3A8JE

Crystal structure of et-ehred complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
126
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
total genus 32
structure length 126
sequence length 127
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8jE00
2DNEA 4IFDG 3LWUA 1K8OA 1DXMA 1Q1EA 2BDOA 3VR2A 2B8GA 3VR5A 1GJXA 1CTMA 2E75C 2KCCA 2L5TA 2K32A 4GZYC 4BA1I 2KA7A 4G7HC 1HCZA 3I72A 2A6HD 3PUYA 4JBWA 1K8MA 1GHJA 2ZT9C 1OXSC 2EJFC 1CI3M 1OXUA 3FPPA 1QJOA 3P20A 1CFMA 3OPOA 4DNRB 4PV1C 2QF7A 2JEAI 4XTCS 3I73A 1VDZA 3VR4A 1H9SA 5BN3A 4H44C 1BDOA 4TKOB 2BE5D 1FR3A 1HPCA 1VCIA 3QG1A 2LMCB 5KNCA 1B9MA 2E74C 3SDZA 3VR6A 2A69C 3PUWA 4KHZA 1TU2B 2NN6I 1Y8OB 1H9KA 2A6EC 1GUOA 1Q90A 3MXUA 2A68D 3M85A 1IYVA 3CRKC 5BN5A 2K7VA 3M4YA 1GUNA 3ND8A 4TQUS 5KNBA 1H9SB 3N6RA 2PCFB 1A6XA 3KLRA 4JK1C 4H13C 4H0LC 1E2ZA 3D4RA 4KI0A 1IYUA 2YYZA 1ONLA 1OXVA 1V43A 2DN8A 1VF5C 4DK1A 4IFDH 3OOCA 4IQZA 1OXXK 5K36G 4KKTA 4G7ZC 1PMRA 3EQLC 2EJMA 3QJYA 3A7AB 1Q12A 1LABA 3PUZA 5BN4A 4OO1G 3A7LA 3A8KE 2V4DA 1Q1BA 5C0XH 3OW7A 1V8QA 5K36H 2A69D 4G7OC 4HR7B 3W3AA 2EDGA 2A6HC 1GUTA 3BG3A 4OO1H 1IW7D 4RCNA 3DXJC 3H94A 4KMUC 2NN6H 3IKJA 4I7ZC 3VA7A 3PUVA 3GQBA 3T53B 5A35A 3AB9A 2BA1A 1H9MA 3RLFA 4LK1C 1OXTA 3SE0A 3TZUA 1Y69U 1LACA 5C0XG 1GHKA 1YNJC 1I6VC 3ND9A 4OGQC 1DCZA 3VR3A 2E76C 1VF7A 2PPBC 1HQMC 1Z7TA 2R6GA 2PNRC 3BDOA 5JEAH 2D62A 2NN6G 3U9SA 2EJGC 4KKSA 1GUGA 4BA2I 2JE6I 3HGBA 3PUXA 3FMCA 1IW7C 4KN7C 2A68C 3T56B 1Y8NB 1B9NA 3LNNA 2D5DA 1YNNC 2D2CC 3WDNA 4KKUA 1E2WA 1O78A 1HTPA 2AUJD 2BA0A 2EVBA 2JEBI 5JEAG 1Z6HA 3L7ZC 2B8FA 1SMYC 5KNDA 2AUKA 4XIGS 1T5EA 3M7NA 1ZYRC 3IFTA 2DNCA 2JXMB 1FYCA 3A8IE 3CRLC 3QIAA 1H9JA 1ZKOA 2O5IC 2IT1A 2A6ED 3GD7A 3MFYA 3NE5B 1TKWB 3T51B 4DK0A 1DD2A 3A8JE 2Q8IB 1E2VA 1H9RA 2BE5C 3PV0A 1Y8PB 1GUSA 2F1MA 2AWOA 4LJZC 4DNTB 2K33A 1EWHA 4L8JA 3D31A 3I4LA 1G291 2O5JC 2CW0C 4KN4C 1O7LA
chains in the Genus database with same CATH superfamily
3KYHC 1PH4A 2F0OA 4IUNA 5F2DA 3CCVA 2KCCA 5G3LD 4DV0Q 2R92H 2J7ZA 2LXKA 1HCZA 2N49A 1GHJA 2ZT9C 2HHHL 4IPGA 3HOUG 3P20A 4JI8L 4KTAA 2R3ZA 3ZYYX 4JPBW 3RN2A 2K1BA 2F3VA 4DUZL 3I3CA 2RA4A 1VQ6A 3VR6A 4KHZA 1D7QA 1DOLA 1WTXA 4HTHA 2RHQB 1UE6A 4GLAC 4A3FG 2UUAL 5IT9c 1SNPA 3DEPA 2F4VL 3KLRA 5GAEC 4K2KA 3EBEA 4UP8A 2B2WC 2CH4A 1NNXA 4IQZA 5ELCA 4KKTA 4CJ1B 3HOVH 1TWAH 2NTTA 5DLQE 1NE3A 3EVQA 2BOSA 1PYWD 4LNQA 4C3JH 4R4OA 1ESRA 1SAPA 4ZCKA 1HNZQ 4OWWB 4DAYB 2UXCQ 4GOPB 2JA6B 1MIUA 1D8LA 2K05A 2Z1CA 4C3HB 4F8MA 3CF5A 1IHZA 1WVLA 1PH1A 4R9WA 3PUVA 1I50B 5BR8L 3K81C 5IGEA 2E2HH 4A3FB 4A3JB 1D5XC 2MFIA 1YNJC 3LX0A 4AQYQ 4X3KA 5C3EG 5M3FG 1L2FA 2WP8J 3NPPA 3AQQA 4KKSA 3PCOB 2RCNA 5GROA 5LMNW 4YCWA 1O7ZA 5GAHC 3BJUA 1X6OA 4A3KB 3HOUB 1SROA 2BA0A 5C44H 2Z4IA 1PTOH 1KNEA 3WWVA 4YY3Q 4A3MG 1U4MA 1BNZA 1FNVA 1FYCA 1KAAA 2R7FA 1TR5A 4YHHQ 2O5IC 1IBML 3A8JE 1E2VA 3PV0A 2AWOA 4MTKA 4UP9A 4B3RL 4LF6L 3M4OB 3D31A 4GNXA 4C3JB 1S72A 5EBDA 1P16A 3MFGA 5FJ8H 3U58A 2E2IB 2E2JB 1W2BA 3S15B 2VL6A 3K7AB 5M3MH 3K58A 1C8CA 3GTJH 2E75C 2DY8A 3J81L 2WKDA 4CHTB 5CBEE 1I6HH 5JPMC 5AJ3L 3D6CA 1A15A 1QJOA 4YHHL 2RKSA 1LTLA 1HTLD 2JYOA 4DFAA 4KJNA 2K03A 3HS0C 2M2LA 2OCEA 4CDFC 2RBMA 1IYVA 4LMQD 2Y0SE 2EYHA 1YI2A 1A8VA 5IWAQ 3RZDB 1V43A 5CYUA 1XX8A 4IO9A 3R3OA 1B53A 3CP0A 1O7IA 2EY6A 2UUBQ 4B3RQ 2XTIA 5HGTA 2HQLA 1SR3A 1YVCA 4QY7A 3HKZE 2QEXA 3PIOA 4KK7A 1RDPD 3K57A 1WD0A 3HOWB 3L0OA 1JWUD 5DNFA 4LFCQ 3S16B 4LK1C 2X6LA 4RMFA 5I4DA 1I3QB 2OQ0A 2KCTA 1BF4A 2VQFL 3GTMB 3I2ZA 2NN6G 2GA4B 4BA2I 2Q2UA 1QVCA 4IUQA 1VS0A 1IW7C 3T56B 5M3FH 2Z6BA 1G2TA 3H3VH 3PO3H 2E5LQ 4L5RC 3FKIB 5A2QE 1O78A 1FJGL 4C3HG 3TP5A 3NQTA 3S1QB 3K59A 2IW3A 4E6IA 2AUKA 4NXNQ 4HSVA 4AYBB 3UI2A 1ZKOA 3K6OA 5EKKA 4R4IA 2IT1A 5IYCG 3Q0AA 3TZDA 2SNSA 2F0VA 2JJQA 1WTVA 5ELEA 1HFNA 4A3CH 3TQYA 4PMCA 2HIXA 2DY7A 4LF4Q 1O7LA 1IW7D 3KF8B 4FP5D 1SN8A 2KJXA 3NTHA 1MHWC 3ZJYC 3HOVG 4N9TA 2A6HD 4I65A 1PRTB 1NY4A 4FF4A 4YWLA 4ALPA 2B63H 1CSQA 3I73A 4O0AA 5JVH3 4TKOB 4N8X1 5C4XB 2Y0SB 1SNMA 1UE7A 2N8NA 1JE5A 1G8ZD 1LTSD 2VB3X 5IP9H 2B29A 1TU2B 4OIJA 5FO7B 3J80L 3D0FA 3M85A 2YU9B 4BXXH 3NHHA 5IGDA 3KF6A 4B3SQ 4YCUA 4J15A 1E2ZA 1WTWA 4APVA 4KI0A 1E22A 2E2IH 2E2JH 2FINB 1VMCA 3TMEA 4JI5L 4K2LA 4RCOA 1X3EA 1WTQA 1F2MA 1BUVT 3QJYA 4UP7A 2N78A 3FVQA 1EY0A 4BBRH 5C0XH 4WORA 5A2QL 4G7OC 3W3AA 4HSPA 3JAML 1GUTA 3S2HB 2C35B 4YY3L 1I4RA 4KV6A 1F9SA 2B3GA 3RZDH 3A55A 5A35A 4G4KA 3MXGA 2R7ZG 1EY5A 1VQ4A 2K52A 1I6VC 3HOYG 2K14A 3TRZA 1VQGA 4K5WA 3BDOA 4NXMQ 2SEBD 3HGBA 4KN7C 2K50A 5GAGC 2D0PA 1B9NA 3V05A 2NVQH 4X3SA 2CCZA 1VMPA 1E2WA 2XWBB 3SVMA 1SMYC 4PZ7A 3TREA 1PZID 3S1RH 2VXWA 2UU9L 1H9JA 1TY0A 2A6ED 2NVYB 3EA6A 5FO9B 2ASBA 5M3MB 1IXRA 1X3PA 1GUSA 3OSOA 5JVG3 1VQIA 1S4ZA 5CV5A 5C4JB 1E1OA 1EZ8A 5I2XA 1XPOA 2K28A 3MEFA 1TY2A 3V96A 4C2MH 4A3DH 4C3IG 1Q3LA 2JA8B 2F0KA 1TWHH 1CTMA 5M9OA 3GDEA 5IT9E 3H0GG 1PLFA 2RDFA 4IPDA 1F77A 4CDCC 4XT3B 1TS2A 4A3BH 4KD3A 1RCVD 4GKKL 4UDUC 1HNXL 4DR2L 4Q5VA 4XTCS 1JORA 1X32A 4DR6L 4GOPC 3UE1A 1X54A 3BVZA 4QMGA 1B9MA 3SDZA 2ICIA 3RMHA 3TS0A 5C5LA 4CDEC 1F2LA 3BZCA 2B39A 1WCMH 1EQRA 1ET9A 1STHA 2ZXRA 2SOBA 4MZ9A 2JK8A 1MBYA 1DONA 3ITPA 5IP7H 5I6WA 4XQJA 5AJ3Q 1OXXK 2PQAA 3S1QH 1VQAA 3F2BA 3CCSA 2AMCB 5EJWA 2L1BA 2OWOA 3AFQA 4OO1G 2L55A 2ES2A 3GTGB 4MIUA 4HR7B 1SYBA 2CW0D 3GV6A 3VYSA 2A6HC 3IFDA 5J39A 4G57A 2RSOA 1I3QH 1C0AA 2F0SA 3HEJA 3QO2A 3T53B 2A19A 1CKNB 3KF8A 3HRZC 4H02A 1VF7A 4TVAB 1N36Q 2VUMH 1Z7TA 2D62A 3K5MA 4V190 2F0LA 2YTYA 3WDNA 1AH9A 5JJLA 4JI0Q 1HTPA 2CH4W 2QKIC 1FNUA 2ZXPA 4HCSA 4DV6Q 4DR5L 4BXXG 2NYZD 1HH2P 5GADC 1ZYRC 1TWGB 2UUCQ 1TWFH 2C5CA 2ZTDA 1K0SA 4A3EH 1ILQA 3NE5B 1TWHB 1CHQD 4FF2A 1DD2A 2YTXA 1C48A 2PNHA 2JA7H 1RD9D 1SXTA 1UAPA 3DMUA 1KLUD 3F2DA 1QZHA 3FHWA 2O5JC 1L1OC 4O42A 4JI3Q 4K14A 4JI2L 3IAYA 2DNEA 2F0NA 1SDFA 2NVYH 3OMGA 2QA4A 3PO2B 5IYDH 2K32A 2KA7A 3K80C 4G7HC 2X6GA 5IYBH 3OWEB 1HA5A 1W6JA 2F0UA 1ASZA 1ENFA 1Y1WB 5C4XH 2OTJA 3R8BA 1L0YB 5C5MA 3GTJB 1CM9A 2A1AA 2QW7A 1BDOA 2MP1A 4OELB 4GKJL 3U4VA 3PO2H 1WFQA 1STAA 5JJIA 2B2TC 4P75A 1J5EQ 4DV2L 1Q90A 1EYDA 4GN4B 4TQUS 5KNBA 1U0LA 4H13C 1II3A 3BZKA 4QCLA 5CR3A 3UE0A 3BDCA 4GOPA 3I70A 1TWFB 4R4TA 3A54A 1N36L 4M8AA 2VZAA 3E6ZX 2P5ZX 4FXGC 3H0GH 5FKAC 1SE8A 1I4GA 1SE4A 4DV3L 5K36H 3AFPA 3HOXH 1JOKA 4P73A 1YJWA 4JI6Q 3KFUA 4IFDJ 1ML0D 2XSCA 3M3YB 3MC0B 3RLFA 2AQ3B 1ENAA 1B3QA 1I50H 4A76A 1V9PA 3I55A 2EYMA 2VB2X 4XQNA 3GTMH 1DZ1A 5JEAH 5FLMH 1AN8A 4YWKA 5CV7A 1N33Q 1WI5A 5IIFA 4LFBL 3C1FA 2ATWA 4RH6A 3DUZA 4QQBX 4DV1Q 3EIVA 1BOSA 1Z6HA 3L7ZC 3HOVB 1C4QA 1SYCA 3CQZB 4A93H 2IWHA 4B9XA 2JXMB 1EYGA 1EOTA 1QNKA 4C3IH 1EYCA 4X62L 1XNRL 2E2DC 1LLRD 3PQIA 1I4QA 1Y1VB 4B3MQ 2QILA 3TN2A 3MVVA 4PMWA 4BBSH 1X9NA 1C9OA 5IYBG 1VQHA 3CU7A 4PZ8A 3S1MB 1ICWA 3PMFA 4QB4A 4IUTA 3STBD 4RGTA 1C7YA 4JI4L 3CC4A 2QF7A 4GN3B 4A3MH 1H9SA 1PRTC 1LTBD 3DEOA 1FR3A 5M5YH 1J5EL 1JOQA 2LMCB 2NZOA 4C3IB 1Q8IA 2NN6I 4DUYQ 2E5LL 1YNJD 3F2UA 1ZEQX 4FF1A 4FF3A 3PO2G 1ZYRD 1UWVA 3CAMA 1K83H 4ZKBB 3GV3A 5LL6X 4EQPA 1EQTA 3X3MA 1YITA 3M4OH 1UEBA 5HURA 5H1SE 1K9MC 5LHY1 3C1EA 4POGA 1G91A 4ZUIA 2C9OA 1Q8KA 1IKMA 3A7AB 2JA5G 3A74A 3OW7A 3CCJA 4JBKA 3ULLA 2HDLA 2EYPA 2F0JA 1FJGQ 1G6PA 3OIQA 3J81i 3D8GA 1CT1D 3JC66 5C44B 2AKWB 3I4MG 1NCVA 2KHSA 2CVRA 4R8NA 4TSSA 1OXTA 4JYAQ 2OEOA 4DN4M 3MHBA 4OGQC 1GO3E 4OXPA 3W1GA 2A8VA 2Q2HA 1GD7A 4CBVA 4Z9CB 3UDIA 2ZTEA 4JC0A 3D3RA 3OIPA 4RA8A 4AH6A 4MHEA 1IBLQ 5C3EH 1IYJB 3FP9A 1FVIA 5CC4A 4EX5A 2EOTA 2PI2E 1PDQA 1BBUA 2DNCA 1KDAA 3A8IE 1Z47A 1N34L 5D14A 3HOXG 2JQOA 5E1FA 5E3FA 1A0IA 5M5WH 4FDBA 3I7FA 2R92G 2NVTH 4GN5A 4IPHA 4NPSA 4O1NA 4K8JA 3BVMA 4A75A 3E9IA 1TVXA 1NR2A 3K7UC 3NTKA 5IYCH 4P72A 5IGBA 1K8OA 1L1OA 4A3GH 1O80A 1KXLA 1SYGA 2L5TA 2PYKA 1P8LA 2MO1A 1F9RA 2IX1A 4GZYC 2PW7A 1L1OB 2F0WA 3HOZH 2L0CA 2HDMA 1EFWA 4DNRB 2L15A 4OWXB 3HZXA 4UAIA 1EU4A 4DR4Q 4IURA 2JA7B 2QDLA 2B2TA 4DR6Q 2A73B 2CFMA 1PZJD 4LF7Q 1K0RA 2LSSA 4LWCA 2FXQA 1JE4A 4DV7Q 1TWGH 4X65L 1U4RA 1JQYD 2M9VA 4HCEA 2NWGA 2IPKD 1FD7D 5KYIA 4OONA 1NAPA 2PCFB 1RL2A 1DJRD 5ELDA 2IHEA 1EWIA 2JA5B 3SXHA 1HA6A 1WTOA 2F0QA 5FJ8G 2JA6G 3CPFA 4IFDH 2RHSB 3HOZG 4DPGA 1XTCD 3CQZH 3EQLC 1KHIA 1NJIC 2VUMB 2PZWA 4UHVA 2PO4A 3PO3B 4DAVA 1D5MC 3KJPA 4DKAC 5C44G 4EQ5A 4BWGB 2ID0A 3Q8DA 4RGMA 2UXCL 3R93A 2Q8TA 3HOWG 4KHVA 3J80c 4DAPA 3CPWA 2AWNA 2DJGC 4QF4A 1W6KA 3PF4A 4OX9Q 2F4VQ 3D4WA 3NEMA 2G9DA 4F87A 4N9PA 2UXBQ 1HQRD 5EBCA 1D5ZC 1BBXC 2PPBC 3MEHA 2K5NA 1HZ9A 2EJGC 2H4OA 2IX3A 5JEAJ 2PZTA 1XMQL 5L37A 2QGQA 3ERSX 1KTKA 1TS5A 3I56A 3S17B 1HUMA 2NTSA 4F88A 3DWAA 3BDLA 3VYTA 2JA5H 1IKLA 4WJWA 2JA7G 4IJLA 1PVOA 1AZPA 2RCFA 1XNQQ 1SYEA 2ZJRA 2Q8IB 4ME5A 4LF6Q 2UUBL 3RN5A 3MWYW 2J0TD 1RIPA 4L63B 1FL0A 4L8JA 3K5LA 1K3RA 4DXFA 3SR1A 2OXPA 2CW0C 1CHPD 4EQOA 3EROA 3LGJA 2B8GA 4NW2A 3I8ZA 3GTKB 5I2YA 3NK9A 2N88A 3PUYA 3VDYA 3K0YA 1STBA 1K8MA 1OXSC 2IJ0A 3PO3G 4JOIC 4ZRZA 5LL6S 1JCKB 1HXYD 3I4OA 4RGOS 2XGTA 1HFGA 1V1PB 4JI8Q 5JJKA 1LYLA 5BN3A 2EYJA 1GM5A 3R2TA 1VCIA 3UDGA 2EYFA 1IZ6A 3OWFA 2E74C 4DAMA 1JJGA 4X65Q 2XRSD 3CMAA 2F0PA 2CWPA 1Y8OB 2L4NA 1PYBA 3VYRA 4LFBQ 2EYLA 5BN5A 3CCLA 3ND8A 1S5DD 3N6RA 1KAWA 3ERQA 4DF7A 4DK3C 1AFPA 1YIJA 1MGSA 1B70B 3B6YA 1IYUA 3X3NA 4HJ8A 4BY1H 3J7AF 3OOCA 4IPCA 1SYFA 5IOCA 3GTKH 2NUCA 1CZGA 4Y7NB 1IL2A 1AE3A 5I9OA 3BZDB 3AMUA 3HOUH 1V8QA 1N32L 4OEMB 1UEAB 1EYAA 2VY3A 2H1EA 3T1YQ 4NXNL 2JA8G 3DXJC 1Q86C 3GTQB 3J80i 3HOYB 4ULLA 1H9MA 1EY9A 3KBGA 4A3JH 5CGKA 1HQMC 4JYAL 2I0QA 1SJHD 3QWNA 2KECA 1HR0W 3NWSA 3MXNA 2JA6H 3LNNA 1UNSA 2AUJD 5FK9C 1VQLA 2UUAQ 4H7BA 1SNOA 1TWAB 1MI2A 5C0XI 1YHAA 5EAYA 5D65A 1VQKA 3IFTA 1BR9A 1XNQL 1S3OA 2SNMA 1BKBA 4QUFA 3DWPA 2EY5A 1BQQT 4IN3A 1WCMB 4A3MB 1OO9B 3I4LA 5EPKA 2EE1A 1VQ5A 4A3EG 2KHIA 1UUPA 3LWUA 3I4MB 2GN5A 2Y0SG 2FJ2A 3C3LA 1V1OA 4BA1I 4JBWA 5E4WC 2EY1A 2D9UA 4PMBA 1OXUA 4BY7H 4C1NI 4OWTB 3RLNA 3R2IA 3D6WA 4PV1C 3IRBA 3VR4A 3SHLA 2VQFQ 2ENBA 3HG9A 2HD3A 1Y1VH 4OL7A 3S17H 3I4NG 5EGTA 2IY5B 4YCVA 3MXUA 4JCVE 1EEID 2LFNA 4RFBA 5JJZA 4A3IG 2K4KA 3PGZA 4X3TA 4KY6A 1XWEA 2WB1E 1MD2D 1CA6A 4LAAA 4FXKC 4B9WA 4X62Q 2CWAA 1NTGA 1QWYA 4RWSC 1JR0D 1VQ9A 1Q12A 3S2DB 3FPUB 4CDDC 2KCNA 2CKZB 5CV9A 1VQ7A 1WTPA 2F52A 2Z9HA 5C3WA 2Q8RE 3M3YH 4RG1A 1PRTF 4X64Q 1IL8A 4X3UA 3GTQH 1U4LA 3KDFB 3G7LA 2VUMG 1A63A 3GTLH 4ZUJA 4HAEA 1CQFA 3HOXB 4JV5Q 2B2WA 1G6ZA 4NP5A 4LW1A 2MO0A 3S14B 1LTGD 1U5KA 1JB7A 2Z6KA 2JE6I 3GTPH 3CCRA 4HJ5A 4ME3A 3P7JA 3CCEA 4JI6L 5D3IB 1SFOB 3OMCA 3NBIA 4XIGS 1S40A 3P1HA 5M5XB 3CRLC 3FEWX 2MHVA 4KD4A 1I5FA 1N34Q 3BU2A 2UXBL 4WFN3 5G3LF 1PFNA 3ONAB 2NVXH 4DV5L 3JAMi 1ESFA 4PG3A 1Y1WH 3RUZA 4GNXC 4WRDA 3BYTB 5AFWA 1E0BA 4CKEA 4A3CG 4KY5A 1BXTA 3RLOA 1LTID 2XVSA 3C46A 2BDNA 2RSNA 2I07B 3Q6SA 3H3VC 3FPPA 2KCMA 3STBC 1CFMA 1QB5D 3PIPA 3EN2A 3I4NH 2FFKB 1PH9A 1E3PA 1XNRQ 1VDZA 1WCMG 3H15A 2PZUA 1AZQA 2E8GA 1PRTD 2R7DA 4R4CA 4XXEA 1HPCA 1B44D 2N3SA 4A3EB 1S5FD 3CW2C 2A68D 2ZM6L 1KRTA 4Y52H 5ELFA 2K7VA 2F4IA 1GUNA 2NBFA 3NSWA 1G51A 1HZBA 3G4SA 2ZJPA 3HKSA 4H0LC 3D4RA 4ZAIA 3GP7A 3HKZG 4QIWB 1JJCB 1PFBA 4QIWE 1XPUA 4A3BG 3I4MH 5IYDG 2K5DA 1JWMD 4ZYSA 2XWJB 4OIKA 4XYOA 5BN4A 4UY8C 3A7LA 1Q1BA 3J7AV 2F0HA 1PXUA 1U9RA 4POFA 1JC7A 4ZQ3A 4LF4L 2E2HB 1B4OA 1MJEA 3EJIA 1PZKD 4LF8L 5LMUQ 3T1HL 4DK6C 3VA7A 4AIMA 1NUCA 4A93B 1E7ZA 1GHKA 4GLVB 4JBJA 4RGNA 1M4VA 3S16H 1WD1A 3SK6A 4U673 4DR4L 3MA2B 3FMCA 4PQXA 1SNCA 4ODGA 1K8GA 1EIFA 1EQQA 2WAQB 2ZJQA 4MN3A 2GVAA 4CJ0B 5M5YB 1Q81C 1I4XA 3T1HQ 1CA5A 1FGBD 2PW5A 4JVZA 2KVMA 3M7NA 3WOFA 5C4XG 3E0JA 1YNND 4DR2Q 2K6AA 1XYIA 4A3GG 2QCPX 2KUMA 3MFYA 2JN4A 4J6HA 1J9OA 4XQQA 1YNXA 1PFMA 1EY4A 1F2YA 1HNZL 1R4PB 2Z4HA 1QE6A 2RQXA 1TS4A 2L9HA 5LMNQ 1XXGA 1EY8A 3BVGA 1PTOF 1Q1EA 4Q0FA 3A56A 3M4QA 3VR5A 1GJXA 1Y14B 4BBSB 4R4QA 2FHTA 1RTNA 1GUWA 4K0KQ 1UE1A 5KYLA 4LFAL 4K5XA 3MXPA 3OPOA 2ALYB 4RHRA 4C3JG 4A4IA 1LUZA 2JEAI 2KEEA 1HNXQ 4A3IH 1CZWA 3CC2A 3N52A 4KHPL 1N32Q 3QG1A 2R93G 1T9HA 1YZ6A 3K7AH 1F2ZA 1KDCA 5M5WB 2WB1B 1JOOA 1CQVA 4BY7G 3SEBA 2X69A 1I4PA 4JI0L 3K5NA 1R4QB 3L3OC 1BCPB 4JK1C 1X65A 4IUUA 1KD1C 3H91A 1SYDA 2Z0SA 2EQSA 4DK1A 4HJAA 2FMCA 2QEJC 3UDXA 2KBNA 1B50A 1EEFD 1PMRA 1G2SA 1HJPA 1VQFA 2WAQG 4JI1L 2MPMA 4NKLA 3NTIA 2EIFA 5COYA 1XMOQ 1LTTD 1BO0A 2I5MX 2XRQD 4JI3L 4FVMA 4YWMA 4A93G 1J8IA 3W5OA 1PA6A 4OO1H 4CGYB 1Y1VG 3VA5A 1NSNS 3E0EA 3H94A 4KMUC 1EIHA 2Z8LA 5IE8A 3K5OA 4J1MA 3TZUA 1IBMQ 1WTRA 4LUZA 1ET6A 4ZKCB 3RZOH 3VR3A 4GNXB 4JV5L 3NELA 2NB0A 3D4DA 1XTDA 4XT1B 2Q2IA 3KLSA 1SRUA 3U9SA 3J7A5 4C3HH 1I94Q 2AHOB 2IL8A 1LTRD 1EZ6A 5KGUA 1Y8NB 1X3GA 1RHPA 2F0EA 2B8FA 4K6DA 2ZXOA 1BCPC 3AU7A 4FO2A 4A3DG 4CJ2C 3TP7A 4HN7A 3H3VI 5J3BA 1STYA 4U68A 4F7XA 2YTVA 1EWHA 5LMNL 5IY0A 1M1KC 3QOJA 2EXZA 4OO1I 1G291 3KLSX 1D1IA 1VQDA 4IFDG 1S5ED 3NBHB 1A2UA 4AYBG 3J80E 4XYQA 3VR2A 4DR1L 4A3IB 1AP0A 3F2CA 4DV1L 1LT4D 4LF9L 3U50C 4DNIA 5BR8Q 1FGUA 2R93B 1CI3M 2WIIB 1MKHA 3K8AA 2DGYA 3Q22A 2I5HA 3IL8A 2RVLA 5KEEA 4DU9A 5ELOA 1D6EC 2EZVA 2R92B 2HQEA 5IGCA 5KNCA 5CBAE 2L12A 1RTOA 4N8FA 5JAVA 4IUPA 1STGA 3DM3A 1SEBD 1WTHA 2EPBA 4IALA 4M1UB 1HNWL 4EVOA 3PIP3 1HUNA 2WAQE 3M4YA 3TP6A 4JI7Q 1DOMA 1F9PA 4OX9L 1IBKL 3G6EA 4MNOA 4GKKQ 2VQEL 1SSOA 2K5VA 3A5ZB 3H6MA 5M3FB 5CV8A 5J1ZA 5K36G 4G7ZC 3CXCA 4QJFA 1N8RC 2JA8H 3OTOL 5JOBA 1ENCA 1DYQA 2B2YA 4B3TL 1EIGA 2PQAB 2V4DA 2A69D 3T4AC 3QB3A 1KIXA 1HNWQ 3GTGH 1QILA 1D2BA 2WINB 4RCNA 3JAME 2VW9A 2K01A 4IJHA 5DM63 2F0FA 3SE0A 2MGSA 5CV6A 1DCZA 3I90A 3I91A 4B3ML 5NUCA 4NXML 5FLXE 3CCMA 1N9WA 2R6GA 4FNFA 3AEVA 4DGZA 1TWCH 3DWQA 2F3WA 2DJFC 3H0GB 2HCIA 3PUXA 2O4XA 3KK7A 3NWTA 2A5HA 3HOYH 2D2CC 2YV5A 4KKUA 4ABNA 1ASYA 2EVBA 3S24A 3CMEA 4RAUC 2F03A 5I9PA 5EKLA 4K6LA 4LF9Q 2UXDQ 4GS3A 1SE3A 5IT9L 2B63G 5IWAL 1K73C 1U4PA 4O2DA 5EQ0A 3ULJA 1MSHA 3S2HH 4I7AA 1H9RA 1B2TA 2B2UA 2R61A 1QZGA 5IP7G 4ZK9B 1LT6D 4L5TA 4A3DB 3L2PA 2EY2A 5C3XA 2AQ1B 1LM0A 4DR5Q 4JI5Q 4P71A 3S15H 1K83B 3SK5A 4JW0A 1UE5A 4AQYL 1PH2A 3PSIA 2WACA 3CC7A 2I5LX 1Z9FA 1I94L 3AYHB 4DXGA 3PUWA 3VYUA 1OTCA 1RJTA 1H9KA 1B3AA 2NVQB 3CRKC 4YIJA 1BCPD 5CV4A 1JT8A 1PTOB 3TSSA 2CQAA 1SNDA 3KLWA 1LT3D 2YYZA 1SE2A 2J4XA 2DN8A 1VF5C 1VQBA 2TSSA 3E5SA 5K5PA 4DAYA 2B2UC 3MAQA 1XMOL 4L5SA 1K3BC 2OQKA 3RNUA 4R8IA 1D1KA 1TT2A 3LWEA 5C4HA 2OT2A 5ISRA 4Y7NH 4A3KG 5IGGA 2M00A 1KQSA 4DV5Q 4KJOA 2K04A 2PMZB 4BBSG 2HT1A 3S14H 1KABA 1DM0B 2ICEC 2XIWA 4ILWA 4JI7L 3URYA 1EUJA 4K5VA 4DV4L 2BA1A 2F0DA 1Y69U 2EXDA 1CSPA 1LACA 3J81j 2A74C 4NDXA 3MZ5A 2Z6KC 3A0JA 1BCPF 1AE2A 2PQEA 2KOLA 1J6QA 4X66L 4LF7L 1QCBD 3P75A 4ZLTF 2D5DA 2YU9H 1T5XD 3HFZB 2O2LD 1WJJA 1F9QA 3ICEA 1O7YA 4K0KL 2BH2A 1VQEA 2RDGA 1LTAD 2F3IA 1EOVA 3T16A 4DV4Q 3NENA 4LFCL 3RR5A 2CQOA 1GVPA 1TKWB 2TMPA 4L6TB 2ZTCA 3H09A 4ID6A 1GOZA 2F1MA 4B3TQ 4LJZC 4FYDA 4DNTB 3S1MH 3KF6B 5FLXL 1NMGA 3FDTA 1AEXA 4S3SA 4HIDA 1DXMA 3U9OA 2VNUD 3KDFA 1BBWA 1H95A 1K8AC 4CKCA 1JB3A 1CUKA 3M7GA 3TP8A 5C0XJ 1FNWA 4DV6L 1RF2D 4C1NK 5DEHA 2KHJA 4NMZA 5IP9G 2VS1A 5FLXc 2R93H 1PV4A 1WOCA 4C2MB 3TDQA 4R1JA 2BE5D 3U4ZA 4JG2A 1PH5A 4QGUA 1JWSD 2LY7A 3ULPA 1LV9A 1MJCA 1H9SB 4B08A 1A2TA 4RKLA 3SGIA 4WJ3M 2CHBD 1I6HB 1YBYA 1NR4A 4AYBE 5DM73 1JICA 2HHHQ 3TBIB 4FXDA 1YJ9A 1L0WA 3J7ZC 2NVTB 4P2CB 3EFXD 3HOWH 2RDHA 3W2DA 5ELNA 5HGQA 1B7YB 1LABA 1QG7A 1YHQA 4DR7Q 2KEDA 2G5DA 2EDGA 2B2VC 1SFOH 5C6AA 4RKBA 1SJED 3CD6A 4OHJA 2WV6D 1QUQB 3KOJA 4B3SL 2NN6H 1S5CD 3IKJA 4WJ4A 4HIOA 3GQBA 3S1NH 5C3EB 3KBXA 3Q24A 3GTPB 2SDFA 3ND9A 2E76C 1X3QA 3M4PA 3GO5A 3F1ZA 1GKHA 3KJOA 2PNRC 4GKJQ 3V2TA 4KHPQ 4X6AH 2K5HA 1GUGA 3MTSA 4JI2Q 1ILPA 3DM1A 4DV2Q 1NMFA 1VQPA 3J81c 2LKVA 3DLLA 3GTLB 1EL0A 2GVBA 1YNNC 3RD4A 1HZCA 3I4NB 5JEAG 3FKIG 1B8AA 5FO8B 4A3FH 3HOZB 4P74A 2B2VA 4K8IA 4BY1B 1KDBA 2UXDL 1AW7A 1ICFB 2WKCA 3E9HA 2KENA 3CCQA 2H5XA 4KLKA 1DGSA 1QVGA 2HIVA 5D3DA 1KNAA 2B2YC 4A3GB 3DHQA 4DA2A 2MQHA 1HRJA 3FRPB 4UPAA 1E1TA 1PH7A 4IOAA 4KY7A 1CKMA 1M90C 3A5UA 4DV0L 1YHBA 1EU3A 1JJ2A 1IBKQ 4CKBA 5M5XH 3I72A 2VQEQ 1X55A 1STEA 3OYYA 1BVSA 3OTOQ 4GLXA 1KRSA 4DUZQ 3ER0A 4LF5Q 2NZHA 4DR3L 3G48A 1WYDA 4DUYL 4HJ7A 3JAMc 2A69C 3NP8A 1XPRA 1XMQQ 1HR0Q 3NBHA 4BY7B 1GXDC 1GUOA 2BCOA 2A6EC 5FOBB 2R7ZH 2JP1A 1PH8A 1XJVA 5J22A 2JA9A 2QDBA 1JMCA 1PYSB 5CORA 3G6JB 4BS9A 1KL9A 1ONLA 3K0XA 3Q23A 1M8AA 2MJ8A 3MXNB 5DAUA 5JPNC 4IZ8A 1TWCB 2EJMA 1EFID 4J8QA 4A3LG 1TQOA 3CCUA 1R9TH 1TIID 3PUZA 4PNYA 1CKOA 3A8KE 1VQNA 5C4JH 3PF5A 1EWCA 2EYOA 4X64L 1Q7YC 1PH6A 2WB1G 4DR1Q 4HJ9A 2F0TA 3UDFA 1SMXA 3S1RB 3L9AX 4NB3A 2HUGA 2Q2TA 4BBRG 2V1CC 5C0XG 2I46A 3T13A 2F0IA 2HCCA 1EQVA 3TEHB 3F8TA 4XDXA 3G71A 2IX0A 4JOIA 1R9TB 5IGFA 1QNUA 3SK4A 4QUCA 4BY1G 1N33L 5TSSA 5HY6A 4X66Q 4PZ6A 2JEBI 1ZXTA 1NBWA 2OTLA 4LF8Q 5CMDA 5KNDA 5LMUL 3S9WA 1Q46A 2IHFA 1CKNA 1W3SA 1SLJA 1E24A 5M3MG 5T1IA 2R7ZB 1Y1WG 3GD7A 2JSOA 1A3UA 4LF5L 1SMYD 5KRUA 5T1GA 5ELBA 4A3BB 2RF4A 1PFSA 2OF1A 4V0BA 1A3TA 3QR8A 4BBRB 1HR0L 3HKZB 1X3FA 1PTOD 4KN4C 4LUVA 5I6YA 2WFWA 2AQ2B 2BDOA 1IBLL 4HIMA 1YJNA 3C2PA 2PI2A 5EPJA 3T1YL 3O13A 2DUDA 1SNQA 2F0GA 4QL5A 2MNAA 4EGVA 2D0OA 1TXYA 3KUPA 2EJFC 2UUCL 2UU9Q 1K28A 1TS3A 3GTOH 1CK1A 3TS2A 4HMIA 3SK8A 4H44C 5EKIA 1A3VA 1DOKA 4HIKA 5IODA 3E3XA 5KIXA 3HP3A 2NVXB 1HHVA 4L5QA 2B63B 3GTOB 1A6XA 2ZM6Q 1L0XB 1VQOA 4EQNA 1QUQA 3OHXC 4A3LH 3NQIA 1V1PA 2KQ3A 4C56C 1OXVA 2LS01 4HMJA 3WOEA 2G9HD 4A3KH 1VQJA 4RHSA 5E4XA 4JI1Q 3PIO3 2F0MA 3NUCA 4IOCA 3RZOB 2K5QA 2XN9C 3BS1A 1I4HA 3BG3A 3BYYB 1QOHA 4TRDA 4DV7L 4IFDI 2K5WA 3S1NB 1YEZA 1HZAA 4I7ZC 1LO5D 4LFAQ 3AB9A 1KC8C 2K75A 2MUYA 5E7NA 1EY7A 1B1ZA 1RKNA 2FMMA 3NXWA 3FKIH 4LUOA 1MSGA 1EIYB 2BH8A 1KLGD 1SBBB 3CKIB 2N55A 1VQCA 1RODA 2A68C 1A62A 2XNAC 3W1BA 5GQOA 1QVFA 3S2DH 1S5BD 4IUVA 3OW2A 4JBMA 5FLMG 3QOLA 2NZ1D 4HEDA 1Q82C 5EPLA 4DR7L 3CHBD 4JI4Q 1T5EA 5C4ZA 3QIAA 1PH3A 1PTOC 4DK0A 4DR3Q 3T51B 1VQMA 1V1QA 1PHJA 1STNA 1X56A 2PMZE 1EY6A 1LT5D 2BE5C 1Y8PB 2L11A 2K33A 4A3JG 3J81E 4MTNA 2LXJA 1VQ8A 3J7YW 4DV3Q 3M9BA
chains in the Genus database with same CATH topology
2F0OA 4IUNA 5F2DA 2KCCA 5G3LD 2J7ZA 1HCZA 1GHJA 2ZT9C 3P20A 4KTAA 2R3ZA 3ZYYX 2K1BA 2F3VA 3I3CA 2RA4A 3VR6A 4KHZA 1DOLA 1WTXA 4HTHA 1SNPA 3DEPA 3KLRA 4K2KA 2B2WC 4IQZA 5ELCA 4KKTA 4CJ1B 2NTTA 3EVQA 2BOSA 1PYWD 1ESRA 1SAPA 2JA6B 2K05A 2Z1CA 4C3HB 4F8MA 1IHZA 1WVLA 4R9WA 3PUVA 1I50B 5IGEA 4A3FB 4A3JB 1D5XC 1YNJC 3LX0A 4X3KA 2WP8J 3NPPA 4KKSA 1O7ZA 4A3KB 3HOUB 2BA0A 2Z4IA 1PTOH 1KNEA 1U4MA 1BNZA 1FNVA 1FYCA 1KAAA 1TR5A 2O5IC 3A8JE 1E2VA 3PV0A 2AWOA 3M4OB 3D31A 4C3JB 5EBDA 3MFGA 2E2IB 2E2JB 3S15B 3K7AB 3K58A 1C8CA 2E75C 2DY8A 3J81L 2WKDA 4CHTB 5CBEE 5JPMC 3D6CA 1A15A 1QJOA 2RKSA 1HTLD 2JYOA 4DFAA 4KJNA 2K03A 3HS0C 2M2LA 2RBMA 1IYVA 4LMQD 2EYHA 3RZDB 1V43A 5CYUA 1XX8A 3R3OA 1B53A 2EY6A 5HGTA 4KK7A 1RDPD 3K57A 1WD0A 3HOWB 1JWUD 5DNFA 3S16B 4LK1C 2X6LA 5I4DA 1I3QB 1BF4A 3GTMB 2NN6G 2GA4B 4BA2I 4IUQA 1G2TA 1IW7C 3T56B 3FKIB 5A2QE 1O78A 4C3HG 3TP5A 3NQTA 3S1QB 3K59A 2IW3A 4E6IA 2AUKA 4HSVA 4AYBB 3UI2A 1ZKOA 3K6OA 5EKKA 2IT1A 3Q0AA 3TZDA 2SNSA 2F0VA 1WTVA 5ELEA 1HFNA 4PMCA 2DY7A 1O7LA 1IW7D 4FP5D 2KJXA 3NTHA 4N9TA 2A6HD 4I65A 1PRTB 4FF4A 3I73A 5JVH3 4TKOB 5C4XB 2Y0SB 1SNMA 1G8ZD 1LTSD 2VB3X 1TU2B 4OIJA 5FO7B 3J80L 2YU9B 3M85A 3NHHA 5IGDA 1E2ZA 1WTWA 4KI0A 2FINB 1VMCA 3TMEA 4K2LA 4RCOA 1WTQA 1F2MA 1BUVT 3QJYA 3FVQA 1EY0A 5C0XH 4WORA 5A2QL 4G7OC 3W3AA 4HSPA 3JAML 1GUTA 3S2HB 1I4RA 4KV6A 1F9SA 3A55A 5A35A 4G4KA 3MXGA 1EY5A 1I6VC 4K5WA 3BDOA 2SEBD 3HGBA 4KN7C 1B9NA 3V05A 4X3SA 1VMPA 1E2WA 2XWBB 3SVMA 1SMYC 1PZID 2VXWA 1H9JA 1TY0A 2A6ED 2NVYB 3EA6A 5FO9B 5M3MB 1X3PA 1GUSA 3OSOA 5JVG3 1S4ZA 5CV5A 5C4JB 1EZ8A 5I2XA 2K28A 1TY2A 3V96A 4C3IG 1Q3LA 2JA8B 2F0KA 1CTMA 5M9OA 5IT9E 1PLFA 2RDFA 1F77A 4XT3B 1TS2A 4KD3A 1RCVD 4UDUC 4Q5VA 4XTCS 1JORA 1X32A 3BVZA 4QMGA 1B9MA 3SDZA 2ICIA 3RMHA 5C5LA 1F2LA 2B39A 1ET9A 1STHA 2ZXRA 2SOBA 1MBYA 1DONA 3ITPA 4XQJA 5I6WA 1OXXK 5EJWA 2L1BA 4OO1G 2L55A 3GTGB 4MIUA 4HR7B 1SYBA 2CW0D 3GV6A 3VYSA 2A6HC 3IFDA 5J39A 4G57A 2RSOA 2F0SA 3HEJA 3QO2A 3T53B 3KF8A 3HRZC 1VF7A 1Z7TA 2D62A 3K5MA 4V190 2F0LA 3WDNA 1HTPA 2QKIC 1FNUA 2ZXPA 4HCSA 2NYZD 1ZYRC 1TWGB 2C5CA 1ILQA 3NE5B 1TWHB 1CHQD 4FF2A 1DD2A 1C48A 1RD9D 1SXTA 1UAPA 3DMUA 1KLUD 2O5JC 4O42A 4K14A 3IAYA 2DNEA 2F0NA 1SDFA 3OMGA 3PO2B 2K32A 2KA7A 4G7HC 2X6GA 3OWEB 1HA5A 1W6JA 2F0UA 1ENFA 1Y1WB 3R8BA 1L0YB 5C5MA 3GTJB 1CM9A 1BDOA 2MP1A 1STAA 2B2TC 1Q90A 1EYDA 4TQUS 5KNBA 4H13C 1II3A 4QCLA 5CR3A 3BDCA 3I70A 1TWFB 3A54A 4M8AA 3E6ZX 4FXGC 5FKAC 1I4GA 1SE4A 5K36H 1JOKA 4IFDJ 1ML0D 2XSCA 3M3YB 3MC0B 3RLFA 2AQ3B 1ENAA 2EYMA 2VB2X 4XQNA 1DZ1A 5JEAH 1AN8A 5CV7A 5IIFA 3C1FA 4RH6A 3DUZA 1BOSA 1Z6HA 3L7ZC 3HOVB 1C4QA 1SYCA 3CQZB 2IWHA 4B9XA 2JXMB 1EOTA 1QNKA 1EYCA 2E2DC 1LLRD 1I4QA 1Y1VB 2QILA 3TN2A 3MVVA 4PMWA 3CU7A 3S1MB 1ICWA 3PMFA 4QB4A 4IUTA 4RGTA 2QF7A 1H9SA 1PRTC 1LTBD 3DEOA 1FR3A 1JOQA 2LMCB 4C3IB 1Q8IA 2NN6I 1YNJD 3F2UA 1ZEQX 4FF1A 4FF3A 1ZYRD 4ZKBB 3GV3A 5LL6X 4EQPA 1EQTA 3X3MA 5HURA 5LHY1 3C1EA 1G91A 4ZUIA 2C9OA 1IKMA 3A7AB 3OW7A 2HDLA 2EYPA 2F0JA 3OIQA 3D8GA 1CT1D 5C44B 1NCVA 2KHSA 2CVRA 4R8NA 4TSSA 1OXTA 2OEOA 4DN4M 3MHBA 4OGQC 4CBVA 4Z9CB 3D3RA 3OIPA 4RA8A 4MHEA 5CC4A 2EOTA 1PDQA 2DNCA 1KDAA 3A8IE 1Z47A 5D14A 5E1FA 5E3FA 4O1NA 4K8JA 3BVMA 1TVXA 1NR2A 3NTKA 5IGBA 1K8OA 1O80A 1SYGA 2L5TA 2PYKA 1F9RA 2IX1A 4GZYC 2PW7A 2F0WA 2L0CA 2HDMA 4DNRB 3HZXA 4UAIA 1EU4A 4IURA 2JA7B 2B2TA 2A73B 1PZJD 1JE4A 1U4RA 1JQYD 2M9VA 4HCEA 2NWGA 2IPKD 1FD7D 5KYIA 1NAPA 2PCFB 1DJRD 5ELDA 2JA5B 3SXHA 1HA6A 1WTOA 2F0QA 4IFDH 1XTCD 3EQLC 2VUMB 2PZWA 2PO4A 3PO3B 4DAVA 1D5MC 4BWGB 2ID0A 4RGMA 3R93A 2Q8TA 4KHVA 4DAPA 2AWNA 4QF4A 1W6KA 3D4WA 2G9DA 4F87A 4N9PA 1HQRD 5EBCA 1D5ZC 1BBXC 2PPBC 3MEHA 2EJGC 2H4OA 2IX3A 5JEAJ 2PZTA 1KTKA 1TS5A 3S17B 1HUMA 2NTSA 4F88A 3DWAA 3BDLA 3VYTA 1IKLA 4WJWA 1AZPA 1SYEA 2Q8IB 4ME5A 3MWYW 2J0TD 4L63B 4L8JA 3K5LA 4DXFA 3SR1A 2OXPA 2CW0C 1CHPD 4EQOA 3EROA 2B8GA 4NW2A 3I8ZA 3GTKB 5I2YA 3NK9A 2N88A 3PUYA 3K0YA 1STBA 1K8MA 1OXSC 2IJ0A 4ZRZA 5LL6S 1JCKB 1HXYD 4RGOS 1HFGA 1V1PB 5BN3A 2EYJA 3R2TA 1VCIA 2EYFA 3OWFA 2E74C 2XRSD 2F0PA 2L4NA 1Y8OB 3VYRA 2EYLA 5BN5A 3ND8A 1S5DD 3N6RA 3ERQA 4DF7A 1AFPA 1MGSA 1IYUA 3J7AF 3X3NA 3OOCA 1SYFA 5IOCA 2NUCA 1CZGA 4Y7NB 5I9OA 3BZDB 3AMUA 1V8QA 1UEAB 1EYAA 2H1EA 3DXJC 3GTQB 3HOYB 4ULLA 1H9MA 1EY9A 3KBGA 5CGKA 1HQMC 1SJHD 3QWNA 2KECA 3NWSA 3MXNA 3LNNA 1UNSA 2AUJD 5FK9C 4H7BA 1SNOA 1TWAB 1MI2A 5C0XI 5D65A 3IFTA 1BR9A 2SNMA 4QUFA 3DWPA 2EY5A 1BQQT 4IN3A 1WCMB 4A3MB 1OO9B 3I4LA 5EPKA 2EE1A 1UUPA 3LWUA 3I4MB 2FJ2A 3C3LA 1V1OA 4BA1I 4JBWA 5E4WC 2EY1A 2D9UA 4PMBA 1OXUA 4C1NI 3R2IA 3D6WA 4PV1C 3VR4A 3SHLA 2ENBA 3HG9A 4OL7A 5EGTA 3MXUA 1EEID 2LFNA 4RFBA 5JJZA 4X3TA 4KY6A 1XWEA 1MD2D 1CA6A 4LAAA 4FXKC 4B9WA 1QWYA 4RWSC 1JR0D 1Q12A 3S2DB 3FPUB 2KCNA 5CV9A 1WTPA 5C3WA 2Q8RE 1PRTF 1IL8A 4X3UA 1U4LA 3G7LA 4ZUJA 4HAEA 1CQFA 3HOXB 2B2WA 1G6ZA 4NP5A 3S14B 1LTGD 2JE6I 3P7JA 5D3IB 1SFOB 3OMCA 3NBIA 4XIGS 3P1HA 5M5XB 3CRLC 3FEWX 2MHVA 4KD4A 4WFN3 5G3LF 1PFNA 3ONAB 1ESFA 3RUZA 4WRDA 3BYTB 5AFWA 1E0BA 4CKEA 4KY5A 1BXTA 1LTID 2XVSA 3C46A 2BDNA 2RSNA 2I07B 3Q6SA 3H3VC 3FPPA 1CFMA 1QB5D 2FFKB 1VDZA 1AZQA 2PZUA 4XXEA 1PRTD 1HPCA 1B44D 4A3EB 1S5FD 2A68D 5ELFA 2K7VA 2F4IA 1GUNA 2NBFA 3NSWA 4H0LC 3D4RA 4ZAIA 3GP7A 4QIWB 1PFBA 2K5DA 1JWMD 4ZYSA 2XWJB 4OIKA 4XYOA 5BN4A 3A7LA 1Q1BA 3J7AV 2F0HA 1PXUA 1U9RA 1JC7A 4ZQ3A 2E2HB 1B4OA 3EJIA 1PZKD 3VA7A 1NUCA 4A93B 1GHKA 4RGNA 1M4VA 1WD1A 3SK6A 4U673 3MA2B 3FMCA 4PQXA 1SNCA 4ODGA 2WAQB 4MN3A 4CJ0B 5M5YB 1I4XA 1CA5A 1FGBD 2PW5A 2KVMA 3M7NA 3WOFA 3E0JA 1YNND 1XYIA 2K6AA 2QCPX 2KUMA 3MFYA 4J6HA 1J9OA 4XQQA 1PFMA 1EY4A 1F2YA 1R4PB 2Z4HA 1QE6A 2RQXA 1TS4A 2L9HA 1XXGA 1EY8A 3BVGA 1PTOF 1Q1EA 4Q0FA 3A56A 3VR5A 1GJXA 4BBSB 2FHTA 1RTNA 1GUWA 5KYLA 4K5XA 3MXPA 3OPOA 4RHRA 4C3JG 2JEAI 2KEEA 1CZWA 3N52A 3QG1A 1F2ZA 1KDCA 5M5WB 2WB1B 1JOOA 1CQVA 3SEBA 2X69A 1I4PA 3K5NA 1R4QB 3L3OC 1BCPB 4JK1C 4IUUA 3H91A 1SYDA 4DK1A 2FMCA 2QEJC 1B50A 1EEFD 1PMRA 1G2SA 2MPMA 4NKLA 3NTIA 5COYA 1LTTD 1BO0A 2XRQD 4FVMA 1J8IA 4OO1H 4CGYB 3VA5A 1NSNS 4KMUC 3H94A 1EIHA 2Z8LA 3K5OA 4J1MA 3TZUA 1WTRA 1ET6A 4ZKCB 3VR3A 2NB0A 3D4DA 4XT1B 3KLSA 3U9SA 2IL8A 1LTRD 1EZ6A 5KGUA 1Y8NB 1RHPA 2F0EA 2B8FA 4K6DA 2ZXOA 1BCPC 3AU7A 4FO2A 4CJ2C 3TP7A 4HN7A 1STYA 4U68A 4F7XA 1EWHA 4OO1I 3QOJA 2EXZA 1G291 3KLSX 1D1IA 4IFDG 1S5ED 1A2UA 3J80E 4XYQA 3VR2A 1AP0A 4A3IB 1LT4D 2R93B 1CI3M 2WIIB 3Q22A 3IL8A 2RVLA 5KEEA 4DU9A 1D6EC 2EZVA 2R92B 2HQEA 5IGCA 5KNCA 5CBAE 2L12A 1RTOA 5JAVA 4IUPA 1STGA 1SEBD 4IALA 2EPBA 4M1UB 4EVOA 3PIP3 1HUNA 3M4YA 3TP6A 1DOMA 1F9PA 1SSOA 3H6MA 5M3FB 5CV8A 5J1ZA 5K36G 4G7ZC 5JOBA 1ENCA 1DYQA 2B2YA 1EIGA 2V4DA 2A69D 3T4AC 3QB3A 1QILA 1D2BA 2WINB 4RCNA 3JAME 2K01A 5DM63 2F0FA 3SE0A 2MGSA 5CV6A 1DCZA 3I90A 3I91A 5NUCA 5FLXE 2R6GA 4FNFA 4DGZA 3DWQA 2F3WA 3H0GB 2HCIA 3PUXA 2O4XA 3KK7A 3NWTA 2A5HA 2D2CC 4KKUA 4ABNA 2EVBA 2F03A 4RAUC 5I9PA 5EKLA 4K6LA 1SE3A 5IT9L 1U4PA 5EQ0A 1MSHA 1H9RA 1B2TA 2B2UA 2R61A 4ZK9B 1LT6D 4A3DB 2EY2A 5C3XA 2AQ1B 1K83B 3SK5A 2WACA 4DXGA 3PUWA 3VYUA 1RJTA 1H9KA 1B3AA 2NVQB 3CRKC 4YIJA 1BCPD 5CV4A 1PTOB 3TSSA 2CQAA 1SNDA 1LT3D 2YYZA 1SE2A 2J4XA 2DN8A 1VF5C 2TSSA 3E5SA 5K5PA 4DAYA 2B2UC 3MAQA 4R8IA 1D1KA 1TT2A 3LWEA 5C4HA 2OT2A 5ISRA 5IGGA 2M00A 4KJOA 2K04A 2PMZB 1KABA 1DM0B 2ICEC 2XIWA 4ILWA 3URYA 4K5VA 2BA1A 2F0DA 1Y69U 1LACA 2A74C 4NDXA 3MZ5A 1BCPF 2PQEA 2KOLA 1QCBD 3P75A 4ZLTF 2D5DA 1T5XD 2O2LD 1F9QA 1O7YA 2RDGA 1LTAD 3T16A 1TKWB 2TMPA 4L6TB 3H09A 4ID6A 1GOZA 2F1MA 4LJZC 4FYDA 4DNTB 5FLXL 3FDTA 1AEXA 4S3SA 1DXMA 3U9OA 2VNUD 4CKCA 1JB3A 3M7GA 3TP8A 5C0XJ 1FNWA 1RF2D 4C1NK 5DEHA 4NMZA 4C2MB 3TDQA 2BE5D 1JWSD 2LY7A 1LV9A 1H9SB 4B08A 1A2TA 4RKLA 2CHBD 1I6HB 1NR4A 5DM73 1JICA 3TBIB 4FXDA 2NVTB 4P2CB 3EFXD 2RDHA 3W2DA 1LABA 1QG7A 2KEDA 2EDGA 2B2VC 5C6AA 4RKBA 1SJED 4OHJA 2WV6D 2NN6H 1S5CD 3IKJA 3GQBA 5C3EB 3KBXA 3Q24A 3GTPB 2SDFA 3ND9A 2E76C 1X3QA 3GO5A 2PNRC 3V2TA 1GUGA 3MTSA 1ILPA 3DM1A 3GTLB 2LKVA 1EL0A 1YNNC 3RD4A 3I4NB 5JEAG 5FO8B 3HOZB 2B2VA 4K8IA 4BY1B 1KDBA 1AW7A 2WKCA 5D3DA 1KNAA 2B2YC 4A3GB 3DHQA 4DA2A 1HRJA 3FRPB 4KY7A 1EU3A 4CKBA 3I72A 1STEA 4BY7B 2A69C 3NP8A 3NBHA 1GXDC 1GUOA 2BCOA 2A6EC 5FOBB 2JP1A 5J22A 2QDBA 5CORA 3G6JB 4BS9A 1ONLA 3Q23A 1M8AA 2MJ8A 5DAUA 5JPNC 4IZ8A 1TWCB 2EJMA 1EFID 4J8QA 1TQOA 1TIID 3PUZA 4PNYA 3A8KE 1EWCA 2EYOA 2F0TA 3S1RB 3L9AX 2HUGA 5C0XG 2I46A 3T13A 2F0IA 2HCCA 1EQVA 4XDXA 2IX0A 1R9TB 5IGFA 1QNUA 3SK4A 4QUCA 5TSSA 2JEBI 1ZXTA 5CMDA 5KNDA 3S9WA 5T1IA 2R7ZB 3GD7A 2JSOA 1A3UA 1SMYD 5KRUA 5T1GA 5ELBA 4A3BB 2OF1A 4V0BA 1A3TA 4BBRB 3HKZB 1PTOD 4KN4C 5I6YA 2AQ2B 2BDOA 3C2PA 5EPJA 3O13A 1SNQA 2F0GA 4EGVA 3KUPA 2EJFC 1TS3A 1CK1A 4HMIA 3SK8A 4H44C 5EKIA 1A3VA 1DOKA 5IODA 5KIXA 3HP3A 2NVXB 1HHVA 2B63B 3GTOB 1A6XA 1L0XB 4EQNA 3OHXC 3NQIA 1V1PA 2KQ3A 4C56C 1OXVA 2LS01 4HMJA 3WOEA 2G9HD 4RHSA 5E4XA 3PIO3 2F0MA 3NUCA 3RZOB 2K5QA 2XN9C 3BS1A 1I4HA 3BG3A 3BYYB 1QOHA 4TRDA 4IFDI 2K5WA 3S1NB 4I7ZC 1LO5D 3AB9A 2MUYA 1EY7A 1B1ZA 1RKNA 2FMMA 3NXWA 1MSGA 1KLGD 1SBBB 3CKIB 2N55A 1RODA 2A68C 2XNAC 1S5BD 4IUVA 3QOLA 2NZ1D 4HEDA 5EPLA 3CHBD 1T5EA 5C4ZA 3QIAA 1PTOC 4DK0A 3T51B 1STNA 1EY6A 1LT5D 2BE5C 1Y8PB 2L11A 2K33A 3J81E 3J7YW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNE A;  4IFD G;  3LWU A;  1K8O A;  1DXM A;  1Q1E A;  2BDO A;  3VR2 A;  2B8G A;  3VR5 A;  1GJX A;  1CTM A;  2E75 C;  2KCC A;  2L5T A;  2K32 A;  4GZY C;  4BA1 I;  2KA7 A;  4G7H C;  1HCZ A;  3I72 A;  2A6H D;  3PUY A;  4JBW A;  1K8M A;  1GHJ A;  2ZT9 C;  1OXS C;  2EJF C;  1CI3 M;  1OXU A;  3FPP A;  1QJO A;  3P20 A;  1CFM A;  3OPO A;  4DNR B;  4PV1 C;  2QF7 A;  2JEA I;  4XTC S;  3I73 A;  1VDZ A;  3VR4 A;  1H9S A;  5BN3 A;  4H44 C;  1BDO A;  4TKO B;  2BE5 D;  1FR3 A;  1HPC A;  1VCI A;  3QG1 A;  2LMC B;  5KNC A;  1B9M A;  2E74 C;  3SDZ A;  3VR6 A;  2A69 C;  3PUW A;  4KHZ A;  1TU2 B;  2NN6 I;  1Y8O B;  1H9K A;  2A6E C;  1GUO A;  1Q90 A;  3MXU A;  2A68 D;  3M85 A;  1IYV A;  3CRK C;  5BN5 A;  2K7V A;  3M4Y A;  1GUN A;  3ND8 A;  4TQU S;  5KNB A;  1H9S B;  3N6R A;  2PCF B;  1A6X A;  3KLR A;  4JK1 C;  4H13 C;  4H0L C;  1E2Z A;  3D4R A;  4KI0 A;  1IYU A;  2YYZ A;  1ONL A;  1OXV A;  1V43 A;  2DN8 A;  1VF5 C;  4DK1 A;  4IFD H;  3OOC A;  4IQZ A;  1OXX K;  5K36 G;  4KKT A;  4G7Z C;  1PMR A;  3EQL C;  2EJM A;  3QJY A;  3A7A B;  1Q12 A;  1LAB A;  3PUZ A;  5BN4 A;  4OO1 G;  3A7L A;  3A8K E;  2V4D A;  1Q1B A;  5C0X H;  3OW7 A;  1V8Q A;  5K36 H;  2A69 D;  4G7O C;  4HR7 B;  3W3A A;  2EDG A;  2A6H C;  1GUT A;  3BG3 A;  4OO1 H;  1IW7 D;  4RCN A;  3DXJ C;  3H94 A;  4KMU C;  2NN6 H;  3IKJ A;  4I7Z C;  3VA7 A;  3PUV A;  3GQB A;  3T53 B;  5A35 A;  3AB9 A;  2BA1 A;  1H9M A;  3RLF A;  4LK1 C;  1OXT A;  3SE0 A;  3TZU A;  1Y69 U;  1LAC A;  5C0X G;  1GHK A;  1YNJ C;  1I6V C;  3ND9 A;  4OGQ C;  1DCZ A;  3VR3 A;  2E76 C;  1VF7 A;  2PPB C;  1HQM C;  1Z7T A;  2R6G A;  2PNR C;  3BDO A;  5JEA H;  2D62 A;  2NN6 G;  3U9S A;  2EJG C;  4KKS A;  1GUG A;  4BA2 I;  2JE6 I;  3HGB A;  3PUX A;  3FMC A;  1IW7 C;  4KN7 C;  2A68 C;  3T56 B;  1Y8N B;  1B9N A;  3LNN A;  2D5D A;  1YNN C;  2D2C C;  3WDN A;  4KKU A;  1E2W A;  1O78 A;  1HTP A;  2AUJ D;  2BA0 A;  2EVB A;  2JEB I;  5JEA G;  1Z6H A;  3L7Z C;  2B8F A;  1SMY C;  5KND A;  2AUK A;  4XIG S;  1T5E A;  3M7N A;  1ZYR C;  3IFT A;  2DNC A;  2JXM B;  1FYC A;  3A8I E;  3CRL C;  3QIA A;  1H9J A;  1ZKO A;  2O5I C;  2IT1 A;  2A6E D;  3GD7 A;  3MFY A;  3NE5 B;  1TKW B;  3T51 B;  4DK0 A;  1DD2 A;  3A8J E;  2Q8I B;  1E2V A;  1H9R A;  2BE5 C;  3PV0 A;  1Y8P B;  1GUS A;  2F1M A;  2AWO A;  4LJZ C;  4DNT B;  2K33 A;  1EWH A;  4L8J A;  3D31 A;  3I4L A;  1G29 1;  2O5J C;  2CW0 C;  4KN4 C;  1O7L A; 
#chains in the Genus database with same CATH topology
 3KYH C;  1PH4 A;  2F0O A;  4IUN A;  5F2D A;  3CCV A;  2KCC A;  5G3L D;  4DV0 Q;  2R92 H;  2J7Z A;  2LXK A;  1HCZ A;  2N49 A;  1GHJ A;  2ZT9 C;  2HHH L;  4IPG A;  3HOU G;  3P20 A;  4JI8 L;  4KTA A;  2R3Z A;  3ZYY X;  4JPB W;  3RN2 A;  2K1B A;  2F3V A;  4DUZ L;  3I3C A;  2RA4 A;  1VQ6 A;  3VR6 A;  4KHZ A;  1D7Q A;  1DOL A;  1WTX A;  4HTH A;  2RHQ B;  1UE6 A;  4GLA C;  4A3F G;  2UUA L;  5IT9 c;  1SNP A;  3DEP A;  2F4V L;  3KLR A;  5GAE C;  4K2K A;  3EBE A;  4UP8 A;  2B2W C;  2CH4 A;  1NNX A;  4IQZ A;  5ELC A;  4KKT A;  4CJ1 B;  3HOV H;  1TWA H;  2NTT A;  5DLQ E;  1NE3 A;  3EVQ A;  2BOS A;  1PYW D;  4LNQ A;  4C3J H;  4R4O A;  1ESR A;  1SAP A;  4ZCK A;  1HNZ Q;  4OWW B;  4DAY B;  2UXC Q;  4GOP B;  2JA6 B;  1MIU A;  1D8L A;  2K05 A;  2Z1C A;  4C3H B;  4F8M A;  3CF5 A;  1IHZ A;  1WVL A;  1PH1 A;  4R9W A;  3PUV A;  1I50 B;  5BR8 L;  3K81 C;  5IGE A;  2E2H H;  4A3F B;  4A3J B;  1D5X C;  2MFI A;  1YNJ C;  3LX0 A;  4AQY Q;  4X3K A;  5C3E G;  5M3F G;  1L2F A;  2WP8 J;  3NPP A;  3AQQ A;  4KKS A;  3PCO B;  2RCN A;  5GRO A;  5LMN W;  4YCW A;  1O7Z A;  5GAH C;  3BJU A;  1X6O A;  4A3K B;  3HOU B;  1SRO A;  2BA0 A;  5C44 H;  2Z4I A;  1PTO H;  1KNE A;  3WWV A;  4YY3 Q;  4A3M G;  1U4M A;  1BNZ A;  1FNV A;  1FYC A;  1KAA A;  2R7F A;  1TR5 A;  4YHH Q;  2O5I C;  1IBM L;  3A8J E;  1E2V A;  3PV0 A;  2AWO A;  4MTK A;  4UP9 A;  4B3R L;  4LF6 L;  3M4O B;  3D31 A;  4GNX A;  4C3J B;  1S72 A;  5EBD A;  1P16 A;  3MFG A;  5FJ8 H;  3U58 A;  2E2I B;  2E2J B;  1W2B A;  3S15 B;  2VL6 A;  3K7A B;  5M3M H;  3K58 A;  1C8C A;  3GTJ H;  2E75 C;  2DY8 A;  3J81 L;  2WKD A;  4CHT B;  5CBE E;  1I6H H;  5JPM C;  5AJ3 L;  3D6C A;  1A15 A;  1QJO A;  4YHH L;  2RKS A;  1LTL A;  1HTL D;  2JYO A;  4DFA A;  4KJN A;  2K03 A;  3HS0 C;  2M2L A;  2OCE A;  4CDF C;  2RBM A;  1IYV A;  4LMQ D;  2Y0S E;  2EYH A;  1YI2 A;  1A8V A;  5IWA Q;  3RZD B;  1V43 A;  5CYU A;  1XX8 A;  4IO9 A;  3R3O A;  1B53 A;  3CP0 A;  1O7I A;  2EY6 A;  2UUB Q;  4B3R Q;  2XTI A;  5HGT A;  2HQL A;  1SR3 A;  1YVC A;  4QY7 A;  3HKZ E;  2QEX A;  3PIO A;  4KK7 A;  1RDP D;  3K57 A;  1WD0 A;  3HOW B;  3L0O A;  1JWU D;  5DNF A;  4LFC Q;  3S16 B;  4LK1 C;  2X6L A;  4RMF A;  5I4D A;  1I3Q B;  2OQ0 A;  2KCT A;  1BF4 A;  2VQF L;  3GTM B;  3I2Z A;  2NN6 G;  2GA4 B;  4BA2 I;  2Q2U A;  1QVC A;  4IUQ A;  1VS0 A;  1IW7 C;  3T56 B;  5M3F H;  2Z6B A;  1G2T A;  3H3V H;  3PO3 H;  2E5L Q;  4L5R C;  3FKI B;  5A2Q E;  1O78 A;  1FJG L;  4C3H G;  3TP5 A;  3NQT A;  3S1Q B;  3K59 A;  2IW3 A;  4E6I A;  2AUK A;  4NXN Q;  4HSV A;  4AYB B;  3UI2 A;  1ZKO A;  3K6O A;  5EKK A;  4R4I A;  2IT1 A;  5IYC G;  3Q0A A;  3TZD A;  2SNS A;  2F0V A;  2JJQ A;  1WTV A;  5ELE A;  1HFN A;  4A3C H;  3TQY A;  4PMC A;  2HIX A;  2DY7 A;  4LF4 Q;  1O7L A;  1IW7 D;  3KF8 B;  4FP5 D;  1SN8 A;  2KJX A;  3NTH A;  1MHW C;  3ZJY C;  3HOV G;  4N9T A;  2A6H D;  4I65 A;  1PRT B;  1NY4 A;  4FF4 A;  4YWL A;  4ALP A;  2B63 H;  1CSQ A;  3I73 A;  4O0A A;  5JVH 3;  4TKO B;  4N8X 1;  5C4X B;  2Y0S B;  1SNM A;  1UE7 A;  2N8N A;  1JE5 A;  1G8Z D;  1LTS D;  2VB3 X;  5IP9 H;  2B29 A;  1TU2 B;  4OIJ A;  5FO7 B;  3J80 L;  3D0F A;  3M85 A;  2YU9 B;  4BXX H;  3NHH A;  5IGD A;  3KF6 A;  4B3S Q;  4YCU A;  4J15 A;  1E2Z A;  1WTW A;  4APV A;  4KI0 A;  1E22 A;  2E2I H;  2E2J H;  2FIN B;  1VMC A;  3TME A;  4JI5 L;  4K2L A;  4RCO A;  1X3E A;  1WTQ A;  1F2M A;  1BUV T;  3QJY A;  4UP7 A;  2N78 A;  3FVQ A;  1EY0 A;  4BBR H;  5C0X H;  4WOR A;  5A2Q L;  4G7O C;  3W3A A;  4HSP A;  3JAM L;  1GUT A;  3S2H B;  2C35 B;  4YY3 L;  1I4R A;  4KV6 A;  1F9S A;  2B3G A;  3RZD H;  3A55 A;  5A35 A;  4G4K A;  3MXG A;  2R7Z G;  1EY5 A;  1VQ4 A;  2K52 A;  1I6V C;  3HOY G;  2K14 A;  3TRZ A;  1VQG A;  4K5W A;  3BDO A;  4NXM Q;  2SEB D;  3HGB A;  4KN7 C;  2K50 A;  5GAG C;  2D0P A;  1B9N A;  3V05 A;  2NVQ H;  4X3S A;  2CCZ A;  1VMP A;  1E2W A;  2XWB B;  3SVM A;  1SMY C;  4PZ7 A;  3TRE A;  1PZI D;  3S1R H;  2VXW A;  2UU9 L;  1H9J A;  1TY0 A;  2A6E D;  2NVY B;  3EA6 A;  5FO9 B;  2ASB A;  5M3M B;  1IXR A;  1X3P A;  1GUS A;  3OSO A;  5JVG 3;  1VQI A;  1S4Z A;  5CV5 A;  5C4J B;  1E1O A;  1EZ8 A;  5I2X A;  1XPO A;  2K28 A;  3MEF A;  1TY2 A;  3V96 A;  4C2M H;  4A3D H;  4C3I G;  1Q3L A;  2JA8 B;  2F0K A;  1TWH H;  1CTM A;  5M9O A;  3GDE A;  5IT9 E;  3H0G G;  1PLF A;  2RDF A;  4IPD A;  1F77 A;  4CDC C;  4XT3 B;  1TS2 A;  4A3B H;  4KD3 A;  1RCV D;  4GKK L;  4UDU C;  1HNX L;  4DR2 L;  4Q5V A;  4XTC S;  1JOR A;  1X32 A;  4DR6 L;  4GOP C;  3UE1 A;  1X54 A;  3BVZ A;  4QMG A;  1B9M A;  3SDZ A;  2ICI A;  3RMH A;  3TS0 A;  5C5L A;  4CDE C;  1F2L A;  3BZC A;  2B39 A;  1WCM H;  1EQR A;  1ET9 A;  1STH A;  2ZXR A;  2SOB A;  4MZ9 A;  2JK8 A;  1MBY A;  1DON A;  3ITP A;  5IP7 H;  5I6W A;  4XQJ A;  5AJ3 Q;  1OXX K;  2PQA A;  3S1Q H;  1VQA A;  3F2B A;  3CCS A;  2AMC B;  5EJW A;  2L1B A;  2OWO A;  3AFQ A;  4OO1 G;  2L55 A;  2ES2 A;  3GTG B;  4MIU A;  4HR7 B;  1SYB A;  2CW0 D;  3GV6 A;  3VYS A;  2A6H C;  3IFD A;  5J39 A;  4G57 A;  2RSO A;  1I3Q H;  1C0A A;  2F0S A;  3HEJ A;  3QO2 A;  3T53 B;  2A19 A;  1CKN B;  3KF8 A;  3HRZ C;  4H02 A;  1VF7 A;  4TVA B;  1N36 Q;  2VUM H;  1Z7T A;  2D62 A;  3K5M A;  4V19 0;  2F0L A;  2YTY A;  3WDN A;  1AH9 A;  5JJL A;  4JI0 Q;  1HTP A;  2CH4 W;  2QKI C;  1FNU A;  2ZXP A;  4HCS A;  4DV6 Q;  4DR5 L;  4BXX G;  2NYZ D;  1HH2 P;  5GAD C;  1ZYR C;  1TWG B;  2UUC Q;  1TWF H;  2C5C A;  2ZTD A;  1K0S A;  4A3E H;  1ILQ A;  3NE5 B;  1TWH B;  1CHQ D;  4FF2 A;  1DD2 A;  2YTX A;  1C48 A;  2PNH A;  2JA7 H;  1RD9 D;  1SXT A;  1UAP A;  3DMU A;  1KLU D;  3F2D A;  1QZH A;  3FHW A;  2O5J C;  1L1O C;  4O42 A;  4JI3 Q;  4K14 A;  4JI2 L;  3IAY A;  2DNE A;  2F0N A;  1SDF A;  2NVY H;  3OMG A;  2QA4 A;  3PO2 B;  5IYD H;  2K32 A;  2KA7 A;  3K80 C;  4G7H C;  2X6G A;  5IYB H;  3OWE B;  1HA5 A;  1W6J A;  2F0U A;  1ASZ A;  1ENF A;  1Y1W B;  5C4X H;  2OTJ A;  3R8B A;  1L0Y B;  5C5M A;  3GTJ B;  1CM9 A;  2A1A A;  2QW7 A;  1BDO A;  2MP1 A;  4OEL B;  4GKJ L;  3U4V A;  3PO2 H;  1WFQ A;  1STA A;  5JJI A;  2B2T C;  4P75 A;  1J5E Q;  4DV2 L;  1Q90 A;  1EYD A;  4GN4 B;  4TQU S;  5KNB A;  1U0L A;  4H13 C;  1II3 A;  3BZK A;  4QCL A;  5CR3 A;  3UE0 A;  3BDC A;  4GOP A;  3I70 A;  1TWF B;  4R4T A;  3A54 A;  1N36 L;  4M8A A;  2VZA A;  3E6Z X;  2P5Z X;  4FXG C;  3H0G H;  5FKA C;  1SE8 A;  1I4G A;  1SE4 A;  4DV3 L;  5K36 H;  3AFP A;  3HOX H;  1JOK A;  4P73 A;  1YJW A;  4JI6 Q;  3KFU A;  4IFD J;  1ML0 D;  2XSC A;  3M3Y B;  3MC0 B;  3RLF A;  2AQ3 B;  1ENA A;  1B3Q A;  1I50 H;  4A76 A;  1V9P A;  3I55 A;  2EYM A;  2VB2 X;  4XQN A;  3GTM H;  1DZ1 A;  5JEA H;  5FLM H;  1AN8 A;  4YWK A;  5CV7 A;  1N33 Q;  1WI5 A;  5IIF A;  4LFB L;  3C1F A;  2ATW A;  4RH6 A;  3DUZ A;  4QQB X;  4DV1 Q;  3EIV A;  1BOS A;  1Z6H A;  3L7Z C;  3HOV B;  1C4Q A;  1SYC A;  3CQZ B;  4A93 H;  2IWH A;  4B9X A;  2JXM B;  1EYG A;  1EOT A;  1QNK A;  4C3I H;  1EYC A;  4X62 L;  1XNR L;  2E2D C;  1LLR D;  3PQI A;  1I4Q A;  1Y1V B;  4B3M Q;  2QIL A;  3TN2 A;  3MVV A;  4PMW A;  4BBS H;  1X9N A;  1C9O A;  5IYB G;  1VQH A;  3CU7 A;  4PZ8 A;  3S1M B;  1ICW A;  3PMF A;  4QB4 A;  4IUT A;  3STB D;  4RGT A;  1C7Y A;  4JI4 L;  3CC4 A;  2QF7 A;  4GN3 B;  4A3M H;  1H9S A;  1PRT C;  1LTB D;  3DEO A;  1FR3 A;  5M5Y H;  1J5E L;  1JOQ A;  2LMC B;  2NZO A;  4C3I B;  1Q8I A;  2NN6 I;  4DUY Q;  2E5L L;  1YNJ D;  3F2U A;  1ZEQ X;  4FF1 A;  4FF3 A;  3PO2 G;  1ZYR D;  1UWV A;  3CAM A;  1K83 H;  4ZKB B;  3GV3 A;  5LL6 X;  4EQP A;  1EQT A;  3X3M A;  1YIT A;  3M4O H;  1UEB A;  5HUR A;  5H1S E;  1K9M C;  5LHY 1;  3C1E A;  4POG A;  1G91 A;  4ZUI A;  2C9O A;  1Q8K A;  1IKM A;  3A7A B;  2JA5 G;  3A74 A;  3OW7 A;  3CCJ A;  4JBK A;  3ULL A;  2HDL A;  2EYP A;  2F0J A;  1FJG Q;  1G6P A;  3OIQ A;  3J81 i;  3D8G A;  1CT1 D;  3JC6 6;  5C44 B;  2AKW B;  3I4M G;  1NCV A;  2KHS A;  2CVR A;  4R8N A;  4TSS A;  1OXT A;  4JYA Q;  2OEO A;  4DN4 M;  3MHB A;  4OGQ C;  1GO3 E;  4OXP A;  3W1G A;  2A8V A;  2Q2H A;  1GD7 A;  4CBV A;  4Z9C B;  3UDI A;  2ZTE A;  4JC0 A;  3D3R A;  3OIP A;  4RA8 A;  4AH6 A;  4MHE A;  1IBL Q;  5C3E H;  1IYJ B;  3FP9 A;  1FVI A;  5CC4 A;  4EX5 A;  2EOT A;  2PI2 E;  1PDQ A;  1BBU A;  2DNC A;  1KDA A;  3A8I E;  1Z47 A;  1N34 L;  5D14 A;  3HOX G;  2JQO A;  5E1F A;  5E3F A;  1A0I A;  5M5W H;  4FDB A;  3I7F A;  2R92 G;  2NVT H;  4GN5 A;  4IPH A;  4NPS A;  4O1N A;  4K8J A;  3BVM A;  4A75 A;  3E9I A;  1TVX A;  1NR2 A;  3K7U C;  3NTK A;  5IYC H;  4P72 A;  5IGB A;  1K8O A;  1L1O A;  4A3G H;  1O80 A;  1KXL A;  1SYG A;  2L5T A;  2PYK A;  1P8L A;  2MO1 A;  1F9R A;  2IX1 A;  4GZY C;  2PW7 A;  1L1O B;  2F0W A;  3HOZ H;  2L0C A;  2HDM A;  1EFW A;  4DNR B;  2L15 A;  4OWX B;  3HZX A;  4UAI A;  1EU4 A;  4DR4 Q;  4IUR A;  2JA7 B;  2QDL A;  2B2T A;  4DR6 Q;  2A73 B;  2CFM A;  1PZJ D;  4LF7 Q;  1K0R A;  2LSS A;  4LWC A;  2FXQ A;  1JE4 A;  4DV7 Q;  1TWG H;  4X65 L;  1U4R A;  1JQY D;  2M9V A;  4HCE A;  2NWG A;  2IPK D;  1FD7 D;  5KYI A;  4OON A;  1NAP A;  2PCF B;  1RL2 A;  1DJR D;  5ELD A;  2IHE A;  1EWI A;  2JA5 B;  3SXH A;  1HA6 A;  1WTO A;  2F0Q A;  5FJ8 G;  2JA6 G;  3CPF A;  4IFD H;  2RHS B;  3HOZ G;  4DPG A;  1XTC D;  3CQZ H;  3EQL C;  1KHI A;  1NJI C;  2VUM B;  2PZW A;  4UHV A;  2PO4 A;  3PO3 B;  4DAV A;  1D5M C;  3KJP A;  4DKA C;  5C44 G;  4EQ5 A;  4BWG B;  2ID0 A;  3Q8D A;  4RGM A;  2UXC L;  3R93 A;  2Q8T A;  3HOW G;  4KHV A;  3J80 c;  4DAP A;  3CPW A;  2AWN A;  2DJG C;  4QF4 A;  1W6K A;  3PF4 A;  4OX9 Q;  2F4V Q;  3D4W A;  3NEM A;  2G9D A;  4F87 A;  4N9P A;  2UXB Q;  1HQR D;  5EBC A;  1D5Z C;  1BBX C;  2PPB C;  3MEH A;  2K5N A;  1HZ9 A;  2EJG C;  2H4O A;  2IX3 A;  5JEA J;  2PZT A;  1XMQ L;  5L37 A;  2QGQ A;  3ERS X;  1KTK A;  1TS5 A;  3I56 A;  3S17 B;  1HUM A;  2NTS A;  4F88 A;  3DWA A;  3BDL A;  3VYT A;  2JA5 H;  1IKL A;  4WJW A;  2JA7 G;  4IJL A;  1PVO A;  1AZP A;  2RCF A;  1XNQ Q;  1SYE A;  2ZJR A;  2Q8I B;  4ME5 A;  4LF6 Q;  2UUB L;  3RN5 A;  3MWY W;  2J0T D;  1RIP A;  4L63 B;  1FL0 A;  4L8J A;  3K5L A;  1K3R A;  4DXF A;  3SR1 A;  2OXP A;  2CW0 C;  1CHP D;  4EQO A;  3ERO A;  3LGJ A;  2B8G A;  4NW2 A;  3I8Z A;  3GTK B;  5I2Y A;  3NK9 A;  2N88 A;  3PUY A;  3VDY A;  3K0Y A;  1STB A;  1K8M A;  1OXS C;  2IJ0 A;  3PO3 G;  4JOI C;  4ZRZ A;  5LL6 S;  1JCK B;  1HXY D;  3I4O A;  4RGO S;  2XGT A;  1HFG A;  1V1P B;  4JI8 Q;  5JJK A;  1LYL A;  5BN3 A;  2EYJ A;  1GM5 A;  3R2T A;  1VCI A;  3UDG A;  2EYF A;  1IZ6 A;  3OWF A;  2E74 C;  4DAM A;  1JJG A;  4X65 Q;  2XRS D;  3CMA A;  2F0P A;  2CWP A;  1Y8O B;  2L4N A;  1PYB A;  3VYR A;  4LFB Q;  2EYL A;  5BN5 A;  3CCL A;  3ND8 A;  1S5D D;  3N6R A;  1KAW A;  3ERQ A;  4DF7 A;  4DK3 C;  1AFP A;  1YIJ A;  1MGS A;  1B70 B;  3B6Y A;  1IYU A;  3X3N A;  4HJ8 A;  4BY1 H;  3J7A F;  3OOC A;  4IPC A;  1SYF A;  5IOC A;  3GTK H;  2NUC A;  1CZG A;  4Y7N B;  1IL2 A;  1AE3 A;  5I9O A;  3BZD B;  3AMU A;  3HOU H;  1V8Q A;  1N32 L;  4OEM B;  1UEA B;  1EYA A;  2VY3 A;  2H1E A;  3T1Y Q;  4NXN L;  2JA8 G;  3DXJ C;  1Q86 C;  3GTQ B;  3J80 i;  3HOY B;  4ULL A;  1H9M A;  1EY9 A;  3KBG A;  4A3J H;  5CGK A;  1HQM C;  4JYA L;  2I0Q A;  1SJH D;  3QWN A;  2KEC A;  1HR0 W;  3NWS A;  3MXN A;  2JA6 H;  3LNN A;  1UNS A;  2AUJ D;  5FK9 C;  1VQL A;  2UUA Q;  4H7B A;  1SNO A;  1TWA B;  1MI2 A;  5C0X I;  1YHA A;  5EAY A;  5D65 A;  1VQK A;  3IFT A;  1BR9 A;  1XNQ L;  1S3O A;  2SNM A;  1BKB A;  4QUF A;  3DWP A;  2EY5 A;  1BQQ T;  4IN3 A;  1WCM B;  4A3M B;  1OO9 B;  3I4L A;  5EPK A;  2EE1 A;  1VQ5 A;  4A3E G;  2KHI A;  1UUP A;  3LWU A;  3I4M B;  2GN5 A;  2Y0S G;  2FJ2 A;  3C3L A;  1V1O A;  4BA1 I;  4JBW A;  5E4W C;  2EY1 A;  2D9U A;  4PMB A;  1OXU A;  4BY7 H;  4C1N I;  4OWT B;  3RLN A;  3R2I A;  3D6W A;  4PV1 C;  3IRB A;  3VR4 A;  3SHL A;  2VQF Q;  2ENB A;  3HG9 A;  2HD3 A;  1Y1V H;  4OL7 A;  3S17 H;  3I4N G;  5EGT A;  2IY5 B;  4YCV A;  3MXU A;  4JCV E;  1EEI D;  2LFN A;  4RFB A;  5JJZ A;  4A3I G;  2K4K A;  3PGZ A;  4X3T A;  4KY6 A;  1XWE A;  2WB1 E;  1MD2 D;  1CA6 A;  4LAA A;  4FXK C;  4B9W A;  4X62 Q;  2CWA A;  1NTG A;  1QWY A;  4RWS C;  1JR0 D;  1VQ9 A;  1Q12 A;  3S2D B;  3FPU B;  4CDD C;  2KCN A;  2CKZ B;  5CV9 A;  1VQ7 A;  1WTP A;  2F52 A;  2Z9H A;  5C3W A;  2Q8R E;  3M3Y H;  4RG1 A;  1PRT F;  4X64 Q;  1IL8 A;  4X3U A;  3GTQ H;  1U4L A;  3KDF B;  3G7L A;  2VUM G;  1A63 A;  3GTL H;  4ZUJ A;  4HAE A;  1CQF A;  3HOX B;  4JV5 Q;  2B2W A;  1G6Z A;  4NP5 A;  4LW1 A;  2MO0 A;  3S14 B;  1LTG D;  1U5K A;  1JB7 A;  2Z6K A;  2JE6 I;  3GTP H;  3CCR A;  4HJ5 A;  4ME3 A;  3P7J A;  3CCE A;  4JI6 L;  5D3I B;  1SFO B;  3OMC A;  3NBI A;  4XIG S;  1S40 A;  3P1H A;  5M5X B;  3CRL C;  3FEW X;  2MHV A;  4KD4 A;  1I5F A;  1N34 Q;  3BU2 A;  2UXB L;  4WFN 3;  5G3L F;  1PFN A;  3ONA B;  2NVX H;  4DV5 L;  3JAM i;  1ESF A;  4PG3 A;  1Y1W H;  3RUZ A;  4GNX C;  4WRD A;  3BYT B;  5AFW A;  1E0B A;  4CKE A;  4A3C G;  4KY5 A;  1BXT A;  3RLO A;  1LTI D;  2XVS A;  3C46 A;  2BDN A;  2RSN A;  2I07 B;  3Q6S A;  3H3V C;  3FPP A;  2KCM A;  3STB C;  1CFM A;  1QB5 D;  3PIP A;  3EN2 A;  3I4N H;  2FFK B;  1PH9 A;  1E3P A;  1XNR Q;  1VDZ A;  1WCM G;  3H15 A;  2PZU A;  1AZQ A;  2E8G A;  1PRT D;  2R7D A;  4R4C A;  4XXE A;  1HPC A;  1B44 D;  2N3S A;  4A3E B;  1S5F D;  3CW2 C;  2A68 D;  2ZM6 L;  1KRT A;  4Y52 H;  5ELF A;  2K7V A;  2F4I A;  1GUN A;  2NBF A;  3NSW A;  1G51 A;  1HZB A;  3G4S A;  2ZJP A;  3HKS A;  4H0L C;  3D4R A;  4ZAI A;  3GP7 A;  3HKZ G;  4QIW B;  1JJC B;  1PFB A;  4QIW E;  1XPU A;  4A3B G;  3I4M H;  5IYD G;  2K5D A;  1JWM D;  4ZYS A;  2XWJ B;  4OIK A;  4XYO A;  5BN4 A;  4UY8 C;  3A7L A;  1Q1B A;  3J7A V;  2F0H A;  1PXU A;  1U9R A;  4POF A;  1JC7 A;  4ZQ3 A;  4LF4 L;  2E2H B;  1B4O A;  1MJE A;  3EJI A;  1PZK D;  4LF8 L;  5LMU Q;  3T1H L;  4DK6 C;  3VA7 A;  4AIM A;  1NUC A;  4A93 B;  1E7Z A;  1GHK A;  4GLV B;  4JBJ A;  4RGN A;  1M4V A;  3S16 H;  1WD1 A;  3SK6 A;  4U67 3;  4DR4 L;  3MA2 B;  3FMC A;  4PQX A;  1SNC A;  4ODG A;  1K8G A;  1EIF A;  1EQQ A;  2WAQ B;  2ZJQ A;  4MN3 A;  2GVA A;  4CJ0 B;  5M5Y B;  1Q81 C;  1I4X A;  3T1H Q;  1CA5 A;  1FGB D;  2PW5 A;  4JVZ A;  2KVM A;  3M7N A;  3WOF A;  5C4X G;  3E0J A;  1YNN D;  4DR2 Q;  2K6A A;  1XYI A;  4A3G G;  2QCP X;  2KUM A;  3MFY A;  2JN4 A;  4J6H A;  1J9O A;  4XQQ A;  1YNX A;  1PFM A;  1EY4 A;  1F2Y A;  1HNZ L;  1R4P B;  2Z4H A;  1QE6 A;  2RQX A;  1TS4 A;  2L9H A;  5LMN Q;  1XXG A;  1EY8 A;  3BVG A;  1PTO F;  1Q1E A;  4Q0F A;  3A56 A;  3M4Q A;  3VR5 A;  1GJX A;  1Y14 B;  4BBS B;  4R4Q A;  2FHT A;  1RTN A;  1GUW A;  4K0K Q;  1UE1 A;  5KYL A;  4LFA L;  4K5X A;  3MXP A;  3OPO A;  2ALY B;  4RHR A;  4C3J G;  4A4I A;  1LUZ A;  2JEA I;  2KEE A;  1HNX Q;  4A3I H;  1CZW A;  3CC2 A;  3N52 A;  4KHP L;  1N32 Q;  3QG1 A;  2R93 G;  1T9H A;  1YZ6 A;  3K7A H;  1F2Z A;  1KDC A;  5M5W B;  2WB1 B;  1JOO A;  1CQV A;  4BY7 G;  3SEB A;  2X69 A;  1I4P A;  4JI0 L;  3K5N A;  1R4Q B;  3L3O C;  1BCP B;  4JK1 C;  1X65 A;  4IUU A;  1KD1 C;  3H91 A;  1SYD A;  2Z0S A;  2EQS A;  4DK1 A;  4HJA A;  2FMC A;  2QEJ C;  3UDX A;  2KBN A;  1B50 A;  1EEF D;  1PMR A;  1G2S A;  1HJP A;  1VQF A;  2WAQ G;  4JI1 L;  2MPM A;  4NKL A;  3NTI A;  2EIF A;  5COY A;  1XMO Q;  1LTT D;  1BO0 A;  2I5M X;  2XRQ D;  4JI3 L;  4FVM A;  4YWM A;  4A93 G;  1J8I A;  3W5O A;  1PA6 A;  4OO1 H;  4CGY B;  1Y1V G;  3VA5 A;  1NSN S;  3E0E A;  3H94 A;  4KMU C;  1EIH A;  2Z8L A;  5IE8 A;  3K5O A;  4J1M A;  3TZU A;  1IBM Q;  1WTR A;  4LUZ A;  1ET6 A;  4ZKC B;  3RZO H;  3VR3 A;  4GNX B;  4JV5 L;  3NEL A;  2NB0 A;  3D4D A;  1XTD A;  4XT1 B;  2Q2I A;  3KLS A;  1SRU A;  3U9S A;  3J7A 5;  4C3H H;  1I94 Q;  2AHO B;  2IL8 A;  1LTR D;  1EZ6 A;  5KGU A;  1Y8N B;  1X3G A;  1RHP A;  2F0E A;  2B8F A;  4K6D A;  2ZXO A;  1BCP C;  3AU7 A;  4FO2 A;  4A3D G;  4CJ2 C;  3TP7 A;  4HN7 A;  3H3V I;  5J3B A;  1STY A;  4U68 A;  4F7X A;  2YTV A;  1EWH A;  5LMN L;  5IY0 A;  1M1K C;  3QOJ A;  2EXZ A;  4OO1 I;  1G29 1;  3KLS X;  1D1I A;  1VQD A;  4IFD G;  1S5E D;  3NBH B;  1A2U A;  4AYB G;  3J80 E;  4XYQ A;  3VR2 A;  4DR1 L;  4A3I B;  1AP0 A;  3F2C A;  4DV1 L;  1LT4 D;  4LF9 L;  3U50 C;  4DNI A;  5BR8 Q;  1FGU A;  2R93 B;  1CI3 M;  2WII B;  1MKH A;  3K8A A;  2DGY A;  3Q22 A;  2I5H A;  3IL8 A;  2RVL A;  5KEE A;  4DU9 A;  5ELO A;  1D6E C;  2EZV A;  2R92 B;  2HQE A;  5IGC A;  5KNC A;  5CBA E;  2L12 A;  1RTO A;  4N8F A;  5JAV A;  4IUP A;  1STG A;  3DM3 A;  1SEB D;  1WTH A;  2EPB A;  4IAL A;  4M1U B;  1HNW L;  4EVO A;  3PIP 3;  1HUN A;  2WAQ E;  3M4Y A;  3TP6 A;  4JI7 Q;  1DOM A;  1F9P A;  4OX9 L;  1IBK L;  3G6E A;  4MNO A;  4GKK Q;  2VQE L;  1SSO A;  2K5V A;  3A5Z B;  3H6M A;  5M3F B;  5CV8 A;  5J1Z A;  5K36 G;  4G7Z C;  3CXC A;  4QJF A;  1N8R C;  2JA8 H;  3OTO L;  5JOB A;  1ENC A;  1DYQ A;  2B2Y A;  4B3T L;  1EIG A;  2PQA B;  2V4D A;  2A69 D;  3T4A C;  3QB3 A;  1KIX A;  1HNW Q;  3GTG H;  1QIL A;  1D2B A;  2WIN B;  4RCN A;  3JAM E;  2VW9 A;  2K01 A;  4IJH A;  5DM6 3;  2F0F A;  3SE0 A;  2MGS A;  5CV6 A;  1DCZ A;  3I90 A;  3I91 A;  4B3M L;  5NUC A;  4NXM L;  5FLX E;  3CCM A;  1N9W A;  2R6G A;  4FNF A;  3AEV A;  4DGZ A;  1TWC H;  3DWQ A;  2F3W A;  2DJF C;  3H0G B;  2HCI A;  3PUX A;  2O4X A;  3KK7 A;  3NWT A;  2A5H A;  3HOY H;  2D2C C;  2YV5 A;  4KKU A;  4ABN A;  1ASY A;  2EVB A;  3S24 A;  3CME A;  4RAU C;  2F03 A;  5I9P A;  5EKL A;  4K6L A;  4LF9 Q;  2UXD Q;  4GS3 A;  1SE3 A;  5IT9 L;  2B63 G;  5IWA L;  1K73 C;  1U4P A;  4O2D A;  5EQ0 A;  3ULJ A;  1MSH A;  3S2H H;  4I7A A;  1H9R A;  1B2T A;  2B2U A;  2R61 A;  1QZG A;  5IP7 G;  4ZK9 B;  1LT6 D;  4L5T A;  4A3D B;  3L2P A;  2EY2 A;  5C3X A;  2AQ1 B;  1LM0 A;  4DR5 Q;  4JI5 Q;  4P71 A;  3S15 H;  1K83 B;  3SK5 A;  4JW0 A;  1UE5 A;  4AQY L;  1PH2 A;  3PSI A;  2WAC A;  3CC7 A;  2I5L X;  1Z9F A;  1I94 L;  3AYH B;  4DXG A;  3PUW A;  3VYU A;  1OTC A;  1RJT A;  1H9K A;  1B3A A;  2NVQ B;  3CRK C;  4YIJ A;  1BCP D;  5CV4 A;  1JT8 A;  1PTO B;  3TSS A;  2CQA A;  1SND A;  3KLW A;  1LT3 D;  2YYZ A;  1SE2 A;  2J4X A;  2DN8 A;  1VF5 C;  1VQB A;  2TSS A;  3E5S A;  5K5P A;  4DAY A;  2B2U C;  3MAQ A;  1XMO L;  4L5S A;  1K3B C;  2OQK A;  3RNU A;  4R8I A;  1D1K A;  1TT2 A;  3LWE A;  5C4H A;  2OT2 A;  5ISR A;  4Y7N H;  4A3K G;  5IGG A;  2M00 A;  1KQS A;  4DV5 Q;  4KJO A;  2K04 A;  2PMZ B;  4BBS G;  2HT1 A;  3S14 H;  1KAB A;  1DM0 B;  2ICE C;  2XIW A;  4ILW A;  4JI7 L;  3URY A;  1EUJ A;  4K5V A;  4DV4 L;  2BA1 A;  2F0D A;  1Y69 U;  2EXD A;  1CSP A;  1LAC A;  3J81 j;  2A74 C;  4NDX A;  3MZ5 A;  2Z6K C;  3A0J A;  1BCP F;  1AE2 A;  2PQE A;  2KOL A;  1J6Q A;  4X66 L;  4LF7 L;  1QCB D;  3P75 A;  4ZLT F;  2D5D A;  2YU9 H;  1T5X D;  3HFZ B;  2O2L D;  1WJJ A;  1F9Q A;  3ICE A;  1O7Y A;  4K0K L;  2BH2 A;  1VQE A;  2RDG A;  1LTA D;  2F3I A;  1EOV A;  3T16 A;  4DV4 Q;  3NEN A;  4LFC L;  3RR5 A;  2CQO A;  1GVP A;  1TKW B;  2TMP A;  4L6T B;  2ZTC A;  3H09 A;  4ID6 A;  1GOZ A;  2F1M A;  4B3T Q;  4LJZ C;  4FYD A;  4DNT B;  3S1M H;  3KF6 B;  5FLX L;  1NMG A;  3FDT A;  1AEX A;  4S3S A;  4HID A;  1DXM A;  3U9O A;  2VNU D;  3KDF A;  1BBW A;  1H95 A;  1K8A C;  4CKC A;  1JB3 A;  1CUK A;  3M7G A;  3TP8 A;  5C0X J;  1FNW A;  4DV6 L;  1RF2 D;  4C1N K;  5DEH A;  2KHJ A;  4NMZ A;  5IP9 G;  2VS1 A;  5FLX c;  2R93 H;  1PV4 A;  1WOC A;  4C2M B;  3TDQ A;  4R1J A;  2BE5 D;  3U4Z A;  4JG2 A;  1PH5 A;  4QGU A;  1JWS D;  2LY7 A;  3ULP A;  1LV9 A;  1MJC A;  1H9S B;  4B08 A;  1A2T A;  4RKL A;  3SGI A;  4WJ3 M;  2CHB D;  1I6H B;  1YBY A;  1NR4 A;  4AYB E;  5DM7 3;  1JIC A;  2HHH Q;  3TBI B;  4FXD A;  1YJ9 A;  1L0W A;  3J7Z C;  2NVT B;  4P2C B;  3EFX D;  3HOW H;  2RDH A;  3W2D A;  5ELN A;  5HGQ A;  1B7Y B;  1LAB A;  1QG7 A;  1YHQ A;  4DR7 Q;  2KED A;  2G5D A;  2EDG A;  2B2V C;  1SFO H;  5C6A A;  4RKB A;  1SJE D;  3CD6 A;  4OHJ A;  2WV6 D;  1QUQ B;  3KOJ A;  4B3S L;  2NN6 H;  1S5C D;  3IKJ A;  4WJ4 A;  4HIO A;  3GQB A;  3S1N H;  5C3E B;  3KBX A;  3Q24 A;  3GTP B;  2SDF A;  3ND9 A;  2E76 C;  1X3Q A;  3M4P A;  3GO5 A;  3F1Z A;  1GKH A;  3KJO A;  2PNR C;  4GKJ Q;  3V2T A;  4KHP Q;  4X6A H;  2K5H A;  1GUG A;  3MTS A;  4JI2 Q;  1ILP A;  3DM1 A;  4DV2 Q;  1NMF A;  1VQP A;  3J81 c;  2LKV A;  3DLL A;  3GTL B;  1EL0 A;  2GVB A;  1YNN C;  3RD4 A;  1HZC A;  3I4N B;  5JEA G;  3FKI G;  1B8A A;  5FO8 B;  4A3F H;  3HOZ B;  4P74 A;  2B2V A;  4K8I A;  4BY1 B;  1KDB A;  2UXD L;  1AW7 A;  1ICF B;  2WKC A;  3E9H A;  2KEN A;  3CCQ A;  2H5X A;  4KLK A;  1DGS A;  1QVG A;  2HIV A;  5D3D A;  1KNA A;  2B2Y C;  4A3G B;  3DHQ A;  4DA2 A;  2MQH A;  1HRJ A;  3FRP B;  4UPA A;  1E1T A;  1PH7 A;  4IOA A;  4KY7 A;  1CKM A;  1M90 C;  3A5U A;  4DV0 L;  1YHB A;  1EU3 A;  1JJ2 A;  1IBK Q;  4CKB A;  5M5X H;  3I72 A;  2VQE Q;  1X55 A;  1STE A;  3OYY A;  1BVS A;  3OTO Q;  4GLX A;  1KRS A;  4DUZ Q;  3ER0 A;  4LF5 Q;  2NZH A;  4DR3 L;  3G48 A;  1WYD A;  4DUY L;  4HJ7 A;  3JAM c;  2A69 C;  3NP8 A;  1XPR A;  1XMQ Q;  1HR0 Q;  3NBH A;  4BY7 B;  1GXD C;  1GUO A;  2BCO A;  2A6E C;  5FOB B;  2R7Z H;  2JP1 A;  1PH8 A;  1XJV A;  5J22 A;  2JA9 A;  2QDB A;  1JMC A;  1PYS B;  5COR A;  3G6J B;  4BS9 A;  1KL9 A;  1ONL A;  3K0X A;  3Q23 A;  1M8A A;  2MJ8 A;  3MXN B;  5DAU A;  5JPN C;  4IZ8 A;  1TWC B;  2EJM A;  1EFI D;  4J8Q A;  4A3L G;  1TQO A;  3CCU A;  1R9T H;  1TII D;  3PUZ A;  4PNY A;  1CKO A;  3A8K E;  1VQN A;  5C4J H;  3PF5 A;  1EWC A;  2EYO A;  4X64 L;  1Q7Y C;  1PH6 A;  2WB1 G;  4DR1 Q;  4HJ9 A;  2F0T A;  3UDF A;  1SMX A;  3S1R B;  3L9A X;  4NB3 A;  2HUG A;  2Q2T A;  4BBR G;  2V1C C;  5C0X G;  2I46 A;  3T13 A;  2F0I A;  2HCC A;  1EQV A;  3TEH B;  3F8T A;  4XDX A;  3G71 A;  2IX0 A;  4JOI A;  1R9T B;  5IGF A;  1QNU A;  3SK4 A;  4QUC A;  4BY1 G;  1N33 L;  5TSS A;  5HY6 A;  4X66 Q;  4PZ6 A;  2JEB I;  1ZXT A;  1NBW A;  2OTL A;  4LF8 Q;  5CMD A;  5KND A;  5LMU L;  3S9W A;  1Q46 A;  2IHF A;  1CKN A;  1W3S A;  1SLJ A;  1E24 A;  5M3M G;  5T1I A;  2R7Z B;  1Y1W G;  3GD7 A;  2JSO A;  1A3U A;  4LF5 L;  1SMY D;  5KRU A;  5T1G A;  5ELB A;  4A3B B;  2RF4 A;  1PFS A;  2OF1 A;  4V0B A;  1A3T A;  3QR8 A;  4BBR B;  1HR0 L;  3HKZ B;  1X3F A;  1PTO D;  4KN4 C;  4LUV A;  5I6Y A;  2WFW A;  2AQ2 B;  2BDO A;  1IBL L;  4HIM A;  1YJN A;  3C2P A;  2PI2 A;  5EPJ A;  3T1Y L;  3O13 A;  2DUD A;  1SNQ A;  2F0G A;  4QL5 A;  2MNA A;  4EGV A;  2D0O A;  1TXY A;  3KUP A;  2EJF C;  2UUC L;  2UU9 Q;  1K28 A;  1TS3 A;  3GTO H;  1CK1 A;  3TS2 A;  4HMI A;  3SK8 A;  4H44 C;  5EKI A;  1A3V A;  1DOK A;  4HIK A;  5IOD A;  3E3X A;  5KIX A;  3HP3 A;  2NVX B;  1HHV A;  4L5Q A;  2B63 B;  3GTO B;  1A6X A;  2ZM6 Q;  1L0X B;  1VQO A;  4EQN A;  1QUQ A;  3OHX C;  4A3L H;  3NQI A;  1V1P A;  2KQ3 A;  4C56 C;  1OXV A;  2LS0 1;  4HMJ A;  3WOE A;  2G9H D;  4A3K H;  1VQJ A;  4RHS A;  5E4X A;  4JI1 Q;  3PIO 3;  2F0M A;  3NUC A;  4IOC A;  3RZO B;  2K5Q A;  2XN9 C;  3BS1 A;  1I4H A;  3BG3 A;  3BYY B;  1QOH A;  4TRD A;  4DV7 L;  4IFD I;  2K5W A;  3S1N B;  1YEZ A;  1HZA A;  4I7Z C;  1LO5 D;  4LFA Q;  3AB9 A;  1KC8 C;  2K75 A;  2MUY A;  5E7N A;  1EY7 A;  1B1Z A;  1RKN A;  2FMM A;  3NXW A;  3FKI H;  4LUO A;  1MSG A;  1EIY B;  2BH8 A;  1KLG D;  1SBB B;  3CKI B;  2N55 A;  1VQC A;  1ROD A;  2A68 C;  1A62 A;  2XNA C;  3W1B A;  5GQO A;  1QVF A;  3S2D H;  1S5B D;  4IUV A;  3OW2 A;  4JBM A;  5FLM G;  3QOL A;  2NZ1 D;  4HED A;  1Q82 C;  5EPL A;  4DR7 L;  3CHB D;  4JI4 Q;  1T5E A;  5C4Z A;  3QIA A;  1PH3 A;  1PTO C;  4DK0 A;  4DR3 Q;  3T51 B;  1VQM A;  1V1Q A;  1PHJ A;  1STN A;  1X56 A;  2PMZ E;  1EY6 A;  1LT5 D;  2BE5 C;  1Y8P B;  2L11 A;  2K33 A;  4A3J G;  3J81 E;  4MTN A;  2LXJ A;  1VQ8 A;  3J7Y W;  4DV3 Q;  3M9B A; 
#chains in the Genus database with same CATH homology
 2F0O A;  4IUN A;  5F2D A;  2KCC A;  5G3L D;  2J7Z A;  1HCZ A;  1GHJ A;  2ZT9 C;  3P20 A;  4KTA A;  2R3Z A;  3ZYY X;  2K1B A;  2F3V A;  3I3C A;  2RA4 A;  3VR6 A;  4KHZ A;  1DOL A;  1WTX A;  4HTH A;  1SNP A;  3DEP A;  3KLR A;  4K2K A;  2B2W C;  4IQZ A;  5ELC A;  4KKT A;  4CJ1 B;  2NTT A;  3EVQ A;  2BOS A;  1PYW D;  1ESR A;  1SAP A;  2JA6 B;  2K05 A;  2Z1C A;  4C3H B;  4F8M A;  1IHZ A;  1WVL A;  4R9W A;  3PUV A;  1I50 B;  5IGE A;  4A3F B;  4A3J B;  1D5X C;  1YNJ C;  3LX0 A;  4X3K A;  2WP8 J;  3NPP A;  4KKS A;  1O7Z A;  4A3K B;  3HOU B;  2BA0 A;  2Z4I A;  1PTO H;  1KNE A;  1U4M A;  1BNZ A;  1FNV A;  1FYC A;  1KAA A;  1TR5 A;  2O5I C;  3A8J E;  1E2V A;  3PV0 A;  2AWO A;  3M4O B;  3D31 A;  4C3J B;  5EBD A;  3MFG A;  2E2I B;  2E2J B;  3S15 B;  3K7A B;  3K58 A;  1C8C A;  2E75 C;  2DY8 A;  3J81 L;  2WKD A;  4CHT B;  5CBE E;  5JPM C;  3D6C A;  1A15 A;  1QJO A;  2RKS A;  1HTL D;  2JYO A;  4DFA A;  4KJN A;  2K03 A;  3HS0 C;  2M2L A;  2RBM A;  1IYV A;  4LMQ D;  2EYH A;  3RZD B;  1V43 A;  5CYU A;  1XX8 A;  3R3O A;  1B53 A;  2EY6 A;  5HGT A;  4KK7 A;  1RDP D;  3K57 A;  1WD0 A;  3HOW B;  1JWU D;  5DNF A;  3S16 B;  4LK1 C;  2X6L A;  5I4D A;  1I3Q B;  1BF4 A;  3GTM B;  2NN6 G;  2GA4 B;  4BA2 I;  4IUQ A;  1G2T A;  1IW7 C;  3T56 B;  3FKI B;  5A2Q E;  1O78 A;  4C3H G;  3TP5 A;  3NQT A;  3S1Q B;  3K59 A;  2IW3 A;  4E6I A;  2AUK A;  4HSV A;  4AYB B;  3UI2 A;  1ZKO A;  3K6O A;  5EKK A;  2IT1 A;  3Q0A A;  3TZD A;  2SNS A;  2F0V A;  1WTV A;  5ELE A;  1HFN A;  4PMC A;  2DY7 A;  1O7L A;  1IW7 D;  4FP5 D;  2KJX A;  3NTH A;  4N9T A;  2A6H D;  4I65 A;  1PRT B;  4FF4 A;  3I73 A;  5JVH 3;  4TKO B;  5C4X B;  2Y0S B;  1SNM A;  1G8Z D;  1LTS D;  2VB3 X;  1TU2 B;  4OIJ A;  5FO7 B;  3J80 L;  2YU9 B;  3M85 A;  3NHH A;  5IGD A;  1E2Z A;  1WTW A;  4KI0 A;  2FIN B;  1VMC A;  3TME A;  4K2L A;  4RCO A;  1WTQ A;  1F2M A;  1BUV T;  3QJY A;  3FVQ A;  1EY0 A;  5C0X H;  4WOR A;  5A2Q L;  4G7O C;  3W3A A;  4HSP A;  3JAM L;  1GUT A;  3S2H B;  1I4R A;  4KV6 A;  1F9S A;  3A55 A;  5A35 A;  4G4K A;  3MXG A;  1EY5 A;  1I6V C;  4K5W A;  3BDO A;  2SEB D;  3HGB A;  4KN7 C;  1B9N A;  3V05 A;  4X3S A;  1VMP A;  1E2W A;  2XWB B;  3SVM A;  1SMY C;  1PZI D;  2VXW A;  1H9J A;  1TY0 A;  2A6E D;  2NVY B;  3EA6 A;  5FO9 B;  5M3M B;  1X3P A;  1GUS A;  3OSO A;  5JVG 3;  1S4Z A;  5CV5 A;  5C4J B;  1EZ8 A;  5I2X A;  2K28 A;  1TY2 A;  3V96 A;  4C3I G;  1Q3L A;  2JA8 B;  2F0K A;  1CTM A;  5M9O A;  5IT9 E;  1PLF A;  2RDF A;  1F77 A;  4XT3 B;  1TS2 A;  4KD3 A;  1RCV D;  4UDU C;  4Q5V A;  4XTC S;  1JOR A;  1X32 A;  3BVZ A;  4QMG A;  1B9M A;  3SDZ A;  2ICI A;  3RMH A;  5C5L A;  1F2L A;  2B39 A;  1ET9 A;  1STH A;  2ZXR A;  2SOB A;  1MBY A;  1DON A;  3ITP A;  4XQJ A;  5I6W A;  1OXX K;  5EJW A;  2L1B A;  4OO1 G;  2L55 A;  3GTG B;  4MIU A;  4HR7 B;  1SYB A;  2CW0 D;  3GV6 A;  3VYS A;  2A6H C;  3IFD A;  5J39 A;  4G57 A;  2RSO A;  2F0S A;  3HEJ A;  3QO2 A;  3T53 B;  3KF8 A;  3HRZ C;  1VF7 A;  1Z7T A;  2D62 A;  3K5M A;  4V19 0;  2F0L A;  3WDN A;  1HTP A;  2QKI C;  1FNU A;  2ZXP A;  4HCS A;  2NYZ D;  1ZYR C;  1TWG B;  2C5C A;  1ILQ A;  3NE5 B;  1TWH B;  1CHQ D;  4FF2 A;  1DD2 A;  1C48 A;  1RD9 D;  1SXT A;  1UAP A;  3DMU A;  1KLU D;  2O5J C;  4O42 A;  4K14 A;  3IAY A;  2DNE A;  2F0N A;  1SDF A;  3OMG A;  3PO2 B;  2K32 A;  2KA7 A;  4G7H C;  2X6G A;  3OWE B;  1HA5 A;  1W6J A;  2F0U A;  1ENF A;  1Y1W B;  3R8B A;  1L0Y B;  5C5M A;  3GTJ B;  1CM9 A;  1BDO A;  2MP1 A;  1STA A;  2B2T C;  1Q90 A;  1EYD A;  4TQU S;  5KNB A;  4H13 C;  1II3 A;  4QCL A;  5CR3 A;  3BDC A;  3I70 A;  1TWF B;  3A54 A;  4M8A A;  3E6Z X;  4FXG C;  5FKA C;  1I4G A;  1SE4 A;  5K36 H;  1JOK A;  4IFD J;  1ML0 D;  2XSC A;  3M3Y B;  3MC0 B;  3RLF A;  2AQ3 B;  1ENA A;  2EYM A;  2VB2 X;  4XQN A;  1DZ1 A;  5JEA H;  1AN8 A;  5CV7 A;  5IIF A;  3C1F A;  4RH6 A;  3DUZ A;  1BOS A;  1Z6H A;  3L7Z C;  3HOV B;  1C4Q A;  1SYC A;  3CQZ B;  2IWH A;  4B9X A;  2JXM B;  1EOT A;  1QNK A;  1EYC A;  2E2D C;  1LLR D;  1I4Q A;  1Y1V B;  2QIL A;  3TN2 A;  3MVV A;  4PMW A;  3CU7 A;  3S1M B;  1ICW A;  3PMF A;  4QB4 A;  4IUT A;  4RGT A;  2QF7 A;  1H9S A;  1PRT C;  1LTB D;  3DEO A;  1FR3 A;  1JOQ A;  2LMC B;  4C3I B;  1Q8I A;  2NN6 I;  1YNJ D;  3F2U A;  1ZEQ X;  4FF1 A;  4FF3 A;  1ZYR D;  4ZKB B;  3GV3 A;  5LL6 X;  4EQP A;  1EQT A;  3X3M A;  5HUR A;  5LHY 1;  3C1E A;  1G91 A;  4ZUI A;  2C9O A;  1IKM A;  3A7A B;  3OW7 A;  2HDL A;  2EYP A;  2F0J A;  3OIQ A;  3D8G A;  1CT1 D;  5C44 B;  1NCV A;  2KHS A;  2CVR A;  4R8N A;  4TSS A;  1OXT A;  2OEO A;  4DN4 M;  3MHB A;  4OGQ C;  4CBV A;  4Z9C B;  3D3R A;  3OIP A;  4RA8 A;  4MHE A;  5CC4 A;  2EOT A;  1PDQ A;  2DNC A;  1KDA A;  3A8I E;  1Z47 A;  5D14 A;  5E1F A;  5E3F A;  4O1N A;  4K8J A;  3BVM A;  1TVX A;  1NR2 A;  3NTK A;  5IGB A;  1K8O A;  1O80 A;  1SYG A;  2L5T A;  2PYK A;  1F9R A;  2IX1 A;  4GZY C;  2PW7 A;  2F0W A;  2L0C A;  2HDM A;  4DNR B;  3HZX A;  4UAI A;  1EU4 A;  4IUR A;  2JA7 B;  2B2T A;  2A73 B;  1PZJ D;  1JE4 A;  1U4R A;  1JQY D;  2M9V A;  4HCE A;  2NWG A;  2IPK D;  1FD7 D;  5KYI A;  1NAP A;  2PCF B;  1DJR D;  5ELD A;  2JA5 B;  3SXH A;  1HA6 A;  1WTO A;  2F0Q A;  4IFD H;  1XTC D;  3EQL C;  2VUM B;  2PZW A;  2PO4 A;  3PO3 B;  4DAV A;  1D5M C;  4BWG B;  2ID0 A;  4RGM A;  3R93 A;  2Q8T A;  4KHV A;  4DAP A;  2AWN A;  4QF4 A;  1W6K A;  3D4W A;  2G9D A;  4F87 A;  4N9P A;  1HQR D;  5EBC A;  1D5Z C;  1BBX C;  2PPB C;  3MEH A;  2EJG C;  2H4O A;  2IX3 A;  5JEA J;  2PZT A;  1KTK A;  1TS5 A;  3S17 B;  1HUM A;  2NTS A;  4F88 A;  3DWA A;  3BDL A;  3VYT A;  1IKL A;  4WJW A;  1AZP A;  1SYE A;  2Q8I B;  4ME5 A;  3MWY W;  2J0T D;  4L63 B;  4L8J A;  3K5L A;  4DXF A;  3SR1 A;  2OXP A;  2CW0 C;  1CHP D;  4EQO A;  3ERO A;  2B8G A;  4NW2 A;  3I8Z A;  3GTK B;  5I2Y A;  3NK9 A;  2N88 A;  3PUY A;  3K0Y A;  1STB A;  1K8M A;  1OXS C;  2IJ0 A;  4ZRZ A;  5LL6 S;  1JCK B;  1HXY D;  4RGO S;  1HFG A;  1V1P B;  5BN3 A;  2EYJ A;  3R2T A;  1VCI A;  2EYF A;  3OWF A;  2E74 C;  2XRS D;  2F0P A;  2L4N A;  1Y8O B;  3VYR A;  2EYL A;  5BN5 A;  3ND8 A;  1S5D D;  3N6R A;  3ERQ A;  4DF7 A;  1AFP A;  1MGS A;  1IYU A;  3J7A F;  3X3N A;  3OOC A;  1SYF A;  5IOC A;  2NUC A;  1CZG A;  4Y7N B;  5I9O A;  3BZD B;  3AMU A;  1V8Q A;  1UEA B;  1EYA A;  2H1E A;  3DXJ C;  3GTQ B;  3HOY B;  4ULL A;  1H9M A;  1EY9 A;  3KBG A;  5CGK A;  1HQM C;  1SJH D;  3QWN A;  2KEC A;  3NWS A;  3MXN A;  3LNN A;  1UNS A;  2AUJ D;  5FK9 C;  4H7B A;  1SNO A;  1TWA B;  1MI2 A;  5C0X I;  5D65 A;  3IFT A;  1BR9 A;  2SNM A;  4QUF A;  3DWP A;  2EY5 A;  1BQQ T;  4IN3 A;  1WCM B;  4A3M B;  1OO9 B;  3I4L A;  5EPK A;  2EE1 A;  1UUP A;  3LWU A;  3I4M B;  2FJ2 A;  3C3L A;  1V1O A;  4BA1 I;  4JBW A;  5E4W C;  2EY1 A;  2D9U A;  4PMB A;  1OXU A;  4C1N I;  3R2I A;  3D6W A;  4PV1 C;  3VR4 A;  3SHL A;  2ENB A;  3HG9 A;  4OL7 A;  5EGT A;  3MXU A;  1EEI D;  2LFN A;  4RFB A;  5JJZ A;  4X3T A;  4KY6 A;  1XWE A;  1MD2 D;  1CA6 A;  4LAA A;  4FXK C;  4B9W A;  1QWY A;  4RWS C;  1JR0 D;  1Q12 A;  3S2D B;  3FPU B;  2KCN A;  5CV9 A;  1WTP A;  5C3W A;  2Q8R E;  1PRT F;  1IL8 A;  4X3U A;  1U4L A;  3G7L A;  4ZUJ A;  4HAE A;  1CQF A;  3HOX B;  2B2W A;  1G6Z A;  4NP5 A;  3S14 B;  1LTG D;  2JE6 I;  3P7J A;  5D3I B;  1SFO B;  3OMC A;  3NBI A;  4XIG S;  3P1H A;  5M5X B;  3CRL C;  3FEW X;  2MHV A;  4KD4 A;  4WFN 3;  5G3L F;  1PFN A;  3ONA B;  1ESF A;  3RUZ A;  4WRD A;  3BYT B;  5AFW A;  1E0B A;  4CKE A;  4KY5 A;  1BXT A;  1LTI D;  2XVS A;  3C46 A;  2BDN A;  2RSN A;  2I07 B;  3Q6S A;  3H3V C;  3FPP A;  1CFM A;  1QB5 D;  2FFK B;  1VDZ A;  1AZQ A;  2PZU A;  4XXE A;  1PRT D;  1HPC A;  1B44 D;  4A3E B;  1S5F D;  2A68 D;  5ELF A;  2K7V A;  2F4I A;  1GUN A;  2NBF A;  3NSW A;  4H0L C;  3D4R A;  4ZAI A;  3GP7 A;  4QIW B;  1PFB A;  2K5D A;  1JWM D;  4ZYS A;  2XWJ B;  4OIK A;  4XYO A;  5BN4 A;  3A7L A;  1Q1B A;  3J7A V;  2F0H A;  1PXU A;  1U9R A;  1JC7 A;  4ZQ3 A;  2E2H B;  1B4O A;  3EJI A;  1PZK D;  3VA7 A;  1NUC A;  4A93 B;  1GHK A;  4RGN A;  1M4V A;  1WD1 A;  3SK6 A;  4U67 3;  3MA2 B;  3FMC A;  4PQX A;  1SNC A;  4ODG A;  2WAQ B;  4MN3 A;  4CJ0 B;  5M5Y B;  1I4X A;  1CA5 A;  1FGB D;  2PW5 A;  2KVM A;  3M7N A;  3WOF A;  3E0J A;  1YNN D;  1XYI A;  2K6A A;  2QCP X;  2KUM A;  3MFY A;  4J6H A;  1J9O A;  4XQQ A;  1PFM A;  1EY4 A;  1F2Y A;  1R4P B;  2Z4H A;  1QE6 A;  2RQX A;  1TS4 A;  2L9H A;  1XXG A;  1EY8 A;  3BVG A;  1PTO F;  1Q1E A;  4Q0F A;  3A56 A;  3VR5 A;  1GJX A;  4BBS B;  2FHT A;  1RTN A;  1GUW A;  5KYL A;  4K5X A;  3MXP A;  3OPO A;  4RHR A;  4C3J G;  2JEA I;  2KEE A;  1CZW A;  3N52 A;  3QG1 A;  1F2Z A;  1KDC A;  5M5W B;  2WB1 B;  1JOO A;  1CQV A;  3SEB A;  2X69 A;  1I4P A;  3K5N A;  1R4Q B;  3L3O C;  1BCP B;  4JK1 C;  4IUU A;  3H91 A;  1SYD A;  4DK1 A;  2FMC A;  2QEJ C;  1B50 A;  1EEF D;  1PMR A;  1G2S A;  2MPM A;  4NKL A;  3NTI A;  5COY A;  1LTT D;  1BO0 A;  2XRQ D;  4FVM A;  1J8I A;  4OO1 H;  4CGY B;  3VA5 A;  1NSN S;  4KMU C;  3H94 A;  1EIH A;  2Z8L A;  3K5O A;  4J1M A;  3TZU A;  1WTR A;  1ET6 A;  4ZKC B;  3VR3 A;  2NB0 A;  3D4D A;  4XT1 B;  3KLS A;  3U9S A;  2IL8 A;  1LTR D;  1EZ6 A;  5KGU A;  1Y8N B;  1RHP A;  2F0E A;  2B8F A;  4K6D A;  2ZXO A;  1BCP C;  3AU7 A;  4FO2 A;  4CJ2 C;  3TP7 A;  4HN7 A;  1STY A;  4U68 A;  4F7X A;  1EWH A;  4OO1 I;  3QOJ A;  2EXZ A;  1G29 1;  3KLS X;  1D1I A;  4IFD G;  1S5E D;  1A2U A;  3J80 E;  4XYQ A;  3VR2 A;  1AP0 A;  4A3I B;  1LT4 D;  2R93 B;  1CI3 M;  2WII B;  3Q22 A;  3IL8 A;  2RVL A;  5KEE A;  4DU9 A;  1D6E C;  2EZV A;  2R92 B;  2HQE A;  5IGC A;  5KNC A;  5CBA E;  2L12 A;  1RTO A;  5JAV A;  4IUP A;  1STG A;  1SEB D;  4IAL A;  2EPB A;  4M1U B;  4EVO A;  3PIP 3;  1HUN A;  3M4Y A;  3TP6 A;  1DOM A;  1F9P A;  1SSO A;  3H6M A;  5M3F B;  5CV8 A;  5J1Z A;  5K36 G;  4G7Z C;  5JOB A;  1ENC A;  1DYQ A;  2B2Y A;  1EIG A;  2V4D A;  2A69 D;  3T4A C;  3QB3 A;  1QIL A;  1D2B A;  2WIN B;  4RCN A;  3JAM E;  2K01 A;  5DM6 3;  2F0F A;  3SE0 A;  2MGS A;  5CV6 A;  1DCZ A;  3I90 A;  3I91 A;  5NUC A;  5FLX E;  2R6G A;  4FNF A;  4DGZ A;  3DWQ A;  2F3W A;  3H0G B;  2HCI A;  3PUX A;  2O4X A;  3KK7 A;  3NWT A;  2A5H A;  2D2C C;  4KKU A;  4ABN A;  2EVB A;  2F03 A;  4RAU C;  5I9P A;  5EKL A;  4K6L A;  1SE3 A;  5IT9 L;  1U4P A;  5EQ0 A;  1MSH A;  1H9R A;  1B2T A;  2B2U A;  2R61 A;  4ZK9 B;  1LT6 D;  4A3D B;  2EY2 A;  5C3X A;  2AQ1 B;  1K83 B;  3SK5 A;  2WAC A;  4DXG A;  3PUW A;  3VYU A;  1RJT A;  1H9K A;  1B3A A;  2NVQ B;  3CRK C;  4YIJ A;  1BCP D;  5CV4 A;  1PTO B;  3TSS A;  2CQA A;  1SND A;  1LT3 D;  2YYZ A;  1SE2 A;  2J4X A;  2DN8 A;  1VF5 C;  2TSS A;  3E5S A;  5K5P A;  4DAY A;  2B2U C;  3MAQ A;  4R8I A;  1D1K A;  1TT2 A;  3LWE A;  5C4H A;  2OT2 A;  5ISR A;  5IGG A;  2M00 A;  4KJO A;  2K04 A;  2PMZ B;  1KAB A;  1DM0 B;  2ICE C;  2XIW A;  4ILW A;  3URY A;  4K5V A;  2BA1 A;  2F0D A;  1Y69 U;  1LAC A;  2A74 C;  4NDX A;  3MZ5 A;  1BCP F;  2PQE A;  2KOL A;  1QCB D;  3P75 A;  4ZLT F;  2D5D A;  1T5X D;  2O2L D;  1F9Q A;  1O7Y A;  2RDG A;  1LTA D;  3T16 A;  1TKW B;  2TMP A;  4L6T B;  3H09 A;  4ID6 A;  1GOZ A;  2F1M A;  4LJZ C;  4FYD A;  4DNT B;  5FLX L;  3FDT A;  1AEX A;  4S3S A;  1DXM A;  3U9O A;  2VNU D;  4CKC A;  1JB3 A;  3M7G A;  3TP8 A;  5C0X J;  1FNW A;  1RF2 D;  4C1N K;  5DEH A;  4NMZ A;  4C2M B;  3TDQ A;  2BE5 D;  1JWS D;  2LY7 A;  1LV9 A;  1H9S B;  4B08 A;  1A2T A;  4RKL A;  2CHB D;  1I6H B;  1NR4 A;  5DM7 3;  1JIC A;  3TBI B;  4FXD A;  2NVT B;  4P2C B;  3EFX D;  2RDH A;  3W2D A;  1LAB A;  1QG7 A;  2KED A;  2EDG A;  2B2V C;  5C6A A;  4RKB A;  1SJE D;  4OHJ A;  2WV6 D;  2NN6 H;  1S5C D;  3IKJ A;  3GQB A;  5C3E B;  3KBX A;  3Q24 A;  3GTP B;  2SDF A;  3ND9 A;  2E76 C;  1X3Q A;  3GO5 A;  2PNR C;  3V2T A;  1GUG A;  3MTS A;  1ILP A;  3DM1 A;  3GTL B;  2LKV A;  1EL0 A;  1YNN C;  3RD4 A;  3I4N B;  5JEA G;  5FO8 B;  3HOZ B;  2B2V A;  4K8I A;  4BY1 B;  1KDB A;  1AW7 A;  2WKC A;  5D3D A;  1KNA A;  2B2Y C;  4A3G B;  3DHQ A;  4DA2 A;  1HRJ A;  3FRP B;  4KY7 A;  1EU3 A;  4CKB A;  3I72 A;  1STE A;  4BY7 B;  2A69 C;  3NP8 A;  3NBH A;  1GXD C;  1GUO A;  2BCO A;  2A6E C;  5FOB B;  2JP1 A;  5J22 A;  2QDB A;  5COR A;  3G6J B;  4BS9 A;  1ONL A;  3Q23 A;  1M8A A;  2MJ8 A;  5DAU A;  5JPN C;  4IZ8 A;  1TWC B;  2EJM A;  1EFI D;  4J8Q A;  1TQO A;  1TII D;  3PUZ A;  4PNY A;  3A8K E;  1EWC A;  2EYO A;  2F0T A;  3S1R B;  3L9A X;  2HUG A;  5C0X G;  2I46 A;  3T13 A;  2F0I A;  2HCC A;  1EQV A;  4XDX A;  2IX0 A;  1R9T B;  5IGF A;  1QNU A;  3SK4 A;  4QUC A;  5TSS A;  2JEB I;  1ZXT A;  5CMD A;  5KND A;  3S9W A;  5T1I A;  2R7Z B;  3GD7 A;  2JSO A;  1A3U A;  1SMY D;  5KRU A;  5T1G A;  5ELB A;  4A3B B;  2OF1 A;  4V0B A;  1A3T A;  4BBR B;  3HKZ B;  1PTO D;  4KN4 C;  5I6Y A;  2AQ2 B;  2BDO A;  3C2P A;  5EPJ A;  3O13 A;  1SNQ A;  2F0G A;  4EGV A;  3KUP A;  2EJF C;  1TS3 A;  1CK1 A;  4HMI A;  3SK8 A;  4H44 C;  5EKI A;  1A3V A;  1DOK A;  5IOD A;  5KIX A;  3HP3 A;  2NVX B;  1HHV A;  2B63 B;  3GTO B;  1A6X A;  1L0X B;  4EQN A;  3OHX C;  3NQI A;  1V1P A;  2KQ3 A;  4C56 C;  1OXV A;  2LS0 1;  4HMJ A;  3WOE A;  2G9H D;  4RHS A;  5E4X A;  3PIO 3;  2F0M A;  3NUC A;  3RZO B;  2K5Q A;  2XN9 C;  3BS1 A;  1I4H A;  3BG3 A;  3BYY B;  1QOH A;  4TRD A;  4IFD I;  2K5W A;  3S1N B;  4I7Z C;  1LO5 D;  3AB9 A;  2MUY A;  1EY7 A;  1B1Z A;  1RKN A;  2FMM A;  3NXW A;  1MSG A;  1KLG D;  1SBB B;  3CKI B;  2N55 A;  1ROD A;  2A68 C;  2XNA C;  1S5B D;  4IUV A;  3QOL A;  2NZ1 D;  4HED A;  5EPL A;  3CHB D;  1T5E A;  5C4Z A;  3QIA A;  1PTO C;  4DK0 A;  3T51 B;  1STN A;  1EY6 A;  1LT5 D;  2BE5 C;  1Y8P B;  2L11 A;  2K33 A;  3J81 E;  3J7Y W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...