4ZUIA

Crystal structure of staphylococcal nuclease variant delta+phs v23h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTHKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zuiA00
5KGUA 2EYFA 2F0TA 4YIJA 4RKBA 1STHA 2F0PA 4K5XA 3SK8A 2PW7A 2PW5A 4KD3A 1STYA 4EVOA 4WORA 2SOBA 2QDBA 3MXPA 4K5WA 4PMCA 3NUCA 5I9PA 4EQNA 3S9WA 5EKLA 5C4HA 2RDFA 5KYLA 4N9TA 5I6YA 1KDBA 5CV5A 4ZUJA 4KJNA 4ID6A 5I6WA 1SYBA 3OMCA 5KIXA 3NXWA 4EQPA 4IZ8A 4B9XA 1AEXA 1EQVA 3SK6A 1SYFA 1TQOA 3OMGA 4J1MA 1NUCA 3SHLA 2HQEA 3SR1A 3TP8A 4E6IA 2EYHA 2PZTA 2PQEA 1A2TA 4DU9A 2LKVA 5C4ZA 2PZWA 1SYCA 2RKSA 4K2KA 5DEHA 1EY6A 5E3FA 1SNCA 4B9WA 1EY0A 1SYEA 1STGA 2EYPA 2F0VA 2F0IA 3D4DA 1EY4A 1SNDA 4J6HA 4KJOA 3V2TA 5M9OA 3ITPA 1U9RA 2F0FA 4KTAA 4OL7A 2F0EA 2KHSA 5EKKA 5F2DA 3MVVA 5HGTA 5IOCA 3C1FA 1A3VA 1F2MA 5CV6A 5IGDA 2F0JA 4HTHA 4PMBA 1A3UA 3C1EA 4HMJA 4QB4A 5CV9A 5C3XA 4F8MA 3NHHA 5CGKA 1ENAA 1KDAA 3NQTA 4K2LA 1EY7A 1KDCA 5ISRA 3TMEA 2F0MA 2F0UA 5KEEA 1JORA 4DF7A 3T13A 1II3A 4K8IA 4NKLA 2F0WA 4F7XA 2EYOA 1STNA 3SXHA 5IGGA 5C5MA 3H6MA 4KV6A 1KAAA 2F0GA 4K14A 4KY5A 4KY7A 4EQOA 4QF4A 1TT2A 4ODGA 5IGEA 3EROA 3SK5A 5JOBA 4DGZA 1A2UA 3T16A 4WRDA 5NUCA 3EJIA 3OSOA 4ZQ3A 1TR5A 3TP6A 1EZ6A 5E1FA 1JOQA 4IALA 4N9PA 1A3TA 2F0NA 2EXZA 1EYDA 5IODA 4KD4A 2RBMA 5EGTA 1SNMA 5J1ZA 1NSNS 3U9OA 5C6AA 3MZ5A 5IGCA 3NK9A 1SNPA 3MEHA 3SK4A 2OEOA 4NDXA 5JAVA 2F0LA 5IGFA 3QB3A 2ENBA 2F0DA 2WACA 3QOJA 4R8NA 3D6CA 2PZUA 5IIFA 1ENCA 2F0HA 1EY8A 3HEJA 1JOKA 1SNOA 2EYMA 2F0OA 4TRDA 3BDCA 4NMZA 5C3WA 5IGBA 5HURA 5KRUA 3D8GA 3DHQA 1EYAA 5K5PA 4QMGA 3DMUA 4PNYA 2EYLA 2M00A 2OF1A 2OXPA 2SNSA 4H7BA 4I65A 3D4WA 5CC4A 1EZ8A 3E5SA 2PYKA 4LAAA 1EY5A 3QOLA 5CV4A 4HMIA 1STAA 3NP8A 5CR3A 3VA5A 1EY9A 3TP5A 4NP5A 1IHZA 5I9OA 5DAUA 2F0KA 1SYGA 4IUNA 4K6DA 3P75A 3R3OA 2F3WA 2F3VA 4DFAA 5J22A 4MIUA 3EVQA 5J39A 1JOOA 2EY6A 2NUCA 3OWFA 4RKLA 2EY1A 5C5LA 3BDLA 1SNQA 3TP7A 4G57A 5CV7A 2F0QA 3MHBA 4ME5A 5CV8A 1STBA 4K5VA 2SNMA 3PMFA 4ZUIA 5KYIA 3HZXA 2EY5A 2KQ3A 2F0SA 4S3SA 2O4XA 2EY2A 1EYCA 3ERQA 3P1HA 1RKNA 3LX0A 1F2ZA 1F2YA 2EYJA 4KY6A 1SYDA 4KHVA 4K8JA 3RUZA 1KABA
chains in the Genus database with same CATH superfamily
2VNUD 3B6YA 3DM1A 4EVOA 2QDBA 1TWAB 3CRLC 3TQYA 4BBSB 3E6ZX 1MD2D 5ELOA 3I4LA 3KOJA 3PIPA 2DNCA 1BBUA 3TSSA 1NUCA 4DV2L 2HQEA 4A3BB 4KKSA 2PQEA 4IPCA 1XTDA 3URYA 1IYVA 2YTYA 4QIWB 4Y52H 1V1PB 3K58A 4OXPA 3KF8A 4HIKA 1IL8A 3JAME 4JI5Q 3KF8B 1FJGQ 5CGKA 4A3EB 5JJIA 2K01A 2ZTDA 2BH8A 3Q0AA 4A3KG 1N34L 2EYOA 2WP8J 3RR5A 3MXGA 1OXSC 3K7AB 1LT4D 5IT9c 3MTSA 3X3MA 4DV4Q 1OO9B 3M3YB 4X3KA 5IE8A 2UXBL 3CP0A 1S5ED 1XNRL 1I50H 1DONA 2ZTCA 4JC0A 2UXDL 2PI2E 5IGFA 4DV1L 3J7A5 1GM5A 3QG1A 2Z9HA 3T51B 5K5PA 1XX8A 3DMUA 4DR4Q 2CHBD 2B3GA 4ME3A 1N8RC 4HMIA 1WI5A 1KRSA 3AYHB 3HOUG 1UEAB 1K9MC 1SXTA 1SE3A 2QEJC 3DEOA 2VQFQ 4P73A 4R4QA 3I90A 3KJPA 1BBWA 1FD7D 1PH5A 1UAPA 1PYSB 4WJ3M 3CCLA 2K5QA 5JPNC 1VMPA 1GUWA 3RLFA 5CV8A 1NBWA 1CI3M 3HOUH 2PI2A 2HHHQ 1X3QA 3AFPA 4S3SA 1MI2A 2R93H 3FEWX 3IL8A 5K36G 3LX0A 4B3MQ 4XYQA 1JT8A 4GOPC 4IO9A 2VUMB 1GXDC 2CKZB 3SK8A 4GNXC 2K5HA 4WORA 4DR6Q 4C1NI 4BY1G 4IUUA 1R9TH 4PV1C 2SDFA 3ULJA 4NXML 5M3FH 4A3KB 1AEXA 3SR1A 4J1MA 1VQNA 4BY7B 4JBKA 2YV5A 3K5MA 4EX5A 2F0VA 1PTOF 1QVFA 4C1NK 1YBYA 1L0WA 1U9RA 2H4OA 2ICIA 1YNJD 4PMWA 2RQXA 1SJED 2B2WA 1I4RA 4UP9A 2BA1A 2NBFA 2CWAA 1Q46A 1LT5D 3WOFA 4C3IB 3OTOQ 4IFDI 1ENAA 4IUVA 2VUMH 2NVTH 1GO3E 2E75C 4FXKC 2F4VQ 1II3A 4HJ8A 2F0WA 4IUTA 1HTLD 1KNEA 2OCEA 4LMQD 2UU9L 1SFOB 2PO4A 5LL6X 5CYUA 3PIP3 2QA4A 2Z1CA 1BF4A 4NPSA 1FNUA 2I0QA 1ZYRD 4N9PA 4A3DG 4GLXA 3OWEB 4NB3A 4WJWA 2RBMA 4A3JH 1NSNS 3A7AB 4UY8C 3JC66 3RLOA 1G8ZD 3W2DA 1XMOQ 2EJMA 4GN3B 2QILA 5M3MG 4U673 3G71A 3C2PA 2DUDA 4X64L 2NZ1D 1PH2A 3BZCA 1QNKA 1BKBA 4AH6A 1U0LA 3KDFB 3SEBA 4A3IB 2AWNA 2HDMA 5M3FB 1BXTA 4ZAIA 1Y1VH 5I9OA 2VQEQ 3ONAB 4DR5Q 2AHOB 3W1GA 1XWEA 1VQIA 3OW7A 1TIID 2F3VA 3A74A 4QIWE 3LNNA 1YHQA 2NVYB 2SNMA 4Z9CB 2L12A 3BJUA 1Y14B 3H91A 4GZYC 1VQ8A 2DY7A 3BVMA 4DUYQ 3PO2H 1B8AA 1Q12A 4DR3L 2JA9A 4A3GB 4Q0FA 5JEAG 1Y8PB 4JG2A 3CCVA 2JA7B 1FVIA 2UUAQ 3GTPB 2R92B 4ZUJA 3HOWB 1Y1VB 4GOPB 5M3MH 3SK6A 2B2VA 4A3CG 1HTPA 3M7NA 2Z6KA 4E6IA 4GNXB 3H3VC 1D8LA 2PZWA 4AYBE 4LF4Q 5DEHA 5FO8B 3MFYA 1RHPA 1V1QA 3X3NA 2NVQH 4FDBA 4O2DA 4J8QA 1VQPA 2BE5C 1BO0A 4FP5D 3E3XA 2MP1A 1DOMA 3RMHA 4QUCA 4POFA 1GUOA 2F0UA 1IBMQ 3AEVA 4KN4C 1C0AA 1MIUA 1D1KA 1T5XD 2B2UC 1KHIA 2EDGA 4XTCS 3OIQA 5JJKA 3VYUA 5GAHC 3V05A 4MNOA 2RHQB 4OEMB 1PTOC 4JI1Q 3DM3A 1K73C 2KA7A 3DWPA 4YWLA 3MZ5A 1SNPA 3G7LA 5EPLA 2E5LL 1JE4A 4HEDA 2F03A 4LF5L 2P5ZX 4OIKA 1VQAA 1I94L 2NTTA 2EYMA 4TRDA 3BDCA 4H02A 5E4WC 1VMCA 2L1BA 4DR2Q 2K04A 3PIOA 3R2TA 4QMGA 3S16B 4BA1I 2EIFA 3MAQA 2EYLA 2M00A 2R61A 3OOCA 2K50A 2JN4A 3PO3H 1SE8A 3A55A 1LYLA 3SDZA 3I4MG 5IP9H 4LFBL 4Y7NB 1HZCA 1E2WA 3NE5B 1I6VC 2MO0A 4IUNA 5KNCA 2EQSA 4U68A 5C44H 3GTKB 5C5LA 1X56A 4ZYSA 1KLGD 2WKDA 4JI5L 1H95A 3A8JE 1STBA 1BUVT 2B2TC 2Q8IB 1WTQA 2K6AA 3M4YA 1N34Q 1EFID 1H9MA 5TSSA 4JI8L 1PFNA 4H0LC 1QWYA 2Q2HA 4O42A 4DV4L 3J81j 4OO1G 2N78A 1G2SA 4CGYB 2PW5A 3D4RA 4KD3A 4GKJL 2YTXA 2MHVA 1L1OC 3F2BA 1B1ZA 2KBNA 1FNWA 4HAEA 1VQFA 3A56A 1WTVA 4DV1Q 5M5WH 2XVSA 1EUJA 4CDEC 2Z0SA 3OMGA 3SHLA 5D3IB 5BR8L 4A3BH 3U50C 1EY4A 3MEFA 1C7YA 1MJEA 4BBRG 1HUNA 1HHVA 3T53B 2K14A 5ELCA 5HGTA 1IBLQ 4B3TQ 1QNUA 3HG9A 2N8NA 1CHQD 2GA4B 2F0JA 1XMQL 1I4XA 3Q24A 1QZGA 2MGSA 4Y7NH 3NHHA 2VY3A 1JCKB 4CKCA 3KBGA 3TMEA 2IJ0A 2BOSA 1WCMG 2XRSD 5M3MB 3S17B 3I8ZA 3R93A 1HNWL 3SXHA 4R8IA 1BOSA 4JYAQ 1KAAA 4EQOA 1RD9D 2K75A 4A75A 4MN3A 4DKAC 1S4ZA 1AE3A 1B9MA 1B53A 4A3LH 5M5WB 1MSHA 2EJFC 5M3FG 1JOQA 3I91A 1A3TA 1Y8OB 1YEZA 2EXZA 5C44B 1EYDA 2RCFA 4C3JB 3FDTA 1TWHB 3NK9A 1WJJA 3QB3A 3BZDB 2NZHA 2Q8TA 1G2TA 2LXJA 4JVZA 3PO3B 4PZ6A 1X55A 3RN2A 4NXMQ 3CXCA 1X65A 2ICEC 2Z4IA 5JVG3 2JA8G 2FXQA 1JE5A 1YHAA 5DNFA 2PYKA 1SE4A 3VA7A 4KK7A 2AQ1B 5COYA 5A2QL 4LJZC 5CR3A 1HZAA 4JW0A 2HQLA 1IHZA 1Q3LA 3K5LA 2I5HA 1LTGD 2H5XA 1M1KC 4MIUA 1EU3A 4UAIA 3NELA 1CZWA 3VYSA 5ELNA 2HCCA 3G48A 1LV9A 5C0XJ 3OTOL 5C4XB 3BDOA 1S3OA 5GROA 2K5WA 1FR3A 1TWFB 2B2YA 1EYCA 4OGQC 4H13C 3E0JA 1BVSA 1JWMD 2UU9Q 1I50B 4KY6A 3H0GH 3RUZA 4DR7Q 1A6XA 3NTKA 3CMAA 4R4IA 1EQRA 1GUTA 1C4QA 5I2XA 1T5EA 1OXVA 3CW2C 4ZKCB 1EQVA 5BN3A 1CKNB 2L0CA 4LUOA 1CFMA 1JC7A 3CHBD 3CAMA 2JYOA 2B2UA 2FINB 2MJ8A 1XMOL 1IW7C 1N33Q 1A0IA 1W6JA 2E76C 2CH4W 2J4XA 4X65Q 3KUPA 1JWSD 1O7IA 3C1EA 4YY3Q 4IN3A 1VQ5A 1KDAA 1KDCA 2VQEL 5EPJA 2IPKD 2JA6B 4RWSC 4LFAL 1LABA 1PLFA 4HJ7A 3FVQA 2CW0D 2RSOA 1ET9A 4KV6A 2C5CA 4APVA 4DAPA 1IXRA 1WFQA 2R7ZH 1XTCD 1ONLA 1A2UA 1TR5A 4MTNA 2B2VC 1HR0L 2KHIA 2NN6G 3CPWA 1S5DD 2A6ED 4V190 4OX9L 2R92H 4DUYL 3GTOH 3SK4A 2B63G 1AZQA 5IT9L 1CKOA 4R8NA 2ZXRA 3I7FA 3L2PA 4DR3Q 3GTQH 1DOLA 1JOKA 2F3IA 1EEID 1HNZQ 5IGBA 1QG7A 5HURA 1I4QA 2UUAL 5C4XG 2Z8LA 2TSSA 1VQ9A 1I5FA 1NTGA 2A69C 3E5SA 2IL8A 1VQLA 3UE1A 5LMUQ 2WAQB 1WD0A 2JA8H 4DUZQ 2JE6I 3GTGH 1IZ6A 4XT1B 1SYGA 4K6DA 1D6EC 4QQBX 3SVMA 4CHTB 4DFAA 1XXGA 3EVQA 2KCTA 4YCWA 1RL2A 3S1NB 4IOCA 1N32L 1PH7A 3U4VA 3M4QA 2F0QA 2VZAA 5K36H 2CWPA 3NTIA 2A6HC 1ZEQX 4I7ZC 3GTJH 1F77A 4UPAA 3K0XA 3CC7A 2E2IB 4DK3C 3K7UC 1WTPA 2KOLA 1O80A 1LTLA 1X32A 1JWUD 2NN6H 1GUGA 3VDYA 4C3IH 4ULLA 1RJTA 3MXPA 4XQNA 4EQNA 1ET6A 3S9WA 5CORA 2SEBD 5KIXA 4IZ8A 1NMFA 5AJ3L 4LFCQ 1N9WA 1SYFA 4CJ2C 2WFWA 3HOWH 1V8QA 5FLXL 2RKSA 1SYCA 1X3FA 2L4NA 4DR2L 4MHEA 2EYPA 4A3BG 2F0FA 1IBKL 2M9VA 3MVVA 3K6OA 3PCOB 2PNHA 4HTHA 4B3SQ 1HFNA 3VR5A 2XGTA 3PV0A 5GADC 4ZLTF 1LTID 2WB1B 3PF5A 5FO7B 3RD4A 3HOVG 4KY5A 3Q8DA 2JA5B 4ODGA 2AUKA 2JP1A 1BR9A 5E1FA 4RCOA 4DV5L 2RHSB 3D31A 5D3DA 1BBXC 4OO1I 5EGTA 2JA6H 3HOYG 1VF7A 4GLAC 4JI4Q 5DM63 3IAYA 4LF8L 1G91A 4BY1B 5LL6S 3QOJA 3NSWA 1HA6A 5IYDG 1NNXA 1PTOB 5C3WA 4HSVA 1QUQB 4BY7G 1TWGH 3D8GA 1EYAA 1KC8C 1JR0D 1EU4A 3TREA 2A6HD 3J7YW 1T9HA 3RZDB 1B50A 4XT3B 3CRKC 4IJHA 1MHWC 5CC4A 4WJ4A 2KENA 4ALPA 4WFN3 1VQCA 3ER0A 3TEHB 2R7DA 2AQ2B 1IYUA 1U4PA 2LMCB 3TN2A 1IBLL 1TWAH 4FXDA 2D0PA 4JI0Q 2VW9A 4ME5A 3Q6SA 3W5OA 3DUZA 2NVTB 5KYIA 1JQYD 4G4KA 4HJAA 1HNWQ 2Z6KC 4MZ9A 1MSGA 2AKWB 3VR3A 3HOZH 3EQLC 3STBD 2F0PA 4K5XA 4A3JG 2K4KA 1JICA 3U4ZA 1Q81C 4L5TA 5I6WA 1B7YB 2HD3A 3LGJA 4B9XA 1LLRD 3TP8A 1X9NA 3I55A 2GN5A 3ZJYC 4HJ5A 3W1BA 1PH8A 2EXDA 4K2KA 4LUZA 1SNCA 1H9KA 3TZUA 1W2BA 1JB3A 2DNEA 1B4OA 3H15A 2RCNA 4LF7L 4ZCKA 5IP7H 4C56C 5CV6A 4A93B 2B2YC 4QB4A 2FFKB 4F8MA 2E8GA 1PHJA 3PUXA 2E2DC 3G6EA 1SMXA 1SSOA 2KEEA 2N49A 1K83H 3PO2G 4FYDA 2NVYH 2D5DA 1HZBA 2G5DA 3Q22A 4BY1H 4CKEA 4LWCA 4X3SA 2B39A 1W6KA 4H44C 3MEHA 1SMYC 4NDXA 3BVGA 2YU9B 3FKIG 3E0EA 3GTLH 3HOZB 3HOXB 1E1TA 1M90C 1CSPA 3DWQA 4JI3L 4DXGA 1AW7A 1D5ZC 1FGUA 1U5KA 5IYBG 3MXNA 1OTCA 2UXBQ 3MXNB 1E0BA 1EL0A 4X66Q 1Y69U 1EZ8A 3K80C 4V0BA 1R9TB 4P2CB 4RHRA 4XIGS 1C8CA 3VA5A 4BBRH 4HN7A 4NP5A 1N33L 5HGQA 3K8AA 4YHHL 3WOEA 5FJ8G 4X65L 5C3EG 5CBEE 3F1ZA 4YWKA 2PNRC 4ZUIA 4X3UA 1E2VA 2LXKA 4C3HG 2IX0A 2NN6I 4KHVA 2JA7H 3G6JB 1KABA 2PQAB 1V1OA 4JK1C 1TWCH 2K33A 2C9OA 2BA0A 1HR0Q 4LF9Q 2CCZA 3KF6B 4GNXA 3FRPB 4N9TA 3PUYA 2HHHL 3OPOA 2E2IH 1TS3A 2X6GA 5IYBH 3UDGA 1VQHA 3CCSA 2XRQD 1FYCA 3S24A 5EJWA 5C4ZA 4BBSH 1EY6A 1AZPA 2QGQA 1K8MA 3S1QH 2OQ0A 5IP9G 3A5UA 1G6PA 5FLMH 2F4IA 1CZGA 4OONA 5IGDA 5C0XH 5C3XA 3EIVA 1C48A 1Z6HA 2F0MA 2R6GA 4HR7B 1H9SB 1CKMA 3LWEA 4B08A 3GTKH 3WDNA 4ZK9B 2HDLA 1H9JA 1WCMH 1S5BD 1W3SA 4P71A 3UI2A 3R8BA 2CH4A 3CD6A 1LTRD 5JAVA 4OO1H 1D5MC 2YTVA 3CC2A 5H1SE 1STEA 3ND8A 1D7QA 3S16H 2F0OA 4RGOS 1QCBD 1GUNA 3M9BA 3DHQA 4QUFA 3CC4A 4DV6Q 4P72A 4DV7Q 2OXPA 5AJ3Q 4UDUC 2L5TA 5LMNW 2J7ZA 1QJOA 1LTSD 2YU9H 3U9SA 2KVMA 4G7ZC 4DN4M 1EY5A 2Y0SG 2D2CC 5ELBA 3QJYA 4DAYA 4JOIA 1RF2D 3P75A 3M3YH 1XNQL 4Q5VA 3HKZE 1HQMC 3CCRA 1E22A 3M4PA 3H0GG 4AYBB 3OHXC 1AE2A 1JMCA 5DLQE 2EY5A 3NENA 1EFWA 2ZM6L 2R3ZA 2CW0C 2JSOA 3HKSA 1RKNA 2MUYA 2PCFB 1UNSA 1D1IA 1STHA 2VS1A 3AU7A 5EPKA 4XQQA 4DV3L 1H9RA 4DV5Q 3H09A 3J81L 1X3PA 2BDOA 5A2QE 4GLVB 4JI2L 2RDFA 1ASZA 1PDQA 5I6YA 4KJNA 5L37A 4EGVA 2N88A 4DXFA 1Y1WH 4LF8Q 3PO3G 2FMMA 4BA2I 1JJGA 4LNQA 4DAVA 1RTOA 1PMRA 3TDQA 2I46A 1ENFA 4DU9A 2JA8B 4B9WA 1UEBA 5IYDH 2Q2TA 5M9OA 1JB7A 1PH1A 2LY7A 1EQQA 4KMUC 1WVLA 2VB2X 2B2TA 1GHJA 5EKKA 2EVBA 2ZT9C 2QEXA 5CV9A 3VR6A 3S1RB 3A54A 1O7LA 1U4RA 5GQOA 3S2DH 4LF4L 4DV0L 3S14B 1TY2A 4QY7A 5IGGA 1SN8A 1RCVD 4QF4A 4JBJA 5LMNL 3BZKA 4WRDA 1KRTA 4FF1A 4R4TA 1CTMA 2N3SA 4A3KH 1MBYA 4IALA 2OTJA 1S40A 3GTOB 1LUZA 3TS2A 1OXTA 5J1ZA 1LTTD 2HCIA 3P20A 1S5CD 4RAUC 2OEOA 1M4VA 1NR4A 3SGIA 1PZID 1CM9A 4A93G 1PRTF 3HEJA 4FNFA 2XTIA 4N8FA 1L2FA 1X3EA 5KRUA 4JOIC 1AN8A 4YWMA 1UE6A 2WINB 4JI1L 1XPOA 2E74C 4I65A 4H7BA 3N6RA 1ESRA 3D6WA 2ZJRA 4PG3A 3I73A 2Z6BA 4ILWA 4LF5Q 1G51A 3CCJA 3K59A 1CKNA 3JAMi 5T1GA 1I94Q 1A15A 3KLRA 2ZTEA 4LF7Q 2HIVA 4FF4A 5C3EH 1UE7A 2EY1A 3GO5A 4A3IH 1PFBA 2PMZE 4HCSA 5CV7A 1V1PA 4BS9A 1HUMA 1K83B 3PMFA 5IT9E 2PPBC 3S1RH 2NYZD 5JEAJ 3HZXA 3I72A 1PFSA 4A3MG 2O4XA 5C0XI 4R4OA 2EOTA 3T4AC 1AP0A 1B70B 4GN4B 4LAAA 4A3FH 2V4DA 2B63H 1GVPA 3GP7A 4NW2A 1ZXTA 4LF6Q 1J5EL 3CCQA 5G3LF 5C4HA 3ZYYX 1SYBA 2HUGA 1M8AA 1P16A 5GAEC 1Q1EA 2VL6A 5C4XH 1UUPA 2EYHA 2PZTA 4JI3Q 2LKVA 2MNAA 1VQBA 3NQIA 3RZOH 1N36L 1EY0A 1ML0D 3V2TA 2M2LA 2Q8RE 2D0OA 3BU2A 4FXGC 3NBHA 1EOTA 3J7AF 3OW2A 4GKJQ 3NBHB 2F0EA 3KBXA 2OWOA 1TS2A 2NVQB 1DXMA 1A3UA 3HFZB 3H3VH 3ULPA 2O2LD 3S15H 5A35A 1EWHA 1Q86C 1F9SA 1LACA 2TMPA 1TKWB 4L8JA 4YHHQ 1YI2A 2JA5H 4F7XA 5C5MA 1K0RA 1EIYB 1LTAD 2DJGC 5JOBA 5M5YB 5NUCA 4B3TL 3OSOA 5GAGC 1DM0B 3A7LA 1GKHA 1PH3A 1XMQQ 2VUMG 3EBEA 2ZXPA 5FLXE 2BH2A 2FHTA 2MO1A 1X6OA 2K5VA 1NCVA 2K32A 3IFTA 1HFGA 3F2DA 1WTRA 1YJWA 3UDXA 1X54A 5JJLA 3STBC 3J80c 1Q7YC 3NTHA 2QDLA 3H0GB 4CDDC 4IJLA 1Y1VG 1EOVA 4AIMA 3I4MB 2OTLA 4KKTA 4NXNQ 4HIOA 1ESFA 4L5QA 1EIFA 3IFDA 3NP8A 3M4OB 3GTMH 3A8KE 3OIPA 4ABNA 1Y8NB 2NUCA 4RKLA 4X6AH 2A1AA 4UHVA 1OXXK 1PRTC 5JPMC 3MHBA 2VXWA 1HCZA 3TRZA 4A3FB 3BVZA 5D65A 4C2MB 4QJFA 3ICEA 1K0SA 1L1OB 4ZRZA 3M7GA 4DNRB 1VQEA 4DV2Q 3AB9A 1PA6A 1EQTA 4PMBA 1BCPC 2EYFA 4KHPQ 1KXLA 1LTBD 2L55A 1KAWA 1STYA 1KL9A 1NE3A 5EKLA 1BQQT 1ICWA 4O0AA 4X3TA 2LS01 4JI7Q 1ICFB 3OMCA 3JAML 2A68D 2RVLA 3VR2A 1EWIA 1B2TA 1FL0A 4RMFA 3L9AX 5IWAL 2R93B 4DR7L 4M8AA 1QVCA 2UUCL 3HRZC 1SNDA 2JEBI 4IFDG 1NJIC 3Q23A 3HKZB 4DAYB 3P7JA 2KHSA 5F2DA 3S15B 1CHPD 3C1FA 3S1QB 5CBAE 1Z9FA 3VYRA 5KNBA 3GTGB 3GTLB 1UWVA 1IYJB 4HIMA 2KCCA 1Q90A 2A69D 4HSPA 1E1OA 1STNA 2IHFA 2WB1G 4XXEA 1ZKOA 4XDXA 2ES2A 3O13A 2PMZB 4CDCC 1E3PA 5I4DA 1TS4A 2F0NA 5AFWA 1U4MA 4YY3L 4DR4L 2ZM6Q 3S14H 2AWOA 1TU2B 1Z7TA 2QCPX 3FP9A 2R92G 2ENBA 1SR3A 2F0DA 4A3MH 1JJ2A 4DV3Q 1ENCA 3I4MH 1SNOA 3UE0A 2CVRA 1Q8KA 4DK6C 4JI2Q 3E9HA 4J15A 4DR1Q 3CQZB 4POGA 2FJ2A 3IKJA 1PRTD 1RIPA 1TVXA 2XWBB 5FK9C 4G7OC 4YCUA 4OX9Q 2O5IC 4IPHA 4IOAA 3QOLA 4GN5A 3PQIA 1DCZA 1UE5A 3A8IE 4GOPA 2D9UA 1B44D 3TP5A 3BYYB 2Q2IA 4X62L 5C0XG 3DWAA 2VB3X 2KCMA 3K7AH 2GVAA 3PGZA 1BCPD 2Y0SE 1JOOA 4KLKA 4DK1A 1NAPA 3A0JA 4KHZA 4RG1A 1HQRD 4IUPA 3JAMc 5LMUL 4DUZL 4OHJA 2L9HA 3PSIA 3KLSA 2R93G 4GKKQ 2ASBA 4A3LG 1I3QH 5EBDA 1TWHH 3P1HA 3I4NB 3GTPH 1A62A 5IYCH 1SYDA 1TWCB 2F0TA 3GTMB 3FPPA 3V96A 2BE5D 3CPFA 3KJOA 4AQYL 2B29A 5FKAC 3J80i 2A74C 1KDBA 5D14A 1ASYA 1PZJD 2NVXH 1HXYD 1KTKA 1EIHA 2NTSA 3CCUA 2N55A 2UUBQ 2OT2A 4RH6A 3HOWG 2KUMA 2E2JB 1PVOA 5BN4A 5IOCA 1SYEA 2AUJD 4TKOB 4JCVE 2QF7A 4GS3A 4L6TB 5FLXc 1FNVA 3ITPA 4A3MB 1KQSA 4OL7A 2R7FA 2RDHA 1D2BA 4R9WA 3K57A 4JV5L 3FKIB 1WOCA 1E2ZA 3K5OA 4LFCL 5KNDA 1O7ZA 1I6HB 1EY7A 1BNZA 4EQ5A 3CCMA 5KEEA 2K5NA 4F88A 3T13A 4G7HC 1SLJA 3I70A 3H6MA 4KY7A 4K14A 1VQ4A 3HOVH 1IBKQ 3J80L 1WTWA 3EROA 2G9DA 3SK5A 4FO2A 3J81i 1F9RA 4JBWA 4B3SL 2B63B 3S2HB 1PH9A 4DK0A 5C6AA 1KLUD 1SEBD 1TXYA 2DGYA 2PZUA 4PZ7A 2F0HA 1V9PA 4A3FG 1QZHA 4LF6L 3EFXD 1J5EQ 1P8LA 3I4NH 2F1MA 2XIWA 1Y1WG 1XYIA 3QWNA 4P74A 3L7ZC 1B9NA 1ILPA 4JI4L 3DXJC 1STAA 5ELDA 3QO2A 1EY9A 1N36Q 2NVXB 1VQ7A 1G291 1PXUA 2JQOA 1O78A 3PUVA 3T1HL 1YNJC 3S1MB 1D5XC 4HIDA 2EY6A 2MFIA 1WTOA 4I7AA 3ULLA 3TP7A 3UDIA 2JA6G 3HOYH 3QIAA 1BCPB 5JVH3 3F2CA 1K8GA 2IHEA 4DNIA 3K0YA 3H94A 3ERQA 3BS1A 1IKMA 4CJ0B 2I07B 3C46A 4C3JG 4JBMA 2OQKA 4K8JA 1CK1A 2B2WC 5KGUA 3I2ZA 3EN2A 1WYDA 2PW7A 1SE2A 4C3HB 1R4QB 4A93H 2X69A 4A76A 1VQJA 2GVBA 2KECA 4ID6A 2UXCL 4HCEA 1HPCA 2XN9C 4EQPA 1RTNA 1YNND 2AQ3B 1PYBA 4N8X1 1IBML 1I3QB 4ZKBB 4J6HA 1Q82C 4K6LA 4QCLA 1C9OA 2K1BA 1F2LA 4A3GH 3GTJB 1VQMA 1F9QA 3HS0C 1A3VA 4JPBW 1JJCB 4NXNL 5I2YA 2Z4HA 4BBRB 1H9SA 4HMJA 3I3CA 4K2LA 1O7YA 1NMGA 2JA5G 2E5LQ 3MC0B 3WWVA 1Y1WB 2WIIB 1WD1A 1GHKA 2F0GA 4O1NA 1IKLA 1B3AA 1Q8IA 3T16A 1WTHA 3HOYB 1AFPA 5T1IA 4JI6Q 2MQHA 1NY4A 1CQFA 1SNMA 3TS0A 5IGCA 5BN5A 4LFBQ 2K7VA 4C3IG 1YJ9A 2ZJPA 4IFDH 3D6CA 3BYTB 4OELB 4KHPL 2QW7A 3W3AA 3VR4A 2H1EA 4NMZA 3LWUA 2IW3A 2QKIC 4R4CA 4JI7L 2K52A 4OIJA 2OF1A 3RLNA 1DOKA 2DJFC 3L0OA 3TZDA 2IX3A 4FF2A 2A68C 3NEMA 5IWAQ 2UUCQ 4CJ1B 5DAUA 4JI8Q 5CMDA 1SMYD 3T1YL 1HNXQ 3R3OA 1EYGA 5IY0A 4B3RL 5J22A 4FF3A 3OWFA 3PUZA 3MA2B 4K0KQ 3MXUA 4X66L 2YYZA 3R2IA 2NB0A 1HRJA 1I4PA 4L5SA 3D3RA 1J9OA 2EPBA 1QE6A 2IWHA 5C4JH 3J81c 1S72A 2EY2A 4A3JB 3S1MH 2JA7G 1PZKD 2EYJA 1QUQA 4A3IG 5BR8Q 1MGSA 1F9PA 1XPRA 4A3DB 4YIJA 1EWCA 1U4LA 2SOBA 2K03A 5ELFA 3HGBA 4IPGA 1HH2P 1CUKA 2NWGA 4BY7H 4XYOA 1PTOD 1K8AC 3ERSX 4XQJA 4RGTA 4IURA 3QR8A 3RZOB 1TS5A 1ILQA 3GV3A 5G3LD 1A2TA 4IUQA 3AMUA 4FVMA 2JXMB 3S1NH 2O5JC 4DR1L 1VCIA 3D4DA 1SRUA 4JYAL 5E4XA 3T56B 2CFMA 4KN7C 4CBVA 2RA4A 4LF9L 1VQOA 3I4NG 4A3GG 1SJHD 2JJQA 5FLMG 3KLSX 2DN8A 3I56A 4X62Q 1JORA 1L0YB 4DF7A 2WAQE 1SFOH 1YZ6A 1CA5A 3GQBA 4UP8A 3KK7A 4DPGA 3U58A 3MFGA 1K3RA 2R7ZG 2XNAC 2F52A 3J7AV 4GKKL 4P75A 5JEAH 4IPDA 3S17H 3CCEA 2IX1A 1J6QA 2FMCA 3F8TA 2KEDA 2F0LA 2EZVA 1ZYRC 3KLWA 4A3DH 1EY8A 2B8FA 4KKUA 2CQOA 1YITA 4AQYQ 3BG3A 2E2JH 1K8OA 2KHJA 1DGSA 1LT3D 3HOXH 1CSQA 1DJRD 1Z47A 3KDFA 3J7ZC 2UUBL 1I6HH 4TVAB 5ELEA 5IP7G 5CV4A 2B8GA 3KYHC 1FJGL 2RDGA 5C3EB 2IT1A 1BDOA 4UP7A 3RNUA 1DYQA 1I4GA 5FJ8H 3NWTA 2C35B 5EBCA 4BWGB 5J39A 1CT1D 2V1CC 5FO9B 3CKIB 4DV6L 3J80E 3GDEA 4JV5Q 2EJGC 2K05A 4DV7L 1VQDA 1G6ZA 4C2MH 1KD1C 4K5VA 1A63A 1L0XB 2ALYB 1XNRQ 2WV6D 2WB1E 3S2DB 1EIGA 4C3JH 2UXDQ 1YIJA 4PZ8A 1XNQQ 4RCNA 5IGEA 2MPMA 5LHY1 4RKBA 1GUSA 1SDFA 3M4OH 3FKIH 1MJCA 4K5WA 1HZ9A 1GOZA 4F87A 2G9HD 3CF5A 1CQVA 5DM73 1EEFD 3A5ZB 1QB5D 1SROA 4A3EH 1B3QA 3DEPA 4LFAQ 1PV4A 5ISRA 1STGA 3M85A 2KCNA 2VQFL 1UE1A 4CKBA 4OWWB 1J8IA 1KNAA 4LW1A 1HR0W 1QVGA 1F2MA 3GV6A 2E2HB 3PIO3 2LFNA 1VQ6A 3F2UA 2I5LX 1E24A 3FMCA 3T1HQ 4K8IA 1VDZA 4NKLA 3RN5A 2AMCB 1R4PB 1FGBD 4B3ML 4DAMA 1HNZL 1QOHA 1TT2A 2DY8A 1YNNC 3IRBA 4DGZA 3KF6A 3EJIA 4R1JA 4ZQ3A 2RSNA 1RDPD 3NPPA 3TP6A 1PH6A 5FOBB 3HOVB 4PQXA 2IY5B 1K28A 4DR6L 1XJVA 1TWGB 4KD4A 5IYCG 3CMEA 1S5FD 1PTOH 5KYLA 1A8VA 5EKIA 4DV0Q 1SAPA 5IIFA 3RZDH 2Q2UA 3MWYW 3CU7A 4A3CH 4RFBA 5LMNQ 1VF5C 4DNTB 2X6LA 1PYWD 5M5XB 2UXCQ 4PNYA 2WKCA 4BXXH 2SNSA 1N32Q 4L63B 3D4WA 1VS0A 1YHBA 4KI0A 1BCPF 2K28A 5C44G 3C3LA 1CA6A 3DLLA 2A6EC 2ZXOA 2F4VL 4QL5A 4AYBG 3SE0A 3J81E 1PH4A 1L1OA 4G57A 2A8VA 1WCMB 3I4OA 3AFQA 4RA8A 3VYTA 3PO2B 2F0SA 4IQZA 2E2HH 3L3OC 3H3VI 1QILA 4CDFC 1F2ZA 3HKZG 1GD7A 4OWXB 1RODA 2NZOA 2ZJQA 4LUVA 5E7NA 5EQ0A 5I9PA 4PMCA 4JI6L 5M5YH 3NUCA 3GD7A 3HOXG 2K5DA 3ND9A 1IW7D 1LM0A 4YCVA 5CV5A 1LO5D 2XWJB 3D0FA 3K5NA 3NXWA 5EAYA 4X64Q 5JJZA 1TQOA 1GJXA 4TQUS 4BXXG 2R7ZB 3UDFA 1WTXA 3HP3A 1NR2A 5E3FA 4KJOA 2F0IA 3G4SA 4DR5L 4DA2A 4KTAA 4OWTB 2Y0SB 2A19A 3E9IA 1YJNA 3NBIA 4QGUA 3FPUB 4RHSA 3EA6A 3GTQB 1SBBB 2A5HA 4BBSG 1YNXA 1VQGA 3NQTA 5J3BA 4LK1C 3T1YQ 4MTKA 1HNXL 4B3RQ 1TWFH 5C4JB 2JEAI 2RF4A 4K0KL 1Q1BA 3PUWA 1EZ6A 1HJPA 3OYYA 1DD2A 5IODA 3U9OA 2WACA 4A3EG 2ATWA 5M5XH 1I4HA 3AQQA 1KIXA 2J0TD 1HA5A 1XPUA 1PFMA 1X3GA 2PQAA 2WAQG 2XSCA 3HOZG 2ID0A 4HJ9A 2BCOA 4JI0L 1E7ZA 1YVCA 2JK8A 2I5MX 3KFUA 2D62A 2HIXA 2HT1A 4L5RC 1DZ1A 3S2HH 2F0KA 3N52A 1OXUA 4M1UB 2F3WA 1K3BC 2L15A 2KJXA 1LT6D 3BDLA 1SNQA 1IL2A 4RGMA 1V43A 3K81C 4RGNA 1TY0A 2EE1A 1AH9A 3NWSA 3TBIB 2L11A 1MKHA 2A73B 3CQZH 3PF4A 2BDNA 2KQ3A 2CQAA 5HY6A 4TSSA 1VQKA 2LSSA 1F2YA 4IFDJ 1PRTB 4A4IA 3HOUB 4C3HH 3FHWA
chains in the Genus database with same CATH topology
2VNUD 3DM1A 4EVOA 2QDBA 1TWAB 3CRLC 4BBSB 3E6ZX 1MD2D 3I4LA 2DNCA 3TSSA 1NUCA 4A3BB 2HQEA 4KKSA 2PQEA 3URYA 1IYVA 4QIWB 1V1PB 3K58A 3KF8A 1IL8A 3JAME 5CGKA 4A3EB 2K01A 3Q0AA 2EYOA 2WP8J 3MXGA 1OXSC 3K7AB 1LT4D 3MTSA 3X3MA 1OO9B 3M3YB 4X3KA 1S5ED 1DONA 5IGFA 3QG1A 3T51B 5K5PA 1XX8A 3DMUA 2CHBD 4HMIA 1UEAB 1SXTA 1SE3A 2QEJC 3DEOA 3I90A 1FD7D 1UAPA 2K5QA 5JPNC 1VMPA 1GUWA 3RLFA 5CV8A 1CI3M 1X3QA 4S3SA 1MI2A 3FEWX 3IL8A 5K36G 3LX0A 4XYQA 2VUMB 1GXDC 3SK8A 4WORA 4C1NI 4IUUA 4PV1C 2SDFA 4A3KB 1AEXA 3SR1A 4J1MA 4BY7B 3K5MA 2F0VA 1PTOF 4C1NK 1U9RA 2H4OA 2ICIA 1YNJD 4PMWA 2RQXA 1SJED 2B2WA 1I4RA 2BA1A 2NBFA 1LT5D 3WOFA 4C3IB 4IFDI 1ENAA 4IUVA 2E75C 4FXKC 1II3A 2F0WA 4IUTA 1HTLD 1KNEA 4LMQD 1SFOB 2PO4A 5LL6X 5CYUA 3PIP3 2Z1CA 1BF4A 1FNUA 1ZYRD 4N9PA 3OWEB 4WJWA 2RBMA 1NSNS 3A7AB 1G8ZD 3W2DA 2EJMA 2QILA 4U673 3C2PA 2NZ1D 1QNKA 3SEBA 4A3IB 2AWNA 2HDMA 5M3FB 1BXTA 4ZAIA 5I9OA 3ONAB 1XWEA 3OW7A 1TIID 2F3VA 3LNNA 2NVYB 2SNMA 4Z9CB 2L12A 3H91A 4GZYC 2DY7A 3BVMA 1Q12A 4A3GB 4Q0FA 5JEAG 1Y8PB 2JA7B 3GTPB 2R92B 4ZUJA 3HOWB 1Y1VB 3SK6A 2B2VA 1HTPA 3M7NA 4E6IA 3H3VC 2PZWA 5DEHA 5FO8B 3MFYA 1RHPA 3X3NA 4J8QA 2BE5C 1BO0A 4FP5D 2MP1A 1DOMA 3RMHA 4QUCA 1GUOA 2F0UA 4KN4C 1D1KA 1T5XD 2B2UC 2EDGA 4XTCS 3OIQA 3VYUA 3V05A 1PTOC 2KA7A 3DWPA 3MZ5A 1SNPA 3G7LA 5EPLA 1JE4A 4HEDA 2F03A 4OIKA 2NTTA 2EYMA 4TRDA 3BDCA 5E4WC 1VMCA 2L1BA 2K04A 3R2TA 4QMGA 3S16B 4BA1I 3MAQA 2EYLA 2M00A 2R61A 3OOCA 3A55A 3SDZA 4Y7NB 1E2WA 3NE5B 1I6VC 4IUNA 5KNCA 4U68A 3GTKB 5C5LA 4ZYSA 1KLGD 2WKDA 3A8JE 1STBA 1BUVT 2B2TC 2Q8IB 1WTQA 2K6AA 3M4YA 1EFID 1H9MA 5TSSA 1PFNA 4H0LC 1QWYA 4O42A 4OO1G 1G2SA 4CGYB 2PW5A 3D4RA 4KD3A 2MHVA 1B1ZA 1FNWA 4HAEA 3A56A 1WTVA 2XVSA 3OMGA 3SHLA 5D3IB 1EY4A 1HUNA 1HHVA 3T53B 5ELCA 5HGTA 1QNUA 3HG9A 1CHQD 2GA4B 2F0JA 1I4XA 3Q24A 2MGSA 3NHHA 1JCKB 4CKCA 3KBGA 3TMEA 2IJ0A 2BOSA 2XRSD 5M3MB 3S17B 3I8ZA 3R93A 3SXHA 4R8IA 1BOSA 1KAAA 4EQOA 1RD9D 4MN3A 1S4ZA 1B9MA 1B53A 5M5WB 1MSHA 2EJFC 1JOQA 3I91A 1A3TA 1Y8OB 2EXZA 5C44B 1EYDA 4C3JB 3FDTA 1TWHB 3NK9A 3QB3A 3BZDB 2Q8TA 1G2TA 3PO3B 2ICEC 2Z4IA 5JVG3 5DNFA 2PYKA 1SE4A 3VA7A 4KK7A 2AQ1B 5COYA 5A2QL 4LJZC 5CR3A 1IHZA 1Q3LA 3K5LA 1LTGD 4MIUA 1EU3A 4UAIA 1CZWA 3VYSA 2HCCA 1LV9A 5C0XJ 5C4XB 3BDOA 2K5WA 1FR3A 1TWFB 2B2YA 1EYCA 3E0JA 4H13C 4OGQC 1JWMD 1I50B 4KY6A 3RUZA 1A6XA 3NTKA 1GUTA 1C4QA 5I2XA 1T5EA 1OXVA 4ZKCB 1EQVA 5BN3A 2L0CA 1CFMA 1JC7A 3CHBD 2JYOA 2B2UA 2FINB 2MJ8A 1IW7C 1W6JA 2E76C 2J4XA 3KUPA 1JWSD 3C1EA 4IN3A 1KDAA 1KDCA 5EPJA 2IPKD 2JA6B 4RWSC 1LABA 1PLFA 3FVQA 2CW0D 2RSOA 1ET9A 4KV6A 2C5CA 4DAPA 1XTCD 1ONLA 1A2UA 1TR5A 2B2VC 2NN6G 1S5DD 2A6ED 4V190 3SK4A 1AZQA 5IT9L 4R8NA 2ZXRA 1DOLA 1JOKA 1EEID 5IGBA 1QG7A 5HURA 1I4QA 2Z8LA 2TSSA 2A69C 3E5SA 2IL8A 2WAQB 1WD0A 2JE6I 4XT1B 1SYGA 4K6DA 1D6EC 3SVMA 4CHTB 4DFAA 1XXGA 3EVQA 3S1NB 2F0QA 5K36H 3NTIA 2A6HC 1ZEQX 4I7ZC 1F77A 2E2IB 1WTPA 2KOLA 1O80A 1X32A 1JWUD 2NN6H 1GUGA 4ULLA 1RJTA 3MXPA 4XQNA 4EQNA 1ET6A 3S9WA 5CORA 2SEBD 5KIXA 4IZ8A 1SYFA 4CJ2C 1V8QA 5FLXL 2RKSA 1SYCA 2L4NA 4MHEA 2EYPA 2F0FA 2M9VA 3MVVA 3K6OA 4HTHA 1HFNA 3VR5A 3PV0A 4ZLTF 1LTID 2WB1B 5FO7B 3RD4A 4KY5A 2JA5B 4ODGA 2AUKA 2JP1A 1BR9A 5E1FA 4RCOA 1BBXC 3D31A 5D3DA 4OO1I 5EGTA 1VF7A 5DM63 3IAYA 1G91A 4BY1B 5LL6S 3QOJA 3NSWA 1HA6A 1PTOB 5C3WA 4HSVA 3D8GA 1EYAA 1JR0D 1EU4A 2A6HD 3J7YW 3RZDB 1B50A 4XT3B 3CRKC 5CC4A 4WFN3 2AQ2B 1IYUA 1U4PA 2LMCB 3TN2A 4FXDA 4ME5A 3Q6SA 3DUZA 2NVTB 5KYIA 1JQYD 4G4KA 1MSGA 3VR3A 3EQLC 2F0PA 4K5XA 1JICA 5I6WA 4B9XA 1LLRD 3TP8A 4K2KA 1SNCA 1H9KA 3TZUA 1JB3A 2DNEA 1B4OA 4C56C 5CV6A 4A93B 2B2YC 4QB4A 2FFKB 4F8MA 3PUXA 2E2DC 1SSOA 2KEEA 4FYDA 2D5DA 3Q22A 4CKEA 4X3SA 2B39A 1W6KA 4H44C 3MEHA 1SMYC 4NDXA 3BVGA 2YU9B 3HOZB 3HOXB 3DWQA 4DXGA 1AW7A 1D5ZC 3MXNA 1E0BA 1EL0A 1Y69U 1EZ8A 4V0BA 1R9TB 4P2CB 4RHRA 4XIGS 1C8CA 3VA5A 4HN7A 4NP5A 3WOEA 5CBEE 2PNRC 4ZUIA 4X3UA 1E2VA 4C3HG 2IX0A 2NN6I 4KHVA 3G6JB 1KABA 1V1OA 4JK1C 2K33A 2C9OA 2BA0A 3FRPB 4N9TA 3PUYA 3OPOA 1TS3A 2X6GA 2XRQD 1FYCA 5EJWA 5C4ZA 1EY6A 1AZPA 1K8MA 2F4IA 5IGDA 1CZGA 5C0XH 5C3XA 1C48A 1Z6HA 2F0MA 2R6GA 4HR7B 1H9SB 3LWEA 4B08A 3WDNA 4ZK9B 2HDLA 1H9JA 1S5BD 3UI2A 3R8BA 1LTRD 5JAVA 4OO1H 1D5MC 1STEA 3ND8A 2F0OA 4RGOS 1GUNA 1QCBD 3DHQA 4QUFA 2OXPA 4UDUC 2L5TA 2J7ZA 1QJOA 1LTSD 3U9SA 4G7ZC 2KVMA 4DN4M 1EY5A 2D2CC 5ELBA 3QJYA 4DAYA 1RF2D 3P75A 4Q5VA 1HQMC 4AYBB 3OHXC 2EY5A 2R3ZA 2CW0C 2JSOA 1RKNA 2MUYA 2PCFB 1UNSA 1D1IA 1STHA 3AU7A 5EPKA 4XQQA 1H9RA 3H09A 3J81L 1X3PA 2BDOA 5A2QE 2RDFA 1PDQA 5I6YA 4KJNA 4EGVA 2N88A 4DXFA 2FMMA 4BA2I 4DAVA 1RTOA 1PMRA 3TDQA 2I46A 1ENFA 4DU9A 2JA8B 4B9WA 5M9OA 2LY7A 4KMUC 1WVLA 2VB2X 2B2TA 1GHJA 5EKKA 2EVBA 2ZT9C 5CV9A 3VR6A 3S1RB 3A54A 1O7LA 1U4RA 3S14B 1TY2A 5IGGA 1RCVD 4QF4A 4WRDA 4FF1A 1CTMA 1MBYA 4IALA 3GTOB 1OXTA 5J1ZA 1LTTD 2HCIA 3P20A 1S5CD 4RAUC 2OEOA 1M4VA 1NR4A 1PZID 1CM9A 1PRTF 3HEJA 4FNFA 5KRUA 1AN8A 2WINB 2E74C 4I65A 4H7BA 3N6RA 1ESRA 3D6WA 3I73A 4ILWA 3K59A 5T1GA 1A15A 3KLRA 4FF4A 2EY1A 3GO5A 1PFBA 4HCSA 5CV7A 1V1PA 4BS9A 1HUMA 1K83B 3PMFA 5IT9E 2PPBC 2NYZD 5JEAJ 3HZXA 3I72A 2O4XA 5C0XI 2EOTA 3T4AC 1AP0A 4LAAA 2V4DA 3GP7A 4NW2A 1ZXTA 5G3LF 5C4HA 3ZYYX 1SYBA 2HUGA 1M8AA 1Q1EA 1UUPA 2EYHA 2PZTA 2LKVA 3NQIA 1EY0A 1ML0D 3V2TA 2M2LA 2Q8RE 4FXGC 3NBHA 1EOTA 3J7AF 2F0EA 3KBXA 1TS2A 2NVQB 1DXMA 1A3UA 2O2LD 5A35A 1EWHA 1F9SA 1LACA 2TMPA 1TKWB 4L8JA 4F7XA 5C5MA 1LTAD 5JOBA 5M5YB 5NUCA 3OSOA 1DM0B 3A7LA 2ZXPA 5FLXE 2FHTA 1NCVA 2K32A 3IFTA 1HFGA 1WTRA 3NTHA 3H0GB 3I4MB 4KKTA 1ESFA 3IFDA 3NP8A 3M4OB 3A8KE 3OIPA 4ABNA 1Y8NB 2NUCA 4RKLA 1OXXK 1PRTC 5JPMC 3MHBA 2VXWA 1HCZA 4A3FB 3BVZA 5D65A 4C2MB 4ZRZA 3M7GA 4DNRB 3AB9A 1EQTA 4PMBA 1BCPC 2EYFA 1LTBD 2L55A 1STYA 5EKLA 1BQQT 1ICWA 4X3TA 2LS01 3OMCA 3JAML 2A68D 2RVLA 3VR2A 1B2TA 3L9AX 2R93B 4M8AA 3HRZC 1SNDA 2JEBI 4IFDG 3Q23A 3HKZB 3P7JA 2KHSA 5F2DA 3S15B 1CHPD 3C1FA 3S1QB 5CBAE 5KNBA 3VYRA 3GTGB 3GTLB 2KCCA 1Q90A 2A69D 4HSPA 1STNA 4XXEA 1ZKOA 4XDXA 3O13A 2PMZB 5I4DA 1TS4A 2F0NA 5AFWA 1U4MA 2AWOA 1TU2B 1Z7TA 2QCPX 2ENBA 2F0DA 1ENCA 1SNOA 2CVRA 3CQZB 2FJ2A 3IKJA 1PRTD 2XWBB 1TVXA 5FK9C 4G7OC 2O5IC 3QOLA 1DCZA 3A8IE 2D9UA 1B44D 3TP5A 3BYYB 5C0XG 3DWAA 2VB3X 1BCPD 1JOOA 4DK1A 1NAPA 4KHZA 1HQRD 4IUPA 4OHJA 2L9HA 3KLSA 5EBDA 3P1HA 3I4NB 1SYDA 1TWCB 2F0TA 3GTMB 3FPPA 3V96A 2BE5D 5FKAC 2A74C 1KDBA 5D14A 1PZJD 1EIHA 1HXYD 1KTKA 2NTSA 2N55A 2OT2A 4RH6A 2E2JB 2KUMA 5BN4A 5IOCA 1SYEA 2AUJD 4TKOB 2QF7A 4L6TB 4A3MB 1FNVA 3ITPA 4OL7A 2RDHA 1D2BA 4R9WA 3K57A 3FKIB 1E2ZA 3K5OA 5KNDA 1O7ZA 1I6HB 1EY7A 1BNZA 5KEEA 4F88A 3T13A 4G7HC 3I70A 3H6MA 4KY7A 4K14A 3J80L 1WTWA 3EROA 2G9DA 3SK5A 4FO2A 1F9RA 4JBWA 2B63B 3S2HB 4DK0A 5C6AA 1KLUD 1SEBD 2PZUA 2F0HA 3EFXD 2F1MA 2XIWA 1XYIA 3QWNA 3L7ZC 1B9NA 1ILPA 3DXJC 1STAA 5ELDA 3QO2A 1EY9A 2NVXB 1G291 1PXUA 1O78A 3PUVA 1YNJC 3S1MB 1D5XC 2EY6A 1WTOA 3TP7A 3QIAA 1BCPB 5JVH3 3K0YA 3H94A 3ERQA 3BS1A 1IKMA 4CJ0B 2I07B 3C46A 4C3JG 4K8JA 1CK1A 2B2WC 5KGUA 2PW7A 1SE2A 4C3HB 1R4QB 2X69A 2KECA 4ID6A 4HCEA 1HPCA 2XN9C 4EQPA 1RTNA 1YNND 2AQ3B 1I3QB 4ZKBB 4J6HA 4K6LA 4QCLA 2K1BA 1F2LA 3GTJB 1F9QA 3HS0C 1A3VA 5I2YA 2Z4HA 4BBRB 1H9SA 4HMJA 3I3CA 4K2LA 1O7YA 3MC0B 1Y1WB 2WIIB 1WD1A 1GHKA 2F0GA 4O1NA 1IKLA 1B3AA 1Q8IA 3T16A 3HOYB 1AFPA 5T1IA 1CQFA 1SNMA 5IGCA 5BN5A 2K7VA 4C3IG 4IFDH 3D6CA 3BYTB 3W3AA 3VR4A 2H1EA 4NMZA 3LWUA 2IW3A 2QKIC 4OIJA 2OF1A 1DOKA 3TZDA 2IX3A 4FF2A 2A68C 4CJ1B 5DAUA 5CMDA 1SMYD 3R3OA 5J22A 4FF3A 3OWFA 3PUZA 3MA2B 3MXUA 2YYZA 3R2IA 2NB0A 1HRJA 1I4PA 3D3RA 1J9OA 2EPBA 1QE6A 2IWHA 2EY2A 4A3JB 1PZKD 2EYJA 1MGSA 1F9PA 4A3DB 4YIJA 1EWCA 1U4LA 2SOBA 2K03A 5ELFA 3HGBA 2NWGA 4XYOA 1PTOD 4XQJA 4RGTA 4IURA 3RZOB 1TS5A 1ILQA 3GV3A 5G3LD 1A2TA 4IUQA 3AMUA 4FVMA 2JXMB 2O5JC 1VCIA 3D4DA 5E4XA 3T56B 4CBVA 4KN7C 2RA4A 1SJHD 3KLSX 2DN8A 1JORA 1L0YB 4DF7A 1CA5A 3GQBA 3KK7A 3MFGA 2XNAC 3J7AV 5JEAH 2IX1A 2FMCA 2KEDA 2F0LA 2EZVA 1ZYRC 1EY8A 2B8FA 4KKUA 3BG3A 1K8OA 1LT3D 1DJRD 1Z47A 5ELEA 5CV4A 2B8GA 2RDGA 5C3EB 2IT1A 1BDOA 1DYQA 1I4GA 3NWTA 5EBCA 4BWGB 5J39A 1CT1D 5FO9B 3CKIB 3J80E 1G6ZA 2EJGC 2K05A 4K5VA 1L0XB 2WV6D 3S2DB 1EIGA 4RCNA 5IGEA 2MPMA 5LHY1 4RKBA 1GUSA 1SDFA 4K5WA 1GOZA 4F87A 2G9HD 1CQVA 5DM73 1EEFD 1QB5D 3DEPA 5ISRA 1STGA 3M85A 2KCNA 4CKBA 1J8IA 1KNAA 1F2MA 3GV6A 2E2HB 3PIO3 2LFNA 3F2UA 3FMCA 4K8IA 1VDZA 4NKLA 1R4PB 1FGBD 1QOHA 1TT2A 2DY8A 1YNNC 4DGZA 3EJIA 4ZQ3A 2RSNA 1RDPD 3NPPA 3TP6A 3HOVB 5FOBB 4PQXA 1TWGB 4KD4A 1S5FD 1PTOH 5KYLA 5EKIA 1SAPA 5IIFA 3MWYW 3CU7A 4RFBA 1VF5C 4DNTB 2X6LA 1PYWD 5M5XB 4PNYA 2WKCA 2SNSA 4L63B 3D4WA 4KI0A 1BCPF 2K28A 3C3LA 1CA6A 2A6EC 2ZXOA 3SE0A 3J81E 4G57A 1WCMB 4RA8A 3VYTA 3PO2B 2F0SA 4IQZA 3L3OC 1QILA 1F2ZA 1RODA 5I9PA 5EQ0A 4PMCA 3NUCA 3GD7A 2K5DA 3ND9A 1IW7D 5CV5A 1LO5D 2XWJB 3K5NA 3NXWA 5JJZA 1TQOA 1GJXA 4TQUS 2R7ZB 1WTXA 3HP3A 1NR2A 5E3FA 4KJOA 2F0IA 4DA2A 4KTAA 2Y0SB 3NBIA 3FPUB 4RHSA 3EA6A 3GTQB 1SBBB 2A5HA 3NQTA 4LK1C 5C4JB 2JEAI 1Q1BA 3PUWA 1EZ6A 1DD2A 5IODA 3U9OA 2WACA 1I4HA 2J0TD 1HA5A 1PFMA 2XSCA 2ID0A 2BCOA 2D62A 1DZ1A 2F0KA 3N52A 1OXUA 4M1UB 2F3WA 2KJXA 1LT6D 3BDLA 1SNQA 4RGMA 1V43A 4RGNA 1TY0A 2EE1A 3NWSA 3TBIB 2L11A 2A73B 2BDNA 2KQ3A 2CQAA 4TSSA 1F2YA 4IFDJ 1PRTB 3HOUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KGU A;  2EYF A;  2F0T A;  4YIJ A;  4RKB A;  1STH A;  2F0P A;  4K5X A;  3SK8 A;  2PW7 A;  2PW5 A;  4KD3 A;  1STY A;  4EVO A;  4WOR A;  2SOB A;  2QDB A;  3MXP A;  4K5W A;  4PMC A;  3NUC A;  5I9P A;  4EQN A;  3S9W A;  5EKL A;  5C4H A;  2RDF A;  5KYL A;  4N9T A;  5I6Y A;  1KDB A;  5CV5 A;  4ZUJ A;  4KJN A;  4ID6 A;  5I6W A;  1SYB A;  3OMC A;  5KIX A;  3NXW A;  4EQP A;  4IZ8 A;  4B9X A;  1AEX A;  1EQV A;  3SK6 A;  1SYF A;  1TQO A;  3OMG A;  4J1M A;  1NUC A;  3SHL A;  2HQE A;  3SR1 A;  3TP8 A;  4E6I A;  2EYH A;  2PZT A;  2PQE A;  1A2T A;  4DU9 A;  2LKV A;  5C4Z A;  2PZW A;  1SYC A;  2RKS A;  4K2K A;  5DEH A;  1EY6 A;  5E3F A;  1SNC A;  4B9W A;  1EY0 A;  1SYE A;  1STG A;  2EYP A;  2F0V A;  2F0I A;  3D4D A;  1EY4 A;  1SND A;  4J6H A;  4KJO A;  3V2T A;  5M9O A;  3ITP A;  1U9R A;  2F0F A;  4KTA A;  4OL7 A;  2F0E A;  2KHS A;  5EKK A;  5F2D A;  3MVV A;  5HGT A;  5IOC A;  3C1F A;  1A3V A;  1F2M A;  5CV6 A;  5IGD A;  2F0J A;  4HTH A;  4PMB A;  1A3U A;  3C1E A;  4HMJ A;  4QB4 A;  5CV9 A;  5C3X A;  4F8M A;  3NHH A;  5CGK A;  1ENA A;  1KDA A;  3NQT A;  4K2L A;  1EY7 A;  1KDC A;  5ISR A;  3TME A;  2F0M A;  2F0U A;  5KEE A;  1JOR A;  4DF7 A;  3T13 A;  1II3 A;  4K8I A;  4NKL A;  2F0W A;  4F7X A;  2EYO A;  1STN A;  3SXH A;  5IGG A;  5C5M A;  3H6M A;  4KV6 A;  1KAA A;  2F0G A;  4K14 A;  4KY5 A;  4KY7 A;  4EQO A;  4QF4 A;  1TT2 A;  4ODG A;  5IGE A;  3ERO A;  3SK5 A;  5JOB A;  4DGZ A;  1A2U A;  3T16 A;  4WRD A;  5NUC A;  3EJI A;  3OSO A;  4ZQ3 A;  1TR5 A;  3TP6 A;  1EZ6 A;  5E1F A;  1JOQ A;  4IAL A;  4N9P A;  1A3T A;  2F0N A;  2EXZ A;  1EYD A;  5IOD A;  4KD4 A;  2RBM A;  5EGT A;  1SNM A;  5J1Z A;  1NSN S;  3U9O A;  5C6A A;  3MZ5 A;  5IGC A;  3NK9 A;  1SNP A;  3MEH A;  3SK4 A;  2OEO A;  4NDX A;  5JAV A;  2F0L A;  5IGF A;  3QB3 A;  2ENB A;  2F0D A;  2WAC A;  3QOJ A;  4R8N A;  3D6C A;  2PZU A;  5IIF A;  1ENC A;  2F0H A;  1EY8 A;  3HEJ A;  1JOK A;  1SNO A;  2EYM A;  2F0O A;  4TRD A;  3BDC A;  4NMZ A;  5C3W A;  5IGB A;  5HUR A;  5KRU A;  3D8G A;  3DHQ A;  1EYA A;  5K5P A;  4QMG A;  3DMU A;  4PNY A;  2EYL A;  2M00 A;  2OF1 A;  2OXP A;  2SNS A;  4H7B A;  4I65 A;  3D4W A;  5CC4 A;  1EZ8 A;  3E5S A;  2PYK A;  4LAA A;  1EY5 A;  3QOL A;  5CV4 A;  4HMI A;  1STA A;  3NP8 A;  5CR3 A;  3VA5 A;  1EY9 A;  3TP5 A;  4NP5 A;  1IHZ A;  5I9O A;  5DAU A;  2F0K A;  1SYG A;  4IUN A;  4K6D A;  3P75 A;  3R3O A;  2F3W A;  2F3V A;  4DFA A;  5J22 A;  4MIU A;  3EVQ A;  5J39 A;  1JOO A;  2EY6 A;  2NUC A;  3OWF A;  4RKL A;  2EY1 A;  5C5L A;  3BDL A;  1SNQ A;  3TP7 A;  4G57 A;  5CV7 A;  2F0Q A;  3MHB A;  4ME5 A;  5CV8 A;  1STB A;  4K5V A;  2SNM A;  3PMF A;  4ZUI A;  5KYI A;  3HZX A;  2EY5 A;  2KQ3 A;  2F0S A;  4S3S A;  2O4X A;  2EY2 A;  1EYC A;  3ERQ A;  3P1H A;  1RKN A;  3LX0 A;  1F2Z A;  1F2Y A;  2EYJ A;  4KY6 A;  1SYD A;  4KHV A;  4K8J A;  3RUZ A;  1KAB A; 
#chains in the Genus database with same CATH topology
 2VNU D;  3B6Y A;  3DM1 A;  4EVO A;  2QDB A;  1TWA B;  3CRL C;  3TQY A;  4BBS B;  3E6Z X;  1MD2 D;  5ELO A;  3I4L A;  3KOJ A;  3PIP A;  2DNC A;  1BBU A;  3TSS A;  1NUC A;  4DV2 L;  2HQE A;  4A3B B;  4KKS A;  2PQE A;  4IPC A;  1XTD A;  3URY A;  1IYV A;  2YTY A;  4QIW B;  4Y52 H;  1V1P B;  3K58 A;  4OXP A;  3KF8 A;  4HIK A;  1IL8 A;  3JAM E;  4JI5 Q;  3KF8 B;  1FJG Q;  5CGK A;  4A3E B;  5JJI A;  2K01 A;  2ZTD A;  2BH8 A;  3Q0A A;  4A3K G;  1N34 L;  2EYO A;  2WP8 J;  3RR5 A;  3MXG A;  1OXS C;  3K7A B;  1LT4 D;  5IT9 c;  3MTS A;  3X3M A;  4DV4 Q;  1OO9 B;  3M3Y B;  4X3K A;  5IE8 A;  2UXB L;  3CP0 A;  1S5E D;  1XNR L;  1I50 H;  1DON A;  2ZTC A;  4JC0 A;  2UXD L;  2PI2 E;  5IGF A;  4DV1 L;  3J7A 5;  1GM5 A;  3QG1 A;  2Z9H A;  3T51 B;  5K5P A;  1XX8 A;  3DMU A;  4DR4 Q;  2CHB D;  2B3G A;  4ME3 A;  1N8R C;  4HMI A;  1WI5 A;  1KRS A;  3AYH B;  3HOU G;  1UEA B;  1K9M C;  1SXT A;  1SE3 A;  2QEJ C;  3DEO A;  2VQF Q;  4P73 A;  4R4Q A;  3I90 A;  3KJP A;  1BBW A;  1FD7 D;  1PH5 A;  1UAP A;  1PYS B;  4WJ3 M;  3CCL A;  2K5Q A;  5JPN C;  1VMP A;  1GUW A;  3RLF A;  5CV8 A;  1NBW A;  1CI3 M;  3HOU H;  2PI2 A;  2HHH Q;  1X3Q A;  3AFP A;  4S3S A;  1MI2 A;  2R93 H;  3FEW X;  3IL8 A;  5K36 G;  3LX0 A;  4B3M Q;  4XYQ A;  1JT8 A;  4GOP C;  4IO9 A;  2VUM B;  1GXD C;  2CKZ B;  3SK8 A;  4GNX C;  2K5H A;  4WOR A;  4DR6 Q;  4C1N I;  4BY1 G;  4IUU A;  1R9T H;  4PV1 C;  2SDF A;  3ULJ A;  4NXM L;  5M3F H;  4A3K B;  1AEX A;  3SR1 A;  4J1M A;  1VQN A;  4BY7 B;  4JBK A;  2YV5 A;  3K5M A;  4EX5 A;  2F0V A;  1PTO F;  1QVF A;  4C1N K;  1YBY A;  1L0W A;  1U9R A;  2H4O A;  2ICI A;  1YNJ D;  4PMW A;  2RQX A;  1SJE D;  2B2W A;  1I4R A;  4UP9 A;  2BA1 A;  2NBF A;  2CWA A;  1Q46 A;  1LT5 D;  3WOF A;  4C3I B;  3OTO Q;  4IFD I;  1ENA A;  4IUV A;  2VUM H;  2NVT H;  1GO3 E;  2E75 C;  4FXK C;  2F4V Q;  1II3 A;  4HJ8 A;  2F0W A;  4IUT A;  1HTL D;  1KNE A;  2OCE A;  4LMQ D;  2UU9 L;  1SFO B;  2PO4 A;  5LL6 X;  5CYU A;  3PIP 3;  2QA4 A;  2Z1C A;  1BF4 A;  4NPS A;  1FNU A;  2I0Q A;  1ZYR D;  4N9P A;  4A3D G;  4GLX A;  3OWE B;  4NB3 A;  4WJW A;  2RBM A;  4A3J H;  1NSN S;  3A7A B;  4UY8 C;  3JC6 6;  3RLO A;  1G8Z D;  3W2D A;  1XMO Q;  2EJM A;  4GN3 B;  2QIL A;  5M3M G;  4U67 3;  3G71 A;  3C2P A;  2DUD A;  4X64 L;  2NZ1 D;  1PH2 A;  3BZC A;  1QNK A;  1BKB A;  4AH6 A;  1U0L A;  3KDF B;  3SEB A;  4A3I B;  2AWN A;  2HDM A;  5M3F B;  1BXT A;  4ZAI A;  1Y1V H;  5I9O A;  2VQE Q;  3ONA B;  4DR5 Q;  2AHO B;  3W1G A;  1XWE A;  1VQI A;  3OW7 A;  1TII D;  2F3V A;  3A74 A;  4QIW E;  3LNN A;  1YHQ A;  2NVY B;  2SNM A;  4Z9C B;  2L12 A;  3BJU A;  1Y14 B;  3H91 A;  4GZY C;  1VQ8 A;  2DY7 A;  3BVM A;  4DUY Q;  3PO2 H;  1B8A A;  1Q12 A;  4DR3 L;  2JA9 A;  4A3G B;  4Q0F A;  5JEA G;  1Y8P B;  4JG2 A;  3CCV A;  2JA7 B;  1FVI A;  2UUA Q;  3GTP B;  2R92 B;  4ZUJ A;  3HOW B;  1Y1V B;  4GOP B;  5M3M H;  3SK6 A;  2B2V A;  4A3C G;  1HTP A;  3M7N A;  2Z6K A;  4E6I A;  4GNX B;  3H3V C;  1D8L A;  2PZW A;  4AYB E;  4LF4 Q;  5DEH A;  5FO8 B;  3MFY A;  1RHP A;  1V1Q A;  3X3N A;  2NVQ H;  4FDB A;  4O2D A;  4J8Q A;  1VQP A;  2BE5 C;  1BO0 A;  4FP5 D;  3E3X A;  2MP1 A;  1DOM A;  3RMH A;  4QUC A;  4POF A;  1GUO A;  2F0U A;  1IBM Q;  3AEV A;  4KN4 C;  1C0A A;  1MIU A;  1D1K A;  1T5X D;  2B2U C;  1KHI A;  2EDG A;  4XTC S;  3OIQ A;  5JJK A;  3VYU A;  5GAH C;  3V05 A;  4MNO A;  2RHQ B;  4OEM B;  1PTO C;  4JI1 Q;  3DM3 A;  1K73 C;  2KA7 A;  3DWP A;  4YWL A;  3MZ5 A;  1SNP A;  3G7L A;  5EPL A;  2E5L L;  1JE4 A;  4HED A;  2F03 A;  4LF5 L;  2P5Z X;  4OIK A;  1VQA A;  1I94 L;  2NTT A;  2EYM A;  4TRD A;  3BDC A;  4H02 A;  5E4W C;  1VMC A;  2L1B A;  4DR2 Q;  2K04 A;  3PIO A;  3R2T A;  4QMG A;  3S16 B;  4BA1 I;  2EIF A;  3MAQ A;  2EYL A;  2M00 A;  2R61 A;  3OOC A;  2K50 A;  2JN4 A;  3PO3 H;  1SE8 A;  3A55 A;  1LYL A;  3SDZ A;  3I4M G;  5IP9 H;  4LFB L;  4Y7N B;  1HZC A;  1E2W A;  3NE5 B;  1I6V C;  2MO0 A;  4IUN A;  5KNC A;  2EQS A;  4U68 A;  5C44 H;  3GTK B;  5C5L A;  1X56 A;  4ZYS A;  1KLG D;  2WKD A;  4JI5 L;  1H95 A;  3A8J E;  1STB A;  1BUV T;  2B2T C;  2Q8I B;  1WTQ A;  2K6A A;  3M4Y A;  1N34 Q;  1EFI D;  1H9M A;  5TSS A;  4JI8 L;  1PFN A;  4H0L C;  1QWY A;  2Q2H A;  4O42 A;  4DV4 L;  3J81 j;  4OO1 G;  2N78 A;  1G2S A;  4CGY B;  2PW5 A;  3D4R A;  4KD3 A;  4GKJ L;  2YTX A;  2MHV A;  1L1O C;  3F2B A;  1B1Z A;  2KBN A;  1FNW A;  4HAE A;  1VQF A;  3A56 A;  1WTV A;  4DV1 Q;  5M5W H;  2XVS A;  1EUJ A;  4CDE C;  2Z0S A;  3OMG A;  3SHL A;  5D3I B;  5BR8 L;  4A3B H;  3U50 C;  1EY4 A;  3MEF A;  1C7Y A;  1MJE A;  4BBR G;  1HUN A;  1HHV A;  3T53 B;  2K14 A;  5ELC A;  5HGT A;  1IBL Q;  4B3T Q;  1QNU A;  3HG9 A;  2N8N A;  1CHQ D;  2GA4 B;  2F0J A;  1XMQ L;  1I4X A;  3Q24 A;  1QZG A;  2MGS A;  4Y7N H;  3NHH A;  2VY3 A;  1JCK B;  4CKC A;  3KBG A;  3TME A;  2IJ0 A;  2BOS A;  1WCM G;  2XRS D;  5M3M B;  3S17 B;  3I8Z A;  3R93 A;  1HNW L;  3SXH A;  4R8I A;  1BOS A;  4JYA Q;  1KAA A;  4EQO A;  1RD9 D;  2K75 A;  4A75 A;  4MN3 A;  4DKA C;  1S4Z A;  1AE3 A;  1B9M A;  1B53 A;  4A3L H;  5M5W B;  1MSH A;  2EJF C;  5M3F G;  1JOQ A;  3I91 A;  1A3T A;  1Y8O B;  1YEZ A;  2EXZ A;  5C44 B;  1EYD A;  2RCF A;  4C3J B;  3FDT A;  1TWH B;  3NK9 A;  1WJJ A;  3QB3 A;  3BZD B;  2NZH A;  2Q8T A;  1G2T A;  2LXJ A;  4JVZ A;  3PO3 B;  4PZ6 A;  1X55 A;  3RN2 A;  4NXM Q;  3CXC A;  1X65 A;  2ICE C;  2Z4I A;  5JVG 3;  2JA8 G;  2FXQ A;  1JE5 A;  1YHA A;  5DNF A;  2PYK A;  1SE4 A;  3VA7 A;  4KK7 A;  2AQ1 B;  5COY A;  5A2Q L;  4LJZ C;  5CR3 A;  1HZA A;  4JW0 A;  2HQL A;  1IHZ A;  1Q3L A;  3K5L A;  2I5H A;  1LTG D;  2H5X A;  1M1K C;  4MIU A;  1EU3 A;  4UAI A;  3NEL A;  1CZW A;  3VYS A;  5ELN A;  2HCC A;  3G48 A;  1LV9 A;  5C0X J;  3OTO L;  5C4X B;  3BDO A;  1S3O A;  5GRO A;  2K5W A;  1FR3 A;  1TWF B;  2B2Y A;  1EYC A;  4OGQ C;  4H13 C;  3E0J A;  1BVS A;  1JWM D;  2UU9 Q;  1I50 B;  4KY6 A;  3H0G H;  3RUZ A;  4DR7 Q;  1A6X A;  3NTK A;  3CMA A;  4R4I A;  1EQR A;  1GUT A;  1C4Q A;  5I2X A;  1T5E A;  1OXV A;  3CW2 C;  4ZKC B;  1EQV A;  5BN3 A;  1CKN B;  2L0C A;  4LUO A;  1CFM A;  1JC7 A;  3CHB D;  3CAM A;  2JYO A;  2B2U A;  2FIN B;  2MJ8 A;  1XMO L;  1IW7 C;  1N33 Q;  1A0I A;  1W6J A;  2E76 C;  2CH4 W;  2J4X A;  4X65 Q;  3KUP A;  1JWS D;  1O7I A;  3C1E A;  4YY3 Q;  4IN3 A;  1VQ5 A;  1KDA A;  1KDC A;  2VQE L;  5EPJ A;  2IPK D;  2JA6 B;  4RWS C;  4LFA L;  1LAB A;  1PLF A;  4HJ7 A;  3FVQ A;  2CW0 D;  2RSO A;  1ET9 A;  4KV6 A;  2C5C A;  4APV A;  4DAP A;  1IXR A;  1WFQ A;  2R7Z H;  1XTC D;  1ONL A;  1A2U A;  1TR5 A;  4MTN A;  2B2V C;  1HR0 L;  2KHI A;  2NN6 G;  3CPW A;  1S5D D;  2A6E D;  4V19 0;  4OX9 L;  2R92 H;  4DUY L;  3GTO H;  3SK4 A;  2B63 G;  1AZQ A;  5IT9 L;  1CKO A;  4R8N A;  2ZXR A;  3I7F A;  3L2P A;  4DR3 Q;  3GTQ H;  1DOL A;  1JOK A;  2F3I A;  1EEI D;  1HNZ Q;  5IGB A;  1QG7 A;  5HUR A;  1I4Q A;  2UUA L;  5C4X G;  2Z8L A;  2TSS A;  1VQ9 A;  1I5F A;  1NTG A;  2A69 C;  3E5S A;  2IL8 A;  1VQL A;  3UE1 A;  5LMU Q;  2WAQ B;  1WD0 A;  2JA8 H;  4DUZ Q;  2JE6 I;  3GTG H;  1IZ6 A;  4XT1 B;  1SYG A;  4K6D A;  1D6E C;  4QQB X;  3SVM A;  4CHT B;  4DFA A;  1XXG A;  3EVQ A;  2KCT A;  4YCW A;  1RL2 A;  3S1N B;  4IOC A;  1N32 L;  1PH7 A;  3U4V A;  3M4Q A;  2F0Q A;  2VZA A;  5K36 H;  2CWP A;  3NTI A;  2A6H C;  1ZEQ X;  4I7Z C;  3GTJ H;  1F77 A;  4UPA A;  3K0X A;  3CC7 A;  2E2I B;  4DK3 C;  3K7U C;  1WTP A;  2KOL A;  1O80 A;  1LTL A;  1X32 A;  1JWU D;  2NN6 H;  1GUG A;  3VDY A;  4C3I H;  4ULL A;  1RJT A;  3MXP A;  4XQN A;  4EQN A;  1ET6 A;  3S9W A;  5COR A;  2SEB D;  5KIX A;  4IZ8 A;  1NMF A;  5AJ3 L;  4LFC Q;  1N9W A;  1SYF A;  4CJ2 C;  2WFW A;  3HOW H;  1V8Q A;  5FLX L;  2RKS A;  1SYC A;  1X3F A;  2L4N A;  4DR2 L;  4MHE A;  2EYP A;  4A3B G;  2F0F A;  1IBK L;  2M9V A;  3MVV A;  3K6O A;  3PCO B;  2PNH A;  4HTH A;  4B3S Q;  1HFN A;  3VR5 A;  2XGT A;  3PV0 A;  5GAD C;  4ZLT F;  1LTI D;  2WB1 B;  3PF5 A;  5FO7 B;  3RD4 A;  3HOV G;  4KY5 A;  3Q8D A;  2JA5 B;  4ODG A;  2AUK A;  2JP1 A;  1BR9 A;  5E1F A;  4RCO A;  4DV5 L;  2RHS B;  3D31 A;  5D3D A;  1BBX C;  4OO1 I;  5EGT A;  2JA6 H;  3HOY G;  1VF7 A;  4GLA C;  4JI4 Q;  5DM6 3;  3IAY A;  4LF8 L;  1G91 A;  4BY1 B;  5LL6 S;  3QOJ A;  3NSW A;  1HA6 A;  5IYD G;  1NNX A;  1PTO B;  5C3W A;  4HSV A;  1QUQ B;  4BY7 G;  1TWG H;  3D8G A;  1EYA A;  1KC8 C;  1JR0 D;  1EU4 A;  3TRE A;  2A6H D;  3J7Y W;  1T9H A;  3RZD B;  1B50 A;  4XT3 B;  3CRK C;  4IJH A;  1MHW C;  5CC4 A;  4WJ4 A;  2KEN A;  4ALP A;  4WFN 3;  1VQC A;  3ER0 A;  3TEH B;  2R7D A;  2AQ2 B;  1IYU A;  1U4P A;  2LMC B;  3TN2 A;  1IBL L;  1TWA H;  4FXD A;  2D0P A;  4JI0 Q;  2VW9 A;  4ME5 A;  3Q6S A;  3W5O A;  3DUZ A;  2NVT B;  5KYI A;  1JQY D;  4G4K A;  4HJA A;  1HNW Q;  2Z6K C;  4MZ9 A;  1MSG A;  2AKW B;  3VR3 A;  3HOZ H;  3EQL C;  3STB D;  2F0P A;  4K5X A;  4A3J G;  2K4K A;  1JIC A;  3U4Z A;  1Q81 C;  4L5T A;  5I6W A;  1B7Y B;  2HD3 A;  3LGJ A;  4B9X A;  1LLR D;  3TP8 A;  1X9N A;  3I55 A;  2GN5 A;  3ZJY C;  4HJ5 A;  3W1B A;  1PH8 A;  2EXD A;  4K2K A;  4LUZ A;  1SNC A;  1H9K A;  3TZU A;  1W2B A;  1JB3 A;  2DNE A;  1B4O A;  3H15 A;  2RCN A;  4LF7 L;  4ZCK A;  5IP7 H;  4C56 C;  5CV6 A;  4A93 B;  2B2Y C;  4QB4 A;  2FFK B;  4F8M A;  2E8G A;  1PHJ A;  3PUX A;  2E2D C;  3G6E A;  1SMX A;  1SSO A;  2KEE A;  2N49 A;  1K83 H;  3PO2 G;  4FYD A;  2NVY H;  2D5D A;  1HZB A;  2G5D A;  3Q22 A;  4BY1 H;  4CKE A;  4LWC A;  4X3S A;  2B39 A;  1W6K A;  4H44 C;  3MEH A;  1SMY C;  4NDX A;  3BVG A;  2YU9 B;  3FKI G;  3E0E A;  3GTL H;  3HOZ B;  3HOX B;  1E1T A;  1M90 C;  1CSP A;  3DWQ A;  4JI3 L;  4DXG A;  1AW7 A;  1D5Z C;  1FGU A;  1U5K A;  5IYB G;  3MXN A;  1OTC A;  2UXB Q;  3MXN B;  1E0B A;  1EL0 A;  4X66 Q;  1Y69 U;  1EZ8 A;  3K80 C;  4V0B A;  1R9T B;  4P2C B;  4RHR A;  4XIG S;  1C8C A;  3VA5 A;  4BBR H;  4HN7 A;  4NP5 A;  1N33 L;  5HGQ A;  3K8A A;  4YHH L;  3WOE A;  5FJ8 G;  4X65 L;  5C3E G;  5CBE E;  3F1Z A;  4YWK A;  2PNR C;  4ZUI A;  4X3U A;  1E2V A;  2LXK A;  4C3H G;  2IX0 A;  2NN6 I;  4KHV A;  2JA7 H;  3G6J B;  1KAB A;  2PQA B;  1V1O A;  4JK1 C;  1TWC H;  2K33 A;  2C9O A;  2BA0 A;  1HR0 Q;  4LF9 Q;  2CCZ A;  3KF6 B;  4GNX A;  3FRP B;  4N9T A;  3PUY A;  2HHH L;  3OPO A;  2E2I H;  1TS3 A;  2X6G A;  5IYB H;  3UDG A;  1VQH A;  3CCS A;  2XRQ D;  1FYC A;  3S24 A;  5EJW A;  5C4Z A;  4BBS H;  1EY6 A;  1AZP A;  2QGQ A;  1K8M A;  3S1Q H;  2OQ0 A;  5IP9 G;  3A5U A;  1G6P A;  5FLM H;  2F4I A;  1CZG A;  4OON A;  5IGD A;  5C0X H;  5C3X A;  3EIV A;  1C48 A;  1Z6H A;  2F0M A;  2R6G A;  4HR7 B;  1H9S B;  1CKM A;  3LWE A;  4B08 A;  3GTK H;  3WDN A;  4ZK9 B;  2HDL A;  1H9J A;  1WCM H;  1S5B D;  1W3S A;  4P71 A;  3UI2 A;  3R8B A;  2CH4 A;  3CD6 A;  1LTR D;  5JAV A;  4OO1 H;  1D5M C;  2YTV A;  3CC2 A;  5H1S E;  1STE A;  3ND8 A;  1D7Q A;  3S16 H;  2F0O A;  4RGO S;  1QCB D;  1GUN A;  3M9B A;  3DHQ A;  4QUF A;  3CC4 A;  4DV6 Q;  4P72 A;  4DV7 Q;  2OXP A;  5AJ3 Q;  4UDU C;  2L5T A;  5LMN W;  2J7Z A;  1QJO A;  1LTS D;  2YU9 H;  3U9S A;  2KVM A;  4G7Z C;  4DN4 M;  1EY5 A;  2Y0S G;  2D2C C;  5ELB A;  3QJY A;  4DAY A;  4JOI A;  1RF2 D;  3P75 A;  3M3Y H;  1XNQ L;  4Q5V A;  3HKZ E;  1HQM C;  3CCR A;  1E22 A;  3M4P A;  3H0G G;  4AYB B;  3OHX C;  1AE2 A;  1JMC A;  5DLQ E;  2EY5 A;  3NEN A;  1EFW A;  2ZM6 L;  2R3Z A;  2CW0 C;  2JSO A;  3HKS A;  1RKN A;  2MUY A;  2PCF B;  1UNS A;  1D1I A;  1STH A;  2VS1 A;  3AU7 A;  5EPK A;  4XQQ A;  4DV3 L;  1H9R A;  4DV5 Q;  3H09 A;  3J81 L;  1X3P A;  2BDO A;  5A2Q E;  4GLV B;  4JI2 L;  2RDF A;  1ASZ A;  1PDQ A;  5I6Y A;  4KJN A;  5L37 A;  4EGV A;  2N88 A;  4DXF A;  1Y1W H;  4LF8 Q;  3PO3 G;  2FMM A;  4BA2 I;  1JJG A;  4LNQ A;  4DAV A;  1RTO A;  1PMR A;  3TDQ A;  2I46 A;  1ENF A;  4DU9 A;  2JA8 B;  4B9W A;  1UEB A;  5IYD H;  2Q2T A;  5M9O A;  1JB7 A;  1PH1 A;  2LY7 A;  1EQQ A;  4KMU C;  1WVL A;  2VB2 X;  2B2T A;  1GHJ A;  5EKK A;  2EVB A;  2ZT9 C;  2QEX A;  5CV9 A;  3VR6 A;  3S1R B;  3A54 A;  1O7L A;  1U4R A;  5GQO A;  3S2D H;  4LF4 L;  4DV0 L;  3S14 B;  1TY2 A;  4QY7 A;  5IGG A;  1SN8 A;  1RCV D;  4QF4 A;  4JBJ A;  5LMN L;  3BZK A;  4WRD A;  1KRT A;  4FF1 A;  4R4T A;  1CTM A;  2N3S A;  4A3K H;  1MBY A;  4IAL A;  2OTJ A;  1S40 A;  3GTO B;  1LUZ A;  3TS2 A;  1OXT A;  5J1Z A;  1LTT D;  2HCI A;  3P20 A;  1S5C D;  4RAU C;  2OEO A;  1M4V A;  1NR4 A;  3SGI A;  1PZI D;  1CM9 A;  4A93 G;  1PRT F;  3HEJ A;  4FNF A;  2XTI A;  4N8F A;  1L2F A;  1X3E A;  5KRU A;  4JOI C;  1AN8 A;  4YWM A;  1UE6 A;  2WIN B;  4JI1 L;  1XPO A;  2E74 C;  4I65 A;  4H7B A;  3N6R A;  1ESR A;  3D6W A;  2ZJR A;  4PG3 A;  3I73 A;  2Z6B A;  4ILW A;  4LF5 Q;  1G51 A;  3CCJ A;  3K59 A;  1CKN A;  3JAM i;  5T1G A;  1I94 Q;  1A15 A;  3KLR A;  2ZTE A;  4LF7 Q;  2HIV A;  4FF4 A;  5C3E H;  1UE7 A;  2EY1 A;  3GO5 A;  4A3I H;  1PFB A;  2PMZ E;  4HCS A;  5CV7 A;  1V1P A;  4BS9 A;  1HUM A;  1K83 B;  3PMF A;  5IT9 E;  2PPB C;  3S1R H;  2NYZ D;  5JEA J;  3HZX A;  3I72 A;  1PFS A;  4A3M G;  2O4X A;  5C0X I;  4R4O A;  2EOT A;  3T4A C;  1AP0 A;  1B70 B;  4GN4 B;  4LAA A;  4A3F H;  2V4D A;  2B63 H;  1GVP A;  3GP7 A;  4NW2 A;  1ZXT A;  4LF6 Q;  1J5E L;  3CCQ A;  5G3L F;  5C4H A;  3ZYY X;  1SYB A;  2HUG A;  1M8A A;  1P16 A;  5GAE C;  1Q1E A;  2VL6 A;  5C4X H;  1UUP A;  2EYH A;  2PZT A;  4JI3 Q;  2LKV A;  2MNA A;  1VQB A;  3NQI A;  3RZO H;  1N36 L;  1EY0 A;  1ML0 D;  3V2T A;  2M2L A;  2Q8R E;  2D0O A;  3BU2 A;  4FXG C;  3NBH A;  1EOT A;  3J7A F;  3OW2 A;  4GKJ Q;  3NBH B;  2F0E A;  3KBX A;  2OWO A;  1TS2 A;  2NVQ B;  1DXM A;  1A3U A;  3HFZ B;  3H3V H;  3ULP A;  2O2L D;  3S15 H;  5A35 A;  1EWH A;  1Q86 C;  1F9S A;  1LAC A;  2TMP A;  1TKW B;  4L8J A;  4YHH Q;  1YI2 A;  2JA5 H;  4F7X A;  5C5M A;  1K0R A;  1EIY B;  1LTA D;  2DJG C;  5JOB A;  5M5Y B;  5NUC A;  4B3T L;  3OSO A;  5GAG C;  1DM0 B;  3A7L A;  1GKH A;  1PH3 A;  1XMQ Q;  2VUM G;  3EBE A;  2ZXP A;  5FLX E;  2BH2 A;  2FHT A;  2MO1 A;  1X6O A;  2K5V A;  1NCV A;  2K32 A;  3IFT A;  1HFG A;  3F2D A;  1WTR A;  1YJW A;  3UDX A;  1X54 A;  5JJL A;  3STB C;  3J80 c;  1Q7Y C;  3NTH A;  2QDL A;  3H0G B;  4CDD C;  4IJL A;  1Y1V G;  1EOV A;  4AIM A;  3I4M B;  2OTL A;  4KKT A;  4NXN Q;  4HIO A;  1ESF A;  4L5Q A;  1EIF A;  3IFD A;  3NP8 A;  3M4O B;  3GTM H;  3A8K E;  3OIP A;  4ABN A;  1Y8N B;  2NUC A;  4RKL A;  4X6A H;  2A1A A;  4UHV A;  1OXX K;  1PRT C;  5JPM C;  3MHB A;  2VXW A;  1HCZ A;  3TRZ A;  4A3F B;  3BVZ A;  5D65 A;  4C2M B;  4QJF A;  3ICE A;  1K0S A;  1L1O B;  4ZRZ A;  3M7G A;  4DNR B;  1VQE A;  4DV2 Q;  3AB9 A;  1PA6 A;  1EQT A;  4PMB A;  1BCP C;  2EYF A;  4KHP Q;  1KXL A;  1LTB D;  2L55 A;  1KAW A;  1STY A;  1KL9 A;  1NE3 A;  5EKL A;  1BQQ T;  1ICW A;  4O0A A;  4X3T A;  2LS0 1;  4JI7 Q;  1ICF B;  3OMC A;  3JAM L;  2A68 D;  2RVL A;  3VR2 A;  1EWI A;  1B2T A;  1FL0 A;  4RMF A;  3L9A X;  5IWA L;  2R93 B;  4DR7 L;  4M8A A;  1QVC A;  2UUC L;  3HRZ C;  1SND A;  2JEB I;  4IFD G;  1NJI C;  3Q23 A;  3HKZ B;  4DAY B;  3P7J A;  2KHS A;  5F2D A;  3S15 B;  1CHP D;  3C1F A;  3S1Q B;  5CBA E;  1Z9F A;  3VYR A;  5KNB A;  3GTG B;  3GTL B;  1UWV A;  1IYJ B;  4HIM A;  2KCC A;  1Q90 A;  2A69 D;  4HSP A;  1E1O A;  1STN A;  2IHF A;  2WB1 G;  4XXE A;  1ZKO A;  4XDX A;  2ES2 A;  3O13 A;  2PMZ B;  4CDC C;  1E3P A;  5I4D A;  1TS4 A;  2F0N A;  5AFW A;  1U4M A;  4YY3 L;  4DR4 L;  2ZM6 Q;  3S14 H;  2AWO A;  1TU2 B;  1Z7T A;  2QCP X;  3FP9 A;  2R92 G;  2ENB A;  1SR3 A;  2F0D A;  4A3M H;  1JJ2 A;  4DV3 Q;  1ENC A;  3I4M H;  1SNO A;  3UE0 A;  2CVR A;  1Q8K A;  4DK6 C;  4JI2 Q;  3E9H A;  4J15 A;  4DR1 Q;  3CQZ B;  4POG A;  2FJ2 A;  3IKJ A;  1PRT D;  1RIP A;  1TVX A;  2XWB B;  5FK9 C;  4G7O C;  4YCU A;  4OX9 Q;  2O5I C;  4IPH A;  4IOA A;  3QOL A;  4GN5 A;  3PQI A;  1DCZ A;  1UE5 A;  3A8I E;  4GOP A;  2D9U A;  1B44 D;  3TP5 A;  3BYY B;  2Q2I A;  4X62 L;  5C0X G;  3DWA A;  2VB3 X;  2KCM A;  3K7A H;  2GVA A;  3PGZ A;  1BCP D;  2Y0S E;  1JOO A;  4KLK A;  4DK1 A;  1NAP A;  3A0J A;  4KHZ A;  4RG1 A;  1HQR D;  4IUP A;  3JAM c;  5LMU L;  4DUZ L;  4OHJ A;  2L9H A;  3PSI A;  3KLS A;  2R93 G;  4GKK Q;  2ASB A;  4A3L G;  1I3Q H;  5EBD A;  1TWH H;  3P1H A;  3I4N B;  3GTP H;  1A62 A;  5IYC H;  1SYD A;  1TWC B;  2F0T A;  3GTM B;  3FPP A;  3V96 A;  2BE5 D;  3CPF A;  3KJO A;  4AQY L;  2B29 A;  5FKA C;  3J80 i;  2A74 C;  1KDB A;  5D14 A;  1ASY A;  1PZJ D;  2NVX H;  1HXY D;  1KTK A;  1EIH A;  2NTS A;  3CCU A;  2N55 A;  2UUB Q;  2OT2 A;  4RH6 A;  3HOW G;  2KUM A;  2E2J B;  1PVO A;  5BN4 A;  5IOC A;  1SYE A;  2AUJ D;  4TKO B;  4JCV E;  2QF7 A;  4GS3 A;  4L6T B;  5FLX c;  1FNV A;  3ITP A;  4A3M B;  1KQS A;  4OL7 A;  2R7F A;  2RDH A;  1D2B A;  4R9W A;  3K57 A;  4JV5 L;  3FKI B;  1WOC A;  1E2Z A;  3K5O A;  4LFC L;  5KND A;  1O7Z A;  1I6H B;  1EY7 A;  1BNZ A;  4EQ5 A;  3CCM A;  5KEE A;  2K5N A;  4F88 A;  3T13 A;  4G7H C;  1SLJ A;  3I70 A;  3H6M A;  4KY7 A;  4K14 A;  1VQ4 A;  3HOV H;  1IBK Q;  3J80 L;  1WTW A;  3ERO A;  2G9D A;  3SK5 A;  4FO2 A;  3J81 i;  1F9R A;  4JBW A;  4B3S L;  2B63 B;  3S2H B;  1PH9 A;  4DK0 A;  5C6A A;  1KLU D;  1SEB D;  1TXY A;  2DGY A;  2PZU A;  4PZ7 A;  2F0H A;  1V9P A;  4A3F G;  1QZH A;  4LF6 L;  3EFX D;  1J5E Q;  1P8L A;  3I4N H;  2F1M A;  2XIW A;  1Y1W G;  1XYI A;  3QWN A;  4P74 A;  3L7Z C;  1B9N A;  1ILP A;  4JI4 L;  3DXJ C;  1STA A;  5ELD A;  3QO2 A;  1EY9 A;  1N36 Q;  2NVX B;  1VQ7 A;  1G29 1;  1PXU A;  2JQO A;  1O78 A;  3PUV A;  3T1H L;  1YNJ C;  3S1M B;  1D5X C;  4HID A;  2EY6 A;  2MFI A;  1WTO A;  4I7A A;  3ULL A;  3TP7 A;  3UDI A;  2JA6 G;  3HOY H;  3QIA A;  1BCP B;  5JVH 3;  3F2C A;  1K8G A;  2IHE A;  4DNI A;  3K0Y A;  3H94 A;  3ERQ A;  3BS1 A;  1IKM A;  4CJ0 B;  2I07 B;  3C46 A;  4C3J G;  4JBM A;  2OQK A;  4K8J A;  1CK1 A;  2B2W C;  5KGU A;  3I2Z A;  3EN2 A;  1WYD A;  2PW7 A;  1SE2 A;  4C3H B;  1R4Q B;  4A93 H;  2X69 A;  4A76 A;  1VQJ A;  2GVB A;  2KEC A;  4ID6 A;  2UXC L;  4HCE A;  1HPC A;  2XN9 C;  4EQP A;  1RTN A;  1YNN D;  2AQ3 B;  1PYB A;  4N8X 1;  1IBM L;  1I3Q B;  4ZKB B;  4J6H A;  1Q82 C;  4K6L A;  4QCL A;  1C9O A;  2K1B A;  1F2L A;  4A3G H;  3GTJ B;  1VQM A;  1F9Q A;  3HS0 C;  1A3V A;  4JPB W;  1JJC B;  4NXN L;  5I2Y A;  2Z4H A;  4BBR B;  1H9S A;  4HMJ A;  3I3C A;  4K2L A;  1O7Y A;  1NMG A;  2JA5 G;  2E5L Q;  3MC0 B;  3WWV A;  1Y1W B;  2WII B;  1WD1 A;  1GHK A;  2F0G A;  4O1N A;  1IKL A;  1B3A A;  1Q8I A;  3T16 A;  1WTH A;  3HOY B;  1AFP A;  5T1I A;  4JI6 Q;  2MQH A;  1NY4 A;  1CQF A;  1SNM A;  3TS0 A;  5IGC A;  5BN5 A;  4LFB Q;  2K7V A;  4C3I G;  1YJ9 A;  2ZJP A;  4IFD H;  3D6C A;  3BYT B;  4OEL B;  4KHP L;  2QW7 A;  3W3A A;  3VR4 A;  2H1E A;  4NMZ A;  3LWU A;  2IW3 A;  2QKI C;  4R4C A;  4JI7 L;  2K52 A;  4OIJ A;  2OF1 A;  3RLN A;  1DOK A;  2DJF C;  3L0O A;  3TZD A;  2IX3 A;  4FF2 A;  2A68 C;  3NEM A;  5IWA Q;  2UUC Q;  4CJ1 B;  5DAU A;  4JI8 Q;  5CMD A;  1SMY D;  3T1Y L;  1HNX Q;  3R3O A;  1EYG A;  5IY0 A;  4B3R L;  5J22 A;  4FF3 A;  3OWF A;  3PUZ A;  3MA2 B;  4K0K Q;  3MXU A;  4X66 L;  2YYZ A;  3R2I A;  2NB0 A;  1HRJ A;  1I4P A;  4L5S A;  3D3R A;  1J9O A;  2EPB A;  1QE6 A;  2IWH A;  5C4J H;  3J81 c;  1S72 A;  2EY2 A;  4A3J B;  3S1M H;  2JA7 G;  1PZK D;  2EYJ A;  1QUQ A;  4A3I G;  5BR8 Q;  1MGS A;  1F9P A;  1XPR A;  4A3D B;  4YIJ A;  1EWC A;  1U4L A;  2SOB A;  2K03 A;  5ELF A;  3HGB A;  4IPG A;  1HH2 P;  1CUK A;  2NWG A;  4BY7 H;  4XYO A;  1PTO D;  1K8A C;  3ERS X;  4XQJ A;  4RGT A;  4IUR A;  3QR8 A;  3RZO B;  1TS5 A;  1ILQ A;  3GV3 A;  5G3L D;  1A2T A;  4IUQ A;  3AMU A;  4FVM A;  2JXM B;  3S1N H;  2O5J C;  4DR1 L;  1VCI A;  3D4D A;  1SRU A;  4JYA L;  5E4X A;  3T56 B;  2CFM A;  4KN7 C;  4CBV A;  2RA4 A;  4LF9 L;  1VQO A;  3I4N G;  4A3G G;  1SJH D;  2JJQ A;  5FLM G;  3KLS X;  2DN8 A;  3I56 A;  4X62 Q;  1JOR A;  1L0Y B;  4DF7 A;  2WAQ E;  1SFO H;  1YZ6 A;  1CA5 A;  3GQB A;  4UP8 A;  3KK7 A;  4DPG A;  3U58 A;  3MFG A;  1K3R A;  2R7Z G;  2XNA C;  2F52 A;  3J7A V;  4GKK L;  4P75 A;  5JEA H;  4IPD A;  3S17 H;  3CCE A;  2IX1 A;  1J6Q A;  2FMC A;  3F8T A;  2KED A;  2F0L A;  2EZV A;  1ZYR C;  3KLW A;  4A3D H;  1EY8 A;  2B8F A;  4KKU A;  2CQO A;  1YIT A;  4AQY Q;  3BG3 A;  2E2J H;  1K8O A;  2KHJ A;  1DGS A;  1LT3 D;  3HOX H;  1CSQ A;  1DJR D;  1Z47 A;  3KDF A;  3J7Z C;  2UUB L;  1I6H H;  4TVA B;  5ELE A;  5IP7 G;  5CV4 A;  2B8G A;  3KYH C;  1FJG L;  2RDG A;  5C3E B;  2IT1 A;  1BDO A;  4UP7 A;  3RNU A;  1DYQ A;  1I4G A;  5FJ8 H;  3NWT A;  2C35 B;  5EBC A;  4BWG B;  5J39 A;  1CT1 D;  2V1C C;  5FO9 B;  3CKI B;  4DV6 L;  3J80 E;  3GDE A;  4JV5 Q;  2EJG C;  2K05 A;  4DV7 L;  1VQD A;  1G6Z A;  4C2M H;  1KD1 C;  4K5V A;  1A63 A;  1L0X B;  2ALY B;  1XNR Q;  2WV6 D;  2WB1 E;  3S2D B;  1EIG A;  4C3J H;  2UXD Q;  1YIJ A;  4PZ8 A;  1XNQ Q;  4RCN A;  5IGE A;  2MPM A;  5LHY 1;  4RKB A;  1GUS A;  1SDF A;  3M4O H;  3FKI H;  1MJC A;  4K5W A;  1HZ9 A;  1GOZ A;  4F87 A;  2G9H D;  3CF5 A;  1CQV A;  5DM7 3;  1EEF D;  3A5Z B;  1QB5 D;  1SRO A;  4A3E H;  1B3Q A;  3DEP A;  4LFA Q;  1PV4 A;  5ISR A;  1STG A;  3M85 A;  2KCN A;  2VQF L;  1UE1 A;  4CKB A;  4OWW B;  1J8I A;  1KNA A;  4LW1 A;  1HR0 W;  1QVG A;  1F2M A;  3GV6 A;  2E2H B;  3PIO 3;  2LFN A;  1VQ6 A;  3F2U A;  2I5L X;  1E24 A;  3FMC A;  3T1H Q;  4K8I A;  1VDZ A;  4NKL A;  3RN5 A;  2AMC B;  1R4P B;  1FGB D;  4B3M L;  4DAM A;  1HNZ L;  1QOH A;  1TT2 A;  2DY8 A;  1YNN C;  3IRB A;  4DGZ A;  3KF6 A;  3EJI A;  4R1J A;  4ZQ3 A;  2RSN A;  1RDP D;  3NPP A;  3TP6 A;  1PH6 A;  5FOB B;  3HOV B;  4PQX A;  2IY5 B;  1K28 A;  4DR6 L;  1XJV A;  1TWG B;  4KD4 A;  5IYC G;  3CME A;  1S5F D;  1PTO H;  5KYL A;  1A8V A;  5EKI A;  4DV0 Q;  1SAP A;  5IIF A;  3RZD H;  2Q2U A;  3MWY W;  3CU7 A;  4A3C H;  4RFB A;  5LMN Q;  1VF5 C;  4DNT B;  2X6L A;  1PYW D;  5M5X B;  2UXC Q;  4PNY A;  2WKC A;  4BXX H;  2SNS A;  1N32 Q;  4L63 B;  3D4W A;  1VS0 A;  1YHB A;  4KI0 A;  1BCP F;  2K28 A;  5C44 G;  3C3L A;  1CA6 A;  3DLL A;  2A6E C;  2ZXO A;  2F4V L;  4QL5 A;  4AYB G;  3SE0 A;  3J81 E;  1PH4 A;  1L1O A;  4G57 A;  2A8V A;  1WCM B;  3I4O A;  3AFQ A;  4RA8 A;  3VYT A;  3PO2 B;  2F0S A;  4IQZ A;  2E2H H;  3L3O C;  3H3V I;  1QIL A;  4CDF C;  1F2Z A;  3HKZ G;  1GD7 A;  4OWX B;  1ROD A;  2NZO A;  2ZJQ A;  4LUV A;  5E7N A;  5EQ0 A;  5I9P A;  4PMC A;  4JI6 L;  5M5Y H;  3NUC A;  3GD7 A;  3HOX G;  2K5D A;  3ND9 A;  1IW7 D;  1LM0 A;  4YCV A;  5CV5 A;  1LO5 D;  2XWJ B;  3D0F A;  3K5N A;  3NXW A;  5EAY A;  4X64 Q;  5JJZ A;  1TQO A;  1GJX A;  4TQU S;  4BXX G;  2R7Z B;  3UDF A;  1WTX A;  3HP3 A;  1NR2 A;  5E3F A;  4KJO A;  2F0I A;  3G4S A;  4DR5 L;  4DA2 A;  4KTA A;  4OWT B;  2Y0S B;  2A19 A;  3E9I A;  1YJN A;  3NBI A;  4QGU A;  3FPU B;  4RHS A;  3EA6 A;  3GTQ B;  1SBB B;  2A5H A;  4BBS G;  1YNX A;  1VQG A;  3NQT A;  5J3B A;  4LK1 C;  3T1Y Q;  4MTK A;  1HNX L;  4B3R Q;  1TWF H;  5C4J B;  2JEA I;  2RF4 A;  4K0K L;  1Q1B A;  3PUW A;  1EZ6 A;  1HJP A;  3OYY A;  1DD2 A;  5IOD A;  3U9O A;  2WAC A;  4A3E G;  2ATW A;  5M5X H;  1I4H A;  3AQQ A;  1KIX A;  2J0T D;  1HA5 A;  1XPU A;  1PFM A;  1X3G A;  2PQA A;  2WAQ G;  2XSC A;  3HOZ G;  2ID0 A;  4HJ9 A;  2BCO A;  4JI0 L;  1E7Z A;  1YVC A;  2JK8 A;  2I5M X;  3KFU A;  2D62 A;  2HIX A;  2HT1 A;  4L5R C;  1DZ1 A;  3S2H H;  2F0K A;  3N52 A;  1OXU A;  4M1U B;  2F3W A;  1K3B C;  2L15 A;  2KJX A;  1LT6 D;  3BDL A;  1SNQ A;  1IL2 A;  4RGM A;  1V43 A;  3K81 C;  4RGN A;  1TY0 A;  2EE1 A;  1AH9 A;  3NWS A;  3TBI B;  2L11 A;  1MKH A;  2A73 B;  3CQZ H;  3PF4 A;  2BDN A;  2KQ3 A;  2CQA A;  5HY6 A;  4TSS A;  1VQK A;  2LSS A;  1F2Y A;  4IFD J;  1PRT B;  4A4I A;  3HOU B;  4C3H H;  3FHW A; 
#chains in the Genus database with same CATH homology
 2VNU D;  3DM1 A;  4EVO A;  2QDB A;  1TWA B;  3CRL C;  4BBS B;  3E6Z X;  1MD2 D;  3I4L A;  2DNC A;  3TSS A;  1NUC A;  4A3B B;  2HQE A;  4KKS A;  2PQE A;  3URY A;  1IYV A;  4QIW B;  1V1P B;  3K58 A;  3KF8 A;  1IL8 A;  3JAM E;  5CGK A;  4A3E B;  2K01 A;  3Q0A A;  2EYO A;  2WP8 J;  3MXG A;  1OXS C;  3K7A B;  1LT4 D;  3MTS A;  3X3M A;  1OO9 B;  3M3Y B;  4X3K A;  1S5E D;  1DON A;  5IGF A;  3QG1 A;  3T51 B;  5K5P A;  1XX8 A;  3DMU A;  2CHB D;  4HMI A;  1UEA B;  1SXT A;  1SE3 A;  2QEJ C;  3DEO A;  3I90 A;  1FD7 D;  1UAP A;  2K5Q A;  5JPN C;  1VMP A;  1GUW A;  3RLF A;  5CV8 A;  1CI3 M;  1X3Q A;  4S3S A;  1MI2 A;  3FEW X;  3IL8 A;  5K36 G;  3LX0 A;  4XYQ A;  2VUM B;  1GXD C;  3SK8 A;  4WOR A;  4C1N I;  4IUU A;  4PV1 C;  2SDF A;  4A3K B;  1AEX A;  3SR1 A;  4J1M A;  4BY7 B;  3K5M A;  2F0V A;  1PTO F;  4C1N K;  1U9R A;  2H4O A;  2ICI A;  1YNJ D;  4PMW A;  2RQX A;  1SJE D;  2B2W A;  1I4R A;  2BA1 A;  2NBF A;  1LT5 D;  3WOF A;  4C3I B;  4IFD I;  1ENA A;  4IUV A;  2E75 C;  4FXK C;  1II3 A;  2F0W A;  4IUT A;  1HTL D;  1KNE A;  4LMQ D;  1SFO B;  2PO4 A;  5LL6 X;  5CYU A;  3PIP 3;  2Z1C A;  1BF4 A;  1FNU A;  1ZYR D;  4N9P A;  3OWE B;  4WJW A;  2RBM A;  1NSN S;  3A7A B;  1G8Z D;  3W2D A;  2EJM A;  2QIL A;  4U67 3;  3C2P A;  2NZ1 D;  1QNK A;  3SEB A;  4A3I B;  2AWN A;  2HDM A;  5M3F B;  1BXT A;  4ZAI A;  5I9O A;  3ONA B;  1XWE A;  3OW7 A;  1TII D;  2F3V A;  3LNN A;  2NVY B;  2SNM A;  4Z9C B;  2L12 A;  3H91 A;  4GZY C;  2DY7 A;  3BVM A;  1Q12 A;  4A3G B;  4Q0F A;  5JEA G;  1Y8P B;  2JA7 B;  3GTP B;  2R92 B;  4ZUJ A;  3HOW B;  1Y1V B;  3SK6 A;  2B2V A;  1HTP A;  3M7N A;  4E6I A;  3H3V C;  2PZW A;  5DEH A;  5FO8 B;  3MFY A;  1RHP A;  3X3N A;  4J8Q A;  2BE5 C;  1BO0 A;  4FP5 D;  2MP1 A;  1DOM A;  3RMH A;  4QUC A;  1GUO A;  2F0U A;  4KN4 C;  1D1K A;  1T5X D;  2B2U C;  2EDG A;  4XTC S;  3OIQ A;  3VYU A;  3V05 A;  1PTO C;  2KA7 A;  3DWP A;  3MZ5 A;  1SNP A;  3G7L A;  5EPL A;  1JE4 A;  4HED A;  2F03 A;  4OIK A;  2NTT A;  2EYM A;  4TRD A;  3BDC A;  5E4W C;  1VMC A;  2L1B A;  2K04 A;  3R2T A;  4QMG A;  3S16 B;  4BA1 I;  3MAQ A;  2EYL A;  2M00 A;  2R61 A;  3OOC A;  3A55 A;  3SDZ A;  4Y7N B;  1E2W A;  3NE5 B;  1I6V C;  4IUN A;  5KNC A;  4U68 A;  3GTK B;  5C5L A;  4ZYS A;  1KLG D;  2WKD A;  3A8J E;  1STB A;  1BUV T;  2B2T C;  2Q8I B;  1WTQ A;  2K6A A;  3M4Y A;  1EFI D;  1H9M A;  5TSS A;  1PFN A;  4H0L C;  1QWY A;  4O42 A;  4OO1 G;  1G2S A;  4CGY B;  2PW5 A;  3D4R A;  4KD3 A;  2MHV A;  1B1Z A;  1FNW A;  4HAE A;  3A56 A;  1WTV A;  2XVS A;  3OMG A;  3SHL A;  5D3I B;  1EY4 A;  1HUN A;  1HHV A;  3T53 B;  5ELC A;  5HGT A;  1QNU A;  3HG9 A;  1CHQ D;  2GA4 B;  2F0J A;  1I4X A;  3Q24 A;  2MGS A;  3NHH A;  1JCK B;  4CKC A;  3KBG A;  3TME A;  2IJ0 A;  2BOS A;  2XRS D;  5M3M B;  3S17 B;  3I8Z A;  3R93 A;  3SXH A;  4R8I A;  1BOS A;  1KAA A;  4EQO A;  1RD9 D;  4MN3 A;  1S4Z A;  1B9M A;  1B53 A;  5M5W B;  1MSH A;  2EJF C;  1JOQ A;  3I91 A;  1A3T A;  1Y8O B;  2EXZ A;  5C44 B;  1EYD A;  4C3J B;  3FDT A;  1TWH B;  3NK9 A;  3QB3 A;  3BZD B;  2Q8T A;  1G2T A;  3PO3 B;  2ICE C;  2Z4I A;  5JVG 3;  5DNF A;  2PYK A;  1SE4 A;  3VA7 A;  4KK7 A;  2AQ1 B;  5COY A;  5A2Q L;  4LJZ C;  5CR3 A;  1IHZ A;  1Q3L A;  3K5L A;  1LTG D;  4MIU A;  1EU3 A;  4UAI A;  1CZW A;  3VYS A;  2HCC A;  1LV9 A;  5C0X J;  5C4X B;  3BDO A;  2K5W A;  1FR3 A;  1TWF B;  2B2Y A;  1EYC A;  3E0J A;  4H13 C;  4OGQ C;  1JWM D;  1I50 B;  4KY6 A;  3RUZ A;  1A6X A;  3NTK A;  1GUT A;  1C4Q A;  5I2X A;  1T5E A;  1OXV A;  4ZKC B;  1EQV A;  5BN3 A;  2L0C A;  1CFM A;  1JC7 A;  3CHB D;  2JYO A;  2B2U A;  2FIN B;  2MJ8 A;  1IW7 C;  1W6J A;  2E76 C;  2J4X A;  3KUP A;  1JWS D;  3C1E A;  4IN3 A;  1KDA A;  1KDC A;  5EPJ A;  2IPK D;  2JA6 B;  4RWS C;  1LAB A;  1PLF A;  3FVQ A;  2CW0 D;  2RSO A;  1ET9 A;  4KV6 A;  2C5C A;  4DAP A;  1XTC D;  1ONL A;  1A2U A;  1TR5 A;  2B2V C;  2NN6 G;  1S5D D;  2A6E D;  4V19 0;  3SK4 A;  1AZQ A;  5IT9 L;  4R8N A;  2ZXR A;  1DOL A;  1JOK A;  1EEI D;  5IGB A;  1QG7 A;  5HUR A;  1I4Q A;  2Z8L A;  2TSS A;  2A69 C;  3E5S A;  2IL8 A;  2WAQ B;  1WD0 A;  2JE6 I;  4XT1 B;  1SYG A;  4K6D A;  1D6E C;  3SVM A;  4CHT B;  4DFA A;  1XXG A;  3EVQ A;  3S1N B;  2F0Q A;  5K36 H;  3NTI A;  2A6H C;  1ZEQ X;  4I7Z C;  1F77 A;  2E2I B;  1WTP A;  2KOL A;  1O80 A;  1X32 A;  1JWU D;  2NN6 H;  1GUG A;  4ULL A;  1RJT A;  3MXP A;  4XQN A;  4EQN A;  1ET6 A;  3S9W A;  5COR A;  2SEB D;  5KIX A;  4IZ8 A;  1SYF A;  4CJ2 C;  1V8Q A;  5FLX L;  2RKS A;  1SYC A;  2L4N A;  4MHE A;  2EYP A;  2F0F A;  2M9V A;  3MVV A;  3K6O A;  4HTH A;  1HFN A;  3VR5 A;  3PV0 A;  4ZLT F;  1LTI D;  2WB1 B;  5FO7 B;  3RD4 A;  4KY5 A;  2JA5 B;  4ODG A;  2AUK A;  2JP1 A;  1BR9 A;  5E1F A;  4RCO A;  1BBX C;  3D31 A;  5D3D A;  4OO1 I;  5EGT A;  1VF7 A;  5DM6 3;  3IAY A;  1G91 A;  4BY1 B;  5LL6 S;  3QOJ A;  3NSW A;  1HA6 A;  1PTO B;  5C3W A;  4HSV A;  3D8G A;  1EYA A;  1JR0 D;  1EU4 A;  2A6H D;  3J7Y W;  3RZD B;  1B50 A;  4XT3 B;  3CRK C;  5CC4 A;  4WFN 3;  2AQ2 B;  1IYU A;  1U4P A;  2LMC B;  3TN2 A;  4FXD A;  4ME5 A;  3Q6S A;  3DUZ A;  2NVT B;  5KYI A;  1JQY D;  4G4K A;  1MSG A;  3VR3 A;  3EQL C;  2F0P A;  4K5X A;  1JIC A;  5I6W A;  4B9X A;  1LLR D;  3TP8 A;  4K2K A;  1SNC A;  1H9K A;  3TZU A;  1JB3 A;  2DNE A;  1B4O A;  4C56 C;  5CV6 A;  4A93 B;  2B2Y C;  4QB4 A;  2FFK B;  4F8M A;  3PUX A;  2E2D C;  1SSO A;  2KEE A;  4FYD A;  2D5D A;  3Q22 A;  4CKE A;  4X3S A;  2B39 A;  1W6K A;  4H44 C;  3MEH A;  1SMY C;  4NDX A;  3BVG A;  2YU9 B;  3HOZ B;  3HOX B;  3DWQ A;  4DXG A;  1AW7 A;  1D5Z C;  3MXN A;  1E0B A;  1EL0 A;  1Y69 U;  1EZ8 A;  4V0B A;  1R9T B;  4P2C B;  4RHR A;  4XIG S;  1C8C A;  3VA5 A;  4HN7 A;  4NP5 A;  3WOE A;  5CBE E;  2PNR C;  4ZUI A;  4X3U A;  1E2V A;  4C3H G;  2IX0 A;  2NN6 I;  4KHV A;  3G6J B;  1KAB A;  1V1O A;  4JK1 C;  2K33 A;  2C9O A;  2BA0 A;  3FRP B;  4N9T A;  3PUY A;  3OPO A;  1TS3 A;  2X6G A;  2XRQ D;  1FYC A;  5EJW A;  5C4Z A;  1EY6 A;  1AZP A;  1K8M A;  2F4I A;  5IGD A;  1CZG A;  5C0X H;  5C3X A;  1C48 A;  1Z6H A;  2F0M A;  2R6G A;  4HR7 B;  1H9S B;  3LWE A;  4B08 A;  3WDN A;  4ZK9 B;  2HDL A;  1H9J A;  1S5B D;  3UI2 A;  3R8B A;  1LTR D;  5JAV A;  4OO1 H;  1D5M C;  1STE A;  3ND8 A;  2F0O A;  4RGO S;  1GUN A;  1QCB D;  3DHQ A;  4QUF A;  2OXP A;  4UDU C;  2L5T A;  2J7Z A;  1QJO A;  1LTS D;  3U9S A;  4G7Z C;  2KVM A;  4DN4 M;  1EY5 A;  2D2C C;  5ELB A;  3QJY A;  4DAY A;  1RF2 D;  3P75 A;  4Q5V A;  1HQM C;  4AYB B;  3OHX C;  2EY5 A;  2R3Z A;  2CW0 C;  2JSO A;  1RKN A;  2MUY A;  2PCF B;  1UNS A;  1D1I A;  1STH A;  3AU7 A;  5EPK A;  4XQQ A;  1H9R A;  3H09 A;  3J81 L;  1X3P A;  2BDO A;  5A2Q E;  2RDF A;  1PDQ A;  5I6Y A;  4KJN A;  4EGV A;  2N88 A;  4DXF A;  2FMM A;  4BA2 I;  4DAV A;  1RTO A;  1PMR A;  3TDQ A;  2I46 A;  1ENF A;  4DU9 A;  2JA8 B;  4B9W A;  5M9O A;  2LY7 A;  4KMU C;  1WVL A;  2VB2 X;  2B2T A;  1GHJ A;  5EKK A;  2EVB A;  2ZT9 C;  5CV9 A;  3VR6 A;  3S1R B;  3A54 A;  1O7L A;  1U4R A;  3S14 B;  1TY2 A;  5IGG A;  1RCV D;  4QF4 A;  4WRD A;  4FF1 A;  1CTM A;  1MBY A;  4IAL A;  3GTO B;  1OXT A;  5J1Z A;  1LTT D;  2HCI A;  3P20 A;  1S5C D;  4RAU C;  2OEO A;  1M4V A;  1NR4 A;  1PZI D;  1CM9 A;  1PRT F;  3HEJ A;  4FNF A;  5KRU A;  1AN8 A;  2WIN B;  2E74 C;  4I65 A;  4H7B A;  3N6R A;  1ESR A;  3D6W A;  3I73 A;  4ILW A;  3K59 A;  5T1G A;  1A15 A;  3KLR A;  4FF4 A;  2EY1 A;  3GO5 A;  1PFB A;  4HCS A;  5CV7 A;  1V1P A;  4BS9 A;  1HUM A;  1K83 B;  3PMF A;  5IT9 E;  2PPB C;  2NYZ D;  5JEA J;  3HZX A;  3I72 A;  2O4X A;  5C0X I;  2EOT A;  3T4A C;  1AP0 A;  4LAA A;  2V4D A;  3GP7 A;  4NW2 A;  1ZXT A;  5G3L F;  5C4H A;  3ZYY X;  1SYB A;  2HUG A;  1M8A A;  1Q1E A;  1UUP A;  2EYH A;  2PZT A;  2LKV A;  3NQI A;  1EY0 A;  1ML0 D;  3V2T A;  2M2L A;  2Q8R E;  4FXG C;  3NBH A;  1EOT A;  3J7A F;  2F0E A;  3KBX A;  1TS2 A;  2NVQ B;  1DXM A;  1A3U A;  2O2L D;  5A35 A;  1EWH A;  1F9S A;  1LAC A;  2TMP A;  1TKW B;  4L8J A;  4F7X A;  5C5M A;  1LTA D;  5JOB A;  5M5Y B;  5NUC A;  3OSO A;  1DM0 B;  3A7L A;  2ZXP A;  5FLX E;  2FHT A;  1NCV A;  2K32 A;  3IFT A;  1HFG A;  1WTR A;  3NTH A;  3H0G B;  3I4M B;  4KKT A;  1ESF A;  3IFD A;  3NP8 A;  3M4O B;  3A8K E;  3OIP A;  4ABN A;  1Y8N B;  2NUC A;  4RKL A;  1OXX K;  1PRT C;  5JPM C;  3MHB A;  2VXW A;  1HCZ A;  4A3F B;  3BVZ A;  5D65 A;  4C2M B;  4ZRZ A;  3M7G A;  4DNR B;  3AB9 A;  1EQT A;  4PMB A;  1BCP C;  2EYF A;  1LTB D;  2L55 A;  1STY A;  5EKL A;  1BQQ T;  1ICW A;  4X3T A;  2LS0 1;  3OMC A;  3JAM L;  2A68 D;  2RVL A;  3VR2 A;  1B2T A;  3L9A X;  2R93 B;  4M8A A;  3HRZ C;  1SND A;  2JEB I;  4IFD G;  3Q23 A;  3HKZ B;  3P7J A;  2KHS A;  5F2D A;  3S15 B;  1CHP D;  3C1F A;  3S1Q B;  5CBA E;  5KNB A;  3VYR A;  3GTG B;  3GTL B;  2KCC A;  1Q90 A;  2A69 D;  4HSP A;  1STN A;  4XXE A;  1ZKO A;  4XDX A;  3O13 A;  2PMZ B;  5I4D A;  1TS4 A;  2F0N A;  5AFW A;  1U4M A;  2AWO A;  1TU2 B;  1Z7T A;  2QCP X;  2ENB A;  2F0D A;  1ENC A;  1SNO A;  2CVR A;  3CQZ B;  2FJ2 A;  3IKJ A;  1PRT D;  2XWB B;  1TVX A;  5FK9 C;  4G7O C;  2O5I C;  3QOL A;  1DCZ A;  3A8I E;  2D9U A;  1B44 D;  3TP5 A;  3BYY B;  5C0X G;  3DWA A;  2VB3 X;  1BCP D;  1JOO A;  4DK1 A;  1NAP A;  4KHZ A;  1HQR D;  4IUP A;  4OHJ A;  2L9H A;  3KLS A;  5EBD A;  3P1H A;  3I4N B;  1SYD A;  1TWC B;  2F0T A;  3GTM B;  3FPP A;  3V96 A;  2BE5 D;  5FKA C;  2A74 C;  1KDB A;  5D14 A;  1PZJ D;  1EIH A;  1HXY D;  1KTK A;  2NTS A;  2N55 A;  2OT2 A;  4RH6 A;  2E2J B;  2KUM A;  5BN4 A;  5IOC A;  1SYE A;  2AUJ D;  4TKO B;  2QF7 A;  4L6T B;  4A3M B;  1FNV A;  3ITP A;  4OL7 A;  2RDH A;  1D2B A;  4R9W A;  3K57 A;  3FKI B;  1E2Z A;  3K5O A;  5KND A;  1O7Z A;  1I6H B;  1EY7 A;  1BNZ A;  5KEE A;  4F88 A;  3T13 A;  4G7H C;  3I70 A;  3H6M A;  4KY7 A;  4K14 A;  3J80 L;  1WTW A;  3ERO A;  2G9D A;  3SK5 A;  4FO2 A;  1F9R A;  4JBW A;  2B63 B;  3S2H B;  4DK0 A;  5C6A A;  1KLU D;  1SEB D;  2PZU A;  2F0H A;  3EFX D;  2F1M A;  2XIW A;  1XYI A;  3QWN A;  3L7Z C;  1B9N A;  1ILP A;  3DXJ C;  1STA A;  5ELD A;  3QO2 A;  1EY9 A;  2NVX B;  1G29 1;  1PXU A;  1O78 A;  3PUV A;  1YNJ C;  3S1M B;  1D5X C;  2EY6 A;  1WTO A;  3TP7 A;  3QIA A;  1BCP B;  5JVH 3;  3K0Y A;  3H94 A;  3ERQ A;  3BS1 A;  1IKM A;  4CJ0 B;  2I07 B;  3C46 A;  4C3J G;  4K8J A;  1CK1 A;  2B2W C;  5KGU A;  2PW7 A;  1SE2 A;  4C3H B;  1R4Q B;  2X69 A;  2KEC A;  4ID6 A;  4HCE A;  1HPC A;  2XN9 C;  4EQP A;  1RTN A;  1YNN D;  2AQ3 B;  1I3Q B;  4ZKB B;  4J6H A;  4K6L A;  4QCL A;  2K1B A;  1F2L A;  3GTJ B;  1F9Q A;  3HS0 C;  1A3V A;  5I2Y A;  2Z4H A;  4BBR B;  1H9S A;  4HMJ A;  3I3C A;  4K2L A;  1O7Y A;  3MC0 B;  1Y1W B;  2WII B;  1WD1 A;  1GHK A;  2F0G A;  4O1N A;  1IKL A;  1B3A A;  1Q8I A;  3T16 A;  3HOY B;  1AFP A;  5T1I A;  1CQF A;  1SNM A;  5IGC A;  5BN5 A;  2K7V A;  4C3I G;  4IFD H;  3D6C A;  3BYT B;  3W3A A;  3VR4 A;  2H1E A;  4NMZ A;  3LWU A;  2IW3 A;  2QKI C;  4OIJ A;  2OF1 A;  1DOK A;  3TZD A;  2IX3 A;  4FF2 A;  2A68 C;  4CJ1 B;  5DAU A;  5CMD A;  1SMY D;  3R3O A;  5J22 A;  4FF3 A;  3OWF A;  3PUZ A;  3MA2 B;  3MXU A;  2YYZ A;  3R2I A;  2NB0 A;  1HRJ A;  1I4P A;  3D3R A;  1J9O A;  2EPB A;  1QE6 A;  2IWH A;  2EY2 A;  4A3J B;  1PZK D;  2EYJ A;  1MGS A;  1F9P A;  4A3D B;  4YIJ A;  1EWC A;  1U4L A;  2SOB A;  2K03 A;  5ELF A;  3HGB A;  2NWG A;  4XYO A;  1PTO D;  4XQJ A;  4RGT A;  4IUR A;  3RZO B;  1TS5 A;  1ILQ A;  3GV3 A;  5G3L D;  1A2T A;  4IUQ A;  3AMU A;  4FVM A;  2JXM B;  2O5J C;  1VCI A;  3D4D A;  5E4X A;  3T56 B;  4CBV A;  4KN7 C;  2RA4 A;  1SJH D;  3KLS X;  2DN8 A;  1JOR A;  1L0Y B;  4DF7 A;  1CA5 A;  3GQB A;  3KK7 A;  3MFG A;  2XNA C;  3J7A V;  5JEA H;  2IX1 A;  2FMC A;  2KED A;  2F0L A;  2EZV A;  1ZYR C;  1EY8 A;  2B8F A;  4KKU A;  3BG3 A;  1K8O A;  1LT3 D;  1DJR D;  1Z47 A;  5ELE A;  5CV4 A;  2B8G A;  2RDG A;  5C3E B;  2IT1 A;  1BDO A;  1DYQ A;  1I4G A;  3NWT A;  5EBC A;  4BWG B;  5J39 A;  1CT1 D;  5FO9 B;  3CKI B;  3J80 E;  1G6Z A;  2EJG C;  2K05 A;  4K5V A;  1L0X B;  2WV6 D;  3S2D B;  1EIG A;  4RCN A;  5IGE A;  2MPM A;  5LHY 1;  4RKB A;  1GUS A;  1SDF A;  4K5W A;  1GOZ A;  4F87 A;  2G9H D;  1CQV A;  5DM7 3;  1EEF D;  1QB5 D;  3DEP A;  5ISR A;  1STG A;  3M85 A;  2KCN A;  4CKB A;  1J8I A;  1KNA A;  1F2M A;  3GV6 A;  2E2H B;  3PIO 3;  2LFN A;  3F2U A;  3FMC A;  4K8I A;  1VDZ A;  4NKL A;  1R4P B;  1FGB D;  1QOH A;  1TT2 A;  2DY8 A;  1YNN C;  4DGZ A;  3EJI A;  4ZQ3 A;  2RSN A;  1RDP D;  3NPP A;  3TP6 A;  3HOV B;  5FOB B;  4PQX A;  1TWG B;  4KD4 A;  1S5F D;  1PTO H;  5KYL A;  5EKI A;  1SAP A;  5IIF A;  3MWY W;  3CU7 A;  4RFB A;  1VF5 C;  4DNT B;  2X6L A;  1PYW D;  5M5X B;  4PNY A;  2WKC A;  2SNS A;  4L63 B;  3D4W A;  4KI0 A;  1BCP F;  2K28 A;  3C3L A;  1CA6 A;  2A6E C;  2ZXO A;  3SE0 A;  3J81 E;  4G57 A;  1WCM B;  4RA8 A;  3VYT A;  3PO2 B;  2F0S A;  4IQZ A;  3L3O C;  1QIL A;  1F2Z A;  1ROD A;  5I9P A;  5EQ0 A;  4PMC A;  3NUC A;  3GD7 A;  2K5D A;  3ND9 A;  1IW7 D;  5CV5 A;  1LO5 D;  2XWJ B;  3K5N A;  3NXW A;  5JJZ A;  1TQO A;  1GJX A;  4TQU S;  2R7Z B;  1WTX A;  3HP3 A;  1NR2 A;  5E3F A;  4KJO A;  2F0I A;  4DA2 A;  4KTA A;  2Y0S B;  3NBI A;  3FPU B;  4RHS A;  3EA6 A;  3GTQ B;  1SBB B;  2A5H A;  3NQT A;  4LK1 C;  5C4J B;  2JEA I;  1Q1B A;  3PUW A;  1EZ6 A;  1DD2 A;  5IOD A;  3U9O A;  2WAC A;  1I4H A;  2J0T D;  1HA5 A;  1PFM A;  2XSC A;  2ID0 A;  2BCO A;  2D62 A;  1DZ1 A;  2F0K A;  3N52 A;  1OXU A;  4M1U B;  2F3W A;  2KJX A;  1LT6 D;  3BDL A;  1SNQ A;  4RGM A;  1V43 A;  4RGN A;  1TY0 A;  2EE1 A;  3NWS A;  3TBI B;  2L11 A;  2A73 B;  2BDN A;  2KQ3 A;  2CQA A;  4TSS A;  1F2Y A;  4IFD J;  1PRT B;  3HOU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...