4ZUIA

Crystal structure of staphylococcal nuclease variant delta+phs v23h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTHKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zuiA00
4K2LA 2F0NA 5M9OA 2F0UA 4QF4A 3TP6A 3C1EA 5CGKA 4K8IA 3HZXA 4G57A 1SNCA 4ODGA 4IZ8A 3OMGA 1JOQA 5HGTA 2F3WA 1A3TA 2M00A 2ENBA 5CV9A 1EQVA 3QOJA 4K5VA 5DEHA 4ZUIA 1ENAA 1IHZA 3H6MA 1U9RA 3ITPA 3P1HA 4KY5A 4KY6A 4E6IA 5KYLA 1EY5A 2F0SA 1JOOA 3PMFA 4ME5A 5I6YA 5I9PA 5F2DA 4ZUJA 2EY6A 3VA5A 2PZTA 4K2KA 4K8JA 5DAUA 4DF7A 5KRUA 1II3A 4HTHA 3OMCA 4WRDA 5IODA 2PZWA 4DGZA 1F2MA 2EYHA 3NP8A 5IGFA 3NUCA 2WACA 2RDFA 4HMJA 4YIJA 5EGTA 3SHLA 3BDLA 2F0HA 5CR3A 2OEOA 3SK6A 4LAAA 1SNMA 2EXZA 4QB4A 5C3XA 4I65A 2F0IA 1SYFA 2F0OA 4KV6A 4F8MA 1SYGA 4F7XA 4IUNA 4J1MA 4DU9A 3T16A 5HURA 1JORA 3D4WA 1NUCA 3NK9A 1SYCA 2NUCA 3SK4A 2RBMA 5I9OA 5JAVA 2SNMA 2F0JA 5EKKA 1KAAA 1SNQA 2F0KA 2F0VA 2PQEA 5KYIA 3NQTA 1SYDA 2PYKA 3NXWA 1ENCA 3P75A 2PZUA 3D6CA 3TP8A 5IGDA 4K5XA 1EZ6A 4MIUA 5J1ZA 3EJIA 3R3OA 1RKNA 4K14A 4B9XA 4KD3A 3D4DA 4IALA 4PMBA 1F2YA 2F0LA 5JOBA 3C1FA 4R8NA 5K5PA 1TR5A 1EYAA 5EKLA 2KQ3A 4K6DA 4EVOA 1SNDA 4J6HA 4NKLA 4S3SA 4WORA 2QDBA 1JOKA 3TP5A 5C4HA 5C6AA 1STHA 1SYEA 1A2TA 3E5SA 3ERQA 1EYCA 1A3VA 2RKSA 1EY0A 2KHSA 4EQOA 5IGGA 2SOBA 4HMIA 4KY7A 5C3WA 5C4ZA 5KIXA 2HQEA 4PMCA 5I6WA 5IGCA 4N9PA 2EYOA 1EYDA 2LKVA 3SK8A 3S9WA 4QMGA 3MXPA 5C5MA 4PNYA 5J39A 3NHHA 1TT2A 5CV5A 1EY8A 3TMEA 2EYMA 1TQOA 3QB3A 3SK5A 5CC4A 4TRDA 3OSOA 3QOLA 3MHBA 5KGUA 5IGEA 5IGBA 1EY6A 1STAA 1STYA 2SNSA 2EYPA 1SNPA 3SXHA 4KTAA 5E3FA 2EY2A 2F0WA 3HEJA 2F0EA 3MEHA 2F0QA 4NDXA 1STGA 5CV4A 1A2UA 1EY7A 4OL7A 1STBA 4KJNA 5C5LA 1EZ8A 2PW5A 3V2TA 4K5WA 1KDBA 4N9TA 1KDCA 4RKBA 3RUZA 4DFAA 2EY1A 4B9WA 1AEXA 2EY5A 2F0TA 2F0DA 1NSNS 5E1FA 1KABA 4KHVA 5IOCA 2F0GA 2EYLA 3DHQA 4H7BA 1A3UA 2EYJA 2F3VA 4ID6A 2F0MA 1EY9A 2OF1A 3DMUA 3LX0A 1STNA 5CV7A 4KJOA 5CV6A 4ZQ3A 2F0FA 4RKLA 4NMZA 4NP5A 3MZ5A 3T13A 4EQNA 4KD4A 4EQPA 1EY4A 3EVQA 5IIFA 3SR1A 5ISRA 5J22A 1SNOA 2F0PA 3U9OA 1KDAA 2EYFA 3MVVA 5CV8A 3TP7A 3EROA 1SYBA 3D8GA 2OXPA 2O4XA 2PW7A 3BDCA 5NUCA 5KEEA 3OWFA 1F2ZA
chains in the Genus database with same CATH superfamily
2B2VA 3Q23A 1PMRA 2PO4A 2NVXH 1EWHA 3S1NH 3AU7A 5E4WC 1X3PA 5IYCH 1KTKA 2A73B 2NBFA 3H6MA 3GTKH 4DAYA 2B2TC 1NCVA 2FINB 3FPPA 1UWVA 5I9PA 1SSOA 3I56A 4R4TA 1IL8A 4QIWB 5IP7G 3NUCA 2RDFA 1WOCA 3RD4A 3Q8DA 3AFQA 1YNJC 1SNMA 1N34Q 4BA2I 4PZ7A 2HDLA 2Y0SB 3GTJB 2UXBL 4RHRA 4F8MA 3HKZG 1CKNB 5FLXE 2A6EC 3GQBA 3URYA 2CCZA 1EEID 4KKUA 2A69C 4JI7L 2F52A 1HFNA 4BY7B 3CW2C 1W2BA 1LTTD 4JCVE 5LMUL 2JA7H 2VB2X 3FRPB 4B3RL 3CU7A 2E2IH 1XTDA 3S14B 1SMXA 1Q82C 2ZXRA 3TDQA 1Z7TA 5ELNA 5BN3A 2MFIA 1XPUA 2RVLA 1ICWA 1HQRD 2L15A 2HHHQ 2NWGA 1RF2D 1V1PA 1HXYD 2OCEA 3R8BA 1VQLA 3R2TA 1M1KC 1GUNA 5LL6X 1WI5A 1EIHA 5M5YH 1I4RA 4N9PA 2B29A 4HSVA 3OWEB 2FXQA 1VMCA 2NN6I 3S1MH 1PA6A 3J7A5 2N49A 3O13A 2HCIA 3RZDB 3PIO3 3KOJA 4Y7NB 3U4ZA 2AKWB 1BOSA 1IYJB 2GVAA 2E76C 3LGJA 3I91A 4JW0A 1EEFD 1B44D 4LF8Q 1QOHA 3VR4A 1HR0W 2MHVA 4RKBA 3TS0A 4A3LH 1AEXA 1JB7A 3LWEA 3J81L 2R7ZB 1OO9B 3SE0A 3QG1A 1LTLA 1L0WA 3NTKA 5FK9C 2WV6D 1CKNA 1KC8C 1V9PA 3IL8A 1D5MC 2DGYA 4DAPA 2M9VA 3G6JB 3U9OA 4GKJL 1DGSA 3S15B 1Q8IA 1VQDA 2RF4A 3MXUA 3D8GA 5DM73 2UUAQ 5JVH3 3OWFA 3I2ZA 1WVLA 5FLXc 4LF5Q 1Y1WG 3J81i 2JA6B 1YBYA 4G57A 2F3WA 2JXMB 1JWMD 5LMNW 4DXGA 2HDMA 1VQHA 3RZOH 3OHXC 2NYZD 4DV5Q 4ZUJA 2JK8A 4RGMA 4Y52H 4C3JH 2Q8IB 2ALYB 2JA8H 1IKMA 1EYGA 5IGFA 3ONAB 4LFCQ 1DOLA 4P73A 1B4OA 4ZCKA 1G6PA 3KF6B 1BCPB 2JN4A 3E3XA 4A3DH 2F0IA 1NR2A 3NWTA 4QUCA 4A93G 1N36Q 1QJOA 1QCBD 1VQ6A 3NBIA 2RBMA 4LUZA 2IHFA 3PUXA 2ATWA 2NVYH 1NR4A 4GOPB 4QUFA 1XXGA 1CSPA 5D14A 1IW7D 5C0XJ 4ABNA 4KHZA 2ICEC 2TSSA 1R4PB 2RHSB 1CFMA 1QNKA 2RSNA 3KLRA 4K6DA 3V05A 3M4QA 2NN6H 3PO3B 3NENA 4X64L 4FVMA 1RDPD 5D3IB 1O7LA 2RKSA 1GUOA 3M4PA 5IGGA 1UUPA 1EOTA 4PMCA 4BBRB 3JAML 1IBMQ 1YNNC 3R2IA 2VW9A 3S1QH 3PUYA 3K80C 1BQQT 4L5SA 1IZ6A 3D3RA 1WCMH 3SK5A 2L4NA 4MTNA 5LL6S 1Q12A 4JI8L 3AMUA 1PH8A 4O1NA 4RFBA 1MJEA 1W6KA 4DA2A 1STBA 2BA0A 2ID0A 4DR7Q 1H9JA 1KNAA 1PYSB 1ZYRC 4FDBA 3A54A 3H15A 4DV7L 1HJPA 1KABA 3DHQA 1BBUA 1XTCD 4XT1B 3CKIB 4A3DB 1VQ8A 1EY9A 1JMCA 5CV6A 4G4KA 2ZJQA 5FO8B 1LT3D 2OTJA 4HIDA 2E5LQ 1WTQA 2V1CC 2G9HD 1TIID 1R9TH 1S72A 4A4IA 1PRTD 3ULPA 3LNNA 5C4JB 2RHQB 2CW0D 5JVG3 4GOPA 3GTQH 3F8TA 5A2QE 3E0JA 1OTCA 1BR9A 1DD2A 2IW3A 4A3IB 4UDUC 5FLMG 2Z8LA 3MWYW 1TWFB 5GQOA 1EY5A 2FMMA 3M9BA 1GOZA 2PZTA 3TEHB 5DLQE 4CDFC 4CJ1B 4NXMQ 4DXFA 4RCNA 3EIVA 3CCRA 4X66Q 5C3XA 4MZ9A 1ZXTA 1SMYC 2Q2UA 4C3IG 2VQEL 2YU9B 4A3KG 2CVRA 1JORA 4X6AH 4BA1I 3PIP3 5EKKA 5CYUA 1GUSA 4AH6A 5KNCA 3M3YB 3TS2A 2NB0A 2CKZB 4DV2Q 1TXYA 1PH9A 2QILA 4GKKL 4A93B 1LABA 4NKLA 4B08A 3E5SA 1SDFA 1PFSA 3LWUA 4DKAC 2BOSA 2FFKB 4QQBX 3D31A 3CCJA 5C3WA 5IT9E 5I6WA 3GTQB 1I6VC 2B63H 1VS0A 2B3GA 2K5VA 1Y1VG 3H0GB 4DV3Q 1WTPA 5EQ0A 4GNXB 2A6HD 1TWGB 4A3CG 1BO0A 1ONLA 2R6GA 4CDEC 1YHAA 4WFN3 3IAYA 1VQMA 1SR3A 5JJLA 4A3BH 4XDXA 2JEAI 3FMCA 1EFWA 1TWAB 1DOMA 1AW7A 2F0DA 4IUVA 3ERSX 3U4VA 4GZYC 1H9RA 2L55A 4POFA 1CZGA 1X56A 3K0XA 5IIFA 1J6QA 2YTYA 1PH7A 3AQQA 3MAQA 1PFNA 5C44H 2UXCL 1QZHA 2PW7A 5M3MH 2OQKA 1SFOH 1RD9D 4P72A 3NWSA 1SJHD 4YWMA 4BY1G 2Z4IA 3I70A 4A3EG 5HGTA 1JJ2A 3T1HL 4ZLTF 1E7ZA 5M3FH 4ZUIA 4KY6A 4OXPA 1B8AA 1PFBA 4POGA 3PMFA 1MBYA 3HOWG 3GTLH 1CQVA 3GTPH 1SXTA 2EE1A 2ZJPA 1K83H 1MI2A 1F2MA 1VQOA 4QL5A 4GNXA 2EVBA 5IY0A 5E4XA 2E2DC 1BCPC 1O78A 4LAAA 1F2LA 4OONA 3IRBA 4P2CB 4YWKA 4DK3C 5IT9c 2UUBL 5JEAH 4A3JH 3RR5A 2F0OA 3OIPA 1PH1A 1TWHH 5IP9H 1WYDA 3D6WA 5HY6A 3RN2A 4IUTA 4DR1L 2K03A 2VXWA 2ZM6L 1J8IA 1Q86C 2DN8A 2E8GA 3FP9A 2VNUD 2VZAA 1OXTA 3D6CA 4RWSC 1RCVD 4C2MH 3NEMA 1PTOH 2D0PA 2WB1E 1CA6A 2L0CA 4X3TA 4DV0Q 4HIKA 4A3KB 5BR8Q 1GHKA 3NE5B 1LUZA 3VR6A 1HCZA 4O42A 3TP5A 2Q2TA 3HOUH 1E24A 1E2ZA 1LT4D 3AB9A 4J8QA 3P20A 4L5QA 3I4MG 3E9IA 1EOVA 1P16A 1J5EQ 1CA5A 2SOBA 5KIXA 3CQZB 5T1IA 3FHWA 1FD7D 3FPUB 2BE5C 1ASZA 1GD7A 5FJ8H 5AJ3Q 1LO5D 4A3MH 2K5HA 5G3LF 1ILQA 5CORA 4UHVA 1GO3E 3DUZA 1HZAA 4R8IA 1ILPA 5IGEA 3KLWA 1VMPA 2E2JH 4JV5L 1DM0B 2F0QA 1STGA 3DEPA 1RTNA 3BJUA 2L12A 1DJRD 5AFWA 1AE2A 3PUVA 3BYTB 5IOCA 1VDZA 5A35A 2EZVA 5C3EH 2I07B 1ESFA 2F0MA 2O2LD 2VY3A 1HR0L 1Z9FA 3HOXG 3K58A 4TQUS 1K8MA 3I4NG 3S16B 4LWCA 2R92G 1DZ1A 4K0KQ 3N52A 2FMCA 2IJ0A 4RAUC 1NTGA 3JC66 2B2TA 4LFAL 1PZKD 3V96A 3HOVB 2DY8A 1E1TA 2R93H 1ZEQX 4LFBL 2K33A 3S17B 1EQVA 4IO9A 4B3SQ 5IYDH 2LXJA 5LMNL 5DAUA 4A3FH 1II3A 4BY1B 3I7FA 5FKAC 4C3HH 1TU2B 5EPJA 4A3EB 1DYQA 1H95A 1YJNA 4KKTA 4XYOA 4LF7Q 1R4QB 1SYFA 3T4AC 3A55A 1PDQA 3HOZG 2K50A 3L7ZC 1PRTB 1S5CD 4IN3A 5EJWA 2Y0SG 2PYKA 2BA1A 3P75A 3ER0A 4YCVA 3HOYB 2QW7A 5J1ZA 2J0TD 1SN8A 1JICA 1PZID 4JI2L 2KJXA 4KD3A 4PMBA 2NVQB 3S1RH 1EYAA 1X3EA 4J6HA 4OWWB 1SE2A 2L5TA 5C4HA 3HKSA 2PI2A 3T1YL 2K05A 3ERQA 4XYQA 1HZ9A 3HFZB 2EQSA 1XNQQ 4C1NI 2XWJB 5IGCA 1AP0A 1WFQA 4A75A 3NTHA 1A8VA 2LKVA 2R93B 3GDEA 1EY8A 1B3AA 2A68D 3TMEA 1X32A 3PO2H 4DAMA 1K8GA 5IGBA 2AWNA 1MSHA 1NMFA 3A8KE 5JPMC 3I4MB 1OXXK 2N8NA 2MGSA 2JJQA 1N33Q 1IYUA 3C2PA 1X6OA 4FNFA 1XMQQ 5ELOA 2EDGA 2JQOA 2EYLA 4M8AA 2O5IC 3S2DB 4RGOS 5M5WH 5M5XB 1TS5A 1STNA 1AZPA 3UI2A 4YCWA 4JBKA 4DUZQ 3D4RA 1QILA 2EYFA 1G2TA 1F9RA 1UE5A 4CBVA 4IPDA 4HIOA 1D2BA 4BS9A 2KEDA 1NBWA 1FYCA 4J15A 4JBWA 4IFDH 1IBKL 5CGKA 4DV6L 1XX8A 3OTOL 1I6HB 1JWSD 3HOXB 2D9UA 1F77A 1W3SA 4CKCA 3K57A 1Q46A 5IYBH 2JA5H 4DV4L 3UDFA 3TSSA 4DR5Q 3QOJA 3F2DA 4OO1H 3P1HA 3QWNA 1G6ZA 1RL2A 3GTGB 3NBHA 4ME5A 5LHY1 3NELA 2EY6A 3SEBA 4PQXA 1D5XC 4AYBE 2WACA 2OQ0A 2N88A 4YWLA 1BF4A 4FXGC 1KRSA 3HG9A 4YY3L 1T5EA 2I0QA 1D1KA 1YI2A 4I65A 4F88A 1LTGD 4BXXH 4IUNA 4JPBW 4KKSA 1S40A 4LW1A 3CC7A 1QNUA 2LS01 1KAAA 2F0KA 2I5LX 2P5ZX 4FXDA 2WINB 2C35B 5A2QL 5CBAE 1EZ6A 4MTKA 1U4RA 4B9XA 1FJGL 2NZOA 2J4XA 1L2FA 3K7AB 3BZKA 3BS1A 5K36G 3HOZB 2EXDA 1KAWA 2GVBA 4JI5L 5C6AA 2VS1A 3M4OH 1A2TA 1LTAD 2R7DA 1M8AA 1EY0A 2KHSA 3D0FA 3W2DA 4OGQC 1E2WA 3TQYA 1PTOF 4RH6A 2NTTA 1EFID 4B3ML 3PO3G 2PQAA 3RLOA 4JI0Q 5BN4A 2E74C 3NHHA 1TT2A 3M4YA 3GTOH 3QB3A 1CTMA 4BBRG 3A0JA 1EY6A 4DNRB 1I94L 2F0WA 2F0EA 4CDDC 5CMDA 1SBBB 1Y8OB 1Y8PB 4RMFA 1KDBA 3RUZA 1VCIA 5C4XH 1E0BA 1Z47A 1NSNS 4X65Q 4KHPQ 4HJAA 1O7ZA 4Z9CB 4C3JG 1LV9A 4EQOA 2JA8G 4OEMB 4JYAQ 1AN8A 3K81C 1GM5A 2NVXB 3S1NB 2KCNA 2KOLA 4MN3A 4XQQA 5IT9L 2WKCA 3J7AF 5ELFA 3ND9A 2C5CA 4A3DG 1SYBA 2IHEA 2CQOA 3KJOA 3GTKB 3FKIH 1J9OA 2HD3A 2ZXOA 3KYHC 3CCSA 4A3GH 3C1EA 2FJ2A 3HZXA 4XT3B 3QJYA 1LTRD 2UUCL 3A8IE 4KLKA 1MIUA 4B3TQ 5KYLA 2FHTA 2KHIA 3ZYYX 1RJTA 2Q8TA 2VQFQ 4HTHA 3GTMH 4WRDA 5IODA 4A3IG 3NPPA 3NP8A 4OIJA 3FDTA 2CH4A 4YIJA 2JA7B 3K5LA 1X3QA 3STBD 1LTSD 3E0EA 2E2IB 1PH2A 1NY4A 4O2DA 1PRTC 2XRSD 1HUMA 3PQIA 4PZ8A 2CW0C 2PQEA 1CKOA 3NQTA 2AWOA 2IX3A 5IGDA 1GJXA 2K04A 4MIUA 5M5YB 4DV1Q 1SE4A 3S1MB 3KDFB 1E3PA 1DOKA 1L1OB 3RMHA 4RG1A 1EWCA 1JOKA 4JI6Q 5EBDA 3HGBA 4KI0A 2K5QA 4LF9L 3H3VI 3MEFA 2HQEA 3FVQA 1YHQA 3TZUA 2EYOA 2KCTA 4X62L 4KN7C 1HA5A 1TWCH 4F87A 2F3IA 3H0GG 2HIXA 1XMOL 3WDNA 1PHJA 1EZ8A 3J80L 4BWGB 3QIAA 1KDCA 1HNXL 3SVMA 1SAPA 4IJLA 5TSSA 2EY5A 4H7BA 2KBNA 3E9HA 2F3VA 1KNEA 3J81j 2D62A 2OF1A 3CAMA 3LX0A 4ZQ3A 1B2TA 4KJOA 4OX9Q 1K9MC 2JP1A 1EY4A 3R93A 1PH4A 1ASYA 1PTOD 1L0XB 4UY8C 5ELEA 1B53A 2B2WC 3CPWA 1NMGA 1S3OA 3RZOB 2QCPX 3J80i 5COYA 2Z4HA 2J7ZA 2B2YC 1CQFA 2A6HC 4C3JB 3F2CA 2JA8B 2XSCA 4FYDA 3KDFA 3JAMi 1JOQA 4LF6L 3A7AB 1Y1WH 3EQLC 3KK7A 3HKZE 2LY7A 4DR6L 3KF6A 3ITPA 1IBLQ 3PUWA 2VUMH 1N32L 4WJWA 4DR4L 1CT1D 3MXNB 1HHVA 3G71A 1F9SA 3G7LA 5GROA 2MO1A 1WJJA 1YJWA 1X3GA 3K5MA 1LM0A 2NVYB 3SHLA 3BDLA 2F0HA 2KENA 3WOEA 2QEXA 4HJ9A 1GVPA 1JE4A 1D8LA 3CP0A 3EN2A 1JE5A 4DUYL 4OELB 1NUCA 1K3BC 1OXUA 2PMZE 4Q0FA 5JAVA 4OWXB 3J7YW 1HNZQ 2F4VL 2F0JA 1RODA 4X3UA 1A0IA 1HFGA 4KN4C 4A3BG 4NXNQ 3R3OA 1KIXA 2ZTCA 3S1QB 1SEBD 2KQ3A 3BDOA 1EUJA 4WORA 1JQYD 1WCMB 4JI3Q 1STHA 4IQZA 2YTVA 2UU9Q 4LNQA 2XTIA 3CCLA 4JC0A 3CCEA 1EU3A 4CKEA 3MXPA 5M3MG 1XNRQ 3VR2A 4KK7A 3OSOA 4HIMA 1H9KA 3PV0A 3K59A 3SXHA 2Z0SA 4RA8A 2VUMB 1EIFA 2EY2A 3MEHA 3HEJA 2XGTA 2K5NA 5J3BA 4XXEA 3H94A 3RNUA 4KJNA 1K8AC 4DR2Q 1R9TB 1QE6A 4ZAIA 2CFMA 5E1FA 3KBGA 2L1BA 4ULLA 1NJIC 5IWAQ 4FXKC 4NP5A 1IL2A 1KXLA 3T53B 2WAQE 5BN5A 5J22A 2L11A 3MVVA 2N78A 3UDIA 1GXDC 2O4XA 5JEAG 4A3JG 1LLRD 4HCEA 1N34L 2PPBC 3BVGA 2VB3X 3I8ZA 2BH2A 1EQRA 2ZJRA 5KNBA 2ENBA 3K7UC 5CV9A 2Z6BA 4K5VA 1ENAA 3HOVG 1IHZA 4JI4L 2K52A 4ME3A 1JOOA 1VQNA 4DF7A 1DXMA 1HPCA 3HOUG 5FLMH 1YITA 4LK1C 4APVA 3J81E 5D65A 2HCCA 3G6EA 1SRUA 1LYLA 3N6RA 4YY3Q 2NTSA 4LUOA 1PFMA 1O80A 3D4WA 3NK9A 1VQEA 4H0LC 4HCSA 4JOIC 1D5ZC 4C3IH 4UP8A 5C0XI 1F9PA 1AFPA 2RQXA 1LT6D 3A56A 1TVXA 1G91A 1XPRA 2B63B 1PV4A 1TS4A 2KVMA 2DNEA 3IFDA 1BBWA 1L1OC 2Z6KC 2NVTH 3OPOA 4LF8L 3HOYG 4R4CA 2UXBQ 1I5FA 2WB1B 4A3BB 4JI7Q 1LTID 2LXKA 1CI3M 4QMGA 2X6GA 2XIWA 2QDLA 2KHJA 2TMPA 3P7JA 4JBMA 5LMUQ 3RLFA 3H91A 5CC4A 4B3RQ 1E22A 3KBXA 3QOLA 2UUAL 2H5XA 1Y1VH 1STYA 2R93G 1I94Q 4LF5L 5CV4A 1EY7A 3OW7A 1MSGA 2PW5A 1VQGA 5C44B 1P8LA 5ELBA 5M3MB 4B9WA 1T9HA 1SFOB 1L0YB 2L9HA 2K5DA 1AE3A 4RKLA 3T51B 4EQNA 1I50H 4DV5L 5FLXL 2LFNA 3VYSA 1HQMC 1VQIA 3I72A 4LUVA 3J81c 3TRZA 4IOAA 5M3FB 3VDYA 4LFCL 4DR3L 5GAEC 4DAVA 5NUCA 1HTPA 1U0LA 3GTLB 1YHBA 3S2HH 3GTPB 1Y14B 2A68C 4GLVB 2PCFB 1N36L 2MJ8A 1ET9A 1K83B 1KHIA 2MUYA 4OHJA 5ELDA 4K6LA 1U9RA 5H1SE 4N8X1 4CGYB 4YHHL 4AYBG 2H1EA 4A3JB 1AH9A 1KLUD 1TWHB 1X55A 3VA5A 4DK1A 1KD1C 4GKJQ 1DONA 3HOWH 3KLSX 4XQJA 1Q1BA 5EGTA 4JK1C 2N3SA 4GLAC 4C2MB 4IURA 5D3DA 4DN4M 4V0BA 3CMAA 1PTOB 5C0XH 4LF4L 1Q7YC 1SYGA 1K73C 4J1MA 3PO2G 1IBML 2YTXA 3HOUB 3X3NA 2DY7A 4RGTA 1UE1A 2PZUA 2Q2HA 1EQQA 1M4VA 4JBJA 1RKNA 1HTLD 5JOBA 1V1OA 4A3MB 4TSSA 1FNUA 4DR7L 4JG2A 5E7NA 1ML0D 1IYVA 1A3VA 2E2HH 2E2JB 2BDNA 2PI2E 4ILWA 4L8JA 1B1ZA 4JI1L 1K8OA 3QR8A 4UAIA 3VR5A 4XIGS 2E5LL 3UDXA 3Q6SA 1VQ4A 3A7LA 3KF8B 1D6EC 1AZQA 4IFDG 5C3EB 2MNAA 4L5TA 2QF7A 2SNSA 4KTAA 3CCQA 5ELCA 5IYBG 3UDGA 2A1AA 2JA5G 2JEBI 2LMCB 4OO1G 3A5ZB 4AQYL 3ICEA 4X64Q 1SLJA 2CWAA 1Y8NB 5CV7A 5I6YA 1XYIA 4EQPA 1HUNA 1I3QH 3PGZA 4IUQA 1QUQB 4NXML 3EROA 3I4NH 4HJ5A 4BXXG 1YZ6A 1YNXA 5KEEA 2R92H 4K2LA 4JI8Q 3S24A 4X66L 3TP6A 5IYCG 1UE6A 4BBSH 4A3FB 2IY5B 4GN5A 4ODGA 3OMGA 4HJ7A 4C3HB 1KL9A 2X6LA 3I4OA 1S5DD 4DV7Q 3QO2A 5DEHA 2OTLA 5T1GA 5JJIA 2QEJC 2H4OA 2N55A 3W3AA 4MHEA 1N8RC 4DV2L 1NE3A 1FNVA 5EPLA 5KRUA 4K8JA 4TKOB 3DLLA 2XNAC 4L5RC 2QGQA 5G3LD 3AYHB 3KF8A 1ET6A 4WJ3M 4EGVA 2EXZA 2ZTEA 4DAYB 3CCVA 3L0OA 4AYBB 2WFWA 1CUKA 3S1RB 4DUYQ 2JA7G 5I9OA 3GP7A 4DV3L 1X65A 1B9MA 1GUWA 3GTJH 1WTOA 1JT8A 3RN5A 4R8NA 1OXVA 2JE6I 4BY7H 3PO2B 2WP8J 1B9NA 1E2VA 5HGQA 4NPSA 2XRQD 1D1IA 4GS3A 2M2LA 2VQEQ 1O7IA 3S14H 2K28A 3S9WA 3STBC 1HNWL 3BVZA 3FKIG 1JCKB 1WTVA 5J39A 5CV5A 4CHTB 3CRKC 3G48A 1V1PB 1VQAA 1TS2A 5M5WB 4GN4B 3TP7A 5I4DA 1HZBA 4LJZC 4A3LG 4FF1A 4GKKQ 1A2UA 2VL6A 3MA2B 4OL7A 2HIVA 5EKIA 2B2WA 1S5BD 4DFAA 1U4LA 2EY1A 5KNDA 1FGUA 2PNRC 2ZTDA 5IE8A 4KHVA 4EQ5A 3RZDH 2EYJA 2B2YA 1I4QA 4Y7NH 1BUVT 1XWEA 4DK6C 1UAPA 1WTRA 3U50C 2QA4A 2JA5B 4QCLA 3CCMA 1UEAB 4H44C 2K01A 2CWPA 1F2ZA 2R7ZH 1DCZA 2D2CC 1PH5A 1X9NA 3MXGA 2G5DA 4PG3A 4DNTB 2DJGC 2JA9A 3BU2A 4UP9A 1Z6HA 1IW7C 4RGNA 3S15H 3MTSA 4ZRZA 3GV3A 4QIWE 1X3FA 4E6IA 4JI4Q 1U4MA 3OW2A 3IKJA 3DEOA 2Y0SE 4QY7A 3A74A 2OT2A 3ZJYC 2JA6H 4DV0L 2UXCQ 1EU4A 5BR8L 4HMJA 2OEOA 2QKIC 1PTOC 2SEBD 4KV6A 1J5EL 3A5UA 1MHWC 3T1HQ 5KYIA 2G9DA 1PRTF 3K6OA 3M4OB 2KA7A 5AJ3L 3SGIA 3TP8A 2B39A 3U58A 4K14A 1VQ9A 5JEAJ 3HS0C 2NN6G 1PLFA 5EKLA 1UNSA 1B3QA 2IX1A 1HRJA 4P71A 3GTOB 4LMQD 4IUUA 3NTIA 2CH4W 3DXJC 5IP7H 5K36H 4XQNA 1CZWA 2UUBQ 4AIMA 3CHBD 2A8VA 3K0YA 4YCUA 1A62A 2K4KA 1JC7A 1FNWA 2ZT9C 1WCMG 3OYYA 2AUJD 4UP7A 1S4ZA 3PUZA 5C5MA 5GADC 1PH6A 4DR1Q 2ZM6Q 4HN7A 3EBEA 4K0KL 3DM3A 5C4XB 2EYMA 2IL8A 1BNZA 2CQAA 3PO3H 5CBEE 3MHBA 4JVZA 1G51A 2Q2IA 1K0RA 4BBRH 1JJGA 3DM1A 3V2TA 1K3RA 3FKIB 2VUMG 3EFXD 1SE3A 2WAQG 3VYUA 2BCOA 2F0GA 4A3GB 1A3UA 1PYBA 1WTHA 3KUPA 2MP1A 1JWUD 3PIOA 2EJGC 3L3OC 4NMZA 1Q1EA 4A76A 2B2UC 4KD4A 4B3SL 3SR1A 1YNJD 2F0PA 4NW2A 5GAHC 2A6ED 2OXPA 2A69D 1EQTA 1H9MA 2KUMA 1JB3A 4DR3Q 3L2PA 4FF3A 5M9OA 4JV5Q 2F0UA 1QZGA 3B6YA 4LF7L 2C9OA 1HA6A 3GTMB 4O0AA 2EJFC 3T56B 2E75C 2D0OA 2XVSA 1NNXA 1Q90A 4KY5A 5C4JH 1HR0Q 4YHHQ 3I3CA 2IPKD 1PVOA 2B2VC 2MPMA 2RDHA 1RIPA 2RA4A 3VR3A 1C9OA 2LSSA 3HKZB 4JOIA 4DGZA 1VQFA 3ULJA 3WOFA 4EX5A 1EL0A 4LFAQ 4A3IH 1TWFH 4LF4Q 4IJHA 1XNQL 1TKWB 4DU9A 3X3MA 1SYCA 2XWBB 3SK4A 5EAYA 1L1OA 2Z6KA 4LFBQ 1ESRA 2EOTA 4ZYSA 3CCUA 2JSOA 4PZ6A 2PMZB 5LMNQ 3H09A 3DWPA 2UXDL 2YU9H 3D4DA 1BVSA 3F2UA 2F0LA 3C1FA 2OWOA 4Q5VA 1SNDA 4PV1C 1TWCB 1N33L 3M3YH 4R4IA 1SYEA 2B63G 1XMQL 1N9WA 2BDOA 3DWQA 4JI1Q 1V8QA 3I4LA 2ES2A 5DM63 3WWVA 3UE1A 4DPGA 4A93H 4DUZL 2WB1G 4HJ8A 4TRDA 4QGUA 2KEEA 1FVIA 3ULLA 5KGUA 3PF4A 1STAA 2EYPA 4JI2Q 2R7FA 3NQIA 4UPAA 3H3VH 1IKLA 1QB5D 1IXRA 4FO2A 1YVCA 2K14A 3K8AA 4K5WA 3H0GH 4AQYQ 1A6XA 3T1YQ 1TWGH 1JR0D 2F0TA 1ZKOA 4H13C 4DR5L 1E1OA 1LTBD 2IWHA 5C44G 5EBCA 1S5FD 1BDOA 2B8GA 3J7ZC 1YJ9A 2Z1CA 2KECA 3CF5A 4KMUC 1Y1WB 1TWAH 1M90C 1I4XA 1TY0A 1XJVA 2Q8RE 3BDCA 1RHPA 2WAQB 4QF4A 3MXNA 1VQ7A 1CSQA 1G8ZD 2PNHA 4K8IA 1WD0A 1CKMA 5M3FG 1RTOA 2WKDA 5JPNC 1STEA 3W1BA 1B7YB 3Q22A 1UE7A 4OIKA 2GA4B 2KCCA 1U4PA 4R4OA 5JJZA 2ASBA 2F0SA 4IPGA 4HSPA 4FF2A 1VF5C 1MJCA 4IFDJ 3A8JE 4I7ZC 4K2KA 3E6ZX 3BZDB 2HT1A 1KQSA 1EIYB 3ND8A 1YNND 1C8CA 3NSWA 5CR3A 5IP9G 4QB4A 1IBKQ 4DV6Q 1BXTA 4F7XA 3OTOQ 1Q3LA 2NUCA 4RCOA 2AQ1B 3I90A 4DV4Q 4DK0A 1SNQA 4ZKCB 4JI0L 1Q81C 2EJMA 1SE8A 1SYDA 4H02A 4K5XA 1ZYRD 1PYWD 2NZ1D 3EJIA 1G2SA 1V1QA 1WD1A 1QG7A 3PIPA 4EVOA 3F1ZA 2HHHL 2K1BA 3HRZC 4C1NK 2I5MX 1Y69U 1EWIA 1GUGA 4L6TB 1EYCA 4X65L 1BCPF 3K5OA 2AQ3B 3Q0AA 5FJ8G 3CC4A 4KHPL 4KY7A 5C4ZA 4XTCS 4A3MG 2X69A 5I2YA 4JYAL 1C0AA 1GKHA 3M85A 4A3KH 1HNWQ 2I46A 1KLGD 4HAEA 1VQKA 2I5HA 1TY2A 4CKBA 3AFPA 1FJGQ 1SNPA 1T5XD 1X54A 4ZK9B 3CQZH 3PF5A 2ICIA 4GN3B 3TN2A 3M7GA 4WJ4A 1BBXC 4CDCC 4U673 5C3EG 1I4PA 1VQJA 4N9TA 4JI5Q 4FF4A 1PZJD 3I55A 4X3SA 4IUPA 2D5DA 3Q24A 4B3TL 3DMUA 3T13A 4B3MQ 2F0FA 2R3ZA 3MZ5A 4IPCA 1SNOA 2VQFL 1SMYD 1KDAA 1B50A 1XPOA 2F1MA 2RSOA 1WTXA 2AMCB 4PMWA 5C0XG 1WTWA 4A3CH 2Z9HA 1PH3A 3I73A 4N8FA 3FEWX 1FGBD 4IZ8A 3S16H 2XN9C 1I4HA 1A3TA 3TREA 4FP5D 2K75A 5IYDG 3TZDA 4I7AA 4A3FG 2WIIB 4CJ2C 4GOPC 4R9WA 4C3HG 1K28A 5F2DA 4G7OC 4DV1L 3HOVH 3J80E 4QJFA 3MC0B 3K5NA 2B8FA 5I2XA 3GO5A 4C3IB 4G7HC 3DWAA 3VYRA 2GN5A 3S17H 2DUDA 4JI6L 3CRLC 3SK6A 3JAME 3VA7A 5L37A 1YEZA 2MQHA 2KCMA 1U5KA 3BG3A 4DNIA 2UUCQ 2NVTB 1HZCA 4R1JA 2SNMA 3KJPA 4GLXA 3CMEA 4BY1H 2F0VA 2RCNA 4A3EH 3NXWA 2IX0A 1UEBA 3AEVA 2AUKA 2HQLA 1SJED 1V43A 3BZCA 1TR5A 1FR3A 2K7VA 3C46A 1K0SA 1GHJA 2K6AA 3MFGA 1C4QA 1Y1VB 3EA6A 3CPFA 4HEDA 4HMIA 3HOYH 1HH2P 4OX9L 2F4IA 1MGSA 2R61A 2YV5A 2NVQH 2DNCA 4PNYA 1A63A 2YYZA 1TQOA 1CHQD 4BBSG 2JYOA 1QVFA 4IOCA 2A5HA 2CHBD 5FO7B 1F9QA 4NDXA 1I50B 4U68A 2NZHA 3UE0A 1PXUA 3CC2A 1LACA 1LT5D 1ENFA 1JJCB 2IT1A 3GV6A 5DNFA 4LF9Q 4IFDI 4ID6A 3TBIB 3U9SA 1IBLL 3S2HB 1H9SB 1D7QA 1QVGA 3J80c 5ISRA 1BCPD 3I4MH 1MD2D 3EVQA 3KFUA 4X62Q 1CK1A 5CV8A 1CM9A 4OO1I 1O7YA 3JAMc 4L63B 3BVMA 2DJFC 1OXSC 2F0NA 3CXCA 1VQ5A 2HUGA 4P75A 3S2DH 5M5XH 3M7NA 1XMOQ 3PSIA 3MFYA 4ALPA 2A74C 3CD6A 4RHSA 1SNCA 1NAPA 3HOWB 1HNXQ 1HNZL 2M00A 1ICFB 1CHPD 4CJ0B 4M1UB 3GD7A 4NXNL 3J7AV 4TVAB 4BY7G 3OOCA 1QVCA 1I6HH 3OIQA 4G7ZC 3OMCA 3HOXH 1YIJA 2PZWA 2EYHA 2BE5D 4JI3L 3G4SA 2UU9L 4C56C 3GTGH 2AQ2B 2RDGA 3NBHB 2MO0A 3HP3A 3H3VC 3T16A 1SROA 4LF6Q 2K32A 1XNRL 4OWTB 4DR6Q 4GNXC 1MKHA 1ENCA 5GAGC 2E2HB 1N32Q 1S5ED 1G291 3IFTA 4DR4Q 1H9SA 4V190 2EPBA 3L9AX 4IALA 2UXDQ 1F2YA 1BKBA 4ZKBB 5EPKA 3RLNA 5K5PA 2AHOB 4DR2L 4S3SA 2QDBA 2O5JC 5JJKA 3BYYB 4P74A 2A19A 3F2BA 3C3LA 4MNOA 5IWAL 1FL0A 3W1GA 2F4VQ 1EYDA 3SK8A 3W5OA 3K7AH 3KLSA 3HOZH 1EIGA 1W6JA 2ZXPA 2R7ZG 3PCOB 2EIFA 2BH8A 4HR7B 1KRTA 5FOBB 5E3FA 2B2UA 5C4XG 1Q8KA 1I3QB 5C5LA 5FO9B 1QUQA 2PQAB 2V4DA 1VQCA 3VYTA 1QWYA 3I4NB 1C7YA 1A15A 2R92B 1B70B 3SDZA 1TS3A 1I4GA 1VF7A 5HURA 2JA6G 4BBSB 1VQPA 2K5WA 1VQBA 4IPHA 1GUTA 2F03A 4R4QA 4A3GG 2RCFA 4X3KA 4NB3A 2SDFA 1C48A
chains in the Genus database with same CATH topology
2B2VA 3Q23A 1PMRA 2PO4A 1EWHA 3AU7A 5E4WC 1X3PA 1KTKA 2A73B 2NBFA 3H6MA 4DAYA 2B2TC 1NCVA 2FINB 3FPPA 5I9PA 1SSOA 1IL8A 4QIWB 3NUCA 2RDFA 3RD4A 1YNJC 1SNMA 4BA2I 2HDLA 2Y0SB 3GTJB 4RHRA 4F8MA 5FLXE 2A6EC 3GQBA 3URYA 1EEID 4KKUA 2A69C 1HFNA 4BY7B 1LTTD 2VB2X 3FRPB 3CU7A 3S14B 2ZXRA 3TDQA 1Z7TA 5BN3A 2RVLA 1ICWA 1HQRD 2NWGA 1RF2D 1V1PA 1HXYD 3R8BA 3R2TA 1GUNA 5LL6X 1EIHA 1I4RA 4N9PA 4HSVA 3OWEB 2NN6I 1VMCA 3O13A 2HCIA 3RZDB 3PIO3 4Y7NB 1BOSA 2E76C 3I91A 1EEFD 1B44D 1QOHA 3VR4A 2MHVA 4RKBA 1AEXA 3LWEA 3J81L 2R7ZB 1OO9B 3SE0A 3QG1A 3NTKA 5FK9C 2WV6D 3IL8A 1D5MC 4DAPA 2M9VA 3G6JB 3U9OA 3S15B 1Q8IA 3MXUA 3D8GA 5DM73 5JVH3 3OWFA 1WVLA 2JA6B 4G57A 2F3WA 2JXMB 1JWMD 4DXGA 2HDMA 3OHXC 2NYZD 4ZUJA 4RGMA 2Q8IB 1IKMA 5IGFA 3ONAB 1DOLA 1B4OA 1BCPB 2F0IA 1NR2A 3NWTA 4QUCA 1QJOA 1QCBD 3NBIA 2RBMA 3PUXA 1NR4A 4QUFA 1XXGA 5D14A 1IW7D 5C0XJ 4ABNA 4KHZA 2ICEC 2TSSA 1R4PB 1CFMA 1QNKA 2RSNA 3KLRA 4K6DA 3V05A 2NN6H 3PO3B 4FVMA 1RDPD 5D3IB 1O7LA 2RKSA 1GUOA 5IGGA 1UUPA 1EOTA 4PMCA 4BBRB 3JAML 1YNNC 3R2IA 3PUYA 1BQQT 3D3RA 3SK5A 2L4NA 5LL6S 1Q12A 3AMUA 4O1NA 4RFBA 1W6KA 4DA2A 1STBA 2BA0A 2ID0A 1H9JA 1KNAA 1ZYRC 3A54A 1KABA 3DHQA 1XTCD 4XT1B 3CKIB 4A3DB 1EY9A 5CV6A 4G4KA 5FO8B 1LT3D 1WTQA 2G9HD 1TIID 1PRTD 3LNNA 5C4JB 2CW0D 5JVG3 5A2QE 3E0JA 1BR9A 1DD2A 2IW3A 4A3IB 4UDUC 2Z8LA 3MWYW 1TWFB 1EY5A 2FMMA 1GOZA 2PZTA 4CJ1B 4DXFA 4RCNA 5C3XA 1ZXTA 1SMYC 4C3IG 2YU9B 2CVRA 1JORA 4BA1I 3PIP3 5EKKA 5CYUA 1GUSA 5KNCA 3M3YB 2NB0A 2QILA 4A93B 1LABA 4NKLA 4B08A 3E5SA 1SDFA 3LWUA 2BOSA 2FFKB 3D31A 5C3WA 5IT9E 5I6WA 3GTQB 1I6VC 3H0GB 1WTPA 5EQ0A 2A6HD 1TWGB 1BO0A 1ONLA 2R6GA 4WFN3 3IAYA 4XDXA 2JEAI 3FMCA 1TWAB 1DOMA 1AW7A 2F0DA 4IUVA 4GZYC 1H9RA 2L55A 1CZGA 5IIFA 3MAQA 1PFNA 2PW7A 1RD9D 3NWSA 1SJHD 2Z4IA 3I70A 5HGTA 4ZLTF 4ZUIA 4KY6A 1PFBA 3PMFA 1MBYA 1CQVA 1SXTA 2EE1A 1MI2A 1F2MA 2EVBA 5E4XA 2E2DC 1BCPC 1O78A 4LAAA 1F2LA 4P2CB 5JEAH 2F0OA 3OIPA 3D6WA 4IUTA 2K03A 2VXWA 1J8IA 2DN8A 2VNUD 1OXTA 3D6CA 4RWSC 1RCVD 1PTOH 1CA6A 2L0CA 4X3TA 4A3KB 1GHKA 3NE5B 3VR6A 1HCZA 4O42A 3TP5A 1E2ZA 1LT4D 3AB9A 4J8QA 3P20A 1CA5A 2SOBA 5KIXA 3CQZB 5T1IA 1FD7D 3FPUB 2BE5C 1LO5D 5G3LF 1ILQA 5CORA 3DUZA 4R8IA 1ILPA 5IGEA 1VMPA 1DM0B 2F0QA 1STGA 3DEPA 1RTNA 2L12A 1DJRD 5AFWA 3PUVA 3BYTB 5IOCA 1VDZA 5A35A 2EZVA 2I07B 1ESFA 2F0MA 2O2LD 3K58A 4TQUS 1K8MA 3S16B 1DZ1A 3N52A 2FMCA 2IJ0A 4RAUC 2B2TA 1PZKD 3V96A 3HOVB 2DY8A 1ZEQX 2K33A 3S17B 1EQVA 5DAUA 1II3A 4BY1B 5FKAC 1TU2B 5EPJA 4A3EB 1DYQA 4KKTA 4XYOA 1R4QB 1SYFA 3T4AC 3A55A 1PDQA 3L7ZC 1PRTB 1S5CD 4IN3A 5EJWA 2PYKA 2BA1A 3P75A 3HOYB 5J1ZA 2J0TD 1JICA 1PZID 2KJXA 4KD3A 4PMBA 2NVQB 1EYAA 4J6HA 1SE2A 2L5TA 5C4HA 2K05A 3ERQA 4XYQA 4C1NI 2XWJB 5IGCA 1AP0A 3NTHA 2LKVA 2R93B 1EY8A 1B3AA 2A68D 3TMEA 1X32A 5IGBA 2AWNA 1MSHA 3A8KE 5JPMC 3I4MB 1OXXK 2MGSA 1IYUA 3C2PA 4FNFA 2EDGA 2EYLA 4M8AA 2O5IC 3S2DB 4RGOS 5M5XB 1TS5A 1STNA 1AZPA 3UI2A 3D4RA 1QILA 2EYFA 1G2TA 1F9RA 4CBVA 1D2BA 4BS9A 2KEDA 1FYCA 4JBWA 4IFDH 5CGKA 1XX8A 1I6HB 1JWSD 3HOXB 2D9UA 1F77A 4CKCA 3K57A 3TSSA 3QOJA 4OO1H 3P1HA 3QWNA 1G6ZA 3GTGB 3NBHA 4ME5A 5LHY1 2EY6A 3SEBA 4PQXA 1D5XC 2WACA 2N88A 1BF4A 4FXGC 3HG9A 1T5EA 1D1KA 4F88A 4I65A 1LTGD 4IUNA 4KKSA 1QNUA 2LS01 1KAAA 2F0KA 4FXDA 2WINB 5A2QL 5CBAE 1EZ6A 1U4RA 4B9XA 2J4XA 3K7AB 5K36G 3BS1A 3HOZB 5C6AA 1A2TA 1LTAD 1M8AA 1EY0A 2KHSA 3W2DA 4OGQC 1E2WA 1PTOF 4RH6A 2NTTA 1EFID 5BN4A 2E74C 3NHHA 1TT2A 3M4YA 3QB3A 1CTMA 1EY6A 4DNRB 2F0WA 2F0EA 5CMDA 1SBBB 1Y8OB 1Y8PB 1KDBA 3RUZA 1VCIA 1E0BA 1Z47A 1NSNS 1O7ZA 4Z9CB 4C3JG 1LV9A 4EQOA 1AN8A 2NVXB 3S1NB 2KCNA 2KOLA 4MN3A 4XQQA 5IT9L 2WKCA 3J7AF 5ELFA 3ND9A 2C5CA 1SYBA 3GTKB 1J9OA 2ZXOA 3C1EA 2FJ2A 3HZXA 4XT3B 3QJYA 1LTRD 3A8IE 5KYLA 2FHTA 3ZYYX 1RJTA 2Q8TA 4HTHA 4WRDA 5IODA 3NPPA 3NP8A 4OIJA 3FDTA 4YIJA 2JA7B 3K5LA 1X3QA 1LTSD 2E2IB 1PRTC 2XRSD 1HUMA 2CW0C 2PQEA 3NQTA 2AWOA 2IX3A 5IGDA 1GJXA 2K04A 4MIUA 5M5YB 1SE4A 3S1MB 1DOKA 3RMHA 1EWCA 1JOKA 5EBDA 3HGBA 4KI0A 2K5QA 2HQEA 3FVQA 3TZUA 2EYOA 4KN7C 1HA5A 4F87A 3WDNA 1EZ8A 3J80L 4BWGB 3QIAA 1KDCA 3SVMA 1SAPA 5TSSA 2EY5A 4H7BA 2F3VA 1KNEA 1B2TA 2D62A 2OF1A 3LX0A 4ZQ3A 4KJOA 2JP1A 1EY4A 3R93A 1PTOD 1L0XB 5ELEA 1B53A 2B2WC 3RZOB 2QCPX 5COYA 2Z4HA 2J7ZA 2B2YC 1CQFA 2A6HC 4C3JB 2JA8B 2XSCA 4FYDA 1JOQA 3A7AB 3EQLC 3KK7A 2LY7A 3ITPA 3PUWA 4WJWA 1CT1D 1HHVA 1F9SA 3G7LA 3K5MA 2NVYB 3SHLA 3BDLA 2F0HA 3WOEA 1JE4A 4Q0FA 1NUCA 1OXUA 3J7YW 5JAVA 2F0JA 1RODA 4X3UA 1HFGA 4KN4C 3R3OA 3S1QB 1SEBD 2KQ3A 3BDOA 4WORA 1JQYD 1WCMB 1STHA 4IQZA 1EU3A 4CKEA 3MXPA 3VR2A 4KK7A 3OSOA 1H9KA 3PV0A 3K59A 3SXHA 4RA8A 2VUMB 2EY2A 3HEJA 3MEHA 4XXEA 3H94A 4KJNA 1R9TB 1QE6A 4ZAIA 5E1FA 3KBGA 2L1BA 4ULLA 4FXKC 4NP5A 3T53B 5BN5A 5J22A 2L11A 3MVVA 5JEAG 1GXDC 2O4XA 1LLRD 4HCEA 2PPBC 3BVGA 2VB3X 3I8ZA 5KNBA 2ENBA 5CV9A 4K5VA 1ENAA 1IHZA 1JOOA 4DF7A 1DXMA 1HPCA 4LK1C 3J81E 5D65A 2HCCA 3N6RA 2NTSA 1PFMA 1O80A 3D4WA 3NK9A 4H0LC 4HCSA 1D5ZC 5C0XI 1F9PA 1AFPA 2RQXA 1LT6D 3A56A 1TVXA 1G91A 2B63B 1TS4A 2KVMA 2DNEA 3IFDA 3OPOA 2WB1B 4A3BB 1LTID 1CI3M 4QMGA 2X6GA 2XIWA 2TMPA 3P7JA 3RLFA 3H91A 5CC4A 3KBXA 3QOLA 1STYA 5CV4A 1EY7A 3OW7A 1MSGA 2PW5A 5C44B 5ELBA 5M3MB 4B9WA 1SFOB 1L0YB 2L9HA 2K5DA 4RKLA 3T51B 4EQNA 5FLXL 2LFNA 3VYSA 1HQMC 3I72A 5M3FB 4DAVA 5NUCA 1HTPA 3GTLB 3GTPB 2A68C 2PCFB 2MJ8A 1ET9A 1K83B 2MUYA 4OHJA 5ELDA 4K6LA 1U9RA 4CGYB 2H1EA 4A3JB 1KLUD 1TWHB 3VA5A 4DK1A 1DONA 3KLSX 4XQJA 1Q1BA 5EGTA 4JK1C 4C2MB 4IURA 5D3DA 4DN4M 4V0BA 1PTOB 5C0XH 1SYGA 4J1MA 3HOUB 3X3NA 2DY7A 4RGTA 2PZUA 1M4VA 1RKNA 1HTLD 5JOBA 1V1OA 4A3MB 4TSSA 1FNUA 1ML0D 1IYVA 1A3VA 2E2JB 2BDNA 4ILWA 4L8JA 1B1ZA 1K8OA 4UAIA 3VR5A 4XIGS 3Q6SA 3A7LA 4IFDG 1D6EC 1AZQA 5C3EB 2QF7A 2SNSA 4KTAA 5ELCA 2JEBI 2LMCB 4OO1G 1Y8NB 5CV7A 5I6YA 1XYIA 4EQPA 1HUNA 4IUQA 3EROA 5KEEA 4K2LA 3TP6A 4A3FB 4ODGA 3OMGA 4C3HB 2X6LA 1S5DD 3QO2A 5DEHA 5T1GA 2QEJC 2H4OA 2N55A 3W3AA 4MHEA 1FNVA 5EPLA 5KRUA 4K8JA 4TKOB 2XNAC 5G3LD 3KF8A 1ET6A 4EGVA 2EXZA 4AYBB 3S1RB 5I9OA 3GP7A 1B9MA 1GUWA 1WTOA 4R8NA 1OXVA 2JE6I 3PO2B 2WP8J 1B9NA 1E2VA 2XRQD 1D1IA 2M2LA 2K28A 3S9WA 3BVZA 1JCKB 1WTVA 5J39A 5CV5A 4CHTB 3CRKC 1V1PB 1TS2A 5M5WB 3TP7A 5I4DA 4LJZC 4FF1A 1A2UA 4OL7A 3MA2B 5EKIA 2B2WA 1S5BD 4DFAA 1U4LA 2EY1A 5KNDA 2PNRC 4KHVA 2EYJA 2B2YA 1I4QA 1BUVT 1XWEA 1UAPA 1WTRA 2JA5B 4QCLA 1UEAB 4H44C 2K01A 1F2ZA 1DCZA 2D2CC 3MXGA 4DNTB 1Z6HA 1IW7C 4RGNA 3MTSA 4ZRZA 3GV3A 4E6IA 1U4MA 3IKJA 3DEOA 2OT2A 1EU4A 4HMJA 2OEOA 2QKIC 1PTOC 2SEBD 4KV6A 5KYIA 2G9DA 1PRTF 3K6OA 3M4OB 2KA7A 3TP8A 2B39A 4K14A 5JEAJ 3HS0C 2NN6G 1PLFA 5EKLA 1UNSA 2IX1A 1HRJA 3GTOB 4LMQD 4IUUA 3NTIA 3DXJC 5K36H 4XQNA 1CZWA 3CHBD 3K0YA 1JC7A 1FNWA 2ZT9C 2AUJD 1S4ZA 3PUZA 5C5MA 4HN7A 5C4XB 2EYMA 2IL8A 1BNZA 2CQAA 5CBEE 3MHBA 3DM1A 3V2TA 3FKIB 3EFXD 1SE3A 3VYUA 2BCOA 2F0GA 4A3GB 1A3UA 3KUPA 2MP1A 1JWUD 2EJGC 3L3OC 4NMZA 1Q1EA 2B2UC 4KD4A 3SR1A 1YNJD 2F0PA 4NW2A 2A6ED 2OXPA 2A69D 1EQTA 1H9MA 2KUMA 1JB3A 4FF3A 5M9OA 2F0UA 2C9OA 1HA6A 3GTMB 2EJFC 3T56B 2E75C 2XVSA 1Q90A 4KY5A 3I3CA 2IPKD 2B2VC 2MPMA 2RDHA 2RA4A 3VR3A 3HKZB 4DGZA 3WOFA 1EL0A 1TKWB 4DU9A 3X3MA 1SYCA 2XWBB 3SK4A 1ESRA 2EOTA 4ZYSA 2JSOA 2PMZB 3H09A 3DWPA 3D4DA 3F2UA 2F0LA 3C1FA 4Q5VA 1SNDA 4PV1C 1TWCB 1SYEA 2BDOA 3DWQA 1V8QA 3I4LA 5DM63 4TRDA 2KEEA 5KGUA 1STAA 2EYPA 3NQIA 1IKLA 1QB5D 4FO2A 4K5WA 1A6XA 2F0TA 1JR0D 1ZKOA 4H13C 1LTBD 2IWHA 5EBCA 1S5FD 1BDOA 2B8GA 2Z1CA 2KECA 4KMUC 1Y1WB 1I4XA 1TY0A 2Q8RE 3BDCA 1RHPA 2WAQB 4QF4A 3MXNA 1G8ZD 1WD0A 4K8IA 1RTOA 2WKDA 5JPNC 1STEA 3Q22A 4OIKA 2GA4B 2KCCA 1U4PA 5JJZA 2F0SA 4HSPA 4FF2A 1VF5C 4IFDJ 3A8JE 4I7ZC 4K2KA 3E6ZX 3BZDB 3ND8A 1YNND 1C8CA 3NSWA 5CR3A 4QB4A 1BXTA 4F7XA 1Q3LA 2NUCA 4RCOA 2AQ1B 3I90A 4DK0A 1SNQA 4ZKCB 2EJMA 1SYDA 4K5XA 1ZYRD 1PYWD 2NZ1D 3EJIA 1G2SA 1WD1A 1QG7A 4EVOA 2K1BA 3HRZC 4C1NK 1Y69U 1GUGA 4L6TB 1EYCA 3Q0AA 1BCPF 3K5OA 2AQ3B 4KY7A 5C4ZA 4XTCS 2X69A 5I2YA 3M85A 2I46A 1KLGD 4HAEA 1TY2A 4CKBA 1SNPA 1T5XD 4ZK9B 2ICIA 3TN2A 3M7GA 1BBXC 4U673 1I4PA 4N9TA 4FF4A 1PZJD 4X3SA 4IUPA 2D5DA 3Q24A 3DMUA 3T13A 2F0FA 2R3ZA 3MZ5A 1SNOA 1SMYD 1KDAA 1B50A 2F1MA 2RSOA 1WTXA 4PMWA 5C0XG 1WTWA 3I73A 3FEWX 1FGBD 4IZ8A 2XN9C 1I4HA 1A3TA 4FP5D 3TZDA 2WIIB 4CJ2C 4R9WA 4C3HG 5F2DA 4G7OC 3J80E 3MC0B 3K5NA 2B8FA 5I2XA 3GO5A 4C3IB 4G7HC 3DWAA 3VYRA 3CRLC 3SK6A 3JAME 3VA7A 3BG3A 2NVTB 2SNMA 2F0VA 3NXWA 2IX0A 2AUKA 1SJED 1V43A 1TR5A 1FR3A 2K7VA 3C46A 1GHJA 2K6AA 3MFGA 1C4QA 1Y1VB 3EA6A 4HEDA 4HMIA 2F4IA 1MGSA 2R61A 2DNCA 4PNYA 2YYZA 1TQOA 1CHQD 2JYOA 2A5HA 2CHBD 5FO7B 1F9QA 4NDXA 1I50B 4U68A 1PXUA 1LACA 1LT5D 1ENFA 2IT1A 3GV6A 5DNFA 4IFDI 3U9SA 3TBIB 4ID6A 3S2HB 1H9SB 5ISRA 1BCPD 1MD2D 3EVQA 1CK1A 5CV8A 1CM9A 4OO1I 1O7YA 4L63B 3BVMA 1OXSC 2F0NA 2HUGA 3M7NA 3MFYA 2A74C 4RHSA 1SNCA 1NAPA 3HOWB 2M00A 1CHPD 4CJ0B 4M1UB 3GD7A 3J7AV 3OOCA 3OIQA 4G7ZC 3OMCA 2PZWA 2EYHA 2BE5D 4C56C 2AQ2B 2RDGA 3HP3A 3H3VC 3T16A 2K32A 1ENCA 2E2HB 1S5ED 1G291 3IFTA 1H9SA 4V190 2EPBA 3L9AX 4IALA 1F2YA 4ZKBB 5EPKA 5K5PA 4S3SA 2QDBA 2O5JC 3BYYB 3C3LA 1EYDA 3SK8A 3KLSA 1EIGA 1W6JA 2ZXPA 4HR7B 5FOBB 5E3FA 2B2UA 1I3QB 5C5LA 5FO9B 2V4DA 3VYTA 1QWYA 3I4NB 1A15A 2R92B 3SDZA 1TS3A 1I4GA 1VF7A 5HURA 4BBSB 2K5WA 1GUTA 2F03A 4X3KA 2SDFA 1C48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2L A;  2F0N A;  5M9O A;  2F0U A;  4QF4 A;  3TP6 A;  3C1E A;  5CGK A;  4K8I A;  3HZX A;  4G57 A;  1SNC A;  4ODG A;  4IZ8 A;  3OMG A;  1JOQ A;  5HGT A;  2F3W A;  1A3T A;  2M00 A;  2ENB A;  5CV9 A;  1EQV A;  3QOJ A;  4K5V A;  5DEH A;  4ZUI A;  1ENA A;  1IHZ A;  3H6M A;  1U9R A;  3ITP A;  3P1H A;  4KY5 A;  4KY6 A;  4E6I A;  5KYL A;  1EY5 A;  2F0S A;  1JOO A;  3PMF A;  4ME5 A;  5I6Y A;  5I9P A;  5F2D A;  4ZUJ A;  2EY6 A;  3VA5 A;  2PZT A;  4K2K A;  4K8J A;  5DAU A;  4DF7 A;  5KRU A;  1II3 A;  4HTH A;  3OMC A;  4WRD A;  5IOD A;  2PZW A;  4DGZ A;  1F2M A;  2EYH A;  3NP8 A;  5IGF A;  3NUC A;  2WAC A;  2RDF A;  4HMJ A;  4YIJ A;  5EGT A;  3SHL A;  3BDL A;  2F0H A;  5CR3 A;  2OEO A;  3SK6 A;  4LAA A;  1SNM A;  2EXZ A;  4QB4 A;  5C3X A;  4I65 A;  2F0I A;  1SYF A;  2F0O A;  4KV6 A;  4F8M A;  1SYG A;  4F7X A;  4IUN A;  4J1M A;  4DU9 A;  3T16 A;  5HUR A;  1JOR A;  3D4W A;  1NUC A;  3NK9 A;  1SYC A;  2NUC A;  3SK4 A;  2RBM A;  5I9O A;  5JAV A;  2SNM A;  2F0J A;  5EKK A;  1KAA A;  1SNQ A;  2F0K A;  2F0V A;  2PQE A;  5KYI A;  3NQT A;  1SYD A;  2PYK A;  3NXW A;  1ENC A;  3P75 A;  2PZU A;  3D6C A;  3TP8 A;  5IGD A;  4K5X A;  1EZ6 A;  4MIU A;  5J1Z A;  3EJI A;  3R3O A;  1RKN A;  4K14 A;  4B9X A;  4KD3 A;  3D4D A;  4IAL A;  4PMB A;  1F2Y A;  2F0L A;  5JOB A;  3C1F A;  4R8N A;  5K5P A;  1TR5 A;  1EYA A;  5EKL A;  2KQ3 A;  4K6D A;  4EVO A;  1SND A;  4J6H A;  4NKL A;  4S3S A;  4WOR A;  2QDB A;  1JOK A;  3TP5 A;  5C4H A;  5C6A A;  1STH A;  1SYE A;  1A2T A;  3E5S A;  3ERQ A;  1EYC A;  1A3V A;  2RKS A;  1EY0 A;  2KHS A;  4EQO A;  5IGG A;  2SOB A;  4HMI A;  4KY7 A;  5C3W A;  5C4Z A;  5KIX A;  2HQE A;  4PMC A;  5I6W A;  5IGC A;  4N9P A;  2EYO A;  1EYD A;  2LKV A;  3SK8 A;  3S9W A;  4QMG A;  3MXP A;  5C5M A;  4PNY A;  5J39 A;  3NHH A;  1TT2 A;  5CV5 A;  1EY8 A;  3TME A;  2EYM A;  1TQO A;  3QB3 A;  3SK5 A;  5CC4 A;  4TRD A;  3OSO A;  3QOL A;  3MHB A;  5KGU A;  5IGE A;  5IGB A;  1EY6 A;  1STA A;  1STY A;  2SNS A;  2EYP A;  1SNP A;  3SXH A;  4KTA A;  5E3F A;  2EY2 A;  2F0W A;  3HEJ A;  2F0E A;  3MEH A;  2F0Q A;  4NDX A;  1STG A;  5CV4 A;  1A2U A;  1EY7 A;  4OL7 A;  1STB A;  4KJN A;  5C5L A;  1EZ8 A;  2PW5 A;  3V2T A;  4K5W A;  1KDB A;  4N9T A;  1KDC A;  4RKB A;  3RUZ A;  4DFA A;  2EY1 A;  4B9W A;  1AEX A;  2EY5 A;  2F0T A;  2F0D A;  1NSN S;  5E1F A;  1KAB A;  4KHV A;  5IOC A;  2F0G A;  2EYL A;  3DHQ A;  4H7B A;  1A3U A;  2EYJ A;  2F3V A;  4ID6 A;  2F0M A;  1EY9 A;  2OF1 A;  3DMU A;  3LX0 A;  1STN A;  5CV7 A;  4KJO A;  5CV6 A;  4ZQ3 A;  2F0F A;  4RKL A;  4NMZ A;  4NP5 A;  3MZ5 A;  3T13 A;  4EQN A;  4KD4 A;  4EQP A;  1EY4 A;  3EVQ A;  5IIF A;  3SR1 A;  5ISR A;  5J22 A;  1SNO A;  2F0P A;  3U9O A;  1KDA A;  2EYF A;  3MVV A;  5CV8 A;  3TP7 A;  3ERO A;  1SYB A;  3D8G A;  2OXP A;  2O4X A;  2PW7 A;  3BDC A;  5NUC A;  5KEE A;  3OWF A;  1F2Z A; 
#chains in the Genus database with same CATH topology
 2B2V A;  3Q23 A;  1PMR A;  2PO4 A;  2NVX H;  1EWH A;  3S1N H;  3AU7 A;  5E4W C;  1X3P A;  5IYC H;  1KTK A;  2A73 B;  2NBF A;  3H6M A;  3GTK H;  4DAY A;  2B2T C;  1NCV A;  2FIN B;  3FPP A;  1UWV A;  5I9P A;  1SSO A;  3I56 A;  4R4T A;  1IL8 A;  4QIW B;  5IP7 G;  3NUC A;  2RDF A;  1WOC A;  3RD4 A;  3Q8D A;  3AFQ A;  1YNJ C;  1SNM A;  1N34 Q;  4BA2 I;  4PZ7 A;  2HDL A;  2Y0S B;  3GTJ B;  2UXB L;  4RHR A;  4F8M A;  3HKZ G;  1CKN B;  5FLX E;  2A6E C;  3GQB A;  3URY A;  2CCZ A;  1EEI D;  4KKU A;  2A69 C;  4JI7 L;  2F52 A;  1HFN A;  4BY7 B;  3CW2 C;  1W2B A;  1LTT D;  4JCV E;  5LMU L;  2JA7 H;  2VB2 X;  3FRP B;  4B3R L;  3CU7 A;  2E2I H;  1XTD A;  3S14 B;  1SMX A;  1Q82 C;  2ZXR A;  3TDQ A;  1Z7T A;  5ELN A;  5BN3 A;  2MFI A;  1XPU A;  2RVL A;  1ICW A;  1HQR D;  2L15 A;  2HHH Q;  2NWG A;  1RF2 D;  1V1P A;  1HXY D;  2OCE A;  3R8B A;  1VQL A;  3R2T A;  1M1K C;  1GUN A;  5LL6 X;  1WI5 A;  1EIH A;  5M5Y H;  1I4R A;  4N9P A;  2B29 A;  4HSV A;  3OWE B;  2FXQ A;  1VMC A;  2NN6 I;  3S1M H;  1PA6 A;  3J7A 5;  2N49 A;  3O13 A;  2HCI A;  3RZD B;  3PIO 3;  3KOJ A;  4Y7N B;  3U4Z A;  2AKW B;  1BOS A;  1IYJ B;  2GVA A;  2E76 C;  3LGJ A;  3I91 A;  4JW0 A;  1EEF D;  1B44 D;  4LF8 Q;  1QOH A;  3VR4 A;  1HR0 W;  2MHV A;  4RKB A;  3TS0 A;  4A3L H;  1AEX A;  1JB7 A;  3LWE A;  3J81 L;  2R7Z B;  1OO9 B;  3SE0 A;  3QG1 A;  1LTL A;  1L0W A;  3NTK A;  5FK9 C;  2WV6 D;  1CKN A;  1KC8 C;  1V9P A;  3IL8 A;  1D5M C;  2DGY A;  4DAP A;  2M9V A;  3G6J B;  3U9O A;  4GKJ L;  1DGS A;  3S15 B;  1Q8I A;  1VQD A;  2RF4 A;  3MXU A;  3D8G A;  5DM7 3;  2UUA Q;  5JVH 3;  3OWF A;  3I2Z A;  1WVL A;  5FLX c;  4LF5 Q;  1Y1W G;  3J81 i;  2JA6 B;  1YBY A;  4G57 A;  2F3W A;  2JXM B;  1JWM D;  5LMN W;  4DXG A;  2HDM A;  1VQH A;  3RZO H;  3OHX C;  2NYZ D;  4DV5 Q;  4ZUJ A;  2JK8 A;  4RGM A;  4Y52 H;  4C3J H;  2Q8I B;  2ALY B;  2JA8 H;  1IKM A;  1EYG A;  5IGF A;  3ONA B;  4LFC Q;  1DOL A;  4P73 A;  1B4O A;  4ZCK A;  1G6P A;  3KF6 B;  1BCP B;  2JN4 A;  3E3X A;  4A3D H;  2F0I A;  1NR2 A;  3NWT A;  4QUC A;  4A93 G;  1N36 Q;  1QJO A;  1QCB D;  1VQ6 A;  3NBI A;  2RBM A;  4LUZ A;  2IHF A;  3PUX A;  2ATW A;  2NVY H;  1NR4 A;  4GOP B;  4QUF A;  1XXG A;  1CSP A;  5D14 A;  1IW7 D;  5C0X J;  4ABN A;  4KHZ A;  2ICE C;  2TSS A;  1R4P B;  2RHS B;  1CFM A;  1QNK A;  2RSN A;  3KLR A;  4K6D A;  3V05 A;  3M4Q A;  2NN6 H;  3PO3 B;  3NEN A;  4X64 L;  4FVM A;  1RDP D;  5D3I B;  1O7L A;  2RKS A;  1GUO A;  3M4P A;  5IGG A;  1UUP A;  1EOT A;  4PMC A;  4BBR B;  3JAM L;  1IBM Q;  1YNN C;  3R2I A;  2VW9 A;  3S1Q H;  3PUY A;  3K80 C;  1BQQ T;  4L5S A;  1IZ6 A;  3D3R A;  1WCM H;  3SK5 A;  2L4N A;  4MTN A;  5LL6 S;  1Q12 A;  4JI8 L;  3AMU A;  1PH8 A;  4O1N A;  4RFB A;  1MJE A;  1W6K A;  4DA2 A;  1STB A;  2BA0 A;  2ID0 A;  4DR7 Q;  1H9J A;  1KNA A;  1PYS B;  1ZYR C;  4FDB A;  3A54 A;  3H15 A;  4DV7 L;  1HJP A;  1KAB A;  3DHQ A;  1BBU A;  1XTC D;  4XT1 B;  3CKI B;  4A3D B;  1VQ8 A;  1EY9 A;  1JMC A;  5CV6 A;  4G4K A;  2ZJQ A;  5FO8 B;  1LT3 D;  2OTJ A;  4HID A;  2E5L Q;  1WTQ A;  2V1C C;  2G9H D;  1TII D;  1R9T H;  1S72 A;  4A4I A;  1PRT D;  3ULP A;  3LNN A;  5C4J B;  2RHQ B;  2CW0 D;  5JVG 3;  4GOP A;  3GTQ H;  3F8T A;  5A2Q E;  3E0J A;  1OTC A;  1BR9 A;  1DD2 A;  2IW3 A;  4A3I B;  4UDU C;  5FLM G;  2Z8L A;  3MWY W;  1TWF B;  5GQO A;  1EY5 A;  2FMM A;  3M9B A;  1GOZ A;  2PZT A;  3TEH B;  5DLQ E;  4CDF C;  4CJ1 B;  4NXM Q;  4DXF A;  4RCN A;  3EIV A;  3CCR A;  4X66 Q;  5C3X A;  4MZ9 A;  1ZXT A;  1SMY C;  2Q2U A;  4C3I G;  2VQE L;  2YU9 B;  4A3K G;  2CVR A;  1JOR A;  4X6A H;  4BA1 I;  3PIP 3;  5EKK A;  5CYU A;  1GUS A;  4AH6 A;  5KNC A;  3M3Y B;  3TS2 A;  2NB0 A;  2CKZ B;  4DV2 Q;  1TXY A;  1PH9 A;  2QIL A;  4GKK L;  4A93 B;  1LAB A;  4NKL A;  4B08 A;  3E5S A;  1SDF A;  1PFS A;  3LWU A;  4DKA C;  2BOS A;  2FFK B;  4QQB X;  3D31 A;  3CCJ A;  5C3W A;  5IT9 E;  5I6W A;  3GTQ B;  1I6V C;  2B63 H;  1VS0 A;  2B3G A;  2K5V A;  1Y1V G;  3H0G B;  4DV3 Q;  1WTP A;  5EQ0 A;  4GNX B;  2A6H D;  1TWG B;  4A3C G;  1BO0 A;  1ONL A;  2R6G A;  4CDE C;  1YHA A;  4WFN 3;  3IAY A;  1VQM A;  1SR3 A;  5JJL A;  4A3B H;  4XDX A;  2JEA I;  3FMC A;  1EFW A;  1TWA B;  1DOM A;  1AW7 A;  2F0D A;  4IUV A;  3ERS X;  3U4V A;  4GZY C;  1H9R A;  2L55 A;  4POF A;  1CZG A;  1X56 A;  3K0X A;  5IIF A;  1J6Q A;  2YTY A;  1PH7 A;  3AQQ A;  3MAQ A;  1PFN A;  5C44 H;  2UXC L;  1QZH A;  2PW7 A;  5M3M H;  2OQK A;  1SFO H;  1RD9 D;  4P72 A;  3NWS A;  1SJH D;  4YWM A;  4BY1 G;  2Z4I A;  3I70 A;  4A3E G;  5HGT A;  1JJ2 A;  3T1H L;  4ZLT F;  1E7Z A;  5M3F H;  4ZUI A;  4KY6 A;  4OXP A;  1B8A A;  1PFB A;  4POG A;  3PMF A;  1MBY A;  3HOW G;  3GTL H;  1CQV A;  3GTP H;  1SXT A;  2EE1 A;  2ZJP A;  1K83 H;  1MI2 A;  1F2M A;  1VQO A;  4QL5 A;  4GNX A;  2EVB A;  5IY0 A;  5E4X A;  2E2D C;  1BCP C;  1O78 A;  4LAA A;  1F2L A;  4OON A;  3IRB A;  4P2C B;  4YWK A;  4DK3 C;  5IT9 c;  2UUB L;  5JEA H;  4A3J H;  3RR5 A;  2F0O A;  3OIP A;  1PH1 A;  1TWH H;  5IP9 H;  1WYD A;  3D6W A;  5HY6 A;  3RN2 A;  4IUT A;  4DR1 L;  2K03 A;  2VXW A;  2ZM6 L;  1J8I A;  1Q86 C;  2DN8 A;  2E8G A;  3FP9 A;  2VNU D;  2VZA A;  1OXT A;  3D6C A;  4RWS C;  1RCV D;  4C2M H;  3NEM A;  1PTO H;  2D0P A;  2WB1 E;  1CA6 A;  2L0C A;  4X3T A;  4DV0 Q;  4HIK A;  4A3K B;  5BR8 Q;  1GHK A;  3NE5 B;  1LUZ A;  3VR6 A;  1HCZ A;  4O42 A;  3TP5 A;  2Q2T A;  3HOU H;  1E24 A;  1E2Z A;  1LT4 D;  3AB9 A;  4J8Q A;  3P20 A;  4L5Q A;  3I4M G;  3E9I A;  1EOV A;  1P16 A;  1J5E Q;  1CA5 A;  2SOB A;  5KIX A;  3CQZ B;  5T1I A;  3FHW A;  1FD7 D;  3FPU B;  2BE5 C;  1ASZ A;  1GD7 A;  5FJ8 H;  5AJ3 Q;  1LO5 D;  4A3M H;  2K5H A;  5G3L F;  1ILQ A;  5COR A;  4UHV A;  1GO3 E;  3DUZ A;  1HZA A;  4R8I A;  1ILP A;  5IGE A;  3KLW A;  1VMP A;  2E2J H;  4JV5 L;  1DM0 B;  2F0Q A;  1STG A;  3DEP A;  1RTN A;  3BJU A;  2L12 A;  1DJR D;  5AFW A;  1AE2 A;  3PUV A;  3BYT B;  5IOC A;  1VDZ A;  5A35 A;  2EZV A;  5C3E H;  2I07 B;  1ESF A;  2F0M A;  2O2L D;  2VY3 A;  1HR0 L;  1Z9F A;  3HOX G;  3K58 A;  4TQU S;  1K8M A;  3I4N G;  3S16 B;  4LWC A;  2R92 G;  1DZ1 A;  4K0K Q;  3N52 A;  2FMC A;  2IJ0 A;  4RAU C;  1NTG A;  3JC6 6;  2B2T A;  4LFA L;  1PZK D;  3V96 A;  3HOV B;  2DY8 A;  1E1T A;  2R93 H;  1ZEQ X;  4LFB L;  2K33 A;  3S17 B;  1EQV A;  4IO9 A;  4B3S Q;  5IYD H;  2LXJ A;  5LMN L;  5DAU A;  4A3F H;  1II3 A;  4BY1 B;  3I7F A;  5FKA C;  4C3H H;  1TU2 B;  5EPJ A;  4A3E B;  1DYQ A;  1H95 A;  1YJN A;  4KKT A;  4XYO A;  4LF7 Q;  1R4Q B;  1SYF A;  3T4A C;  3A55 A;  1PDQ A;  3HOZ G;  2K50 A;  3L7Z C;  1PRT B;  1S5C D;  4IN3 A;  5EJW A;  2Y0S G;  2PYK A;  2BA1 A;  3P75 A;  3ER0 A;  4YCV A;  3HOY B;  2QW7 A;  5J1Z A;  2J0T D;  1SN8 A;  1JIC A;  1PZI D;  4JI2 L;  2KJX A;  4KD3 A;  4PMB A;  2NVQ B;  3S1R H;  1EYA A;  1X3E A;  4J6H A;  4OWW B;  1SE2 A;  2L5T A;  5C4H A;  3HKS A;  2PI2 A;  3T1Y L;  2K05 A;  3ERQ A;  4XYQ A;  1HZ9 A;  3HFZ B;  2EQS A;  1XNQ Q;  4C1N I;  2XWJ B;  5IGC A;  1AP0 A;  1WFQ A;  4A75 A;  3NTH A;  1A8V A;  2LKV A;  2R93 B;  3GDE A;  1EY8 A;  1B3A A;  2A68 D;  3TME A;  1X32 A;  3PO2 H;  4DAM A;  1K8G A;  5IGB A;  2AWN A;  1MSH A;  1NMF A;  3A8K E;  5JPM C;  3I4M B;  1OXX K;  2N8N A;  2MGS A;  2JJQ A;  1N33 Q;  1IYU A;  3C2P A;  1X6O A;  4FNF A;  1XMQ Q;  5ELO A;  2EDG A;  2JQO A;  2EYL A;  4M8A A;  2O5I C;  3S2D B;  4RGO S;  5M5W H;  5M5X B;  1TS5 A;  1STN A;  1AZP A;  3UI2 A;  4YCW A;  4JBK A;  4DUZ Q;  3D4R A;  1QIL A;  2EYF A;  1G2T A;  1F9R A;  1UE5 A;  4CBV A;  4IPD A;  4HIO A;  1D2B A;  4BS9 A;  2KED A;  1NBW A;  1FYC A;  4J15 A;  4JBW A;  4IFD H;  1IBK L;  5CGK A;  4DV6 L;  1XX8 A;  3OTO L;  1I6H B;  1JWS D;  3HOX B;  2D9U A;  1F77 A;  1W3S A;  4CKC A;  3K57 A;  1Q46 A;  5IYB H;  2JA5 H;  4DV4 L;  3UDF A;  3TSS A;  4DR5 Q;  3QOJ A;  3F2D A;  4OO1 H;  3P1H A;  3QWN A;  1G6Z A;  1RL2 A;  3GTG B;  3NBH A;  4ME5 A;  5LHY 1;  3NEL A;  2EY6 A;  3SEB A;  4PQX A;  1D5X C;  4AYB E;  2WAC A;  2OQ0 A;  2N88 A;  4YWL A;  1BF4 A;  4FXG C;  1KRS A;  3HG9 A;  4YY3 L;  1T5E A;  2I0Q A;  1D1K A;  1YI2 A;  4I65 A;  4F88 A;  1LTG D;  4BXX H;  4IUN A;  4JPB W;  4KKS A;  1S40 A;  4LW1 A;  3CC7 A;  1QNU A;  2LS0 1;  1KAA A;  2F0K A;  2I5L X;  2P5Z X;  4FXD A;  2WIN B;  2C35 B;  5A2Q L;  5CBA E;  1EZ6 A;  4MTK A;  1U4R A;  4B9X A;  1FJG L;  2NZO A;  2J4X A;  1L2F A;  3K7A B;  3BZK A;  3BS1 A;  5K36 G;  3HOZ B;  2EXD A;  1KAW A;  2GVB A;  4JI5 L;  5C6A A;  2VS1 A;  3M4O H;  1A2T A;  1LTA D;  2R7D A;  1M8A A;  1EY0 A;  2KHS A;  3D0F A;  3W2D A;  4OGQ C;  1E2W A;  3TQY A;  1PTO F;  4RH6 A;  2NTT A;  1EFI D;  4B3M L;  3PO3 G;  2PQA A;  3RLO A;  4JI0 Q;  5BN4 A;  2E74 C;  3NHH A;  1TT2 A;  3M4Y A;  3GTO H;  3QB3 A;  1CTM A;  4BBR G;  3A0J A;  1EY6 A;  4DNR B;  1I94 L;  2F0W A;  2F0E A;  4CDD C;  5CMD A;  1SBB B;  1Y8O B;  1Y8P B;  4RMF A;  1KDB A;  3RUZ A;  1VCI A;  5C4X H;  1E0B A;  1Z47 A;  1NSN S;  4X65 Q;  4KHP Q;  4HJA A;  1O7Z A;  4Z9C B;  4C3J G;  1LV9 A;  4EQO A;  2JA8 G;  4OEM B;  4JYA Q;  1AN8 A;  3K81 C;  1GM5 A;  2NVX B;  3S1N B;  2KCN A;  2KOL A;  4MN3 A;  4XQQ A;  5IT9 L;  2WKC A;  3J7A F;  5ELF A;  3ND9 A;  2C5C A;  4A3D G;  1SYB A;  2IHE A;  2CQO A;  3KJO A;  3GTK B;  3FKI H;  1J9O A;  2HD3 A;  2ZXO A;  3KYH C;  3CCS A;  4A3G H;  3C1E A;  2FJ2 A;  3HZX A;  4XT3 B;  3QJY A;  1LTR D;  2UUC L;  3A8I E;  4KLK A;  1MIU A;  4B3T Q;  5KYL A;  2FHT A;  2KHI A;  3ZYY X;  1RJT A;  2Q8T A;  2VQF Q;  4HTH A;  3GTM H;  4WRD A;  5IOD A;  4A3I G;  3NPP A;  3NP8 A;  4OIJ A;  3FDT A;  2CH4 A;  4YIJ A;  2JA7 B;  3K5L A;  1X3Q A;  3STB D;  1LTS D;  3E0E A;  2E2I B;  1PH2 A;  1NY4 A;  4O2D A;  1PRT C;  2XRS D;  1HUM A;  3PQI A;  4PZ8 A;  2CW0 C;  2PQE A;  1CKO A;  3NQT A;  2AWO A;  2IX3 A;  5IGD A;  1GJX A;  2K04 A;  4MIU A;  5M5Y B;  4DV1 Q;  1SE4 A;  3S1M B;  3KDF B;  1E3P A;  1DOK A;  1L1O B;  3RMH A;  4RG1 A;  1EWC A;  1JOK A;  4JI6 Q;  5EBD A;  3HGB A;  4KI0 A;  2K5Q A;  4LF9 L;  3H3V I;  3MEF A;  2HQE A;  3FVQ A;  1YHQ A;  3TZU A;  2EYO A;  2KCT A;  4X62 L;  4KN7 C;  1HA5 A;  1TWC H;  4F87 A;  2F3I A;  3H0G G;  2HIX A;  1XMO L;  3WDN A;  1PHJ A;  1EZ8 A;  3J80 L;  4BWG B;  3QIA A;  1KDC A;  1HNX L;  3SVM A;  1SAP A;  4IJL A;  5TSS A;  2EY5 A;  4H7B A;  2KBN A;  3E9H A;  2F3V A;  1KNE A;  3J81 j;  2D62 A;  2OF1 A;  3CAM A;  3LX0 A;  4ZQ3 A;  1B2T A;  4KJO A;  4OX9 Q;  1K9M C;  2JP1 A;  1EY4 A;  3R93 A;  1PH4 A;  1ASY A;  1PTO D;  1L0X B;  4UY8 C;  5ELE A;  1B53 A;  2B2W C;  3CPW A;  1NMG A;  1S3O A;  3RZO B;  2QCP X;  3J80 i;  5COY A;  2Z4H A;  2J7Z A;  2B2Y C;  1CQF A;  2A6H C;  4C3J B;  3F2C A;  2JA8 B;  2XSC A;  4FYD A;  3KDF A;  3JAM i;  1JOQ A;  4LF6 L;  3A7A B;  1Y1W H;  3EQL C;  3KK7 A;  3HKZ E;  2LY7 A;  4DR6 L;  3KF6 A;  3ITP A;  1IBL Q;  3PUW A;  2VUM H;  1N32 L;  4WJW A;  4DR4 L;  1CT1 D;  3MXN B;  1HHV A;  3G71 A;  1F9S A;  3G7L A;  5GRO A;  2MO1 A;  1WJJ A;  1YJW A;  1X3G A;  3K5M A;  1LM0 A;  2NVY B;  3SHL A;  3BDL A;  2F0H A;  2KEN A;  3WOE A;  2QEX A;  4HJ9 A;  1GVP A;  1JE4 A;  1D8L A;  3CP0 A;  3EN2 A;  1JE5 A;  4DUY L;  4OEL B;  1NUC A;  1K3B C;  1OXU A;  2PMZ E;  4Q0F A;  5JAV A;  4OWX B;  3J7Y W;  1HNZ Q;  2F4V L;  2F0J A;  1ROD A;  4X3U A;  1A0I A;  1HFG A;  4KN4 C;  4A3B G;  4NXN Q;  3R3O A;  1KIX A;  2ZTC A;  3S1Q B;  1SEB D;  2KQ3 A;  3BDO A;  1EUJ A;  4WOR A;  1JQY D;  1WCM B;  4JI3 Q;  1STH A;  4IQZ A;  2YTV A;  2UU9 Q;  4LNQ A;  2XTI A;  3CCL A;  4JC0 A;  3CCE A;  1EU3 A;  4CKE A;  3MXP A;  5M3M G;  1XNR Q;  3VR2 A;  4KK7 A;  3OSO A;  4HIM A;  1H9K A;  3PV0 A;  3K59 A;  3SXH A;  2Z0S A;  4RA8 A;  2VUM B;  1EIF A;  2EY2 A;  3MEH A;  3HEJ A;  2XGT A;  2K5N A;  5J3B A;  4XXE A;  3H94 A;  3RNU A;  4KJN A;  1K8A C;  4DR2 Q;  1R9T B;  1QE6 A;  4ZAI A;  2CFM A;  5E1F A;  3KBG A;  2L1B A;  4ULL A;  1NJI C;  5IWA Q;  4FXK C;  4NP5 A;  1IL2 A;  1KXL A;  3T53 B;  2WAQ E;  5BN5 A;  5J22 A;  2L11 A;  3MVV A;  2N78 A;  3UDI A;  1GXD C;  2O4X A;  5JEA G;  4A3J G;  1LLR D;  4HCE A;  1N34 L;  2PPB C;  3BVG A;  2VB3 X;  3I8Z A;  2BH2 A;  1EQR A;  2ZJR A;  5KNB A;  2ENB A;  3K7U C;  5CV9 A;  2Z6B A;  4K5V A;  1ENA A;  3HOV G;  1IHZ A;  4JI4 L;  2K52 A;  4ME3 A;  1JOO A;  1VQN A;  4DF7 A;  1DXM A;  1HPC A;  3HOU G;  5FLM H;  1YIT A;  4LK1 C;  4APV A;  3J81 E;  5D65 A;  2HCC A;  3G6E A;  1SRU A;  1LYL A;  3N6R A;  4YY3 Q;  2NTS A;  4LUO A;  1PFM A;  1O80 A;  3D4W A;  3NK9 A;  1VQE A;  4H0L C;  4HCS A;  4JOI C;  1D5Z C;  4C3I H;  4UP8 A;  5C0X I;  1F9P A;  1AFP A;  2RQX A;  1LT6 D;  3A56 A;  1TVX A;  1G91 A;  1XPR A;  2B63 B;  1PV4 A;  1TS4 A;  2KVM A;  2DNE A;  3IFD A;  1BBW A;  1L1O C;  2Z6K C;  2NVT H;  3OPO A;  4LF8 L;  3HOY G;  4R4C A;  2UXB Q;  1I5F A;  2WB1 B;  4A3B B;  4JI7 Q;  1LTI D;  2LXK A;  1CI3 M;  4QMG A;  2X6G A;  2XIW A;  2QDL A;  2KHJ A;  2TMP A;  3P7J A;  4JBM A;  5LMU Q;  3RLF A;  3H91 A;  5CC4 A;  4B3R Q;  1E22 A;  3KBX A;  3QOL A;  2UUA L;  2H5X A;  1Y1V H;  1STY A;  2R93 G;  1I94 Q;  4LF5 L;  5CV4 A;  1EY7 A;  3OW7 A;  1MSG A;  2PW5 A;  1VQG A;  5C44 B;  1P8L A;  5ELB A;  5M3M B;  4B9W A;  1T9H A;  1SFO B;  1L0Y B;  2L9H A;  2K5D A;  1AE3 A;  4RKL A;  3T51 B;  4EQN A;  1I50 H;  4DV5 L;  5FLX L;  2LFN A;  3VYS A;  1HQM C;  1VQI A;  3I72 A;  4LUV A;  3J81 c;  3TRZ A;  4IOA A;  5M3F B;  3VDY A;  4LFC L;  4DR3 L;  5GAE C;  4DAV A;  5NUC A;  1HTP A;  1U0L A;  3GTL B;  1YHB A;  3S2H H;  3GTP B;  1Y14 B;  2A68 C;  4GLV B;  2PCF B;  1N36 L;  2MJ8 A;  1ET9 A;  1K83 B;  1KHI A;  2MUY A;  4OHJ A;  5ELD A;  4K6L A;  1U9R A;  5H1S E;  4N8X 1;  4CGY B;  4YHH L;  4AYB G;  2H1E A;  4A3J B;  1AH9 A;  1KLU D;  1TWH B;  1X55 A;  3VA5 A;  4DK1 A;  1KD1 C;  4GKJ Q;  1DON A;  3HOW H;  3KLS X;  4XQJ A;  1Q1B A;  5EGT A;  4JK1 C;  2N3S A;  4GLA C;  4C2M B;  4IUR A;  5D3D A;  4DN4 M;  4V0B A;  3CMA A;  1PTO B;  5C0X H;  4LF4 L;  1Q7Y C;  1SYG A;  1K73 C;  4J1M A;  3PO2 G;  1IBM L;  2YTX A;  3HOU B;  3X3N A;  2DY7 A;  4RGT A;  1UE1 A;  2PZU A;  2Q2H A;  1EQQ A;  1M4V A;  4JBJ A;  1RKN A;  1HTL D;  5JOB A;  1V1O A;  4A3M B;  4TSS A;  1FNU A;  4DR7 L;  4JG2 A;  5E7N A;  1ML0 D;  1IYV A;  1A3V A;  2E2H H;  2E2J B;  2BDN A;  2PI2 E;  4ILW A;  4L8J A;  1B1Z A;  4JI1 L;  1K8O A;  3QR8 A;  4UAI A;  3VR5 A;  4XIG S;  2E5L L;  3UDX A;  3Q6S A;  1VQ4 A;  3A7L A;  3KF8 B;  1D6E C;  1AZQ A;  4IFD G;  5C3E B;  2MNA A;  4L5T A;  2QF7 A;  2SNS A;  4KTA A;  3CCQ A;  5ELC A;  5IYB G;  3UDG A;  2A1A A;  2JA5 G;  2JEB I;  2LMC B;  4OO1 G;  3A5Z B;  4AQY L;  3ICE A;  4X64 Q;  1SLJ A;  2CWA A;  1Y8N B;  5CV7 A;  5I6Y A;  1XYI A;  4EQP A;  1HUN A;  1I3Q H;  3PGZ A;  4IUQ A;  1QUQ B;  4NXM L;  3ERO A;  3I4N H;  4HJ5 A;  4BXX G;  1YZ6 A;  1YNX A;  5KEE A;  2R92 H;  4K2L A;  4JI8 Q;  3S24 A;  4X66 L;  3TP6 A;  5IYC G;  1UE6 A;  4BBS H;  4A3F B;  2IY5 B;  4GN5 A;  4ODG A;  3OMG A;  4HJ7 A;  4C3H B;  1KL9 A;  2X6L A;  3I4O A;  1S5D D;  4DV7 Q;  3QO2 A;  5DEH A;  2OTL A;  5T1G A;  5JJI A;  2QEJ C;  2H4O A;  2N55 A;  3W3A A;  4MHE A;  1N8R C;  4DV2 L;  1NE3 A;  1FNV A;  5EPL A;  5KRU A;  4K8J A;  4TKO B;  3DLL A;  2XNA C;  4L5R C;  2QGQ A;  5G3L D;  3AYH B;  3KF8 A;  1ET6 A;  4WJ3 M;  4EGV A;  2EXZ A;  2ZTE A;  4DAY B;  3CCV A;  3L0O A;  4AYB B;  2WFW A;  1CUK A;  3S1R B;  4DUY Q;  2JA7 G;  5I9O A;  3GP7 A;  4DV3 L;  1X65 A;  1B9M A;  1GUW A;  3GTJ H;  1WTO A;  1JT8 A;  3RN5 A;  4R8N A;  1OXV A;  2JE6 I;  4BY7 H;  3PO2 B;  2WP8 J;  1B9N A;  1E2V A;  5HGQ A;  4NPS A;  2XRQ D;  1D1I A;  4GS3 A;  2M2L A;  2VQE Q;  1O7I A;  3S14 H;  2K28 A;  3S9W A;  3STB C;  1HNW L;  3BVZ A;  3FKI G;  1JCK B;  1WTV A;  5J39 A;  5CV5 A;  4CHT B;  3CRK C;  3G48 A;  1V1P B;  1VQA A;  1TS2 A;  5M5W B;  4GN4 B;  3TP7 A;  5I4D A;  1HZB A;  4LJZ C;  4A3L G;  4FF1 A;  4GKK Q;  1A2U A;  2VL6 A;  3MA2 B;  4OL7 A;  2HIV A;  5EKI A;  2B2W A;  1S5B D;  4DFA A;  1U4L A;  2EY1 A;  5KND A;  1FGU A;  2PNR C;  2ZTD A;  5IE8 A;  4KHV A;  4EQ5 A;  3RZD H;  2EYJ A;  2B2Y A;  1I4Q A;  4Y7N H;  1BUV T;  1XWE A;  4DK6 C;  1UAP A;  1WTR A;  3U50 C;  2QA4 A;  2JA5 B;  4QCL A;  3CCM A;  1UEA B;  4H44 C;  2K01 A;  2CWP A;  1F2Z A;  2R7Z H;  1DCZ A;  2D2C C;  1PH5 A;  1X9N A;  3MXG A;  2G5D A;  4PG3 A;  4DNT B;  2DJG C;  2JA9 A;  3BU2 A;  4UP9 A;  1Z6H A;  1IW7 C;  4RGN A;  3S15 H;  3MTS A;  4ZRZ A;  3GV3 A;  4QIW E;  1X3F A;  4E6I A;  4JI4 Q;  1U4M A;  3OW2 A;  3IKJ A;  3DEO A;  2Y0S E;  4QY7 A;  3A74 A;  2OT2 A;  3ZJY C;  2JA6 H;  4DV0 L;  2UXC Q;  1EU4 A;  5BR8 L;  4HMJ A;  2OEO A;  2QKI C;  1PTO C;  2SEB D;  4KV6 A;  1J5E L;  3A5U A;  1MHW C;  3T1H Q;  5KYI A;  2G9D A;  1PRT F;  3K6O A;  3M4O B;  2KA7 A;  5AJ3 L;  3SGI A;  3TP8 A;  2B39 A;  3U58 A;  4K14 A;  1VQ9 A;  5JEA J;  3HS0 C;  2NN6 G;  1PLF A;  5EKL A;  1UNS A;  1B3Q A;  2IX1 A;  1HRJ A;  4P71 A;  3GTO B;  4LMQ D;  4IUU A;  3NTI A;  2CH4 W;  3DXJ C;  5IP7 H;  5K36 H;  4XQN A;  1CZW A;  2UUB Q;  4AIM A;  3CHB D;  2A8V A;  3K0Y A;  4YCU A;  1A62 A;  2K4K A;  1JC7 A;  1FNW A;  2ZT9 C;  1WCM G;  3OYY A;  2AUJ D;  4UP7 A;  1S4Z A;  3PUZ A;  5C5M A;  5GAD C;  1PH6 A;  4DR1 Q;  2ZM6 Q;  4HN7 A;  3EBE A;  4K0K L;  3DM3 A;  5C4X B;  2EYM A;  2IL8 A;  1BNZ A;  2CQA A;  3PO3 H;  5CBE E;  3MHB A;  4JVZ A;  1G51 A;  2Q2I A;  1K0R A;  4BBR H;  1JJG A;  3DM1 A;  3V2T A;  1K3R A;  3FKI B;  2VUM G;  3EFX D;  1SE3 A;  2WAQ G;  3VYU A;  2BCO A;  2F0G A;  4A3G B;  1A3U A;  1PYB A;  1WTH A;  3KUP A;  2MP1 A;  1JWU D;  3PIO A;  2EJG C;  3L3O C;  4NMZ A;  1Q1E A;  4A76 A;  2B2U C;  4KD4 A;  4B3S L;  3SR1 A;  1YNJ D;  2F0P A;  4NW2 A;  5GAH C;  2A6E D;  2OXP A;  2A69 D;  1EQT A;  1H9M A;  2KUM A;  1JB3 A;  4DR3 Q;  3L2P A;  4FF3 A;  5M9O A;  4JV5 Q;  2F0U A;  1QZG A;  3B6Y A;  4LF7 L;  2C9O A;  1HA6 A;  3GTM B;  4O0A A;  2EJF C;  3T56 B;  2E75 C;  2D0O A;  2XVS A;  1NNX A;  1Q90 A;  4KY5 A;  5C4J H;  1HR0 Q;  4YHH Q;  3I3C A;  2IPK D;  1PVO A;  2B2V C;  2MPM A;  2RDH A;  1RIP A;  2RA4 A;  3VR3 A;  1C9O A;  2LSS A;  3HKZ B;  4JOI A;  4DGZ A;  1VQF A;  3ULJ A;  3WOF A;  4EX5 A;  1EL0 A;  4LFA Q;  4A3I H;  1TWF H;  4LF4 Q;  4IJH A;  1XNQ L;  1TKW B;  4DU9 A;  3X3M A;  1SYC A;  2XWB B;  3SK4 A;  5EAY A;  1L1O A;  2Z6K A;  4LFB Q;  1ESR A;  2EOT A;  4ZYS A;  3CCU A;  2JSO A;  4PZ6 A;  2PMZ B;  5LMN Q;  3H09 A;  3DWP A;  2UXD L;  2YU9 H;  3D4D A;  1BVS A;  3F2U A;  2F0L A;  3C1F A;  2OWO A;  4Q5V A;  1SND A;  4PV1 C;  1TWC B;  1N33 L;  3M3Y H;  4R4I A;  1SYE A;  2B63 G;  1XMQ L;  1N9W A;  2BDO A;  3DWQ A;  4JI1 Q;  1V8Q A;  3I4L A;  2ES2 A;  5DM6 3;  3WWV A;  3UE1 A;  4DPG A;  4A93 H;  4DUZ L;  2WB1 G;  4HJ8 A;  4TRD A;  4QGU A;  2KEE A;  1FVI A;  3ULL A;  5KGU A;  3PF4 A;  1STA A;  2EYP A;  4JI2 Q;  2R7F A;  3NQI A;  4UPA A;  3H3V H;  1IKL A;  1QB5 D;  1IXR A;  4FO2 A;  1YVC A;  2K14 A;  3K8A A;  4K5W A;  3H0G H;  4AQY Q;  1A6X A;  3T1Y Q;  1TWG H;  1JR0 D;  2F0T A;  1ZKO A;  4H13 C;  4DR5 L;  1E1O A;  1LTB D;  2IWH A;  5C44 G;  5EBC A;  1S5F D;  1BDO A;  2B8G A;  3J7Z C;  1YJ9 A;  2Z1C A;  2KEC A;  3CF5 A;  4KMU C;  1Y1W B;  1TWA H;  1M90 C;  1I4X A;  1TY0 A;  1XJV A;  2Q8R E;  3BDC A;  1RHP A;  2WAQ B;  4QF4 A;  3MXN A;  1VQ7 A;  1CSQ A;  1G8Z D;  2PNH A;  4K8I A;  1WD0 A;  1CKM A;  5M3F G;  1RTO A;  2WKD A;  5JPN C;  1STE A;  3W1B A;  1B7Y B;  3Q22 A;  1UE7 A;  4OIK A;  2GA4 B;  2KCC A;  1U4P A;  4R4O A;  5JJZ A;  2ASB A;  2F0S A;  4IPG A;  4HSP A;  4FF2 A;  1VF5 C;  1MJC A;  4IFD J;  3A8J E;  4I7Z C;  4K2K A;  3E6Z X;  3BZD B;  2HT1 A;  1KQS A;  1EIY B;  3ND8 A;  1YNN D;  1C8C A;  3NSW A;  5CR3 A;  5IP9 G;  4QB4 A;  1IBK Q;  4DV6 Q;  1BXT A;  4F7X A;  3OTO Q;  1Q3L A;  2NUC A;  4RCO A;  2AQ1 B;  3I90 A;  4DV4 Q;  4DK0 A;  1SNQ A;  4ZKC B;  4JI0 L;  1Q81 C;  2EJM A;  1SE8 A;  1SYD A;  4H02 A;  4K5X A;  1ZYR D;  1PYW D;  2NZ1 D;  3EJI A;  1G2S A;  1V1Q A;  1WD1 A;  1QG7 A;  3PIP A;  4EVO A;  3F1Z A;  2HHH L;  2K1B A;  3HRZ C;  4C1N K;  2I5M X;  1Y69 U;  1EWI A;  1GUG A;  4L6T B;  1EYC A;  4X65 L;  1BCP F;  3K5O A;  2AQ3 B;  3Q0A A;  5FJ8 G;  3CC4 A;  4KHP L;  4KY7 A;  5C4Z A;  4XTC S;  4A3M G;  2X69 A;  5I2Y A;  4JYA L;  1C0A A;  1GKH A;  3M85 A;  4A3K H;  1HNW Q;  2I46 A;  1KLG D;  4HAE A;  1VQK A;  2I5H A;  1TY2 A;  4CKB A;  3AFP A;  1FJG Q;  1SNP A;  1T5X D;  1X54 A;  4ZK9 B;  3CQZ H;  3PF5 A;  2ICI A;  4GN3 B;  3TN2 A;  3M7G A;  4WJ4 A;  1BBX C;  4CDC C;  4U67 3;  5C3E G;  1I4P A;  1VQJ A;  4N9T A;  4JI5 Q;  4FF4 A;  1PZJ D;  3I55 A;  4X3S A;  4IUP A;  2D5D A;  3Q24 A;  4B3T L;  3DMU A;  3T13 A;  4B3M Q;  2F0F A;  2R3Z A;  3MZ5 A;  4IPC A;  1SNO A;  2VQF L;  1SMY D;  1KDA A;  1B50 A;  1XPO A;  2F1M A;  2RSO A;  1WTX A;  2AMC B;  4PMW A;  5C0X G;  1WTW A;  4A3C H;  2Z9H A;  1PH3 A;  3I73 A;  4N8F A;  3FEW X;  1FGB D;  4IZ8 A;  3S16 H;  2XN9 C;  1I4H A;  1A3T A;  3TRE A;  4FP5 D;  2K75 A;  5IYD G;  3TZD A;  4I7A A;  4A3F G;  2WII B;  4CJ2 C;  4GOP C;  4R9W A;  4C3H G;  1K28 A;  5F2D A;  4G7O C;  4DV1 L;  3HOV H;  3J80 E;  4QJF A;  3MC0 B;  3K5N A;  2B8F A;  5I2X A;  3GO5 A;  4C3I B;  4G7H C;  3DWA A;  3VYR A;  2GN5 A;  3S17 H;  2DUD A;  4JI6 L;  3CRL C;  3SK6 A;  3JAM E;  3VA7 A;  5L37 A;  1YEZ A;  2MQH A;  2KCM A;  1U5K A;  3BG3 A;  4DNI A;  2UUC Q;  2NVT B;  1HZC A;  4R1J A;  2SNM A;  3KJP A;  4GLX A;  3CME A;  4BY1 H;  2F0V A;  2RCN A;  4A3E H;  3NXW A;  2IX0 A;  1UEB A;  3AEV A;  2AUK A;  2HQL A;  1SJE D;  1V43 A;  3BZC A;  1TR5 A;  1FR3 A;  2K7V A;  3C46 A;  1K0S A;  1GHJ A;  2K6A A;  3MFG A;  1C4Q A;  1Y1V B;  3EA6 A;  3CPF A;  4HED A;  4HMI A;  3HOY H;  1HH2 P;  4OX9 L;  2F4I A;  1MGS A;  2R61 A;  2YV5 A;  2NVQ H;  2DNC A;  4PNY A;  1A63 A;  2YYZ A;  1TQO A;  1CHQ D;  4BBS G;  2JYO A;  1QVF A;  4IOC A;  2A5H A;  2CHB D;  5FO7 B;  1F9Q A;  4NDX A;  1I50 B;  4U68 A;  2NZH A;  3UE0 A;  1PXU A;  3CC2 A;  1LAC A;  1LT5 D;  1ENF A;  1JJC B;  2IT1 A;  3GV6 A;  5DNF A;  4LF9 Q;  4IFD I;  4ID6 A;  3TBI B;  3U9S A;  1IBL L;  3S2H B;  1H9S B;  1D7Q A;  1QVG A;  3J80 c;  5ISR A;  1BCP D;  3I4M H;  1MD2 D;  3EVQ A;  3KFU A;  4X62 Q;  1CK1 A;  5CV8 A;  1CM9 A;  4OO1 I;  1O7Y A;  3JAM c;  4L63 B;  3BVM A;  2DJF C;  1OXS C;  2F0N A;  3CXC A;  1VQ5 A;  2HUG A;  4P75 A;  3S2D H;  5M5X H;  3M7N A;  1XMO Q;  3PSI A;  3MFY A;  4ALP A;  2A74 C;  3CD6 A;  4RHS A;  1SNC A;  1NAP A;  3HOW B;  1HNX Q;  1HNZ L;  2M00 A;  1ICF B;  1CHP D;  4CJ0 B;  4M1U B;  3GD7 A;  4NXN L;  3J7A V;  4TVA B;  4BY7 G;  3OOC A;  1QVC A;  1I6H H;  3OIQ A;  4G7Z C;  3OMC A;  3HOX H;  1YIJ A;  2PZW A;  2EYH A;  2BE5 D;  4JI3 L;  3G4S A;  2UU9 L;  4C56 C;  3GTG H;  2AQ2 B;  2RDG A;  3NBH B;  2MO0 A;  3HP3 A;  3H3V C;  3T16 A;  1SRO A;  4LF6 Q;  2K32 A;  1XNR L;  4OWT B;  4DR6 Q;  4GNX C;  1MKH A;  1ENC A;  5GAG C;  2E2H B;  1N32 Q;  1S5E D;  1G29 1;  3IFT A;  4DR4 Q;  1H9S A;  4V19 0;  2EPB A;  3L9A X;  4IAL A;  2UXD Q;  1F2Y A;  1BKB A;  4ZKB B;  5EPK A;  3RLN A;  5K5P A;  2AHO B;  4DR2 L;  4S3S A;  2QDB A;  2O5J C;  5JJK A;  3BYY B;  4P74 A;  2A19 A;  3F2B A;  3C3L A;  4MNO A;  5IWA L;  1FL0 A;  3W1G A;  2F4V Q;  1EYD A;  3SK8 A;  3W5O A;  3K7A H;  3KLS A;  3HOZ H;  1EIG A;  1W6J A;  2ZXP A;  2R7Z G;  3PCO B;  2EIF A;  2BH8 A;  4HR7 B;  1KRT A;  5FOB B;  5E3F A;  2B2U A;  5C4X G;  1Q8K A;  1I3Q B;  5C5L A;  5FO9 B;  1QUQ A;  2PQA B;  2V4D A;  1VQC A;  3VYT A;  1QWY A;  3I4N B;  1C7Y A;  1A15 A;  2R92 B;  1B70 B;  3SDZ A;  1TS3 A;  1I4G A;  1VF7 A;  5HUR A;  2JA6 G;  4BBS B;  1VQP A;  2K5W A;  1VQB A;  4IPH A;  1GUT A;  2F03 A;  4R4Q A;  4A3G G;  2RCF A;  4X3K A;  4NB3 A;  2SDF A;  1C48 A; 
#chains in the Genus database with same CATH homology
 2B2V A;  3Q23 A;  1PMR A;  2PO4 A;  1EWH A;  3AU7 A;  5E4W C;  1X3P A;  1KTK A;  2A73 B;  2NBF A;  3H6M A;  4DAY A;  2B2T C;  1NCV A;  2FIN B;  3FPP A;  5I9P A;  1SSO A;  1IL8 A;  4QIW B;  3NUC A;  2RDF A;  3RD4 A;  1YNJ C;  1SNM A;  4BA2 I;  2HDL A;  2Y0S B;  3GTJ B;  4RHR A;  4F8M A;  5FLX E;  2A6E C;  3GQB A;  3URY A;  1EEI D;  4KKU A;  2A69 C;  1HFN A;  4BY7 B;  1LTT D;  2VB2 X;  3FRP B;  3CU7 A;  3S14 B;  2ZXR A;  3TDQ A;  1Z7T A;  5BN3 A;  2RVL A;  1ICW A;  1HQR D;  2NWG A;  1RF2 D;  1V1P A;  1HXY D;  3R8B A;  3R2T A;  1GUN A;  5LL6 X;  1EIH A;  1I4R A;  4N9P A;  4HSV A;  3OWE B;  2NN6 I;  1VMC A;  3O13 A;  2HCI A;  3RZD B;  3PIO 3;  4Y7N B;  1BOS A;  2E76 C;  3I91 A;  1EEF D;  1B44 D;  1QOH A;  3VR4 A;  2MHV A;  4RKB A;  1AEX A;  3LWE A;  3J81 L;  2R7Z B;  1OO9 B;  3SE0 A;  3QG1 A;  3NTK A;  5FK9 C;  2WV6 D;  3IL8 A;  1D5M C;  4DAP A;  2M9V A;  3G6J B;  3U9O A;  3S15 B;  1Q8I A;  3MXU A;  3D8G A;  5DM7 3;  5JVH 3;  3OWF A;  1WVL A;  2JA6 B;  4G57 A;  2F3W A;  2JXM B;  1JWM D;  4DXG A;  2HDM A;  3OHX C;  2NYZ D;  4ZUJ A;  4RGM A;  2Q8I B;  1IKM A;  5IGF A;  3ONA B;  1DOL A;  1B4O A;  1BCP B;  2F0I A;  1NR2 A;  3NWT A;  4QUC A;  1QJO A;  1QCB D;  3NBI A;  2RBM A;  3PUX A;  1NR4 A;  4QUF A;  1XXG A;  5D14 A;  1IW7 D;  5C0X J;  4ABN A;  4KHZ A;  2ICE C;  2TSS A;  1R4P B;  1CFM A;  1QNK A;  2RSN A;  3KLR A;  4K6D A;  3V05 A;  2NN6 H;  3PO3 B;  4FVM A;  1RDP D;  5D3I B;  1O7L A;  2RKS A;  1GUO A;  5IGG A;  1UUP A;  1EOT A;  4PMC A;  4BBR B;  3JAM L;  1YNN C;  3R2I A;  3PUY A;  1BQQ T;  3D3R A;  3SK5 A;  2L4N A;  5LL6 S;  1Q12 A;  3AMU A;  4O1N A;  4RFB A;  1W6K A;  4DA2 A;  1STB A;  2BA0 A;  2ID0 A;  1H9J A;  1KNA A;  1ZYR C;  3A54 A;  1KAB A;  3DHQ A;  1XTC D;  4XT1 B;  3CKI B;  4A3D B;  1EY9 A;  5CV6 A;  4G4K A;  5FO8 B;  1LT3 D;  1WTQ A;  2G9H D;  1TII D;  1PRT D;  3LNN A;  5C4J B;  2CW0 D;  5JVG 3;  5A2Q E;  3E0J A;  1BR9 A;  1DD2 A;  2IW3 A;  4A3I B;  4UDU C;  2Z8L A;  3MWY W;  1TWF B;  1EY5 A;  2FMM A;  1GOZ A;  2PZT A;  4CJ1 B;  4DXF A;  4RCN A;  5C3X A;  1ZXT A;  1SMY C;  4C3I G;  2YU9 B;  2CVR A;  1JOR A;  4BA1 I;  3PIP 3;  5EKK A;  5CYU A;  1GUS A;  5KNC A;  3M3Y B;  2NB0 A;  2QIL A;  4A93 B;  1LAB A;  4NKL A;  4B08 A;  3E5S A;  1SDF A;  3LWU A;  2BOS A;  2FFK B;  3D31 A;  5C3W A;  5IT9 E;  5I6W A;  3GTQ B;  1I6V C;  3H0G B;  1WTP A;  5EQ0 A;  2A6H D;  1TWG B;  1BO0 A;  1ONL A;  2R6G A;  4WFN 3;  3IAY A;  4XDX A;  2JEA I;  3FMC A;  1TWA B;  1DOM A;  1AW7 A;  2F0D A;  4IUV A;  4GZY C;  1H9R A;  2L55 A;  1CZG A;  5IIF A;  3MAQ A;  1PFN A;  2PW7 A;  1RD9 D;  3NWS A;  1SJH D;  2Z4I A;  3I70 A;  5HGT A;  4ZLT F;  4ZUI A;  4KY6 A;  1PFB A;  3PMF A;  1MBY A;  1CQV A;  1SXT A;  2EE1 A;  1MI2 A;  1F2M A;  2EVB A;  5E4X A;  2E2D C;  1BCP C;  1O78 A;  4LAA A;  1F2L A;  4P2C B;  5JEA H;  2F0O A;  3OIP A;  3D6W A;  4IUT A;  2K03 A;  2VXW A;  1J8I A;  2DN8 A;  2VNU D;  1OXT A;  3D6C A;  4RWS C;  1RCV D;  1PTO H;  1CA6 A;  2L0C A;  4X3T A;  4A3K B;  1GHK A;  3NE5 B;  3VR6 A;  1HCZ A;  4O42 A;  3TP5 A;  1E2Z A;  1LT4 D;  3AB9 A;  4J8Q A;  3P20 A;  1CA5 A;  2SOB A;  5KIX A;  3CQZ B;  5T1I A;  1FD7 D;  3FPU B;  2BE5 C;  1LO5 D;  5G3L F;  1ILQ A;  5COR A;  3DUZ A;  4R8I A;  1ILP A;  5IGE A;  1VMP A;  1DM0 B;  2F0Q A;  1STG A;  3DEP A;  1RTN A;  2L12 A;  1DJR D;  5AFW A;  3PUV A;  3BYT B;  5IOC A;  1VDZ A;  5A35 A;  2EZV A;  2I07 B;  1ESF A;  2F0M A;  2O2L D;  3K58 A;  4TQU S;  1K8M A;  3S16 B;  1DZ1 A;  3N52 A;  2FMC A;  2IJ0 A;  4RAU C;  2B2T A;  1PZK D;  3V96 A;  3HOV B;  2DY8 A;  1ZEQ X;  2K33 A;  3S17 B;  1EQV A;  5DAU A;  1II3 A;  4BY1 B;  5FKA C;  1TU2 B;  5EPJ A;  4A3E B;  1DYQ A;  4KKT A;  4XYO A;  1R4Q B;  1SYF A;  3T4A C;  3A55 A;  1PDQ A;  3L7Z C;  1PRT B;  1S5C D;  4IN3 A;  5EJW A;  2PYK A;  2BA1 A;  3P75 A;  3HOY B;  5J1Z A;  2J0T D;  1JIC A;  1PZI D;  2KJX A;  4KD3 A;  4PMB A;  2NVQ B;  1EYA A;  4J6H A;  1SE2 A;  2L5T A;  5C4H A;  2K05 A;  3ERQ A;  4XYQ A;  4C1N I;  2XWJ B;  5IGC A;  1AP0 A;  3NTH A;  2LKV A;  2R93 B;  1EY8 A;  1B3A A;  2A68 D;  3TME A;  1X32 A;  5IGB A;  2AWN A;  1MSH A;  3A8K E;  5JPM C;  3I4M B;  1OXX K;  2MGS A;  1IYU A;  3C2P A;  4FNF A;  2EDG A;  2EYL A;  4M8A A;  2O5I C;  3S2D B;  4RGO S;  5M5X B;  1TS5 A;  1STN A;  1AZP A;  3UI2 A;  3D4R A;  1QIL A;  2EYF A;  1G2T A;  1F9R A;  4CBV A;  1D2B A;  4BS9 A;  2KED A;  1FYC A;  4JBW A;  4IFD H;  5CGK A;  1XX8 A;  1I6H B;  1JWS D;  3HOX B;  2D9U A;  1F77 A;  4CKC A;  3K57 A;  3TSS A;  3QOJ A;  4OO1 H;  3P1H A;  3QWN A;  1G6Z A;  3GTG B;  3NBH A;  4ME5 A;  5LHY 1;  2EY6 A;  3SEB A;  4PQX A;  1D5X C;  2WAC A;  2N88 A;  1BF4 A;  4FXG C;  3HG9 A;  1T5E A;  1D1K A;  4F88 A;  4I65 A;  1LTG D;  4IUN A;  4KKS A;  1QNU A;  2LS0 1;  1KAA A;  2F0K A;  4FXD A;  2WIN B;  5A2Q L;  5CBA E;  1EZ6 A;  1U4R A;  4B9X A;  2J4X A;  3K7A B;  5K36 G;  3BS1 A;  3HOZ B;  5C6A A;  1A2T A;  1LTA D;  1M8A A;  1EY0 A;  2KHS A;  3W2D A;  4OGQ C;  1E2W A;  1PTO F;  4RH6 A;  2NTT A;  1EFI D;  5BN4 A;  2E74 C;  3NHH A;  1TT2 A;  3M4Y A;  3QB3 A;  1CTM A;  1EY6 A;  4DNR B;  2F0W A;  2F0E A;  5CMD A;  1SBB B;  1Y8O B;  1Y8P B;  1KDB A;  3RUZ A;  1VCI A;  1E0B A;  1Z47 A;  1NSN S;  1O7Z A;  4Z9C B;  4C3J G;  1LV9 A;  4EQO A;  1AN8 A;  2NVX B;  3S1N B;  2KCN A;  2KOL A;  4MN3 A;  4XQQ A;  5IT9 L;  2WKC A;  3J7A F;  5ELF A;  3ND9 A;  2C5C A;  1SYB A;  3GTK B;  1J9O A;  2ZXO A;  3C1E A;  2FJ2 A;  3HZX A;  4XT3 B;  3QJY A;  1LTR D;  3A8I E;  5KYL A;  2FHT A;  3ZYY X;  1RJT A;  2Q8T A;  4HTH A;  4WRD A;  5IOD A;  3NPP A;  3NP8 A;  4OIJ A;  3FDT A;  4YIJ A;  2JA7 B;  3K5L A;  1X3Q A;  1LTS D;  2E2I B;  1PRT C;  2XRS D;  1HUM A;  2CW0 C;  2PQE A;  3NQT A;  2AWO A;  2IX3 A;  5IGD A;  1GJX A;  2K04 A;  4MIU A;  5M5Y B;  1SE4 A;  3S1M B;  1DOK A;  3RMH A;  1EWC A;  1JOK A;  5EBD A;  3HGB A;  4KI0 A;  2K5Q A;  2HQE A;  3FVQ A;  3TZU A;  2EYO A;  4KN7 C;  1HA5 A;  4F87 A;  3WDN A;  1EZ8 A;  3J80 L;  4BWG B;  3QIA A;  1KDC A;  3SVM A;  1SAP A;  5TSS A;  2EY5 A;  4H7B A;  2F3V A;  1KNE A;  1B2T A;  2D62 A;  2OF1 A;  3LX0 A;  4ZQ3 A;  4KJO A;  2JP1 A;  1EY4 A;  3R93 A;  1PTO D;  1L0X B;  5ELE A;  1B53 A;  2B2W C;  3RZO B;  2QCP X;  5COY A;  2Z4H A;  2J7Z A;  2B2Y C;  1CQF A;  2A6H C;  4C3J B;  2JA8 B;  2XSC A;  4FYD A;  1JOQ A;  3A7A B;  3EQL C;  3KK7 A;  2LY7 A;  3ITP A;  3PUW A;  4WJW A;  1CT1 D;  1HHV A;  1F9S A;  3G7L A;  3K5M A;  2NVY B;  3SHL A;  3BDL A;  2F0H A;  3WOE A;  1JE4 A;  4Q0F A;  1NUC A;  1OXU A;  3J7Y W;  5JAV A;  2F0J A;  1ROD A;  4X3U A;  1HFG A;  4KN4 C;  3R3O A;  3S1Q B;  1SEB D;  2KQ3 A;  3BDO A;  4WOR A;  1JQY D;  1WCM B;  1STH A;  4IQZ A;  1EU3 A;  4CKE A;  3MXP A;  3VR2 A;  4KK7 A;  3OSO A;  1H9K A;  3PV0 A;  3K59 A;  3SXH A;  4RA8 A;  2VUM B;  2EY2 A;  3HEJ A;  3MEH A;  4XXE A;  3H94 A;  4KJN A;  1R9T B;  1QE6 A;  4ZAI A;  5E1F A;  3KBG A;  2L1B A;  4ULL A;  4FXK C;  4NP5 A;  3T53 B;  5BN5 A;  5J22 A;  2L11 A;  3MVV A;  5JEA G;  1GXD C;  2O4X A;  1LLR D;  4HCE A;  2PPB C;  3BVG A;  2VB3 X;  3I8Z A;  5KNB A;  2ENB A;  5CV9 A;  4K5V A;  1ENA A;  1IHZ A;  1JOO A;  4DF7 A;  1DXM A;  1HPC A;  4LK1 C;  3J81 E;  5D65 A;  2HCC A;  3N6R A;  2NTS A;  1PFM A;  1O80 A;  3D4W A;  3NK9 A;  4H0L C;  4HCS A;  1D5Z C;  5C0X I;  1F9P A;  1AFP A;  2RQX A;  1LT6 D;  3A56 A;  1TVX A;  1G91 A;  2B63 B;  1TS4 A;  2KVM A;  2DNE A;  3IFD A;  3OPO A;  2WB1 B;  4A3B B;  1LTI D;  1CI3 M;  4QMG A;  2X6G A;  2XIW A;  2TMP A;  3P7J A;  3RLF A;  3H91 A;  5CC4 A;  3KBX A;  3QOL A;  1STY A;  5CV4 A;  1EY7 A;  3OW7 A;  1MSG A;  2PW5 A;  5C44 B;  5ELB A;  5M3M B;  4B9W A;  1SFO B;  1L0Y B;  2L9H A;  2K5D A;  4RKL A;  3T51 B;  4EQN A;  5FLX L;  2LFN A;  3VYS A;  1HQM C;  3I72 A;  5M3F B;  4DAV A;  5NUC A;  1HTP A;  3GTL B;  3GTP B;  2A68 C;  2PCF B;  2MJ8 A;  1ET9 A;  1K83 B;  2MUY A;  4OHJ A;  5ELD A;  4K6L A;  1U9R A;  4CGY B;  2H1E A;  4A3J B;  1KLU D;  1TWH B;  3VA5 A;  4DK1 A;  1DON A;  3KLS X;  4XQJ A;  1Q1B A;  5EGT A;  4JK1 C;  4C2M B;  4IUR A;  5D3D A;  4DN4 M;  4V0B A;  1PTO B;  5C0X H;  1SYG A;  4J1M A;  3HOU B;  3X3N A;  2DY7 A;  4RGT A;  2PZU A;  1M4V A;  1RKN A;  1HTL D;  5JOB A;  1V1O A;  4A3M B;  4TSS A;  1FNU A;  1ML0 D;  1IYV A;  1A3V A;  2E2J B;  2BDN A;  4ILW A;  4L8J A;  1B1Z A;  1K8O A;  4UAI A;  3VR5 A;  4XIG S;  3Q6S A;  3A7L A;  4IFD G;  1D6E C;  1AZQ A;  5C3E B;  2QF7 A;  2SNS A;  4KTA A;  5ELC A;  2JEB I;  2LMC B;  4OO1 G;  1Y8N B;  5CV7 A;  5I6Y A;  1XYI A;  4EQP A;  1HUN A;  4IUQ A;  3ERO A;  5KEE A;  4K2L A;  3TP6 A;  4A3F B;  4ODG A;  3OMG A;  4C3H B;  2X6L A;  1S5D D;  3QO2 A;  5DEH A;  5T1G A;  2QEJ C;  2H4O A;  2N55 A;  3W3A A;  4MHE A;  1FNV A;  5EPL A;  5KRU A;  4K8J A;  4TKO B;  2XNA C;  5G3L D;  3KF8 A;  1ET6 A;  4EGV A;  2EXZ A;  4AYB B;  3S1R B;  5I9O A;  3GP7 A;  1B9M A;  1GUW A;  1WTO A;  4R8N A;  1OXV A;  2JE6 I;  3PO2 B;  2WP8 J;  1B9N A;  1E2V A;  2XRQ D;  1D1I A;  2M2L A;  2K28 A;  3S9W A;  3BVZ A;  1JCK B;  1WTV A;  5J39 A;  5CV5 A;  4CHT B;  3CRK C;  1V1P B;  1TS2 A;  5M5W B;  3TP7 A;  5I4D A;  4LJZ C;  4FF1 A;  1A2U A;  4OL7 A;  3MA2 B;  5EKI A;  2B2W A;  1S5B D;  4DFA A;  1U4L A;  2EY1 A;  5KND A;  2PNR C;  4KHV A;  2EYJ A;  2B2Y A;  1I4Q A;  1BUV T;  1XWE A;  1UAP A;  1WTR A;  2JA5 B;  4QCL A;  1UEA B;  4H44 C;  2K01 A;  1F2Z A;  1DCZ A;  2D2C C;  3MXG A;  4DNT B;  1Z6H A;  1IW7 C;  4RGN A;  3MTS A;  4ZRZ A;  3GV3 A;  4E6I A;  1U4M A;  3IKJ A;  3DEO A;  2OT2 A;  1EU4 A;  4HMJ A;  2OEO A;  2QKI C;  1PTO C;  2SEB D;  4KV6 A;  5KYI A;  2G9D A;  1PRT F;  3K6O A;  3M4O B;  2KA7 A;  3TP8 A;  2B39 A;  4K14 A;  5JEA J;  3HS0 C;  2NN6 G;  1PLF A;  5EKL A;  1UNS A;  2IX1 A;  1HRJ A;  3GTO B;  4LMQ D;  4IUU A;  3NTI A;  3DXJ C;  5K36 H;  4XQN A;  1CZW A;  3CHB D;  3K0Y A;  1JC7 A;  1FNW A;  2ZT9 C;  2AUJ D;  1S4Z A;  3PUZ A;  5C5M A;  4HN7 A;  5C4X B;  2EYM A;  2IL8 A;  1BNZ A;  2CQA A;  5CBE E;  3MHB A;  3DM1 A;  3V2T A;  3FKI B;  3EFX D;  1SE3 A;  3VYU A;  2BCO A;  2F0G A;  4A3G B;  1A3U A;  3KUP A;  2MP1 A;  1JWU D;  2EJG C;  3L3O C;  4NMZ A;  1Q1E A;  2B2U C;  4KD4 A;  3SR1 A;  1YNJ D;  2F0P A;  4NW2 A;  2A6E D;  2OXP A;  2A69 D;  1EQT A;  1H9M A;  2KUM A;  1JB3 A;  4FF3 A;  5M9O A;  2F0U A;  2C9O A;  1HA6 A;  3GTM B;  2EJF C;  3T56 B;  2E75 C;  2XVS A;  1Q90 A;  4KY5 A;  3I3C A;  2IPK D;  2B2V C;  2MPM A;  2RDH A;  2RA4 A;  3VR3 A;  3HKZ B;  4DGZ A;  3WOF A;  1EL0 A;  1TKW B;  4DU9 A;  3X3M A;  1SYC A;  2XWB B;  3SK4 A;  1ESR A;  2EOT A;  4ZYS A;  2JSO A;  2PMZ B;  3H09 A;  3DWP A;  3D4D A;  3F2U A;  2F0L A;  3C1F A;  4Q5V A;  1SND A;  4PV1 C;  1TWC B;  1SYE A;  2BDO A;  3DWQ A;  1V8Q A;  3I4L A;  5DM6 3;  4TRD A;  2KEE A;  5KGU A;  1STA A;  2EYP A;  3NQI A;  1IKL A;  1QB5 D;  4FO2 A;  4K5W A;  1A6X A;  2F0T A;  1JR0 D;  1ZKO A;  4H13 C;  1LTB D;  2IWH A;  5EBC A;  1S5F D;  1BDO A;  2B8G A;  2Z1C A;  2KEC A;  4KMU C;  1Y1W B;  1I4X A;  1TY0 A;  2Q8R E;  3BDC A;  1RHP A;  2WAQ B;  4QF4 A;  3MXN A;  1G8Z D;  1WD0 A;  4K8I A;  1RTO A;  2WKD A;  5JPN C;  1STE A;  3Q22 A;  4OIK A;  2GA4 B;  2KCC A;  1U4P A;  5JJZ A;  2F0S A;  4HSP A;  4FF2 A;  1VF5 C;  4IFD J;  3A8J E;  4I7Z C;  4K2K A;  3E6Z X;  3BZD B;  3ND8 A;  1YNN D;  1C8C A;  3NSW A;  5CR3 A;  4QB4 A;  1BXT A;  4F7X A;  1Q3L A;  2NUC A;  4RCO A;  2AQ1 B;  3I90 A;  4DK0 A;  1SNQ A;  4ZKC B;  2EJM A;  1SYD A;  4K5X A;  1ZYR D;  1PYW D;  2NZ1 D;  3EJI A;  1G2S A;  1WD1 A;  1QG7 A;  4EVO A;  2K1B A;  3HRZ C;  4C1N K;  1Y69 U;  1GUG A;  4L6T B;  1EYC A;  3Q0A A;  1BCP F;  3K5O A;  2AQ3 B;  4KY7 A;  5C4Z A;  4XTC S;  2X69 A;  5I2Y A;  3M85 A;  2I46 A;  1KLG D;  4HAE A;  1TY2 A;  4CKB A;  1SNP A;  1T5X D;  4ZK9 B;  2ICI A;  3TN2 A;  3M7G A;  1BBX C;  4U67 3;  1I4P A;  4N9T A;  4FF4 A;  1PZJ D;  4X3S A;  4IUP A;  2D5D A;  3Q24 A;  3DMU A;  3T13 A;  2F0F A;  2R3Z A;  3MZ5 A;  1SNO A;  1SMY D;  1KDA A;  1B50 A;  2F1M A;  2RSO A;  1WTX A;  4PMW A;  5C0X G;  1WTW A;  3I73 A;  3FEW X;  1FGB D;  4IZ8 A;  2XN9 C;  1I4H A;  1A3T A;  4FP5 D;  3TZD A;  2WII B;  4CJ2 C;  4R9W A;  4C3H G;  5F2D A;  4G7O C;  3J80 E;  3MC0 B;  3K5N A;  2B8F A;  5I2X A;  3GO5 A;  4C3I B;  4G7H C;  3DWA A;  3VYR A;  3CRL C;  3SK6 A;  3JAM E;  3VA7 A;  3BG3 A;  2NVT B;  2SNM A;  2F0V A;  3NXW A;  2IX0 A;  2AUK A;  1SJE D;  1V43 A;  1TR5 A;  1FR3 A;  2K7V A;  3C46 A;  1GHJ A;  2K6A A;  3MFG A;  1C4Q A;  1Y1V B;  3EA6 A;  4HED A;  4HMI A;  2F4I A;  1MGS A;  2R61 A;  2DNC A;  4PNY A;  2YYZ A;  1TQO A;  1CHQ D;  2JYO A;  2A5H A;  2CHB D;  5FO7 B;  1F9Q A;  4NDX A;  1I50 B;  4U68 A;  1PXU A;  1LAC A;  1LT5 D;  1ENF A;  2IT1 A;  3GV6 A;  5DNF A;  4IFD I;  3U9S A;  3TBI B;  4ID6 A;  3S2H B;  1H9S B;  5ISR A;  1BCP D;  1MD2 D;  3EVQ A;  1CK1 A;  5CV8 A;  1CM9 A;  4OO1 I;  1O7Y A;  4L63 B;  3BVM A;  1OXS C;  2F0N A;  2HUG A;  3M7N A;  3MFY A;  2A74 C;  4RHS A;  1SNC A;  1NAP A;  3HOW B;  2M00 A;  1CHP D;  4CJ0 B;  4M1U B;  3GD7 A;  3J7A V;  3OOC A;  3OIQ A;  4G7Z C;  3OMC A;  2PZW A;  2EYH A;  2BE5 D;  4C56 C;  2AQ2 B;  2RDG A;  3HP3 A;  3H3V C;  3T16 A;  2K32 A;  1ENC A;  2E2H B;  1S5E D;  1G29 1;  3IFT A;  1H9S A;  4V19 0;  2EPB A;  3L9A X;  4IAL A;  1F2Y A;  4ZKB B;  5EPK A;  5K5P A;  4S3S A;  2QDB A;  2O5J C;  3BYY B;  3C3L A;  1EYD A;  3SK8 A;  3KLS A;  1EIG A;  1W6J A;  2ZXP A;  4HR7 B;  5FOB B;  5E3F A;  2B2U A;  1I3Q B;  5C5L A;  5FO9 B;  2V4D A;  3VYT A;  1QWY A;  3I4N B;  1A15 A;  2R92 B;  3SDZ A;  1TS3 A;  1I4G A;  1VF7 A;  5HUR A;  4BBS B;  2K5W A;  1GUT A;  2F03 A;  4X3K A;  2SDF A;  1C48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...