4ZUIA

Crystal structure of staphylococcal nuclease variant delta+phs v23h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTHKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zuiA00
4S3SA 1EY7A 2F0HA 3ITPA 3P1HA 2PW7A 4K8JA 4NDXA 3T16A 3TMEA 5CGKA 5CV7A 4KD3A 4KJOA 4WRDA 3TP6A 3D4WA 1A2TA 2F0TA 4K2LA 1NSNS 1EY4A 2EY6A 2PZUA 2RDFA 2PZWA 1EQVA 1EY8A 3D4DA 4IZ8A 1KDCA 1EZ6A 4EVOA 5IOCA 5J39A 1JOKA 1AEXA 5C4ZA 1JOQA 4KTAA 3BDCA 3DHQA 4KD4A 3R3OA 1ENAA 4KY6A 3P75A 4NMZA 5CV6A 5E3FA 4N9TA 5IGEA 3NHHA 3D8GA 4TRDA 5CV9A 4R8NA 5I6WA 3SK6A 5KRUA 1SNDA 1STAA 1STBA 1SNCA 1F2MA 2F0UA 1A2UA 2EY5A 2F3WA 2PQEA 4K6DA 4K5XA 5F2DA 4ZUJA 4K5WA 5C3WA 1NUCA 5K5PA 1TR5A 1EYCA 5I9PA 2EYOA 5JOBA 2EYLA 5HGTA 4DGZA 4MIUA 2F0KA 2F0VA 2PZTA 3SR1A 4K8IA 1F2ZA 2RBMA 5NUCA 1STNA 1STHA 2F0PA 5M9OA 5C4HA 2SOBA 3C1EA 2RKSA 4PNYA 2F0FA 5EKLA 5HURA 3NK9A 4OL7A 5J1ZA 1EY6A 5IIFA 2M00A 3D6CA 3E5SA 3PMFA 4QMGA 3NP8A 3MXPA 4G57A 3NQTA 2EXZA 3SK4A 2PYKA 5CV4A 4QF4A 5DEHA 4RKLA 5C6AA 3HZXA 2F0MA 4HTHA 4DU9A 1KDBA 3QOJA 1STGA 3TP7A 4EQOA 3MVVA 3SHLA 1SNOA 4PMBA 3EVQA 3SK5A 3H6MA 1JORA 1F2YA 3OMCA 2SNSA 1JOOA 2EYPA 2EY2A 4DFAA 4E6IA 5IGDA 1TQOA 4K5VA 3TP5A 3RUZA 2F0WA 3SXHA 1SYBA 3U9OA 1SYCA 2F0OA 3C1FA 3MZ5A 1SYFA 1A3UA 5CV8A 5KYLA 2O4XA 4HMJA 1KAAA 4KV6A 5IGBA 5CR3A 4B9XA 3DMUA 2PW5A 5EKKA 5C5LA 2EYFA 4F8MA 5JAVA 1IHZA 1STYA 1SNPA 1SYDA 5ISRA 2EY1A 4WORA 3SK8A 3EJIA 2OXPA 4ODGA 5E1FA 4KJNA 5KIXA 3HEJA 2WACA 1SYGA 2EYHA 3EROA 3MEHA 1ENCA 4N9PA 5KGUA 1KABA 4ID6A 4EQNA 2F0DA 5IGCA 5CC4A 4KHVA 5I6YA 2ENBA 3VA5A 3QOLA 5EGTA 2F0EA 3OSOA 5C3XA 2OF1A 3QB3A 3S9WA 4LAAA 1EY9A 4PMCA 1EY0A 2KHSA 5J22A 1A3TA 2F3VA 3BDLA 3NXWA 2F0JA 1TT2A 2KQ3A 4ME5A 1EYDA 4YIJA 1EYAA 4B9WA 1A3VA 4KY7A 4H7BA 1SNMA 3LX0A 4K14A 3ERQA 4QB4A 2F0GA 4K2KA 4NP5A 2EYMA 3OWFA 4I65A 2QDBA 1EZ8A 3MHBA 2F0QA 4HMIA 4IUNA 4EQPA 4DF7A 4IALA 2F0IA 2LKVA 5KYIA 5IODA 2F0NA 3T13A 1II3A 2F0SA 3V2TA 2HQEA 5KEEA 3NUCA 2F0LA 4F7XA 5CV5A 5C5MA 5IGGA 5I9OA 1RKNA 2OEOA 4KY5A 1KDAA 4J6HA 1EY5A 1SNQA 2SNMA 3OMGA 4RKBA 5DAUA 4NKLA 4ZQ3A 5IGFA 1U9RA 4ZUIA 3TP8A 2EYJA 1SYEA 4J1MA 2NUCA
chains in the Genus database with same CATH superfamily
5M5YB 3GTMH 3A5ZB 2VQFL 2KEEA 3A7AB 3TMEA 1Y69U 2LY7A 2M9VA 1VQHA 4XQQA 4C1NK 1C8CA 2F4VL 1K8OA 3HOYG 4FNFA 2CW0C 3R2TA 4UAIA 1EZ6A 2V4DA 4G7ZC 2JA7B 2ID0A 1D6EC 1STEA 3IL8A 4KKTA 2MP1A 4PG3A 5I6WA 4DA2A 1SNCA 4DKAC 5BN4A 3S1MB 3FEWX 4A3JH 1EYCA 5JOBA 4X64Q 2NTSA 5IYCH 1I4HA 2K14A 4JI8Q 1L1OC 1QJOA 5M9OA 5C4HA 4AQYQ 3L2PA 1LLRD 1FGUA 1EY6A 4JW0A 2JA5G 1KNAA 4C3IB 3NTHA 4P2CB 3RZDB 3J80E 2SNSA 1XPUA 1TY0A 1S72A 1DGSA 1SYBA 4FYDA 3FKIB 4KV6A 4R4OA 1BOSA 1RTOA 3U58A 2NZHA 1JB7A 4LF8L 4A93H 3EJIA 1YHAA 2B2VC 2EYHA 2NTTA 1ZYRD 4KLKA 2QEXA 2K01A 4N9PA 4ID6A 3BS1A 2ES2A 5C4JB 4JI3Q 1ZYRC 3BDOA 1EEFD 3TSSA 5C44H 4R8IA 3OSOA 1F9RA 1XMOL 1VQPA 4GN3B 2EE1A 1BVSA 1SDFA 1JC7A 3LNNA 2TSSA 1IW7C 1QVFA 2KQ3A 1IL2A 4GOPB 1BDOA 4A3KG 1QNKA 2A69D 2WFWA 3ERQA 3CP0A 1T9HA 2QDBA 4ALPA 2UXBQ 3MXUA 5EKIA 5KYIA 3G71A 3WDNA 2R7ZG 3CCSA 5EPKA 4BBRG 2AHOB 2XRSD 4X64L 1QWYA 5C4XH 5LMNW 3F2BA 2IX0A 1XJVA 1PFMA 1EWIA 2OEOA 3NPPA 4GKKQ 1H9MA 2PMZB 4ZUIA 5EQ0A 3LGJA 2P5ZX 3WOEA 3ITPA 2F0HA 4IUTA 5LHY1 3V96A 2HT1A 3A56A 2CFMA 4DR7Q 4EQ5A 2F0TA 1D1IA 1O7ZA 3ICEA 5M5WB 1FNUA 1EY8A 3K7AH 1LACA 4G7OC 1Q8IA 2Z6KC 4BBSH 4KTAA 4H44C 4LFAQ 3T4AC 1ET9A 3NHHA 4ILWA 5C0XI 2CW0D 1SNDA 1STBA 2PQEA 4K5XA 4OEMB 2YYZA 1VQGA 2NB0A 1TWAH 1TR5A 2Q2TA 5C4XG 2E2HH 3I2ZA 4TKOB 5T1GA 4DXGA 1V1OA 4JYAQ 3HKZB 1X65A 2R7ZH 2RBMA 1YJWA 4GN5A 1GUGA 1W6JA 2R7DA 4X62Q 4LFAL 3C1EA 5C44B 1BF4A 1LTGD 3GTLB 1A6XA 5J1ZA 4DAPA 3D6CA 3DEPA 2B63H 4DV6Q 4XQNA 4QUFA 1PRTF 3H3VH 1VQBA 1JT8A 5IP9G 1C0AA 4EGVA 1KLUD 3AMUA 3OMCA 4DFAA 3CMAA 1ILPA 1ENFA 2F52A 2F0OA 1AZQA 4A3IH 1VQ9A 1EOVA 2CH4A 2DGYA 2O2LD 1KAWA 1EFWA 5C5LA 3D31A 1VQOA 1HUMA 3W1GA 4HIMA 2OXPA 1NTGA 4HCEA 4DNIA 4OHJA 4DR4Q 2D0OA 4IN3A 4JG2A 4KHVA 3QOLA 5IWAL 3NQIA 3F2DA 2K32A 1YJNA 3OW7A 4JI0Q 2L5TA 3VR6A 2O5JC 1EY0A 1WTVA 1LT3D 1B7YB 4Z9CB 3RN5A 1JWMD 1XNQQ 3FVQA 1FR3A 4BBSB 4C3IH 2VQEQ 3AB9A 4B3SQ 1XTDA 4HMIA 2VXWA 4ZRZA 5M5XB 1KC8C 2ZXOA 4HIOA 4LF7Q 4A3GB 3TREA 5K36G 2JK8A 3NTIA 5FLXE 4EX5A 3NUCA 2PO4A 4JVZA 3HOVG 1RDPD 2A6EC 2K75A 5CORA 3J81j 1RKNA 1KDAA 2ZXPA 3JC66 5ELDA 3K81C 4GLVB 4S3SA 4BY7B 1K8AC 2B63B 1HNXQ 3VYSA 4HJ7A 3PF4A 2VQEL 4KHPL 1NSNS 2Q2HA 2DY7A 1UE6A 4BY1G 1K83B 3OTOQ 1DYQA 4A3IB 4RG1A 2H1EA 5ELBA 2JA6G 1PH4A 1EU3A 4BWGB 3S16H 2VB3X 3WWVA 1LV9A 1I50B 1MKHA 4CHTB 4IOCA 1TWFH 4AYBB 2Z6BA 2AWOA 1CKMA 3SE0A 5LMNQ 3NP8A 4YHHL 1W3SA 4DNTB 2A73B 2MO0A 3S2DH 2B2VA 5EPLA 4EQOA 1SNOA 4YWLA 5IT9L 1TQOA 3GTOB 5BN5A 2WKCA 1I6VC 1E22A 1LT4D 1KAAA 2RF4A 4A3MH 1XXGA 4F8MA 3HOVB 3A7LA 2DJFC 4FP5D 1EL0A 2K04A 4JOIC 1X54A 1WI5A 1YZ6A 4APVA 1T5EA 3TZDA 4CKEA 2IX1A 2WAQB 3PO3G 2E2HB 2AQ1B 1F9SA 1PH7A 2KEDA 1BO0A 1CHQD 3TBIB 1NY4A 5DM73 4O0AA 2N8NA 4GLXA 2CHBD 3CCVA 1WTWA 2MGSA 5JJZA 4IFDJ 4DR6L 4FF4A 2B2WC 2FXQA 1CSPA 3ULPA 1N9WA 1D2BA 4DR7L 2B2UA 4ZK9B 1QG7A 1Y1WB 2F0IA 4MZ9A 1II3A 1BCPB 5EBCA 3N6RA 4ZAIA 4JOIA 1SE8A 2VB2X 1W2BA 5C5MA 5D14A 1L2FA 5DM63 1G291 1SNQA 3ND8A 2WINB 2NUCA 4A3BH 1FD7D 1YNJD 3K5LA 5LL6X 5EJWA 1A2TA 1EWHA 5JJLA 4XT1B 5FLXc 1SLJA 4NW2A 1EWCA 4QL5A 5C44G 3DUZA 1YEZA 3K0YA 5CV9A 3W3AA 2JSOA 2UUBL 1AZPA 2K5DA 3CRLC 3MTSA 5C4JH 3HOZG 4GLAC 2EPBA 3X3NA 1Y8PB 1DZ1A 5BN3A 2HQLA 3J80L 1Z6HA 2L0CA 4JI3L 4M8AA 5H1SE 1PH2A 2A69C 3E9HA 1R9TB 3ULJA 4LF6Q 1SBBB 3MXPA 1SR3A 3NQTA 2HIVA 3H91A 4RKLA 2QA4A 3EFXD 1KDBA 1B50A 3H15A 2RSOA 4LK1C 2D0PA 3P7JA 3HOUH 3RUZA 1PFNA 1GJXA 1N34L 2MHVA 4XQJA 3GD7A 4DV4L 1SEBD 1OXTA 3T1HL 3C2PA 4P75A 1Y1WG 3S1RB 1D5XC 4DR1Q 3CQZH 3BU2A 3Q6SA 1GUOA 2L55A 3KLWA 5CBAE 2A8VA 3HOWH 2CWPA 3BZCA 1EQRA 2A68D 3BVMA 4RCOA 1ESFA 1T5XD 3N52A 1X32A 2F3VA 1MD2D 2RHQB 1LM0A 4A3LG 4Y52H 4RHSA 2B2YA 3GTPB 3R93A 4A3IG 4H7BA 3LX0A 4K14A 4H13C 4IFDI 4HEDA 1B2TA 2PPBC 2VQFQ 2A1AA 4RWSC 2LKVA 3T13A 4KK7A 1B8AA 2BH8A 3M4OB 1EU4A 2CKZB 3KK7A 3OTOL 1JJ2A 4GNXC 2BA0A 1TU2B 1PYBA 1SYEA 4P72A 4J1MA 4K8JA 1X56A 4HIDA 2TMPA 2AKWB 3GTJB 2VNUD 1AP0A 2UUCL 4OWXB 4MTNA 3ZJYC 1JOKA 5J39A 1M8AA 4NMZA 3VR2A 1VQMA 4B3RQ 4XDXA 3FHWA 1CK1A 1HNZL 5IY0A 1ASZA 2OQ0A 5KRUA 2I5LX 2NN6I 3CCMA 5C3WA 4JI7Q 2O5IC 3FP9A 4IFDH 4AQYL 3S1QH 4OO1G 1VQJA 2EYOA 1IBML 1HCZA 3A8JE 4P74A 4K8IA 4IUQA 1XNRQ 5JPNC 3MXNA 4JI1L 3HOVH 1VMCA 1YBYA 1TIID 4YCVA 1XPRA 5CV4A 4FDBA 1HA6A 4OGQC 3QOJA 1VQDA 1K0SA 3MVVA 1O80A 5HY6A 5D65A 1LYLA 3KF6A 3TP5A 1U0LA 3I7FA 4LF9Q 1VQNA 4DV5L 5I4DA 3L3OC 1Q7YC 1L1OB 1AE3A 2O4XA 2K05A 3A0JA 4HMJA 4A3JG 5IGBA 1F2LA 2B39A 3FPUB 5ISRA 2JEBI 3SK8A 3J80c 5E1FA 1C9OA 1RD9D 4XIGS 2NBFA 2N55A 4LUOA 1SJHD 3G6JB 1SAPA 2B2WA 2XGTA 4QJFA 5ELFA 3KJOA 2ZJQA 2KENA 4A3CH 3NSWA 1A62A 1HPCA 3RLNA 1JB3A 1B53A 3PIPA 2MFIA 2A74C 3I4NB 2KHSA 4F87A 3I4OA 1O7LA 3T53B 5TSSA 2J4XA 2L11A 1VF5C 1I6HH 2E75C 2UUCQ 2VUMB 2I46A 4B9WA 5JEAH 4I7AA 2Q8TA 1HXYD 3E3XA 4MTKA 1B4OA 1GHKA 4NB3A 1IL8A 1Z47A 2F0NA 4PZ8A 4X3KA 5IODA 5ELEA 3MWYW 5KEEA 4LF5L 3M7NA 3OHXC 3UDFA 4NXNQ 3PO2H 3HS0C 1G6PA 2Z0SA 2Z4IA 4ZQ3A 4J8QA 4CKCA 3TP8A 1Y1VG 2L12A 1N34Q 4P71A 1H9KA 3G4SA 1BKBA 3UE1A 1Y14B 2PW7A 5FO7B 5IYCG 4Q0FA 1SE2A 4WRDA 1KRSA 4A76A 1GD7A 1HJPA 4A3FB 2YU9H 4ZKCB 5JEAG 1XMQQ 2PCFB 1NE3A 4C3JB 4GKKL 3MXGA 3CCQA 3KBGA 1LO5D 4X62L 2B8GA 4KY6A 1H9RA 4CJ2C 4IJHA 4LMQD 5M5XH 1R4QB 1DD2A 2Y0SE 4UPAA 2VZAA 4KI0A 1QZHA 2XVSA 2R3ZA 4C2MB 4IURA 4LFBQ 4GKJQ 2PI2A 4U673 1F2ZA 1D7QA 2K52A 1PH8A 2IHEA 1LTBD 2XWBB 2A19A 1TS2A 2CCZA 4A3DH 2F0FA 5HURA 2Q2UA 4ZYSA 2PI2E 3CPFA 3T51B 1HFNA 1G2TA 1N32Q 4BBRH 4QMGA 3S15B 4QCLA 2KUMA 3CMEA 4DV0L 3Q0AA 1I6HB 2EQSA 3ZYYX 2L9HA 3OOCA 2RDHA 3MXNB 2CWAA 2PNRC 3T56B 1BBWA 4J15A 2H5XA 4JI6Q 4B3MQ 1PZID 4X66Q 1S5BD 2SDFA 4L5TA 4FF3A 4X65L 2K03A 5IYBH 2A68C 2MO1A 2VS1A 1CKOA 1GUNA 1G51A 1H9JA 1IYVA 2NZOA 5IGCA 1Y8NB 5DLQE 3S9WA 2E2IH 4JBJA 4C3HG 3HGBA 4RFBA 5E7NA 5M5WH 1BBXC 2BE5D 3TN2A 3S2DB 4OO1I 1E24A 2I0QA 1EYDA 4KY7A 1PYWD 5DNFA 4XTCS 2JA8G 1NJIC 2XIWA 5LL6S 3RZDH 3H94A 4A3MB 2F0SA 2KOLA 3J81L 3AYHB 2JA5H 3SVMA 2ZXRA 2KCMA 4GNXA 2G9HD 3FKIH 2D2CC 3F2UA 4FXGC 2KA7A 3OMGA 4L63B 4PZ7A 3JAMi 1OXXK 3GTKH 3UDIA 3S15H 1ZEQX 1LTID 3J7ZC 3W2DA 4IUUA 4YCUA 3GTQB 3M4OH 2I5HA 3S2HH 5C4ZA 4RGTA 1JOQA 3DHQA 4HSVA 1NR2A 2PNHA 4N9TA 1WD0A 4JV5Q 3D8GA 4IPCA 4UP9A 3TZUA 1ML0D 2Z6KA 1A0IA 2F0UA 1A2UA 2PQAA 2BDNA 2ZJPA 1VS0A 2UXBL 4IJLA 2EIFA 1HZBA 1D5MC 2IHFA 3QJYA 2XSCA 1VMPA 5GAEC 1FJGQ 4ZKBB 4B08A 1X3QA 1Q86C 4QUCA 1MSGA 2M2LA 4RA8A 4A93B 2KBNA 2RVLA 3NK9A 3TS0A 4RGNA 3PMFA 1NMGA 3KYHC 4G57A 2WIIB 1LABA 5DEHA 4XT3B 5IT9E 3Q23A 3S1MH 2ICIA 3GO5A 1L0WA 2C35B 4A3JB 4UHVA 1E2WA 2VW9A 2NN6G 4C3HB 5FO8B 1X3PA 4B3TL 2DNEA 3U9OA 5LMUL 1DCZA 3QIAA 1IKMA 2WKDA 1IKLA 3CKIB 3K5OA 4DAYB 5FJ8H 1E0BA 4LUZA 1FVIA 2JXMB 2Z9HA 3PIO3 4KJNA 2J0TD 1ENCA 4GS3A 1CFMA 3E9IA 3CC7A 3HOZH 2UXCL 1XTCD 5G3LF 3VA7A 1XYIA 3VA5A 1IBLL 1QUQB 1WTHA 5C3XA 4B3TQ 2X6GA 3F2CA 1DOKA 2X69A 3KDFB 2IWHA 3W5OA 3BDLA 2HCCA 3RD4A 2FJ2A 2UUAQ 3HOXH 1XMQL 3IAYA 4LF6L 4OWWB 1A3VA 5IYDG 1WTQA 4B3RL 3J7AV 2F0GA 4K2KA 4A75A 1I3QB 2B2TA 4LF4L 2F3IA 3DWPA 3M9BA 1PRTB 4A93G 3OWEB 4I7ZC 2EDGA 1JWUD 3CC2A 4X3UA 3I4NH 3FMCA 5G3LD 1X9NA 4CGYB 5M3MB 1NNXA 2XWJB 3OIQA 4GN4B 2VL6A 2ATWA 1UUPA 2L15A 3L9AX 1EY7A 1JE5A 1JE4A 3I73A 1CKNB 5GROA 3I72A 4LF5Q 2PZWA 4DV1Q 1L0XB 3P75A 4JI7L 1CKNA 3CCUA 1K8GA 1LTSD 4MN3A 4K5WA 5BR8Q 5GQOA 5I9PA 2DN8A 2FHTA 2EJGC 4JCVE 2F0PA 2G9DA 1PYSB 2N3SA 4C3JH 5EKLA 2A6ED 2HDMA 5IIFA 4YWKA 5COYA 1YITA 3GTGB 1NAPA 4HN7A 1VQ7A 5FK9C 5FO9B 1Y8OB 1VCIA 2A6HC 3GTJH 3EVQA 4DUZQ 4POGA 2OQKA 3Q22A 2K28A 1OTCA 3S1NH 1QVGA 1B70B 4HJ9A 1JJCB 2PW5A 3D6WA 3FRPB 5JAVA 3TQYA 1SYDA 1VF7A 4BY1B 1Q12A 1NBWA 3J7A5 4NXNL 3RNUA 4CDEC 4WFN3 1TWCB 3RR5A 3T1YL 3F8TA 3ERSX 1FYCA 1HTPA 1AH9A 3S16B 2B2UC 1M4VA 4XXEA 4DAYA 5JVG3 4N8X1 1MJEA 4DPGA 1A3TA 3S24A 1QE6A 1EOTA 4HCSA 1D5ZC 1ZKOA 1TWHH 1CZGA 2R6GA 4DN4M 3BJUA 4QB4A 2JA7G 4IUNA 4WJ3M 3VR4A 3L0OA 5JJKA 3CCLA 4C2MH 3DWQA 1UE1A 1I3QH 3PUYA 1HZCA 3C3LA 1Q82C 4Y7NH 2KCCA 1BCPD 3SGIA 1UNSA 5D3IB 4R4CA 3J81E 4KY5A 4A3EG 1Q1BA 4X3SA 3MAQA 2SNMA 3E0JA 3OIPA 4ABNA 1U9RA 3M4YA 1EIFA 4H0LC 3IRBA 4B3ML 3KJPA 1LTLA 2YU9B 2ZM6L 4KJOA 4DR2Q 2LSSA 3D4WA 4C3IG 1EIYB 5IOCA 3AEVA 3BDCA 5CV6A 3KLSX 5JEAJ 4R8NA 5CBEE 4DK0A 1RIPA 3MFYA 1SMYD 2OTLA 2KCTA 1V9PA 3PQIA 1HH2P 1I5FA 3U4VA 2JYOA 4V0BA 1O7YA 1VQEA 3PF5A 3PO2B 1STHA 2AWNA 2WAQG 4R4TA 2UXCQ 1K83H 4OL7A 1PH6A 2C9OA 4A3CG 3HOYB 1B3QA 2PYKA 5IT9c 1HR0Q 2F0MA 1NCVA 4G4KA 4HTHA 4LUVA 4PV1C 4TVAB 5AJ3Q 2EYPA 2NZ1D 3UI2A 3DM1A 5C3EG 5KYLA 3JAMc 4L5QA 3I70A 1STYA 1SNPA 1K3BC 4JI4L 4Y7NB 3M3YB 3GTKB 2GA4B 2JA9A 3H3VI 1PDQA 1Q81C 5I6YA 4JI0L 2WAQE 2G5DA 4L5RC 5M5YH 5JVH3 3QB3A 3S2HB 1GM5A 1OXUA 2OT2A 3PIOA 1NMFA 1EUJA 5M3MG 3AQQA 4O42A 4YIJA 1N32L 1I4XA 3WOFA 3J7AF 4IFDG 2EYMA 4WJWA 1LTTD 2WB1E 2SEBD 4MHEA 1V43A 2YV5A 2KHJA 3D3RA 1K73C 4A3GG 1PTOD 1O7IA 3QG1A 1SFOH 5CYUA 1TS4A 1LT6D 1WTOA 3S1QB 2F0LA 4F7XA 1J8IA 3DEOA 1Z9FA 1P8LA 2ICEC 5IGGA 3OW2A 3HRZC 3V05A 1AE2A 5DAUA 1EY5A 2D62A 5IGFA 4DV4Q 2E2JH 2EYJA 4AYBE 1RODA 1S3OA 2K5NA 1PRTC 4L6TB 4X6AH 2J7ZA 2AQ2B 1YNND 4GOPC 1UWVA 3PGZA 3TP6A 4RH6A 3GTQH 1SMYC 3D4RA 2RDFA 4IZ8A 5GADC 3H3VC 2DJGC 1KDCA 5A2QE 4JV5L 2AUKA 2PMZE 4YCWA 5JJIA 1SRUA 1ENAA 2Y0SB 1VQAA 2JEAI 2JP1A 3C46A 1MIUA 2QEJC 2IX3A 4LFBL 4QQBX 1STAA 3EQLC 4RHRA 2IPKD 4K6DA 5F2DA 2R7FA 1HNWL 1ILQA 3NWSA 5HGTA 1YJ9A 2MUYA 4LFCQ 4A3KH 3HOUB 1JR0D 2F0KA 3DXJC 3I4MB 2I07B 4DV2L 3OPOA 3U50C 1CHPD 4JC0A 1EEID 3HP3A 4PMWA 2DY8A 2MPMA 3PUZA 1M1KC 3RZOB 2JN4A 5GAGC 2HD3A 1IZ6A 3HZXA 4YY3L 1SJED 1U5KA 3HKZE 2IJ0A 1SSOA 3KLSA 1TS3A 2QDLA 4C3HH 1JJGA 1V1QA 4JI5L 2NVTH 2QGQA 3CHBD 1E7ZA 3KOJA 1DXMA 3VYUA 2F0WA 2MQHA 3C1FA 2Q8IB 5I2XA 1O78A 5CR3A 5M3MH 1BNZA 3K6OA 4AH6A 4CJ1B 1TS5A 1B3AA 3GV6A 3UDXA 3HEJA 3CF5A 2WACA 1I4QA 3VR5A 4XYOA 4A3FG 2K4KA 2WP8J 1I4PA 3NWTA 2KHIA 4DV7L 2OF1A 4QGUA 1NR4A 1QVCA 2YTYA 3HOXB 1YVCA 3NXWA 2FMCA 4OO1H 3G6EA 4BS9A 4BA1I 3HOYH 1JWSD 5EBDA 3FPPA 3MFGA 3UE0A 1HR0W 1C48A 2A6HD 3K0XA 4R4QA 2K5HA 3Q8DA 1VQ4A 3CCEA 4J6HA 3STBD 3HOZB 1TWHB 3H09A 2MJ8A 1KQSA 1A63A 2XN9C 3RZOH 4LJZC 5CGKA 1PV4A 4K2LA 2EY6A 3S1NB 5EPJA 2JA8B 1Q90A 1BUVT 4JI1Q 1R4PB 2UXDL 2LXJA 2B63G 1RL2A 1YNXA 4YHHQ 3L7ZC 1S5DD 2E74C 1PLFA 1BBUA 3STBC 4ZUJA 1OXVA 4DNRB 1SXTA 5C0XG 5FJ8G 1BCPF 4KN7C 2QCPX 1AW7A 2B2TC 3S17H 1HZ9A 1MHWC 5HGQA 3URYA 1WD1A 3Q24A 2SOBA 1N33L 2R7ZB 2B2YC 4QY7A 1CI3M 3LWEA 4R4IA 4Q5VA 3FDTA 4X3TA 3HG9A 4LF7L 4YWMA 2UXDQ 4K6LA 5ELOA 1STGA 2R93G 3SHLA 3JAML 4DR3L 4V190 4ME3A 1XPOA 2NWGA 1AN8A 1SYFA 1IXRA 1DM0B 3EBEA 1WTRA 2OTJA 2LFNA 4GKJL 2WB1G 4OELB 4AYBG 1L1OA 1U4PA 1G8ZD 2HCIA 4OX9Q 1IBKL 2F0DA 5D3DA 2ENBA 5EGTA 4R1JA 2K5VA 1DOLA 1HQMC 4LAAA 5C4XB 2LS01 1KHIA 2K33A 3QWNA 1EFID 2Z4HA 2R93B 1EYAA 1A8VA 4RGMA 1SNMA 2OWOA 2IL8A 4I65A 1L0YB 4EQPA 4C3JG 1KRTA 3GQBA 1HZAA 3U4ZA 1QNUA 2CQAA 3K7AB 2E5LQ 4JBKA 4MNOA 1XWEA 4OX9L 3PV0A 5CV5A 4JI2L 1ICWA 4IPHA 1WVLA 3SEBA 3S17B 4C1NI 1E2VA 1QCBD 1WTXA 1TWFB 1RJTA 1PH5A 2JJQA 1I4GA 1J6QA 4DK1A 1CA6A 3KLRA 1JQYD 2LXKA 1VQLA 3S14B 1HNWQ 3TDQA 1WFQA 3NBIA 1H95A 2ALYB 2V1CC 2UU9L 5BR8L 3R3OA 4PQXA 3R8BA 1GKHA 5IGEA 3AFPA 1F2MA 4M1UB 4NXMQ 3I4NG 4C56C 2ZTEA 3J7YW 2ZTCA 2R92H 1AFPA 1PTOC 1XMOQ 3NENA 5NUCA 2D5DA 1P16A 3DWAA 1YHQA 1B44D 4O2DA 1PHJA 2K6AA 3E5SA 1IYUA 2E2DC 2EXZA 3IFDA 2XTIA 2QF7A 1F9QA 5C3EB 2C5CA 3TP7A 1LTAD 3T1YQ 2JA6H 3SK5A 4JBMA 4DV5Q 4E6IA 3MA2B 3CW2C 4HJ5A 1GXDC 2H4OA 2RA4A 1A3UA 1D8LA 2BE5C 4IO9A 1PVOA 1B9NA 4B9XA 1GVPA 2F4IA 2EYFA 5JPMC 3PUXA 1S5ED 1WCMG 3PSIA 2A5HA 3U9SA 3H0GH 4CBVA 2EY1A 2K5QA 4WORA 4ZCKA 3EA6A 3NTKA 1SYGA 1CUKA 3E0EA 4JI6L 1ICFB 3CCRA 1SN8A 4A3DG 2RCNA 1VQ5A 2F0EA 4A3BB 1EIHA 3K8AA 2UUAL 2K5WA 1Q3LA 1DONA 4OXPA 3VDYA 3X3MA 1VQKA 1BXTA 5AFWA 4B3SL 2RSNA 5C0XJ 1TY2A 4K0KQ 2UUBQ 1RCVD 1GUTA 5L37A 1TVXA 3I55A 1CM9A 4A4IA 2R93H 4WJ4A 1MJCA 3H0GG 4X65Q 2EXDA 1Z7TA 4PZ6A 1Y1WH 4DR3Q 1S5CD 2K50A 4LFCL 2EOTA 5T1IA 3TS2A 3KBXA 3HKZG 2E2JB 2JE6I 4IPDA 3EN2A 4KHPQ 1M90C 1J5EQ 1F9PA 2D9UA 5IYBG 1N33Q 1E2ZA 4GZYC 4TQUS 2NVTB 5CV7A 1X55A 4DV6L 4KD3A 1EY4A 2R61A 5C3EH 2JA5B 2CVRA 4TRDA 4TSSA 3RN2A 2F4VQ 1EIGA 4DR6Q 2EY5A 2ZM6Q 2RCFA 2B3GA 2EYLA 4MIUA 4HSPA 1TWCH 2EJFC 3CQZB 4A3DB 4KKSA 3RLFA 1STNA 1B1ZA 2FFKB 2HHHL 2JA8H 4JBWA 4PNYA 4BBRB 5A35A 1KTKA 3KUPA 1KIXA 4HJ8A 3SK4A 1ZXTA 3KF6B 5M3FB 2HIXA 1X3GA 1K28A 4QF4A 4DUZL 1I94L 1PH3A 4POFA 3GTGH 2BH2A 4A3GH 4PMBA 3H6MA 3GTPH 1F2YA 4FXKC 1EQQA 3S14H 2JA6B 3JAME 4A3EB 1HUNA 3MEFA 4DR5Q 4IUPA 1MBYA 5KNBA 4X66L 4BY7H 3H0GB 2RQXA 3D0FA 4DK6C 5KGUA 4LWCA 1FL0A 1MGSA 5CC4A 4DR1L 1VQ8A 3PO2G 4NXML 2R92B 3HOWB 1CTMA 1PTOB 1FGBD 3E6ZX 3QR8A 3GTOH 1UE5A 2KCNA 1DJRD 3BZKA 2NVXB 4FO2A 2L4NA 4YY3Q 1S5FD 1JCKB 2AQ3B 1GUSA 3O13A 5LMUQ 1R9TH 3NELA 2JA7H 3NEMA 2NN6H 1HQRD 3KF8B 3M4PA 4NP5A 1EZ8A 3MHBA 1DOMA 4CDCC 4DF7A 1PZKD 5GAHC 1BR9A 2QKIC 3RLOA 4JI8L 1HTLD 4JI4Q 1IW7D 2HQEA 3PUWA 5E4WC 1CSQA 1PMRA 1ESRA 2NVYB 2GN5A 4DV3Q 4OWTB 4LF9L 1K3RA 4DXFA 1G2SA 1FNWA 3OYYA 3HOWG 1VDZA 5A2QL 3T16A 3LWUA 1OO9B 3UDGA 2PQAB 2E5LL 1UEBA 3J81c 3G7LA 4LF4Q 2HUGA 2E76C 2XNAC 2NVQB 4N8FA 3AFQA 3I91A 1PTOF 3HKSA 1KL9A 3QO2A 5CMDA 4ZLTF 2N88A 2F3WA 4AIMA 1NUCA 1H9SB 5K5PA 2JQOA 4GNXB 3CCJA 2BDOA 1XNRL 1S40A 1J9OA 1WJJA 4NPSA 1RTNA 1HHVA 2PZTA 1IBMQ 1UEAB 1Y1VH 2Z1CA 5ELCA 4UP7A 2RKSA 2ZJRA 1U4RA 4BY1H 2IY5B 1PH9A 4U68A 4BBSG 4DU9A 2BCOA 2HDLA 1JORA 3J81i 2ASBA 1J5EL 1N36Q 4HIKA 1GUWA 3M4QA 1LUZA 2EY2A 4CKBA 5I2YA 4K5VA 4DR2L 2EZVA 3SXHA 2X6LA 1CZWA 5CV8A 1QUQA 2KECA 1N8RC 4DK3C 3VYTA 3I8ZA 3K57A 3HFZB 4A3MG 5KIXA 2VY3A 3TEHB 1XNQL 4JI5Q 1YHBA 1TXYA 4EQNA 1TKWB 1WCMB 3MC0B 1K9MC 3NBHB 4PMCA 1BCPC 1KNEA 4DR4L 5IP9H 2F0JA 1ASYA 1TT2A 2HHHQ 5FKAC 2NVXH 4ME5A 1GO3E 3K5MA 4A3BG 2ZTDA 1ET6A 2N78A 4RKBA 1WTPA 4DAMA 1JICA 2F0QA 4BXXH 3ULLA 4R9WA 3I90A 4A3LH 1H9SA 1HNZQ 1PA6A 1SFOB 1RHPA 3RMHA 2F03A 3A74A 2Q8RE 2GVAA 3KF8A 4IQZA 1K8MA 1W6KA 1Y1VB 1SROA 2NVYH 3HOXG 1OXSC 2EVBA 5IP7H 4IPGA 3VR3A 3BVZA 4NDXA 1HFGA 4RAUC 1FNVA 5FLMG 3DLLA 1KD1C 4JPBW 4OIKA 2PZUA 3D4DA 4P73A 4EVOA 2FMMA 1QZGA 2Z8LA 1AEXA 4A3FH 1PZJD 5E3FA 1MSHA 4CDFC 3SK6A 2GVBA 2NVQH 1D1KA 1Q46A 4IOAA 1YNJC 1V1PB 3F1ZA 1SE3A 2FINB 4HJAA 3GV3A 4ULLA 2F0VA 4FF1A 3PO3B 2YTVA 3SR1A 5IE8A 5M3FG 2E8GA 5IWAQ 3I4LA 4QIWB 1G91A 1QOHA 1WCMH 4UP8A 1VQIA 3CRKC 1X3EA 2QW7A 2M00A 5EAYA 2BA1A 3BVGA 2I5MX 5C6AA 4K0KL 4DR5L 2CQOA 4DAVA 5KNDA 1N36L 5FOBB 2NYZD 1JOOA 5IGDA 5E4XA 5IP7G 3I56A 4RGOS 3MZ5A 4DUYL 1VQCA 5IYDH 4OONA 1BQQT 4OIJA 5EKKA 4FXDA 3S1RH 2XRQD 2K7VA 2OCEA 4ODGA 1VQFA 1E1TA 3MEHA 2RDGA 3GTMB 1S4ZA 3PCOB 4BXXG 3R2IA 2K1BA 4FVMA 4A3KB 3CD6A 3A5UA 4DV2Q 2AUJD 1WOCA 2IT1A 3FKIG 3HOUG 2YTXA 4LF8Q 5J22A 1YNNC 1PH1A 2BOSA 1PRTD 2KJXA 5KNCA 4JK1C 2DNCA 2R92G 2EJMA 1EQTA 2Y0SG 3A54A 3A8KE 1B9MA 1GOZA 1TWGH 4F88A 2Q2IA 4DV0Q 1IYJB 4IALA 2RHSB 3J80i 2AMCB 5J3BA 1I94Q 2WB1B 1JMCA 1A15A 4GOPA 1IBLQ 1PTOH 1V1PA 1YIJA 3W1BA 3I4MG 4BY7G 1I4RA 5I9OA 1MI2A 1LT5D 3B6YA 3PO3H 4LW1A 4NKLA 4H02A 1U4LA 1F77A 1TWAB 4L8JA 3ND9A 2UU9Q 3P1HA 3CAMA 2F1MA 5FLXL 3I4MH 1CA5A 5ELNA 1KXLA 4RCNA 1G6ZA 1EQVA 1C7YA 5K36H 1YI2A 4KD4A 1PFBA 3GTLH 4HAEA 3ONAB 4KHZA 3KFUA 1E3PA 4G7HC 1U4MA 4RMFA 3IKJA 3PUVA 4HR7B 1XX8A 4JI2Q 1RF2D 1PXUA 1FJGL 4DGZA 4IUVA 1C4QA 3I3CA 3GDEA 1VQ6A 4LNQA 3PIP3 4KKUA 1I50H 2L1BA 4DV1L 1HRJA 4XYQA 4UY8C 5M3FH 3CC4A 1ONLA 3A8IE 3ER0A 3M85A 3NE5B 4FF2A 1HNXL 1E1OA 2VUMG 3BG3A 5AJ3L 3K58A 1V8QA 2WV6D 3M7GA 2MNAA 4CJ0B 1QB5D 3AU7A 4A3EH 4DV7Q 2E2IB 3P20A 1TWGB 1SYCA 1LTRD 3SDZA 4KMUC 3CU7A 3DMUA 2DUDA 1IHZA 2QILA 4L5SA 2N49A 4JYAL 2LMCB 4DV3L 3IFTA 3EROA 3NBHA 4CDDC 3TRZA 3K80C 1HA5A 5C0XH 1KABA 1SE4A 2CH4W 3K7UC 2ZT9C 2IW3A 1CQVA 5LMNL 1EY9A 1IBKQ 3EIVA 1Q8KA 2VUMH 3G48A 3VYRA 3T1HQ 4UDUC 2B8FA 1CT1D 3GP7A 3K5NA 1QILA 3BYYB 1WYDA 3OWFA 3K59A 1EYGA 1KLGD 4O1NA 1X6OA 3KDFA 1HR0L 3BYTB 1UAPA 3A55A 1K0RA 3V2TA 4KN4C 3DM3A 2KVMA 1GHJA 3M3YH 5FLMH 3CPWA 1PFSA 1SMXA 2B29A 4BA2I 4DUYQ 1X3FA 3BZDB 1CQFA 1UE7A 3CXCA 1Q1EA 4QIWE
chains in the Genus database with same CATH topology
5M5YB 2KEEA 3A7AB 3TMEA 1Y69U 2LY7A 2M9VA 4XQQA 4C1NK 1C8CA 1K8OA 4FNFA 2CW0C 3R2TA 4UAIA 1EZ6A 2V4DA 4G7ZC 2JA7B 2ID0A 1D6EC 1STEA 3IL8A 4KKTA 2MP1A 5I6WA 4DA2A 1SNCA 5BN4A 3S1MB 3FEWX 1EYCA 5JOBA 2NTSA 1I4HA 1QJOA 5M9OA 5C4HA 1LLRD 1EY6A 1KNAA 4C3IB 3NTHA 4P2CB 3RZDB 3J80E 2SNSA 1TY0A 1SYBA 4FYDA 3FKIB 4KV6A 1BOSA 1RTOA 3EJIA 2B2VC 2EYHA 2NTTA 1ZYRD 2K01A 4N9PA 4ID6A 3BS1A 5C4JB 1ZYRC 3BDOA 1EEFD 3TSSA 4R8IA 3OSOA 1F9RA 2EE1A 1SDFA 1JC7A 3LNNA 2TSSA 1IW7C 2KQ3A 1BDOA 1QNKA 2A69D 3ERQA 2QDBA 3MXUA 5EKIA 5KYIA 3WDNA 5EPKA 2XRSD 1QWYA 2IX0A 1PFMA 2OEOA 3NPPA 1H9MA 2PMZB 4ZUIA 5EQ0A 3WOEA 5LHY1 3ITPA 2F0HA 4IUTA 3V96A 3A56A 2F0TA 1D1IA 1O7ZA 5M5WB 1FNUA 1EY8A 1LACA 4G7OC 1Q8IA 4H44C 4KTAA 3T4AC 1ET9A 3NHHA 4ILWA 5C0XI 2CW0D 1SNDA 1STBA 2PQEA 4K5XA 2YYZA 2NB0A 1TR5A 4TKOB 5T1GA 4DXGA 1V1OA 3HKZB 2RBMA 1GUGA 1W6JA 3C1EA 5C44B 1BF4A 1LTGD 3GTLB 1A6XA 5J1ZA 4DAPA 3D6CA 3DEPA 4XQNA 4QUFA 1PRTF 4EGVA 1KLUD 3AMUA 3OMCA 4DFAA 1ILPA 1ENFA 2F0OA 1AZQA 2O2LD 5C5LA 3D31A 1HUMA 2OXPA 4HCEA 4OHJA 4IN3A 4KHVA 3QOLA 3NQIA 2K32A 3OW7A 2L5TA 3VR6A 2O5JC 1EY0A 1WTVA 1LT3D 4Z9CB 1JWMD 3FVQA 1FR3A 4BBSB 3AB9A 4HMIA 2VXWA 4ZRZA 5M5XB 2ZXOA 4A3GB 5K36G 3NTIA 5FLXE 3NUCA 2PO4A 1RDPD 2A6EC 5CORA 1RKNA 1KDAA 2ZXPA 5ELDA 4S3SA 4BY7B 2B63B 3VYSA 1NSNS 2DY7A 1K83B 1DYQA 4A3IB 2H1EA 5ELBA 1EU3A 4BWGB 2VB3X 1LV9A 1I50B 4CHTB 4AYBB 2AWOA 3SE0A 3NP8A 4DNTB 2A73B 2B2VA 5EPLA 4EQOA 1SNOA 5IT9L 1TQOA 3GTOB 5BN5A 2WKCA 1I6VC 1LT4D 1KAAA 1XXGA 4F8MA 3HOVB 3A7LA 4FP5D 1EL0A 2K04A 1T5EA 3TZDA 4CKEA 2IX1A 2WAQB 2E2HB 2AQ1B 1F9SA 2KEDA 1BO0A 1CHQD 3TBIB 5DM73 2CHBD 1WTWA 2MGSA 5JJZA 4IFDJ 4FF4A 2B2WC 1D2BA 2B2UA 4ZK9B 1QG7A 1Y1WB 2F0IA 1II3A 1BCPB 5EBCA 3N6RA 4ZAIA 2VB2X 5C5MA 5D14A 5DM63 1G291 1SNQA 3ND8A 2WINB 2NUCA 1FD7D 1YNJD 3K5LA 5LL6X 5EJWA 1A2TA 1EWHA 4XT1B 4NW2A 1EWCA 3DUZA 3K0YA 5CV9A 3W3AA 2JSOA 1AZPA 2K5DA 3CRLC 3MTSA 2EPBA 3X3NA 1Y8PB 1DZ1A 5BN3A 3J80L 1Z6HA 2L0CA 4M8AA 2A69C 1R9TB 1SBBB 3MXPA 3NQTA 3H91A 4RKLA 3EFXD 1KDBA 1B50A 2RSOA 4LK1C 3P7JA 3RUZA 1PFNA 1GJXA 2MHVA 4XQJA 3GD7A 1SEBD 1OXTA 3C2PA 3S1RB 1D5XC 3Q6SA 1GUOA 2L55A 5CBAE 2A68D 3BVMA 4RCOA 1ESFA 1T5XD 3N52A 1X32A 2F3VA 1MD2D 4RHSA 2B2YA 3GTPB 3R93A 4H7BA 3LX0A 4K14A 4H13C 4IFDI 4HEDA 1B2TA 2PPBC 4RWSC 2LKVA 3T13A 4KK7A 3M4OB 1EU4A 3KK7A 2BA0A 1TU2B 1SYEA 4J1MA 4K8JA 2TMPA 3GTJB 2VNUD 1AP0A 5J39A 1JOKA 1M8AA 4NMZA 3VR2A 4XDXA 1CK1A 5KRUA 2NN6I 2O5IC 5C3WA 4IFDH 4OO1G 2EYOA 1HCZA 3A8JE 4K8IA 4IUQA 5JPNC 3MXNA 1VMCA 1TIID 5CV4A 1HA6A 4OGQC 3QOJA 3MVVA 1O80A 5D65A 3TP5A 5I4DA 3L3OC 2O4XA 2K05A 4HMJA 5IGBA 1F2LA 2B39A 3FPUB 5ISRA 2JEBI 3SK8A 5E1FA 1RD9D 4XIGS 2NBFA 2N55A 3G6JB 1SJHD 1SAPA 2B2WA 5ELFA 3NSWA 1HPCA 1JB3A 1B53A 2A74C 3I4NB 2KHSA 4F87A 1O7LA 3T53B 5TSSA 2J4XA 2L11A 1VF5C 2E75C 2VUMB 2I46A 4B9WA 5JEAH 2Q8TA 1HXYD 1B4OA 1GHKA 5IODA 1IL8A 1Z47A 2F0NA 4X3KA 5ELEA 3MWYW 5KEEA 3M7NA 3OHXC 3HS0C 2Z4IA 4ZQ3A 4J8QA 4CKCA 3TP8A 2L12A 1H9KA 2PW7A 5FO7B 4Q0FA 1SE2A 4WRDA 4A3FB 4ZKCB 5JEAG 2PCFB 4C3JB 3MXGA 3KBGA 1LO5D 2B8GA 4KY6A 1H9RA 4CJ2C 4LMQD 1R4QB 1DD2A 4KI0A 2XVSA 2R3ZA 4C2MB 4IURA 4U673 1F2ZA 1LTBD 2XWBB 1TS2A 2F0FA 5HURA 4ZYSA 3T51B 1HFNA 1G2TA 4QMGA 3S15B 4QCLA 2KUMA 3Q0AA 1I6HB 3ZYYX 2L9HA 3OOCA 2RDHA 2PNRC 3T56B 1PZID 1S5BD 2SDFA 4FF3A 2K03A 2A68C 1GUNA 1H9JA 1IYVA 5IGCA 1Y8NB 3S9WA 4C3HG 3HGBA 4RFBA 1BBXC 2BE5D 3TN2A 3S2DB 4OO1I 1EYDA 4KY7A 1PYWD 5DNFA 4XTCS 2XIWA 5LL6S 3H94A 4A3MB 2F0SA 2KOLA 3J81L 3SVMA 2ZXRA 2G9HD 2D2CC 3F2UA 4FXGC 2KA7A 3OMGA 4L63B 1OXXK 1ZEQX 1LTID 3W2DA 4IUUA 3GTQB 5C4ZA 4RGTA 1JOQA 3DHQA 4HSVA 1NR2A 4N9TA 1WD0A 3D8GA 3TZUA 1ML0D 2F0UA 1A2UA 2BDNA 1D5MC 3QJYA 2XSCA 1VMPA 4ZKBB 4B08A 1X3QA 4QUCA 1MSGA 2M2LA 4RA8A 4A93B 2RVLA 3NK9A 4RGNA 3PMFA 4G57A 2WIIB 1LABA 5DEHA 4XT3B 5IT9E 3Q23A 2ICIA 3GO5A 4A3JB 1E2WA 2NN6G 4C3HB 5FO8B 1X3PA 2DNEA 3U9OA 1DCZA 3QIAA 1IKMA 2WKDA 1IKLA 3CKIB 3K5OA 1E0BA 2JXMB 3PIO3 4KJNA 2J0TD 1ENCA 1CFMA 1XTCD 5G3LF 3VA7A 1XYIA 3VA5A 5C3XA 2X6GA 1DOKA 2X69A 2IWHA 3BDLA 2HCCA 3RD4A 2FJ2A 3IAYA 1A3VA 1WTQA 3J7AV 2F0GA 4K2KA 1I3QB 2B2TA 3DWPA 1PRTB 3OWEB 4I7ZC 2EDGA 1JWUD 4X3UA 3FMCA 5G3LD 4CGYB 5M3MB 2XWJB 3OIQA 1UUPA 3L9AX 1EY7A 1JE4A 3I73A 3I72A 2PZWA 1L0XB 3P75A 1LTSD 4MN3A 4K5WA 5I9PA 2DN8A 2FHTA 2EJGC 2F0PA 2G9DA 5EKLA 2A6ED 2HDMA 5IIFA 5COYA 3GTGB 1NAPA 4HN7A 5FK9C 5FO9B 1Y8OB 1VCIA 2A6HC 3EVQA 3Q22A 2K28A 2PW5A 3D6WA 3FRPB 5JAVA 1SYDA 4BY1B 1VF7A 1Q12A 4WFN3 1TWCB 1FYCA 1HTPA 3S16B 2B2UC 1M4VA 4XXEA 4DAYA 5JVG3 1A3TA 1QE6A 1EOTA 4HCSA 1D5ZC 1ZKOA 1CZGA 2R6GA 4DN4M 4QB4A 4IUNA 3VR4A 3DWQA 3PUYA 3C3LA 2KCCA 1BCPD 1UNSA 5D3IB 3J81E 4KY5A 1Q1BA 4X3SA 3MAQA 2SNMA 3E0JA 3OIPA 4ABNA 1U9RA 3M4YA 4H0LC 2YU9B 4KJOA 3D4WA 4C3IG 5IOCA 3BDCA 5CV6A 3KLSX 5JEAJ 4R8NA 5CBEE 4DK0A 3MFYA 1SMYD 2JYOA 4V0BA 1O7YA 3PO2B 1STHA 2AWNA 4OL7A 2C9OA 3HOYB 2PYKA 2F0MA 1NCVA 4G4KA 4HTHA 4PV1C 2EYPA 2NZ1D 3UI2A 3DM1A 5KYLA 3I70A 1STYA 1SNPA 4Y7NB 3M3YB 3GTKB 2GA4B 1PDQA 5I6YA 5JVH3 3QB3A 3S2HB 1OXUA 2OT2A 4O42A 4YIJA 1I4XA 3WOFA 3J7AF 4IFDG 2EYMA 4WJWA 1LTTD 2SEBD 4MHEA 1V43A 3D3RA 1PTOD 3QG1A 5CYUA 1TS4A 1LT6D 1WTOA 3S1QB 2F0LA 4F7XA 1J8IA 3DEOA 2ICEC 5IGGA 3HRZC 3V05A 5DAUA 1EY5A 2D62A 5IGFA 2EYJA 1RODA 1PRTC 4L6TB 2J7ZA 2AQ2B 1YNND 3TP6A 4RH6A 1SMYC 3D4RA 2RDFA 4IZ8A 3H3VC 5A2QE 1KDCA 2AUKA 1ENAA 2Y0SB 2JEAI 2JP1A 3C46A 2QEJC 2IX3A 1STAA 3EQLC 4RHRA 2IPKD 4K6DA 5F2DA 1ILQA 3NWSA 5HGTA 2MUYA 3HOUB 1JR0D 2F0KA 3DXJC 3I4MB 2I07B 3OPOA 1CHPD 1EEID 3HP3A 4PMWA 2DY8A 2MPMA 3PUZA 3RZOB 3HZXA 1SJED 2IJ0A 1SSOA 3KLSA 1TS3A 3CHBD 1DXMA 3VYUA 2F0WA 3C1FA 2Q8IB 5I2XA 1O78A 5CR3A 1BNZA 3K6OA 4CJ1B 1TS5A 1B3AA 3GV6A 3HEJA 2WACA 1I4QA 3VR5A 4XYOA 2WP8J 1I4PA 3NWTA 2OF1A 1NR4A 3HOXB 3NXWA 2FMCA 4OO1H 4BS9A 4BA1I 1JWSD 5EBDA 3FPPA 3MFGA 1C48A 2A6HD 4J6HA 3HOZB 1TWHB 3H09A 2MJ8A 2XN9C 4LJZC 5CGKA 4K2LA 2EY6A 3S1NB 5EPJA 2JA8B 1Q90A 1BUVT 1R4PB 3L7ZC 1S5DD 2E74C 1PLFA 4ZUJA 1OXVA 4DNRB 1SXTA 5C0XG 1BCPF 4KN7C 2QCPX 1AW7A 2B2TC 3URYA 1WD1A 3Q24A 2SOBA 2R7ZB 2B2YC 1CI3M 3LWEA 4Q5VA 3FDTA 4X3TA 3HG9A 4K6LA 1STGA 3SHLA 3JAML 4V190 2NWGA 1AN8A 1SYFA 1DM0B 1WTRA 2LFNA 1U4PA 1G8ZD 2HCIA 2F0DA 5D3DA 2ENBA 5EGTA 1DOLA 1HQMC 4LAAA 5C4XB 2LS01 2K33A 3QWNA 1EFID 2Z4HA 2R93B 1EYAA 4RGMA 1SNMA 2IL8A 4I65A 1L0YB 4EQPA 4C3JG 3GQBA 1QNUA 2CQAA 3K7AB 1XWEA 3PV0A 5CV5A 1WVLA 1ICWA 3SEBA 3S17B 4C1NI 1E2VA 1QCBD 1WTXA 1TWFB 1RJTA 1I4GA 4DK1A 1CA6A 3KLRA 1JQYD 3S14B 3TDQA 3NBIA 3R3OA 4PQXA 3R8BA 5IGEA 1F2MA 4M1UB 4C56C 3J7YW 1AFPA 1PTOC 5NUCA 2D5DA 3DWAA 1B44D 2K6AA 3E5SA 1IYUA 2E2DC 2EXZA 3IFDA 2QF7A 1F9QA 5C3EB 2C5CA 3TP7A 1LTAD 3SK5A 4E6IA 3MA2B 1GXDC 2H4OA 2RA4A 1A3UA 2BE5C 1B9NA 4B9XA 2F4IA 2EYFA 5JPMC 3PUXA 1S5ED 3U9SA 2A5HA 4CBVA 2EY1A 2K5QA 4WORA 3EA6A 3NTKA 1SYGA 2F0EA 4A3BB 1EIHA 2K5WA 1Q3LA 1DONA 3X3MA 1BXTA 5AFWA 2RSNA 5C0XJ 1TY2A 1RCVD 1GUTA 1TVXA 1CM9A 1Z7TA 1S5CD 2EOTA 5T1IA 3KBXA 2E2JB 2JE6I 1F9PA 2D9UA 1E2ZA 4GZYC 4TQUS 2NVTB 5CV7A 4KD3A 1EY4A 2R61A 2JA5B 2CVRA 4TRDA 4TSSA 1EIGA 2EY5A 2EYLA 4MIUA 4HSPA 2EJFC 3CQZB 4A3DB 4KKSA 3RLFA 1STNA 1B1ZA 2FFKB 4JBWA 4PNYA 4BBRB 5A35A 1KTKA 3KUPA 3SK4A 1ZXTA 5M3FB 4QF4A 4PMBA 3H6MA 1F2YA 4FXKC 2JA6B 3JAME 4A3EB 1HUNA 4IUPA 1MBYA 5KNBA 3H0GB 2RQXA 5KGUA 1MGSA 5CC4A 2R92B 3HOWB 1CTMA 1PTOB 1FGBD 3E6ZX 2KCNA 1DJRD 2NVXB 4FO2A 2L4NA 1S5FD 1JCKB 2AQ3B 1GUSA 3O13A 2NN6H 1HQRD 4NP5A 1EZ8A 3MHBA 1DOMA 4DF7A 1PZKD 1BR9A 2QKIC 1HTLD 1IW7D 2HQEA 3PUWA 5E4WC 1ESRA 1PMRA 2NVYB 4DXFA 1G2SA 1FNWA 1VDZA 5A2QL 3T16A 3LWUA 1OO9B 3G7LA 2HUGA 2E76C 2XNAC 2NVQB 3I91A 1PTOF 3QO2A 5CMDA 4ZLTF 2N88A 2F3WA 1NUCA 1H9SB 5K5PA 2BDOA 1J9OA 1RTNA 1HHVA 2PZTA 1UEAB 2Z1CA 5ELCA 2RKSA 1U4RA 4U68A 4DU9A 2BCOA 2HDLA 1JORA 1GUWA 4CKBA 2EY2A 5I2YA 4K5VA 2EZVA 3SXHA 2X6LA 1CZWA 5CV8A 2KECA 3VYTA 3I8ZA 3K57A 5KIXA 4EQNA 1TKWB 1WCMB 3MC0B 4PMCA 1BCPC 1KNEA 2F0JA 1TT2A 5FKAC 4ME5A 3K5MA 1ET6A 4RKBA 1WTPA 1JICA 2F0QA 4R9WA 3I90A 1H9SA 1SFOB 1RHPA 3RMHA 2F03A 2Q8RE 3KF8A 4IQZA 1K8MA 1W6KA 1Y1VB 1OXSC 2EVBA 3VR3A 3BVZA 4NDXA 1HFGA 4RAUC 1FNVA 4OIKA 2PZUA 3D4DA 4EVOA 2FMMA 2Z8LA 1AEXA 1PZJD 5E3FA 1MSHA 3SK6A 1D1KA 1YNJC 1V1PB 1SE3A 2FINB 3GV3A 4ULLA 2F0VA 4FF1A 3PO3B 3SR1A 3I4LA 4QIWB 1G91A 1QOHA 3CRKC 2M00A 2BA1A 3BVGA 5C6AA 4DAVA 5KNDA 5FOBB 2NYZD 1JOOA 5IGDA 5E4XA 4RGOS 3MZ5A 1BQQT 4OIJA 5EKKA 4FXDA 2XRQD 2K7VA 4ODGA 3MEHA 2RDGA 3GTMB 1S4ZA 3R2IA 2K1BA 4FVMA 4A3KB 2AUJD 2IT1A 5J22A 1YNNC 2BOSA 1PRTD 2KJXA 5KNCA 4JK1C 2DNCA 2EJMA 1EQTA 3A54A 3A8KE 1B9MA 4F88A 1GOZA 4IALA 2WB1B 1A15A 1PTOH 1V1PA 1I4RA 5I9OA 1MI2A 1LT5D 4NKLA 1U4LA 1F77A 1TWAB 4L8JA 3ND9A 3P1HA 2F1MA 5FLXL 1CA5A 4RCNA 1G6ZA 1EQVA 5K36H 4KD4A 1PFBA 4HAEA 3ONAB 4KHZA 4G7HC 1U4MA 3IKJA 3PUVA 4HR7B 1XX8A 1RF2D 1PXUA 4DGZA 4IUVA 1C4QA 3I3CA 3PIP3 4KKUA 2L1BA 1HRJA 4XYQA 1ONLA 3A8IE 3M85A 3NE5B 4FF2A 3BG3A 3K58A 1V8QA 2WV6D 3M7GA 4CJ0B 1QB5D 3AU7A 2E2IB 3P20A 1TWGB 1SYCA 1LTRD 3SDZA 4KMUC 3CU7A 3DMUA 1IHZA 2QILA 2LMCB 3IFTA 3EROA 3NBHA 1HA5A 5C0XH 1KABA 1SE4A 2ZT9C 2IW3A 1CQVA 1EY9A 3VYRA 4UDUC 2B8FA 1CT1D 3K5NA 3GP7A 1QILA 3BYYB 3OWFA 3K59A 1KLGD 4O1NA 3BYTB 1UAPA 3A55A 3V2TA 4KN4C 2KVMA 1GHJA 4BA2I 3BZDB 1CQFA 1Q1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3S A;  1EY7 A;  2F0H A;  3ITP A;  3P1H A;  2PW7 A;  4K8J A;  4NDX A;  3T16 A;  3TME A;  5CGK A;  5CV7 A;  4KD3 A;  4KJO A;  4WRD A;  3TP6 A;  3D4W A;  1A2T A;  2F0T A;  4K2L A;  1NSN S;  1EY4 A;  2EY6 A;  2PZU A;  2RDF A;  2PZW A;  1EQV A;  1EY8 A;  3D4D A;  4IZ8 A;  1KDC A;  1EZ6 A;  4EVO A;  5IOC A;  5J39 A;  1JOK A;  1AEX A;  5C4Z A;  1JOQ A;  4KTA A;  3BDC A;  3DHQ A;  4KD4 A;  3R3O A;  1ENA A;  4KY6 A;  3P75 A;  4NMZ A;  5CV6 A;  5E3F A;  4N9T A;  5IGE A;  3NHH A;  3D8G A;  4TRD A;  5CV9 A;  4R8N A;  5I6W A;  3SK6 A;  5KRU A;  1SND A;  1STA A;  1STB A;  1SNC A;  1F2M A;  2F0U A;  1A2U A;  2EY5 A;  2F3W A;  2PQE A;  4K6D A;  4K5X A;  5F2D A;  4ZUJ A;  4K5W A;  5C3W A;  1NUC A;  5K5P A;  1TR5 A;  1EYC A;  5I9P A;  2EYO A;  5JOB A;  2EYL A;  5HGT A;  4DGZ A;  4MIU A;  2F0K A;  2F0V A;  2PZT A;  3SR1 A;  4K8I A;  1F2Z A;  2RBM A;  5NUC A;  1STN A;  1STH A;  2F0P A;  5M9O A;  5C4H A;  2SOB A;  3C1E A;  2RKS A;  4PNY A;  2F0F A;  5EKL A;  5HUR A;  3NK9 A;  4OL7 A;  5J1Z A;  1EY6 A;  5IIF A;  2M00 A;  3D6C A;  3E5S A;  3PMF A;  4QMG A;  3NP8 A;  3MXP A;  4G57 A;  3NQT A;  2EXZ A;  3SK4 A;  2PYK A;  5CV4 A;  4QF4 A;  5DEH A;  4RKL A;  5C6A A;  3HZX A;  2F0M A;  4HTH A;  4DU9 A;  1KDB A;  3QOJ A;  1STG A;  3TP7 A;  4EQO A;  3MVV A;  3SHL A;  1SNO A;  4PMB A;  3EVQ A;  3SK5 A;  3H6M A;  1JOR A;  1F2Y A;  3OMC A;  2SNS A;  1JOO A;  2EYP A;  2EY2 A;  4DFA A;  4E6I A;  5IGD A;  1TQO A;  4K5V A;  3TP5 A;  3RUZ A;  2F0W A;  3SXH A;  1SYB A;  3U9O A;  1SYC A;  2F0O A;  3C1F A;  3MZ5 A;  1SYF A;  1A3U A;  5CV8 A;  5KYL A;  2O4X A;  4HMJ A;  1KAA A;  4KV6 A;  5IGB A;  5CR3 A;  4B9X A;  3DMU A;  2PW5 A;  5EKK A;  5C5L A;  2EYF A;  4F8M A;  5JAV A;  1IHZ A;  1STY A;  1SNP A;  1SYD A;  5ISR A;  2EY1 A;  4WOR A;  3SK8 A;  3EJI A;  2OXP A;  4ODG A;  5E1F A;  4KJN A;  5KIX A;  3HEJ A;  2WAC A;  1SYG A;  2EYH A;  3ERO A;  3MEH A;  1ENC A;  4N9P A;  5KGU A;  1KAB A;  4ID6 A;  4EQN A;  2F0D A;  5IGC A;  5CC4 A;  4KHV A;  5I6Y A;  2ENB A;  3VA5 A;  3QOL A;  5EGT A;  2F0E A;  3OSO A;  5C3X A;  2OF1 A;  3QB3 A;  3S9W A;  4LAA A;  1EY9 A;  4PMC A;  1EY0 A;  2KHS A;  5J22 A;  1A3T A;  2F3V A;  3BDL A;  3NXW A;  2F0J A;  1TT2 A;  2KQ3 A;  4ME5 A;  1EYD A;  4YIJ A;  1EYA A;  4B9W A;  1A3V A;  4KY7 A;  4H7B A;  1SNM A;  3LX0 A;  4K14 A;  3ERQ A;  4QB4 A;  2F0G A;  4K2K A;  4NP5 A;  2EYM A;  3OWF A;  4I65 A;  2QDB A;  1EZ8 A;  3MHB A;  2F0Q A;  4HMI A;  4IUN A;  4EQP A;  4DF7 A;  4IAL A;  2F0I A;  2LKV A;  5KYI A;  5IOD A;  2F0N A;  3T13 A;  1II3 A;  2F0S A;  3V2T A;  2HQE A;  5KEE A;  3NUC A;  2F0L A;  4F7X A;  5CV5 A;  5C5M A;  5IGG A;  5I9O A;  1RKN A;  2OEO A;  4KY5 A;  1KDA A;  4J6H A;  1EY5 A;  1SNQ A;  2SNM A;  3OMG A;  4RKB A;  5DAU A;  4NKL A;  4ZQ3 A;  5IGF A;  1U9R A;  4ZUI A;  3TP8 A;  2EYJ A;  1SYE A;  4J1M A;  2NUC A; 
#chains in the Genus database with same CATH topology
 5M5Y B;  3GTM H;  3A5Z B;  2VQF L;  2KEE A;  3A7A B;  3TME A;  1Y69 U;  2LY7 A;  2M9V A;  1VQH A;  4XQQ A;  4C1N K;  1C8C A;  2F4V L;  1K8O A;  3HOY G;  4FNF A;  2CW0 C;  3R2T A;  4UAI A;  1EZ6 A;  2V4D A;  4G7Z C;  2JA7 B;  2ID0 A;  1D6E C;  1STE A;  3IL8 A;  4KKT A;  2MP1 A;  4PG3 A;  5I6W A;  4DA2 A;  1SNC A;  4DKA C;  5BN4 A;  3S1M B;  3FEW X;  4A3J H;  1EYC A;  5JOB A;  4X64 Q;  2NTS A;  5IYC H;  1I4H A;  2K14 A;  4JI8 Q;  1L1O C;  1QJO A;  5M9O A;  5C4H A;  4AQY Q;  3L2P A;  1LLR D;  1FGU A;  1EY6 A;  4JW0 A;  2JA5 G;  1KNA A;  4C3I B;  3NTH A;  4P2C B;  3RZD B;  3J80 E;  2SNS A;  1XPU A;  1TY0 A;  1S72 A;  1DGS A;  1SYB A;  4FYD A;  3FKI B;  4KV6 A;  4R4O A;  1BOS A;  1RTO A;  3U58 A;  2NZH A;  1JB7 A;  4LF8 L;  4A93 H;  3EJI A;  1YHA A;  2B2V C;  2EYH A;  2NTT A;  1ZYR D;  4KLK A;  2QEX A;  2K01 A;  4N9P A;  4ID6 A;  3BS1 A;  2ES2 A;  5C4J B;  4JI3 Q;  1ZYR C;  3BDO A;  1EEF D;  3TSS A;  5C44 H;  4R8I A;  3OSO A;  1F9R A;  1XMO L;  1VQP A;  4GN3 B;  2EE1 A;  1BVS A;  1SDF A;  1JC7 A;  3LNN A;  2TSS A;  1IW7 C;  1QVF A;  2KQ3 A;  1IL2 A;  4GOP B;  1BDO A;  4A3K G;  1QNK A;  2A69 D;  2WFW A;  3ERQ A;  3CP0 A;  1T9H A;  2QDB A;  4ALP A;  2UXB Q;  3MXU A;  5EKI A;  5KYI A;  3G71 A;  3WDN A;  2R7Z G;  3CCS A;  5EPK A;  4BBR G;  2AHO B;  2XRS D;  4X64 L;  1QWY A;  5C4X H;  5LMN W;  3F2B A;  2IX0 A;  1XJV A;  1PFM A;  1EWI A;  2OEO A;  3NPP A;  4GKK Q;  1H9M A;  2PMZ B;  4ZUI A;  5EQ0 A;  3LGJ A;  2P5Z X;  3WOE A;  3ITP A;  2F0H A;  4IUT A;  5LHY 1;  3V96 A;  2HT1 A;  3A56 A;  2CFM A;  4DR7 Q;  4EQ5 A;  2F0T A;  1D1I A;  1O7Z A;  3ICE A;  5M5W B;  1FNU A;  1EY8 A;  3K7A H;  1LAC A;  4G7O C;  1Q8I A;  2Z6K C;  4BBS H;  4KTA A;  4H44 C;  4LFA Q;  3T4A C;  1ET9 A;  3NHH A;  4ILW A;  5C0X I;  2CW0 D;  1SND A;  1STB A;  2PQE A;  4K5X A;  4OEM B;  2YYZ A;  1VQG A;  2NB0 A;  1TWA H;  1TR5 A;  2Q2T A;  5C4X G;  2E2H H;  3I2Z A;  4TKO B;  5T1G A;  4DXG A;  1V1O A;  4JYA Q;  3HKZ B;  1X65 A;  2R7Z H;  2RBM A;  1YJW A;  4GN5 A;  1GUG A;  1W6J A;  2R7D A;  4X62 Q;  4LFA L;  3C1E A;  5C44 B;  1BF4 A;  1LTG D;  3GTL B;  1A6X A;  5J1Z A;  4DAP A;  3D6C A;  3DEP A;  2B63 H;  4DV6 Q;  4XQN A;  4QUF A;  1PRT F;  3H3V H;  1VQB A;  1JT8 A;  5IP9 G;  1C0A A;  4EGV A;  1KLU D;  3AMU A;  3OMC A;  4DFA A;  3CMA A;  1ILP A;  1ENF A;  2F52 A;  2F0O A;  1AZQ A;  4A3I H;  1VQ9 A;  1EOV A;  2CH4 A;  2DGY A;  2O2L D;  1KAW A;  1EFW A;  5C5L A;  3D31 A;  1VQO A;  1HUM A;  3W1G A;  4HIM A;  2OXP A;  1NTG A;  4HCE A;  4DNI A;  4OHJ A;  4DR4 Q;  2D0O A;  4IN3 A;  4JG2 A;  4KHV A;  3QOL A;  5IWA L;  3NQI A;  3F2D A;  2K32 A;  1YJN A;  3OW7 A;  4JI0 Q;  2L5T A;  3VR6 A;  2O5J C;  1EY0 A;  1WTV A;  1LT3 D;  1B7Y B;  4Z9C B;  3RN5 A;  1JWM D;  1XNQ Q;  3FVQ A;  1FR3 A;  4BBS B;  4C3I H;  2VQE Q;  3AB9 A;  4B3S Q;  1XTD A;  4HMI A;  2VXW A;  4ZRZ A;  5M5X B;  1KC8 C;  2ZXO A;  4HIO A;  4LF7 Q;  4A3G B;  3TRE A;  5K36 G;  2JK8 A;  3NTI A;  5FLX E;  4EX5 A;  3NUC A;  2PO4 A;  4JVZ A;  3HOV G;  1RDP D;  2A6E C;  2K75 A;  5COR A;  3J81 j;  1RKN A;  1KDA A;  2ZXP A;  3JC6 6;  5ELD A;  3K81 C;  4GLV B;  4S3S A;  4BY7 B;  1K8A C;  2B63 B;  1HNX Q;  3VYS A;  4HJ7 A;  3PF4 A;  2VQE L;  4KHP L;  1NSN S;  2Q2H A;  2DY7 A;  1UE6 A;  4BY1 G;  1K83 B;  3OTO Q;  1DYQ A;  4A3I B;  4RG1 A;  2H1E A;  5ELB A;  2JA6 G;  1PH4 A;  1EU3 A;  4BWG B;  3S16 H;  2VB3 X;  3WWV A;  1LV9 A;  1I50 B;  1MKH A;  4CHT B;  4IOC A;  1TWF H;  4AYB B;  2Z6B A;  2AWO A;  1CKM A;  3SE0 A;  5LMN Q;  3NP8 A;  4YHH L;  1W3S A;  4DNT B;  2A73 B;  2MO0 A;  3S2D H;  2B2V A;  5EPL A;  4EQO A;  1SNO A;  4YWL A;  5IT9 L;  1TQO A;  3GTO B;  5BN5 A;  2WKC A;  1I6V C;  1E22 A;  1LT4 D;  1KAA A;  2RF4 A;  4A3M H;  1XXG A;  4F8M A;  3HOV B;  3A7L A;  2DJF C;  4FP5 D;  1EL0 A;  2K04 A;  4JOI C;  1X54 A;  1WI5 A;  1YZ6 A;  4APV A;  1T5E A;  3TZD A;  4CKE A;  2IX1 A;  2WAQ B;  3PO3 G;  2E2H B;  2AQ1 B;  1F9S A;  1PH7 A;  2KED A;  1BO0 A;  1CHQ D;  3TBI B;  1NY4 A;  5DM7 3;  4O0A A;  2N8N A;  4GLX A;  2CHB D;  3CCV A;  1WTW A;  2MGS A;  5JJZ A;  4IFD J;  4DR6 L;  4FF4 A;  2B2W C;  2FXQ A;  1CSP A;  3ULP A;  1N9W A;  1D2B A;  4DR7 L;  2B2U A;  4ZK9 B;  1QG7 A;  1Y1W B;  2F0I A;  4MZ9 A;  1II3 A;  1BCP B;  5EBC A;  3N6R A;  4ZAI A;  4JOI A;  1SE8 A;  2VB2 X;  1W2B A;  5C5M A;  5D14 A;  1L2F A;  5DM6 3;  1G29 1;  1SNQ A;  3ND8 A;  2WIN B;  2NUC A;  4A3B H;  1FD7 D;  1YNJ D;  3K5L A;  5LL6 X;  5EJW A;  1A2T A;  1EWH A;  5JJL A;  4XT1 B;  5FLX c;  1SLJ A;  4NW2 A;  1EWC A;  4QL5 A;  5C44 G;  3DUZ A;  1YEZ A;  3K0Y A;  5CV9 A;  3W3A A;  2JSO A;  2UUB L;  1AZP A;  2K5D A;  3CRL C;  3MTS A;  5C4J H;  3HOZ G;  4GLA C;  2EPB A;  3X3N A;  1Y8P B;  1DZ1 A;  5BN3 A;  2HQL A;  3J80 L;  1Z6H A;  2L0C A;  4JI3 L;  4M8A A;  5H1S E;  1PH2 A;  2A69 C;  3E9H A;  1R9T B;  3ULJ A;  4LF6 Q;  1SBB B;  3MXP A;  1SR3 A;  3NQT A;  2HIV A;  3H91 A;  4RKL A;  2QA4 A;  3EFX D;  1KDB A;  1B50 A;  3H15 A;  2RSO A;  4LK1 C;  2D0P A;  3P7J A;  3HOU H;  3RUZ A;  1PFN A;  1GJX A;  1N34 L;  2MHV A;  4XQJ A;  3GD7 A;  4DV4 L;  1SEB D;  1OXT A;  3T1H L;  3C2P A;  4P75 A;  1Y1W G;  3S1R B;  1D5X C;  4DR1 Q;  3CQZ H;  3BU2 A;  3Q6S A;  1GUO A;  2L55 A;  3KLW A;  5CBA E;  2A8V A;  3HOW H;  2CWP A;  3BZC A;  1EQR A;  2A68 D;  3BVM A;  4RCO A;  1ESF A;  1T5X D;  3N52 A;  1X32 A;  2F3V A;  1MD2 D;  2RHQ B;  1LM0 A;  4A3L G;  4Y52 H;  4RHS A;  2B2Y A;  3GTP B;  3R93 A;  4A3I G;  4H7B A;  3LX0 A;  4K14 A;  4H13 C;  4IFD I;  4HED A;  1B2T A;  2PPB C;  2VQF Q;  2A1A A;  4RWS C;  2LKV A;  3T13 A;  4KK7 A;  1B8A A;  2BH8 A;  3M4O B;  1EU4 A;  2CKZ B;  3KK7 A;  3OTO L;  1JJ2 A;  4GNX C;  2BA0 A;  1TU2 B;  1PYB A;  1SYE A;  4P72 A;  4J1M A;  4K8J A;  1X56 A;  4HID A;  2TMP A;  2AKW B;  3GTJ B;  2VNU D;  1AP0 A;  2UUC L;  4OWX B;  4MTN A;  3ZJY C;  1JOK A;  5J39 A;  1M8A A;  4NMZ A;  3VR2 A;  1VQM A;  4B3R Q;  4XDX A;  3FHW A;  1CK1 A;  1HNZ L;  5IY0 A;  1ASZ A;  2OQ0 A;  5KRU A;  2I5L X;  2NN6 I;  3CCM A;  5C3W A;  4JI7 Q;  2O5I C;  3FP9 A;  4IFD H;  4AQY L;  3S1Q H;  4OO1 G;  1VQJ A;  2EYO A;  1IBM L;  1HCZ A;  3A8J E;  4P74 A;  4K8I A;  4IUQ A;  1XNR Q;  5JPN C;  3MXN A;  4JI1 L;  3HOV H;  1VMC A;  1YBY A;  1TII D;  4YCV A;  1XPR A;  5CV4 A;  4FDB A;  1HA6 A;  4OGQ C;  3QOJ A;  1VQD A;  1K0S A;  3MVV A;  1O80 A;  5HY6 A;  5D65 A;  1LYL A;  3KF6 A;  3TP5 A;  1U0L A;  3I7F A;  4LF9 Q;  1VQN A;  4DV5 L;  5I4D A;  3L3O C;  1Q7Y C;  1L1O B;  1AE3 A;  2O4X A;  2K05 A;  3A0J A;  4HMJ A;  4A3J G;  5IGB A;  1F2L A;  2B39 A;  3FPU B;  5ISR A;  2JEB I;  3SK8 A;  3J80 c;  5E1F A;  1C9O A;  1RD9 D;  4XIG S;  2NBF A;  2N55 A;  4LUO A;  1SJH D;  3G6J B;  1SAP A;  2B2W A;  2XGT A;  4QJF A;  5ELF A;  3KJO A;  2ZJQ A;  2KEN A;  4A3C H;  3NSW A;  1A62 A;  1HPC A;  3RLN A;  1JB3 A;  1B53 A;  3PIP A;  2MFI A;  2A74 C;  3I4N B;  2KHS A;  4F87 A;  3I4O A;  1O7L A;  3T53 B;  5TSS A;  2J4X A;  2L11 A;  1VF5 C;  1I6H H;  2E75 C;  2UUC Q;  2VUM B;  2I46 A;  4B9W A;  5JEA H;  4I7A A;  2Q8T A;  1HXY D;  3E3X A;  4MTK A;  1B4O A;  1GHK A;  4NB3 A;  1IL8 A;  1Z47 A;  2F0N A;  4PZ8 A;  4X3K A;  5IOD A;  5ELE A;  3MWY W;  5KEE A;  4LF5 L;  3M7N A;  3OHX C;  3UDF A;  4NXN Q;  3PO2 H;  3HS0 C;  1G6P A;  2Z0S A;  2Z4I A;  4ZQ3 A;  4J8Q A;  4CKC A;  3TP8 A;  1Y1V G;  2L12 A;  1N34 Q;  4P71 A;  1H9K A;  3G4S A;  1BKB A;  3UE1 A;  1Y14 B;  2PW7 A;  5FO7 B;  5IYC G;  4Q0F A;  1SE2 A;  4WRD A;  1KRS A;  4A76 A;  1GD7 A;  1HJP A;  4A3F B;  2YU9 H;  4ZKC B;  5JEA G;  1XMQ Q;  2PCF B;  1NE3 A;  4C3J B;  4GKK L;  3MXG A;  3CCQ A;  3KBG A;  1LO5 D;  4X62 L;  2B8G A;  4KY6 A;  1H9R A;  4CJ2 C;  4IJH A;  4LMQ D;  5M5X H;  1R4Q B;  1DD2 A;  2Y0S E;  4UPA A;  2VZA A;  4KI0 A;  1QZH A;  2XVS A;  2R3Z A;  4C2M B;  4IUR A;  4LFB Q;  4GKJ Q;  2PI2 A;  4U67 3;  1F2Z A;  1D7Q A;  2K52 A;  1PH8 A;  2IHE A;  1LTB D;  2XWB B;  2A19 A;  1TS2 A;  2CCZ A;  4A3D H;  2F0F A;  5HUR A;  2Q2U A;  4ZYS A;  2PI2 E;  3CPF A;  3T51 B;  1HFN A;  1G2T A;  1N32 Q;  4BBR H;  4QMG A;  3S15 B;  4QCL A;  2KUM A;  3CME A;  4DV0 L;  3Q0A A;  1I6H B;  2EQS A;  3ZYY X;  2L9H A;  3OOC A;  2RDH A;  3MXN B;  2CWA A;  2PNR C;  3T56 B;  1BBW A;  4J15 A;  2H5X A;  4JI6 Q;  4B3M Q;  1PZI D;  4X66 Q;  1S5B D;  2SDF A;  4L5T A;  4FF3 A;  4X65 L;  2K03 A;  5IYB H;  2A68 C;  2MO1 A;  2VS1 A;  1CKO A;  1GUN A;  1G51 A;  1H9J A;  1IYV A;  2NZO A;  5IGC A;  1Y8N B;  5DLQ E;  3S9W A;  2E2I H;  4JBJ A;  4C3H G;  3HGB A;  4RFB A;  5E7N A;  5M5W H;  1BBX C;  2BE5 D;  3TN2 A;  3S2D B;  4OO1 I;  1E24 A;  2I0Q A;  1EYD A;  4KY7 A;  1PYW D;  5DNF A;  4XTC S;  2JA8 G;  1NJI C;  2XIW A;  5LL6 S;  3RZD H;  3H94 A;  4A3M B;  2F0S A;  2KOL A;  3J81 L;  3AYH B;  2JA5 H;  3SVM A;  2ZXR A;  2KCM A;  4GNX A;  2G9H D;  3FKI H;  2D2C C;  3F2U A;  4FXG C;  2KA7 A;  3OMG A;  4L63 B;  4PZ7 A;  3JAM i;  1OXX K;  3GTK H;  3UDI A;  3S15 H;  1ZEQ X;  1LTI D;  3J7Z C;  3W2D A;  4IUU A;  4YCU A;  3GTQ B;  3M4O H;  2I5H A;  3S2H H;  5C4Z A;  4RGT A;  1JOQ A;  3DHQ A;  4HSV A;  1NR2 A;  2PNH A;  4N9T A;  1WD0 A;  4JV5 Q;  3D8G A;  4IPC A;  4UP9 A;  3TZU A;  1ML0 D;  2Z6K A;  1A0I A;  2F0U A;  1A2U A;  2PQA A;  2BDN A;  2ZJP A;  1VS0 A;  2UXB L;  4IJL A;  2EIF A;  1HZB A;  1D5M C;  2IHF A;  3QJY A;  2XSC A;  1VMP A;  5GAE C;  1FJG Q;  4ZKB B;  4B08 A;  1X3Q A;  1Q86 C;  4QUC A;  1MSG A;  2M2L A;  4RA8 A;  4A93 B;  2KBN A;  2RVL A;  3NK9 A;  3TS0 A;  4RGN A;  3PMF A;  1NMG A;  3KYH C;  4G57 A;  2WII B;  1LAB A;  5DEH A;  4XT3 B;  5IT9 E;  3Q23 A;  3S1M H;  2ICI A;  3GO5 A;  1L0W A;  2C35 B;  4A3J B;  4UHV A;  1E2W A;  2VW9 A;  2NN6 G;  4C3H B;  5FO8 B;  1X3P A;  4B3T L;  2DNE A;  3U9O A;  5LMU L;  1DCZ A;  3QIA A;  1IKM A;  2WKD A;  1IKL A;  3CKI B;  3K5O A;  4DAY B;  5FJ8 H;  1E0B A;  4LUZ A;  1FVI A;  2JXM B;  2Z9H A;  3PIO 3;  4KJN A;  2J0T D;  1ENC A;  4GS3 A;  1CFM A;  3E9I A;  3CC7 A;  3HOZ H;  2UXC L;  1XTC D;  5G3L F;  3VA7 A;  1XYI A;  3VA5 A;  1IBL L;  1QUQ B;  1WTH A;  5C3X A;  4B3T Q;  2X6G A;  3F2C A;  1DOK A;  2X69 A;  3KDF B;  2IWH A;  3W5O A;  3BDL A;  2HCC A;  3RD4 A;  2FJ2 A;  2UUA Q;  3HOX H;  1XMQ L;  3IAY A;  4LF6 L;  4OWW B;  1A3V A;  5IYD G;  1WTQ A;  4B3R L;  3J7A V;  2F0G A;  4K2K A;  4A75 A;  1I3Q B;  2B2T A;  4LF4 L;  2F3I A;  3DWP A;  3M9B A;  1PRT B;  4A93 G;  3OWE B;  4I7Z C;  2EDG A;  1JWU D;  3CC2 A;  4X3U A;  3I4N H;  3FMC A;  5G3L D;  1X9N A;  4CGY B;  5M3M B;  1NNX A;  2XWJ B;  3OIQ A;  4GN4 B;  2VL6 A;  2ATW A;  1UUP A;  2L15 A;  3L9A X;  1EY7 A;  1JE5 A;  1JE4 A;  3I73 A;  1CKN B;  5GRO A;  3I72 A;  4LF5 Q;  2PZW A;  4DV1 Q;  1L0X B;  3P75 A;  4JI7 L;  1CKN A;  3CCU A;  1K8G A;  1LTS D;  4MN3 A;  4K5W A;  5BR8 Q;  5GQO A;  5I9P A;  2DN8 A;  2FHT A;  2EJG C;  4JCV E;  2F0P A;  2G9D A;  1PYS B;  2N3S A;  4C3J H;  5EKL A;  2A6E D;  2HDM A;  5IIF A;  4YWK A;  5COY A;  1YIT A;  3GTG B;  1NAP A;  4HN7 A;  1VQ7 A;  5FK9 C;  5FO9 B;  1Y8O B;  1VCI A;  2A6H C;  3GTJ H;  3EVQ A;  4DUZ Q;  4POG A;  2OQK A;  3Q22 A;  2K28 A;  1OTC A;  3S1N H;  1QVG A;  1B70 B;  4HJ9 A;  1JJC B;  2PW5 A;  3D6W A;  3FRP B;  5JAV A;  3TQY A;  1SYD A;  1VF7 A;  4BY1 B;  1Q12 A;  1NBW A;  3J7A 5;  4NXN L;  3RNU A;  4CDE C;  4WFN 3;  1TWC B;  3RR5 A;  3T1Y L;  3F8T A;  3ERS X;  1FYC A;  1HTP A;  1AH9 A;  3S16 B;  2B2U C;  1M4V A;  4XXE A;  4DAY A;  5JVG 3;  4N8X 1;  1MJE A;  4DPG A;  1A3T A;  3S24 A;  1QE6 A;  1EOT A;  4HCS A;  1D5Z C;  1ZKO A;  1TWH H;  1CZG A;  2R6G A;  4DN4 M;  3BJU A;  4QB4 A;  2JA7 G;  4IUN A;  4WJ3 M;  3VR4 A;  3L0O A;  5JJK A;  3CCL A;  4C2M H;  3DWQ A;  1UE1 A;  1I3Q H;  3PUY A;  1HZC A;  3C3L A;  1Q82 C;  4Y7N H;  2KCC A;  1BCP D;  3SGI A;  1UNS A;  5D3I B;  4R4C A;  3J81 E;  4KY5 A;  4A3E G;  1Q1B A;  4X3S A;  3MAQ A;  2SNM A;  3E0J A;  3OIP A;  4ABN A;  1U9R A;  3M4Y A;  1EIF A;  4H0L C;  3IRB A;  4B3M L;  3KJP A;  1LTL A;  2YU9 B;  2ZM6 L;  4KJO A;  4DR2 Q;  2LSS A;  3D4W A;  4C3I G;  1EIY B;  5IOC A;  3AEV A;  3BDC A;  5CV6 A;  3KLS X;  5JEA J;  4R8N A;  5CBE E;  4DK0 A;  1RIP A;  3MFY A;  1SMY D;  2OTL A;  2KCT A;  1V9P A;  3PQI A;  1HH2 P;  1I5F A;  3U4V A;  2JYO A;  4V0B A;  1O7Y A;  1VQE A;  3PF5 A;  3PO2 B;  1STH A;  2AWN A;  2WAQ G;  4R4T A;  2UXC Q;  1K83 H;  4OL7 A;  1PH6 A;  2C9O A;  4A3C G;  3HOY B;  1B3Q A;  2PYK A;  5IT9 c;  1HR0 Q;  2F0M A;  1NCV A;  4G4K A;  4HTH A;  4LUV A;  4PV1 C;  4TVA B;  5AJ3 Q;  2EYP A;  2NZ1 D;  3UI2 A;  3DM1 A;  5C3E G;  5KYL A;  3JAM c;  4L5Q A;  3I70 A;  1STY A;  1SNP A;  1K3B C;  4JI4 L;  4Y7N B;  3M3Y B;  3GTK B;  2GA4 B;  2JA9 A;  3H3V I;  1PDQ A;  1Q81 C;  5I6Y A;  4JI0 L;  2WAQ E;  2G5D A;  4L5R C;  5M5Y H;  5JVH 3;  3QB3 A;  3S2H B;  1GM5 A;  1OXU A;  2OT2 A;  3PIO A;  1NMF A;  1EUJ A;  5M3M G;  3AQQ A;  4O42 A;  4YIJ A;  1N32 L;  1I4X A;  3WOF A;  3J7A F;  4IFD G;  2EYM A;  4WJW A;  1LTT D;  2WB1 E;  2SEB D;  4MHE A;  1V43 A;  2YV5 A;  2KHJ A;  3D3R A;  1K73 C;  4A3G G;  1PTO D;  1O7I A;  3QG1 A;  1SFO H;  5CYU A;  1TS4 A;  1LT6 D;  1WTO A;  3S1Q B;  2F0L A;  4F7X A;  1J8I A;  3DEO A;  1Z9F A;  1P8L A;  2ICE C;  5IGG A;  3OW2 A;  3HRZ C;  3V05 A;  1AE2 A;  5DAU A;  1EY5 A;  2D62 A;  5IGF A;  4DV4 Q;  2E2J H;  2EYJ A;  4AYB E;  1ROD A;  1S3O A;  2K5N A;  1PRT C;  4L6T B;  4X6A H;  2J7Z A;  2AQ2 B;  1YNN D;  4GOP C;  1UWV A;  3PGZ A;  3TP6 A;  4RH6 A;  3GTQ H;  1SMY C;  3D4R A;  2RDF A;  4IZ8 A;  5GAD C;  3H3V C;  2DJG C;  1KDC A;  5A2Q E;  4JV5 L;  2AUK A;  2PMZ E;  4YCW A;  5JJI A;  1SRU A;  1ENA A;  2Y0S B;  1VQA A;  2JEA I;  2JP1 A;  3C46 A;  1MIU A;  2QEJ C;  2IX3 A;  4LFB L;  4QQB X;  1STA A;  3EQL C;  4RHR A;  2IPK D;  4K6D A;  5F2D A;  2R7F A;  1HNW L;  1ILQ A;  3NWS A;  5HGT A;  1YJ9 A;  2MUY A;  4LFC Q;  4A3K H;  3HOU B;  1JR0 D;  2F0K A;  3DXJ C;  3I4M B;  2I07 B;  4DV2 L;  3OPO A;  3U50 C;  1CHP D;  4JC0 A;  1EEI D;  3HP3 A;  4PMW A;  2DY8 A;  2MPM A;  3PUZ A;  1M1K C;  3RZO B;  2JN4 A;  5GAG C;  2HD3 A;  1IZ6 A;  3HZX A;  4YY3 L;  1SJE D;  1U5K A;  3HKZ E;  2IJ0 A;  1SSO A;  3KLS A;  1TS3 A;  2QDL A;  4C3H H;  1JJG A;  1V1Q A;  4JI5 L;  2NVT H;  2QGQ A;  3CHB D;  1E7Z A;  3KOJ A;  1DXM A;  3VYU A;  2F0W A;  2MQH A;  3C1F A;  2Q8I B;  5I2X A;  1O78 A;  5CR3 A;  5M3M H;  1BNZ A;  3K6O A;  4AH6 A;  4CJ1 B;  1TS5 A;  1B3A A;  3GV6 A;  3UDX A;  3HEJ A;  3CF5 A;  2WAC A;  1I4Q A;  3VR5 A;  4XYO A;  4A3F G;  2K4K A;  2WP8 J;  1I4P A;  3NWT A;  2KHI A;  4DV7 L;  2OF1 A;  4QGU A;  1NR4 A;  1QVC A;  2YTY A;  3HOX B;  1YVC A;  3NXW A;  2FMC A;  4OO1 H;  3G6E A;  4BS9 A;  4BA1 I;  3HOY H;  1JWS D;  5EBD A;  3FPP A;  3MFG A;  3UE0 A;  1HR0 W;  1C48 A;  2A6H D;  3K0X A;  4R4Q A;  2K5H A;  3Q8D A;  1VQ4 A;  3CCE A;  4J6H A;  3STB D;  3HOZ B;  1TWH B;  3H09 A;  2MJ8 A;  1KQS A;  1A63 A;  2XN9 C;  3RZO H;  4LJZ C;  5CGK A;  1PV4 A;  4K2L A;  2EY6 A;  3S1N B;  5EPJ A;  2JA8 B;  1Q90 A;  1BUV T;  4JI1 Q;  1R4P B;  2UXD L;  2LXJ A;  2B63 G;  1RL2 A;  1YNX A;  4YHH Q;  3L7Z C;  1S5D D;  2E74 C;  1PLF A;  1BBU A;  3STB C;  4ZUJ A;  1OXV A;  4DNR B;  1SXT A;  5C0X G;  5FJ8 G;  1BCP F;  4KN7 C;  2QCP X;  1AW7 A;  2B2T C;  3S17 H;  1HZ9 A;  1MHW C;  5HGQ A;  3URY A;  1WD1 A;  3Q24 A;  2SOB A;  1N33 L;  2R7Z B;  2B2Y C;  4QY7 A;  1CI3 M;  3LWE A;  4R4I A;  4Q5V A;  3FDT A;  4X3T A;  3HG9 A;  4LF7 L;  4YWM A;  2UXD Q;  4K6L A;  5ELO A;  1STG A;  2R93 G;  3SHL A;  3JAM L;  4DR3 L;  4V19 0;  4ME3 A;  1XPO A;  2NWG A;  1AN8 A;  1SYF A;  1IXR A;  1DM0 B;  3EBE A;  1WTR A;  2OTJ A;  2LFN A;  4GKJ L;  2WB1 G;  4OEL B;  4AYB G;  1L1O A;  1U4P A;  1G8Z D;  2HCI A;  4OX9 Q;  1IBK L;  2F0D A;  5D3D A;  2ENB A;  5EGT A;  4R1J A;  2K5V A;  1DOL A;  1HQM C;  4LAA A;  5C4X B;  2LS0 1;  1KHI A;  2K33 A;  3QWN A;  1EFI D;  2Z4H A;  2R93 B;  1EYA A;  1A8V A;  4RGM A;  1SNM A;  2OWO A;  2IL8 A;  4I65 A;  1L0Y B;  4EQP A;  4C3J G;  1KRT A;  3GQB A;  1HZA A;  3U4Z A;  1QNU A;  2CQA A;  3K7A B;  2E5L Q;  4JBK A;  4MNO A;  1XWE A;  4OX9 L;  3PV0 A;  5CV5 A;  4JI2 L;  1ICW A;  4IPH A;  1WVL A;  3SEB A;  3S17 B;  4C1N I;  1E2V A;  1QCB D;  1WTX A;  1TWF B;  1RJT A;  1PH5 A;  2JJQ A;  1I4G A;  1J6Q A;  4DK1 A;  1CA6 A;  3KLR A;  1JQY D;  2LXK A;  1VQL A;  3S14 B;  1HNW Q;  3TDQ A;  1WFQ A;  3NBI A;  1H95 A;  2ALY B;  2V1C C;  2UU9 L;  5BR8 L;  3R3O A;  4PQX A;  3R8B A;  1GKH A;  5IGE A;  3AFP A;  1F2M A;  4M1U B;  4NXM Q;  3I4N G;  4C56 C;  2ZTE A;  3J7Y W;  2ZTC A;  2R92 H;  1AFP A;  1PTO C;  1XMO Q;  3NEN A;  5NUC A;  2D5D A;  1P16 A;  3DWA A;  1YHQ A;  1B44 D;  4O2D A;  1PHJ A;  2K6A A;  3E5S A;  1IYU A;  2E2D C;  2EXZ A;  3IFD A;  2XTI A;  2QF7 A;  1F9Q A;  5C3E B;  2C5C A;  3TP7 A;  1LTA D;  3T1Y Q;  2JA6 H;  3SK5 A;  4JBM A;  4DV5 Q;  4E6I A;  3MA2 B;  3CW2 C;  4HJ5 A;  1GXD C;  2H4O A;  2RA4 A;  1A3U A;  1D8L A;  2BE5 C;  4IO9 A;  1PVO A;  1B9N A;  4B9X A;  1GVP A;  2F4I A;  2EYF A;  5JPM C;  3PUX A;  1S5E D;  1WCM G;  3PSI A;  2A5H A;  3U9S A;  3H0G H;  4CBV A;  2EY1 A;  2K5Q A;  4WOR A;  4ZCK A;  3EA6 A;  3NTK A;  1SYG A;  1CUK A;  3E0E A;  4JI6 L;  1ICF B;  3CCR A;  1SN8 A;  4A3D G;  2RCN A;  1VQ5 A;  2F0E A;  4A3B B;  1EIH A;  3K8A A;  2UUA L;  2K5W A;  1Q3L A;  1DON A;  4OXP A;  3VDY A;  3X3M A;  1VQK A;  1BXT A;  5AFW A;  4B3S L;  2RSN A;  5C0X J;  1TY2 A;  4K0K Q;  2UUB Q;  1RCV D;  1GUT A;  5L37 A;  1TVX A;  3I55 A;  1CM9 A;  4A4I A;  2R93 H;  4WJ4 A;  1MJC A;  3H0G G;  4X65 Q;  2EXD A;  1Z7T A;  4PZ6 A;  1Y1W H;  4DR3 Q;  1S5C D;  2K50 A;  4LFC L;  2EOT A;  5T1I A;  3TS2 A;  3KBX A;  3HKZ G;  2E2J B;  2JE6 I;  4IPD A;  3EN2 A;  4KHP Q;  1M90 C;  1J5E Q;  1F9P A;  2D9U A;  5IYB G;  1N33 Q;  1E2Z A;  4GZY C;  4TQU S;  2NVT B;  5CV7 A;  1X55 A;  4DV6 L;  4KD3 A;  1EY4 A;  2R61 A;  5C3E H;  2JA5 B;  2CVR A;  4TRD A;  4TSS A;  3RN2 A;  2F4V Q;  1EIG A;  4DR6 Q;  2EY5 A;  2ZM6 Q;  2RCF A;  2B3G A;  2EYL A;  4MIU A;  4HSP A;  1TWC H;  2EJF C;  3CQZ B;  4A3D B;  4KKS A;  3RLF A;  1STN A;  1B1Z A;  2FFK B;  2HHH L;  2JA8 H;  4JBW A;  4PNY A;  4BBR B;  5A35 A;  1KTK A;  3KUP A;  1KIX A;  4HJ8 A;  3SK4 A;  1ZXT A;  3KF6 B;  5M3F B;  2HIX A;  1X3G A;  1K28 A;  4QF4 A;  4DUZ L;  1I94 L;  1PH3 A;  4POF A;  3GTG H;  2BH2 A;  4A3G H;  4PMB A;  3H6M A;  3GTP H;  1F2Y A;  4FXK C;  1EQQ A;  3S14 H;  2JA6 B;  3JAM E;  4A3E B;  1HUN A;  3MEF A;  4DR5 Q;  4IUP A;  1MBY A;  5KNB A;  4X66 L;  4BY7 H;  3H0G B;  2RQX A;  3D0F A;  4DK6 C;  5KGU A;  4LWC A;  1FL0 A;  1MGS A;  5CC4 A;  4DR1 L;  1VQ8 A;  3PO2 G;  4NXM L;  2R92 B;  3HOW B;  1CTM A;  1PTO B;  1FGB D;  3E6Z X;  3QR8 A;  3GTO H;  1UE5 A;  2KCN A;  1DJR D;  3BZK A;  2NVX B;  4FO2 A;  2L4N A;  4YY3 Q;  1S5F D;  1JCK B;  2AQ3 B;  1GUS A;  3O13 A;  5LMU Q;  1R9T H;  3NEL A;  2JA7 H;  3NEM A;  2NN6 H;  1HQR D;  3KF8 B;  3M4P A;  4NP5 A;  1EZ8 A;  3MHB A;  1DOM A;  4CDC C;  4DF7 A;  1PZK D;  5GAH C;  1BR9 A;  2QKI C;  3RLO A;  4JI8 L;  1HTL D;  4JI4 Q;  1IW7 D;  2HQE A;  3PUW A;  5E4W C;  1CSQ A;  1PMR A;  1ESR A;  2NVY B;  2GN5 A;  4DV3 Q;  4OWT B;  4LF9 L;  1K3R A;  4DXF A;  1G2S A;  1FNW A;  3OYY A;  3HOW G;  1VDZ A;  5A2Q L;  3T16 A;  3LWU A;  1OO9 B;  3UDG A;  2PQA B;  2E5L L;  1UEB A;  3J81 c;  3G7L A;  4LF4 Q;  2HUG A;  2E76 C;  2XNA C;  2NVQ B;  4N8F A;  3AFQ A;  3I91 A;  1PTO F;  3HKS A;  1KL9 A;  3QO2 A;  5CMD A;  4ZLT F;  2N88 A;  2F3W A;  4AIM A;  1NUC A;  1H9S B;  5K5P A;  2JQO A;  4GNX B;  3CCJ A;  2BDO A;  1XNR L;  1S40 A;  1J9O A;  1WJJ A;  4NPS A;  1RTN A;  1HHV A;  2PZT A;  1IBM Q;  1UEA B;  1Y1V H;  2Z1C A;  5ELC A;  4UP7 A;  2RKS A;  2ZJR A;  1U4R A;  4BY1 H;  2IY5 B;  1PH9 A;  4U68 A;  4BBS G;  4DU9 A;  2BCO A;  2HDL A;  1JOR A;  3J81 i;  2ASB A;  1J5E L;  1N36 Q;  4HIK A;  1GUW A;  3M4Q A;  1LUZ A;  2EY2 A;  4CKB A;  5I2Y A;  4K5V A;  4DR2 L;  2EZV A;  3SXH A;  2X6L A;  1CZW A;  5CV8 A;  1QUQ A;  2KEC A;  1N8R C;  4DK3 C;  3VYT A;  3I8Z A;  3K57 A;  3HFZ B;  4A3M G;  5KIX A;  2VY3 A;  3TEH B;  1XNQ L;  4JI5 Q;  1YHB A;  1TXY A;  4EQN A;  1TKW B;  1WCM B;  3MC0 B;  1K9M C;  3NBH B;  4PMC A;  1BCP C;  1KNE A;  4DR4 L;  5IP9 H;  2F0J A;  1ASY A;  1TT2 A;  2HHH Q;  5FKA C;  2NVX H;  4ME5 A;  1GO3 E;  3K5M A;  4A3B G;  2ZTD A;  1ET6 A;  2N78 A;  4RKB A;  1WTP A;  4DAM A;  1JIC A;  2F0Q A;  4BXX H;  3ULL A;  4R9W A;  3I90 A;  4A3L H;  1H9S A;  1HNZ Q;  1PA6 A;  1SFO B;  1RHP A;  3RMH A;  2F03 A;  3A74 A;  2Q8R E;  2GVA A;  3KF8 A;  4IQZ A;  1K8M A;  1W6K A;  1Y1V B;  1SRO A;  2NVY H;  3HOX G;  1OXS C;  2EVB A;  5IP7 H;  4IPG A;  3VR3 A;  3BVZ A;  4NDX A;  1HFG A;  4RAU C;  1FNV A;  5FLM G;  3DLL A;  1KD1 C;  4JPB W;  4OIK A;  2PZU A;  3D4D A;  4P73 A;  4EVO A;  2FMM A;  1QZG A;  2Z8L A;  1AEX A;  4A3F H;  1PZJ D;  5E3F A;  1MSH A;  4CDF C;  3SK6 A;  2GVB A;  2NVQ H;  1D1K A;  1Q46 A;  4IOA A;  1YNJ C;  1V1P B;  3F1Z A;  1SE3 A;  2FIN B;  4HJA A;  3GV3 A;  4ULL A;  2F0V A;  4FF1 A;  3PO3 B;  2YTV A;  3SR1 A;  5IE8 A;  5M3F G;  2E8G A;  5IWA Q;  3I4L A;  4QIW B;  1G91 A;  1QOH A;  1WCM H;  4UP8 A;  1VQI A;  3CRK C;  1X3E A;  2QW7 A;  2M00 A;  5EAY A;  2BA1 A;  3BVG A;  2I5M X;  5C6A A;  4K0K L;  4DR5 L;  2CQO A;  4DAV A;  5KND A;  1N36 L;  5FOB B;  2NYZ D;  1JOO A;  5IGD A;  5E4X A;  5IP7 G;  3I56 A;  4RGO S;  3MZ5 A;  4DUY L;  1VQC A;  5IYD H;  4OON A;  1BQQ T;  4OIJ A;  5EKK A;  4FXD A;  3S1R H;  2XRQ D;  2K7V A;  2OCE A;  4ODG A;  1VQF A;  1E1T A;  3MEH A;  2RDG A;  3GTM B;  1S4Z A;  3PCO B;  4BXX G;  3R2I A;  2K1B A;  4FVM A;  4A3K B;  3CD6 A;  3A5U A;  4DV2 Q;  2AUJ D;  1WOC A;  2IT1 A;  3FKI G;  3HOU G;  2YTX A;  4LF8 Q;  5J22 A;  1YNN C;  1PH1 A;  2BOS A;  1PRT D;  2KJX A;  5KNC A;  4JK1 C;  2DNC A;  2R92 G;  2EJM A;  1EQT A;  2Y0S G;  3A54 A;  3A8K E;  1B9M A;  1GOZ A;  1TWG H;  4F88 A;  2Q2I A;  4DV0 Q;  1IYJ B;  4IAL A;  2RHS B;  3J80 i;  2AMC B;  5J3B A;  1I94 Q;  2WB1 B;  1JMC A;  1A15 A;  4GOP A;  1IBL Q;  1PTO H;  1V1P A;  1YIJ A;  3W1B A;  3I4M G;  4BY7 G;  1I4R A;  5I9O A;  1MI2 A;  1LT5 D;  3B6Y A;  3PO3 H;  4LW1 A;  4NKL A;  4H02 A;  1U4L A;  1F77 A;  1TWA B;  4L8J A;  3ND9 A;  2UU9 Q;  3P1H A;  3CAM A;  2F1M A;  5FLX L;  3I4M H;  1CA5 A;  5ELN A;  1KXL A;  4RCN A;  1G6Z A;  1EQV A;  1C7Y A;  5K36 H;  1YI2 A;  4KD4 A;  1PFB A;  3GTL H;  4HAE A;  3ONA B;  4KHZ A;  3KFU A;  1E3P A;  4G7H C;  1U4M A;  4RMF A;  3IKJ A;  3PUV A;  4HR7 B;  1XX8 A;  4JI2 Q;  1RF2 D;  1PXU A;  1FJG L;  4DGZ A;  4IUV A;  1C4Q A;  3I3C A;  3GDE A;  1VQ6 A;  4LNQ A;  3PIP 3;  4KKU A;  1I50 H;  2L1B A;  4DV1 L;  1HRJ A;  4XYQ A;  4UY8 C;  5M3F H;  3CC4 A;  1ONL A;  3A8I E;  3ER0 A;  3M85 A;  3NE5 B;  4FF2 A;  1HNX L;  1E1O A;  2VUM G;  3BG3 A;  5AJ3 L;  3K58 A;  1V8Q A;  2WV6 D;  3M7G A;  2MNA A;  4CJ0 B;  1QB5 D;  3AU7 A;  4A3E H;  4DV7 Q;  2E2I B;  3P20 A;  1TWG B;  1SYC A;  1LTR D;  3SDZ A;  4KMU C;  3CU7 A;  3DMU A;  2DUD A;  1IHZ A;  2QIL A;  4L5S A;  2N49 A;  4JYA L;  2LMC B;  4DV3 L;  3IFT A;  3ERO A;  3NBH A;  4CDD C;  3TRZ A;  3K80 C;  1HA5 A;  5C0X H;  1KAB A;  1SE4 A;  2CH4 W;  3K7U C;  2ZT9 C;  2IW3 A;  1CQV A;  5LMN L;  1EY9 A;  1IBK Q;  3EIV A;  1Q8K A;  2VUM H;  3G48 A;  3VYR A;  3T1H Q;  4UDU C;  2B8F A;  1CT1 D;  3GP7 A;  3K5N A;  1QIL A;  3BYY B;  1WYD A;  3OWF A;  3K59 A;  1EYG A;  1KLG D;  4O1N A;  1X6O A;  3KDF A;  1HR0 L;  3BYT B;  1UAP A;  3A55 A;  1K0R A;  3V2T A;  4KN4 C;  3DM3 A;  2KVM A;  1GHJ A;  3M3Y H;  5FLM H;  3CPW A;  1PFS A;  1SMX A;  2B29 A;  4BA2 I;  4DUY Q;  1X3F A;  3BZD B;  1CQF A;  1UE7 A;  3CXC A;  1Q1E A;  4QIW E; 
#chains in the Genus database with same CATH homology
 5M5Y B;  2KEE A;  3A7A B;  3TME A;  1Y69 U;  2LY7 A;  2M9V A;  4XQQ A;  4C1N K;  1C8C A;  1K8O A;  4FNF A;  2CW0 C;  3R2T A;  4UAI A;  1EZ6 A;  2V4D A;  4G7Z C;  2JA7 B;  2ID0 A;  1D6E C;  1STE A;  3IL8 A;  4KKT A;  2MP1 A;  5I6W A;  4DA2 A;  1SNC A;  5BN4 A;  3S1M B;  3FEW X;  1EYC A;  5JOB A;  2NTS A;  1I4H A;  1QJO A;  5M9O A;  5C4H A;  1LLR D;  1EY6 A;  1KNA A;  4C3I B;  3NTH A;  4P2C B;  3RZD B;  3J80 E;  2SNS A;  1TY0 A;  1SYB A;  4FYD A;  3FKI B;  4KV6 A;  1BOS A;  1RTO A;  3EJI A;  2B2V C;  2EYH A;  2NTT A;  1ZYR D;  2K01 A;  4N9P A;  4ID6 A;  3BS1 A;  5C4J B;  1ZYR C;  3BDO A;  1EEF D;  3TSS A;  4R8I A;  3OSO A;  1F9R A;  2EE1 A;  1SDF A;  1JC7 A;  3LNN A;  2TSS A;  1IW7 C;  2KQ3 A;  1BDO A;  1QNK A;  2A69 D;  3ERQ A;  2QDB A;  3MXU A;  5EKI A;  5KYI A;  3WDN A;  5EPK A;  2XRS D;  1QWY A;  2IX0 A;  1PFM A;  2OEO A;  3NPP A;  1H9M A;  2PMZ B;  4ZUI A;  5EQ0 A;  3WOE A;  5LHY 1;  3ITP A;  2F0H A;  4IUT A;  3V96 A;  3A56 A;  2F0T A;  1D1I A;  1O7Z A;  5M5W B;  1FNU A;  1EY8 A;  1LAC A;  4G7O C;  1Q8I A;  4H44 C;  4KTA A;  3T4A C;  1ET9 A;  3NHH A;  4ILW A;  5C0X I;  2CW0 D;  1SND A;  1STB A;  2PQE A;  4K5X A;  2YYZ A;  2NB0 A;  1TR5 A;  4TKO B;  5T1G A;  4DXG A;  1V1O A;  3HKZ B;  2RBM A;  1GUG A;  1W6J A;  3C1E A;  5C44 B;  1BF4 A;  1LTG D;  3GTL B;  1A6X A;  5J1Z A;  4DAP A;  3D6C A;  3DEP A;  4XQN A;  4QUF A;  1PRT F;  4EGV A;  1KLU D;  3AMU A;  3OMC A;  4DFA A;  1ILP A;  1ENF A;  2F0O A;  1AZQ A;  2O2L D;  5C5L A;  3D31 A;  1HUM A;  2OXP A;  4HCE A;  4OHJ A;  4IN3 A;  4KHV A;  3QOL A;  3NQI A;  2K32 A;  3OW7 A;  2L5T A;  3VR6 A;  2O5J C;  1EY0 A;  1WTV A;  1LT3 D;  4Z9C B;  1JWM D;  3FVQ A;  1FR3 A;  4BBS B;  3AB9 A;  4HMI A;  2VXW A;  4ZRZ A;  5M5X B;  2ZXO A;  4A3G B;  5K36 G;  3NTI A;  5FLX E;  3NUC A;  2PO4 A;  1RDP D;  2A6E C;  5COR A;  1RKN A;  1KDA A;  2ZXP A;  5ELD A;  4S3S A;  4BY7 B;  2B63 B;  3VYS A;  1NSN S;  2DY7 A;  1K83 B;  1DYQ A;  4A3I B;  2H1E A;  5ELB A;  1EU3 A;  4BWG B;  2VB3 X;  1LV9 A;  1I50 B;  4CHT B;  4AYB B;  2AWO A;  3SE0 A;  3NP8 A;  4DNT B;  2A73 B;  2B2V A;  5EPL A;  4EQO A;  1SNO A;  5IT9 L;  1TQO A;  3GTO B;  5BN5 A;  2WKC A;  1I6V C;  1LT4 D;  1KAA A;  1XXG A;  4F8M A;  3HOV B;  3A7L A;  4FP5 D;  1EL0 A;  2K04 A;  1T5E A;  3TZD A;  4CKE A;  2IX1 A;  2WAQ B;  2E2H B;  2AQ1 B;  1F9S A;  2KED A;  1BO0 A;  1CHQ D;  3TBI B;  5DM7 3;  2CHB D;  1WTW A;  2MGS A;  5JJZ A;  4IFD J;  4FF4 A;  2B2W C;  1D2B A;  2B2U A;  4ZK9 B;  1QG7 A;  1Y1W B;  2F0I A;  1II3 A;  1BCP B;  5EBC A;  3N6R A;  4ZAI A;  2VB2 X;  5C5M A;  5D14 A;  5DM6 3;  1G29 1;  1SNQ A;  3ND8 A;  2WIN B;  2NUC A;  1FD7 D;  1YNJ D;  3K5L A;  5LL6 X;  5EJW A;  1A2T A;  1EWH A;  4XT1 B;  4NW2 A;  1EWC A;  3DUZ A;  3K0Y A;  5CV9 A;  3W3A A;  2JSO A;  1AZP A;  2K5D A;  3CRL C;  3MTS A;  2EPB A;  3X3N A;  1Y8P B;  1DZ1 A;  5BN3 A;  3J80 L;  1Z6H A;  2L0C A;  4M8A A;  2A69 C;  1R9T B;  1SBB B;  3MXP A;  3NQT A;  3H91 A;  4RKL A;  3EFX D;  1KDB A;  1B50 A;  2RSO A;  4LK1 C;  3P7J A;  3RUZ A;  1PFN A;  1GJX A;  2MHV A;  4XQJ A;  3GD7 A;  1SEB D;  1OXT A;  3C2P A;  3S1R B;  1D5X C;  3Q6S A;  1GUO A;  2L55 A;  5CBA E;  2A68 D;  3BVM A;  4RCO A;  1ESF A;  1T5X D;  3N52 A;  1X32 A;  2F3V A;  1MD2 D;  4RHS A;  2B2Y A;  3GTP B;  3R93 A;  4H7B A;  3LX0 A;  4K14 A;  4H13 C;  4IFD I;  4HED A;  1B2T A;  2PPB C;  4RWS C;  2LKV A;  3T13 A;  4KK7 A;  3M4O B;  1EU4 A;  3KK7 A;  2BA0 A;  1TU2 B;  1SYE A;  4J1M A;  4K8J A;  2TMP A;  3GTJ B;  2VNU D;  1AP0 A;  5J39 A;  1JOK A;  1M8A A;  4NMZ A;  3VR2 A;  4XDX A;  1CK1 A;  5KRU A;  2NN6 I;  2O5I C;  5C3W A;  4IFD H;  4OO1 G;  2EYO A;  1HCZ A;  3A8J E;  4K8I A;  4IUQ A;  5JPN C;  3MXN A;  1VMC A;  1TII D;  5CV4 A;  1HA6 A;  4OGQ C;  3QOJ A;  3MVV A;  1O80 A;  5D65 A;  3TP5 A;  5I4D A;  3L3O C;  2O4X A;  2K05 A;  4HMJ A;  5IGB A;  1F2L A;  2B39 A;  3FPU B;  5ISR A;  2JEB I;  3SK8 A;  5E1F A;  1RD9 D;  4XIG S;  2NBF A;  2N55 A;  3G6J B;  1SJH D;  1SAP A;  2B2W A;  5ELF A;  3NSW A;  1HPC A;  1JB3 A;  1B53 A;  2A74 C;  3I4N B;  2KHS A;  4F87 A;  1O7L A;  3T53 B;  5TSS A;  2J4X A;  2L11 A;  1VF5 C;  2E75 C;  2VUM B;  2I46 A;  4B9W A;  5JEA H;  2Q8T A;  1HXY D;  1B4O A;  1GHK A;  5IOD A;  1IL8 A;  1Z47 A;  2F0N A;  4X3K A;  5ELE A;  3MWY W;  5KEE A;  3M7N A;  3OHX C;  3HS0 C;  2Z4I A;  4ZQ3 A;  4J8Q A;  4CKC A;  3TP8 A;  2L12 A;  1H9K A;  2PW7 A;  5FO7 B;  4Q0F A;  1SE2 A;  4WRD A;  4A3F B;  4ZKC B;  5JEA G;  2PCF B;  4C3J B;  3MXG A;  3KBG A;  1LO5 D;  2B8G A;  4KY6 A;  1H9R A;  4CJ2 C;  4LMQ D;  1R4Q B;  1DD2 A;  4KI0 A;  2XVS A;  2R3Z A;  4C2M B;  4IUR A;  4U67 3;  1F2Z A;  1LTB D;  2XWB B;  1TS2 A;  2F0F A;  5HUR A;  4ZYS A;  3T51 B;  1HFN A;  1G2T A;  4QMG A;  3S15 B;  4QCL A;  2KUM A;  3Q0A A;  1I6H B;  3ZYY X;  2L9H A;  3OOC A;  2RDH A;  2PNR C;  3T56 B;  1PZI D;  1S5B D;  2SDF A;  4FF3 A;  2K03 A;  2A68 C;  1GUN A;  1H9J A;  1IYV A;  5IGC A;  1Y8N B;  3S9W A;  4C3H G;  3HGB A;  4RFB A;  1BBX C;  2BE5 D;  3TN2 A;  3S2D B;  4OO1 I;  1EYD A;  4KY7 A;  1PYW D;  5DNF A;  4XTC S;  2XIW A;  5LL6 S;  3H94 A;  4A3M B;  2F0S A;  2KOL A;  3J81 L;  3SVM A;  2ZXR A;  2G9H D;  2D2C C;  3F2U A;  4FXG C;  2KA7 A;  3OMG A;  4L63 B;  1OXX K;  1ZEQ X;  1LTI D;  3W2D A;  4IUU A;  3GTQ B;  5C4Z A;  4RGT A;  1JOQ A;  3DHQ A;  4HSV A;  1NR2 A;  4N9T A;  1WD0 A;  3D8G A;  3TZU A;  1ML0 D;  2F0U A;  1A2U A;  2BDN A;  1D5M C;  3QJY A;  2XSC A;  1VMP A;  4ZKB B;  4B08 A;  1X3Q A;  4QUC A;  1MSG A;  2M2L A;  4RA8 A;  4A93 B;  2RVL A;  3NK9 A;  4RGN A;  3PMF A;  4G57 A;  2WII B;  1LAB A;  5DEH A;  4XT3 B;  5IT9 E;  3Q23 A;  2ICI A;  3GO5 A;  4A3J B;  1E2W A;  2NN6 G;  4C3H B;  5FO8 B;  1X3P A;  2DNE A;  3U9O A;  1DCZ A;  3QIA A;  1IKM A;  2WKD A;  1IKL A;  3CKI B;  3K5O A;  1E0B A;  2JXM B;  3PIO 3;  4KJN A;  2J0T D;  1ENC A;  1CFM A;  1XTC D;  5G3L F;  3VA7 A;  1XYI A;  3VA5 A;  5C3X A;  2X6G A;  1DOK A;  2X69 A;  2IWH A;  3BDL A;  2HCC A;  3RD4 A;  2FJ2 A;  3IAY A;  1A3V A;  1WTQ A;  3J7A V;  2F0G A;  4K2K A;  1I3Q B;  2B2T A;  3DWP A;  1PRT B;  3OWE B;  4I7Z C;  2EDG A;  1JWU D;  4X3U A;  3FMC A;  5G3L D;  4CGY B;  5M3M B;  2XWJ B;  3OIQ A;  1UUP A;  3L9A X;  1EY7 A;  1JE4 A;  3I73 A;  3I72 A;  2PZW A;  1L0X B;  3P75 A;  1LTS D;  4MN3 A;  4K5W A;  5I9P A;  2DN8 A;  2FHT A;  2EJG C;  2F0P A;  2G9D A;  5EKL A;  2A6E D;  2HDM A;  5IIF A;  5COY A;  3GTG B;  1NAP A;  4HN7 A;  5FK9 C;  5FO9 B;  1Y8O B;  1VCI A;  2A6H C;  3EVQ A;  3Q22 A;  2K28 A;  2PW5 A;  3D6W A;  3FRP B;  5JAV A;  1SYD A;  4BY1 B;  1VF7 A;  1Q12 A;  4WFN 3;  1TWC B;  1FYC A;  1HTP A;  3S16 B;  2B2U C;  1M4V A;  4XXE A;  4DAY A;  5JVG 3;  1A3T A;  1QE6 A;  1EOT A;  4HCS A;  1D5Z C;  1ZKO A;  1CZG A;  2R6G A;  4DN4 M;  4QB4 A;  4IUN A;  3VR4 A;  3DWQ A;  3PUY A;  3C3L A;  2KCC A;  1BCP D;  1UNS A;  5D3I B;  3J81 E;  4KY5 A;  1Q1B A;  4X3S A;  3MAQ A;  2SNM A;  3E0J A;  3OIP A;  4ABN A;  1U9R A;  3M4Y A;  4H0L C;  2YU9 B;  4KJO A;  3D4W A;  4C3I G;  5IOC A;  3BDC A;  5CV6 A;  3KLS X;  5JEA J;  4R8N A;  5CBE E;  4DK0 A;  3MFY A;  1SMY D;  2JYO A;  4V0B A;  1O7Y A;  3PO2 B;  1STH A;  2AWN A;  4OL7 A;  2C9O A;  3HOY B;  2PYK A;  2F0M A;  1NCV A;  4G4K A;  4HTH A;  4PV1 C;  2EYP A;  2NZ1 D;  3UI2 A;  3DM1 A;  5KYL A;  3I70 A;  1STY A;  1SNP A;  4Y7N B;  3M3Y B;  3GTK B;  2GA4 B;  1PDQ A;  5I6Y A;  5JVH 3;  3QB3 A;  3S2H B;  1OXU A;  2OT2 A;  4O42 A;  4YIJ A;  1I4X A;  3WOF A;  3J7A F;  4IFD G;  2EYM A;  4WJW A;  1LTT D;  2SEB D;  4MHE A;  1V43 A;  3D3R A;  1PTO D;  3QG1 A;  5CYU A;  1TS4 A;  1LT6 D;  1WTO A;  3S1Q B;  2F0L A;  4F7X A;  1J8I A;  3DEO A;  2ICE C;  5IGG A;  3HRZ C;  3V05 A;  5DAU A;  1EY5 A;  2D62 A;  5IGF A;  2EYJ A;  1ROD A;  1PRT C;  4L6T B;  2J7Z A;  2AQ2 B;  1YNN D;  3TP6 A;  4RH6 A;  1SMY C;  3D4R A;  2RDF A;  4IZ8 A;  3H3V C;  5A2Q E;  1KDC A;  2AUK A;  1ENA A;  2Y0S B;  2JEA I;  2JP1 A;  3C46 A;  2QEJ C;  2IX3 A;  1STA A;  3EQL C;  4RHR A;  2IPK D;  4K6D A;  5F2D A;  1ILQ A;  3NWS A;  5HGT A;  2MUY A;  3HOU B;  1JR0 D;  2F0K A;  3DXJ C;  3I4M B;  2I07 B;  3OPO A;  1CHP D;  1EEI D;  3HP3 A;  4PMW A;  2DY8 A;  2MPM A;  3PUZ A;  3RZO B;  3HZX A;  1SJE D;  2IJ0 A;  1SSO A;  3KLS A;  1TS3 A;  3CHB D;  1DXM A;  3VYU A;  2F0W A;  3C1F A;  2Q8I B;  5I2X A;  1O78 A;  5CR3 A;  1BNZ A;  3K6O A;  4CJ1 B;  1TS5 A;  1B3A A;  3GV6 A;  3HEJ A;  2WAC A;  1I4Q A;  3VR5 A;  4XYO A;  2WP8 J;  1I4P A;  3NWT A;  2OF1 A;  1NR4 A;  3HOX B;  3NXW A;  2FMC A;  4OO1 H;  4BS9 A;  4BA1 I;  1JWS D;  5EBD A;  3FPP A;  3MFG A;  1C48 A;  2A6H D;  4J6H A;  3HOZ B;  1TWH B;  3H09 A;  2MJ8 A;  2XN9 C;  4LJZ C;  5CGK A;  4K2L A;  2EY6 A;  3S1N B;  5EPJ A;  2JA8 B;  1Q90 A;  1BUV T;  1R4P B;  3L7Z C;  1S5D D;  2E74 C;  1PLF A;  4ZUJ A;  1OXV A;  4DNR B;  1SXT A;  5C0X G;  1BCP F;  4KN7 C;  2QCP X;  1AW7 A;  2B2T C;  3URY A;  1WD1 A;  3Q24 A;  2SOB A;  2R7Z B;  2B2Y C;  1CI3 M;  3LWE A;  4Q5V A;  3FDT A;  4X3T A;  3HG9 A;  4K6L A;  1STG A;  3SHL A;  3JAM L;  4V19 0;  2NWG A;  1AN8 A;  1SYF A;  1DM0 B;  1WTR A;  2LFN A;  1U4P A;  1G8Z D;  2HCI A;  2F0D A;  5D3D A;  2ENB A;  5EGT A;  1DOL A;  1HQM C;  4LAA A;  5C4X B;  2LS0 1;  2K33 A;  3QWN A;  1EFI D;  2Z4H A;  2R93 B;  1EYA A;  4RGM A;  1SNM A;  2IL8 A;  4I65 A;  1L0Y B;  4EQP A;  4C3J G;  3GQB A;  1QNU A;  2CQA A;  3K7A B;  1XWE A;  3PV0 A;  5CV5 A;  1WVL A;  1ICW A;  3SEB A;  3S17 B;  4C1N I;  1E2V A;  1QCB D;  1WTX A;  1TWF B;  1RJT A;  1I4G A;  4DK1 A;  1CA6 A;  3KLR A;  1JQY D;  3S14 B;  3TDQ A;  3NBI A;  3R3O A;  4PQX A;  3R8B A;  5IGE A;  1F2M A;  4M1U B;  4C56 C;  3J7Y W;  1AFP A;  1PTO C;  5NUC A;  2D5D A;  3DWA A;  1B44 D;  2K6A A;  3E5S A;  1IYU A;  2E2D C;  2EXZ A;  3IFD A;  2QF7 A;  1F9Q A;  5C3E B;  2C5C A;  3TP7 A;  1LTA D;  3SK5 A;  4E6I A;  3MA2 B;  1GXD C;  2H4O A;  2RA4 A;  1A3U A;  2BE5 C;  1B9N A;  4B9X A;  2F4I A;  2EYF A;  5JPM C;  3PUX A;  1S5E D;  3U9S A;  2A5H A;  4CBV A;  2EY1 A;  2K5Q A;  4WOR A;  3EA6 A;  3NTK A;  1SYG A;  2F0E A;  4A3B B;  1EIH A;  2K5W A;  1Q3L A;  1DON A;  3X3M A;  1BXT A;  5AFW A;  2RSN A;  5C0X J;  1TY2 A;  1RCV D;  1GUT A;  1TVX A;  1CM9 A;  1Z7T A;  1S5C D;  2EOT A;  5T1I A;  3KBX A;  2E2J B;  2JE6 I;  1F9P A;  2D9U A;  1E2Z A;  4GZY C;  4TQU S;  2NVT B;  5CV7 A;  4KD3 A;  1EY4 A;  2R61 A;  2JA5 B;  2CVR A;  4TRD A;  4TSS A;  1EIG A;  2EY5 A;  2EYL A;  4MIU A;  4HSP A;  2EJF C;  3CQZ B;  4A3D B;  4KKS A;  3RLF A;  1STN A;  1B1Z A;  2FFK B;  4JBW A;  4PNY A;  4BBR B;  5A35 A;  1KTK A;  3KUP A;  3SK4 A;  1ZXT A;  5M3F B;  4QF4 A;  4PMB A;  3H6M A;  1F2Y A;  4FXK C;  2JA6 B;  3JAM E;  4A3E B;  1HUN A;  4IUP A;  1MBY A;  5KNB A;  3H0G B;  2RQX A;  5KGU A;  1MGS A;  5CC4 A;  2R92 B;  3HOW B;  1CTM A;  1PTO B;  1FGB D;  3E6Z X;  2KCN A;  1DJR D;  2NVX B;  4FO2 A;  2L4N A;  1S5F D;  1JCK B;  2AQ3 B;  1GUS A;  3O13 A;  2NN6 H;  1HQR D;  4NP5 A;  1EZ8 A;  3MHB A;  1DOM A;  4DF7 A;  1PZK D;  1BR9 A;  2QKI C;  1HTL D;  1IW7 D;  2HQE A;  3PUW A;  5E4W C;  1ESR A;  1PMR A;  2NVY B;  4DXF A;  1G2S A;  1FNW A;  1VDZ A;  5A2Q L;  3T16 A;  3LWU A;  1OO9 B;  3G7L A;  2HUG A;  2E76 C;  2XNA C;  2NVQ B;  3I91 A;  1PTO F;  3QO2 A;  5CMD A;  4ZLT F;  2N88 A;  2F3W A;  1NUC A;  1H9S B;  5K5P A;  2BDO A;  1J9O A;  1RTN A;  1HHV A;  2PZT A;  1UEA B;  2Z1C A;  5ELC A;  2RKS A;  1U4R A;  4U68 A;  4DU9 A;  2BCO A;  2HDL A;  1JOR A;  1GUW A;  4CKB A;  2EY2 A;  5I2Y A;  4K5V A;  2EZV A;  3SXH A;  2X6L A;  1CZW A;  5CV8 A;  2KEC A;  3VYT A;  3I8Z A;  3K57 A;  5KIX A;  4EQN A;  1TKW B;  1WCM B;  3MC0 B;  4PMC A;  1BCP C;  1KNE A;  2F0J A;  1TT2 A;  5FKA C;  4ME5 A;  3K5M A;  1ET6 A;  4RKB A;  1WTP A;  1JIC A;  2F0Q A;  4R9W A;  3I90 A;  1H9S A;  1SFO B;  1RHP A;  3RMH A;  2F03 A;  2Q8R E;  3KF8 A;  4IQZ A;  1K8M A;  1W6K A;  1Y1V B;  1OXS C;  2EVB A;  3VR3 A;  3BVZ A;  4NDX A;  1HFG A;  4RAU C;  1FNV A;  4OIK A;  2PZU A;  3D4D A;  4EVO A;  2FMM A;  2Z8L A;  1AEX A;  1PZJ D;  5E3F A;  1MSH A;  3SK6 A;  1D1K A;  1YNJ C;  1V1P B;  1SE3 A;  2FIN B;  3GV3 A;  4ULL A;  2F0V A;  4FF1 A;  3PO3 B;  3SR1 A;  3I4L A;  4QIW B;  1G91 A;  1QOH A;  3CRK C;  2M00 A;  2BA1 A;  3BVG A;  5C6A A;  4DAV A;  5KND A;  5FOB B;  2NYZ D;  1JOO A;  5IGD A;  5E4X A;  4RGO S;  3MZ5 A;  1BQQ T;  4OIJ A;  5EKK A;  4FXD A;  2XRQ D;  2K7V A;  4ODG A;  3MEH A;  2RDG A;  3GTM B;  1S4Z A;  3R2I A;  2K1B A;  4FVM A;  4A3K B;  2AUJ D;  2IT1 A;  5J22 A;  1YNN C;  2BOS A;  1PRT D;  2KJX A;  5KNC A;  4JK1 C;  2DNC A;  2EJM A;  1EQT A;  3A54 A;  3A8K E;  1B9M A;  4F88 A;  1GOZ A;  4IAL A;  2WB1 B;  1A15 A;  1PTO H;  1V1P A;  1I4R A;  5I9O A;  1MI2 A;  1LT5 D;  4NKL A;  1U4L A;  1F77 A;  1TWA B;  4L8J A;  3ND9 A;  3P1H A;  2F1M A;  5FLX L;  1CA5 A;  4RCN A;  1G6Z A;  1EQV A;  5K36 H;  4KD4 A;  1PFB A;  4HAE A;  3ONA B;  4KHZ A;  4G7H C;  1U4M A;  3IKJ A;  3PUV A;  4HR7 B;  1XX8 A;  1RF2 D;  1PXU A;  4DGZ A;  4IUV A;  1C4Q A;  3I3C A;  3PIP 3;  4KKU A;  2L1B A;  1HRJ A;  4XYQ A;  1ONL A;  3A8I E;  3M85 A;  3NE5 B;  4FF2 A;  3BG3 A;  3K58 A;  1V8Q A;  2WV6 D;  3M7G A;  4CJ0 B;  1QB5 D;  3AU7 A;  2E2I B;  3P20 A;  1TWG B;  1SYC A;  1LTR D;  3SDZ A;  4KMU C;  3CU7 A;  3DMU A;  1IHZ A;  2QIL A;  2LMC B;  3IFT A;  3ERO A;  3NBH A;  1HA5 A;  5C0X H;  1KAB A;  1SE4 A;  2ZT9 C;  2IW3 A;  1CQV A;  1EY9 A;  3VYR A;  4UDU C;  2B8F A;  1CT1 D;  3K5N A;  3GP7 A;  1QIL A;  3BYY B;  3OWF A;  3K59 A;  1KLG D;  4O1N A;  3BYT B;  1UAP A;  3A55 A;  3V2T A;  4KN4 C;  2KVM A;  1GHJ A;  4BA2 I;  3BZD B;  1CQF A;  1Q1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...