2K4KA

Solution structure of gsp13 from bacillus subtilis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of GSP13 from Bacillus subtilis exhibits an S1 domain related to cold shock proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Rna binding protein
molecule keywords General stress protein 13
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k4kA01
4AYBE 2K50A 1N9WA 4B3RQ 2GVAA 3STBC 1LM0A 3CD6A 5LMUQ 2ZTEA 4A3LH 4K0KQ 5IP7G 4GKKL 5IP9G 1J6QA 3TEHB 2UUBL 2PMZE 1L1OB 4IPGA 2I5MX 4YWLA 4YCVA 5IT9c 1KXLA 4JI6Q 4LF8L 2RHSB 1KC8C 2NVXH 1RIPA 1X9NA 4HJ9A 4YCWA 2ASBA 1GKHA 2K5NA 2OTLA 4PMWA 3GTJH 3J81i 3KFUA 4DK3C 2KCMA 2B3GA 4HJAA 1KRSA 3HKZG 3WWVA 3PUZA 1PA6A 3TS2A 3RN5A 3ERSX 4DV3L 3KJPA 2Q2UA 1QVFA 1GD7A 4GLXA 3PO3G 1A63A 3MXNB 3RLNA 4OXPA 4APVA 1PH2A 1J5EQ 1IBMQ 4IPDA 2WAQE 3GO5A 2EIFA 4YY3L 3OTOQ 1A8VA 1Q82C 1YVCA 4L5SA 1OXXK 3U58A 1VQ4A 4AYBG 4DR3Q 1SMXA 4JI2Q 5IYBG 2YYZA 4BXXH 2HHHL 4OONA 3EBEA 4JI0Q 1D7QA 1EFWA 4L5RC 3E9HA 4KHZA 3J81j 1S72A 1PH5A 4X6AH 1VQ6A 1TWHH 2I5LX 4A3EG 2VNUD 3KF6A 4X64L 3I4MH 2QGQA 4YHHQ 2Y0SE 2QA4A 3LGJA 3W5OA 1VQAA 1AE2A 5IYCG 5H1SE 3FHWA 1YBYA 4P72A 4DR1L 2E2HH 2JEBI 2HT1A 4JI2L 2CWPA 4A3IG 3HOWG 1FGUA 1M1KC 4LF7L 4FDBA 4HIMA 3I4MG 2V1CC 3IRBA 3L7ZC 4HIOA 2F4VQ 3M7NA 2BH8A 2KENA 4LF9Q 4JYAL 1WYDA 1NTGA 4GLAC 1IBML 4A3CG 4UY8C 4HIKA 1EIFA 1HNZQ 4JI5L 1B8AA 2OQKA 1S40A 1EIYB 5C4XH 5C3EG 1IZ6A 2ZJQA 3K7UC 1YIJA 2JA6G 4K0KL 3CCVA 5LMUL 4PG3A 2XGTA 2KHIA 3F8TA 3J7ZC 5GQOA 1PHJA 4IFDI 4YY3Q 3K8AA 3OTOL 2N3SA 1LTLA 5LMNL 2HQLA 2LXJA 3U4VA 4R4TA 3J80i 4A3FG 1KQSA 3GTMH 3PIPA 4GOPC 2JA5G 2Y0SG 3S1MH 1VS0A 4JOIA 4ALPA 2VW9A 4EX5A 3K7AH 1XMQQ 4JI4L 1XPOA 1YZ6A 4JBWA 4BA2I 2KBNA 1U5KA 1Y1VH 4B3RL 3T1HQ 4BY1H 3S17H 3S2HH 1UE6A 4P75A 1Q46A 2JE6I 3PV0A 4X66Q 1UE5A 2YTYA 3KLWA 4O0AA 2JEAI 5JJKA 2VL6A 2IX0A 4OWWB 2JA9A 3JC66 4HIDA 2R93G 2AWOA 4A3CH 4DR2L 5JEAJ 2LXKA 3CCSA 4GOPB 2OCEA 3RZDH 1K83H 4KI0A 5M3MH 4NXML 3M4PA 1TWAH 2Z0SA 1A0IA 1JB7A 4NPSA 2ALYB 4A3MG 1XPRA 1PYSB 3RLOA 3KDFB 2CCZA 1Q8KA 1N32L 2AHOB 4IOCA 4DR1Q 2F3IA 1HJPA 4R4QA 3B6YA 2UU9Q 2B63G 4KHPL 1YI2A 4YHHL 2ES2A 3S2DH 3BZCA 4LF5Q 1OTCA 2JK8A 1Q12A 3GD7A 3ULJA 4DAYB 1YEZA 4LF6Q 2IHEA 2DUDA 1QZGA 3GTOH 4R4OA 2WP8J 3AEVA 3KF6B 4B3SL 2ZM6Q 4LF7Q 3HOUH 4ME3A 4A3BG 1SLJA 1XPUA 2A19A 3GDEA 1CSQA 2PNHA 1MKHA 1N32Q 3H3VI 1PFSA 2PI2A 3NBHB 4L5TA 1NJIC 1TWGH 1TWFH 1EYGA 1YNXA 1VQEA 2D0PA 2VUMH 1PH7A 4LUVA 1PV4A 4O2DA 4IFDJ 1L0WA 4A75A 1PH9A 1FJGL 1WFQA 5C3EH 5C4XG 1JE5A 1K0RA 4A3IH 4DV7L 3BU2A 1YHAA 2F52A 4DR4L 5BR8Q 1Y14B 1YHBA 2HHHQ 4IFDG 1A62A 1YJ9A 4UP9A 3RR5A 1K73C 1VQLA 2MFIA 3I2ZA 1WJJA 1BKBA 3HFZB 1VCIA 2BA1A 3VDYA 1VQBA 3GTGH 1L1OA 2FXQA 4QQBX 4LNQA 3JAMi 1C7YA 1X3GA 2R6GA 1SN8A 4GNXA 4WJ4A 5IYCH 3OW2A 4BY7H 4DV4Q 4GLVB 1EQRA 1HH2P 2QEXA 2JJQA 4X66L 1ASYA 3NEMA 4P73A 4JI3Q 3PSIA 1V9PA 3CCRA 2R7FA 2NVYH 1K8GA 1BBWA 5J3BA 2ZJRA 1K9MC 4X65Q 1IBLQ 4A3GG 1V43A 3AFQA 1JJCB 1NY4A 1CKOA 1KD1C 5C44H 3PF5A 4A3KG 2VQFQ 5C44G 2A1AA 2Q2HA 4UP7A 3U4ZA 2F4VL 1I6HH 4BBSG 4GOPA 2E5LL 1XTDA 4Y7NH 1JJGA 4A3GH 4OWTB 2UXDQ 3F1ZA 3D0FA 1IBKQ 3F2CA 3KDFA 2K4KA 3AYHB 5FLMG 2VQEQ 1DGSA 1UE1A 2VY3A 2ZJPA 1NE3A 4DUZL 2UUAL 2YU9H 1Q1EA 1Q86C 1SR3A 2IY5B 3TQYA 2Z6KA 1YHQA 2AMCB 2R7ZH 3J7A5 3H0GG 4DV6L 3CC2A 2XTIA 4L5QA 5FLXc 3HOXH 1PH6A 4QY7A 3AFPA 4DPGA 3G71A 3M4QA 1ASZA 1VQ9A 3S16H 1W3SA 3SGIA 4JCVE 3ULLA 2VZAA 3GTLH 4GN4B 1WI5A 4JV5Q 1N33Q 2UXBQ 4R1JA 1X3FA 3BZKA 3M9BA 3NENA 3CCLA 3CCEA 3ICEA 1U0LA 5GADC 5IYDG 1HR0L 4GS3A 3PO2G 3CQZH 3KF8B 4HJ8A 1N34L 4WJ3M 1QVCA 3UDFA 4EQ5A 5C0XJ 4JOIC 4DUYL 2E8GA 2NZOA 4JI8Q 1S3OA 2B29A 4DR2Q 3CMEA 3HOYG 1N36L 1Y1WH 1VQMA 4LUZA 4QGUA 3T1YL 1XNQQ 4HJ5A 1H95A 1D8LA 4P71A 1V1QA 1VQJA 5C4JH 4X62Q 4DV1Q 3A5UA 4JI7L 1CSPA 2IHFA 1JMCA 3RNUA 3HOYH 1Q7YC 4DV2Q 3HOUG 2WB1G 3A5ZB 2B63H 4DV0L 3G4SA 2MQHA 1HNXL 4DR7L 3UE1A 1E1OA 3I4NG 1KRTA 3J81c 2NN6G 3PUWA 4X62L 1HZBA 3JAMc 4MNOA 4DV1L 4HJ7A 4OX9Q 3F2BA 2UXCQ 1C0AA 1RL2A 2AWNA 3S1RH 3DLLA 1CKMA 3I56A 3AQQA 2ZTCA 2ATWA 5M3MG 2JA8G 2JA8H 4H02A 1KL9A 3CC7A 3PUXA 4DR5Q 4IPHA 1OXVA 4DR5L 1JJ2A 2PI2E 1X55A 1OXUA 1HNZL 2N78A 3L0OA 5FLMH 5DLQE 1YJWA 1NMGA 1XNQL 3DM3A 1AH9A 5M3FH 4LF4L 4BA1I 2K52A 4JBJA 4GKJL 4YCUA 2L15A 4JI5Q 1UWVA 1R9TH 5JJIA 2C35B 2NVQH 1Y1VG 1MIUA 4AIMA 2HIVA 4LFAQ 2BA0A 5HY6A 4BBRH 4TQUS 3M85A 4DAMA 2ZTDA 4JI7Q 4A3DH 1EWIA 3TREA 3RZOH 3H3VH 4PZ8A 1T9HA 3UDXA 4C2MH 1P8LA 4C3JH 1GVPA 1XNRL 2K75A 2UU9L 1XNRQ 1VQDA 3G6EA 4BY7G 3PGZA 1CUKA 1CKNB 1X3EA 4IJLA 2N8NA 3STBD 3PO2H 1HNWL 4PZ6A 1E1TA 1WCMG 3OYYA 3RN2A 3GTPH 2PQAA 3W1GA 4JBMA 2RCNA 3HKSA 5K36G 2R7DA 4LUOA 1XMOL 4JI0L 3CXCA 1KIXA 5GAEC 4A93H 4DV5L 1YITA 2WAQG 4J15A 4DR6L 2EXDA 3HKZE 4NB3A 4A76A 2JA7H 4XIGS 1KAWA 4A3LG 4DV3Q 2Q2TA 1G6PA 2RHQB 5IP9H 1UEBA 2UXCL 2OQ0A 1I94L 1FVIA 1Q1BA 2D62A 4A3EH 4YWMA 5M5WH 4A3MH 2K5HA 2R7ZG 2JA7G 1B7YB 5IE8A 1BBUA 3FP9A 3CCQA 3CAMA 1E7ZA 3L2PA 4DV2L 4AQYL 2UUCQ 4LF8Q 1Z9FA 2JA5H 1G51A 1UE7A 4GKKQ 4LF4Q 1B70B 1PYBA 4JI1Q 1E3PA 2N49A 4A3BH 3CP0A 2GN5A 2IX1A 4XTCS 1LYLA 2VUMG 4QIWE 4JI6L 3CCUA 2CQOA 4GN5A 3E0EA 1N36Q 4A3JH 3D31A 2AKWB 4OWXB 1PVOA 3FKIH 4TVAB 1Z47A 2KCTA 4BBSH 1VQFA 3GTKH 1P16A 2R92G 2WFWA 2VQFL 1WOCA 4Y52H 2RF4A 4NXNQ 1VQNA 4GKJQ 4OX9L 1SRUA 3BJUA 3KYHC 5LMNQ 5IYDH 1VQGA 5JEAG 4P74A 2MNAA 2ID0A 3ER0A 2GVBA 4IJHA 3H15A 1YJNA 1VQPA 3H0GH 3E9IA 1MJCA 4DUYQ 2Q2IA 2KHJA 3U50C 4LFBL 3NELA 3GTQH 5IP7H 4B3SQ 2K5VA 3RLFA 5M5XH 4X64Q 1FJGQ 2VS1A 3UDGA 2BH2A 4LFCQ 2I5HA 2YV5A 4JYAQ 1OXTA 3G48A 1X56A 3HOVH 5GROA 4POFA 4UPAA 1FL0A 4PZ7A 3CF5A 4DV0Q 1X65A 4RMFA 1CKNA 5FJ8H 5AJ3Q 1XMOQ 1MJEA 3A0JA 3TRZA 4R4CA 2CKZB 3FKIG 3K80C 4POGA 2A8VA 2R92H 3I55A 1W2BA 4NXMQ 1Y1WG 1SFOH 2DGYA 3T1YQ 3S15H 3UDIA 5IY0A 3PIOA 4IPCA 3UE0A 4A4IA 4A3FH 4DUZQ 2JA6H 4JI8L 1EQQA 4DR3L 2D0OA 2ZM6L 1VQ8A 4QL5A 3CPWA 1HR0Q 4LFAL 1M90C 1HZCA 1VQIA 2OWOA 2MO0A 3EN2A 1VQKA 3K0XA 5IWAQ 3CC4A 1EOVA 2HIXA 1GO3E 2IT1A 2R93H 3HOXG 1C9OA 1NBWA 1IBKL 4LFCL 2I0QA 3CPFA 5E7NA 4NXNL 4GNXC 1VQ5A 4JI3L 2YTXA 1LUZA 1GM5A 5BR8L 1SROA 1WCMH 3HOZG 4LFBQ 3PF4A 2NN6I 1IYJB 5C0XI 1PH4A 1N8RC 1X6OA 4C3IH 1VQOA 1SE8A 3J80c 4B3ML 1TXYA 5IYBH 1HZ9A 4B3MQ 4BXXG 3KJOA 4QJFA 1PH8A 2CWAA 4OO1I 2JQOA 2UXDL 2YTVA 5ELOA 1IXRA 5LMNW 1HNXQ 2E2IH 4DR7Q 4B3TL 4BBRG 4DV4L 5JJLA 1JT8A 2EQSA 5GAGC 4A3DG 3TS0A 1HZAA 1TWCH 4YWKA 4UP8A 4GNXB 1I94Q 3HOVG 4LF9L 1I5FA 4JI1L 1VQHA 4LF5L 1G291 3F2DA 1N33L 2UXBL 1KHIA 4A3KH 1NMFA 2NZHA 1VQ7A 5FJ8G 5IWAL 4DK6C 4JBKA 4DR4Q 4AQYQ 2UUCL 3HOWH 1BVSA 3K81C 4KLKA 3CMAA 4DR6Q 1L1OC 1N34Q 3A74A 5M5YH 3S1NH 4C3HH 1E22A 1O7IA 4LWCA 4DKAC 4DV6Q 1QVGA 4LF6L 4A93G 1HNWQ 1PH3A 2H5XA 4AH6A 3S14H 1E24A 4RG1A 2LSSA 4KHPQ 1L2FA 2OTJA 3MEFA 1EUJA 5AJ3L 4DV5Q 1XJVA 2VQEL 2K14A 1QUQA 4DV7Q 1QUQB 5C0XG 3T1HL 1Q81C 1VQCA 2WB1E 4BY1G 1X54A 3I4NH 1J5EL 5EAYA 3CW2C 3KOJA 2NVTH 4JV5L 3PUYA 4MZ9A 4LW1A 1I50H 1QZHA 4DNIA 4JG2A 4MTNA 4X65L 5ELNA 1IBLL 1K8AC 1HR0W 2CFMA 4A3JG 3M4OH 3I7FA 3ZJYC 3PUVA 3I4OA 5GAHC 3CCMA 1PH1A 1K3RA 4OO1G 4JC0A 1XMQL 4JI4Q 4IOAA 3PO3H 2E5LQ 3S1QH 3Q8DA 2Z6KC 1IL2A 1OXSC 3CCJA 1I3QH 4R4IA 2PQAB 3W1BA 3S24A 5HGQA 4GN3B 2UUBQ 5M3FG 3ULPA 4B3TQ 2UUAQ 2MO1A 3HOZH 3M3YH 4IO9A 3EIVA 3PCOB 1AE3A 2E2JH
chains in the Genus database with same CATH superfamily
2RBMA 3ND8A 2K50A 2P5ZX 4AYBE 4ZKCB 4B3RQ 5IIFA 4KY5A 1BCPC 1BF4A 4A3LH 4K0KQ 5IP7G 5IP9G 3Q0AA 3T16A 1KXLA 5I4DA 3W2DA 1O7YA 3VR5A 4YCWA 3GTJH 3J81i 3KFUA 4QCLA 1KRSA 4NDXA 1HUMA 4B9WA 2Q2UA 4A3EB 4GLXA 3RLNA 4APVA 1J5EQ 1X3QA 2HCIA 2AQ3B 2WAQE 3GO5A 4YY3L 3OTOQ 3L3OC 4J1MA 4K8JA 1VQ4A 3U58A 4AYBG 1SMXA 5IYBG 1CA5A 2R3ZA 1A3VA 4OONA 3EBEA 1SYCA 1MD2D 3DHQA 1RJTA 3TZDA 4X6AH 3C1FA 1PYWD 2FINB 3VR6A 2EPBA 2I5LX 3A55A 3OMGA 3KF6A 4A3EG 1WTQA 4YHHQ 2HD3A 3W5OA 1AE2A 3TN2A 1SJED 5HGTA 1YNNC 3NSWA 2LY7A 3LNNA 5I6WA 2HT1A 1IKMA 1B1ZA 2CWPA 4I7AA 4A3IG 3NHHA 1NTGA 4WFN3 1HNZQ 1B8AA 2OQKA 1EIYB 5C3EG 2OT2A 3K7UC 2QF7A 5LMUL 2KQ3A 1O7ZA 3J7ZC 5GQOA 2N3SA 4A3FG 3BDCA 4NMZA 4C3HB 3SDZA 4KN7C 3S1MH 2L5TA 3K7AH 1XPOA 2KBNA 1SYDA 4B3RL 3T1HQ 3S17H 1UE6A 3VA5A 2OEOA 5JJKA 1UE5A 2YTYA 4O0AA 5EPKA 3JC66 2R93G 2AWOA 4K14A 1BQQT 4A3CH 2LXKA 3CCSA 5IT9L 4KI0A 4NXML 5FLXL 3EVQA 1TWAH 3M4PA 1WTVA 1JB7A 4HEDA 3GTKB 2CCZA 1N32L 4DR1Q 2EOTA 3I70A 1JWSD 3B6YA 2ES2A 3S2DH 1XXGA 1OTCA 2JK8A 4DAYB 4LF6Q 2B2YC 2IL8A 3KF6B 3HOUH 4A3BG 3DWQA 1N32Q 2PI2A 3H3VC 4L5TA 3V05A 1PH7A 4IFDJ 4DAVA 1PH9A 4G7OC 4N8FA 5FOBB 2B2WA 1PRTC 1U4LA 4FF1A 4DR4L 5BR8Q 2G5DA 3JAML 4HSVA 3NQTA 3S2DB 1IW7D 2WKCA 4EQNA 4CJ1B 1L1OA 4UHVA 4J6HA 1IL8A 1C7YA 2FFKB 1SN8A 2Q8RE 5IYCH 1O78A 3OW2A 4DV4Q 1EQRA 4X66L 4P73A 1LLRD 2ZJRA 4X65Q 1S5DD 1STNA 3OWFA 1CKOA 1TY0A 3PF5A 2EE1A 1JQYD 1U4RA 4Y7NH 1JJGA 2UXDQ 1CFMA 3T4AC 3KDFA 2VQEQ 2UUAL 3MA2B 2YU9H 3PIO3 1MI2A 5K5PA 1XX8A 3LX0A 2MP1A 5KGUA 3HZXA 5JAVA 4R9WA 3I3CA 2XTIA 1SNOA 3HOXH 1PH6A 3CRKC 2XN9C 3G71A 1ASZA 3QO2A 1EL0A 2VZAA 1DOKA 4ZLTF 2UXBQ 3ND9A 5DM63 3BZKA 1HUNA 3NENA 3CCEA 3D3RA 5IYDG 1HR0L 3K5NA 1N34L 1QVCA 5C0XJ 4JOIC 4JI8Q 2B29A 3EFXD 3HOYG 1N36L 4QGUA 1JOOA 2A6HC 1SMYC 1KLUD 1Y8OB 4JI7L 2I46A 2IHFA 2Y0SB 1JMCA 3HOYH 1Q7YC 1EZ6A 2WB1G 2B63H 4DV0L 2IWHA 3D6CA 3G4SA 3UE1A 3PUWA 3BDOA 1GXDC 1Z6HA 3URYA 3SK8A 4CDEC 4GZYC 2JA8G 1ENAA 2JA8H 1B44D 4H02A 3EQLC 2K5DA 1A3UA 2JA5B 2N78A 4LJZC 3S16B 1AH9A 4EQPA 4BA1I 1UWVA 2NVQH 2JA6B 4Y7NB 1NCVA 3M85A 4BBRH 1SYGA 2BA0A 4TQUS 4DAMA 2FMMA 4JI7Q 3R8BA 1QOHA 2Z6BA 4DGZA 3UDXA 2NTSA 1F9SA 2UU9L 3KBXA 4IJLA 1CUKA 1CKNB 1PTOB 3T56B 4KV6A 1E1TA 1WCMG 2CH4W 3GTPH 5K36G 2RA4A 1B9MA 4DR6L 1S5BD 3MTSA 1SE2A 1PTOH 2BE5D 5CBAE 4CDDC 1FNUA 4ZAIA 3S1NB 3C1EA 1Q1BA 1BDOA 4J8QA 4FXDA 2K5HA 4CKEA 2R7ZG 3K6OA 2JA7G 2J0TD 1BBUA 1Y69U 3CAMA 4DV2L 4AQYL 2M00A 1Z9FA 3J80L 2EJGC 4H13C 1JOQA 3K5MA 1E3PA 4A3BH 3CP0A 2GN5A 4LK1C 4OWXB 3FKIH 3OWEB 2KCTA 2B2YA 1VQFA 3GTKH 2R92G 1MBYA 2F0OA 4Y52H 4JPBW 4C1NK 5IGCA 3BJUA 2JA8B 3KYHC 3J81L 1HRJA 1SFOB 3FPPA 1HFNA 5CMDA 3H0GH 4LAAA 4DUYQ 1V1PB 3PO2B 4LFBL 3NELA 3S17B 3CKIB 2K5VA 2ICEC 3OPOA 1X56A 3Q22A 4A3JB 1WTXA 4PZ7A 2CKZB 1SBBB 1AZQA 2R92H 1JE4A 1AZPA 3GTLB 5EBCA 1W2BA 1GJXA 2DGYA 3S15H 2F0NA 4XQQA 3PIOA 2CW0C 4JI8L 3GTOB 2B8FA 2L55A 2R61A 1HZCA 5IGDA 4IUUA 1DONA 4K5XA 5I9PA 3HOXG 1NBWA 4NXNL 1G91A 1LUZA 5CYUA 3HOZG 1RD9D 2NN6I 2F0PA 4OIKA 1EIHA 4C3IH 5A2QL 5KYIA 5IYBH 4ZQ3A 3W3AA 5ELOA 4C2MB 2B2VC 5LMNW 2B8GA 4B3TL 2JYOA 2EQSA 1SE3A 3NE5B 5GAGC 3A8KE 1KABA 4IUVA 1PFBA 3F2DA 1NMFA 3GV6A 5FJ8G 2KHSA 4FXKC 1FR3A 2NWGA 3HOWH 3K81C 2A6HD 1SSOA 1E22A 4DKAC 4LF6L 4XXEA 4DA2A 1DD2A 3FDTA 1HPCA 1TQOA 2K33A 4B08A 3Q23A 1ZYRC 4KHPQ 4G57A 1LTGD 2BDOA 2ZXPA 1CZWA 2KEDA 1VQCA 3QB3A 5JPMC 4Q5VA 1A6XA 4MZ9A 1WD0A 1I50H 4MTNA 2A69C 3TP5A 4RGOS 3I7FA 3OIPA 3HG9A 3ZJYC 1PH1A 3U9SA 4XQJA 2HCCA 3PO3H 1IL2A 1I3QH 3KLSX 3W1BA 2XRQD 1B2TA 4DAPA 3M3YH 3PCOB 2L0CA 3PIP3 1N9WA 2XNAC 3SXHA 2KVMA 2F0FA 5LMUQ 4KHVA 3D4RA 4HMJA 4YWLA 1WTPA 2NBFA 1LABA 2RHSB 1KC8C 1MGSA 1RIPA 1X9NA 2B2UC 2ASBA 2OTLA 4QB4A 2KCMA 4QUFA 4HJAA 3WWVA 1I4PA 3ERSX 4DV3L 2RQXA 1F9RA 3V96A 1GD7A 5LL6S 1A63A 2VB3X 2A73B 1PH2A 1IBMQ 4IPDA 1O7LA 2NTTA 4TKOB 1A8VA 2HHHL 2DJFC 4JI0Q 5DM73 2B2WC 1PXUA 4L5RC 1SYFA 3E9HA 1S72A 1PH5A 3K5OA 2SEBD 1PTOC 2VNUD 3I4MH 2QA4A 3LGJA 5IYCG 2M9VA 4K6LA 5H1SE 4P72A 1YBYA 3RZDB 2JEBI 4LF7L 4FDBA 4HIMA 3I4MG 2V1CC 3L7ZC 4AYBB 4L63B 4LF9Q 2KENA 4JYAL 4KD4A 4UY8C 1EIFA 1EY9A 4JI5L 2JA6G 1IZ6A 1TS4A 2ZJQA 4K0KL 3CCVA 3H09A 4PG3A 2XGTA 4FF2A 2KHIA 1PHJA 2EJFC 2F3VA 1CK1A 3FEWX 3P75A 5LMNL 2HQLA 4R4TA 3J80i 3OIQA 3S9WA 5JPNC 4GOPC 1ONLA 2Y0SG 2VW9A 1LTSD 1YZ6A 1EYDA 4UAIA 1SAPA 4P75A 4MHEA 4M1UB 4X66Q 4CBVA 5ELFA 4HR7B 4FNFA 2QEJC 3BVGA 1HQRD 1DYQA 5JVH3 5M3MH 2Z0SA 3E5SA 1A0IA 2KCCA 2ALYB 1XPRA 1D5MC 3RLOA 2AHOB 2EYPA 4R4QA 3RZOB 3A7AB 3VR4A 2UU9Q 1K83B 2B63G 1GUGA 1YI2A 3BZCA 3NBIA 5AFWA 2F0UA 2NN6H 2WV6D 3H0GB 3ULJA 2H1EA 3D4DA 1QZGA 3GTOH 1D5ZC 1EY8A 5EKLA 2WP8J 1F2LA 4LF7Q 3J81E 5T1IA 3NBHA 3H3VI 1PFSA 2Z4IA 2IPKD 2K5QA 1TWGH 3NBHB 1TWFH 5M5YB 1VQEA 2D0PA 1STAA 2EXZA 4LUVA 3R2IA 4O2DA 4A75A 5C3EH 1JE5A 1K0RA 3MFYA 4A3IH 4DV7L 1LT3D 1JORA 2K1BA 1PDQA 2F52A 4B9XA 1E0BA 4ABNA 4UP9A 3RR5A 5EPLA 1K73C 1VQLA 4FF3A 1JICA 1WJJA 1BKBA 3O13A 4IUTA 2L11A 5JEAH 4LNQA 4RGTA 3N6RA 4K2LA 1SNPA 1X3GA 2R6GA 3A7LA 1ET6A 2QEXA 3QIAA 3GTQB 3E3XA 3PSIA 1VF7A 4KY7A 3CCRA 2R7FA 2RDFA 1BBWA 5J3BA 2L1BA 2F0KA 1IBLQ 4A3GG 5C4JB 2PW5A 1NY4A 3T13A 2VQFQ 5CBEE 1WD1A 1ILQA 1XTDA 3VYUA 3HGBA 5CGKA 1X3PA 2SOBA 5FLMG 1DGSA 2PZTA 2ZJPA 3X3NA 1Q1EA 2IY5B 3LWUA 3TQYA 1W6JA 2LS01 3BG3A 3J7A5 5FLXc 4RGNA 5C4XB 3S16H 4HMIA 4I65A 3SGIA 3ULLA 3GTLH 5TSSA 3P1HA 1WI5A 1N33Q 1D1KA 2RKSA 3M9BA 3CCLA 1JR0D 4GS3A 3PO2G 3CQZH 2MUYA 5D3DA 3NTHA 4RFBA 4F87A 2E8GA 2CVRA 1SYBA 4IZ8A 3L9AX 1D5XC 5CV9A 1LACA 1V1QA 1VQJA 4X62Q 5LL6X 2AUJD 3A5UA 4DV1Q 3CU7A 3NTIA 1EY7A 1HTPA 4DV2Q 5J1ZA 2MQHA 2VUMB 4MNOA 5FO8B 2KEEA 5I6YA 5IGEA 3SE0A 4HSPA 4X3KA 1RL2A 2AWNA 3DLLA 2ZTCA 2ATWA 2PNRC 2MGSA 1ICWA 3WOFA 3VYSA 3HRZC 4DR5Q 5CC4A 2HQEA 4DR5L 1IHZA 1NNXA 4DNRB 2SDFA 3L0OA 4C3HG 3DUZA 1K3BC 2IJ0A 4A3FB 1YNJD 1H9MA 3HOWB 1UUPA 3S14B 1KLGD 1IYVA 1BUVT 2L15A 1R9TH 1EYAA 5JJIA 1EZ8A 3BYYB 2HIVA 4LFAQ 5HY6A 1VF5C 1WTWA 2ZTDA 4IUPA 4A3DH 3RZOH 2PZWA 3QJYA 4K5WA 4C2MH 1T9HA 4C3JH 5F2DA 4BY7G 3FMCA 1X3EA 1HHVA 3STBD 1F2MA 1HNWL 1G6ZA 4PZ6A 3NK9A 2CQAA 3SK6A 1TS2A 3J7YW 3RN2A 3W1GA 4LMQD 1PLFA 4LUOA 1XMOL 4JI0L 4WJWA 1BR9A 4DV5L 1YITA 3HKZE 4NB3A 4A76A 1RKNA 3IFTA 2EY6A 2FJ2A 4DV3Q 4JVZA 4G7HC 4EVOA 5IP9H 5CV4A 2WACA 1I94L 4MIUA 4A3EH 2XWJB 4A3MH 3HS0C 3K59A 2D9UA 3MC0B 5JOBA 2CH4A 1H9RA 5JVG3 2UUCQ 4N9TA 2JA5H 4C3JG 1UE7A 1ET9A 1PYBA 1RTNA 2BE5C 5M3FB 2K05A 3I90A 3OMCA 3CCUA 2IX3A 4JK1C 2WB1B 2ZXRA 3DM1A 1PVOA 4ZUIA 2L9HA 2XSCA 2VQFL 5IGBA 4V190 4C56C 1EIGA 3BVMA 3K58A 1KDBA 5JEAG 3HOYB 3S1RB 1YNND 2ID0A 5COYA 2GVBA 3SHLA 3E9IA 1PRTB 2KHJA 2QILA 4XT3B 4BY1B 4EGVA 5IP7H 5J39A 3QG1A 4B3SQ 5M5XH 1FJGQ 2BH2A 1PRTD 4LFCQ 1OXTA 1MSGA 1LTID 3G48A 5G3LF 1B3QA 3HOVH 5GROA 3EJIA 4HCSA 4RMFA 1CKNA 5FJ8H 1XMOQ 3A0JA 4R4CA 3K80C 4KKSA 1NUCA 5KEEA 1Y1WG 2DY7A 1ESFA 4KJNA 4U68A 3MAQA 4KY6A 2K03A 2QDBA 3A56A 3BYTB 4XT1B 3S15B 4Q0FA 1VQIA 1AP0A 2HIXA 3MXUA 4KTAA 2PYKA 1LT4D 5G3LD 1C9OA 1NSNS 2OXPA 1IBKL 4LFCL 2I0QA 1EU4A 3CPFA 4JI3L 2YTXA 1GM5A 5BR8L 1S5FD 1WCMH 1CI3M 4ME5A 4U673 3PF4A 2RSNA 4FF4A 1EU3A 3MXPA 4IUQA 1O80A 2VB2X 4A3DB 5KNDA 1VQOA 1J8IA 1SE8A 1TXYA 1SJHD 3KJOA 4QJFA 2JQOA 3BZDB 4RKLA 4DAYA 2O5JC 5JJLA 4NP5A 1JT8A 1GUNA 4FXGC 1HZAA 1TWCH 4UP8A 4ID6A 4GNXB 2EYOA 1D6EC 4JI1L 2UXBL 1CZGA 1VQ7A 5IWAL 1B53A 1BO0A 4JBKA 4DR4Q 3P20A 2O4XA 4KLKA 3CMAA 3A74A 5M5YH 4LWCA 4A93G 4DU9A 1GUWA 1PH3A 2H5XA 3NPPA 5CV6A 1HFGA 2AQ2B 2B2TC 1DOLA 1L2FA 5IGFA 1EUJA 1PZKD 1ILPA 4DV5Q 2K32A 4KKUA 5FK9C 2VQEL 2E2HB 3R2TA 4DV7Q 1CQVA 2KCNA 3T1HL 1K0SA 1ZKOA 2EY5A 1DM0B 2WB1E 1V1PA 1SEBD 1X54A 4WRDA 1J5EL 2X6LA 1TU2B 3I91A 3SR1A 1AW7A 4JV5L 3MEHA 4JG2A 1E2WA 3VR2A 1EQVA 5ELNA 3KK7A 4X65L 1EQTA 3NUCA 5GAHC 2X69A 4IQZA 4IOAA 1TWHB 3TDQA 3S1QH 3Q8DA 2Z6KC 1OXSC 1DJRD 3H91A 5I2YA 1TIID 2PQAB 3S24A 5HGQA 4GN3B 5M3FG 3ULPA 4B3TQ 3VA7A 2UUAQ 3VYRA 3DWPA 1AE3A 1EYCA 1UNSA 5I2XA 2GVAA 3NP8A 5C3EB 1HA6A 2BOSA 1J6QA 1SYEA 5M9OA 1GHKA 2V4DA 2NVXH 4HJ9A 2B3GA 5J22A 3HKZG 3PUZA 2OF1A 3GQBA 3KJPA 1Z7TA 5CV5A 1QNKA 2EIFA 1RHPA 2BDNA 1OXXK 3C3LA 2C5CA 4DR3Q 1L0YB 4BXXH 2YYZA 3I4MB 1WTRA 1TT2A 4YIJA 1EFWA 3M4OB 2WAQB 3CRLC 3J81j 2N88A 1EFID 5D14A 3WDNA 1STHA 1TWHH 3S1QB 4RH6A 3X3MA 1T5XD 3GTGB 2Y0SE 2NVYB 1VQAA 1AEXA 1LTBD 1IW7C 4QMGA 2E2HH 1F2YA 3HOWG 4BY7B 1RDPD 4HAEA 4IUNA 3IRBA 4R8NA 4DNTB 2F4VQ 3M7NA 2BH8A 2B2UA 1WYDA 4CHTB 4CJ2C 4A3CG 2G9DA 1KAAA 3NQIA 4QIWB 1PRTF 3KF8A 1S40A 3CD6A 2F0TA 4G4KA 1NAPA 2O2LD 5BN5A 1YIJA 2L4NA 1ESRA 1V1OA 3F8TA 2F0MA 1LTLA 3HOUB 4RGMA 2JXMB 5EGTA 2Q8IB 4HTHA 3GTMH 3PIPA 1VS0A 3BVZA 1IYUA 1XMQQ 4BA2I 1Y1VH 5M3MB 3EA6A 3JAME 3S2HH 3QR8A 3PV0A 4CDCC 3KLWA 2JEAI 1B9NA 1SXTA 2IX0A 4OWWB 2JA9A 4HIDA 2LKVA 1STYA 1AFPA 1CM9A 3RZDH 4GOPB 2OCEA 3CHBD 4KK7A 4KN4C 1HQMC 2J7ZA 1H9JA 1Q8KA 1Y8PB 4IOCA 1TR5A 4KHPL 2F0VA 5CV8A 1Q12A 2ZXOA 3AB9A 2IHEA 3TP7A 4R4OA 3AEVA 1PFMA 3CQZB 2ZM6Q 3N52A 1Q90A 1SLJA 2A19A 1KNAA 1PZJD 1MKHA 2EJMA 2G9HD 4OO1H 1NJIC 1YNXA 4I7ZC 2VUMH 5EPJA 4BBSB 1L0WA 1FJGL 4CKBA 5C4XG 5C44B 2F4IA 2Z1CA 3BU2A 1YHAA 4IFDG 1G2TA 1R4PB 1A62A 5ELDA 1H9SA 2MFIA 5IODA 3HFZB 1VCIA 2BA1A 3VDYA 1VQBA 3GTGH 3AU7A 3E0JA 4FP5D 3NTKA 4BY7H 4GLVB 1HH2P 2E2DC 3NEMA 5EKKA 1K8GA 2NVYH 3ERQA 3MWYW 1V43A 3AFQA 1JJCB 3K0YA 1KD1C 1F77A 1I6HH 2A1AA 3U4ZA 3S2HB 1HCZA 2NVQB 4F7XA 1JCKB 2A68C 2GA4B 1I4RA 4OIJA 3DMUA 3G6JB 1IBKQ 3F2CA 4A3MG 3AYHB 2VXWA 3HP3A 2VY3A 1NE3A 1SNCA 1UEAB 1Q86C 2A69D 1DCZA 1U4PA 1TWGB 2Z6KA 2AMCB 3H0GG 4DV6L 3CC2A 2K6AA 2M2LA 1NR4A 4L5QA 3OSOA 1VQ9A 3M4QA 1W3SA 4JCVE 4JV5Q 1I6VC 1BNZA 4R1JA 4X3TA 1U0LA 4MN3A 5D3IB 5DEHA 3UDFA 4EQ5A 4CDFC 4DUYL 2NZOA 1S3OA 3CMEA 1VQMA 4H7BA 3K5LA 4HJ5A 3A8JE 1D8LA 4P71A 4IN3A 5CORA 1CSPA 3D6WA 3TP8A 2MJ8A 3RNUA 1I4QA 4DR7L 1E1OA 3I4NG 3I8ZA 2F0GA 2NN6G 3JAMc 1HZBA 4HJ7A 3I4LA 3F2BA 2UXCQ 1C0AA 1CKMA 3I56A 3AQQA 3NWTA 1KL9A 3CC7A 3PUXA 4IPHA 1OXVA 5K36H 1OXUA 1HNZL 5FLMH 5DLQE 1YJWA 3J80E 1TS3A 1Y8NB 1RTOA 1XNQL 3DM3A 2RDHA 4K5VA 3EROA 2K52A 4GKJL 1JWUD 2O5IC 1EEFD 1HA5A 3ONAB 4RCOA 5KNCA 1EWCA 3R93A 1Y1VG 1MIUA 5A2QE 2F4VL 5DAUA 2RDGA 4K8IA 5E1FA 3H3VH 4CKCA 4PZ8A 1GVPA 1XNRL 4IURA 1XNRQ 1BCPD 3G6EA 1DOMA 3U9OA 1A3TA 3NWSA 3PO2H 3IKJA 1BCPB 3G7LA 1PTOF 4JBMA 2RCNA 2E75C 4XDXA 1KIXA 1L0XB 3DEOA 2JA7H 3DXJC 2Q2TA 3KLSA 1UEBA 2HDLA 2D62A 4DXGA 3GTMB 1TVXA 5C4HA 5M5WH 1STEA 3CCQA 1Y1VB 1E7ZA 3L2PA 4OELB 1SNQA 1C48A 4LF4Q 1B70B 1TWCB 2VUMG 2IX1A 5C6AA 1STBA 2CQOA 4GN5A 2EY2A 3E0EA 4A3JH 1STGA 4NW2A 4Z9CB 3IFDA 1Z47A 1P16A 2K01A 2F0LA 1VQNA 4GKJQ 4OX9L 1G2SA 1SRUA 4M8AA 2NYZD 5ISRA 2N55A 1Q8IA 1SDFA 2L12A 2XIWA 2NB0A 1QJOA 1LTTD 4X3SA 1MJCA 3I4NB 2Q2IA 2KA7A 2EYHA 3GTQH 1EY0A 4X64Q 1I50B 5I9OA 2VS1A 2I5HA 1H9KA 1ZYRD 1PZID 1EY4A 1FL0A 4DV0Q 1JJ2A 4DR6Q 1X65A 5AJ3Q 1MJEA 3FKIG 3S1MB 2C9OA 4POGA 2A8VA 3I55A 4NXMQ 2PO4A 3UDIA 5IY0A 4KD3A 3MHBA 3TSSA 4K2KA 3GTJB 5C5LA 3UE0A 4A4IA 2JA6H 1CHPD 2EDGA 4DR3L 2D0OA 3TZUA 2ZM6L 1VQ8A 4QL5A 1HR0Q 1QWYA 4A3KB 3D4WA 3EN2A 1VQKA 4FVMA 3SK4A 5IWAQ 3CC4A 1G8ZD 4A3GB 1GO3E 2IT1A 3DEPA 1ZXTA 1I4GA 3HOVB 2EYMA 2HUGA 4LFBQ 1IYJB 5C0XI 4R8IA 1PH4A 4QF4A 5M5XB 1N8RC 1X6OA 4BBRB 1I6HB 3J80c 4B3MQ 4BXXG 4O42A 1OO9B 5ELCA 2K7VA 2UXDL 1IXRA 4DR7Q 2E2IH 4ULLA 4BBRG 2EZVA 1DXMA 2XWBB 3TS0A 2F0HA 2EYLA 4YWKA 1M4VA 2WINB 1TKWB 1I94Q 3HOVG 4LF9L 1I5FA 4LF5L 3Q24A 2KJXA 4HCEA 1N33L 1KTKA 1KHIA 4A3KH 2NZHA 1XTCD 3HOXB 4AQYQ 1BVSA 5KYLA 1N34Q 3OHXC 3HEJA 3MXNA 1F9PA 1ENCA 1QVGA 1HNWQ 3PMFA 1BCPF 4AH6A 3S14H 2B63B 4RG1A 1S5ED 3MEFA 1XJVA 2F0IA 1QUQB 5C0XG 5FO7B 1Q81C 3I4NH 2KUMA 5EAYA 4PMBA 2NVTH 3C2PA 4LW1A 1QZHA 4DNIA 1IBLL 1HR0W 2CFMA 4A3JG 3PUVA 1K3RA 4X3UA 5KNBA 1V8QA 3MXGA 1SE4A 4ZKBB 1XMQL 2F03A 4PMCA 3CCJA 4R4IA 1CHQD 2UUBQ 4FO2A 2R93B 1QG7A 3J7AF 4IALA 3EIVA 2QDLA 1WTHA 1A15A 2TMPA 1R9TB 3STBC 1B3AA 1LM0A 4DXFA 2ZTEA 2YU9B 4GKKL 3TEHB 2UUBL 2PMZE 1L1OB 4IPGA 2I5MX 4MTKA 4YCVA 5IT9c 2LMCB 2AUKA 3DWAA 2R92B 1XWEA 4JI6Q 2PQEA 4LF8L 3QOLA 1JWMD 2PW7A 1GKHA 2K5NA 4PMWA 4PQXA 3TBIB 4DK3C 4XYQA 1SMYD 3TS2A 1PA6A 1PMRA 3RN5A 4ZUJA 2Z4HA 1QVFA 4RCNA 1X32A 1PTOD 3PO3G 3MXNB 4OXPA 1VMCA 1II3A 2JA7B 1Q82C 4L5SA 1YVCA 2NVTB 4JI2Q 3GTPB 2X6GA 1D7QA 1PFNA 4KHZA 4P2CB 1EY6A 1VQ6A 2E2IB 4RHSA 3MZ5A 3PO3B 2A6ED 3IAYA 4X64L 2QGQA 5BN4A 1WCMB 1MSHA 2F0JA 4CJ0B 3FHWA 4DR1L 1D2BA 4JI2L 1FGUA 1M1KC 2RVLA 1GHJA 3LWEA 4HIOA 1IBML 4GLAC 4RWSC 4HIKA 1GUSA 1FYCA 1B50A 1C4QA 1KDCA 5C4XH 1TS5A 2NUCA 4DFAA 2HDMA 4BWGB 3E6ZX 5T1GA 2LFNA 4IFDI 4YY3Q 3K8AA 3OTOL 2LXJA 3U4VA 1KQSA 3UI2A 2JA5G 2TSSA 3NXWA 2F0WA 4JOIA 4ALPA 4EX5A 1RF2D 5C3XA 2Z9HA 1CA6A 4JI4L 4JBWA 5IOCA 1U5KA 5ELEA 1AN8A 4BY1H 2B2TA 1Q46A 2JE6I 2VL6A 1CT1D 3K57A 4OGQC 5JEAJ 4DR2L 1K83H 2H4OA 4NPSA 4ODGA 1LT6D 1PYSB 3KDFB 1S5CD 2F3IA 1HJPA 1RCVD 2SNMA 2A74C 4YHHL 4LF5Q 3GD7A 3I73A 1YEZA 2DUDA 1RODA 3VR3A 4B3SL 1UAPA 3H94A 4ME3A 4RKBA 1XPUA 3GDEA 1CSQA 2PNHA 4A3MB 2XRSD 1LTRD 1EYGA 2F0QA 3C46A 1PV4A 1K8MA 1WFQA 1JC7A 3J7AV 2A5HA 2SNSA 3T53B 1ML0D 1GUTA 4DK0A 4O1NA 1Y14B 1YHBA 2HHHQ 2QCPX 1YJ9A 5D65A 3QOJA 3I2ZA 4QQBX 2FXQA 4N8X1 5EJWA 2XVSA 3JAMi 1R4QB 1ENFA 4GNXA 3HOZB 2ENBA 4WJ4A 2NZ1D 3H6MA 2JJQA 1ASYA 1YNJC 4H0LC 1MHWC 4JI3Q 1V9PA 1LO5D 1K9MC 3D8GA 2Z8LA 5C44H 4A3KG 5C44G 1HTLD 2Q2HA 4UP7A 1SNMA 2QW7A 4BBSG 4GOPA 2E5LL 4A3GH 4OWTB 3F1ZA 3D0FA 3F2UA 4FYDA 1F2ZA 2K4KA 2QKIC 3KLRA 1UE1A 4DUZL 5CV7A 4A3BB 1SR3A 3BS1A 2PMZB 1FNVA 2D5DA 1KNEA 1ZEQX 3GP7A 1E2ZA 1YHQA 2R7ZH 3SEBA 3FKIB 3M4YA 4ZCKA 1A2UA 3OOCA 4QY7A 3AFPA 1TY2A 4DPGA 1I4HA 1W6KA 1QCBD 4GN4B 3M7GA 4RA8A 2EY1A 1X3FA 3ICEA 5CR3A 5GADC 4WJ3M 5E3FA 3KF8B 4H44C 2JSOA 4HJ8A 3RD4A 4PV1C 3M3YB 4DR2Q 1LV9A 1Y1WH 4KJOA 4LUZA 4XQNA 3T1YL 1XNQQ 3P7JA 1H95A 2AQ1B 5C4JH 3FRPB 2E76C 1E2VA 3HOUG 5EBDA 3A5ZB 2MPMA 4EQOA 1HNXL 4DF7A 5JJZA 4K6DA 2IW3A 1KRTA 2RSOA 4ZYSA 4X62L 3J81c 4DV1L 1JB3A 4CGYB 2E74C 1KDAA 3I72A 3S1RH 4G7ZC 1J9OA 1T5EA 5M3MG 5KIXA 3QWNA 2R7ZB 5C5MA 2PI2E 1X55A 2K28A 1D1IA 2A6EC 5KRUA 2FHTA 4A3IB 1NMGA 4QUCA 1QILA 5M3FH 4LF4L 4JBJA 3RUZA 4YCUA 5IGGA 4JI5Q 3TP6A 1QB5D 2EVBA 5FLXE 2DY8A 2C35B 5EQ0A 5IT9E 4ILWA 4AIMA 2DNEA 1EWIA 3PQIA 3TREA 4F88A 1P8LA 4XYOA 2K75A 1VQDA 4RHRA 3PGZA 4KMUC 2KECA 2N8NA 3IL8A 4V0BA 1IKLA 1JOKA 2DN8A 3OYYA 2B39A 2PQAA 4TSSA 3HKSA 2R7DA 1WTOA 3CXCA 5GAEC 2F3WA 4A93H 2WAQG 4J15A 3HKZB 2EXDA 4XIGS 1KAWA 4A3LG 1G6PA 2RHQB 2UXCL 2OQ0A 2BCOA 2MHVA 1FVIA 4YWMA 2PPBC 5BN3A 1NR2A 5DNFA 1B7YB 1Q3LA 5IE8A 3FP9A 2F0SA 4LF8Q 3R3OA 2PCFB 1G51A 1CTMA 4GKKQ 2NVXB 4JI1Q 2N49A 1EOTA 3T51B 1EY5A 1LYLA 4XTCS 4HN7A 4QIWE 4JI6L 4OHJA 1A2TA 4C1NI 1N36Q 3D31A 2CHBD 2AKWB 5FKAC 2E2JB 2ICIA 4TVAB 2I07B 2WFWA 1WOCA 2RF4A 1FNWA 4NXNQ 1CQFA 4L8JA 5LMNQ 5IYDH 2EYFA 1VQGA 4C3IG 4P74A 2MNAA 3ER0A 4IJHA 3H15A 1YJNA 1VQPA 1H9SB 4KKTA 3U50C 2JN4A 2F1MA 1LTAD 3A8IE 3V2TA 3OW7A 3RLFA 3UDGA 2FMCA 2K5WA 2YV5A 1WVLA 4JYAQ 3KUPA 2RCFA 2KOLA 3ITPA 2DNCA 4POFA 4UPAA 4WORA 4BBSH 3CF5A 2WIIB 3TRZA 5L37A 4UDUC 1SFOH 3T1YQ 2ZT9C 1VMPA 4S3SA 1U4MA 4OEMB 4IPCA 4A3FH 1QNUA 3RMHA 4DUZQ 1EQQA 5E4WC 5LHY1 1SNDA 1U9RA 1QE6A 3CPWA 5C0XH 4LFAL 2Q8TA 1M90C 2A68D 1FD7D 2OWOA 2MO0A 4A93B 3K0XA 1EEID 2F0EA 1EOVA 5M5WB 3KBGA 2R93H 5HURA 1I3QB 5E7NA 4RAUC 4GNXC 1VQ5A 4ZRZA 3TMEA 1EWHA 3BDLA 1SROA 2D2CC 4N9PA 2F0DA 3MVVA 5FO9B 4B3ML 3AMUA 1HZ9A 2K04A 1PH8A 2CWAA 1I4XA 4PNYA 4ZK9B 1BBXC 4OO1I 2YTVA 1FGBD 1HNXQ 3ZYYX 4DV4L 1BXTA 4A3DG 2DJGC 5E4XA 3MFGA 1VQHA 1G291 1C8CA 5C3WA 4NKLA 1GOZA 4L6TB 4DK6C 2UUCL 3FPUB 1DZ1A 4DN4M 3SK5A 4DK1A 1L1OC 4E6IA 3S1NH 4C3HH 1O7IA 4DV6Q 1S4ZA 4F8MA 1E24A 2WKDA 2PZUA 2LSSA 2OTJA 1LT5D 1VDZA 5AJ3L 4IFDH 3GV3A 3FVQA 2K14A 1QUQA 3VYTA 5EKIA 1TWAB 2J4XA 1B4OA 3WOEA 1Y1WB 4BY1G 5ELBA 5A35A 1K28A 3CW2C 3KOJA 3PUYA 3Q6SA 2B2VA 4C3IB 1GUOA 1K8OA 1K8AC 5C4ZA 4JW0A 2CW0D 3M4OH 3K7AB 3I4OA 3CCMA 4OO1G 1F9QA 4JC0A 1BOSA 4OL7A 4JI4Q 2E5LQ 1HXYD 3SVMA 1ICFB 4TRDA 1XYIA 3A54A 2JP1A 1M8AA 2EYJA 4BS9A 2MO1A 5NUCA 1TWFB 3HOZH 4IO9A 4C3JB 4OX9Q 2E2JH
chains in the Genus database with same CATH topology
4AYBE 2K50A 1N9WA 4B3RQ 2GVAA 3STBC 1LM0A 3CD6A 5LMUQ 2ZTEA 4A3LH 4K0KQ 5IP7G 4GKKL 5IP9G 1J6QA 3TEHB 2UUBL 2PMZE 1L1OB 4IPGA 2I5MX 4YWLA 4YCVA 5IT9c 1KXLA 4JI6Q 4LF8L 2RHSB 1KC8C 2NVXH 1RIPA 1X9NA 4HJ9A 4YCWA 2ASBA 1GKHA 2K5NA 2OTLA 4PMWA 3GTJH 3J81i 3KFUA 4DK3C 2KCMA 2B3GA 4HJAA 1KRSA 3HKZG 3WWVA 3PUZA 1PA6A 3TS2A 3RN5A 3ERSX 4DV3L 3KJPA 2Q2UA 1QVFA 1GD7A 4GLXA 3PO3G 1A63A 3MXNB 3RLNA 4OXPA 4APVA 1PH2A 1J5EQ 1IBMQ 4IPDA 2WAQE 3GO5A 2EIFA 4YY3L 3OTOQ 1A8VA 1Q82C 1YVCA 4L5SA 1OXXK 3U58A 1VQ4A 4AYBG 4DR3Q 1SMXA 4JI2Q 5IYBG 2YYZA 4BXXH 2HHHL 4OONA 3EBEA 4JI0Q 1D7QA 1EFWA 4L5RC 3E9HA 4KHZA 3J81j 1S72A 1PH5A 4X6AH 1VQ6A 1TWHH 2I5LX 4A3EG 2VNUD 3KF6A 4X64L 3I4MH 2QGQA 4YHHQ 2Y0SE 2QA4A 3LGJA 3W5OA 1VQAA 1AE2A 5IYCG 5H1SE 3FHWA 1YBYA 4P72A 4DR1L 2E2HH 2JEBI 2HT1A 4JI2L 2CWPA 4A3IG 3HOWG 1FGUA 1M1KC 4LF7L 4FDBA 4HIMA 3I4MG 2V1CC 3IRBA 3L7ZC 4HIOA 2F4VQ 3M7NA 2BH8A 2KENA 4LF9Q 4JYAL 1WYDA 1NTGA 4GLAC 1IBML 4A3CG 4UY8C 4HIKA 1EIFA 1HNZQ 4JI5L 1B8AA 2OQKA 1S40A 1EIYB 5C4XH 5C3EG 1IZ6A 2ZJQA 3K7UC 1YIJA 2JA6G 4K0KL 3CCVA 5LMUL 4PG3A 2XGTA 2KHIA 3F8TA 3J7ZC 5GQOA 1PHJA 4IFDI 4YY3Q 3K8AA 3OTOL 2N3SA 1LTLA 5LMNL 2HQLA 2LXJA 3U4VA 4R4TA 3J80i 4A3FG 1KQSA 3GTMH 3PIPA 4GOPC 2JA5G 2Y0SG 3S1MH 1VS0A 4JOIA 4ALPA 2VW9A 4EX5A 3K7AH 1XMQQ 4JI4L 1XPOA 1YZ6A 4JBWA 4BA2I 2KBNA 1U5KA 1Y1VH 4B3RL 3T1HQ 4BY1H 3S17H 3S2HH 1UE6A 4P75A 1Q46A 2JE6I 3PV0A 4X66Q 1UE5A 2YTYA 3KLWA 4O0AA 2JEAI 5JJKA 2VL6A 2IX0A 4OWWB 2JA9A 3JC66 4HIDA 2R93G 2AWOA 4A3CH 4DR2L 5JEAJ 2LXKA 3CCSA 4GOPB 2OCEA 3RZDH 1K83H 4KI0A 5M3MH 4NXML 3M4PA 1TWAH 2Z0SA 1A0IA 1JB7A 4NPSA 2ALYB 4A3MG 1XPRA 1PYSB 3RLOA 3KDFB 2CCZA 1Q8KA 1N32L 2AHOB 4IOCA 4DR1Q 2F3IA 1HJPA 4R4QA 3B6YA 2UU9Q 2B63G 4KHPL 1YI2A 4YHHL 2ES2A 3S2DH 3BZCA 4LF5Q 1OTCA 2JK8A 1Q12A 3GD7A 3ULJA 4DAYB 1YEZA 4LF6Q 2IHEA 2DUDA 1QZGA 3GTOH 4R4OA 2WP8J 3AEVA 3KF6B 4B3SL 2ZM6Q 4LF7Q 3HOUH 4ME3A 4A3BG 1SLJA 1XPUA 2A19A 3GDEA 1CSQA 2PNHA 1MKHA 1N32Q 3H3VI 1PFSA 2PI2A 3NBHB 4L5TA 1NJIC 1TWGH 1TWFH 1EYGA 1YNXA 1VQEA 2D0PA 2VUMH 1PH7A 4LUVA 1PV4A 4O2DA 4IFDJ 1L0WA 4A75A 1PH9A 1FJGL 1WFQA 5C3EH 5C4XG 1JE5A 1K0RA 4A3IH 4DV7L 3BU2A 1YHAA 2F52A 4DR4L 5BR8Q 1Y14B 1YHBA 2HHHQ 4IFDG 1A62A 1YJ9A 4UP9A 3RR5A 1K73C 1VQLA 2MFIA 3I2ZA 1WJJA 1BKBA 3HFZB 1VCIA 2BA1A 3VDYA 1VQBA 3GTGH 1L1OA 2FXQA 4QQBX 4LNQA 3JAMi 1C7YA 1X3GA 2R6GA 1SN8A 4GNXA 4WJ4A 5IYCH 3OW2A 4BY7H 4DV4Q 4GLVB 1EQRA 1HH2P 2QEXA 2JJQA 4X66L 1ASYA 3NEMA 4P73A 4JI3Q 3PSIA 1V9PA 3CCRA 2R7FA 2NVYH 1K8GA 1BBWA 5J3BA 2ZJRA 1K9MC 4X65Q 1IBLQ 4A3GG 1V43A 3AFQA 1JJCB 1NY4A 1CKOA 1KD1C 5C44H 3PF5A 4A3KG 2VQFQ 5C44G 2A1AA 2Q2HA 4UP7A 3U4ZA 2F4VL 1I6HH 4BBSG 4GOPA 2E5LL 1XTDA 4Y7NH 1JJGA 4A3GH 4OWTB 2UXDQ 3F1ZA 3D0FA 1IBKQ 3F2CA 3KDFA 2K4KA 3AYHB 5FLMG 2VQEQ 1DGSA 1UE1A 2VY3A 2ZJPA 1NE3A 4DUZL 2UUAL 2YU9H 1Q1EA 1Q86C 1SR3A 2IY5B 3TQYA 2Z6KA 1YHQA 2AMCB 2R7ZH 3J7A5 3H0GG 4DV6L 3CC2A 2XTIA 4L5QA 5FLXc 3HOXH 1PH6A 4QY7A 3AFPA 4DPGA 3G71A 3M4QA 1ASZA 1VQ9A 3S16H 1W3SA 3SGIA 4JCVE 3ULLA 2VZAA 3GTLH 4GN4B 1WI5A 4JV5Q 1N33Q 2UXBQ 4R1JA 1X3FA 3BZKA 3M9BA 3NENA 3CCLA 3CCEA 3ICEA 1U0LA 5GADC 5IYDG 1HR0L 4GS3A 3PO2G 3CQZH 3KF8B 4HJ8A 1N34L 4WJ3M 1QVCA 3UDFA 4EQ5A 5C0XJ 4JOIC 4DUYL 2E8GA 2NZOA 4JI8Q 1S3OA 2B29A 4DR2Q 3CMEA 3HOYG 1N36L 1Y1WH 1VQMA 4LUZA 4QGUA 3T1YL 1XNQQ 4HJ5A 1H95A 1D8LA 4P71A 1V1QA 1VQJA 5C4JH 4X62Q 4DV1Q 3A5UA 4JI7L 1CSPA 2IHFA 1JMCA 3RNUA 3HOYH 1Q7YC 4DV2Q 3HOUG 2WB1G 3A5ZB 2B63H 4DV0L 3G4SA 2MQHA 1HNXL 4DR7L 3UE1A 1E1OA 3I4NG 1KRTA 3J81c 2NN6G 3PUWA 4X62L 1HZBA 3JAMc 4MNOA 4DV1L 4HJ7A 4OX9Q 3F2BA 2UXCQ 1C0AA 1RL2A 2AWNA 3S1RH 3DLLA 1CKMA 3I56A 3AQQA 2ZTCA 2ATWA 5M3MG 2JA8G 2JA8H 4H02A 1KL9A 3CC7A 3PUXA 4DR5Q 4IPHA 1OXVA 4DR5L 1JJ2A 2PI2E 1X55A 1OXUA 1HNZL 2N78A 3L0OA 5FLMH 5DLQE 1YJWA 1NMGA 1XNQL 3DM3A 1AH9A 5M3FH 4LF4L 4BA1I 2K52A 4JBJA 4GKJL 4YCUA 2L15A 4JI5Q 1UWVA 1R9TH 5JJIA 2C35B 2NVQH 1Y1VG 1MIUA 4AIMA 2HIVA 4LFAQ 2BA0A 5HY6A 4BBRH 4TQUS 3M85A 4DAMA 2ZTDA 4JI7Q 4A3DH 1EWIA 3TREA 3RZOH 3H3VH 4PZ8A 1T9HA 3UDXA 4C2MH 1P8LA 4C3JH 1GVPA 1XNRL 2K75A 2UU9L 1XNRQ 1VQDA 3G6EA 4BY7G 3PGZA 1CUKA 1CKNB 1X3EA 4IJLA 2N8NA 3STBD 3PO2H 1HNWL 4PZ6A 1E1TA 1WCMG 3OYYA 3RN2A 3GTPH 2PQAA 3W1GA 4JBMA 2RCNA 3HKSA 5K36G 2R7DA 4LUOA 1XMOL 4JI0L 3CXCA 1KIXA 5GAEC 4A93H 4DV5L 1YITA 2WAQG 4J15A 4DR6L 2EXDA 3HKZE 4NB3A 4A76A 2JA7H 4XIGS 1KAWA 4A3LG 4DV3Q 2Q2TA 1G6PA 2RHQB 5IP9H 1UEBA 2UXCL 2OQ0A 1I94L 1FVIA 1Q1BA 2D62A 4A3EH 4YWMA 5M5WH 4A3MH 2K5HA 2R7ZG 2JA7G 1B7YB 5IE8A 1BBUA 3FP9A 3CCQA 3CAMA 1E7ZA 3L2PA 4DV2L 4AQYL 2UUCQ 4LF8Q 1Z9FA 2JA5H 1G51A 1UE7A 4GKKQ 4LF4Q 1B70B 1PYBA 4JI1Q 1E3PA 2N49A 4A3BH 3CP0A 2GN5A 2IX1A 4XTCS 1LYLA 2VUMG 4QIWE 4JI6L 3CCUA 2CQOA 4GN5A 3E0EA 1N36Q 4A3JH 3D31A 2AKWB 4OWXB 1PVOA 3FKIH 4TVAB 1Z47A 2KCTA 4BBSH 1VQFA 3GTKH 1P16A 2R92G 2WFWA 2VQFL 1WOCA 4Y52H 2RF4A 4NXNQ 1VQNA 4GKJQ 4OX9L 1SRUA 3BJUA 3KYHC 5LMNQ 5IYDH 1VQGA 5JEAG 4P74A 2MNAA 2ID0A 3ER0A 2GVBA 4IJHA 3H15A 1YJNA 1VQPA 3H0GH 3E9IA 1MJCA 4DUYQ 2Q2IA 2KHJA 3U50C 4LFBL 3NELA 3GTQH 5IP7H 4B3SQ 2K5VA 3RLFA 5M5XH 4X64Q 1FJGQ 2VS1A 3UDGA 2BH2A 4LFCQ 2I5HA 2YV5A 4JYAQ 1OXTA 3G48A 1X56A 3HOVH 5GROA 4POFA 4UPAA 1FL0A 4PZ7A 3CF5A 4DV0Q 1X65A 4RMFA 1CKNA 5FJ8H 5AJ3Q 1XMOQ 1MJEA 3A0JA 3TRZA 4R4CA 2CKZB 3FKIG 3K80C 4POGA 2A8VA 2R92H 3I55A 1W2BA 4NXMQ 1Y1WG 1SFOH 2DGYA 3T1YQ 3S15H 3UDIA 5IY0A 3PIOA 4IPCA 3UE0A 4A4IA 4A3FH 4DUZQ 2JA6H 4JI8L 1EQQA 4DR3L 2D0OA 2ZM6L 1VQ8A 4QL5A 3CPWA 1HR0Q 4LFAL 1M90C 1HZCA 1VQIA 2OWOA 2MO0A 3EN2A 1VQKA 3K0XA 5IWAQ 3CC4A 1EOVA 2HIXA 1GO3E 2IT1A 2R93H 3HOXG 1C9OA 1NBWA 1IBKL 4LFCL 2I0QA 3CPFA 5E7NA 4NXNL 4GNXC 1VQ5A 4JI3L 2YTXA 1LUZA 1GM5A 5BR8L 1SROA 1WCMH 3HOZG 4LFBQ 3PF4A 2NN6I 1IYJB 5C0XI 1PH4A 1N8RC 1X6OA 4C3IH 1VQOA 1SE8A 3J80c 4B3ML 1TXYA 5IYBH 1HZ9A 4B3MQ 4BXXG 3KJOA 4QJFA 1PH8A 2CWAA 4OO1I 2JQOA 2UXDL 2YTVA 5ELOA 1IXRA 5LMNW 1HNXQ 2E2IH 4DR7Q 4B3TL 4BBRG 4DV4L 5JJLA 1JT8A 2EQSA 5GAGC 4A3DG 3TS0A 1HZAA 1TWCH 4YWKA 4UP8A 4GNXB 1I94Q 3HOVG 4LF9L 1I5FA 4JI1L 1VQHA 4LF5L 1G291 3F2DA 1N33L 2UXBL 1KHIA 4A3KH 1NMFA 2NZHA 1VQ7A 5FJ8G 5IWAL 4DK6C 4JBKA 4DR4Q 4AQYQ 2UUCL 3HOWH 1BVSA 3K81C 4KLKA 3CMAA 4DR6Q 1L1OC 1N34Q 3A74A 5M5YH 3S1NH 4C3HH 1E22A 1O7IA 4LWCA 4DKAC 4DV6Q 1QVGA 4LF6L 4A93G 1HNWQ 1PH3A 2H5XA 4AH6A 3S14H 1E24A 4RG1A 2LSSA 4KHPQ 1L2FA 2OTJA 3MEFA 1EUJA 5AJ3L 4DV5Q 1XJVA 2VQEL 2K14A 1QUQA 4DV7Q 1QUQB 5C0XG 3T1HL 1Q81C 1VQCA 2WB1E 4BY1G 1X54A 3I4NH 1J5EL 5EAYA 3CW2C 3KOJA 2NVTH 4JV5L 3PUYA 4MZ9A 4LW1A 1I50H 1QZHA 4DNIA 4JG2A 4MTNA 4X65L 5ELNA 1IBLL 1K8AC 1HR0W 2CFMA 4A3JG 3M4OH 3I7FA 3ZJYC 3PUVA 3I4OA 5GAHC 3CCMA 1PH1A 1K3RA 4OO1G 4JC0A 1XMQL 4JI4Q 4IOAA 3PO3H 2E5LQ 3S1QH 3Q8DA 2Z6KC 1IL2A 1OXSC 3CCJA 1I3QH 4R4IA 2PQAB 3W1BA 3S24A 5HGQA 4GN3B 2UUBQ 5M3FG 3ULPA 4B3TQ 2UUAQ 2MO1A 3HOZH 3M3YH 4IO9A 3EIVA 3PCOB 1AE3A 2E2JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB E;  2K50 A;  1N9W A;  4B3R Q;  2GVA A;  3STB C;  1LM0 A;  3CD6 A;  5LMU Q;  2ZTE A;  4A3L H;  4K0K Q;  5IP7 G;  4GKK L;  5IP9 G;  1J6Q A;  3TEH B;  2UUB L;  2PMZ E;  1L1O B;  4IPG A;  2I5M X;  4YWL A;  4YCV A;  5IT9 c;  1KXL A;  4JI6 Q;  4LF8 L;  2RHS B;  1KC8 C;  2NVX H;  1RIP A;  1X9N A;  4HJ9 A;  4YCW A;  2ASB A;  1GKH A;  2K5N A;  2OTL A;  4PMW A;  3GTJ H;  3J81 i;  3KFU A;  4DK3 C;  2KCM A;  2B3G A;  4HJA A;  1KRS A;  3HKZ G;  3WWV A;  3PUZ A;  1PA6 A;  3TS2 A;  3RN5 A;  3ERS X;  4DV3 L;  3KJP A;  2Q2U A;  1QVF A;  1GD7 A;  4GLX A;  3PO3 G;  1A63 A;  3MXN B;  3RLN A;  4OXP A;  4APV A;  1PH2 A;  1J5E Q;  1IBM Q;  4IPD A;  2WAQ E;  3GO5 A;  2EIF A;  4YY3 L;  3OTO Q;  1A8V A;  1Q82 C;  1YVC A;  4L5S A;  1OXX K;  3U58 A;  1VQ4 A;  4AYB G;  4DR3 Q;  1SMX A;  4JI2 Q;  5IYB G;  2YYZ A;  4BXX H;  2HHH L;  4OON A;  3EBE A;  4JI0 Q;  1D7Q A;  1EFW A;  4L5R C;  3E9H A;  4KHZ A;  3J81 j;  1S72 A;  1PH5 A;  4X6A H;  1VQ6 A;  1TWH H;  2I5L X;  4A3E G;  2VNU D;  3KF6 A;  4X64 L;  3I4M H;  2QGQ A;  4YHH Q;  2Y0S E;  2QA4 A;  3LGJ A;  3W5O A;  1VQA A;  1AE2 A;  5IYC G;  5H1S E;  3FHW A;  1YBY A;  4P72 A;  4DR1 L;  2E2H H;  2JEB I;  2HT1 A;  4JI2 L;  2CWP A;  4A3I G;  3HOW G;  1FGU A;  1M1K C;  4LF7 L;  4FDB A;  4HIM A;  3I4M G;  2V1C C;  3IRB A;  3L7Z C;  4HIO A;  2F4V Q;  3M7N A;  2BH8 A;  2KEN A;  4LF9 Q;  4JYA L;  1WYD A;  1NTG A;  4GLA C;  1IBM L;  4A3C G;  4UY8 C;  4HIK A;  1EIF A;  1HNZ Q;  4JI5 L;  1B8A A;  2OQK A;  1S40 A;  1EIY B;  5C4X H;  5C3E G;  1IZ6 A;  2ZJQ A;  3K7U C;  1YIJ A;  2JA6 G;  4K0K L;  3CCV A;  5LMU L;  4PG3 A;  2XGT A;  2KHI A;  3F8T A;  3J7Z C;  5GQO A;  1PHJ A;  4IFD I;  4YY3 Q;  3K8A A;  3OTO L;  2N3S A;  1LTL A;  5LMN L;  2HQL A;  2LXJ A;  3U4V A;  4R4T A;  3J80 i;  4A3F G;  1KQS A;  3GTM H;  3PIP A;  4GOP C;  2JA5 G;  2Y0S G;  3S1M H;  1VS0 A;  4JOI A;  4ALP A;  2VW9 A;  4EX5 A;  3K7A H;  1XMQ Q;  4JI4 L;  1XPO A;  1YZ6 A;  4JBW A;  4BA2 I;  2KBN A;  1U5K A;  1Y1V H;  4B3R L;  3T1H Q;  4BY1 H;  3S17 H;  3S2H H;  1UE6 A;  4P75 A;  1Q46 A;  2JE6 I;  3PV0 A;  4X66 Q;  1UE5 A;  2YTY A;  3KLW A;  4O0A A;  2JEA I;  5JJK A;  2VL6 A;  2IX0 A;  4OWW B;  2JA9 A;  3JC6 6;  4HID A;  2R93 G;  2AWO A;  4A3C H;  4DR2 L;  5JEA J;  2LXK A;  3CCS A;  4GOP B;  2OCE A;  3RZD H;  1K83 H;  4KI0 A;  5M3M H;  4NXM L;  3M4P A;  1TWA H;  2Z0S A;  1A0I A;  1JB7 A;  4NPS A;  2ALY B;  4A3M G;  1XPR A;  1PYS B;  3RLO A;  3KDF B;  2CCZ A;  1Q8K A;  1N32 L;  2AHO B;  4IOC A;  4DR1 Q;  2F3I A;  1HJP A;  4R4Q A;  3B6Y A;  2UU9 Q;  2B63 G;  4KHP L;  1YI2 A;  4YHH L;  2ES2 A;  3S2D H;  3BZC A;  4LF5 Q;  1OTC A;  2JK8 A;  1Q12 A;  3GD7 A;  3ULJ A;  4DAY B;  1YEZ A;  4LF6 Q;  2IHE A;  2DUD A;  1QZG A;  3GTO H;  4R4O A;  2WP8 J;  3AEV A;  3KF6 B;  4B3S L;  2ZM6 Q;  4LF7 Q;  3HOU H;  4ME3 A;  4A3B G;  1SLJ A;  1XPU A;  2A19 A;  3GDE A;  1CSQ A;  2PNH A;  1MKH A;  1N32 Q;  3H3V I;  1PFS A;  2PI2 A;  3NBH B;  4L5T A;  1NJI C;  1TWG H;  1TWF H;  1EYG A;  1YNX A;  1VQE A;  2D0P A;  2VUM H;  1PH7 A;  4LUV A;  1PV4 A;  4O2D A;  4IFD J;  1L0W A;  4A75 A;  1PH9 A;  1FJG L;  1WFQ A;  5C3E H;  5C4X G;  1JE5 A;  1K0R A;  4A3I H;  4DV7 L;  3BU2 A;  1YHA A;  2F52 A;  4DR4 L;  5BR8 Q;  1Y14 B;  1YHB A;  2HHH Q;  4IFD G;  1A62 A;  1YJ9 A;  4UP9 A;  3RR5 A;  1K73 C;  1VQL A;  2MFI A;  3I2Z A;  1WJJ A;  1BKB A;  3HFZ B;  1VCI A;  2BA1 A;  3VDY A;  1VQB A;  3GTG H;  1L1O A;  2FXQ A;  4QQB X;  4LNQ A;  3JAM i;  1C7Y A;  1X3G A;  2R6G A;  1SN8 A;  4GNX A;  4WJ4 A;  5IYC H;  3OW2 A;  4BY7 H;  4DV4 Q;  4GLV B;  1EQR A;  1HH2 P;  2QEX A;  2JJQ A;  4X66 L;  1ASY A;  3NEM A;  4P73 A;  4JI3 Q;  3PSI A;  1V9P A;  3CCR A;  2R7F A;  2NVY H;  1K8G A;  1BBW A;  5J3B A;  2ZJR A;  1K9M C;  4X65 Q;  1IBL Q;  4A3G G;  1V43 A;  3AFQ A;  1JJC B;  1NY4 A;  1CKO A;  1KD1 C;  5C44 H;  3PF5 A;  4A3K G;  2VQF Q;  5C44 G;  2A1A A;  2Q2H A;  4UP7 A;  3U4Z A;  2F4V L;  1I6H H;  4BBS G;  4GOP A;  2E5L L;  1XTD A;  4Y7N H;  1JJG A;  4A3G H;  4OWT B;  2UXD Q;  3F1Z A;  3D0F A;  1IBK Q;  3F2C A;  3KDF A;  2K4K A;  3AYH B;  5FLM G;  2VQE Q;  1DGS A;  1UE1 A;  2VY3 A;  2ZJP A;  1NE3 A;  4DUZ L;  2UUA L;  2YU9 H;  1Q1E A;  1Q86 C;  1SR3 A;  2IY5 B;  3TQY A;  2Z6K A;  1YHQ A;  2AMC B;  2R7Z H;  3J7A 5;  3H0G G;  4DV6 L;  3CC2 A;  2XTI A;  4L5Q A;  5FLX c;  3HOX H;  1PH6 A;  4QY7 A;  3AFP A;  4DPG A;  3G71 A;  3M4Q A;  1ASZ A;  1VQ9 A;  3S16 H;  1W3S A;  3SGI A;  4JCV E;  3ULL A;  2VZA A;  3GTL H;  4GN4 B;  1WI5 A;  4JV5 Q;  1N33 Q;  2UXB Q;  4R1J A;  1X3F A;  3BZK A;  3M9B A;  3NEN A;  3CCL A;  3CCE A;  3ICE A;  1U0L A;  5GAD C;  5IYD G;  1HR0 L;  4GS3 A;  3PO2 G;  3CQZ H;  3KF8 B;  4HJ8 A;  1N34 L;  4WJ3 M;  1QVC A;  3UDF A;  4EQ5 A;  5C0X J;  4JOI C;  4DUY L;  2E8G A;  2NZO A;  4JI8 Q;  1S3O A;  2B29 A;  4DR2 Q;  3CME A;  3HOY G;  1N36 L;  1Y1W H;  1VQM A;  4LUZ A;  4QGU A;  3T1Y L;  1XNQ Q;  4HJ5 A;  1H95 A;  1D8L A;  4P71 A;  1V1Q A;  1VQJ A;  5C4J H;  4X62 Q;  4DV1 Q;  3A5U A;  4JI7 L;  1CSP A;  2IHF A;  1JMC A;  3RNU A;  3HOY H;  1Q7Y C;  4DV2 Q;  3HOU G;  2WB1 G;  3A5Z B;  2B63 H;  4DV0 L;  3G4S A;  2MQH A;  1HNX L;  4DR7 L;  3UE1 A;  1E1O A;  3I4N G;  1KRT A;  3J81 c;  2NN6 G;  3PUW A;  4X62 L;  1HZB A;  3JAM c;  4MNO A;  4DV1 L;  4HJ7 A;  4OX9 Q;  3F2B A;  2UXC Q;  1C0A A;  1RL2 A;  2AWN A;  3S1R H;  3DLL A;  1CKM A;  3I56 A;  3AQQ A;  2ZTC A;  2ATW A;  5M3M G;  2JA8 G;  2JA8 H;  4H02 A;  1KL9 A;  3CC7 A;  3PUX A;  4DR5 Q;  4IPH A;  1OXV A;  4DR5 L;  1JJ2 A;  2PI2 E;  1X55 A;  1OXU A;  1HNZ L;  2N78 A;  3L0O A;  5FLM H;  5DLQ E;  1YJW A;  1NMG A;  1XNQ L;  3DM3 A;  1AH9 A;  5M3F H;  4LF4 L;  4BA1 I;  2K52 A;  4JBJ A;  4GKJ L;  4YCU A;  2L15 A;  4JI5 Q;  1UWV A;  1R9T H;  5JJI A;  2C35 B;  2NVQ H;  1Y1V G;  1MIU A;  4AIM A;  2HIV A;  4LFA Q;  2BA0 A;  5HY6 A;  4BBR H;  4TQU S;  3M85 A;  4DAM A;  2ZTD A;  4JI7 Q;  4A3D H;  1EWI A;  3TRE A;  3RZO H;  3H3V H;  4PZ8 A;  1T9H A;  3UDX A;  4C2M H;  1P8L A;  4C3J H;  1GVP A;  1XNR L;  2K75 A;  2UU9 L;  1XNR Q;  1VQD A;  3G6E A;  4BY7 G;  3PGZ A;  1CUK A;  1CKN B;  1X3E A;  4IJL A;  2N8N A;  3STB D;  3PO2 H;  1HNW L;  4PZ6 A;  1E1T A;  1WCM G;  3OYY A;  3RN2 A;  3GTP H;  2PQA A;  3W1G A;  4JBM A;  2RCN A;  3HKS A;  5K36 G;  2R7D A;  4LUO A;  1XMO L;  4JI0 L;  3CXC A;  1KIX A;  5GAE C;  4A93 H;  4DV5 L;  1YIT A;  2WAQ G;  4J15 A;  4DR6 L;  2EXD A;  3HKZ E;  4NB3 A;  4A76 A;  2JA7 H;  4XIG S;  1KAW A;  4A3L G;  4DV3 Q;  2Q2T A;  1G6P A;  2RHQ B;  5IP9 H;  1UEB A;  2UXC L;  2OQ0 A;  1I94 L;  1FVI A;  1Q1B A;  2D62 A;  4A3E H;  4YWM A;  5M5W H;  4A3M H;  2K5H A;  2R7Z G;  2JA7 G;  1B7Y B;  5IE8 A;  1BBU A;  3FP9 A;  3CCQ A;  3CAM A;  1E7Z A;  3L2P A;  4DV2 L;  4AQY L;  2UUC Q;  4LF8 Q;  1Z9F A;  2JA5 H;  1G51 A;  1UE7 A;  4GKK Q;  4LF4 Q;  1B70 B;  1PYB A;  4JI1 Q;  1E3P A;  2N49 A;  4A3B H;  3CP0 A;  2GN5 A;  2IX1 A;  4XTC S;  1LYL A;  2VUM G;  4QIW E;  4JI6 L;  3CCU A;  2CQO A;  4GN5 A;  3E0E A;  1N36 Q;  4A3J H;  3D31 A;  2AKW B;  4OWX B;  1PVO A;  3FKI H;  4TVA B;  1Z47 A;  2KCT A;  4BBS H;  1VQF A;  3GTK H;  1P16 A;  2R92 G;  2WFW A;  2VQF L;  1WOC A;  4Y52 H;  2RF4 A;  4NXN Q;  1VQN A;  4GKJ Q;  4OX9 L;  1SRU A;  3BJU A;  3KYH C;  5LMN Q;  5IYD H;  1VQG A;  5JEA G;  4P74 A;  2MNA A;  2ID0 A;  3ER0 A;  2GVB A;  4IJH A;  3H15 A;  1YJN A;  1VQP A;  3H0G H;  3E9I A;  1MJC A;  4DUY Q;  2Q2I A;  2KHJ A;  3U50 C;  4LFB L;  3NEL A;  3GTQ H;  5IP7 H;  4B3S Q;  2K5V A;  3RLF A;  5M5X H;  4X64 Q;  1FJG Q;  2VS1 A;  3UDG A;  2BH2 A;  4LFC Q;  2I5H A;  2YV5 A;  4JYA Q;  1OXT A;  3G48 A;  1X56 A;  3HOV H;  5GRO A;  4POF A;  4UPA A;  1FL0 A;  4PZ7 A;  3CF5 A;  4DV0 Q;  1X65 A;  4RMF A;  1CKN A;  5FJ8 H;  5AJ3 Q;  1XMO Q;  1MJE A;  3A0J A;  3TRZ A;  4R4C A;  2CKZ B;  3FKI G;  3K80 C;  4POG A;  2A8V A;  2R92 H;  3I55 A;  1W2B A;  4NXM Q;  1Y1W G;  1SFO H;  2DGY A;  3T1Y Q;  3S15 H;  3UDI A;  5IY0 A;  3PIO A;  4IPC A;  3UE0 A;  4A4I A;  4A3F H;  4DUZ Q;  2JA6 H;  4JI8 L;  1EQQ A;  4DR3 L;  2D0O A;  2ZM6 L;  1VQ8 A;  4QL5 A;  3CPW A;  1HR0 Q;  4LFA L;  1M90 C;  1HZC A;  1VQI A;  2OWO A;  2MO0 A;  3EN2 A;  1VQK A;  3K0X A;  5IWA Q;  3CC4 A;  1EOV A;  2HIX A;  1GO3 E;  2IT1 A;  2R93 H;  3HOX G;  1C9O A;  1NBW A;  1IBK L;  4LFC L;  2I0Q A;  3CPF A;  5E7N A;  4NXN L;  4GNX C;  1VQ5 A;  4JI3 L;  2YTX A;  1LUZ A;  1GM5 A;  5BR8 L;  1SRO A;  1WCM H;  3HOZ G;  4LFB Q;  3PF4 A;  2NN6 I;  1IYJ B;  5C0X I;  1PH4 A;  1N8R C;  1X6O A;  4C3I H;  1VQO A;  1SE8 A;  3J80 c;  4B3M L;  1TXY A;  5IYB H;  1HZ9 A;  4B3M Q;  4BXX G;  3KJO A;  4QJF A;  1PH8 A;  2CWA A;  4OO1 I;  2JQO A;  2UXD L;  2YTV A;  5ELO A;  1IXR A;  5LMN W;  1HNX Q;  2E2I H;  4DR7 Q;  4B3T L;  4BBR G;  4DV4 L;  5JJL A;  1JT8 A;  2EQS A;  5GAG C;  4A3D G;  3TS0 A;  1HZA A;  1TWC H;  4YWK A;  4UP8 A;  4GNX B;  1I94 Q;  3HOV G;  4LF9 L;  1I5F A;  4JI1 L;  1VQH A;  4LF5 L;  1G29 1;  3F2D A;  1N33 L;  2UXB L;  1KHI A;  4A3K H;  1NMF A;  2NZH A;  1VQ7 A;  5FJ8 G;  5IWA L;  4DK6 C;  4JBK A;  4DR4 Q;  4AQY Q;  2UUC L;  3HOW H;  1BVS A;  3K81 C;  4KLK A;  3CMA A;  4DR6 Q;  1L1O C;  1N34 Q;  3A74 A;  5M5Y H;  3S1N H;  4C3H H;  1E22 A;  1O7I A;  4LWC A;  4DKA C;  4DV6 Q;  1QVG A;  4LF6 L;  4A93 G;  1HNW Q;  1PH3 A;  2H5X A;  4AH6 A;  3S14 H;  1E24 A;  4RG1 A;  2LSS A;  4KHP Q;  1L2F A;  2OTJ A;  3MEF A;  1EUJ A;  5AJ3 L;  4DV5 Q;  1XJV A;  2VQE L;  2K14 A;  1QUQ A;  4DV7 Q;  1QUQ B;  5C0X G;  3T1H L;  1Q81 C;  1VQC A;  2WB1 E;  4BY1 G;  1X54 A;  3I4N H;  1J5E L;  5EAY A;  3CW2 C;  3KOJ A;  2NVT H;  4JV5 L;  3PUY A;  4MZ9 A;  4LW1 A;  1I50 H;  1QZH A;  4DNI A;  4JG2 A;  4MTN A;  4X65 L;  5ELN A;  1IBL L;  1K8A C;  1HR0 W;  2CFM A;  4A3J G;  3M4O H;  3I7F A;  3ZJY C;  3PUV A;  3I4O A;  5GAH C;  3CCM A;  1PH1 A;  1K3R A;  4OO1 G;  4JC0 A;  1XMQ L;  4JI4 Q;  4IOA A;  3PO3 H;  2E5L Q;  3S1Q H;  3Q8D A;  2Z6K C;  1IL2 A;  1OXS C;  3CCJ A;  1I3Q H;  4R4I A;  2PQA B;  3W1B A;  3S24 A;  5HGQ A;  4GN3 B;  2UUB Q;  5M3F G;  3ULP A;  4B3T Q;  2UUA Q;  2MO1 A;  3HOZ H;  3M3Y H;  4IO9 A;  3EIV A;  3PCO B;  1AE3 A;  2E2J H; 
#chains in the Genus database with same CATH topology
 2RBM A;  3ND8 A;  2K50 A;  2P5Z X;  4AYB E;  4ZKC B;  4B3R Q;  5IIF A;  4KY5 A;  1BCP C;  1BF4 A;  4A3L H;  4K0K Q;  5IP7 G;  5IP9 G;  3Q0A A;  3T16 A;  1KXL A;  5I4D A;  3W2D A;  1O7Y A;  3VR5 A;  4YCW A;  3GTJ H;  3J81 i;  3KFU A;  4QCL A;  1KRS A;  4NDX A;  1HUM A;  4B9W A;  2Q2U A;  4A3E B;  4GLX A;  3RLN A;  4APV A;  1J5E Q;  1X3Q A;  2HCI A;  2AQ3 B;  2WAQ E;  3GO5 A;  4YY3 L;  3OTO Q;  3L3O C;  4J1M A;  4K8J A;  1VQ4 A;  3U58 A;  4AYB G;  1SMX A;  5IYB G;  1CA5 A;  2R3Z A;  1A3V A;  4OON A;  3EBE A;  1SYC A;  1MD2 D;  3DHQ A;  1RJT A;  3TZD A;  4X6A H;  3C1F A;  1PYW D;  2FIN B;  3VR6 A;  2EPB A;  2I5L X;  3A55 A;  3OMG A;  3KF6 A;  4A3E G;  1WTQ A;  4YHH Q;  2HD3 A;  3W5O A;  1AE2 A;  3TN2 A;  1SJE D;  5HGT A;  1YNN C;  3NSW A;  2LY7 A;  3LNN A;  5I6W A;  2HT1 A;  1IKM A;  1B1Z A;  2CWP A;  4I7A A;  4A3I G;  3NHH A;  1NTG A;  4WFN 3;  1HNZ Q;  1B8A A;  2OQK A;  1EIY B;  5C3E G;  2OT2 A;  3K7U C;  2QF7 A;  5LMU L;  2KQ3 A;  1O7Z A;  3J7Z C;  5GQO A;  2N3S A;  4A3F G;  3BDC A;  4NMZ A;  4C3H B;  3SDZ A;  4KN7 C;  3S1M H;  2L5T A;  3K7A H;  1XPO A;  2KBN A;  1SYD A;  4B3R L;  3T1H Q;  3S17 H;  1UE6 A;  3VA5 A;  2OEO A;  5JJK A;  1UE5 A;  2YTY A;  4O0A A;  5EPK A;  3JC6 6;  2R93 G;  2AWO A;  4K14 A;  1BQQ T;  4A3C H;  2LXK A;  3CCS A;  5IT9 L;  4KI0 A;  4NXM L;  5FLX L;  3EVQ A;  1TWA H;  3M4P A;  1WTV A;  1JB7 A;  4HED A;  3GTK B;  2CCZ A;  1N32 L;  4DR1 Q;  2EOT A;  3I70 A;  1JWS D;  3B6Y A;  2ES2 A;  3S2D H;  1XXG A;  1OTC A;  2JK8 A;  4DAY B;  4LF6 Q;  2B2Y C;  2IL8 A;  3KF6 B;  3HOU H;  4A3B G;  3DWQ A;  1N32 Q;  2PI2 A;  3H3V C;  4L5T A;  3V05 A;  1PH7 A;  4IFD J;  4DAV A;  1PH9 A;  4G7O C;  4N8F A;  5FOB B;  2B2W A;  1PRT C;  1U4L A;  4FF1 A;  4DR4 L;  5BR8 Q;  2G5D A;  3JAM L;  4HSV A;  3NQT A;  3S2D B;  1IW7 D;  2WKC A;  4EQN A;  4CJ1 B;  1L1O A;  4UHV A;  4J6H A;  1IL8 A;  1C7Y A;  2FFK B;  1SN8 A;  2Q8R E;  5IYC H;  1O78 A;  3OW2 A;  4DV4 Q;  1EQR A;  4X66 L;  4P73 A;  1LLR D;  2ZJR A;  4X65 Q;  1S5D D;  1STN A;  3OWF A;  1CKO A;  1TY0 A;  3PF5 A;  2EE1 A;  1JQY D;  1U4R A;  4Y7N H;  1JJG A;  2UXD Q;  1CFM A;  3T4A C;  3KDF A;  2VQE Q;  2UUA L;  3MA2 B;  2YU9 H;  3PIO 3;  1MI2 A;  5K5P A;  1XX8 A;  3LX0 A;  2MP1 A;  5KGU A;  3HZX A;  5JAV A;  4R9W A;  3I3C A;  2XTI A;  1SNO A;  3HOX H;  1PH6 A;  3CRK C;  2XN9 C;  3G71 A;  1ASZ A;  3QO2 A;  1EL0 A;  2VZA A;  1DOK A;  4ZLT F;  2UXB Q;  3ND9 A;  5DM6 3;  3BZK A;  1HUN A;  3NEN A;  3CCE A;  3D3R A;  5IYD G;  1HR0 L;  3K5N A;  1N34 L;  1QVC A;  5C0X J;  4JOI C;  4JI8 Q;  2B29 A;  3EFX D;  3HOY G;  1N36 L;  4QGU A;  1JOO A;  2A6H C;  1SMY C;  1KLU D;  1Y8O B;  4JI7 L;  2I46 A;  2IHF A;  2Y0S B;  1JMC A;  3HOY H;  1Q7Y C;  1EZ6 A;  2WB1 G;  2B63 H;  4DV0 L;  2IWH A;  3D6C A;  3G4S A;  3UE1 A;  3PUW A;  3BDO A;  1GXD C;  1Z6H A;  3URY A;  3SK8 A;  4CDE C;  4GZY C;  2JA8 G;  1ENA A;  2JA8 H;  1B44 D;  4H02 A;  3EQL C;  2K5D A;  1A3U A;  2JA5 B;  2N78 A;  4LJZ C;  3S16 B;  1AH9 A;  4EQP A;  4BA1 I;  1UWV A;  2NVQ H;  2JA6 B;  4Y7N B;  1NCV A;  3M85 A;  4BBR H;  1SYG A;  2BA0 A;  4TQU S;  4DAM A;  2FMM A;  4JI7 Q;  3R8B A;  1QOH A;  2Z6B A;  4DGZ A;  3UDX A;  2NTS A;  1F9S A;  2UU9 L;  3KBX A;  4IJL A;  1CUK A;  1CKN B;  1PTO B;  3T56 B;  4KV6 A;  1E1T A;  1WCM G;  2CH4 W;  3GTP H;  5K36 G;  2RA4 A;  1B9M A;  4DR6 L;  1S5B D;  3MTS A;  1SE2 A;  1PTO H;  2BE5 D;  5CBA E;  4CDD C;  1FNU A;  4ZAI A;  3S1N B;  3C1E A;  1Q1B A;  1BDO A;  4J8Q A;  4FXD A;  2K5H A;  4CKE A;  2R7Z G;  3K6O A;  2JA7 G;  2J0T D;  1BBU A;  1Y69 U;  3CAM A;  4DV2 L;  4AQY L;  2M00 A;  1Z9F A;  3J80 L;  2EJG C;  4H13 C;  1JOQ A;  3K5M A;  1E3P A;  4A3B H;  3CP0 A;  2GN5 A;  4LK1 C;  4OWX B;  3FKI H;  3OWE B;  2KCT A;  2B2Y A;  1VQF A;  3GTK H;  2R92 G;  1MBY A;  2F0O A;  4Y52 H;  4JPB W;  4C1N K;  5IGC A;  3BJU A;  2JA8 B;  3KYH C;  3J81 L;  1HRJ A;  1SFO B;  3FPP A;  1HFN A;  5CMD A;  3H0G H;  4LAA A;  4DUY Q;  1V1P B;  3PO2 B;  4LFB L;  3NEL A;  3S17 B;  3CKI B;  2K5V A;  2ICE C;  3OPO A;  1X56 A;  3Q22 A;  4A3J B;  1WTX A;  4PZ7 A;  2CKZ B;  1SBB B;  1AZQ A;  2R92 H;  1JE4 A;  1AZP A;  3GTL B;  5EBC A;  1W2B A;  1GJX A;  2DGY A;  3S15 H;  2F0N A;  4XQQ A;  3PIO A;  2CW0 C;  4JI8 L;  3GTO B;  2B8F A;  2L55 A;  2R61 A;  1HZC A;  5IGD A;  4IUU A;  1DON A;  4K5X A;  5I9P A;  3HOX G;  1NBW A;  4NXN L;  1G91 A;  1LUZ A;  5CYU A;  3HOZ G;  1RD9 D;  2NN6 I;  2F0P A;  4OIK A;  1EIH A;  4C3I H;  5A2Q L;  5KYI A;  5IYB H;  4ZQ3 A;  3W3A A;  5ELO A;  4C2M B;  2B2V C;  5LMN W;  2B8G A;  4B3T L;  2JYO A;  2EQS A;  1SE3 A;  3NE5 B;  5GAG C;  3A8K E;  1KAB A;  4IUV A;  1PFB A;  3F2D A;  1NMF A;  3GV6 A;  5FJ8 G;  2KHS A;  4FXK C;  1FR3 A;  2NWG A;  3HOW H;  3K81 C;  2A6H D;  1SSO A;  1E22 A;  4DKA C;  4LF6 L;  4XXE A;  4DA2 A;  1DD2 A;  3FDT A;  1HPC A;  1TQO A;  2K33 A;  4B08 A;  3Q23 A;  1ZYR C;  4KHP Q;  4G57 A;  1LTG D;  2BDO A;  2ZXP A;  1CZW A;  2KED A;  1VQC A;  3QB3 A;  5JPM C;  4Q5V A;  1A6X A;  4MZ9 A;  1WD0 A;  1I50 H;  4MTN A;  2A69 C;  3TP5 A;  4RGO S;  3I7F A;  3OIP A;  3HG9 A;  3ZJY C;  1PH1 A;  3U9S A;  4XQJ A;  2HCC A;  3PO3 H;  1IL2 A;  1I3Q H;  3KLS X;  3W1B A;  2XRQ D;  1B2T A;  4DAP A;  3M3Y H;  3PCO B;  2L0C A;  3PIP 3;  1N9W A;  2XNA C;  3SXH A;  2KVM A;  2F0F A;  5LMU Q;  4KHV A;  3D4R A;  4HMJ A;  4YWL A;  1WTP A;  2NBF A;  1LAB A;  2RHS B;  1KC8 C;  1MGS A;  1RIP A;  1X9N A;  2B2U C;  2ASB A;  2OTL A;  4QB4 A;  2KCM A;  4QUF A;  4HJA A;  3WWV A;  1I4P A;  3ERS X;  4DV3 L;  2RQX A;  1F9R A;  3V96 A;  1GD7 A;  5LL6 S;  1A63 A;  2VB3 X;  2A73 B;  1PH2 A;  1IBM Q;  4IPD A;  1O7L A;  2NTT A;  4TKO B;  1A8V A;  2HHH L;  2DJF C;  4JI0 Q;  5DM7 3;  2B2W C;  1PXU A;  4L5R C;  1SYF A;  3E9H A;  1S72 A;  1PH5 A;  3K5O A;  2SEB D;  1PTO C;  2VNU D;  3I4M H;  2QA4 A;  3LGJ A;  5IYC G;  2M9V A;  4K6L A;  5H1S E;  4P72 A;  1YBY A;  3RZD B;  2JEB I;  4LF7 L;  4FDB A;  4HIM A;  3I4M G;  2V1C C;  3L7Z C;  4AYB B;  4L63 B;  4LF9 Q;  2KEN A;  4JYA L;  4KD4 A;  4UY8 C;  1EIF A;  1EY9 A;  4JI5 L;  2JA6 G;  1IZ6 A;  1TS4 A;  2ZJQ A;  4K0K L;  3CCV A;  3H09 A;  4PG3 A;  2XGT A;  4FF2 A;  2KHI A;  1PHJ A;  2EJF C;  2F3V A;  1CK1 A;  3FEW X;  3P75 A;  5LMN L;  2HQL A;  4R4T A;  3J80 i;  3OIQ A;  3S9W A;  5JPN C;  4GOP C;  1ONL A;  2Y0S G;  2VW9 A;  1LTS D;  1YZ6 A;  1EYD A;  4UAI A;  1SAP A;  4P75 A;  4MHE A;  4M1U B;  4X66 Q;  4CBV A;  5ELF A;  4HR7 B;  4FNF A;  2QEJ C;  3BVG A;  1HQR D;  1DYQ A;  5JVH 3;  5M3M H;  2Z0S A;  3E5S A;  1A0I A;  2KCC A;  2ALY B;  1XPR A;  1D5M C;  3RLO A;  2AHO B;  2EYP A;  4R4Q A;  3RZO B;  3A7A B;  3VR4 A;  2UU9 Q;  1K83 B;  2B63 G;  1GUG A;  1YI2 A;  3BZC A;  3NBI A;  5AFW A;  2F0U A;  2NN6 H;  2WV6 D;  3H0G B;  3ULJ A;  2H1E A;  3D4D A;  1QZG A;  3GTO H;  1D5Z C;  1EY8 A;  5EKL A;  2WP8 J;  1F2L A;  4LF7 Q;  3J81 E;  5T1I A;  3NBH A;  3H3V I;  1PFS A;  2Z4I A;  2IPK D;  2K5Q A;  1TWG H;  3NBH B;  1TWF H;  5M5Y B;  1VQE A;  2D0P A;  1STA A;  2EXZ A;  4LUV A;  3R2I A;  4O2D A;  4A75 A;  5C3E H;  1JE5 A;  1K0R A;  3MFY A;  4A3I H;  4DV7 L;  1LT3 D;  1JOR A;  2K1B A;  1PDQ A;  2F52 A;  4B9X A;  1E0B A;  4ABN A;  4UP9 A;  3RR5 A;  5EPL A;  1K73 C;  1VQL A;  4FF3 A;  1JIC A;  1WJJ A;  1BKB A;  3O13 A;  4IUT A;  2L11 A;  5JEA H;  4LNQ A;  4RGT A;  3N6R A;  4K2L A;  1SNP A;  1X3G A;  2R6G A;  3A7L A;  1ET6 A;  2QEX A;  3QIA A;  3GTQ B;  3E3X A;  3PSI A;  1VF7 A;  4KY7 A;  3CCR A;  2R7F A;  2RDF A;  1BBW A;  5J3B A;  2L1B A;  2F0K A;  1IBL Q;  4A3G G;  5C4J B;  2PW5 A;  1NY4 A;  3T13 A;  2VQF Q;  5CBE E;  1WD1 A;  1ILQ A;  1XTD A;  3VYU A;  3HGB A;  5CGK A;  1X3P A;  2SOB A;  5FLM G;  1DGS A;  2PZT A;  2ZJP A;  3X3N A;  1Q1E A;  2IY5 B;  3LWU A;  3TQY A;  1W6J A;  2LS0 1;  3BG3 A;  3J7A 5;  5FLX c;  4RGN A;  5C4X B;  3S16 H;  4HMI A;  4I65 A;  3SGI A;  3ULL A;  3GTL H;  5TSS A;  3P1H A;  1WI5 A;  1N33 Q;  1D1K A;  2RKS A;  3M9B A;  3CCL A;  1JR0 D;  4GS3 A;  3PO2 G;  3CQZ H;  2MUY A;  5D3D A;  3NTH A;  4RFB A;  4F87 A;  2E8G A;  2CVR A;  1SYB A;  4IZ8 A;  3L9A X;  1D5X C;  5CV9 A;  1LAC A;  1V1Q A;  1VQJ A;  4X62 Q;  5LL6 X;  2AUJ D;  3A5U A;  4DV1 Q;  3CU7 A;  3NTI A;  1EY7 A;  1HTP A;  4DV2 Q;  5J1Z A;  2MQH A;  2VUM B;  4MNO A;  5FO8 B;  2KEE A;  5I6Y A;  5IGE A;  3SE0 A;  4HSP A;  4X3K A;  1RL2 A;  2AWN A;  3DLL A;  2ZTC A;  2ATW A;  2PNR C;  2MGS A;  1ICW A;  3WOF A;  3VYS A;  3HRZ C;  4DR5 Q;  5CC4 A;  2HQE A;  4DR5 L;  1IHZ A;  1NNX A;  4DNR B;  2SDF A;  3L0O A;  4C3H G;  3DUZ A;  1K3B C;  2IJ0 A;  4A3F B;  1YNJ D;  1H9M A;  3HOW B;  1UUP A;  3S14 B;  1KLG D;  1IYV A;  1BUV T;  2L15 A;  1R9T H;  1EYA A;  5JJI A;  1EZ8 A;  3BYY B;  2HIV A;  4LFA Q;  5HY6 A;  1VF5 C;  1WTW A;  2ZTD A;  4IUP A;  4A3D H;  3RZO H;  2PZW A;  3QJY A;  4K5W A;  4C2M H;  1T9H A;  4C3J H;  5F2D A;  4BY7 G;  3FMC A;  1X3E A;  1HHV A;  3STB D;  1F2M A;  1HNW L;  1G6Z A;  4PZ6 A;  3NK9 A;  2CQA A;  3SK6 A;  1TS2 A;  3J7Y W;  3RN2 A;  3W1G A;  4LMQ D;  1PLF A;  4LUO A;  1XMO L;  4JI0 L;  4WJW A;  1BR9 A;  4DV5 L;  1YIT A;  3HKZ E;  4NB3 A;  4A76 A;  1RKN A;  3IFT A;  2EY6 A;  2FJ2 A;  4DV3 Q;  4JVZ A;  4G7H C;  4EVO A;  5IP9 H;  5CV4 A;  2WAC A;  1I94 L;  4MIU A;  4A3E H;  2XWJ B;  4A3M H;  3HS0 C;  3K59 A;  2D9U A;  3MC0 B;  5JOB A;  2CH4 A;  1H9R A;  5JVG 3;  2UUC Q;  4N9T A;  2JA5 H;  4C3J G;  1UE7 A;  1ET9 A;  1PYB A;  1RTN A;  2BE5 C;  5M3F B;  2K05 A;  3I90 A;  3OMC A;  3CCU A;  2IX3 A;  4JK1 C;  2WB1 B;  2ZXR A;  3DM1 A;  1PVO A;  4ZUI A;  2L9H A;  2XSC A;  2VQF L;  5IGB A;  4V19 0;  4C56 C;  1EIG A;  3BVM A;  3K58 A;  1KDB A;  5JEA G;  3HOY B;  3S1R B;  1YNN D;  2ID0 A;  5COY A;  2GVB A;  3SHL A;  3E9I A;  1PRT B;  2KHJ A;  2QIL A;  4XT3 B;  4BY1 B;  4EGV A;  5IP7 H;  5J39 A;  3QG1 A;  4B3S Q;  5M5X H;  1FJG Q;  2BH2 A;  1PRT D;  4LFC Q;  1OXT A;  1MSG A;  1LTI D;  3G48 A;  5G3L F;  1B3Q A;  3HOV H;  5GRO A;  3EJI A;  4HCS A;  4RMF A;  1CKN A;  5FJ8 H;  1XMO Q;  3A0J A;  4R4C A;  3K80 C;  4KKS A;  1NUC A;  5KEE A;  1Y1W G;  2DY7 A;  1ESF A;  4KJN A;  4U68 A;  3MAQ A;  4KY6 A;  2K03 A;  2QDB A;  3A56 A;  3BYT B;  4XT1 B;  3S15 B;  4Q0F A;  1VQI A;  1AP0 A;  2HIX A;  3MXU A;  4KTA A;  2PYK A;  1LT4 D;  5G3L D;  1C9O A;  1NSN S;  2OXP A;  1IBK L;  4LFC L;  2I0Q A;  1EU4 A;  3CPF A;  4JI3 L;  2YTX A;  1GM5 A;  5BR8 L;  1S5F D;  1WCM H;  1CI3 M;  4ME5 A;  4U67 3;  3PF4 A;  2RSN A;  4FF4 A;  1EU3 A;  3MXP A;  4IUQ A;  1O80 A;  2VB2 X;  4A3D B;  5KND A;  1VQO A;  1J8I A;  1SE8 A;  1TXY A;  1SJH D;  3KJO A;  4QJF A;  2JQO A;  3BZD B;  4RKL A;  4DAY A;  2O5J C;  5JJL A;  4NP5 A;  1JT8 A;  1GUN A;  4FXG C;  1HZA A;  1TWC H;  4UP8 A;  4ID6 A;  4GNX B;  2EYO A;  1D6E C;  4JI1 L;  2UXB L;  1CZG A;  1VQ7 A;  5IWA L;  1B53 A;  1BO0 A;  4JBK A;  4DR4 Q;  3P20 A;  2O4X A;  4KLK A;  3CMA A;  3A74 A;  5M5Y H;  4LWC A;  4A93 G;  4DU9 A;  1GUW A;  1PH3 A;  2H5X A;  3NPP A;  5CV6 A;  1HFG A;  2AQ2 B;  2B2T C;  1DOL A;  1L2F A;  5IGF A;  1EUJ A;  1PZK D;  1ILP A;  4DV5 Q;  2K32 A;  4KKU A;  5FK9 C;  2VQE L;  2E2H B;  3R2T A;  4DV7 Q;  1CQV A;  2KCN A;  3T1H L;  1K0S A;  1ZKO A;  2EY5 A;  1DM0 B;  2WB1 E;  1V1P A;  1SEB D;  1X54 A;  4WRD A;  1J5E L;  2X6L A;  1TU2 B;  3I91 A;  3SR1 A;  1AW7 A;  4JV5 L;  3MEH A;  4JG2 A;  1E2W A;  3VR2 A;  1EQV A;  5ELN A;  3KK7 A;  4X65 L;  1EQT A;  3NUC A;  5GAH C;  2X69 A;  4IQZ A;  4IOA A;  1TWH B;  3TDQ A;  3S1Q H;  3Q8D A;  2Z6K C;  1OXS C;  1DJR D;  3H91 A;  5I2Y A;  1TII D;  2PQA B;  3S24 A;  5HGQ A;  4GN3 B;  5M3F G;  3ULP A;  4B3T Q;  3VA7 A;  2UUA Q;  3VYR A;  3DWP A;  1AE3 A;  1EYC A;  1UNS A;  5I2X A;  2GVA A;  3NP8 A;  5C3E B;  1HA6 A;  2BOS A;  1J6Q A;  1SYE A;  5M9O A;  1GHK A;  2V4D A;  2NVX H;  4HJ9 A;  2B3G A;  5J22 A;  3HKZ G;  3PUZ A;  2OF1 A;  3GQB A;  3KJP A;  1Z7T A;  5CV5 A;  1QNK A;  2EIF A;  1RHP A;  2BDN A;  1OXX K;  3C3L A;  2C5C A;  4DR3 Q;  1L0Y B;  4BXX H;  2YYZ A;  3I4M B;  1WTR A;  1TT2 A;  4YIJ A;  1EFW A;  3M4O B;  2WAQ B;  3CRL C;  3J81 j;  2N88 A;  1EFI D;  5D14 A;  3WDN A;  1STH A;  1TWH H;  3S1Q B;  4RH6 A;  3X3M A;  1T5X D;  3GTG B;  2Y0S E;  2NVY B;  1VQA A;  1AEX A;  1LTB D;  1IW7 C;  4QMG A;  2E2H H;  1F2Y A;  3HOW G;  4BY7 B;  1RDP D;  4HAE A;  4IUN A;  3IRB A;  4R8N A;  4DNT B;  2F4V Q;  3M7N A;  2BH8 A;  2B2U A;  1WYD A;  4CHT B;  4CJ2 C;  4A3C G;  2G9D A;  1KAA A;  3NQI A;  4QIW B;  1PRT F;  3KF8 A;  1S40 A;  3CD6 A;  2F0T A;  4G4K A;  1NAP A;  2O2L D;  5BN5 A;  1YIJ A;  2L4N A;  1ESR A;  1V1O A;  3F8T A;  2F0M A;  1LTL A;  3HOU B;  4RGM A;  2JXM B;  5EGT A;  2Q8I B;  4HTH A;  3GTM H;  3PIP A;  1VS0 A;  3BVZ A;  1IYU A;  1XMQ Q;  4BA2 I;  1Y1V H;  5M3M B;  3EA6 A;  3JAM E;  3S2H H;  3QR8 A;  3PV0 A;  4CDC C;  3KLW A;  2JEA I;  1B9N A;  1SXT A;  2IX0 A;  4OWW B;  2JA9 A;  4HID A;  2LKV A;  1STY A;  1AFP A;  1CM9 A;  3RZD H;  4GOP B;  2OCE A;  3CHB D;  4KK7 A;  4KN4 C;  1HQM C;  2J7Z A;  1H9J A;  1Q8K A;  1Y8P B;  4IOC A;  1TR5 A;  4KHP L;  2F0V A;  5CV8 A;  1Q12 A;  2ZXO A;  3AB9 A;  2IHE A;  3TP7 A;  4R4O A;  3AEV A;  1PFM A;  3CQZ B;  2ZM6 Q;  3N52 A;  1Q90 A;  1SLJ A;  2A19 A;  1KNA A;  1PZJ D;  1MKH A;  2EJM A;  2G9H D;  4OO1 H;  1NJI C;  1YNX A;  4I7Z C;  2VUM H;  5EPJ A;  4BBS B;  1L0W A;  1FJG L;  4CKB A;  5C4X G;  5C44 B;  2F4I A;  2Z1C A;  3BU2 A;  1YHA A;  4IFD G;  1G2T A;  1R4P B;  1A62 A;  5ELD A;  1H9S A;  2MFI A;  5IOD A;  3HFZ B;  1VCI A;  2BA1 A;  3VDY A;  1VQB A;  3GTG H;  3AU7 A;  3E0J A;  4FP5 D;  3NTK A;  4BY7 H;  4GLV B;  1HH2 P;  2E2D C;  3NEM A;  5EKK A;  1K8G A;  2NVY H;  3ERQ A;  3MWY W;  1V43 A;  3AFQ A;  1JJC B;  3K0Y A;  1KD1 C;  1F77 A;  1I6H H;  2A1A A;  3U4Z A;  3S2H B;  1HCZ A;  2NVQ B;  4F7X A;  1JCK B;  2A68 C;  2GA4 B;  1I4R A;  4OIJ A;  3DMU A;  3G6J B;  1IBK Q;  3F2C A;  4A3M G;  3AYH B;  2VXW A;  3HP3 A;  2VY3 A;  1NE3 A;  1SNC A;  1UEA B;  1Q86 C;  2A69 D;  1DCZ A;  1U4P A;  1TWG B;  2Z6K A;  2AMC B;  3H0G G;  4DV6 L;  3CC2 A;  2K6A A;  2M2L A;  1NR4 A;  4L5Q A;  3OSO A;  1VQ9 A;  3M4Q A;  1W3S A;  4JCV E;  4JV5 Q;  1I6V C;  1BNZ A;  4R1J A;  4X3T A;  1U0L A;  4MN3 A;  5D3I B;  5DEH A;  3UDF A;  4EQ5 A;  4CDF C;  4DUY L;  2NZO A;  1S3O A;  3CME A;  1VQM A;  4H7B A;  3K5L A;  4HJ5 A;  3A8J E;  1D8L A;  4P71 A;  4IN3 A;  5COR A;  1CSP A;  3D6W A;  3TP8 A;  2MJ8 A;  3RNU A;  1I4Q A;  4DR7 L;  1E1O A;  3I4N G;  3I8Z A;  2F0G A;  2NN6 G;  3JAM c;  1HZB A;  4HJ7 A;  3I4L A;  3F2B A;  2UXC Q;  1C0A A;  1CKM A;  3I56 A;  3AQQ A;  3NWT A;  1KL9 A;  3CC7 A;  3PUX A;  4IPH A;  1OXV A;  5K36 H;  1OXU A;  1HNZ L;  5FLM H;  5DLQ E;  1YJW A;  3J80 E;  1TS3 A;  1Y8N B;  1RTO A;  1XNQ L;  3DM3 A;  2RDH A;  4K5V A;  3ERO A;  2K52 A;  4GKJ L;  1JWU D;  2O5I C;  1EEF D;  1HA5 A;  3ONA B;  4RCO A;  5KNC A;  1EWC A;  3R93 A;  1Y1V G;  1MIU A;  5A2Q E;  2F4V L;  5DAU A;  2RDG A;  4K8I A;  5E1F A;  3H3V H;  4CKC A;  4PZ8 A;  1GVP A;  1XNR L;  4IUR A;  1XNR Q;  1BCP D;  3G6E A;  1DOM A;  3U9O A;  1A3T A;  3NWS A;  3PO2 H;  3IKJ A;  1BCP B;  3G7L A;  1PTO F;  4JBM A;  2RCN A;  2E75 C;  4XDX A;  1KIX A;  1L0X B;  3DEO A;  2JA7 H;  3DXJ C;  2Q2T A;  3KLS A;  1UEB A;  2HDL A;  2D62 A;  4DXG A;  3GTM B;  1TVX A;  5C4H A;  5M5W H;  1STE A;  3CCQ A;  1Y1V B;  1E7Z A;  3L2P A;  4OEL B;  1SNQ A;  1C48 A;  4LF4 Q;  1B70 B;  1TWC B;  2VUM G;  2IX1 A;  5C6A A;  1STB A;  2CQO A;  4GN5 A;  2EY2 A;  3E0E A;  4A3J H;  1STG A;  4NW2 A;  4Z9C B;  3IFD A;  1Z47 A;  1P16 A;  2K01 A;  2F0L A;  1VQN A;  4GKJ Q;  4OX9 L;  1G2S A;  1SRU A;  4M8A A;  2NYZ D;  5ISR A;  2N55 A;  1Q8I A;  1SDF A;  2L12 A;  2XIW A;  2NB0 A;  1QJO A;  1LTT D;  4X3S A;  1MJC A;  3I4N B;  2Q2I A;  2KA7 A;  2EYH A;  3GTQ H;  1EY0 A;  4X64 Q;  1I50 B;  5I9O A;  2VS1 A;  2I5H A;  1H9K A;  1ZYR D;  1PZI D;  1EY4 A;  1FL0 A;  4DV0 Q;  1JJ2 A;  4DR6 Q;  1X65 A;  5AJ3 Q;  1MJE A;  3FKI G;  3S1M B;  2C9O A;  4POG A;  2A8V A;  3I55 A;  4NXM Q;  2PO4 A;  3UDI A;  5IY0 A;  4KD3 A;  3MHB A;  3TSS A;  4K2K A;  3GTJ B;  5C5L A;  3UE0 A;  4A4I A;  2JA6 H;  1CHP D;  2EDG A;  4DR3 L;  2D0O A;  3TZU A;  2ZM6 L;  1VQ8 A;  4QL5 A;  1HR0 Q;  1QWY A;  4A3K B;  3D4W A;  3EN2 A;  1VQK A;  4FVM A;  3SK4 A;  5IWA Q;  3CC4 A;  1G8Z D;  4A3G B;  1GO3 E;  2IT1 A;  3DEP A;  1ZXT A;  1I4G A;  3HOV B;  2EYM A;  2HUG A;  4LFB Q;  1IYJ B;  5C0X I;  4R8I A;  1PH4 A;  4QF4 A;  5M5X B;  1N8R C;  1X6O A;  4BBR B;  1I6H B;  3J80 c;  4B3M Q;  4BXX G;  4O42 A;  1OO9 B;  5ELC A;  2K7V A;  2UXD L;  1IXR A;  4DR7 Q;  2E2I H;  4ULL A;  4BBR G;  2EZV A;  1DXM A;  2XWB B;  3TS0 A;  2F0H A;  2EYL A;  4YWK A;  1M4V A;  2WIN B;  1TKW B;  1I94 Q;  3HOV G;  4LF9 L;  1I5F A;  4LF5 L;  3Q24 A;  2KJX A;  4HCE A;  1N33 L;  1KTK A;  1KHI A;  4A3K H;  2NZH A;  1XTC D;  3HOX B;  4AQY Q;  1BVS A;  5KYL A;  1N34 Q;  3OHX C;  3HEJ A;  3MXN A;  1F9P A;  1ENC A;  1QVG A;  1HNW Q;  3PMF A;  1BCP F;  4AH6 A;  3S14 H;  2B63 B;  4RG1 A;  1S5E D;  3MEF A;  1XJV A;  2F0I A;  1QUQ B;  5C0X G;  5FO7 B;  1Q81 C;  3I4N H;  2KUM A;  5EAY A;  4PMB A;  2NVT H;  3C2P A;  4LW1 A;  1QZH A;  4DNI A;  1IBL L;  1HR0 W;  2CFM A;  4A3J G;  3PUV A;  1K3R A;  4X3U A;  5KNB A;  1V8Q A;  3MXG A;  1SE4 A;  4ZKB B;  1XMQ L;  2F03 A;  4PMC A;  3CCJ A;  4R4I A;  1CHQ D;  2UUB Q;  4FO2 A;  2R93 B;  1QG7 A;  3J7A F;  4IAL A;  3EIV A;  2QDL A;  1WTH A;  1A15 A;  2TMP A;  1R9T B;  3STB C;  1B3A A;  1LM0 A;  4DXF A;  2ZTE A;  2YU9 B;  4GKK L;  3TEH B;  2UUB L;  2PMZ E;  1L1O B;  4IPG A;  2I5M X;  4MTK A;  4YCV A;  5IT9 c;  2LMC B;  2AUK A;  3DWA A;  2R92 B;  1XWE A;  4JI6 Q;  2PQE A;  4LF8 L;  3QOL A;  1JWM D;  2PW7 A;  1GKH A;  2K5N A;  4PMW A;  4PQX A;  3TBI B;  4DK3 C;  4XYQ A;  1SMY D;  3TS2 A;  1PA6 A;  1PMR A;  3RN5 A;  4ZUJ A;  2Z4H A;  1QVF A;  4RCN A;  1X32 A;  1PTO D;  3PO3 G;  3MXN B;  4OXP A;  1VMC A;  1II3 A;  2JA7 B;  1Q82 C;  4L5S A;  1YVC A;  2NVT B;  4JI2 Q;  3GTP B;  2X6G A;  1D7Q A;  1PFN A;  4KHZ A;  4P2C B;  1EY6 A;  1VQ6 A;  2E2I B;  4RHS A;  3MZ5 A;  3PO3 B;  2A6E D;  3IAY A;  4X64 L;  2QGQ A;  5BN4 A;  1WCM B;  1MSH A;  2F0J A;  4CJ0 B;  3FHW A;  4DR1 L;  1D2B A;  4JI2 L;  1FGU A;  1M1K C;  2RVL A;  1GHJ A;  3LWE A;  4HIO A;  1IBM L;  4GLA C;  4RWS C;  4HIK A;  1GUS A;  1FYC A;  1B50 A;  1C4Q A;  1KDC A;  5C4X H;  1TS5 A;  2NUC A;  4DFA A;  2HDM A;  4BWG B;  3E6Z X;  5T1G A;  2LFN A;  4IFD I;  4YY3 Q;  3K8A A;  3OTO L;  2LXJ A;  3U4V A;  1KQS A;  3UI2 A;  2JA5 G;  2TSS A;  3NXW A;  2F0W A;  4JOI A;  4ALP A;  4EX5 A;  1RF2 D;  5C3X A;  2Z9H A;  1CA6 A;  4JI4 L;  4JBW A;  5IOC A;  1U5K A;  5ELE A;  1AN8 A;  4BY1 H;  2B2T A;  1Q46 A;  2JE6 I;  2VL6 A;  1CT1 D;  3K57 A;  4OGQ C;  5JEA J;  4DR2 L;  1K83 H;  2H4O A;  4NPS A;  4ODG A;  1LT6 D;  1PYS B;  3KDF B;  1S5C D;  2F3I A;  1HJP A;  1RCV D;  2SNM A;  2A74 C;  4YHH L;  4LF5 Q;  3GD7 A;  3I73 A;  1YEZ A;  2DUD A;  1ROD A;  3VR3 A;  4B3S L;  1UAP A;  3H94 A;  4ME3 A;  4RKB A;  1XPU A;  3GDE A;  1CSQ A;  2PNH A;  4A3M B;  2XRS D;  1LTR D;  1EYG A;  2F0Q A;  3C46 A;  1PV4 A;  1K8M A;  1WFQ A;  1JC7 A;  3J7A V;  2A5H A;  2SNS A;  3T53 B;  1ML0 D;  1GUT A;  4DK0 A;  4O1N A;  1Y14 B;  1YHB A;  2HHH Q;  2QCP X;  1YJ9 A;  5D65 A;  3QOJ A;  3I2Z A;  4QQB X;  2FXQ A;  4N8X 1;  5EJW A;  2XVS A;  3JAM i;  1R4Q B;  1ENF A;  4GNX A;  3HOZ B;  2ENB A;  4WJ4 A;  2NZ1 D;  3H6M A;  2JJQ A;  1ASY A;  1YNJ C;  4H0L C;  1MHW C;  4JI3 Q;  1V9P A;  1LO5 D;  1K9M C;  3D8G A;  2Z8L A;  5C44 H;  4A3K G;  5C44 G;  1HTL D;  2Q2H A;  4UP7 A;  1SNM A;  2QW7 A;  4BBS G;  4GOP A;  2E5L L;  4A3G H;  4OWT B;  3F1Z A;  3D0F A;  3F2U A;  4FYD A;  1F2Z A;  2K4K A;  2QKI C;  3KLR A;  1UE1 A;  4DUZ L;  5CV7 A;  4A3B B;  1SR3 A;  3BS1 A;  2PMZ B;  1FNV A;  2D5D A;  1KNE A;  1ZEQ X;  3GP7 A;  1E2Z A;  1YHQ A;  2R7Z H;  3SEB A;  3FKI B;  3M4Y A;  4ZCK A;  1A2U A;  3OOC A;  4QY7 A;  3AFP A;  1TY2 A;  4DPG A;  1I4H A;  1W6K A;  1QCB D;  4GN4 B;  3M7G A;  4RA8 A;  2EY1 A;  1X3F A;  3ICE A;  5CR3 A;  5GAD C;  4WJ3 M;  5E3F A;  3KF8 B;  4H44 C;  2JSO A;  4HJ8 A;  3RD4 A;  4PV1 C;  3M3Y B;  4DR2 Q;  1LV9 A;  1Y1W H;  4KJO A;  4LUZ A;  4XQN A;  3T1Y L;  1XNQ Q;  3P7J A;  1H95 A;  2AQ1 B;  5C4J H;  3FRP B;  2E76 C;  1E2V A;  3HOU G;  5EBD A;  3A5Z B;  2MPM A;  4EQO A;  1HNX L;  4DF7 A;  5JJZ A;  4K6D A;  2IW3 A;  1KRT A;  2RSO A;  4ZYS A;  4X62 L;  3J81 c;  4DV1 L;  1JB3 A;  4CGY B;  2E74 C;  1KDA A;  3I72 A;  3S1R H;  4G7Z C;  1J9O A;  1T5E A;  5M3M G;  5KIX A;  3QWN A;  2R7Z B;  5C5M A;  2PI2 E;  1X55 A;  2K28 A;  1D1I A;  2A6E C;  5KRU A;  2FHT A;  4A3I B;  1NMG A;  4QUC A;  1QIL A;  5M3F H;  4LF4 L;  4JBJ A;  3RUZ A;  4YCU A;  5IGG A;  4JI5 Q;  3TP6 A;  1QB5 D;  2EVB A;  5FLX E;  2DY8 A;  2C35 B;  5EQ0 A;  5IT9 E;  4ILW A;  4AIM A;  2DNE A;  1EWI A;  3PQI A;  3TRE A;  4F88 A;  1P8L A;  4XYO A;  2K75 A;  1VQD A;  4RHR A;  3PGZ A;  4KMU C;  2KEC A;  2N8N A;  3IL8 A;  4V0B A;  1IKL A;  1JOK A;  2DN8 A;  3OYY A;  2B39 A;  2PQA A;  4TSS A;  3HKS A;  2R7D A;  1WTO A;  3CXC A;  5GAE C;  2F3W A;  4A93 H;  2WAQ G;  4J15 A;  3HKZ B;  2EXD A;  4XIG S;  1KAW A;  4A3L G;  1G6P A;  2RHQ B;  2UXC L;  2OQ0 A;  2BCO A;  2MHV A;  1FVI A;  4YWM A;  2PPB C;  5BN3 A;  1NR2 A;  5DNF A;  1B7Y B;  1Q3L A;  5IE8 A;  3FP9 A;  2F0S A;  4LF8 Q;  3R3O A;  2PCF B;  1G51 A;  1CTM A;  4GKK Q;  2NVX B;  4JI1 Q;  2N49 A;  1EOT A;  3T51 B;  1EY5 A;  1LYL A;  4XTC S;  4HN7 A;  4QIW E;  4JI6 L;  4OHJ A;  1A2T A;  4C1N I;  1N36 Q;  3D31 A;  2CHB D;  2AKW B;  5FKA C;  2E2J B;  2ICI A;  4TVA B;  2I07 B;  2WFW A;  1WOC A;  2RF4 A;  1FNW A;  4NXN Q;  1CQF A;  4L8J A;  5LMN Q;  5IYD H;  2EYF A;  1VQG A;  4C3I G;  4P74 A;  2MNA A;  3ER0 A;  4IJH A;  3H15 A;  1YJN A;  1VQP A;  1H9S B;  4KKT A;  3U50 C;  2JN4 A;  2F1M A;  1LTA D;  3A8I E;  3V2T A;  3OW7 A;  3RLF A;  3UDG A;  2FMC A;  2K5W A;  2YV5 A;  1WVL A;  4JYA Q;  3KUP A;  2RCF A;  2KOL A;  3ITP A;  2DNC A;  4POF A;  4UPA A;  4WOR A;  4BBS H;  3CF5 A;  2WII B;  3TRZ A;  5L37 A;  4UDU C;  1SFO H;  3T1Y Q;  2ZT9 C;  1VMP A;  4S3S A;  1U4M A;  4OEM B;  4IPC A;  4A3F H;  1QNU A;  3RMH A;  4DUZ Q;  1EQQ A;  5E4W C;  5LHY 1;  1SND A;  1U9R A;  1QE6 A;  3CPW A;  5C0X H;  4LFA L;  2Q8T A;  1M90 C;  2A68 D;  1FD7 D;  2OWO A;  2MO0 A;  4A93 B;  3K0X A;  1EEI D;  2F0E A;  1EOV A;  5M5W B;  3KBG A;  2R93 H;  5HUR A;  1I3Q B;  5E7N A;  4RAU C;  4GNX C;  1VQ5 A;  4ZRZ A;  3TME A;  1EWH A;  3BDL A;  1SRO A;  2D2C C;  4N9P A;  2F0D A;  3MVV A;  5FO9 B;  4B3M L;  3AMU A;  1HZ9 A;  2K04 A;  1PH8 A;  2CWA A;  1I4X A;  4PNY A;  4ZK9 B;  1BBX C;  4OO1 I;  2YTV A;  1FGB D;  1HNX Q;  3ZYY X;  4DV4 L;  1BXT A;  4A3D G;  2DJG C;  5E4X A;  3MFG A;  1VQH A;  1G29 1;  1C8C A;  5C3W A;  4NKL A;  1GOZ A;  4L6T B;  4DK6 C;  2UUC L;  3FPU B;  1DZ1 A;  4DN4 M;  3SK5 A;  4DK1 A;  1L1O C;  4E6I A;  3S1N H;  4C3H H;  1O7I A;  4DV6 Q;  1S4Z A;  4F8M A;  1E24 A;  2WKD A;  2PZU A;  2LSS A;  2OTJ A;  1LT5 D;  1VDZ A;  5AJ3 L;  4IFD H;  3GV3 A;  3FVQ A;  2K14 A;  1QUQ A;  3VYT A;  5EKI A;  1TWA B;  2J4X A;  1B4O A;  3WOE A;  1Y1W B;  4BY1 G;  5ELB A;  5A35 A;  1K28 A;  3CW2 C;  3KOJ A;  3PUY A;  3Q6S A;  2B2V A;  4C3I B;  1GUO A;  1K8O A;  1K8A C;  5C4Z A;  4JW0 A;  2CW0 D;  3M4O H;  3K7A B;  3I4O A;  3CCM A;  4OO1 G;  1F9Q A;  4JC0 A;  1BOS A;  4OL7 A;  4JI4 Q;  2E5L Q;  1HXY D;  3SVM A;  1ICF B;  4TRD A;  1XYI A;  3A54 A;  2JP1 A;  1M8A A;  2EYJ A;  4BS9 A;  2MO1 A;  5NUC A;  1TWF B;  3HOZ H;  4IO9 A;  4C3J B;  4OX9 Q;  2E2J H; 
#chains in the Genus database with same CATH homology
 4AYB E;  2K50 A;  1N9W A;  4B3R Q;  2GVA A;  3STB C;  1LM0 A;  3CD6 A;  5LMU Q;  2ZTE A;  4A3L H;  4K0K Q;  5IP7 G;  4GKK L;  5IP9 G;  1J6Q A;  3TEH B;  2UUB L;  2PMZ E;  1L1O B;  4IPG A;  2I5M X;  4YWL A;  4YCV A;  5IT9 c;  1KXL A;  4JI6 Q;  4LF8 L;  2RHS B;  1KC8 C;  2NVX H;  1RIP A;  1X9N A;  4HJ9 A;  4YCW A;  2ASB A;  1GKH A;  2K5N A;  2OTL A;  4PMW A;  3GTJ H;  3J81 i;  3KFU A;  4DK3 C;  2KCM A;  2B3G A;  4HJA A;  1KRS A;  3HKZ G;  3WWV A;  3PUZ A;  1PA6 A;  3TS2 A;  3RN5 A;  3ERS X;  4DV3 L;  3KJP A;  2Q2U A;  1QVF A;  1GD7 A;  4GLX A;  3PO3 G;  1A63 A;  3MXN B;  3RLN A;  4OXP A;  4APV A;  1PH2 A;  1J5E Q;  1IBM Q;  4IPD A;  2WAQ E;  3GO5 A;  2EIF A;  4YY3 L;  3OTO Q;  1A8V A;  1Q82 C;  1YVC A;  4L5S A;  1OXX K;  3U58 A;  1VQ4 A;  4AYB G;  4DR3 Q;  1SMX A;  4JI2 Q;  5IYB G;  2YYZ A;  4BXX H;  2HHH L;  4OON A;  3EBE A;  4JI0 Q;  1D7Q A;  1EFW A;  4L5R C;  3E9H A;  4KHZ A;  3J81 j;  1S72 A;  1PH5 A;  4X6A H;  1VQ6 A;  1TWH H;  2I5L X;  4A3E G;  2VNU D;  3KF6 A;  4X64 L;  3I4M H;  2QGQ A;  4YHH Q;  2Y0S E;  2QA4 A;  3LGJ A;  3W5O A;  1VQA A;  1AE2 A;  5IYC G;  5H1S E;  3FHW A;  1YBY A;  4P72 A;  4DR1 L;  2E2H H;  2JEB I;  2HT1 A;  4JI2 L;  2CWP A;  4A3I G;  3HOW G;  1FGU A;  1M1K C;  4LF7 L;  4FDB A;  4HIM A;  3I4M G;  2V1C C;  3IRB A;  3L7Z C;  4HIO A;  2F4V Q;  3M7N A;  2BH8 A;  2KEN A;  4LF9 Q;  4JYA L;  1WYD A;  1NTG A;  4GLA C;  1IBM L;  4A3C G;  4UY8 C;  4HIK A;  1EIF A;  1HNZ Q;  4JI5 L;  1B8A A;  2OQK A;  1S40 A;  1EIY B;  5C4X H;  5C3E G;  1IZ6 A;  2ZJQ A;  3K7U C;  1YIJ A;  2JA6 G;  4K0K L;  3CCV A;  5LMU L;  4PG3 A;  2XGT A;  2KHI A;  3F8T A;  3J7Z C;  5GQO A;  1PHJ A;  4IFD I;  4YY3 Q;  3K8A A;  3OTO L;  2N3S A;  1LTL A;  5LMN L;  2HQL A;  2LXJ A;  3U4V A;  4R4T A;  3J80 i;  4A3F G;  1KQS A;  3GTM H;  3PIP A;  4GOP C;  2JA5 G;  2Y0S G;  3S1M H;  1VS0 A;  4JOI A;  4ALP A;  2VW9 A;  4EX5 A;  3K7A H;  1XMQ Q;  4JI4 L;  1XPO A;  1YZ6 A;  4JBW A;  4BA2 I;  2KBN A;  1U5K A;  1Y1V H;  4B3R L;  3T1H Q;  4BY1 H;  3S17 H;  3S2H H;  1UE6 A;  4P75 A;  1Q46 A;  2JE6 I;  3PV0 A;  4X66 Q;  1UE5 A;  2YTY A;  3KLW A;  4O0A A;  2JEA I;  5JJK A;  2VL6 A;  2IX0 A;  4OWW B;  2JA9 A;  3JC6 6;  4HID A;  2R93 G;  2AWO A;  4A3C H;  4DR2 L;  5JEA J;  2LXK A;  3CCS A;  4GOP B;  2OCE A;  3RZD H;  1K83 H;  4KI0 A;  5M3M H;  4NXM L;  3M4P A;  1TWA H;  2Z0S A;  1A0I A;  1JB7 A;  4NPS A;  2ALY B;  4A3M G;  1XPR A;  1PYS B;  3RLO A;  3KDF B;  2CCZ A;  1Q8K A;  1N32 L;  2AHO B;  4IOC A;  4DR1 Q;  2F3I A;  1HJP A;  4R4Q A;  3B6Y A;  2UU9 Q;  2B63 G;  4KHP L;  1YI2 A;  4YHH L;  2ES2 A;  3S2D H;  3BZC A;  4LF5 Q;  1OTC A;  2JK8 A;  1Q12 A;  3GD7 A;  3ULJ A;  4DAY B;  1YEZ A;  4LF6 Q;  2IHE A;  2DUD A;  1QZG A;  3GTO H;  4R4O A;  2WP8 J;  3AEV A;  3KF6 B;  4B3S L;  2ZM6 Q;  4LF7 Q;  3HOU H;  4ME3 A;  4A3B G;  1SLJ A;  1XPU A;  2A19 A;  3GDE A;  1CSQ A;  2PNH A;  1MKH A;  1N32 Q;  3H3V I;  1PFS A;  2PI2 A;  3NBH B;  4L5T A;  1NJI C;  1TWG H;  1TWF H;  1EYG A;  1YNX A;  1VQE A;  2D0P A;  2VUM H;  1PH7 A;  4LUV A;  1PV4 A;  4O2D A;  4IFD J;  1L0W A;  4A75 A;  1PH9 A;  1FJG L;  1WFQ A;  5C3E H;  5C4X G;  1JE5 A;  1K0R A;  4A3I H;  4DV7 L;  3BU2 A;  1YHA A;  2F52 A;  4DR4 L;  5BR8 Q;  1Y14 B;  1YHB A;  2HHH Q;  4IFD G;  1A62 A;  1YJ9 A;  4UP9 A;  3RR5 A;  1K73 C;  1VQL A;  2MFI A;  3I2Z A;  1WJJ A;  1BKB A;  3HFZ B;  1VCI A;  2BA1 A;  3VDY A;  1VQB A;  3GTG H;  1L1O A;  2FXQ A;  4QQB X;  4LNQ A;  3JAM i;  1C7Y A;  1X3G A;  2R6G A;  1SN8 A;  4GNX A;  4WJ4 A;  5IYC H;  3OW2 A;  4BY7 H;  4DV4 Q;  4GLV B;  1EQR A;  1HH2 P;  2QEX A;  2JJQ A;  4X66 L;  1ASY A;  3NEM A;  4P73 A;  4JI3 Q;  3PSI A;  1V9P A;  3CCR A;  2R7F A;  2NVY H;  1K8G A;  1BBW A;  5J3B A;  2ZJR A;  1K9M C;  4X65 Q;  1IBL Q;  4A3G G;  1V43 A;  3AFQ A;  1JJC B;  1NY4 A;  1CKO A;  1KD1 C;  5C44 H;  3PF5 A;  4A3K G;  2VQF Q;  5C44 G;  2A1A A;  2Q2H A;  4UP7 A;  3U4Z A;  2F4V L;  1I6H H;  4BBS G;  4GOP A;  2E5L L;  1XTD A;  4Y7N H;  1JJG A;  4A3G H;  4OWT B;  2UXD Q;  3F1Z A;  3D0F A;  1IBK Q;  3F2C A;  3KDF A;  2K4K A;  3AYH B;  5FLM G;  2VQE Q;  1DGS A;  1UE1 A;  2VY3 A;  2ZJP A;  1NE3 A;  4DUZ L;  2UUA L;  2YU9 H;  1Q1E A;  1Q86 C;  1SR3 A;  2IY5 B;  3TQY A;  2Z6K A;  1YHQ A;  2AMC B;  2R7Z H;  3J7A 5;  3H0G G;  4DV6 L;  3CC2 A;  2XTI A;  4L5Q A;  5FLX c;  3HOX H;  1PH6 A;  4QY7 A;  3AFP A;  4DPG A;  3G71 A;  3M4Q A;  1ASZ A;  1VQ9 A;  3S16 H;  1W3S A;  3SGI A;  4JCV E;  3ULL A;  2VZA A;  3GTL H;  4GN4 B;  1WI5 A;  4JV5 Q;  1N33 Q;  2UXB Q;  4R1J A;  1X3F A;  3BZK A;  3M9B A;  3NEN A;  3CCL A;  3CCE A;  3ICE A;  1U0L A;  5GAD C;  5IYD G;  1HR0 L;  4GS3 A;  3PO2 G;  3CQZ H;  3KF8 B;  4HJ8 A;  1N34 L;  4WJ3 M;  1QVC A;  3UDF A;  4EQ5 A;  5C0X J;  4JOI C;  4DUY L;  2E8G A;  2NZO A;  4JI8 Q;  1S3O A;  2B29 A;  4DR2 Q;  3CME A;  3HOY G;  1N36 L;  1Y1W H;  1VQM A;  4LUZ A;  4QGU A;  3T1Y L;  1XNQ Q;  4HJ5 A;  1H95 A;  1D8L A;  4P71 A;  1V1Q A;  1VQJ A;  5C4J H;  4X62 Q;  4DV1 Q;  3A5U A;  4JI7 L;  1CSP A;  2IHF A;  1JMC A;  3RNU A;  3HOY H;  1Q7Y C;  4DV2 Q;  3HOU G;  2WB1 G;  3A5Z B;  2B63 H;  4DV0 L;  3G4S A;  2MQH A;  1HNX L;  4DR7 L;  3UE1 A;  1E1O A;  3I4N G;  1KRT A;  3J81 c;  2NN6 G;  3PUW A;  4X62 L;  1HZB A;  3JAM c;  4MNO A;  4DV1 L;  4HJ7 A;  4OX9 Q;  3F2B A;  2UXC Q;  1C0A A;  1RL2 A;  2AWN A;  3S1R H;  3DLL A;  1CKM A;  3I56 A;  3AQQ A;  2ZTC A;  2ATW A;  5M3M G;  2JA8 G;  2JA8 H;  4H02 A;  1KL9 A;  3CC7 A;  3PUX A;  4DR5 Q;  4IPH A;  1OXV A;  4DR5 L;  1JJ2 A;  2PI2 E;  1X55 A;  1OXU A;  1HNZ L;  2N78 A;  3L0O A;  5FLM H;  5DLQ E;  1YJW A;  1NMG A;  1XNQ L;  3DM3 A;  1AH9 A;  5M3F H;  4LF4 L;  4BA1 I;  2K52 A;  4JBJ A;  4GKJ L;  4YCU A;  2L15 A;  4JI5 Q;  1UWV A;  1R9T H;  5JJI A;  2C35 B;  2NVQ H;  1Y1V G;  1MIU A;  4AIM A;  2HIV A;  4LFA Q;  2BA0 A;  5HY6 A;  4BBR H;  4TQU S;  3M85 A;  4DAM A;  2ZTD A;  4JI7 Q;  4A3D H;  1EWI A;  3TRE A;  3RZO H;  3H3V H;  4PZ8 A;  1T9H A;  3UDX A;  4C2M H;  1P8L A;  4C3J H;  1GVP A;  1XNR L;  2K75 A;  2UU9 L;  1XNR Q;  1VQD A;  3G6E A;  4BY7 G;  3PGZ A;  1CUK A;  1CKN B;  1X3E A;  4IJL A;  2N8N A;  3STB D;  3PO2 H;  1HNW L;  4PZ6 A;  1E1T A;  1WCM G;  3OYY A;  3RN2 A;  3GTP H;  2PQA A;  3W1G A;  4JBM A;  2RCN A;  3HKS A;  5K36 G;  2R7D A;  4LUO A;  1XMO L;  4JI0 L;  3CXC A;  1KIX A;  5GAE C;  4A93 H;  4DV5 L;  1YIT A;  2WAQ G;  4J15 A;  4DR6 L;  2EXD A;  3HKZ E;  4NB3 A;  4A76 A;  2JA7 H;  4XIG S;  1KAW A;  4A3L G;  4DV3 Q;  2Q2T A;  1G6P A;  2RHQ B;  5IP9 H;  1UEB A;  2UXC L;  2OQ0 A;  1I94 L;  1FVI A;  1Q1B A;  2D62 A;  4A3E H;  4YWM A;  5M5W H;  4A3M H;  2K5H A;  2R7Z G;  2JA7 G;  1B7Y B;  5IE8 A;  1BBU A;  3FP9 A;  3CCQ A;  3CAM A;  1E7Z A;  3L2P A;  4DV2 L;  4AQY L;  2UUC Q;  4LF8 Q;  1Z9F A;  2JA5 H;  1G51 A;  1UE7 A;  4GKK Q;  4LF4 Q;  1B70 B;  1PYB A;  4JI1 Q;  1E3P A;  2N49 A;  4A3B H;  3CP0 A;  2GN5 A;  2IX1 A;  4XTC S;  1LYL A;  2VUM G;  4QIW E;  4JI6 L;  3CCU A;  2CQO A;  4GN5 A;  3E0E A;  1N36 Q;  4A3J H;  3D31 A;  2AKW B;  4OWX B;  1PVO A;  3FKI H;  4TVA B;  1Z47 A;  2KCT A;  4BBS H;  1VQF A;  3GTK H;  1P16 A;  2R92 G;  2WFW A;  2VQF L;  1WOC A;  4Y52 H;  2RF4 A;  4NXN Q;  1VQN A;  4GKJ Q;  4OX9 L;  1SRU A;  3BJU A;  3KYH C;  5LMN Q;  5IYD H;  1VQG A;  5JEA G;  4P74 A;  2MNA A;  2ID0 A;  3ER0 A;  2GVB A;  4IJH A;  3H15 A;  1YJN A;  1VQP A;  3H0G H;  3E9I A;  1MJC A;  4DUY Q;  2Q2I A;  2KHJ A;  3U50 C;  4LFB L;  3NEL A;  3GTQ H;  5IP7 H;  4B3S Q;  2K5V A;  3RLF A;  5M5X H;  4X64 Q;  1FJG Q;  2VS1 A;  3UDG A;  2BH2 A;  4LFC Q;  2I5H A;  2YV5 A;  4JYA Q;  1OXT A;  3G48 A;  1X56 A;  3HOV H;  5GRO A;  4POF A;  4UPA A;  1FL0 A;  4PZ7 A;  3CF5 A;  4DV0 Q;  1X65 A;  4RMF A;  1CKN A;  5FJ8 H;  5AJ3 Q;  1XMO Q;  1MJE A;  3A0J A;  3TRZ A;  4R4C A;  2CKZ B;  3FKI G;  3K80 C;  4POG A;  2A8V A;  2R92 H;  3I55 A;  1W2B A;  4NXM Q;  1Y1W G;  1SFO H;  2DGY A;  3T1Y Q;  3S15 H;  3UDI A;  5IY0 A;  3PIO A;  4IPC A;  3UE0 A;  4A4I A;  4A3F H;  4DUZ Q;  2JA6 H;  4JI8 L;  1EQQ A;  4DR3 L;  2D0O A;  2ZM6 L;  1VQ8 A;  4QL5 A;  3CPW A;  1HR0 Q;  4LFA L;  1M90 C;  1HZC A;  1VQI A;  2OWO A;  2MO0 A;  3EN2 A;  1VQK A;  3K0X A;  5IWA Q;  3CC4 A;  1EOV A;  2HIX A;  1GO3 E;  2IT1 A;  2R93 H;  3HOX G;  1C9O A;  1NBW A;  1IBK L;  4LFC L;  2I0Q A;  3CPF A;  5E7N A;  4NXN L;  4GNX C;  1VQ5 A;  4JI3 L;  2YTX A;  1LUZ A;  1GM5 A;  5BR8 L;  1SRO A;  1WCM H;  3HOZ G;  4LFB Q;  3PF4 A;  2NN6 I;  1IYJ B;  5C0X I;  1PH4 A;  1N8R C;  1X6O A;  4C3I H;  1VQO A;  1SE8 A;  3J80 c;  4B3M L;  1TXY A;  5IYB H;  1HZ9 A;  4B3M Q;  4BXX G;  3KJO A;  4QJF A;  1PH8 A;  2CWA A;  4OO1 I;  2JQO A;  2UXD L;  2YTV A;  5ELO A;  1IXR A;  5LMN W;  1HNX Q;  2E2I H;  4DR7 Q;  4B3T L;  4BBR G;  4DV4 L;  5JJL A;  1JT8 A;  2EQS A;  5GAG C;  4A3D G;  3TS0 A;  1HZA A;  1TWC H;  4YWK A;  4UP8 A;  4GNX B;  1I94 Q;  3HOV G;  4LF9 L;  1I5F A;  4JI1 L;  1VQH A;  4LF5 L;  1G29 1;  3F2D A;  1N33 L;  2UXB L;  1KHI A;  4A3K H;  1NMF A;  2NZH A;  1VQ7 A;  5FJ8 G;  5IWA L;  4DK6 C;  4JBK A;  4DR4 Q;  4AQY Q;  2UUC L;  3HOW H;  1BVS A;  3K81 C;  4KLK A;  3CMA A;  4DR6 Q;  1L1O C;  1N34 Q;  3A74 A;  5M5Y H;  3S1N H;  4C3H H;  1E22 A;  1O7I A;  4LWC A;  4DKA C;  4DV6 Q;  1QVG A;  4LF6 L;  4A93 G;  1HNW Q;  1PH3 A;  2H5X A;  4AH6 A;  3S14 H;  1E24 A;  4RG1 A;  2LSS A;  4KHP Q;  1L2F A;  2OTJ A;  3MEF A;  1EUJ A;  5AJ3 L;  4DV5 Q;  1XJV A;  2VQE L;  2K14 A;  1QUQ A;  4DV7 Q;  1QUQ B;  5C0X G;  3T1H L;  1Q81 C;  1VQC A;  2WB1 E;  4BY1 G;  1X54 A;  3I4N H;  1J5E L;  5EAY A;  3CW2 C;  3KOJ A;  2NVT H;  4JV5 L;  3PUY A;  4MZ9 A;  4LW1 A;  1I50 H;  1QZH A;  4DNI A;  4JG2 A;  4MTN A;  4X65 L;  5ELN A;  1IBL L;  1K8A C;  1HR0 W;  2CFM A;  4A3J G;  3M4O H;  3I7F A;  3ZJY C;  3PUV A;  3I4O A;  5GAH C;  3CCM A;  1PH1 A;  1K3R A;  4OO1 G;  4JC0 A;  1XMQ L;  4JI4 Q;  4IOA A;  3PO3 H;  2E5L Q;  3S1Q H;  3Q8D A;  2Z6K C;  1IL2 A;  1OXS C;  3CCJ A;  1I3Q H;  4R4I A;  2PQA B;  3W1B A;  3S24 A;  5HGQ A;  4GN3 B;  2UUB Q;  5M3F G;  3ULP A;  4B3T Q;  2UUA Q;  2MO1 A;  3HOZ H;  3M3Y H;  4IO9 A;  3EIV A;  3PCO B;  1AE3 A;  2E2J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...