2K4KA

Solution structure of gsp13 from bacillus subtilis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords General stress protein 13
publication title Solution structure of GSP13 from Bacillus subtilis exhibits an S1 domain related to cold shock proteins.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k4kA01
3S1QH 3KOJA 1H95A 3F2BA 3A0JA 4R4QA 2MO0A 4DR1L 3H3VH 4HIOA 3TREA 2UUAQ 2UUBQ 2NVXH 4B3MQ 1CKNB 1FVIA 2N8NA 1CKOA 1X6OA 3S24A 4OWTB 1N33Q 1HR0Q 3S1MH 1IBMQ 3AFPA 2QA4A 1XMOQ 4A3LH 4IPCA 5ELNA 3T1HQ 4JBMA 4UP8A 4J15A 4DV4L 1SLJA 2ATWA 3I4MG 3PIOA 5IP7G 1J5EL 4DR4Q 4AYBG 4LFBL 2DUDA 1XJVA 4HJ7A 2ZJQA 4JV5L 4L5RC 1Y1VH 4HIKA 4A3FH 2PQAA 3F2CA 2IHFA 4IFDI 4OO1I 3BZCA 4BXXH 3A74A 2OQ0A 3WWVA 4GNXB 3PUVA 4NXML 1JB7A 1JJCB 1EQRA 1A8VA 3CCJA 2Q2UA 4RG1A 5GADC 1VQCA 3S2HH 1SFOH 4YCVA 2R7DA 1HZAA 1SROA 3STBC 4X66Q 1T9HA 3EIVA 3ULLA 4JG2A 2K52A 4B3TL 3H3VI 3SGIA 5IYCH 3RN2A 4DV5L 3CF5A 1TXYA 4A3MG 1VQFA 3CCSA 4GOPC 1OXVA 1FGUA 2BA0A 5FLMG 2R92G 5GROA 3F8TA 5M5XH 4DUZQ 3L7ZC 1N34L 3HOYH 4YWMA 5H1SE 2CFMA 4L5SA 3TQYA 2ASBA 1KAWA 3CMEA 1Z47A 4DR3L 1S40A 1XNQQ 4LFAQ 5K36G 3J81c 1VS0A 2K14A 2N78A 4JCVE 2VUMG 1I3QH 2F4VQ 3GTGH 5C44H 3CMAA 4HJ5A 3NELA 3RN5A 4UP7A 1N8RC 4LF5Q 4KHPQ 3CC4A 4JI0L 4BBSH 1E24A 1XPOA 1Q12A 4A3BG 1IYJB 4DAMA 3ULPA 4GOPA 4UP9A 3ZJYC 2UUAL 3G6EA 1PHJA 2UUBL 4B3ML 4JI2Q 1XMQQ 3CXCA 4IOAA 1N33L 5C0XG 1AH9A 3GTKH 1HR0L 1IBML 4LFCQ 4GN3B 1TWAH 1NY4A 4ME3A 1XMOL 2R7ZG 3CPFA 4IFDG 3I4MH 4A3CG 3T1HL 5IP7H 3TS0A 4OO1G 2R6GA 3G48A 1JE5A 4DR4L 2IY5B 1VQ7A 2JA8G 2KENA 1C9OA 3PV0A 3GTJH 2C35B 3CCRA 5LMNW 2PNHA 2VQFQ 3HOVH 1SRUA 3PUWA 1Q81C 1HZ9A 1CKMA 1X54A 1IL2A 1HH2P 3M85A 4C3JH 3OYYA 1VQOA 1EOVA 3GTLH 3AQQA 3I2ZA 3MXNB 5BR8Q 3RNUA 2YU9H 2EXDA 2OCEA 2ES2A 4A3DG 2PI2A 1L1OB 1K73C 4X66L 5C4XG 5M5WH 1C7YA 3HOWG 2VNUD 3L2PA 2K5VA 4IJHA 4A3MH 1QUQA 1W2BA 5FLMH 3UDFA 3OTOQ 4DV3Q 2GVBA 1YIJA 3J7A5 3KYHC 4DV2L 2E2JH 4B3SQ 4LF8Q 4DUZL 2HT1A 3ERSX 3GD7A 1V9PA 1WOCA 3CCMA 3KJOA 2JEBI 2WB1E 1PV4A 1XNQL 3GTMH 4BXXG 4LFAL 4RMFA 2DGYA 1MKHA 3S15H 1EWIA 2F4VL 5GAHC 3CQZH 3BJUA 4LF5L 4KHPL 1QVFA 4A75A 4A3BH 4QL5A 3UE0A 3J81j 1WCMG 2YYZA 4HJAA 3GO5A 2VQEQ 4JI3Q 2NVQH 4A3GG 3J80i 2BA1A 3M4OH 3UDXA 3PIPA 1YEZA 4JI8Q 4QQBX 2AMCB 3ULJA 1U5KA 1E22A 5IYCG 4JI1Q 1XMQL 4A3JG 4JI2L 1VQGA 4YWKA 3CCUA 4QY7A 2R7ZH 2D0PA 5C4JH 2WAQG 5C0XJ 1PH9A 1WI5A 1ASZA 4LFCL 4A3CH 4R4TA 1KRTA 3U50C 1HNXQ 3HOYG 2IT1A 4R4IA 4DR6Q 2JA8H 4A4IA 3UE1A 1X3EA 1GVPA 2V1CC 1KD1C 2I5LX 4ALPA 3PO3G 4DKAC 4GN4B 1E3PA 4B3RQ 2VQFL 2LSSA 4DV2Q 1VQMA 4BBSG 1TWGH 1GO3E 3CC7A 4POGA 3S16H 4H02A 3TEHB 2L15A 2KHIA 4JI6Q 3OW2A 1PH5A 1VQHA 2KCTA 4DR5Q 3GTOH 4P73A 1U0LA 1Q1BA 1NE3A 4A3DH 5BR8L 2K50A 1YHQA 3CCLA 5C4XH 2VY3A 3DM3A 3FKIH 2HIVA 4AIMA 1PFSA 2MO1A 1FJGQ 3HOWH 3HKSA 3DLLA 1PH3A 4LF6Q 2RCNA 2AHOB 2A8VA 3K8AA 2UXCQ 1I6HH 1AE2A 5C0XI 3OTOL 4DV3L 1OXTA 1YJ9A 1K83H 1RIPA 3KF8B 4C2MH 1GD7A 4B3SL 4LF8L 1PYSB 3Q8DA 2E2IH 3TRZA 1Q46A 3HOVG 1YVCA 1PH4A 4GKJQ 4K0KQ 1GKHA 5JJIA 2HHHQ 1YZ6A 2FXQA 1J6QA 1WCMH 4UPAA 3CCEA 2I0QA 1VQAA 2UUCQ 3HOXH 3JAMi 4A3GH 2VQEL 3EN2A 1X56A 4JI3L 4JBWA 1DGSA 2JA9A 2CKZB 4LUVA 2N49A 1L0WA 2Z6KC 4X64Q 5M3FH 2GVAA 1M1KC 4JI8L 4A3JH 1UEBA 4DV1Q 4P74A 4A3IG 4AH6A 4DR2Q 1N36Q 4JI1L 5AJ3Q 3KF6A 4XTCS 1B70B 5JJLA 4X65Q 3K7UC 2I5HA 3J7ZC 3U4VA 3G71A 3KDFB 1HNXL 4P75A 4DR6L 1KQSA 2WB1G 4DR7Q 1VQPA 1Y1WH 2HIXA 1IBLQ 5C3EG 2PMZE 2IHEA 4UY8C 3PO3H 1HZCA 2B29A 1B8AA 3S1NH 2Y0SE 2LXJA 4BY7G 2QGQA 3PUXA 4B3RL 2CWPA 2I5MX 4KHZA 2EQSA 3HKZE 3CW2C 3FHWA 2Z6KA 4KLKA 1P8LA 3K80C 3CCVA 1EFWA 5GAGC 2CWAA 4JI6L 3CP0A 1PYBA 1VQ6A 2JJQA 4DR5L 4GKKQ 4A93G 5FJ8G 3E9HA 3KJPA 1RL2A 1I50H 2UU9Q 1NTGA 1SN8A 3H0GG 4BA2I 1V43A 5IYBG 3S1RH 2ZJPA 2EIFA 1OXUA 3AYHB 1FJGL 4WJ4A 1IBKQ 2IX1A 3RZDH 4LF6L 2PQAB 4A3EG 2UXCL 2B63G 1TWCH 2KCMA 2NN6I 1NMFA 4YY3Q 5JJKA 1LYLA 1G6PA 1KIXA 1WYDA 2HQLA 1VQKA 3TS2A 4JBJA 1LTLA 1Q86C 1CSQA 3A5UA 2UXBQ 2XGTA 5C44G 1QZGA 1EIFA 4GKJL 1HNWQ 1X9NA 4K0KL 4IJLA 5GQOA 2HHHL 4GLVB 4Y7NH 2ID0A 3PUYA 4X6AH 2UUCL 1VQIA 1XNRQ 3JC66 5JEAJ 3FKIG 5FLXc 4L5TA 4LF9Q 1KL9A 4FDBA 4X64L 4AYBE 4A3IH 1PH6A 1EYGA 3PO2H 2Z0SA 4DV1L 4IO9A 4EX5A 1N36L 4DR2L 1E1OA 5AJ3L 4BBRG 2MQHA 1SE8A 4X65L 3CPWA 1I94Q 3G4SA 3M3YH 3AFQA 1VQ8A 2KBNA 3PF5A 3PF4A 4DUYQ 4PZ7A 1PH7A 1S3OA 4DR7L 5C3EH 1KXLA 4IPGA 1IBLL 4OX9Q 4LUOA 1YITA 2D62A 4BY7H 5LMNQ 1Q8KA 4GNXC 1VCIA 1XPRA 4GOPB 5IYDH 4DNIA 1CKNA 2OTJA 1NBWA 3PGZA 2K5NA 1A62A 4AQYQ 3HOXG 4OWWB 4JOIC 1HNZQ 1YI2A 3HOUH 3J81i 5FJ8H 4A93H 1IXRA 4GKKL 4JYAQ 4DK3C 1O7IA 3H0GH 5M3FG 5IYBH 5IWAQ 1UE6A 1G51A 5E7NA 2UU9L 4R1JA 2NN6G 2NVYH 3H15A 5HGQA 2ZTEA 4WJ3M 2MNAA 3IRBA 1GM5A 4A3EH 1IBKL 1Z9FA 4YCUA 2JA6G 3UDGA 3M9BA 1YHBA 2JE6I 2B63H 1Y1WG 1E1TA 4GNXA 3A5ZB 3D31A 4YY3L 4BY1H 4NXNQ 4LF7Q 1AE3A 5IY0A 1HR0W 3VDYA 3K81C 1B7YB 1LM0A 4JOIA 4JBKA 1CSPA 1VQEA 2MFIA 1UWVA 1PA6A 2A1AA 4P72A 2UXBL 5DLQE 4X62Q 1L2FA 1BBUA 2Q2IA 5ELOA 1X65A 4GLAC 1EUJA 2PI2E 1HNWL 1JT8A 4YHHQ 1BVSA 1BBWA 3S2DH 2RHSB 1QUQB 2VW9A 4JI4Q 4DV0Q 1XNRL 4POFA 3I56A 4LF9L 3L0OA 4YWLA 1PH8A 1VQ5A 4LUZA 1YBYA 2R93H 4BBRH 4LF4Q 3I4OA 2UXDQ 4QGUA 1EIYB 1YHAA 3AEVA 4L5QA 3T1YQ 2E8GA 1I94L 3RLFA 1K9MC 3I7FA 2NZOA 2WFWA 2JK8A 4JI5Q 3B6YA 4DUYL 3UDIA 4A3KH 1ASYA 4OWXB 1K0RA 4OX9L 1LUZA 1KRSA 3GTPH 1G291 4GLXA 4NPSA 5LMNL 4MNOA 3LGJA 4KI0A 2BH2A 5JEAG 4PG3A 2QEXA 2CCZA 4AQYL 3W5OA 4DAYB 5IP9G 1HNZL 3NEMA 1K8GA 4JC0A 2ZM6Q 1VQLA 4JYAL 2ALYB 1PH2A 3S14H 2JA5H 1L1OC 5IWAL 3PO2G 1FL0A 1D7QA 2OWOA 3PCOB 4PZ6A 3BZKA 5EAYA 4DV6Q 2K4KA 2NZHA 2JA6H 4OONA 3K0XA 3F1ZA 1MJCA 4GS3A 1OTCA 3FP9A 4NXNL 4R4CA 4LF7L 3HFZB 1SMXA 2ZJRA 1N32Q 1C0AA 1W3SA 1I5FA 1JJ2A 2GN5A 5IYDG 4PMWA 4DK6C 4X62L 4O2DA 3RZOH 2K5HA 3F2DA 1L1OA 1TWHH 3HOUG 3RLNA 1OXXK 1HZBA 4YHHL 1Y14B 1V1QA 2K75A 2WAQE 3ER0A 4JI7Q 4JI4L 3KFUA 1WJJA 4DV0L 3J80c 2YTXA 3M4PA 5M3MG 1VQJA 1HJPA 3M7NA 4LWCA 1R9TH 3BU2A 2D0OA 2VS1A 4GN5A 1YJNA 1NMGA 2Q2TA 4LF4L 2UXDL 2H5XA 2AWOA 4DV7Q 1X3FA 2F3IA 4YCWA 3T1YL 4BY1G 3U4ZA 5LMUQ 2YV5A 3MEFA 3M4QA 4JI5L 1CUKA 2E5LQ 1X3GA 4DPGA 2OTLA 1XTDA 4HJ8A 4LNQA 4APVA 4XIGS 1NJIC 3I4NG 2F52A 5IT9c 4NB3A 5IP9H 4IOCA 2JA7G 3HOZG 3KF6B 3NBHB 1WFQA 2ZM6L 1A0IA 3E0EA 2Q2HA 4A76A 1S72A 2R93G 2N3SA 1E7ZA 1Q1EA 2RF4A 3CCQA 4HIMA 3E9IA 3CC2A 1X55A 4IPDA 4DV6L 1Q7YC 1JJGA 2OQKA 1QZHA 4DR1Q 1TWFH 1VQ4A 1D8LA 1K3RA 2ZTDA 2JQOA 3EBEA 4A3KG 4QIWE 4QJFA 4O0AA 1YJWA 2XTIA 4MTNA 1BKBA 2YTVA 3GDEA 2AWNA 1UE1A 2B3GA 3PUZA 1K8AC 1N32L 2ZTCA 1MIUA 4DV4Q 3D0FA 3W1BA 5IE8A 4A3LG 1QVGA 1J5EQ 3KLWA 4Y52H 2R92H 4LFBQ 2R7FA 2E2HH 4JV5Q 1YNXA 2IX0A 4LW1A 4P71A 4TQUS 1OXSC 1UE5A 1Y1VG 1PH1A 4A3FG 3PSIA 2JA5G 1MJEA 4JI7L 3JAMc 5M3MH 2VL6A 1M90C 3K7AH 2VUMH 4NXMQ 1EQQA 3GTQH 2CQOA 4IPHA 3S17H 4BA1I 1VQNA 1A63A 2RHQB 1VQ9A 4R4OA 5GAEC 3STBD 5HY6A 3ICEA 3W1GA 4DV7L 1KC8C 2Y0SG 2VZAA 1VQDA 3U58A 2LXKA 5LMUL 5M5YH 3HKZG 4HJ9A 3NENA 4EQ5A 2JEAI 2E5LL 4B3TQ 4C3IH 4DV5Q 3I4NH 1KHIA 2YTYA 2AKWB 1JMCA 1PVOA 1XPUA 4OXPA 1IZ6A 1P16A 1UE7A 4PZ8A 5J3BA 1N34Q 2JA7H 2WP8J 3HOZH 2BH8A 1QVCA 4HIDA 4DR3Q 4IFDJ 3I55A 2A19A 2NVTH 2KHJA 1SR3A 1Q82C 1N9WA 3CAMA 3KDFA 4C3HH 3CD6A 4MZ9A 4TVAB 3RR5A 1VQBA 4JI0Q 3RLOA
chains in the Genus database with same CATH superfamily
3FPUB 4RH6A 4HIOA 3TREA 4B08A 5KNBA 2UUAQ 2NVXH 3D4DA 1FVIA 4QB4A 3S24A 2IPKD 3GTOB 1VMPA 4MHEA 1EY7A 3AFPA 1XMOQ 5ELNA 3KK7A 1SNMA 1SLJA 3BYTB 3C1EA 3LNNA 2PCFB 3PIOA 1SMYC 4L5RC 2I07B 4HIKA 4GNXB 3PUVA 1MD2D 1ENCA 1AN8A 3ND8A 5FOBB 2FMCA 1ICWA 4C3JG 3PQIA 3GTPB 2D9UA 2F0PA 3STBC 3EIVA 3ULLA 3H3VI 3CF5A 1TXYA 4A3MG 5M3FB 4CHTB 2ICIA 2JN4A 3F8TA 3L7ZC 3HOYH 3SK8A 2QF7A 4YWMA 3TQYA 3CMEA 1XNQQ 2F1MA 4LFAQ 3NWTA 1SNOA 2N78A 4JCVE 1I3QH 1Y1WB 4H7BA 3CMAA 3CC4A 1JOOA 3A8KE 1KNAA 4S3SA 1BO0A 4RAUC 2V4DA 3G6EA 2UUBL 1TWHB 1XMQQ 5C4HA 1HR0L 1IBML 4GN3B 2R7ZG 4RFBA 4IFDG 3T1HL 5IP7H 2R6GA 2ZT9C 4DR4L 2IY5B 2Q8TA 1TWCB 1AFPA 2HDMA 1H9SB 2WKCA 5CORA 1HH2P 2JXMB 4XT3B 1IKLA 1GUOA 1HFGA 5HURA 3R2TA 3R93A 2K5VA 3BVZA 4LMQD 5FLMH 3IFDA 3OTOQ 2GVBA 3PO2B 5J39A 2A69D 2L5TA 1CK1A 4B3SQ 2RDHA 1FNUA 2HT1A 3GD7A 3CCMA 2WACA 3KJOA 4E6IA 1MKHA 2DGYA 4UAIA 1TWFB 1EOTA 5GAHC 2DY8A 1W6JA 4LF5L 2ZXOA 1QVFA 4G7HC 1FNWA 1M4VA 3NPPA 3GO5A 3M4OH 3SR1A 5C0XH 1E22A 1KLUD 4JI1Q 2F0QA 1TVXA 3CCUA 4QY7A 5C0XJ 4OO1H 1S5ED 1QB5D 3U50C 3HOYG 5FKAC 1BNZA 2EY1A 5CV4A 3OW7A 1GVPA 4ALPA 4BY1B 4B3RQ 2BDNA 2VQFL 4DV2Q 1VQMA 1IYVA 3S16H 3TEHB 2KHIA 1PH5A 1VQHA 2KCTA 4C3IB 1QOHA 3GP7A 2XVSA 1PFMA 2K50A 3CCLA 5C4XH 3SVMA 2VY3A 3J80L 3HKSA 4G57A 3BYYB 2A8VA 3MHBA 3NP8A 1AE2A 1H9MA 4C3HB 5C3XA 2F4IA 3DM1A 2E2IH 1JOKA 3I8ZA 1F2LA 1YVCA 1DXMA 4ZUIA 3AU7A 4K0KQ 1ENAA 4TRDA 5JJIA 1X3PA 2I0QA 1XX8A 3E6ZX 2UUCQ 3I73A 3S1MB 5CBAE 2VQEL 4JBWA 2CKZB 2KJXA 4KV6A 4KN7C 2Z6KC 3ONAB 1UEBA 4A3IG 1H9RA 2HDLA 1G6ZA 3H94A 3NBHA 3S14B 4KJOA 3DUZA 4X65Q 1JWSD 3J7ZC 3U4VA 4LJZC 4P75A 4DR6L 4V0BA 1VQPA 5CV9A 3GV3A 3DMUA 4RGTA 2PMZE 2IHEA 2LKVA 3PO3H 2B29A 2Y0SE 1EYCA 1FYCA 4ILWA 5FO9B 4BY7G 3PUXA 2CWPA 2F0DA 3HKZE 1SFOB 2Z6KA 2KOLA 2CWAA 3CP0A 3DEOA 4QF4A 1SEBD 1I50H 4ABNA 4BA2I 2EY5A 5EQ0A 2GA4B 2EIFA 3T56B 5M5XB 3EROA 4ZLTF 4LF6L 1MI2A 2B2YC 5CV7A 5JJKA 1LV9A 1Q8IA 1G6PA 4G4KA 1VQKA 1LTLA 2N55A 3OMCA 2UXBQ 2H1EA 1XYIA 1QZGA 5IGEA 3RUZA 1XNRQ 3JC66 4LF9Q 1TWAB 2B2YA 2CW0D 4Q0FA 4KY7A 1A3TA 1HQRD 2EXZA 1EYGA 2MP1A 2Z0SA 3J80E 2MQHA 2CH4W 1SE8A 3G4SA 1KTKA 2RCFA 4DUYQ 3MC0B 3N6RA 3P20A 4H13C 4C3JB 1Q8KA 1VCIA 1XPRA 4KD4A 4XQJA 4CJ2C 2YU9B 3HG9A 2M2LA 2FFKB 3HOUH 4C1NI 1S5CD 2KA7A 1IXRA 4A3MB 2PNRC 1SE4A 1UE6A 1PTOH 4FF2A 2MNAA 2EJFC 3IRBA 1GM5A 3E5SA 1BUVT 4ZKCB 4BS9A 3M9BA 4RGOS 2B63H 2JE6I 2QILA 4WJWA 3S17B 5JPNC 3A5ZB 3D31A 4YY3L 1WTQA 4QMGA 3CQZB 1AE3A 1HR0W 1CSPA 1VQEA 2MFIA 2FINB 3IAYA 4P72A 3O13A 1X65A 1EUJA 2PI2E 1JT8A 1BBWA 2B2UC 3K58A 2VW9A 2R7ZB 2G5DA 5C4JB 1MBYA 2L9HA 5J1ZA 1PH8A 3BDOA 4LF4Q 2LMCB 2NUCA 3AEVA 1WTVA 2TSSA 3SK6A 2SEBD 4OWXB 1HTPA 1YNJD 1K0RA 4OX9L 2B2UA 4BWGB 4KHVA 4WFN3 3GTPH 2BOSA 2A68D 3W5OA 2KCNA 3NEMA 2ZM6Q 2ALYB 1PH2A 1I6HB 1L1OC 5IWAL 1D7QA 4PZ6A 5EAYA 1KDAA 4DV6Q 3HZXA 2NYZD 2K01A 2Z4IA 4ULLA 1PRTC 2XWJB 1I5FA 2K05A 5T1GA 1JJ2A 4DK6C 4X62L 1BQQT 2K5HA 1L1OA 1TWHH 3HOUG 3RLNA 4YHHL 1V1QA 4JI4L 3KFUA 2H4OA 3HOYB 3FEWX 2YTXA 5M3MG 2BDOA 1HJPA 2H5XA 3MVVA 2JYOA 2F3IA 1SYEA 1KNEA 3U4ZA 1TQOA 1IKMA 4OEMB 1UNSA 1KABA 1CUKA 1EWCA 1XTDA 3EA6A 1T5EA 5AFWA 1NJIC 2BCOA 2F52A 3I4NG 4IUNA 3S1RB 2C9OA 4IOCA 1CTMA 3NBHB 4K2LA 4OHJA 1A0IA 3MA2B 2HQEA 3E0EA 3SHLA 1S72A 2N3SA 1ZXTA 4ZK9B 3J7AF 1LTBD 4IPDA 1JJGA 5EJWA 1TWFH 1VQ4A 1GUWA 3MEHA 2NZ1D 2Z9HA 2EDGA 3WDNA 2YTVA 3W3AA 2HCCA 2RA4A 1QVGA 4PMCA 4C1NK 3MXGA 2R7FA 3NE5B 4A3IB 4DAVA 1MJEA 1U4LA 2NBFA 3QR8A 4M8AA 5I9OA 5DAUA 3M3YB 1K8MA 4RGMA 1VQNA 4DNTB 2RHQB 3SDZA 5GAEC 5HY6A 4DV7L 1KC8C 4FXKC 4BY7B 2NWGA 5LMUL 2DNCA 3NENA 4EQ5A 4C3IH 3M4OB 1QWYA 5EKIA 3K5NA 3Q22A 2AKWB 1JMCA 3OSOA 1P16A 2F0UA 4HIDA 4DAPA 3W2DA 4DU9A 1Q82C 4C3HH 3F2UA 5C44G 3T53B 5DLQE 4FF1A 3RLOA 4FO2A 1AZQA 2BE5D 2A74C 3H3VH 4V190 2UUBQ 2J0TD 2A6HC 1CKOA 1X6OA 1HR0Q 3S1MH 1L0YB 4K2KA 2PZWA 1IBMQ 2QA4A 4IPCA 2OT2A 3T1HQ 2AQ1B 4J15A 5IODA 3SK5A 3VYTA 1J5EL 4AYBG 4DR4Q 4J1MA 1XJVA 2ZJQA 5LL6X 1MSGA 2Z8LA 2X69A 4K6DA 1DM0B 1RDPD 3VR4A 1LT5D 3KBGA 1A8VA 2Q2UA 2ZXPA 4RG1A 4CDEC 1G2SA 3PIO3 1SFOH 5LHY1 4RGNA 4H0LC 4HAEA 1A3VA 2K52A 5IYCH 1D5XC 3QJYA 1FGUA 5M5XH 1STBA 3NQIA 3TP6A 2ASBA 2K6AA 2A6ED 4KKTA 3J81c 4CDFC 4HJ5A 3NELA 2RKSA 1N8RC 4LF5Q 3OMGA 2RSOA 1E24A 1XPOA 1Q12A 1IYJB 5I6YA 3ULPA 3RZOB 2A5HA 4IOAA 1EY6A 1I50B 4M1UB 1SNDA 4XDXA 1TWAH 1NY4A 2KCCA 3NTHA 4ME3A 4A3CG 3V96A 1A6XA 1F77A 5C5MA 4WORA 1IHZA 1JCKB 1NSNS 2JA8G 3PV0A 1PDQA 5E3FA 3CCRA 2VQFQ 5C3WA 5E1FA 1Q81C 3K57A 2R61A 3M85A 4C3JH 3OYYA 3VR5A 2MHVA 1A15A 3I2ZA 2R3ZA 3RNUA 2YU9H 3D4RA 4KMUC 1L1OB 3H3VC 4X66L 1C7YA 3HOWG 3L2PA 1S4ZA 1K0SA 4A3MH 1E2VA 2EOTA 3FDTA 1YIJA 4DUZL 3ERSX 4F8MA 2WB1E 1EY5A 1T5XD 1GUGA 4DA2A 1PRTB 2F4VL 2NB0A 3CQZH 1BDOA 2AQ3B 2DNEA 3BJUA 2O5JC 4KHPL 1RJTA 4A75A 3J81j 2XRQD 4NW2A 1RTNA 2VQEQ 4A3GG 4JVZA 3J80i 3UDXA 5KYIA 3PIPA 3HOUB 2WIIB 3QO2A 5IYCG 4JI2L 4DAYA 1B9MA 2R7ZH 2D0PA 5C4JH 2F0NA 1PH9A 4LFCL 2IT1A 4DR6Q 2QKIC 5M3MB 3C1FA 3K7AB 3GTQB 3OIPA 1FR3A 2L4NA 1WD1A 1HA5A 3CC7A 4POGA 1HPCA 2M00A 4H02A 5M5YB 2L15A 2OF1A 5A35A 4FXDA 2F0IA 3D6CA 1PLFA 2NTTA 3I4NB 1Q1BA 5KNDA 1CZWA 2PYKA 1B53A 3FKIH 1PTOD 2HIVA 1PFSA 4XYQA 4LF6Q 1I6HH 3NXWA 4DV3L 1CA6A 5E4WC 1GD7A 2E75C 2LS01 4LF8L 3S1QB 1LTSD 1PH4A 4MN3A 3D4WA 1GKHA 3MTSA 2FXQA 1J6QA 1GOZA 4UPAA 5EKLA 3HOXH 4JI3L 1X56A 3BVMA 1L0WA 1AP0A 2N49A 1M1KC 3L3OC 2RVLA 4I7AA 4AH6A 1EY8A 3FVQA 5JJLA 1CFMA 1DOLA 3VR2A 2RDGA 4ZYSA 1HNXL 5JJZA 3LWEA 5KRUA 4UY8C 1HZCA 3C46A 2FHTA 1I4RA 4KHZA 3A7LA 1P8LA 3TBIB 5GAGC 2F3VA 1LT6D 4KD3A 5C5LA 1PYBA 3VYSA 1VQ6A 4DR5L 3KJPA 1RL2A 1SN8A 5I2XA 3H0GG 5IYBG 3S1RH 2RBMA 3AYHB 3TMEA 4F88A 1SXTA 1BCPB 4A3EG 2HCIA 2UXCL 3GTGB 4YY3Q 2NN6I 1NMFA 4N9PA 2DY7A 5C44B 1LYLA 5I2YA 1EIHA 3K6OA 3TS2A 3A5UA 2XGTA 1KDBA 1DJRD 4ZUJA 5C6AA 5CBEE 4GKJL 1HFNA 1X9NA 2PZTA 2HHHL 4GLVB 1B50A 1D2BA 2FJ2A 2ID0A 1K8OA 3PUYA 2IWHA 2SOBA 3HP3A 3FKIG 1EEID 1I4PA 1LT4D 3ND9A 4A3IH 4X64L 4AYBB 4IO9A 4DV1L 1N36L 5AJ3L 3GTJB 1EZ6A 3CPWA 2J7ZA 3M3YH 4FXGC 3U9OA 3PF5A 3PF4A 4DR7L 1S3OA 1LABA 1ONLA 1PYWD 1IBLL 3AB9A 4OX9Q 1YITA 4OIKA 4NP5A 4ZKBB 4BY7H 3GTLB 5IYDH 3V05A 4DNIA 2MJ8A 2K5NA 5IGFA 2K5QA 3HOXG 3L9AX 5JOBA 4DK3C 1O7IA 5IWAQ 2NVYH 2ZTEA 2E2JB 3TZDA 1IBKL 3ZYYX 5IGDA 3S15B 1YNNC 1LTRD 3BS1A 5IY0A 3VDYA 3K81C 1B7YB 4JBKA 1ZKOA 2EY6A 2A1AA 2X6LA 3OWFA 2NVQB 4X62Q 1BBUA 1JC7A 2F0JA 2K03A 4YHHQ 3C3LA 2RHSB 3IFTA 4JI4Q 1V1OA 2AQ2B 3I56A 4ZQ3A 1GJXA 3J81L 3SEBA 5M9OA 5KYLA 1VQ5A 3DWAA 2JA8B 1PFNA 1HUNA 2QDLA 3I90A 1NR4A 1I4GA 2E8GA 1O80A 3RLFA 1I94L 1SYDA 2MPMA 1WTWA 2JK8A 1U4MA 1ZYRD 2B2WC 1IW7C 2I46A 1JWMD 4GLXA 1C48A 1JWUD 3LGJA 1B44D 1EY9A 4PG3A 1D6EC 3HOWB 5ELEA 1CT1D 5NUCA 4DAYB 1JQYD 1PZKD 4XQNA 4JC0A 2JA5H 1FL0A 3PCOB 4PNYA 2EYMA 4OONA 4CBVA 2B2WA 3F1ZA 1C8CA 4GS3A 3D6WA 1ILQA 1OTCA 4NXNL 2X6GA 3HFZB 1C0AA 1B4OA 4A3GB 3MXNA 5IYDG 3RZOH 2F0VA 3F2DA 4XQQA 1AW7A 4I65A 1EWHA 1Y14B 1FGBD 1WTPA 1NNXA 1WJJA 4DV0L 2RSNA 3M4PA 1DONA 3M7NA 5CV6A 2XRSD 2XWBB 2VS1A 1D1KA 2J4XA 2Q2TA 4DV7Q 4YCWA 4RCOA 3T1YL 3S1NB 1HQMC 5LMUQ 3BDCA 1X3GA 4DPGA 2OTLA 1E0BA 1SYFA 1JR0D 2EYLA 2M9VA 4JPBW 4ZCKA 4QUFA 5IT9c 2F0WA 3HOZG 1WFQA 3FRPB 4A76A 1LACA 3J81E 1PFBA 3CCQA 5I9PA 5JAVA 3NQTA 1TIID 1O78A 1K3RA 3EBEA 3NWSA 4QJFA 1SBBB 4O0AA 4QIWB 1PXUA 1EFID 1BKBA 1S5DD 1N32L 3DXJC 1SMYD 1QNUA 4A3LG 3W1BA 1J5EQ 4Y52H 2R92H 4C56C 1YNXA 2IX0A 4G7ZC 1OXSC 1UE5A 1Y1VG 2LY7A 3QB3A 5CV5A 4A3FG 1PH1A 2JA5G 3JAMc 4JI7L 5K36H 5M3MH 2VL6A 3IKJA 3K7AH 1D5MC 1EQQA 2CQOA 2F0GA 3GTQH 2SNMA 3ITPA 1VQ9A 2VXWA 3STBD 4FVMA 2K28A 2QCPX 1D5ZC 2LXKA 5M5YH 4J6HA 4QCLA 1PTOF 3MAQA 2TMPA 3I4NH 3FPPA 4O42A 2L11A 1KHIA 4DN4M 4HSPA 4U673 3H0GB 4OXPA 1IZ6A 1QG7A 3I91A 4PZ8A 3HGBA 3QIAA 4KJNA 2F0FA 3I55A 2A19A 4A3EB 2KHJA 3CKIB 3KDFA 4MZ9A 1PMRA 4LUZA 3SK4A 3S1QH 1NUCA 4Q5VA 1H95A 3F2BA 3A0JA 1RODA 1QCBD 1SJHD 4R4QA 4DGZA 3NTIA 2MO0A 4DR1L 1EU4A 1O7YA 3J7AV 3VYUA 2N8NA 2E2DC 1MSHA 2K5DA 1LTAD 3S2DB 5D3DA 4DK1A 3FKIB 4ID6A 4UP8A 4L8JA 3I4MG 4LFBL 4JV5L 4NMZA 4K6LA 2PQAA 1Y8OB 4Z9CB 3F2CA 4OO1I 1G2TA 3BZCA 1F2YA 4EGVA 4BXXH 4YIJA 3VYRA 3A74A 2OQ0A 3WWVA 1EQRA 1J9OA 3CCJA 1VQCA 3QOJA 2R7DA 1SROA 5IOCA 4X66Q 1T9HA 2DJFC 3HOXB 4CJ0B 3SGIA 1GUNA 1VQFA 4GOPC 1OXVA 2BA0A 1I4HA 2R92G 4IURA 3T4AC 4DUZQ 2FMMA 4L5SA 1KAWA 5K36G 1Z47A 1S40A 4HMJA 1VS0A 2K14A 3GTGH 1WTHA 2F4VQ 1QJOA 5C44H 3RN5A 1SNCA 3OOCA 3D3RA 4IZ8A 4KHPQ 4JK1C 4JI0L 4BBSH 1QE6A 4A3BG 1CHQD 4HMIA 1H9JA 4GOPA 4UP9A 3ZJYC 5D14A 4B3ML 4IUVA 4JI2Q 3CXCA 1N33L 1CM9A 2KUMA 3HRZC 5EKKA 4LFCQ 2L1BA 5IIFA 2F0KA 3CPFA 3TS0A 3G48A 3C2PA 4FP5D 3Q0AA 1VQ7A 2KENA 3GTJH 2F0LA 1CA5A 4J8QA 4B9WA 3HOVH 1KLGD 4ODGA 1HZ9A 1X54A 1IL2A 2F0MA 1K3BC 4UDUC 1EOVA 3GTLH 3MXNB 2EJMA 4DNRB 2F0SA 3TSSA 4A3DG 1K73C 2VNUD 2EY2A 4IJHA 1I6VC 4KN4C 3H6MA 1EZ8A 4DV3Q 3J7A5 2PO4A 3KYHC 2E2JH 4LF8Q 1JE4A 1RD9D 3GQBA 4XXEA 1PV4A 4K5WA 4BXXG 3S15H 5I4DA 5FK9C 3MWYW 5DM73 3UE0A 1WCMG 2NVQH 4JI3Q 2BA1A 1MHWC 2B2TC 4JW0A 1SAPA 1YEZA 2MGSA 2AMCB 1U5KA 1HXYD 4A3JG 2E2HB 4YWKA 1EQVA 1ASZA 4A3CH 2WAQG 1WD0A 5JVH3 2NVYB 1KRTA 1HNXQ 4OIJA 1Q90A 2VUMB 2JP1A 2JA8H 4A4IA 3UE1A 1X3EA 2V1CC 1WTRA 2I5LX 1TS4A 3PIP3 1BCPC 2Z6BA 4GN4B 2LSSA 2B2TA 4BBSG 1TWGH 1GO3E 5LL6S 1IYUA 4DR5Q 4KY6A 1U0LA 5BR8L 1YHQA 5A2QL 3HOWH 1TY2A 3EQLC 2MO1A 2CQAA 3TZUA 3HOZB 1B9NA 3NTKA 1TS5A 2UXCQ 2NVTB 4OGQC 1LLRD 1RIPA 5K5PA 4IUUA 4FNFA 3GV6A 3TRZA 2A69C 1Q46A 4IUPA 5E4XA 3HOVG 5DEHA 2SDFA 1B2TA 4GKJQ 2HHHQ 1ET6A 1YZ6A 5D65A 3P1HA 3CRLC 5IT9L 3WOFA 4A3GH 1G91A 2JA9A 4X64Q 2GVAA 4JI8L 1N36Q 4DV1Q 1TS2A 4PV1C 2NN6H 5AJ3Q 1ILPA 3VA7A 1LO5D 4XTCS 2JA5B 1Y1VB 1DZ1A 4A3FB 4OELB 4K5VA 3G71A 3KDFB 1KQSA 4GZYC 2WB1G 5EGTA 4DR7Q 3VR6A 2Z4HA 4CKBA 1IBLQ 5C3EG 5ELDA 5EBCA 1B8AA 1A2UA 1SDFA 1UAPA 1RF2D 3S1NH 3CU7A 1HA6A 2LXJA 1LTID 3WOEA 3S2HB 5F2DA 4DK0A 3FHWA 3J7YW 4JI6L 3EJIA 5FO8B 2JJQA 1VF5C 3DWPA 4A93G 5FJ8G 1NTGA 2K04A 1V43A 3JAML 2ZJPA 1OXUA 1FJGL 3H09A 4WJ4A 1ICFB 3NK9A 1IBKQ 2PQAB 2EYJA 1G8ZD 4R9WA 1SE2A 2AUJD 1Q86C 3I70A 1EIFA 3A55A 4KKSA 4IJLA 1WTXA 4HTHA 4Y7NH 1I4XA 3GTKB 2QEJC 4NDXA 1ET9A 4L5TA 5FLXc 3I4MB 4AYBE 1PH6A 5A2QE 4EX5A 4DR2L 4BBRG 3UI2A 1GUSA 5IGBA 1NCVA 1I94Q 3AFQA 1F2ZA 3VA5A 2KBNA 4PZ7A 1KXLA 4LUOA 2D62A 4CDCC 4CKEA 1K28A 4GOPB 1CKNA 2OTJA 3PGZA 2E74C 4KKUA 4JOIC 2EZVA 5M5WB 3J81i 1JICA 5IT9E 3RD4A 4GKKL 3H0GH 5IYBH 2R92B 3Q24A 5E7NA 2UU9L 4R1JA 1XWEA 2NN6G 4X3KA 4WJ3M 3R2IA 5ELFA 3U9SA 4A3EH 1Z9FA 3GTMB 4YCUA 5ELBA 3UDGA 3K5LA 2JA6G 1YHBA 2JSOA 3OPOA 1PRTD 3KUPA 4R8IA 4NXNQ 4CJ1B 2EPBA 1LM0A 4A3BB 4JOIA 1PA6A 1EEFD 5ELOA 2EJGC 4GLAC 1HNWL 2K5WA 3P75A 2L12A 4HN7A 1BVSA 3AMUA 3M4YA 3S2DH 1U9RA 2N88A 4DV0Q 4POFA 1V8QA 4KTAA 3L0OA 4XYOA 4YWLA 2R93H 3JAME 1E2ZA 1TU2B 3BVGA 4N8X1 5BN5A 4QGUA 1EIYB 2CW0C 4L5QA 3T1YQ 1EQTA 3I7FA 2NZOA 5IGGA 1R4QB 3B6YA 3UDIA 4A3KH 1ASYA 1KRSA 4KY5A 4NPSA 5LMNL 4MNOA 4KI0A 4A3DB 2BH2A 2QEXA 4AQYL 5IP9G 1HNZL 4X3SA 1SJED 1TR5A 1VQLA 4JYAL 2O4XA 2EYFA 3NBIA 2MUYA 2OWOA 1I4QA 1K83B 3BZKA 4RHSA 4C2MB 2K4KA 1RCVD 1C4QA 3K0XA 2LFNA 1FD7D 1LTGD 1RTOA 3FP9A 1B3QA 4R4CA 4LF7L 3DHQA 1SMXA 5EPLA 1WCMB 1N32Q 1W3SA 2GN5A 4ZAIA 3A8JE 4MTKA 3T51B 1HTLD 1OXXK 4FF4A 4A3JB 3M7GA 2WAQB 4JI7Q 1E2WA 1R4PB 4LWCA 1R9TH 2UXDL 1KDCA 1BF4A 4UHVA 2D5DA 3NHHA 2AWOA 5DNFA 3SXHA 1EYDA 4BBSB 4F7XA 4DXGA 3MEFA 3A56A 4JI5L 2KQ3A 1DYQA 4HJ8A 1O7LA 2SNSA 4PMBA 2WV6D 3MFGA 2CH4A 4XIGS 1YNJC 1XXGA 2JA7G 1LT3D 3P7JA 1RHPA 2A68C 1BCPD 3RZDB 2R93G 2RF4A 1ESFA 5DM63 3CC2A 1X55A 2A6HD 2OQKA 3HOVB 5HGTA 1QZHA 3D8GA 4DR1Q 1ESRA 2ZTDA 4A3KG 1DD2A 4QIWE 2D2CC 1VDZA 2XTIA 4MTNA 3X3MA 2OXPA 3GDEA 1UE1A 2B3GA 2XNAC 3K59A 2ZTCA 1MIUA 3D0FA 1JB3A 3KLWA 3BZDB 4LFBQ 2E2HH 4JV5Q 3OHXC 4LW1A 4TQUS 1EY0A 1Y69U 1M90C 2VUMH 2WB1B 3KF8A 4F87A 4BA1I 5C3EB 3A54A 1QNKA 4LK1C 3W1GA 1TY0A 1WVLA 1AZPA 3ICEA 2Y0SG 1H9KA 3U58A 3TN2A 1PZID 3HKZG 3I3CA 1TT2A 4HJ9A 2JEAI 2E5LL 3T13A 2PW7A 1HHVA 2IJ0A 4A93B 4DFAA 3A7AB 2YTYA 1PVOA 2O2LD 1UE7A 5J3BA 3HOZH 2G9DA 2BH8A 3EFXD 1S5BD 2NVTH 1SR3A 1D1IA 1N9WA 3CAMA 2QDBA 3CD6A 1GUTA 1SE3A 3RR5A 1VQBA 4JI0Q 3MXPA 3KOJA 1F9QA 1TWGB 4TSSA 1A2TA 2KVMA 3TDQA 4B3MQ 1CKNB 1N33Q 4OWTB 2Z1CA 2IL8A 4A3LH 3FMCA 3KLRA 4JBMA 4DV4L 2ATWA 1UEAB 5IP7G 4K8IA 1F2MA 2DUDA 4HJ7A 1Y1VH 4BBRB 4A3FH 1JORA 1ML0D 2IHFA 4IFDI 4RKBA 1U4RA 1SYBA 4NXML 1JB7A 1JJCB 4EQNA 2F0OA 5CYUA 5GADC 3S2HH 2DN8A 3I72A 4YCVA 1HZAA 5FLXL 1II3A 1W6KA 4JG2A 4B3TL 3RN2A 1DOMA 4DV5L 4HCSA 3CCSA 2PZUA 3R3OA 5C4ZA 5FLMG 3G7LA 5GROA 1N34L 2PW5A 5H1SE 3HS0C 2CFMA 1X3QA 4DR3L 2JA6B 1UUPA 3LX0A 2VUMG 2ENBA 4UP7A 1Z6HA 1S5FD 1GXDC 3K0YA 3OWEB 4DAMA 1WTOA 4X3UA 2UUAL 1PHJA 1SNPA 2BE5C 1F9RA 5C0XG 3GTKH 1AH9A 2HUGA 3TP8A 1XMOL 4OO1G 4RHRA 5CC4A 3I4MH 5CMDA 1JE5A 3MXUA 3ERQA 1C9OA 2VB2X 2C35B 5LMNW 2PNHA 1SRUA 3PUWA 1LTTD 1CKMA 1BR9A 2F0HA 3URYA 3CHBD 1VQOA 4N9TA 1EU3A 3AQQA 4PQXA 5BR8Q 3CRKC 2EXDA 2OCEA 2VB3X 2ES2A 2PI2A 4EQPA 4Y7NB 1PZJD 4LAAA 5C4XG 5M5WH 5EPJA 2B2VC 1L0XB 1QUQA 1W2BA 1J8IA 2B8FA 3UDFA 4EQOA 1DOKA 2F0TA 1PRTF 1JOQA 3BDLA 1V9PA 1WOCA 3V2TA 3GTMH 2JEBI 1XNQL 2G9HD 4LFAL 4RMFA 1EY4A 4H44C 1EWIA 3H91A 2A6EC 3K5OA 4K5XA 4A3BH 1STHA 4QL5A 5CGKA 2XN9C 2B2VA 4HJAA 2YYZA 1HRJA 4I7ZC 2KECA 4JI8Q 4QQBX 3ULJA 1IL8A 1XMQL 5FLXE 1VQGA 1WI5A 4R4TA 3NUCA 3PMFA 4R4IA 4HEDA 1SYCA 1CHPD 1KD1C 3PO3G 4EVOA 4DKAC 3BG3A 3X3NA 1E3PA 1GHJA 2Q8RE 4JI6Q 3OW2A 3GTOH 3QG1A 4P73A 1NE3A 4A3DH 2WKDA 2XSCA 3DM3A 4AIMA 3KLSX 4O1NA 4ME5A 1FJGQ 2JA7B 5J22A 3DLLA 1VMCA 1PH3A 2RCNA 2AHOB 1SNQA 3K8AA 5C0XI 3OTOL 1YJ9A 1OXTA 2R93B 1K83H 3RMHA 3KF8B 3KLSA 4C2MH 5ISRA 2F03A 4B3SL 4CGYB 1PYSB 1MGSA 3Q8DA 1EL0A 3N52A 2EYHA 1A3UA 2ICEC 3S9WA 5G3LD 4A3KB 1RKNA 3OIQA 2NVXB 2AUKA 1WCMH 2P5ZX 3CCEA 1VQAA 3E3XA 4OL7A 3JAMi 3EN2A 1DGSA 4LUVA 2CVRA 5M3FH 4K8JA 1B3AA 4A3JH 5IGCA 4P74A 4DR2Q 3A8IE 4JI1L 3KF6A 5BN4A 1B70B 3K7UC 1GHKA 1CQVA 1AEXA 2I5HA 5EBDA 1V1PA 1Y1WH 2ZXRA 2HIXA 2PMZB 2Y0SB 4B3RL 2QGQA 4DV2L 2I5MX 2EQSA 4KLKA 3CW2C 3HKZB 1EFWA 3CCVA 1KAAA 3K80C 5KIXA 4GKKQ 3E9HA 2UU9Q 1BCPF 1STGA 2HD3A 4IUTA 3DEPA 1YNND 1Y8PB 2Q8IB 4L6TB 2IX1A 3RZDH 1PTOC 1I3QB 4HR7B 1TWCH 2KCMA 1R9TB 2B63G 3R8BA 1BBXC 4ZRZA 1KIXA 1WYDA 2HQLA 4JBJA 1CSQA 4RCNA 3HEJA 5TSSA 2F3WA 2QW7A 3NSWA 2E76C 1HNWQ 4WRDA 4K0KL 5GQOA 1QILA 5JEAH 5CR3A 1EIGA 4X6AH 2UUCL 1VQIA 5JEAJ 1KL9A 4FDBA 3PO2H 1E1OA 1EYAA 3Q6SA 2C5CA 4X65L 5I6WA 1VQ8A 4RWSC 1IW7D 3TP7A 1PH7A 5T1IA 5C3EH 1Z7TA 3EVQA 4IPGA 4DXFA 3I4LA 1FNVA 5LMNQ 4GNXC 4KK7A 1NBWA 1A62A 4AQYQ 1STNA 4OWWB 1HNZQ 4DF7A 1YI2A 4A93H 5FJ8H 2KEDA 4HSVA 1CZGA 4JYAQ 2PQEA 1STYA 5M3FG 1G51A 4L63B 1CQFA 1BOSA 3H15A 5HGQA 1O7ZA 2B39A 3SE0A 4P2CB 1Y1WG 1E1TA 4GNXA 1TKWB 1X32A 4BY1H 4LF7Q 1UWVA 2UXBL 1L2FA 2Q2IA 2EYPA 5JVG3 1VF7A 4IQZA 2DJGC 1QUQB 1SSOA 2XIWA 1XNRL 5KGUA 4LF9L 2EVBA 4HCEA 1CI3M 1YBYA 4BBRH 2UXDQ 3I4OA 4X3TA 3KBXA 1YHAA 1Y8NB 1K9MC 2WFWA 4JI5Q 4TKOB 4DUYL 2OEOA 1F9PA 2NTSA 3S16B 1SYGA 1F9SA 1DCZA 2L0CA 1LUZA 2RQXA 1G291 5JEAG 5C4XB 5KNCA 2CCZA 4IUQA 1K8GA 4CDDC 3S14H 3PO2G 3DWQA 2NZHA 2JA6H 5ELCA 4NKLA 2E2IB 2K7VA 4FF3A 1MJCA 3IL8A 2K32A 1H9SA 3G6JB 2ZJRA 5D3IB 2B8GA 4PMWA 1TS3A 4O2DA 1HZBA 2K75A 2WAQE 1STAA 3ER0A 5EPKA 3J80c 5L37A 1VQJA 3BU2A 4RKLA 2D0OA 4LF4L 4GN5A 1YJNA 1NMGA 3PO3B 1ZEQX 1X3FA 5FO7B 4BY1G 2YV5A 3M4QA 2E5LQ 4B9XA 4C3IG 4LNQA 2KEEA 4APVA 1ZYRC 1NAPA 2RDFA 4NB3A 5IP9H 4CKCA 5CV8A 4G7OC 1B1ZA 2IW3A 3T16A 4IN3A 1M8AA 3KF6B 3MFYA 2ZM6L 2Q2HA 1V1PB 1XTCD 1E7ZA 1Q1EA 4C3HG 4MIUA 4HIMA 3E9IA 4FYDA 4DV6L 1Q7YC 1U4PA 1HCZA 1D8LA 2JQOA 1YJWA 1STEA 4N8FA 2AWNA 3PUZA 3QOLA 1K8AC 3QWNA 2O5IC 1NR2A 3K5MA 4QUCA 4DV4Q 3VR3A 5IE8A 3E0JA 4R8NA 4K14A 1HUMA 5JPMC 2K33A 4P71A 3PSIA 2CHBD 4IALA 2KHSA 4NXMQ 2WINB 4IPHA 3S17H 3MZ5A 1A63A 2PPBC 4R4OA 1Q3LA 2EE1A 2EYOA 2VZAA 1VQDA 2K1BA 4B3TQ 1BXTA 4DV5Q 4U68A 5BN3A 3TP5A 5COYA 1PTOB 1XPUA 1N34Q 2JA7H 4IFDH 2A73B 5KEEA 2WP8J 4XT1B 1QVCA 3Q23A 2F0EA 4DR3Q 2IX3A 4IFDJ 1ENFA 3LWUA 4RA8A 2B63B 2L55A 1OO9B 5G3LF 4TVAB
chains in the Genus database with same CATH topology
3S1QH 3KOJA 1H95A 3F2BA 3A0JA 4R4QA 2MO0A 4DR1L 3H3VH 4HIOA 3TREA 2UUAQ 2UUBQ 2NVXH 4B3MQ 1CKNB 1FVIA 2N8NA 1CKOA 1X6OA 3S24A 4OWTB 1N33Q 1HR0Q 3S1MH 1IBMQ 3AFPA 2QA4A 1XMOQ 4A3LH 4IPCA 5ELNA 3T1HQ 4JBMA 4UP8A 4J15A 4DV4L 1SLJA 2ATWA 3I4MG 3PIOA 5IP7G 1J5EL 4DR4Q 4AYBG 4LFBL 2DUDA 1XJVA 4HJ7A 2ZJQA 4JV5L 4L5RC 1Y1VH 4HIKA 4A3FH 2PQAA 3F2CA 2IHFA 4IFDI 4OO1I 3BZCA 4BXXH 3A74A 2OQ0A 3WWVA 4GNXB 3PUVA 4NXML 1JB7A 1JJCB 1EQRA 1A8VA 3CCJA 2Q2UA 4RG1A 5GADC 1VQCA 3S2HH 1SFOH 4YCVA 2R7DA 1HZAA 1SROA 3STBC 4X66Q 1T9HA 3EIVA 3ULLA 4JG2A 2K52A 4B3TL 3H3VI 3SGIA 5IYCH 3RN2A 4DV5L 3CF5A 1TXYA 4A3MG 1VQFA 3CCSA 4GOPC 1OXVA 1FGUA 2BA0A 5FLMG 2R92G 5GROA 3F8TA 5M5XH 4DUZQ 3L7ZC 1N34L 3HOYH 4YWMA 5H1SE 2CFMA 4L5SA 3TQYA 2ASBA 1KAWA 3CMEA 1Z47A 4DR3L 1S40A 1XNQQ 4LFAQ 5K36G 3J81c 1VS0A 2K14A 2N78A 4JCVE 2VUMG 1I3QH 2F4VQ 3GTGH 5C44H 3CMAA 4HJ5A 3NELA 3RN5A 4UP7A 1N8RC 4LF5Q 4KHPQ 3CC4A 4JI0L 4BBSH 1E24A 1XPOA 1Q12A 4A3BG 1IYJB 4DAMA 3ULPA 4GOPA 4UP9A 3ZJYC 2UUAL 3G6EA 1PHJA 2UUBL 4B3ML 4JI2Q 1XMQQ 3CXCA 4IOAA 1N33L 5C0XG 1AH9A 3GTKH 1HR0L 1IBML 4LFCQ 4GN3B 1TWAH 1NY4A 4ME3A 1XMOL 2R7ZG 3CPFA 4IFDG 3I4MH 4A3CG 3T1HL 5IP7H 3TS0A 4OO1G 2R6GA 3G48A 1JE5A 4DR4L 2IY5B 1VQ7A 2JA8G 2KENA 1C9OA 3PV0A 3GTJH 2C35B 3CCRA 5LMNW 2PNHA 2VQFQ 3HOVH 1SRUA 3PUWA 1Q81C 1HZ9A 1CKMA 1X54A 1IL2A 1HH2P 3M85A 4C3JH 3OYYA 1VQOA 1EOVA 3GTLH 3AQQA 3I2ZA 3MXNB 5BR8Q 3RNUA 2YU9H 2EXDA 2OCEA 2ES2A 4A3DG 2PI2A 1L1OB 1K73C 4X66L 5C4XG 5M5WH 1C7YA 3HOWG 2VNUD 3L2PA 2K5VA 4IJHA 4A3MH 1QUQA 1W2BA 5FLMH 3UDFA 3OTOQ 4DV3Q 2GVBA 1YIJA 3J7A5 3KYHC 4DV2L 2E2JH 4B3SQ 4LF8Q 4DUZL 2HT1A 3ERSX 3GD7A 1V9PA 1WOCA 3CCMA 3KJOA 2JEBI 2WB1E 1PV4A 1XNQL 3GTMH 4BXXG 4LFAL 4RMFA 2DGYA 1MKHA 3S15H 1EWIA 2F4VL 5GAHC 3CQZH 3BJUA 4LF5L 4KHPL 1QVFA 4A75A 4A3BH 4QL5A 3UE0A 3J81j 1WCMG 2YYZA 4HJAA 3GO5A 2VQEQ 4JI3Q 2NVQH 4A3GG 3J80i 2BA1A 3M4OH 3UDXA 3PIPA 1YEZA 4JI8Q 4QQBX 2AMCB 3ULJA 1U5KA 1E22A 5IYCG 4JI1Q 1XMQL 4A3JG 4JI2L 1VQGA 4YWKA 3CCUA 4QY7A 2R7ZH 2D0PA 5C4JH 2WAQG 5C0XJ 1PH9A 1WI5A 1ASZA 4LFCL 4A3CH 4R4TA 1KRTA 3U50C 1HNXQ 3HOYG 2IT1A 4R4IA 4DR6Q 2JA8H 4A4IA 3UE1A 1X3EA 1GVPA 2V1CC 1KD1C 2I5LX 4ALPA 3PO3G 4DKAC 4GN4B 1E3PA 4B3RQ 2VQFL 2LSSA 4DV2Q 1VQMA 4BBSG 1TWGH 1GO3E 3CC7A 4POGA 3S16H 4H02A 3TEHB 2L15A 2KHIA 4JI6Q 3OW2A 1PH5A 1VQHA 2KCTA 4DR5Q 3GTOH 4P73A 1U0LA 1Q1BA 1NE3A 4A3DH 5BR8L 2K50A 1YHQA 3CCLA 5C4XH 2VY3A 3DM3A 3FKIH 2HIVA 4AIMA 1PFSA 2MO1A 1FJGQ 3HOWH 3HKSA 3DLLA 1PH3A 4LF6Q 2RCNA 2AHOB 2A8VA 3K8AA 2UXCQ 1I6HH 1AE2A 5C0XI 3OTOL 4DV3L 1OXTA 1YJ9A 1K83H 1RIPA 3KF8B 4C2MH 1GD7A 4B3SL 4LF8L 1PYSB 3Q8DA 2E2IH 3TRZA 1Q46A 3HOVG 1YVCA 1PH4A 4GKJQ 4K0KQ 1GKHA 5JJIA 2HHHQ 1YZ6A 2FXQA 1J6QA 1WCMH 4UPAA 3CCEA 2I0QA 1VQAA 2UUCQ 3HOXH 3JAMi 4A3GH 2VQEL 3EN2A 1X56A 4JI3L 4JBWA 1DGSA 2JA9A 2CKZB 4LUVA 2N49A 1L0WA 2Z6KC 4X64Q 5M3FH 2GVAA 1M1KC 4JI8L 4A3JH 1UEBA 4DV1Q 4P74A 4A3IG 4AH6A 4DR2Q 1N36Q 4JI1L 5AJ3Q 3KF6A 4XTCS 1B70B 5JJLA 4X65Q 3K7UC 2I5HA 3J7ZC 3U4VA 3G71A 3KDFB 1HNXL 4P75A 4DR6L 1KQSA 2WB1G 4DR7Q 1VQPA 1Y1WH 2HIXA 1IBLQ 5C3EG 2PMZE 2IHEA 4UY8C 3PO3H 1HZCA 2B29A 1B8AA 3S1NH 2Y0SE 2LXJA 4BY7G 2QGQA 3PUXA 4B3RL 2CWPA 2I5MX 4KHZA 2EQSA 3HKZE 3CW2C 3FHWA 2Z6KA 4KLKA 1P8LA 3K80C 3CCVA 1EFWA 5GAGC 2CWAA 4JI6L 3CP0A 1PYBA 1VQ6A 2JJQA 4DR5L 4GKKQ 4A93G 5FJ8G 3E9HA 3KJPA 1RL2A 1I50H 2UU9Q 1NTGA 1SN8A 3H0GG 4BA2I 1V43A 5IYBG 3S1RH 2ZJPA 2EIFA 1OXUA 3AYHB 1FJGL 4WJ4A 1IBKQ 2IX1A 3RZDH 4LF6L 2PQAB 4A3EG 2UXCL 2B63G 1TWCH 2KCMA 2NN6I 1NMFA 4YY3Q 5JJKA 1LYLA 1G6PA 1KIXA 1WYDA 2HQLA 1VQKA 3TS2A 4JBJA 1LTLA 1Q86C 1CSQA 3A5UA 2UXBQ 2XGTA 5C44G 1QZGA 1EIFA 4GKJL 1HNWQ 1X9NA 4K0KL 4IJLA 5GQOA 2HHHL 4GLVB 4Y7NH 2ID0A 3PUYA 4X6AH 2UUCL 1VQIA 1XNRQ 3JC66 5JEAJ 3FKIG 5FLXc 4L5TA 4LF9Q 1KL9A 4FDBA 4X64L 4AYBE 4A3IH 1PH6A 1EYGA 3PO2H 2Z0SA 4DV1L 4IO9A 4EX5A 1N36L 4DR2L 1E1OA 5AJ3L 4BBRG 2MQHA 1SE8A 4X65L 3CPWA 1I94Q 3G4SA 3M3YH 3AFQA 1VQ8A 2KBNA 3PF5A 3PF4A 4DUYQ 4PZ7A 1PH7A 1S3OA 4DR7L 5C3EH 1KXLA 4IPGA 1IBLL 4OX9Q 4LUOA 1YITA 2D62A 4BY7H 5LMNQ 1Q8KA 4GNXC 1VCIA 1XPRA 4GOPB 5IYDH 4DNIA 1CKNA 2OTJA 1NBWA 3PGZA 2K5NA 1A62A 4AQYQ 3HOXG 4OWWB 4JOIC 1HNZQ 1YI2A 3HOUH 3J81i 5FJ8H 4A93H 1IXRA 4GKKL 4JYAQ 4DK3C 1O7IA 3H0GH 5M3FG 5IYBH 5IWAQ 1UE6A 1G51A 5E7NA 2UU9L 4R1JA 2NN6G 2NVYH 3H15A 5HGQA 2ZTEA 4WJ3M 2MNAA 3IRBA 1GM5A 4A3EH 1IBKL 1Z9FA 4YCUA 2JA6G 3UDGA 3M9BA 1YHBA 2JE6I 2B63H 1Y1WG 1E1TA 4GNXA 3A5ZB 3D31A 4YY3L 4BY1H 4NXNQ 4LF7Q 1AE3A 5IY0A 1HR0W 3VDYA 3K81C 1B7YB 1LM0A 4JOIA 4JBKA 1CSPA 1VQEA 2MFIA 1UWVA 1PA6A 2A1AA 4P72A 2UXBL 5DLQE 4X62Q 1L2FA 1BBUA 2Q2IA 5ELOA 1X65A 4GLAC 1EUJA 2PI2E 1HNWL 1JT8A 4YHHQ 1BVSA 1BBWA 3S2DH 2RHSB 1QUQB 2VW9A 4JI4Q 4DV0Q 1XNRL 4POFA 3I56A 4LF9L 3L0OA 4YWLA 1PH8A 1VQ5A 4LUZA 1YBYA 2R93H 4BBRH 4LF4Q 3I4OA 2UXDQ 4QGUA 1EIYB 1YHAA 3AEVA 4L5QA 3T1YQ 2E8GA 1I94L 3RLFA 1K9MC 3I7FA 2NZOA 2WFWA 2JK8A 4JI5Q 3B6YA 4DUYL 3UDIA 4A3KH 1ASYA 4OWXB 1K0RA 4OX9L 1LUZA 1KRSA 3GTPH 1G291 4GLXA 4NPSA 5LMNL 4MNOA 3LGJA 4KI0A 2BH2A 5JEAG 4PG3A 2QEXA 2CCZA 4AQYL 3W5OA 4DAYB 5IP9G 1HNZL 3NEMA 1K8GA 4JC0A 2ZM6Q 1VQLA 4JYAL 2ALYB 1PH2A 3S14H 2JA5H 1L1OC 5IWAL 3PO2G 1FL0A 1D7QA 2OWOA 3PCOB 4PZ6A 3BZKA 5EAYA 4DV6Q 2K4KA 2NZHA 2JA6H 4OONA 3K0XA 3F1ZA 1MJCA 4GS3A 1OTCA 3FP9A 4NXNL 4R4CA 4LF7L 3HFZB 1SMXA 2ZJRA 1N32Q 1C0AA 1W3SA 1I5FA 1JJ2A 2GN5A 5IYDG 4PMWA 4DK6C 4X62L 4O2DA 3RZOH 2K5HA 3F2DA 1L1OA 1TWHH 3HOUG 3RLNA 1OXXK 1HZBA 4YHHL 1Y14B 1V1QA 2K75A 2WAQE 3ER0A 4JI7Q 4JI4L 3KFUA 1WJJA 4DV0L 3J80c 2YTXA 3M4PA 5M3MG 1VQJA 1HJPA 3M7NA 4LWCA 1R9TH 3BU2A 2D0OA 2VS1A 4GN5A 1YJNA 1NMGA 2Q2TA 4LF4L 2UXDL 2H5XA 2AWOA 4DV7Q 1X3FA 2F3IA 4YCWA 3T1YL 4BY1G 3U4ZA 5LMUQ 2YV5A 3MEFA 3M4QA 4JI5L 1CUKA 2E5LQ 1X3GA 4DPGA 2OTLA 1XTDA 4HJ8A 4LNQA 4APVA 4XIGS 1NJIC 3I4NG 2F52A 5IT9c 4NB3A 5IP9H 4IOCA 2JA7G 3HOZG 3KF6B 3NBHB 1WFQA 2ZM6L 1A0IA 3E0EA 2Q2HA 4A76A 1S72A 2R93G 2N3SA 1E7ZA 1Q1EA 2RF4A 3CCQA 4HIMA 3E9IA 3CC2A 1X55A 4IPDA 4DV6L 1Q7YC 1JJGA 2OQKA 1QZHA 4DR1Q 1TWFH 1VQ4A 1D8LA 1K3RA 2ZTDA 2JQOA 3EBEA 4A3KG 4QIWE 4QJFA 4O0AA 1YJWA 2XTIA 4MTNA 1BKBA 2YTVA 3GDEA 2AWNA 1UE1A 2B3GA 3PUZA 1K8AC 1N32L 2ZTCA 1MIUA 4DV4Q 3D0FA 3W1BA 5IE8A 4A3LG 1QVGA 1J5EQ 3KLWA 4Y52H 2R92H 4LFBQ 2R7FA 2E2HH 4JV5Q 1YNXA 2IX0A 4LW1A 4P71A 4TQUS 1OXSC 1UE5A 1Y1VG 1PH1A 4A3FG 3PSIA 2JA5G 1MJEA 4JI7L 3JAMc 5M3MH 2VL6A 1M90C 3K7AH 2VUMH 4NXMQ 1EQQA 3GTQH 2CQOA 4IPHA 3S17H 4BA1I 1VQNA 1A63A 2RHQB 1VQ9A 4R4OA 5GAEC 3STBD 5HY6A 3ICEA 3W1GA 4DV7L 1KC8C 2Y0SG 2VZAA 1VQDA 3U58A 2LXKA 5LMUL 5M5YH 3HKZG 4HJ9A 3NENA 4EQ5A 2JEAI 2E5LL 4B3TQ 4C3IH 4DV5Q 3I4NH 1KHIA 2YTYA 2AKWB 1JMCA 1PVOA 1XPUA 4OXPA 1IZ6A 1P16A 1UE7A 4PZ8A 5J3BA 1N34Q 2JA7H 2WP8J 3HOZH 2BH8A 1QVCA 4HIDA 4DR3Q 4IFDJ 3I55A 2A19A 2NVTH 2KHJA 1SR3A 1Q82C 1N9WA 3CAMA 3KDFA 4C3HH 3CD6A 4MZ9A 4TVAB 3RR5A 1VQBA 4JI0Q 3RLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q H;  3KOJ A;  1H95 A;  3F2B A;  3A0J A;  4R4Q A;  2MO0 A;  4DR1 L;  3H3V H;  4HIO A;  3TRE A;  2UUA Q;  2UUB Q;  2NVX H;  4B3M Q;  1CKN B;  1FVI A;  2N8N A;  1CKO A;  1X6O A;  3S24 A;  4OWT B;  1N33 Q;  1HR0 Q;  3S1M H;  1IBM Q;  3AFP A;  2QA4 A;  1XMO Q;  4A3L H;  4IPC A;  5ELN A;  3T1H Q;  4JBM A;  4UP8 A;  4J15 A;  4DV4 L;  1SLJ A;  2ATW A;  3I4M G;  3PIO A;  5IP7 G;  1J5E L;  4DR4 Q;  4AYB G;  4LFB L;  2DUD A;  1XJV A;  4HJ7 A;  2ZJQ A;  4JV5 L;  4L5R C;  1Y1V H;  4HIK A;  4A3F H;  2PQA A;  3F2C A;  2IHF A;  4IFD I;  4OO1 I;  3BZC A;  4BXX H;  3A74 A;  2OQ0 A;  3WWV A;  4GNX B;  3PUV A;  4NXM L;  1JB7 A;  1JJC B;  1EQR A;  1A8V A;  3CCJ A;  2Q2U A;  4RG1 A;  5GAD C;  1VQC A;  3S2H H;  1SFO H;  4YCV A;  2R7D A;  1HZA A;  1SRO A;  3STB C;  4X66 Q;  1T9H A;  3EIV A;  3ULL A;  4JG2 A;  2K52 A;  4B3T L;  3H3V I;  3SGI A;  5IYC H;  3RN2 A;  4DV5 L;  3CF5 A;  1TXY A;  4A3M G;  1VQF A;  3CCS A;  4GOP C;  1OXV A;  1FGU A;  2BA0 A;  5FLM G;  2R92 G;  5GRO A;  3F8T A;  5M5X H;  4DUZ Q;  3L7Z C;  1N34 L;  3HOY H;  4YWM A;  5H1S E;  2CFM A;  4L5S A;  3TQY A;  2ASB A;  1KAW A;  3CME A;  1Z47 A;  4DR3 L;  1S40 A;  1XNQ Q;  4LFA Q;  5K36 G;  3J81 c;  1VS0 A;  2K14 A;  2N78 A;  4JCV E;  2VUM G;  1I3Q H;  2F4V Q;  3GTG H;  5C44 H;  3CMA A;  4HJ5 A;  3NEL A;  3RN5 A;  4UP7 A;  1N8R C;  4LF5 Q;  4KHP Q;  3CC4 A;  4JI0 L;  4BBS H;  1E24 A;  1XPO A;  1Q12 A;  4A3B G;  1IYJ B;  4DAM A;  3ULP A;  4GOP A;  4UP9 A;  3ZJY C;  2UUA L;  3G6E A;  1PHJ A;  2UUB L;  4B3M L;  4JI2 Q;  1XMQ Q;  3CXC A;  4IOA A;  1N33 L;  5C0X G;  1AH9 A;  3GTK H;  1HR0 L;  1IBM L;  4LFC Q;  4GN3 B;  1TWA H;  1NY4 A;  4ME3 A;  1XMO L;  2R7Z G;  3CPF A;  4IFD G;  3I4M H;  4A3C G;  3T1H L;  5IP7 H;  3TS0 A;  4OO1 G;  2R6G A;  3G48 A;  1JE5 A;  4DR4 L;  2IY5 B;  1VQ7 A;  2JA8 G;  2KEN A;  1C9O A;  3PV0 A;  3GTJ H;  2C35 B;  3CCR A;  5LMN W;  2PNH A;  2VQF Q;  3HOV H;  1SRU A;  3PUW A;  1Q81 C;  1HZ9 A;  1CKM A;  1X54 A;  1IL2 A;  1HH2 P;  3M85 A;  4C3J H;  3OYY A;  1VQO A;  1EOV A;  3GTL H;  3AQQ A;  3I2Z A;  3MXN B;  5BR8 Q;  3RNU A;  2YU9 H;  2EXD A;  2OCE A;  2ES2 A;  4A3D G;  2PI2 A;  1L1O B;  1K73 C;  4X66 L;  5C4X G;  5M5W H;  1C7Y A;  3HOW G;  2VNU D;  3L2P A;  2K5V A;  4IJH A;  4A3M H;  1QUQ A;  1W2B A;  5FLM H;  3UDF A;  3OTO Q;  4DV3 Q;  2GVB A;  1YIJ A;  3J7A 5;  3KYH C;  4DV2 L;  2E2J H;  4B3S Q;  4LF8 Q;  4DUZ L;  2HT1 A;  3ERS X;  3GD7 A;  1V9P A;  1WOC A;  3CCM A;  3KJO A;  2JEB I;  2WB1 E;  1PV4 A;  1XNQ L;  3GTM H;  4BXX G;  4LFA L;  4RMF A;  2DGY A;  1MKH A;  3S15 H;  1EWI A;  2F4V L;  5GAH C;  3CQZ H;  3BJU A;  4LF5 L;  4KHP L;  1QVF A;  4A75 A;  4A3B H;  4QL5 A;  3UE0 A;  3J81 j;  1WCM G;  2YYZ A;  4HJA A;  3GO5 A;  2VQE Q;  4JI3 Q;  2NVQ H;  4A3G G;  3J80 i;  2BA1 A;  3M4O H;  3UDX A;  3PIP A;  1YEZ A;  4JI8 Q;  4QQB X;  2AMC B;  3ULJ A;  1U5K A;  1E22 A;  5IYC G;  4JI1 Q;  1XMQ L;  4A3J G;  4JI2 L;  1VQG A;  4YWK A;  3CCU A;  4QY7 A;  2R7Z H;  2D0P A;  5C4J H;  2WAQ G;  5C0X J;  1PH9 A;  1WI5 A;  1ASZ A;  4LFC L;  4A3C H;  4R4T A;  1KRT A;  3U50 C;  1HNX Q;  3HOY G;  2IT1 A;  4R4I A;  4DR6 Q;  2JA8 H;  4A4I A;  3UE1 A;  1X3E A;  1GVP A;  2V1C C;  1KD1 C;  2I5L X;  4ALP A;  3PO3 G;  4DKA C;  4GN4 B;  1E3P A;  4B3R Q;  2VQF L;  2LSS A;  4DV2 Q;  1VQM A;  4BBS G;  1TWG H;  1GO3 E;  3CC7 A;  4POG A;  3S16 H;  4H02 A;  3TEH B;  2L15 A;  2KHI A;  4JI6 Q;  3OW2 A;  1PH5 A;  1VQH A;  2KCT A;  4DR5 Q;  3GTO H;  4P73 A;  1U0L A;  1Q1B A;  1NE3 A;  4A3D H;  5BR8 L;  2K50 A;  1YHQ A;  3CCL A;  5C4X H;  2VY3 A;  3DM3 A;  3FKI H;  2HIV A;  4AIM A;  1PFS A;  2MO1 A;  1FJG Q;  3HOW H;  3HKS A;  3DLL A;  1PH3 A;  4LF6 Q;  2RCN A;  2AHO B;  2A8V A;  3K8A A;  2UXC Q;  1I6H H;  1AE2 A;  5C0X I;  3OTO L;  4DV3 L;  1OXT A;  1YJ9 A;  1K83 H;  1RIP A;  3KF8 B;  4C2M H;  1GD7 A;  4B3S L;  4LF8 L;  1PYS B;  3Q8D A;  2E2I H;  3TRZ A;  1Q46 A;  3HOV G;  1YVC A;  1PH4 A;  4GKJ Q;  4K0K Q;  1GKH A;  5JJI A;  2HHH Q;  1YZ6 A;  2FXQ A;  1J6Q A;  1WCM H;  4UPA A;  3CCE A;  2I0Q A;  1VQA A;  2UUC Q;  3HOX H;  3JAM i;  4A3G H;  2VQE L;  3EN2 A;  1X56 A;  4JI3 L;  4JBW A;  1DGS A;  2JA9 A;  2CKZ B;  4LUV A;  2N49 A;  1L0W A;  2Z6K C;  4X64 Q;  5M3F H;  2GVA A;  1M1K C;  4JI8 L;  4A3J H;  1UEB A;  4DV1 Q;  4P74 A;  4A3I G;  4AH6 A;  4DR2 Q;  1N36 Q;  4JI1 L;  5AJ3 Q;  3KF6 A;  4XTC S;  1B70 B;  5JJL A;  4X65 Q;  3K7U C;  2I5H A;  3J7Z C;  3U4V A;  3G71 A;  3KDF B;  1HNX L;  4P75 A;  4DR6 L;  1KQS A;  2WB1 G;  4DR7 Q;  1VQP A;  1Y1W H;  2HIX A;  1IBL Q;  5C3E G;  2PMZ E;  2IHE A;  4UY8 C;  3PO3 H;  1HZC A;  2B29 A;  1B8A A;  3S1N H;  2Y0S E;  2LXJ A;  4BY7 G;  2QGQ A;  3PUX A;  4B3R L;  2CWP A;  2I5M X;  4KHZ A;  2EQS A;  3HKZ E;  3CW2 C;  3FHW A;  2Z6K A;  4KLK A;  1P8L A;  3K80 C;  3CCV A;  1EFW A;  5GAG C;  2CWA A;  4JI6 L;  3CP0 A;  1PYB A;  1VQ6 A;  2JJQ A;  4DR5 L;  4GKK Q;  4A93 G;  5FJ8 G;  3E9H A;  3KJP A;  1RL2 A;  1I50 H;  2UU9 Q;  1NTG A;  1SN8 A;  3H0G G;  4BA2 I;  1V43 A;  5IYB G;  3S1R H;  2ZJP A;  2EIF A;  1OXU A;  3AYH B;  1FJG L;  4WJ4 A;  1IBK Q;  2IX1 A;  3RZD H;  4LF6 L;  2PQA B;  4A3E G;  2UXC L;  2B63 G;  1TWC H;  2KCM A;  2NN6 I;  1NMF A;  4YY3 Q;  5JJK A;  1LYL A;  1G6P A;  1KIX A;  1WYD A;  2HQL A;  1VQK A;  3TS2 A;  4JBJ A;  1LTL A;  1Q86 C;  1CSQ A;  3A5U A;  2UXB Q;  2XGT A;  5C44 G;  1QZG A;  1EIF A;  4GKJ L;  1HNW Q;  1X9N A;  4K0K L;  4IJL A;  5GQO A;  2HHH L;  4GLV B;  4Y7N H;  2ID0 A;  3PUY A;  4X6A H;  2UUC L;  1VQI A;  1XNR Q;  3JC6 6;  5JEA J;  3FKI G;  5FLX c;  4L5T A;  4LF9 Q;  1KL9 A;  4FDB A;  4X64 L;  4AYB E;  4A3I H;  1PH6 A;  1EYG A;  3PO2 H;  2Z0S A;  4DV1 L;  4IO9 A;  4EX5 A;  1N36 L;  4DR2 L;  1E1O A;  5AJ3 L;  4BBR G;  2MQH A;  1SE8 A;  4X65 L;  3CPW A;  1I94 Q;  3G4S A;  3M3Y H;  3AFQ A;  1VQ8 A;  2KBN A;  3PF5 A;  3PF4 A;  4DUY Q;  4PZ7 A;  1PH7 A;  1S3O A;  4DR7 L;  5C3E H;  1KXL A;  4IPG A;  1IBL L;  4OX9 Q;  4LUO A;  1YIT A;  2D62 A;  4BY7 H;  5LMN Q;  1Q8K A;  4GNX C;  1VCI A;  1XPR A;  4GOP B;  5IYD H;  4DNI A;  1CKN A;  2OTJ A;  1NBW A;  3PGZ A;  2K5N A;  1A62 A;  4AQY Q;  3HOX G;  4OWW B;  4JOI C;  1HNZ Q;  1YI2 A;  3HOU H;  3J81 i;  5FJ8 H;  4A93 H;  1IXR A;  4GKK L;  4JYA Q;  4DK3 C;  1O7I A;  3H0G H;  5M3F G;  5IYB H;  5IWA Q;  1UE6 A;  1G51 A;  5E7N A;  2UU9 L;  4R1J A;  2NN6 G;  2NVY H;  3H15 A;  5HGQ A;  2ZTE A;  4WJ3 M;  2MNA A;  3IRB A;  1GM5 A;  4A3E H;  1IBK L;  1Z9F A;  4YCU A;  2JA6 G;  3UDG A;  3M9B A;  1YHB A;  2JE6 I;  2B63 H;  1Y1W G;  1E1T A;  4GNX A;  3A5Z B;  3D31 A;  4YY3 L;  4BY1 H;  4NXN Q;  4LF7 Q;  1AE3 A;  5IY0 A;  1HR0 W;  3VDY A;  3K81 C;  1B7Y B;  1LM0 A;  4JOI A;  4JBK A;  1CSP A;  1VQE A;  2MFI A;  1UWV A;  1PA6 A;  2A1A A;  4P72 A;  2UXB L;  5DLQ E;  4X62 Q;  1L2F A;  1BBU A;  2Q2I A;  5ELO A;  1X65 A;  4GLA C;  1EUJ A;  2PI2 E;  1HNW L;  1JT8 A;  4YHH Q;  1BVS A;  1BBW A;  3S2D H;  2RHS B;  1QUQ B;  2VW9 A;  4JI4 Q;  4DV0 Q;  1XNR L;  4POF A;  3I56 A;  4LF9 L;  3L0O A;  4YWL A;  1PH8 A;  1VQ5 A;  4LUZ A;  1YBY A;  2R93 H;  4BBR H;  4LF4 Q;  3I4O A;  2UXD Q;  4QGU A;  1EIY B;  1YHA A;  3AEV A;  4L5Q A;  3T1Y Q;  2E8G A;  1I94 L;  3RLF A;  1K9M C;  3I7F A;  2NZO A;  2WFW A;  2JK8 A;  4JI5 Q;  3B6Y A;  4DUY L;  3UDI A;  4A3K H;  1ASY A;  4OWX B;  1K0R A;  4OX9 L;  1LUZ A;  1KRS A;  3GTP H;  1G29 1;  4GLX A;  4NPS A;  5LMN L;  4MNO A;  3LGJ A;  4KI0 A;  2BH2 A;  5JEA G;  4PG3 A;  2QEX A;  2CCZ A;  4AQY L;  3W5O A;  4DAY B;  5IP9 G;  1HNZ L;  3NEM A;  1K8G A;  4JC0 A;  2ZM6 Q;  1VQL A;  4JYA L;  2ALY B;  1PH2 A;  3S14 H;  2JA5 H;  1L1O C;  5IWA L;  3PO2 G;  1FL0 A;  1D7Q A;  2OWO A;  3PCO B;  4PZ6 A;  3BZK A;  5EAY A;  4DV6 Q;  2K4K A;  2NZH A;  2JA6 H;  4OON A;  3K0X A;  3F1Z A;  1MJC A;  4GS3 A;  1OTC A;  3FP9 A;  4NXN L;  4R4C A;  4LF7 L;  3HFZ B;  1SMX A;  2ZJR A;  1N32 Q;  1C0A A;  1W3S A;  1I5F A;  1JJ2 A;  2GN5 A;  5IYD G;  4PMW A;  4DK6 C;  4X62 L;  4O2D A;  3RZO H;  2K5H A;  3F2D A;  1L1O A;  1TWH H;  3HOU G;  3RLN A;  1OXX K;  1HZB A;  4YHH L;  1Y14 B;  1V1Q A;  2K75 A;  2WAQ E;  3ER0 A;  4JI7 Q;  4JI4 L;  3KFU A;  1WJJ A;  4DV0 L;  3J80 c;  2YTX A;  3M4P A;  5M3M G;  1VQJ A;  1HJP A;  3M7N A;  4LWC A;  1R9T H;  3BU2 A;  2D0O A;  2VS1 A;  4GN5 A;  1YJN A;  1NMG A;  2Q2T A;  4LF4 L;  2UXD L;  2H5X A;  2AWO A;  4DV7 Q;  1X3F A;  2F3I A;  4YCW A;  3T1Y L;  4BY1 G;  3U4Z A;  5LMU Q;  2YV5 A;  3MEF A;  3M4Q A;  4JI5 L;  1CUK A;  2E5L Q;  1X3G A;  4DPG A;  2OTL A;  1XTD A;  4HJ8 A;  4LNQ A;  4APV A;  4XIG S;  1NJI C;  3I4N G;  2F52 A;  5IT9 c;  4NB3 A;  5IP9 H;  4IOC A;  2JA7 G;  3HOZ G;  3KF6 B;  3NBH B;  1WFQ A;  2ZM6 L;  1A0I A;  3E0E A;  2Q2H A;  4A76 A;  1S72 A;  2R93 G;  2N3S A;  1E7Z A;  1Q1E A;  2RF4 A;  3CCQ A;  4HIM A;  3E9I A;  3CC2 A;  1X55 A;  4IPD A;  4DV6 L;  1Q7Y C;  1JJG A;  2OQK A;  1QZH A;  4DR1 Q;  1TWF H;  1VQ4 A;  1D8L A;  1K3R A;  2ZTD A;  2JQO A;  3EBE A;  4A3K G;  4QIW E;  4QJF A;  4O0A A;  1YJW A;  2XTI A;  4MTN A;  1BKB A;  2YTV A;  3GDE A;  2AWN A;  1UE1 A;  2B3G A;  3PUZ A;  1K8A C;  1N32 L;  2ZTC A;  1MIU A;  4DV4 Q;  3D0F A;  3W1B A;  5IE8 A;  4A3L G;  1QVG A;  1J5E Q;  3KLW A;  4Y52 H;  2R92 H;  4LFB Q;  2R7F A;  2E2H H;  4JV5 Q;  1YNX A;  2IX0 A;  4LW1 A;  4P71 A;  4TQU S;  1OXS C;  1UE5 A;  1Y1V G;  1PH1 A;  4A3F G;  3PSI A;  2JA5 G;  1MJE A;  4JI7 L;  3JAM c;  5M3M H;  2VL6 A;  1M90 C;  3K7A H;  2VUM H;  4NXM Q;  1EQQ A;  3GTQ H;  2CQO A;  4IPH A;  3S17 H;  4BA1 I;  1VQN A;  1A63 A;  2RHQ B;  1VQ9 A;  4R4O A;  5GAE C;  3STB D;  5HY6 A;  3ICE A;  3W1G A;  4DV7 L;  1KC8 C;  2Y0S G;  2VZA A;  1VQD A;  3U58 A;  2LXK A;  5LMU L;  5M5Y H;  3HKZ G;  4HJ9 A;  3NEN A;  4EQ5 A;  2JEA I;  2E5L L;  4B3T Q;  4C3I H;  4DV5 Q;  3I4N H;  1KHI A;  2YTY A;  2AKW B;  1JMC A;  1PVO A;  1XPU A;  4OXP A;  1IZ6 A;  1P16 A;  1UE7 A;  4PZ8 A;  5J3B A;  1N34 Q;  2JA7 H;  2WP8 J;  3HOZ H;  2BH8 A;  1QVC A;  4HID A;  4DR3 Q;  4IFD J;  3I55 A;  2A19 A;  2NVT H;  2KHJ A;  1SR3 A;  1Q82 C;  1N9W A;  3CAM A;  3KDF A;  4C3H H;  3CD6 A;  4MZ9 A;  4TVA B;  3RR5 A;  1VQB A;  4JI0 Q;  3RLO A; 
#chains in the Genus database with same CATH topology
 3FPU B;  4RH6 A;  4HIO A;  3TRE A;  4B08 A;  5KNB A;  2UUA Q;  2NVX H;  3D4D A;  1FVI A;  4QB4 A;  3S24 A;  2IPK D;  3GTO B;  1VMP A;  4MHE A;  1EY7 A;  3AFP A;  1XMO Q;  5ELN A;  3KK7 A;  1SNM A;  1SLJ A;  3BYT B;  3C1E A;  3LNN A;  2PCF B;  3PIO A;  1SMY C;  4L5R C;  2I07 B;  4HIK A;  4GNX B;  3PUV A;  1MD2 D;  1ENC A;  1AN8 A;  3ND8 A;  5FOB B;  2FMC A;  1ICW A;  4C3J G;  3PQI A;  3GTP B;  2D9U A;  2F0P A;  3STB C;  3EIV A;  3ULL A;  3H3V I;  3CF5 A;  1TXY A;  4A3M G;  5M3F B;  4CHT B;  2ICI A;  2JN4 A;  3F8T A;  3L7Z C;  3HOY H;  3SK8 A;  2QF7 A;  4YWM A;  3TQY A;  3CME A;  1XNQ Q;  2F1M A;  4LFA Q;  3NWT A;  1SNO A;  2N78 A;  4JCV E;  1I3Q H;  1Y1W B;  4H7B A;  3CMA A;  3CC4 A;  1JOO A;  3A8K E;  1KNA A;  4S3S A;  1BO0 A;  4RAU C;  2V4D A;  3G6E A;  2UUB L;  1TWH B;  1XMQ Q;  5C4H A;  1HR0 L;  1IBM L;  4GN3 B;  2R7Z G;  4RFB A;  4IFD G;  3T1H L;  5IP7 H;  2R6G A;  2ZT9 C;  4DR4 L;  2IY5 B;  2Q8T A;  1TWC B;  1AFP A;  2HDM A;  1H9S B;  2WKC A;  5COR A;  1HH2 P;  2JXM B;  4XT3 B;  1IKL A;  1GUO A;  1HFG A;  5HUR A;  3R2T A;  3R93 A;  2K5V A;  3BVZ A;  4LMQ D;  5FLM H;  3IFD A;  3OTO Q;  2GVB A;  3PO2 B;  5J39 A;  2A69 D;  2L5T A;  1CK1 A;  4B3S Q;  2RDH A;  1FNU A;  2HT1 A;  3GD7 A;  3CCM A;  2WAC A;  3KJO A;  4E6I A;  1MKH A;  2DGY A;  4UAI A;  1TWF B;  1EOT A;  5GAH C;  2DY8 A;  1W6J A;  4LF5 L;  2ZXO A;  1QVF A;  4G7H C;  1FNW A;  1M4V A;  3NPP A;  3GO5 A;  3M4O H;  3SR1 A;  5C0X H;  1E22 A;  1KLU D;  4JI1 Q;  2F0Q A;  1TVX A;  3CCU A;  4QY7 A;  5C0X J;  4OO1 H;  1S5E D;  1QB5 D;  3U50 C;  3HOY G;  5FKA C;  1BNZ A;  2EY1 A;  5CV4 A;  3OW7 A;  1GVP A;  4ALP A;  4BY1 B;  4B3R Q;  2BDN A;  2VQF L;  4DV2 Q;  1VQM A;  1IYV A;  3S16 H;  3TEH B;  2KHI A;  1PH5 A;  1VQH A;  2KCT A;  4C3I B;  1QOH A;  3GP7 A;  2XVS A;  1PFM A;  2K50 A;  3CCL A;  5C4X H;  3SVM A;  2VY3 A;  3J80 L;  3HKS A;  4G57 A;  3BYY B;  2A8V A;  3MHB A;  3NP8 A;  1AE2 A;  1H9M A;  4C3H B;  5C3X A;  2F4I A;  3DM1 A;  2E2I H;  1JOK A;  3I8Z A;  1F2L A;  1YVC A;  1DXM A;  4ZUI A;  3AU7 A;  4K0K Q;  1ENA A;  4TRD A;  5JJI A;  1X3P A;  2I0Q A;  1XX8 A;  3E6Z X;  2UUC Q;  3I73 A;  3S1M B;  5CBA E;  2VQE L;  4JBW A;  2CKZ B;  2KJX A;  4KV6 A;  4KN7 C;  2Z6K C;  3ONA B;  1UEB A;  4A3I G;  1H9R A;  2HDL A;  1G6Z A;  3H94 A;  3NBH A;  3S14 B;  4KJO A;  3DUZ A;  4X65 Q;  1JWS D;  3J7Z C;  3U4V A;  4LJZ C;  4P75 A;  4DR6 L;  4V0B A;  1VQP A;  5CV9 A;  3GV3 A;  3DMU A;  4RGT A;  2PMZ E;  2IHE A;  2LKV A;  3PO3 H;  2B29 A;  2Y0S E;  1EYC A;  1FYC A;  4ILW A;  5FO9 B;  4BY7 G;  3PUX A;  2CWP A;  2F0D A;  3HKZ E;  1SFO B;  2Z6K A;  2KOL A;  2CWA A;  3CP0 A;  3DEO A;  4QF4 A;  1SEB D;  1I50 H;  4ABN A;  4BA2 I;  2EY5 A;  5EQ0 A;  2GA4 B;  2EIF A;  3T56 B;  5M5X B;  3ERO A;  4ZLT F;  4LF6 L;  1MI2 A;  2B2Y C;  5CV7 A;  5JJK A;  1LV9 A;  1Q8I A;  1G6P A;  4G4K A;  1VQK A;  1LTL A;  2N55 A;  3OMC A;  2UXB Q;  2H1E A;  1XYI A;  1QZG A;  5IGE A;  3RUZ A;  1XNR Q;  3JC6 6;  4LF9 Q;  1TWA B;  2B2Y A;  2CW0 D;  4Q0F A;  4KY7 A;  1A3T A;  1HQR D;  2EXZ A;  1EYG A;  2MP1 A;  2Z0S A;  3J80 E;  2MQH A;  2CH4 W;  1SE8 A;  3G4S A;  1KTK A;  2RCF A;  4DUY Q;  3MC0 B;  3N6R A;  3P20 A;  4H13 C;  4C3J B;  1Q8K A;  1VCI A;  1XPR A;  4KD4 A;  4XQJ A;  4CJ2 C;  2YU9 B;  3HG9 A;  2M2L A;  2FFK B;  3HOU H;  4C1N I;  1S5C D;  2KA7 A;  1IXR A;  4A3M B;  2PNR C;  1SE4 A;  1UE6 A;  1PTO H;  4FF2 A;  2MNA A;  2EJF C;  3IRB A;  1GM5 A;  3E5S A;  1BUV T;  4ZKC B;  4BS9 A;  3M9B A;  4RGO S;  2B63 H;  2JE6 I;  2QIL A;  4WJW A;  3S17 B;  5JPN C;  3A5Z B;  3D31 A;  4YY3 L;  1WTQ A;  4QMG A;  3CQZ B;  1AE3 A;  1HR0 W;  1CSP A;  1VQE A;  2MFI A;  2FIN B;  3IAY A;  4P72 A;  3O13 A;  1X65 A;  1EUJ A;  2PI2 E;  1JT8 A;  1BBW A;  2B2U C;  3K58 A;  2VW9 A;  2R7Z B;  2G5D A;  5C4J B;  1MBY A;  2L9H A;  5J1Z A;  1PH8 A;  3BDO A;  4LF4 Q;  2LMC B;  2NUC A;  3AEV A;  1WTV A;  2TSS A;  3SK6 A;  2SEB D;  4OWX B;  1HTP A;  1YNJ D;  1K0R A;  4OX9 L;  2B2U A;  4BWG B;  4KHV A;  4WFN 3;  3GTP H;  2BOS A;  2A68 D;  3W5O A;  2KCN A;  3NEM A;  2ZM6 Q;  2ALY B;  1PH2 A;  1I6H B;  1L1O C;  5IWA L;  1D7Q A;  4PZ6 A;  5EAY A;  1KDA A;  4DV6 Q;  3HZX A;  2NYZ D;  2K01 A;  2Z4I A;  4ULL A;  1PRT C;  2XWJ B;  1I5F A;  2K05 A;  5T1G A;  1JJ2 A;  4DK6 C;  4X62 L;  1BQQ T;  2K5H A;  1L1O A;  1TWH H;  3HOU G;  3RLN A;  4YHH L;  1V1Q A;  4JI4 L;  3KFU A;  2H4O A;  3HOY B;  3FEW X;  2YTX A;  5M3M G;  2BDO A;  1HJP A;  2H5X A;  3MVV A;  2JYO A;  2F3I A;  1SYE A;  1KNE A;  3U4Z A;  1TQO A;  1IKM A;  4OEM B;  1UNS A;  1KAB A;  1CUK A;  1EWC A;  1XTD A;  3EA6 A;  1T5E A;  5AFW A;  1NJI C;  2BCO A;  2F52 A;  3I4N G;  4IUN A;  3S1R B;  2C9O A;  4IOC A;  1CTM A;  3NBH B;  4K2L A;  4OHJ A;  1A0I A;  3MA2 B;  2HQE A;  3E0E A;  3SHL A;  1S72 A;  2N3S A;  1ZXT A;  4ZK9 B;  3J7A F;  1LTB D;  4IPD A;  1JJG A;  5EJW A;  1TWF H;  1VQ4 A;  1GUW A;  3MEH A;  2NZ1 D;  2Z9H A;  2EDG A;  3WDN A;  2YTV A;  3W3A A;  2HCC A;  2RA4 A;  1QVG A;  4PMC A;  4C1N K;  3MXG A;  2R7F A;  3NE5 B;  4A3I B;  4DAV A;  1MJE A;  1U4L A;  2NBF A;  3QR8 A;  4M8A A;  5I9O A;  5DAU A;  3M3Y B;  1K8M A;  4RGM A;  1VQN A;  4DNT B;  2RHQ B;  3SDZ A;  5GAE C;  5HY6 A;  4DV7 L;  1KC8 C;  4FXK C;  4BY7 B;  2NWG A;  5LMU L;  2DNC A;  3NEN A;  4EQ5 A;  4C3I H;  3M4O B;  1QWY A;  5EKI A;  3K5N A;  3Q22 A;  2AKW B;  1JMC A;  3OSO A;  1P16 A;  2F0U A;  4HID A;  4DAP A;  3W2D A;  4DU9 A;  1Q82 C;  4C3H H;  3F2U A;  5C44 G;  3T53 B;  5DLQ E;  4FF1 A;  3RLO A;  4FO2 A;  1AZQ A;  2BE5 D;  2A74 C;  3H3V H;  4V19 0;  2UUB Q;  2J0T D;  2A6H C;  1CKO A;  1X6O A;  1HR0 Q;  3S1M H;  1L0Y B;  4K2K A;  2PZW A;  1IBM Q;  2QA4 A;  4IPC A;  2OT2 A;  3T1H Q;  2AQ1 B;  4J15 A;  5IOD A;  3SK5 A;  3VYT A;  1J5E L;  4AYB G;  4DR4 Q;  4J1M A;  1XJV A;  2ZJQ A;  5LL6 X;  1MSG A;  2Z8L A;  2X69 A;  4K6D A;  1DM0 B;  1RDP D;  3VR4 A;  1LT5 D;  3KBG A;  1A8V A;  2Q2U A;  2ZXP A;  4RG1 A;  4CDE C;  1G2S A;  3PIO 3;  1SFO H;  5LHY 1;  4RGN A;  4H0L C;  4HAE A;  1A3V A;  2K52 A;  5IYC H;  1D5X C;  3QJY A;  1FGU A;  5M5X H;  1STB A;  3NQI A;  3TP6 A;  2ASB A;  2K6A A;  2A6E D;  4KKT A;  3J81 c;  4CDF C;  4HJ5 A;  3NEL A;  2RKS A;  1N8R C;  4LF5 Q;  3OMG A;  2RSO A;  1E24 A;  1XPO A;  1Q12 A;  1IYJ B;  5I6Y A;  3ULP A;  3RZO B;  2A5H A;  4IOA A;  1EY6 A;  1I50 B;  4M1U B;  1SND A;  4XDX A;  1TWA H;  1NY4 A;  2KCC A;  3NTH A;  4ME3 A;  4A3C G;  3V96 A;  1A6X A;  1F77 A;  5C5M A;  4WOR A;  1IHZ A;  1JCK B;  1NSN S;  2JA8 G;  3PV0 A;  1PDQ A;  5E3F A;  3CCR A;  2VQF Q;  5C3W A;  5E1F A;  1Q81 C;  3K57 A;  2R61 A;  3M85 A;  4C3J H;  3OYY A;  3VR5 A;  2MHV A;  1A15 A;  3I2Z A;  2R3Z A;  3RNU A;  2YU9 H;  3D4R A;  4KMU C;  1L1O B;  3H3V C;  4X66 L;  1C7Y A;  3HOW G;  3L2P A;  1S4Z A;  1K0S A;  4A3M H;  1E2V A;  2EOT A;  3FDT A;  1YIJ A;  4DUZ L;  3ERS X;  4F8M A;  2WB1 E;  1EY5 A;  1T5X D;  1GUG A;  4DA2 A;  1PRT B;  2F4V L;  2NB0 A;  3CQZ H;  1BDO A;  2AQ3 B;  2DNE A;  3BJU A;  2O5J C;  4KHP L;  1RJT A;  4A75 A;  3J81 j;  2XRQ D;  4NW2 A;  1RTN A;  2VQE Q;  4A3G G;  4JVZ A;  3J80 i;  3UDX A;  5KYI A;  3PIP A;  3HOU B;  2WII B;  3QO2 A;  5IYC G;  4JI2 L;  4DAY A;  1B9M A;  2R7Z H;  2D0P A;  5C4J H;  2F0N A;  1PH9 A;  4LFC L;  2IT1 A;  4DR6 Q;  2QKI C;  5M3M B;  3C1F A;  3K7A B;  3GTQ B;  3OIP A;  1FR3 A;  2L4N A;  1WD1 A;  1HA5 A;  3CC7 A;  4POG A;  1HPC A;  2M00 A;  4H02 A;  5M5Y B;  2L15 A;  2OF1 A;  5A35 A;  4FXD A;  2F0I A;  3D6C A;  1PLF A;  2NTT A;  3I4N B;  1Q1B A;  5KND A;  1CZW A;  2PYK A;  1B53 A;  3FKI H;  1PTO D;  2HIV A;  1PFS A;  4XYQ A;  4LF6 Q;  1I6H H;  3NXW A;  4DV3 L;  1CA6 A;  5E4W C;  1GD7 A;  2E75 C;  2LS0 1;  4LF8 L;  3S1Q B;  1LTS D;  1PH4 A;  4MN3 A;  3D4W A;  1GKH A;  3MTS A;  2FXQ A;  1J6Q A;  1GOZ A;  4UPA A;  5EKL A;  3HOX H;  4JI3 L;  1X56 A;  3BVM A;  1L0W A;  1AP0 A;  2N49 A;  1M1K C;  3L3O C;  2RVL A;  4I7A A;  4AH6 A;  1EY8 A;  3FVQ A;  5JJL A;  1CFM A;  1DOL A;  3VR2 A;  2RDG A;  4ZYS A;  1HNX L;  5JJZ A;  3LWE A;  5KRU A;  4UY8 C;  1HZC A;  3C46 A;  2FHT A;  1I4R A;  4KHZ A;  3A7L A;  1P8L A;  3TBI B;  5GAG C;  2F3V A;  1LT6 D;  4KD3 A;  5C5L A;  1PYB A;  3VYS A;  1VQ6 A;  4DR5 L;  3KJP A;  1RL2 A;  1SN8 A;  5I2X A;  3H0G G;  5IYB G;  3S1R H;  2RBM A;  3AYH B;  3TME A;  4F88 A;  1SXT A;  1BCP B;  4A3E G;  2HCI A;  2UXC L;  3GTG B;  4YY3 Q;  2NN6 I;  1NMF A;  4N9P A;  2DY7 A;  5C44 B;  1LYL A;  5I2Y A;  1EIH A;  3K6O A;  3TS2 A;  3A5U A;  2XGT A;  1KDB A;  1DJR D;  4ZUJ A;  5C6A A;  5CBE E;  4GKJ L;  1HFN A;  1X9N A;  2PZT A;  2HHH L;  4GLV B;  1B50 A;  1D2B A;  2FJ2 A;  2ID0 A;  1K8O A;  3PUY A;  2IWH A;  2SOB A;  3HP3 A;  3FKI G;  1EEI D;  1I4P A;  1LT4 D;  3ND9 A;  4A3I H;  4X64 L;  4AYB B;  4IO9 A;  4DV1 L;  1N36 L;  5AJ3 L;  3GTJ B;  1EZ6 A;  3CPW A;  2J7Z A;  3M3Y H;  4FXG C;  3U9O A;  3PF5 A;  3PF4 A;  4DR7 L;  1S3O A;  1LAB A;  1ONL A;  1PYW D;  1IBL L;  3AB9 A;  4OX9 Q;  1YIT A;  4OIK A;  4NP5 A;  4ZKB B;  4BY7 H;  3GTL B;  5IYD H;  3V05 A;  4DNI A;  2MJ8 A;  2K5N A;  5IGF A;  2K5Q A;  3HOX G;  3L9A X;  5JOB A;  4DK3 C;  1O7I A;  5IWA Q;  2NVY H;  2ZTE A;  2E2J B;  3TZD A;  1IBK L;  3ZYY X;  5IGD A;  3S15 B;  1YNN C;  1LTR D;  3BS1 A;  5IY0 A;  3VDY A;  3K81 C;  1B7Y B;  4JBK A;  1ZKO A;  2EY6 A;  2A1A A;  2X6L A;  3OWF A;  2NVQ B;  4X62 Q;  1BBU A;  1JC7 A;  2F0J A;  2K03 A;  4YHH Q;  3C3L A;  2RHS B;  3IFT A;  4JI4 Q;  1V1O A;  2AQ2 B;  3I56 A;  4ZQ3 A;  1GJX A;  3J81 L;  3SEB A;  5M9O A;  5KYL A;  1VQ5 A;  3DWA A;  2JA8 B;  1PFN A;  1HUN A;  2QDL A;  3I90 A;  1NR4 A;  1I4G A;  2E8G A;  1O80 A;  3RLF A;  1I94 L;  1SYD A;  2MPM A;  1WTW A;  2JK8 A;  1U4M A;  1ZYR D;  2B2W C;  1IW7 C;  2I46 A;  1JWM D;  4GLX A;  1C48 A;  1JWU D;  3LGJ A;  1B44 D;  1EY9 A;  4PG3 A;  1D6E C;  3HOW B;  5ELE A;  1CT1 D;  5NUC A;  4DAY B;  1JQY D;  1PZK D;  4XQN A;  4JC0 A;  2JA5 H;  1FL0 A;  3PCO B;  4PNY A;  2EYM A;  4OON A;  4CBV A;  2B2W A;  3F1Z A;  1C8C A;  4GS3 A;  3D6W A;  1ILQ A;  1OTC A;  4NXN L;  2X6G A;  3HFZ B;  1C0A A;  1B4O A;  4A3G B;  3MXN A;  5IYD G;  3RZO H;  2F0V A;  3F2D A;  4XQQ A;  1AW7 A;  4I65 A;  1EWH A;  1Y14 B;  1FGB D;  1WTP A;  1NNX A;  1WJJ A;  4DV0 L;  2RSN A;  3M4P A;  1DON A;  3M7N A;  5CV6 A;  2XRS D;  2XWB B;  2VS1 A;  1D1K A;  2J4X A;  2Q2T A;  4DV7 Q;  4YCW A;  4RCO A;  3T1Y L;  3S1N B;  1HQM C;  5LMU Q;  3BDC A;  1X3G A;  4DPG A;  2OTL A;  1E0B A;  1SYF A;  1JR0 D;  2EYL A;  2M9V A;  4JPB W;  4ZCK A;  4QUF A;  5IT9 c;  2F0W A;  3HOZ G;  1WFQ A;  3FRP B;  4A76 A;  1LAC A;  3J81 E;  1PFB A;  3CCQ A;  5I9P A;  5JAV A;  3NQT A;  1TII D;  1O78 A;  1K3R A;  3EBE A;  3NWS A;  4QJF A;  1SBB B;  4O0A A;  4QIW B;  1PXU A;  1EFI D;  1BKB A;  1S5D D;  1N32 L;  3DXJ C;  1SMY D;  1QNU A;  4A3L G;  3W1B A;  1J5E Q;  4Y52 H;  2R92 H;  4C56 C;  1YNX A;  2IX0 A;  4G7Z C;  1OXS C;  1UE5 A;  1Y1V G;  2LY7 A;  3QB3 A;  5CV5 A;  4A3F G;  1PH1 A;  2JA5 G;  3JAM c;  4JI7 L;  5K36 H;  5M3M H;  2VL6 A;  3IKJ A;  3K7A H;  1D5M C;  1EQQ A;  2CQO A;  2F0G A;  3GTQ H;  2SNM A;  3ITP A;  1VQ9 A;  2VXW A;  3STB D;  4FVM A;  2K28 A;  2QCP X;  1D5Z C;  2LXK A;  5M5Y H;  4J6H A;  4QCL A;  1PTO F;  3MAQ A;  2TMP A;  3I4N H;  3FPP A;  4O42 A;  2L11 A;  1KHI A;  4DN4 M;  4HSP A;  4U67 3;  3H0G B;  4OXP A;  1IZ6 A;  1QG7 A;  3I91 A;  4PZ8 A;  3HGB A;  3QIA A;  4KJN A;  2F0F A;  3I55 A;  2A19 A;  4A3E B;  2KHJ A;  3CKI B;  3KDF A;  4MZ9 A;  1PMR A;  4LUZ A;  3SK4 A;  3S1Q H;  1NUC A;  4Q5V A;  1H95 A;  3F2B A;  3A0J A;  1ROD A;  1QCB D;  1SJH D;  4R4Q A;  4DGZ A;  3NTI A;  2MO0 A;  4DR1 L;  1EU4 A;  1O7Y A;  3J7A V;  3VYU A;  2N8N A;  2E2D C;  1MSH A;  2K5D A;  1LTA D;  3S2D B;  5D3D A;  4DK1 A;  3FKI B;  4ID6 A;  4UP8 A;  4L8J A;  3I4M G;  4LFB L;  4JV5 L;  4NMZ A;  4K6L A;  2PQA A;  1Y8O B;  4Z9C B;  3F2C A;  4OO1 I;  1G2T A;  3BZC A;  1F2Y A;  4EGV A;  4BXX H;  4YIJ A;  3VYR A;  3A74 A;  2OQ0 A;  3WWV A;  1EQR A;  1J9O A;  3CCJ A;  1VQC A;  3QOJ A;  2R7D A;  1SRO A;  5IOC A;  4X66 Q;  1T9H A;  2DJF C;  3HOX B;  4CJ0 B;  3SGI A;  1GUN A;  1VQF A;  4GOP C;  1OXV A;  2BA0 A;  1I4H A;  2R92 G;  4IUR A;  3T4A C;  4DUZ Q;  2FMM A;  4L5S A;  1KAW A;  5K36 G;  1Z47 A;  1S40 A;  4HMJ A;  1VS0 A;  2K14 A;  3GTG H;  1WTH A;  2F4V Q;  1QJO A;  5C44 H;  3RN5 A;  1SNC A;  3OOC A;  3D3R A;  4IZ8 A;  4KHP Q;  4JK1 C;  4JI0 L;  4BBS H;  1QE6 A;  4A3B G;  1CHQ D;  4HMI A;  1H9J A;  4GOP A;  4UP9 A;  3ZJY C;  5D14 A;  4B3M L;  4IUV A;  4JI2 Q;  3CXC A;  1N33 L;  1CM9 A;  2KUM A;  3HRZ C;  5EKK A;  4LFC Q;  2L1B A;  5IIF A;  2F0K A;  3CPF A;  3TS0 A;  3G48 A;  3C2P A;  4FP5 D;  3Q0A A;  1VQ7 A;  2KEN A;  3GTJ H;  2F0L A;  1CA5 A;  4J8Q A;  4B9W A;  3HOV H;  1KLG D;  4ODG A;  1HZ9 A;  1X54 A;  1IL2 A;  2F0M A;  1K3B C;  4UDU C;  1EOV A;  3GTL H;  3MXN B;  2EJM A;  4DNR B;  2F0S A;  3TSS A;  4A3D G;  1K73 C;  2VNU D;  2EY2 A;  4IJH A;  1I6V C;  4KN4 C;  3H6M A;  1EZ8 A;  4DV3 Q;  3J7A 5;  2PO4 A;  3KYH C;  2E2J H;  4LF8 Q;  1JE4 A;  1RD9 D;  3GQB A;  4XXE A;  1PV4 A;  4K5W A;  4BXX G;  3S15 H;  5I4D A;  5FK9 C;  3MWY W;  5DM7 3;  3UE0 A;  1WCM G;  2NVQ H;  4JI3 Q;  2BA1 A;  1MHW C;  2B2T C;  4JW0 A;  1SAP A;  1YEZ A;  2MGS A;  2AMC B;  1U5K A;  1HXY D;  4A3J G;  2E2H B;  4YWK A;  1EQV A;  1ASZ A;  4A3C H;  2WAQ G;  1WD0 A;  5JVH 3;  2NVY B;  1KRT A;  1HNX Q;  4OIJ A;  1Q90 A;  2VUM B;  2JP1 A;  2JA8 H;  4A4I A;  3UE1 A;  1X3E A;  2V1C C;  1WTR A;  2I5L X;  1TS4 A;  3PIP 3;  1BCP C;  2Z6B A;  4GN4 B;  2LSS A;  2B2T A;  4BBS G;  1TWG H;  1GO3 E;  5LL6 S;  1IYU A;  4DR5 Q;  4KY6 A;  1U0L A;  5BR8 L;  1YHQ A;  5A2Q L;  3HOW H;  1TY2 A;  3EQL C;  2MO1 A;  2CQA A;  3TZU A;  3HOZ B;  1B9N A;  3NTK A;  1TS5 A;  2UXC Q;  2NVT B;  4OGQ C;  1LLR D;  1RIP A;  5K5P A;  4IUU A;  4FNF A;  3GV6 A;  3TRZ A;  2A69 C;  1Q46 A;  4IUP A;  5E4X A;  3HOV G;  5DEH A;  2SDF A;  1B2T A;  4GKJ Q;  2HHH Q;  1ET6 A;  1YZ6 A;  5D65 A;  3P1H A;  3CRL C;  5IT9 L;  3WOF A;  4A3G H;  1G91 A;  2JA9 A;  4X64 Q;  2GVA A;  4JI8 L;  1N36 Q;  4DV1 Q;  1TS2 A;  4PV1 C;  2NN6 H;  5AJ3 Q;  1ILP A;  3VA7 A;  1LO5 D;  4XTC S;  2JA5 B;  1Y1V B;  1DZ1 A;  4A3F B;  4OEL B;  4K5V A;  3G71 A;  3KDF B;  1KQS A;  4GZY C;  2WB1 G;  5EGT A;  4DR7 Q;  3VR6 A;  2Z4H A;  4CKB A;  1IBL Q;  5C3E G;  5ELD A;  5EBC A;  1B8A A;  1A2U A;  1SDF A;  1UAP A;  1RF2 D;  3S1N H;  3CU7 A;  1HA6 A;  2LXJ A;  1LTI D;  3WOE A;  3S2H B;  5F2D A;  4DK0 A;  3FHW A;  3J7Y W;  4JI6 L;  3EJI A;  5FO8 B;  2JJQ A;  1VF5 C;  3DWP A;  4A93 G;  5FJ8 G;  1NTG A;  2K04 A;  1V43 A;  3JAM L;  2ZJP A;  1OXU A;  1FJG L;  3H09 A;  4WJ4 A;  1ICF B;  3NK9 A;  1IBK Q;  2PQA B;  2EYJ A;  1G8Z D;  4R9W A;  1SE2 A;  2AUJ D;  1Q86 C;  3I70 A;  1EIF A;  3A55 A;  4KKS A;  4IJL A;  1WTX A;  4HTH A;  4Y7N H;  1I4X A;  3GTK B;  2QEJ C;  4NDX A;  1ET9 A;  4L5T A;  5FLX c;  3I4M B;  4AYB E;  1PH6 A;  5A2Q E;  4EX5 A;  4DR2 L;  4BBR G;  3UI2 A;  1GUS A;  5IGB A;  1NCV A;  1I94 Q;  3AFQ A;  1F2Z A;  3VA5 A;  2KBN A;  4PZ7 A;  1KXL A;  4LUO A;  2D62 A;  4CDC C;  4CKE A;  1K28 A;  4GOP B;  1CKN A;  2OTJ A;  3PGZ A;  2E74 C;  4KKU A;  4JOI C;  2EZV A;  5M5W B;  3J81 i;  1JIC A;  5IT9 E;  3RD4 A;  4GKK L;  3H0G H;  5IYB H;  2R92 B;  3Q24 A;  5E7N A;  2UU9 L;  4R1J A;  1XWE A;  2NN6 G;  4X3K A;  4WJ3 M;  3R2I A;  5ELF A;  3U9S A;  4A3E H;  1Z9F A;  3GTM B;  4YCU A;  5ELB A;  3UDG A;  3K5L A;  2JA6 G;  1YHB A;  2JSO A;  3OPO A;  1PRT D;  3KUP A;  4R8I A;  4NXN Q;  4CJ1 B;  2EPB A;  1LM0 A;  4A3B B;  4JOI A;  1PA6 A;  1EEF D;  5ELO A;  2EJG C;  4GLA C;  1HNW L;  2K5W A;  3P75 A;  2L12 A;  4HN7 A;  1BVS A;  3AMU A;  3M4Y A;  3S2D H;  1U9R A;  2N88 A;  4DV0 Q;  4POF A;  1V8Q A;  4KTA A;  3L0O A;  4XYO A;  4YWL A;  2R93 H;  3JAM E;  1E2Z A;  1TU2 B;  3BVG A;  4N8X 1;  5BN5 A;  4QGU A;  1EIY B;  2CW0 C;  4L5Q A;  3T1Y Q;  1EQT A;  3I7F A;  2NZO A;  5IGG A;  1R4Q B;  3B6Y A;  3UDI A;  4A3K H;  1ASY A;  1KRS A;  4KY5 A;  4NPS A;  5LMN L;  4MNO A;  4KI0 A;  4A3D B;  2BH2 A;  2QEX A;  4AQY L;  5IP9 G;  1HNZ L;  4X3S A;  1SJE D;  1TR5 A;  1VQL A;  4JYA L;  2O4X A;  2EYF A;  3NBI A;  2MUY A;  2OWO A;  1I4Q A;  1K83 B;  3BZK A;  4RHS A;  4C2M B;  2K4K A;  1RCV D;  1C4Q A;  3K0X A;  2LFN A;  1FD7 D;  1LTG D;  1RTO A;  3FP9 A;  1B3Q A;  4R4C A;  4LF7 L;  3DHQ A;  1SMX A;  5EPL A;  1WCM B;  1N32 Q;  1W3S A;  2GN5 A;  4ZAI A;  3A8J E;  4MTK A;  3T51 B;  1HTL D;  1OXX K;  4FF4 A;  4A3J B;  3M7G A;  2WAQ B;  4JI7 Q;  1E2W A;  1R4P B;  4LWC A;  1R9T H;  2UXD L;  1KDC A;  1BF4 A;  4UHV A;  2D5D A;  3NHH A;  2AWO A;  5DNF A;  3SXH A;  1EYD A;  4BBS B;  4F7X A;  4DXG A;  3MEF A;  3A56 A;  4JI5 L;  2KQ3 A;  1DYQ A;  4HJ8 A;  1O7L A;  2SNS A;  4PMB A;  2WV6 D;  3MFG A;  2CH4 A;  4XIG S;  1YNJ C;  1XXG A;  2JA7 G;  1LT3 D;  3P7J A;  1RHP A;  2A68 C;  1BCP D;  3RZD B;  2R93 G;  2RF4 A;  1ESF A;  5DM6 3;  3CC2 A;  1X55 A;  2A6H D;  2OQK A;  3HOV B;  5HGT A;  1QZH A;  3D8G A;  4DR1 Q;  1ESR A;  2ZTD A;  4A3K G;  1DD2 A;  4QIW E;  2D2C C;  1VDZ A;  2XTI A;  4MTN A;  3X3M A;  2OXP A;  3GDE A;  1UE1 A;  2B3G A;  2XNA C;  3K59 A;  2ZTC A;  1MIU A;  3D0F A;  1JB3 A;  3KLW A;  3BZD B;  4LFB Q;  2E2H H;  4JV5 Q;  3OHX C;  4LW1 A;  4TQU S;  1EY0 A;  1Y69 U;  1M90 C;  2VUM H;  2WB1 B;  3KF8 A;  4F87 A;  4BA1 I;  5C3E B;  3A54 A;  1QNK A;  4LK1 C;  3W1G A;  1TY0 A;  1WVL A;  1AZP A;  3ICE A;  2Y0S G;  1H9K A;  3U58 A;  3TN2 A;  1PZI D;  3HKZ G;  3I3C A;  1TT2 A;  4HJ9 A;  2JEA I;  2E5L L;  3T13 A;  2PW7 A;  1HHV A;  2IJ0 A;  4A93 B;  4DFA A;  3A7A B;  2YTY A;  1PVO A;  2O2L D;  1UE7 A;  5J3B A;  3HOZ H;  2G9D A;  2BH8 A;  3EFX D;  1S5B D;  2NVT H;  1SR3 A;  1D1I A;  1N9W A;  3CAM A;  2QDB A;  3CD6 A;  1GUT A;  1SE3 A;  3RR5 A;  1VQB A;  4JI0 Q;  3MXP A;  3KOJ A;  1F9Q A;  1TWG B;  4TSS A;  1A2T A;  2KVM A;  3TDQ A;  4B3M Q;  1CKN B;  1N33 Q;  4OWT B;  2Z1C A;  2IL8 A;  4A3L H;  3FMC A;  3KLR A;  4JBM A;  4DV4 L;  2ATW A;  1UEA B;  5IP7 G;  4K8I A;  1F2M A;  2DUD A;  4HJ7 A;  1Y1V H;  4BBR B;  4A3F H;  1JOR A;  1ML0 D;  2IHF A;  4IFD I;  4RKB A;  1U4R A;  1SYB A;  4NXM L;  1JB7 A;  1JJC B;  4EQN A;  2F0O A;  5CYU A;  5GAD C;  3S2H H;  2DN8 A;  3I72 A;  4YCV A;  1HZA A;  5FLX L;  1II3 A;  1W6K A;  4JG2 A;  4B3T L;  3RN2 A;  1DOM A;  4DV5 L;  4HCS A;  3CCS A;  2PZU A;  3R3O A;  5C4Z A;  5FLM G;  3G7L A;  5GRO A;  1N34 L;  2PW5 A;  5H1S E;  3HS0 C;  2CFM A;  1X3Q A;  4DR3 L;  2JA6 B;  1UUP A;  3LX0 A;  2VUM G;  2ENB A;  4UP7 A;  1Z6H A;  1S5F D;  1GXD C;  3K0Y A;  3OWE B;  4DAM A;  1WTO A;  4X3U A;  2UUA L;  1PHJ A;  1SNP A;  2BE5 C;  1F9R A;  5C0X G;  3GTK H;  1AH9 A;  2HUG A;  3TP8 A;  1XMO L;  4OO1 G;  4RHR A;  5CC4 A;  3I4M H;  5CMD A;  1JE5 A;  3MXU A;  3ERQ A;  1C9O A;  2VB2 X;  2C35 B;  5LMN W;  2PNH A;  1SRU A;  3PUW A;  1LTT D;  1CKM A;  1BR9 A;  2F0H A;  3URY A;  3CHB D;  1VQO A;  4N9T A;  1EU3 A;  3AQQ A;  4PQX A;  5BR8 Q;  3CRK C;  2EXD A;  2OCE A;  2VB3 X;  2ES2 A;  2PI2 A;  4EQP A;  4Y7N B;  1PZJ D;  4LAA A;  5C4X G;  5M5W H;  5EPJ A;  2B2V C;  1L0X B;  1QUQ A;  1W2B A;  1J8I A;  2B8F A;  3UDF A;  4EQO A;  1DOK A;  2F0T A;  1PRT F;  1JOQ A;  3BDL A;  1V9P A;  1WOC A;  3V2T A;  3GTM H;  2JEB I;  1XNQ L;  2G9H D;  4LFA L;  4RMF A;  1EY4 A;  4H44 C;  1EWI A;  3H91 A;  2A6E C;  3K5O A;  4K5X A;  4A3B H;  1STH A;  4QL5 A;  5CGK A;  2XN9 C;  2B2V A;  4HJA A;  2YYZ A;  1HRJ A;  4I7Z C;  2KEC A;  4JI8 Q;  4QQB X;  3ULJ A;  1IL8 A;  1XMQ L;  5FLX E;  1VQG A;  1WI5 A;  4R4T A;  3NUC A;  3PMF A;  4R4I A;  4HED A;  1SYC A;  1CHP D;  1KD1 C;  3PO3 G;  4EVO A;  4DKA C;  3BG3 A;  3X3N A;  1E3P A;  1GHJ A;  2Q8R E;  4JI6 Q;  3OW2 A;  3GTO H;  3QG1 A;  4P73 A;  1NE3 A;  4A3D H;  2WKD A;  2XSC A;  3DM3 A;  4AIM A;  3KLS X;  4O1N A;  4ME5 A;  1FJG Q;  2JA7 B;  5J22 A;  3DLL A;  1VMC A;  1PH3 A;  2RCN A;  2AHO B;  1SNQ A;  3K8A A;  5C0X I;  3OTO L;  1YJ9 A;  1OXT A;  2R93 B;  1K83 H;  3RMH A;  3KF8 B;  3KLS A;  4C2M H;  5ISR A;  2F03 A;  4B3S L;  4CGY B;  1PYS B;  1MGS A;  3Q8D A;  1EL0 A;  3N52 A;  2EYH A;  1A3U A;  2ICE C;  3S9W A;  5G3L D;  4A3K B;  1RKN A;  3OIQ A;  2NVX B;  2AUK A;  1WCM H;  2P5Z X;  3CCE A;  1VQA A;  3E3X A;  4OL7 A;  3JAM i;  3EN2 A;  1DGS A;  4LUV A;  2CVR A;  5M3F H;  4K8J A;  1B3A A;  4A3J H;  5IGC A;  4P74 A;  4DR2 Q;  3A8I E;  4JI1 L;  3KF6 A;  5BN4 A;  1B70 B;  3K7U C;  1GHK A;  1CQV A;  1AEX A;  2I5H A;  5EBD A;  1V1P A;  1Y1W H;  2ZXR A;  2HIX A;  2PMZ B;  2Y0S B;  4B3R L;  2QGQ A;  4DV2 L;  2I5M X;  2EQS A;  4KLK A;  3CW2 C;  3HKZ B;  1EFW A;  3CCV A;  1KAA A;  3K80 C;  5KIX A;  4GKK Q;  3E9H A;  2UU9 Q;  1BCP F;  1STG A;  2HD3 A;  4IUT A;  3DEP A;  1YNN D;  1Y8P B;  2Q8I B;  4L6T B;  2IX1 A;  3RZD H;  1PTO C;  1I3Q B;  4HR7 B;  1TWC H;  2KCM A;  1R9T B;  2B63 G;  3R8B A;  1BBX C;  4ZRZ A;  1KIX A;  1WYD A;  2HQL A;  4JBJ A;  1CSQ A;  4RCN A;  3HEJ A;  5TSS A;  2F3W A;  2QW7 A;  3NSW A;  2E76 C;  1HNW Q;  4WRD A;  4K0K L;  5GQO A;  1QIL A;  5JEA H;  5CR3 A;  1EIG A;  4X6A H;  2UUC L;  1VQI A;  5JEA J;  1KL9 A;  4FDB A;  3PO2 H;  1E1O A;  1EYA A;  3Q6S A;  2C5C A;  4X65 L;  5I6W A;  1VQ8 A;  4RWS C;  1IW7 D;  3TP7 A;  1PH7 A;  5T1I A;  5C3E H;  1Z7T A;  3EVQ A;  4IPG A;  4DXF A;  3I4L A;  1FNV A;  5LMN Q;  4GNX C;  4KK7 A;  1NBW A;  1A62 A;  4AQY Q;  1STN A;  4OWW B;  1HNZ Q;  4DF7 A;  1YI2 A;  4A93 H;  5FJ8 H;  2KED A;  4HSV A;  1CZG A;  4JYA Q;  2PQE A;  1STY A;  5M3F G;  1G51 A;  4L63 B;  1CQF A;  1BOS A;  3H15 A;  5HGQ A;  1O7Z A;  2B39 A;  3SE0 A;  4P2C B;  1Y1W G;  1E1T A;  4GNX A;  1TKW B;  1X32 A;  4BY1 H;  4LF7 Q;  1UWV A;  2UXB L;  1L2F A;  2Q2I A;  2EYP A;  5JVG 3;  1VF7 A;  4IQZ A;  2DJG C;  1QUQ B;  1SSO A;  2XIW A;  1XNR L;  5KGU A;  4LF9 L;  2EVB A;  4HCE A;  1CI3 M;  1YBY A;  4BBR H;  2UXD Q;  3I4O A;  4X3T A;  3KBX A;  1YHA A;  1Y8N B;  1K9M C;  2WFW A;  4JI5 Q;  4TKO B;  4DUY L;  2OEO A;  1F9P A;  2NTS A;  3S16 B;  1SYG A;  1F9S A;  1DCZ A;  2L0C A;  1LUZ A;  2RQX A;  1G29 1;  5JEA G;  5C4X B;  5KNC A;  2CCZ A;  4IUQ A;  1K8G A;  4CDD C;  3S14 H;  3PO2 G;  3DWQ A;  2NZH A;  2JA6 H;  5ELC A;  4NKL A;  2E2I B;  2K7V A;  4FF3 A;  1MJC A;  3IL8 A;  2K32 A;  1H9S A;  3G6J B;  2ZJR A;  5D3I B;  2B8G A;  4PMW A;  1TS3 A;  4O2D A;  1HZB A;  2K75 A;  2WAQ E;  1STA A;  3ER0 A;  5EPK A;  3J80 c;  5L37 A;  1VQJ A;  3BU2 A;  4RKL A;  2D0O A;  4LF4 L;  4GN5 A;  1YJN A;  1NMG A;  3PO3 B;  1ZEQ X;  1X3F A;  5FO7 B;  4BY1 G;  2YV5 A;  3M4Q A;  2E5L Q;  4B9X A;  4C3I G;  4LNQ A;  2KEE A;  4APV A;  1ZYR C;  1NAP A;  2RDF A;  4NB3 A;  5IP9 H;  4CKC A;  5CV8 A;  4G7O C;  1B1Z A;  2IW3 A;  3T16 A;  4IN3 A;  1M8A A;  3KF6 B;  3MFY A;  2ZM6 L;  2Q2H A;  1V1P B;  1XTC D;  1E7Z A;  1Q1E A;  4C3H G;  4MIU A;  4HIM A;  3E9I A;  4FYD A;  4DV6 L;  1Q7Y C;  1U4P A;  1HCZ A;  1D8L A;  2JQO A;  1YJW A;  1STE A;  4N8F A;  2AWN A;  3PUZ A;  3QOL A;  1K8A C;  3QWN A;  2O5I C;  1NR2 A;  3K5M A;  4QUC A;  4DV4 Q;  3VR3 A;  5IE8 A;  3E0J A;  4R8N A;  4K14 A;  1HUM A;  5JPM C;  2K33 A;  4P71 A;  3PSI A;  2CHB D;  4IAL A;  2KHS A;  4NXM Q;  2WIN B;  4IPH A;  3S17 H;  3MZ5 A;  1A63 A;  2PPB C;  4R4O A;  1Q3L A;  2EE1 A;  2EYO A;  2VZA A;  1VQD A;  2K1B A;  4B3T Q;  1BXT A;  4DV5 Q;  4U68 A;  5BN3 A;  3TP5 A;  5COY A;  1PTO B;  1XPU A;  1N34 Q;  2JA7 H;  4IFD H;  2A73 B;  5KEE A;  2WP8 J;  4XT1 B;  1QVC A;  3Q23 A;  2F0E A;  4DR3 Q;  2IX3 A;  4IFD J;  1ENF A;  3LWU A;  4RA8 A;  2B63 B;  2L55 A;  1OO9 B;  5G3L F;  4TVA B; 
#chains in the Genus database with same CATH homology
 3S1Q H;  3KOJ A;  1H95 A;  3F2B A;  3A0J A;  4R4Q A;  2MO0 A;  4DR1 L;  3H3V H;  4HIO A;  3TRE A;  2UUA Q;  2UUB Q;  2NVX H;  4B3M Q;  1CKN B;  1FVI A;  2N8N A;  1CKO A;  1X6O A;  3S24 A;  4OWT B;  1N33 Q;  1HR0 Q;  3S1M H;  1IBM Q;  3AFP A;  2QA4 A;  1XMO Q;  4A3L H;  4IPC A;  5ELN A;  3T1H Q;  4JBM A;  4UP8 A;  4J15 A;  4DV4 L;  1SLJ A;  2ATW A;  3I4M G;  3PIO A;  5IP7 G;  1J5E L;  4DR4 Q;  4AYB G;  4LFB L;  2DUD A;  1XJV A;  4HJ7 A;  2ZJQ A;  4JV5 L;  4L5R C;  1Y1V H;  4HIK A;  4A3F H;  2PQA A;  3F2C A;  2IHF A;  4IFD I;  4OO1 I;  3BZC A;  4BXX H;  3A74 A;  2OQ0 A;  3WWV A;  4GNX B;  3PUV A;  4NXM L;  1JB7 A;  1JJC B;  1EQR A;  1A8V A;  3CCJ A;  2Q2U A;  4RG1 A;  5GAD C;  1VQC A;  3S2H H;  1SFO H;  4YCV A;  2R7D A;  1HZA A;  1SRO A;  3STB C;  4X66 Q;  1T9H A;  3EIV A;  3ULL A;  4JG2 A;  2K52 A;  4B3T L;  3H3V I;  3SGI A;  5IYC H;  3RN2 A;  4DV5 L;  3CF5 A;  1TXY A;  4A3M G;  1VQF A;  3CCS A;  4GOP C;  1OXV A;  1FGU A;  2BA0 A;  5FLM G;  2R92 G;  5GRO A;  3F8T A;  5M5X H;  4DUZ Q;  3L7Z C;  1N34 L;  3HOY H;  4YWM A;  5H1S E;  2CFM A;  4L5S A;  3TQY A;  2ASB A;  1KAW A;  3CME A;  1Z47 A;  4DR3 L;  1S40 A;  1XNQ Q;  4LFA Q;  5K36 G;  3J81 c;  1VS0 A;  2K14 A;  2N78 A;  4JCV E;  2VUM G;  1I3Q H;  2F4V Q;  3GTG H;  5C44 H;  3CMA A;  4HJ5 A;  3NEL A;  3RN5 A;  4UP7 A;  1N8R C;  4LF5 Q;  4KHP Q;  3CC4 A;  4JI0 L;  4BBS H;  1E24 A;  1XPO A;  1Q12 A;  4A3B G;  1IYJ B;  4DAM A;  3ULP A;  4GOP A;  4UP9 A;  3ZJY C;  2UUA L;  3G6E A;  1PHJ A;  2UUB L;  4B3M L;  4JI2 Q;  1XMQ Q;  3CXC A;  4IOA A;  1N33 L;  5C0X G;  1AH9 A;  3GTK H;  1HR0 L;  1IBM L;  4LFC Q;  4GN3 B;  1TWA H;  1NY4 A;  4ME3 A;  1XMO L;  2R7Z G;  3CPF A;  4IFD G;  3I4M H;  4A3C G;  3T1H L;  5IP7 H;  3TS0 A;  4OO1 G;  2R6G A;  3G48 A;  1JE5 A;  4DR4 L;  2IY5 B;  1VQ7 A;  2JA8 G;  2KEN A;  1C9O A;  3PV0 A;  3GTJ H;  2C35 B;  3CCR A;  5LMN W;  2PNH A;  2VQF Q;  3HOV H;  1SRU A;  3PUW A;  1Q81 C;  1HZ9 A;  1CKM A;  1X54 A;  1IL2 A;  1HH2 P;  3M85 A;  4C3J H;  3OYY A;  1VQO A;  1EOV A;  3GTL H;  3AQQ A;  3I2Z A;  3MXN B;  5BR8 Q;  3RNU A;  2YU9 H;  2EXD A;  2OCE A;  2ES2 A;  4A3D G;  2PI2 A;  1L1O B;  1K73 C;  4X66 L;  5C4X G;  5M5W H;  1C7Y A;  3HOW G;  2VNU D;  3L2P A;  2K5V A;  4IJH A;  4A3M H;  1QUQ A;  1W2B A;  5FLM H;  3UDF A;  3OTO Q;  4DV3 Q;  2GVB A;  1YIJ A;  3J7A 5;  3KYH C;  4DV2 L;  2E2J H;  4B3S Q;  4LF8 Q;  4DUZ L;  2HT1 A;  3ERS X;  3GD7 A;  1V9P A;  1WOC A;  3CCM A;  3KJO A;  2JEB I;  2WB1 E;  1PV4 A;  1XNQ L;  3GTM H;  4BXX G;  4LFA L;  4RMF A;  2DGY A;  1MKH A;  3S15 H;  1EWI A;  2F4V L;  5GAH C;  3CQZ H;  3BJU A;  4LF5 L;  4KHP L;  1QVF A;  4A75 A;  4A3B H;  4QL5 A;  3UE0 A;  3J81 j;  1WCM G;  2YYZ A;  4HJA A;  3GO5 A;  2VQE Q;  4JI3 Q;  2NVQ H;  4A3G G;  3J80 i;  2BA1 A;  3M4O H;  3UDX A;  3PIP A;  1YEZ A;  4JI8 Q;  4QQB X;  2AMC B;  3ULJ A;  1U5K A;  1E22 A;  5IYC G;  4JI1 Q;  1XMQ L;  4A3J G;  4JI2 L;  1VQG A;  4YWK A;  3CCU A;  4QY7 A;  2R7Z H;  2D0P A;  5C4J H;  2WAQ G;  5C0X J;  1PH9 A;  1WI5 A;  1ASZ A;  4LFC L;  4A3C H;  4R4T A;  1KRT A;  3U50 C;  1HNX Q;  3HOY G;  2IT1 A;  4R4I A;  4DR6 Q;  2JA8 H;  4A4I A;  3UE1 A;  1X3E A;  1GVP A;  2V1C C;  1KD1 C;  2I5L X;  4ALP A;  3PO3 G;  4DKA C;  4GN4 B;  1E3P A;  4B3R Q;  2VQF L;  2LSS A;  4DV2 Q;  1VQM A;  4BBS G;  1TWG H;  1GO3 E;  3CC7 A;  4POG A;  3S16 H;  4H02 A;  3TEH B;  2L15 A;  2KHI A;  4JI6 Q;  3OW2 A;  1PH5 A;  1VQH A;  2KCT A;  4DR5 Q;  3GTO H;  4P73 A;  1U0L A;  1Q1B A;  1NE3 A;  4A3D H;  5BR8 L;  2K50 A;  1YHQ A;  3CCL A;  5C4X H;  2VY3 A;  3DM3 A;  3FKI H;  2HIV A;  4AIM A;  1PFS A;  2MO1 A;  1FJG Q;  3HOW H;  3HKS A;  3DLL A;  1PH3 A;  4LF6 Q;  2RCN A;  2AHO B;  2A8V A;  3K8A A;  2UXC Q;  1I6H H;  1AE2 A;  5C0X I;  3OTO L;  4DV3 L;  1OXT A;  1YJ9 A;  1K83 H;  1RIP A;  3KF8 B;  4C2M H;  1GD7 A;  4B3S L;  4LF8 L;  1PYS B;  3Q8D A;  2E2I H;  3TRZ A;  1Q46 A;  3HOV G;  1YVC A;  1PH4 A;  4GKJ Q;  4K0K Q;  1GKH A;  5JJI A;  2HHH Q;  1YZ6 A;  2FXQ A;  1J6Q A;  1WCM H;  4UPA A;  3CCE A;  2I0Q A;  1VQA A;  2UUC Q;  3HOX H;  3JAM i;  4A3G H;  2VQE L;  3EN2 A;  1X56 A;  4JI3 L;  4JBW A;  1DGS A;  2JA9 A;  2CKZ B;  4LUV A;  2N49 A;  1L0W A;  2Z6K C;  4X64 Q;  5M3F H;  2GVA A;  1M1K C;  4JI8 L;  4A3J H;  1UEB A;  4DV1 Q;  4P74 A;  4A3I G;  4AH6 A;  4DR2 Q;  1N36 Q;  4JI1 L;  5AJ3 Q;  3KF6 A;  4XTC S;  1B70 B;  5JJL A;  4X65 Q;  3K7U C;  2I5H A;  3J7Z C;  3U4V A;  3G71 A;  3KDF B;  1HNX L;  4P75 A;  4DR6 L;  1KQS A;  2WB1 G;  4DR7 Q;  1VQP A;  1Y1W H;  2HIX A;  1IBL Q;  5C3E G;  2PMZ E;  2IHE A;  4UY8 C;  3PO3 H;  1HZC A;  2B29 A;  1B8A A;  3S1N H;  2Y0S E;  2LXJ A;  4BY7 G;  2QGQ A;  3PUX A;  4B3R L;  2CWP A;  2I5M X;  4KHZ A;  2EQS A;  3HKZ E;  3CW2 C;  3FHW A;  2Z6K A;  4KLK A;  1P8L A;  3K80 C;  3CCV A;  1EFW A;  5GAG C;  2CWA A;  4JI6 L;  3CP0 A;  1PYB A;  1VQ6 A;  2JJQ A;  4DR5 L;  4GKK Q;  4A93 G;  5FJ8 G;  3E9H A;  3KJP A;  1RL2 A;  1I50 H;  2UU9 Q;  1NTG A;  1SN8 A;  3H0G G;  4BA2 I;  1V43 A;  5IYB G;  3S1R H;  2ZJP A;  2EIF A;  1OXU A;  3AYH B;  1FJG L;  4WJ4 A;  1IBK Q;  2IX1 A;  3RZD H;  4LF6 L;  2PQA B;  4A3E G;  2UXC L;  2B63 G;  1TWC H;  2KCM A;  2NN6 I;  1NMF A;  4YY3 Q;  5JJK A;  1LYL A;  1G6P A;  1KIX A;  1WYD A;  2HQL A;  1VQK A;  3TS2 A;  4JBJ A;  1LTL A;  1Q86 C;  1CSQ A;  3A5U A;  2UXB Q;  2XGT A;  5C44 G;  1QZG A;  1EIF A;  4GKJ L;  1HNW Q;  1X9N A;  4K0K L;  4IJL A;  5GQO A;  2HHH L;  4GLV B;  4Y7N H;  2ID0 A;  3PUY A;  4X6A H;  2UUC L;  1VQI A;  1XNR Q;  3JC6 6;  5JEA J;  3FKI G;  5FLX c;  4L5T A;  4LF9 Q;  1KL9 A;  4FDB A;  4X64 L;  4AYB E;  4A3I H;  1PH6 A;  1EYG A;  3PO2 H;  2Z0S A;  4DV1 L;  4IO9 A;  4EX5 A;  1N36 L;  4DR2 L;  1E1O A;  5AJ3 L;  4BBR G;  2MQH A;  1SE8 A;  4X65 L;  3CPW A;  1I94 Q;  3G4S A;  3M3Y H;  3AFQ A;  1VQ8 A;  2KBN A;  3PF5 A;  3PF4 A;  4DUY Q;  4PZ7 A;  1PH7 A;  1S3O A;  4DR7 L;  5C3E H;  1KXL A;  4IPG A;  1IBL L;  4OX9 Q;  4LUO A;  1YIT A;  2D62 A;  4BY7 H;  5LMN Q;  1Q8K A;  4GNX C;  1VCI A;  1XPR A;  4GOP B;  5IYD H;  4DNI A;  1CKN A;  2OTJ A;  1NBW A;  3PGZ A;  2K5N A;  1A62 A;  4AQY Q;  3HOX G;  4OWW B;  4JOI C;  1HNZ Q;  1YI2 A;  3HOU H;  3J81 i;  5FJ8 H;  4A93 H;  1IXR A;  4GKK L;  4JYA Q;  4DK3 C;  1O7I A;  3H0G H;  5M3F G;  5IYB H;  5IWA Q;  1UE6 A;  1G51 A;  5E7N A;  2UU9 L;  4R1J A;  2NN6 G;  2NVY H;  3H15 A;  5HGQ A;  2ZTE A;  4WJ3 M;  2MNA A;  3IRB A;  1GM5 A;  4A3E H;  1IBK L;  1Z9F A;  4YCU A;  2JA6 G;  3UDG A;  3M9B A;  1YHB A;  2JE6 I;  2B63 H;  1Y1W G;  1E1T A;  4GNX A;  3A5Z B;  3D31 A;  4YY3 L;  4BY1 H;  4NXN Q;  4LF7 Q;  1AE3 A;  5IY0 A;  1HR0 W;  3VDY A;  3K81 C;  1B7Y B;  1LM0 A;  4JOI A;  4JBK A;  1CSP A;  1VQE A;  2MFI A;  1UWV A;  1PA6 A;  2A1A A;  4P72 A;  2UXB L;  5DLQ E;  4X62 Q;  1L2F A;  1BBU A;  2Q2I A;  5ELO A;  1X65 A;  4GLA C;  1EUJ A;  2PI2 E;  1HNW L;  1JT8 A;  4YHH Q;  1BVS A;  1BBW A;  3S2D H;  2RHS B;  1QUQ B;  2VW9 A;  4JI4 Q;  4DV0 Q;  1XNR L;  4POF A;  3I56 A;  4LF9 L;  3L0O A;  4YWL A;  1PH8 A;  1VQ5 A;  4LUZ A;  1YBY A;  2R93 H;  4BBR H;  4LF4 Q;  3I4O A;  2UXD Q;  4QGU A;  1EIY B;  1YHA A;  3AEV A;  4L5Q A;  3T1Y Q;  2E8G A;  1I94 L;  3RLF A;  1K9M C;  3I7F A;  2NZO A;  2WFW A;  2JK8 A;  4JI5 Q;  3B6Y A;  4DUY L;  3UDI A;  4A3K H;  1ASY A;  4OWX B;  1K0R A;  4OX9 L;  1LUZ A;  1KRS A;  3GTP H;  1G29 1;  4GLX A;  4NPS A;  5LMN L;  4MNO A;  3LGJ A;  4KI0 A;  2BH2 A;  5JEA G;  4PG3 A;  2QEX A;  2CCZ A;  4AQY L;  3W5O A;  4DAY B;  5IP9 G;  1HNZ L;  3NEM A;  1K8G A;  4JC0 A;  2ZM6 Q;  1VQL A;  4JYA L;  2ALY B;  1PH2 A;  3S14 H;  2JA5 H;  1L1O C;  5IWA L;  3PO2 G;  1FL0 A;  1D7Q A;  2OWO A;  3PCO B;  4PZ6 A;  3BZK A;  5EAY A;  4DV6 Q;  2K4K A;  2NZH A;  2JA6 H;  4OON A;  3K0X A;  3F1Z A;  1MJC A;  4GS3 A;  1OTC A;  3FP9 A;  4NXN L;  4R4C A;  4LF7 L;  3HFZ B;  1SMX A;  2ZJR A;  1N32 Q;  1C0A A;  1W3S A;  1I5F A;  1JJ2 A;  2GN5 A;  5IYD G;  4PMW A;  4DK6 C;  4X62 L;  4O2D A;  3RZO H;  2K5H A;  3F2D A;  1L1O A;  1TWH H;  3HOU G;  3RLN A;  1OXX K;  1HZB A;  4YHH L;  1Y14 B;  1V1Q A;  2K75 A;  2WAQ E;  3ER0 A;  4JI7 Q;  4JI4 L;  3KFU A;  1WJJ A;  4DV0 L;  3J80 c;  2YTX A;  3M4P A;  5M3M G;  1VQJ A;  1HJP A;  3M7N A;  4LWC A;  1R9T H;  3BU2 A;  2D0O A;  2VS1 A;  4GN5 A;  1YJN A;  1NMG A;  2Q2T A;  4LF4 L;  2UXD L;  2H5X A;  2AWO A;  4DV7 Q;  1X3F A;  2F3I A;  4YCW A;  3T1Y L;  4BY1 G;  3U4Z A;  5LMU Q;  2YV5 A;  3MEF A;  3M4Q A;  4JI5 L;  1CUK A;  2E5L Q;  1X3G A;  4DPG A;  2OTL A;  1XTD A;  4HJ8 A;  4LNQ A;  4APV A;  4XIG S;  1NJI C;  3I4N G;  2F52 A;  5IT9 c;  4NB3 A;  5IP9 H;  4IOC A;  2JA7 G;  3HOZ G;  3KF6 B;  3NBH B;  1WFQ A;  2ZM6 L;  1A0I A;  3E0E A;  2Q2H A;  4A76 A;  1S72 A;  2R93 G;  2N3S A;  1E7Z A;  1Q1E A;  2RF4 A;  3CCQ A;  4HIM A;  3E9I A;  3CC2 A;  1X55 A;  4IPD A;  4DV6 L;  1Q7Y C;  1JJG A;  2OQK A;  1QZH A;  4DR1 Q;  1TWF H;  1VQ4 A;  1D8L A;  1K3R A;  2ZTD A;  2JQO A;  3EBE A;  4A3K G;  4QIW E;  4QJF A;  4O0A A;  1YJW A;  2XTI A;  4MTN A;  1BKB A;  2YTV A;  3GDE A;  2AWN A;  1UE1 A;  2B3G A;  3PUZ A;  1K8A C;  1N32 L;  2ZTC A;  1MIU A;  4DV4 Q;  3D0F A;  3W1B A;  5IE8 A;  4A3L G;  1QVG A;  1J5E Q;  3KLW A;  4Y52 H;  2R92 H;  4LFB Q;  2R7F A;  2E2H H;  4JV5 Q;  1YNX A;  2IX0 A;  4LW1 A;  4P71 A;  4TQU S;  1OXS C;  1UE5 A;  1Y1V G;  1PH1 A;  4A3F G;  3PSI A;  2JA5 G;  1MJE A;  4JI7 L;  3JAM c;  5M3M H;  2VL6 A;  1M90 C;  3K7A H;  2VUM H;  4NXM Q;  1EQQ A;  3GTQ H;  2CQO A;  4IPH A;  3S17 H;  4BA1 I;  1VQN A;  1A63 A;  2RHQ B;  1VQ9 A;  4R4O A;  5GAE C;  3STB D;  5HY6 A;  3ICE A;  3W1G A;  4DV7 L;  1KC8 C;  2Y0S G;  2VZA A;  1VQD A;  3U58 A;  2LXK A;  5LMU L;  5M5Y H;  3HKZ G;  4HJ9 A;  3NEN A;  4EQ5 A;  2JEA I;  2E5L L;  4B3T Q;  4C3I H;  4DV5 Q;  3I4N H;  1KHI A;  2YTY A;  2AKW B;  1JMC A;  1PVO A;  1XPU A;  4OXP A;  1IZ6 A;  1P16 A;  1UE7 A;  4PZ8 A;  5J3B A;  1N34 Q;  2JA7 H;  2WP8 J;  3HOZ H;  2BH8 A;  1QVC A;  4HID A;  4DR3 Q;  4IFD J;  3I55 A;  2A19 A;  2NVT H;  2KHJ A;  1SR3 A;  1Q82 C;  1N9W A;  3CAM A;  3KDF A;  4C3H H;  3CD6 A;  4MZ9 A;  4TVA B;  3RR5 A;  1VQB A;  4JI0 Q;  3RLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...