2K4KA

Solution structure of gsp13 from bacillus subtilis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General stress protein 13
publication title Solution structure of GSP13 from Bacillus subtilis exhibits an S1 domain related to cold shock proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Rna binding protein
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k4kA01
2ZTDA 4IPDA 4JI5Q 1WI5A 2UUCQ 1OXUA 4L5QA 1PH9A 4R4QA 4DR5L 4BA2I 1RL2A 2D0OA 3A74A 3OTOQ 2AWNA 4A3EH 3KOJA 5ELNA 1JT8A 1X3FA 1XMQQ 3GTPH 2Q2IA 2ZJQA 1I50H 3L7ZC 1Q12A 5IWAL 1EOVA 4LUOA 4A3BH 4YCUA 4LF7Q 1PH3A 2JQOA 3PF5A 4A3BG 3HOUH 2JA6G 3E0EA 2NN6G 3PUXA 5LMNW 1KXLA 1PH1A 3JAMc 4JI6L 4KHPL 4P71A 4QY7A 3CC7A 1VQFA 4JI5L 4DNIA 4PG3A 4YY3Q 1Z9FA 2UUCL 1N33Q 2R7ZH 3TS2A 1VQ5A 1KL9A 1IXRA 2HIXA 2R7ZG 2BA0A 2LSSA 2D62A 4JOIC 3OTOL 3J81c 2F4VQ 3PF4A 3CCEA 1XTDA 3KYHC 3WWVA 1XMQL 3BJUA 4YHHQ 4JI1L 3ICEA 4P72A 1YEZA 4IFDG 3U4ZA 1WCMH 3UDXA 1YJ9A 4AYBG 2VUMG 4LF7L 4JI3Q 3S16H 1I3QH 4JV5Q 2K50A 3AFPA 4LFAQ 1CSQA 1YBYA 1NMGA 3KDFB 2ATWA 1TWAH 5FJ8H 1PFSA 4YY3L 1Y1WH 3F1ZA 1KC8C 1N33L 3J7A5 4EX5A 4AYBE 1VQBA 2F4VL 2R7FA 1UE1A 2VZAA 5AJ3Q 5DLQE 1TXYA 1VQHA 1CUKA 2KBNA 3S1RH 1HR0Q 2UUBQ 4YHHL 1SN8A 5FLMH 1L1OA 1P8LA 4DR1Q 4LFBQ 5FLMG 5M3MH 4TQUS 4JI3L 5M3MG 2JEBI 2YYZA 2ALYB 3BZCA 4JI0Q 3J80c 4JV5L 2UXDQ 4YWKA 2VW9A 4A3DH 3S15H 3I4OA 5LMUQ 4A93H 1QUQA 5IT9c 4A3DG 2CWPA 3AQQA 4O2DA 3RR5A 5J3BA 4X66L 4APVA 1K8AC 4BBSG 1NBWA 1DGSA 4C2MH 4A4IA 4JC0A 1MKHA 2KHJA 4BA1I 3S2DH 4QQBX 2GVAA 4DV1Q 4P73A 1VQAA 5AJ3L 3D0FA 5GAGC 1PH6A 1AH9A 2NN6I 1HR0L 1YITA 2UUBL 4DR1L 3KJPA 1VQJA 3PO2G 4LFBL 4WJ4A 3ZJYC 2GVBA 1YI2A 1CSPA 1NTGA 5C44H 4JI0L 1HZAA 4B3MQ 4DUZQ 3EN2A 5C44G 1VQ8A 2UXDL 4DV6Q 1JB7A 1PVOA 2HIVA 4YWLA 4DAMA 5LMUL 3A5UA 1OXXK 2OTLA 4NXMQ 1HNXQ 1VQKA 1B8AA 1YNXA 4IPGA 4JI2Q 1KQSA 4LF9Q 4IFDI 1YJNA 3KF6B 3JC66 3M4PA 1G6PA 3K80C 2I5HA 1U5KA 4LF8Q 3STBD 4R4CA 4DV1L 1QVFA 1XNQQ 2K5NA 1XPOA 1HR0W 1I6HH 3PUVA 4L5SA 3PO3H 2K14A 1EYGA 4DR7Q 1E7ZA 3PO3G 4JYAQ 1HZCA 1PYSB 3IRBA 4ALPA 1HNWQ 4LUZA 1TWGH 5JEAJ 1N34Q 2I0QA 1X56A 4HJ8A 4B3ML 4DUZL 3SGIA 5JJIA 3H15A 4YCWA 1EIYB 3STBC 3K0XA 5IE8A 3CCUA 4O0AA 4NXML 2OWOA 3LGJA 3G6EA 4HIKA 3M4QA 1HNXL 4JI2L 4LF9L 4DR6L 1CKNB 3NBHB 4X65Q 4BXXH 1ASZA 4P74A 3F2CA 4BXXG 1VQMA 3BU2A 4LF8L 3I4MH 1XNQL 2MQHA 1LYLA 1EWIA 3RLNA 4HJ9A 3I4MG 1VQEA 1FGUA 1VQDA 1A8VA 4OXPA 2WFWA 2OCEA 3NEMA 4DK3C 4A3KH 2NVXH 3CC4A 4OWWB 4DR7L 3S2HH 4JYAL 2BA1A 4A3KG 2JA7G 5ELOA 2VQFQ 1HNWL 4H02A 4GLAC 1AE2A 1P16A 2Y0SG 3K81C 4JCVE 3I55A 1N34L 4TVAB 1MJCA 3PUYA 1X9NA 1LM0A 2K75A 2MFIA 3W5OA 1FVIA 1D8LA 1W2BA 4FDBA 2RHQB 3E9IA 1EQQA 3PUWA 2K5VA 3AYHB 4OX9Q 5HY6A 5H1SE 2MNAA 4HJ5A 2A8VA 2MO0A 4X65L 4QIWE 1KRTA 4X64Q 4HIDA 2Y0SE 4Y52H 5C0XG 4QGUA 2A19A 4A3IH 3KDFA 1V9PA 4MNOA 2JA6H 4A3IG 5IYDG 1WJJA 1U0LA 3L2PA 3D31A 1X3GA 1IYJB 2VQFL 3U58A 1EQRA 4LFCQ 2OQ0A 1HH2P 1IL2A 4L5TA 3HKSA 2QA4A 1PH7A 2ZTCA 1IBLQ 2N78A 3ULPA 4GN4B 1V43A 3T1YQ 1HJPA 1T9HA 2EIFA 2KCMA 3K7AH 5LMNL 3H0GH 4OX9L 3KLWA 1N36Q 1E1OA 3H0GG 3S14H 1XJVA 1OXTA 1I94Q 3UDFA 4B3SQ 4X64L 1Y14B 2VUMH 1HNZQ 1VQIA 4UP8A 4XIGS 2NVYH 4DV5Q 3HOZH 5HGQA 2I5MX 3HOZG 1K9MC 2HQLA 3CP0A 3S24A 4LFCL 2IHEA 1YZ6A 2IX0A 2RHSB 3PSIA 1PHJA 4PZ7A 2JJQA 1O7IA 1IBLL 3MEFA 2CFMA 2PI2E 1JE5A 5C4XH 4DV3Q 3T1YL 1XPUA 4IOAA 2VNUD 5C4XG 1G291 4IO9A 3J7ZC 1N36L 3FKIG 3CCSA 1UWVA 3CPWA 1I94L 1WFQA 1EIFA 3W1GA 2IY5B 4B3SL 2PQAB 1HNZL 2E8GA 5BR8Q 2VQEQ 2CCZA 3T1HQ 3J81j 3PGZA 3EBEA 4L5RC 1VQ6A 1S72A 4IJHA 4GN3B 1NMFA 4DV5L 3GTKH 2N3SA 4LFAL 4B3RQ 3DM3A 4GOPB 3KF6A 4GOPC 4JI8Q 4BBSH 1A0IA 3RNUA 3G71A 5EAYA 3GO5A 3EIVA 3NENA 4DUYQ 5C0XI 4DV3L 2CKZB 1TWFH 4QL5A 1PA6A 1R9TH 2XGTA 1XPRA 5K36G 1SMXA 1HZBA 4A3JH 2OQKA 3I7FA 3HFZB 4DR3Q 2UU9Q 4A3JG 4JBJA 2N8NA 4UY8C 3PO2H 2MO1A 2B63H 4A75A 4ME3A 4YWMA 1NE3A 2B63G 5BR8L 1XNRQ 3OW2A 1Q86C 3RZOH 1NY4A 3T1HL 1N32Q 2RCNA 1A63A 1CKNA 1M90C 4YCVA 1CKOA 2ZTEA 4B3RL 1S3OA 2B29A 3U50C 3ULJA 3ER0A 1FL0A 1PH2A 4GN5A 2DGYA 5C3EG 1IBKQ 5FLXc 4JI4Q 1A62A 4DUYL 2AMCB 1OXVA 2JK8A 1KD1C 4NXNQ 2WAQG 3UDGA 1YJWA 1Q8KA 1S40A 4DR3L 2UU9L 1ASYA 3CXCA 1NJIC 3H3VI 4B3TQ 4A3MG 3RN5A 1SLJA 3NELA 2E5LQ 3CCLA 1KIXA 1Y1VH 2YV5A 3MXNB 4LW1A 1XNRL 3AEVA 1Q7YC 1N32L 2EXDA 1Y1VG 4MZ9A 4C3IH 3GTLH 2JE6I 1YHQA 2WAQE 2Z6KA 4DV6L 2QGQA 2ZJRA 1SRUA 3CCVA 4UPAA 1E24A 1K73C 4JI7Q 2K52A 1OXSC 3CPFA 4R1JA 1GD7A 1SR3A 1TWCH 2DUDA 2PMZE 4DV2Q 3W1BA 4JI4L 4R4OA 3HOVH 4DR4Q 5GADC 4IFDJ 1Q1EA 3HOVG 2R7DA 1RIPA 2D0PA 4NXNL 4A3LH 2UUAQ 4A3LG 4BY7H 1BBUA 4C3JH 4KHZA 2JA7H 5IYCH 4BY7G 1EFWA 4B3TL 5IYCG 2NVTH 4R4IA 4R4TA 4XTCS 2E5LL 4AH6A 2GN5A 3HOYG 3KFUA 3K7UC 3HOXH 3PIOA 1UE5A 3HOXG 2VL6A 3Q8DA 3ERSX 1JMCA 4JI7L 2NVQH 3S1NH 4C3HH 4IJLA 4DV2L 4GLXA 3U4VA 4DR4L 1QVGA 2Z6KC 4MTNA 1GKHA 1Q81C 2ES2A 2UUAL 2JA8H 2N49A 3F8TA 5IYDH 2JA8G 2F52A 2IX1A 3KJOA 4KHPQ 3CC2A 1C7YA 1YHAA 3S17H 2R6GA 3HKZG 1KHIA 3CCRA 4QJFA 1PH4A 2JA5G 1WYDA 2OTJA 2L15A 2YU9H 1BBWA 3ULLA 2F3IA 4X62Q 4GKJQ 3J80i 3HOWH 1L0WA 3I4NH 2V1CC 3HOWG 1J5EQ 4OO1G 1HZ9A 2PQAA 3I4NG 1C0AA 4A3EG 3RZDH 4GNXB 1MJEA 1Q46A 1W3SA 4JI1Q 3TEHB 4GNXC 4IPCA 1VQ9A 3HKZE 2E2HH 2YTXA 1GVPA 1PYBA 3E9HA 4GOPA 1G51A 3CAMA 2HHHQ 1PH8A 4POGA 3M85A 2IHFA 1Q82C 5JJLA 1Z47A 1VQ4A 4LF4Q 4LF6Q 3I2ZA 2PI2A 3HOUG 3TS0A 2NZOA 1YIJA 3M3YH 4K0KQ 3H3VH 4BY1H 2KCTA 3I56A 3BZKA 4GKKQ 4BY1G 5JEAG 4X62L 4A3FH 4GKJL 3CMAA 3M4OH 2UXCQ 4A3FG 2A1AA 5IP9H 1SFOH 4KLKA 1D7QA 1WOCA 1BVSA 5IP9G 1BKBA 1J5EL 3FKIH 1I5FA 1JJ2A 1UE7A 1B7YB 3FP9A 3RLFA 3S1MH 3CF5A 2ZM6Q 1K3RA 1B70B 1VQOA 2R93H 1FJGQ 1VQNA 5GQOA 1N8RC 5C4JH 2HHHL 1X6OA 2HT1A 3TRZA 1WCMG 2R93G 4LUVA 2B3GA 3CCMA 1QZGA 1L2FA 1E3PA 3OYYA 4LF4L 4LF6L 1AE3A 3PIPA 1JJGA 2LXKA 3CCJA 4HJAA 1K8GA 3PUZA 2EQSA 3PCOB 1KRSA 5GROA 3M9BA 4J15A 2ZJPA 1CKMA 3FHWA 1KAWA 3TQYA 4X66Q 4A3GH 4K0KL 4UP7A 1VQ7A 2YTYA 4GKKL 3KF8B 3A5ZB 1C9OA 4A3GG 2UXCL 1K83H 3RN2A 5IYBH 3CW2C 5FJ8G 1Q1BA 1Y1WG 2E2IH 3GDEA 4PZ6A 1IZ6A 5E7NA 2I5LX 1VS0A 5IYBG 4HIOA 3TREA 2Q2HA 4A3CH 2JEAI 2CWAA 4A3CG 4LNQA 5M3FH 3F2DA 3K8AA 3UE1A 4WJ3M 4HJ7A 2KHIA 2ZM6L 5M3FG 1FJGL 4OONA 3B6YA 1QZHA 2H5XA 4RG1A 1LTLA 1X54A 2RF4A 2VQEL 1E1TA 2VS1A 2Q2TA 4EQ5A 1E22A 1YHBA 3UE0A 1QVCA 2YTVA 4AIMA 4OO1I 2AWOA 4DR2Q 1VQGA 3L0OA 4JI8L 5C3EH 1M1KC 4A93G 2ASBA 2VY3A 4UP9A 4DPGA 1UEBA 5GAEC 5C0XJ 4DKAC 4DK6C 3GTGH 4LWCA 4NB3A 1VQLA 2XTIA 4PZ8A 2UXBQ 3GTMH 4GS3A 4A3MH 1SROA 2Z0SA 4BBRH 3F2BA 3GD7A 5IY0A 4BBRG 1X55A 5IP7H 4AQYQ 3CMEA 2AHOB 3RLOA 1VCIA 5IP7G 1L1OB 1TWHH 1L1OC 4DR2L 2Q2UA 2WB1G 1VQCA 3PV0A 4PMWA 5M5YH 3CCQA 2WP8J 4HIMA 3JAMi 1OTCA 4DR6Q 1EUJA 4JBMA 5M5XH 3G48A 1GM5A 4DAYB 1IBKL 3M7NA 4X6AH 1XMOQ 1GO3E 1X3EA 1J6QA 2C35B 2ID0A 2KENA 1QUQB 3G4SA 1PV4A 2BH2A 2BH8A 3J81i 4IOCA 4GLVB 5JJKA 2AKWB 2K5HA 4OWXB 4LF5Q 2K4KA 4DV4Q 4DV7Q 2UXBL 3GTOH 2WB1E 1YVCA 5M5WH 1N9WA 4JBKA 1PH5A 3AFQA 5LMNQ 4DV0Q 1IBMQ 2R92H 2FXQA 4IPHA 5GAHC 3HOYH 1UE6A 4JG2A 3GTJH 2E2JH 2R92G 4POFA 4AQYL 2QEXA 4JBWA 4A76A 4GNXA 3S1QH 4DR5Q 2JA9A 3CQZH 1MIUA 4Y7NH 1SE8A 2PNHA 1K0RA 3UDIA 3VDYA 2NZHA 1XMOL 4OWTB 3A0JA 5IWAQ 3GTQH 4KI0A 1V1QA 4RMFA 1JJCB 4NPSA 3DLLA 3CD6A 2CQOA 4LF5L 4DV7L 4P75A 4DV4L 1H95A 1X65A 1VQPA 1LUZA 2LXJA 4JOIA 2IT1A 4DV0L 2JA5H 1IBML 4JI6Q
chains in the Genus database with same CATH superfamily
2ZTDA 4CDEC 2NYZD 2OT2A 1PH9A 4BA2I 1RL2A 3A74A 4IUVA 2EY6A 3KOJA 1TS4A 1XMQQ 1EY5A 1EY0A 2R92B 1EOVA 1WTPA 1CT1D 2JQOA 3HOUH 1ET6A 2F0SA 1KXLA 2NVQB 4JI6L 4JI5L 2UUCL 2R7ZH 1N33Q 1HFGA 1VQ5A 1IXRA 2BA0A 3URYA 3J81c 5EPJA 5EJWA 3PF4A 3KYHC 1E0BA 3BJUA 3ICEA 1YEZA 2EXZA 1JQYD 1YJ9A 4AYBG 1BNZA 3S16H 3CKIB 2IWHA 1I3QH 1EY9A 4LFAQ 2GA4B 5A35A 3D6CA 2EPBA 3VR6A 2SNSA 1I50B 1F9PA 5EPLA 1PFSA 3NHHA 1DD2A 3QWNA 4K5XA 1UE1A 2VZAA 5AJ3Q 1W6JA 1VQHA 2FMMA 2UUBQ 3D4DA 4DR1Q 5M3MH 3K5LA 4JI3L 2EY5A 4ZRZA 2YYZA 2ALYB 3T13A 4O1NA 3EA6A 4CKCA 5A2QE 2QW7A 3S15H 5LMUQ 4RKBA 2N88A 5IT9c 4A3DG 4BBSG 4O2DA 1NBWA 2A69C 1LT4D 1MKHA 4BA1I 1B9MA 2GVAA 4ZKBB 4DV1Q 2VB3X 1AH9A 1YITA 3NE5B 4WJ4A 3IKJA 1FNUA 2LS01 2GVBA 4ZQ3A 1MI2A 2EDGA 4FF2A 2UXDL 1CHQD 2M9VA 4DAMA 3S1RB 1OXXK 3EVQA 1HNXQ 1B8AA 4IPGA 4JI2Q 4IFDI 4XQQA 4KJOA 1DOLA 1U5KA 1QVFA 1XNQQ 4ZKCB 2KCCA 3OW7A 1XPOA 2OXPA 4L5SA 4JW0A 5IGDA 1I6HH 4A3DB 4ZYSA 1IW7C 1EYGA 4JYAQ 1IYVA 1K28A 3R2IA 4M1UB 4B3ML 3S2DB 4IUUA 3H15A 1EU3A 1B3AA 4YCWA 2F0WA 3CCUA 4O0AA 2OWOA 3LGJA 4BXXH 3FDTA 1ILQA 3I4MH 3RLNA 4HJ9A 1EWIA 2WB1B 1I4GA 2HUGA 3S2HH 2CW0D 4NMZA 2BCOA 1XYIA 1U4LA 1AE2A 1GOZA 4JCVE 1N34L 4RWSC 4G7ZC 5G3LD 2K75A 1FVIA 2B2YA 1A3TA 4X3SA 1G8ZD 3AYHB 5HY6A 2MNAA 3HEJA 2MO0A 4C56C 4OIKA 1KRTA 5IT9E 1TWGB 3DUZA 4X64Q 1HQMC 5C4ZA 1KLGD 1RD9D 5C0XG 5CV6A 1FYCA 2XWJB 3L2PA 1GHKA 5TSSA 1IBLQ 2N78A 3ULPA 3T1YQ 1VMCA 3A7AB 1CQFA 2NVXB 3ZYYX 3FEWX 3S14H 1XJVA 1PFBA 5I6YA 1HNZQ 1QG7A 3HOZH 4QB4A 3U9SA 3NK9A 2P5ZX 1EY7A 3S24A 1IYUA 5IIFA 2RHSB 4G7OC 5CYUA 4DV3Q 2PI2E 1JE5A 1XPUA 2JA6B 5C4XG 1G291 3QIAA 4O42A 1N36L 4CJ2C 1UWVA 3CPWA 3SEBA 1I94L 4RGTA 4KY7A 5BR8Q 2VQEQ 1ET9A 1SYDA 4LFAL 3KF6A 4GOPC 2K5DA 4BBSH 3G71A 3J7AF 4HN7A 2VUMB 3NENA 4DUYQ 2CKZB 2F0IA 1FNVA 4QL5A 4XT1B 4EGVA 3VA7A 4XQJA 1PA6A 2B2TA 1R9TH 1XPRA 1BCPB 1HZBA 4A3JH 2TSSA 2OQKA 4DR3Q 1F9RA 4UY8C 1XTCD 1PTOB 5LHY1 5C3XA 2B63G 3OW2A 5C4XB 4FXGC 3NBHA 1SXTA 4B3RL 1IKLA 3U50C 4RHRA 1VDZA 1PH2A 3DMUA 3MWYW 5COYA 1A62A 2AMCB 3JAME 3UDGA 5L37A 1D5ZC 3GTKB 2F0EA 1BCPF 4IZ8A 1STBA 4A3MG 4B3TQ 3NELA 1BR9A 2E5LQ 1Y1VH 2ICIA 2YV5A 1Q7YC 1SMYC 4MZ9A 4G7HC 3TP6A 1EQVA 2WAQE 1EEFD 1K73C 3CPFA 3PO2B 2PMZE 2B63B 3HOVH 2NZ1D 4JI4L 2B39A 3T16A 2D0PA 2UUAQ 4A3LG 1BBUA 5JVG3 4KHZA 5IYCH 1EFWA 5KYIA 2NVTH 4PMBA 4R4TA 1IHZA 1WTOA 1DONA 4AH6A 3KFUA 1H9JA 4B9WA 4RAUC 3HOXH 2KOLA 1B44D 3NTIA 3WOFA 3F2UA 4KK7A 3Q8DA 2KA7A 5IGFA 1JMCA 4JI7L 3S1NH 4IJLA 2F0OA 4DV2L 4MTNA 1Q81C 2O5IC 1EZ8A 3GTLB 3F8TA 2K04A 2EYHA 5D3IB 2F52A 4KKSA 1C7YA 1YHAA 1HHVA 1C8CA 1GUTA 2EJFC 1KHIA 4QJFA 1BBWA 2F0VA 1HZ9A 1WTXA 4A3EG 1FGBD 4GNXB 1MJEA 1Q46A 4IPCA 2E2HH 2YTXA 1PYBA 1B50A 1G51A 3CAMA 4F88A 1VQ4A 4LF6Q 2BE5D 2QF7A 2PI2A 3DHQA 1QNUA 1YIJA 1A6XA 1LTGD 4K0KQ 4BY1H 3J81L 5JEAG 4K2LA 3M4OH 2UXCQ 2K1BA 2E2DC 2F0NA 1BVSA 4OL7A 3S1MH 4L6TB 3CF5A 1B70B 3I91A 1D5MC 2XWBB 5GQOA 3MC0B 2YU9B 1N8RC 3TRZA 2B2WC 4X3KA 1L2FA 2Z4IA 3M7GA 3PCOB 1KRSA 4X66Q 2K01A 4UP7A 3DWPA 1Y1WG 1T5XD 1CZWA 4PZ6A 5IYBG 4HIOA 2AQ1B 1VS0A 2I5LX 4DK1A 4A3CH 3M4YA 2CWAA 1B53A 4KN4C 4LNQA 3K5OA 3K8AA 3M3YB 3K57A 3EQLC 1S5BD 1QZHA 5ISRA 3OMCA 2RF4A 2OF1A 1KNEA 1TY2A 1E1TA 1FR3A 5IT9L 2VQEL 1SFOB 3J7AV 1E22A 2YTVA 4OO1I 3FKIB 5I9OA 2NTSA 3SVMA 4KD3A 4A93G 5C0XJ 4XXEA 1FD7D 4LWCA 4IUPA 3TDQA 4QF4A 1LT3D 2UXBQ 1A2TA 4GS3A 4A3MH 4J6HA 1CK1A 4HCEA 1K83B 1PMRA 3IFTA 5IP7H 3CMEA 4AQYQ 1L1OC 5JJKA 4IURA 1GM5A 2L11A 1UAPA 2ID0A 2KENA 3G4SA 2BH8A 3J81i 4E6IA 1XWEA 4GLVB 3BDCA 4LF5Q 5M5WH 5I2XA 1N9WA 5GAHC 1UE6A 4HTHA 4DK0A 4A76A 3S1QH 3CQZH 3GTMB 3SXHA 1Q8IA 3I8ZA 1AW7A 4NW2A 1STEA 1V1QA 3V2TA 2DNCA 2NTTA 1V1OA 2FHTA 3DLLA 4P75A 4DV4L 1K8OA 2C9OA 4IUNA 4KJNA 5LMNL 5M5XB 4JI6Q 1JOOA 4JI5Q 1WI5A 4XT3B 2UUCQ 1J9OA 4L5QA 1WD0A 3X3NA 4A3EH 4DNTB 3GTOB 1LTID 2K32A 3AB9A 3GTJB 1T5EA 4YCUA 1U4RA 3PF5A 5FK9C 2NN6H 1G2SA 2KQ3A 4DN4M 5LMNW 1PH1A 1H9MA 4KHPL 2PPBC 3CC7A 1HUMA 5IGEA 3DEPA 2MUYA 2M2LA 2HIXA 2IJ0A 2R7ZG 2MGSA 1LTBD 1PDQA 2D62A 2O5JC 3KK7A 1KTKA 2PQEA 4IQZA 1EY4A 5CBAE 2JA5B 4HEDA 1X3PA 1BQQT 4LF7L 4JI3Q 1SEBD 3I4NB 1VF7A 3I4LA 2PZWA 1YBYA 4K8IA 2IW3A 2IL8A 5CMDA 1TWAH 3T56B 3C1FA 4YY3L 1Y1WH 3F1ZA 1KC8C 2F0KA 4EX5A 3A7LA 1SNMA 1I4XA 1VQBA 1QCBD 3HOUB 4KHVA 2F0JA 3D4WA 1TXYA 2D2CC 1JB3A 5FLMH 1P8LA 3D8GA 2R7ZB 5M3MG 4JV5L 4DAYA 2UXDQ 3KLSA 2HQEA 4PMCA 2VW9A 2PW5A 4A93H 3LX0A 1AEXA 4X66L 3CRKC 2FINB 2OEOA 4A4IA 4JC0A 2KHJA 3S16B 1STGA 1I3QB 5D65A 1VQAA 3D0FA 1HR0L 1SNCA 1RJTA 5KNDA 2K5QA 3TP7A 3NTHA 2F0LA 4NDXA 1HA6A 1NTGA 5C44H 4B3MQ 5DEHA 1PVOA 3H91A 4YWLA 1EWCA 1AN8A 2EJGC 4OELB 3PIP3 5M3MB 1NSNS 3KF6B 4CDFC 2I5HA 3SK4A 3STBD 1HR0W 3PO3H 2K14A 3S15B 2F3WA 2PO4A 5EKLA 3ONAB 2KCNA 4F7XA 1PYSB 1MD2D 2EYLA 4LUZA 5JEAJ 1N34Q 1KDCA 2F0FA 4DUZL 1TKWB 2BDNA 3MA2B 1HRJA 5IE8A 4IUTA 5J39A 4NXML 3FRPB 3NBHB 4BXXG 2DJFC 4P74A 3F2CA 4LF8L 2MQHA 1LYLA 3I4MG 5KIXA 1VQDA 4XYQA 2WFWA 2A6EC 1DOKA 2OCEA 4A3KH 1SJHD 1B4OA 2BA1A 2JA7G 1YNJC 1HNWL 3I55A 3C46A 1L0XB 3K81C 4MN3A 1LM0A 1PRTD 1W2BA 3TBIB 5JPMC 5EKIA 1I6HB 1BDOA 2KEDA 3PUWA 2H1EA 1LO5D 4CKBA 2L0CA 2CW0C 3HP3A 4TRDA 4HIDA 2E2JB 2EY2A 5FO8B 4FXKC 3KDFA 3GV6A 3D4RA 1B9NA 1QWYA 1IYJB 2VQFL 1U9RA 4ZUJA 3U58A 4H13C 4M8AA 5I4DA 3R2TA 3R8BA 3I4MB 5T1GA 2QA4A 2ZTCA 3K5MA 2F3VA 1T9HA 2EIFA 3K7AH 4OX9L 1N36Q 3S2HB 3MXPA 4KTAA 1OXTA 1I94Q 1M8AA 1Y14B 3VR3A 3BDLA 2JSOA 3HGBA 1VQIA 4UP8A 4CKEA 1GHJA 4C1NI 3LWEA 1SSOA 3HOZG 1EZ6A 2DJGC 2CH4A 4LFCL 1YZ6A 3PSIA 1H9SA 4PZ7A 2F0DA 3J7YW 3VR5A 3SDZA 4K2KA 4B3SL 2B2UC 1WTHA 1STAA 1D1KA 1EY8A 3KLSX 4DXGA 2CCZA 1FNWA 3PGZA 1VQ6A 4ULLA 4DV5L 4GN3B 2KHSA 1E2VA 2N3SA 1PYWD 4B3RQ 2DY7A 4JI8Q 4ZK9B 1A0IA 3S14B 3RNUA 1BXTA 3EIVA 3GO5A 4AYBB 5C0XI 2WIIB 1TWFH 2V4DA 1DM0B 3T53B 3E0JA 3FVQA 3HOZB 1SMXA 1BCPC 2A6HD 4HR7B 3J80L 4A3JG 3MXGA 4ME3A 1PTOC 4ZCKA 1D5XC 1Q86C 3BVGA 1NY4A 3BS1A 1C4QA 1CKNA 1M90C 4YCVA 1CKOA 2ZTEA 1JWUD 1FL0A 3MTSA 4LJZC 3EJIA 3O13A 4JI4Q 2EOTA 4DU9A 3ERQA 1OXVA 2WAQG 2WINB 2KJXA 2A73B 3G7LA 4DF7A 4BBSB 3J81E 3CXCA 1NJIC 2A68D 1SLJA 3CCLA 1XNRL 4X3UA 1KIXA 1N32L 1Y1VG 1YHQA 1R9TB 1UNSA 1Z7TA 4A3JB 1SRUA 4JI7Q 1OXSC 4R1JA 4GZYC 1TWCH 2DUDA 4DV2Q 3W1BA 1O7ZA 4R4OA 3HOVG 3OMGA 4C3JH 1DCZA 2JA7H 5IYCG 1AZPA 2WAQB 5D3DA 3HOYG 3SK5A 1STNA 1UE5A 5DM63 3HOXG 1JWSD 2PMZB 2VL6A 3ERSX 2NVQH 4C3HH 2K05A 1LACA 2Z6KC 1Y1VB 1RKNA 4Q0FA 1JOQA 1CHPD 2IX1A 1I4RA 4RFBA 1TR5A 2EZVA 3CC2A 2CH4W 3HOVB 2A5HA 2OTJA 2L15A 1CFMA 3ULLA 3J80i 1JE4A 3HOWH 2G5DA 5CGKA 2V1CC 2PQAA 2AQ2B 4EQOA 2F0MA 3TEHB 4GNXC 3KUPA 3HKZE 1G91A 2WV6D 3RD4A 3DWQA 3M85A 2IHFA 5JJLA 2RDHA 3HOXB 4ABNA 2RCFA 2KVMA 3TS0A 1Q90A 5HGTA 3S1NB 3CHBD 3H3VH 3P75A 3I56A 3OOCA 4OGQC 4BY1G 4X62L 4A3FH 3CMAA 4XDXA 2NUCA 2B8GA 2A1AA 3C1EA 4KLKA 1WOCA 1J5EL 1UE7A 4R8IA 2R93H 1CZGA 1VQNA 1DOMA 5C4JH 1X6OA 2HT1A 1WCMG 4FP5D 4LUVA 3CCMA 1QZGA 1AE3A 3PIPA 4HJAA 3CCJA 2XRSD 4J15A 2ZJPA 3TQYA 4A3GH 5BN3A 2YTYA 4GKKL 3A5ZB 4U68A 1Q1BA 2HCIA 2E2IH 3L9AX 1HPCA 4A3CG 5M3FH 3UE1A 2A69D 4HJ7A 2KHIA 2O2LD 4IUQA 4BY1B 1FJGL 2B8FA 3B6YA 3M4OB 1LTLA 1X54A 1EYDA 2I07B 4UAIA 2B2VC 1B1ZA 5FO7B 4EQ5A 1YHBA 4AIMA 4K5VA 2WACA 4DFAA 1VQGA 4JI8L 3S1MB 2ASBA 1AP0A 3HRZC 5GAEC 1EEID 5EPKA 4DKAC 3IAYA 2Z9HA 3GTGH 3PQIA 2E74C 4NB3A 1VQLA 2XTIA 2EE1A 5FO9B 3DEOA 3OWFA 4CDDC 1SROA 1MSHA 3ITPA 3A54A 4BBRH 1SYCA 5IY0A 2EYPA 1KDBA 4RGMA 2KEEA 1PTOF 1V1PA 5IP7G 4ZUIA 2MJ8A 4DR2L 3PV0A 1VQCA 4PMWA 5M5YH 3CCQA 4HIMA 5FKAC 1EUJA 3M7NA 4DAYB 1RTNA 2PCFB 1X3EA 2C35B 4BWGB 4LAAA 2BH2A 1ZEQX 4OWXB 4DV4Q 2WB1E 4JBKA 5LMNQ 1SNOA 3HOYH 2QEJC 2QEXA 4JBWA 4KV6A 5ELFA 4KKTA 3VYRA 1SE8A 2PNHA 4A3MB 1JICA 3H6MA 3QO2A 1HTLD 1XMOL 4OWTB 5IGGA 1SYEA 2NB0A 1UUPA 2L5TA 1X65A 2LXJA 2IT1A 2Z1CA 4DV0L 4KHPQ 3GV3A 3VR4A 2ICEC 1CQVA 1EYCA 1H9RA 1KAAA 1EYAA 1OXUA 4R4QA 1U4MA 1K8MA 1PFMA 4HSPA 2XNAC 1JCKB 2AWNA 1EQTA 3MZ5A 5ELNA 1JT8A 5M5WB 3GTPH 2ZJQA 4RHSA 5DNFA 5IWAL 1GJXA 4LUOA 4A3BH 4LF7Q 5CV4A 4RCOA 3CQZB 5E4XA 1L0YB 2NN6G 3PUXA 4P71A 1ICWA 4QY7A 4Z9CB 4DNIA 4PG3A 4YY3Q 1GUGA 3RUZA 5CV9A 5BN5A 3OTOL 1IKMA 4OIJA 1I4PA 3R93A 3WWVA 4IFDH 1ONLA 1LLRD 2VXWA 2D5DA 4P72A 1DZ1A 2RA4A 2K6AA 3U4ZA 2SEBD 1WCMH 3UDXA 1JORA 4JV5Q 2K50A 3TN2A 4A3EB 3WDNA 4TKOB 2XIWA 3KDFB 4WFN3 3WOEA 3J7A5 1PZID 4KKUA 2R3ZA 2F4VL 2R7FA 1WD1A 1HR0Q 2KBNA 4YHHL 1SN8A 1A2UA 3W3AA 5FLMG 1HXYD 4PQXA 2JEBI 3BZCA 3J80c 1DXMA 4YWKA 1ZYRC 2XVSA 4WORA 4APVA 1K8AC 4FYDA 2E76C 4C2MH 1O80A 4IALA 4CJ0B 4LMQD 4FO2A 1PH6A 5GAGC 1EIHA 1H9SB 1LTRD 3S9WA 1TWAB 4LFBL 1Y1WB 4JI0L 1HZAA 4DUZQ 5C44G 1VQ8A 1JB7A 1EU4A 1WTRA 3A5UA 2OTLA 4NXMQ 3OSOA 1VQKA 1KQSA 1SMYD 5C3WA 2PZTA 1G6PA 3QOLA 3P1HA 4LF8Q 1X32A 3PUVA 3BVMA 3NTKA 4A93B 1SYBA 3PO3G 4WJWA 2AQ3B 1HZCA 1HNWQ 2B2TC 5M9OA 4G4KA 2I0QA 2D9UA 5JJIA 3STBC 3K0XA 1RDPD 1YNNC 1JOKA 1U4PA 4LF9L 1K0SA 1CKNB 1ASZA 1VQMA 1LT6D 3BU2A 5C44B 2CVRA 1G6ZA 1VQEA 1FGUA 1TWHB 3CC4A 4OXPA 4OWWB 4DR7L 4ODGA 4A3KG 5ELCA 5ELOA 2VQFQ 1F2MA 4F87A 1DYQA 4RA8A 4V190 2J7ZA 4H44C 3PUYA 1SYGA 2MFIA 2Q8TA 5T1IA 5E1FA 3PO3B 2RHQB 3E9IA 1ESRA 2A8VA 3J80E 4OX9Q 5H1SE 4HJ5A 1OO9B 1UEAB 2QKIC 4X65L 4QIWE 2PZUA 3EFXD 2Y0SE 4Y52H 3C3LA 2HDMA 4A3IH 1XX8A 2G9DA 1V9PA 5K5PA 1O7LA 2FJ2A 2RDFA 1U0LA 4Y7NB 3A8KE 2RSOA 1X3GA 5CV8A 1EQRA 4LFCQ 3BDOA 1W6KA 2A74C 4L5TA 3VA5A 3GTQB 1PH7A 3Q23A 1LTTD 3H0GH 4A3KB 1SAPA 3KLWA 1E1OA 5J22A 3UDFA 4B3SQ 5KNBA 2X6GA 4FXDA 1F2ZA 2NVYH 4DV5Q 1BO0A 4V0BA 4ZAIA 1EL0A 3DWAA 3PMFA 2PNRC 2IX0A 1PHJA 3NWTA 1O7IA 1CM9A 2FMCA 1NAPA 1SJED 4NP5A 4LK1C 2IY5B 1EIFA 2F0TA 2PQAB 4ID6A 3NQTA 3SK6A 2ENBA 4L5RC 1ZKOA 1S72A 1NMFA 3K7AB 4QUCA 4L8JA 4DAPA 3Q0AA 3BYTB 4R9WA 1R4PB 5CORA 5KEEA 4OEMB 5K36H 4CDCC 2KUMA 3D6WA 3I7FA 4JBJA 1EIGA 2N8NA 2MO1A 2CHBD 1XNRQ 3NQIA 3RZOH 1N32Q 2ZT9C 3T1HL 1JWMD 2RCNA 1A63A 2ZXOA 2B29A 3ER0A 5C3EG 1S4ZA 2EYJA 2EYOA 3VYTA 1ENFA 2H4OA 3Q6SA 1STYA 4I65A 1YJWA 4C1NK 1SDFA 1GUOA 2UU9L 1XXGA 3H3VI 5EBDA 1I4HA 1Y8NB 1ENAA 1TWFB 3DXJC 4C3IH 4QCLA 2JE6I 2Z6KA 1D6EC 3BG3A 4HCSA 1TVXA 3CCVA 1E24A 2L9HA 4PNYA 4HMIA 4H7BA 1GD7A 4RGNA 3N52A 5KGUA 4UDUC 4NXNL 5C5MA 3UI2A 1F77A 4BY7H 4C3JG 1QJOA 4XTCS 2MPMA 3A8IE 2GN5A 3AMUA 4U673 3K7UC 3KLRA 1WTQA 1LABA 4BS9A 1V1PB 4GLXA 3U4VA 4DR4L 2K28A 4C3HG 2ES2A 2JA8H 2N49A 3C2PA 1J8IA 1PRTB 2K5WA 3S17H 1TWCB 3HKZG 2MHVA 3CCRA 2EYMA 1PH4A 4L63B 4X62Q 2F3IA 4J8QA 2O4XA 1L0WA 4OO1H 3I4NH 3HOWG 1J5EQ 3NSWA 4CHTB 4C3JB 1C0AA 2JA7B 3RZDH 2F0UA 1W3SA 4JI1Q 3E5SA 1ICFB 3E9HA 4GOPA 3QOJA 3MHBA 3I2ZA 1ILPA 2NZOA 4C3HB 1Y8PB 1PRTF 2KCTA 3FMCA 1EOTA 4GKKQ 5FOBB 4GKJL 3TSSA 4A3FG 5IP9H 1NR4A 4IN3A 1BKBA 1PZJD 4HSVA 2B2VA 3HKZB 3FP9A 3RLFA 4DA2A 3IFDA 1VQOA 5JVH3 1FJGQ 3QJYA 2HHHL 2R93G 1PFNA 3HOWB 1D1IA 1QE6A 2C5CA 2XRQD 1E3PA 3OYYA 4LF4L 2LXKA 1K8GA 2EQSA 5GROA 4FNFA 3M9BA 1KAWA 1GXDC 2F03A 1C9OA 4A3GG 1S5FD 3RN2A 5FJ8G 3BVZA 3FPPA 1A15A 1HA5A 4RH6A 1PZKD 2Q2HA 3NXWA 3MXNA 3F2DA 4WJ3M 2ZM6L 1TY0A 3MAQA 5M3FG 3ND8A 1KABA 4A3FB 2H5XA 1NNXA 2Q2TA 3QR8A 1QVCA 4DR2Q 1SE4A 5C3EH 5C5LA 2R93B 2NBFA 5C4JB 4S3SA 1CA6A 3P7JA 3OPOA 4JPBW 5KRUA 3CRLC 4PZ8A 4ME5A 2BOSA 2PYKA 5J1ZA 4A3GB 3F2BA 4BBRG 1X55A 2E2IB 1G2TA 2AHOB 5FLXL 1E2WA 1AFPA 1SNPA 2WB1G 5M3FB 1OTCA 4DR6Q 1PXUA 1XMOQ 2RKSA 1GO3E 1E2ZA 1RCVD 1PV4A 3OHXC 4IOCA 2AKWB 2K5HA 2K4KA 5IGBA 1M4VA 3AFQA 4DV0Q 2R92H 4IPHA 4DGZA 4JG2A 2E2JH 1Q3LA 4POFA 3NWSA 2A6ED 3GTGB 2RSNA 1TS2A 1YNJD 5CC4A 3BYYB 5E3FA 3UDIA 4BBRB 4H0LC 4RKLA 5IWAQ 1SNQA 5I9PA 4NPSA 4DV7L 1TT2A 2LKVA 5M5YB 2L1BA 1VQPA 5JPNC 2E75C 3OIPA 1IBML 4IPDA 1CI3M 3T4AC 4DR5L 2D0OA 3OTOQ 2B2WA 3N6RA 1X3FA 2L55A 2Q2IA 3LWUA 3DM1A 1I50H 2NVTB 1ML0D 3L7ZC 1Q12A 3HOYB 1R4QB 2M00A 1PH3A 3K6OA 4UHVA 4A3BG 5ELBA 3KF8A 2JA6G 3E0EA 4DNRB 1GUSA 1EY6A 3A8JE 5G3LF 3JAMc 4K14A 2HCCA 1VQFA 5JJZA 1Z9FA 3TS2A 5DAUA 1KL9A 2LSSA 2J0TD 4JOIC 1S5CD 2F4VQ 2EYFA 3CCEA 1XTDA 1XMQL 3FPUB 2BE5C 1HUNA 4YHHQ 4JI1L 1MGSA 4IFDG 3PIO3 3I70A 2VUMG 1Z6HA 1C48A 2AUJD 3AFPA 1CSQA 4N8FA 1S5DD 1NMGA 3GTPB 2ATWA 1KNAA 2E2HB 5FJ8H 1N33L 4A3BB 3VYUA 4AYBE 2QDLA 2SOBA 3I3CA 5DLQE 2LFNA 1CUKA 3S1RH 3VYSA 1H9KA 2RBMA 1L1OA 4LFBQ 4TQUS 1BF4A 3R3OA 3U9OA 2J4XA 1WTVA 4JI0Q 1BCPD 2Q8IB 2JN4A 5JAVA 3AU7A 3KBXA 4A3DH 3I4OA 1PTOD 1TS3A 5ELDA 1QUQA 2CWPA 3AQQA 3RR5A 5J3BA 1DGSA 1WCMB 4RCNA 4QQBX 4B08A 5I6WA 3S2DH 4FVMA 4P73A 5AJ3L 2NN6I 1NR2A 4X3TA 2UUBL 5CBEE 3A56A 4DR1L 5KNCA 1VQJA 5D14A 3KJPA 3PO2G 3ZJYC 1YI2A 1CSPA 3TMEA 2EJMA 3X3MA 1GUWA 3EN2A 4DV6Q 1IW7D 2HIVA 3LNNA 5LMUL 1DJRD 1SE2A 1YNXA 4LF9Q 5NUCA 4EQNA 1YJNA 1LT5D 5F2DA 3JC66 3M4PA 3K80C 4R4CA 4DV1L 1TU2B 4YIJA 2K5NA 4FF1A 1D2BA 3NBIA 4K5WA 4QMGA 2F0GA 2LY7A 4DR7Q 1E7ZA 2JXMB 4OHJA 2JYOA 4ALPA 3IRBA 3I72A 2R61A 4I7AA 1TWGH 4C2MB 1X56A 4HJ8A 1O78A 4Q5VA 3SGIA 3VR2A 1EIYB 2X69A 1MBYA 3G6EA 3K58A 4HIKA 3M4QA 1HNXL 4JI2L 4DR6L 4X65Q 2DY8A 1XNQL 4ILWA 3SK8A 1A8VA 2NVXH 3NEMA 4DK3C 1TS5A 4JYAL 2K03A 4H02A 4GLAC 1P16A 2Y0SG 2PW7A 2ZXRA 4TVAB 1MJCA 1X9NA 5KYLA 3W5OA 5EBCA 1D8LA 5EGTA 4FDBA 4P2CB 5A2QL 1EQQA 2K5VA 4G57A 4QUFA 5C0XH 4QGUA 2A19A 2N55A 2JA6H 4MNOA 3S1QB 4A3IG 5IYDG 3MXUA 4NKLA 1WJJA 3D31A 1MSGA 2K7VA 3G6JB 1TIID 4MIUA 2OQ0A 1HH2P 1IL2A 4I7ZC 2SDFA 3HKSA 3T51B 4GN4B 1V43A 1HJPA 2QILA 5CR3A 2KCMA 1LTSD 4RGOS 4QIWB 3H0GG 2Y0SB 1RODA 1F9SA 4X64L 2VUMH 2F0PA 2B2YC 1WVLA 3OWEB 4N8X1 5LL6S 1KDAA 1BOSA 1VF5C 4XIGS 1F2YA 1LV9A 1QB5D 5HGQA 2I5MX 1K9MC 5C4HA 2HQLA 1PTOH 3CP0A 4JVZA 2IHEA 1ENCA 2JJQA 1IBLL 3MEFA 2CFMA 3ND9A 4J1MA 3V96A 5C4XH 4XQNA 3T1YL 4A3IB 4IOAA 2VNUD 2WKDA 4IO9A 3J7ZC 3FKIG 2WKCA 3CCSA 1GUNA 3TP5A 4CJ1B 1WFQA 3W1GA 1HNZL 2E8GA 3T1HQ 3J81j 3EBEA 1K3BC 4IJHA 2F0HA 3GTKH 3DM3A 3H0GB 4GOPB 2Z4HA 5EAYA 2LMCB 3V05A 4DV3L 2Q8RE 3QG1A 2NVYB 2XGTA 3TZDA 5K36G 1JC7A 3HFZB 2UU9Q 3RMHA 3PO2H 2B63H 4A75A 4YWMA 3SHLA 1KLUD 1NE3A 5BR8L 5JOBA 2RQXA 5HURA 1S3OA 3ULJA 5DM73 1A3UA 4ZLTF 1QOHA 2BDOA 2DGYA 4GN5A 1IBKQ 3KBGA 5FLXc 2XSCA 3K5NA 4DUYL 3A55A 4EQPA 2CQAA 2JK8A 4KN7C 1KD1C 4NXNQ 1F2LA 2ZXPA 2EVBA 1Q8KA 1S40A 4DR3L 1ASYA 2JP1A 3RN5A 2L12A 3P20A 3AEVA 4LW1A 3MXNB 5AFWA 2EXDA 3GTLH 4EVOA 4DV6L 4C3IG 1EWHA 1SBBB 1ESFA 2QGQA 2ZJRA 3L3OC 4UPAA 2K52A 2DN8A 1SR3A 1X3QA 1AZQA 2TMPA 3W2DA 4DR4Q 3CU7A 5GADC 1Q1EA 3H94A 4IFDJ 1LTAD 2R7DA 3RZOB 1RIPA 4A3LH 2VB2X 2AUKA 4HMJA 4BY7G 3TP8A 4B3TL 4R4IA 2Z6BA 2E5LL 1I6VC 2Z8LA 4DXFA 5ELEA 3K59A 3PIOA 3IL8A 3I73A 1QVGA 1SE3A 1GKHA 2UUAL 4C3IB 1CA5A 2FFKB 5LL6X 5IYDH 2JA8G 4CBVA 2IPKD 3KJOA 1PRTC 3MFGA 2R6GA 4KY5A 1PLFA 1WYDA 2JA5G 2YU9H 4GKJQ 1RF2D 4TSSA 1HTPA 3HG9A 2HD3A 2B2UA 4OO1G 4FF4A 3I4NG 4BY7B 2I46A 3GQBA 1Y8OB 1I4QA 1VQ9A 1GVPA 2HDLA 2HHHQ 4POGA 1PH8A 1HFNA 2G9HD 3JAML 5FLXE 1Q82C 1Z47A 4LF4Q 1BBXC 4XYOA 1STHA 3BZDB 3HOUG 4K6DA 2RVLA 3M3YH 5JEAH 4F8MA 3BZKA 1NCVA 2F0QA 1SFOH 3K0YA 2JA8B 1D7QA 1QNKA 3QB3A 5IP9G 3FKIH 1QILA 1I5FA 1JJ2A 2F4IA 1B7YB 3S17B 3H09A 4KY6A 3SE0A 1K3RA 3NP8A 2ZM6Q 3MVVA 2B3GA 3SR1A 4FF3A 4LF6L 1JJGA 4KMUC 3PUZA 5CV7A 2KECA 1CKMA 3FHWA 3RZDB 4K0KL 1II3A 1VQ7A 3KF8B 2UXCL 2QDBA 1K83H 4B9XA 5IYBH 3NPPA 3CW2C 1WTWA 1ZXTA 3GDEA 1IZ6A 5E7NA 3OIQA 1ZYRD 3TREA 3E6ZX 2JEAI 2F1MA 2RDGA 3H3VC 1MHWC 3MFYA 4OONA 4RG1A 2SNMA 4MTKA 2VS1A 3HZXA 3UE0A 3HS0C 2AWOA 1Y69U 1B3QA 2QCPX 4K8JA 1M1KC 3L0OA 5CV5A 5EQ0A 2A6HC 2VY3A 4UP9A 2K33A 4DPGA 2XN9C 1UEBA 4KD4A 4DK6C 4R8NA 5IGCA 5IODA 1TQOA 3GTMH 2Z0SA 5I2YA 3EROA 5BN4A 3GD7A 2IX3A 1CTMA 3RLOA 2DNEA 1VCIA 3Q24A 5C6AA 4N9TA 1L1OB 5IOCA 1TWHH 2Q2UA 3MEHA 2NWGA 2WP8J 3E3XA 3JAMi 1O7YA 4JBMA 5M5XH 3G48A 1IBKL 2MP1A 4X6AH 1IL8A 1RHPA 1NUCA 1J6QA 2A68C 1QUQB 1SNDA 4K6LA 4PV1C 3Q22A 1SYFA 1YNND 4DAVA 2EY1A 5EKKA 3TZUA 4DV7Q 2UXBL 3GTOH 1YVCA 5C3EB 1PH5A 3D3RA 1HQRD 1IBMQ 2FXQA 3GTJH 1S5ED 2R92G 4AQYL 4JK1C 4GNXA 1RTOA 4DR5Q 3I90A 2X6LA 1JR0D 2JA9A 1MIUA 1A3VA 4Y7NH 1HCZA 1B2TA 1K0RA 3VDYA 1BUVT 2NZHA 3NUCA 3GP7A 3A0JA 2L4NA 4CGYB 4WRDA 3GTQH 4KI0A 4RMFA 4N9PA 1F9QA 1JJCB 3CD6A 2CQOA 4LF5L 4HAEA 1H95A 1V8QA 1EFID 1LUZA 4JOIA 4MHEA 2JA5H 5E4WC 1VMPA
chains in the Genus database with same CATH topology
2ZTDA 4IPDA 4JI5Q 1WI5A 2UUCQ 1OXUA 4L5QA 1PH9A 4R4QA 4DR5L 4BA2I 1RL2A 2D0OA 3A74A 3OTOQ 2AWNA 4A3EH 3KOJA 5ELNA 1JT8A 1X3FA 1XMQQ 3GTPH 2Q2IA 2ZJQA 1I50H 3L7ZC 1Q12A 5IWAL 1EOVA 4LUOA 4A3BH 4YCUA 4LF7Q 1PH3A 2JQOA 3PF5A 4A3BG 3HOUH 2JA6G 3E0EA 2NN6G 3PUXA 5LMNW 1KXLA 1PH1A 3JAMc 4JI6L 4KHPL 4P71A 4QY7A 3CC7A 1VQFA 4JI5L 4DNIA 4PG3A 4YY3Q 1Z9FA 2UUCL 1N33Q 2R7ZH 3TS2A 1VQ5A 1KL9A 1IXRA 2HIXA 2R7ZG 2BA0A 2LSSA 2D62A 4JOIC 3OTOL 3J81c 2F4VQ 3PF4A 3CCEA 1XTDA 3KYHC 3WWVA 1XMQL 3BJUA 4YHHQ 4JI1L 3ICEA 4P72A 1YEZA 4IFDG 3U4ZA 1WCMH 3UDXA 1YJ9A 4AYBG 2VUMG 4LF7L 4JI3Q 3S16H 1I3QH 4JV5Q 2K50A 3AFPA 4LFAQ 1CSQA 1YBYA 1NMGA 3KDFB 2ATWA 1TWAH 5FJ8H 1PFSA 4YY3L 1Y1WH 3F1ZA 1KC8C 1N33L 3J7A5 4EX5A 4AYBE 1VQBA 2F4VL 2R7FA 1UE1A 2VZAA 5AJ3Q 5DLQE 1TXYA 1VQHA 1CUKA 2KBNA 3S1RH 1HR0Q 2UUBQ 4YHHL 1SN8A 5FLMH 1L1OA 1P8LA 4DR1Q 4LFBQ 5FLMG 5M3MH 4TQUS 4JI3L 5M3MG 2JEBI 2YYZA 2ALYB 3BZCA 4JI0Q 3J80c 4JV5L 2UXDQ 4YWKA 2VW9A 4A3DH 3S15H 3I4OA 5LMUQ 4A93H 1QUQA 5IT9c 4A3DG 2CWPA 3AQQA 4O2DA 3RR5A 5J3BA 4X66L 4APVA 1K8AC 4BBSG 1NBWA 1DGSA 4C2MH 4A4IA 4JC0A 1MKHA 2KHJA 4BA1I 3S2DH 4QQBX 2GVAA 4DV1Q 4P73A 1VQAA 5AJ3L 3D0FA 5GAGC 1PH6A 1AH9A 2NN6I 1HR0L 1YITA 2UUBL 4DR1L 3KJPA 1VQJA 3PO2G 4LFBL 4WJ4A 3ZJYC 2GVBA 1YI2A 1CSPA 1NTGA 5C44H 4JI0L 1HZAA 4B3MQ 4DUZQ 3EN2A 5C44G 1VQ8A 2UXDL 4DV6Q 1JB7A 1PVOA 2HIVA 4YWLA 4DAMA 5LMUL 3A5UA 1OXXK 2OTLA 4NXMQ 1HNXQ 1VQKA 1B8AA 1YNXA 4IPGA 4JI2Q 1KQSA 4LF9Q 4IFDI 1YJNA 3KF6B 3JC66 3M4PA 1G6PA 3K80C 2I5HA 1U5KA 4LF8Q 3STBD 4R4CA 4DV1L 1QVFA 1XNQQ 2K5NA 1XPOA 1HR0W 1I6HH 3PUVA 4L5SA 3PO3H 2K14A 1EYGA 4DR7Q 1E7ZA 3PO3G 4JYAQ 1HZCA 1PYSB 3IRBA 4ALPA 1HNWQ 4LUZA 1TWGH 5JEAJ 1N34Q 2I0QA 1X56A 4HJ8A 4B3ML 4DUZL 3SGIA 5JJIA 3H15A 4YCWA 1EIYB 3STBC 3K0XA 5IE8A 3CCUA 4O0AA 4NXML 2OWOA 3LGJA 3G6EA 4HIKA 3M4QA 1HNXL 4JI2L 4LF9L 4DR6L 1CKNB 3NBHB 4X65Q 4BXXH 1ASZA 4P74A 3F2CA 4BXXG 1VQMA 3BU2A 4LF8L 3I4MH 1XNQL 2MQHA 1LYLA 1EWIA 3RLNA 4HJ9A 3I4MG 1VQEA 1FGUA 1VQDA 1A8VA 4OXPA 2WFWA 2OCEA 3NEMA 4DK3C 4A3KH 2NVXH 3CC4A 4OWWB 4DR7L 3S2HH 4JYAL 2BA1A 4A3KG 2JA7G 5ELOA 2VQFQ 1HNWL 4H02A 4GLAC 1AE2A 1P16A 2Y0SG 3K81C 4JCVE 3I55A 1N34L 4TVAB 1MJCA 3PUYA 1X9NA 1LM0A 2K75A 2MFIA 3W5OA 1FVIA 1D8LA 1W2BA 4FDBA 2RHQB 3E9IA 1EQQA 3PUWA 2K5VA 3AYHB 4OX9Q 5HY6A 5H1SE 2MNAA 4HJ5A 2A8VA 2MO0A 4X65L 4QIWE 1KRTA 4X64Q 4HIDA 2Y0SE 4Y52H 5C0XG 4QGUA 2A19A 4A3IH 3KDFA 1V9PA 4MNOA 2JA6H 4A3IG 5IYDG 1WJJA 1U0LA 3L2PA 3D31A 1X3GA 1IYJB 2VQFL 3U58A 1EQRA 4LFCQ 2OQ0A 1HH2P 1IL2A 4L5TA 3HKSA 2QA4A 1PH7A 2ZTCA 1IBLQ 2N78A 3ULPA 4GN4B 1V43A 3T1YQ 1HJPA 1T9HA 2EIFA 2KCMA 3K7AH 5LMNL 3H0GH 4OX9L 3KLWA 1N36Q 1E1OA 3H0GG 3S14H 1XJVA 1OXTA 1I94Q 3UDFA 4B3SQ 4X64L 1Y14B 2VUMH 1HNZQ 1VQIA 4UP8A 4XIGS 2NVYH 4DV5Q 3HOZH 5HGQA 2I5MX 3HOZG 1K9MC 2HQLA 3CP0A 3S24A 4LFCL 2IHEA 1YZ6A 2IX0A 2RHSB 3PSIA 1PHJA 4PZ7A 2JJQA 1O7IA 1IBLL 3MEFA 2CFMA 2PI2E 1JE5A 5C4XH 4DV3Q 3T1YL 1XPUA 4IOAA 2VNUD 5C4XG 1G291 4IO9A 3J7ZC 1N36L 3FKIG 3CCSA 1UWVA 3CPWA 1I94L 1WFQA 1EIFA 3W1GA 2IY5B 4B3SL 2PQAB 1HNZL 2E8GA 5BR8Q 2VQEQ 2CCZA 3T1HQ 3J81j 3PGZA 3EBEA 4L5RC 1VQ6A 1S72A 4IJHA 4GN3B 1NMFA 4DV5L 3GTKH 2N3SA 4LFAL 4B3RQ 3DM3A 4GOPB 3KF6A 4GOPC 4JI8Q 4BBSH 1A0IA 3RNUA 3G71A 5EAYA 3GO5A 3EIVA 3NENA 4DUYQ 5C0XI 4DV3L 2CKZB 1TWFH 4QL5A 1PA6A 1R9TH 2XGTA 1XPRA 5K36G 1SMXA 1HZBA 4A3JH 2OQKA 3I7FA 3HFZB 4DR3Q 2UU9Q 4A3JG 4JBJA 2N8NA 4UY8C 3PO2H 2MO1A 2B63H 4A75A 4ME3A 4YWMA 1NE3A 2B63G 5BR8L 1XNRQ 3OW2A 1Q86C 3RZOH 1NY4A 3T1HL 1N32Q 2RCNA 1A63A 1CKNA 1M90C 4YCVA 1CKOA 2ZTEA 4B3RL 1S3OA 2B29A 3U50C 3ULJA 3ER0A 1FL0A 1PH2A 4GN5A 2DGYA 5C3EG 1IBKQ 5FLXc 4JI4Q 1A62A 4DUYL 2AMCB 1OXVA 2JK8A 1KD1C 4NXNQ 2WAQG 3UDGA 1YJWA 1Q8KA 1S40A 4DR3L 2UU9L 1ASYA 3CXCA 1NJIC 3H3VI 4B3TQ 4A3MG 3RN5A 1SLJA 3NELA 2E5LQ 3CCLA 1KIXA 1Y1VH 2YV5A 3MXNB 4LW1A 1XNRL 3AEVA 1Q7YC 1N32L 2EXDA 1Y1VG 4MZ9A 4C3IH 3GTLH 2JE6I 1YHQA 2WAQE 2Z6KA 4DV6L 2QGQA 2ZJRA 1SRUA 3CCVA 4UPAA 1E24A 1K73C 4JI7Q 2K52A 1OXSC 3CPFA 4R1JA 1GD7A 1SR3A 1TWCH 2DUDA 2PMZE 4DV2Q 3W1BA 4JI4L 4R4OA 3HOVH 4DR4Q 5GADC 4IFDJ 1Q1EA 3HOVG 2R7DA 1RIPA 2D0PA 4NXNL 4A3LH 2UUAQ 4A3LG 4BY7H 1BBUA 4C3JH 4KHZA 2JA7H 5IYCH 4BY7G 1EFWA 4B3TL 5IYCG 2NVTH 4R4IA 4R4TA 4XTCS 2E5LL 4AH6A 2GN5A 3HOYG 3KFUA 3K7UC 3HOXH 3PIOA 1UE5A 3HOXG 2VL6A 3Q8DA 3ERSX 1JMCA 4JI7L 2NVQH 3S1NH 4C3HH 4IJLA 4DV2L 4GLXA 3U4VA 4DR4L 1QVGA 2Z6KC 4MTNA 1GKHA 1Q81C 2ES2A 2UUAL 2JA8H 2N49A 3F8TA 5IYDH 2JA8G 2F52A 2IX1A 3KJOA 4KHPQ 3CC2A 1C7YA 1YHAA 3S17H 2R6GA 3HKZG 1KHIA 3CCRA 4QJFA 1PH4A 2JA5G 1WYDA 2OTJA 2L15A 2YU9H 1BBWA 3ULLA 2F3IA 4X62Q 4GKJQ 3J80i 3HOWH 1L0WA 3I4NH 2V1CC 3HOWG 1J5EQ 4OO1G 1HZ9A 2PQAA 3I4NG 1C0AA 4A3EG 3RZDH 4GNXB 1MJEA 1Q46A 1W3SA 4JI1Q 3TEHB 4GNXC 4IPCA 1VQ9A 3HKZE 2E2HH 2YTXA 1GVPA 1PYBA 3E9HA 4GOPA 1G51A 3CAMA 2HHHQ 1PH8A 4POGA 3M85A 2IHFA 1Q82C 5JJLA 1Z47A 1VQ4A 4LF4Q 4LF6Q 3I2ZA 2PI2A 3HOUG 3TS0A 2NZOA 1YIJA 3M3YH 4K0KQ 3H3VH 4BY1H 2KCTA 3I56A 3BZKA 4GKKQ 4BY1G 5JEAG 4X62L 4A3FH 4GKJL 3CMAA 3M4OH 2UXCQ 4A3FG 2A1AA 5IP9H 1SFOH 4KLKA 1D7QA 1WOCA 1BVSA 5IP9G 1BKBA 1J5EL 3FKIH 1I5FA 1JJ2A 1UE7A 1B7YB 3FP9A 3RLFA 3S1MH 3CF5A 2ZM6Q 1K3RA 1B70B 1VQOA 2R93H 1FJGQ 1VQNA 5GQOA 1N8RC 5C4JH 2HHHL 1X6OA 2HT1A 3TRZA 1WCMG 2R93G 4LUVA 2B3GA 3CCMA 1QZGA 1L2FA 1E3PA 3OYYA 4LF4L 4LF6L 1AE3A 3PIPA 1JJGA 2LXKA 3CCJA 4HJAA 1K8GA 3PUZA 2EQSA 3PCOB 1KRSA 5GROA 3M9BA 4J15A 2ZJPA 1CKMA 3FHWA 1KAWA 3TQYA 4X66Q 4A3GH 4K0KL 4UP7A 1VQ7A 2YTYA 4GKKL 3KF8B 3A5ZB 1C9OA 4A3GG 2UXCL 1K83H 3RN2A 5IYBH 3CW2C 5FJ8G 1Q1BA 1Y1WG 2E2IH 3GDEA 4PZ6A 1IZ6A 5E7NA 2I5LX 1VS0A 5IYBG 4HIOA 3TREA 2Q2HA 4A3CH 2JEAI 2CWAA 4A3CG 4LNQA 5M3FH 3F2DA 3K8AA 3UE1A 4WJ3M 4HJ7A 2KHIA 2ZM6L 5M3FG 1FJGL 4OONA 3B6YA 1QZHA 2H5XA 4RG1A 1LTLA 1X54A 2RF4A 2VQEL 1E1TA 2VS1A 2Q2TA 4EQ5A 1E22A 1YHBA 3UE0A 1QVCA 2YTVA 4AIMA 4OO1I 2AWOA 4DR2Q 1VQGA 3L0OA 4JI8L 5C3EH 1M1KC 4A93G 2ASBA 2VY3A 4UP9A 4DPGA 1UEBA 5GAEC 5C0XJ 4DKAC 4DK6C 3GTGH 4LWCA 4NB3A 1VQLA 2XTIA 4PZ8A 2UXBQ 3GTMH 4GS3A 4A3MH 1SROA 2Z0SA 4BBRH 3F2BA 3GD7A 5IY0A 4BBRG 1X55A 5IP7H 4AQYQ 3CMEA 2AHOB 3RLOA 1VCIA 5IP7G 1L1OB 1TWHH 1L1OC 4DR2L 2Q2UA 2WB1G 1VQCA 3PV0A 4PMWA 5M5YH 3CCQA 2WP8J 4HIMA 3JAMi 1OTCA 4DR6Q 1EUJA 4JBMA 5M5XH 3G48A 1GM5A 4DAYB 1IBKL 3M7NA 4X6AH 1XMOQ 1GO3E 1X3EA 1J6QA 2C35B 2ID0A 2KENA 1QUQB 3G4SA 1PV4A 2BH2A 2BH8A 3J81i 4IOCA 4GLVB 5JJKA 2AKWB 2K5HA 4OWXB 4LF5Q 2K4KA 4DV4Q 4DV7Q 2UXBL 3GTOH 2WB1E 1YVCA 5M5WH 1N9WA 4JBKA 1PH5A 3AFQA 5LMNQ 4DV0Q 1IBMQ 2R92H 2FXQA 4IPHA 5GAHC 3HOYH 1UE6A 4JG2A 3GTJH 2E2JH 2R92G 4POFA 4AQYL 2QEXA 4JBWA 4A76A 4GNXA 3S1QH 4DR5Q 2JA9A 3CQZH 1MIUA 4Y7NH 1SE8A 2PNHA 1K0RA 3UDIA 3VDYA 2NZHA 1XMOL 4OWTB 3A0JA 5IWAQ 3GTQH 4KI0A 1V1QA 4RMFA 1JJCB 4NPSA 3DLLA 3CD6A 2CQOA 4LF5L 4DV7L 4P75A 4DV4L 1H95A 1X65A 1VQPA 1LUZA 2LXJA 4JOIA 2IT1A 4DV0L 2JA5H 1IBML 4JI6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  4IPD A;  4JI5 Q;  1WI5 A;  2UUC Q;  1OXU A;  4L5Q A;  1PH9 A;  4R4Q A;  4DR5 L;  4BA2 I;  1RL2 A;  2D0O A;  3A74 A;  3OTO Q;  2AWN A;  4A3E H;  3KOJ A;  5ELN A;  1JT8 A;  1X3F A;  1XMQ Q;  3GTP H;  2Q2I A;  2ZJQ A;  1I50 H;  3L7Z C;  1Q12 A;  5IWA L;  1EOV A;  4LUO A;  4A3B H;  4YCU A;  4LF7 Q;  1PH3 A;  2JQO A;  3PF5 A;  4A3B G;  3HOU H;  2JA6 G;  3E0E A;  2NN6 G;  3PUX A;  5LMN W;  1KXL A;  1PH1 A;  3JAM c;  4JI6 L;  4KHP L;  4P71 A;  4QY7 A;  3CC7 A;  1VQF A;  4JI5 L;  4DNI A;  4PG3 A;  4YY3 Q;  1Z9F A;  2UUC L;  1N33 Q;  2R7Z H;  3TS2 A;  1VQ5 A;  1KL9 A;  1IXR A;  2HIX A;  2R7Z G;  2BA0 A;  2LSS A;  2D62 A;  4JOI C;  3OTO L;  3J81 c;  2F4V Q;  3PF4 A;  3CCE A;  1XTD A;  3KYH C;  3WWV A;  1XMQ L;  3BJU A;  4YHH Q;  4JI1 L;  3ICE A;  4P72 A;  1YEZ A;  4IFD G;  3U4Z A;  1WCM H;  3UDX A;  1YJ9 A;  4AYB G;  2VUM G;  4LF7 L;  4JI3 Q;  3S16 H;  1I3Q H;  4JV5 Q;  2K50 A;  3AFP A;  4LFA Q;  1CSQ A;  1YBY A;  1NMG A;  3KDF B;  2ATW A;  1TWA H;  5FJ8 H;  1PFS A;  4YY3 L;  1Y1W H;  3F1Z A;  1KC8 C;  1N33 L;  3J7A 5;  4EX5 A;  4AYB E;  1VQB A;  2F4V L;  2R7F A;  1UE1 A;  2VZA A;  5AJ3 Q;  5DLQ E;  1TXY A;  1VQH A;  1CUK A;  2KBN A;  3S1R H;  1HR0 Q;  2UUB Q;  4YHH L;  1SN8 A;  5FLM H;  1L1O A;  1P8L A;  4DR1 Q;  4LFB Q;  5FLM G;  5M3M H;  4TQU S;  4JI3 L;  5M3M G;  2JEB I;  2YYZ A;  2ALY B;  3BZC A;  4JI0 Q;  3J80 c;  4JV5 L;  2UXD Q;  4YWK A;  2VW9 A;  4A3D H;  3S15 H;  3I4O A;  5LMU Q;  4A93 H;  1QUQ A;  5IT9 c;  4A3D G;  2CWP A;  3AQQ A;  4O2D A;  3RR5 A;  5J3B A;  4X66 L;  4APV A;  1K8A C;  4BBS G;  1NBW A;  1DGS A;  4C2M H;  4A4I A;  4JC0 A;  1MKH A;  2KHJ A;  4BA1 I;  3S2D H;  4QQB X;  2GVA A;  4DV1 Q;  4P73 A;  1VQA A;  5AJ3 L;  3D0F A;  5GAG C;  1PH6 A;  1AH9 A;  2NN6 I;  1HR0 L;  1YIT A;  2UUB L;  4DR1 L;  3KJP A;  1VQJ A;  3PO2 G;  4LFB L;  4WJ4 A;  3ZJY C;  2GVB A;  1YI2 A;  1CSP A;  1NTG A;  5C44 H;  4JI0 L;  1HZA A;  4B3M Q;  4DUZ Q;  3EN2 A;  5C44 G;  1VQ8 A;  2UXD L;  4DV6 Q;  1JB7 A;  1PVO A;  2HIV A;  4YWL A;  4DAM A;  5LMU L;  3A5U A;  1OXX K;  2OTL A;  4NXM Q;  1HNX Q;  1VQK A;  1B8A A;  1YNX A;  4IPG A;  4JI2 Q;  1KQS A;  4LF9 Q;  4IFD I;  1YJN A;  3KF6 B;  3JC6 6;  3M4P A;  1G6P A;  3K80 C;  2I5H A;  1U5K A;  4LF8 Q;  3STB D;  4R4C A;  4DV1 L;  1QVF A;  1XNQ Q;  2K5N A;  1XPO A;  1HR0 W;  1I6H H;  3PUV A;  4L5S A;  3PO3 H;  2K14 A;  1EYG A;  4DR7 Q;  1E7Z A;  3PO3 G;  4JYA Q;  1HZC A;  1PYS B;  3IRB A;  4ALP A;  1HNW Q;  4LUZ A;  1TWG H;  5JEA J;  1N34 Q;  2I0Q A;  1X56 A;  4HJ8 A;  4B3M L;  4DUZ L;  3SGI A;  5JJI A;  3H15 A;  4YCW A;  1EIY B;  3STB C;  3K0X A;  5IE8 A;  3CCU A;  4O0A A;  4NXM L;  2OWO A;  3LGJ A;  3G6E A;  4HIK A;  3M4Q A;  1HNX L;  4JI2 L;  4LF9 L;  4DR6 L;  1CKN B;  3NBH B;  4X65 Q;  4BXX H;  1ASZ A;  4P74 A;  3F2C A;  4BXX G;  1VQM A;  3BU2 A;  4LF8 L;  3I4M H;  1XNQ L;  2MQH A;  1LYL A;  1EWI A;  3RLN A;  4HJ9 A;  3I4M G;  1VQE A;  1FGU A;  1VQD A;  1A8V A;  4OXP A;  2WFW A;  2OCE A;  3NEM A;  4DK3 C;  4A3K H;  2NVX H;  3CC4 A;  4OWW B;  4DR7 L;  3S2H H;  4JYA L;  2BA1 A;  4A3K G;  2JA7 G;  5ELO A;  2VQF Q;  1HNW L;  4H02 A;  4GLA C;  1AE2 A;  1P16 A;  2Y0S G;  3K81 C;  4JCV E;  3I55 A;  1N34 L;  4TVA B;  1MJC A;  3PUY A;  1X9N A;  1LM0 A;  2K75 A;  2MFI A;  3W5O A;  1FVI A;  1D8L A;  1W2B A;  4FDB A;  2RHQ B;  3E9I A;  1EQQ A;  3PUW A;  2K5V A;  3AYH B;  4OX9 Q;  5HY6 A;  5H1S E;  2MNA A;  4HJ5 A;  2A8V A;  2MO0 A;  4X65 L;  4QIW E;  1KRT A;  4X64 Q;  4HID A;  2Y0S E;  4Y52 H;  5C0X G;  4QGU A;  2A19 A;  4A3I H;  3KDF A;  1V9P A;  4MNO A;  2JA6 H;  4A3I G;  5IYD G;  1WJJ A;  1U0L A;  3L2P A;  3D31 A;  1X3G A;  1IYJ B;  2VQF L;  3U58 A;  1EQR A;  4LFC Q;  2OQ0 A;  1HH2 P;  1IL2 A;  4L5T A;  3HKS A;  2QA4 A;  1PH7 A;  2ZTC A;  1IBL Q;  2N78 A;  3ULP A;  4GN4 B;  1V43 A;  3T1Y Q;  1HJP A;  1T9H A;  2EIF A;  2KCM A;  3K7A H;  5LMN L;  3H0G H;  4OX9 L;  3KLW A;  1N36 Q;  1E1O A;  3H0G G;  3S14 H;  1XJV A;  1OXT A;  1I94 Q;  3UDF A;  4B3S Q;  4X64 L;  1Y14 B;  2VUM H;  1HNZ Q;  1VQI A;  4UP8 A;  4XIG S;  2NVY H;  4DV5 Q;  3HOZ H;  5HGQ A;  2I5M X;  3HOZ G;  1K9M C;  2HQL A;  3CP0 A;  3S24 A;  4LFC L;  2IHE A;  1YZ6 A;  2IX0 A;  2RHS B;  3PSI A;  1PHJ A;  4PZ7 A;  2JJQ A;  1O7I A;  1IBL L;  3MEF A;  2CFM A;  2PI2 E;  1JE5 A;  5C4X H;  4DV3 Q;  3T1Y L;  1XPU A;  4IOA A;  2VNU D;  5C4X G;  1G29 1;  4IO9 A;  3J7Z C;  1N36 L;  3FKI G;  3CCS A;  1UWV A;  3CPW A;  1I94 L;  1WFQ A;  1EIF A;  3W1G A;  2IY5 B;  4B3S L;  2PQA B;  1HNZ L;  2E8G A;  5BR8 Q;  2VQE Q;  2CCZ A;  3T1H Q;  3J81 j;  3PGZ A;  3EBE A;  4L5R C;  1VQ6 A;  1S72 A;  4IJH A;  4GN3 B;  1NMF A;  4DV5 L;  3GTK H;  2N3S A;  4LFA L;  4B3R Q;  3DM3 A;  4GOP B;  3KF6 A;  4GOP C;  4JI8 Q;  4BBS H;  1A0I A;  3RNU A;  3G71 A;  5EAY A;  3GO5 A;  3EIV A;  3NEN A;  4DUY Q;  5C0X I;  4DV3 L;  2CKZ B;  1TWF H;  4QL5 A;  1PA6 A;  1R9T H;  2XGT A;  1XPR A;  5K36 G;  1SMX A;  1HZB A;  4A3J H;  2OQK A;  3I7F A;  3HFZ B;  4DR3 Q;  2UU9 Q;  4A3J G;  4JBJ A;  2N8N A;  4UY8 C;  3PO2 H;  2MO1 A;  2B63 H;  4A75 A;  4ME3 A;  4YWM A;  1NE3 A;  2B63 G;  5BR8 L;  1XNR Q;  3OW2 A;  1Q86 C;  3RZO H;  1NY4 A;  3T1H L;  1N32 Q;  2RCN A;  1A63 A;  1CKN A;  1M90 C;  4YCV A;  1CKO A;  2ZTE A;  4B3R L;  1S3O A;  2B29 A;  3U50 C;  3ULJ A;  3ER0 A;  1FL0 A;  1PH2 A;  4GN5 A;  2DGY A;  5C3E G;  1IBK Q;  5FLX c;  4JI4 Q;  1A62 A;  4DUY L;  2AMC B;  1OXV A;  2JK8 A;  1KD1 C;  4NXN Q;  2WAQ G;  3UDG A;  1YJW A;  1Q8K A;  1S40 A;  4DR3 L;  2UU9 L;  1ASY A;  3CXC A;  1NJI C;  3H3V I;  4B3T Q;  4A3M G;  3RN5 A;  1SLJ A;  3NEL A;  2E5L Q;  3CCL A;  1KIX A;  1Y1V H;  2YV5 A;  3MXN B;  4LW1 A;  1XNR L;  3AEV A;  1Q7Y C;  1N32 L;  2EXD A;  1Y1V G;  4MZ9 A;  4C3I H;  3GTL H;  2JE6 I;  1YHQ A;  2WAQ E;  2Z6K A;  4DV6 L;  2QGQ A;  2ZJR A;  1SRU A;  3CCV A;  4UPA A;  1E24 A;  1K73 C;  4JI7 Q;  2K52 A;  1OXS C;  3CPF A;  4R1J A;  1GD7 A;  1SR3 A;  1TWC H;  2DUD A;  2PMZ E;  4DV2 Q;  3W1B A;  4JI4 L;  4R4O A;  3HOV H;  4DR4 Q;  5GAD C;  4IFD J;  1Q1E A;  3HOV G;  2R7D A;  1RIP A;  2D0P A;  4NXN L;  4A3L H;  2UUA Q;  4A3L G;  4BY7 H;  1BBU A;  4C3J H;  4KHZ A;  2JA7 H;  5IYC H;  4BY7 G;  1EFW A;  4B3T L;  5IYC G;  2NVT H;  4R4I A;  4R4T A;  4XTC S;  2E5L L;  4AH6 A;  2GN5 A;  3HOY G;  3KFU A;  3K7U C;  3HOX H;  3PIO A;  1UE5 A;  3HOX G;  2VL6 A;  3Q8D A;  3ERS X;  1JMC A;  4JI7 L;  2NVQ H;  3S1N H;  4C3H H;  4IJL A;  4DV2 L;  4GLX A;  3U4V A;  4DR4 L;  1QVG A;  2Z6K C;  4MTN A;  1GKH A;  1Q81 C;  2ES2 A;  2UUA L;  2JA8 H;  2N49 A;  3F8T A;  5IYD H;  2JA8 G;  2F52 A;  2IX1 A;  3KJO A;  4KHP Q;  3CC2 A;  1C7Y A;  1YHA A;  3S17 H;  2R6G A;  3HKZ G;  1KHI A;  3CCR A;  4QJF A;  1PH4 A;  2JA5 G;  1WYD A;  2OTJ A;  2L15 A;  2YU9 H;  1BBW A;  3ULL A;  2F3I A;  4X62 Q;  4GKJ Q;  3J80 i;  3HOW H;  1L0W A;  3I4N H;  2V1C C;  3HOW G;  1J5E Q;  4OO1 G;  1HZ9 A;  2PQA A;  3I4N G;  1C0A A;  4A3E G;  3RZD H;  4GNX B;  1MJE A;  1Q46 A;  1W3S A;  4JI1 Q;  3TEH B;  4GNX C;  4IPC A;  1VQ9 A;  3HKZ E;  2E2H H;  2YTX A;  1GVP A;  1PYB A;  3E9H A;  4GOP A;  1G51 A;  3CAM A;  2HHH Q;  1PH8 A;  4POG A;  3M85 A;  2IHF A;  1Q82 C;  5JJL A;  1Z47 A;  1VQ4 A;  4LF4 Q;  4LF6 Q;  3I2Z A;  2PI2 A;  3HOU G;  3TS0 A;  2NZO A;  1YIJ A;  3M3Y H;  4K0K Q;  3H3V H;  4BY1 H;  2KCT A;  3I56 A;  3BZK A;  4GKK Q;  4BY1 G;  5JEA G;  4X62 L;  4A3F H;  4GKJ L;  3CMA A;  3M4O H;  2UXC Q;  4A3F G;  2A1A A;  5IP9 H;  1SFO H;  4KLK A;  1D7Q A;  1WOC A;  1BVS A;  5IP9 G;  1BKB A;  1J5E L;  3FKI H;  1I5F A;  1JJ2 A;  1UE7 A;  1B7Y B;  3FP9 A;  3RLF A;  3S1M H;  3CF5 A;  2ZM6 Q;  1K3R A;  1B70 B;  1VQO A;  2R93 H;  1FJG Q;  1VQN A;  5GQO A;  1N8R C;  5C4J H;  2HHH L;  1X6O A;  2HT1 A;  3TRZ A;  1WCM G;  2R93 G;  4LUV A;  2B3G A;  3CCM A;  1QZG A;  1L2F A;  1E3P A;  3OYY A;  4LF4 L;  4LF6 L;  1AE3 A;  3PIP A;  1JJG A;  2LXK A;  3CCJ A;  4HJA A;  1K8G A;  3PUZ A;  2EQS A;  3PCO B;  1KRS A;  5GRO A;  3M9B A;  4J15 A;  2ZJP A;  1CKM A;  3FHW A;  1KAW A;  3TQY A;  4X66 Q;  4A3G H;  4K0K L;  4UP7 A;  1VQ7 A;  2YTY A;  4GKK L;  3KF8 B;  3A5Z B;  1C9O A;  4A3G G;  2UXC L;  1K83 H;  3RN2 A;  5IYB H;  3CW2 C;  5FJ8 G;  1Q1B A;  1Y1W G;  2E2I H;  3GDE A;  4PZ6 A;  1IZ6 A;  5E7N A;  2I5L X;  1VS0 A;  5IYB G;  4HIO A;  3TRE A;  2Q2H A;  4A3C H;  2JEA I;  2CWA A;  4A3C G;  4LNQ A;  5M3F H;  3F2D A;  3K8A A;  3UE1 A;  4WJ3 M;  4HJ7 A;  2KHI A;  2ZM6 L;  5M3F G;  1FJG L;  4OON A;  3B6Y A;  1QZH A;  2H5X A;  4RG1 A;  1LTL A;  1X54 A;  2RF4 A;  2VQE L;  1E1T A;  2VS1 A;  2Q2T A;  4EQ5 A;  1E22 A;  1YHB A;  3UE0 A;  1QVC A;  2YTV A;  4AIM A;  4OO1 I;  2AWO A;  4DR2 Q;  1VQG A;  3L0O A;  4JI8 L;  5C3E H;  1M1K C;  4A93 G;  2ASB A;  2VY3 A;  4UP9 A;  4DPG A;  1UEB A;  5GAE C;  5C0X J;  4DKA C;  4DK6 C;  3GTG H;  4LWC A;  4NB3 A;  1VQL A;  2XTI A;  4PZ8 A;  2UXB Q;  3GTM H;  4GS3 A;  4A3M H;  1SRO A;  2Z0S A;  4BBR H;  3F2B A;  3GD7 A;  5IY0 A;  4BBR G;  1X55 A;  5IP7 H;  4AQY Q;  3CME A;  2AHO B;  3RLO A;  1VCI A;  5IP7 G;  1L1O B;  1TWH H;  1L1O C;  4DR2 L;  2Q2U A;  2WB1 G;  1VQC A;  3PV0 A;  4PMW A;  5M5Y H;  3CCQ A;  2WP8 J;  4HIM A;  3JAM i;  1OTC A;  4DR6 Q;  1EUJ A;  4JBM A;  5M5X H;  3G48 A;  1GM5 A;  4DAY B;  1IBK L;  3M7N A;  4X6A H;  1XMO Q;  1GO3 E;  1X3E A;  1J6Q A;  2C35 B;  2ID0 A;  2KEN A;  1QUQ B;  3G4S A;  1PV4 A;  2BH2 A;  2BH8 A;  3J81 i;  4IOC A;  4GLV B;  5JJK A;  2AKW B;  2K5H A;  4OWX B;  4LF5 Q;  2K4K A;  4DV4 Q;  4DV7 Q;  2UXB L;  3GTO H;  2WB1 E;  1YVC A;  5M5W H;  1N9W A;  4JBK A;  1PH5 A;  3AFQ A;  5LMN Q;  4DV0 Q;  1IBM Q;  2R92 H;  2FXQ A;  4IPH A;  5GAH C;  3HOY H;  1UE6 A;  4JG2 A;  3GTJ H;  2E2J H;  2R92 G;  4POF A;  4AQY L;  2QEX A;  4JBW A;  4A76 A;  4GNX A;  3S1Q H;  4DR5 Q;  2JA9 A;  3CQZ H;  1MIU A;  4Y7N H;  1SE8 A;  2PNH A;  1K0R A;  3UDI A;  3VDY A;  2NZH A;  1XMO L;  4OWT B;  3A0J A;  5IWA Q;  3GTQ H;  4KI0 A;  1V1Q A;  4RMF A;  1JJC B;  4NPS A;  3DLL A;  3CD6 A;  2CQO A;  4LF5 L;  4DV7 L;  4P75 A;  4DV4 L;  1H95 A;  1X65 A;  1VQP A;  1LUZ A;  2LXJ A;  4JOI A;  2IT1 A;  4DV0 L;  2JA5 H;  1IBM L;  4JI6 Q; 
#chains in the Genus database with same CATH topology
 2ZTD A;  4CDE C;  2NYZ D;  2OT2 A;  1PH9 A;  4BA2 I;  1RL2 A;  3A74 A;  4IUV A;  2EY6 A;  3KOJ A;  1TS4 A;  1XMQ Q;  1EY5 A;  1EY0 A;  2R92 B;  1EOV A;  1WTP A;  1CT1 D;  2JQO A;  3HOU H;  1ET6 A;  2F0S A;  1KXL A;  2NVQ B;  4JI6 L;  4JI5 L;  2UUC L;  2R7Z H;  1N33 Q;  1HFG A;  1VQ5 A;  1IXR A;  2BA0 A;  3URY A;  3J81 c;  5EPJ A;  5EJW A;  3PF4 A;  3KYH C;  1E0B A;  3BJU A;  3ICE A;  1YEZ A;  2EXZ A;  1JQY D;  1YJ9 A;  4AYB G;  1BNZ A;  3S16 H;  3CKI B;  2IWH A;  1I3Q H;  1EY9 A;  4LFA Q;  2GA4 B;  5A35 A;  3D6C A;  2EPB A;  3VR6 A;  2SNS A;  1I50 B;  1F9P A;  5EPL A;  1PFS A;  3NHH A;  1DD2 A;  3QWN A;  4K5X A;  1UE1 A;  2VZA A;  5AJ3 Q;  1W6J A;  1VQH A;  2FMM A;  2UUB Q;  3D4D A;  4DR1 Q;  5M3M H;  3K5L A;  4JI3 L;  2EY5 A;  4ZRZ A;  2YYZ A;  2ALY B;  3T13 A;  4O1N A;  3EA6 A;  4CKC A;  5A2Q E;  2QW7 A;  3S15 H;  5LMU Q;  4RKB A;  2N88 A;  5IT9 c;  4A3D G;  4BBS G;  4O2D A;  1NBW A;  2A69 C;  1LT4 D;  1MKH A;  4BA1 I;  1B9M A;  2GVA A;  4ZKB B;  4DV1 Q;  2VB3 X;  1AH9 A;  1YIT A;  3NE5 B;  4WJ4 A;  3IKJ A;  1FNU A;  2LS0 1;  2GVB A;  4ZQ3 A;  1MI2 A;  2EDG A;  4FF2 A;  2UXD L;  1CHQ D;  2M9V A;  4DAM A;  3S1R B;  1OXX K;  3EVQ A;  1HNX Q;  1B8A A;  4IPG A;  4JI2 Q;  4IFD I;  4XQQ A;  4KJO A;  1DOL A;  1U5K A;  1QVF A;  1XNQ Q;  4ZKC B;  2KCC A;  3OW7 A;  1XPO A;  2OXP A;  4L5S A;  4JW0 A;  5IGD A;  1I6H H;  4A3D B;  4ZYS A;  1IW7 C;  1EYG A;  4JYA Q;  1IYV A;  1K28 A;  3R2I A;  4M1U B;  4B3M L;  3S2D B;  4IUU A;  3H15 A;  1EU3 A;  1B3A A;  4YCW A;  2F0W A;  3CCU A;  4O0A A;  2OWO A;  3LGJ A;  4BXX H;  3FDT A;  1ILQ A;  3I4M H;  3RLN A;  4HJ9 A;  1EWI A;  2WB1 B;  1I4G A;  2HUG A;  3S2H H;  2CW0 D;  4NMZ A;  2BCO A;  1XYI A;  1U4L A;  1AE2 A;  1GOZ A;  4JCV E;  1N34 L;  4RWS C;  4G7Z C;  5G3L D;  2K75 A;  1FVI A;  2B2Y A;  1A3T A;  4X3S A;  1G8Z D;  3AYH B;  5HY6 A;  2MNA A;  3HEJ A;  2MO0 A;  4C56 C;  4OIK A;  1KRT A;  5IT9 E;  1TWG B;  3DUZ A;  4X64 Q;  1HQM C;  5C4Z A;  1KLG D;  1RD9 D;  5C0X G;  5CV6 A;  1FYC A;  2XWJ B;  3L2P A;  1GHK A;  5TSS A;  1IBL Q;  2N78 A;  3ULP A;  3T1Y Q;  1VMC A;  3A7A B;  1CQF A;  2NVX B;  3ZYY X;  3FEW X;  3S14 H;  1XJV A;  1PFB A;  5I6Y A;  1HNZ Q;  1QG7 A;  3HOZ H;  4QB4 A;  3U9S A;  3NK9 A;  2P5Z X;  1EY7 A;  3S24 A;  1IYU A;  5IIF A;  2RHS B;  4G7O C;  5CYU A;  4DV3 Q;  2PI2 E;  1JE5 A;  1XPU A;  2JA6 B;  5C4X G;  1G29 1;  3QIA A;  4O42 A;  1N36 L;  4CJ2 C;  1UWV A;  3CPW A;  3SEB A;  1I94 L;  4RGT A;  4KY7 A;  5BR8 Q;  2VQE Q;  1ET9 A;  1SYD A;  4LFA L;  3KF6 A;  4GOP C;  2K5D A;  4BBS H;  3G71 A;  3J7A F;  4HN7 A;  2VUM B;  3NEN A;  4DUY Q;  2CKZ B;  2F0I A;  1FNV A;  4QL5 A;  4XT1 B;  4EGV A;  3VA7 A;  4XQJ A;  1PA6 A;  2B2T A;  1R9T H;  1XPR A;  1BCP B;  1HZB A;  4A3J H;  2TSS A;  2OQK A;  4DR3 Q;  1F9R A;  4UY8 C;  1XTC D;  1PTO B;  5LHY 1;  5C3X A;  2B63 G;  3OW2 A;  5C4X B;  4FXG C;  3NBH A;  1SXT A;  4B3R L;  1IKL A;  3U50 C;  4RHR A;  1VDZ A;  1PH2 A;  3DMU A;  3MWY W;  5COY A;  1A62 A;  2AMC B;  3JAM E;  3UDG A;  5L37 A;  1D5Z C;  3GTK B;  2F0E A;  1BCP F;  4IZ8 A;  1STB A;  4A3M G;  4B3T Q;  3NEL A;  1BR9 A;  2E5L Q;  1Y1V H;  2ICI A;  2YV5 A;  1Q7Y C;  1SMY C;  4MZ9 A;  4G7H C;  3TP6 A;  1EQV A;  2WAQ E;  1EEF D;  1K73 C;  3CPF A;  3PO2 B;  2PMZ E;  2B63 B;  3HOV H;  2NZ1 D;  4JI4 L;  2B39 A;  3T16 A;  2D0P A;  2UUA Q;  4A3L G;  1BBU A;  5JVG 3;  4KHZ A;  5IYC H;  1EFW A;  5KYI A;  2NVT H;  4PMB A;  4R4T A;  1IHZ A;  1WTO A;  1DON A;  4AH6 A;  3KFU A;  1H9J A;  4B9W A;  4RAU C;  3HOX H;  2KOL A;  1B44 D;  3NTI A;  3WOF A;  3F2U A;  4KK7 A;  3Q8D A;  2KA7 A;  5IGF A;  1JMC A;  4JI7 L;  3S1N H;  4IJL A;  2F0O A;  4DV2 L;  4MTN A;  1Q81 C;  2O5I C;  1EZ8 A;  3GTL B;  3F8T A;  2K04 A;  2EYH A;  5D3I B;  2F52 A;  4KKS A;  1C7Y A;  1YHA A;  1HHV A;  1C8C A;  1GUT A;  2EJF C;  1KHI A;  4QJF A;  1BBW A;  2F0V A;  1HZ9 A;  1WTX A;  4A3E G;  1FGB D;  4GNX B;  1MJE A;  1Q46 A;  4IPC A;  2E2H H;  2YTX A;  1PYB A;  1B50 A;  1G51 A;  3CAM A;  4F88 A;  1VQ4 A;  4LF6 Q;  2BE5 D;  2QF7 A;  2PI2 A;  3DHQ A;  1QNU A;  1YIJ A;  1A6X A;  1LTG D;  4K0K Q;  4BY1 H;  3J81 L;  5JEA G;  4K2L A;  3M4O H;  2UXC Q;  2K1B A;  2E2D C;  2F0N A;  1BVS A;  4OL7 A;  3S1M H;  4L6T B;  3CF5 A;  1B70 B;  3I91 A;  1D5M C;  2XWB B;  5GQO A;  3MC0 B;  2YU9 B;  1N8R C;  3TRZ A;  2B2W C;  4X3K A;  1L2F A;  2Z4I A;  3M7G A;  3PCO B;  1KRS A;  4X66 Q;  2K01 A;  4UP7 A;  3DWP A;  1Y1W G;  1T5X D;  1CZW A;  4PZ6 A;  5IYB G;  4HIO A;  2AQ1 B;  1VS0 A;  2I5L X;  4DK1 A;  4A3C H;  3M4Y A;  2CWA A;  1B53 A;  4KN4 C;  4LNQ A;  3K5O A;  3K8A A;  3M3Y B;  3K57 A;  3EQL C;  1S5B D;  1QZH A;  5ISR A;  3OMC A;  2RF4 A;  2OF1 A;  1KNE A;  1TY2 A;  1E1T A;  1FR3 A;  5IT9 L;  2VQE L;  1SFO B;  3J7A V;  1E22 A;  2YTV A;  4OO1 I;  3FKI B;  5I9O A;  2NTS A;  3SVM A;  4KD3 A;  4A93 G;  5C0X J;  4XXE A;  1FD7 D;  4LWC A;  4IUP A;  3TDQ A;  4QF4 A;  1LT3 D;  2UXB Q;  1A2T A;  4GS3 A;  4A3M H;  4J6H A;  1CK1 A;  4HCE A;  1K83 B;  1PMR A;  3IFT A;  5IP7 H;  3CME A;  4AQY Q;  1L1O C;  5JJK A;  4IUR A;  1GM5 A;  2L11 A;  1UAP A;  2ID0 A;  2KEN A;  3G4S A;  2BH8 A;  3J81 i;  4E6I A;  1XWE A;  4GLV B;  3BDC A;  4LF5 Q;  5M5W H;  5I2X A;  1N9W A;  5GAH C;  1UE6 A;  4HTH A;  4DK0 A;  4A76 A;  3S1Q H;  3CQZ H;  3GTM B;  3SXH A;  1Q8I A;  3I8Z A;  1AW7 A;  4NW2 A;  1STE A;  1V1Q A;  3V2T A;  2DNC A;  2NTT A;  1V1O A;  2FHT A;  3DLL A;  4P75 A;  4DV4 L;  1K8O A;  2C9O A;  4IUN A;  4KJN A;  5LMN L;  5M5X B;  4JI6 Q;  1JOO A;  4JI5 Q;  1WI5 A;  4XT3 B;  2UUC Q;  1J9O A;  4L5Q A;  1WD0 A;  3X3N A;  4A3E H;  4DNT B;  3GTO B;  1LTI D;  2K32 A;  3AB9 A;  3GTJ B;  1T5E A;  4YCU A;  1U4R A;  3PF5 A;  5FK9 C;  2NN6 H;  1G2S A;  2KQ3 A;  4DN4 M;  5LMN W;  1PH1 A;  1H9M A;  4KHP L;  2PPB C;  3CC7 A;  1HUM A;  5IGE A;  3DEP A;  2MUY A;  2M2L A;  2HIX A;  2IJ0 A;  2R7Z G;  2MGS A;  1LTB D;  1PDQ A;  2D62 A;  2O5J C;  3KK7 A;  1KTK A;  2PQE A;  4IQZ A;  1EY4 A;  5CBA E;  2JA5 B;  4HED A;  1X3P A;  1BQQ T;  4LF7 L;  4JI3 Q;  1SEB D;  3I4N B;  1VF7 A;  3I4L A;  2PZW A;  1YBY A;  4K8I A;  2IW3 A;  2IL8 A;  5CMD A;  1TWA H;  3T56 B;  3C1F A;  4YY3 L;  1Y1W H;  3F1Z A;  1KC8 C;  2F0K A;  4EX5 A;  3A7L A;  1SNM A;  1I4X A;  1VQB A;  1QCB D;  3HOU B;  4KHV A;  2F0J A;  3D4W A;  1TXY A;  2D2C C;  1JB3 A;  5FLM H;  1P8L A;  3D8G A;  2R7Z B;  5M3M G;  4JV5 L;  4DAY A;  2UXD Q;  3KLS A;  2HQE A;  4PMC A;  2VW9 A;  2PW5 A;  4A93 H;  3LX0 A;  1AEX A;  4X66 L;  3CRK C;  2FIN B;  2OEO A;  4A4I A;  4JC0 A;  2KHJ A;  3S16 B;  1STG A;  1I3Q B;  5D65 A;  1VQA A;  3D0F A;  1HR0 L;  1SNC A;  1RJT A;  5KND A;  2K5Q A;  3TP7 A;  3NTH A;  2F0L A;  4NDX A;  1HA6 A;  1NTG A;  5C44 H;  4B3M Q;  5DEH A;  1PVO A;  3H91 A;  4YWL A;  1EWC A;  1AN8 A;  2EJG C;  4OEL B;  3PIP 3;  5M3M B;  1NSN S;  3KF6 B;  4CDF C;  2I5H A;  3SK4 A;  3STB D;  1HR0 W;  3PO3 H;  2K14 A;  3S15 B;  2F3W A;  2PO4 A;  5EKL A;  3ONA B;  2KCN A;  4F7X A;  1PYS B;  1MD2 D;  2EYL A;  4LUZ A;  5JEA J;  1N34 Q;  1KDC A;  2F0F A;  4DUZ L;  1TKW B;  2BDN A;  3MA2 B;  1HRJ A;  5IE8 A;  4IUT A;  5J39 A;  4NXM L;  3FRP B;  3NBH B;  4BXX G;  2DJF C;  4P74 A;  3F2C A;  4LF8 L;  2MQH A;  1LYL A;  3I4M G;  5KIX A;  1VQD A;  4XYQ A;  2WFW A;  2A6E C;  1DOK A;  2OCE A;  4A3K H;  1SJH D;  1B4O A;  2BA1 A;  2JA7 G;  1YNJ C;  1HNW L;  3I55 A;  3C46 A;  1L0X B;  3K81 C;  4MN3 A;  1LM0 A;  1PRT D;  1W2B A;  3TBI B;  5JPM C;  5EKI A;  1I6H B;  1BDO A;  2KED A;  3PUW A;  2H1E A;  1LO5 D;  4CKB A;  2L0C A;  2CW0 C;  3HP3 A;  4TRD A;  4HID A;  2E2J B;  2EY2 A;  5FO8 B;  4FXK C;  3KDF A;  3GV6 A;  3D4R A;  1B9N A;  1QWY A;  1IYJ B;  2VQF L;  1U9R A;  4ZUJ A;  3U58 A;  4H13 C;  4M8A A;  5I4D A;  3R2T A;  3R8B A;  3I4M B;  5T1G A;  2QA4 A;  2ZTC A;  3K5M A;  2F3V A;  1T9H A;  2EIF A;  3K7A H;  4OX9 L;  1N36 Q;  3S2H B;  3MXP A;  4KTA A;  1OXT A;  1I94 Q;  1M8A A;  1Y14 B;  3VR3 A;  3BDL A;  2JSO A;  3HGB A;  1VQI A;  4UP8 A;  4CKE A;  1GHJ A;  4C1N I;  3LWE A;  1SSO A;  3HOZ G;  1EZ6 A;  2DJG C;  2CH4 A;  4LFC L;  1YZ6 A;  3PSI A;  1H9S A;  4PZ7 A;  2F0D A;  3J7Y W;  3VR5 A;  3SDZ A;  4K2K A;  4B3S L;  2B2U C;  1WTH A;  1STA A;  1D1K A;  1EY8 A;  3KLS X;  4DXG A;  2CCZ A;  1FNW A;  3PGZ A;  1VQ6 A;  4ULL A;  4DV5 L;  4GN3 B;  2KHS A;  1E2V A;  2N3S A;  1PYW D;  4B3R Q;  2DY7 A;  4JI8 Q;  4ZK9 B;  1A0I A;  3S14 B;  3RNU A;  1BXT A;  3EIV A;  3GO5 A;  4AYB B;  5C0X I;  2WII B;  1TWF H;  2V4D A;  1DM0 B;  3T53 B;  3E0J A;  3FVQ A;  3HOZ B;  1SMX A;  1BCP C;  2A6H D;  4HR7 B;  3J80 L;  4A3J G;  3MXG A;  4ME3 A;  1PTO C;  4ZCK A;  1D5X C;  1Q86 C;  3BVG A;  1NY4 A;  3BS1 A;  1C4Q A;  1CKN A;  1M90 C;  4YCV A;  1CKO A;  2ZTE A;  1JWU D;  1FL0 A;  3MTS A;  4LJZ C;  3EJI A;  3O13 A;  4JI4 Q;  2EOT A;  4DU9 A;  3ERQ A;  1OXV A;  2WAQ G;  2WIN B;  2KJX A;  2A73 B;  3G7L A;  4DF7 A;  4BBS B;  3J81 E;  3CXC A;  1NJI C;  2A68 D;  1SLJ A;  3CCL A;  1XNR L;  4X3U A;  1KIX A;  1N32 L;  1Y1V G;  1YHQ A;  1R9T B;  1UNS A;  1Z7T A;  4A3J B;  1SRU A;  4JI7 Q;  1OXS C;  4R1J A;  4GZY C;  1TWC H;  2DUD A;  4DV2 Q;  3W1B A;  1O7Z A;  4R4O A;  3HOV G;  3OMG A;  4C3J H;  1DCZ A;  2JA7 H;  5IYC G;  1AZP A;  2WAQ B;  5D3D A;  3HOY G;  3SK5 A;  1STN A;  1UE5 A;  5DM6 3;  3HOX G;  1JWS D;  2PMZ B;  2VL6 A;  3ERS X;  2NVQ H;  4C3H H;  2K05 A;  1LAC A;  2Z6K C;  1Y1V B;  1RKN A;  4Q0F A;  1JOQ A;  1CHP D;  2IX1 A;  1I4R A;  4RFB A;  1TR5 A;  2EZV A;  3CC2 A;  2CH4 W;  3HOV B;  2A5H A;  2OTJ A;  2L15 A;  1CFM A;  3ULL A;  3J80 i;  1JE4 A;  3HOW H;  2G5D A;  5CGK A;  2V1C C;  2PQA A;  2AQ2 B;  4EQO A;  2F0M A;  3TEH B;  4GNX C;  3KUP A;  3HKZ E;  1G91 A;  2WV6 D;  3RD4 A;  3DWQ A;  3M85 A;  2IHF A;  5JJL A;  2RDH A;  3HOX B;  4ABN A;  2RCF A;  2KVM A;  3TS0 A;  1Q90 A;  5HGT A;  3S1N B;  3CHB D;  3H3V H;  3P75 A;  3I56 A;  3OOC A;  4OGQ C;  4BY1 G;  4X62 L;  4A3F H;  3CMA A;  4XDX A;  2NUC A;  2B8G A;  2A1A A;  3C1E A;  4KLK A;  1WOC A;  1J5E L;  1UE7 A;  4R8I A;  2R93 H;  1CZG A;  1VQN A;  1DOM A;  5C4J H;  1X6O A;  2HT1 A;  1WCM G;  4FP5 D;  4LUV A;  3CCM A;  1QZG A;  1AE3 A;  3PIP A;  4HJA A;  3CCJ A;  2XRS D;  4J15 A;  2ZJP A;  3TQY A;  4A3G H;  5BN3 A;  2YTY A;  4GKK L;  3A5Z B;  4U68 A;  1Q1B A;  2HCI A;  2E2I H;  3L9A X;  1HPC A;  4A3C G;  5M3F H;  3UE1 A;  2A69 D;  4HJ7 A;  2KHI A;  2O2L D;  4IUQ A;  4BY1 B;  1FJG L;  2B8F A;  3B6Y A;  3M4O B;  1LTL A;  1X54 A;  1EYD A;  2I07 B;  4UAI A;  2B2V C;  1B1Z A;  5FO7 B;  4EQ5 A;  1YHB A;  4AIM A;  4K5V A;  2WAC A;  4DFA A;  1VQG A;  4JI8 L;  3S1M B;  2ASB A;  1AP0 A;  3HRZ C;  5GAE C;  1EEI D;  5EPK A;  4DKA C;  3IAY A;  2Z9H A;  3GTG H;  3PQI A;  2E74 C;  4NB3 A;  1VQL A;  2XTI A;  2EE1 A;  5FO9 B;  3DEO A;  3OWF A;  4CDD C;  1SRO A;  1MSH A;  3ITP A;  3A54 A;  4BBR H;  1SYC A;  5IY0 A;  2EYP A;  1KDB A;  4RGM A;  2KEE A;  1PTO F;  1V1P A;  5IP7 G;  4ZUI A;  2MJ8 A;  4DR2 L;  3PV0 A;  1VQC A;  4PMW A;  5M5Y H;  3CCQ A;  4HIM A;  5FKA C;  1EUJ A;  3M7N A;  4DAY B;  1RTN A;  2PCF B;  1X3E A;  2C35 B;  4BWG B;  4LAA A;  2BH2 A;  1ZEQ X;  4OWX B;  4DV4 Q;  2WB1 E;  4JBK A;  5LMN Q;  1SNO A;  3HOY H;  2QEJ C;  2QEX A;  4JBW A;  4KV6 A;  5ELF A;  4KKT A;  3VYR A;  1SE8 A;  2PNH A;  4A3M B;  1JIC A;  3H6M A;  3QO2 A;  1HTL D;  1XMO L;  4OWT B;  5IGG A;  1SYE A;  2NB0 A;  1UUP A;  2L5T A;  1X65 A;  2LXJ A;  2IT1 A;  2Z1C A;  4DV0 L;  4KHP Q;  3GV3 A;  3VR4 A;  2ICE C;  1CQV A;  1EYC A;  1H9R A;  1KAA A;  1EYA A;  1OXU A;  4R4Q A;  1U4M A;  1K8M A;  1PFM A;  4HSP A;  2XNA C;  1JCK B;  2AWN A;  1EQT A;  3MZ5 A;  5ELN A;  1JT8 A;  5M5W B;  3GTP H;  2ZJQ A;  4RHS A;  5DNF A;  5IWA L;  1GJX A;  4LUO A;  4A3B H;  4LF7 Q;  5CV4 A;  4RCO A;  3CQZ B;  5E4X A;  1L0Y B;  2NN6 G;  3PUX A;  4P71 A;  1ICW A;  4QY7 A;  4Z9C B;  4DNI A;  4PG3 A;  4YY3 Q;  1GUG A;  3RUZ A;  5CV9 A;  5BN5 A;  3OTO L;  1IKM A;  4OIJ A;  1I4P A;  3R93 A;  3WWV A;  4IFD H;  1ONL A;  1LLR D;  2VXW A;  2D5D A;  4P72 A;  1DZ1 A;  2RA4 A;  2K6A A;  3U4Z A;  2SEB D;  1WCM H;  3UDX A;  1JOR A;  4JV5 Q;  2K50 A;  3TN2 A;  4A3E B;  3WDN A;  4TKO B;  2XIW A;  3KDF B;  4WFN 3;  3WOE A;  3J7A 5;  1PZI D;  4KKU A;  2R3Z A;  2F4V L;  2R7F A;  1WD1 A;  1HR0 Q;  2KBN A;  4YHH L;  1SN8 A;  1A2U A;  3W3A A;  5FLM G;  1HXY D;  4PQX A;  2JEB I;  3BZC A;  3J80 c;  1DXM A;  4YWK A;  1ZYR C;  2XVS A;  4WOR A;  4APV A;  1K8A C;  4FYD A;  2E76 C;  4C2M H;  1O80 A;  4IAL A;  4CJ0 B;  4LMQ D;  4FO2 A;  1PH6 A;  5GAG C;  1EIH A;  1H9S B;  1LTR D;  3S9W A;  1TWA B;  4LFB L;  1Y1W B;  4JI0 L;  1HZA A;  4DUZ Q;  5C44 G;  1VQ8 A;  1JB7 A;  1EU4 A;  1WTR A;  3A5U A;  2OTL A;  4NXM Q;  3OSO A;  1VQK A;  1KQS A;  1SMY D;  5C3W A;  2PZT A;  1G6P A;  3QOL A;  3P1H A;  4LF8 Q;  1X32 A;  3PUV A;  3BVM A;  3NTK A;  4A93 B;  1SYB A;  3PO3 G;  4WJW A;  2AQ3 B;  1HZC A;  1HNW Q;  2B2T C;  5M9O A;  4G4K A;  2I0Q A;  2D9U A;  5JJI A;  3STB C;  3K0X A;  1RDP D;  1YNN C;  1JOK A;  1U4P A;  4LF9 L;  1K0S A;  1CKN B;  1ASZ A;  1VQM A;  1LT6 D;  3BU2 A;  5C44 B;  2CVR A;  1G6Z A;  1VQE A;  1FGU A;  1TWH B;  3CC4 A;  4OXP A;  4OWW B;  4DR7 L;  4ODG A;  4A3K G;  5ELC A;  5ELO A;  2VQF Q;  1F2M A;  4F87 A;  1DYQ A;  4RA8 A;  4V19 0;  2J7Z A;  4H44 C;  3PUY A;  1SYG A;  2MFI A;  2Q8T A;  5T1I A;  5E1F A;  3PO3 B;  2RHQ B;  3E9I A;  1ESR A;  2A8V A;  3J80 E;  4OX9 Q;  5H1S E;  4HJ5 A;  1OO9 B;  1UEA B;  2QKI C;  4X65 L;  4QIW E;  2PZU A;  3EFX D;  2Y0S E;  4Y52 H;  3C3L A;  2HDM A;  4A3I H;  1XX8 A;  2G9D A;  1V9P A;  5K5P A;  1O7L A;  2FJ2 A;  2RDF A;  1U0L A;  4Y7N B;  3A8K E;  2RSO A;  1X3G A;  5CV8 A;  1EQR A;  4LFC Q;  3BDO A;  1W6K A;  2A74 C;  4L5T A;  3VA5 A;  3GTQ B;  1PH7 A;  3Q23 A;  1LTT D;  3H0G H;  4A3K B;  1SAP A;  3KLW A;  1E1O A;  5J22 A;  3UDF A;  4B3S Q;  5KNB A;  2X6G A;  4FXD A;  1F2Z A;  2NVY H;  4DV5 Q;  1BO0 A;  4V0B A;  4ZAI A;  1EL0 A;  3DWA A;  3PMF A;  2PNR C;  2IX0 A;  1PHJ A;  3NWT A;  1O7I A;  1CM9 A;  2FMC A;  1NAP A;  1SJE D;  4NP5 A;  4LK1 C;  2IY5 B;  1EIF A;  2F0T A;  2PQA B;  4ID6 A;  3NQT A;  3SK6 A;  2ENB A;  4L5R C;  1ZKO A;  1S72 A;  1NMF A;  3K7A B;  4QUC A;  4L8J A;  4DAP A;  3Q0A A;  3BYT B;  4R9W A;  1R4P B;  5COR A;  5KEE A;  4OEM B;  5K36 H;  4CDC C;  2KUM A;  3D6W A;  3I7F A;  4JBJ A;  1EIG A;  2N8N A;  2MO1 A;  2CHB D;  1XNR Q;  3NQI A;  3RZO H;  1N32 Q;  2ZT9 C;  3T1H L;  1JWM D;  2RCN A;  1A63 A;  2ZXO A;  2B29 A;  3ER0 A;  5C3E G;  1S4Z A;  2EYJ A;  2EYO A;  3VYT A;  1ENF A;  2H4O A;  3Q6S A;  1STY A;  4I65 A;  1YJW A;  4C1N K;  1SDF A;  1GUO A;  2UU9 L;  1XXG A;  3H3V I;  5EBD A;  1I4H A;  1Y8N B;  1ENA A;  1TWF B;  3DXJ C;  4C3I H;  4QCL A;  2JE6 I;  2Z6K A;  1D6E C;  3BG3 A;  4HCS A;  1TVX A;  3CCV A;  1E24 A;  2L9H A;  4PNY A;  4HMI A;  4H7B A;  1GD7 A;  4RGN A;  3N52 A;  5KGU A;  4UDU C;  4NXN L;  5C5M A;  3UI2 A;  1F77 A;  4BY7 H;  4C3J G;  1QJO A;  4XTC S;  2MPM A;  3A8I E;  2GN5 A;  3AMU A;  4U67 3;  3K7U C;  3KLR A;  1WTQ A;  1LAB A;  4BS9 A;  1V1P B;  4GLX A;  3U4V A;  4DR4 L;  2K28 A;  4C3H G;  2ES2 A;  2JA8 H;  2N49 A;  3C2P A;  1J8I A;  1PRT B;  2K5W A;  3S17 H;  1TWC B;  3HKZ G;  2MHV A;  3CCR A;  2EYM A;  1PH4 A;  4L63 B;  4X62 Q;  2F3I A;  4J8Q A;  2O4X A;  1L0W A;  4OO1 H;  3I4N H;  3HOW G;  1J5E Q;  3NSW A;  4CHT B;  4C3J B;  1C0A A;  2JA7 B;  3RZD H;  2F0U A;  1W3S A;  4JI1 Q;  3E5S A;  1ICF B;  3E9H A;  4GOP A;  3QOJ A;  3MHB A;  3I2Z A;  1ILP A;  2NZO A;  4C3H B;  1Y8P B;  1PRT F;  2KCT A;  3FMC A;  1EOT A;  4GKK Q;  5FOB B;  4GKJ L;  3TSS A;  4A3F G;  5IP9 H;  1NR4 A;  4IN3 A;  1BKB A;  1PZJ D;  4HSV A;  2B2V A;  3HKZ B;  3FP9 A;  3RLF A;  4DA2 A;  3IFD A;  1VQO A;  5JVH 3;  1FJG Q;  3QJY A;  2HHH L;  2R93 G;  1PFN A;  3HOW B;  1D1I A;  1QE6 A;  2C5C A;  2XRQ D;  1E3P A;  3OYY A;  4LF4 L;  2LXK A;  1K8G A;  2EQS A;  5GRO A;  4FNF A;  3M9B A;  1KAW A;  1GXD C;  2F03 A;  1C9O A;  4A3G G;  1S5F D;  3RN2 A;  5FJ8 G;  3BVZ A;  3FPP A;  1A15 A;  1HA5 A;  4RH6 A;  1PZK D;  2Q2H A;  3NXW A;  3MXN A;  3F2D A;  4WJ3 M;  2ZM6 L;  1TY0 A;  3MAQ A;  5M3F G;  3ND8 A;  1KAB A;  4A3F B;  2H5X A;  1NNX A;  2Q2T A;  3QR8 A;  1QVC A;  4DR2 Q;  1SE4 A;  5C3E H;  5C5L A;  2R93 B;  2NBF A;  5C4J B;  4S3S A;  1CA6 A;  3P7J A;  3OPO A;  4JPB W;  5KRU A;  3CRL C;  4PZ8 A;  4ME5 A;  2BOS A;  2PYK A;  5J1Z A;  4A3G B;  3F2B A;  4BBR G;  1X55 A;  2E2I B;  1G2T A;  2AHO B;  5FLX L;  1E2W A;  1AFP A;  1SNP A;  2WB1 G;  5M3F B;  1OTC A;  4DR6 Q;  1PXU A;  1XMO Q;  2RKS A;  1GO3 E;  1E2Z A;  1RCV D;  1PV4 A;  3OHX C;  4IOC A;  2AKW B;  2K5H A;  2K4K A;  5IGB A;  1M4V A;  3AFQ A;  4DV0 Q;  2R92 H;  4IPH A;  4DGZ A;  4JG2 A;  2E2J H;  1Q3L A;  4POF A;  3NWS A;  2A6E D;  3GTG B;  2RSN A;  1TS2 A;  1YNJ D;  5CC4 A;  3BYY B;  5E3F A;  3UDI A;  4BBR B;  4H0L C;  4RKL A;  5IWA Q;  1SNQ A;  5I9P A;  4NPS A;  4DV7 L;  1TT2 A;  2LKV A;  5M5Y B;  2L1B A;  1VQP A;  5JPN C;  2E75 C;  3OIP A;  1IBM L;  4IPD A;  1CI3 M;  3T4A C;  4DR5 L;  2D0O A;  3OTO Q;  2B2W A;  3N6R A;  1X3F A;  2L55 A;  2Q2I A;  3LWU A;  3DM1 A;  1I50 H;  2NVT B;  1ML0 D;  3L7Z C;  1Q12 A;  3HOY B;  1R4Q B;  2M00 A;  1PH3 A;  3K6O A;  4UHV A;  4A3B G;  5ELB A;  3KF8 A;  2JA6 G;  3E0E A;  4DNR B;  1GUS A;  1EY6 A;  3A8J E;  5G3L F;  3JAM c;  4K14 A;  2HCC A;  1VQF A;  5JJZ A;  1Z9F A;  3TS2 A;  5DAU A;  1KL9 A;  2LSS A;  2J0T D;  4JOI C;  1S5C D;  2F4V Q;  2EYF A;  3CCE A;  1XTD A;  1XMQ L;  3FPU B;  2BE5 C;  1HUN A;  4YHH Q;  4JI1 L;  1MGS A;  4IFD G;  3PIO 3;  3I70 A;  2VUM G;  1Z6H A;  1C48 A;  2AUJ D;  3AFP A;  1CSQ A;  4N8F A;  1S5D D;  1NMG A;  3GTP B;  2ATW A;  1KNA A;  2E2H B;  5FJ8 H;  1N33 L;  4A3B B;  3VYU A;  4AYB E;  2QDL A;  2SOB A;  3I3C A;  5DLQ E;  2LFN A;  1CUK A;  3S1R H;  3VYS A;  1H9K A;  2RBM A;  1L1O A;  4LFB Q;  4TQU S;  1BF4 A;  3R3O A;  3U9O A;  2J4X A;  1WTV A;  4JI0 Q;  1BCP D;  2Q8I B;  2JN4 A;  5JAV A;  3AU7 A;  3KBX A;  4A3D H;  3I4O A;  1PTO D;  1TS3 A;  5ELD A;  1QUQ A;  2CWP A;  3AQQ A;  3RR5 A;  5J3B A;  1DGS A;  1WCM B;  4RCN A;  4QQB X;  4B08 A;  5I6W A;  3S2D H;  4FVM A;  4P73 A;  5AJ3 L;  2NN6 I;  1NR2 A;  4X3T A;  2UUB L;  5CBE E;  3A56 A;  4DR1 L;  5KNC A;  1VQJ A;  5D14 A;  3KJP A;  3PO2 G;  3ZJY C;  1YI2 A;  1CSP A;  3TME A;  2EJM A;  3X3M A;  1GUW A;  3EN2 A;  4DV6 Q;  1IW7 D;  2HIV A;  3LNN A;  5LMU L;  1DJR D;  1SE2 A;  1YNX A;  4LF9 Q;  5NUC A;  4EQN A;  1YJN A;  1LT5 D;  5F2D A;  3JC6 6;  3M4P A;  3K80 C;  4R4C A;  4DV1 L;  1TU2 B;  4YIJ A;  2K5N A;  4FF1 A;  1D2B A;  3NBI A;  4K5W A;  4QMG A;  2F0G A;  2LY7 A;  4DR7 Q;  1E7Z A;  2JXM B;  4OHJ A;  2JYO A;  4ALP A;  3IRB A;  3I72 A;  2R61 A;  4I7A A;  1TWG H;  4C2M B;  1X56 A;  4HJ8 A;  1O78 A;  4Q5V A;  3SGI A;  3VR2 A;  1EIY B;  2X69 A;  1MBY A;  3G6E A;  3K58 A;  4HIK A;  3M4Q A;  1HNX L;  4JI2 L;  4DR6 L;  4X65 Q;  2DY8 A;  1XNQ L;  4ILW A;  3SK8 A;  1A8V A;  2NVX H;  3NEM A;  4DK3 C;  1TS5 A;  4JYA L;  2K03 A;  4H02 A;  4GLA C;  1P16 A;  2Y0S G;  2PW7 A;  2ZXR A;  4TVA B;  1MJC A;  1X9N A;  5KYL A;  3W5O A;  5EBC A;  1D8L A;  5EGT A;  4FDB A;  4P2C B;  5A2Q L;  1EQQ A;  2K5V A;  4G57 A;  4QUF A;  5C0X H;  4QGU A;  2A19 A;  2N55 A;  2JA6 H;  4MNO A;  3S1Q B;  4A3I G;  5IYD G;  3MXU A;  4NKL A;  1WJJ A;  3D31 A;  1MSG A;  2K7V A;  3G6J B;  1TII D;  4MIU A;  2OQ0 A;  1HH2 P;  1IL2 A;  4I7Z C;  2SDF A;  3HKS A;  3T51 B;  4GN4 B;  1V43 A;  1HJP A;  2QIL A;  5CR3 A;  2KCM A;  1LTS D;  4RGO S;  4QIW B;  3H0G G;  2Y0S B;  1ROD A;  1F9S A;  4X64 L;  2VUM H;  2F0P A;  2B2Y C;  1WVL A;  3OWE B;  4N8X 1;  5LL6 S;  1KDA A;  1BOS A;  1VF5 C;  4XIG S;  1F2Y A;  1LV9 A;  1QB5 D;  5HGQ A;  2I5M X;  1K9M C;  5C4H A;  2HQL A;  1PTO H;  3CP0 A;  4JVZ A;  2IHE A;  1ENC A;  2JJQ A;  1IBL L;  3MEF A;  2CFM A;  3ND9 A;  4J1M A;  3V96 A;  5C4X H;  4XQN A;  3T1Y L;  4A3I B;  4IOA A;  2VNU D;  2WKD A;  4IO9 A;  3J7Z C;  3FKI G;  2WKC A;  3CCS A;  1GUN A;  3TP5 A;  4CJ1 B;  1WFQ A;  3W1G A;  1HNZ L;  2E8G A;  3T1H Q;  3J81 j;  3EBE A;  1K3B C;  4IJH A;  2F0H A;  3GTK H;  3DM3 A;  3H0G B;  4GOP B;  2Z4H A;  5EAY A;  2LMC B;  3V05 A;  4DV3 L;  2Q8R E;  3QG1 A;  2NVY B;  2XGT A;  3TZD A;  5K36 G;  1JC7 A;  3HFZ B;  2UU9 Q;  3RMH A;  3PO2 H;  2B63 H;  4A75 A;  4YWM A;  3SHL A;  1KLU D;  1NE3 A;  5BR8 L;  5JOB A;  2RQX A;  5HUR A;  1S3O A;  3ULJ A;  5DM7 3;  1A3U A;  4ZLT F;  1QOH A;  2BDO A;  2DGY A;  4GN5 A;  1IBK Q;  3KBG A;  5FLX c;  2XSC A;  3K5N A;  4DUY L;  3A55 A;  4EQP A;  2CQA A;  2JK8 A;  4KN7 C;  1KD1 C;  4NXN Q;  1F2L A;  2ZXP A;  2EVB A;  1Q8K A;  1S40 A;  4DR3 L;  1ASY A;  2JP1 A;  3RN5 A;  2L12 A;  3P20 A;  3AEV A;  4LW1 A;  3MXN B;  5AFW A;  2EXD A;  3GTL H;  4EVO A;  4DV6 L;  4C3I G;  1EWH A;  1SBB B;  1ESF A;  2QGQ A;  2ZJR A;  3L3O C;  4UPA A;  2K52 A;  2DN8 A;  1SR3 A;  1X3Q A;  1AZQ A;  2TMP A;  3W2D A;  4DR4 Q;  3CU7 A;  5GAD C;  1Q1E A;  3H94 A;  4IFD J;  1LTA D;  2R7D A;  3RZO B;  1RIP A;  4A3L H;  2VB2 X;  2AUK A;  4HMJ A;  4BY7 G;  3TP8 A;  4B3T L;  4R4I A;  2Z6B A;  2E5L L;  1I6V C;  2Z8L A;  4DXF A;  5ELE A;  3K59 A;  3PIO A;  3IL8 A;  3I73 A;  1QVG A;  1SE3 A;  1GKH A;  2UUA L;  4C3I B;  1CA5 A;  2FFK B;  5LL6 X;  5IYD H;  2JA8 G;  4CBV A;  2IPK D;  3KJO A;  1PRT C;  3MFG A;  2R6G A;  4KY5 A;  1PLF A;  1WYD A;  2JA5 G;  2YU9 H;  4GKJ Q;  1RF2 D;  4TSS A;  1HTP A;  3HG9 A;  2HD3 A;  2B2U A;  4OO1 G;  4FF4 A;  3I4N G;  4BY7 B;  2I46 A;  3GQB A;  1Y8O B;  1I4Q A;  1VQ9 A;  1GVP A;  2HDL A;  2HHH Q;  4POG A;  1PH8 A;  1HFN A;  2G9H D;  3JAM L;  5FLX E;  1Q82 C;  1Z47 A;  4LF4 Q;  1BBX C;  4XYO A;  1STH A;  3BZD B;  3HOU G;  4K6D A;  2RVL A;  3M3Y H;  5JEA H;  4F8M A;  3BZK A;  1NCV A;  2F0Q A;  1SFO H;  3K0Y A;  2JA8 B;  1D7Q A;  1QNK A;  3QB3 A;  5IP9 G;  3FKI H;  1QIL A;  1I5F A;  1JJ2 A;  2F4I A;  1B7Y B;  3S17 B;  3H09 A;  4KY6 A;  3SE0 A;  1K3R A;  3NP8 A;  2ZM6 Q;  3MVV A;  2B3G A;  3SR1 A;  4FF3 A;  4LF6 L;  1JJG A;  4KMU C;  3PUZ A;  5CV7 A;  2KEC A;  1CKM A;  3FHW A;  3RZD B;  4K0K L;  1II3 A;  1VQ7 A;  3KF8 B;  2UXC L;  2QDB A;  1K83 H;  4B9X A;  5IYB H;  3NPP A;  3CW2 C;  1WTW A;  1ZXT A;  3GDE A;  1IZ6 A;  5E7N A;  3OIQ A;  1ZYR D;  3TRE A;  3E6Z X;  2JEA I;  2F1M A;  2RDG A;  3H3V C;  1MHW C;  3MFY A;  4OON A;  4RG1 A;  2SNM A;  4MTK A;  2VS1 A;  3HZX A;  3UE0 A;  3HS0 C;  2AWO A;  1Y69 U;  1B3Q A;  2QCP X;  4K8J A;  1M1K C;  3L0O A;  5CV5 A;  5EQ0 A;  2A6H C;  2VY3 A;  4UP9 A;  2K33 A;  4DPG A;  2XN9 C;  1UEB A;  4KD4 A;  4DK6 C;  4R8N A;  5IGC A;  5IOD A;  1TQO A;  3GTM H;  2Z0S A;  5I2Y A;  3ERO A;  5BN4 A;  3GD7 A;  2IX3 A;  1CTM A;  3RLO A;  2DNE A;  1VCI A;  3Q24 A;  5C6A A;  4N9T A;  1L1O B;  5IOC A;  1TWH H;  2Q2U A;  3MEH A;  2NWG A;  2WP8 J;  3E3X A;  3JAM i;  1O7Y A;  4JBM A;  5M5X H;  3G48 A;  1IBK L;  2MP1 A;  4X6A H;  1IL8 A;  1RHP A;  1NUC A;  1J6Q A;  2A68 C;  1QUQ B;  1SND A;  4K6L A;  4PV1 C;  3Q22 A;  1SYF A;  1YNN D;  4DAV A;  2EY1 A;  5EKK A;  3TZU A;  4DV7 Q;  2UXB L;  3GTO H;  1YVC A;  5C3E B;  1PH5 A;  3D3R A;  1HQR D;  1IBM Q;  2FXQ A;  3GTJ H;  1S5E D;  2R92 G;  4AQY L;  4JK1 C;  4GNX A;  1RTO A;  4DR5 Q;  3I90 A;  2X6L A;  1JR0 D;  2JA9 A;  1MIU A;  1A3V A;  4Y7N H;  1HCZ A;  1B2T A;  1K0R A;  3VDY A;  1BUV T;  2NZH A;  3NUC A;  3GP7 A;  3A0J A;  2L4N A;  4CGY B;  4WRD A;  3GTQ H;  4KI0 A;  4RMF A;  4N9P A;  1F9Q A;  1JJC B;  3CD6 A;  2CQO A;  4LF5 L;  4HAE A;  1H95 A;  1V8Q A;  1EFI D;  1LUZ A;  4JOI A;  4MHE A;  2JA5 H;  5E4W C;  1VMP A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  4IPD A;  4JI5 Q;  1WI5 A;  2UUC Q;  1OXU A;  4L5Q A;  1PH9 A;  4R4Q A;  4DR5 L;  4BA2 I;  1RL2 A;  2D0O A;  3A74 A;  3OTO Q;  2AWN A;  4A3E H;  3KOJ A;  5ELN A;  1JT8 A;  1X3F A;  1XMQ Q;  3GTP H;  2Q2I A;  2ZJQ A;  1I50 H;  3L7Z C;  1Q12 A;  5IWA L;  1EOV A;  4LUO A;  4A3B H;  4YCU A;  4LF7 Q;  1PH3 A;  2JQO A;  3PF5 A;  4A3B G;  3HOU H;  2JA6 G;  3E0E A;  2NN6 G;  3PUX A;  5LMN W;  1KXL A;  1PH1 A;  3JAM c;  4JI6 L;  4KHP L;  4P71 A;  4QY7 A;  3CC7 A;  1VQF A;  4JI5 L;  4DNI A;  4PG3 A;  4YY3 Q;  1Z9F A;  2UUC L;  1N33 Q;  2R7Z H;  3TS2 A;  1VQ5 A;  1KL9 A;  1IXR A;  2HIX A;  2R7Z G;  2BA0 A;  2LSS A;  2D62 A;  4JOI C;  3OTO L;  3J81 c;  2F4V Q;  3PF4 A;  3CCE A;  1XTD A;  3KYH C;  3WWV A;  1XMQ L;  3BJU A;  4YHH Q;  4JI1 L;  3ICE A;  4P72 A;  1YEZ A;  4IFD G;  3U4Z A;  1WCM H;  3UDX A;  1YJ9 A;  4AYB G;  2VUM G;  4LF7 L;  4JI3 Q;  3S16 H;  1I3Q H;  4JV5 Q;  2K50 A;  3AFP A;  4LFA Q;  1CSQ A;  1YBY A;  1NMG A;  3KDF B;  2ATW A;  1TWA H;  5FJ8 H;  1PFS A;  4YY3 L;  1Y1W H;  3F1Z A;  1KC8 C;  1N33 L;  3J7A 5;  4EX5 A;  4AYB E;  1VQB A;  2F4V L;  2R7F A;  1UE1 A;  2VZA A;  5AJ3 Q;  5DLQ E;  1TXY A;  1VQH A;  1CUK A;  2KBN A;  3S1R H;  1HR0 Q;  2UUB Q;  4YHH L;  1SN8 A;  5FLM H;  1L1O A;  1P8L A;  4DR1 Q;  4LFB Q;  5FLM G;  5M3M H;  4TQU S;  4JI3 L;  5M3M G;  2JEB I;  2YYZ A;  2ALY B;  3BZC A;  4JI0 Q;  3J80 c;  4JV5 L;  2UXD Q;  4YWK A;  2VW9 A;  4A3D H;  3S15 H;  3I4O A;  5LMU Q;  4A93 H;  1QUQ A;  5IT9 c;  4A3D G;  2CWP A;  3AQQ A;  4O2D A;  3RR5 A;  5J3B A;  4X66 L;  4APV A;  1K8A C;  4BBS G;  1NBW A;  1DGS A;  4C2M H;  4A4I A;  4JC0 A;  1MKH A;  2KHJ A;  4BA1 I;  3S2D H;  4QQB X;  2GVA A;  4DV1 Q;  4P73 A;  1VQA A;  5AJ3 L;  3D0F A;  5GAG C;  1PH6 A;  1AH9 A;  2NN6 I;  1HR0 L;  1YIT A;  2UUB L;  4DR1 L;  3KJP A;  1VQJ A;  3PO2 G;  4LFB L;  4WJ4 A;  3ZJY C;  2GVB A;  1YI2 A;  1CSP A;  1NTG A;  5C44 H;  4JI0 L;  1HZA A;  4B3M Q;  4DUZ Q;  3EN2 A;  5C44 G;  1VQ8 A;  2UXD L;  4DV6 Q;  1JB7 A;  1PVO A;  2HIV A;  4YWL A;  4DAM A;  5LMU L;  3A5U A;  1OXX K;  2OTL A;  4NXM Q;  1HNX Q;  1VQK A;  1B8A A;  1YNX A;  4IPG A;  4JI2 Q;  1KQS A;  4LF9 Q;  4IFD I;  1YJN A;  3KF6 B;  3JC6 6;  3M4P A;  1G6P A;  3K80 C;  2I5H A;  1U5K A;  4LF8 Q;  3STB D;  4R4C A;  4DV1 L;  1QVF A;  1XNQ Q;  2K5N A;  1XPO A;  1HR0 W;  1I6H H;  3PUV A;  4L5S A;  3PO3 H;  2K14 A;  1EYG A;  4DR7 Q;  1E7Z A;  3PO3 G;  4JYA Q;  1HZC A;  1PYS B;  3IRB A;  4ALP A;  1HNW Q;  4LUZ A;  1TWG H;  5JEA J;  1N34 Q;  2I0Q A;  1X56 A;  4HJ8 A;  4B3M L;  4DUZ L;  3SGI A;  5JJI A;  3H15 A;  4YCW A;  1EIY B;  3STB C;  3K0X A;  5IE8 A;  3CCU A;  4O0A A;  4NXM L;  2OWO A;  3LGJ A;  3G6E A;  4HIK A;  3M4Q A;  1HNX L;  4JI2 L;  4LF9 L;  4DR6 L;  1CKN B;  3NBH B;  4X65 Q;  4BXX H;  1ASZ A;  4P74 A;  3F2C A;  4BXX G;  1VQM A;  3BU2 A;  4LF8 L;  3I4M H;  1XNQ L;  2MQH A;  1LYL A;  1EWI A;  3RLN A;  4HJ9 A;  3I4M G;  1VQE A;  1FGU A;  1VQD A;  1A8V A;  4OXP A;  2WFW A;  2OCE A;  3NEM A;  4DK3 C;  4A3K H;  2NVX H;  3CC4 A;  4OWW B;  4DR7 L;  3S2H H;  4JYA L;  2BA1 A;  4A3K G;  2JA7 G;  5ELO A;  2VQF Q;  1HNW L;  4H02 A;  4GLA C;  1AE2 A;  1P16 A;  2Y0S G;  3K81 C;  4JCV E;  3I55 A;  1N34 L;  4TVA B;  1MJC A;  3PUY A;  1X9N A;  1LM0 A;  2K75 A;  2MFI A;  3W5O A;  1FVI A;  1D8L A;  1W2B A;  4FDB A;  2RHQ B;  3E9I A;  1EQQ A;  3PUW A;  2K5V A;  3AYH B;  4OX9 Q;  5HY6 A;  5H1S E;  2MNA A;  4HJ5 A;  2A8V A;  2MO0 A;  4X65 L;  4QIW E;  1KRT A;  4X64 Q;  4HID A;  2Y0S E;  4Y52 H;  5C0X G;  4QGU A;  2A19 A;  4A3I H;  3KDF A;  1V9P A;  4MNO A;  2JA6 H;  4A3I G;  5IYD G;  1WJJ A;  1U0L A;  3L2P A;  3D31 A;  1X3G A;  1IYJ B;  2VQF L;  3U58 A;  1EQR A;  4LFC Q;  2OQ0 A;  1HH2 P;  1IL2 A;  4L5T A;  3HKS A;  2QA4 A;  1PH7 A;  2ZTC A;  1IBL Q;  2N78 A;  3ULP A;  4GN4 B;  1V43 A;  3T1Y Q;  1HJP A;  1T9H A;  2EIF A;  2KCM A;  3K7A H;  5LMN L;  3H0G H;  4OX9 L;  3KLW A;  1N36 Q;  1E1O A;  3H0G G;  3S14 H;  1XJV A;  1OXT A;  1I94 Q;  3UDF A;  4B3S Q;  4X64 L;  1Y14 B;  2VUM H;  1HNZ Q;  1VQI A;  4UP8 A;  4XIG S;  2NVY H;  4DV5 Q;  3HOZ H;  5HGQ A;  2I5M X;  3HOZ G;  1K9M C;  2HQL A;  3CP0 A;  3S24 A;  4LFC L;  2IHE A;  1YZ6 A;  2IX0 A;  2RHS B;  3PSI A;  1PHJ A;  4PZ7 A;  2JJQ A;  1O7I A;  1IBL L;  3MEF A;  2CFM A;  2PI2 E;  1JE5 A;  5C4X H;  4DV3 Q;  3T1Y L;  1XPU A;  4IOA A;  2VNU D;  5C4X G;  1G29 1;  4IO9 A;  3J7Z C;  1N36 L;  3FKI G;  3CCS A;  1UWV A;  3CPW A;  1I94 L;  1WFQ A;  1EIF A;  3W1G A;  2IY5 B;  4B3S L;  2PQA B;  1HNZ L;  2E8G A;  5BR8 Q;  2VQE Q;  2CCZ A;  3T1H Q;  3J81 j;  3PGZ A;  3EBE A;  4L5R C;  1VQ6 A;  1S72 A;  4IJH A;  4GN3 B;  1NMF A;  4DV5 L;  3GTK H;  2N3S A;  4LFA L;  4B3R Q;  3DM3 A;  4GOP B;  3KF6 A;  4GOP C;  4JI8 Q;  4BBS H;  1A0I A;  3RNU A;  3G71 A;  5EAY A;  3GO5 A;  3EIV A;  3NEN A;  4DUY Q;  5C0X I;  4DV3 L;  2CKZ B;  1TWF H;  4QL5 A;  1PA6 A;  1R9T H;  2XGT A;  1XPR A;  5K36 G;  1SMX A;  1HZB A;  4A3J H;  2OQK A;  3I7F A;  3HFZ B;  4DR3 Q;  2UU9 Q;  4A3J G;  4JBJ A;  2N8N A;  4UY8 C;  3PO2 H;  2MO1 A;  2B63 H;  4A75 A;  4ME3 A;  4YWM A;  1NE3 A;  2B63 G;  5BR8 L;  1XNR Q;  3OW2 A;  1Q86 C;  3RZO H;  1NY4 A;  3T1H L;  1N32 Q;  2RCN A;  1A63 A;  1CKN A;  1M90 C;  4YCV A;  1CKO A;  2ZTE A;  4B3R L;  1S3O A;  2B29 A;  3U50 C;  3ULJ A;  3ER0 A;  1FL0 A;  1PH2 A;  4GN5 A;  2DGY A;  5C3E G;  1IBK Q;  5FLX c;  4JI4 Q;  1A62 A;  4DUY L;  2AMC B;  1OXV A;  2JK8 A;  1KD1 C;  4NXN Q;  2WAQ G;  3UDG A;  1YJW A;  1Q8K A;  1S40 A;  4DR3 L;  2UU9 L;  1ASY A;  3CXC A;  1NJI C;  3H3V I;  4B3T Q;  4A3M G;  3RN5 A;  1SLJ A;  3NEL A;  2E5L Q;  3CCL A;  1KIX A;  1Y1V H;  2YV5 A;  3MXN B;  4LW1 A;  1XNR L;  3AEV A;  1Q7Y C;  1N32 L;  2EXD A;  1Y1V G;  4MZ9 A;  4C3I H;  3GTL H;  2JE6 I;  1YHQ A;  2WAQ E;  2Z6K A;  4DV6 L;  2QGQ A;  2ZJR A;  1SRU A;  3CCV A;  4UPA A;  1E24 A;  1K73 C;  4JI7 Q;  2K52 A;  1OXS C;  3CPF A;  4R1J A;  1GD7 A;  1SR3 A;  1TWC H;  2DUD A;  2PMZ E;  4DV2 Q;  3W1B A;  4JI4 L;  4R4O A;  3HOV H;  4DR4 Q;  5GAD C;  4IFD J;  1Q1E A;  3HOV G;  2R7D A;  1RIP A;  2D0P A;  4NXN L;  4A3L H;  2UUA Q;  4A3L G;  4BY7 H;  1BBU A;  4C3J H;  4KHZ A;  2JA7 H;  5IYC H;  4BY7 G;  1EFW A;  4B3T L;  5IYC G;  2NVT H;  4R4I A;  4R4T A;  4XTC S;  2E5L L;  4AH6 A;  2GN5 A;  3HOY G;  3KFU A;  3K7U C;  3HOX H;  3PIO A;  1UE5 A;  3HOX G;  2VL6 A;  3Q8D A;  3ERS X;  1JMC A;  4JI7 L;  2NVQ H;  3S1N H;  4C3H H;  4IJL A;  4DV2 L;  4GLX A;  3U4V A;  4DR4 L;  1QVG A;  2Z6K C;  4MTN A;  1GKH A;  1Q81 C;  2ES2 A;  2UUA L;  2JA8 H;  2N49 A;  3F8T A;  5IYD H;  2JA8 G;  2F52 A;  2IX1 A;  3KJO A;  4KHP Q;  3CC2 A;  1C7Y A;  1YHA A;  3S17 H;  2R6G A;  3HKZ G;  1KHI A;  3CCR A;  4QJF A;  1PH4 A;  2JA5 G;  1WYD A;  2OTJ A;  2L15 A;  2YU9 H;  1BBW A;  3ULL A;  2F3I A;  4X62 Q;  4GKJ Q;  3J80 i;  3HOW H;  1L0W A;  3I4N H;  2V1C C;  3HOW G;  1J5E Q;  4OO1 G;  1HZ9 A;  2PQA A;  3I4N G;  1C0A A;  4A3E G;  3RZD H;  4GNX B;  1MJE A;  1Q46 A;  1W3S A;  4JI1 Q;  3TEH B;  4GNX C;  4IPC A;  1VQ9 A;  3HKZ E;  2E2H H;  2YTX A;  1GVP A;  1PYB A;  3E9H A;  4GOP A;  1G51 A;  3CAM A;  2HHH Q;  1PH8 A;  4POG A;  3M85 A;  2IHF A;  1Q82 C;  5JJL A;  1Z47 A;  1VQ4 A;  4LF4 Q;  4LF6 Q;  3I2Z A;  2PI2 A;  3HOU G;  3TS0 A;  2NZO A;  1YIJ A;  3M3Y H;  4K0K Q;  3H3V H;  4BY1 H;  2KCT A;  3I56 A;  3BZK A;  4GKK Q;  4BY1 G;  5JEA G;  4X62 L;  4A3F H;  4GKJ L;  3CMA A;  3M4O H;  2UXC Q;  4A3F G;  2A1A A;  5IP9 H;  1SFO H;  4KLK A;  1D7Q A;  1WOC A;  1BVS A;  5IP9 G;  1BKB A;  1J5E L;  3FKI H;  1I5F A;  1JJ2 A;  1UE7 A;  1B7Y B;  3FP9 A;  3RLF A;  3S1M H;  3CF5 A;  2ZM6 Q;  1K3R A;  1B70 B;  1VQO A;  2R93 H;  1FJG Q;  1VQN A;  5GQO A;  1N8R C;  5C4J H;  2HHH L;  1X6O A;  2HT1 A;  3TRZ A;  1WCM G;  2R93 G;  4LUV A;  2B3G A;  3CCM A;  1QZG A;  1L2F A;  1E3P A;  3OYY A;  4LF4 L;  4LF6 L;  1AE3 A;  3PIP A;  1JJG A;  2LXK A;  3CCJ A;  4HJA A;  1K8G A;  3PUZ A;  2EQS A;  3PCO B;  1KRS A;  5GRO A;  3M9B A;  4J15 A;  2ZJP A;  1CKM A;  3FHW A;  1KAW A;  3TQY A;  4X66 Q;  4A3G H;  4K0K L;  4UP7 A;  1VQ7 A;  2YTY A;  4GKK L;  3KF8 B;  3A5Z B;  1C9O A;  4A3G G;  2UXC L;  1K83 H;  3RN2 A;  5IYB H;  3CW2 C;  5FJ8 G;  1Q1B A;  1Y1W G;  2E2I H;  3GDE A;  4PZ6 A;  1IZ6 A;  5E7N A;  2I5L X;  1VS0 A;  5IYB G;  4HIO A;  3TRE A;  2Q2H A;  4A3C H;  2JEA I;  2CWA A;  4A3C G;  4LNQ A;  5M3F H;  3F2D A;  3K8A A;  3UE1 A;  4WJ3 M;  4HJ7 A;  2KHI A;  2ZM6 L;  5M3F G;  1FJG L;  4OON A;  3B6Y A;  1QZH A;  2H5X A;  4RG1 A;  1LTL A;  1X54 A;  2RF4 A;  2VQE L;  1E1T A;  2VS1 A;  2Q2T A;  4EQ5 A;  1E22 A;  1YHB A;  3UE0 A;  1QVC A;  2YTV A;  4AIM A;  4OO1 I;  2AWO A;  4DR2 Q;  1VQG A;  3L0O A;  4JI8 L;  5C3E H;  1M1K C;  4A93 G;  2ASB A;  2VY3 A;  4UP9 A;  4DPG A;  1UEB A;  5GAE C;  5C0X J;  4DKA C;  4DK6 C;  3GTG H;  4LWC A;  4NB3 A;  1VQL A;  2XTI A;  4PZ8 A;  2UXB Q;  3GTM H;  4GS3 A;  4A3M H;  1SRO A;  2Z0S A;  4BBR H;  3F2B A;  3GD7 A;  5IY0 A;  4BBR G;  1X55 A;  5IP7 H;  4AQY Q;  3CME A;  2AHO B;  3RLO A;  1VCI A;  5IP7 G;  1L1O B;  1TWH H;  1L1O C;  4DR2 L;  2Q2U A;  2WB1 G;  1VQC A;  3PV0 A;  4PMW A;  5M5Y H;  3CCQ A;  2WP8 J;  4HIM A;  3JAM i;  1OTC A;  4DR6 Q;  1EUJ A;  4JBM A;  5M5X H;  3G48 A;  1GM5 A;  4DAY B;  1IBK L;  3M7N A;  4X6A H;  1XMO Q;  1GO3 E;  1X3E A;  1J6Q A;  2C35 B;  2ID0 A;  2KEN A;  1QUQ B;  3G4S A;  1PV4 A;  2BH2 A;  2BH8 A;  3J81 i;  4IOC A;  4GLV B;  5JJK A;  2AKW B;  2K5H A;  4OWX B;  4LF5 Q;  2K4K A;  4DV4 Q;  4DV7 Q;  2UXB L;  3GTO H;  2WB1 E;  1YVC A;  5M5W H;  1N9W A;  4JBK A;  1PH5 A;  3AFQ A;  5LMN Q;  4DV0 Q;  1IBM Q;  2R92 H;  2FXQ A;  4IPH A;  5GAH C;  3HOY H;  1UE6 A;  4JG2 A;  3GTJ H;  2E2J H;  2R92 G;  4POF A;  4AQY L;  2QEX A;  4JBW A;  4A76 A;  4GNX A;  3S1Q H;  4DR5 Q;  2JA9 A;  3CQZ H;  1MIU A;  4Y7N H;  1SE8 A;  2PNH A;  1K0R A;  3UDI A;  3VDY A;  2NZH A;  1XMO L;  4OWT B;  3A0J A;  5IWA Q;  3GTQ H;  4KI0 A;  1V1Q A;  4RMF A;  1JJC B;  4NPS A;  3DLL A;  3CD6 A;  2CQO A;  4LF5 L;  4DV7 L;  4P75 A;  4DV4 L;  1H95 A;  1X65 A;  1VQP A;  1LUZ A;  2LXJ A;  4JOI A;  2IT1 A;  4DV0 L;  2JA5 H;  1IBM L;  4JI6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...