4BWGB

Structural basis of subtilase cytotoxin subab assembly
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
95
Chain Sequence
VVITQFHTGQIDNKPYFCIEGKSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Subtilase Cytotoxin Subab Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords SUBA
total genus 19
structure length 95
sequence length 99
chains with identical sequence C, D, E, F, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4bwgB00
1EEFD 1B1ZA 3CHBD 1F77A 5I4DA 1FNUA 1LTRD 1D6EC 1PZKD 1FGBD 1TS2A 2IJ0A 1I4GA 1PRTC 1L0YB 3EFXD 1BCPB 4RGTA 3OWEB 1SE4A 1SBBB 1BCPF 1D5MC 1CHQD 1AN8A 1V1PB 4K6LA 1TS4A 3V05A 1KLGD 2SEBD 3R2TA 1EU3A 1EWCA 1QILA 1I4RA 4RFBA 2G9HD 1TY2A 4OHJA 1S5FD 1S5ED 3W2DA 3TSSA 1ESFA 1PYWD 1T5XD 1PTOB 2RDGA 1BCPC 3MC0B 1LTAD 2QILA 1ENFA 1LT4D 1TS3A 1RF2D 1PRTF 3BVMA 1LTTD 1S5CD 1RDPD 2J4XA 1DYQA 3SEBA 1JWMD 1CK1A 1PTOH 4O1NA 4DXGA 1PRTD 4BWGB 1LT5D 1PTOF 4C56C 1I4QA 1JCKB 1D5XC 2XN9C 2NTSA 1V1PA 1LTSD 1EFID 1LT6D 1TY0A 3R2IA 1SJHD 4ZYSA 2TSSA 3BYYB 1PZJD 1CHPD 1SE2A 5ELEA 1FNVA 1JR0D 1ET9A 4RH6A 2CHBD 1I4PA 4RHRA 5ELDA 1BCPD 4Z9CB 1RD9D 1AW7A 4RGNA 2O2LD 1STEA 3BZDB 1XTCD 2AQ3B 1CT1D 1HQRD 3DWAA 3BVZA 1BXTA 5D3IB 3O13A 1UNSA 1I4HA 1KLUD 1SEBD 1EU4A 1ET6A 1JWUD 5ELCA 4UDUC 2RDHA 5TSSA 1HA5A 4RHSA 1SXTA 1M4VA 4RGOS 4RCOA 1DJRD 1LTGD 3MFGA 3URYA 1MD2D 1LO5D 5ELFA 3R8BA 1L0XB 4L6TB 5ELBA 2XNAC 1CQVA 3BVGA 3DWPA 2XRSD 1RCVD 1LLRD 1FD7D 1LT3D 3GP7A 1XXGA 1D5ZC 1LTBD 2Z8LA 4DXFA 1PRTB 1SE3A 1S5DD 3DWQA 1G8ZD 1JQYD 1PTOD 1LTID 4L63B 1GOZA 2NTTA 1V1OA 1FNWA 2WV6D 1TS5A 1HTLD 1I4XA 4RGMA 5FKAC 2QEJC 3EA6A 5FK9C 2IPKD 3BYTB 1HXYD 1S5BD 1JWSD 1PTOC 1KTKA 1UUPA 2AQ2B 1PZID 4TSSA 2XRQD 5D3DA 2R61A 1SJED 2ICIA 2AQ1B 1EEID 1B44D 3KLSX
chains in the Genus database with same CATH superfamily
4DR1Q 2D9UA 1YJNA 4EVOA 1B7YB 3KDFA 4RA8A 4X3UA 3H0GH 2ZJPA 2K50A 1P8LA 3KF8B 5IWAL 2F0VA 4NPSA 3OWEB 1SE4A 1OO9B 3TS0A 1GD7A 4DV1Q 4HSPA 1NUCA 1EYDA 3I90A 4HEDA 5EPJA 5C5LA 1KQSA 2E76C 1N33Q 3PO3B 3KJOA 1PH1A 2RBMA 3A56A 3JC66 4BBSB 1K8MA 4DV0Q 3K58A 1QJOA 1EY5A 3F2BA 2K01A 2B8FA 4A76A 1VQFA 3BZKA 1SYGA 1CZWA 3VDYA 1SFOB 4LFAL 1GUOA 4PV1C 5JAVA 4WJ3M 1PH7A 4QUFA 1BNZA 2P5ZX 4XTCS 2OT2A 1VQ9A 4B9WA 1ENAA 4ZUIA 5JEAG 3F2UA 5C0XI 3CF5A 3T1YQ 2JA8H 2Q8RE 1SE2A 4KI0A 4DV2Q 1HR0W 4JI8L 4ODGA 2Z1CA 4B3SQ 4LUVA 4IFDH 4A3LH 3TP6A 2O2LD 1S4ZA 3HKZG 1MI2A 5CBEE 1PH2A 4Y7NB 1BUVT 4CKCA 2R3ZA 2KHJA 2Z6BA 1DCZA 2KEEA 4LF5L 1HUNA 4JG2A 2MFIA 1I94Q 4FNFA 3WOEA 2HDLA 2N3SA 4RHSA 4F87A 4X65L 4LF9Q 3GTMB 3F2CA 4QIWE 5M3MB 4BY1G 2NBFA 1EOVA 2WACA 4F88A 5ELFA 1A6XA 3RN2A 1MBYA 1CKNB 4B3SL 3FP9A 4CDDC 1II3A 1VQPA 1PVOA 3NE5B 2BA1A 3NTKA 3U9SA 4OO1I 1SNOA 2D5DA 1HRJA 5A2QL 2PI2E 2KQ3A 5IGDA 3A8JE 4H13C 1O7IA 1M8AA 3AYHB 2JN4A 1EYCA 2OCEA 1Q8KA 1X65A 1FGUA 1KRTA 1RJTA 1EIYB 4WRDA 4OX9L 3MXGA 1H9SA 4LF6Q 3CXCA 1JOOA 4X62Q 1EEID 1KRSA 4BBRB 3GTGB 4OO1H 1LABA 1KD1C 2IW3A 4U673 4G7HC 2VL6A 4DNTB 2SNMA 2IX3A 1EWIA 3RMHA 2HCIA 3ITPA 4A3EH 3PV0A 2WKDA 3BU2A 1JORA 4GS3A 4DK0A 1SBBB 1SDFA 1V1PB 2UXBQ 1TS4A 4A75A 2ZJRA 2C9OA 4CBVA 1K3RA 4LK1C 4EQNA 2G9HD 4YWMA 2EIFA 2BE5D 1MIUA 1TR5A 3KUPA 4ZAIA 1L1OA 1OXSC 3H15A 3EQLC 1JC7A 1PRTF 4B08A 3PQIA 4UP7A 3WDNA 1CKMA 4DR2Q 2VQEL 4GKJL 1HNXL 2A6HD 1ASYA 3U9OA 4BY7B 4DNRB 4R4TA 2KOLA 2O5IC 4A93H 4A3GG 1Z6HA 2AMCB 2OQ0A 3CMEA 1QVFA 4B3TQ 1AW7A 3G6EA 1Q3LA 2PQEA 5KNDA 3ER0A 4OXPA 3PO3G 3PIOA 5KNCA 1PFSA 1TWHH 2R6GA 4DR6Q 3FPUB 1VQOA 2RDHA 1CM9A 1M4VA 4RCOA 1Q8IA 3SK5A 4GN5A 3L7ZC 3Q22A 1K73C 3LWUA 2PNRC 1GHKA 3N6RA 3I4OA 5C4HA 1V8QA 5E4XA 3J7YW 2MO1A 2A68D 1CSPA 1JICA 2NTTA 3HOWB 1NTGA 4GOPA 2Z4IA 1HTLD 3EA6A 2FINB 1HXYD 3TZUA 2HQLA 1D8LA 3TBIB 2NVTB 3H3VI 4TSSA 1KDAA 3VA5A 2E8GA 2WKCA 1HZCA 5D3IB 5J1ZA 2A69D 2HD3A 3A0JA 3H6MA 3NP8A 1Q1BA 1WI5A 4DV0L 1C4QA 5J22A 3IFTA 5LL6S 1F2LA 1IYUA 3ONAB 1QE6A 4J15A 3SE0A 1SNPA 2B39A 4IO9A 1BCPF 3HOXH 4N8FA 3OYYA 3AMUA 1BVSA 1KLGD 1VCIA 1I6HB 3U4ZA 2DN8A 2K4KA 2PMZE 2F0LA 2RQXA 5CR3A 1GXDC 1EY0A 1HZAA 2RDGA 5E4WC 4DR1L 3GTGH 3IKJA 1CI3M 4HIDA 2KCTA 3GDEA 1STHA 3GV3A 4DV4L 1S3OA 4ID6A 3NQIA 3QIAA 1Q7YC 3DHQA 2XIWA 4A3EB 3PO2B 1Y8PB 1GUSA 4CDFC 1I4QA 4LF9L 2F0UA 3LX0A 4F7XA 2RHSB 3I4NH 5DM63 1BDOA 5CYUA 1A3VA 1QNKA 2L55A 3BYYB 1SYCA 3CD6A 4JBJA 2F0JA 1I4PA 3OMGA 1VQDA 2F0TA 3I7FA 3EN2A 1XPUA 1SR3A 1AH9A 1B2TA 1DD2A 3CCLA 1Y8OB 1QNUA 4IOAA 4XXEA 5CV6A 4B3RQ 1X3PA 5IP9H 4HAEA 4LFBQ 1L0XB 2F4IA 3I73A 2CW0D 4IJLA 3Q23A 1SSOA 4Y52H 1WTOA 1F9SA 1X54A 4A93B 1BBUA 1Q86C 4CGYB 2VQFL 4CJ0B 3VR3A 2HQEA 4L63B 2GA4B 2ZTCA 1GOZA 2B2TA 2FJ2A 2R92G 1U4RA 4A4IA 1V1OA 4TKOB 1TWHB 3K81C 3J81L 1TS5A 2YTYA 3T51B 4K2LA 3MVVA 1E1TA 3W1BA 3OTOL 2PZTA 1WTVA 2CWAA 2PW7A 3HOZH 4FF1A 5D3DA 4PG3A 4DR5Q 4C1NK 4QF4A 5JVH3 5HGQA 4NMZA 2VQFQ 2EDGA 1EQTA 3T1HL 4H02A 3ULPA 1LTRD 2Z6KA 1N9WA 2AWOA 2KJXA 2MPMA 1FGBD 3DM3A 1C48A 3E9IA 3TN2A 4M8AA 4DR3Q 4KHVA 2Y0SG 1BR9A 5C3WA 4YHHQ 1NSNS 2LXJA 1E0BA 1VQ4A 3K57A 3PGZA 3HOUH 1QILA 3I91A 4A3FH 1WTRA 3IAYA 5C4JH 4YIJA 2CCZA 3NBIA 3TSSA 1PV4A 1FR3A 4X62L 3GTQH 4DV3Q 4V0BA 1L2FA 2UU9L 3S2HB 1XMQL 3UDIA 3NHHA 1JWMD 3IL8A 2R93B 1PRTD 5EKIA 3AFQA 3GQBA 3T56B 3RLFA 5GADC 1DOMA 1G6PA 1E3PA 1EFWA 1I6HH 1WCMH 1GUNA 1VMCA 3MXNB 5BN5A 1MSGA 3D6CA 5D14A 4A3GH 4FDBA 1TXYA 4RH6A 5HURA 4GKKL 1NR4A 3AU7A 5FLXc 3VA7A 2Y0SB 1YHBA 5BN3A 2EZVA 3BVZA 3W3AA 3HEJA 2FFKB 4DR2L 3S1QH 4O2DA 3S9WA 2B2UA 1SRUA 3VYSA 4DV7L 4DUZQ 3KF6B 1Y1VH 4OL7A 3E6ZX 3URYA 1MD2D 1YJWA 1TU2B 3BVGA 4E6IA 4GKKQ 4HCEA 1LT3D 1GO3E 2JP1A 3OPOA 1SMXA 4NXML 1I6VC 3C3LA 2ZTEA 1B50A 4HTHA 2NVQB 1NMFA 1CKNA 1EIHA 1IXRA 1TIID 4L5TA 2K6AA 3D4RA 4K8IA 3SK4A 5C0XH 1IW7C 1PA6A 4GLVB 2R7ZG 3C1FA 1ONLA 1LM0A 1JWSD 2VXWA 4LMQD 3Q6SA 1A2TA 4GN4B 2DGYA 5C5MA 4A3BB 1LACA 3QO2A 3FVQA 1JJGA 2F0DA 3VYRA 3A7AB 4HJ5A 2ZXRA 3HOVB 4NP5A 3K7UC 3DXJC 2BA0A 1TS2A 2IJ0A 2EYJA 2F0KA 4A3IH 2NVXB 4LW1A 3UI2A 1D5MC 3GTPB 4YY3Q 1G6ZA 2OXPA 5C4XB 2EJMA 1MHWC 2DY7A 4UAIA 2F0IA 2IHEA 1S5ED 1UE7A 2PW5A 3EJIA 4L5RC 1I3QH 1KABA 3P7JA 2QA4A 2JYOA 1Y69U 2KCNA 4DN4M 5GROA 2PCFB 5ELNA 3NWTA 3OW2A 5C3XA 1S5CD 3BG3A 1K0RA 5J3BA 5EBCA 3P20A 1LT5D 4DV1L 2PMZB 4B3RL 2F52A 1KDBA 3J80L 5C4XG 4ZKCB 2E5LQ 3GTJH 1KC8C 3C2PA 1PZJD 3ERQA 5FO8B 3NXWA 2JA8G 2QKIC 3PUVA 3SR1A 1BCPD 3RLNA 3GTQB 1YNND 5E3FA 3BZDB 1Z47A 2KHSA 3HOVG 3OIQA 4NXNQ 3GTKB 4A3DB 3S2HH 1U0LA 4DFAA 3M4QA 3SGIA 4CDEC 1TWFB 2V4DA 4JYAL 3LGJA 5C3EB 3MEHA 4R4CA 2F0FA 1TQOA 1DOKA 2QF7A 1JT8A 3FKIB 3S17B 4CKBA 1VF5C 2RHQB 4DV6Q 1WD0A 2I07B 1L1OC 1PXUA 1J5EL 4HR7B 1HZBA 2F0HA 4RCNA 3FRPB 2JA7G 2PI2A 3CCUA 2A74C 4IPGA 1DONA 2ES2A 2EXZA 4QY7A 1IBLQ 4HIMA 3P1HA 1LTID 3T1HQ 1DGSA 1WOCA 3MXUA 4U68A 1HHVA 2K33A 3J7AF 1STGA 1CTMA 4JI0L 4KK7A 4DAYA 1ML0D 3BS1A 3TREA 4GLXA 2CQAA 1R4QB 2F0SA 4APVA 4DU9A 1RTOA 1J6QA 2QEXA 1F2YA 4AYBE 2B2WA 4MN3A 3VR4A 3H0GB 4RAUC 2EY2A 3PIO3 4B3ML 1Y14B 2K7VA 1HJPA 3KLSX 3SDZA 2GVAA 1HNZQ 2EJGC 4A3JG 3K0XA 4G7OC 2KENA 1SYFA 3KJPA 3I70A 4UP9A 1A15A 2VUMB 2F3VA 4K6LA 2A69C 1IW7D 3QB3A 2A8VA 5M5YH 3MTSA 2GVBA 1IKLA 3RNUA 3W1GA 3CKIB 1MGSA 2F0GA 2K5HA 1X3GA 3Q8DA 1J9OA 4IPCA 4PZ8A 3ICEA 3CPFA 2K5VA 5C3EG 1SFOH 4YCVA 5M5WB 1G2SA 1RF2D 4P2CB 3FEWX 1STYA 4GN3B 1Y8NB 1X32A 4OWTB 3HOVH 1CK1A 3CC2A 5JVG3 4DR3L 3NBHB 2JA8B 3KK7A 3K59A 1SYBA 4DUZL 4A3MH 1MKHA 2KEDA 4QQBX 3S2DH 1W3SA 1ICFB 3R93A 1I3QB 3I72A 3K5OA 4DAVA 5D65A 5JPMC 2LKVA 3GTMH 3PF4A 5M3MH 2OF1A 1UNSA 1KLUD 2X6LA 3OHXC 1EU4A 1VDZA 4DR7Q 1B9NA 1EZ8A 4JI1Q 4QGUA 4BS9A 4IUUA 1I94L 4FXGC 1YNNC 3PSIA 4TVAB 1OXUA 3F8TA 1HFGA 3PMFA 3SK8A 3DWPA 2ATWA 2BE5C 2R92H 3T16A 1Q82C 3H94A 2IL8A 1K8GA 3QWNA 2HUGA 2PQAA 1AFPA 3A8IE 1E1OA 1A3UA 4C3HG 4DR6L 4HN7A 1JE4A 3L3OC 4G4KA 2JA5H 2K5DA 3SVMA 1A2UA 3NWSA 5KYIA 4MTKA 3FMCA 2AQ2B 1HNXQ 4POFA 1YEZA 1STAA 2DJGC 3ND8A 1F2ZA 2DUDA 4HJ7A 1EEFD 1YZ6A 2OTJA 1TWAH 1IHZA 2J0TD 3ND9A 1VQNA 2O5JC 2L15A 4L5QA 4UHVA 2F1MA 4DPGA 1XMOL 5IP7H 4XQJA 4ME5A 1ENCA 1G91A 1EIFA 3S1RH 2Q2TA 4R4QA 2ASBA 1VQ5A 2DNCA 4A3MG 5KGUA 1HUMA 4CKEA 3W2DA 1X3FA 1X3EA 2RA4A 3U58A 1T5XD 2E2IB 1OXXK 4NDXA 1ENFA 2LY7A 3NK9A 2XSCA 1Q81C 3VYTA 2EYOA 1FJGQ 4YCUA 1WTWA 1XMOQ 4HMJA 4O1NA 1B70B 4AH6A 2VQEQ 5JJLA 4GKJQ 4S3SA 5T1IA 4YY3L 4IFDI 1CQFA 4DK3C 1D5XC 2K32A 2XN9C 2Y0SE 4KY6A 2CKZB 1HPCA 1S72A 3JAME 5M5YB 3E0EA 1LUZA 3CQZH 4WJ4A 3J7A5 4ZYSA 1X9NA 4LF7Q 2VUMG 4ILWA 2HIVA 3D0FA 2F4VL 4X66L 1EY4A 3NSWA 5CV4A 3CCQA 1RD9D 5M9OA 2AQ3B 4A3JH 5M5WH 4HIKA 4JK1C 1N34Q 4GNXB 1R9TH 1OXVA 3R8BA 1STNA 1E2ZA 4A3MB 3HOUG 4JI3L 2AUKA 5JPNC 1WTHA 1E7ZA 5JJIA 3HOWG 3S14H 5NUCA 3HOWH 2MO0A 5FLXL 1HNZL 2QDLA 3TZDA 1UEAB 5I6YA 5LMUQ 1EY7A 4RMFA 3KF8A 4DAMA 4JYAQ 3FDTA 2F03A 2JA7B 5AFWA 2NVTH 3U4VA 5IGCA 4DV4Q 4PQXA 1GUGA 2K75A 4RGMA 4XYOA 1TVXA 4ZRZA 2AWNA 1KTKA 4K0KQ 3NEMA 3FKIG 4LF4Q 1UAPA 2ZT9C 3HS0C 4AQYQ 2R92B 1V9PA 4KHPL 4KKUA 3MHBA 3TMEA 5I4DA 2A5HA 3HOXB 4C3HH 1I50H 3OW7A 2F0EA 1HR0Q 1PHJA 5IWAQ 5DEHA 4MNOA 4ZLTF 1XNRQ 2JA5B 1AN8A 3I8ZA 1MSHA 1ZYRD 3SK6A 3CC7A 1ASZA 3CMAA 4LJZC 1YBYA 2F0WA 3AFPA 4NW2A 4X3KA 5EPLA 1BKBA 1RODA 1QZGA 3KFUA 3PO2H 3QOLA 4X3TA 3CCVA 4ZQ3A 4O0AA 2Z4HA 1K0SA 1ESRA 2XWJB 3G7LA 5I2XA 2ZXPA 1TWAB 3K5MA 4DR7L 4YHHL 5IP7G 2JSOA 5HGTA 1PTOF 2OEOA 1HH2P 3HKSA 1WYDA 1LTLA 4A3KB 1W6KA 5ELEA 5CBAE 3EROA 4JV5L 1ET9A 2K14A 1XMQQ 1MJCA 1X56A 2IX0A 4FO2A 2PO4A 1VQIA 1IBML 2LMCB 1IL8A 1BF4A 3CCRA 2WAQG 1CUKA 1UE5A 5I2YA 3WOFA 3A55A 1LTGD 1FVIA 5C0XG 5ELBA 1P16A 5KIXA 4PNYA 3HOXG 1RCVD 1K9MC 1LLRD 5IT9c 1D1KA 1D5ZC 3L9AX 3SXHA 3M4OB 1VQHA 1PRTB 5K5PA 2B2VC 1PH3A 3KF6A 3BDLA 3QJYA 1FYCA 4A3JB 2NN6I 4RG1A 1W2BA 1SMYD 1VQGA 3OMCA 3MZ5A 1VQAA 4AYBG 1NBWA 5FK9C 4QMGA 4IUNA 5DM73 2R61A 4ALPA 4JI7Q 1EUJA 5HY6A 3HFZB 5IE8A 3CCMA 3S14B 1PFNA 2CH4A 2ENBA 3NQTA 5A2QE 1STBA 3HOUB 4A3FB 2XWBB 1PRTC 5IT9L 1L0YB 1JB3A 2ICEC 2PQAB 3G71A 2JA7H 5FO7B 3V05A 1WTPA 3TDQA 4I7AA 4OHJA 4JI2Q 1XNQL 2NVYB 1ZXTA 4LAAA 4PZ7A 4FF3A 1LT4D 3CCEA 3KBXA 1NY4A 1SNCA 5G3LD 1I50B 1VF7A 3CAMA 3LNNA 4KY5A 5EPKA 1Q90A 4A3GB 4C56C 4AIMA 1D2BA 1B3AA 2H1EA 5CV7A 1LT6D 4HSVA 3VYUA 3E3XA 1VQBA 4HJ8A 3PUWA 4ZCKA 4I65A 3S1QB 4Z9CB 2M2LA 3RLOA 3DWAA 2UUAQ 1PDQA 3I3CA 3JAML 1I4HA 1CFMA 1NAPA 1NR2A 4N8X1 4IALA 3IFDA 2E2JB 3NBHA 2Q8IB 2WB1G 2EYLA 4HMIA 2K28A 3MFGA 2EY5A 5C6AA 2KCMA 2VY3A 4KMUC 3TEHB 2NVQH 4OONA 4K0KL 3V96A 4LF4L 1ZEQX 4X66Q 4A3IG 1QVGA 2YU9H 4IOCA 3J80c 2CH4W 5GAEC 4DXFA 1PTOD 1H95A 3E0JA 5IODA 2EE1A 2K1BA 2EY6A 1N34L 1XJVA 3M9BA 4LFAQ 2YTXA 1XNRL 2Q2HA 4PMBA 2L12A 1O80A 1KNEA 1GHJA 1ILQA 4DGZA 2E5LL 1ZKOA 1IYVA 3CC4A 1D7QA 1B44D 1PH5A 3HKZE 1ZYRC 4A3IB 3M4OH 2K5WA 4XT3B 4XQQA 3GTPH 3G48A 1E22A 5C4XH 1KL9A 5EKLA 4JI0Q 3D31A 4JBKA 2HT1A 1CA5A 4OWXB 1N32L 1JOQA 1S40A 2TMPA 3PCOB 2I5HA 4X64L 2NB0A 2MP1A 2R7DA 4BY1H 2C5CA 1LYLA 3PO2G 1ESFA 2E75C 4H7BA 4KD3A 2Q8TA 2NZ1D 5LMNL 3RN5A 4C3IH 1U4MA 2J4XA 5JJZA 1EYAA 4A3LG 2IX1A 5BR8Q 1CSQA 2J7ZA 3GTOB 2AHOB 1TWCH 2K52A 4DR4Q 3RZDB 4X64Q 2B2UC 1VQMA 1QUQB 1T5EA 2JA6B 2JQOA 1GKHA 3GTKH 4L5SA 3KYHC 3A74A 2FMMA 5LMNQ 1CHPD 2K03A 1E2VA 1SYDA 2NVYH 1TWFH 2D0PA 5EKKA 3T53B 1EQQA 1VQ6A 4IFDJ 2RSOA 1PH8A 2R93G 1STEA 3HP3A 3FKIH 3S17H 2FXQA 2R7ZH 4JW0A 3PIP3 4BBSG 1X6OA 1O7LA 1RKNA 2QCPX 3V2TA 5K36H 4RGOS 1VQEA 1J8IA 3GO5A 5T1GA 3M3YH 4K5VA 3RD4A 2UXBL 4A3FG 2G5DA 2H4OA 4L6TB 1BBWA 2D0OA 1G291 3K7AB 1X3QA 4FP5D 1LTBD 1VQKA 3H0GG 4IQZA 1M90C 3K80C 4JI1L 5LL6X 1SAPA 1JJCB 2EXDA 4AYBB 5FLMG 2UXCQ 2IPKD 2B63B 3MEFA 4R8IA 4YWKA 5G3LF 1OTCA 1CKOA 3CCJA 2BCOA 4LF6L 3RR5A 1HCZA 2ZTDA 4BXXG 4F8MA 2L4NA 3HRZC 2VUMH 2YU9B 3JAMi 1A8VA 1WCMG 4K5XA 4R4IA 3HZXA 1D6EC 2B8GA 3L0OA 4A93G 3EFXD 2G9DA 3S16B 1EIGA 2D2CC 1SE8A 5EGTA 4R8NA 1EU3A 4QB4A 5CMDA 1I4RA 2R7FA 4EQ5A 4RFBA 3JAMc 5IP9G 1WFQA 1KDCA 2VW9A 3ULLA 3H09A 1AEXA 1XTDA 1EQVA 1LTAD 5I9OA 1KNAA 1YIJA 5CV8A 3S15B 2K5NA 1EY8A 1PTOH 2A1AA 3CRLC 2L5TA 3NTHA 3NTIA 3S2DB 2BOSA 2NZOA 2JA9A 1JCKB 4POGA 1V1PA 1LTSD 1TY0A 2NWGA 2E74C 3ZJYC 4DR5L 1JJ2A 1SJHD 5IYCH 1CZGA 2NUCA 5I6WA 3J7ZC 1D1IA 5IYCG 4CHTB 3HG9A 4RGNA 1QB5D 3K6OA 1XTCD 2RKSA 5KNBA 3KOJA 4C3IB 2BH8A 5IYBG 3ZYYX 1ET6A 2HHHQ 5IYDG 1JWUD 4H44C 5ELCA 1HA5A 3AQQA 4DKAC 2JA5G 1RIPA 3J81E 2A6HC 1EWHA 2VB2X 3GTOH 3PIPA 1H9JA 3QG1A 1LO5D 1XX8A 4QUCA 1PYBA 1XPOA 1CQVA 3D6WA 2K05A 2XRSD 4ZUJA 1VQJA 4MIUA 4DNIA 1EYGA 3GP7A 2PZWA 4A3BG 4ABNA 1EL0A 3H3VC 1SROA 4JI5L 1C8CA 3J81i 3D4DA 4G57A 4KKSA 2R7ZB 3M4PA 3AB9A 1IL2A 5JJKA 5FKAC 1PH6A 2FHTA 3RZOH 1GVPA 2NN6G 2UXDL 5M3MG 3X3NA 1EZ6A 4BA2I 3M3YB 5C4ZA 3OSOA 1HFNA 4DK1A 4LF8Q 2ZXOA 2F3IA 4UP8A 2B29A 4JI5Q 2V1CC 2F0QA 5LMUL 1F77A 1Y1WB 2EYFA 3I4NG 3S1RB 2NYZD 1E2WA 3STBD 4N9TA 5FLMH 2IY5B 4QCLA 3WWVA 4KN4C 3TS2A 1I4GA 4DUYL 4KJNA 1DOLA 2XVSA 4PMWA 2L11A 2B2VA 2E2IH 1PLFA 2SEBD 1LV9A 3E9HA 1O7YA 3EIVA 5DLQE 2JJQA 5A35A 1TY2A 2JK8A 3PUZA 5GAHC 5ISRA 1KAWA 2KUMA 2X69A 3LWEA 5CC4A 2CFMA 2XTIA 4IUVA 3ERSX 1B3QA 2Q2IA 4DK6C 1IYJB 2EYHA 2ID0A 1TS3A 2SOBA 4J1MA 4R9WA 1FJGL 5K36G 1XWEA 1DYQA 1KIXA 4JBWA 3CQZB 4DXGA 4PMCA 4ULLA 5CV5A 1PH4A 3S16H 2E2HB 2NTSA 1AZPA 1XPRA 4EQOA 2ALYB 4JBMA 5J39A 2UUCQ 3T1YL 2BDOA 1V43A 5EBDA 3VR5A 1JMCA 1JR0D 3J80i 1C7YA 4XDXA 4JOIA 4C2MB 5IT9E 2WINB 4AQYL 1QWYA 4KV6A 4LUOA 1AZQA 1R9TB 4UY8C 4H0LC 5AJ3L 4A3CG 4DAYB 3S15H 1RL2A 3KLRA 3R3OA 5IGBA 3A5ZB 1HR0L 5KYLA 1GJXA 4FVMA 4TRDA 3I4MG 3S1MB 2Z9HA 3M4YA 3GTLH 4JOIC 1JB7A 1UE1A 1SNDA 1QOHA 3DMUA 1RHPA 3OOCA 4N9PA 3M85A 1TWGH 4DV3L 1SE3A 3DWQA 1Z7TA 5BN4A 1JQYD 4KJOA 3L2PA 5AJ3Q 2M9VA 3F2DA 2A73B 3PF5A 1ICWA 4X6AH 1YJ9A 4HJAA 1I4XA 1KXLA 3BYTB 1S5BD 4GLAC 5JEAJ 1B53A 2VB3X 4DV2L 3EVQA 4C3HB 3UDGA 3C46A 5FJ8G 2AQ1B 3VR2A 1N33L 4B3MQ 2MGSA 1F9RA 2Z0SA 4EGVA 2LS01 4ME3A 2F0PA 2WAQB 1K3BC 1U5KA 4BBRH 2IT1A 1VQLA 1U4LA 2ZJQA 3MXPA 3DLLA 1IZ6A 5GQOA 3ULJA 2UXCL 4IPDA 3S24A 1J5EQ 1R4PB 2RCNA 3BDCA 5IY0A 3KLSA 4XT1B 4A3KG 1VQ8A 1NCVA 2Q2UA 1PYWD 5LHY1 3QR8A 2YTVA 1HA6A 4JCVE 4K14A 1JE5A 3UE0A 5M3FB 2D62A 3BVMA 1LTTD 5L37A 5M3FG 1Y1WH 2EQSA 3HKZB 4JI6L 2B3GA 2B2YA 1L1OB 1C9OA 2CQOA 2N88A 4IFDG 4A3CH 3Q24A 4A3KH 4KTAA 4RWSC 2QGQA 1A63A 2UUBQ 5E7NA 2F3WA 1C0AA 1YITA 1A3TA 2TSSA 2H5XA 1U4PA 3CRKC 2XGTA 1AE2A 1T9HA 5EJWA 5I9PA 4OO1G 2CHBD 4JV5Q 1F9PA 4B3TL 4BY7H 1IBMQ 4CJ2C 1JOKA 3O13A 2EPBA 2EYPA 5DNFA 1PMRA 3SHLA 5FJ8H 1PH9A 2DY8A 3CCSA 1AP0A 4ZK9B 1G51A 4TQUS 2K5QA 2E2HH 1XYIA 2XNAC 4OWWB 2L1BA 3NPPA 4PZ6A 2RDFA 4LF8L 4P73A 2Z8LA 1NMGA 3CU7A 4C2MH 1U9RA 3NUCA 2HHHL 1Y1VG 4I7ZC 3PUXA 2RCFA 1FNWA 1WD1A 5C44G 2WV6D 2VS1A 1Q12A 1KAAA 3KBGA 4MTNA 4K5WA 1B9MA 3I4MB 2L9HA 1N8RC 3D4WA 1PZID 3TP5A 2JEAI 2WFWA 4C3JH 4IZ8A 4MHEA 1FL0A 2EYMA 3S1MH 3KDFB 3GTLB 3B6YA 5M5XH 4C1NI 3RUZA 2YV5A 2QDBA 1WTQA 3OWFA 1IBKL 2MQHA 2IHFA 1B1ZA 2NN6H 4WFN3 1ILPA 1N36Q 1TT2A 1TWGB 5JEAH 2L0CA 1BOSA 1BO0A 2A68C 4NXNL 1Q1EA 1YNJD 1PZKD 3EBEA 2KVMA 1EY6A 2RVLA 1BCPB 1SNMA 1UEBA 4OIJA 4P72A 1Z9FA 2WB1E 4DV6L 4MZ9A 4XQNA 3DUZA 5E1FA 4DV5L 3U50C 4A3DG 1WVLA 3DM1A 1DZ1A 5KRUA 1IKMA 4YWLA 2JA6G 3MC0B 1F9QA 2QILA 3J7AV 4LFCQ 4LNQA 5FO9B 2A19A 3I55A 5CORA 1HTPA 4BY7G 2NZHA 4HJ9A 1EQRA 4WJWA 4FF4A 4FXKC 1EFID 2WP8J 1NJIC 3R2IA 2MHVA 3P75A 3G6JB 4R4OA 3HGBA 2RSNA 3BZCA 1GM5A 1FNVA 3A5UA 5FLXE 3MXNA 4V190 1YI2A 3I4NB 3HOZG 2FMCA 2E2JH 1HQRD 4P75A 1Y1WG 1B4OA 1PFMA 1BXTA 5M3FH 3AEVA 1GUTA 5BR8L 2UUAL 3TP7A 1SEBD 3D8GA 4UPAA 4OELB 1A62A 4B9XA 1DM0B 2MJ8A 4IN3A 4XYQA 1HQMC 2JEBI 3KLWA 3T13A 1DJRD 4Q5VA 4IUTA 1VQCA 2UUCL 1DXMA 5GAGC 3OIPA 3J80E 1FD7D 4BA1I 4BBRG 1S5DD 1G8ZD 3C1EA 3HOYH 4K6DA 3I2ZA 4Q0FA 3DEPA 4KY7A 2HDMA 4IURA 1GUWA 2OTLA 2WAQE 2AUJD 2KCCA 1SYEA 3MWYW 5H1SE 1CA6A 4DR4L 2B2WC 4IJHA 1QVCA 1HNWL 2F4VQ 2XRQD 2F0MA 3N52A 4OGQC 3BJUA 4J8QA 5IYDH 2GN5A 5IYBH 1PYSB 2DNEA 2PZUA 4YCWA 2WB1B 3HOZB 2O4XA 3A8KE 2I0QA 1YHAA 3CW2C 1X55A 1FNUA 3T4AC 4JI6Q 1VMPA 5LMNW 1YNXA 3S1NH 4BY1B 4RGTA 1HNWQ 5KEEA 1N32Q 2KECA 2LFNA 2AKWB 3I4MH 1YHQA 2RF4A 4JVZA 1S5FD 4IUQA 1MJEA 3CP0A 3E5SA 4RKLA 3IRBA 4C3JB 1K83B 1QCBD 2F0NA 4O42A 5M5XB 4EX5A 5C4JB 3A54A 1TWCB 5IGFA 2M00A 3RZDH 1RDPD 3PUYA 2MUYA 2JA6H 4HCSA 2OQKA 3VR6A 2JE6I 3UDXA 4BWGB 2KA7A 3OTOQ 4X65Q 2DJFC 2EOTA 2LXKA 1VQ7A 4GZYC 2R93H 1HZ9A 3K5LA 2LSSA 3NELA 1BBXC 3H91A 4LFBL 2CWPA 1RTNA 1Q46A 3K0YA 4CDCC 4KHPQ 4DA2A 2N78A 1OXTA 2QW7A 1WCMB 4K2KA 4G7ZC 1CT1D 2BH2A 5F2DA 3BDOA 4EQPA 5COYA 1E24A 3UE1A 4BXXH 4JI4Q 2A6EC 4GOPB 4UDUC 4CJ1B 3I56A 1SXTA 3A7LA 3K7AH 4P74A 4C3JG 4J6HA 2UUBL 4IUPA 1NNXA 2YYZA 2WIIB 2B63G 4KN7C 3NENA 3TP8A 4FXDA 1WJJA 2K04A 1K28A 5JOBA 5CV9A 4OX9Q 4WORA 5C44H 2I5MX 4KLKA 4JI8Q 4XIGS 1O78A 4NXMQ 1Y1VB 1B8AA 4KKTA 1YVCA 2BDNA 1L0WA 4FYDA 1F2MA 2JXMB 4OIKA 5IGEA 4JI4L 2B63H 4LF5Q 1KHIA 1TKWB 1V1QA 3M7NA 1BQQT 4R1JA 2PNHA 3GV6A 5EQ0A 5C0XJ 3K5NA 4KD4A 1EOTA 2QEJC 5DAUA 4QL5A 1PTOC 4GOPC 3STBC 3PO3H 2OWOA 1YNJC 4JC0A 4BBSH 4NKLA 4GNXC 2PPBC 5IOCA 1SJED 3G4SA 4L8JA 2N8NA 3CHBD 4LFCL 3TRZA 1K8OA 2UU9Q 1W6JA 4QJFA 5FOBB 3HOYB 4A3BH 1H9SB 4DV7Q 1SMYC 1K8AC 2MNAA 1CHQD 4DF7A 2I46A 3QOJA 3R2TA 2CVRA 1EWCA 2KHIA 3CPWA 3MFYA 2C35B 3GD7A 4KHZA 2N49A 5IIFA 2IWHA 4JI2L 1XNQQ 5IGGA 2NVXH 4JI3Q 4ZKBB 1IBKQ 3I4LA 1PTOB 2N55A 2Z6KC 2E2DC 1BCPC 2VZAA 3J81j 4Y7NH 3X3MA 1SN8A 1N36L 3D3RA 1WTXA 4C3IG 2KBNA 4DUYQ 3SEBA 4IPHA 1QZHA 4OEMB 1NE3A 1H9RA 3H3VH 4P71A 3S1NB 4A3EG 4LWCA 3UDFA 1G2TA 1SLJA 5EAYA 4DV5Q 4JI7L 3DEOA 4DAPA 2I5LX 4QIWB 2UXDQ 4LF7L 4LUZA 2B2TC 4FF2A 1AE3A 3MA2B 4RHRA 5ELDA 1K83H 2EY1A 3Q0AA 1I5FA 1SNQA 3W5OA 3GTJB 1QUQA 1A0IA 2CW0C 1M1KC 3FPPA 1UWVA 3J81c 2VNUD 5TSSA 4A3DH 4HIOA 2ZM6Q 2HIXA 1QG7A 3K8AA 1H9KA 3M7GA 3F1ZA 2B2YC 3HOYG 2X6GA 5CGKA 2PYKA 5C3EH 1VS0A 2EJFC 2A6ED 1XXGA 1IBLL 1H9MA 4RKBA 3MAQA 2HCCA 2EVBA 3RZOB 3FHWA 5ELOA 1PFBA 3TQYA 2SNSA 4JPBW 2ZM6L 4K8JA 1EY9A 2SDFA 1UUPA 1UE6A 4M1UB 4GNXA 2F0OA 2ICIA 5C44B 4X3SA 1O7ZA 4NB3A
chains in the Genus database with same CATH topology
2D9UA 4EVOA 4RA8A 4X3UA 2F0VA 3OWEB 1SE4A 1OO9B 4HSPA 1NUCA 1EYDA 3I90A 4HEDA 5EPJA 5C5LA 2E76C 3PO3B 2RBMA 3A56A 4BBSB 1K8MA 3K58A 1QJOA 1EY5A 2K01A 2B8FA 1SYGA 1CZWA 1SFOB 1GUOA 4PV1C 5JAVA 4QUFA 1BNZA 4XTCS 2OT2A 4B9WA 1ENAA 4ZUIA 5JEAG 3F2UA 5C0XI 2Q8RE 1SE2A 4KI0A 4ODGA 2Z1CA 4IFDH 3TP6A 2O2LD 1S4ZA 1MI2A 5CBEE 4Y7NB 1BUVT 4CKCA 2R3ZA 1DCZA 2KEEA 1HUNA 4FNFA 3WOEA 2HDLA 4F87A 4RHSA 3GTMB 5M3MB 2NBFA 2WACA 4F88A 5ELFA 1A6XA 1MBYA 1II3A 3NE5B 2BA1A 3NTKA 3U9SA 4OO1I 1SNOA 2D5DA 1HRJA 5A2QL 2KQ3A 5IGDA 3A8JE 4H13C 1M8AA 1EYCA 1RJTA 4WRDA 3MXGA 1H9SA 1JOOA 1EEID 3GTGB 4BBRB 4OO1H 1LABA 2IW3A 4U673 4G7HC 4DNTB 2SNMA 2IX3A 3RMHA 2HCIA 3ITPA 3PV0A 2WKDA 1JORA 4DK0A 1SBBB 1SDFA 1V1PB 1TS4A 2C9OA 4CBVA 4LK1C 4EQNA 2G9HD 2BE5D 1TR5A 3KUPA 4ZAIA 1OXSC 3EQLC 1JC7A 1PRTF 4B08A 3WDNA 2A6HD 3U9OA 4BY7B 4DNRB 2KOLA 2O5IC 1Z6HA 1AW7A 1Q3LA 2PQEA 5KNDA 5KNCA 2R6GA 3FPUB 2RDHA 1CM9A 1M4VA 4RCOA 1Q8IA 3SK5A 3L7ZC 3Q22A 3LWUA 2PNRC 1GHKA 3N6RA 5C4HA 1V8QA 5E4XA 3J7YW 2A68D 1JICA 2NTTA 3HOWB 2Z4IA 1HTLD 3EA6A 2FINB 1HXYD 3TZUA 3TBIB 2NVTB 4TSSA 1KDAA 3VA5A 2WKCA 5D3IB 5J1ZA 2A69D 3NP8A 3H6MA 1Q1BA 1C4QA 5J22A 3IFTA 5LL6S 1F2LA 1IYUA 3ONAB 1QE6A 3SE0A 1SNPA 2B39A 1BCPF 3AMUA 1I6HB 1KLGD 1VCIA 2DN8A 2F0LA 2RQXA 5CR3A 1GXDC 1EY0A 2RDGA 5E4WC 3IKJA 1CI3M 1STHA 3GV3A 4ID6A 3NQIA 3QIAA 3DHQA 2XIWA 4A3EB 3PO2B 1Y8PB 1GUSA 1I4QA 2F0UA 3LX0A 4F7XA 5DM63 1BDOA 5CYUA 1A3VA 1QNKA 2L55A 3BYYB 1SYCA 2F0JA 1I4PA 3OMGA 2F0TA 1B2TA 1DD2A 1Y8OB 1QNUA 4XXEA 5CV6A 1X3PA 4HAEA 1L0XB 2F4IA 3I73A 2CW0D 3Q23A 1SSOA 1WTOA 1F9SA 4A93B 4CGYB 4CJ0B 3VR3A 2HQEA 4L63B 2GA4B 1GOZA 2B2TA 2FJ2A 1U4RA 1V1OA 4TKOB 1TWHB 3J81L 1TS5A 3T51B 4K2LA 3MVVA 2PZTA 1WTVA 2PW7A 4FF1A 5D3DA 4C1NK 4QF4A 5JVH3 4NMZA 2EDGA 1EQTA 1LTRD 2MPMA 2AWOA 2KJXA 1FGBD 1C48A 3TN2A 4M8AA 4KHVA 1BR9A 5C3WA 1NSNS 1E0BA 3K57A 3IAYA 1QILA 3I91A 1WTRA 4YIJA 3NBIA 3TSSA 1FR3A 4V0BA 3S2HB 3NHHA 1JWMD 3IL8A 2R93B 1PRTD 5EKIA 3GQBA 3T56B 3RLFA 1DOMA 1GUNA 1VMCA 5BN5A 1MSGA 3D6CA 5D14A 4RH6A 5HURA 1NR4A 3AU7A 3VA7A 2Y0SB 5BN3A 2EZVA 3BVZA 3W3AA 3HEJA 2FFKB 3S9WA 2B2UA 3VYSA 4OL7A 3E6ZX 3URYA 1MD2D 1TU2B 3BVGA 4E6IA 4HCEA 1LT3D 2JP1A 3OPOA 1I6VC 3C3LA 1B50A 4HTHA 2NVQB 1EIHA 1TIID 2K6AA 3D4RA 4K8IA 3SK4A 5C0XH 1IW7C 3C1FA 1ONLA 1JWSD 2VXWA 4LMQD 3Q6SA 1A2TA 5C5MA 4A3BB 1LACA 3QO2A 3FVQA 2F0DA 3VYRA 3A7AB 2ZXRA 3HOVB 4NP5A 3DXJC 2BA0A 1TS2A 2IJ0A 2EYJA 2F0KA 2NVXB 3UI2A 1D5MC 3GTPB 1G6ZA 2OXPA 5C4XB 2EJMA 2DY7A 4UAIA 2F0IA 1S5ED 2PW5A 3EJIA 1KABA 3P7JA 2JYOA 1Y69U 2KCNA 4DN4M 2PCFB 3NWTA 5C3XA 1S5CD 3BG3A 5EBCA 3P20A 1LT5D 2PMZB 1KDBA 3J80L 4ZKCB 3C2PA 1PZJD 3ERQA 5FO8B 3NXWA 2QKIC 3PUVA 3SR1A 1BCPD 3GTQB 1YNND 5E3FA 3BZDB 1Z47A 2KHSA 3OIQA 3GTKB 4A3DB 4DFAA 1TWFB 2V4DA 5C3EB 3MEHA 2F0FA 1TQOA 1DOKA 2QF7A 3FKIB 3S17B 4CKBA 1VF5C 1WD0A 2I07B 1PXUA 4HR7B 2F0HA 4RCNA 3FRPB 2A74C 1DONA 2EXZA 3P1HA 1LTID 3MXUA 4U68A 1HHVA 2K33A 3J7AF 1STGA 1CTMA 4KK7A 4DAYA 1ML0D 3BS1A 2CQAA 1R4QB 2F0SA 4DU9A 1RTOA 1F2YA 2B2WA 4MN3A 3VR4A 3H0GB 4RAUC 2EY2A 3PIO3 2K7VA 3KLSX 3SDZA 2EJGC 4G7OC 1SYFA 3I70A 1A15A 2VUMB 2F3VA 4K6LA 2A69C 1IW7D 3QB3A 3MTSA 1IKLA 3CKIB 1MGSA 2F0GA 1J9OA 5M5WB 1G2SA 1RF2D 4P2CB 3FEWX 1STYA 1Y8NB 1X32A 1CK1A 5JVG3 2JA8B 3KK7A 3K59A 1SYBA 2KEDA 3R93A 1I3QB 3I72A 3K5OA 4DAVA 5D65A 5JPMC 2LKVA 2OF1A 1UNSA 1KLUD 2X6LA 3OHXC 1EU4A 1VDZA 1B9NA 1EZ8A 4BS9A 4IUUA 4FXGC 1YNNC 1OXUA 1HFGA 3PMFA 3SK8A 3DWPA 2BE5C 3T16A 3H94A 2IL8A 3QWNA 2HUGA 1AFPA 3A8IE 1A3UA 4C3HG 4HN7A 1JE4A 3L3OC 4G4KA 2K5DA 3SVMA 1A2UA 3NWSA 5KYIA 3FMCA 2AQ2B 1STAA 3ND8A 1F2ZA 1EEFD 1IHZA 2J0TD 3ND9A 2O5JC 2F1MA 4XQJA 4ME5A 1ENCA 1G91A 2DNCA 5KGUA 1HUMA 4CKEA 3W2DA 2RA4A 1T5XD 2E2IB 1OXXK 4NDXA 1ENFA 2LY7A 3NK9A 2XSCA 3VYTA 2EYOA 1WTWA 4HMJA 4O1NA 4S3SA 5T1IA 4IFDI 1CQFA 1D5XC 2K32A 2XN9C 4KY6A 1HPCA 3JAME 5M5YB 4ZYSA 4ILWA 1EY4A 3NSWA 5CV4A 1RD9D 5M9OA 2AQ3B 4JK1C 1OXVA 3R8BA 1STNA 1E2ZA 4A3MB 2AUKA 5JPNC 5NUCA 5FLXL 3TZDA 1UEAB 5I6YA 1EY7A 3KF8A 3FDTA 2F03A 2JA7B 5AFWA 5IGCA 4PQXA 1GUGA 4RGMA 4XYOA 1TVXA 4ZRZA 2AWNA 1KTKA 1UAPA 2ZT9C 3HS0C 2R92B 4KKUA 3MHBA 3TMEA 5I4DA 2A5HA 3HOXB 3OW7A 2F0EA 5DEHA 2JA5B 4ZLTF 1AN8A 3I8ZA 1MSHA 1ZYRD 3SK6A 4LJZC 2F0WA 4NW2A 4X3KA 5EPLA 1RODA 3QOLA 4X3TA 4ZQ3A 2Z4HA 1ESRA 2XWJB 3G7LA 5I2XA 2ZXPA 3K5MA 1TWAB 2JSOA 5HGTA 1PTOF 2OEOA 4A3KB 1W6KA 5ELEA 5CBAE 3EROA 1ET9A 2IX0A 4FO2A 2PO4A 2LMCB 1IL8A 1BF4A 5I2YA 3WOFA 3A55A 1LTGD 5C0XG 5ELBA 5KIXA 4PNYA 1RCVD 1LLRD 1D1KA 1D5ZC 3L9AX 3SXHA 3M4OB 1PRTB 5K5PA 2B2VC 3BDLA 3QJYA 1FYCA 4A3JB 2NN6I 1SMYD 3OMCA 3MZ5A 5FK9C 4QMGA 4IUNA 5DM73 2R61A 3S14B 1PFNA 2ENBA 3NQTA 5A2QE 1STBA 3HOUB 4A3FB 2XWBB 1PRTC 5IT9L 1L0YB 1JB3A 2ICEC 5FO7B 3V05A 1WTPA 3TDQA 4OHJA 2NVYB 1ZXTA 4LAAA 4FF3A 1LT4D 3KBXA 1SNCA 5G3LD 1I50B 1VF7A 3LNNA 4KY5A 5EPKA 1Q90A 4A3GB 4C56C 1D2BA 1B3AA 2H1EA 5CV7A 1LT6D 4HSVA 3VYUA 3PUWA 4I65A 3S1QB 4Z9CB 2M2LA 3DWAA 1PDQA 3I3CA 3JAML 1I4HA 1CFMA 1NAPA 1NR2A 4IALA 3IFDA 2E2JB 3NBHA 2Q8IB 2EYLA 4HMIA 2K28A 3MFGA 2EY5A 5C6AA 4KMUC 3V96A 1ZEQX 4DXFA 1PTOD 3E0JA 5IODA 2EE1A 2K1BA 2EY6A 4PMBA 2L12A 1O80A 1KNEA 1GHJA 1ILQA 4DGZA 1ZKOA 1IYVA 1B44D 1ZYRC 4A3IB 2K5WA 4XT3B 4XQQA 5EKLA 3D31A 1CA5A 1JOQA 2TMPA 2NB0A 2MP1A 2C5CA 1ESFA 2E75C 4H7BA 4KD3A 2Q8TA 2NZ1D 1U4MA 2J4XA 5JJZA 1EYAA 2IX1A 2J7ZA 3GTOB 3RZDB 2B2UC 1T5EA 2JA6B 2FMMA 1CHPD 2K03A 1E2VA 1SYDA 5EKKA 3T53B 4IFDJ 2RSOA 1STEA 3HP3A 3PIP3 1O7LA 1RKNA 2QCPX 3V2TA 5K36H 4RGOS 1J8IA 3GO5A 5T1GA 4K5VA 3RD4A 2H4OA 4L6TB 1G291 3K7AB 1X3QA 4FP5D 1LTBD 4IQZA 5LL6X 1SAPA 4AYBB 2IPKD 2B63B 4R8IA 5G3LF 2BCOA 1HCZA 4F8MA 2L4NA 3HRZC 2YU9B 4K5XA 3HZXA 1D6EC 2B8GA 3EFXD 2G9DA 3S16B 1EIGA 2D2CC 5EGTA 4R8NA 1EU3A 4QB4A 5CMDA 1I4RA 4RFBA 1KDCA 3H09A 1AEXA 1EQVA 1LTAD 5I9OA 1KNAA 5CV8A 3S15B 1EY8A 1PTOH 3CRLC 3NTHA 2L5TA 3NTIA 3S2DB 2BOSA 1JCKB 1V1PA 1LTSD 1TY0A 2NWGA 2E74C 1SJHD 1CZGA 2NUCA 5I6WA 1D1IA 4CHTB 3HG9A 4RGNA 1QB5D 3K6OA 1XTCD 2RKSA 5KNBA 4C3IB 3ZYYX 1ET6A 1JWUD 4H44C 5ELCA 1HA5A 3J81E 2A6HC 1EWHA 2VB2X 1H9JA 3QG1A 1LO5D 1XX8A 4QUCA 1CQVA 3D6WA 2K05A 2XRSD 4ZUJA 4MIUA 3GP7A 2PZWA 4ABNA 1EL0A 3H3VC 1C8CA 3D4DA 4G57A 4KKSA 2R7ZB 3AB9A 5FKAC 2FHTA 2NN6G 3X3NA 1EZ6A 4BA2I 3M3YB 5C4ZA 3OSOA 1HFNA 4DK1A 2ZXOA 2F0QA 1F77A 1Y1WB 2EYFA 3S1RB 2NYZD 1E2WA 4N9TA 4QCLA 4KN4C 1I4GA 4KJNA 1DOLA 2XVSA 4PMWA 2L11A 2B2VA 1PLFA 2SEBD 1LV9A 1O7YA 5A35A 1TY2A 3PUZA 5ISRA 2KUMA 2X69A 3LWEA 5CC4A 4IUVA 2EYHA 2ID0A 1TS3A 2SOBA 4J1MA 4R9WA 5K36G 1XWEA 1DYQA 4JBWA 3CQZB 4DXGA 4PMCA 4ULLA 5CV5A 2E2HB 2NTSA 1AZPA 4EQOA 5J39A 2BDOA 1V43A 5EBDA 3VR5A 1JR0D 4XDXA 4C2MB 5IT9E 2WINB 1QWYA 4KV6A 1AZQA 1R9TB 4H0LC 3KLRA 3R3OA 5IGBA 5KYLA 1GJXA 4FVMA 4TRDA 3S1MB 3M4YA 1SNDA 1QOHA 3DMUA 1RHPA 3OOCA 4N9PA 3M85A 1SE3A 3DWQA 1Z7TA 5BN4A 1JQYD 4KJOA 2M9VA 2A73B 1ICWA 1I4XA 3BYTB 1S5BD 5JEAJ 1B53A 2VB3X 3EVQA 4C3HB 3C46A 2AQ1B 3VR2A 2MGSA 1F9RA 4EGVA 2LS01 2F0PA 2WAQB 2IT1A 1U4LA 3MXPA 1R4PB 3BDCA 3KLSA 4XT1B 1NCVA 1PYWD 5LHY1 1HA6A 4K14A 5M3FB 2D62A 3BVMA 1LTTD 3HKZB 2B2YA 2N88A 4IFDG 3Q24A 4KTAA 4RWSC 2F3WA 1A3TA 2TSSA 1U4PA 3CRKC 5EJWA 5I9PA 4OO1G 2CHBD 1F9PA 4CJ2C 1JOKA 3O13A 2EPBA 2EYPA 5DNFA 1PMRA 3SHLA 2DY8A 1AP0A 4ZK9B 4TQUS 2K5QA 1XYIA 2XNAC 2L1BA 3NPPA 2RDFA 2Z8LA 3CU7A 1U9RA 3NUCA 4I7ZC 3PUXA 1FNWA 1WD1A 2WV6D 1Q12A 1KAAA 3KBGA 4K5WA 1B9MA 3I4MB 2L9HA 3D4WA 1PZID 3TP5A 2JEAI 4IZ8A 4MHEA 2EYMA 3GTLB 4C1NI 3RUZA 2QDBA 1WTQA 3OWFA 1B1ZA 2NN6H 4WFN3 1ILPA 1TT2A 1TWGB 5JEAH 2L0CA 1BOSA 1BO0A 2A68C 1Q1EA 1YNJD 1PZKD 2KVMA 1EY6A 2RVLA 1BCPB 1SNMA 4OIJA 4XQNA 3DUZA 5E1FA 1WVLA 3DM1A 1DZ1A 5KRUA 1IKMA 3MC0B 1F9QA 2QILA 3J7AV 5FO9B 5CORA 1HTPA 4WJWA 4FF4A 4FXKC 1EFID 2WP8J 3R2IA 2MHVA 3P75A 3G6JB 3HGBA 2RSNA 1FNVA 5FLXE 3MXNA 4V190 3I4NB 2FMCA 1HQRD 1B4OA 1PFMA 1BXTA 1GUTA 3TP7A 1SEBD 3D8GA 4B9XA 1DM0B 2MJ8A 4IN3A 4XYQA 1HQMC 2JEBI 3T13A 1DJRD 4Q5VA 4IUTA 1DXMA 3OIPA 3J80E 1FD7D 4BA1I 1S5DD 1G8ZD 3C1EA 4K6DA 4Q0FA 3DEPA 4KY7A 2HDMA 4IURA 1GUWA 2AUJD 2KCCA 1SYEA 3MWYW 1CA6A 2B2WC 2XRQD 2F0MA 3N52A 4OGQC 4J8QA 2DNEA 2PZUA 2WB1B 3HOZB 2O4XA 3A8KE 1FNUA 3T4AC 1VMPA 4BY1B 4RGTA 5KEEA 2KECA 2LFNA 1S5FD 4IUQA 3E5SA 4RKLA 4C3JB 1K83B 1QCBD 2F0NA 4O42A 5M5XB 5C4JB 3A54A 1TWCB 5IGFA 2M00A 1RDPD 3PUYA 2MUYA 4HCSA 3VR6A 2JE6I 4BWGB 2KA7A 2EOTA 4GZYC 3K5LA 1BBXC 3H91A 1RTNA 3K0YA 4DA2A 1OXTA 1WCMB 4K2KA 4G7ZC 1CT1D 5F2DA 3BDOA 4EQPA 5COYA 2A6EC 4UDUC 4CJ1B 1SXTA 3A7LA 4C3JG 4J6HA 4IUPA 2YYZA 2WIIB 4KN7C 3TP8A 4FXDA 2K04A 5JOBA 5CV9A 4WORA 4XIGS 1O78A 1Y1VB 4KKTA 2BDNA 4FYDA 1F2MA 2JXMB 4OIKA 5IGEA 1TKWB 3M7NA 1BQQT 3GV6A 5EQ0A 5C0XJ 3K5NA 4KD4A 1EOTA 2QEJC 5DAUA 1PTOC 1YNJC 4NKLA 2PPBC 5IOCA 1SJED 4L8JA 3CHBD 1K8OA 1W6JA 5FOBB 3HOYB 1H9SB 1SMYC 1CHQD 4DF7A 2I46A 3QOJA 3R2TA 2CVRA 1EWCA 3MFYA 3GD7A 4KHZA 5IIFA 2IWHA 5IGGA 4ZKBB 3I4LA 1PTOB 2N55A 2E2DC 1BCPC 3X3MA 3D3RA 1WTXA 4C3IG 3SEBA 1H9RA 3S1NB 1G2TA 3DEOA 4DAPA 4QIWB 2B2TC 4FF2A 3MA2B 4RHRA 5ELDA 2EY1A 3Q0AA 1SNQA 3GTJB 2CW0C 3FPPA 2VNUD 5TSSA 1QG7A 1H9KA 3M7GA 2B2YC 2X6GA 5CGKA 2PYKA 2EJFC 2A6ED 1XXGA 1H9MA 4RKBA 3MAQA 2HCCA 2EVBA 3RZOB 1PFBA 2SNSA 4K8JA 1EY9A 2SDFA 1UUPA 4M1UB 2F0OA 2ICIA 5C44B 4X3SA 1O7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EEF D;  1B1Z A;  3CHB D;  1F77 A;  5I4D A;  1FNU A;  1LTR D;  1D6E C;  1PZK D;  1FGB D;  1TS2 A;  2IJ0 A;  1I4G A;  1PRT C;  1L0Y B;  3EFX D;  1BCP B;  4RGT A;  3OWE B;  1SE4 A;  1SBB B;  1BCP F;  1D5M C;  1CHQ D;  1AN8 A;  1V1P B;  4K6L A;  1TS4 A;  3V05 A;  1KLG D;  2SEB D;  3R2T A;  1EU3 A;  1EWC A;  1QIL A;  1I4R A;  4RFB A;  2G9H D;  1TY2 A;  4OHJ A;  1S5F D;  1S5E D;  3W2D A;  3TSS A;  1ESF A;  1PYW D;  1T5X D;  1PTO B;  2RDG A;  1BCP C;  3MC0 B;  1LTA D;  2QIL A;  1ENF A;  1LT4 D;  1TS3 A;  1RF2 D;  1PRT F;  3BVM A;  1LTT D;  1S5C D;  1RDP D;  2J4X A;  1DYQ A;  3SEB A;  1JWM D;  1CK1 A;  1PTO H;  4O1N A;  4DXG A;  1PRT D;  4BWG B;  1LT5 D;  1PTO F;  4C56 C;  1I4Q A;  1JCK B;  1D5X C;  2XN9 C;  2NTS A;  1V1P A;  1LTS D;  1EFI D;  1LT6 D;  1TY0 A;  3R2I A;  1SJH D;  4ZYS A;  2TSS A;  3BYY B;  1PZJ D;  1CHP D;  1SE2 A;  5ELE A;  1FNV A;  1JR0 D;  1ET9 A;  4RH6 A;  2CHB D;  1I4P A;  4RHR A;  5ELD A;  1BCP D;  4Z9C B;  1RD9 D;  1AW7 A;  4RGN A;  2O2L D;  1STE A;  3BZD B;  1XTC D;  2AQ3 B;  1CT1 D;  1HQR D;  3DWA A;  3BVZ A;  1BXT A;  5D3I B;  3O13 A;  1UNS A;  1I4H A;  1KLU D;  1SEB D;  1EU4 A;  1ET6 A;  1JWU D;  5ELC A;  4UDU C;  2RDH A;  5TSS A;  1HA5 A;  4RHS A;  1SXT A;  1M4V A;  4RGO S;  4RCO A;  1DJR D;  1LTG D;  3MFG A;  3URY A;  1MD2 D;  1LO5 D;  5ELF A;  3R8B A;  1L0X B;  4L6T B;  5ELB A;  2XNA C;  1CQV A;  3BVG A;  3DWP A;  2XRS D;  1RCV D;  1LLR D;  1FD7 D;  1LT3 D;  3GP7 A;  1XXG A;  1D5Z C;  1LTB D;  2Z8L A;  4DXF A;  1PRT B;  1SE3 A;  1S5D D;  3DWQ A;  1G8Z D;  1JQY D;  1PTO D;  1LTI D;  4L63 B;  1GOZ A;  2NTT A;  1V1O A;  1FNW A;  2WV6 D;  1TS5 A;  1HTL D;  1I4X A;  4RGM A;  5FKA C;  2QEJ C;  3EA6 A;  5FK9 C;  2IPK D;  3BYT B;  1HXY D;  1S5B D;  1JWS D;  1PTO C;  1KTK A;  1UUP A;  2AQ2 B;  1PZI D;  4TSS A;  2XRQ D;  5D3D A;  2R61 A;  1SJE D;  2ICI A;  2AQ1 B;  1EEI D;  1B44 D;  3KLS X; 
#chains in the Genus database with same CATH topology
 4DR1 Q;  2D9U A;  1YJN A;  4EVO A;  1B7Y B;  3KDF A;  4RA8 A;  4X3U A;  3H0G H;  2ZJP A;  2K50 A;  1P8L A;  3KF8 B;  5IWA L;  2F0V A;  4NPS A;  3OWE B;  1SE4 A;  1OO9 B;  3TS0 A;  1GD7 A;  4DV1 Q;  4HSP A;  1NUC A;  1EYD A;  3I90 A;  4HED A;  5EPJ A;  5C5L A;  1KQS A;  2E76 C;  1N33 Q;  3PO3 B;  3KJO A;  1PH1 A;  2RBM A;  3A56 A;  3JC6 6;  4BBS B;  1K8M A;  4DV0 Q;  3K58 A;  1QJO A;  1EY5 A;  3F2B A;  2K01 A;  2B8F A;  4A76 A;  1VQF A;  3BZK A;  1SYG A;  1CZW A;  3VDY A;  1SFO B;  4LFA L;  1GUO A;  4PV1 C;  5JAV A;  4WJ3 M;  1PH7 A;  4QUF A;  1BNZ A;  2P5Z X;  4XTC S;  2OT2 A;  1VQ9 A;  4B9W A;  1ENA A;  4ZUI A;  5JEA G;  3F2U A;  5C0X I;  3CF5 A;  3T1Y Q;  2JA8 H;  2Q8R E;  1SE2 A;  4KI0 A;  4DV2 Q;  1HR0 W;  4JI8 L;  4ODG A;  2Z1C A;  4B3S Q;  4LUV A;  4IFD H;  4A3L H;  3TP6 A;  2O2L D;  1S4Z A;  3HKZ G;  1MI2 A;  5CBE E;  1PH2 A;  4Y7N B;  1BUV T;  4CKC A;  2R3Z A;  2KHJ A;  2Z6B A;  1DCZ A;  2KEE A;  4LF5 L;  1HUN A;  4JG2 A;  2MFI A;  1I94 Q;  4FNF A;  3WOE A;  2HDL A;  2N3S A;  4RHS A;  4F87 A;  4X65 L;  4LF9 Q;  3GTM B;  3F2C A;  4QIW E;  5M3M B;  4BY1 G;  2NBF A;  1EOV A;  2WAC A;  4F88 A;  5ELF A;  1A6X A;  3RN2 A;  1MBY A;  1CKN B;  4B3S L;  3FP9 A;  4CDD C;  1II3 A;  1VQP A;  1PVO A;  3NE5 B;  2BA1 A;  3NTK A;  3U9S A;  4OO1 I;  1SNO A;  2D5D A;  1HRJ A;  5A2Q L;  2PI2 E;  2KQ3 A;  5IGD A;  3A8J E;  4H13 C;  1O7I A;  1M8A A;  3AYH B;  2JN4 A;  1EYC A;  2OCE A;  1Q8K A;  1X65 A;  1FGU A;  1KRT A;  1RJT A;  1EIY B;  4WRD A;  4OX9 L;  3MXG A;  1H9S A;  4LF6 Q;  3CXC A;  1JOO A;  4X62 Q;  1EEI D;  1KRS A;  4BBR B;  3GTG B;  4OO1 H;  1LAB A;  1KD1 C;  2IW3 A;  4U67 3;  4G7H C;  2VL6 A;  4DNT B;  2SNM A;  2IX3 A;  1EWI A;  3RMH A;  2HCI A;  3ITP A;  4A3E H;  3PV0 A;  2WKD A;  3BU2 A;  1JOR A;  4GS3 A;  4DK0 A;  1SBB B;  1SDF A;  1V1P B;  2UXB Q;  1TS4 A;  4A75 A;  2ZJR A;  2C9O A;  4CBV A;  1K3R A;  4LK1 C;  4EQN A;  2G9H D;  4YWM A;  2EIF A;  2BE5 D;  1MIU A;  1TR5 A;  3KUP A;  4ZAI A;  1L1O A;  1OXS C;  3H15 A;  3EQL C;  1JC7 A;  1PRT F;  4B08 A;  3PQI A;  4UP7 A;  3WDN A;  1CKM A;  4DR2 Q;  2VQE L;  4GKJ L;  1HNX L;  2A6H D;  1ASY A;  3U9O A;  4BY7 B;  4DNR B;  4R4T A;  2KOL A;  2O5I C;  4A93 H;  4A3G G;  1Z6H A;  2AMC B;  2OQ0 A;  3CME A;  1QVF A;  4B3T Q;  1AW7 A;  3G6E A;  1Q3L A;  2PQE A;  5KND A;  3ER0 A;  4OXP A;  3PO3 G;  3PIO A;  5KNC A;  1PFS A;  1TWH H;  2R6G A;  4DR6 Q;  3FPU B;  1VQO A;  2RDH A;  1CM9 A;  1M4V A;  4RCO A;  1Q8I A;  3SK5 A;  4GN5 A;  3L7Z C;  3Q22 A;  1K73 C;  3LWU A;  2PNR C;  1GHK A;  3N6R A;  3I4O A;  5C4H A;  1V8Q A;  5E4X A;  3J7Y W;  2MO1 A;  2A68 D;  1CSP A;  1JIC A;  2NTT A;  3HOW B;  1NTG A;  4GOP A;  2Z4I A;  1HTL D;  3EA6 A;  2FIN B;  1HXY D;  3TZU A;  2HQL A;  1D8L A;  3TBI B;  2NVT B;  3H3V I;  4TSS A;  1KDA A;  3VA5 A;  2E8G A;  2WKC A;  1HZC A;  5D3I B;  5J1Z A;  2A69 D;  2HD3 A;  3A0J A;  3H6M A;  3NP8 A;  1Q1B A;  1WI5 A;  4DV0 L;  1C4Q A;  5J22 A;  3IFT A;  5LL6 S;  1F2L A;  1IYU A;  3ONA B;  1QE6 A;  4J15 A;  3SE0 A;  1SNP A;  2B39 A;  4IO9 A;  1BCP F;  3HOX H;  4N8F A;  3OYY A;  3AMU A;  1BVS A;  1KLG D;  1VCI A;  1I6H B;  3U4Z A;  2DN8 A;  2K4K A;  2PMZ E;  2F0L A;  2RQX A;  5CR3 A;  1GXD C;  1EY0 A;  1HZA A;  2RDG A;  5E4W C;  4DR1 L;  3GTG H;  3IKJ A;  1CI3 M;  4HID A;  2KCT A;  3GDE A;  1STH A;  3GV3 A;  4DV4 L;  1S3O A;  4ID6 A;  3NQI A;  3QIA A;  1Q7Y C;  3DHQ A;  2XIW A;  4A3E B;  3PO2 B;  1Y8P B;  1GUS A;  4CDF C;  1I4Q A;  4LF9 L;  2F0U A;  3LX0 A;  4F7X A;  2RHS B;  3I4N H;  5DM6 3;  1BDO A;  5CYU A;  1A3V A;  1QNK A;  2L55 A;  3BYY B;  1SYC A;  3CD6 A;  4JBJ A;  2F0J A;  1I4P A;  3OMG A;  1VQD A;  2F0T A;  3I7F A;  3EN2 A;  1XPU A;  1SR3 A;  1AH9 A;  1B2T A;  1DD2 A;  3CCL A;  1Y8O B;  1QNU A;  4IOA A;  4XXE A;  5CV6 A;  4B3R Q;  1X3P A;  5IP9 H;  4HAE A;  4LFB Q;  1L0X B;  2F4I A;  3I73 A;  2CW0 D;  4IJL A;  3Q23 A;  1SSO A;  4Y52 H;  1WTO A;  1F9S A;  1X54 A;  4A93 B;  1BBU A;  1Q86 C;  4CGY B;  2VQF L;  4CJ0 B;  3VR3 A;  2HQE A;  4L63 B;  2GA4 B;  2ZTC A;  1GOZ A;  2B2T A;  2FJ2 A;  2R92 G;  1U4R A;  4A4I A;  1V1O A;  4TKO B;  1TWH B;  3K81 C;  3J81 L;  1TS5 A;  2YTY A;  3T51 B;  4K2L A;  3MVV A;  1E1T A;  3W1B A;  3OTO L;  2PZT A;  1WTV A;  2CWA A;  2PW7 A;  3HOZ H;  4FF1 A;  5D3D A;  4PG3 A;  4DR5 Q;  4C1N K;  4QF4 A;  5JVH 3;  5HGQ A;  4NMZ A;  2VQF Q;  2EDG A;  1EQT A;  3T1H L;  4H02 A;  3ULP A;  1LTR D;  2Z6K A;  1N9W A;  2AWO A;  2KJX A;  2MPM A;  1FGB D;  3DM3 A;  1C48 A;  3E9I A;  3TN2 A;  4M8A A;  4DR3 Q;  4KHV A;  2Y0S G;  1BR9 A;  5C3W A;  4YHH Q;  1NSN S;  2LXJ A;  1E0B A;  1VQ4 A;  3K57 A;  3PGZ A;  3HOU H;  1QIL A;  3I91 A;  4A3F H;  1WTR A;  3IAY A;  5C4J H;  4YIJ A;  2CCZ A;  3NBI A;  3TSS A;  1PV4 A;  1FR3 A;  4X62 L;  3GTQ H;  4DV3 Q;  4V0B A;  1L2F A;  2UU9 L;  3S2H B;  1XMQ L;  3UDI A;  3NHH A;  1JWM D;  3IL8 A;  2R93 B;  1PRT D;  5EKI A;  3AFQ A;  3GQB A;  3T56 B;  3RLF A;  5GAD C;  1DOM A;  1G6P A;  1E3P A;  1EFW A;  1I6H H;  1WCM H;  1GUN A;  1VMC A;  3MXN B;  5BN5 A;  1MSG A;  3D6C A;  5D14 A;  4A3G H;  4FDB A;  1TXY A;  4RH6 A;  5HUR A;  4GKK L;  1NR4 A;  3AU7 A;  5FLX c;  3VA7 A;  2Y0S B;  1YHB A;  5BN3 A;  2EZV A;  3BVZ A;  3W3A A;  3HEJ A;  2FFK B;  4DR2 L;  3S1Q H;  4O2D A;  3S9W A;  2B2U A;  1SRU A;  3VYS A;  4DV7 L;  4DUZ Q;  3KF6 B;  1Y1V H;  4OL7 A;  3E6Z X;  3URY A;  1MD2 D;  1YJW A;  1TU2 B;  3BVG A;  4E6I A;  4GKK Q;  4HCE A;  1LT3 D;  1GO3 E;  2JP1 A;  3OPO A;  1SMX A;  4NXM L;  1I6V C;  3C3L A;  2ZTE A;  1B50 A;  4HTH A;  2NVQ B;  1NMF A;  1CKN A;  1EIH A;  1IXR A;  1TII D;  4L5T A;  2K6A A;  3D4R A;  4K8I A;  3SK4 A;  5C0X H;  1IW7 C;  1PA6 A;  4GLV B;  2R7Z G;  3C1F A;  1ONL A;  1LM0 A;  1JWS D;  2VXW A;  4LMQ D;  3Q6S A;  1A2T A;  4GN4 B;  2DGY A;  5C5M A;  4A3B B;  1LAC A;  3QO2 A;  3FVQ A;  1JJG A;  2F0D A;  3VYR A;  3A7A B;  4HJ5 A;  2ZXR A;  3HOV B;  4NP5 A;  3K7U C;  3DXJ C;  2BA0 A;  1TS2 A;  2IJ0 A;  2EYJ A;  2F0K A;  4A3I H;  2NVX B;  4LW1 A;  3UI2 A;  1D5M C;  3GTP B;  4YY3 Q;  1G6Z A;  2OXP A;  5C4X B;  2EJM A;  1MHW C;  2DY7 A;  4UAI A;  2F0I A;  2IHE A;  1S5E D;  1UE7 A;  2PW5 A;  3EJI A;  4L5R C;  1I3Q H;  1KAB A;  3P7J A;  2QA4 A;  2JYO A;  1Y69 U;  2KCN A;  4DN4 M;  5GRO A;  2PCF B;  5ELN A;  3NWT A;  3OW2 A;  5C3X A;  1S5C D;  3BG3 A;  1K0R A;  5J3B A;  5EBC A;  3P20 A;  1LT5 D;  4DV1 L;  2PMZ B;  4B3R L;  2F52 A;  1KDB A;  3J80 L;  5C4X G;  4ZKC B;  2E5L Q;  3GTJ H;  1KC8 C;  3C2P A;  1PZJ D;  3ERQ A;  5FO8 B;  3NXW A;  2JA8 G;  2QKI C;  3PUV A;  3SR1 A;  1BCP D;  3RLN A;  3GTQ B;  1YNN D;  5E3F A;  3BZD B;  1Z47 A;  2KHS A;  3HOV G;  3OIQ A;  4NXN Q;  3GTK B;  4A3D B;  3S2H H;  1U0L A;  4DFA A;  3M4Q A;  3SGI A;  4CDE C;  1TWF B;  2V4D A;  4JYA L;  3LGJ A;  5C3E B;  3MEH A;  4R4C A;  2F0F A;  1TQO A;  1DOK A;  2QF7 A;  1JT8 A;  3FKI B;  3S17 B;  4CKB A;  1VF5 C;  2RHQ B;  4DV6 Q;  1WD0 A;  2I07 B;  1L1O C;  1PXU A;  1J5E L;  4HR7 B;  1HZB A;  2F0H A;  4RCN A;  3FRP B;  2JA7 G;  2PI2 A;  3CCU A;  2A74 C;  4IPG A;  1DON A;  2ES2 A;  2EXZ A;  4QY7 A;  1IBL Q;  4HIM A;  3P1H A;  1LTI D;  3T1H Q;  1DGS A;  1WOC A;  3MXU A;  4U68 A;  1HHV A;  2K33 A;  3J7A F;  1STG A;  1CTM A;  4JI0 L;  4KK7 A;  4DAY A;  1ML0 D;  3BS1 A;  3TRE A;  4GLX A;  2CQA A;  1R4Q B;  2F0S A;  4APV A;  4DU9 A;  1RTO A;  1J6Q A;  2QEX A;  1F2Y A;  4AYB E;  2B2W A;  4MN3 A;  3VR4 A;  3H0G B;  4RAU C;  2EY2 A;  3PIO 3;  4B3M L;  1Y14 B;  2K7V A;  1HJP A;  3KLS X;  3SDZ A;  2GVA A;  1HNZ Q;  2EJG C;  4A3J G;  3K0X A;  4G7O C;  2KEN A;  1SYF A;  3KJP A;  3I70 A;  4UP9 A;  1A15 A;  2VUM B;  2F3V A;  4K6L A;  2A69 C;  1IW7 D;  3QB3 A;  2A8V A;  5M5Y H;  3MTS A;  2GVB A;  1IKL A;  3RNU A;  3W1G A;  3CKI B;  1MGS A;  2F0G A;  2K5H A;  1X3G A;  3Q8D A;  1J9O A;  4IPC A;  4PZ8 A;  3ICE A;  3CPF A;  2K5V A;  5C3E G;  1SFO H;  4YCV A;  5M5W B;  1G2S A;  1RF2 D;  4P2C B;  3FEW X;  1STY A;  4GN3 B;  1Y8N B;  1X32 A;  4OWT B;  3HOV H;  1CK1 A;  3CC2 A;  5JVG 3;  4DR3 L;  3NBH B;  2JA8 B;  3KK7 A;  3K59 A;  1SYB A;  4DUZ L;  4A3M H;  1MKH A;  2KED A;  4QQB X;  3S2D H;  1W3S A;  1ICF B;  3R93 A;  1I3Q B;  3I72 A;  3K5O A;  4DAV A;  5D65 A;  5JPM C;  2LKV A;  3GTM H;  3PF4 A;  5M3M H;  2OF1 A;  1UNS A;  1KLU D;  2X6L A;  3OHX C;  1EU4 A;  1VDZ A;  4DR7 Q;  1B9N A;  1EZ8 A;  4JI1 Q;  4QGU A;  4BS9 A;  4IUU A;  1I94 L;  4FXG C;  1YNN C;  3PSI A;  4TVA B;  1OXU A;  3F8T A;  1HFG A;  3PMF A;  3SK8 A;  3DWP A;  2ATW A;  2BE5 C;  2R92 H;  3T16 A;  1Q82 C;  3H94 A;  2IL8 A;  1K8G A;  3QWN A;  2HUG A;  2PQA A;  1AFP A;  3A8I E;  1E1O A;  1A3U A;  4C3H G;  4DR6 L;  4HN7 A;  1JE4 A;  3L3O C;  4G4K A;  2JA5 H;  2K5D A;  3SVM A;  1A2U A;  3NWS A;  5KYI A;  4MTK A;  3FMC A;  2AQ2 B;  1HNX Q;  4POF A;  1YEZ A;  1STA A;  2DJG C;  3ND8 A;  1F2Z A;  2DUD A;  4HJ7 A;  1EEF D;  1YZ6 A;  2OTJ A;  1TWA H;  1IHZ A;  2J0T D;  3ND9 A;  1VQN A;  2O5J C;  2L15 A;  4L5Q A;  4UHV A;  2F1M A;  4DPG A;  1XMO L;  5IP7 H;  4XQJ A;  4ME5 A;  1ENC A;  1G91 A;  1EIF A;  3S1R H;  2Q2T A;  4R4Q A;  2ASB A;  1VQ5 A;  2DNC A;  4A3M G;  5KGU A;  1HUM A;  4CKE A;  3W2D A;  1X3F A;  1X3E A;  2RA4 A;  3U58 A;  1T5X D;  2E2I B;  1OXX K;  4NDX A;  1ENF A;  2LY7 A;  3NK9 A;  2XSC A;  1Q81 C;  3VYT A;  2EYO A;  1FJG Q;  4YCU A;  1WTW A;  1XMO Q;  4HMJ A;  4O1N A;  1B70 B;  4AH6 A;  2VQE Q;  5JJL A;  4GKJ Q;  4S3S A;  5T1I A;  4YY3 L;  4IFD I;  1CQF A;  4DK3 C;  1D5X C;  2K32 A;  2XN9 C;  2Y0S E;  4KY6 A;  2CKZ B;  1HPC A;  1S72 A;  3JAM E;  5M5Y B;  3E0E A;  1LUZ A;  3CQZ H;  4WJ4 A;  3J7A 5;  4ZYS A;  1X9N A;  4LF7 Q;  2VUM G;  4ILW A;  2HIV A;  3D0F A;  2F4V L;  4X66 L;  1EY4 A;  3NSW A;  5CV4 A;  3CCQ A;  1RD9 D;  5M9O A;  2AQ3 B;  4A3J H;  5M5W H;  4HIK A;  4JK1 C;  1N34 Q;  4GNX B;  1R9T H;  1OXV A;  3R8B A;  1STN A;  1E2Z A;  4A3M B;  3HOU G;  4JI3 L;  2AUK A;  5JPN C;  1WTH A;  1E7Z A;  5JJI A;  3HOW G;  3S14 H;  5NUC A;  3HOW H;  2MO0 A;  5FLX L;  1HNZ L;  2QDL A;  3TZD A;  1UEA B;  5I6Y A;  5LMU Q;  1EY7 A;  4RMF A;  3KF8 A;  4DAM A;  4JYA Q;  3FDT A;  2F03 A;  2JA7 B;  5AFW A;  2NVT H;  3U4V A;  5IGC A;  4DV4 Q;  4PQX A;  1GUG A;  2K75 A;  4RGM A;  4XYO A;  1TVX A;  4ZRZ A;  2AWN A;  1KTK A;  4K0K Q;  3NEM A;  3FKI G;  4LF4 Q;  1UAP A;  2ZT9 C;  3HS0 C;  4AQY Q;  2R92 B;  1V9P A;  4KHP L;  4KKU A;  3MHB A;  3TME A;  5I4D A;  2A5H A;  3HOX B;  4C3H H;  1I50 H;  3OW7 A;  2F0E A;  1HR0 Q;  1PHJ A;  5IWA Q;  5DEH A;  4MNO A;  4ZLT F;  1XNR Q;  2JA5 B;  1AN8 A;  3I8Z A;  1MSH A;  1ZYR D;  3SK6 A;  3CC7 A;  1ASZ A;  3CMA A;  4LJZ C;  1YBY A;  2F0W A;  3AFP A;  4NW2 A;  4X3K A;  5EPL A;  1BKB A;  1ROD A;  1QZG A;  3KFU A;  3PO2 H;  3QOL A;  4X3T A;  3CCV A;  4ZQ3 A;  4O0A A;  2Z4H A;  1K0S A;  1ESR A;  2XWJ B;  3G7L A;  5I2X A;  2ZXP A;  1TWA B;  3K5M A;  4DR7 L;  4YHH L;  5IP7 G;  2JSO A;  5HGT A;  1PTO F;  2OEO A;  1HH2 P;  3HKS A;  1WYD A;  1LTL A;  4A3K B;  1W6K A;  5ELE A;  5CBA E;  3ERO A;  4JV5 L;  1ET9 A;  2K14 A;  1XMQ Q;  1MJC A;  1X56 A;  2IX0 A;  4FO2 A;  2PO4 A;  1VQI A;  1IBM L;  2LMC B;  1IL8 A;  1BF4 A;  3CCR A;  2WAQ G;  1CUK A;  1UE5 A;  5I2Y A;  3WOF A;  3A55 A;  1LTG D;  1FVI A;  5C0X G;  5ELB A;  1P16 A;  5KIX A;  4PNY A;  3HOX G;  1RCV D;  1K9M C;  1LLR D;  5IT9 c;  1D1K A;  1D5Z C;  3L9A X;  3SXH A;  3M4O B;  1VQH A;  1PRT B;  5K5P A;  2B2V C;  1PH3 A;  3KF6 A;  3BDL A;  3QJY A;  1FYC A;  4A3J B;  2NN6 I;  4RG1 A;  1W2B A;  1SMY D;  1VQG A;  3OMC A;  3MZ5 A;  1VQA A;  4AYB G;  1NBW A;  5FK9 C;  4QMG A;  4IUN A;  5DM7 3;  2R61 A;  4ALP A;  4JI7 Q;  1EUJ A;  5HY6 A;  3HFZ B;  5IE8 A;  3CCM A;  3S14 B;  1PFN A;  2CH4 A;  2ENB A;  3NQT A;  5A2Q E;  1STB A;  3HOU B;  4A3F B;  2XWB B;  1PRT C;  5IT9 L;  1L0Y B;  1JB3 A;  2ICE C;  2PQA B;  3G71 A;  2JA7 H;  5FO7 B;  3V05 A;  1WTP A;  3TDQ A;  4I7A A;  4OHJ A;  4JI2 Q;  1XNQ L;  2NVY B;  1ZXT A;  4LAA A;  4PZ7 A;  4FF3 A;  1LT4 D;  3CCE A;  3KBX A;  1NY4 A;  1SNC A;  5G3L D;  1I50 B;  1VF7 A;  3CAM A;  3LNN A;  4KY5 A;  5EPK A;  1Q90 A;  4A3G B;  4C56 C;  4AIM A;  1D2B A;  1B3A A;  2H1E A;  5CV7 A;  1LT6 D;  4HSV A;  3VYU A;  3E3X A;  1VQB A;  4HJ8 A;  3PUW A;  4ZCK A;  4I65 A;  3S1Q B;  4Z9C B;  2M2L A;  3RLO A;  3DWA A;  2UUA Q;  1PDQ A;  3I3C A;  3JAM L;  1I4H A;  1CFM A;  1NAP A;  1NR2 A;  4N8X 1;  4IAL A;  3IFD A;  2E2J B;  3NBH A;  2Q8I B;  2WB1 G;  2EYL A;  4HMI A;  2K28 A;  3MFG A;  2EY5 A;  5C6A A;  2KCM A;  2VY3 A;  4KMU C;  3TEH B;  2NVQ H;  4OON A;  4K0K L;  3V96 A;  4LF4 L;  1ZEQ X;  4X66 Q;  4A3I G;  1QVG A;  2YU9 H;  4IOC A;  3J80 c;  2CH4 W;  5GAE C;  4DXF A;  1PTO D;  1H95 A;  3E0J A;  5IOD A;  2EE1 A;  2K1B A;  2EY6 A;  1N34 L;  1XJV A;  3M9B A;  4LFA Q;  2YTX A;  1XNR L;  2Q2H A;  4PMB A;  2L12 A;  1O80 A;  1KNE A;  1GHJ A;  1ILQ A;  4DGZ A;  2E5L L;  1ZKO A;  1IYV A;  3CC4 A;  1D7Q A;  1B44 D;  1PH5 A;  3HKZ E;  1ZYR C;  4A3I B;  3M4O H;  2K5W A;  4XT3 B;  4XQQ A;  3GTP H;  3G48 A;  1E22 A;  5C4X H;  1KL9 A;  5EKL A;  4JI0 Q;  3D31 A;  4JBK A;  2HT1 A;  1CA5 A;  4OWX B;  1N32 L;  1JOQ A;  1S40 A;  2TMP A;  3PCO B;  2I5H A;  4X64 L;  2NB0 A;  2MP1 A;  2R7D A;  4BY1 H;  2C5C A;  1LYL A;  3PO2 G;  1ESF A;  2E75 C;  4H7B A;  4KD3 A;  2Q8T A;  2NZ1 D;  5LMN L;  3RN5 A;  4C3I H;  1U4M A;  2J4X A;  5JJZ A;  1EYA A;  4A3L G;  2IX1 A;  5BR8 Q;  1CSQ A;  2J7Z A;  3GTO B;  2AHO B;  1TWC H;  2K52 A;  4DR4 Q;  3RZD B;  4X64 Q;  2B2U C;  1VQM A;  1QUQ B;  1T5E A;  2JA6 B;  2JQO A;  1GKH A;  3GTK H;  4L5S A;  3KYH C;  3A74 A;  2FMM A;  5LMN Q;  1CHP D;  2K03 A;  1E2V A;  1SYD A;  2NVY H;  1TWF H;  2D0P A;  5EKK A;  3T53 B;  1EQQ A;  1VQ6 A;  4IFD J;  2RSO A;  1PH8 A;  2R93 G;  1STE A;  3HP3 A;  3FKI H;  3S17 H;  2FXQ A;  2R7Z H;  4JW0 A;  3PIP 3;  4BBS G;  1X6O A;  1O7L A;  1RKN A;  2QCP X;  3V2T A;  5K36 H;  4RGO S;  1VQE A;  1J8I A;  3GO5 A;  5T1G A;  3M3Y H;  4K5V A;  3RD4 A;  2UXB L;  4A3F G;  2G5D A;  2H4O A;  4L6T B;  1BBW A;  2D0O A;  1G29 1;  3K7A B;  1X3Q A;  4FP5 D;  1LTB D;  1VQK A;  3H0G G;  4IQZ A;  1M90 C;  3K80 C;  4JI1 L;  5LL6 X;  1SAP A;  1JJC B;  2EXD A;  4AYB B;  5FLM G;  2UXC Q;  2IPK D;  2B63 B;  3MEF A;  4R8I A;  4YWK A;  5G3L F;  1OTC A;  1CKO A;  3CCJ A;  2BCO A;  4LF6 L;  3RR5 A;  1HCZ A;  2ZTD A;  4BXX G;  4F8M A;  2L4N A;  3HRZ C;  2VUM H;  2YU9 B;  3JAM i;  1A8V A;  1WCM G;  4K5X A;  4R4I A;  3HZX A;  1D6E C;  2B8G A;  3L0O A;  4A93 G;  3EFX D;  2G9D A;  3S16 B;  1EIG A;  2D2C C;  1SE8 A;  5EGT A;  4R8N A;  1EU3 A;  4QB4 A;  5CMD A;  1I4R A;  2R7F A;  4EQ5 A;  4RFB A;  3JAM c;  5IP9 G;  1WFQ A;  1KDC A;  2VW9 A;  3ULL A;  3H09 A;  1AEX A;  1XTD A;  1EQV A;  1LTA D;  5I9O A;  1KNA A;  1YIJ A;  5CV8 A;  3S15 B;  2K5N A;  1EY8 A;  1PTO H;  2A1A A;  3CRL C;  2L5T A;  3NTH A;  3NTI A;  3S2D B;  2BOS A;  2NZO A;  2JA9 A;  1JCK B;  4POG A;  1V1P A;  1LTS D;  1TY0 A;  2NWG A;  2E74 C;  3ZJY C;  4DR5 L;  1JJ2 A;  1SJH D;  5IYC H;  1CZG A;  2NUC A;  5I6W A;  3J7Z C;  1D1I A;  5IYC G;  4CHT B;  3HG9 A;  4RGN A;  1QB5 D;  3K6O A;  1XTC D;  2RKS A;  5KNB A;  3KOJ A;  4C3I B;  2BH8 A;  5IYB G;  3ZYY X;  1ET6 A;  2HHH Q;  5IYD G;  1JWU D;  4H44 C;  5ELC A;  1HA5 A;  3AQQ A;  4DKA C;  2JA5 G;  1RIP A;  3J81 E;  2A6H C;  1EWH A;  2VB2 X;  3GTO H;  3PIP A;  1H9J A;  3QG1 A;  1LO5 D;  1XX8 A;  4QUC A;  1PYB A;  1XPO A;  1CQV A;  3D6W A;  2K05 A;  2XRS D;  4ZUJ A;  1VQJ A;  4MIU A;  4DNI A;  1EYG A;  3GP7 A;  2PZW A;  4A3B G;  4ABN A;  1EL0 A;  3H3V C;  1SRO A;  4JI5 L;  1C8C A;  3J81 i;  3D4D A;  4G57 A;  4KKS A;  2R7Z B;  3M4P A;  3AB9 A;  1IL2 A;  5JJK A;  5FKA C;  1PH6 A;  2FHT A;  3RZO H;  1GVP A;  2NN6 G;  2UXD L;  5M3M G;  3X3N A;  1EZ6 A;  4BA2 I;  3M3Y B;  5C4Z A;  3OSO A;  1HFN A;  4DK1 A;  4LF8 Q;  2ZXO A;  2F3I A;  4UP8 A;  2B29 A;  4JI5 Q;  2V1C C;  2F0Q A;  5LMU L;  1F77 A;  1Y1W B;  2EYF A;  3I4N G;  3S1R B;  2NYZ D;  1E2W A;  3STB D;  4N9T A;  5FLM H;  2IY5 B;  4QCL A;  3WWV A;  4KN4 C;  3TS2 A;  1I4G A;  4DUY L;  4KJN A;  1DOL A;  2XVS A;  4PMW A;  2L11 A;  2B2V A;  2E2I H;  1PLF A;  2SEB D;  1LV9 A;  3E9H A;  1O7Y A;  3EIV A;  5DLQ E;  2JJQ A;  5A35 A;  1TY2 A;  2JK8 A;  3PUZ A;  5GAH C;  5ISR A;  1KAW A;  2KUM A;  2X69 A;  3LWE A;  5CC4 A;  2CFM A;  2XTI A;  4IUV A;  3ERS X;  1B3Q A;  2Q2I A;  4DK6 C;  1IYJ B;  2EYH A;  2ID0 A;  1TS3 A;  2SOB A;  4J1M A;  4R9W A;  1FJG L;  5K36 G;  1XWE A;  1DYQ A;  1KIX A;  4JBW A;  3CQZ B;  4DXG A;  4PMC A;  4ULL A;  5CV5 A;  1PH4 A;  3S16 H;  2E2H B;  2NTS A;  1AZP A;  1XPR A;  4EQO A;  2ALY B;  4JBM A;  5J39 A;  2UUC Q;  3T1Y L;  2BDO A;  1V43 A;  5EBD A;  3VR5 A;  1JMC A;  1JR0 D;  3J80 i;  1C7Y A;  4XDX A;  4JOI A;  4C2M B;  5IT9 E;  2WIN B;  4AQY L;  1QWY A;  4KV6 A;  4LUO A;  1AZQ A;  1R9T B;  4UY8 C;  4H0L C;  5AJ3 L;  4A3C G;  4DAY B;  3S15 H;  1RL2 A;  3KLR A;  3R3O A;  5IGB A;  3A5Z B;  1HR0 L;  5KYL A;  1GJX A;  4FVM A;  4TRD A;  3I4M G;  3S1M B;  2Z9H A;  3M4Y A;  3GTL H;  4JOI C;  1JB7 A;  1UE1 A;  1SND A;  1QOH A;  3DMU A;  1RHP A;  3OOC A;  4N9P A;  3M85 A;  1TWG H;  4DV3 L;  1SE3 A;  3DWQ A;  1Z7T A;  5BN4 A;  1JQY D;  4KJO A;  3L2P A;  5AJ3 Q;  2M9V A;  3F2D A;  2A73 B;  3PF5 A;  1ICW A;  4X6A H;  1YJ9 A;  4HJA A;  1I4X A;  1KXL A;  3BYT B;  1S5B D;  4GLA C;  5JEA J;  1B53 A;  2VB3 X;  4DV2 L;  3EVQ A;  4C3H B;  3UDG A;  3C46 A;  5FJ8 G;  2AQ1 B;  3VR2 A;  1N33 L;  4B3M Q;  2MGS A;  1F9R A;  2Z0S A;  4EGV A;  2LS0 1;  4ME3 A;  2F0P A;  2WAQ B;  1K3B C;  1U5K A;  4BBR H;  2IT1 A;  1VQL A;  1U4L A;  2ZJQ A;  3MXP A;  3DLL A;  1IZ6 A;  5GQO A;  3ULJ A;  2UXC L;  4IPD A;  3S24 A;  1J5E Q;  1R4P B;  2RCN A;  3BDC A;  5IY0 A;  3KLS A;  4XT1 B;  4A3K G;  1VQ8 A;  1NCV A;  2Q2U A;  1PYW D;  5LHY 1;  3QR8 A;  2YTV A;  1HA6 A;  4JCV E;  4K14 A;  1JE5 A;  3UE0 A;  5M3F B;  2D62 A;  3BVM A;  1LTT D;  5L37 A;  5M3F G;  1Y1W H;  2EQS A;  3HKZ B;  4JI6 L;  2B3G A;  2B2Y A;  1L1O B;  1C9O A;  2CQO A;  2N88 A;  4IFD G;  4A3C H;  3Q24 A;  4A3K H;  4KTA A;  4RWS C;  2QGQ A;  1A63 A;  2UUB Q;  5E7N A;  2F3W A;  1C0A A;  1YIT A;  1A3T A;  2TSS A;  2H5X A;  1U4P A;  3CRK C;  2XGT A;  1AE2 A;  1T9H A;  5EJW A;  5I9P A;  4OO1 G;  2CHB D;  4JV5 Q;  1F9P A;  4B3T L;  4BY7 H;  1IBM Q;  4CJ2 C;  1JOK A;  3O13 A;  2EPB A;  2EYP A;  5DNF A;  1PMR A;  3SHL A;  5FJ8 H;  1PH9 A;  2DY8 A;  3CCS A;  1AP0 A;  4ZK9 B;  1G51 A;  4TQU S;  2K5Q A;  2E2H H;  1XYI A;  2XNA C;  4OWW B;  2L1B A;  3NPP A;  4PZ6 A;  2RDF A;  4LF8 L;  4P73 A;  2Z8L A;  1NMG A;  3CU7 A;  4C2M H;  1U9R A;  3NUC A;  2HHH L;  1Y1V G;  4I7Z C;  3PUX A;  2RCF A;  1FNW A;  1WD1 A;  5C44 G;  2WV6 D;  2VS1 A;  1Q12 A;  1KAA A;  3KBG A;  4MTN A;  4K5W A;  1B9M A;  3I4M B;  2L9H A;  1N8R C;  3D4W A;  1PZI D;  3TP5 A;  2JEA I;  2WFW A;  4C3J H;  4IZ8 A;  4MHE A;  1FL0 A;  2EYM A;  3S1M H;  3KDF B;  3GTL B;  3B6Y A;  5M5X H;  4C1N I;  3RUZ A;  2YV5 A;  2QDB A;  1WTQ A;  3OWF A;  1IBK L;  2MQH A;  2IHF A;  1B1Z A;  2NN6 H;  4WFN 3;  1ILP A;  1N36 Q;  1TT2 A;  1TWG B;  5JEA H;  2L0C A;  1BOS A;  1BO0 A;  2A68 C;  4NXN L;  1Q1E A;  1YNJ D;  1PZK D;  3EBE A;  2KVM A;  1EY6 A;  2RVL A;  1BCP B;  1SNM A;  1UEB A;  4OIJ A;  4P72 A;  1Z9F A;  2WB1 E;  4DV6 L;  4MZ9 A;  4XQN A;  3DUZ A;  5E1F A;  4DV5 L;  3U50 C;  4A3D G;  1WVL A;  3DM1 A;  1DZ1 A;  5KRU A;  1IKM A;  4YWL A;  2JA6 G;  3MC0 B;  1F9Q A;  2QIL A;  3J7A V;  4LFC Q;  4LNQ A;  5FO9 B;  2A19 A;  3I55 A;  5COR A;  1HTP A;  4BY7 G;  2NZH A;  4HJ9 A;  1EQR A;  4WJW A;  4FF4 A;  4FXK C;  1EFI D;  2WP8 J;  1NJI C;  3R2I A;  2MHV A;  3P75 A;  3G6J B;  4R4O A;  3HGB A;  2RSN A;  3BZC A;  1GM5 A;  1FNV A;  3A5U A;  5FLX E;  3MXN A;  4V19 0;  1YI2 A;  3I4N B;  3HOZ G;  2FMC A;  2E2J H;  1HQR D;  4P75 A;  1Y1W G;  1B4O A;  1PFM A;  1BXT A;  5M3F H;  3AEV A;  1GUT A;  5BR8 L;  2UUA L;  3TP7 A;  1SEB D;  3D8G A;  4UPA A;  4OEL B;  1A62 A;  4B9X A;  1DM0 B;  2MJ8 A;  4IN3 A;  4XYQ A;  1HQM C;  2JEB I;  3KLW A;  3T13 A;  1DJR D;  4Q5V A;  4IUT A;  1VQC A;  2UUC L;  1DXM A;  5GAG C;  3OIP A;  3J80 E;  1FD7 D;  4BA1 I;  4BBR G;  1S5D D;  1G8Z D;  3C1E A;  3HOY H;  4K6D A;  3I2Z A;  4Q0F A;  3DEP A;  4KY7 A;  2HDM A;  4IUR A;  1GUW A;  2OTL A;  2WAQ E;  2AUJ D;  2KCC A;  1SYE A;  3MWY W;  5H1S E;  1CA6 A;  4DR4 L;  2B2W C;  4IJH A;  1QVC A;  1HNW L;  2F4V Q;  2XRQ D;  2F0M A;  3N52 A;  4OGQ C;  3BJU A;  4J8Q A;  5IYD H;  2GN5 A;  5IYB H;  1PYS B;  2DNE A;  2PZU A;  4YCW A;  2WB1 B;  3HOZ B;  2O4X A;  3A8K E;  2I0Q A;  1YHA A;  3CW2 C;  1X55 A;  1FNU A;  3T4A C;  4JI6 Q;  1VMP A;  5LMN W;  1YNX A;  3S1N H;  4BY1 B;  4RGT A;  1HNW Q;  5KEE A;  1N32 Q;  2KEC A;  2LFN A;  2AKW B;  3I4M H;  1YHQ A;  2RF4 A;  4JVZ A;  1S5F D;  4IUQ A;  1MJE A;  3CP0 A;  3E5S A;  4RKL A;  3IRB A;  4C3J B;  1K83 B;  1QCB D;  2F0N A;  4O42 A;  5M5X B;  4EX5 A;  5C4J B;  3A54 A;  1TWC B;  5IGF A;  2M00 A;  3RZD H;  1RDP D;  3PUY A;  2MUY A;  2JA6 H;  4HCS A;  2OQK A;  3VR6 A;  2JE6 I;  3UDX A;  4BWG B;  2KA7 A;  3OTO Q;  4X65 Q;  2DJF C;  2EOT A;  2LXK A;  1VQ7 A;  4GZY C;  2R93 H;  1HZ9 A;  3K5L A;  2LSS A;  3NEL A;  1BBX C;  3H91 A;  4LFB L;  2CWP A;  1RTN A;  1Q46 A;  3K0Y A;  4CDC C;  4KHP Q;  4DA2 A;  2N78 A;  1OXT A;  2QW7 A;  1WCM B;  4K2K A;  4G7Z C;  1CT1 D;  2BH2 A;  5F2D A;  3BDO A;  4EQP A;  5COY A;  1E24 A;  3UE1 A;  4BXX H;  4JI4 Q;  2A6E C;  4GOP B;  4UDU C;  4CJ1 B;  3I56 A;  1SXT A;  3A7L A;  3K7A H;  4P74 A;  4C3J G;  4J6H A;  2UUB L;  4IUP A;  1NNX A;  2YYZ A;  2WII B;  2B63 G;  4KN7 C;  3NEN A;  3TP8 A;  4FXD A;  1WJJ A;  2K04 A;  1K28 A;  5JOB A;  5CV9 A;  4OX9 Q;  4WOR A;  5C44 H;  2I5M X;  4KLK A;  4JI8 Q;  4XIG S;  1O78 A;  4NXM Q;  1Y1V B;  1B8A A;  4KKT A;  1YVC A;  2BDN A;  1L0W A;  4FYD A;  1F2M A;  2JXM B;  4OIK A;  5IGE A;  4JI4 L;  2B63 H;  4LF5 Q;  1KHI A;  1TKW B;  1V1Q A;  3M7N A;  1BQQ T;  4R1J A;  2PNH A;  3GV6 A;  5EQ0 A;  5C0X J;  3K5N A;  4KD4 A;  1EOT A;  2QEJ C;  5DAU A;  4QL5 A;  1PTO C;  4GOP C;  3STB C;  3PO3 H;  2OWO A;  1YNJ C;  4JC0 A;  4BBS H;  4NKL A;  4GNX C;  2PPB C;  5IOC A;  1SJE D;  3G4S A;  4L8J A;  2N8N A;  3CHB D;  4LFC L;  3TRZ A;  1K8O A;  2UU9 Q;  1W6J A;  4QJF A;  5FOB B;  3HOY B;  4A3B H;  1H9S B;  4DV7 Q;  1SMY C;  1K8A C;  2MNA A;  1CHQ D;  4DF7 A;  2I46 A;  3QOJ A;  3R2T A;  2CVR A;  1EWC A;  2KHI A;  3CPW A;  3MFY A;  2C35 B;  3GD7 A;  4KHZ A;  2N49 A;  5IIF A;  2IWH A;  4JI2 L;  1XNQ Q;  5IGG A;  2NVX H;  4JI3 Q;  4ZKB B;  1IBK Q;  3I4L A;  1PTO B;  2N55 A;  2Z6K C;  2E2D C;  1BCP C;  2VZA A;  3J81 j;  4Y7N H;  3X3M A;  1SN8 A;  1N36 L;  3D3R A;  1WTX A;  4C3I G;  2KBN A;  4DUY Q;  3SEB A;  4IPH A;  1QZH A;  4OEM B;  1NE3 A;  1H9R A;  3H3V H;  4P71 A;  3S1N B;  4A3E G;  4LWC A;  3UDF A;  1G2T A;  1SLJ A;  5EAY A;  4DV5 Q;  4JI7 L;  3DEO A;  4DAP A;  2I5L X;  4QIW B;  2UXD Q;  4LF7 L;  4LUZ A;  2B2T C;  4FF2 A;  1AE3 A;  3MA2 B;  4RHR A;  5ELD A;  1K83 H;  2EY1 A;  3Q0A A;  1I5F A;  1SNQ A;  3W5O A;  3GTJ B;  1QUQ A;  1A0I A;  2CW0 C;  1M1K C;  3FPP A;  1UWV A;  3J81 c;  2VNU D;  5TSS A;  4A3D H;  4HIO A;  2ZM6 Q;  2HIX A;  1QG7 A;  3K8A A;  1H9K A;  3M7G A;  3F1Z A;  2B2Y C;  3HOY G;  2X6G A;  5CGK A;  2PYK A;  5C3E H;  1VS0 A;  2EJF C;  2A6E D;  1XXG A;  1IBL L;  1H9M A;  4RKB A;  3MAQ A;  2HCC A;  2EVB A;  3RZO B;  3FHW A;  5ELO A;  1PFB A;  3TQY A;  2SNS A;  4JPB W;  2ZM6 L;  4K8J A;  1EY9 A;  2SDF A;  1UUP A;  1UE6 A;  4M1U B;  4GNX A;  2F0O A;  2ICI A;  5C44 B;  4X3S A;  1O7Z A;  4NB3 A; 
#chains in the Genus database with same CATH homology
 2D9U A;  4EVO A;  4RA8 A;  4X3U A;  2F0V A;  3OWE B;  1SE4 A;  1OO9 B;  4HSP A;  1NUC A;  1EYD A;  3I90 A;  4HED A;  5EPJ A;  5C5L A;  2E76 C;  3PO3 B;  2RBM A;  3A56 A;  4BBS B;  1K8M A;  3K58 A;  1QJO A;  1EY5 A;  2K01 A;  2B8F A;  1SYG A;  1CZW A;  1SFO B;  1GUO A;  4PV1 C;  5JAV A;  4QUF A;  1BNZ A;  4XTC S;  2OT2 A;  4B9W A;  1ENA A;  4ZUI A;  5JEA G;  3F2U A;  5C0X I;  2Q8R E;  1SE2 A;  4KI0 A;  4ODG A;  2Z1C A;  4IFD H;  3TP6 A;  2O2L D;  1S4Z A;  1MI2 A;  5CBE E;  4Y7N B;  1BUV T;  4CKC A;  2R3Z A;  1DCZ A;  2KEE A;  1HUN A;  4FNF A;  3WOE A;  2HDL A;  4F87 A;  4RHS A;  3GTM B;  5M3M B;  2NBF A;  2WAC A;  4F88 A;  5ELF A;  1A6X A;  1MBY A;  1II3 A;  3NE5 B;  2BA1 A;  3NTK A;  3U9S A;  4OO1 I;  1SNO A;  2D5D A;  1HRJ A;  5A2Q L;  2KQ3 A;  5IGD A;  3A8J E;  4H13 C;  1M8A A;  1EYC A;  1RJT A;  4WRD A;  3MXG A;  1H9S A;  1JOO A;  1EEI D;  3GTG B;  4BBR B;  4OO1 H;  1LAB A;  2IW3 A;  4U67 3;  4G7H C;  4DNT B;  2SNM A;  2IX3 A;  3RMH A;  2HCI A;  3ITP A;  3PV0 A;  2WKD A;  1JOR A;  4DK0 A;  1SBB B;  1SDF A;  1V1P B;  1TS4 A;  2C9O A;  4CBV A;  4LK1 C;  4EQN A;  2G9H D;  2BE5 D;  1TR5 A;  3KUP A;  4ZAI A;  1OXS C;  3EQL C;  1JC7 A;  1PRT F;  4B08 A;  3WDN A;  2A6H D;  3U9O A;  4BY7 B;  4DNR B;  2KOL A;  2O5I C;  1Z6H A;  1AW7 A;  1Q3L A;  2PQE A;  5KND A;  5KNC A;  2R6G A;  3FPU B;  2RDH A;  1CM9 A;  1M4V A;  4RCO A;  1Q8I A;  3SK5 A;  3L7Z C;  3Q22 A;  3LWU A;  2PNR C;  1GHK A;  3N6R A;  5C4H A;  1V8Q A;  5E4X A;  3J7Y W;  2A68 D;  1JIC A;  2NTT A;  3HOW B;  2Z4I A;  1HTL D;  3EA6 A;  2FIN B;  1HXY D;  3TZU A;  3TBI B;  2NVT B;  4TSS A;  1KDA A;  3VA5 A;  2WKC A;  5D3I B;  5J1Z A;  2A69 D;  3NP8 A;  3H6M A;  1Q1B A;  1C4Q A;  5J22 A;  3IFT A;  5LL6 S;  1F2L A;  1IYU A;  3ONA B;  1QE6 A;  3SE0 A;  1SNP A;  2B39 A;  1BCP F;  3AMU A;  1I6H B;  1KLG D;  1VCI A;  2DN8 A;  2F0L A;  2RQX A;  5CR3 A;  1GXD C;  1EY0 A;  2RDG A;  5E4W C;  3IKJ A;  1CI3 M;  1STH A;  3GV3 A;  4ID6 A;  3NQI A;  3QIA A;  3DHQ A;  2XIW A;  4A3E B;  3PO2 B;  1Y8P B;  1GUS A;  1I4Q A;  2F0U A;  3LX0 A;  4F7X A;  5DM6 3;  1BDO A;  5CYU A;  1A3V A;  1QNK A;  2L55 A;  3BYY B;  1SYC A;  2F0J A;  1I4P A;  3OMG A;  2F0T A;  1B2T A;  1DD2 A;  1Y8O B;  1QNU A;  4XXE A;  5CV6 A;  1X3P A;  4HAE A;  1L0X B;  2F4I A;  3I73 A;  2CW0 D;  3Q23 A;  1SSO A;  1WTO A;  1F9S A;  4A93 B;  4CGY B;  4CJ0 B;  3VR3 A;  2HQE A;  4L63 B;  2GA4 B;  1GOZ A;  2B2T A;  2FJ2 A;  1U4R A;  1V1O A;  4TKO B;  1TWH B;  3J81 L;  1TS5 A;  3T51 B;  4K2L A;  3MVV A;  2PZT A;  1WTV A;  2PW7 A;  4FF1 A;  5D3D A;  4C1N K;  4QF4 A;  5JVH 3;  4NMZ A;  2EDG A;  1EQT A;  1LTR D;  2MPM A;  2AWO A;  2KJX A;  1FGB D;  1C48 A;  3TN2 A;  4M8A A;  4KHV A;  1BR9 A;  5C3W A;  1NSN S;  1E0B A;  3K57 A;  3IAY A;  1QIL A;  3I91 A;  1WTR A;  4YIJ A;  3NBI A;  3TSS A;  1FR3 A;  4V0B A;  3S2H B;  3NHH A;  1JWM D;  3IL8 A;  2R93 B;  1PRT D;  5EKI A;  3GQB A;  3T56 B;  3RLF A;  1DOM A;  1GUN A;  1VMC A;  5BN5 A;  1MSG A;  3D6C A;  5D14 A;  4RH6 A;  5HUR A;  1NR4 A;  3AU7 A;  3VA7 A;  2Y0S B;  5BN3 A;  2EZV A;  3BVZ A;  3W3A A;  3HEJ A;  2FFK B;  3S9W A;  2B2U A;  3VYS A;  4OL7 A;  3E6Z X;  3URY A;  1MD2 D;  1TU2 B;  3BVG A;  4E6I A;  4HCE A;  1LT3 D;  2JP1 A;  3OPO A;  1I6V C;  3C3L A;  1B50 A;  4HTH A;  2NVQ B;  1EIH A;  1TII D;  2K6A A;  3D4R A;  4K8I A;  3SK4 A;  5C0X H;  1IW7 C;  3C1F A;  1ONL A;  1JWS D;  2VXW A;  4LMQ D;  3Q6S A;  1A2T A;  5C5M A;  4A3B B;  1LAC A;  3QO2 A;  3FVQ A;  2F0D A;  3VYR A;  3A7A B;  2ZXR A;  3HOV B;  4NP5 A;  3DXJ C;  2BA0 A;  1TS2 A;  2IJ0 A;  2EYJ A;  2F0K A;  2NVX B;  3UI2 A;  1D5M C;  3GTP B;  1G6Z A;  2OXP A;  5C4X B;  2EJM A;  2DY7 A;  4UAI A;  2F0I A;  1S5E D;  2PW5 A;  3EJI A;  1KAB A;  3P7J A;  2JYO A;  1Y69 U;  2KCN A;  4DN4 M;  2PCF B;  3NWT A;  5C3X A;  1S5C D;  3BG3 A;  5EBC A;  3P20 A;  1LT5 D;  2PMZ B;  1KDB A;  3J80 L;  4ZKC B;  3C2P A;  1PZJ D;  3ERQ A;  5FO8 B;  3NXW A;  2QKI C;  3PUV A;  3SR1 A;  1BCP D;  3GTQ B;  1YNN D;  5E3F A;  3BZD B;  1Z47 A;  2KHS A;  3OIQ A;  3GTK B;  4A3D B;  4DFA A;  1TWF B;  2V4D A;  5C3E B;  3MEH A;  2F0F A;  1TQO A;  1DOK A;  2QF7 A;  3FKI B;  3S17 B;  4CKB A;  1VF5 C;  1WD0 A;  2I07 B;  1PXU A;  4HR7 B;  2F0H A;  4RCN A;  3FRP B;  2A74 C;  1DON A;  2EXZ A;  3P1H A;  1LTI D;  3MXU A;  4U68 A;  1HHV A;  2K33 A;  3J7A F;  1STG A;  1CTM A;  4KK7 A;  4DAY A;  1ML0 D;  3BS1 A;  2CQA A;  1R4Q B;  2F0S A;  4DU9 A;  1RTO A;  1F2Y A;  2B2W A;  4MN3 A;  3VR4 A;  3H0G B;  4RAU C;  2EY2 A;  3PIO 3;  2K7V A;  3KLS X;  3SDZ A;  2EJG C;  4G7O C;  1SYF A;  3I70 A;  1A15 A;  2VUM B;  2F3V A;  4K6L A;  2A69 C;  1IW7 D;  3QB3 A;  3MTS A;  1IKL A;  3CKI B;  1MGS A;  2F0G A;  1J9O A;  5M5W B;  1G2S A;  1RF2 D;  4P2C B;  3FEW X;  1STY A;  1Y8N B;  1X32 A;  1CK1 A;  5JVG 3;  2JA8 B;  3KK7 A;  3K59 A;  1SYB A;  2KED A;  3R93 A;  1I3Q B;  3I72 A;  3K5O A;  4DAV A;  5D65 A;  5JPM C;  2LKV A;  2OF1 A;  1UNS A;  1KLU D;  2X6L A;  3OHX C;  1EU4 A;  1VDZ A;  1B9N A;  1EZ8 A;  4BS9 A;  4IUU A;  4FXG C;  1YNN C;  1OXU A;  1HFG A;  3PMF A;  3SK8 A;  3DWP A;  2BE5 C;  3T16 A;  3H94 A;  2IL8 A;  3QWN A;  2HUG A;  1AFP A;  3A8I E;  1A3U A;  4C3H G;  4HN7 A;  1JE4 A;  3L3O C;  4G4K A;  2K5D A;  3SVM A;  1A2U A;  3NWS A;  5KYI A;  3FMC A;  2AQ2 B;  1STA A;  3ND8 A;  1F2Z A;  1EEF D;  1IHZ A;  2J0T D;  3ND9 A;  2O5J C;  2F1M A;  4XQJ A;  4ME5 A;  1ENC A;  1G91 A;  2DNC A;  5KGU A;  1HUM A;  4CKE A;  3W2D A;  2RA4 A;  1T5X D;  2E2I B;  1OXX K;  4NDX A;  1ENF A;  2LY7 A;  3NK9 A;  2XSC A;  3VYT A;  2EYO A;  1WTW A;  4HMJ A;  4O1N A;  4S3S A;  5T1I A;  4IFD I;  1CQF A;  1D5X C;  2K32 A;  2XN9 C;  4KY6 A;  1HPC A;  3JAM E;  5M5Y B;  4ZYS A;  4ILW A;  1EY4 A;  3NSW A;  5CV4 A;  1RD9 D;  5M9O A;  2AQ3 B;  4JK1 C;  1OXV A;  3R8B A;  1STN A;  1E2Z A;  4A3M B;  2AUK A;  5JPN C;  5NUC A;  5FLX L;  3TZD A;  1UEA B;  5I6Y A;  1EY7 A;  3KF8 A;  3FDT A;  2F03 A;  2JA7 B;  5AFW A;  5IGC A;  4PQX A;  1GUG A;  4RGM A;  4XYO A;  1TVX A;  4ZRZ A;  2AWN A;  1KTK A;  1UAP A;  2ZT9 C;  3HS0 C;  2R92 B;  4KKU A;  3MHB A;  3TME A;  5I4D A;  2A5H A;  3HOX B;  3OW7 A;  2F0E A;  5DEH A;  2JA5 B;  4ZLT F;  1AN8 A;  3I8Z A;  1MSH A;  1ZYR D;  3SK6 A;  4LJZ C;  2F0W A;  4NW2 A;  4X3K A;  5EPL A;  1ROD A;  3QOL A;  4X3T A;  4ZQ3 A;  2Z4H A;  1ESR A;  2XWJ B;  3G7L A;  5I2X A;  2ZXP A;  3K5M A;  1TWA B;  2JSO A;  5HGT A;  1PTO F;  2OEO A;  4A3K B;  1W6K A;  5ELE A;  5CBA E;  3ERO A;  1ET9 A;  2IX0 A;  4FO2 A;  2PO4 A;  2LMC B;  1IL8 A;  1BF4 A;  5I2Y A;  3WOF A;  3A55 A;  1LTG D;  5C0X G;  5ELB A;  5KIX A;  4PNY A;  1RCV D;  1LLR D;  1D1K A;  1D5Z C;  3L9A X;  3SXH A;  3M4O B;  1PRT B;  5K5P A;  2B2V C;  3BDL A;  3QJY A;  1FYC A;  4A3J B;  2NN6 I;  1SMY D;  3OMC A;  3MZ5 A;  5FK9 C;  4QMG A;  4IUN A;  5DM7 3;  2R61 A;  3S14 B;  1PFN A;  2ENB A;  3NQT A;  5A2Q E;  1STB A;  3HOU B;  4A3F B;  2XWB B;  1PRT C;  5IT9 L;  1L0Y B;  1JB3 A;  2ICE C;  5FO7 B;  3V05 A;  1WTP A;  3TDQ A;  4OHJ A;  2NVY B;  1ZXT A;  4LAA A;  4FF3 A;  1LT4 D;  3KBX A;  1SNC A;  5G3L D;  1I50 B;  1VF7 A;  3LNN A;  4KY5 A;  5EPK A;  1Q90 A;  4A3G B;  4C56 C;  1D2B A;  1B3A A;  2H1E A;  5CV7 A;  1LT6 D;  4HSV A;  3VYU A;  3PUW A;  4I65 A;  3S1Q B;  4Z9C B;  2M2L A;  3DWA A;  1PDQ A;  3I3C A;  3JAM L;  1I4H A;  1CFM A;  1NAP A;  1NR2 A;  4IAL A;  3IFD A;  2E2J B;  3NBH A;  2Q8I B;  2EYL A;  4HMI A;  2K28 A;  3MFG A;  2EY5 A;  5C6A A;  4KMU C;  3V96 A;  1ZEQ X;  4DXF A;  1PTO D;  3E0J A;  5IOD A;  2EE1 A;  2K1B A;  2EY6 A;  4PMB A;  2L12 A;  1O80 A;  1KNE A;  1GHJ A;  1ILQ A;  4DGZ A;  1ZKO A;  1IYV A;  1B44 D;  1ZYR C;  4A3I B;  2K5W A;  4XT3 B;  4XQQ A;  5EKL A;  3D31 A;  1CA5 A;  1JOQ A;  2TMP A;  2NB0 A;  2MP1 A;  2C5C A;  1ESF A;  2E75 C;  4H7B A;  4KD3 A;  2Q8T A;  2NZ1 D;  1U4M A;  2J4X A;  5JJZ A;  1EYA A;  2IX1 A;  2J7Z A;  3GTO B;  3RZD B;  2B2U C;  1T5E A;  2JA6 B;  2FMM A;  1CHP D;  2K03 A;  1E2V A;  1SYD A;  5EKK A;  3T53 B;  4IFD J;  2RSO A;  1STE A;  3HP3 A;  3PIP 3;  1O7L A;  1RKN A;  2QCP X;  3V2T A;  5K36 H;  4RGO S;  1J8I A;  3GO5 A;  5T1G A;  4K5V A;  3RD4 A;  2H4O A;  4L6T B;  1G29 1;  3K7A B;  1X3Q A;  4FP5 D;  1LTB D;  4IQZ A;  5LL6 X;  1SAP A;  4AYB B;  2IPK D;  2B63 B;  4R8I A;  5G3L F;  2BCO A;  1HCZ A;  4F8M A;  2L4N A;  3HRZ C;  2YU9 B;  4K5X A;  3HZX A;  1D6E C;  2B8G A;  3EFX D;  2G9D A;  3S16 B;  1EIG A;  2D2C C;  5EGT A;  4R8N A;  1EU3 A;  4QB4 A;  5CMD A;  1I4R A;  4RFB A;  1KDC A;  3H09 A;  1AEX A;  1EQV A;  1LTA D;  5I9O A;  1KNA A;  5CV8 A;  3S15 B;  1EY8 A;  1PTO H;  3CRL C;  3NTH A;  2L5T A;  3NTI A;  3S2D B;  2BOS A;  1JCK B;  1V1P A;  1LTS D;  1TY0 A;  2NWG A;  2E74 C;  1SJH D;  1CZG A;  2NUC A;  5I6W A;  1D1I A;  4CHT B;  3HG9 A;  4RGN A;  1QB5 D;  3K6O A;  1XTC D;  2RKS A;  5KNB A;  4C3I B;  3ZYY X;  1ET6 A;  1JWU D;  4H44 C;  5ELC A;  1HA5 A;  3J81 E;  2A6H C;  1EWH A;  2VB2 X;  1H9J A;  3QG1 A;  1LO5 D;  1XX8 A;  4QUC A;  1CQV A;  3D6W A;  2K05 A;  2XRS D;  4ZUJ A;  4MIU A;  3GP7 A;  2PZW A;  4ABN A;  1EL0 A;  3H3V C;  1C8C A;  3D4D A;  4G57 A;  4KKS A;  2R7Z B;  3AB9 A;  5FKA C;  2FHT A;  2NN6 G;  3X3N A;  1EZ6 A;  4BA2 I;  3M3Y B;  5C4Z A;  3OSO A;  1HFN A;  4DK1 A;  2ZXO A;  2F0Q A;  1F77 A;  1Y1W B;  2EYF A;  3S1R B;  2NYZ D;  1E2W A;  4N9T A;  4QCL A;  4KN4 C;  1I4G A;  4KJN A;  1DOL A;  2XVS A;  4PMW A;  2L11 A;  2B2V A;  1PLF A;  2SEB D;  1LV9 A;  1O7Y A;  5A35 A;  1TY2 A;  3PUZ A;  5ISR A;  2KUM A;  2X69 A;  3LWE A;  5CC4 A;  4IUV A;  2EYH A;  2ID0 A;  1TS3 A;  2SOB A;  4J1M A;  4R9W A;  5K36 G;  1XWE A;  1DYQ A;  4JBW A;  3CQZ B;  4DXG A;  4PMC A;  4ULL A;  5CV5 A;  2E2H B;  2NTS A;  1AZP A;  4EQO A;  5J39 A;  2BDO A;  1V43 A;  5EBD A;  3VR5 A;  1JR0 D;  4XDX A;  4C2M B;  5IT9 E;  2WIN B;  1QWY A;  4KV6 A;  1AZQ A;  1R9T B;  4H0L C;  3KLR A;  3R3O A;  5IGB A;  5KYL A;  1GJX A;  4FVM A;  4TRD A;  3S1M B;  3M4Y A;  1SND A;  1QOH A;  3DMU A;  1RHP A;  3OOC A;  4N9P A;  3M85 A;  1SE3 A;  3DWQ A;  1Z7T A;  5BN4 A;  1JQY D;  4KJO A;  2M9V A;  2A73 B;  1ICW A;  1I4X A;  3BYT B;  1S5B D;  5JEA J;  1B53 A;  2VB3 X;  3EVQ A;  4C3H B;  3C46 A;  2AQ1 B;  3VR2 A;  2MGS A;  1F9R A;  4EGV A;  2LS0 1;  2F0P A;  2WAQ B;  2IT1 A;  1U4L A;  3MXP A;  1R4P B;  3BDC A;  3KLS A;  4XT1 B;  1NCV A;  1PYW D;  5LHY 1;  1HA6 A;  4K14 A;  5M3F B;  2D62 A;  3BVM A;  1LTT D;  3HKZ B;  2B2Y A;  2N88 A;  4IFD G;  3Q24 A;  4KTA A;  4RWS C;  2F3W A;  1A3T A;  2TSS A;  1U4P A;  3CRK C;  5EJW A;  5I9P A;  4OO1 G;  2CHB D;  1F9P A;  4CJ2 C;  1JOK A;  3O13 A;  2EPB A;  2EYP A;  5DNF A;  1PMR A;  3SHL A;  2DY8 A;  1AP0 A;  4ZK9 B;  4TQU S;  2K5Q A;  1XYI A;  2XNA C;  2L1B A;  3NPP A;  2RDF A;  2Z8L A;  3CU7 A;  1U9R A;  3NUC A;  4I7Z C;  3PUX A;  1FNW A;  1WD1 A;  2WV6 D;  1Q12 A;  1KAA A;  3KBG A;  4K5W A;  1B9M A;  3I4M B;  2L9H A;  3D4W A;  1PZI D;  3TP5 A;  2JEA I;  4IZ8 A;  4MHE A;  2EYM A;  3GTL B;  4C1N I;  3RUZ A;  2QDB A;  1WTQ A;  3OWF A;  1B1Z A;  2NN6 H;  4WFN 3;  1ILP A;  1TT2 A;  1TWG B;  5JEA H;  2L0C A;  1BOS A;  1BO0 A;  2A68 C;  1Q1E A;  1YNJ D;  1PZK D;  2KVM A;  1EY6 A;  2RVL A;  1BCP B;  1SNM A;  4OIJ A;  4XQN A;  3DUZ A;  5E1F A;  1WVL A;  3DM1 A;  1DZ1 A;  5KRU A;  1IKM A;  3MC0 B;  1F9Q A;  2QIL A;  3J7A V;  5FO9 B;  5COR A;  1HTP A;  4WJW A;  4FF4 A;  4FXK C;  1EFI D;  2WP8 J;  3R2I A;  2MHV A;  3P75 A;  3G6J B;  3HGB A;  2RSN A;  1FNV A;  5FLX E;  3MXN A;  4V19 0;  3I4N B;  2FMC A;  1HQR D;  1B4O A;  1PFM A;  1BXT A;  1GUT A;  3TP7 A;  1SEB D;  3D8G A;  4B9X A;  1DM0 B;  2MJ8 A;  4IN3 A;  4XYQ A;  1HQM C;  2JEB I;  3T13 A;  1DJR D;  4Q5V A;  4IUT A;  1DXM A;  3OIP A;  3J80 E;  1FD7 D;  4BA1 I;  1S5D D;  1G8Z D;  3C1E A;  4K6D A;  4Q0F A;  3DEP A;  4KY7 A;  2HDM A;  4IUR A;  1GUW A;  2AUJ D;  2KCC A;  1SYE A;  3MWY W;  1CA6 A;  2B2W C;  2XRQ D;  2F0M A;  3N52 A;  4OGQ C;  4J8Q A;  2DNE A;  2PZU A;  2WB1 B;  3HOZ B;  2O4X A;  3A8K E;  1FNU A;  3T4A C;  1VMP A;  4BY1 B;  4RGT A;  5KEE A;  2KEC A;  2LFN A;  1S5F D;  4IUQ A;  3E5S A;  4RKL A;  4C3J B;  1K83 B;  1QCB D;  2F0N A;  4O42 A;  5M5X B;  5C4J B;  3A54 A;  1TWC B;  5IGF A;  2M00 A;  1RDP D;  3PUY A;  2MUY A;  4HCS A;  3VR6 A;  2JE6 I;  4BWG B;  2KA7 A;  2EOT A;  4GZY C;  3K5L A;  1BBX C;  3H91 A;  1RTN A;  3K0Y A;  4DA2 A;  1OXT A;  1WCM B;  4K2K A;  4G7Z C;  1CT1 D;  5F2D A;  3BDO A;  4EQP A;  5COY A;  2A6E C;  4UDU C;  4CJ1 B;  1SXT A;  3A7L A;  4C3J G;  4J6H A;  4IUP A;  2YYZ A;  2WII B;  4KN7 C;  3TP8 A;  4FXD A;  2K04 A;  5JOB A;  5CV9 A;  4WOR A;  4XIG S;  1O78 A;  1Y1V B;  4KKT A;  2BDN A;  4FYD A;  1F2M A;  2JXM B;  4OIK A;  5IGE A;  1TKW B;  3M7N A;  1BQQ T;  3GV6 A;  5EQ0 A;  5C0X J;  3K5N A;  4KD4 A;  1EOT A;  2QEJ C;  5DAU A;  1PTO C;  1YNJ C;  4NKL A;  2PPB C;  5IOC A;  1SJE D;  4L8J A;  3CHB D;  1K8O A;  1W6J A;  5FOB B;  3HOY B;  1H9S B;  1SMY C;  1CHQ D;  4DF7 A;  2I46 A;  3QOJ A;  3R2T A;  2CVR A;  1EWC A;  3MFY A;  3GD7 A;  4KHZ A;  5IIF A;  2IWH A;  5IGG A;  4ZKB B;  3I4L A;  1PTO B;  2N55 A;  2E2D C;  1BCP C;  3X3M A;  3D3R A;  1WTX A;  4C3I G;  3SEB A;  1H9R A;  3S1N B;  1G2T A;  3DEO A;  4DAP A;  4QIW B;  2B2T C;  4FF2 A;  3MA2 B;  4RHR A;  5ELD A;  2EY1 A;  3Q0A A;  1SNQ A;  3GTJ B;  2CW0 C;  3FPP A;  2VNU D;  5TSS A;  1QG7 A;  1H9K A;  3M7G A;  2B2Y C;  2X6G A;  5CGK A;  2PYK A;  2EJF C;  2A6E D;  1XXG A;  1H9M A;  4RKB A;  3MAQ A;  2HCC A;  2EVB A;  3RZO B;  1PFB A;  2SNS A;  4K8J A;  1EY9 A;  2SDF A;  1UUP A;  4M1U B;  2F0O A;  2ICI A;  5C44 B;  4X3S A;  1O7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...