59A 1F77A 4PZ7A 3Q0AA 2N55A 4MN3A 3NUCA 4KKUA 4BBSH 2N88A 5C3EH 5D65A 3TRZA 1UNSA 1PZID 3QG1A 2Y0SG 4O0AA 2OWOA 3PO2B 3I55A 1EQQA 3PIPA 4QMGA 4LAAA 1X3GA 1RDPD 2ZTDA 2SDFA 1FJGQ 3MXPA 5JJZA 4R1JA 3ULPA 4DR1Q 2LSSA 3PUZA 3Q22A 1VF7A 2O4XA 1YHBA 4HJ5A 3RN2A 1EEFD 1N36Q 4FF3A 3HOVB 4ZUJA 3GTPH 1G91A 4I65A 2YYZA 1IYUA 5G3LD 1DZ1A 1VQFA 4CKCA 4TVAB 1YHAA 4DR6Q 4H44C 3GDEA 1BXTA 2MGSA 2SNSA 3CRKC 3TZDA 5M3MB 3AFPA 3I4NB 1QUQB 1CHQD 2D0PA 1SXTA 5A2QE 4A3IB 1PTOB 1NJIC 1UE5A 1SMXA 3BYYB 4F8MA 4YWMA 1QVFA 5C5MA 4DF7A 1X55A 3HOUG 1V1PB 1W2BA 4R8NA 1KIXA 5CORA 2ZTCA 3HOXG 1LTGD 3AB9A 2KEEA 2HIXA 5D3IB 1GUSA 4DUYQ 4XT1B 1PTOH 3EBEA 3HOYB 4DV5L 2EVBA 3T1HL 5E1FA 2OTJA 1K9MC 1Q12A 5CBEE 2Y0SE 5K36G 1NCVA 1II3A 3WWVA 3CPFA 1MBYA 4FXDA 1VDZA 1ENFA 2NYZD 3DUZA 3OMCA 5CV9A 3GV6A 4C2MH 4IFDI 2HHHL 5J1ZA 3RNUA 1GUNA 3RR5A 3HRZC 1JB7A 1PYBA 3HOYH 4IN3A 1L1OC 1EYCA 5CMDA 3J80E 2M00A 4KJOA 2B63G 3SDZA 4HJAA 1E7ZA 1EFWA 5J3BA 2NUCA 3MEFA 3SK5A 4GLVB 3HEJA 4KHPL 2MO1A 1CM9A 4EQOA 4QQBX 2KCCA 1QNKA 2BDOA 3I91A 2R92H 2B39A 1DD2A 4Y7NH 3ITPA 4ZRZA 3VA7A 2EZVA 1WD0A 4F7XA 2QDBA 2K4KA 3EFXD 1EFID 2HCCA 4YHHQ 5AFWA 1MKHA 2F0NA 5KRUA 4XXEA 1FVIA 2R93G 1YJ9A 5FJ8H 1PLFA 2MQHA 4OHJA 5G3LF 4KY6A 3K5OA 3X3NA 3K80C 1NMFA 2K75A 1NUCA 3ND9A 1SAPA 3VR4A 1ONLA 1SSOA 2LXKA 1I50B 1MD2D 2GN5A 4UDUC 4CDCC 3D6CA 2BOSA 4DUYL 5EBCA 4A3JH 1R9TB 1X65A 5EAYA 1HQMC 2B2VA 2NB0A 3DEPA 4ZCKA 1XNQL 3FP9A 4V190 1X6OA 3T4AC 2F4VQ 1BDOA 1PTOC 2HCIA 3CMAA 2LY7A 1Z6HA 3VR6A 3NE5B 3L9AX 4IPCA 3W3AA 3F2BA 1WYDA 1Z7TA 2MHVA 3HG9A 2BE5C 1HRJA 3OYYA 1C48A 3VR3A 2AQ3B 4RCNA 2XGTA 3EJIA 4PMBA 1LO5D 1LTBD 4X62L 1NMGA 1FYCA 1SMYD 1WCMB 2SNMA 2ZJPA 3KLSX 4HMJA 1SNDA 4M8AA 1EEID 4OGQC 3T16A 4KHPQ 4B3MQ 3S1RH 1EY9A 1SYFA 1HJPA 4OIKA 4CHTB 4YY3Q 5KNDA 1JOKA 4DNTB 4R4TA 1STAA 1AH9A 2UXCL 2HQEA 1Y1WG 2RQXA 5FLXL 3J81c 1I6VC 4YWLA 1YJNA 3FPUB 3MA2B 1RTNA 3E0EA 1XMOL 3MXUA 1GUGA 3NHHA 3TN2A 1JE4A 3S15B 1EY5A 1T5EA 1JCKB 3HKSA 5IE8A 4I7AA 3H3VC 3BVGA 3A74A 4KI0A 1SNQA 1LTAD 1HPCA 3GV3A 1VQOA 1C0AA 1WTXA 2IX1A 4AH6A 1BKBA 1XPRA 2NN6G 3NBHB 4G57A 1STHA 5IGEA 5EPJA 4B9WA 2CVRA 2JA6B 1STEA 2Q2IA 4DN4M 3OHXC 4B3SQ 4DR5L 2XTIA 2VB3X 4DV6Q 5CV4A 4X65L 3WOEA 1J5EL 3PGZA 1SE2A 1YIJA 3S15H 1D6EC 3HOZG 1G6PA 2KENA 1VQ5A 4NMZA 4J6HA 4OXPA 1LM0A 5C44B 2JA5G 2R92G 4GOPB 4DR7L 4OL7A 2NVQB 2ZJQA 2UUCQ 3J7AF 1H9KA 3J81E 5LL6X 1ASYA 4BWGB 3A7AB 1EWIA 4K5WA 4DA2A 1D5MC 5FJ8G 5E7NA 3S1MB 2EY1A 3M7GA 2R6GA 2K14A 1V8QA 5GQOA 4JK1C 1ENCA 5M3FH 3AQQA 1Y1VH 1WFQA 4BY7H 4JI2L 2B2UC 1BCPC 1TS4A 3QR8A 4HAEA 1FJGL 3NTKA 3DLLA 4A3KH 3NWSA 4JI0Q 1E2WA 1L2FA 5C4XB 1X9NA 1BF4A 3I56A 3S1MH 5IT9E 1A8VA 1GM5A 2ALYB 5J22A 2LS01 4FNFA 2P5ZX 5BN4A 3CHBD 1WTHA 3RLOA 1A2TA 3SK8A 3J81i 4IFDH 2R93H 2TMPA 4RGTA 1K8GA 1BVSA 4PZ8A 5CV5A 2TSSA 4A3IH 4L5SA 1PYSB 1AE2A 1L0WA 3TP6A 2Z8LA 4P71A 4FO2A 4B3SL 1DYQA 2VNUD 3CAMA 1A15A 2EYHA 4A3KB 4LUZA 4L5QA 5IWAL 3S9WA 4HSPA 1HUNA 1HTLD 4ULLA 4HTHA 1Q90A 3VYRA 4DFAA 3V2TA 2D62A 1QB5D 2RCFA 2BA1A 1PFMA 2CWAA 3NTIA 3WOFA 2NVYB 3IRBA 2F0UA 1I4XA 2UU9L 3UE0A 2YU9H 4NXMQ 3HKZG 3WDNA 1PRTD 4XYQA 3IFDA 1TVXA 1TWGH 1YITA 3HOVG 1LLRD 2MUYA 2F0FA 4NP5A 1HUMA 3AEVA 3HOUB 1N32Q 4DR2L 1KNEA 3J81L 1TIID 2B2TA 1BNZA 5FLXc 2QEJC 1CA6A 2JA8G 2NVYH 4ODGA 4GN5A 4FXKC 1SYCA 2UXBQ 3FDTA 5KIXA 3HGBA 3CKIB 1Y14B 4DV7Q 4JC0A 1S4ZA 1V1QA 4TKOB 1U9RA 2WP8J 4YIJA 3JAMc 1QCBD 1E1OA 2ES2A 2PI2A 2B2UA 2XWJB 5I2YA 2E2HB 4DK3C 5KEEA 2LXJA 3K8AA 2CKZB 3CMEA 1WTRA 3HOWH 3VYUA 3TQYA 1S5FD 2KECA 1CSQA 2UUAL 3H3VH 2UUBL 3S2DH 4CDDC 2NVXH 4A3BG 1OXUA 3FVQA 1UEAB 1RCVD 1IZ6A 1LTLA 2WV6D 1HNZL 3GTKB 2QGQA 5C3EG 4R8IA 3UE1A 1KNAA 3AFQA 4EGVA 4N9PA 1AZQA 1OTCA 3TREA 1E22A 5FLXE 3G4SA 4BY7G 5E3FA 1JOOA 1VMCA 1N32L 4NXNQ 5CC4A 4JV5Q 2RHQB 5IWAQ 2QDLA 4YHHL 1LTID 4HIKA 2KA7A 4XT3B 5CR3A 4LF6Q 2L0CA 2OTLA 2LKVA 5L37A 1OXVA 2AQ1B 2PNHA 2M9VA 4A3FB 5ELNA 1QVGA 3S17B 1HHVA 1SRUA 2DGYA 3MEHA 1LTTD 2B2WC 2E8GA 3PO2H 1PH6A 4IQZA 2I5HA 1Y8NB 4X66L 1EY7A 3J80c 3FHWA 1VMPA 3CCUA 2EYMA 1H9JA 4JYAL 2YTXA 1AFPA 1TWFH 2L11A 3I4OA 1IL2A 2RDFA 3S17H 4DR2Q 2O5JC 1GKHA 4L63B 2EXZA 1QJOA 1CKMA 3GTLH 3I4MH 3M3YH 3GTPB 4JBKA 3ERQA 3HKZB 2MNAA 1PDQA 1I4RA 3HFZB 1PFSA 1JWMD 2PQAB 4DK0A 1HNZQ 1YNXA 2F0TA 1FGBD 4G7ZC 1C4QA 3PO3B 4JI4Q 5IYDH 3R2IA 4A93G 4R4IA 1ESFA 1B8AA 2JEBI 4ZKBB 1K28A 2ZXOA 1WTVA 4FXGC 3I4MB 2B29A 4RG1A 1VQEA 3SEBA 2F3WA 2XIWA 1B9MA 3LWUA 3CCLA 5I9PA 1KAAA 1WTOA 1K0SA 1UUPA 3EN2A 4BA2I 1W6KA 4GOPC 2BH2A 4JYAQ 2F0VA 2PI2E 4LFAL 4L6TB 5GAGC 4DR3L 1QILA 2XWBB 3M85A 5EGTA 2PZWA 1AZPA 4K8JA 4L5TA 1EWHA 2KHSA 4YY3L 4MHEA 3S14H 1EYAA 3QWNA 1Q81C 1RJTA 1E2ZA 1I3QB 1J6QA 3TSSA 5GADC 4JV5L 1CZWA 1PMRA 4QF4A 3E0JA 4O1NA 5JEAJ 1Y8OB 2KCNA 4LF4L 1SNOA 1SN8A 3JAME 5M5XH 3PUYA 1XNRL 1D1KA 2OQKA 4JI7L 5C4XH 3STBD 3OWFA 2FFKB 5IP7H 3ZYYX 1TR5A 2X6GA 3H0GG 2R92B 5CYUA 2XSCA 2G5DA 5IYBH 4XTCS 2G9DA 4K5XA 2K5NA 5EPLA 4DV0Q 4KV6A 4P2CB 5IGGA 1M4VA 1MHWC 1N33L 2B2YC 2F0GA 4ZLTF 5C3WA 3GTMH 3A55A 1GHKA 1B70B 4HR7B 3OTOL 4DV3Q 4R4OA 4JVZA 2WB1E 2VXWA 4C3JB 3S16H 4A76A 3A8IE 1EOTA 3DXJC 1AW7A 2VW9A 4A3EB 4P74A 5C4HA 1BO0A 3RZDB 4UP9A 3CQZB 4UPAA 1DOMA 4O2DA 4LK1C 2D2CC 1VQJA 4RKLA 3LWEA 2YU9B 3S16B 4OWXB 2X6LA 2IY5B 2NVTH 1WI5A 2ATWA 1ZKOA 2RF4A 5M5YB 1XWEA 2PO4A 5AJ3Q 2ICEC 4PNYA 4LF8Q 1IHZA 4C3JH 5ELDA 3BZDB 1PTOD 4KK7A 4PV1C 3F8TA 1OXSC 2RHSB 2ICIA 1A3VA 3VA5A 3A56A 1D8LA 3CQZH 4ABNA 2RSOA 4GS3A 1EZ8A 3T56B 2XRQD 4DR4Q 1DM0B 4BS9A 1W3SA 3MAQA 5DLQE 1F9SA 1A0IA 1K83H 1S3OA 1GO3E 1WCMG 4GNXA 4YCWA 1I94Q 3NSWA 4WORA 1FL0A 3CP0A 2B8FA 4HCSA 4QIWB 3KUPA 2VUMH 3GTQH 1U4RA 3MC0B 1GVPA 1VQAA 1W6JA 1HNWQ 1DJRD 4Q5VA 1PH8A 2ZJRA 4HIDA 2DY8A 1IYJB 4F87A 4IO9A 4JI3Q 3G6JB 3PO3G 1HZCA 3BDCA 4KKSA 5IP9G 3ULJA 1DGSA 3A8KE 4OELB 2PMZB 4GKKL 3GP7A 2KCTA 5EBDA 2VUMB 1LYLA 5DEHA 1CTMA 3L0OA 3T13A 3KBXA 3N6RA 2C35B 2AWNA 3A7LA 1TS3A 4RGOS 3BZKA 2JA6H 4DR4L 4C56C 4GN4B 2QKIC 5JPMC 5CV8A 2K05A 5HY6A 1B4OA 5F2DA 3CC4A 1JWSD 1U4MA 1SMYC 1V1OA 1I94L 1TY0A 1S72A 3CCRA 5C4JH 4KTAA 1WJJA 4BY1G 4IALA 4LWCA 3VYSA 3Q23A 1BUVT 2B2VC 3CCEA 2A68C 3ND8A 4RHSA 4A3DG 2Q8RE 1D1IA 3MWYW 1J5EQ 1N34L 5M3FB 4CDEC 4EVOA 1GXDC 3F1ZA 1Y1VB 1HA5A 4BY7B 1TWFB 2GVBA 4PZ6A 4LFCL 3UDFA 3KJOA 4DV1Q 1Q8IA 1HZAA 2EJMA 2ZXPA 4AQYQ 1HR0W 2QILA 4RGNA 1CHPD 4JBJA 2Z4HA 1YNJD 2FINB 1K8OA 4FVMA 5IT9L 5CV6A 3BG3A 1ENAA 4B08A 4KN7C 1X56A 1BBUA 1SE3A 2L5TA 2ZTEA 2Q2HA 1Q1EA 3J81j 3HOVH 2KHIA 2F3IA 2Z6BA 5E4WC 4LUVA 2BH8A 4R4QA 3DWPA 3K58A 1JJGA 2NN6I 2KOLA 3NK9A 1M8AA 5DM63 2EYJA 1EL0A 1UE6A 1F2LA 2K50A 4GZYC 1EY4A 1EWCA 2PNRC 2IHFA 2AKWB 4DU9A 1VQ8A 1NAPA 3VR2A 5I2XA 1VQLA 1PYWD 4J15A 4OX9Q 2NTSA 1SEBD 3M4PA 4AYBE 3TS0A 4LF4Q 1IKLA 2WKCA 1Y1WB 2KJXA 3E6ZX 3M4YA 1J9OA 2J7ZA 4JI7Q 1H9SB 3K5LA 2WINB 5I9OA 1O7LA 1GHJA 1JC7A 3HOUH 1YBYA 4JI5L 2YTYA 1I3QH 4AQYL 3MTSA 5FOBB 1K8AC 2BA0A 4IJLA 1PRTB 3M9BA 4JI0L 2OCEA 3HKZE 3H09A 4LMQD 2AQ2B 5M5XB 3G48A 3TZUA 5H1SE 3NPPA 2F03A 4A3GB 3NP8A 1XTDA 1GUTA 1A63A 3PUVA 1N34Q 4LUOA 4O42A 3I7FA 1YJWA 1XNQQ 1O7ZA 1OO9B 3NTHA 3W1BA 2PZUA 2VQEL 4U68A 3RZOB 2IL8A 3C46A 4A4IA 2ZM6L 3OW2A 2UXBL 4HIMA 5CGKA 3LX0A 2VQFQ 2KCMA 5I4DA 3SHLA 2G9HD 4A3GH 4X3TA 2KVMA 3CCMA 3BJUA 3GTKH 1ICWA 1TY2A 1LT3D 1NY4A 1O80A 4A3KG 1GUWA 1VQPA 1HQRD 3ICEA 1NR2A 3M4OB 2EE1A 2PYKA 4K0KL 5C0XJ 1Q46A 1CSPA 3DM1A 4IFDG 4A3MG 3U9OA 4HIOA 4KD3A 1KDAA 1JORA 1VQHA 1HA6A 4RAUC 3CD6A 2PQAA 1SFOH 1V9PA 5C0XG 1VQNA 4GLXA 5M5YH 5C4XG 1UE7A 3P75A 2N49A 3E3XA 4DV7L 1ASZA 1KXLA 4A3JB 3PIP3 2UXDL 2WIIB 1CT1D 4RGMA 2WACA 4V0BA 3PCOB 1S40A 1LABA 2B63B 4IUTA 3SK6A 4OO1I 2A6HD 4Y52H 3T1YQ 1YEZA 2CW0C 3QIAA 4A93H 4A3MB 1HNWL 3NENA 1SFOB 1F2YA 5ELEA 3I70A 1H95A 4C3JG 4DR5Q 4ZAIA 3KFUA 3OMGA 1FGUA 1TWCH 4A3FG 1N33Q 3CC2A 5BR8L 3AYHB 1QOHA 1Z47A 3GTGB 1I4GA 3M3YB 4IZ8A 4C3HG 1S5CD 1LTRD 1WCMH 5ELFA 1YVCA 2WB1G 1WD1A 4OO1H 4JI5Q 3K0XA 1EU4A 4UP8A 1DOKA 3RD4A 4DAMA 4B9XA 2A6HC 2AWOA 4BA1I 1JWUD 4ILWA 4A75A 3QJYA 5JJIA 2R7ZH 1G6ZA 4DKAC 4DPGA 1B3QA 1PH1A 4NB3A 4DNIA 4EX5A 2JA6G 1TWCB 3CF5A 1ILQA 3K81C 1FR3A 2RKSA 4KY7A 2Q2UA 4UAIA 5FLMH 1NTGA 4IOCA 4NKLA 2B2WA 4G7HC 1TWHB 4NXML 1A62A 5EKKA 1ML0D 4MNOA 2OXPA 1JOQA 3I4NG 1NNXA 5JJLA 4R4CA 3KOJA 2JA8H 1B3AA 5K5PA 3A8JE 5FLMG 1UE1A 2Y0SB 1EY0A 4C3IG 3NQIA 3RLFA 2WAQE 3FRPB 4JI8L 1BBWA 1ZYRC 3URYA 1JB3A 4GKJQ 2NN6H 4LF5Q 2BCOA 2OT2A 1B1ZA 1K8MA 1SYGA 1VQBA 2LMCB 4JI1L 1H9SA 2I46A 4GN3B 2F4VL 5LMUL 4LF9L 3U50C 1BR9A 3BVMA 3QO2A 1IKMA 3D8GA 1RHPA 3PIO3 1Y69U 1IBLL 2X69A 1TU2B 3V05A 1KLUD 2K28A 1SNPA 4DV2L 2EQSA 1I5FA 2FJ2A 3G71A 4ID6A 2D0OA 3NBIA 4RCOA 3RN5A 1E3PA 4ME5A 3TBIB 2E5LL 3L7ZC 3LGJA 1PA6A 5C0XH 1SYDA 4LFAQ 1K73C 2F52A 2EY5A 4JPBW 1L1OB 4B3ML 1P16A 3KBGA 2CHBD 2K7VA 4DUZQ 1QUQA 1J8IA 1MSGA 3CXCA 2Q8TA 1BCPB 2JA9A 3OSOA 1KAWA 1WTWA 4C3HB 1XMQL 5NUCA 5JJKA 2QW7A 3C3LA 4IURA 2GVAA 3ER0A 2DN8A 1A3TA 1X3PA 2H4OA 2F0HA 4KKTA 1IXRA 2R93B 1DONA 4YCUA 2L12A 2A69D 2Z1CA 3RZDH 3KF8B 1RKNA 1CQFA 3OW7A 5COYA 5D14A 4X3SA 5M9OA 3HOXH 3RMHA 2HUGA 3EA6A 4MIUA 2CW0D 5KNCA 2WAQG 3KLSA 1B44D 3RUZA 3OTOQ 3PIOA 3GTOH 2V4DA 1CK1A 2EJGC 1E24A 2CQAA 1JR0D 2K5VA 2WAQB 2R7ZG 2BE5D 3A54A 1ET9A 4LW1A 3G7LA 2A6ED 5C3XA 2EPBA 3X3MA 3CRLC 1F9QA 1TS5A 2A69C 2DJFC 4ALPA 1UWVA 2F0IA 4HSVA 4OX9L 1K83B 1XX8A 3I3CA 1DCZA 3D0FA 1STNA 3HOXB 4DR6L 2E74C 5EPKA 3B6YA 3AMUA 4KMUC 3K5MA 1TWGB 3O13A 1XMQQ 4DAYA 3KK7A 3GTOB 1RF2D 1HR0L 4FP5D 3IAYA 1AN8A 2MO0A 2RBMA 2R3ZA 1WOCA 1JT8A 1XPUA 4DV3L 2UUAQ 1SDFA 1F2MA 3H91A 1MJCA 4KD4A 4DV4L 5IP9H 2F0DA 2I5MX 4DGZA 1IYVA 4JI3L 4IPGA 4X65Q 1U4LA 1RIPA 4G7OC 5K36H 1H9MA 3ERSX 3DWQA 2R7DA 4A3CH 1KL9A 3CU7A 1EIGA 5IYCH 2DNEA 4LFBL 4JI6Q 2JK8A 1Q3LA 3NBHA 3CCQA 1YI2A 4A3GG 1CKNB 1EQRA 4QB4A 4WJ3M 5IYBG 3H3VI 2NVXB 1KLGD 1PFNA 3KDFA 1B53A 4DUZL 1JMCA 1VQCA 3TDQA 3K57A 3P7JA 5LMNQ 2B8GA 1TKWB 3P1HA 2ASBA 2A19A 4K14A 3CC7A 1EUJA 2RCNA 2R7FA 1TT2A 2B63H 5BR8Q 5HGQA 3IL8A 4APVA 4G4KA 1S5ED 1YZ6A 4A3MH 1LACA 1N8RC 4KHZA 1PH2A 3TMEA 2QEXA 4RA8A 3J80L 2NZOA 4NPSA 4A3FH 1SYEA 1O78A 5J39A 2VQFL 1PXUA 2IJ0A 4P72A 3EVQA 2XRSD 1V1PA 3CW2C 4HEDA 3UDGA 1A3UA 2Z4IA 4DV1L 2JSOA 4K2KA 3CPWA 4GNXB 2ID0A 1WTQA 1CUKA 1KTKA 4JBMA 4K8IA 5M3MH 3P20A 3R93A 2JXMB 3U4VA 4A3JG 1EIHA 4CJ0B 1EZ6A 2A1AA 1KC8C 2QF7A 4NXNL 1HCZA 1VQGA 3GTLB 2PCFB 2R61A 2OQ0A 4B3TQ 1CI3M 1SE4A 2K52A 4XIGS 5EKIA 5C0XI 2YTVA 1SYBA 4C1NK 2VS1A 1RL2A 1SROA 2V1CC 3PO3H 2L1BA 4LFBQ 4JI1Q 4HMIA 3L3OC 2A6EC 5BN3A 1EYGA 3HOWG 1A6XA 4I7ZC 4FF2A 5C4ZA 4QCLA 3R2TA 2F0EA 5D3DA 1GUOA 1L0YB 1TS2A 4QGUA 3Q24A 2O2LD 2L4NA 4LF7Q 3DWAA 3KYHC 2OF1A 4JOIA 4A3BH 4GLAC 1AEXA 1STGA 3HOYG 2ZXRA 2ZT9C 4TQUS 5C5LA 3KF6A 2PW7A 2SOBA 4K2LA 4LNQA 1R4QB 4C2MB 1EY6A 1Q7YC 1QVCA 4GOPA 3E9HA 1U0LA 5JEAH 2F0LA 5LMNW 4GNXC 1PH5A 3I73A 3STBC 3MFYA 2DNCA 2F1MA 1QZGA 1E2VA 4RHRA 5JVG3 1R4PB 4PMCA 1OXXK 3PUXA 5KYIA 1RTOA 1FNVA 2EY6A 3DMUA 4DK1A 2IX3A 4HN7A 3RZOH 5JPNC 2F0KA 1QWYA 4HJ9A 1K0RA 3ULLA 1YHQA 2Q2TA 1PHJA 2FMMA 1XMOQ 1BOSA 4KY5A 1KDBA 2D5DA 5CV7A 2E5LQ 3BVZA 2UUBQ 2VL6A 1BBXC 4BXXH 1IBML 2F0OA 5IYCG 1E0BA 1PH7A 2A68D 3J80i 5GAHC 1EIFA 1EY8A 4FYDA 5KGUA 5IOCA 5A2QL 5I6WA 2JA7H 2K6AA 2RDHA 1I50H 4JI2Q 3M4OH 2E2DC 2IX0A 3G6EA 2RVLA 2OEOA 3Q6SA 4OWWB 2C9OA 1QG7A 2B3GA 2F0WA 2VB2X 4OWTB 4A3EG 4LF5L 1ICFB 1PVOA 1JQYD 2JA7G 1EQTA 1JJCB 2F3VA 3FMCA 1CQVA 2HDMA 1NE3A 2K04A 4DK6C 3I4LA 4QL5A 2KEDA 5KYLA 4A3EH 1MJEA 3J7YW 3CCVA 3H94A 4BBRG 2L15A 2UU9Q 4K0KQ 1I4QA 2WB1B 3F2UA 3A5UA 3DHQA 2NVTB 4DV6L 3J7ZC 3I90A 2WFWA 2CFMA 3W5OA 3PO2G 1X54A 2F4IA 2NWGA 3TEHB 1P8LA 4JW0A 1VQ7A 4UP7A 3FKIH 2EY2A 2M2LA 4LJZC 3U9SA 4DV5Q 3ZJYC 3T1HQ 2AHOB 4E6IA 3GTGH 2E75C 2UUCL 4IUPA 1CKOA 1LT4D
chains in the Genus database with same CATH topology
3SK4A 2A73B 3EQLC 1YNNC 2D9UA 2EYPA 5ELCA 3GTQB 2R7ZB 4DAVA 1LT5D 2MP1A 3T51B 3FKIB 5FO8B 3V96A 5LHY1 1LT6D 2SEBD 1HFNA 2A74C 4L8JA 5IGCA 5JEAG 1B9NA 1VCIA 3GQBA 1Q1BA 3FPPA 4QUCA 3FEWX 4Z9CB 1HTPA 2E2IB 2JA8B 5FO7B 1SNMA 1FNWA 1GJXA 1QNUA 1SJED 3GTJB 2QCPX 3MZ5A 1CZGA 1V43A 1MSHA 3HP3A 4TSSA 1X32A 1LTSD 1D5XC 5C4JB 4PMWA 1F9RA 5E4XA 5T1GA 2F0SA 2MJ8A 2IPKD 3D6WA 2Q8IB 4IUNA 4TRDA 2DY7A 1LV9A 2K32A 3KF8A 5IGBA 2NBFA 2LFNA 4DNRB 1SNCA 4S3SA 4IUVA 3D4WA 4X3UA 4Q0FA 1STBA 3I8ZA 4J8QA 2NTTA 1D5ZC 1YNND 4RFBA 3OWEB 5IGDA 5KNBA 1ILPA 4OIJA 1BCPD 1I6HB 2IT1A 1PFBA 4R9WA 2J4XA 3OPOA 4XQNA 2JYOA 4OO1G 2BDNA 3QB3A 1ESRA 1PRTF 5EQ0A 3JAML 2EYLA 4JBWA 3NWTA 3SR1A 2K5WA 1STYA 2XNAC 5BN5A 5JOBA 3D31A 3M7NA 4BBRB 4KN4C 3KLRA 1B50A 4WJWA 5ISRA 2ENBA 3BYTB 1PRTC 2A5HA 3IFTA 3BDOA 1SJHD 2WKDA 2RA4A 2JE6I 5M5WB 1T5XD 4HCEA 1CFMA 1F9PA 5JAVA 5DAUA 1F2ZA 4ZYSA 3S1NB 2E2JB 1G8ZD 2AUKA 5I6YA 3VYTA 1G2SA 1TQOA 4K5VA 5EJWA 2HDLA 3EROA 3OIPA 2PW5A 4DXGA 3C1EA 2F0QA 1YNJC 3IKJA 3LNNA 3J7AV 4A3DB 2K5QA 4U673 1ET6A 4BY1B 1BCPF 4CJ1B 2KUMA 2NZ1D 5IGFA 4EQNA 1O7YA 3PV0A 1BQQT 1B2TA 1KABA 3N52A 3S1QB 1OXTA 3D3RA 2EDGA 1DOLA 1L0XB 4WRDA 3VR5A 4H0LC 4XDXA 3R8BA 4NW2A 3D4RA 4DAPA 4BBSB 3NQTA 2EYFA 2O5IC 4XQQA 1XTCD 3K6OA 4XYOA 4CKBA 3PUWA 4ZUIA 4IUQA 4A93B 4CGYB 2H1EA 3S1RB 1DXMA 1KDCA 2EOTA 4KHVA 1WTPA 3QOLA 5A35A 2RDGA 2C5CA 3SXHA 1GOZA 1HFGA 3MXGA 1RD9D 1EU3A 4X3KA 1JICA 4AYBB 1IW7D 1S5BD 1ZXTA 2B2TC 4CJ2C 2IWHA 3MFGA 3MVVA 4IFDJ 3E5SA 1HXYD 3PMFA 5EKLA 4ZQ3A 3R3OA 5IIFA 4H13C 5FKAC 2KQ3A 4J1MA 4IUUA 2XVSA 3QOJA 3BS1A 4A3BB 4FF4A 3GO5A 3S14B 4DXFA 2L55A 2F0JA 2I07B 4XQJA 1U4PA 2EJFC 3UI2A 3HS0C 3ONAB 4RKBA 1QE6A 2AUJD 4N9TA 2PPBC 1WVLA 3TP7A 4WFN3 1MGSA 2K1BA 4FF1A 2IW3A 3K0YA 4K6DA 1VF5C 1IL8A 3C2PA 3S2HB 1AP0A 4PQXA 2F0MA 1XYIA 2JP1A 3D4DA 3SE0A 3H0GB 2FMCA 1SBBB 3K7AB 3GTMB 2PQEA 1EQVA 1MI2A 2K5DA 4C3IB 2E76C 1I4PA 3H6MA 2JA7B 2MPMA 3T53B 2L9HA 4Y7NB 4ZK9B 1RODA 2XN9C 3I72A 4RWSC 3W2DA 5HURA 1CA5A 1H9RA 1UAPA 1FD7D 2FHTA 3OOCA 3GD7A 3OIQA 1NSNS 5DM73 1D2BA 5IODA 5FK9C 4F88A 4RH6A 5CBAE 4CKEA 4K6LA 2J0TD 4EQPA 2JEAI 2F0PA 3TP8A 2K33A 1EYDA 4KJNA 3MXNA 1G2TA 1I4HA 1ZEQX 4H7BA 2PZTA 4QUFA 5JVH3 1ZYRD 2RSNA 3C1FA 4CBVA 1NR4A 1S5DD 1A2UA 5T1IA 3BDLA 1X3QA 1IW7C 3MHBA 1G291 2K03A 3NXWA 5FO9B 3DEOA 2K01A 3HZXA 2JA5B 3HOWB 5HGTA 3K5NA 1PTOF 1PZJD 1XXGA 3TP5A 5LL6S 3S2DB 1FNUA 5C6AA 4ZKCB 5TSSA 1C8CA 5ELBA 1TWAB 2GA4B 3SVMA 4NDXA 2B2YA 5C3EB 4C1NI 2EYOA 5DNFA 1PZKD 3HOZB 4M1UB 1Y8PB 3AU7A 3K59A 1F77A 3Q0AA 2N55A 4MN3A 3NUCA 4KKUA 2N88A 5D65A 1UNSA 1PZID 3QG1A 3PO2B 4QMGA 4LAAA 1RDPD 2SDFA 3MXPA 5JJZA 3PUZA 3Q22A 1VF7A 2O4XA 1EEFD 4FF3A 3HOVB 4ZUJA 1G91A 4I65A 1IYUA 2YYZA 5G3LD 1DZ1A 4CKCA 4H44C 1BXTA 2MGSA 2SNSA 3CRKC 3TZDA 5M3MB 3I4NB 1CHQD 1SXTA 5A2QE 4A3IB 1PTOB 3BYYB 4F8MA 5C5MA 4DF7A 1V1PB 4R8NA 5CORA 1LTGD 3AB9A 2KEEA 5D3IB 1GUSA 4XT1B 1PTOH 3HOYB 2EVBA 5E1FA 1Q12A 5CBEE 5K36G 1NCVA 1II3A 1MBYA 4FXDA 1VDZA 1ENFA 2NYZD 3DUZA 3OMCA 5CV9A 3GV6A 4IFDI 5J1ZA 1GUNA 3HRZC 4IN3A 5CMDA 1EYCA 3J80E 2M00A 4KJOA 3SDZA 2NUCA 3SK5A 3HEJA 1CM9A 4EQOA 2KCCA 1QNKA 2BDOA 3I91A 1DD2A 2B39A 3ITPA 4ZRZA 3VA7A 2EZVA 1WD0A 4F7XA 2QDBA 3EFXD 1EFID 2HCCA 5AFWA 2F0NA 5KRUA 4XXEA 1PLFA 4OHJA 5G3LF 4KY6A 3K5OA 3X3NA 1NUCA 3ND9A 1SAPA 3VR4A 1ONLA 1SSOA 3S16B 1I50B 1MD2D 4UDUC 2BOSA 3D6CA 5EBCA 1R9TB 1HQMC 2B2VA 2NB0A 3DEPA 4V190 3T4AC 1BDOA 1PTOC 2HCIA 2LY7A 1Z6HA 3VR6A 3NE5B 3L9AX 3W3AA 1Z7TA 2MHVA 3HG9A 2BE5C 1HRJA 1C48A 3VR3A 2AQ3B 4RCNA 3EJIA 4PMBA 1LO5D 1LTBD 1FYCA 1SMYD 1WCMB 2SNMA 3KLSX 4HMJA 1SNDA 4M8AA 1EEID 4OGQC 3T16A 1EY9A 1SYFA 4OIKA 4CHTB 5KNDA 1JOKA 4DNTB 1STAA 2HQEA 2RQXA 5FLXL 1I6VC 3FPUB 3MA2B 1RTNA 3MXUA 1GUGA 3NHHA 3TN2A 1JE4A 3S15B 1EY5A 1T5EA 1JCKB 3H3VC 3BVGA 4KI0A 1SNQA 1LTAD 1HPCA 3GV3A 1WTXA 2IX1A 2NN6G 4G57A 1STHA 5IGEA 5EPJA 4B9WA 2CVRA 2JA6B 1STEA 4DN4M 3OHXC 2VB3X 5CV4A 3WOEA 1SE2A 1D6EC 4NMZA 4J6HA 5C44B 4OL7A 2NVQB 3J7AF 1H9KA 3J81E 5LL6X 4BWGB 3A7AB 4K5WA 4DA2A 1D5MC 3S1MB 2EY1A 3M7GA 2R6GA 1V8QA 4JK1C 1ENCA 2B2UC 1BCPC 1TS4A 4HAEA 3NTKA 3NWSA 1E2WA 5C4XB 1BF4A 5IT9E 5J22A 2LS01 4FNFA 5BN4A 3CHBD 3SK8A 4IFDH 1A2TA 2TMPA 4RGTA 5CV5A 2TSSA 3TP6A 2Z8LA 4FO2A 1DYQA 2VNUD 1A15A 2EYHA 4A3KB 3S9WA 4HSPA 1HUNA 1HTLD 4ULLA 4HTHA 3VYRA 1Q90A 4DFAA 3V2TA 2D62A 1QB5D 2BA1A 1PFMA 3NTIA 3WOFA 2NVYB 2F0UA 1I4XA 3WDNA 1PRTD 4XYQA 3IFDA 1TVXA 1LLRD 2MUYA 2F0FA 4NP5A 1HUMA 3HOUB 1KNEA 3J81L 1TIID 2B2TA 1BNZA 2QEJC 1CA6A 4ODGA 4FXKC 1SYCA 3FDTA 5KIXA 3HGBA 3CKIB 1S4ZA 4TKOB 1U9RA 2WP8J 4YIJA 1QCBD 2B2UA 2XWJB 5I2YA 2E2HB 5KEEA 1WTRA 3VYUA 1S5FD 2KECA 1OXUA 3FVQA 1UEAB 1RCVD 2WV6D 3GTKB 4R8IA 1KNAA 4EGVA 4N9PA 1AZQA 5FLXE 5E3FA 1JOOA 1VMCA 5CC4A 1LTID 2KA7A 4XT3B 5CR3A 2L0CA 2LKVA 1OXVA 2AQ1B 2M9VA 4A3FB 3S17B 1HHVA 3MEHA 1LTTD 2B2WC 4IQZA 1Y8NB 1EY7A 1VMPA 2EYMA 1H9JA 1AFPA 2L11A 2RDFA 2O5JC 4L63B 2EXZA 1QJOA 3GTPB 3ERQA 3HKZB 1PDQA 1I4RA 4DK0A 1JWMD 2F0TA 1FGBD 4G7ZC 1C4QA 3PO3B 3R2IA 1ESFA 2JEBI 4ZKBB 2ZXOA 1WTVA 4FXGC 3I4MB 3SEBA 2F3WA 2XIWA 1B9MA 3LWUA 5I9PA 1KAAA 1WTOA 1UUPA 4BA2I 1W6KA 2F0VA 4L6TB 1QILA 2XWBB 3M85A 5EGTA 2PZWA 1AZPA 4K8JA 1EWHA 2KHSA 4MHEA 1EYAA 3QWNA 1RJTA 1E2ZA 1I3QB 3TSSA 1CZWA 1PMRA 4QF4A 3E0JA 4O1NA 5JEAJ 1Y8OB 2KCNA 1SNOA 3JAME 3PUYA 1D1KA 3OWFA 2FFKB 3ZYYX 1TR5A 2X6GA 2R92B 5CYUA 2XSCA 4XTCS 2G9DA 4K5XA 5EPLA 4KV6A 4P2CB 5IGGA 1M4VA 2B2YC 2F0GA 4ZLTF 5C3WA 3A55A 1GHKA 4HR7B 2VXWA 4C3JB 3A8IE 1EOTA 3DXJC 1AW7A 4A3EB 5C4HA 1BO0A 3RZDB 3CQZB 1DOMA 2D2CC 4LK1C 4RKLA 3LWEA 2YU9B 2X6LA 1ZKOA 5M5YB 1XWEA 2PO4A 2ICEC 4PNYA 1IHZA 5ELDA 3BZDB 1PTOD 4KK7A 4PV1C 1OXSC 2ICIA 1A3VA 3VA5A 3A56A 4ABNA 2RSOA 1EZ8A 3T56B 2XRQD 1DM0B 4BS9A 3MAQA 1F9SA 3NSWA 4WORA 2B8FA 4HCSA 4QIWB 3KUPA 1U4RA 3MC0B 1W6JA 1DJRD 4Q5VA 2DY8A 4F87A 3G6JB 3BDCA 4KKSA 3A8KE 2PMZB 3GP7A 5EBDA 2VUMB 5DEHA 1CTMA 3T13A 3KBXA 3N6RA 2AWNA 3A7LA 1TS3A 4RGOS 4C56C 2QKIC 5JPMC 5CV8A 2K05A 1B4OA 5F2DA 1JWSD 1U4MA 1SMYC 1V1OA 1TY0A 4KTAA 4IALA 3VYSA 3Q23A 1BUVT 2B2VC 2A68C 3ND8A 4RHSA 2Q8RE 1D1IA 3MWYW 5M3FB 4EVOA 1GXDC 1Y1VB 1HA5A 4BY7B 1TWFB 1Q8IA 2EJMA 2ZXPA 2QILA 4RGNA 1CHPD 2Z4HA 1YNJD 2FINB 1K8OA 4FVMA 5IT9L 5CV6A 3BG3A 1ENAA 4B08A 4KN7C 1SE3A 2L5TA 1Q1EA 5E4WC 3DWPA 3K58A 2NN6I 2KOLA 3NK9A 1M8AA 5DM63 2EYJA 1EL0A 1F2LA 4GZYC 1EY4A 1EWCA 2PNRC 4DU9A 1NAPA 3VR2A 5I2XA 1PYWD 2NTSA 1SEBD 1IKLA 2WKCA 1Y1WB 2KJXA 3E6ZX 3M4YA 1J9OA 2J7ZA 3K5LA 1H9SB 2WINB 5I9OA 1O7LA 1GHJA 1JC7A 3MTSA 5FOBB 2BA0A 1PRTB 3H09A 4LMQD 2AQ2B 5M5XB 3TZUA 3NPPA 2F03A 4A3GB 3NP8A 1GUTA 3PUVA 4O42A 1O7ZA 1OO9B 3NTHA 2PZUA 4U68A 3RZOB 2IL8A 3C46A 5CGKA 3LX0A 5I4DA 3SHLA 2G9HD 4X3TA 2KVMA 1ICWA 1TY2A 1LT3D 1O80A 1GUWA 1HQRD 1NR2A 3M4OB 2EE1A 2PYKA 5C0XJ 3DM1A 4IFDG 3U9OA 4KD3A 1KDAA 1JORA 1HA6A 4RAUC 5C0XG 3P75A 4A3JB 3PIP3 2WIIB 1CT1D 4RGMA 2WACA 4V0BA 1LABA 2B63B 3SK6A 4IUTA 4OO1I 2A6HD 2CW0C 3QIAA 4A3MB 1SFOB 1F2YA 5ELEA 3I70A 4C3JG 4ZAIA 3OMGA 1QOHA 1Z47A 3GTGB 1I4GA 3M3YB 4IZ8A 4C3HG 1S5CD 1LTRD 5ELFA 1WD1A 4OO1H 1EU4A 1DOKA 3RD4A 4B9XA 2A6HC 2AWOA 4BA1I 1JWUD 4ILWA 3QJYA 1G6ZA 1TWCB 1ILQA 1FR3A 2RKSA 4KY7A 4UAIA 4NKLA 2B2WA 4G7HC 1TWHB 5EKKA 1ML0D 2OXPA 1JOQA 1B3AA 5K5PA 3A8JE 2Y0SB 1EY0A 4C3IG 3NQIA 3RLFA 3FRPB 1ZYRC 3URYA 1JB3A 2NN6H 2BCOA 2OT2A 1B1ZA 1K8MA 1SYGA 2LMCB 1H9SA 2I46A 1BR9A 3BVMA 3QO2A 1IKMA 3D8GA 1RHPA 3PIO3 1Y69U 2X69A 1TU2B 3V05A 1KLUD 2K28A 1SNPA 2FJ2A 4ID6A 4RCOA 3NBIA 4ME5A 3TBIB 3L7ZC 5C0XH 1SYDA 2EY5A 3KBGA 2CHBD 2K7VA 1J8IA 1MSGA 2Q8TA 1BCPB 3OSOA 1WTWA 4C3HB 5NUCA 3C3LA 4IURA 2DN8A 1A3TA 1X3PA 2H4OA 2F0HA 4KKTA 2R93B 1DONA 2L12A 2A69D 2Z1CA 1RKNA 1CQFA 3OW7A 5COYA 5D14A 4X3SA 5M9OA 3RMHA 2HUGA 3EA6A 4MIUA 2CW0D 5KNCA 3KLSA 1B44D 3RUZA 2V4DA 1CK1A 2EJGC 2CQAA 1JR0D 2WAQB 2BE5D 3A54A 1ET9A 3G7LA 2A6ED 5C3XA 2EPBA 3X3MA 3CRLC 1F9QA 1TS5A 2A69C 2F0IA 4HSVA 1K83B 1XX8A 3I3CA 1DCZA 1STNA 3HOXB 2E74C 5EPKA 3AMUA 4KMUC 3K5MA 1TWGB 3O13A 4DAYA 3KK7A 3GTOB 1RF2D 4FP5D 3IAYA 1AN8A 2RBMA 2R3ZA 1SDFA 1F2MA 3H91A 4KD4A 2F0DA 4DGZA 1IYVA 1U4LA 4G7OC 5K36H 1H9MA 3DWQA 3CU7A 1EIGA 2DNEA 3NBHA 1Q3LA 4QB4A 2NVXB 1KLGD 1PFNA 1B53A 3TDQA 3K57A 3P7JA 2B8GA 1TKWB 3P1HA 4K14A 1TT2A 3IL8A 4G4KA 1S5ED 1LACA 4KHZA 3TMEA 4RA8A 3J80L 1SYEA 1O78A 5J39A 1PXUA 2IJ0A 3EVQA 2XRSD 1V1PA 4HEDA 1A3UA 2Z4IA 2JSOA 4K2KA 2ID0A 1WTQA 1KTKA 4K8IA 3P20A 3R93A 2JXMB 1EIHA 4CJ0B 1EZ6A 2QF7A 1HCZA 3GTLB 2PCFB 2R61A 1CI3M 1SE4A 4XIGS 5EKIA 5C0XI 1SYBA 4C1NK 2L1BA 4HMIA 3L3OC 2A6EC 5BN3A 1A6XA 4I7ZC 4FF2A 5C4ZA 4QCLA 3R2TA 2F0EA 5D3DA 1GUOA 1L0YB 1TS2A 3Q24A 2O2LD 2L4NA 3DWAA 2OF1A 1AEXA 1STGA 2ZXRA 2ZT9C 5C5LA 2PW7A 2SOBA 4K2LA 1R4QB 4C2MB 1EY6A 5JEAH 2F0LA 3I73A 3MFYA 2DNCA 2F1MA 1E2VA 4RHRA 5JVG3 1R4PB 4PMCA 5KYIA 1OXXK 3PUXA 1RTOA 1FNVA 2EY6A 3DMUA 4DK1A 2IX3A 4HN7A 5JPNC 2F0KA 1QWYA 2FMMA 1BOSA 4KY5A 1KDBA 2D5DA 5CV7A 3BVZA 1BBXC 2F0OA 1E0BA 2A68D 1EY8A 4FYDA 5KGUA 5IOCA 5A2QL 5I6WA 2K6AA 2RDHA 2E2DC 2IX0A 2RVLA 2OEOA 3Q6SA 2C9OA 1QG7A 2F0WA 2VB2X 1JQYD 1EQTA 2F3VA 3FMCA 1CQVA 2HDMA 2K04A 3I4LA 5KYLA 2KEDA 3J7YW 3H94A 1I4QA 2WB1B 3F2UA 3DHQA 2NVTB 3I90A 2F4IA 2NWGA 2EY2A 2M2LA 4LJZC 3U9SA 4E6IA 2E75C 4IUPA 4TQUS 1LT4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD H;  1E2Z A;  2A6H D;  1GUS A;  4OO1 G;  4KKS A;  4GZY C;  2K7V A;  1OXT A;  2CW0 C;  3QIA A;  2PNR C;  2KA7 A;  3EQL C;  1YNN C;  1PMR A;  4OGQ C;  3A8K E;  2EDG A;  3VR2 A;  3SE0 A;  1Y8O B;  5JEA H;  3VR5 A;  2EVB A;  3PUY A;  4H0L C;  1CTM A;  1OXV A;  5KND A;  3I73 A;  3N6R A;  1Q12 A;  3MFY A;  2DNC A;  3T51 B;  2B8G A;  4DNT B;  1TKW B;  2F1M A;  3D4R A;  1E2V A;  3A7L A;  4JBW A;  2DN8 A;  3M4Y A;  4L8J A;  1Q90 A;  2O5I C;  1OXX K;  1H9S B;  2E76 C;  1I6V C;  3PUX A;  5K36 G;  5JEA G;  4KKT A;  1O7L A;  1GHJ A;  2D62 A;  4DK1 A;  5BN4 A;  1VDZ A;  1B9N A;  1VCI A;  3GQB A;  1Q1B A;  3T53 B;  3MXU A;  2BA1 A;  5BN5 A;  1GUG A;  3FPP A;  3PUW A;  4XTC S;  4OO1 H;  2A69 D;  2BA0 A;  3D31 A;  1LAC A;  3M7N A;  4IQZ A;  1GUN A;  4KHZ A;  2A6H C;  1Y8N B;  2AWO A;  4BA1 I;  3I72 A;  2D5D A;  4KN4 C;  1HTP A;  1T5E A;  3OW7 A;  3QJY A;  4KI0 A;  1H9R A;  3SDZ A;  3TZU A;  1HPC A;  1Y8P B;  1DXM A;  1SMY C;  1H9J A;  3KLR A;  3GD7 A;  3OOC A;  1GUT A;  1GHK A;  5KNC A;  2A68 D;  3PUV A;  3WDN A;  4HR7 B;  2NN6 G;  4KKU A;  1O78 A;  1GJX A;  2O5J C;  2V4D A;  5A35 A;  2EJG C;  1FR3 A;  1QJO A;  3QG1 A;  2KCC A;  2BDO A;  1DD2 A;  2BE5 D;  3IFT A;  3BDO A;  3A8I E;  3DXJ C;  2A68 C;  2JE6 I;  3ND8 A;  3VA7 A;  4DK0 A;  4G7H C;  2A6E D;  3CRL C;  1V43 A;  4G7Z C;  2A69 C;  2D2C C;  4LK1 C;  1CFM A;  3HGB A;  1IW7 D;  3P20 A;  1DCZ A;  2JEB I;  2JXM B;  3VR4 A;  3A8J E;  2E74 C;  3PUZ A;  1VF7 A;  4TKO B;  2JEA I;  1ZKO A;  4KMU C;  2K33 A;  2QF7 A;  3FMC A;  3RLF A;  1HCZ A;  2AUK A;  1H9K A;  4H13 C;  3I4L A;  1IYU A;  2PCF B;  2YYZ A;  1ONL A;  1ZYR C;  3ND9 A;  2EJM A;  3LWU A;  1B9M A;  1CI3 M;  4PV1 C;  1OXS C;  3A7A B;  4XIG S;  2NN6 H;  2Q8I B;  1K8M A;  4H44 C;  2K32 A;  2R6G A;  1HQM C;  3T56 B;  3H94 A;  2LMC B;  1V8Q A;  1H9S A;  4JK1 C;  4IFD G;  4BA2 I;  4DNR B;  1K8O A;  3CRK C;  3BG3 A;  2A6E C;  1YNJ C;  4KN7 C;  1IYV A;  2EJF C;  3IKJ A;  3LNN A;  5BN3 A;  1BDO A;  1OXU A;  2L5T A;  5C0X G;  1Y69 U;  2B8F A;  1TU2 B;  1A6X A;  4I7Z C;  4G7O C;  1IW7 C;  1Q1E A;  5K36 H;  1H9M A;  1Z6H A;  3VR6 A;  3NE5 B;  1G29 1;  3M85 A;  2AUJ D;  2PPB C;  1GUO A;  3W3A A;  5KNB A;  1Z7T A;  2DNE A;  4LJZ C;  1E2W A;  2BE5 C;  3U9S A;  3VR3 A;  1EWH A;  2NN6 I;  4RCN A;  3L7Z C;  2IT1 A;  2ZT9 C;  5C0X H;  2E75 C;  1VF5 C;  3PV0 A;  3OPO A;  1LAB A;  4TQU S;  3AB9 A;  1FYC A; 
#chains in the Genus database with same CATH topology
 3SK4 A;  2A73 B;  3EQL C;  1YNN C;  4N8F A;  2AMC B;  2D9U A;  2EYP A;  5ELC A;  3GTQ B;  2R7Z B;  2H5X A;  4DAV A;  4PG3 A;  2FXQ A;  1HZB A;  2EIF A;  1LT5 D;  2MP1 A;  1HZ9 A;  3T51 B;  4LFC Q;  3FKI B;  5FO8 B;  3V96 A;  5LHY 1;  1LT6 D;  2SEB D;  1LUZ A;  1HFN A;  2A74 C;  4L8J A;  3K7U C;  5IGC A;  5JEA G;  3GTJ H;  3J7A 5;  1B9N A;  1CKN A;  1VCI A;  3GQB A;  1Q1B A;  3FPP A;  1TWH H;  3FEW X;  4QUC A;  4Z9C B;  1HTP A;  4ME3 A;  2E2I B;  2JA8 B;  4POG A;  3A5Z B;  5FO7 B;  1VS0 A;  3M4Q A;  1SNM A;  1FNW A;  2VZA A;  4A3C G;  2KBN A;  4DAY B;  1GJX A;  1QNU A;  1SJE D;  4H02 A;  4OEM B;  1VQK A;  3GTJ B;  2QCP X;  2N78 A;  2JJQ A;  3MZ5 A;  1CZG A;  1N9W A;  1V43 A;  4DV2 Q;  4YCV A;  1MSH A;  3HP3 A;  4TSS A;  1X32 A;  1LTS D;  4P73 A;  4IPH A;  5AJ3 L;  1AE3 A;  1D5X C;  5LMU Q;  5IY0 A;  5C4J B;  4PMW A;  1F9R A;  4AIM A;  5E4X A;  5T1G A;  2F0S A;  2CQO A;  3CCJ A;  1NBW A;  3U58 A;  2MJ8 A;  2IPK D;  3D6W A;  4YWK A;  2Q8I B;  4IUN A;  4TRD A;  2DY7 A;  4A3I G;  1LV9 A;  2K32 A;  3KF8 A;  5M3M G;  5IGB A;  2NBF A;  4BXX G;  2LFN A;  4DNR B;  1SNC A;  4S3S A;  4IUV A;  3D4W A;  2CWP A;  4X3U A;  1U5K A;  1STB A;  4Q0F A;  4B3T L;  3RLN A;  3I8Z A;  4J8Q A;  4GKJ L;  2NTT A;  4X6A H;  1D5Z C;  1YNN D;  4RFB A;  3OWE B;  2HD3 A;  5IGD A;  5KNB A;  1ILP A;  3NEL A;  3VDY A;  1GD7 A;  4OIJ A;  1BCP D;  1I6H B;  2HIV A;  1PFB A;  2IT1 A;  2JQO A;  4R9W A;  2J4X A;  3OPO A;  3UDX A;  4XQN A;  2JYO A;  4OO1 G;  2BDN A;  3QB3 A;  1ESR A;  1PRT F;  5EQ0 A;  4MTN A;  3JAM L;  2EYL A;  1D7Q A;  1VQ6 A;  4JBW A;  3NWT A;  3T1Y L;  2KHJ A;  5GRO A;  3SR1 A;  2K5W A;  1I6H H;  1STY A;  2XNA C;  5BN5 A;  5JOB A;  3D31 A;  3M7N A;  1Q82 C;  3PSI A;  4BBR B;  4KN4 C;  1C9O A;  3KLW A;  3KLR A;  1B50 A;  1IBM Q;  1TXY A;  2E2J H;  4WJW A;  1Y1W H;  5ISR A;  4JI4 L;  2ENB A;  3BYT B;  1PRT C;  2A5H A;  2I5L X;  1PH3 A;  3IFT A;  3BDO A;  1SJH D;  2WKD A;  2RA4 A;  2I0Q A;  2JE6 I;  3KDF B;  5M5W B;  4AYB G;  1IBK L;  3DM3 A;  1T9H A;  1HR0 Q;  1T5X D;  4HCE A;  4DR3 Q;  1L1O A;  5IT9 c;  1CFM A;  1F9P A;  2CH4 W;  5JAV A;  5DAU A;  1F2Z A;  4ZYS A;  1JJ2 A;  3JAM i;  4A3D H;  1HH2 P;  3S1N B;  2E2J B;  4DV4 Q;  1G8Z D;  4HJ7 A;  2AUK A;  4FDB A;  2JN4 A;  5I6Y A;  3VYT A;  1G2S A;  2K5H A;  1TQO A;  1K3R A;  5M5W H;  4K5V A;  5EJW A;  2HDL A;  3ERO A;  3OIP A;  1Y1V G;  2PW5 A;  4DXG A;  4JOI C;  2A8V A;  3C1E A;  1N36 L;  2F0Q A;  3BZC A;  4X64 L;  4JG2 A;  1YNJ C;  3IKJ A;  3LNN A;  1C7Y A;  3J7A V;  4A3D B;  2K5Q A;  4U67 3;  2DUD A;  1ET6 A;  1M1K C;  4BY1 B;  5GAE C;  4BBS G;  1EIY B;  1TWA H;  1BCP F;  4CJ1 B;  2KUM A;  2NZ1 D;  5IGF A;  1R9T H;  4EQN A;  1O7Y A;  3SGI A;  4X62 Q;  1MIU A;  3PV0 A;  1BQQ T;  1B2T A;  3PQI A;  2CCZ A;  4L5R C;  1KAB A;  3N52 A;  3S1Q B;  1OXT A;  3D3R A;  2EDG A;  1DOL A;  2Z0S A;  1L0X B;  4WRD A;  3VR5 A;  4H0L C;  2PMZ E;  4XDX A;  3MXN B;  1Z9F A;  3R8B A;  4B3R L;  4NW2 A;  3D4R A;  2HT1 A;  4DAP A;  1X3F A;  3NQT A;  4BBS B;  2EYF A;  3L2P A;  4XQQ A;  2O5I C;  1XTC D;  1K3B C;  3K6O A;  4XYO A;  4HJ8 A;  3F2D A;  2VUM G;  1SLJ A;  4CKB A;  3S1Q H;  3PUW A;  4ZUI A;  1G51 A;  4IUQ A;  4CGY B;  4A93 B;  2H1E A;  3S1R B;  2Z9H A;  1DXM A;  1KDC A;  4N8X 1;  4LF9 Q;  2EOT A;  4KHV A;  1PH4 A;  1KRS A;  1WTP A;  1X3E A;  3FKI G;  3QOL A;  5A35 A;  1XNR Q;  2RDG A;  4DR7 Q;  2C5C A;  3SXH A;  1VQI A;  1GOZ A;  1HFG A;  3MXG A;  3H15 A;  1RD9 D;  1EU3 A;  4X3K A;  3PF4 A;  1JIC A;  4LF6 L;  4AYB B;  2NZH A;  1IW7 D;  3I4N H;  1S5B D;  2DJG C;  1ZXT A;  2B2T C;  2HQL A;  1KRT A;  2QA4 A;  4CJ2 C;  4LF7 L;  1Q86 C;  2IWH A;  3MFG A;  3MVV A;  4IFD J;  3I2Z A;  4LF8 L;  3E5S A;  1HXY D;  3PMF A;  5EKL A;  4POF A;  4ZQ3 A;  1PV4 A;  3R3O A;  5IIF A;  4H13 C;  5FKA C;  2KQ3 A;  4J1M A;  4IUU A;  2XVS A;  3QOJ A;  3BS1 A;  4A3B B;  4FF4 A;  3GO5 A;  3S14 B;  3A0J A;  4DXF A;  3W1G A;  2L55 A;  2F0J A;  3S2H H;  2I07 B;  4XQJ A;  1U4P A;  2EJF C;  5C44 H;  3UI2 A;  3HS0 C;  3ONA B;  4RKB A;  2NVQ H;  1QE6 A;  3H0G H;  1HNX Q;  2AUJ D;  4N9T A;  1VQM A;  1KD1 C;  1WVL A;  2PPB C;  3TP7 A;  3UDI A;  4WFN 3;  1MGS A;  4IPD A;  2K1B A;  4FF1 A;  2N3S A;  2IW3 A;  4C3I H;  3K0Y A;  4K6D A;  1XJV A;  1VF5 C;  1IL8 A;  5M3F G;  3C2P A;  3S2H B;  1AP0 A;  4PQX A;  4GKK Q;  3PF5 A;  2F0M A;  1SR3 A;  1XYI A;  3S24 A;  4MTK A;  2JP1 A;  3D4D A;  3SE0 A;  4JI6 L;  3H0G B;  2FMC A;  1SBB B;  3K7A B;  3GTM B;  4X66 Q;  2PQE A;  3KJP A;  1EQV A;  1MI2 A;  4P75 A;  2K5D A;  4OON A;  2E76 C;  4C3I B;  1I4P A;  1UEB A;  3H6M A;  1PH9 A;  2JA7 B;  2MPM A;  3JC6 6;  4DR1 L;  3T53 B;  1KQS A;  2L9H A;  4Y7N B;  1B7Y B;  4ZK9 B;  5LMN L;  1ROD A;  2XN9 C;  2Z6K A;  3I72 A;  4RWS C;  3W2D A;  5HUR A;  4C3H H;  1CA5 A;  1H9R A;  1UAP A;  1FD7 D;  2FHT A;  3OOC A;  3K7A H;  3GD7 A;  1KHI A;  3OIQ A;  1NSN S;  1EOV A;  3I4M G;  4IOA A;  5DM7 3;  1M90 C;  1JE5 A;  1D2B A;  4DV0 L;  5IOD A;  4WJ4 A;  1XPO A;  4A3L H;  1Q8K A;  2UXD Q;  5FK9 C;  4F88 A;  4RH6 A;  5IYD G;  4IJH A;  3CCS A;  5CBA E;  3TS2 A;  4JCV E;  4BBR H;  4CKE A;  1HNX L;  4RMF A;  4K6L A;  2Z6K C;  3E9I A;  2J0T D;  1O7I A;  4EQP A;  2JEA I;  2F0P A;  4A3L G;  3TP8 A;  2K33 A;  2IHE A;  1EYD A;  4KJN A;  3MXN A;  1G2T A;  1I4H A;  4UHV A;  2UXC Q;  1ZEQ X;  4H7B A;  2PZT A;  4QUF A;  5JVH 3;  1ZYR D;  2VY3 A;  2RSN A;  5ELO A;  3C1F A;  4CBV A;  1NR4 A;  4CDF C;  1S5D D;  3Q8D A;  1A2U A;  5T1I A;  1VQD A;  3BDL A;  1X3Q A;  4QY7 A;  3S1N H;  4KLK A;  4QIW E;  1IW7 C;  3MHB A;  1VQ4 A;  1G29 1;  2K03 A;  3NXW A;  2E2H H;  3EIV A;  5FO9 B;  3DEO A;  2K01 A;  3HZX A;  2ZM6 Q;  2JA5 B;  5C44 G;  4EQ5 A;  3U4Z A;  3HOW B;  5HGT A;  3K5N A;  1PTO F;  1PZJ D;  1XXG A;  3TP5 A;  5LL6 S;  3S2D B;  4JI8 Q;  1FNU A;  3HOZ H;  5C6A A;  4ZKC B;  1SE8 A;  5TSS A;  2VQE Q;  2E2I H;  1C8C A;  4UY8 C;  1QZH A;  4BY1 H;  5ELB A;  1TWA B;  5IP7 G;  2YV5 A;  4X64 Q;  1E1T A;  2GA4 B;  3SVM A;  4NDX A;  2B2Y A;  5C3E B;  4B3R Q;  2JA5 H;  2MFI A;  1IBL Q;  4C1N I;  2EXD A;  2EYO A;  5DNF A;  1PZK D;  3F2C A;  3BU2 A;  3HOZ B;  4M1U B;  3NEM A;  2HHH Q;  4MZ9 A;  1VQ9 A;  4QJF A;  1Y8P B;  2CH4 A;  3AU7 A;  3KF6 B;  1IBK Q;  2N8N A;  3K59 A;  1F77 A;  4PZ7 A;  3Q0A A;  2N55 A;  4MN3 A;  3NUC A;  4KKU A;  4BBS H;  2N88 A;  5C3E H;  5D65 A;  3TRZ A;  1UNS A;  1PZI D;  3QG1 A;  2Y0S G;  4O0A A;  2OWO A;  3PO2 B;  3I55 A;  1EQQ A;  3PIP A;  4QMG A;  4LAA A;  1X3G A;  1RDP D;  2ZTD A;  2SDF A;  1FJG Q;  3MXP A;  5JJZ A;  4R1J A;  3ULP A;  4DR1 Q;  2LSS A;  3PUZ A;  3Q22 A;  1VF7 A;  2O4X A;  1YHB A;  4HJ5 A;  3RN2 A;  1EEF D;  1N36 Q;  4FF3 A;  3HOV B;  4ZUJ A;  3GTP H;  1G91 A;  4I65 A;  2YYZ A;  1IYU A;  5G3L D;  1DZ1 A;  1VQF A;  4CKC A;  4TVA B;  1YHA A;  4DR6 Q;  4H44 C;  3GDE A;  1BXT A;  2MGS A;  2SNS A;  3CRK C;  3TZD A;  5M3M B;  3AFP A;  3I4N B;  1QUQ B;  1CHQ D;  2D0P A;  1SXT A;  5A2Q E;  4A3I B;  1PTO B;  1NJI C;  1UE5 A;  1SMX A;  3BYY B;  4F8M A;  4YWM A;  1QVF A;  5C5M A;  4DF7 A;  1X55 A;  3HOU G;  1V1P B;  1W2B A;  4R8N A;  1KIX A;  5COR A;  2ZTC A;  3HOX G;  1LTG D;  3AB9 A;  2KEE A;  2HIX A;  5D3I B;  1GUS A;  4DUY Q;  4XT1 B;  1PTO H;  3EBE A;  3HOY B;  4DV5 L;  2EVB A;  3T1H L;  5E1F A;  2OTJ A;  1K9M C;  1Q12 A;  5CBE E;  2Y0S E;  5K36 G;  1NCV A;  1II3 A;  3WWV A;  3CPF A;  1MBY A;  4FXD A;  1VDZ A;  1ENF A;  2NYZ D;  3DUZ A;  3OMC A;  5CV9 A;  3GV6 A;  4C2M H;  4IFD I;  2HHH L;  5J1Z A;  3RNU A;  1GUN A;  3RR5 A;  3HRZ C;  1JB7 A;  1PYB A;  3HOY H;  4IN3 A;  1L1O C;  1EYC A;  5CMD A;  3J80 E;  2M00 A;  4KJO A;  2B63 G;  3SDZ A;  4HJA A;  1E7Z A;  1EFW A;  5J3B A;  2NUC A;  3MEF A;  3SK5 A;  4GLV B;  3HEJ A;  4KHP L;  2MO1 A;  1CM9 A;  4EQO A;  4QQB X;  2KCC A;  1QNK A;  2BDO A;  3I91 A;  2R92 H;  2B39 A;  1DD2 A;  4Y7N H;  3ITP A;  4ZRZ A;  3VA7 A;  2EZV A;  1WD0 A;  4F7X A;  2QDB A;  2K4K A;  3EFX D;  1EFI D;  2HCC A;  4YHH Q;  5AFW A;  1MKH A;  2F0N A;  5KRU A;  4XXE A;  1FVI A;  2R93 G;  1YJ9 A;  5FJ8 H;  1PLF A;  2MQH A;  4OHJ A;  5G3L F;  4KY6 A;  3K5O A;  3X3N A;  3K80 C;  1NMF A;  2K75 A;  1NUC A;  3ND9 A;  1SAP A;  3VR4 A;  1ONL A;  1SSO A;  2LXK A;  1I50 B;  1MD2 D;  2GN5 A;  4UDU C;  4CDC C;  3D6C A;  2BOS A;  4DUY L;  5EBC A;  4A3J H;  1R9T B;  1X65 A;  5EAY A;  1HQM C;  2B2V A;  2NB0 A;  3DEP A;  4ZCK A;  1XNQ L;  3FP9 A;  4V19 0;  1X6O A;  3T4A C;  2F4V Q;  1BDO A;  1PTO C;  2HCI A;  3CMA A;  2LY7 A;  1Z6H A;  3VR6 A;  3NE5 B;  3L9A X;  4IPC A;  3W3A A;  3F2B A;  1WYD A;  1Z7T A;  2MHV A;  3HG9 A;  2BE5 C;  1HRJ A;  3OYY A;  1C48 A;  3VR3 A;  2AQ3 B;  4RCN A;  2XGT A;  3EJI A;  4PMB A;  1LO5 D;  1LTB D;  4X62 L;  1NMG A;  1FYC A;  1SMY D;  1WCM B;  2SNM A;  2ZJP A;  3KLS X;  4HMJ A;  1SND A;  4M8A A;  1EEI D;  4OGQ C;  3T16 A;  4KHP Q;  4B3M Q;  3S1R H;  1EY9 A;  1SYF A;  1HJP A;  4OIK A;  4CHT B;  4YY3 Q;  5KND A;  1JOK A;  4DNT B;  4R4T A;  1STA A;  1AH9 A;  2UXC L;  2HQE A;  1Y1W G;  2RQX A;  5FLX L;  3J81 c;  1I6V C;  4YWL A;  1YJN A;  3FPU B;  3MA2 B;  1RTN A;  3E0E A;  1XMO L;  3MXU A;  1GUG A;  3NHH A;  3TN2 A;  1JE4 A;  3S15 B;  1EY5 A;  1T5E A;  1JCK B;  3HKS A;  5IE8 A;  4I7A A;  3H3V C;  3BVG A;  3A74 A;  4KI0 A;  1SNQ A;  1LTA D;  1HPC A;  3GV3 A;  1VQO A;  1C0A A;  1WTX A;  2IX1 A;  4AH6 A;  1BKB A;  1XPR A;  2NN6 G;  3NBH B;  4G57 A;  1STH A;  5IGE A;  5EPJ A;  4B9W A;  2CVR A;  2JA6 B;  1STE A;  2Q2I A;  4DN4 M;  3OHX C;  4B3S Q;  4DR5 L;  2XTI A;  2VB3 X;  4DV6 Q;  5CV4 A;  4X65 L;  3WOE A;  1J5E L;  3PGZ A;  1SE2 A;  1YIJ A;  3S15 H;  1D6E C;  3HOZ G;  1G6P A;  2KEN A;  1VQ5 A;  4NMZ A;  4J6H A;  4OXP A;  1LM0 A;  5C44 B;  2JA5 G;  2R92 G;  4GOP B;  4DR7 L;  4OL7 A;  2NVQ B;  2ZJQ A;  2UUC Q;  3J7A F;  1H9K A;  3J81 E;  5LL6 X;  1ASY A;  4BWG B;  3A7A B;  1EWI A;  4K5W A;  4DA2 A;  1D5M C;  5FJ8 G;  5E7N A;  3S1M B;  2EY1 A;  3M7G A;  2R6G A;  2K14 A;  1V8Q A;  5GQO A;  4JK1 C;  1ENC A;  5M3F H;  3AQQ A;  1Y1V H;  1WFQ A;  4BY7 H;  4JI2 L;  2B2U C;  1BCP C;  1TS4 A;  3QR8 A;  4HAE A;  1FJG L;  3NTK A;  3DLL A;  4A3K H;  3NWS A;  4JI0 Q;  1E2W A;  1L2F A;  5C4X B;  1X9N A;  1BF4 A;  3I56 A;  3S1M H;  5IT9 E;  1A8V A;  1GM5 A;  2ALY B;  5J22 A;  2LS0 1;  4FNF A;  2P5Z X;  5BN4 A;  3CHB D;  1WTH A;  3RLO A;  1A2T A;  3SK8 A;  3J81 i;  4IFD H;  2R93 H;  2TMP A;  4RGT A;  1K8G A;  1BVS A;  4PZ8 A;  5CV5 A;  2TSS A;  4A3I H;  4L5S A;  1PYS B;  1AE2 A;  1L0W A;  3TP6 A;  2Z8L A;  4P71 A;  4FO2 A;  4B3S L;  1DYQ A;  2VNU D;  3CAM A;  1A15 A;  2EYH A;  4A3K B;  4LUZ A;  4L5Q A;  5IWA L;  3S9W A;  4HSP A;  1HUN A;  1HTL D;  4ULL A;  4HTH A;  1Q90 A;  3VYR A;  4DFA A;  3V2T A;  2D62 A;  1QB5 D;  2RCF A;  2BA1 A;  1PFM A;  2CWA A;  3NTI A;  3WOF A;  2NVY B;  3IRB A;  2F0U A;  1I4X A;  2UU9 L;  3UE0 A;  2YU9 H;  4NXM Q;  3HKZ G;  3WDN A;  1PRT D;  4XYQ A;  3IFD A;  1TVX A;  1TWG H;  1YIT A;  3HOV G;  1LLR D;  2MUY A;  2F0F A;  4NP5 A;  1HUM A;  3AEV A;  3HOU B;  1N32 Q;  4DR2 L;  1KNE A;  3J81 L;  1TII D;  2B2T A;  1BNZ A;  5FLX c;  2QEJ C;  1CA6 A;  2JA8 G;  2NVY H;  4ODG A;  4GN5 A;  4FXK C;  1SYC A;  2UXB Q;  3FDT A;  5KIX A;  3HGB A;  3CKI B;  1Y14 B;  4DV7 Q;  4JC0 A;  1S4Z A;  1V1Q A;  4TKO B;  1U9R A;  2WP8 J;  4YIJ A;  3JAM c;  1QCB D;  1E1O A;  2ES2 A;  2PI2 A;  2B2U A;  2XWJ B;  5I2Y A;  2E2H B;  4DK3 C;  5KEE A;  2LXJ A;  3K8A A;  2CKZ B;  3CME A;  1WTR A;  3HOW H;  3VYU A;  3TQY A;  1S5F D;  2KEC A;  1CSQ A;  2UUA L;  3H3V H;  2UUB L;  3S2D H;  4CDD C;  2NVX H;  4A3B G;  1OXU A;  3FVQ A;  1UEA B;  1RCV D;  1IZ6 A;  1LTL A;  2WV6 D;  1HNZ L;  3GTK B;  2QGQ A;  5C3E G;  4R8I A;  3UE1 A;  1KNA A;  3AFQ A;  4EGV A;  4N9P A;  1AZQ A;  1OTC A;  3TRE A;  1E22 A;  5FLX E;  3G4S A;  4BY7 G;  5E3F A;  1JOO A;  1VMC A;  1N32 L;  4NXN Q;  5CC4 A;  4JV5 Q;  2RHQ B;  5IWA Q;  2QDL A;  4YHH L;  1LTI D;  4HIK A;  2KA7 A;  4XT3 B;  5CR3 A;  4LF6 Q;  2L0C A;  2OTL A;  2LKV A;  5L37 A;  1OXV A;  2AQ1 B;  2PNH A;  2M9V A;  4A3F B;  5ELN A;  1QVG A;  3S17 B;  1HHV A;  1SRU A;  2DGY A;  3MEH A;  1LTT D;  2B2W C;  2E8G A;  3PO2 H;  1PH6 A;  4IQZ A;  2I5H A;  1Y8N B;  4X66 L;  1EY7 A;  3J80 c;  3FHW A;  1VMP A;  3CCU A;  2EYM A;  1H9J A;  4JYA L;  2YTX A;  1AFP A;  1TWF H;  2L11 A;  3I4O A;  1IL2 A;  2RDF A;  3S17 H;  4DR2 Q;  2O5J C;  1GKH A;  4L63 B;  2EXZ A;  1QJO A;  1CKM A;  3GTL H;  3I4M H;  3M3Y H;  3GTP B;  4JBK A;  3ERQ A;  3HKZ B;  2MNA A;  1PDQ A;  1I4R A;  3HFZ B;  1PFS A;  1JWM D;  2PQA B;  4DK0 A;  1HNZ Q;  1YNX A;  2F0T A;  1FGB D;  4G7Z C;  1C4Q A;  3PO3 B;  4JI4 Q;  5IYD H;  3R2I A;  4A93 G;  4R4I A;  1ESF A;  1B8A A;  2JEB I;  4ZKB B;  1K28 A;  2ZXO A;  1WTV A;  4FXG C;  3I4M B;  2B29 A;  4RG1 A;  1VQE A;  3SEB A;  2F3W A;  2XIW A;  1B9M A;  3LWU A;  3CCL A;  5I9P A;  1KAA A;  1WTO A;  1K0S A;  1UUP A;  3EN2 A;  4BA2 I;  1W6K A;  4GOP C;  2BH2 A;  4JYA Q;  2F0V A;  2PI2 E;  4LFA L;  4L6T B;  5GAG C;  4DR3 L;  1QIL A;  2XWB B;  3M85 A;  5EGT A;  2PZW A;  1AZP A;  4K8J A;  4L5T A;  1EWH A;  2KHS A;  4YY3 L;  4MHE A;  3S14 H;  1EYA A;  3QWN A;  1Q81 C;  1RJT A;  1E2Z A;  1I3Q B;  1J6Q A;  3TSS A;  5GAD C;  4JV5 L;  1CZW A;  1PMR A;  4QF4 A;  3E0J A;  4O1N A;  5JEA J;  1Y8O B;  2KCN A;  4LF4 L;  1SNO A;  1SN8 A;  3JAM E;  5M5X H;  3PUY A;  1XNR L;  1D1K A;  2OQK A;  4JI7 L;  5C4X H;  3STB D;  3OWF A;  2FFK B;  5IP7 H;  3ZYY X;  1TR5 A;  2X6G A;  3H0G G;  2R92 B;  5CYU A;  2XSC A;  2G5D A;  5IYB H;  4XTC S;  2G9D A;  4K5X A;  2K5N A;  5EPL A;  4DV0 Q;  4KV6 A;  4P2C B;  5IGG A;  1M4V A;  1MHW C;  1N33 L;  2B2Y C;  2F0G A;  4ZLT F;  5C3W A;  3GTM H;  3A55 A;  1GHK A;  1B70 B;  4HR7 B;  3OTO L;  4DV3 Q;  4R4O A;  4JVZ A;  2WB1 E;  2VXW A;  4C3J B;  3S16 H;  4A76 A;  3A8I E;  1EOT A;  3DXJ C;  1AW7 A;  2VW9 A;  4A3E B;  4P74 A;  5C4H A;  1BO0 A;  3RZD B;  4UP9 A;  3CQZ B;  4UPA A;  1DOM A;  4O2D A;  4LK1 C;  2D2C C;  1VQJ A;  4RKL A;  3LWE A;  2YU9 B;  3S16 B;  4OWX B;  2X6L A;  2IY5 B;  2NVT H;  1WI5 A;  2ATW A;  1ZKO A;  2RF4 A;  5M5Y B;  1XWE A;  2PO4 A;  5AJ3 Q;  2ICE C;  4PNY A;  4LF8 Q;  1IHZ A;  4C3J H;  5ELD A;  3BZD B;  1PTO D;  4KK7 A;  4PV1 C;  3F8T A;  1OXS C;  2RHS B;  2ICI A;  1A3V A;  3VA5 A;  3A56 A;  1D8L A;  3CQZ H;  4ABN A;  2RSO A;  4GS3 A;  1EZ8 A;  3T56 B;  2XRQ D;  4DR4 Q;  1DM0 B;  4BS9 A;  1W3S A;  3MAQ A;  5DLQ E;  1F9S A;  1A0I A;  1K83 H;  1S3O A;  1GO3 E;  1WCM G;  4GNX A;  4YCW A;  1I94 Q;  3NSW A;  4WOR A;  1FL0 A;  3CP0 A;  2B8F A;  4HCS A;  4QIW B;  3KUP A;  2VUM H;  3GTQ H;  1U4R A;  3MC0 B;  1GVP A;  1VQA A;  1W6J A;  1HNW Q;  1DJR D;  4Q5V A;  1PH8 A;  2ZJR A;  4HID A;  2DY8 A;  1IYJ B;  4F87 A;  4IO9 A;  4JI3 Q;  3G6J B;  3PO3 G;  1HZC A;  3BDC A;  4KKS A;  5IP9 G;  3ULJ A;  1DGS A;  3A8K E;  4OEL B;  2PMZ B;  4GKK L;  3GP7 A;  2KCT A;  5EBD A;  2VUM B;  1LYL A;  5DEH A;  1CTM A;  3L0O A;  3T13 A;  3KBX A;  3N6R A;  2C35 B;  2AWN A;  3A7L A;  1TS3 A;  4RGO S;  3BZK A;  2JA6 H;  4DR4 L;  4C56 C;  4GN4 B;  2QKI C;  5JPM C;  5CV8 A;  2K05 A;  5HY6 A;  1B4O A;  5F2D A;  3CC4 A;  1JWS D;  1U4M A;  1SMY C;  1V1O A;  1I94 L;  1TY0 A;  1S72 A;  3CCR A;  5C4J H;  4KTA A;  1WJJ A;  4BY1 G;  4IAL A;  4LWC A;  3VYS A;  3Q23 A;  1BUV T;  2B2V C;  3CCE A;  2A68 C;  3ND8 A;  4RHS A;  4A3D G;  2Q8R E;  1D1I A;  3MWY W;  1J5E Q;  1N34 L;  5M3F B;  4CDE C;  4EVO A;  1GXD C;  3F1Z A;  1Y1V B;  1HA5 A;  4BY7 B;  1TWF B;  2GVB A;  4PZ6 A;  4LFC L;  3UDF A;  3KJO A;  4DV1 Q;  1Q8I A;  1HZA A;  2EJM A;  2ZXP A;  4AQY Q;  1HR0 W;  2QIL A;  4RGN A;  1CHP D;  4JBJ A;  2Z4H A;  1YNJ D;  2FIN B;  1K8O A;  4FVM A;  5IT9 L;  5CV6 A;  3BG3 A;  1ENA A;  4B08 A;  4KN7 C;  1X56 A;  1BBU A;  1SE3 A;  2L5T A;  2ZTE A;  2Q2H A;  1Q1E A;  3J81 j;  3HOV H;  2KHI A;  2F3I A;  2Z6B A;  5E4W C;  4LUV A;  2BH8 A;  4R4Q A;  3DWP A;  3K58 A;  1JJG A;  2NN6 I;  2KOL A;  3NK9 A;  1M8A A;  5DM6 3;  2EYJ A;  1EL0 A;  1UE6 A;  1F2L A;  2K50 A;  4GZY C;  1EY4 A;  1EWC A;  2PNR C;  2IHF A;  2AKW B;  4DU9 A;  1VQ8 A;  1NAP A;  3VR2 A;  5I2X A;  1VQL A;  1PYW D;  4J15 A;  4OX9 Q;  2NTS A;  1SEB D;  3M4P A;  4AYB E;  3TS0 A;  4LF4 Q;  1IKL A;  2WKC A;  1Y1W B;  2KJX A;  3E6Z X;  3M4Y A;  1J9O A;  2J7Z A;  4JI7 Q;  1H9S B;  3K5L A;  2WIN B;  5I9O A;  1O7L A;  1GHJ A;  1JC7 A;  3HOU H;  1YBY A;  4JI5 L;  2YTY A;  1I3Q H;  4AQY L;  3MTS A;  5FOB B;  1K8A C;  2BA0 A;  4IJL A;  1PRT B;  3M9B A;  4JI0 L;  2OCE A;  3HKZ E;  3H09 A;  4LMQ D;  2AQ2 B;  5M5X B;  3G48 A;  3TZU A;  5H1S E;  3NPP A;  2F03 A;  4A3G B;  3NP8 A;  1XTD A;  1GUT A;  1A63 A;  3PUV A;  1N34 Q;  4LUO A;  4O42 A;  3I7F A;  1YJW A;  1XNQ Q;  1O7Z A;  1OO9 B;  3NTH A;  3W1B A;  2PZU A;  2VQE L;  4U68 A;  3RZO B;  2IL8 A;  3C46 A;  4A4I A;  2ZM6 L;  3OW2 A;  2UXB L;  4HIM A;  5CGK A;  3LX0 A;  2VQF Q;  2KCM A;  5I4D A;  3SHL A;  2G9H D;  4A3G H;  4X3T A;  2KVM A;  3CCM A;  3BJU A;  3GTK H;  1ICW A;  1TY2 A;  1LT3 D;  1NY4 A;  1O80 A;  4A3K G;  1GUW A;  1VQP A;  1HQR D;  3ICE A;  1NR2 A;  3M4O B;  2EE1 A;  2PYK A;  4K0K L;  5C0X J;  1Q46 A;  1CSP A;  3DM1 A;  4IFD G;  4A3M G;  3U9O A;  4HIO A;  4KD3 A;  1KDA A;  1JOR A;  1VQH A;  1HA6 A;  4RAU C;  3CD6 A;  2PQA A;  1SFO H;  1V9P A;  5C0X G;  1VQN A;  4GLX A;  5M5Y H;  5C4X G;  1UE7 A;  3P75 A;  2N49 A;  3E3X A;  4DV7 L;  1ASZ A;  1KXL A;  4A3J B;  3PIP 3;  2UXD L;  2WII B;  1CT1 D;  4RGM A;  2WAC A;  4V0B A;  3PCO B;  1S40 A;  1LAB A;  2B63 B;  4IUT A;  3SK6 A;  4OO1 I;  2A6H D;  4Y52 H;  3T1Y Q;  1YEZ A;  2CW0 C;  3QIA A;  4A93 H;  4A3M B;  1HNW L;  3NEN A;  1SFO B;  1F2Y A;  5ELE A;  3I70 A;  1H95 A;  4C3J G;  4DR5 Q;  4ZAI A;  3KFU A;  3OMG A;  1FGU A;  1TWC H;  4A3F G;  1N33 Q;  3CC2 A;  5BR8 L;  3AYH B;  1QOH A;  1Z47 A;  3GTG B;  1I4G A;  3M3Y B;  4IZ8 A;  4C3H G;  1S5C D;  1LTR D;  1WCM H;  5ELF A;  1YVC A;  2WB1 G;  1WD1 A;  4OO1 H;  4JI5 Q;  3K0X A;  1EU4 A;  4UP8 A;  1DOK A;  3RD4 A;  4DAM A;  4B9X A;  2A6H C;  2AWO A;  4BA1 I;  1JWU D;  4ILW A;  4A75 A;  3QJY A;  5JJI A;  2R7Z H;  1G6Z A;  4DKA C;  4DPG A;  1B3Q A;  1PH1 A;  4NB3 A;  4DNI A;  4EX5 A;  2JA6 G;  1TWC B;  3CF5 A;  1ILQ A;  3K81 C;  1FR3 A;  2RKS A;  4KY7 A;  2Q2U A;  4UAI A;  5FLM H;  1NTG A;  4IOC A;  4NKL A;  2B2W A;  4G7H C;  1TWH B;  4NXM L;  1A62 A;  5EKK A;  1ML0 D;  4MNO A;  2OXP A;  1JOQ A;  3I4N G;  1NNX A;  5JJL A;  4R4C A;  3KOJ A;  2JA8 H;  1B3A A;  5K5P A;  3A8J E;  5FLM G;  1UE1 A;  2Y0S B;  1EY0 A;  4C3I G;  3NQI A;  3RLF A;  2WAQ E;  3FRP B;  4JI8 L;  1BBW A;  1ZYR C;  3URY A;  1JB3 A;  4GKJ Q;  2NN6 H;  4LF5 Q;  2BCO A;  2OT2 A;  1B1Z A;  1K8M A;  1SYG A;  1VQB A;  2LMC B;  4JI1 L;  1H9S A;  2I46 A;  4GN3 B;  2F4V L;  5LMU L;  4LF9 L;  3U50 C;  1BR9 A;  3BVM A;  3QO2 A;  1IKM A;  3D8G A;  1RHP A;  3PIO 3;  1Y69 U;  1IBL L;  2X69 A;  1TU2 B;  3V05 A;  1KLU D;  2K28 A;  1SNP A;  4DV2 L;  2EQS A;  1I5F A;  2FJ2 A;  3G71 A;  4ID6 A;  2D0O A;  3NBI A;  4RCO A;  3RN5 A;  1E3P A;  4ME5 A;  3TBI B;  2E5L L;  3L7Z C;  3LGJ A;  1PA6 A;  5C0X H;  1SYD A;  4LFA Q;  1K73 C;  2F52 A;  2EY5 A;  4JPB W;  1L1O B;  4B3M L;  1P16 A;  3KBG A;  2CHB D;  2K7V A;  4DUZ Q;  1QUQ A;  1J8I A;  1MSG A;  3CXC A;  2Q8T A;  1BCP B;  2JA9 A;  3OSO A;  1KAW A;  1WTW A;  4C3H B;  1XMQ L;  5NUC A;  5JJK A;  2QW7 A;  3C3L A;  4IUR A;  2GVA A;  3ER0 A;  2DN8 A;  1A3T A;  1X3P A;  2H4O A;  2F0H A;  4KKT A;  1IXR A;  2R93 B;  1DON A;  4YCU A;  2L12 A;  2A69 D;  2Z1C A;  3RZD H;  3KF8 B;  1RKN A;  1CQF A;  3OW7 A;  5COY A;  5D14 A;  4X3S A;  5M9O A;  3HOX H;  3RMH A;  2HUG A;  3EA6 A;  4MIU A;  2CW0 D;  5KNC A;  2WAQ G;  3KLS A;  1B44 D;  3RUZ A;  3OTO Q;  3PIO A;  3GTO H;  2V4D A;  1CK1 A;  2EJG C;  1E24 A;  2CQA A;  1JR0 D;  2K5V A;  2WAQ B;  2R7Z G;  2BE5 D;  3A54 A;  1ET9 A;  4LW1 A;  3G7L A;  2A6E D;  5C3X A;  2EPB A;  3X3M A;  3CRL C;  1F9Q A;  1TS5 A;  2A69 C;  2DJF C;  4ALP A;  1UWV A;  2F0I A;  4HSV A;  4OX9 L;  1K83 B;  1XX8 A;  3I3C A;  1DCZ A;  3D0F A;  1STN A;  3HOX B;  4DR6 L;  2E74 C;  5EPK A;  3B6Y A;  3AMU A;  4KMU C;  3K5M A;  1TWG B;  3O13 A;  1XMQ Q;  4DAY A;  3KK7 A;  3GTO B;  1RF2 D;  1HR0 L;  4FP5 D;  3IAY A;  1AN8 A;  2MO0 A;  2RBM A;  2R3Z A;  1WOC A;  1JT8 A;  1XPU A;  4DV3 L;  2UUA Q;  1SDF A;  1F2M A;  3H91 A;  1MJC A;  4KD4 A;  4DV4 L;  5IP9 H;  2F0D A;  2I5M X;  4DGZ A;  1IYV A;  4JI3 L;  4IPG A;  4X65 Q;  1U4L A;  1RIP A;  4G7O C;  5K36 H;  1H9M A;  3ERS X;  3DWQ A;  2R7D A;  4A3C H;  1KL9 A;  3CU7 A;  1EIG A;  5IYC H;  2DNE A;  4LFB L;  4JI6 Q;  2JK8 A;  1Q3L A;  3NBH A;  3CCQ A;  1YI2 A;  4A3G G;  1CKN B;  1EQR A;  4QB4 A;  4WJ3 M;  5IYB G;  3H3V I;  2NVX B;  1KLG D;  1PFN A;  3KDF A;  1B53 A;  4DUZ L;  1JMC A;  1VQC A;  3TDQ A;  3K57 A;  3P7J A;  5LMN Q;  2B8G A;  1TKW B;  3P1H A;  2ASB A;  2A19 A;  4K14 A;  3CC7 A;  1EUJ A;  2RCN A;  2R7F A;  1TT2 A;  2B63 H;  5BR8 Q;  5HGQ A;  3IL8 A;  4APV A;  4G4K A;  1S5E D;  1YZ6 A;  4A3M H;  1LAC A;  1N8R C;  4KHZ A;  1PH2 A;  3TME A;  2QEX A;  4RA8 A;  3J80 L;  2NZO A;  4NPS A;  4A3F H;  1SYE A;  1O78 A;  5J39 A;  2VQF L;  1PXU A;  2IJ0 A;  4P72 A;  3EVQ A;  2XRS D;  1V1P A;  3CW2 C;  4HED A;  3UDG A;  1A3U A;  2Z4I A;  4DV1 L;  2JSO A;  4K2K A;  3CPW A;  4GNX B;  2ID0 A;  1WTQ A;  1CUK A;  1KTK A;  4JBM A;  4K8I A;  5M3M H;  3P20 A;  3R93 A;  2JXM B;  3U4V A;  4A3J G;  1EIH A;  4CJ0 B;  1EZ6 A;  2A1A A;  1KC8 C;  2QF7 A;  4NXN L;  1HCZ A;  1VQG A;  3GTL B;  2PCF B;  2R61 A;  2OQ0 A;  4B3T Q;  1CI3 M;  1SE4 A;  2K52 A;  4XIG S;  5EKI A;  5C0X I;  2YTV A;  1SYB A;  4C1N K;  2VS1 A;  1RL2 A;  1SRO A;  2V1C C;  3PO3 H;  2L1B A;  4LFB Q;  4JI1 Q;  4HMI A;  3L3O C;  2A6E C;  5BN3 A;  1EYG A;  3HOW G;  1A6X A;  4I7Z C;  4FF2 A;  5C4Z A;  4QCL A;  3R2T A;  2F0E A;  5D3D A;  1GUO A;  1L0Y B;  1TS2 A;  4QGU A;  3Q24 A;  2O2L D;  2L4N A;  4LF7 Q;  3DWA A;  3KYH C;  2OF1 A;  4JOI A;  4A3B H;  4GLA C;  1AEX A;  1STG A;  3HOY G;  2ZXR A;  2ZT9 C;  4TQU S;  5C5L A;  3KF6 A;  2PW7 A;  2SOB A;  4K2L A;  4LNQ A;  1R4Q B;  4C2M B;  1EY6 A;  1Q7Y C;  1QVC A;  4GOP A;  3E9H A;  1U0L A;  5JEA H;  2F0L A;  5LMN W;  4GNX C;  1PH5 A;  3I73 A;  3STB C;  3MFY A;  2DNC A;  2F1M A;  1QZG A;  1E2V A;  4RHR A;  5JVG 3;  1R4P B;  4PMC A;  1OXX K;  3PUX A;  5KYI A;  1RTO A;  1FNV A;  2EY6 A;  3DMU A;  4DK1 A;  2IX3 A;  4HN7 A;  3RZO H;  5JPN C;  2F0K A;  1QWY A;  4HJ9 A;  1K0R A;  3ULL A;  1YHQ A;  2Q2T A;  1PHJ A;  2FMM A;  1XMO Q;  1BOS A;  4KY5 A;  1KDB A;  2D5D A;  5CV7 A;  2E5L Q;  3BVZ A;  2UUB Q;  2VL6 A;  1BBX C;  4BXX H;  1IBM L;  2F0O A;  5IYC G;  1E0B A;  1PH7 A;  2A68 D;  3J80 i;  5GAH C;  1EIF A;  1EY8 A;  4FYD A;  5KGU A;  5IOC A;  5A2Q L;  5I6W A;  2JA7 H;  2K6A A;  2RDH A;  1I50 H;  4JI2 Q;  3M4O H;  2E2D C;  2IX0 A;  3G6E A;  2RVL A;  2OEO A;  3Q6S A;  4OWW B;  2C9O A;  1QG7 A;  2B3G A;  2F0W A;  2VB2 X;  4OWT B;  4A3E G;  4LF5 L;  1ICF B;  1PVO A;  1JQY D;  2JA7 G;  1EQT A;  1JJC B;  2F3V A;  3FMC A;  1CQV A;  2HDM A;  1NE3 A;  2K04 A;  4DK6 C;  3I4L A;  4QL5 A;  2KED A;  5KYL A;  4A3E H;  1MJE A;  3J7Y W;  3CCV A;  3H94 A;  4BBR G;  2L15 A;  2UU9 Q;  4K0K Q;  1I4Q A;  2WB1 B;  3F2U A;  3A5U A;  3DHQ A;  2NVT B;  4DV6 L;  3J7Z C;  3I90 A;  2WFW A;  2CFM A;  3W5O A;  3PO2 G;  1X54 A;  2F4I A;  2NWG A;  3TEH B;  1P8L A;  4JW0 A;  1VQ7 A;  4UP7 A;  3FKI H;  2EY2 A;  2M2L A;  4LJZ C;  3U9S A;  4DV5 Q;  3ZJY C;  3T1H Q;  2AHO B;  4E6I A;  3GTG H;  2E75 C;  2UUC L;  4IUP A;  1CKO A;  1LT4 D; 
#chains in the Genus database with same CATH homology
 3SK4 A;  2A73 B;  3EQL C;  1YNN C;  2D9U A;  2EYP A;  5ELC A;  3GTQ B;  2R7Z B;  4DAV A;  1LT5 D;  2MP1 A;  3T51 B;  3FKI B;  5FO8 B;  3V96 A;  5LHY 1;  1LT6 D;  2SEB D;  1HFN A;  2A74 C;  4L8J A;  5IGC A;  5JEA G;  1B9N A;  1VCI A;  3GQB A;  1Q1B A;  3FPP A;  4QUC A;  3FEW X;  4Z9C B;  1HTP A;  2E2I B;  2JA8 B;  5FO7 B;  1SNM A;  1FNW A;  1GJX A;  1QNU A;  1SJE D;  3GTJ B;  2QCP X;  3MZ5 A;  1CZG A;  1V43 A;  1MSH A;  3HP3 A;  4TSS A;  1X32 A;  1LTS D;  1D5X C;  5C4J B;  4PMW A;  1F9R A;  5E4X A;  5T1G A;  2F0S A;  2MJ8 A;  2IPK D;  3D6W A;  2Q8I B;  4IUN A;  4TRD A;  2DY7 A;  1LV9 A;  2K32 A;  3KF8 A;  5IGB A;  2NBF A;  2LFN A;  4DNR B;  1SNC A;  4S3S A;  4IUV A;  3D4W A;  4X3U A;  4Q0F A;  1STB A;  3I8Z A;  4J8Q A;  2NTT A;  1D5Z C;  1YNN D;  4RFB A;  3OWE B;  5IGD A;  5KNB A;  1ILP A;  4OIJ A;  1BCP D;  1I6H B;  2IT1 A;  1PFB A;  4R9W A;  2J4X A;  3OPO A;  4XQN A;  2JYO A;  4OO1 G;  2BDN A;  3QB3 A;  1ESR A;  1PRT F;  5EQ0 A;  3JAM L;  2EYL A;  4JBW A;  3NWT A;  3SR1 A;  2K5W A;  1STY A;  2XNA C;  5BN5 A;  5JOB A;  3D31 A;  3M7N A;  4BBR B;  4KN4 C;  3KLR A;  1B50 A;  4WJW A;  5ISR A;  2ENB A;  3BYT B;  1PRT C;  2A5H A;  3IFT A;  3BDO A;  1SJH D;  2WKD A;  2RA4 A;  2JE6 I;  5M5W B;  1T5X D;  4HCE A;  1CFM A;  1F9P A;  5JAV A;  5DAU A;  1F2Z A;  4ZYS A;  3S1N B;  2E2J B;  1G8Z D;  2AUK A;  5I6Y A;  3VYT A;  1G2S A;  1TQO A;  4K5V A;  5EJW A;  2HDL A;  3ERO A;  3OIP A;  2PW5 A;  4DXG A;  3C1E A;  2F0Q A;  1YNJ C;  3IKJ A;  3LNN A;  3J7A V;  4A3D B;  2K5Q A;  4U67 3;  1ET6 A;  4BY1 B;  1BCP F;  4CJ1 B;  2KUM A;  2NZ1 D;  5IGF A;  4EQN A;  1O7Y A;  3PV0 A;  1BQQ T;  1B2T A;  1KAB A;  3N52 A;  3S1Q B;  1OXT A;  3D3R A;  2EDG A;  1DOL A;  1L0X B;  4WRD A;  3VR5 A;  4H0L C;  4XDX A;  3R8B A;  4NW2 A;  3D4R A;  4DAP A;  4BBS B;  3NQT A;  2EYF A;  2O5I C;  4XQQ A;  1XTC D;  3K6O A;  4XYO A;  4CKB A;  3PUW A;  4ZUI A;  4IUQ A;  4A93 B;  4CGY B;  2H1E A;  3S1R B;  1DXM A;  1KDC A;  2EOT A;  4KHV A;  1WTP A;  3QOL A;  5A35 A;  2RDG A;  2C5C A;  3SXH A;  1GOZ A;  1HFG A;  3MXG A;  1RD9 D;  1EU3 A;  4X3K A;  1JIC A;  4AYB B;  1IW7 D;  1S5B D;  1ZXT A;  2B2T C;  4CJ2 C;  2IWH A;  3MFG A;  3MVV A;  4IFD J;  3E5S A;  1HXY D;  3PMF A;  5EKL A;  4ZQ3 A;  3R3O A;  5IIF A;  4H13 C;  5FKA C;  2KQ3 A;  4J1M A;  4IUU A;  2XVS A;  3QOJ A;  3BS1 A;  4A3B B;  4FF4 A;  3GO5 A;  3S14 B;  4DXF A;  2L55 A;  2F0J A;  2I07 B;  4XQJ A;  1U4P A;  2EJF C;  3UI2 A;  3HS0 C;  3ONA B;  4RKB A;  1QE6 A;  2AUJ D;  4N9T A;  2PPB C;  1WVL A;  3TP7 A;  4WFN 3;  1MGS A;  2K1B A;  4FF1 A;  2IW3 A;  3K0Y A;  4K6D A;  1VF5 C;  1IL8 A;  3C2P A;  3S2H B;  1AP0 A;  4PQX A;  2F0M A;  1XYI A;  2JP1 A;  3D4D A;  3SE0 A;  3H0G B;  2FMC A;  1SBB B;  3K7A B;  3GTM B;  2PQE A;  1EQV A;  1MI2 A;  2K5D A;  4C3I B;  2E76 C;  1I4P A;  3H6M A;  2JA7 B;  2MPM A;  3T53 B;  2L9H A;  4Y7N B;  4ZK9 B;  1ROD A;  2XN9 C;  3I72 A;  4RWS C;  3W2D A;  5HUR A;  1CA5 A;  1H9R A;  1UAP A;  1FD7 D;  2FHT A;  3OOC A;  3GD7 A;  3OIQ A;  1NSN S;  5DM7 3;  1D2B A;  5IOD A;  5FK9 C;  4F88 A;  4RH6 A;  5CBA E;  4CKE A;  4K6L A;  2J0T D;  4EQP A;  2JEA I;  2F0P A;  3TP8 A;  2K33 A;  1EYD A;  4KJN A;  3MXN A;  1G2T A;  1I4H A;  1ZEQ X;  4H7B A;  2PZT A;  4QUF A;  5JVH 3;  1ZYR D;  2RSN A;  3C1F A;  4CBV A;  1NR4 A;  1S5D D;  1A2U A;  5T1I A;  3BDL A;  1X3Q A;  1IW7 C;  3MHB A;  1G29 1;  2K03 A;  3NXW A;  5FO9 B;  3DEO A;  2K01 A;  3HZX A;  2JA5 B;  3HOW B;  5HGT A;  3K5N A;  1PTO F;  1PZJ D;  1XXG A;  3TP5 A;  5LL6 S;  3S2D B;  1FNU A;  5C6A A;  4ZKC B;  5TSS A;  1C8C A;  5ELB A;  1TWA B;  2GA4 B;  3SVM A;  4NDX A;  2B2Y A;  5C3E B;  4C1N I;  2EYO A;  5DNF A;  1PZK D;  3HOZ B;  4M1U B;  1Y8P B;  3AU7 A;  3K59 A;  1F77 A;  3Q0A A;  2N55 A;  4MN3 A;  3NUC A;  4KKU A;  2N88 A;  5D65 A;  1UNS A;  1PZI D;  3QG1 A;  3PO2 B;  4QMG A;  4LAA A;  1RDP D;  2SDF A;  3MXP A;  5JJZ A;  3PUZ A;  3Q22 A;  1VF7 A;  2O4X A;  1EEF D;  4FF3 A;  3HOV B;  4ZUJ A;  1G91 A;  4I65 A;  1IYU A;  2YYZ A;  5G3L D;  1DZ1 A;  4CKC A;  4H44 C;  1BXT A;  2MGS A;  2SNS A;  3CRK C;  3TZD A;  5M3M B;  3I4N B;  1CHQ D;  1SXT A;  5A2Q E;  4A3I B;  1PTO B;  3BYY B;  4F8M A;  5C5M A;  4DF7 A;  1V1P B;  4R8N A;  5COR A;  1LTG D;  3AB9 A;  2KEE A;  5D3I B;  1GUS A;  4XT1 B;  1PTO H;  3HOY B;  2EVB A;  5E1F A;  1Q12 A;  5CBE E;  5K36 G;  1NCV A;  1II3 A;  1MBY A;  4FXD A;  1VDZ A;  1ENF A;  2NYZ D;  3DUZ A;  3OMC A;  5CV9 A;  3GV6 A;  4IFD I;  5J1Z A;  1GUN A;  3HRZ C;  4IN3 A;  5CMD A;  1EYC A;  3J80 E;  2M00 A;  4KJO A;  3SDZ A;  2NUC A;  3SK5 A;  3HEJ A;  1CM9 A;  4EQO A;  2KCC A;  1QNK A;  2BDO A;  3I91 A;  1DD2 A;  2B39 A;  3ITP A;  4ZRZ A;  3VA7 A;  2EZV A;  1WD0 A;  4F7X A;  2QDB A;  3EFX D;  1EFI D;  2HCC A;  5AFW A;  2F0N A;  5KRU A;  4XXE A;  1PLF A;  4OHJ A;  5G3L F;  4KY6 A;  3K5O A;  3X3N A;  1NUC A;  3ND9 A;  1SAP A;  3VR4 A;  1ONL A;  1SSO A;  3S16 B;  1I50 B;  1MD2 D;  4UDU C;  2BOS A;  3D6C A;  5EBC A;  1R9T B;  1HQM C;  2B2V A;  2NB0 A;  3DEP A;  4V19 0;  3T4A C;  1BDO A;  1PTO C;  2HCI A;  2LY7 A;  1Z6H A;  3VR6 A;  3NE5 B;  3L9A X;  3W3A A;  1Z7T A;  2MHV A;  3HG9 A;  2BE5 C;  1HRJ A;  1C48 A;  3VR3 A;  2AQ3 B;  4RCN A;  3EJI A;  4PMB A;  1LO5 D;  1LTB D;  1FYC A;  1SMY D;  1WCM B;  2SNM A;  3KLS X;  4HMJ A;  1SND A;  4M8A A;  1EEI D;  4OGQ C;  3T16 A;  1EY9 A;  1SYF A;  4OIK A;  4CHT B;  5KND A;  1JOK A;  4DNT B;  1STA A;  2HQE A;  2RQX A;  5FLX L;  1I6V C;  3FPU B;  3MA2 B;  1RTN A;  3MXU A;  1GUG A;  3NHH A;  3TN2 A;  1JE4 A;  3S15 B;  1EY5 A;  1T5E A;  1JCK B;  3H3V C;  3BVG A;  4KI0 A;  1SNQ A;  1LTA D;  1HPC A;  3GV3 A;  1WTX A;  2IX1 A;  2NN6 G;  4G57 A;  1STH A;  5IGE A;  5EPJ A;  4B9W A;  2CVR A;  2JA6 B;  1STE A;  4DN4 M;  3OHX C;  2VB3 X;  5CV4 A;  3WOE A;  1SE2 A;  1D6E C;  4NMZ A;  4J6H A;  5C44 B;  4OL7 A;  2NVQ B;  3J7A F;  1H9K A;  3J81 E;  5LL6 X;  4BWG B;  3A7A B;  4K5W A;  4DA2 A;  1D5M C;  3S1M B;  2EY1 A;  3M7G A;  2R6G A;  1V8Q A;  4JK1 C;  1ENC A;  2B2U C;  1BCP C;  1TS4 A;  4HAE A;  3NTK A;  3NWS A;  1E2W A;  5C4X B;  1BF4 A;  5IT9 E;  5J22 A;  2LS0 1;  4FNF A;  5BN4 A;  3CHB D;  3SK8 A;  4IFD H;  1A2T A;  2TMP A;  4RGT A;  5CV5 A;  2TSS A;  3TP6 A;  2Z8L A;  4FO2 A;  1DYQ A;  2VNU D;  1A15 A;  2EYH A;  4A3K B;  3S9W A;  4HSP A;  1HUN A;  1HTL D;  4ULL A;  4HTH A;  3VYR A;  1Q90 A;  4DFA A;  3V2T A;  2D62 A;  1QB5 D;  2BA1 A;  1PFM A;  3NTI A;  3WOF A;  2NVY B;  2F0U A;  1I4X A;  3WDN A;  1PRT D;  4XYQ A;  3IFD A;  1TVX A;  1LLR D;  2MUY A;  2F0F A;  4NP5 A;  1HUM A;  3HOU B;  1KNE A;  3J81 L;  1TII D;  2B2T A;  1BNZ A;  2QEJ C;  1CA6 A;  4ODG A;  4FXK C;  1SYC A;  3FDT A;  5KIX A;  3HGB A;  3CKI B;  1S4Z A;  4TKO B;  1U9R A;  2WP8 J;  4YIJ A;  1QCB D;  2B2U A;  2XWJ B;  5I2Y A;  2E2H B;  5KEE A;  1WTR A;  3VYU A;  1S5F D;  2KEC A;  1OXU A;  3FVQ A;  1UEA B;  1RCV D;  2WV6 D;  3GTK B;  4R8I A;  1KNA A;  4EGV A;  4N9P A;  1AZQ A;  5FLX E;  5E3F A;  1JOO A;  1VMC A;  5CC4 A;  1LTI D;  2KA7 A;  4XT3 B;  5CR3 A;  2L0C A;  2LKV A;  1OXV A;  2AQ1 B;  2M9V A;  4A3F B;  3S17 B;  1HHV A;  3MEH A;  1LTT D;  2B2W C;  4IQZ A;  1Y8N B;  1EY7 A;  1VMP A;  2EYM A;  1H9J A;  1AFP A;  2L11 A;  2RDF A;  2O5J C;  4L63 B;  2EXZ A;  1QJO A;  3GTP B;  3ERQ A;  3HKZ B;  1PDQ A;  1I4R A;  4DK0 A;  1JWM D;  2F0T A;  1FGB D;  4G7Z C;  1C4Q A;  3PO3 B;  3R2I A;  1ESF A;  2JEB I;  4ZKB B;  2ZXO A;  1WTV A;  4FXG C;  3I4M B;  3SEB A;  2F3W A;  2XIW A;  1B9M A;  3LWU A;  5I9P A;  1KAA A;  1WTO A;  1UUP A;  4BA2 I;  1W6K A;  2F0V A;  4L6T B;  1QIL A;  2XWB B;  3M85 A;  5EGT A;  2PZW A;  1AZP A;  4K8J A;  1EWH A;  2KHS A;  4MHE A;  1EYA A;  3QWN A;  1RJT A;  1E2Z A;  1I3Q B;  3TSS A;  1CZW A;  1PMR A;  4QF4 A;  3E0J A;  4O1N A;  5JEA J;  1Y8O B;  2KCN A;  1SNO A;  3JAM E;  3PUY A;  1D1K A;  3OWF A;  2FFK B;  3ZYY X;  1TR5 A;  2X6G A;  2R92 B;  5CYU A;  2XSC A;  4XTC S;  2G9D A;  4K5X A;  5EPL A;  4KV6 A;  4P2C B;  5IGG A;  1M4V A;  2B2Y C;  2F0G A;  4ZLT F;  5C3W A;  3A55 A;  1GHK A;  4HR7 B;  2VXW A;  4C3J B;  3A8I E;  1EOT A;  3DXJ C;  1AW7 A;  4A3E B;  5C4H A;  1BO0 A;  3RZD B;  3CQZ B;  1DOM A;  2D2C C;  4LK1 C;  4RKL A;  3LWE A;  2YU9 B;  2X6L A;  1ZKO A;  5M5Y B;  1XWE A;  2PO4 A;  2ICE C;  4PNY A;  1IHZ A;  5ELD A;  3BZD B;  1PTO D;  4KK7 A;  4PV1 C;  1OXS C;  2ICI A;  1A3V A;  3VA5 A;  3A56 A;  4ABN A;  2RSO A;  1EZ8 A;  3T56 B;  2XRQ D;  1DM0 B;  4BS9 A;  3MAQ A;  1F9S A;  3NSW A;  4WOR A;  2B8F A;  4HCS A;  4QIW B;  3KUP A;  1U4R A;  3MC0 B;  1W6J A;  1DJR D;  4Q5V A;  2DY8 A;  4F87 A;  3G6J B;  3BDC A;  4KKS A;  3A8K E;  2PMZ B;  3GP7 A;  5EBD A;  2VUM B;  5DEH A;  1CTM A;  3T13 A;  3KBX A;  3N6R A;  2AWN A;  3A7L A;  1TS3 A;  4RGO S;  4C56 C;  2QKI C;  5JPM C;  5CV8 A;  2K05 A;  1B4O A;  5F2D A;  1JWS D;  1U4M A;  1SMY C;  1V1O A;  1TY0 A;  4KTA A;  4IAL A;  3VYS A;  3Q23 A;  1BUV T;  2B2V C;  2A68 C;  3ND8 A;  4RHS A;  2Q8R E;  1D1I A;  3MWY W;  5M3F B;  4EVO A;  1GXD C;  1Y1V B;  1HA5 A;  4BY7 B;  1TWF B;  1Q8I A;  2EJM A;  2ZXP A;  2QIL A;  4RGN A;  1CHP D;  2Z4H A;  1YNJ D;  2FIN B;  1K8O A;  4FVM A;  5IT9 L;  5CV6 A;  3BG3 A;  1ENA A;  4B08 A;  4KN7 C;  1SE3 A;  2L5T A;  1Q1E A;  5E4W C;  3DWP A;  3K58 A;  2NN6 I;  2KOL A;  3NK9 A;  1M8A A;  5DM6 3;  2EYJ A;  1EL0 A;  1F2L A;  4GZY C;  1EY4 A;  1EWC A;  2PNR C;  4DU9 A;  1NAP A;  3VR2 A;  5I2X A;  1PYW D;  2NTS A;  1SEB D;  1IKL A;  2WKC A;  1Y1W B;  2KJX A;  3E6Z X;  3M4Y A;  1J9O A;  2J7Z A;  3K5L A;  1H9S B;  2WIN B;  5I9O A;  1O7L A;  1GHJ A;  1JC7 A;  3MTS A;  5FOB B;  2BA0 A;  1PRT B;  3H09 A;  4LMQ D;  2AQ2 B;  5M5X B;  3TZU A;  3NPP A;  2F03 A;  4A3G B;  3NP8 A;  1GUT A;  3PUV A;  4O42 A;  1O7Z A;  1OO9 B;  3NTH A;  2PZU A;  4U68 A;  3RZO B;  2IL8 A;  3C46 A;  5CGK A;  3LX0 A;  5I4D A;  3SHL A;  2G9H D;  4X3T A;  2KVM A;  1ICW A;  1TY2 A;  1LT3 D;  1O80 A;  1GUW A;  1HQR D;  1NR2 A;  3M4O B;  2EE1 A;  2PYK A;  5C0X J;  3DM1 A;  4IFD G;  3U9O A;  4KD3 A;  1KDA A;  1JOR A;  1HA6 A;  4RAU C;  5C0X G;  3P75 A;  4A3J B;  3PIP 3;  2WII B;  1CT1 D;  4RGM A;  2WAC A;  4V0B A;  1LAB A;  2B63 B;  3SK6 A;  4IUT A;  4OO1 I;  2A6H D;  2CW0 C;  3QIA A;  4A3M B;  1SFO B;  1F2Y A;  5ELE A;  3I70 A;  4C3J G;  4ZAI A;  3OMG A;  1QOH A;  1Z47 A;  3GTG B;  1I4G A;  3M3Y B;  4IZ8 A;  4C3H G;  1S5C D;  1LTR D;  5ELF A;  1WD1 A;  4OO1 H;  1EU4 A;  1DOK A;  3RD4 A;  4B9X A;  2A6H C;  2AWO A;  4BA1 I;  1JWU D;  4ILW A;  3QJY A;  1G6Z A;  1TWC B;  1ILQ A;  1FR3 A;  2RKS A;  4KY7 A;  4UAI A;  4NKL A;  2B2W A;  4G7H C;  1TWH B;  5EKK A;  1ML0 D;  2OXP A;  1JOQ A;  1B3A A;  5K5P A;  3A8J E;  2Y0S B;  1EY0 A;  4C3I G;  3NQI A;  3RLF A;  3FRP B;  1ZYR C;  3URY A;  1JB3 A;  2NN6 H;  2BCO A;  2OT2 A;  1B1Z A;  1K8M A;  1SYG A;  2LMC B;  1H9S A;  2I46 A;  1BR9 A;  3BVM A;  3QO2 A;  1IKM A;  3D8G A;  1RHP A;  3PIO 3;  1Y69 U;  2X69 A;  1TU2 B;  3V05 A;  1KLU D;  2K28 A;  1SNP A;  2FJ2 A;  4ID6 A;  4RCO A;  3NBI A;  4ME5 A;  3TBI B;  3L7Z C;  5C0X H;  1SYD A;  2EY5 A;  3KBG A;  2CHB D;  2K7V A;  1J8I A;  1MSG A;  2Q8T A;  1BCP B;  3OSO A;  1WTW A;  4C3H B;  5NUC A;  3C3L A;  4IUR A;  2DN8 A;  1A3T A;  1X3P A;  2H4O A;  2F0H A;  4KKT A;  2R93 B;  1DON A;  2L12 A;  2A69 D;  2Z1C A;  1RKN A;  1CQF A;  3OW7 A;  5COY A;  5D14 A;  4X3S A;  5M9O A;  3RMH A;  2HUG A;  3EA6 A;  4MIU A;  2CW0 D;  5KNC A;  3KLS A;  1B44 D;  3RUZ A;  2V4D A;  1CK1 A;  2EJG C;  2CQA A;  1JR0 D;  2WAQ B;  2BE5 D;  3A54 A;  1ET9 A;  3G7L A;  2A6E D;  5C3X A;  2EPB A;  3X3M A;  3CRL C;  1F9Q A;  1TS5 A;  2A69 C;  2F0I A;  4HSV A;  1K83 B;  1XX8 A;  3I3C A;  1DCZ A;  1STN A;  3HOX B;  2E74 C;  5EPK A;  3AMU A;  4KMU C;  3K5M A;  1TWG B;  3O13 A;  4DAY A;  3KK7 A;  3GTO B;  1RF2 D;  4FP5 D;  3IAY A;  1AN8 A;  2RBM A;  2R3Z A;  1SDF A;  1F2M A;  3H91 A;  4KD4 A;  2F0D A;  4DGZ A;  1IYV A;  1U4L A;  4G7O C;  5K36 H;  1H9M A;  3DWQ A;  3CU7 A;  1EIG A;  2DNE A;  3NBH A;  1Q3L A;  4QB4 A;  2NVX B;  1KLG D;  1PFN A;  1B53 A;  3TDQ A;  3K57 A;  3P7J A;  2B8G A;  1TKW B;  3P1H A;  4K14 A;  1TT2 A;  3IL8 A;  4G4K A;  1S5E D;  1LAC A;  4KHZ A;  3TME A;  4RA8 A;  3J80 L;  1SYE A;  1O78 A;  5J39 A;  1PXU A;  2IJ0 A;  3EVQ A;  2XRS D;  1V1P A;  4HED A;  1A3U A;  2Z4I A;  2JSO A;  4K2K A;  2ID0 A;  1WTQ A;  1KTK A;  4K8I A;  3P20 A;  3R93 A;  2JXM B;  1EIH A;  4CJ0 B;  1EZ6 A;  2QF7 A;  1HCZ A;  3GTL B;  2PCF B;  2R61 A;  1CI3 M;  1SE4 A;  4XIG S;  5EKI A;  5C0X I;  1SYB A;  4C1N K;  2L1B A;  4HMI A;  3L3O C;  2A6E C;  5BN3 A;  1A6X A;  4I7Z C;  4FF2 A;  5C4Z A;  4QCL A;  3R2T A;  2F0E A;  5D3D A;  1GUO A;  1L0Y B;  1TS2 A;  3Q24 A;  2O2L D;  2L4N A;  3DWA A;  2OF1 A;  1AEX A;  1STG A;  2ZXR A;  2ZT9 C;  5C5L A;  2PW7 A;  2SOB A;  4K2L A;  1R4Q B;  4C2M B;  1EY6 A;  5JEA H;  2F0L A;  3I73 A;  3MFY A;  2DNC A;  2F1M A;  1E2V A;  4RHR A;  5JVG 3;  1R4P B;  4PMC A;  5KYI A;  1OXX K;  3PUX A;  1RTO A;  1FNV A;  2EY6 A;  3DMU A;  4DK1 A;  2IX3 A;  4HN7 A;  5JPN C;  2F0K A;  1QWY A;  2FMM A;  1BOS A;  4KY5 A;  1KDB A;  2D5D A;  5CV7 A;  3BVZ A;  1BBX C;  2F0O A;  1E0B A;  2A68 D;  1EY8 A;  4FYD A;  5KGU A;  5IOC A;  5A2Q L;  5I6W A;  2K6A A;  2RDH A;  2E2D C;  2IX0 A;  2RVL A;  2OEO A;  3Q6S A;  2C9O A;  1QG7 A;  2F0W A;  2VB2 X;  1JQY D;  1EQT A;  2F3V A;  3FMC A;  1CQV A;  2HDM A;  2K04 A;  3I4L A;  5KYL A;  2KED A;  3J7Y W;  3H94 A;  1I4Q A;  2WB1 B;  3F2U A;  3DHQ A;  2NVT B;  3I90 A;  2F4I A;  2NWG A;  2EY2 A;  2M2L A;  4LJZ C;  3U9S A;  4E6I A;  2E75 C;  4IUP A;  4TQU S;  1LT4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...