4BWGB

Structural basis of subtilase cytotoxin subab assembly
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
95
Chain Sequence
b'VVITQFHTGQIDNKPYFCIEGKSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBA
molecule tags Toxin
source organism Escherichia coli
publication title Structural Basis of Subtilase Cytotoxin Subab Assembly.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 99
chains with identical sequence C, D, E, F, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4bwgB00
1HTLD 3DWQA 3CHBD 1DJRD 5FK9C 2AQ3B 1PTOD 2RDGA 2O2LD 5ELEA 1CK1A 1L0XB 1SE4A 1FGBD 1PRTC 1UNSA 2SEBD 1SJED 1PYWD 4DXGA 1LTRD 1CHQD 3TSSA 1STEA 3GP7A 1BXTA 3KLSX 1D6EC 1EEFD 1RD9D 5ELCA 3DWAA 1RCVD 1QILA 1PTOC 1EU3A 1KTKA 4RFBA 4L63B 1JWMD 1S5ED 3DWPA 1SJHD 2TSSA 1M4VA 1TS3A 4OHJA 1JWUD 3SEBA 1D5ZC 3BYYB 1LLRD 4RHSA 3BZDB 1V1OA 1LO5D 2CHBD 1ET9A 3BVGA 1CT1D 2IPKD 5FKAC 5I4DA 4UDUC 3MFGA 1SBBB 1PRTB 3V05A 1I4RA 1TS5A 1TS4A 1I4HA 1PRTD 4L6TB 1FD7D 1LTTD 4RGTA 1B1ZA 1EFID 1I4XA 2NTTA 2R61A 4RHRA 2Z8LA 5D3DA 5ELFA 1PTOB 4RCOA 1HA5A 1XXGA 1BCPB 1HXYD 1TS2A 1D5MC 2XN9C 1EU4A 4K6LA 4Z9CB 1S5DD 1SE3A 1LT3D 3R2IA 1I4GA 1AN8A 1FNWA 4ZYSA 1V1PB 1JWSD 3BVZA 4RGOS 4RGNA 1BCPD 1S5BD 1PTOH 1B44D 1JCKB 5ELDA 1JQYD 1LTGD 1F77A 1SXTA 3EA6A 1ENFA 3O13A 1KLUD 4O1NA 1BCPF 1I4QA 1RDPD 5D3IB 1LTBD 1T5XD 1LT4D 2G9HD 3BVMA 1D5XC 1PZKD 1SE2A 2AQ1B 2J4XA 1ESFA 3BYTB 1KLGD 1S5CD 3URYA 4RGMA 4C56C 4RH6A 2RDHA 1PZJD 1HQRD 1LT6D 1DYQA 1PTOF 3OWEB 2ICIA 1CHPD 3MC0B 1S5FD 3R8BA 1BCPC 4TSSA 2NTSA 1LT5D 1G8ZD 2XRSD 1PRTF 4BWGB 2QEJC 1XTCD 1MD2D 1SEBD 5ELBA 1TY0A 1RF2D 1CQVA 1ET6A 1FNVA 1JR0D 2QILA 2XRQD 3W2DA 2WV6D 5TSSA 1LTID 1EEID 1EWCA 1TY2A 1LTSD 1UUPA 1AW7A 2XNAC 1V1PA 1PZID 4DXFA 1L0YB 2IJ0A 1FNUA 1GOZA 1LTAD 2AQ2B 3EFXD 3R2TA 1I4PA
chains in the Genus database with same CATH superfamily
3PQIA 4DN4M 3S24A 2ZM6L 4QIWB 3I55A 4LF9L 3KF6A 2I46A 5ELEA 1WTHA 3G71A 5CV9A 1HFGA 3UDIA 4JI4Q 2CFMA 1BKBA 1YNNC 1Q3LA 3F2UA 3W1GA 3CCEA 4LK1C 3I4MB 1F9SA 2HIXA 2IX1A 5I9PA 1PH7A 3S2HH 4ID6A 3I4OA 4OGQC 1STAA 4QJFA 2OQ0A 3OMGA 5IGEA 3TBIB 3CC4A 2CHBD 1WFQA 1Y1WG 1YNJC 3T1YQ 3A8KE 1MSGA 2Y0SG 3C1EA 3MEFA 5CBEE 5GAEC 3GTQH 4RGTA 1B1ZA 1K0RA 1YNND 1ZYRD 1MHWC 4R1JA 4GN5A 1E2VA 3DEPA 5ELFA 1JJCB 2JA6G 2L55A 3S17H 4MIUA 4XDXA 5E7NA 2JA5G 4HSPA 4KHVA 2GN5A 2KJXA 2PCFB 4DKAC 4B3RQ 1MKHA 3C2PA 3VYRA 4DR6L 4XYQA 4KK7A 3MXNB 3B6YA 4FXGC 1WVLA 1I4QA 2SNSA 2NUCA 1PH3A 4E6IA 4KI0A 3J81L 2K50A 2LSSA 4IURA 2JA7H 1VDZA 1TT2A 5GADC 4S3SA 3TN2A 1LACA 4ALPA 4L5RC 4QB4A 4A93B 2SDFA 2ZXRA 1QG7A 2ID0A 1XTCD 2LS01 2QEJC 3U4ZA 3DM3A 3X3NA 1HNXL 4A3GB 1HZ9A 1E2WA 2BH2A 5JOBA 3W2DA 3FKIH 2PZWA 5DM63 3HOUH 4LF6Q 1WOCA 1PDQA 1AW7A 5DNFA 3J81i 3F2DA 3HOVG 4A3FB 2B29A 4N9PA 1O7YA 3CKIB 5M5WH 5HGQA 2WB1B 1I6HB 1WI5A 1KDBA 4XYOA 1E24A 2FINB 1CK1A 5FOBB 3T1YL 4BXXH 3M4YA 4CGYB 4ZLTF 2HT1A 1SJED 5IT9E 4DV6L 1JE5A 2HDLA 1I3QB 3BDOA 5C3EG 4DUZL 2EJGC 2MPMA 4JBWA 3KBXA 1DOKA 1EU3A 1IZ6A 1U4LA 3V96A 2K04A 2DY7A 2XWBB 1SJHD 1GD7A 2QA4A 5KNBA 3HOYB 1DOMA 4C1NK 4TKOB 4GNXB 5FLXL 1H9SB 4JBMA 4DV2Q 2F3WA 3LX0A 3M3YH 3AMUA 3QR8A 2ZTDA 1QNKA 1SE8A 3D4WA 4TRDA 1SBBB 5K5PA 2NN6H 2RSOA 5EJWA 2ZM6Q 1VMPA 3NBHA 4MTKA 3E6ZX 4OONA 1L1OC 3G48A 3PIOA 2ZJQA 2NVYB 3DM1A 2LKVA 4V0BA 1RL2A 1V1PB 1LTLA 1RKNA 2KENA 4J15A 4DR2L 4IFDJ 4DAVA 1HNWQ 2VQFL 1C9OA 5JJLA 3AFPA 5C44H 3CCLA 1Z7TA 1WTXA 1YITA 2MO0A 5C5MA 2EDGA 2C9OA 4XTCS 2BH8A 2ENBA 5BN3A 5CV4A 3RZDB 2E76C 1A62A 4A3MB 2R7DA 1SYFA 4K6DA 1KC8C 4HIKA 5KGUA 4MTNA 4LFAQ 4RGMA 1SYGA 1HQRD 1VQDA 4DUZQ 4O2DA 2K5QA 4NMZA 4P71A 1EL0A 5FLMH 3CAMA 1DZ1A 2HQEA 2DUDA 2F0QA 4QF4A 1J5EQ 2PI2A 1EZ8A 4B3MQ 3S1QB 5ELBA 2QW7A 1TXYA 5IE8A 3IKJA 2B2YC 2L4NA 1XJVA 1YHQA 2HIVA 4DV4Q 3S1RB 4LF8Q 1ET6A 1YI2A 2KCTA 3TP6A 1TY2A 5FJ8H 2F3VA 3HOZB 1PYSB 2ALYB 4C3JG 4BBRG 3I73A 3TEHB 4DNRB 4CKCA 3HOWB 3TP5A 2B8GA 1Y8PB 2MHVA 3EROA 1HNXQ 1ICFB 2DY8A 5E4XA 5KNDA 4K2LA 2R7ZB 1J8IA 1FGBD 2A6HC 2P5ZX 4K5WA 1X9NA 2WB1G 2OXPA 1BXTA 3ULLA 4IUQA 1D6EC 1D8LA 5EPKA 3S14B 1B8AA 1PTOC 3S2DH 1YZ6A 5C3WA 3ITPA 2EYFA 4IUVA 3DWPA 1YHAA 1E7ZA 5JJZA 4TVAB 2B3GA 2OCEA 4QGUA 1IBKL 2K28A 2WKCA 5CYUA 4NW2A 4KJOA 4OWTB 3HKZE 3NE5B 2MGSA 1TWAB 4HIDA 5G3LD 4BY1B 2QGQA 4YCWA 1HA6A 3EBEA 5M5XB 4RWSC 2XIWA 2R61A 2K6AA 1BBWA 3A0JA 4X66Q 2R3ZA 2PO4A 1OXXK 1II3A 1XMQQ 4IFDH 1X3PA 2KHJA 4HJ9A 2WACA 5HY6A 3KOJA 4R4IA 2F0OA 3JC66 5IGCA 4FF2A 2JA6H 5GAGC 2E2JH 1PFSA 3FP9A 2JA5H 3PO3G 4DR1Q 2G5DA 3SXHA 1OXTA 1N9WA 1CKNA 3NWTA 5FO8B 1JCKB 2XGTA 1CFMA 4N8X1 2BDOA 4JI8L 2IT1A 3EA6A 2UUCQ 3I7FA 2F1MA 4A3EH 1JB7A 2PQEA 1JC7A 2FMCA 1AH9A 3HOVB 1SNQA 1EY9A 4L5SA 5JJKA 1PZJD 3PF4A 4P72A 1PTOF 3H0GG 4FXKC 4AQYQ 1S72A 3A8IE 3K7AH 5DAUA 1S5FD 1B3AA 2EY2A 2PI2E 2QCPX 5IYBG 3SE0A 3D3RA 2RQXA 4NXML 2JA7G 2VUMG 1I50B 1Q86C 3Q23A 4BY7B 5K36G 4N8FA 2Q8IB 4G7OC 2UXBQ 2ZJPA 4LF5L 5NUCA 4JCVE 2JP1A 4Y7NB 2PMZB 2CH4A 5FO7B 1DOLA 1IHZA 4WJWA 3I4NB 4X3UA 3DWQA 5FK9C 5C4ZA 1PTOD 1AZQA 3NTKA 2VB3X 1VQLA 5CV8A 4IQZA 1EY0A 4UP7A 5D14A 1YEZA 1VQ7A 3TSSA 1CA5A 1EWHA 2F0FA 2KOLA 4C2MB 4TQUS 3GQBA 2NVTH 2N8NA 1TWCH 5C3EH 4JV5L 4LF5Q 4B3SL 3NPPA 1D5ZC 2K5HA 1EIGA 4IJLA 3MXUA 1O80A 2OF1A 5I4DA 1GUNA 4UDUC 1PFBA 2NZ1D 4PMBA 2D9UA 2E2IB 3GO5A 5JVH3 3V05A 4GOPB 3DXJC 4RKBA 1WTWA 2CKZB 2NTTA 4KN4C 4LW1A 1BUVT 3A5UA 1VQEA 2UXCQ 2RHQB 5EAYA 3I4MG 4DAYB 3IL8A 5M3MH 2F0SA 5M3MB 2K5NA 2R93H 1GUOA 4L5QA 4MHEA 3RMHA 2L11A 4N9TA 4FF4A 1VQ8A 3QJYA 1F2ZA 2F0LA 5D65A 2E2DC 3ULJA 1SFOB 3CCSA 3L9AX 4C3HG 2RKSA 3NWSA 2B2WA 5IT9L 4POFA 4O1NA 1RDPD 1IW7D 3I3CA 2E5LQ 4M8AA 4DV7L 2H1EA 1N32Q 4H02A 2HHHL 3TP8A 1T9HA 1Q81C 2RDHA 3UE0A 4BA2I 2OWOA 2JSOA 4CHTB 3E5SA 2RHSB 1PH9A 4PG3A 4PQXA 1N33L 4DR7L 2V4DA 4X3TA 1A0IA 3PO2B 1G2TA 1GHJA 5FLMG 4ME5A 4C3IB 5AJ3Q 1QWYA 1TY0A 3H09A 2R92H 2UXDL 2ZT9C 1IBKQ 4P2CB 2VB2X 4KLKA 2TMPA 2NBFA 3WOFA 1KRSA 4KTAA 1L0YB 1LTAD 4GLAC 4DV7Q 3T1HL 4B9XA 2PZTA 3T13A 2VZAA 3E3XA 1ASYA 2L9HA 1NR2A 4PZ8A 3DHQA 1F2YA 2EYLA 3ULPA 4BY7H 2JXMB 2B2UA 3W1BA 2QF7A 1KDCA 1R9TB 3S1MH 3M4OB 3WDNA 4HJAA 4P74A 1LTRD 3J81c 1VQOA 5AJ3L 4BS9A 1FR3A 1NMGA 1QILA 5EQ0A 4LFCL 3LWUA 5C4XH 3K7AB 3A8JE 5L37A 4NKLA 1M4VA 3VA5A 4NB3A 4DV4L 1H9JA 1SSOA 3NTIA 3BVGA 2AUJD 2E2HB 1E22A 1KHIA 3CRLC 1SMYC 1J5EL 4KHPL 3J80E 4JI0L 2I5MX 3W3AA 4R4CA 1KAAA 4KKSA 1K3RA 4L6TB 2K03A 3S1MB 4A3DB 1LTTD 2O5IC 2HCIA 3CPWA 3PF5A 2MP1A 4RCOA 1A2UA 4JOIC 5M9OA 4JV5Q 1D1IA 1TR5A 3M7NA 2F0PA 4A75A 2K7VA 1EU4A 1VF5C 1HZCA 1TWFH 4IFDG 2YV5A 4ZUJA 4YCUA 3KF6B 1F9RA 4HEDA 1N34L 4LF4L 2Q2UA 5IP7H 5LMUQ 4A3BH 1FJGL 1IL8A 2MQHA 2O5JC 2F0DA 1AFPA 3NK9A 4C3IH 4Y52H 3HOXB 2KHIA 4XIGS 3PO2H 1KLUD 5CV7A 1RTOA 3FHWA 2CVRA 3CF5A 4X62L 3VR6A 5I2YA 2B2VC 4DK1A 1A6XA 3BYTB 1KLGD 1RIPA 4JVZA 4GLXA 2L12A 4MZ9A 2DJGC 5AFWA 2ICIA 5J22A 3LGJA 3OIPA 4OIJA 1SNMA 3NQIA 3S2DB 2B2VA 1MJEA 1G8ZD 5KRUA 1STYA 1IBML 2IX3A 2F3IA 2A6HD 1HUMA 3AFQA 4IJHA 4FXDA 2EPBA 1SFOH 5JEAG 4I7AA 1CQVA 1VCIA 1KABA 4QY7A 1EY7A 4A76A 3CCJA 3J80i 4OO1H 2VQEQ 1RJTA 3HOZH 1TWGB 3OIQA 3FEWX 2MJ8A 1SLJA 4UAIA 5BN4A 1C48A 1SROA 3ER0A 3KYHC 4JI8Q 1XNQL 5IWAL 3PO3H 2FHTA 1EIYB 1Q46A 4X3SA 4JI6L 1UNSA 3Q0AA 1BQQT 2SEBD 4LFBL 3M4PA 1TWHH 5M3FG 3GP7A 1QOHA 3HOXG 1L0WA 2VQEL 1L1OA 1KNAA 4GKKL 1U9RA 2A1AA 3ND9A 5GAHC 4IPHA 4LF6L 2D2CC 2JYOA 2NB0A 4ZAIA 2VXWA 3MHBA 1PH6A 4LF7L 4IPCA 1TWCB 1K9MC 2NVTB 1XMOQ 3FVQA 1MJCA 1CT1D 5I6YA 1B53A 4C2MH 5LHY1 2A69C 1X55A 1CSQA 4RAUC 1VQNA 1A8VA 5T1GA 1VQPA 1V9PA 2KUMA 1Z6HA 2Z6KC 2NWGA 1GO3E 3KLWA 4KY7A 5IP9G 1IKLA 3NP8A 3SK6A 4JK1C 1GUGA 1KDAA 5E1FA 2M2LA 4C1NI 1QZHA 5D3DA 1F2LA 3KJPA 1BO0A 2UUCL 4RG1A 3BG3A 1VF7A 3I4NH 3HGBA 3F2CA 1B4OA 1LT3D 4Y7NH 2X6LA 2N88A 1JWSD 5M5YH 1HNZQ 1NJIC 1PTOH 2O4XA 3MEHA 4HSVA 1IYVA 4GKJL 2PYKA 1JOQA 2BDNA 1LTGD 4JPBW 4DU9A 1F2MA 1FJGQ 1NE3A 2E74C 1I50H 1G291 4WJ3M 5D3IB 1WCMH 1LT4D 3M3YB 1HJPA 2J4XA 3A5ZB 4OO1I 3EIVA 3E9HA 4EGVA 2HQLA 1TKWB 2B63H 3SK4A 2PMZE 1LM0A 2L5TA 4YHHQ 1D7QA 2GA4B 3HEJA 4C3JB 3SVMA 1LT5D 1I94Q 2K14A 1PRTF 2UUBQ 1ZXTA 2UUBL 1WJJA 3K0XA 4K5XA 4DV5Q 1HFNA 3OPOA 1I6HH 3RN2A 2R6GA 4J8QA 5M5WB 1EWCA 2C5CA 1SAPA 4K8IA 1HCZA 1I5FA 1PV4A 3OSOA 1EYGA 1IYUA 2Z1CA 3KK7A 4AYBG 1J6QA 4UPAA 5M3MG 4HMJA 3CHBD 2QEXA 4JI5Q 1U4RA 2AQ3B 3D6CA 1QVGA 3GV6A 1L0XB 3NUCA 4IUPA 1HNWL 2PW5A 1NY4A 3QG1A 1CKOA 2Z0SA 3T53B 4A3MG 3ERSX 1TWAH 1JOKA 4ZKCB 3VYSA 2PW7A 1E3PA 5ELCA 1BR9A 4FNFA 3D4RA 2L0CA 4X65Q 5I2XA 3HG9A 3HRZC 3NTHA 5EKLA 2XVSA 5EKIA 3F2BA 3UE1A 5C0XH 3G6JB 4JI7Q 2PPBC 2A8VA 1HTPA 2DN8A 4DR7Q 4DR5Q 1I4RA 4R8IA 1TS4A 2R7ZH 1SYBA 1F9QA 1Q7YC 1EFID 4LF7Q 1ZYRC 3M4QA 4HTHA 1PA6A 1UAPA 2Z8LA 3LWEA 1W6JA 3CPFA 2M9VA 4DR3Q 2XN9C 4Z9CB 2BA1A 3CXCA 1WD1A 3BDLA 2JA9A 3S17B 3W5OA 3PMFA 5E4WC 2D0PA 4YCVA 4GS3A 5IYCG 1KQSA 2F4VQ 4L5TA 1L2FA 5ELDA 1JQYD 3JAML 1PMRA 2K75A 3H3VC 4U68A 1QE6A 3MWYW 2EOTA 3IAYA 1T5XD 1Y8NB 1JB3A 1SNOA 1BOSA 1NSNS 2DGYA 5ELNA 4DV1Q 3UDGA 2EZVA 1X6OA 4DK6C 1IBLQ 3S2HB 3FDTA 5C4XG 1VQFA 2VL6A 1SYDA 3PUXA 1MBYA 1L1OB 1P8LA 2EQSA 3RZDH 1Z9FA 1YJNA 5IGFA 1XNRQ 1AE2A 2AKWB 3PGZA 1SNDA 3C46A 2QILA 2RVLA 2Z9HA 1JR0D 2WAQB 3H94A 3FMCA 2VUMB 4KKTA 5CC4A 1EEID 4HJ5A 3K5MA 3K0YA 4DR3L 4KHPQ 4FVMA 2RF4A 2B2WC 1X3FA 1S40A 4DXFA 4B3TL 2YTXA 3J7A5 3EFXD 1IW7C 4MN3A 5IOCA 1UE7A 5FLXE 1I4PA 3K5OA 3U9OA 1CQFA 2LFNA 2RDGA 3A54A 3RLNA 3HOZG 2IL8A 5IP7G 5LMUL 1K83H 1GUTA 1N34Q 4C3IG 4HCEA 1Y14B 4DR4Q 3L0OA 4ZK9B 5C0XJ 1S5ED 1X3QA 2KCNA 1M90C 3ERQA 3HOYH 4F7XA 4DR1L 2B63B 5IGDA 3R93A 4RHSA 5LMNW 1EFWA 4WRDA 5FLXc 4OIKA 1S3OA 1AZPA 2CH4W 4DF7A 4JI2Q 2KQ3A 1PRTB 3V2TA 4IN3A 1K83B 4A3EG 2I5LX 1JMCA 5DM73 4IUTA 1MSHA 1U4MA 2RDFA 1PTOB 1OXSC 5IT9c 1BCPB 3J81E 1TS2A 3K5LA 4P75A 4G7ZC 1K3BC 2Q2IA 4OO1G 4LWCA 4IUUA 3BVZA 4RGOS 1EQQA 1NBWA 3PUWA 2BOSA 2VUMH 1B44D 1S4ZA 3U4VA 1D2BA 3I72A 3IRBA 3CQZB 3P1HA 4HCSA 3FKIG 1WTOA 2K33A 1VMCA 4A3GH 1N32L 3F8TA 4AYBB 2YYZA 4A93H 3OTOQ 3OW7A 1D5XC 1PZKD 1FGUA 3A74A 1BNZA 2LY7A 1EIHA 2JJQA 2F0IA 1A2TA 4YIJA 1QJOA 1WCMG 3HP3A 3MVVA 4B08A 4YWKA 2Q8RE 2WFWA 3GD7A 3PCOB 2G9DA 2NTSA 1K28A 3E0JA 4UY8C 2A19A 1TWHB 4DV5L 4OELB 2V1CC 3BZKA 3PO3B 2RCFA 2NYZD 4O0AA 1FNVA 4CJ0B 2WV6D 2J0TD 1XYIA 5C5LA 2ZXPA 4FF1A 4RKLA 1V1PA 2JEAI 4LF9Q 5ISRA 4BBSH 5KIXA 4YHHL 4V190 4QCLA 3ONAB 4ZUIA 5HURA 4DR4L 1SRUA 1SNCA 1RD9D 1G2SA 1RCVD 4Q5VA 4L63B 1JWMD 2HCCA 1Q8IA 4K2KA 1KAWA 2TSSA 4B9WA 4IFDI 5GROA 3TMEA 2ZTCA 4FP5D 3VR3A 4HJ8A 2CWAA 4GLVB 4LUOA 5LMNQ 5I6WA 1LO5D 1O7IA 3L2PA 3CMAA 4B3TQ 3FRPB 2DJFC 3AU7A 1EIFA 4K0KQ 2F0JA 1X56A 1GUWA 1EY6A 3G6EA 3PSIA 2F0NA 3PUVA 3HOWG 1HRJA 4A3BB 1DGSA 4GOPC 1TWFB 1SE3A 1MI2A 2EYHA 3IFDA 3J7ZC 1R4PB 2PQAA 4X3KA 4F8MA 5COYA 3T4AC 2L1BA 2DNCA 2ICEC 1IBLL 4A3DH 1T5EA 2Q8TA 5BN5A 3QB3A 4C3JH 3CCQA 3OW2A 1U5KA 2AQ1B 1ESFA 5JJIA 2A68D 2F4VL 3S15H 1N36L 1DM0B 4DV3L 2UXBL 1SYCA 2JQOA 3H15A 4PV1C 5E3FA 4BY7G 4FDBA 5CGKA 3NSWA 1GVPA 1WCMB 2NVXH 3EN2A 3CCRA 1UEBA 4IPDA 4NXMQ 5C0XG 1CZWA 2JE6I 4HN7A 3M4OH 5EPLA 3R3OA 1XPOA 3D8GA 3NXWA 4JG2A 2NZOA 1UEAB 4HAEA 1EYCA 5M5YB 1K8GA 1O7ZA 5A35A 3J81j 1FNUA 2I07B 4A3JB 1TVXA 2ZXOA 2R7FA 4DV6Q 1NAPA 2WINB 3F1ZA 4DK0A 1Y1VH 2R92B 4Q0FA 5IIFA 5CV6A 5DEHA 4YY3Q 4JYAQ 4R4TA 3OOCA 4OWXB 2I0QA 1VQBA 4ZRZA 2RSNA 1B70B 4XQNA 1Y8OB 1ICWA 1KTKA 2F0HA 3FPUB 5KEEA 4AH6A 2F03A 3D31A 4JI5L 5HGTA 3Q22A 3I8ZA 4B3RL 4A3KH 4IOCA 3PIO3 4QIWE 3HOYG 3FPPA 3UDFA 3D6WA 4KV6A 1TS5A 1XX8A 1FD7D 1CKNB 2EYMA 3CW2C 2UUAL 4H7BA 2KEEA 1PLFA 4H13C 1ILQA 1GM5A 4KY5A 1HA5A 1WTRA 5BR8L 4A3FG 4B3ML 1VQKA 1PH8A 1TWGH 4PNYA 1WTVA 2K01A 4F87A 3KF8A 4DK3C 3K6OA 3M9BA 4RGNA 4IOAA 3SDZA 1G6PA 4DR6Q 1SXTA 5JEAH 1QNUA 4BA1I 1ENFA 5LL6S 1Y1WH 2ZTEA 3RLFA 3S16B 2XTIA 3BVMA 2A5HA 4A3GG 3UI2A 1HZAA 1EZ6A 1UWVA 3JAME 1SYEA 1PYBA 4GKKQ 1CKMA 2JA8H 1U4PA 1HNZL 2RA4A 2YTVA 2A6EC 1ZEQX 2VY3A 1KD1C 4JI6Q 3EQLC 3G7LA 4XT1B 2K4KA 3HOXH 1X65A 3VR4A 1RF2D 2K1BA 4A3IH 5C4HA 3GDEA 4HMIA 1VQGA 3GTOB 3RD4A 2MNAA 3P75A 2GVBA 4QQBX 1B50A 1VQ9A 2B2TC 2F0VA 3MXPA 2CCZA 3BZCA 3JAMc 3I56A 2SOBA 2AWOA 2B8FA 4DA2A 2Q2TA 4CJ1B 4X64Q 1PFMA 4DXGA 2E5LL 3SR1A 4KKUA 1KXLA 5CORA 4DV3Q 2E2HH 3MA2B 4GN3B 3SK5A 4XXEA 1QCBD 4CBVA 2SNMA 4A3LH 4K0KL 4ZKBB 5EGTA 3HKSA 3GV3A 4OHJA 1JWUD 3WWVA 4FF3A 1BF4A 1VQHA 4C3HH 5C4XB 3X3MA 3HOVH 4CDEC 2N55A 5IYDH 4K5VA 1HZBA 4JI1Q 4XQJA 1DONA 1SMYD 5A2QL 4R8NA 2K5VA 1R9TH 4LF4Q 3C1FA 4KY6A 2VNUD 1NR4A 4IO9A 4BXXG 1I6VC 1R4QB 3GTJH 2B63G 3RZOH 1M8AA 5CV5A 1CA6A 2JA5B 2J7ZA 1Q1EA 3I90A 3HKZG 5JEAJ 2OQKA 4R4QA 1XNRL 1AEXA 3L7ZC 2H5XA 1XTDA 2EVBA 5BR8Q 1F77A 4BY1H 1X3EA 1B3QA 2MFIA 1F9PA 3GTLH 1WTPA 3TS2A 2FXQA 5KNCA 3HKZB 3DLLA 4EQ5A 2A69D 4GNXA 3NQTA 4RH6A 3KLSA 5GQOA 1YVCA 2WIIB 4EQNA 1DYQA 2B2UC 1YIJA 1EYAA 1RTNA 2PZUA 3PIPA 4TSSA 3D0FA 1G6ZA 3MTSA 1TQOA 4M1UB 2KBNA 4U673 4DV0L 3L3OC 4EVOA 3VR2A 2EE1A 2N3SA 1X32A 1ESRA 1PH5A 5FO9B 4YY3L 4JYAL 2JEBI 5TSSA 3HOWH 2OT2A 2F0KA 2XNAC 3HZXA 2R93B 2UU9L 3M85A 3CMEA 1GOZA 1P16A 4QUCA 2RCNA 4OEMB 3TP7A 3GTMH 1ENCA 3GTPH 4CKBA 1HPCA 3S1RH 2O2LD 1DCZA 3TZDA 1SE4A 2R7ZG 2IX0A 4DPGA 3S1NH 3S1QH 4UP8A 2E2IH 3QO2A 1EQVA 1STEA 4OX9Q 3KLSX 2UU9Q 1CTMA 3EVQA 2KHSA 4RFBA 1E2ZA 4X65L 2HHHQ 2B39A 2X69A 4K14A 1TS3A 1B7YB 3OTOL 2K5WA 5C3EB 5FJ8G 1C4QA 1LLRD 1Q8KA 1JJGA 1G51A 2Z4HA 3KDFA 1HR0Q 1EYDA 3PO2G 4DV0Q 1BVSA 4BBRH 2Y0SE 1ILPA 1DD2A 2EXDA 2Y0SB 1TIID 1V8QA 3KF8B 1JE4A 3N52A 3MXNA 4AYBE 1X3GA 1H9RA 4I65A 3BJUA 1E0BA 3CU7A 2E8GA 3NENA 2D62A 3BS1A 1Q90A 3GTGH 3H3VH 1S5DD 1C0AA 2PNRC 3GTGB 4OL7A 1MIUA 3G4SA 2A74C 1S5BD 4WORA 4JI2L 4FYDA 2IHEA 1FYCA 1I94L 3K57A 4DNTB 1Y1VG 1BCPF 4DFAA 3MZ5A 3RR5A 3URYA 4EX5A 4C56C 1Q82C 1O78A 1PHJA 4PZ7A 2M00A 3RUZA 1LT6D 3NBIA 2IWHA 3NEMA 5LMNL 3CP0A 5J3BA 3R8BA 3J7YW 3J7AF 5JPMC 2WAQE 5M3FH 3NHHA 4A3KG 2JA8G 5JVG3 4A3EB 1H9MA 2VQFQ 2UXCL 5KYIA 4JI3L 4KN7C 1SDFA 3PUYA 3SK8A 1X54A 4LF8L 1OXUA 3TRZA 1Y69U 4HIOA 3AEVA 4A3JG 1KNEA 2WKDA 5CR3A 3GTPB 2JK8A 1LTSD 3MXGA 1UUPA 2EIFA 1CM9A 2E2JB 4J1MA 4KHZA 2JA6B 4A3FH 2OEOA 3A7AB 2AQ2B 4H0LC 4F88A 3MFYA 3R2TA 1A63A 3PV0A 3HOUB 2PQAB 1DJRD 1QUQB 3FKIB 4B3SQ 2A68C 4LFAL 5M5XH 2MO1A 3VR5A 1YBYA 5EBCA 1XMOL 3I4NG 1NCVA 4KMUC 1CHQD 1EEFD 2EJMA 4JC0A 4AQYL 3ICEA 4AIMA 3BDCA 5K36H 4JI7L 5EPJA 1BBUA 3KLRA 2KCCA 3SEBA 1IL2A 4YWLA 4A3LG 2N49A 1GJXA 4RMFA 3I2ZA 3S14H 2IPKD 5FKAC 2HUGA 4UHVA 1OTCA 4EQOA 3QOLA 4KD4A 4CDDC 4PMCA 4A93G 5IYDG 2D5DA 4DUYL 4GN4B 2AMCB 5EBDA 1VQIA 1I4XA 3CC2A 2NN6I 3KJOA 1M1KC 1HXYD 1HH2P 3HS0C 2CQAA 1EY5A 4A3IG 3RLOA 2VS1A 1SMXA 4DAYA 1I4GA 1KIXA 4X66L 3M7GA 2EY5A 1B9NA 1H9KA 1LUZA 1V43A 2IHFA 3SHLA 4P73A 4JW0A 3I70A 1HHVA 1K0SA 4DAMA 2F4IA 4POGA 3GTQB 3CD6A 3O13A 1A3UA 4MNOA 2QKIC 3H6MA 1VQJA 4UP9A 5M3FB 2WP8J 4C3HB 4BBSG 4LNQA 1CHPD 1PXUA 3I4MH 4HIMA 4A3MH 2BE5C 4QMGA 3VA7A 3ZYYX 3LNNA 1MD2D 4LJZC 5ELOA 5A2QE 1QZGA 1K73C 2LXJA 5C44B 4RCNA 2XRQD 3A7LA 1CZGA 1BBXC 1LTID 3TREA 4ABNA 2BCOA 1STGA 2ASBA 3I91A 2IJ0A 2VW9A 3CCUA 5JAVA 2NVYH 1V1QA 1ZKOA 2CW0D 3CRKC 1EUJA 4G7HC 3T56B 2BE5D 1UE5A 4NDXA 1EWIA 2Z6KA 1Q1BA 3T51B 2UUAQ 4OXPA 2EYOA 3T16A 4HR7B 4ZQ3A 4BBRB 1VQAA 1D1KA 3QWNA 2LXKA 3CCVA 4LUVA 3P7JA 3Q24A 2EJFC 2IY5B 5IYCH 3QIAA 4NP5A 1SR3A 3DMUA 3BZDB 1KRTA 1KL9A 3STBD 4GZYC 2B2TA 1OO9B 1I3QH 3S16H 2AUKA 1QVFA 3S1NB 1I4HA 4DNIA 4DR2Q 4DV1L 1HUNA 5LL6X 4PMWA 1AP0A 1EQTA 5J1ZA 1W3SA 4CDFC 1D5MC 5H1SE 3GTMB 5IWAQ 5F2DA 4A3CH 4WFN3 1B9MA 2K5DA 4GOPA 1AN8A 1EY4A 1FNWA 2EY6A 4ZYSA 1NNXA 3PIP3 3K8AA 3RNUA 3CC7A 3VDYA 3HFZB 4NPSA 3QOJA 1XPUA 1K8OA 1ASZA 1TU2B 1YNJD 1PH4A 4ODGA 3NELA 3WOEA 3KUPA 3MAQA 3J80c 1LTBD 2K32A 2A6ED 3OWFA 4JI4L 2YU9H 1IBMQ 3DEOA 4DAPA 1S5CD 4ZCKA 4DR5L 2XSCA 4A3KB 1EQRA 2JA7B 4GNXC 2F0TA 3E9IA 3VYUA 2F0UA 2HD3A 4IUNA 4H44C 3RN5A 1MGSA 3J7AV 3BU2A 4K8JA 1LABA 4JOIA 4KD3A 2DNEA 1N36Q 3N6RA 4R9WA 3OYYA 3GTLB 3KBGA 3ND8A 1XNQQ 3I4LA 2KVMA 1SEBD 2XWJB 1SN8A 5EKKA 4J6HA 1UE1A 2EYJA 1Y1VB 2CW0C 1BDOA 4IALA 3U50C 2F0GA 2NZHA 2OTLA 4A3JH 4DV2L 1FL0A 2GVAA 1FVIA 1IKMA 3RZOB 3H0GH 3GTJB 4G57A 1WD0A 2KEDA 1B2TA 2FFKB 3OMCA 5IODA 5IYBH 4PZ6A 4DGZA 1LV9A 3UDXA 1ML0D 2F0EA 1VQ5A 1WTQA 4YWMA 3KDFB 5CBAE 1UE6A 4CDCC 1YJ9A 4IPGA 5CMDA 2AHOB 2BA0A 3BYYB 2I5HA 5C6AA 1V1OA 1ET9A 2KCMA 1SNPA 1XWEA 4ULLA 3MFGA 3IFTA 2H4OA 2Q2HA 1W2BA 3AQQA 2ZJRA 1GHKA 1A3VA 3HOUG 1HQMC 1VS0A 3C3LA 1WYDA 1STBA 1K8AC 4R4OA 4L8JA 1PH2A 2E75C 4GKJQ 4K6LA 2FJ2A 3AYHB 1NTGA 3K7UC 2F0MA 1LYLA 1E1TA 5JPNC 3AB9A 2X6GA 3T1HQ 1JT8A 4O42A 2B2YA 2KECA 3OHXC 3P20A 1BCPD 1GXDC 3GTOH 4A3IB 1YHBA 1PFNA 1E1OA 3D4DA 2KA7A 1PH1A 2RBMA 2G9HD 4JBJA 3SGIA 2D0OA 1STHA 3TQYA 3U9SA 1EOVA 5C3XA 1H9SA 3S9WA 1SE2A 3A56A 5IP9H 3ZJYC 3H91A 2JN4A 1N33Q 2JA8B 4LFCQ 1C7YA 2EYPA 2EXZA 3OWEB 1DXMA 4ME3A 4OWWB 1QB5D 1VQCA 2R93G 2NN6G 2XRSD 4BWGB 5C4JB 1ENAA 2AWNA 4IZ8A 4QL5A 1YJWA 1A3TA 1NUCA 1Y1WB 5DLQE 1HR0L 1H95A 2F52A 1HR0W 4I7ZC 2WB1E 1JICA 4LFBQ 3K59A 3H0GB 2QDBA 3DUZA 4LAAA 1A15A 1PZID 4BBSB 1XMQL 1JORA 5T1IA 2UXDQ 2WAQG 2Z4IA 4NXNL 4OX9L 1HTLD 3U58A 1JOOA 4WJ4A 3GTKH 2NVQB 3TZUA 1C8CA 1GKHA 1PRTC 2ATWA 1CSPA 1PYWD 1STNA 3DWAA 4LMQD 2R92G 3NBHB 1XPRA 3H3VI 2A73B 3J80L 1YNXA 4XQQA 4ILWA 1PVOA 1EY8A 1G91A 5IGBA 2PNHA 4X6AH 1AE3A 4A3DG 3K80C 2YU9B 4DUYQ 2FMMA 2YTYA 4FO2A 1N8RC 4BY1G 1JJ2A 4LUZA 2HDMA 1PRTD 4RA8A 3K58A 3CQZH 4X62Q 1CUKA 4RHRA 2NVQH 3GTKB 1IXRA 4JI3Q 1XXGA 4APVA 5IY0A 4CJ2C 1U0LA 4CKEA 4XT3B 3R2IA 3E0EA 1RODA 5KYLA 2LMCB 3PUZA 5C44G 3EJIA 4A3CG 2MUYA 1Q12A 1J9OA 3JAMi 2CQOA 3TS0A 2L15A 2QDLA 2EY1A 2F0WA 5I9OA 5C4JH 3K81C 2NVXB 1VQ4A 4X64L 3STBC 4JI0Q 5J39A 2OTJA 2K52A 1NMFA 1IYJB 4EQPA 3S15B 3Q6SA 1EOTA 1GUSA 3MC0B 3A55A 1BCPC 2IW3A 1VQ6A 1CI3M 1VQMA 4HJ7A 4A4IA 3Q8DA 5G3LF 3KFUA 1OXVA 4JI1L 4A3BG 5C0XI 4JBKA 4QUFA 2CWPA 3TDQA 4KJNA 3CCMA 4NXNQ 1K8MA 1QVCA 1QUQA 2C35B 3VYTA 1O7LA 2N78A 1RHPA 1W6KA 3K5NA 2Z6BA 5IGGA 1ONLA 4G4KA 2K05A 1Z47A 2ES2A
chains in the Genus database with same CATH topology
4DN4M 4QIWB 2I46A 5ELEA 5CV9A 1HFGA 1YNNC 1Q3LA 3F2UA 4LK1C 3I4MB 1F9SA 2IX1A 5I9PA 4ID6A 4OGQC 1STAA 3OMGA 5IGEA 3TBIB 2CHBD 1YNJC 3A8KE 1MSGA 3C1EA 5CBEE 4RGTA 1B1ZA 1YNND 1ZYRD 1E2VA 3DEPA 5ELFA 2L55A 4MIUA 4XDXA 4HSPA 4KHVA 2KJXA 2PCFB 3C2PA 3VYRA 4XYQA 4KK7A 4FXGC 1WVLA 1I4QA 2SNSA 2NUCA 4E6IA 4KI0A 3J81L 4IURA 1VDZA 1TT2A 4S3SA 3TN2A 1LACA 4QB4A 4A93B 2SDFA 2ZXRA 1QG7A 2ID0A 1XTCD 2LS01 2QEJC 3X3NA 4A3GB 1E2WA 5JOBA 3W2DA 2PZWA 5DM63 1PDQA 1AW7A 5DNFA 4A3FB 4N9PA 1O7YA 3CKIB 2WB1B 1I6HB 1KDBA 4XYOA 2FINB 1CK1A 5FOBB 3M4YA 4CGYB 4ZLTF 1SJED 5IT9E 2HDLA 1I3QB 3BDOA 2EJGC 2MPMA 4JBWA 3KBXA 1DOKA 1EU3A 1U4LA 3V96A 2K04A 2DY7A 2XWBB 1SJHD 5KNBA 3HOYB 1DOMA 4C1NK 4TKOB 5FLXL 1H9SB 2F3WA 3LX0A 3AMUA 1QNKA 3D4WA 4TRDA 1SBBB 5K5PA 2NN6H 2RSOA 5EJWA 1VMPA 3NBHA 3E6ZX 2NVYB 3DM1A 2LKVA 4V0BA 1V1PB 1RKNA 4IFDJ 4DAVA 1Z7TA 1WTXA 5C5MA 2EDGA 2C9OA 4XTCS 2ENBA 5BN3A 5CV4A 3RZDB 2E76C 4A3MB 1SYFA 4K6DA 5KGUA 4RGMA 1SYGA 1HQRD 2K5QA 4NMZA 1EL0A 1DZ1A 2HQEA 2F0QA 4QF4A 1EZ8A 3S1QB 5ELBA 3IKJA 2B2YC 2L4NA 3S1RB 1ET6A 3TP6A 1TY2A 2F3VA 3HOZB 4C3JG 3I73A 4DNRB 4CKCA 3HOWB 3TP5A 2B8GA 1Y8PB 2MHVA 3EROA 2DY8A 5E4XA 5KNDA 4K2LA 2R7ZB 1J8IA 1FGBD 2A6HC 4K5WA 2OXPA 1BXTA 4IUQA 1D6EC 5EPKA 3S14B 1PTOC 5C3WA 3ITPA 2EYFA 4IUVA 3DWPA 5JJZA 2K28A 2WKCA 5CYUA 4NW2A 4KJOA 3NE5B 2MGSA 1TWAB 5G3LD 4BY1B 1HA6A 5M5XB 4RWSC 2XIWA 2R61A 2K6AA 2R3ZA 2PO4A 1OXXK 1II3A 4IFDH 1X3PA 2WACA 2F0OA 5IGCA 4FF2A 3SXHA 1OXTA 3NWTA 5FO8B 1JCKB 1CFMA 2BDOA 2IT1A 3EA6A 2F1MA 2PQEA 1JC7A 2FMCA 3HOVB 1SNQA 1EY9A 1PZJD 1PTOF 4FXKC 3A8IE 5DAUA 1S5FD 1B3AA 2EY2A 2QCPX 3SE0A 3D3RA 2RQXA 1I50B 3Q23A 4BY7B 5K36G 2Q8IB 4G7OC 5NUCA 2JP1A 4Y7NB 2PMZB 5FO7B 1DOLA 1IHZA 4WJWA 3I4NB 4X3UA 3DWQA 5FK9C 5C4ZA 1PTOD 1AZQA 3NTKA 2VB3X 5CV8A 4IQZA 1EY0A 5D14A 3TSSA 1CA5A 1EWHA 2F0FA 2KOLA 4C2MB 4TQUS 3GQBA 3NPPA 1D5ZC 1EIGA 3MXUA 1O80A 2OF1A 5I4DA 1GUNA 4UDUC 1PFBA 2NZ1D 4PMBA 2D9UA 2E2IB 5JVH3 3GO5A 3V05A 3DXJC 4RKBA 1WTWA 2NTTA 4KN4C 1BUVT 3IL8A 2F0SA 5M3MB 1GUOA 3RMHA 4MHEA 2L11A 4N9TA 4FF4A 5D65A 1F2ZA 2F0LA 3QJYA 2E2DC 1SFOB 3L9AX 4C3HG 2RKSA 3NWSA 2B2WA 5IT9L 4O1NA 1RDPD 1IW7D 3I3CA 4M8AA 2H1EA 3TP8A 4BA2I 2RDHA 2JSOA 4CHTB 3E5SA 4PQXA 2V4DA 4X3TA 3PO2B 1G2TA 1GHJA 4ME5A 4C3IB 1QWYA 1TY0A 3H09A 2ZT9C 4P2CB 2VB2X 2TMPA 2NBFA 3WOFA 4KTAA 1L0YB 1LTAD 4B9XA 2PZTA 3T13A 2L9HA 1NR2A 3DHQA 1F2YA 2EYLA 2JXMB 2B2UA 2QF7A 1KDCA 1R9TB 3M4OB 3WDNA 1LTRD 4BS9A 1FR3A 1QILA 5EQ0A 3LWUA 3K7AB 3A8JE 4NKLA 1M4VA 3VA5A 1H9JA 1SSOA 3NTIA 3BVGA 2AUJD 2E2HB 3CRLC 1SMYC 3J80E 3W3AA 1KAAA 4KKSA 4L6TB 4A3DB 2K03A 3S1MB 1LTTD 2O5IC 2HCIA 2MP1A 4RCOA 1A2UA 5M9OA 1D1IA 1TR5A 3M7NA 2F0PA 2K7VA 1EU4A 1VF5C 4IFDG 4ZUJA 1F9RA 4HEDA 1IL8A 2O5JC 2F0DA 1AFPA 3NK9A 3HOXB 4XIGS 1KLUD 5CV7A 1RTOA 2CVRA 3VR6A 5I2YA 2B2VC 4DK1A 1A6XA 3BYTB 1KLGD 2L12A 5AFWA 2ICIA 5J22A 3OIPA 4OIJA 1SNMA 3NQIA 3S2DB 2B2VA 1G8ZD 5KRUA 1STYA 2IX3A 2A6HD 1HUMA 4FXDA 2EPBA 5JEAG 1CQVA 1VCIA 1KABA 1EY7A 4OO1H 1RJTA 1TWGB 3OIQA 3FEWX 2MJ8A 4UAIA 5BN4A 1C48A 2FHTA 4X3SA 1UNSA 3Q0AA 1BQQT 2SEBD 3GP7A 1QOHA 1KNAA 1U9RA 3ND9A 2D2CC 2JYOA 2NB0A 4ZAIA 2VXWA 3MHBA 1TWCB 2NVTB 3FVQA 1CT1D 5I6YA 1B53A 5LHY1 2A69C 4RAUC 5T1GA 2KUMA 1Z6HA 2NWGA 4KY7A 1IKLA 3NP8A 3SK6A 4JK1C 1GUGA 1KDAA 5E1FA 2M2LA 4C1NI 5D3DA 1F2LA 1BO0A 3BG3A 1VF7A 3HGBA 1B4OA 1LT3D 2X6LA 2N88A 1JWSD 1PTOH 2O4XA 3MEHA 4HSVA 1IYVA 2PYKA 1JOQA 2BDNA 1LTGD 4DU9A 1F2MA 2E74C 1G291 5D3IB 1LT4D 3M3YB 2J4XA 4OO1I 4EGVA 1TKWB 3SK4A 2L5TA 2GA4B 3HEJA 4C3JB 3SVMA 1LT5D 1PRTF 1ZXTA 4K5XA 1HFNA 3OPOA 2R6GA 4J8QA 5M5WB 1EWCA 2C5CA 1SAPA 4K8IA 1HCZA 3OSOA 1IYUA 2Z1CA 3KK7A 4HMJA 3CHBD 1U4RA 2AQ3B 3D6CA 3GV6A 1L0XB 3NUCA 4IUPA 2PW5A 3QG1A 3T53B 1JOKA 4ZKCB 3VYSA 2PW7A 5ELCA 1BR9A 4FNFA 3D4RA 2L0CA 5I2XA 3HG9A 3HRZC 3NTHA 5EKLA 2XVSA 5EKIA 5C0XH 3G6JB 2PPBC 1HTPA 2DN8A 1I4RA 4R8IA 1TS4A 1SYBA 1F9QA 1EFID 1ZYRC 4HTHA 1UAPA 2Z8LA 3LWEA 1W6JA 2M9VA 2XN9C 4Z9CB 2BA1A 1WD1A 3BDLA 3S17B 3PMFA 5E4WC 5ELDA 1JQYD 3JAML 1PMRA 3H3VC 4U68A 1QE6A 3MWYW 2EOTA 3IAYA 1T5XD 1Y8NB 1JB3A 2EZVA 1SNOA 1BOSA 1NSNS 3S2HB 3FDTA 1SYDA 3PUXA 1MBYA 5IGFA 1SNDA 3C46A 2QILA 2RVLA 1JR0D 2WAQB 3H94A 3FMCA 2VUMB 4KKTA 5CC4A 1EEID 3K5MA 3K0YA 4FVMA 2B2WC 4DXFA 3EFXD 1IW7C 4MN3A 5IOCA 5FLXE 1I4PA 3K5OA 3U9OA 1CQFA 2LFNA 2RDGA 3A54A 2IL8A 1GUTA 4C3IG 4HCEA 4ZK9B 5C0XJ 1S5ED 1X3QA 2KCNA 3ERQA 4F7XA 2B63B 5IGDA 3R93A 4RHSA 4WRDA 1AZPA 4OIKA 4DF7A 2KQ3A 1PRTB 3V2TA 4IN3A 1K83B 5DM73 4IUTA 1MSHA 1U4MA 2RDFA 1PTOB 1OXSC 1BCPB 3J81E 1TS2A 3K5LA 4G7ZC 4OO1G 4IUUA 3BVZA 4RGOS 3PUWA 2BOSA 1B44D 1S4ZA 1D2BA 3I72A 3P1HA 3CQZB 4HCSA 1WTOA 2K33A 1VMCA 4AYBB 2YYZA 3OW7A 1D5XC 1PZKD 1BNZA 2LY7A 1EIHA 2F0IA 1A2TA 4YIJA 1QJOA 3HP3A 3MVVA 4B08A 2Q8RE 3GD7A 2G9DA 2NTSA 3E0JA 1TWHB 3PO3B 2NYZD 4CJ0B 1FNVA 2WV6D 2J0TD 1XYIA 5C5LA 2ZXPA 4FF1A 4RKLA 1V1PA 2JEAI 5ISRA 5KIXA 4V190 4QCLA 3ONAB 4ZUIA 5HURA 1SNCA 1RD9D 1G2SA 1RCVD 4Q5VA 4L63B 1JWMD 2HCCA 1Q8IA 4K2KA 2TSSA 4B9WA 4IFDI 3TMEA 4FP5D 3VR3A 5I6WA 1LO5D 3FRPB 3AU7A 2F0JA 1GUWA 1EY6A 2F0NA 3PUVA 1HRJA 4A3BB 1TWFB 1SE3A 1MI2A 2EYHA 3IFDA 1R4PB 4F8MA 4X3KA 5COYA 3T4AC 2L1BA 2DNCA 2ICEC 1T5EA 2Q8TA 5BN5A 3QB3A 2AQ1B 1ESFA 2A68D 1DM0B 1SYCA 4PV1C 5E3FA 5CGKA 3NSWA 1WCMB 5C0XG 1CZWA 2JE6I 4HN7A 5EPLA 3R3OA 3D8GA 3NXWA 1UEAB 4HAEA 1EYCA 5M5YB 1O7ZA 5A35A 1FNUA 2I07B 4A3JB 1TVXA 2ZXOA 1NAPA 2WINB 4DK0A 2R92B 4Q0FA 5IIFA 5CV6A 5DEHA 3OOCA 4ZRZA 2RSNA 4XQNA 1Y8OB 1ICWA 1KTKA 2F0HA 3FPUB 5KEEA 2F03A 3D31A 5HGTA 3Q22A 3I8ZA 3PIO3 3FPPA 3D6WA 4KV6A 1TS5A 1XX8A 1FD7D 2EYMA 4H7BA 2KEEA 1PLFA 4H13C 1ILQA 4KY5A 1HA5A 1WTRA 1WTVA 4PNYA 2K01A 4F87A 3KF8A 3K6OA 4RGNA 3SDZA 1SXTA 5JEAH 1QNUA 4BA1I 1ENFA 5LL6S 3RLFA 3S16B 3BVMA 2A5HA 3UI2A 1EZ6A 3JAME 1SYEA 1U4PA 2RA4A 2A6EC 1ZEQX 3EQLC 3G7LA 4XT1B 3VR4A 1RF2D 2K1BA 5C4HA 4HMIA 3GTOB 3RD4A 3P75A 1B50A 2B2TC 2F0VA 3MXPA 2SOBA 2AWOA 2B8FA 4DA2A 4CJ1B 1PFMA 4DXGA 3SR1A 4KKUA 5CORA 3MA2B 3SK5A 4XXEA 1QCBD 4CBVA 2SNMA 4ZKBB 5EGTA 3GV3A 4OHJA 1JWUD 4FF3A 1BF4A 5C4XB 3X3MA 2N55A 4K5VA 4XQJA 1DONA 1SMYD 5A2QL 4R8NA 3C1FA 4KY6A 2VNUD 1NR4A 1I6VC 1R4QB 1M8AA 5CV5A 1CA6A 2JA5B 2J7ZA 1Q1EA 3I90A 5JEAJ 1AEXA 3L7ZC 2EVBA 1F77A 1F9PA 1WTPA 5KNCA 3HKZB 2A69D 3NQTA 4RH6A 3KLSA 2WIIB 4EQNA 1DYQA 2B2UC 1EYAA 1RTNA 2PZUA 4TSSA 1G6ZA 3MTSA 1TQOA 4M1UB 4U673 3L3OC 4EVOA 3VR2A 2EE1A 1X32A 1ESRA 5FO9B 2JEBI 5TSSA 2OT2A 2F0KA 2XNAC 3HZXA 2R93B 3M85A 1GOZA 4QUCA 3TP7A 1ENCA 4CKBA 1HPCA 2O2LD 1DCZA 3TZDA 1SE4A 2IX0A 3QO2A 1EQVA 1STEA 3KLSX 1CTMA 3EVQA 2KHSA 4RFBA 1E2ZA 2B39A 2X69A 4K14A 1TS3A 2K5WA 5C3EB 1C4QA 1LLRD 2Z4HA 1EYDA 1DD2A 1ILPA 2Y0SB 1TIID 1V8QA 1JE4A 3N52A 3MXNA 1H9RA 4I65A 1E0BA 3CU7A 3BS1A 2D62A 1Q90A 1S5DD 2PNRC 3GTGB 4OL7A 2A74C 1S5BD 4WORA 4FYDA 1FYCA 3K57A 4DNTB 1BCPF 4DFAA 3MZ5A 3URYA 4C56C 1O78A 2M00A 3RUZA 1LT6D 3NBIA 2IWHA 3R8BA 3J7YW 3J7AF 5JPMC 3NHHA 5JVG3 4A3EB 1H9MA 5KYIA 4KN7C 1SDFA 3PUYA 3SK8A 1OXUA 1Y69U 1KNEA 2WKDA 5CR3A 3GTPB 1LTSD 3MXGA 1UUPA 1CM9A 2E2JB 4J1MA 4KHZA 2JA6B 4F88A 2OEOA 3A7AB 2AQ2B 4H0LC 3MFYA 3R2TA 3PV0A 3HOUB 1DJRD 3FKIB 2A68C 3VR5A 5EBCA 1NCVA 4KMUC 1CHQD 1EEFD 2EJMA 3BDCA 5K36H 5EPJA 3KLRA 2KCCA 3SEBA 1GJXA 2IPKD 5FKAC 2HUGA 4EQOA 3QOLA 4KD4A 4PMCA 2D5DA 5EBDA 1I4XA 2NN6I 1HXYD 3HS0C 2CQAA 1EY5A 4DAYA 1I4GA 3M7GA 2EY5A 1B9NA 1V43A 1H9KA 3SHLA 3I70A 1HHVA 3GTQB 2F4IA 3O13A 1A3UA 2QKIC 3H6MA 5M3FB 2WP8J 4C3HB 1CHPD 1PXUA 2BE5C 4QMGA 3VA7A 3ZYYX 3LNNA 1MD2D 4LJZC 5A2QE 5C44B 4RCNA 2XRQD 3A7LA 1BBXC 1CZGA 1LTID 4ABNA 2BCOA 1STGA 3I91A 2IJ0A 5JAVA 1ZKOA 2CW0D 3CRKC 4G7HC 3T56B 2BE5D 4NDXA 1Q1BA 3T51B 2EYOA 3T16A 4HR7B 4ZQ3A 4BBRB 1D1KA 3QWNA 3P7JA 3Q24A 2EJFC 3QIAA 4NP5A 3DMUA 3BZDB 4GZYC 2B2TA 1OO9B 2AUKA 3S1NB 1I4HA 1HUNA 5LL6X 4PMWA 1AP0A 1EQTA 5J1ZA 1D5MC 3GTMB 5F2DA 4WFN3 1B9MA 2K5DA 1AN8A 1EY4A 1FNWA 2EY6A 4ZYSA 3PIP3 1K8OA 3QOJA 1TU2B 1YNJD 4ODGA 3WOEA 3KUPA 3MAQA 1LTBD 2K32A 2A6ED 3OWFA 3DEOA 4DAPA 1S5CD 2XSCA 4A3KB 2JA7B 2F0TA 3VYUA 2F0UA 4IUNA 4H44C 1MGSA 3J7AV 4K8JA 1LABA 4KD3A 2DNEA 3N6RA 4R9WA 3GTLB 3KBGA 3ND8A 3I4LA 2KVMA 1SEBD 2XWJB 5EKKA 4J6HA 2EYJA 1Y1VB 2CW0C 1BDOA 4IALA 2F0GA 1IKMA 3RZOB 3GTJB 4G57A 1WD0A 2KEDA 1B2TA 2FFKB 3OMCA 5IODA 4DGZA 1LV9A 1ML0D 2F0EA 1WTQA 5CBAE 5CMDA 2BA0A 3BYYB 5C6AA 1V1OA 1ET9A 1SNPA 1XWEA 4ULLA 3MFGA 3IFTA 2H4OA 1GHKA 1A3VA 1HQMC 3C3LA 1STBA 4L8JA 2E75C 4K6LA 2FJ2A 2F0MA 5JPNC 3AB9A 2X6GA 4O42A 2B2YA 2KECA 3OHXC 3P20A 1BCPD 1GXDC 4A3IB 1PFNA 3D4DA 2KA7A 2RBMA 2G9HD 1STHA 3U9SA 5C3XA 1H9SA 3S9WA 1SE2A 3A56A 3H91A 2JA8B 2EYPA 2EXZA 3OWEB 1DXMA 1QB5D 2NN6G 2XRSD 4BWGB 5C4JB 1ENAA 2AWNA 4IZ8A 1Y1WB 1A3TA 1NUCA 4I7ZC 1JICA 3K59A 3H0GB 2QDBA 3DUZA 4LAAA 1A15A 1PZID 4BBSB 1JORA 5T1IA 2Z4IA 1HTLD 1JOOA 2NVQB 3TZUA 1C8CA 1PRTC 1PYWD 1STNA 3DWAA 4LMQD 2A73B 3J80L 4XQQA 4ILWA 1EY8A 1G91A 5IGBA 2YU9B 2FMMA 4FO2A 2HDMA 1PRTD 4RA8A 3K58A 4RHRA 3GTKB 1XXGA 4CJ2C 4CKEA 4XT3B 3R2IA 1RODA 5KYLA 2LMCB 3PUZA 3EJIA 2MUYA 1Q12A 1J9OA 2EY1A 2F0WA 5I9OA 2NVXB 5J39A 4EQPA 3S15B 3Q6SA 1EOTA 1GUSA 3MC0B 3A55A 1BCPC 2IW3A 1CI3M 5G3LF 1OXVA 5C0XI 4QUFA 3TDQA 4KJNA 1K8MA 3VYTA 1O7LA 1RHPA 3K5NA 1W6KA 5IGGA 1ONLA 4G4KA 2K05A 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL D;  3DWQ A;  3CHB D;  1DJR D;  5FK9 C;  2AQ3 B;  1PTO D;  2RDG A;  2O2L D;  5ELE A;  1CK1 A;  1L0X B;  1SE4 A;  1FGB D;  1PRT C;  1UNS A;  2SEB D;  1SJE D;  1PYW D;  4DXG A;  1LTR D;  1CHQ D;  3TSS A;  1STE A;  3GP7 A;  1BXT A;  3KLS X;  1D6E C;  1EEF D;  1RD9 D;  5ELC A;  3DWA A;  1RCV D;  1QIL A;  1PTO C;  1EU3 A;  1KTK A;  4RFB A;  4L63 B;  1JWM D;  1S5E D;  3DWP A;  1SJH D;  2TSS A;  1M4V A;  1TS3 A;  4OHJ A;  1JWU D;  3SEB A;  1D5Z C;  3BYY B;  1LLR D;  4RHS A;  3BZD B;  1V1O A;  1LO5 D;  2CHB D;  1ET9 A;  3BVG A;  1CT1 D;  2IPK D;  5FKA C;  5I4D A;  4UDU C;  3MFG A;  1SBB B;  1PRT B;  3V05 A;  1I4R A;  1TS5 A;  1TS4 A;  1I4H A;  1PRT D;  4L6T B;  1FD7 D;  1LTT D;  4RGT A;  1B1Z A;  1EFI D;  1I4X A;  2NTT A;  2R61 A;  4RHR A;  2Z8L A;  5D3D A;  5ELF A;  1PTO B;  4RCO A;  1HA5 A;  1XXG A;  1BCP B;  1HXY D;  1TS2 A;  1D5M C;  2XN9 C;  1EU4 A;  4K6L A;  4Z9C B;  1S5D D;  1SE3 A;  1LT3 D;  3R2I A;  1I4G A;  1AN8 A;  1FNW A;  4ZYS A;  1V1P B;  1JWS D;  3BVZ A;  4RGO S;  4RGN A;  1BCP D;  1S5B D;  1PTO H;  1B44 D;  1JCK B;  5ELD A;  1JQY D;  1LTG D;  1F77 A;  1SXT A;  3EA6 A;  1ENF A;  3O13 A;  1KLU D;  4O1N A;  1BCP F;  1I4Q A;  1RDP D;  5D3I B;  1LTB D;  1T5X D;  1LT4 D;  2G9H D;  3BVM A;  1D5X C;  1PZK D;  1SE2 A;  2AQ1 B;  2J4X A;  1ESF A;  3BYT B;  1KLG D;  1S5C D;  3URY A;  4RGM A;  4C56 C;  4RH6 A;  2RDH A;  1PZJ D;  1HQR D;  1LT6 D;  1DYQ A;  1PTO F;  3OWE B;  2ICI A;  1CHP D;  3MC0 B;  1S5F D;  3R8B A;  1BCP C;  4TSS A;  2NTS A;  1LT5 D;  1G8Z D;  2XRS D;  1PRT F;  4BWG B;  2QEJ C;  1XTC D;  1MD2 D;  1SEB D;  5ELB A;  1TY0 A;  1RF2 D;  1CQV A;  1ET6 A;  1FNV A;  1JR0 D;  2QIL A;  2XRQ D;  3W2D A;  2WV6 D;  5TSS A;  1LTI D;  1EEI D;  1EWC A;  1TY2 A;  1LTS D;  1UUP A;  1AW7 A;  2XNA C;  1V1P A;  1PZI D;  4DXF A;  1L0Y B;  2IJ0 A;  1FNU A;  1GOZ A;  1LTA D;  2AQ2 B;  3EFX D;  3R2T A;  1I4P A; 
#chains in the Genus database with same CATH topology
 3PQI A;  4DN4 M;  3S24 A;  2ZM6 L;  4QIW B;  3I55 A;  4LF9 L;  3KF6 A;  2I46 A;  5ELE A;  1WTH A;  3G71 A;  5CV9 A;  1HFG A;  3UDI A;  4JI4 Q;  2CFM A;  1BKB A;  1YNN C;  1Q3L A;  3F2U A;  3W1G A;  3CCE A;  4LK1 C;  3I4M B;  1F9S A;  2HIX A;  2IX1 A;  5I9P A;  1PH7 A;  3S2H H;  4ID6 A;  3I4O A;  4OGQ C;  1STA A;  4QJF A;  2OQ0 A;  3OMG A;  5IGE A;  3TBI B;  3CC4 A;  2CHB D;  1WFQ A;  1Y1W G;  1YNJ C;  3T1Y Q;  3A8K E;  1MSG A;  2Y0S G;  3C1E A;  3MEF A;  5CBE E;  5GAE C;  3GTQ H;  4RGT A;  1B1Z A;  1K0R A;  1YNN D;  1ZYR D;  1MHW C;  4R1J A;  4GN5 A;  1E2V A;  3DEP A;  5ELF A;  1JJC B;  2JA6 G;  2L55 A;  3S17 H;  4MIU A;  4XDX A;  5E7N A;  2JA5 G;  4HSP A;  4KHV A;  2GN5 A;  2KJX A;  2PCF B;  4DKA C;  4B3R Q;  1MKH A;  3C2P A;  3VYR A;  4DR6 L;  4XYQ A;  4KK7 A;  3MXN B;  3B6Y A;  4FXG C;  1WVL A;  1I4Q A;  2SNS A;  2NUC A;  1PH3 A;  4E6I A;  4KI0 A;  3J81 L;  2K50 A;  2LSS A;  4IUR A;  2JA7 H;  1VDZ A;  1TT2 A;  5GAD C;  4S3S A;  3TN2 A;  1LAC A;  4ALP A;  4L5R C;  4QB4 A;  4A93 B;  2SDF A;  2ZXR A;  1QG7 A;  2ID0 A;  1XTC D;  2LS0 1;  2QEJ C;  3U4Z A;  3DM3 A;  3X3N A;  1HNX L;  4A3G B;  1HZ9 A;  1E2W A;  2BH2 A;  5JOB A;  3W2D A;  3FKI H;  2PZW A;  5DM6 3;  3HOU H;  4LF6 Q;  1WOC A;  1PDQ A;  1AW7 A;  5DNF A;  3J81 i;  3F2D A;  3HOV G;  4A3F B;  2B29 A;  4N9P A;  1O7Y A;  3CKI B;  5M5W H;  5HGQ A;  2WB1 B;  1I6H B;  1WI5 A;  1KDB A;  4XYO A;  1E24 A;  2FIN B;  1CK1 A;  5FOB B;  3T1Y L;  4BXX H;  3M4Y A;  4CGY B;  4ZLT F;  2HT1 A;  1SJE D;  5IT9 E;  4DV6 L;  1JE5 A;  2HDL A;  1I3Q B;  3BDO A;  5C3E G;  4DUZ L;  2EJG C;  2MPM A;  4JBW A;  3KBX A;  1DOK A;  1EU3 A;  1IZ6 A;  1U4L A;  3V96 A;  2K04 A;  2DY7 A;  2XWB B;  1SJH D;  1GD7 A;  2QA4 A;  5KNB A;  3HOY B;  1DOM A;  4C1N K;  4TKO B;  4GNX B;  5FLX L;  1H9S B;  4JBM A;  4DV2 Q;  2F3W A;  3LX0 A;  3M3Y H;  3AMU A;  3QR8 A;  2ZTD A;  1QNK A;  1SE8 A;  3D4W A;  4TRD A;  1SBB B;  5K5P A;  2NN6 H;  2RSO A;  5EJW A;  2ZM6 Q;  1VMP A;  3NBH A;  4MTK A;  3E6Z X;  4OON A;  1L1O C;  3G48 A;  3PIO A;  2ZJQ A;  2NVY B;  3DM1 A;  2LKV A;  4V0B A;  1RL2 A;  1V1P B;  1LTL A;  1RKN A;  2KEN A;  4J15 A;  4DR2 L;  4IFD J;  4DAV A;  1HNW Q;  2VQF L;  1C9O A;  5JJL A;  3AFP A;  5C44 H;  3CCL A;  1Z7T A;  1WTX A;  1YIT A;  2MO0 A;  5C5M A;  2EDG A;  2C9O A;  4XTC S;  2BH8 A;  2ENB A;  5BN3 A;  5CV4 A;  3RZD B;  2E76 C;  1A62 A;  4A3M B;  2R7D A;  1SYF A;  4K6D A;  1KC8 C;  4HIK A;  5KGU A;  4MTN A;  4LFA Q;  4RGM A;  1SYG A;  1HQR D;  1VQD A;  4DUZ Q;  4O2D A;  2K5Q A;  4NMZ A;  4P71 A;  1EL0 A;  5FLM H;  3CAM A;  1DZ1 A;  2HQE A;  2DUD A;  2F0Q A;  4QF4 A;  1J5E Q;  2PI2 A;  1EZ8 A;  4B3M Q;  3S1Q B;  5ELB A;  2QW7 A;  1TXY A;  5IE8 A;  3IKJ A;  2B2Y C;  2L4N A;  1XJV A;  1YHQ A;  2HIV A;  4DV4 Q;  3S1R B;  4LF8 Q;  1ET6 A;  1YI2 A;  2KCT A;  3TP6 A;  1TY2 A;  5FJ8 H;  2F3V A;  3HOZ B;  1PYS B;  2ALY B;  4C3J G;  4BBR G;  3I73 A;  3TEH B;  4DNR B;  4CKC A;  3HOW B;  3TP5 A;  2B8G A;  1Y8P B;  2MHV A;  3ERO A;  1HNX Q;  1ICF B;  2DY8 A;  5E4X A;  5KND A;  4K2L A;  2R7Z B;  1J8I A;  1FGB D;  2A6H C;  2P5Z X;  4K5W A;  1X9N A;  2WB1 G;  2OXP A;  1BXT A;  3ULL A;  4IUQ A;  1D6E C;  1D8L A;  5EPK A;  3S14 B;  1B8A A;  1PTO C;  3S2D H;  1YZ6 A;  5C3W A;  3ITP A;  2EYF A;  4IUV A;  3DWP A;  1YHA A;  1E7Z A;  5JJZ A;  4TVA B;  2B3G A;  2OCE A;  4QGU A;  1IBK L;  2K28 A;  2WKC A;  5CYU A;  4NW2 A;  4KJO A;  4OWT B;  3HKZ E;  3NE5 B;  2MGS A;  1TWA B;  4HID A;  5G3L D;  4BY1 B;  2QGQ A;  4YCW A;  1HA6 A;  3EBE A;  5M5X B;  4RWS C;  2XIW A;  2R61 A;  2K6A A;  1BBW A;  3A0J A;  4X66 Q;  2R3Z A;  2PO4 A;  1OXX K;  1II3 A;  1XMQ Q;  4IFD H;  1X3P A;  2KHJ A;  4HJ9 A;  2WAC A;  5HY6 A;  3KOJ A;  4R4I A;  2F0O A;  3JC6 6;  5IGC A;  4FF2 A;  2JA6 H;  5GAG C;  2E2J H;  1PFS A;  3FP9 A;  2JA5 H;  3PO3 G;  4DR1 Q;  2G5D A;  3SXH A;  1OXT A;  1N9W A;  1CKN A;  3NWT A;  5FO8 B;  1JCK B;  2XGT A;  1CFM A;  4N8X 1;  2BDO A;  4JI8 L;  2IT1 A;  3EA6 A;  2UUC Q;  3I7F A;  2F1M A;  4A3E H;  1JB7 A;  2PQE A;  1JC7 A;  2FMC A;  1AH9 A;  3HOV B;  1SNQ A;  1EY9 A;  4L5S A;  5JJK A;  1PZJ D;  3PF4 A;  4P72 A;  1PTO F;  3H0G G;  4FXK C;  4AQY Q;  1S72 A;  3A8I E;  3K7A H;  5DAU A;  1S5F D;  1B3A A;  2EY2 A;  2PI2 E;  2QCP X;  5IYB G;  3SE0 A;  3D3R A;  2RQX A;  4NXM L;  2JA7 G;  2VUM G;  1I50 B;  1Q86 C;  3Q23 A;  4BY7 B;  5K36 G;  4N8F A;  2Q8I B;  4G7O C;  2UXB Q;  2ZJP A;  4LF5 L;  5NUC A;  4JCV E;  2JP1 A;  4Y7N B;  2PMZ B;  2CH4 A;  5FO7 B;  1DOL A;  1IHZ A;  4WJW A;  3I4N B;  4X3U A;  3DWQ A;  5FK9 C;  5C4Z A;  1PTO D;  1AZQ A;  3NTK A;  2VB3 X;  1VQL A;  5CV8 A;  4IQZ A;  1EY0 A;  4UP7 A;  5D14 A;  1YEZ A;  1VQ7 A;  3TSS A;  1CA5 A;  1EWH A;  2F0F A;  2KOL A;  4C2M B;  4TQU S;  3GQB A;  2NVT H;  2N8N A;  1TWC H;  5C3E H;  4JV5 L;  4LF5 Q;  4B3S L;  3NPP A;  1D5Z C;  2K5H A;  1EIG A;  4IJL A;  3MXU A;  1O80 A;  2OF1 A;  5I4D A;  1GUN A;  4UDU C;  1PFB A;  2NZ1 D;  4PMB A;  2D9U A;  2E2I B;  3GO5 A;  5JVH 3;  3V05 A;  4GOP B;  3DXJ C;  4RKB A;  1WTW A;  2CKZ B;  2NTT A;  4KN4 C;  4LW1 A;  1BUV T;  3A5U A;  1VQE A;  2UXC Q;  2RHQ B;  5EAY A;  3I4M G;  4DAY B;  3IL8 A;  5M3M H;  2F0S A;  5M3M B;  2K5N A;  2R93 H;  1GUO A;  4L5Q A;  4MHE A;  3RMH A;  2L11 A;  4N9T A;  4FF4 A;  1VQ8 A;  3QJY A;  1F2Z A;  2F0L A;  5D65 A;  2E2D C;  3ULJ A;  1SFO B;  3CCS A;  3L9A X;  4C3H G;  2RKS A;  3NWS A;  2B2W A;  5IT9 L;  4POF A;  4O1N A;  1RDP D;  1IW7 D;  3I3C A;  2E5L Q;  4M8A A;  4DV7 L;  2H1E A;  1N32 Q;  4H02 A;  2HHH L;  3TP8 A;  1T9H A;  1Q81 C;  2RDH A;  3UE0 A;  4BA2 I;  2OWO A;  2JSO A;  4CHT B;  3E5S A;  2RHS B;  1PH9 A;  4PG3 A;  4PQX A;  1N33 L;  4DR7 L;  2V4D A;  4X3T A;  1A0I A;  3PO2 B;  1G2T A;  1GHJ A;  5FLM G;  4ME5 A;  4C3I B;  5AJ3 Q;  1QWY A;  1TY0 A;  3H09 A;  2R92 H;  2UXD L;  2ZT9 C;  1IBK Q;  4P2C B;  2VB2 X;  4KLK A;  2TMP A;  2NBF A;  3WOF A;  1KRS A;  4KTA A;  1L0Y B;  1LTA D;  4GLA C;  4DV7 Q;  3T1H L;  4B9X A;  2PZT A;  3T13 A;  2VZA A;  3E3X A;  1ASY A;  2L9H A;  1NR2 A;  4PZ8 A;  3DHQ A;  1F2Y A;  2EYL A;  3ULP A;  4BY7 H;  2JXM B;  2B2U A;  3W1B A;  2QF7 A;  1KDC A;  1R9T B;  3S1M H;  3M4O B;  3WDN A;  4HJA A;  4P74 A;  1LTR D;  3J81 c;  1VQO A;  5AJ3 L;  4BS9 A;  1FR3 A;  1NMG A;  1QIL A;  5EQ0 A;  4LFC L;  3LWU A;  5C4X H;  3K7A B;  3A8J E;  5L37 A;  4NKL A;  1M4V A;  3VA5 A;  4NB3 A;  4DV4 L;  1H9J A;  1SSO A;  3NTI A;  3BVG A;  2AUJ D;  2E2H B;  1E22 A;  1KHI A;  3CRL C;  1SMY C;  1J5E L;  4KHP L;  3J80 E;  4JI0 L;  2I5M X;  3W3A A;  4R4C A;  1KAA A;  4KKS A;  1K3R A;  4L6T B;  2K03 A;  3S1M B;  4A3D B;  1LTT D;  2O5I C;  2HCI A;  3CPW A;  3PF5 A;  2MP1 A;  4RCO A;  1A2U A;  4JOI C;  5M9O A;  4JV5 Q;  1D1I A;  1TR5 A;  3M7N A;  2F0P A;  4A75 A;  2K7V A;  1EU4 A;  1VF5 C;  1HZC A;  1TWF H;  4IFD G;  2YV5 A;  4ZUJ A;  4YCU A;  3KF6 B;  1F9R A;  4HED A;  1N34 L;  4LF4 L;  2Q2U A;  5IP7 H;  5LMU Q;  4A3B H;  1FJG L;  1IL8 A;  2MQH A;  2O5J C;  2F0D A;  1AFP A;  3NK9 A;  4C3I H;  4Y52 H;  3HOX B;  2KHI A;  4XIG S;  3PO2 H;  1KLU D;  5CV7 A;  1RTO A;  3FHW A;  2CVR A;  3CF5 A;  4X62 L;  3VR6 A;  5I2Y A;  2B2V C;  4DK1 A;  1A6X A;  3BYT B;  1KLG D;  1RIP A;  4JVZ A;  4GLX A;  2L12 A;  4MZ9 A;  2DJG C;  5AFW A;  2ICI A;  5J22 A;  3LGJ A;  3OIP A;  4OIJ A;  1SNM A;  3NQI A;  3S2D B;  2B2V A;  1MJE A;  1G8Z D;  5KRU A;  1STY A;  1IBM L;  2IX3 A;  2F3I A;  2A6H D;  1HUM A;  3AFQ A;  4IJH A;  4FXD A;  2EPB A;  1SFO H;  5JEA G;  4I7A A;  1CQV A;  1VCI A;  1KAB A;  4QY7 A;  1EY7 A;  4A76 A;  3CCJ A;  3J80 i;  4OO1 H;  2VQE Q;  1RJT A;  3HOZ H;  1TWG B;  3OIQ A;  3FEW X;  2MJ8 A;  1SLJ A;  4UAI A;  5BN4 A;  1C48 A;  1SRO A;  3ER0 A;  3KYH C;  4JI8 Q;  1XNQ L;  5IWA L;  3PO3 H;  2FHT A;  1EIY B;  1Q46 A;  4X3S A;  4JI6 L;  1UNS A;  3Q0A A;  1BQQ T;  2SEB D;  4LFB L;  3M4P A;  1TWH H;  5M3F G;  3GP7 A;  1QOH A;  3HOX G;  1L0W A;  2VQE L;  1L1O A;  1KNA A;  4GKK L;  1U9R A;  2A1A A;  3ND9 A;  5GAH C;  4IPH A;  4LF6 L;  2D2C C;  2JYO A;  2NB0 A;  4ZAI A;  2VXW A;  3MHB A;  1PH6 A;  4LF7 L;  4IPC A;  1TWC B;  1K9M C;  2NVT B;  1XMO Q;  3FVQ A;  1MJC A;  1CT1 D;  5I6Y A;  1B53 A;  4C2M H;  5LHY 1;  2A69 C;  1X55 A;  1CSQ A;  4RAU C;  1VQN A;  1A8V A;  5T1G A;  1VQP A;  1V9P A;  2KUM A;  1Z6H A;  2Z6K C;  2NWG A;  1GO3 E;  3KLW A;  4KY7 A;  5IP9 G;  1IKL A;  3NP8 A;  3SK6 A;  4JK1 C;  1GUG A;  1KDA A;  5E1F A;  2M2L A;  4C1N I;  1QZH A;  5D3D A;  1F2L A;  3KJP A;  1BO0 A;  2UUC L;  4RG1 A;  3BG3 A;  1VF7 A;  3I4N H;  3HGB A;  3F2C A;  1B4O A;  1LT3 D;  4Y7N H;  2X6L A;  2N88 A;  1JWS D;  5M5Y H;  1HNZ Q;  1NJI C;  1PTO H;  2O4X A;  3MEH A;  4HSV A;  1IYV A;  4GKJ L;  2PYK A;  1JOQ A;  2BDN A;  1LTG D;  4JPB W;  4DU9 A;  1F2M A;  1FJG Q;  1NE3 A;  2E74 C;  1I50 H;  1G29 1;  4WJ3 M;  5D3I B;  1WCM H;  1LT4 D;  3M3Y B;  1HJP A;  2J4X A;  3A5Z B;  4OO1 I;  3EIV A;  3E9H A;  4EGV A;  2HQL A;  1TKW B;  2B63 H;  3SK4 A;  2PMZ E;  1LM0 A;  2L5T A;  4YHH Q;  1D7Q A;  2GA4 B;  3HEJ A;  4C3J B;  3SVM A;  1LT5 D;  1I94 Q;  2K14 A;  1PRT F;  2UUB Q;  1ZXT A;  2UUB L;  1WJJ A;  3K0X A;  4K5X A;  4DV5 Q;  1HFN A;  3OPO A;  1I6H H;  3RN2 A;  2R6G A;  4J8Q A;  5M5W B;  1EWC A;  2C5C A;  1SAP A;  4K8I A;  1HCZ A;  1I5F A;  1PV4 A;  3OSO A;  1EYG A;  1IYU A;  2Z1C A;  3KK7 A;  4AYB G;  1J6Q A;  4UPA A;  5M3M G;  4HMJ A;  3CHB D;  2QEX A;  4JI5 Q;  1U4R A;  2AQ3 B;  3D6C A;  1QVG A;  3GV6 A;  1L0X B;  3NUC A;  4IUP A;  1HNW L;  2PW5 A;  1NY4 A;  3QG1 A;  1CKO A;  2Z0S A;  3T53 B;  4A3M G;  3ERS X;  1TWA H;  1JOK A;  4ZKC B;  3VYS A;  2PW7 A;  1E3P A;  5ELC A;  1BR9 A;  4FNF A;  3D4R A;  2L0C A;  4X65 Q;  5I2X A;  3HG9 A;  3HRZ C;  3NTH A;  5EKL A;  2XVS A;  5EKI A;  3F2B A;  3UE1 A;  5C0X H;  3G6J B;  4JI7 Q;  2PPB C;  2A8V A;  1HTP A;  2DN8 A;  4DR7 Q;  4DR5 Q;  1I4R A;  4R8I A;  1TS4 A;  2R7Z H;  1SYB A;  1F9Q A;  1Q7Y C;  1EFI D;  4LF7 Q;  1ZYR C;  3M4Q A;  4HTH A;  1PA6 A;  1UAP A;  2Z8L A;  3LWE A;  1W6J A;  3CPF A;  2M9V A;  4DR3 Q;  2XN9 C;  4Z9C B;  2BA1 A;  3CXC A;  1WD1 A;  3BDL A;  2JA9 A;  3S17 B;  3W5O A;  3PMF A;  5E4W C;  2D0P A;  4YCV A;  4GS3 A;  5IYC G;  1KQS A;  2F4V Q;  4L5T A;  1L2F A;  5ELD A;  1JQY D;  3JAM L;  1PMR A;  2K75 A;  3H3V C;  4U68 A;  1QE6 A;  3MWY W;  2EOT A;  3IAY A;  1T5X D;  1Y8N B;  1JB3 A;  1SNO A;  1BOS A;  1NSN S;  2DGY A;  5ELN A;  4DV1 Q;  3UDG A;  2EZV A;  1X6O A;  4DK6 C;  1IBL Q;  3S2H B;  3FDT A;  5C4X G;  1VQF A;  2VL6 A;  1SYD A;  3PUX A;  1MBY A;  1L1O B;  1P8L A;  2EQS A;  3RZD H;  1Z9F A;  1YJN A;  5IGF A;  1XNR Q;  1AE2 A;  2AKW B;  3PGZ A;  1SND A;  3C46 A;  2QIL A;  2RVL A;  2Z9H A;  1JR0 D;  2WAQ B;  3H94 A;  3FMC A;  2VUM B;  4KKT A;  5CC4 A;  1EEI D;  4HJ5 A;  3K5M A;  3K0Y A;  4DR3 L;  4KHP Q;  4FVM A;  2RF4 A;  2B2W C;  1X3F A;  1S40 A;  4DXF A;  4B3T L;  2YTX A;  3J7A 5;  3EFX D;  1IW7 C;  4MN3 A;  5IOC A;  1UE7 A;  5FLX E;  1I4P A;  3K5O A;  3U9O A;  1CQF A;  2LFN A;  2RDG A;  3A54 A;  3RLN A;  3HOZ G;  2IL8 A;  5IP7 G;  5LMU L;  1K83 H;  1GUT A;  1N34 Q;  4C3I G;  4HCE A;  1Y14 B;  4DR4 Q;  3L0O A;  4ZK9 B;  5C0X J;  1S5E D;  1X3Q A;  2KCN A;  1M90 C;  3ERQ A;  3HOY H;  4F7X A;  4DR1 L;  2B63 B;  5IGD A;  3R93 A;  4RHS A;  5LMN W;  1EFW A;  4WRD A;  5FLX c;  4OIK A;  1S3O A;  1AZP A;  2CH4 W;  4DF7 A;  4JI2 Q;  2KQ3 A;  1PRT B;  3V2T A;  4IN3 A;  1K83 B;  4A3E G;  2I5L X;  1JMC A;  5DM7 3;  4IUT A;  1MSH A;  1U4M A;  2RDF A;  1PTO B;  1OXS C;  5IT9 c;  1BCP B;  3J81 E;  1TS2 A;  3K5L A;  4P75 A;  4G7Z C;  1K3B C;  2Q2I A;  4OO1 G;  4LWC A;  4IUU A;  3BVZ A;  4RGO S;  1EQQ A;  1NBW A;  3PUW A;  2BOS A;  2VUM H;  1B44 D;  1S4Z A;  3U4V A;  1D2B A;  3I72 A;  3IRB A;  3CQZ B;  3P1H A;  4HCS A;  3FKI G;  1WTO A;  2K33 A;  1VMC A;  4A3G H;  1N32 L;  3F8T A;  4AYB B;  2YYZ A;  4A93 H;  3OTO Q;  3OW7 A;  1D5X C;  1PZK D;  1FGU A;  3A74 A;  1BNZ A;  2LY7 A;  1EIH A;  2JJQ A;  2F0I A;  1A2T A;  4YIJ A;  1QJO A;  1WCM G;  3HP3 A;  3MVV A;  4B08 A;  4YWK A;  2Q8R E;  2WFW A;  3GD7 A;  3PCO B;  2G9D A;  2NTS A;  1K28 A;  3E0J A;  4UY8 C;  2A19 A;  1TWH B;  4DV5 L;  4OEL B;  2V1C C;  3BZK A;  3PO3 B;  2RCF A;  2NYZ D;  4O0A A;  1FNV A;  4CJ0 B;  2WV6 D;  2J0T D;  1XYI A;  5C5L A;  2ZXP A;  4FF1 A;  4RKL A;  1V1P A;  2JEA I;  4LF9 Q;  5ISR A;  4BBS H;  5KIX A;  4YHH L;  4V19 0;  4QCL A;  3ONA B;  4ZUI A;  5HUR A;  4DR4 L;  1SRU A;  1SNC A;  1RD9 D;  1G2S A;  1RCV D;  4Q5V A;  4L63 B;  1JWM D;  2HCC A;  1Q8I A;  4K2K A;  1KAW A;  2TSS A;  4B9W A;  4IFD I;  5GRO A;  3TME A;  2ZTC A;  4FP5 D;  3VR3 A;  4HJ8 A;  2CWA A;  4GLV B;  4LUO A;  5LMN Q;  5I6W A;  1LO5 D;  1O7I A;  3L2P A;  3CMA A;  4B3T Q;  3FRP B;  2DJF C;  3AU7 A;  1EIF A;  4K0K Q;  2F0J A;  1X56 A;  1GUW A;  1EY6 A;  3G6E A;  3PSI A;  2F0N A;  3PUV A;  3HOW G;  1HRJ A;  4A3B B;  1DGS A;  4GOP C;  1TWF B;  1SE3 A;  1MI2 A;  2EYH A;  3IFD A;  3J7Z C;  1R4P B;  2PQA A;  4X3K A;  4F8M A;  5COY A;  3T4A C;  2L1B A;  2DNC A;  2ICE C;  1IBL L;  4A3D H;  1T5E A;  2Q8T A;  5BN5 A;  3QB3 A;  4C3J H;  3CCQ A;  3OW2 A;  1U5K A;  2AQ1 B;  1ESF A;  5JJI A;  2A68 D;  2F4V L;  3S15 H;  1N36 L;  1DM0 B;  4DV3 L;  2UXB L;  1SYC A;  2JQO A;  3H15 A;  4PV1 C;  5E3F A;  4BY7 G;  4FDB A;  5CGK A;  3NSW A;  1GVP A;  1WCM B;  2NVX H;  3EN2 A;  3CCR A;  1UEB A;  4IPD A;  4NXM Q;  5C0X G;  1CZW A;  2JE6 I;  4HN7 A;  3M4O H;  5EPL A;  3R3O A;  1XPO A;  3D8G A;  3NXW A;  4JG2 A;  2NZO A;  1UEA B;  4HAE A;  1EYC A;  5M5Y B;  1K8G A;  1O7Z A;  5A35 A;  3J81 j;  1FNU A;  2I07 B;  4A3J B;  1TVX A;  2ZXO A;  2R7F A;  4DV6 Q;  1NAP A;  2WIN B;  3F1Z A;  4DK0 A;  1Y1V H;  2R92 B;  4Q0F A;  5IIF A;  5CV6 A;  5DEH A;  4YY3 Q;  4JYA Q;  4R4T A;  3OOC A;  4OWX B;  2I0Q A;  1VQB A;  4ZRZ A;  2RSN A;  1B70 B;  4XQN A;  1Y8O B;  1ICW A;  1KTK A;  2F0H A;  3FPU B;  5KEE A;  4AH6 A;  2F03 A;  3D31 A;  4JI5 L;  5HGT A;  3Q22 A;  3I8Z A;  4B3R L;  4A3K H;  4IOC A;  3PIO 3;  4QIW E;  3HOY G;  3FPP A;  3UDF A;  3D6W A;  4KV6 A;  1TS5 A;  1XX8 A;  1FD7 D;  1CKN B;  2EYM A;  3CW2 C;  2UUA L;  4H7B A;  2KEE A;  1PLF A;  4H13 C;  1ILQ A;  1GM5 A;  4KY5 A;  1HA5 A;  1WTR A;  5BR8 L;  4A3F G;  4B3M L;  1VQK A;  1PH8 A;  1TWG H;  4PNY A;  1WTV A;  2K01 A;  4F87 A;  3KF8 A;  4DK3 C;  3K6O A;  3M9B A;  4RGN A;  4IOA A;  3SDZ A;  1G6P A;  4DR6 Q;  1SXT A;  5JEA H;  1QNU A;  4BA1 I;  1ENF A;  5LL6 S;  1Y1W H;  2ZTE A;  3RLF A;  3S16 B;  2XTI A;  3BVM A;  2A5H A;  4A3G G;  3UI2 A;  1HZA A;  1EZ6 A;  1UWV A;  3JAM E;  1SYE A;  1PYB A;  4GKK Q;  1CKM A;  2JA8 H;  1U4P A;  1HNZ L;  2RA4 A;  2YTV A;  2A6E C;  1ZEQ X;  2VY3 A;  1KD1 C;  4JI6 Q;  3EQL C;  3G7L A;  4XT1 B;  2K4K A;  3HOX H;  1X65 A;  3VR4 A;  1RF2 D;  2K1B A;  4A3I H;  5C4H A;  3GDE A;  4HMI A;  1VQG A;  3GTO B;  3RD4 A;  2MNA A;  3P75 A;  2GVB A;  4QQB X;  1B50 A;  1VQ9 A;  2B2T C;  2F0V A;  3MXP A;  2CCZ A;  3BZC A;  3JAM c;  3I56 A;  2SOB A;  2AWO A;  2B8F A;  4DA2 A;  2Q2T A;  4CJ1 B;  4X64 Q;  1PFM A;  4DXG A;  2E5L L;  3SR1 A;  4KKU A;  1KXL A;  5COR A;  4DV3 Q;  2E2H H;  3MA2 B;  4GN3 B;  3SK5 A;  4XXE A;  1QCB D;  4CBV A;  2SNM A;  4A3L H;  4K0K L;  4ZKB B;  5EGT A;  3HKS A;  3GV3 A;  4OHJ A;  1JWU D;  3WWV A;  4FF3 A;  1BF4 A;  1VQH A;  4C3H H;  5C4X B;  3X3M A;  3HOV H;  4CDE C;  2N55 A;  5IYD H;  4K5V A;  1HZB A;  4JI1 Q;  4XQJ A;  1DON A;  1SMY D;  5A2Q L;  4R8N A;  2K5V A;  1R9T H;  4LF4 Q;  3C1F A;  4KY6 A;  2VNU D;  1NR4 A;  4IO9 A;  4BXX G;  1I6V C;  1R4Q B;  3GTJ H;  2B63 G;  3RZO H;  1M8A A;  5CV5 A;  1CA6 A;  2JA5 B;  2J7Z A;  1Q1E A;  3I90 A;  3HKZ G;  5JEA J;  2OQK A;  4R4Q A;  1XNR L;  1AEX A;  3L7Z C;  2H5X A;  1XTD A;  2EVB A;  5BR8 Q;  1F77 A;  4BY1 H;  1X3E A;  1B3Q A;  2MFI A;  1F9P A;  3GTL H;  1WTP A;  3TS2 A;  2FXQ A;  5KNC A;  3HKZ B;  3DLL A;  4EQ5 A;  2A69 D;  4GNX A;  3NQT A;  4RH6 A;  3KLS A;  5GQO A;  1YVC A;  2WII B;  4EQN A;  1DYQ A;  2B2U C;  1YIJ A;  1EYA A;  1RTN A;  2PZU A;  3PIP A;  4TSS A;  3D0F A;  1G6Z A;  3MTS A;  1TQO A;  4M1U B;  2KBN A;  4U67 3;  4DV0 L;  3L3O C;  4EVO A;  3VR2 A;  2EE1 A;  2N3S A;  1X32 A;  1ESR A;  1PH5 A;  5FO9 B;  4YY3 L;  4JYA L;  2JEB I;  5TSS A;  3HOW H;  2OT2 A;  2F0K A;  2XNA C;  3HZX A;  2R93 B;  2UU9 L;  3M85 A;  3CME A;  1GOZ A;  1P16 A;  4QUC A;  2RCN A;  4OEM B;  3TP7 A;  3GTM H;  1ENC A;  3GTP H;  4CKB A;  1HPC A;  3S1R H;  2O2L D;  1DCZ A;  3TZD A;  1SE4 A;  2R7Z G;  2IX0 A;  4DPG A;  3S1N H;  3S1Q H;  4UP8 A;  2E2I H;  3QO2 A;  1EQV A;  1STE A;  4OX9 Q;  3KLS X;  2UU9 Q;  1CTM A;  3EVQ A;  2KHS A;  4RFB A;  1E2Z A;  4X65 L;  2HHH Q;  2B39 A;  2X69 A;  4K14 A;  1TS3 A;  1B7Y B;  3OTO L;  2K5W A;  5C3E B;  5FJ8 G;  1C4Q A;  1LLR D;  1Q8K A;  1JJG A;  1G51 A;  2Z4H A;  3KDF A;  1HR0 Q;  1EYD A;  3PO2 G;  4DV0 Q;  1BVS A;  4BBR H;  2Y0S E;  1ILP A;  1DD2 A;  2EXD A;  2Y0S B;  1TII D;  1V8Q A;  3KF8 B;  1JE4 A;  3N52 A;  3MXN A;  4AYB E;  1X3G A;  1H9R A;  4I65 A;  3BJU A;  1E0B A;  3CU7 A;  2E8G A;  3NEN A;  2D62 A;  3BS1 A;  1Q90 A;  3GTG H;  3H3V H;  1S5D D;  1C0A A;  2PNR C;  3GTG B;  4OL7 A;  1MIU A;  3G4S A;  2A74 C;  1S5B D;  4WOR A;  4JI2 L;  4FYD A;  2IHE A;  1FYC A;  1I94 L;  3K57 A;  4DNT B;  1Y1V G;  1BCP F;  4DFA A;  3MZ5 A;  3RR5 A;  3URY A;  4EX5 A;  4C56 C;  1Q82 C;  1O78 A;  1PHJ A;  4PZ7 A;  2M00 A;  3RUZ A;  1LT6 D;  3NBI A;  2IWH A;  3NEM A;  5LMN L;  3CP0 A;  5J3B A;  3R8B A;  3J7Y W;  3J7A F;  5JPM C;  2WAQ E;  5M3F H;  3NHH A;  4A3K G;  2JA8 G;  5JVG 3;  4A3E B;  1H9M A;  2VQF Q;  2UXC L;  5KYI A;  4JI3 L;  4KN7 C;  1SDF A;  3PUY A;  3SK8 A;  1X54 A;  4LF8 L;  1OXU A;  3TRZ A;  1Y69 U;  4HIO A;  3AEV A;  4A3J G;  1KNE A;  2WKD A;  5CR3 A;  3GTP B;  2JK8 A;  1LTS D;  3MXG A;  1UUP A;  2EIF A;  1CM9 A;  2E2J B;  4J1M A;  4KHZ A;  2JA6 B;  4A3F H;  2OEO A;  3A7A B;  2AQ2 B;  4H0L C;  4F88 A;  3MFY A;  3R2T A;  1A63 A;  3PV0 A;  3HOU B;  2PQA B;  1DJR D;  1QUQ B;  3FKI B;  4B3S Q;  2A68 C;  4LFA L;  5M5X H;  2MO1 A;  3VR5 A;  1YBY A;  5EBC A;  1XMO L;  3I4N G;  1NCV A;  4KMU C;  1CHQ D;  1EEF D;  2EJM A;  4JC0 A;  4AQY L;  3ICE A;  4AIM A;  3BDC A;  5K36 H;  4JI7 L;  5EPJ A;  1BBU A;  3KLR A;  2KCC A;  3SEB A;  1IL2 A;  4YWL A;  4A3L G;  2N49 A;  1GJX A;  4RMF A;  3I2Z A;  3S14 H;  2IPK D;  5FKA C;  2HUG A;  4UHV A;  1OTC A;  4EQO A;  3QOL A;  4KD4 A;  4CDD C;  4PMC A;  4A93 G;  5IYD G;  2D5D A;  4DUY L;  4GN4 B;  2AMC B;  5EBD A;  1VQI A;  1I4X A;  3CC2 A;  2NN6 I;  3KJO A;  1M1K C;  1HXY D;  1HH2 P;  3HS0 C;  2CQA A;  1EY5 A;  4A3I G;  3RLO A;  2VS1 A;  1SMX A;  4DAY A;  1I4G A;  1KIX A;  4X66 L;  3M7G A;  2EY5 A;  1B9N A;  1H9K A;  1LUZ A;  1V43 A;  2IHF A;  3SHL A;  4P73 A;  4JW0 A;  3I70 A;  1HHV A;  1K0S A;  4DAM A;  2F4I A;  4POG A;  3GTQ B;  3CD6 A;  3O13 A;  1A3U A;  4MNO A;  2QKI C;  3H6M A;  1VQJ A;  4UP9 A;  5M3F B;  2WP8 J;  4C3H B;  4BBS G;  4LNQ A;  1CHP D;  1PXU A;  3I4M H;  4HIM A;  4A3M H;  2BE5 C;  4QMG A;  3VA7 A;  3ZYY X;  3LNN A;  1MD2 D;  4LJZ C;  5ELO A;  5A2Q E;  1QZG A;  1K73 C;  2LXJ A;  5C44 B;  4RCN A;  2XRQ D;  3A7L A;  1CZG A;  1BBX C;  1LTI D;  3TRE A;  4ABN A;  2BCO A;  1STG A;  2ASB A;  3I91 A;  2IJ0 A;  2VW9 A;  3CCU A;  5JAV A;  2NVY H;  1V1Q A;  1ZKO A;  2CW0 D;  3CRK C;  1EUJ A;  4G7H C;  3T56 B;  2BE5 D;  1UE5 A;  4NDX A;  1EWI A;  2Z6K A;  1Q1B A;  3T51 B;  2UUA Q;  4OXP A;  2EYO A;  3T16 A;  4HR7 B;  4ZQ3 A;  4BBR B;  1VQA A;  1D1K A;  3QWN A;  2LXK A;  3CCV A;  4LUV A;  3P7J A;  3Q24 A;  2EJF C;  2IY5 B;  5IYC H;  3QIA A;  4NP5 A;  1SR3 A;  3DMU A;  3BZD B;  1KRT A;  1KL9 A;  3STB D;  4GZY C;  2B2T A;  1OO9 B;  1I3Q H;  3S16 H;  2AUK A;  1QVF A;  3S1N B;  1I4H A;  4DNI A;  4DR2 Q;  4DV1 L;  1HUN A;  5LL6 X;  4PMW A;  1AP0 A;  1EQT A;  5J1Z A;  1W3S A;  4CDF C;  1D5M C;  5H1S E;  3GTM B;  5IWA Q;  5F2D A;  4A3C H;  4WFN 3;  1B9M A;  2K5D A;  4GOP A;  1AN8 A;  1EY4 A;  1FNW A;  2EY6 A;  4ZYS A;  1NNX A;  3PIP 3;  3K8A A;  3RNU A;  3CC7 A;  3VDY A;  3HFZ B;  4NPS A;  3QOJ A;  1XPU A;  1K8O A;  1ASZ A;  1TU2 B;  1YNJ D;  1PH4 A;  4ODG A;  3NEL A;  3WOE A;  3KUP A;  3MAQ A;  3J80 c;  1LTB D;  2K32 A;  2A6E D;  3OWF A;  4JI4 L;  2YU9 H;  1IBM Q;  3DEO A;  4DAP A;  1S5C D;  4ZCK A;  4DR5 L;  2XSC A;  4A3K B;  1EQR A;  2JA7 B;  4GNX C;  2F0T A;  3E9I A;  3VYU A;  2F0U A;  2HD3 A;  4IUN A;  4H44 C;  3RN5 A;  1MGS A;  3J7A V;  3BU2 A;  4K8J A;  1LAB A;  4JOI A;  4KD3 A;  2DNE A;  1N36 Q;  3N6R A;  4R9W A;  3OYY A;  3GTL B;  3KBG A;  3ND8 A;  1XNQ Q;  3I4L A;  2KVM A;  1SEB D;  2XWJ B;  1SN8 A;  5EKK A;  4J6H A;  1UE1 A;  2EYJ A;  1Y1V B;  2CW0 C;  1BDO A;  4IAL A;  3U50 C;  2F0G A;  2NZH A;  2OTL A;  4A3J H;  4DV2 L;  1FL0 A;  2GVA A;  1FVI A;  1IKM A;  3RZO B;  3H0G H;  3GTJ B;  4G57 A;  1WD0 A;  2KED A;  1B2T A;  2FFK B;  3OMC A;  5IOD A;  5IYB H;  4PZ6 A;  4DGZ A;  1LV9 A;  3UDX A;  1ML0 D;  2F0E A;  1VQ5 A;  1WTQ A;  4YWM A;  3KDF B;  5CBA E;  1UE6 A;  4CDC C;  1YJ9 A;  4IPG A;  5CMD A;  2AHO B;  2BA0 A;  3BYY B;  2I5H A;  5C6A A;  1V1O A;  1ET9 A;  2KCM A;  1SNP A;  1XWE A;  4ULL A;  3MFG A;  3IFT A;  2H4O A;  2Q2H A;  1W2B A;  3AQQ A;  2ZJR A;  1GHK A;  1A3V A;  3HOU G;  1HQM C;  1VS0 A;  3C3L A;  1WYD A;  1STB A;  1K8A C;  4R4O A;  4L8J A;  1PH2 A;  2E75 C;  4GKJ Q;  4K6L A;  2FJ2 A;  3AYH B;  1NTG A;  3K7U C;  2F0M A;  1LYL A;  1E1T A;  5JPN C;  3AB9 A;  2X6G A;  3T1H Q;  1JT8 A;  4O42 A;  2B2Y A;  2KEC A;  3OHX C;  3P20 A;  1BCP D;  1GXD C;  3GTO H;  4A3I B;  1YHB A;  1PFN A;  1E1O A;  3D4D A;  2KA7 A;  1PH1 A;  2RBM A;  2G9H D;  4JBJ A;  3SGI A;  2D0O A;  1STH A;  3TQY A;  3U9S A;  1EOV A;  5C3X A;  1H9S A;  3S9W A;  1SE2 A;  3A56 A;  5IP9 H;  3ZJY C;  3H91 A;  2JN4 A;  1N33 Q;  2JA8 B;  4LFC Q;  1C7Y A;  2EYP A;  2EXZ A;  3OWE B;  1DXM A;  4ME3 A;  4OWW B;  1QB5 D;  1VQC A;  2R93 G;  2NN6 G;  2XRS D;  4BWG B;  5C4J B;  1ENA A;  2AWN A;  4IZ8 A;  4QL5 A;  1YJW A;  1A3T A;  1NUC A;  1Y1W B;  5DLQ E;  1HR0 L;  1H95 A;  2F52 A;  1HR0 W;  4I7Z C;  2WB1 E;  1JIC A;  4LFB Q;  3K59 A;  3H0G B;  2QDB A;  3DUZ A;  4LAA A;  1A15 A;  1PZI D;  4BBS B;  1XMQ L;  1JOR A;  5T1I A;  2UXD Q;  2WAQ G;  2Z4I A;  4NXN L;  4OX9 L;  1HTL D;  3U58 A;  1JOO A;  4WJ4 A;  3GTK H;  2NVQ B;  3TZU A;  1C8C A;  1GKH A;  1PRT C;  2ATW A;  1CSP A;  1PYW D;  1STN A;  3DWA A;  4LMQ D;  2R92 G;  3NBH B;  1XPR A;  3H3V I;  2A73 B;  3J80 L;  1YNX A;  4XQQ A;  4ILW A;  1PVO A;  1EY8 A;  1G91 A;  5IGB A;  2PNH A;  4X6A H;  1AE3 A;  4A3D G;  3K80 C;  2YU9 B;  4DUY Q;  2FMM A;  2YTY A;  4FO2 A;  1N8R C;  4BY1 G;  1JJ2 A;  4LUZ A;  2HDM A;  1PRT D;  4RA8 A;  3K58 A;  3CQZ H;  4X62 Q;  1CUK A;  4RHR A;  2NVQ H;  3GTK B;  1IXR A;  4JI3 Q;  1XXG A;  4APV A;  5IY0 A;  4CJ2 C;  1U0L A;  4CKE A;  4XT3 B;  3R2I A;  3E0E A;  1ROD A;  5KYL A;  2LMC B;  3PUZ A;  5C44 G;  3EJI A;  4A3C G;  2MUY A;  1Q12 A;  1J9O A;  3JAM i;  2CQO A;  3TS0 A;  2L15 A;  2QDL A;  2EY1 A;  2F0W A;  5I9O A;  5C4J H;  3K81 C;  2NVX B;  1VQ4 A;  4X64 L;  3STB C;  4JI0 Q;  5J39 A;  2OTJ A;  2K52 A;  1NMF A;  1IYJ B;  4EQP A;  3S15 B;  3Q6S A;  1EOT A;  1GUS A;  3MC0 B;  3A55 A;  1BCP C;  2IW3 A;  1VQ6 A;  1CI3 M;  1VQM A;  4HJ7 A;  4A4I A;  3Q8D A;  5G3L F;  3KFU A;  1OXV A;  4JI1 L;  4A3B G;  5C0X I;  4JBK A;  4QUF A;  2CWP A;  3TDQ A;  4KJN A;  3CCM A;  4NXN Q;  1K8M A;  1QVC A;  1QUQ A;  2C35 B;  3VYT A;  1O7L A;  2N78 A;  1RHP A;  1W6K A;  3K5N A;  2Z6B A;  5IGG A;  1ONL A;  4G4K A;  2K05 A;  1Z47 A;  2ES2 A; 
#chains in the Genus database with same CATH homology
 4DN4 M;  4QIW B;  2I46 A;  5ELE A;  5CV9 A;  1HFG A;  1YNN C;  1Q3L A;  3F2U A;  4LK1 C;  3I4M B;  1F9S A;  2IX1 A;  5I9P A;  4ID6 A;  4OGQ C;  1STA A;  3OMG A;  5IGE A;  3TBI B;  2CHB D;  1YNJ C;  3A8K E;  1MSG A;  3C1E A;  5CBE E;  4RGT A;  1B1Z A;  1YNN D;  1ZYR D;  1E2V A;  3DEP A;  5ELF A;  2L55 A;  4MIU A;  4XDX A;  4HSP A;  4KHV A;  2KJX A;  2PCF B;  3C2P A;  3VYR A;  4XYQ A;  4KK7 A;  4FXG C;  1WVL A;  1I4Q A;  2SNS A;  2NUC A;  4E6I A;  4KI0 A;  3J81 L;  4IUR A;  1VDZ A;  1TT2 A;  4S3S A;  3TN2 A;  1LAC A;  4QB4 A;  4A93 B;  2SDF A;  2ZXR A;  1QG7 A;  2ID0 A;  1XTC D;  2LS0 1;  2QEJ C;  3X3N A;  4A3G B;  1E2W A;  5JOB A;  3W2D A;  2PZW A;  5DM6 3;  1PDQ A;  1AW7 A;  5DNF A;  4A3F B;  4N9P A;  1O7Y A;  3CKI B;  2WB1 B;  1I6H B;  1KDB A;  4XYO A;  2FIN B;  1CK1 A;  5FOB B;  3M4Y A;  4CGY B;  4ZLT F;  1SJE D;  5IT9 E;  2HDL A;  1I3Q B;  3BDO A;  2EJG C;  2MPM A;  4JBW A;  3KBX A;  1DOK A;  1EU3 A;  1U4L A;  3V96 A;  2K04 A;  2DY7 A;  2XWB B;  1SJH D;  5KNB A;  3HOY B;  1DOM A;  4C1N K;  4TKO B;  5FLX L;  1H9S B;  2F3W A;  3LX0 A;  3AMU A;  1QNK A;  3D4W A;  4TRD A;  1SBB B;  5K5P A;  2NN6 H;  2RSO A;  5EJW A;  1VMP A;  3NBH A;  3E6Z X;  2NVY B;  3DM1 A;  2LKV A;  4V0B A;  1V1P B;  1RKN A;  4IFD J;  4DAV A;  1Z7T A;  1WTX A;  5C5M A;  2EDG A;  2C9O A;  4XTC S;  2ENB A;  5BN3 A;  5CV4 A;  3RZD B;  2E76 C;  4A3M B;  1SYF A;  4K6D A;  5KGU A;  4RGM A;  1SYG A;  1HQR D;  2K5Q A;  4NMZ A;  1EL0 A;  1DZ1 A;  2HQE A;  2F0Q A;  4QF4 A;  1EZ8 A;  3S1Q B;  5ELB A;  3IKJ A;  2B2Y C;  2L4N A;  3S1R B;  1ET6 A;  3TP6 A;  1TY2 A;  2F3V A;  3HOZ B;  4C3J G;  3I73 A;  4DNR B;  4CKC A;  3HOW B;  3TP5 A;  2B8G A;  1Y8P B;  2MHV A;  3ERO A;  2DY8 A;  5E4X A;  5KND A;  4K2L A;  2R7Z B;  1J8I A;  1FGB D;  2A6H C;  4K5W A;  2OXP A;  1BXT A;  4IUQ A;  1D6E C;  5EPK A;  3S14 B;  1PTO C;  5C3W A;  3ITP A;  2EYF A;  4IUV A;  3DWP A;  5JJZ A;  2K28 A;  2WKC A;  5CYU A;  4NW2 A;  4KJO A;  3NE5 B;  2MGS A;  1TWA B;  5G3L D;  4BY1 B;  1HA6 A;  5M5X B;  4RWS C;  2XIW A;  2R61 A;  2K6A A;  2R3Z A;  2PO4 A;  1OXX K;  1II3 A;  4IFD H;  1X3P A;  2WAC A;  2F0O A;  5IGC A;  4FF2 A;  3SXH A;  1OXT A;  3NWT A;  5FO8 B;  1JCK B;  1CFM A;  2BDO A;  2IT1 A;  3EA6 A;  2F1M A;  2PQE A;  1JC7 A;  2FMC A;  3HOV B;  1SNQ A;  1EY9 A;  1PZJ D;  1PTO F;  4FXK C;  3A8I E;  5DAU A;  1S5F D;  1B3A A;  2EY2 A;  2QCP X;  3SE0 A;  3D3R A;  2RQX A;  1I50 B;  3Q23 A;  4BY7 B;  5K36 G;  2Q8I B;  4G7O C;  5NUC A;  2JP1 A;  4Y7N B;  2PMZ B;  5FO7 B;  1DOL A;  1IHZ A;  4WJW A;  3I4N B;  4X3U A;  3DWQ A;  5FK9 C;  5C4Z A;  1PTO D;  1AZQ A;  3NTK A;  2VB3 X;  5CV8 A;  4IQZ A;  1EY0 A;  5D14 A;  3TSS A;  1CA5 A;  1EWH A;  2F0F A;  2KOL A;  4C2M B;  4TQU S;  3GQB A;  3NPP A;  1D5Z C;  1EIG A;  3MXU A;  1O80 A;  2OF1 A;  5I4D A;  1GUN A;  4UDU C;  1PFB A;  2NZ1 D;  4PMB A;  2D9U A;  2E2I B;  5JVH 3;  3GO5 A;  3V05 A;  3DXJ C;  4RKB A;  1WTW A;  2NTT A;  4KN4 C;  1BUV T;  3IL8 A;  2F0S A;  5M3M B;  1GUO A;  3RMH A;  4MHE A;  2L11 A;  4N9T A;  4FF4 A;  5D65 A;  1F2Z A;  2F0L A;  3QJY A;  2E2D C;  1SFO B;  3L9A X;  4C3H G;  2RKS A;  3NWS A;  2B2W A;  5IT9 L;  4O1N A;  1RDP D;  1IW7 D;  3I3C A;  4M8A A;  2H1E A;  3TP8 A;  4BA2 I;  2RDH A;  2JSO A;  4CHT B;  3E5S A;  4PQX A;  2V4D A;  4X3T A;  3PO2 B;  1G2T A;  1GHJ A;  4ME5 A;  4C3I B;  1QWY A;  1TY0 A;  3H09 A;  2ZT9 C;  4P2C B;  2VB2 X;  2TMP A;  2NBF A;  3WOF A;  4KTA A;  1L0Y B;  1LTA D;  4B9X A;  2PZT A;  3T13 A;  2L9H A;  1NR2 A;  3DHQ A;  1F2Y A;  2EYL A;  2JXM B;  2B2U A;  2QF7 A;  1KDC A;  1R9T B;  3M4O B;  3WDN A;  1LTR D;  4BS9 A;  1FR3 A;  1QIL A;  5EQ0 A;  3LWU A;  3K7A B;  3A8J E;  4NKL A;  1M4V A;  3VA5 A;  1H9J A;  1SSO A;  3NTI A;  3BVG A;  2AUJ D;  2E2H B;  3CRL C;  1SMY C;  3J80 E;  3W3A A;  1KAA A;  4KKS A;  4L6T B;  4A3D B;  2K03 A;  3S1M B;  1LTT D;  2O5I C;  2HCI A;  2MP1 A;  4RCO A;  1A2U A;  5M9O A;  1D1I A;  1TR5 A;  3M7N A;  2F0P A;  2K7V A;  1EU4 A;  1VF5 C;  4IFD G;  4ZUJ A;  1F9R A;  4HED A;  1IL8 A;  2O5J C;  2F0D A;  1AFP A;  3NK9 A;  3HOX B;  4XIG S;  1KLU D;  5CV7 A;  1RTO A;  2CVR A;  3VR6 A;  5I2Y A;  2B2V C;  4DK1 A;  1A6X A;  3BYT B;  1KLG D;  2L12 A;  5AFW A;  2ICI A;  5J22 A;  3OIP A;  4OIJ A;  1SNM A;  3NQI A;  3S2D B;  2B2V A;  1G8Z D;  5KRU A;  1STY A;  2IX3 A;  2A6H D;  1HUM A;  4FXD A;  2EPB A;  5JEA G;  1CQV A;  1VCI A;  1KAB A;  1EY7 A;  4OO1 H;  1RJT A;  1TWG B;  3OIQ A;  3FEW X;  2MJ8 A;  4UAI A;  5BN4 A;  1C48 A;  2FHT A;  4X3S A;  1UNS A;  3Q0A A;  1BQQ T;  2SEB D;  3GP7 A;  1QOH A;  1KNA A;  1U9R A;  3ND9 A;  2D2C C;  2JYO A;  2NB0 A;  4ZAI A;  2VXW A;  3MHB A;  1TWC B;  2NVT B;  3FVQ A;  1CT1 D;  5I6Y A;  1B53 A;  5LHY 1;  2A69 C;  4RAU C;  5T1G A;  2KUM A;  1Z6H A;  2NWG A;  4KY7 A;  1IKL A;  3NP8 A;  3SK6 A;  4JK1 C;  1GUG A;  1KDA A;  5E1F A;  2M2L A;  4C1N I;  5D3D A;  1F2L A;  1BO0 A;  3BG3 A;  1VF7 A;  3HGB A;  1B4O A;  1LT3 D;  2X6L A;  2N88 A;  1JWS D;  1PTO H;  2O4X A;  3MEH A;  4HSV A;  1IYV A;  2PYK A;  1JOQ A;  2BDN A;  1LTG D;  4DU9 A;  1F2M A;  2E74 C;  1G29 1;  5D3I B;  1LT4 D;  3M3Y B;  2J4X A;  4OO1 I;  4EGV A;  1TKW B;  3SK4 A;  2L5T A;  2GA4 B;  3HEJ A;  4C3J B;  3SVM A;  1LT5 D;  1PRT F;  1ZXT A;  4K5X A;  1HFN A;  3OPO A;  2R6G A;  4J8Q A;  5M5W B;  1EWC A;  2C5C A;  1SAP A;  4K8I A;  1HCZ A;  3OSO A;  1IYU A;  2Z1C A;  3KK7 A;  4HMJ A;  3CHB D;  1U4R A;  2AQ3 B;  3D6C A;  3GV6 A;  1L0X B;  3NUC A;  4IUP A;  2PW5 A;  3QG1 A;  3T53 B;  1JOK A;  4ZKC B;  3VYS A;  2PW7 A;  5ELC A;  1BR9 A;  4FNF A;  3D4R A;  2L0C A;  5I2X A;  3HG9 A;  3HRZ C;  3NTH A;  5EKL A;  2XVS A;  5EKI A;  5C0X H;  3G6J B;  2PPB C;  1HTP A;  2DN8 A;  1I4R A;  4R8I A;  1TS4 A;  1SYB A;  1F9Q A;  1EFI D;  1ZYR C;  4HTH A;  1UAP A;  2Z8L A;  3LWE A;  1W6J A;  2M9V A;  2XN9 C;  4Z9C B;  2BA1 A;  1WD1 A;  3BDL A;  3S17 B;  3PMF A;  5E4W C;  5ELD A;  1JQY D;  3JAM L;  1PMR A;  3H3V C;  4U68 A;  1QE6 A;  3MWY W;  2EOT A;  3IAY A;  1T5X D;  1Y8N B;  1JB3 A;  2EZV A;  1SNO A;  1BOS A;  1NSN S;  3S2H B;  3FDT A;  1SYD A;  3PUX A;  1MBY A;  5IGF A;  1SND A;  3C46 A;  2QIL A;  2RVL A;  1JR0 D;  2WAQ B;  3H94 A;  3FMC A;  2VUM B;  4KKT A;  5CC4 A;  1EEI D;  3K5M A;  3K0Y A;  4FVM A;  2B2W C;  4DXF A;  3EFX D;  1IW7 C;  4MN3 A;  5IOC A;  5FLX E;  1I4P A;  3K5O A;  3U9O A;  1CQF A;  2LFN A;  2RDG A;  3A54 A;  2IL8 A;  1GUT A;  4C3I G;  4HCE A;  4ZK9 B;  5C0X J;  1S5E D;  1X3Q A;  2KCN A;  3ERQ A;  4F7X A;  2B63 B;  5IGD A;  3R93 A;  4RHS A;  4WRD A;  1AZP A;  4OIK A;  4DF7 A;  2KQ3 A;  1PRT B;  3V2T A;  4IN3 A;  1K83 B;  5DM7 3;  4IUT A;  1MSH A;  1U4M A;  2RDF A;  1PTO B;  1OXS C;  1BCP B;  3J81 E;  1TS2 A;  3K5L A;  4G7Z C;  4OO1 G;  4IUU A;  3BVZ A;  4RGO S;  3PUW A;  2BOS A;  1B44 D;  1S4Z A;  1D2B A;  3I72 A;  3P1H A;  3CQZ B;  4HCS A;  1WTO A;  2K33 A;  1VMC A;  4AYB B;  2YYZ A;  3OW7 A;  1D5X C;  1PZK D;  1BNZ A;  2LY7 A;  1EIH A;  2F0I A;  1A2T A;  4YIJ A;  1QJO A;  3HP3 A;  3MVV A;  4B08 A;  2Q8R E;  3GD7 A;  2G9D A;  2NTS A;  3E0J A;  1TWH B;  3PO3 B;  2NYZ D;  4CJ0 B;  1FNV A;  2WV6 D;  2J0T D;  1XYI A;  5C5L A;  2ZXP A;  4FF1 A;  4RKL A;  1V1P A;  2JEA I;  5ISR A;  5KIX A;  4V19 0;  4QCL A;  3ONA B;  4ZUI A;  5HUR A;  1SNC A;  1RD9 D;  1G2S A;  1RCV D;  4Q5V A;  4L63 B;  1JWM D;  2HCC A;  1Q8I A;  4K2K A;  2TSS A;  4B9W A;  4IFD I;  3TME A;  4FP5 D;  3VR3 A;  5I6W A;  1LO5 D;  3FRP B;  3AU7 A;  2F0J A;  1GUW A;  1EY6 A;  2F0N A;  3PUV A;  1HRJ A;  4A3B B;  1TWF B;  1SE3 A;  1MI2 A;  2EYH A;  3IFD A;  1R4P B;  4F8M A;  4X3K A;  5COY A;  3T4A C;  2L1B A;  2DNC A;  2ICE C;  1T5E A;  2Q8T A;  5BN5 A;  3QB3 A;  2AQ1 B;  1ESF A;  2A68 D;  1DM0 B;  1SYC A;  4PV1 C;  5E3F A;  5CGK A;  3NSW A;  1WCM B;  5C0X G;  1CZW A;  2JE6 I;  4HN7 A;  5EPL A;  3R3O A;  3D8G A;  3NXW A;  1UEA B;  4HAE A;  1EYC A;  5M5Y B;  1O7Z A;  5A35 A;  1FNU A;  2I07 B;  4A3J B;  1TVX A;  2ZXO A;  1NAP A;  2WIN B;  4DK0 A;  2R92 B;  4Q0F A;  5IIF A;  5CV6 A;  5DEH A;  3OOC A;  4ZRZ A;  2RSN A;  4XQN A;  1Y8O B;  1ICW A;  1KTK A;  2F0H A;  3FPU B;  5KEE A;  2F03 A;  3D31 A;  5HGT A;  3Q22 A;  3I8Z A;  3PIO 3;  3FPP A;  3D6W A;  4KV6 A;  1TS5 A;  1XX8 A;  1FD7 D;  2EYM A;  4H7B A;  2KEE A;  1PLF A;  4H13 C;  1ILQ A;  4KY5 A;  1HA5 A;  1WTR A;  1WTV A;  4PNY A;  2K01 A;  4F87 A;  3KF8 A;  3K6O A;  4RGN A;  3SDZ A;  1SXT A;  5JEA H;  1QNU A;  4BA1 I;  1ENF A;  5LL6 S;  3RLF A;  3S16 B;  3BVM A;  2A5H A;  3UI2 A;  1EZ6 A;  3JAM E;  1SYE A;  1U4P A;  2RA4 A;  2A6E C;  1ZEQ X;  3EQL C;  3G7L A;  4XT1 B;  3VR4 A;  1RF2 D;  2K1B A;  5C4H A;  4HMI A;  3GTO B;  3RD4 A;  3P75 A;  1B50 A;  2B2T C;  2F0V A;  3MXP A;  2SOB A;  2AWO A;  2B8F A;  4DA2 A;  4CJ1 B;  1PFM A;  4DXG A;  3SR1 A;  4KKU A;  5COR A;  3MA2 B;  3SK5 A;  4XXE A;  1QCB D;  4CBV A;  2SNM A;  4ZKB B;  5EGT A;  3GV3 A;  4OHJ A;  1JWU D;  4FF3 A;  1BF4 A;  5C4X B;  3X3M A;  2N55 A;  4K5V A;  4XQJ A;  1DON A;  1SMY D;  5A2Q L;  4R8N A;  3C1F A;  4KY6 A;  2VNU D;  1NR4 A;  1I6V C;  1R4Q B;  1M8A A;  5CV5 A;  1CA6 A;  2JA5 B;  2J7Z A;  1Q1E A;  3I90 A;  5JEA J;  1AEX A;  3L7Z C;  2EVB A;  1F77 A;  1F9P A;  1WTP A;  5KNC A;  3HKZ B;  2A69 D;  3NQT A;  4RH6 A;  3KLS A;  2WII B;  4EQN A;  1DYQ A;  2B2U C;  1EYA A;  1RTN A;  2PZU A;  4TSS A;  1G6Z A;  3MTS A;  1TQO A;  4M1U B;  4U67 3;  3L3O C;  4EVO A;  3VR2 A;  2EE1 A;  1X32 A;  1ESR A;  5FO9 B;  2JEB I;  5TSS A;  2OT2 A;  2F0K A;  2XNA C;  3HZX A;  2R93 B;  3M85 A;  1GOZ A;  4QUC A;  3TP7 A;  1ENC A;  4CKB A;  1HPC A;  2O2L D;  1DCZ A;  3TZD A;  1SE4 A;  2IX0 A;  3QO2 A;  1EQV A;  1STE A;  3KLS X;  1CTM A;  3EVQ A;  2KHS A;  4RFB A;  1E2Z A;  2B39 A;  2X69 A;  4K14 A;  1TS3 A;  2K5W A;  5C3E B;  1C4Q A;  1LLR D;  2Z4H A;  1EYD A;  1DD2 A;  1ILP A;  2Y0S B;  1TII D;  1V8Q A;  1JE4 A;  3N52 A;  3MXN A;  1H9R A;  4I65 A;  1E0B A;  3CU7 A;  3BS1 A;  2D62 A;  1Q90 A;  1S5D D;  2PNR C;  3GTG B;  4OL7 A;  2A74 C;  1S5B D;  4WOR A;  4FYD A;  1FYC A;  3K57 A;  4DNT B;  1BCP F;  4DFA A;  3MZ5 A;  3URY A;  4C56 C;  1O78 A;  2M00 A;  3RUZ A;  1LT6 D;  3NBI A;  2IWH A;  3R8B A;  3J7Y W;  3J7A F;  5JPM C;  3NHH A;  5JVG 3;  4A3E B;  1H9M A;  5KYI A;  4KN7 C;  1SDF A;  3PUY A;  3SK8 A;  1OXU A;  1Y69 U;  1KNE A;  2WKD A;  5CR3 A;  3GTP B;  1LTS D;  3MXG A;  1UUP A;  1CM9 A;  2E2J B;  4J1M A;  4KHZ A;  2JA6 B;  4F88 A;  2OEO A;  3A7A B;  2AQ2 B;  4H0L C;  3MFY A;  3R2T A;  3PV0 A;  3HOU B;  1DJR D;  3FKI B;  2A68 C;  3VR5 A;  5EBC A;  1NCV A;  4KMU C;  1CHQ D;  1EEF D;  2EJM A;  3BDC A;  5K36 H;  5EPJ A;  3KLR A;  2KCC A;  3SEB A;  1GJX A;  2IPK D;  5FKA C;  2HUG A;  4EQO A;  3QOL A;  4KD4 A;  4PMC A;  2D5D A;  5EBD A;  1I4X A;  2NN6 I;  1HXY D;  3HS0 C;  2CQA A;  1EY5 A;  4DAY A;  1I4G A;  3M7G A;  2EY5 A;  1B9N A;  1V43 A;  1H9K A;  3SHL A;  3I70 A;  1HHV A;  3GTQ B;  2F4I A;  3O13 A;  1A3U A;  2QKI C;  3H6M A;  5M3F B;  2WP8 J;  4C3H B;  1CHP D;  1PXU A;  2BE5 C;  4QMG A;  3VA7 A;  3ZYY X;  3LNN A;  1MD2 D;  4LJZ C;  5A2Q E;  5C44 B;  4RCN A;  2XRQ D;  3A7L A;  1BBX C;  1CZG A;  1LTI D;  4ABN A;  2BCO A;  1STG A;  3I91 A;  2IJ0 A;  5JAV A;  1ZKO A;  2CW0 D;  3CRK C;  4G7H C;  3T56 B;  2BE5 D;  4NDX A;  1Q1B A;  3T51 B;  2EYO A;  3T16 A;  4HR7 B;  4ZQ3 A;  4BBR B;  1D1K A;  3QWN A;  3P7J A;  3Q24 A;  2EJF C;  3QIA A;  4NP5 A;  3DMU A;  3BZD B;  4GZY C;  2B2T A;  1OO9 B;  2AUK A;  3S1N B;  1I4H A;  1HUN A;  5LL6 X;  4PMW A;  1AP0 A;  1EQT A;  5J1Z A;  1D5M C;  3GTM B;  5F2D A;  4WFN 3;  1B9M A;  2K5D A;  1AN8 A;  1EY4 A;  1FNW A;  2EY6 A;  4ZYS A;  3PIP 3;  1K8O A;  3QOJ A;  1TU2 B;  1YNJ D;  4ODG A;  3WOE A;  3KUP A;  3MAQ A;  1LTB D;  2K32 A;  2A6E D;  3OWF A;  3DEO A;  4DAP A;  1S5C D;  2XSC A;  4A3K B;  2JA7 B;  2F0T A;  3VYU A;  2F0U A;  4IUN A;  4H44 C;  1MGS A;  3J7A V;  4K8J A;  1LAB A;  4KD3 A;  2DNE A;  3N6R A;  4R9W A;  3GTL B;  3KBG A;  3ND8 A;  3I4L A;  2KVM A;  1SEB D;  2XWJ B;  5EKK A;  4J6H A;  2EYJ A;  1Y1V B;  2CW0 C;  1BDO A;  4IAL A;  2F0G A;  1IKM A;  3RZO B;  3GTJ B;  4G57 A;  1WD0 A;  2KED A;  1B2T A;  2FFK B;  3OMC A;  5IOD A;  4DGZ A;  1LV9 A;  1ML0 D;  2F0E A;  1WTQ A;  5CBA E;  5CMD A;  2BA0 A;  3BYY B;  5C6A A;  1V1O A;  1ET9 A;  1SNP A;  1XWE A;  4ULL A;  3MFG A;  3IFT A;  2H4O A;  1GHK A;  1A3V A;  1HQM C;  3C3L A;  1STB A;  4L8J A;  2E75 C;  4K6L A;  2FJ2 A;  2F0M A;  5JPN C;  3AB9 A;  2X6G A;  4O42 A;  2B2Y A;  2KEC A;  3OHX C;  3P20 A;  1BCP D;  1GXD C;  4A3I B;  1PFN A;  3D4D A;  2KA7 A;  2RBM A;  2G9H D;  1STH A;  3U9S A;  5C3X A;  1H9S A;  3S9W A;  1SE2 A;  3A56 A;  3H91 A;  2JA8 B;  2EYP A;  2EXZ A;  3OWE B;  1DXM A;  1QB5 D;  2NN6 G;  2XRS D;  4BWG B;  5C4J B;  1ENA A;  2AWN A;  4IZ8 A;  1Y1W B;  1A3T A;  1NUC A;  4I7Z C;  1JIC A;  3K59 A;  3H0G B;  2QDB A;  3DUZ A;  4LAA A;  1A15 A;  1PZI D;  4BBS B;  1JOR A;  5T1I A;  2Z4I A;  1HTL D;  1JOO A;  2NVQ B;  3TZU A;  1C8C A;  1PRT C;  1PYW D;  1STN A;  3DWA A;  4LMQ D;  2A73 B;  3J80 L;  4XQQ A;  4ILW A;  1EY8 A;  1G91 A;  5IGB A;  2YU9 B;  2FMM A;  4FO2 A;  2HDM A;  1PRT D;  4RA8 A;  3K58 A;  4RHR A;  3GTK B;  1XXG A;  4CJ2 C;  4CKE A;  4XT3 B;  3R2I A;  1ROD A;  5KYL A;  2LMC B;  3PUZ A;  3EJI A;  2MUY A;  1Q12 A;  1J9O A;  2EY1 A;  2F0W A;  5I9O A;  2NVX B;  5J39 A;  4EQP A;  3S15 B;  3Q6S A;  1EOT A;  1GUS A;  3MC0 B;  3A55 A;  1BCP C;  2IW3 A;  1CI3 M;  5G3L F;  1OXV A;  5C0X I;  4QUF A;  3TDQ A;  4KJN A;  1K8M A;  3VYT A;  1O7L A;  1RHP A;  3K5N A;  1W6K A;  5IGG A;  1ONL A;  4G4K A;  2K05 A;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...