3A8JE

Crystal structure of et-ehred complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
126
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 32
structure length 126
sequence length 127
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8jE00
3QG1A 2LMCB 1OXUA 2JEAI 1CFMA 2KA7A 1H9RA 1FR3A 2O5JC 2D2CC 4OO1G 4G7OC 2E75C 4DNRB 1IYUA 1T5EA 3BDOA 1OXSC 3IFTA 1DD2A 1LACA 4JK1C 1H9JA 1HTPA 1EWHA 1I6VC 1H9SA 2K33A 1DXMA 2IT1A 2F1MA 4H0LC 5K36H 5K36G 2A69C 3KLRA 4KMUC 1GUSA 3AB9A 5JEAG 1GUOA 3VR6A 2L5TA 5KNDA 3LNNA 3OW7A 3A8IE 1Z6HA 3A8KE 5KNCA 2AUJD 1ZYRC 1CI3M 2EVBA 1O78A 3GD7A 3VR5A 5BN3A 4DK1A 2QF7A 3T56B 2E76C 3PUWA 1HQMC 1YNJC 2DNEA 2PNRC 3M4YA 1Q1BA 3P20A 2PPBC 2B8FA 3CRLC 3VR3A 2JEBI 2BA1A 1OXXK 2K32A 1GHKA 2K7VA 3A7AB 4KKUA 1OXVA 1VF5C 3SDZA 3PUXA 1CTMA 1E2WA 1VDZA 3CRKC 3T53B 1SMYC 1Y8NB 1GJXA 1V8QA 1YNNC 1IYVA 2EJFC 4H13C 1Y8PB 5KNBA 5A35A 1K8OA 3M85A 2ZT9C 1GUTA 3U9SA 4H44C 1E2ZA 4BA1I 3L7ZC 1B9NA 1V43A 2D5DA 3DXJC 3D4RA 4OGQC 3ND9A 2D62A 2DNCA 1QJOA 4LK1C 3VR2A 4BA2I 1GUNA 1E2VA 1A6XA 2A6ED 2NN6H 4HR7B 1TU2B 3PUZA 3N6RA 2YYZA 2V4DA 5C0XH 3OPOA 3RLFA 2B8GA 1PMRA 3A7LA 4IQZA 2O5IC 3LWUA 4LJZC 2JXMB 1Q12A 4XTCS 2DN8A 2E74C 2KCCA 2PCFB 3W3AA 4TQUS 1IW7C 1G291 2A6HD 3I72A 4KI0A 4KN4C 1ONLA 2EDGA 1Y8OB 1IW7D 2BA0A 2BE5D 2EJMA 3NE5B 2BDOA 3I4LA 4DNTB 2R6GA 1Y69U 4RCNA 3ND8A 4KKTA 3HGBA 3MFYA 4PV1C 1DCZA 2Q8IB 1BDOA 4G7HC 3BG3A 4IFDH 4OO1H 2A68D 5BN5A 2AUKA 4XIGS 2A6EC 4KKSA 3FPPA 2NN6G 3VR4A 1VCIA 1Z7TA 2EJGC 4GZYC 1B9MA 2AWOA 3D31A 3PUVA 3PV0A 1Q90A 4TKOB 3WDNA 3TZUA 4JBWA 5C0XG 4KN7C 2JE6I 3EQLC 3MXUA 3SE0A 3IKJA 4KHZA 1O7LA 3OOCA 2A6HC 1VF7A 3I73A 1HPCA 2CW0C 1GUGA 2BE5C 3A8JE 1Q1EA 3H94A 3GQBA 3QIAA 4L8JA 1H9SB 2A69D 4I7ZC 4DK0A 5BN4A 5JEAH 1TKWB 3PUYA 3M7NA 1FYCA 1OXTA 3QJYA 3T51B 2A68C 1K8MA 1LABA 2NN6I 3FMCA 3VA7A 1ZKOA 1HCZA 4G7ZC 4IFDG 1H9KA 1H9MA 1GHJA
chains in the Genus database with same CATH superfamily
4LF5Q 3KUPA 1EY8A 5JVH3 4BBSG 2G9DA 5J39A 1EQVA 1PH4A 3OMCA 1EY0A 4P72A 4MN3A 3DHQA 4DR3Q 2KBNA 2PW5A 1GXDC 1Z9FA 2B29A 2EE1A 5FJ8G 3KBGA 1AN8A 1JMCA 1JOOA 4AYBB 3LNNA 1XMQQ 3J80i 5C44H 1VQLA 5BN3A 3HOWB 2NVXB 1EU3A 2PNRC 3P20A 1VQOA 5FO9B 3A7AB 5ELNA 2JYOA 1E2WA 5JOBA 1IZ6A 3RZOB 4HEDA 3VYRA 4K2KA 4NXMQ 4GLAC 3RR5A 3GTGB 1JWSD 5C4JH 1XYIA 2HQEA 2NN6H 3NP8A 4DV7L 4DV3L 2RSNA 1YHAA 2EXZA 5C0XH 3D6CA 1M1KC 2JA7G 5M5YB 1BQQT 1PMRA 4F8MA 4LJZC 2ZXPA 4A3LH 4UHVA 4JI6Q 1ENAA 1HNWL 4E6IA 2E74C 3RZDH 1IW7C 1PZKD 2AQ2B 4WJ3M 4YWLA 4C3IB 3QR8A 5NUCA 3HOYG 4KKTA 2K5VA 4LWCA 3MHBA 2N8NA 2Z9HA 1RDPD 1JC7A 1VQBA 5IIFA 2HCCA 1IBMQ 3ICEA 3SK8A 1D1IA 3U50C 4DXFA 4JBWA 3SE0A 4B08A 4FXDA 2JA8G 2SDFA 1J5EQ 1B3QA 3CCVA 1WTVA 3PO3G 3ZYYX 4DR2L 1ET9A 4BY1G 3H6MA 2F0DA 1SNCA 2E2IB 3T51B 2A68C 5M3MH 2N3SA 1TWHH 2CKZB 1N33L 4DV4L 3F8TA 1WTWA 3H3VI 3SEBA 4KHVA 4CDFC 4RHSA 3EN2A 3E3XA 1H9JA 3DMUA 4BBRG 1VQFA 4HCEA 4LF6Q 1CQFA 2BDNA 2I07B 1I4QA 2ID0A 1IBKL 4JI5L 2EY2A 2XRSD 3S1NH 5JEAG 4GN5A 3IFDA 1EY9A 3K0YA 2L5TA 4YHHQ 1WVLA 1SFOB 3K5OA 1CI3M 3CMEA 4K8JA 4C3JH 3T56B 1I4PA 5LMNW 1EY6A 2FFKB 3DWAA 4OWXB 1I4GA 3RN5A 1UE1A 3VYUA 3UDFA 3GTOB 1DOKA 2IHEA 3BVMA 1OXVA 1BCPC 1QWYA 2F4IA 3SDZA 3TS0A 1KABA 4FO2A 5I2XA 1CZGA 1NSNS 4X3SA 4DKAC 5M3FB 1MKHA 2ZT9C 1EFWA 1VQNA 2JA5B 1HNXL 1B9NA 3GTMH 1DONA 2B2VA 1QJOA 4AYBE 1K83B 4NXNL 1LTTD 5F2DA 4IUPA 1VQCA 3J80c 2C35B 2EY6A 4JI1L 3ULJA 2YYZA 1GKHA 4YWKA 3V2TA 1CSPA 2UU9Q 1LT3D 2MO1A 1GUWA 4XTCS 1X54A 2RDGA 4HSVA 2H4OA 2KCCA 3VYTA 4CJ2C 2JK8A 5EQ0A 1MBYA 1OTCA 2BE5D 1BDOA 3SR1A 1DOLA 4POFA 1NCVA 3I4OA 5E4XA 1VCIA 4BY7G 4JI7L 2WP8J 1O80A 4GKKQ 3NWSA 2VS1A 4NB3A 1Y1WG 4R8NA 2IX0A 5FJ8H 2A19A 2DY8A 4A3JB 2MPMA 1F2ZA 2HDMA 1I4RA 1LTBD 1NR2A 3S1QB 2JA9A 3UDXA 5E3FA 2UUBQ 2HIXA 3I4NG 1X3QA 3E0JA 1FR3A 4X65L 4DNIA 5JVG3 3PO2H 4I7AA 2R93G 4PMBA 1LT4D 1OXSC 2I5LX 1TWFB 4P71A 1BBWA 4JYAQ 4UP8A 2XIWA 1PZJD 3H09A 4IPHA 3AMUA 3K0XA 1KDBA 3G71A 5C6AA 2F0MA 2D0PA 3DEPA 1A63A 2EYOA 3T1HQ 2F3WA 3EIVA 1MIUA 4A3FB 2B2YA 4GNXA 2DJGC 4IZ8A 5KNDA 3S1MH 5KNCA 1V1OA 3CCSA 2VL6A 2DNEA 3SK6A 3IAYA 5FLMH 1V1PA 3TQYA 2PNHA 1RTOA 5C3EB 1SMYC 3M4QA 1AEXA 5IYCG 5A35A 3PGZA 1K8OA 2MQHA 1B53A 3JAME 3KBXA 3C1FA 5KIXA 1JJGA 4J8QA 5IP7G 5IWAL 4DAVA 1EIYB 5J3BA 3H91A 1WYDA 3LX0A 1HUMA 1PTOB 2PZUA 3K6OA 1CA5A 1HNZQ 1VS0A 2HT1A 2JA8H 2UXDL 3PF5A 4GS3A 3S1RB 3PO3H 1KAAA 3FHWA 1IW7D 1PFBA 1SMXA 4BY1H 1FVIA 2C5CA 2K01A 5LL6S 2JA7B 2DUDA 1P8LA 2R92B 4HIOA 2R7ZH 1WI5A 2IPKD 5BN5A 4XIGS 3T1YQ 3H3VC 1F9PA 1RODA 3F2BA 3I4MG 1Q81C 4UPAA 2NUCA 1B9MA 3U9OA 1HFGA 4ZQ3A 1LV9A 5LMNL 4JI0L 1SAPA 4FNFA 2KJXA 1WD0A 3I73A 4UP7A 4A3EH 1CSQA 3A8JE 1L0YB 1C9OA 2OXPA 3GQBA 5BN4A 5C4HA 1E0BA 5JEAH 5C4XB 1HHVA 4RFBA 2K52A 2LXKA 4DAYB 1KL9A 1QE6A 2L12A 5CBAE 1H9MA 2QILA 4PMCA 2NWGA 1T5XD 2MGSA 1Q82C 1PXUA 4C3HB 2JEAI 1CFMA 1MJCA 2JJQA 1SXTA 5CGKA 3HG9A 3J81L 2WAQB 3TBIB 1TWAB 3IFTA 3H0GB 2Z6KC 1LACA 4A3KG 1EWHA 4KLKA 3TP5A 4K5WA 4C2MH 5K36G 1SNOA 5KRUA 1VQ9A 1HUNA 1LTAD 1GUSA 1X9NA 1PRTB 1Y14B 4DUZQ 1WTPA 5LHY1 2Z4HA 4BBRB 3J81j 4IO9A 2PYKA 3R93A 2Z4IA 4APVA 4KJOA 2K6AA 4P2CB 4HIMA 4K5VA 5CC4A 4AYBG 1PTOD 2M00A 3PQIA 1F2YA 2QCPX 4QUFA 5IGBA 2V1CC 3DM3A 1FJGL 1PFMA 3S15H 1EYGA 2WV6D 3A56A 1VMPA 3HOWG 2HD3A 2E2HB 1II3A 2ZJPA 2D5DA 4HMJA 1TY0A 4IPGA 3UE0A 4DV2Q 3GV6A 1Q86C 1PH1A 4DV0L 2UXBL 2A6ED 4BY7H 4NDXA 4QY7A 1QVCA 2NVQB 4MTKA 1BBUA 3BU2A 2F0IA 4FXKC 2NVYB 5M9OA 4YY3Q 3A74A 1QNKA 1VMCA 1K0SA 2RDHA 5CBEE 3H3VH 4DAMA 2EY5A 3PIP3 5JAVA 1ICWA 3BVZA 1IYJB 2LXJA 4XT1B 3BJUA 3HKSA 3I55A 3I72A 2PI2A 1Y1WH 2BA0A 4DR7L 1HJPA 5HY6A 3HZXA 3FKIB 4FP5D 1C48A 5C3XA 2K03A 1FNWA 1XTCD 3VR4A 5M5XH 2EJGC 1EWCA 3BZKA 4K6DA 3I4NH 1BR9A 1BXTA 2AWOA 4L5TA 5E7NA 3C3LA 1PYSB 4C3IG 1OO9B 1DYQA 2R93H 2EY1A 3I7FA 3RLOA 3CCJA 2F0JA 2RHQB 3KJPA 1L2FA 1SDFA 2FJ2A 3H94A 2MFIA 4LF4L 1BVSA 1MJEA 4DU9A 1XWEA 5EBDA 2KEDA 1CHPD 2Q2IA 3D4DA 3MXNB 3T13A 1QCBD 1U4MA 4DA2A 5JJZA 2ZM6L 4A3MB 1UE7A 4ME5A 2E5LL 4DR6L 1PRTD 1STGA 4C1NI 4QIWB 5G3LF 4Q0FA 3AU7A 3G48A 1A62A 3HEJA 2G5DA 4DV6L 3DEOA 1ICFB 2ZJQA 3S16H 3GTQB 2B2WA 3OIPA 4JK1C 1PDQA 1JE5A 5IYCH 1E7ZA 2M9VA 1K3BC 4PZ8A 3HRZC 1TY2A 4OO1I 3A5ZB 2QKIC 4ZAIA 5IP7H 3JAMi 1RHPA 1I50H 1HZCA 2CHBD 3GD7A 1FGBD 3BVGA 2A1AA 5CV5A 2WIIB 3KF6B 4PQXA 1BCPF 3VR3A 3GTJH 1KLGD 2B63B 2WAQE 4DR2Q 4PZ6A 4JI3Q 5FO7B 3HOVG 1U5KA 3MC0B 1VQ8A 1SMYD 3SGIA 4IUTA 2HHHL 3DUZA 4A93H 3QO2A 3TN2A 4DK3C 2LS01 2XNAC 4BA2I 4HMIA 3W2DA 4MHEA 1I4HA 5FKAC 4CHTB 5D65A 1SRUA 4ZCKA 5KYIA 5M3FG 5A2QE 3I56A 2VQFQ 3HOZB 1IBKQ 3RNUA 2JA5G 2VNUD 1CUKA 1R9TB 2H5XA 3OYYA 2PCFB 4UDUC 3KOJA 1WJJA 4GOPB 2I46A 4DNTB 4B3RL 4KD4A 3KYHC 3CPWA 3CHBD 2WKCA 3GTPH 4PG3A 4Y7NB 3J7A5 1JWMD 4LF8L 4GZYC 3RUZA 2F3VA 3D31A 5A2QL 4POGA 5I9OA 3OSOA 1AZPA 5IP9G 4AIMA 3KLWA 5EBCA 3NBHB 3PSIA 1TWCH 1RKNA 1HNXQ 2YTYA 2Q2HA 1B70B 2BE5C 1PH6A 1JB3A 1PH7A 1EYDA 2OT2A 2OTJA 1H9SB 1D5MC 1KNEA 4HJ8A 4PZ7A 4LFCQ 1X65A 1J8IA 4OO1G 4JCVE 3GO5A 1HH2P 1ZYRD 3UE1A 1JQYD 1XPUA 1W3SA 3AFPA 4A3JG 4DNRB 4A3DH 5GADC 1SYEA 1CQVA 2SEBD 3NTKA 1D5ZC 5CORA 3L9AX 5JJIA 3S14B 3HOWH 4RHRA 4RGMA 2UUCQ 2L9HA 3I90A 4JBJA 3FEWX 4X62L 1Q8KA 5CV9A 1GUOA 3T16A 1GD7A 4IURA 3VR6A 3BDLA 2HCIA 3CMAA 3OW7A 2ICIA 3RZOH 2YTVA 4DK1A 1X32A 4QIWE 3S2DB 1KC8C 5I9PA 2PPBC 1LO5D 3U58A 4IOCA 3GTGH 4DK6C 5ELDA 1YZ6A 1HR0L 4A3FG 1KLUD 3H15A 4F7XA 3N52A 4CGYB 2BH2A 1AW7A 3E9IA 3HS0C 4P74A 5M5YH 1A2TA 1EFID 2D62A 4X65Q 4A3CG 4R9WA 2JA6B 5C3EG 3EJIA 4DUYQ 3JAMc 5DM73 1GM5A 3NQTA 3G4SA 3NUCA 2B2UA 3L0OA 2Q2UA 4C3IH 4B3SL 3C2PA 1ESFA 3PIOA 2B2VC 3A7LA 4JI8L 2JXMB 4A3IG 2NB0A 5EPLA 5KGUA 1G2TA 4K6LA 4JG2A 5TSSA 4YCWA 3F2DA 4R4QA 3HOUH 3GTLB 2UUAQ 4N8FA 1AH9A 1LT5D 1EEFD 2K14A 2R7FA 2RQXA 2TMPA 5D14A 4HIDA 3I3CA 2AWNA 2PW7A 1O7YA 2RDFA 4QL5A 3W1BA 3TSSA 2IY5B 5AJ3Q 4FF4A 1EYAA 2ATWA 1BUVT 3IKJA 2R92G 3TREA 5LMUQ 4BXXG 3C1EA 1UAPA 1WD1A 1HFNA 2IL8A 2ICEC 4JI2L 4B3TL 1LTGD 1JOKA 4DR4L 1NMGA 4OEMB 4CBVA 3K5MA 1Q7YC 3D0FA 4ALPA 3CXCA 4GN3B 1W6JA 3J7YW 3DWQA 5C4XG 2E75C 2E8GA 1MD2D 5EKLA 1DD2A 1LM0A 4ABNA 1FNVA 4X3TA 5C44B 4HJ9A 1SFOH 1BNZA 1V1QA 1XNQL 1I6VC 1LT6D 4C3HG 2AKWB 1VQPA 4RH6A 3OTOL 5IYDG 3GTOH 3AYHB 4CKBA 3CF5A 1D5XC 2WAQG 1T9HA 1F2LA 3A8IE 1IBLL 3H0GG 1Z6HA 2CH4W 2AUJD 2FMMA 1A15A 4RAUC 2QF7A 1SE4A 5M3FH 3MWYW 2RVLA 1XXGA 2B2YC 4GNXC 2JA5H 4A3BH 4DFAA 1EOTA 2QW7A 3CRKC 4NW2A 1FL0A 5C5MA 1HQRD 1Y8PB 3A5UA 1NE3A 4K0KQ 2Z0SA 4CJ1B 4DR5Q 1E2ZA 3DWPA 4K5XA 2E2JB 1EIHA 1PLFA 4L5SA 1D8LA 3HOVB 3CQZH 1R4PB 4HR7B 2FINB 4J15A 1TU2B 1WTHA 3PUZA 3N6RA 3ONAB 1RJTA 5IP9H 4KY5A 4JV5Q 1YIJA 1K0RA 5C3WA 2HQLA 2DN8A 3NTIA 4LF7L 1PTOC 1CK1A 1A3UA 4BS9A 5IT9E 1YJ9A 4AQYL 1WTQA 1Y8OB 1S5DD 3MFYA 3E9HA 1NUCA 4CJ0B 1ENFA 4OO1H 1TQOA 2ZJRA 2A6EC 2OQ0A 4FF1A 2Z8LA 4ME3A 1UEAB 2DY7A 1Q90A 3TZUA 4A3JH 4XQNA 3BYTB 3EQLC 1VQMA 4FF3A 3MVVA 3FKIG 1TWHB 2OF1A 3OWEB 3RMHA 1CT1D 1HXYD 4R8IA 3S1QH 5IT9L 1HPCA 4BWGB 4DV1Q 2F0NA 1Q1EA 2VQEQ 2RCFA 1NR4A 3M7NA 1SROA 2WB1B 1TKWB 3NELA 3PUYA 3SHLA 1OXTA 1E1OA 1LABA 1TWFH 4IUVA 1H95A 4EQ5A 4IALA 3IRBA 1YNJD 4BBSH 3S1NB 4JI4L 5C4ZA 4A3FH 3Q22A 1C0AA 4EX5A 1SJED 1HA5A 4A3MG 2IT1A 4L63B 1WCMB 1WOCA 4KV6A 1TIID 3J7AV 3EBEA 4OIKA 3RN2A 4X64Q 4ZK9B 1G91A 2IJ0A 4L6TB 4A3CH 1CKMA 4LUZA 5C3EH 5HGQA 3I2ZA 1ZEQX 1S5CD 4KK7A 1PRTC 2GVBA 2EVBA 2K5QA 4X6AH 5JJLA 2NYZD 3LGJA 4YCVA 4KHPQ 5J1ZA 4LF9L 2VB3X 2K32A 3G6JB 4LF4Q 4ZLTF 4IUQA 2EYHA 1Y8NB 1GJXA 2CQAA 1HZ9A 1IYVA 1LTSD 2QEJC 2CQOA 1VQ4A 3W1GA 1PA6A 4DR6Q 3MEHA 3M7GA 3M4OB 4ID6A 3U9SA 1SSOA 4H44C 1PTOH 4OGQC 5E4WC 2B63G 1ILPA 3GP7A 3CCLA 1EEID 1A6XA 1IHZA 3CP0A 2KOLA 1QOHA 3P75A 5D3IB 2A73B 1STNA 1G8ZD 5EGTA 2NZOA 4RGNA 2JA7H 1RL2A 2R92H 1Q12A 2F03A 1BF4A 2EXDA 3NPPA 4BXXH 1G291 3E6ZX 1ONLA 5ISRA 4YCUA 2NTTA 3HOYH 3ND8A 3HGBA 2PQAA 4IJLA 2L0CA 4HCSA 4A3IB 5I6YA 3HOZG 5GAGC 1N36Q 2PQAB 3CW2C 3NEMA 1NNXA 3O13A 3E0EA 5DM63 2ZXOA 2IWHA 4ZKBB 2MNAA 1S72A 4ZYSA 3MZ5A 2HHHQ 2XWBB 3S2HB 1ILQA 3OIQA 1X3EA 1EL0A 2LFNA 4IN3A 3NHHA 4FYDA 3MTSA 5FO8B 5T1GA 1D1KA 1VQ5A 4JI6L 2LY7A 3QIAA 4I7ZC 4DK0A 1F2MA 1TS3A 4HN7A 2VW9A 4JBKA 1UWVA 3MXGA 3QJYA 5EAYA 1TWAH 4OXPA 4G7ZC 1BOSA 3ITPA 2IX1A 2K5WA 4DGZA 3QG1A 1EQQA 1MSHA 1G51A 4JPBW 2O5JC 4B3RQ 1I5FA 1IBML 2VZAA 1HRJA 2I0QA 2RKSA 4A3GB 1KNAA 3S1MB 3J81E 4JW0A 1HTPA 4BBRH 3Q6SA 3P7JA 1Y1VG 1XX8A 4DAYA 1KTKA 2WB1E 3K7AB 4AH6A 3CCQA 2B2WC 4LFBQ 2EZVA 3HP3A 1ZYRC 4U673 2E76C 4OHJA 4LFAQ 5T1IA 2E2HH 2JEBI 1PH9A 1OXXK 2K7VA 1XNRQ 2P5ZX 4N9TA 2HUGA 1K8AC 1IXRA 1V8QA 2AQ1B 2EIFA 3TS2A 1JJ2A 2NVYH 1SJHD 2MJ8A 4PMWA 4LF6L 2F4VL 2RBMA 1STBA 1MI2A 2WACA 4ZUIA 2IHFA 1QNUA 1C7YA 1VQJA 4RWSC 4XXEA 3M4PA 1KIXA 2B8GA 2MUYA 4YHHL 1B7YB 4IQZA 2R7ZB 3FKIH 4MIUA 4JBMA 1A3TA 2SNSA 3EA6A 2Z6BA 1PH2A 2YU9B 2JA6G 1DOMA 2G9HD 2R6GA 3HOXB 2PZWA 4GOPC 2RCNA 4KTAA 4XQQA 5IGCA 3DLLA 1C8CA 5IODA 1N32L 1SYGA 2L55A 5J22A 4A3EB 1TR5A 3HKZB 2A74C 1HR0Q 1IKLA 1L1OA 3TZDA 3X3NA 3PUVA 2B2TA 1L1OB 1L0WA 3KFUA 1AZQA 2VXWA 1YEZA 5FLXE 2OCEA 2UU9L 3CD6A 4V190 1DM0B 5M5WB 4ILWA 3D3RA 1A3VA 2EYFA 4DN4M 3U4ZA 4B3SQ 2PQEA 5DNFA 3GTQH 1PVOA 3QOLA 1OXUA 4TRDA 4IJHA 4RMFA 2GA4B 1E22A 2ZTCA 1EY4A 3D4WA 4X3UA 2GN5A 4HIKA 3URYA 4MZ9A 5FLXL 2KHJA 1I94L 2KCTA 2IX3A 1PHJA 5AFWA 4GKKL 4H0LC 5DAUA 1WTXA 3A54A 1LTID 3FVQA 5L37A 4IFDI 3MXNA 4DV7Q 4DV3Q 1KD1C 2B63H 1YITA 1I4XA 4RGOS 4A4IA 4XYQA 4LMQD 1GO3E 1O78A 2XWJB 4K2LA 5C44G 4WJ4A 3PIPA 4O0AA 2N88A 3DM1A 1HNWQ 3FRPB 1Q1BA 2NTSA 2KECA 1Q46A 3UDIA 1F77A 2AHOB 1IL8A 2UUBL 4B3TQ 4OWTB 2R7DA 2Q8TA 1JCKB 3MEFA 4LAAA 2QDBA 4HAEA 3K59A 1YHBA 1S5BD 3K8AA 1TWGH 1EIFA 3J80L 1K9MC 4JYAL 3HOZH 3L7ZC 5FOBB 3D4RA 3ND9A 1R9TH 1GUNA 3KF6A 2K1BA 4B9XA 1QB5D 3T1HL 4RKBA 2ENBA 1VQIA 3QOJA 1PTOF 5I2YA 2AMCB 3CKIB 3OTOQ 4A3LG 3NENA 3U4VA 2B2UC 5M5XB 4TQUS 2LSSA 2NVTH 4KI0A 1SYCA 4Y7NH 2CW0D 1AE2A 2EJMA 4R4IA 1ZXTA 1N33Q 4RCOA 4DV4Q 2L1BA 1A8VA 4DV5L 4PV1C 5IT9c 1B3AA 4WORA 5K5PA 2AUKA 3BYYB 3SK5A 3I4MH 3BZDB 2F0VA 5GQOA 4LW1A 2XSCA 5IE8A 2AQ3B 3I91A 4TKOB 1HZAA 3UDGA 5JJKA 2KENA 3BS1A 2XRQD 4G57A 4GOPA 2KHSA 4FXGC 4JI5Q 4A75A 3ULLA 1ESRA 3MFGA 3TP8A 3F1ZA 3BZCA 4QMGA 3J81i 2X6LA 3MXPA 4RKLA 1TVXA 4N8X1 1D2BA 2VY3A 3E5SA 1GVPA 3W5OA 3JC66 1U0LA 4IFDG 5DEHA 1H9KA 4HJ7A 2JP1A 4EQNA 1STEA 1G6PA 3HKZE 2LMCB 1M8AA 3L3OC 1I6HB 2KA7A 3J7ZC 2LKVA 4AQYQ 3T1YL 3NBHA 2E2DC 2L4NA 1EU4A 4HSPA 1R4QB 4LUVA 4G7OC 2WB1G 2EYPA 1DZ1A 1STYA 1ASYA 2I5HA 1I50B 4A3KH 4GKJL 1H9SA 1YNND 1D7QA 3PCOB 1UNSA 5K36H 1X6OA 3S2DH 4NXNQ 2YTXA 4JI1Q 1SNDA 4NPSA 1AFPA 1PRTF 1KXLA 3K80C 4IFDJ 2F0HA 1PH3A 1YNJC 1M4VA 1Y1VB 2F0KA 3OWFA 4HJ5A 2A5HA 1WCMG 4A93B 3S24A 3TEHB 2BA1A 5IGEA 4QUCA 3PUXA 3CCUA 1WTOA 2JA6H 2ZTEA 1B4OA 3GTKB 1I3QB 1KDAA 1JORA 2PZTA 2NVXH 3CC2A 1GUTA 4JI7Q 1QVFA 3RD4A 2RF4A 4JI4Q 3M9BA 1S5ED 3SVMA 5ELBA 2K5DA 3S17B 1TT2A 1UE5A 1XMOL 1VQGA 3GTLH 1N34L 1XTDA 1ML0D 4IPCA 1BBXC 1ASZA 3M3YB 1Q8IA 2BH8A 3TMEA 4HTHA 2C9OA 2CWPA 4QQBX 2A6HD 1U4RA 3EFXD 2O2LD 2J4XA 3BG3A 1SLJA 4LF9Q 4Y52H 2N78A 4EGVA 3PMFA 2BOSA 3PV0A 3WDNA 4DV2L 3K7UC 1Q3LA 4C1NK 3K81C 4G4KA 3KK7A 5ELFA 3ZJYC 4YY3L 2F0UA 3BDCA 4QCLA 2A8VA 4RG1A 1ET6A 2A69D 4A3DB 2KCMA 1CKNA 3F2CA 2QEXA 5IOCA 1CKNB 1K3RA 4UP9A 3OHXC 3ULPA 4CDDC 2F0QA 1EQTA 1H9RA 2MHVA 2XGTA 2VUMB 4FDBA 3PO2G 4NMZA 5DLQE 2ASBA 3A55A 2E2IH 4X66L 4V0BA 4JVZA 2KCNA 2K5NA 1PFNA 1NTGA 1JR0D 4DXGA 4OIJA 2F1MA 2D9UA 3FDTA 3J81c 5EKIA 1G2SA 5IWAQ 3KF8A 3WOEA 1W2BA 4M8AA 1B2TA 4A3GG 4OL7A 2CCZA 5IGFA 3KF8B 1QUQA 4GN4B 3V96A 2UXDQ 1B8AA 5FLMG 1QUQB 3CCRA 4OX9L 2VB2X 4R4CA 3Q23A 2E2JH 3K5LA 1EY5A 1V9PA 3J7AF 1LYLA 2GVAA 3HOVH 4Q5VA 4WFN3 4DR1L 3TP6A 1QVGA 4X3KA 1JWUD 4IUNA 2DNCA 5C5LA 3VR2A 3A0JA 5LMNQ 4JI0Q 3R8BA 1SNPA 1YJNA 5FK9C 3HOUB 2CH4A 4MNOA 2Q8RE 1RD9D 2N49A 1NMFA 1NY4A 2BCOA 1XPOA 1SYBA 5C4JB 5KEEA 1SR3A 3Q24A 1E3PA 2F0FA 1K83H 4C56C 2EDGA 1EY7A 2M2LA 2BDOA 1FGUA 4RCNA 5CMDA 4JI3L 5I4DA 1O7IA 4QB4A 2R7ZG 4H02A 4IFDH 4KKSA 3RZDB 1F9RA 1SE3A 1KRSA 3R2TA 1E24A 4JOIA 3G6EA 3KLSA 3RLNA 2RHSB 3HOXG 4KN7C 1SBBB 4R1JA 2UXCL 2WFWA 1GOZA 4EQOA 2F4VQ 1VQAA 4A3EG 4N9PA 2VQFL 3HKZG 1RTNA 5FLXc 1EQRA 1K73C 4O2DA 3STBD 2R61A 1FYCA 1QZHA 3KLSX 5KYLA 1MGSA 1JT8A 1GHJA 1XJVA 2ZTDA 1WCMH 3K57A 1UEBA 3D6WA 1FJGQ 1SNMA 4KY6A 2R3ZA 5M3MB 1IYUA 3BDOA 2DJFC 1N32Q 1VQEA 3K58A 4S3SA 2UXBQ 4DV0Q 1JB7A 2JN4A 2Q2TA 4A3BB 2XVSA 5IYBG 2J7ZA 2K28A 3T4AC 4B3ML 2F3IA 2PMZB 5JEAJ 3PF4A 3F2UA 1NJIC 4TVAB 4L5QA 2HDLA 1TXYA 3IL8A 4LFCL 2EYJA 3M4OH 3CRLC 3MAQA 4DR7Q 5CV6A 4DAPA 1VF5C 1QILA 3CQZB 4B9WA 4L5RC 4CDCC 4C3JB 4H13C 5HURA 4ODGA 1HA6A 1CKOA 3HFZB 1D6EC 3CCEA 1KAWA 4H7BA 4CKEA 5EPKA 2QDLA 4FF2A 3KDFA 1E2VA 1EWIA 2UUCL 1EZ6A 3UI2A 3KDFB 1SE8A 4CDEC 1I94Q 5EJWA 5BR8L 5GROA 4K8IA 4U68A 2O5IC 3SK4A 2EYLA 1UUPA 3GTMB 4A3IH 2XTIA 4LF5L 1NBWA 4JC0A 3QB3A 1CM9A 1EIGA 3B6YA 4KN4C 3WOFA 2KEEA 2KUMA 2IW3A 4EVOA 2ZM6Q 1STAA 2E5LQ 4QGUA 2FHTA 1N8RC 3S2HH 4DR3L 2KQ3A 2O4XA 2NBFA 4DV6Q 2Y0SB 2OTLA 3S1RH 4Z9CB 2OEOA 2JE6I 4DUYL 1XMQL 3WWVA 1L1OC 3OOCA 1SYFA 2CW0C 4GLXA 1PYBA 1YHQA 4BBSB 2B2TC 1X3GA 5H1SE 1PH5A 4OWWB 1F9SA 1EYCA 1K8MA 3VA7A 4A3GH 1HTLD 1J9OA 2UUAL 4OONA 4GNXB 2H1EA 4NXML 1X3PA 4PNYA 1FNUA 3NBIA 3VA5A 2QGQA 3K7AH 5C4XH 3NK9A 1T5EA 1V1PB 4DV5Q 1VQKA 5IGDA 3GV3A 5HGTA 1Z47A 2F0TA 5AJ3L 1VQ7A 4C3HH 1K8GA 1S5FD 5LMUL 1AE3A 5IYDH 3AB9A 3PO2B 4IPDA 4LNQA 5I6WA 3H0GH 3A8KE 1MSGA 1TS4A 1CZWA 3S9WA 3I8ZA 1BCPB 2K5HA 2X69A 5COYA 1A2UA 3OW2A 4KKUA 1F9QA 3G7LA 2D0OA 1CTMA 1SE2A 1YNNC 1DGSA 3SXHA 3JAML 5CR3A 2EQSA 2JSOA 1LLRD 4A93G 3M85A 3CC4A 4NKLA 4KY7A 1V43A 4LF8Q 2OWOA 4KJNA 1J5EL 2PMZE 2YU9H 1PV4A 3AEVA 4P73A 4WJWA 1SN8A 3AFQA 3HOYB 2F0GA 2PO4A 1JOQA 4QF4A 4GKJQ 3HOXH 2F0EA 3RLFA 2Z1CA 4K14A 3LWUA 2I5MX 4IUUA 2EYMA 2YV5A 3W3AA 4TSSA 3CC7A 3MA2B 5ELOA 4ZRZA 2XN9C 2NVQH 3NE5B 2ALYB 1Y69U 4DPGA 2J0TD 5JPNC 1DCZA 1QZGA 1X56A 4G7HC 1G6ZA 1VQHA 2A68D 2JA8B 1S4ZA 2TSSA 3VDYA 3FPPA 1EOVA 4K0KL 3PO3B 1SEBD 4DR5L 1WFQA 5M5WH 4R4TA 1U4PA 4BY1B 3OMGA 1TS2A 2CVRA 3CAMA 5G3LD 1CHQD 1KRTA 4KHZA 2FXQA 2A6HC 1VF7A 4X62Q 2QA4A 4JV5L 1GUGA 3EROA 2F0SA 1VQDA 5IYBH 1XMOQ 1FD7D 1E1TA 1N34Q 2NN6I 4XDXA 4I65A 3D8GA 3CPFA 1M90C 5ELEA 4M1UB 5IGGA 3GDEA 5C0XI 2Y0SE 2F0OA 3ERSX 2D2CC 2K50A 1TS5A 4UAIA 4A3DG 1BCPD 2MP1A 2JQOA 4A3MH 2K33A 1PYWD 4ULLA 5GAEC 4F87A 2A69C 4MTNA 4KMUC 4IOAA 1S3OA 2VUMG 2L11A 4DV1L 1B1ZA 1X55A 4YIJA 2VQEL 3FPUB 2RSOA 4JI8Q 1BKBA 3VR5A 5CV7A 1YVCA 3PUWA 2OQKA 4C2MB 1P16A 1VQ6A 1B50A 4R4OA 3KJOA 4FVMA 1YNXA 1GHKA 1NAPA 1VDZA 3T53B 2WINB 1K28A 1YBYA 1U4LA 1X3FA 5EKKA 1HZBA 1O7ZA 3J80E 1RCVD 2WKDA 4LK1C 2NZ1D 4X64L 4X66Q 3S15B 2KHIA 3P1HA 1STHA 3TP7A 1HR0W 3OPOA 3R3OA 3R2IA 4CKCA 4JI2Q 1LUZA 2EOTA 3NTHA 5LL6X 4BY7B 4KHPL 2B39A 4DR4Q 3AQQA 2MO0A 1ENCA 4GLVB 1PFSA 1KQSA 3HOUG 1QG7A 2FMCA 4OX9Q 4OELB 2NN6G 2KVMA 1Z7TA 5ELCA 1Y1WB 3K5NA 3Q8DA 4DR1Q 1XNQQ 4A76A 5C0XG 2SNMA 3MXUA 2F0LA 3NWTA 1WTRA 3ERQA 2EPBA 1CA6A 1RF2D 3I4NB 1I6HH 1IBLQ 4L8JA 3V05A 1SYDA 2K04A 2X6GA 2R93B 4EQPA 1LTRD 1B44D 1A0IA 3CCMA 1W6KA 4ZKCB 3FMCA 1JICA 1ZKOA 1HCZA 3LWEA 4P75A 3NQIA 1KDCA 4YWMA 2Z6KA 1SNQA 1PZID 1N36L 2ZXRA 1JJCB 2K75A 5GAHC 5C0XJ 1DXMA 1Y1VH 1HNZL 3KLRA 2B3GA 3STBC 4QJFA 2F0WA 3S16B 5M3MG 5IY0A 1IKMA 2UXCQ 1MHWC 3EVQA 3S14H 3GTKH 1I3QH 5CV8A 1HQMC 4LF7Q 1TWGB 3M4YA 1BO0A 3NSWA 2HIVA 2B8FA 2F52A 4A3BG 1C4QA 4XT3B 1RIPA 1U9RA 3TDQA 3S17H 2EJFC 2K05A 2ES2A 5KNBA 2K4KA 3CU7A 1JE4A 4DF7A 1L0XB 2CFMA 4RA8A 3NXWA 1J6QA 4BA1I 3GTJB 3DXJC 1YI2A 2NZHA 1AP0A 2N55A 3M3YH 1UE6A 2NVTB 4ZUJA 4RGTA 5D3DA 4HJAA 4C3JG 1YJWA 1DJRD 2CWAA 1N9WA 1EZ8A 2V4DA 4LFBL 4KD3A 4XQJA 3VYSA 3C46A 4LFAL 3I4MB 1PH8A 5CV4A 5CYUA 2SOBA 4B3MQ 2F0PA 1EUJA 3I4LA 5JPMC 2PI2E 1XNRL 3X3MA 1KHIA 2Q8IB 2L15A 3I70A 4LUOA 1S40A 1XPRA 4O1NA 1IL2A 3QWNA 3L2PA 4O42A 4DUZL 4UY8C 2DGYA 3Q0AA 5E1FA 3GTPB 1O7LA 4JOIC 3PIO3 2RA4A 4F88A 3ER0A 3FP9A 2Y0SG 3TRZA 4WRDA 4J6HA 1LTLA 4XYOA 5EPJA 2VUMH 5BR8Q 4NP5A 1TWCB 4A3KB 4J1MA
chains in the Genus database with same CATH topology
3KUPA 1EY8A 5JVH3 2G9DA 5J39A 1EQVA 3OMCA 1EY0A 4MN3A 3DHQA 2PW5A 1GXDC 2EE1A 3KBGA 1AN8A 1JOOA 4AYBB 3LNNA 5BN3A 3HOWB 2NVXB 1EU3A 2PNRC 3P20A 5FO9B 3A7AB 2JYOA 1E2WA 5JOBA 3RZOB 4HEDA 3VYRA 4K2KA 3GTGB 1JWSD 1XYIA 2HQEA 2NN6H 3NP8A 2RSNA 2EXZA 5C0XH 3D6CA 5M5YB 1BQQT 1PMRA 4F8MA 4LJZC 2ZXPA 1ENAA 4E6IA 2E74C 1IW7C 1PZKD 2AQ2B 4C3IB 5NUCA 4KKTA 3MHBA 1RDPD 1JC7A 5IIFA 2HCCA 3SK8A 1D1IA 4DXFA 4JBWA 3SE0A 4B08A 4FXDA 2SDFA 1WTVA 3ZYYX 1ET9A 3H6MA 2F0DA 1SNCA 2E2IB 3T51B 2A68C 1WTWA 3SEBA 4KHVA 4RHSA 1H9JA 3DMUA 4HCEA 1CQFA 2BDNA 2I07B 1I4QA 2ID0A 2EY2A 2XRSD 5JEAG 3IFDA 1EY9A 3K0YA 2L5TA 1WVLA 1SFOB 3K5OA 1CI3M 4K8JA 3T56B 1I4PA 1EY6A 2FFKB 3DWAA 1I4GA 3VYUA 3GTOB 1DOKA 1OXVA 1QWYA 1BCPC 2F4IA 3BVMA 3SDZA 1KABA 4FO2A 5I2XA 1CZGA 1NSNS 4X3SA 5M3FB 2ZT9C 2JA5B 1B9NA 1DONA 2B2VA 1QJOA 1K83B 1LTTD 5F2DA 4IUPA 2EY6A 2YYZA 3V2TA 1LT3D 1GUWA 4XTCS 2RDGA 4HSVA 2H4OA 2KCCA 3VYTA 4CJ2C 5EQ0A 1MBYA 2BE5D 1BDOA 3SR1A 1DOLA 1NCVA 5E4XA 1VCIA 2WP8J 1O80A 3NWSA 4R8NA 2IX0A 2DY8A 4A3JB 2MPMA 1F2ZA 2HDMA 1I4RA 1LTBD 1NR2A 3S1QB 5E3FA 1X3QA 3E0JA 1FR3A 5JVG3 4PMBA 1LT4D 1OXSC 1TWFB 2XIWA 1PZJD 3H09A 3AMUA 1KDBA 5C6AA 2F0MA 3DEPA 2EYOA 2F3WA 4A3FB 2B2YA 4IZ8A 5KNDA 5KNCA 1V1OA 2DNEA 3SK6A 3IAYA 1V1PA 1RTOA 5C3EB 1SMYC 1AEXA 5A35A 1K8OA 1B53A 3JAME 3KBXA 3C1FA 5KIXA 4J8QA 4DAVA 3H91A 3LX0A 1HUMA 1PTOB 2PZUA 3K6OA 1CA5A 3S1RB 1KAAA 1IW7D 1PFBA 2C5CA 2K01A 5LL6S 2JA7B 2R92B 2IPKD 5BN5A 4XIGS 3H3VC 1F9PA 1RODA 2NUCA 1B9MA 3U9OA 1HFGA 4ZQ3A 1LV9A 1SAPA 4FNFA 2KJXA 1WD0A 3I73A 3A8JE 1L0YB 2OXPA 3GQBA 5BN4A 5C4HA 1E0BA 5JEAH 5C4XB 1HHVA 4RFBA 1QE6A 2L12A 5CBAE 1H9MA 2QILA 4PMCA 2NWGA 1T5XD 2MGSA 1PXUA 4C3HB 2JEAI 1CFMA 1SXTA 5CGKA 3HG9A 3J81L 2WAQB 3TBIB 1TWAB 3IFTA 3H0GB 1LACA 1EWHA 3TP5A 4K5WA 5K36G 1SNOA 5KRUA 1HUNA 1LTAD 1GUSA 1PRTB 1WTPA 5LHY1 2Z4HA 4BBRB 2PYKA 3R93A 2Z4IA 4KJOA 2K6AA 4P2CB 5CC4A 5IGBA 4K5VA 1PTOD 2M00A 1F2YA 2QCPX 4QUFA 1PFMA 2WV6D 3A56A 1VMPA 2E2HB 1II3A 2D5DA 4HMJA 1TY0A 3GV6A 2A6ED 4NDXA 2NVQB 5M9OA 1G6ZA 2F0IA 4FXKC 2NVYB 1QNKA 1VMCA 2RDHA 5CBEE 2EY5A 3PIP3 5JAVA 1ICWA 3BVZA 4XT1B 3I72A 2BA0A 3HZXA 3FKIB 4FP5D 1C48A 5C3XA 2K03A 1FNWA 1XTCD 3VR4A 2EJGC 1EWCA 4K6DA 1BR9A 1BXTA 2AWOA 3C3LA 4C3IG 1OO9B 1DYQA 2EY1A 2F0JA 1SDFA 2FJ2A 3H94A 4DU9A 1XWEA 5EBDA 2KEDA 1CHPD 3D4DA 3T13A 1QCBD 5JJZA 4DA2A 1U4MA 4A3MB 4ME5A 1PRTD 1STGA 4C1NI 4QIWB 5G3LF 4Q0FA 3AU7A 3HEJA 3DEOA 3GTQB 2B2WA 3OIPA 4JK1C 1PDQA 2M9VA 3HRZC 1TY2A 4OO1I 2QKIC 4ZAIA 1RHPA 2CHBD 3GD7A 1FGBD 3BVGA 5CV5A 2WIIB 4PQXA 1BCPF 3VR3A 1KLGD 2B63B 5FO7B 3MC0B 1SMYD 4IUTA 3DUZA 3QO2A 3TN2A 2LS01 2XNAC 4BA2I 4HMIA 3W2DA 4MHEA 1I4HA 5FKAC 4CHTB 5D65A 5KYIA 5A2QE 3HOZB 2VNUD 1R9TB 2PCFB 4UDUC 2I46A 4DNTB 4KD4A 3CHBD 2WKCA 4Y7NB 1JWMD 4GZYC 3RUZA 2F3VA 3D31A 5A2QL 5I9OA 3OSOA 1AZPA 5EBCA 1RKNA 2BE5C 1JB3A 1EYDA 2OT2A 1H9SB 1D5MC 1KNEA 1J8IA 4OO1G 3GO5A 1ZYRD 1JQYD 4DNRB 1SYEA 1CQVA 2SEBD 3NTKA 1D5ZC 5CORA 3L9AX 3S14B 4RHRA 4RGMA 2L9HA 3I90A 3FEWX 5CV9A 1GUOA 3T16A 4IURA 3VR6A 3BDLA 2HCIA 3OW7A 2ICIA 4DK1A 1X32A 3S2DB 5I9PA 2PPBC 1LO5D 5ELDA 1KLUD 4F7XA 3N52A 4CGYB 1AW7A 3HS0C 1A2TA 1EFID 2D62A 4R9WA 2JA6B 3EJIA 5DM73 3NQTA 3NUCA 2B2UA 3C2PA 1ESFA 2B2VC 3A7LA 2JXMB 2NB0A 5KGUA 5EPLA 1G2TA 4K6LA 5TSSA 3GTLB 1LT5D 1EEFD 2RQXA 2TMPA 5D14A 3I3CA 2AWNA 2PW7A 1O7YA 2RDFA 3TSSA 4FF4A 1EYAA 1BUVT 3IKJA 3C1EA 1UAPA 1WD1A 1HFNA 2IL8A 2ICEC 1JOKA 1LTGD 4CBVA 3K5MA 1W6JA 3J7YW 3DWQA 2E75C 1MD2D 5EKLA 1DD2A 4ABNA 1FNVA 4X3TA 5C44B 1BNZA 1I6VC 1LT6D 4C3HG 4RH6A 4CKBA 1D5XC 1F2LA 3A8IE 1Z6HA 2AUJD 2FMMA 1A15A 4RAUC 2QF7A 1SE4A 3MWYW 2RVLA 1XXGA 2B2YC 4DFAA 1EOTA 3CRKC 4NW2A 5C5MA 1HQRD 1Y8PB 4CJ1B 1E2ZA 3DWPA 4K5XA 2E2JB 1EIHA 1PLFA 3HOVB 1R4PB 4HR7B 2FINB 1TU2B 3PUZA 3N6RA 3ONAB 1RJTA 4KY5A 5C3WA 2DN8A 3NTIA 1PTOC 1CK1A 1A3UA 4BS9A 5IT9E 1WTQA 1Y8OB 1S5DD 3MFYA 1NUCA 4CJ0B 1ENFA 4OO1H 1TQOA 2A6EC 4FF1A 2Z8LA 1UEAB 2DY7A 1Q90A 3TZUA 4XQNA 3BYTB 3EQLC 4FF3A 3MVVA 1TWHB 2OF1A 3OWEB 3RMHA 1CT1D 1HXYD 4R8IA 5IT9L 1HPCA 4BWGB 2F0NA 1Q1EA 1NR4A 3M7NA 2WB1B 1TKWB 3PUYA 3SHLA 1OXTA 1LABA 4IUVA 4IALA 1YNJD 3S1NB 5C4ZA 3Q22A 1SJED 1HA5A 2IT1A 4L63B 1WCMB 4KV6A 1TIID 3J7AV 4OIKA 4ZK9B 1G91A 2IJ0A 4L6TB 1ZEQX 1S5CD 4KK7A 1PRTC 2EVBA 2K5QA 2NYZD 5J1ZA 2VB3X 2K32A 3G6JB 4ZLTF 4IUQA 2EYHA 1Y8NB 1GJXA 2CQAA 1IYVA 1LTSD 2QEJC 3MEHA 3M7GA 3M4OB 4ID6A 3U9SA 1SSOA 4H44C 1PTOH 4OGQC 5E4WC 1ILPA 3GP7A 1EEID 1A6XA 1IHZA 2KOLA 1QOHA 3P75A 5D3IB 2A73B 1STNA 1G8ZD 5EGTA 4RGNA 1Q12A 2F03A 1BF4A 3NPPA 1G291 3E6ZX 1ONLA 5ISRA 2NTTA 3ND8A 3HGBA 2L0CA 4HCSA 4A3IB 5I6YA 3O13A 5DM63 2ZXOA 2IWHA 4ZKBB 4ZYSA 3MZ5A 2XWBB 3S2HB 1ILQA 3OIQA 1EL0A 2LFNA 4IN3A 3NHHA 4FYDA 3MTSA 5FO8B 5T1GA 1D1KA 2LY7A 3QIAA 4I7ZC 4DK0A 1F2MA 1TS3A 4HN7A 3MXGA 3QJYA 4G7ZC 1BOSA 3ITPA 2IX1A 2K5WA 4DGZA 3QG1A 1MSHA 2O5JC 1HRJA 2RKSA 4A3GB 1KNAA 3S1MB 3J81E 1HTPA 3Q6SA 3P7JA 1XX8A 4DAYA 1KTKA 3K7AB 2B2WC 2EZVA 3HP3A 1ZYRC 4U673 2E76C 4OHJA 5T1IA 2JEBI 1OXXK 2K7VA 4N9TA 2HUGA 1V8QA 2AQ1B 1SJHD 2MJ8A 4PMWA 2RBMA 1STBA 1MI2A 2WACA 4ZUIA 1QNUA 4RWSC 4XXEA 2B8GA 2MUYA 4IQZA 2R7ZB 4MIUA 1A3TA 2SNSA 3EA6A 2YU9B 1DOMA 2G9HD 2R6GA 3HOXB 2PZWA 4KTAA 4XQQA 5IGCA 1C8CA 5IODA 1SYGA 2L55A 5J22A 4A3EB 1TR5A 3HKZB 2A74C 1IKLA 3X3NA 3TZDA 3PUVA 2B2TA 1AZQA 2VXWA 5FLXE 4V190 1DM0B 5M5WB 4ILWA 3D3RA 1A3VA 2EYFA 4DN4M 2PQEA 5DNFA 3QOLA 1OXUA 4TRDA 2GA4B 1EY4A 3D4WA 4X3UA 3URYA 5FLXL 2IX3A 5AFWA 4H0LC 5DAUA 1WTXA 3A54A 1LTID 3FVQA 4IFDI 3MXNA 1I4XA 4RGOS 4XYQA 4LMQD 1O78A 2XWJB 4K2LA 2N88A 3DM1A 3FRPB 1Q1BA 2NTSA 2KECA 1F77A 1IL8A 2Q8TA 1JCKB 4LAAA 2QDBA 4HAEA 3K59A 1S5BD 3J80L 3L7ZC 5FOBB 3D4RA 3ND9A 1GUNA 2K1BA 4B9XA 1QB5D 4RKBA 2ENBA 3QOJA 1PTOF 5I2YA 3CKIB 2B2UC 5M5XB 4TQUS 4KI0A 1SYCA 2CW0D 2EJMA 1ZXTA 4RCOA 2L1BA 4PV1C 1B3AA 4WORA 5K5PA 2AUKA 3BYYB 3SK5A 3BZDB 2F0VA 2XSCA 2AQ3B 3I91A 4TKOB 3BS1A 2XRQD 4G57A 2KHSA 4FXGC 1ESRA 3MFGA 3TP8A 4QMGA 2X6LA 3MXPA 4RKLA 1TVXA 1D2BA 3E5SA 4IFDG 5DEHA 1H9KA 2JP1A 4EQNA 1STEA 2LMCB 1M8AA 3L3OC 1I6HB 2KA7A 2LKVA 3NBHA 2E2DC 2L4NA 1EU4A 4HSPA 1R4QB 4G7OC 1DZ1A 2EYPA 1STYA 1I50B 1H9SA 1YNND 1UNSA 5K36H 1SNDA 1AFPA 1PRTF 4IFDJ 2F0HA 1YNJC 1M4VA 1Y1VB 2F0KA 3OWFA 4A93B 2A5HA 2BA1A 5IGEA 4QUCA 3PUXA 1WTOA 1B4OA 3GTKB 1I3QB 1KDAA 1JORA 2PZTA 1GUTA 3RD4A 3SVMA 1S5ED 5ELBA 2K5DA 3S17B 1TT2A 1ML0D 1BBXC 3M3YB 1Q8IA 3TMEA 4HTHA 2C9OA 2A6HD 1U4RA 3EFXD 2O2LD 2J4XA 3BG3A 4EGVA 3PMFA 2BOSA 3PV0A 3WDNA 1Q3LA 4C1NK 4G4KA 3KK7A 5ELFA 2F0UA 3BDCA 4QCLA 1ET6A 2A69D 4A3DB 5IOCA 3OHXC 2F0QA 1EQTA 1H9RA 2MHVA 2VUMB 4NMZA 3A55A 4V0BA 2KCNA 1PFNA 1JR0D 4DXGA 4OIJA 2F1MA 2D9UA 3FDTA 5EKIA 1G2SA 3KF8A 3WOEA 4M8AA 1B2TA 4OL7A 5IGFA 3V96A 2VB2X 3Q23A 3K5LA 1EY5A 3J7AF 4Q5VA 4WFN3 3TP6A 4X3KA 1JWUD 4IUNA 2DNCA 5C5LA 3VR2A 3R8BA 1SNPA 5FK9C 3HOUB 2Q8RE 1RD9D 2BCOA 1SYBA 5C4JB 5KEEA 3Q24A 2F0FA 4C56C 2EDGA 1EY7A 2M2LA 2BDOA 4RCNA 5CMDA 5I4DA 4QB4A 4IFDH 4KKSA 3RZDB 1F9RA 1SE3A 3R2TA 3KLSA 4KN7C 1SBBB 1GOZA 4EQOA 4N9PA 1RTNA 2R61A 1FYCA 3KLSX 5KYLA 1MGSA 1GHJA 3K57A 3D6WA 1SNMA 4KY6A 2R3ZA 5M3MB 1IYUA 3BDOA 3K58A 4S3SA 4A3BB 2XVSA 2J7ZA 2K28A 3T4AC 2PMZB 5JEAJ 3F2UA 2HDLA 3IL8A 2EYJA 3CRLC 3MAQA 5CV6A 4DAPA 1VF5C 1QILA 3CQZB 4B9WA 4C3JB 4H13C 5HURA 4ODGA 1HA6A 1D6EC 4H7BA 4CKEA 5EPKA 4FF2A 1E2VA 1EZ6A 3UI2A 5EJWA 4K8IA 4U68A 2O5IC 3SK4A 2EYLA 1UUPA 3GTMB 3QB3A 1CM9A 1EIGA 4KN4C 3WOFA 2KEEA 2KUMA 2IW3A 4EVOA 1STAA 2FHTA 2KQ3A 2O4XA 2NBFA 2Y0SB 4Z9CB 2OEOA 2JE6I 3OOCA 1SYFA 2CW0C 4BBSB 2B2TC 1F9SA 1EYCA 1K8MA 3VA7A 1HTLD 1J9OA 2H1EA 1X3PA 4PNYA 1FNUA 3NBIA 3VA5A 3NK9A 1T5EA 1V1PB 5IGDA 3GV3A 5HGTA 1Z47A 2F0TA 1S5FD 3AB9A 3PO2B 5I6WA 3A8KE 1MSGA 1TS4A 1CZWA 3S9WA 3I8ZA 1BCPB 2X69A 5COYA 1A2UA 4KKUA 1F9QA 3G7LA 1CTMA 1SE2A 1YNNC 3SXHA 3JAML 5CR3A 2JSOA 1LLRD 3M85A 4NKLA 4KY7A 1V43A 4KJNA 4WJWA 3HOYB 2F0GA 2PO4A 1JOQA 4QF4A 2F0EA 3RLFA 2Z1CA 4K14A 3LWUA 4IUUA 2EYMA 3W3AA 4TSSA 3MA2B 4ZRZA 2XN9C 3NE5B 1Y69U 2J0TD 5JPNC 1DCZA 4G7HC 2A68D 2JA8B 1S4ZA 2TSSA 3FPPA 3PO3B 1SEBD 1U4PA 4BY1B 3OMGA 1TS2A 2CVRA 5G3LD 1CHQD 4KHZA 2A6HC 1VF7A 1GUGA 3EROA 2F0SA 1FD7D 2NN6I 4XDXA 4I65A 3D8GA 5ELEA 4M1UB 5IGGA 5C0XI 2F0OA 2D2CC 1TS5A 4UAIA 1BCPD 2MP1A 2K33A 1PYWD 4ULLA 4F87A 2A69C 4KMUC 2L11A 1B1ZA 4YIJA 3FPUB 2RSOA 3VR5A 5CV7A 3PUWA 4C2MB 1B50A 4FVMA 1GHKA 1NAPA 1VDZA 3T53B 2WINB 1U4LA 5EKKA 1O7ZA 3J80E 1RCVD 2WKDA 4LK1C 2NZ1D 3S15B 3P1HA 1STHA 3TP7A 3OPOA 3R3OA 3R2IA 4CKCA 2EOTA 3NTHA 5LL6X 4BY7B 2B39A 1ENCA 1QG7A 2FMCA 2NN6G 2KVMA 1Z7TA 5ELCA 1Y1WB 3K5NA 5C0XG 2SNMA 3MXUA 2F0LA 3NWTA 1WTRA 3ERQA 2EPBA 1CA6A 1RF2D 3I4NB 4L8JA 3V05A 1SYDA 2K04A 2X6GA 2R93B 4EQPA 1LTRD 1B44D 1W6KA 4ZKCB 3FMCA 1JICA 1ZKOA 1HCZA 3LWEA 3NQIA 1KDCA 1SNQA 1PZID 2ZXRA 5C0XJ 1DXMA 3KLRA 2F0WA 3S16B 1IKMA 3EVQA 5CV8A 1HQMC 1TWGB 3M4YA 1BO0A 3NSWA 2B8FA 1C4QA 4XT3B 1U9RA 3TDQA 2EJFC 2K05A 5KNBA 3CU7A 1JE4A 4DF7A 1L0XB 4RA8A 3NXWA 4BA1I 3GTJB 3DXJC 1AP0A 2N55A 2NVTB 4ZUJA 4RGTA 5D3DA 4C3JG 1DJRD 2V4DA 1EZ8A 4KD3A 4XQJA 3VYSA 3C46A 3I4MB 5CV4A 5CYUA 2SOBA 2F0PA 3I4LA 5JPMC 3X3MA 2Q8IB 3I70A 4O1NA 3QWNA 4O42A 3Q0AA 5E1FA 3GTPB 1O7LA 3PIO3 2RA4A 4F88A 4WRDA 4J6HA 4XYOA 5EPJA 4NP5A 1TWCB 4A3KB 4J1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG1 A;  2LMC B;  1OXU A;  2JEA I;  1CFM A;  2KA7 A;  1H9R A;  1FR3 A;  2O5J C;  2D2C C;  4OO1 G;  4G7O C;  2E75 C;  4DNR B;  1IYU A;  1T5E A;  3BDO A;  1OXS C;  3IFT A;  1DD2 A;  1LAC A;  4JK1 C;  1H9J A;  1HTP A;  1EWH A;  1I6V C;  1H9S A;  2K33 A;  1DXM A;  2IT1 A;  2F1M A;  4H0L C;  5K36 H;  5K36 G;  2A69 C;  3KLR A;  4KMU C;  1GUS A;  3AB9 A;  5JEA G;  1GUO A;  3VR6 A;  2L5T A;  5KND A;  3LNN A;  3OW7 A;  3A8I E;  1Z6H A;  3A8K E;  5KNC A;  2AUJ D;  1ZYR C;  1CI3 M;  2EVB A;  1O78 A;  3GD7 A;  3VR5 A;  5BN3 A;  4DK1 A;  2QF7 A;  3T56 B;  2E76 C;  3PUW A;  1HQM C;  1YNJ C;  2DNE A;  2PNR C;  3M4Y A;  1Q1B A;  3P20 A;  2PPB C;  2B8F A;  3CRL C;  3VR3 A;  2JEB I;  2BA1 A;  1OXX K;  2K32 A;  1GHK A;  2K7V A;  3A7A B;  4KKU A;  1OXV A;  1VF5 C;  3SDZ A;  3PUX A;  1CTM A;  1E2W A;  1VDZ A;  3CRK C;  3T53 B;  1SMY C;  1Y8N B;  1GJX A;  1V8Q A;  1YNN C;  1IYV A;  2EJF C;  4H13 C;  1Y8P B;  5KNB A;  5A35 A;  1K8O A;  3M85 A;  2ZT9 C;  1GUT A;  3U9S A;  4H44 C;  1E2Z A;  4BA1 I;  3L7Z C;  1B9N A;  1V43 A;  2D5D A;  3DXJ C;  3D4R A;  4OGQ C;  3ND9 A;  2D62 A;  2DNC A;  1QJO A;  4LK1 C;  3VR2 A;  4BA2 I;  1GUN A;  1E2V A;  1A6X A;  2A6E D;  2NN6 H;  4HR7 B;  1TU2 B;  3PUZ A;  3N6R A;  2YYZ A;  2V4D A;  5C0X H;  3OPO A;  3RLF A;  2B8G A;  1PMR A;  3A7L A;  4IQZ A;  2O5I C;  3LWU A;  4LJZ C;  2JXM B;  1Q12 A;  4XTC S;  2DN8 A;  2E74 C;  2KCC A;  2PCF B;  3W3A A;  4TQU S;  1IW7 C;  1G29 1;  2A6H D;  3I72 A;  4KI0 A;  4KN4 C;  1ONL A;  2EDG A;  1Y8O B;  1IW7 D;  2BA0 A;  2BE5 D;  2EJM A;  3NE5 B;  2BDO A;  3I4L A;  4DNT B;  2R6G A;  1Y69 U;  4RCN A;  3ND8 A;  4KKT A;  3HGB A;  3MFY A;  4PV1 C;  1DCZ A;  2Q8I B;  1BDO A;  4G7H C;  3BG3 A;  4IFD H;  4OO1 H;  2A68 D;  5BN5 A;  2AUK A;  4XIG S;  2A6E C;  4KKS A;  3FPP A;  2NN6 G;  3VR4 A;  1VCI A;  1Z7T A;  2EJG C;  4GZY C;  1B9M A;  2AWO A;  3D31 A;  3PUV A;  3PV0 A;  1Q90 A;  4TKO B;  3WDN A;  3TZU A;  4JBW A;  5C0X G;  4KN7 C;  2JE6 I;  3EQL C;  3MXU A;  3SE0 A;  3IKJ A;  4KHZ A;  1O7L A;  3OOC A;  2A6H C;  1VF7 A;  3I73 A;  1HPC A;  2CW0 C;  1GUG A;  2BE5 C;  3A8J E;  1Q1E A;  3H94 A;  3GQB A;  3QIA A;  4L8J A;  1H9S B;  2A69 D;  4I7Z C;  4DK0 A;  5BN4 A;  5JEA H;  1TKW B;  3PUY A;  3M7N A;  1FYC A;  1OXT A;  3QJY A;  3T51 B;  2A68 C;  1K8M A;  1LAB A;  2NN6 I;  3FMC A;  3VA7 A;  1ZKO A;  1HCZ A;  4G7Z C;  4IFD G;  1H9K A;  1H9M A;  1GHJ A; 
#chains in the Genus database with same CATH topology
 4LF5 Q;  3KUP A;  1EY8 A;  5JVH 3;  4BBS G;  2G9D A;  5J39 A;  1EQV A;  1PH4 A;  3OMC A;  1EY0 A;  4P72 A;  4MN3 A;  3DHQ A;  4DR3 Q;  2KBN A;  2PW5 A;  1GXD C;  1Z9F A;  2B29 A;  2EE1 A;  5FJ8 G;  3KBG A;  1AN8 A;  1JMC A;  1JOO A;  4AYB B;  3LNN A;  1XMQ Q;  3J80 i;  5C44 H;  1VQL A;  5BN3 A;  3HOW B;  2NVX B;  1EU3 A;  2PNR C;  3P20 A;  1VQO A;  5FO9 B;  3A7A B;  5ELN A;  2JYO A;  1E2W A;  5JOB A;  1IZ6 A;  3RZO B;  4HED A;  3VYR A;  4K2K A;  4NXM Q;  4GLA C;  3RR5 A;  3GTG B;  1JWS D;  5C4J H;  1XYI A;  2HQE A;  2NN6 H;  3NP8 A;  4DV7 L;  4DV3 L;  2RSN A;  1YHA A;  2EXZ A;  5C0X H;  3D6C A;  1M1K C;  2JA7 G;  5M5Y B;  1BQQ T;  1PMR A;  4F8M A;  4LJZ C;  2ZXP A;  4A3L H;  4UHV A;  4JI6 Q;  1ENA A;  1HNW L;  4E6I A;  2E74 C;  3RZD H;  1IW7 C;  1PZK D;  2AQ2 B;  4WJ3 M;  4YWL A;  4C3I B;  3QR8 A;  5NUC A;  3HOY G;  4KKT A;  2K5V A;  4LWC A;  3MHB A;  2N8N A;  2Z9H A;  1RDP D;  1JC7 A;  1VQB A;  5IIF A;  2HCC A;  1IBM Q;  3ICE A;  3SK8 A;  1D1I A;  3U50 C;  4DXF A;  4JBW A;  3SE0 A;  4B08 A;  4FXD A;  2JA8 G;  2SDF A;  1J5E Q;  1B3Q A;  3CCV A;  1WTV A;  3PO3 G;  3ZYY X;  4DR2 L;  1ET9 A;  4BY1 G;  3H6M A;  2F0D A;  1SNC A;  2E2I B;  3T51 B;  2A68 C;  5M3M H;  2N3S A;  1TWH H;  2CKZ B;  1N33 L;  4DV4 L;  3F8T A;  1WTW A;  3H3V I;  3SEB A;  4KHV A;  4CDF C;  4RHS A;  3EN2 A;  3E3X A;  1H9J A;  3DMU A;  4BBR G;  1VQF A;  4HCE A;  4LF6 Q;  1CQF A;  2BDN A;  2I07 B;  1I4Q A;  2ID0 A;  1IBK L;  4JI5 L;  2EY2 A;  2XRS D;  3S1N H;  5JEA G;  4GN5 A;  3IFD A;  1EY9 A;  3K0Y A;  2L5T A;  4YHH Q;  1WVL A;  1SFO B;  3K5O A;  1CI3 M;  3CME A;  4K8J A;  4C3J H;  3T56 B;  1I4P A;  5LMN W;  1EY6 A;  2FFK B;  3DWA A;  4OWX B;  1I4G A;  3RN5 A;  1UE1 A;  3VYU A;  3UDF A;  3GTO B;  1DOK A;  2IHE A;  3BVM A;  1OXV A;  1BCP C;  1QWY A;  2F4I A;  3SDZ A;  3TS0 A;  1KAB A;  4FO2 A;  5I2X A;  1CZG A;  1NSN S;  4X3S A;  4DKA C;  5M3F B;  1MKH A;  2ZT9 C;  1EFW A;  1VQN A;  2JA5 B;  1HNX L;  1B9N A;  3GTM H;  1DON A;  2B2V A;  1QJO A;  4AYB E;  1K83 B;  4NXN L;  1LTT D;  5F2D A;  4IUP A;  1VQC A;  3J80 c;  2C35 B;  2EY6 A;  4JI1 L;  3ULJ A;  2YYZ A;  1GKH A;  4YWK A;  3V2T A;  1CSP A;  2UU9 Q;  1LT3 D;  2MO1 A;  1GUW A;  4XTC S;  1X54 A;  2RDG A;  4HSV A;  2H4O A;  2KCC A;  3VYT A;  4CJ2 C;  2JK8 A;  5EQ0 A;  1MBY A;  1OTC A;  2BE5 D;  1BDO A;  3SR1 A;  1DOL A;  4POF A;  1NCV A;  3I4O A;  5E4X A;  1VCI A;  4BY7 G;  4JI7 L;  2WP8 J;  1O80 A;  4GKK Q;  3NWS A;  2VS1 A;  4NB3 A;  1Y1W G;  4R8N A;  2IX0 A;  5FJ8 H;  2A19 A;  2DY8 A;  4A3J B;  2MPM A;  1F2Z A;  2HDM A;  1I4R A;  1LTB D;  1NR2 A;  3S1Q B;  2JA9 A;  3UDX A;  5E3F A;  2UUB Q;  2HIX A;  3I4N G;  1X3Q A;  3E0J A;  1FR3 A;  4X65 L;  4DNI A;  5JVG 3;  3PO2 H;  4I7A A;  2R93 G;  4PMB A;  1LT4 D;  1OXS C;  2I5L X;  1TWF B;  4P71 A;  1BBW A;  4JYA Q;  4UP8 A;  2XIW A;  1PZJ D;  3H09 A;  4IPH A;  3AMU A;  3K0X A;  1KDB A;  3G71 A;  5C6A A;  2F0M A;  2D0P A;  3DEP A;  1A63 A;  2EYO A;  3T1H Q;  2F3W A;  3EIV A;  1MIU A;  4A3F B;  2B2Y A;  4GNX A;  2DJG C;  4IZ8 A;  5KND A;  3S1M H;  5KNC A;  1V1O A;  3CCS A;  2VL6 A;  2DNE A;  3SK6 A;  3IAY A;  5FLM H;  1V1P A;  3TQY A;  2PNH A;  1RTO A;  5C3E B;  1SMY C;  3M4Q A;  1AEX A;  5IYC G;  5A35 A;  3PGZ A;  1K8O A;  2MQH A;  1B53 A;  3JAM E;  3KBX A;  3C1F A;  5KIX A;  1JJG A;  4J8Q A;  5IP7 G;  5IWA L;  4DAV A;  1EIY B;  5J3B A;  3H91 A;  1WYD A;  3LX0 A;  1HUM A;  1PTO B;  2PZU A;  3K6O A;  1CA5 A;  1HNZ Q;  1VS0 A;  2HT1 A;  2JA8 H;  2UXD L;  3PF5 A;  4GS3 A;  3S1R B;  3PO3 H;  1KAA A;  3FHW A;  1IW7 D;  1PFB A;  1SMX A;  4BY1 H;  1FVI A;  2C5C A;  2K01 A;  5LL6 S;  2JA7 B;  2DUD A;  1P8L A;  2R92 B;  4HIO A;  2R7Z H;  1WI5 A;  2IPK D;  5BN5 A;  4XIG S;  3T1Y Q;  3H3V C;  1F9P A;  1ROD A;  3F2B A;  3I4M G;  1Q81 C;  4UPA A;  2NUC A;  1B9M A;  3U9O A;  1HFG A;  4ZQ3 A;  1LV9 A;  5LMN L;  4JI0 L;  1SAP A;  4FNF A;  2KJX A;  1WD0 A;  3I73 A;  4UP7 A;  4A3E H;  1CSQ A;  3A8J E;  1L0Y B;  1C9O A;  2OXP A;  3GQB A;  5BN4 A;  5C4H A;  1E0B A;  5JEA H;  5C4X B;  1HHV A;  4RFB A;  2K52 A;  2LXK A;  4DAY B;  1KL9 A;  1QE6 A;  2L12 A;  5CBA E;  1H9M A;  2QIL A;  4PMC A;  2NWG A;  1T5X D;  2MGS A;  1Q82 C;  1PXU A;  4C3H B;  2JEA I;  1CFM A;  1MJC A;  2JJQ A;  1SXT A;  5CGK A;  3HG9 A;  3J81 L;  2WAQ B;  3TBI B;  1TWA B;  3IFT A;  3H0G B;  2Z6K C;  1LAC A;  4A3K G;  1EWH A;  4KLK A;  3TP5 A;  4K5W A;  4C2M H;  5K36 G;  1SNO A;  5KRU A;  1VQ9 A;  1HUN A;  1LTA D;  1GUS A;  1X9N A;  1PRT B;  1Y14 B;  4DUZ Q;  1WTP A;  5LHY 1;  2Z4H A;  4BBR B;  3J81 j;  4IO9 A;  2PYK A;  3R93 A;  2Z4I A;  4APV A;  4KJO A;  2K6A A;  4P2C B;  4HIM A;  4K5V A;  5CC4 A;  4AYB G;  1PTO D;  2M00 A;  3PQI A;  1F2Y A;  2QCP X;  4QUF A;  5IGB A;  2V1C C;  3DM3 A;  1FJG L;  1PFM A;  3S15 H;  1EYG A;  2WV6 D;  3A56 A;  1VMP A;  3HOW G;  2HD3 A;  2E2H B;  1II3 A;  2ZJP A;  2D5D A;  4HMJ A;  1TY0 A;  4IPG A;  3UE0 A;  4DV2 Q;  3GV6 A;  1Q86 C;  1PH1 A;  4DV0 L;  2UXB L;  2A6E D;  4BY7 H;  4NDX A;  4QY7 A;  1QVC A;  2NVQ B;  4MTK A;  1BBU A;  3BU2 A;  2F0I A;  4FXK C;  2NVY B;  5M9O A;  4YY3 Q;  3A74 A;  1QNK A;  1VMC A;  1K0S A;  2RDH A;  5CBE E;  3H3V H;  4DAM A;  2EY5 A;  3PIP 3;  5JAV A;  1ICW A;  3BVZ A;  1IYJ B;  2LXJ A;  4XT1 B;  3BJU A;  3HKS A;  3I55 A;  3I72 A;  2PI2 A;  1Y1W H;  2BA0 A;  4DR7 L;  1HJP A;  5HY6 A;  3HZX A;  3FKI B;  4FP5 D;  1C48 A;  5C3X A;  2K03 A;  1FNW A;  1XTC D;  3VR4 A;  5M5X H;  2EJG C;  1EWC A;  3BZK A;  4K6D A;  3I4N H;  1BR9 A;  1BXT A;  2AWO A;  4L5T A;  5E7N A;  3C3L A;  1PYS B;  4C3I G;  1OO9 B;  1DYQ A;  2R93 H;  2EY1 A;  3I7F A;  3RLO A;  3CCJ A;  2F0J A;  2RHQ B;  3KJP A;  1L2F A;  1SDF A;  2FJ2 A;  3H94 A;  2MFI A;  4LF4 L;  1BVS A;  1MJE A;  4DU9 A;  1XWE A;  5EBD A;  2KED A;  1CHP D;  2Q2I A;  3D4D A;  3MXN B;  3T13 A;  1QCB D;  1U4M A;  4DA2 A;  5JJZ A;  2ZM6 L;  4A3M B;  1UE7 A;  4ME5 A;  2E5L L;  4DR6 L;  1PRT D;  1STG A;  4C1N I;  4QIW B;  5G3L F;  4Q0F A;  3AU7 A;  3G48 A;  1A62 A;  3HEJ A;  2G5D A;  4DV6 L;  3DEO A;  1ICF B;  2ZJQ A;  3S16 H;  3GTQ B;  2B2W A;  3OIP A;  4JK1 C;  1PDQ A;  1JE5 A;  5IYC H;  1E7Z A;  2M9V A;  1K3B C;  4PZ8 A;  3HRZ C;  1TY2 A;  4OO1 I;  3A5Z B;  2QKI C;  4ZAI A;  5IP7 H;  3JAM i;  1RHP A;  1I50 H;  1HZC A;  2CHB D;  3GD7 A;  1FGB D;  3BVG A;  2A1A A;  5CV5 A;  2WII B;  3KF6 B;  4PQX A;  1BCP F;  3VR3 A;  3GTJ H;  1KLG D;  2B63 B;  2WAQ E;  4DR2 Q;  4PZ6 A;  4JI3 Q;  5FO7 B;  3HOV G;  1U5K A;  3MC0 B;  1VQ8 A;  1SMY D;  3SGI A;  4IUT A;  2HHH L;  3DUZ A;  4A93 H;  3QO2 A;  3TN2 A;  4DK3 C;  2LS0 1;  2XNA C;  4BA2 I;  4HMI A;  3W2D A;  4MHE A;  1I4H A;  5FKA C;  4CHT B;  5D65 A;  1SRU A;  4ZCK A;  5KYI A;  5M3F G;  5A2Q E;  3I56 A;  2VQF Q;  3HOZ B;  1IBK Q;  3RNU A;  2JA5 G;  2VNU D;  1CUK A;  1R9T B;  2H5X A;  3OYY A;  2PCF B;  4UDU C;  3KOJ A;  1WJJ A;  4GOP B;  2I46 A;  4DNT B;  4B3R L;  4KD4 A;  3KYH C;  3CPW A;  3CHB D;  2WKC A;  3GTP H;  4PG3 A;  4Y7N B;  3J7A 5;  1JWM D;  4LF8 L;  4GZY C;  3RUZ A;  2F3V A;  3D31 A;  5A2Q L;  4POG A;  5I9O A;  3OSO A;  1AZP A;  5IP9 G;  4AIM A;  3KLW A;  5EBC A;  3NBH B;  3PSI A;  1TWC H;  1RKN A;  1HNX Q;  2YTY A;  2Q2H A;  1B70 B;  2BE5 C;  1PH6 A;  1JB3 A;  1PH7 A;  1EYD A;  2OT2 A;  2OTJ A;  1H9S B;  1D5M C;  1KNE A;  4HJ8 A;  4PZ7 A;  4LFC Q;  1X65 A;  1J8I A;  4OO1 G;  4JCV E;  3GO5 A;  1HH2 P;  1ZYR D;  3UE1 A;  1JQY D;  1XPU A;  1W3S A;  3AFP A;  4A3J G;  4DNR B;  4A3D H;  5GAD C;  1SYE A;  1CQV A;  2SEB D;  3NTK A;  1D5Z C;  5COR A;  3L9A X;  5JJI A;  3S14 B;  3HOW H;  4RHR A;  4RGM A;  2UUC Q;  2L9H A;  3I90 A;  4JBJ A;  3FEW X;  4X62 L;  1Q8K A;  5CV9 A;  1GUO A;  3T16 A;  1GD7 A;  4IUR A;  3VR6 A;  3BDL A;  2HCI A;  3CMA A;  3OW7 A;  2ICI A;  3RZO H;  2YTV A;  4DK1 A;  1X32 A;  4QIW E;  3S2D B;  1KC8 C;  5I9P A;  2PPB C;  1LO5 D;  3U58 A;  4IOC A;  3GTG H;  4DK6 C;  5ELD A;  1YZ6 A;  1HR0 L;  4A3F G;  1KLU D;  3H15 A;  4F7X A;  3N52 A;  4CGY B;  2BH2 A;  1AW7 A;  3E9I A;  3HS0 C;  4P74 A;  5M5Y H;  1A2T A;  1EFI D;  2D62 A;  4X65 Q;  4A3C G;  4R9W A;  2JA6 B;  5C3E G;  3EJI A;  4DUY Q;  3JAM c;  5DM7 3;  1GM5 A;  3NQT A;  3G4S A;  3NUC A;  2B2U A;  3L0O A;  2Q2U A;  4C3I H;  4B3S L;  3C2P A;  1ESF A;  3PIO A;  2B2V C;  3A7L A;  4JI8 L;  2JXM B;  4A3I G;  2NB0 A;  5EPL A;  5KGU A;  1G2T A;  4K6L A;  4JG2 A;  5TSS A;  4YCW A;  3F2D A;  4R4Q A;  3HOU H;  3GTL B;  2UUA Q;  4N8F A;  1AH9 A;  1LT5 D;  1EEF D;  2K14 A;  2R7F A;  2RQX A;  2TMP A;  5D14 A;  4HID A;  3I3C A;  2AWN A;  2PW7 A;  1O7Y A;  2RDF A;  4QL5 A;  3W1B A;  3TSS A;  2IY5 B;  5AJ3 Q;  4FF4 A;  1EYA A;  2ATW A;  1BUV T;  3IKJ A;  2R92 G;  3TRE A;  5LMU Q;  4BXX G;  3C1E A;  1UAP A;  1WD1 A;  1HFN A;  2IL8 A;  2ICE C;  4JI2 L;  4B3T L;  1LTG D;  1JOK A;  4DR4 L;  1NMG A;  4OEM B;  4CBV A;  3K5M A;  1Q7Y C;  3D0F A;  4ALP A;  3CXC A;  4GN3 B;  1W6J A;  3J7Y W;  3DWQ A;  5C4X G;  2E75 C;  2E8G A;  1MD2 D;  5EKL A;  1DD2 A;  1LM0 A;  4ABN A;  1FNV A;  4X3T A;  5C44 B;  4HJ9 A;  1SFO H;  1BNZ A;  1V1Q A;  1XNQ L;  1I6V C;  1LT6 D;  4C3H G;  2AKW B;  1VQP A;  4RH6 A;  3OTO L;  5IYD G;  3GTO H;  3AYH B;  4CKB A;  3CF5 A;  1D5X C;  2WAQ G;  1T9H A;  1F2L A;  3A8I E;  1IBL L;  3H0G G;  1Z6H A;  2CH4 W;  2AUJ D;  2FMM A;  1A15 A;  4RAU C;  2QF7 A;  1SE4 A;  5M3F H;  3MWY W;  2RVL A;  1XXG A;  2B2Y C;  4GNX C;  2JA5 H;  4A3B H;  4DFA A;  1EOT A;  2QW7 A;  3CRK C;  4NW2 A;  1FL0 A;  5C5M A;  1HQR D;  1Y8P B;  3A5U A;  1NE3 A;  4K0K Q;  2Z0S A;  4CJ1 B;  4DR5 Q;  1E2Z A;  3DWP A;  4K5X A;  2E2J B;  1EIH A;  1PLF A;  4L5S A;  1D8L A;  3HOV B;  3CQZ H;  1R4P B;  4HR7 B;  2FIN B;  4J15 A;  1TU2 B;  1WTH A;  3PUZ A;  3N6R A;  3ONA B;  1RJT A;  5IP9 H;  4KY5 A;  4JV5 Q;  1YIJ A;  1K0R A;  5C3W A;  2HQL A;  2DN8 A;  3NTI A;  4LF7 L;  1PTO C;  1CK1 A;  1A3U A;  4BS9 A;  5IT9 E;  1YJ9 A;  4AQY L;  1WTQ A;  1Y8O B;  1S5D D;  3MFY A;  3E9H A;  1NUC A;  4CJ0 B;  1ENF A;  4OO1 H;  1TQO A;  2ZJR A;  2A6E C;  2OQ0 A;  4FF1 A;  2Z8L A;  4ME3 A;  1UEA B;  2DY7 A;  1Q90 A;  3TZU A;  4A3J H;  4XQN A;  3BYT B;  3EQL C;  1VQM A;  4FF3 A;  3MVV A;  3FKI G;  1TWH B;  2OF1 A;  3OWE B;  3RMH A;  1CT1 D;  1HXY D;  4R8I A;  3S1Q H;  5IT9 L;  1HPC A;  4BWG B;  4DV1 Q;  2F0N A;  1Q1E A;  2VQE Q;  2RCF A;  1NR4 A;  3M7N A;  1SRO A;  2WB1 B;  1TKW B;  3NEL A;  3PUY A;  3SHL A;  1OXT A;  1E1O A;  1LAB A;  1TWF H;  4IUV A;  1H95 A;  4EQ5 A;  4IAL A;  3IRB A;  1YNJ D;  4BBS H;  3S1N B;  4JI4 L;  5C4Z A;  4A3F H;  3Q22 A;  1C0A A;  4EX5 A;  1SJE D;  1HA5 A;  4A3M G;  2IT1 A;  4L63 B;  1WCM B;  1WOC A;  4KV6 A;  1TII D;  3J7A V;  3EBE A;  4OIK A;  3RN2 A;  4X64 Q;  4ZK9 B;  1G91 A;  2IJ0 A;  4L6T B;  4A3C H;  1CKM A;  4LUZ A;  5C3E H;  5HGQ A;  3I2Z A;  1ZEQ X;  1S5C D;  4KK7 A;  1PRT C;  2GVB A;  2EVB A;  2K5Q A;  4X6A H;  5JJL A;  2NYZ D;  3LGJ A;  4YCV A;  4KHP Q;  5J1Z A;  4LF9 L;  2VB3 X;  2K32 A;  3G6J B;  4LF4 Q;  4ZLT F;  4IUQ A;  2EYH A;  1Y8N B;  1GJX A;  2CQA A;  1HZ9 A;  1IYV A;  1LTS D;  2QEJ C;  2CQO A;  1VQ4 A;  3W1G A;  1PA6 A;  4DR6 Q;  3MEH A;  3M7G A;  3M4O B;  4ID6 A;  3U9S A;  1SSO A;  4H44 C;  1PTO H;  4OGQ C;  5E4W C;  2B63 G;  1ILP A;  3GP7 A;  3CCL A;  1EEI D;  1A6X A;  1IHZ A;  3CP0 A;  2KOL A;  1QOH A;  3P75 A;  5D3I B;  2A73 B;  1STN A;  1G8Z D;  5EGT A;  2NZO A;  4RGN A;  2JA7 H;  1RL2 A;  2R92 H;  1Q12 A;  2F03 A;  1BF4 A;  2EXD A;  3NPP A;  4BXX H;  1G29 1;  3E6Z X;  1ONL A;  5ISR A;  4YCU A;  2NTT A;  3HOY H;  3ND8 A;  3HGB A;  2PQA A;  4IJL A;  2L0C A;  4HCS A;  4A3I B;  5I6Y A;  3HOZ G;  5GAG C;  1N36 Q;  2PQA B;  3CW2 C;  3NEM A;  1NNX A;  3O13 A;  3E0E A;  5DM6 3;  2ZXO A;  2IWH A;  4ZKB B;  2MNA A;  1S72 A;  4ZYS A;  3MZ5 A;  2HHH Q;  2XWB B;  3S2H B;  1ILQ A;  3OIQ A;  1X3E A;  1EL0 A;  2LFN A;  4IN3 A;  3NHH A;  4FYD A;  3MTS A;  5FO8 B;  5T1G A;  1D1K A;  1VQ5 A;  4JI6 L;  2LY7 A;  3QIA A;  4I7Z C;  4DK0 A;  1F2M A;  1TS3 A;  4HN7 A;  2VW9 A;  4JBK A;  1UWV A;  3MXG A;  3QJY A;  5EAY A;  1TWA H;  4OXP A;  4G7Z C;  1BOS A;  3ITP A;  2IX1 A;  2K5W A;  4DGZ A;  3QG1 A;  1EQQ A;  1MSH A;  1G51 A;  4JPB W;  2O5J C;  4B3R Q;  1I5F A;  1IBM L;  2VZA A;  1HRJ A;  2I0Q A;  2RKS A;  4A3G B;  1KNA A;  3S1M B;  3J81 E;  4JW0 A;  1HTP A;  4BBR H;  3Q6S A;  3P7J A;  1Y1V G;  1XX8 A;  4DAY A;  1KTK A;  2WB1 E;  3K7A B;  4AH6 A;  3CCQ A;  2B2W C;  4LFB Q;  2EZV A;  3HP3 A;  1ZYR C;  4U67 3;  2E76 C;  4OHJ A;  4LFA Q;  5T1I A;  2E2H H;  2JEB I;  1PH9 A;  1OXX K;  2K7V A;  1XNR Q;  2P5Z X;  4N9T A;  2HUG A;  1K8A C;  1IXR A;  1V8Q A;  2AQ1 B;  2EIF A;  3TS2 A;  1JJ2 A;  2NVY H;  1SJH D;  2MJ8 A;  4PMW A;  4LF6 L;  2F4V L;  2RBM A;  1STB A;  1MI2 A;  2WAC A;  4ZUI A;  2IHF A;  1QNU A;  1C7Y A;  1VQJ A;  4RWS C;  4XXE A;  3M4P A;  1KIX A;  2B8G A;  2MUY A;  4YHH L;  1B7Y B;  4IQZ A;  2R7Z B;  3FKI H;  4MIU A;  4JBM A;  1A3T A;  2SNS A;  3EA6 A;  2Z6B A;  1PH2 A;  2YU9 B;  2JA6 G;  1DOM A;  2G9H D;  2R6G A;  3HOX B;  2PZW A;  4GOP C;  2RCN A;  4KTA A;  4XQQ A;  5IGC A;  3DLL A;  1C8C A;  5IOD A;  1N32 L;  1SYG A;  2L55 A;  5J22 A;  4A3E B;  1TR5 A;  3HKZ B;  2A74 C;  1HR0 Q;  1IKL A;  1L1O A;  3TZD A;  3X3N A;  3PUV A;  2B2T A;  1L1O B;  1L0W A;  3KFU A;  1AZQ A;  2VXW A;  1YEZ A;  5FLX E;  2OCE A;  2UU9 L;  3CD6 A;  4V19 0;  1DM0 B;  5M5W B;  4ILW A;  3D3R A;  1A3V A;  2EYF A;  4DN4 M;  3U4Z A;  4B3S Q;  2PQE A;  5DNF A;  3GTQ H;  1PVO A;  3QOL A;  1OXU A;  4TRD A;  4IJH A;  4RMF A;  2GA4 B;  1E22 A;  2ZTC A;  1EY4 A;  3D4W A;  4X3U A;  2GN5 A;  4HIK A;  3URY A;  4MZ9 A;  5FLX L;  2KHJ A;  1I94 L;  2KCT A;  2IX3 A;  1PHJ A;  5AFW A;  4GKK L;  4H0L C;  5DAU A;  1WTX A;  3A54 A;  1LTI D;  3FVQ A;  5L37 A;  4IFD I;  3MXN A;  4DV7 Q;  4DV3 Q;  1KD1 C;  2B63 H;  1YIT A;  1I4X A;  4RGO S;  4A4I A;  4XYQ A;  4LMQ D;  1GO3 E;  1O78 A;  2XWJ B;  4K2L A;  5C44 G;  4WJ4 A;  3PIP A;  4O0A A;  2N88 A;  3DM1 A;  1HNW Q;  3FRP B;  1Q1B A;  2NTS A;  2KEC A;  1Q46 A;  3UDI A;  1F77 A;  2AHO B;  1IL8 A;  2UUB L;  4B3T Q;  4OWT B;  2R7D A;  2Q8T A;  1JCK B;  3MEF A;  4LAA A;  2QDB A;  4HAE A;  3K59 A;  1YHB A;  1S5B D;  3K8A A;  1TWG H;  1EIF A;  3J80 L;  1K9M C;  4JYA L;  3HOZ H;  3L7Z C;  5FOB B;  3D4R A;  3ND9 A;  1R9T H;  1GUN A;  3KF6 A;  2K1B A;  4B9X A;  1QB5 D;  3T1H L;  4RKB A;  2ENB A;  1VQI A;  3QOJ A;  1PTO F;  5I2Y A;  2AMC B;  3CKI B;  3OTO Q;  4A3L G;  3NEN A;  3U4V A;  2B2U C;  5M5X B;  4TQU S;  2LSS A;  2NVT H;  4KI0 A;  1SYC A;  4Y7N H;  2CW0 D;  1AE2 A;  2EJM A;  4R4I A;  1ZXT A;  1N33 Q;  4RCO A;  4DV4 Q;  2L1B A;  1A8V A;  4DV5 L;  4PV1 C;  5IT9 c;  1B3A A;  4WOR A;  5K5P A;  2AUK A;  3BYY B;  3SK5 A;  3I4M H;  3BZD B;  2F0V A;  5GQO A;  4LW1 A;  2XSC A;  5IE8 A;  2AQ3 B;  3I91 A;  4TKO B;  1HZA A;  3UDG A;  5JJK A;  2KEN A;  3BS1 A;  2XRQ D;  4G57 A;  4GOP A;  2KHS A;  4FXG C;  4JI5 Q;  4A75 A;  3ULL A;  1ESR A;  3MFG A;  3TP8 A;  3F1Z A;  3BZC A;  4QMG A;  3J81 i;  2X6L A;  3MXP A;  4RKL A;  1TVX A;  4N8X 1;  1D2B A;  2VY3 A;  3E5S A;  1GVP A;  3W5O A;  3JC6 6;  1U0L A;  4IFD G;  5DEH A;  1H9K A;  4HJ7 A;  2JP1 A;  4EQN A;  1STE A;  1G6P A;  3HKZ E;  2LMC B;  1M8A A;  3L3O C;  1I6H B;  2KA7 A;  3J7Z C;  2LKV A;  4AQY Q;  3T1Y L;  3NBH A;  2E2D C;  2L4N A;  1EU4 A;  4HSP A;  1R4Q B;  4LUV A;  4G7O C;  2WB1 G;  2EYP A;  1DZ1 A;  1STY A;  1ASY A;  2I5H A;  1I50 B;  4A3K H;  4GKJ L;  1H9S A;  1YNN D;  1D7Q A;  3PCO B;  1UNS A;  5K36 H;  1X6O A;  3S2D H;  4NXN Q;  2YTX A;  4JI1 Q;  1SND A;  4NPS A;  1AFP A;  1PRT F;  1KXL A;  3K80 C;  4IFD J;  2F0H A;  1PH3 A;  1YNJ C;  1M4V A;  1Y1V B;  2F0K A;  3OWF A;  4HJ5 A;  2A5H A;  1WCM G;  4A93 B;  3S24 A;  3TEH B;  2BA1 A;  5IGE A;  4QUC A;  3PUX A;  3CCU A;  1WTO A;  2JA6 H;  2ZTE A;  1B4O A;  3GTK B;  1I3Q B;  1KDA A;  1JOR A;  2PZT A;  2NVX H;  3CC2 A;  1GUT A;  4JI7 Q;  1QVF A;  3RD4 A;  2RF4 A;  4JI4 Q;  3M9B A;  1S5E D;  3SVM A;  5ELB A;  2K5D A;  3S17 B;  1TT2 A;  1UE5 A;  1XMO L;  1VQG A;  3GTL H;  1N34 L;  1XTD A;  1ML0 D;  4IPC A;  1BBX C;  1ASZ A;  3M3Y B;  1Q8I A;  2BH8 A;  3TME A;  4HTH A;  2C9O A;  2CWP A;  4QQB X;  2A6H D;  1U4R A;  3EFX D;  2O2L D;  2J4X A;  3BG3 A;  1SLJ A;  4LF9 Q;  4Y52 H;  2N78 A;  4EGV A;  3PMF A;  2BOS A;  3PV0 A;  3WDN A;  4DV2 L;  3K7U C;  1Q3L A;  4C1N K;  3K81 C;  4G4K A;  3KK7 A;  5ELF A;  3ZJY C;  4YY3 L;  2F0U A;  3BDC A;  4QCL A;  2A8V A;  4RG1 A;  1ET6 A;  2A69 D;  4A3D B;  2KCM A;  1CKN A;  3F2C A;  2QEX A;  5IOC A;  1CKN B;  1K3R A;  4UP9 A;  3OHX C;  3ULP A;  4CDD C;  2F0Q A;  1EQT A;  1H9R A;  2MHV A;  2XGT A;  2VUM B;  4FDB A;  3PO2 G;  4NMZ A;  5DLQ E;  2ASB A;  3A55 A;  2E2I H;  4X66 L;  4V0B A;  4JVZ A;  2KCN A;  2K5N A;  1PFN A;  1NTG A;  1JR0 D;  4DXG A;  4OIJ A;  2F1M A;  2D9U A;  3FDT A;  3J81 c;  5EKI A;  1G2S A;  5IWA Q;  3KF8 A;  3WOE A;  1W2B A;  4M8A A;  1B2T A;  4A3G G;  4OL7 A;  2CCZ A;  5IGF A;  3KF8 B;  1QUQ A;  4GN4 B;  3V96 A;  2UXD Q;  1B8A A;  5FLM G;  1QUQ B;  3CCR A;  4OX9 L;  2VB2 X;  4R4C A;  3Q23 A;  2E2J H;  3K5L A;  1EY5 A;  1V9P A;  3J7A F;  1LYL A;  2GVA A;  3HOV H;  4Q5V A;  4WFN 3;  4DR1 L;  3TP6 A;  1QVG A;  4X3K A;  1JWU D;  4IUN A;  2DNC A;  5C5L A;  3VR2 A;  3A0J A;  5LMN Q;  4JI0 Q;  3R8B A;  1SNP A;  1YJN A;  5FK9 C;  3HOU B;  2CH4 A;  4MNO A;  2Q8R E;  1RD9 D;  2N49 A;  1NMF A;  1NY4 A;  2BCO A;  1XPO A;  1SYB A;  5C4J B;  5KEE A;  1SR3 A;  3Q24 A;  1E3P A;  2F0F A;  1K83 H;  4C56 C;  2EDG A;  1EY7 A;  2M2L A;  2BDO A;  1FGU A;  4RCN A;  5CMD A;  4JI3 L;  5I4D A;  1O7I A;  4QB4 A;  2R7Z G;  4H02 A;  4IFD H;  4KKS A;  3RZD B;  1F9R A;  1SE3 A;  1KRS A;  3R2T A;  1E24 A;  4JOI A;  3G6E A;  3KLS A;  3RLN A;  2RHS B;  3HOX G;  4KN7 C;  1SBB B;  4R1J A;  2UXC L;  2WFW A;  1GOZ A;  4EQO A;  2F4V Q;  1VQA A;  4A3E G;  4N9P A;  2VQF L;  3HKZ G;  1RTN A;  5FLX c;  1EQR A;  1K73 C;  4O2D A;  3STB D;  2R61 A;  1FYC A;  1QZH A;  3KLS X;  5KYL A;  1MGS A;  1JT8 A;  1GHJ A;  1XJV A;  2ZTD A;  1WCM H;  3K57 A;  1UEB A;  3D6W A;  1FJG Q;  1SNM A;  4KY6 A;  2R3Z A;  5M3M B;  1IYU A;  3BDO A;  2DJF C;  1N32 Q;  1VQE A;  3K58 A;  4S3S A;  2UXB Q;  4DV0 Q;  1JB7 A;  2JN4 A;  2Q2T A;  4A3B B;  2XVS A;  5IYB G;  2J7Z A;  2K28 A;  3T4A C;  4B3M L;  2F3I A;  2PMZ B;  5JEA J;  3PF4 A;  3F2U A;  1NJI C;  4TVA B;  4L5Q A;  2HDL A;  1TXY A;  3IL8 A;  4LFC L;  2EYJ A;  3M4O H;  3CRL C;  3MAQ A;  4DR7 Q;  5CV6 A;  4DAP A;  1VF5 C;  1QIL A;  3CQZ B;  4B9W A;  4L5R C;  4CDC C;  4C3J B;  4H13 C;  5HUR A;  4ODG A;  1HA6 A;  1CKO A;  3HFZ B;  1D6E C;  3CCE A;  1KAW A;  4H7B A;  4CKE A;  5EPK A;  2QDL A;  4FF2 A;  3KDF A;  1E2V A;  1EWI A;  2UUC L;  1EZ6 A;  3UI2 A;  3KDF B;  1SE8 A;  4CDE C;  1I94 Q;  5EJW A;  5BR8 L;  5GRO A;  4K8I A;  4U68 A;  2O5I C;  3SK4 A;  2EYL A;  1UUP A;  3GTM B;  4A3I H;  2XTI A;  4LF5 L;  1NBW A;  4JC0 A;  3QB3 A;  1CM9 A;  1EIG A;  3B6Y A;  4KN4 C;  3WOF A;  2KEE A;  2KUM A;  2IW3 A;  4EVO A;  2ZM6 Q;  1STA A;  2E5L Q;  4QGU A;  2FHT A;  1N8R C;  3S2H H;  4DR3 L;  2KQ3 A;  2O4X A;  2NBF A;  4DV6 Q;  2Y0S B;  2OTL A;  3S1R H;  4Z9C B;  2OEO A;  2JE6 I;  4DUY L;  1XMQ L;  3WWV A;  1L1O C;  3OOC A;  1SYF A;  2CW0 C;  4GLX A;  1PYB A;  1YHQ A;  4BBS B;  2B2T C;  1X3G A;  5H1S E;  1PH5 A;  4OWW B;  1F9S A;  1EYC A;  1K8M A;  3VA7 A;  4A3G H;  1HTL D;  1J9O A;  2UUA L;  4OON A;  4GNX B;  2H1E A;  4NXM L;  1X3P A;  4PNY A;  1FNU A;  3NBI A;  3VA5 A;  2QGQ A;  3K7A H;  5C4X H;  3NK9 A;  1T5E A;  1V1P B;  4DV5 Q;  1VQK A;  5IGD A;  3GV3 A;  5HGT A;  1Z47 A;  2F0T A;  5AJ3 L;  1VQ7 A;  4C3H H;  1K8G A;  1S5F D;  5LMU L;  1AE3 A;  5IYD H;  3AB9 A;  3PO2 B;  4IPD A;  4LNQ A;  5I6W A;  3H0G H;  3A8K E;  1MSG A;  1TS4 A;  1CZW A;  3S9W A;  3I8Z A;  1BCP B;  2K5H A;  2X69 A;  5COY A;  1A2U A;  3OW2 A;  4KKU A;  1F9Q A;  3G7L A;  2D0O A;  1CTM A;  1SE2 A;  1YNN C;  1DGS A;  3SXH A;  3JAM L;  5CR3 A;  2EQS A;  2JSO A;  1LLR D;  4A93 G;  3M85 A;  3CC4 A;  4NKL A;  4KY7 A;  1V43 A;  4LF8 Q;  2OWO A;  4KJN A;  1J5E L;  2PMZ E;  2YU9 H;  1PV4 A;  3AEV A;  4P73 A;  4WJW A;  1SN8 A;  3AFQ A;  3HOY B;  2F0G A;  2PO4 A;  1JOQ A;  4QF4 A;  4GKJ Q;  3HOX H;  2F0E A;  3RLF A;  2Z1C A;  4K14 A;  3LWU A;  2I5M X;  4IUU A;  2EYM A;  2YV5 A;  3W3A A;  4TSS A;  3CC7 A;  3MA2 B;  5ELO A;  4ZRZ A;  2XN9 C;  2NVQ H;  3NE5 B;  2ALY B;  1Y69 U;  4DPG A;  2J0T D;  5JPN C;  1DCZ A;  1QZG A;  1X56 A;  4G7H C;  1G6Z A;  1VQH A;  2A68 D;  2JA8 B;  1S4Z A;  2TSS A;  3VDY A;  3FPP A;  1EOV A;  4K0K L;  3PO3 B;  1SEB D;  4DR5 L;  1WFQ A;  5M5W H;  4R4T A;  1U4P A;  4BY1 B;  3OMG A;  1TS2 A;  2CVR A;  3CAM A;  5G3L D;  1CHQ D;  1KRT A;  4KHZ A;  2FXQ A;  2A6H C;  1VF7 A;  4X62 Q;  2QA4 A;  4JV5 L;  1GUG A;  3ERO A;  2F0S A;  1VQD A;  5IYB H;  1XMO Q;  1FD7 D;  1E1T A;  1N34 Q;  2NN6 I;  4XDX A;  4I65 A;  3D8G A;  3CPF A;  1M90 C;  5ELE A;  4M1U B;  5IGG A;  3GDE A;  5C0X I;  2Y0S E;  2F0O A;  3ERS X;  2D2C C;  2K50 A;  1TS5 A;  4UAI A;  4A3D G;  1BCP D;  2MP1 A;  2JQO A;  4A3M H;  2K33 A;  1PYW D;  4ULL A;  5GAE C;  4F87 A;  2A69 C;  4MTN A;  4KMU C;  4IOA A;  1S3O A;  2VUM G;  2L11 A;  4DV1 L;  1B1Z A;  1X55 A;  4YIJ A;  2VQE L;  3FPU B;  2RSO A;  4JI8 Q;  1BKB A;  3VR5 A;  5CV7 A;  1YVC A;  3PUW A;  2OQK A;  4C2M B;  1P16 A;  1VQ6 A;  1B50 A;  4R4O A;  3KJO A;  4FVM A;  1YNX A;  1GHK A;  1NAP A;  1VDZ A;  3T53 B;  2WIN B;  1K28 A;  1YBY A;  1U4L A;  1X3F A;  5EKK A;  1HZB A;  1O7Z A;  3J80 E;  1RCV D;  2WKD A;  4LK1 C;  2NZ1 D;  4X64 L;  4X66 Q;  3S15 B;  2KHI A;  3P1H A;  1STH A;  3TP7 A;  1HR0 W;  3OPO A;  3R3O A;  3R2I A;  4CKC A;  4JI2 Q;  1LUZ A;  2EOT A;  3NTH A;  5LL6 X;  4BY7 B;  4KHP L;  2B39 A;  4DR4 Q;  3AQQ A;  2MO0 A;  1ENC A;  4GLV B;  1PFS A;  1KQS A;  3HOU G;  1QG7 A;  2FMC A;  4OX9 Q;  4OEL B;  2NN6 G;  2KVM A;  1Z7T A;  5ELC A;  1Y1W B;  3K5N A;  3Q8D A;  4DR1 Q;  1XNQ Q;  4A76 A;  5C0X G;  2SNM A;  3MXU A;  2F0L A;  3NWT A;  1WTR A;  3ERQ A;  2EPB A;  1CA6 A;  1RF2 D;  3I4N B;  1I6H H;  1IBL Q;  4L8J A;  3V05 A;  1SYD A;  2K04 A;  2X6G A;  2R93 B;  4EQP A;  1LTR D;  1B44 D;  1A0I A;  3CCM A;  1W6K A;  4ZKC B;  3FMC A;  1JIC A;  1ZKO A;  1HCZ A;  3LWE A;  4P75 A;  3NQI A;  1KDC A;  4YWM A;  2Z6K A;  1SNQ A;  1PZI D;  1N36 L;  2ZXR A;  1JJC B;  2K75 A;  5GAH C;  5C0X J;  1DXM A;  1Y1V H;  1HNZ L;  3KLR A;  2B3G A;  3STB C;  4QJF A;  2F0W A;  3S16 B;  5M3M G;  5IY0 A;  1IKM A;  2UXC Q;  1MHW C;  3EVQ A;  3S14 H;  3GTK H;  1I3Q H;  5CV8 A;  1HQM C;  4LF7 Q;  1TWG B;  3M4Y A;  1BO0 A;  3NSW A;  2HIV A;  2B8F A;  2F52 A;  4A3B G;  1C4Q A;  4XT3 B;  1RIP A;  1U9R A;  3TDQ A;  3S17 H;  2EJF C;  2K05 A;  2ES2 A;  5KNB A;  2K4K A;  3CU7 A;  1JE4 A;  4DF7 A;  1L0X B;  2CFM A;  4RA8 A;  3NXW A;  1J6Q A;  4BA1 I;  3GTJ B;  3DXJ C;  1YI2 A;  2NZH A;  1AP0 A;  2N55 A;  3M3Y H;  1UE6 A;  2NVT B;  4ZUJ A;  4RGT A;  5D3D A;  4HJA A;  4C3J G;  1YJW A;  1DJR D;  2CWA A;  1N9W A;  1EZ8 A;  2V4D A;  4LFB L;  4KD3 A;  4XQJ A;  3VYS A;  3C46 A;  4LFA L;  3I4M B;  1PH8 A;  5CV4 A;  5CYU A;  2SOB A;  4B3M Q;  2F0P A;  1EUJ A;  3I4L A;  5JPM C;  2PI2 E;  1XNR L;  3X3M A;  1KHI A;  2Q8I B;  2L15 A;  3I70 A;  4LUO A;  1S40 A;  1XPR A;  4O1N A;  1IL2 A;  3QWN A;  3L2P A;  4O42 A;  4DUZ L;  4UY8 C;  2DGY A;  3Q0A A;  5E1F A;  3GTP B;  1O7L A;  4JOI C;  3PIO 3;  2RA4 A;  4F88 A;  3ER0 A;  3FP9 A;  2Y0S G;  3TRZ A;  4WRD A;  4J6H A;  1LTL A;  4XYO A;  5EPJ A;  2VUM H;  5BR8 Q;  4NP5 A;  1TWC B;  4A3K B;  4J1M A; 
#chains in the Genus database with same CATH homology
 3KUP A;  1EY8 A;  5JVH 3;  2G9D A;  5J39 A;  1EQV A;  3OMC A;  1EY0 A;  4MN3 A;  3DHQ A;  2PW5 A;  1GXD C;  2EE1 A;  3KBG A;  1AN8 A;  1JOO A;  4AYB B;  3LNN A;  5BN3 A;  3HOW B;  2NVX B;  1EU3 A;  2PNR C;  3P20 A;  5FO9 B;  3A7A B;  2JYO A;  1E2W A;  5JOB A;  3RZO B;  4HED A;  3VYR A;  4K2K A;  3GTG B;  1JWS D;  1XYI A;  2HQE A;  2NN6 H;  3NP8 A;  2RSN A;  2EXZ A;  5C0X H;  3D6C A;  5M5Y B;  1BQQ T;  1PMR A;  4F8M A;  4LJZ C;  2ZXP A;  1ENA A;  4E6I A;  2E74 C;  1IW7 C;  1PZK D;  2AQ2 B;  4C3I B;  5NUC A;  4KKT A;  3MHB A;  1RDP D;  1JC7 A;  5IIF A;  2HCC A;  3SK8 A;  1D1I A;  4DXF A;  4JBW A;  3SE0 A;  4B08 A;  4FXD A;  2SDF A;  1WTV A;  3ZYY X;  1ET9 A;  3H6M A;  2F0D A;  1SNC A;  2E2I B;  3T51 B;  2A68 C;  1WTW A;  3SEB A;  4KHV A;  4RHS A;  1H9J A;  3DMU A;  4HCE A;  1CQF A;  2BDN A;  2I07 B;  1I4Q A;  2ID0 A;  2EY2 A;  2XRS D;  5JEA G;  3IFD A;  1EY9 A;  3K0Y A;  2L5T A;  1WVL A;  1SFO B;  3K5O A;  1CI3 M;  4K8J A;  3T56 B;  1I4P A;  1EY6 A;  2FFK B;  3DWA A;  1I4G A;  3VYU A;  3GTO B;  1DOK A;  1OXV A;  1QWY A;  1BCP C;  2F4I A;  3BVM A;  3SDZ A;  1KAB A;  4FO2 A;  5I2X A;  1CZG A;  1NSN S;  4X3S A;  5M3F B;  2ZT9 C;  2JA5 B;  1B9N A;  1DON A;  2B2V A;  1QJO A;  1K83 B;  1LTT D;  5F2D A;  4IUP A;  2EY6 A;  2YYZ A;  3V2T A;  1LT3 D;  1GUW A;  4XTC S;  2RDG A;  4HSV A;  2H4O A;  2KCC A;  3VYT A;  4CJ2 C;  5EQ0 A;  1MBY A;  2BE5 D;  1BDO A;  3SR1 A;  1DOL A;  1NCV A;  5E4X A;  1VCI A;  2WP8 J;  1O80 A;  3NWS A;  4R8N A;  2IX0 A;  2DY8 A;  4A3J B;  2MPM A;  1F2Z A;  2HDM A;  1I4R A;  1LTB D;  1NR2 A;  3S1Q B;  5E3F A;  1X3Q A;  3E0J A;  1FR3 A;  5JVG 3;  4PMB A;  1LT4 D;  1OXS C;  1TWF B;  2XIW A;  1PZJ D;  3H09 A;  3AMU A;  1KDB A;  5C6A A;  2F0M A;  3DEP A;  2EYO A;  2F3W A;  4A3F B;  2B2Y A;  4IZ8 A;  5KND A;  5KNC A;  1V1O A;  2DNE A;  3SK6 A;  3IAY A;  1V1P A;  1RTO A;  5C3E B;  1SMY C;  1AEX A;  5A35 A;  1K8O A;  1B53 A;  3JAM E;  3KBX A;  3C1F A;  5KIX A;  4J8Q A;  4DAV A;  3H91 A;  3LX0 A;  1HUM A;  1PTO B;  2PZU A;  3K6O A;  1CA5 A;  3S1R B;  1KAA A;  1IW7 D;  1PFB A;  2C5C A;  2K01 A;  5LL6 S;  2JA7 B;  2R92 B;  2IPK D;  5BN5 A;  4XIG S;  3H3V C;  1F9P A;  1ROD A;  2NUC A;  1B9M A;  3U9O A;  1HFG A;  4ZQ3 A;  1LV9 A;  1SAP A;  4FNF A;  2KJX A;  1WD0 A;  3I73 A;  3A8J E;  1L0Y B;  2OXP A;  3GQB A;  5BN4 A;  5C4H A;  1E0B A;  5JEA H;  5C4X B;  1HHV A;  4RFB A;  1QE6 A;  2L12 A;  5CBA E;  1H9M A;  2QIL A;  4PMC A;  2NWG A;  1T5X D;  2MGS A;  1PXU A;  4C3H B;  2JEA I;  1CFM A;  1SXT A;  5CGK A;  3HG9 A;  3J81 L;  2WAQ B;  3TBI B;  1TWA B;  3IFT A;  3H0G B;  1LAC A;  1EWH A;  3TP5 A;  4K5W A;  5K36 G;  1SNO A;  5KRU A;  1HUN A;  1LTA D;  1GUS A;  1PRT B;  1WTP A;  5LHY 1;  2Z4H A;  4BBR B;  2PYK A;  3R93 A;  2Z4I A;  4KJO A;  2K6A A;  4P2C B;  5CC4 A;  5IGB A;  4K5V A;  1PTO D;  2M00 A;  1F2Y A;  2QCP X;  4QUF A;  1PFM A;  2WV6 D;  3A56 A;  1VMP A;  2E2H B;  1II3 A;  2D5D A;  4HMJ A;  1TY0 A;  3GV6 A;  2A6E D;  4NDX A;  2NVQ B;  5M9O A;  1G6Z A;  2F0I A;  4FXK C;  2NVY B;  1QNK A;  1VMC A;  2RDH A;  5CBE E;  2EY5 A;  3PIP 3;  5JAV A;  1ICW A;  3BVZ A;  4XT1 B;  3I72 A;  2BA0 A;  3HZX A;  3FKI B;  4FP5 D;  1C48 A;  5C3X A;  2K03 A;  1FNW A;  1XTC D;  3VR4 A;  2EJG C;  1EWC A;  4K6D A;  1BR9 A;  1BXT A;  2AWO A;  3C3L A;  4C3I G;  1OO9 B;  1DYQ A;  2EY1 A;  2F0J A;  1SDF A;  2FJ2 A;  3H94 A;  4DU9 A;  1XWE A;  5EBD A;  2KED A;  1CHP D;  3D4D A;  3T13 A;  1QCB D;  5JJZ A;  4DA2 A;  1U4M A;  4A3M B;  4ME5 A;  1PRT D;  1STG A;  4C1N I;  4QIW B;  5G3L F;  4Q0F A;  3AU7 A;  3HEJ A;  3DEO A;  3GTQ B;  2B2W A;  3OIP A;  4JK1 C;  1PDQ A;  2M9V A;  3HRZ C;  1TY2 A;  4OO1 I;  2QKI C;  4ZAI A;  1RHP A;  2CHB D;  3GD7 A;  1FGB D;  3BVG A;  5CV5 A;  2WII B;  4PQX A;  1BCP F;  3VR3 A;  1KLG D;  2B63 B;  5FO7 B;  3MC0 B;  1SMY D;  4IUT A;  3DUZ A;  3QO2 A;  3TN2 A;  2LS0 1;  2XNA C;  4BA2 I;  4HMI A;  3W2D A;  4MHE A;  1I4H A;  5FKA C;  4CHT B;  5D65 A;  5KYI A;  5A2Q E;  3HOZ B;  2VNU D;  1R9T B;  2PCF B;  4UDU C;  2I46 A;  4DNT B;  4KD4 A;  3CHB D;  2WKC A;  4Y7N B;  1JWM D;  4GZY C;  3RUZ A;  2F3V A;  3D31 A;  5A2Q L;  5I9O A;  3OSO A;  1AZP A;  5EBC A;  1RKN A;  2BE5 C;  1JB3 A;  1EYD A;  2OT2 A;  1H9S B;  1D5M C;  1KNE A;  1J8I A;  4OO1 G;  3GO5 A;  1ZYR D;  1JQY D;  4DNR B;  1SYE A;  1CQV A;  2SEB D;  3NTK A;  1D5Z C;  5COR A;  3L9A X;  3S14 B;  4RHR A;  4RGM A;  2L9H A;  3I90 A;  3FEW X;  5CV9 A;  1GUO A;  3T16 A;  4IUR A;  3VR6 A;  3BDL A;  2HCI A;  3OW7 A;  2ICI A;  4DK1 A;  1X32 A;  3S2D B;  5I9P A;  2PPB C;  1LO5 D;  5ELD A;  1KLU D;  4F7X A;  3N52 A;  4CGY B;  1AW7 A;  3HS0 C;  1A2T A;  1EFI D;  2D62 A;  4R9W A;  2JA6 B;  3EJI A;  5DM7 3;  3NQT A;  3NUC A;  2B2U A;  3C2P A;  1ESF A;  2B2V C;  3A7L A;  2JXM B;  2NB0 A;  5KGU A;  5EPL A;  1G2T A;  4K6L A;  5TSS A;  3GTL B;  1LT5 D;  1EEF D;  2RQX A;  2TMP A;  5D14 A;  3I3C A;  2AWN A;  2PW7 A;  1O7Y A;  2RDF A;  3TSS A;  4FF4 A;  1EYA A;  1BUV T;  3IKJ A;  3C1E A;  1UAP A;  1WD1 A;  1HFN A;  2IL8 A;  2ICE C;  1JOK A;  1LTG D;  4CBV A;  3K5M A;  1W6J A;  3J7Y W;  3DWQ A;  2E75 C;  1MD2 D;  5EKL A;  1DD2 A;  4ABN A;  1FNV A;  4X3T A;  5C44 B;  1BNZ A;  1I6V C;  1LT6 D;  4C3H G;  4RH6 A;  4CKB A;  1D5X C;  1F2L A;  3A8I E;  1Z6H A;  2AUJ D;  2FMM A;  1A15 A;  4RAU C;  2QF7 A;  1SE4 A;  3MWY W;  2RVL A;  1XXG A;  2B2Y C;  4DFA A;  1EOT A;  3CRK C;  4NW2 A;  5C5M A;  1HQR D;  1Y8P B;  4CJ1 B;  1E2Z A;  3DWP A;  4K5X A;  2E2J B;  1EIH A;  1PLF A;  3HOV B;  1R4P B;  4HR7 B;  2FIN B;  1TU2 B;  3PUZ A;  3N6R A;  3ONA B;  1RJT A;  4KY5 A;  5C3W A;  2DN8 A;  3NTI A;  1PTO C;  1CK1 A;  1A3U A;  4BS9 A;  5IT9 E;  1WTQ A;  1Y8O B;  1S5D D;  3MFY A;  1NUC A;  4CJ0 B;  1ENF A;  4OO1 H;  1TQO A;  2A6E C;  4FF1 A;  2Z8L A;  1UEA B;  2DY7 A;  1Q90 A;  3TZU A;  4XQN A;  3BYT B;  3EQL C;  4FF3 A;  3MVV A;  1TWH B;  2OF1 A;  3OWE B;  3RMH A;  1CT1 D;  1HXY D;  4R8I A;  5IT9 L;  1HPC A;  4BWG B;  2F0N A;  1Q1E A;  1NR4 A;  3M7N A;  2WB1 B;  1TKW B;  3PUY A;  3SHL A;  1OXT A;  1LAB A;  4IUV A;  4IAL A;  1YNJ D;  3S1N B;  5C4Z A;  3Q22 A;  1SJE D;  1HA5 A;  2IT1 A;  4L63 B;  1WCM B;  4KV6 A;  1TII D;  3J7A V;  4OIK A;  4ZK9 B;  1G91 A;  2IJ0 A;  4L6T B;  1ZEQ X;  1S5C D;  4KK7 A;  1PRT C;  2EVB A;  2K5Q A;  2NYZ D;  5J1Z A;  2VB3 X;  2K32 A;  3G6J B;  4ZLT F;  4IUQ A;  2EYH A;  1Y8N B;  1GJX A;  2CQA A;  1IYV A;  1LTS D;  2QEJ C;  3MEH A;  3M7G A;  3M4O B;  4ID6 A;  3U9S A;  1SSO A;  4H44 C;  1PTO H;  4OGQ C;  5E4W C;  1ILP A;  3GP7 A;  1EEI D;  1A6X A;  1IHZ A;  2KOL A;  1QOH A;  3P75 A;  5D3I B;  2A73 B;  1STN A;  1G8Z D;  5EGT A;  4RGN A;  1Q12 A;  2F03 A;  1BF4 A;  3NPP A;  1G29 1;  3E6Z X;  1ONL A;  5ISR A;  2NTT A;  3ND8 A;  3HGB A;  2L0C A;  4HCS A;  4A3I B;  5I6Y A;  3O13 A;  5DM6 3;  2ZXO A;  2IWH A;  4ZKB B;  4ZYS A;  3MZ5 A;  2XWB B;  3S2H B;  1ILQ A;  3OIQ A;  1EL0 A;  2LFN A;  4IN3 A;  3NHH A;  4FYD A;  3MTS A;  5FO8 B;  5T1G A;  1D1K A;  2LY7 A;  3QIA A;  4I7Z C;  4DK0 A;  1F2M A;  1TS3 A;  4HN7 A;  3MXG A;  3QJY A;  4G7Z C;  1BOS A;  3ITP A;  2IX1 A;  2K5W A;  4DGZ A;  3QG1 A;  1MSH A;  2O5J C;  1HRJ A;  2RKS A;  4A3G B;  1KNA A;  3S1M B;  3J81 E;  1HTP A;  3Q6S A;  3P7J A;  1XX8 A;  4DAY A;  1KTK A;  3K7A B;  2B2W C;  2EZV A;  3HP3 A;  1ZYR C;  4U67 3;  2E76 C;  4OHJ A;  5T1I A;  2JEB I;  1OXX K;  2K7V A;  4N9T A;  2HUG A;  1V8Q A;  2AQ1 B;  1SJH D;  2MJ8 A;  4PMW A;  2RBM A;  1STB A;  1MI2 A;  2WAC A;  4ZUI A;  1QNU A;  4RWS C;  4XXE A;  2B8G A;  2MUY A;  4IQZ A;  2R7Z B;  4MIU A;  1A3T A;  2SNS A;  3EA6 A;  2YU9 B;  1DOM A;  2G9H D;  2R6G A;  3HOX B;  2PZW A;  4KTA A;  4XQQ A;  5IGC A;  1C8C A;  5IOD A;  1SYG A;  2L55 A;  5J22 A;  4A3E B;  1TR5 A;  3HKZ B;  2A74 C;  1IKL A;  3X3N A;  3TZD A;  3PUV A;  2B2T A;  1AZQ A;  2VXW A;  5FLX E;  4V19 0;  1DM0 B;  5M5W B;  4ILW A;  3D3R A;  1A3V A;  2EYF A;  4DN4 M;  2PQE A;  5DNF A;  3QOL A;  1OXU A;  4TRD A;  2GA4 B;  1EY4 A;  3D4W A;  4X3U A;  3URY A;  5FLX L;  2IX3 A;  5AFW A;  4H0L C;  5DAU A;  1WTX A;  3A54 A;  1LTI D;  3FVQ A;  4IFD I;  3MXN A;  1I4X A;  4RGO S;  4XYQ A;  4LMQ D;  1O78 A;  2XWJ B;  4K2L A;  2N88 A;  3DM1 A;  3FRP B;  1Q1B A;  2NTS A;  2KEC A;  1F77 A;  1IL8 A;  2Q8T A;  1JCK B;  4LAA A;  2QDB A;  4HAE A;  3K59 A;  1S5B D;  3J80 L;  3L7Z C;  5FOB B;  3D4R A;  3ND9 A;  1GUN A;  2K1B A;  4B9X A;  1QB5 D;  4RKB A;  2ENB A;  3QOJ A;  1PTO F;  5I2Y A;  3CKI B;  2B2U C;  5M5X B;  4TQU S;  4KI0 A;  1SYC A;  2CW0 D;  2EJM A;  1ZXT A;  4RCO A;  2L1B A;  4PV1 C;  1B3A A;  4WOR A;  5K5P A;  2AUK A;  3BYY B;  3SK5 A;  3BZD B;  2F0V A;  2XSC A;  2AQ3 B;  3I91 A;  4TKO B;  3BS1 A;  2XRQ D;  4G57 A;  2KHS A;  4FXG C;  1ESR A;  3MFG A;  3TP8 A;  4QMG A;  2X6L A;  3MXP A;  4RKL A;  1TVX A;  1D2B A;  3E5S A;  4IFD G;  5DEH A;  1H9K A;  2JP1 A;  4EQN A;  1STE A;  2LMC B;  1M8A A;  3L3O C;  1I6H B;  2KA7 A;  2LKV A;  3NBH A;  2E2D C;  2L4N A;  1EU4 A;  4HSP A;  1R4Q B;  4G7O C;  1DZ1 A;  2EYP A;  1STY A;  1I50 B;  1H9S A;  1YNN D;  1UNS A;  5K36 H;  1SND A;  1AFP A;  1PRT F;  4IFD J;  2F0H A;  1YNJ C;  1M4V A;  1Y1V B;  2F0K A;  3OWF A;  4A93 B;  2A5H A;  2BA1 A;  5IGE A;  4QUC A;  3PUX A;  1WTO A;  1B4O A;  3GTK B;  1I3Q B;  1KDA A;  1JOR A;  2PZT A;  1GUT A;  3RD4 A;  3SVM A;  1S5E D;  5ELB A;  2K5D A;  3S17 B;  1TT2 A;  1ML0 D;  1BBX C;  3M3Y B;  1Q8I A;  3TME A;  4HTH A;  2C9O A;  2A6H D;  1U4R A;  3EFX D;  2O2L D;  2J4X A;  3BG3 A;  4EGV A;  3PMF A;  2BOS A;  3PV0 A;  3WDN A;  1Q3L A;  4C1N K;  4G4K A;  3KK7 A;  5ELF A;  2F0U A;  3BDC A;  4QCL A;  1ET6 A;  2A69 D;  4A3D B;  5IOC A;  3OHX C;  2F0Q A;  1EQT A;  1H9R A;  2MHV A;  2VUM B;  4NMZ A;  3A55 A;  4V0B A;  2KCN A;  1PFN A;  1JR0 D;  4DXG A;  4OIJ A;  2F1M A;  2D9U A;  3FDT A;  5EKI A;  1G2S A;  3KF8 A;  3WOE A;  4M8A A;  1B2T A;  4OL7 A;  5IGF A;  3V96 A;  2VB2 X;  3Q23 A;  3K5L A;  1EY5 A;  3J7A F;  4Q5V A;  4WFN 3;  3TP6 A;  4X3K A;  1JWU D;  4IUN A;  2DNC A;  5C5L A;  3VR2 A;  3R8B A;  1SNP A;  5FK9 C;  3HOU B;  2Q8R E;  1RD9 D;  2BCO A;  1SYB A;  5C4J B;  5KEE A;  3Q24 A;  2F0F A;  4C56 C;  2EDG A;  1EY7 A;  2M2L A;  2BDO A;  4RCN A;  5CMD A;  5I4D A;  4QB4 A;  4IFD H;  4KKS A;  3RZD B;  1F9R A;  1SE3 A;  3R2T A;  3KLS A;  4KN7 C;  1SBB B;  1GOZ A;  4EQO A;  4N9P A;  1RTN A;  2R61 A;  1FYC A;  3KLS X;  5KYL A;  1MGS A;  1GHJ A;  3K57 A;  3D6W A;  1SNM A;  4KY6 A;  2R3Z A;  5M3M B;  1IYU A;  3BDO A;  3K58 A;  4S3S A;  4A3B B;  2XVS A;  2J7Z A;  2K28 A;  3T4A C;  2PMZ B;  5JEA J;  3F2U A;  2HDL A;  3IL8 A;  2EYJ A;  3CRL C;  3MAQ A;  5CV6 A;  4DAP A;  1VF5 C;  1QIL A;  3CQZ B;  4B9W A;  4C3J B;  4H13 C;  5HUR A;  4ODG A;  1HA6 A;  1D6E C;  4H7B A;  4CKE A;  5EPK A;  4FF2 A;  1E2V A;  1EZ6 A;  3UI2 A;  5EJW A;  4K8I A;  4U68 A;  2O5I C;  3SK4 A;  2EYL A;  1UUP A;  3GTM B;  3QB3 A;  1CM9 A;  1EIG A;  4KN4 C;  3WOF A;  2KEE A;  2KUM A;  2IW3 A;  4EVO A;  1STA A;  2FHT A;  2KQ3 A;  2O4X A;  2NBF A;  2Y0S B;  4Z9C B;  2OEO A;  2JE6 I;  3OOC A;  1SYF A;  2CW0 C;  4BBS B;  2B2T C;  1F9S A;  1EYC A;  1K8M A;  3VA7 A;  1HTL D;  1J9O A;  2H1E A;  1X3P A;  4PNY A;  1FNU A;  3NBI A;  3VA5 A;  3NK9 A;  1T5E A;  1V1P B;  5IGD A;  3GV3 A;  5HGT A;  1Z47 A;  2F0T A;  1S5F D;  3AB9 A;  3PO2 B;  5I6W A;  3A8K E;  1MSG A;  1TS4 A;  1CZW A;  3S9W A;  3I8Z A;  1BCP B;  2X69 A;  5COY A;  1A2U A;  4KKU A;  1F9Q A;  3G7L A;  1CTM A;  1SE2 A;  1YNN C;  3SXH A;  3JAM L;  5CR3 A;  2JSO A;  1LLR D;  3M85 A;  4NKL A;  4KY7 A;  1V43 A;  4KJN A;  4WJW A;  3HOY B;  2F0G A;  2PO4 A;  1JOQ A;  4QF4 A;  2F0E A;  3RLF A;  2Z1C A;  4K14 A;  3LWU A;  4IUU A;  2EYM A;  3W3A A;  4TSS A;  3MA2 B;  4ZRZ A;  2XN9 C;  3NE5 B;  1Y69 U;  2J0T D;  5JPN C;  1DCZ A;  4G7H C;  2A68 D;  2JA8 B;  1S4Z A;  2TSS A;  3FPP A;  3PO3 B;  1SEB D;  1U4P A;  4BY1 B;  3OMG A;  1TS2 A;  2CVR A;  5G3L D;  1CHQ D;  4KHZ A;  2A6H C;  1VF7 A;  1GUG A;  3ERO A;  2F0S A;  1FD7 D;  2NN6 I;  4XDX A;  4I65 A;  3D8G A;  5ELE A;  4M1U B;  5IGG A;  5C0X I;  2F0O A;  2D2C C;  1TS5 A;  4UAI A;  1BCP D;  2MP1 A;  2K33 A;  1PYW D;  4ULL A;  4F87 A;  2A69 C;  4KMU C;  2L11 A;  1B1Z A;  4YIJ A;  3FPU B;  2RSO A;  3VR5 A;  5CV7 A;  3PUW A;  4C2M B;  1B50 A;  4FVM A;  1GHK A;  1NAP A;  1VDZ A;  3T53 B;  2WIN B;  1U4L A;  5EKK A;  1O7Z A;  3J80 E;  1RCV D;  2WKD A;  4LK1 C;  2NZ1 D;  3S15 B;  3P1H A;  1STH A;  3TP7 A;  3OPO A;  3R3O A;  3R2I A;  4CKC A;  2EOT A;  3NTH A;  5LL6 X;  4BY7 B;  2B39 A;  1ENC A;  1QG7 A;  2FMC A;  2NN6 G;  2KVM A;  1Z7T A;  5ELC A;  1Y1W B;  3K5N A;  5C0X G;  2SNM A;  3MXU A;  2F0L A;  3NWT A;  1WTR A;  3ERQ A;  2EPB A;  1CA6 A;  1RF2 D;  3I4N B;  4L8J A;  3V05 A;  1SYD A;  2K04 A;  2X6G A;  2R93 B;  4EQP A;  1LTR D;  1B44 D;  1W6K A;  4ZKC B;  3FMC A;  1JIC A;  1ZKO A;  1HCZ A;  3LWE A;  3NQI A;  1KDC A;  1SNQ A;  1PZI D;  2ZXR A;  5C0X J;  1DXM A;  3KLR A;  2F0W A;  3S16 B;  1IKM A;  3EVQ A;  5CV8 A;  1HQM C;  1TWG B;  3M4Y A;  1BO0 A;  3NSW A;  2B8F A;  1C4Q A;  4XT3 B;  1U9R A;  3TDQ A;  2EJF C;  2K05 A;  5KNB A;  3CU7 A;  1JE4 A;  4DF7 A;  1L0X B;  4RA8 A;  3NXW A;  4BA1 I;  3GTJ B;  3DXJ C;  1AP0 A;  2N55 A;  2NVT B;  4ZUJ A;  4RGT A;  5D3D A;  4C3J G;  1DJR D;  2V4D A;  1EZ8 A;  4KD3 A;  4XQJ A;  3VYS A;  3C46 A;  3I4M B;  5CV4 A;  5CYU A;  2SOB A;  2F0P A;  3I4L A;  5JPM C;  3X3M A;  2Q8I B;  3I70 A;  4O1N A;  3QWN A;  4O42 A;  3Q0A A;  5E1F A;  3GTP B;  1O7L A;  3PIO 3;  2RA4 A;  4F88 A;  4WRD A;  4J6H A;  4XYO A;  5EPJ A;  4NP5 A;  1TWC B;  4A3K B;  4J1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...