2K4KA

Solution structure of gsp13 from bacillus subtilis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of GSP13 from Bacillus subtilis exhibits an S1 domain related to cold shock proteins.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Rna binding protein
molecule keywords General stress protein 13
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k4kA01
4FDBA 2IHFA 5C3EH 4A3EG 2JE6I 4KLKA 2K5NA 4P75A 2QEXA 2JA8G 4B3ML 5GADC 1EIFA 1LM0A 4A3CH 3S16H 3KF6B 2B29A 2I0QA 4JI1L 1FGUA 2K5VA 4DV1Q 2KHIA 4JI1Q 4DV1L 3UE1A 1KL9A 3UE0A 2ZTCA 2R7FA 2RCNA 2YV5A 1KD1C 4DR1L 1I3QH 4LF5Q 4YWLA 4DR1Q 1HR0W 1UE5A 4ALPA 4IPCA 4A3GH 3OYYA 2UU9L 1VQHA 3DLLA 1Y1WG 3D31A 4A76A 4YY3Q 1X9NA 1EFWA 1NTGA 1VQFA 3FKIH 3L2PA 2OQKA 4DAMA 4DV6Q 1ASYA 3AFPA 4JBWA 4YWKA 3VDYA 2E2HH 4OWXB 3HFZB 4YCVA 5IT9c 4LF7Q 2ZJRA 1A0IA 4C3IH 2WFWA 3F8TA 4RG1A 1C7YA 2HHHL 3HOVH 1FJGQ 4JI8L 3DM3A 3M4PA 1U5KA 2NZHA 3M4QA 4A93G 4OONA 4DR3Q 1MJCA 2OQ0A 5GQOA 1Y14B 2WB1G 4BA1I 4GOPA 1AE2A 3U58A 3HOXH 4L5SA 4BBSH 2JQOA 2Y0SE 4IOAA 3G48A 2JA9A 4OWTB 4DKAC 1BKBA 2VQEL 3U4VA 4GLXA 3MEFA 3S17H 2R93H 5JJKA 3TQYA 3RZOH 2K4KA 3A74A 1PHJA 2KCMA 1K8GA 2KHJA 4X64Q 1EQQA 1L1OB 1X55A 3W5OA 4DR4Q 1XTDA 2CWPA 1TWGH 3KDFA 3CMEA 3PO3G 2VUMH 4BA2I 1YVCA 3E9IA 3FP9A 3KF6A 1YHBA 4A3LG 5HGQA 1P8LA 2A8VA 4JCVE 1CKNB 4BY1H 5FJ8H 1YJNA 3GTKH 4C3HH 3KJOA 3H3VH 4JG2A 1UE1A 4DV4L 3PF5A 3T1YL 1J6QA 4DNIA 3S2HH 1VQKA 3HKZG 1QVCA 3S24A 1S40A 3H3VI 4GNXA 5FLXc 3E9HA 1IZ6A 4X65L 4JI4Q 1SE8A 1LTLA 4X65Q 4LF6Q 1PH5A 5IYCH 4NXML 2PI2E 2RHSB 4R4OA 3RZDH 4GKJQ 1YJ9A 1VQCA 2AMCB 4HJ5A 1FJGL 1S72A 1N36L 2D62A 1W2BA 1YJWA 1CUKA 1G291 1Q1EA 1J5EQ 2D0PA 3FKIG 4B3TQ 3HOWG 2R92H 1PV4A 5HY6A 2UUBL 1NBWA 1QZGA 1XJVA 2E5LQ 1BVSA 1B8AA 1I94L 4X64L 5FLMG 5C0XG 3I4MH 1MKHA 3HOYH 3CMAA 3RNUA 2EXDA 1M1KC 1KHIA 3RLOA 2MFIA 3SGIA 3ZJYC 3CCSA 2NN6G 3CCEA 2ID0A 4QJFA 2KBNA 2NN6I 4LWCA 5C3EG 1HZAA 3STBD 4A3EH 1PH3A 4HJ7A 1Q46A 3NEMA 4JV5L 3ULJA 3CCVA 1QVFA 2Q2UA 3PV0A 4EQ5A 1CSPA 3GDEA 2R7DA 4Y52H 4GN4B 1WFQA 3F2CA 4DV0Q 1FL0A 3AEVA 1NE3A 2CKZB 2H5XA 2ES2A 2WAQG 3EIVA 2LXJA 4KI0A 3S1NH 3L0OA 4UP8A 1SROA 1E22A 1WJJA 2BA1A 3TS2A 3CCMA 1L0WA 1N9WA 1IXRA 4X62L 2NVQH 4P72A 2Q2TA 3B6YA 1Q82C 1N32L 1C9OA 5IY0A 3OTOQ 1XNQL 4AIMA 5M3FG 1K3RA 1K73C 3S1RH 1JT8A 2PNHA 2UUAQ 4LF6L 1IBML 2HQLA 4IPDA 1YNXA 5AJ3Q 1E1TA 3D0FA 5IYBG 5JJLA 1WYDA 2N3SA 2N78A 3CF5A 3PCOB 1N36Q 3J81c 2K52A 2NZOA 3CCUA 1PYSB 4C3JH 5M3MH 5LMNW 1D7QA 3HOYG 2N8NA 2OTLA 4LFAQ 3KOJA 1XPUA 3PUXA 1PVOA 2AKWB 2UUBQ 2PI2A 3F1ZA 5C0XJ 3OW2A 5IE8A 1QUQA 5LMNL 4IO9A 3PSIA 4L5RC 4OXPA 2CCZA 3T1HQ 2BH2A 1YI2A 1K9MC 1Z47A 2IT1A 2IX0A 3BU2A 3HOWH 1KRTA 3PUYA 1HR0Q 4DR6Q 1B70B 4MNOA 1LUZA 4JI7Q 4GLVB 5J3BA 4IOCA 2Z6KC 1XMOL 1L2FA 4JYAQ 4K0KL 1DGSA 1WCMH 3J7ZC 2B3GA 1PH1A 3ULLA 3RN2A 2JA6H 5C4XG 3GTLH 4AYBE 5IYCG 1HNXL 3RN5A 5EAYA 4APVA 4JI8Q 1SLJA 1QZHA 3ERSX 2IX1A 4KHPL 1UE7A 1HZBA 4YHHQ 2UXCQ 1IBKL 5IP7H 2OWOA 4A3JG 4NB3A 1Q12A 3J80c 5JJIA 4J15A 3GTPH 3UDIA 5FJ8G 4GKKQ 2AWOA 3GTMH 1GD7A 1HH2P 1A62A 1TWHH 1N32Q 4JBJA 4PZ8A 3CP0A 3I4NG 2K50A 1B7YB 3JAMc 3RLNA 3I4OA 4DR4L 2UXBL 1X3GA 3UDXA 1HNZQ 3ER0A 3F2BA 4LF9L 1PH8A 5FLMH 4DV3L 2HIVA 5K36G 2FXQA 1HNWQ 3PO2G 3K7AH 5ELNA 4DR5L 4DUYL 1TWAH 2K14A 4IPGA 1YIJA 4GLAC 4JOIA 4B3SQ 2ZTEA 1E7ZA 4BY7H 4X62Q 1CSQA 4YWMA 4HIDA 3MXNB 1VQOA 3GTGH 1H95A 1V1QA 1EQRA 3GTQH 4A3FH 4A3IG 1NJIC 1HZCA 2E8GA 4GN5A 1PFSA 1VQDA 2YTYA 1AH9A 1KIXA 3I7FA 1HNWL 3AFQA 1Q8KA 1I5FA 1IBMQ 2LXKA 4IFDI 1SFOH 4WJ3M 3CC2A 3NENA 5C44G 1C0AA 4C2MH 3CPFA 3EBEA 1VQEA 2F3IA 1OXSC 4QL5A 3A5ZB 2IHEA 3CW2C 5JEAJ 2ZM6L 4A3GG 2CFMA 2GVBA 2PQAB 2MO1A 3EN2A 4BY1G 4NXMQ 5IP9H 2QGQA 1TWFH 1VQ4A 2JA7H 4X6AH 4QIWE 2YU9H 1NY4A 4NXNQ 2ALYB 4YCUA 3CD6A 1XNRQ 1OXVA 1J5EL 3KLWA 1GO3E 1Z9FA 3PUZA 4LUVA 4HJ9A 1PH4A 1A63A 4DUZL 2JA8H 2F4VQ 1EUJA 1OXTA 4QY7A 2JA6G 1I6HH 1WCMG 3AYHB 2ZJPA 4DUYQ 1SN8A 1QVGA 3GO5A 2RHQB 4JI5Q 1X6OA 3K0XA 2JEAI 2Q2HA 3CCLA 2BA0A 4PMWA 4P71A 3HOZG 1BBWA 4BBSG 4DR6L 2UXBQ 1CKMA 4MZ9A 4JI6L 4JBMA 4UP9A 4X66L 3CCQA 4DV2Q 2NVYH 3GTOH 4JI6Q 4KHPQ 4IPHA 4AQYQ 3UDFA 1PH6A 4QGUA 3TRZA 1PH2A 1I94Q 4A3IH 5H1SE 1GVPA 3HOVG 2VZAA 1E1OA 2OCEA 5M5XH 2B63G 2ZTDA 3M4OH 4JOIC 4BBRH 2JJQA 5E7NA 3M85A 4B3TL 1VCIA 1KAWA 4L5QA 1G51A 4JYAL 3KDFB 4O0AA 1N34Q 2UXDL 1KQSA 3F2DA 1Y1VH 1IYJB 4GKJL 4XTCS 4A4IA 1VQ8A 3S1MH 4BBRG 1RL2A 2EQSA 4POFA 1XMQL 2UU9Q 2A1AA 4JBKA 4JI7L 3K7UC 4GNXB 1A8VA 1X3FA 4LUOA 2ZM6Q 1EYGA 4GOPB 1HR0L 2V1CC 1E3PA 4A75A 2ATWA 4DR2Q 4OX9L 2DGYA 1O7IA 1S3OA 3LGJA 1T9HA 2L15A 3HKZE 4DV5L 1PH7A 4NXNL 4LF7L 1Q86C 4PZ6A 4R4QA 3I4NH 2R7ZG 1G6PA 4IJHA 1U0LA 5DLQE 1W3SA 1TWCH 2JEBI 5ELOA 2VW9A 1MIUA 5M5WH 4PZ7A 2D0OA 4IJLA 3OTOL 4A3MH 1JB7A 3NELA 4IFDG 3TS0A 2WAQE 1ASZA 4JI3L 3W1BA 2Z6KA 3I55A 2Q2IA 2NVXH 4A3JH 3J80i 5AJ3L 4LF5L 4DPGA 2MQHA 2WB1E 4B3SL 1EOVA 1L1OC 5C4XH 5LMUQ 1VQMA 2RF4A 4DK6C 5LMUL 2I5MX 2VUMG 2XTIA 3JAMi 1Q7YC 4A3DH 1E24A 1NMFA 2EIFA 3STBC 4JI3Q 4B3RL 3K80C 4O2DA 3S15H 1K0RA 2E5LL 2PQAA 4H02A 2HHHQ 5JEAG 3E0EA 4LW1A 1WOCA 2JA5G 1VQAA 1SRUA 4DR7L 4JI0L 4B3MQ 4DAYB 5IYBH 3PUVA 2Z0SA 4YY3L 1X3EA 4MTNA 4A93H 1JJCB 1VQ7A 3I56A 4OO1G 1VQJA 2CWAA 1K83H 4JC0A 3BZCA 4A3FG 3CQZH 1IBLQ 1N33L 4TQUS 3L7ZC 1X54A 2JA5H 2B63H 1UE6A 3NBHB 1XMQQ 2E2JH 3CCJA 1N8RC 3H15A 4DV7Q 3JC66 1FVIA 1IBKQ 4YHHL 4K0KQ 1Y1WH 4DV2L 5C0XI 3CC4A 1JJGA 3UDGA 2VQFL 4P73A 1HNXQ 5BR8L 4HIOA 4GS3A 2HIXA 1VQ5A 3PO3H 1V43A 5C4JH 4LF8Q 1CKOA 1PA6A 1GM5A 1X56A 2MO0A 1Q81C 4JI4L 4A3KG 1N34L 2UXDQ 1JJ2A 4AQYL 3G4SA 4LFBL 2UXCL 2R93G 2A19A 3CPWA 2R6GA 4RMFA 4TVAB 1EWIA 2C35B 5IP7G 3HOXG 1YEZA 3BJUA 2VQEQ 1KC8C 1UEBA 1L1OA 2ZJQA 3J81j 4LNQA 4JI0Q 2HT1A 3RR5A 4LF8L 4DR3L 3A0JA 3CCRA 4A3MG 1SR3A 3K81C 4HIKA 3RLFA 1VQNA 1HJPA 3G6EA 5GROA 2Y0SG 4Y7NH 1XMOQ 1WI5A 4X66Q 2F4VL 3I4MG 2KENA 1GKHA 3KF8B 4DUZQ 4UY8C 4BXXH 3U4ZA 3HKSA 1VQLA 3T1HL 1NMGA 3ULPA 1SMXA 3Q8DA 4R1JA 4R4TA 3J81i 4GNXC 3H0GG 2R92G 2CQOA 5IYDH 3CAMA 1R9TH 4BY7G 1VQPA 3PO2H 1YBYA 5IWAQ 4OWWB 1N33Q 4DK3C 1YZ6A 3PF4A 1JMCA 5IWAL 2AHOB 1KXLA 1X65A 5M3MG 1Y1VG 4A3BH 4DR5Q 2PMZE 2OTJA 2QA4A 4NPSA 4AH6A 3J7A5 1BBUA 4JI2L 1V9PA 2ASBA 4DV0L 2K75A 4DV6L 1HNZL 4LF9Q 4R4CA 3KJPA 3PIOA 5M3FH 4DR2L 2YYZA 4OX9Q 4HIMA 4JV5Q 1YHAA 1JE5A 4UP7A 2E2IH 3HOZH 3M3YH 3W1GA 2VNUD 4A3LH 4POGA 4A3KH 2DUDA 1OXUA 3PIPA 4LUZA 2YTVA 4DV3Q 3HOUH 2IY5B 1CKNA 4GOPC 4L5TA 2N49A 4LFBQ 2XGTA 2WP8J 3M9BA 3I2ZA 2VY3A 1EIYB 5GAEC 4KHZA 3CXCA 2GN5A 3HOUG 1XPOA 5IYDG 4P74A 2JK8A 3GD7A 4ME3A 3TREA 4JI2Q 5GAHC 1VQ9A 3KFUA 3IRBA 3S1QH 5IP9G 3BZKA 1MJEA 2JA7G 2VQFQ 1K8AC 4YCWA 4LFCL 3FHWA 4DV5Q 3M7NA 4LF4L 5LMNQ 2K5HA 2VS1A 4DV4Q 2I5LX 1AE3A 1KRSA 2VL6A 5M5YH 5C44H 4GKKL 2YTXA 4QQBX 4OO1I 1YITA 2KCTA 1M90C 4UPAA 5GAGC 1OTCA 2LSSA 1PYBA 4WJ4A 4A3BG 5BR8Q 1Q1BA 3WWVA 2UUCQ 4LFCQ 1I50H 3T1YQ 2F52A 3PUWA 3S2DH 4A3DG 2UUCL 1RIPA 1VQGA 1UWVA 3H0GH 4A3CG 1XNRL 4IFDJ 1LYLA 4EX5A 4DR7Q 2AWNA 1IBLL 4PG3A 2MNAA 1HZ9A 1VQIA 2BH8A 1XNQQ 4HJ8A 3CC7A 4B3RQ 4R4IA 3U50C 1OXXK 2I5HA 3ICEA 2GVAA 1YHQA 4LF4Q 1TXYA 1XPRA 2NVTH 1QUQB 1D8LA 3TEHB 4AYBG 4XIGS 4BXXG 1PH9A 3S14H 1IL2A 4DV7L 1VQBA 4HJAA 3PGZA 3A5UA 3GTJH 3K8AA 4LFAL 2UUAL 3AQQA 3G71A 1VQ6A 4GN3B 4JI5L 1P16A 2R7ZH 1VS0A 3KYHC
chains in the Genus database with same CATH superfamily
2EXZA 3OWFA 4ZLTF 2A5HA 3NTIA 3J81E 5GADC 2AUKA 3S16H 3KF6B 1ENFA 2KHIA 4DV1L 4G4KA 1MSGA 3UE0A 2I07B 1X3PA 5JVG3 4DR1L 3QB3A 1UE5A 1STYA 2NTTA 4IPCA 2UU9L 3BYTB 1NTGA 1NR4A 4DV6Q 1EY8A 2IW3A 4JBWA 3VDYA 4OWXB 2KECA 5IT9c 3H94A 3J7YW 4EVOA 3TP5A 2WFWA 1G6ZA 2R3ZA 2R93B 1U5KA 1U4LA 4OEMB 4DR3Q 1W6KA 4K14A 3VYTA 5C5LA 4BA1I 1Y14B 3U58A 3DWQA 5IYDH 1AE2A 2A6ED 2Y0SE 4OWTB 5JJKA 3U4VA 2R93H 2K4KA 1ESFA 1FD7D 5EBCA 4X64Q 4KD3A 3W5OA 1SBBB 1XTDA 4DXGA 3UI2A 3CMEA 4BA2I 1WTWA 1YVCA 2JP1A 1P8LA 2EYPA 2J4XA 1CKNB 5C6AA 2FHTA 4DN4M 3H3VH 5M3MB 1RCVD 5HGTA 1ZYRC 1QVCA 3S24A 3H3VI 4GNXA 4JVZA 4X65L 2YU9B 1SE8A 5COYA 1SNOA 1LTLA 4X65Q 1PH5A 5IYCH 1ZEQX 4R4OA 4HJ5A 1FJGL 5A2QE 1W2BA 3D3RA 2CW0C 3D4DA 2VB2X 3W3AA 5JAVA 3T53B 4B3TQ 1K3BC 2R92H 5HY6A 4XQJA 2UUBL 4G7HC 1B8AA 1I94L 2L5TA 2NVYB 3OHXC 1K83B 1BF4A 1M1KC 5C4JB 2AQ3B 3M4OB 2ID0A 1HUNA 2KBNA 5F2DA 3NSWA 4HJ7A 1QB5D 4M1UB 4JV5L 1QE6A 3CCVA 1F2LA 2R7DA 2ZXRA 4GN4B 4OGQC 1FL0A 1NE3A 2CKZB 1B44D 3EIVA 4MTKA 3S1NH 4HSPA 1HA6A 1SROA 1IYVA 1SAPA 4HCSA 3MA2B 2F03A 4P72A 1Q82C 3QOLA 1N32L 1C9OA 4AIMA 1K3RA 2PNHA 4LF6L 1IBML 3TN2A 3Q0AA 1E1TA 2N78A 3PCOB 1QOHA 3J81c 1HTPA 3CCUA 2NUCA 1F2ZA 3HOYG 3PUXA 3MXUA 1EY7A 1O80A 4FF3A 4K8JA 4DAPA 4IO9A 2JA8B 3ND9A 5C3WA 1K9MC 3BU2A 2IX0A 1C48A 1EEID 3TSSA 4DR6Q 1B70B 4MNOA 4JI7Q 2A69C 5J3BA 4JYAQ 3ONAB 5KYLA 3S16B 3RN2A 3GTLH 4KHVA 3TZDA 2F0PA 5IYCG 3BYYB 3RN5A 4APVA 2AUJD 5D3IB 1Y8OB 4KHPL 4S3SA 1IBKL 3V96A 3R2IA 3HOZB 3I4MB 1Q12A 1TS3A 5CBEE 5FJ8G 3GTMH 3DWPA 1A62A 3TP8A 2DNEA 3RLNA 3I4OA 4B08A 2UXBL 1Y8PB 3UDXA 5L37A 1PH8A 5K36G 1STHA 3K7AH 2KQ3A 5ELNA 4DR5L 4DUYL 4JOIA 4B3SQ 3EA6A 5TSSA 4X62Q 3GTGH 4BY7H 1V1QA 1EQRA 3K7AB 4A3FH 1VQDA 2RA4A 1AH9A 2M9VA 5C44B 1HNWL 2K04A 4DA2A 2F0FA 1IBMQ 3GTGB 2LXKA 3VR2A 4KTAA 3NENA 3SR1A 5C44G 4A3FB 4C2MH 4PMCA 2B2UC 4FNFA 3EBEA 4QB4A 4KJNA 2SNMA 2ZXPA 3SDZA 3CW2C 2GVBA 4HR7B 2QGQA 4RHSA 1K8OA 5A35A 4KKSA 2ALYB 1DXMA 2QF7A 3QJYA 1OXVA 3PUZA 3DUZA 1PH4A 4DUZL 1F9SA 3N52A 4HN7A 1WCMG 3AYHB 2ZJPA 1QVGA 1D6EC 3GO5A 5FOBB 1B4OA 1BR9A 1SE4A 2Q2HA 1Y8NB 2HDMA 3HOZG 4ILWA 4MZ9A 1TY0A 4DV2Q 3BVMA 2A74C 3GTOH 4AQYQ 3UDFA 1PH6A 4KY7A 1QNUA 4F7XA 3NXWA 4A3IH 1WD0A 4ZQ3A 5M5XH 3M4OH 1AZPA 4B3TL 4JYAL 1PTOD 2UXDL 3PIP3 5FO9B 3F2DA 4KK7A 3D6WA 4XDXA 2K5DA 2SDFA 3V2TA 4XTCS 4XXEA 1SYBA 3NE5B 1RL2A 2EQSA 3PMFA 3S1NB 2A1AA 1I4PA 2AQ1B 4FYDA 1HR0L 1PRTB 4A75A 2DGYA 4DV5L 1NR2A 2DNCA 2PNRC 4R4QA 4DK1A 4HSVA 1G6PA 4JPBW 4IALA 1TWCH 5I6YA 2SOBA 2VW9A 1MIUA 4A3MH 4PZ7A 3EROA 4TRDA 3TS0A 1SFOB 4JI3L 4J8QA 3SK5A 1VMCA 2NVXH 4FXGC 5AJ3L 5ELBA 2WB1E 2XIWA 4B3SL 1EOVA 1L1OC 1RF2D 4A3DB 5LMUQ 1RTOA 3MHBA 5D14A 2I5MX 2VUMG 2NVXB 3A55A 1HQMC 1JR0D 4HMJA 3BS1A 1NMFA 3K80C 4N8X1 3S15H 1K0RA 4XT1B 2E5LL 5JEAG 3E0EA 2LS01 5FLXE 5KNDA 4Q5VA 2OXPA 1DM0B 2JA5B 5IYBH 1GXDC 4RAUC 1JJCB 1VQ7A 4L63B 5C3EB 1TY2A 1IBLQ 4TQUS 5I9OA 1XMQQ 1SNQA 5ISRA 3QO2A 4DV7Q 4DAVA 1ENCA 2F3VA 4DV2L 5I9PA 3CC4A 3HP3A 3DHQA 5BR8L 4HIOA 1EZ6A 1JQYD 3IFTA 1V43A 1PA6A 1GM5A 1Q81C 1V1PB 1KABA 1U4MA 1N34L 1SE3A 2UXCL 1MBYA 5E4WC 4TVAB 3P75A 1AFPA 1EWIA 3QOJA 5IP7G 1YEZA 5I4DA 4LNQA 4JW0A 1JE4A 2HT1A 1F2YA 4LF8L 3A0JA 3TP6A 1IKLA 2B2YC 5GROA 2Y0SG 4Y7NH 1SDFA 2KENA 3KF8B 4BXXH 2ICEC 1EYDA 3HKSA 4B9WA 3BVZA 5CMDA 3T1HL 1NMGA 3VR3A 2R92G 2MUYA 1PRTD 1YBYA 3K58A 4OWWB 1VF5C 2A69D 2L9HA 1EY6A 3I4LA 3LWEA 2JA6B 2QA4A 4NPSA 1BBUA 4C3JG 2F0QA 2ASBA 4DV6L 3QWNA 4WRDA 1F9RA 4A3KB 5M3FH 2YYZA 4HIMA 1D1KA 1JE5A 2E2IH 1CT1D 4CKCA 3M3YH 2IWHA 4FF1A 4A3KH 2H4OA 1OXUA 4LUZA 2YTVA 1BOSA 3D6CA 2WP8J 3M3YB 4CDFC 2D9UA 4HTHA 2L1BA 1HPCA 4X3UA 4MHEA 4JI2Q 3FEWX 4H13C 4DF7A 2EPBA 1IKMA 4YCWA 4DV5Q 3D4RA 5T1GA 3KBXA 3OIQA 1EY4A 2VS1A 5T1IA 2VL6A 2I46A 5KNCA 1M90C 2KCTA 2F0UA 3I4NB 1GUNA 2VB3X 2RDFA 5BR8Q 4PNYA 2F0DA 1Q1BA 4LFCQ 1XNRL 4EX5A 2B2UA 1HZ9A 3WOEA 4FF2A 2K05A 3CC7A 4R4IA 2AQ2B 3ICEA 1KLGD 3OPOA 4LF4Q 4K6LA 4BXXG 3NQIA 3TEHB 4XIGS 3MVVA 3SEBA 2IJ0A 3S14H 1ILQA 1H9SB 4LFAL 2UUAL 1S5ED 3TP7A 3S14B 3HGBA 2IHFA 5C3EH 4A3EG 1GUWA 1I3QB 2B8GA 1CZGA 1EIFA 2J7ZA 3CKIB 1RKNA 3WDNA 1QILA 1HHVA 3DEPA 5IGFA 1R4QB 1QCBD 2L0CA 3LNNA 4KJOA 1X32A 4DR1Q 2CHBD 1IW7C 3OYYA 4A76A 1T5XD 5NUCA 3AFPA 2P5ZX 4YWKA 3TBIB 3I72A 2E2HH 1FGBD 2F3WA 3HOVH 3MWYW 4RG1A 1C7YA 2HHHL 1HTLD 1TR5A 1FJGQ 1LO5D 4RA8A 1MJCA 3R2TA 4U673 5GQOA 4L5SA 3NWSA 4QCLA 2JQOA 4IOAA 3G48A 4DKAC 3S17H 1BKBA 5JEAH 4F8MA 3A74A 5CV9A 1PHJA 2F0LA 1K8GA 2KHJA 1EQQA 1IW7D 1L1OB 3AU7A 3I73A 2L4NA 4CGYB 2VUMH 2RVLA 3E9IA 3M4YA 5JOBA 5DM63 4JCVE 2SNSA 4DV4L 1TWGB 4RGTA 1J6QA 4DNIA 2BDOA 2A6HD 2CH4W 3P20A 3GTKB 4UHVA 2NWGA 5CV5A 5FO8B 1C8CA 1F9PA 1UEAB 3RZDH 1YJ9A 1VQCA 4GKJQ 5IIFA 1N36L 3S9WA 1SYDA 1G291 2H1EA 2B2VC 3MXNA 1SNCA 2O5IC 1PTOB 2KCCA 2F0NA 4LMQD 2RKSA 2F0TA 5EPLA 1B3AA 1CQVA 1PTOH 1WVLA 5C0XG 1MKHA 2QKIC 3CMAA 2EXDA 3RLOA 3ZJYC 3CCEA 1EZ8A 2NN6I 1PH3A 1HZAA 5EBDA 4QUFA 2Z6BA 1Q46A 2E76C 5IGBA 3ULJA 3URYA 1CTMA 4K6DA 2Q2UA 1QVFA 4EQ5A 3GDEA 2RQXA 1STNA 2QILA 1WFQA 4DV0Q 3C1FA 3AEVA 3ERQA 2WAQG 3K5LA 1YNND 5CV8A 4KI0A 3L0OA 3V05A 1L0WA 3SK4A 3CRKC 1B50A 1XNQL 1V8QA 4C56C 2HQLA 3QIAA 2MJ8A 2RCFA 5BN4A 5IYBG 2N3SA 3CF5A 3S1RB 4C3JH 2F0KA 1JORA 2OTLA 4LFAQ 1JB3A 1PFNA 2PI2A 3F1ZA 2UUBQ 4ZCKA 3BDOA 5FK9C 5IE8A 3T1HQ 2R61A 1YI2A 2IT1A 1I6HB 1LUZA 2Z6KC 1BCPF 4EQOA 4A3BB 1SEBD 3MXPA 4WORA 3J7ZC 1PH1A 5IGCA 4AYBE 1SXTA 5EAYA 2R92B 2HCIA 1SLJA 4ULLA 4JI8Q 3ERSX 3SHLA 3NTKA 2E2DC 5ELFA 3W2DA 1UE7A 1HZBA 4YHHQ 5EQ0A 2XSCA 4K5VA 4ZKBB 4A3JG 2OWOA 2HCCA 3J80c 1WTOA 4J15A 4PV1C 3FMCA 1E2VA 2AWOA 1DONA 2K32A 5DNFA 3GV6A 1N32Q 4MIUA 4JBJA 2K50A 4LF9L 4OIKA 3ER0A 3F2BA 2XNAC 3N6RA 3A54A 4FXKC 2FXQA 1HNWQ 3FVQA 3PO2G 4KN7C 4GLAC 2ZTEA 3L3OC 4YWMA 3MXNB 3K5OA 3IAYA 3BVGA 4H7BA 1QNKA 4I65A 1E2ZA 2YTYA 3I7FA 1I5FA 1SFOH 3FDTA 3CC2A 1A3UA 1I4RA 4A3JB 2G9HD 3TDQA 1VQEA 2F3IA 5I6WA 4NDXA 4QL5A 5LHY1 1LACA 2IHEA 2RSNA 4A3GG 4NXMQ 3G7LA 2JA7H 3GTJB 4DK0A 4NXNQ 2KJXA 2R7ZB 1J5EL 2PO4A 1Q3LA 1BCPD 1Z9FA 4HJ9A 2HQEA 2JA8H 1OXTA 4QY7A 5M9OA 2EYOA 4UAIA 3I3CA 3MTSA 1X6OA 2JEAI 3DMUA 2BA0A 2N88A 4P71A 4BBSG 1CKMA 4JI6L 3CCQA 4ZKCB 1JWMD 2ENBA 4JI6Q 4IPHA 4B9XA 1JOKA 4QGUA 1GUSA 1PH2A 1GVPA 3HOVG 1E1OA 2OCEA 2B63G 4C3IB 2TMPA 4O1NA 2L55A 2KA7A 2RBMA 2PZTA 1SNMA 4RKBA 4GKJL 3NP8A 2D2CC 3S1QB 4HEDA 1GHJA 2PYKA 2HDLA 3K7UC 1G2TA 4GNXB 4JK1C 4LUOA 2ZM6Q 1E3PA 5CYUA 2B8FA 1UUPA 1PH7A 1T9HA 5BN5A 1KDAA 1Q86C 4PZ6A 4R8IA 1QJOA 3KLSX 4LAAA 4DFAA 4IJHA 1U0LA 1EY9A 5M5WH 3J81L 4IFDG 1ZKOA 1Q90A 3W1BA 2Z6KA 4DPGA 2MQHA 4ODGA 5LMUL 2X69A 4IUPA 1E24A 4O2DA 2HHHQ 2PQAA 4H02A 1CK1A 4LW1A 1I4XA 1VQAA 4IN3A 1U4RA 2E74C 4JI0L 4B3MQ 1SJHD 1UNSA 4DAYB 2JN4A 2Z0SA 4YY3L 1I4QA 1X3EA 4MTNA 4A93H 2Q8IB 3T16A 3I56A 4OO1G 1VQJA 2CWAA 3CQZH 1N33L 2F4IA 1UE6A 2E2JH 2FMMA 2B2TC 3CCJA 1N8RC 3JC66 1F77A 1BUVT 4YHHL 3FPPA 2WAQB 4G57A 5C0XI 1TWHB 2VQFL 4QUCA 3OWEB 4GS3A 3NQTA 3BDLA 1X56A 2MO0A 4CJ1B 4A3KG 4O42A 5I2XA 2XWBB 2UXDQ 3G4SA 2R6GA 4RMFA 2KVMA 2VQEQ 1HQRD 4YIJA 3HOXB 1LTGD 1I4HA 3BG3A 5A2QL 4DR3L 1NAPA 1VDZA 4HIKA 3K81C 4ZYSA 4G7OC 3I4MG 2F4VL 4DUZQ 4UY8C 2NVQB 1S5BD 1VQLA 3K6OA 4N9PA 3ULPA 4IUVA 3EVQA 3Q8DA 4R1JA 2JA7B 3H0GG 4BY1B 5IGEA 1E2WA 3A8IE 1R9TH 1VQPA 2F0GA 3PO2H 3R8BA 1YZ6A 5CORA 2AHOB 5E3FA 1Y1VG 4CDDC 4IUUA 2OTJA 3GTLB 4AH6A 3J7A5 4JI2L 2XWJB 4DV0L 3H91A 1HNZL 2BCOA 1BNZA 3HOWB 3SK6A 1SYGA 1YHAA 1SNPA 3H09A 1PLFA 4A3LH 2EJGC 1DYQA 3VR5A 4POGA 1V1OA 2DUDA 2HUGA 4A3GB 2XGTA 2K01A 1STEA 2PMZB 2FMCA 3CXCA 3HOUG 4ME3A 2PW5A 3TREA 5GAHC 3I70A 3KFUA 3KK7A 3BZKA 3NPPA 1SYEA 3M7NA 4LF4L 1TS4A 4RCNA 1K8MA 4GKKL 3JAME 5C44H 4OO1I 2F0WA 1U4PA 1WTQA 3IFDA 2EYJA 1EQVA 1R4PB 2NYZD 4CHTB 2UUCQ 1PFBA 3S2DH 1RIPA 1UWVA 4A3CG 4DR7Q 1PRTF 1XNQQ 4HJ8A 1E0BA 2DY7A 1EU4A 2WV6D 1YHQA 1CHPD 1TXYA 2NVTH 2BE5C 4MN3A 1VQBA 2G5DA 4LJZC 3PGZA 3SK8A 5CV6A 4IUNA 3GTJH 3R3OA 5EPJA 3G71A 2C9OA 4JI5L 1YITA 2EOTA 3KYHC 1S5FD 2B2TA 4KLKA 2K5NA 3T4AC 4B3ML 4A3CH 4CJ2C 4KKUA 2B29A 1RJTA 4JI1L 5JJZA 2I0QA 2E2IB 1NSNS 3UE1A 1KL9A 2ZTCA 2R7FA 2RCNA 1Z7TA 3OMCA 1Y1WB 1CZWA 1HR0W 4ALPA 3VYRA 1KNEA 3GP7A 1Y1WG 3DXJC 5IGGA 1VQFA 1KDBA 3L2PA 2OQKA 1ASYA 3S1MB 3HFZB 4YCVA 1DCZA 3HS0C 2ZJRA 1A0IA 4C3IH 1LTTD 3F8TA 2TSSA 1XX8A 4F87A 2DJFC 4A93G 2NZHA 3M4QA 4OONA 2CH4A 2OQ0A 2WB1G 5EKLA 4KMUC 3HOXH 1D5MC 3K57A 4GLXA 2VQEL 1EYCA 3TQYA 1AW7A 3GTQB 4QMGA 1X55A 4DR4Q 2A6HC 2CWPA 3KDFA 1K28A 1YHBA 5IOCA 5DAUA 5HGQA 2A8VA 4BY1H 5FJ8H 4C3HH 4M8AA 1UE1A 3PF5A 2K28A 1EOTA 3S2HH 3HKZG 2NN6H 1S40A 1DOKA 3A7LA 4L6TB 5FLXc 3E9HA 1VMPA 4LF6Q 4QIWB 4TKOB 5IT9E 2AMCB 5EJWA 2D62A 1CUKA 1Q1EA 1J5EQ 2D0PA 2B2WC 1O7LA 3HKZB 4PQXA 1NBWA 3KLSA 1XJVA 2WB1B 4ME5A 1BVSA 1IHZA 4X64L 3HOUB 3GTOB 1KNAA 5FLMG 4A93B 3HOYH 1ET6A 1KHIA 3SGIA 1GJXA 1BCPC 3U9SA 1RODA 4NMZA 4LWCA 3VA7A 3FKIB 5J1ZA 1CSPA 2G9DA 4ABNA 2B2WA 4Y52H 2WKDA 5G3LD 4EQNA 3KLRA 2ES2A 1LT3D 2LXJA 1S5CD 3NBHA 1QWYA 5KNBA 1SJED 4UP8A 1EL0A 1E22A 2BA1A 1ZYRD 2F0MA 1N9WA 1IXRA 1U9RA 2Q2TA 3OTOQ 1K73C 5M3FG 1JT8A 1TWCB 3OIPA 1XTCD 3OMGA 4AYBB 5AJ3Q 5JJLA 1WYDA 1LTAD 2ZT9C 4U68A 5C5MA 2Q8TA 5LMNW 1D7QA 2N8NA 3KOJA 1XPUA 2AKWB 1X3QA 2DN8A 5LMNL 2BH2A 1WCMB 3I8ZA 3PSIA 2CCZA 1PVOA 4FP5D 3AB9A 3WOFA 1KRTA 1HR0Q 2MPMA 1HFNA 3RZDB 1G8ZD 4IOCA 1L2FA 4K0KL 1JOOA 1WCMH 1EWHA 5C4XG 2B3GA 3ULLA 5I2YA 1TT2A 4HCEA 1QZHA 1RDPD 2VXWA 2IX1A 2B63B 3GTMB 5IP7H 4NB3A 4Q0FA 3UDIA 3DEOA 4GKKQ 2BOSA 1GD7A 1S5DD 1HH2P 1V1PA 4PZ8A 3CP0A 1B7YB 3MC0B 4V0BA 4BY7B 5FLMH 1HRJA 3RMHA 1AZQA 3E0JA 1TWAH 2M00A 4KY6A 4E6IA 4TSSA 1ONLA 1E7ZA 1SMYC 3E3XA 5AFWA 1CSQA 4CBVA 1H95A 1TS5A 3GTQH 3KF8A 1HZCA 2E8GA 2QW7A 1H9RA 3VYSA 1KIXA 3AFQA 1Q8KA 1TS2A 2XVSA 4WJ3M 3NK9A 1STBA 4X3TA 3A5ZB 4RGNA 1ET9A 2CFMA 1AEXA 5IP9H 1VQ4A 4X6AH 1AN8A 3T51B 2YU9H 4C3HG 2E75C 3CD6A 3KLWA 1DOLA 5C4HA 4LUVA 1A63A 2F4VQ 1I6HH 4DUYQ 2O4XA 2RHQB 4K5XA 1KDCA 3E5SA 3K0XA 3CCLA 4CDCC 5KGUA 1BBWA 2UXBQ 4KHPQ 5E4XA 2NVYH 4ZAIA 3HEJA 1I94Q 1LTRD 3RUZA 4C3IG 2ZTDA 4JOIC 1JCKB 1L0YB 5DM73 3C1EA 3HOVB 1GUTA 3HRZC 3MFYA 1KAWA 1HCZA 1G51A 4I7AA 2KEEA 4O0AA 2Y0SB 1T5EA 1ICWA 1KQSA 4BBSB 2QDBA 4KKTA 4UDUC 5CR3A 1VQ8A 3S17B 1ML0D 2EJMA 2F0EA 3S1MH 2UU9Q 4JBKA 4JI7L 1X3FA 1IYUA 2V1CC 3A56A 2ATWA 3LGJA 1O7IA 1S3OA 2WACA 2L15A 1XXGA 3HKZE 2PZWA 4H44C 5E1FA 4LF7L 5ELCA 4FF4A 3I4NH 2R7ZG 1CFMA 1FNWA 4J6HA 3OTOL 1DJRD 3NELA 3DM1A 1JB7A 2Z1CA 2XRSD 2R7ZH 5KIXA 3T56B 2Q2IA 3Q23A 4A3JH 3J80i 4LF5L 2NZ1D 1ZXTA 5C4XH 1NNXA 1SE2A 4EQPA 2IX3A 3QR8A 5FO7B 1Q8IA 1H9SA 3A8KE 2EY1A 1Q7YC 5BN3A 4A3DH 2EY5A 2A68D 2X6GA 4GZYC 1II3A 2JA5G 2BE5D 1SRUA 3GV3A 4DR7L 3PUVA 3I90A 5EKKA 2QCPX 4R9WA 4JC0A 4C1NK 3PQIA 5IGDA 4A3FG 2B63H 1CA5A 1X54A 2JA5H 1I4GA 1S4ZA 1PZJD 4A3EB 1FYCA 3H15A 1JC7A 1FVIA 1IBKQ 4K0KQ 3J80E 2FFKB 1JJGA 3UDGA 2EZVA 2EJFC 4K8IA 1HFGA 1F2MA 2KHSA 5K5PA 4LF8Q 5C4JH 1CKOA 1FR3A 1UAPA 1JJ2A 2R93G 4LFBL 2A19A 4L5RC 4X3KA 2O5JC 2C35B 4RH6A 3HOXG 1UEBA 1PFMA 2NBFA 1HA5A 1L1OA 2ZJQA 3J81j 4JI0Q 2JXMB 4RHRA 5FLXL 3CCRA 1SR3A 4A3MG 2PCFB 4IZ8A 3RLFA 1HJPA 5LL6X 2MP1A 3G6EA 1XMOQ 1WI5A 4X66Q 4K5WA 1A2UA 5M5WB 1A3TA 1SMXA 3BZDB 4ZRZA 2KOLA 3IL8A 4R4TA 2CQOA 1D2BA 4ID6A 5IWAQ 1H9JA 3PF4A 4DK3C 2O2LD 3MZ5A 5J22A 5DEHA 3KBGA 2OEOA 4A3BH 3FPUB 4DR5Q 2PMZE 1A6XA 5CGKA 2K75A 1LTSD 2HD3A 4ZUIA 4R4CA 3KJPA 4DR2L 4OX9Q 1B9MA 4H0LC 4JV5Q 1J8IA 1SMYD 2EYMA 3EFXD 3W1GA 2VNUD 3J7AF 5M5XB 2IY5B 5ELDA 3PIPA 2K7VA 4DV3Q 2K33A 3A7AB 2N49A 2F0OA 3M9BA 2B39A 3C3LA 1MSHA 3I2ZA 2VY3A 1JWUD 1C4QA 2PQEA 4KHZA 1EIYB 2PPBC 3VR4A 5IYDG 4P74A 2JK8A 3GD7A 1RTNA 5EKIA 1J9OA 2JA7G 1SNDA 4WFN3 1PZID 2VQFQ 4LFCL 1PTOF 1SYFA 3NTHA 4FO2A 1TQOA 5LMNQ 3M7GA 2K5HA 2I5LX 1KRSA 5M5YH 2YTXA 2C5CA 5GAGC 2LSSA 1PYBA 1EIGA 4XQNA 1G91A 4A3BG 5M5YB 2LKVA 2N55A 4A3DG 1EYAA 3PUWA 2UUCL 1VQGA 3H0GH 1LYLA 4OIJA 1RD9D 4PG3A 4KN4C 2MNAA 1TIID 1VQIA 3S2HB 4B3RQ 3U50C 3IKJA 2GVAA 4PMBA 5K36H 2M2LA 1D8LA 4AYBG 1R9TB 2JSOA 1PH9A 1IL2A 3S15B 4DV7L 4HJAA 1BXTA 3NHHA 2WINB 3AQQA 5EPKA 4GN3B 3FRPB 4WJWA 1IBLL 4FDBA 1IL8A 1B1ZA 2JE6I 4P75A 2JA8G 2QEXA 4R8NA 1LM0A 1LABA 2EDGA 1FGUA 2K5VA 4DV1Q 3K59A 1OO9B 4JI1Q 4CKBA 2XN9C 2F0HA 2OT2A 2Z9HA 3HOYB 4BS9A 2IL8A 2YV5A 1KD1C 4LF5Q 1I3QH 4YWLA 1NUCA 5JPNC 2ICIA 3D8GA 4G7ZC 1LT6D 4A3GH 4ZK9B 4RGMA 1VQHA 3DLLA 1GHKA 3D31A 1X9NA 4YY3Q 1EFWA 3FKIH 4DAMA 3ITPA 3LX0A 4OO1H 4LF7Q 1LTBD 5IODA 1XWEA 1CQFA 1B2TA 4OL7A 2V4DA 4JI8L 3DM3A 2E2HB 3M4PA 5EGTA 2CW0D 3EJIA 4GOPA 4BBSH 4XYOA 2JA9A 1ESRA 1W6JA 3MEFA 5KRUA 3RZOH 3O13A 5CC4A 4KD4A 4Y7NB 2KCMA 3MAQA 1TWGH 3PO3G 3A8JE 1QG7A 4DAYA 3FP9A 3KF6A 4A3LG 4KV6A 4IFDJ 1YNNC 1YJNA 3GTKH 3KJOA 4JG2A 4IFDH 1EY0A 3T1YL 4IUTA 1VQKA 3NWTA 2RDHA 1IZ6A 3TMEA 2JYOA 2NVTB 4JI4Q 4NXML 2PI2E 2RHSB 5C3XA 5HURA 1S72A 4I7ZC 4NKLA 1YJWA 5M3FB 1PRTC 1TU2B 3FKIG 3HOWG 4X3SA 1PV4A 2PZUA 1B53A 1QZGA 4QF4A 2E5LQ 4F88A 3GQBA 1I6VC 3I4MH 3X3MA 1FNVA 2K03A 3RNUA 3SE0A 2MFIA 4EGVA 3CCSA 2NN6G 4QJFA 5C3EG 4A3EH 3STBD 2QDLA 3NEMA 1YNJC 3HZXA 3PV0A 4NP5A 1KLUD 1TWAB 2B2VA 3F2CA 4ZUJA 4DU9A 2H5XA 5KEEA 2KUMA 3TS2A 1WJJA 3R93A 3CCMA 1STGA 3Q6SA 3CHBD 4X62L 2NVQH 3B6YA 5FKAC 4IUQA 5IY0A 3K5NA 1VF7A 2Q8RE 1PXUA 3P1HA 4CKEA 3S1RH 2UUAQ 4RWSC 1PMRA 5CV7A 4IPDA 1YNXA 2MHVA 3PO2B 3D0FA 4K2LA 1N36Q 2IPKD 2K52A 2NZOA 4C3HB 1PYSB 2Z4IA 3LWUA 5M3MH 3VYUA 2K6AA 5KYIA 1M8AA 4J1MA 2WKCA 5C0XJ 3OW2A 4NW2A 1QUQA 5JPMC 2NB0A 4OXPA 3C2PA 1Z47A 4DNTB 3HOWH 3PUYA 2SEBD 1TKWB 1ENAA 4GLVB 1XMOL 1DGSA 1EEFD 1PTOC 2DY8A 2JA6H 2Z4HA 1HNXL 1BDOA 3KUPA 1WTXA 2A73B 2UXCQ 3D4WA 1D1IA 4DXFA 5IT9L 5JJIA 3GTPH 1LT5D 1TWHH 3AMUA 3I4NG 4DR4L 3JAMc 1X3GA 1HNZQ 2K5QA 3VA5A 4DV3L 3NBIA 2HIVA 4FXDA 3MFGA 5CBAE 2K14A 4IPGA 1YIJA 1A15A 1JWSD 4HIDA 1VQOA 1WTHA 1BO0A 2WIIB 2PW7A 1CHQD 3JAML 1WTPA 1NJIC 4A3IG 3X3NA 2EE1A 4GN5A 1PFSA 4A3MB 4IFDI 2L12A 1CI3M 1C0AA 3CPFA 4IURA 1OXSC 1K0SA 4LK1C 2EY6A 2ZM6L 5JEAJ 2PQAB 2MO1A 3EN2A 3H0GB 4BY1G 1TWFH 4QIWE 1H9KA 1B3QA 3L9AX 1NY4A 2DJGC 4YCUA 1XNRQ 1Z6HA 4N9TA 5C4ZA 3DWAA 1AP0A 1GO3E 1TWFB 2JA6G 1EUJA 3VR6A 2KCNA 4BWGB 1SN8A 4JI5Q 2EYLA 3T13A 3U9OA 3PIO3 4PMWA 4DR6L 2FINB 4UP9A 4X66L 4JBMA 4N8FA 3TRZA 4V190 1L0XB 1M4VA 5H1SE 2VZAA 4DNRB 3E6ZX 4HMIA 1O7ZA 4BBRH 1B9NA 3OOCA 2JJQA 1NCVA 5E7NA 3M85A 1VCIA 4L5QA 3KDFB 3QG1A 1EWCA 1N34Q 1Y1VH 4RFBA 5J39A 4BBRB 1IYJB 4CJ0B 2EVBA 4A4IA 4BBRG 1XMQL 4POFA 3CRLC 3J7AV 1EQTA 1ICFB 3H6MA 1Y1VB 1A8VA 2F0VA 1EYGA 4GOPB 1Y69U 1RHPA 4DR2Q 4OX9L 1ILPA 4NXNL 1STAA 4RGOS 1BQQT 1DZ1A 5DLQE 1W3SA 2JEBI 5ELOA 2D0OA 4IJLA 1I50B 3RD4A 2WAQE 3S2DB 2LFNA 3K5MA 1PZKD 1ASZA 4OHJA 2ZXOA 1G2SA 1TVXA 4XQQA 4C2MB 3HG9A 2VUMB 1VQMA 2RF4A 3G6JB 4DK6C 2B2YA 1H9MA 4OELB 1XYIA 2XTIA 1PDQA 3JAMi 3STBC 2EIFA 4JI3Q 4B3RL 1EY5A 2A6EC 1WOCA 1LV9A 1A3VA 1YNJD 2RDGA 2OF1A 1F9QA 4FVMA 1WTVA 2EYFA 1JOQA 3OW7A 3OSOA 4IQZA 3Q24A 1K83H 3BZCA 3L7ZC 3NBHB 3ZYYX 4DGZA 3SXHA 3BDCA 1HXYD 3GTPB 4A3IB 3PO3B 3CQZB 1Y1WH 5D3DA 2E2JB 4P73A 1HNXQ 2HIXA 1VQ5A 3C46A 1DD2A 3PO3H 4RKLA 3Q22A 1SSOA 1EU3A 4P2CB 2EYHA 4JI4L 2LMCB 1KTKA 1LLRD 4AQYL 1WTRA 2Z8LA 1LT4D 3CPWA 1GUOA 2LY7A 2XRQD 1KC8C 3BJUA 4CDEC 3TZUA 4KY5A 3RR5A 1DOMA 1VQNA 2F0IA 5C0XH 1GKHA 3U4ZA 1EFID 4RCOA 4GNXC 3J81i 2J0TD 4Z9CB 3CAMA 4BY7G 5C4XB 1D5ZC 5D65A 1N33Q 1KXLA 1JMCA 5IWAL 3NUCA 1X65A 2QEJC 4XT3B 5M3MG 1HUMA 5JVH3 4C3JB 3SVMA 2D5DA 1V9PA 1D5XC 4LF9Q 3MXGA 3PIOA 2NTSA 1O7YA 4UP7A 3HOZH 3P7JA 2RSOA 2K5WA 2FJ2A 2F0SA 1A2TA 1MHWC 2F1MA 5CV4A 3HOUH 1CKNA 4GOPC 4L5TA 4LFBQ 2KEDA 3CU7A 1WD1A 4C1NI 2F0JA 5GAEC 2GN5A 5G3LF 1XPOA 3EQLC 1GUGA 2X6LA 1VQ9A 3IRBA 3S1QH 5IP9G 2CQAA 1MJEA 1K8AC 3FHWA 1KAAA 1BBXC 1EIHA 3MEHA 4DV4Q 1AE3A 4QQBX 1BCPB 4UPAA 1OTCA 3RZOB 2K1BA 4WJ4A 4XYQA 1JICA 2L11A 4K2KA 5LL6S 3WWVA 1MI2A 1I50H 3K0YA 2BDNA 2F52A 3T1YQ 1PYWD 1SYCA 1CA6A 1MD2D 2AWNA 3H3VC 2BH8A 2CVRA 2GA4B 4HAEA 1O78A 3F2UA 1OXXK 2I5HA 2MGSA 1CM9A 2EY2A 1XPRA 1QUQB 1GOZA 5ELEA 3ND8A 3A5UA 2A68C 1MGSA 3K8AA 4L8JA 3I91A 3J80L 1VQ6A 1FNUA 1P16A 1LTID 1VS0A 3I55A
chains in the Genus database with same CATH topology
4FDBA 2IHFA 5C3EH 4A3EG 2JE6I 4KLKA 2K5NA 4P75A 2QEXA 2JA8G 4B3ML 5GADC 1EIFA 1LM0A 4A3CH 3S16H 3KF6B 2B29A 2I0QA 4JI1L 1FGUA 2K5VA 4DV1Q 2KHIA 4JI1Q 4DV1L 3UE1A 1KL9A 3UE0A 2ZTCA 2R7FA 2RCNA 2YV5A 1KD1C 4DR1L 1I3QH 4LF5Q 4YWLA 4DR1Q 1HR0W 1UE5A 4ALPA 4IPCA 4A3GH 3OYYA 2UU9L 1VQHA 3DLLA 1Y1WG 3D31A 4A76A 4YY3Q 1X9NA 1EFWA 1NTGA 1VQFA 3FKIH 3L2PA 2OQKA 4DAMA 4DV6Q 1ASYA 3AFPA 4JBWA 4YWKA 3VDYA 2E2HH 4OWXB 3HFZB 4YCVA 5IT9c 4LF7Q 2ZJRA 1A0IA 4C3IH 2WFWA 3F8TA 4RG1A 1C7YA 2HHHL 3HOVH 1FJGQ 4JI8L 3DM3A 3M4PA 1U5KA 2NZHA 3M4QA 4A93G 4OONA 4DR3Q 1MJCA 2OQ0A 5GQOA 1Y14B 2WB1G 4BA1I 4GOPA 1AE2A 3U58A 3HOXH 4L5SA 4BBSH 2JQOA 2Y0SE 4IOAA 3G48A 2JA9A 4OWTB 4DKAC 1BKBA 2VQEL 3U4VA 4GLXA 3MEFA 3S17H 2R93H 5JJKA 3TQYA 3RZOH 2K4KA 3A74A 1PHJA 2KCMA 1K8GA 2KHJA 4X64Q 1EQQA 1L1OB 1X55A 3W5OA 4DR4Q 1XTDA 2CWPA 1TWGH 3KDFA 3CMEA 3PO3G 2VUMH 4BA2I 1YVCA 3E9IA 3FP9A 3KF6A 1YHBA 4A3LG 5HGQA 1P8LA 2A8VA 4JCVE 1CKNB 4BY1H 5FJ8H 1YJNA 3GTKH 4C3HH 3KJOA 3H3VH 4JG2A 1UE1A 4DV4L 3PF5A 3T1YL 1J6QA 4DNIA 3S2HH 1VQKA 3HKZG 1QVCA 3S24A 1S40A 3H3VI 4GNXA 5FLXc 3E9HA 1IZ6A 4X65L 4JI4Q 1SE8A 1LTLA 4X65Q 4LF6Q 1PH5A 5IYCH 4NXML 2PI2E 2RHSB 4R4OA 3RZDH 4GKJQ 1YJ9A 1VQCA 2AMCB 4HJ5A 1FJGL 1S72A 1N36L 2D62A 1W2BA 1YJWA 1CUKA 1G291 1Q1EA 1J5EQ 2D0PA 3FKIG 4B3TQ 3HOWG 2R92H 1PV4A 5HY6A 2UUBL 1NBWA 1QZGA 1XJVA 2E5LQ 1BVSA 1B8AA 1I94L 4X64L 5FLMG 5C0XG 3I4MH 1MKHA 3HOYH 3CMAA 3RNUA 2EXDA 1M1KC 1KHIA 3RLOA 2MFIA 3SGIA 3ZJYC 3CCSA 2NN6G 3CCEA 2ID0A 4QJFA 2KBNA 2NN6I 4LWCA 5C3EG 1HZAA 3STBD 4A3EH 1PH3A 4HJ7A 1Q46A 3NEMA 4JV5L 3ULJA 3CCVA 1QVFA 2Q2UA 3PV0A 4EQ5A 1CSPA 3GDEA 2R7DA 4Y52H 4GN4B 1WFQA 3F2CA 4DV0Q 1FL0A 3AEVA 1NE3A 2CKZB 2H5XA 2ES2A 2WAQG 3EIVA 2LXJA 4KI0A 3S1NH 3L0OA 4UP8A 1SROA 1E22A 1WJJA 2BA1A 3TS2A 3CCMA 1L0WA 1N9WA 1IXRA 4X62L 2NVQH 4P72A 2Q2TA 3B6YA 1Q82C 1N32L 1C9OA 5IY0A 3OTOQ 1XNQL 4AIMA 5M3FG 1K3RA 1K73C 3S1RH 1JT8A 2PNHA 2UUAQ 4LF6L 1IBML 2HQLA 4IPDA 1YNXA 5AJ3Q 1E1TA 3D0FA 5IYBG 5JJLA 1WYDA 2N3SA 2N78A 3CF5A 3PCOB 1N36Q 3J81c 2K52A 2NZOA 3CCUA 1PYSB 4C3JH 5M3MH 5LMNW 1D7QA 3HOYG 2N8NA 2OTLA 4LFAQ 3KOJA 1XPUA 3PUXA 1PVOA 2AKWB 2UUBQ 2PI2A 3F1ZA 5C0XJ 3OW2A 5IE8A 1QUQA 5LMNL 4IO9A 3PSIA 4L5RC 4OXPA 2CCZA 3T1HQ 2BH2A 1YI2A 1K9MC 1Z47A 2IT1A 2IX0A 3BU2A 3HOWH 1KRTA 3PUYA 1HR0Q 4DR6Q 1B70B 4MNOA 1LUZA 4JI7Q 4GLVB 5J3BA 4IOCA 2Z6KC 1XMOL 1L2FA 4JYAQ 4K0KL 1DGSA 1WCMH 3J7ZC 2B3GA 1PH1A 3ULLA 3RN2A 2JA6H 5C4XG 3GTLH 4AYBE 5IYCG 1HNXL 3RN5A 5EAYA 4APVA 4JI8Q 1SLJA 1QZHA 3ERSX 2IX1A 4KHPL 1UE7A 1HZBA 4YHHQ 2UXCQ 1IBKL 5IP7H 2OWOA 4A3JG 4NB3A 1Q12A 3J80c 5JJIA 4J15A 3GTPH 3UDIA 5FJ8G 4GKKQ 2AWOA 3GTMH 1GD7A 1HH2P 1A62A 1TWHH 1N32Q 4JBJA 4PZ8A 3CP0A 3I4NG 2K50A 1B7YB 3JAMc 3RLNA 3I4OA 4DR4L 2UXBL 1X3GA 3UDXA 1HNZQ 3ER0A 3F2BA 4LF9L 1PH8A 5FLMH 4DV3L 2HIVA 5K36G 2FXQA 1HNWQ 3PO2G 3K7AH 5ELNA 4DR5L 4DUYL 1TWAH 2K14A 4IPGA 1YIJA 4GLAC 4JOIA 4B3SQ 2ZTEA 1E7ZA 4BY7H 4X62Q 1CSQA 4YWMA 4HIDA 3MXNB 1VQOA 3GTGH 1H95A 1V1QA 1EQRA 3GTQH 4A3FH 4A3IG 1NJIC 1HZCA 2E8GA 4GN5A 1PFSA 1VQDA 2YTYA 1AH9A 1KIXA 3I7FA 1HNWL 3AFQA 1Q8KA 1I5FA 1IBMQ 2LXKA 4IFDI 1SFOH 4WJ3M 3CC2A 3NENA 5C44G 1C0AA 4C2MH 3CPFA 3EBEA 1VQEA 2F3IA 1OXSC 4QL5A 3A5ZB 2IHEA 3CW2C 5JEAJ 2ZM6L 4A3GG 2CFMA 2GVBA 2PQAB 2MO1A 3EN2A 4BY1G 4NXMQ 5IP9H 2QGQA 1TWFH 1VQ4A 2JA7H 4X6AH 4QIWE 2YU9H 1NY4A 4NXNQ 2ALYB 4YCUA 3CD6A 1XNRQ 1OXVA 1J5EL 3KLWA 1GO3E 1Z9FA 3PUZA 4LUVA 4HJ9A 1PH4A 1A63A 4DUZL 2JA8H 2F4VQ 1EUJA 1OXTA 4QY7A 2JA6G 1I6HH 1WCMG 3AYHB 2ZJPA 4DUYQ 1SN8A 1QVGA 3GO5A 2RHQB 4JI5Q 1X6OA 3K0XA 2JEAI 2Q2HA 3CCLA 2BA0A 4PMWA 4P71A 3HOZG 1BBWA 4BBSG 4DR6L 2UXBQ 1CKMA 4MZ9A 4JI6L 4JBMA 4UP9A 4X66L 3CCQA 4DV2Q 2NVYH 3GTOH 4JI6Q 4KHPQ 4IPHA 4AQYQ 3UDFA 1PH6A 4QGUA 3TRZA 1PH2A 1I94Q 4A3IH 5H1SE 1GVPA 3HOVG 2VZAA 1E1OA 2OCEA 5M5XH 2B63G 2ZTDA 3M4OH 4JOIC 4BBRH 2JJQA 5E7NA 3M85A 4B3TL 1VCIA 1KAWA 4L5QA 1G51A 4JYAL 3KDFB 4O0AA 1N34Q 2UXDL 1KQSA 3F2DA 1Y1VH 1IYJB 4GKJL 4XTCS 4A4IA 1VQ8A 3S1MH 4BBRG 1RL2A 2EQSA 4POFA 1XMQL 2UU9Q 2A1AA 4JBKA 4JI7L 3K7UC 4GNXB 1A8VA 1X3FA 4LUOA 2ZM6Q 1EYGA 4GOPB 1HR0L 2V1CC 1E3PA 4A75A 2ATWA 4DR2Q 4OX9L 2DGYA 1O7IA 1S3OA 3LGJA 1T9HA 2L15A 3HKZE 4DV5L 1PH7A 4NXNL 4LF7L 1Q86C 4PZ6A 4R4QA 3I4NH 2R7ZG 1G6PA 4IJHA 1U0LA 5DLQE 1W3SA 1TWCH 2JEBI 5ELOA 2VW9A 1MIUA 5M5WH 4PZ7A 2D0OA 4IJLA 3OTOL 4A3MH 1JB7A 3NELA 4IFDG 3TS0A 2WAQE 1ASZA 4JI3L 3W1BA 2Z6KA 3I55A 2Q2IA 2NVXH 4A3JH 3J80i 5AJ3L 4LF5L 4DPGA 2MQHA 2WB1E 4B3SL 1EOVA 1L1OC 5C4XH 5LMUQ 1VQMA 2RF4A 4DK6C 5LMUL 2I5MX 2VUMG 2XTIA 3JAMi 1Q7YC 4A3DH 1E24A 1NMFA 2EIFA 3STBC 4JI3Q 4B3RL 3K80C 4O2DA 3S15H 1K0RA 2E5LL 2PQAA 4H02A 2HHHQ 5JEAG 3E0EA 4LW1A 1WOCA 2JA5G 1VQAA 1SRUA 4DR7L 4JI0L 4B3MQ 4DAYB 5IYBH 3PUVA 2Z0SA 4YY3L 1X3EA 4MTNA 4A93H 1JJCB 1VQ7A 3I56A 4OO1G 1VQJA 2CWAA 1K83H 4JC0A 3BZCA 4A3FG 3CQZH 1IBLQ 1N33L 4TQUS 3L7ZC 1X54A 2JA5H 2B63H 1UE6A 3NBHB 1XMQQ 2E2JH 3CCJA 1N8RC 3H15A 4DV7Q 3JC66 1FVIA 1IBKQ 4YHHL 4K0KQ 1Y1WH 4DV2L 5C0XI 3CC4A 1JJGA 3UDGA 2VQFL 4P73A 1HNXQ 5BR8L 4HIOA 4GS3A 2HIXA 1VQ5A 3PO3H 1V43A 5C4JH 4LF8Q 1CKOA 1PA6A 1GM5A 1X56A 2MO0A 1Q81C 4JI4L 4A3KG 1N34L 2UXDQ 1JJ2A 4AQYL 3G4SA 4LFBL 2UXCL 2R93G 2A19A 3CPWA 2R6GA 4RMFA 4TVAB 1EWIA 2C35B 5IP7G 3HOXG 1YEZA 3BJUA 2VQEQ 1KC8C 1UEBA 1L1OA 2ZJQA 3J81j 4LNQA 4JI0Q 2HT1A 3RR5A 4LF8L 4DR3L 3A0JA 3CCRA 4A3MG 1SR3A 3K81C 4HIKA 3RLFA 1VQNA 1HJPA 3G6EA 5GROA 2Y0SG 4Y7NH 1XMOQ 1WI5A 4X66Q 2F4VL 3I4MG 2KENA 1GKHA 3KF8B 4DUZQ 4UY8C 4BXXH 3U4ZA 3HKSA 1VQLA 3T1HL 1NMGA 3ULPA 1SMXA 3Q8DA 4R1JA 4R4TA 3J81i 4GNXC 3H0GG 2R92G 2CQOA 5IYDH 3CAMA 1R9TH 4BY7G 1VQPA 3PO2H 1YBYA 5IWAQ 4OWWB 1N33Q 4DK3C 1YZ6A 3PF4A 1JMCA 5IWAL 2AHOB 1KXLA 1X65A 5M3MG 1Y1VG 4A3BH 4DR5Q 2PMZE 2OTJA 2QA4A 4NPSA 4AH6A 3J7A5 1BBUA 4JI2L 1V9PA 2ASBA 4DV0L 2K75A 4DV6L 1HNZL 4LF9Q 4R4CA 3KJPA 3PIOA 5M3FH 4DR2L 2YYZA 4OX9Q 4HIMA 4JV5Q 1YHAA 1JE5A 4UP7A 2E2IH 3HOZH 3M3YH 3W1GA 2VNUD 4A3LH 4POGA 4A3KH 2DUDA 1OXUA 3PIPA 4LUZA 2YTVA 4DV3Q 3HOUH 2IY5B 1CKNA 4GOPC 4L5TA 2N49A 4LFBQ 2XGTA 2WP8J 3M9BA 3I2ZA 2VY3A 1EIYB 5GAEC 4KHZA 3CXCA 2GN5A 3HOUG 1XPOA 5IYDG 4P74A 2JK8A 3GD7A 4ME3A 3TREA 4JI2Q 5GAHC 1VQ9A 3KFUA 3IRBA 3S1QH 5IP9G 3BZKA 1MJEA 2JA7G 2VQFQ 1K8AC 4YCWA 4LFCL 3FHWA 4DV5Q 3M7NA 4LF4L 5LMNQ 2K5HA 2VS1A 4DV4Q 2I5LX 1AE3A 1KRSA 2VL6A 5M5YH 5C44H 4GKKL 2YTXA 4QQBX 4OO1I 1YITA 2KCTA 1M90C 4UPAA 5GAGC 1OTCA 2LSSA 1PYBA 4WJ4A 4A3BG 5BR8Q 1Q1BA 3WWVA 2UUCQ 4LFCQ 1I50H 3T1YQ 2F52A 3PUWA 3S2DH 4A3DG 2UUCL 1RIPA 1VQGA 1UWVA 3H0GH 4A3CG 1XNRL 4IFDJ 1LYLA 4EX5A 4DR7Q 2AWNA 1IBLL 4PG3A 2MNAA 1HZ9A 1VQIA 2BH8A 1XNQQ 4HJ8A 3CC7A 4B3RQ 4R4IA 3U50C 1OXXK 2I5HA 3ICEA 2GVAA 1YHQA 4LF4Q 1TXYA 1XPRA 2NVTH 1QUQB 1D8LA 3TEHB 4AYBG 4XIGS 4BXXG 1PH9A 3S14H 1IL2A 4DV7L 1VQBA 4HJAA 3PGZA 3A5UA 3GTJH 3K8AA 4LFAL 2UUAL 3AQQA 3G71A 1VQ6A 4GN3B 4JI5L 1P16A 2R7ZH 1VS0A 3KYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDB A;  2IHF A;  5C3E H;  4A3E G;  2JE6 I;  4KLK A;  2K5N A;  4P75 A;  2QEX A;  2JA8 G;  4B3M L;  5GAD C;  1EIF A;  1LM0 A;  4A3C H;  3S16 H;  3KF6 B;  2B29 A;  2I0Q A;  4JI1 L;  1FGU A;  2K5V A;  4DV1 Q;  2KHI A;  4JI1 Q;  4DV1 L;  3UE1 A;  1KL9 A;  3UE0 A;  2ZTC A;  2R7F A;  2RCN A;  2YV5 A;  1KD1 C;  4DR1 L;  1I3Q H;  4LF5 Q;  4YWL A;  4DR1 Q;  1HR0 W;  1UE5 A;  4ALP A;  4IPC A;  4A3G H;  3OYY A;  2UU9 L;  1VQH A;  3DLL A;  1Y1W G;  3D31 A;  4A76 A;  4YY3 Q;  1X9N A;  1EFW A;  1NTG A;  1VQF A;  3FKI H;  3L2P A;  2OQK A;  4DAM A;  4DV6 Q;  1ASY A;  3AFP A;  4JBW A;  4YWK A;  3VDY A;  2E2H H;  4OWX B;  3HFZ B;  4YCV A;  5IT9 c;  4LF7 Q;  2ZJR A;  1A0I A;  4C3I H;  2WFW A;  3F8T A;  4RG1 A;  1C7Y A;  2HHH L;  3HOV H;  1FJG Q;  4JI8 L;  3DM3 A;  3M4P A;  1U5K A;  2NZH A;  3M4Q A;  4A93 G;  4OON A;  4DR3 Q;  1MJC A;  2OQ0 A;  5GQO A;  1Y14 B;  2WB1 G;  4BA1 I;  4GOP A;  1AE2 A;  3U58 A;  3HOX H;  4L5S A;  4BBS H;  2JQO A;  2Y0S E;  4IOA A;  3G48 A;  2JA9 A;  4OWT B;  4DKA C;  1BKB A;  2VQE L;  3U4V A;  4GLX A;  3MEF A;  3S17 H;  2R93 H;  5JJK A;  3TQY A;  3RZO H;  2K4K A;  3A74 A;  1PHJ A;  2KCM A;  1K8G A;  2KHJ A;  4X64 Q;  1EQQ A;  1L1O B;  1X55 A;  3W5O A;  4DR4 Q;  1XTD A;  2CWP A;  1TWG H;  3KDF A;  3CME A;  3PO3 G;  2VUM H;  4BA2 I;  1YVC A;  3E9I A;  3FP9 A;  3KF6 A;  1YHB A;  4A3L G;  5HGQ A;  1P8L A;  2A8V A;  4JCV E;  1CKN B;  4BY1 H;  5FJ8 H;  1YJN A;  3GTK H;  4C3H H;  3KJO A;  3H3V H;  4JG2 A;  1UE1 A;  4DV4 L;  3PF5 A;  3T1Y L;  1J6Q A;  4DNI A;  3S2H H;  1VQK A;  3HKZ G;  1QVC A;  3S24 A;  1S40 A;  3H3V I;  4GNX A;  5FLX c;  3E9H A;  1IZ6 A;  4X65 L;  4JI4 Q;  1SE8 A;  1LTL A;  4X65 Q;  4LF6 Q;  1PH5 A;  5IYC H;  4NXM L;  2PI2 E;  2RHS B;  4R4O A;  3RZD H;  4GKJ Q;  1YJ9 A;  1VQC A;  2AMC B;  4HJ5 A;  1FJG L;  1S72 A;  1N36 L;  2D62 A;  1W2B A;  1YJW A;  1CUK A;  1G29 1;  1Q1E A;  1J5E Q;  2D0P A;  3FKI G;  4B3T Q;  3HOW G;  2R92 H;  1PV4 A;  5HY6 A;  2UUB L;  1NBW A;  1QZG A;  1XJV A;  2E5L Q;  1BVS A;  1B8A A;  1I94 L;  4X64 L;  5FLM G;  5C0X G;  3I4M H;  1MKH A;  3HOY H;  3CMA A;  3RNU A;  2EXD A;  1M1K C;  1KHI A;  3RLO A;  2MFI A;  3SGI A;  3ZJY C;  3CCS A;  2NN6 G;  3CCE A;  2ID0 A;  4QJF A;  2KBN A;  2NN6 I;  4LWC A;  5C3E G;  1HZA A;  3STB D;  4A3E H;  1PH3 A;  4HJ7 A;  1Q46 A;  3NEM A;  4JV5 L;  3ULJ A;  3CCV A;  1QVF A;  2Q2U A;  3PV0 A;  4EQ5 A;  1CSP A;  3GDE A;  2R7D A;  4Y52 H;  4GN4 B;  1WFQ A;  3F2C A;  4DV0 Q;  1FL0 A;  3AEV A;  1NE3 A;  2CKZ B;  2H5X A;  2ES2 A;  2WAQ G;  3EIV A;  2LXJ A;  4KI0 A;  3S1N H;  3L0O A;  4UP8 A;  1SRO A;  1E22 A;  1WJJ A;  2BA1 A;  3TS2 A;  3CCM A;  1L0W A;  1N9W A;  1IXR A;  4X62 L;  2NVQ H;  4P72 A;  2Q2T A;  3B6Y A;  1Q82 C;  1N32 L;  1C9O A;  5IY0 A;  3OTO Q;  1XNQ L;  4AIM A;  5M3F G;  1K3R A;  1K73 C;  3S1R H;  1JT8 A;  2PNH A;  2UUA Q;  4LF6 L;  1IBM L;  2HQL A;  4IPD A;  1YNX A;  5AJ3 Q;  1E1T A;  3D0F A;  5IYB G;  5JJL A;  1WYD A;  2N3S A;  2N78 A;  3CF5 A;  3PCO B;  1N36 Q;  3J81 c;  2K52 A;  2NZO A;  3CCU A;  1PYS B;  4C3J H;  5M3M H;  5LMN W;  1D7Q A;  3HOY G;  2N8N A;  2OTL A;  4LFA Q;  3KOJ A;  1XPU A;  3PUX A;  1PVO A;  2AKW B;  2UUB Q;  2PI2 A;  3F1Z A;  5C0X J;  3OW2 A;  5IE8 A;  1QUQ A;  5LMN L;  4IO9 A;  3PSI A;  4L5R C;  4OXP A;  2CCZ A;  3T1H Q;  2BH2 A;  1YI2 A;  1K9M C;  1Z47 A;  2IT1 A;  2IX0 A;  3BU2 A;  3HOW H;  1KRT A;  3PUY A;  1HR0 Q;  4DR6 Q;  1B70 B;  4MNO A;  1LUZ A;  4JI7 Q;  4GLV B;  5J3B A;  4IOC A;  2Z6K C;  1XMO L;  1L2F A;  4JYA Q;  4K0K L;  1DGS A;  1WCM H;  3J7Z C;  2B3G A;  1PH1 A;  3ULL A;  3RN2 A;  2JA6 H;  5C4X G;  3GTL H;  4AYB E;  5IYC G;  1HNX L;  3RN5 A;  5EAY A;  4APV A;  4JI8 Q;  1SLJ A;  1QZH A;  3ERS X;  2IX1 A;  4KHP L;  1UE7 A;  1HZB A;  4YHH Q;  2UXC Q;  1IBK L;  5IP7 H;  2OWO A;  4A3J G;  4NB3 A;  1Q12 A;  3J80 c;  5JJI A;  4J15 A;  3GTP H;  3UDI A;  5FJ8 G;  4GKK Q;  2AWO A;  3GTM H;  1GD7 A;  1HH2 P;  1A62 A;  1TWH H;  1N32 Q;  4JBJ A;  4PZ8 A;  3CP0 A;  3I4N G;  2K50 A;  1B7Y B;  3JAM c;  3RLN A;  3I4O A;  4DR4 L;  2UXB L;  1X3G A;  3UDX A;  1HNZ Q;  3ER0 A;  3F2B A;  4LF9 L;  1PH8 A;  5FLM H;  4DV3 L;  2HIV A;  5K36 G;  2FXQ A;  1HNW Q;  3PO2 G;  3K7A H;  5ELN A;  4DR5 L;  4DUY L;  1TWA H;  2K14 A;  4IPG A;  1YIJ A;  4GLA C;  4JOI A;  4B3S Q;  2ZTE A;  1E7Z A;  4BY7 H;  4X62 Q;  1CSQ A;  4YWM A;  4HID A;  3MXN B;  1VQO A;  3GTG H;  1H95 A;  1V1Q A;  1EQR A;  3GTQ H;  4A3F H;  4A3I G;  1NJI C;  1HZC A;  2E8G A;  4GN5 A;  1PFS A;  1VQD A;  2YTY A;  1AH9 A;  1KIX A;  3I7F A;  1HNW L;  3AFQ A;  1Q8K A;  1I5F A;  1IBM Q;  2LXK A;  4IFD I;  1SFO H;  4WJ3 M;  3CC2 A;  3NEN A;  5C44 G;  1C0A A;  4C2M H;  3CPF A;  3EBE A;  1VQE A;  2F3I A;  1OXS C;  4QL5 A;  3A5Z B;  2IHE A;  3CW2 C;  5JEA J;  2ZM6 L;  4A3G G;  2CFM A;  2GVB A;  2PQA B;  2MO1 A;  3EN2 A;  4BY1 G;  4NXM Q;  5IP9 H;  2QGQ A;  1TWF H;  1VQ4 A;  2JA7 H;  4X6A H;  4QIW E;  2YU9 H;  1NY4 A;  4NXN Q;  2ALY B;  4YCU A;  3CD6 A;  1XNR Q;  1OXV A;  1J5E L;  3KLW A;  1GO3 E;  1Z9F A;  3PUZ A;  4LUV A;  4HJ9 A;  1PH4 A;  1A63 A;  4DUZ L;  2JA8 H;  2F4V Q;  1EUJ A;  1OXT A;  4QY7 A;  2JA6 G;  1I6H H;  1WCM G;  3AYH B;  2ZJP A;  4DUY Q;  1SN8 A;  1QVG A;  3GO5 A;  2RHQ B;  4JI5 Q;  1X6O A;  3K0X A;  2JEA I;  2Q2H A;  3CCL A;  2BA0 A;  4PMW A;  4P71 A;  3HOZ G;  1BBW A;  4BBS G;  4DR6 L;  2UXB Q;  1CKM A;  4MZ9 A;  4JI6 L;  4JBM A;  4UP9 A;  4X66 L;  3CCQ A;  4DV2 Q;  2NVY H;  3GTO H;  4JI6 Q;  4KHP Q;  4IPH A;  4AQY Q;  3UDF A;  1PH6 A;  4QGU A;  3TRZ A;  1PH2 A;  1I94 Q;  4A3I H;  5H1S E;  1GVP A;  3HOV G;  2VZA A;  1E1O A;  2OCE A;  5M5X H;  2B63 G;  2ZTD A;  3M4O H;  4JOI C;  4BBR H;  2JJQ A;  5E7N A;  3M85 A;  4B3T L;  1VCI A;  1KAW A;  4L5Q A;  1G51 A;  4JYA L;  3KDF B;  4O0A A;  1N34 Q;  2UXD L;  1KQS A;  3F2D A;  1Y1V H;  1IYJ B;  4GKJ L;  4XTC S;  4A4I A;  1VQ8 A;  3S1M H;  4BBR G;  1RL2 A;  2EQS A;  4POF A;  1XMQ L;  2UU9 Q;  2A1A A;  4JBK A;  4JI7 L;  3K7U C;  4GNX B;  1A8V A;  1X3F A;  4LUO A;  2ZM6 Q;  1EYG A;  4GOP B;  1HR0 L;  2V1C C;  1E3P A;  4A75 A;  2ATW A;  4DR2 Q;  4OX9 L;  2DGY A;  1O7I A;  1S3O A;  3LGJ A;  1T9H A;  2L15 A;  3HKZ E;  4DV5 L;  1PH7 A;  4NXN L;  4LF7 L;  1Q86 C;  4PZ6 A;  4R4Q A;  3I4N H;  2R7Z G;  1G6P A;  4IJH A;  1U0L A;  5DLQ E;  1W3S A;  1TWC H;  2JEB I;  5ELO A;  2VW9 A;  1MIU A;  5M5W H;  4PZ7 A;  2D0O A;  4IJL A;  3OTO L;  4A3M H;  1JB7 A;  3NEL A;  4IFD G;  3TS0 A;  2WAQ E;  1ASZ A;  4JI3 L;  3W1B A;  2Z6K A;  3I55 A;  2Q2I A;  2NVX H;  4A3J H;  3J80 i;  5AJ3 L;  4LF5 L;  4DPG A;  2MQH A;  2WB1 E;  4B3S L;  1EOV A;  1L1O C;  5C4X H;  5LMU Q;  1VQM A;  2RF4 A;  4DK6 C;  5LMU L;  2I5M X;  2VUM G;  2XTI A;  3JAM i;  1Q7Y C;  4A3D H;  1E24 A;  1NMF A;  2EIF A;  3STB C;  4JI3 Q;  4B3R L;  3K80 C;  4O2D A;  3S15 H;  1K0R A;  2E5L L;  2PQA A;  4H02 A;  2HHH Q;  5JEA G;  3E0E A;  4LW1 A;  1WOC A;  2JA5 G;  1VQA A;  1SRU A;  4DR7 L;  4JI0 L;  4B3M Q;  4DAY B;  5IYB H;  3PUV A;  2Z0S A;  4YY3 L;  1X3E A;  4MTN A;  4A93 H;  1JJC B;  1VQ7 A;  3I56 A;  4OO1 G;  1VQJ A;  2CWA A;  1K83 H;  4JC0 A;  3BZC A;  4A3F G;  3CQZ H;  1IBL Q;  1N33 L;  4TQU S;  3L7Z C;  1X54 A;  2JA5 H;  2B63 H;  1UE6 A;  3NBH B;  1XMQ Q;  2E2J H;  3CCJ A;  1N8R C;  3H15 A;  4DV7 Q;  3JC6 6;  1FVI A;  1IBK Q;  4YHH L;  4K0K Q;  1Y1W H;  4DV2 L;  5C0X I;  3CC4 A;  1JJG A;  3UDG A;  2VQF L;  4P73 A;  1HNX Q;  5BR8 L;  4HIO A;  4GS3 A;  2HIX A;  1VQ5 A;  3PO3 H;  1V43 A;  5C4J H;  4LF8 Q;  1CKO A;  1PA6 A;  1GM5 A;  1X56 A;  2MO0 A;  1Q81 C;  4JI4 L;  4A3K G;  1N34 L;  2UXD Q;  1JJ2 A;  4AQY L;  3G4S A;  4LFB L;  2UXC L;  2R93 G;  2A19 A;  3CPW A;  2R6G A;  4RMF A;  4TVA B;  1EWI A;  2C35 B;  5IP7 G;  3HOX G;  1YEZ A;  3BJU A;  2VQE Q;  1KC8 C;  1UEB A;  1L1O A;  2ZJQ A;  3J81 j;  4LNQ A;  4JI0 Q;  2HT1 A;  3RR5 A;  4LF8 L;  4DR3 L;  3A0J A;  3CCR A;  4A3M G;  1SR3 A;  3K81 C;  4HIK A;  3RLF A;  1VQN A;  1HJP A;  3G6E A;  5GRO A;  2Y0S G;  4Y7N H;  1XMO Q;  1WI5 A;  4X66 Q;  2F4V L;  3I4M G;  2KEN A;  1GKH A;  3KF8 B;  4DUZ Q;  4UY8 C;  4BXX H;  3U4Z A;  3HKS A;  1VQL A;  3T1H L;  1NMG A;  3ULP A;  1SMX A;  3Q8D A;  4R1J A;  4R4T A;  3J81 i;  4GNX C;  3H0G G;  2R92 G;  2CQO A;  5IYD H;  3CAM A;  1R9T H;  4BY7 G;  1VQP A;  3PO2 H;  1YBY A;  5IWA Q;  4OWW B;  1N33 Q;  4DK3 C;  1YZ6 A;  3PF4 A;  1JMC A;  5IWA L;  2AHO B;  1KXL A;  1X65 A;  5M3M G;  1Y1V G;  4A3B H;  4DR5 Q;  2PMZ E;  2OTJ A;  2QA4 A;  4NPS A;  4AH6 A;  3J7A 5;  1BBU A;  4JI2 L;  1V9P A;  2ASB A;  4DV0 L;  2K75 A;  4DV6 L;  1HNZ L;  4LF9 Q;  4R4C A;  3KJP A;  3PIO A;  5M3F H;  4DR2 L;  2YYZ A;  4OX9 Q;  4HIM A;  4JV5 Q;  1YHA A;  1JE5 A;  4UP7 A;  2E2I H;  3HOZ H;  3M3Y H;  3W1G A;  2VNU D;  4A3L H;  4POG A;  4A3K H;  2DUD A;  1OXU A;  3PIP A;  4LUZ A;  2YTV A;  4DV3 Q;  3HOU H;  2IY5 B;  1CKN A;  4GOP C;  4L5T A;  2N49 A;  4LFB Q;  2XGT A;  2WP8 J;  3M9B A;  3I2Z A;  2VY3 A;  1EIY B;  5GAE C;  4KHZ A;  3CXC A;  2GN5 A;  3HOU G;  1XPO A;  5IYD G;  4P74 A;  2JK8 A;  3GD7 A;  4ME3 A;  3TRE A;  4JI2 Q;  5GAH C;  1VQ9 A;  3KFU A;  3IRB A;  3S1Q H;  5IP9 G;  3BZK A;  1MJE A;  2JA7 G;  2VQF Q;  1K8A C;  4YCW A;  4LFC L;  3FHW A;  4DV5 Q;  3M7N A;  4LF4 L;  5LMN Q;  2K5H A;  2VS1 A;  4DV4 Q;  2I5L X;  1AE3 A;  1KRS A;  2VL6 A;  5M5Y H;  5C44 H;  4GKK L;  2YTX A;  4QQB X;  4OO1 I;  1YIT A;  2KCT A;  1M90 C;  4UPA A;  5GAG C;  1OTC A;  2LSS A;  1PYB A;  4WJ4 A;  4A3B G;  5BR8 Q;  1Q1B A;  3WWV A;  2UUC Q;  4LFC Q;  1I50 H;  3T1Y Q;  2F52 A;  3PUW A;  3S2D H;  4A3D G;  2UUC L;  1RIP A;  1VQG A;  1UWV A;  3H0G H;  4A3C G;  1XNR L;  4IFD J;  1LYL A;  4EX5 A;  4DR7 Q;  2AWN A;  1IBL L;  4PG3 A;  2MNA A;  1HZ9 A;  1VQI A;  2BH8 A;  1XNQ Q;  4HJ8 A;  3CC7 A;  4B3R Q;  4R4I A;  3U50 C;  1OXX K;  2I5H A;  3ICE A;  2GVA A;  1YHQ A;  4LF4 Q;  1TXY A;  1XPR A;  2NVT H;  1QUQ B;  1D8L A;  3TEH B;  4AYB G;  4XIG S;  4BXX G;  1PH9 A;  3S14 H;  1IL2 A;  4DV7 L;  1VQB A;  4HJA A;  3PGZ A;  3A5U A;  3GTJ H;  3K8A A;  4LFA L;  2UUA L;  3AQQ A;  3G71 A;  1VQ6 A;  4GN3 B;  4JI5 L;  1P16 A;  2R7Z H;  1VS0 A;  3KYH C; 
#chains in the Genus database with same CATH topology
 2EXZ A;  3OWF A;  4ZLT F;  2A5H A;  3NTI A;  3J81 E;  5GAD C;  2AUK A;  3S16 H;  3KF6 B;  1ENF A;  2KHI A;  4DV1 L;  4G4K A;  1MSG A;  3UE0 A;  2I07 B;  1X3P A;  5JVG 3;  4DR1 L;  3QB3 A;  1UE5 A;  1STY A;  2NTT A;  4IPC A;  2UU9 L;  3BYT B;  1NTG A;  1NR4 A;  4DV6 Q;  1EY8 A;  2IW3 A;  4JBW A;  3VDY A;  4OWX B;  2KEC A;  5IT9 c;  3H94 A;  3J7Y W;  4EVO A;  3TP5 A;  2WFW A;  1G6Z A;  2R3Z A;  2R93 B;  1U5K A;  1U4L A;  4OEM B;  4DR3 Q;  1W6K A;  4K14 A;  3VYT A;  5C5L A;  4BA1 I;  1Y14 B;  3U58 A;  3DWQ A;  5IYD H;  1AE2 A;  2A6E D;  2Y0S E;  4OWT B;  5JJK A;  3U4V A;  2R93 H;  2K4K A;  1ESF A;  1FD7 D;  5EBC A;  4X64 Q;  4KD3 A;  3W5O A;  1SBB B;  1XTD A;  4DXG A;  3UI2 A;  3CME A;  4BA2 I;  1WTW A;  1YVC A;  2JP1 A;  1P8L A;  2EYP A;  2J4X A;  1CKN B;  5C6A A;  2FHT A;  4DN4 M;  3H3V H;  5M3M B;  1RCV D;  5HGT A;  1ZYR C;  1QVC A;  3S24 A;  3H3V I;  4GNX A;  4JVZ A;  4X65 L;  2YU9 B;  1SE8 A;  5COY A;  1SNO A;  1LTL A;  4X65 Q;  1PH5 A;  5IYC H;  1ZEQ X;  4R4O A;  4HJ5 A;  1FJG L;  5A2Q E;  1W2B A;  3D3R A;  2CW0 C;  3D4D A;  2VB2 X;  3W3A A;  5JAV A;  3T53 B;  4B3T Q;  1K3B C;  2R92 H;  5HY6 A;  4XQJ A;  2UUB L;  4G7H C;  1B8A A;  1I94 L;  2L5T A;  2NVY B;  3OHX C;  1K83 B;  1BF4 A;  1M1K C;  5C4J B;  2AQ3 B;  3M4O B;  2ID0 A;  1HUN A;  2KBN A;  5F2D A;  3NSW A;  4HJ7 A;  1QB5 D;  4M1U B;  4JV5 L;  1QE6 A;  3CCV A;  1F2L A;  2R7D A;  2ZXR A;  4GN4 B;  4OGQ C;  1FL0 A;  1NE3 A;  2CKZ B;  1B44 D;  3EIV A;  4MTK A;  3S1N H;  4HSP A;  1HA6 A;  1SRO A;  1IYV A;  1SAP A;  4HCS A;  3MA2 B;  2F03 A;  4P72 A;  1Q82 C;  3QOL A;  1N32 L;  1C9O A;  4AIM A;  1K3R A;  2PNH A;  4LF6 L;  1IBM L;  3TN2 A;  3Q0A A;  1E1T A;  2N78 A;  3PCO B;  1QOH A;  3J81 c;  1HTP A;  3CCU A;  2NUC A;  1F2Z A;  3HOY G;  3PUX A;  3MXU A;  1EY7 A;  1O80 A;  4FF3 A;  4K8J A;  4DAP A;  4IO9 A;  2JA8 B;  3ND9 A;  5C3W A;  1K9M C;  3BU2 A;  2IX0 A;  1C48 A;  1EEI D;  3TSS A;  4DR6 Q;  1B70 B;  4MNO A;  4JI7 Q;  2A69 C;  5J3B A;  4JYA Q;  3ONA B;  5KYL A;  3S16 B;  3RN2 A;  3GTL H;  4KHV A;  3TZD A;  2F0P A;  5IYC G;  3BYY B;  3RN5 A;  4APV A;  2AUJ D;  5D3I B;  1Y8O B;  4KHP L;  4S3S A;  1IBK L;  3V96 A;  3R2I A;  3HOZ B;  3I4M B;  1Q12 A;  1TS3 A;  5CBE E;  5FJ8 G;  3GTM H;  3DWP A;  1A62 A;  3TP8 A;  2DNE A;  3RLN A;  3I4O A;  4B08 A;  2UXB L;  1Y8P B;  3UDX A;  5L37 A;  1PH8 A;  5K36 G;  1STH A;  3K7A H;  2KQ3 A;  5ELN A;  4DR5 L;  4DUY L;  4JOI A;  4B3S Q;  3EA6 A;  5TSS A;  4X62 Q;  3GTG H;  4BY7 H;  1V1Q A;  1EQR A;  3K7A B;  4A3F H;  1VQD A;  2RA4 A;  1AH9 A;  2M9V A;  5C44 B;  1HNW L;  2K04 A;  4DA2 A;  2F0F A;  1IBM Q;  3GTG B;  2LXK A;  3VR2 A;  4KTA A;  3NEN A;  3SR1 A;  5C44 G;  4A3F B;  4C2M H;  4PMC A;  2B2U C;  4FNF A;  3EBE A;  4QB4 A;  4KJN A;  2SNM A;  2ZXP A;  3SDZ A;  3CW2 C;  2GVB A;  4HR7 B;  2QGQ A;  4RHS A;  1K8O A;  5A35 A;  4KKS A;  2ALY B;  1DXM A;  2QF7 A;  3QJY A;  1OXV A;  3PUZ A;  3DUZ A;  1PH4 A;  4DUZ L;  1F9S A;  3N52 A;  4HN7 A;  1WCM G;  3AYH B;  2ZJP A;  1QVG A;  1D6E C;  3GO5 A;  5FOB B;  1B4O A;  1BR9 A;  1SE4 A;  2Q2H A;  1Y8N B;  2HDM A;  3HOZ G;  4ILW A;  4MZ9 A;  1TY0 A;  4DV2 Q;  3BVM A;  2A74 C;  3GTO H;  4AQY Q;  3UDF A;  1PH6 A;  4KY7 A;  1QNU A;  4F7X A;  3NXW A;  4A3I H;  1WD0 A;  4ZQ3 A;  5M5X H;  3M4O H;  1AZP A;  4B3T L;  4JYA L;  1PTO D;  2UXD L;  3PIP 3;  5FO9 B;  3F2D A;  4KK7 A;  3D6W A;  4XDX A;  2K5D A;  2SDF A;  3V2T A;  4XTC S;  4XXE A;  1SYB A;  3NE5 B;  1RL2 A;  2EQS A;  3PMF A;  3S1N B;  2A1A A;  1I4P A;  2AQ1 B;  4FYD A;  1HR0 L;  1PRT B;  4A75 A;  2DGY A;  4DV5 L;  1NR2 A;  2DNC A;  2PNR C;  4R4Q A;  4DK1 A;  4HSV A;  1G6P A;  4JPB W;  4IAL A;  1TWC H;  5I6Y A;  2SOB A;  2VW9 A;  1MIU A;  4A3M H;  4PZ7 A;  3ERO A;  4TRD A;  3TS0 A;  1SFO B;  4JI3 L;  4J8Q A;  3SK5 A;  1VMC A;  2NVX H;  4FXG C;  5AJ3 L;  5ELB A;  2WB1 E;  2XIW A;  4B3S L;  1EOV A;  1L1O C;  1RF2 D;  4A3D B;  5LMU Q;  1RTO A;  3MHB A;  5D14 A;  2I5M X;  2VUM G;  2NVX B;  3A55 A;  1HQM C;  1JR0 D;  4HMJ A;  3BS1 A;  1NMF A;  3K80 C;  4N8X 1;  3S15 H;  1K0R A;  4XT1 B;  2E5L L;  5JEA G;  3E0E A;  2LS0 1;  5FLX E;  5KND A;  4Q5V A;  2OXP A;  1DM0 B;  2JA5 B;  5IYB H;  1GXD C;  4RAU C;  1JJC B;  1VQ7 A;  4L63 B;  5C3E B;  1TY2 A;  1IBL Q;  4TQU S;  5I9O A;  1XMQ Q;  1SNQ A;  5ISR A;  3QO2 A;  4DV7 Q;  4DAV A;  1ENC A;  2F3V A;  4DV2 L;  5I9P A;  3CC4 A;  3HP3 A;  3DHQ A;  5BR8 L;  4HIO A;  1EZ6 A;  1JQY D;  3IFT A;  1V43 A;  1PA6 A;  1GM5 A;  1Q81 C;  1V1P B;  1KAB A;  1U4M A;  1N34 L;  1SE3 A;  2UXC L;  1MBY A;  5E4W C;  4TVA B;  3P75 A;  1AFP A;  1EWI A;  3QOJ A;  5IP7 G;  1YEZ A;  5I4D A;  4LNQ A;  4JW0 A;  1JE4 A;  2HT1 A;  1F2Y A;  4LF8 L;  3A0J A;  3TP6 A;  1IKL A;  2B2Y C;  5GRO A;  2Y0S G;  4Y7N H;  1SDF A;  2KEN A;  3KF8 B;  4BXX H;  2ICE C;  1EYD A;  3HKS A;  4B9W A;  3BVZ A;  5CMD A;  3T1H L;  1NMG A;  3VR3 A;  2R92 G;  2MUY A;  1PRT D;  1YBY A;  3K58 A;  4OWW B;  1VF5 C;  2A69 D;  2L9H A;  1EY6 A;  3I4L A;  3LWE A;  2JA6 B;  2QA4 A;  4NPS A;  1BBU A;  4C3J G;  2F0Q A;  2ASB A;  4DV6 L;  3QWN A;  4WRD A;  1F9R A;  4A3K B;  5M3F H;  2YYZ A;  4HIM A;  1D1K A;  1JE5 A;  2E2I H;  1CT1 D;  4CKC A;  3M3Y H;  2IWH A;  4FF1 A;  4A3K H;  2H4O A;  1OXU A;  4LUZ A;  2YTV A;  1BOS A;  3D6C A;  2WP8 J;  3M3Y B;  4CDF C;  2D9U A;  4HTH A;  2L1B A;  1HPC A;  4X3U A;  4MHE A;  4JI2 Q;  3FEW X;  4H13 C;  4DF7 A;  2EPB A;  1IKM A;  4YCW A;  4DV5 Q;  3D4R A;  5T1G A;  3KBX A;  3OIQ A;  1EY4 A;  2VS1 A;  5T1I A;  2VL6 A;  2I46 A;  5KNC A;  1M90 C;  2KCT A;  2F0U A;  3I4N B;  1GUN A;  2VB3 X;  2RDF A;  5BR8 Q;  4PNY A;  2F0D A;  1Q1B A;  4LFC Q;  1XNR L;  4EX5 A;  2B2U A;  1HZ9 A;  3WOE A;  4FF2 A;  2K05 A;  3CC7 A;  4R4I A;  2AQ2 B;  3ICE A;  1KLG D;  3OPO A;  4LF4 Q;  4K6L A;  4BXX G;  3NQI A;  3TEH B;  4XIG S;  3MVV A;  3SEB A;  2IJ0 A;  3S14 H;  1ILQ A;  1H9S B;  4LFA L;  2UUA L;  1S5E D;  3TP7 A;  3S14 B;  3HGB A;  2IHF A;  5C3E H;  4A3E G;  1GUW A;  1I3Q B;  2B8G A;  1CZG A;  1EIF A;  2J7Z A;  3CKI B;  1RKN A;  3WDN A;  1QIL A;  1HHV A;  3DEP A;  5IGF A;  1R4Q B;  1QCB D;  2L0C A;  3LNN A;  4KJO A;  1X32 A;  4DR1 Q;  2CHB D;  1IW7 C;  3OYY A;  4A76 A;  1T5X D;  5NUC A;  3AFP A;  2P5Z X;  4YWK A;  3TBI B;  3I72 A;  2E2H H;  1FGB D;  2F3W A;  3HOV H;  3MWY W;  4RG1 A;  1C7Y A;  2HHH L;  1HTL D;  1TR5 A;  1FJG Q;  1LO5 D;  4RA8 A;  1MJC A;  3R2T A;  4U67 3;  5GQO A;  4L5S A;  3NWS A;  4QCL A;  2JQO A;  4IOA A;  3G48 A;  4DKA C;  3S17 H;  1BKB A;  5JEA H;  4F8M A;  3A74 A;  5CV9 A;  1PHJ A;  2F0L A;  1K8G A;  2KHJ A;  1EQQ A;  1IW7 D;  1L1O B;  3AU7 A;  3I73 A;  2L4N A;  4CGY B;  2VUM H;  2RVL A;  3E9I A;  3M4Y A;  5JOB A;  5DM6 3;  4JCV E;  2SNS A;  4DV4 L;  1TWG B;  4RGT A;  1J6Q A;  4DNI A;  2BDO A;  2A6H D;  2CH4 W;  3P20 A;  3GTK B;  4UHV A;  2NWG A;  5CV5 A;  5FO8 B;  1C8C A;  1F9P A;  1UEA B;  3RZD H;  1YJ9 A;  1VQC A;  4GKJ Q;  5IIF A;  1N36 L;  3S9W A;  1SYD A;  1G29 1;  2H1E A;  2B2V C;  3MXN A;  1SNC A;  2O5I C;  1PTO B;  2KCC A;  2F0N A;  4LMQ D;  2RKS A;  2F0T A;  5EPL A;  1B3A A;  1CQV A;  1PTO H;  1WVL A;  5C0X G;  1MKH A;  2QKI C;  3CMA A;  2EXD A;  3RLO A;  3ZJY C;  3CCE A;  1EZ8 A;  2NN6 I;  1PH3 A;  1HZA A;  5EBD A;  4QUF A;  2Z6B A;  1Q46 A;  2E76 C;  5IGB A;  3ULJ A;  3URY A;  1CTM A;  4K6D A;  2Q2U A;  1QVF A;  4EQ5 A;  3GDE A;  2RQX A;  1STN A;  2QIL A;  1WFQ A;  4DV0 Q;  3C1F A;  3AEV A;  3ERQ A;  2WAQ G;  3K5L A;  1YNN D;  5CV8 A;  4KI0 A;  3L0O A;  3V05 A;  1L0W A;  3SK4 A;  3CRK C;  1B50 A;  1XNQ L;  1V8Q A;  4C56 C;  2HQL A;  3QIA A;  2MJ8 A;  2RCF A;  5BN4 A;  5IYB G;  2N3S A;  3CF5 A;  3S1R B;  4C3J H;  2F0K A;  1JOR A;  2OTL A;  4LFA Q;  1JB3 A;  1PFN A;  2PI2 A;  3F1Z A;  2UUB Q;  4ZCK A;  3BDO A;  5FK9 C;  5IE8 A;  3T1H Q;  2R61 A;  1YI2 A;  2IT1 A;  1I6H B;  1LUZ A;  2Z6K C;  1BCP F;  4EQO A;  4A3B B;  1SEB D;  3MXP A;  4WOR A;  3J7Z C;  1PH1 A;  5IGC A;  4AYB E;  1SXT A;  5EAY A;  2R92 B;  2HCI A;  1SLJ A;  4ULL A;  4JI8 Q;  3ERS X;  3SHL A;  3NTK A;  2E2D C;  5ELF A;  3W2D A;  1UE7 A;  1HZB A;  4YHH Q;  5EQ0 A;  2XSC A;  4K5V A;  4ZKB B;  4A3J G;  2OWO A;  2HCC A;  3J80 c;  1WTO A;  4J15 A;  4PV1 C;  3FMC A;  1E2V A;  2AWO A;  1DON A;  2K32 A;  5DNF A;  3GV6 A;  1N32 Q;  4MIU A;  4JBJ A;  2K50 A;  4LF9 L;  4OIK A;  3ER0 A;  3F2B A;  2XNA C;  3N6R A;  3A54 A;  4FXK C;  2FXQ A;  1HNW Q;  3FVQ A;  3PO2 G;  4KN7 C;  4GLA C;  2ZTE A;  3L3O C;  4YWM A;  3MXN B;  3K5O A;  3IAY A;  3BVG A;  4H7B A;  1QNK A;  4I65 A;  1E2Z A;  2YTY A;  3I7F A;  1I5F A;  1SFO H;  3FDT A;  3CC2 A;  1A3U A;  1I4R A;  4A3J B;  2G9H D;  3TDQ A;  1VQE A;  2F3I A;  5I6W A;  4NDX A;  4QL5 A;  5LHY 1;  1LAC A;  2IHE A;  2RSN A;  4A3G G;  4NXM Q;  3G7L A;  2JA7 H;  3GTJ B;  4DK0 A;  4NXN Q;  2KJX A;  2R7Z B;  1J5E L;  2PO4 A;  1Q3L A;  1BCP D;  1Z9F A;  4HJ9 A;  2HQE A;  2JA8 H;  1OXT A;  4QY7 A;  5M9O A;  2EYO A;  4UAI A;  3I3C A;  3MTS A;  1X6O A;  2JEA I;  3DMU A;  2BA0 A;  2N88 A;  4P71 A;  4BBS G;  1CKM A;  4JI6 L;  3CCQ A;  4ZKC B;  1JWM D;  2ENB A;  4JI6 Q;  4IPH A;  4B9X A;  1JOK A;  4QGU A;  1GUS A;  1PH2 A;  1GVP A;  3HOV G;  1E1O A;  2OCE A;  2B63 G;  4C3I B;  2TMP A;  4O1N A;  2L55 A;  2KA7 A;  2RBM A;  2PZT A;  1SNM A;  4RKB A;  4GKJ L;  3NP8 A;  2D2C C;  3S1Q B;  4HED A;  1GHJ A;  2PYK A;  2HDL A;  3K7U C;  1G2T A;  4GNX B;  4JK1 C;  4LUO A;  2ZM6 Q;  1E3P A;  5CYU A;  2B8F A;  1UUP A;  1PH7 A;  1T9H A;  5BN5 A;  1KDA A;  1Q86 C;  4PZ6 A;  4R8I A;  1QJO A;  3KLS X;  4LAA A;  4DFA A;  4IJH A;  1U0L A;  1EY9 A;  5M5W H;  3J81 L;  4IFD G;  1ZKO A;  1Q90 A;  3W1B A;  2Z6K A;  4DPG A;  2MQH A;  4ODG A;  5LMU L;  2X69 A;  4IUP A;  1E24 A;  4O2D A;  2HHH Q;  2PQA A;  4H02 A;  1CK1 A;  4LW1 A;  1I4X A;  1VQA A;  4IN3 A;  1U4R A;  2E74 C;  4JI0 L;  4B3M Q;  1SJH D;  1UNS A;  4DAY B;  2JN4 A;  2Z0S A;  4YY3 L;  1I4Q A;  1X3E A;  4MTN A;  4A93 H;  2Q8I B;  3T16 A;  3I56 A;  4OO1 G;  1VQJ A;  2CWA A;  3CQZ H;  1N33 L;  2F4I A;  1UE6 A;  2E2J H;  2FMM A;  2B2T C;  3CCJ A;  1N8R C;  3JC6 6;  1F77 A;  1BUV T;  4YHH L;  3FPP A;  2WAQ B;  4G57 A;  5C0X I;  1TWH B;  2VQF L;  4QUC A;  3OWE B;  4GS3 A;  3NQT A;  3BDL A;  1X56 A;  2MO0 A;  4CJ1 B;  4A3K G;  4O42 A;  5I2X A;  2XWB B;  2UXD Q;  3G4S A;  2R6G A;  4RMF A;  2KVM A;  2VQE Q;  1HQR D;  4YIJ A;  3HOX B;  1LTG D;  1I4H A;  3BG3 A;  5A2Q L;  4DR3 L;  1NAP A;  1VDZ A;  4HIK A;  3K81 C;  4ZYS A;  4G7O C;  3I4M G;  2F4V L;  4DUZ Q;  4UY8 C;  2NVQ B;  1S5B D;  1VQL A;  3K6O A;  4N9P A;  3ULP A;  4IUV A;  3EVQ A;  3Q8D A;  4R1J A;  2JA7 B;  3H0G G;  4BY1 B;  5IGE A;  1E2W A;  3A8I E;  1R9T H;  1VQP A;  2F0G A;  3PO2 H;  3R8B A;  1YZ6 A;  5COR A;  2AHO B;  5E3F A;  1Y1V G;  4CDD C;  4IUU A;  2OTJ A;  3GTL B;  4AH6 A;  3J7A 5;  4JI2 L;  2XWJ B;  4DV0 L;  3H91 A;  1HNZ L;  2BCO A;  1BNZ A;  3HOW B;  3SK6 A;  1SYG A;  1YHA A;  1SNP A;  3H09 A;  1PLF A;  4A3L H;  2EJG C;  1DYQ A;  3VR5 A;  4POG A;  1V1O A;  2DUD A;  2HUG A;  4A3G B;  2XGT A;  2K01 A;  1STE A;  2PMZ B;  2FMC A;  3CXC A;  3HOU G;  4ME3 A;  2PW5 A;  3TRE A;  5GAH C;  3I70 A;  3KFU A;  3KK7 A;  3BZK A;  3NPP A;  1SYE A;  3M7N A;  4LF4 L;  1TS4 A;  4RCN A;  1K8M A;  4GKK L;  3JAM E;  5C44 H;  4OO1 I;  2F0W A;  1U4P A;  1WTQ A;  3IFD A;  2EYJ A;  1EQV A;  1R4P B;  2NYZ D;  4CHT B;  2UUC Q;  1PFB A;  3S2D H;  1RIP A;  1UWV A;  4A3C G;  4DR7 Q;  1PRT F;  1XNQ Q;  4HJ8 A;  1E0B A;  2DY7 A;  1EU4 A;  2WV6 D;  1YHQ A;  1CHP D;  1TXY A;  2NVT H;  2BE5 C;  4MN3 A;  1VQB A;  2G5D A;  4LJZ C;  3PGZ A;  3SK8 A;  5CV6 A;  4IUN A;  3GTJ H;  3R3O A;  5EPJ A;  3G71 A;  2C9O A;  4JI5 L;  1YIT A;  2EOT A;  3KYH C;  1S5F D;  2B2T A;  4KLK A;  2K5N A;  3T4A C;  4B3M L;  4A3C H;  4CJ2 C;  4KKU A;  2B29 A;  1RJT A;  4JI1 L;  5JJZ A;  2I0Q A;  2E2I B;  1NSN S;  3UE1 A;  1KL9 A;  2ZTC A;  2R7F A;  2RCN A;  1Z7T A;  3OMC A;  1Y1W B;  1CZW A;  1HR0 W;  4ALP A;  3VYR A;  1KNE A;  3GP7 A;  1Y1W G;  3DXJ C;  5IGG A;  1VQF A;  1KDB A;  3L2P A;  2OQK A;  1ASY A;  3S1M B;  3HFZ B;  4YCV A;  1DCZ A;  3HS0 C;  2ZJR A;  1A0I A;  4C3I H;  1LTT D;  3F8T A;  2TSS A;  1XX8 A;  4F87 A;  2DJF C;  4A93 G;  2NZH A;  3M4Q A;  4OON A;  2CH4 A;  2OQ0 A;  2WB1 G;  5EKL A;  4KMU C;  3HOX H;  1D5M C;  3K57 A;  4GLX A;  2VQE L;  1EYC A;  3TQY A;  1AW7 A;  3GTQ B;  4QMG A;  1X55 A;  4DR4 Q;  2A6H C;  2CWP A;  3KDF A;  1K28 A;  1YHB A;  5IOC A;  5DAU A;  5HGQ A;  2A8V A;  4BY1 H;  5FJ8 H;  4C3H H;  4M8A A;  1UE1 A;  3PF5 A;  2K28 A;  1EOT A;  3S2H H;  3HKZ G;  2NN6 H;  1S40 A;  1DOK A;  3A7L A;  4L6T B;  5FLX c;  3E9H A;  1VMP A;  4LF6 Q;  4QIW B;  4TKO B;  5IT9 E;  2AMC B;  5EJW A;  2D62 A;  1CUK A;  1Q1E A;  1J5E Q;  2D0P A;  2B2W C;  1O7L A;  3HKZ B;  4PQX A;  1NBW A;  3KLS A;  1XJV A;  2WB1 B;  4ME5 A;  1BVS A;  1IHZ A;  4X64 L;  3HOU B;  3GTO B;  1KNA A;  5FLM G;  4A93 B;  3HOY H;  1ET6 A;  1KHI A;  3SGI A;  1GJX A;  1BCP C;  3U9S A;  1ROD A;  4NMZ A;  4LWC A;  3VA7 A;  3FKI B;  5J1Z A;  1CSP A;  2G9D A;  4ABN A;  2B2W A;  4Y52 H;  2WKD A;  5G3L D;  4EQN A;  3KLR A;  2ES2 A;  1LT3 D;  2LXJ A;  1S5C D;  3NBH A;  1QWY A;  5KNB A;  1SJE D;  4UP8 A;  1EL0 A;  1E22 A;  2BA1 A;  1ZYR D;  2F0M A;  1N9W A;  1IXR A;  1U9R A;  2Q2T A;  3OTO Q;  1K73 C;  5M3F G;  1JT8 A;  1TWC B;  3OIP A;  1XTC D;  3OMG A;  4AYB B;  5AJ3 Q;  5JJL A;  1WYD A;  1LTA D;  2ZT9 C;  4U68 A;  5C5M A;  2Q8T A;  5LMN W;  1D7Q A;  2N8N A;  3KOJ A;  1XPU A;  2AKW B;  1X3Q A;  2DN8 A;  5LMN L;  2BH2 A;  1WCM B;  3I8Z A;  3PSI A;  2CCZ A;  1PVO A;  4FP5 D;  3AB9 A;  3WOF A;  1KRT A;  1HR0 Q;  2MPM A;  1HFN A;  3RZD B;  1G8Z D;  4IOC A;  1L2F A;  4K0K L;  1JOO A;  1WCM H;  1EWH A;  5C4X G;  2B3G A;  3ULL A;  5I2Y A;  1TT2 A;  4HCE A;  1QZH A;  1RDP D;  2VXW A;  2IX1 A;  2B63 B;  3GTM B;  5IP7 H;  4NB3 A;  4Q0F A;  3UDI A;  3DEO A;  4GKK Q;  2BOS A;  1GD7 A;  1S5D D;  1HH2 P;  1V1P A;  4PZ8 A;  3CP0 A;  1B7Y B;  3MC0 B;  4V0B A;  4BY7 B;  5FLM H;  1HRJ A;  3RMH A;  1AZQ A;  3E0J A;  1TWA H;  2M00 A;  4KY6 A;  4E6I A;  4TSS A;  1ONL A;  1E7Z A;  1SMY C;  3E3X A;  5AFW A;  1CSQ A;  4CBV A;  1H95 A;  1TS5 A;  3GTQ H;  3KF8 A;  1HZC A;  2E8G A;  2QW7 A;  1H9R A;  3VYS A;  1KIX A;  3AFQ A;  1Q8K A;  1TS2 A;  2XVS A;  4WJ3 M;  3NK9 A;  1STB A;  4X3T A;  3A5Z B;  4RGN A;  1ET9 A;  2CFM A;  1AEX A;  5IP9 H;  1VQ4 A;  4X6A H;  1AN8 A;  3T51 B;  2YU9 H;  4C3H G;  2E75 C;  3CD6 A;  3KLW A;  1DOL A;  5C4H A;  4LUV A;  1A63 A;  2F4V Q;  1I6H H;  4DUY Q;  2O4X A;  2RHQ B;  4K5X A;  1KDC A;  3E5S A;  3K0X A;  3CCL A;  4CDC C;  5KGU A;  1BBW A;  2UXB Q;  4KHP Q;  5E4X A;  2NVY H;  4ZAI A;  3HEJ A;  1I94 Q;  1LTR D;  3RUZ A;  4C3I G;  2ZTD A;  4JOI C;  1JCK B;  1L0Y B;  5DM7 3;  3C1E A;  3HOV B;  1GUT A;  3HRZ C;  3MFY A;  1KAW A;  1HCZ A;  1G51 A;  4I7A A;  2KEE A;  4O0A A;  2Y0S B;  1T5E A;  1ICW A;  1KQS A;  4BBS B;  2QDB A;  4KKT A;  4UDU C;  5CR3 A;  1VQ8 A;  3S17 B;  1ML0 D;  2EJM A;  2F0E A;  3S1M H;  2UU9 Q;  4JBK A;  4JI7 L;  1X3F A;  1IYU A;  2V1C C;  3A56 A;  2ATW A;  3LGJ A;  1O7I A;  1S3O A;  2WAC A;  2L15 A;  1XXG A;  3HKZ E;  2PZW A;  4H44 C;  5E1F A;  4LF7 L;  5ELC A;  4FF4 A;  3I4N H;  2R7Z G;  1CFM A;  1FNW A;  4J6H A;  3OTO L;  1DJR D;  3NEL A;  3DM1 A;  1JB7 A;  2Z1C A;  2XRS D;  2R7Z H;  5KIX A;  3T56 B;  2Q2I A;  3Q23 A;  4A3J H;  3J80 i;  4LF5 L;  2NZ1 D;  1ZXT A;  5C4X H;  1NNX A;  1SE2 A;  4EQP A;  2IX3 A;  3QR8 A;  5FO7 B;  1Q8I A;  1H9S A;  3A8K E;  2EY1 A;  1Q7Y C;  5BN3 A;  4A3D H;  2EY5 A;  2A68 D;  2X6G A;  4GZY C;  1II3 A;  2JA5 G;  2BE5 D;  1SRU A;  3GV3 A;  4DR7 L;  3PUV A;  3I90 A;  5EKK A;  2QCP X;  4R9W A;  4JC0 A;  4C1N K;  3PQI A;  5IGD A;  4A3F G;  2B63 H;  1CA5 A;  1X54 A;  2JA5 H;  1I4G A;  1S4Z A;  1PZJ D;  4A3E B;  1FYC A;  3H15 A;  1JC7 A;  1FVI A;  1IBK Q;  4K0K Q;  3J80 E;  2FFK B;  1JJG A;  3UDG A;  2EZV A;  2EJF C;  4K8I A;  1HFG A;  1F2M A;  2KHS A;  5K5P A;  4LF8 Q;  5C4J H;  1CKO A;  1FR3 A;  1UAP A;  1JJ2 A;  2R93 G;  4LFB L;  2A19 A;  4L5R C;  4X3K A;  2O5J C;  2C35 B;  4RH6 A;  3HOX G;  1UEB A;  1PFM A;  2NBF A;  1HA5 A;  1L1O A;  2ZJQ A;  3J81 j;  4JI0 Q;  2JXM B;  4RHR A;  5FLX L;  3CCR A;  1SR3 A;  4A3M G;  2PCF B;  4IZ8 A;  3RLF A;  1HJP A;  5LL6 X;  2MP1 A;  3G6E A;  1XMO Q;  1WI5 A;  4X66 Q;  4K5W A;  1A2U A;  5M5W B;  1A3T A;  1SMX A;  3BZD B;  4ZRZ A;  2KOL A;  3IL8 A;  4R4T A;  2CQO A;  1D2B A;  4ID6 A;  5IWA Q;  1H9J A;  3PF4 A;  4DK3 C;  2O2L D;  3MZ5 A;  5J22 A;  5DEH A;  3KBG A;  2OEO A;  4A3B H;  3FPU B;  4DR5 Q;  2PMZ E;  1A6X A;  5CGK A;  2K75 A;  1LTS D;  2HD3 A;  4ZUI A;  4R4C A;  3KJP A;  4DR2 L;  4OX9 Q;  1B9M A;  4H0L C;  4JV5 Q;  1J8I A;  1SMY D;  2EYM A;  3EFX D;  3W1G A;  2VNU D;  3J7A F;  5M5X B;  2IY5 B;  5ELD A;  3PIP A;  2K7V A;  4DV3 Q;  2K33 A;  3A7A B;  2N49 A;  2F0O A;  3M9B A;  2B39 A;  3C3L A;  1MSH A;  3I2Z A;  2VY3 A;  1JWU D;  1C4Q A;  2PQE A;  4KHZ A;  1EIY B;  2PPB C;  3VR4 A;  5IYD G;  4P74 A;  2JK8 A;  3GD7 A;  1RTN A;  5EKI A;  1J9O A;  2JA7 G;  1SND A;  4WFN 3;  1PZI D;  2VQF Q;  4LFC L;  1PTO F;  1SYF A;  3NTH A;  4FO2 A;  1TQO A;  5LMN Q;  3M7G A;  2K5H A;  2I5L X;  1KRS A;  5M5Y H;  2YTX A;  2C5C A;  5GAG C;  2LSS A;  1PYB A;  1EIG A;  4XQN A;  1G91 A;  4A3B G;  5M5Y B;  2LKV A;  2N55 A;  4A3D G;  1EYA A;  3PUW A;  2UUC L;  1VQG A;  3H0G H;  1LYL A;  4OIJ A;  1RD9 D;  4PG3 A;  4KN4 C;  2MNA A;  1TII D;  1VQI A;  3S2H B;  4B3R Q;  3U50 C;  3IKJ A;  2GVA A;  4PMB A;  5K36 H;  2M2L A;  1D8L A;  4AYB G;  1R9T B;  2JSO A;  1PH9 A;  1IL2 A;  3S15 B;  4DV7 L;  4HJA A;  1BXT A;  3NHH A;  2WIN B;  3AQQ A;  5EPK A;  4GN3 B;  3FRP B;  4WJW A;  1IBL L;  4FDB A;  1IL8 A;  1B1Z A;  2JE6 I;  4P75 A;  2JA8 G;  2QEX A;  4R8N A;  1LM0 A;  1LAB A;  2EDG A;  1FGU A;  2K5V A;  4DV1 Q;  3K59 A;  1OO9 B;  4JI1 Q;  4CKB A;  2XN9 C;  2F0H A;  2OT2 A;  2Z9H A;  3HOY B;  4BS9 A;  2IL8 A;  2YV5 A;  1KD1 C;  4LF5 Q;  1I3Q H;  4YWL A;  1NUC A;  5JPN C;  2ICI A;  3D8G A;  4G7Z C;  1LT6 D;  4A3G H;  4ZK9 B;  4RGM A;  1VQH A;  3DLL A;  1GHK A;  3D31 A;  1X9N A;  4YY3 Q;  1EFW A;  3FKI H;  4DAM A;  3ITP A;  3LX0 A;  4OO1 H;  4LF7 Q;  1LTB D;  5IOD A;  1XWE A;  1CQF A;  1B2T A;  4OL7 A;  2V4D A;  4JI8 L;  3DM3 A;  2E2H B;  3M4P A;  5EGT A;  2CW0 D;  3EJI A;  4GOP A;  4BBS H;  4XYO A;  2JA9 A;  1ESR A;  1W6J A;  3MEF A;  5KRU A;  3RZO H;  3O13 A;  5CC4 A;  4KD4 A;  4Y7N B;  2KCM A;  3MAQ A;  1TWG H;  3PO3 G;  3A8J E;  1QG7 A;  4DAY A;  3FP9 A;  3KF6 A;  4A3L G;  4KV6 A;  4IFD J;  1YNN C;  1YJN A;  3GTK H;  3KJO A;  4JG2 A;  4IFD H;  1EY0 A;  3T1Y L;  4IUT A;  1VQK A;  3NWT A;  2RDH A;  1IZ6 A;  3TME A;  2JYO A;  2NVT B;  4JI4 Q;  4NXM L;  2PI2 E;  2RHS B;  5C3X A;  5HUR A;  1S72 A;  4I7Z C;  4NKL A;  1YJW A;  5M3F B;  1PRT C;  1TU2 B;  3FKI G;  3HOW G;  4X3S A;  1PV4 A;  2PZU A;  1B53 A;  1QZG A;  4QF4 A;  2E5L Q;  4F88 A;  3GQB A;  1I6V C;  3I4M H;  3X3M A;  1FNV A;  2K03 A;  3RNU A;  3SE0 A;  2MFI A;  4EGV A;  3CCS A;  2NN6 G;  4QJF A;  5C3E G;  4A3E H;  3STB D;  2QDL A;  3NEM A;  1YNJ C;  3HZX A;  3PV0 A;  4NP5 A;  1KLU D;  1TWA B;  2B2V A;  3F2C A;  4ZUJ A;  4DU9 A;  2H5X A;  5KEE A;  2KUM A;  3TS2 A;  1WJJ A;  3R93 A;  3CCM A;  1STG A;  3Q6S A;  3CHB D;  4X62 L;  2NVQ H;  3B6Y A;  5FKA C;  4IUQ A;  5IY0 A;  3K5N A;  1VF7 A;  2Q8R E;  1PXU A;  3P1H A;  4CKE A;  3S1R H;  2UUA Q;  4RWS C;  1PMR A;  5CV7 A;  4IPD A;  1YNX A;  2MHV A;  3PO2 B;  3D0F A;  4K2L A;  1N36 Q;  2IPK D;  2K52 A;  2NZO A;  4C3H B;  1PYS B;  2Z4I A;  3LWU A;  5M3M H;  3VYU A;  2K6A A;  5KYI A;  1M8A A;  4J1M A;  2WKC A;  5C0X J;  3OW2 A;  4NW2 A;  1QUQ A;  5JPM C;  2NB0 A;  4OXP A;  3C2P A;  1Z47 A;  4DNT B;  3HOW H;  3PUY A;  2SEB D;  1TKW B;  1ENA A;  4GLV B;  1XMO L;  1DGS A;  1EEF D;  1PTO C;  2DY8 A;  2JA6 H;  2Z4H A;  1HNX L;  1BDO A;  3KUP A;  1WTX A;  2A73 B;  2UXC Q;  3D4W A;  1D1I A;  4DXF A;  5IT9 L;  5JJI A;  3GTP H;  1LT5 D;  1TWH H;  3AMU A;  3I4N G;  4DR4 L;  3JAM c;  1X3G A;  1HNZ Q;  2K5Q A;  3VA5 A;  4DV3 L;  3NBI A;  2HIV A;  4FXD A;  3MFG A;  5CBA E;  2K14 A;  4IPG A;  1YIJ A;  1A15 A;  1JWS D;  4HID A;  1VQO A;  1WTH A;  1BO0 A;  2WII B;  2PW7 A;  1CHQ D;  3JAM L;  1WTP A;  1NJI C;  4A3I G;  3X3N A;  2EE1 A;  4GN5 A;  1PFS A;  4A3M B;  4IFD I;  2L12 A;  1CI3 M;  1C0A A;  3CPF A;  4IUR A;  1OXS C;  1K0S A;  4LK1 C;  2EY6 A;  2ZM6 L;  5JEA J;  2PQA B;  2MO1 A;  3EN2 A;  3H0G B;  4BY1 G;  1TWF H;  4QIW E;  1H9K A;  1B3Q A;  3L9A X;  1NY4 A;  2DJG C;  4YCU A;  1XNR Q;  1Z6H A;  4N9T A;  5C4Z A;  3DWA A;  1AP0 A;  1GO3 E;  1TWF B;  2JA6 G;  1EUJ A;  3VR6 A;  2KCN A;  4BWG B;  1SN8 A;  4JI5 Q;  2EYL A;  3T13 A;  3U9O A;  3PIO 3;  4PMW A;  4DR6 L;  2FIN B;  4UP9 A;  4X66 L;  4JBM A;  4N8F A;  3TRZ A;  4V19 0;  1L0X B;  1M4V A;  5H1S E;  2VZA A;  4DNR B;  3E6Z X;  4HMI A;  1O7Z A;  4BBR H;  1B9N A;  3OOC A;  2JJQ A;  1NCV A;  5E7N A;  3M85 A;  1VCI A;  4L5Q A;  3KDF B;  3QG1 A;  1EWC A;  1N34 Q;  1Y1V H;  4RFB A;  5J39 A;  4BBR B;  1IYJ B;  4CJ0 B;  2EVB A;  4A4I A;  4BBR G;  1XMQ L;  4POF A;  3CRL C;  3J7A V;  1EQT A;  1ICF B;  3H6M A;  1Y1V B;  1A8V A;  2F0V A;  1EYG A;  4GOP B;  1Y69 U;  1RHP A;  4DR2 Q;  4OX9 L;  1ILP A;  4NXN L;  1STA A;  4RGO S;  1BQQ T;  1DZ1 A;  5DLQ E;  1W3S A;  2JEB I;  5ELO A;  2D0O A;  4IJL A;  1I50 B;  3RD4 A;  2WAQ E;  3S2D B;  2LFN A;  3K5M A;  1PZK D;  1ASZ A;  4OHJ A;  2ZXO A;  1G2S A;  1TVX A;  4XQQ A;  4C2M B;  3HG9 A;  2VUM B;  1VQM A;  2RF4 A;  3G6J B;  4DK6 C;  2B2Y A;  1H9M A;  4OEL B;  1XYI A;  2XTI A;  1PDQ A;  3JAM i;  3STB C;  2EIF A;  4JI3 Q;  4B3R L;  1EY5 A;  2A6E C;  1WOC A;  1LV9 A;  1A3V A;  1YNJ D;  2RDG A;  2OF1 A;  1F9Q A;  4FVM A;  1WTV A;  2EYF A;  1JOQ A;  3OW7 A;  3OSO A;  4IQZ A;  3Q24 A;  1K83 H;  3BZC A;  3L7Z C;  3NBH B;  3ZYY X;  4DGZ A;  3SXH A;  3BDC A;  1HXY D;  3GTP B;  4A3I B;  3PO3 B;  3CQZ B;  1Y1W H;  5D3D A;  2E2J B;  4P73 A;  1HNX Q;  2HIX A;  1VQ5 A;  3C46 A;  1DD2 A;  3PO3 H;  4RKL A;  3Q22 A;  1SSO A;  1EU3 A;  4P2C B;  2EYH A;  4JI4 L;  2LMC B;  1KTK A;  1LLR D;  4AQY L;  1WTR A;  2Z8L A;  1LT4 D;  3CPW A;  1GUO A;  2LY7 A;  2XRQ D;  1KC8 C;  3BJU A;  4CDE C;  3TZU A;  4KY5 A;  3RR5 A;  1DOM A;  1VQN A;  2F0I A;  5C0X H;  1GKH A;  3U4Z A;  1EFI D;  4RCO A;  4GNX C;  3J81 i;  2J0T D;  4Z9C B;  3CAM A;  4BY7 G;  5C4X B;  1D5Z C;  5D65 A;  1N33 Q;  1KXL A;  1JMC A;  5IWA L;  3NUC A;  1X65 A;  2QEJ C;  4XT3 B;  5M3M G;  1HUM A;  5JVH 3;  4C3J B;  3SVM A;  2D5D A;  1V9P A;  1D5X C;  4LF9 Q;  3MXG A;  3PIO A;  2NTS A;  1O7Y A;  4UP7 A;  3HOZ H;  3P7J A;  2RSO A;  2K5W A;  2FJ2 A;  2F0S A;  1A2T A;  1MHW C;  2F1M A;  5CV4 A;  3HOU H;  1CKN A;  4GOP C;  4L5T A;  4LFB Q;  2KED A;  3CU7 A;  1WD1 A;  4C1N I;  2F0J A;  5GAE C;  2GN5 A;  5G3L F;  1XPO A;  3EQL C;  1GUG A;  2X6L A;  1VQ9 A;  3IRB A;  3S1Q H;  5IP9 G;  2CQA A;  1MJE A;  1K8A C;  3FHW A;  1KAA A;  1BBX C;  1EIH A;  3MEH A;  4DV4 Q;  1AE3 A;  4QQB X;  1BCP B;  4UPA A;  1OTC A;  3RZO B;  2K1B A;  4WJ4 A;  4XYQ A;  1JIC A;  2L11 A;  4K2K A;  5LL6 S;  3WWV A;  1MI2 A;  1I50 H;  3K0Y A;  2BDN A;  2F52 A;  3T1Y Q;  1PYW D;  1SYC A;  1CA6 A;  1MD2 D;  2AWN A;  3H3V C;  2BH8 A;  2CVR A;  2GA4 B;  4HAE A;  1O78 A;  3F2U A;  1OXX K;  2I5H A;  2MGS A;  1CM9 A;  2EY2 A;  1XPR A;  1QUQ B;  1GOZ A;  5ELE A;  3ND8 A;  3A5U A;  2A68 C;  1MGS A;  3K8A A;  4L8J A;  3I91 A;  3J80 L;  1VQ6 A;  1FNU A;  1P16 A;  1LTI D;  1VS0 A;  3I55 A; 
#chains in the Genus database with same CATH homology
 4FDB A;  2IHF A;  5C3E H;  4A3E G;  2JE6 I;  4KLK A;  2K5N A;  4P75 A;  2QEX A;  2JA8 G;  4B3M L;  5GAD C;  1EIF A;  1LM0 A;  4A3C H;  3S16 H;  3KF6 B;  2B29 A;  2I0Q A;  4JI1 L;  1FGU A;  2K5V A;  4DV1 Q;  2KHI A;  4JI1 Q;  4DV1 L;  3UE1 A;  1KL9 A;  3UE0 A;  2ZTC A;  2R7F A;  2RCN A;  2YV5 A;  1KD1 C;  4DR1 L;  1I3Q H;  4LF5 Q;  4YWL A;  4DR1 Q;  1HR0 W;  1UE5 A;  4ALP A;  4IPC A;  4A3G H;  3OYY A;  2UU9 L;  1VQH A;  3DLL A;  1Y1W G;  3D31 A;  4A76 A;  4YY3 Q;  1X9N A;  1EFW A;  1NTG A;  1VQF A;  3FKI H;  3L2P A;  2OQK A;  4DAM A;  4DV6 Q;  1ASY A;  3AFP A;  4JBW A;  4YWK A;  3VDY A;  2E2H H;  4OWX B;  3HFZ B;  4YCV A;  5IT9 c;  4LF7 Q;  2ZJR A;  1A0I A;  4C3I H;  2WFW A;  3F8T A;  4RG1 A;  1C7Y A;  2HHH L;  3HOV H;  1FJG Q;  4JI8 L;  3DM3 A;  3M4P A;  1U5K A;  2NZH A;  3M4Q A;  4A93 G;  4OON A;  4DR3 Q;  1MJC A;  2OQ0 A;  5GQO A;  1Y14 B;  2WB1 G;  4BA1 I;  4GOP A;  1AE2 A;  3U58 A;  3HOX H;  4L5S A;  4BBS H;  2JQO A;  2Y0S E;  4IOA A;  3G48 A;  2JA9 A;  4OWT B;  4DKA C;  1BKB A;  2VQE L;  3U4V A;  4GLX A;  3MEF A;  3S17 H;  2R93 H;  5JJK A;  3TQY A;  3RZO H;  2K4K A;  3A74 A;  1PHJ A;  2KCM A;  1K8G A;  2KHJ A;  4X64 Q;  1EQQ A;  1L1O B;  1X55 A;  3W5O A;  4DR4 Q;  1XTD A;  2CWP A;  1TWG H;  3KDF A;  3CME A;  3PO3 G;  2VUM H;  4BA2 I;  1YVC A;  3E9I A;  3FP9 A;  3KF6 A;  1YHB A;  4A3L G;  5HGQ A;  1P8L A;  2A8V A;  4JCV E;  1CKN B;  4BY1 H;  5FJ8 H;  1YJN A;  3GTK H;  4C3H H;  3KJO A;  3H3V H;  4JG2 A;  1UE1 A;  4DV4 L;  3PF5 A;  3T1Y L;  1J6Q A;  4DNI A;  3S2H H;  1VQK A;  3HKZ G;  1QVC A;  3S24 A;  1S40 A;  3H3V I;  4GNX A;  5FLX c;  3E9H A;  1IZ6 A;  4X65 L;  4JI4 Q;  1SE8 A;  1LTL A;  4X65 Q;  4LF6 Q;  1PH5 A;  5IYC H;  4NXM L;  2PI2 E;  2RHS B;  4R4O A;  3RZD H;  4GKJ Q;  1YJ9 A;  1VQC A;  2AMC B;  4HJ5 A;  1FJG L;  1S72 A;  1N36 L;  2D62 A;  1W2B A;  1YJW A;  1CUK A;  1G29 1;  1Q1E A;  1J5E Q;  2D0P A;  3FKI G;  4B3T Q;  3HOW G;  2R92 H;  1PV4 A;  5HY6 A;  2UUB L;  1NBW A;  1QZG A;  1XJV A;  2E5L Q;  1BVS A;  1B8A A;  1I94 L;  4X64 L;  5FLM G;  5C0X G;  3I4M H;  1MKH A;  3HOY H;  3CMA A;  3RNU A;  2EXD A;  1M1K C;  1KHI A;  3RLO A;  2MFI A;  3SGI A;  3ZJY C;  3CCS A;  2NN6 G;  3CCE A;  2ID0 A;  4QJF A;  2KBN A;  2NN6 I;  4LWC A;  5C3E G;  1HZA A;  3STB D;  4A3E H;  1PH3 A;  4HJ7 A;  1Q46 A;  3NEM A;  4JV5 L;  3ULJ A;  3CCV A;  1QVF A;  2Q2U A;  3PV0 A;  4EQ5 A;  1CSP A;  3GDE A;  2R7D A;  4Y52 H;  4GN4 B;  1WFQ A;  3F2C A;  4DV0 Q;  1FL0 A;  3AEV A;  1NE3 A;  2CKZ B;  2H5X A;  2ES2 A;  2WAQ G;  3EIV A;  2LXJ A;  4KI0 A;  3S1N H;  3L0O A;  4UP8 A;  1SRO A;  1E22 A;  1WJJ A;  2BA1 A;  3TS2 A;  3CCM A;  1L0W A;  1N9W A;  1IXR A;  4X62 L;  2NVQ H;  4P72 A;  2Q2T A;  3B6Y A;  1Q82 C;  1N32 L;  1C9O A;  5IY0 A;  3OTO Q;  1XNQ L;  4AIM A;  5M3F G;  1K3R A;  1K73 C;  3S1R H;  1JT8 A;  2PNH A;  2UUA Q;  4LF6 L;  1IBM L;  2HQL A;  4IPD A;  1YNX A;  5AJ3 Q;  1E1T A;  3D0F A;  5IYB G;  5JJL A;  1WYD A;  2N3S A;  2N78 A;  3CF5 A;  3PCO B;  1N36 Q;  3J81 c;  2K52 A;  2NZO A;  3CCU A;  1PYS B;  4C3J H;  5M3M H;  5LMN W;  1D7Q A;  3HOY G;  2N8N A;  2OTL A;  4LFA Q;  3KOJ A;  1XPU A;  3PUX A;  1PVO A;  2AKW B;  2UUB Q;  2PI2 A;  3F1Z A;  5C0X J;  3OW2 A;  5IE8 A;  1QUQ A;  5LMN L;  4IO9 A;  3PSI A;  4L5R C;  4OXP A;  2CCZ A;  3T1H Q;  2BH2 A;  1YI2 A;  1K9M C;  1Z47 A;  2IT1 A;  2IX0 A;  3BU2 A;  3HOW H;  1KRT A;  3PUY A;  1HR0 Q;  4DR6 Q;  1B70 B;  4MNO A;  1LUZ A;  4JI7 Q;  4GLV B;  5J3B A;  4IOC A;  2Z6K C;  1XMO L;  1L2F A;  4JYA Q;  4K0K L;  1DGS A;  1WCM H;  3J7Z C;  2B3G A;  1PH1 A;  3ULL A;  3RN2 A;  2JA6 H;  5C4X G;  3GTL H;  4AYB E;  5IYC G;  1HNX L;  3RN5 A;  5EAY A;  4APV A;  4JI8 Q;  1SLJ A;  1QZH A;  3ERS X;  2IX1 A;  4KHP L;  1UE7 A;  1HZB A;  4YHH Q;  2UXC Q;  1IBK L;  5IP7 H;  2OWO A;  4A3J G;  4NB3 A;  1Q12 A;  3J80 c;  5JJI A;  4J15 A;  3GTP H;  3UDI A;  5FJ8 G;  4GKK Q;  2AWO A;  3GTM H;  1GD7 A;  1HH2 P;  1A62 A;  1TWH H;  1N32 Q;  4JBJ A;  4PZ8 A;  3CP0 A;  3I4N G;  2K50 A;  1B7Y B;  3JAM c;  3RLN A;  3I4O A;  4DR4 L;  2UXB L;  1X3G A;  3UDX A;  1HNZ Q;  3ER0 A;  3F2B A;  4LF9 L;  1PH8 A;  5FLM H;  4DV3 L;  2HIV A;  5K36 G;  2FXQ A;  1HNW Q;  3PO2 G;  3K7A H;  5ELN A;  4DR5 L;  4DUY L;  1TWA H;  2K14 A;  4IPG A;  1YIJ A;  4GLA C;  4JOI A;  4B3S Q;  2ZTE A;  1E7Z A;  4BY7 H;  4X62 Q;  1CSQ A;  4YWM A;  4HID A;  3MXN B;  1VQO A;  3GTG H;  1H95 A;  1V1Q A;  1EQR A;  3GTQ H;  4A3F H;  4A3I G;  1NJI C;  1HZC A;  2E8G A;  4GN5 A;  1PFS A;  1VQD A;  2YTY A;  1AH9 A;  1KIX A;  3I7F A;  1HNW L;  3AFQ A;  1Q8K A;  1I5F A;  1IBM Q;  2LXK A;  4IFD I;  1SFO H;  4WJ3 M;  3CC2 A;  3NEN A;  5C44 G;  1C0A A;  4C2M H;  3CPF A;  3EBE A;  1VQE A;  2F3I A;  1OXS C;  4QL5 A;  3A5Z B;  2IHE A;  3CW2 C;  5JEA J;  2ZM6 L;  4A3G G;  2CFM A;  2GVB A;  2PQA B;  2MO1 A;  3EN2 A;  4BY1 G;  4NXM Q;  5IP9 H;  2QGQ A;  1TWF H;  1VQ4 A;  2JA7 H;  4X6A H;  4QIW E;  2YU9 H;  1NY4 A;  4NXN Q;  2ALY B;  4YCU A;  3CD6 A;  1XNR Q;  1OXV A;  1J5E L;  3KLW A;  1GO3 E;  1Z9F A;  3PUZ A;  4LUV A;  4HJ9 A;  1PH4 A;  1A63 A;  4DUZ L;  2JA8 H;  2F4V Q;  1EUJ A;  1OXT A;  4QY7 A;  2JA6 G;  1I6H H;  1WCM G;  3AYH B;  2ZJP A;  4DUY Q;  1SN8 A;  1QVG A;  3GO5 A;  2RHQ B;  4JI5 Q;  1X6O A;  3K0X A;  2JEA I;  2Q2H A;  3CCL A;  2BA0 A;  4PMW A;  4P71 A;  3HOZ G;  1BBW A;  4BBS G;  4DR6 L;  2UXB Q;  1CKM A;  4MZ9 A;  4JI6 L;  4JBM A;  4UP9 A;  4X66 L;  3CCQ A;  4DV2 Q;  2NVY H;  3GTO H;  4JI6 Q;  4KHP Q;  4IPH A;  4AQY Q;  3UDF A;  1PH6 A;  4QGU A;  3TRZ A;  1PH2 A;  1I94 Q;  4A3I H;  5H1S E;  1GVP A;  3HOV G;  2VZA A;  1E1O A;  2OCE A;  5M5X H;  2B63 G;  2ZTD A;  3M4O H;  4JOI C;  4BBR H;  2JJQ A;  5E7N A;  3M85 A;  4B3T L;  1VCI A;  1KAW A;  4L5Q A;  1G51 A;  4JYA L;  3KDF B;  4O0A A;  1N34 Q;  2UXD L;  1KQS A;  3F2D A;  1Y1V H;  1IYJ B;  4GKJ L;  4XTC S;  4A4I A;  1VQ8 A;  3S1M H;  4BBR G;  1RL2 A;  2EQS A;  4POF A;  1XMQ L;  2UU9 Q;  2A1A A;  4JBK A;  4JI7 L;  3K7U C;  4GNX B;  1A8V A;  1X3F A;  4LUO A;  2ZM6 Q;  1EYG A;  4GOP B;  1HR0 L;  2V1C C;  1E3P A;  4A75 A;  2ATW A;  4DR2 Q;  4OX9 L;  2DGY A;  1O7I A;  1S3O A;  3LGJ A;  1T9H A;  2L15 A;  3HKZ E;  4DV5 L;  1PH7 A;  4NXN L;  4LF7 L;  1Q86 C;  4PZ6 A;  4R4Q A;  3I4N H;  2R7Z G;  1G6P A;  4IJH A;  1U0L A;  5DLQ E;  1W3S A;  1TWC H;  2JEB I;  5ELO A;  2VW9 A;  1MIU A;  5M5W H;  4PZ7 A;  2D0O A;  4IJL A;  3OTO L;  4A3M H;  1JB7 A;  3NEL A;  4IFD G;  3TS0 A;  2WAQ E;  1ASZ A;  4JI3 L;  3W1B A;  2Z6K A;  3I55 A;  2Q2I A;  2NVX H;  4A3J H;  3J80 i;  5AJ3 L;  4LF5 L;  4DPG A;  2MQH A;  2WB1 E;  4B3S L;  1EOV A;  1L1O C;  5C4X H;  5LMU Q;  1VQM A;  2RF4 A;  4DK6 C;  5LMU L;  2I5M X;  2VUM G;  2XTI A;  3JAM i;  1Q7Y C;  4A3D H;  1E24 A;  1NMF A;  2EIF A;  3STB C;  4JI3 Q;  4B3R L;  3K80 C;  4O2D A;  3S15 H;  1K0R A;  2E5L L;  2PQA A;  4H02 A;  2HHH Q;  5JEA G;  3E0E A;  4LW1 A;  1WOC A;  2JA5 G;  1VQA A;  1SRU A;  4DR7 L;  4JI0 L;  4B3M Q;  4DAY B;  5IYB H;  3PUV A;  2Z0S A;  4YY3 L;  1X3E A;  4MTN A;  4A93 H;  1JJC B;  1VQ7 A;  3I56 A;  4OO1 G;  1VQJ A;  2CWA A;  1K83 H;  4JC0 A;  3BZC A;  4A3F G;  3CQZ H;  1IBL Q;  1N33 L;  4TQU S;  3L7Z C;  1X54 A;  2JA5 H;  2B63 H;  1UE6 A;  3NBH B;  1XMQ Q;  2E2J H;  3CCJ A;  1N8R C;  3H15 A;  4DV7 Q;  3JC6 6;  1FVI A;  1IBK Q;  4YHH L;  4K0K Q;  1Y1W H;  4DV2 L;  5C0X I;  3CC4 A;  1JJG A;  3UDG A;  2VQF L;  4P73 A;  1HNX Q;  5BR8 L;  4HIO A;  4GS3 A;  2HIX A;  1VQ5 A;  3PO3 H;  1V43 A;  5C4J H;  4LF8 Q;  1CKO A;  1PA6 A;  1GM5 A;  1X56 A;  2MO0 A;  1Q81 C;  4JI4 L;  4A3K G;  1N34 L;  2UXD Q;  1JJ2 A;  4AQY L;  3G4S A;  4LFB L;  2UXC L;  2R93 G;  2A19 A;  3CPW A;  2R6G A;  4RMF A;  4TVA B;  1EWI A;  2C35 B;  5IP7 G;  3HOX G;  1YEZ A;  3BJU A;  2VQE Q;  1KC8 C;  1UEB A;  1L1O A;  2ZJQ A;  3J81 j;  4LNQ A;  4JI0 Q;  2HT1 A;  3RR5 A;  4LF8 L;  4DR3 L;  3A0J A;  3CCR A;  4A3M G;  1SR3 A;  3K81 C;  4HIK A;  3RLF A;  1VQN A;  1HJP A;  3G6E A;  5GRO A;  2Y0S G;  4Y7N H;  1XMO Q;  1WI5 A;  4X66 Q;  2F4V L;  3I4M G;  2KEN A;  1GKH A;  3KF8 B;  4DUZ Q;  4UY8 C;  4BXX H;  3U4Z A;  3HKS A;  1VQL A;  3T1H L;  1NMG A;  3ULP A;  1SMX A;  3Q8D A;  4R1J A;  4R4T A;  3J81 i;  4GNX C;  3H0G G;  2R92 G;  2CQO A;  5IYD H;  3CAM A;  1R9T H;  4BY7 G;  1VQP A;  3PO2 H;  1YBY A;  5IWA Q;  4OWW B;  1N33 Q;  4DK3 C;  1YZ6 A;  3PF4 A;  1JMC A;  5IWA L;  2AHO B;  1KXL A;  1X65 A;  5M3M G;  1Y1V G;  4A3B H;  4DR5 Q;  2PMZ E;  2OTJ A;  2QA4 A;  4NPS A;  4AH6 A;  3J7A 5;  1BBU A;  4JI2 L;  1V9P A;  2ASB A;  4DV0 L;  2K75 A;  4DV6 L;  1HNZ L;  4LF9 Q;  4R4C A;  3KJP A;  3PIO A;  5M3F H;  4DR2 L;  2YYZ A;  4OX9 Q;  4HIM A;  4JV5 Q;  1YHA A;  1JE5 A;  4UP7 A;  2E2I H;  3HOZ H;  3M3Y H;  3W1G A;  2VNU D;  4A3L H;  4POG A;  4A3K H;  2DUD A;  1OXU A;  3PIP A;  4LUZ A;  2YTV A;  4DV3 Q;  3HOU H;  2IY5 B;  1CKN A;  4GOP C;  4L5T A;  2N49 A;  4LFB Q;  2XGT A;  2WP8 J;  3M9B A;  3I2Z A;  2VY3 A;  1EIY B;  5GAE C;  4KHZ A;  3CXC A;  2GN5 A;  3HOU G;  1XPO A;  5IYD G;  4P74 A;  2JK8 A;  3GD7 A;  4ME3 A;  3TRE A;  4JI2 Q;  5GAH C;  1VQ9 A;  3KFU A;  3IRB A;  3S1Q H;  5IP9 G;  3BZK A;  1MJE A;  2JA7 G;  2VQF Q;  1K8A C;  4YCW A;  4LFC L;  3FHW A;  4DV5 Q;  3M7N A;  4LF4 L;  5LMN Q;  2K5H A;  2VS1 A;  4DV4 Q;  2I5L X;  1AE3 A;  1KRS A;  2VL6 A;  5M5Y H;  5C44 H;  4GKK L;  2YTX A;  4QQB X;  4OO1 I;  1YIT A;  2KCT A;  1M90 C;  4UPA A;  5GAG C;  1OTC A;  2LSS A;  1PYB A;  4WJ4 A;  4A3B G;  5BR8 Q;  1Q1B A;  3WWV A;  2UUC Q;  4LFC Q;  1I50 H;  3T1Y Q;  2F52 A;  3PUW A;  3S2D H;  4A3D G;  2UUC L;  1RIP A;  1VQG A;  1UWV A;  3H0G H;  4A3C G;  1XNR L;  4IFD J;  1LYL A;  4EX5 A;  4DR7 Q;  2AWN A;  1IBL L;  4PG3 A;  2MNA A;  1HZ9 A;  1VQI A;  2BH8 A;  1XNQ Q;  4HJ8 A;  3CC7 A;  4B3R Q;  4R4I A;  3U50 C;  1OXX K;  2I5H A;  3ICE A;  2GVA A;  1YHQ A;  4LF4 Q;  1TXY A;  1XPR A;  2NVT H;  1QUQ B;  1D8L A;  3TEH B;  4AYB G;  4XIG S;  4BXX G;  1PH9 A;  3S14 H;  1IL2 A;  4DV7 L;  1VQB A;  4HJA A;  3PGZ A;  3A5U A;  3GTJ H;  3K8A A;  4LFA L;  2UUA L;  3AQQ A;  3G71 A;  1VQ6 A;  4GN3 B;  4JI5 L;  1P16 A;  2R7Z H;  1VS0 A;  3KYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...