3A8JE

Crystal structure of et-ehred complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
126
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
total genus 32
structure length 126
sequence length 127
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8jE00
5A35A 5JEAG 1SMYC 2EVBA 3I72A 3SE0A 1CI3M 2JXMB 3WDNA 3L7ZC 2L5TA 1IW7D 1ONLA 5C0XH 1G291 1B9NA 4KHZA 3PUVA 1Q1EA 3U9SA 1T5EA 3M7NA 4KKTA 1Z7TA 3OPOA 4DNTB 5JEAH 1GUGA 1V43A 2E74C 1LABA 4IQZA 1A6XA 2R6GA 4IFDG 2QF7A 4HR7B 2O5JC 1E2WA 1IW7C 2PNRC 2YYZA 2BDOA 3SDZA 2KA7A 3FPPA 4LJZC 4GZYC 1CTMA 4XIGS 4DK1A 3MFYA 2JEBI 3T56B 4KKUA 4IFDH 3PUXA 1PMRA 1E2ZA 2NN6H 3FMCA 4KMUC 2Q8IB 1YNJC 3I73A 1Y8OB 3VR5A 4BA2I 3NE5B 4XTCS 5BN3A 1VF7A 3GD7A 1H9RA 2B8GA 2BA0A 3PUWA 5KNDA 2D2CC 3KLRA 2PPBC 3MXUA 2K33A 2ZT9C 2DNEA 2CW0C 2A6ED 4H44C 2D62A 2LMCB 4JBWA 4PV1C 2KCCA 1Z6HA 3GQBA 3H94A 3BDOA 1CFMA 3CRLC 3QJYA 4L8JA 2BE5C 1OXSC 4G7ZC 1K8OA 1QJOA 1Y8NB 3A7AB 5K36G 2A6HC 3D4RA 4TQUS 1BDOA 2BA1A 4LK1C 1HQMC 3ND8A 2AWOA 1DD2A 3VR6A 2A69C 1GUOA 2DNCA 4OO1H 3PUYA 1HTPA 1FR3A 1Q90A 1GUSA 2A6HD 3CRKC 2DN8A 2EJGC 3TZUA 4G7HC 4G7OC 1IYVA 1H9SB 2AUJD 3VR3A 5BN5A 3VA7A 1HPCA 3W3AA 2IT1A 3PUZA 3T53B 4TKOB 1VCIA 1GHKA 1ZYRC 1H9KA 1YNNC 4I7ZC 4KN7C 5BN4A 1OXTA 3A8KE 1V8QA 2PCFB 2NN6G 1TKWB 3HGBA 4KI0A 1GUNA 4OGQC 2O5IC 5KNCA 3D31A 2F1MA 3QIAA 1Q12A 2JEAI 3ND9A 2A68C 2A69D 3AB9A 1VDZA 2E75C 1GUTA 1TU2B 3N6RA 4RCNA 3PV0A 3A8IE 5C0XG 1I6VC 2A68D 2EDGA 1FYCA 1GHJA 4BA1I 4H0LC 4JK1C 1LACA 2K32A 5K36H 3IFTA 5KNBA 1H9MA 3DXJC 3QG1A 1H9JA 1Y8PB 4KN4C 2EJFC 2NN6I 3VR2A 2D5DA 3OW7A 4DNRB 1OXVA 3M85A 4OO1G 1GJXA 3OOCA 1E2VA 1EWHA 2E76C 4KKSA 1ZKOA 3LWUA 3A8JE 2AUKA 1HCZA 3EQLC 2JE6I 1DXMA 1IYUA 1H9SA 3P20A 1B9MA 1Y69U 2A6EC 3I4LA 1DCZA 1OXUA 3T51B 1O78A 1Q1BA 2K7VA 1K8MA 3BG3A 4H13C 3VR4A 2EJMA 4DK0A 2V4DA 1O7LA 3M4YA 3RLFA 3A7LA 1OXXK 2B8FA 3LNNA 2BE5D 1VF5C 3IKJA
chains in the Genus database with same CATH superfamily
3STBD 2RKSA 1VQBA 2WAQG 2F0WA 5C0XJ 3NPPA 1A62A 2RDGA 2EYJA 4KD3A 4DR6L 4KHZA 5EKIA 4Y7NB 5C5MA 2NVTB 2R93G 3I8ZA 3HZXA 1WTQA 1QNKA 2O5JC 1IW7C 1PLFA 1Q81C 2XNAC 4UPAA 2HCCA 2KA7A 4I7AA 4XIGS 2KENA 4CJ0B 5IT9E 2I46A 4DAYB 2QGQA 1FJGQ 1YNXA 1OTCA 4DUYL 3FVQA 4N8FA 1QUQA 1EOTA 2JN4A 4BXXH 4LMQD 3K0YA 1J5EL 2B2VA 2CW0C 4B3SL 2CVRA 1D1KA 2J0TD 4A4IA 4PMCA 1KDBA 3J7AV 2JA8H 3Q24A 4DK6C 4TQUS 4IO9A 1STYA 2SNSA 4HMIA 1DD2A 1WTXA 2A69C 2F0EA 4WRDA 1AEXA 2QCPX 1VQCA 4IPHA 1AE2A 2IW3A 1LTBD 4OIJA 5CR3A 5LMUQ 2B2UC 3G7LA 4H7BA 5C0XI 1FNUA 1XNQQ 3VYUA 1K83H 5IGGA 4IUTA 1BCPD 2NWGA 4RFBA 1TKWB 3X3MA 1GUNA 3CC4A 3DHQA 3F2BA 5D14A 1EEID 2E75C 5FJ8G 2ALYB 3QWNA 1K8AC 4B3RQ 3FKIH 2JK8A 1SMXA 3DWAA 4M1UB 1QCBD 4HSVA 5T1IA 2MFIA 2NVQB 4FXDA 1VQPA 1KQSA 3CCQA 3CCEA 1FGBD 5FLMG 2QEJC 4IPDA 5C3EB 1HA5A 1U4LA 3EQLC 2NTSA 3A5UA 4CHTB 1CA6A 1JOOA 4MTKA 3L0OA 4JI7Q 1ICFB 1LT3D 3R2TA 2OEOA 1XNQL 1B44D 3RD4A 2PQEA 1C9OA 2K6AA 1IKMA 3S1NB 3PO3G 3CPFA 2NZHA 2F0SA 3K7AB 4JYAQ 4HJ9A 1N36L 4B9WA 2HQEA 4MTNA 4DPGA 1WYDA 5JJIA 2SNMA 3D3RA 3H0GG 4JI1Q 3HKSA 4KY6A 1V9PA 2YU9B 1SROA 1BF4A 5IP9H 4JI0L 3H09A 5EPLA 1F9SA 3BVZA 4OWTB 4YWKA 3AFQA 2NB0A 4K8JA 3SDZA 3J7A5 3OHXC 4NKLA 4JOIA 3S2DH 2R3ZA 5IY0A 1PH6A 1CK1A 2OCEA 5GQOA 3GTJB 1PMRA 3FMCA 3VR5A 2EYOA 2F0HA 1TWHH 4JBKA 4DV4L 4DR2L 1V1PA 4CKBA 1Y1WB 5HGQA 2TMPA 1QJOA 2V1CC 4ABNA 5HGTA 5J1ZA 4DV5L 3EIVA 1HQMC 1W2BA 4KY7A 1SR3A 2G5DA 2GVBA 3HP3A 1HTPA 5IYDH 3BZCA 4O42A 3HOVG 1CT1D 1II3A 3IL8A 5C44H 2Q2TA 2A5HA 1HUNA 4NXNQ 4LFBL 1CM9A 2K5QA 3Q23A 2CH4A 1EEFD 1K3RA 4ZCKA 1LTSD 1E22A 3E6ZX 4J15A 2R61A 1S72A 1STGA 5M5WB 2VXWA 3OTOL 2YU9H 4DUZL 1KRSA 1X3QA 2JA5G 3FRPB 4FDBA 4F7XA 2C35B 2UUCL 3ULPA 3HOVB 1L1OB 2I0QA 3HOWG 2B63B 1RTNA 1VQAA 4DV7L 3K57A 1Q8IA 2VB2X 4FF1A 3DM1A 4CJ1B 2BH8A 3EVQA 3S15H 1GD7A 1WVLA 4DV1L 1O7LA 4H02A 5E7NA 4L6TB 3LNNA 1S5FD 5FO7B 3J81i 4LFBQ 3IKJA 1Z9FA 1SMYC 5CV6A 2UUBL 3E0EA 4B3TL 3HKZG 2VY3A 3OYYA 1TY2A 2B2YC 2IX0A 3L9AX 3H15A 4MIUA 3M7NA 3MXNA 4KKTA 1BQQT 2L1BA 2MNAA 2WAQB 1EYAA 3H91A 2MHVA 1WCMH 4DUZQ 2VL6A 2RBMA 4K8IA 5CYUA 2ZM6Q 4YCWA 1Z47A 1MSHA 3KLSX 4IUNA 1TQOA 4K6LA 2JEBI 2UXBL 2WV6D 3E3XA 1MIUA 4C3HB 2ASBA 1RIPA 4KMUC 3B6YA 3S1RH 4LF4L 4YHHL 2RQXA 2B3GA 1PH2A 1FNVA 1BCPC 1PTOB 2UU9Q 2LMCB 1E1OA 1Z6HA 4EQ5A 5I6YA 4HIKA 4CGYB 4A3IB 2JA6G 3K5NA 4ALPA 2D0OA 4FNFA 4DK3C 1TS5A 1W6KA 3JAMc 2AWOA 1U4PA 3E5SA 4ME5A 1O80A 1FR3A 1ET9A 1SYBA 4HEDA 2XVSA 4C3HH 3CRKC 3J80c 2DN8A 2EJGC 3CCRA 2B63H 2K4KA 1UWVA 3J7YW 4FP5D 2IT1A 2K50A 3RN2A 4GNXB 4CDCC 5C4JB 2R92G 1I3QB 2NBFA 1HQRD 3QIAA 2EXDA 4NMZA 2BDNA 2WB1B 3DEOA 1B4OA 3MEHA 1S4ZA 1QWYA 3GV3A 1PZJD 1PTOC 2Z6KC 4EGVA 4A3CG 5DM63 4DR5L 4K2KA 3W1GA 5I2YA 1NCVA 4G4KA 1I5FA 5K36H 4ZRZA 3DXJC 4XQNA 3VR2A 3NUCA 4EQNA 3M7GA 2R93H 1HZAA 2E2JB 1YNJD 4KKSA 1ZKOA 2CW0D 1DXMA 4JBMA 2UXDQ 3G6EA 1PTOF 2R92B 3J80E 2R92H 3I4MH 4GKKL 3M4PA 1PFNA 4WJ4A 3PO2G 1VF5C 3I2ZA 5A35A 1SYDA 2L9HA 2EYPA 4QL5A 3L3OC 2NVXB 4U673 4R8IA 2MO0A 2G9HD 1HH2P 1X6OA 1JICA 3RR5A 3R93A 4A3MH 4B3MQ 5D3IB 1X3GA 4DAVA 4C3IG 4C56C 1GM5A 4JV5Q 4DR7L 2L12A 4RKLA 5HURA 3UDGA 2EYMA 4OL7A 2Z4IA 2PNRC 2PYKA 4OWWB 4LJZC 3CD6A 4EVOA 3FHWA 2MUYA 4JPBW 4A3EG 1IYJB 3GTMB 2VUMG 2K01A 5KIXA 4LF8L 3AFPA 1NNXA 2B8GA 5IGBA 1IL8A 2K1BA 2RVLA 2A6ED 3J81E 3C46A 1WJJA 1EIGA 1RTOA 3QJYA 1AH9A 1BR9A 1EYDA 1A8VA 4E6IA 3GTOB 5IWAL 3N52A 1STHA 3UDIA 5FLXE 3J81j 2R93B 1G91A 1KDAA 4ZUJA 1KRTA 3TS2A 3PUYA 3GTJH 2KCMA 3KF6A 1HNZL 3BVMA 1K28A 2PZTA 4GLAC 1OO9B 4A3FB 1WTVA 1H9KA 4C3JH 5BN4A 5IYDG 2YTXA 1D5XC 1HJPA 2PI2A 1SFOH 4OGQC 3WOFA 3HS0C 1Q12A 2HHHL 1V1QA 3AMUA 2R7ZB 1PFBA 3N6RA 1N33L 3QO2A 1HUMA 2NVYH 2EDGA 4KY5A 1HFGA 2QW7A 1VS0A 1CUKA 1STNA 3D6WA 4B3SQ 3NEMA 5EJWA 1WTPA 4RHRA 1FVIA 4KJNA 2EJFC 1JB7A 1SE2A 1K83B 1E0BA 1B53A 1LM0A 2PW5A 3CU7A 4AYBB 1EU3A 1F2ZA 5I6WA 4U68A 4J1MA 4LF5L 3KUPA 4O2DA 5JVH3 1B9MA 1SN8A 2WFWA 2K5HA 1G2SA 1TWAB 4LFCQ 3BG3A 1MSGA 1LTRD 2V4DA 3MEFA 3RLFA 4YWMA 3A7LA 1ASYA 2EYFA 3NP8A 5JAVA 1XWEA 3I72A 5COYA 1ENCA 4DXFA 1D2BA 4XYQA 2L5TA 4LAAA 1Q46A 4JI6L 2B2YA 3PUVA 1BKBA 2OF1A 1C8CA 5C3EG 3I91A 3C2PA 4C3JB 2DGYA 5LL6S 2KBNA 1CTMA 4HIMA 5D3DA 1PH8A 3KBGA 2NN6H 1CSQA 5IP7H 5M3MB 2Q8IB 4BY1G 5C6AA 4QCLA 1VQ5A 4BA2I 4JI3Q 2F0PA 2BA0A 1F2LA 5KYIA 4JI7L 3S17B 2M00A 4OXPA 1YI2A 3D8GA 2KCNA 1EY0A 3CP0A 3TREA 3GTQB 1AW7A 3K6OA 4R4TA 2L55A 4LK1C 1PDQA 4C3IH 3PGZA 3CQZB 5C3EH 1SNPA 3NBIA 4G7OC 2KEEA 2AUJD 4UHVA 1U4MA 3VA7A 2ZJPA 3DWQA 2CWPA 3I4NG 1WFQA 3S1MB 1OXTA 5JEAJ 4KI0A 4GKJQ 4BY1H 1ENAA 2KUMA 1KABA 4QGUA 1PFSA 5A2QL 5CORA 3ZYYX 3O13A 3GDEA 3BZKA 1B2TA 3TZDA 2PQAA 1WTRA 4IALA 1YHBA 4QF4A 4KN4C 2NN6I 4A3KG 2EE1A 2D5DA 4QB4A 1N32Q 3A5ZB 1AN8A 4DV5Q 5JOBA 2AQ2B 5IGCA 1VQ7A 5EBDA 3A8JE 2AMCB 5D65A 2EYHA 2PW7A 2L4NA 2IY5B 4YIJA 1SSOA 1KLUD 4XT3B 2XWJB 1Q1BA 3TSSA 5CMDA 1K8GA 4JCVE 1ET6A 5GROA 2PI2E 5M5YH 2F0IA 3HOZG 2Y0SG 4A3IH 4GKJL 4RAUC 3NQTA 1GXDC 1JT8A 4DR3L 4TSSA 5EGTA 1ASZA 3RNUA 3OMCA 1UE5A 3S1QB 4S3SA 2JYOA 1NAPA 1Z7TA 2RA4A 1VQEA 4HCSA 1BUVT 1LABA 3DMUA 3GP7A 2ZJRA 4BBRH 2R6GA 3CXCA 2VUMH 4OELB 2UUAL 4HN7A 4A3GH 5DLQE 2AKWB 4OHJA 4RH6A 1N32L 3MZ5A 2Q2HA 2ID0A 3HOXH 4DV6L 3MVVA 4QY7A 1DOMA 2X6GA 1BOSA 5JVG3 4DV7Q 1YZ6A 1H9RA 3M3YH 1I4PA 4A3EB 4X6AH 1QG7A 2EZVA 4OEMB 1IKLA 5EPKA 4QJFA 3A7AB 3CC2A 2KOLA 3PSIA 4QMGA 3FEWX 2BOSA 4OX9Q 3HOUH 1PYWD 3NHHA 1G51A 3RZOH 2D9UA 2BH2A 3FKIB 3AYHB 4GNXA 3NQIA 3CMAA 1IYVA 1LLRD 3U4ZA 3NBHB 5BN5A 3OMGA 5LL6X 4NDXA 5I2XA 1RODA 3GTGB 1WD1A 3DEPA 3QOLA 2UUAQ 2GVAA 2HT1A 1TS3A 2YV5A 3S2HH 1M4VA 4KD4A 2PCFB 4A3CH 4ZKBB 4HJ5A 1KAWA 1TIID 2UXBQ 4DV6Q 2JEAI 4UY8C 2NVXH 2H1EA 3AB9A 1QZGA 3TP8A 5M5WH 3PV0A 4P2CB 5DNFA 1VQOA 3VYTA 5CC4A 5IYCH 4H0LC 1P8LA 2UU9L 2C9OA 1KD1C 3I4OA 1H9JA 2M9VA 3K7AH 1CQVA 4DR1L 1MD2D 4IJHA 4Z9CB 5CV9A 2F3IA 3FKIG 1E2VA 2E2JH 2IX3A 2E76C 2XGTA 3ERSX 2MO1A 3SK4A 1H9SA 1EIFA 1F2YA 1XMOQ 1DCZA 2EY2A 5I9PA 3R2IA 3M4OB 2K7VA 2LS01 1TS2A 4OWXB 4HAEA 4A3BH 4QIWB 3LGJA 3KBXA 2RDFA 3K58A 2JA5B 3A74A 4HIDA 2AWNA 1XMQQ 3RN5A 1STEA 2ZJQA 4F88A 3G71A 3KFUA 2NZ1D 5HY6A 1WOCA 2E5LL 1CZGA 5K5PA 1YBYA 2PMZE 4P73A 2P5ZX 1KL9A 1A0IA 1X65A 4X65Q 4DK1A 5F2DA 3UE1A 4CDDC 4ZLTF 1A2TA 3JAML 1CKMA 1EQRA 1AZQA 4R8NA 4DV0L 1Y1VH 4NXML 1NBWA 1LTAD 3PUWA 1IBKL 3RZDH 2PPBC 3M4QA 3NWSA 3HOXG 1VQNA 3AU7A 2JQOA 1XPRA 4UP9A 3KLSA 4DV2Q 3CRLC 2HCIA 4ZK9B 4KTAA 2KVMA 1JWMD 2HIVA 5CV5A 2A6HC 1Y14B 3VA5A 1RKNA 1SNOA 2F0FA 3GTPH 1NY4A 1GUSA 2C5CA 1VQ9A 4ODGA 3I56A 3H3VI 1NR2A 4OONA 4A3GB 4MHEA 2SDFA 1SEBD 1YNND 1R4PB 3UDFA 3TRZA 1D5ZC 4RMFA 3RMHA 2E2DC 4DR6Q 1YITA 4PG3A 5I4DA 5M3FG 4RHSA 3K5LA 1VMCA 1PZKD 3A8IE 2Y0SE 3GTKH 3MWYW 1WI5A 3PIOA 1IBLL 1M90C 4R4IA 3K81C 3OIQA 1EUJA 3ONAB 3OW7A 2B2UA 4A3FG 3OOCA 2JA7H 3HOVH 2G9DA 2MQHA 4L5SA 4JVZA 1J5EQ 2MJ8A 3R3OA 1IZ6A 1PTOH 1CKNA 2K04A 4GLVB 3K5OA 1ILQA 1OXXK 3OWEB 1K3BC 1UEBA 4WJWA 2B2VC 1HRJA 5FK9C 2FFKB 5DAUA 4BBRG 2EQSA 1LUZA 1STBA 2XWBB 3KK7A 2QEXA 1G291 4M8AA 3U9OA 4Q0FA 4K14A 3H6MA 2VNUD 4Y7NH 3H3VC 2HQLA 1JB3A 3TDQA 2F0LA 4HSPA 1TT2A 2CCZA 1PV4A 3T1HQ 4QUFA 1TVXA 1AZPA 1NMFA 1FD7D 1I4XA 2XIWA 4DXGA 2IHEA 3P75A 5FOBB 1FNWA 3MFYA 2RHQB 3G6JB 4IFDH 1X9NA 1VF7A 4X3KA 2D2CC 3I4MG 3D4WA 1EYCA 3QR8A 4POGA 1FL0A 1LTGD 2Q8TA 5DM73 4A93G 4DF7A 2F0VA 1BDOA 1N36Q 4LFAL 3TQYA 4CBVA 4XXEA 2A1AA 5FLMH 1KNAA 1JR0D 1MJCA 5IYBH 4G7HC 3QOJA 1HNXL 3P1HA 2VUMB 1XXGA 3QB3A 1B70B 1HPCA 5M3MG 1N34Q 3GTLB 2K5DA 3T53B 5EAYA 4R4QA 2B63G 1KAAA 1PRTB 1YJWA 4IZ8A 1X56A 1O7YA 4WORA 2PO4A 2Q8RE 1G6ZA 1RHPA 4JI1L 2Z6KA 4JW0A 5JJZA 1I50B 5C0XG 1K0RA 1UE1A 1QB5D 1UNSA 2A68D 3PO3B 4DV4Q 4A93H 3K80C 1A2UA 2F0OA 1F77A 2EYLA 3CCMA 1GJXA 4DNRB 4POFA 3I4NB 1EWHA 3LWUA 1J9OA 2AUKA 3S24A 4HIOA 3P20A 4YCUA 1EL0A 3GTLH 4BWGB 1F2MA 1MI2A 3MHBA 5GADC 4NXNL 4QQBX 4PQXA 1VQDA 1A63A 2MPMA 5M3FH 4GS3A 3WDNA 2F0JA 3PIPA 1TY0A 1ONLA 1K73C 3DLLA 2QDLA 4DNTB 4C1NK 5C44B 5AJ3L 2QF7A 3JAME 5JPNC 4J8QA 4BBSH 4A3FH 1XX8A 5IGDA 3KF6B 3I4NH 1EQVA 1E3PA 1CA5A 1HFNA 3I73A 1EIYB 5KEEA 5BN3A 2JA6H 4IURA 4DAPA 4LF6L 3S15B 5JPMC 1ESFA 1I50H 5LHY1 3I70A 2D62A 4YY3Q 2BE5C 1MHWC 5BR8Q 1SRUA 1SJHD 2UUCQ 2EXZA 4UP8A 2LSSA 1HNWL 3K59A 5ELFA 5C4XB 2A6HD 1LTID 2GN5A 4GN3B 2Z0SA 5KYLA 1S3OA 1UE7A 3CPWA 4RKBA 1SYFA 1MKHA 3C3LA 2HDLA 2ZXRA 5EQ0A 5EKKA 2EY5A 3HGBA 3ULLA 1GUWA 2N49A 2KEDA 1SLJA 3NWTA 4WFN3 3TEHB 4RA8A 4LF6Q 1WTWA 4RCNA 1CSPA 5E3FA 1VQGA 1A3VA 3BZDB 1R9TH 2JA7G 2K32A 5ELCA 5KNBA 2RDHA 1H9MA 1EY9A 3SGIA 1WTOA 2HDMA 3AQQA 2IHFA 1B8AA 1HR0L 4ME3A 4CDFC 3NELA 3I90A 4OO1G 4A3JG 2MP1A 5C4XG 1HNWQ 2K5VA 3KYHC 1FGUA 1JWUD 3Q6SA 4DR4L 4PMBA 1STAA 3E9HA 3EBEA 4R1JA 1HZBA 3K0XA 2JP1A 2CFMA 2K14A 2NVYB 3S2HB 1QVFA 2B8FA 2FINB 2LXJA 3K8AA 3W5OA 2R7ZH 4LUVA 4IPCA 3Q8DA 3L7ZC 4FVMA 1IW7D 1PH3A 4JI5Q 1X32A 1EZ6A 3S1QH 1TWFH 1Q1EA 5JEAH 1ILPA 5IOCA 3MTSA 4DV3L 3IRBA 4IFDG 1TS4A 2NZOA 1DJRD 1U5KA 1NMGA 3KJPA 1X3FA 1C4QA 1IL2A 3FPPA 4P71A 3S1NH 3NK9A 1X3EA 1Y1WG 1YNJC 4BBSG 3NE5B 2Y0SB 2R7DA 3BDLA 3GD7A 5KNDA 1DGSA 1SJED 1AP0A 1BCPF 3GTKB 4PV1C 4K6DA 1PRTC 3GQBA 3H94A 2QILA 1KIXA 1BNZA 3Q0AA 5K36G 2JA5H 2MGSA 1DOKA 3TP5A 4BS9A 4BY7B 3URYA 4O1NA 3T4AC 4JI5L 1Q90A 1A15A 2UXDL 1SBBB 1IHZA 2NVTH 1MJEA 3T1YQ 3CCLA 1ENFA 3VR3A 4JV5L 2SOBA 2QKIC 3AEVA 1ML0D 2Z1CA 4KN7C 4RCOA 3ITPA 1V8QA 2YTVA 4WJ3M 3KJOA 4FXGC 4A3BG 5JJKA 2Z4HA 4JC0A 2F1MA 3EROA 5AFWA 3T13A 1HTLD 2ICIA 4DUYQ 1TWAH 4DV0Q 1NUCA 3RZOB 3CQZH 3PO2B 1GHJA 5FLXL 4JK1C 3HOWB 1SDFA 5A2QE 4L5TA 3PIO3 3DUZA 1GVPA 3A54A 3UDXA 2NUCA 1PFMA 3UE0A 2B39A 4L5RC 5ELOA 5GAGC 5EPJA 1E1TA 5LMNL 3M85A 1I6HB 3TP7A 2M2LA 3S14B 4QUCA 2K52A 5CV4A 4C1NI 1C48A 4C2MH 1EQTA 2JE6I 4UAIA 1IYUA 2N3SA 3T1YL 1O78A 3VR4A 2CQAA 1XPOA 2PZWA 3S16H 3IAYA 5IWAQ 2ZXPA 3EN2A 1CI3M 3F1ZA 4AYBE 5FO8B 4LF7Q 1SNQA 1RDPD 3PCOB 1I4HA 1QILA 3HOYB 4AH6A 1T9HA 1R9TB 3G48A 4IQZA 4A76A 4B3RL 2EPBA 1U9RA 3GTQH 5TSSA 1Q82C 4LF9L 1HZCA 4K5XA 3TN2A 2F4IA 2WKDA 3J80L 1MBYA 5M9OA 5ELNA 5LMNQ 1VQKA 1VQJA 1LV9A 2DY8A 3J7AF 1EY6A 4LF5Q 1TXYA 3NXWA 3HEJA 2B2WC 2Z6BA 3MXNB 2ZXOA 4PZ6A 3KLRA 2LFNA 1L0YB 2A74C 2ZT9C 2X6LA 1NJIC 4LW1A 2AHOB 2EY1A 3SVMA 4DFAA 1Y1WH 2RF4A 1BVSA 2R7ZG 2ICEC 4DN4M 4G7ZC 1BCPB 2ZTDA 1SE8A 2Z8LA 3OW2A 4JYAL 1A3TA 3F2DA 4LF7L 4NPSA 3H0GH 1GO3E 4K5VA 4IFDJ 3SK6A 2KHJA 1Q3LA 4C2MB 2I5HA 2JA8G 5IT9c 4LFCL 1SYCA 3Q22A 4A3KB 4JI0Q 1U4RA 3T1HL 1E24A 3TMEA 4DNIA 1UEAB 4I7ZC 1EOVA 1Q86C 1I4QA 1LT4D 1QOHA 5KGUA 3CKIB 5KNCA 2JJQA 3MC0B 1A3UA 4NP5A 1ZEQX 3CCVA 4CDEC 1ICWA 4ID6A 4DR2Q 1LACA 2D0PA 2RSNA 1D5MC 3OWFA 3GTOH 1D6EC 2KHSA 3TP6A 3KLWA 5G3LF 3E9IA 5FKAC 4ZUIA 3ER0A 2F0GA 4LFAQ 2IX1A 3RLOA 5EBCA 3J81L 1PYBA 1N8RC 3STBC 1EWCA 4GN5A 3PQIA 2A8VA 1BBXC 4UP7A 2KCTA 4BXXG 5ELEA 1I3QH 4A3DG 1IBML 4H44C 1WTHA 2EVBA 2YTYA 4F8MA 3SE0A 2K03A 4HMJA 3WWVA 1EU4A 2FJ2A 3RLNA 3SK5A 1K0SA 1JJCB 4X3UA 4A3MB 4MZ9A 3S14H 4N9PA 2E2HB 2E74C 4ZAIA 3D6CA 1A6XA 2UXCL 4HR7B 3W2DA 2ENBA 2RCFA 4JG2A 2N78A 2WACA 3MAQA 2F0DA 2EIFA 4UDUC 1I4RA 2IL8A 3OSOA 4X64L 3FPUB 3SHLA 1LTLA 3OTOQ 5G3LD 4CJ2C 2DNEA 3S16B 5C4JH 3V2TA 4L8JA 1F9QA 4B08A 4PZ8A 2KJXA 4X66L 1C7YA 3DWPA 3M9BA 4A3MG 4IUPA 2UUBQ 4B3TQ 3H0GB 5E1FA 4DAYA 5T1GA 1F9RA 3UI2A 3U4VA 2OWOA 4EQOA 3W3AA 4DV1Q 1Q7YC 1M8AA 1YNNC 2J4XA 2UXCQ 3I4MB 5E4WC 5C3XA 1JWSD 2E8GA 4XYOA 1I94L 4FYDA 1SE4A 5M5YB 2ZTCA 4DR3Q 3CF5A 2A68C 2A69D 5KRUA 4A3IG 1VDZA 2PQAB 1EY4A 2F0UA 4X64Q 3M3YB 1TWGB 1TWGH 2Z9HA 5CBEE 4AYBG 3S17H 1UE6A 3D0FA 4BA1I 3L2PA 2JA9A 1PH1A 2ZM6L 3NENA 3NTHA 2F3WA 3IFTA 1KNEA 3EJIA 4YY3L 3RUZA 4JBJA 3CAMA 3VYSA 1PH4A 5BR8L 1HZ9A 1NE3A 1PXUA 1RCVD 4X66Q 1NTGA 5IYCG 3CCJA 2N55A 5NUCA 1S5DD 4EX5A 1SFOB 4NW2A 2O4XA 2OQ0A 4YWLA 2DJGC 3ZJYC 1YIJA 4LF4Q 5IP7G 1TR5A 4RGMA 4KJOA 1UAPA 1E7ZA 4TVAB 3PF5A 3K7UC 4FF2A 1JMCA 1XNRL 1QNUA 5ISRA 3BJUA 1QVCA 1I94Q 1LO5D 1YEZA 2DJFC 5ELBA 5J39A 4GN4B 4CKCA 4A3LG 1KHIA 4EQPA 1T5EA 1QUQB 2FMCA 2FMMA 2CKZB 1VQFA 5M5XH 4IN3A 3BS1A 1U0LA 4JI4Q 2F4VL 3WOEA 2IJ0A 3OIPA 4QIWE 1EZ8A 1PTOD 3LWEA 1HR0Q 4HTHA 4IUQA 4GLXA 3U50C 3T56B 3E0JA 1UUPA 3S1RB 1HHVA 2ZTEA 1BBUA 2KQ3A 2B2WA 3W1BA 3J80i 4DR5Q 1PYSB 1G6PA 4RG1A 3DM3A 1SNDA 1PVOA 3U58A 4DGZA 1BBWA 4P74A 4BY1B 2F3VA 1K8OA 2LKVA 1WCMB 4KV6A 1DONA 2HIXA 1CHQD 3F2CA 1PHJA 2WB1E 2I5MX 4BY7H 1GUOA 5C4XH 4OO1H 3HOWH 1H9SB 4KK7A 1LT6D 4DR7Q 1P16A 3PUZA 3PIP3 3RZDB 4GKKQ 4BBSB 2E5LQ 4JI8L 4A3EH 1K9MC 4C3HG 1XPUA 3TS0A 2H5XA 4Q5VA 4ZQ3A 1QZHA 1X54A 3D31A 4X62L 1ZYRD 4HJAA 3ND9A 4DU9A 2JA6B 1RL2A 3KF8B 4B3ML 4IUUA 1EFWA 3F2UA 1B3QA 1PH5A 1CKNB 1IBKQ 3FDTA 3NTKA 4K2LA 3R8BA 3BYYB 2PZUA 4BBRB 2XSCA 4DV2L 3A0JA 1PRTD 1RF2D 1SYEA 3CMEA 1AFPA 1SNMA 1L0WA 2ATWA 3S9WA 1HCZA 4A3DH 3BYTB 1Y69U 3KDFB 5LMNW 2WB1G 4H13C 1Y1VG 1KC8C 4DK0A 1S40A 2AQ3B 2LXKA 1QVGA 4JI8Q 2L11A 1L1OC 3LX0A 4V190 4OO1I 4PNYA 1ZXTA 1YHQA 5IODA 3K5MA 4X62Q 2HHHQ 3D4DA 1VQLA 2K28A 5C0XH 1PA6A 3JC66 5LMUL 3U9SA 3PO2H 1HNZQ 5EKLA 1V43A 4LNQA 2VS1A 5C5LA 2QA4A 5M5XB 5IGFA 4ULLA 1IBLQ 1J6QA 2NYZD 2NVQH 1F9PA 1E2WA 1W6JA 2YYZA 1SMYD 1XTCD 1V1PB 5IE8A 4PZ7A 4J6HA 4G57A 1D1IA 1VQIA 3H3VH 1Y8OB 2XN9C 1N33Q 3KOJA 2I5LX 3HFZB 3GO5A 1BO0A 3MXUA 3S1MH 4IFDI 5J3BA 3VDYA 4CKEA 2E2IB 4GOPA 4KHPQ 1CFMA 1LT5D 5ELDA 1X55A 1SE3A 1Y8NB 4LUOA 4OIKA 1YVCA 1CZWA 2BA1A 1DOLA 3HOUB 2CHBD 3ND8A 4ZYSA 3VR6A 1QE6A 4C3IB 2ES2A 2DNCA 2XTIA 4JI6Q 1JE5A 3TZUA 1N9WA 2J7ZA 3M4OH 2K75A 2SEBD 4MN3A 4TKOB 4LF9Q 1GHKA 2VB3X 2F0QA 1JORA 3A8KE 2NN6G 5CBAE 4V0BA 4HJ7A 2O2LD 2Q2IA 3MXPA 5M3MH 2F52A 3NBHA 4HJ8A 1PRTF 1L2FA 2B29A 3A55A 3CW2C 2OQKA 2L0CA 3HOYH 2BCOA 4KHVA 2XRQD 1FYCA 1JJGA 3EA6A 4JI2L 3BVGA 3KF8A 4KHPL 4KLKA 3CHBD 4MNOA 3QG1A 2JA8B 4XT1B 3HOUG 1Y8PB 3SEBA 1VQ8A 4IPGA 1B7YB 2K5NA 2OXPA 5FJ8H 3J81c 3A56A 5FO9B 1J8IA 3BDCA 4GOPC 1M1KC 4Y52H 5C44G 1R4QB 2HD3A 4JI3L 3I7FA 2A6EC 2OT2A 3T16A 1XTDA 1JCKB 1OXUA 3T51B 1DYQA 1JE4A 2EJMA 4P75A 5C4ZA 1N34L 2RHSB 1LYLA 2F0NA 3PF4A 2L15A 2I07B 1TWCB 3KDFA 1AE3A 1WD0A 2KHIA 1W3SA 1D7QA 1SXTA 4RWSC 1B50A 2VZAA 2F03A 3CCSA 1TWFB 3J7ZC 1HNXQ 2K05A 2K5WA 2EY6A 1GUGA 4JOIC 4K0KL 3G4SA 4A93B 1HR0W 4PMWA 4JI2Q 4A3KH 2OTLA 5IT9L 1KXLA 4IUVA 2IWHA 2GA4B 5I9OA 3HKZE 4N8X1 5J22A 4RGTA 1BXTA 1G8ZD 4GZYC 1KLGD 3HOXB 5IP9G 3BU2A 3PUXA 1E2ZA 1O7IA 4R9WA 4X3SA 3CC7A 1JOKA 4A3DB 3HG9A 1YJNA 3CCUA 2VW9A 5CV8A 3HOZB 3TBIB 4LWCA 5JJLA 3IFDA 2R7FA 2K33A 4O0AA 3ICEA 2KCCA 4A75A 1B1ZA 1EY5A 3BDOA 4I65A 3MXGA 4YCVA 1IBMQ 2WP8J 3F8TA 5GAEC 1DM0B 2EOTA 3D4RA 1Q8KA 1VQ6A 1CKOA 2JA7B 4ZKCB 4A3JB 2HUGA 4XDXA 2WINB 4IOCA 1WCMG 1O7ZA 1GKHA 2FHTA 4RGOS 1RD9D 4K0KQ 2A73B 1D8LA 3SR1A 3MFGA 4R4CA 1ZYRC 2IPKD 1YJ9A 1L1OA 4DA2A 2NTTA 1H95A 3V96A 1G2TA 1V1OA 1TWCH 1JJ2A 4DAMA 2N8NA 1GUTA 1T5XD 1TU2B 2DY7A 4TRDA 3ULJA 5AJ3Q 2H4OA 3C1FA 1KDCA 2CWAA 3HKZB 1PZID 5DEHA 5M3FB 2OTJA 1JC7A 1RJTA 1GOZA 1EY7A 2LY7A 1JOQA 2TSSA 4GNXC 3C1EA 3S2DB 1KTKA 1C0AA 4HCEA 2VQFQ 1EY8A 4FF3A 2A19A 4YHHQ 4B9XA 5L37A 4L5QA 3I4LA 4RGNA 4P72A 1K8MA 5IIFA 1L0XB 2XRSD 1JQYD 2CQOA 3I3CA 5FLXc 4LUZA 3M4YA 5CV7A 4AIMA 1YHAA 2BE5D 4A3LH 5JEAG 4OX9L 2JXMB 3X3NA 1LTTD 1Y1VB 3VYRA 3HRZC 3SXHA 1B9NA 2WIIB 5C4HA 2VQEQ 3PO3H 1PH9A 4BY7G 4X3TA 1EIHA 3OPOA 3PMFA 2E2HH 3JAMi 5H1SE 1VQMA 5IYBG 3GTGH 3GV6A 4NB3A 2BDOA 4DR1Q 2DUDA 2B2TA 4XQJA 4KKUA 5CGKA 1ESRA 1SYGA 2N88A 2VQFL 4XTCS 1HXYD 1XMOL 2F0MA 2E2IH 4JBWA 4N9TA 4A3BB 3FP9A 2WKCA 4DKAC 3NTIA 1XNRQ 2F0KA 1PH7A 1OXSC 4FXKC 3V05A 1I4GA 4ILWA 1NR4A 4FF4A 1I6HH 3GTPB 4DR4Q 1EWIA 4AQYQ 4A3JH 1S5CD 1SAPA 2VQEL 1VMPA 1EFID 5IGEA 2Q2UA 2X69A 1CQFA 3P7JA 4DV3Q 2WAQE 1SNCA 4JI4L 2F4VQ 1B3AA 1VCIA 2AQ1B 2PNHA 3SK8A 4R4OA 4FO2A 3EFXD 1XJVA 4K5WA 2O5IC 1NSNS 4X65L 1EYGA 4F87A 3I55A 3GTMH 2JSOA 4APVA 1XMQL 2FXQA 3HOZH 4IOAA 1TWHB 4NXMQ 1HA6A 2CH4W 1I6VC 2B2TC 1IXRA 1DZ1A 1X3PA 5E4XA 1VQHA 4IJLA 3HOYG 3ERQA 2QDBA 5C3WA 1OXVA 4A3GG 1FJGL 2F0TA 4LF8Q 3MA2B 3NSWA 4L63B 4XQQA 1XYIA 4AQYL 1VQ4A 1CHPD 2KECA 4C3JG 1S5ED 1MGSA 2RSOA 4GOPB 1S5BD 5GAHC 1EQQA 2PMZB 2RCNA
chains in the Genus database with same CATH topology
2RKSA 2F0WA 5C0XJ 3NPPA 2RDGA 2EYJA 4KD3A 4KHZA 5EKIA 4Y7NB 5C5MA 2NVTB 3I8ZA 3HZXA 1WTQA 1QNKA 2O5JC 1IW7C 1PLFA 2XNAC 2HCCA 2KA7A 4XIGS 4CJ0B 5IT9E 2I46A 3FVQA 1EOTA 4LMQD 3K0YA 2B2VA 2CW0C 2CVRA 1D1KA 2J0TD 4PMCA 1KDBA 3J7AV 3Q24A 4TQUS 1STYA 2SNSA 4HMIA 1DD2A 1WTXA 2A69C 2F0EA 4WRDA 1AEXA 2QCPX 4OIJA 2IW3A 1LTBD 5CR3A 2B2UC 3G7LA 4H7BA 5C0XI 1FNUA 3VYUA 5IGGA 4IUTA 1BCPD 2NWGA 4RFBA 1TKWB 3X3MA 1GUNA 3DHQA 5D14A 1EEID 2E75C 3QWNA 3DWAA 4M1UB 1QCBD 4HSVA 5T1IA 2NVQB 4FXDA 1FGBD 2QEJC 5C3EB 1HA5A 1U4LA 3EQLC 2NTSA 4CHTB 1CA6A 1JOOA 1LT3D 3R2TA 2OEOA 1B44D 3RD4A 2PQEA 2K6AA 1IKMA 3S1NB 2F0SA 3K7AB 4B9WA 2HQEA 2SNMA 3D3RA 4KY6A 2YU9B 1BF4A 3H09A 5EPLA 1F9SA 3BVZA 2NB0A 4K8JA 3SDZA 3OHXC 4NKLA 2R3ZA 1CK1A 3GTJB 1PMRA 3FMCA 3VR5A 2EYOA 2F0HA 1V1PA 4CKBA 1Y1WB 2TMPA 1QJOA 4ABNA 5HGTA 5J1ZA 1HQMC 4KY7A 3HP3A 1HTPA 4O42A 1CT1D 1II3A 3IL8A 2A5HA 1HUNA 1CM9A 2K5QA 3Q23A 1EEFD 1LTSD 3E6ZX 2R61A 1STGA 5M5WB 2VXWA 1X3QA 3FRPB 4F7XA 3HOVB 2B63B 1RTNA 3K57A 1Q8IA 2VB2X 4FF1A 3DM1A 4CJ1B 3EVQA 1WVLA 1O7LA 4L6TB 3LNNA 1S5FD 5FO7B 3IKJA 1SMYC 5CV6A 1TY2A 2B2YC 2IX0A 3L9AX 4MIUA 3M7NA 3MXNA 4KKTA 1BQQT 2L1BA 2WAQB 1EYAA 3H91A 2MHVA 5CYUA 2RBMA 4K8IA 1Z47A 1MSHA 3KLSX 4IUNA 1TQOA 4K6LA 2JEBI 2WV6D 4C3HB 4KMUC 2RQXA 1FNVA 1BCPC 1PTOB 2LMCB 1Z6HA 5I6YA 4CGYB 4A3IB 3K5NA 4FNFA 1TS5A 1W6KA 2AWOA 1U4PA 3E5SA 4ME5A 1O80A 1FR3A 1ET9A 1SYBA 4HEDA 2XVSA 3CRKC 2DN8A 2EJGC 3J7YW 4FP5D 2IT1A 5C4JB 1I3QB 2NBFA 1HQRD 3QIAA 4NMZA 2BDNA 2WB1B 3DEOA 1B4OA 3MEHA 1S4ZA 1QWYA 3GV3A 1PZJD 1PTOC 4EGVA 5DM63 4K2KA 5I2YA 1NCVA 4G4KA 5K36H 4ZRZA 3DXJC 4XQNA 3VR2A 3NUCA 4EQNA 3M7GA 2E2JB 1YNJD 4KKSA 1ZKOA 2CW0D 1DXMA 1PTOF 2R92B 3J80E 1PFNA 1VF5C 5A35A 1SYDA 2L9HA 2EYPA 3L3OC 2NVXB 4U673 4R8IA 2G9HD 1JICA 3R93A 5D3IB 4DAVA 4C3IG 4C56C 2L12A 4RKLA 5HURA 2EYMA 4OL7A 2Z4IA 2PNRC 2PYKA 4LJZC 4EVOA 2MUYA 3GTMB 2K01A 5KIXA 2B8GA 5IGBA 1IL8A 2K1BA 2RVLA 2A6ED 3J81E 3C46A 1EIGA 1RTOA 3QJYA 1BR9A 1EYDA 4E6IA 3GTOB 3N52A 1STHA 5FLXE 2R93B 1G91A 1KDAA 4ZUJA 3PUYA 3BVMA 2PZTA 1OO9B 4A3FB 1WTVA 1H9KA 5BN4A 1D5XC 4OGQC 3WOFA 3HS0C 1Q12A 3AMUA 2R7ZB 1PFBA 3N6RA 3QO2A 1HUMA 2EDGA 4KY5A 1HFGA 1STNA 3D6WA 1WTPA 5EJWA 4RHRA 2EJFC 4KJNA 1SE2A 1K83B 1E0BA 1B53A 2PW5A 3CU7A 4AYBB 1EU3A 1F2ZA 5I6WA 4U68A 4J1MA 3KUPA 5JVH3 1B9MA 1G2SA 1TWAB 3BG3A 1MSGA 1LTRD 2V4DA 3RLFA 3A7LA 2EYFA 5JAVA 3NP8A 1XWEA 3I72A 5COYA 1ENCA 4DXFA 1D2BA 4XYQA 2L5TA 4LAAA 2B2YA 3PUVA 2OF1A 1C8CA 3I91A 3C2PA 4C3JB 5LL6S 1CTMA 5D3DA 3KBGA 2NN6H 5M3MB 2Q8IB 5C6AA 4QCLA 4BA2I 2F0PA 2BA0A 1F2LA 5KYIA 3S17B 2M00A 3D8GA 2KCNA 1EY0A 3GTQB 1AW7A 3K6OA 2L55A 4LK1C 1PDQA 3CQZB 1SNPA 3NBIA 4G7OC 2KEEA 2AUJD 1U4MA 3VA7A 3DWQA 3S1MB 1OXTA 5JEAJ 4KI0A 1ENAA 2KUMA 1KABA 5A2QL 5CORA 3ZYYX 3O13A 1B2TA 3TZDA 1WTRA 4IALA 4QF4A 4KN4C 2NN6I 2EE1A 2D5DA 4QB4A 1AN8A 5JOBA 2AQ2B 5IGCA 5EBDA 3A8JE 5D65A 2EYHA 2PW7A 2L4NA 4YIJA 1SSOA 1KLUD 4XT3B 2XWJB 1Q1BA 3TSSA 5CMDA 1ET6A 2F0IA 4RAUC 3NQTA 1GXDC 4TSSA 5EGTA 3OMCA 3S1QB 4S3SA 2JYOA 1NAPA 1Z7TA 2RA4A 4HCSA 1BUVT 1LABA 3DMUA 3GP7A 2R6GA 4HN7A 4OHJA 4RH6A 3MZ5A 2ID0A 3MVVA 1DOMA 2X6GA 1BOSA 5JVG3 1H9RA 1I4PA 4A3EB 1QG7A 2EZVA 1IKLA 5EPKA 3A7AB 2KOLA 4QMGA 3FEWX 2BOSA 1PYWD 3NHHA 2D9UA 3FKIB 1IYVA 3NQIA 1LLRD 5BN5A 3OMGA 5LL6X 4NDXA 5I2XA 1RODA 3GTGB 1WD1A 3DEPA 3QOLA 1TS3A 1M4VA 4KD4A 2PCFB 4ZKBB 1TIID 2JEAI 2H1EA 3AB9A 3TP8A 3PV0A 4P2CB 5DNFA 3VYTA 5CC4A 4H0LC 2C9OA 1H9JA 2M9VA 1CQVA 1MD2D 4Z9CB 5CV9A 1E2VA 2IX3A 2E76C 3SK4A 1H9SA 1F2YA 1DCZA 2EY2A 5I9PA 3R2IA 3M4OB 2K7VA 2LS01 1TS2A 4HAEA 4QIWB 3KBXA 2RDFA 3K58A 2JA5B 2AWNA 1STEA 4F88A 2NZ1D 1CZGA 5K5PA 4DK1A 5F2DA 4ZLTF 1A2TA 3JAML 1AZQA 4R8NA 1LTAD 3PUWA 2PPBC 3NWSA 3AU7A 3KLSA 3CRLC 2HCIA 4ZK9B 4KTAA 2KVMA 1JWMD 5CV5A 2A6HC 3VA5A 1RKNA 1SNOA 2F0FA 1GUSA 2C5CA 4ODGA 1NR2A 4A3GB 4MHEA 2SDFA 1SEBD 1YNND 1R4PB 1D5ZC 3RMHA 2E2DC 5I4DA 4RHSA 3K5LA 1VMCA 1PZKD 3A8IE 3MWYW 3OIQA 3ONAB 3OW7A 2B2UA 3OOCA 2G9DA 2MJ8A 3R3OA 1PTOH 2K04A 3K5OA 1ILQA 1OXXK 3OWEB 4WJWA 2B2VC 1HRJA 5FK9C 2FFKB 5DAUA 1STBA 2XWBB 3KK7A 1G291 4M8AA 3U9OA 4Q0FA 4K14A 3H6MA 2VNUD 3H3VC 1JB3A 3TDQA 2F0LA 4HSPA 1TT2A 4QUFA 1TVXA 1AZPA 1FD7D 1I4XA 2XIWA 4DXGA 3P75A 5FOBB 1FNWA 3MFYA 4IFDH 3G6JB 1VF7A 4X3KA 2D2CC 3D4WA 1EYCA 1LTGD 2Q8TA 5DM73 4DF7A 2F0VA 1BDOA 4CBVA 4XXEA 1KNAA 1JR0D 4G7HC 3QOJA 3P1HA 2VUMB 1XXGA 3QB3A 1HPCA 3GTLB 2K5DA 3T53B 1KAAA 1PRTB 4IZ8A 1O7YA 4WORA 2PO4A 2Q8RE 1G6ZA 1RHPA 5JJZA 1I50B 5C0XG 2A68D 1UNSA 1QB5D 3PO3B 1A2UA 1F77A 2F0OA 2EYLA 1GJXA 4DNRB 3I4NB 1EWHA 3LWUA 1J9OA 2AUKA 3P20A 1EL0A 4BWGB 1F2MA 1MI2A 3MHBA 4PQXA 2MPMA 3WDNA 2F0JA 1TY0A 1ONLA 4DNTB 4C1NK 5C44B 2QF7A 3JAME 5JPNC 4J8QA 1XX8A 5IGDA 1EQVA 1HFNA 1CA5A 3I73A 5KEEA 5BN3A 4IURA 4DAPA 3S15B 5JPMC 1ESFA 5LHY1 3I70A 2D62A 2BE5C 1SJHD 2EXZA 3K59A 5ELFA 5C4XB 2A6HD 1LTID 5KYLA 4RKBA 1SYFA 3C3LA 2HDLA 2ZXRA 5EQ0A 5EKKA 2EY5A 3HGBA 1GUWA 2KEDA 3NWTA 4WFN3 4RA8A 1WTWA 4RCNA 5E3FA 1A3VA 3BZDB 2K32A 5ELCA 5KNBA 2RDHA 1H9MA 1EY9A 1WTOA 2HDMA 3I90A 4OO1G 2MP1A 1JWUD 3Q6SA 4PMBA 1STAA 2JP1A 2NVYB 3S2HB 2B8FA 2FINB 3L7ZC 4FVMA 1IW7D 1X32A 1EZ6A 1Q1EA 5JEAH 1ILPA 5IOCA 3MTSA 4IFDG 1TS4A 1DJRD 1C4QA 3FPPA 3NK9A 1YNJC 3NE5B 2Y0SB 3BDLA 3GD7A 5KNDA 1SJED 1AP0A 1BCPF 3GTKB 4PV1C 4K6DA 1PRTC 3GQBA 3H94A 2QILA 1BNZA 3Q0AA 5K36G 3TP5A 1DOKA 2MGSA 4BS9A 4BY7B 3URYA 4O1NA 3T4AC 1Q90A 1A15A 1SBBB 1IHZA 1ENFA 3VR3A 2SOBA 2QKIC 1ML0D 2Z1CA 4KN7C 4RCOA 3ITPA 1V8QA 4FXGC 2Z4HA 2F1MA 3EROA 5AFWA 3T13A 1HTLD 2ICIA 1NUCA 3RZOB 3PO2B 1GHJA 5FLXL 4JK1C 3HOWB 1SDFA 5A2QE 3PIO3 3DUZA 3A54A 2NUCA 1PFMA 2B39A 5EPJA 3M85A 1I6HB 3TP7A 2M2LA 3S14B 4QUCA 5CV4A 4C1NI 1C48A 1EQTA 2JE6I 4UAIA 1IYUA 1O78A 3VR4A 2CQAA 2PZWA 3IAYA 2ZXPA 5FO8B 1CI3M 1SNQA 1RDPD 1I4HA 1QILA 3HOYB 1R9TB 4IQZA 2EPBA 1U9RA 5TSSA 4K5XA 3TN2A 2F4IA 2WKDA 3J80L 1MBYA 5M9OA 1LV9A 2DY8A 3J7AF 1EY6A 3NXWA 3HEJA 2B2WC 2ZXOA 3KLRA 2LFNA 1L0YB 2A74C 2ZT9C 2X6LA 2EY1A 3SVMA 4DFAA 2ICEC 4DN4M 4G7ZC 1BCPB 2Z8LA 1A3TA 4K5VA 4IFDJ 3SK6A 1Q3LA 4C2MB 1SYCA 3Q22A 4A3KB 1U4RA 3TMEA 1UEAB 4I7ZC 1I4QA 1LT4D 1QOHA 5KGUA 3CKIB 5KNCA 3MC0B 1A3UA 4NP5A 1ZEQX 1ICWA 4ID6A 1LACA 2RSNA 1D5MC 3OWFA 1D6EC 2KHSA 3TP6A 5G3LF 5FKAC 4ZUIA 2F0GA 2IX1A 5EBCA 3J81L 1EWCA 1BBXC 5ELEA 4H44C 4F8MA 2EVBA 3SE0A 2K03A 4HMJA 1EU4A 2FJ2A 3SK5A 4X3UA 4A3MB 4N9PA 2E2HB 2E74C 4ZAIA 3D6CA 1A6XA 4HR7B 3W2DA 2ENBA 2WACA 3MAQA 2F0DA 4UDUC 1I4RA 2IL8A 3OSOA 3FPUB 3SHLA 5G3LD 4CJ2C 2DNEA 3S16B 3V2TA 4L8JA 1F9QA 4B08A 2KJXA 3DWPA 4IUPA 3H0GB 5E1FA 4DAYA 5T1GA 1F9RA 3UI2A 4EQOA 3W3AA 1M8AA 1YNNC 2J4XA 3I4MB 5E4WC 5C3XA 1JWSD 4XYOA 4FYDA 1SE4A 5M5YB 2A68C 2A69D 5KRUA 1VDZA 1EY4A 2F0UA 3M3YB 1TWGB 5CBEE 4BA1I 3NTHA 2F3WA 3IFTA 1KNEA 3EJIA 3RUZA 3VYSA 1PXUA 1RCVD 2N55A 5NUCA 1S5DD 1SFOB 4NW2A 2O4XA 1TR5A 4RGMA 4KJOA 1UAPA 4FF2A 1QNUA 5ISRA 1LO5D 5ELBA 5J39A 4CKCA 4EQPA 1T5EA 2FMCA 2FMMA 4IN3A 3BS1A 3WOEA 2IJ0A 3OIPA 1EZ8A 1PTOD 3LWEA 4HTHA 4IUQA 3T56B 3E0JA 1UUPA 3S1RB 1HHVA 2KQ3A 2B2WA 1SNDA 4DGZA 4BY1B 2F3VA 1K8OA 2LKVA 1WCMB 4KV6A 1DONA 1CHQD 1GUOA 4OO1H 1H9SB 4KK7A 1LT6D 3PUZA 3PIP3 3RZDB 4BBSB 4C3HG 4Q5VA 4ZQ3A 3D31A 1ZYRD 3ND9A 4DU9A 2JA6B 4IUUA 3F2UA 3FDTA 3NTKA 4K2LA 3R8BA 3BYYB 2PZUA 4BBRB 2XSCA 1PRTD 1RF2D 1SYEA 1AFPA 1SNMA 3S9WA 1HCZA 3BYTB 1Y69U 4H13C 4DK0A 2AQ3B 2L11A 3LX0A 4V190 4OO1I 4PNYA 1ZXTA 5IODA 3K5MA 3D4DA 2K28A 5C0XH 3U9SA 5EKLA 1V43A 5C5LA 5M5XB 5IGFA 4ULLA 2NYZD 1F9PA 1E2WA 1W6JA 2YYZA 1SMYD 1XTCD 1V1PB 4J6HA 4G57A 1D1IA 1Y8OB 2XN9C 3GO5A 1BO0A 3MXUA 4IFDI 2E2IB 4CKEA 1CFMA 1LT5D 5ELDA 1SE3A 1Y8NB 4OIKA 1CZWA 2BA1A 1DOLA 3HOUB 2CHBD 3ND8A 4ZYSA 3VR6A 1QE6A 4C3IB 2DNCA 3TZUA 2J7ZA 4MN3A 2SEBD 4TKOB 1GHKA 2VB3X 2F0QA 1JORA 3A8KE 2NN6G 5CBAE 4V0BA 2O2LD 3MXPA 3NBHA 1PRTF 3A55A 2L0CA 2BCOA 4KHVA 2XRQD 1FYCA 3EA6A 3BVGA 3KF8A 3CHBD 3QG1A 2JA8B 4XT1B 1Y8PB 3SEBA 2OXPA 3A56A 5FO9B 1J8IA 3BDCA 1R4QB 2A6EC 2OT2A 3T16A 1JCKB 1OXUA 3T51B 1DYQA 1JE4A 2EJMA 5C4ZA 2F0NA 2I07B 1TWCB 1WD0A 1SXTA 4RWSC 1B50A 2F03A 1TWFB 2K05A 2K5WA 2EY6A 1GUGA 4A93B 4PMWA 5IT9L 4IUVA 2IWHA 2GA4B 5I9OA 5J22A 4RGTA 1BXTA 1G8ZD 4GZYC 1KLGD 3HOXB 4X3SA 3PUXA 1E2ZA 4R9WA 4A3DB 1JOKA 3HG9A 5CV8A 3HOZB 3TBIB 3IFDA 2K33A 2KCCA 1B1ZA 1EY5A 3BDOA 4I65A 3MXGA 2WP8J 1DM0B 2EOTA 3D4RA 2JA7B 4ZKCB 4A3JB 2HUGA 4XDXA 2WINB 1O7ZA 2FHTA 4RGOS 1RD9D 2A73B 3SR1A 3MFGA 1ZYRC 2IPKD 4DA2A 2NTTA 3V96A 1G2TA 1V1OA 1GUTA 1T5XD 1TU2B 2DY7A 4TRDA 2H4OA 3C1FA 1KDCA 5DEHA 3HKZB 1PZID 5M3FB 1JC7A 1RJTA 1GOZA 1EY7A 2LY7A 1JOQA 2TSSA 3C1EA 3S2DB 1KTKA 4HCEA 1EY8A 4FF3A 4B9XA 3I4LA 4RGNA 1K8MA 5IIFA 1L0XB 2XRSD 1JQYD 3I3CA 3M4YA 5CV7A 2BE5D 5JEAG 2JXMB 3X3NA 1LTTD 1Y1VB 3VYRA 3HRZC 3SXHA 1B9NA 2WIIB 5C4HA 4X3TA 1EIHA 3OPOA 3PMFA 3GV6A 2BDOA 2B2TA 4XQJA 4KKUA 5CGKA 1ESRA 1SYGA 2N88A 4XTCS 1HXYD 2F0MA 4JBWA 4N9TA 4A3BB 2WKCA 3NTIA 2F0KA 1OXSC 4FXKC 3V05A 1I4GA 4ILWA 1NR4A 4FF4A 3GTPB 1S5CD 1SAPA 1VMPA 1EFID 5IGEA 2X69A 1CQFA 3P7JA 1SNCA 1B3AA 1VCIA 2AQ1B 3SK8A 4FO2A 3EFXD 4K5WA 2O5IC 1NSNS 4F87A 2JSOA 1TWHB 1HA6A 1I6VC 2B2TC 1DZ1A 1X3PA 5E4XA 3ERQA 2QDBA 5C3WA 1OXVA 2F0TA 3MA2B 3NSWA 4L63B 4XQQA 1XYIA 1CHPD 2KECA 4C3JG 1S5ED 1MGSA 2RSOA 1S5BD 2PMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A35 A;  5JEA G;  1SMY C;  2EVB A;  3I72 A;  3SE0 A;  1CI3 M;  2JXM B;  3WDN A;  3L7Z C;  2L5T A;  1IW7 D;  1ONL A;  5C0X H;  1G29 1;  1B9N A;  4KHZ A;  3PUV A;  1Q1E A;  3U9S A;  1T5E A;  3M7N A;  4KKT A;  1Z7T A;  3OPO A;  4DNT B;  5JEA H;  1GUG A;  1V43 A;  2E74 C;  1LAB A;  4IQZ A;  1A6X A;  2R6G A;  4IFD G;  2QF7 A;  4HR7 B;  2O5J C;  1E2W A;  1IW7 C;  2PNR C;  2YYZ A;  2BDO A;  3SDZ A;  2KA7 A;  3FPP A;  4LJZ C;  4GZY C;  1CTM A;  4XIG S;  4DK1 A;  3MFY A;  2JEB I;  3T56 B;  4KKU A;  4IFD H;  3PUX A;  1PMR A;  1E2Z A;  2NN6 H;  3FMC A;  4KMU C;  2Q8I B;  1YNJ C;  3I73 A;  1Y8O B;  3VR5 A;  4BA2 I;  3NE5 B;  4XTC S;  5BN3 A;  1VF7 A;  3GD7 A;  1H9R A;  2B8G A;  2BA0 A;  3PUW A;  5KND A;  2D2C C;  3KLR A;  2PPB C;  3MXU A;  2K33 A;  2ZT9 C;  2DNE A;  2CW0 C;  2A6E D;  4H44 C;  2D62 A;  2LMC B;  4JBW A;  4PV1 C;  2KCC A;  1Z6H A;  3GQB A;  3H94 A;  3BDO A;  1CFM A;  3CRL C;  3QJY A;  4L8J A;  2BE5 C;  1OXS C;  4G7Z C;  1K8O A;  1QJO A;  1Y8N B;  3A7A B;  5K36 G;  2A6H C;  3D4R A;  4TQU S;  1BDO A;  2BA1 A;  4LK1 C;  1HQM C;  3ND8 A;  2AWO A;  1DD2 A;  3VR6 A;  2A69 C;  1GUO A;  2DNC A;  4OO1 H;  3PUY A;  1HTP A;  1FR3 A;  1Q90 A;  1GUS A;  2A6H D;  3CRK C;  2DN8 A;  2EJG C;  3TZU A;  4G7H C;  4G7O C;  1IYV A;  1H9S B;  2AUJ D;  3VR3 A;  5BN5 A;  3VA7 A;  1HPC A;  3W3A A;  2IT1 A;  3PUZ A;  3T53 B;  4TKO B;  1VCI A;  1GHK A;  1ZYR C;  1H9K A;  1YNN C;  4I7Z C;  4KN7 C;  5BN4 A;  1OXT A;  3A8K E;  1V8Q A;  2PCF B;  2NN6 G;  1TKW B;  3HGB A;  4KI0 A;  1GUN A;  4OGQ C;  2O5I C;  5KNC A;  3D31 A;  2F1M A;  3QIA A;  1Q12 A;  2JEA I;  3ND9 A;  2A68 C;  2A69 D;  3AB9 A;  1VDZ A;  2E75 C;  1GUT A;  1TU2 B;  3N6R A;  4RCN A;  3PV0 A;  3A8I E;  5C0X G;  1I6V C;  2A68 D;  2EDG A;  1FYC A;  1GHJ A;  4BA1 I;  4H0L C;  4JK1 C;  1LAC A;  2K32 A;  5K36 H;  3IFT A;  5KNB A;  1H9M A;  3DXJ C;  3QG1 A;  1H9J A;  1Y8P B;  4KN4 C;  2EJF C;  2NN6 I;  3VR2 A;  2D5D A;  3OW7 A;  4DNR B;  1OXV A;  3M85 A;  4OO1 G;  1GJX A;  3OOC A;  1E2V A;  1EWH A;  2E76 C;  4KKS A;  1ZKO A;  3LWU A;  3A8J E;  2AUK A;  1HCZ A;  3EQL C;  2JE6 I;  1DXM A;  1IYU A;  1H9S A;  3P20 A;  1B9M A;  1Y69 U;  2A6E C;  3I4L A;  1DCZ A;  1OXU A;  3T51 B;  1O78 A;  1Q1B A;  2K7V A;  1K8M A;  3BG3 A;  4H13 C;  3VR4 A;  2EJM A;  4DK0 A;  2V4D A;  1O7L A;  3M4Y A;  3RLF A;  3A7L A;  1OXX K;  2B8F A;  3LNN A;  2BE5 D;  1VF5 C;  3IKJ A; 
#chains in the Genus database with same CATH topology
 3STB D;  2RKS A;  1VQB A;  2WAQ G;  2F0W A;  5C0X J;  3NPP A;  1A62 A;  2RDG A;  2EYJ A;  4KD3 A;  4DR6 L;  4KHZ A;  5EKI A;  4Y7N B;  5C5M A;  2NVT B;  2R93 G;  3I8Z A;  3HZX A;  1WTQ A;  1QNK A;  2O5J C;  1IW7 C;  1PLF A;  1Q81 C;  2XNA C;  4UPA A;  2HCC A;  2KA7 A;  4I7A A;  4XIG S;  2KEN A;  4CJ0 B;  5IT9 E;  2I46 A;  4DAY B;  2QGQ A;  1FJG Q;  1YNX A;  1OTC A;  4DUY L;  3FVQ A;  4N8F A;  1QUQ A;  1EOT A;  2JN4 A;  4BXX H;  4LMQ D;  3K0Y A;  1J5E L;  2B2V A;  2CW0 C;  4B3S L;  2CVR A;  1D1K A;  2J0T D;  4A4I A;  4PMC A;  1KDB A;  3J7A V;  2JA8 H;  3Q24 A;  4DK6 C;  4TQU S;  4IO9 A;  1STY A;  2SNS A;  4HMI A;  1DD2 A;  1WTX A;  2A69 C;  2F0E A;  4WRD A;  1AEX A;  2QCP X;  1VQC A;  4IPH A;  1AE2 A;  2IW3 A;  1LTB D;  4OIJ A;  5CR3 A;  5LMU Q;  2B2U C;  3G7L A;  4H7B A;  5C0X I;  1FNU A;  1XNQ Q;  3VYU A;  1K83 H;  5IGG A;  4IUT A;  1BCP D;  2NWG A;  4RFB A;  1TKW B;  3X3M A;  1GUN A;  3CC4 A;  3DHQ A;  3F2B A;  5D14 A;  1EEI D;  2E75 C;  5FJ8 G;  2ALY B;  3QWN A;  1K8A C;  4B3R Q;  3FKI H;  2JK8 A;  1SMX A;  3DWA A;  4M1U B;  1QCB D;  4HSV A;  5T1I A;  2MFI A;  2NVQ B;  4FXD A;  1VQP A;  1KQS A;  3CCQ A;  3CCE A;  1FGB D;  5FLM G;  2QEJ C;  4IPD A;  5C3E B;  1HA5 A;  1U4L A;  3EQL C;  2NTS A;  3A5U A;  4CHT B;  1CA6 A;  1JOO A;  4MTK A;  3L0O A;  4JI7 Q;  1ICF B;  1LT3 D;  3R2T A;  2OEO A;  1XNQ L;  1B44 D;  3RD4 A;  2PQE A;  1C9O A;  2K6A A;  1IKM A;  3S1N B;  3PO3 G;  3CPF A;  2NZH A;  2F0S A;  3K7A B;  4JYA Q;  4HJ9 A;  1N36 L;  4B9W A;  2HQE A;  4MTN A;  4DPG A;  1WYD A;  5JJI A;  2SNM A;  3D3R A;  3H0G G;  4JI1 Q;  3HKS A;  4KY6 A;  1V9P A;  2YU9 B;  1SRO A;  1BF4 A;  5IP9 H;  4JI0 L;  3H09 A;  5EPL A;  1F9S A;  3BVZ A;  4OWT B;  4YWK A;  3AFQ A;  2NB0 A;  4K8J A;  3SDZ A;  3J7A 5;  3OHX C;  4NKL A;  4JOI A;  3S2D H;  2R3Z A;  5IY0 A;  1PH6 A;  1CK1 A;  2OCE A;  5GQO A;  3GTJ B;  1PMR A;  3FMC A;  3VR5 A;  2EYO A;  2F0H A;  1TWH H;  4JBK A;  4DV4 L;  4DR2 L;  1V1P A;  4CKB A;  1Y1W B;  5HGQ A;  2TMP A;  1QJO A;  2V1C C;  4ABN A;  5HGT A;  5J1Z A;  4DV5 L;  3EIV A;  1HQM C;  1W2B A;  4KY7 A;  1SR3 A;  2G5D A;  2GVB A;  3HP3 A;  1HTP A;  5IYD H;  3BZC A;  4O42 A;  3HOV G;  1CT1 D;  1II3 A;  3IL8 A;  5C44 H;  2Q2T A;  2A5H A;  1HUN A;  4NXN Q;  4LFB L;  1CM9 A;  2K5Q A;  3Q23 A;  2CH4 A;  1EEF D;  1K3R A;  4ZCK A;  1LTS D;  1E22 A;  3E6Z X;  4J15 A;  2R61 A;  1S72 A;  1STG A;  5M5W B;  2VXW A;  3OTO L;  2YU9 H;  4DUZ L;  1KRS A;  1X3Q A;  2JA5 G;  3FRP B;  4FDB A;  4F7X A;  2C35 B;  2UUC L;  3ULP A;  3HOV B;  1L1O B;  2I0Q A;  3HOW G;  2B63 B;  1RTN A;  1VQA A;  4DV7 L;  3K57 A;  1Q8I A;  2VB2 X;  4FF1 A;  3DM1 A;  4CJ1 B;  2BH8 A;  3EVQ A;  3S15 H;  1GD7 A;  1WVL A;  4DV1 L;  1O7L A;  4H02 A;  5E7N A;  4L6T B;  3LNN A;  1S5F D;  5FO7 B;  3J81 i;  4LFB Q;  3IKJ A;  1Z9F A;  1SMY C;  5CV6 A;  2UUB L;  3E0E A;  4B3T L;  3HKZ G;  2VY3 A;  3OYY A;  1TY2 A;  2B2Y C;  2IX0 A;  3L9A X;  3H15 A;  4MIU A;  3M7N A;  3MXN A;  4KKT A;  1BQQ T;  2L1B A;  2MNA A;  2WAQ B;  1EYA A;  3H91 A;  2MHV A;  1WCM H;  4DUZ Q;  2VL6 A;  2RBM A;  4K8I A;  5CYU A;  2ZM6 Q;  4YCW A;  1Z47 A;  1MSH A;  3KLS X;  4IUN A;  1TQO A;  4K6L A;  2JEB I;  2UXB L;  2WV6 D;  3E3X A;  1MIU A;  4C3H B;  2ASB A;  1RIP A;  4KMU C;  3B6Y A;  3S1R H;  4LF4 L;  4YHH L;  2RQX A;  2B3G A;  1PH2 A;  1FNV A;  1BCP C;  1PTO B;  2UU9 Q;  2LMC B;  1E1O A;  1Z6H A;  4EQ5 A;  5I6Y A;  4HIK A;  4CGY B;  4A3I B;  2JA6 G;  3K5N A;  4ALP A;  2D0O A;  4FNF A;  4DK3 C;  1TS5 A;  1W6K A;  3JAM c;  2AWO A;  1U4P A;  3E5S A;  4ME5 A;  1O80 A;  1FR3 A;  1ET9 A;  1SYB A;  4HED A;  2XVS A;  4C3H H;  3CRK C;  3J80 c;  2DN8 A;  2EJG C;  3CCR A;  2B63 H;  2K4K A;  1UWV A;  3J7Y W;  4FP5 D;  2IT1 A;  2K50 A;  3RN2 A;  4GNX B;  4CDC C;  5C4J B;  2R92 G;  1I3Q B;  2NBF A;  1HQR D;  3QIA A;  2EXD A;  4NMZ A;  2BDN A;  2WB1 B;  3DEO A;  1B4O A;  3MEH A;  1S4Z A;  1QWY A;  3GV3 A;  1PZJ D;  1PTO C;  2Z6K C;  4EGV A;  4A3C G;  5DM6 3;  4DR5 L;  4K2K A;  3W1G A;  5I2Y A;  1NCV A;  4G4K A;  1I5F A;  5K36 H;  4ZRZ A;  3DXJ C;  4XQN A;  3VR2 A;  3NUC A;  4EQN A;  3M7G A;  2R93 H;  1HZA A;  2E2J B;  1YNJ D;  4KKS A;  1ZKO A;  2CW0 D;  1DXM A;  4JBM A;  2UXD Q;  3G6E A;  1PTO F;  2R92 B;  3J80 E;  2R92 H;  3I4M H;  4GKK L;  3M4P A;  1PFN A;  4WJ4 A;  3PO2 G;  1VF5 C;  3I2Z A;  5A35 A;  1SYD A;  2L9H A;  2EYP A;  4QL5 A;  3L3O C;  2NVX B;  4U67 3;  4R8I A;  2MO0 A;  2G9H D;  1HH2 P;  1X6O A;  1JIC A;  3RR5 A;  3R93 A;  4A3M H;  4B3M Q;  5D3I B;  1X3G A;  4DAV A;  4C3I G;  4C56 C;  1GM5 A;  4JV5 Q;  4DR7 L;  2L12 A;  4RKL A;  5HUR A;  3UDG A;  2EYM A;  4OL7 A;  2Z4I A;  2PNR C;  2PYK A;  4OWW B;  4LJZ C;  3CD6 A;  4EVO A;  3FHW A;  2MUY A;  4JPB W;  4A3E G;  1IYJ B;  3GTM B;  2VUM G;  2K01 A;  5KIX A;  4LF8 L;  3AFP A;  1NNX A;  2B8G A;  5IGB A;  1IL8 A;  2K1B A;  2RVL A;  2A6E D;  3J81 E;  3C46 A;  1WJJ A;  1EIG A;  1RTO A;  3QJY A;  1AH9 A;  1BR9 A;  1EYD A;  1A8V A;  4E6I A;  3GTO B;  5IWA L;  3N52 A;  1STH A;  3UDI A;  5FLX E;  3J81 j;  2R93 B;  1G91 A;  1KDA A;  4ZUJ A;  1KRT A;  3TS2 A;  3PUY A;  3GTJ H;  2KCM A;  3KF6 A;  1HNZ L;  3BVM A;  1K28 A;  2PZT A;  4GLA C;  1OO9 B;  4A3F B;  1WTV A;  1H9K A;  4C3J H;  5BN4 A;  5IYD G;  2YTX A;  1D5X C;  1HJP A;  2PI2 A;  1SFO H;  4OGQ C;  3WOF A;  3HS0 C;  1Q12 A;  2HHH L;  1V1Q A;  3AMU A;  2R7Z B;  1PFB A;  3N6R A;  1N33 L;  3QO2 A;  1HUM A;  2NVY H;  2EDG A;  4KY5 A;  1HFG A;  2QW7 A;  1VS0 A;  1CUK A;  1STN A;  3D6W A;  4B3S Q;  3NEM A;  5EJW A;  1WTP A;  4RHR A;  1FVI A;  4KJN A;  2EJF C;  1JB7 A;  1SE2 A;  1K83 B;  1E0B A;  1B53 A;  1LM0 A;  2PW5 A;  3CU7 A;  4AYB B;  1EU3 A;  1F2Z A;  5I6W A;  4U68 A;  4J1M A;  4LF5 L;  3KUP A;  4O2D A;  5JVH 3;  1B9M A;  1SN8 A;  2WFW A;  2K5H A;  1G2S A;  1TWA B;  4LFC Q;  3BG3 A;  1MSG A;  1LTR D;  2V4D A;  3MEF A;  3RLF A;  4YWM A;  3A7L A;  1ASY A;  2EYF A;  3NP8 A;  5JAV A;  1XWE A;  3I72 A;  5COY A;  1ENC A;  4DXF A;  1D2B A;  4XYQ A;  2L5T A;  4LAA A;  1Q46 A;  4JI6 L;  2B2Y A;  3PUV A;  1BKB A;  2OF1 A;  1C8C A;  5C3E G;  3I91 A;  3C2P A;  4C3J B;  2DGY A;  5LL6 S;  2KBN A;  1CTM A;  4HIM A;  5D3D A;  1PH8 A;  3KBG A;  2NN6 H;  1CSQ A;  5IP7 H;  5M3M B;  2Q8I B;  4BY1 G;  5C6A A;  4QCL A;  1VQ5 A;  4BA2 I;  4JI3 Q;  2F0P A;  2BA0 A;  1F2L A;  5KYI A;  4JI7 L;  3S17 B;  2M00 A;  4OXP A;  1YI2 A;  3D8G A;  2KCN A;  1EY0 A;  3CP0 A;  3TRE A;  3GTQ B;  1AW7 A;  3K6O A;  4R4T A;  2L55 A;  4LK1 C;  1PDQ A;  4C3I H;  3PGZ A;  3CQZ B;  5C3E H;  1SNP A;  3NBI A;  4G7O C;  2KEE A;  2AUJ D;  4UHV A;  1U4M A;  3VA7 A;  2ZJP A;  3DWQ A;  2CWP A;  3I4N G;  1WFQ A;  3S1M B;  1OXT A;  5JEA J;  4KI0 A;  4GKJ Q;  4BY1 H;  1ENA A;  2KUM A;  1KAB A;  4QGU A;  1PFS A;  5A2Q L;  5COR A;  3ZYY X;  3O13 A;  3GDE A;  3BZK A;  1B2T A;  3TZD A;  2PQA A;  1WTR A;  4IAL A;  1YHB A;  4QF4 A;  4KN4 C;  2NN6 I;  4A3K G;  2EE1 A;  2D5D A;  4QB4 A;  1N32 Q;  3A5Z B;  1AN8 A;  4DV5 Q;  5JOB A;  2AQ2 B;  5IGC A;  1VQ7 A;  5EBD A;  3A8J E;  2AMC B;  5D65 A;  2EYH A;  2PW7 A;  2L4N A;  2IY5 B;  4YIJ A;  1SSO A;  1KLU D;  4XT3 B;  2XWJ B;  1Q1B A;  3TSS A;  5CMD A;  1K8G A;  4JCV E;  1ET6 A;  5GRO A;  2PI2 E;  5M5Y H;  2F0I A;  3HOZ G;  2Y0S G;  4A3I H;  4GKJ L;  4RAU C;  3NQT A;  1GXD C;  1JT8 A;  4DR3 L;  4TSS A;  5EGT A;  1ASZ A;  3RNU A;  3OMC A;  1UE5 A;  3S1Q B;  4S3S A;  2JYO A;  1NAP A;  1Z7T A;  2RA4 A;  1VQE A;  4HCS A;  1BUV T;  1LAB A;  3DMU A;  3GP7 A;  2ZJR A;  4BBR H;  2R6G A;  3CXC A;  2VUM H;  4OEL B;  2UUA L;  4HN7 A;  4A3G H;  5DLQ E;  2AKW B;  4OHJ A;  4RH6 A;  1N32 L;  3MZ5 A;  2Q2H A;  2ID0 A;  3HOX H;  4DV6 L;  3MVV A;  4QY7 A;  1DOM A;  2X6G A;  1BOS A;  5JVG 3;  4DV7 Q;  1YZ6 A;  1H9R A;  3M3Y H;  1I4P A;  4A3E B;  4X6A H;  1QG7 A;  2EZV A;  4OEM B;  1IKL A;  5EPK A;  4QJF A;  3A7A B;  3CC2 A;  2KOL A;  3PSI A;  4QMG A;  3FEW X;  2BOS A;  4OX9 Q;  3HOU H;  1PYW D;  3NHH A;  1G51 A;  3RZO H;  2D9U A;  2BH2 A;  3FKI B;  3AYH B;  4GNX A;  3NQI A;  3CMA A;  1IYV A;  1LLR D;  3U4Z A;  3NBH B;  5BN5 A;  3OMG A;  5LL6 X;  4NDX A;  5I2X A;  1ROD A;  3GTG B;  1WD1 A;  3DEP A;  3QOL A;  2UUA Q;  2GVA A;  2HT1 A;  1TS3 A;  2YV5 A;  3S2H H;  1M4V A;  4KD4 A;  2PCF B;  4A3C H;  4ZKB B;  4HJ5 A;  1KAW A;  1TII D;  2UXB Q;  4DV6 Q;  2JEA I;  4UY8 C;  2NVX H;  2H1E A;  3AB9 A;  1QZG A;  3TP8 A;  5M5W H;  3PV0 A;  4P2C B;  5DNF A;  1VQO A;  3VYT A;  5CC4 A;  5IYC H;  4H0L C;  1P8L A;  2UU9 L;  2C9O A;  1KD1 C;  3I4O A;  1H9J A;  2M9V A;  3K7A H;  1CQV A;  4DR1 L;  1MD2 D;  4IJH A;  4Z9C B;  5CV9 A;  2F3I A;  3FKI G;  1E2V A;  2E2J H;  2IX3 A;  2E76 C;  2XGT A;  3ERS X;  2MO1 A;  3SK4 A;  1H9S A;  1EIF A;  1F2Y A;  1XMO Q;  1DCZ A;  2EY2 A;  5I9P A;  3R2I A;  3M4O B;  2K7V A;  2LS0 1;  1TS2 A;  4OWX B;  4HAE A;  4A3B H;  4QIW B;  3LGJ A;  3KBX A;  2RDF A;  3K58 A;  2JA5 B;  3A74 A;  4HID A;  2AWN A;  1XMQ Q;  3RN5 A;  1STE A;  2ZJQ A;  4F88 A;  3G71 A;  3KFU A;  2NZ1 D;  5HY6 A;  1WOC A;  2E5L L;  1CZG A;  5K5P A;  1YBY A;  2PMZ E;  4P73 A;  2P5Z X;  1KL9 A;  1A0I A;  1X65 A;  4X65 Q;  4DK1 A;  5F2D A;  3UE1 A;  4CDD C;  4ZLT F;  1A2T A;  3JAM L;  1CKM A;  1EQR A;  1AZQ A;  4R8N A;  4DV0 L;  1Y1V H;  4NXM L;  1NBW A;  1LTA D;  3PUW A;  1IBK L;  3RZD H;  2PPB C;  3M4Q A;  3NWS A;  3HOX G;  1VQN A;  3AU7 A;  2JQO A;  1XPR A;  4UP9 A;  3KLS A;  4DV2 Q;  3CRL C;  2HCI A;  4ZK9 B;  4KTA A;  2KVM A;  1JWM D;  2HIV A;  5CV5 A;  2A6H C;  1Y14 B;  3VA5 A;  1RKN A;  1SNO A;  2F0F A;  3GTP H;  1NY4 A;  1GUS A;  2C5C A;  1VQ9 A;  4ODG A;  3I56 A;  3H3V I;  1NR2 A;  4OON A;  4A3G B;  4MHE A;  2SDF A;  1SEB D;  1YNN D;  1R4P B;  3UDF A;  3TRZ A;  1D5Z C;  4RMF A;  3RMH A;  2E2D C;  4DR6 Q;  1YIT A;  4PG3 A;  5I4D A;  5M3F G;  4RHS A;  3K5L A;  1VMC A;  1PZK D;  3A8I E;  2Y0S E;  3GTK H;  3MWY W;  1WI5 A;  3PIO A;  1IBL L;  1M90 C;  4R4I A;  3K81 C;  3OIQ A;  1EUJ A;  3ONA B;  3OW7 A;  2B2U A;  4A3F G;  3OOC A;  2JA7 H;  3HOV H;  2G9D A;  2MQH A;  4L5S A;  4JVZ A;  1J5E Q;  2MJ8 A;  3R3O A;  1IZ6 A;  1PTO H;  1CKN A;  2K04 A;  4GLV B;  3K5O A;  1ILQ A;  1OXX K;  3OWE B;  1K3B C;  1UEB A;  4WJW A;  2B2V C;  1HRJ A;  5FK9 C;  2FFK B;  5DAU A;  4BBR G;  2EQS A;  1LUZ A;  1STB A;  2XWB B;  3KK7 A;  2QEX A;  1G29 1;  4M8A A;  3U9O A;  4Q0F A;  4K14 A;  3H6M A;  2VNU D;  4Y7N H;  3H3V C;  2HQL A;  1JB3 A;  3TDQ A;  2F0L A;  4HSP A;  1TT2 A;  2CCZ A;  1PV4 A;  3T1H Q;  4QUF A;  1TVX A;  1AZP A;  1NMF A;  1FD7 D;  1I4X A;  2XIW A;  4DXG A;  2IHE A;  3P75 A;  5FOB B;  1FNW A;  3MFY A;  2RHQ B;  3G6J B;  4IFD H;  1X9N A;  1VF7 A;  4X3K A;  2D2C C;  3I4M G;  3D4W A;  1EYC A;  3QR8 A;  4POG A;  1FL0 A;  1LTG D;  2Q8T A;  5DM7 3;  4A93 G;  4DF7 A;  2F0V A;  1BDO A;  1N36 Q;  4LFA L;  3TQY A;  4CBV A;  4XXE A;  2A1A A;  5FLM H;  1KNA A;  1JR0 D;  1MJC A;  5IYB H;  4G7H C;  3QOJ A;  1HNX L;  3P1H A;  2VUM B;  1XXG A;  3QB3 A;  1B70 B;  1HPC A;  5M3M G;  1N34 Q;  3GTL B;  2K5D A;  3T53 B;  5EAY A;  4R4Q A;  2B63 G;  1KAA A;  1PRT B;  1YJW A;  4IZ8 A;  1X56 A;  1O7Y A;  4WOR A;  2PO4 A;  2Q8R E;  1G6Z A;  1RHP A;  4JI1 L;  2Z6K A;  4JW0 A;  5JJZ A;  1I50 B;  5C0X G;  1K0R A;  1UE1 A;  1QB5 D;  1UNS A;  2A68 D;  3PO3 B;  4DV4 Q;  4A93 H;  3K80 C;  1A2U A;  2F0O A;  1F77 A;  2EYL A;  3CCM A;  1GJX A;  4DNR B;  4POF A;  3I4N B;  1EWH A;  3LWU A;  1J9O A;  2AUK A;  3S24 A;  4HIO A;  3P20 A;  4YCU A;  1EL0 A;  3GTL H;  4BWG B;  1F2M A;  1MI2 A;  3MHB A;  5GAD C;  4NXN L;  4QQB X;  4PQX A;  1VQD A;  1A63 A;  2MPM A;  5M3F H;  4GS3 A;  3WDN A;  2F0J A;  3PIP A;  1TY0 A;  1ONL A;  1K73 C;  3DLL A;  2QDL A;  4DNT B;  4C1N K;  5C44 B;  5AJ3 L;  2QF7 A;  3JAM E;  5JPN C;  4J8Q A;  4BBS H;  4A3F H;  1XX8 A;  5IGD A;  3KF6 B;  3I4N H;  1EQV A;  1E3P A;  1CA5 A;  1HFN A;  3I73 A;  1EIY B;  5KEE A;  5BN3 A;  2JA6 H;  4IUR A;  4DAP A;  4LF6 L;  3S15 B;  5JPM C;  1ESF A;  1I50 H;  5LHY 1;  3I70 A;  2D62 A;  4YY3 Q;  2BE5 C;  1MHW C;  5BR8 Q;  1SRU A;  1SJH D;  2UUC Q;  2EXZ A;  4UP8 A;  2LSS A;  1HNW L;  3K59 A;  5ELF A;  5C4X B;  2A6H D;  1LTI D;  2GN5 A;  4GN3 B;  2Z0S A;  5KYL A;  1S3O A;  1UE7 A;  3CPW A;  4RKB A;  1SYF A;  1MKH A;  3C3L A;  2HDL A;  2ZXR A;  5EQ0 A;  5EKK A;  2EY5 A;  3HGB A;  3ULL A;  1GUW A;  2N49 A;  2KED A;  1SLJ A;  3NWT A;  4WFN 3;  3TEH B;  4RA8 A;  4LF6 Q;  1WTW A;  4RCN A;  1CSP A;  5E3F A;  1VQG A;  1A3V A;  3BZD B;  1R9T H;  2JA7 G;  2K32 A;  5ELC A;  5KNB A;  2RDH A;  1H9M A;  1EY9 A;  3SGI A;  1WTO A;  2HDM A;  3AQQ A;  2IHF A;  1B8A A;  1HR0 L;  4ME3 A;  4CDF C;  3NEL A;  3I90 A;  4OO1 G;  4A3J G;  2MP1 A;  5C4X G;  1HNW Q;  2K5V A;  3KYH C;  1FGU A;  1JWU D;  3Q6S A;  4DR4 L;  4PMB A;  1STA A;  3E9H A;  3EBE A;  4R1J A;  1HZB A;  3K0X A;  2JP1 A;  2CFM A;  2K14 A;  2NVY B;  3S2H B;  1QVF A;  2B8F A;  2FIN B;  2LXJ A;  3K8A A;  3W5O A;  2R7Z H;  4LUV A;  4IPC A;  3Q8D A;  3L7Z C;  4FVM A;  1IW7 D;  1PH3 A;  4JI5 Q;  1X32 A;  1EZ6 A;  3S1Q H;  1TWF H;  1Q1E A;  5JEA H;  1ILP A;  5IOC A;  3MTS A;  4DV3 L;  3IRB A;  4IFD G;  1TS4 A;  2NZO A;  1DJR D;  1U5K A;  1NMG A;  3KJP A;  1X3F A;  1C4Q A;  1IL2 A;  3FPP A;  4P71 A;  3S1N H;  3NK9 A;  1X3E A;  1Y1W G;  1YNJ C;  4BBS G;  3NE5 B;  2Y0S B;  2R7D A;  3BDL A;  3GD7 A;  5KND A;  1DGS A;  1SJE D;  1AP0 A;  1BCP F;  3GTK B;  4PV1 C;  4K6D A;  1PRT C;  3GQB A;  3H94 A;  2QIL A;  1KIX A;  1BNZ A;  3Q0A A;  5K36 G;  2JA5 H;  2MGS A;  1DOK A;  3TP5 A;  4BS9 A;  4BY7 B;  3URY A;  4O1N A;  3T4A C;  4JI5 L;  1Q90 A;  1A15 A;  2UXD L;  1SBB B;  1IHZ A;  2NVT H;  1MJE A;  3T1Y Q;  3CCL A;  1ENF A;  3VR3 A;  4JV5 L;  2SOB A;  2QKI C;  3AEV A;  1ML0 D;  2Z1C A;  4KN7 C;  4RCO A;  3ITP A;  1V8Q A;  2YTV A;  4WJ3 M;  3KJO A;  4FXG C;  4A3B G;  5JJK A;  2Z4H A;  4JC0 A;  2F1M A;  3ERO A;  5AFW A;  3T13 A;  1HTL D;  2ICI A;  4DUY Q;  1TWA H;  4DV0 Q;  1NUC A;  3RZO B;  3CQZ H;  3PO2 B;  1GHJ A;  5FLX L;  4JK1 C;  3HOW B;  1SDF A;  5A2Q E;  4L5T A;  3PIO 3;  3DUZ A;  1GVP A;  3A54 A;  3UDX A;  2NUC A;  1PFM A;  3UE0 A;  2B39 A;  4L5R C;  5ELO A;  5GAG C;  5EPJ A;  1E1T A;  5LMN L;  3M85 A;  1I6H B;  3TP7 A;  2M2L A;  3S14 B;  4QUC A;  2K52 A;  5CV4 A;  4C1N I;  1C48 A;  4C2M H;  1EQT A;  2JE6 I;  4UAI A;  1IYU A;  2N3S A;  3T1Y L;  1O78 A;  3VR4 A;  2CQA A;  1XPO A;  2PZW A;  3S16 H;  3IAY A;  5IWA Q;  2ZXP A;  3EN2 A;  1CI3 M;  3F1Z A;  4AYB E;  5FO8 B;  4LF7 Q;  1SNQ A;  1RDP D;  3PCO B;  1I4H A;  1QIL A;  3HOY B;  4AH6 A;  1T9H A;  1R9T B;  3G48 A;  4IQZ A;  4A76 A;  4B3R L;  2EPB A;  1U9R A;  3GTQ H;  5TSS A;  1Q82 C;  4LF9 L;  1HZC A;  4K5X A;  3TN2 A;  2F4I A;  2WKD A;  3J80 L;  1MBY A;  5M9O A;  5ELN A;  5LMN Q;  1VQK A;  1VQJ A;  1LV9 A;  2DY8 A;  3J7A F;  1EY6 A;  4LF5 Q;  1TXY A;  3NXW A;  3HEJ A;  2B2W C;  2Z6B A;  3MXN B;  2ZXO A;  4PZ6 A;  3KLR A;  2LFN A;  1L0Y B;  2A74 C;  2ZT9 C;  2X6L A;  1NJI C;  4LW1 A;  2AHO B;  2EY1 A;  3SVM A;  4DFA A;  1Y1W H;  2RF4 A;  1BVS A;  2R7Z G;  2ICE C;  4DN4 M;  4G7Z C;  1BCP B;  2ZTD A;  1SE8 A;  2Z8L A;  3OW2 A;  4JYA L;  1A3T A;  3F2D A;  4LF7 L;  4NPS A;  3H0G H;  1GO3 E;  4K5V A;  4IFD J;  3SK6 A;  2KHJ A;  1Q3L A;  4C2M B;  2I5H A;  2JA8 G;  5IT9 c;  4LFC L;  1SYC A;  3Q22 A;  4A3K B;  4JI0 Q;  1U4R A;  3T1H L;  1E24 A;  3TME A;  4DNI A;  1UEA B;  4I7Z C;  1EOV A;  1Q86 C;  1I4Q A;  1LT4 D;  1QOH A;  5KGU A;  3CKI B;  5KNC A;  2JJQ A;  3MC0 B;  1A3U A;  4NP5 A;  1ZEQ X;  3CCV A;  4CDE C;  1ICW A;  4ID6 A;  4DR2 Q;  1LAC A;  2D0P A;  2RSN A;  1D5M C;  3OWF A;  3GTO H;  1D6E C;  2KHS A;  3TP6 A;  3KLW A;  5G3L F;  3E9I A;  5FKA C;  4ZUI A;  3ER0 A;  2F0G A;  4LFA Q;  2IX1 A;  3RLO A;  5EBC A;  3J81 L;  1PYB A;  1N8R C;  3STB C;  1EWC A;  4GN5 A;  3PQI A;  2A8V A;  1BBX C;  4UP7 A;  2KCT A;  4BXX G;  5ELE A;  1I3Q H;  4A3D G;  1IBM L;  4H44 C;  1WTH A;  2EVB A;  2YTY A;  4F8M A;  3SE0 A;  2K03 A;  4HMJ A;  3WWV A;  1EU4 A;  2FJ2 A;  3RLN A;  3SK5 A;  1K0S A;  1JJC B;  4X3U A;  4A3M B;  4MZ9 A;  3S14 H;  4N9P A;  2E2H B;  2E74 C;  4ZAI A;  3D6C A;  1A6X A;  2UXC L;  4HR7 B;  3W2D A;  2ENB A;  2RCF A;  4JG2 A;  2N78 A;  2WAC A;  3MAQ A;  2F0D A;  2EIF A;  4UDU C;  1I4R A;  2IL8 A;  3OSO A;  4X64 L;  3FPU B;  3SHL A;  1LTL A;  3OTO Q;  5G3L D;  4CJ2 C;  2DNE A;  3S16 B;  5C4J H;  3V2T A;  4L8J A;  1F9Q A;  4B08 A;  4PZ8 A;  2KJX A;  4X66 L;  1C7Y A;  3DWP A;  3M9B A;  4A3M G;  4IUP A;  2UUB Q;  4B3T Q;  3H0G B;  5E1F A;  4DAY A;  5T1G A;  1F9R A;  3UI2 A;  3U4V A;  2OWO A;  4EQO A;  3W3A A;  4DV1 Q;  1Q7Y C;  1M8A A;  1YNN C;  2J4X A;  2UXC Q;  3I4M B;  5E4W C;  5C3X A;  1JWS D;  2E8G A;  4XYO A;  1I94 L;  4FYD A;  1SE4 A;  5M5Y B;  2ZTC A;  4DR3 Q;  3CF5 A;  2A68 C;  2A69 D;  5KRU A;  4A3I G;  1VDZ A;  2PQA B;  1EY4 A;  2F0U A;  4X64 Q;  3M3Y B;  1TWG B;  1TWG H;  2Z9H A;  5CBE E;  4AYB G;  3S17 H;  1UE6 A;  3D0F A;  4BA1 I;  3L2P A;  2JA9 A;  1PH1 A;  2ZM6 L;  3NEN A;  3NTH A;  2F3W A;  3IFT A;  1KNE A;  3EJI A;  4YY3 L;  3RUZ A;  4JBJ A;  3CAM A;  3VYS A;  1PH4 A;  5BR8 L;  1HZ9 A;  1NE3 A;  1PXU A;  1RCV D;  4X66 Q;  1NTG A;  5IYC G;  3CCJ A;  2N55 A;  5NUC A;  1S5D D;  4EX5 A;  1SFO B;  4NW2 A;  2O4X A;  2OQ0 A;  4YWL A;  2DJG C;  3ZJY C;  1YIJ A;  4LF4 Q;  5IP7 G;  1TR5 A;  4RGM A;  4KJO A;  1UAP A;  1E7Z A;  4TVA B;  3PF5 A;  3K7U C;  4FF2 A;  1JMC A;  1XNR L;  1QNU A;  5ISR A;  3BJU A;  1QVC A;  1I94 Q;  1LO5 D;  1YEZ A;  2DJF C;  5ELB A;  5J39 A;  4GN4 B;  4CKC A;  4A3L G;  1KHI A;  4EQP A;  1T5E A;  1QUQ B;  2FMC A;  2FMM A;  2CKZ B;  1VQF A;  5M5X H;  4IN3 A;  3BS1 A;  1U0L A;  4JI4 Q;  2F4V L;  3WOE A;  2IJ0 A;  3OIP A;  4QIW E;  1EZ8 A;  1PTO D;  3LWE A;  1HR0 Q;  4HTH A;  4IUQ A;  4GLX A;  3U50 C;  3T56 B;  3E0J A;  1UUP A;  3S1R B;  1HHV A;  2ZTE A;  1BBU A;  2KQ3 A;  2B2W A;  3W1B A;  3J80 i;  4DR5 Q;  1PYS B;  1G6P A;  4RG1 A;  3DM3 A;  1SND A;  1PVO A;  3U58 A;  4DGZ A;  1BBW A;  4P74 A;  4BY1 B;  2F3V A;  1K8O A;  2LKV A;  1WCM B;  4KV6 A;  1DON A;  2HIX A;  1CHQ D;  3F2C A;  1PHJ A;  2WB1 E;  2I5M X;  4BY7 H;  1GUO A;  5C4X H;  4OO1 H;  3HOW H;  1H9S B;  4KK7 A;  1LT6 D;  4DR7 Q;  1P16 A;  3PUZ A;  3PIP 3;  3RZD B;  4GKK Q;  4BBS B;  2E5L Q;  4JI8 L;  4A3E H;  1K9M C;  4C3H G;  1XPU A;  3TS0 A;  2H5X A;  4Q5V A;  4ZQ3 A;  1QZH A;  1X54 A;  3D31 A;  4X62 L;  1ZYR D;  4HJA A;  3ND9 A;  4DU9 A;  2JA6 B;  1RL2 A;  3KF8 B;  4B3M L;  4IUU A;  1EFW A;  3F2U A;  1B3Q A;  1PH5 A;  1CKN B;  1IBK Q;  3FDT A;  3NTK A;  4K2L A;  3R8B A;  3BYY B;  2PZU A;  4BBR B;  2XSC A;  4DV2 L;  3A0J A;  1PRT D;  1RF2 D;  1SYE A;  3CME A;  1AFP A;  1SNM A;  1L0W A;  2ATW A;  3S9W A;  1HCZ A;  4A3D H;  3BYT B;  1Y69 U;  3KDF B;  5LMN W;  2WB1 G;  4H13 C;  1Y1V G;  1KC8 C;  4DK0 A;  1S40 A;  2AQ3 B;  2LXK A;  1QVG A;  4JI8 Q;  2L11 A;  1L1O C;  3LX0 A;  4V19 0;  4OO1 I;  4PNY A;  1ZXT A;  1YHQ A;  5IOD A;  3K5M A;  4X62 Q;  2HHH Q;  3D4D A;  1VQL A;  2K28 A;  5C0X H;  1PA6 A;  3JC6 6;  5LMU L;  3U9S A;  3PO2 H;  1HNZ Q;  5EKL A;  1V43 A;  4LNQ A;  2VS1 A;  5C5L A;  2QA4 A;  5M5X B;  5IGF A;  4ULL A;  1IBL Q;  1J6Q A;  2NYZ D;  2NVQ H;  1F9P A;  1E2W A;  1W6J A;  2YYZ A;  1SMY D;  1XTC D;  1V1P B;  5IE8 A;  4PZ7 A;  4J6H A;  4G57 A;  1D1I A;  1VQI A;  3H3V H;  1Y8O B;  2XN9 C;  1N33 Q;  3KOJ A;  2I5L X;  3HFZ B;  3GO5 A;  1BO0 A;  3MXU A;  3S1M H;  4IFD I;  5J3B A;  3VDY A;  4CKE A;  2E2I B;  4GOP A;  4KHP Q;  1CFM A;  1LT5 D;  5ELD A;  1X55 A;  1SE3 A;  1Y8N B;  4LUO A;  4OIK A;  1YVC A;  1CZW A;  2BA1 A;  1DOL A;  3HOU B;  2CHB D;  3ND8 A;  4ZYS A;  3VR6 A;  1QE6 A;  4C3I B;  2ES2 A;  2DNC A;  2XTI A;  4JI6 Q;  1JE5 A;  3TZU A;  1N9W A;  2J7Z A;  3M4O H;  2K75 A;  2SEB D;  4MN3 A;  4TKO B;  4LF9 Q;  1GHK A;  2VB3 X;  2F0Q A;  1JOR A;  3A8K E;  2NN6 G;  5CBA E;  4V0B A;  4HJ7 A;  2O2L D;  2Q2I A;  3MXP A;  5M3M H;  2F52 A;  3NBH A;  4HJ8 A;  1PRT F;  1L2F A;  2B29 A;  3A55 A;  3CW2 C;  2OQK A;  2L0C A;  3HOY H;  2BCO A;  4KHV A;  2XRQ D;  1FYC A;  1JJG A;  3EA6 A;  4JI2 L;  3BVG A;  3KF8 A;  4KHP L;  4KLK A;  3CHB D;  4MNO A;  3QG1 A;  2JA8 B;  4XT1 B;  3HOU G;  1Y8P B;  3SEB A;  1VQ8 A;  4IPG A;  1B7Y B;  2K5N A;  2OXP A;  5FJ8 H;  3J81 c;  3A56 A;  5FO9 B;  1J8I A;  3BDC A;  4GOP C;  1M1K C;  4Y52 H;  5C44 G;  1R4Q B;  2HD3 A;  4JI3 L;  3I7F A;  2A6E C;  2OT2 A;  3T16 A;  1XTD A;  1JCK B;  1OXU A;  3T51 B;  1DYQ A;  1JE4 A;  2EJM A;  4P75 A;  5C4Z A;  1N34 L;  2RHS B;  1LYL A;  2F0N A;  3PF4 A;  2L15 A;  2I07 B;  1TWC B;  3KDF A;  1AE3 A;  1WD0 A;  2KHI A;  1W3S A;  1D7Q A;  1SXT A;  4RWS C;  1B50 A;  2VZA A;  2F03 A;  3CCS A;  1TWF B;  3J7Z C;  1HNX Q;  2K05 A;  2K5W A;  2EY6 A;  1GUG A;  4JOI C;  4K0K L;  3G4S A;  4A93 B;  1HR0 W;  4PMW A;  4JI2 Q;  4A3K H;  2OTL A;  5IT9 L;  1KXL A;  4IUV A;  2IWH A;  2GA4 B;  5I9O A;  3HKZ E;  4N8X 1;  5J22 A;  4RGT A;  1BXT A;  1G8Z D;  4GZY C;  1KLG D;  3HOX B;  5IP9 G;  3BU2 A;  3PUX A;  1E2Z A;  1O7I A;  4R9W A;  4X3S A;  3CC7 A;  1JOK A;  4A3D B;  3HG9 A;  1YJN A;  3CCU A;  2VW9 A;  5CV8 A;  3HOZ B;  3TBI B;  4LWC A;  5JJL A;  3IFD A;  2R7F A;  2K33 A;  4O0A A;  3ICE A;  2KCC A;  4A75 A;  1B1Z A;  1EY5 A;  3BDO A;  4I65 A;  3MXG A;  4YCV A;  1IBM Q;  2WP8 J;  3F8T A;  5GAE C;  1DM0 B;  2EOT A;  3D4R A;  1Q8K A;  1VQ6 A;  1CKO A;  2JA7 B;  4ZKC B;  4A3J B;  2HUG A;  4XDX A;  2WIN B;  4IOC A;  1WCM G;  1O7Z A;  1GKH A;  2FHT A;  4RGO S;  1RD9 D;  4K0K Q;  2A73 B;  1D8L A;  3SR1 A;  3MFG A;  4R4C A;  1ZYR C;  2IPK D;  1YJ9 A;  1L1O A;  4DA2 A;  2NTT A;  1H95 A;  3V96 A;  1G2T A;  1V1O A;  1TWC H;  1JJ2 A;  4DAM A;  2N8N A;  1GUT A;  1T5X D;  1TU2 B;  2DY7 A;  4TRD A;  3ULJ A;  5AJ3 Q;  2H4O A;  3C1F A;  1KDC A;  2CWA A;  3HKZ B;  1PZI D;  5DEH A;  5M3F B;  2OTJ A;  1JC7 A;  1RJT A;  1GOZ A;  1EY7 A;  2LY7 A;  1JOQ A;  2TSS A;  4GNX C;  3C1E A;  3S2D B;  1KTK A;  1C0A A;  4HCE A;  2VQF Q;  1EY8 A;  4FF3 A;  2A19 A;  4YHH Q;  4B9X A;  5L37 A;  4L5Q A;  3I4L A;  4RGN A;  4P72 A;  1K8M A;  5IIF A;  1L0X B;  2XRS D;  1JQY D;  2CQO A;  3I3C A;  5FLX c;  4LUZ A;  3M4Y A;  5CV7 A;  4AIM A;  1YHA A;  2BE5 D;  4A3L H;  5JEA G;  4OX9 L;  2JXM B;  3X3N A;  1LTT D;  1Y1V B;  3VYR A;  3HRZ C;  3SXH A;  1B9N A;  2WII B;  5C4H A;  2VQE Q;  3PO3 H;  1PH9 A;  4BY7 G;  4X3T A;  1EIH A;  3OPO A;  3PMF A;  2E2H H;  3JAM i;  5H1S E;  1VQM A;  5IYB G;  3GTG H;  3GV6 A;  4NB3 A;  2BDO A;  4DR1 Q;  2DUD A;  2B2T A;  4XQJ A;  4KKU A;  5CGK A;  1ESR A;  1SYG A;  2N88 A;  2VQF L;  4XTC S;  1HXY D;  1XMO L;  2F0M A;  2E2I H;  4JBW A;  4N9T A;  4A3B B;  3FP9 A;  2WKC A;  4DKA C;  3NTI A;  1XNR Q;  2F0K A;  1PH7 A;  1OXS C;  4FXK C;  3V05 A;  1I4G A;  4ILW A;  1NR4 A;  4FF4 A;  1I6H H;  3GTP B;  4DR4 Q;  1EWI A;  4AQY Q;  4A3J H;  1S5C D;  1SAP A;  2VQE L;  1VMP A;  1EFI D;  5IGE A;  2Q2U A;  2X69 A;  1CQF A;  3P7J A;  4DV3 Q;  2WAQ E;  1SNC A;  4JI4 L;  2F4V Q;  1B3A A;  1VCI A;  2AQ1 B;  2PNH A;  3SK8 A;  4R4O A;  4FO2 A;  3EFX D;  1XJV A;  4K5W A;  2O5I C;  1NSN S;  4X65 L;  1EYG A;  4F87 A;  3I55 A;  3GTM H;  2JSO A;  4APV A;  1XMQ L;  2FXQ A;  3HOZ H;  4IOA A;  1TWH B;  4NXM Q;  1HA6 A;  2CH4 W;  1I6V C;  2B2T C;  1IXR A;  1DZ1 A;  1X3P A;  5E4X A;  1VQH A;  4IJL A;  3HOY G;  3ERQ A;  2QDB A;  5C3W A;  1OXV A;  4A3G G;  1FJG L;  2F0T A;  4LF8 Q;  3MA2 B;  3NSW A;  4L63 B;  4XQQ A;  1XYI A;  4AQY L;  1VQ4 A;  1CHP D;  2KEC A;  4C3J G;  1S5E D;  1MGS A;  2RSO A;  4GOP B;  1S5B D;  5GAH C;  1EQQ A;  2PMZ B;  2RCN A; 
#chains in the Genus database with same CATH homology
 2RKS A;  2F0W A;  5C0X J;  3NPP A;  2RDG A;  2EYJ A;  4KD3 A;  4KHZ A;  5EKI A;  4Y7N B;  5C5M A;  2NVT B;  3I8Z A;  3HZX A;  1WTQ A;  1QNK A;  2O5J C;  1IW7 C;  1PLF A;  2XNA C;  2HCC A;  2KA7 A;  4XIG S;  4CJ0 B;  5IT9 E;  2I46 A;  3FVQ A;  1EOT A;  4LMQ D;  3K0Y A;  2B2V A;  2CW0 C;  2CVR A;  1D1K A;  2J0T D;  4PMC A;  1KDB A;  3J7A V;  3Q24 A;  4TQU S;  1STY A;  2SNS A;  4HMI A;  1DD2 A;  1WTX A;  2A69 C;  2F0E A;  4WRD A;  1AEX A;  2QCP X;  4OIJ A;  2IW3 A;  1LTB D;  5CR3 A;  2B2U C;  3G7L A;  4H7B A;  5C0X I;  1FNU A;  3VYU A;  5IGG A;  4IUT A;  1BCP D;  2NWG A;  4RFB A;  1TKW B;  3X3M A;  1GUN A;  3DHQ A;  5D14 A;  1EEI D;  2E75 C;  3QWN A;  3DWA A;  4M1U B;  1QCB D;  4HSV A;  5T1I A;  2NVQ B;  4FXD A;  1FGB D;  2QEJ C;  5C3E B;  1HA5 A;  1U4L A;  3EQL C;  2NTS A;  4CHT B;  1CA6 A;  1JOO A;  1LT3 D;  3R2T A;  2OEO A;  1B44 D;  3RD4 A;  2PQE A;  2K6A A;  1IKM A;  3S1N B;  2F0S A;  3K7A B;  4B9W A;  2HQE A;  2SNM A;  3D3R A;  4KY6 A;  2YU9 B;  1BF4 A;  3H09 A;  5EPL A;  1F9S A;  3BVZ A;  2NB0 A;  4K8J A;  3SDZ A;  3OHX C;  4NKL A;  2R3Z A;  1CK1 A;  3GTJ B;  1PMR A;  3FMC A;  3VR5 A;  2EYO A;  2F0H A;  1V1P A;  4CKB A;  1Y1W B;  2TMP A;  1QJO A;  4ABN A;  5HGT A;  5J1Z A;  1HQM C;  4KY7 A;  3HP3 A;  1HTP A;  4O42 A;  1CT1 D;  1II3 A;  3IL8 A;  2A5H A;  1HUN A;  1CM9 A;  2K5Q A;  3Q23 A;  1EEF D;  1LTS D;  3E6Z X;  2R61 A;  1STG A;  5M5W B;  2VXW A;  1X3Q A;  3FRP B;  4F7X A;  3HOV B;  2B63 B;  1RTN A;  3K57 A;  1Q8I A;  2VB2 X;  4FF1 A;  3DM1 A;  4CJ1 B;  3EVQ A;  1WVL A;  1O7L A;  4L6T B;  3LNN A;  1S5F D;  5FO7 B;  3IKJ A;  1SMY C;  5CV6 A;  1TY2 A;  2B2Y C;  2IX0 A;  3L9A X;  4MIU A;  3M7N A;  3MXN A;  4KKT A;  1BQQ T;  2L1B A;  2WAQ B;  1EYA A;  3H91 A;  2MHV A;  5CYU A;  2RBM A;  4K8I A;  1Z47 A;  1MSH A;  3KLS X;  4IUN A;  1TQO A;  4K6L A;  2JEB I;  2WV6 D;  4C3H B;  4KMU C;  2RQX A;  1FNV A;  1BCP C;  1PTO B;  2LMC B;  1Z6H A;  5I6Y A;  4CGY B;  4A3I B;  3K5N A;  4FNF A;  1TS5 A;  1W6K A;  2AWO A;  1U4P A;  3E5S A;  4ME5 A;  1O80 A;  1FR3 A;  1ET9 A;  1SYB A;  4HED A;  2XVS A;  3CRK C;  2DN8 A;  2EJG C;  3J7Y W;  4FP5 D;  2IT1 A;  5C4J B;  1I3Q B;  2NBF A;  1HQR D;  3QIA A;  4NMZ A;  2BDN A;  2WB1 B;  3DEO A;  1B4O A;  3MEH A;  1S4Z A;  1QWY A;  3GV3 A;  1PZJ D;  1PTO C;  4EGV A;  5DM6 3;  4K2K A;  5I2Y A;  1NCV A;  4G4K A;  5K36 H;  4ZRZ A;  3DXJ C;  4XQN A;  3VR2 A;  3NUC A;  4EQN A;  3M7G A;  2E2J B;  1YNJ D;  4KKS A;  1ZKO A;  2CW0 D;  1DXM A;  1PTO F;  2R92 B;  3J80 E;  1PFN A;  1VF5 C;  5A35 A;  1SYD A;  2L9H A;  2EYP A;  3L3O C;  2NVX B;  4U67 3;  4R8I A;  2G9H D;  1JIC A;  3R93 A;  5D3I B;  4DAV A;  4C3I G;  4C56 C;  2L12 A;  4RKL A;  5HUR A;  2EYM A;  4OL7 A;  2Z4I A;  2PNR C;  2PYK A;  4LJZ C;  4EVO A;  2MUY A;  3GTM B;  2K01 A;  5KIX A;  2B8G A;  5IGB A;  1IL8 A;  2K1B A;  2RVL A;  2A6E D;  3J81 E;  3C46 A;  1EIG A;  1RTO A;  3QJY A;  1BR9 A;  1EYD A;  4E6I A;  3GTO B;  3N52 A;  1STH A;  5FLX E;  2R93 B;  1G91 A;  1KDA A;  4ZUJ A;  3PUY A;  3BVM A;  2PZT A;  1OO9 B;  4A3F B;  1WTV A;  1H9K A;  5BN4 A;  1D5X C;  4OGQ C;  3WOF A;  3HS0 C;  1Q12 A;  3AMU A;  2R7Z B;  1PFB A;  3N6R A;  3QO2 A;  1HUM A;  2EDG A;  4KY5 A;  1HFG A;  1STN A;  3D6W A;  1WTP A;  5EJW A;  4RHR A;  2EJF C;  4KJN A;  1SE2 A;  1K83 B;  1E0B A;  1B53 A;  2PW5 A;  3CU7 A;  4AYB B;  1EU3 A;  1F2Z A;  5I6W A;  4U68 A;  4J1M A;  3KUP A;  5JVH 3;  1B9M A;  1G2S A;  1TWA B;  3BG3 A;  1MSG A;  1LTR D;  2V4D A;  3RLF A;  3A7L A;  2EYF A;  5JAV A;  3NP8 A;  1XWE A;  3I72 A;  5COY A;  1ENC A;  4DXF A;  1D2B A;  4XYQ A;  2L5T A;  4LAA A;  2B2Y A;  3PUV A;  2OF1 A;  1C8C A;  3I91 A;  3C2P A;  4C3J B;  5LL6 S;  1CTM A;  5D3D A;  3KBG A;  2NN6 H;  5M3M B;  2Q8I B;  5C6A A;  4QCL A;  4BA2 I;  2F0P A;  2BA0 A;  1F2L A;  5KYI A;  3S17 B;  2M00 A;  3D8G A;  2KCN A;  1EY0 A;  3GTQ B;  1AW7 A;  3K6O A;  2L55 A;  4LK1 C;  1PDQ A;  3CQZ B;  1SNP A;  3NBI A;  4G7O C;  2KEE A;  2AUJ D;  1U4M A;  3VA7 A;  3DWQ A;  3S1M B;  1OXT A;  5JEA J;  4KI0 A;  1ENA A;  2KUM A;  1KAB A;  5A2Q L;  5COR A;  3ZYY X;  3O13 A;  1B2T A;  3TZD A;  1WTR A;  4IAL A;  4QF4 A;  4KN4 C;  2NN6 I;  2EE1 A;  2D5D A;  4QB4 A;  1AN8 A;  5JOB A;  2AQ2 B;  5IGC A;  5EBD A;  3A8J E;  5D65 A;  2EYH A;  2PW7 A;  2L4N A;  4YIJ A;  1SSO A;  1KLU D;  4XT3 B;  2XWJ B;  1Q1B A;  3TSS A;  5CMD A;  1ET6 A;  2F0I A;  4RAU C;  3NQT A;  1GXD C;  4TSS A;  5EGT A;  3OMC A;  3S1Q B;  4S3S A;  2JYO A;  1NAP A;  1Z7T A;  2RA4 A;  4HCS A;  1BUV T;  1LAB A;  3DMU A;  3GP7 A;  2R6G A;  4HN7 A;  4OHJ A;  4RH6 A;  3MZ5 A;  2ID0 A;  3MVV A;  1DOM A;  2X6G A;  1BOS A;  5JVG 3;  1H9R A;  1I4P A;  4A3E B;  1QG7 A;  2EZV A;  1IKL A;  5EPK A;  3A7A B;  2KOL A;  4QMG A;  3FEW X;  2BOS A;  1PYW D;  3NHH A;  2D9U A;  3FKI B;  1IYV A;  3NQI A;  1LLR D;  5BN5 A;  3OMG A;  5LL6 X;  4NDX A;  5I2X A;  1ROD A;  3GTG B;  1WD1 A;  3DEP A;  3QOL A;  1TS3 A;  1M4V A;  4KD4 A;  2PCF B;  4ZKB B;  1TII D;  2JEA I;  2H1E A;  3AB9 A;  3TP8 A;  3PV0 A;  4P2C B;  5DNF A;  3VYT A;  5CC4 A;  4H0L C;  2C9O A;  1H9J A;  2M9V A;  1CQV A;  1MD2 D;  4Z9C B;  5CV9 A;  1E2V A;  2IX3 A;  2E76 C;  3SK4 A;  1H9S A;  1F2Y A;  1DCZ A;  2EY2 A;  5I9P A;  3R2I A;  3M4O B;  2K7V A;  2LS0 1;  1TS2 A;  4HAE A;  4QIW B;  3KBX A;  2RDF A;  3K58 A;  2JA5 B;  2AWN A;  1STE A;  4F88 A;  2NZ1 D;  1CZG A;  5K5P A;  4DK1 A;  5F2D A;  4ZLT F;  1A2T A;  3JAM L;  1AZQ A;  4R8N A;  1LTA D;  3PUW A;  2PPB C;  3NWS A;  3AU7 A;  3KLS A;  3CRL C;  2HCI A;  4ZK9 B;  4KTA A;  2KVM A;  1JWM D;  5CV5 A;  2A6H C;  3VA5 A;  1RKN A;  1SNO A;  2F0F A;  1GUS A;  2C5C A;  4ODG A;  1NR2 A;  4A3G B;  4MHE A;  2SDF A;  1SEB D;  1YNN D;  1R4P B;  1D5Z C;  3RMH A;  2E2D C;  5I4D A;  4RHS A;  3K5L A;  1VMC A;  1PZK D;  3A8I E;  3MWY W;  3OIQ A;  3ONA B;  3OW7 A;  2B2U A;  3OOC A;  2G9D A;  2MJ8 A;  3R3O A;  1PTO H;  2K04 A;  3K5O A;  1ILQ A;  1OXX K;  3OWE B;  4WJW A;  2B2V C;  1HRJ A;  5FK9 C;  2FFK B;  5DAU A;  1STB A;  2XWB B;  3KK7 A;  1G29 1;  4M8A A;  3U9O A;  4Q0F A;  4K14 A;  3H6M A;  2VNU D;  3H3V C;  1JB3 A;  3TDQ A;  2F0L A;  4HSP A;  1TT2 A;  4QUF A;  1TVX A;  1AZP A;  1FD7 D;  1I4X A;  2XIW A;  4DXG A;  3P75 A;  5FOB B;  1FNW A;  3MFY A;  4IFD H;  3G6J B;  1VF7 A;  4X3K A;  2D2C C;  3D4W A;  1EYC A;  1LTG D;  2Q8T A;  5DM7 3;  4DF7 A;  2F0V A;  1BDO A;  4CBV A;  4XXE A;  1KNA A;  1JR0 D;  4G7H C;  3QOJ A;  3P1H A;  2VUM B;  1XXG A;  3QB3 A;  1HPC A;  3GTL B;  2K5D A;  3T53 B;  1KAA A;  1PRT B;  4IZ8 A;  1O7Y A;  4WOR A;  2PO4 A;  2Q8R E;  1G6Z A;  1RHP A;  5JJZ A;  1I50 B;  5C0X G;  2A68 D;  1UNS A;  1QB5 D;  3PO3 B;  1A2U A;  1F77 A;  2F0O A;  2EYL A;  1GJX A;  4DNR B;  3I4N B;  1EWH A;  3LWU A;  1J9O A;  2AUK A;  3P20 A;  1EL0 A;  4BWG B;  1F2M A;  1MI2 A;  3MHB A;  4PQX A;  2MPM A;  3WDN A;  2F0J A;  1TY0 A;  1ONL A;  4DNT B;  4C1N K;  5C44 B;  2QF7 A;  3JAM E;  5JPN C;  4J8Q A;  1XX8 A;  5IGD A;  1EQV A;  1HFN A;  1CA5 A;  3I73 A;  5KEE A;  5BN3 A;  4IUR A;  4DAP A;  3S15 B;  5JPM C;  1ESF A;  5LHY 1;  3I70 A;  2D62 A;  2BE5 C;  1SJH D;  2EXZ A;  3K59 A;  5ELF A;  5C4X B;  2A6H D;  1LTI D;  5KYL A;  4RKB A;  1SYF A;  3C3L A;  2HDL A;  2ZXR A;  5EQ0 A;  5EKK A;  2EY5 A;  3HGB A;  1GUW A;  2KED A;  3NWT A;  4WFN 3;  4RA8 A;  1WTW A;  4RCN A;  5E3F A;  1A3V A;  3BZD B;  2K32 A;  5ELC A;  5KNB A;  2RDH A;  1H9M A;  1EY9 A;  1WTO A;  2HDM A;  3I90 A;  4OO1 G;  2MP1 A;  1JWU D;  3Q6S A;  4PMB A;  1STA A;  2JP1 A;  2NVY B;  3S2H B;  2B8F A;  2FIN B;  3L7Z C;  4FVM A;  1IW7 D;  1X32 A;  1EZ6 A;  1Q1E A;  5JEA H;  1ILP A;  5IOC A;  3MTS A;  4IFD G;  1TS4 A;  1DJR D;  1C4Q A;  3FPP A;  3NK9 A;  1YNJ C;  3NE5 B;  2Y0S B;  3BDL A;  3GD7 A;  5KND A;  1SJE D;  1AP0 A;  1BCP F;  3GTK B;  4PV1 C;  4K6D A;  1PRT C;  3GQB A;  3H94 A;  2QIL A;  1BNZ A;  3Q0A A;  5K36 G;  3TP5 A;  1DOK A;  2MGS A;  4BS9 A;  4BY7 B;  3URY A;  4O1N A;  3T4A C;  1Q90 A;  1A15 A;  1SBB B;  1IHZ A;  1ENF A;  3VR3 A;  2SOB A;  2QKI C;  1ML0 D;  2Z1C A;  4KN7 C;  4RCO A;  3ITP A;  1V8Q A;  4FXG C;  2Z4H A;  2F1M A;  3ERO A;  5AFW A;  3T13 A;  1HTL D;  2ICI A;  1NUC A;  3RZO B;  3PO2 B;  1GHJ A;  5FLX L;  4JK1 C;  3HOW B;  1SDF A;  5A2Q E;  3PIO 3;  3DUZ A;  3A54 A;  2NUC A;  1PFM A;  2B39 A;  5EPJ A;  3M85 A;  1I6H B;  3TP7 A;  2M2L A;  3S14 B;  4QUC A;  5CV4 A;  4C1N I;  1C48 A;  1EQT A;  2JE6 I;  4UAI A;  1IYU A;  1O78 A;  3VR4 A;  2CQA A;  2PZW A;  3IAY A;  2ZXP A;  5FO8 B;  1CI3 M;  1SNQ A;  1RDP D;  1I4H A;  1QIL A;  3HOY B;  1R9T B;  4IQZ A;  2EPB A;  1U9R A;  5TSS A;  4K5X A;  3TN2 A;  2F4I A;  2WKD A;  3J80 L;  1MBY A;  5M9O A;  1LV9 A;  2DY8 A;  3J7A F;  1EY6 A;  3NXW A;  3HEJ A;  2B2W C;  2ZXO A;  3KLR A;  2LFN A;  1L0Y B;  2A74 C;  2ZT9 C;  2X6L A;  2EY1 A;  3SVM A;  4DFA A;  2ICE C;  4DN4 M;  4G7Z C;  1BCP B;  2Z8L A;  1A3T A;  4K5V A;  4IFD J;  3SK6 A;  1Q3L A;  4C2M B;  1SYC A;  3Q22 A;  4A3K B;  1U4R A;  3TME A;  1UEA B;  4I7Z C;  1I4Q A;  1LT4 D;  1QOH A;  5KGU A;  3CKI B;  5KNC A;  3MC0 B;  1A3U A;  4NP5 A;  1ZEQ X;  1ICW A;  4ID6 A;  1LAC A;  2RSN A;  1D5M C;  3OWF A;  1D6E C;  2KHS A;  3TP6 A;  5G3L F;  5FKA C;  4ZUI A;  2F0G A;  2IX1 A;  5EBC A;  3J81 L;  1EWC A;  1BBX C;  5ELE A;  4H44 C;  4F8M A;  2EVB A;  3SE0 A;  2K03 A;  4HMJ A;  1EU4 A;  2FJ2 A;  3SK5 A;  4X3U A;  4A3M B;  4N9P A;  2E2H B;  2E74 C;  4ZAI A;  3D6C A;  1A6X A;  4HR7 B;  3W2D A;  2ENB A;  2WAC A;  3MAQ A;  2F0D A;  4UDU C;  1I4R A;  2IL8 A;  3OSO A;  3FPU B;  3SHL A;  5G3L D;  4CJ2 C;  2DNE A;  3S16 B;  3V2T A;  4L8J A;  1F9Q A;  4B08 A;  2KJX A;  3DWP A;  4IUP A;  3H0G B;  5E1F A;  4DAY A;  5T1G A;  1F9R A;  3UI2 A;  4EQO A;  3W3A A;  1M8A A;  1YNN C;  2J4X A;  3I4M B;  5E4W C;  5C3X A;  1JWS D;  4XYO A;  4FYD A;  1SE4 A;  5M5Y B;  2A68 C;  2A69 D;  5KRU A;  1VDZ A;  1EY4 A;  2F0U A;  3M3Y B;  1TWG B;  5CBE E;  4BA1 I;  3NTH A;  2F3W A;  3IFT A;  1KNE A;  3EJI A;  3RUZ A;  3VYS A;  1PXU A;  1RCV D;  2N55 A;  5NUC A;  1S5D D;  1SFO B;  4NW2 A;  2O4X A;  1TR5 A;  4RGM A;  4KJO A;  1UAP A;  4FF2 A;  1QNU A;  5ISR A;  1LO5 D;  5ELB A;  5J39 A;  4CKC A;  4EQP A;  1T5E A;  2FMC A;  2FMM A;  4IN3 A;  3BS1 A;  3WOE A;  2IJ0 A;  3OIP A;  1EZ8 A;  1PTO D;  3LWE A;  4HTH A;  4IUQ A;  3T56 B;  3E0J A;  1UUP A;  3S1R B;  1HHV A;  2KQ3 A;  2B2W A;  1SND A;  4DGZ A;  4BY1 B;  2F3V A;  1K8O A;  2LKV A;  1WCM B;  4KV6 A;  1DON A;  1CHQ D;  1GUO A;  4OO1 H;  1H9S B;  4KK7 A;  1LT6 D;  3PUZ A;  3PIP 3;  3RZD B;  4BBS B;  4C3H G;  4Q5V A;  4ZQ3 A;  3D31 A;  1ZYR D;  3ND9 A;  4DU9 A;  2JA6 B;  4IUU A;  3F2U A;  3FDT A;  3NTK A;  4K2L A;  3R8B A;  3BYY B;  2PZU A;  4BBR B;  2XSC A;  1PRT D;  1RF2 D;  1SYE A;  1AFP A;  1SNM A;  3S9W A;  1HCZ A;  3BYT B;  1Y69 U;  4H13 C;  4DK0 A;  2AQ3 B;  2L11 A;  3LX0 A;  4V19 0;  4OO1 I;  4PNY A;  1ZXT A;  5IOD A;  3K5M A;  3D4D A;  2K28 A;  5C0X H;  3U9S A;  5EKL A;  1V43 A;  5C5L A;  5M5X B;  5IGF A;  4ULL A;  2NYZ D;  1F9P A;  1E2W A;  1W6J A;  2YYZ A;  1SMY D;  1XTC D;  1V1P B;  4J6H A;  4G57 A;  1D1I A;  1Y8O B;  2XN9 C;  3GO5 A;  1BO0 A;  3MXU A;  4IFD I;  2E2I B;  4CKE A;  1CFM A;  1LT5 D;  5ELD A;  1SE3 A;  1Y8N B;  4OIK A;  1CZW A;  2BA1 A;  1DOL A;  3HOU B;  2CHB D;  3ND8 A;  4ZYS A;  3VR6 A;  1QE6 A;  4C3I B;  2DNC A;  3TZU A;  2J7Z A;  4MN3 A;  2SEB D;  4TKO B;  1GHK A;  2VB3 X;  2F0Q A;  1JOR A;  3A8K E;  2NN6 G;  5CBA E;  4V0B A;  2O2L D;  3MXP A;  3NBH A;  1PRT F;  3A55 A;  2L0C A;  2BCO A;  4KHV A;  2XRQ D;  1FYC A;  3EA6 A;  3BVG A;  3KF8 A;  3CHB D;  3QG1 A;  2JA8 B;  4XT1 B;  1Y8P B;  3SEB A;  2OXP A;  3A56 A;  5FO9 B;  1J8I A;  3BDC A;  1R4Q B;  2A6E C;  2OT2 A;  3T16 A;  1JCK B;  1OXU A;  3T51 B;  1DYQ A;  1JE4 A;  2EJM A;  5C4Z A;  2F0N A;  2I07 B;  1TWC B;  1WD0 A;  1SXT A;  4RWS C;  1B50 A;  2F03 A;  1TWF B;  2K05 A;  2K5W A;  2EY6 A;  1GUG A;  4A93 B;  4PMW A;  5IT9 L;  4IUV A;  2IWH A;  2GA4 B;  5I9O A;  5J22 A;  4RGT A;  1BXT A;  1G8Z D;  4GZY C;  1KLG D;  3HOX B;  4X3S A;  3PUX A;  1E2Z A;  4R9W A;  4A3D B;  1JOK A;  3HG9 A;  5CV8 A;  3HOZ B;  3TBI B;  3IFD A;  2K33 A;  2KCC A;  1B1Z A;  1EY5 A;  3BDO A;  4I65 A;  3MXG A;  2WP8 J;  1DM0 B;  2EOT A;  3D4R A;  2JA7 B;  4ZKC B;  4A3J B;  2HUG A;  4XDX A;  2WIN B;  1O7Z A;  2FHT A;  4RGO S;  1RD9 D;  2A73 B;  3SR1 A;  3MFG A;  1ZYR C;  2IPK D;  4DA2 A;  2NTT A;  3V96 A;  1G2T A;  1V1O A;  1GUT A;  1T5X D;  1TU2 B;  2DY7 A;  4TRD A;  2H4O A;  3C1F A;  1KDC A;  5DEH A;  3HKZ B;  1PZI D;  5M3F B;  1JC7 A;  1RJT A;  1GOZ A;  1EY7 A;  2LY7 A;  1JOQ A;  2TSS A;  3C1E A;  3S2D B;  1KTK A;  4HCE A;  1EY8 A;  4FF3 A;  4B9X A;  3I4L A;  4RGN A;  1K8M A;  5IIF A;  1L0X B;  2XRS D;  1JQY D;  3I3C A;  3M4Y A;  5CV7 A;  2BE5 D;  5JEA G;  2JXM B;  3X3N A;  1LTT D;  1Y1V B;  3VYR A;  3HRZ C;  3SXH A;  1B9N A;  2WII B;  5C4H A;  4X3T A;  1EIH A;  3OPO A;  3PMF A;  3GV6 A;  2BDO A;  2B2T A;  4XQJ A;  4KKU A;  5CGK A;  1ESR A;  1SYG A;  2N88 A;  4XTC S;  1HXY D;  2F0M A;  4JBW A;  4N9T A;  4A3B B;  2WKC A;  3NTI A;  2F0K A;  1OXS C;  4FXK C;  3V05 A;  1I4G A;  4ILW A;  1NR4 A;  4FF4 A;  3GTP B;  1S5C D;  1SAP A;  1VMP A;  1EFI D;  5IGE A;  2X69 A;  1CQF A;  3P7J A;  1SNC A;  1B3A A;  1VCI A;  2AQ1 B;  3SK8 A;  4FO2 A;  3EFX D;  4K5W A;  2O5I C;  1NSN S;  4F87 A;  2JSO A;  1TWH B;  1HA6 A;  1I6V C;  2B2T C;  1DZ1 A;  1X3P A;  5E4X A;  3ERQ A;  2QDB A;  5C3W A;  1OXV A;  2F0T A;  3MA2 B;  3NSW A;  4L63 B;  4XQQ A;  1XYI A;  1CHP D;  2KEC A;  4C3J G;  1S5E D;  1MGS A;  2RSO A;  1S5B D;  2PMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...