3A8JE

Crystal structure of et-ehred complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
126
Chain Sequence
b'SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 32
structure length 126
sequence length 127
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8jE00
3M7NA 1G291 2PCFB 3P20A 1GHJA 1E2ZA 2A68D 2ZT9C 3QIAA 4XTCS 1HCZA 3QJYA 1OXUA 3MFYA 3PV0A 1GUSA 1LABA 4G7HC 2DNEA 4KMUC 5BN5A 1Z6HA 1B9MA 3M4YA 3MXUA 3OW7A 4H0LC 2B8GA 2A6ED 3CRLC 4L8JA 2A69D 2Q8IB 5K36H 4DK0A 3A8KE 1IW7D 1Q12A 3FPPA 1Y8PB 5K36G 2A68C 3I73A 3WDNA 2O5IC 2KCCA 2BA1A 3VR5A 1Q90A 3PUWA 4DNRB 1ZYRC 1OXSC 1Q1BA 1YNJC 2A6EC 4LJZC 1E2WA 2A69C 4OGQC 3A8IE 5A35A 1IW7C 1OXTA 1A6XA 1QJOA 1DCZA 1I6VC 1GUOA 3PUXA 1GUGA 3IKJA 3VR6A 1GJXA 3A7LA 1T5EA 3OOCA 2EJFC 2PNRC 3A7AB 2BA0A 3FMCA 4XIGS 2NN6I 4DNTB 1V43A 4TQUS 2E76C 4JBWA 1O7LA 5BN3A 4JK1C 3M85A 1VDZA 2K32A 4OO1H 5KNDA 3ND9A 1VF7A 4H44C 3VR2A 1DXMA 4OO1G 3AB9A 2EJGC 1Q1EA 3LWUA 3IFTA 4HR7B 1TKWB 1CTMA 2NN6H 3T53B 5BN4A 2AUKA 3EQLC 2NN6G 1DD2A 2PPBC 3TZUA 1HPCA 4KKTA 3D31A 3KLRA 2EVBA 1TU2B 1Z7TA 3L7ZC 5KNCA 2D62A 1ONLA 2K7VA 1YNNC 1Y8NB 2DN8A 5C0XH 1SMYC 4GZYC 1O78A 1FR3A 4KN7C 1CI3M 4KKUA 5C0XG 2QF7A 1V8QA 1K8MA 3A8JE 4RCNA 3RLFA 3I72A 3T51B 2IT1A 4G7OC 4BA1I 2EJMA 2JEAI 2B8FA 1OXVA 3SE0A 4H13C 3OPOA 3QG1A 1H9RA 1H9SB 3T56B 1K8OA 2F1MA 3LNNA 1H9JA 2JEBI 4IQZA 4TKOB 3VR3A 3VA7A 5JEAH 2LMCB 1VCIA 4KHZA 2AUJD 4DK1A 3D4RA 5JEAG 2KA7A 3PUZA 2A6HD 2R6GA 2L5TA 3H94A 2E74C 3BDOA 2D5DA 3I4LA 1HTPA 1FYCA 1OXXK 2D2CC 1IYVA 1HQMC 3N6RA 2EDGA 3NE5B 3VR4A 2E75C 4IFDH 3PUVA 4KKSA 1LACA 2CW0C 2YYZA 1EWHA 3ND8A 4I7ZC 4KN4C 4BA2I 1H9SA 4IFDG 1Y8OB 1Y69U 1ZKOA 2JE6I 3W3AA 3GQBA 1IYUA 3PUYA 4PV1C 2A6HC 3CRKC 2V4DA 3BG3A 2BE5D 2AWOA 2JXMB 4G7ZC 2BDOA 3U9SA 1H9MA 1B9NA 1GUTA 1H9KA 3DXJC 3HGBA 1CFMA 1BDOA 1VF5C 4KI0A 2O5JC 2K33A 4LK1C 1GHKA 2DNCA 1PMRA 1E2VA 3GD7A 1GUNA 5KNBA 2BE5C 3SDZA
chains in the Genus database with same CATH superfamily
1KAAA 4MTNA 1YNXA 1S40A 3L9AX 5EKKA 4LF8Q 4ALPA 4IUQA 1BVSA 5J1ZA 3MXUA 5K36H 2UXDL 2P5ZX 4NW2A 4JI8Q 2I5HA 3VR5A 4A3JG 3GTPB 3K0YA 1NY4A 2G5DA 4N8X1 1N32Q 1IHZA 1PYBA 1BUVT 2DGYA 1HQRD 1VQ9A 3KJPA 2RCFA 1I3QB 4EQ5A 3PGZA 1QZGA 3FKIH 3WOEA 4B3RL 3PO3H 2NVQB 2EXZA 2OEOA 5IYDG 2ID0A 1VQ5A 3GDEA 1X65A 3QB3A 3S14H 1V43A 3EBEA 1G8ZD 1O7LA 3S16B 1YVCA 1VQMA 2PQEA 1GUWA 4DV3L 3HOYH 1YNND 3FRPB 4JYAL 1X3PA 1TKWB 3IRBA 3X3MA 4DN4M 1J5EL 1KRSA 1CK1A 2F3WA 4UY8C 5JPMC 1BCPB 1L0YB 3VYRA 1PH3A 1QOHA 1YNNC 4IUTA 2DN8A 4DAPA 5M5WB 2CWPA 4C3JG 2G9HD 3GO5A 1TWHH 3T13A 2AMCB 3S1NH 1JB3A 4DR5Q 2PMZB 2F3IA 4ZCKA 5C4XH 4TKOB 1XXGA 5ELOA 2XNAC 2B2WC 5C44H 4UPAA 4DR4L 1QVFA 1KDAA 1IL8A 3MEHA 3MVVA 3NWTA 1NR4A 4WJ3M 1JJCB 2PO4A 1AP0A 3BDLA 4ILWA 2WACA 2I5LX 3UE0A 5LMNW 3NEMA 3HOUB 5FJ8H 5C3EB 4C1NI 4C2MB 2R7DA 1SYFA 4LF9Q 4DV2Q 3UE1A 3GTPH 1NUCA 4CHTB 4O0AA 4OWXB 2PQAB 1PH7A 4GS3A 5IT9c 3UDFA 5K5PA 4IPCA 1I3QH 3SEBA 3HFZB 4A3CH 1PMRA 2NZOA 1B3AA 2R7FA 3MXGA 3CHBD 2F0GA 2ZTDA 2XWJB 2HUGA 3CP0A 5LMUQ 2IHFA 2VQEL 1EFID 2A68D 3R3OA 4X3TA 4EQOA 1P16A 1MSHA 1X3EA 1CHQD 2PI2E 5GAEC 3S2DB 1NBWA 4MIUA 2GVAA 3BZDB 1QG7A 5IYBH 2BOSA 1BCPD 2A69D 1XJVA 2NB0A 2XRSD 2ICIA 3PSIA 2ATWA 2A68C 4NXNQ 2BA1A 4DA2A 5FOBB 1OO9B 1TQOA 4JI4Q 2Q2UA 3GTQB 1XMQL 2A69C 1NCVA 5M5WH 4CDEC 5D3IB 1RL2A 1IBKL 2MQHA 3IKJA 2JA9A 1Y1VG 2Q2HA 4EGVA 1PH5A 3Q24A 5J22A 5HURA 1IBML 2KQ3A 3QWNA 4P2CB 3HZXA 1HNWL 4OO1H 2Y0SE 2NYZD 3K81C 4A75A 3VR2A 1AZPA 5EJWA 3CCMA 1LT4D 3HOUH 1PXUA 4C2MH 3DLLA 3FHWA 5IWAQ 3UDIA 4BY7B 2E2HB 4DV5Q 3L7ZC 3C46A 4FXKC 2K7VA 3KBXA 2F0NA 1O78A 1EZ8A 1F2YA 2PW7A 5FKAC 2K14A 4GN4B 4PZ7A 3A5ZB 2JEAI 2B8FA 5JVH3 1LO5D 1AW7A 3LNNA 4R8NA 2C35B 4K6LA 3I4MG 3D4RA 3RN5A 4K0KQ 4B3ML 1JE4A 1NR2A 1LTAD 1AEXA 1HTPA 3DEPA 1BO0A 5D3DA 3RMHA 4DR3L 1D8LA 4M1UB 2MNAA 1SNPA 1HNXL 4HMJA 1QVCA 1Y8OB 3AMUA 2VQFL 4LF4Q 1VMCA 3PUYA 4BXXG 1UEAB 4LFAL 1CZGA 3J81L 2CHBD 2NUCA 3CC2A 3HG9A 3G48A 4IALA 3GTQH 4PMWA 2IX3A 2KJXA 2O5JC 5DAUA 4X62Q 1U4RA 5FLXc 1X56A 2DNCA 2RQXA 4WFN3 4O2DA 1SYDA 3LGJA 4YWMA 3TS2A 4YY3Q 2ASBA 1Q8KA 3P75A 3UI2A 3VYTA 1B44D 2QGQA 3TREA 2XGTA 4KMUC 3A56A 1TWCB 4F7XA 3MEFA 1B9MA 4A3GB 3GTKH 3CRLC 1KDCA 4S3SA 4DR2Q 2L12A 2VS1A 2MJ8A 1G6PA 4XYOA 1SDFA 2ZXPA 3OWEB 4HCSA 1LT3D 4HJ8A 4IURA 3M4QA 4BY7H 2YTXA 2E2HH 4K5WA 3TP7A 4P72A 2YTYA 1M90C 4G4KA 2JA6G 4YHHQ 4HJ9A 2L1BA 3TS0A 3S9WA 2B2TA 3SK4A 1FJGL 1PRTF 1UNSA 1EU3A 1AE2A 2R93B 1LT6D 4DKAC 4R1JA 3NBHA 1CKMA 4MHEA 5KNDA 4H02A 4DF7A 1CQFA 3I7FA 4TRDA 1ESRA 1HFGA 1TR5A 4L5QA 5EAYA 1HFNA 3CCQA 2WAQE 3QOJA 4B9WA 5E3FA 3NBHB 3U58A 1JORA 1PTOB 4IOCA 1K0RA 4XQJA 5KNCA 3TN2A 1C9OA 1N34Q 2MP1A 2J0TD 3CXCA 4GKKQ 3NHHA 1NAPA 4R4CA 2K4KA 2R3ZA 4RHRA 1OXVA 1WTQA 4Y7NB 5JEAH 3CCLA 4IQZA 1CKOA 2LMCB 2EXDA 2EPBA 3MA2B 4C3HG 3I55A 2CFMA 4ZUIA 2IY5B 5IGBA 4QUCA 1HQMC 4JOIA 1WCMG 3PUVA 4A3GH 3HOZH 4KN4C 5M3FG 4PQXA 3SK6A 3K57A 5JJZA 3KLSA 5IYCG 5T1GA 1STAA 1T9HA 1F9QA 3PIP3 2BE5D 2OTJA 1EY5A 1H9MA 1E1TA 2R61A 1BCPF 1K83B 4LK1C 2PI2A 4HJAA 3W5OA 2IX0A 1GUNA 1ENFA 5FO9B 3P7JA 2B2YC 4RGOS 2E2DC 2BE5C 3KK7A 5I9PA 1N36L 3D4DA 5FLMH 1I5FA 3P20A 2R93H 3I3CA 4G57A 1VQIA 3QIAA 5LMNL 2HIVA 2RDHA 4A3MH 4A3IB 3KFUA 3I8ZA 2DNEA 1SNMA 1ZYRD 1PTOD 1C7YA 3H91A 2LY7A 3H0GB 5IT9E 1VQ4A 2NVXB 3EIVA 2A6ED 1ILQA 2B2TC 4EX5A 5G3LF 4DAMA 2WP8J 3HKZG 4DR6Q 2ZTCA 3ZJYC 4OELB 2Q2TA 1PTOH 2EYPA 5JPNC 1CKNA 1JJGA 4HIKA 1ZYRC 1PTOC 3OSOA 5IGFA 3CCJA 4A3FH 2MPMA 2A5HA 2A6EC 4JI8L 1N32L 5M3MB 5FK9C 1I4QA 4Y7NH 5C4HA 1QB5D 4DNTB 5IE8A 1G2SA 1HJPA 5CR3A 2FMCA 2Y0SB 4A3LG 1ENCA 3K59A 3NUCA 4A3BB 1Q86C 2JA5H 2JJQA 2NN6H 3MTSA 2N78A 2EY6A 1YJ9A 4HMIA 4A3EB 2ENBA 1F77A 1EWIA 4JOIC 1K83H 3AFPA 3A8JE 4X3KA 1KLGD 2F0VA 4ZQ3A 4C56C 3PO2G 4P71A 4BBSB 2R7ZB 1K8OA 4IFDI 4RHSA 4HEDA 2RDFA 4LAAA 4DR5L 1VQ7A 5M5XB 1GKHA 3ONAB 2NVXH 4BA2I 4N9PA 3WOFA 4IFDG 2BDNA 4KHPQ 1IYJB 1V1OA 2ALYB 4NKLA 2AWNA 1I50H 2BDOA 2I07B 4AYBG 4LF9L 4DV2L 2DY8A 1PZID 4GN5A 5CV6A 1S5BD 4CJ0B 1XMOQ 5AJ3Q 4HJ5A 4QMGA 4IPHA 4B9XA 2F0LA 1PFSA 4IJHA 1HNXQ 3SDZA 3AFQA 3S17B 4QGUA 4V190 1SE3A 5DM73 1SMXA 2PNHA 2KEDA 5LMUL 4G7HC 3SGIA 4A3BH 2ZJRA 1SNOA 4L8JA 1LTBD 2F0DA 5FLXE 1IW7D 1Y8PB 3R93A 3E9HA 3I73A 5TSSA 1WJJA 1D1IA 4L5SA 1E1OA 3NTKA 2DJGC 1Z9FA 4A3EH 3GTOB 4NXNL 2F0FA 1VQEA 5C3EG 1QZHA 3OHXC 1R9TB 1R4QB 4JI4L 4OGQC 3HOXB 1IW7C 1YEZA 1HHVA 1JE5A 1GUOA 1GVPA 2LXJA 3EJIA 3BU2A 5BR8Q 1HA5A 4PNYA 5GQOA 2CH4W 3FMCA 2WB1E 4IFDJ 2JA7B 1LYLA 2QEXA 2VZAA 4JI5Q 3Q8DA 1L1OB 3GTMB 1VDZA 4DUYQ 3C3LA 4BBRB 3W1GA 4KY6A 4OL7A 5C5MA 1D7QA 1AN8A 2L4NA 3EQLC 3OIPA 1PFBA 1KRTA 1JWUD 1STGA 5I2YA 4NXMQ 4IPGA 3MHBA 1A3TA 3TP8A 1JQYD 3QR8A 5C0XH 3L2PA 3KLSX 5IWAL 4DV5L 4KKUA 1ET9A 1B53A 3V05A 3RZDH 1H95A 4F87A 2Z4HA 1STHA 1UE1A 4DXFA 3NQTA 3S17H 1E7ZA 4QQBX 3H94A 2XIWA 1HA6A 1GD7A 3VR4A 4DAVA 1SSOA 4K0KL 4KKSA 3H3VC 2CQOA 4PZ6A 5CV8A 2QEJC 2E5LQ 4A3DB 2ZJPA 4FYDA 1X3GA 4LF4L 3FKIB 1X6OA 1B1ZA 2M2LA 1WTPA 4KI0A 2C5CA 2KHJA 1R9TH 1SLJA 4J15A 3SK8A 3HOXH 2OWOA 4AQYL 3S14B 3GD7A 3PMFA 5KNBA 2ZXOA 3DHQA 4MTKA 3TP6A 1IBLQ 1MKHA 4X62L 2SEBD 4IUPA 5KYIA 3K8AA 1G291 3J81j 2JA7H 1E2ZA 2SNSA 1L0WA 4XTCS 4YY3L 3MFYA 3EVQA 2RA4A 3GTMH 1C4QA 1L1OC 2F0JA 2L0CA 1F2MA 3M4YA 4BBRH 4LUZA 4XT3B 1YHBA 3I4NB 3B6YA 4YCVA 2N8NA 1KD1C 1U4MA 2K5NA 4DR2L 2JK8A 1TS4A 2FFKB 2MO1A 3K80C 1NMGA 1PRTB 2ICEC 1S5CD 5C4XB 2EYLA 2K28A 4FVMA 5C44B 5EKIA 2F0OA 2TMPA 4YHHL 2X6LA 1PH4A 4DV6L 2B63G 4X3SA 4TQUS 1VQ8A 5BN3A 1UEBA 3BDCA 3KLWA 3NQIA 1TIID 1HR0Q 1PH9A 1WTRA 5IP9G 4IO9A 2AUKA 2ZTEA 4UP9A 2RSNA 4JI2Q 1N33Q 1SBBB 4A3DH 2EVBA 1YBYA 4B3TQ 1TU2B 5GROA 1EFWA 4PG3A 3M7GA 4FXDA 3KUPA 4CKCA 1K8MA 1A3VA 4CDFC 2R92B 1N34L 1B2TA 1H9SB 5J3BA 4GKKL 2AQ3B 2CH4A 2G9DA 4KHZA 3LWEA 2R6GA 4GN3B 5CV4A 1FYCA 3L0OA 5C4ZA 2VW9A 2EYFA 3FPUB 3ND8A 1EWHA 1PRTD 4I7ZC 2Z8LA 3I4NH 1PH2A 4R4QA 4MN3A 3S1MB 1ZKOA 5IP7H 1WTVA 4LF7L 4X3UA 3TZDA 2Q8TA 3U9SA 5IT9L 1GUTA 4WORA 1PHJA 1PRTC 4APVA 4MZ9A 2CKZB 1F9RA 5ELEA 5C5LA 1M8AA 5IGEA 4QIWE 4LF5Q 1M1KC 1RTNA 2PCFB 3UDXA 3DEOA 3Q22A 2H5XA 1UWVA 2PQAA 3S24A 1KABA 3HOWB 3RLOA 4K8JA 4DR1Q 1PDQA 1TWGB 1UE6A 2OT2A 4HIDA 3RUZA 3MWYW 3OW7A 2HQLA 1WYDA 3E0EA 2K5WA 1NJIC 3CCEA 1CT1D 2H1EA 5IGCA 4A93B 3KJOA 1PZJD 1FVIA 3DM1A 4UP7A 2F03A 2E8GA 1D5MC 4LJZC 4DR6L 3P1HA 5A35A 4HSVA 3PQIA 1DCZA 1HR0W 2R92H 1KTKA 1Q3LA 3TSSA 4KK7A 4CGYB 1GJXA 4XDXA 4FP5D 2WB1B 1C0AA 2JA8B 5FO8B 2L55A 1VQPA 3DWQA 3EA6A 1W3SA 1HNZQ 5CV9A 4XYQA 3AB9A 1ZXTA 2FJ2A 2VL6A 1SMYD 2Z6KA 1EIYB 1U4LA 1KIXA 3S1MH 4L6TB 4A3IG 1BCPC 1CA6A 4JI0Q 4QUFA 4DPGA 1PYWD 4GLAC 1VQCA 2LS01 2F0IA 2VY3A 3H0GG 2VB3X 5I9OA 5M5YB 4ZKCB 1LTSD 1SMYC 5C4JH 4GZYC 1FR3A 1E22A 2LSSA 4AIMA 2QA4A 2UXCQ 5G3LD 4QJFA 1WD1A 4ZYSA 1MSGA 2L15A 2EJMA 3U9OA 4H13C 1PH6A 3GTKB 1SJED 2E2JB 2KA7A 3HOWH 4ODGA 3PIPA 2NTTA 1PH1A 1BNZA 1TWGH 2NBFA 2AKWB 1UE7A 1TXYA 1DOKA 2MUYA 3RD4A 5M9OA 4A93H 3AYHB 4RCOA 4G7ZC 3K5LA 4KY5A 5ELFA 4KHPL 1JC7A 1JR0D 3G6JB 2OQKA 5FLXL 5EPKA 5HY6A 1GHKA 5DNFA 1SYCA 5DEHA 4FXGC 5JAVA 1MHWC 1EQRA 2D0OA 1XMOL 5AJ3L 4RG1A 1TWFB 2JA8H 3SR1A 3D4WA 1YHAA 1XX8A 5T1IA 3CPWA 4CJ1B 1G91A 1EEID 5BN5A 4RGTA 1YITA 1FGBD 2R7ZG 2B8GA 4CKEA 4LMQD 4DK0A 1Q12A 2CVRA 4OONA 5C3WA 4AQYQ 2TSSA 1SRUA 2SDFA 1JOKA 4C3IH 2QDBA 5E7NA 5M5YH 4OX9Q 4FDBA 1V1PA 5I4DA 2Z6KC 3DUZA 3F8TA 1Y14B 2QILA 3VR6A 2F0TA 2EJFC 3A7AB 4BY1G 1EIGA 2F0EA 4GKJL 4KD3A 2J7ZA 2E2JH 5BR8L 3HOZB 4JBWA 5ELBA 1YHQA 1V1PB 3GV6A 1JCKB 3H3VI 3IFDA 3NTHA 3AU7A 1Y1WG 4QCLA 5JJKA 2B2YA 1EYAA 2EE1A 4JI5L 2I5MX 1CTMA 4DUYL 3A0JA 4A3JB 1EY7A 1MBYA 3F2BA 1EY6A 3R2TA 3J80c 2UUAQ 4JG2A 2EYOA 1FD7D 1Y8NB 2FHTA 4DV6Q 1K8AC 4LFCL 1LTID 4NXML 1B3QA 4A3KG 2IX1A 1SAPA 1SFOB 4RCNA 2IWHA 4A3MB 3TEHB 2GVBA 1G6ZA 3T56B 3VR3A 1NMFA 1KQSA 1FGUA 3BVZA 1TWFH 2VUMG 3E9IA 5ELCA 1X9NA 3I4LA 2D2CC 3HRZC 1STEA 2WFWA 4QF4A 3F2DA 1SE4A 4K2KA 4C1NK 4A3FB 3KDFB 2F0PA 4AH6A 5ELNA 4BWGB 3BG3A 5LL6S 4DV4Q 1V9PA 1XTCD 3Q0AA 2E5LL 1BDOA 4YWKA 2B2UA 3HOVG 1CUKA 3CMEA 4C3JB 3QOLA 2WAQG 2E2IB 1SXTA 1X55A 3AEVA 2WKCA 2FMMA 2L9HA 1E2VA 4GOPB 4K6DA 4QIWB 5KGUA 3MFGA 2UUCQ 3T1HQ 2RKSA 4ZUJA 3U50C 1R4PB 1EL0A 4LF7Q 2JA5B 1IBLL 1OXUA 1CA5A 3S1RB 1K0SA 1BXTA 4ID6A 1KC8C 1LV9A 3D0FA 3J7A5 5K36G 4U673 2NVTB 3V2TA 4A3JH 4EQNA 4X64Q 1Q1BA 4R4IA 1Q7YC 1EWCA 2D0PA 1QJOA 1SFOH 1IKMA 1S4ZA 3PUXA 5IYDH 1GUGA 3FKIG 3OOCA 5CV5A 1JOOA 2KHIA 3J7AF 3PO3G 1HTLD 1K28A 3BVGA 5KRUA 2PZWA 4JI6Q 1Q46A 1DXMA 3K5NA 1Q1EA 4L63B 4X65Q 3ULPA 3HOYG 1I50B 3HKZE 3JAMc 2UXBQ 5LHY1 2PPBC 4KD4A 1HR0L 3TDQA 4RGMA 3BVMA 3T16A 4KV6A 3TMEA 1RODA 4JI2L 1N33L 1VQAA 1SYBA 4K2LA 4C3JH 4RH6A 4B3TL 2E2IH 5EBDA 2F52A 1Y1VB 3I72A 3CD6A 2KECA 2MO0A 4K8IA 4RAUC 1B4OA 5CGKA 3RNUA 4GOPC 3KF6A 1DOMA 3ULLA 1SJHD 3C1EA 5C4XG 1QWYA 5C44G 4RGNA 2B2UC 2PW5A 3I90A 3S1RH 1PLFA 2K6AA 2PYKA 1XNRQ 1O7YA 2RSOA 1AFPA 3KF6B 1QNUA 1X3QA 1LLRD 1Y69U 5JVG3 2NVTH 4PMCA 1DJRD 5FJ8G 1U0LA 1STYA 3BYTB 5C6AA 3MAQA 1VQ6A 3DWAA 1D2BA 3DMUA 1O80A 1Q81C 4FF3A 3KYHC 1VF5C 3TQYA 1I4GA 1A62A 2RHSB 1I4RA 1JB7A 5JJIA 4A3CG 5J39A 1CQVA 3ERSX 2I0QA 2AQ2B 1SROA 5D14A 1GHJA 4R4TA 3M3YB 4LF5L 3EROA 3PV0A 4DR7Q 3E0JA 4RWSC 3M4OB 1HRJA 4XQNA 2K5VA 4JI3Q 3K5OA 1VQKA 5KEEA 4DR1L 5A2QE 3A8KE 5EBCA 4DNIA 3D6WA 2O5IC 3NP8A 3D6CA 3NBIA 4JI1Q 4AYBE 1WI5A 1QE6A 2N3SA 1DGSA 3M9BA 4K14A 1EQTA 1OXSC 4DV0Q 1YIJA 3RZDB 3D8GA 2A8VA 1DOLA 4UDUC 4Z9CB 3HKSA 2KBNA 2JSOA 1QNKA 4P74A 3I91A 4XT1B 5HGTA 1Y1VH 3NXWA 2Z6BA 4OO1I 3SK5A 4NP5A 3CQZH 2IW3A 2A19A 2Q8RE 1L2FA 2OQ0A 1RKNA 4X66L 3NENA 2RF4A 1S5ED 4OO1G 2LFNA 3OMGA 3GP7A 4JV5Q 3RZOH 1HNZL 2FINB 2V1CC 1W6KA 1PVOA 2KHSA 3HOUG 3FDTA 4FF4A 3KLRA 2OTLA 1L1OA 2D62A 5E4WC 3KBGA 2JA6B 1D5ZC 4GKJQ 4JI0L 4KN7C 3T51B 2MHVA 1CM9A 3RLFA 1EIHA 2IT1A 4GNXA 4G7OC 1WVLA 1XNQQ 4ZRZA 1H9RA 2UXCL 1NNXA 3I4MH 1ET6A 1EIFA 3M3YH 3J80E 2D5DA 4DGZA 3CCSA 2DY7A 2KENA 3PCOB 4GNXB 3M4OH 4HIMA 3NE5B 4LFCQ 2HIXA 4I65A 3G4SA 1EQVA 1F9PA 4BXXH 2B2VA 2JE6I 4KJOA 3FEWX 3A74A 5EKLA 2N49A 4HSPA 4OIJA 2X6GA 2IPKD 2JN4A 2WIIB 1B9NA 1F2ZA 1RF2D 5ELDA 1ILPA 2B3GA 2WKDA 3AQQA 2D9UA 3N52A 3PIOA 2K33A 3NTIA 2ZM6Q 4WJ4A 4V0BA 1FNVA 3M7NA 1BBUA 5GAGC 1QUQA 1IZ6A 2KOLA 1D5XC 4NPSA 3S2HB 2LKVA 1LABA 2F0UA 4DK3C 5IOCA 4GLXA 5M3FB 3ER0A 3IL8A 2Q8IB 1J6QA 4YIJA 1CHPD 2F3VA 4P75A 2CQAA 4A76A 1TS2A 4RKLA 2JYOA 1QUQB 3OIQA 1VQOA 3NWSA 1EUJA 4OWTB 1PH8A 2JA6H 1ICWA 4BY7G 4TSSA 5EGTA 3H09A 3A8IE 3G6EA 4OX9L 4A3KH 4CBVA 3BZCA 4P73A 4HIOA 1LUZA 2MFIA 1PA6A 4LFBQ 1RDPD 1TS5A 1LTTD 2NZHA 4POGA 3ERQA 4DFAA 4WJWA 3BYYB 4GNXC 1AE3A 4KLKA 4R8IA 3HKZB 1IXRA 1DD2A 3TZUA 2OCEA 1EU4A 1WTWA 4IJLA 1ONLA 5F2DA 4LNQA 3IAYA 1K8GA 1M4VA 3TRZA 4HTHA 2UUAL 2JQOA 1E24A 4DV1Q 3HOVH 4ZAIA 2B2VC 4J1MA 3OTOQ 3UDGA 2CW0D 4DV7Q 1SE8A 4C3HH 5JEAG 1EYDA 3S2HH 2K04A 1WCMH 1MI2A 1BR9A 1KLUD 4HCEA 5M3FH 2PZTA 2E75C 2EY5A 3T1YQ 2WINB 2Z4IA 2CW0C 1HZ9A 5IYCH 1H9SA 4A3GG 3HOZG 3OMCA 4FF1A 1GO3E 3CRKC 1TWAB 4J6HA 1ENAA 5EPLA 5GAHC 3SVMA 4IZ8A 3BZKA 3J7ZC 4DV4L 3PO2B 3H15A 2EY1A 1KNAA 4K5VA 1HZBA 1N8RC 3NPPA 2HQEA 2AHOB 2DUDA 3VA5A 5FLMG 2R93G 4F8MA 2UUCL 3T1HL 4A3MG 5IGDA 5IY0A 1YNJD 4H0LC 2UU9Q 4HAEA 3E6ZX 1WTXA 1XPOA 1A3UA 1SR3A 3RLNA 1FNUA 3WDNA 5C4JB 4AYBB 4RA8A 1VQNA 3CCRA 3PUWA 2H4OA 2F4VQ 1YNJC 2O4XA 5JEAJ 2X69A 1VS0A 1P8LA 1HUMA 1II3A 4A3FG 1DONA 4X64L 4DUZQ 1C8CA 3F2UA 3L3OC 1S5DD 3PIO3 3ZYYX 3OWFA 1QVGA 4IUNA 2HHHL 1U4PA 3K6OA 2NN6I 3URYA 2QCPX 3Q23A 2E76C 3M85A 1BOSA 4JK1C 4A3LH 1RIPA 1AH9A 2KCNA 2HDMA 3ND9A 1MJCA 1ZEQX 1J9OA 1JMCA 1VQGA 3LWUA 2Z1CA 3IFTA 4HR7B 4JI6L 2JA5G 1S72A 2NN6G 1VQFA 1WOCA 4X65L 2EY2A 1EYGA 2F0KA 5I6YA 3F1ZA 3K7AB 3CW2C 2UXBL 1TWAH 5D65A 2RDGA 1LT5D 2BH2A 1JICA 4LF6Q 2K1BA 2JP1A 3PO2H 2F0SA 4X66Q 2K01A 4KJNA 4OIKA 1O7ZA 4RKBA 3SE0A 3MXPA 3R2IA 3Q6SA 2JEBI 4MNOA 3GTJB 3C2PA 5I2XA 1HUNA 4PZ8A 3PUZA 2L5TA 2NVQH 4X6AH 4EVOA 2K5DA 1D1KA 2EDGA 4IFDH 1L0XB 4DU9A 2YYZA 3S16H 4C3IB 1TT2A 1X32A 1XNRL 3GQBA 4LWCA 2UUBQ 1IYUA 3CCVA 1YZ6A 2AWOA 2ES2A 1B8AA 5A2QL 5KIXA 2SNMA 3E5SA 3A5UA 3D3RA 1RHPA 2A73B 1HH2P 1GOZA 3NELA 5M3MG 2F4IA 3QJYA 4ME5A 4JI7Q 2K05A 1EY4A 4LW1A 3J80i 4ULLA 2Y0SG 4DR7L 4A3BG 3W1BA 1W6JA 1DM0B 2F0QA 2IHEA 4JI3L 1BKBA 2SOBA 2K5HA 3J81i 4KTAA 5EPJA 1ESFA 3K7AH 3A55A 5C3EH 4JI1L 2EZVA 1BQQT 4A3EG 4E6IA 1PFMA 4HN7A 1OXTA 1B7YB 1VQLA 2BCOA 1KHIA 4DV0L 1W2BA 1NSNS 4OWWB 4CJ2C 1HZCA 3A7LA 1TY0A 3GTJH 4BBSG 3CC7A 1I6HB 5E4XA 3WWVA 3I70A 1FNWA 1RTOA 1VF7A 1VQJA 2EJGC 1I4HA 4KHVA 3T53B 5BN4A 3S2DH 5C0XI 1N9WA 3DWPA 3J80L 3FP9A 5IIFA 2MGSA 2NWGA 3D31A 4JV5L 1I94Q 4ME3A 2A1AA 1SE2A 2HT1A 3K5MA 2NTSA 2Z9HA 5ISRA 4B08A 4NMZA 3K0XA 1CI3M 1XWEA 3U4ZA 5C0XG 4B3SQ 4QL5A 3K7UC 1KDBA 3JC66 3OPOA 1K3BC 3DM3A 4JC0A 5JOBA 3U4VA 2B63B 1H9JA 2VXWA 4DK1A 1XNQL 1U5KA 2K5QA 3HEJA 3G71A 1IYVA 4CDDC 1VQBA 1PYSB 4RMFA 3J7AV 4YCWA 1EOVA 4PV1C 2C9OA 4ZLTF 1QILA 1G2TA 5NUCA 3J81c 2EYMA 5JJLA 1RD9D 2GA4B 3CC4A 2I46A 1JT8A 1LTRD 3G7LA 5I6WA 1EYCA 3HOXG 3KDFA 2B29A 4JW0A 4JBMA 2OXPA 2IL8A 1WTHA 2KCTA 2ZM6L 2FXQA 3JAMi 5KYLA 3OW2A 1HCZA 2KUMA 1I6HH 2JA7G 4ZK9B 4U68A 1J8IA 2Q2IA 2XN9C 3LX0A 2UXDQ 1PFNA 3W2DA 1Z6HA 4IN3A 4GOPA 1EQQA 3OYYA 4BBRG 4IUUA 3SXHA 5FO7B 1F9SA 5C0XJ 1O7IA 5AFWA 2KCCA 2F0HA 5L37A 3F2CA 1HXYD 1K9MC 4B3RQ 2YU9B 2EOTA 4JPBW 2K52A 2WV6D 4M8AA 4DK6C 3ITPA 2IJ0A 3J7YW 2HD3A 2YTVA 3MZ5A 2PNRC 1YJWA 1SNQA 2B63H 4DV3Q 1A15A 4JYAQ 1NTGA 2EQSA 1GXDC 1YI2A 1MGSA 4Q5VA 1BF4A 4JBKA 1A8VA 2CWAA 4H44C 1A63A 1IL2A 3JAML 3NSWA 1J5EQ 4IOAA 4LFBL 2RVLA 5IP9H 2ZJQA 1TWCH 1JWSD 1BBWA 2NVYB 2DJFC 2EIFA 2N55A 2OF1A 2HHHQ 5LL6X 3GTGB 1JWMD 4A3DG 3C1FA 1SNDA 1DYQA 2QF7A 4DR4Q 4PMBA 4BA1I 3VDYA 4KY7A 1A2UA 2F1MA 5EQ0A 4DV1L 3H6MA 2XVSA 4ZKBB 3VA7A 5E1FA 3OTOL 2A6HD 2E74C 3TBIB 4LUVA 3BDOA 4DV7L 1YJNA 3VYSA 1ICFB 5CMDA 3ICEA 1Q8IA 3CKIB 1LTGD 4DAYA 1LM0A 4JVZA 4FNFA 3I4NG 3T1YL 2A6HC 5IP7G 4LF8L 2V4DA 1H9KA 1CFMA 3CQZB 1OTCA 4DAYB 2YU9H 4EQPA 1JJ2A 3CAMA 2VQEQ 1EY8A 1MJEA 1VMPA 1RCVD 4TVAB 1QCBD 2ZT9C 1KAWA 1UE5A 3RZOB 1XTDA 2AQ1B 1CKNB 4YCUA 1EY0A 4Y52H 3HS0C 4I7AA 1ASYA 4R4OA 3ULJA 3HP3A 3MXNA 3FPPA 2BH8A 2M00A 1ASZA 2L11A 1IKLA 2UU9L 2NVYH 4BS9A 1KL9A 1XMQQ 1Q90A 4H7BA 3QO2A 3GTGH 4DNRB 3K58A 1Z47A 1IBKQ 4RFBA 3R8BA 5CBEE 4FF2A 1HZAA 3MXNB 3I4MB 2XTIA 4LUOA 1Q82C 2F4VL 1I6VC 1IBMQ 4L5RC 2LXKA 2HCCA 5C3XA 1A0IA 1T5XD 2R92G 1C48A 4ABNA 1HNWQ 5COYA 4DUZL 1I4PA 2XWBB 4HJ7A 1EOTA 3RR5A 4XXEA 2RCNA 5IYBG 1STBA 2NZ1D 2K32A 1E3PA 4YWLA 4N9TA 1I4XA 4QB4A 4A3IH 2K03A 5H1SE 1HPCA 3H0GH 5HGQA 4KKTA 4O42A 3GTLB 1Z7TA 5DLQE 1S3OA 2Z0SA 4A4IA 4UAIA 3I56A 2GN5A 3TP5A 2CCZA 4UHVA 2K50A 4CDCC 2QKIC 1K73C 2KEEA 3M4PA 1V8QA 3SHLA 5DM63 3S1QB 3S15B 4BY1B 3STBD 2KVMA 4LF6L 2PMZE 3EFXD 3QG1A 1FL0A 1MIUA 4Q0FA 4B3MQ 3O13A 1JOQA 4DR3Q 1TY2A 1EY9A 2RBMA 1Y1WB 1CSPA 5M3MH 5CV7A 3HOWG 1OXXK 2VQFQ 3N6RA 1CZWA 2PZUA 3STBC 1LACA 4LFAQ 1DZ1A 2EYJA 1E0BA 3T4AC 2HDLA 2O2LD 1A2TA 1G51A 2N88A 3DXJC 3HGBA 4A3KB 2UUBL 3I4OA 4OXPA 2K75A 2B39A 4A93G 2F0WA 1S5FD 4OEMB 1SEBD 1B70B 1B50A 3PF5A 4N8FA 1LTLA 2VUMB 2A74C 3CU7A 2VB2X 2WB1G 1GUSA 1GM5A 3J81E 4IUVA 2JA8G 4BBSH 2YV5A 2XRQD 2R7ZH 1SYEA 4NB3A 1F2LA 4J8QA 4JI7L 1XPUA 1XYIA 1CSQA 5M5XH 1U9RA 3GTLH 1KNEA 1MD2D 3HOVB 2WAQB 1WTOA 1D6EC 1XPRA 2M9VA 3VYUA 1E2WA 4C3IG 1V1QA 3CMAA 1A6XA 1FJGQ 1RJTA 5IGGA 4C3HB 1VQHA 1TS3A 5IODA 3S15H 3S1QH 3CF5A 4BY1H 4DXGA 1T5EA 1WCMB 3KF8A 1AZQA 3E3XA 2BA0A 4R9WA 4IPDA 4XIGS 1X3FA 4K5XA 1PV4A 4JCVE 1Y1WH 3RN2A 1WFQA 4QY7A 3FVQA 3GV3A 3KF8B 3A54A 5CBAE 3X3NA 5CYUA 3CCUA 3CPFA 2J4XA 3H3VH 1WD0A 2QW7A 4JBJA 3V96A 4WRDA 2EYHA 2F0MA 2XSCA 2KCMA 1I94L 2HCIA 2QDLA 5CORA 3BJUA 4O1NA 5CC4A 3BS1A 1PTOF 3GTOH 4OHJA 3PO3B 4B3SL 4L5TA 2VUMH 1EEFD 1VCIA 2AUJD 1UUPA 1X54A 4GLVB 1VQDA 1TVXA 5GADC 4NDXA 3MC0B 3HOYB 2RHQB 1PZKD 1ML0D 1BBXC 2VNUD 4F88A 3PF4A 3W3AA 2ZXRA 1SN8A 4CKBA 1KXLA 1STNA 3NK9A 4XQQA 1NE3A 1EZ6A 1UAPA 1SNCA 2B2WA 2JXMB 4UP8A 4POFA 3JAME 1SYGA 3EN2A 1N36Q 1K3RA 1TWHB 3S1NB 5LMNQ 3KOJA 4FO2A 3I2ZA
chains in the Genus database with same CATH topology
1KAAA 3L9AX 5EKKA 4IUQA 5J1ZA 3MXUA 5K36H 4NW2A 3VR5A 3GTPB 3K0YA 1IHZA 1BUVT 1HQRD 1I3QB 3WOEA 2NVQB 2EXZA 2OEOA 2ID0A 3QB3A 1V43A 1G8ZD 1O7LA 3S16B 2PQEA 1GUWA 1YNND 3FRPB 1X3PA 1TKWB 3X3MA 4DN4M 1CK1A 2F3WA 5JPMC 1BCPB 1L0YB 3VYRA 1QOHA 1YNNC 4IUTA 2DN8A 4DAPA 5M5WB 4C3JG 2G9HD 3GO5A 3T13A 1JB3A 2PMZB 4TKOB 1XXGA 2XNAC 2B2WC 1KDAA 1IL8A 3MEHA 3MVVA 3NWTA 1NR4A 2PO4A 1AP0A 3BDLA 4ILWA 2WACA 3HOUB 5C3EB 4C1NI 4C2MB 1SYFA 1NUCA 4CHTB 5K5PA 3SEBA 1PMRA 1B3AA 3MXGA 3CHBD 2F0GA 2XWJB 2HUGA 1EFID 2A68D 3R3OA 4X3TA 4EQOA 1MSHA 1CHQD 3S2DB 4MIUA 3BZDB 1QG7A 2BOSA 1BCPD 2A69D 2NB0A 2XRSD 2ICIA 2A68C 2BA1A 4DA2A 5FOBB 1OO9B 1TQOA 3GTQB 2A69C 1NCVA 5D3IB 3IKJA 4EGVA 3Q24A 5J22A 5HURA 2KQ3A 3QWNA 4P2CB 3HZXA 4OO1H 2NYZD 3VR2A 1AZPA 5EJWA 1LT4D 1PXUA 4BY7B 2E2HB 3L7ZC 3C46A 4FXKC 2K7VA 3KBXA 2F0NA 1O78A 1EZ8A 1F2YA 2PW7A 5FKAC 2JEAI 2B8FA 5JVH3 1LO5D 1AW7A 3LNNA 4R8NA 4K6LA 3D4RA 1JE4A 1NR2A 1LTAD 1AEXA 1HTPA 3DEPA 1BO0A 5D3DA 3RMHA 4M1UB 1SNPA 4HMJA 1Y8OB 3AMUA 1VMCA 3PUYA 1UEAB 1CZGA 3J81L 2CHBD 2NUCA 3HG9A 4IALA 4PMWA 2IX3A 2KJXA 2O5JC 5DAUA 1U4RA 2DNCA 2RQXA 4WFN3 1SYDA 3P75A 3UI2A 3VYTA 1B44D 4KMUC 3A56A 1TWCB 4F7XA 1B9MA 4A3GB 3CRLC 1KDCA 4S3SA 2L12A 2MJ8A 4XYOA 1SDFA 2ZXPA 3OWEB 4HCSA 1LT3D 4IURA 4K5WA 3TP7A 4G4KA 2L1BA 3S9WA 2B2TA 3SK4A 1PRTF 1UNSA 1EU3A 2R93B 1LT6D 3NBHA 4MHEA 5KNDA 4DF7A 1CQFA 4TRDA 1ESRA 1HFGA 1TR5A 1HFNA 3QOJA 4B9WA 5E3FA 1JORA 1PTOB 4XQJA 5KNCA 3TN2A 2MP1A 2J0TD 3NHHA 1NAPA 2R3ZA 4RHRA 1OXVA 1WTQA 4Y7NB 5JEAH 4IQZA 2LMCB 2EPBA 3MA2B 4C3HG 4ZUIA 5IGBA 4QUCA 1HQMC 3PUVA 4KN4C 4PQXA 3SK6A 3K57A 5JJZA 3KLSA 5T1GA 1STAA 1F9QA 3PIP3 2BE5D 1EY5A 1H9MA 2R61A 1BCPF 1K83B 4LK1C 2IX0A 1GUNA 1ENFA 5FO9B 3P7JA 2B2YC 4RGOS 2E2DC 2BE5C 3KK7A 5I9PA 3D4DA 3P20A 3I3CA 4G57A 3QIAA 2RDHA 4A3IB 3I8ZA 2DNEA 1SNMA 1ZYRD 1PTOD 3H91A 2LY7A 3H0GB 5IT9E 2NVXB 2A6ED 1ILQA 2B2TC 5G3LF 2WP8J 1PTOH 2EYPA 5JPNC 1ZYRC 1PTOC 3OSOA 5IGFA 2MPMA 2A5HA 2A6EC 5M3MB 5FK9C 1I4QA 5C4HA 1QB5D 4DNTB 1G2SA 5CR3A 2FMCA 2Y0SB 1ENCA 3K59A 3NUCA 4A3BB 2NN6H 3MTSA 2EY6A 4HMIA 4A3EB 2ENBA 1F77A 3A8JE 4X3KA 1KLGD 2F0VA 4ZQ3A 4C56C 4BBSB 2R7ZB 1K8OA 4IFDI 4RHSA 4HEDA 2RDFA 4LAAA 5M5XB 3ONAB 4BA2I 4N9PA 3WOFA 4IFDG 2BDNA 1V1OA 4NKLA 2AWNA 2BDOA 2I07B 2DY8A 1PZID 5CV6A 1S5BD 4CJ0B 4QMGA 4B9XA 2F0LA 3SDZA 3S17B 4V190 1SE3A 5DM73 2KEDA 4G7HC 1SNOA 4L8JA 1LTBD 2F0DA 5FLXE 1IW7D 1Y8PB 3R93A 3I73A 5TSSA 1D1IA 3NTKA 3GTOB 2F0FA 3OHXC 1R9TB 1R4QB 4OGQC 3HOXB 1IW7C 1HHVA 1GUOA 3EJIA 1HA5A 4PNYA 3FMCA 4IFDJ 2JA7B 3GTMB 1VDZA 3C3LA 4BBRB 4KY6A 4OL7A 5C5MA 1AN8A 2L4NA 3EQLC 3OIPA 1PFBA 1JWUD 1STGA 5I2YA 3MHBA 1A3TA 3TP8A 1JQYD 5C0XH 3KLSX 4KKUA 1ET9A 1B53A 3V05A 4F87A 2Z4HA 1STHA 4DXFA 3NQTA 3H94A 2XIWA 1HA6A 3VR4A 4DAVA 1SSOA 4KKSA 3H3VC 5CV8A 2QEJC 4A3DB 4FYDA 3FKIB 1B1ZA 2M2LA 1WTPA 4KI0A 2C5CA 3SK8A 3S14B 3GD7A 3PMFA 5KNBA 2ZXOA 3DHQA 3TP6A 2SEBD 4IUPA 5KYIA 1G291 1E2ZA 2SNSA 4XTCS 3MFYA 3EVQA 2RA4A 1C4QA 2L0CA 2F0JA 1F2MA 3M4YA 4XT3B 3I4NB 1U4MA 1TS4A 2FFKB 1PRTB 2ICEC 1S5CD 5C4XB 2EYLA 2K28A 4FVMA 5C44B 5EKIA 2F0OA 2TMPA 2X6LA 4X3SA 4TQUS 5BN3A 3BDCA 3NQIA 1TIID 1WTRA 2AUKA 2RSNA 1SBBB 2EVBA 1TU2B 3M7GA 4FXDA 3KUPA 4CKCA 1K8MA 1A3VA 2R92B 1B2TA 1H9SB 2AQ3B 2G9DA 4KHZA 3LWEA 2R6GA 5CV4A 1FYCA 5C4ZA 2EYFA 3FPUB 3ND8A 1EWHA 1PRTD 4I7ZC 2Z8LA 4MN3A 3S1MB 1ZKOA 1WTVA 4X3UA 3TZDA 2Q8TA 3U9SA 5IT9L 1GUTA 4WORA 1PRTC 1F9RA 5ELEA 5C5LA 1M8AA 5IGEA 1RTNA 2PCFB 3DEOA 3Q22A 1KABA 3HOWB 4K8JA 1PDQA 1TWGB 2OT2A 3RUZA 3MWYW 3OW7A 2K5WA 1CT1D 2H1EA 5IGCA 4A93B 1PZJD 3DM1A 2F03A 1D5MC 4LJZC 3P1HA 5A35A 4HSVA 1DCZA 1KTKA 1Q3LA 3TSSA 4KK7A 4CGYB 1GJXA 4XDXA 4FP5D 2WB1B 2JA8B 5FO8B 2L55A 3DWQA 3EA6A 5CV9A 4XYQA 3AB9A 1ZXTA 2FJ2A 1SMYD 1U4LA 4L6TB 1BCPC 1CA6A 4QUFA 1PYWD 2LS01 2F0IA 2VB3X 5I9OA 5M5YB 4ZKCB 1LTSD 1SMYC 4GZYC 1FR3A 5G3LD 1WD1A 4ZYSA 1MSGA 2EJMA 3U9OA 4H13C 3GTKB 1SJED 2E2JB 2KA7A 4ODGA 2NTTA 1BNZA 2NBFA 1DOKA 2MUYA 3RD4A 5M9OA 4RCOA 4G7ZC 3K5LA 4KY5A 5ELFA 1JC7A 1JR0D 3G6JB 5FLXL 5EPKA 1GHKA 5DNFA 1SYCA 5DEHA 4FXGC 5JAVA 1TWFB 3SR1A 3D4WA 1XX8A 5T1IA 4CJ1B 1G91A 1EEID 5BN5A 4RGTA 1FGBD 2B8GA 4CKEA 4LMQD 4DK0A 1Q12A 2CVRA 5C3WA 2TSSA 2SDFA 1JOKA 2QDBA 1V1PA 5I4DA 3DUZA 2QILA 3VR6A 2F0TA 2EJFC 3A7AB 1EIGA 2F0EA 4KD3A 2J7ZA 3HOZB 4JBWA 5ELBA 1V1PB 3GV6A 1JCKB 3IFDA 3NTHA 3AU7A 4QCLA 2B2YA 1EYAA 2EE1A 1CTMA 4A3JB 1EY7A 1MBYA 1EY6A 3R2TA 2EYOA 1FD7D 1Y8NB 2FHTA 1LTID 2IX1A 1SAPA 1SFOB 4RCNA 2IWHA 4A3MB 1G6ZA 3T56B 3VR3A 3BVZA 5ELCA 3I4LA 2D2CC 3HRZC 1STEA 4QF4A 1SE4A 4K2KA 4C1NK 4A3FB 2F0PA 4BWGB 3BG3A 5LL6S 1XTCD 3Q0AA 1BDOA 2B2UA 4C3JB 3QOLA 2E2IB 1SXTA 2WKCA 2FMMA 2L9HA 1E2VA 4K6DA 4QIWB 5KGUA 3MFGA 2RKSA 4ZUJA 1R4PB 1EL0A 2JA5B 1OXUA 1CA5A 3S1RB 1BXTA 4ID6A 1LV9A 5K36G 4U673 2NVTB 3V2TA 4EQNA 1Q1BA 1EWCA 1QJOA 1IKMA 1S4ZA 3PUXA 1GUGA 3OOCA 5CV5A 1JOOA 3J7AF 1HTLD 3BVGA 5KRUA 2PZWA 1DXMA 3K5NA 1Q1EA 4L63B 1I50B 5LHY1 2PPBC 4KD4A 3TDQA 4RGMA 3BVMA 3T16A 4KV6A 3TMEA 1RODA 1SYBA 4K2LA 4RH6A 5EBDA 1Y1VB 3I72A 2KECA 4K8IA 4RAUC 1B4OA 5CGKA 1DOMA 1SJHD 3C1EA 1QWYA 4RGNA 2B2UC 2PW5A 3I90A 1PLFA 2K6AA 2PYKA 1O7YA 2RSOA 1AFPA 1QNUA 1X3QA 1LLRD 1Y69U 5JVG3 4PMCA 1DJRD 1STYA 3BYTB 5C6AA 3MAQA 3DWAA 1D2BA 3DMUA 1O80A 4FF3A 1VF5C 1I4GA 1I4RA 5J39A 1CQVA 2AQ2B 5D14A 1GHJA 3M3YB 3EROA 3PV0A 3E0JA 4RWSC 3M4OB 1HRJA 4XQNA 3K5OA 5KEEA 5A2QE 3A8KE 5EBCA 3D6WA 2O5IC 3NP8A 3D6CA 3NBIA 1QE6A 4K14A 1EQTA 1OXSC 3RZDB 3D8GA 1DOLA 4UDUC 4Z9CB 2JSOA 1QNKA 4XT1B 3I91A 5HGTA 3NXWA 4OO1I 3SK5A 4NP5A 2IW3A 2Q8RE 1RKNA 1S5ED 4OO1G 2LFNA 3OMGA 3GP7A 2FINB 1W6KA 2KHSA 3FDTA 4FF4A 3KLRA 2D62A 5E4WC 3KBGA 2JA6B 1D5ZC 4KN7C 3T51B 2MHVA 1CM9A 3RLFA 1EIHA 2IT1A 4G7OC 1WVLA 4ZRZA 1H9RA 1ET6A 3J80E 2D5DA 4DGZA 2DY7A 3NE5B 4I65A 1EQVA 1F9PA 2B2VA 2JE6I 4KJOA 3FEWX 5EKLA 4HSPA 4OIJA 2X6GA 2IPKD 2WIIB 1B9NA 1F2ZA 1RF2D 5ELDA 1ILPA 2WKDA 3N52A 2D9UA 2K33A 3NTIA 4V0BA 1FNVA 3M7NA 2KOLA 1D5XC 3S2HB 2LKVA 1LABA 2F0UA 5IOCA 5M3FB 3IL8A 2Q8IB 4YIJA 1CHPD 2F3VA 2CQAA 1TS2A 4RKLA 2JYOA 3OIQA 3NWSA 1ICWA 4TSSA 5EGTA 3H09A 3A8IE 4CBVA 1RDPD 1TS5A 1LTTD 3ERQA 4DFAA 4WJWA 3BYYB 4R8IA 3HKZB 1DD2A 3TZUA 1EU4A 1WTWA 1ONLA 5F2DA 3IAYA 1M4VA 4HTHA 4ZAIA 2B2VC 4J1MA 2CW0D 5JEAG 1EYDA 2K04A 1MI2A 1BR9A 1KLUD 4HCEA 2PZTA 2E75C 2EY5A 2WINB 2Z4IA 2CW0C 1H9SA 3OMCA 4FF1A 3CRKC 1TWAB 4J6HA 1ENAA 5EPLA 3SVMA 4IZ8A 3PO2B 2EY1A 1KNAA 4K5VA 3NPPA 2HQEA 3VA5A 4F8MA 5IGDA 1YNJD 4H0LC 4HAEA 3E6ZX 1WTXA 1A3UA 1FNUA 3WDNA 5C4JB 4AYBB 4RA8A 3PUWA 2H4OA 1YNJC 2O4XA 5JEAJ 2X69A 1HUMA 1II3A 1DONA 1C8CA 3F2UA 3L3OC 1S5DD 3PIO3 3ZYYX 3OWFA 4IUNA 1U4PA 3K6OA 2NN6I 3URYA 2QCPX 3Q23A 2E76C 3M85A 1BOSA 4JK1C 2KCNA 2HDMA 3ND9A 1ZEQX 1J9OA 3LWUA 2Z1CA 3IFTA 4HR7B 2NN6G 2EY2A 2F0KA 5I6YA 3K7AB 5D65A 2RDGA 1LT5D 1JICA 2K1BA 2JP1A 2F0SA 2K01A 4KJNA 4OIKA 1O7ZA 4RKBA 3SE0A 3MXPA 3R2IA 3Q6SA 2JEBI 3GTJB 3C2PA 5I2XA 1HUNA 3PUZA 2L5TA 4EVOA 2K5DA 1D1KA 2EDGA 4IFDH 1L0XB 4DU9A 2YYZA 4C3IB 1TT2A 1X32A 3GQBA 1IYUA 2AWOA 5A2QL 5KIXA 2SNMA 3E5SA 3D3RA 1RHPA 2A73B 1GOZA 2F4IA 3QJYA 4ME5A 2K05A 1EY4A 4ULLA 1W6JA 1DM0B 2F0QA 2SOBA 4KTAA 5EPJA 1ESFA 3A55A 2EZVA 1BQQT 4E6IA 1PFMA 4HN7A 1OXTA 2BCOA 1NSNS 4CJ2C 3A7LA 1TY0A 1I6HB 5E4XA 3I70A 1FNWA 1RTOA 1VF7A 2EJGC 1I4HA 4KHVA 3T53B 5BN4A 5C0XI 3DWPA 3J80L 5IIFA 2MGSA 2NWGA 3D31A 1SE2A 3K5MA 2NTSA 5ISRA 4B08A 4NMZA 1CI3M 1XWEA 5C0XG 1KDBA 3OPOA 5JOBA 2B63B 1H9JA 2VXWA 4DK1A 2K5QA 3HEJA 1IYVA 3J7AV 4PV1C 2C9OA 4ZLTF 1QILA 1G2TA 5NUCA 2EYMA 1RD9D 2GA4B 2I46A 1LTRD 3G7LA 5I6WA 1EYCA 2OXPA 2IL8A 5KYLA 1HCZA 2KUMA 4ZK9B 4U68A 1J8IA 2XN9C 3LX0A 1PFNA 3W2DA 1Z6HA 4IN3A 4IUUA 3SXHA 5FO7B 1F9SA 5C0XJ 5AFWA 2KCCA 2F0HA 1HXYD 2YU9B 2EOTA 2WV6D 4M8AA 3ITPA 2IJ0A 3J7YW 3MZ5A 2PNRC 1SNQA 1A15A 1GXDC 1MGSA 4Q5VA 1BF4A 4H44C 3JAML 3NSWA 2RVLA 1JWSD 2NVYB 2N55A 2OF1A 5LL6X 3GTGB 1JWMD 3C1FA 1SNDA 1DYQA 2QF7A 4PMBA 4BA1I 5EQ0A 4KY7A 1A2UA 2F1MA 3H6MA 2XVSA 4ZKBB 3VA7A 5E1FA 2A6HD 2E74C 3TBIB 3BDOA 3VYSA 5CMDA 1Q8IA 3CKIB 1LTGD 4DAYA 4FNFA 2A6HC 2V4DA 1H9KA 1CFMA 3CQZB 4EQPA 1EY8A 1VMPA 1RCVD 1QCBD 2ZT9C 3RZOB 2AQ1B 1EY0A 3HS0C 3HP3A 3MXNA 3FPPA 2M00A 2L11A 1IKLA 4BS9A 1Q90A 4H7BA 3QO2A 4DNRB 3K58A 1Z47A 4RFBA 3R8BA 5CBEE 4FF2A 3I4MB 1I6VC 2HCCA 5C3XA 1T5XD 1C48A 4ABNA 5COYA 1I4PA 2XWBB 1EOTA 4XXEA 1STBA 2NZ1D 2K32A 4N9TA 1I4XA 4QB4A 2K03A 1HPCA 4KKTA 4O42A 3GTLB 1Z7TA 4UAIA 3TP5A 2QKIC 2KEEA 1V8QA 3SHLA 5DM63 3S1QB 3S15B 4BY1B 2KVMA 3EFXD 3QG1A 4Q0FA 3O13A 1JOQA 1TY2A 1EY9A 2RBMA 1Y1WB 5CV7A 1OXXK 3N6RA 1CZWA 2PZUA 1LACA 1DZ1A 2EYJA 1E0BA 3T4AC 2HDLA 2O2LD 1A2TA 2N88A 3DXJC 3HGBA 4A3KB 2B39A 2F0WA 1S5FD 1SEBD 1B50A 2VUMB 2A74C 3CU7A 2VB2X 1GUSA 3J81E 4IUVA 2XRQD 1SYEA 1F2LA 4J8QA 1XYIA 1U9RA 1KNEA 1MD2D 3HOVB 2WAQB 1WTOA 1D6EC 2M9VA 3VYUA 1E2WA 4C3IG 1A6XA 1RJTA 5IGGA 4C3HB 1TS3A 5IODA 4DXGA 1T5EA 1WCMB 3KF8A 1AZQA 2BA0A 4R9WA 4XIGS 4K5XA 3FVQA 3GV3A 3A54A 5CBAE 3X3NA 5CYUA 2J4XA 1WD0A 3V96A 4WRDA 2EYHA 2F0MA 2XSCA 2HCIA 5CORA 5CC4A 4O1NA 3BS1A 1PTOF 4OHJA 3PO3B 1EEFD 1VCIA 2AUJD 1UUPA 1TVXA 4NDXA 3MC0B 3HOYB 1PZKD 1ML0D 1BBXC 2VNUD 4F88A 3W3AA 2ZXRA 4CKBA 1STNA 3NK9A 4XQQA 1EZ6A 1UAPA 1SNCA 2B2WA 2JXMB 3JAME 1SYGA 1TWHB 3S1NB 4FO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N A;  1G29 1;  2PCF B;  3P20 A;  1GHJ A;  1E2Z A;  2A68 D;  2ZT9 C;  3QIA A;  4XTC S;  1HCZ A;  3QJY A;  1OXU A;  3MFY A;  3PV0 A;  1GUS A;  1LAB A;  4G7H C;  2DNE A;  4KMU C;  5BN5 A;  1Z6H A;  1B9M A;  3M4Y A;  3MXU A;  3OW7 A;  4H0L C;  2B8G A;  2A6E D;  3CRL C;  4L8J A;  2A69 D;  2Q8I B;  5K36 H;  4DK0 A;  3A8K E;  1IW7 D;  1Q12 A;  3FPP A;  1Y8P B;  5K36 G;  2A68 C;  3I73 A;  3WDN A;  2O5I C;  2KCC A;  2BA1 A;  3VR5 A;  1Q90 A;  3PUW A;  4DNR B;  1ZYR C;  1OXS C;  1Q1B A;  1YNJ C;  2A6E C;  4LJZ C;  1E2W A;  2A69 C;  4OGQ C;  3A8I E;  5A35 A;  1IW7 C;  1OXT A;  1A6X A;  1QJO A;  1DCZ A;  1I6V C;  1GUO A;  3PUX A;  1GUG A;  3IKJ A;  3VR6 A;  1GJX A;  3A7L A;  1T5E A;  3OOC A;  2EJF C;  2PNR C;  3A7A B;  2BA0 A;  3FMC A;  4XIG S;  2NN6 I;  4DNT B;  1V43 A;  4TQU S;  2E76 C;  4JBW A;  1O7L A;  5BN3 A;  4JK1 C;  3M85 A;  1VDZ A;  2K32 A;  4OO1 H;  5KND A;  3ND9 A;  1VF7 A;  4H44 C;  3VR2 A;  1DXM A;  4OO1 G;  3AB9 A;  2EJG C;  1Q1E A;  3LWU A;  3IFT A;  4HR7 B;  1TKW B;  1CTM A;  2NN6 H;  3T53 B;  5BN4 A;  2AUK A;  3EQL C;  2NN6 G;  1DD2 A;  2PPB C;  3TZU A;  1HPC A;  4KKT A;  3D31 A;  3KLR A;  2EVB A;  1TU2 B;  1Z7T A;  3L7Z C;  5KNC A;  2D62 A;  1ONL A;  2K7V A;  1YNN C;  1Y8N B;  2DN8 A;  5C0X H;  1SMY C;  4GZY C;  1O78 A;  1FR3 A;  4KN7 C;  1CI3 M;  4KKU A;  5C0X G;  2QF7 A;  1V8Q A;  1K8M A;  3A8J E;  4RCN A;  3RLF A;  3I72 A;  3T51 B;  2IT1 A;  4G7O C;  4BA1 I;  2EJM A;  2JEA I;  2B8F A;  1OXV A;  3SE0 A;  4H13 C;  3OPO A;  3QG1 A;  1H9R A;  1H9S B;  3T56 B;  1K8O A;  2F1M A;  3LNN A;  1H9J A;  2JEB I;  4IQZ A;  4TKO B;  3VR3 A;  3VA7 A;  5JEA H;  2LMC B;  1VCI A;  4KHZ A;  2AUJ D;  4DK1 A;  3D4R A;  5JEA G;  2KA7 A;  3PUZ A;  2A6H D;  2R6G A;  2L5T A;  3H94 A;  2E74 C;  3BDO A;  2D5D A;  3I4L A;  1HTP A;  1FYC A;  1OXX K;  2D2C C;  1IYV A;  1HQM C;  3N6R A;  2EDG A;  3NE5 B;  3VR4 A;  2E75 C;  4IFD H;  3PUV A;  4KKS A;  1LAC A;  2CW0 C;  2YYZ A;  1EWH A;  3ND8 A;  4I7Z C;  4KN4 C;  4BA2 I;  1H9S A;  4IFD G;  1Y8O B;  1Y69 U;  1ZKO A;  2JE6 I;  3W3A A;  3GQB A;  1IYU A;  3PUY A;  4PV1 C;  2A6H C;  3CRK C;  2V4D A;  3BG3 A;  2BE5 D;  2AWO A;  2JXM B;  4G7Z C;  2BDO A;  3U9S A;  1H9M A;  1B9N A;  1GUT A;  1H9K A;  3DXJ C;  3HGB A;  1CFM A;  1BDO A;  1VF5 C;  4KI0 A;  2O5J C;  2K33 A;  4LK1 C;  1GHK A;  2DNC A;  1PMR A;  1E2V A;  3GD7 A;  1GUN A;  5KNB A;  2BE5 C;  3SDZ A; 
#chains in the Genus database with same CATH topology
 1KAA A;  4MTN A;  1YNX A;  1S40 A;  3L9A X;  5EKK A;  4LF8 Q;  4ALP A;  4IUQ A;  1BVS A;  5J1Z A;  3MXU A;  5K36 H;  2UXD L;  2P5Z X;  4NW2 A;  4JI8 Q;  2I5H A;  3VR5 A;  4A3J G;  3GTP B;  3K0Y A;  1NY4 A;  2G5D A;  4N8X 1;  1N32 Q;  1IHZ A;  1PYB A;  1BUV T;  2DGY A;  1HQR D;  1VQ9 A;  3KJP A;  2RCF A;  1I3Q B;  4EQ5 A;  3PGZ A;  1QZG A;  3FKI H;  3WOE A;  4B3R L;  3PO3 H;  2NVQ B;  2EXZ A;  2OEO A;  5IYD G;  2ID0 A;  1VQ5 A;  3GDE A;  1X65 A;  3QB3 A;  3S14 H;  1V43 A;  3EBE A;  1G8Z D;  1O7L A;  3S16 B;  1YVC A;  1VQM A;  2PQE A;  1GUW A;  4DV3 L;  3HOY H;  1YNN D;  3FRP B;  4JYA L;  1X3P A;  1TKW B;  3IRB A;  3X3M A;  4DN4 M;  1J5E L;  1KRS A;  1CK1 A;  2F3W A;  4UY8 C;  5JPM C;  1BCP B;  1L0Y B;  3VYR A;  1PH3 A;  1QOH A;  1YNN C;  4IUT A;  2DN8 A;  4DAP A;  5M5W B;  2CWP A;  4C3J G;  2G9H D;  3GO5 A;  1TWH H;  3T13 A;  2AMC B;  3S1N H;  1JB3 A;  4DR5 Q;  2PMZ B;  2F3I A;  4ZCK A;  5C4X H;  4TKO B;  1XXG A;  5ELO A;  2XNA C;  2B2W C;  5C44 H;  4UPA A;  4DR4 L;  1QVF A;  1KDA A;  1IL8 A;  3MEH A;  3MVV A;  3NWT A;  1NR4 A;  4WJ3 M;  1JJC B;  2PO4 A;  1AP0 A;  3BDL A;  4ILW A;  2WAC A;  2I5L X;  3UE0 A;  5LMN W;  3NEM A;  3HOU B;  5FJ8 H;  5C3E B;  4C1N I;  4C2M B;  2R7D A;  1SYF A;  4LF9 Q;  4DV2 Q;  3UE1 A;  3GTP H;  1NUC A;  4CHT B;  4O0A A;  4OWX B;  2PQA B;  1PH7 A;  4GS3 A;  5IT9 c;  3UDF A;  5K5P A;  4IPC A;  1I3Q H;  3SEB A;  3HFZ B;  4A3C H;  1PMR A;  2NZO A;  1B3A A;  2R7F A;  3MXG A;  3CHB D;  2F0G A;  2ZTD A;  2XWJ B;  2HUG A;  3CP0 A;  5LMU Q;  2IHF A;  2VQE L;  1EFI D;  2A68 D;  3R3O A;  4X3T A;  4EQO A;  1P16 A;  1MSH A;  1X3E A;  1CHQ D;  2PI2 E;  5GAE C;  3S2D B;  1NBW A;  4MIU A;  2GVA A;  3BZD B;  1QG7 A;  5IYB H;  2BOS A;  1BCP D;  2A69 D;  1XJV A;  2NB0 A;  2XRS D;  2ICI A;  3PSI A;  2ATW A;  2A68 C;  4NXN Q;  2BA1 A;  4DA2 A;  5FOB B;  1OO9 B;  1TQO A;  4JI4 Q;  2Q2U A;  3GTQ B;  1XMQ L;  2A69 C;  1NCV A;  5M5W H;  4CDE C;  5D3I B;  1RL2 A;  1IBK L;  2MQH A;  3IKJ A;  2JA9 A;  1Y1V G;  2Q2H A;  4EGV A;  1PH5 A;  3Q24 A;  5J22 A;  5HUR A;  1IBM L;  2KQ3 A;  3QWN A;  4P2C B;  3HZX A;  1HNW L;  4OO1 H;  2Y0S E;  2NYZ D;  3K81 C;  4A75 A;  3VR2 A;  1AZP A;  5EJW A;  3CCM A;  1LT4 D;  3HOU H;  1PXU A;  4C2M H;  3DLL A;  3FHW A;  5IWA Q;  3UDI A;  4BY7 B;  2E2H B;  4DV5 Q;  3L7Z C;  3C46 A;  4FXK C;  2K7V A;  3KBX A;  2F0N A;  1O78 A;  1EZ8 A;  1F2Y A;  2PW7 A;  5FKA C;  2K14 A;  4GN4 B;  4PZ7 A;  3A5Z B;  2JEA I;  2B8F A;  5JVH 3;  1LO5 D;  1AW7 A;  3LNN A;  4R8N A;  2C35 B;  4K6L A;  3I4M G;  3D4R A;  3RN5 A;  4K0K Q;  4B3M L;  1JE4 A;  1NR2 A;  1LTA D;  1AEX A;  1HTP A;  3DEP A;  1BO0 A;  5D3D A;  3RMH A;  4DR3 L;  1D8L A;  4M1U B;  2MNA A;  1SNP A;  1HNX L;  4HMJ A;  1QVC A;  1Y8O B;  3AMU A;  2VQF L;  4LF4 Q;  1VMC A;  3PUY A;  4BXX G;  1UEA B;  4LFA L;  1CZG A;  3J81 L;  2CHB D;  2NUC A;  3CC2 A;  3HG9 A;  3G48 A;  4IAL A;  3GTQ H;  4PMW A;  2IX3 A;  2KJX A;  2O5J C;  5DAU A;  4X62 Q;  1U4R A;  5FLX c;  1X56 A;  2DNC A;  2RQX A;  4WFN 3;  4O2D A;  1SYD A;  3LGJ A;  4YWM A;  3TS2 A;  4YY3 Q;  2ASB A;  1Q8K A;  3P75 A;  3UI2 A;  3VYT A;  1B44 D;  2QGQ A;  3TRE A;  2XGT A;  4KMU C;  3A56 A;  1TWC B;  4F7X A;  3MEF A;  1B9M A;  4A3G B;  3GTK H;  3CRL C;  1KDC A;  4S3S A;  4DR2 Q;  2L12 A;  2VS1 A;  2MJ8 A;  1G6P A;  4XYO A;  1SDF A;  2ZXP A;  3OWE B;  4HCS A;  1LT3 D;  4HJ8 A;  4IUR A;  3M4Q A;  4BY7 H;  2YTX A;  2E2H H;  4K5W A;  3TP7 A;  4P72 A;  2YTY A;  1M90 C;  4G4K A;  2JA6 G;  4YHH Q;  4HJ9 A;  2L1B A;  3TS0 A;  3S9W A;  2B2T A;  3SK4 A;  1FJG L;  1PRT F;  1UNS A;  1EU3 A;  1AE2 A;  2R93 B;  1LT6 D;  4DKA C;  4R1J A;  3NBH A;  1CKM A;  4MHE A;  5KND A;  4H02 A;  4DF7 A;  1CQF A;  3I7F A;  4TRD A;  1ESR A;  1HFG A;  1TR5 A;  4L5Q A;  5EAY A;  1HFN A;  3CCQ A;  2WAQ E;  3QOJ A;  4B9W A;  5E3F A;  3NBH B;  3U58 A;  1JOR A;  1PTO B;  4IOC A;  1K0R A;  4XQJ A;  5KNC A;  3TN2 A;  1C9O A;  1N34 Q;  2MP1 A;  2J0T D;  3CXC A;  4GKK Q;  3NHH A;  1NAP A;  4R4C A;  2K4K A;  2R3Z A;  4RHR A;  1OXV A;  1WTQ A;  4Y7N B;  5JEA H;  3CCL A;  4IQZ A;  1CKO A;  2LMC B;  2EXD A;  2EPB A;  3MA2 B;  4C3H G;  3I55 A;  2CFM A;  4ZUI A;  2IY5 B;  5IGB A;  4QUC A;  1HQM C;  4JOI A;  1WCM G;  3PUV A;  4A3G H;  3HOZ H;  4KN4 C;  5M3F G;  4PQX A;  3SK6 A;  3K57 A;  5JJZ A;  3KLS A;  5IYC G;  5T1G A;  1STA A;  1T9H A;  1F9Q A;  3PIP 3;  2BE5 D;  2OTJ A;  1EY5 A;  1H9M A;  1E1T A;  2R61 A;  1BCP F;  1K83 B;  4LK1 C;  2PI2 A;  4HJA A;  3W5O A;  2IX0 A;  1GUN A;  1ENF A;  5FO9 B;  3P7J A;  2B2Y C;  4RGO S;  2E2D C;  2BE5 C;  3KK7 A;  5I9P A;  1N36 L;  3D4D A;  5FLM H;  1I5F A;  3P20 A;  2R93 H;  3I3C A;  4G57 A;  1VQI A;  3QIA A;  5LMN L;  2HIV A;  2RDH A;  4A3M H;  4A3I B;  3KFU A;  3I8Z A;  2DNE A;  1SNM A;  1ZYR D;  1PTO D;  1C7Y A;  3H91 A;  2LY7 A;  3H0G B;  5IT9 E;  1VQ4 A;  2NVX B;  3EIV A;  2A6E D;  1ILQ A;  2B2T C;  4EX5 A;  5G3L F;  4DAM A;  2WP8 J;  3HKZ G;  4DR6 Q;  2ZTC A;  3ZJY C;  4OEL B;  2Q2T A;  1PTO H;  2EYP A;  5JPN C;  1CKN A;  1JJG A;  4HIK A;  1ZYR C;  1PTO C;  3OSO A;  5IGF A;  3CCJ A;  4A3F H;  2MPM A;  2A5H A;  2A6E C;  4JI8 L;  1N32 L;  5M3M B;  5FK9 C;  1I4Q A;  4Y7N H;  5C4H A;  1QB5 D;  4DNT B;  5IE8 A;  1G2S A;  1HJP A;  5CR3 A;  2FMC A;  2Y0S B;  4A3L G;  1ENC A;  3K59 A;  3NUC A;  4A3B B;  1Q86 C;  2JA5 H;  2JJQ A;  2NN6 H;  3MTS A;  2N78 A;  2EY6 A;  1YJ9 A;  4HMI A;  4A3E B;  2ENB A;  1F77 A;  1EWI A;  4JOI C;  1K83 H;  3AFP A;  3A8J E;  4X3K A;  1KLG D;  2F0V A;  4ZQ3 A;  4C56 C;  3PO2 G;  4P71 A;  4BBS B;  2R7Z B;  1K8O A;  4IFD I;  4RHS A;  4HED A;  2RDF A;  4LAA A;  4DR5 L;  1VQ7 A;  5M5X B;  1GKH A;  3ONA B;  2NVX H;  4BA2 I;  4N9P A;  3WOF A;  4IFD G;  2BDN A;  4KHP Q;  1IYJ B;  1V1O A;  2ALY B;  4NKL A;  2AWN A;  1I50 H;  2BDO A;  2I07 B;  4AYB G;  4LF9 L;  4DV2 L;  2DY8 A;  1PZI D;  4GN5 A;  5CV6 A;  1S5B D;  4CJ0 B;  1XMO Q;  5AJ3 Q;  4HJ5 A;  4QMG A;  4IPH A;  4B9X A;  2F0L A;  1PFS A;  4IJH A;  1HNX Q;  3SDZ A;  3AFQ A;  3S17 B;  4QGU A;  4V19 0;  1SE3 A;  5DM7 3;  1SMX A;  2PNH A;  2KED A;  5LMU L;  4G7H C;  3SGI A;  4A3B H;  2ZJR A;  1SNO A;  4L8J A;  1LTB D;  2F0D A;  5FLX E;  1IW7 D;  1Y8P B;  3R93 A;  3E9H A;  3I73 A;  5TSS A;  1WJJ A;  1D1I A;  4L5S A;  1E1O A;  3NTK A;  2DJG C;  1Z9F A;  4A3E H;  3GTO B;  4NXN L;  2F0F A;  1VQE A;  5C3E G;  1QZH A;  3OHX C;  1R9T B;  1R4Q B;  4JI4 L;  4OGQ C;  3HOX B;  1IW7 C;  1YEZ A;  1HHV A;  1JE5 A;  1GUO A;  1GVP A;  2LXJ A;  3EJI A;  3BU2 A;  5BR8 Q;  1HA5 A;  4PNY A;  5GQO A;  2CH4 W;  3FMC A;  2WB1 E;  4IFD J;  2JA7 B;  1LYL A;  2QEX A;  2VZA A;  4JI5 Q;  3Q8D A;  1L1O B;  3GTM B;  1VDZ A;  4DUY Q;  3C3L A;  4BBR B;  3W1G A;  4KY6 A;  4OL7 A;  5C5M A;  1D7Q A;  1AN8 A;  2L4N A;  3EQL C;  3OIP A;  1PFB A;  1KRT A;  1JWU D;  1STG A;  5I2Y A;  4NXM Q;  4IPG A;  3MHB A;  1A3T A;  3TP8 A;  1JQY D;  3QR8 A;  5C0X H;  3L2P A;  3KLS X;  5IWA L;  4DV5 L;  4KKU A;  1ET9 A;  1B53 A;  3V05 A;  3RZD H;  1H95 A;  4F87 A;  2Z4H A;  1STH A;  1UE1 A;  4DXF A;  3NQT A;  3S17 H;  1E7Z A;  4QQB X;  3H94 A;  2XIW A;  1HA6 A;  1GD7 A;  3VR4 A;  4DAV A;  1SSO A;  4K0K L;  4KKS A;  3H3V C;  2CQO A;  4PZ6 A;  5CV8 A;  2QEJ C;  2E5L Q;  4A3D B;  2ZJP A;  4FYD A;  1X3G A;  4LF4 L;  3FKI B;  1X6O A;  1B1Z A;  2M2L A;  1WTP A;  4KI0 A;  2C5C A;  2KHJ A;  1R9T H;  1SLJ A;  4J15 A;  3SK8 A;  3HOX H;  2OWO A;  4AQY L;  3S14 B;  3GD7 A;  3PMF A;  5KNB A;  2ZXO A;  3DHQ A;  4MTK A;  3TP6 A;  1IBL Q;  1MKH A;  4X62 L;  2SEB D;  4IUP A;  5KYI A;  3K8A A;  1G29 1;  3J81 j;  2JA7 H;  1E2Z A;  2SNS A;  1L0W A;  4XTC S;  4YY3 L;  3MFY A;  3EVQ A;  2RA4 A;  3GTM H;  1C4Q A;  1L1O C;  2F0J A;  2L0C A;  1F2M A;  3M4Y A;  4BBR H;  4LUZ A;  4XT3 B;  1YHB A;  3I4N B;  3B6Y A;  4YCV A;  2N8N A;  1KD1 C;  1U4M A;  2K5N A;  4DR2 L;  2JK8 A;  1TS4 A;  2FFK B;  2MO1 A;  3K80 C;  1NMG A;  1PRT B;  2ICE C;  1S5C D;  5C4X B;  2EYL A;  2K28 A;  4FVM A;  5C44 B;  5EKI A;  2F0O A;  2TMP A;  4YHH L;  2X6L A;  1PH4 A;  4DV6 L;  2B63 G;  4X3S A;  4TQU S;  1VQ8 A;  5BN3 A;  1UEB A;  3BDC A;  3KLW A;  3NQI A;  1TII D;  1HR0 Q;  1PH9 A;  1WTR A;  5IP9 G;  4IO9 A;  2AUK A;  2ZTE A;  4UP9 A;  2RSN A;  4JI2 Q;  1N33 Q;  1SBB B;  4A3D H;  2EVB A;  1YBY A;  4B3T Q;  1TU2 B;  5GRO A;  1EFW A;  4PG3 A;  3M7G A;  4FXD A;  3KUP A;  4CKC A;  1K8M A;  1A3V A;  4CDF C;  2R92 B;  1N34 L;  1B2T A;  1H9S B;  5J3B A;  4GKK L;  2AQ3 B;  2CH4 A;  2G9D A;  4KHZ A;  3LWE A;  2R6G A;  4GN3 B;  5CV4 A;  1FYC A;  3L0O A;  5C4Z A;  2VW9 A;  2EYF A;  3FPU B;  3ND8 A;  1EWH A;  1PRT D;  4I7Z C;  2Z8L A;  3I4N H;  1PH2 A;  4R4Q A;  4MN3 A;  3S1M B;  1ZKO A;  5IP7 H;  1WTV A;  4LF7 L;  4X3U A;  3TZD A;  2Q8T A;  3U9S A;  5IT9 L;  1GUT A;  4WOR A;  1PHJ A;  1PRT C;  4APV A;  4MZ9 A;  2CKZ B;  1F9R A;  5ELE A;  5C5L A;  1M8A A;  5IGE A;  4QIW E;  4LF5 Q;  1M1K C;  1RTN A;  2PCF B;  3UDX A;  3DEO A;  3Q22 A;  2H5X A;  1UWV A;  2PQA A;  3S24 A;  1KAB A;  3HOW B;  3RLO A;  4K8J A;  4DR1 Q;  1PDQ A;  1TWG B;  1UE6 A;  2OT2 A;  4HID A;  3RUZ A;  3MWY W;  3OW7 A;  2HQL A;  1WYD A;  3E0E A;  2K5W A;  1NJI C;  3CCE A;  1CT1 D;  2H1E A;  5IGC A;  4A93 B;  3KJO A;  1PZJ D;  1FVI A;  3DM1 A;  4UP7 A;  2F03 A;  2E8G A;  1D5M C;  4LJZ C;  4DR6 L;  3P1H A;  5A35 A;  4HSV A;  3PQI A;  1DCZ A;  1HR0 W;  2R92 H;  1KTK A;  1Q3L A;  3TSS A;  4KK7 A;  4CGY B;  1GJX A;  4XDX A;  4FP5 D;  2WB1 B;  1C0A A;  2JA8 B;  5FO8 B;  2L55 A;  1VQP A;  3DWQ A;  3EA6 A;  1W3S A;  1HNZ Q;  5CV9 A;  4XYQ A;  3AB9 A;  1ZXT A;  2FJ2 A;  2VL6 A;  1SMY D;  2Z6K A;  1EIY B;  1U4L A;  1KIX A;  3S1M H;  4L6T B;  4A3I G;  1BCP C;  1CA6 A;  4JI0 Q;  4QUF A;  4DPG A;  1PYW D;  4GLA C;  1VQC A;  2LS0 1;  2F0I A;  2VY3 A;  3H0G G;  2VB3 X;  5I9O A;  5M5Y B;  4ZKC B;  1LTS D;  1SMY C;  5C4J H;  4GZY C;  1FR3 A;  1E22 A;  2LSS A;  4AIM A;  2QA4 A;  2UXC Q;  5G3L D;  4QJF A;  1WD1 A;  4ZYS A;  1MSG A;  2L15 A;  2EJM A;  3U9O A;  4H13 C;  1PH6 A;  3GTK B;  1SJE D;  2E2J B;  2KA7 A;  3HOW H;  4ODG A;  3PIP A;  2NTT A;  1PH1 A;  1BNZ A;  1TWG H;  2NBF A;  2AKW B;  1UE7 A;  1TXY A;  1DOK A;  2MUY A;  3RD4 A;  5M9O A;  4A93 H;  3AYH B;  4RCO A;  4G7Z C;  3K5L A;  4KY5 A;  5ELF A;  4KHP L;  1JC7 A;  1JR0 D;  3G6J B;  2OQK A;  5FLX L;  5EPK A;  5HY6 A;  1GHK A;  5DNF A;  1SYC A;  5DEH A;  4FXG C;  5JAV A;  1MHW C;  1EQR A;  2D0O A;  1XMO L;  5AJ3 L;  4RG1 A;  1TWF B;  2JA8 H;  3SR1 A;  3D4W A;  1YHA A;  1XX8 A;  5T1I A;  3CPW A;  4CJ1 B;  1G91 A;  1EEI D;  5BN5 A;  4RGT A;  1YIT A;  1FGB D;  2R7Z G;  2B8G A;  4CKE A;  4LMQ D;  4DK0 A;  1Q12 A;  2CVR A;  4OON A;  5C3W A;  4AQY Q;  2TSS A;  1SRU A;  2SDF A;  1JOK A;  4C3I H;  2QDB A;  5E7N A;  5M5Y H;  4OX9 Q;  4FDB A;  1V1P A;  5I4D A;  2Z6K C;  3DUZ A;  3F8T A;  1Y14 B;  2QIL A;  3VR6 A;  2F0T A;  2EJF C;  3A7A B;  4BY1 G;  1EIG A;  2F0E A;  4GKJ L;  4KD3 A;  2J7Z A;  2E2J H;  5BR8 L;  3HOZ B;  4JBW A;  5ELB A;  1YHQ A;  1V1P B;  3GV6 A;  1JCK B;  3H3V I;  3IFD A;  3NTH A;  3AU7 A;  1Y1W G;  4QCL A;  5JJK A;  2B2Y A;  1EYA A;  2EE1 A;  4JI5 L;  2I5M X;  1CTM A;  4DUY L;  3A0J A;  4A3J B;  1EY7 A;  1MBY A;  3F2B A;  1EY6 A;  3R2T A;  3J80 c;  2UUA Q;  4JG2 A;  2EYO A;  1FD7 D;  1Y8N B;  2FHT A;  4DV6 Q;  1K8A C;  4LFC L;  1LTI D;  4NXM L;  1B3Q A;  4A3K G;  2IX1 A;  1SAP A;  1SFO B;  4RCN A;  2IWH A;  4A3M B;  3TEH B;  2GVB A;  1G6Z A;  3T56 B;  3VR3 A;  1NMF A;  1KQS A;  1FGU A;  3BVZ A;  1TWF H;  2VUM G;  3E9I A;  5ELC A;  1X9N A;  3I4L A;  2D2C C;  3HRZ C;  1STE A;  2WFW A;  4QF4 A;  3F2D A;  1SE4 A;  4K2K A;  4C1N K;  4A3F B;  3KDF B;  2F0P A;  4AH6 A;  5ELN A;  4BWG B;  3BG3 A;  5LL6 S;  4DV4 Q;  1V9P A;  1XTC D;  3Q0A A;  2E5L L;  1BDO A;  4YWK A;  2B2U A;  3HOV G;  1CUK A;  3CME A;  4C3J B;  3QOL A;  2WAQ G;  2E2I B;  1SXT A;  1X55 A;  3AEV A;  2WKC A;  2FMM A;  2L9H A;  1E2V A;  4GOP B;  4K6D A;  4QIW B;  5KGU A;  3MFG A;  2UUC Q;  3T1H Q;  2RKS A;  4ZUJ A;  3U50 C;  1R4P B;  1EL0 A;  4LF7 Q;  2JA5 B;  1IBL L;  1OXU A;  1CA5 A;  3S1R B;  1K0S A;  1BXT A;  4ID6 A;  1KC8 C;  1LV9 A;  3D0F A;  3J7A 5;  5K36 G;  4U67 3;  2NVT B;  3V2T A;  4A3J H;  4EQN A;  4X64 Q;  1Q1B A;  4R4I A;  1Q7Y C;  1EWC A;  2D0P A;  1QJO A;  1SFO H;  1IKM A;  1S4Z A;  3PUX A;  5IYD H;  1GUG A;  3FKI G;  3OOC A;  5CV5 A;  1JOO A;  2KHI A;  3J7A F;  3PO3 G;  1HTL D;  1K28 A;  3BVG A;  5KRU A;  2PZW A;  4JI6 Q;  1Q46 A;  1DXM A;  3K5N A;  1Q1E A;  4L63 B;  4X65 Q;  3ULP A;  3HOY G;  1I50 B;  3HKZ E;  3JAM c;  2UXB Q;  5LHY 1;  2PPB C;  4KD4 A;  1HR0 L;  3TDQ A;  4RGM A;  3BVM A;  3T16 A;  4KV6 A;  3TME A;  1ROD A;  4JI2 L;  1N33 L;  1VQA A;  1SYB A;  4K2L A;  4C3J H;  4RH6 A;  4B3T L;  2E2I H;  5EBD A;  2F52 A;  1Y1V B;  3I72 A;  3CD6 A;  2KEC A;  2MO0 A;  4K8I A;  4RAU C;  1B4O A;  5CGK A;  3RNU A;  4GOP C;  3KF6 A;  1DOM A;  3ULL A;  1SJH D;  3C1E A;  5C4X G;  1QWY A;  5C44 G;  4RGN A;  2B2U C;  2PW5 A;  3I90 A;  3S1R H;  1PLF A;  2K6A A;  2PYK A;  1XNR Q;  1O7Y A;  2RSO A;  1AFP A;  3KF6 B;  1QNU A;  1X3Q A;  1LLR D;  1Y69 U;  5JVG 3;  2NVT H;  4PMC A;  1DJR D;  5FJ8 G;  1U0L A;  1STY A;  3BYT B;  5C6A A;  3MAQ A;  1VQ6 A;  3DWA A;  1D2B A;  3DMU A;  1O80 A;  1Q81 C;  4FF3 A;  3KYH C;  1VF5 C;  3TQY A;  1I4G A;  1A62 A;  2RHS B;  1I4R A;  1JB7 A;  5JJI A;  4A3C G;  5J39 A;  1CQV A;  3ERS X;  2I0Q A;  2AQ2 B;  1SRO A;  5D14 A;  1GHJ A;  4R4T A;  3M3Y B;  4LF5 L;  3ERO A;  3PV0 A;  4DR7 Q;  3E0J A;  4RWS C;  3M4O B;  1HRJ A;  4XQN A;  2K5V A;  4JI3 Q;  3K5O A;  1VQK A;  5KEE A;  4DR1 L;  5A2Q E;  3A8K E;  5EBC A;  4DNI A;  3D6W A;  2O5I C;  3NP8 A;  3D6C A;  3NBI A;  4JI1 Q;  4AYB E;  1WI5 A;  1QE6 A;  2N3S A;  1DGS A;  3M9B A;  4K14 A;  1EQT A;  1OXS C;  4DV0 Q;  1YIJ A;  3RZD B;  3D8G A;  2A8V A;  1DOL A;  4UDU C;  4Z9C B;  3HKS A;  2KBN A;  2JSO A;  1QNK A;  4P74 A;  3I91 A;  4XT1 B;  5HGT A;  1Y1V H;  3NXW A;  2Z6B A;  4OO1 I;  3SK5 A;  4NP5 A;  3CQZ H;  2IW3 A;  2A19 A;  2Q8R E;  1L2F A;  2OQ0 A;  1RKN A;  4X66 L;  3NEN A;  2RF4 A;  1S5E D;  4OO1 G;  2LFN A;  3OMG A;  3GP7 A;  4JV5 Q;  3RZO H;  1HNZ L;  2FIN B;  2V1C C;  1W6K A;  1PVO A;  2KHS A;  3HOU G;  3FDT A;  4FF4 A;  3KLR A;  2OTL A;  1L1O A;  2D62 A;  5E4W C;  3KBG A;  2JA6 B;  1D5Z C;  4GKJ Q;  4JI0 L;  4KN7 C;  3T51 B;  2MHV A;  1CM9 A;  3RLF A;  1EIH A;  2IT1 A;  4GNX A;  4G7O C;  1WVL A;  1XNQ Q;  4ZRZ A;  1H9R A;  2UXC L;  1NNX A;  3I4M H;  1ET6 A;  1EIF A;  3M3Y H;  3J80 E;  2D5D A;  4DGZ A;  3CCS A;  2DY7 A;  2KEN A;  3PCO B;  4GNX B;  3M4O H;  4HIM A;  3NE5 B;  4LFC Q;  2HIX A;  4I65 A;  3G4S A;  1EQV A;  1F9P A;  4BXX H;  2B2V A;  2JE6 I;  4KJO A;  3FEW X;  3A74 A;  5EKL A;  2N49 A;  4HSP A;  4OIJ A;  2X6G A;  2IPK D;  2JN4 A;  2WII B;  1B9N A;  1F2Z A;  1RF2 D;  5ELD A;  1ILP A;  2B3G A;  2WKD A;  3AQQ A;  2D9U A;  3N52 A;  3PIO A;  2K33 A;  3NTI A;  2ZM6 Q;  4WJ4 A;  4V0B A;  1FNV A;  3M7N A;  1BBU A;  5GAG C;  1QUQ A;  1IZ6 A;  2KOL A;  1D5X C;  4NPS A;  3S2H B;  2LKV A;  1LAB A;  2F0U A;  4DK3 C;  5IOC A;  4GLX A;  5M3F B;  3ER0 A;  3IL8 A;  2Q8I B;  1J6Q A;  4YIJ A;  1CHP D;  2F3V A;  4P75 A;  2CQA A;  4A76 A;  1TS2 A;  4RKL A;  2JYO A;  1QUQ B;  3OIQ A;  1VQO A;  3NWS A;  1EUJ A;  4OWT B;  1PH8 A;  2JA6 H;  1ICW A;  4BY7 G;  4TSS A;  5EGT A;  3H09 A;  3A8I E;  3G6E A;  4OX9 L;  4A3K H;  4CBV A;  3BZC A;  4P73 A;  4HIO A;  1LUZ A;  2MFI A;  1PA6 A;  4LFB Q;  1RDP D;  1TS5 A;  1LTT D;  2NZH A;  4POG A;  3ERQ A;  4DFA A;  4WJW A;  3BYY B;  4GNX C;  1AE3 A;  4KLK A;  4R8I A;  3HKZ B;  1IXR A;  1DD2 A;  3TZU A;  2OCE A;  1EU4 A;  1WTW A;  4IJL A;  1ONL A;  5F2D A;  4LNQ A;  3IAY A;  1K8G A;  1M4V A;  3TRZ A;  4HTH A;  2UUA L;  2JQO A;  1E24 A;  4DV1 Q;  3HOV H;  4ZAI A;  2B2V C;  4J1M A;  3OTO Q;  3UDG A;  2CW0 D;  4DV7 Q;  1SE8 A;  4C3H H;  5JEA G;  1EYD A;  3S2H H;  2K04 A;  1WCM H;  1MI2 A;  1BR9 A;  1KLU D;  4HCE A;  5M3F H;  2PZT A;  2E75 C;  2EY5 A;  3T1Y Q;  2WIN B;  2Z4I A;  2CW0 C;  1HZ9 A;  5IYC H;  1H9S A;  4A3G G;  3HOZ G;  3OMC A;  4FF1 A;  1GO3 E;  3CRK C;  1TWA B;  4J6H A;  1ENA A;  5EPL A;  5GAH C;  3SVM A;  4IZ8 A;  3BZK A;  3J7Z C;  4DV4 L;  3PO2 B;  3H15 A;  2EY1 A;  1KNA A;  4K5V A;  1HZB A;  1N8R C;  3NPP A;  2HQE A;  2AHO B;  2DUD A;  3VA5 A;  5FLM G;  2R93 G;  4F8M A;  2UUC L;  3T1H L;  4A3M G;  5IGD A;  5IY0 A;  1YNJ D;  4H0L C;  2UU9 Q;  4HAE A;  3E6Z X;  1WTX A;  1XPO A;  1A3U A;  1SR3 A;  3RLN A;  1FNU A;  3WDN A;  5C4J B;  4AYB B;  4RA8 A;  1VQN A;  3CCR A;  3PUW A;  2H4O A;  2F4V Q;  1YNJ C;  2O4X A;  5JEA J;  2X69 A;  1VS0 A;  1P8L A;  1HUM A;  1II3 A;  4A3F G;  1DON A;  4X64 L;  4DUZ Q;  1C8C A;  3F2U A;  3L3O C;  1S5D D;  3PIO 3;  3ZYY X;  3OWF A;  1QVG A;  4IUN A;  2HHH L;  1U4P A;  3K6O A;  2NN6 I;  3URY A;  2QCP X;  3Q23 A;  2E76 C;  3M85 A;  1BOS A;  4JK1 C;  4A3L H;  1RIP A;  1AH9 A;  2KCN A;  2HDM A;  3ND9 A;  1MJC A;  1ZEQ X;  1J9O A;  1JMC A;  1VQG A;  3LWU A;  2Z1C A;  3IFT A;  4HR7 B;  4JI6 L;  2JA5 G;  1S72 A;  2NN6 G;  1VQF A;  1WOC A;  4X65 L;  2EY2 A;  1EYG A;  2F0K A;  5I6Y A;  3F1Z A;  3K7A B;  3CW2 C;  2UXB L;  1TWA H;  5D65 A;  2RDG A;  1LT5 D;  2BH2 A;  1JIC A;  4LF6 Q;  2K1B A;  2JP1 A;  3PO2 H;  2F0S A;  4X66 Q;  2K01 A;  4KJN A;  4OIK A;  1O7Z A;  4RKB A;  3SE0 A;  3MXP A;  3R2I A;  3Q6S A;  2JEB I;  4MNO A;  3GTJ B;  3C2P A;  5I2X A;  1HUN A;  4PZ8 A;  3PUZ A;  2L5T A;  2NVQ H;  4X6A H;  4EVO A;  2K5D A;  1D1K A;  2EDG A;  4IFD H;  1L0X B;  4DU9 A;  2YYZ A;  3S16 H;  4C3I B;  1TT2 A;  1X32 A;  1XNR L;  3GQB A;  4LWC A;  2UUB Q;  1IYU A;  3CCV A;  1YZ6 A;  2AWO A;  2ES2 A;  1B8A A;  5A2Q L;  5KIX A;  2SNM A;  3E5S A;  3A5U A;  3D3R A;  1RHP A;  2A73 B;  1HH2 P;  1GOZ A;  3NEL A;  5M3M G;  2F4I A;  3QJY A;  4ME5 A;  4JI7 Q;  2K05 A;  1EY4 A;  4LW1 A;  3J80 i;  4ULL A;  2Y0S G;  4DR7 L;  4A3B G;  3W1B A;  1W6J A;  1DM0 B;  2F0Q A;  2IHE A;  4JI3 L;  1BKB A;  2SOB A;  2K5H A;  3J81 i;  4KTA A;  5EPJ A;  1ESF A;  3K7A H;  3A55 A;  5C3E H;  4JI1 L;  2EZV A;  1BQQ T;  4A3E G;  4E6I A;  1PFM A;  4HN7 A;  1OXT A;  1B7Y B;  1VQL A;  2BCO A;  1KHI A;  4DV0 L;  1W2B A;  1NSN S;  4OWW B;  4CJ2 C;  1HZC A;  3A7L A;  1TY0 A;  3GTJ H;  4BBS G;  3CC7 A;  1I6H B;  5E4X A;  3WWV A;  3I70 A;  1FNW A;  1RTO A;  1VF7 A;  1VQJ A;  2EJG C;  1I4H A;  4KHV A;  3T53 B;  5BN4 A;  3S2D H;  5C0X I;  1N9W A;  3DWP A;  3J80 L;  3FP9 A;  5IIF A;  2MGS A;  2NWG A;  3D31 A;  4JV5 L;  1I94 Q;  4ME3 A;  2A1A A;  1SE2 A;  2HT1 A;  3K5M A;  2NTS A;  2Z9H A;  5ISR A;  4B08 A;  4NMZ A;  3K0X A;  1CI3 M;  1XWE A;  3U4Z A;  5C0X G;  4B3S Q;  4QL5 A;  3K7U C;  1KDB A;  3JC6 6;  3OPO A;  1K3B C;  3DM3 A;  4JC0 A;  5JOB A;  3U4V A;  2B63 B;  1H9J A;  2VXW A;  4DK1 A;  1XNQ L;  1U5K A;  2K5Q A;  3HEJ A;  3G71 A;  1IYV A;  4CDD C;  1VQB A;  1PYS B;  4RMF A;  3J7A V;  4YCW A;  1EOV A;  4PV1 C;  2C9O A;  4ZLT F;  1QIL A;  1G2T A;  5NUC A;  3J81 c;  2EYM A;  5JJL A;  1RD9 D;  2GA4 B;  3CC4 A;  2I46 A;  1JT8 A;  1LTR D;  3G7L A;  5I6W A;  1EYC A;  3HOX G;  3KDF A;  2B29 A;  4JW0 A;  4JBM A;  2OXP A;  2IL8 A;  1WTH A;  2KCT A;  2ZM6 L;  2FXQ A;  3JAM i;  5KYL A;  3OW2 A;  1HCZ A;  2KUM A;  1I6H H;  2JA7 G;  4ZK9 B;  4U68 A;  1J8I A;  2Q2I A;  2XN9 C;  3LX0 A;  2UXD Q;  1PFN A;  3W2D A;  1Z6H A;  4IN3 A;  4GOP A;  1EQQ A;  3OYY A;  4BBR G;  4IUU A;  3SXH A;  5FO7 B;  1F9S A;  5C0X J;  1O7I A;  5AFW A;  2KCC A;  2F0H A;  5L37 A;  3F2C A;  1HXY D;  1K9M C;  4B3R Q;  2YU9 B;  2EOT A;  4JPB W;  2K52 A;  2WV6 D;  4M8A A;  4DK6 C;  3ITP A;  2IJ0 A;  3J7Y W;  2HD3 A;  2YTV A;  3MZ5 A;  2PNR C;  1YJW A;  1SNQ A;  2B63 H;  4DV3 Q;  1A15 A;  4JYA Q;  1NTG A;  2EQS A;  1GXD C;  1YI2 A;  1MGS A;  4Q5V A;  1BF4 A;  4JBK A;  1A8V A;  2CWA A;  4H44 C;  1A63 A;  1IL2 A;  3JAM L;  3NSW A;  1J5E Q;  4IOA A;  4LFB L;  2RVL A;  5IP9 H;  2ZJQ A;  1TWC H;  1JWS D;  1BBW A;  2NVY B;  2DJF C;  2EIF A;  2N55 A;  2OF1 A;  2HHH Q;  5LL6 X;  3GTG B;  1JWM D;  4A3D G;  3C1F A;  1SND A;  1DYQ A;  2QF7 A;  4DR4 Q;  4PMB A;  4BA1 I;  3VDY A;  4KY7 A;  1A2U A;  2F1M A;  5EQ0 A;  4DV1 L;  3H6M A;  2XVS A;  4ZKB B;  3VA7 A;  5E1F A;  3OTO L;  2A6H D;  2E74 C;  3TBI B;  4LUV A;  3BDO A;  4DV7 L;  1YJN A;  3VYS A;  1ICF B;  5CMD A;  3ICE A;  1Q8I A;  3CKI B;  1LTG D;  4DAY A;  1LM0 A;  4JVZ A;  4FNF A;  3I4N G;  3T1Y L;  2A6H C;  5IP7 G;  4LF8 L;  2V4D A;  1H9K A;  1CFM A;  3CQZ B;  1OTC A;  4DAY B;  2YU9 H;  4EQP A;  1JJ2 A;  3CAM A;  2VQE Q;  1EY8 A;  1MJE A;  1VMP A;  1RCV D;  4TVA B;  1QCB D;  2ZT9 C;  1KAW A;  1UE5 A;  3RZO B;  1XTD A;  2AQ1 B;  1CKN B;  4YCU A;  1EY0 A;  4Y52 H;  3HS0 C;  4I7A A;  1ASY A;  4R4O A;  3ULJ A;  3HP3 A;  3MXN A;  3FPP A;  2BH8 A;  2M00 A;  1ASZ A;  2L11 A;  1IKL A;  2UU9 L;  2NVY H;  4BS9 A;  1KL9 A;  1XMQ Q;  1Q90 A;  4H7B A;  3QO2 A;  3GTG H;  4DNR B;  3K58 A;  1Z47 A;  1IBK Q;  4RFB A;  3R8B A;  5CBE E;  4FF2 A;  1HZA A;  3MXN B;  3I4M B;  2XTI A;  4LUO A;  1Q82 C;  2F4V L;  1I6V C;  1IBM Q;  4L5R C;  2LXK A;  2HCC A;  5C3X A;  1A0I A;  1T5X D;  2R92 G;  1C48 A;  4ABN A;  1HNW Q;  5COY A;  4DUZ L;  1I4P A;  2XWB B;  4HJ7 A;  1EOT A;  3RR5 A;  4XXE A;  2RCN A;  5IYB G;  1STB A;  2NZ1 D;  2K32 A;  1E3P A;  4YWL A;  4N9T A;  1I4X A;  4QB4 A;  4A3I H;  2K03 A;  5H1S E;  1HPC A;  3H0G H;  5HGQ A;  4KKT A;  4O42 A;  3GTL B;  1Z7T A;  5DLQ E;  1S3O A;  2Z0S A;  4A4I A;  4UAI A;  3I56 A;  2GN5 A;  3TP5 A;  2CCZ A;  4UHV A;  2K50 A;  4CDC C;  2QKI C;  1K73 C;  2KEE A;  3M4P A;  1V8Q A;  3SHL A;  5DM6 3;  3S1Q B;  3S15 B;  4BY1 B;  3STB D;  2KVM A;  4LF6 L;  2PMZ E;  3EFX D;  3QG1 A;  1FL0 A;  1MIU A;  4Q0F A;  4B3M Q;  3O13 A;  1JOQ A;  4DR3 Q;  1TY2 A;  1EY9 A;  2RBM A;  1Y1W B;  1CSP A;  5M3M H;  5CV7 A;  3HOW G;  1OXX K;  2VQF Q;  3N6R A;  1CZW A;  2PZU A;  3STB C;  1LAC A;  4LFA Q;  1DZ1 A;  2EYJ A;  1E0B A;  3T4A C;  2HDL A;  2O2L D;  1A2T A;  1G51 A;  2N88 A;  3DXJ C;  3HGB A;  4A3K B;  2UUB L;  3I4O A;  4OXP A;  2K75 A;  2B39 A;  4A93 G;  2F0W A;  1S5F D;  4OEM B;  1SEB D;  1B70 B;  1B50 A;  3PF5 A;  4N8F A;  1LTL A;  2VUM B;  2A74 C;  3CU7 A;  2VB2 X;  2WB1 G;  1GUS A;  1GM5 A;  3J81 E;  4IUV A;  2JA8 G;  4BBS H;  2YV5 A;  2XRQ D;  2R7Z H;  1SYE A;  4NB3 A;  1F2L A;  4J8Q A;  4JI7 L;  1XPU A;  1XYI A;  1CSQ A;  5M5X H;  1U9R A;  3GTL H;  1KNE A;  1MD2 D;  3HOV B;  2WAQ B;  1WTO A;  1D6E C;  1XPR A;  2M9V A;  3VYU A;  1E2W A;  4C3I G;  1V1Q A;  3CMA A;  1A6X A;  1FJG Q;  1RJT A;  5IGG A;  4C3H B;  1VQH A;  1TS3 A;  5IOD A;  3S15 H;  3S1Q H;  3CF5 A;  4BY1 H;  4DXG A;  1T5E A;  1WCM B;  3KF8 A;  1AZQ A;  3E3X A;  2BA0 A;  4R9W A;  4IPD A;  4XIG S;  1X3F A;  4K5X A;  1PV4 A;  4JCV E;  1Y1W H;  3RN2 A;  1WFQ A;  4QY7 A;  3FVQ A;  3GV3 A;  3KF8 B;  3A54 A;  5CBA E;  3X3N A;  5CYU A;  3CCU A;  3CPF A;  2J4X A;  3H3V H;  1WD0 A;  2QW7 A;  4JBJ A;  3V96 A;  4WRD A;  2EYH A;  2F0M A;  2XSC A;  2KCM A;  1I94 L;  2HCI A;  2QDL A;  5COR A;  3BJU A;  4O1N A;  5CC4 A;  3BS1 A;  1PTO F;  3GTO H;  4OHJ A;  3PO3 B;  4B3S L;  4L5T A;  2VUM H;  1EEF D;  1VCI A;  2AUJ D;  1UUP A;  1X54 A;  4GLV B;  1VQD A;  1TVX A;  5GAD C;  4NDX A;  3MC0 B;  3HOY B;  2RHQ B;  1PZK D;  1ML0 D;  1BBX C;  2VNU D;  4F88 A;  3PF4 A;  3W3A A;  2ZXR A;  1SN8 A;  4CKB A;  1KXL A;  1STN A;  3NK9 A;  4XQQ A;  1NE3 A;  1EZ6 A;  1UAP A;  1SNC A;  2B2W A;  2JXM B;  4UP8 A;  4POF A;  3JAM E;  1SYG A;  3EN2 A;  1N36 Q;  1K3R A;  1TWH B;  3S1N B;  5LMN Q;  3KOJ A;  4FO2 A;  3I2Z A; 
#chains in the Genus database with same CATH homology
 1KAA A;  3L9A X;  5EKK A;  4IUQ A;  5J1Z A;  3MXU A;  5K36 H;  4NW2 A;  3VR5 A;  3GTP B;  3K0Y A;  1IHZ A;  1BUV T;  1HQR D;  1I3Q B;  3WOE A;  2NVQ B;  2EXZ A;  2OEO A;  2ID0 A;  3QB3 A;  1V43 A;  1G8Z D;  1O7L A;  3S16 B;  2PQE A;  1GUW A;  1YNN D;  3FRP B;  1X3P A;  1TKW B;  3X3M A;  4DN4 M;  1CK1 A;  2F3W A;  5JPM C;  1BCP B;  1L0Y B;  3VYR A;  1QOH A;  1YNN C;  4IUT A;  2DN8 A;  4DAP A;  5M5W B;  4C3J G;  2G9H D;  3GO5 A;  3T13 A;  1JB3 A;  2PMZ B;  4TKO B;  1XXG A;  2XNA C;  2B2W C;  1KDA A;  1IL8 A;  3MEH A;  3MVV A;  3NWT A;  1NR4 A;  2PO4 A;  1AP0 A;  3BDL A;  4ILW A;  2WAC A;  3HOU B;  5C3E B;  4C1N I;  4C2M B;  1SYF A;  1NUC A;  4CHT B;  5K5P A;  3SEB A;  1PMR A;  1B3A A;  3MXG A;  3CHB D;  2F0G A;  2XWJ B;  2HUG A;  1EFI D;  2A68 D;  3R3O A;  4X3T A;  4EQO A;  1MSH A;  1CHQ D;  3S2D B;  4MIU A;  3BZD B;  1QG7 A;  2BOS A;  1BCP D;  2A69 D;  2NB0 A;  2XRS D;  2ICI A;  2A68 C;  2BA1 A;  4DA2 A;  5FOB B;  1OO9 B;  1TQO A;  3GTQ B;  2A69 C;  1NCV A;  5D3I B;  3IKJ A;  4EGV A;  3Q24 A;  5J22 A;  5HUR A;  2KQ3 A;  3QWN A;  4P2C B;  3HZX A;  4OO1 H;  2NYZ D;  3VR2 A;  1AZP A;  5EJW A;  1LT4 D;  1PXU A;  4BY7 B;  2E2H B;  3L7Z C;  3C46 A;  4FXK C;  2K7V A;  3KBX A;  2F0N A;  1O78 A;  1EZ8 A;  1F2Y A;  2PW7 A;  5FKA C;  2JEA I;  2B8F A;  5JVH 3;  1LO5 D;  1AW7 A;  3LNN A;  4R8N A;  4K6L A;  3D4R A;  1JE4 A;  1NR2 A;  1LTA D;  1AEX A;  1HTP A;  3DEP A;  1BO0 A;  5D3D A;  3RMH A;  4M1U B;  1SNP A;  4HMJ A;  1Y8O B;  3AMU A;  1VMC A;  3PUY A;  1UEA B;  1CZG A;  3J81 L;  2CHB D;  2NUC A;  3HG9 A;  4IAL A;  4PMW A;  2IX3 A;  2KJX A;  2O5J C;  5DAU A;  1U4R A;  2DNC A;  2RQX A;  4WFN 3;  1SYD A;  3P75 A;  3UI2 A;  3VYT A;  1B44 D;  4KMU C;  3A56 A;  1TWC B;  4F7X A;  1B9M A;  4A3G B;  3CRL C;  1KDC A;  4S3S A;  2L12 A;  2MJ8 A;  4XYO A;  1SDF A;  2ZXP A;  3OWE B;  4HCS A;  1LT3 D;  4IUR A;  4K5W A;  3TP7 A;  4G4K A;  2L1B A;  3S9W A;  2B2T A;  3SK4 A;  1PRT F;  1UNS A;  1EU3 A;  2R93 B;  1LT6 D;  3NBH A;  4MHE A;  5KND A;  4DF7 A;  1CQF A;  4TRD A;  1ESR A;  1HFG A;  1TR5 A;  1HFN A;  3QOJ A;  4B9W A;  5E3F A;  1JOR A;  1PTO B;  4XQJ A;  5KNC A;  3TN2 A;  2MP1 A;  2J0T D;  3NHH A;  1NAP A;  2R3Z A;  4RHR A;  1OXV A;  1WTQ A;  4Y7N B;  5JEA H;  4IQZ A;  2LMC B;  2EPB A;  3MA2 B;  4C3H G;  4ZUI A;  5IGB A;  4QUC A;  1HQM C;  3PUV A;  4KN4 C;  4PQX A;  3SK6 A;  3K57 A;  5JJZ A;  3KLS A;  5T1G A;  1STA A;  1F9Q A;  3PIP 3;  2BE5 D;  1EY5 A;  1H9M A;  2R61 A;  1BCP F;  1K83 B;  4LK1 C;  2IX0 A;  1GUN A;  1ENF A;  5FO9 B;  3P7J A;  2B2Y C;  4RGO S;  2E2D C;  2BE5 C;  3KK7 A;  5I9P A;  3D4D A;  3P20 A;  3I3C A;  4G57 A;  3QIA A;  2RDH A;  4A3I B;  3I8Z A;  2DNE A;  1SNM A;  1ZYR D;  1PTO D;  3H91 A;  2LY7 A;  3H0G B;  5IT9 E;  2NVX B;  2A6E D;  1ILQ A;  2B2T C;  5G3L F;  2WP8 J;  1PTO H;  2EYP A;  5JPN C;  1ZYR C;  1PTO C;  3OSO A;  5IGF A;  2MPM A;  2A5H A;  2A6E C;  5M3M B;  5FK9 C;  1I4Q A;  5C4H A;  1QB5 D;  4DNT B;  1G2S A;  5CR3 A;  2FMC A;  2Y0S B;  1ENC A;  3K59 A;  3NUC A;  4A3B B;  2NN6 H;  3MTS A;  2EY6 A;  4HMI A;  4A3E B;  2ENB A;  1F77 A;  3A8J E;  4X3K A;  1KLG D;  2F0V A;  4ZQ3 A;  4C56 C;  4BBS B;  2R7Z B;  1K8O A;  4IFD I;  4RHS A;  4HED A;  2RDF A;  4LAA A;  5M5X B;  3ONA B;  4BA2 I;  4N9P A;  3WOF A;  4IFD G;  2BDN A;  1V1O A;  4NKL A;  2AWN A;  2BDO A;  2I07 B;  2DY8 A;  1PZI D;  5CV6 A;  1S5B D;  4CJ0 B;  4QMG A;  4B9X A;  2F0L A;  3SDZ A;  3S17 B;  4V19 0;  1SE3 A;  5DM7 3;  2KED A;  4G7H C;  1SNO A;  4L8J A;  1LTB D;  2F0D A;  5FLX E;  1IW7 D;  1Y8P B;  3R93 A;  3I73 A;  5TSS A;  1D1I A;  3NTK A;  3GTO B;  2F0F A;  3OHX C;  1R9T B;  1R4Q B;  4OGQ C;  3HOX B;  1IW7 C;  1HHV A;  1GUO A;  3EJI A;  1HA5 A;  4PNY A;  3FMC A;  4IFD J;  2JA7 B;  3GTM B;  1VDZ A;  3C3L A;  4BBR B;  4KY6 A;  4OL7 A;  5C5M A;  1AN8 A;  2L4N A;  3EQL C;  3OIP A;  1PFB A;  1JWU D;  1STG A;  5I2Y A;  3MHB A;  1A3T A;  3TP8 A;  1JQY D;  5C0X H;  3KLS X;  4KKU A;  1ET9 A;  1B53 A;  3V05 A;  4F87 A;  2Z4H A;  1STH A;  4DXF A;  3NQT A;  3H94 A;  2XIW A;  1HA6 A;  3VR4 A;  4DAV A;  1SSO A;  4KKS A;  3H3V C;  5CV8 A;  2QEJ C;  4A3D B;  4FYD A;  3FKI B;  1B1Z A;  2M2L A;  1WTP A;  4KI0 A;  2C5C A;  3SK8 A;  3S14 B;  3GD7 A;  3PMF A;  5KNB A;  2ZXO A;  3DHQ A;  3TP6 A;  2SEB D;  4IUP A;  5KYI A;  1G29 1;  1E2Z A;  2SNS A;  4XTC S;  3MFY A;  3EVQ A;  2RA4 A;  1C4Q A;  2L0C A;  2F0J A;  1F2M A;  3M4Y A;  4XT3 B;  3I4N B;  1U4M A;  1TS4 A;  2FFK B;  1PRT B;  2ICE C;  1S5C D;  5C4X B;  2EYL A;  2K28 A;  4FVM A;  5C44 B;  5EKI A;  2F0O A;  2TMP A;  2X6L A;  4X3S A;  4TQU S;  5BN3 A;  3BDC A;  3NQI A;  1TII D;  1WTR A;  2AUK A;  2RSN A;  1SBB B;  2EVB A;  1TU2 B;  3M7G A;  4FXD A;  3KUP A;  4CKC A;  1K8M A;  1A3V A;  2R92 B;  1B2T A;  1H9S B;  2AQ3 B;  2G9D A;  4KHZ A;  3LWE A;  2R6G A;  5CV4 A;  1FYC A;  5C4Z A;  2EYF A;  3FPU B;  3ND8 A;  1EWH A;  1PRT D;  4I7Z C;  2Z8L A;  4MN3 A;  3S1M B;  1ZKO A;  1WTV A;  4X3U A;  3TZD A;  2Q8T A;  3U9S A;  5IT9 L;  1GUT A;  4WOR A;  1PRT C;  1F9R A;  5ELE A;  5C5L A;  1M8A A;  5IGE A;  1RTN A;  2PCF B;  3DEO A;  3Q22 A;  1KAB A;  3HOW B;  4K8J A;  1PDQ A;  1TWG B;  2OT2 A;  3RUZ A;  3MWY W;  3OW7 A;  2K5W A;  1CT1 D;  2H1E A;  5IGC A;  4A93 B;  1PZJ D;  3DM1 A;  2F03 A;  1D5M C;  4LJZ C;  3P1H A;  5A35 A;  4HSV A;  1DCZ A;  1KTK A;  1Q3L A;  3TSS A;  4KK7 A;  4CGY B;  1GJX A;  4XDX A;  4FP5 D;  2WB1 B;  2JA8 B;  5FO8 B;  2L55 A;  3DWQ A;  3EA6 A;  5CV9 A;  4XYQ A;  3AB9 A;  1ZXT A;  2FJ2 A;  1SMY D;  1U4L A;  4L6T B;  1BCP C;  1CA6 A;  4QUF A;  1PYW D;  2LS0 1;  2F0I A;  2VB3 X;  5I9O A;  5M5Y B;  4ZKC B;  1LTS D;  1SMY C;  4GZY C;  1FR3 A;  5G3L D;  1WD1 A;  4ZYS A;  1MSG A;  2EJM A;  3U9O A;  4H13 C;  3GTK B;  1SJE D;  2E2J B;  2KA7 A;  4ODG A;  2NTT A;  1BNZ A;  2NBF A;  1DOK A;  2MUY A;  3RD4 A;  5M9O A;  4RCO A;  4G7Z C;  3K5L A;  4KY5 A;  5ELF A;  1JC7 A;  1JR0 D;  3G6J B;  5FLX L;  5EPK A;  1GHK A;  5DNF A;  1SYC A;  5DEH A;  4FXG C;  5JAV A;  1TWF B;  3SR1 A;  3D4W A;  1XX8 A;  5T1I A;  4CJ1 B;  1G91 A;  1EEI D;  5BN5 A;  4RGT A;  1FGB D;  2B8G A;  4CKE A;  4LMQ D;  4DK0 A;  1Q12 A;  2CVR A;  5C3W A;  2TSS A;  2SDF A;  1JOK A;  2QDB A;  1V1P A;  5I4D A;  3DUZ A;  2QIL A;  3VR6 A;  2F0T A;  2EJF C;  3A7A B;  1EIG A;  2F0E A;  4KD3 A;  2J7Z A;  3HOZ B;  4JBW A;  5ELB A;  1V1P B;  3GV6 A;  1JCK B;  3IFD A;  3NTH A;  3AU7 A;  4QCL A;  2B2Y A;  1EYA A;  2EE1 A;  1CTM A;  4A3J B;  1EY7 A;  1MBY A;  1EY6 A;  3R2T A;  2EYO A;  1FD7 D;  1Y8N B;  2FHT A;  1LTI D;  2IX1 A;  1SAP A;  1SFO B;  4RCN A;  2IWH A;  4A3M B;  1G6Z A;  3T56 B;  3VR3 A;  3BVZ A;  5ELC A;  3I4L A;  2D2C C;  3HRZ C;  1STE A;  4QF4 A;  1SE4 A;  4K2K A;  4C1N K;  4A3F B;  2F0P A;  4BWG B;  3BG3 A;  5LL6 S;  1XTC D;  3Q0A A;  1BDO A;  2B2U A;  4C3J B;  3QOL A;  2E2I B;  1SXT A;  2WKC A;  2FMM A;  2L9H A;  1E2V A;  4K6D A;  4QIW B;  5KGU A;  3MFG A;  2RKS A;  4ZUJ A;  1R4P B;  1EL0 A;  2JA5 B;  1OXU A;  1CA5 A;  3S1R B;  1BXT A;  4ID6 A;  1LV9 A;  5K36 G;  4U67 3;  2NVT B;  3V2T A;  4EQN A;  1Q1B A;  1EWC A;  1QJO A;  1IKM A;  1S4Z A;  3PUX A;  1GUG A;  3OOC A;  5CV5 A;  1JOO A;  3J7A F;  1HTL D;  3BVG A;  5KRU A;  2PZW A;  1DXM A;  3K5N A;  1Q1E A;  4L63 B;  1I50 B;  5LHY 1;  2PPB C;  4KD4 A;  3TDQ A;  4RGM A;  3BVM A;  3T16 A;  4KV6 A;  3TME A;  1ROD A;  1SYB A;  4K2L A;  4RH6 A;  5EBD A;  1Y1V B;  3I72 A;  2KEC A;  4K8I A;  4RAU C;  1B4O A;  5CGK A;  1DOM A;  1SJH D;  3C1E A;  1QWY A;  4RGN A;  2B2U C;  2PW5 A;  3I90 A;  1PLF A;  2K6A A;  2PYK A;  1O7Y A;  2RSO A;  1AFP A;  1QNU A;  1X3Q A;  1LLR D;  1Y69 U;  5JVG 3;  4PMC A;  1DJR D;  1STY A;  3BYT B;  5C6A A;  3MAQ A;  3DWA A;  1D2B A;  3DMU A;  1O80 A;  4FF3 A;  1VF5 C;  1I4G A;  1I4R A;  5J39 A;  1CQV A;  2AQ2 B;  5D14 A;  1GHJ A;  3M3Y B;  3ERO A;  3PV0 A;  3E0J A;  4RWS C;  3M4O B;  1HRJ A;  4XQN A;  3K5O A;  5KEE A;  5A2Q E;  3A8K E;  5EBC A;  3D6W A;  2O5I C;  3NP8 A;  3D6C A;  3NBI A;  1QE6 A;  4K14 A;  1EQT A;  1OXS C;  3RZD B;  3D8G A;  1DOL A;  4UDU C;  4Z9C B;  2JSO A;  1QNK A;  4XT1 B;  3I91 A;  5HGT A;  3NXW A;  4OO1 I;  3SK5 A;  4NP5 A;  2IW3 A;  2Q8R E;  1RKN A;  1S5E D;  4OO1 G;  2LFN A;  3OMG A;  3GP7 A;  2FIN B;  1W6K A;  2KHS A;  3FDT A;  4FF4 A;  3KLR A;  2D62 A;  5E4W C;  3KBG A;  2JA6 B;  1D5Z C;  4KN7 C;  3T51 B;  2MHV A;  1CM9 A;  3RLF A;  1EIH A;  2IT1 A;  4G7O C;  1WVL A;  4ZRZ A;  1H9R A;  1ET6 A;  3J80 E;  2D5D A;  4DGZ A;  2DY7 A;  3NE5 B;  4I65 A;  1EQV A;  1F9P A;  2B2V A;  2JE6 I;  4KJO A;  3FEW X;  5EKL A;  4HSP A;  4OIJ A;  2X6G A;  2IPK D;  2WII B;  1B9N A;  1F2Z A;  1RF2 D;  5ELD A;  1ILP A;  2WKD A;  3N52 A;  2D9U A;  2K33 A;  3NTI A;  4V0B A;  1FNV A;  3M7N A;  2KOL A;  1D5X C;  3S2H B;  2LKV A;  1LAB A;  2F0U A;  5IOC A;  5M3F B;  3IL8 A;  2Q8I B;  4YIJ A;  1CHP D;  2F3V A;  2CQA A;  1TS2 A;  4RKL A;  2JYO A;  3OIQ A;  3NWS A;  1ICW A;  4TSS A;  5EGT A;  3H09 A;  3A8I E;  4CBV A;  1RDP D;  1TS5 A;  1LTT D;  3ERQ A;  4DFA A;  4WJW A;  3BYY B;  4R8I A;  3HKZ B;  1DD2 A;  3TZU A;  1EU4 A;  1WTW A;  1ONL A;  5F2D A;  3IAY A;  1M4V A;  4HTH A;  4ZAI A;  2B2V C;  4J1M A;  2CW0 D;  5JEA G;  1EYD A;  2K04 A;  1MI2 A;  1BR9 A;  1KLU D;  4HCE A;  2PZT A;  2E75 C;  2EY5 A;  2WIN B;  2Z4I A;  2CW0 C;  1H9S A;  3OMC A;  4FF1 A;  3CRK C;  1TWA B;  4J6H A;  1ENA A;  5EPL A;  3SVM A;  4IZ8 A;  3PO2 B;  2EY1 A;  1KNA A;  4K5V A;  3NPP A;  2HQE A;  3VA5 A;  4F8M A;  5IGD A;  1YNJ D;  4H0L C;  4HAE A;  3E6Z X;  1WTX A;  1A3U A;  1FNU A;  3WDN A;  5C4J B;  4AYB B;  4RA8 A;  3PUW A;  2H4O A;  1YNJ C;  2O4X A;  5JEA J;  2X69 A;  1HUM A;  1II3 A;  1DON A;  1C8C A;  3F2U A;  3L3O C;  1S5D D;  3PIO 3;  3ZYY X;  3OWF A;  4IUN A;  1U4P A;  3K6O A;  2NN6 I;  3URY A;  2QCP X;  3Q23 A;  2E76 C;  3M85 A;  1BOS A;  4JK1 C;  2KCN A;  2HDM A;  3ND9 A;  1ZEQ X;  1J9O A;  3LWU A;  2Z1C A;  3IFT A;  4HR7 B;  2NN6 G;  2EY2 A;  2F0K A;  5I6Y A;  3K7A B;  5D65 A;  2RDG A;  1LT5 D;  1JIC A;  2K1B A;  2JP1 A;  2F0S A;  2K01 A;  4KJN A;  4OIK A;  1O7Z A;  4RKB A;  3SE0 A;  3MXP A;  3R2I A;  3Q6S A;  2JEB I;  3GTJ B;  3C2P A;  5I2X A;  1HUN A;  3PUZ A;  2L5T A;  4EVO A;  2K5D A;  1D1K A;  2EDG A;  4IFD H;  1L0X B;  4DU9 A;  2YYZ A;  4C3I B;  1TT2 A;  1X32 A;  3GQB A;  1IYU A;  2AWO A;  5A2Q L;  5KIX A;  2SNM A;  3E5S A;  3D3R A;  1RHP A;  2A73 B;  1GOZ A;  2F4I A;  3QJY A;  4ME5 A;  2K05 A;  1EY4 A;  4ULL A;  1W6J A;  1DM0 B;  2F0Q A;  2SOB A;  4KTA A;  5EPJ A;  1ESF A;  3A55 A;  2EZV A;  1BQQ T;  4E6I A;  1PFM A;  4HN7 A;  1OXT A;  2BCO A;  1NSN S;  4CJ2 C;  3A7L A;  1TY0 A;  1I6H B;  5E4X A;  3I70 A;  1FNW A;  1RTO A;  1VF7 A;  2EJG C;  1I4H A;  4KHV A;  3T53 B;  5BN4 A;  5C0X I;  3DWP A;  3J80 L;  5IIF A;  2MGS A;  2NWG A;  3D31 A;  1SE2 A;  3K5M A;  2NTS A;  5ISR A;  4B08 A;  4NMZ A;  1CI3 M;  1XWE A;  5C0X G;  1KDB A;  3OPO A;  5JOB A;  2B63 B;  1H9J A;  2VXW A;  4DK1 A;  2K5Q A;  3HEJ A;  1IYV A;  3J7A V;  4PV1 C;  2C9O A;  4ZLT F;  1QIL A;  1G2T A;  5NUC A;  2EYM A;  1RD9 D;  2GA4 B;  2I46 A;  1LTR D;  3G7L A;  5I6W A;  1EYC A;  2OXP A;  2IL8 A;  5KYL A;  1HCZ A;  2KUM A;  4ZK9 B;  4U68 A;  1J8I A;  2XN9 C;  3LX0 A;  1PFN A;  3W2D A;  1Z6H A;  4IN3 A;  4IUU A;  3SXH A;  5FO7 B;  1F9S A;  5C0X J;  5AFW A;  2KCC A;  2F0H A;  1HXY D;  2YU9 B;  2EOT A;  2WV6 D;  4M8A A;  3ITP A;  2IJ0 A;  3J7Y W;  3MZ5 A;  2PNR C;  1SNQ A;  1A15 A;  1GXD C;  1MGS A;  4Q5V A;  1BF4 A;  4H44 C;  3JAM L;  3NSW A;  2RVL A;  1JWS D;  2NVY B;  2N55 A;  2OF1 A;  5LL6 X;  3GTG B;  1JWM D;  3C1F A;  1SND A;  1DYQ A;  2QF7 A;  4PMB A;  4BA1 I;  5EQ0 A;  4KY7 A;  1A2U A;  2F1M A;  3H6M A;  2XVS A;  4ZKB B;  3VA7 A;  5E1F A;  2A6H D;  2E74 C;  3TBI B;  3BDO A;  3VYS A;  5CMD A;  1Q8I A;  3CKI B;  1LTG D;  4DAY A;  4FNF A;  2A6H C;  2V4D A;  1H9K A;  1CFM A;  3CQZ B;  4EQP A;  1EY8 A;  1VMP A;  1RCV D;  1QCB D;  2ZT9 C;  3RZO B;  2AQ1 B;  1EY0 A;  3HS0 C;  3HP3 A;  3MXN A;  3FPP A;  2M00 A;  2L11 A;  1IKL A;  4BS9 A;  1Q90 A;  4H7B A;  3QO2 A;  4DNR B;  3K58 A;  1Z47 A;  4RFB A;  3R8B A;  5CBE E;  4FF2 A;  3I4M B;  1I6V C;  2HCC A;  5C3X A;  1T5X D;  1C48 A;  4ABN A;  5COY A;  1I4P A;  2XWB B;  1EOT A;  4XXE A;  1STB A;  2NZ1 D;  2K32 A;  4N9T A;  1I4X A;  4QB4 A;  2K03 A;  1HPC A;  4KKT A;  4O42 A;  3GTL B;  1Z7T A;  4UAI A;  3TP5 A;  2QKI C;  2KEE A;  1V8Q A;  3SHL A;  5DM6 3;  3S1Q B;  3S15 B;  4BY1 B;  2KVM A;  3EFX D;  3QG1 A;  4Q0F A;  3O13 A;  1JOQ A;  1TY2 A;  1EY9 A;  2RBM A;  1Y1W B;  5CV7 A;  1OXX K;  3N6R A;  1CZW A;  2PZU A;  1LAC A;  1DZ1 A;  2EYJ A;  1E0B A;  3T4A C;  2HDL A;  2O2L D;  1A2T A;  2N88 A;  3DXJ C;  3HGB A;  4A3K B;  2B39 A;  2F0W A;  1S5F D;  1SEB D;  1B50 A;  2VUM B;  2A74 C;  3CU7 A;  2VB2 X;  1GUS A;  3J81 E;  4IUV A;  2XRQ D;  1SYE A;  1F2L A;  4J8Q A;  1XYI A;  1U9R A;  1KNE A;  1MD2 D;  3HOV B;  2WAQ B;  1WTO A;  1D6E C;  2M9V A;  3VYU A;  1E2W A;  4C3I G;  1A6X A;  1RJT A;  5IGG A;  4C3H B;  1TS3 A;  5IOD A;  4DXG A;  1T5E A;  1WCM B;  3KF8 A;  1AZQ A;  2BA0 A;  4R9W A;  4XIG S;  4K5X A;  3FVQ A;  3GV3 A;  3A54 A;  5CBA E;  3X3N A;  5CYU A;  2J4X A;  1WD0 A;  3V96 A;  4WRD A;  2EYH A;  2F0M A;  2XSC A;  2HCI A;  5COR A;  5CC4 A;  4O1N A;  3BS1 A;  1PTO F;  4OHJ A;  3PO3 B;  1EEF D;  1VCI A;  2AUJ D;  1UUP A;  1TVX A;  4NDX A;  3MC0 B;  3HOY B;  1PZK D;  1ML0 D;  1BBX C;  2VNU D;  4F88 A;  3W3A A;  2ZXR A;  4CKB A;  1STN A;  3NK9 A;  4XQQ A;  1EZ6 A;  1UAP A;  1SNC A;  2B2W A;  2JXM B;  3JAM E;  1SYG A;  1TWH B;  3S1N B;  4FO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...