4BWGB

Structural basis of subtilase cytotoxin subab assembly
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
95
Chain Sequence
b'VVITQFHTGQIDNKPYFCIEGKSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBA
publication title Structural Basis of Subtilase Cytotoxin Subab Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 19
structure length 95
sequence length 99
chains with identical sequence C, D, E, F, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4bwgB00
5TSSA 3R8BA 1RF2D 1I4QA 1SJHD 1UUPA 3O13A 1TS2A 5I4DA 1SBBB 1PTOB 4DXFA 1LTTD 1SXTA 1TS5A 1D6EC 1D5MC 1D5XC 1HQRD 2NTSA 4C56C 1JQYD 4L63B 1I4RA 1PRTD 1UNSA 2G9HD 5ELCA 1PRTB 2XNAC 1PTOF 5ELFA 1CK1A 1ET9A 1DJRD 1S5CD 2J4XA 1AW7A 1HA5A 3GP7A 3BYTB 1LTGD 4DXGA 1FNWA 1PRTF 1LTAD 1LTSD 1S5FD 1PTOD 5ELDA 3SEBA 3DWPA 1KLUD 1LT5D 1XTCD 1TY0A 3BVMA 1FNUA 2RDHA 1RDPD 1ENFA 1HTLD 1XXGA 4L6TB 1FNVA 1B1ZA 1S5ED 2IJ0A 1F77A 1LO5D 3TSSA 1AN8A 3BZDB 1PYWD 5D3IB 1CT1D 1DYQA 4ZYSA 1I4XA 1FD7D 1I4PA 3MC0B 4RHRA 1PZID 1LT6D 1RD9D 1EFID 2QILA 4Z9CB 5ELBA 1ESFA 1LTRD 1BCPD 3V05A 4RH6A 5D3DA 3W2DA 1EEID 5FKAC 1BCPB 1PTOH 1EU3A 1STEA 1CQVA 1LTID 3BVGA 1PRTC 1D5ZC 4TSSA 4BWGB 1BXTA 3DWQA 1JWUD 1HXYD 1JWSD 1TS3A 1G8ZD 1LTBD 1JWMD 2IPKD 3BVZA 4RGMA 1SEBD 1TY2A 1SE4A 4UDUC 1ET6A 1JCKB 2O2LD 4OHJA 1BCPF 1TS4A 5FK9C 3OWEB 1SJED 3BYYB 1I4GA 1QILA 2AQ1B 1CHPD 2ICIA 2AQ3B 2XN9C 5ELEA 1S5DD 1I4HA 2Z8LA 3KLSX 1PTOC 1V1PB 2TSSA 3R2TA 1RCVD 1LT3D 2R61A 2WV6D 4RCOA 3CHBD 1KLGD 4K6LA 4RHSA 1PZKD 1EU4A 3MFGA 2XRQD 1MD2D 1FGBD 1V1OA 3URYA 1GOZA 1EWCA 1SE2A 2XRSD 1LT4D 1PZJD 2NTTA 3EFXD 3EA6A 1S5BD 4O1NA 1LLRD 3R2IA 4RGTA 2CHBD 1M4VA 2AQ2B 2QEJC 4RGNA 1L0YB 4RFBA 1B44D 1BCPC 1CHQD 1L0XB 2SEBD 1V1PA 1KTKA 1EEFD 1SE3A 4RGOS 3DWAA 1JR0D 1T5XD 2RDGA
chains in the Genus database with same CATH superfamily
1MSGA 3FEWX 3KOJA 1X55A 1TS2A 3F2BA 3PF5A 2F0PA 1A0IA 2L4NA 4B3SL 1D5MC 3M4QA 1SYBA 4OO1H 4KN4C 4M1UB 4XT3B 3H09A 1NNXA 1EY7A 3PQIA 3J80i 1O80A 3HEJA 1BBWA 3VDYA 2HDLA 1Q86C 2WACA 3TQYA 3S16B 4K2LA 1VQ9A 4JI6Q 3KF6A 3OYYA 4KHPQ 4TRDA 3PSIA 3L3OC 2R93B 1AZPA 4OO1G 1DXMA 3K80C 2UXBL 2CFMA 3SR1A 5LL6S 5KIXA 2UXCQ 2E2DC 5HY6A 5M5WB 1ZEQX 1W3SA 1FD7D 5J22A 3A55A 3NE5B 1DCZA 4PMBA 5JOBA 1S40A 3DHQA 1E22A 4DPGA 1M1KC 1A3TA 5FKAC 3U50C 1YJWA 1PRTC 4BWGB 2SOBA 2F52A 1TXYA 3UE0A 4CDDC 3CMEA 3HOYH 4H13C 3EJIA 1Y1WH 4LUZA 1YZ6A 1WD0A 2MPMA 4KV6A 1WJJA 1V8QA 1SNMA 4UP9A 5BN5A 1R9TB 1AH9A 3GO5A 3KLSX 2KQ3A 4FDBA 3R2TA 1X56A 1NCVA 3RZOB 4JI4L 3HOYG 3GV3A 1N32L 3VYUA 4K2KA 1Y1WG 1JE5A 4QUCA 1LT4D 4RKLA 4DAMA 2ZTDA 4DK3C 4EQ5A 3S1NH 4RGTA 2NVQB 1G2SA 3J80c 4UPAA 2CWPA 2JK8A 1EY9A 4HTHA 1Q82C 2K5HA 4B3RQ 4WJ4A 1BOSA 1AP0A 3DEOA 4RFBA 2BDOA 1L0XB 3E9IA 1RHPA 2PZTA 4N8X1 4DV4L 2YU9H 2PNRC 5IT9L 2IWHA 3CMAA 5EBCA 4ZKCB 3NQTA 1UUPA 2OT2A 2DNEA 4C3IH 5M3MH 3T1YQ 1G6PA 2B39A 3EQLC 5FO7B 3NWSA 4FNFA 3S1RH 1B4OA 3GTKB 1BF4A 4R9WA 5IODA 2Z4HA 5KYLA 4ODGA 4JI0Q 1DOMA 1DD2A 3J81L 4JBMA 2F0HA 4C3IG 5M3MG 3JAMc 1KC8C 3HP3A 3AB9A 3OOCA 5C0XH 3S17B 1IW7C 2ICEC 2M00A 1ICWA 5DEHA 3BVMA 2R3ZA 4FXKC 1NJIC 2KHJA 2RSOA 2SNSA 2E5LQ 1EL0A 5C3WA 1QNKA 4Y7NB 4A76A 4CJ1B 1BUVT 1EOVA 5C0XG 3OHXC 2C5CA 2QW7A 1SYFA 4YCVA 4Z9CB 2WAQB 1ESFA 1OO9B 1TQOA 3S2HB 4EQPA 4JI7Q 1CQVA 3SVMA 1C7YA 4KMUC 2PMZE 2VNUD 2ZJPA 1TS3A 4LFAL 3I73A 3SXHA 4F7XA 1YHBA 1TWCH 3CCMA 1CSQA 1X6OA 2K01A 2ZJQA 4OHJA 4CDCC 2PQAB 2P5ZX 5JJKA 1ZYRC 1AZQA 2XN9C 4JV5L 3PO3B 4QIWE 4GS3A 1TU2B 1YNND 2ZXOA 3IFDA 4BS9A 4MIUA 3G71A 1LT3D 2A6HC 4LFCQ 2ATWA 1HTPA 2D9UA 1ASZA 2PYKA 3K7UC 3NUCA 1GOZA 1I94Q 4IUTA 4GN5A 3MWYW 5C0XJ 5C4JB 4H0LC 2DJFC 1EQTA 2D62A 3IL8A 4LW1A 4KTAA 4IOCA 1IYVA 3T4AC 2PQAA 4LF7L 1WYDA 1K83B 4AQYL 3G7LA 5IY0A 5BN3A 2F0FA 4A3EB 3U9OA 3E3XA 1GKHA 3LWEA 3GTOB 4IPGA 1SAPA 4KD3A 4K0KL 2EXZA 2RDGA 1NTGA 2KENA 2LS01 1F2ZA 2ALYB 3BG3A 1K3BC 4LK1C 2KA7A 4DXFA 1QJOA 3H0GB 3CCVA 1D5XC 3HGBA 2NTSA 2R92B 3I56A 5ELCA 4GOPC 5IIFA 3C2PA 4DV7Q 4ZKBB 2K1BA 2RKSA 4J8QA 1ET9A 3FHWA 3MXUA 4DR7Q 3ERSX 4WRDA 5E7NA 4R8NA 1SFOB 4DUZL 3TREA 4DN4M 1JOKA 2KJXA 4J15A 3GTJH 3S1MB 5FO9B 1K9MC 4HJ5A 3OMCA 1V43A 2O5IC 1Q8KA 1ILQA 2A69D 2HCIA 5IT9E 2NVXH 2UUCQ 4GN4B 4P2CB 2IHFA 4GZYC 5L37A 3HOUB 1PFMA 1Z9FA 5CBEE 3S14B 3HOZH 1F9PA 4HJ7A 3NBHB 2AHOB 4IPCA 5EPJA 3H6MA 1RD9D 2N49A 2RBMA 5GROA 4AYBB 4A3JH 1BCPB 2AUKA 2EYOA 3J81E 2A6ED 1IKLA 1BXTA 3DWQA 3HOZG 1L0WA 3BZKA 3RN2A 1HR0W 1SEBD 2DNCA 1JCKB 1M8AA 1Q8IA 1VQIA 1BCPF 2L11A 3L7ZC 3OMGA 4JOIA 3NBHA 3J81j 1EZ8A 2ICIA 4A3JG 2FHTA 4RCNA 3G4SA 1I4HA 3K5LA 1PTOC 5H1SE 1ASYA 4OX9L 3FKIH 1RL2A 1PXUA 1FGBD 3AFPA 2D0PA 5JAVA 3C46A 1PZJD 3GDEA 2NVTH 3H91A 3BDOA 1C0AA 4KJNA 2ZTEA 1CFMA 1M4VA 2HCCA 5M5YH 2QEJC 2ASBA 3FKIG 4FO2A 2UUAL 2E2HB 4DFAA 3M4OH 1TWFH 2JJQA 4B3TL 3DWAA 2JA5H 1Y8NB 2VQEQ 1JJ2A 1JOOA 1ICFB 1VQDA 4NB3A 1O7ZA 3CQZH 4V0BA 2K5QA 1STHA 1LTTD 3Q24A 2HQLA 1TS5A 3U9SA 1HZAA 2EIFA 1VQ4A 3KDFB 1MKHA 2EXDA 4P74A 5KNBA 3CCRA 2JA5G 1UE7A 4R4IA 3WOEA 5LMNQ 1SNCA 4FYDA 5DAUA 1EZ6A 1ENAA 4ZUJA 5G3LF 2F0NA 2PW5A 2Z6BA 3IKJA 4KJOA 1L2FA 3H3VC 3OIQA 4A3BH 2M2LA 4LF8L 1XPUA 4P71A 3ERQA 4RAUC 1TIID 1R4PB 3VR5A 4EQOA 3CCUA 2CH4A 3J7AV 4NDXA 1XYIA 3S24A 1O7YA 1RDPD 2UU9Q 2BH2A 4BBSH 1K3RA 4GLVB 3S15B 4DV5L 3HZXA 3Q22A 3GTLB 3KDFA 1EYAA 4K5VA 2F1MA 4FXDA 4ZUIA 1I6VC 2UUBL 2R7FA 2X6GA 1CT1D 1EWIA 4A3BG 1E2ZA 4B3SQ 2GN5A 3T1HL 1VDZA 3TP5A 1IYUA 1LT6D 1X3FA 4QQBX 5GAHC 1BCPD 4BBSG 4RH6A 1FGUA 2H4OA 1PTOH 3K5MA 3GTGH 2EYJA 1SDFA 2K05A 2WB1B 1GM5A 2OEOA 2B2TC 1G8ZD 2JA6H 1A62A 2MHVA 2O2LD 1A8VA 1HHVA 2KECA 2RF4A 3K7AH 4IJHA 4NMZA 4GLAC 2VZAA 5C4XH 2UXBQ 3I72A 2V4DA 1HNXL 2EY6A 5KYIA 1VMPA 2LSSA 1BBXC 2JA6G 1OXTA 2XWBB 1B9NA 1HNWL 1IZ6A 3C1FA 4CKCA 2MO1A 1VQ8A 3RZDH 1SROA 3DXJC 4P72A 4PZ8A 1YJNA 4E6IA 3RLFA 1L1OB 1QOHA 5BR8L 3K0YA 2EY1A 4K5XA 3NQIA 5C4XG 1A3UA 2F0SA 2ID0A 1MI2A 2NWGA 5CMDA 1TR5A 3D8GA 1G2TA 2ES2A 5C5LA 5IGBA 3R8BA 2C9OA 2OTLA 1CKNB 5CV6A 4DK1A 3H3VH 3PUVA 1PHJA 2J0TD 4A3KH 1L1OA 2K28A 2E76C 2J7ZA 4B3MQ 5LMUQ 3OPOA 3HOYB 4A75A 3PIPA 2MJ8A 2OQKA 4DA2A 1N32Q 1RTOA 5EJWA 3QO2A 2CWAA 1HUMA 1A15A 1MJCA 1XX8A 5GADC 3GP7A 3CP0A 5AJ3L 4DXGA 1WTVA 1CKNA 3L2PA 4A3KG 1VQOA 3AQQA 4HSVA 4JG2A 1SLJA 2OTJA 1E2WA 3SHLA 4OO1I 4C3JH 1EQQA 3FP9A 4JBWA 2VUMH 2JA7H 3MEHA 3KJPA 3S1NB 4DV6Q 4BY1H 3TSSA 1YNJC 4FVMA 3BZDB 3KF8B 4OXPA 1IL8A 1DYQA 1KRSA 4JI8Q 2VXWA 5CYUA 4OWWB 5DNFA 4P75A 1LTRD 3UDXA 2F0LA 1U4RA 4HCEA 3IFTA 4C3IB 5M3MB 2M9VA 2VS1A 2VUMG 1J5EL 2JA7G 1MJEA 4BY1G 1EYGA 2G5DA 3HKSA 3IRBA 5EBDA 3S1RB 4CDEC 1DM0B 3OWFA 1PH3A 1WFQA 4UDUC 3KF8A 3K0XA 1NBWA 2DGYA 1G51A 1EYCA 3OWEB 1JB3A 2IT1A 4ZAIA 2AQ3B 5ELEA 5E4WC 4G57A 4X66L 1NUCA 2JEAI 5M9OA 3RUZA 1JT8A 1CI3M 3HFZB 2F3IA 3D6WA 2EZVA 3HG9A 2LY7A 4A3MH 2FXQA 2B2YA 5KNDA 2F0OA 3PO2H 3CCQA 4J6HA 1EWCA 4JYAL 4YCWA 3A0JA 3VR6A 5EQ0A 1YI2A 1EIFA 4X65L 2KOLA 1S5BD 1LLRD 2F4VQ 2ZXPA 1IBML 1JB7A 5I6YA 3A7LA 1N36Q 3S1QH 4OWTB 1PH1A 1CHQD 1Q46A 4A3MG 2DY7A 2MFIA 1CKMA 3PO2G 1S4ZA 5HGQA 5IWAL 5FLXL 5CBAE 1KDAA 1YHQA 1KNEA 4A4IA 4A3CH 2LFNA 2F3WA 2IW3A 1QNUA 3KK7A 2FMMA 2VB3X 4HCSA 3P7JA 2JA9A 3I4NH 2ZT9C 1HFGA 3I3CA 1GO3E 1TWCB 3U58A 4DR2L 4DV2Q 4QY7A 4R4OA 5ELFA 3R93A 3RLNA 2QDBA 2AWOA 5EKIA 4QL5A 4A3CG 3DUZA 1HA5A 4R4TA 5D65A 3WWVA 1STYA 5IGCA 2GVBA 4K5WA 1FNWA 3I4NG 1S5FD 1H9MA 4IUUA 4K0KQ 4JBKA 2N55A 2ZM6L 1MGSA 1GUNA 1BR9A 1LUZA 4IJLA 3TP8A 2AKWB 3HKZB 4I7AA 2ENBA 4XQNA 4CGYB 4ZYSA 5LHY1 5IOCA 3A56A 4DNIA 1TT2A 1C48A 2JXMB 5C0XI 4JBJA 1WTWA 1XMOL 1SMYD 3V05A 1D1IA 1F9RA 2Q2HA 1N8RC 1EU3A 4POGA 1WTHA 2L55A 3N52A 4Q5VA 2ZXRA 3CPWA 3J81i 2Y0SE 1QVCA 2JP1A 2RA4A 5IP7H 4YHHL 3SK8A 2NZOA 4JI5L 2Q2UA 5CC4A 1M90C 3EVQA 3GTJB 1XMQL 4JI1L 1MD2D 4QUFA 1B7YB 3ITPA 4XQJA 3CW2C 2NTTA 2B8GA 2NVXB 3MEFA 5IP7G 2L5TA 4B08A 3HOZB 1QB5D 3D4WA 4QMGA 1GHJA 1D8LA 1SE3A 4OIKA 4Q0FA 4X3KA 3M7NA 1RF2D 1N33Q 1SNOA 4PMWA 1JE4A 4A3JB 1PH6A 4FF3A 1U4LA 2MGSA 4B9WA 2I5MX 1X65A 1QZHA 1WCMH 1D6EC 3BZCA 5JPMC 4OX9Q 1JQYD 1K8GA 4R4CA 4RKBA 2QF7A 4NXNL 3CAMA 1HA6A 5C4ZA 4I7ZC 1DJRD 3G6EA 4JPBW 1YJ9A 3KFUA 3FKIB 5C3XA 1JORA 1WCMG 2I46A 4A93H 5ELDA 2UUAQ 4BXXH 4DV3Q 1HCZA 1A3VA 1XTCD 4CKBA 1B2TA 4HMJA 2RDHA 4B3TQ 1XXGA 2E2IH 5FLMH 2NVTB 1PH5A 1Y8OB 2EYLA 1T9HA 2NN6H 1HZ9A 5FLXE 2DJGC 5C6AA 4NP5A 1Q12A 5M5YB 4PMCA 1LABA 1CSPA 3MC0B 4A93G 1TWFB 4BXXG 2JA5B 2QILA 2Z4IA 3LX0A 3FDTA 4N8FA 4DR5Q 2EDGA 1S72A 5FLMG 1EEID 2KCNA 4L5QA 3CQZB 2DUDA 2YV5A 2NN6G 1H9SB 4GKJL 1DOLA 3FPPA 1W2BA 1XNRL 4HEDA 2D0OA 1Y14B 3PIOA 4L5SA 1VQJA 1E0BA 1I4GA 4XT1B 2BH8A 3FPUB 1U0LA 1X54A 3PF4A 4CKEA 2XIWA 1J6QA 2A8VA 2CW0D 3T13A 4A3BB 4BA2I 2UUBQ 1H9SA 2F3VA 3H94A 3T1HQ 2WFWA 5JJIA 1KDBA 2WKDA 3MXNB 5M5XH 3CC4A 1EY6A 2PCFB 1N34Q 2YYZA 4BBSB 2QA4A 1SYCA 4O1NA 4MTKA 2RVLA 4EGVA 4JI3Q 4GKKL 3GD7A 4XDXA 3W3AA 1EY5A 2N3SA 1YEZA 2OQ0A 1B53A 3A7AB 1PV4A 3STBD 3ULLA 1XNQL 3HOVH 1G291 1KTKA 3T51B 2HHHL 1X9NA 1T5XD 2N78A 3ULJA 1HZCA 3ND8A 4IFDH 1SJHD 1H9KA 1SBBB 3MXNA 5EPKA 4BBRH 1PTOB 4DUYQ 3GTGB 2K32A 2PI2A 4KKTA 1HNXQ 4NXMQ 1TWAH 1CA5A 2ZJRA 3HOVG 1HNWQ 1KAAA 1VMCA 1PTOF 2BE5D 4LUOA 1YNNC 3K7AB 4LF6L 4IFDG 1Q3LA 1RIPA 3CRKC 1DOKA 3BDCA 4DAVA 1YITA 1AW7A 5BR8Q 5CR3A 4BBRG 2EPBA 5T1IA 1EQRA 4XYQA 2F0MA 4IURA 4DR6L 2KHSA 3GTMH 4X3SA 3RZDB 1CKOA 1FJGL 1NR2A 5NUCA 4H02A 5IGEA 3RN5A 1SNPA 1LYLA 1GXDC 4DR3L 2WIIB 4ILWA 1I4XA 3S16H 5I9PA 1EFID 4DV0L 4UY8C 4YWKA 3TP7A 4TKOB 1C8CA 3BS1A 2K50A 2B63B 1X32A 4BA1I 1K8MA 4IFDJ 2VQFQ 4Y52H 4A3KB 3M7GA 5AJ3Q 1SE4A 4JI6L 1ET6A 5E3FA 2HD3A 4IPDA 1I5FA 2X6LA 1B3AA 5KEEA 5J39A 2EJGC 4KY7A 2KCCA 4JCVE 1F2MA 4IPHA 1P8LA 4KI0A 5EPLA 2EYFA 2AWNA 2A69C 4C3HH 4EQNA 3MFGA 3T53B 2R7ZH 3URYA 1EOTA 3D6CA 1VQ6A 3NK9A 4C3JB 1K0RA 2WB1E 2PW7A 1GUWA 1P16A 2EY5A 1QVFA 4QGUA 5DLQE 2F0UA 4BY1B 1PVOA 1J5EQ 1B8AA 2F4IA 4X6AH 1A2UA 4GN3B 4HJ8A 1CTMA 1VQFA 2D2CC 1SYDA 2NUCA 2SEBD 4C3HG 1WTOA 2R7ZG 2A6EC 4X62Q 2KVMA 1HNZQ 2PMZB 1EIGA 4HIMA 5CGKA 3K58A 1Y1VH 3PV0A 4ZQ3A 2UXDQ 2G9HD 3KBXA 3JAME 2Q2TA 4QF4A 2BDNA 3P20A 3CPFA 4ZCKA 2A19A 3DM3A 4X65Q 1S5CD 1WTXA 5J3BA 2R7DA 2F0JA 1PYSB 3I4MH 3H3VI 1IBMQ 5E1FA 2BA1A 2EYHA 1Y1VG 4A3MB 4B3RL 1IHZA 3M3YH 3PO2B 1I6HH 3CXCA 1O7IA 2K04A 2CVRA 1LO5D 4DR1L 3A8IE 2Z6KA 1AN8A 1HJPA 2EVBA 4CJ2C 5FO8B 4OL7A 3I4MG 1QUQB 5EKKA 1KABA 3S1QB 2A5HA 2O5JC 1HQMC 1PZID 2A68D 2F0WA 1TKWB 3HS0C 1KD1C 1VQ5A 3S9WA 4A3LH 3CC7A 5ELBA 1UE6A 2HQEA 2KHIA 3BVGA 1J8IA 1NMFA 4JI0L 4HSPA 3L9AX 4A3FH 3I4NB 3NTKA 1SRUA 4GNXB 2B29A 1QUQA 3QG1A 1U9RA 1PH4A 4A3LG 3K59A 1HH2P 1LACA 1STNA 1S5DD 4IQZA 1W6JA 2ZM6Q 4RA8A 4PZ6A 3QIAA 3DM1A 2HT1A 1B9MA 3BJUA 4A3FG 2EJMA 1II3A 1PFNA 2Y0SG 2Q8RE 5GAGC 1V1OA 4X64L 1GUGA 5IGGA 4ZRZA 4AIMA 2VL6A 2SNMA 4JOIC 4K6DA 3EFXD 4GNXA 1NMGA 4MNOA 3A8JE 3HOXH 3K6OA 1VS0A 3VYRA 4B9XA 3E0JA 1EUJA 1BCPC 1E1TA 2K4KA 3TZDA 3UI2A 2F03A 2JEBI 4YIJA 2PNHA 5TSSA 2KCTA 3AEVA 4LAAA 2RQXA 3TN2A 3TBIB 2JA8H 4UP7A 4YHHQ 2K5NA 3HOXG 5LMNW 4CDFC 1K28A 1PLFA 2NB0A 2WKCA 2QDLA 2K03A 4JI1Q 1PFSA 5FJ8H 3GTQH 3OW7A 4O42A 4GLXA 3ER0A 1EY8A 1G6ZA 3M4PA 1CK1A 3MA2B 1VQNA 5I6WA 1V1QA 3AU7A 4DNRB 3KBGA 1BDOA 1I94L 2JA8G 4G7HC 1TWGH 1A6XA 3W1BA 1TWHH 1VQPA 2RCNA 4NPSA 2XGTA 3EBEA 5FJ8G 2O4XA 5G3LD 3UDIA 4IUNA 3I7FA 2F0EA 5E4XA 3D4RA 1HR0L 2JE6I 2B2UA 3OTOL 3CCSA 1GJXA 1Y1WB 4LUVA 2QGQA 3ND9A 4JI4Q 1STBA 2A74C 1PH8A 2FINB 1EQVA 3SE0A 1H95A 1C4QA 4JW0A 2R92G 1KQSA 4LFBL 2KEEA 2B2VA 3D4DA 5ELOA 5ISRA 4L5RC 3NHHA 3LWUA 3SK4A 4DV4Q 4RWSC 1WCMB 4LF5L 4DR7L 2C35B 1X3GA 1Z6HA 1SYGA 2RHQB 4EVOA 1SJED 1STAA 3BYYB 1PH7A 3HKZE 2E74C 4PQXA 3KLRA 4IOAA 2YU9B 1H9JA 3Q8DA 4WJ3M 2F0IA 3CHBD 4PNYA 2XRQD 4A93B 1CUKA 3F2UA 1AFPA 1AE3A 2RHSB 2E2IB 3AMUA 3MHBA 5FOBB 4TQUS 2MP1A 1KAWA 2X69A 3PUYA 4GKJQ 1L0YB 1U5KA 3EIVA 2AMCB 2QEXA 4C2MH 2Q8TA 3DMUA 4RGOS 1VQ7A 1PYBA 3HOWH 4MZ9A 1A63A 1K73C 1I3QH 1K0SA 1UAPA 1X3EA 3MFYA 1XJVA 1RKNA 4QCLA 4S3SA 4R4QA 3D31A 1VQMA 2JQOA 1PRTB 3M9BA 4G4KA 2E2JH 3HOWG 3ZJYC 1KDCA 4LFAQ 3RLOA 2L0CA 2IY5B 1HRJA 4X3TA 3QOJA 2CKZB 4UAIA 3TMEA 5HGTA 1MIUA 1STGA 1PRTF 4DR4L 1OXVA 3CKIB 1D1KA 1L1OC 1XNQQ 1OXSC 1JJCB 3VA5A 4JV5Q 5M5XB 1CQFA 4KY5A 2IJ0A 3CD6A 2E8GA 4CJ0B 4KLKA 1FYCA 1VQGA 4HAEA 1N9WA 3KUPA 3T56B 4FF4A 3TEHB 2MUYA 5C44H 3NSWA 2IX1A 3ZYYX 3AFQA 4LF7Q 4AQYQ 5DM63 1JC7A 3PIO3 2SDFA 4BBRB 3C3LA 1VQAA 1EYDA 2NN6I 1JWUD 2K75A 4XXEA 1JWSD 1ILPA 1H9RA 1KNAA 1JWMD 5JPNC 1TWAB 4RGMA 1TY2A 4DR6Q 2N8NA 5JVH3 4JI2L 5C44G 1FR3A 2AQ1B 1FJGQ 5KNCA 3FRPB 2IL8A 3GQBA 4A3DH 2UU9L 3W1GA 2OCEA 2TSSA 4OEMB 5JVG3 1RCVD 3KF6B 2JSOA 2WV6D 5KGUA 4DR3Q 2NVYH 5KRUA 1IBLL 3GTMB 1I50H 3MXPA 4DV0Q 4DUZQ 5CV5A 4BY7H 4TVAB 3EROA 4YWLA 3P75A 4LJZC 4A3DG 2K14A 2LMCB 3RNUA 1SMYC 3CCJA 2AUJD 2I0QA 4YY3L 2B2YC 2EE1A 2WB1G 2ZTCA 5C5MA 1O7LA 1WTQA 3VYSA 5I2XA 3PMFA 2WAQE 4BY7G 4DAPA 4HN7A 1PRTD 1UNSA 2PI2E 3M4YA 1O78A 1DONA 4LF9L 1HUNA 2XNAC 5CV9A 2WINB 1YVCA 3RR5A 3NXWA 4KKUA 3G6JB 3BDLA 1MHWC 2MQHA 3VR2A 1YIJA 1Z47A 1GUOA 1MSHA 4OIJA 4IFDI 1QE6A 3JAMi 5C4HA 4OWXB 3RD4A 2LXJA 2JN4A 3IAYA 4C3HB 4LWCA 1LTSD 4UHVA 3DWPA 3F8TA 4H7BA 3NPPA 2R7ZB 4XQQA 2F0DA 1ENFA 5COYA 3GTPH 1QWYA 1B70B 1QCBD 2K6AA 4DU9A 1F77A 5AFWA 5CV8A 3K57A 4N9PA 4KK7A 5CV4A 3QJYA 4A3IH 1DZ1A 1SE8A 2HUGA 5IT9c 1S3OA 2IHEA 4WJWA 4QJFA 5D14A 1NAPA 1D7QA 4IUVA 4B3ML 3RMHA 5LMUL 2WP8J 1XWEA 2L12A 4DF7A 1K8AC 1RTNA 3W2DA 2FMCA 2HDMA 3D3RA 1XTDA 1STEA 3NENA 4TSSA 2IX0A 3I2ZA 3WDNA 1HXYD 1NSNS 2Q8IB 4A3IG 1LTBD 1Y1VB 4HIOA 3PGZA 5CV7A 5C3EH 1F2YA 4FXGC 3J81c 3NBIA 5FK9C 3I70A 3L0OA 3J80L 2E75C 3F1ZA 2K5DA 4GOPB 4DR1Q 3M4OB 1X3PA 3A5UA 3I4MB 2R61A 1KIXA 4DV6L 3U4ZA 4HJ9A 1XPOA 4A3GH 5C3EG 4DK6C 3VA7A 3M3YB 1I6HB 3FVQA 4K8JA 5JEAH 4LF4L 4L8JA 4JI8L 1IW7D 2EJFC 4LF8Q 4G7ZC 4ZK9B 3TDQA 1BNZA 2F0KA 2KBNA 1UE1A 5F2DA 4ME3A 1EIYB 3VYTA 2VW9A 4GOPA 2EOTA 2MNAA 4DV5Q 4A3GG 3TS0A 4K8IA 1IYJB 3KYHC 5JEAG 3O13A 3JAML 1UWVA 4AYBE 4RG1A 1LM0A 2EQSA 1EY4A 1WTPA 4ID6A 5M3FH 3FMCA 4A3FB 3ULPA 3J7ZC 4HMIA 2Y0SB 3UE1A 1I4RA 3K5NA 1BO0A 2CQOA 4X64Q 2CW0C 1VCIA 3NWTA 2A1AA 2K5WA 4OONA 2L15A 1AEXA 3X3NA 3CCLA 1ZYRD 5M3FG 2QKIC 2F4VL 4MHEA 2XVSA 3EN2A 1TY0A 3OIPA 2A6HD 4KN7C 1N36L 1R4QB 2OF1A 2JA6B 3S2DH 3STBC 3N6RA 3HOXB 4R8IA 1TVXA 1CZGA 5JEAJ 5D3IB 4DV1L 2F0VA 1I4PA 4LMQD 4JK1C 3K81C 4IN3A 2KEDA 5C4XB 1EFWA 3K8AA 3I4OA 3U4VA 3OW2A 3QOLA 1QG7A 4DV2L 1IBKL 1SN8A 2JA8B 3MXGA 3WOFA 2H1EA 1CM9A 4XYOA 2YTXA 3NTIA 2BE5C 2TMPA 2VY3A 2XWJB 3QWNA 1SNDA 1E3PA 5CORA 3GTQB 1IXRA 1QILA 3I4LA 3QR8A 1CHPD 2L1BA 3VR4A 1PDQA 1KL9A 1EY0A 3HRZC 4PZ7A 2V1CC 2Z8LA 4X3UA 4V190 1HR0Q 3SK5A 1V1PB 3OTOQ 1TWGB 1Q81C 4QB4A 4C1NI 3CF5A 1TWHB 1JMCA 1J9OA 4HIKA 1PZKD 2R93H 1SYEA 1VF7A 1ZKOA 1NY4A 3HKZG 1LV9A 4FP5D 4LFBQ 3I90A 1B50A 3H15A 4LNQA 2PQEA 2BA0A 4KHPL 4UP8A 5M5WH 2R6GA 3J7AF 3OSOA 1B44D 2HIXA 3E6ZX 3F2CA 3GV6A 4LF5Q 1V1PA 2R93G 4ZLTF 5IE8A 3E5SA 4KHVA 2B2WA 4DKAC 1WVLA 3TRZA 3P1HA 2K7VA 3J80E 2UXCL 2YTVA 1W6KA 4U68A 4C56C 1ESRA 2NBFA 5IYCH 2VUMB 2GA4B 2JA7B 5HURA 5T1GA 3ONAB 5IYBH 3M85A 3TP6A 4POFA 1R9TH 3SK6A 3PUWA 4APVA 1Z7TA 4HR7B 1LTGD 1YHAA 3R3OA 3Q0AA 1BQQT 1F9QA 4OELB 1E1OA 3RZOH 1QZGA 1OTCA 1PTOD 3KLSA 1RODA 5IYCG 2JYOA 3B6YA 3PIP3 1FNUA 4X66Q 4FF2A 1FVIA 4L6TB 1PH9A 1Y8PB 3A74A 4KY6A 5IYBG 3E0EA 2NVQH 3E9HA 1E7ZA 1F9SA 2B2TA 1N33L 1PYWD 5GQOA 1GD7A 4M8AA 3NP8A 4ULLA 1VQKA 4JYAQ 3TZUA 4QIWB 2YTYA 1UEBA 4C2MB 2Z9HA 1D2BA 4RHRA 2KUMA 4FF1A 4JC0A 1NR4A 3HOWB 5D3DA 1I3QB 1GHKA 2OXPA 2IPKD 2BCOA 3GTKH 4DR4Q 3BVZA 5IWAQ 4KHZA 1C9OA 4PG3A 1Q1BA 1SMXA 3UDGA 2Q2IA 2E2JB 1BVSA 5A2QL 3T16A 3T1YL 2MO0A 3ICEA 4DV3L 1T5EA 5JJLA 3CC2A 1Q90A 4HJAA 5IYDH 3W5OA 4DR2Q 3S17H 4RCOA 1KLGD 2NYZD 2K52A 4CBVA 3SGIA 1SE2A 1VQBA 2KCMA 4F88A 1Y69U 1BKBA 2XRSD 3EA6A 4DR5L 2A68C 2AQ2B 4Y7NH 4F87A 5IYDG 1QVGA 2B2WC 3KJOA 3A8KE 2LKVA 1VF5C 1PA6A 1ONLA 2N88A 1GVPA 1VQLA 1RJTA 4JI2Q 4NW2A 5C44B 1JOQA 2GVAA 4C1NK 2D5DA 3CU7A 1I4QA 3F2DA 2E5LL 3TS2A 3S2HH 1DGSA 3K5OA 3VR3A 2CCZA 1GUSA 4OGQC 1HQRD 1XPRA 3MAQA 1XMOQ 1GUTA 5LL6X 1IBLQ 2F0TA 3KLWA 4XTCS 2WAQG 3CCEA 4JI7L 2A73B 4YCUA 3PO3H 3V2TA 1E24A 4A3DB 1N34L 3BYTB 4H44C 1ML0D 1IKMA 2DY8A 4F8MA 4JI3L 3SEBA 2NVYB 1LT5D 4WORA 4YY3Q 5K5PA 1I50B 5C4JH 4JI5Q 2PO4A 1FNVA 1U4MA 1B1ZA 2EYMA 4EX5A 4BY7B 3C1EA 1G91A 5IGFA 4YWMA 3PO3G 1K83H 3NEMA 1XMQQ 2B8FA 4LFCL 4A3EH 4DUYL 3Q6SA 4DK0A 3GTOH 1JICA 5EKLA 2I07B 3G48A 3NTHA 4LF9Q 4NXML 1ENCA 3MTSA 2NZ1D 4L5TA 1YNXA 1LTID 5EGTA 3H0GH 4O2DA 3X3MA 2Z6KC 3V96A 2R92H 3J7YW 4MTNA 2L9HA 1VQEA 4AH6A 4A3EG 1IL2A 1HFNA 3A5ZB 2PPBC 2EYPA 5BN4A 1Q1EA 1WI5A 1E2VA 2CQAA 4DGZA 1SFOH 3A54A 2Z0SA 3H0GG 2K5VA 1HZBA 1PFBA 4K6LA 3S1MH 1HPCA 5EAYA 4NXNQ 2B63H 3PUXA 4DV7L 3D0FA 2EY2A 1SSOA 1WOCA 3GTPB 4PV1C 5J1ZA 1JJGA 5K36H 2K33A 4ME5A 3CRLC 1WD1A 4DAYB 3HOUH 1LTLA 2CHBD 4WFN3 1UE5A 3S14H 2H5XA 4A3IB 2NZHA 2F0GA 4RGNA 4HIDA 3DEPA 3UDFA 3PCOB 2B3GA 1EWHA 1YNJD 1EEFD 2VQFL 2B63G 1JR0D 4P73A 2UUCL 4IZ8A 5I9OA 5I4DA 1CZWA 5A2QE 3AYHB 5K36G 1MBYA 1BBUA 4GNXC 3HOUG 4JVZA 1EIHA 1SXTA 2F0QA 1SR3A 4DAYA 1FL0A 4IUQA 4L63B 4DNTB 5ELNA 1UEAB 4I65A 5C3EB 2FJ2A 1K8OA 2XSCA 1YBYA 2RDFA 2XTIA 4AYBG 4LF4Q 2CH4W 2VB2X 1V9PA 1XNRQ 2J4XA 1SNQA 1OXUA 1ZXTA 4C3JG 1LTAD 3NELA 3I55A 4NKLA 1KLUD 4A3GB 2QCPX 4J1MA 4U673 1HTLD 3MVVA 1CA6A 5JJZA 1S5ED 1VQHA 3JC66 3QB3A 4KKSA 1F2LA 3I8ZA 4X62L 1HNZL 2Z1CA 2IX3A 2RSNA 3SDZA 1OXXK 3DLLA 2E2HH 1Q7YC 4ALPA 5FLXc 2PZUA 3I91A 1AE2A 2BOSA 1KXLA 4GKKQ 4KD4A 2UXDL 5GAEC 1NE3A 2LXKA 2G9DA 4N9TA 1A2TA 1D5ZC 4RMFA 5M3FB 2B2UC 4ABNA 2HHHQ 2I5HA 1WTRA 5IP9H 2VQEL 4G7OC 1TS4A 2HIVA 5A35A 4IALA 5IGDA 4R1JA 2OWOA 2B2VC 3MZ5A 2PZWA 3LGJA 3HOVB 3Q23A 4IO9A 4RHSA 4DV1Q 1EU4A 4O0AA 4LF6Q 4IUPA 1U4PA 5IP9G 2FFKB 1PMRA 3BU2A 1PH2A 2I5LX 4K14A 5LMNL 3S15H 4MN3A 3GTLH 3PUZA 2DN8A 1VQCA 3LNNA 3R2IA 3J7A5 1IBKQ 4XIGS 4CHTB 5DM73 3S2DB 5I2YA 1KHIA 1X3QA 1KRTA 2RCFA 1B3QA
chains in the Genus database with same CATH topology
1MSGA 3FEWX 1TS2A 2F0PA 2L4NA 1D5MC 1SYBA 4OO1H 4KN4C 4M1UB 4XT3B 3H09A 1EY7A 1O80A 3HEJA 2HDLA 2WACA 3S16B 4K2LA 4TRDA 3L3OC 2R93B 1AZPA 4OO1G 1DXMA 3SR1A 5LL6S 5KIXA 2E2DC 5M5WB 1ZEQX 1FD7D 5J22A 3A55A 3NE5B 1DCZA 4PMBA 5JOBA 3DHQA 1A3TA 5FKAC 1PRTC 4BWGB 2SOBA 4H13C 3EJIA 1WD0A 2MPMA 4KV6A 1V8QA 1SNMA 5BN5A 1R9TB 3GO5A 3KLSX 2KQ3A 3R2TA 1NCVA 3RZOB 3GV3A 3VYUA 4K2KA 4QUCA 1LT4D 4RKLA 4RGTA 2NVQB 1G2SA 4HTHA 1EY9A 1BOSA 1AP0A 3DEOA 4RFBA 2BDOA 1L0XB 1RHPA 2PZTA 2PNRC 5IT9L 2IWHA 5EBCA 4ZKCB 3NQTA 1UUPA 2OT2A 2DNEA 2B39A 3EQLC 5FO7B 3NWSA 4FNFA 1B4OA 3GTKB 1BF4A 4R9WA 5IODA 2Z4HA 5KYLA 4ODGA 1DOMA 1DD2A 3J81L 2F0HA 4C3IG 3HP3A 3AB9A 3OOCA 5C0XH 3S17B 1IW7C 2ICEC 2M00A 1ICWA 5DEHA 3BVMA 2R3ZA 4FXKC 2RSOA 2SNSA 1EL0A 5C3WA 1QNKA 4Y7NB 4CJ1B 1BUVT 5C0XG 3OHXC 2C5CA 1SYFA 4Z9CB 2WAQB 1ESFA 1OO9B 1TQOA 3S2HB 4EQPA 1CQVA 3SVMA 4KMUC 2VNUD 1TS3A 3I73A 3SXHA 4F7XA 2K01A 4OHJA 1ZYRC 1AZQA 2XN9C 3PO3B 1TU2B 1YNND 2ZXOA 3IFDA 4BS9A 4MIUA 1LT3D 2A6HC 1HTPA 2D9UA 2PYKA 3NUCA 1GOZA 4IUTA 3MWYW 5C0XJ 5C4JB 4H0LC 1IYVA 1EQTA 2D62A 3IL8A 4KTAA 3T4AC 1K83B 3G7LA 5BN3A 2F0FA 4A3EB 3U9OA 3LWEA 3GTOB 1SAPA 4KD3A 2EXZA 2RDGA 2LS01 1F2ZA 3BG3A 4LK1C 2KA7A 4DXFA 1QJOA 3H0GB 1D5XC 3HGBA 2NTSA 2R92B 5ELCA 5IIFA 3C2PA 4ZKBB 2K1BA 2RKSA 4J8QA 1ET9A 3MXUA 4WRDA 1SFOB 4R8NA 4DN4M 1JOKA 2KJXA 3S1MB 5FO9B 3OMCA 1V43A 2O5IC 1ILQA 2A69D 2HCIA 5IT9E 4P2CB 4GZYC 3HOUB 1PFMA 5CBEE 3S14B 1F9PA 5EPJA 3H6MA 1RD9D 2RBMA 4AYBB 1BCPB 2AUKA 2EYOA 3J81E 2A6ED 1IKLA 1BXTA 3DWQA 1SEBD 2DNCA 1JCKB 1M8AA 1Q8IA 1BCPF 2L11A 3L7ZC 3OMGA 3NBHA 1EZ8A 2ICIA 2FHTA 4RCNA 1I4HA 3K5LA 1PTOC 1PXUA 1FGBD 5JAVA 3C46A 1PZJD 3H91A 3BDOA 4KJNA 1CFMA 1M4VA 2HCCA 2QEJC 4FO2A 2E2HB 4DFAA 3DWAA 1Y8NB 1JOOA 1O7ZA 4V0BA 2K5QA 1STHA 1LTTD 3Q24A 1TS5A 3U9SA 5KNBA 3WOEA 1SNCA 4FYDA 5DAUA 1EZ6A 1ENAA 4ZUJA 5G3LF 2F0NA 2PW5A 3IKJA 4KJOA 3H3VC 3OIQA 2M2LA 3ERQA 4RAUC 1TIID 1R4PB 3VR5A 4EQOA 3J7AV 4NDXA 1XYIA 1O7YA 1RDPD 3S15B 3HZXA 3Q22A 3GTLB 1EYAA 4K5VA 2F1MA 4FXDA 4ZUIA 1I6VC 2X6GA 1CT1D 1E2ZA 1VDZA 3TP5A 1IYUA 1LT6D 1BCPD 4RH6A 2H4OA 1PTOH 3K5MA 2EYJA 1SDFA 2K05A 2WB1B 2OEOA 2B2TC 1G8ZD 2MHVA 2O2LD 1HHVA 2KECA 4NMZA 3I72A 2V4DA 2EY6A 5KYIA 1VMPA 1BBXC 1OXTA 2XWBB 1B9NA 3C1FA 4CKCA 3DXJC 4E6IA 3RLFA 1QOHA 3K0YA 2EY1A 4K5XA 3NQIA 1A3UA 2F0SA 2ID0A 1MI2A 2NWGA 5CMDA 1TR5A 3D8GA 1G2TA 5C5LA 5IGBA 3R8BA 2C9OA 5CV6A 4DK1A 3PUVA 2J0TD 2K28A 2E76C 2J7ZA 3OPOA 3HOYB 2MJ8A 4DA2A 1RTOA 5EJWA 3QO2A 1HUMA 1A15A 1XX8A 3GP7A 4DXGA 1WTVA 4HSVA 1E2WA 3SHLA 4OO1I 4JBWA 3MEHA 3S1NB 3TSSA 1YNJC 4FVMA 3BZDB 1IL8A 1DYQA 2VXWA 5CYUA 5DNFA 1LTRD 2F0LA 1U4RA 4HCEA 3IFTA 4C3IB 5M3MB 2M9VA 5EBDA 3S1RB 1DM0B 3OWFA 4UDUC 3KF8A 1EYCA 3OWEB 1JB3A 2IT1A 4ZAIA 2AQ3B 5ELEA 5E4WC 4G57A 1NUCA 2JEAI 5M9OA 3RUZA 1CI3M 3D6WA 2EZVA 3HG9A 2LY7A 2B2YA 5KNDA 2F0OA 4J6HA 1EWCA 3VR6A 5EQ0A 2KOLA 1S5BD 1LLRD 2ZXPA 5I6YA 3A7LA 1CHQD 2DY7A 1S4ZA 5FLXL 5CBAE 1KDAA 1KNEA 2LFNA 2F3WA 2IW3A 1QNUA 3KK7A 2FMMA 2VB3X 4HCSA 3P7JA 2ZT9C 1HFGA 3I3CA 1TWCB 5ELFA 3R93A 2QDBA 2AWOA 5EKIA 3DUZA 1HA5A 5D65A 5IGCA 1STYA 4K5WA 1FNWA 1S5FD 1H9MA 4IUUA 2N55A 1MGSA 1GUNA 1BR9A 3TP8A 3HKZB 2ENBA 4XQNA 4CGYB 4ZYSA 5LHY1 5IOCA 3A56A 1TT2A 1C48A 2JXMB 5C0XI 1WTWA 1SMYD 3V05A 1D1IA 1F9RA 1EU3A 2L55A 3N52A 4Q5VA 2ZXRA 2JP1A 2RA4A 3SK8A 5CC4A 3EVQA 3GTJB 1MD2D 4QUFA 3ITPA 4XQJA 2NTTA 2B8GA 2NVXB 2L5TA 4B08A 3HOZB 1QB5D 3D4WA 4QMGA 1GHJA 1SE3A 4OIKA 4Q0FA 4X3KA 3M7NA 1RF2D 1SNOA 4PMWA 1JE4A 4A3JB 4FF3A 1U4LA 2MGSA 4B9WA 1D6EC 5JPMC 1JQYD 4RKBA 2QF7A 1HA6A 5C4ZA 4I7ZC 1DJRD 3FKIB 5C3XA 1JORA 2I46A 5ELDA 1HCZA 1A3VA 1XTCD 4CKBA 1B2TA 4HMJA 2RDHA 1XXGA 2NVTB 1Y8OB 2EYLA 2NN6H 5FLXE 5C6AA 4NP5A 1Q12A 5M5YB 4PMCA 1LABA 3MC0B 1TWFB 2JA5B 2QILA 2Z4IA 3LX0A 3FDTA 2EDGA 1EEID 2KCNA 3CQZB 2NN6G 1H9SB 1DOLA 3FPPA 4HEDA 1E0BA 1I4GA 4XT1B 3FPUB 4CKEA 2XIWA 2CW0D 3T13A 4A3BB 4BA2I 1H9SA 2F3VA 3H94A 1KDBA 2WKDA 1EY6A 2PCFB 2YYZA 4BBSB 1SYCA 4O1NA 2RVLA 4EGVA 3GD7A 4XDXA 3W3AA 1EY5A 1B53A 3A7AB 1G291 1KTKA 3T51B 1T5XD 3ND8A 4IFDH 1SJHD 1H9KA 1SBBB 3MXNA 5EPKA 1PTOB 3GTGB 2K32A 4KKTA 1CA5A 1KAAA 1VMCA 1PTOF 2BE5D 1YNNC 3K7AB 4IFDG 1Q3LA 3CRKC 1DOKA 3BDCA 4DAVA 1AW7A 5CR3A 2EPBA 5T1IA 4XYQA 2F0MA 4IURA 2KHSA 4X3SA 3RZDB 1NR2A 5NUCA 5IGEA 1SNPA 1GXDC 2WIIB 4ILWA 1I4XA 5I9PA 1EFID 3TP7A 4TKOB 1C8CA 3BS1A 2B63B 1X32A 4BA1I 1K8MA 4IFDJ 4A3KB 3M7GA 1SE4A 1ET6A 5E3FA 2X6LA 1B3AA 5KEEA 5J39A 2EJGC 4KY7A 2KCCA 1F2MA 4KI0A 5EPLA 2EYFA 2AWNA 2A69C 4EQNA 3MFGA 3T53B 3URYA 1EOTA 3D6CA 3NK9A 4C3JB 2PW7A 1GUWA 2EY5A 2F0UA 4BY1B 2F4IA 1A2UA 1CTMA 2D2CC 1SYDA 2NUCA 2SEBD 4C3HG 1WTOA 2A6EC 2KVMA 2PMZB 1EIGA 5CGKA 3K58A 3PV0A 4ZQ3A 2G9HD 3KBXA 3JAME 4QF4A 2BDNA 3P20A 1WTXA 1S5CD 2F0JA 5E1FA 2BA1A 2EYHA 4A3MB 1IHZA 3PO2B 2K04A 2CVRA 1LO5D 3A8IE 1AN8A 2EVBA 4CJ2C 5FO8B 4OL7A 5EKKA 1KABA 3S1QB 2A5HA 2O5JC 1HQMC 1PZID 2A68D 2F0WA 1TKWB 3HS0C 3S9WA 5ELBA 2HQEA 3BVGA 1J8IA 4HSPA 3L9AX 3I4NB 3NTKA 3QG1A 1U9RA 3K59A 1LACA 1STNA 1S5DD 4IQZA 1W6JA 4RA8A 3QIAA 3DM1A 1B9MA 2EJMA 1II3A 1PFNA 2Q8RE 1V1OA 1GUGA 5IGGA 4ZRZA 2SNMA 4K6DA 3EFXD 3A8JE 3K6OA 3VYRA 4B9XA 3E0JA 1BCPC 3TZDA 3UI2A 2F03A 2JEBI 4YIJA 5TSSA 4LAAA 2RQXA 3TN2A 3TBIB 1PLFA 2NB0A 2WKCA 2K03A 3OW7A 4O42A 1EY8A 1G6ZA 1CK1A 3MA2B 5I6WA 3AU7A 4DNRB 3KBGA 1BDOA 4G7HC 1A6XA 2O4XA 5G3LD 4IUNA 2F0EA 5E4XA 3D4RA 2JE6I 2B2UA 1GJXA 1Y1WB 3ND9A 1STBA 2A74C 2FINB 1EQVA 3SE0A 1C4QA 2KEEA 2B2VA 3D4DA 5ISRA 3NHHA 3LWUA 3SK4A 4RWSC 1WCMB 1Z6HA 1SYGA 4EVOA 1SJED 1STAA 3BYYB 2E74C 4PQXA 3KLRA 2YU9B 1H9JA 2F0IA 3CHBD 4PNYA 2XRQD 4A93B 3F2UA 1AFPA 2E2IB 3AMUA 3MHBA 5FOBB 4TQUS 2MP1A 2X69A 3PUYA 1L0YB 2Q8TA 3DMUA 4RGOS 1UAPA 3MFYA 1RKNA 4QCLA 4S3SA 3D31A 1PRTB 4G4KA 1KDCA 2L0CA 1HRJA 4X3TA 3QOJA 4UAIA 3TMEA 5HGTA 1STGA 1PRTF 1OXVA 3CKIB 1D1KA 1OXSC 3VA5A 5M5XB 1CQFA 4KY5A 2IJ0A 4CJ0B 1FYCA 4HAEA 3KUPA 3T56B 4FF4A 2MUYA 3NSWA 2IX1A 3ZYYX 5DM63 1JC7A 3PIO3 2SDFA 4BBRB 3C3LA 1EYDA 2NN6I 1JWUD 4XXEA 1JWSD 1ILPA 1H9RA 1KNAA 1JWMD 5JPNC 1TWAB 4RGMA 1TY2A 5JVH3 1FR3A 2AQ1B 5KNCA 3FRPB 2IL8A 3GQBA 2TSSA 5JVG3 1RCVD 2JSOA 2WV6D 5KGUA 5KRUA 3GTMB 3MXPA 5CV5A 3EROA 3P75A 4LJZC 2LMCB 1SMYC 2AUJD 2B2YC 2EE1A 5C5MA 1O7LA 1WTQA 3VYSA 5I2XA 3PMFA 4DAPA 4HN7A 1PRTD 1UNSA 3M4YA 1O78A 1DONA 1HUNA 2XNAC 5CV9A 2WINB 3NXWA 4KKUA 3G6JB 3BDLA 3VR2A 1Z47A 1GUOA 1MSHA 4OIJA 4IFDI 1QE6A 5C4HA 3RD4A 3IAYA 4C3HB 1LTSD 3DWPA 4H7BA 3NPPA 2R7ZB 4XQQA 2F0DA 1ENFA 5COYA 1QWYA 1QCBD 2K6AA 4DU9A 1F77A 5CV8A 5AFWA 3K57A 4N9PA 4KK7A 5CV4A 3QJYA 1DZ1A 2HUGA 4WJWA 5D14A 1NAPA 4IUVA 3RMHA 2WP8J 1XWEA 2L12A 4DF7A 1RTNA 3W2DA 2FMCA 2HDMA 3D3RA 1STEA 4TSSA 2IX0A 3WDNA 1HXYD 1NSNS 2Q8IB 1LTBD 1Y1VB 5CV7A 1F2YA 4FXGC 3NBIA 5FK9C 3I70A 3J80L 2E75C 2K5DA 3M4OB 1X3PA 3I4MB 2R61A 3VA7A 3M3YB 1I6HB 3FVQA 4K8JA 5JEAH 4L8JA 1IW7D 2EJFC 4G7ZC 4ZK9B 3TDQA 1BNZA 2F0KA 5F2DA 3VYTA 2EOTA 4K8IA 5JEAG 3O13A 3JAML 1EY4A 1WTPA 4ID6A 3FMCA 4A3FB 4HMIA 2Y0SB 1I4RA 3K5NA 1BO0A 2CW0C 1VCIA 3NWTA 2K5WA 1AEXA 3X3NA 1ZYRD 2QKIC 4MHEA 2XVSA 1TY0A 3OIPA 2A6HD 4KN7C 1R4QB 2OF1A 2JA6B 3N6RA 3HOXB 4R8IA 1TVXA 1CZGA 5JEAJ 5D3IB 2F0VA 1I4PA 4LMQD 4JK1C 4IN3A 2KEDA 5C4XB 3QOLA 1QG7A 2JA8B 3MXGA 3WOFA 2H1EA 1CM9A 4XYOA 3NTIA 2BE5C 2TMPA 2XWJB 3QWNA 1SNDA 5CORA 3GTQB 1QILA 3I4LA 1CHPD 2L1BA 3VR4A 1PDQA 4X3UA 1EY0A 3HRZC 4V190 2Z8LA 3SK5A 1V1PB 1TWGB 4QB4A 4C1NI 1TWHB 1J9OA 1PZKD 1SYEA 1VF7A 1ZKOA 1LV9A 4FP5D 3I90A 1B50A 2PQEA 2BA0A 2R6GA 3J7AF 3OSOA 1B44D 3E6ZX 3GV6A 1V1PA 4ZLTF 3E5SA 4KHVA 2B2WA 1WVLA 3P1HA 2K7VA 3J80E 1W6KA 4U68A 4C56C 1ESRA 2NBFA 2VUMB 2GA4B 2JA7B 5HURA 5T1GA 3ONAB 3M85A 3TP6A 3SK6A 3PUWA 1Z7TA 4HR7B 1LTGD 3R3OA 3Q0AA 1BQQT 1F9QA 1PTOD 3KLSA 1RODA 2JYOA 3PIP3 1FNUA 4FF2A 4L6TB 1Y8PB 4KY6A 1F9SA 2B2TA 1PYWD 4M8AA 3NP8A 4ULLA 3TZUA 4QIWB 4C2MB 1D2BA 4RHRA 2KUMA 4FF1A 1NR4A 3HOWB 5D3DA 1I3QB 1GHKA 2OXPA 2IPKD 2BCOA 3BVZA 4KHZA 1Q1BA 2E2JB 5A2QL 3T16A 1T5EA 1Q90A 4RCOA 1KLGD 2NYZD 4CBVA 1SE2A 4F88A 1Y69U 2XRSD 3EA6A 2A68C 2AQ2B 4F87A 2B2WC 3A8KE 2LKVA 1VF5C 1ONLA 2N88A 1RJTA 4NW2A 5C44B 1JOQA 4C1NK 2D5DA 3CU7A 1I4QA 3K5OA 3VR3A 1GUSA 4OGQC 1HQRD 3MAQA 1GUTA 5LL6X 2F0TA 4XTCS 2A73B 3V2TA 4A3DB 3BYTB 4H44C 1ML0D 1IKMA 2DY8A 4F8MA 3SEBA 2NVYB 1LT5D 4WORA 5K5PA 1I50B 2PO4A 1FNVA 1U4MA 1B1ZA 2EYMA 4BY7B 3C1EA 1G91A 5IGFA 2B8FA 3Q6SA 4DK0A 1JICA 5EKLA 2I07B 3NTHA 1ENCA 3MTSA 2NZ1D 1LTID 5EGTA 3X3MA 3V96A 3J7YW 2L9HA 1HFNA 2PPBC 2EYPA 5BN4A 1Q1EA 1E2VA 2CQAA 4DGZA 3A54A 1PFBA 4K6LA 1HPCA 3PUXA 2EY2A 1SSOA 3GTPB 4PV1C 5J1ZA 5K36H 2K33A 4ME5A 3CRLC 1WD1A 2CHBD 4WFN3 4A3IB 2F0GA 4RGNA 3DEPA 1EWHA 1YNJD 1EEFD 1JR0D 4IZ8A 5I9OA 5I4DA 1CZWA 5A2QE 5K36G 1MBYA 1EIHA 1SXTA 2F0QA 4DAYA 4IUQA 4L63B 4DNTB 1UEAB 4I65A 5C3EB 2FJ2A 1K8OA 2XSCA 2RDFA 2VB2X 2J4XA 1SNQA 1OXUA 1ZXTA 4C3JG 1LTAD 4NKLA 1KLUD 4A3GB 2QCPX 4J1MA 4U673 1HTLD 3MVVA 1CA6A 5JJZA 1S5ED 3QB3A 4KKSA 1F2LA 3I8ZA 2Z1CA 2IX3A 2RSNA 3SDZA 1OXXK 2PZUA 3I91A 2BOSA 4KD4A 2G9DA 4N9TA 1A2TA 1D5ZC 5M3FB 2B2UC 4ABNA 1WTRA 4G7OC 1TS4A 5A35A 4IALA 5IGDA 2B2VC 3MZ5A 2PZWA 3HOVB 3Q23A 4RHSA 1EU4A 4IUPA 1U4PA 2FFKB 1PMRA 4K14A 4MN3A 3PUZA 2DN8A 3LNNA 3R2IA 3S2DB 4CHTB 4XIGS 5DM73 5I2YA 1X3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSS A;  3R8B A;  1RF2 D;  1I4Q A;  1SJH D;  1UUP A;  3O13 A;  1TS2 A;  5I4D A;  1SBB B;  1PTO B;  4DXF A;  1LTT D;  1SXT A;  1TS5 A;  1D6E C;  1D5M C;  1D5X C;  1HQR D;  2NTS A;  4C56 C;  1JQY D;  4L63 B;  1I4R A;  1PRT D;  1UNS A;  2G9H D;  5ELC A;  1PRT B;  2XNA C;  1PTO F;  5ELF A;  1CK1 A;  1ET9 A;  1DJR D;  1S5C D;  2J4X A;  1AW7 A;  1HA5 A;  3GP7 A;  3BYT B;  1LTG D;  4DXG A;  1FNW A;  1PRT F;  1LTA D;  1LTS D;  1S5F D;  1PTO D;  5ELD A;  3SEB A;  3DWP A;  1KLU D;  1LT5 D;  1XTC D;  1TY0 A;  3BVM A;  1FNU A;  2RDH A;  1RDP D;  1ENF A;  1HTL D;  1XXG A;  4L6T B;  1FNV A;  1B1Z A;  1S5E D;  2IJ0 A;  1F77 A;  1LO5 D;  3TSS A;  1AN8 A;  3BZD B;  1PYW D;  5D3I B;  1CT1 D;  1DYQ A;  4ZYS A;  1I4X A;  1FD7 D;  1I4P A;  3MC0 B;  4RHR A;  1PZI D;  1LT6 D;  1RD9 D;  1EFI D;  2QIL A;  4Z9C B;  5ELB A;  1ESF A;  1LTR D;  1BCP D;  3V05 A;  4RH6 A;  5D3D A;  3W2D A;  1EEI D;  5FKA C;  1BCP B;  1PTO H;  1EU3 A;  1STE A;  1CQV A;  1LTI D;  3BVG A;  1PRT C;  1D5Z C;  4TSS A;  4BWG B;  1BXT A;  3DWQ A;  1JWU D;  1HXY D;  1JWS D;  1TS3 A;  1G8Z D;  1LTB D;  1JWM D;  2IPK D;  3BVZ A;  4RGM A;  1SEB D;  1TY2 A;  1SE4 A;  4UDU C;  1ET6 A;  1JCK B;  2O2L D;  4OHJ A;  1BCP F;  1TS4 A;  5FK9 C;  3OWE B;  1SJE D;  3BYY B;  1I4G A;  1QIL A;  2AQ1 B;  1CHP D;  2ICI A;  2AQ3 B;  2XN9 C;  5ELE A;  1S5D D;  1I4H A;  2Z8L A;  3KLS X;  1PTO C;  1V1P B;  2TSS A;  3R2T A;  1RCV D;  1LT3 D;  2R61 A;  2WV6 D;  4RCO A;  3CHB D;  1KLG D;  4K6L A;  4RHS A;  1PZK D;  1EU4 A;  3MFG A;  2XRQ D;  1MD2 D;  1FGB D;  1V1O A;  3URY A;  1GOZ A;  1EWC A;  1SE2 A;  2XRS D;  1LT4 D;  1PZJ D;  2NTT A;  3EFX D;  3EA6 A;  1S5B D;  4O1N A;  1LLR D;  3R2I A;  4RGT A;  2CHB D;  1M4V A;  2AQ2 B;  2QEJ C;  4RGN A;  1L0Y B;  4RFB A;  1B44 D;  1BCP C;  1CHQ D;  1L0X B;  2SEB D;  1V1P A;  1KTK A;  1EEF D;  1SE3 A;  4RGO S;  3DWA A;  1JR0 D;  1T5X D;  2RDG A; 
#chains in the Genus database with same CATH topology
 1MSG A;  3FEW X;  3KOJ A;  1X55 A;  1TS2 A;  3F2B A;  3PF5 A;  2F0P A;  1A0I A;  2L4N A;  4B3S L;  1D5M C;  3M4Q A;  1SYB A;  4OO1 H;  4KN4 C;  4M1U B;  4XT3 B;  3H09 A;  1NNX A;  1EY7 A;  3PQI A;  3J80 i;  1O80 A;  3HEJ A;  1BBW A;  3VDY A;  2HDL A;  1Q86 C;  2WAC A;  3TQY A;  3S16 B;  4K2L A;  1VQ9 A;  4JI6 Q;  3KF6 A;  3OYY A;  4KHP Q;  4TRD A;  3PSI A;  3L3O C;  2R93 B;  1AZP A;  4OO1 G;  1DXM A;  3K80 C;  2UXB L;  2CFM A;  3SR1 A;  5LL6 S;  5KIX A;  2UXC Q;  2E2D C;  5HY6 A;  5M5W B;  1ZEQ X;  1W3S A;  1FD7 D;  5J22 A;  3A55 A;  3NE5 B;  1DCZ A;  4PMB A;  5JOB A;  1S40 A;  3DHQ A;  1E22 A;  4DPG A;  1M1K C;  1A3T A;  5FKA C;  3U50 C;  1YJW A;  1PRT C;  4BWG B;  2SOB A;  2F52 A;  1TXY A;  3UE0 A;  4CDD C;  3CME A;  3HOY H;  4H13 C;  3EJI A;  1Y1W H;  4LUZ A;  1YZ6 A;  1WD0 A;  2MPM A;  4KV6 A;  1WJJ A;  1V8Q A;  1SNM A;  4UP9 A;  5BN5 A;  1R9T B;  1AH9 A;  3GO5 A;  3KLS X;  2KQ3 A;  4FDB A;  3R2T A;  1X56 A;  1NCV A;  3RZO B;  4JI4 L;  3HOY G;  3GV3 A;  1N32 L;  3VYU A;  4K2K A;  1Y1W G;  1JE5 A;  4QUC A;  1LT4 D;  4RKL A;  4DAM A;  2ZTD A;  4DK3 C;  4EQ5 A;  3S1N H;  4RGT A;  2NVQ B;  1G2S A;  3J80 c;  4UPA A;  2CWP A;  2JK8 A;  1EY9 A;  4HTH A;  1Q82 C;  2K5H A;  4B3R Q;  4WJ4 A;  1BOS A;  1AP0 A;  3DEO A;  4RFB A;  2BDO A;  1L0X B;  3E9I A;  1RHP A;  2PZT A;  4N8X 1;  4DV4 L;  2YU9 H;  2PNR C;  5IT9 L;  2IWH A;  3CMA A;  5EBC A;  4ZKC B;  3NQT A;  1UUP A;  2OT2 A;  2DNE A;  4C3I H;  5M3M H;  3T1Y Q;  1G6P A;  2B39 A;  3EQL C;  5FO7 B;  3NWS A;  4FNF A;  3S1R H;  1B4O A;  3GTK B;  1BF4 A;  4R9W A;  5IOD A;  2Z4H A;  5KYL A;  4ODG A;  4JI0 Q;  1DOM A;  1DD2 A;  3J81 L;  4JBM A;  2F0H A;  4C3I G;  5M3M G;  3JAM c;  1KC8 C;  3HP3 A;  3AB9 A;  3OOC A;  5C0X H;  3S17 B;  1IW7 C;  2ICE C;  2M00 A;  1ICW A;  5DEH A;  3BVM A;  2R3Z A;  4FXK C;  1NJI C;  2KHJ A;  2RSO A;  2SNS A;  2E5L Q;  1EL0 A;  5C3W A;  1QNK A;  4Y7N B;  4A76 A;  4CJ1 B;  1BUV T;  1EOV A;  5C0X G;  3OHX C;  2C5C A;  2QW7 A;  1SYF A;  4YCV A;  4Z9C B;  2WAQ B;  1ESF A;  1OO9 B;  1TQO A;  3S2H B;  4EQP A;  4JI7 Q;  1CQV A;  3SVM A;  1C7Y A;  4KMU C;  2PMZ E;  2VNU D;  2ZJP A;  1TS3 A;  4LFA L;  3I73 A;  3SXH A;  4F7X A;  1YHB A;  1TWC H;  3CCM A;  1CSQ A;  1X6O A;  2K01 A;  2ZJQ A;  4OHJ A;  4CDC C;  2PQA B;  2P5Z X;  5JJK A;  1ZYR C;  1AZQ A;  2XN9 C;  4JV5 L;  3PO3 B;  4QIW E;  4GS3 A;  1TU2 B;  1YNN D;  2ZXO A;  3IFD A;  4BS9 A;  4MIU A;  3G71 A;  1LT3 D;  2A6H C;  4LFC Q;  2ATW A;  1HTP A;  2D9U A;  1ASZ A;  2PYK A;  3K7U C;  3NUC A;  1GOZ A;  1I94 Q;  4IUT A;  4GN5 A;  3MWY W;  5C0X J;  5C4J B;  4H0L C;  2DJF C;  1EQT A;  2D62 A;  3IL8 A;  4LW1 A;  4KTA A;  4IOC A;  1IYV A;  3T4A C;  2PQA A;  4LF7 L;  1WYD A;  1K83 B;  4AQY L;  3G7L A;  5IY0 A;  5BN3 A;  2F0F A;  4A3E B;  3U9O A;  3E3X A;  1GKH A;  3LWE A;  3GTO B;  4IPG A;  1SAP A;  4KD3 A;  4K0K L;  2EXZ A;  2RDG A;  1NTG A;  2KEN A;  2LS0 1;  1F2Z A;  2ALY B;  3BG3 A;  1K3B C;  4LK1 C;  2KA7 A;  4DXF A;  1QJO A;  3H0G B;  3CCV A;  1D5X C;  3HGB A;  2NTS A;  2R92 B;  3I56 A;  5ELC A;  4GOP C;  5IIF A;  3C2P A;  4DV7 Q;  4ZKB B;  2K1B A;  2RKS A;  4J8Q A;  1ET9 A;  3FHW A;  3MXU A;  4DR7 Q;  3ERS X;  4WRD A;  5E7N A;  4R8N A;  1SFO B;  4DUZ L;  3TRE A;  4DN4 M;  1JOK A;  2KJX A;  4J15 A;  3GTJ H;  3S1M B;  5FO9 B;  1K9M C;  4HJ5 A;  3OMC A;  1V43 A;  2O5I C;  1Q8K A;  1ILQ A;  2A69 D;  2HCI A;  5IT9 E;  2NVX H;  2UUC Q;  4GN4 B;  4P2C B;  2IHF A;  4GZY C;  5L37 A;  3HOU B;  1PFM A;  1Z9F A;  5CBE E;  3S14 B;  3HOZ H;  1F9P A;  4HJ7 A;  3NBH B;  2AHO B;  4IPC A;  5EPJ A;  3H6M A;  1RD9 D;  2N49 A;  2RBM A;  5GRO A;  4AYB B;  4A3J H;  1BCP B;  2AUK A;  2EYO A;  3J81 E;  2A6E D;  1IKL A;  1BXT A;  3DWQ A;  3HOZ G;  1L0W A;  3BZK A;  3RN2 A;  1HR0 W;  1SEB D;  2DNC A;  1JCK B;  1M8A A;  1Q8I A;  1VQI A;  1BCP F;  2L11 A;  3L7Z C;  3OMG A;  4JOI A;  3NBH A;  3J81 j;  1EZ8 A;  2ICI A;  4A3J G;  2FHT A;  4RCN A;  3G4S A;  1I4H A;  3K5L A;  1PTO C;  5H1S E;  1ASY A;  4OX9 L;  3FKI H;  1RL2 A;  1PXU A;  1FGB D;  3AFP A;  2D0P A;  5JAV A;  3C46 A;  1PZJ D;  3GDE A;  2NVT H;  3H91 A;  3BDO A;  1C0A A;  4KJN A;  2ZTE A;  1CFM A;  1M4V A;  2HCC A;  5M5Y H;  2QEJ C;  2ASB A;  3FKI G;  4FO2 A;  2UUA L;  2E2H B;  4DFA A;  3M4O H;  1TWF H;  2JJQ A;  4B3T L;  3DWA A;  2JA5 H;  1Y8N B;  2VQE Q;  1JJ2 A;  1JOO A;  1ICF B;  1VQD A;  4NB3 A;  1O7Z A;  3CQZ H;  4V0B A;  2K5Q A;  1STH A;  1LTT D;  3Q24 A;  2HQL A;  1TS5 A;  3U9S A;  1HZA A;  2EIF A;  1VQ4 A;  3KDF B;  1MKH A;  2EXD A;  4P74 A;  5KNB A;  3CCR A;  2JA5 G;  1UE7 A;  4R4I A;  3WOE A;  5LMN Q;  1SNC A;  4FYD A;  5DAU A;  1EZ6 A;  1ENA A;  4ZUJ A;  5G3L F;  2F0N A;  2PW5 A;  2Z6B A;  3IKJ A;  4KJO A;  1L2F A;  3H3V C;  3OIQ A;  4A3B H;  2M2L A;  4LF8 L;  1XPU A;  4P71 A;  3ERQ A;  4RAU C;  1TII D;  1R4P B;  3VR5 A;  4EQO A;  3CCU A;  2CH4 A;  3J7A V;  4NDX A;  1XYI A;  3S24 A;  1O7Y A;  1RDP D;  2UU9 Q;  2BH2 A;  4BBS H;  1K3R A;  4GLV B;  3S15 B;  4DV5 L;  3HZX A;  3Q22 A;  3GTL B;  3KDF A;  1EYA A;  4K5V A;  2F1M A;  4FXD A;  4ZUI A;  1I6V C;  2UUB L;  2R7F A;  2X6G A;  1CT1 D;  1EWI A;  4A3B G;  1E2Z A;  4B3S Q;  2GN5 A;  3T1H L;  1VDZ A;  3TP5 A;  1IYU A;  1LT6 D;  1X3F A;  4QQB X;  5GAH C;  1BCP D;  4BBS G;  4RH6 A;  1FGU A;  2H4O A;  1PTO H;  3K5M A;  3GTG H;  2EYJ A;  1SDF A;  2K05 A;  2WB1 B;  1GM5 A;  2OEO A;  2B2T C;  1G8Z D;  2JA6 H;  1A62 A;  2MHV A;  2O2L D;  1A8V A;  1HHV A;  2KEC A;  2RF4 A;  3K7A H;  4IJH A;  4NMZ A;  4GLA C;  2VZA A;  5C4X H;  2UXB Q;  3I72 A;  2V4D A;  1HNX L;  2EY6 A;  5KYI A;  1VMP A;  2LSS A;  1BBX C;  2JA6 G;  1OXT A;  2XWB B;  1B9N A;  1HNW L;  1IZ6 A;  3C1F A;  4CKC A;  2MO1 A;  1VQ8 A;  3RZD H;  1SRO A;  3DXJ C;  4P72 A;  4PZ8 A;  1YJN A;  4E6I A;  3RLF A;  1L1O B;  1QOH A;  5BR8 L;  3K0Y A;  2EY1 A;  4K5X A;  3NQI A;  5C4X G;  1A3U A;  2F0S A;  2ID0 A;  1MI2 A;  2NWG A;  5CMD A;  1TR5 A;  3D8G A;  1G2T A;  2ES2 A;  5C5L A;  5IGB A;  3R8B A;  2C9O A;  2OTL A;  1CKN B;  5CV6 A;  4DK1 A;  3H3V H;  3PUV A;  1PHJ A;  2J0T D;  4A3K H;  1L1O A;  2K28 A;  2E76 C;  2J7Z A;  4B3M Q;  5LMU Q;  3OPO A;  3HOY B;  4A75 A;  3PIP A;  2MJ8 A;  2OQK A;  4DA2 A;  1N32 Q;  1RTO A;  5EJW A;  3QO2 A;  2CWA A;  1HUM A;  1A15 A;  1MJC A;  1XX8 A;  5GAD C;  3GP7 A;  3CP0 A;  5AJ3 L;  4DXG A;  1WTV A;  1CKN A;  3L2P A;  4A3K G;  1VQO A;  3AQQ A;  4HSV A;  4JG2 A;  1SLJ A;  2OTJ A;  1E2W A;  3SHL A;  4OO1 I;  4C3J H;  1EQQ A;  3FP9 A;  4JBW A;  2VUM H;  2JA7 H;  3MEH A;  3KJP A;  3S1N B;  4DV6 Q;  4BY1 H;  3TSS A;  1YNJ C;  4FVM A;  3BZD B;  3KF8 B;  4OXP A;  1IL8 A;  1DYQ A;  1KRS A;  4JI8 Q;  2VXW A;  5CYU A;  4OWW B;  5DNF A;  4P75 A;  1LTR D;  3UDX A;  2F0L A;  1U4R A;  4HCE A;  3IFT A;  4C3I B;  5M3M B;  2M9V A;  2VS1 A;  2VUM G;  1J5E L;  2JA7 G;  1MJE A;  4BY1 G;  1EYG A;  2G5D A;  3HKS A;  3IRB A;  5EBD A;  3S1R B;  4CDE C;  1DM0 B;  3OWF A;  1PH3 A;  1WFQ A;  4UDU C;  3KF8 A;  3K0X A;  1NBW A;  2DGY A;  1G51 A;  1EYC A;  3OWE B;  1JB3 A;  2IT1 A;  4ZAI A;  2AQ3 B;  5ELE A;  5E4W C;  4G57 A;  4X66 L;  1NUC A;  2JEA I;  5M9O A;  3RUZ A;  1JT8 A;  1CI3 M;  3HFZ B;  2F3I A;  3D6W A;  2EZV A;  3HG9 A;  2LY7 A;  4A3M H;  2FXQ A;  2B2Y A;  5KND A;  2F0O A;  3PO2 H;  3CCQ A;  4J6H A;  1EWC A;  4JYA L;  4YCW A;  3A0J A;  3VR6 A;  5EQ0 A;  1YI2 A;  1EIF A;  4X65 L;  2KOL A;  1S5B D;  1LLR D;  2F4V Q;  2ZXP A;  1IBM L;  1JB7 A;  5I6Y A;  3A7L A;  1N36 Q;  3S1Q H;  4OWT B;  1PH1 A;  1CHQ D;  1Q46 A;  4A3M G;  2DY7 A;  2MFI A;  1CKM A;  3PO2 G;  1S4Z A;  5HGQ A;  5IWA L;  5FLX L;  5CBA E;  1KDA A;  1YHQ A;  1KNE A;  4A4I A;  4A3C H;  2LFN A;  2F3W A;  2IW3 A;  1QNU A;  3KK7 A;  2FMM A;  2VB3 X;  4HCS A;  3P7J A;  2JA9 A;  3I4N H;  2ZT9 C;  1HFG A;  3I3C A;  1GO3 E;  1TWC B;  3U58 A;  4DR2 L;  4DV2 Q;  4QY7 A;  4R4O A;  5ELF A;  3R93 A;  3RLN A;  2QDB A;  2AWO A;  5EKI A;  4QL5 A;  4A3C G;  3DUZ A;  1HA5 A;  4R4T A;  5D65 A;  3WWV A;  1STY A;  5IGC A;  2GVB A;  4K5W A;  1FNW A;  3I4N G;  1S5F D;  1H9M A;  4IUU A;  4K0K Q;  4JBK A;  2N55 A;  2ZM6 L;  1MGS A;  1GUN A;  1BR9 A;  1LUZ A;  4IJL A;  3TP8 A;  2AKW B;  3HKZ B;  4I7A A;  2ENB A;  4XQN A;  4CGY B;  4ZYS A;  5LHY 1;  5IOC A;  3A56 A;  4DNI A;  1TT2 A;  1C48 A;  2JXM B;  5C0X I;  4JBJ A;  1WTW A;  1XMO L;  1SMY D;  3V05 A;  1D1I A;  1F9R A;  2Q2H A;  1N8R C;  1EU3 A;  4POG A;  1WTH A;  2L55 A;  3N52 A;  4Q5V A;  2ZXR A;  3CPW A;  3J81 i;  2Y0S E;  1QVC A;  2JP1 A;  2RA4 A;  5IP7 H;  4YHH L;  3SK8 A;  2NZO A;  4JI5 L;  2Q2U A;  5CC4 A;  1M90 C;  3EVQ A;  3GTJ B;  1XMQ L;  4JI1 L;  1MD2 D;  4QUF A;  1B7Y B;  3ITP A;  4XQJ A;  3CW2 C;  2NTT A;  2B8G A;  2NVX B;  3MEF A;  5IP7 G;  2L5T A;  4B08 A;  3HOZ B;  1QB5 D;  3D4W A;  4QMG A;  1GHJ A;  1D8L A;  1SE3 A;  4OIK A;  4Q0F A;  4X3K A;  3M7N A;  1RF2 D;  1N33 Q;  1SNO A;  4PMW A;  1JE4 A;  4A3J B;  1PH6 A;  4FF3 A;  1U4L A;  2MGS A;  4B9W A;  2I5M X;  1X65 A;  1QZH A;  1WCM H;  1D6E C;  3BZC A;  5JPM C;  4OX9 Q;  1JQY D;  1K8G A;  4R4C A;  4RKB A;  2QF7 A;  4NXN L;  3CAM A;  1HA6 A;  5C4Z A;  4I7Z C;  1DJR D;  3G6E A;  4JPB W;  1YJ9 A;  3KFU A;  3FKI B;  5C3X A;  1JOR A;  1WCM G;  2I46 A;  4A93 H;  5ELD A;  2UUA Q;  4BXX H;  4DV3 Q;  1HCZ A;  1A3V A;  1XTC D;  4CKB A;  1B2T A;  4HMJ A;  2RDH A;  4B3T Q;  1XXG A;  2E2I H;  5FLM H;  2NVT B;  1PH5 A;  1Y8O B;  2EYL A;  1T9H A;  2NN6 H;  1HZ9 A;  5FLX E;  2DJG C;  5C6A A;  4NP5 A;  1Q12 A;  5M5Y B;  4PMC A;  1LAB A;  1CSP A;  3MC0 B;  4A93 G;  1TWF B;  4BXX G;  2JA5 B;  2QIL A;  2Z4I A;  3LX0 A;  3FDT A;  4N8F A;  4DR5 Q;  2EDG A;  1S72 A;  5FLM G;  1EEI D;  2KCN A;  4L5Q A;  3CQZ B;  2DUD A;  2YV5 A;  2NN6 G;  1H9S B;  4GKJ L;  1DOL A;  3FPP A;  1W2B A;  1XNR L;  4HED A;  2D0O A;  1Y14 B;  3PIO A;  4L5S A;  1VQJ A;  1E0B A;  1I4G A;  4XT1 B;  2BH8 A;  3FPU B;  1U0L A;  1X54 A;  3PF4 A;  4CKE A;  2XIW A;  1J6Q A;  2A8V A;  2CW0 D;  3T13 A;  4A3B B;  4BA2 I;  2UUB Q;  1H9S A;  2F3V A;  3H94 A;  3T1H Q;  2WFW A;  5JJI A;  1KDB A;  2WKD A;  3MXN B;  5M5X H;  3CC4 A;  1EY6 A;  2PCF B;  1N34 Q;  2YYZ A;  4BBS B;  2QA4 A;  1SYC A;  4O1N A;  4MTK A;  2RVL A;  4EGV A;  4JI3 Q;  4GKK L;  3GD7 A;  4XDX A;  3W3A A;  1EY5 A;  2N3S A;  1YEZ A;  2OQ0 A;  1B53 A;  3A7A B;  1PV4 A;  3STB D;  3ULL A;  1XNQ L;  3HOV H;  1G29 1;  1KTK A;  3T51 B;  2HHH L;  1X9N A;  1T5X D;  2N78 A;  3ULJ A;  1HZC A;  3ND8 A;  4IFD H;  1SJH D;  1H9K A;  1SBB B;  3MXN A;  5EPK A;  4BBR H;  1PTO B;  4DUY Q;  3GTG B;  2K32 A;  2PI2 A;  4KKT A;  1HNX Q;  4NXM Q;  1TWA H;  1CA5 A;  2ZJR A;  3HOV G;  1HNW Q;  1KAA A;  1VMC A;  1PTO F;  2BE5 D;  4LUO A;  1YNN C;  3K7A B;  4LF6 L;  4IFD G;  1Q3L A;  1RIP A;  3CRK C;  1DOK A;  3BDC A;  4DAV A;  1YIT A;  1AW7 A;  5BR8 Q;  5CR3 A;  4BBR G;  2EPB A;  5T1I A;  1EQR A;  4XYQ A;  2F0M A;  4IUR A;  4DR6 L;  2KHS A;  3GTM H;  4X3S A;  3RZD B;  1CKO A;  1FJG L;  1NR2 A;  5NUC A;  4H02 A;  5IGE A;  3RN5 A;  1SNP A;  1LYL A;  1GXD C;  4DR3 L;  2WII B;  4ILW A;  1I4X A;  3S16 H;  5I9P A;  1EFI D;  4DV0 L;  4UY8 C;  4YWK A;  3TP7 A;  4TKO B;  1C8C A;  3BS1 A;  2K50 A;  2B63 B;  1X32 A;  4BA1 I;  1K8M A;  4IFD J;  2VQF Q;  4Y52 H;  4A3K B;  3M7G A;  5AJ3 Q;  1SE4 A;  4JI6 L;  1ET6 A;  5E3F A;  2HD3 A;  4IPD A;  1I5F A;  2X6L A;  1B3A A;  5KEE A;  5J39 A;  2EJG C;  4KY7 A;  2KCC A;  4JCV E;  1F2M A;  4IPH A;  1P8L A;  4KI0 A;  5EPL A;  2EYF A;  2AWN A;  2A69 C;  4C3H H;  4EQN A;  3MFG A;  3T53 B;  2R7Z H;  3URY A;  1EOT A;  3D6C A;  1VQ6 A;  3NK9 A;  4C3J B;  1K0R A;  2WB1 E;  2PW7 A;  1GUW A;  1P16 A;  2EY5 A;  1QVF A;  4QGU A;  5DLQ E;  2F0U A;  4BY1 B;  1PVO A;  1J5E Q;  1B8A A;  2F4I A;  4X6A H;  1A2U A;  4GN3 B;  4HJ8 A;  1CTM A;  1VQF A;  2D2C C;  1SYD A;  2NUC A;  2SEB D;  4C3H G;  1WTO A;  2R7Z G;  2A6E C;  4X62 Q;  2KVM A;  1HNZ Q;  2PMZ B;  1EIG A;  4HIM A;  5CGK A;  3K58 A;  1Y1V H;  3PV0 A;  4ZQ3 A;  2UXD Q;  2G9H D;  3KBX A;  3JAM E;  2Q2T A;  4QF4 A;  2BDN A;  3P20 A;  3CPF A;  4ZCK A;  2A19 A;  3DM3 A;  4X65 Q;  1S5C D;  1WTX A;  5J3B A;  2R7D A;  2F0J A;  1PYS B;  3I4M H;  3H3V I;  1IBM Q;  5E1F A;  2BA1 A;  2EYH A;  1Y1V G;  4A3M B;  4B3R L;  1IHZ A;  3M3Y H;  3PO2 B;  1I6H H;  3CXC A;  1O7I A;  2K04 A;  2CVR A;  1LO5 D;  4DR1 L;  3A8I E;  2Z6K A;  1AN8 A;  1HJP A;  2EVB A;  4CJ2 C;  5FO8 B;  4OL7 A;  3I4M G;  1QUQ B;  5EKK A;  1KAB A;  3S1Q B;  2A5H A;  2O5J C;  1HQM C;  1PZI D;  2A68 D;  2F0W A;  1TKW B;  3HS0 C;  1KD1 C;  1VQ5 A;  3S9W A;  4A3L H;  3CC7 A;  5ELB A;  1UE6 A;  2HQE A;  2KHI A;  3BVG A;  1J8I A;  1NMF A;  4JI0 L;  4HSP A;  3L9A X;  4A3F H;  3I4N B;  3NTK A;  1SRU A;  4GNX B;  2B29 A;  1QUQ A;  3QG1 A;  1U9R A;  1PH4 A;  4A3L G;  3K59 A;  1HH2 P;  1LAC A;  1STN A;  1S5D D;  4IQZ A;  1W6J A;  2ZM6 Q;  4RA8 A;  4PZ6 A;  3QIA A;  3DM1 A;  2HT1 A;  1B9M A;  3BJU A;  4A3F G;  2EJM A;  1II3 A;  1PFN A;  2Y0S G;  2Q8R E;  5GAG C;  1V1O A;  4X64 L;  1GUG A;  5IGG A;  4ZRZ A;  4AIM A;  2VL6 A;  2SNM A;  4JOI C;  4K6D A;  3EFX D;  4GNX A;  1NMG A;  4MNO A;  3A8J E;  3HOX H;  3K6O A;  1VS0 A;  3VYR A;  4B9X A;  3E0J A;  1EUJ A;  1BCP C;  1E1T A;  2K4K A;  3TZD A;  3UI2 A;  2F03 A;  2JEB I;  4YIJ A;  2PNH A;  5TSS A;  2KCT A;  3AEV A;  4LAA A;  2RQX A;  3TN2 A;  3TBI B;  2JA8 H;  4UP7 A;  4YHH Q;  2K5N A;  3HOX G;  5LMN W;  4CDF C;  1K28 A;  1PLF A;  2NB0 A;  2WKC A;  2QDL A;  2K03 A;  4JI1 Q;  1PFS A;  5FJ8 H;  3GTQ H;  3OW7 A;  4O42 A;  4GLX A;  3ER0 A;  1EY8 A;  1G6Z A;  3M4P A;  1CK1 A;  3MA2 B;  1VQN A;  5I6W A;  1V1Q A;  3AU7 A;  4DNR B;  3KBG A;  1BDO A;  1I94 L;  2JA8 G;  4G7H C;  1TWG H;  1A6X A;  3W1B A;  1TWH H;  1VQP A;  2RCN A;  4NPS A;  2XGT A;  3EBE A;  5FJ8 G;  2O4X A;  5G3L D;  3UDI A;  4IUN A;  3I7F A;  2F0E A;  5E4X A;  3D4R A;  1HR0 L;  2JE6 I;  2B2U A;  3OTO L;  3CCS A;  1GJX A;  1Y1W B;  4LUV A;  2QGQ A;  3ND9 A;  4JI4 Q;  1STB A;  2A74 C;  1PH8 A;  2FIN B;  1EQV A;  3SE0 A;  1H95 A;  1C4Q A;  4JW0 A;  2R92 G;  1KQS A;  4LFB L;  2KEE A;  2B2V A;  3D4D A;  5ELO A;  5ISR A;  4L5R C;  3NHH A;  3LWU A;  3SK4 A;  4DV4 Q;  4RWS C;  1WCM B;  4LF5 L;  4DR7 L;  2C35 B;  1X3G A;  1Z6H A;  1SYG A;  2RHQ B;  4EVO A;  1SJE D;  1STA A;  3BYY B;  1PH7 A;  3HKZ E;  2E74 C;  4PQX A;  3KLR A;  4IOA A;  2YU9 B;  1H9J A;  3Q8D A;  4WJ3 M;  2F0I A;  3CHB D;  4PNY A;  2XRQ D;  4A93 B;  1CUK A;  3F2U A;  1AFP A;  1AE3 A;  2RHS B;  2E2I B;  3AMU A;  3MHB A;  5FOB B;  4TQU S;  2MP1 A;  1KAW A;  2X69 A;  3PUY A;  4GKJ Q;  1L0Y B;  1U5K A;  3EIV A;  2AMC B;  2QEX A;  4C2M H;  2Q8T A;  3DMU A;  4RGO S;  1VQ7 A;  1PYB A;  3HOW H;  4MZ9 A;  1A63 A;  1K73 C;  1I3Q H;  1K0S A;  1UAP A;  1X3E A;  3MFY A;  1XJV A;  1RKN A;  4QCL A;  4S3S A;  4R4Q A;  3D31 A;  1VQM A;  2JQO A;  1PRT B;  3M9B A;  4G4K A;  2E2J H;  3HOW G;  3ZJY C;  1KDC A;  4LFA Q;  3RLO A;  2L0C A;  2IY5 B;  1HRJ A;  4X3T A;  3QOJ A;  2CKZ B;  4UAI A;  3TME A;  5HGT A;  1MIU A;  1STG A;  1PRT F;  4DR4 L;  1OXV A;  3CKI B;  1D1K A;  1L1O C;  1XNQ Q;  1OXS C;  1JJC B;  3VA5 A;  4JV5 Q;  5M5X B;  1CQF A;  4KY5 A;  2IJ0 A;  3CD6 A;  2E8G A;  4CJ0 B;  4KLK A;  1FYC A;  1VQG A;  4HAE A;  1N9W A;  3KUP A;  3T56 B;  4FF4 A;  3TEH B;  2MUY A;  5C44 H;  3NSW A;  2IX1 A;  3ZYY X;  3AFQ A;  4LF7 Q;  4AQY Q;  5DM6 3;  1JC7 A;  3PIO 3;  2SDF A;  4BBR B;  3C3L A;  1VQA A;  1EYD A;  2NN6 I;  1JWU D;  2K75 A;  4XXE A;  1JWS D;  1ILP A;  1H9R A;  1KNA A;  1JWM D;  5JPN C;  1TWA B;  4RGM A;  1TY2 A;  4DR6 Q;  2N8N A;  5JVH 3;  4JI2 L;  5C44 G;  1FR3 A;  2AQ1 B;  1FJG Q;  5KNC A;  3FRP B;  2IL8 A;  3GQB A;  4A3D H;  2UU9 L;  3W1G A;  2OCE A;  2TSS A;  4OEM B;  5JVG 3;  1RCV D;  3KF6 B;  2JSO A;  2WV6 D;  5KGU A;  4DR3 Q;  2NVY H;  5KRU A;  1IBL L;  3GTM B;  1I50 H;  3MXP A;  4DV0 Q;  4DUZ Q;  5CV5 A;  4BY7 H;  4TVA B;  3ERO A;  4YWL A;  3P75 A;  4LJZ C;  4A3D G;  2K14 A;  2LMC B;  3RNU A;  1SMY C;  3CCJ A;  2AUJ D;  2I0Q A;  4YY3 L;  2B2Y C;  2EE1 A;  2WB1 G;  2ZTC A;  5C5M A;  1O7L A;  1WTQ A;  3VYS A;  5I2X A;  3PMF A;  2WAQ E;  4BY7 G;  4DAP A;  4HN7 A;  1PRT D;  1UNS A;  2PI2 E;  3M4Y A;  1O78 A;  1DON A;  4LF9 L;  1HUN A;  2XNA C;  5CV9 A;  2WIN B;  1YVC A;  3RR5 A;  3NXW A;  4KKU A;  3G6J B;  3BDL A;  1MHW C;  2MQH A;  3VR2 A;  1YIJ A;  1Z47 A;  1GUO A;  1MSH A;  4OIJ A;  4IFD I;  1QE6 A;  3JAM i;  5C4H A;  4OWX B;  3RD4 A;  2LXJ A;  2JN4 A;  3IAY A;  4C3H B;  4LWC A;  1LTS D;  4UHV A;  3DWP A;  3F8T A;  4H7B A;  3NPP A;  2R7Z B;  4XQQ A;  2F0D A;  1ENF A;  5COY A;  3GTP H;  1QWY A;  1B70 B;  1QCB D;  2K6A A;  4DU9 A;  1F77 A;  5AFW A;  5CV8 A;  3K57 A;  4N9P A;  4KK7 A;  5CV4 A;  3QJY A;  4A3I H;  1DZ1 A;  1SE8 A;  2HUG A;  5IT9 c;  1S3O A;  2IHE A;  4WJW A;  4QJF A;  5D14 A;  1NAP A;  1D7Q A;  4IUV A;  4B3M L;  3RMH A;  5LMU L;  2WP8 J;  1XWE A;  2L12 A;  4DF7 A;  1K8A C;  1RTN A;  3W2D A;  2FMC A;  2HDM A;  3D3R A;  1XTD A;  1STE A;  3NEN A;  4TSS A;  2IX0 A;  3I2Z A;  3WDN A;  1HXY D;  1NSN S;  2Q8I B;  4A3I G;  1LTB D;  1Y1V B;  4HIO A;  3PGZ A;  5CV7 A;  5C3E H;  1F2Y A;  4FXG C;  3J81 c;  3NBI A;  5FK9 C;  3I70 A;  3L0O A;  3J80 L;  2E75 C;  3F1Z A;  2K5D A;  4GOP B;  4DR1 Q;  3M4O B;  1X3P A;  3A5U A;  3I4M B;  2R61 A;  1KIX A;  4DV6 L;  3U4Z A;  4HJ9 A;  1XPO A;  4A3G H;  5C3E G;  4DK6 C;  3VA7 A;  3M3Y B;  1I6H B;  3FVQ A;  4K8J A;  5JEA H;  4LF4 L;  4L8J A;  4JI8 L;  1IW7 D;  2EJF C;  4LF8 Q;  4G7Z C;  4ZK9 B;  3TDQ A;  1BNZ A;  2F0K A;  2KBN A;  1UE1 A;  5F2D A;  4ME3 A;  1EIY B;  3VYT A;  2VW9 A;  4GOP A;  2EOT A;  2MNA A;  4DV5 Q;  4A3G G;  3TS0 A;  4K8I A;  1IYJ B;  3KYH C;  5JEA G;  3O13 A;  3JAM L;  1UWV A;  4AYB E;  4RG1 A;  1LM0 A;  2EQS A;  1EY4 A;  1WTP A;  4ID6 A;  5M3F H;  3FMC A;  4A3F B;  3ULP A;  3J7Z C;  4HMI A;  2Y0S B;  3UE1 A;  1I4R A;  3K5N A;  1BO0 A;  2CQO A;  4X64 Q;  2CW0 C;  1VCI A;  3NWT A;  2A1A A;  2K5W A;  4OON A;  2L15 A;  1AEX A;  3X3N A;  3CCL A;  1ZYR D;  5M3F G;  2QKI C;  2F4V L;  4MHE A;  2XVS A;  3EN2 A;  1TY0 A;  3OIP A;  2A6H D;  4KN7 C;  1N36 L;  1R4Q B;  2OF1 A;  2JA6 B;  3S2D H;  3STB C;  3N6R A;  3HOX B;  4R8I A;  1TVX A;  1CZG A;  5JEA J;  5D3I B;  4DV1 L;  2F0V A;  1I4P A;  4LMQ D;  4JK1 C;  3K81 C;  4IN3 A;  2KED A;  5C4X B;  1EFW A;  3K8A A;  3I4O A;  3U4V A;  3OW2 A;  3QOL A;  1QG7 A;  4DV2 L;  1IBK L;  1SN8 A;  2JA8 B;  3MXG A;  3WOF A;  2H1E A;  1CM9 A;  4XYO A;  2YTX A;  3NTI A;  2BE5 C;  2TMP A;  2VY3 A;  2XWJ B;  3QWN A;  1SND A;  1E3P A;  5COR A;  3GTQ B;  1IXR A;  1QIL A;  3I4L A;  3QR8 A;  1CHP D;  2L1B A;  3VR4 A;  1PDQ A;  1KL9 A;  1EY0 A;  3HRZ C;  4PZ7 A;  2V1C C;  2Z8L A;  4X3U A;  4V19 0;  1HR0 Q;  3SK5 A;  1V1P B;  3OTO Q;  1TWG B;  1Q81 C;  4QB4 A;  4C1N I;  3CF5 A;  1TWH B;  1JMC A;  1J9O A;  4HIK A;  1PZK D;  2R93 H;  1SYE A;  1VF7 A;  1ZKO A;  1NY4 A;  3HKZ G;  1LV9 A;  4FP5 D;  4LFB Q;  3I90 A;  1B50 A;  3H15 A;  4LNQ A;  2PQE A;  2BA0 A;  4KHP L;  4UP8 A;  5M5W H;  2R6G A;  3J7A F;  3OSO A;  1B44 D;  2HIX A;  3E6Z X;  3F2C A;  3GV6 A;  4LF5 Q;  1V1P A;  2R93 G;  4ZLT F;  5IE8 A;  3E5S A;  4KHV A;  2B2W A;  4DKA C;  1WVL A;  3TRZ A;  3P1H A;  2K7V A;  3J80 E;  2UXC L;  2YTV A;  1W6K A;  4U68 A;  4C56 C;  1ESR A;  2NBF A;  5IYC H;  2VUM B;  2GA4 B;  2JA7 B;  5HUR A;  5T1G A;  3ONA B;  5IYB H;  3M85 A;  3TP6 A;  4POF A;  1R9T H;  3SK6 A;  3PUW A;  4APV A;  1Z7T A;  4HR7 B;  1LTG D;  1YHA A;  3R3O A;  3Q0A A;  1BQQ T;  1F9Q A;  4OEL B;  1E1O A;  3RZO H;  1QZG A;  1OTC A;  1PTO D;  3KLS A;  1ROD A;  5IYC G;  2JYO A;  3B6Y A;  3PIP 3;  1FNU A;  4X66 Q;  4FF2 A;  1FVI A;  4L6T B;  1PH9 A;  1Y8P B;  3A74 A;  4KY6 A;  5IYB G;  3E0E A;  2NVQ H;  3E9H A;  1E7Z A;  1F9S A;  2B2T A;  1N33 L;  1PYW D;  5GQO A;  1GD7 A;  4M8A A;  3NP8 A;  4ULL A;  1VQK A;  4JYA Q;  3TZU A;  4QIW B;  2YTY A;  1UEB A;  4C2M B;  2Z9H A;  1D2B A;  4RHR A;  2KUM A;  4FF1 A;  4JC0 A;  1NR4 A;  3HOW B;  5D3D A;  1I3Q B;  1GHK A;  2OXP A;  2IPK D;  2BCO A;  3GTK H;  4DR4 Q;  3BVZ A;  5IWA Q;  4KHZ A;  1C9O A;  4PG3 A;  1Q1B A;  1SMX A;  3UDG A;  2Q2I A;  2E2J B;  1BVS A;  5A2Q L;  3T16 A;  3T1Y L;  2MO0 A;  3ICE A;  4DV3 L;  1T5E A;  5JJL A;  3CC2 A;  1Q90 A;  4HJA A;  5IYD H;  3W5O A;  4DR2 Q;  3S17 H;  4RCO A;  1KLG D;  2NYZ D;  2K52 A;  4CBV A;  3SGI A;  1SE2 A;  1VQB A;  2KCM A;  4F88 A;  1Y69 U;  1BKB A;  2XRS D;  3EA6 A;  4DR5 L;  2A68 C;  2AQ2 B;  4Y7N H;  4F87 A;  5IYD G;  1QVG A;  2B2W C;  3KJO A;  3A8K E;  2LKV A;  1VF5 C;  1PA6 A;  1ONL A;  2N88 A;  1GVP A;  1VQL A;  1RJT A;  4JI2 Q;  4NW2 A;  5C44 B;  1JOQ A;  2GVA A;  4C1N K;  2D5D A;  3CU7 A;  1I4Q A;  3F2D A;  2E5L L;  3TS2 A;  3S2H H;  1DGS A;  3K5O A;  3VR3 A;  2CCZ A;  1GUS A;  4OGQ C;  1HQR D;  1XPR A;  3MAQ A;  1XMO Q;  1GUT A;  5LL6 X;  1IBL Q;  2F0T A;  3KLW A;  4XTC S;  2WAQ G;  3CCE A;  4JI7 L;  2A73 B;  4YCU A;  3PO3 H;  3V2T A;  1E24 A;  4A3D B;  1N34 L;  3BYT B;  4H44 C;  1ML0 D;  1IKM A;  2DY8 A;  4F8M A;  4JI3 L;  3SEB A;  2NVY B;  1LT5 D;  4WOR A;  4YY3 Q;  5K5P A;  1I50 B;  5C4J H;  4JI5 Q;  2PO4 A;  1FNV A;  1U4M A;  1B1Z A;  2EYM A;  4EX5 A;  4BY7 B;  3C1E A;  1G91 A;  5IGF A;  4YWM A;  3PO3 G;  1K83 H;  3NEM A;  1XMQ Q;  2B8F A;  4LFC L;  4A3E H;  4DUY L;  3Q6S A;  4DK0 A;  3GTO H;  1JIC A;  5EKL A;  2I07 B;  3G48 A;  3NTH A;  4LF9 Q;  4NXM L;  1ENC A;  3MTS A;  2NZ1 D;  4L5T A;  1YNX A;  1LTI D;  5EGT A;  3H0G H;  4O2D A;  3X3M A;  2Z6K C;  3V96 A;  2R92 H;  3J7Y W;  4MTN A;  2L9H A;  1VQE A;  4AH6 A;  4A3E G;  1IL2 A;  1HFN A;  3A5Z B;  2PPB C;  2EYP A;  5BN4 A;  1Q1E A;  1WI5 A;  1E2V A;  2CQA A;  4DGZ A;  1SFO H;  3A54 A;  2Z0S A;  3H0G G;  2K5V A;  1HZB A;  1PFB A;  4K6L A;  3S1M H;  1HPC A;  5EAY A;  4NXN Q;  2B63 H;  3PUX A;  4DV7 L;  3D0F A;  2EY2 A;  1SSO A;  1WOC A;  3GTP B;  4PV1 C;  5J1Z A;  1JJG A;  5K36 H;  2K33 A;  4ME5 A;  3CRL C;  1WD1 A;  4DAY B;  3HOU H;  1LTL A;  2CHB D;  4WFN 3;  1UE5 A;  3S14 H;  2H5X A;  4A3I B;  2NZH A;  2F0G A;  4RGN A;  4HID A;  3DEP A;  3UDF A;  3PCO B;  2B3G A;  1EWH A;  1YNJ D;  1EEF D;  2VQF L;  2B63 G;  1JR0 D;  4P73 A;  2UUC L;  4IZ8 A;  5I9O A;  5I4D A;  1CZW A;  5A2Q E;  3AYH B;  5K36 G;  1MBY A;  1BBU A;  4GNX C;  3HOU G;  4JVZ A;  1EIH A;  1SXT A;  2F0Q A;  1SR3 A;  4DAY A;  1FL0 A;  4IUQ A;  4L63 B;  4DNT B;  5ELN A;  1UEA B;  4I65 A;  5C3E B;  2FJ2 A;  1K8O A;  2XSC A;  1YBY A;  2RDF A;  2XTI A;  4AYB G;  4LF4 Q;  2CH4 W;  2VB2 X;  1V9P A;  1XNR Q;  2J4X A;  1SNQ A;  1OXU A;  1ZXT A;  4C3J G;  1LTA D;  3NEL A;  3I55 A;  4NKL A;  1KLU D;  4A3G B;  2QCP X;  4J1M A;  4U67 3;  1HTL D;  3MVV A;  1CA6 A;  5JJZ A;  1S5E D;  1VQH A;  3JC6 6;  3QB3 A;  4KKS A;  1F2L A;  3I8Z A;  4X62 L;  1HNZ L;  2Z1C A;  2IX3 A;  2RSN A;  3SDZ A;  1OXX K;  3DLL A;  2E2H H;  1Q7Y C;  4ALP A;  5FLX c;  2PZU A;  3I91 A;  1AE2 A;  2BOS A;  1KXL A;  4GKK Q;  4KD4 A;  2UXD L;  5GAE C;  1NE3 A;  2LXK A;  2G9D A;  4N9T A;  1A2T A;  1D5Z C;  4RMF A;  5M3F B;  2B2U C;  4ABN A;  2HHH Q;  2I5H A;  1WTR A;  5IP9 H;  2VQE L;  4G7O C;  1TS4 A;  2HIV A;  5A35 A;  4IAL A;  5IGD A;  4R1J A;  2OWO A;  2B2V C;  3MZ5 A;  2PZW A;  3LGJ A;  3HOV B;  3Q23 A;  4IO9 A;  4RHS A;  4DV1 Q;  1EU4 A;  4O0A A;  4LF6 Q;  4IUP A;  1U4P A;  5IP9 G;  2FFK B;  1PMR A;  3BU2 A;  1PH2 A;  2I5L X;  4K14 A;  5LMN L;  3S15 H;  4MN3 A;  3GTL H;  3PUZ A;  2DN8 A;  1VQC A;  3LNN A;  3R2I A;  3J7A 5;  1IBK Q;  4XIG S;  4CHT B;  5DM7 3;  3S2D B;  5I2Y A;  1KHI A;  1X3Q A;  1KRT A;  2RCF A;  1B3Q A; 
#chains in the Genus database with same CATH homology
 1MSG A;  3FEW X;  1TS2 A;  2F0P A;  2L4N A;  1D5M C;  1SYB A;  4OO1 H;  4KN4 C;  4M1U B;  4XT3 B;  3H09 A;  1EY7 A;  1O80 A;  3HEJ A;  2HDL A;  2WAC A;  3S16 B;  4K2L A;  4TRD A;  3L3O C;  2R93 B;  1AZP A;  4OO1 G;  1DXM A;  3SR1 A;  5LL6 S;  5KIX A;  2E2D C;  5M5W B;  1ZEQ X;  1FD7 D;  5J22 A;  3A55 A;  3NE5 B;  1DCZ A;  4PMB A;  5JOB A;  3DHQ A;  1A3T A;  5FKA C;  1PRT C;  4BWG B;  2SOB A;  4H13 C;  3EJI A;  1WD0 A;  2MPM A;  4KV6 A;  1V8Q A;  1SNM A;  5BN5 A;  1R9T B;  3GO5 A;  3KLS X;  2KQ3 A;  3R2T A;  1NCV A;  3RZO B;  3GV3 A;  3VYU A;  4K2K A;  4QUC A;  1LT4 D;  4RKL A;  4RGT A;  2NVQ B;  1G2S A;  4HTH A;  1EY9 A;  1BOS A;  1AP0 A;  3DEO A;  4RFB A;  2BDO A;  1L0X B;  1RHP A;  2PZT A;  2PNR C;  5IT9 L;  2IWH A;  5EBC A;  4ZKC B;  3NQT A;  1UUP A;  2OT2 A;  2DNE A;  2B39 A;  3EQL C;  5FO7 B;  3NWS A;  4FNF A;  1B4O A;  3GTK B;  1BF4 A;  4R9W A;  5IOD A;  2Z4H A;  5KYL A;  4ODG A;  1DOM A;  1DD2 A;  3J81 L;  2F0H A;  4C3I G;  3HP3 A;  3AB9 A;  3OOC A;  5C0X H;  3S17 B;  1IW7 C;  2ICE C;  2M00 A;  1ICW A;  5DEH A;  3BVM A;  2R3Z A;  4FXK C;  2RSO A;  2SNS A;  1EL0 A;  5C3W A;  1QNK A;  4Y7N B;  4CJ1 B;  1BUV T;  5C0X G;  3OHX C;  2C5C A;  1SYF A;  4Z9C B;  2WAQ B;  1ESF A;  1OO9 B;  1TQO A;  3S2H B;  4EQP A;  1CQV A;  3SVM A;  4KMU C;  2VNU D;  1TS3 A;  3I73 A;  3SXH A;  4F7X A;  2K01 A;  4OHJ A;  1ZYR C;  1AZQ A;  2XN9 C;  3PO3 B;  1TU2 B;  1YNN D;  2ZXO A;  3IFD A;  4BS9 A;  4MIU A;  1LT3 D;  2A6H C;  1HTP A;  2D9U A;  2PYK A;  3NUC A;  1GOZ A;  4IUT A;  3MWY W;  5C0X J;  5C4J B;  4H0L C;  1IYV A;  1EQT A;  2D62 A;  3IL8 A;  4KTA A;  3T4A C;  1K83 B;  3G7L A;  5BN3 A;  2F0F A;  4A3E B;  3U9O A;  3LWE A;  3GTO B;  1SAP A;  4KD3 A;  2EXZ A;  2RDG A;  2LS0 1;  1F2Z A;  3BG3 A;  4LK1 C;  2KA7 A;  4DXF A;  1QJO A;  3H0G B;  1D5X C;  3HGB A;  2NTS A;  2R92 B;  5ELC A;  5IIF A;  3C2P A;  4ZKB B;  2K1B A;  2RKS A;  4J8Q A;  1ET9 A;  3MXU A;  4WRD A;  1SFO B;  4R8N A;  4DN4 M;  1JOK A;  2KJX A;  3S1M B;  5FO9 B;  3OMC A;  1V43 A;  2O5I C;  1ILQ A;  2A69 D;  2HCI A;  5IT9 E;  4P2C B;  4GZY C;  3HOU B;  1PFM A;  5CBE E;  3S14 B;  1F9P A;  5EPJ A;  3H6M A;  1RD9 D;  2RBM A;  4AYB B;  1BCP B;  2AUK A;  2EYO A;  3J81 E;  2A6E D;  1IKL A;  1BXT A;  3DWQ A;  1SEB D;  2DNC A;  1JCK B;  1M8A A;  1Q8I A;  1BCP F;  2L11 A;  3L7Z C;  3OMG A;  3NBH A;  1EZ8 A;  2ICI A;  2FHT A;  4RCN A;  1I4H A;  3K5L A;  1PTO C;  1PXU A;  1FGB D;  5JAV A;  3C46 A;  1PZJ D;  3H91 A;  3BDO A;  4KJN A;  1CFM A;  1M4V A;  2HCC A;  2QEJ C;  4FO2 A;  2E2H B;  4DFA A;  3DWA A;  1Y8N B;  1JOO A;  1O7Z A;  4V0B A;  2K5Q A;  1STH A;  1LTT D;  3Q24 A;  1TS5 A;  3U9S A;  5KNB A;  3WOE A;  1SNC A;  4FYD A;  5DAU A;  1EZ6 A;  1ENA A;  4ZUJ A;  5G3L F;  2F0N A;  2PW5 A;  3IKJ A;  4KJO A;  3H3V C;  3OIQ A;  2M2L A;  3ERQ A;  4RAU C;  1TII D;  1R4P B;  3VR5 A;  4EQO A;  3J7A V;  4NDX A;  1XYI A;  1O7Y A;  1RDP D;  3S15 B;  3HZX A;  3Q22 A;  3GTL B;  1EYA A;  4K5V A;  2F1M A;  4FXD A;  4ZUI A;  1I6V C;  2X6G A;  1CT1 D;  1E2Z A;  1VDZ A;  3TP5 A;  1IYU A;  1LT6 D;  1BCP D;  4RH6 A;  2H4O A;  1PTO H;  3K5M A;  2EYJ A;  1SDF A;  2K05 A;  2WB1 B;  2OEO A;  2B2T C;  1G8Z D;  2MHV A;  2O2L D;  1HHV A;  2KEC A;  4NMZ A;  3I72 A;  2V4D A;  2EY6 A;  5KYI A;  1VMP A;  1BBX C;  1OXT A;  2XWB B;  1B9N A;  3C1F A;  4CKC A;  3DXJ C;  4E6I A;  3RLF A;  1QOH A;  3K0Y A;  2EY1 A;  4K5X A;  3NQI A;  1A3U A;  2F0S A;  2ID0 A;  1MI2 A;  2NWG A;  5CMD A;  1TR5 A;  3D8G A;  1G2T A;  5C5L A;  5IGB A;  3R8B A;  2C9O A;  5CV6 A;  4DK1 A;  3PUV A;  2J0T D;  2K28 A;  2E76 C;  2J7Z A;  3OPO A;  3HOY B;  2MJ8 A;  4DA2 A;  1RTO A;  5EJW A;  3QO2 A;  1HUM A;  1A15 A;  1XX8 A;  3GP7 A;  4DXG A;  1WTV A;  4HSV A;  1E2W A;  3SHL A;  4OO1 I;  4JBW A;  3MEH A;  3S1N B;  3TSS A;  1YNJ C;  4FVM A;  3BZD B;  1IL8 A;  1DYQ A;  2VXW A;  5CYU A;  5DNF A;  1LTR D;  2F0L A;  1U4R A;  4HCE A;  3IFT A;  4C3I B;  5M3M B;  2M9V A;  5EBD A;  3S1R B;  1DM0 B;  3OWF A;  4UDU C;  3KF8 A;  1EYC A;  3OWE B;  1JB3 A;  2IT1 A;  4ZAI A;  2AQ3 B;  5ELE A;  5E4W C;  4G57 A;  1NUC A;  2JEA I;  5M9O A;  3RUZ A;  1CI3 M;  3D6W A;  2EZV A;  3HG9 A;  2LY7 A;  2B2Y A;  5KND A;  2F0O A;  4J6H A;  1EWC A;  3VR6 A;  5EQ0 A;  2KOL A;  1S5B D;  1LLR D;  2ZXP A;  5I6Y A;  3A7L A;  1CHQ D;  2DY7 A;  1S4Z A;  5FLX L;  5CBA E;  1KDA A;  1KNE A;  2LFN A;  2F3W A;  2IW3 A;  1QNU A;  3KK7 A;  2FMM A;  2VB3 X;  4HCS A;  3P7J A;  2ZT9 C;  1HFG A;  3I3C A;  1TWC B;  5ELF A;  3R93 A;  2QDB A;  2AWO A;  5EKI A;  3DUZ A;  1HA5 A;  5D65 A;  5IGC A;  1STY A;  4K5W A;  1FNW A;  1S5F D;  1H9M A;  4IUU A;  2N55 A;  1MGS A;  1GUN A;  1BR9 A;  3TP8 A;  3HKZ B;  2ENB A;  4XQN A;  4CGY B;  4ZYS A;  5LHY 1;  5IOC A;  3A56 A;  1TT2 A;  1C48 A;  2JXM B;  5C0X I;  1WTW A;  1SMY D;  3V05 A;  1D1I A;  1F9R A;  1EU3 A;  2L55 A;  3N52 A;  4Q5V A;  2ZXR A;  2JP1 A;  2RA4 A;  3SK8 A;  5CC4 A;  3EVQ A;  3GTJ B;  1MD2 D;  4QUF A;  3ITP A;  4XQJ A;  2NTT A;  2B8G A;  2NVX B;  2L5T A;  4B08 A;  3HOZ B;  1QB5 D;  3D4W A;  4QMG A;  1GHJ A;  1SE3 A;  4OIK A;  4Q0F A;  4X3K A;  3M7N A;  1RF2 D;  1SNO A;  4PMW A;  1JE4 A;  4A3J B;  4FF3 A;  1U4L A;  2MGS A;  4B9W A;  1D6E C;  5JPM C;  1JQY D;  4RKB A;  2QF7 A;  1HA6 A;  5C4Z A;  4I7Z C;  1DJR D;  3FKI B;  5C3X A;  1JOR A;  2I46 A;  5ELD A;  1HCZ A;  1A3V A;  1XTC D;  4CKB A;  1B2T A;  4HMJ A;  2RDH A;  1XXG A;  2NVT B;  1Y8O B;  2EYL A;  2NN6 H;  5FLX E;  5C6A A;  4NP5 A;  1Q12 A;  5M5Y B;  4PMC A;  1LAB A;  3MC0 B;  1TWF B;  2JA5 B;  2QIL A;  2Z4I A;  3LX0 A;  3FDT A;  2EDG A;  1EEI D;  2KCN A;  3CQZ B;  2NN6 G;  1H9S B;  1DOL A;  3FPP A;  4HED A;  1E0B A;  1I4G A;  4XT1 B;  3FPU B;  4CKE A;  2XIW A;  2CW0 D;  3T13 A;  4A3B B;  4BA2 I;  1H9S A;  2F3V A;  3H94 A;  1KDB A;  2WKD A;  1EY6 A;  2PCF B;  2YYZ A;  4BBS B;  1SYC A;  4O1N A;  2RVL A;  4EGV A;  3GD7 A;  4XDX A;  3W3A A;  1EY5 A;  1B53 A;  3A7A B;  1G29 1;  1KTK A;  3T51 B;  1T5X D;  3ND8 A;  4IFD H;  1SJH D;  1H9K A;  1SBB B;  3MXN A;  5EPK A;  1PTO B;  3GTG B;  2K32 A;  4KKT A;  1CA5 A;  1KAA A;  1VMC A;  1PTO F;  2BE5 D;  1YNN C;  3K7A B;  4IFD G;  1Q3L A;  3CRK C;  1DOK A;  3BDC A;  4DAV A;  1AW7 A;  5CR3 A;  2EPB A;  5T1I A;  4XYQ A;  2F0M A;  4IUR A;  2KHS A;  4X3S A;  3RZD B;  1NR2 A;  5NUC A;  5IGE A;  1SNP A;  1GXD C;  2WII B;  4ILW A;  1I4X A;  5I9P A;  1EFI D;  3TP7 A;  4TKO B;  1C8C A;  3BS1 A;  2B63 B;  1X32 A;  4BA1 I;  1K8M A;  4IFD J;  4A3K B;  3M7G A;  1SE4 A;  1ET6 A;  5E3F A;  2X6L A;  1B3A A;  5KEE A;  5J39 A;  2EJG C;  4KY7 A;  2KCC A;  1F2M A;  4KI0 A;  5EPL A;  2EYF A;  2AWN A;  2A69 C;  4EQN A;  3MFG A;  3T53 B;  3URY A;  1EOT A;  3D6C A;  3NK9 A;  4C3J B;  2PW7 A;  1GUW A;  2EY5 A;  2F0U A;  4BY1 B;  2F4I A;  1A2U A;  1CTM A;  2D2C C;  1SYD A;  2NUC A;  2SEB D;  4C3H G;  1WTO A;  2A6E C;  2KVM A;  2PMZ B;  1EIG A;  5CGK A;  3K58 A;  3PV0 A;  4ZQ3 A;  2G9H D;  3KBX A;  3JAM E;  4QF4 A;  2BDN A;  3P20 A;  1WTX A;  1S5C D;  2F0J A;  5E1F A;  2BA1 A;  2EYH A;  4A3M B;  1IHZ A;  3PO2 B;  2K04 A;  2CVR A;  1LO5 D;  3A8I E;  1AN8 A;  2EVB A;  4CJ2 C;  5FO8 B;  4OL7 A;  5EKK A;  1KAB A;  3S1Q B;  2A5H A;  2O5J C;  1HQM C;  1PZI D;  2A68 D;  2F0W A;  1TKW B;  3HS0 C;  3S9W A;  5ELB A;  2HQE A;  3BVG A;  1J8I A;  4HSP A;  3L9A X;  3I4N B;  3NTK A;  3QG1 A;  1U9R A;  3K59 A;  1LAC A;  1STN A;  1S5D D;  4IQZ A;  1W6J A;  4RA8 A;  3QIA A;  3DM1 A;  1B9M A;  2EJM A;  1II3 A;  1PFN A;  2Q8R E;  1V1O A;  1GUG A;  5IGG A;  4ZRZ A;  2SNM A;  4K6D A;  3EFX D;  3A8J E;  3K6O A;  3VYR A;  4B9X A;  3E0J A;  1BCP C;  3TZD A;  3UI2 A;  2F03 A;  2JEB I;  4YIJ A;  5TSS A;  4LAA A;  2RQX A;  3TN2 A;  3TBI B;  1PLF A;  2NB0 A;  2WKC A;  2K03 A;  3OW7 A;  4O42 A;  1EY8 A;  1G6Z A;  1CK1 A;  3MA2 B;  5I6W A;  3AU7 A;  4DNR B;  3KBG A;  1BDO A;  4G7H C;  1A6X A;  2O4X A;  5G3L D;  4IUN A;  2F0E A;  5E4X A;  3D4R A;  2JE6 I;  2B2U A;  1GJX A;  1Y1W B;  3ND9 A;  1STB A;  2A74 C;  2FIN B;  1EQV A;  3SE0 A;  1C4Q A;  2KEE A;  2B2V A;  3D4D A;  5ISR A;  3NHH A;  3LWU A;  3SK4 A;  4RWS C;  1WCM B;  1Z6H A;  1SYG A;  4EVO A;  1SJE D;  1STA A;  3BYY B;  2E74 C;  4PQX A;  3KLR A;  2YU9 B;  1H9J A;  2F0I A;  3CHB D;  4PNY A;  2XRQ D;  4A93 B;  3F2U A;  1AFP A;  2E2I B;  3AMU A;  3MHB A;  5FOB B;  4TQU S;  2MP1 A;  2X69 A;  3PUY A;  1L0Y B;  2Q8T A;  3DMU A;  4RGO S;  1UAP A;  3MFY A;  1RKN A;  4QCL A;  4S3S A;  3D31 A;  1PRT B;  4G4K A;  1KDC A;  2L0C A;  1HRJ A;  4X3T A;  3QOJ A;  4UAI A;  3TME A;  5HGT A;  1STG A;  1PRT F;  1OXV A;  3CKI B;  1D1K A;  1OXS C;  3VA5 A;  5M5X B;  1CQF A;  4KY5 A;  2IJ0 A;  4CJ0 B;  1FYC A;  4HAE A;  3KUP A;  3T56 B;  4FF4 A;  2MUY A;  3NSW A;  2IX1 A;  3ZYY X;  5DM6 3;  1JC7 A;  3PIO 3;  2SDF A;  4BBR B;  3C3L A;  1EYD A;  2NN6 I;  1JWU D;  4XXE A;  1JWS D;  1ILP A;  1H9R A;  1KNA A;  1JWM D;  5JPN C;  1TWA B;  4RGM A;  1TY2 A;  5JVH 3;  1FR3 A;  2AQ1 B;  5KNC A;  3FRP B;  2IL8 A;  3GQB A;  2TSS A;  5JVG 3;  1RCV D;  2JSO A;  2WV6 D;  5KGU A;  5KRU A;  3GTM B;  3MXP A;  5CV5 A;  3ERO A;  3P75 A;  4LJZ C;  2LMC B;  1SMY C;  2AUJ D;  2B2Y C;  2EE1 A;  5C5M A;  1O7L A;  1WTQ A;  3VYS A;  5I2X A;  3PMF A;  4DAP A;  4HN7 A;  1PRT D;  1UNS A;  3M4Y A;  1O78 A;  1DON A;  1HUN A;  2XNA C;  5CV9 A;  2WIN B;  3NXW A;  4KKU A;  3G6J B;  3BDL A;  3VR2 A;  1Z47 A;  1GUO A;  1MSH A;  4OIJ A;  4IFD I;  1QE6 A;  5C4H A;  3RD4 A;  3IAY A;  4C3H B;  1LTS D;  3DWP A;  4H7B A;  3NPP A;  2R7Z B;  4XQQ A;  2F0D A;  1ENF A;  5COY A;  1QWY A;  1QCB D;  2K6A A;  4DU9 A;  1F77 A;  5CV8 A;  5AFW A;  3K57 A;  4N9P A;  4KK7 A;  5CV4 A;  3QJY A;  1DZ1 A;  2HUG A;  4WJW A;  5D14 A;  1NAP A;  4IUV A;  3RMH A;  2WP8 J;  1XWE A;  2L12 A;  4DF7 A;  1RTN A;  3W2D A;  2FMC A;  2HDM A;  3D3R A;  1STE A;  4TSS A;  2IX0 A;  3WDN A;  1HXY D;  1NSN S;  2Q8I B;  1LTB D;  1Y1V B;  5CV7 A;  1F2Y A;  4FXG C;  3NBI A;  5FK9 C;  3I70 A;  3J80 L;  2E75 C;  2K5D A;  3M4O B;  1X3P A;  3I4M B;  2R61 A;  3VA7 A;  3M3Y B;  1I6H B;  3FVQ A;  4K8J A;  5JEA H;  4L8J A;  1IW7 D;  2EJF C;  4G7Z C;  4ZK9 B;  3TDQ A;  1BNZ A;  2F0K A;  5F2D A;  3VYT A;  2EOT A;  4K8I A;  5JEA G;  3O13 A;  3JAM L;  1EY4 A;  1WTP A;  4ID6 A;  3FMC A;  4A3F B;  4HMI A;  2Y0S B;  1I4R A;  3K5N A;  1BO0 A;  2CW0 C;  1VCI A;  3NWT A;  2K5W A;  1AEX A;  3X3N A;  1ZYR D;  2QKI C;  4MHE A;  2XVS A;  1TY0 A;  3OIP A;  2A6H D;  4KN7 C;  1R4Q B;  2OF1 A;  2JA6 B;  3N6R A;  3HOX B;  4R8I A;  1TVX A;  1CZG A;  5JEA J;  5D3I B;  2F0V A;  1I4P A;  4LMQ D;  4JK1 C;  4IN3 A;  2KED A;  5C4X B;  3QOL A;  1QG7 A;  2JA8 B;  3MXG A;  3WOF A;  2H1E A;  1CM9 A;  4XYO A;  3NTI A;  2BE5 C;  2TMP A;  2XWJ B;  3QWN A;  1SND A;  5COR A;  3GTQ B;  1QIL A;  3I4L A;  1CHP D;  2L1B A;  3VR4 A;  1PDQ A;  4X3U A;  1EY0 A;  3HRZ C;  4V19 0;  2Z8L A;  3SK5 A;  1V1P B;  1TWG B;  4QB4 A;  4C1N I;  1TWH B;  1J9O A;  1PZK D;  1SYE A;  1VF7 A;  1ZKO A;  1LV9 A;  4FP5 D;  3I90 A;  1B50 A;  2PQE A;  2BA0 A;  2R6G A;  3J7A F;  3OSO A;  1B44 D;  3E6Z X;  3GV6 A;  1V1P A;  4ZLT F;  3E5S A;  4KHV A;  2B2W A;  1WVL A;  3P1H A;  2K7V A;  3J80 E;  1W6K A;  4U68 A;  4C56 C;  1ESR A;  2NBF A;  2VUM B;  2GA4 B;  2JA7 B;  5HUR A;  5T1G A;  3ONA B;  3M85 A;  3TP6 A;  3SK6 A;  3PUW A;  1Z7T A;  4HR7 B;  1LTG D;  3R3O A;  3Q0A A;  1BQQ T;  1F9Q A;  1PTO D;  3KLS A;  1ROD A;  2JYO A;  3PIP 3;  1FNU A;  4FF2 A;  4L6T B;  1Y8P B;  4KY6 A;  1F9S A;  2B2T A;  1PYW D;  4M8A A;  3NP8 A;  4ULL A;  3TZU A;  4QIW B;  4C2M B;  1D2B A;  4RHR A;  2KUM A;  4FF1 A;  1NR4 A;  3HOW B;  5D3D A;  1I3Q B;  1GHK A;  2OXP A;  2IPK D;  2BCO A;  3BVZ A;  4KHZ A;  1Q1B A;  2E2J B;  5A2Q L;  3T16 A;  1T5E A;  1Q90 A;  4RCO A;  1KLG D;  2NYZ D;  4CBV A;  1SE2 A;  4F88 A;  1Y69 U;  2XRS D;  3EA6 A;  2A68 C;  2AQ2 B;  4F87 A;  2B2W C;  3A8K E;  2LKV A;  1VF5 C;  1ONL A;  2N88 A;  1RJT A;  4NW2 A;  5C44 B;  1JOQ A;  4C1N K;  2D5D A;  3CU7 A;  1I4Q A;  3K5O A;  3VR3 A;  1GUS A;  4OGQ C;  1HQR D;  3MAQ A;  1GUT A;  5LL6 X;  2F0T A;  4XTC S;  2A73 B;  3V2T A;  4A3D B;  3BYT B;  4H44 C;  1ML0 D;  1IKM A;  2DY8 A;  4F8M A;  3SEB A;  2NVY B;  1LT5 D;  4WOR A;  5K5P A;  1I50 B;  2PO4 A;  1FNV A;  1U4M A;  1B1Z A;  2EYM A;  4BY7 B;  3C1E A;  1G91 A;  5IGF A;  2B8F A;  3Q6S A;  4DK0 A;  1JIC A;  5EKL A;  2I07 B;  3NTH A;  1ENC A;  3MTS A;  2NZ1 D;  1LTI D;  5EGT A;  3X3M A;  3V96 A;  3J7Y W;  2L9H A;  1HFN A;  2PPB C;  2EYP A;  5BN4 A;  1Q1E A;  1E2V A;  2CQA A;  4DGZ A;  3A54 A;  1PFB A;  4K6L A;  1HPC A;  3PUX A;  2EY2 A;  1SSO A;  3GTP B;  4PV1 C;  5J1Z A;  5K36 H;  2K33 A;  4ME5 A;  3CRL C;  1WD1 A;  2CHB D;  4WFN 3;  4A3I B;  2F0G A;  4RGN A;  3DEP A;  1EWH A;  1YNJ D;  1EEF D;  1JR0 D;  4IZ8 A;  5I9O A;  5I4D A;  1CZW A;  5A2Q E;  5K36 G;  1MBY A;  1EIH A;  1SXT A;  2F0Q A;  4DAY A;  4IUQ A;  4L63 B;  4DNT B;  1UEA B;  4I65 A;  5C3E B;  2FJ2 A;  1K8O A;  2XSC A;  2RDF A;  2VB2 X;  2J4X A;  1SNQ A;  1OXU A;  1ZXT A;  4C3J G;  1LTA D;  4NKL A;  1KLU D;  4A3G B;  2QCP X;  4J1M A;  4U67 3;  1HTL D;  3MVV A;  1CA6 A;  5JJZ A;  1S5E D;  3QB3 A;  4KKS A;  1F2L A;  3I8Z A;  2Z1C A;  2IX3 A;  2RSN A;  3SDZ A;  1OXX K;  2PZU A;  3I91 A;  2BOS A;  4KD4 A;  2G9D A;  4N9T A;  1A2T A;  1D5Z C;  5M3F B;  2B2U C;  4ABN A;  1WTR A;  4G7O C;  1TS4 A;  5A35 A;  4IAL A;  5IGD A;  2B2V C;  3MZ5 A;  2PZW A;  3HOV B;  3Q23 A;  4RHS A;  1EU4 A;  4IUP A;  1U4P A;  2FFK B;  1PMR A;  4K14 A;  4MN3 A;  3PUZ A;  2DN8 A;  3LNN A;  3R2I A;  3S2D B;  4CHT B;  4XIG S;  5DM7 3;  5I2Y A;  1X3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...