4ZUIA

Crystal structure of staphylococcal nuclease variant delta+phs v23h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTHKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zuiA00
1STYA 2SNSA 4EQPA 2EYFA 4EVOA 1EYDA 1A3UA 1ENCA 1F2MA 1IHZA 3ITPA 5ISRA 1EYCA 2EYOA 4NDXA 5I6YA 4B9XA 3OMGA 5C3XA 4F8MA 4K5XA 4DFAA 2EYMA 5IIFA 5KYLA 1EY6A 1KDCA 2PZTA 3P1HA 5C5MA 3D4WA 1SYBA 2M00A 4N9PA 1EY0A 3V2TA 4ODGA 2F0PA 1KDBA 2F0GA 4KJOA 5K5PA 5KEEA 5E3FA 4K8JA 3SK4A 2QDBA 1TQOA 4KJNA 2ENBA 3MXPA 5C5LA 3NQTA 4HTHA 5J39A 1II3A 1STNA 2F3VA 2OF1A 3EJIA 4ID6A 4DU9A 5IOCA 4MIUA 5NUCA 5C3WA 4J6HA 5KGUA 2F0UA 5CV9A 4PMBA 2RKSA 4K14A 3QOJA 3DMUA 3DHQA 5M9OA 1JOQA 3OSOA 4EQOA 1EZ6A 4QMGA 2RBMA 5JOBA 2EYJA 5IGBA 3QB3A 1SNOA 3E5SA 3PMFA 3T16A 5IGGA 3D4DA 1SNDA 4ME5A 4KY5A 3SXHA 3TP5A 1KDAA 3S9WA 1KABA 5CV6A 4IALA 5CGKA 5DEHA 2F0DA 4NP5A 2EY2A 1EY5A 2F3WA 3HEJA 4YIJA 4HMIA 5EKLA 2F0LA 5C6AA 2F0OA 5E1FA 1F2ZA 3TMEA 1NUCA 1U9RA 2KHSA 3C1FA 3H6MA 4WORA 1SYGA 5J1ZA 1JORA 1EYAA 2PZWA 4IZ8A 4B9WA 5F2DA 3NP8A 4KY7A 5CV8A 5DAUA 5CC4A 2EYPA 5J22A 3BDLA 1SYDA 1SYEA 2PQEA 3BDCA 3ERQA 3EVQA 3QOLA 3SK5A 5HGTA 5I6WA 4LAAA 2OEOA 3SR1A 1A3TA 4ZUIA 4G57A 3U9OA 4KTAA 3NK9A 4ZQ3A 5HURA 2F0TA 1JOOA 4KV6A 1AEXA 1EY9A 4I65A 5IGEA 1A2UA 1KAAA 4KY6A 1A3VA 1SNPA 2F0NA 2F0HA 3TP7A 1STBA 3TP6A 3NUCA 4HMJA 4K6DA 1EY7A 1SNMA 1TT2A 4PMCA 3SHLA 5I9OA 2LKVA 2PZUA 3R3OA 4K2LA 4K8IA 2KQ3A 3MZ5A 2SOBA 4K5WA 5KRUA 1TR5A 1SYCA 2OXPA 4PNYA 5CR3A 5EKKA 3RUZA 5C4HA 4KD4A 5IGFA 2HQEA 3D8GA 4OL7A 2F0EA 2F0QA 3C1EA 2EY5A 4NMZA 3OMCA 1RKNA 4J1MA 3HZXA 4TRDA 3T13A 5JAVA 4IUNA 4S3SA 5KYIA 5EGTA 4DGZA 3MEHA 3VA5A 4E6IA 5IGDA 1STAA 4WRDA 1EZ8A 3OWFA 2EYHA 3TP8A 2WACA 5IGCA 4QB4A 2F0VA 1NSNS 2PYKA 2F0SA 4K5VA 2F0MA 4R8NA 2O4XA 1A2TA 5CV7A 3P75A 2F0KA 2F0IA 2F0FA 4F7XA 3NHHA 5I9PA 2PW7A 4NKLA 3MHBA 4ZUJA 2F0JA 2EY6A 1SNCA 2NUCA 1JOKA 2PW5A 1ENAA 5CV4A 3NXWA 4DF7A 1STGA 4K2KA 1EY4A 3SK8A 3D6CA 2EYLA 4H7BA 3EROA 4KHVA 3LX0A 4KD3A 2RDFA 4RKLA 2EY1A 5KIXA 1EY8A 1STHA 2SNMA 4RKBA 1SNQA 1EQVA 3MVVA 2F0WA 5CV5A 3SK6A 4EQNA 5C4ZA 4N9TA 5IODA 4QF4A 2EXZA 1F2YA 1SYFA
chains in the Genus database with same CATH superfamily
1XMOQ 2LSSA 3K80C 4M1UB 1JT8A 1MSGA 1U4RA 1PYWD 1TWCB 3OMGA 4POGA 4G7OC 3ND9A 3P1HA 4KHZA 3MXUA 2F0GA 2Z4HA 1CKNB 4HJ5A 4A93H 4RMFA 3BU2A 3S16H 2B2YA 2PI2E 1N33Q 2CWPA 3OW7A 2DN8A 1ONLA 4A3GG 1GVPA 4JI5L 3N6RA 5FO8B 1T5XD 3QB3A 2B2WC 2BH8A 3G7LA 4POFA 5C0XI 2MO0A 3SXHA 3PIO3 1IKLA 2JEBI 3M7NA 2E8GA 4IALA 2B3GA 3I4NG 3HKSA 4DA2A 1SJED 1CQVA 3NTIA 4GNXB 2IW3A 4WJ4A 4CDCC 4A3DG 1I3QB 4IUPA 2WFWA 3B6YA 4A3EH 1N36L 1M90C 4ZUIA 2Y0SB 1UAPA 1HH2P 5DNFA 2HDLA 4DV5L 1NNXA 1E7ZA 1K28A 1A3VA 2EVBA 3J81i 2O5IC 1GO3E 5E4XA 2F4VQ 2NTSA 3R2IA 2UU9Q 2UUBQ 1IL2A 1CI3M 2AHOB 2ZTDA 3RUZA 2HIXA 3TSSA 3EA6A 3SGIA 4OWTB 4A3LH 4IUNA 1VQFA 2VY3A 3D6WA 3M4PA 2K5VA 1B4OA 4E6IA 1D6EC 1OXUA 1EZ8A 4JW0A 1I50H 3LNNA 1D7QA 3F8TA 4CJ1B 1PH2A 3G6EA 5FJ8G 4B3TQ 4YY3Q 2EY6A 2R7ZG 3TDQA 4K0KQ 1XNQQ 1WFQA 4RGNA 1Y1VG 4KD3A 2H1EA 4XIGS 3S9WA 1LTID 1PYSB 5M5YH 4C3IB 3GTOB 1U4MA 4ZCKA 2A5HA 2L11A 2PNRC 2QCPX 1WJJA 1F2MA 2NVXH 2D9UA 5ELFA 1VQJA 5C3XA 4QGUA 4ZLTF 1BUVT 1SYBA 4ODGA 3S2DB 4KJOA 3D4RA 4MN3A 5C44H 1M1KC 1TQOA 3UI2A 2JA8B 4LF7Q 2UXCQ 4ID6A 4PZ7A 5HGQA 1BNZA 4LF8L 5C3WA 2MP1A 4KLKA 1SE8A 1B8AA 1MD2D 1VMCA 4H44C 2MFIA 2KENA 4DAPA 1ESRA 1TWHB 2K01A 2VB2X 3CAMA 5JOBA 2TSSA 4P74A 3S2HB 3PMFA 2L9HA 1JWSD 1STEA 1LTAD 2HIVA 5I2XA 5CV6A 2R92B 5IT9L 3DWPA 1A15A 3I72A 4H0LC 3U50C 4DNRB 4LF4L 4ZK9B 3EQLC 2EE1A 1B9NA 2ZM6Q 1I94L 2ALYB 4JI7L 5FLXc 5M5WH 2VW9A 2NVYH 3NELA 4DK3C 4LF5Q 4P71A 5EPLA 3V05A 2D0OA 1EIGA 4XQQA 3BVZA 4G57A 4DN4M 2OWOA 3CCSA 4GOPC 1A2UA 1ESFA 2Q2TA 3PIPA 4C3HG 4GN5A 1VDZA 2WP8J 2EJFC 3OIQA 1Z9FA 2D0PA 1PMRA 2OXPA 3BYYB 5IGFA 1PDQA 2KHJA 2Z1CA 3KF8A 4IJHA 2F4VL 5KYIA 1JE5A 1G6ZA 2WKCA 1ICFB 1MGSA 5FLMG 3HOUB 2R93H 5M3FB 2F0MA 4R8NA 3PGZA 2JA6H 4A3LG 3GV3A 1JICA 2NVTH 1Q12A 1CKMA 2ZJRA 1BXTA 4ABNA 5CV4A 3DXJC 3Q22A 1EQQA 2XIWA 4H7BA 2AUKA 4AYBE 1VF5C 1V1PA 2FJ2A 2N78A 1DYQA 1G2TA 1BCPC 3NTHA 3KUPA 5L37A 2JXMB 3HP3A 4C3JH 5C4XH 3FPPA 4JI4Q 2EYFA 2ZT9C 4NXNQ 3FDTA 4RCNA 2ZJQA 2K14A 4DR4Q 4NDXA 3S1MH 3GDEA 1RD9D 1GOZA 3FP9A 4OGQC 5K36H 1B7YB 3D4WA 2A19A 3KLSA 4GKJQ 4K8JA 1P8LA 1HR0L 3OW2A 2E2JB 4DU9A 5JVG3 1XNRQ 4BA1I 3E0JA 5CV9A 3OPOA 3L9AX 1L0WA 3WOEA 4NB3A 5C44G 4DK1A 3RZDB 4IPDA 4JI6Q 1K8MA 3G48A 5LMNL 2N88A 4X3UA 1D5ZC 3C46A 3FKIB 1KABA 1WD1A 2G9DA 2FMMA 4LFCL 1ICWA 3J80L 3KLSX 1YZ6A 2B63G 3TMEA 2KHSA 1YVCA 4RGMA 1I6VC 1GUNA 1GM5A 2EYPA 1TS3A 4EX5A 3J80c 1QUQB 3VYSA 3PUYA 1O7ZA 4LAAA 4DV1Q 2B29A 2C35B 3U9OA 1X55A 1IW7C 3J81E 1ASZA 2HHHQ 2EDGA 2KCTA 1MJEA 3S17B 1SNPA 2F0NA 3TP7A 1BCPD 1EY7A 1S4ZA 2RDHA 1J5EL 1SN8A 4K8IA 1D5XC 1LLRD 3KYHC 3NPPA 4MZ9A 3PCOB 4PMWA 5EKKA 1JWMD 2EY5A 4A76A 2KUMA 1CT1D 3TZDA 1SDFA 4WRDA 2Q8RE 3TP8A 4HEDA 1PZJD 1RODA 2UXDL 3H3VH 4BY7G 1SFOB 3P75A 2EOTA 2OTJA 4F7XA 5HY6A 1PH4A 1UE6A 1OTCA 3CCLA 4LF9L 3NXWA 4LNQA 2R93G 3TS2A 2JA5H 1HZAA 1MKHA 1TWCH 2JA6G 3CMEA 2Y0SE 5CYUA 1W6JA 4DR1L 3HOYH 5JJKA 5KNDA 4EQNA 4GOPA 2QDLA 3KLRA 2E5LQ 4ZKCB 2ASBA 1FGUA 2L1BA 1TS2A 4DAVA 1ENCA 3HOXB 4JOIC 1QJOA 2Z6BA 1KTKA 3S24A 4QY7A 4C3JG 5C4XG 2B2UC 1X3PA 3V2TA 1EL0A 4DUZQ 4QUCA 1IW7D 2NN6H 1B2TA 5K36G 2UUAL 3QOJA 5G3LD 1WCMH 4P72A 1ILPA 3K0YA 3T1HQ 1U4PA 3K7UC 3OTOQ 4HR7B 3EN2A 3DLLA 4X6AH 4X62L 1I3QH 4XQNA 1HA6A 3RD4A 4UDUC 4A3JG 1E2WA 3A7LA 4YIJA 4HMIA 3BYTB 4L5RC 3U9SA 4DR7Q 3ONAB 2VQEQ 5ELNA 3O13A 3I56A 2DJFC 1JORA 4LUVA 1VQEA 2K4KA 1H95A 4DR6L 1SYEA 5I6WA 1TWAB 4DKAC 4IFDJ 2B2TC 1AZPA 4HCEA 4P75A 2MHVA 1AEXA 2A68C 3G71A 3HOZG 1GUOA 3NUCA 1OXTA 4FDBA 4BXXH 3CCMA 4FF1A 2F03A 1SR3A 4K2LA 3AEVA 1YJ9A 2NZOA 3CCQA 4MTKA 2PQAB 1RKNA 3A8JE 2G5DA 4LF6Q 3RZOH 5AFWA 3L7ZC 4CDEC 3HOWB 1STAA 1A8VA 5IGCA 2TMPA 3AYHB 3NWSA 5M3MB 3RNUA 1Y1WG 3M4YA 1HNXQ 1DM0B 1XMQQ 4JV5L 2VUMB 4YCWA 1EY4A 1Q82C 2IX1A 2ICEC 3QR8A 1LT6D 2DY8A 1EIYB 2SNMA 1MJCA 1IKMA 5T1IA 2F0WA 3A0JA 3KK7A 4R4TA 2EXZA 2E2DC 4RGOS 1LT4D 4OO1H 3K7AH 2JA8H 1NAPA 1HQMC 1LYLA 5ISRA 4GN3B 5ELEA 3HOYG 1CHPD 4OONA 3KJPA 3Q0AA 5LL6S 1TWHH 1I6HH 1GUSA 4NW2A 5BR8Q 1EY0A 4IJLA 5K5PA 1E2ZA 4XYOA 2A68D 4J6HA 1EWHA 3G6JB 1MIUA 2GN5A 4CDDC 5IWAQ 1BCPF 3K5OA 3Q6SA 4CKEA 2IX3A 1IBKL 2NN6G 1UNSA 1KRTA 1EFID 5C4JB 1IBMQ 4BA2I 3ULPA 1WCMG 2V4DA 3CQZB 1JMCA 3D3RA 3CCEA 1QWYA 1NBWA 1HZ9A 2EY2A 2A6ED 3CCVA 4HIKA 1H9RA 2CW0C 2MO1A 5E1FA 4GZYC 4X3KA 4YWLA 5J22A 4NXML 4B3SQ 3NP8A 1Q3LA 2IHEA 2Y0SG 1D2BA 1EWIA 5IE8A 4JOIA 3NWTA 5HGTA 1TIID 4IUTA 4RG1A 4O2DA 2JP1A 4DR7L 2ID0A 2B2UA 4CJ2C 3I55A 2Q2UA 3I4NH 5GADC 4ZKBB 2BOSA 2JK8A 2PI2A 2FMCA 2XWJB 4C2MH 1CA6A 2LKVA 4FO2A 4B3RQ 1F9SA 2DJGC 4HJ8A 5C4HA 3CC2A 1H9SB 5C3EH 2A8VA 3IKJA 3L2PA 1Y8PB 2L15A 1G51A 5EAYA 4BXXG 4OX9Q 2RSOA 1KLUD 2MGSA 3AB9A 3J81c 4RCOA 2B8FA 1XTDA 4V0BA 4YWMA 1FD7D 1GUTA 2OT2A 3IFDA 4RWSC 3GTMH 1UWVA 2PW7A 2K04A 3PUVA 1JOKA 3A8KE 5CORA 3LWEA 5DM63 4A4IA 1PYBA 1VQ4A 1FNVA 5DLQE 1A6XA 2IJ0A 2OQKA 1XMQL 1N32Q 2B2TA 5FJ8H 2CWAA 4EVOA 1H9JA 3VYRA 2OCEA 2EYOA 4FYDA 2Q2HA 4X64Q 1B53A 4A3MB 4G7HC 1X9NA 3VYUA 1XPUA 2EYMA 3K8AA 4DXGA 3KF6A 4R4IA 3QJYA 5LHY1 2XSCA 4O0AA 2JA8G 5J39A 3FKIH 5GROA 2CH4W 1LO5D 4J15A 4DK6C 2VZAA 1EOTA 1MBYA 4RFBA 1BBXC 2GVAA 1NY4A 1CSPA 2XWBB 1I4GA 1BR9A 5D3DA 4Q0FA 2R92G 1WTOA 1L1OA 3DEPA 5IYDH 2WAQB 2X6LA 2IL8A 2VXWA 3CC7A 3H3VC 1B3QA 4Y7NH 2PO4A 1B50A 4LJZC 4APVA 1DOLA 2QILA 4KHPQ 3GTGB 2NVQB 1PTOC 3D0FA 3HKZB 1TKWB 3I73A 4JI2Q 3F2BA 1SXTA 3C1FA 4AQYL 4WORA 1CFMA 2RHSB 1F9RA 1EYAA 2OTLA 1WTHA 1M8AA 2IY5B 3MXGA 2AQ3B 4HSVA 3GQBA 1TU2B 2KJXA 1CZWA 1LABA 4ME3A 2QEJC 3M9BA 4YCVA 3BS1A 2NZHA 4B3SL 3GP7A 2LFNA 1ET9A 4A3BH 1IZ6A 4LK1C 1W6KA 4CHTB 2E2IH 3KF8B 1BO0A 3I4OA 2WINB 2WIIB 5LMUQ 3I4LA 4LMQD 2F0QA 2E75C 4LFBQ 1EQTA 5AJ3Q 5M3FG 3I7FA 2HCCA 3NTKA 2YTXA 1O7LA 2EYHA 4C3HH 1I5FA 5C3EG 3PQIA 1R4PB 1VF7A 2IHFA 1J9OA 2CCZA 1V1PB 3NHHA 3MHBA 4OX9L 1HR0W 3Q23A 1D8LA 4JI0L 1JJCB 3URYA 3MC0B 4KHVA 5FLMH 4DAYB 3BG3A 4GKKQ 4TVAB 4P73A 3SK6A 5A2QL 1PA6A 5LMNW 1CSQA 4JI3Q 1A3UA 1PTOD 2F3IA 3DWAA 1RDPD 3MXNA 1YHAA 4B9XA 1N32L 2EJMA 3U58A 3X3MA 3KLWA 1XJVA 4LUZA 2WV6D 3JAMi 1PV4A 2F0PA 3RLFA 3SK4A 1QNUA 1KHIA 3MXPA 4X65Q 4DR5L 3S1NB 5GAGC 4DV2Q 1WTXA 2OQ0A 5KNCA 4A3IB 4P2CB 1ENFA 2GA4B 3DMUA 1DJRD 2K52A 3K0XA 1RL2A 4RHRA 1TWFB 1XYIA 3AFPA 4IO9A 3FKIG 2WB1B 1AW7A 3J7A5 1ILQA 3TP5A 1Y8NB 4DV3Q 4DV4Q 1F9PA 1VQKA 2Z8LA 5EJWA 1KRSA 1HA5A 4NP5A 1TWAH 4OEMB 1XMOL 5IYDG 1SJHD 1U9RA 2AWNA 1D1IA 1LTBD 1VQ8A 4JI8Q 5I9OA 2L55A 3SK5A 4F88A 1A3TA 1K83H 2ES2A 2H4OA 4DNTB 1N33L 1J8IA 2D2CC 2LY7A 4BBRB 2B63H 2M9VA 1M4VA 1HCZA 5EKIA 3GD7A 5FLXL 3GTLB 1VQBA 2SEBD 2FFKB 1NJIC 2KQ3A 1MHWC 1SYCA 5CR3A 1VQOA 3GTPH 2J4XA 4KD4A 4DUYQ 4A3BG 2AQ2B 2JQOA 2XRQD 4J1MA 3T13A 2VUMH 1V1QA 1N9WA 4DXFA 1K8AC 4LFAQ 5LMUL 4WFN3 2PYKA 4I7ZC 1A2TA 1EQRA 1AZQA 4IPCA 2CKZB 3HOVH 4WJ3M 1STGA 3NBHA 4PV1C 3C3LA 3F2DA 4GOPB 2EYLA 1W3SA 1CZGA 3LWUA 2I5LX 1N34Q 1TWGH 1KNAA 5J3BA 4RKBA 3GTJH 1G91A 1CKNA 3GV6A 1EIFA 4BY7H 4A3GB 4N9TA 2KHIA 4FXDA 1B1ZA 3SE0A 2UU9L 2UUBL 4KK7A 1V8QA 3VA7A 1IHZA 2K6AA 2K5NA 5M5XB 4DFAA 1WTPA 1KDCA 1QG7A 4J8QA 5C5MA 3TQYA 1O78A 2EQSA 5KEEA 1EWCA 3S14B 5C4JH 3M7GA 1UEBA 1C4QA 1KNEA 4IQZA 3K5MA 4B3TL 5IP9H 1QILA 4YY3L 3DHQA 4A3DB 1RTNA 4FXGC 5IGBA 1K3BC 4K0KL 1XNQL 3BZDB 1FYCA 4X65L 3T1YQ 1SNDA 2RCFA 1BCPB 4IOCA 2I07B 2D62A 1AP0A 2DNEA 3VR3A 1UUPA 3ZJYC 1YHQA 4IPHA 4JI1Q 4B3MQ 2CQAA 2WKDA 3T4AC 4LW1A 3CRLC 2CHBD 4B9WA 1RTOA 1R9TH 1NE3A 5C0XH 4EGVA 1RHPA 1VQ9A 5GAEC 1G6PA 4IUVA 2AKWB 5FK9C 1FL0A 1VQGA 3SDZA 4A3JH 1LV9A 4ZQ3A 3TN2A 4DNIA 2J7ZA 4LF7L 2UXCL 2F52A 3ZYYX 1GUGA 2I5MX 1G291 4I65A 4JG2A 5ELDA 4IOAA 3TP6A 1I4QA 2NYZD 5JJIA 4HMJA 4A3KH 1LTTD 2R3ZA 3S1QH 2MQHA 4K5WA 2YYZA 4DR2Q 2A69C 4UP9A 4IFDI 2HQEA 2BDNA 3VR5A 1HNZQ 2A6HC 1BBUA 3HOZH 5D3IB 3MEHA 3PUZA 2ZM6L 2K28A 2F1MA 3Q8DA 3OHXC 2WACA 3KOJA 1JB7A 1K73C 2FHTA 1UEAB 4RHSA 3MFYA 2VUMG 3GTQH 5EQ0A 3KBGA 4KKUA 4LF5L 2FINB 2L0CA 1YHBA 4BBSH 1GJXA 2L5TA 5DM73 1PFBA 3JC66 3CU7A 4DV7Q 1PRTC 4A3MH 3J7ZC 2JEAI 1Y14B 3GTKB 2ZTCA 3HOVG 4QIWB 1Y1WH 3KJOA 2M2LA 1VMPA 3NBIA 1ASYA 4A93B 3FPUB 3S16B 2KCNA 3BVGA 1XPRA 1FJGQ 1EOVA 2NTTA 3KDFA 3H91A 4QUFA 4DR3Q 3JAME 2N49A 4IUUA 2O5JC 4XTCS 2M00A 4CKCA 3BDOA 3MEFA 2QDBA 4KJNA 5FO9B 2BA0A 4PZ6A 1H9MA 5IYCH 4UY8C 1A63A 1SE3A 3OYYA 1DONA 1WTVA 4OWWB 2O2LD 3GTGH 2E76C 1SLJA 1A62A 4ULLA 5IP9G 1Z47A 2ZJPA 4GS3A 2A6HD 1KQSA 2K33A 1HHVA 4A3EB 1BF4A 4JI4L 3T1YL 1VCIA 4NXNL 4DR4L 2MJ8A 4R9WA 3C2PA 3PO3B 3HG9A 1IBLQ 3FVQA 3N52A 2PQEA 2PPBC 3W1GA 3PSIA 1B9MA 3STBC 4C56C 4GKJL 1XWEA 3NK9A 3HGBA 2IX0A 1NR4A 1PRTD 4KV6A 1XNRL 4OXPA 5FKAC 1LTSD 5C0XG 4N8FA 3A7AB 3PIOA 1VQLA 3DEOA 2K03A 3J7AF 2P5ZX 1QOHA 3NENA 4JI6L 1P16A 2L4NA 1I50B 4JBWA 1Y69U 4JYAQ 4A3KG 1E2VA 4NMZA 4BY1B 3AMUA 4FF4A 1FNWA 4FNFA 2RQXA 1QZGA 1I4HA 3HFZB 3AFQA 3RN5A 2F0FA 4L5TA 4V190 3MFGA 5IYBH 3TS0A 2N3SA 1VQ7A 4DF7A 4DV1L 4HJ9A 1D5MC 3L0OA 1EIHA 2HHHL 2NVXB 2A74C 4ILWA 5CV5A 1SNQA 4BBSG 4QF4A 1N8RC 3WWVA 1SYFA 3HS0C 4RAUC 4YHHQ 3KF6B 3S1NH 5E7NA 5C44B 4A3MG 1S72A 3J80i 3G4SA 3W1BA 4HIOA 4XT1B 5TSSA 4XQJA 3F2CA 5IIFA 2EXDA 4HJ7A 4C3IH 3A54A 3GTOH 4DAMA 1TWFH 1L1OC 3STBD 4UAIA 5EPJA 5GQOA 5LL6X 1FJGL 3VR4A 1II3A 1PFSA 5IOCA 1X56A 4XXEA 1HTPA 2BCOA 3BZKA 4K14A 1BKBA 4MTNA 1L0XB 2MUYA 1DZ1A 1WYDA 3S2DH 2RBMA 2RF4A 5IYCG 2B39A 4ME5A 1VQIA 1QUQA 4HCSA 2JA7B 1RF2D 1LT5D 5M5WB 2NVYB 3I90A 5IP7H 2F0DA 2E5LL 3S2HH 1E3PA 5I4DA 2BE5C 2UXBQ 2QGQA 5CV8A 4PG3A 2R92H 5H1SE 3BDLA 1BBWA 4H02A 5ELOA 2Z4IA 3FMCA 4KKTA 3I8ZA 1EEID 3IL8A 1JJ2A 1GD7A 4DUZL 4X66Q 3T53B 2R61A 4R4QA 2VQFQ 3M4OB 1Z7TA 4KY6A 1LUZA 1WD0A 1QVFA 4ZYSA 3TEHB 4PMCA 2PMZB 1N36Q 3VR2A 1V1OA 5KRUA 3T1HL 3OTOL 1KL9A 2RA4A 3CRKC 2JA6B 2NB0A 1XXGA 4S3SA 3A74A 1NMFA 1JR0D 3VA5A 1DOKA 5IGDA 3OWFA 1WTWA 2KOLA 1TXYA 2VQEL 4K5VA 2RDGA 3MWYW 4RH6A 2JSOA 3NE5B 4CBVA 4JI5Q 4YWKA 1E24A 1SE2A 1TY2A 1I4RA 2NUCA 4C3JB 1E1TA 2EIFA 3DWQA 4HJAA 4O42A 2FXQA 3HOUH 2V1CC 5M3FH 1A0IA 3J81L 1B44D 2BA1A 1SMYC 2F4IA 5M5XH 4L8JA 3K6OA 1BOSA 3S1MB 5IYBG 3E6ZX 3MXNB 5IT9E 3S14H 2CVRA 2PCFB 1JC7A 2MNAA 2XRSD 1EYDA 2QEXA 1K3RA 2BE5D 3UE0A 5BN3A 5CBEE 3I3CA 4K5XA 2KBNA 1MSHA 4LF6L 1WOCA 4U68A 2EPBA 3FRPB 1AN8A 4N9PA 2JYOA 3T56B 4YHHL 4A3FB 4JBMA 3SVMA 5G3LF 1GXDC 3M85A 3NQTA 1GKHA 4HTHA 1YI2A 2OF1A 1TY0A 1IYVA 1HNXL 4C3IG 4PMBA 3HRZC 4I7AA 4AYBB 1Q90A 1NR2A 5IGGA 2ATWA 3JAMc 2E2JH 4CJ0B 1AH9A 1QZHA 3CCUA 2CW0D 4N8X1 4JC0A 3I70A 3RZDH 4DV6Q 3K59A 4R1JA 3PO2B 2HCIA 5EKLA 3DM1A 5EPKA 2Z6KA 1S5FD 2D5DA 1B3AA 1DGSA 1QVCA 2PZWA 5IP7G 5F2DA 5DAUA 5CC4A 1VQPA 2K5QA 1E22A 3EVQA 3M3YB 4IUQA 2QKIC 5BR8L 3FHWA 4KTAA 5HURA 1J6QA 2F0TA 1EYGA 1EY9A 3QIAA 1KAWA 4OHJA 1SMYD 2KVMA 4JBKA 3DM3A 1SNMA 2EZVA 4GLVB 2IPKD 2PZUA 1HPCA 5IWAL 4MHEA 3NEMA 1JWUD 4TQUS 1TR5A 3S17H 2VQFL 1JQYD 1IBML 2F0EA 1L2FA 1Z6HA 4RA8A 1Q1EA 4LUOA 4H13C 1G8ZD 4DGZA 1EEFD 1PTOB 3J7YW 2XN9C 2K50A 2L12A 2Z0SA 4EQ5A 2JA5B 3S15B 1WTRA 3NBHB 3K5LA 3GTKH 1QB5D 4LF8Q 2RHQB 4UP8A 2VL6A 4QJFA 3CHBD 3TZUA 5I9PA 3HOYB 3X3NA 5ELBA 5BN5A 3RN2A 1LM0A 4FXKC 1PH3A 1KIXA 1OXXK 1L0YB 1UE5A 2K7VA 1F2LA 1SFOH 5KIXA 3ER0A 2I46A 5CMDA 2E74C 3A5ZB 4FF2A 3W5OA 4LF4Q 4O1NA 3HOUG 4B3RL 2SNSA 1I94Q 3J80E 1SBBB 4L6TB 3TREA 4JI7Q 1TS5A 3UDFA 3ITPA 3I4MB 5I6YA 4G4KA 2C5CA 4GNXC 3F2UA 1PH6A 5KYLA 4QL5A 1Q81C 1WCMB 1KDBA 3HOXH 5C5LA 4MIUA 1PZID 5EBDA 1JOQA 3BJUA 2EYJA 3UDGA 1VQ6A 3E5SA 3PO3H 2Z9HA 4KY5A 4JK1C 5I2YA 1PLFA 2R6GA 4KN4C 3WOFA 3QO2A 5DEHA 1K0RA 1PZKD 3J7AV 3HEJA 2DUDA 1FGBD 4DPGA 5C6AA 5JVH3 1S5ED 3PF4A 1NUCA 2ICIA 1X54A 5J1ZA 4X64L 3H0GB 4KMUC 1V43A 3QOLA 4DV6L 1H9SA 2QW7A 1HNWQ 4MNOA 2YTYA 1HFNA 3U4ZA 1HUNA 1HTLD 1JOOA 4Z9CB 1CK1A 1HJPA 1X3QA 4BY1H 4CDFC 3CW2C 1OXVA 1AE2A 2LS01 2QF7A 1YITA 3I2ZA 3H3VI 2VS1A 3RZOB 1S3OA 3MZ5A 2SOBA 4GN4B 3C1EA 1PH5A 2K5DA 4TRDA 4C1NI 4A3CG 4FP5D 4KHPL 3CKIB 1X3EA 1HR0Q 4JI2L 1NSNS 4OWXB 2F0SA 2O4XA 3AU7A 3H94A 1VQ5A 3CF5A 4ZUJA 2F0JA 1I4XA 5BN4A 3HOWH 2XVSA 4K2KA 3KBXA 3PUXA 2NBFA 3K7AB 5LMNQ 5M3MH 1C7YA 4RKLA 3BZCA 3H15A 3EBEA 1EQVA 3OOCA 4LWCA 5IODA 1YNNC 4A93G 2YU9B 4LFCQ 3KDFB 1E0BA 1I6HB 2I5HA 2NN6I 4FF3A 2Q8TA 2LXKA 2PMZE 2RVLA 3AQQA 1YIJA 1BQQT 3R2TA 1XPOA 1K9MC 4F8MA 1KLGD 2HUGA 2N8NA 4LFBL 1EY6A 2JA9A 5AJ3L 1IYJB 3K57A 1WTQA 5C0XJ 4ZRZA 1GHKA 1SEBD 5IT9c 2JA7H 1LT3D 2H5XA 1KXLA 5NUCA 2ZXPA 3ND8A 1EUJA 3R93A 3PUWA 1J5EQ 1CM9A 1VQHA 3CP0A 1T5EA 1YEZA 3HOXG 4AH6A 1E1OA 1ET6A 1ZYRC 1C48A 4BWGB 1UE1A 1KDAA 4A3EG 4GKKL 2HDMA 3IRBA 4IN3A 3PF5A 1SMXA 1PHJA 4L5SA 3PO3G 2F0LA 4TSSA 1FR3A 1KD1C 4JI3L 1F2ZA 3I4NB 2UXDQ 1Q86C 3M4OH 1SYGA 1H9KA 2B2WA 2KCCA 1PH1A 4KY7A 3CQZH 3L3OC 1SROA 1SYDA 3ERQA 2B8GA 3SEBA 2YTVA 4LF9Q 4C2MB 1VS0A 4GNXA 2HT1A 3CMAA 1OO9B 1CKOA 1DXMA 5C3EB 3S1RB 1U5KA 4DV2L 4DR1Q 1S5BD 1KAAA 1FNUA 2LXJA 1STBA 3E0EA 1HNWL 1CA5A 1TT2A 1YNND 2IWHA 1XX8A 1JCKB 3Q24A 1O7IA 4XT3B 1AFPA 2YV5A 3TBIB 1PXUA 4BY1G 1HZCA 3UDIA 1MI2A 2K5HA 4K6LA 3GTMB 4DV3L 4DV4L 2UUCQ 1R4QB 2HD3A 4UPAA 1T9HA 4DAYA 1K0SA 1X65A 2RCNA 4ALPA 2F0VA 3E9HA 4HSPA 3ULLA 3VR6A 2Q2IA 4OO1I 3I91A 1NTGA 5CV7A 1U4LA 2F0KA 4U673 4XYQA 1X32A 4PQXA 2UUAQ 1CTMA 2JJQA 4NKLA 4JI8L 3MAQA 1PH9A 4OIKA 1W2BA 4C1NK 2ZXRA 1TVXA 4KI0A 2K75A 2R7ZB 4X62Q 4X3SA 1ZYRD 3BVMA 1RIPA 4FVMA 1STHA 4UHVA 1PTOF 3MVVA 2NWGA 4A3FH 3HOWG 1Y1VB 2K32A 1F2YA 2WAQE 1RCVD 5COYA 3CCRA 2E2HB 5M3MG 1CHQD 1JJGA 4XDXA 4QQBX 4DUYL 2IT1A 3HKZE 2X69A 4DR6Q 3QG1A 3P7JA 2A1AA 3NSWA 5D14A 2VB3X 4HIMA 4LFAL 1X6OA 2C9OA 2F3VA 5FO7B 1LTGD 2RKSA 1AE3A 1VQMA 5JPNC 3PO2H 3OSOA 4EQOA 4QMGA 4Y7NB 3WDNA 1D1KA 1PRTB 4F87A 3A8IE 2JA7G 3D4DA 3KFUA 3CD6A 1N34L 1SSOA 1S5DD 2VNUD 3M3YH 1EU3A 2KEEA 1O80A 4R8IA 1G2SA 1PH8A 5JPMC 4M8AA 1IXRA 4IZ8A 3CCJA 3CPWA 1SRUA 4OIJA 1V9PA 4KN7C 4A3BB 4JV5Q 5JJLA 2QA4A 2OEOA 2NVQH 2E2IB 4JVZA 1BVSA 3NQIA 2K05A 4HIDA 2A69D 4JBJA 3R8BA 5IGEA 1DD2A 4CKBA 3F1ZA 1ML0D 2BDOA 4K6DA 1PTOH 3EIVA 3R3OA 4HN7A 2ZTEA 3W3AA 3S15H 1S40A 3MTSA 4C3HB 2DY7A 1U0LA 1GHJA 5T1GA 3A56A 2KA7A 3OMCA 5JJZA 4TKOB 4OELB 5EGTA 4JPBW 1Q1BA 4JI1L 4B3ML 3IFTA 3ERSX 2UUCL 1DOMA 5A35A 4GLAC 2BH2A 1KC8C 1Q8KA 3SK8A 2XTIA 2K5WA 3H09A 4L5QA 3RLOA 4DV0Q 3I4MH 1IBKQ 2N55A 1Q46A 3LX0A 1YJWA 1LTRD 2WB1E 5C4ZA 5KNBA 1VQCA 1STYA 3EFXD 2R7DA 1YNXA 4DR2L 1RJTA 2AWOA 2A73B 4A3FG 4NXMQ 1F77A 1HNZL 2PZTA 3RR5A 5IY0A 1SAPA 5M5YB 5E3FA 2B2VC 3K81C 1STNA 4UP7A 4AYBG 3MA2B 5KGUA 1GUWA 4YCUA 5M9OA 2Z6KC 5JEAJ 1EZ6A 1SE4A 3TRZA 1QCBD 4GLXA 1YJNA 4NPSA 4DV7L 1XTCD 3H0GH 4A3IH 1YBYA 3PO2G 1K8GA 1LTLA 2DGYA 3CXCA 5CGKA 2F3WA 3P20A 1X3FA 1K83B 1ZEQX 2F0OA 2XGTA 1CQFA 3PV0A 3H6MA 3J81j 2B63B 4DR3L 2A6EC 1L1OB 2KECA 3BDCA 4HAEA 3SR1A 2K1BA 4A75A 2WAQG 2CH4A 1NCVA 2SDFA 3GTPB 3PIP3 1Q8IA 4AIMA 2F0HA 3OWEB 3A5UA 3QWNA 5A2QE 3HKZG 2NZ1D 1S5CD 4PNYA 4BBRH 1FVIA 3VDYA 1F9QA 1CUKA 2AUJD 3D8GA 4OL7A 5FOBB 3HZXA 2JA5G 1PFNA 2B2YC 4CGYB 3GTLH 3IAYA 3U4VA 2PNHA 3HOVB 4L63B 4QB4A 2AMCB 1TWGB 3RMHA 5JEAH 2F0IA 2YU9H 1IBLL 3GTJB 4IFDH 4BY7B 2PW5A 3T51B 3D6CA 3EROA 4BS9A 2R93B 3V96A 2LMCB 1YNJC 4DK0A 5D65A 4IPGA 3K58A 4B08A 1PH7A 2NVTB 3K5NA 3I4MG 3E9IA 2Q8IB 2CFMA 4Q5VA 4EQPA 4DV0L 1I4PA 2R7FA 2X6GA 3RLNA 2MPMA 3GO5A 4AQYQ 1Y8OB 1EYCA 2GVBA 4JYAL 5CBAE 1HXYD 4A3GH 3ULJA 4Y52H 5C4XB 1UE7A 2CQOA 2HQLA 4WJWA 1K8OA 2ENBA 4G7ZC 1QVGA 3EJIA 4X3TA 5GAHC 1WI5A 2F0UA 3DUZA 1B70B 3M4QA 2G9HD 4QCLA 5FLXE 1HZBA 1SNOA 3T16A 3UDXA 1PVOA 1JB3A 1ZKOA 1R9TB 4A3DH 1EY5A 1HFGA 3H0GG 4A3IG 3S1RH 4A3JB 3W2DA 4DV5Q 2J0TD 3JAML 1PRTF 4A3KB 1Q7YC 4JI0Q 1EU4A 2WB1G 4KKSA 1WVLA 4ZAIA 3S1QB 1EFWA 2JN4A 4R4CA 1OXSC 1IL8A 4RGTA 3D31A 2RSNA 3E3XA 1QE6A 1TS4A 1PFMA 2DNCA 2B2VA 1YNJD 1C9OA 3LGJA 3HOZB 3SHLA 2I0QA 2XNAC 4QIWE 2JE6I 1C0AA 3FEWX 3ICEA 2AQ1B 3CPFA 3GTQB 5JAVA 1VQAA 2KCMA 4BBSB 1IYUA 2EJGC 3VYTA 1LACA 4BBRG 1X3GA 1QNKA 5EBCA 2PQAA 2R7ZH 4DR5Q 2KEDA 1HQRD 4R4OA 2UXBL 1NMGA 3A55A 1JE4A 1VQDA 1Y1VH 4OO1G 3CC4A 1SNCA 4IURA 1Y1WB 1ENAA 1BDOA 1O7YA 2E2HH 5E4WC 4JCVE 4A3CH 5JEAG 4X66L 1HRJA 4PZ8A 2RDFA 2EY1A 5ELCA 1EY8A 3OIPA 4IFDG 1VQNA 1ZXTA 1C8CA 3UE1A 1DCZA 2ZXOA 1HUMA
chains in the Genus database with same CATH topology
4M1UB 1MSGA 1U4RA 1PYWD 1TWCB 3OMGA 4G7OC 3ND9A 3P1HA 4KHZA 3MXUA 2F0GA 2Z4HA 2B2YA 3OW7A 2DN8A 1ONLA 3N6RA 5FO8B 1T5XD 3QB3A 2B2WC 3G7LA 5C0XI 3SXHA 3PIO3 1IKLA 2JEBI 3M7NA 4IALA 4DA2A 1SJED 1CQVA 3NTIA 2IW3A 1I3QB 4IUPA 4ZUIA 2Y0SB 1UAPA 5DNFA 2HDLA 1A3VA 2EVBA 2O5IC 5E4XA 2NTSA 3R2IA 1CI3M 3RUZA 3TSSA 3EA6A 4IUNA 3D6WA 1B4OA 4E6IA 1D6EC 1OXUA 1EZ8A 3LNNA 4CJ1B 2EY6A 3TDQA 4RGNA 4KD3A 2H1EA 4XIGS 3S9WA 1LTID 4C3IB 3GTOB 1U4MA 2A5HA 2L11A 2PNRC 2QCPX 1F2MA 2D9UA 5ELFA 5C3XA 4ZLTF 1BUVT 1SYBA 4ODGA 3S2DB 4KJOA 3D4RA 4MN3A 1TQOA 3UI2A 2JA8B 4ID6A 1BNZA 5C3WA 2MP1A 1VMCA 1MD2D 4H44C 4DAPA 1ESRA 1TWHB 2K01A 2VB2X 5JOBA 2TSSA 3S2HB 3PMFA 2L9HA 1JWSD 1STEA 1LTAD 5I2XA 5CV6A 2R92B 5IT9L 3DWPA 1A15A 3I72A 4H0LC 4DNRB 4ZK9B 3EQLC 2EE1A 1B9NA 5EPLA 3V05A 1EIGA 4XQQA 3BVZA 4G57A 4DN4M 1A2UA 1ESFA 4C3HG 1VDZA 2WP8J 2EJFC 3OIQA 1PMRA 2OXPA 3BYYB 5IGFA 1PDQA 2Z1CA 3KF8A 5KYIA 1G6ZA 2WKCA 1MGSA 3HOUB 5M3FB 2F0MA 4R8NA 3GV3A 1JICA 1Q12A 1BXTA 4ABNA 5CV4A 3DXJC 3Q22A 2XIWA 4H7BA 2AUKA 1VF5C 1V1PA 2FJ2A 1DYQA 1G2TA 1BCPC 3NTHA 3KUPA 2JXMB 3HP3A 3FPPA 2EYFA 2ZT9C 3FDTA 4RCNA 4NDXA 1RD9D 1GOZA 4OGQC 5K36H 3D4WA 3KLSA 4K8JA 2E2JB 4DU9A 5JVG3 4BA1I 3E0JA 5CV9A 3OPOA 3L9AX 3WOEA 4DK1A 3RZDB 1K8MA 2N88A 4X3UA 1D5ZC 3C46A 3FKIB 1KABA 1WD1A 2G9DA 2FMMA 1ICWA 3J80L 3KLSX 3TMEA 2KHSA 4RGMA 1I6VC 1GUNA 2EYPA 1TS3A 3VYSA 3PUYA 1O7ZA 4LAAA 3U9OA 1IW7C 3J81E 3S17B 2EDGA 1SNPA 2F0NA 3TP7A 1BCPD 1EY7A 1S4ZA 2RDHA 4K8IA 1D5XC 1LLRD 3NPPA 4PMWA 5EKKA 1JWMD 2EY5A 2KUMA 1CT1D 3TZDA 1SDFA 4WRDA 2Q8RE 3TP8A 4HEDA 1PZJD 1RODA 1SFOB 3P75A 2EOTA 4F7XA 3NXWA 5CYUA 1W6JA 5KNDA 4EQNA 3KLRA 4ZKCB 2L1BA 1TS2A 4DAVA 1ENCA 3HOXB 1QJOA 1KTKA 4C3JG 2B2UC 1X3PA 3V2TA 1EL0A 4QUCA 1IW7D 2NN6H 1B2TA 5K36G 3QOJA 5G3LD 1ILPA 3K0YA 1U4PA 4HR7B 4XQNA 1HA6A 3RD4A 4UDUC 1E2WA 3A7LA 4YIJA 4HMIA 3BYTB 3U9SA 3ONAB 3O13A 1JORA 1SYEA 5I6WA 1TWAB 4IFDJ 2B2TC 1AZPA 4HCEA 2MHVA 1AEXA 2A68C 1GUOA 3NUCA 1OXTA 4FF1A 2F03A 4K2LA 1RKNA 3A8JE 5AFWA 3L7ZC 3HOWB 1STAA 5IGCA 2TMPA 3NWSA 5M3MB 3M4YA 1DM0B 2VUMB 1EY4A 2IX1A 2ICEC 1LT6D 2DY8A 2SNMA 1IKMA 5T1IA 2F0WA 3KK7A 2EXZA 2E2DC 4RGOS 1LT4D 4OO1H 1NAPA 1HQMC 5ISRA 5ELEA 1CHPD 3Q0AA 5LL6S 1GUSA 4NW2A 1EY0A 5K5PA 1E2ZA 4XYOA 2A68D 4J6HA 1EWHA 3G6JB 1BCPF 3K5OA 3Q6SA 4CKEA 2IX3A 2NN6G 1UNSA 1EFID 5C4JB 4BA2I 2V4DA 3CQZB 3D3RA 1QWYA 2EY2A 2A6ED 1H9RA 2CW0C 5E1FA 4GZYC 4X3KA 5J22A 3NP8A 1Q3LA 1D2BA 5HGTA 3NWTA 1TIID 4IUTA 2JP1A 2ID0A 2B2UA 4CJ2C 4ZKBB 2BOSA 2FMCA 2XWJB 1CA6A 2LKVA 4FO2A 1F9SA 5C4HA 1H9SB 3IKJA 1Y8PB 2RSOA 1KLUD 2MGSA 3AB9A 4RCOA 2B8FA 4V0BA 1FD7D 1GUTA 2OT2A 3IFDA 4RWSC 2PW7A 2K04A 3PUVA 1JOKA 3A8KE 5CORA 3LWEA 5DM63 1FNVA 1A6XA 2IJ0A 2B2TA 4EVOA 1H9JA 3VYRA 2EYOA 4FYDA 1B53A 4A3MB 4G7HC 3VYUA 2EYMA 4DXGA 5LHY1 3QJYA 2XSCA 5J39A 1LO5D 1EOTA 1MBYA 4RFBA 1BBXC 2XWBB 1I4GA 1BR9A 5D3DA 4Q0FA 1WTOA 3DEPA 2WAQB 2X6LA 2IL8A 2VXWA 3H3VC 1B50A 2PO4A 4LJZC 1DOLA 2QILA 3GTGB 2NVQB 1PTOC 3HKZB 1TKWB 3I73A 1SXTA 3C1FA 4WORA 1CFMA 1F9RA 1EYAA 1M8AA 3MXGA 2AQ3B 4HSVA 3GQBA 1TU2B 2KJXA 1CZWA 1LABA 2QEJC 3BS1A 3GP7A 2LFNA 1ET9A 4LK1C 1W6KA 4CHTB 1BO0A 2WINB 2WIIB 3I4LA 4LMQD 2F0QA 2E75C 1EQTA 2HCCA 3NTKA 1O7LA 2EYHA 1R4PB 1VF7A 1J9OA 1V1PB 3NHHA 3MHBA 3Q23A 3URYA 3MC0B 4KHVA 3BG3A 3SK6A 5A2QL 1A3UA 1PTOD 3DWAA 1RDPD 3MXNA 4B9XA 2EJMA 3X3MA 2WV6D 2F0PA 3RLFA 3SK4A 1QNUA 3MXPA 3S1NB 1WTXA 5KNCA 4A3IB 4P2CB 1ENFA 2GA4B 3DMUA 1DJRD 4RHRA 1TWFB 1XYIA 2WB1B 1AW7A 1ILQA 3TP5A 1Y8NB 1F9PA 2Z8LA 5EJWA 1HA5A 4NP5A 1SJHD 1U9RA 2AWNA 1D1IA 1LTBD 5I9OA 2L55A 3SK5A 4F88A 1A3TA 2H4OA 4DNTB 1J8IA 2D2CC 2LY7A 4BBRB 2M9VA 1M4VA 1HCZA 5EKIA 3GD7A 5FLXL 3GTLB 2SEBD 2FFKB 2KQ3A 1SYCA 5CR3A 2J4XA 4KD4A 2AQ2B 2XRQD 4J1MA 3T13A 4DXFA 4WFN3 2PYKA 4I7ZC 1A2TA 1AZQA 1STGA 3NBHA 4PV1C 3C3LA 2EYLA 1CZGA 3LWUA 1KNAA 4RKBA 1G91A 3GV6A 4A3GB 4N9TA 4FXDA 1B1ZA 3SE0A 4KK7A 1V8QA 3VA7A 1IHZA 2K6AA 5M5XB 4DFAA 1WTPA 1KDCA 1QG7A 4J8QA 5C5MA 1O78A 5KEEA 1EWCA 3S14B 3M7GA 1C4QA 1KNEA 4IQZA 3K5MA 1QILA 3DHQA 4A3DB 1RTNA 4FXGC 5IGBA 3BZDB 1FYCA 1SNDA 1BCPB 2I07B 2D62A 1AP0A 2DNEA 3VR3A 1UUPA 2CQAA 2WKDA 3T4AC 3CRLC 2CHBD 4B9WA 1RTOA 5C0XH 4EGVA 1RHPA 4IUVA 5FK9C 3SDZA 1LV9A 4ZQ3A 3TN2A 2J7ZA 3ZYYX 1GUGA 1G291 4I65A 5ELDA 3TP6A 1I4QA 2NYZD 4HMJA 1LTTD 2R3ZA 4K5WA 2YYZA 2A69C 4IFDI 2HQEA 2BDNA 3VR5A 2A6HC 5D3IB 3MEHA 3PUZA 2K28A 2F1MA 3OHXC 2WACA 2FHTA 1UEAB 4RHSA 3MFYA 5EQ0A 3KBGA 4KKUA 2FINB 2L0CA 1GJXA 2L5TA 5DM73 1PFBA 3CU7A 1PRTC 2JEAI 3GTKB 4QIWB 2M2LA 1VMPA 3NBIA 4A93B 3FPUB 3S16B 2KCNA 3BVGA 2NTTA 3H91A 4QUFA 3JAME 4IUUA 2O5JC 4XTCS 2M00A 4CKCA 3BDOA 2QDBA 4KJNA 5FO9B 2BA0A 1H9MA 1SE3A 1DONA 1WTVA 2O2LD 2E76C 4ULLA 1Z47A 2A6HD 2K33A 1HHVA 4A3EB 1BF4A 1VCIA 2MJ8A 4R9WA 3C2PA 3PO3B 3HG9A 3FVQA 3N52A 2PQEA 2PPBC 1B9MA 4C56C 1XWEA 3NK9A 3HGBA 2IX0A 1NR4A 1PRTD 4KV6A 5FKAC 1LTSD 5C0XG 3A7AB 3DEOA 2K03A 3J7AF 1QOHA 2L4NA 1I50B 4JBWA 1Y69U 1E2VA 4NMZA 4BY1B 3AMUA 4FF4A 1FNWA 4FNFA 2RQXA 1I4HA 2F0FA 4V190 3MFGA 4DF7A 1D5MC 1EIHA 2NVXB 2A74C 4ILWA 5CV5A 1SNQA 4QF4A 1SYFA 3HS0C 4RAUC 5C44B 4XT1B 5TSSA 4XQJA 5IIFA 3A54A 4UAIA 5EPJA 5LL6X 3VR4A 1II3A 5IOCA 4XXEA 1HTPA 2BCOA 4K14A 1DZ1A 1L0XB 2MUYA 2RBMA 2B39A 4ME5A 4HCSA 2JA7B 1RF2D 1LT5D 5M5WB 2NVYB 3I90A 2F0DA 5I4DA 2BE5C 5CV8A 3BDLA 2Z4IA 3FMCA 4KKTA 3I8ZA 1EEID 3IL8A 3T53B 2R61A 3M4OB 1Z7TA 4KY6A 1WD0A 4ZYSA 4PMCA 2PMZB 3VR2A 1V1OA 5KRUA 2RA4A 3CRKC 2JA6B 2NB0A 1XXGA 4S3SA 1JR0D 3VA5A 1DOKA 5IGDA 3OWFA 1WTWA 2KOLA 4K5VA 2RDGA 3MWYW 4RH6A 2JSOA 3NE5B 4CBVA 1SE2A 1TY2A 1I4RA 2NUCA 4C3JB 3DWQA 4O42A 3J81L 1B44D 2BA1A 1SMYC 2F4IA 4L8JA 3K6OA 1BOSA 3S1MB 3E6ZX 5IT9E 2CVRA 2PCFB 1JC7A 2XRSD 1EYDA 2BE5D 5BN3A 5CBEE 3I3CA 4K5XA 1MSHA 4U68A 2EPBA 3FRPB 1AN8A 4N9PA 2JYOA 3T56B 4A3FB 3SVMA 5G3LF 1GXDC 3M85A 3NQTA 4HTHA 2OF1A 1TY0A 1IYVA 4C3IG 4PMBA 3HRZC 4AYBB 1Q90A 1NR2A 5IGGA 4CJ0B 2CW0D 3I70A 3K59A 3PO2B 2HCIA 5EKLA 3DM1A 5EPKA 1S5FD 2D5DA 1B3AA 2PZWA 5F2DA 5DAUA 5CC4A 2K5QA 3EVQA 3M3YB 4IUQA 2QKIC 4KTAA 5HURA 2F0TA 1EY9A 3QIAA 4OHJA 1SMYD 2KVMA 1SNMA 2EZVA 2IPKD 2PZUA 1HPCA 4MHEA 1JWUD 4TQUS 1TR5A 1JQYD 2F0EA 4RA8A 1Z6HA 1Q1EA 4H13C 1G8ZD 4DGZA 1EEFD 1PTOB 3J7YW 2XN9C 2L12A 2JA5B 3S15B 1WTRA 3K5LA 1QB5D 3TZUA 5I9PA 3CHBD 3HOYB 3X3NA 5ELBA 5BN5A 4FXKC 1OXXK 1L0YB 2K7VA 1F2LA 5KIXA 2I46A 5CMDA 2E74C 4FF2A 4O1NA 2SNSA 3J80E 1SBBB 4L6TB 1TS5A 3ITPA 3I4MB 5I6YA 4G4KA 2C5CA 3F2UA 5KYLA 1WCMB 1KDBA 5C5LA 4MIUA 1PZID 5EBDA 1JOQA 2EYJA 3E5SA 4KY5A 4JK1C 5I2YA 1PLFA 2R6GA 4KN4C 3WOFA 3QO2A 5DEHA 1PZKD 3J7AV 3HEJA 1FGBD 5C6AA 5JVH3 1S5ED 1NUCA 2ICIA 5J1ZA 3H0GB 4KMUC 1V43A 3QOLA 1H9SA 1HFNA 1HUNA 1HTLD 1JOOA 4Z9CB 1CK1A 1X3QA 1OXVA 2LS01 2QF7A 3RZOB 3MZ5A 2SOBA 3C1EA 2K5DA 4TRDA 4C1NI 4FP5D 3CKIB 1NSNS 2F0SA 2O4XA 3AU7A 3H94A 4ZUJA 2F0JA 1I4XA 5BN4A 2XVSA 4K2KA 3KBXA 3PUXA 2NBFA 3K7AB 4RKLA 1EQVA 3OOCA 5IODA 1YNNC 2YU9B 1E0BA 1I6HB 2NN6I 4FF3A 2Q8TA 2RVLA 1BQQT 3R2TA 4F8MA 1KLGD 2HUGA 1EY6A 3K57A 1WTQA 5C0XJ 4ZRZA 1GHKA 1SEBD 1LT3D 5NUCA 2ZXPA 3ND8A 3R93A 3PUWA 1CM9A 1T5EA 1ET6A 1ZYRC 1C48A 4BWGB 1KDAA 2HDMA 4IN3A 2F0LA 4TSSA 1FR3A 1F2ZA 3I4NB 1SYGA 1H9KA 2B2WA 2KCCA 4KY7A 3L3OC 1SYDA 3ERQA 2B8GA 3SEBA 4C2MB 1OO9B 1DXMA 5C3EB 3S1RB 1S5BD 1KAAA 1FNUA 1STBA 1CA5A 1TT2A 1YNND 2IWHA 1XX8A 1JCKB 3Q24A 4XT3B 1AFPA 3TBIB 1PXUA 1MI2A 4K6LA 3GTMB 1R4QB 4DAYA 2F0VA 4HSPA 3VR6A 4OO1I 3I91A 5CV7A 1U4LA 2F0KA 4U673 4XYQA 1X32A 4PQXA 1CTMA 4NKLA 3MAQA 4OIKA 4C1NK 2ZXRA 1TVXA 4KI0A 2R7ZB 4X3SA 1ZYRD 3BVMA 4FVMA 1STHA 1PTOF 3MVVA 2NWGA 1Y1VB 2K32A 1F2YA 1RCVD 5COYA 2E2HB 1CHQD 4XDXA 2IT1A 2X69A 3QG1A 3P7JA 3NSWA 5D14A 2VB3X 2C9OA 2F3VA 5FO7B 1LTGD 2RKSA 5JPNC 3OSOA 4EQOA 4QMGA 4Y7NB 3WDNA 1D1KA 1PRTB 4F87A 3A8IE 3D4DA 1SSOA 1S5DD 2VNUD 1EU3A 2KEEA 1O80A 4R8IA 1G2SA 5JPMC 4M8AA 4IZ8A 4OIJA 4KN7C 4A3BB 2OEOA 2E2IB 3NQIA 2K05A 2A69D 3R8BA 1DD2A 5IGEA 4CKBA 1ML0D 2BDOA 4K6DA 1PTOH 3R3OA 4HN7A 3W3AA 3MTSA 4C3HB 2DY7A 1GHJA 5T1GA 3A56A 2KA7A 3OMCA 5JJZA 4TKOB 5EGTA 1Q1BA 3IFTA 1DOMA 5A35A 3SK8A 2K5WA 3H09A 2N55A 3LX0A 1LTRD 5C4ZA 5KNBA 1STYA 3EFXD 1RJTA 2AWOA 2A73B 1F77A 2PZTA 1SAPA 5M5YB 5E3FA 2B2VC 1STNA 3MA2B 5KGUA 1GUWA 5M9OA 5JEAJ 1EZ6A 1SE4A 1QCBD 1XTCD 5CGKA 2F3WA 3P20A 1K83B 1ZEQX 2F0OA 1CQFA 3PV0A 3H6MA 2B63B 2A6EC 2KECA 3BDCA 4HAEA 3SR1A 2K1BA 1NCVA 2SDFA 3GTPB 3PIP3 1Q8IA 2F0HA 3OWEB 3QWNA 5A2QE 2NZ1D 1S5CD 4PNYA 1F9QA 2AUJD 3D8GA 4OL7A 5FOBB 3HZXA 1PFNA 2B2YC 4CGYB 3IAYA 3HOVB 4L63B 4QB4A 1TWGB 3RMHA 5JEAH 2F0IA 3GTJB 4IFDH 4BY7B 2PW5A 3T51B 3D6CA 3EROA 4BS9A 2R93B 3V96A 2LMCB 1YNJC 4DK0A 5D65A 3K58A 2NVTB 4B08A 3K5NA 2Q8IB 4Q5VA 4EQPA 1I4PA 2X6GA 2MPMA 3GO5A 1Y8OB 1EYCA 5CBAE 1HXYD 5C4XB 4WJWA 1K8OA 2ENBA 4G7ZC 3EJIA 4X3TA 2F0UA 3DUZA 4QCLA 2G9HD 5FLXE 1SNOA 3T16A 1JB3A 1ZKOA 1R9TB 1EY5A 1HFGA 4A3JB 3W2DA 2J0TD 3JAML 1PRTF 4A3KB 1EU4A 4KKSA 1WVLA 4ZAIA 3S1QB 1OXSC 1IL8A 4RGTA 3D31A 2RSNA 1QE6A 1TS4A 1PFMA 2DNCA 2B2VA 1YNJD 3HOZB 3SHLA 2XNAC 2JE6I 3FEWX 2AQ1B 3GTQB 5JAVA 4BBSB 1IYUA 2EJGC 3VYTA 1LACA 5EBCA 1QNKA 2KEDA 1HQRD 3A55A 1JE4A 4OO1G 1SNCA 4IURA 1Y1WB 1ENAA 1BDOA 1O7YA 5E4WC 5JEAG 1HRJA 2RDFA 2EY1A 5ELCA 1EY8A 3OIPA 4IFDG 1ZXTA 1C8CA 1DCZA 2ZXOA 1HUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STY A;  2SNS A;  4EQP A;  2EYF A;  4EVO A;  1EYD A;  1A3U A;  1ENC A;  1F2M A;  1IHZ A;  3ITP A;  5ISR A;  1EYC A;  2EYO A;  4NDX A;  5I6Y A;  4B9X A;  3OMG A;  5C3X A;  4F8M A;  4K5X A;  4DFA A;  2EYM A;  5IIF A;  5KYL A;  1EY6 A;  1KDC A;  2PZT A;  3P1H A;  5C5M A;  3D4W A;  1SYB A;  2M00 A;  4N9P A;  1EY0 A;  3V2T A;  4ODG A;  2F0P A;  1KDB A;  2F0G A;  4KJO A;  5K5P A;  5KEE A;  5E3F A;  4K8J A;  3SK4 A;  2QDB A;  1TQO A;  4KJN A;  2ENB A;  3MXP A;  5C5L A;  3NQT A;  4HTH A;  5J39 A;  1II3 A;  1STN A;  2F3V A;  2OF1 A;  3EJI A;  4ID6 A;  4DU9 A;  5IOC A;  4MIU A;  5NUC A;  5C3W A;  4J6H A;  5KGU A;  2F0U A;  5CV9 A;  4PMB A;  2RKS A;  4K14 A;  3QOJ A;  3DMU A;  3DHQ A;  5M9O A;  1JOQ A;  3OSO A;  4EQO A;  1EZ6 A;  4QMG A;  2RBM A;  5JOB A;  2EYJ A;  5IGB A;  3QB3 A;  1SNO A;  3E5S A;  3PMF A;  3T16 A;  5IGG A;  3D4D A;  1SND A;  4ME5 A;  4KY5 A;  3SXH A;  3TP5 A;  1KDA A;  3S9W A;  1KAB A;  5CV6 A;  4IAL A;  5CGK A;  5DEH A;  2F0D A;  4NP5 A;  2EY2 A;  1EY5 A;  2F3W A;  3HEJ A;  4YIJ A;  4HMI A;  5EKL A;  2F0L A;  5C6A A;  2F0O A;  5E1F A;  1F2Z A;  3TME A;  1NUC A;  1U9R A;  2KHS A;  3C1F A;  3H6M A;  4WOR A;  1SYG A;  5J1Z A;  1JOR A;  1EYA A;  2PZW A;  4IZ8 A;  4B9W A;  5F2D A;  3NP8 A;  4KY7 A;  5CV8 A;  5DAU A;  5CC4 A;  2EYP A;  5J22 A;  3BDL A;  1SYD A;  1SYE A;  2PQE A;  3BDC A;  3ERQ A;  3EVQ A;  3QOL A;  3SK5 A;  5HGT A;  5I6W A;  4LAA A;  2OEO A;  3SR1 A;  1A3T A;  4ZUI A;  4G57 A;  3U9O A;  4KTA A;  3NK9 A;  4ZQ3 A;  5HUR A;  2F0T A;  1JOO A;  4KV6 A;  1AEX A;  1EY9 A;  4I65 A;  5IGE A;  1A2U A;  1KAA A;  4KY6 A;  1A3V A;  1SNP A;  2F0N A;  2F0H A;  3TP7 A;  1STB A;  3TP6 A;  3NUC A;  4HMJ A;  4K6D A;  1EY7 A;  1SNM A;  1TT2 A;  4PMC A;  3SHL A;  5I9O A;  2LKV A;  2PZU A;  3R3O A;  4K2L A;  4K8I A;  2KQ3 A;  3MZ5 A;  2SOB A;  4K5W A;  5KRU A;  1TR5 A;  1SYC A;  2OXP A;  4PNY A;  5CR3 A;  5EKK A;  3RUZ A;  5C4H A;  4KD4 A;  5IGF A;  2HQE A;  3D8G A;  4OL7 A;  2F0E A;  2F0Q A;  3C1E A;  2EY5 A;  4NMZ A;  3OMC A;  1RKN A;  4J1M A;  3HZX A;  4TRD A;  3T13 A;  5JAV A;  4IUN A;  4S3S A;  5KYI A;  5EGT A;  4DGZ A;  3MEH A;  3VA5 A;  4E6I A;  5IGD A;  1STA A;  4WRD A;  1EZ8 A;  3OWF A;  2EYH A;  3TP8 A;  2WAC A;  5IGC A;  4QB4 A;  2F0V A;  1NSN S;  2PYK A;  2F0S A;  4K5V A;  2F0M A;  4R8N A;  2O4X A;  1A2T A;  5CV7 A;  3P75 A;  2F0K A;  2F0I A;  2F0F A;  4F7X A;  3NHH A;  5I9P A;  2PW7 A;  4NKL A;  3MHB A;  4ZUJ A;  2F0J A;  2EY6 A;  1SNC A;  2NUC A;  1JOK A;  2PW5 A;  1ENA A;  5CV4 A;  3NXW A;  4DF7 A;  1STG A;  4K2K A;  1EY4 A;  3SK8 A;  3D6C A;  2EYL A;  4H7B A;  3ERO A;  4KHV A;  3LX0 A;  4KD3 A;  2RDF A;  4RKL A;  2EY1 A;  5KIX A;  1EY8 A;  1STH A;  2SNM A;  4RKB A;  1SNQ A;  1EQV A;  3MVV A;  2F0W A;  5CV5 A;  3SK6 A;  4EQN A;  5C4Z A;  4N9T A;  5IOD A;  4QF4 A;  2EXZ A;  1F2Y A;  1SYF A; 
#chains in the Genus database with same CATH topology
 1XMO Q;  2LSS A;  3K80 C;  4M1U B;  1JT8 A;  1MSG A;  1U4R A;  1PYW D;  1TWC B;  3OMG A;  4POG A;  4G7O C;  3ND9 A;  3P1H A;  4KHZ A;  3MXU A;  2F0G A;  2Z4H A;  1CKN B;  4HJ5 A;  4A93 H;  4RMF A;  3BU2 A;  3S16 H;  2B2Y A;  2PI2 E;  1N33 Q;  2CWP A;  3OW7 A;  2DN8 A;  1ONL A;  4A3G G;  1GVP A;  4JI5 L;  3N6R A;  5FO8 B;  1T5X D;  3QB3 A;  2B2W C;  2BH8 A;  3G7L A;  4POF A;  5C0X I;  2MO0 A;  3SXH A;  3PIO 3;  1IKL A;  2JEB I;  3M7N A;  2E8G A;  4IAL A;  2B3G A;  3I4N G;  3HKS A;  4DA2 A;  1SJE D;  1CQV A;  3NTI A;  4GNX B;  2IW3 A;  4WJ4 A;  4CDC C;  4A3D G;  1I3Q B;  4IUP A;  2WFW A;  3B6Y A;  4A3E H;  1N36 L;  1M90 C;  4ZUI A;  2Y0S B;  1UAP A;  1HH2 P;  5DNF A;  2HDL A;  4DV5 L;  1NNX A;  1E7Z A;  1K28 A;  1A3V A;  2EVB A;  3J81 i;  2O5I C;  1GO3 E;  5E4X A;  2F4V Q;  2NTS A;  3R2I A;  2UU9 Q;  2UUB Q;  1IL2 A;  1CI3 M;  2AHO B;  2ZTD A;  3RUZ A;  2HIX A;  3TSS A;  3EA6 A;  3SGI A;  4OWT B;  4A3L H;  4IUN A;  1VQF A;  2VY3 A;  3D6W A;  3M4P A;  2K5V A;  1B4O A;  4E6I A;  1D6E C;  1OXU A;  1EZ8 A;  4JW0 A;  1I50 H;  3LNN A;  1D7Q A;  3F8T A;  4CJ1 B;  1PH2 A;  3G6E A;  5FJ8 G;  4B3T Q;  4YY3 Q;  2EY6 A;  2R7Z G;  3TDQ A;  4K0K Q;  1XNQ Q;  1WFQ A;  4RGN A;  1Y1V G;  4KD3 A;  2H1E A;  4XIG S;  3S9W A;  1LTI D;  1PYS B;  5M5Y H;  4C3I B;  3GTO B;  1U4M A;  4ZCK A;  2A5H A;  2L11 A;  2PNR C;  2QCP X;  1WJJ A;  1F2M A;  2NVX H;  2D9U A;  5ELF A;  1VQJ A;  5C3X A;  4QGU A;  4ZLT F;  1BUV T;  1SYB A;  4ODG A;  3S2D B;  4KJO A;  3D4R A;  4MN3 A;  5C44 H;  1M1K C;  1TQO A;  3UI2 A;  2JA8 B;  4LF7 Q;  2UXC Q;  4ID6 A;  4PZ7 A;  5HGQ A;  1BNZ A;  4LF8 L;  5C3W A;  2MP1 A;  4KLK A;  1SE8 A;  1B8A A;  1MD2 D;  1VMC A;  4H44 C;  2MFI A;  2KEN A;  4DAP A;  1ESR A;  1TWH B;  2K01 A;  2VB2 X;  3CAM A;  5JOB A;  2TSS A;  4P74 A;  3S2H B;  3PMF A;  2L9H A;  1JWS D;  1STE A;  1LTA D;  2HIV A;  5I2X A;  5CV6 A;  2R92 B;  5IT9 L;  3DWP A;  1A15 A;  3I72 A;  4H0L C;  3U50 C;  4DNR B;  4LF4 L;  4ZK9 B;  3EQL C;  2EE1 A;  1B9N A;  2ZM6 Q;  1I94 L;  2ALY B;  4JI7 L;  5FLX c;  5M5W H;  2VW9 A;  2NVY H;  3NEL A;  4DK3 C;  4LF5 Q;  4P71 A;  5EPL A;  3V05 A;  2D0O A;  1EIG A;  4XQQ A;  3BVZ A;  4G57 A;  4DN4 M;  2OWO A;  3CCS A;  4GOP C;  1A2U A;  1ESF A;  2Q2T A;  3PIP A;  4C3H G;  4GN5 A;  1VDZ A;  2WP8 J;  2EJF C;  3OIQ A;  1Z9F A;  2D0P A;  1PMR A;  2OXP A;  3BYY B;  5IGF A;  1PDQ A;  2KHJ A;  2Z1C A;  3KF8 A;  4IJH A;  2F4V L;  5KYI A;  1JE5 A;  1G6Z A;  2WKC A;  1ICF B;  1MGS A;  5FLM G;  3HOU B;  2R93 H;  5M3F B;  2F0M A;  4R8N A;  3PGZ A;  2JA6 H;  4A3L G;  3GV3 A;  1JIC A;  2NVT H;  1Q12 A;  1CKM A;  2ZJR A;  1BXT A;  4ABN A;  5CV4 A;  3DXJ C;  3Q22 A;  1EQQ A;  2XIW A;  4H7B A;  2AUK A;  4AYB E;  1VF5 C;  1V1P A;  2FJ2 A;  2N78 A;  1DYQ A;  1G2T A;  1BCP C;  3NTH A;  3KUP A;  5L37 A;  2JXM B;  3HP3 A;  4C3J H;  5C4X H;  3FPP A;  4JI4 Q;  2EYF A;  2ZT9 C;  4NXN Q;  3FDT A;  4RCN A;  2ZJQ A;  2K14 A;  4DR4 Q;  4NDX A;  3S1M H;  3GDE A;  1RD9 D;  1GOZ A;  3FP9 A;  4OGQ C;  5K36 H;  1B7Y B;  3D4W A;  2A19 A;  3KLS A;  4GKJ Q;  4K8J A;  1P8L A;  1HR0 L;  3OW2 A;  2E2J B;  4DU9 A;  5JVG 3;  1XNR Q;  4BA1 I;  3E0J A;  5CV9 A;  3OPO A;  3L9A X;  1L0W A;  3WOE A;  4NB3 A;  5C44 G;  4DK1 A;  3RZD B;  4IPD A;  4JI6 Q;  1K8M A;  3G48 A;  5LMN L;  2N88 A;  4X3U A;  1D5Z C;  3C46 A;  3FKI B;  1KAB A;  1WD1 A;  2G9D A;  2FMM A;  4LFC L;  1ICW A;  3J80 L;  3KLS X;  1YZ6 A;  2B63 G;  3TME A;  2KHS A;  1YVC A;  4RGM A;  1I6V C;  1GUN A;  1GM5 A;  2EYP A;  1TS3 A;  4EX5 A;  3J80 c;  1QUQ B;  3VYS A;  3PUY A;  1O7Z A;  4LAA A;  4DV1 Q;  2B29 A;  2C35 B;  3U9O A;  1X55 A;  1IW7 C;  3J81 E;  1ASZ A;  2HHH Q;  2EDG A;  2KCT A;  1MJE A;  3S17 B;  1SNP A;  2F0N A;  3TP7 A;  1BCP D;  1EY7 A;  1S4Z A;  2RDH A;  1J5E L;  1SN8 A;  4K8I A;  1D5X C;  1LLR D;  3KYH C;  3NPP A;  4MZ9 A;  3PCO B;  4PMW A;  5EKK A;  1JWM D;  2EY5 A;  4A76 A;  2KUM A;  1CT1 D;  3TZD A;  1SDF A;  4WRD A;  2Q8R E;  3TP8 A;  4HED A;  1PZJ D;  1ROD A;  2UXD L;  3H3V H;  4BY7 G;  1SFO B;  3P75 A;  2EOT A;  2OTJ A;  4F7X A;  5HY6 A;  1PH4 A;  1UE6 A;  1OTC A;  3CCL A;  4LF9 L;  3NXW A;  4LNQ A;  2R93 G;  3TS2 A;  2JA5 H;  1HZA A;  1MKH A;  1TWC H;  2JA6 G;  3CME A;  2Y0S E;  5CYU A;  1W6J A;  4DR1 L;  3HOY H;  5JJK A;  5KND A;  4EQN A;  4GOP A;  2QDL A;  3KLR A;  2E5L Q;  4ZKC B;  2ASB A;  1FGU A;  2L1B A;  1TS2 A;  4DAV A;  1ENC A;  3HOX B;  4JOI C;  1QJO A;  2Z6B A;  1KTK A;  3S24 A;  4QY7 A;  4C3J G;  5C4X G;  2B2U C;  1X3P A;  3V2T A;  1EL0 A;  4DUZ Q;  4QUC A;  1IW7 D;  2NN6 H;  1B2T A;  5K36 G;  2UUA L;  3QOJ A;  5G3L D;  1WCM H;  4P72 A;  1ILP A;  3K0Y A;  3T1H Q;  1U4P A;  3K7U C;  3OTO Q;  4HR7 B;  3EN2 A;  3DLL A;  4X6A H;  4X62 L;  1I3Q H;  4XQN A;  1HA6 A;  3RD4 A;  4UDU C;  4A3J G;  1E2W A;  3A7L A;  4YIJ A;  4HMI A;  3BYT B;  4L5R C;  3U9S A;  4DR7 Q;  3ONA B;  2VQE Q;  5ELN A;  3O13 A;  3I56 A;  2DJF C;  1JOR A;  4LUV A;  1VQE A;  2K4K A;  1H95 A;  4DR6 L;  1SYE A;  5I6W A;  1TWA B;  4DKA C;  4IFD J;  2B2T C;  1AZP A;  4HCE A;  4P75 A;  2MHV A;  1AEX A;  2A68 C;  3G71 A;  3HOZ G;  1GUO A;  3NUC A;  1OXT A;  4FDB A;  4BXX H;  3CCM A;  4FF1 A;  2F03 A;  1SR3 A;  4K2L A;  3AEV A;  1YJ9 A;  2NZO A;  3CCQ A;  4MTK A;  2PQA B;  1RKN A;  3A8J E;  2G5D A;  4LF6 Q;  3RZO H;  5AFW A;  3L7Z C;  4CDE C;  3HOW B;  1STA A;  1A8V A;  5IGC A;  2TMP A;  3AYH B;  3NWS A;  5M3M B;  3RNU A;  1Y1W G;  3M4Y A;  1HNX Q;  1DM0 B;  1XMQ Q;  4JV5 L;  2VUM B;  4YCW A;  1EY4 A;  1Q82 C;  2IX1 A;  2ICE C;  3QR8 A;  1LT6 D;  2DY8 A;  1EIY B;  2SNM A;  1MJC A;  1IKM A;  5T1I A;  2F0W A;  3A0J A;  3KK7 A;  4R4T A;  2EXZ A;  2E2D C;  4RGO S;  1LT4 D;  4OO1 H;  3K7A H;  2JA8 H;  1NAP A;  1HQM C;  1LYL A;  5ISR A;  4GN3 B;  5ELE A;  3HOY G;  1CHP D;  4OON A;  3KJP A;  3Q0A A;  5LL6 S;  1TWH H;  1I6H H;  1GUS A;  4NW2 A;  5BR8 Q;  1EY0 A;  4IJL A;  5K5P A;  1E2Z A;  4XYO A;  2A68 D;  4J6H A;  1EWH A;  3G6J B;  1MIU A;  2GN5 A;  4CDD C;  5IWA Q;  1BCP F;  3K5O A;  3Q6S A;  4CKE A;  2IX3 A;  1IBK L;  2NN6 G;  1UNS A;  1KRT A;  1EFI D;  5C4J B;  1IBM Q;  4BA2 I;  3ULP A;  1WCM G;  2V4D A;  3CQZ B;  1JMC A;  3D3R A;  3CCE A;  1QWY A;  1NBW A;  1HZ9 A;  2EY2 A;  2A6E D;  3CCV A;  4HIK A;  1H9R A;  2CW0 C;  2MO1 A;  5E1F A;  4GZY C;  4X3K A;  4YWL A;  5J22 A;  4NXM L;  4B3S Q;  3NP8 A;  1Q3L A;  2IHE A;  2Y0S G;  1D2B A;  1EWI A;  5IE8 A;  4JOI A;  3NWT A;  5HGT A;  1TII D;  4IUT A;  4RG1 A;  4O2D A;  2JP1 A;  4DR7 L;  2ID0 A;  2B2U A;  4CJ2 C;  3I55 A;  2Q2U A;  3I4N H;  5GAD C;  4ZKB B;  2BOS A;  2JK8 A;  2PI2 A;  2FMC A;  2XWJ B;  4C2M H;  1CA6 A;  2LKV A;  4FO2 A;  4B3R Q;  1F9S A;  2DJG C;  4HJ8 A;  5C4H A;  3CC2 A;  1H9S B;  5C3E H;  2A8V A;  3IKJ A;  3L2P A;  1Y8P B;  2L15 A;  1G51 A;  5EAY A;  4BXX G;  4OX9 Q;  2RSO A;  1KLU D;  2MGS A;  3AB9 A;  3J81 c;  4RCO A;  2B8F A;  1XTD A;  4V0B A;  4YWM A;  1FD7 D;  1GUT A;  2OT2 A;  3IFD A;  4RWS C;  3GTM H;  1UWV A;  2PW7 A;  2K04 A;  3PUV A;  1JOK A;  3A8K E;  5COR A;  3LWE A;  5DM6 3;  4A4I A;  1PYB A;  1VQ4 A;  1FNV A;  5DLQ E;  1A6X A;  2IJ0 A;  2OQK A;  1XMQ L;  1N32 Q;  2B2T A;  5FJ8 H;  2CWA A;  4EVO A;  1H9J A;  3VYR A;  2OCE A;  2EYO A;  4FYD A;  2Q2H A;  4X64 Q;  1B53 A;  4A3M B;  4G7H C;  1X9N A;  3VYU A;  1XPU A;  2EYM A;  3K8A A;  4DXG A;  3KF6 A;  4R4I A;  3QJY A;  5LHY 1;  2XSC A;  4O0A A;  2JA8 G;  5J39 A;  3FKI H;  5GRO A;  2CH4 W;  1LO5 D;  4J15 A;  4DK6 C;  2VZA A;  1EOT A;  1MBY A;  4RFB A;  1BBX C;  2GVA A;  1NY4 A;  1CSP A;  2XWB B;  1I4G A;  1BR9 A;  5D3D A;  4Q0F A;  2R92 G;  1WTO A;  1L1O A;  3DEP A;  5IYD H;  2WAQ B;  2X6L A;  2IL8 A;  2VXW A;  3CC7 A;  3H3V C;  1B3Q A;  4Y7N H;  2PO4 A;  1B50 A;  4LJZ C;  4APV A;  1DOL A;  2QIL A;  4KHP Q;  3GTG B;  2NVQ B;  1PTO C;  3D0F A;  3HKZ B;  1TKW B;  3I73 A;  4JI2 Q;  3F2B A;  1SXT A;  3C1F A;  4AQY L;  4WOR A;  1CFM A;  2RHS B;  1F9R A;  1EYA A;  2OTL A;  1WTH A;  1M8A A;  2IY5 B;  3MXG A;  2AQ3 B;  4HSV A;  3GQB A;  1TU2 B;  2KJX A;  1CZW A;  1LAB A;  4ME3 A;  2QEJ C;  3M9B A;  4YCV A;  3BS1 A;  2NZH A;  4B3S L;  3GP7 A;  2LFN A;  1ET9 A;  4A3B H;  1IZ6 A;  4LK1 C;  1W6K A;  4CHT B;  2E2I H;  3KF8 B;  1BO0 A;  3I4O A;  2WIN B;  2WII B;  5LMU Q;  3I4L A;  4LMQ D;  2F0Q A;  2E75 C;  4LFB Q;  1EQT A;  5AJ3 Q;  5M3F G;  3I7F A;  2HCC A;  3NTK A;  2YTX A;  1O7L A;  2EYH A;  4C3H H;  1I5F A;  5C3E G;  3PQI A;  1R4P B;  1VF7 A;  2IHF A;  1J9O A;  2CCZ A;  1V1P B;  3NHH A;  3MHB A;  4OX9 L;  1HR0 W;  3Q23 A;  1D8L A;  4JI0 L;  1JJC B;  3URY A;  3MC0 B;  4KHV A;  5FLM H;  4DAY B;  3BG3 A;  4GKK Q;  4TVA B;  4P73 A;  3SK6 A;  5A2Q L;  1PA6 A;  5LMN W;  1CSQ A;  4JI3 Q;  1A3U A;  1PTO D;  2F3I A;  3DWA A;  1RDP D;  3MXN A;  1YHA A;  4B9X A;  1N32 L;  2EJM A;  3U58 A;  3X3M A;  3KLW A;  1XJV A;  4LUZ A;  2WV6 D;  3JAM i;  1PV4 A;  2F0P A;  3RLF A;  3SK4 A;  1QNU A;  1KHI A;  3MXP A;  4X65 Q;  4DR5 L;  3S1N B;  5GAG C;  4DV2 Q;  1WTX A;  2OQ0 A;  5KNC A;  4A3I B;  4P2C B;  1ENF A;  2GA4 B;  3DMU A;  1DJR D;  2K52 A;  3K0X A;  1RL2 A;  4RHR A;  1TWF B;  1XYI A;  3AFP A;  4IO9 A;  3FKI G;  2WB1 B;  1AW7 A;  3J7A 5;  1ILQ A;  3TP5 A;  1Y8N B;  4DV3 Q;  4DV4 Q;  1F9P A;  1VQK A;  2Z8L A;  5EJW A;  1KRS A;  1HA5 A;  4NP5 A;  1TWA H;  4OEM B;  1XMO L;  5IYD G;  1SJH D;  1U9R A;  2AWN A;  1D1I A;  1LTB D;  1VQ8 A;  4JI8 Q;  5I9O A;  2L55 A;  3SK5 A;  4F88 A;  1A3T A;  1K83 H;  2ES2 A;  2H4O A;  4DNT B;  1N33 L;  1J8I A;  2D2C C;  2LY7 A;  4BBR B;  2B63 H;  2M9V A;  1M4V A;  1HCZ A;  5EKI A;  3GD7 A;  5FLX L;  3GTL B;  1VQB A;  2SEB D;  2FFK B;  1NJI C;  2KQ3 A;  1MHW C;  1SYC A;  5CR3 A;  1VQO A;  3GTP H;  2J4X A;  4KD4 A;  4DUY Q;  4A3B G;  2AQ2 B;  2JQO A;  2XRQ D;  4J1M A;  3T13 A;  2VUM H;  1V1Q A;  1N9W A;  4DXF A;  1K8A C;  4LFA Q;  5LMU L;  4WFN 3;  2PYK A;  4I7Z C;  1A2T A;  1EQR A;  1AZQ A;  4IPC A;  2CKZ B;  3HOV H;  4WJ3 M;  1STG A;  3NBH A;  4PV1 C;  3C3L A;  3F2D A;  4GOP B;  2EYL A;  1W3S A;  1CZG A;  3LWU A;  2I5L X;  1N34 Q;  1TWG H;  1KNA A;  5J3B A;  4RKB A;  3GTJ H;  1G91 A;  1CKN A;  3GV6 A;  1EIF A;  4BY7 H;  4A3G B;  4N9T A;  2KHI A;  4FXD A;  1B1Z A;  3SE0 A;  2UU9 L;  2UUB L;  4KK7 A;  1V8Q A;  3VA7 A;  1IHZ A;  2K6A A;  2K5N A;  5M5X B;  4DFA A;  1WTP A;  1KDC A;  1QG7 A;  4J8Q A;  5C5M A;  3TQY A;  1O78 A;  2EQS A;  5KEE A;  1EWC A;  3S14 B;  5C4J H;  3M7G A;  1UEB A;  1C4Q A;  1KNE A;  4IQZ A;  3K5M A;  4B3T L;  5IP9 H;  1QIL A;  4YY3 L;  3DHQ A;  4A3D B;  1RTN A;  4FXG C;  5IGB A;  1K3B C;  4K0K L;  1XNQ L;  3BZD B;  1FYC A;  4X65 L;  3T1Y Q;  1SND A;  2RCF A;  1BCP B;  4IOC A;  2I07 B;  2D62 A;  1AP0 A;  2DNE A;  3VR3 A;  1UUP A;  3ZJY C;  1YHQ A;  4IPH A;  4JI1 Q;  4B3M Q;  2CQA A;  2WKD A;  3T4A C;  4LW1 A;  3CRL C;  2CHB D;  4B9W A;  1RTO A;  1R9T H;  1NE3 A;  5C0X H;  4EGV A;  1RHP A;  1VQ9 A;  5GAE C;  1G6P A;  4IUV A;  2AKW B;  5FK9 C;  1FL0 A;  1VQG A;  3SDZ A;  4A3J H;  1LV9 A;  4ZQ3 A;  3TN2 A;  4DNI A;  2J7Z A;  4LF7 L;  2UXC L;  2F52 A;  3ZYY X;  1GUG A;  2I5M X;  1G29 1;  4I65 A;  4JG2 A;  5ELD A;  4IOA A;  3TP6 A;  1I4Q A;  2NYZ D;  5JJI A;  4HMJ A;  4A3K H;  1LTT D;  2R3Z A;  3S1Q H;  2MQH A;  4K5W A;  2YYZ A;  4DR2 Q;  2A69 C;  4UP9 A;  4IFD I;  2HQE A;  2BDN A;  3VR5 A;  1HNZ Q;  2A6H C;  1BBU A;  3HOZ H;  5D3I B;  3MEH A;  3PUZ A;  2ZM6 L;  2K28 A;  2F1M A;  3Q8D A;  3OHX C;  2WAC A;  3KOJ A;  1JB7 A;  1K73 C;  2FHT A;  1UEA B;  4RHS A;  3MFY A;  2VUM G;  3GTQ H;  5EQ0 A;  3KBG A;  4KKU A;  4LF5 L;  2FIN B;  2L0C A;  1YHB A;  4BBS H;  1GJX A;  2L5T A;  5DM7 3;  1PFB A;  3JC6 6;  3CU7 A;  4DV7 Q;  1PRT C;  4A3M H;  3J7Z C;  2JEA I;  1Y14 B;  3GTK B;  2ZTC A;  3HOV G;  4QIW B;  1Y1W H;  3KJO A;  2M2L A;  1VMP A;  3NBI A;  1ASY A;  4A93 B;  3FPU B;  3S16 B;  2KCN A;  3BVG A;  1XPR A;  1FJG Q;  1EOV A;  2NTT A;  3KDF A;  3H91 A;  4QUF A;  4DR3 Q;  3JAM E;  2N49 A;  4IUU A;  2O5J C;  4XTC S;  2M00 A;  4CKC A;  3BDO A;  3MEF A;  2QDB A;  4KJN A;  5FO9 B;  2BA0 A;  4PZ6 A;  1H9M A;  5IYC H;  4UY8 C;  1A63 A;  1SE3 A;  3OYY A;  1DON A;  1WTV A;  4OWW B;  2O2L D;  3GTG H;  2E76 C;  1SLJ A;  1A62 A;  4ULL A;  5IP9 G;  1Z47 A;  2ZJP A;  4GS3 A;  2A6H D;  1KQS A;  2K33 A;  1HHV A;  4A3E B;  1BF4 A;  4JI4 L;  3T1Y L;  1VCI A;  4NXN L;  4DR4 L;  2MJ8 A;  4R9W A;  3C2P A;  3PO3 B;  3HG9 A;  1IBL Q;  3FVQ A;  3N52 A;  2PQE A;  2PPB C;  3W1G A;  3PSI A;  1B9M A;  3STB C;  4C56 C;  4GKJ L;  1XWE A;  3NK9 A;  3HGB A;  2IX0 A;  1NR4 A;  1PRT D;  4KV6 A;  1XNR L;  4OXP A;  5FKA C;  1LTS D;  5C0X G;  4N8F A;  3A7A B;  3PIO A;  1VQL A;  3DEO A;  2K03 A;  3J7A F;  2P5Z X;  1QOH A;  3NEN A;  4JI6 L;  1P16 A;  2L4N A;  1I50 B;  4JBW A;  1Y69 U;  4JYA Q;  4A3K G;  1E2V A;  4NMZ A;  4BY1 B;  3AMU A;  4FF4 A;  1FNW A;  4FNF A;  2RQX A;  1QZG A;  1I4H A;  3HFZ B;  3AFQ A;  3RN5 A;  2F0F A;  4L5T A;  4V19 0;  3MFG A;  5IYB H;  3TS0 A;  2N3S A;  1VQ7 A;  4DF7 A;  4DV1 L;  4HJ9 A;  1D5M C;  3L0O A;  1EIH A;  2HHH L;  2NVX B;  2A74 C;  4ILW A;  5CV5 A;  1SNQ A;  4BBS G;  4QF4 A;  1N8R C;  3WWV A;  1SYF A;  3HS0 C;  4RAU C;  4YHH Q;  3KF6 B;  3S1N H;  5E7N A;  5C44 B;  4A3M G;  1S72 A;  3J80 i;  3G4S A;  3W1B A;  4HIO A;  4XT1 B;  5TSS A;  4XQJ A;  3F2C A;  5IIF A;  2EXD A;  4HJ7 A;  4C3I H;  3A54 A;  3GTO H;  4DAM A;  1TWF H;  1L1O C;  3STB D;  4UAI A;  5EPJ A;  5GQO A;  5LL6 X;  1FJG L;  3VR4 A;  1II3 A;  1PFS A;  5IOC A;  1X56 A;  4XXE A;  1HTP A;  2BCO A;  3BZK A;  4K14 A;  1BKB A;  4MTN A;  1L0X B;  2MUY A;  1DZ1 A;  1WYD A;  3S2D H;  2RBM A;  2RF4 A;  5IYC G;  2B39 A;  4ME5 A;  1VQI A;  1QUQ A;  4HCS A;  2JA7 B;  1RF2 D;  1LT5 D;  5M5W B;  2NVY B;  3I90 A;  5IP7 H;  2F0D A;  2E5L L;  3S2H H;  1E3P A;  5I4D A;  2BE5 C;  2UXB Q;  2QGQ A;  5CV8 A;  4PG3 A;  2R92 H;  5H1S E;  3BDL A;  1BBW A;  4H02 A;  5ELO A;  2Z4I A;  3FMC A;  4KKT A;  3I8Z A;  1EEI D;  3IL8 A;  1JJ2 A;  1GD7 A;  4DUZ L;  4X66 Q;  3T53 B;  2R61 A;  4R4Q A;  2VQF Q;  3M4O B;  1Z7T A;  4KY6 A;  1LUZ A;  1WD0 A;  1QVF A;  4ZYS A;  3TEH B;  4PMC A;  2PMZ B;  1N36 Q;  3VR2 A;  1V1O A;  5KRU A;  3T1H L;  3OTO L;  1KL9 A;  2RA4 A;  3CRK C;  2JA6 B;  2NB0 A;  1XXG A;  4S3S A;  3A74 A;  1NMF A;  1JR0 D;  3VA5 A;  1DOK A;  5IGD A;  3OWF A;  1WTW A;  2KOL A;  1TXY A;  2VQE L;  4K5V A;  2RDG A;  3MWY W;  4RH6 A;  2JSO A;  3NE5 B;  4CBV A;  4JI5 Q;  4YWK A;  1E24 A;  1SE2 A;  1TY2 A;  1I4R A;  2NUC A;  4C3J B;  1E1T A;  2EIF A;  3DWQ A;  4HJA A;  4O42 A;  2FXQ A;  3HOU H;  2V1C C;  5M3F H;  1A0I A;  3J81 L;  1B44 D;  2BA1 A;  1SMY C;  2F4I A;  5M5X H;  4L8J A;  3K6O A;  1BOS A;  3S1M B;  5IYB G;  3E6Z X;  3MXN B;  5IT9 E;  3S14 H;  2CVR A;  2PCF B;  1JC7 A;  2MNA A;  2XRS D;  1EYD A;  2QEX A;  1K3R A;  2BE5 D;  3UE0 A;  5BN3 A;  5CBE E;  3I3C A;  4K5X A;  2KBN A;  1MSH A;  4LF6 L;  1WOC A;  4U68 A;  2EPB A;  3FRP B;  1AN8 A;  4N9P A;  2JYO A;  3T56 B;  4YHH L;  4A3F B;  4JBM A;  3SVM A;  5G3L F;  1GXD C;  3M85 A;  3NQT A;  1GKH A;  4HTH A;  1YI2 A;  2OF1 A;  1TY0 A;  1IYV A;  1HNX L;  4C3I G;  4PMB A;  3HRZ C;  4I7A A;  4AYB B;  1Q90 A;  1NR2 A;  5IGG A;  2ATW A;  3JAM c;  2E2J H;  4CJ0 B;  1AH9 A;  1QZH A;  3CCU A;  2CW0 D;  4N8X 1;  4JC0 A;  3I70 A;  3RZD H;  4DV6 Q;  3K59 A;  4R1J A;  3PO2 B;  2HCI A;  5EKL A;  3DM1 A;  5EPK A;  2Z6K A;  1S5F D;  2D5D A;  1B3A A;  1DGS A;  1QVC A;  2PZW A;  5IP7 G;  5F2D A;  5DAU A;  5CC4 A;  1VQP A;  2K5Q A;  1E22 A;  3EVQ A;  3M3Y B;  4IUQ A;  2QKI C;  5BR8 L;  3FHW A;  4KTA A;  5HUR A;  1J6Q A;  2F0T A;  1EYG A;  1EY9 A;  3QIA A;  1KAW A;  4OHJ A;  1SMY D;  2KVM A;  4JBK A;  3DM3 A;  1SNM A;  2EZV A;  4GLV B;  2IPK D;  2PZU A;  1HPC A;  5IWA L;  4MHE A;  3NEM A;  1JWU D;  4TQU S;  1TR5 A;  3S17 H;  2VQF L;  1JQY D;  1IBM L;  2F0E A;  1L2F A;  1Z6H A;  4RA8 A;  1Q1E A;  4LUO A;  4H13 C;  1G8Z D;  4DGZ A;  1EEF D;  1PTO B;  3J7Y W;  2XN9 C;  2K50 A;  2L12 A;  2Z0S A;  4EQ5 A;  2JA5 B;  3S15 B;  1WTR A;  3NBH B;  3K5L A;  3GTK H;  1QB5 D;  4LF8 Q;  2RHQ B;  4UP8 A;  2VL6 A;  4QJF A;  3CHB D;  3TZU A;  5I9P A;  3HOY B;  3X3N A;  5ELB A;  5BN5 A;  3RN2 A;  1LM0 A;  4FXK C;  1PH3 A;  1KIX A;  1OXX K;  1L0Y B;  1UE5 A;  2K7V A;  1F2L A;  1SFO H;  5KIX A;  3ER0 A;  2I46 A;  5CMD A;  2E74 C;  3A5Z B;  4FF2 A;  3W5O A;  4LF4 Q;  4O1N A;  3HOU G;  4B3R L;  2SNS A;  1I94 Q;  3J80 E;  1SBB B;  4L6T B;  3TRE A;  4JI7 Q;  1TS5 A;  3UDF A;  3ITP A;  3I4M B;  5I6Y A;  4G4K A;  2C5C A;  4GNX C;  3F2U A;  1PH6 A;  5KYL A;  4QL5 A;  1Q81 C;  1WCM B;  1KDB A;  3HOX H;  5C5L A;  4MIU A;  1PZI D;  5EBD A;  1JOQ A;  3BJU A;  2EYJ A;  3UDG A;  1VQ6 A;  3E5S A;  3PO3 H;  2Z9H A;  4KY5 A;  4JK1 C;  5I2Y A;  1PLF A;  2R6G A;  4KN4 C;  3WOF A;  3QO2 A;  5DEH A;  1K0R A;  1PZK D;  3J7A V;  3HEJ A;  2DUD A;  1FGB D;  4DPG A;  5C6A A;  5JVH 3;  1S5E D;  3PF4 A;  1NUC A;  2ICI A;  1X54 A;  5J1Z A;  4X64 L;  3H0G B;  4KMU C;  1V43 A;  3QOL A;  4DV6 L;  1H9S A;  2QW7 A;  1HNW Q;  4MNO A;  2YTY A;  1HFN A;  3U4Z A;  1HUN A;  1HTL D;  1JOO A;  4Z9C B;  1CK1 A;  1HJP A;  1X3Q A;  4BY1 H;  4CDF C;  3CW2 C;  1OXV A;  1AE2 A;  2LS0 1;  2QF7 A;  1YIT A;  3I2Z A;  3H3V I;  2VS1 A;  3RZO B;  1S3O A;  3MZ5 A;  2SOB A;  4GN4 B;  3C1E A;  1PH5 A;  2K5D A;  4TRD A;  4C1N I;  4A3C G;  4FP5 D;  4KHP L;  3CKI B;  1X3E A;  1HR0 Q;  4JI2 L;  1NSN S;  4OWX B;  2F0S A;  2O4X A;  3AU7 A;  3H94 A;  1VQ5 A;  3CF5 A;  4ZUJ A;  2F0J A;  1I4X A;  5BN4 A;  3HOW H;  2XVS A;  4K2K A;  3KBX A;  3PUX A;  2NBF A;  3K7A B;  5LMN Q;  5M3M H;  1C7Y A;  4RKL A;  3BZC A;  3H15 A;  3EBE A;  1EQV A;  3OOC A;  4LWC A;  5IOD A;  1YNN C;  4A93 G;  2YU9 B;  4LFC Q;  3KDF B;  1E0B A;  1I6H B;  2I5H A;  2NN6 I;  4FF3 A;  2Q8T A;  2LXK A;  2PMZ E;  2RVL A;  3AQQ A;  1YIJ A;  1BQQ T;  3R2T A;  1XPO A;  1K9M C;  4F8M A;  1KLG D;  2HUG A;  2N8N A;  4LFB L;  1EY6 A;  2JA9 A;  5AJ3 L;  1IYJ B;  3K57 A;  1WTQ A;  5C0X J;  4ZRZ A;  1GHK A;  1SEB D;  5IT9 c;  2JA7 H;  1LT3 D;  2H5X A;  1KXL A;  5NUC A;  2ZXP A;  3ND8 A;  1EUJ A;  3R93 A;  3PUW A;  1J5E Q;  1CM9 A;  1VQH A;  3CP0 A;  1T5E A;  1YEZ A;  3HOX G;  4AH6 A;  1E1O A;  1ET6 A;  1ZYR C;  1C48 A;  4BWG B;  1UE1 A;  1KDA A;  4A3E G;  4GKK L;  2HDM A;  3IRB A;  4IN3 A;  3PF5 A;  1SMX A;  1PHJ A;  4L5S A;  3PO3 G;  2F0L A;  4TSS A;  1FR3 A;  1KD1 C;  4JI3 L;  1F2Z A;  3I4N B;  2UXD Q;  1Q86 C;  3M4O H;  1SYG A;  1H9K A;  2B2W A;  2KCC A;  1PH1 A;  4KY7 A;  3CQZ H;  3L3O C;  1SRO A;  1SYD A;  3ERQ A;  2B8G A;  3SEB A;  2YTV A;  4LF9 Q;  4C2M B;  1VS0 A;  4GNX A;  2HT1 A;  3CMA A;  1OO9 B;  1CKO A;  1DXM A;  5C3E B;  3S1R B;  1U5K A;  4DV2 L;  4DR1 Q;  1S5B D;  1KAA A;  1FNU A;  2LXJ A;  1STB A;  3E0E A;  1HNW L;  1CA5 A;  1TT2 A;  1YNN D;  2IWH A;  1XX8 A;  1JCK B;  3Q24 A;  1O7I A;  4XT3 B;  1AFP A;  2YV5 A;  3TBI B;  1PXU A;  4BY1 G;  1HZC A;  3UDI A;  1MI2 A;  2K5H A;  4K6L A;  3GTM B;  4DV3 L;  4DV4 L;  2UUC Q;  1R4Q B;  2HD3 A;  4UPA A;  1T9H A;  4DAY A;  1K0S A;  1X65 A;  2RCN A;  4ALP A;  2F0V A;  3E9H A;  4HSP A;  3ULL A;  3VR6 A;  2Q2I A;  4OO1 I;  3I91 A;  1NTG A;  5CV7 A;  1U4L A;  2F0K A;  4U67 3;  4XYQ A;  1X32 A;  4PQX A;  2UUA Q;  1CTM A;  2JJQ A;  4NKL A;  4JI8 L;  3MAQ A;  1PH9 A;  4OIK A;  1W2B A;  4C1N K;  2ZXR A;  1TVX A;  4KI0 A;  2K75 A;  2R7Z B;  4X62 Q;  4X3S A;  1ZYR D;  3BVM A;  1RIP A;  4FVM A;  1STH A;  4UHV A;  1PTO F;  3MVV A;  2NWG A;  4A3F H;  3HOW G;  1Y1V B;  2K32 A;  1F2Y A;  2WAQ E;  1RCV D;  5COY A;  3CCR A;  2E2H B;  5M3M G;  1CHQ D;  1JJG A;  4XDX A;  4QQB X;  4DUY L;  2IT1 A;  3HKZ E;  2X69 A;  4DR6 Q;  3QG1 A;  3P7J A;  2A1A A;  3NSW A;  5D14 A;  2VB3 X;  4HIM A;  4LFA L;  1X6O A;  2C9O A;  2F3V A;  5FO7 B;  1LTG D;  2RKS A;  1AE3 A;  1VQM A;  5JPN C;  3PO2 H;  3OSO A;  4EQO A;  4QMG A;  4Y7N B;  3WDN A;  1D1K A;  1PRT B;  4F87 A;  3A8I E;  2JA7 G;  3D4D A;  3KFU A;  3CD6 A;  1N34 L;  1SSO A;  1S5D D;  2VNU D;  3M3Y H;  1EU3 A;  2KEE A;  1O80 A;  4R8I A;  1G2S A;  1PH8 A;  5JPM C;  4M8A A;  1IXR A;  4IZ8 A;  3CCJ A;  3CPW A;  1SRU A;  4OIJ A;  1V9P A;  4KN7 C;  4A3B B;  4JV5 Q;  5JJL A;  2QA4 A;  2OEO A;  2NVQ H;  2E2I B;  4JVZ A;  1BVS A;  3NQI A;  2K05 A;  4HID A;  2A69 D;  4JBJ A;  3R8B A;  5IGE A;  1DD2 A;  4CKB A;  3F1Z A;  1ML0 D;  2BDO A;  4K6D A;  1PTO H;  3EIV A;  3R3O A;  4HN7 A;  2ZTE A;  3W3A A;  3S15 H;  1S40 A;  3MTS A;  4C3H B;  2DY7 A;  1U0L A;  1GHJ A;  5T1G A;  3A56 A;  2KA7 A;  3OMC A;  5JJZ A;  4TKO B;  4OEL B;  5EGT A;  4JPB W;  1Q1B A;  4JI1 L;  4B3M L;  3IFT A;  3ERS X;  2UUC L;  1DOM A;  5A35 A;  4GLA C;  2BH2 A;  1KC8 C;  1Q8K A;  3SK8 A;  2XTI A;  2K5W A;  3H09 A;  4L5Q A;  3RLO A;  4DV0 Q;  3I4M H;  1IBK Q;  2N55 A;  1Q46 A;  3LX0 A;  1YJW A;  1LTR D;  2WB1 E;  5C4Z A;  5KNB A;  1VQC A;  1STY A;  3EFX D;  2R7D A;  1YNX A;  4DR2 L;  1RJT A;  2AWO A;  2A73 B;  4A3F G;  4NXM Q;  1F77 A;  1HNZ L;  2PZT A;  3RR5 A;  5IY0 A;  1SAP A;  5M5Y B;  5E3F A;  2B2V C;  3K81 C;  1STN A;  4UP7 A;  4AYB G;  3MA2 B;  5KGU A;  1GUW A;  4YCU A;  5M9O A;  2Z6K C;  5JEA J;  1EZ6 A;  1SE4 A;  3TRZ A;  1QCB D;  4GLX A;  1YJN A;  4NPS A;  4DV7 L;  1XTC D;  3H0G H;  4A3I H;  1YBY A;  3PO2 G;  1K8G A;  1LTL A;  2DGY A;  3CXC A;  5CGK A;  2F3W A;  3P20 A;  1X3F A;  1K83 B;  1ZEQ X;  2F0O A;  2XGT A;  1CQF A;  3PV0 A;  3H6M A;  3J81 j;  2B63 B;  4DR3 L;  2A6E C;  1L1O B;  2KEC A;  3BDC A;  4HAE A;  3SR1 A;  2K1B A;  4A75 A;  2WAQ G;  2CH4 A;  1NCV A;  2SDF A;  3GTP B;  3PIP 3;  1Q8I A;  4AIM A;  2F0H A;  3OWE B;  3A5U A;  3QWN A;  5A2Q E;  3HKZ G;  2NZ1 D;  1S5C D;  4PNY A;  4BBR H;  1FVI A;  3VDY A;  1F9Q A;  1CUK A;  2AUJ D;  3D8G A;  4OL7 A;  5FOB B;  3HZX A;  2JA5 G;  1PFN A;  2B2Y C;  4CGY B;  3GTL H;  3IAY A;  3U4V A;  2PNH A;  3HOV B;  4L63 B;  4QB4 A;  2AMC B;  1TWG B;  3RMH A;  5JEA H;  2F0I A;  2YU9 H;  1IBL L;  3GTJ B;  4IFD H;  4BY7 B;  2PW5 A;  3T51 B;  3D6C A;  3ERO A;  4BS9 A;  2R93 B;  3V96 A;  2LMC B;  1YNJ C;  4DK0 A;  5D65 A;  4IPG A;  3K58 A;  4B08 A;  1PH7 A;  2NVT B;  3K5N A;  3I4M G;  3E9I A;  2Q8I B;  2CFM A;  4Q5V A;  4EQP A;  4DV0 L;  1I4P A;  2R7F A;  2X6G A;  3RLN A;  2MPM A;  3GO5 A;  4AQY Q;  1Y8O B;  1EYC A;  2GVB A;  4JYA L;  5CBA E;  1HXY D;  4A3G H;  3ULJ A;  4Y52 H;  5C4X B;  1UE7 A;  2CQO A;  2HQL A;  4WJW A;  1K8O A;  2ENB A;  4G7Z C;  1QVG A;  3EJI A;  4X3T A;  5GAH C;  1WI5 A;  2F0U A;  3DUZ A;  1B70 B;  3M4Q A;  2G9H D;  4QCL A;  5FLX E;  1HZB A;  1SNO A;  3T16 A;  3UDX A;  1PVO A;  1JB3 A;  1ZKO A;  1R9T B;  4A3D H;  1EY5 A;  1HFG A;  3H0G G;  4A3I G;  3S1R H;  4A3J B;  3W2D A;  4DV5 Q;  2J0T D;  3JAM L;  1PRT F;  4A3K B;  1Q7Y C;  4JI0 Q;  1EU4 A;  2WB1 G;  4KKS A;  1WVL A;  4ZAI A;  3S1Q B;  1EFW A;  2JN4 A;  4R4C A;  1OXS C;  1IL8 A;  4RGT A;  3D31 A;  2RSN A;  3E3X A;  1QE6 A;  1TS4 A;  1PFM A;  2DNC A;  2B2V A;  1YNJ D;  1C9O A;  3LGJ A;  3HOZ B;  3SHL A;  2I0Q A;  2XNA C;  4QIW E;  2JE6 I;  1C0A A;  3FEW X;  3ICE A;  2AQ1 B;  3CPF A;  3GTQ B;  5JAV A;  1VQA A;  2KCM A;  4BBS B;  1IYU A;  2EJG C;  3VYT A;  1LAC A;  4BBR G;  1X3G A;  1QNK A;  5EBC A;  2PQA A;  2R7Z H;  4DR5 Q;  2KED A;  1HQR D;  4R4O A;  2UXB L;  1NMG A;  3A55 A;  1JE4 A;  1VQD A;  1Y1V H;  4OO1 G;  3CC4 A;  1SNC A;  4IUR A;  1Y1W B;  1ENA A;  1BDO A;  1O7Y A;  2E2H H;  5E4W C;  4JCV E;  4A3C H;  5JEA G;  4X66 L;  1HRJ A;  4PZ8 A;  2RDF A;  2EY1 A;  5ELC A;  1EY8 A;  3OIP A;  4IFD G;  1VQN A;  1ZXT A;  1C8C A;  3UE1 A;  1DCZ A;  2ZXO A;  1HUM A; 
#chains in the Genus database with same CATH homology
 4M1U B;  1MSG A;  1U4R A;  1PYW D;  1TWC B;  3OMG A;  4G7O C;  3ND9 A;  3P1H A;  4KHZ A;  3MXU A;  2F0G A;  2Z4H A;  2B2Y A;  3OW7 A;  2DN8 A;  1ONL A;  3N6R A;  5FO8 B;  1T5X D;  3QB3 A;  2B2W C;  3G7L A;  5C0X I;  3SXH A;  3PIO 3;  1IKL A;  2JEB I;  3M7N A;  4IAL A;  4DA2 A;  1SJE D;  1CQV A;  3NTI A;  2IW3 A;  1I3Q B;  4IUP A;  4ZUI A;  2Y0S B;  1UAP A;  5DNF A;  2HDL A;  1A3V A;  2EVB A;  2O5I C;  5E4X A;  2NTS A;  3R2I A;  1CI3 M;  3RUZ A;  3TSS A;  3EA6 A;  4IUN A;  3D6W A;  1B4O A;  4E6I A;  1D6E C;  1OXU A;  1EZ8 A;  3LNN A;  4CJ1 B;  2EY6 A;  3TDQ A;  4RGN A;  4KD3 A;  2H1E A;  4XIG S;  3S9W A;  1LTI D;  4C3I B;  3GTO B;  1U4M A;  2A5H A;  2L11 A;  2PNR C;  2QCP X;  1F2M A;  2D9U A;  5ELF A;  5C3X A;  4ZLT F;  1BUV T;  1SYB A;  4ODG A;  3S2D B;  4KJO A;  3D4R A;  4MN3 A;  1TQO A;  3UI2 A;  2JA8 B;  4ID6 A;  1BNZ A;  5C3W A;  2MP1 A;  1VMC A;  1MD2 D;  4H44 C;  4DAP A;  1ESR A;  1TWH B;  2K01 A;  2VB2 X;  5JOB A;  2TSS A;  3S2H B;  3PMF A;  2L9H A;  1JWS D;  1STE A;  1LTA D;  5I2X A;  5CV6 A;  2R92 B;  5IT9 L;  3DWP A;  1A15 A;  3I72 A;  4H0L C;  4DNR B;  4ZK9 B;  3EQL C;  2EE1 A;  1B9N A;  5EPL A;  3V05 A;  1EIG A;  4XQQ A;  3BVZ A;  4G57 A;  4DN4 M;  1A2U A;  1ESF A;  4C3H G;  1VDZ A;  2WP8 J;  2EJF C;  3OIQ A;  1PMR A;  2OXP A;  3BYY B;  5IGF A;  1PDQ A;  2Z1C A;  3KF8 A;  5KYI A;  1G6Z A;  2WKC A;  1MGS A;  3HOU B;  5M3F B;  2F0M A;  4R8N A;  3GV3 A;  1JIC A;  1Q12 A;  1BXT A;  4ABN A;  5CV4 A;  3DXJ C;  3Q22 A;  2XIW A;  4H7B A;  2AUK A;  1VF5 C;  1V1P A;  2FJ2 A;  1DYQ A;  1G2T A;  1BCP C;  3NTH A;  3KUP A;  2JXM B;  3HP3 A;  3FPP A;  2EYF A;  2ZT9 C;  3FDT A;  4RCN A;  4NDX A;  1RD9 D;  1GOZ A;  4OGQ C;  5K36 H;  3D4W A;  3KLS A;  4K8J A;  2E2J B;  4DU9 A;  5JVG 3;  4BA1 I;  3E0J A;  5CV9 A;  3OPO A;  3L9A X;  3WOE A;  4DK1 A;  3RZD B;  1K8M A;  2N88 A;  4X3U A;  1D5Z C;  3C46 A;  3FKI B;  1KAB A;  1WD1 A;  2G9D A;  2FMM A;  1ICW A;  3J80 L;  3KLS X;  3TME A;  2KHS A;  4RGM A;  1I6V C;  1GUN A;  2EYP A;  1TS3 A;  3VYS A;  3PUY A;  1O7Z A;  4LAA A;  3U9O A;  1IW7 C;  3J81 E;  3S17 B;  2EDG A;  1SNP A;  2F0N A;  3TP7 A;  1BCP D;  1EY7 A;  1S4Z A;  2RDH A;  4K8I A;  1D5X C;  1LLR D;  3NPP A;  4PMW A;  5EKK A;  1JWM D;  2EY5 A;  2KUM A;  1CT1 D;  3TZD A;  1SDF A;  4WRD A;  2Q8R E;  3TP8 A;  4HED A;  1PZJ D;  1ROD A;  1SFO B;  3P75 A;  2EOT A;  4F7X A;  3NXW A;  5CYU A;  1W6J A;  5KND A;  4EQN A;  3KLR A;  4ZKC B;  2L1B A;  1TS2 A;  4DAV A;  1ENC A;  3HOX B;  1QJO A;  1KTK A;  4C3J G;  2B2U C;  1X3P A;  3V2T A;  1EL0 A;  4QUC A;  1IW7 D;  2NN6 H;  1B2T A;  5K36 G;  3QOJ A;  5G3L D;  1ILP A;  3K0Y A;  1U4P A;  4HR7 B;  4XQN A;  1HA6 A;  3RD4 A;  4UDU C;  1E2W A;  3A7L A;  4YIJ A;  4HMI A;  3BYT B;  3U9S A;  3ONA B;  3O13 A;  1JOR A;  1SYE A;  5I6W A;  1TWA B;  4IFD J;  2B2T C;  1AZP A;  4HCE A;  2MHV A;  1AEX A;  2A68 C;  1GUO A;  3NUC A;  1OXT A;  4FF1 A;  2F03 A;  4K2L A;  1RKN A;  3A8J E;  5AFW A;  3L7Z C;  3HOW B;  1STA A;  5IGC A;  2TMP A;  3NWS A;  5M3M B;  3M4Y A;  1DM0 B;  2VUM B;  1EY4 A;  2IX1 A;  2ICE C;  1LT6 D;  2DY8 A;  2SNM A;  1IKM A;  5T1I A;  2F0W A;  3KK7 A;  2EXZ A;  2E2D C;  4RGO S;  1LT4 D;  4OO1 H;  1NAP A;  1HQM C;  5ISR A;  5ELE A;  1CHP D;  3Q0A A;  5LL6 S;  1GUS A;  4NW2 A;  1EY0 A;  5K5P A;  1E2Z A;  4XYO A;  2A68 D;  4J6H A;  1EWH A;  3G6J B;  1BCP F;  3K5O A;  3Q6S A;  4CKE A;  2IX3 A;  2NN6 G;  1UNS A;  1EFI D;  5C4J B;  4BA2 I;  2V4D A;  3CQZ B;  3D3R A;  1QWY A;  2EY2 A;  2A6E D;  1H9R A;  2CW0 C;  5E1F A;  4GZY C;  4X3K A;  5J22 A;  3NP8 A;  1Q3L A;  1D2B A;  5HGT A;  3NWT A;  1TII D;  4IUT A;  2JP1 A;  2ID0 A;  2B2U A;  4CJ2 C;  4ZKB B;  2BOS A;  2FMC A;  2XWJ B;  1CA6 A;  2LKV A;  4FO2 A;  1F9S A;  5C4H A;  1H9S B;  3IKJ A;  1Y8P B;  2RSO A;  1KLU D;  2MGS A;  3AB9 A;  4RCO A;  2B8F A;  4V0B A;  1FD7 D;  1GUT A;  2OT2 A;  3IFD A;  4RWS C;  2PW7 A;  2K04 A;  3PUV A;  1JOK A;  3A8K E;  5COR A;  3LWE A;  5DM6 3;  1FNV A;  1A6X A;  2IJ0 A;  2B2T A;  4EVO A;  1H9J A;  3VYR A;  2EYO A;  4FYD A;  1B53 A;  4A3M B;  4G7H C;  3VYU A;  2EYM A;  4DXG A;  5LHY 1;  3QJY A;  2XSC A;  5J39 A;  1LO5 D;  1EOT A;  1MBY A;  4RFB A;  1BBX C;  2XWB B;  1I4G A;  1BR9 A;  5D3D A;  4Q0F A;  1WTO A;  3DEP A;  2WAQ B;  2X6L A;  2IL8 A;  2VXW A;  3H3V C;  1B50 A;  2PO4 A;  4LJZ C;  1DOL A;  2QIL A;  3GTG B;  2NVQ B;  1PTO C;  3HKZ B;  1TKW B;  3I73 A;  1SXT A;  3C1F A;  4WOR A;  1CFM A;  1F9R A;  1EYA A;  1M8A A;  3MXG A;  2AQ3 B;  4HSV A;  3GQB A;  1TU2 B;  2KJX A;  1CZW A;  1LAB A;  2QEJ C;  3BS1 A;  3GP7 A;  2LFN A;  1ET9 A;  4LK1 C;  1W6K A;  4CHT B;  1BO0 A;  2WIN B;  2WII B;  3I4L A;  4LMQ D;  2F0Q A;  2E75 C;  1EQT A;  2HCC A;  3NTK A;  1O7L A;  2EYH A;  1R4P B;  1VF7 A;  1J9O A;  1V1P B;  3NHH A;  3MHB A;  3Q23 A;  3URY A;  3MC0 B;  4KHV A;  3BG3 A;  3SK6 A;  5A2Q L;  1A3U A;  1PTO D;  3DWA A;  1RDP D;  3MXN A;  4B9X A;  2EJM A;  3X3M A;  2WV6 D;  2F0P A;  3RLF A;  3SK4 A;  1QNU A;  3MXP A;  3S1N B;  1WTX A;  5KNC A;  4A3I B;  4P2C B;  1ENF A;  2GA4 B;  3DMU A;  1DJR D;  4RHR A;  1TWF B;  1XYI A;  2WB1 B;  1AW7 A;  1ILQ A;  3TP5 A;  1Y8N B;  1F9P A;  2Z8L A;  5EJW A;  1HA5 A;  4NP5 A;  1SJH D;  1U9R A;  2AWN A;  1D1I A;  1LTB D;  5I9O A;  2L55 A;  3SK5 A;  4F88 A;  1A3T A;  2H4O A;  4DNT B;  1J8I A;  2D2C C;  2LY7 A;  4BBR B;  2M9V A;  1M4V A;  1HCZ A;  5EKI A;  3GD7 A;  5FLX L;  3GTL B;  2SEB D;  2FFK B;  2KQ3 A;  1SYC A;  5CR3 A;  2J4X A;  4KD4 A;  2AQ2 B;  2XRQ D;  4J1M A;  3T13 A;  4DXF A;  4WFN 3;  2PYK A;  4I7Z C;  1A2T A;  1AZQ A;  1STG A;  3NBH A;  4PV1 C;  3C3L A;  2EYL A;  1CZG A;  3LWU A;  1KNA A;  4RKB A;  1G91 A;  3GV6 A;  4A3G B;  4N9T A;  4FXD A;  1B1Z A;  3SE0 A;  4KK7 A;  1V8Q A;  3VA7 A;  1IHZ A;  2K6A A;  5M5X B;  4DFA A;  1WTP A;  1KDC A;  1QG7 A;  4J8Q A;  5C5M A;  1O78 A;  5KEE A;  1EWC A;  3S14 B;  3M7G A;  1C4Q A;  1KNE A;  4IQZ A;  3K5M A;  1QIL A;  3DHQ A;  4A3D B;  1RTN A;  4FXG C;  5IGB A;  3BZD B;  1FYC A;  1SND A;  1BCP B;  2I07 B;  2D62 A;  1AP0 A;  2DNE A;  3VR3 A;  1UUP A;  2CQA A;  2WKD A;  3T4A C;  3CRL C;  2CHB D;  4B9W A;  1RTO A;  5C0X H;  4EGV A;  1RHP A;  4IUV A;  5FK9 C;  3SDZ A;  1LV9 A;  4ZQ3 A;  3TN2 A;  2J7Z A;  3ZYY X;  1GUG A;  1G29 1;  4I65 A;  5ELD A;  3TP6 A;  1I4Q A;  2NYZ D;  4HMJ A;  1LTT D;  2R3Z A;  4K5W A;  2YYZ A;  2A69 C;  4IFD I;  2HQE A;  2BDN A;  3VR5 A;  2A6H C;  5D3I B;  3MEH A;  3PUZ A;  2K28 A;  2F1M A;  3OHX C;  2WAC A;  2FHT A;  1UEA B;  4RHS A;  3MFY A;  5EQ0 A;  3KBG A;  4KKU A;  2FIN B;  2L0C A;  1GJX A;  2L5T A;  5DM7 3;  1PFB A;  3CU7 A;  1PRT C;  2JEA I;  3GTK B;  4QIW B;  2M2L A;  1VMP A;  3NBI A;  4A93 B;  3FPU B;  3S16 B;  2KCN A;  3BVG A;  2NTT A;  3H91 A;  4QUF A;  3JAM E;  4IUU A;  2O5J C;  4XTC S;  2M00 A;  4CKC A;  3BDO A;  2QDB A;  4KJN A;  5FO9 B;  2BA0 A;  1H9M A;  1SE3 A;  1DON A;  1WTV A;  2O2L D;  2E76 C;  4ULL A;  1Z47 A;  2A6H D;  2K33 A;  1HHV A;  4A3E B;  1BF4 A;  1VCI A;  2MJ8 A;  4R9W A;  3C2P A;  3PO3 B;  3HG9 A;  3FVQ A;  3N52 A;  2PQE A;  2PPB C;  1B9M A;  4C56 C;  1XWE A;  3NK9 A;  3HGB A;  2IX0 A;  1NR4 A;  1PRT D;  4KV6 A;  5FKA C;  1LTS D;  5C0X G;  3A7A B;  3DEO A;  2K03 A;  3J7A F;  1QOH A;  2L4N A;  1I50 B;  4JBW A;  1Y69 U;  1E2V A;  4NMZ A;  4BY1 B;  3AMU A;  4FF4 A;  1FNW A;  4FNF A;  2RQX A;  1I4H A;  2F0F A;  4V19 0;  3MFG A;  4DF7 A;  1D5M C;  1EIH A;  2NVX B;  2A74 C;  4ILW A;  5CV5 A;  1SNQ A;  4QF4 A;  1SYF A;  3HS0 C;  4RAU C;  5C44 B;  4XT1 B;  5TSS A;  4XQJ A;  5IIF A;  3A54 A;  4UAI A;  5EPJ A;  5LL6 X;  3VR4 A;  1II3 A;  5IOC A;  4XXE A;  1HTP A;  2BCO A;  4K14 A;  1DZ1 A;  1L0X B;  2MUY A;  2RBM A;  2B39 A;  4ME5 A;  4HCS A;  2JA7 B;  1RF2 D;  1LT5 D;  5M5W B;  2NVY B;  3I90 A;  2F0D A;  5I4D A;  2BE5 C;  5CV8 A;  3BDL A;  2Z4I A;  3FMC A;  4KKT A;  3I8Z A;  1EEI D;  3IL8 A;  3T53 B;  2R61 A;  3M4O B;  1Z7T A;  4KY6 A;  1WD0 A;  4ZYS A;  4PMC A;  2PMZ B;  3VR2 A;  1V1O A;  5KRU A;  2RA4 A;  3CRK C;  2JA6 B;  2NB0 A;  1XXG A;  4S3S A;  1JR0 D;  3VA5 A;  1DOK A;  5IGD A;  3OWF A;  1WTW A;  2KOL A;  4K5V A;  2RDG A;  3MWY W;  4RH6 A;  2JSO A;  3NE5 B;  4CBV A;  1SE2 A;  1TY2 A;  1I4R A;  2NUC A;  4C3J B;  3DWQ A;  4O42 A;  3J81 L;  1B44 D;  2BA1 A;  1SMY C;  2F4I A;  4L8J A;  3K6O A;  1BOS A;  3S1M B;  3E6Z X;  5IT9 E;  2CVR A;  2PCF B;  1JC7 A;  2XRS D;  1EYD A;  2BE5 D;  5BN3 A;  5CBE E;  3I3C A;  4K5X A;  1MSH A;  4U68 A;  2EPB A;  3FRP B;  1AN8 A;  4N9P A;  2JYO A;  3T56 B;  4A3F B;  3SVM A;  5G3L F;  1GXD C;  3M85 A;  3NQT A;  4HTH A;  2OF1 A;  1TY0 A;  1IYV A;  4C3I G;  4PMB A;  3HRZ C;  4AYB B;  1Q90 A;  1NR2 A;  5IGG A;  4CJ0 B;  2CW0 D;  3I70 A;  3K59 A;  3PO2 B;  2HCI A;  5EKL A;  3DM1 A;  5EPK A;  1S5F D;  2D5D A;  1B3A A;  2PZW A;  5F2D A;  5DAU A;  5CC4 A;  2K5Q A;  3EVQ A;  3M3Y B;  4IUQ A;  2QKI C;  4KTA A;  5HUR A;  2F0T A;  1EY9 A;  3QIA A;  4OHJ A;  1SMY D;  2KVM A;  1SNM A;  2EZV A;  2IPK D;  2PZU A;  1HPC A;  4MHE A;  1JWU D;  4TQU S;  1TR5 A;  1JQY D;  2F0E A;  4RA8 A;  1Z6H A;  1Q1E A;  4H13 C;  1G8Z D;  4DGZ A;  1EEF D;  1PTO B;  3J7Y W;  2XN9 C;  2L12 A;  2JA5 B;  3S15 B;  1WTR A;  3K5L A;  1QB5 D;  3TZU A;  5I9P A;  3CHB D;  3HOY B;  3X3N A;  5ELB A;  5BN5 A;  4FXK C;  1OXX K;  1L0Y B;  2K7V A;  1F2L A;  5KIX A;  2I46 A;  5CMD A;  2E74 C;  4FF2 A;  4O1N A;  2SNS A;  3J80 E;  1SBB B;  4L6T B;  1TS5 A;  3ITP A;  3I4M B;  5I6Y A;  4G4K A;  2C5C A;  3F2U A;  5KYL A;  1WCM B;  1KDB A;  5C5L A;  4MIU A;  1PZI D;  5EBD A;  1JOQ A;  2EYJ A;  3E5S A;  4KY5 A;  4JK1 C;  5I2Y A;  1PLF A;  2R6G A;  4KN4 C;  3WOF A;  3QO2 A;  5DEH A;  1PZK D;  3J7A V;  3HEJ A;  1FGB D;  5C6A A;  5JVH 3;  1S5E D;  1NUC A;  2ICI A;  5J1Z A;  3H0G B;  4KMU C;  1V43 A;  3QOL A;  1H9S A;  1HFN A;  1HUN A;  1HTL D;  1JOO A;  4Z9C B;  1CK1 A;  1X3Q A;  1OXV A;  2LS0 1;  2QF7 A;  3RZO B;  3MZ5 A;  2SOB A;  3C1E A;  2K5D A;  4TRD A;  4C1N I;  4FP5 D;  3CKI B;  1NSN S;  2F0S A;  2O4X A;  3AU7 A;  3H94 A;  4ZUJ A;  2F0J A;  1I4X A;  5BN4 A;  2XVS A;  4K2K A;  3KBX A;  3PUX A;  2NBF A;  3K7A B;  4RKL A;  1EQV A;  3OOC A;  5IOD A;  1YNN C;  2YU9 B;  1E0B A;  1I6H B;  2NN6 I;  4FF3 A;  2Q8T A;  2RVL A;  1BQQ T;  3R2T A;  4F8M A;  1KLG D;  2HUG A;  1EY6 A;  3K57 A;  1WTQ A;  5C0X J;  4ZRZ A;  1GHK A;  1SEB D;  1LT3 D;  5NUC A;  2ZXP A;  3ND8 A;  3R93 A;  3PUW A;  1CM9 A;  1T5E A;  1ET6 A;  1ZYR C;  1C48 A;  4BWG B;  1KDA A;  2HDM A;  4IN3 A;  2F0L A;  4TSS A;  1FR3 A;  1F2Z A;  3I4N B;  1SYG A;  1H9K A;  2B2W A;  2KCC A;  4KY7 A;  3L3O C;  1SYD A;  3ERQ A;  2B8G A;  3SEB A;  4C2M B;  1OO9 B;  1DXM A;  5C3E B;  3S1R B;  1S5B D;  1KAA A;  1FNU A;  1STB A;  1CA5 A;  1TT2 A;  1YNN D;  2IWH A;  1XX8 A;  1JCK B;  3Q24 A;  4XT3 B;  1AFP A;  3TBI B;  1PXU A;  1MI2 A;  4K6L A;  3GTM B;  1R4Q B;  4DAY A;  2F0V A;  4HSP A;  3VR6 A;  4OO1 I;  3I91 A;  5CV7 A;  1U4L A;  2F0K A;  4U67 3;  4XYQ A;  1X32 A;  4PQX A;  1CTM A;  4NKL A;  3MAQ A;  4OIK A;  4C1N K;  2ZXR A;  1TVX A;  4KI0 A;  2R7Z B;  4X3S A;  1ZYR D;  3BVM A;  4FVM A;  1STH A;  1PTO F;  3MVV A;  2NWG A;  1Y1V B;  2K32 A;  1F2Y A;  1RCV D;  5COY A;  2E2H B;  1CHQ D;  4XDX A;  2IT1 A;  2X69 A;  3QG1 A;  3P7J A;  3NSW A;  5D14 A;  2VB3 X;  2C9O A;  2F3V A;  5FO7 B;  1LTG D;  2RKS A;  5JPN C;  3OSO A;  4EQO A;  4QMG A;  4Y7N B;  3WDN A;  1D1K A;  1PRT B;  4F87 A;  3A8I E;  3D4D A;  1SSO A;  1S5D D;  2VNU D;  1EU3 A;  2KEE A;  1O80 A;  4R8I A;  1G2S A;  5JPM C;  4M8A A;  4IZ8 A;  4OIJ A;  4KN7 C;  4A3B B;  2OEO A;  2E2I B;  3NQI A;  2K05 A;  2A69 D;  3R8B A;  1DD2 A;  5IGE A;  4CKB A;  1ML0 D;  2BDO A;  4K6D A;  1PTO H;  3R3O A;  4HN7 A;  3W3A A;  3MTS A;  4C3H B;  2DY7 A;  1GHJ A;  5T1G A;  3A56 A;  2KA7 A;  3OMC A;  5JJZ A;  4TKO B;  5EGT A;  1Q1B A;  3IFT A;  1DOM A;  5A35 A;  3SK8 A;  2K5W A;  3H09 A;  2N55 A;  3LX0 A;  1LTR D;  5C4Z A;  5KNB A;  1STY A;  3EFX D;  1RJT A;  2AWO A;  2A73 B;  1F77 A;  2PZT A;  1SAP A;  5M5Y B;  5E3F A;  2B2V C;  1STN A;  3MA2 B;  5KGU A;  1GUW A;  5M9O A;  5JEA J;  1EZ6 A;  1SE4 A;  1QCB D;  1XTC D;  5CGK A;  2F3W A;  3P20 A;  1K83 B;  1ZEQ X;  2F0O A;  1CQF A;  3PV0 A;  3H6M A;  2B63 B;  2A6E C;  2KEC A;  3BDC A;  4HAE A;  3SR1 A;  2K1B A;  1NCV A;  2SDF A;  3GTP B;  3PIP 3;  1Q8I A;  2F0H A;  3OWE B;  3QWN A;  5A2Q E;  2NZ1 D;  1S5C D;  4PNY A;  1F9Q A;  2AUJ D;  3D8G A;  4OL7 A;  5FOB B;  3HZX A;  1PFN A;  2B2Y C;  4CGY B;  3IAY A;  3HOV B;  4L63 B;  4QB4 A;  1TWG B;  3RMH A;  5JEA H;  2F0I A;  3GTJ B;  4IFD H;  4BY7 B;  2PW5 A;  3T51 B;  3D6C A;  3ERO A;  4BS9 A;  2R93 B;  3V96 A;  2LMC B;  1YNJ C;  4DK0 A;  5D65 A;  3K58 A;  2NVT B;  4B08 A;  3K5N A;  2Q8I B;  4Q5V A;  4EQP A;  1I4P A;  2X6G A;  2MPM A;  3GO5 A;  1Y8O B;  1EYC A;  5CBA E;  1HXY D;  5C4X B;  4WJW A;  1K8O A;  2ENB A;  4G7Z C;  3EJI A;  4X3T A;  2F0U A;  3DUZ A;  4QCL A;  2G9H D;  5FLX E;  1SNO A;  3T16 A;  1JB3 A;  1ZKO A;  1R9T B;  1EY5 A;  1HFG A;  4A3J B;  3W2D A;  2J0T D;  3JAM L;  1PRT F;  4A3K B;  1EU4 A;  4KKS A;  1WVL A;  4ZAI A;  3S1Q B;  1OXS C;  1IL8 A;  4RGT A;  3D31 A;  2RSN A;  1QE6 A;  1TS4 A;  1PFM A;  2DNC A;  2B2V A;  1YNJ D;  3HOZ B;  3SHL A;  2XNA C;  2JE6 I;  3FEW X;  2AQ1 B;  3GTQ B;  5JAV A;  4BBS B;  1IYU A;  2EJG C;  3VYT A;  1LAC A;  5EBC A;  1QNK A;  2KED A;  1HQR D;  3A55 A;  1JE4 A;  4OO1 G;  1SNC A;  4IUR A;  1Y1W B;  1ENA A;  1BDO A;  1O7Y A;  5E4W C;  5JEA G;  1HRJ A;  2RDF A;  2EY1 A;  5ELC A;  1EY8 A;  3OIP A;  4IFD G;  1ZXT A;  1C8C A;  1DCZ A;  2ZXO A;  1HUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...