4BWGB

Structural basis of subtilase cytotoxin subab assembly
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
95
Chain Sequence
VVITQFHTGQIDNKPYFCIEGKSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords SUBA
publication title Structural Basis of Subtilase Cytotoxin Subab Assembly.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 95
sequence length 99
chains with identical sequence C, D, E, F, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4bwgB00
1LT4D 1LTBD 1JR0D 1EFID 1JWMD 1D5MC 3BYTB 1LTGD 1RDPD 1FNVA 1JWUD 5ELDA 1L0YB 1CT1D 3W2DA 1EWCA 5FKAC 1TY0A 1XTCD 3DWQA 1SBBB 1DJRD 1UUPA 2XRSD 4Z9CB 1EU4A 4BWGB 1ENFA 1F77A 1ESFA 1HTLD 1G8ZD 4RH6A 3R2TA 3EFXD 1JCKB 2NTSA 4RGNA 1S5ED 1SJHD 1TS4A 4UDUC 1PTOF 1RF2D 2IJ0A 2TSSA 3TSSA 1B44D 1D5XC 2NTTA 1I4XA 3KLSX 1GOZA 1BCPD 2QILA 2RDGA 3GP7A 4DXFA 2ICIA 4DXGA 1STEA 4L63B 1HA5A 1LT6D 1PTOH 2WV6D 3BZDB 4RGOS 1UNSA 1LT5D 1D5ZC 1PZID 4RCOA 1S5FD 2RDHA 1LTSD 1CQVA 4RHSA 1CK1A 1BCPC 1EU3A 1RCVD 1XXGA 1I4HA 2G9HD 3OWEB 1D6EC 1LTRD 5FK9C 1V1OA 1TS5A 4K6LA 5D3DA 1QILA 4RFBA 3DWAA 1I4PA 2IPKD 2QEJC 3R8BA 5ELCA 1SE4A 1BXTA 4C56C 1B1ZA 3R2IA 1SEBD 1FGBD 1PRTB 1BCPB 1PRTD 1SXTA 1TS2A 1CHPD 1I4GA 5TSSA 1M4VA 2SEBD 3BVGA 1S5BD 1I4RA 2Z8LA 2XRQD 3EA6A 1LTAD 1AW7A 2AQ1B 1S5CD 1HQRD 2O2LD 5ELFA 3MC0B 1FNUA 1PTOD 1TY2A 2XN9C 1T5XD 3O13A 1S5DD 1PRTC 4RGMA 5D3IB 1PZJD 3DWPA 1L0XB 4OHJA 4L6TB 2CHBD 3BYYB 1DYQA 1CHQD 1PTOC 1HXYD 1V1PB 1SE2A 4RHRA 2XNAC 2R61A 4TSSA 1JQYD 1LT3D 2AQ3B 2J4XA 1PYWD 1LO5D 1AN8A 1KTKA 5ELEA 1LTTD 1MD2D 3CHBD 1JWSD 1SE3A 3V05A 4RGTA 1ET9A 3BVMA 1ET6A 1KLUD 4ZYSA 1V1PA 1RD9D 4O1NA 1PZKD 1KLGD 1LTID 1LLRD 1SJED 1PTOB 1I4QA 2AQ2B 1PRTF 1BCPF 1FD7D 1EEFD 1EEID 3URYA 3BVZA 1TS3A 3MFGA 1FNWA 3SEBA 5I4DA 5ELBA
chains in the Genus database with same CATH superfamily
5EQ0A 3E5SA 2F0KA 4JCVE 3BYTB 2F0HA 2LSSA 1B3QA 2VUMG 1HTPA 2JA7B 3M85A 5EPJA 3EIVA 5CV6A 3TQYA 2AMCB 4P74A 2IHEA 2JA8G 3EROA 4FNFA 4P75A 1V1QA 5IIFA 3GTMB 5DNFA 1XTDA 3NQIA 5IYDG 1UEBA 2MO1A 4S3SA 2IJ0A 3A8IE 3TSSA 2UUAQ 4ID6A 2DY8A 2QILA 3PSIA 4YCVA 3H15A 1QCBD 2F4VL 4NDXA 5FO7B 4KKSA 3OTOL 4A4IA 3WOEA 1XYIA 2ALYB 1VQBA 2V1CC 1H9MA 4QCLA 4A3LH 2L9HA 1I4HA 1D8LA 2G9HD 4IUVA 2L15A 2F0DA 2OQ0A 4TKOB 1TKWB 5BR8Q 3UDIA 1W6JA 2ZXOA 3EQLC 3Q8DA 1P8LA 4UP7A 4YWMA 1JC7A 3UDXA 2F0SA 3NQTA 4OELB 5J39A 3PIPA 2WP8J 4BY7G 5IGGA 4L5TA 3C3LA 3NE5B 1YNJD 4PV1C 5HGTA 3GTKH 2VZAA 2JEAI 2A68D 2WACA 4LFCQ 3STBC 4DV2L 1X3QA 1EY7A 2E5LL 1L0XB 3S1RH 2R93B 1EQQA 3DM3A 3TEHB 1QE6A 2LKVA 3TDQA 3I7FA 1M90C 2F0WA 2PQAA 3GTPH 3CHBD 1QOHA 5CV8A 2EOTA 5IGCA 5KRUA 3JAMc 4R9WA 1KLGD 3I4LA 4HCEA 2D0PA 2PI2A 1PTOB 4HN7A 1MJCA 3QB3A 1ASYA 3EBEA 4ZAIA 4DPGA 2EY6A 3IFDA 4LFBL 3K8AA 1EY6A 3OIQA 1E1OA 1LT4D 1Q7YC 4PG3A 2OCEA 1L1OB 3F8TA 2UU9L 3I4NH 4CDCC 1Y1WH 1STBA 3VYTA 2B2TA 2EPBA 3D8GA 4ILWA 1W2BA 1B7YB 4FXGC 4JI7Q 4HJ5A 5LL6X 1DOLA 4JI8L 1YITA 2F4VQ 4A3FH 1TWHH 1AE3A 3OTOQ 4KY7A 1MHWC 4DAVA 2NTTA 1X65A 3S1NH 1JE5A 3A54A 1UE5A 1STEA 4QUCA 3DLLA 2XIWA 3HOZG 3HOYH 3EN2A 2N8NA 3RNUA 1R4QB 5JJZA 4FF2A 2UUBL 3E0EA 3PF5A 3QO2A 1TS5A 2EJMA 5IYBH 5M3FH 3RZOH 4X65L 4L5RC 1VQEA 4IN3A 5T1IA 1XPRA 3TN2A 4OIKA 2CVRA 3J7AV 1S5BD 3L0OA 1KABA 4CDFC 1LTAD 3F1ZA 4O2DA 1Y69U 2E5LQ 1K83H 2I07B 5ELFA 1ICWA 4BXXH 4HIDA 5IYCH 2E2HB 4C3JB 4X62Q 4OHJA 3J81i 1A3VA 2B2UA 1PTOC 2B2YC 3OMGA 1O80A 1I5FA 3CP0A 4FVMA 1LT3D 3KLSA 4K0KQ 1QB5D 4HSVA 2DN8A 1RIPA 4C3HH 3NTIA 3KOJA 5IP7G 3V05A 5K5PA 2MQHA 1LM0A 5I6YA 4IFDJ 4WJ3M 4G7HC 4LFBQ 3I72A 1L1OC 2RCNA 3CRLC 2Z4IA 3NK9A 1EQRA 3H6MA 1WTXA 1FYCA 4UAIA 1TVXA 1X32A 4I65A 3NWTA 4FYDA 4MIUA 1U0LA 2R92H 2EY2A 5LL6S 4NKLA 4HJ9A 2N3SA 5K36H 4KLKA 1FGUA 3K5OA 4CJ1B 2F0TA 3AB9A 4XQQA 1YIJA 3AMUA 1ZEQX 3TP5A 2A6HC 4GN3B 1HUNA 4BWGB 1JJCB 1F77A 1WI5A 4PMWA 4DR7Q 1Q12A 4KHPL 4KY5A 2L0CA 1PFMA 1K0RA 4LUVA 1B3AA 3QOJA 5KNCA 4EQPA 1P16A 4WRDA 1BBXC 3I4MH 2K50A 2PCFB 3NP8A 3KLSX 3PMFA 2ICIA 3A74A 2SNSA 2KEDA 1PH7A 1HCZA 4JI1L 1SDFA 2UUBQ 1PZID 5NUCA 1S72A 4XYOA 1CK1A 4HAEA 1ILPA 3U9SA 4X65Q 4DAMA 2Q2IA 1F2MA 2QDLA 3FDTA 3Q0AA 5M3MB 2FINB 3OIPA 4DK3C 2B63B 1STAA 5ELNA 1SXTA 4JW0A 1CI3M 2N49A 1B8AA 4A3CH 1TWFB 2K32A 1LUZA 5C0XJ 3S14H 3MFYA 1Q82C 5E7NA 3EA6A 5CV7A 4LFAL 2QKIC 4FF3A 1C4QA 2EXZA 3K7AB 4QUFA 3W1GA 4K8IA 4RMFA 1X3FA 4A3BG 1OXUA 1ONLA 5C3EH 1XNRL 5FOBB 4ODGA 2EVBA 1G2TA 3L2PA 2R61A 4IO9A 1A62A 4EQNA 5KYIA 1PYWD 4GS3A 4GZYC 3Q24A 4A93G 4IPDA 4PNYA 5JEAH 3HOUB 1E2WA 1HZ9A 3BVMA 2CWAA 2VB2X 2F0QA 1NJIC 1X3GA 1SJED 4CKCA 1Z6HA 4B3SQ 4APVA 3NBHB 3MFGA 3GDEA 1I50H 3OHXC 4JOIC 3G7LA 2NN6H 3SK8A 4XDXA 4HJ7A 1EFID 2EDGA 1E1TA 4XYQA 2VUMB 5ELDA 2EY1A 2Z6KC 5CV4A 4A3DH 2EIFA 2JA8B 3GQBA 3GTOH 1UE7A 1HR0L 3H3VC 3MTSA 1PV4A 1H9RA 4H44C 3HS0C 4JOIA 4JI1Q 1B44D 3SE0A 1GKHA 4IQZA 5GAHC 3J7YW 2KCMA 2RF4A 1WCMG 1KL9A 3TRZA 5GROA 1CFMA 3H0GH 1ZYRD 4FO2A 1F2ZA 3MWYW 1S5FD 2BOSA 1X3PA 5DM73 2VQFL 3C2PA 2A8VA 1STGA 2L55A 3M4OH 4AYBG 4DV1Q 5DAUA 2R7ZG 3G4SA 1C9OA 1IHZA 1BBUA 1K9MC 3R8BA 2HQEA 1U4MA 4DU9A 1B1ZA 4C3IG 1KDCA 4LFAQ 4WFN3 4G7OC 4BY7B 2AQ1B 1U4PA 3EVQA 2PYKA 1L0WA 4DGZA 2YTXA 3GTJH 1FNUA 1XNRQ 2F3IA 3IAYA 4A3IH 3MXPA 2IW3A 2E2JB 3J81L 1PH5A 1YJWA 1YNXA 3D3RA 2WKCA 1XNQL 1HNZL 3I55A 2PNRC 4RHRA 1Y8NB 2HIXA 3WWVA 2F0NA 1JORA 2NB0A 2J4XA 2GN5A 4XQNA 3LGJA 4LJZC 5C3XA 1WTOA 1SRUA 1HZCA 4RGTA 4OEMB 3CD6A 4Y52H 3PO3B 1X3EA 4IUNA 4ZYSA 3ZYYX 2KCCA 3FKIH 1E2VA 3MA2B 2K6AA 2KCTA 3CPFA 5FLMG 2EE1A 3LNNA 2ZJPA 1U9RA 2B29A 5I4DA 2MNAA 3GTLB 4UY8C 3RLNA 1D5MC 4DV7L 1HFGA 1EYGA 1WD1A 2JXMB 1PFSA 1XTCD 1SYGA 1AEXA 2PW7A 1YI2A 1AFPA 2XWJB 1LV9A 1C0AA 4DNTB 1VQFA 3HOVG 1BKBA 1HR0Q 2E2IH 3D4DA 4C2MH 1ML0D 1TWGB 3OYYA 4I7ZC 1HPCA 1WTPA 1HH2P 3MZ5A 1Y1VG 2JA6G 1QVCA 3T51B 3E9HA 1WYDA 1M8AA 5C4JB 4YWLA 5T1GA 2FMMA 2CW0D 4IALA 1G2SA 4DA2A 3EJIA 3SDZA 4X64L 2VQFQ 1WJJA 1HA5A 4NB3A 1LT6D 5C5MA 1FL0A 3HOZB 1D5ZC 4GOPA 3P7JA 3L7ZC 3NSWA 5C6AA 4LF5Q 3D6CA 2JYOA 5CR3A 3K0XA 2BE5C 1IYUA 3HKZG 3KJPA 5FK9C 3X3NA 1G91A 1V1OA 1SMYC 4OWXB 1BOSA 1SROA 1EWIA 3QJYA 4IFDH 1N9WA 3Q23A 4AQYL 2PW5A 3CCLA 2BCOA 1TS2A 1PRTB 2L4NA 4A3JH 1GUGA 5CV9A 2Q2TA 5M5XH 3H3VH 3T1YQ 3J80i 2WAQG 1XNQQ 1GUOA 4BY1G 1HNZQ 2I5LX 5M3MH 3S15B 3H91A 1IKLA 2WKDA 2B63H 3HOXB 5H1SE 3PO2G 3PUWA 1CA6A 4KI0A 5FJ8G 5LMNL 4CGYB 1HFNA 1JB7A 1KTKA 2B2VC 3KBXA 1KQSA 4B08A 1KXLA 1SNPA 1ET9A 3M7GA 1JE4A 2B39A 1XMOL 1I4QA 2AQ2B 5LHY1 4JI0Q 1K3RA 1BCPF 1EIYB 1QVGA 3CRKC 5E1FA 1CQFA 3CAMA 1CTMA 3Q6SA 3NUCA 2B8FA 3HOWG 4LFCL 2NUCA 3PIO3 3P75A 1SFOH 1KNEA 1VQJA 1RDPD 1JWUD 3A56A 4KHVA 2J0TD 5M5YB 1TY0A 4LAAA 3F2DA 4L5SA 2ZM6L 2H4OA 1I94L 2F3WA 3MEFA 3GTQH 2AHOB 4A3GG 4U673 1EUJA 5C0XH 1EL0A 4K8JA 4X64Q 1GD7A 1F9SA 1RF2D 2UXBL 4ME3A 1KDAA 3TP7A 1I4XA 3S24A 4A3EH 1GOZA 5IE8A 4A76A 3C1FA 2JA8H 1RODA 4RGOS 3X3MA 1F2LA 3I56A 4E6IA 1GUWA 3S16B 2NVTB 3I91A 3NTHA 1HRJA 2Z9HA 2JA5H 5IYDH 4DNIA 3W1BA 1LTRD 2X6GA 3VA7A 4AQYQ 3UE0A 4JI4L 4XT1B 5JEAJ 4K5VA 3WOFA 3QR8A 2HUGA 3AU7A 4K5WA 2HIVA 4TVAB 4UP8A 1K73C 3AEVA 2HD3A 2GVAA 4JI7L 1PRTD 3PUZA 5C4ZA 1G291 2Z6BA 2IT1A 2ASBA 4CKEA 3K5MA 3BZKA 3W5OA 1OTCA 4XIGS 4GKJL 1JJGA 3HZXA 4R4CA 3NBIA 5D14A 2AWNA 3U9OA 5LMNQ 1DONA 4F87A 5C4XH 2MGSA 1SMXA 2PZTA 2M9VA 1I3QB 1YNJC 3OMCA 2A68C 1BO0A 1EOTA 4DN4M 1QUQA 5E4XA 3K6OA 2EY5A 5M9OA 4A93B 1XMOQ 3VDYA 1I6HH 2QW7A 4MNOA 4PZ7A 3S2DB 2Y0SG 1ASZA 2MHVA 4XTCS 3VYUA 2E2JH 1RD9D 4PZ8A 3CMEA 4BS9A 4DR6L 4OO1I 3D4RA 1O78A 4NPSA 4OGQC 4P2CB 1WTVA 2V4DA 2SOBA 2C35B 3AFQA 4A3LG 4L8JA 1RL2A 2EYPA 1LTBD 2P5ZX 1YZ6A 4NXML 3CCRA 4X62L 3PO3H 4JI3L 3L9AX 2VW9A 2RA4A 1NAPA 2ZM6Q 1D2BA 3W3AA 1I94Q 2B2TC 3BJUA 2AKWB 3CCSA 1IZ6A 1EWCA 5FKAC 1G6PA 4JYAL 2E8GA 2K28A 4K0KL 3FMCA 1EY5A 4OWWB 5IGDA 1J5EQ 2K04A 3TZDA 4OL7A 1NUCA 1CZWA 2KENA 3CCVA 5JVH3 1A15A 2UXBQ 1X55A 2Z1CA 4ZKBB 3B6YA 4AIMA 3T13A 3R93A 2ID0A 1VQ5A 4B3RL 1WCMB 3RMHA 1PLFA 2RDGA 4RA8A 5IGEA 3GP7A 3KYHC 3S1MB 5I9OA 1EIGA 2YU9H 5IGFA 3RR5A 3ZJYC 1IYJB 4YWKA 4RCOA 3GD7A 1GHKA 2CWPA 4R1JA 1IBLL 3M9BA 4JI4Q 4HSPA 2XWBB 3RZDH 4IOCA 1DGSA 1F2YA 1MI2A 2OF1A 2JK8A 4CDDC 3OWEB 3J80E 5IGBA 1J9OA 3CQZH 5E4WC 4AYBB 4BA2I 2R7ZB 1QILA 4IUUA 1J6QA 2QEJC 5LMNW 2EYFA 1S40A 2OEOA 4DR7L 1DM0B 3A7AB 4C3IB 4GKJQ 2PI2E 3GV6A 1CM9A 3A5ZB 4XQJA 2SEBD 4FF1A 2UXDL 1EIHA 2UXCQ 1JJ2A 3J80L 4A3KB 1H9KA 2BDNA 4Y7NB 1Y1WG 1S5DD 4K2LA 5KGUA 1HZBA 1KDBA 4X3TA 2B2UC 3MEHA 4A3MG 2ZTEA 4H7BA 4KJOA 1V9PA 2X6LA 4HIKA 1C7YA 2ZXRA 1UE1A 4KN4C 2JP1A 4J8QA 4DK0A 3FPUB 1AN8A 4A3FG 2H5XA 4RCNA 1BUVT 5I2YA 1JWSD 1XMQL 1DZ1A 4DR6Q 1W6KA 3AQQA 1ET6A 2KECA 3HOXH 2YTYA 3FPPA 3VR3A 2KJXA 4M8AA 1UE6A 2R7FA 4NXMQ 3HOYG 1FVIA 4MTNA 1Z47A 4JI3Q 4DV3L 2I5HA 1VQCA 4F88A 5J1ZA 1Q90A 2K03A 4JYAQ 5IYBG 4GKKL 3K7UC 2SDFA 3LWUA 4WORA 1BNZA 1R9TH 3FHWA 2N78A 1TWAH 4H02A 5IOCA 3J80c 4B3ML 4WJ4A 1MBYA 4K5XA 1BDOA 4BBRH 3DM1A 1ENCA 2XRSD 4Z9CB 3SHLA 3G6JB 5BN5A 3FRPB 1ENFA 2L12A 3GTGH 1V8QA 1HTLD 1Q1BA 5KIXA 4OO1G 3DEOA 3R2TA 3GV3A 3TS0A 4BXXG 5IYCG 4B3RQ 1ILQA 5JJIA 1Y1VB 4ZK9B 2JA6B 1NCVA 2G5DA 2OQKA 4IUTA 1K8MA 1IXRA 4B3SL 1PH8A 2NN6I 4LWCA 3MAQA 1Q3LA 1IBLQ 3I2ZA 2IX1A 3M3YB 2NVQB 1OXTA 1SSOA 3SXHA 4C3HG 1IL2A 5C4HA 4ZCKA 1EU3A 1RJTA 1SYCA 2IX0A 3P20A 4BBSH 3HKZB 2KEEA 1T9HA 3A8JE 1GJXA 2RQXA 5IY0A 2UXDQ 5GQOA 3CC7A 4LF9Q 2A6EC 1SE4A 4QL5A 5DLQE 1CZGA 2JA7H 1GXDC 4IUPA 2R92G 3AYHB 2K01A 1A0IA 3S16H 4PQXA 1PH9A 5K36G 1UAPA 3BZCA 2Q2UA 4R4OA 5CV5A 4N8X1 3I70A 2WAQB 2A5HA 1HA6A 2OTLA 4BY1B 1ZXTA 3UI2A 4PZ6A 1ZKOA 3GTMH 2CCZA 4JC0A 2K7VA 2F0IA 3PO2B 1Y14B 2C9OA 5FLXL 3E9IA 5KYLA 5CBAE 1HXYD 2HCCA 1XMQQ 3SGIA 4GNXA 5GAEC 2JA9A 4DFAA 4DV1L 2B8GA 3I4MG 2I0QA 3PQIA 2HHHL 2NYZD 2RHSB 2MUYA 4DV3Q 2PMZB 1E24A 2L11A 4FF4A 1WD0A 3U58A 3VR5A 1VQKA 4GKKQ 1N33L 3C46A 4EX5A 2DJGC 2PZUA 3BS1A 2VNUD 1JR0D 3HOWB 1AH9A 4ZLTF 2KOLA 4B3MQ 3S2DH 2XGTA 1IBML 5JPNC 2ZTCA 4DF7A 5C44G 3F2BA 1TWCB 3I73A 3IFTA 4PMCA 4DR1L 1PH6A 4KKTA 4A3CG 1WTHA 3E0JA 2R93H 2LXKA 2XVSA 4IPCA 1BR9A 1PXUA 3MXGA 4A3GB 1IBKL 2BDOA 4V0BA 5JVG3 4NP5A 4RGNA 4ZUIA 1VMCA 1PTOF 2KBNA 2DNEA 3UDFA 2PPBC 5DM63 2GA4B 5C3EG 4JBMA 1H9SA 2CFMA 4JBWA 1BVSA 1ESRA 2FHTA 2BH2A 1PTOH 3NXWA 3KF8B 2F0JA 3PUYA 2RDHA 1YNND 5E3FA 1QZGA 5IP9G 1GUNA 1ZYRC 4ALPA 4C1NK 3V2TA 3PIOA 2L1BA 2ATWA 4GOPB 4OX9L 1I4PA 4LF7Q 4BA1I 2F0EA 1EYAA 4C56C 3CCEA 1SYFA 5BN3A 1IW7D 1T5EA 5TSSA 2NN6G 2Q8TA 1M4VA 1YJNA 4IUQA 1SN8A 4HMIA 2IY5B 1PVOA 2IWHA 2BA1A 3QOLA 2EXDA 2R7ZH 4RGMA 5IT9E 4K14A 4JV5L 1EY4A 4A3DG 1PDQA 2A1AA 4GN5A 2K5HA 3BYYB 4LF5L 4JI5Q 4RKBA 3M7NA 2XNAC 2KVMA 5G3LF 2ENBA 1LO5D 4A3KH 2HHHQ 3MXNA 3J81E 5ELEA 4IFDI 4J1MA 3FVQA 5IT9L 3S2HB 1DOKA 4DAPA 2NBFA 3ERSX 4RG1A 1B4OA 3A0JA 1N33Q 5M5WB 3H0GG 5D65A 2NVXB 2OWOA 2QDBA 4LF4L 5IODA 3T1YL 1HQMC 3BVZA 3SK6A 1IBMQ 1GUSA 4CDEC 3AFPA 3QG1A 4DR1Q 4A75A 5A35A 1VMPA 1GVPA 3HRZC 4ZKCB 1JMCA 3VYSA 1H95A 2A69D 3NELA 2E2HH 3W2DA 4C3JH 2K1BA 1IBKQ 5GAGC 3JAMi 2F1MA 4WJWA 1ESFA 1A3TA 1G8ZD 1VF7A 3KK7A 3OOCA 2LXJA 5J3BA 2NTSA 2EJFC 4KD3A 2K05A 3U4VA 4JI0L 1SNCA 4A3IG 2F0FA 4U68A 1O7YA 3S1RB 1EY8A 4HJ8A 4YHHL 1FJGL 1BCPD 3SK4A 3CCQA 4GOPC 5IWAL 2RSOA 5CYUA 4F7XA 3CKIB 2ZJRA 3ERQA 3GTPB 3TS2A 3BDOA 1NSNS 2AWOA 2CW0C 1PH3A 4OX9Q 2PMZE 5AFWA 3ND8A 3J81c 3WDNA 2IHFA 3FKIG 3NEMA 3KF8A 2DUDA 5BN4A 3ER0A 1B53A 3K80C 3N6RA 5EKKA 5C0XI 2NVQH 1SNQA 5DEHA 4DK6C 1Y8PB 3K5LA 3S1QB 5EPKA 1D7QA 1I4RA 4JV5Q 2F03A 1MSGA 2RSNA 2YTVA 2AUKA 2LMCB 1S5CD 1TY2A 3NTKA 4IPGA 3ND9A 1CKNB 1Y1WB 4ULLA 4YIJA 1J8IA 1E2ZA 3DWPA 5CBEE 3D6WA 4QIWB 4DV0L 4A3MB 3OPOA 4L6TB 3G48A 3PCOB 4DR5L 2M00A 4NW2A 1SE2A 3KF6B 3T56B 1NBWA 1HZAA 3UDGA 4A3FB 1TWHB 3OSOA 3TP8A 4J6HA 1FR3A 1E0BA 3S1NB 1CUKA 4DUYL 4LF4Q 4DR4L 3PO2H 1VQAA 1QUQB 1HUMA 3HOYB 3K0YA 4KHZA 1Q86C 3URYA 4N8FA 1KAWA 4FP5D 2B2WA 1C48A 3KBGA 4G4KA 4FXDA 2MO0A 3NWSA 3CC2A 1TWFH 1PFBA 1LYLA 3LX0A 3RZOB 1LTGD 5I2XA 4R8IA 2JQOA 4QB4A 2Q8IB 2WINB 4IFDG 2K75A 3ONAB 4KY6A 1DJRD 3K7AH 4UHVA 4A3JG 2MPMA 1BQQT 1SNDA 2I46A 1VQ4A 1K83B 2WB1G 1ICFB 4YHHQ 1FJGQ 1SAPA 5IWAQ 1TXYA 4CHTB 3K81C 3FEWX 3HGBA 2EYLA 3VR4A 1YVCA 1C8CA 3HOUH 4IOAA 4HIOA 2JE6I 3S17B 1AP0A 3A5UA 2D5DA 2GVBA 4C1NI 1CQVA 4C3HB 1B50A 4QQBX 5EGTA 3IRBA 4AH6A 4DAYB 2KHSA 3HG9A 1EOVA 1EYDA 3J7AF 1VQHA 1VS0A 2QGQA 2B3GA 1J5EL 2VUMH 3S9WA 4ABNA 2R92B 3CF5A 4N9PA 2XRQD 4KMUC 4GLXA 1TT2A 4DV0Q 1A8VA 4DV4L 3O13A 4DR5Q 1PRTC 3G71A 5JJKA 1VQMA 1MSHA 4LF8L 3ULJA 3J7ZC 2MP1A 1N34Q 1EY9A 2F3VA 3NENA 4LUZA 3MHBA 1WOCA 5C0XG 1CKNA 4DUYQ 2IX3A 4LF6Q 4DR4Q 5A2QL 4JBJA 3PF4A 1XWEA 3I4MB 3IL8A 4A3EG 2KCNA 5EBCA 1B2TA 4L5QA 1SR3A 3KF6A 1LTID 1VQ9A 5EJWA 2UXCL 1EEID 1KIXA 4B3TL 3JAME 5CGKA 4MN3A 2JA5G 4A3BB 2HDMA 2LS01 4LW1A 1ENAA 1X9NA 3S2HH 3R3OA 3TMEA 1TQOA 4OIJA 3HKSA 4GLVB 4BY7H 2E74C 4HTHA 5M5WH 5C44B 2EYOA 2ZJQA 1L0YB 2NVXH 2O5JC 3A7LA 3M4YA 1PH4A 1TU2B 2FJ2A 2NVYB 3C1EA 3M4QA 4R4QA 3JAML 1BF4A 3S14B 5AJ3Q 3SK5A 1A2TA 4O42A 4X3SA 4JBKA 4J15A 2OXPA 1MIUA 1RHPA 3MXUA 4QIWE 5JAVA 2K5DA 1S5ED 1SJHD 1UWVA 1RKNA 5C4XG 2RBMA 2MJ8A 5C3EB 1WTWA 1E22A 3KFUA 1Z7TA 2JSOA 1YEZA 1WTRA 5L37A 1OXSC 1VQPA 1L2FA 5EPLA 4RWSC 1I6VC 4IZ8A 1YHQA 2A19A 4Q0FA 4UP9A 3GTLH 4DNRB 3OWFA 4K6LA 2CH4W 1NR4A 4X66Q 3KUPA 2FXQA 4MHEA 1BXTA 1QNUA 4G57A 4CBVA 3DXJC 1I50B 4DAYA 1K0SA 3RD4A 4DV4Q 2PNHA 1CHPD 3STBD 3PO3G 1TWGH 4FDBA 1K3BC 3M4PA 4LF8Q 2XN9C 1T5XD 4OWTB 2RVLA 2KHIA 5CC4A 1PZJD 4K6DA 4ME5A 4MTKA 3OW2A 4A3DB 4JVZA 3GO5A 3OW7A 5C4JH 3SR1A 4DV5L 3S1QH 4LK1C 4X3UA 1Q46A 2X69A 3GTOB 1SYBA 2QCPX 1EY0A 1AE2A 3HOZH 2F0PA 4OXPA 3U50C 1G6ZA 1GHJA 1NY4A 4HJAA 4LF9L 2Z4HA 2PZWA 2VY3A 4A3MH 4GNXB 4B3TQ 4TQUS 3H0GB 1QWYA 2JEBI 3I4NG 1PRTF 1VQOA 5HY6A 1WTQA 5EKLA 4P71A 2UUCL 3J7A5 5C5LA 4NXNL 3DUZA 1FNWA 1QZHA 3CCMA 3H94A 3M4OB 4HMJA 2K5WA 1JWMD 4K2KA 2J7ZA 3T16A 3JC66 2ZTDA 3E3XA 1LABA 2F0UA 4ZRZA 3KLWA 4CJ2C 4KV6A 4CJ0B 3DWQA 3S15H 1B9MA 1UUPA 3TREA 5KNBA 2VS1A 4Q5VA 1PA6A 2CKZB 3GTJB 1KD1C 1IKMA 1DCZA 2R6GA 1Z9FA 1JCKB 4KJNA 1SLJA 1U4LA 1II3A 2Z0SA 4RKLA 1TS4A 4GN4B 4DR2L 4A3IB 1QG7A 4KK7A 1WVLA 5IP7H 3CPWA 3BG3A 5C3WA 5KEEA 5M3FG 1HHVA 3TZUA 3FP9A 4DV2Q 1UNSA 1AZQA 1LT5D 4OO1H 3QIAA 3RLOA 3NHHA 2DNCA 4JG2A 3I4OA 3HOVB 3DEPA 1JOKA 3HOXG 1H9SB 2RDFA 2VXWA 4H13C 4MZ9A 3FKIB 1YHBA 3HP3A 3DWAA 3S17H 1XPUA 1CSQA 5M5YH 4X6AH 2K5VA 1F9RA 1PYBA 1FGBD 2N55A 1I4GA 1Q8KA 5JJLA 2F4IA 2Q2HA 4EQOA 3D31A 1JOQA 3KJOA 1S3OA 2L5TA 3TBIB 1IL8A 1JICA 2O2LD 5HURA 1PTOD 4QMGA 4DV5Q 3NPPA 2OTJA 2QA4A 4BBRG 1TIID 1EQVA 3K58A 1N8RC 1HJPA 4JI2L 4GNXC 2UU9Q 2E2IB 4C2MB 1Y8OB 1V1PB 1VCIA 4EVOA 2A73B 4RAUC 2B2YA 1DD2A 4NMZA 1CSPA 1MD2D 2CQOA 5FLXE 2DGYA 2K52A 4LF7L 2NVTH 1O7ZA 3L3OC 3PUXA 2UUCQ 4NXNQ 4JI8Q 2F0VA 2R3ZA 1K28A 1MKHA 2M2LA 5I9PA 3QWNA 1FD7D 1EEFD 1Q1EA 3MXNB 1L1OA 4O0AA 1XX8A 1R4PB 3ICEA 1N32L 3BU2A 1IYVA 4BBSG 5ELBA 3RN5A 3T1HL 2VL6A 2A6HD 3CXCA 4IURA 2PQEA 2K5QA 4DR3L 3CW2C 1NMFA 2OT2A 4JI5L 4M1UB 1CKMA 2D9UA 2JA7G 1A3UA 1NE3A 4V190 4A3JB 3RLFA 2EZVA 2NZ1D 2A6ED 1DXMA 5M5XB 1JOOA 1KC8C 4A3BH 5G3LD 3PIP3 4DR2Q 3D0FA 1I3QH 2WB1B 3EFXD 1KRSA 5JPMC 3P1HA 2KQ3A 1K8AC 1STNA 4AYBE 5C44H 1VQ6A 3F2CA 4A93H 4PMBA 1KHIA 1STHA 4QJFA 1X56A 2WFWA 2NVYH 2ZT9C 4DXFA 4DXGA 2O4XA 4IPHA 3H09A 4RHSA 4KTAA 3ULLA 4JK1C 1VQGA 2E75C 2I5MX 3DMUA 2FFKB 1YHAA 4DUZL 3TP6A 1NMGA 1VF5C 5FLXc 5D3DA 1QNKA 1YNNC 4POFA 5ELCA 1OXVA 1HNXL 3R2IA 3RN2A 1EIFA 1BCPB 1EFWA 2TMPA 5LMUL 4QF4A 4JI6L 3ITPA 1SFOB 2K14A 1A63A 5IP9H 2Z8LA 1AW7A 2QEXA 3SVMA 4G7ZC 4JI2Q 1E3PA 3VA5A 3A55A 3CCJA 1IW7C 2DJFC 5JEAG 1NR2A 3U4ZA 4R4IA 3GTQB 2R93G 1SNMA 1DYQA 1WCMH 1DOMA 1U4RA 2D62A 4B9WA 4B9XA 1QVFA 3BDLA 5CORA 3S1MH 2FMCA 2AQ3B 2XSCA 1M1KC 1CA5A 3CMAA 2HT1A 4FXKC 4I7AA 3KDFB 4ZUJA 4QGUA 4KHPQ 4DV6L 4A3EB 1HNWL 2R7DA 2EQSA 2VB3X 1V1PA 1PZKD 3UE1A 1N32Q 4TRDA 5ISRA 3T4AC 2JN4A 3A8KE 3T1HQ 3DHQA 4N9TA 1K8OA 4KD4A 1B9NA 1TS3A 3PGZA 2JA5B 4C3IH 4DR3Q 3T53B 3PUVA 2F0MA 2F0OA 1O7LA 1OXXK 3F2UA 2ES2A 1YJ9A 4R4TA 3BDCA 1CT1D 2F0LA 4OONA 4Y7NH 4HR7B 5I6WA 2Y0SB 3LWEA 4LUOA 2Z6KA 2JJQA 1EU4A 3H3VI 4DK1A 1SE8A 2A69C 2ZXPA 4GLAC 1PH2A 1EWHA 3HKZE 2RCFA 1N36L 4UDUC 5C4XB 5J22A 4UPAA 4HEDA 5ELOA 2NZHA 2KHJA 2KA7A 4L63B 3K59A 1PMRA 1A2UA 4A3KG 2NWGA 4DUZQ 5FLMH 1I6HB 4ZQ3A 5HGQA 3D4WA 1BCPC 1XXGA 3CU7A 2WAQE 3ULPA 1VDZA 1HNXQ 1D6EC 2CH4A 5GADC 2O5IC 2MFIA 2QF7A 5FO9B 3GTKB 2IPKD 1PH1A 5LMUQ 4JI6Q 1NNXA 4LMQD 2EYHA 3BVGA 5IT9c 1BBWA 1F9PA 4X3KA 4YCWA 5F2DA 1GUTA 1X6OA 5EKIA 3HOVH 4EQ5A 4XXEA 5D3IB 1PFNA 1Y1VH 1K8GA 2JA6H 4C3JG 2WB1E 1F9QA 1VQDA 1GM5A 3I90A 2HQLA 3M3YH 4TSSA 4DV6Q 1HNWQ 4DKAC 2HDLA 1SYEA 1G51A 3NBHA 4LNQA 1B70B 1LTTD 1SE3A 1YBYA 2BH8A 1H9JA 2YV5A 4H0LC 2HCIA 3VR6A 3CCUA 1D1IA 2LFNA 5FO8B 2VQEL 4O1NA 2YU9B 3I4NB 2ICEC 1EYCA 1LACA 1KRTA 3V96A 4YY3L 1SNOA 5JOBA 1RTNA 2B2WC 3RZDB 3KDFA 1XPOA 2A74C 1AZPA 3VR2A 2F52A 4JPBW 2SNMA 3E6ZX 3CQZB 4P72A 1VQIA 1U5KA 2EJGC 4P73A 1FNVA 2PO4A 1N34L 4BY1H 3MVVA 4POGA 1XJVA 1PYSB 1SBBB 3Q22A 2G9DA 5EAYA 4LF6L 3J81j 5KNDA 1N36Q 4KKUA 2RHQB 3I3CA 4HCSA 4RH6A 1GO3E 5FJ8H 1TR5A 1RTOA 1QJOA 2K5NA 1EZ6A 2RKSA 4IJLA 1EZ8A 4IJHA 1VQLA 2TSSA 1D5XC 5COYA 3G6EA 5M3FB 2CQAA 2BE5D 2AUJD 2WV6D 3BZDB 2WIIB 2UUAL 4EGVA 2DY7A 1VQNA 1SMYD 1VQ8A 1LTSD 1SYDA 3IKJA 1RCVD 1WFQA 1EQTA 3CC4A 1S4ZA 3KLRA 3K5NA 3HOWH 3HEJA 1W3SA 4RFBA 5M3MG 2EYJA 5AJ3L 1Q8IA 2NZOA 2B63G 1TWCH 1Q81C 1MGSA 2E2DC 1SEBD 1MJEA 5BR8L 1VQ7A 2YYZA 1UEAB 4HIMA 1PHJA 1HQRD 1X54A 4A3GH 2BA0A 2Y0SE 3MC0B 1R9TB 1TWAB 1OO9B 2C5CA 2PQAB 1V43A 4YCUA 3RUZA 2LY7A 4BBRB 1E7ZA 1NTGA 2H1EA 4DV7Q 2XTIA 2E76C 2F0GA 2CHBD 3GTGB 1HR0W 1CHQD 3N52A 5EBDA 3PV0A 3VYRA 2IL8A 1JT8A 2K4KA 1LTLA 1JQYD 1KAAA 3K57A 4F8MA 2KUMA 1STYA 2VQEQ 4CKBA 2N88A 2K33A 5CMDA 2B2VA 1D1KA 4X66L 1JB3A 4YY3Q 1KNAA 1O7IA 3HOUG 2Q8RE 1KLUD 2D2CC 2D0OA 1A6XA 3I8ZA 2EYMA 3HFZB 1LLRD 5A2QE 4QY7A 4KN7C 4XT3B 4R8NA 1CKOA 4BBSB 3SEBA
chains in the Genus database with same CATH topology
5EQ0A 3E5SA 2F0KA 3BYTB 2F0HA 1HTPA 2JA7B 3M85A 5EPJA 5CV6A 3EROA 4FNFA 5IIFA 3GTMB 5DNFA 3NQIA 4S3SA 2IJ0A 3A8IE 3TSSA 4ID6A 2DY8A 2QILA 1QCBD 4NDXA 5FO7B 4KKSA 3WOEA 1XYIA 1H9MA 4QCLA 2L9HA 1I4HA 2G9HD 4IUVA 2F0DA 4TKOB 1TKWB 1W6JA 2ZXOA 3EQLC 1JC7A 2F0SA 3NQTA 5J39A 2WP8J 5IGGA 3C3LA 3NE5B 1YNJD 4PV1C 5HGTA 2JEAI 2A68D 2WACA 1X3QA 1EY7A 1L0XB 2R93B 1QE6A 2LKVA 3TDQA 2F0WA 3CHBD 1QOHA 5CV8A 2EOTA 5IGCA 5KRUA 4R9WA 1KLGD 3I4LA 4HCEA 1PTOB 4HN7A 3QB3A 4ZAIA 2EY6A 3IFDA 1EY6A 3OIQA 1LT4D 1STBA 3VYTA 2B2TA 2EPBA 3D8GA 4ILWA 4FXGC 5LL6X 1DOLA 4KY7A 4DAVA 2NTTA 3A54A 1STEA 4QUCA 2XIWA 1R4QB 5JJZA 4FF2A 3QO2A 1TS5A 2EJMA 4IN3A 5T1IA 3TN2A 4OIKA 2CVRA 3J7AV 1S5BD 1KABA 1LTAD 1Y69U 2I07B 5ELFA 1ICWA 2E2HB 4C3JB 4OHJA 1A3VA 2B2UA 1PTOC 2B2YC 3OMGA 1O80A 4FVMA 1LT3D 3KLSA 1QB5D 4HSVA 2DN8A 3NTIA 3V05A 5K5PA 5I6YA 4IFDJ 4G7HC 3I72A 3NK9A 3CRLC 2Z4IA 3H6MA 1WTXA 1FYCA 4UAIA 1TVXA 1X32A 4I65A 3NWTA 4FYDA 4MIUA 2EY2A 5LL6S 4NKLA 5K36H 3K5OA 4CJ1B 2F0TA 3AB9A 4XQQA 3AMUA 1ZEQX 3TP5A 2A6HC 1HUNA 4BWGB 1F77A 4PMWA 1Q12A 4KY5A 2L0CA 1PFMA 1B3AA 3QOJA 5KNCA 4EQPA 4WRDA 1BBXC 2PCFB 3NP8A 3KLSX 3PMFA 2ICIA 2SNSA 2KEDA 1HCZA 1SDFA 1PZID 5NUCA 4XYOA 1CK1A 4HAEA 1ILPA 3U9SA 1F2MA 3FDTA 3Q0AA 5M3MB 2FINB 3OIPA 2B63B 1STAA 1SXTA 1CI3M 1TWFB 2K32A 5C0XJ 3MFYA 3EA6A 5CV7A 2QKIC 4FF3A 1C4QA 2EXZA 3K7AB 4QUFA 4K8IA 1OXUA 1ONLA 5FOBB 4ODGA 2EVBA 1G2TA 2R61A 4EQNA 5KYIA 1PYWD 4GZYC 3Q24A 4PNYA 5JEAH 3HOUB 1E2WA 3BVMA 2VB2X 2F0QA 1SJED 4CKCA 1Z6HA 3MFGA 3OHXC 3G7LA 2NN6H 3SK8A 4XDXA 1EFID 2EDGA 4XYQA 2VUMB 5ELDA 2EY1A 5CV4A 2JA8B 3GQBA 3H3VC 3MTSA 1H9RA 4H44C 3HS0C 1B44D 3SE0A 4IQZA 3J7YW 1CFMA 1ZYRD 4FO2A 1F2ZA 3MWYW 1S5FD 2BOSA 1X3PA 5DM73 3C2PA 1STGA 2L55A 5DAUA 1IHZA 3R8BA 2HQEA 1U4MA 4DU9A 1B1ZA 4C3IG 1KDCA 4WFN3 4G7OC 4BY7B 2AQ1B 1U4PA 4DGZA 2PYKA 3EVQA 1FNUA 3IAYA 3MXPA 2IW3A 2E2JB 3J81L 3D3RA 2WKCA 2PNRC 4RHRA 1Y8NB 1JORA 2F0NA 2NB0A 2J4XA 4XQNA 4LJZC 5C3XA 1WTOA 4RGTA 3PO3B 4IUNA 4ZYSA 3ZYYX 2KCCA 1E2VA 3MA2B 2K6AA 2EE1A 3LNNA 1U9RA 5I4DA 3GTLB 1D5MC 1HFGA 1WD1A 2JXMB 1XTCD 1SYGA 1AEXA 2PW7A 1AFPA 2XWJB 1LV9A 4DNTB 3D4DA 1ML0D 1TWGB 4I7ZC 1HPCA 1WTPA 3MZ5A 3T51B 1M8AA 5C4JB 5T1GA 2FMMA 2CW0D 4IALA 1G2SA 4DA2A 3EJIA 3SDZA 1HA5A 1LT6D 5C5MA 3HOZB 1D5ZC 3P7JA 3L7ZC 3NSWA 5C6AA 3D6CA 2JYOA 5CR3A 2BE5C 1IYUA 5FK9C 3X3NA 1G91A 1V1OA 1SMYC 1BOSA 3QJYA 4IFDH 3Q23A 2PW5A 2BCOA 1TS2A 1PRTB 2L4NA 1GUGA 5CV9A 1GUOA 3S15B 3H91A 1IKLA 2WKDA 3HOXB 3PUWA 1CA6A 4KI0A 4CGYB 1HFNA 1KTKA 2B2VC 3KBXA 4B08A 1SNPA 1ET9A 3M7GA 1JE4A 2B39A 1I4QA 2AQ2B 5LHY1 1BCPF 3CRKC 5E1FA 1CQFA 1CTMA 3Q6SA 3NUCA 2B8FA 2NUCA 3PIO3 3P75A 1KNEA 1RDPD 1JWUD 3A56A 4KHVA 2J0TD 5M5YB 1TY0A 4LAAA 2H4OA 2F3WA 4U673 5C0XH 1EL0A 4K8JA 1F9SA 1RF2D 3TP7A 1KDAA 1I4XA 1GOZA 3C1FA 1RODA 4RGOS 3X3MA 1F2LA 4E6IA 1GUWA 3S16B 2NVTB 3I91A 3NTHA 1HRJA 1LTRD 2X6GA 3VA7A 4XT1B 5JEAJ 4K5VA 3WOFA 2HUGA 3AU7A 4K5WA 1PRTD 3PUZA 5C4ZA 1G291 2IT1A 4CKEA 3K5MA 4XIGS 3HZXA 3NBIA 5D14A 2AWNA 3U9OA 1DONA 4F87A 2MGSA 2PZTA 2M9VA 1I3QB 1YNJC 2A68C 3OMCA 1BO0A 1EOTA 4DN4M 5E4XA 3K6OA 2EY5A 5M9OA 4A93B 3S2DB 2MHVA 4XTCS 3VYUA 1RD9D 4BS9A 4OO1I 3D4RA 1O78A 4OGQC 4P2CB 1WTVA 2V4DA 2SOBA 4L8JA 2EYPA 1LTBD 3L9AX 2RA4A 1NAPA 1D2BA 3W3AA 2B2TC 1EWCA 5FKAC 2K28A 3FMCA 1EY5A 5IGDA 2K04A 3TZDA 4OL7A 1NUCA 1CZWA 5JVH3 1A15A 2Z1CA 4ZKBB 3T13A 3R93A 2ID0A 1WCMB 3RMHA 1PLFA 2RDGA 4RA8A 5IGEA 3GP7A 3S1MB 5I9OA 1EIGA 5IGFA 1GHKA 4RCOA 3GD7A 4HSPA 2XWBB 1F2YA 1MI2A 2OF1A 3OWEB 3J80E 5IGBA 1J9OA 5E4WC 4AYBB 4BA2I 2R7ZB 1QILA 4IUUA 2QEJC 2EYFA 2OEOA 1DM0B 3A7AB 4C3IB 3GV6A 1CM9A 4XQJA 2SEBD 4FF1A 1EIHA 3J80L 4A3KB 1H9KA 2BDNA 4Y7NB 1S5DD 4K2LA 5KGUA 1KDBA 4X3TA 2B2UC 3MEHA 4H7BA 4KJOA 2X6LA 2ZXRA 4KN4C 2JP1A 4J8QA 4DK0A 3FPUB 1AN8A 4RCNA 1BUVT 5I2YA 1JWSD 1DZ1A 1W6KA 1ET6A 2KECA 3FPPA 3VR3A 2KJXA 4M8AA 1Z47A 4F88A 5J1ZA 1Q90A 2K03A 2SDFA 3LWUA 4WORA 1BNZA 5IOCA 1MBYA 4K5XA 1BDOA 3DM1A 1ENCA 2XRSD 4Z9CB 3SHLA 3G6JB 5BN5A 3FRPB 1ENFA 2L12A 1V8QA 1HTLD 1Q1BA 5KIXA 4OO1G 3DEOA 3R2TA 3GV3A 1ILQA 1Y1VB 4ZK9B 2JA6B 1NCVA 4IUTA 1K8MA 2NN6I 3MAQA 1Q3LA 3M3YB 2IX1A 2NVQB 1OXTA 1SSOA 3SXHA 4C3HG 5C4HA 1EU3A 1RJTA 1SYCA 2IX0A 3P20A 3HKZB 2KEEA 3A8JE 1GJXA 2RQXA 2A6EC 1SE4A 1CZGA 1GXDC 4IUPA 2K01A 4PQXA 5K36G 1UAPA 5CV5A 2WAQB 3I70A 2A5HA 1HA6A 4BY1B 1ZXTA 3UI2A 1ZKOA 2K7VA 2F0IA 3PO2B 2C9OA 5FLXL 5KYLA 5CBAE 1HXYD 2HCCA 4DFAA 2B8GA 2NYZD 2MUYA 2PMZB 2L11A 4FF4A 1WD0A 3VR5A 3C46A 2PZUA 3BS1A 2VNUD 1JR0D 3HOWB 4ZLTF 2KOLA 5JPNC 4DF7A 1TWCB 3I73A 3IFTA 4PMCA 4KKTA 3E0JA 2XVSA 1BR9A 1PXUA 3MXGA 4A3GB 2BDOA 4V0BA 5JVG3 4NP5A 4RGNA 4ZUIA 1VMCA 1PTOF 2DNEA 2PPBC 5DM63 2GA4B 1H9SA 4JBWA 1ESRA 2FHTA 1PTOH 3NXWA 2F0JA 3PUYA 2RDHA 1YNND 5E3FA 1GUNA 1ZYRC 4C1NK 3V2TA 2L1BA 1I4PA 4BA1I 2F0EA 1EYAA 4C56C 1SYFA 5BN3A 1IW7D 1T5EA 5TSSA 2NN6G 2Q8TA 1M4VA 4IUQA 4HMIA 2IWHA 2BA1A 3QOLA 4RGMA 5IT9E 4K14A 1EY4A 1PDQA 3BYYB 4RKBA 3M7NA 2XNAC 2KVMA 5G3LF 2ENBA 1LO5D 3MXNA 3J81E 5ELEA 4IFDI 4J1MA 3FVQA 5IT9L 3S2HB 1DOKA 4DAPA 2NBFA 1B4OA 5M5WB 5D65A 2NVXB 2QDBA 5IODA 1HQMC 3BVZA 3SK6A 1GUSA 3QG1A 5A35A 1VMPA 3HRZC 4ZKCB 3VYSA 2A69D 3W2DA 2K1BA 2F1MA 4WJWA 1ESFA 1A3TA 1G8ZD 1VF7A 3KK7A 3OOCA 2NTSA 2EJFC 4KD3A 2K05A 1SNCA 2F0FA 4U68A 1O7YA 3S1RB 1EY8A 1BCPD 3SK4A 2RSOA 5CYUA 4F7XA 3CKIB 3ERQA 3GTPB 3BDOA 1NSNS 2AWOA 2CW0C 5AFWA 3ND8A 3WDNA 3KF8A 5BN4A 1B53A 3N6RA 5EKKA 5C0XI 1SNQA 5DEHA 1Y8PB 3K5LA 3S1QB 5EPKA 1I4RA 2F03A 1MSGA 2RSNA 2AUKA 2LMCB 1S5CD 1TY2A 3NTKA 3ND9A 1Y1WB 4ULLA 4YIJA 1J8IA 1E2ZA 3DWPA 5CBEE 3D6WA 4QIWB 4A3MB 3OPOA 4L6TB 2M00A 4NW2A 1SE2A 3T56B 4A3FB 1TWHB 3OSOA 3TP8A 4J6HA 1FR3A 1E0BA 3S1NB 1HUMA 3HOYB 3K0YA 4KHZA 3URYA 4FP5D 2B2WA 1C48A 3KBGA 4G4KA 4FXDA 3NWSA 1PFBA 3LX0A 3RZOB 1LTGD 5I2XA 4R8IA 4QB4A 2Q8IB 2WINB 4IFDG 3ONAB 4KY6A 1DJRD 2MPMA 1BQQT 1SNDA 2I46A 1K83B 1SAPA 4CHTB 3FEWX 3HGBA 2EYLA 3VR4A 1C8CA 2JE6I 3S17B 1AP0A 2D5DA 4C1NI 1CQVA 4C3HB 1B50A 5EGTA 2KHSA 3HG9A 1EYDA 3J7AF 3S9WA 4ABNA 2R92B 4N9PA 2XRQD 4KMUC 1TT2A 3O13A 1PRTC 1MSHA 2MP1A 1EY9A 2F3VA 3MHBA 5C0XG 2IX3A 5A2QL 1XWEA 3I4MB 3IL8A 2KCNA 5EBCA 1B2TA 1LTID 5EJWA 1EEID 3JAME 5CGKA 4MN3A 4A3BB 2HDMA 2LS01 1ENAA 3R3OA 3TMEA 1TQOA 4OIJA 2E74C 4HTHA 5C44B 2EYOA 1L0YB 2O5JC 3A7LA 3M4YA 1TU2B 2FJ2A 2NVYB 3C1EA 3JAML 1BF4A 3S14B 3SK5A 1A2TA 4O42A 4X3SA 2OXPA 1RHPA 3MXUA 5JAVA 2K5DA 1S5ED 1SJHD 1RKNA 2RBMA 2MJ8A 5C3EB 1WTWA 1Z7TA 2JSOA 1WTRA 1OXSC 5EPLA 4RWSC 1I6VC 4IZ8A 4Q0FA 4DNRB 3OWFA 4K6LA 1NR4A 3KUPA 4MHEA 1BXTA 4CBVA 1QNUA 4G57A 3DXJC 1I50B 4DAYA 3RD4A 1CHPD 2XN9C 1T5XD 2RVLA 5CC4A 1PZJD 4K6DA 4ME5A 4A3DB 3GO5A 3OW7A 3SR1A 4LK1C 4X3UA 2X69A 3GTOB 1SYBA 2QCPX 1EY0A 1G6ZA 2F0PA 1GHJA 2Z4HA 2PZWA 4TQUS 3H0GB 1QWYA 2JEBI 1PRTF 1WTQA 5EKLA 5C5LA 3DUZA 1FNWA 3H94A 3M4OB 4HMJA 2K5WA 1JWMD 4K2KA 2J7ZA 3T16A 1LABA 2F0UA 4ZRZA 4CJ2C 4KV6A 4CJ0B 3DWQA 1B9MA 1UUPA 5KNBA 4Q5VA 3GTJB 1IKMA 1DCZA 2R6GA 1JCKB 4KJNA 1U4LA 1II3A 4RKLA 1TS4A 4A3IB 1QG7A 4KK7A 1WVLA 3BG3A 5C3WA 5KEEA 1HHVA 3TZUA 1UNSA 1AZQA 1LT5D 4OO1H 3QIAA 3NHHA 2DNCA 3HOVB 3DEPA 1JOKA 1H9SB 2RDFA 2VXWA 4H13C 3FKIB 3HP3A 3DWAA 1F9RA 1FGBD 2N55A 1I4GA 2F4IA 4EQOA 3D31A 1JOQA 2L5TA 3TBIB 1IL8A 1JICA 2O2LD 5HURA 1PTOD 4QMGA 3NPPA 1TIID 1EQVA 3K58A 2E2IB 4C2MB 1Y8OB 1V1PB 1VCIA 4EVOA 2A73B 4RAUC 2B2YA 1DD2A 4NMZA 5FLXE 1MD2D 1O7ZA 3L3OC 3PUXA 2F0VA 2R3ZA 2M2LA 5I9PA 3QWNA 1FD7D 1EEFD 1Q1EA 1XX8A 1R4PB 1IYVA 5ELBA 2A6HD 4IURA 2PQEA 2K5QA 2OT2A 4M1UB 2D9UA 1A3UA 4V190 4A3JB 3RLFA 2EZVA 2NZ1D 2A6ED 1DXMA 5M5XB 1JOOA 5G3LD 3PIP3 2WB1B 3EFXD 5JPMC 3P1HA 2KQ3A 1STNA 4PMBA 1STHA 2ZT9C 4DXFA 4DXGA 2O4XA 3H09A 4RHSA 4KTAA 4JK1C 2E75C 3DMUA 2FFKB 3TP6A 1VF5C 5D3DA 1QNKA 1YNNC 5ELCA 1OXVA 3R2IA 1BCPB 2TMPA 4QF4A 3ITPA 1SFOB 2Z8LA 1AW7A 3SVMA 4G7ZC 3VA5A 3A55A 1IW7C 5JEAG 1NR2A 3GTQB 1SNMA 1DYQA 1DOMA 1U4RA 4B9WA 2D62A 4B9XA 3BDLA 5CORA 2FMCA 2AQ3B 2XSCA 1CA5A 4FXKC 4ZUJA 4A3EB 2VB3X 1V1PA 1PZKD 4TRDA 5ISRA 3T4AC 3A8KE 3DHQA 4N9TA 1K8OA 4KD4A 1B9NA 1TS3A 2JA5B 3T53B 3PUVA 2F0MA 2F0OA 1O7LA 1OXXK 3F2UA 3BDCA 1CT1D 2F0LA 4HR7B 5I6WA 2Y0SB 3LWEA 1EU4A 4DK1A 2A69C 2ZXPA 1EWHA 4UDUC 5C4XB 5J22A 4HEDA 2KA7A 4L63B 3K59A 1PMRA 1A2UA 2NWGA 1I6HB 4ZQ3A 3D4WA 1BCPC 1XXGA 3CU7A 1VDZA 1D6EC 2O5IC 2QF7A 5FO9B 3GTKB 2IPKD 4LMQD 2EYHA 3BVGA 1F9PA 4X3KA 5F2DA 1GUTA 5EKIA 4XXEA 5D3IB 1PFNA 4C3JG 1F9QA 3I90A 4TSSA 2HDLA 1SYEA 3NBHA 1LTTD 1SE3A 1H9JA 4H0LC 2HCIA 3VR6A 1D1IA 2LFNA 5FO8B 4O1NA 2YU9B 3I4NB 2ICEC 1EYCA 1LACA 3V96A 1SNOA 5JOBA 1RTNA 2B2WC 3RZDB 2A74C 1AZPA 3VR2A 2SNMA 3E6ZX 3CQZB 2EJGC 1FNVA 2PO4A 3MVVA 1SBBB 3Q22A 2G9DA 5KNDA 4KKUA 3I3CA 4RH6A 4HCSA 1TR5A 1RTOA 1QJOA 2RKSA 1EZ6A 1EZ8A 2TSSA 1D5XC 5COYA 5M3FB 2CQAA 2BE5D 2AUJD 2WV6D 3BZDB 2WIIB 4EGVA 2DY7A 1SMYD 1LTSD 1SYDA 3IKJA 1RCVD 1EQTA 1S4ZA 3KLRA 3K5NA 3HEJA 4RFBA 2EYJA 1Q8IA 1MGSA 2E2DC 1SEBD 2YYZA 1UEAB 1HQRD 2BA0A 1R9TB 3MC0B 1TWAB 1OO9B 2C5CA 1V43A 3RUZA 2LY7A 4BBRB 2H1EA 2E76C 2F0GA 2CHBD 3GTGB 1CHQD 3N52A 5EBDA 3PV0A 3VYRA 2IL8A 1JQYD 1KAAA 3K57A 4F8MA 2KUMA 1STYA 4CKBA 2N88A 2K33A 5CMDA 2B2VA 1D1KA 1JB3A 1KNAA 2Q8RE 1KLUD 2D2CC 1A6XA 3I8ZA 2EYMA 1LLRD 5A2QE 4KN7C 4XT3B 4R8NA 4BBSB 3SEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT4 D;  1LTB D;  1JR0 D;  1EFI D;  1JWM D;  1D5M C;  3BYT B;  1LTG D;  1RDP D;  1FNV A;  1JWU D;  5ELD A;  1L0Y B;  1CT1 D;  3W2D A;  1EWC A;  5FKA C;  1TY0 A;  1XTC D;  3DWQ A;  1SBB B;  1DJR D;  1UUP A;  2XRS D;  4Z9C B;  1EU4 A;  4BWG B;  1ENF A;  1F77 A;  1ESF A;  1HTL D;  1G8Z D;  4RH6 A;  3R2T A;  3EFX D;  1JCK B;  2NTS A;  4RGN A;  1S5E D;  1SJH D;  1TS4 A;  4UDU C;  1PTO F;  1RF2 D;  2IJ0 A;  2TSS A;  3TSS A;  1B44 D;  1D5X C;  2NTT A;  1I4X A;  3KLS X;  1GOZ A;  1BCP D;  2QIL A;  2RDG A;  3GP7 A;  4DXF A;  2ICI A;  4DXG A;  1STE A;  4L63 B;  1HA5 A;  1LT6 D;  1PTO H;  2WV6 D;  3BZD B;  4RGO S;  1UNS A;  1LT5 D;  1D5Z C;  1PZI D;  4RCO A;  1S5F D;  2RDH A;  1LTS D;  1CQV A;  4RHS A;  1CK1 A;  1BCP C;  1EU3 A;  1RCV D;  1XXG A;  1I4H A;  2G9H D;  3OWE B;  1D6E C;  1LTR D;  5FK9 C;  1V1O A;  1TS5 A;  4K6L A;  5D3D A;  1QIL A;  4RFB A;  3DWA A;  1I4P A;  2IPK D;  2QEJ C;  3R8B A;  5ELC A;  1SE4 A;  1BXT A;  4C56 C;  1B1Z A;  3R2I A;  1SEB D;  1FGB D;  1PRT B;  1BCP B;  1PRT D;  1SXT A;  1TS2 A;  1CHP D;  1I4G A;  5TSS A;  1M4V A;  2SEB D;  3BVG A;  1S5B D;  1I4R A;  2Z8L A;  2XRQ D;  3EA6 A;  1LTA D;  1AW7 A;  2AQ1 B;  1S5C D;  1HQR D;  2O2L D;  5ELF A;  3MC0 B;  1FNU A;  1PTO D;  1TY2 A;  2XN9 C;  1T5X D;  3O13 A;  1S5D D;  1PRT C;  4RGM A;  5D3I B;  1PZJ D;  3DWP A;  1L0X B;  4OHJ A;  4L6T B;  2CHB D;  3BYY B;  1DYQ A;  1CHQ D;  1PTO C;  1HXY D;  1V1P B;  1SE2 A;  4RHR A;  2XNA C;  2R61 A;  4TSS A;  1JQY D;  1LT3 D;  2AQ3 B;  2J4X A;  1PYW D;  1LO5 D;  1AN8 A;  1KTK A;  5ELE A;  1LTT D;  1MD2 D;  3CHB D;  1JWS D;  1SE3 A;  3V05 A;  4RGT A;  1ET9 A;  3BVM A;  1ET6 A;  1KLU D;  4ZYS A;  1V1P A;  1RD9 D;  4O1N A;  1PZK D;  1KLG D;  1LTI D;  1LLR D;  1SJE D;  1PTO B;  1I4Q A;  2AQ2 B;  1PRT F;  1BCP F;  1FD7 D;  1EEF D;  1EEI D;  3URY A;  3BVZ A;  1TS3 A;  3MFG A;  1FNW A;  3SEB A;  5I4D A;  5ELB A; 
#chains in the Genus database with same CATH topology
 5EQ0 A;  3E5S A;  2F0K A;  4JCV E;  3BYT B;  2F0H A;  2LSS A;  1B3Q A;  2VUM G;  1HTP A;  2JA7 B;  3M85 A;  5EPJ A;  3EIV A;  5CV6 A;  3TQY A;  2AMC B;  4P74 A;  2IHE A;  2JA8 G;  3ERO A;  4FNF A;  4P75 A;  1V1Q A;  5IIF A;  3GTM B;  5DNF A;  1XTD A;  3NQI A;  5IYD G;  1UEB A;  2MO1 A;  4S3S A;  2IJ0 A;  3A8I E;  3TSS A;  2UUA Q;  4ID6 A;  2DY8 A;  2QIL A;  3PSI A;  4YCV A;  3H15 A;  1QCB D;  2F4V L;  4NDX A;  5FO7 B;  4KKS A;  3OTO L;  4A4I A;  3WOE A;  1XYI A;  2ALY B;  1VQB A;  2V1C C;  1H9M A;  4QCL A;  4A3L H;  2L9H A;  1I4H A;  1D8L A;  2G9H D;  4IUV A;  2L15 A;  2F0D A;  2OQ0 A;  4TKO B;  1TKW B;  5BR8 Q;  3UDI A;  1W6J A;  2ZXO A;  3EQL C;  3Q8D A;  1P8L A;  4UP7 A;  4YWM A;  1JC7 A;  3UDX A;  2F0S A;  3NQT A;  4OEL B;  5J39 A;  3PIP A;  2WP8 J;  4BY7 G;  5IGG A;  4L5T A;  3C3L A;  3NE5 B;  1YNJ D;  4PV1 C;  5HGT A;  3GTK H;  2VZA A;  2JEA I;  2A68 D;  2WAC A;  4LFC Q;  3STB C;  4DV2 L;  1X3Q A;  1EY7 A;  2E5L L;  1L0X B;  3S1R H;  2R93 B;  1EQQ A;  3DM3 A;  3TEH B;  1QE6 A;  2LKV A;  3TDQ A;  3I7F A;  1M90 C;  2F0W A;  2PQA A;  3GTP H;  3CHB D;  1QOH A;  5CV8 A;  2EOT A;  5IGC A;  5KRU A;  3JAM c;  4R9W A;  1KLG D;  3I4L A;  4HCE A;  2D0P A;  2PI2 A;  1PTO B;  4HN7 A;  1MJC A;  3QB3 A;  1ASY A;  3EBE A;  4ZAI A;  4DPG A;  2EY6 A;  3IFD A;  4LFB L;  3K8A A;  1EY6 A;  3OIQ A;  1E1O A;  1LT4 D;  1Q7Y C;  4PG3 A;  2OCE A;  1L1O B;  3F8T A;  2UU9 L;  3I4N H;  4CDC C;  1Y1W H;  1STB A;  3VYT A;  2B2T A;  2EPB A;  3D8G A;  4ILW A;  1W2B A;  1B7Y B;  4FXG C;  4JI7 Q;  4HJ5 A;  5LL6 X;  1DOL A;  4JI8 L;  1YIT A;  2F4V Q;  4A3F H;  1TWH H;  1AE3 A;  3OTO Q;  4KY7 A;  1MHW C;  4DAV A;  2NTT A;  1X65 A;  3S1N H;  1JE5 A;  3A54 A;  1UE5 A;  1STE A;  4QUC A;  3DLL A;  2XIW A;  3HOZ G;  3HOY H;  3EN2 A;  2N8N A;  3RNU A;  1R4Q B;  5JJZ A;  4FF2 A;  2UUB L;  3E0E A;  3PF5 A;  3QO2 A;  1TS5 A;  2EJM A;  5IYB H;  5M3F H;  3RZO H;  4X65 L;  4L5R C;  1VQE A;  4IN3 A;  5T1I A;  1XPR A;  3TN2 A;  4OIK A;  2CVR A;  3J7A V;  1S5B D;  3L0O A;  1KAB A;  4CDF C;  1LTA D;  3F1Z A;  4O2D A;  1Y69 U;  2E5L Q;  1K83 H;  2I07 B;  5ELF A;  1ICW A;  4BXX H;  4HID A;  5IYC H;  2E2H B;  4C3J B;  4X62 Q;  4OHJ A;  3J81 i;  1A3V A;  2B2U A;  1PTO C;  2B2Y C;  3OMG A;  1O80 A;  1I5F A;  3CP0 A;  4FVM A;  1LT3 D;  3KLS A;  4K0K Q;  1QB5 D;  4HSV A;  2DN8 A;  1RIP A;  4C3H H;  3NTI A;  3KOJ A;  5IP7 G;  3V05 A;  5K5P A;  2MQH A;  1LM0 A;  5I6Y A;  4IFD J;  4WJ3 M;  4G7H C;  4LFB Q;  3I72 A;  1L1O C;  2RCN A;  3CRL C;  2Z4I A;  3NK9 A;  1EQR A;  3H6M A;  1WTX A;  1FYC A;  4UAI A;  1TVX A;  1X32 A;  4I65 A;  3NWT A;  4FYD A;  4MIU A;  1U0L A;  2R92 H;  2EY2 A;  5LL6 S;  4NKL A;  4HJ9 A;  2N3S A;  5K36 H;  4KLK A;  1FGU A;  3K5O A;  4CJ1 B;  2F0T A;  3AB9 A;  4XQQ A;  1YIJ A;  3AMU A;  1ZEQ X;  3TP5 A;  2A6H C;  4GN3 B;  1HUN A;  4BWG B;  1JJC B;  1F77 A;  1WI5 A;  4PMW A;  4DR7 Q;  1Q12 A;  4KHP L;  4KY5 A;  2L0C A;  1PFM A;  1K0R A;  4LUV A;  1B3A A;  3QOJ A;  5KNC A;  4EQP A;  1P16 A;  4WRD A;  1BBX C;  3I4M H;  2K50 A;  2PCF B;  3NP8 A;  3KLS X;  3PMF A;  2ICI A;  3A74 A;  2SNS A;  2KED A;  1PH7 A;  1HCZ A;  4JI1 L;  1SDF A;  2UUB Q;  1PZI D;  5NUC A;  1S72 A;  4XYO A;  1CK1 A;  4HAE A;  1ILP A;  3U9S A;  4X65 Q;  4DAM A;  2Q2I A;  1F2M A;  2QDL A;  3FDT A;  3Q0A A;  5M3M B;  2FIN B;  3OIP A;  4DK3 C;  2B63 B;  1STA A;  5ELN A;  1SXT A;  4JW0 A;  1CI3 M;  2N49 A;  1B8A A;  4A3C H;  1TWF B;  2K32 A;  1LUZ A;  5C0X J;  3S14 H;  3MFY A;  1Q82 C;  5E7N A;  3EA6 A;  5CV7 A;  4LFA L;  2QKI C;  4FF3 A;  1C4Q A;  2EXZ A;  3K7A B;  4QUF A;  3W1G A;  4K8I A;  4RMF A;  1X3F A;  4A3B G;  1OXU A;  1ONL A;  5C3E H;  1XNR L;  5FOB B;  4ODG A;  2EVB A;  1G2T A;  3L2P A;  2R61 A;  4IO9 A;  1A62 A;  4EQN A;  5KYI A;  1PYW D;  4GS3 A;  4GZY C;  3Q24 A;  4A93 G;  4IPD A;  4PNY A;  5JEA H;  3HOU B;  1E2W A;  1HZ9 A;  3BVM A;  2CWA A;  2VB2 X;  2F0Q A;  1NJI C;  1X3G A;  1SJE D;  4CKC A;  1Z6H A;  4B3S Q;  4APV A;  3NBH B;  3MFG A;  3GDE A;  1I50 H;  3OHX C;  4JOI C;  3G7L A;  2NN6 H;  3SK8 A;  4XDX A;  4HJ7 A;  1EFI D;  2EDG A;  1E1T A;  4XYQ A;  2VUM B;  5ELD A;  2EY1 A;  2Z6K C;  5CV4 A;  4A3D H;  2EIF A;  2JA8 B;  3GQB A;  3GTO H;  1UE7 A;  1HR0 L;  3H3V C;  3MTS A;  1PV4 A;  1H9R A;  4H44 C;  3HS0 C;  4JOI A;  4JI1 Q;  1B44 D;  3SE0 A;  1GKH A;  4IQZ A;  5GAH C;  3J7Y W;  2KCM A;  2RF4 A;  1WCM G;  1KL9 A;  3TRZ A;  5GRO A;  1CFM A;  3H0G H;  1ZYR D;  4FO2 A;  1F2Z A;  3MWY W;  1S5F D;  2BOS A;  1X3P A;  5DM7 3;  2VQF L;  3C2P A;  2A8V A;  1STG A;  2L55 A;  3M4O H;  4AYB G;  4DV1 Q;  5DAU A;  2R7Z G;  3G4S A;  1C9O A;  1IHZ A;  1BBU A;  1K9M C;  3R8B A;  2HQE A;  1U4M A;  4DU9 A;  1B1Z A;  4C3I G;  1KDC A;  4LFA Q;  4WFN 3;  4G7O C;  4BY7 B;  2AQ1 B;  1U4P A;  3EVQ A;  2PYK A;  1L0W A;  4DGZ A;  2YTX A;  3GTJ H;  1FNU A;  1XNR Q;  2F3I A;  3IAY A;  4A3I H;  3MXP A;  2IW3 A;  2E2J B;  3J81 L;  1PH5 A;  1YJW A;  1YNX A;  3D3R A;  2WKC A;  1XNQ L;  1HNZ L;  3I55 A;  2PNR C;  4RHR A;  1Y8N B;  2HIX A;  3WWV A;  2F0N A;  1JOR A;  2NB0 A;  2J4X A;  2GN5 A;  4XQN A;  3LGJ A;  4LJZ C;  5C3X A;  1WTO A;  1SRU A;  1HZC A;  4RGT A;  4OEM B;  3CD6 A;  4Y52 H;  3PO3 B;  1X3E A;  4IUN A;  4ZYS A;  3ZYY X;  2KCC A;  3FKI H;  1E2V A;  3MA2 B;  2K6A A;  2KCT A;  3CPF A;  5FLM G;  2EE1 A;  3LNN A;  2ZJP A;  1U9R A;  2B29 A;  5I4D A;  2MNA A;  3GTL B;  4UY8 C;  3RLN A;  1D5M C;  4DV7 L;  1HFG A;  1EYG A;  1WD1 A;  2JXM B;  1PFS A;  1XTC D;  1SYG A;  1AEX A;  2PW7 A;  1YI2 A;  1AFP A;  2XWJ B;  1LV9 A;  1C0A A;  4DNT B;  1VQF A;  3HOV G;  1BKB A;  1HR0 Q;  2E2I H;  3D4D A;  4C2M H;  1ML0 D;  1TWG B;  3OYY A;  4I7Z C;  1HPC A;  1WTP A;  1HH2 P;  3MZ5 A;  1Y1V G;  2JA6 G;  1QVC A;  3T51 B;  3E9H A;  1WYD A;  1M8A A;  5C4J B;  4YWL A;  5T1G A;  2FMM A;  2CW0 D;  4IAL A;  1G2S A;  4DA2 A;  3EJI A;  3SDZ A;  4X64 L;  2VQF Q;  1WJJ A;  1HA5 A;  4NB3 A;  1LT6 D;  5C5M A;  1FL0 A;  3HOZ B;  1D5Z C;  4GOP A;  3P7J A;  3L7Z C;  3NSW A;  5C6A A;  4LF5 Q;  3D6C A;  2JYO A;  5CR3 A;  3K0X A;  2BE5 C;  1IYU A;  3HKZ G;  3KJP A;  5FK9 C;  3X3N A;  1G91 A;  1V1O A;  1SMY C;  4OWX B;  1BOS A;  1SRO A;  1EWI A;  3QJY A;  4IFD H;  1N9W A;  3Q23 A;  4AQY L;  2PW5 A;  3CCL A;  2BCO A;  1TS2 A;  1PRT B;  2L4N A;  4A3J H;  1GUG A;  5CV9 A;  2Q2T A;  5M5X H;  3H3V H;  3T1Y Q;  3J80 i;  2WAQ G;  1XNQ Q;  1GUO A;  4BY1 G;  1HNZ Q;  2I5L X;  5M3M H;  3S15 B;  3H91 A;  1IKL A;  2WKD A;  2B63 H;  3HOX B;  5H1S E;  3PO2 G;  3PUW A;  1CA6 A;  4KI0 A;  5FJ8 G;  5LMN L;  4CGY B;  1HFN A;  1JB7 A;  1KTK A;  2B2V C;  3KBX A;  1KQS A;  4B08 A;  1KXL A;  1SNP A;  1ET9 A;  3M7G A;  1JE4 A;  2B39 A;  1XMO L;  1I4Q A;  2AQ2 B;  5LHY 1;  4JI0 Q;  1K3R A;  1BCP F;  1EIY B;  1QVG A;  3CRK C;  5E1F A;  1CQF A;  3CAM A;  1CTM A;  3Q6S A;  3NUC A;  2B8F A;  3HOW G;  4LFC L;  2NUC A;  3PIO 3;  3P75 A;  1SFO H;  1KNE A;  1VQJ A;  1RDP D;  1JWU D;  3A56 A;  4KHV A;  2J0T D;  5M5Y B;  1TY0 A;  4LAA A;  3F2D A;  4L5S A;  2ZM6 L;  2H4O A;  1I94 L;  2F3W A;  3MEF A;  3GTQ H;  2AHO B;  4A3G G;  4U67 3;  1EUJ A;  5C0X H;  1EL0 A;  4K8J A;  4X64 Q;  1GD7 A;  1F9S A;  1RF2 D;  2UXB L;  4ME3 A;  1KDA A;  3TP7 A;  1I4X A;  3S24 A;  4A3E H;  1GOZ A;  5IE8 A;  4A76 A;  3C1F A;  2JA8 H;  1ROD A;  4RGO S;  3X3M A;  1F2L A;  3I56 A;  4E6I A;  1GUW A;  3S16 B;  2NVT B;  3I91 A;  3NTH A;  1HRJ A;  2Z9H A;  2JA5 H;  5IYD H;  4DNI A;  3W1B A;  1LTR D;  2X6G A;  3VA7 A;  4AQY Q;  3UE0 A;  4JI4 L;  4XT1 B;  5JEA J;  4K5V A;  3WOF A;  3QR8 A;  2HUG A;  3AU7 A;  4K5W A;  2HIV A;  4TVA B;  4UP8 A;  1K73 C;  3AEV A;  2HD3 A;  2GVA A;  4JI7 L;  1PRT D;  3PUZ A;  5C4Z A;  1G29 1;  2Z6B A;  2IT1 A;  2ASB A;  4CKE A;  3K5M A;  3BZK A;  3W5O A;  1OTC A;  4XIG S;  4GKJ L;  1JJG A;  3HZX A;  4R4C A;  3NBI A;  5D14 A;  2AWN A;  3U9O A;  5LMN Q;  1DON A;  4F87 A;  5C4X H;  2MGS A;  1SMX A;  2PZT A;  2M9V A;  1I3Q B;  1YNJ C;  3OMC A;  2A68 C;  1BO0 A;  1EOT A;  4DN4 M;  1QUQ A;  5E4X A;  3K6O A;  2EY5 A;  5M9O A;  4A93 B;  1XMO Q;  3VDY A;  1I6H H;  2QW7 A;  4MNO A;  4PZ7 A;  3S2D B;  2Y0S G;  1ASZ A;  2MHV A;  4XTC S;  3VYU A;  2E2J H;  1RD9 D;  4PZ8 A;  3CME A;  4BS9 A;  4DR6 L;  4OO1 I;  3D4R A;  1O78 A;  4NPS A;  4OGQ C;  4P2C B;  1WTV A;  2V4D A;  2SOB A;  2C35 B;  3AFQ A;  4A3L G;  4L8J A;  1RL2 A;  2EYP A;  1LTB D;  2P5Z X;  1YZ6 A;  4NXM L;  3CCR A;  4X62 L;  3PO3 H;  4JI3 L;  3L9A X;  2VW9 A;  2RA4 A;  1NAP A;  2ZM6 Q;  1D2B A;  3W3A A;  1I94 Q;  2B2T C;  3BJU A;  2AKW B;  3CCS A;  1IZ6 A;  1EWC A;  5FKA C;  1G6P A;  4JYA L;  2E8G A;  2K28 A;  4K0K L;  3FMC A;  1EY5 A;  4OWW B;  5IGD A;  1J5E Q;  2K04 A;  3TZD A;  4OL7 A;  1NUC A;  1CZW A;  2KEN A;  3CCV A;  5JVH 3;  1A15 A;  2UXB Q;  1X55 A;  2Z1C A;  4ZKB B;  3B6Y A;  4AIM A;  3T13 A;  3R93 A;  2ID0 A;  1VQ5 A;  4B3R L;  1WCM B;  3RMH A;  1PLF A;  2RDG A;  4RA8 A;  5IGE A;  3GP7 A;  3KYH C;  3S1M B;  5I9O A;  1EIG A;  2YU9 H;  5IGF A;  3RR5 A;  3ZJY C;  1IYJ B;  4YWK A;  4RCO A;  3GD7 A;  1GHK A;  2CWP A;  4R1J A;  1IBL L;  3M9B A;  4JI4 Q;  4HSP A;  2XWB B;  3RZD H;  4IOC A;  1DGS A;  1F2Y A;  1MI2 A;  2OF1 A;  2JK8 A;  4CDD C;  3OWE B;  3J80 E;  5IGB A;  1J9O A;  3CQZ H;  5E4W C;  4AYB B;  4BA2 I;  2R7Z B;  1QIL A;  4IUU A;  1J6Q A;  2QEJ C;  5LMN W;  2EYF A;  1S40 A;  2OEO A;  4DR7 L;  1DM0 B;  3A7A B;  4C3I B;  4GKJ Q;  2PI2 E;  3GV6 A;  1CM9 A;  3A5Z B;  4XQJ A;  2SEB D;  4FF1 A;  2UXD L;  1EIH A;  2UXC Q;  1JJ2 A;  3J80 L;  4A3K B;  1H9K A;  2BDN A;  4Y7N B;  1Y1W G;  1S5D D;  4K2L A;  5KGU A;  1HZB A;  1KDB A;  4X3T A;  2B2U C;  3MEH A;  4A3M G;  2ZTE A;  4H7B A;  4KJO A;  1V9P A;  2X6L A;  4HIK A;  1C7Y A;  2ZXR A;  1UE1 A;  4KN4 C;  2JP1 A;  4J8Q A;  4DK0 A;  3FPU B;  1AN8 A;  4A3F G;  2H5X A;  4RCN A;  1BUV T;  5I2Y A;  1JWS D;  1XMQ L;  1DZ1 A;  4DR6 Q;  1W6K A;  3AQQ A;  1ET6 A;  2KEC A;  3HOX H;  2YTY A;  3FPP A;  3VR3 A;  2KJX A;  4M8A A;  1UE6 A;  2R7F A;  4NXM Q;  3HOY G;  1FVI A;  4MTN A;  1Z47 A;  4JI3 Q;  4DV3 L;  2I5H A;  1VQC A;  4F88 A;  5J1Z A;  1Q90 A;  2K03 A;  4JYA Q;  5IYB G;  4GKK L;  3K7U C;  2SDF A;  3LWU A;  4WOR A;  1BNZ A;  1R9T H;  3FHW A;  2N78 A;  1TWA H;  4H02 A;  5IOC A;  3J80 c;  4B3M L;  4WJ4 A;  1MBY A;  4K5X A;  1BDO A;  4BBR H;  3DM1 A;  1ENC A;  2XRS D;  4Z9C B;  3SHL A;  3G6J B;  5BN5 A;  3FRP B;  1ENF A;  2L12 A;  3GTG H;  1V8Q A;  1HTL D;  1Q1B A;  5KIX A;  4OO1 G;  3DEO A;  3R2T A;  3GV3 A;  3TS0 A;  4BXX G;  5IYC G;  4B3R Q;  1ILQ A;  5JJI A;  1Y1V B;  4ZK9 B;  2JA6 B;  1NCV A;  2G5D A;  2OQK A;  4IUT A;  1K8M A;  1IXR A;  4B3S L;  1PH8 A;  2NN6 I;  4LWC A;  3MAQ A;  1Q3L A;  1IBL Q;  3I2Z A;  2IX1 A;  3M3Y B;  2NVQ B;  1OXT A;  1SSO A;  3SXH A;  4C3H G;  1IL2 A;  5C4H A;  4ZCK A;  1EU3 A;  1RJT A;  1SYC A;  2IX0 A;  3P20 A;  4BBS H;  3HKZ B;  2KEE A;  1T9H A;  3A8J E;  1GJX A;  2RQX A;  5IY0 A;  2UXD Q;  5GQO A;  3CC7 A;  4LF9 Q;  2A6E C;  1SE4 A;  4QL5 A;  5DLQ E;  1CZG A;  2JA7 H;  1GXD C;  4IUP A;  2R92 G;  3AYH B;  2K01 A;  1A0I A;  3S16 H;  4PQX A;  1PH9 A;  5K36 G;  1UAP A;  3BZC A;  2Q2U A;  4R4O A;  5CV5 A;  4N8X 1;  3I70 A;  2WAQ B;  2A5H A;  1HA6 A;  2OTL A;  4BY1 B;  1ZXT A;  3UI2 A;  4PZ6 A;  1ZKO A;  3GTM H;  2CCZ A;  4JC0 A;  2K7V A;  2F0I A;  3PO2 B;  1Y14 B;  2C9O A;  5FLX L;  3E9I A;  5KYL A;  5CBA E;  1HXY D;  2HCC A;  1XMQ Q;  3SGI A;  4GNX A;  5GAE C;  2JA9 A;  4DFA A;  4DV1 L;  2B8G A;  3I4M G;  2I0Q A;  3PQI A;  2HHH L;  2NYZ D;  2RHS B;  2MUY A;  4DV3 Q;  2PMZ B;  1E24 A;  2L11 A;  4FF4 A;  1WD0 A;  3U58 A;  3VR5 A;  1VQK A;  4GKK Q;  1N33 L;  3C46 A;  4EX5 A;  2DJG C;  2PZU A;  3BS1 A;  2VNU D;  1JR0 D;  3HOW B;  1AH9 A;  4ZLT F;  2KOL A;  4B3M Q;  3S2D H;  2XGT A;  1IBM L;  5JPN C;  2ZTC A;  4DF7 A;  5C44 G;  3F2B A;  1TWC B;  3I73 A;  3IFT A;  4PMC A;  4DR1 L;  1PH6 A;  4KKT A;  4A3C G;  1WTH A;  3E0J A;  2R93 H;  2LXK A;  2XVS A;  4IPC A;  1BR9 A;  1PXU A;  3MXG A;  4A3G B;  1IBK L;  2BDO A;  4V0B A;  5JVG 3;  4NP5 A;  4RGN A;  4ZUI A;  1VMC A;  1PTO F;  2KBN A;  2DNE A;  3UDF A;  2PPB C;  5DM6 3;  2GA4 B;  5C3E G;  4JBM A;  1H9S A;  2CFM A;  4JBW A;  1BVS A;  1ESR A;  2FHT A;  2BH2 A;  1PTO H;  3NXW A;  3KF8 B;  2F0J A;  3PUY A;  2RDH A;  1YNN D;  5E3F A;  1QZG A;  5IP9 G;  1GUN A;  1ZYR C;  4ALP A;  4C1N K;  3V2T A;  3PIO A;  2L1B A;  2ATW A;  4GOP B;  4OX9 L;  1I4P A;  4LF7 Q;  4BA1 I;  2F0E A;  1EYA A;  4C56 C;  3CCE A;  1SYF A;  5BN3 A;  1IW7 D;  1T5E A;  5TSS A;  2NN6 G;  2Q8T A;  1M4V A;  1YJN A;  4IUQ A;  1SN8 A;  4HMI A;  2IY5 B;  1PVO A;  2IWH A;  2BA1 A;  3QOL A;  2EXD A;  2R7Z H;  4RGM A;  5IT9 E;  4K14 A;  4JV5 L;  1EY4 A;  4A3D G;  1PDQ A;  2A1A A;  4GN5 A;  2K5H A;  3BYY B;  4LF5 L;  4JI5 Q;  4RKB A;  3M7N A;  2XNA C;  2KVM A;  5G3L F;  2ENB A;  1LO5 D;  4A3K H;  2HHH Q;  3MXN A;  3J81 E;  5ELE A;  4IFD I;  4J1M A;  3FVQ A;  5IT9 L;  3S2H B;  1DOK A;  4DAP A;  2NBF A;  3ERS X;  4RG1 A;  1B4O A;  3A0J A;  1N33 Q;  5M5W B;  3H0G G;  5D65 A;  2NVX B;  2OWO A;  2QDB A;  4LF4 L;  5IOD A;  3T1Y L;  1HQM C;  3BVZ A;  3SK6 A;  1IBM Q;  1GUS A;  4CDE C;  3AFP A;  3QG1 A;  4DR1 Q;  4A75 A;  5A35 A;  1VMP A;  1GVP A;  3HRZ C;  4ZKC B;  1JMC A;  3VYS A;  1H95 A;  2A69 D;  3NEL A;  2E2H H;  3W2D A;  4C3J H;  2K1B A;  1IBK Q;  5GAG C;  3JAM i;  2F1M A;  4WJW A;  1ESF A;  1A3T A;  1G8Z D;  1VF7 A;  3KK7 A;  3OOC A;  2LXJ A;  5J3B A;  2NTS A;  2EJF C;  4KD3 A;  2K05 A;  3U4V A;  4JI0 L;  1SNC A;  4A3I G;  2F0F A;  4U68 A;  1O7Y A;  3S1R B;  1EY8 A;  4HJ8 A;  4YHH L;  1FJG L;  1BCP D;  3SK4 A;  3CCQ A;  4GOP C;  5IWA L;  2RSO A;  5CYU A;  4F7X A;  3CKI B;  2ZJR A;  3ERQ A;  3GTP B;  3TS2 A;  3BDO A;  1NSN S;  2AWO A;  2CW0 C;  1PH3 A;  4OX9 Q;  2PMZ E;  5AFW A;  3ND8 A;  3J81 c;  3WDN A;  2IHF A;  3FKI G;  3NEM A;  3KF8 A;  2DUD A;  5BN4 A;  3ER0 A;  1B53 A;  3K80 C;  3N6R A;  5EKK A;  5C0X I;  2NVQ H;  1SNQ A;  5DEH A;  4DK6 C;  1Y8P B;  3K5L A;  3S1Q B;  5EPK A;  1D7Q A;  1I4R A;  4JV5 Q;  2F03 A;  1MSG A;  2RSN A;  2YTV A;  2AUK A;  2LMC B;  1S5C D;  1TY2 A;  3NTK A;  4IPG A;  3ND9 A;  1CKN B;  1Y1W B;  4ULL A;  4YIJ A;  1J8I A;  1E2Z A;  3DWP A;  5CBE E;  3D6W A;  4QIW B;  4DV0 L;  4A3M B;  3OPO A;  4L6T B;  3G48 A;  3PCO B;  4DR5 L;  2M00 A;  4NW2 A;  1SE2 A;  3KF6 B;  3T56 B;  1NBW A;  1HZA A;  3UDG A;  4A3F B;  1TWH B;  3OSO A;  3TP8 A;  4J6H A;  1FR3 A;  1E0B A;  3S1N B;  1CUK A;  4DUY L;  4LF4 Q;  4DR4 L;  3PO2 H;  1VQA A;  1QUQ B;  1HUM A;  3HOY B;  3K0Y A;  4KHZ A;  1Q86 C;  3URY A;  4N8F A;  1KAW A;  4FP5 D;  2B2W A;  1C48 A;  3KBG A;  4G4K A;  4FXD A;  2MO0 A;  3NWS A;  3CC2 A;  1TWF H;  1PFB A;  1LYL A;  3LX0 A;  3RZO B;  1LTG D;  5I2X A;  4R8I A;  2JQO A;  4QB4 A;  2Q8I B;  2WIN B;  4IFD G;  2K75 A;  3ONA B;  4KY6 A;  1DJR D;  3K7A H;  4UHV A;  4A3J G;  2MPM A;  1BQQ T;  1SND A;  2I46 A;  1VQ4 A;  1K83 B;  2WB1 G;  1ICF B;  4YHH Q;  1FJG Q;  1SAP A;  5IWA Q;  1TXY A;  4CHT B;  3K81 C;  3FEW X;  3HGB A;  2EYL A;  3VR4 A;  1YVC A;  1C8C A;  3HOU H;  4IOA A;  4HIO A;  2JE6 I;  3S17 B;  1AP0 A;  3A5U A;  2D5D A;  2GVB A;  4C1N I;  1CQV A;  4C3H B;  1B50 A;  4QQB X;  5EGT A;  3IRB A;  4AH6 A;  4DAY B;  2KHS A;  3HG9 A;  1EOV A;  1EYD A;  3J7A F;  1VQH A;  1VS0 A;  2QGQ A;  2B3G A;  1J5E L;  2VUM H;  3S9W A;  4ABN A;  2R92 B;  3CF5 A;  4N9P A;  2XRQ D;  4KMU C;  4GLX A;  1TT2 A;  4DV0 Q;  1A8V A;  4DV4 L;  3O13 A;  4DR5 Q;  1PRT C;  3G71 A;  5JJK A;  1VQM A;  1MSH A;  4LF8 L;  3ULJ A;  3J7Z C;  2MP1 A;  1N34 Q;  1EY9 A;  2F3V A;  3NEN A;  4LUZ A;  3MHB A;  1WOC A;  5C0X G;  1CKN A;  4DUY Q;  2IX3 A;  4LF6 Q;  4DR4 Q;  5A2Q L;  4JBJ A;  3PF4 A;  1XWE A;  3I4M B;  3IL8 A;  4A3E G;  2KCN A;  5EBC A;  1B2T A;  4L5Q A;  1SR3 A;  3KF6 A;  1LTI D;  1VQ9 A;  5EJW A;  2UXC L;  1EEI D;  1KIX A;  4B3T L;  3JAM E;  5CGK A;  4MN3 A;  2JA5 G;  4A3B B;  2HDM A;  2LS0 1;  4LW1 A;  1ENA A;  1X9N A;  3S2H H;  3R3O A;  3TME A;  1TQO A;  4OIJ A;  3HKS A;  4GLV B;  4BY7 H;  2E74 C;  4HTH A;  5M5W H;  5C44 B;  2EYO A;  2ZJQ A;  1L0Y B;  2NVX H;  2O5J C;  3A7L A;  3M4Y A;  1PH4 A;  1TU2 B;  2FJ2 A;  2NVY B;  3C1E A;  3M4Q A;  4R4Q A;  3JAM L;  1BF4 A;  3S14 B;  5AJ3 Q;  3SK5 A;  1A2T A;  4O42 A;  4X3S A;  4JBK A;  4J15 A;  2OXP A;  1MIU A;  1RHP A;  3MXU A;  4QIW E;  5JAV A;  2K5D A;  1S5E D;  1SJH D;  1UWV A;  1RKN A;  5C4X G;  2RBM A;  2MJ8 A;  5C3E B;  1WTW A;  1E22 A;  3KFU A;  1Z7T A;  2JSO A;  1YEZ A;  1WTR A;  5L37 A;  1OXS C;  1VQP A;  1L2F A;  5EPL A;  4RWS C;  1I6V C;  4IZ8 A;  1YHQ A;  2A19 A;  4Q0F A;  4UP9 A;  3GTL H;  4DNR B;  3OWF A;  4K6L A;  2CH4 W;  1NR4 A;  4X66 Q;  3KUP A;  2FXQ A;  4MHE A;  1BXT A;  1QNU A;  4G57 A;  4CBV A;  3DXJ C;  1I50 B;  4DAY A;  1K0S A;  3RD4 A;  4DV4 Q;  2PNH A;  1CHP D;  3STB D;  3PO3 G;  1TWG H;  4FDB A;  1K3B C;  3M4P A;  4LF8 Q;  2XN9 C;  1T5X D;  4OWT B;  2RVL A;  2KHI A;  5CC4 A;  1PZJ D;  4K6D A;  4ME5 A;  4MTK A;  3OW2 A;  4A3D B;  4JVZ A;  3GO5 A;  3OW7 A;  5C4J H;  3SR1 A;  4DV5 L;  3S1Q H;  4LK1 C;  4X3U A;  1Q46 A;  2X69 A;  3GTO B;  1SYB A;  2QCP X;  1EY0 A;  1AE2 A;  3HOZ H;  2F0P A;  4OXP A;  3U50 C;  1G6Z A;  1GHJ A;  1NY4 A;  4HJA A;  4LF9 L;  2Z4H A;  2PZW A;  2VY3 A;  4A3M H;  4GNX B;  4B3T Q;  4TQU S;  3H0G B;  1QWY A;  2JEB I;  3I4N G;  1PRT F;  1VQO A;  5HY6 A;  1WTQ A;  5EKL A;  4P71 A;  2UUC L;  3J7A 5;  5C5L A;  4NXN L;  3DUZ A;  1FNW A;  1QZH A;  3CCM A;  3H94 A;  3M4O B;  4HMJ A;  2K5W A;  1JWM D;  4K2K A;  2J7Z A;  3T16 A;  3JC6 6;  2ZTD A;  3E3X A;  1LAB A;  2F0U A;  4ZRZ A;  3KLW A;  4CJ2 C;  4KV6 A;  4CJ0 B;  3DWQ A;  3S15 H;  1B9M A;  1UUP A;  3TRE A;  5KNB A;  2VS1 A;  4Q5V A;  1PA6 A;  2CKZ B;  3GTJ B;  1KD1 C;  1IKM A;  1DCZ A;  2R6G A;  1Z9F A;  1JCK B;  4KJN A;  1SLJ A;  1U4L A;  1II3 A;  2Z0S A;  4RKL A;  1TS4 A;  4GN4 B;  4DR2 L;  4A3I B;  1QG7 A;  4KK7 A;  1WVL A;  5IP7 H;  3CPW A;  3BG3 A;  5C3W A;  5KEE A;  5M3F G;  1HHV A;  3TZU A;  3FP9 A;  4DV2 Q;  1UNS A;  1AZQ A;  1LT5 D;  4OO1 H;  3QIA A;  3RLO A;  3NHH A;  2DNC A;  4JG2 A;  3I4O A;  3HOV B;  3DEP A;  1JOK A;  3HOX G;  1H9S B;  2RDF A;  2VXW A;  4H13 C;  4MZ9 A;  3FKI B;  1YHB A;  3HP3 A;  3DWA A;  3S17 H;  1XPU A;  1CSQ A;  5M5Y H;  4X6A H;  2K5V A;  1F9R A;  1PYB A;  1FGB D;  2N55 A;  1I4G A;  1Q8K A;  5JJL A;  2F4I A;  2Q2H A;  4EQO A;  3D31 A;  1JOQ A;  3KJO A;  1S3O A;  2L5T A;  3TBI B;  1IL8 A;  1JIC A;  2O2L D;  5HUR A;  1PTO D;  4QMG A;  4DV5 Q;  3NPP A;  2OTJ A;  2QA4 A;  4BBR G;  1TII D;  1EQV A;  3K58 A;  1N8R C;  1HJP A;  4JI2 L;  4GNX C;  2UU9 Q;  2E2I B;  4C2M B;  1Y8O B;  1V1P B;  1VCI A;  4EVO A;  2A73 B;  4RAU C;  2B2Y A;  1DD2 A;  4NMZ A;  1CSP A;  1MD2 D;  2CQO A;  5FLX E;  2DGY A;  2K52 A;  4LF7 L;  2NVT H;  1O7Z A;  3L3O C;  3PUX A;  2UUC Q;  4NXN Q;  4JI8 Q;  2F0V A;  2R3Z A;  1K28 A;  1MKH A;  2M2L A;  5I9P A;  3QWN A;  1FD7 D;  1EEF D;  1Q1E A;  3MXN B;  1L1O A;  4O0A A;  1XX8 A;  1R4P B;  3ICE A;  1N32 L;  3BU2 A;  1IYV A;  4BBS G;  5ELB A;  3RN5 A;  3T1H L;  2VL6 A;  2A6H D;  3CXC A;  4IUR A;  2PQE A;  2K5Q A;  4DR3 L;  3CW2 C;  1NMF A;  2OT2 A;  4JI5 L;  4M1U B;  1CKM A;  2D9U A;  2JA7 G;  1A3U A;  1NE3 A;  4V19 0;  4A3J B;  3RLF A;  2EZV A;  2NZ1 D;  2A6E D;  1DXM A;  5M5X B;  1JOO A;  1KC8 C;  4A3B H;  5G3L D;  3PIP 3;  4DR2 Q;  3D0F A;  1I3Q H;  2WB1 B;  3EFX D;  1KRS A;  5JPM C;  3P1H A;  2KQ3 A;  1K8A C;  1STN A;  4AYB E;  5C44 H;  1VQ6 A;  3F2C A;  4A93 H;  4PMB A;  1KHI A;  1STH A;  4QJF A;  1X56 A;  2WFW A;  2NVY H;  2ZT9 C;  4DXF A;  4DXG A;  2O4X A;  4IPH A;  3H09 A;  4RHS A;  4KTA A;  3ULL A;  4JK1 C;  1VQG A;  2E75 C;  2I5M X;  3DMU A;  2FFK B;  1YHA A;  4DUZ L;  3TP6 A;  1NMG A;  1VF5 C;  5FLX c;  5D3D A;  1QNK A;  1YNN C;  4POF A;  5ELC A;  1OXV A;  1HNX L;  3R2I A;  3RN2 A;  1EIF A;  1BCP B;  1EFW A;  2TMP A;  5LMU L;  4QF4 A;  4JI6 L;  3ITP A;  1SFO B;  2K14 A;  1A63 A;  5IP9 H;  2Z8L A;  1AW7 A;  2QEX A;  3SVM A;  4G7Z C;  4JI2 Q;  1E3P A;  3VA5 A;  3A55 A;  3CCJ A;  1IW7 C;  2DJF C;  5JEA G;  1NR2 A;  3U4Z A;  4R4I A;  3GTQ B;  2R93 G;  1SNM A;  1DYQ A;  1WCM H;  1DOM A;  1U4R A;  2D62 A;  4B9W A;  4B9X A;  1QVF A;  3BDL A;  5COR A;  3S1M H;  2FMC A;  2AQ3 B;  2XSC A;  1M1K C;  1CA5 A;  3CMA A;  2HT1 A;  4FXK C;  4I7A A;  3KDF B;  4ZUJ A;  4QGU A;  4KHP Q;  4DV6 L;  4A3E B;  1HNW L;  2R7D A;  2EQS A;  2VB3 X;  1V1P A;  1PZK D;  3UE1 A;  1N32 Q;  4TRD A;  5ISR A;  3T4A C;  2JN4 A;  3A8K E;  3T1H Q;  3DHQ A;  4N9T A;  1K8O A;  4KD4 A;  1B9N A;  1TS3 A;  3PGZ A;  2JA5 B;  4C3I H;  4DR3 Q;  3T53 B;  3PUV A;  2F0M A;  2F0O A;  1O7L A;  1OXX K;  3F2U A;  2ES2 A;  1YJ9 A;  4R4T A;  3BDC A;  1CT1 D;  2F0L A;  4OON A;  4Y7N H;  4HR7 B;  5I6W A;  2Y0S B;  3LWE A;  4LUO A;  2Z6K A;  2JJQ A;  1EU4 A;  3H3V I;  4DK1 A;  1SE8 A;  2A69 C;  2ZXP A;  4GLA C;  1PH2 A;  1EWH A;  3HKZ E;  2RCF A;  1N36 L;  4UDU C;  5C4X B;  5J22 A;  4UPA A;  4HED A;  5ELO A;  2NZH A;  2KHJ A;  2KA7 A;  4L63 B;  3K59 A;  1PMR A;  1A2U A;  4A3K G;  2NWG A;  4DUZ Q;  5FLM H;  1I6H B;  4ZQ3 A;  5HGQ A;  3D4W A;  1BCP C;  1XXG A;  3CU7 A;  2WAQ E;  3ULP A;  1VDZ A;  1HNX Q;  1D6E C;  2CH4 A;  5GAD C;  2O5I C;  2MFI A;  2QF7 A;  5FO9 B;  3GTK B;  2IPK D;  1PH1 A;  5LMU Q;  4JI6 Q;  1NNX A;  4LMQ D;  2EYH A;  3BVG A;  5IT9 c;  1BBW A;  1F9P A;  4X3K A;  4YCW A;  5F2D A;  1GUT A;  1X6O A;  5EKI A;  3HOV H;  4EQ5 A;  4XXE A;  5D3I B;  1PFN A;  1Y1V H;  1K8G A;  2JA6 H;  4C3J G;  2WB1 E;  1F9Q A;  1VQD A;  1GM5 A;  3I90 A;  2HQL A;  3M3Y H;  4TSS A;  4DV6 Q;  1HNW Q;  4DKA C;  2HDL A;  1SYE A;  1G51 A;  3NBH A;  4LNQ A;  1B70 B;  1LTT D;  1SE3 A;  1YBY A;  2BH8 A;  1H9J A;  2YV5 A;  4H0L C;  2HCI A;  3VR6 A;  3CCU A;  1D1I A;  2LFN A;  5FO8 B;  2VQE L;  4O1N A;  2YU9 B;  3I4N B;  2ICE C;  1EYC A;  1LAC A;  1KRT A;  3V96 A;  4YY3 L;  1SNO A;  5JOB A;  1RTN A;  2B2W C;  3RZD B;  3KDF A;  1XPO A;  2A74 C;  1AZP A;  3VR2 A;  2F52 A;  4JPB W;  2SNM A;  3E6Z X;  3CQZ B;  4P72 A;  1VQI A;  1U5K A;  2EJG C;  4P73 A;  1FNV A;  2PO4 A;  1N34 L;  4BY1 H;  3MVV A;  4POG A;  1XJV A;  1PYS B;  1SBB B;  3Q22 A;  2G9D A;  5EAY A;  4LF6 L;  3J81 j;  5KND A;  1N36 Q;  4KKU A;  2RHQ B;  3I3C A;  4HCS A;  4RH6 A;  1GO3 E;  5FJ8 H;  1TR5 A;  1RTO A;  1QJO A;  2K5N A;  1EZ6 A;  2RKS A;  4IJL A;  1EZ8 A;  4IJH A;  1VQL A;  2TSS A;  1D5X C;  5COY A;  3G6E A;  5M3F B;  2CQA A;  2BE5 D;  2AUJ D;  2WV6 D;  3BZD B;  2WII B;  2UUA L;  4EGV A;  2DY7 A;  1VQN A;  1SMY D;  1VQ8 A;  1LTS D;  1SYD A;  3IKJ A;  1RCV D;  1WFQ A;  1EQT A;  3CC4 A;  1S4Z A;  3KLR A;  3K5N A;  3HOW H;  3HEJ A;  1W3S A;  4RFB A;  5M3M G;  2EYJ A;  5AJ3 L;  1Q8I A;  2NZO A;  2B63 G;  1TWC H;  1Q81 C;  1MGS A;  2E2D C;  1SEB D;  1MJE A;  5BR8 L;  1VQ7 A;  2YYZ A;  1UEA B;  4HIM A;  1PHJ A;  1HQR D;  1X54 A;  4A3G H;  2BA0 A;  2Y0S E;  3MC0 B;  1R9T B;  1TWA B;  1OO9 B;  2C5C A;  2PQA B;  1V43 A;  4YCU A;  3RUZ A;  2LY7 A;  4BBR B;  1E7Z A;  1NTG A;  2H1E A;  4DV7 Q;  2XTI A;  2E76 C;  2F0G A;  2CHB D;  3GTG B;  1HR0 W;  1CHQ D;  3N52 A;  5EBD A;  3PV0 A;  3VYR A;  2IL8 A;  1JT8 A;  2K4K A;  1LTL A;  1JQY D;  1KAA A;  3K57 A;  4F8M A;  2KUM A;  1STY A;  2VQE Q;  4CKB A;  2N88 A;  2K33 A;  5CMD A;  2B2V A;  1D1K A;  4X66 L;  1JB3 A;  4YY3 Q;  1KNA A;  1O7I A;  3HOU G;  2Q8R E;  1KLU D;  2D2C C;  2D0O A;  1A6X A;  3I8Z A;  2EYM A;  3HFZ B;  1LLR D;  5A2Q E;  4QY7 A;  4KN7 C;  4XT3 B;  4R8N A;  1CKO A;  4BBS B;  3SEB A; 
#chains in the Genus database with same CATH homology
 5EQ0 A;  3E5S A;  2F0K A;  3BYT B;  2F0H A;  1HTP A;  2JA7 B;  3M85 A;  5EPJ A;  5CV6 A;  3ERO A;  4FNF A;  5IIF A;  3GTM B;  5DNF A;  3NQI A;  4S3S A;  2IJ0 A;  3A8I E;  3TSS A;  4ID6 A;  2DY8 A;  2QIL A;  1QCB D;  4NDX A;  5FO7 B;  4KKS A;  3WOE A;  1XYI A;  1H9M A;  4QCL A;  2L9H A;  1I4H A;  2G9H D;  4IUV A;  2F0D A;  4TKO B;  1TKW B;  1W6J A;  2ZXO A;  3EQL C;  1JC7 A;  2F0S A;  3NQT A;  5J39 A;  2WP8 J;  5IGG A;  3C3L A;  3NE5 B;  1YNJ D;  4PV1 C;  5HGT A;  2JEA I;  2A68 D;  2WAC A;  1X3Q A;  1EY7 A;  1L0X B;  2R93 B;  1QE6 A;  2LKV A;  3TDQ A;  2F0W A;  3CHB D;  1QOH A;  5CV8 A;  2EOT A;  5IGC A;  5KRU A;  4R9W A;  1KLG D;  3I4L A;  4HCE A;  1PTO B;  4HN7 A;  3QB3 A;  4ZAI A;  2EY6 A;  3IFD A;  1EY6 A;  3OIQ A;  1LT4 D;  1STB A;  3VYT A;  2B2T A;  2EPB A;  3D8G A;  4ILW A;  4FXG C;  5LL6 X;  1DOL A;  4KY7 A;  4DAV A;  2NTT A;  3A54 A;  1STE A;  4QUC A;  2XIW A;  1R4Q B;  5JJZ A;  4FF2 A;  3QO2 A;  1TS5 A;  2EJM A;  4IN3 A;  5T1I A;  3TN2 A;  4OIK A;  2CVR A;  3J7A V;  1S5B D;  1KAB A;  1LTA D;  1Y69 U;  2I07 B;  5ELF A;  1ICW A;  2E2H B;  4C3J B;  4OHJ A;  1A3V A;  2B2U A;  1PTO C;  2B2Y C;  3OMG A;  1O80 A;  4FVM A;  1LT3 D;  3KLS A;  1QB5 D;  4HSV A;  2DN8 A;  3NTI A;  3V05 A;  5K5P A;  5I6Y A;  4IFD J;  4G7H C;  3I72 A;  3NK9 A;  3CRL C;  2Z4I A;  3H6M A;  1WTX A;  1FYC A;  4UAI A;  1TVX A;  1X32 A;  4I65 A;  3NWT A;  4FYD A;  4MIU A;  2EY2 A;  5LL6 S;  4NKL A;  5K36 H;  3K5O A;  4CJ1 B;  2F0T A;  3AB9 A;  4XQQ A;  3AMU A;  1ZEQ X;  3TP5 A;  2A6H C;  1HUN A;  4BWG B;  1F77 A;  4PMW A;  1Q12 A;  4KY5 A;  2L0C A;  1PFM A;  1B3A A;  3QOJ A;  5KNC A;  4EQP A;  4WRD A;  1BBX C;  2PCF B;  3NP8 A;  3KLS X;  3PMF A;  2ICI A;  2SNS A;  2KED A;  1HCZ A;  1SDF A;  1PZI D;  5NUC A;  4XYO A;  1CK1 A;  4HAE A;  1ILP A;  3U9S A;  1F2M A;  3FDT A;  3Q0A A;  5M3M B;  2FIN B;  3OIP A;  2B63 B;  1STA A;  1SXT A;  1CI3 M;  1TWF B;  2K32 A;  5C0X J;  3MFY A;  3EA6 A;  5CV7 A;  2QKI C;  4FF3 A;  1C4Q A;  2EXZ A;  3K7A B;  4QUF A;  4K8I A;  1OXU A;  1ONL A;  5FOB B;  4ODG A;  2EVB A;  1G2T A;  2R61 A;  4EQN A;  5KYI A;  1PYW D;  4GZY C;  3Q24 A;  4PNY A;  5JEA H;  3HOU B;  1E2W A;  3BVM A;  2VB2 X;  2F0Q A;  1SJE D;  4CKC A;  1Z6H A;  3MFG A;  3OHX C;  3G7L A;  2NN6 H;  3SK8 A;  4XDX A;  1EFI D;  2EDG A;  4XYQ A;  2VUM B;  5ELD A;  2EY1 A;  5CV4 A;  2JA8 B;  3GQB A;  3H3V C;  3MTS A;  1H9R A;  4H44 C;  3HS0 C;  1B44 D;  3SE0 A;  4IQZ A;  3J7Y W;  1CFM A;  1ZYR D;  4FO2 A;  1F2Z A;  3MWY W;  1S5F D;  2BOS A;  1X3P A;  5DM7 3;  3C2P A;  1STG A;  2L55 A;  5DAU A;  1IHZ A;  3R8B A;  2HQE A;  1U4M A;  4DU9 A;  1B1Z A;  4C3I G;  1KDC A;  4WFN 3;  4G7O C;  4BY7 B;  2AQ1 B;  1U4P A;  4DGZ A;  2PYK A;  3EVQ A;  1FNU A;  3IAY A;  3MXP A;  2IW3 A;  2E2J B;  3J81 L;  3D3R A;  2WKC A;  2PNR C;  4RHR A;  1Y8N B;  1JOR A;  2F0N A;  2NB0 A;  2J4X A;  4XQN A;  4LJZ C;  5C3X A;  1WTO A;  4RGT A;  3PO3 B;  4IUN A;  4ZYS A;  3ZYY X;  2KCC A;  1E2V A;  3MA2 B;  2K6A A;  2EE1 A;  3LNN A;  1U9R A;  5I4D A;  3GTL B;  1D5M C;  1HFG A;  1WD1 A;  2JXM B;  1XTC D;  1SYG A;  1AEX A;  2PW7 A;  1AFP A;  2XWJ B;  1LV9 A;  4DNT B;  3D4D A;  1ML0 D;  1TWG B;  4I7Z C;  1HPC A;  1WTP A;  3MZ5 A;  3T51 B;  1M8A A;  5C4J B;  5T1G A;  2FMM A;  2CW0 D;  4IAL A;  1G2S A;  4DA2 A;  3EJI A;  3SDZ A;  1HA5 A;  1LT6 D;  5C5M A;  3HOZ B;  1D5Z C;  3P7J A;  3L7Z C;  3NSW A;  5C6A A;  3D6C A;  2JYO A;  5CR3 A;  2BE5 C;  1IYU A;  5FK9 C;  3X3N A;  1G91 A;  1V1O A;  1SMY C;  1BOS A;  3QJY A;  4IFD H;  3Q23 A;  2PW5 A;  2BCO A;  1TS2 A;  1PRT B;  2L4N A;  1GUG A;  5CV9 A;  1GUO A;  3S15 B;  3H91 A;  1IKL A;  2WKD A;  3HOX B;  3PUW A;  1CA6 A;  4KI0 A;  4CGY B;  1HFN A;  1KTK A;  2B2V C;  3KBX A;  4B08 A;  1SNP A;  1ET9 A;  3M7G A;  1JE4 A;  2B39 A;  1I4Q A;  2AQ2 B;  5LHY 1;  1BCP F;  3CRK C;  5E1F A;  1CQF A;  1CTM A;  3Q6S A;  3NUC A;  2B8F A;  2NUC A;  3PIO 3;  3P75 A;  1KNE A;  1RDP D;  1JWU D;  3A56 A;  4KHV A;  2J0T D;  5M5Y B;  1TY0 A;  4LAA A;  2H4O A;  2F3W A;  4U67 3;  5C0X H;  1EL0 A;  4K8J A;  1F9S A;  1RF2 D;  3TP7 A;  1KDA A;  1I4X A;  1GOZ A;  3C1F A;  1ROD A;  4RGO S;  3X3M A;  1F2L A;  4E6I A;  1GUW A;  3S16 B;  2NVT B;  3I91 A;  3NTH A;  1HRJ A;  1LTR D;  2X6G A;  3VA7 A;  4XT1 B;  5JEA J;  4K5V A;  3WOF A;  2HUG A;  3AU7 A;  4K5W A;  1PRT D;  3PUZ A;  5C4Z A;  1G29 1;  2IT1 A;  4CKE A;  3K5M A;  4XIG S;  3HZX A;  3NBI A;  5D14 A;  2AWN A;  3U9O A;  1DON A;  4F87 A;  2MGS A;  2PZT A;  2M9V A;  1I3Q B;  1YNJ C;  2A68 C;  3OMC A;  1BO0 A;  1EOT A;  4DN4 M;  5E4X A;  3K6O A;  2EY5 A;  5M9O A;  4A93 B;  3S2D B;  2MHV A;  4XTC S;  3VYU A;  1RD9 D;  4BS9 A;  4OO1 I;  3D4R A;  1O78 A;  4OGQ C;  4P2C B;  1WTV A;  2V4D A;  2SOB A;  4L8J A;  2EYP A;  1LTB D;  3L9A X;  2RA4 A;  1NAP A;  1D2B A;  3W3A A;  2B2T C;  1EWC A;  5FKA C;  2K28 A;  3FMC A;  1EY5 A;  5IGD A;  2K04 A;  3TZD A;  4OL7 A;  1NUC A;  1CZW A;  5JVH 3;  1A15 A;  2Z1C A;  4ZKB B;  3T13 A;  3R93 A;  2ID0 A;  1WCM B;  3RMH A;  1PLF A;  2RDG A;  4RA8 A;  5IGE A;  3GP7 A;  3S1M B;  5I9O A;  1EIG A;  5IGF A;  1GHK A;  4RCO A;  3GD7 A;  4HSP A;  2XWB B;  1F2Y A;  1MI2 A;  2OF1 A;  3OWE B;  3J80 E;  5IGB A;  1J9O A;  5E4W C;  4AYB B;  4BA2 I;  2R7Z B;  1QIL A;  4IUU A;  2QEJ C;  2EYF A;  2OEO A;  1DM0 B;  3A7A B;  4C3I B;  3GV6 A;  1CM9 A;  4XQJ A;  2SEB D;  4FF1 A;  1EIH A;  3J80 L;  4A3K B;  1H9K A;  2BDN A;  4Y7N B;  1S5D D;  4K2L A;  5KGU A;  1KDB A;  4X3T A;  2B2U C;  3MEH A;  4H7B A;  4KJO A;  2X6L A;  2ZXR A;  4KN4 C;  2JP1 A;  4J8Q A;  4DK0 A;  3FPU B;  1AN8 A;  4RCN A;  1BUV T;  5I2Y A;  1JWS D;  1DZ1 A;  1W6K A;  1ET6 A;  2KEC A;  3FPP A;  3VR3 A;  2KJX A;  4M8A A;  1Z47 A;  4F88 A;  5J1Z A;  1Q90 A;  2K03 A;  2SDF A;  3LWU A;  4WOR A;  1BNZ A;  5IOC A;  1MBY A;  4K5X A;  1BDO A;  3DM1 A;  1ENC A;  2XRS D;  4Z9C B;  3SHL A;  3G6J B;  5BN5 A;  3FRP B;  1ENF A;  2L12 A;  1V8Q A;  1HTL D;  1Q1B A;  5KIX A;  4OO1 G;  3DEO A;  3R2T A;  3GV3 A;  1ILQ A;  1Y1V B;  4ZK9 B;  2JA6 B;  1NCV A;  4IUT A;  1K8M A;  2NN6 I;  3MAQ A;  1Q3L A;  3M3Y B;  2IX1 A;  2NVQ B;  1OXT A;  1SSO A;  3SXH A;  4C3H G;  5C4H A;  1EU3 A;  1RJT A;  1SYC A;  2IX0 A;  3P20 A;  3HKZ B;  2KEE A;  3A8J E;  1GJX A;  2RQX A;  2A6E C;  1SE4 A;  1CZG A;  1GXD C;  4IUP A;  2K01 A;  4PQX A;  5K36 G;  1UAP A;  5CV5 A;  2WAQ B;  3I70 A;  2A5H A;  1HA6 A;  4BY1 B;  1ZXT A;  3UI2 A;  1ZKO A;  2K7V A;  2F0I A;  3PO2 B;  2C9O A;  5FLX L;  5KYL A;  5CBA E;  1HXY D;  2HCC A;  4DFA A;  2B8G A;  2NYZ D;  2MUY A;  2PMZ B;  2L11 A;  4FF4 A;  1WD0 A;  3VR5 A;  3C46 A;  2PZU A;  3BS1 A;  2VNU D;  1JR0 D;  3HOW B;  4ZLT F;  2KOL A;  5JPN C;  4DF7 A;  1TWC B;  3I73 A;  3IFT A;  4PMC A;  4KKT A;  3E0J A;  2XVS A;  1BR9 A;  1PXU A;  3MXG A;  4A3G B;  2BDO A;  4V0B A;  5JVG 3;  4NP5 A;  4RGN A;  4ZUI A;  1VMC A;  1PTO F;  2DNE A;  2PPB C;  5DM6 3;  2GA4 B;  1H9S A;  4JBW A;  1ESR A;  2FHT A;  1PTO H;  3NXW A;  2F0J A;  3PUY A;  2RDH A;  1YNN D;  5E3F A;  1GUN A;  1ZYR C;  4C1N K;  3V2T A;  2L1B A;  1I4P A;  4BA1 I;  2F0E A;  1EYA A;  4C56 C;  1SYF A;  5BN3 A;  1IW7 D;  1T5E A;  5TSS A;  2NN6 G;  2Q8T A;  1M4V A;  4IUQ A;  4HMI A;  2IWH A;  2BA1 A;  3QOL A;  4RGM A;  5IT9 E;  4K14 A;  1EY4 A;  1PDQ A;  3BYY B;  4RKB A;  3M7N A;  2XNA C;  2KVM A;  5G3L F;  2ENB A;  1LO5 D;  3MXN A;  3J81 E;  5ELE A;  4IFD I;  4J1M A;  3FVQ A;  5IT9 L;  3S2H B;  1DOK A;  4DAP A;  2NBF A;  1B4O A;  5M5W B;  5D65 A;  2NVX B;  2QDB A;  5IOD A;  1HQM C;  3BVZ A;  3SK6 A;  1GUS A;  3QG1 A;  5A35 A;  1VMP A;  3HRZ C;  4ZKC B;  3VYS A;  2A69 D;  3W2D A;  2K1B A;  2F1M A;  4WJW A;  1ESF A;  1A3T A;  1G8Z D;  1VF7 A;  3KK7 A;  3OOC A;  2NTS A;  2EJF C;  4KD3 A;  2K05 A;  1SNC A;  2F0F A;  4U68 A;  1O7Y A;  3S1R B;  1EY8 A;  1BCP D;  3SK4 A;  2RSO A;  5CYU A;  4F7X A;  3CKI B;  3ERQ A;  3GTP B;  3BDO A;  1NSN S;  2AWO A;  2CW0 C;  5AFW A;  3ND8 A;  3WDN A;  3KF8 A;  5BN4 A;  1B53 A;  3N6R A;  5EKK A;  5C0X I;  1SNQ A;  5DEH A;  1Y8P B;  3K5L A;  3S1Q B;  5EPK A;  1I4R A;  2F03 A;  1MSG A;  2RSN A;  2AUK A;  2LMC B;  1S5C D;  1TY2 A;  3NTK A;  3ND9 A;  1Y1W B;  4ULL A;  4YIJ A;  1J8I A;  1E2Z A;  3DWP A;  5CBE E;  3D6W A;  4QIW B;  4A3M B;  3OPO A;  4L6T B;  2M00 A;  4NW2 A;  1SE2 A;  3T56 B;  4A3F B;  1TWH B;  3OSO A;  3TP8 A;  4J6H A;  1FR3 A;  1E0B A;  3S1N B;  1HUM A;  3HOY B;  3K0Y A;  4KHZ A;  3URY A;  4FP5 D;  2B2W A;  1C48 A;  3KBG A;  4G4K A;  4FXD A;  3NWS A;  1PFB A;  3LX0 A;  3RZO B;  1LTG D;  5I2X A;  4R8I A;  4QB4 A;  2Q8I B;  2WIN B;  4IFD G;  3ONA B;  4KY6 A;  1DJR D;  2MPM A;  1BQQ T;  1SND A;  2I46 A;  1K83 B;  1SAP A;  4CHT B;  3FEW X;  3HGB A;  2EYL A;  3VR4 A;  1C8C A;  2JE6 I;  3S17 B;  1AP0 A;  2D5D A;  4C1N I;  1CQV A;  4C3H B;  1B50 A;  5EGT A;  2KHS A;  3HG9 A;  1EYD A;  3J7A F;  3S9W A;  4ABN A;  2R92 B;  4N9P A;  2XRQ D;  4KMU C;  1TT2 A;  3O13 A;  1PRT C;  1MSH A;  2MP1 A;  1EY9 A;  2F3V A;  3MHB A;  5C0X G;  2IX3 A;  5A2Q L;  1XWE A;  3I4M B;  3IL8 A;  2KCN A;  5EBC A;  1B2T A;  1LTI D;  5EJW A;  1EEI D;  3JAM E;  5CGK A;  4MN3 A;  4A3B B;  2HDM A;  2LS0 1;  1ENA A;  3R3O A;  3TME A;  1TQO A;  4OIJ A;  2E74 C;  4HTH A;  5C44 B;  2EYO A;  1L0Y B;  2O5J C;  3A7L A;  3M4Y A;  1TU2 B;  2FJ2 A;  2NVY B;  3C1E A;  3JAM L;  1BF4 A;  3S14 B;  3SK5 A;  1A2T A;  4O42 A;  4X3S A;  2OXP A;  1RHP A;  3MXU A;  5JAV A;  2K5D A;  1S5E D;  1SJH D;  1RKN A;  2RBM A;  2MJ8 A;  5C3E B;  1WTW A;  1Z7T A;  2JSO A;  1WTR A;  1OXS C;  5EPL A;  4RWS C;  1I6V C;  4IZ8 A;  4Q0F A;  4DNR B;  3OWF A;  4K6L A;  1NR4 A;  3KUP A;  4MHE A;  1BXT A;  4CBV A;  1QNU A;  4G57 A;  3DXJ C;  1I50 B;  4DAY A;  3RD4 A;  1CHP D;  2XN9 C;  1T5X D;  2RVL A;  5CC4 A;  1PZJ D;  4K6D A;  4ME5 A;  4A3D B;  3GO5 A;  3OW7 A;  3SR1 A;  4LK1 C;  4X3U A;  2X69 A;  3GTO B;  1SYB A;  2QCP X;  1EY0 A;  1G6Z A;  2F0P A;  1GHJ A;  2Z4H A;  2PZW A;  4TQU S;  3H0G B;  1QWY A;  2JEB I;  1PRT F;  1WTQ A;  5EKL A;  5C5L A;  3DUZ A;  1FNW A;  3H94 A;  3M4O B;  4HMJ A;  2K5W A;  1JWM D;  4K2K A;  2J7Z A;  3T16 A;  1LAB A;  2F0U A;  4ZRZ A;  4CJ2 C;  4KV6 A;  4CJ0 B;  3DWQ A;  1B9M A;  1UUP A;  5KNB A;  4Q5V A;  3GTJ B;  1IKM A;  1DCZ A;  2R6G A;  1JCK B;  4KJN A;  1U4L A;  1II3 A;  4RKL A;  1TS4 A;  4A3I B;  1QG7 A;  4KK7 A;  1WVL A;  3BG3 A;  5C3W A;  5KEE A;  1HHV A;  3TZU A;  1UNS A;  1AZQ A;  1LT5 D;  4OO1 H;  3QIA A;  3NHH A;  2DNC A;  3HOV B;  3DEP A;  1JOK A;  1H9S B;  2RDF A;  2VXW A;  4H13 C;  3FKI B;  3HP3 A;  3DWA A;  1F9R A;  1FGB D;  2N55 A;  1I4G A;  2F4I A;  4EQO A;  3D31 A;  1JOQ A;  2L5T A;  3TBI B;  1IL8 A;  1JIC A;  2O2L D;  5HUR A;  1PTO D;  4QMG A;  3NPP A;  1TII D;  1EQV A;  3K58 A;  2E2I B;  4C2M B;  1Y8O B;  1V1P B;  1VCI A;  4EVO A;  2A73 B;  4RAU C;  2B2Y A;  1DD2 A;  4NMZ A;  5FLX E;  1MD2 D;  1O7Z A;  3L3O C;  3PUX A;  2F0V A;  2R3Z A;  2M2L A;  5I9P A;  3QWN A;  1FD7 D;  1EEF D;  1Q1E A;  1XX8 A;  1R4P B;  1IYV A;  5ELB A;  2A6H D;  4IUR A;  2PQE A;  2K5Q A;  2OT2 A;  4M1U B;  2D9U A;  1A3U A;  4V19 0;  4A3J B;  3RLF A;  2EZV A;  2NZ1 D;  2A6E D;  1DXM A;  5M5X B;  1JOO A;  5G3L D;  3PIP 3;  2WB1 B;  3EFX D;  5JPM C;  3P1H A;  2KQ3 A;  1STN A;  4PMB A;  1STH A;  2ZT9 C;  4DXF A;  4DXG A;  2O4X A;  3H09 A;  4RHS A;  4KTA A;  4JK1 C;  2E75 C;  3DMU A;  2FFK B;  3TP6 A;  1VF5 C;  5D3D A;  1QNK A;  1YNN C;  5ELC A;  1OXV A;  3R2I A;  1BCP B;  2TMP A;  4QF4 A;  3ITP A;  1SFO B;  2Z8L A;  1AW7 A;  3SVM A;  4G7Z C;  3VA5 A;  3A55 A;  1IW7 C;  5JEA G;  1NR2 A;  3GTQ B;  1SNM A;  1DYQ A;  1DOM A;  1U4R A;  4B9W A;  2D62 A;  4B9X A;  3BDL A;  5COR A;  2FMC A;  2AQ3 B;  2XSC A;  1CA5 A;  4FXK C;  4ZUJ A;  4A3E B;  2VB3 X;  1V1P A;  1PZK D;  4TRD A;  5ISR A;  3T4A C;  3A8K E;  3DHQ A;  4N9T A;  1K8O A;  4KD4 A;  1B9N A;  1TS3 A;  2JA5 B;  3T53 B;  3PUV A;  2F0M A;  2F0O A;  1O7L A;  1OXX K;  3F2U A;  3BDC A;  1CT1 D;  2F0L A;  4HR7 B;  5I6W A;  2Y0S B;  3LWE A;  1EU4 A;  4DK1 A;  2A69 C;  2ZXP A;  1EWH A;  4UDU C;  5C4X B;  5J22 A;  4HED A;  2KA7 A;  4L63 B;  3K59 A;  1PMR A;  1A2U A;  2NWG A;  1I6H B;  4ZQ3 A;  3D4W A;  1BCP C;  1XXG A;  3CU7 A;  1VDZ A;  1D6E C;  2O5I C;  2QF7 A;  5FO9 B;  3GTK B;  2IPK D;  4LMQ D;  2EYH A;  3BVG A;  1F9P A;  4X3K A;  5F2D A;  1GUT A;  5EKI A;  4XXE A;  5D3I B;  1PFN A;  4C3J G;  1F9Q A;  3I90 A;  4TSS A;  2HDL A;  1SYE A;  3NBH A;  1LTT D;  1SE3 A;  1H9J A;  4H0L C;  2HCI A;  3VR6 A;  1D1I A;  2LFN A;  5FO8 B;  4O1N A;  2YU9 B;  3I4N B;  2ICE C;  1EYC A;  1LAC A;  3V96 A;  1SNO A;  5JOB A;  1RTN A;  2B2W C;  3RZD B;  2A74 C;  1AZP A;  3VR2 A;  2SNM A;  3E6Z X;  3CQZ B;  2EJG C;  1FNV A;  2PO4 A;  3MVV A;  1SBB B;  3Q22 A;  2G9D A;  5KND A;  4KKU A;  3I3C A;  4RH6 A;  4HCS A;  1TR5 A;  1RTO A;  1QJO A;  2RKS A;  1EZ6 A;  1EZ8 A;  2TSS A;  1D5X C;  5COY A;  5M3F B;  2CQA A;  2BE5 D;  2AUJ D;  2WV6 D;  3BZD B;  2WII B;  4EGV A;  2DY7 A;  1SMY D;  1LTS D;  1SYD A;  3IKJ A;  1RCV D;  1EQT A;  1S4Z A;  3KLR A;  3K5N A;  3HEJ A;  4RFB A;  2EYJ A;  1Q8I A;  1MGS A;  2E2D C;  1SEB D;  2YYZ A;  1UEA B;  1HQR D;  2BA0 A;  1R9T B;  3MC0 B;  1TWA B;  1OO9 B;  2C5C A;  1V43 A;  3RUZ A;  2LY7 A;  4BBR B;  2H1E A;  2E76 C;  2F0G A;  2CHB D;  3GTG B;  1CHQ D;  3N52 A;  5EBD A;  3PV0 A;  3VYR A;  2IL8 A;  1JQY D;  1KAA A;  3K57 A;  4F8M A;  2KUM A;  1STY A;  4CKB A;  2N88 A;  2K33 A;  5CMD A;  2B2V A;  1D1K A;  1JB3 A;  1KNA A;  2Q8R E;  1KLU D;  2D2C C;  1A6X A;  3I8Z A;  2EYM A;  1LLR D;  5A2Q E;  4KN7 C;  4XT3 B;  4R8N A;  4BBS B;  3SEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...