3A8JE

Crystal structure of et-ehred complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
126
Chain Sequence
SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 126
sequence length 127
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8jE00
4OGQC 3U9SA 1H9SA 4JBWA 2BA0A 2BE5D 3LWUA 2ZT9C 4OO1H 1E2ZA 3A8IE 1IW7D 1Z6HA 1K8OA 3M7NA 4IFDG 2A68C 1HCZA 3VA7A 1BDOA 1G291 3PUXA 2PPBC 2B8GA 1FYCA 2D5DA 1Q1BA 4KN7C 1IW7C 3I72A 2Q8IB 5BN4A 2D62A 4H0LC 3QIAA 2AUJD 3M85A 2AUKA 4HR7B 5JEAG 5KNBA 2A6HD 2JEBI 1GJXA 3W3AA 1Y69U 4KKTA 4DK0A 2A69D 1VCIA 2A6HC 1Y8PB 2IT1A 4IQZA 3T53B 1GUSA 3OW7A 2D2CC 2A6EC 1H9JA 3D4RA 2NN6H 4LJZC 1IYVA 2A69C 1IYUA 1VF5C 1OXTA 1FR3A 4DK1A 1GUOA 2DNEA 4KKSA 3GQBA 4G7HC 2R6GA 2A68D 3PV0A 3VR5A 1HPCA 1I6VC 1Y8NB 1YNNC 2O5IC 1YNJC 5BN3A 4PV1C 3A8KE 1Q12A 2DNCA 1CFMA 1B9MA 1ZKOA 1H9KA 2PNRC 2CW0C 2E75C 2QF7A 3OOCA 4IFDH 4RCNA 5K36G 3PUZA 1Q1EA 2V4DA 2KA7A 3VR2A 1H9MA 2B8FA 3LNNA 1QJOA 2NN6I 2A6ED 3ND8A 4KN4C 1PMRA 4XTCS 2AWOA 3MXUA 4BA1I 5KNDA 5JEAH 3I73A 1E2VA 4KI0A 4TQUS 3TZUA 2EJGC 1TU2B 2K33A 3DXJC 4KMUC 1Y8OB 2DN8A 4I7ZC 2BA1A 1O7LA 1LACA 5C0XG 3L7ZC 4BA2I 3OPOA 1GUGA 3WDNA 3PUWA 2LMCB 3FMCA 1O78A 2JXMB 3D31A 4DNTB 4H44C 3VR4A 1HQMC 1EWHA 1B9NA 3M4YA 3N6RA 3CRLC 3PUYA 1OXXK 3QG1A 4LK1C 2JE6I 3SE0A 1ONLA 4TKOB 2EJMA 2K7VA 2YYZA 2EDGA 1HTPA 4G7ZC 1CTMA 1SMYC 4JK1C 4DNRB 3VR3A 1CI3M 4L8JA 3KLRA 3QJYA 1TKWB 3HGBA 4OO1G 3MFYA 2O5JC 5K36H 2EVBA 3FPPA 2E76C 2EJFC 3NE5B 3IKJA 3PUVA 3EQLC 2E74C 3BDOA 1OXUA 3I4LA 4KHZA 3RLFA 3A8JE 3T56B 1GUTA 1VF7A 4XIGS 3SDZA 1DD2A 1GHKA 2BDOA 3A7AB 3AB9A 2BE5C 3VR6A 5BN5A 1T5EA 1Z7TA 3T51B 1ZYRC 1DXMA 2PCFB 2KCCA 5C0XH 3GD7A 2JEAI 4G7OC 3H94A 1H9RA 1V8QA 4KKUA 3IFTA 2L5TA 1A6XA 2NN6G 3ND9A 5A35A 1OXSC 1VDZA 2F1MA 5KNCA 3CRKC 1H9SB 1LABA 3P20A 1E2WA 1OXVA 1GUNA 1V43A 3A7LA 1Q90A 4GZYC 1K8MA 4H13C 1GHJA 2K32A 3BG3A 1DCZA
chains in the Genus database with same CATH superfamily
3KF6A 3U9SA 1KL9A 5LMNL 3MTSA 1NR2A 2QCPX 1CA5A 1WCMH 5KGUA 2CH4A 4KV6A 4PMCA 1TT2A 3H15A 4Q5VA 3G6EA 3JAMc 2XRSD 1HCZA 4N8FA 1X65A 2NVXB 1S4ZA 1V1OA 2EY1A 1WTHA 4H0LC 5JEAG 4LF9L 1NNXA 3TDQA 1GJXA 5J22A 3CC2A 1S5CD 4GKKL 4GKJL 3T53B 5FKAC 4A3MG 4QMGA 3CCVA 1TWHH 1PZJD 4CGYB 5G3LD 2NN6H 2Z1CA 4KD3A 4AYBG 5EQ0A 2Z9HA 5FO9B 4POGA 2DNEA 4HJ7A 2F52A 3RN2A 4B3TQ 1UAPA 3I91A 5C4ZA 1Q12A 2RKSA 1VQKA 2NBFA 3OYYA 3SEBA 3M4QA 3KBGA 2PNRC 3K5LA 2HHHL 5G3LF 5JPNC 4X62Q 1YJWA 4A3DB 4JPBW 1XPRA 2WAQB 5CV6A 3CP0A 1TS5A 2KEEA 3EIVA 1SXTA 4NXNL 3OMCA 1SEBD 5E3FA 3DXJC 3WOEA 2K14A 3OW2A 2KCNA 4BA2I 1IBMQ 5IP9H 1WTRA 4DNTB 2EYFA 2UUAQ 1SYFA 1RD9D 3SE0A 4K6DA 1SMYD 3J7A5 1X3EA 5I9OA 3H09A 2OEOA 2ENBA 1UE7A 3ERSX 5D14A 4L8JA 1NUCA 4BXXG 4OWXB 2ZXRA 4UY8C 1HJPA 4IUQA 5T1GA 2WV6D 2Q8RE 4F87A 4HJAA 1AE3A 4FXGC 1K8GA 2C35B 4RKBA 1VF7A 1UNSA 5EBDA 2NTSA 4A3LH 3PO2B 3FHWA 4I65A 1AFPA 1XNQL 3KDFA 2RF4A 1PVOA 2JA6B 3MAQA 4A3CH 5GAGC 1G6ZA 3WWVA 4LF5L 1EY0A 4GOPB 5IP9G 4IUTA 4JI0Q 2WP8J 2I07B 5I9PA 1P8LA 2EYJA 3NEMA 1H9SA 4BBRB 2F0SA 4JI1Q 1IW7D 2EXDA 4BY1B 4XQQA 1XNRQ 1SROA 4A3IG 4DV0Q 2F0UA 2C5CA 3S17H 3MXPA 4R4TA 4CKCA 4DNIA 1F9PA 2PMZE 2PW5A 4RGOS 3URYA 5AJ3L 1I50H 2RHQB 1ET9A 2Q8TA 1FJGL 1J5EL 1JWSD 4QUCA 3OMGA 3K6OA 1SNOA 5ELCA 4JBKA 2B39A 2IL8A 3PIOA 5KYIA 5M3MG 1GUWA 3PIO3 1I3QH 4C2MH 2R92G 1QVFA 1B9MA 1CFMA 1ZKOA 1LTID 4MIUA 4R9WA 4HEDA 2F4VQ 3UDXA 4P73A 3GTPH 1TS2A 2ZJQA 1YEZA 5GAHC 5JJKA 3PF5A 4C3HB 4CJ0B 2WACA 3TZDA 3CCUA 1STGA 1TU2B 3SXHA 4X6AH 2HCCA 5JJZA 2EYOA 2MPMA 2VQEQ 4JG2A 1ESFA 2Y0SE 2UXDQ 4P2CB 5EPLA 4ZLTF 4YY3Q 4EQNA 4DR1Q 1HQMC 2CH4W 3U50C 4X3TA 2ALYB 2EJMA 1EQQA 4DAYA 1KNAA 1HNZQ 2ZTEA 4O42A 1Y14B 4DR5Q 3VR3A 3KLRA 2VUMB 3MFYA 1HH2P 1HFGA 1HNXQ 1TS3A 1HA6A 3CF5A 2KHIA 3M4PA 4BS9A 2HUGA 3T13A 4FF3A 1STAA 2QKIC 4OIJA 3RMHA 3K0XA 1Q8IA 1B70B 4A3JG 1KRTA 3I4OA 3P1HA 1FL0A 2NWGA 1ASYA 4DV6L 5CV4A 2RBMA 1EZ8A 4KHPL 2AQ1B 2GN5A 3KF6B 3GV6A 4JI5Q 4RH6A 4FP5D 1JWUD 2IJ0A 4DAMA 3NQIA 1DCZA 2RSOA 2WKDA 1V1PA 2AKWB 4YHHQ 4IUNA 1Z6HA 3W1GA 4IFDG 3Q8DA 2LY7A 2PPBC 2WB1E 2G9DA 3CCRA 5M5WB 1A15A 2AUJD 5COYA 4G57A 2MUYA 2EPBA 1TWFH 1YITA 4UP9A 4OIKA 5ELBA 1EY8A 3BVMA 4JI8L 1UWVA 2KOLA 2LXKA 3R3OA 1S5FD 1YJNA 4K8IA 2UU9L 4DV1Q 3MA2B 1PRTD 3HG9A 1YNND 4YIJA 2CQAA 4UP8A 2CFMA 3BZCA 4P71A 3MC0B 2SEBD 1IKLA 2O5IC 1D5MC 1STEA 3AU7A 1Y1VG 1TS4A 1T9HA 2K05A 5IT9c 3AMUA 4F7XA 1PRTF 1GOZA 1Q8KA 4RCNA 1DYQA 4B3MQ 2KA7A 1XWEA 2Q2UA 1B4OA 3HOZG 3TREA 2XWJB 2TMPA 1VQBA 1R9TH 1JE4A 4TQUS 1C48A 4S3SA 4DV7Q 3CCLA 3HOUH 3GTMB 1M90C 3J80i 4B3TL 1PZID 4DGZA 3J81L 1I50B 2IHEA 3GTLB 5FO7B 1KRSA 1XPOA 1Y1WG 3S1NH 3VR4A 3ICEA 1B7YB 1AW7A 4IO9A 1RJTA 5DNFA 3N6RA 1CM9A 1EQTA 2OQ0A 3T1YL 1JT8A 2SOBA 4UHVA 2L12A 4FXKC 1I3QB 3UDFA 4ZUIA 3MFGA 4IUPA 3DM3A 1CI3M 2D9UA 2RDFA 4YWMA 3RD4A 4IZ8A 1N32Q 3NP8A 3M4OB 3CAMA 3FPPA 5C3WA 1IBML 2KBNA 3IKJA 1PH6A 2K04A 2VB2X 3RZDH 1LTGD 3KLSA 2UUAL 1SYBA 1LT6D 3KDFB 3U4ZA 2B63G 4LF4L 2PMZB 5E4WC 2IX3A 4CDFC 1VQMA 4GS3A 3P75A 4JV5Q 3F8TA 3UDIA 1BUVT 1CKNA 1BOSA 1H9SB 2QA4A 4JCVE 4NPSA 1N33Q 3OIPA 1GHJA 4DR3Q 4DN4M 2R93H 1TQOA 2NVTB 4EQPA 2R7ZB 3C1EA 4AIMA 4KTAA 4A3GG 3J7ZC 5IOCA 2QEJC 2Z4HA 3P7JA 3X3NA 1N34Q 1HHVA 3CKIB 4IALA 4A3KB 1DJRD 3TMEA 1K8OA 3EVQA 5ELEA 5LMNQ 5IGFA 5I6YA 5LHY1 4JI4Q 1JOQA 1CHPD 2D5DA 5BN4A 5J3BA 1PTOD 2BH2A 4X64L 4J6HA 2CVRA 5M3FB 4JI0L 4ZYSA 3EJIA 4O2DA 1VCIA 3NTKA 2VW9A 4LF9Q 4ULLA 2BCOA 2Y0SB 1IYUA 5C44B 1FR3A 4GKKQ 4GKJQ 2B2TA 2MHVA 3F2BA 4OX9L 1F9RA 1PTOF 1CA6A 3PV0A 5F2DA 1XNRL 1EY4A 1H95A 4QCLA 1L1OA 4A3BG 4JVZA 3CMEA 2R93G 1UE5A 5H1SE 3FKIG 4R4CA 4A3FB 2HHHQ 3I4NG 1QJOA 1QWYA 4LF8L 1F2ZA 1TWGB 2JA8H 3UE1A 2XGTA 3SK5A 2O4XA 4KMUC 1CZGA 4NXNQ 2FMMA 2LMCB 3D31A 4DAYB 3CC7A 4A93G 3HEJA 3MEHA 3QB3A 3QOLA 1N9WA 1BCPC 3VYSA 2EDGA 4QUFA 3IL8A 3I8ZA 3C46A 2I46A 3V96A 2VL6A 3K8AA 1EIGA 4DV4L 5CMDA 1EY5A 4IOAA 2PNHA 4ZKCB 2EYPA 4Y52H 1YNXA 3K80C 1VQEA 2G9HD 1VQIA 2WB1B 1I4RA 1OXUA 3I4LA 2R61A 3SDZA 4C3IG 2F0PA 5CV5A 1ZYRD 4BBSH 2BDOA 2B2UC 5LMUL 1S5ED 4DA2A 1T5EA 1PV4A 3AEVA 1Z7TA 3HOUB 4YCWA 3S14B 5IP7H 1LTTD 1PZKD 1X6OA 2NZHA 2JA8G 4JI2L 1GO3E 1XMOL 1PRTB 4CHTB 2L4NA 5EPJA 2AMCB 4Q0FA 1VQPA 4HJ5A 1TIID 4V0BA 1V1PB 1HNXL 1Q90A 1BBXC 1JMCA 1AN8A 1BQQT 2NVXH 3G71A 2L55A 1EZ6A 2VY3A 4HSPA 2UUBL 1XTDA 3GDEA 2EIFA 5C0XI 3M3YB 4B9WA 1GM5A 3Q6SA 1FYCA 4KN7C 3S15B 3I72A 3D4DA 2H5XA 3HOYG 4MZ9A 1YJ9A 1B50A 2IT1A 3KLSX 3SGIA 2C9OA 4RWSC 5C3EH 2UXBL 5AJ3Q 4BWGB 4C3JB 3HOXG 2JN4A 2OWOA 4GN5A 5DEHA 4DV5Q 4G7HC 1FJGQ 1PH5A 4A3DH 1JWMD 4PV1C 4XQJA 2HIXA 5IWAL 1K8AC 3I4MH 3STBD 1L0YB 3R2IA 1A3TA 2A8VA 1FVIA 1KABA 2PQAA 3D3RA 3ND8A 5AFWA 2AWOA 1EWCA 4BA1I 2UUCQ 4DR2L 1U4RA 4LW1A 2CKZB 2K52A 1WFQA 1JB3A 1JC7A 1QUQA 3J7AF 3CCEA 4KJNA 5CV9A 3JAMi 2B29A 1B9NA 4ZRZA 5K5PA 4J15A 4B3ML 3QG1A 1J6QA 1IKMA 3BS1A 3U4VA 2OCEA 4A3EB 2K6AA 1CTMA 3K5NA 1SYCA 4OO1G 4HSVA 3BYTB 1FGBD 1QNKA 1D1KA 2K4KA 3H0GB 1EY6A 5GROA 1PTOB 1QZGA 1FGUA 3NQTA 2JA6H 1CKNB 3CCJA 4A75A 4JBJA 2D0PA 2GVBA 3HP3A 4X3SA 4U673 4KK7A 1IBLL 4DK3C 2F0QA 2L5TA 3QR8A 5DAUA 1OXSC 5KNCA 1PH1A 4DV6Q 4BBRH 1SN8A 1PA6A 2EY2A 4GZYC 4KHPQ 3CHBD 4LUVA 1WTOA 1QOHA 4DR7Q 1TWAB 2EZVA 4BY1H 1NCVA 1VQFA 4FO2A 4HJ8A 3K58A 1K9MC 3E0JA 2IY5B 4WJ3M 5E4XA 4JV5L 5C0XJ 4LWCA 4MTKA 1BDOA 4LUZA 4PZ7A 5ELDA 2MQHA 3RZOB 2Q8IB 2KHJA 3CCQA 2PZWA 4BBSB 2X69A 1Y69U 3FRPB 3PO2G 4DR3L 4LFBQ 2A69D 2A6HC 3E3XA 3NTIA 1GUSA 5JVG3 3U9OA 4LJZC 4JI8Q 1N34L 3B6YA 2E8GA 2JA5G 1L1OB 1DOMA 2UU9Q 2HQLA 3LX0A 4EX5A 2F0EA 1STNA 4JI4L 4ABNA 4F8MA 4JYAL 1QE6A 5IYDG 4BBRG 4LAAA 4ZUJA 2ZJRA 4ILWA 1H9KA 4NW2A 2CW0C 5EKLA 3UI2A 1G8ZD 4C3HH 2DUDA 1DM0B 1AP0A 4XT1B 1PLFA 3IAYA 5C5MA 3S1QH 2B8FA 1QVGA 5HGTA 1L2FA 5IGCA 1II3A 1SNMA 2I5LX 4NDXA 1KTKA 5IIFA 1X3QA 2F0NA 3WDNA 2KEDA 1I4PA 3PF4A 2K01A 1D5XC 5C3EB 1SNPA 4FDBA 1WYDA 4KD4A 2ZXOA 4F88A 3VDYA 3CRLC 1QCBD 1NTGA 2VUMH 1ENFA 3T1YQ 5T1IA 2KHSA 3I4MB 2RDHA 1WCMG 1LTBD 3M7GA 3NE5B 4N9PA 3S16B 3BDOA 4K5VA 4EVOA 3EBEA 2HD3A 1FD7D 3T56B 1GUTA 4C3HG 1SFOB 1DD2A 3C1FA 3AB9A 4CKBA 2R7FA 5JJIA 1E3PA 3NSWA 3T51B 4JBMA 1V8QA 3D0FA 3F2DA 4LF4Q 2Z6KA 4DAVA 1SLJA 3NXWA 5FLMH 1WTPA 2NN6G 1PXUA 4IUUA 1RHPA 3A74A 1I6HB 3RR5A 3T16A 3CCSA 3BG3A 1HZ9A 3R8BA 2K28A 2NB0A 3DMUA 5M5WH 3TBIB 5C4XB 4JOIA 2PI2A 5A2QL 1ILQA 1G291 3PUXA 1AE2A 2F3WA 3UE0A 1F77A 1VQJA 4HJ9A 1LUZA 1GD7A 2MO1A 3NELA 2F3VA 1PYSB 5FK9C 5L37A 4X64Q 1FNVA 3OHXC 5KRUA 2D2CC 3J81c 1A3UA 4PNYA 1U4MA 3S1RB 1GUOA 4LNQA 4LF6L 3DWAA 3Q24A 1BKBA 5FLMG 2A74C 2PI2E 2PQAB 4OX9Q 3S2DB 1JE5A 4MN3A 1L1OC 1NE3A 1SRUA 2A19A 5CORA 3GTOB 3GTMH 3H3VC 1HR0L 5CC4A 3HKSA 3MWYW 1X32A 3I55A 3GTLH 3TS0A 2MO0A 1A2TA 3I73A 1N8RC 1TXYA 1QUQB 4DV5L 2K1BA 4LF8Q 3BU2A 4A3LG 2AWNA 3DM1A 4PMBA 3H91A 3ER0A 3HKZE 2JXMB 2PO4A 1F2MA 4A3CG 3KJOA 2ATWA 4JC0A 1CQVA 2QILA 5DM73 4EQ5A 5IGEA 1ONLA 2UUCL 3M4OH 4CJ1B 2NUCA 5JEAJ 4L6TB 4DNRB 1Z9FA 4GN3B 5IGGA 1SE3A 1NAPA 1NJIC 2QW7A 3HGBA 4OL7A 5K36H 2IW3A 4FXDA 2EVBA 3GTJH 2EJFC 4DV4Q 3BDCA 3KYHC 3S1QB 2J4XA 3RUZA 1KXLA 3K7AB 4RGMA 1AEXA 3FVQA 2YTXA 1K3BC 5ELNA 5LMUQ 3MXNA 4NP5A 3G48A 2NVTH 1VDZA 2NVYH 2R7ZH 4JI2Q 1M8AA 1XMOQ 1E2WA 3G7LA 1EL0A 1G91A 4JI3Q 4A3KH 1XTCD 1EEFD 3A8IE 1RF2D 3DWPA 3A0JA 3I2ZA 5CYUA 2Z6BA 5M3FH 2YTYA 1ML0D 2F03A 2UUBQ 3ITPA 1CHQD 1U4LA 1SYEA 4IPDA 3OSOA 1I4XA 3I70A 4TRDA 4IUVA 5C44H 1PH3A 4DR7L 3EA6A 4ZK9B 1UEBA 3GQBA 4DV3L 2UXBQ 1JOOA 1EIHA 4DUYQ 2LKVA 3VR5A 4A3FH 1JORA 3KOJA 1QVCA 1SBBB 1IHZA 1BNZA 1JCKB 4GOPC 1TWGH 1NR4A 5IWAQ 2F0MA 5KEEA 2CWAA 1MHWC 4AQYQ 1IBKL 4LFBL 3O13A 2B2WC 1I94Q 2V4DA 3G6JB 1ASZA 3A5ZB 2A6ED 2F3IA 1U0LA 3T4AC 5BR8L 1MI2A 1HTLD 1YHBA 1BF4A 2JSOA 4A3IB 1Y8OB 3TEHB 4DR2Q 2D0OA 5GQOA 2P5ZX 2RCFA 2K5QA 3K7UC 4DV2L 2Y0SG 3AQQA 1O78A 5C5LA 3BVZA 2SNSA 5FOBB 5C44G 4IFDI 3J80E 4Y7NH 4DR4L 5C3XA 2JE6I 3PMFA 1Q86C 2YU9B 4NXML 4G7ZC 3DWQA 2PYKA 3K59A 4JK1C 3CU7A 2G5DA 3MHBA 2F4IA 3EFXD 1PH8A 5FLXE 2R92B 3RN5A 3OWFA 1QZHA 4EGVA 3S14H 3A8JE 2IX0A 4R1JA 3RNUA 4X3UA 3BZDB 3HOVB 1MJCA 2F0IA 1IYJB 1DXMA 3A56A 4MHEA 1H9RA 4KKUA 3W1BA 4JI6L 1ILPA 1LTRD 3Q22A 4I7AA 4PG3A 4U68A 1IBLQ 3ONAB 5LL6X 1DOKA 1D1IA 1K8MA 2F0JA 1JJGA 4NKLA 5JPMC 3J7AV 3M3YH 4X66L 1C0AA 2BA0A 3S15H 4UDUC 1HNWL 3M9BA 1X55A 3E5SA 2F0WA 4K5WA 4LF7Q 1XMQL 3SK4A 4FNFA 1I4GA 3GTJB 3ZYYX 5IODA 2RQXA 1G6PA 2AUKA 4O1NA 4YWKA 4H02A 4B3RL 4Z9CB 4FYDA 2FXQA 1NMFA 4C3JH 3HOUG 1Y8PB 5JOBA 2JJQA 1RKNA 3CQZB 3HKZB 3VYRA 1JJCB 1M1KC 2NZOA 5E7NA 2B2VA 1I4HA 1PFBA 2NVYB 4DK1A 2IWHA 3GTKB 2F0LA 1MBYA 1SJED 5ISRA 1XYIA 3R93A 1PH7A 2JA7H 3KF8A 5EBCA 5C4JB 3NUCA 1EQRA 1SNCA 2KQ3A 2QF7A 4JYAQ 1DGSA 1K83H 4DPGA 3PUZA 1Q1EA 1VQ4A 1VMCA 3ULJA 5DLQE 1MKHA 4M1UB 4XTCS 5IYBH 5ELFA 4HCEA 1IXRA 1O7YA 1EEID 2LFNA 1E2VA 5JAVA 2BH8A 1Q81C 4R8IA 1U5KA 2EJGC 3FEWX 2UXCQ 4CDDC 5EPKA 1UEAB 2PZUA 2XN9C 4DAPA 2EQSA 2L15A 4RHSA 4E6IA 4OWTB 4A3EH 1W6JA 1OO9B 4IFDJ 1OXXK 4LK1C 2XSCA 2XVSA 2A5HA 2DJFC 1HTPA 1LYLA 1D6EC 5A2QE 1SMYC 3H0GH 1SNDA 1C8CA 1PTOH 3L3OC 3S9WA 3QJYA 1TKWB 1LTSD 4YCUA 1YIJA 3A55A 3NBIA 1Y1VB 1HUNA 4CJ2C 1KDCA 5D3IB 1XXGA 3MXNB 2CQOA 5BN5A 3HOZB 2I5HA 3L9AX 4G7OC 5C0XH 1GXDC 4X65L 3IFTA 4HTHA 4UPAA 1CT1D 1TWAH 3ND9A 4V190 3CRKC 3D8GA 2OQKA 5IYCH 1OXVA 2Z6KC 1VQ5A 3RLNA 4Y7NB 1Y1WB 2DY7A 2K32A 4C1NK 1SAPA 4A3EG 1WTQA 3QO2A 3RZOH 3LWUA 3HOWH 1AZPA 3PO3H 1WD0A 3H0GG 2FMCA 1Q1BA 1IW7C 3UDGA 2ZM6L 1P16A 4OONA 1TVXA 5GADC 1SE4A 4ODGA 1B53A 3E6ZX 5KYLA 4JI3L 1HZCA 3H3VH 2VNUD 4QIWE 1UE1A 1B1ZA 1EU4A 2B63B 3KUPA 4OHJA 1PHJA 1LTAD 4DUZL 5EKIA 1W3SA 4N8X1 2R6GA 3J7YW 2A68D 1JICA 1SJHD 1HPCA 3DLLA 4LF6Q 1E7ZA 1E24A 2E75C 4K6LA 2KENA 2NTTA 3K81C 2K03A 5CBEE 2HT1A 3GV3A 5IT9L 1H9MA 4RA8A 3LNNA 1LM0A 3ZJYC 5HURA 3C3LA 2EXZA 1BBWA 2ZXPA 3GP7A 4BBSG 1HR0Q 3LGJA 4DUYL 2E2JB 2DN8A 5C4HA 4RHRA 1ENAA 5IP7G 3L7ZC 1B8AA 4TSSA 5IE8A 3TP5A 4AQYL 2TSSA 3GTGH 1I94L 4QB4A 4WFN3 2ICEC 2V1CC 2JA7B 1S3OA 4L63B 4DF7A 5CV7A 2HCIA 2M9VA 5I6WA 3S16H 4CKEA 3JAME 1EFID 4WORA 1SFOH 4X3KA 3SK8A 2MNAA 1F2LA 2O5JC 4CBVA 3EROA 1K83B 2A1AA 4A3BB 1EFWA 2J0TD 3TN2A 3PUVA 4KHZA 1U4PA 1S72A 3NPPA 3FKIB 4R8NA 2N49A 4B08A 4OEMB 3Q0AA 2PQEA 1RDPD 3F2UA 1T5XD 1I6HH 4KY6A 3T1HL 4FF1A 1WJJA 4BY7B 1A6XA 5C3EG 3TRZA 4OXPA 3P20A 4DFAA 4J1MA 5C4XH 4DR6Q 1YI2A 3PSIA 4A3DG 1VS0A 4DKAC 1PH4A 4A93B 2WAQG 2I5MX 3I4MG 2X6LA 1MGSA 1JQYD 1KDBA 1A2UA 3VA7A 4O0AA 1TY2A 3M85A 2RHSB 3GTQH 4LFCL 2XRQD 3S1MB 2EY6A 4H7BA 4RG1A 4XT3B 3S1RH 4RAUC 4C3IB 3OW7A 1QNUA 1H9JA 2A6EC 1IYVA 4AYBE 3KF8B 4OO1I 4LF7L 2MFIA 3S2DH 3J80L 2E2IB 2WIIB 1WTWA 1N36Q 1PRTC 3GTOH 1YNNC 5I4DA 2X6GA 1YHQA 4XXEA 1HR0W 5EKKA 4DV3Q 2N3SA 3CCMA 2JK8A 3TP7A 3HOWB 2NZ1D 5FLXL 2ES2A 3IFDA 3PO3B 1DOLA 4ZAIA 1VQLA 1PMRA 4A76A 1IBKQ 1YVCA 5JEAH 2F0DA 5TSSA 2JA6G 1G51A 4HIOA 2FFKB 4IJHA 5LL6S 5BR8Q 4B3SL 3NBHA 4ME3A 1O7LA 1LACA 4KY5A 1GUGA 2E2DC 4H44C 3CMAA 5NUCA 1VQ9A 4IPGA 1LO5D 1MD2D 2WKCA 3F2CA 4DV2Q 1SNQA 3PUYA 1MSHA 4HAEA 4CDCC 4ZKBB 2VS1A 3AFPA 4RCOA 4BY1G 3KLWA 4DR4Q 4B9XA 2UXCL 1A63A 1TWCH 4NXMQ 1EYDA 3K7AH 1XX8A 2IX1A 3J81i 2NYZD 3EQLC 2E74C 3KFUA 4WJWA 3RLFA 4QGUA 1I5FA 1EQVA 1S40A 1VQNA 4WRDA 1M4VA 1SMXA 4IJLA 5ELOA 2JEAI 3GD7A 2KJXA 4QIWB 1ET6A 1S5DD 1B3AA 4RFBA 1VMPA 1X56A 1JR0D 2JYOA 4JI6Q 2K5WA 4IN3A 5E1FA 1GUNA 3GTGB 5C6AA 1SE8A 3I90A 1EYAA 1JJ2A 2BE5D 4A4IA 4BXXH 2R3ZA 4X66Q 3M7NA 4EQOA 1VQ7A 1HNWQ 1PH2A 4HMIA 4FF4A 1NSNS 1XMQQ 2NVQH 2JEBI 3FPUB 3W3AA 1I4QA 2DGYA 4APVA 4WJ4A 1TR5A 1TY0A 1IL2A 1PTOC 4B3RQ 4L5RC 3R2TA 1NBWA 4MNOA 3A5UA 1Q82C 1VF5C 2H1EA 1OXTA 4JI7Q 3ULLA 2K5HA 1EY9A 1I6VC 1Y8NB 2B2VC 2XIWA 4QY7A 2KVMA 2VUMG 1Q3LA 4IURA 3TP6A 1HFNA 2LXJA 4GNXA 4K8JA 4IOCA 5M9OA 2WFWA 2QEXA 4A3IH 2NN6I 1E0BA 3W5OA 3GTQB 2B2UA 4HIKA 2K33A 2BOSA 1PDQA 2YU9H 2HDMA 2L1BA 2HDLA 3D6CA 2B2TC 4C1NI 1BCPD 1X3FA 4IPHA 5M3MH 4RKLA 3NWSA 3NK9A 3LWEA 2JA5B 2O2LD 2KUMA 2R92H 2N78A 1IZ6A 1BCPF 1MIUA 2E2HB 1PYWD 2E76C 2OF1A 3HOVH 1RIPA 1KNEA 5D3DA 2ICIA 2CCZA 2JQOA 3PCOB 2WINB 1ZYRC 3AYHB 3CPWA 1YZ6A 4A3MB 5M5YB 1K0RA 4AYBB 3OTOL 1SYDA 1SR3A 4X65Q 3NHHA 2VXWA 4M8AA 3U58A 3VYTA 4CDEC 5M5XB 4DK6C 1KDAA 4HN7A 1WTVA 4OGQC 1BO0A 3ULPA 5IT9E 2Z4IA 1G2SA 2BDNA 1R4QB 1EIYB 2E5LL 1E2ZA 3HFZB 1TWCB 1WVLA 2A68C 1WCMB 2B2YA 2PW7A 2F0GA 3CQZH 4HR7B 5KNBA 4A3JH 4QL5A 3HS0C 3CD6A 1ENCA 3HOVG 2ZM6Q 4DR6L 4DK0A 1RODA 3HRZC 3GTKH 1X9NA 1HRJA 1ESRA 1KQSA 3D4RA 4K0KL 4GLVB 1EUJA 5C4JH 2SDFA 2H4OA 2K5NA 1D2BA 4J8QA 2OTJA 3TS2A 2Q2IA 2MP1A 2N55A 1TWHB 3OIQA 4L5SA 4DUZQ 3HZXA 5BN3A 1WI5A 3JAML 3F1ZA 1HZBA 4HIMA 4IFDH 3H6MA 5K36G 1Q7YC 3BZKA 3STBC 1RL2A 1GVPA 1STHA 3NBHB 5KNDA 2OXPA 2Z8LA 1HXYD 4KI0A 2NVQB 4JW0A 1PH9A 4KLKA 2EE1A 4XYQA 4DXFA 5IGBA 1N36L 1YNJD 3HKZG 3I3CA 1RTOA 3SR1A 4ZCKA 2R7ZG 2F0FA 2JA9A 2RVLA 3E9IA 1Q46A 1LT4D 1EY7A 4UAIA 4A3KG 4R4OA 4LFAQ 4FVMA 5IGDA 3N52A 1W2BA 1BXTA 1SSOA 1PFSA 2K75A 1Y1VH 2VQFL 2I0QA 3S24A 5JVH3 3PQIA 3HOZH 2DY8A 3PGZA 5M3FG 3AFQA 3DEOA 4XIGS 1CUKA 2EYMA 1NMGA 1DZ1A 1CKOA 3BVGA 3GO5A 1VQ6A 1E22A 4G4KA 4KJOA 2Q2TA 4HIDA 1XPUA 1X3PA 1Y1WH 2R7DA 4GN4B 1EIFA 5A35A 3T1HQ 5CGKA 5HY6A 5M3MB 4PZ8A 5EAYA 1E1TA 5IY0A 4ID6A 4LMQD 4A3FG 1S5BD 4JBWA 5JJLA 3RLOA 2N8NA 1V9PA 2AQ2B 4POFA 3MEFA 2L0CA 4MTNA 2KCTA 2D62A 1KLUD 4K5XA 2B63H 1C9OA 2A6HD 1B44D 2L9HA 4RMFA 1UUPA 1C4QA 1F9QA 3S17B 4LFCQ 1NY4A 4PMWA 1UE6A 1AZQA 3PIPA 1VQCA 1BCPB 2LS01 2A69C 1HA5A 3PIP3 5J39A 3TQYA 4GNXB 3IRBA 1EU3A 2PZTA 1K28A 2CW0D 1CKMA 4XYOA 4X62L 3NENA 3E0EA 4KY7A 4A3GH 5CR3A 2F0HA 2WB1G 5FO8B 3E9HA 4C2MB 5I2YA 2KCMA 2XWBB 1KC8C 2ZTCA 1KHIA 1KAAA 3BJUA 3TP8A 2E2JH 1D5ZC 1O80A 3FDTA 4JI7L 1L0WA 3GTPB 1X54A 3TSSA 3TZUA 5DM63 4A3JB 1J9OA 1G2TA 1LT3D 2EOTA 1AH9A 1YHAA 4QJFA 3CC4A 5EGTA 2MJ8A 3OPOA 2Z0SA 1KIXA 5CV8A 3FMCA 4B3SQ 1EWHA 4R4QA 3ERQA 1C7YA 3FP9A 2YYZA 2HQEA 4AH6A 1O7IA 4A3BH 4P74A 1VQGA 4FF2A 4QQBX 4KHVA 3FKIH 1KLGD 2ZTDA 3I4NH 2JP1A 4K2KA 1HZAA 4C56C 1STBA 5CBAE 1EYCA 3A7AB 4BY7H 2BE5C 1B3QA 1HUMA 2AHOB 2RDGA 4C3JG 3DEPA 3KJPA 1R4PB 4XQNA 2RA4A 4NB3A 3SVMA 4P72A 1LT5D 1CSPA 4A93H 4N9TA 1A0IA 2IHFA 4ME5A 2YV5A 4RGNA 2OTLA 1CQFA 2JA7G 3J80c 1CK1A 1VQHA 4H13C 1GKHA 1A8VA 3OOCA 4JI1L 2SNMA 2KECA 1FNWA 1EOTA 1SE2A 1CSQA 4L5QA 4DV0L 2ZT9C 1EWIA 4GLAC 1EYGA 1O7ZA 2B3GA 3S1MH 4GLXA 3NTHA 4HMJA 5FLXc 2B8GA 4K14A 2MGSA 1VQ8A 4C3IH 5IYBG 3QIAA 1PFMA 3S2HH 1IL8A 3QWNA 1K73C 4NMZA 1VQOA 4OELB 3MZ5A 3X3MA 2FHTA 3L0OA 2E2IH 2QDLA 2M2LA 2L11A 4BY7G 1TWFB 3K5OA 2FINB 5FJ8H 3MXGA 1K3RA 2F4VL 4QF4A 1ZXTA 5J1ZA 1QG7A 3A8KE 1W6KA 2XNAC 2EY5A 1OTCA 2A73B 4JOIC 4GNXC 3SK6A 3V05A 3MXUA 3HOYH 3MVVA 2VQEL 2ASBA 2HIVA 2UXDL 4YY3L 4DR1L 5C0XG 3OWEB 2N88A 1LLRD 1R9TB 1J8IA 3KK7A 3K5MA 2RSNA 1JB7A 3HOXH 2ZJPA 1K0SA 4K2LA 1HNZL 5IYCG 4DR5L 4TKOB 3S1NB 4PQXA 1PFNA 5LMNW 5HGQA 1A62A 1XNQQ 3J81j 4L5TA 3JC66 4A3GB 5FJ8G 1F2YA 4PZ6A 3HOWG 2CHBD 2F0VA 1B2TA 4LF5Q 3G4SA 3PO3G 2WAQE 1QILA 2F0KA 1WOCA 2RCNA 2F0TA 1GHKA 3VA5A 3EN2A 1YBYA 4P75A 1MSGA 3VR6A 1BVSA 2DJGC 2PCFB 3RZDB 4LFAL 1FNUA 2GA4B 3H94A 4JI5L 1F9SA 1Z47A 2QGQA 3VYUA 1KD1C 1BR9A 2ID0A 4XDXA 3I56A 1ICWA 1PYBA 1ZEQX 4YHHL 3OTOQ 1JOKA 1L0XB 4KN4C 1SYGA 1J5EQ 1A3VA 4GOPA 4OO1H 1RCVD 2R93B 2J7ZA 3QOJA 3BYYB 1V1QA 3CXCA 2B2WA 3I4NB 2E5LQ 4ZQ3A 1D7QA 2CWPA 3D6WA 3H3VI 3K0YA 4DV1L 4KKTA 2B2YC 3C2PA 4YWLA 2EYLA 4IQZA 2M00A 1QB5D 2VB3X 4UP7A 2VZAA 4KKSA 4K0KQ 1XJVA 4DXGA 2EYHA 2F0OA 1MJEA 1EOVA 4LUOA 1YNJC 4DU9A 1WTXA 2DNCA 1X3GA 1HQRD 1RTNA 3DHQA 3BDLA 3K57A 2YTVA 4HCSA 3KBXA 2OT2A 3DUZA 2K50A 2K5DA 1WD1A 5I2XA 3VR2A 1SDFA 5KIXA 4DV7L 2LSSA 2Q2HA 4R4IA 3L2PA 3S2HB 2FJ2A 1ICFB 4ALPA 2GVAA 2XTIA 3A54A 4OWWB 3PO2H 1DONA 4I7ZC 2BA1A 2JA8B 3PUWA 1U9RA 2JA5H 4RGTA 3WOFA 1VQDA 3M4YA 1LV9A 1CZWA 1STYA 4IPCA 5C4XG 2K7VA 5IYDH 1VQAA 1LTLA 2E2HH 1N32L 1E1OA 3D4WA 1KAWA 5GAEC 2AQ3B 4YCVA 5D65A 3SHLA 3NWTA 2QDBA 2IPKD 2VQFQ 4A3MH 3Q23A 3HOYB 3I7FA 5M5YH 1BBUA 4TVAB 3CPFA 2KCCA 1D8LA 3J81E 5M5XH 3V2TA 3CW2C 1N33L 2F1MA 3HOXB 5EJWA 2K5VA 1LABA 1V43A 3A7LA 3W2DA
chains in the Genus database with same CATH topology
3U9SA 3MTSA 1NR2A 2QCPX 1CA5A 5KGUA 4KV6A 4PMCA 1TT2A 4Q5VA 2XRSD 1HCZA 2NVXB 1S4ZA 1V1OA 2EY1A 4H0LC 5JEAG 3TDQA 1GJXA 5J22A 1S5CD 3T53B 5FKAC 4QMGA 1PZJD 4CGYB 5G3LD 2NN6H 2Z1CA 4KD3A 5EQ0A 5FO9B 2DNEA 1UAPA 3I91A 5C4ZA 1Q12A 2RKSA 2NBFA 3SEBA 3KBGA 2PNRC 3K5LA 5G3LF 5JPNC 4A3DB 2WAQB 5CV6A 1TS5A 2KEEA 1SXTA 3OMCA 1SEBD 5E3FA 3DXJC 3WOEA 2KCNA 4BA2I 1WTRA 4DNTB 2EYFA 1SYFA 1RD9D 3SE0A 4K6DA 1SMYD 5I9OA 3H09A 2OEOA 2ENBA 5D14A 4L8JA 1NUCA 2ZXRA 4IUQA 5T1GA 2WV6D 2Q8RE 4F87A 4FXGC 4RKBA 1VF7A 1UNSA 5EBDA 2NTSA 3PO2B 4I65A 1AFPA 2JA6B 3MAQA 1G6ZA 1EY0A 4IUTA 2WP8J 2I07B 5I9PA 2EYJA 1H9SA 4BBRB 2F0SA 1IW7D 4BY1B 4XQQA 2F0UA 2C5CA 3MXPA 4CKCA 1F9PA 2PW5A 4RGOS 3URYA 1ET9A 2Q8TA 1JWSD 4QUCA 3OMGA 3K6OA 1SNOA 5ELCA 2B39A 2IL8A 5KYIA 1GUWA 3PIO3 1B9MA 1CFMA 1ZKOA 1LTID 4MIUA 4R9WA 4HEDA 1TS2A 4C3HB 4CJ0B 2WACA 3TZDA 1STGA 1TU2B 3SXHA 2HCCA 5JJZA 2EYOA 2MPMA 1ESFA 4P2CB 5EPLA 4ZLTF 4EQNA 1HQMC 4X3TA 2EJMA 4DAYA 1KNAA 4O42A 3VR3A 3KLRA 2VUMB 3MFYA 1HFGA 1TS3A 1HA6A 4BS9A 2HUGA 3T13A 4FF3A 1STAA 2QKIC 4OIJA 3RMHA 1Q8IA 3P1HA 2NWGA 5CV4A 2RBMA 1EZ8A 2AQ1B 3GV6A 4RH6A 4FP5D 1JWUD 2IJ0A 3NQIA 1DCZA 2RSOA 2WKDA 1V1PA 4IUNA 1Z6HA 4IFDG 2LY7A 2PPBC 2G9DA 5M5WB 1A15A 2AUJD 5COYA 4G57A 2MUYA 2EPBA 4OIKA 5ELBA 1EY8A 3BVMA 2KOLA 3R3OA 1S5FD 4K8IA 3MA2B 1PRTD 3HG9A 1YNND 4YIJA 2CQAA 3MC0B 2SEBD 1IKLA 2O5IC 1D5MC 1STEA 3AU7A 1TS4A 3AMUA 2K05A 4F7XA 1PRTF 1GOZA 4RCNA 1DYQA 2KA7A 1XWEA 1B4OA 2XWJB 2TMPA 1JE4A 4TQUS 1C48A 4S3SA 3GTMB 1PZID 4DGZA 3J81L 1I50B 3GTLB 5FO7B 3VR4A 1AW7A 1RJTA 5DNFA 3N6RA 1CM9A 1EQTA 2SOBA 2L12A 4FXKC 1I3QB 4ZUIA 3MFGA 4IUPA 1CI3M 2D9UA 2RDFA 3RD4A 4IZ8A 3NP8A 3M4OB 5C3WA 3FPPA 3IKJA 2K04A 2VB2X 1LTGD 3KLSA 1SYBA 1LT6D 2PMZB 5E4WC 2IX3A 3P75A 1BUVT 1BOSA 1H9SB 3OIPA 1GHJA 4DN4M 1TQOA 2NVTB 4EQPA 2R7ZB 3C1EA 4KTAA 5IOCA 2QEJC 2Z4HA 3P7JA 3X3NA 1HHVA 3CKIB 4IALA 4A3KB 1DJRD 3TMEA 1K8OA 3EVQA 5ELEA 5IGFA 5I6YA 5LHY1 1JOQA 1CHPD 2D5DA 5BN4A 1PTOD 4J6HA 2CVRA 5M3FB 4ZYSA 3EJIA 1VCIA 3NTKA 4ULLA 2BCOA 2Y0SB 1IYUA 5C44B 1FR3A 2B2TA 2MHVA 1F9RA 1PTOF 1CA6A 3PV0A 5F2DA 1EY4A 4QCLA 4A3FB 1QJOA 1QWYA 1F2ZA 1TWGB 3SK5A 2O4XA 4KMUC 1CZGA 2FMMA 2LMCB 3D31A 3HEJA 3MEHA 3QB3A 3QOLA 1BCPC 3VYSA 2EDGA 4QUFA 3IL8A 3I8ZA 3C46A 2I46A 3V96A 1EIGA 5CMDA 1EY5A 4ZKCB 2EYPA 2G9HD 2WB1B 1I4RA 1OXUA 3I4LA 2R61A 3SDZA 4C3IG 2F0PA 5CV5A 1ZYRD 2BDOA 2B2UC 1S5ED 4DA2A 1T5EA 3HOUB 1Z7TA 3S14B 1LTTD 1PZKD 1PRTB 4CHTB 2L4NA 5EPJA 4Q0FA 1TIID 4V0BA 1V1PB 1Q90A 1BBXC 1AN8A 1BQQT 2L55A 1EZ6A 4HSPA 5C0XI 3M3YB 4B9WA 3Q6SA 1FYCA 4KN7C 3S15B 3I72A 3D4DA 1B50A 2IT1A 3KLSX 2C9OA 4RWSC 4BWGB 4C3JB 4G7HC 5DEHA 1JWMD 4PV1C 4XQJA 1L0YB 3R2IA 1A3TA 1KABA 3D3RA 3ND8A 5AFWA 2AWOA 1EWCA 4BA1I 1U4RA 1JB3A 1JC7A 3J7AF 4KJNA 5CV9A 1B9NA 4ZRZA 5K5PA 3QG1A 1IKMA 3BS1A 4A3EB 2K6AA 1CTMA 3K5NA 1SYCA 4OO1G 4HSVA 3BYTB 1FGBD 1QNKA 1D1KA 3H0GB 1EY6A 1PTOB 3NQTA 3HP3A 4X3SA 4U673 4KK7A 2F0QA 2L5TA 5DAUA 1OXSC 5KNCA 2EY2A 4GZYC 3CHBD 1WTOA 1QOHA 1TWAB 2EZVA 1NCVA 4FO2A 3K58A 3E0JA 5E4XA 5C0XJ 1BDOA 5ELDA 3RZOB 2Q8IB 2PZWA 4BBSB 2X69A 1Y69U 3FRPB 2A69D 2A6HC 3NTIA 1GUSA 5JVG3 3U9OA 4LJZC 1DOMA 3LX0A 2F0EA 1STNA 4ABNA 4F8MA 1QE6A 4LAAA 4ZUJA 4ILWA 1H9KA 4NW2A 2CW0C 5EKLA 3UI2A 1G8ZD 1AP0A 1DM0B 4XT1B 1PLFA 3IAYA 5C5MA 2B8FA 5HGTA 5IGCA 1II3A 1SNMA 4NDXA 1KTKA 5IIFA 1X3QA 2F0NA 3WDNA 2KEDA 1I4PA 2K01A 1D5XC 5C3EB 1SNPA 4KD4A 2ZXOA 4F88A 3CRLC 1QCBD 1ENFA 5T1IA 2KHSA 3I4MB 2RDHA 1LTBD 3M7GA 3NE5B 4N9PA 3S16B 3BDOA 4K5VA 4EVOA 1FD7D 3T56B 1GUTA 4C3HG 1SFOB 1DD2A 3C1FA 3AB9A 4CKBA 3NSWA 3T51B 1V8QA 4DAVA 3NXWA 1WTPA 2NN6G 1PXUA 4IUUA 1RHPA 1I6HB 3T16A 3BG3A 3R8BA 2K28A 2NB0A 3DMUA 3TBIB 5C4XB 5A2QL 1ILQA 1G291 3PUXA 2F3WA 1F77A 2F3VA 5FK9C 1FNVA 3OHXC 5KRUA 2D2CC 1A3UA 4PNYA 1U4MA 3S1RB 1GUOA 3DWAA 3Q24A 2A74C 3S2DB 4MN3A 5CORA 3GTOB 3H3VC 5CC4A 3MWYW 1X32A 1A2TA 3I73A 2K1BA 2AWNA 3DM1A 4PMBA 3H91A 2JXMB 2PO4A 1F2MA 1CQVA 2QILA 5DM73 5IGEA 1ONLA 4CJ1B 2NUCA 5JEAJ 4L6TB 4DNRB 5IGGA 1SE3A 1NAPA 3HGBA 4OL7A 5K36H 2IW3A 4FXDA 2EVBA 2EJFC 3BDCA 3S1QB 2J4XA 3RUZA 3K7AB 4RGMA 1AEXA 3FVQA 3MXNA 4NP5A 1VDZA 1M8AA 1E2WA 3G7LA 1EL0A 1G91A 1XTCD 1EEFD 3A8IE 1RF2D 3DWPA 5CYUA 1ML0D 2F03A 3ITPA 1CHQD 1U4LA 1SYEA 3OSOA 1I4XA 3I70A 4TRDA 4IUVA 3EA6A 4ZK9B 3GQBA 1EIHA 1JOOA 2LKVA 3VR5A 1JORA 1SBBB 1IHZA 1BNZA 1JCKB 1NR4A 2F0MA 5KEEA 3O13A 2B2WC 2V4DA 3G6JB 2A6ED 3T4AC 1MI2A 1HTLD 1BF4A 2JSOA 4A3IB 1Y8OB 2K5QA 5C5LA 1O78A 3BVZA 2SNSA 5FOBB 4IFDI 3J80E 5C3XA 2JE6I 3PMFA 2YU9B 4G7ZC 3DWQA 2PYKA 3K59A 4JK1C 3CU7A 3MHBA 2F4IA 3EFXD 5FLXE 2R92B 3OWFA 4EGVA 3A8JE 2IX0A 4X3UA 3BZDB 3HOVB 2F0IA 1DXMA 3A56A 4MHEA 1H9RA 4KKUA 1ILPA 1LTRD 3Q22A 4U68A 3ONAB 5LL6X 1DOKA 1D1IA 1K8MA 2F0JA 4NKLA 5JPMC 3J7AV 2BA0A 4UDUC 3E5SA 2F0WA 4K5WA 3SK4A 4FNFA 1I4GA 3GTJB 3ZYYX 5IODA 2RQXA 2AUKA 4O1NA 4Z9CB 4FYDA 1Y8PB 5JOBA 1RKNA 3CQZB 3HKZB 3VYRA 2B2VA 1I4HA 1PFBA 2NVYB 4DK1A 2IWHA 3GTKB 2F0LA 1MBYA 1SJED 5ISRA 1XYIA 3R93A 3KF8A 5EBCA 5C4JB 3NUCA 1SNCA 2KQ3A 2QF7A 3PUZA 1Q1EA 1VMCA 4XTCS 4M1UB 5ELFA 4HCEA 1O7YA 1EEID 2LFNA 1E2VA 5JAVA 4R8IA 3FEWX 2EJGC 5EPKA 1UEAB 2PZUA 2XN9C 4DAPA 4RHSA 4E6IA 1W6JA 1OO9B 4IFDJ 1OXXK 4LK1C 2XSCA 2XVSA 2A5HA 1HTPA 1D6EC 5A2QE 1SMYC 1SNDA 1C8CA 1PTOH 3L3OC 3S9WA 3QJYA 1TKWB 1LTSD 3A55A 3NBIA 1Y1VB 1HUNA 4CJ2C 1KDCA 5D3IB 1XXGA 5BN5A 3HOZB 3L9AX 4G7OC 5C0XH 1GXDC 3IFTA 4HTHA 1CT1D 3ND9A 4V190 3CRKC 3D8GA 1OXVA 4Y7NB 1Y1WB 2DY7A 2K32A 4C1NK 1SAPA 1WTQA 3QO2A 3LWUA 1AZPA 1WD0A 2FMCA 1Q1BA 1IW7C 1TVXA 1SE4A 4ODGA 1B53A 3E6ZX 5KYLA 2VNUD 1B1ZA 1EU4A 2B63B 3KUPA 4OHJA 1LTAD 5EKIA 3J7YW 2R6GA 2A68D 1JICA 1SJHD 1HPCA 2E75C 4K6LA 2NTTA 5CBEE 2K03A 3GV3A 5IT9L 1H9MA 4RA8A 3LNNA 5HURA 3C3LA 2EXZA 2ZXPA 3GP7A 2E2JB 2DN8A 5C4HA 4RHRA 1ENAA 3L7ZC 4TSSA 3TP5A 2TSSA 4QB4A 4WFN3 2ICEC 2JA7B 4DF7A 4L63B 5CV7A 2HCIA 2M9VA 5I6WA 4CKEA 3JAME 1EFID 4WORA 4X3KA 3SK8A 2O5JC 1F2LA 4CBVA 3EROA 1K83B 4A3BB 2J0TD 3TN2A 3PUVA 4KHZA 1U4PA 3NPPA 3FKIB 4R8NA 4B08A 3Q0AA 2PQEA 1RDPD 3F2UA 1T5XD 4KY6A 4FF1A 4BY7B 1A6XA 3P20A 4DFAA 4J1MA 4A93B 2X6LA 1MGSA 1JQYD 1KDBA 1A2UA 3VA7A 1TY2A 3M85A 2XRQD 3S1MB 2EY6A 4H7BA 4XT3B 4RAUC 4C3IB 3OW7A 1QNUA 1H9JA 2A6EC 1IYVA 4OO1I 3J80L 2E2IB 2WIIB 1WTWA 1PRTC 1YNNC 5I4DA 2X6GA 4XXEA 5EKKA 3TP7A 3HOWB 2NZ1D 5FLXL 3IFDA 3PO3B 1DOLA 4ZAIA 1PMRA 5JEAH 2F0DA 5TSSA 2FFKB 5LL6S 3NBHA 1O7LA 1LACA 4KY5A 1GUGA 2E2DC 4H44C 5NUCA 1LO5D 1MD2D 2WKCA 1SNQA 3PUYA 1MSHA 4HAEA 4ZKBB 4RCOA 4B9XA 1EYDA 1XX8A 2IX1A 2NYZD 3EQLC 2E74C 4WJWA 3RLFA 1EQVA 4WRDA 1M4VA 2JEAI 3GD7A 2KJXA 4QIWB 1ET6A 1S5DD 1B3AA 4RFBA 1VMPA 2JYOA 1JR0D 2K5WA 4IN3A 5E1FA 1GUNA 3GTGB 5C6AA 3I90A 1EYAA 2BE5D 2R3ZA 3M7NA 4EQOA 4HMIA 4FF4A 1NSNS 2JEBI 3FPUB 3W3AA 1I4QA 1TR5A 1TY0A 1PTOC 3R2TA 1VF5C 2H1EA 1OXTA 1EY9A 1I6VC 1Y8NB 2B2VC 2XIWA 2KVMA 1Q3LA 4IURA 3TP6A 1HFNA 4K8JA 5M9OA 2NN6I 1E0BA 3GTQB 2B2UA 2K33A 2BOSA 1PDQA 2HDMA 2L1BA 2HDLA 3D6CA 2B2TC 4C1NI 1BCPD 4RKLA 3NWSA 3NK9A 3LWEA 2JA5B 2O2LD 2KUMA 1BCPF 2E2HB 1PYWD 2E76C 2OF1A 1KNEA 5D3DA 2ICIA 2WINB 1ZYRC 4A3MB 5M5YB 4AYBB 1SYDA 3NHHA 2VXWA 4M8AA 3VYTA 5M5XB 1KDAA 4HN7A 1WTVA 4OGQC 1BO0A 5IT9E 2Z4IA 1G2SA 2BDNA 1R4QB 1E2ZA 1WVLA 1TWCB 2A68C 1WCMB 2B2YA 2PW7A 2F0GA 4HR7B 5KNBA 3HS0C 1ENCA 4DK0A 1RODA 3HRZC 1HRJA 1ESRA 3D4RA 2SDFA 2H4OA 1D2BA 4J8QA 2MP1A 2N55A 1TWHB 3OIQA 3HZXA 5BN3A 3JAML 4IFDH 3H6MA 5K36G 1STHA 5KNDA 2OXPA 2Z8LA 1HXYD 4KI0A 2NVQB 4DXFA 2EE1A 4XYQA 5IGBA 1YNJD 3I3CA 1RTOA 3SR1A 2F0FA 2RVLA 1LT4D 1EY7A 4UAIA 5IGDA 4FVMA 3N52A 1BXTA 1SSOA 5JVH3 2DY8A 4XIGS 3DEOA 2EYMA 1DZ1A 3BVGA 3GO5A 4KJOA 4G4KA 1X3PA 5A35A 5CGKA 5M3MB 4ID6A 4LMQD 1S5BD 4JBWA 2AQ2B 2L0CA 2D62A 1KLUD 4K5XA 2A6HD 1B44D 2L9HA 1UUPA 1C4QA 1F9QA 3S17B 4PMWA 1AZQA 1BCPB 2LS01 2A69C 1HA5A 3PIP3 5J39A 1EU3A 2PZTA 2CW0D 4XYOA 4KY7A 5CR3A 2F0HA 5FO8B 4C2MB 5I2YA 2XWBB 1KAAA 3TP8A 1D5ZC 1O80A 3FDTA 3GTPB 3TSSA 3TZUA 5DM63 4A3JB 1J9OA 1G2TA 1LT3D 2EOTA 5EGTA 2MJ8A 3OPOA 5CV8A 3FMCA 1EWHA 3ERQA 2YYZA 2HQEA 4FF2A 4KHVA 1KLGD 2JP1A 4K2KA 4C56C 1STBA 5CBAE 1EYCA 3A7AB 2BE5C 1HUMA 2RDGA 4C3JG 3DEPA 1R4PB 4XQNA 2RA4A 3SVMA 1LT5D 4N9TA 4ME5A 4RGNA 1CQFA 1CK1A 4H13C 3OOCA 2SNMA 2KECA 1FNWA 1EOTA 1SE2A 2ZT9C 1O7ZA 3NTHA 4HMJA 2B8GA 4K14A 2MGSA 3QIAA 1PFMA 1IL8A 3QWNA 4NMZA 3MZ5A 3X3MA 2FHTA 2M2LA 2L11A 1TWFB 3K5OA 2FINB 3MXGA 4QF4A 1ZXTA 5J1ZA 1QG7A 3A8KE 1W6KA 2XNAC 2EY5A 2A73B 3SK6A 3V05A 3MXUA 3MVVA 5C0XG 3OWEB 2N88A 1LLRD 1R9TB 1J8IA 3KK7A 3K5MA 2RSNA 4K2LA 4TKOB 3S1NB 4PQXA 1PFNA 4A3GB 1F2YA 2CHBD 2F0VA 1B2TA 1QILA 2F0KA 2F0TA 1GHKA 3VA5A 3VR6A 1MSGA 2PCFB 3RZDB 1FNUA 2GA4B 3H94A 1F9SA 1Z47A 3VYUA 1BR9A 2ID0A 4XDXA 1ICWA 1ZEQX 1JOKA 1L0XB 4KN4C 1SYGA 1A3VA 4OO1H 1RCVD 2R93B 2J7ZA 3QOJA 3BYYB 2B2WA 3I4NB 4ZQ3A 3D6WA 3K0YA 4KKTA 2B2YC 3C2PA 2EYLA 4IQZA 2M00A 1QB5D 2VB3X 4KKSA 4DXGA 2EYHA 2F0OA 4DU9A 1YNJC 1WTXA 2DNCA 1HQRD 1RTNA 3DHQA 3BDLA 3K57A 4HCSA 3KBXA 2OT2A 3DUZA 2K5DA 1WD1A 5I2XA 3VR2A 1SDFA 5KIXA 3S2HB 2FJ2A 3A54A 1DONA 4I7ZC 2BA1A 2JA8B 3PUWA 1U9RA 4RGTA 3WOFA 3M4YA 1LV9A 1CZWA 1STYA 2K7VA 3D4WA 2AQ3B 5D65A 3SHLA 3NWTA 2QDBA 2IPKD 3Q23A 3HOYB 2KCCA 3J81E 3V2TA 2F1MA 3HOXB 5EJWA 1LABA 1V43A 3A7LA 3W2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ C;  3U9S A;  1H9S A;  4JBW A;  2BA0 A;  2BE5 D;  3LWU A;  2ZT9 C;  4OO1 H;  1E2Z A;  3A8I E;  1IW7 D;  1Z6H A;  1K8O A;  3M7N A;  4IFD G;  2A68 C;  1HCZ A;  3VA7 A;  1BDO A;  1G29 1;  3PUX A;  2PPB C;  2B8G A;  1FYC A;  2D5D A;  1Q1B A;  4KN7 C;  1IW7 C;  3I72 A;  2Q8I B;  5BN4 A;  2D62 A;  4H0L C;  3QIA A;  2AUJ D;  3M85 A;  2AUK A;  4HR7 B;  5JEA G;  5KNB A;  2A6H D;  2JEB I;  1GJX A;  3W3A A;  1Y69 U;  4KKT A;  4DK0 A;  2A69 D;  1VCI A;  2A6H C;  1Y8P B;  2IT1 A;  4IQZ A;  3T53 B;  1GUS A;  3OW7 A;  2D2C C;  2A6E C;  1H9J A;  3D4R A;  2NN6 H;  4LJZ C;  1IYV A;  2A69 C;  1IYU A;  1VF5 C;  1OXT A;  1FR3 A;  4DK1 A;  1GUO A;  2DNE A;  4KKS A;  3GQB A;  4G7H C;  2R6G A;  2A68 D;  3PV0 A;  3VR5 A;  1HPC A;  1I6V C;  1Y8N B;  1YNN C;  2O5I C;  1YNJ C;  5BN3 A;  4PV1 C;  3A8K E;  1Q12 A;  2DNC A;  1CFM A;  1B9M A;  1ZKO A;  1H9K A;  2PNR C;  2CW0 C;  2E75 C;  2QF7 A;  3OOC A;  4IFD H;  4RCN A;  5K36 G;  3PUZ A;  1Q1E A;  2V4D A;  2KA7 A;  3VR2 A;  1H9M A;  2B8F A;  3LNN A;  1QJO A;  2NN6 I;  2A6E D;  3ND8 A;  4KN4 C;  1PMR A;  4XTC S;  2AWO A;  3MXU A;  4BA1 I;  5KND A;  5JEA H;  3I73 A;  1E2V A;  4KI0 A;  4TQU S;  3TZU A;  2EJG C;  1TU2 B;  2K33 A;  3DXJ C;  4KMU C;  1Y8O B;  2DN8 A;  4I7Z C;  2BA1 A;  1O7L A;  1LAC A;  5C0X G;  3L7Z C;  4BA2 I;  3OPO A;  1GUG A;  3WDN A;  3PUW A;  2LMC B;  3FMC A;  1O78 A;  2JXM B;  3D31 A;  4DNT B;  4H44 C;  3VR4 A;  1HQM C;  1EWH A;  1B9N A;  3M4Y A;  3N6R A;  3CRL C;  3PUY A;  1OXX K;  3QG1 A;  4LK1 C;  2JE6 I;  3SE0 A;  1ONL A;  4TKO B;  2EJM A;  2K7V A;  2YYZ A;  2EDG A;  1HTP A;  4G7Z C;  1CTM A;  1SMY C;  4JK1 C;  4DNR B;  3VR3 A;  1CI3 M;  4L8J A;  3KLR A;  3QJY A;  1TKW B;  3HGB A;  4OO1 G;  3MFY A;  2O5J C;  5K36 H;  2EVB A;  3FPP A;  2E76 C;  2EJF C;  3NE5 B;  3IKJ A;  3PUV A;  3EQL C;  2E74 C;  3BDO A;  1OXU A;  3I4L A;  4KHZ A;  3RLF A;  3A8J E;  3T56 B;  1GUT A;  1VF7 A;  4XIG S;  3SDZ A;  1DD2 A;  1GHK A;  2BDO A;  3A7A B;  3AB9 A;  2BE5 C;  3VR6 A;  5BN5 A;  1T5E A;  1Z7T A;  3T51 B;  1ZYR C;  1DXM A;  2PCF B;  2KCC A;  5C0X H;  3GD7 A;  2JEA I;  4G7O C;  3H94 A;  1H9R A;  1V8Q A;  4KKU A;  3IFT A;  2L5T A;  1A6X A;  2NN6 G;  3ND9 A;  5A35 A;  1OXS C;  1VDZ A;  2F1M A;  5KNC A;  3CRK C;  1H9S B;  1LAB A;  3P20 A;  1E2W A;  1OXV A;  1GUN A;  1V43 A;  3A7L A;  1Q90 A;  4GZY C;  1K8M A;  4H13 C;  1GHJ A;  2K32 A;  3BG3 A;  1DCZ A; 
#chains in the Genus database with same CATH topology
 3KF6 A;  3U9S A;  1KL9 A;  5LMN L;  3MTS A;  1NR2 A;  2QCP X;  1CA5 A;  1WCM H;  5KGU A;  2CH4 A;  4KV6 A;  4PMC A;  1TT2 A;  3H15 A;  4Q5V A;  3G6E A;  3JAM c;  2XRS D;  1HCZ A;  4N8F A;  1X65 A;  2NVX B;  1S4Z A;  1V1O A;  2EY1 A;  1WTH A;  4H0L C;  5JEA G;  4LF9 L;  1NNX A;  3TDQ A;  1GJX A;  5J22 A;  3CC2 A;  1S5C D;  4GKK L;  4GKJ L;  3T53 B;  5FKA C;  4A3M G;  4QMG A;  3CCV A;  1TWH H;  1PZJ D;  4CGY B;  5G3L D;  2NN6 H;  2Z1C A;  4KD3 A;  4AYB G;  5EQ0 A;  2Z9H A;  5FO9 B;  4POG A;  2DNE A;  4HJ7 A;  2F52 A;  3RN2 A;  4B3T Q;  1UAP A;  3I91 A;  5C4Z A;  1Q12 A;  2RKS A;  1VQK A;  2NBF A;  3OYY A;  3SEB A;  3M4Q A;  3KBG A;  2PNR C;  3K5L A;  2HHH L;  5G3L F;  5JPN C;  4X62 Q;  1YJW A;  4A3D B;  4JPB W;  1XPR A;  2WAQ B;  5CV6 A;  3CP0 A;  1TS5 A;  2KEE A;  3EIV A;  1SXT A;  4NXN L;  3OMC A;  1SEB D;  5E3F A;  3DXJ C;  3WOE A;  2K14 A;  3OW2 A;  2KCN A;  4BA2 I;  1IBM Q;  5IP9 H;  1WTR A;  4DNT B;  2EYF A;  2UUA Q;  1SYF A;  1RD9 D;  3SE0 A;  4K6D A;  1SMY D;  3J7A 5;  1X3E A;  5I9O A;  3H09 A;  2OEO A;  2ENB A;  1UE7 A;  3ERS X;  5D14 A;  4L8J A;  1NUC A;  4BXX G;  4OWX B;  2ZXR A;  4UY8 C;  1HJP A;  4IUQ A;  5T1G A;  2WV6 D;  2Q8R E;  4F87 A;  4HJA A;  1AE3 A;  4FXG C;  1K8G A;  2C35 B;  4RKB A;  1VF7 A;  1UNS A;  5EBD A;  2NTS A;  4A3L H;  3PO2 B;  3FHW A;  4I65 A;  1AFP A;  1XNQ L;  3KDF A;  2RF4 A;  1PVO A;  2JA6 B;  3MAQ A;  4A3C H;  5GAG C;  1G6Z A;  3WWV A;  4LF5 L;  1EY0 A;  4GOP B;  5IP9 G;  4IUT A;  4JI0 Q;  2WP8 J;  2I07 B;  5I9P A;  1P8L A;  2EYJ A;  3NEM A;  1H9S A;  4BBR B;  2F0S A;  4JI1 Q;  1IW7 D;  2EXD A;  4BY1 B;  4XQQ A;  1XNR Q;  1SRO A;  4A3I G;  4DV0 Q;  2F0U A;  2C5C A;  3S17 H;  3MXP A;  4R4T A;  4CKC A;  4DNI A;  1F9P A;  2PMZ E;  2PW5 A;  4RGO S;  3URY A;  5AJ3 L;  1I50 H;  2RHQ B;  1ET9 A;  2Q8T A;  1FJG L;  1J5E L;  1JWS D;  4QUC A;  3OMG A;  3K6O A;  1SNO A;  5ELC A;  4JBK A;  2B39 A;  2IL8 A;  3PIO A;  5KYI A;  5M3M G;  1GUW A;  3PIO 3;  1I3Q H;  4C2M H;  2R92 G;  1QVF A;  1B9M A;  1CFM A;  1ZKO A;  1LTI D;  4MIU A;  4R9W A;  4HED A;  2F4V Q;  3UDX A;  4P73 A;  3GTP H;  1TS2 A;  2ZJQ A;  1YEZ A;  5GAH C;  5JJK A;  3PF5 A;  4C3H B;  4CJ0 B;  2WAC A;  3TZD A;  3CCU A;  1STG A;  1TU2 B;  3SXH A;  4X6A H;  2HCC A;  5JJZ A;  2EYO A;  2MPM A;  2VQE Q;  4JG2 A;  1ESF A;  2Y0S E;  2UXD Q;  4P2C B;  5EPL A;  4ZLT F;  4YY3 Q;  4EQN A;  4DR1 Q;  1HQM C;  2CH4 W;  3U50 C;  4X3T A;  2ALY B;  2EJM A;  1EQQ A;  4DAY A;  1KNA A;  1HNZ Q;  2ZTE A;  4O42 A;  1Y14 B;  4DR5 Q;  3VR3 A;  3KLR A;  2VUM B;  3MFY A;  1HH2 P;  1HFG A;  1HNX Q;  1TS3 A;  1HA6 A;  3CF5 A;  2KHI A;  3M4P A;  4BS9 A;  2HUG A;  3T13 A;  4FF3 A;  1STA A;  2QKI C;  4OIJ A;  3RMH A;  3K0X A;  1Q8I A;  1B70 B;  4A3J G;  1KRT A;  3I4O A;  3P1H A;  1FL0 A;  2NWG A;  1ASY A;  4DV6 L;  5CV4 A;  2RBM A;  1EZ8 A;  4KHP L;  2AQ1 B;  2GN5 A;  3KF6 B;  3GV6 A;  4JI5 Q;  4RH6 A;  4FP5 D;  1JWU D;  2IJ0 A;  4DAM A;  3NQI A;  1DCZ A;  2RSO A;  2WKD A;  1V1P A;  2AKW B;  4YHH Q;  4IUN A;  1Z6H A;  3W1G A;  4IFD G;  3Q8D A;  2LY7 A;  2PPB C;  2WB1 E;  2G9D A;  3CCR A;  5M5W B;  1A15 A;  2AUJ D;  5COY A;  4G57 A;  2MUY A;  2EPB A;  1TWF H;  1YIT A;  4UP9 A;  4OIK A;  5ELB A;  1EY8 A;  3BVM A;  4JI8 L;  1UWV A;  2KOL A;  2LXK A;  3R3O A;  1S5F D;  1YJN A;  4K8I A;  2UU9 L;  4DV1 Q;  3MA2 B;  1PRT D;  3HG9 A;  1YNN D;  4YIJ A;  2CQA A;  4UP8 A;  2CFM A;  3BZC A;  4P71 A;  3MC0 B;  2SEB D;  1IKL A;  2O5I C;  1D5M C;  1STE A;  3AU7 A;  1Y1V G;  1TS4 A;  1T9H A;  2K05 A;  5IT9 c;  3AMU A;  4F7X A;  1PRT F;  1GOZ A;  1Q8K A;  4RCN A;  1DYQ A;  4B3M Q;  2KA7 A;  1XWE A;  2Q2U A;  1B4O A;  3HOZ G;  3TRE A;  2XWJ B;  2TMP A;  1VQB A;  1R9T H;  1JE4 A;  4TQU S;  1C48 A;  4S3S A;  4DV7 Q;  3CCL A;  3HOU H;  3GTM B;  1M90 C;  3J80 i;  4B3T L;  1PZI D;  4DGZ A;  3J81 L;  1I50 B;  2IHE A;  3GTL B;  5FO7 B;  1KRS A;  1XPO A;  1Y1W G;  3S1N H;  3VR4 A;  3ICE A;  1B7Y B;  1AW7 A;  4IO9 A;  1RJT A;  5DNF A;  3N6R A;  1CM9 A;  1EQT A;  2OQ0 A;  3T1Y L;  1JT8 A;  2SOB A;  4UHV A;  2L12 A;  4FXK C;  1I3Q B;  3UDF A;  4ZUI A;  3MFG A;  4IUP A;  3DM3 A;  1CI3 M;  2D9U A;  2RDF A;  4YWM A;  3RD4 A;  4IZ8 A;  1N32 Q;  3NP8 A;  3M4O B;  3CAM A;  3FPP A;  5C3W A;  1IBM L;  2KBN A;  3IKJ A;  1PH6 A;  2K04 A;  2VB2 X;  3RZD H;  1LTG D;  3KLS A;  2UUA L;  1SYB A;  1LT6 D;  3KDF B;  3U4Z A;  2B63 G;  4LF4 L;  2PMZ B;  5E4W C;  2IX3 A;  4CDF C;  1VQM A;  4GS3 A;  3P75 A;  4JV5 Q;  3F8T A;  3UDI A;  1BUV T;  1CKN A;  1BOS A;  1H9S B;  2QA4 A;  4JCV E;  4NPS A;  1N33 Q;  3OIP A;  1GHJ A;  4DR3 Q;  4DN4 M;  2R93 H;  1TQO A;  2NVT B;  4EQP A;  2R7Z B;  3C1E A;  4AIM A;  4KTA A;  4A3G G;  3J7Z C;  5IOC A;  2QEJ C;  2Z4H A;  3P7J A;  3X3N A;  1N34 Q;  1HHV A;  3CKI B;  4IAL A;  4A3K B;  1DJR D;  3TME A;  1K8O A;  3EVQ A;  5ELE A;  5LMN Q;  5IGF A;  5I6Y A;  5LHY 1;  4JI4 Q;  1JOQ A;  1CHP D;  2D5D A;  5BN4 A;  5J3B A;  1PTO D;  2BH2 A;  4X64 L;  4J6H A;  2CVR A;  5M3F B;  4JI0 L;  4ZYS A;  3EJI A;  4O2D A;  1VCI A;  3NTK A;  2VW9 A;  4LF9 Q;  4ULL A;  2BCO A;  2Y0S B;  1IYU A;  5C44 B;  1FR3 A;  4GKK Q;  4GKJ Q;  2B2T A;  2MHV A;  3F2B A;  4OX9 L;  1F9R A;  1PTO F;  1CA6 A;  3PV0 A;  5F2D A;  1XNR L;  1EY4 A;  1H95 A;  4QCL A;  1L1O A;  4A3B G;  4JVZ A;  3CME A;  2R93 G;  1UE5 A;  5H1S E;  3FKI G;  4R4C A;  4A3F B;  2HHH Q;  3I4N G;  1QJO A;  1QWY A;  4LF8 L;  1F2Z A;  1TWG B;  2JA8 H;  3UE1 A;  2XGT A;  3SK5 A;  2O4X A;  4KMU C;  1CZG A;  4NXN Q;  2FMM A;  2LMC B;  3D31 A;  4DAY B;  3CC7 A;  4A93 G;  3HEJ A;  3MEH A;  3QB3 A;  3QOL A;  1N9W A;  1BCP C;  3VYS A;  2EDG A;  4QUF A;  3IL8 A;  3I8Z A;  3C46 A;  2I46 A;  3V96 A;  2VL6 A;  3K8A A;  1EIG A;  4DV4 L;  5CMD A;  1EY5 A;  4IOA A;  2PNH A;  4ZKC B;  2EYP A;  4Y52 H;  1YNX A;  3K80 C;  1VQE A;  2G9H D;  1VQI A;  2WB1 B;  1I4R A;  1OXU A;  3I4L A;  2R61 A;  3SDZ A;  4C3I G;  2F0P A;  5CV5 A;  1ZYR D;  4BBS H;  2BDO A;  2B2U C;  5LMU L;  1S5E D;  4DA2 A;  1T5E A;  1PV4 A;  3AEV A;  1Z7T A;  3HOU B;  4YCW A;  3S14 B;  5IP7 H;  1LTT D;  1PZK D;  1X6O A;  2NZH A;  2JA8 G;  4JI2 L;  1GO3 E;  1XMO L;  1PRT B;  4CHT B;  2L4N A;  5EPJ A;  2AMC B;  4Q0F A;  1VQP A;  4HJ5 A;  1TII D;  4V0B A;  1V1P B;  1HNX L;  1Q90 A;  1BBX C;  1JMC A;  1AN8 A;  1BQQ T;  2NVX H;  3G71 A;  2L55 A;  1EZ6 A;  2VY3 A;  4HSP A;  2UUB L;  1XTD A;  3GDE A;  2EIF A;  5C0X I;  3M3Y B;  4B9W A;  1GM5 A;  3Q6S A;  1FYC A;  4KN7 C;  3S15 B;  3I72 A;  3D4D A;  2H5X A;  3HOY G;  4MZ9 A;  1YJ9 A;  1B50 A;  2IT1 A;  3KLS X;  3SGI A;  2C9O A;  4RWS C;  5C3E H;  2UXB L;  5AJ3 Q;  4BWG B;  4C3J B;  3HOX G;  2JN4 A;  2OWO A;  4GN5 A;  5DEH A;  4DV5 Q;  4G7H C;  1FJG Q;  1PH5 A;  4A3D H;  1JWM D;  4PV1 C;  4XQJ A;  2HIX A;  5IWA L;  1K8A C;  3I4M H;  3STB D;  1L0Y B;  3R2I A;  1A3T A;  2A8V A;  1FVI A;  1KAB A;  2PQA A;  3D3R A;  3ND8 A;  5AFW A;  2AWO A;  1EWC A;  4BA1 I;  2UUC Q;  4DR2 L;  1U4R A;  4LW1 A;  2CKZ B;  2K52 A;  1WFQ A;  1JB3 A;  1JC7 A;  1QUQ A;  3J7A F;  3CCE A;  4KJN A;  5CV9 A;  3JAM i;  2B29 A;  1B9N A;  4ZRZ A;  5K5P A;  4J15 A;  4B3M L;  3QG1 A;  1J6Q A;  1IKM A;  3BS1 A;  3U4V A;  2OCE A;  4A3E B;  2K6A A;  1CTM A;  3K5N A;  1SYC A;  4OO1 G;  4HSV A;  3BYT B;  1FGB D;  1QNK A;  1D1K A;  2K4K A;  3H0G B;  1EY6 A;  5GRO A;  1PTO B;  1QZG A;  1FGU A;  3NQT A;  2JA6 H;  1CKN B;  3CCJ A;  4A75 A;  4JBJ A;  2D0P A;  2GVB A;  3HP3 A;  4X3S A;  4U67 3;  4KK7 A;  1IBL L;  4DK3 C;  2F0Q A;  2L5T A;  3QR8 A;  5DAU A;  1OXS C;  5KNC A;  1PH1 A;  4DV6 Q;  4BBR H;  1SN8 A;  1PA6 A;  2EY2 A;  4GZY C;  4KHP Q;  3CHB D;  4LUV A;  1WTO A;  1QOH A;  4DR7 Q;  1TWA B;  2EZV A;  4BY1 H;  1NCV A;  1VQF A;  4FO2 A;  4HJ8 A;  3K58 A;  1K9M C;  3E0J A;  2IY5 B;  4WJ3 M;  5E4X A;  4JV5 L;  5C0X J;  4LWC A;  4MTK A;  1BDO A;  4LUZ A;  4PZ7 A;  5ELD A;  2MQH A;  3RZO B;  2Q8I B;  2KHJ A;  3CCQ A;  2PZW A;  4BBS B;  2X69 A;  1Y69 U;  3FRP B;  3PO2 G;  4DR3 L;  4LFB Q;  2A69 D;  2A6H C;  3E3X A;  3NTI A;  1GUS A;  5JVG 3;  3U9O A;  4LJZ C;  4JI8 Q;  1N34 L;  3B6Y A;  2E8G A;  2JA5 G;  1L1O B;  1DOM A;  2UU9 Q;  2HQL A;  3LX0 A;  4EX5 A;  2F0E A;  1STN A;  4JI4 L;  4ABN A;  4F8M A;  4JYA L;  1QE6 A;  5IYD G;  4BBR G;  4LAA A;  4ZUJ A;  2ZJR A;  4ILW A;  1H9K A;  4NW2 A;  2CW0 C;  5EKL A;  3UI2 A;  1G8Z D;  4C3H H;  2DUD A;  1DM0 B;  1AP0 A;  4XT1 B;  1PLF A;  3IAY A;  5C5M A;  3S1Q H;  2B8F A;  1QVG A;  5HGT A;  1L2F A;  5IGC A;  1II3 A;  1SNM A;  2I5L X;  4NDX A;  1KTK A;  5IIF A;  1X3Q A;  2F0N A;  3WDN A;  2KED A;  1I4P A;  3PF4 A;  2K01 A;  1D5X C;  5C3E B;  1SNP A;  4FDB A;  1WYD A;  4KD4 A;  2ZXO A;  4F88 A;  3VDY A;  3CRL C;  1QCB D;  1NTG A;  2VUM H;  1ENF A;  3T1Y Q;  5T1I A;  2KHS A;  3I4M B;  2RDH A;  1WCM G;  1LTB D;  3M7G A;  3NE5 B;  4N9P A;  3S16 B;  3BDO A;  4K5V A;  4EVO A;  3EBE A;  2HD3 A;  1FD7 D;  3T56 B;  1GUT A;  4C3H G;  1SFO B;  1DD2 A;  3C1F A;  3AB9 A;  4CKB A;  2R7F A;  5JJI A;  1E3P A;  3NSW A;  3T51 B;  4JBM A;  1V8Q A;  3D0F A;  3F2D A;  4LF4 Q;  2Z6K A;  4DAV A;  1SLJ A;  3NXW A;  5FLM H;  1WTP A;  2NN6 G;  1PXU A;  4IUU A;  1RHP A;  3A74 A;  1I6H B;  3RR5 A;  3T16 A;  3CCS A;  3BG3 A;  1HZ9 A;  3R8B A;  2K28 A;  2NB0 A;  3DMU A;  5M5W H;  3TBI B;  5C4X B;  4JOI A;  2PI2 A;  5A2Q L;  1ILQ A;  1G29 1;  3PUX A;  1AE2 A;  2F3W A;  3UE0 A;  1F77 A;  1VQJ A;  4HJ9 A;  1LUZ A;  1GD7 A;  2MO1 A;  3NEL A;  2F3V A;  1PYS B;  5FK9 C;  5L37 A;  4X64 Q;  1FNV A;  3OHX C;  5KRU A;  2D2C C;  3J81 c;  1A3U A;  4PNY A;  1U4M A;  3S1R B;  1GUO A;  4LNQ A;  4LF6 L;  3DWA A;  3Q24 A;  1BKB A;  5FLM G;  2A74 C;  2PI2 E;  2PQA B;  4OX9 Q;  3S2D B;  1JE5 A;  4MN3 A;  1L1O C;  1NE3 A;  1SRU A;  2A19 A;  5COR A;  3GTO B;  3GTM H;  3H3V C;  1HR0 L;  5CC4 A;  3HKS A;  3MWY W;  1X32 A;  3I55 A;  3GTL H;  3TS0 A;  2MO0 A;  1A2T A;  3I73 A;  1N8R C;  1TXY A;  1QUQ B;  4DV5 L;  2K1B A;  4LF8 Q;  3BU2 A;  4A3L G;  2AWN A;  3DM1 A;  4PMB A;  3H91 A;  3ER0 A;  3HKZ E;  2JXM B;  2PO4 A;  1F2M A;  4A3C G;  3KJO A;  2ATW A;  4JC0 A;  1CQV A;  2QIL A;  5DM7 3;  4EQ5 A;  5IGE A;  1ONL A;  2UUC L;  3M4O H;  4CJ1 B;  2NUC A;  5JEA J;  4L6T B;  4DNR B;  1Z9F A;  4GN3 B;  5IGG A;  1SE3 A;  1NAP A;  1NJI C;  2QW7 A;  3HGB A;  4OL7 A;  5K36 H;  2IW3 A;  4FXD A;  2EVB A;  3GTJ H;  2EJF C;  4DV4 Q;  3BDC A;  3KYH C;  3S1Q B;  2J4X A;  3RUZ A;  1KXL A;  3K7A B;  4RGM A;  1AEX A;  3FVQ A;  2YTX A;  1K3B C;  5ELN A;  5LMU Q;  3MXN A;  4NP5 A;  3G48 A;  2NVT H;  1VDZ A;  2NVY H;  2R7Z H;  4JI2 Q;  1M8A A;  1XMO Q;  1E2W A;  3G7L A;  1EL0 A;  1G91 A;  4JI3 Q;  4A3K H;  1XTC D;  1EEF D;  3A8I E;  1RF2 D;  3DWP A;  3A0J A;  3I2Z A;  5CYU A;  2Z6B A;  5M3F H;  2YTY A;  1ML0 D;  2F03 A;  2UUB Q;  3ITP A;  1CHQ D;  1U4L A;  1SYE A;  4IPD A;  3OSO A;  1I4X A;  3I70 A;  4TRD A;  4IUV A;  5C44 H;  1PH3 A;  4DR7 L;  3EA6 A;  4ZK9 B;  1UEB A;  3GQB A;  4DV3 L;  2UXB Q;  1JOO A;  1EIH A;  4DUY Q;  2LKV A;  3VR5 A;  4A3F H;  1JOR A;  3KOJ A;  1QVC A;  1SBB B;  1IHZ A;  1BNZ A;  1JCK B;  4GOP C;  1TWG H;  1NR4 A;  5IWA Q;  2F0M A;  5KEE A;  2CWA A;  1MHW C;  4AQY Q;  1IBK L;  4LFB L;  3O13 A;  2B2W C;  1I94 Q;  2V4D A;  3G6J B;  1ASZ A;  3A5Z B;  2A6E D;  2F3I A;  1U0L A;  3T4A C;  5BR8 L;  1MI2 A;  1HTL D;  1YHB A;  1BF4 A;  2JSO A;  4A3I B;  1Y8O B;  3TEH B;  4DR2 Q;  2D0O A;  5GQO A;  2P5Z X;  2RCF A;  2K5Q A;  3K7U C;  4DV2 L;  2Y0S G;  3AQQ A;  1O78 A;  5C5L A;  3BVZ A;  2SNS A;  5FOB B;  5C44 G;  4IFD I;  3J80 E;  4Y7N H;  4DR4 L;  5C3X A;  2JE6 I;  3PMF A;  1Q86 C;  2YU9 B;  4NXM L;  4G7Z C;  3DWQ A;  2PYK A;  3K59 A;  4JK1 C;  3CU7 A;  2G5D A;  3MHB A;  2F4I A;  3EFX D;  1PH8 A;  5FLX E;  2R92 B;  3RN5 A;  3OWF A;  1QZH A;  4EGV A;  3S14 H;  3A8J E;  2IX0 A;  4R1J A;  3RNU A;  4X3U A;  3BZD B;  3HOV B;  1MJC A;  2F0I A;  1IYJ B;  1DXM A;  3A56 A;  4MHE A;  1H9R A;  4KKU A;  3W1B A;  4JI6 L;  1ILP A;  1LTR D;  3Q22 A;  4I7A A;  4PG3 A;  4U68 A;  1IBL Q;  3ONA B;  5LL6 X;  1DOK A;  1D1I A;  1K8M A;  2F0J A;  1JJG A;  4NKL A;  5JPM C;  3J7A V;  3M3Y H;  4X66 L;  1C0A A;  2BA0 A;  3S15 H;  4UDU C;  1HNW L;  3M9B A;  1X55 A;  3E5S A;  2F0W A;  4K5W A;  4LF7 Q;  1XMQ L;  3SK4 A;  4FNF A;  1I4G A;  3GTJ B;  3ZYY X;  5IOD A;  2RQX A;  1G6P A;  2AUK A;  4O1N A;  4YWK A;  4H02 A;  4B3R L;  4Z9C B;  4FYD A;  2FXQ A;  1NMF A;  4C3J H;  3HOU G;  1Y8P B;  5JOB A;  2JJQ A;  1RKN A;  3CQZ B;  3HKZ B;  3VYR A;  1JJC B;  1M1K C;  2NZO A;  5E7N A;  2B2V A;  1I4H A;  1PFB A;  2NVY B;  4DK1 A;  2IWH A;  3GTK B;  2F0L A;  1MBY A;  1SJE D;  5ISR A;  1XYI A;  3R93 A;  1PH7 A;  2JA7 H;  3KF8 A;  5EBC A;  5C4J B;  3NUC A;  1EQR A;  1SNC A;  2KQ3 A;  2QF7 A;  4JYA Q;  1DGS A;  1K83 H;  4DPG A;  3PUZ A;  1Q1E A;  1VQ4 A;  1VMC A;  3ULJ A;  5DLQ E;  1MKH A;  4M1U B;  4XTC S;  5IYB H;  5ELF A;  4HCE A;  1IXR A;  1O7Y A;  1EEI D;  2LFN A;  1E2V A;  5JAV A;  2BH8 A;  1Q81 C;  4R8I A;  1U5K A;  2EJG C;  3FEW X;  2UXC Q;  4CDD C;  5EPK A;  1UEA B;  2PZU A;  2XN9 C;  4DAP A;  2EQS A;  2L15 A;  4RHS A;  4E6I A;  4OWT B;  4A3E H;  1W6J A;  1OO9 B;  4IFD J;  1OXX K;  4LK1 C;  2XSC A;  2XVS A;  2A5H A;  2DJF C;  1HTP A;  1LYL A;  1D6E C;  5A2Q E;  1SMY C;  3H0G H;  1SND A;  1C8C A;  1PTO H;  3L3O C;  3S9W A;  3QJY A;  1TKW B;  1LTS D;  4YCU A;  1YIJ A;  3A55 A;  3NBI A;  1Y1V B;  1HUN A;  4CJ2 C;  1KDC A;  5D3I B;  1XXG A;  3MXN B;  2CQO A;  5BN5 A;  3HOZ B;  2I5H A;  3L9A X;  4G7O C;  5C0X H;  1GXD C;  4X65 L;  3IFT A;  4HTH A;  4UPA A;  1CT1 D;  1TWA H;  3ND9 A;  4V19 0;  3CRK C;  3D8G A;  2OQK A;  5IYC H;  1OXV A;  2Z6K C;  1VQ5 A;  3RLN A;  4Y7N B;  1Y1W B;  2DY7 A;  2K32 A;  4C1N K;  1SAP A;  4A3E G;  1WTQ A;  3QO2 A;  3RZO H;  3LWU A;  3HOW H;  1AZP A;  3PO3 H;  1WD0 A;  3H0G G;  2FMC A;  1Q1B A;  1IW7 C;  3UDG A;  2ZM6 L;  1P16 A;  4OON A;  1TVX A;  5GAD C;  1SE4 A;  4ODG A;  1B53 A;  3E6Z X;  5KYL A;  4JI3 L;  1HZC A;  3H3V H;  2VNU D;  4QIW E;  1UE1 A;  1B1Z A;  1EU4 A;  2B63 B;  3KUP A;  4OHJ A;  1PHJ A;  1LTA D;  4DUZ L;  5EKI A;  1W3S A;  4N8X 1;  2R6G A;  3J7Y W;  2A68 D;  1JIC A;  1SJH D;  1HPC A;  3DLL A;  4LF6 Q;  1E7Z A;  1E24 A;  2E75 C;  4K6L A;  2KEN A;  2NTT A;  3K81 C;  2K03 A;  5CBE E;  2HT1 A;  3GV3 A;  5IT9 L;  1H9M A;  4RA8 A;  3LNN A;  1LM0 A;  3ZJY C;  5HUR A;  3C3L A;  2EXZ A;  1BBW A;  2ZXP A;  3GP7 A;  4BBS G;  1HR0 Q;  3LGJ A;  4DUY L;  2E2J B;  2DN8 A;  5C4H A;  4RHR A;  1ENA A;  5IP7 G;  3L7Z C;  1B8A A;  4TSS A;  5IE8 A;  3TP5 A;  4AQY L;  2TSS A;  3GTG H;  1I94 L;  4QB4 A;  4WFN 3;  2ICE C;  2V1C C;  2JA7 B;  1S3O A;  4L63 B;  4DF7 A;  5CV7 A;  2HCI A;  2M9V A;  5I6W A;  3S16 H;  4CKE A;  3JAM E;  1EFI D;  4WOR A;  1SFO H;  4X3K A;  3SK8 A;  2MNA A;  1F2L A;  2O5J C;  4CBV A;  3ERO A;  1K83 B;  2A1A A;  4A3B B;  1EFW A;  2J0T D;  3TN2 A;  3PUV A;  4KHZ A;  1U4P A;  1S72 A;  3NPP A;  3FKI B;  4R8N A;  2N49 A;  4B08 A;  4OEM B;  3Q0A A;  2PQE A;  1RDP D;  3F2U A;  1T5X D;  1I6H H;  4KY6 A;  3T1H L;  4FF1 A;  1WJJ A;  4BY7 B;  1A6X A;  5C3E G;  3TRZ A;  4OXP A;  3P20 A;  4DFA A;  4J1M A;  5C4X H;  4DR6 Q;  1YI2 A;  3PSI A;  4A3D G;  1VS0 A;  4DKA C;  1PH4 A;  4A93 B;  2WAQ G;  2I5M X;  3I4M G;  2X6L A;  1MGS A;  1JQY D;  1KDB A;  1A2U A;  3VA7 A;  4O0A A;  1TY2 A;  3M85 A;  2RHS B;  3GTQ H;  4LFC L;  2XRQ D;  3S1M B;  2EY6 A;  4H7B A;  4RG1 A;  4XT3 B;  3S1R H;  4RAU C;  4C3I B;  3OW7 A;  1QNU A;  1H9J A;  2A6E C;  1IYV A;  4AYB E;  3KF8 B;  4OO1 I;  4LF7 L;  2MFI A;  3S2D H;  3J80 L;  2E2I B;  2WII B;  1WTW A;  1N36 Q;  1PRT C;  3GTO H;  1YNN C;  5I4D A;  2X6G A;  1YHQ A;  4XXE A;  1HR0 W;  5EKK A;  4DV3 Q;  2N3S A;  3CCM A;  2JK8 A;  3TP7 A;  3HOW B;  2NZ1 D;  5FLX L;  2ES2 A;  3IFD A;  3PO3 B;  1DOL A;  4ZAI A;  1VQL A;  1PMR A;  4A76 A;  1IBK Q;  1YVC A;  5JEA H;  2F0D A;  5TSS A;  2JA6 G;  1G51 A;  4HIO A;  2FFK B;  4IJH A;  5LL6 S;  5BR8 Q;  4B3S L;  3NBH A;  4ME3 A;  1O7L A;  1LAC A;  4KY5 A;  1GUG A;  2E2D C;  4H44 C;  3CMA A;  5NUC A;  1VQ9 A;  4IPG A;  1LO5 D;  1MD2 D;  2WKC A;  3F2C A;  4DV2 Q;  1SNQ A;  3PUY A;  1MSH A;  4HAE A;  4CDC C;  4ZKB B;  2VS1 A;  3AFP A;  4RCO A;  4BY1 G;  3KLW A;  4DR4 Q;  4B9X A;  2UXC L;  1A63 A;  1TWC H;  4NXM Q;  1EYD A;  3K7A H;  1XX8 A;  2IX1 A;  3J81 i;  2NYZ D;  3EQL C;  2E74 C;  3KFU A;  4WJW A;  3RLF A;  4QGU A;  1I5F A;  1EQV A;  1S40 A;  1VQN A;  4WRD A;  1M4V A;  1SMX A;  4IJL A;  5ELO A;  2JEA I;  3GD7 A;  2KJX A;  4QIW B;  1ET6 A;  1S5D D;  1B3A A;  4RFB A;  1VMP A;  1X56 A;  1JR0 D;  2JYO A;  4JI6 Q;  2K5W A;  4IN3 A;  5E1F A;  1GUN A;  3GTG B;  5C6A A;  1SE8 A;  3I90 A;  1EYA A;  1JJ2 A;  2BE5 D;  4A4I A;  4BXX H;  2R3Z A;  4X66 Q;  3M7N A;  4EQO A;  1VQ7 A;  1HNW Q;  1PH2 A;  4HMI A;  4FF4 A;  1NSN S;  1XMQ Q;  2NVQ H;  2JEB I;  3FPU B;  3W3A A;  1I4Q A;  2DGY A;  4APV A;  4WJ4 A;  1TR5 A;  1TY0 A;  1IL2 A;  1PTO C;  4B3R Q;  4L5R C;  3R2T A;  1NBW A;  4MNO A;  3A5U A;  1Q82 C;  1VF5 C;  2H1E A;  1OXT A;  4JI7 Q;  3ULL A;  2K5H A;  1EY9 A;  1I6V C;  1Y8N B;  2B2V C;  2XIW A;  4QY7 A;  2KVM A;  2VUM G;  1Q3L A;  4IUR A;  3TP6 A;  1HFN A;  2LXJ A;  4GNX A;  4K8J A;  4IOC A;  5M9O A;  2WFW A;  2QEX A;  4A3I H;  2NN6 I;  1E0B A;  3W5O A;  3GTQ B;  2B2U A;  4HIK A;  2K33 A;  2BOS A;  1PDQ A;  2YU9 H;  2HDM A;  2L1B A;  2HDL A;  3D6C A;  2B2T C;  4C1N I;  1BCP D;  1X3F A;  4IPH A;  5M3M H;  4RKL A;  3NWS A;  3NK9 A;  3LWE A;  2JA5 B;  2O2L D;  2KUM A;  2R92 H;  2N78 A;  1IZ6 A;  1BCP F;  1MIU A;  2E2H B;  1PYW D;  2E76 C;  2OF1 A;  3HOV H;  1RIP A;  1KNE A;  5D3D A;  2ICI A;  2CCZ A;  2JQO A;  3PCO B;  2WIN B;  1ZYR C;  3AYH B;  3CPW A;  1YZ6 A;  4A3M B;  5M5Y B;  1K0R A;  4AYB B;  3OTO L;  1SYD A;  1SR3 A;  4X65 Q;  3NHH A;  2VXW A;  4M8A A;  3U58 A;  3VYT A;  4CDE C;  5M5X B;  4DK6 C;  1KDA A;  4HN7 A;  1WTV A;  4OGQ C;  1BO0 A;  3ULP A;  5IT9 E;  2Z4I A;  1G2S A;  2BDN A;  1R4Q B;  1EIY B;  2E5L L;  1E2Z A;  3HFZ B;  1TWC B;  1WVL A;  2A68 C;  1WCM B;  2B2Y A;  2PW7 A;  2F0G A;  3CQZ H;  4HR7 B;  5KNB A;  4A3J H;  4QL5 A;  3HS0 C;  3CD6 A;  1ENC A;  3HOV G;  2ZM6 Q;  4DR6 L;  4DK0 A;  1ROD A;  3HRZ C;  3GTK H;  1X9N A;  1HRJ A;  1ESR A;  1KQS A;  3D4R A;  4K0K L;  4GLV B;  1EUJ A;  5C4J H;  2SDF A;  2H4O A;  2K5N A;  1D2B A;  4J8Q A;  2OTJ A;  3TS2 A;  2Q2I A;  2MP1 A;  2N55 A;  1TWH B;  3OIQ A;  4L5S A;  4DUZ Q;  3HZX A;  5BN3 A;  1WI5 A;  3JAM L;  3F1Z A;  1HZB A;  4HIM A;  4IFD H;  3H6M A;  5K36 G;  1Q7Y C;  3BZK A;  3STB C;  1RL2 A;  1GVP A;  1STH A;  3NBH B;  5KND A;  2OXP A;  2Z8L A;  1HXY D;  4KI0 A;  2NVQ B;  4JW0 A;  1PH9 A;  4KLK A;  2EE1 A;  4XYQ A;  4DXF A;  5IGB A;  1N36 L;  1YNJ D;  3HKZ G;  3I3C A;  1RTO A;  3SR1 A;  4ZCK A;  2R7Z G;  2F0F A;  2JA9 A;  2RVL A;  3E9I A;  1Q46 A;  1LT4 D;  1EY7 A;  4UAI A;  4A3K G;  4R4O A;  4LFA Q;  4FVM A;  5IGD A;  3N52 A;  1W2B A;  1BXT A;  1SSO A;  1PFS A;  2K75 A;  1Y1V H;  2VQF L;  2I0Q A;  3S24 A;  5JVH 3;  3PQI A;  3HOZ H;  2DY8 A;  3PGZ A;  5M3F G;  3AFQ A;  3DEO A;  4XIG S;  1CUK A;  2EYM A;  1NMG A;  1DZ1 A;  1CKO A;  3BVG A;  3GO5 A;  1VQ6 A;  1E22 A;  4G4K A;  4KJO A;  2Q2T A;  4HID A;  1XPU A;  1X3P A;  1Y1W H;  2R7D A;  4GN4 B;  1EIF A;  5A35 A;  3T1H Q;  5CGK A;  5HY6 A;  5M3M B;  4PZ8 A;  5EAY A;  1E1T A;  5IY0 A;  4ID6 A;  4LMQ D;  4A3F G;  1S5B D;  4JBW A;  5JJL A;  3RLO A;  2N8N A;  1V9P A;  2AQ2 B;  4POF A;  3MEF A;  2L0C A;  4MTN A;  2KCT A;  2D62 A;  1KLU D;  4K5X A;  2B63 H;  1C9O A;  2A6H D;  1B44 D;  2L9H A;  4RMF A;  1UUP A;  1C4Q A;  1F9Q A;  3S17 B;  4LFC Q;  1NY4 A;  4PMW A;  1UE6 A;  1AZQ A;  3PIP A;  1VQC A;  1BCP B;  2LS0 1;  2A69 C;  1HA5 A;  3PIP 3;  5J39 A;  3TQY A;  4GNX B;  3IRB A;  1EU3 A;  2PZT A;  1K28 A;  2CW0 D;  1CKM A;  4XYO A;  4X62 L;  3NEN A;  3E0E A;  4KY7 A;  4A3G H;  5CR3 A;  2F0H A;  2WB1 G;  5FO8 B;  3E9H A;  4C2M B;  5I2Y A;  2KCM A;  2XWB B;  1KC8 C;  2ZTC A;  1KHI A;  1KAA A;  3BJU A;  3TP8 A;  2E2J H;  1D5Z C;  1O80 A;  3FDT A;  4JI7 L;  1L0W A;  3GTP B;  1X54 A;  3TSS A;  3TZU A;  5DM6 3;  4A3J B;  1J9O A;  1G2T A;  1LT3 D;  2EOT A;  1AH9 A;  1YHA A;  4QJF A;  3CC4 A;  5EGT A;  2MJ8 A;  3OPO A;  2Z0S A;  1KIX A;  5CV8 A;  3FMC A;  4B3S Q;  1EWH A;  4R4Q A;  3ERQ A;  1C7Y A;  3FP9 A;  2YYZ A;  2HQE A;  4AH6 A;  1O7I A;  4A3B H;  4P74 A;  1VQG A;  4FF2 A;  4QQB X;  4KHV A;  3FKI H;  1KLG D;  2ZTD A;  3I4N H;  2JP1 A;  4K2K A;  1HZA A;  4C56 C;  1STB A;  5CBA E;  1EYC A;  3A7A B;  4BY7 H;  2BE5 C;  1B3Q A;  1HUM A;  2AHO B;  2RDG A;  4C3J G;  3DEP A;  3KJP A;  1R4P B;  4XQN A;  2RA4 A;  4NB3 A;  3SVM A;  4P72 A;  1LT5 D;  1CSP A;  4A93 H;  4N9T A;  1A0I A;  2IHF A;  4ME5 A;  2YV5 A;  4RGN A;  2OTL A;  1CQF A;  2JA7 G;  3J80 c;  1CK1 A;  1VQH A;  4H13 C;  1GKH A;  1A8V A;  3OOC A;  4JI1 L;  2SNM A;  2KEC A;  1FNW A;  1EOT A;  1SE2 A;  1CSQ A;  4L5Q A;  4DV0 L;  2ZT9 C;  1EWI A;  4GLA C;  1EYG A;  1O7Z A;  2B3G A;  3S1M H;  4GLX A;  3NTH A;  4HMJ A;  5FLX c;  2B8G A;  4K14 A;  2MGS A;  1VQ8 A;  4C3I H;  5IYB G;  3QIA A;  1PFM A;  3S2H H;  1IL8 A;  3QWN A;  1K73 C;  4NMZ A;  1VQO A;  4OEL B;  3MZ5 A;  3X3M A;  2FHT A;  3L0O A;  2E2I H;  2QDL A;  2M2L A;  2L11 A;  4BY7 G;  1TWF B;  3K5O A;  2FIN B;  5FJ8 H;  3MXG A;  1K3R A;  2F4V L;  4QF4 A;  1ZXT A;  5J1Z A;  1QG7 A;  3A8K E;  1W6K A;  2XNA C;  2EY5 A;  1OTC A;  2A73 B;  4JOI C;  4GNX C;  3SK6 A;  3V05 A;  3MXU A;  3HOY H;  3MVV A;  2VQE L;  2ASB A;  2HIV A;  2UXD L;  4YY3 L;  4DR1 L;  5C0X G;  3OWE B;  2N88 A;  1LLR D;  1R9T B;  1J8I A;  3KK7 A;  3K5M A;  2RSN A;  1JB7 A;  3HOX H;  2ZJP A;  1K0S A;  4K2L A;  1HNZ L;  5IYC G;  4DR5 L;  4TKO B;  3S1N B;  4PQX A;  1PFN A;  5LMN W;  5HGQ A;  1A62 A;  1XNQ Q;  3J81 j;  4L5T A;  3JC6 6;  4A3G B;  5FJ8 G;  1F2Y A;  4PZ6 A;  3HOW G;  2CHB D;  2F0V A;  1B2T A;  4LF5 Q;  3G4S A;  3PO3 G;  2WAQ E;  1QIL A;  2F0K A;  1WOC A;  2RCN A;  2F0T A;  1GHK A;  3VA5 A;  3EN2 A;  1YBY A;  4P75 A;  1MSG A;  3VR6 A;  1BVS A;  2DJG C;  2PCF B;  3RZD B;  4LFA L;  1FNU A;  2GA4 B;  3H94 A;  4JI5 L;  1F9S A;  1Z47 A;  2QGQ A;  3VYU A;  1KD1 C;  1BR9 A;  2ID0 A;  4XDX A;  3I56 A;  1ICW A;  1PYB A;  1ZEQ X;  4YHH L;  3OTO Q;  1JOK A;  1L0X B;  4KN4 C;  1SYG A;  1J5E Q;  1A3V A;  4GOP A;  4OO1 H;  1RCV D;  2R93 B;  2J7Z A;  3QOJ A;  3BYY B;  1V1Q A;  3CXC A;  2B2W A;  3I4N B;  2E5L Q;  4ZQ3 A;  1D7Q A;  2CWP A;  3D6W A;  3H3V I;  3K0Y A;  4DV1 L;  4KKT A;  2B2Y C;  3C2P A;  4YWL A;  2EYL A;  4IQZ A;  2M00 A;  1QB5 D;  2VB3 X;  4UP7 A;  2VZA A;  4KKS A;  4K0K Q;  1XJV A;  4DXG A;  2EYH A;  2F0O A;  1MJE A;  1EOV A;  4LUO A;  1YNJ C;  4DU9 A;  1WTX A;  2DNC A;  1X3G A;  1HQR D;  1RTN A;  3DHQ A;  3BDL A;  3K57 A;  2YTV A;  4HCS A;  3KBX A;  2OT2 A;  3DUZ A;  2K50 A;  2K5D A;  1WD1 A;  5I2X A;  3VR2 A;  1SDF A;  5KIX A;  4DV7 L;  2LSS A;  2Q2H A;  4R4I A;  3L2P A;  3S2H B;  2FJ2 A;  1ICF B;  4ALP A;  2GVA A;  2XTI A;  3A54 A;  4OWW B;  3PO2 H;  1DON A;  4I7Z C;  2BA1 A;  2JA8 B;  3PUW A;  1U9R A;  2JA5 H;  4RGT A;  3WOF A;  1VQD A;  3M4Y A;  1LV9 A;  1CZW A;  1STY A;  4IPC A;  5C4X G;  2K7V A;  5IYD H;  1VQA A;  1LTL A;  2E2H H;  1N32 L;  1E1O A;  3D4W A;  1KAW A;  5GAE C;  2AQ3 B;  4YCV A;  5D65 A;  3SHL A;  3NWT A;  2QDB A;  2IPK D;  2VQF Q;  4A3M H;  3Q23 A;  3HOY B;  3I7F A;  5M5Y H;  1BBU A;  4TVA B;  3CPF A;  2KCC A;  1D8L A;  3J81 E;  5M5X H;  3V2T A;  3CW2 C;  1N33 L;  2F1M A;  3HOX B;  5EJW A;  2K5V A;  1LAB A;  1V43 A;  3A7L A;  3W2D A; 
#chains in the Genus database with same CATH homology
 3U9S A;  3MTS A;  1NR2 A;  2QCP X;  1CA5 A;  5KGU A;  4KV6 A;  4PMC A;  1TT2 A;  4Q5V A;  2XRS D;  1HCZ A;  2NVX B;  1S4Z A;  1V1O A;  2EY1 A;  4H0L C;  5JEA G;  3TDQ A;  1GJX A;  5J22 A;  1S5C D;  3T53 B;  5FKA C;  4QMG A;  1PZJ D;  4CGY B;  5G3L D;  2NN6 H;  2Z1C A;  4KD3 A;  5EQ0 A;  5FO9 B;  2DNE A;  1UAP A;  3I91 A;  5C4Z A;  1Q12 A;  2RKS A;  2NBF A;  3SEB A;  3KBG A;  2PNR C;  3K5L A;  5G3L F;  5JPN C;  4A3D B;  2WAQ B;  5CV6 A;  1TS5 A;  2KEE A;  1SXT A;  3OMC A;  1SEB D;  5E3F A;  3DXJ C;  3WOE A;  2KCN A;  4BA2 I;  1WTR A;  4DNT B;  2EYF A;  1SYF A;  1RD9 D;  3SE0 A;  4K6D A;  1SMY D;  5I9O A;  3H09 A;  2OEO A;  2ENB A;  5D14 A;  4L8J A;  1NUC A;  2ZXR A;  4IUQ A;  5T1G A;  2WV6 D;  2Q8R E;  4F87 A;  4FXG C;  4RKB A;  1VF7 A;  1UNS A;  5EBD A;  2NTS A;  3PO2 B;  4I65 A;  1AFP A;  2JA6 B;  3MAQ A;  1G6Z A;  1EY0 A;  4IUT A;  2WP8 J;  2I07 B;  5I9P A;  2EYJ A;  1H9S A;  4BBR B;  2F0S A;  1IW7 D;  4BY1 B;  4XQQ A;  2F0U A;  2C5C A;  3MXP A;  4CKC A;  1F9P A;  2PW5 A;  4RGO S;  3URY A;  1ET9 A;  2Q8T A;  1JWS D;  4QUC A;  3OMG A;  3K6O A;  1SNO A;  5ELC A;  2B39 A;  2IL8 A;  5KYI A;  1GUW A;  3PIO 3;  1B9M A;  1CFM A;  1ZKO A;  1LTI D;  4MIU A;  4R9W A;  4HED A;  1TS2 A;  4C3H B;  4CJ0 B;  2WAC A;  3TZD A;  1STG A;  1TU2 B;  3SXH A;  2HCC A;  5JJZ A;  2EYO A;  2MPM A;  1ESF A;  4P2C B;  5EPL A;  4ZLT F;  4EQN A;  1HQM C;  4X3T A;  2EJM A;  4DAY A;  1KNA A;  4O42 A;  3VR3 A;  3KLR A;  2VUM B;  3MFY A;  1HFG A;  1TS3 A;  1HA6 A;  4BS9 A;  2HUG A;  3T13 A;  4FF3 A;  1STA A;  2QKI C;  4OIJ A;  3RMH A;  1Q8I A;  3P1H A;  2NWG A;  5CV4 A;  2RBM A;  1EZ8 A;  2AQ1 B;  3GV6 A;  4RH6 A;  4FP5 D;  1JWU D;  2IJ0 A;  3NQI A;  1DCZ A;  2RSO A;  2WKD A;  1V1P A;  4IUN A;  1Z6H A;  4IFD G;  2LY7 A;  2PPB C;  2G9D A;  5M5W B;  1A15 A;  2AUJ D;  5COY A;  4G57 A;  2MUY A;  2EPB A;  4OIK A;  5ELB A;  1EY8 A;  3BVM A;  2KOL A;  3R3O A;  1S5F D;  4K8I A;  3MA2 B;  1PRT D;  3HG9 A;  1YNN D;  4YIJ A;  2CQA A;  3MC0 B;  2SEB D;  1IKL A;  2O5I C;  1D5M C;  1STE A;  3AU7 A;  1TS4 A;  3AMU A;  2K05 A;  4F7X A;  1PRT F;  1GOZ A;  4RCN A;  1DYQ A;  2KA7 A;  1XWE A;  1B4O A;  2XWJ B;  2TMP A;  1JE4 A;  4TQU S;  1C48 A;  4S3S A;  3GTM B;  1PZI D;  4DGZ A;  3J81 L;  1I50 B;  3GTL B;  5FO7 B;  3VR4 A;  1AW7 A;  1RJT A;  5DNF A;  3N6R A;  1CM9 A;  1EQT A;  2SOB A;  2L12 A;  4FXK C;  1I3Q B;  4ZUI A;  3MFG A;  4IUP A;  1CI3 M;  2D9U A;  2RDF A;  3RD4 A;  4IZ8 A;  3NP8 A;  3M4O B;  5C3W A;  3FPP A;  3IKJ A;  2K04 A;  2VB2 X;  1LTG D;  3KLS A;  1SYB A;  1LT6 D;  2PMZ B;  5E4W C;  2IX3 A;  3P75 A;  1BUV T;  1BOS A;  1H9S B;  3OIP A;  1GHJ A;  4DN4 M;  1TQO A;  2NVT B;  4EQP A;  2R7Z B;  3C1E A;  4KTA A;  5IOC A;  2QEJ C;  2Z4H A;  3P7J A;  3X3N A;  1HHV A;  3CKI B;  4IAL A;  4A3K B;  1DJR D;  3TME A;  1K8O A;  3EVQ A;  5ELE A;  5IGF A;  5I6Y A;  5LHY 1;  1JOQ A;  1CHP D;  2D5D A;  5BN4 A;  1PTO D;  4J6H A;  2CVR A;  5M3F B;  4ZYS A;  3EJI A;  1VCI A;  3NTK A;  4ULL A;  2BCO A;  2Y0S B;  1IYU A;  5C44 B;  1FR3 A;  2B2T A;  2MHV A;  1F9R A;  1PTO F;  1CA6 A;  3PV0 A;  5F2D A;  1EY4 A;  4QCL A;  4A3F B;  1QJO A;  1QWY A;  1F2Z A;  1TWG B;  3SK5 A;  2O4X A;  4KMU C;  1CZG A;  2FMM A;  2LMC B;  3D31 A;  3HEJ A;  3MEH A;  3QB3 A;  3QOL A;  1BCP C;  3VYS A;  2EDG A;  4QUF A;  3IL8 A;  3I8Z A;  3C46 A;  2I46 A;  3V96 A;  1EIG A;  5CMD A;  1EY5 A;  4ZKC B;  2EYP A;  2G9H D;  2WB1 B;  1I4R A;  1OXU A;  3I4L A;  2R61 A;  3SDZ A;  4C3I G;  2F0P A;  5CV5 A;  1ZYR D;  2BDO A;  2B2U C;  1S5E D;  4DA2 A;  1T5E A;  3HOU B;  1Z7T A;  3S14 B;  1LTT D;  1PZK D;  1PRT B;  4CHT B;  2L4N A;  5EPJ A;  4Q0F A;  1TII D;  4V0B A;  1V1P B;  1Q90 A;  1BBX C;  1AN8 A;  1BQQ T;  2L55 A;  1EZ6 A;  4HSP A;  5C0X I;  3M3Y B;  4B9W A;  3Q6S A;  1FYC A;  4KN7 C;  3S15 B;  3I72 A;  3D4D A;  1B50 A;  2IT1 A;  3KLS X;  2C9O A;  4RWS C;  4BWG B;  4C3J B;  4G7H C;  5DEH A;  1JWM D;  4PV1 C;  4XQJ A;  1L0Y B;  3R2I A;  1A3T A;  1KAB A;  3D3R A;  3ND8 A;  5AFW A;  2AWO A;  1EWC A;  4BA1 I;  1U4R A;  1JB3 A;  1JC7 A;  3J7A F;  4KJN A;  5CV9 A;  1B9N A;  4ZRZ A;  5K5P A;  3QG1 A;  1IKM A;  3BS1 A;  4A3E B;  2K6A A;  1CTM A;  3K5N A;  1SYC A;  4OO1 G;  4HSV A;  3BYT B;  1FGB D;  1QNK A;  1D1K A;  3H0G B;  1EY6 A;  1PTO B;  3NQT A;  3HP3 A;  4X3S A;  4U67 3;  4KK7 A;  2F0Q A;  2L5T A;  5DAU A;  1OXS C;  5KNC A;  2EY2 A;  4GZY C;  3CHB D;  1WTO A;  1QOH A;  1TWA B;  2EZV A;  1NCV A;  4FO2 A;  3K58 A;  3E0J A;  5E4X A;  5C0X J;  1BDO A;  5ELD A;  3RZO B;  2Q8I B;  2PZW A;  4BBS B;  2X69 A;  1Y69 U;  3FRP B;  2A69 D;  2A6H C;  3NTI A;  1GUS A;  5JVG 3;  3U9O A;  4LJZ C;  1DOM A;  3LX0 A;  2F0E A;  1STN A;  4ABN A;  4F8M A;  1QE6 A;  4LAA A;  4ZUJ A;  4ILW A;  1H9K A;  4NW2 A;  2CW0 C;  5EKL A;  3UI2 A;  1G8Z D;  1AP0 A;  1DM0 B;  4XT1 B;  1PLF A;  3IAY A;  5C5M A;  2B8F A;  5HGT A;  5IGC A;  1II3 A;  1SNM A;  4NDX A;  1KTK A;  5IIF A;  1X3Q A;  2F0N A;  3WDN A;  2KED A;  1I4P A;  2K01 A;  1D5X C;  5C3E B;  1SNP A;  4KD4 A;  2ZXO A;  4F88 A;  3CRL C;  1QCB D;  1ENF A;  5T1I A;  2KHS A;  3I4M B;  2RDH A;  1LTB D;  3M7G A;  3NE5 B;  4N9P A;  3S16 B;  3BDO A;  4K5V A;  4EVO A;  1FD7 D;  3T56 B;  1GUT A;  4C3H G;  1SFO B;  1DD2 A;  3C1F A;  3AB9 A;  4CKB A;  3NSW A;  3T51 B;  1V8Q A;  4DAV A;  3NXW A;  1WTP A;  2NN6 G;  1PXU A;  4IUU A;  1RHP A;  1I6H B;  3T16 A;  3BG3 A;  3R8B A;  2K28 A;  2NB0 A;  3DMU A;  3TBI B;  5C4X B;  5A2Q L;  1ILQ A;  1G29 1;  3PUX A;  2F3W A;  1F77 A;  2F3V A;  5FK9 C;  1FNV A;  3OHX C;  5KRU A;  2D2C C;  1A3U A;  4PNY A;  1U4M A;  3S1R B;  1GUO A;  3DWA A;  3Q24 A;  2A74 C;  3S2D B;  4MN3 A;  5COR A;  3GTO B;  3H3V C;  5CC4 A;  3MWY W;  1X32 A;  1A2T A;  3I73 A;  2K1B A;  2AWN A;  3DM1 A;  4PMB A;  3H91 A;  2JXM B;  2PO4 A;  1F2M A;  1CQV A;  2QIL A;  5DM7 3;  5IGE A;  1ONL A;  4CJ1 B;  2NUC A;  5JEA J;  4L6T B;  4DNR B;  5IGG A;  1SE3 A;  1NAP A;  3HGB A;  4OL7 A;  5K36 H;  2IW3 A;  4FXD A;  2EVB A;  2EJF C;  3BDC A;  3S1Q B;  2J4X A;  3RUZ A;  3K7A B;  4RGM A;  1AEX A;  3FVQ A;  3MXN A;  4NP5 A;  1VDZ A;  1M8A A;  1E2W A;  3G7L A;  1EL0 A;  1G91 A;  1XTC D;  1EEF D;  3A8I E;  1RF2 D;  3DWP A;  5CYU A;  1ML0 D;  2F03 A;  3ITP A;  1CHQ D;  1U4L A;  1SYE A;  3OSO A;  1I4X A;  3I70 A;  4TRD A;  4IUV A;  3EA6 A;  4ZK9 B;  3GQB A;  1EIH A;  1JOO A;  2LKV A;  3VR5 A;  1JOR A;  1SBB B;  1IHZ A;  1BNZ A;  1JCK B;  1NR4 A;  2F0M A;  5KEE A;  3O13 A;  2B2W C;  2V4D A;  3G6J B;  2A6E D;  3T4A C;  1MI2 A;  1HTL D;  1BF4 A;  2JSO A;  4A3I B;  1Y8O B;  2K5Q A;  5C5L A;  1O78 A;  3BVZ A;  2SNS A;  5FOB B;  4IFD I;  3J80 E;  5C3X A;  2JE6 I;  3PMF A;  2YU9 B;  4G7Z C;  3DWQ A;  2PYK A;  3K59 A;  4JK1 C;  3CU7 A;  3MHB A;  2F4I A;  3EFX D;  5FLX E;  2R92 B;  3OWF A;  4EGV A;  3A8J E;  2IX0 A;  4X3U A;  3BZD B;  3HOV B;  2F0I A;  1DXM A;  3A56 A;  4MHE A;  1H9R A;  4KKU A;  1ILP A;  1LTR D;  3Q22 A;  4U68 A;  3ONA B;  5LL6 X;  1DOK A;  1D1I A;  1K8M A;  2F0J A;  4NKL A;  5JPM C;  3J7A V;  2BA0 A;  4UDU C;  3E5S A;  2F0W A;  4K5W A;  3SK4 A;  4FNF A;  1I4G A;  3GTJ B;  3ZYY X;  5IOD A;  2RQX A;  2AUK A;  4O1N A;  4Z9C B;  4FYD A;  1Y8P B;  5JOB A;  1RKN A;  3CQZ B;  3HKZ B;  3VYR A;  2B2V A;  1I4H A;  1PFB A;  2NVY B;  4DK1 A;  2IWH A;  3GTK B;  2F0L A;  1MBY A;  1SJE D;  5ISR A;  1XYI A;  3R93 A;  3KF8 A;  5EBC A;  5C4J B;  3NUC A;  1SNC A;  2KQ3 A;  2QF7 A;  3PUZ A;  1Q1E A;  1VMC A;  4XTC S;  4M1U B;  5ELF A;  4HCE A;  1O7Y A;  1EEI D;  2LFN A;  1E2V A;  5JAV A;  4R8I A;  3FEW X;  2EJG C;  5EPK A;  1UEA B;  2PZU A;  2XN9 C;  4DAP A;  4RHS A;  4E6I A;  1W6J A;  1OO9 B;  4IFD J;  1OXX K;  4LK1 C;  2XSC A;  2XVS A;  2A5H A;  1HTP A;  1D6E C;  5A2Q E;  1SMY C;  1SND A;  1C8C A;  1PTO H;  3L3O C;  3S9W A;  3QJY A;  1TKW B;  1LTS D;  3A55 A;  3NBI A;  1Y1V B;  1HUN A;  4CJ2 C;  1KDC A;  5D3I B;  1XXG A;  5BN5 A;  3HOZ B;  3L9A X;  4G7O C;  5C0X H;  1GXD C;  3IFT A;  4HTH A;  1CT1 D;  3ND9 A;  4V19 0;  3CRK C;  3D8G A;  1OXV A;  4Y7N B;  1Y1W B;  2DY7 A;  2K32 A;  4C1N K;  1SAP A;  1WTQ A;  3QO2 A;  3LWU A;  1AZP A;  1WD0 A;  2FMC A;  1Q1B A;  1IW7 C;  1TVX A;  1SE4 A;  4ODG A;  1B53 A;  3E6Z X;  5KYL A;  2VNU D;  1B1Z A;  1EU4 A;  2B63 B;  3KUP A;  4OHJ A;  1LTA D;  5EKI A;  3J7Y W;  2R6G A;  2A68 D;  1JIC A;  1SJH D;  1HPC A;  2E75 C;  4K6L A;  2NTT A;  5CBE E;  2K03 A;  3GV3 A;  5IT9 L;  1H9M A;  4RA8 A;  3LNN A;  5HUR A;  3C3L A;  2EXZ A;  2ZXP A;  3GP7 A;  2E2J B;  2DN8 A;  5C4H A;  4RHR A;  1ENA A;  3L7Z C;  4TSS A;  3TP5 A;  2TSS A;  4QB4 A;  4WFN 3;  2ICE C;  2JA7 B;  4DF7 A;  4L63 B;  5CV7 A;  2HCI A;  2M9V A;  5I6W A;  4CKE A;  3JAM E;  1EFI D;  4WOR A;  4X3K A;  3SK8 A;  2O5J C;  1F2L A;  4CBV A;  3ERO A;  1K83 B;  4A3B B;  2J0T D;  3TN2 A;  3PUV A;  4KHZ A;  1U4P A;  3NPP A;  3FKI B;  4R8N A;  4B08 A;  3Q0A A;  2PQE A;  1RDP D;  3F2U A;  1T5X D;  4KY6 A;  4FF1 A;  4BY7 B;  1A6X A;  3P20 A;  4DFA A;  4J1M A;  4A93 B;  2X6L A;  1MGS A;  1JQY D;  1KDB A;  1A2U A;  3VA7 A;  1TY2 A;  3M85 A;  2XRQ D;  3S1M B;  2EY6 A;  4H7B A;  4XT3 B;  4RAU C;  4C3I B;  3OW7 A;  1QNU A;  1H9J A;  2A6E C;  1IYV A;  4OO1 I;  3J80 L;  2E2I B;  2WII B;  1WTW A;  1PRT C;  1YNN C;  5I4D A;  2X6G A;  4XXE A;  5EKK A;  3TP7 A;  3HOW B;  2NZ1 D;  5FLX L;  3IFD A;  3PO3 B;  1DOL A;  4ZAI A;  1PMR A;  5JEA H;  2F0D A;  5TSS A;  2FFK B;  5LL6 S;  3NBH A;  1O7L A;  1LAC A;  4KY5 A;  1GUG A;  2E2D C;  4H44 C;  5NUC A;  1LO5 D;  1MD2 D;  2WKC A;  1SNQ A;  3PUY A;  1MSH A;  4HAE A;  4ZKB B;  4RCO A;  4B9X A;  1EYD A;  1XX8 A;  2IX1 A;  2NYZ D;  3EQL C;  2E74 C;  4WJW A;  3RLF A;  1EQV A;  4WRD A;  1M4V A;  2JEA I;  3GD7 A;  2KJX A;  4QIW B;  1ET6 A;  1S5D D;  1B3A A;  4RFB A;  1VMP A;  2JYO A;  1JR0 D;  2K5W A;  4IN3 A;  5E1F A;  1GUN A;  3GTG B;  5C6A A;  3I90 A;  1EYA A;  2BE5 D;  2R3Z A;  3M7N A;  4EQO A;  4HMI A;  4FF4 A;  1NSN S;  2JEB I;  3FPU B;  3W3A A;  1I4Q A;  1TR5 A;  1TY0 A;  1PTO C;  3R2T A;  1VF5 C;  2H1E A;  1OXT A;  1EY9 A;  1I6V C;  1Y8N B;  2B2V C;  2XIW A;  2KVM A;  1Q3L A;  4IUR A;  3TP6 A;  1HFN A;  4K8J A;  5M9O A;  2NN6 I;  1E0B A;  3GTQ B;  2B2U A;  2K33 A;  2BOS A;  1PDQ A;  2HDM A;  2L1B A;  2HDL A;  3D6C A;  2B2T C;  4C1N I;  1BCP D;  4RKL A;  3NWS A;  3NK9 A;  3LWE A;  2JA5 B;  2O2L D;  2KUM A;  1BCP F;  2E2H B;  1PYW D;  2E76 C;  2OF1 A;  1KNE A;  5D3D A;  2ICI A;  2WIN B;  1ZYR C;  4A3M B;  5M5Y B;  4AYB B;  1SYD A;  3NHH A;  2VXW A;  4M8A A;  3VYT A;  5M5X B;  1KDA A;  4HN7 A;  1WTV A;  4OGQ C;  1BO0 A;  5IT9 E;  2Z4I A;  1G2S A;  2BDN A;  1R4Q B;  1E2Z A;  1WVL A;  1TWC B;  2A68 C;  1WCM B;  2B2Y A;  2PW7 A;  2F0G A;  4HR7 B;  5KNB A;  3HS0 C;  1ENC A;  4DK0 A;  1ROD A;  3HRZ C;  1HRJ A;  1ESR A;  3D4R A;  2SDF A;  2H4O A;  1D2B A;  4J8Q A;  2MP1 A;  2N55 A;  1TWH B;  3OIQ A;  3HZX A;  5BN3 A;  3JAM L;  4IFD H;  3H6M A;  5K36 G;  1STH A;  5KND A;  2OXP A;  2Z8L A;  1HXY D;  4KI0 A;  2NVQ B;  4DXF A;  2EE1 A;  4XYQ A;  5IGB A;  1YNJ D;  3I3C A;  1RTO A;  3SR1 A;  2F0F A;  2RVL A;  1LT4 D;  1EY7 A;  4UAI A;  5IGD A;  4FVM A;  3N52 A;  1BXT A;  1SSO A;  5JVH 3;  2DY8 A;  4XIG S;  3DEO A;  2EYM A;  1DZ1 A;  3BVG A;  3GO5 A;  4KJO A;  4G4K A;  1X3P A;  5A35 A;  5CGK A;  5M3M B;  4ID6 A;  4LMQ D;  1S5B D;  4JBW A;  2AQ2 B;  2L0C A;  2D62 A;  1KLU D;  4K5X A;  2A6H D;  1B44 D;  2L9H A;  1UUP A;  1C4Q A;  1F9Q A;  3S17 B;  4PMW A;  1AZQ A;  1BCP B;  2LS0 1;  2A69 C;  1HA5 A;  3PIP 3;  5J39 A;  1EU3 A;  2PZT A;  2CW0 D;  4XYO A;  4KY7 A;  5CR3 A;  2F0H A;  5FO8 B;  4C2M B;  5I2Y A;  2XWB B;  1KAA A;  3TP8 A;  1D5Z C;  1O80 A;  3FDT A;  3GTP B;  3TSS A;  3TZU A;  5DM6 3;  4A3J B;  1J9O A;  1G2T A;  1LT3 D;  2EOT A;  5EGT A;  2MJ8 A;  3OPO A;  5CV8 A;  3FMC A;  1EWH A;  3ERQ A;  2YYZ A;  2HQE A;  4FF2 A;  4KHV A;  1KLG D;  2JP1 A;  4K2K A;  4C56 C;  1STB A;  5CBA E;  1EYC A;  3A7A B;  2BE5 C;  1HUM A;  2RDG A;  4C3J G;  3DEP A;  1R4P B;  4XQN A;  2RA4 A;  3SVM A;  1LT5 D;  4N9T A;  4ME5 A;  4RGN A;  1CQF A;  1CK1 A;  4H13 C;  3OOC A;  2SNM A;  2KEC A;  1FNW A;  1EOT A;  1SE2 A;  2ZT9 C;  1O7Z A;  3NTH A;  4HMJ A;  2B8G A;  4K14 A;  2MGS A;  3QIA A;  1PFM A;  1IL8 A;  3QWN A;  4NMZ A;  3MZ5 A;  3X3M A;  2FHT A;  2M2L A;  2L11 A;  1TWF B;  3K5O A;  2FIN B;  3MXG A;  4QF4 A;  1ZXT A;  5J1Z A;  1QG7 A;  3A8K E;  1W6K A;  2XNA C;  2EY5 A;  2A73 B;  3SK6 A;  3V05 A;  3MXU A;  3MVV A;  5C0X G;  3OWE B;  2N88 A;  1LLR D;  1R9T B;  1J8I A;  3KK7 A;  3K5M A;  2RSN A;  4K2L A;  4TKO B;  3S1N B;  4PQX A;  1PFN A;  4A3G B;  1F2Y A;  2CHB D;  2F0V A;  1B2T A;  1QIL A;  2F0K A;  2F0T A;  1GHK A;  3VA5 A;  3VR6 A;  1MSG A;  2PCF B;  3RZD B;  1FNU A;  2GA4 B;  3H94 A;  1F9S A;  1Z47 A;  3VYU A;  1BR9 A;  2ID0 A;  4XDX A;  1ICW A;  1ZEQ X;  1JOK A;  1L0X B;  4KN4 C;  1SYG A;  1A3V A;  4OO1 H;  1RCV D;  2R93 B;  2J7Z A;  3QOJ A;  3BYY B;  2B2W A;  3I4N B;  4ZQ3 A;  3D6W A;  3K0Y A;  4KKT A;  2B2Y C;  3C2P A;  2EYL A;  4IQZ A;  2M00 A;  1QB5 D;  2VB3 X;  4KKS A;  4DXG A;  2EYH A;  2F0O A;  4DU9 A;  1YNJ C;  1WTX A;  2DNC A;  1HQR D;  1RTN A;  3DHQ A;  3BDL A;  3K57 A;  4HCS A;  3KBX A;  2OT2 A;  3DUZ A;  2K5D A;  1WD1 A;  5I2X A;  3VR2 A;  1SDF A;  5KIX A;  3S2H B;  2FJ2 A;  3A54 A;  1DON A;  4I7Z C;  2BA1 A;  2JA8 B;  3PUW A;  1U9R A;  4RGT A;  3WOF A;  3M4Y A;  1LV9 A;  1CZW A;  1STY A;  2K7V A;  3D4W A;  2AQ3 B;  5D65 A;  3SHL A;  3NWT A;  2QDB A;  2IPK D;  3Q23 A;  3HOY B;  2KCC A;  3J81 E;  3V2T A;  2F1M A;  3HOX B;  5EJW A;  1LAB A;  1V43 A;  3A7L A;  3W2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...