2K4KA

Solution structure of gsp13 from bacillus subtilis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
b'MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General stress protein 13
publication title Solution structure of GSP13 from Bacillus subtilis exhibits an S1 domain related to cold shock proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Rna binding protein
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k4kA01
1GKHA 3ULJA 3PIOA 4LUVA 4OX9Q 4A3LH 2JJQA 1Y1VH 4A3EG 2WB1G 4O0AA 4JI1L 3RLOA 2B3GA 5C4XH 4B3RQ 4L5QA 5BR8L 1VQ5A 1E22A 1WYDA 1C9OA 4DR7L 1V9PA 2GN5A 3HOVH 4IPGA 3I4NG 4TVAB 1UE7A 1I94Q 5FLMG 2I5MX 5IP9H 3PUXA 1WOCA 1XMQL 1NMFA 5GROA 3G6EA 2VQEQ 4DV0Q 4HJ8A 2N3SA 1X3GA 4PMWA 3FKIH 3I7FA 3I4OA 4DR6Q 5H1SE 4JOIA 2F3IA 2ZJRA 5IE8A 4R4CA 3CD6A 4NPSA 3PCOB 3U58A 1MJCA 4O2DA 1HNZL 5GQOA 3GTQH 4BA1I 1L1OB 4DR2Q 1A0IA 4A3EH 4KHPL 1BBUA 1OTCA 2K5VA 4HJ7A 4DV2Q 1KRTA 4K0KL 3CW2C 1VQGA 4LUOA 3J81i 4DR3L 2E5LQ 2QEXA 1NTGA 1VQOA 3I4NH 5AJ3Q 4GNXC 5FLMH 1HNXQ 3S15H 2R7DA 1VQBA 1IXRA 4P71A 1LUZA 1OXTA 2E2JH 4HIOA 1N36Q 1SROA 2UU9L 1XNRL 2NVTH 3CCLA 4DK6C 2NVQH 3I4MG 3CP0A 3OW2A 2UXCL 1N33L 2PI2E 4DR5L 1Q8KA 3J80c 3NELA 1HNWL 4IPCA 2VQFL 4IO9A 2CFMA 1S40A 1PV4A 1IBML 2N78A 5JEAG 2RF4A 3EIVA 1NBWA 3TREA 1VQ6A 2NZOA 4R1JA 3L2PA 2OWOA 1CKNA 3S2DH 4LF7L 2RCNA 4AIMA 2FXQA 1VQCA 2Q2TA 1SE8A 2D0OA 2L15A 1VQKA 1Z47A 2JK8A 5DLQE 1J5EL 1HR0Q 3HOXG 1ASYA 4NB3A 1NE3A 4P73A 1D7QA 3BJUA 3GTKH 1RIPA 1PA6A 4LF9L 4JI6L 1CKNB 4PG3A 1X3FA 2Y0SE 1LM0A 2UUAL 1VQ8A 3I4MH 3HOYH 3PO2G 3FP9A 4DUZL 5JJLA 1CUKA 1UE6A 4ALPA 5JEAJ 4HIKA 3RZDH 4GKJQ 1IBLL 1EQQA 3KF8B 1K8GA 1HZCA 4JG2A 2VNUD 3HKSA 3CQZH 2YTYA 3GO5A 4LNQA 2F4VQ 3S1NH 2MFIA 1N34L 1O7IA 3CCUA 3UDGA 1PH7A 1SFOH 1SMXA 1WI5A 2UUCQ 5FJ8G 4GNXB 2BA0A 3HOXH 3F2DA 1VQDA 4B3TL 4XTCS 2JA6G 3GTGH 4RMFA 2KHJA 5C3EH 3TS2A 4DV4Q 1K9MC 5IWAQ 3K81C 1HR0W 1PH5A 2WFWA 3PO2H 1N32L 4LF6L 2CCZA 4A93G 1B8AA 2AWOA 3T1HQ 2NVYH 1LYLA 1HZ9A 3UDFA 3OYYA 4A3FG 3KF6B 1PH1A 1FJGQ 3PIPA 2PMZE 4A3MG 1JMCA 1EYGA 4LF5Q 3JAMc 3GTPH 2Z0SA 1VQJA 4L5TA 3KLWA 3D31A 3RLFA 2K4KA 3KJOA 3PF5A 3CCEA 4R4IA 3E9HA 2NN6I 4OX9L 1HZBA 5K36G 1TWCH 4YWMA 4X64Q 3NENA 3K7UC 4A3GG 3GTLH 4OXPA 4OONA 1L1OC 5IYCG 3S24A 4JBMA 5HY6A 4BY7H 1TWHH 4B3RL 1KAWA 2JA6H 2K52A 3U4VA 1AE2A 4YY3L 2E2HH 1TXYA 4JI8Q 1J6QA 3CPFA 3J81c 2ZM6Q 5ELNA 1VQEA 4DV0L 1I3QH 2VQEL 4BY1G 4AQYL 3PGZA 3CC2A 4A93H 3ERSX 3HOUH 4A3FH 1VQMA 4DR6L 3CCQA 4A3MH 3W5OA 4LWCA 5LMUQ 1UWVA 3UDIA 3S17H 4IFDI 2OQKA 2EQSA 5LMNQ 3K7AH 3HOUG 2ZTEA 3CMAA 4DR2L 3M4QA 4A3GH 3CMEA 5IYCH 4LFBQ 3RR5A 1TWFH 2I0QA 5EAYA 1VQNA 1UE5A 4YCUA 2E5LL 4PZ7A 1FGUA 4X65Q 2GVBA 3HKZE 4Y52H 5AJ3L 5E7NA 2YTXA 2N8NA 1TWAH 4LFAQ 2IX1A 1A63A 1YBYA 4LF8L 1QZGA 4BY1H 3I2ZA 4LFCQ 4GKKQ 2PQAB 2F52A 2VUMH 3CCVA 2VY3A 4IPHA 1VQ7A 1L1OA 4YCWA 4JI7Q 2MO1A 4QGUA 3JAMi 1YJ9A 1VQPA 4B3ML 4BBSG 4DKAC 4JV5Q 2UUBQ 3BZCA 1XPUA 4OWTB 4NXNL 4GN3B 2LXJA 2OCEA 1G51A 2Q2UA 4KI0A 3AFPA 4DK3C 3RZOH 3S14H 3EBEA 1PVOA 4JC0A 3I56A 4HJAA 1GD7A 2YTVA 5ELOA 3F2CA 1CSPA 1QUQA 3HFZB 1GVPA 4JBWA 3TEHB 4DV7Q 3H3VI 2BA1A 1H95A 2IY5B 1PH6A 3PV0A 3D0FA 1HR0L 3M4PA 1Z9FA 4C3IH 1N9WA 1R9TH 2WP8J 4HIMA 1WFQA 1ASZA 3E9IA 5M3MG 2UXBQ 3NBHB 2KHIA 2C35B 4LF4Q 3T1YL 1QUQB 3B6YA 5FLXc 4X62Q 4DV6Q 5C0XI 1S72A 3Q8DA 1EIFA 4BBSH 2EIFA 4DAYB 4Y7NH 4GKJL 1P8LA 1UEBA 1WCMG 4JBJA 4DV3Q 4QQBX 1SR3A 3M9BA 1HH2P 2Q2HA 5GAEC 4APVA 4GN5A 1B7YB 3MEFA 1Y1WG 2VW9A 4MTNA 1PH3A 3AFQA 1PH4A 4B3SL 4JI4Q 3NEMA 3CXCA 2Y0SG 4DUYQ 3A0JA 1A8VA 5M3FG 1VS0A 3DLLA 3UE0A 3STBC 1MIUA 5BR8Q 1KIXA 2ALYB 5M3MH 4GLVB 2JA5G 2XTIA 3CC7A 2B29A 3STBD 2I5LX 5IWAL 1X9NA 4MNOA 3VDYA 1N8RC 2JA7G 4DR4L 1L2FA 1L0WA 4GOPC 1XMOQ 4EQ5A 1XPOA 2ES2A 4JBKA 2QA4A 1VQLA 1XNQQ 4DV1L 3T1HL 3AEVA 4NXML 3PF4A 1OXVA 1G6PA 1FJGL 1EIYB 1JB7A 1X56A 1D8LA 3AQQA 4LF5L 1WCMH 1UE1A 1QVFA 4DAMA 3ZJYC 3M85A 4IOAA 1PHJA 3TS0A 4IJHA 1SLJA 4GNXA 1PFSA 2K5NA 4R4TA 2QGQA 4DV5L 3CCMA 4C3JH 3HOWG 3PUYA 1E24A 4KHPQ 1A62A 2Z6KC 4PZ6A 3G71A 1CKOA 1Q81C 1YZ6A 4XIGS 1DGSA 2MQHA 4YCVA 4DR1L 4GS3A 2VL6A 2ATWA 2JA5H 3PUWA 2K5HA 3KF6A 4JI8L 2ZM6L 1IZ6A 1Q7YC 2JA7H 2R93G 1EOVA 1MJEA 2A1AA 1FL0A 2V1CC 1PH8A 1C7YA 3ULPA 3J7A5 2NN6G 2UU9Q 2DUDA 1VCIA 2JA9A 1KHIA 3F2BA 3RN5A 1Q82C 1XNRQ 4OO1I 1BKBA 2K75A 4BBRG 5LMUL 1VQIA 2UXCQ 1Q1EA 2ID0A 2UXDQ 2IT1A 1HJPA 1U0LA 2OQ0A 4LW1A 4OWXB 4A3IG 4P74A 1HNWQ 3HOWH 4LFBL 3M4OH 4A3JG 3PSIA 4C3HH 4A3KG 3UE1A 2JQOA 4GLXA 4X65L 4UP9A 4UP8A 5GAGC 5FJ8H 1I50H 4JI7L 4LFAL 2PNHA 1K0RA 3CCRA 2R93H 2R6GA 4IFDG 3F1ZA 1BVSA 1J5EQ 4JI3Q 4GOPB 1I94L 3GDEA 4EX5A 4JI2Q 3H0GG 4A3BG 1YHBA 4KLKA 2Z6KA 4LF9Q 2RHQB 3I55A 1X54A 1CSQA 4P75A 1IBKQ 3HKZG 2AWNA 3CAMA 2A8VA 1PH9A 4JI5Q 1IBLQ 1EFWA 5IYDG 4A3JH 3KJPA 1XJVA 4L5RC 3JC66 4A3KH 1YHQA 4IFDJ 1Q86C 1NMGA 4DV2L 1G291 2PQAA 4QL5A 4WJ3M 2JE6I 2KENA 3KDFB 4C2MH 3OTOQ 2OTLA 3G48A 3GTMH 1QVCA 4RG1A 3H0GH 4X66Q 4A3BH 1HNXL 2BH2A 4LF4L 2RHSB 4MZ9A 4DPGA 4X62L 1OXSC 1K73C 2NVXH 5IP9G 1Y14B 3KFUA 1WJJA 1N36L 4WJ4A 2NZHA 1Q12A 2D62A 4DV3L 4IPDA 1JJCB 1X3EA 1JE5A 3MXNB 3BU2A 3K80C 4YHHQ 4JI4L 3S16H 2ZTDA 4DUYL 3TQYA 5LMNW 4JI0Q 2PI2A 4DNIA 3TRZA 5C0XG 1EWIA 2JEAI 4JYAQ 2D0PA 1T9HA 1W2BA 2XGTA 3S1MH 4YY3Q 3L7ZC 3ER0A 3F8TA 3S2HH 1GO3E 1V1QA 1SRUA 2YV5A 3ULLA 1K3RA 4A76A 1XMOL 1KRSA 2WAQG 1XNQL 2HT1A 1JT8A 4AQYQ 4J15A 2A19A 1E7ZA 2K50A 3H3VH 1C0AA 1YVCA 3WWVA 1K83H 2WB1E 4UY8C 2HIXA 2HHHQ 5C0XJ 1KL9A 2F4VL 2IHEA 3DM3A 1FVIA 3PUZA 2E2IH 2YYZA 2WAQE 4QIWE 2CQOA 4BXXG 4AYBG 4UPAA 1YI2A 4TQUS 2AMCB 2ZJPA 4A75A 2CWAA 1M90C 1VQ4A 3SGIA 2IHFA 2UUCL 4R4QA 1IL2A 4JI1Q 2YU9H 4BA2I 5IY0A 1YHAA 1OXUA 3GTJH 2KCTA 4POGA 1KD1C 2R92G 4LF8Q 4A3DG 4DR7Q 2E8GA 3GD7A 4DV4L 2IX0A 2I5HA 4YWLA 1K8AC 4YWKA 1CKMA 1XMQQ 3CCSA 2ASBA 3A5UA 1VQFA 3W1BA 3HOYG 4AYBE 4A3CG 1LTLA 1VQHA 2UXDL 4B3MQ 1NY4A 3BZKA 1Q46A 2LSSA 5JJIA 4PZ8A 4NXNQ 2K14A 1Y1WH 3A5ZB 1HNZQ 3K8AA 4BXXH 1XPRA 4X64L 1S3OA 2OTJA 5IP7G 3H15A 5GADC 4OO1G 5M3FH 4AH6A 2HQLA 3ICEA 4FDBA 4K0KQ 1B70B 4H02A 4IOCA 3A74A 2EXDA 1YJWA 2R7ZG 4JI3L 4DR3Q 2CWPA 2R92H 4A3DH 2MO0A 1KXLA 4JI2L 5C3EG 1E3PA 1EUJA 3PO3G 3M7NA 1SN8A 4HIDA 3T1YQ 2GVAA 3IRBA 5GAHC 4A3CH 1IBKL 3PUVA 1PH2A 4JI5L 4X6AH 5LMNL 1N33Q 5J3BA 4POFA 3G4SA 1RL2A 2AKWB 4DR5Q 4QY7A 1YNXA 1Q1BA 3AYHB 4QJFA 1E1OA 2VS1A 2VQFQ 4LUZA 5IP7H 4GOPA 4B3SQ 4HJ5A 3CF5A 1IBMQ 1KQSA 1JJ2A 3OTOL 1I5FA 1YJNA 1EQRA 5M5YH 4BY7G 3CC4A 2B63G 2R7ZH 1YITA 2DGYA 1VQ9A 3CPWA 4LF7Q 2R7FA 2ZTCA 4X66L 4HJ9A 3PO3H 5C4JH 1TWGH 4OWWB 4DR4Q 1BBWA 4LFCL 4GKKL 3U4ZA 5C44G 2ZJQA 2JA8G 4ME3A 1XTDA 3K0XA 2LXKA 3L0OA 1V43A 4GN4B 4BBRH 4DV1Q 1E1TA 2HIVA 1QVGA 2UUAQ 4JI6Q 4NXMQ 3J80i 1HZAA 4JCVE 4KHZA 5IYBG 4DUZQ 1GM5A 3RNUA 1X6OA 2UUBL 3GTOH 3KDFA 4JV5L 4YHHL 1YIJA 4A3IH 2Q2IA 3U50C 1I6HH 3HOZG 3E0EA 4R4OA 4JI0L 2H5XA 1NJIC 3RLNA 4DV5Q 1AH9A 4UP7A 4DV7L 1P16A 1X65A 1N34Q 2KCMA 1MKHA 3W1GA 3S1RH 2B63H 4JYAL 4A3LG 3J81j 5JJKA 1Y1VG 1PYBA 4DR1Q 3RN2A 1X55A 4IJLA 2MNAA 2CKZB 2KBNA 1AE3A 4JOIC 1KC8C 2JEBI 3LGJA 3KYHC 5C4XG 1QZHA 4GLAC 2UXBL 1W3SA 5C44H 1YEZA 3UDXA 5M5WH 4B3TQ 2JA8H 3S1QH 3HOVG 1IYJB 4DV6L 2VUMG 3M3YH 1U5KA 4L5SA 2AHOB 4LF6Q 1N32Q 5IYBH 3KOJA 1JJGA 1VQAA 4A4IA 5IT9c 2HHHL 3CCJA 2BH8A 1M1KC 3FKIG 2VZAA 1OXXK 3HOZH 5IYDH 4P72A 5HGQA 3FHWA 2N49A 3EN2A 5M5XH 3J7ZC 1PYSB
chains in the Genus database with same CATH superfamily
1GKHA 4OX9Q 1TS4A 3K5LA 2JJQA 3X3NA 4EQNA 3GTQB 2QF7A 1BCPD 4O0AA 4N8X1 4A3EB 1C9OA 4LJZC 3I4NG 5EKKA 3I73A 1OO9B 2I5MX 3PUXA 1WOCA 3UI2A 4IUPA 2KCCA 2WAQB 5H1SE 5IE8A 1TU2B 2B2WC 2RDHA 3PCOB 4JVZA 1EY9A 2B2YC 1CK1A 4O2DA 3U58A 2G5DA 2NVQB 2B8GA 4KHPL 2I46A 1OTCA 2MGSA 1G91A 3QB3A 3D4WA 3I4NH 2HCCA 4AYBB 5DAUA 1E2ZA 2UU9L 4HMJA 4YIJA 1SNDA 4HIOA 1BDOA 1N36Q 3Q6SA 4A3DB 1ZEQX 4K2KA 1Y69U 3GTKB 4DR5L 3A8KE 2RQXA 1WTQA 1HNWL 3T4AC 1PV4A 3EIVA 3RZDB 1NBWA 2NZOA 1CKNA 2BOSA 2RCNA 1X32A 4U673 3S1NB 1SE8A 2D0OA 1K3BC 2JK8A 5DLQE 1ASYA 3HOXG 3MZ5A 3N6RA 2O5IC 1STAA 1PA6A 4DXFA 1CKNB 4JI6L 3T13A 2F0GA 2PCFB 2IL8A 1VQ8A 3PO2G 2FHTA 1QG7A 5FO8B 4KTAA 1JOKA 3KF8B 3HKSA 2MFIA 2NB0A 3H6MA 3HZXA 3CCUA 1SMXA 3DEOA 5FJ8G 2BA0A 3HOXH 4DN4M 2JA6G 4B3TL 3FDTA 2PPBC 4BY7B 5C3EH 3TS2A 5C4ZA 1JOOA 1HR0W 1F2ZA 1RTNA 1PH5A 2WFWA 3PO2H 2EYFA 2NVYH 4A3FG 1PH1A 4KD3A 4A3MG 1AW7A 2SNMA 4A93B 1V1OA 1SYEA 3CCEA 1LTRD 4OX9L 1HZBA 4YWMA 4X64Q 2N88A 3K7UC 4HAEA 3GTLH 4OXPA 4JBMA 3K7AB 1ZXTA 5HY6A 2L12A 3BVGA 2ZXOA 2JA6H 4A3GB 4YY3L 1AE2A 2F0SA 2X69A 3DWQA 5CV7A 1TXYA 1SJHD 4JI8Q 4IALA 3J81c 3DWPA 1VQEA 2M00A 4A3FH 4A3MH 4O1NA 3W5OA 2VB2X 4BY1B 2E76C 2A68D 5LMUQ 2A69D 2OQKA 4RKBA 4C1NI 4KKUA 4MN3A 1QJOA 3KLSA 3CMEA 4LFBQ 1TWFH 1UAPA 3C1FA 5EAYA 3H91A 4CDDC 3E5SA 5E7NA 1HRJA 2N8NA 4LFAQ 2EY1A 1QZGA 1VMPA 3I2ZA 3CCVA 3SHLA 5I2XA 1VQ7A 2MO1A 4QGUA 1C4QA 2KEDA 2A73B 4DKAC 2UUBQ 1VMCA 5I6YA 2E2JB 3EA6A 2KUMA 2EVBA 1X3QA 4Y7NB 4G7HC 1R9TH 2JXMB 1CSPA 3HFZB 3TEHB 3F2CA 4DV7Q 1ZYRC 1TKWB 4K5VA 3PV0A 2B2TA 3D0FA 2Q8IB 4DA2A 1Z9FA 3IAYA 5IIFA 1I4QA 3J81E 1EQVA 3OMCA 4HCSA 1NR4A 4DV6Q 1S72A 1A3UA 4DAYB 1UEBA 1WCMG 4I7ZC 1SR3A 1IHZA 3TBIB 1SE2A 5LL6X 5ELFA 4IURA 1Y1WG 4KK7A 3V05A 1PH4A 2JYOA 3SEBA 4DXGA 4DUYQ 1JOQA 4CKCA 2ZXRA 2EE1A 2DJGC 2Y0SB 1BCPF 1CHQD 1MIUA 2ALYB 2JA5G 3CC7A 3QIAA 3ND9A 2I5LX 1L2FA 4EQ5A 3AEVA 2NTTA 4DV1L 5DEHA 3PF4A 1A6XA 2ICEC 1EIYB 2OF1A 1WCMH 3ZJYC 2JN4A 3TS0A 1QB5D 3MFYA 3CCMA 2MPMA 4N8FA 3PUYA 1Q81C 3EJIA 3G71A 4DFAA 1YZ6A 1U4RA 4YCVA 3X3MA 2VL6A 3HOWB 2JA5H 1GUSA 2K5HA 4JI8L 5JAVA 2B2UC 2PMZB 1DOKA 2KECA 1DD2A 1EY5A 1XNRQ 5D65A 4OO1I 2H1EA 1HTPA 5LMUL 3ITPA 2ID0A 2IT1A 1HJPA 4OWXB 1SAPA 5KNCA 3J7AV 4LFBL 4A3JG 3PSIA 3S17B 4GLXA 3T56B 1I50H 4LFAL 1K0RA 4DAVA 4IFDG 3R3OA 1BVSA 1J5EQ 1I94L 1LTSD 4EX5A 1CA5A 2Z6KA 4QUFA 5M9OA 2RHQB 3I55A 4M8AA 3H0GB 3HKZG 4KN7C 2AWNA 3I91A 2L1BA 4OL7A 1PH9A 3HRZC 2WKCA 4A3JH 1CZGA 3KJPA 1ILPA 1D5ZC 1YHQA 4IFDJ 2XWJB 3D4RA 3WDNA 1X3PA 1G291 2PQAA 3NTHA 1A15A 4QL5A 2DJFC 4C2MH 2F03A 3S16B 2J4XA 4IFDH 4U68A 4KKTA 3GTMH 4Q5VA 1MGSA 4UDUC 4KV6A 2BH2A 2NVXH 1Y14B 2D62A 3VYTA 2JP1A 4IPDA 1CI3M 2XIWA 1CZWA 2I07B 5CV8A 3JAME 1EEFD 1HPCA 4K5WA 4DUYL 4BBSB 3T16A 1SNCA 5LMNW 2F0NA 3TRZA 5C0XG 2JEAI 3PMFA 2D0PA 4KJNA 1T9HA 2E2IB 2SDFA 3F8TA 3C1EA 1GO3E 1V1QA 2YV5A 1Q90A 1V1PA 2WAQG 1TS2A 2EXZA 2F0MA 1JWMD 2SOBA 1E7ZA 3GTJB 3WWVA 1LT5D 2IPKD 5KYIA 4FF1A 3CRLC 5C0XJ 4R8NA 1KL9A 4FXKC 1U4MA 1AEXA 4FF4A 2F4VL 4IQZA 2QILA 1FVIA 4RGTA 1CQVA 2WAQE 3TP7A 2CQOA 5C0XH 4V190 4AYBG 1A3TA 4TQUS 5HURA 1BUVT 4ZCKA 4A75A 2UUCL 5IODA 4O42A 3ONAB 1IL2A 3U9SA 4BA2I 2L5TA 2BDOA 3PIP3 4RAUC 2O2LD 2VB3X 3OWEB 4LF8Q 4A3DG 2E8GA 3GD7A 2RKSA 4J8QA 2I5HA 2X6GA 1S5CD 1RHPA 4YWKA 1CKMA 2ASBA 4AYBE 5DM73 1VQHA 1BBXC 1EWHA 1ML0D 1PRTD 2LSSA 2HQEA 1SMYC 4NXNQ 3A5ZB 2OTJA 2Q8RE 1QCBD 3H15A 2EJFC 5M3FH 5I9OA 2EDGA 3U9OA 4A3DH 2MO0A 3E6ZX 4K5XA 5KRUA 1KXLA 5IGBA 1JWUD 2R7ZB 3MTSA 1F9PA 2CH4W 3I3CA 3LX0A 2CW0D 1TWGB 3J81L 1PH2A 1HTLD 2F0IA 4C56C 4GZYC 2PZTA 3G7LA 1N33Q 4POFA 3TMEA 1GHJA 2AKWB 1YNXA 3NTKA 1Q1BA 3AYHB 4FO2A 2VQFQ 4GOPA 4B3SQ 3H3VC 1S5ED 3Q24A 1K8MA 1T5EA 1KQSA 4BY7G 1YJNA 1LT4D 1YNND 4Q0FA 2ZTCA 4HJ9A 5C4JH 1HFNA 4CHTB 2ZJQA 1TT2A 4ME3A 4JI7L 4NXMQ 4EQPA 1O80A 4DUZQ 5IYBG 4KHZA 3KDFA 2IW3A 1YIJA 3M3YB 3U50C 1T5XD 4KJOA 2BE5D 1AH9A 1X65A 3W1GA 3HOZB 3NHHA 2RVLA 5J22A 1TR5A 2MNAA 2CKZB 4JOIC 1KC8C 4TKOB 3NXWA 1QZHA 2UXBL 3FEWX 1K0SA 3S1QH 4FF3A 3HOVG 5C4XB 4NMZA 1U5KA 4L5SA 1CA6A 5IYBH 1DZ1A 5IT9c 3CCJA 3FKIG 2VZAA 3VYUA 3EN2A 3J7ZC 1PYSB 5DNFA 1EYAA 4LUVA 3M7GA 1SSOA 1B9NA 3S9WA 4B3RQ 2RCFA 4PNYA 5BR8L 1WYDA 3C2PA 3HOVH 2HDLA 4IPGA 5FO7B 1BO0A 5EPLA 4DV0Q 3TDQA 3FKIH 3I7FA 3S15B 3QO2A 1PZID 1IW7D 4DR2Q 1BBUA 2K5VA 4HJ7A 2PNRC 2OT2A 1KRTA 4XT3B 4LUOA 3J81i 3CHBD 2E5LQ 3NSWA 1D5XC 4F88A 1VQOA 3MXGA 4GNXC 1HNXQ 3S2DB 4RCNA 1WTWA 1C8CA 2G9DA 2E2JH 1OXTA 1SROA 3SK5A 2NVTH 3CCLA 4E6IA 3IKJA 3CP0A 3OW2A 2UXCL 2MUYA 1N33L 2PI2E 1UUPA 3I4MB 3J80c 1B50A 3QOLA 5T1IA 2VQFL 2CFMA 4IZ8A 2R61A 2RF4A 3BYTB 3L2PA 2OWOA 3JAML 3OIPA 1JQYD 1PLFA 2EYOA 2FXQA 2B2WA 1Z47A 2B2YA 5IGCA 4NB3A 2TMPA 1SFOB 3BJUA 1RIPA 4LF9L 2EY2A 2Y0SE 5JJLA 5I9PA 3HOYH 3FP9A 4DUZL 1I6VC 4GKJQ 1EQQA 1U4PA 2VNUD 3CQZH 1O7ZA 4HTHA 3ZYYX 5JPNC 4F7XA 1DOMA 5C6AA 4G57A 1O7IA 2J7ZA 3GTPB 2A5HA 1PH7A 4FF2A 1WTRA 1WI5A 1EY6A 2RSOA 1NCVA 3F2DA 2WIIB 3GTGH 2KHJA 5EPJA 1CFMA 4DV4Q 1TWHB 2FINB 4J1MA 5IWAQ 3TN2A 3LWUA 2E2HB 5C3XA 3T1HQ 2F0TA 1LTGD 1HZ9A 3KF6B 5IGFA 3PIPA 2PMZE 4LF5Q 1EYGA 3NTIA 2Z0SA 1KDCA 1PRTF 2F3WA 4L5TA 3D31A 2K4KA 1B4OA 1AN8A 1EY8A 3J80E 1HA5A 2N55A 1DCZA 4OONA 3S24A 4FXGC 1FNVA 4B3RL 1KAWA 2RDFA 1CHPD 3U4VA 3T51B 3DM1A 3FMCA 1KLUD 2AUKA 3CPFA 1BF4A 5ELNA 4DV0L 1I3QH 3HOUH 2PZUA 3CCQA 4LWCA 1UWVA 3S17H 4IFDI 2VUMB 2EQSA 5LMNQ 1SXTA 5I4DA 4DR2L 3M4QA 3FRPB 5FKAC 2EZVA 1V8QA 1VQNA 1ESFA 1GUOA 2E5LL 4Y52H 3S14B 4B9XA 2YTXA 1A63A 1LACA 4C3IG 4LFCQ 2L11A 2VY3A 2HD3A 4WRDA 2L55A 3JAMi 5L37A 1IL8A 1B44D 4BBSG 3BZCA 1LTAD 3HEJA 4OWTB 2PQEA 1H95A 5C4HA 1G51A 1EY7A 3LNNA 3AFPA 3RZOH 1EL0A 4B9WA 4HJAA 4CJ1B 2YTVA 5ELOA 2XVSA 4JBWA 2BA1A 1NSNS 4FNFA 4C3IH 2WP8J 4HIMA 2K04A 1ASZA 3E9IA 4FYDA 2Z8LA 3T1YL 3OSOA 1ESRA 5C0XI 5M3MB 4BBSH 3SE0A 5FK9C 1C48A 3AB9A 4GKJL 4ID6A 1LTID 1HH2P 2LKVA 2D2CC 2Q2HA 5GAEC 1A2TA 4MTNA 3MXUA 4N9PA 3CXCA 1TIID 4C3JG 1A8VA 3EFXD 3VR2A 4FXDA 2CVRA 3OHXC 1X9NA 4DR4L 5IWAL 4MNOA 1EZ6A 3KF8A 4JBKA 3T1HL 4S3SA 3W2DA 1G6PA 1I4RA 2JA7B 3AQQA 4LF5L 5A2QE 3NWTA 2XRSD 1QVFA 4DAMA 1I4HA 2K5NA 5EQ0A 4R4TA 2RA4A 4C3JH 1S5DD 4ZQ3A 4OIKA 3A7AB 1PFBA 5C5MA 3R8BA 2MQHA 4DR1L 3M4OB 3NQTA 4C3HB 4XYOA 4ZK9B 1IZ6A 3SVMA 3Q22A 4BS9A 1MJEA 1F2MA 2A1AA 1SYCA 1FL0A 3D8GA 4G7ZC 1PH8A 2NN6G 1VCIA 2R93B 1KHIA 3RN5A 1Q82C 1BKBA 2K75A 4ODGA 2E74C 1EFID 2EYMA 2OQ0A 2QDBA 3DXJC 3I4LA 4P74A 2C9OA 3NK9A 3MXPA 1W6KA 3K59A 3RD4A 4A3KG 2QCPX 1R4PB 3CRKC 5FJ8H 1W6JA 1EIHA 3DWAA 2R6GA 2NN6H 4XXEA 1H9RA 3BS1A 3MHBA 4KLKA 2NTSA 1X54A 2M2LA 1TWAB 1IBKQ 4A3BB 1IBLQ 2B2UA 2R3ZA 1HFGA 4L5RC 1TY0A 3JC66 4A3KH 5AFWA 2F0JA 2K5WA 2F0PA 3OIQA 3OOCA 2JE6I 2KENA 4KMUC 4HN7A 4OELB 4X66Q 2RHSB 1STHA 1EEID 1OXSC 2D5DA 5IP9G 1N36L 4ABNA 4K14A 2Q8TA 1XYIA 4G7OC 3MXNB 1RD9D 1FR3A 1K83B 4DNRB 1BCPC 2PI2A 1RKNA 1GUGA 3J80L 4WJWA 2WV6D 3VR5A 3S1MH 4DAYA 3D4DA 3S2HH 2C5CA 1BOSA 2MJ8A 3KBGA 1SBBB 2HT1A 3BVMA 4JW0A 1JT8A 4ULLA 4AQYQ 2A19A 1BQQT 1C0AA 2QW7A 1YVCA 3OPOA 2WB1E 4LK1C 2K28A 1KDAA 4NW2A 1H9JA 4FP5D 1LLRD 3PUZA 5FOBB 1O7LA 2B39A 2AQ3B 1F9RA 1CM9A 1VQ4A 2KCNA 5CYUA 1LT6D 2KCTA 2R92G 2K5QA 1E2WA 2A6HC 3V96A 4RKLA 1XMQQ 1HUMA 1EU4A 1VQFA 1TY2A 4RGNA 4B3MQ 1NY4A 1QOHA 1PFNA 3BZKA 3Q23A 3A7LA 2CHBD 3TZUA 2D9UA 1Y1WH 5D14A 1HNZQ 1SMYD 2K01A 4X64L 5CORA 5C5LA 2EYPA 5GADC 2HQLA 4DGZA 1PTOB 4K0KQ 1YJWA 4H02A 2EXDA 1LTTD 2R92H 2CWPA 2QKIC 3I90A 2A74C 1SNMA 4KD4A 1IBKL 3PO3B 1KDBA 4EVOA 5J3BA 1YNJC 1RL2A 1SNQA 2RDGA 4QY7A 4BBRB 2NYZD 1GOZA 3GTOB 3CF5A 1JJ2A 1LO5D 4A3IB 3E0JA 1RJTA 3CC4A 4X66L 1ILQA 2HCIA 4HR7B 2B63B 2MHVA 1F2YA 2DN8A 3A8JE 5EGTA 2LXKA 2NZ1D 4RCOA 1A2UA 3PQIA 4MHEA 5C44B 2UUAQ 2JA8B 5M5WB 3J80i 4QMGA 2UUBL 2Q2IA 3E0EA 4R4OA 3TZDA 2HDMA 4DV5Q 3MVVA 4DV7L 2KCMA 3S1RH 4A3LG 5BN3A 1Y1VG 1HUNA 3RN2A 1X55A 1AE3A 3KYHC 1W3SA 1ENCA 4Z9CB 1F77A 3TSSA 1IYJB 1JE4A 4DV6L 2VUMG 2A69C 1QNKA 2AHOB 4LF6Q 3KOJA 1MI2A 1VQAA 4A4IA 1WTPA 1M1KC 2B2TC 3A55A 4UAIA 3C46A 1OXXK 5E3FA 3R2TA 2B2VC 1JWSD 3MA2B 3FHWA 5M5XH 2K33A 4A3LH 1Y1VH 4ZKBB 4A3EG 2EYHA 2B3GA 1DONA 1E22A 1PDQA 1PTOC 1V9PA 2F1MA 4TVAB 1UE7A 2DY7A 2EJGC 1HQRD 3R93A 2K6AA 1XMQL 1NMFA 5GROA 3G6EA 2VQEQ 3I4NB 2NUCA 1X3GA 4PMWA 1IKLA 4QIWB 3I72A 4DR6Q 4JOIA 2F3IA 2ZJRA 2WACA 3CD6A 4NPSA 4CGYB 1MJCA 1HNZL 3T53B 3L3OC 5GQOA 3GTQH 1PZKD 4BA1I 4F8MA 1L1OB 1CTMA 5CV4A 5JVH3 1DXMA 4A3EH 4WFN3 4DV2Q 4K0KL 3CW2C 2EOTA 1NTGA 5AJ3Q 3FPPA 1WTXA 3VR3A 3A54A 4KHVA 3VA5A 4P71A 1XNRL 1LUZA 4M1UB 4QUCA 2NVQH 2B8FA 3BG3A 4K6LA 1Z7TA 1LV9A 3SXHA 4XDXA 3I8ZA 1Q8KA 5IOCA 5EJWA 3NELA 2F0QA 1S40A 2P5ZX 1RCVD 5JEAG 3BDLA 3TREA 3SK4A 1JB3A 3MAQA 5ELBA 1JCKB 1VQCA 4NKLA 2Q2TA 2L15A 1VQKA 4PMCA 1HR0Q 1J5EL 4J6HA 1D1IA 1NE3A 3QOJA 1D7QA 3GTKH 5CV5A 4H7BA 4PG3A 2UUAL 3HOXB 1LM0A 1UE6A 5C3EB 4ALPA 5JEAJ 4HIKA 3RZDH 4LMQD 2ENBA 1K8GA 2F0DA 2NVYB 5JEAH 4LNQA 2EJMA 2YTYA 3P1HA 4RH6A 3S1NH 5TSSA 3UDGA 5JVG3 4CDCC 4GNXB 4XTCS 4IN3A 4RMFA 1EOTA 3GTLB 1K9MC 3LWEA 3K81C 4LF6L 2CCZA 4K6DA 4A93G 2PO4A 2AWOA 1LYLA 5CV6A 1FJGQ 4KY5A 4X3KA 1VQJA 3RLFA 3K5NA 4A3FB 4A3MB 2NN6I 5K36G 3NENA 4A3GG 1L1OC 3BDCA 4BY7H 3QWNA 1KLGD 5KEEA 2K52A 1TWFB 1TS5A 1J6QA 4H0LC 4A93H 2VQEL 4BY1G 3CC2A 3EVQA 2L4NA 2SNSA 4DR6L 1KABA 3UDIA 2VXWA 3K7AH 5K36H 1AFPA 1UEAB 4A3GH 1UE5A 4PZ7A 2LS01 1Y8OB 2GVBA 5AJ3L 1TWAH 1R9TB 1YBYA 4CKBA 4LF8L 3ERQA 2WB1B 4BY1H 4GKKQ 4P2CB 2F52A 4IPHA 4JPBW 3GQBA 1U9RA 4JV5Q 4I65A 1XPUA 2EY6A 4NXNL 4GN3B 2OCEA 4KI0A 4DK3C 4JC0A 1FGBD 1QUQA 4K8JA 1Q3LA 4JK1C 2IY5B 1HR0L 3M4PA 2KEEA 1WFQA 3NBHB 1SE4A 4HCEA 2C35B 1QUQB 2PW7A 3B6YA 5FLXc 2FMCA 5EKLA 4DU9A 2EIFA 4IUQA 4Y7NH 1SYGA 1P8LA 4DV3Q 4JBJA 5IT9E 4XYQA 4QQBX 3M9BA 4HEDA 3J7YW 2K1BA 4OGQC 3SDZA 3HGBA 4GN5A 2VW9A 4JI4Q 1WCMB 3AFQA 4B3SL 3NEMA 1I4XA 2Y0SG 5G3LD 2DNCA 2LMCB 3L9AX 3DLLA 5BN4A 3STBC 4GLVB 3K6OA 1EY4A 5A35A 2M9VA 4NP5A 4GOPC 1XMOQ 1XNQQ 1MHWC 2JA5B 2MP1A 4NXML 1OXVA 1FJGL 1HQMC 1JB7A 4KN4C 1D8LA 4HSVA 3VR6A 4IOAA 3O13A 4IJHA 1PFSA 2WINB 2QGQA 3HOWG 4KHPQ 1E24A 1A62A 4PZ6A 1CKOA 4XIGS 1DGSA 2ATWA 3MC0B 3KF6A 1TWCB 1VDZA 4CJ2C 3ULPA 3J7A5 1I50B 2UU9Q 3OW7A 2XRQD 5FLXE 1B3AA 4BBRG 1VQIA 1Q1EA 2UXDQ 1U0LA 4LW1A 4K2LA 5LL6S 2EY5A 4OHJA 5T1GA 4F87A 4A3IG 4EQOA 4V0BA 1HNWQ 3HOWH 2XNAC 5EBCA 1YNNC 1AZPA 3UE1A 2F0KA 4UP9A 4A3JB 5GAGC 1B1ZA 3QR8A 1R4QB 3CCRA 4CDFC 1L0XB 5KGUA 3GDEA 4C2MB 3H0GG 4ILWA 1QE6A 2A6EC 1GHKA 3GTMB 5CR3A 1CSQA 5FO9B 5CBAE 5F2DA 3DUZA 2A8VA 3FPUB 1EY0A 2PYKA 4JI5Q 1RODA 2NVXB 3HKZB 5IYDG 1XJVA 3P75A 2LFNA 1NMGA 1E0BA 4KY7A 2OTLA 3G48A 1QVCA 4RG1A 4XQQA 3H0GH 1HNXL 4DPGA 1S4ZA 2CQAA 1ICFB 1RTOA 1PZJD 1K73C 3KFUA 1WJJA 4WJ4A 1IYVA 2NZHA 4DV3L 4N9TA 1JJCB 1JE5A 2O5JC 2V4DA 5D3DA 4QCLA 3BU2A 3K80C 4JI4L 3S16H 3QJYA 3TQYA 1EWIA 1O78A 2F0UA 3KUPA 1SJED 1W2BA 1ZYRD 4YY3Q 3V2TA 3D6WA 4DAPA 3ER0A 2LY7A 1SRUA 1XMOL 4A76A 1XNQL 4R8IA 3H3VH 3I70A 1J9OA 3NP8A 4UY8C 2KVMA 1IW7C 2X6LA 1GUNA 3KLRA 2IHEA 3DM3A 2E2IH 4QIWE 1SYDA 1FD7D 4BXXG 2AMCB 3G6JB 2ZJPA 3SGIA 4R4QA 4JI1Q 1OXUA 1SYBA 4XQJA 3GTJH 4POGA 4DR7Q 4DV4L 5M3FB 2BCOA 2IX0A 3W3AA 1S5BD 4YWLA 3NWSA 3J7AF 2A6HD 3A5UA 2UXDL 5I2YA 1EYCA 1Q46A 5JJIA 4PZ8A 2K14A 1BCPB 3K8AA 2PW5A 5LHY1 4BXXH 1AP0A 4CDEC 5CMDA 1II3A 1ET6A 3URYA 3ICEA 2J0TD 1MSHA 3A74A 2R7ZG 4DR3Q 2KOLA 1PMRA 5C3EG 1E3PA 1EUJA 1HA6A 1SN8A 2GVAA 5GAHC 2QEJC 1ENFA 2TSSA 5C4JB 1STGA 4JI5L 5LMNL 5C3WA 3G4SA 1PFMA 4X3UA 5J1ZA 4QJFA 1YNJD 2VS1A 3P7JA 4LUZA 1CT1D 5IT9L 1IBMQ 2K05A 4C1NK 5G3LF 3TP5A 1I5FA 1KAAA 2R7ZH 1YITA 1RDPD 1XTCD 2DGYA 5E4XA 3CPWA 1VQ9A 4LF7Q 3KBXA 1BR9A 1TWGH 3NBIA 4LFCL 3U4ZA 1I4GA 2F4IA 1STYA 4GN4B 3K0XA 3L0OA 4DV1Q 1E1TA 2HIVA 1QVGA 3S1QB 4JCVE 1GM5A 1IKMA 3A8IE 3RNUA 3HOZG 1GUWA 3RLNA 1ENAA 4UP7A 1N34Q 3J81j 5JJKA 5EBDA 1PYBA 4IJLA 2KBNA 3VR4A 2JEBI 2Z1CA 5C4XG 4GLAC 3MXNA 3TP8A 3M3YH 1N32Q 1JJGA 3HOVB 2BH8A 5FLXL 3HOZH 1J8IA 5IGDA 5HGQA 3FKIB 3ULJA 3PIOA 1XX8A 2K03A 2WB1G 2DNEA 4JI1L 3RLOA 5C4XH 5KNBA 4L5QA 1VQ5A 2FMMA 3FVQA 4DR7L 1KNEA 2F0EA 2GN5A 1LTBD 1I94Q 5EPKA 5FLMG 1PTOD 5IP9H 4HJ8A 1M4VA 2N3SA 2YU9B 2BDNA 3I4OA 4L8JA 4R4CA 1LT3D 5DM63 1TVXA 2NVTB 3MEHA 1A0IA 5J39A 4IUVA 3DEPA 1VQGA 4LAAA 4DR3L 2QEXA 1LABA 5ELCA 2B2VA 2AQ1B 5FLMH 3GV3A 3S15H 2R7DA 1BNZA 4ZUIA 1QWYA 1VQBA 1IXRA 3K5OA 3SK6A 4RGMA 1WD0A 3IFDA 1B3QA 4DK6C 3I4MG 1EWCA 2AQ2B 2KA7A 1JORA 4BWGB 3K57A 1VF5C 1Q8IA 3HOYB 4IPCA 4IO9A 5COYA 1IBML 4OIJA 2N78A 1Y8NB 1VQ6A 3NPPA 4R1JA 3S2DH 4LF7L 1SDFA 1H9KA 2JSOA 3CQZB 4RFBA 4AIMA 3D6CA 2XN9C 2NWGA 2CH4A 2F3VA 4P73A 1FNUA 1G8ZD 5M5YB 1G2TA 3C3LA 1X3FA 3I4MH 3GTGB 4X3TA 1CUKA 1STBA 2HUGA 3TP6A 3QG1A 1ZKOA 1IBLL 1HZCA 4JG2A 2IX3A 2F4VQ 3GO5A 4KKSA 1N34L 1B9MA 1STEA 1SFOH 2UUCQ 5CGKA 3KK7A 1I6HB 5CC4A 1VQDA 4L63B 1EYDA 2F0VA 3WOEA 2K32A 4H44C 2F0LA 3RUZA 1N32L 1B8AA 2WKDA 3UDFA 3OYYA 1I4PA 1JMCA 1I3QB 3JAMc 3GTPH 3SR1A 3HOUB 3KLWA 3KJOA 3PF5A 3KLSX 4R4IA 2OEOA 3Q0AA 3E9HA 1TWCH 5A2QL 5IYCG 4ZYSA 5D3IB 1MSGA 1TWHH 4I7AA 5NUCA 2G9HD 1SEBD 3CU7A 1D5MC 5JJZA 5CV9A 2E2HH 1FYCA 1NAPA 2ZM6Q 2DY8A 4AQYL 2SEBD 3PGZA 1B53A 3ERSX 5KYLA 2A68C 1VQMA 4XT1B 1NR2A 1RF2D 2ZTEA 3CMAA 4ZAIA 5IYCH 2ICIA 3RR5A 3OMGA 4H13C 1EQTA 2I0QA 3IL8A 4DK1A 4YCUA 1HXYD 1FGUA 3RZOB 4X65Q 3HKZE 2IX1A 4XQNA 2PQAB 2VUMH 1F9QA 1L1OA 1SE3A 4YCWA 4C3IB 4JI7Q 4ZUJA 1YJ9A 1VQPA 4B3ML 3VA7A 4NDXA 1H9SA 2QDLA 2LXJA 2Q2UA 3S14H 3EBEA 1PVOA 3I56A 1GD7A 4KY6A 1ET9A 1GVPA 2Z9HA 1WD1A 3H3VI 1KNAA 1PH6A 4WORA 1H9SB 1UNSA 1N9WA 2UXBQ 5JOBA 4HMIA 5M3MG 4MTKA 2KHIA 4LF4Q 2K7VA 4X62Q 1CQFA 1PYWD 3Q8DA 4RHSA 1EIFA 4R9WA 2XWBB 1V1PB 4HSPA 4APVA 1B7YB 3MEFA 1PH3A 4IUUA 3GP7A 3A0JA 3E3XA 3HP3A 3NUCA 1PXUA 5M3FG 1VS0A 1DYQA 3K5MA 3UE0A 2OXPA 5BR8Q 3K0YA 1BXTA 4C3JB 5M3MH 1KIXA 1XXGA 5ISRA 5ELEA 2XTIA 2B29A 3STBD 3D3RA 1N8RC 3VDYA 2JA7G 1EU3A 1L0WA 1WTVA 1SYFA 5I6WA 1XPOA 2ES2A 1PTOF 1M8AA 1Y8PB 2QA4A 1VQLA 1X56A 3VYRA 1UE1A 1WTHA 3M85A 1SNPA 1PHJA 4RWSC 3PO2B 1SLJA 4GNXA 1L0YB 3DMUA 3GV6A 3EQLC 5E4WC 4DV5L 3RMHA 2Z6KC 4C3HG 2PZWA 4QB4A 5KIXA 2EPBA 4GS3A 1IYUA 2EYJA 3PUWA 2ZM6L 1Q7YC 2JA7H 2R93G 1EOVA 1E2VA 3F2UA 2V1CC 1C7YA 2JA6B 2DUDA 2JA9A 3R2IA 3F2BA 1QILA 4IUNA 1F2LA 2Z4IA 2UXCQ 3MWYW 1G6ZA 2F0FA 1GUTA 1B2TA 3M4OH 4C3HH 3H94A 2JQOA 4X65L 4UP8A 4A3KB 2PNHA 2R93H 3F1ZA 4JI3Q 4GOPB 2XSCA 2Z4HA 2KQ3A 4JI2Q 4A3BG 1YHBA 1PRTB 1A3VA 4LF9Q 4P75A 4EGVA 1G2SA 1TS3A 2A6ED 2ZXPA 3OWFA 2ZT9C 3CAMA 1EFWA 4OEMB 3HS0C 5HGTA 1Q86C 4ZKCB 3H09A 4DV2L 1GXDC 4WJ3M 1U4LA 4CJ0B 3KDFB 3OTOQ 1QNUA 1WVLA 4A3BH 4LF4L 4MZ9A 4X62L 4ZLTF 3S1MB 1Z6HA 2KJXA 4ZRZA 1Q12A 3S2HB 3BZDB 1X3EA 5E1FA 4YHHQ 3M4YA 4TSSA 2ZTDA 3BDOA 4JI0Q 3NBHA 2L0CA 4DNIA 1ONLA 1NUCA 3NQIA 4DK0A 3DHQA 4JYAQ 1ICWA 4G4KA 4X3SA 2XGTA 3L7ZC 2IWHA 2NBFA 3A56A 3ULLA 1K3RA 1KRSA 2F0OA 4J15A 5KNDA 2K50A 1K83H 2HIXA 1JC7A 1MD2D 2HHHQ 1TQOA 1HCZA 1MBYA 5JPMC 1DM0B 2YYZA 4UPAA 4DF7A 1YI2A 4CBVA 3BVZA 4RA8A 2RSNA 1O7YA 2CWAA 3SK8A 1Y1WB 1M90C 2IHFA 3N52A 5CBEE 4UHVA 1NNXA 1XWEA 4TRDA 1K28A 2YU9H 5IY0A 1YHAA 2AUJD 1KD1C 1JICA 4PQXA 1DOLA 2FJ2A 2IJ0A 4FVMA 2R92B 1K8AC 3CCSA 1PRTC 3W1BA 3HOYG 4A3CG 1D2BA 1LTLA 3ND8A 5ELDA 4DNTB 4MIUA 1JR0D 3MFGA 1XPRA 1S3OA 5IGEA 1GJXA 5IP7G 5EKIA 4OO1G 4AH6A 5IGGA 4FDBA 1B70B 4IOCA 3WOFA 3K58A 4JI3L 5BN5A 1SNOA 4JI2L 4RHRA 4L6TB 3PO3G 3M7NA 2Z6BA 4HIDA 1HHVA 3T1YQ 2CW0C 3IRBA 4A3CH 3PUVA 4QF4A 3AU7A 4ME5A 3PIO3 4B08A 2F0HA 4X6AH 1D6EC 1DJRD 4DR5Q 1EZ8A 1PTOH 3HG9A 4PMBA 1E1OA 2O4XA 5IP7H 4OO1H 4HJ5A 3EROA 3OTOL 2K5DA 1EQRA 5M5YH 4IUTA 2B63G 2R7FA 3PO3H 3S1RB 2EYLA 4OWWB 4DR4Q 1BBWA 4GKKL 1H9MA 5C44G 2JA8G 3IFTA 1XTDA 3HOUG 1V43A 2GA4B 4BBRH 4JI6Q 4CKEA 2FFKB 1HZAA 2H4OA 3GTOH 4JV5L 1X6OA 2BE5C 4YHHL 4A3IH 1WTOA 2F0WA 1I6HH 4RGOS 4JI0L 3CKIB 2H5XA 1NJIC 5K5PA 1P16A 3P20A 2B63H 1MKHA 3AMUA 1F9SA 1AZQA 4JYAL 1KTKA 1STNA 3BYYB 4DR1Q 4K8IA 1D1KA 5M5XB 2L9HA 3VYSA 3LGJA 3NE5B 1VF7A 1Y1VB 2E2DC 1YEZA 3UDXA 5M5WH 5C44H 4B3TQ 2JA8H 1FNWA 1S5FD 1K8OA 2RBMA 2E75C 4PV1C 2HHHL 5IYDH 4P72A 1EIGA 2N49A 2KHSA
chains in the Genus database with same CATH topology
1GKHA 3ULJA 3PIOA 4LUVA 4OX9Q 4A3LH 2JJQA 1Y1VH 4A3EG 2WB1G 4O0AA 4JI1L 3RLOA 2B3GA 5C4XH 4B3RQ 4L5QA 5BR8L 1VQ5A 1E22A 1WYDA 1C9OA 4DR7L 1V9PA 2GN5A 3HOVH 4IPGA 3I4NG 4TVAB 1UE7A 1I94Q 5FLMG 2I5MX 5IP9H 3PUXA 1WOCA 1XMQL 1NMFA 5GROA 3G6EA 2VQEQ 4DV0Q 4HJ8A 2N3SA 1X3GA 4PMWA 3FKIH 3I7FA 3I4OA 4DR6Q 5H1SE 4JOIA 2F3IA 2ZJRA 5IE8A 4R4CA 3CD6A 4NPSA 3PCOB 3U58A 1MJCA 4O2DA 1HNZL 5GQOA 3GTQH 4BA1I 1L1OB 4DR2Q 1A0IA 4A3EH 4KHPL 1BBUA 1OTCA 2K5VA 4HJ7A 4DV2Q 1KRTA 4K0KL 3CW2C 1VQGA 4LUOA 3J81i 4DR3L 2E5LQ 2QEXA 1NTGA 1VQOA 3I4NH 5AJ3Q 4GNXC 5FLMH 1HNXQ 3S15H 2R7DA 1VQBA 1IXRA 4P71A 1LUZA 1OXTA 2E2JH 4HIOA 1N36Q 1SROA 2UU9L 1XNRL 2NVTH 3CCLA 4DK6C 2NVQH 3I4MG 3CP0A 3OW2A 2UXCL 1N33L 2PI2E 4DR5L 1Q8KA 3J80c 3NELA 1HNWL 4IPCA 2VQFL 4IO9A 2CFMA 1S40A 1PV4A 1IBML 2N78A 5JEAG 2RF4A 3EIVA 1NBWA 3TREA 1VQ6A 2NZOA 4R1JA 3L2PA 2OWOA 1CKNA 3S2DH 4LF7L 2RCNA 4AIMA 2FXQA 1VQCA 2Q2TA 1SE8A 2D0OA 2L15A 1VQKA 1Z47A 2JK8A 5DLQE 1J5EL 1HR0Q 3HOXG 1ASYA 4NB3A 1NE3A 4P73A 1D7QA 3BJUA 3GTKH 1RIPA 1PA6A 4LF9L 4JI6L 1CKNB 4PG3A 1X3FA 2Y0SE 1LM0A 2UUAL 1VQ8A 3I4MH 3HOYH 3PO2G 3FP9A 4DUZL 5JJLA 1CUKA 1UE6A 4ALPA 5JEAJ 4HIKA 3RZDH 4GKJQ 1IBLL 1EQQA 3KF8B 1K8GA 1HZCA 4JG2A 2VNUD 3HKSA 3CQZH 2YTYA 3GO5A 4LNQA 2F4VQ 3S1NH 2MFIA 1N34L 1O7IA 3CCUA 3UDGA 1PH7A 1SFOH 1SMXA 1WI5A 2UUCQ 5FJ8G 4GNXB 2BA0A 3HOXH 3F2DA 1VQDA 4B3TL 4XTCS 2JA6G 3GTGH 4RMFA 2KHJA 5C3EH 3TS2A 4DV4Q 1K9MC 5IWAQ 3K81C 1HR0W 1PH5A 2WFWA 3PO2H 1N32L 4LF6L 2CCZA 4A93G 1B8AA 2AWOA 3T1HQ 2NVYH 1LYLA 1HZ9A 3UDFA 3OYYA 4A3FG 3KF6B 1PH1A 1FJGQ 3PIPA 2PMZE 4A3MG 1JMCA 1EYGA 4LF5Q 3JAMc 3GTPH 2Z0SA 1VQJA 4L5TA 3KLWA 3D31A 3RLFA 2K4KA 3KJOA 3PF5A 3CCEA 4R4IA 3E9HA 2NN6I 4OX9L 1HZBA 5K36G 1TWCH 4YWMA 4X64Q 3NENA 3K7UC 4A3GG 3GTLH 4OXPA 4OONA 1L1OC 5IYCG 3S24A 4JBMA 5HY6A 4BY7H 1TWHH 4B3RL 1KAWA 2JA6H 2K52A 3U4VA 1AE2A 4YY3L 2E2HH 1TXYA 4JI8Q 1J6QA 3CPFA 3J81c 2ZM6Q 5ELNA 1VQEA 4DV0L 1I3QH 2VQEL 4BY1G 4AQYL 3PGZA 3CC2A 4A93H 3ERSX 3HOUH 4A3FH 1VQMA 4DR6L 3CCQA 4A3MH 3W5OA 4LWCA 5LMUQ 1UWVA 3UDIA 3S17H 4IFDI 2OQKA 2EQSA 5LMNQ 3K7AH 3HOUG 2ZTEA 3CMAA 4DR2L 3M4QA 4A3GH 3CMEA 5IYCH 4LFBQ 3RR5A 1TWFH 2I0QA 5EAYA 1VQNA 1UE5A 4YCUA 2E5LL 4PZ7A 1FGUA 4X65Q 2GVBA 3HKZE 4Y52H 5AJ3L 5E7NA 2YTXA 2N8NA 1TWAH 4LFAQ 2IX1A 1A63A 1YBYA 4LF8L 1QZGA 4BY1H 3I2ZA 4LFCQ 4GKKQ 2PQAB 2F52A 2VUMH 3CCVA 2VY3A 4IPHA 1VQ7A 1L1OA 4YCWA 4JI7Q 2MO1A 4QGUA 3JAMi 1YJ9A 1VQPA 4B3ML 4BBSG 4DKAC 4JV5Q 2UUBQ 3BZCA 1XPUA 4OWTB 4NXNL 4GN3B 2LXJA 2OCEA 1G51A 2Q2UA 4KI0A 3AFPA 4DK3C 3RZOH 3S14H 3EBEA 1PVOA 4JC0A 3I56A 4HJAA 1GD7A 2YTVA 5ELOA 3F2CA 1CSPA 1QUQA 3HFZB 1GVPA 4JBWA 3TEHB 4DV7Q 3H3VI 2BA1A 1H95A 2IY5B 1PH6A 3PV0A 3D0FA 1HR0L 3M4PA 1Z9FA 4C3IH 1N9WA 1R9TH 2WP8J 4HIMA 1WFQA 1ASZA 3E9IA 5M3MG 2UXBQ 3NBHB 2KHIA 2C35B 4LF4Q 3T1YL 1QUQB 3B6YA 5FLXc 4X62Q 4DV6Q 5C0XI 1S72A 3Q8DA 1EIFA 4BBSH 2EIFA 4DAYB 4Y7NH 4GKJL 1P8LA 1UEBA 1WCMG 4JBJA 4DV3Q 4QQBX 1SR3A 3M9BA 1HH2P 2Q2HA 5GAEC 4APVA 4GN5A 1B7YB 3MEFA 1Y1WG 2VW9A 4MTNA 1PH3A 3AFQA 1PH4A 4B3SL 4JI4Q 3NEMA 3CXCA 2Y0SG 4DUYQ 3A0JA 1A8VA 5M3FG 1VS0A 3DLLA 3UE0A 3STBC 1MIUA 5BR8Q 1KIXA 2ALYB 5M3MH 4GLVB 2JA5G 2XTIA 3CC7A 2B29A 3STBD 2I5LX 5IWAL 1X9NA 4MNOA 3VDYA 1N8RC 2JA7G 4DR4L 1L2FA 1L0WA 4GOPC 1XMOQ 4EQ5A 1XPOA 2ES2A 4JBKA 2QA4A 1VQLA 1XNQQ 4DV1L 3T1HL 3AEVA 4NXML 3PF4A 1OXVA 1G6PA 1FJGL 1EIYB 1JB7A 1X56A 1D8LA 3AQQA 4LF5L 1WCMH 1UE1A 1QVFA 4DAMA 3ZJYC 3M85A 4IOAA 1PHJA 3TS0A 4IJHA 1SLJA 4GNXA 1PFSA 2K5NA 4R4TA 2QGQA 4DV5L 3CCMA 4C3JH 3HOWG 3PUYA 1E24A 4KHPQ 1A62A 2Z6KC 4PZ6A 3G71A 1CKOA 1Q81C 1YZ6A 4XIGS 1DGSA 2MQHA 4YCVA 4DR1L 4GS3A 2VL6A 2ATWA 2JA5H 3PUWA 2K5HA 3KF6A 4JI8L 2ZM6L 1IZ6A 1Q7YC 2JA7H 2R93G 1EOVA 1MJEA 2A1AA 1FL0A 2V1CC 1PH8A 1C7YA 3ULPA 3J7A5 2NN6G 2UU9Q 2DUDA 1VCIA 2JA9A 1KHIA 3F2BA 3RN5A 1Q82C 1XNRQ 4OO1I 1BKBA 2K75A 4BBRG 5LMUL 1VQIA 2UXCQ 1Q1EA 2ID0A 2UXDQ 2IT1A 1HJPA 1U0LA 2OQ0A 4LW1A 4OWXB 4A3IG 4P74A 1HNWQ 3HOWH 4LFBL 3M4OH 4A3JG 3PSIA 4C3HH 4A3KG 3UE1A 2JQOA 4GLXA 4X65L 4UP9A 4UP8A 5GAGC 5FJ8H 1I50H 4JI7L 4LFAL 2PNHA 1K0RA 3CCRA 2R93H 2R6GA 4IFDG 3F1ZA 1BVSA 1J5EQ 4JI3Q 4GOPB 1I94L 3GDEA 4EX5A 4JI2Q 3H0GG 4A3BG 1YHBA 4KLKA 2Z6KA 4LF9Q 2RHQB 3I55A 1X54A 1CSQA 4P75A 1IBKQ 3HKZG 2AWNA 3CAMA 2A8VA 1PH9A 4JI5Q 1IBLQ 1EFWA 5IYDG 4A3JH 3KJPA 1XJVA 4L5RC 3JC66 4A3KH 1YHQA 4IFDJ 1Q86C 1NMGA 4DV2L 1G291 2PQAA 4QL5A 4WJ3M 2JE6I 2KENA 3KDFB 4C2MH 3OTOQ 2OTLA 3G48A 3GTMH 1QVCA 4RG1A 3H0GH 4X66Q 4A3BH 1HNXL 2BH2A 4LF4L 2RHSB 4MZ9A 4DPGA 4X62L 1OXSC 1K73C 2NVXH 5IP9G 1Y14B 3KFUA 1WJJA 1N36L 4WJ4A 2NZHA 1Q12A 2D62A 4DV3L 4IPDA 1JJCB 1X3EA 1JE5A 3MXNB 3BU2A 3K80C 4YHHQ 4JI4L 3S16H 2ZTDA 4DUYL 3TQYA 5LMNW 4JI0Q 2PI2A 4DNIA 3TRZA 5C0XG 1EWIA 2JEAI 4JYAQ 2D0PA 1T9HA 1W2BA 2XGTA 3S1MH 4YY3Q 3L7ZC 3ER0A 3F8TA 3S2HH 1GO3E 1V1QA 1SRUA 2YV5A 3ULLA 1K3RA 4A76A 1XMOL 1KRSA 2WAQG 1XNQL 2HT1A 1JT8A 4AQYQ 4J15A 2A19A 1E7ZA 2K50A 3H3VH 1C0AA 1YVCA 3WWVA 1K83H 2WB1E 4UY8C 2HIXA 2HHHQ 5C0XJ 1KL9A 2F4VL 2IHEA 3DM3A 1FVIA 3PUZA 2E2IH 2YYZA 2WAQE 4QIWE 2CQOA 4BXXG 4AYBG 4UPAA 1YI2A 4TQUS 2AMCB 2ZJPA 4A75A 2CWAA 1M90C 1VQ4A 3SGIA 2IHFA 2UUCL 4R4QA 1IL2A 4JI1Q 2YU9H 4BA2I 5IY0A 1YHAA 1OXUA 3GTJH 2KCTA 4POGA 1KD1C 2R92G 4LF8Q 4A3DG 4DR7Q 2E8GA 3GD7A 4DV4L 2IX0A 2I5HA 4YWLA 1K8AC 4YWKA 1CKMA 1XMQQ 3CCSA 2ASBA 3A5UA 1VQFA 3W1BA 3HOYG 4AYBE 4A3CG 1LTLA 1VQHA 2UXDL 4B3MQ 1NY4A 3BZKA 1Q46A 2LSSA 5JJIA 4PZ8A 4NXNQ 2K14A 1Y1WH 3A5ZB 1HNZQ 3K8AA 4BXXH 1XPRA 4X64L 1S3OA 2OTJA 5IP7G 3H15A 5GADC 4OO1G 5M3FH 4AH6A 2HQLA 3ICEA 4FDBA 4K0KQ 1B70B 4H02A 4IOCA 3A74A 2EXDA 1YJWA 2R7ZG 4JI3L 4DR3Q 2CWPA 2R92H 4A3DH 2MO0A 1KXLA 4JI2L 5C3EG 1E3PA 1EUJA 3PO3G 3M7NA 1SN8A 4HIDA 3T1YQ 2GVAA 3IRBA 5GAHC 4A3CH 1IBKL 3PUVA 1PH2A 4JI5L 4X6AH 5LMNL 1N33Q 5J3BA 4POFA 3G4SA 1RL2A 2AKWB 4DR5Q 4QY7A 1YNXA 1Q1BA 3AYHB 4QJFA 1E1OA 2VS1A 2VQFQ 4LUZA 5IP7H 4GOPA 4B3SQ 4HJ5A 3CF5A 1IBMQ 1KQSA 1JJ2A 3OTOL 1I5FA 1YJNA 1EQRA 5M5YH 4BY7G 3CC4A 2B63G 2R7ZH 1YITA 2DGYA 1VQ9A 3CPWA 4LF7Q 2R7FA 2ZTCA 4X66L 4HJ9A 3PO3H 5C4JH 1TWGH 4OWWB 4DR4Q 1BBWA 4LFCL 4GKKL 3U4ZA 5C44G 2ZJQA 2JA8G 4ME3A 1XTDA 3K0XA 2LXKA 3L0OA 1V43A 4GN4B 4BBRH 4DV1Q 1E1TA 2HIVA 1QVGA 2UUAQ 4JI6Q 4NXMQ 3J80i 1HZAA 4JCVE 4KHZA 5IYBG 4DUZQ 1GM5A 3RNUA 1X6OA 2UUBL 3GTOH 3KDFA 4JV5L 4YHHL 1YIJA 4A3IH 2Q2IA 3U50C 1I6HH 3HOZG 3E0EA 4R4OA 4JI0L 2H5XA 1NJIC 3RLNA 4DV5Q 1AH9A 4UP7A 4DV7L 1P16A 1X65A 1N34Q 2KCMA 1MKHA 3W1GA 3S1RH 2B63H 4JYAL 4A3LG 3J81j 5JJKA 1Y1VG 1PYBA 4DR1Q 3RN2A 1X55A 4IJLA 2MNAA 2CKZB 2KBNA 1AE3A 4JOIC 1KC8C 2JEBI 3LGJA 3KYHC 5C4XG 1QZHA 4GLAC 2UXBL 1W3SA 5C44H 1YEZA 3UDXA 5M5WH 4B3TQ 2JA8H 3S1QH 3HOVG 1IYJB 4DV6L 2VUMG 3M3YH 1U5KA 4L5SA 2AHOB 4LF6Q 1N32Q 5IYBH 3KOJA 1JJGA 1VQAA 4A4IA 5IT9c 2HHHL 3CCJA 2BH8A 1M1KC 3FKIG 2VZAA 1OXXK 3HOZH 5IYDH 4P72A 5HGQA 3FHWA 2N49A 3EN2A 5M5XH 3J7ZC 1PYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKH A;  3ULJ A;  3PIO A;  4LUV A;  4OX9 Q;  4A3L H;  2JJQ A;  1Y1V H;  4A3E G;  2WB1 G;  4O0A A;  4JI1 L;  3RLO A;  2B3G A;  5C4X H;  4B3R Q;  4L5Q A;  5BR8 L;  1VQ5 A;  1E22 A;  1WYD A;  1C9O A;  4DR7 L;  1V9P A;  2GN5 A;  3HOV H;  4IPG A;  3I4N G;  4TVA B;  1UE7 A;  1I94 Q;  5FLM G;  2I5M X;  5IP9 H;  3PUX A;  1WOC A;  1XMQ L;  1NMF A;  5GRO A;  3G6E A;  2VQE Q;  4DV0 Q;  4HJ8 A;  2N3S A;  1X3G A;  4PMW A;  3FKI H;  3I7F A;  3I4O A;  4DR6 Q;  5H1S E;  4JOI A;  2F3I A;  2ZJR A;  5IE8 A;  4R4C A;  3CD6 A;  4NPS A;  3PCO B;  3U58 A;  1MJC A;  4O2D A;  1HNZ L;  5GQO A;  3GTQ H;  4BA1 I;  1L1O B;  4DR2 Q;  1A0I A;  4A3E H;  4KHP L;  1BBU A;  1OTC A;  2K5V A;  4HJ7 A;  4DV2 Q;  1KRT A;  4K0K L;  3CW2 C;  1VQG A;  4LUO A;  3J81 i;  4DR3 L;  2E5L Q;  2QEX A;  1NTG A;  1VQO A;  3I4N H;  5AJ3 Q;  4GNX C;  5FLM H;  1HNX Q;  3S15 H;  2R7D A;  1VQB A;  1IXR A;  4P71 A;  1LUZ A;  1OXT A;  2E2J H;  4HIO A;  1N36 Q;  1SRO A;  2UU9 L;  1XNR L;  2NVT H;  3CCL A;  4DK6 C;  2NVQ H;  3I4M G;  3CP0 A;  3OW2 A;  2UXC L;  1N33 L;  2PI2 E;  4DR5 L;  1Q8K A;  3J80 c;  3NEL A;  1HNW L;  4IPC A;  2VQF L;  4IO9 A;  2CFM A;  1S40 A;  1PV4 A;  1IBM L;  2N78 A;  5JEA G;  2RF4 A;  3EIV A;  1NBW A;  3TRE A;  1VQ6 A;  2NZO A;  4R1J A;  3L2P A;  2OWO A;  1CKN A;  3S2D H;  4LF7 L;  2RCN A;  4AIM A;  2FXQ A;  1VQC A;  2Q2T A;  1SE8 A;  2D0O A;  2L15 A;  1VQK A;  1Z47 A;  2JK8 A;  5DLQ E;  1J5E L;  1HR0 Q;  3HOX G;  1ASY A;  4NB3 A;  1NE3 A;  4P73 A;  1D7Q A;  3BJU A;  3GTK H;  1RIP A;  1PA6 A;  4LF9 L;  4JI6 L;  1CKN B;  4PG3 A;  1X3F A;  2Y0S E;  1LM0 A;  2UUA L;  1VQ8 A;  3I4M H;  3HOY H;  3PO2 G;  3FP9 A;  4DUZ L;  5JJL A;  1CUK A;  1UE6 A;  4ALP A;  5JEA J;  4HIK A;  3RZD H;  4GKJ Q;  1IBL L;  1EQQ A;  3KF8 B;  1K8G A;  1HZC A;  4JG2 A;  2VNU D;  3HKS A;  3CQZ H;  2YTY A;  3GO5 A;  4LNQ A;  2F4V Q;  3S1N H;  2MFI A;  1N34 L;  1O7I A;  3CCU A;  3UDG A;  1PH7 A;  1SFO H;  1SMX A;  1WI5 A;  2UUC Q;  5FJ8 G;  4GNX B;  2BA0 A;  3HOX H;  3F2D A;  1VQD A;  4B3T L;  4XTC S;  2JA6 G;  3GTG H;  4RMF A;  2KHJ A;  5C3E H;  3TS2 A;  4DV4 Q;  1K9M C;  5IWA Q;  3K81 C;  1HR0 W;  1PH5 A;  2WFW A;  3PO2 H;  1N32 L;  4LF6 L;  2CCZ A;  4A93 G;  1B8A A;  2AWO A;  3T1H Q;  2NVY H;  1LYL A;  1HZ9 A;  3UDF A;  3OYY A;  4A3F G;  3KF6 B;  1PH1 A;  1FJG Q;  3PIP A;  2PMZ E;  4A3M G;  1JMC A;  1EYG A;  4LF5 Q;  3JAM c;  3GTP H;  2Z0S A;  1VQJ A;  4L5T A;  3KLW A;  3D31 A;  3RLF A;  2K4K A;  3KJO A;  3PF5 A;  3CCE A;  4R4I A;  3E9H A;  2NN6 I;  4OX9 L;  1HZB A;  5K36 G;  1TWC H;  4YWM A;  4X64 Q;  3NEN A;  3K7U C;  4A3G G;  3GTL H;  4OXP A;  4OON A;  1L1O C;  5IYC G;  3S24 A;  4JBM A;  5HY6 A;  4BY7 H;  1TWH H;  4B3R L;  1KAW A;  2JA6 H;  2K52 A;  3U4V A;  1AE2 A;  4YY3 L;  2E2H H;  1TXY A;  4JI8 Q;  1J6Q A;  3CPF A;  3J81 c;  2ZM6 Q;  5ELN A;  1VQE A;  4DV0 L;  1I3Q H;  2VQE L;  4BY1 G;  4AQY L;  3PGZ A;  3CC2 A;  4A93 H;  3ERS X;  3HOU H;  4A3F H;  1VQM A;  4DR6 L;  3CCQ A;  4A3M H;  3W5O A;  4LWC A;  5LMU Q;  1UWV A;  3UDI A;  3S17 H;  4IFD I;  2OQK A;  2EQS A;  5LMN Q;  3K7A H;  3HOU G;  2ZTE A;  3CMA A;  4DR2 L;  3M4Q A;  4A3G H;  3CME A;  5IYC H;  4LFB Q;  3RR5 A;  1TWF H;  2I0Q A;  5EAY A;  1VQN A;  1UE5 A;  4YCU A;  2E5L L;  4PZ7 A;  1FGU A;  4X65 Q;  2GVB A;  3HKZ E;  4Y52 H;  5AJ3 L;  5E7N A;  2YTX A;  2N8N A;  1TWA H;  4LFA Q;  2IX1 A;  1A63 A;  1YBY A;  4LF8 L;  1QZG A;  4BY1 H;  3I2Z A;  4LFC Q;  4GKK Q;  2PQA B;  2F52 A;  2VUM H;  3CCV A;  2VY3 A;  4IPH A;  1VQ7 A;  1L1O A;  4YCW A;  4JI7 Q;  2MO1 A;  4QGU A;  3JAM i;  1YJ9 A;  1VQP A;  4B3M L;  4BBS G;  4DKA C;  4JV5 Q;  2UUB Q;  3BZC A;  1XPU A;  4OWT B;  4NXN L;  4GN3 B;  2LXJ A;  2OCE A;  1G51 A;  2Q2U A;  4KI0 A;  3AFP A;  4DK3 C;  3RZO H;  3S14 H;  3EBE A;  1PVO A;  4JC0 A;  3I56 A;  4HJA A;  1GD7 A;  2YTV A;  5ELO A;  3F2C A;  1CSP A;  1QUQ A;  3HFZ B;  1GVP A;  4JBW A;  3TEH B;  4DV7 Q;  3H3V I;  2BA1 A;  1H95 A;  2IY5 B;  1PH6 A;  3PV0 A;  3D0F A;  1HR0 L;  3M4P A;  1Z9F A;  4C3I H;  1N9W A;  1R9T H;  2WP8 J;  4HIM A;  1WFQ A;  1ASZ A;  3E9I A;  5M3M G;  2UXB Q;  3NBH B;  2KHI A;  2C35 B;  4LF4 Q;  3T1Y L;  1QUQ B;  3B6Y A;  5FLX c;  4X62 Q;  4DV6 Q;  5C0X I;  1S72 A;  3Q8D A;  1EIF A;  4BBS H;  2EIF A;  4DAY B;  4Y7N H;  4GKJ L;  1P8L A;  1UEB A;  1WCM G;  4JBJ A;  4DV3 Q;  4QQB X;  1SR3 A;  3M9B A;  1HH2 P;  2Q2H A;  5GAE C;  4APV A;  4GN5 A;  1B7Y B;  3MEF A;  1Y1W G;  2VW9 A;  4MTN A;  1PH3 A;  3AFQ A;  1PH4 A;  4B3S L;  4JI4 Q;  3NEM A;  3CXC A;  2Y0S G;  4DUY Q;  3A0J A;  1A8V A;  5M3F G;  1VS0 A;  3DLL A;  3UE0 A;  3STB C;  1MIU A;  5BR8 Q;  1KIX A;  2ALY B;  5M3M H;  4GLV B;  2JA5 G;  2XTI A;  3CC7 A;  2B29 A;  3STB D;  2I5L X;  5IWA L;  1X9N A;  4MNO A;  3VDY A;  1N8R C;  2JA7 G;  4DR4 L;  1L2F A;  1L0W A;  4GOP C;  1XMO Q;  4EQ5 A;  1XPO A;  2ES2 A;  4JBK A;  2QA4 A;  1VQL A;  1XNQ Q;  4DV1 L;  3T1H L;  3AEV A;  4NXM L;  3PF4 A;  1OXV A;  1G6P A;  1FJG L;  1EIY B;  1JB7 A;  1X56 A;  1D8L A;  3AQQ A;  4LF5 L;  1WCM H;  1UE1 A;  1QVF A;  4DAM A;  3ZJY C;  3M85 A;  4IOA A;  1PHJ A;  3TS0 A;  4IJH A;  1SLJ A;  4GNX A;  1PFS A;  2K5N A;  4R4T A;  2QGQ A;  4DV5 L;  3CCM A;  4C3J H;  3HOW G;  3PUY A;  1E24 A;  4KHP Q;  1A62 A;  2Z6K C;  4PZ6 A;  3G71 A;  1CKO A;  1Q81 C;  1YZ6 A;  4XIG S;  1DGS A;  2MQH A;  4YCV A;  4DR1 L;  4GS3 A;  2VL6 A;  2ATW A;  2JA5 H;  3PUW A;  2K5H A;  3KF6 A;  4JI8 L;  2ZM6 L;  1IZ6 A;  1Q7Y C;  2JA7 H;  2R93 G;  1EOV A;  1MJE A;  2A1A A;  1FL0 A;  2V1C C;  1PH8 A;  1C7Y A;  3ULP A;  3J7A 5;  2NN6 G;  2UU9 Q;  2DUD A;  1VCI A;  2JA9 A;  1KHI A;  3F2B A;  3RN5 A;  1Q82 C;  1XNR Q;  4OO1 I;  1BKB A;  2K75 A;  4BBR G;  5LMU L;  1VQI A;  2UXC Q;  1Q1E A;  2ID0 A;  2UXD Q;  2IT1 A;  1HJP A;  1U0L A;  2OQ0 A;  4LW1 A;  4OWX B;  4A3I G;  4P74 A;  1HNW Q;  3HOW H;  4LFB L;  3M4O H;  4A3J G;  3PSI A;  4C3H H;  4A3K G;  3UE1 A;  2JQO A;  4GLX A;  4X65 L;  4UP9 A;  4UP8 A;  5GAG C;  5FJ8 H;  1I50 H;  4JI7 L;  4LFA L;  2PNH A;  1K0R A;  3CCR A;  2R93 H;  2R6G A;  4IFD G;  3F1Z A;  1BVS A;  1J5E Q;  4JI3 Q;  4GOP B;  1I94 L;  3GDE A;  4EX5 A;  4JI2 Q;  3H0G G;  4A3B G;  1YHB A;  4KLK A;  2Z6K A;  4LF9 Q;  2RHQ B;  3I55 A;  1X54 A;  1CSQ A;  4P75 A;  1IBK Q;  3HKZ G;  2AWN A;  3CAM A;  2A8V A;  1PH9 A;  4JI5 Q;  1IBL Q;  1EFW A;  5IYD G;  4A3J H;  3KJP A;  1XJV A;  4L5R C;  3JC6 6;  4A3K H;  1YHQ A;  4IFD J;  1Q86 C;  1NMG A;  4DV2 L;  1G29 1;  2PQA A;  4QL5 A;  4WJ3 M;  2JE6 I;  2KEN A;  3KDF B;  4C2M H;  3OTO Q;  2OTL A;  3G48 A;  3GTM H;  1QVC A;  4RG1 A;  3H0G H;  4X66 Q;  4A3B H;  1HNX L;  2BH2 A;  4LF4 L;  2RHS B;  4MZ9 A;  4DPG A;  4X62 L;  1OXS C;  1K73 C;  2NVX H;  5IP9 G;  1Y14 B;  3KFU A;  1WJJ A;  1N36 L;  4WJ4 A;  2NZH A;  1Q12 A;  2D62 A;  4DV3 L;  4IPD A;  1JJC B;  1X3E A;  1JE5 A;  3MXN B;  3BU2 A;  3K80 C;  4YHH Q;  4JI4 L;  3S16 H;  2ZTD A;  4DUY L;  3TQY A;  5LMN W;  4JI0 Q;  2PI2 A;  4DNI A;  3TRZ A;  5C0X G;  1EWI A;  2JEA I;  4JYA Q;  2D0P A;  1T9H A;  1W2B A;  2XGT A;  3S1M H;  4YY3 Q;  3L7Z C;  3ER0 A;  3F8T A;  3S2H H;  1GO3 E;  1V1Q A;  1SRU A;  2YV5 A;  3ULL A;  1K3R A;  4A76 A;  1XMO L;  1KRS A;  2WAQ G;  1XNQ L;  2HT1 A;  1JT8 A;  4AQY Q;  4J15 A;  2A19 A;  1E7Z A;  2K50 A;  3H3V H;  1C0A A;  1YVC A;  3WWV A;  1K83 H;  2WB1 E;  4UY8 C;  2HIX A;  2HHH Q;  5C0X J;  1KL9 A;  2F4V L;  2IHE A;  3DM3 A;  1FVI A;  3PUZ A;  2E2I H;  2YYZ A;  2WAQ E;  4QIW E;  2CQO A;  4BXX G;  4AYB G;  4UPA A;  1YI2 A;  4TQU S;  2AMC B;  2ZJP A;  4A75 A;  2CWA A;  1M90 C;  1VQ4 A;  3SGI A;  2IHF A;  2UUC L;  4R4Q A;  1IL2 A;  4JI1 Q;  2YU9 H;  4BA2 I;  5IY0 A;  1YHA A;  1OXU A;  3GTJ H;  2KCT A;  4POG A;  1KD1 C;  2R92 G;  4LF8 Q;  4A3D G;  4DR7 Q;  2E8G A;  3GD7 A;  4DV4 L;  2IX0 A;  2I5H A;  4YWL A;  1K8A C;  4YWK A;  1CKM A;  1XMQ Q;  3CCS A;  2ASB A;  3A5U A;  1VQF A;  3W1B A;  3HOY G;  4AYB E;  4A3C G;  1LTL A;  1VQH A;  2UXD L;  4B3M Q;  1NY4 A;  3BZK A;  1Q46 A;  2LSS A;  5JJI A;  4PZ8 A;  4NXN Q;  2K14 A;  1Y1W H;  3A5Z B;  1HNZ Q;  3K8A A;  4BXX H;  1XPR A;  4X64 L;  1S3O A;  2OTJ A;  5IP7 G;  3H15 A;  5GAD C;  4OO1 G;  5M3F H;  4AH6 A;  2HQL A;  3ICE A;  4FDB A;  4K0K Q;  1B70 B;  4H02 A;  4IOC A;  3A74 A;  2EXD A;  1YJW A;  2R7Z G;  4JI3 L;  4DR3 Q;  2CWP A;  2R92 H;  4A3D H;  2MO0 A;  1KXL A;  4JI2 L;  5C3E G;  1E3P A;  1EUJ A;  3PO3 G;  3M7N A;  1SN8 A;  4HID A;  3T1Y Q;  2GVA A;  3IRB A;  5GAH C;  4A3C H;  1IBK L;  3PUV A;  1PH2 A;  4JI5 L;  4X6A H;  5LMN L;  1N33 Q;  5J3B A;  4POF A;  3G4S A;  1RL2 A;  2AKW B;  4DR5 Q;  4QY7 A;  1YNX A;  1Q1B A;  3AYH B;  4QJF A;  1E1O A;  2VS1 A;  2VQF Q;  4LUZ A;  5IP7 H;  4GOP A;  4B3S Q;  4HJ5 A;  3CF5 A;  1IBM Q;  1KQS A;  1JJ2 A;  3OTO L;  1I5F A;  1YJN A;  1EQR A;  5M5Y H;  4BY7 G;  3CC4 A;  2B63 G;  2R7Z H;  1YIT A;  2DGY A;  1VQ9 A;  3CPW A;  4LF7 Q;  2R7F A;  2ZTC A;  4X66 L;  4HJ9 A;  3PO3 H;  5C4J H;  1TWG H;  4OWW B;  4DR4 Q;  1BBW A;  4LFC L;  4GKK L;  3U4Z A;  5C44 G;  2ZJQ A;  2JA8 G;  4ME3 A;  1XTD A;  3K0X A;  2LXK A;  3L0O A;  1V43 A;  4GN4 B;  4BBR H;  4DV1 Q;  1E1T A;  2HIV A;  1QVG A;  2UUA Q;  4JI6 Q;  4NXM Q;  3J80 i;  1HZA A;  4JCV E;  4KHZ A;  5IYB G;  4DUZ Q;  1GM5 A;  3RNU A;  1X6O A;  2UUB L;  3GTO H;  3KDF A;  4JV5 L;  4YHH L;  1YIJ A;  4A3I H;  2Q2I A;  3U50 C;  1I6H H;  3HOZ G;  3E0E A;  4R4O A;  4JI0 L;  2H5X A;  1NJI C;  3RLN A;  4DV5 Q;  1AH9 A;  4UP7 A;  4DV7 L;  1P16 A;  1X65 A;  1N34 Q;  2KCM A;  1MKH A;  3W1G A;  3S1R H;  2B63 H;  4JYA L;  4A3L G;  3J81 j;  5JJK A;  1Y1V G;  1PYB A;  4DR1 Q;  3RN2 A;  1X55 A;  4IJL A;  2MNA A;  2CKZ B;  2KBN A;  1AE3 A;  4JOI C;  1KC8 C;  2JEB I;  3LGJ A;  3KYH C;  5C4X G;  1QZH A;  4GLA C;  2UXB L;  1W3S A;  5C44 H;  1YEZ A;  3UDX A;  5M5W H;  4B3T Q;  2JA8 H;  3S1Q H;  3HOV G;  1IYJ B;  4DV6 L;  2VUM G;  3M3Y H;  1U5K A;  4L5S A;  2AHO B;  4LF6 Q;  1N32 Q;  5IYB H;  3KOJ A;  1JJG A;  1VQA A;  4A4I A;  5IT9 c;  2HHH L;  3CCJ A;  2BH8 A;  1M1K C;  3FKI G;  2VZA A;  1OXX K;  3HOZ H;  5IYD H;  4P72 A;  5HGQ A;  3FHW A;  2N49 A;  3EN2 A;  5M5X H;  3J7Z C;  1PYS B; 
#chains in the Genus database with same CATH topology
 1GKH A;  4OX9 Q;  1TS4 A;  3K5L A;  2JJQ A;  3X3N A;  4EQN A;  3GTQ B;  2QF7 A;  1BCP D;  4O0A A;  4N8X 1;  4A3E B;  1C9O A;  4LJZ C;  3I4N G;  5EKK A;  3I73 A;  1OO9 B;  2I5M X;  3PUX A;  1WOC A;  3UI2 A;  4IUP A;  2KCC A;  2WAQ B;  5H1S E;  5IE8 A;  1TU2 B;  2B2W C;  2RDH A;  3PCO B;  4JVZ A;  1EY9 A;  2B2Y C;  1CK1 A;  4O2D A;  3U58 A;  2G5D A;  2NVQ B;  2B8G A;  4KHP L;  2I46 A;  1OTC A;  2MGS A;  1G91 A;  3QB3 A;  3D4W A;  3I4N H;  2HCC A;  4AYB B;  5DAU A;  1E2Z A;  2UU9 L;  4HMJ A;  4YIJ A;  1SND A;  4HIO A;  1BDO A;  1N36 Q;  3Q6S A;  4A3D B;  1ZEQ X;  4K2K A;  1Y69 U;  3GTK B;  4DR5 L;  3A8K E;  2RQX A;  1WTQ A;  1HNW L;  3T4A C;  1PV4 A;  3EIV A;  3RZD B;  1NBW A;  2NZO A;  1CKN A;  2BOS A;  2RCN A;  1X32 A;  4U67 3;  3S1N B;  1SE8 A;  2D0O A;  1K3B C;  2JK8 A;  5DLQ E;  1ASY A;  3HOX G;  3MZ5 A;  3N6R A;  2O5I C;  1STA A;  1PA6 A;  4DXF A;  1CKN B;  4JI6 L;  3T13 A;  2F0G A;  2PCF B;  2IL8 A;  1VQ8 A;  3PO2 G;  2FHT A;  1QG7 A;  5FO8 B;  4KTA A;  1JOK A;  3KF8 B;  3HKS A;  2MFI A;  2NB0 A;  3H6M A;  3HZX A;  3CCU A;  1SMX A;  3DEO A;  5FJ8 G;  2BA0 A;  3HOX H;  4DN4 M;  2JA6 G;  4B3T L;  3FDT A;  2PPB C;  4BY7 B;  5C3E H;  3TS2 A;  5C4Z A;  1JOO A;  1HR0 W;  1F2Z A;  1RTN A;  1PH5 A;  2WFW A;  3PO2 H;  2EYF A;  2NVY H;  4A3F G;  1PH1 A;  4KD3 A;  4A3M G;  1AW7 A;  2SNM A;  4A93 B;  1V1O A;  1SYE A;  3CCE A;  1LTR D;  4OX9 L;  1HZB A;  4YWM A;  4X64 Q;  2N88 A;  3K7U C;  4HAE A;  3GTL H;  4OXP A;  4JBM A;  3K7A B;  1ZXT A;  5HY6 A;  2L12 A;  3BVG A;  2ZXO A;  2JA6 H;  4A3G B;  4YY3 L;  1AE2 A;  2F0S A;  2X69 A;  3DWQ A;  5CV7 A;  1TXY A;  1SJH D;  4JI8 Q;  4IAL A;  3J81 c;  3DWP A;  1VQE A;  2M00 A;  4A3F H;  4A3M H;  4O1N A;  3W5O A;  2VB2 X;  4BY1 B;  2E76 C;  2A68 D;  5LMU Q;  2A69 D;  2OQK A;  4RKB A;  4C1N I;  4KKU A;  4MN3 A;  1QJO A;  3KLS A;  3CME A;  4LFB Q;  1TWF H;  1UAP A;  3C1F A;  5EAY A;  3H91 A;  4CDD C;  3E5S A;  5E7N A;  1HRJ A;  2N8N A;  4LFA Q;  2EY1 A;  1QZG A;  1VMP A;  3I2Z A;  3CCV A;  3SHL A;  5I2X A;  1VQ7 A;  2MO1 A;  4QGU A;  1C4Q A;  2KED A;  2A73 B;  4DKA C;  2UUB Q;  1VMC A;  5I6Y A;  2E2J B;  3EA6 A;  2KUM A;  2EVB A;  1X3Q A;  4Y7N B;  4G7H C;  1R9T H;  2JXM B;  1CSP A;  3HFZ B;  3TEH B;  3F2C A;  4DV7 Q;  1ZYR C;  1TKW B;  4K5V A;  3PV0 A;  2B2T A;  3D0F A;  2Q8I B;  4DA2 A;  1Z9F A;  3IAY A;  5IIF A;  1I4Q A;  3J81 E;  1EQV A;  3OMC A;  4HCS A;  1NR4 A;  4DV6 Q;  1S72 A;  1A3U A;  4DAY B;  1UEB A;  1WCM G;  4I7Z C;  1SR3 A;  1IHZ A;  3TBI B;  1SE2 A;  5LL6 X;  5ELF A;  4IUR A;  1Y1W G;  4KK7 A;  3V05 A;  1PH4 A;  2JYO A;  3SEB A;  4DXG A;  4DUY Q;  1JOQ A;  4CKC A;  2ZXR A;  2EE1 A;  2DJG C;  2Y0S B;  1BCP F;  1CHQ D;  1MIU A;  2ALY B;  2JA5 G;  3CC7 A;  3QIA A;  3ND9 A;  2I5L X;  1L2F A;  4EQ5 A;  3AEV A;  2NTT A;  4DV1 L;  5DEH A;  3PF4 A;  1A6X A;  2ICE C;  1EIY B;  2OF1 A;  1WCM H;  3ZJY C;  2JN4 A;  3TS0 A;  1QB5 D;  3MFY A;  3CCM A;  2MPM A;  4N8F A;  3PUY A;  1Q81 C;  3EJI A;  3G71 A;  4DFA A;  1YZ6 A;  1U4R A;  4YCV A;  3X3M A;  2VL6 A;  3HOW B;  2JA5 H;  1GUS A;  2K5H A;  4JI8 L;  5JAV A;  2B2U C;  2PMZ B;  1DOK A;  2KEC A;  1DD2 A;  1EY5 A;  1XNR Q;  5D65 A;  4OO1 I;  2H1E A;  1HTP A;  5LMU L;  3ITP A;  2ID0 A;  2IT1 A;  1HJP A;  4OWX B;  1SAP A;  5KNC A;  3J7A V;  4LFB L;  4A3J G;  3PSI A;  3S17 B;  4GLX A;  3T56 B;  1I50 H;  4LFA L;  1K0R A;  4DAV A;  4IFD G;  3R3O A;  1BVS A;  1J5E Q;  1I94 L;  1LTS D;  4EX5 A;  1CA5 A;  2Z6K A;  4QUF A;  5M9O A;  2RHQ B;  3I55 A;  4M8A A;  3H0G B;  3HKZ G;  4KN7 C;  2AWN A;  3I91 A;  2L1B A;  4OL7 A;  1PH9 A;  3HRZ C;  2WKC A;  4A3J H;  1CZG A;  3KJP A;  1ILP A;  1D5Z C;  1YHQ A;  4IFD J;  2XWJ B;  3D4R A;  3WDN A;  1X3P A;  1G29 1;  2PQA A;  3NTH A;  1A15 A;  4QL5 A;  2DJF C;  4C2M H;  2F03 A;  3S16 B;  2J4X A;  4IFD H;  4U68 A;  4KKT A;  3GTM H;  4Q5V A;  1MGS A;  4UDU C;  4KV6 A;  2BH2 A;  2NVX H;  1Y14 B;  2D62 A;  3VYT A;  2JP1 A;  4IPD A;  1CI3 M;  2XIW A;  1CZW A;  2I07 B;  5CV8 A;  3JAM E;  1EEF D;  1HPC A;  4K5W A;  4DUY L;  4BBS B;  3T16 A;  1SNC A;  5LMN W;  2F0N A;  3TRZ A;  5C0X G;  2JEA I;  3PMF A;  2D0P A;  4KJN A;  1T9H A;  2E2I B;  2SDF A;  3F8T A;  3C1E A;  1GO3 E;  1V1Q A;  2YV5 A;  1Q90 A;  1V1P A;  2WAQ G;  1TS2 A;  2EXZ A;  2F0M A;  1JWM D;  2SOB A;  1E7Z A;  3GTJ B;  3WWV A;  1LT5 D;  2IPK D;  5KYI A;  4FF1 A;  3CRL C;  5C0X J;  4R8N A;  1KL9 A;  4FXK C;  1U4M A;  1AEX A;  4FF4 A;  2F4V L;  4IQZ A;  2QIL A;  1FVI A;  4RGT A;  1CQV A;  2WAQ E;  3TP7 A;  2CQO A;  5C0X H;  4V19 0;  4AYB G;  1A3T A;  4TQU S;  5HUR A;  1BUV T;  4ZCK A;  4A75 A;  2UUC L;  5IOD A;  4O42 A;  3ONA B;  1IL2 A;  3U9S A;  4BA2 I;  2L5T A;  2BDO A;  3PIP 3;  4RAU C;  2O2L D;  2VB3 X;  3OWE B;  4LF8 Q;  4A3D G;  2E8G A;  3GD7 A;  2RKS A;  4J8Q A;  2I5H A;  2X6G A;  1S5C D;  1RHP A;  4YWK A;  1CKM A;  2ASB A;  4AYB E;  5DM7 3;  1VQH A;  1BBX C;  1EWH A;  1ML0 D;  1PRT D;  2LSS A;  2HQE A;  1SMY C;  4NXN Q;  3A5Z B;  2OTJ A;  2Q8R E;  1QCB D;  3H15 A;  2EJF C;  5M3F H;  5I9O A;  2EDG A;  3U9O A;  4A3D H;  2MO0 A;  3E6Z X;  4K5X A;  5KRU A;  1KXL A;  5IGB A;  1JWU D;  2R7Z B;  3MTS A;  1F9P A;  2CH4 W;  3I3C A;  3LX0 A;  2CW0 D;  1TWG B;  3J81 L;  1PH2 A;  1HTL D;  2F0I A;  4C56 C;  4GZY C;  2PZT A;  3G7L A;  1N33 Q;  4POF A;  3TME A;  1GHJ A;  2AKW B;  1YNX A;  3NTK A;  1Q1B A;  3AYH B;  4FO2 A;  2VQF Q;  4GOP A;  4B3S Q;  3H3V C;  1S5E D;  3Q24 A;  1K8M A;  1T5E A;  1KQS A;  4BY7 G;  1YJN A;  1LT4 D;  1YNN D;  4Q0F A;  2ZTC A;  4HJ9 A;  5C4J H;  1HFN A;  4CHT B;  2ZJQ A;  1TT2 A;  4ME3 A;  4JI7 L;  4NXM Q;  4EQP A;  1O80 A;  4DUZ Q;  5IYB G;  4KHZ A;  3KDF A;  2IW3 A;  1YIJ A;  3M3Y B;  3U50 C;  1T5X D;  4KJO A;  2BE5 D;  1AH9 A;  1X65 A;  3W1G A;  3HOZ B;  3NHH A;  2RVL A;  5J22 A;  1TR5 A;  2MNA A;  2CKZ B;  4JOI C;  1KC8 C;  4TKO B;  3NXW A;  1QZH A;  2UXB L;  3FEW X;  1K0S A;  3S1Q H;  4FF3 A;  3HOV G;  5C4X B;  4NMZ A;  1U5K A;  4L5S A;  1CA6 A;  5IYB H;  1DZ1 A;  5IT9 c;  3CCJ A;  3FKI G;  2VZA A;  3VYU A;  3EN2 A;  3J7Z C;  1PYS B;  5DNF A;  1EYA A;  4LUV A;  3M7G A;  1SSO A;  1B9N A;  3S9W A;  4B3R Q;  2RCF A;  4PNY A;  5BR8 L;  1WYD A;  3C2P A;  3HOV H;  2HDL A;  4IPG A;  5FO7 B;  1BO0 A;  5EPL A;  4DV0 Q;  3TDQ A;  3FKI H;  3I7F A;  3S15 B;  3QO2 A;  1PZI D;  1IW7 D;  4DR2 Q;  1BBU A;  2K5V A;  4HJ7 A;  2PNR C;  2OT2 A;  1KRT A;  4XT3 B;  4LUO A;  3J81 i;  3CHB D;  2E5L Q;  3NSW A;  1D5X C;  4F88 A;  1VQO A;  3MXG A;  4GNX C;  1HNX Q;  3S2D B;  4RCN A;  1WTW A;  1C8C A;  2G9D A;  2E2J H;  1OXT A;  1SRO A;  3SK5 A;  2NVT H;  3CCL A;  4E6I A;  3IKJ A;  3CP0 A;  3OW2 A;  2UXC L;  2MUY A;  1N33 L;  2PI2 E;  1UUP A;  3I4M B;  3J80 c;  1B50 A;  3QOL A;  5T1I A;  2VQF L;  2CFM A;  4IZ8 A;  2R61 A;  2RF4 A;  3BYT B;  3L2P A;  2OWO A;  3JAM L;  3OIP A;  1JQY D;  1PLF A;  2EYO A;  2FXQ A;  2B2W A;  1Z47 A;  2B2Y A;  5IGC A;  4NB3 A;  2TMP A;  1SFO B;  3BJU A;  1RIP A;  4LF9 L;  2EY2 A;  2Y0S E;  5JJL A;  5I9P A;  3HOY H;  3FP9 A;  4DUZ L;  1I6V C;  4GKJ Q;  1EQQ A;  1U4P A;  2VNU D;  3CQZ H;  1O7Z A;  4HTH A;  3ZYY X;  5JPN C;  4F7X A;  1DOM A;  5C6A A;  4G57 A;  1O7I A;  2J7Z A;  3GTP B;  2A5H A;  1PH7 A;  4FF2 A;  1WTR A;  1WI5 A;  1EY6 A;  2RSO A;  1NCV A;  3F2D A;  2WII B;  3GTG H;  2KHJ A;  5EPJ A;  1CFM A;  4DV4 Q;  1TWH B;  2FIN B;  4J1M A;  5IWA Q;  3TN2 A;  3LWU A;  2E2H B;  5C3X A;  3T1H Q;  2F0T A;  1LTG D;  1HZ9 A;  3KF6 B;  5IGF A;  3PIP A;  2PMZ E;  4LF5 Q;  1EYG A;  3NTI A;  2Z0S A;  1KDC A;  1PRT F;  2F3W A;  4L5T A;  3D31 A;  2K4K A;  1B4O A;  1AN8 A;  1EY8 A;  3J80 E;  1HA5 A;  2N55 A;  1DCZ A;  4OON A;  3S24 A;  4FXG C;  1FNV A;  4B3R L;  1KAW A;  2RDF A;  1CHP D;  3U4V A;  3T51 B;  3DM1 A;  3FMC A;  1KLU D;  2AUK A;  3CPF A;  1BF4 A;  5ELN A;  4DV0 L;  1I3Q H;  3HOU H;  2PZU A;  3CCQ A;  4LWC A;  1UWV A;  3S17 H;  4IFD I;  2VUM B;  2EQS A;  5LMN Q;  1SXT A;  5I4D A;  4DR2 L;  3M4Q A;  3FRP B;  5FKA C;  2EZV A;  1V8Q A;  1VQN A;  1ESF A;  1GUO A;  2E5L L;  4Y52 H;  3S14 B;  4B9X A;  2YTX A;  1A63 A;  1LAC A;  4C3I G;  4LFC Q;  2L11 A;  2VY3 A;  2HD3 A;  4WRD A;  2L55 A;  3JAM i;  5L37 A;  1IL8 A;  1B44 D;  4BBS G;  3BZC A;  1LTA D;  3HEJ A;  4OWT B;  2PQE A;  1H95 A;  5C4H A;  1G51 A;  1EY7 A;  3LNN A;  3AFP A;  3RZO H;  1EL0 A;  4B9W A;  4HJA A;  4CJ1 B;  2YTV A;  5ELO A;  2XVS A;  4JBW A;  2BA1 A;  1NSN S;  4FNF A;  4C3I H;  2WP8 J;  4HIM A;  2K04 A;  1ASZ A;  3E9I A;  4FYD A;  2Z8L A;  3T1Y L;  3OSO A;  1ESR A;  5C0X I;  5M3M B;  4BBS H;  3SE0 A;  5FK9 C;  1C48 A;  3AB9 A;  4GKJ L;  4ID6 A;  1LTI D;  1HH2 P;  2LKV A;  2D2C C;  2Q2H A;  5GAE C;  1A2T A;  4MTN A;  3MXU A;  4N9P A;  3CXC A;  1TII D;  4C3J G;  1A8V A;  3EFX D;  3VR2 A;  4FXD A;  2CVR A;  3OHX C;  1X9N A;  4DR4 L;  5IWA L;  4MNO A;  1EZ6 A;  3KF8 A;  4JBK A;  3T1H L;  4S3S A;  3W2D A;  1G6P A;  1I4R A;  2JA7 B;  3AQQ A;  4LF5 L;  5A2Q E;  3NWT A;  2XRS D;  1QVF A;  4DAM A;  1I4H A;  2K5N A;  5EQ0 A;  4R4T A;  2RA4 A;  4C3J H;  1S5D D;  4ZQ3 A;  4OIK A;  3A7A B;  1PFB A;  5C5M A;  3R8B A;  2MQH A;  4DR1 L;  3M4O B;  3NQT A;  4C3H B;  4XYO A;  4ZK9 B;  1IZ6 A;  3SVM A;  3Q22 A;  4BS9 A;  1MJE A;  1F2M A;  2A1A A;  1SYC A;  1FL0 A;  3D8G A;  4G7Z C;  1PH8 A;  2NN6 G;  1VCI A;  2R93 B;  1KHI A;  3RN5 A;  1Q82 C;  1BKB A;  2K75 A;  4ODG A;  2E74 C;  1EFI D;  2EYM A;  2OQ0 A;  2QDB A;  3DXJ C;  3I4L A;  4P74 A;  2C9O A;  3NK9 A;  3MXP A;  1W6K A;  3K59 A;  3RD4 A;  4A3K G;  2QCP X;  1R4P B;  3CRK C;  5FJ8 H;  1W6J A;  1EIH A;  3DWA A;  2R6G A;  2NN6 H;  4XXE A;  1H9R A;  3BS1 A;  3MHB A;  4KLK A;  2NTS A;  1X54 A;  2M2L A;  1TWA B;  1IBK Q;  4A3B B;  1IBL Q;  2B2U A;  2R3Z A;  1HFG A;  4L5R C;  1TY0 A;  3JC6 6;  4A3K H;  5AFW A;  2F0J A;  2K5W A;  2F0P A;  3OIQ A;  3OOC A;  2JE6 I;  2KEN A;  4KMU C;  4HN7 A;  4OEL B;  4X66 Q;  2RHS B;  1STH A;  1EEI D;  1OXS C;  2D5D A;  5IP9 G;  1N36 L;  4ABN A;  4K14 A;  2Q8T A;  1XYI A;  4G7O C;  3MXN B;  1RD9 D;  1FR3 A;  1K83 B;  4DNR B;  1BCP C;  2PI2 A;  1RKN A;  1GUG A;  3J80 L;  4WJW A;  2WV6 D;  3VR5 A;  3S1M H;  4DAY A;  3D4D A;  3S2H H;  2C5C A;  1BOS A;  2MJ8 A;  3KBG A;  1SBB B;  2HT1 A;  3BVM A;  4JW0 A;  1JT8 A;  4ULL A;  4AQY Q;  2A19 A;  1BQQ T;  1C0A A;  2QW7 A;  1YVC A;  3OPO A;  2WB1 E;  4LK1 C;  2K28 A;  1KDA A;  4NW2 A;  1H9J A;  4FP5 D;  1LLR D;  3PUZ A;  5FOB B;  1O7L A;  2B39 A;  2AQ3 B;  1F9R A;  1CM9 A;  1VQ4 A;  2KCN A;  5CYU A;  1LT6 D;  2KCT A;  2R92 G;  2K5Q A;  1E2W A;  2A6H C;  3V96 A;  4RKL A;  1XMQ Q;  1HUM A;  1EU4 A;  1VQF A;  1TY2 A;  4RGN A;  4B3M Q;  1NY4 A;  1QOH A;  1PFN A;  3BZK A;  3Q23 A;  3A7L A;  2CHB D;  3TZU A;  2D9U A;  1Y1W H;  5D14 A;  1HNZ Q;  1SMY D;  2K01 A;  4X64 L;  5COR A;  5C5L A;  2EYP A;  5GAD C;  2HQL A;  4DGZ A;  1PTO B;  4K0K Q;  1YJW A;  4H02 A;  2EXD A;  1LTT D;  2R92 H;  2CWP A;  2QKI C;  3I90 A;  2A74 C;  1SNM A;  4KD4 A;  1IBK L;  3PO3 B;  1KDB A;  4EVO A;  5J3B A;  1YNJ C;  1RL2 A;  1SNQ A;  2RDG A;  4QY7 A;  4BBR B;  2NYZ D;  1GOZ A;  3GTO B;  3CF5 A;  1JJ2 A;  1LO5 D;  4A3I B;  3E0J A;  1RJT A;  3CC4 A;  4X66 L;  1ILQ A;  2HCI A;  4HR7 B;  2B63 B;  2MHV A;  1F2Y A;  2DN8 A;  3A8J E;  5EGT A;  2LXK A;  2NZ1 D;  4RCO A;  1A2U A;  3PQI A;  4MHE A;  5C44 B;  2UUA Q;  2JA8 B;  5M5W B;  3J80 i;  4QMG A;  2UUB L;  2Q2I A;  3E0E A;  4R4O A;  3TZD A;  2HDM A;  4DV5 Q;  3MVV A;  4DV7 L;  2KCM A;  3S1R H;  4A3L G;  5BN3 A;  1Y1V G;  1HUN A;  3RN2 A;  1X55 A;  1AE3 A;  3KYH C;  1W3S A;  1ENC A;  4Z9C B;  1F77 A;  3TSS A;  1IYJ B;  1JE4 A;  4DV6 L;  2VUM G;  2A69 C;  1QNK A;  2AHO B;  4LF6 Q;  3KOJ A;  1MI2 A;  1VQA A;  4A4I A;  1WTP A;  1M1K C;  2B2T C;  3A55 A;  4UAI A;  3C46 A;  1OXX K;  5E3F A;  3R2T A;  2B2V C;  1JWS D;  3MA2 B;  3FHW A;  5M5X H;  2K33 A;  4A3L H;  1Y1V H;  4ZKB B;  4A3E G;  2EYH A;  2B3G A;  1DON A;  1E22 A;  1PDQ A;  1PTO C;  1V9P A;  2F1M A;  4TVA B;  1UE7 A;  2DY7 A;  2EJG C;  1HQR D;  3R93 A;  2K6A A;  1XMQ L;  1NMF A;  5GRO A;  3G6E A;  2VQE Q;  3I4N B;  2NUC A;  1X3G A;  4PMW A;  1IKL A;  4QIW B;  3I72 A;  4DR6 Q;  4JOI A;  2F3I A;  2ZJR A;  2WAC A;  3CD6 A;  4NPS A;  4CGY B;  1MJC A;  1HNZ L;  3T53 B;  3L3O C;  5GQO A;  3GTQ H;  1PZK D;  4BA1 I;  4F8M A;  1L1O B;  1CTM A;  5CV4 A;  5JVH 3;  1DXM A;  4A3E H;  4WFN 3;  4DV2 Q;  4K0K L;  3CW2 C;  2EOT A;  1NTG A;  5AJ3 Q;  3FPP A;  1WTX A;  3VR3 A;  3A54 A;  4KHV A;  3VA5 A;  4P71 A;  1XNR L;  1LUZ A;  4M1U B;  4QUC A;  2NVQ H;  2B8F A;  3BG3 A;  4K6L A;  1Z7T A;  1LV9 A;  3SXH A;  4XDX A;  3I8Z A;  1Q8K A;  5IOC A;  5EJW A;  3NEL A;  2F0Q A;  1S40 A;  2P5Z X;  1RCV D;  5JEA G;  3BDL A;  3TRE A;  3SK4 A;  1JB3 A;  3MAQ A;  5ELB A;  1JCK B;  1VQC A;  4NKL A;  2Q2T A;  2L15 A;  1VQK A;  4PMC A;  1HR0 Q;  1J5E L;  4J6H A;  1D1I A;  1NE3 A;  3QOJ A;  1D7Q A;  3GTK H;  5CV5 A;  4H7B A;  4PG3 A;  2UUA L;  3HOX B;  1LM0 A;  1UE6 A;  5C3E B;  4ALP A;  5JEA J;  4HIK A;  3RZD H;  4LMQ D;  2ENB A;  1K8G A;  2F0D A;  2NVY B;  5JEA H;  4LNQ A;  2EJM A;  2YTY A;  3P1H A;  4RH6 A;  3S1N H;  5TSS A;  3UDG A;  5JVG 3;  4CDC C;  4GNX B;  4XTC S;  4IN3 A;  4RMF A;  1EOT A;  3GTL B;  1K9M C;  3LWE A;  3K81 C;  4LF6 L;  2CCZ A;  4K6D A;  4A93 G;  2PO4 A;  2AWO A;  1LYL A;  5CV6 A;  1FJG Q;  4KY5 A;  4X3K A;  1VQJ A;  3RLF A;  3K5N A;  4A3F B;  4A3M B;  2NN6 I;  5K36 G;  3NEN A;  4A3G G;  1L1O C;  3BDC A;  4BY7 H;  3QWN A;  1KLG D;  5KEE A;  2K52 A;  1TWF B;  1TS5 A;  1J6Q A;  4H0L C;  4A93 H;  2VQE L;  4BY1 G;  3CC2 A;  3EVQ A;  2L4N A;  2SNS A;  4DR6 L;  1KAB A;  3UDI A;  2VXW A;  3K7A H;  5K36 H;  1AFP A;  1UEA B;  4A3G H;  1UE5 A;  4PZ7 A;  2LS0 1;  1Y8O B;  2GVB A;  5AJ3 L;  1TWA H;  1R9T B;  1YBY A;  4CKB A;  4LF8 L;  3ERQ A;  2WB1 B;  4BY1 H;  4GKK Q;  4P2C B;  2F52 A;  4IPH A;  4JPB W;  3GQB A;  1U9R A;  4JV5 Q;  4I65 A;  1XPU A;  2EY6 A;  4NXN L;  4GN3 B;  2OCE A;  4KI0 A;  4DK3 C;  4JC0 A;  1FGB D;  1QUQ A;  4K8J A;  1Q3L A;  4JK1 C;  2IY5 B;  1HR0 L;  3M4P A;  2KEE A;  1WFQ A;  3NBH B;  1SE4 A;  4HCE A;  2C35 B;  1QUQ B;  2PW7 A;  3B6Y A;  5FLX c;  2FMC A;  5EKL A;  4DU9 A;  2EIF A;  4IUQ A;  4Y7N H;  1SYG A;  1P8L A;  4DV3 Q;  4JBJ A;  5IT9 E;  4XYQ A;  4QQB X;  3M9B A;  4HED A;  3J7Y W;  2K1B A;  4OGQ C;  3SDZ A;  3HGB A;  4GN5 A;  2VW9 A;  4JI4 Q;  1WCM B;  3AFQ A;  4B3S L;  3NEM A;  1I4X A;  2Y0S G;  5G3L D;  2DNC A;  2LMC B;  3L9A X;  3DLL A;  5BN4 A;  3STB C;  4GLV B;  3K6O A;  1EY4 A;  5A35 A;  2M9V A;  4NP5 A;  4GOP C;  1XMO Q;  1XNQ Q;  1MHW C;  2JA5 B;  2MP1 A;  4NXM L;  1OXV A;  1FJG L;  1HQM C;  1JB7 A;  4KN4 C;  1D8L A;  4HSV A;  3VR6 A;  4IOA A;  3O13 A;  4IJH A;  1PFS A;  2WIN B;  2QGQ A;  3HOW G;  4KHP Q;  1E24 A;  1A62 A;  4PZ6 A;  1CKO A;  4XIG S;  1DGS A;  2ATW A;  3MC0 B;  3KF6 A;  1TWC B;  1VDZ A;  4CJ2 C;  3ULP A;  3J7A 5;  1I50 B;  2UU9 Q;  3OW7 A;  2XRQ D;  5FLX E;  1B3A A;  4BBR G;  1VQI A;  1Q1E A;  2UXD Q;  1U0L A;  4LW1 A;  4K2L A;  5LL6 S;  2EY5 A;  4OHJ A;  5T1G A;  4F87 A;  4A3I G;  4EQO A;  4V0B A;  1HNW Q;  3HOW H;  2XNA C;  5EBC A;  1YNN C;  1AZP A;  3UE1 A;  2F0K A;  4UP9 A;  4A3J B;  5GAG C;  1B1Z A;  3QR8 A;  1R4Q B;  3CCR A;  4CDF C;  1L0X B;  5KGU A;  3GDE A;  4C2M B;  3H0G G;  4ILW A;  1QE6 A;  2A6E C;  1GHK A;  3GTM B;  5CR3 A;  1CSQ A;  5FO9 B;  5CBA E;  5F2D A;  3DUZ A;  2A8V A;  3FPU B;  1EY0 A;  2PYK A;  4JI5 Q;  1ROD A;  2NVX B;  3HKZ B;  5IYD G;  1XJV A;  3P75 A;  2LFN A;  1NMG A;  1E0B A;  4KY7 A;  2OTL A;  3G48 A;  1QVC A;  4RG1 A;  4XQQ A;  3H0G H;  1HNX L;  4DPG A;  1S4Z A;  2CQA A;  1ICF B;  1RTO A;  1PZJ D;  1K73 C;  3KFU A;  1WJJ A;  4WJ4 A;  1IYV A;  2NZH A;  4DV3 L;  4N9T A;  1JJC B;  1JE5 A;  2O5J C;  2V4D A;  5D3D A;  4QCL A;  3BU2 A;  3K80 C;  4JI4 L;  3S16 H;  3QJY A;  3TQY A;  1EWI A;  1O78 A;  2F0U A;  3KUP A;  1SJE D;  1W2B A;  1ZYR D;  4YY3 Q;  3V2T A;  3D6W A;  4DAP A;  3ER0 A;  2LY7 A;  1SRU A;  1XMO L;  4A76 A;  1XNQ L;  4R8I A;  3H3V H;  3I70 A;  1J9O A;  3NP8 A;  4UY8 C;  2KVM A;  1IW7 C;  2X6L A;  1GUN A;  3KLR A;  2IHE A;  3DM3 A;  2E2I H;  4QIW E;  1SYD A;  1FD7 D;  4BXX G;  2AMC B;  3G6J B;  2ZJP A;  3SGI A;  4R4Q A;  4JI1 Q;  1OXU A;  1SYB A;  4XQJ A;  3GTJ H;  4POG A;  4DR7 Q;  4DV4 L;  5M3F B;  2BCO A;  2IX0 A;  3W3A A;  1S5B D;  4YWL A;  3NWS A;  3J7A F;  2A6H D;  3A5U A;  2UXD L;  5I2Y A;  1EYC A;  1Q46 A;  5JJI A;  4PZ8 A;  2K14 A;  1BCP B;  3K8A A;  2PW5 A;  5LHY 1;  4BXX H;  1AP0 A;  4CDE C;  5CMD A;  1II3 A;  1ET6 A;  3URY A;  3ICE A;  2J0T D;  1MSH A;  3A74 A;  2R7Z G;  4DR3 Q;  2KOL A;  1PMR A;  5C3E G;  1E3P A;  1EUJ A;  1HA6 A;  1SN8 A;  2GVA A;  5GAH C;  2QEJ C;  1ENF A;  2TSS A;  5C4J B;  1STG A;  4JI5 L;  5LMN L;  5C3W A;  3G4S A;  1PFM A;  4X3U A;  5J1Z A;  4QJF A;  1YNJ D;  2VS1 A;  3P7J A;  4LUZ A;  1CT1 D;  5IT9 L;  1IBM Q;  2K05 A;  4C1N K;  5G3L F;  3TP5 A;  1I5F A;  1KAA A;  2R7Z H;  1YIT A;  1RDP D;  1XTC D;  2DGY A;  5E4X A;  3CPW A;  1VQ9 A;  4LF7 Q;  3KBX A;  1BR9 A;  1TWG H;  3NBI A;  4LFC L;  3U4Z A;  1I4G A;  2F4I A;  1STY A;  4GN4 B;  3K0X A;  3L0O A;  4DV1 Q;  1E1T A;  2HIV A;  1QVG A;  3S1Q B;  4JCV E;  1GM5 A;  1IKM A;  3A8I E;  3RNU A;  3HOZ G;  1GUW A;  3RLN A;  1ENA A;  4UP7 A;  1N34 Q;  3J81 j;  5JJK A;  5EBD A;  1PYB A;  4IJL A;  2KBN A;  3VR4 A;  2JEB I;  2Z1C A;  5C4X G;  4GLA C;  3MXN A;  3TP8 A;  3M3Y H;  1N32 Q;  1JJG A;  3HOV B;  2BH8 A;  5FLX L;  3HOZ H;  1J8I A;  5IGD A;  5HGQ A;  3FKI B;  3ULJ A;  3PIO A;  1XX8 A;  2K03 A;  2WB1 G;  2DNE A;  4JI1 L;  3RLO A;  5C4X H;  5KNB A;  4L5Q A;  1VQ5 A;  2FMM A;  3FVQ A;  4DR7 L;  1KNE A;  2F0E A;  2GN5 A;  1LTB D;  1I94 Q;  5EPK A;  5FLM G;  1PTO D;  5IP9 H;  4HJ8 A;  1M4V A;  2N3S A;  2YU9 B;  2BDN A;  3I4O A;  4L8J A;  4R4C A;  1LT3 D;  5DM6 3;  1TVX A;  2NVT B;  3MEH A;  1A0I A;  5J39 A;  4IUV A;  3DEP A;  1VQG A;  4LAA A;  4DR3 L;  2QEX A;  1LAB A;  5ELC A;  2B2V A;  2AQ1 B;  5FLM H;  3GV3 A;  3S15 H;  2R7D A;  1BNZ A;  4ZUI A;  1QWY A;  1VQB A;  1IXR A;  3K5O A;  3SK6 A;  4RGM A;  1WD0 A;  3IFD A;  1B3Q A;  4DK6 C;  3I4M G;  1EWC A;  2AQ2 B;  2KA7 A;  1JOR A;  4BWG B;  3K57 A;  1VF5 C;  1Q8I A;  3HOY B;  4IPC A;  4IO9 A;  5COY A;  1IBM L;  4OIJ A;  2N78 A;  1Y8N B;  1VQ6 A;  3NPP A;  4R1J A;  3S2D H;  4LF7 L;  1SDF A;  1H9K A;  2JSO A;  3CQZ B;  4RFB A;  4AIM A;  3D6C A;  2XN9 C;  2NWG A;  2CH4 A;  2F3V A;  4P73 A;  1FNU A;  1G8Z D;  5M5Y B;  1G2T A;  3C3L A;  1X3F A;  3I4M H;  3GTG B;  4X3T A;  1CUK A;  1STB A;  2HUG A;  3TP6 A;  3QG1 A;  1ZKO A;  1IBL L;  1HZC A;  4JG2 A;  2IX3 A;  2F4V Q;  3GO5 A;  4KKS A;  1N34 L;  1B9M A;  1STE A;  1SFO H;  2UUC Q;  5CGK A;  3KK7 A;  1I6H B;  5CC4 A;  1VQD A;  4L63 B;  1EYD A;  2F0V A;  3WOE A;  2K32 A;  4H44 C;  2F0L A;  3RUZ A;  1N32 L;  1B8A A;  2WKD A;  3UDF A;  3OYY A;  1I4P A;  1JMC A;  1I3Q B;  3JAM c;  3GTP H;  3SR1 A;  3HOU B;  3KLW A;  3KJO A;  3PF5 A;  3KLS X;  4R4I A;  2OEO A;  3Q0A A;  3E9H A;  1TWC H;  5A2Q L;  5IYC G;  4ZYS A;  5D3I B;  1MSG A;  1TWH H;  4I7A A;  5NUC A;  2G9H D;  1SEB D;  3CU7 A;  1D5M C;  5JJZ A;  5CV9 A;  2E2H H;  1FYC A;  1NAP A;  2ZM6 Q;  2DY8 A;  4AQY L;  2SEB D;  3PGZ A;  1B53 A;  3ERS X;  5KYL A;  2A68 C;  1VQM A;  4XT1 B;  1NR2 A;  1RF2 D;  2ZTE A;  3CMA A;  4ZAI A;  5IYC H;  2ICI A;  3RR5 A;  3OMG A;  4H13 C;  1EQT A;  2I0Q A;  3IL8 A;  4DK1 A;  4YCU A;  1HXY D;  1FGU A;  3RZO B;  4X65 Q;  3HKZ E;  2IX1 A;  4XQN A;  2PQA B;  2VUM H;  1F9Q A;  1L1O A;  1SE3 A;  4YCW A;  4C3I B;  4JI7 Q;  4ZUJ A;  1YJ9 A;  1VQP A;  4B3M L;  3VA7 A;  4NDX A;  1H9S A;  2QDL A;  2LXJ A;  2Q2U A;  3S14 H;  3EBE A;  1PVO A;  3I56 A;  1GD7 A;  4KY6 A;  1ET9 A;  1GVP A;  2Z9H A;  1WD1 A;  3H3V I;  1KNA A;  1PH6 A;  4WOR A;  1H9S B;  1UNS A;  1N9W A;  2UXB Q;  5JOB A;  4HMI A;  5M3M G;  4MTK A;  2KHI A;  4LF4 Q;  2K7V A;  4X62 Q;  1CQF A;  1PYW D;  3Q8D A;  4RHS A;  1EIF A;  4R9W A;  2XWB B;  1V1P B;  4HSP A;  4APV A;  1B7Y B;  3MEF A;  1PH3 A;  4IUU A;  3GP7 A;  3A0J A;  3E3X A;  3HP3 A;  3NUC A;  1PXU A;  5M3F G;  1VS0 A;  1DYQ A;  3K5M A;  3UE0 A;  2OXP A;  5BR8 Q;  3K0Y A;  1BXT A;  4C3J B;  5M3M H;  1KIX A;  1XXG A;  5ISR A;  5ELE A;  2XTI A;  2B29 A;  3STB D;  3D3R A;  1N8R C;  3VDY A;  2JA7 G;  1EU3 A;  1L0W A;  1WTV A;  1SYF A;  5I6W A;  1XPO A;  2ES2 A;  1PTO F;  1M8A A;  1Y8P B;  2QA4 A;  1VQL A;  1X56 A;  3VYR A;  1UE1 A;  1WTH A;  3M85 A;  1SNP A;  1PHJ A;  4RWS C;  3PO2 B;  1SLJ A;  4GNX A;  1L0Y B;  3DMU A;  3GV6 A;  3EQL C;  5E4W C;  4DV5 L;  3RMH A;  2Z6K C;  4C3H G;  2PZW A;  4QB4 A;  5KIX A;  2EPB A;  4GS3 A;  1IYU A;  2EYJ A;  3PUW A;  2ZM6 L;  1Q7Y C;  2JA7 H;  2R93 G;  1EOV A;  1E2V A;  3F2U A;  2V1C C;  1C7Y A;  2JA6 B;  2DUD A;  2JA9 A;  3R2I A;  3F2B A;  1QIL A;  4IUN A;  1F2L A;  2Z4I A;  2UXC Q;  3MWY W;  1G6Z A;  2F0F A;  1GUT A;  1B2T A;  3M4O H;  4C3H H;  3H94 A;  2JQO A;  4X65 L;  4UP8 A;  4A3K B;  2PNH A;  2R93 H;  3F1Z A;  4JI3 Q;  4GOP B;  2XSC A;  2Z4H A;  2KQ3 A;  4JI2 Q;  4A3B G;  1YHB A;  1PRT B;  1A3V A;  4LF9 Q;  4P75 A;  4EGV A;  1G2S A;  1TS3 A;  2A6E D;  2ZXP A;  3OWF A;  2ZT9 C;  3CAM A;  1EFW A;  4OEM B;  3HS0 C;  5HGT A;  1Q86 C;  4ZKC B;  3H09 A;  4DV2 L;  1GXD C;  4WJ3 M;  1U4L A;  4CJ0 B;  3KDF B;  3OTO Q;  1QNU A;  1WVL A;  4A3B H;  4LF4 L;  4MZ9 A;  4X62 L;  4ZLT F;  3S1M B;  1Z6H A;  2KJX A;  4ZRZ A;  1Q12 A;  3S2H B;  3BZD B;  1X3E A;  5E1F A;  4YHH Q;  3M4Y A;  4TSS A;  2ZTD A;  3BDO A;  4JI0 Q;  3NBH A;  2L0C A;  4DNI A;  1ONL A;  1NUC A;  3NQI A;  4DK0 A;  3DHQ A;  4JYA Q;  1ICW A;  4G4K A;  4X3S A;  2XGT A;  3L7Z C;  2IWH A;  2NBF A;  3A56 A;  3ULL A;  1K3R A;  1KRS A;  2F0O A;  4J15 A;  5KND A;  2K50 A;  1K83 H;  2HIX A;  1JC7 A;  1MD2 D;  2HHH Q;  1TQO A;  1HCZ A;  1MBY A;  5JPM C;  1DM0 B;  2YYZ A;  4UPA A;  4DF7 A;  1YI2 A;  4CBV A;  3BVZ A;  4RA8 A;  2RSN A;  1O7Y A;  2CWA A;  3SK8 A;  1Y1W B;  1M90 C;  2IHF A;  3N52 A;  5CBE E;  4UHV A;  1NNX A;  1XWE A;  4TRD A;  1K28 A;  2YU9 H;  5IY0 A;  1YHA A;  2AUJ D;  1KD1 C;  1JIC A;  4PQX A;  1DOL A;  2FJ2 A;  2IJ0 A;  4FVM A;  2R92 B;  1K8A C;  3CCS A;  1PRT C;  3W1B A;  3HOY G;  4A3C G;  1D2B A;  1LTL A;  3ND8 A;  5ELD A;  4DNT B;  4MIU A;  1JR0 D;  3MFG A;  1XPR A;  1S3O A;  5IGE A;  1GJX A;  5IP7 G;  5EKI A;  4OO1 G;  4AH6 A;  5IGG A;  4FDB A;  1B70 B;  4IOC A;  3WOF A;  3K58 A;  4JI3 L;  5BN5 A;  1SNO A;  4JI2 L;  4RHR A;  4L6T B;  3PO3 G;  3M7N A;  2Z6B A;  4HID A;  1HHV A;  3T1Y Q;  2CW0 C;  3IRB A;  4A3C H;  3PUV A;  4QF4 A;  3AU7 A;  4ME5 A;  3PIO 3;  4B08 A;  2F0H A;  4X6A H;  1D6E C;  1DJR D;  4DR5 Q;  1EZ8 A;  1PTO H;  3HG9 A;  4PMB A;  1E1O A;  2O4X A;  5IP7 H;  4OO1 H;  4HJ5 A;  3ERO A;  3OTO L;  2K5D A;  1EQR A;  5M5Y H;  4IUT A;  2B63 G;  2R7F A;  3PO3 H;  3S1R B;  2EYL A;  4OWW B;  4DR4 Q;  1BBW A;  4GKK L;  1H9M A;  5C44 G;  2JA8 G;  3IFT A;  1XTD A;  3HOU G;  1V43 A;  2GA4 B;  4BBR H;  4JI6 Q;  4CKE A;  2FFK B;  1HZA A;  2H4O A;  3GTO H;  4JV5 L;  1X6O A;  2BE5 C;  4YHH L;  4A3I H;  1WTO A;  2F0W A;  1I6H H;  4RGO S;  4JI0 L;  3CKI B;  2H5X A;  1NJI C;  5K5P A;  1P16 A;  3P20 A;  2B63 H;  1MKH A;  3AMU A;  1F9S A;  1AZQ A;  4JYA L;  1KTK A;  1STN A;  3BYY B;  4DR1 Q;  4K8I A;  1D1K A;  5M5X B;  2L9H A;  3VYS A;  3LGJ A;  3NE5 B;  1VF7 A;  1Y1V B;  2E2D C;  1YEZ A;  3UDX A;  5M5W H;  5C44 H;  4B3T Q;  2JA8 H;  1FNW A;  1S5F D;  1K8O A;  2RBM A;  2E75 C;  4PV1 C;  2HHH L;  5IYD H;  4P72 A;  1EIG A;  2N49 A;  2KHS A; 
#chains in the Genus database with same CATH homology
 1GKH A;  3ULJ A;  3PIO A;  4LUV A;  4OX9 Q;  4A3L H;  2JJQ A;  1Y1V H;  4A3E G;  2WB1 G;  4O0A A;  4JI1 L;  3RLO A;  2B3G A;  5C4X H;  4B3R Q;  4L5Q A;  5BR8 L;  1VQ5 A;  1E22 A;  1WYD A;  1C9O A;  4DR7 L;  1V9P A;  2GN5 A;  3HOV H;  4IPG A;  3I4N G;  4TVA B;  1UE7 A;  1I94 Q;  5FLM G;  2I5M X;  5IP9 H;  3PUX A;  1WOC A;  1XMQ L;  1NMF A;  5GRO A;  3G6E A;  2VQE Q;  4DV0 Q;  4HJ8 A;  2N3S A;  1X3G A;  4PMW A;  3FKI H;  3I7F A;  3I4O A;  4DR6 Q;  5H1S E;  4JOI A;  2F3I A;  2ZJR A;  5IE8 A;  4R4C A;  3CD6 A;  4NPS A;  3PCO B;  3U58 A;  1MJC A;  4O2D A;  1HNZ L;  5GQO A;  3GTQ H;  4BA1 I;  1L1O B;  4DR2 Q;  1A0I A;  4A3E H;  4KHP L;  1BBU A;  1OTC A;  2K5V A;  4HJ7 A;  4DV2 Q;  1KRT A;  4K0K L;  3CW2 C;  1VQG A;  4LUO A;  3J81 i;  4DR3 L;  2E5L Q;  2QEX A;  1NTG A;  1VQO A;  3I4N H;  5AJ3 Q;  4GNX C;  5FLM H;  1HNX Q;  3S15 H;  2R7D A;  1VQB A;  1IXR A;  4P71 A;  1LUZ A;  1OXT A;  2E2J H;  4HIO A;  1N36 Q;  1SRO A;  2UU9 L;  1XNR L;  2NVT H;  3CCL A;  4DK6 C;  2NVQ H;  3I4M G;  3CP0 A;  3OW2 A;  2UXC L;  1N33 L;  2PI2 E;  4DR5 L;  1Q8K A;  3J80 c;  3NEL A;  1HNW L;  4IPC A;  2VQF L;  4IO9 A;  2CFM A;  1S40 A;  1PV4 A;  1IBM L;  2N78 A;  5JEA G;  2RF4 A;  3EIV A;  1NBW A;  3TRE A;  1VQ6 A;  2NZO A;  4R1J A;  3L2P A;  2OWO A;  1CKN A;  3S2D H;  4LF7 L;  2RCN A;  4AIM A;  2FXQ A;  1VQC A;  2Q2T A;  1SE8 A;  2D0O A;  2L15 A;  1VQK A;  1Z47 A;  2JK8 A;  5DLQ E;  1J5E L;  1HR0 Q;  3HOX G;  1ASY A;  4NB3 A;  1NE3 A;  4P73 A;  1D7Q A;  3BJU A;  3GTK H;  1RIP A;  1PA6 A;  4LF9 L;  4JI6 L;  1CKN B;  4PG3 A;  1X3F A;  2Y0S E;  1LM0 A;  2UUA L;  1VQ8 A;  3I4M H;  3HOY H;  3PO2 G;  3FP9 A;  4DUZ L;  5JJL A;  1CUK A;  1UE6 A;  4ALP A;  5JEA J;  4HIK A;  3RZD H;  4GKJ Q;  1IBL L;  1EQQ A;  3KF8 B;  1K8G A;  1HZC A;  4JG2 A;  2VNU D;  3HKS A;  3CQZ H;  2YTY A;  3GO5 A;  4LNQ A;  2F4V Q;  3S1N H;  2MFI A;  1N34 L;  1O7I A;  3CCU A;  3UDG A;  1PH7 A;  1SFO H;  1SMX A;  1WI5 A;  2UUC Q;  5FJ8 G;  4GNX B;  2BA0 A;  3HOX H;  3F2D A;  1VQD A;  4B3T L;  4XTC S;  2JA6 G;  3GTG H;  4RMF A;  2KHJ A;  5C3E H;  3TS2 A;  4DV4 Q;  1K9M C;  5IWA Q;  3K81 C;  1HR0 W;  1PH5 A;  2WFW A;  3PO2 H;  1N32 L;  4LF6 L;  2CCZ A;  4A93 G;  1B8A A;  2AWO A;  3T1H Q;  2NVY H;  1LYL A;  1HZ9 A;  3UDF A;  3OYY A;  4A3F G;  3KF6 B;  1PH1 A;  1FJG Q;  3PIP A;  2PMZ E;  4A3M G;  1JMC A;  1EYG A;  4LF5 Q;  3JAM c;  3GTP H;  2Z0S A;  1VQJ A;  4L5T A;  3KLW A;  3D31 A;  3RLF A;  2K4K A;  3KJO A;  3PF5 A;  3CCE A;  4R4I A;  3E9H A;  2NN6 I;  4OX9 L;  1HZB A;  5K36 G;  1TWC H;  4YWM A;  4X64 Q;  3NEN A;  3K7U C;  4A3G G;  3GTL H;  4OXP A;  4OON A;  1L1O C;  5IYC G;  3S24 A;  4JBM A;  5HY6 A;  4BY7 H;  1TWH H;  4B3R L;  1KAW A;  2JA6 H;  2K52 A;  3U4V A;  1AE2 A;  4YY3 L;  2E2H H;  1TXY A;  4JI8 Q;  1J6Q A;  3CPF A;  3J81 c;  2ZM6 Q;  5ELN A;  1VQE A;  4DV0 L;  1I3Q H;  2VQE L;  4BY1 G;  4AQY L;  3PGZ A;  3CC2 A;  4A93 H;  3ERS X;  3HOU H;  4A3F H;  1VQM A;  4DR6 L;  3CCQ A;  4A3M H;  3W5O A;  4LWC A;  5LMU Q;  1UWV A;  3UDI A;  3S17 H;  4IFD I;  2OQK A;  2EQS A;  5LMN Q;  3K7A H;  3HOU G;  2ZTE A;  3CMA A;  4DR2 L;  3M4Q A;  4A3G H;  3CME A;  5IYC H;  4LFB Q;  3RR5 A;  1TWF H;  2I0Q A;  5EAY A;  1VQN A;  1UE5 A;  4YCU A;  2E5L L;  4PZ7 A;  1FGU A;  4X65 Q;  2GVB A;  3HKZ E;  4Y52 H;  5AJ3 L;  5E7N A;  2YTX A;  2N8N A;  1TWA H;  4LFA Q;  2IX1 A;  1A63 A;  1YBY A;  4LF8 L;  1QZG A;  4BY1 H;  3I2Z A;  4LFC Q;  4GKK Q;  2PQA B;  2F52 A;  2VUM H;  3CCV A;  2VY3 A;  4IPH A;  1VQ7 A;  1L1O A;  4YCW A;  4JI7 Q;  2MO1 A;  4QGU A;  3JAM i;  1YJ9 A;  1VQP A;  4B3M L;  4BBS G;  4DKA C;  4JV5 Q;  2UUB Q;  3BZC A;  1XPU A;  4OWT B;  4NXN L;  4GN3 B;  2LXJ A;  2OCE A;  1G51 A;  2Q2U A;  4KI0 A;  3AFP A;  4DK3 C;  3RZO H;  3S14 H;  3EBE A;  1PVO A;  4JC0 A;  3I56 A;  4HJA A;  1GD7 A;  2YTV A;  5ELO A;  3F2C A;  1CSP A;  1QUQ A;  3HFZ B;  1GVP A;  4JBW A;  3TEH B;  4DV7 Q;  3H3V I;  2BA1 A;  1H95 A;  2IY5 B;  1PH6 A;  3PV0 A;  3D0F A;  1HR0 L;  3M4P A;  1Z9F A;  4C3I H;  1N9W A;  1R9T H;  2WP8 J;  4HIM A;  1WFQ A;  1ASZ A;  3E9I A;  5M3M G;  2UXB Q;  3NBH B;  2KHI A;  2C35 B;  4LF4 Q;  3T1Y L;  1QUQ B;  3B6Y A;  5FLX c;  4X62 Q;  4DV6 Q;  5C0X I;  1S72 A;  3Q8D A;  1EIF A;  4BBS H;  2EIF A;  4DAY B;  4Y7N H;  4GKJ L;  1P8L A;  1UEB A;  1WCM G;  4JBJ A;  4DV3 Q;  4QQB X;  1SR3 A;  3M9B A;  1HH2 P;  2Q2H A;  5GAE C;  4APV A;  4GN5 A;  1B7Y B;  3MEF A;  1Y1W G;  2VW9 A;  4MTN A;  1PH3 A;  3AFQ A;  1PH4 A;  4B3S L;  4JI4 Q;  3NEM A;  3CXC A;  2Y0S G;  4DUY Q;  3A0J A;  1A8V A;  5M3F G;  1VS0 A;  3DLL A;  3UE0 A;  3STB C;  1MIU A;  5BR8 Q;  1KIX A;  2ALY B;  5M3M H;  4GLV B;  2JA5 G;  2XTI A;  3CC7 A;  2B29 A;  3STB D;  2I5L X;  5IWA L;  1X9N A;  4MNO A;  3VDY A;  1N8R C;  2JA7 G;  4DR4 L;  1L2F A;  1L0W A;  4GOP C;  1XMO Q;  4EQ5 A;  1XPO A;  2ES2 A;  4JBK A;  2QA4 A;  1VQL A;  1XNQ Q;  4DV1 L;  3T1H L;  3AEV A;  4NXM L;  3PF4 A;  1OXV A;  1G6P A;  1FJG L;  1EIY B;  1JB7 A;  1X56 A;  1D8L A;  3AQQ A;  4LF5 L;  1WCM H;  1UE1 A;  1QVF A;  4DAM A;  3ZJY C;  3M85 A;  4IOA A;  1PHJ A;  3TS0 A;  4IJH A;  1SLJ A;  4GNX A;  1PFS A;  2K5N A;  4R4T A;  2QGQ A;  4DV5 L;  3CCM A;  4C3J H;  3HOW G;  3PUY A;  1E24 A;  4KHP Q;  1A62 A;  2Z6K C;  4PZ6 A;  3G71 A;  1CKO A;  1Q81 C;  1YZ6 A;  4XIG S;  1DGS A;  2MQH A;  4YCV A;  4DR1 L;  4GS3 A;  2VL6 A;  2ATW A;  2JA5 H;  3PUW A;  2K5H A;  3KF6 A;  4JI8 L;  2ZM6 L;  1IZ6 A;  1Q7Y C;  2JA7 H;  2R93 G;  1EOV A;  1MJE A;  2A1A A;  1FL0 A;  2V1C C;  1PH8 A;  1C7Y A;  3ULP A;  3J7A 5;  2NN6 G;  2UU9 Q;  2DUD A;  1VCI A;  2JA9 A;  1KHI A;  3F2B A;  3RN5 A;  1Q82 C;  1XNR Q;  4OO1 I;  1BKB A;  2K75 A;  4BBR G;  5LMU L;  1VQI A;  2UXC Q;  1Q1E A;  2ID0 A;  2UXD Q;  2IT1 A;  1HJP A;  1U0L A;  2OQ0 A;  4LW1 A;  4OWX B;  4A3I G;  4P74 A;  1HNW Q;  3HOW H;  4LFB L;  3M4O H;  4A3J G;  3PSI A;  4C3H H;  4A3K G;  3UE1 A;  2JQO A;  4GLX A;  4X65 L;  4UP9 A;  4UP8 A;  5GAG C;  5FJ8 H;  1I50 H;  4JI7 L;  4LFA L;  2PNH A;  1K0R A;  3CCR A;  2R93 H;  2R6G A;  4IFD G;  3F1Z A;  1BVS A;  1J5E Q;  4JI3 Q;  4GOP B;  1I94 L;  3GDE A;  4EX5 A;  4JI2 Q;  3H0G G;  4A3B G;  1YHB A;  4KLK A;  2Z6K A;  4LF9 Q;  2RHQ B;  3I55 A;  1X54 A;  1CSQ A;  4P75 A;  1IBK Q;  3HKZ G;  2AWN A;  3CAM A;  2A8V A;  1PH9 A;  4JI5 Q;  1IBL Q;  1EFW A;  5IYD G;  4A3J H;  3KJP A;  1XJV A;  4L5R C;  3JC6 6;  4A3K H;  1YHQ A;  4IFD J;  1Q86 C;  1NMG A;  4DV2 L;  1G29 1;  2PQA A;  4QL5 A;  4WJ3 M;  2JE6 I;  2KEN A;  3KDF B;  4C2M H;  3OTO Q;  2OTL A;  3G48 A;  3GTM H;  1QVC A;  4RG1 A;  3H0G H;  4X66 Q;  4A3B H;  1HNX L;  2BH2 A;  4LF4 L;  2RHS B;  4MZ9 A;  4DPG A;  4X62 L;  1OXS C;  1K73 C;  2NVX H;  5IP9 G;  1Y14 B;  3KFU A;  1WJJ A;  1N36 L;  4WJ4 A;  2NZH A;  1Q12 A;  2D62 A;  4DV3 L;  4IPD A;  1JJC B;  1X3E A;  1JE5 A;  3MXN B;  3BU2 A;  3K80 C;  4YHH Q;  4JI4 L;  3S16 H;  2ZTD A;  4DUY L;  3TQY A;  5LMN W;  4JI0 Q;  2PI2 A;  4DNI A;  3TRZ A;  5C0X G;  1EWI A;  2JEA I;  4JYA Q;  2D0P A;  1T9H A;  1W2B A;  2XGT A;  3S1M H;  4YY3 Q;  3L7Z C;  3ER0 A;  3F8T A;  3S2H H;  1GO3 E;  1V1Q A;  1SRU A;  2YV5 A;  3ULL A;  1K3R A;  4A76 A;  1XMO L;  1KRS A;  2WAQ G;  1XNQ L;  2HT1 A;  1JT8 A;  4AQY Q;  4J15 A;  2A19 A;  1E7Z A;  2K50 A;  3H3V H;  1C0A A;  1YVC A;  3WWV A;  1K83 H;  2WB1 E;  4UY8 C;  2HIX A;  2HHH Q;  5C0X J;  1KL9 A;  2F4V L;  2IHE A;  3DM3 A;  1FVI A;  3PUZ A;  2E2I H;  2YYZ A;  2WAQ E;  4QIW E;  2CQO A;  4BXX G;  4AYB G;  4UPA A;  1YI2 A;  4TQU S;  2AMC B;  2ZJP A;  4A75 A;  2CWA A;  1M90 C;  1VQ4 A;  3SGI A;  2IHF A;  2UUC L;  4R4Q A;  1IL2 A;  4JI1 Q;  2YU9 H;  4BA2 I;  5IY0 A;  1YHA A;  1OXU A;  3GTJ H;  2KCT A;  4POG A;  1KD1 C;  2R92 G;  4LF8 Q;  4A3D G;  4DR7 Q;  2E8G A;  3GD7 A;  4DV4 L;  2IX0 A;  2I5H A;  4YWL A;  1K8A C;  4YWK A;  1CKM A;  1XMQ Q;  3CCS A;  2ASB A;  3A5U A;  1VQF A;  3W1B A;  3HOY G;  4AYB E;  4A3C G;  1LTL A;  1VQH A;  2UXD L;  4B3M Q;  1NY4 A;  3BZK A;  1Q46 A;  2LSS A;  5JJI A;  4PZ8 A;  4NXN Q;  2K14 A;  1Y1W H;  3A5Z B;  1HNZ Q;  3K8A A;  4BXX H;  1XPR A;  4X64 L;  1S3O A;  2OTJ A;  5IP7 G;  3H15 A;  5GAD C;  4OO1 G;  5M3F H;  4AH6 A;  2HQL A;  3ICE A;  4FDB A;  4K0K Q;  1B70 B;  4H02 A;  4IOC A;  3A74 A;  2EXD A;  1YJW A;  2R7Z G;  4JI3 L;  4DR3 Q;  2CWP A;  2R92 H;  4A3D H;  2MO0 A;  1KXL A;  4JI2 L;  5C3E G;  1E3P A;  1EUJ A;  3PO3 G;  3M7N A;  1SN8 A;  4HID A;  3T1Y Q;  2GVA A;  3IRB A;  5GAH C;  4A3C H;  1IBK L;  3PUV A;  1PH2 A;  4JI5 L;  4X6A H;  5LMN L;  1N33 Q;  5J3B A;  4POF A;  3G4S A;  1RL2 A;  2AKW B;  4DR5 Q;  4QY7 A;  1YNX A;  1Q1B A;  3AYH B;  4QJF A;  1E1O A;  2VS1 A;  2VQF Q;  4LUZ A;  5IP7 H;  4GOP A;  4B3S Q;  4HJ5 A;  3CF5 A;  1IBM Q;  1KQS A;  1JJ2 A;  3OTO L;  1I5F A;  1YJN A;  1EQR A;  5M5Y H;  4BY7 G;  3CC4 A;  2B63 G;  2R7Z H;  1YIT A;  2DGY A;  1VQ9 A;  3CPW A;  4LF7 Q;  2R7F A;  2ZTC A;  4X66 L;  4HJ9 A;  3PO3 H;  5C4J H;  1TWG H;  4OWW B;  4DR4 Q;  1BBW A;  4LFC L;  4GKK L;  3U4Z A;  5C44 G;  2ZJQ A;  2JA8 G;  4ME3 A;  1XTD A;  3K0X A;  2LXK A;  3L0O A;  1V43 A;  4GN4 B;  4BBR H;  4DV1 Q;  1E1T A;  2HIV A;  1QVG A;  2UUA Q;  4JI6 Q;  4NXM Q;  3J80 i;  1HZA A;  4JCV E;  4KHZ A;  5IYB G;  4DUZ Q;  1GM5 A;  3RNU A;  1X6O A;  2UUB L;  3GTO H;  3KDF A;  4JV5 L;  4YHH L;  1YIJ A;  4A3I H;  2Q2I A;  3U50 C;  1I6H H;  3HOZ G;  3E0E A;  4R4O A;  4JI0 L;  2H5X A;  1NJI C;  3RLN A;  4DV5 Q;  1AH9 A;  4UP7 A;  4DV7 L;  1P16 A;  1X65 A;  1N34 Q;  2KCM A;  1MKH A;  3W1G A;  3S1R H;  2B63 H;  4JYA L;  4A3L G;  3J81 j;  5JJK A;  1Y1V G;  1PYB A;  4DR1 Q;  3RN2 A;  1X55 A;  4IJL A;  2MNA A;  2CKZ B;  2KBN A;  1AE3 A;  4JOI C;  1KC8 C;  2JEB I;  3LGJ A;  3KYH C;  5C4X G;  1QZH A;  4GLA C;  2UXB L;  1W3S A;  5C44 H;  1YEZ A;  3UDX A;  5M5W H;  4B3T Q;  2JA8 H;  3S1Q H;  3HOV G;  1IYJ B;  4DV6 L;  2VUM G;  3M3Y H;  1U5K A;  4L5S A;  2AHO B;  4LF6 Q;  1N32 Q;  5IYB H;  3KOJ A;  1JJG A;  1VQA A;  4A4I A;  5IT9 c;  2HHH L;  3CCJ A;  2BH8 A;  1M1K C;  3FKI G;  2VZA A;  1OXX K;  3HOZ H;  5IYD H;  4P72 A;  5HGQ A;  3FHW A;  2N49 A;  3EN2 A;  5M5X H;  3J7Z C;  1PYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...