4B3ML

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mL00
1KAWA 3K81C 5JJLA 1MJEA 4BXXG 3UDXA 1TWGH 2PMZE 4YHHL 3T1HQ 1GM5A 3K80C 5GROA 2UU9L 3SGIA 3HOUG 2Z6KC 2DUDA 3IRBA 2AWNA 3KF6A 4DPGA 4L5RC 1NTGA 3H3VI 4RG1A 5IYBH 5FLMG 4A3CG 2MQHA 3HOXG 5C4JH 1J6QA 2ID0A 1N36L 1N34Q 2VQFL 4A4IA 4DV2Q 4LNQA 1SROA 1GVPA 4JI4Q 1EFWA 1EQRA 2EQSA 1AE2A 2OQKA 4XTCS 4A3MG 1ASYA 3I4OA 2UXCL 3PV0A 2VUMG 1IBLL 3W1GA 4PZ7A 3UDGA 3DM3A 4AQYQ 2KCTA 4LUOA 4JC0A 5HGQA 2E2IH 1X3FA 3PSIA 5C0XJ 1X56A 1EIFA 4QIWE 1JJGA 3DLLA 3CW2C 4JI3Q 5FJ8H 3GTPH 3AQQA 4GKKQ 3CP0A 3CC2A 2F4VL 2N3SA 3OTOL 1NJIC 1Q1EA 4OWTB 2YU9H 3I4NG 1FVIA 1Q81C 3F2BA 3K7UC 1UE6A 3ULJA 5JEAG 1KQSA 4OWWB 3M4QA 3CCRA 3RZOH 3I55A 4QQBX 1DGSA 1RL2A 4DV1Q 4POFA 2V1CC 1SN8A 1HNXQ 1HR0L 1VQLA 1YITA 4JI7L 2AHOB 3TEHB 1TWCH 3ULPA 4A75A 4GOPA 5IWAL 4X64L 4A3DH 4DUYQ 5C4XG 4IJLA 1XMOQ 4FDBA 3KYHC 4JI6Q 1UEBA 3PF4A 1QVFA 4A93G 1PH5A 1KRSA 2WAQG 3TQYA 1U5KA 4GNXB 3HFZB 2IY5B 4X6AH 4P74A 4DK6C 1ASZA 1I50H 2H5XA 3J81i 1IZ6A 1HJPA 4BY7H 2RCNA 5IYCH 2PQAB 4AIMA 2Y0SE 4A3KH 1WI5A 4R4CA 3LGJA 2N49A 3PIOA 1OXXK 2ZJQA 3T1YL 2CFMA 2B29A 3RLOA 4A3FH 2AKWB 4C3JH 1VQ4A 4A3EH 3EIVA 2WFWA 3RNUA 2RHSB 3PUVA 1LM0A 4OX9Q 1Q86C 3F1ZA 4C2MH 1AE3A 4IFDI 1MKHA 4Y7NH 2MFIA 4IFDG 5IYDH 4GOPC 3HOWH 3S1MH 3NEMA 3STBC 5IP9G 1JE5A 2I0QA 1IXRA 4EX5A 3I2ZA 4DV0L 2C35B 2Q2IA 2K52A 1HR0Q 1H95A 4MTNA 3A74A 4DV7L 3S15H 4BBRH 3AFQA 1EQQA 2IX1A 3RN2A 1VQHA 1X55A 5M3MH 3L2PA 1X6OA 1YVCA 2A8VA 3PO3H 5E7NA 4AH6A 5H1SE 1VQ7A 3HOZH 3G48A 4PZ6A 4GN3B 4P72A 4B3ML 4LFAL 2JA9A 1VQPA 5IYBG 3S2DH 4RMFA 2K4KA 4IOAA 3GDEA 2GVAA 1VQ8A 4DR3L 1EUJA 5IT9c 2ZM6Q 2E2JH 3M4OH 2YTVA 3U4ZA 4DR6Q 2NVTH 5C3EH 1PH1A 1UWVA 2A19A 2AWOA 2LXKA 1TXYA 3S17H 3I56A 2UXBL 1PHJA 4GKJL 3CQZH 1OXVA 1PH9A 4A3IH 2CWAA 2Z6KA 4JBWA 5LMUQ 4DK3C 1G51A 4JI0L 1JMCA 1WCMH 1NBWA 4HIOA 1L1OA 5FJ8G 4R4IA 3RZDH 4AYBG 1QZGA 3J7A5 4TVAB 1CUKA 4YWMA 1KRTA 3W5OA 4X65Q 1IBKQ 1D8LA 4LF8L 2UUBL 1KD1C 1QZHA 3HOVG 3CF5A 2JA7H 4J15A 2WP8J 3S1NH 4A3LG 4UPAA 2B3GA 4GN4B 2QEXA 3JAMi 2KBNA 5GAHC 1S72A 4K0KL 1PH8A 4LFCQ 4LF9Q 1W2BA 2JE6I 3K0XA 4NXML 2I5MX 2B63H 2UXDL 1X9NA 2YV5A 3CCVA 1VQ5A 4IPGA 1LYLA 3A5ZB 3G4SA 4A3DG 3S16H 1Z47A 4JG2A 2R7ZG 1B70B 4JI8L 3ULLA 1JB7A 4DV4Q 2ZTCA 4B3TQ 4JI5L 3HOYH 2RHQB 1C9OA 1YBYA 1L1OC 1YJNA 1VQEA 3TS2A 2R7FA 5DLQE 5LMNQ 1NE3A 1OXUA 3UE1A 2UUAL 4A3BG 1HNZL 4BY7G 4LF7Q 3F8TA 4YY3L 1Q8KA 3PCOB 4NPSA 1M1KC 4APVA 5FLXc 1N33L 1I94Q 5BR8L 4A3FG 1IBMQ 2UUCL 2F3IA 2NVQH 2WAQE 3CCEA 1A0IA 1CKNA 4L5QA 2JQOA 3OW2A 4LF8Q 3UDFA 4QGUA 2JA8G 2MO0A 4PG3A 5IYDG 5AJ3Q 2NZHA 2XTIA 3TS0A 2HHHQ 1YIJA 1I5FA 4DR1L 4DV6L 1K0RA 1EWIA 4XIGS 1A62A 4DR2L 3GTMH 3ZJYC 1N32L 2K5HA 2JJQA 3FHWA 4BY1H 3J80c 1UE1A 4BBRG 2ALYB 3EN2A 3KF8B 5M3MG 3EBEA 2UU9Q 1BVSA 2A1AA 2K75A 2NZOA 4YHHQ 1HR0W 4DV3L 3PO3G 1E24A 3BZCA 5GAEC 3ER0A 2R92H 4LW1A 1J5EL 4GLVB 3RN5A 4X62L 1WFQA 2CCZA 1TWHH 2YTXA 1PV4A 1N36Q 4LUVA 1GO3E 2VQFQ 4JI1L 1VQKA 5C3EG 2BH2A 3GTQH 4DUZL 2BA0A 2N78A 1IYJB 2IHFA 4H02A 2UXCQ 4DV5L 2E5LL 1IBLQ 1CSPA 3U50C 1C0AA 4A3IG 2JA6H 1JJCB 3F2DA 1VQAA 3M7NA 2CKZB 2VY3A 1Q1BA 1HNWL 4MNOA 1WYDA 2F52A 1JJ2A 1WCMG 1SLJA 4MZ9A 1UE7A 4JI2L 3PUYA 2JEBI 3GO5A 1Y1VH 3TREA 4A3JG 1SMXA 2HQLA 3RLNA 1BKBA 4DV6Q 2F4VQ 5JJKA 1FGUA 4L5TA 4YCVA 3OTOQ 3I7FA 3CCSA 4BXXH 1Z9FA 4DNIA 3HOUH 1QVGA 1EIYB 1QUQB 2JA7G 1YZ6A 2MNAA 3CC4A 1RIPA 3ICEA 2B63G 5FLMH 5C0XI 3GTLH 3HOXH 3CXCA 4A3CH 4IPCA 5C0XG 3NBHB 4JI7Q 4KLKA 1N9WA 4LF5L 1XPRA 4UY8C 4R4OA 4DR5L 2AMCB 5IWAQ 4X64Q 1XNRL 1D7QA 4PZ8A 3H0GH 3KDFB 2MO1A 2PNHA 2ZTDA 4A3MH 1KXLA 2VZAA 2VUMH 3JC66 3HOYG 4A3GH 3I4MH 2IT1A 4ME3A 4B3SL 3CMEA 2JA5H 4LF4L 3CPFA 1SE8A 4HJ7A 1YJ9A 5C44H 1LTLA 4C3IH 3CPWA 1E22A 1B8AA 5IY0A 1M90C 4GN5A 2KENA 1HZ9A 3B6YA 1YHAA 4LUZA 3E0EA 1VQCA 4P71A 2KHIA 5LMNW 3T1YQ 2PI2E 1K9MC 3L0OA 3UDIA 4NXNL 2VW9A 4IOCA 4B3RL 4HIMA 3CMAA 2BA1A 1XMQL 1I6HH 2VNUD 4O0AA 3PF5A 4GNXA 4JV5L 3UE0A 4DR4L 2VQEL 3KF6B 4TQUS 5GADC 1S40A 4LF6L 4LFBL 2PQAA 4JYAL 5J3BA 2Q2UA 4NB3A 1Q46A 5IE8A 2K5NA 3FKIH 4DV0Q 4BY1G 1VQOA 3GTGH 4UP7A 4BA1I 3CC7A 3T1HL 1C7YA 3WWVA 3BZKA 4BBSH 1K83H 2EIFA 2D62A 4DV7Q 5IP7H 3J81c 1G6PA 3Q8DA 3J80i 3KLWA 1MJCA 2R92G 1K73C 1VQGA 1P16A 1N34L 4R4TA 4B3MQ 4DV2L 1V1QA 1A8VA 4GLAC 4LFAQ 1L0WA 1IL2A 1O7IA 1X3GA 1VQ6A 3PO2H 3PIPA 1NY4A 4HJ9A 4DR3Q 2I5HA 4IO9A 1KIXA 5M5XH 4GNXC 5JEAJ 5K36G 2R7DA 2L15A 5M5WH 2UXBQ 3GTKH 4GKJQ 1XMQQ 3RR5A 1Q7YC 2QA4A 2Q2TA 2JA6G 4JI3L 5IYCG 2GN5A 2ATWA 4JV5Q 4A3KG 3AYHB 3S24A 5IP9H 3OYYA 2VQEQ 1YHQA 3A5UA 4JI0Q 1MIUA 1SRUA 5GAGC 3G6EA 3D31A 1Y1VG 4GOPB 1HZCA 3CCMA 4A3EG 4X66L 1PH3A 4BA2I 1PH2A 3K7AH 4KHPL 2UUBQ 2K50A 4JBJA 2WB1G 4DAYB 1CKMA 4DV1L 2HIVA 1R9TH 1HNXL 3HOWG 4L5SA 2ZTEA 4C3HH 3J81j 3KJOA 2XGTA 4K0KQ 2QGQA 5GQOA 2CQOA 1U0LA 4WJ3M 1SR3A 1PH6A 1TWFH 4NXMQ 2UXDQ 4DUYL 4IJHA 3AEVA 1XMOL 1B7YB 1YHBA 4HJ5A 4JI6L 3H0GG 1K3RA 4PMWA 3KJPA 1NMFA 1EYGA 2ASBA 5JJIA 4JI8Q 3GTJH 2OTLA 3A0JA 3U58A 3HOZG 4IFDJ 4A3GG 3I4MG 4JI5Q 2JA5G 1HZAA 4R4QA 3BU2A 1L2FA 3VDYA 5C44G 2R6GA 1PH4A 1VQNA 4UP9A 2R93H 2UUAQ 1X54A 1WOCA 1WJJA 2LXJA 1HNZQ 3CCQA 3S2HH 2ZJRA 3NELA 3M85A 4YY3Q 3AFPA 1E1TA 3HKZG 1N33Q 5BR8Q 1Q12A 2I5LX 2HIXA 3JAMc 1PYBA 2D0PA 2UUCQ 4OX9L 4OXPA 3KOJA 1VQDA 4X66Q 1YJWA 4KHZA 2OWOA 3HOVH 4A3LH 1AH9A 1QVCA 1BBWA 1V9PA 2VS1A 1N8RC 1VQMA 4KHPQ 2PI2A 2KHJA 3E9HA 2E2HH 5M3FH 1Y1WH 3U4VA 2Q2HA 2EXDA 2IHEA 3M4PA 3MEFA 1I3QH 2HT1A 2NVYH 3FKIG 1VS0A 4UP8A 4DR1Q 1BBUA 4OONA 4DR2Q 1N32Q 1W3SA 3S1QH 4JOIA 1V43A 3CAMA 1XPOA 2R7ZH 4BBSG 3W1BA 4R1JA 1VQJA 2E8GA 5IP7G 3ERSX 1FJGL 3GTOH 1CKOA 4DV3Q 3G71A 3FP9A 5M5YH 1XNQL 3H3VH 1T9HA 4P73A 2ZM6L 1J5EQ 4A3BH 3PUWA 1GD7A 4X62Q 3PO2G 3S1RH 1VQ9A 1L1OB 4DR6L 1KL9A 1PVOA 1NMGA 4KI0A 2FXQA 1S3OA 1CSQA 4LWCA 1TWAH 1VQFA 4JI1Q 4HJAA 2NN6I 3TRZA 4DR7L 4DUZQ 3M3YH 4HIDA 2NN6G 4A76A 4YCUA 2YYZA 2ZJPA 5LMUL 3M9BA 1OTCA 3STBD 4DV5Q 1GKHA 2E5LQ 3E9IA 3NENA 2JA8H 3L7ZC 1EOVA 3CCLA 1HNWQ 1HZBA 1SFOH 4YCWA 4JOIC 2ES2A 2OCEA 4X65L 1VQIA 1YI2A 1IBKL 2OQ0A 2K5VA 4JI2Q 4EQ5A 3I4NH 3PUZA 3CD6A 1JT8A 2KCMA 4JCVE 4DKAC 4P75A 3F2CA 2LSSA 4O2DA 3KFUA 2GVBA 3K8AA 1VCIA 3CCJA 4JBKA 3D0FA 2DGYA 2JK8A 1YNXA 4DAMA 1P8LA 4LFCL 1E3PA 4LF9L 1XPUA 4WJ4A 1FJGQ 1Q82C 3HKSA 2D0OA 4IPDA 4AYBE 1E1OA 1X65A 2IX0A 4OWXB 4HJ8A 2CWPA 1XNQQ 3MXNB 4Y52H 1XJVA 1PYSB 5C4XH 4LF5Q 2WB1E 1Y14B 2Y0SG 4DV4L 4DR5Q 4B3TL 1XNRQ 1OXSC 1YEZA 1G291 4GLXA 1QUQA 1CKNB 4DR7Q 4A93H 2BH8A 2K14A 4POGA 3J7ZC 1K8GA 2YTYA 5LMNL 4B3SQ 4LF7L 1K8AC 4QL5A 4JI4L 4GS3A 2VL6A 5ELOA 4LF4Q 1IBML 2R93G 1PA6A 1FL0A 1LUZA 1I94L 4YWLA 1X3EA 1KC8C 2Z0SA 4QJFA 1PH7A 2N8NA 4A3JH 1PFSA 1VQBA 3KDFA 3H15A 3GD7A 5HY6A 2JEAI 3PUXA 3PGZA 5ELNA 4AQYL 2OTJA 3CCUA 4B3RQ 1A63A 4NXNQ 3RLFA 4YWKA 5AJ3L 4OO1I 2HHHL 4IPHA 2NVXH 1E7ZA 1OXTA 4ALPA 4GKKL 4OO1G 1XTDA 3S14H 4DR4Q 4HIKA 5M3FG 4JBMA 1Y1WG 4LFBQ 1HH2P 4LF6Q 1KHIA 4JYAQ 1UE5A 3HKZE 3BJUA 2RF4A 5EAYA 4QY7A
chains in the Genus database with same CATH superfamily
1KAWA 3QO2A 4DXGA 5JJLA 1D2BA 1GM5A 3SGIA 1A2UA 3S1QB 3D4DA 3IRBA 2AWNA 3V2TA 1B2TA 1U4LA 2RDFA 1D5ZC 4RG1A 4KN7C 5C4JH 3SXHA 5EQ0A 2VQFL 4LNQA 1O80A 1SJHD 3MTSA 3E5SA 2OQKA 1T5XD 3S1RB 2B2TC 3URYA 2QKIC 1IBLL 3W1GA 1HHVA 3OHXC 4AQYQ 3CRKC 2EOTA 5HGQA 3NQTA 4DF7A 4K14A 4F8MA 1JJGA 5J1ZA 3I72A 4GKKQ 4C2MB 3CC2A 2SDFA 5IGGA 2QDLA 5CC4A 1CZGA 1D1KA 2IJ0A 3ULJA 1KQSA 3M4QA 1XYIA 1F2MA 3CCRA 1VQLA 5KIXA 4JI7L 2IPKD 3ULPA 5IWAL 5KYLA 4FDBA 2MHVA 5JJZA 1H9JA 4DAYA 2F0HA 4EVOA 1O7YA 4DK6C 3J81i 2OEOA 2RCNA 5IYCH 3CQZB 1I4GA 3C2PA 4A3KH 2F0OA 2N49A 3T1YL 3KF8A 1GUTA 1STYA 3EIVA 3RZDB 4A3JB 1JWSD 1EU4A 4C2MH 4IFDI 4IUPA 4NMZA 2F0GA 3HOWH 2DNEA 3S1NB 3N6RA 3I2ZA 1HR0Q 4IALA 2K52A 4G7OC 5DEHA 2Q8RE 3QIAA 4MTNA 2Q8TA 1B50A 3ONAB 2MGSA 3A74A 3X3MA 4DV7L 1PZJD 1VQHA 1X55A 2JXMB 1X6OA 1YVCA 4KJOA 3C1FA 4AH6A 3HOZH 1TWGB 4GN3B 1RODA 1U9RA 1C8CA 3HOYB 4EQOA 3U4ZA 1C48A 2AWOA 1TXYA 1UNSA 5C5MA 2UXBL 3CQZH 2EVBA 2SEBD 1EY0A 2Z6KA 3AB9A 5CBEE 3NBHA 2VB2X 3GQBA 1QOHA 2PZUA 3RZDH 4CKCA 3ND8A 3OIQA 4X65Q 3GTPB 2OT2A 4LF8L 1D8LA 3A8KE 1SXTA 2UUBL 3GTMB 3I73A 3CF5A 1GJXA 3S1NH 1A15A 2B3GA 4GN4B 1QG7A 3W2DA 3JAMi 5GAHC 2E74C 4K0KL 4X3TA 4N9TA 4LFCQ 2JE6I 4I7AA 2HCIA 3RZOB 2J7ZA 3A5ZB 3I3CA 1W6JA 3S16H 1QWYA 5COYA 3Q24A 5E1FA 3ULLA 5K5PA 2I07B 4DV4Q 2ZTCA 1JB7A 3HOYH 2Z8LA 1YJNA 1VQEA 5DLQE 1NE3A 3UE1A 2UUAL 5I9PA 2JA6B 1KDAA 4APVA 3TP8A 1I94Q 1JOQA 5BR8L 1IBMQ 4I7ZC 3TDQA 2F3IA 3NHHA 3BDOA 1CKNA 4CKBA 3CCEA 4EQNA 1Y1VB 5KYIA 2K32A 3SHLA 4QGUA 5CORA 4ZYSA 5AJ3Q 1EZ8A 4ZLTF 1PYWD 4DR2L 3GTMH 3D3RA 5A2QL 1UE1A 3EROA 2JSOA 4ZKBB 3EBEA 1BVSA 4DV3L 3S15B 3BZCA 3ER0A 1J5EL 3I8ZA 1F77A 1PZKD 2YTXA 4LUVA 4XDXA 2JA5B 4JI1L 2BH2A 3U9OA 3Q0AA 5JAVA 2BA0A 2B2UA 5E4XA 2IHFA 1CSPA 1C0AA 1RTOA 2JA6H 3M7NA 4KKTA 1Q1BA 3OWFA 4B9WA 3K58A 1JJ2A 3E3XA 4OO1H 3DHQA 4MZ9A 2PMZB 3GO5A 4A3JG 1Y1VH 5ISRA 2HQLA 1FGUA 3CCSA 4RHRA 1ENAA 1EWCA 1QVGA 3MFGA 2M00A 1EIYB 4QF4A 3D4RA 1EY9A 2HDMA 3P7JA 1S4ZA 2EY5A 2CW0D 1J9OA 2B2UC 1N9WA 3KDFB 5BN5A 4RWSC 3VR5A 2ZTDA 1BO0A 3HOYG 4E6IA 4B3SL 3CMEA 3C1EA 4X3UA 2JA5H 2RA4A 1SE8A 1HUNA 4HJ7A 2PCFB 5EBDA 3FVQA 5M5WB 3A7AB 1E22A 1LT5D 2KENA 3A56A 2K1BA 3NSWA 1CA5A 1TT2A 4P71A 2MP1A 2PI2E 3FEWX 4J1MA 1SYEA 4IOCA 2HD3A 1DXMA 2KECA 3NWSA 1EY8A 4ZUJA 2EJMA 4RFBA 1SDFA 4TQUS 4KJNA 4LF6L 2V4DA 4NB3A 2F0SA 1ET9A 5CV6A 4F7XA 2EYJA 4B08A 4LMQD 4DV0Q 4UP7A 3HEJA 2EIFA 2Y0SB 4R4TA 4B3MQ 1A8VA 2F0WA 1NY4A 2CVRA 4DR3Q 4IO9A 1KIXA 1IL8A 5JEAJ 5CV5A 1DZ1A 5M5WH 3TP6A 3GTQB 2QEJC 4K6LA 4GKJQ 1XMQQ 2JA6G 2Q2TA 4M8AA 1SYCA 4IFDH 2GN5A 4KKSA 1MHWC 1QILA 2ATWA 3OYYA 3K59A 1HCZA 5D3DA 1Y1VG 1SNMA 4CBVA 3D8GA 3A8IE 3NUCA 1BCPF 1PH3A 1PH2A 1Q3LA 3FMCA 4AYBB 2HIVA 5M9OA 1UEAB 2XGTA 1U0LA 3LWUA 4NP5A 4NXMQ 2UXDQ 3EA6A 3BYYB 3E6ZX 3SR1A 3GTLB 1OO9B 2ASBA 4HEDA 3K5OA 3U58A 1WD1A 4JI5Q 2JA5G 4A3MB 1L2FA 4IQZA 3VDYA 1PH4A 1EIGA 1AN8A 1VQNA 4CJ0B 2B2YA 4L63B 2AQ2B 1HNZQ 1AW7A 2ZJRA 3M85A 4YY3Q 4JVZA 3DMUA 1N33Q 2HIXA 1PRTF 4KD3A 2OWOA 4KHZA 2RDGA 4A3LH 1ZYRD 1BBWA 4KHPQ 1N8RC 2XRSD 5ELCA 2Q2HA 1LO5D 1GUOA 1VS0A 2F0DA 4OONA 1RHPA 1V43A 3CAMA 4RKLA 3IKJA 3W1BA 2CH4W 3ERSX 2B2YC 2WKDA 3G71A 3OSOA 2WINB 4FO2A 4UAIA 5I2XA 3WOFA 3AU7A 4A3BH 3PUWA 1X32A 2CW0C 4KI0A 4DR7L 4FNFA 1VQFA 1QNUA 2NN6I 3TRZA 1PMRA 1AFPA 4HIDA 2EY2A 2P5ZX 1TS4A 3FPPA 1S5DD 1GKHA 1HNWQ 1TQOA 4ZUIA 2ES2A 2OCEA 4X65L 2OQ0A 5JOBA 5JEAH 3CCJA 2IWHA 2JK8A 4LFCL 2EDGA 2L5TA 3K7AB 1R4QB 2CQAA 2LY7A 1Q82C 1X65A 1A3UA 2WIIB 2X6LA 1XNQQ 4R8IA 1PYSB 1DM0B 2LFNA 3VA7A 4DV4L 2Y0SG 1TWFB 5IT9E 1YEZA 4GLXA 2EZVA 1UUPA 5C4ZA 4WRDA 4QL5A 4LF4Q 1QCBD 3QOLA 1FL0A 1I94L 1DJRD 1IHZA 1IBML 2Z0SA 4QJFA 1EIHA 2N8NA 3KDFA 2EYOA 4HCEA 1SNOA 4B3RQ 1A63A 1ONLA 1QE6A 5EPJA 5AJ3L 2NVXH 1E7ZA 3DM1A 1XTDA 4DR4Q 2FHTA 4HIKA 1XWEA 3BJUA 1SNCA 1Q90A 3W3AA 1TKWB 1IW7D 4QY7A 2O2LD 4AYBG 1JE4A 3K81C 2QCPX 2PMZE 1CA6A 5GROA 2KOLA 4O1NA 5ELDA 5C6AA 2DNCA 4CDFC 4DPGA 1NTGA 3TN2A 3H3VI 5FLMG 4DU9A 4P2CB 4A3CG 2DJGC 4RA8A 1J6QA 2ID0A 1DOLA 3O13A 5CV9A 4JI4Q 3SEBA 2NBFA 5DM73 3I90A 1EQRA 1AE2A 2HCCA 4A3MG 1ASYA 2G9DA 3I4OA 5T1GA 2B39A 1TWAB 2KCTA 3M3YB 1HPCA 4U68A 1KNEA 4L6TB 3PSIA 5I4DA 5C0XJ 3TBIB 3CP0A 2JA8B 4MHEA 2JN4A 4RGMA 2N3SA 4IZ8A 3VYRA 4OWTB 1A6XA 3F2BA 1UE6A 4OWWB 5JEAG 1XXGA 3X3NA 3I55A 5E3FA 4BBRB 3NXWA 1HNXQ 1ZYRC 1KDCA 1YITA 3NTHA 3PO3B 1FGBD 3F2UA 4JI6Q 1STAA 2K01A 3PF4A 5HGTA 4X6AH 5EBCA 1ASZA 3QOJA 4MIUA 2PQAB 4AIMA 2Y0SE 1WI5A 4ZAIA 1D1IA 5T1IA 3RLOA 1WCMB 1VQ4A 4YIJA 5FO8B 1U4MA 1DOMA 3RNUA 1JORA 1F2ZA 4DNTB 3F1ZA 3I70A 5IYDH 2K6AA 3NEMA 5IP9G 5EJWA 1IXRA 4DV0L 4HMIA 2Q2IA 3S14B 4OIJA 4BBRH 2IX1A 1I4QA 4XT3B 3PO3H 1NR4A 4OEMB 3T16A 1VQ7A 1TY2A 4P72A 5I2YA 4B3ML 1SE4A 1BOSA 3S2DH 3LNNA 2IW3A 1LLRD 4DR3L 1EUJA 4BS9A 3M4OH 1QJOA 4DR6Q 2EJFC 1UWVA 2A19A 4IUUA 1KLUD 4N9PA 3R2IA 1PLFA 5C4HA 4XQJA 4GKJL 1J8IA 3KBGA 4JBWA 5J39A 5LMUQ 1MSHA 1SSOA 1WCMH 1STBA 2BE5D 4HSVA 1CUKA 1KRTA 5C3XA 1BDOA 5EKKA 1KD1C 2KCCA 3U9SA 3QB3A 1EY6A 2WP8J 2B2TA 4FYDA 1D5MC 4UPAA 1D6EC 3BG3A 1PH8A 1G2SA 4G7ZC 4LF9Q 1W2BA 3K0XA 4NXML 2UXDL 1VMCA 2EE1A 2R92B 1LYLA 2H1EA 3G4SA 1IW7C 1B70B 1Y8OB 2KEDA 1SYFA 1WTQA 5D3IB 2NN6H 4JI5L 2RHQB 1JOKA 1HNZL 4YY3L 1Q8KA 2LMCB 4NPSA 3A54A 1N33L 5TSSA 2C5CA 4A3KB 3MVVA 2A6ED 2B2VA 3KLRA 2JA8G 4MTKA 4PG3A 3OOCA 5IYDG 1SNPA 2Z1CA 4HCSA 4KK7A 4DAPA 1EEID 2D2CC 4XIGS 5CR3A 3ZJYC 3HOWB 2KCNA 3FHWA 1IKMA 2KHSA 1RDPD 2XSCA 3DEOA 4BBRG 3EN2A 4JK1C 3V05A 2UU9Q 2A1AA 2NZOA 2EYHA 1HR0W 3PO3G 1E24A 2R92H 3T53B 2HUGA 4B9XA 2CCZA 3HOZB 1MSGA 4A3GB 1HTPA 1N36Q 1GO3E 4DFAA 1LTTD 4ZQ3A 5C44B 2B2VC 1KNAA 2J0TD 5IGFA 3J7AF 1IYJB 4FXKC 3HKZB 1V8QA 1HNWL 2CKZB 4MNOA 1WYDA 1WCMG 1LTBD 1EQTA 3KK7A 3NPPA 4R8NA 3PUYA 2F0EA 3R2TA 1BUVT 1SMXA 1BKBA 4DV6Q 1CZWA 4L5TA 2F0QA 5CYUA 1L0YB 3I7FA 4BXXH 3HOUH 2NWGA 1QUQB 2NB0A 5CBAE 1Y8PB 2A6HD 5FK9C 1RIPA 4FF1A 3HOXH 5DM63 4IPCA 5C0XG 1O7ZA 5CV8A 4KLKA 3VA5A 1RJTA 2F0UA 2VUMH 3JC66 3S16B 4A3GH 3GV3A 2M9VA 3FDTA 3CRLC 4LF4L 3OMGA 5C44H 3A8JE 2F3WA 5IY0A 4JPBW 4R9WA 1HZ9A 2AQ1B 4LUZA 3E0EA 2KHIA 3BDLA 4B3RL 1I6HH 1LT3D 1BBXC 4O0AA 4CJ2C 3PF5A 1KTKA 4DR4L 2K03A 1VDZA 4JV5L 2F0LA 2VQEL 1G2TA 5GADC 1S40A 2PQAA 3OPOA 5J3BA 5EKIA 1H9SB 1Q46A 5IE8A 1CHQD 2K5NA 5CGKA 1PFBA 2BE5C 3GTGH 3MZ5A 1C7YA 5E4WC 1K83H 4K5VA 4FXDA 5IP7H 2R61A 4RCOA 3J81c 3Q8DA 2R92G 1VQGA 5KEEA 1VQ6A 4GLAC 4LFAQ 1L0WA 1NAPA 4HJ9A 5EPKA 1ESRA 2A69D 5L37A 4C1NK 1ESFA 1RF2D 1I4HA 5JVG3 3OWEB 1DYQA 1L0XB 3UI2A 1XTCD 4IUQA 5IYCG 3J81L 4A3KG 3S24A 5FOBB 4JI0Q 1HQRD 1RD9D 1MIUA 1QB5D 3D31A 2HQEA 4WORA 4GOPB 3CCMA 5M3FB 1F9SA 1Y1WB 4X66L 2A6EC 3K6OA 4LAAA 3PMFA 1HNXL 4U673 3RMHA 3HOWG 5FO7B 4ILWA 1PFMA 2CQOA 4WJ3M 2PPBC 1Y69U 2JP1A 4IJHA 2XNAC 4N8X1 3TMEA 1B7YB 4HJ5A 4JI6L 3KJPA 1EYGA 5JJIA 2OTLA 1RTNA 3A0JA 3HOZG 4IFDJ 4A3GG 1K8MA 3OIPA 1B44D 5C44G 2VB3X 1X3PA 4QMGA 1HQMC 4QUFA 3NELA 3AFPA 4TKOB 3HKZG 2I5LX 3JAMc 1G91A 1WTXA 4OXPA 3HOVH 4HSPA 3I4NB 2FINB 1VQMA 4PMBA 2A5HA 2PI2A 2KHJA 5M3FH 1Y1WH 2EXDA 1HXYD 1KABA 2NVYH 4DR1Q 4UP8A 1N32Q 4JOIA 2R7ZH 1WTPA 5IGCA 1JWMD 2CHBD 4DAVA 4ZCKA 1MI2A 5IP7G 1FJGL 3H6MA 3DXJC 1CKOA 5DNFA 2A6HC 3JAML 1S5CD 3NP8A 4X62Q 4DR6L 1L1OB 1PVOA 1NMGA 1CI3M 1S3OA 4HJAA 4ID6A 3LX0A 4EQPA 1TY0A 2YYZA 5LMUL 3M9BA 1A2TA 1OTCA 3MHBA 4DV5Q 3NENA 4ULLA 4YCWA 4JOIC 1VQIA 5EKLA 3BVMA 4CJ1B 1G6ZA 4JI2Q 3R8BA 4EQ5A 3I4NH 1HA5A 1UAPA 1JT8A 4JCVE 3KFUA 1STHA 2GVBA 4RKBA 3K8AA 3D0FA 4G4KA 4K2LA 5IGEA 1E3PA 4LF9L 1IYVA 3HKSA 4RH6A 2IX0A 4KY7A 2PW7A 3H91A 1E0BA 1LABA 4LF5Q 1EEFD 4DR5Q 1WTRA 4X3SA 1QUQA 2NTSA 2NTTA 1CFMA 2B2WC 2K14A 3MC0B 4POGA 1BR9A 1K8GA 2YTYA 4PNYA 3BVGA 3HRZC 4DN4M 1LUZA 2E2IB 3H15A 5HY6A 2A69C 3PGZA 5ELNA 4AQYL 1ZEQX 3TZUA 2YU9B 1OXTA 4GKKL 2DJFC 4HTHA 4OO1G 4HAEA 5F2DA 5M3FG 4JBMA 1Y1WG 3HKZE 5EGTA 3D6CA 1F2YA 1MJEA 3UDXA 2UU9L 3T1HQ 3K80C 3VR6A 4A3DB 1S5ED 4K5XA 4DGZA 1EY4A 1H9RA 1H9SA 1BF4A 2FJ2A 1N36L 1AZPA 4DV2Q 3OW7A 1SROA 1GVPA 2IL8A 5BN3A 1EFWA 2EQSA 3NQIA 4KY5A 2F4IA 4XTCS 4A3BB 3PV0A 3R3OA 2A74C 2EY1A 2KJXA 4IN3A 5J22A 5NUCA 3QJYA 4LUOA 4JC0A 3T13A 4C3JB 2E2IH 1X3FA 1EQVA 1X56A 4QIWE 5FJ8H 3AQQA 3HGBA 2L0CA 4L8JA 4XQQA 1NJIC 1EYAA 1Q1EA 2YU9H 3S1MB 3I4NG 1EU3A 1I4XA 1JR0D 1LTGD 1DGSA 1RL2A 2N88A 4POFA 2V1CC 1SN8A 2ZXPA 5M3MB 1HR0L 2E2DC 3MFYA 2D9UA 2AHOB 3HZXA 4A75A 4GOPA 1SAPA 4K6DA 4O42A 4A3DH 4NDXA 1A3TA 1XMOQ 1UEBA 1KRSA 2IY5B 1U5KA 3SK4A 1I50H 4DXFA 3HP3A 1IZ6A 1HJPA 4F88A 4IUVA 4A3IB 1V1PB 3LGJA 1OXXK 2ZJQA 2CFMA 2B29A 4C3JH 4A3EH 3K5LA 3PUVA 1PTOF 1WTOA 2XVSA 1Q86C 4FXGC 1MKHA 4Y7NH 3IFDA 4IFDG 4GOPC 1JCKB 2K7VA 3S1MH 1JE5A 2Z4HA 2JA7B 2MUYA 4EX5A 2NVXB 2C35B 2O4XA 4CGYB 3AFQA 1EQQA 3RN2A 5M3MH 5I9OA 4IURA 5AFWA 4PZ6A 4J8QA 5KNDA 2K5QA 4LFAL 1VQPA 4RMFA 1S5FD 3GDEA 5ELFA 5IT9c 4RCNA 3SE0A 1PH1A 2FMCA 3S17H 1WTHA 5ELEA 1GXDC 3I56A 2VXWA 4XT1B 2QW7A 2A73B 3KUPA 1OXVA 1H9MA 4A3IH 1WTWA 2CWAA 5C3WA 2EPBA 4DK3C 1G51A 2F03A 1NNXA 4JI0L 1EWHA 1NBWA 1XX8A 2BOSA 1L1OA 5FJ8G 2F0MA 4HIOA 1ICWA 4R4IA 1QZGA 3QR8A 3J7A5 3W5OA 1IBKQ 2FMMA 4NW2A 1VF5C 1PDQA 5IT9L 1ML0D 4DA2A 2LS01 2JA7H 4J15A 2DY7A 4A3LG 3CKIB 4KKUA 5KNBA 2QEXA 2F0TA 5LHY1 2I5MX 1X9NA 3SK5A 3CCVA 3IAYA 4A3DG 1Z47A 1TWHB 2PO4A 1B3QA 1C9OA 1YBYA 1L1OC 1KAAA 2R7FA 5LMNQ 1LV9A 3A7LA 2PZWA 4A3BG 3Q23A 4LF7Q 1R4PB 2EYFA 3ITPA 3PCOB 2ZXOA 5FLXc 2NVQH 4C3JG 3OW2A 2JQOA 3OMCA 4LF8Q 2BDNA 2EYPA 4Q0FA 3Q6SA 2BDOA 2NZHA 2XTIA 3TS0A 2HHHQ 1I5FA 2WB1B 4DR1L 4J6HA 1A62A 1N32L 2JJQA 3J80c 3EFXD 1DONA 1CHPD 1BCPB 1WD0A 5I6WA 1RKNA 2AQ3B 2ALYB 3KF8B 3ZYYX 5M3MG 1MGSA 4YHHQ 2K75A 1A3VA 5FLXL 3DWAA 5GAEC 3MXUA 3VYUA 4X62L 1WFQA 2L4NA 1TWHH 2K5WA 3SDZA 1PV4A 3S2DB 1BXTA 2RVLA 5K36H 3M4OB 2ZT9C 1W6KA 1MBYA 2N78A 2XWBB 2UXCQ 3J80L 4DV5L 2EYLA 4TRDA 4A3IG 5KNCA 3PQIA 1Q8IA 2RBMA 4HR7B 1GHKA 4JI2L 2JEBI 1HFGA 1Z6HA 3RLNA 2F4VQ 2KA7A 4GZYC 4YCVA 1CK1A 3OTOQ 3E0JA 3PIO3 4XXEA 4G7HC 2JA7G 1PRTB 5D65A 4JW0A 1YZ6A 1SNQA 2EY6A 2NUCA 1WVLA 3ICEA 1I6VC 1LTAD 2L55A 2EYMA 3NBHB 3M4YA 4RGNA 4LF5L 1XPRA 4UY8C 4DR5L 4H7BA 1PXUA 4LJZC 4X64Q 1D7QA 2PNHA 4LK1C 1KXLA 2IT1A 1MD2D 4ME3A 4CKEA 5M5XB 3CPFA 1O78A 1YJ9A 2ICEC 2F0IA 3CPWA 4K5WA 1B8AA 4GN5A 3GTKB 1YHAA 2KEEA 1K9MC 1WTVA 4PMCA 3L0OA 2VNUD 2BA1A 1XMQL 2Z4IA 3UE0A 1ICFB 4OL7A 2TMPA 1BCPD 3KF6B 1AP0A 5D14A 1Y8NB 3A55A 1CT1D 3S9WA 4C3HB 3RD4A 1VQOA 4BA1I 3CC7A 3T1HL 3C46A 3EQLC 5EPLA 1G6PA 3KLWA 1MJCA 1K73C 5JPMC 1P16A 2K5DA 4DV2L 3GTJB 1IL2A 1O7IA 1B4OA 1K28A 2MJ8A 2QF7A 5M5XH 5K36G 2R93B 2RSNA 2L15A 1SYGA 3GTKH 1Q7YC 2QA4A 1NR2A 3D6WA 5FKAC 2K05A 1YHQA 1PRTD 3P20A 4N8FA 5GAGC 3G6EA 5C5LA 3QWNA 1DOKA 1HZCA 1II3A 1PTOH 4RGTA 4BA2I 4UDUC 2XN9C 1I3QB 4DNRB 2RDHA 4KHPL 2E76C 2K50A 4JBJA 2WB1G 3TZDA 1SBBB 5JVH3 1R9TH 3TSSA 4L5SA 2ZTEA 4C3HH 3HOUB 3KJOA 3BYTB 3K57A 2QGQA 3DEPA 3GTOB 1SR3A 1PH6A 2NZ1D 4FF4A 3AEVA 3HOXB 1XMOL 5M5YB 3BZDB 1NMFA 1SYBA 1M4VA 2CH4A 2F0KA 5DAUA 3VYTA 4JI8Q 1YNJD 3GTJH 4UHVA 1DCZA 1HZAA 3LWEA 4R4QA 1F2LA 3BU2A 2VUMB 2Z9HA 4RHSA 2R93H 1WOCA 1WJJA 1PTOD 5I6YA 1SNDA 4WJWA 1Q12A 2UUCQ 1PYBA 2D0PA 2PNRC 4H0LC 4C56C 3KOJA 1AH9A 1YJWA 2PW5A 2DN8A 2X6GA 1I6HB 1V9PA 1JWUD 1EFID 3E9HA 2F1MA 3U4VA 4G57A 3M4PA 1I3QH 4V0BA 1ILPA 1BBUA 2E75C 3S1QH 1XPOA 2DY8A 1TS3A 4R1JA 2C9OA 2QILA 1M8AA 2E8GA 3GTGB 3GTOH 5C4XB 1K83B 3FPUB 1SJED 3FP9A 5M5YH 1XNQL 3H3VH 2SNMA 4A93B 2L1BA 2WAQB 2SOBA 3S1RH 3BVZA 1V1OA 2FXQA 1CSQA 4LWCA 4DUZQ 1EL0A 4QIWB 2NN6G 1B53A 4K8IA 4YCUA 1CM9A 2ZJPA 1IKLA 3K0YA 1LT4D 1AZQA 3STBD 2E5LQ 3E9IA 1BNZA 1EOVA 1HZBA 4K2KA 3SK8A 1YI2A 2RCFA 1IBKL 1HUMA 2K5VA 2F3VA 2KCMA 3F2CA 4P75A 1TVXA 4JBKA 1VCIA 1TU2B 1YNXA 4DAMA 1P8LA 2XIWA 4C3HG 2OXPA 2PYKA 2J4XA 1BCPC 4IPDA 4OWXB 5IGBA 4HJ8A 4FF2A 3MXNB 1SE3A 4Y52H 1XJVA 4ZRZA 5C4XH 2L9HA 1JQYD 2WB1E 1XNRQ 1K0SA 4DR7Q 4A93H 2BH8A 1GOZA 5FO9B 3R93A 5LMNL 3IFTA 3NK9A 1ZXTA 5G3LF 4LF7L 3L3OC 1LTSD 2NYZD 4JI4L 4GS3A 1ZKOA 2R93G 2Z6BA 1PA6A 1HA6A 5CV4A 4K8JA 4YWLA 1X3EA 1PH7A 2G9HD 3K5MA 4A3JH 2AUJD 4XQNA 5LL6X 3PIP3 2JEAI 3PUXA 2K04A 5LL6S 1HTLD 3G7LA 4NXNQ 3RLFA 2HHHL 4IPHA 1TS5A 4ZK9B 1TIID 2TSSA 3HOVB 4LFBQ 1HH2P 1KHIA 1NSNS 4JYAQ 1UE5A 3J81E 5EAYA 1PRTC 1GUGA 4BXXG 2O5IC 1TWGH 1TWCB 2NVYB 4YHHL 3HOUG 2Z6KC 2DUDA 4KN4C 3KF6A 4L5RC 2R7ZB 5BN4A 4KV6A 5IYBH 2MQHA 3HOXG 5ELBA 2LKVA 1N34Q 3IL8A 4A4IA 1LTRD 4DK0A 5A2QE 1F9QA 4BY7B 2RQXA 2UXCL 2VUMG 1EY5A 2H4OA 4PZ7A 3UDGA 3DM3A 1HFNA 1YNJC 4A3FB 4IUNA 4OELB 1EIFA 1LT6D 3DLLA 3CW2C 4JI3Q 3GTPH 3NWTA 2F4VL 3G6JB 1EY7A 1PTOC 3OTOL 3HG9A 1FVIA 1Q81C 2F0VA 3K7UC 4Q5VA 1NCVA 4HMJA 2G5DA 3RZOH 4QQBX 1STNA 4DV1Q 3I91A 3TEHB 1TWCH 1JC7A 4PV1C 4X64L 4DUYQ 5C4XG 1GUSA 4IJLA 3KYHC 2E2JB 1JICA 1QVFA 4A93G 2NVTB 5C3EB 1PH5A 2WAQG 1SYDA 3TQYA 4GNXB 3HFZB 4P74A 2L12A 2H5XA 3JAME 1EZ6A 3KLSX 4BY7H 3J7YW 4R4CA 1B9NA 4XYQA 3PIOA 4A3FH 2AKWB 1PFNA 4F87A 2SNSA 3SK6A 2WFWA 2RHSB 1JB3A 1LM0A 4OX9Q 4QB4A 1AE3A 2MFIA 1VF7A 2B2WA 2F0JA 1CQFA 3STBC 4XYOA 1ET6A 2GA4B 2I0QA 1H95A 2B63B 3S15H 3L2PA 4H13C 2A8VA 5E7NA 5H1SE 2O5JC 3DWQA 3G48A 1E2WA 1RCVD 1YNND 2JA9A 1FD7D 1STEA 5IYBG 3H3VC 3V96A 2K4KA 4IOAA 2K28A 2GVAA 1VQ8A 2E2JH 2ZM6Q 2YTVA 3DUZA 3Q22A 1F9RA 2R3ZA 2NVTH 5C3EH 2LXKA 1NUCA 2PQEA 1PHJA 2KUMA 5JPNC 1PH9A 3H09A 3MXGA 1JMCA 1LTID 1DD2A 1SE2A 3M7GA 1B9MA 4TVAB 4YWMA 4PQXA 3VR3A 1ENFA 1T5EA 3VR4A 1ILQA 1QZHA 3HOVG 4RGOS 4X3KA 4BY1B 4QCLA 2KBNA 1S72A 2B63H 2YV5A 1VQ5A 4IPGA 3NE5B 2R7ZG 4JG2A 4JI8L 3EJIA 2ZXRA 2WV6D 2L11A 4FP5D 4B3TQ 2IX3A 2M2LA 4KTAA 3TS2A 1OXUA 3GP7A 2BCOA 4BY7G 3F8TA 5CV7A 1GUWA 3MXNA 2JYOA 1I50B 1M1KC 1FYCA 1F9PA 4A3FG 4ZKCB 3H94A 2UUCL 2WAQE 1A0IA 4L5QA 3N52A 4KY6A 5IOCA 1EOTA 3UDFA 4A3EB 2MO0A 3TP7A 1YIJA 1CQVA 1LACA 5KGUA 4Y7NB 4DV6L 1K0RA 1EWIA 1G8ZD 3P1HA 2FFKB 2K5HA 4BY1H 1X3QA 4RAUC 4QUCA 1CTMA 1GHJA 3H0GB 4KD4A 1EYCA 4LW1A 3T56B 4GLVB 3RN5A 3MAQA 3I4MB 4I65A 2VQFQ 4DK1A 1VQKA 2MPMA 4H44C 5C3EG 3CHBD 4C3IB 4DUZL 3GTQH 1H9KA 3DWPA 2X69A 3ND9A 4H02A 4ME5A 2E5LL 3S17B 1IBLQ 3U50C 3WDNA 1JJCB 3F2DA 1VQAA 2VY3A 2F52A 1SLJA 1UE7A 3TREA 1B1ZA 5JJKA 1I4PA 1Z9FA 4DNIA 3FKIB 2F0NA 2MNAA 3CC4A 2KVMA 4BBSB 3BDCA 2N55A 4CDEC 1O7LA 5FLMH 5C0XI 3CXCA 2B63G 3GTLH 4A3CH 4JI7Q 3T51B 4R4OA 2AMCB 5IWAQ 1XNRL 5G3LD 4PZ8A 3H0GH 2Q8IB 3PO2B 2MO1A 4A3MH 2VZAA 3I4MH 3MA2B 2A68D 3NTIA 1LTLA 4C3IH 1YNNC 2I46A 1M90C 3AMUA 3B6YA 1VQCA 5LMNW 3T1YQ 3UDIA 4NXNL 2VW9A 4HIMA 3CMAA 5A35A 4GNXA 3T4AC 2NVQB 3KLSA 4LFBL 2AUKA 4JYAL 1E2ZA 2Q2UA 1GUNA 2PZTA 3HS0C 4KHVA 3FKIH 4NKLA 4BY1G 4MN3A 4TSSA 3WWVA 3BZKA 4BBSH 2D62A 4DV7Q 4CDCC 3J80i 1SMYD 3L9AX 1N34L 1V1QA 1X3GA 4V190 3PO2H 3PIPA 1FNUA 2I5HA 4GNXC 2R7DA 3S2HB 2EJGC 2RKSA 2UXBQ 3RR5A 1D5XC 1S5BD 1FNVA 3MXPA 2ENBA 4JI3L 3EVQA 4BWGB 3KBXA 3NTKA 4JV5Q 3AYHB 5IP9H 2VQEQ 3A5UA 1SRUA 2QDBA 1IYUA 1HRJA 2OF1A 4A3EG 2E2HB 1PZID 1EYDA 1ENCA 3K7AH 2UUBQ 4DAYB 2F0FA 1CKMA 4DV1L 1QNKA 3J7AV 3J81j 4EGVA 3FRPB 4K0KQ 5GQOA 1TWFH 2XWJB 4DUYL 3CU7A 4C1NI 1YHBA 1TS2A 3H0GG 1K3RA 4PMWA 4ABNA 1K3BC 3I4MG 5FLXE 2R6GA 4C3IG 4UP9A 2UUAQ 1X54A 2LXJA 4ODGA 3CCQA 3S2HH 1E1TA 1SFOB 3I4LA 5BR8Q 4OX9L 1FR3A 3BS1A 2ICIA 4Z9CB 3VR2A 1VQDA 4X66Q 1SEBD 3J80E 1QVCA 4CDDC 2VS1A 3SVMA 2D5DA 2E2HH 2IHEA 1VMPA 3MEFA 4S3SA 2HT1A 3FKIG 4DR2Q 3D4WA 1I4RA 1W3SA 3C3LA 1KLGD 1STGA 2RSOA 4BBSG 1VQJA 4HN7A 4OHJA 4DV3Q 4KMUC 3GV6A 1T9HA 4P73A 2ZM6L 2F0PA 1J5EQ 3P75A 1GD7A 4FF3A 3PO2G 1VQ9A 3NBIA 1KL9A 1E2VA 4JI1Q 1TWAH 3ERQA 4IUTA 1U4PA 3M3YH 2WACA 4A76A 1AEXA 4OIKA 1KDBA 2JA8H 3L7ZC 1BQQT 3CCLA 3TP5A 3QG1A 1SFOH 2A68C 1C4QA 1TR5A 3VYSA 3PUZA 4CHTB 3CD6A 4DKAC 2LSSA 4O2DA 1PTOB 2KQ3A 2B8FA 2DGYA 4FVMA 1XPUA 4WJ4A 1FJGQ 1V1PA 2D0OA 1R9TB 4AYBE 1E1OA 1Z7TA 3MEHA 2CWPA 4OGQC 1K8OA 2HDLA 5C4JB 1Y14B 5CMDA 4B3TL 1OXSC 1G291 1CKNB 2EXZA 3MWYW 3J7ZC 3RUZA 4B3SQ 1SMYC 1K8AC 5ELOA 2VL6A 4WFN3 1KC8C 5KRUA 5IGDA 1B3AA 1PFSA 1VQBA 3GD7A 4M1UB 2OTJA 3K5NA 2WKCA 5IODA 3CCUA 1FNWA 2B8GA 2XRQD 1JOOA 3WOEA 4YWKA 4OO1I 1U4RA 4ALPA 5IIFA 3S14H 2K33A 4LF6Q 5HURA 5C0XH 2RF4A
chains in the Genus database with same CATH topology
1KAWA 3K81C 5JJLA 1MJEA 4BXXG 3UDXA 1TWGH 2PMZE 4YHHL 3T1HQ 1GM5A 3K80C 5GROA 2UU9L 3SGIA 3HOUG 2Z6KC 2DUDA 3IRBA 2AWNA 3KF6A 4DPGA 4L5RC 1NTGA 3H3VI 4RG1A 5IYBH 5FLMG 4A3CG 2MQHA 3HOXG 5C4JH 1J6QA 2ID0A 1N36L 1N34Q 2VQFL 4A4IA 4DV2Q 4LNQA 1SROA 1GVPA 4JI4Q 1EFWA 1EQRA 2EQSA 1AE2A 2OQKA 4XTCS 4A3MG 1ASYA 3I4OA 2UXCL 3PV0A 2VUMG 1IBLL 3W1GA 4PZ7A 3UDGA 3DM3A 4AQYQ 2KCTA 4LUOA 4JC0A 5HGQA 2E2IH 1X3FA 3PSIA 5C0XJ 1X56A 1EIFA 4QIWE 1JJGA 3DLLA 3CW2C 4JI3Q 5FJ8H 3GTPH 3AQQA 4GKKQ 3CP0A 3CC2A 2F4VL 2N3SA 3OTOL 1NJIC 1Q1EA 4OWTB 2YU9H 3I4NG 1FVIA 1Q81C 3F2BA 3K7UC 1UE6A 3ULJA 5JEAG 1KQSA 4OWWB 3M4QA 3CCRA 3RZOH 3I55A 4QQBX 1DGSA 1RL2A 4DV1Q 4POFA 2V1CC 1SN8A 1HNXQ 1HR0L 1VQLA 1YITA 4JI7L 2AHOB 3TEHB 1TWCH 3ULPA 4A75A 4GOPA 5IWAL 4X64L 4A3DH 4DUYQ 5C4XG 4IJLA 1XMOQ 4FDBA 3KYHC 4JI6Q 1UEBA 3PF4A 1QVFA 4A93G 1PH5A 1KRSA 2WAQG 3TQYA 1U5KA 4GNXB 3HFZB 2IY5B 4X6AH 4P74A 4DK6C 1ASZA 1I50H 2H5XA 3J81i 1IZ6A 1HJPA 4BY7H 2RCNA 5IYCH 2PQAB 4AIMA 2Y0SE 4A3KH 1WI5A 4R4CA 3LGJA 2N49A 3PIOA 1OXXK 2ZJQA 3T1YL 2CFMA 2B29A 3RLOA 4A3FH 2AKWB 4C3JH 1VQ4A 4A3EH 3EIVA 2WFWA 3RNUA 2RHSB 3PUVA 1LM0A 4OX9Q 1Q86C 3F1ZA 4C2MH 1AE3A 4IFDI 1MKHA 4Y7NH 2MFIA 4IFDG 5IYDH 4GOPC 3HOWH 3S1MH 3NEMA 3STBC 5IP9G 1JE5A 2I0QA 1IXRA 4EX5A 3I2ZA 4DV0L 2C35B 2Q2IA 2K52A 1HR0Q 1H95A 4MTNA 3A74A 4DV7L 3S15H 4BBRH 3AFQA 1EQQA 2IX1A 3RN2A 1VQHA 1X55A 5M3MH 3L2PA 1X6OA 1YVCA 2A8VA 3PO3H 5E7NA 4AH6A 5H1SE 1VQ7A 3HOZH 3G48A 4PZ6A 4GN3B 4P72A 4B3ML 4LFAL 2JA9A 1VQPA 5IYBG 3S2DH 4RMFA 2K4KA 4IOAA 3GDEA 2GVAA 1VQ8A 4DR3L 1EUJA 5IT9c 2ZM6Q 2E2JH 3M4OH 2YTVA 3U4ZA 4DR6Q 2NVTH 5C3EH 1PH1A 1UWVA 2A19A 2AWOA 2LXKA 1TXYA 3S17H 3I56A 2UXBL 1PHJA 4GKJL 3CQZH 1OXVA 1PH9A 4A3IH 2CWAA 2Z6KA 4JBWA 5LMUQ 4DK3C 1G51A 4JI0L 1JMCA 1WCMH 1NBWA 4HIOA 1L1OA 5FJ8G 4R4IA 3RZDH 4AYBG 1QZGA 3J7A5 4TVAB 1CUKA 4YWMA 1KRTA 3W5OA 4X65Q 1IBKQ 1D8LA 4LF8L 2UUBL 1KD1C 1QZHA 3HOVG 3CF5A 2JA7H 4J15A 2WP8J 3S1NH 4A3LG 4UPAA 2B3GA 4GN4B 2QEXA 3JAMi 2KBNA 5GAHC 1S72A 4K0KL 1PH8A 4LFCQ 4LF9Q 1W2BA 2JE6I 3K0XA 4NXML 2I5MX 2B63H 2UXDL 1X9NA 2YV5A 3CCVA 1VQ5A 4IPGA 1LYLA 3A5ZB 3G4SA 4A3DG 3S16H 1Z47A 4JG2A 2R7ZG 1B70B 4JI8L 3ULLA 1JB7A 4DV4Q 2ZTCA 4B3TQ 4JI5L 3HOYH 2RHQB 1C9OA 1YBYA 1L1OC 1YJNA 1VQEA 3TS2A 2R7FA 5DLQE 5LMNQ 1NE3A 1OXUA 3UE1A 2UUAL 4A3BG 1HNZL 4BY7G 4LF7Q 3F8TA 4YY3L 1Q8KA 3PCOB 4NPSA 1M1KC 4APVA 5FLXc 1N33L 1I94Q 5BR8L 4A3FG 1IBMQ 2UUCL 2F3IA 2NVQH 2WAQE 3CCEA 1A0IA 1CKNA 4L5QA 2JQOA 3OW2A 4LF8Q 3UDFA 4QGUA 2JA8G 2MO0A 4PG3A 5IYDG 5AJ3Q 2NZHA 2XTIA 3TS0A 2HHHQ 1YIJA 1I5FA 4DR1L 4DV6L 1K0RA 1EWIA 4XIGS 1A62A 4DR2L 3GTMH 3ZJYC 1N32L 2K5HA 2JJQA 3FHWA 4BY1H 3J80c 1UE1A 4BBRG 2ALYB 3EN2A 3KF8B 5M3MG 3EBEA 2UU9Q 1BVSA 2A1AA 2K75A 2NZOA 4YHHQ 1HR0W 4DV3L 3PO3G 1E24A 3BZCA 5GAEC 3ER0A 2R92H 4LW1A 1J5EL 4GLVB 3RN5A 4X62L 1WFQA 2CCZA 1TWHH 2YTXA 1PV4A 1N36Q 4LUVA 1GO3E 2VQFQ 4JI1L 1VQKA 5C3EG 2BH2A 3GTQH 4DUZL 2BA0A 2N78A 1IYJB 2IHFA 4H02A 2UXCQ 4DV5L 2E5LL 1IBLQ 1CSPA 3U50C 1C0AA 4A3IG 2JA6H 1JJCB 3F2DA 1VQAA 3M7NA 2CKZB 2VY3A 1Q1BA 1HNWL 4MNOA 1WYDA 2F52A 1JJ2A 1WCMG 1SLJA 4MZ9A 1UE7A 4JI2L 3PUYA 2JEBI 3GO5A 1Y1VH 3TREA 4A3JG 1SMXA 2HQLA 3RLNA 1BKBA 4DV6Q 2F4VQ 5JJKA 1FGUA 4L5TA 4YCVA 3OTOQ 3I7FA 3CCSA 4BXXH 1Z9FA 4DNIA 3HOUH 1QVGA 1EIYB 1QUQB 2JA7G 1YZ6A 2MNAA 3CC4A 1RIPA 3ICEA 2B63G 5FLMH 5C0XI 3GTLH 3HOXH 3CXCA 4A3CH 4IPCA 5C0XG 3NBHB 4JI7Q 4KLKA 1N9WA 4LF5L 1XPRA 4UY8C 4R4OA 4DR5L 2AMCB 5IWAQ 4X64Q 1XNRL 1D7QA 4PZ8A 3H0GH 3KDFB 2MO1A 2PNHA 2ZTDA 4A3MH 1KXLA 2VZAA 2VUMH 3JC66 3HOYG 4A3GH 3I4MH 2IT1A 4ME3A 4B3SL 3CMEA 2JA5H 4LF4L 3CPFA 1SE8A 4HJ7A 1YJ9A 5C44H 1LTLA 4C3IH 3CPWA 1E22A 1B8AA 5IY0A 1M90C 4GN5A 2KENA 1HZ9A 3B6YA 1YHAA 4LUZA 3E0EA 1VQCA 4P71A 2KHIA 5LMNW 3T1YQ 2PI2E 1K9MC 3L0OA 3UDIA 4NXNL 2VW9A 4IOCA 4B3RL 4HIMA 3CMAA 2BA1A 1XMQL 1I6HH 2VNUD 4O0AA 3PF5A 4GNXA 4JV5L 3UE0A 4DR4L 2VQEL 3KF6B 4TQUS 5GADC 1S40A 4LF6L 4LFBL 2PQAA 4JYAL 5J3BA 2Q2UA 4NB3A 1Q46A 5IE8A 2K5NA 3FKIH 4DV0Q 4BY1G 1VQOA 3GTGH 4UP7A 4BA1I 3CC7A 3T1HL 1C7YA 3WWVA 3BZKA 4BBSH 1K83H 2EIFA 2D62A 4DV7Q 5IP7H 3J81c 1G6PA 3Q8DA 3J80i 3KLWA 1MJCA 2R92G 1K73C 1VQGA 1P16A 1N34L 4R4TA 4B3MQ 4DV2L 1V1QA 1A8VA 4GLAC 4LFAQ 1L0WA 1IL2A 1O7IA 1X3GA 1VQ6A 3PO2H 3PIPA 1NY4A 4HJ9A 4DR3Q 2I5HA 4IO9A 1KIXA 5M5XH 4GNXC 5JEAJ 5K36G 2R7DA 2L15A 5M5WH 2UXBQ 3GTKH 4GKJQ 1XMQQ 3RR5A 1Q7YC 2QA4A 2Q2TA 2JA6G 4JI3L 5IYCG 2GN5A 2ATWA 4JV5Q 4A3KG 3AYHB 3S24A 5IP9H 3OYYA 2VQEQ 1YHQA 3A5UA 4JI0Q 1MIUA 1SRUA 5GAGC 3G6EA 3D31A 1Y1VG 4GOPB 1HZCA 3CCMA 4A3EG 4X66L 1PH3A 4BA2I 1PH2A 3K7AH 4KHPL 2UUBQ 2K50A 4JBJA 2WB1G 4DAYB 1CKMA 4DV1L 2HIVA 1R9TH 1HNXL 3HOWG 4L5SA 2ZTEA 4C3HH 3J81j 3KJOA 2XGTA 4K0KQ 2QGQA 5GQOA 2CQOA 1U0LA 4WJ3M 1SR3A 1PH6A 1TWFH 4NXMQ 2UXDQ 4DUYL 4IJHA 3AEVA 1XMOL 1B7YB 1YHBA 4HJ5A 4JI6L 3H0GG 1K3RA 4PMWA 3KJPA 1NMFA 1EYGA 2ASBA 5JJIA 4JI8Q 3GTJH 2OTLA 3A0JA 3U58A 3HOZG 4IFDJ 4A3GG 3I4MG 4JI5Q 2JA5G 1HZAA 4R4QA 3BU2A 1L2FA 3VDYA 5C44G 2R6GA 1PH4A 1VQNA 4UP9A 2R93H 2UUAQ 1X54A 1WOCA 1WJJA 2LXJA 1HNZQ 3CCQA 3S2HH 2ZJRA 3NELA 3M85A 4YY3Q 3AFPA 1E1TA 3HKZG 1N33Q 5BR8Q 1Q12A 2I5LX 2HIXA 3JAMc 1PYBA 2D0PA 2UUCQ 4OX9L 4OXPA 3KOJA 1VQDA 4X66Q 1YJWA 4KHZA 2OWOA 3HOVH 4A3LH 1AH9A 1QVCA 1BBWA 1V9PA 2VS1A 1N8RC 1VQMA 4KHPQ 2PI2A 2KHJA 3E9HA 2E2HH 5M3FH 1Y1WH 3U4VA 2Q2HA 2EXDA 2IHEA 3M4PA 3MEFA 1I3QH 2HT1A 2NVYH 3FKIG 1VS0A 4UP8A 4DR1Q 1BBUA 4OONA 4DR2Q 1N32Q 1W3SA 3S1QH 4JOIA 1V43A 3CAMA 1XPOA 2R7ZH 4BBSG 3W1BA 4R1JA 1VQJA 2E8GA 5IP7G 3ERSX 1FJGL 3GTOH 1CKOA 4DV3Q 3G71A 3FP9A 5M5YH 1XNQL 3H3VH 1T9HA 4P73A 2ZM6L 1J5EQ 4A3BH 3PUWA 1GD7A 4X62Q 3PO2G 3S1RH 1VQ9A 1L1OB 4DR6L 1KL9A 1PVOA 1NMGA 4KI0A 2FXQA 1S3OA 1CSQA 4LWCA 1TWAH 1VQFA 4JI1Q 4HJAA 2NN6I 3TRZA 4DR7L 4DUZQ 3M3YH 4HIDA 2NN6G 4A76A 4YCUA 2YYZA 2ZJPA 5LMUL 3M9BA 1OTCA 3STBD 4DV5Q 1GKHA 2E5LQ 3E9IA 3NENA 2JA8H 3L7ZC 1EOVA 3CCLA 1HNWQ 1HZBA 1SFOH 4YCWA 4JOIC 2ES2A 2OCEA 4X65L 1VQIA 1YI2A 1IBKL 2OQ0A 2K5VA 4JI2Q 4EQ5A 3I4NH 3PUZA 3CD6A 1JT8A 2KCMA 4JCVE 4DKAC 4P75A 3F2CA 2LSSA 4O2DA 3KFUA 2GVBA 3K8AA 1VCIA 3CCJA 4JBKA 3D0FA 2DGYA 2JK8A 1YNXA 4DAMA 1P8LA 4LFCL 1E3PA 4LF9L 1XPUA 4WJ4A 1FJGQ 1Q82C 3HKSA 2D0OA 4IPDA 4AYBE 1E1OA 1X65A 2IX0A 4OWXB 4HJ8A 2CWPA 1XNQQ 3MXNB 4Y52H 1XJVA 1PYSB 5C4XH 4LF5Q 2WB1E 1Y14B 2Y0SG 4DV4L 4DR5Q 4B3TL 1XNRQ 1OXSC 1YEZA 1G291 4GLXA 1QUQA 1CKNB 4DR7Q 4A93H 2BH8A 2K14A 4POGA 3J7ZC 1K8GA 2YTYA 5LMNL 4B3SQ 4LF7L 1K8AC 4QL5A 4JI4L 4GS3A 2VL6A 5ELOA 4LF4Q 1IBML 2R93G 1PA6A 1FL0A 1LUZA 1I94L 4YWLA 1X3EA 1KC8C 2Z0SA 4QJFA 1PH7A 2N8NA 4A3JH 1PFSA 1VQBA 3KDFA 3H15A 3GD7A 5HY6A 2JEAI 3PUXA 3PGZA 5ELNA 4AQYL 2OTJA 3CCUA 4B3RQ 1A63A 4NXNQ 3RLFA 4YWKA 5AJ3L 4OO1I 2HHHL 4IPHA 2NVXH 1E7ZA 1OXTA 4ALPA 4GKKL 4OO1G 1XTDA 3S14H 4DR4Q 4HIKA 5M3FG 4JBMA 1Y1WG 4LFBQ 1HH2P 4LF6Q 1KHIA 4JYAQ 1UE5A 3HKZE 3BJUA 2RF4A 5EAYA 4QY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAW A;  3K81 C;  5JJL A;  1MJE A;  4BXX G;  3UDX A;  1TWG H;  2PMZ E;  4YHH L;  3T1H Q;  1GM5 A;  3K80 C;  5GRO A;  2UU9 L;  3SGI A;  3HOU G;  2Z6K C;  2DUD A;  3IRB A;  2AWN A;  3KF6 A;  4DPG A;  4L5R C;  1NTG A;  3H3V I;  4RG1 A;  5IYB H;  5FLM G;  4A3C G;  2MQH A;  3HOX G;  5C4J H;  1J6Q A;  2ID0 A;  1N36 L;  1N34 Q;  2VQF L;  4A4I A;  4DV2 Q;  4LNQ A;  1SRO A;  1GVP A;  4JI4 Q;  1EFW A;  1EQR A;  2EQS A;  1AE2 A;  2OQK A;  4XTC S;  4A3M G;  1ASY A;  3I4O A;  2UXC L;  3PV0 A;  2VUM G;  1IBL L;  3W1G A;  4PZ7 A;  3UDG A;  3DM3 A;  4AQY Q;  2KCT A;  4LUO A;  4JC0 A;  5HGQ A;  2E2I H;  1X3F A;  3PSI A;  5C0X J;  1X56 A;  1EIF A;  4QIW E;  1JJG A;  3DLL A;  3CW2 C;  4JI3 Q;  5FJ8 H;  3GTP H;  3AQQ A;  4GKK Q;  3CP0 A;  3CC2 A;  2F4V L;  2N3S A;  3OTO L;  1NJI C;  1Q1E A;  4OWT B;  2YU9 H;  3I4N G;  1FVI A;  1Q81 C;  3F2B A;  3K7U C;  1UE6 A;  3ULJ A;  5JEA G;  1KQS A;  4OWW B;  3M4Q A;  3CCR A;  3RZO H;  3I55 A;  4QQB X;  1DGS A;  1RL2 A;  4DV1 Q;  4POF A;  2V1C C;  1SN8 A;  1HNX Q;  1HR0 L;  1VQL A;  1YIT A;  4JI7 L;  2AHO B;  3TEH B;  1TWC H;  3ULP A;  4A75 A;  4GOP A;  5IWA L;  4X64 L;  4A3D H;  4DUY Q;  5C4X G;  4IJL A;  1XMO Q;  4FDB A;  3KYH C;  4JI6 Q;  1UEB A;  3PF4 A;  1QVF A;  4A93 G;  1PH5 A;  1KRS A;  2WAQ G;  3TQY A;  1U5K A;  4GNX B;  3HFZ B;  2IY5 B;  4X6A H;  4P74 A;  4DK6 C;  1ASZ A;  1I50 H;  2H5X A;  3J81 i;  1IZ6 A;  1HJP A;  4BY7 H;  2RCN A;  5IYC H;  2PQA B;  4AIM A;  2Y0S E;  4A3K H;  1WI5 A;  4R4C A;  3LGJ A;  2N49 A;  3PIO A;  1OXX K;  2ZJQ A;  3T1Y L;  2CFM A;  2B29 A;  3RLO A;  4A3F H;  2AKW B;  4C3J H;  1VQ4 A;  4A3E H;  3EIV A;  2WFW A;  3RNU A;  2RHS B;  3PUV A;  1LM0 A;  4OX9 Q;  1Q86 C;  3F1Z A;  4C2M H;  1AE3 A;  4IFD I;  1MKH A;  4Y7N H;  2MFI A;  4IFD G;  5IYD H;  4GOP C;  3HOW H;  3S1M H;  3NEM A;  3STB C;  5IP9 G;  1JE5 A;  2I0Q A;  1IXR A;  4EX5 A;  3I2Z A;  4DV0 L;  2C35 B;  2Q2I A;  2K52 A;  1HR0 Q;  1H95 A;  4MTN A;  3A74 A;  4DV7 L;  3S15 H;  4BBR H;  3AFQ A;  1EQQ A;  2IX1 A;  3RN2 A;  1VQH A;  1X55 A;  5M3M H;  3L2P A;  1X6O A;  1YVC A;  2A8V A;  3PO3 H;  5E7N A;  4AH6 A;  5H1S E;  1VQ7 A;  3HOZ H;  3G48 A;  4PZ6 A;  4GN3 B;  4P72 A;  4B3M L;  4LFA L;  2JA9 A;  1VQP A;  5IYB G;  3S2D H;  4RMF A;  2K4K A;  4IOA A;  3GDE A;  2GVA A;  1VQ8 A;  4DR3 L;  1EUJ A;  5IT9 c;  2ZM6 Q;  2E2J H;  3M4O H;  2YTV A;  3U4Z A;  4DR6 Q;  2NVT H;  5C3E H;  1PH1 A;  1UWV A;  2A19 A;  2AWO A;  2LXK A;  1TXY A;  3S17 H;  3I56 A;  2UXB L;  1PHJ A;  4GKJ L;  3CQZ H;  1OXV A;  1PH9 A;  4A3I H;  2CWA A;  2Z6K A;  4JBW A;  5LMU Q;  4DK3 C;  1G51 A;  4JI0 L;  1JMC A;  1WCM H;  1NBW A;  4HIO A;  1L1O A;  5FJ8 G;  4R4I A;  3RZD H;  4AYB G;  1QZG A;  3J7A 5;  4TVA B;  1CUK A;  4YWM A;  1KRT A;  3W5O A;  4X65 Q;  1IBK Q;  1D8L A;  4LF8 L;  2UUB L;  1KD1 C;  1QZH A;  3HOV G;  3CF5 A;  2JA7 H;  4J15 A;  2WP8 J;  3S1N H;  4A3L G;  4UPA A;  2B3G A;  4GN4 B;  2QEX A;  3JAM i;  2KBN A;  5GAH C;  1S72 A;  4K0K L;  1PH8 A;  4LFC Q;  4LF9 Q;  1W2B A;  2JE6 I;  3K0X A;  4NXM L;  2I5M X;  2B63 H;  2UXD L;  1X9N A;  2YV5 A;  3CCV A;  1VQ5 A;  4IPG A;  1LYL A;  3A5Z B;  3G4S A;  4A3D G;  3S16 H;  1Z47 A;  4JG2 A;  2R7Z G;  1B70 B;  4JI8 L;  3ULL A;  1JB7 A;  4DV4 Q;  2ZTC A;  4B3T Q;  4JI5 L;  3HOY H;  2RHQ B;  1C9O A;  1YBY A;  1L1O C;  1YJN A;  1VQE A;  3TS2 A;  2R7F A;  5DLQ E;  5LMN Q;  1NE3 A;  1OXU A;  3UE1 A;  2UUA L;  4A3B G;  1HNZ L;  4BY7 G;  4LF7 Q;  3F8T A;  4YY3 L;  1Q8K A;  3PCO B;  4NPS A;  1M1K C;  4APV A;  5FLX c;  1N33 L;  1I94 Q;  5BR8 L;  4A3F G;  1IBM Q;  2UUC L;  2F3I A;  2NVQ H;  2WAQ E;  3CCE A;  1A0I A;  1CKN A;  4L5Q A;  2JQO A;  3OW2 A;  4LF8 Q;  3UDF A;  4QGU A;  2JA8 G;  2MO0 A;  4PG3 A;  5IYD G;  5AJ3 Q;  2NZH A;  2XTI A;  3TS0 A;  2HHH Q;  1YIJ A;  1I5F A;  4DR1 L;  4DV6 L;  1K0R A;  1EWI A;  4XIG S;  1A62 A;  4DR2 L;  3GTM H;  3ZJY C;  1N32 L;  2K5H A;  2JJQ A;  3FHW A;  4BY1 H;  3J80 c;  1UE1 A;  4BBR G;  2ALY B;  3EN2 A;  3KF8 B;  5M3M G;  3EBE A;  2UU9 Q;  1BVS A;  2A1A A;  2K75 A;  2NZO A;  4YHH Q;  1HR0 W;  4DV3 L;  3PO3 G;  1E24 A;  3BZC A;  5GAE C;  3ER0 A;  2R92 H;  4LW1 A;  1J5E L;  4GLV B;  3RN5 A;  4X62 L;  1WFQ A;  2CCZ A;  1TWH H;  2YTX A;  1PV4 A;  1N36 Q;  4LUV A;  1GO3 E;  2VQF Q;  4JI1 L;  1VQK A;  5C3E G;  2BH2 A;  3GTQ H;  4DUZ L;  2BA0 A;  2N78 A;  1IYJ B;  2IHF A;  4H02 A;  2UXC Q;  4DV5 L;  2E5L L;  1IBL Q;  1CSP A;  3U50 C;  1C0A A;  4A3I G;  2JA6 H;  1JJC B;  3F2D A;  1VQA A;  3M7N A;  2CKZ B;  2VY3 A;  1Q1B A;  1HNW L;  4MNO A;  1WYD A;  2F52 A;  1JJ2 A;  1WCM G;  1SLJ A;  4MZ9 A;  1UE7 A;  4JI2 L;  3PUY A;  2JEB I;  3GO5 A;  1Y1V H;  3TRE A;  4A3J G;  1SMX A;  2HQL A;  3RLN A;  1BKB A;  4DV6 Q;  2F4V Q;  5JJK A;  1FGU A;  4L5T A;  4YCV A;  3OTO Q;  3I7F A;  3CCS A;  4BXX H;  1Z9F A;  4DNI A;  3HOU H;  1QVG A;  1EIY B;  1QUQ B;  2JA7 G;  1YZ6 A;  2MNA A;  3CC4 A;  1RIP A;  3ICE A;  2B63 G;  5FLM H;  5C0X I;  3GTL H;  3HOX H;  3CXC A;  4A3C H;  4IPC A;  5C0X G;  3NBH B;  4JI7 Q;  4KLK A;  1N9W A;  4LF5 L;  1XPR A;  4UY8 C;  4R4O A;  4DR5 L;  2AMC B;  5IWA Q;  4X64 Q;  1XNR L;  1D7Q A;  4PZ8 A;  3H0G H;  3KDF B;  2MO1 A;  2PNH A;  2ZTD A;  4A3M H;  1KXL A;  2VZA A;  2VUM H;  3JC6 6;  3HOY G;  4A3G H;  3I4M H;  2IT1 A;  4ME3 A;  4B3S L;  3CME A;  2JA5 H;  4LF4 L;  3CPF A;  1SE8 A;  4HJ7 A;  1YJ9 A;  5C44 H;  1LTL A;  4C3I H;  3CPW A;  1E22 A;  1B8A A;  5IY0 A;  1M90 C;  4GN5 A;  2KEN A;  1HZ9 A;  3B6Y A;  1YHA A;  4LUZ A;  3E0E A;  1VQC A;  4P71 A;  2KHI A;  5LMN W;  3T1Y Q;  2PI2 E;  1K9M C;  3L0O A;  3UDI A;  4NXN L;  2VW9 A;  4IOC A;  4B3R L;  4HIM A;  3CMA A;  2BA1 A;  1XMQ L;  1I6H H;  2VNU D;  4O0A A;  3PF5 A;  4GNX A;  4JV5 L;  3UE0 A;  4DR4 L;  2VQE L;  3KF6 B;  4TQU S;  5GAD C;  1S40 A;  4LF6 L;  4LFB L;  2PQA A;  4JYA L;  5J3B A;  2Q2U A;  4NB3 A;  1Q46 A;  5IE8 A;  2K5N A;  3FKI H;  4DV0 Q;  4BY1 G;  1VQO A;  3GTG H;  4UP7 A;  4BA1 I;  3CC7 A;  3T1H L;  1C7Y A;  3WWV A;  3BZK A;  4BBS H;  1K83 H;  2EIF A;  2D62 A;  4DV7 Q;  5IP7 H;  3J81 c;  1G6P A;  3Q8D A;  3J80 i;  3KLW A;  1MJC A;  2R92 G;  1K73 C;  1VQG A;  1P16 A;  1N34 L;  4R4T A;  4B3M Q;  4DV2 L;  1V1Q A;  1A8V A;  4GLA C;  4LFA Q;  1L0W A;  1IL2 A;  1O7I A;  1X3G A;  1VQ6 A;  3PO2 H;  3PIP A;  1NY4 A;  4HJ9 A;  4DR3 Q;  2I5H A;  4IO9 A;  1KIX A;  5M5X H;  4GNX C;  5JEA J;  5K36 G;  2R7D A;  2L15 A;  5M5W H;  2UXB Q;  3GTK H;  4GKJ Q;  1XMQ Q;  3RR5 A;  1Q7Y C;  2QA4 A;  2Q2T A;  2JA6 G;  4JI3 L;  5IYC G;  2GN5 A;  2ATW A;  4JV5 Q;  4A3K G;  3AYH B;  3S24 A;  5IP9 H;  3OYY A;  2VQE Q;  1YHQ A;  3A5U A;  4JI0 Q;  1MIU A;  1SRU A;  5GAG C;  3G6E A;  3D31 A;  1Y1V G;  4GOP B;  1HZC A;  3CCM A;  4A3E G;  4X66 L;  1PH3 A;  4BA2 I;  1PH2 A;  3K7A H;  4KHP L;  2UUB Q;  2K50 A;  4JBJ A;  2WB1 G;  4DAY B;  1CKM A;  4DV1 L;  2HIV A;  1R9T H;  1HNX L;  3HOW G;  4L5S A;  2ZTE A;  4C3H H;  3J81 j;  3KJO A;  2XGT A;  4K0K Q;  2QGQ A;  5GQO A;  2CQO A;  1U0L A;  4WJ3 M;  1SR3 A;  1PH6 A;  1TWF H;  4NXM Q;  2UXD Q;  4DUY L;  4IJH A;  3AEV A;  1XMO L;  1B7Y B;  1YHB A;  4HJ5 A;  4JI6 L;  3H0G G;  1K3R A;  4PMW A;  3KJP A;  1NMF A;  1EYG A;  2ASB A;  5JJI A;  4JI8 Q;  3GTJ H;  2OTL A;  3A0J A;  3U58 A;  3HOZ G;  4IFD J;  4A3G G;  3I4M G;  4JI5 Q;  2JA5 G;  1HZA A;  4R4Q A;  3BU2 A;  1L2F A;  3VDY A;  5C44 G;  2R6G A;  1PH4 A;  1VQN A;  4UP9 A;  2R93 H;  2UUA Q;  1X54 A;  1WOC A;  1WJJ A;  2LXJ A;  1HNZ Q;  3CCQ A;  3S2H H;  2ZJR A;  3NEL A;  3M85 A;  4YY3 Q;  3AFP A;  1E1T A;  3HKZ G;  1N33 Q;  5BR8 Q;  1Q12 A;  2I5L X;  2HIX A;  3JAM c;  1PYB A;  2D0P A;  2UUC Q;  4OX9 L;  4OXP A;  3KOJ A;  1VQD A;  4X66 Q;  1YJW A;  4KHZ A;  2OWO A;  3HOV H;  4A3L H;  1AH9 A;  1QVC A;  1BBW A;  1V9P A;  2VS1 A;  1N8R C;  1VQM A;  4KHP Q;  2PI2 A;  2KHJ A;  3E9H A;  2E2H H;  5M3F H;  1Y1W H;  3U4V A;  2Q2H A;  2EXD A;  2IHE A;  3M4P A;  3MEF A;  1I3Q H;  2HT1 A;  2NVY H;  3FKI G;  1VS0 A;  4UP8 A;  4DR1 Q;  1BBU A;  4OON A;  4DR2 Q;  1N32 Q;  1W3S A;  3S1Q H;  4JOI A;  1V43 A;  3CAM A;  1XPO A;  2R7Z H;  4BBS G;  3W1B A;  4R1J A;  1VQJ A;  2E8G A;  5IP7 G;  3ERS X;  1FJG L;  3GTO H;  1CKO A;  4DV3 Q;  3G71 A;  3FP9 A;  5M5Y H;  1XNQ L;  3H3V H;  1T9H A;  4P73 A;  2ZM6 L;  1J5E Q;  4A3B H;  3PUW A;  1GD7 A;  4X62 Q;  3PO2 G;  3S1R H;  1VQ9 A;  1L1O B;  4DR6 L;  1KL9 A;  1PVO A;  1NMG A;  4KI0 A;  2FXQ A;  1S3O A;  1CSQ A;  4LWC A;  1TWA H;  1VQF A;  4JI1 Q;  4HJA A;  2NN6 I;  3TRZ A;  4DR7 L;  4DUZ Q;  3M3Y H;  4HID A;  2NN6 G;  4A76 A;  4YCU A;  2YYZ A;  2ZJP A;  5LMU L;  3M9B A;  1OTC A;  3STB D;  4DV5 Q;  1GKH A;  2E5L Q;  3E9I A;  3NEN A;  2JA8 H;  3L7Z C;  1EOV A;  3CCL A;  1HNW Q;  1HZB A;  1SFO H;  4YCW A;  4JOI C;  2ES2 A;  2OCE A;  4X65 L;  1VQI A;  1YI2 A;  1IBK L;  2OQ0 A;  2K5V A;  4JI2 Q;  4EQ5 A;  3I4N H;  3PUZ A;  3CD6 A;  1JT8 A;  2KCM A;  4JCV E;  4DKA C;  4P75 A;  3F2C A;  2LSS A;  4O2D A;  3KFU A;  2GVB A;  3K8A A;  1VCI A;  3CCJ A;  4JBK A;  3D0F A;  2DGY A;  2JK8 A;  1YNX A;  4DAM A;  1P8L A;  4LFC L;  1E3P A;  4LF9 L;  1XPU A;  4WJ4 A;  1FJG Q;  1Q82 C;  3HKS A;  2D0O A;  4IPD A;  4AYB E;  1E1O A;  1X65 A;  2IX0 A;  4OWX B;  4HJ8 A;  2CWP A;  1XNQ Q;  3MXN B;  4Y52 H;  1XJV A;  1PYS B;  5C4X H;  4LF5 Q;  2WB1 E;  1Y14 B;  2Y0S G;  4DV4 L;  4DR5 Q;  4B3T L;  1XNR Q;  1OXS C;  1YEZ A;  1G29 1;  4GLX A;  1QUQ A;  1CKN B;  4DR7 Q;  4A93 H;  2BH8 A;  2K14 A;  4POG A;  3J7Z C;  1K8G A;  2YTY A;  5LMN L;  4B3S Q;  4LF7 L;  1K8A C;  4QL5 A;  4JI4 L;  4GS3 A;  2VL6 A;  5ELO A;  4LF4 Q;  1IBM L;  2R93 G;  1PA6 A;  1FL0 A;  1LUZ A;  1I94 L;  4YWL A;  1X3E A;  1KC8 C;  2Z0S A;  4QJF A;  1PH7 A;  2N8N A;  4A3J H;  1PFS A;  1VQB A;  3KDF A;  3H15 A;  3GD7 A;  5HY6 A;  2JEA I;  3PUX A;  3PGZ A;  5ELN A;  4AQY L;  2OTJ A;  3CCU A;  4B3R Q;  1A63 A;  4NXN Q;  3RLF A;  4YWK A;  5AJ3 L;  4OO1 I;  2HHH L;  4IPH A;  2NVX H;  1E7Z A;  1OXT A;  4ALP A;  4GKK L;  4OO1 G;  1XTD A;  3S14 H;  4DR4 Q;  4HIK A;  5M3F G;  4JBM A;  1Y1W G;  4LFB Q;  1HH2 P;  4LF6 Q;  1KHI A;  4JYA Q;  1UE5 A;  3HKZ E;  3BJU A;  2RF4 A;  5EAY A;  4QY7 A; 
#chains in the Genus database with same CATH topology
 1KAW A;  3QO2 A;  4DXG A;  5JJL A;  1D2B A;  1GM5 A;  3SGI A;  1A2U A;  3S1Q B;  3D4D A;  3IRB A;  2AWN A;  3V2T A;  1B2T A;  1U4L A;  2RDF A;  1D5Z C;  4RG1 A;  4KN7 C;  5C4J H;  3SXH A;  5EQ0 A;  2VQF L;  4LNQ A;  1O80 A;  1SJH D;  3MTS A;  3E5S A;  2OQK A;  1T5X D;  3S1R B;  2B2T C;  3URY A;  2QKI C;  1IBL L;  3W1G A;  1HHV A;  3OHX C;  4AQY Q;  3CRK C;  2EOT A;  5HGQ A;  3NQT A;  4DF7 A;  4K14 A;  4F8M A;  1JJG A;  5J1Z A;  3I72 A;  4GKK Q;  4C2M B;  3CC2 A;  2SDF A;  5IGG A;  2QDL A;  5CC4 A;  1CZG A;  1D1K A;  2IJ0 A;  3ULJ A;  1KQS A;  3M4Q A;  1XYI A;  1F2M A;  3CCR A;  1VQL A;  5KIX A;  4JI7 L;  2IPK D;  3ULP A;  5IWA L;  5KYL A;  4FDB A;  2MHV A;  5JJZ A;  1H9J A;  4DAY A;  2F0H A;  4EVO A;  1O7Y A;  4DK6 C;  3J81 i;  2OEO A;  2RCN A;  5IYC H;  3CQZ B;  1I4G A;  3C2P A;  4A3K H;  2F0O A;  2N49 A;  3T1Y L;  3KF8 A;  1GUT A;  1STY A;  3EIV A;  3RZD B;  4A3J B;  1JWS D;  1EU4 A;  4C2M H;  4IFD I;  4IUP A;  4NMZ A;  2F0G A;  3HOW H;  2DNE A;  3S1N B;  3N6R A;  3I2Z A;  1HR0 Q;  4IAL A;  2K52 A;  4G7O C;  5DEH A;  2Q8R E;  3QIA A;  4MTN A;  2Q8T A;  1B50 A;  3ONA B;  2MGS A;  3A74 A;  3X3M A;  4DV7 L;  1PZJ D;  1VQH A;  1X55 A;  2JXM B;  1X6O A;  1YVC A;  4KJO A;  3C1F A;  4AH6 A;  3HOZ H;  1TWG B;  4GN3 B;  1ROD A;  1U9R A;  1C8C A;  3HOY B;  4EQO A;  3U4Z A;  1C48 A;  2AWO A;  1TXY A;  1UNS A;  5C5M A;  2UXB L;  3CQZ H;  2EVB A;  2SEB D;  1EY0 A;  2Z6K A;  3AB9 A;  5CBE E;  3NBH A;  2VB2 X;  3GQB A;  1QOH A;  2PZU A;  3RZD H;  4CKC A;  3ND8 A;  3OIQ A;  4X65 Q;  3GTP B;  2OT2 A;  4LF8 L;  1D8L A;  3A8K E;  1SXT A;  2UUB L;  3GTM B;  3I73 A;  3CF5 A;  1GJX A;  3S1N H;  1A15 A;  2B3G A;  4GN4 B;  1QG7 A;  3W2D A;  3JAM i;  5GAH C;  2E74 C;  4K0K L;  4X3T A;  4N9T A;  4LFC Q;  2JE6 I;  4I7A A;  2HCI A;  3RZO B;  2J7Z A;  3A5Z B;  3I3C A;  1W6J A;  3S16 H;  1QWY A;  5COY A;  3Q24 A;  5E1F A;  3ULL A;  5K5P A;  2I07 B;  4DV4 Q;  2ZTC A;  1JB7 A;  3HOY H;  2Z8L A;  1YJN A;  1VQE A;  5DLQ E;  1NE3 A;  3UE1 A;  2UUA L;  5I9P A;  2JA6 B;  1KDA A;  4APV A;  3TP8 A;  1I94 Q;  1JOQ A;  5BR8 L;  1IBM Q;  4I7Z C;  3TDQ A;  2F3I A;  3NHH A;  3BDO A;  1CKN A;  4CKB A;  3CCE A;  4EQN A;  1Y1V B;  5KYI A;  2K32 A;  3SHL A;  4QGU A;  5COR A;  4ZYS A;  5AJ3 Q;  1EZ8 A;  4ZLT F;  1PYW D;  4DR2 L;  3GTM H;  3D3R A;  5A2Q L;  1UE1 A;  3ERO A;  2JSO A;  4ZKB B;  3EBE A;  1BVS A;  4DV3 L;  3S15 B;  3BZC A;  3ER0 A;  1J5E L;  3I8Z A;  1F77 A;  1PZK D;  2YTX A;  4LUV A;  4XDX A;  2JA5 B;  4JI1 L;  2BH2 A;  3U9O A;  3Q0A A;  5JAV A;  2BA0 A;  2B2U A;  5E4X A;  2IHF A;  1CSP A;  1C0A A;  1RTO A;  2JA6 H;  3M7N A;  4KKT A;  1Q1B A;  3OWF A;  4B9W A;  3K58 A;  1JJ2 A;  3E3X A;  4OO1 H;  3DHQ A;  4MZ9 A;  2PMZ B;  3GO5 A;  4A3J G;  1Y1V H;  5ISR A;  2HQL A;  1FGU A;  3CCS A;  4RHR A;  1ENA A;  1EWC A;  1QVG A;  3MFG A;  2M00 A;  1EIY B;  4QF4 A;  3D4R A;  1EY9 A;  2HDM A;  3P7J A;  1S4Z A;  2EY5 A;  2CW0 D;  1J9O A;  2B2U C;  1N9W A;  3KDF B;  5BN5 A;  4RWS C;  3VR5 A;  2ZTD A;  1BO0 A;  3HOY G;  4E6I A;  4B3S L;  3CME A;  3C1E A;  4X3U A;  2JA5 H;  2RA4 A;  1SE8 A;  1HUN A;  4HJ7 A;  2PCF B;  5EBD A;  3FVQ A;  5M5W B;  3A7A B;  1E22 A;  1LT5 D;  2KEN A;  3A56 A;  2K1B A;  3NSW A;  1CA5 A;  1TT2 A;  4P71 A;  2MP1 A;  2PI2 E;  3FEW X;  4J1M A;  1SYE A;  4IOC A;  2HD3 A;  1DXM A;  2KEC A;  3NWS A;  1EY8 A;  4ZUJ A;  2EJM A;  4RFB A;  1SDF A;  4TQU S;  4KJN A;  4LF6 L;  2V4D A;  4NB3 A;  2F0S A;  1ET9 A;  5CV6 A;  4F7X A;  2EYJ A;  4B08 A;  4LMQ D;  4DV0 Q;  4UP7 A;  3HEJ A;  2EIF A;  2Y0S B;  4R4T A;  4B3M Q;  1A8V A;  2F0W A;  1NY4 A;  2CVR A;  4DR3 Q;  4IO9 A;  1KIX A;  1IL8 A;  5JEA J;  5CV5 A;  1DZ1 A;  5M5W H;  3TP6 A;  3GTQ B;  2QEJ C;  4K6L A;  4GKJ Q;  1XMQ Q;  2JA6 G;  2Q2T A;  4M8A A;  1SYC A;  4IFD H;  2GN5 A;  4KKS A;  1MHW C;  1QIL A;  2ATW A;  3OYY A;  3K59 A;  1HCZ A;  5D3D A;  1Y1V G;  1SNM A;  4CBV A;  3D8G A;  3A8I E;  3NUC A;  1BCP F;  1PH3 A;  1PH2 A;  1Q3L A;  3FMC A;  4AYB B;  2HIV A;  5M9O A;  1UEA B;  2XGT A;  1U0L A;  3LWU A;  4NP5 A;  4NXM Q;  2UXD Q;  3EA6 A;  3BYY B;  3E6Z X;  3SR1 A;  3GTL B;  1OO9 B;  2ASB A;  4HED A;  3K5O A;  3U58 A;  1WD1 A;  4JI5 Q;  2JA5 G;  4A3M B;  1L2F A;  4IQZ A;  3VDY A;  1PH4 A;  1EIG A;  1AN8 A;  1VQN A;  4CJ0 B;  2B2Y A;  4L63 B;  2AQ2 B;  1HNZ Q;  1AW7 A;  2ZJR A;  3M85 A;  4YY3 Q;  4JVZ A;  3DMU A;  1N33 Q;  2HIX A;  1PRT F;  4KD3 A;  2OWO A;  4KHZ A;  2RDG A;  4A3L H;  1ZYR D;  1BBW A;  4KHP Q;  1N8R C;  2XRS D;  5ELC A;  2Q2H A;  1LO5 D;  1GUO A;  1VS0 A;  2F0D A;  4OON A;  1RHP A;  1V43 A;  3CAM A;  4RKL A;  3IKJ A;  3W1B A;  2CH4 W;  3ERS X;  2B2Y C;  2WKD A;  3G71 A;  3OSO A;  2WIN B;  4FO2 A;  4UAI A;  5I2X A;  3WOF A;  3AU7 A;  4A3B H;  3PUW A;  1X32 A;  2CW0 C;  4KI0 A;  4DR7 L;  4FNF A;  1VQF A;  1QNU A;  2NN6 I;  3TRZ A;  1PMR A;  1AFP A;  4HID A;  2EY2 A;  2P5Z X;  1TS4 A;  3FPP A;  1S5D D;  1GKH A;  1HNW Q;  1TQO A;  4ZUI A;  2ES2 A;  2OCE A;  4X65 L;  2OQ0 A;  5JOB A;  5JEA H;  3CCJ A;  2IWH A;  2JK8 A;  4LFC L;  2EDG A;  2L5T A;  3K7A B;  1R4Q B;  2CQA A;  2LY7 A;  1Q82 C;  1X65 A;  1A3U A;  2WII B;  2X6L A;  1XNQ Q;  4R8I A;  1PYS B;  1DM0 B;  2LFN A;  3VA7 A;  4DV4 L;  2Y0S G;  1TWF B;  5IT9 E;  1YEZ A;  4GLX A;  2EZV A;  1UUP A;  5C4Z A;  4WRD A;  4QL5 A;  4LF4 Q;  1QCB D;  3QOL A;  1FL0 A;  1I94 L;  1DJR D;  1IHZ A;  1IBM L;  2Z0S A;  4QJF A;  1EIH A;  2N8N A;  3KDF A;  2EYO A;  4HCE A;  1SNO A;  4B3R Q;  1A63 A;  1ONL A;  1QE6 A;  5EPJ A;  5AJ3 L;  2NVX H;  1E7Z A;  3DM1 A;  1XTD A;  4DR4 Q;  2FHT A;  4HIK A;  1XWE A;  3BJU A;  1SNC A;  1Q90 A;  3W3A A;  1TKW B;  1IW7 D;  4QY7 A;  2O2L D;  4AYB G;  1JE4 A;  3K81 C;  2QCP X;  2PMZ E;  1CA6 A;  5GRO A;  2KOL A;  4O1N A;  5ELD A;  5C6A A;  2DNC A;  4CDF C;  4DPG A;  1NTG A;  3TN2 A;  3H3V I;  5FLM G;  4DU9 A;  4P2C B;  4A3C G;  2DJG C;  4RA8 A;  1J6Q A;  2ID0 A;  1DOL A;  3O13 A;  5CV9 A;  4JI4 Q;  3SEB A;  2NBF A;  5DM7 3;  3I90 A;  1EQR A;  1AE2 A;  2HCC A;  4A3M G;  1ASY A;  2G9D A;  3I4O A;  5T1G A;  2B39 A;  1TWA B;  2KCT A;  3M3Y B;  1HPC A;  4U68 A;  1KNE A;  4L6T B;  3PSI A;  5I4D A;  5C0X J;  3TBI B;  3CP0 A;  2JA8 B;  4MHE A;  2JN4 A;  4RGM A;  2N3S A;  4IZ8 A;  3VYR A;  4OWT B;  1A6X A;  3F2B A;  1UE6 A;  4OWW B;  5JEA G;  1XXG A;  3X3N A;  3I55 A;  5E3F A;  4BBR B;  3NXW A;  1HNX Q;  1ZYR C;  1KDC A;  1YIT A;  3NTH A;  3PO3 B;  1FGB D;  3F2U A;  4JI6 Q;  1STA A;  2K01 A;  3PF4 A;  5HGT A;  4X6A H;  5EBC A;  1ASZ A;  3QOJ A;  4MIU A;  2PQA B;  4AIM A;  2Y0S E;  1WI5 A;  4ZAI A;  1D1I A;  5T1I A;  3RLO A;  1WCM B;  1VQ4 A;  4YIJ A;  5FO8 B;  1U4M A;  1DOM A;  3RNU A;  1JOR A;  1F2Z A;  4DNT B;  3F1Z A;  3I70 A;  5IYD H;  2K6A A;  3NEM A;  5IP9 G;  5EJW A;  1IXR A;  4DV0 L;  4HMI A;  2Q2I A;  3S14 B;  4OIJ A;  4BBR H;  2IX1 A;  1I4Q A;  4XT3 B;  3PO3 H;  1NR4 A;  4OEM B;  3T16 A;  1VQ7 A;  1TY2 A;  4P72 A;  5I2Y A;  4B3M L;  1SE4 A;  1BOS A;  3S2D H;  3LNN A;  2IW3 A;  1LLR D;  4DR3 L;  1EUJ A;  4BS9 A;  3M4O H;  1QJO A;  4DR6 Q;  2EJF C;  1UWV A;  2A19 A;  4IUU A;  1KLU D;  4N9P A;  3R2I A;  1PLF A;  5C4H A;  4XQJ A;  4GKJ L;  1J8I A;  3KBG A;  4JBW A;  5J39 A;  5LMU Q;  1MSH A;  1SSO A;  1WCM H;  1STB A;  2BE5 D;  4HSV A;  1CUK A;  1KRT A;  5C3X A;  1BDO A;  5EKK A;  1KD1 C;  2KCC A;  3U9S A;  3QB3 A;  1EY6 A;  2WP8 J;  2B2T A;  4FYD A;  1D5M C;  4UPA A;  1D6E C;  3BG3 A;  1PH8 A;  1G2S A;  4G7Z C;  4LF9 Q;  1W2B A;  3K0X A;  4NXM L;  2UXD L;  1VMC A;  2EE1 A;  2R92 B;  1LYL A;  2H1E A;  3G4S A;  1IW7 C;  1B70 B;  1Y8O B;  2KED A;  1SYF A;  1WTQ A;  5D3I B;  2NN6 H;  4JI5 L;  2RHQ B;  1JOK A;  1HNZ L;  4YY3 L;  1Q8K A;  2LMC B;  4NPS A;  3A54 A;  1N33 L;  5TSS A;  2C5C A;  4A3K B;  3MVV A;  2A6E D;  2B2V A;  3KLR A;  2JA8 G;  4MTK A;  4PG3 A;  3OOC A;  5IYD G;  1SNP A;  2Z1C A;  4HCS A;  4KK7 A;  4DAP A;  1EEI D;  2D2C C;  4XIG S;  5CR3 A;  3ZJY C;  3HOW B;  2KCN A;  3FHW A;  1IKM A;  2KHS A;  1RDP D;  2XSC A;  3DEO A;  4BBR G;  3EN2 A;  4JK1 C;  3V05 A;  2UU9 Q;  2A1A A;  2NZO A;  2EYH A;  1HR0 W;  3PO3 G;  1E24 A;  2R92 H;  3T53 B;  2HUG A;  4B9X A;  2CCZ A;  3HOZ B;  1MSG A;  4A3G B;  1HTP A;  1N36 Q;  1GO3 E;  4DFA A;  1LTT D;  4ZQ3 A;  5C44 B;  2B2V C;  1KNA A;  2J0T D;  5IGF A;  3J7A F;  1IYJ B;  4FXK C;  3HKZ B;  1V8Q A;  1HNW L;  2CKZ B;  4MNO A;  1WYD A;  1WCM G;  1LTB D;  1EQT A;  3KK7 A;  3NPP A;  4R8N A;  3PUY A;  2F0E A;  3R2T A;  1BUV T;  1SMX A;  1BKB A;  4DV6 Q;  1CZW A;  4L5T A;  2F0Q A;  5CYU A;  1L0Y B;  3I7F A;  4BXX H;  3HOU H;  2NWG A;  1QUQ B;  2NB0 A;  5CBA E;  1Y8P B;  2A6H D;  5FK9 C;  1RIP A;  4FF1 A;  3HOX H;  5DM6 3;  4IPC A;  5C0X G;  1O7Z A;  5CV8 A;  4KLK A;  3VA5 A;  1RJT A;  2F0U A;  2VUM H;  3JC6 6;  3S16 B;  4A3G H;  3GV3 A;  2M9V A;  3FDT A;  3CRL C;  4LF4 L;  3OMG A;  5C44 H;  3A8J E;  2F3W A;  5IY0 A;  4JPB W;  4R9W A;  1HZ9 A;  2AQ1 B;  4LUZ A;  3E0E A;  2KHI A;  3BDL A;  4B3R L;  1I6H H;  1LT3 D;  1BBX C;  4O0A A;  4CJ2 C;  3PF5 A;  1KTK A;  4DR4 L;  2K03 A;  1VDZ A;  4JV5 L;  2F0L A;  2VQE L;  1G2T A;  5GAD C;  1S40 A;  2PQA A;  3OPO A;  5J3B A;  5EKI A;  1H9S B;  1Q46 A;  5IE8 A;  1CHQ D;  2K5N A;  5CGK A;  1PFB A;  2BE5 C;  3GTG H;  3MZ5 A;  1C7Y A;  5E4W C;  1K83 H;  4K5V A;  4FXD A;  5IP7 H;  2R61 A;  4RCO A;  3J81 c;  3Q8D A;  2R92 G;  1VQG A;  5KEE A;  1VQ6 A;  4GLA C;  4LFA Q;  1L0W A;  1NAP A;  4HJ9 A;  5EPK A;  1ESR A;  2A69 D;  5L37 A;  4C1N K;  1ESF A;  1RF2 D;  1I4H A;  5JVG 3;  3OWE B;  1DYQ A;  1L0X B;  3UI2 A;  1XTC D;  4IUQ A;  5IYC G;  3J81 L;  4A3K G;  3S24 A;  5FOB B;  4JI0 Q;  1HQR D;  1RD9 D;  1MIU A;  1QB5 D;  3D31 A;  2HQE A;  4WOR A;  4GOP B;  3CCM A;  5M3F B;  1F9S A;  1Y1W B;  4X66 L;  2A6E C;  3K6O A;  4LAA A;  3PMF A;  1HNX L;  4U67 3;  3RMH A;  3HOW G;  5FO7 B;  4ILW A;  1PFM A;  2CQO A;  4WJ3 M;  2PPB C;  1Y69 U;  2JP1 A;  4IJH A;  2XNA C;  4N8X 1;  3TME A;  1B7Y B;  4HJ5 A;  4JI6 L;  3KJP A;  1EYG A;  5JJI A;  2OTL A;  1RTN A;  3A0J A;  3HOZ G;  4IFD J;  4A3G G;  1K8M A;  3OIP A;  1B44 D;  5C44 G;  2VB3 X;  1X3P A;  4QMG A;  1HQM C;  4QUF A;  3NEL A;  3AFP A;  4TKO B;  3HKZ G;  2I5L X;  3JAM c;  1G91 A;  1WTX A;  4OXP A;  3HOV H;  4HSP A;  3I4N B;  2FIN B;  1VQM A;  4PMB A;  2A5H A;  2PI2 A;  2KHJ A;  5M3F H;  1Y1W H;  2EXD A;  1HXY D;  1KAB A;  2NVY H;  4DR1 Q;  4UP8 A;  1N32 Q;  4JOI A;  2R7Z H;  1WTP A;  5IGC A;  1JWM D;  2CHB D;  4DAV A;  4ZCK A;  1MI2 A;  5IP7 G;  1FJG L;  3H6M A;  3DXJ C;  1CKO A;  5DNF A;  2A6H C;  3JAM L;  1S5C D;  3NP8 A;  4X62 Q;  4DR6 L;  1L1O B;  1PVO A;  1NMG A;  1CI3 M;  1S3O A;  4HJA A;  4ID6 A;  3LX0 A;  4EQP A;  1TY0 A;  2YYZ A;  5LMU L;  3M9B A;  1A2T A;  1OTC A;  3MHB A;  4DV5 Q;  3NEN A;  4ULL A;  4YCW A;  4JOI C;  1VQI A;  5EKL A;  3BVM A;  4CJ1 B;  1G6Z A;  4JI2 Q;  3R8B A;  4EQ5 A;  3I4N H;  1HA5 A;  1UAP A;  1JT8 A;  4JCV E;  3KFU A;  1STH A;  2GVB A;  4RKB A;  3K8A A;  3D0F A;  4G4K A;  4K2L A;  5IGE A;  1E3P A;  4LF9 L;  1IYV A;  3HKS A;  4RH6 A;  2IX0 A;  4KY7 A;  2PW7 A;  3H91 A;  1E0B A;  1LAB A;  4LF5 Q;  1EEF D;  4DR5 Q;  1WTR A;  4X3S A;  1QUQ A;  2NTS A;  2NTT A;  1CFM A;  2B2W C;  2K14 A;  3MC0 B;  4POG A;  1BR9 A;  1K8G A;  2YTY A;  4PNY A;  3BVG A;  3HRZ C;  4DN4 M;  1LUZ A;  2E2I B;  3H15 A;  5HY6 A;  2A69 C;  3PGZ A;  5ELN A;  4AQY L;  1ZEQ X;  3TZU A;  2YU9 B;  1OXT A;  4GKK L;  2DJF C;  4HTH A;  4OO1 G;  4HAE A;  5F2D A;  5M3F G;  4JBM A;  1Y1W G;  3HKZ E;  5EGT A;  3D6C A;  1F2Y A;  1MJE A;  3UDX A;  2UU9 L;  3T1H Q;  3K80 C;  3VR6 A;  4A3D B;  1S5E D;  4K5X A;  4DGZ A;  1EY4 A;  1H9R A;  1H9S A;  1BF4 A;  2FJ2 A;  1N36 L;  1AZP A;  4DV2 Q;  3OW7 A;  1SRO A;  1GVP A;  2IL8 A;  5BN3 A;  1EFW A;  2EQS A;  3NQI A;  4KY5 A;  2F4I A;  4XTC S;  4A3B B;  3PV0 A;  3R3O A;  2A74 C;  2EY1 A;  2KJX A;  4IN3 A;  5J22 A;  5NUC A;  3QJY A;  4LUO A;  4JC0 A;  3T13 A;  4C3J B;  2E2I H;  1X3F A;  1EQV A;  1X56 A;  4QIW E;  5FJ8 H;  3AQQ A;  3HGB A;  2L0C A;  4L8J A;  4XQQ A;  1NJI C;  1EYA A;  1Q1E A;  2YU9 H;  3S1M B;  3I4N G;  1EU3 A;  1I4X A;  1JR0 D;  1LTG D;  1DGS A;  1RL2 A;  2N88 A;  4POF A;  2V1C C;  1SN8 A;  2ZXP A;  5M3M B;  1HR0 L;  2E2D C;  3MFY A;  2D9U A;  2AHO B;  3HZX A;  4A75 A;  4GOP A;  1SAP A;  4K6D A;  4O42 A;  4A3D H;  4NDX A;  1A3T A;  1XMO Q;  1UEB A;  1KRS A;  2IY5 B;  1U5K A;  3SK4 A;  1I50 H;  4DXF A;  3HP3 A;  1IZ6 A;  1HJP A;  4F88 A;  4IUV A;  4A3I B;  1V1P B;  3LGJ A;  1OXX K;  2ZJQ A;  2CFM A;  2B29 A;  4C3J H;  4A3E H;  3K5L A;  3PUV A;  1PTO F;  1WTO A;  2XVS A;  1Q86 C;  4FXG C;  1MKH A;  4Y7N H;  3IFD A;  4IFD G;  4GOP C;  1JCK B;  2K7V A;  3S1M H;  1JE5 A;  2Z4H A;  2JA7 B;  2MUY A;  4EX5 A;  2NVX B;  2C35 B;  2O4X A;  4CGY B;  3AFQ A;  1EQQ A;  3RN2 A;  5M3M H;  5I9O A;  4IUR A;  5AFW A;  4PZ6 A;  4J8Q A;  5KND A;  2K5Q A;  4LFA L;  1VQP A;  4RMF A;  1S5F D;  3GDE A;  5ELF A;  5IT9 c;  4RCN A;  3SE0 A;  1PH1 A;  2FMC A;  3S17 H;  1WTH A;  5ELE A;  1GXD C;  3I56 A;  2VXW A;  4XT1 B;  2QW7 A;  2A73 B;  3KUP A;  1OXV A;  1H9M A;  4A3I H;  1WTW A;  2CWA A;  5C3W A;  2EPB A;  4DK3 C;  1G51 A;  2F03 A;  1NNX A;  4JI0 L;  1EWH A;  1NBW A;  1XX8 A;  2BOS A;  1L1O A;  5FJ8 G;  2F0M A;  4HIO A;  1ICW A;  4R4I A;  1QZG A;  3QR8 A;  3J7A 5;  3W5O A;  1IBK Q;  2FMM A;  4NW2 A;  1VF5 C;  1PDQ A;  5IT9 L;  1ML0 D;  4DA2 A;  2LS0 1;  2JA7 H;  4J15 A;  2DY7 A;  4A3L G;  3CKI B;  4KKU A;  5KNB A;  2QEX A;  2F0T A;  5LHY 1;  2I5M X;  1X9N A;  3SK5 A;  3CCV A;  3IAY A;  4A3D G;  1Z47 A;  1TWH B;  2PO4 A;  1B3Q A;  1C9O A;  1YBY A;  1L1O C;  1KAA A;  2R7F A;  5LMN Q;  1LV9 A;  3A7L A;  2PZW A;  4A3B G;  3Q23 A;  4LF7 Q;  1R4P B;  2EYF A;  3ITP A;  3PCO B;  2ZXO A;  5FLX c;  2NVQ H;  4C3J G;  3OW2 A;  2JQO A;  3OMC A;  4LF8 Q;  2BDN A;  2EYP A;  4Q0F A;  3Q6S A;  2BDO A;  2NZH A;  2XTI A;  3TS0 A;  2HHH Q;  1I5F A;  2WB1 B;  4DR1 L;  4J6H A;  1A62 A;  1N32 L;  2JJQ A;  3J80 c;  3EFX D;  1DON A;  1CHP D;  1BCP B;  1WD0 A;  5I6W A;  1RKN A;  2AQ3 B;  2ALY B;  3KF8 B;  3ZYY X;  5M3M G;  1MGS A;  4YHH Q;  2K75 A;  1A3V A;  5FLX L;  3DWA A;  5GAE C;  3MXU A;  3VYU A;  4X62 L;  1WFQ A;  2L4N A;  1TWH H;  2K5W A;  3SDZ A;  1PV4 A;  3S2D B;  1BXT A;  2RVL A;  5K36 H;  3M4O B;  2ZT9 C;  1W6K A;  1MBY A;  2N78 A;  2XWB B;  2UXC Q;  3J80 L;  4DV5 L;  2EYL A;  4TRD A;  4A3I G;  5KNC A;  3PQI A;  1Q8I A;  2RBM A;  4HR7 B;  1GHK A;  4JI2 L;  2JEB I;  1HFG A;  1Z6H A;  3RLN A;  2F4V Q;  2KA7 A;  4GZY C;  4YCV A;  1CK1 A;  3OTO Q;  3E0J A;  3PIO 3;  4XXE A;  4G7H C;  2JA7 G;  1PRT B;  5D65 A;  4JW0 A;  1YZ6 A;  1SNQ A;  2EY6 A;  2NUC A;  1WVL A;  3ICE A;  1I6V C;  1LTA D;  2L55 A;  2EYM A;  3NBH B;  3M4Y A;  4RGN A;  4LF5 L;  1XPR A;  4UY8 C;  4DR5 L;  4H7B A;  1PXU A;  4LJZ C;  4X64 Q;  1D7Q A;  2PNH A;  4LK1 C;  1KXL A;  2IT1 A;  1MD2 D;  4ME3 A;  4CKE A;  5M5X B;  3CPF A;  1O78 A;  1YJ9 A;  2ICE C;  2F0I A;  3CPW A;  4K5W A;  1B8A A;  4GN5 A;  3GTK B;  1YHA A;  2KEE A;  1K9M C;  1WTV A;  4PMC A;  3L0O A;  2VNU D;  2BA1 A;  1XMQ L;  2Z4I A;  3UE0 A;  1ICF B;  4OL7 A;  2TMP A;  1BCP D;  3KF6 B;  1AP0 A;  5D14 A;  1Y8N B;  3A55 A;  1CT1 D;  3S9W A;  4C3H B;  3RD4 A;  1VQO A;  4BA1 I;  3CC7 A;  3T1H L;  3C46 A;  3EQL C;  5EPL A;  1G6P A;  3KLW A;  1MJC A;  1K73 C;  5JPM C;  1P16 A;  2K5D A;  4DV2 L;  3GTJ B;  1IL2 A;  1O7I A;  1B4O A;  1K28 A;  2MJ8 A;  2QF7 A;  5M5X H;  5K36 G;  2R93 B;  2RSN A;  2L15 A;  1SYG A;  3GTK H;  1Q7Y C;  2QA4 A;  1NR2 A;  3D6W A;  5FKA C;  2K05 A;  1YHQ A;  1PRT D;  3P20 A;  4N8F A;  5GAG C;  3G6E A;  5C5L A;  3QWN A;  1DOK A;  1HZC A;  1II3 A;  1PTO H;  4RGT A;  4BA2 I;  4UDU C;  2XN9 C;  1I3Q B;  4DNR B;  2RDH A;  4KHP L;  2E76 C;  2K50 A;  4JBJ A;  2WB1 G;  3TZD A;  1SBB B;  5JVH 3;  1R9T H;  3TSS A;  4L5S A;  2ZTE A;  4C3H H;  3HOU B;  3KJO A;  3BYT B;  3K57 A;  2QGQ A;  3DEP A;  3GTO B;  1SR3 A;  1PH6 A;  2NZ1 D;  4FF4 A;  3AEV A;  3HOX B;  1XMO L;  5M5Y B;  3BZD B;  1NMF A;  1SYB A;  1M4V A;  2CH4 A;  2F0K A;  5DAU A;  3VYT A;  4JI8 Q;  1YNJ D;  3GTJ H;  4UHV A;  1DCZ A;  1HZA A;  3LWE A;  4R4Q A;  1F2L A;  3BU2 A;  2VUM B;  2Z9H A;  4RHS A;  2R93 H;  1WOC A;  1WJJ A;  1PTO D;  5I6Y A;  1SND A;  4WJW A;  1Q12 A;  2UUC Q;  1PYB A;  2D0P A;  2PNR C;  4H0L C;  4C56 C;  3KOJ A;  1AH9 A;  1YJW A;  2PW5 A;  2DN8 A;  2X6G A;  1I6H B;  1V9P A;  1JWU D;  1EFI D;  3E9H A;  2F1M A;  3U4V A;  4G57 A;  3M4P A;  1I3Q H;  4V0B A;  1ILP A;  1BBU A;  2E75 C;  3S1Q H;  1XPO A;  2DY8 A;  1TS3 A;  4R1J A;  2C9O A;  2QIL A;  1M8A A;  2E8G A;  3GTG B;  3GTO H;  5C4X B;  1K83 B;  3FPU B;  1SJE D;  3FP9 A;  5M5Y H;  1XNQ L;  3H3V H;  2SNM A;  4A93 B;  2L1B A;  2WAQ B;  2SOB A;  3S1R H;  3BVZ A;  1V1O A;  2FXQ A;  1CSQ A;  4LWC A;  4DUZ Q;  1EL0 A;  4QIW B;  2NN6 G;  1B53 A;  4K8I A;  4YCU A;  1CM9 A;  2ZJP A;  1IKL A;  3K0Y A;  1LT4 D;  1AZQ A;  3STB D;  2E5L Q;  3E9I A;  1BNZ A;  1EOV A;  1HZB A;  4K2K A;  3SK8 A;  1YI2 A;  2RCF A;  1IBK L;  1HUM A;  2K5V A;  2F3V A;  2KCM A;  3F2C A;  4P75 A;  1TVX A;  4JBK A;  1VCI A;  1TU2 B;  1YNX A;  4DAM A;  1P8L A;  2XIW A;  4C3H G;  2OXP A;  2PYK A;  2J4X A;  1BCP C;  4IPD A;  4OWX B;  5IGB A;  4HJ8 A;  4FF2 A;  3MXN B;  1SE3 A;  4Y52 H;  1XJV A;  4ZRZ A;  5C4X H;  2L9H A;  1JQY D;  2WB1 E;  1XNR Q;  1K0S A;  4DR7 Q;  4A93 H;  2BH8 A;  1GOZ A;  5FO9 B;  3R93 A;  5LMN L;  3IFT A;  3NK9 A;  1ZXT A;  5G3L F;  4LF7 L;  3L3O C;  1LTS D;  2NYZ D;  4JI4 L;  4GS3 A;  1ZKO A;  2R93 G;  2Z6B A;  1PA6 A;  1HA6 A;  5CV4 A;  4K8J A;  4YWL A;  1X3E A;  1PH7 A;  2G9H D;  3K5M A;  4A3J H;  2AUJ D;  4XQN A;  5LL6 X;  3PIP 3;  2JEA I;  3PUX A;  2K04 A;  5LL6 S;  1HTL D;  3G7L A;  4NXN Q;  3RLF A;  2HHH L;  4IPH A;  1TS5 A;  4ZK9 B;  1TII D;  2TSS A;  3HOV B;  4LFB Q;  1HH2 P;  1KHI A;  1NSN S;  4JYA Q;  1UE5 A;  3J81 E;  5EAY A;  1PRT C;  1GUG A;  4BXX G;  2O5I C;  1TWG H;  1TWC B;  2NVY B;  4YHH L;  3HOU G;  2Z6K C;  2DUD A;  4KN4 C;  3KF6 A;  4L5R C;  2R7Z B;  5BN4 A;  4KV6 A;  5IYB H;  2MQH A;  3HOX G;  5ELB A;  2LKV A;  1N34 Q;  3IL8 A;  4A4I A;  1LTR D;  4DK0 A;  5A2Q E;  1F9Q A;  4BY7 B;  2RQX A;  2UXC L;  2VUM G;  1EY5 A;  2H4O A;  4PZ7 A;  3UDG A;  3DM3 A;  1HFN A;  1YNJ C;  4A3F B;  4IUN A;  4OEL B;  1EIF A;  1LT6 D;  3DLL A;  3CW2 C;  4JI3 Q;  3GTP H;  3NWT A;  2F4V L;  3G6J B;  1EY7 A;  1PTO C;  3OTO L;  3HG9 A;  1FVI A;  1Q81 C;  2F0V A;  3K7U C;  4Q5V A;  1NCV A;  4HMJ A;  2G5D A;  3RZO H;  4QQB X;  1STN A;  4DV1 Q;  3I91 A;  3TEH B;  1TWC H;  1JC7 A;  4PV1 C;  4X64 L;  4DUY Q;  5C4X G;  1GUS A;  4IJL A;  3KYH C;  2E2J B;  1JIC A;  1QVF A;  4A93 G;  2NVT B;  5C3E B;  1PH5 A;  2WAQ G;  1SYD A;  3TQY A;  4GNX B;  3HFZ B;  4P74 A;  2L12 A;  2H5X A;  3JAM E;  1EZ6 A;  3KLS X;  4BY7 H;  3J7Y W;  4R4C A;  1B9N A;  4XYQ A;  3PIO A;  4A3F H;  2AKW B;  1PFN A;  4F87 A;  2SNS A;  3SK6 A;  2WFW A;  2RHS B;  1JB3 A;  1LM0 A;  4OX9 Q;  4QB4 A;  1AE3 A;  2MFI A;  1VF7 A;  2B2W A;  2F0J A;  1CQF A;  3STB C;  4XYO A;  1ET6 A;  2GA4 B;  2I0Q A;  1H95 A;  2B63 B;  3S15 H;  3L2P A;  4H13 C;  2A8V A;  5E7N A;  5H1S E;  2O5J C;  3DWQ A;  3G48 A;  1E2W A;  1RCV D;  1YNN D;  2JA9 A;  1FD7 D;  1STE A;  5IYB G;  3H3V C;  3V96 A;  2K4K A;  4IOA A;  2K28 A;  2GVA A;  1VQ8 A;  2E2J H;  2ZM6 Q;  2YTV A;  3DUZ A;  3Q22 A;  1F9R A;  2R3Z A;  2NVT H;  5C3E H;  2LXK A;  1NUC A;  2PQE A;  1PHJ A;  2KUM A;  5JPN C;  1PH9 A;  3H09 A;  3MXG A;  1JMC A;  1LTI D;  1DD2 A;  1SE2 A;  3M7G A;  1B9M A;  4TVA B;  4YWM A;  4PQX A;  3VR3 A;  1ENF A;  1T5E A;  3VR4 A;  1ILQ A;  1QZH A;  3HOV G;  4RGO S;  4X3K A;  4BY1 B;  4QCL A;  2KBN A;  1S72 A;  2B63 H;  2YV5 A;  1VQ5 A;  4IPG A;  3NE5 B;  2R7Z G;  4JG2 A;  4JI8 L;  3EJI A;  2ZXR A;  2WV6 D;  2L11 A;  4FP5 D;  4B3T Q;  2IX3 A;  2M2L A;  4KTA A;  3TS2 A;  1OXU A;  3GP7 A;  2BCO A;  4BY7 G;  3F8T A;  5CV7 A;  1GUW A;  3MXN A;  2JYO A;  1I50 B;  1M1K C;  1FYC A;  1F9P A;  4A3F G;  4ZKC B;  3H94 A;  2UUC L;  2WAQ E;  1A0I A;  4L5Q A;  3N52 A;  4KY6 A;  5IOC A;  1EOT A;  3UDF A;  4A3E B;  2MO0 A;  3TP7 A;  1YIJ A;  1CQV A;  1LAC A;  5KGU A;  4Y7N B;  4DV6 L;  1K0R A;  1EWI A;  1G8Z D;  3P1H A;  2FFK B;  2K5H A;  4BY1 H;  1X3Q A;  4RAU C;  4QUC A;  1CTM A;  1GHJ A;  3H0G B;  4KD4 A;  1EYC A;  4LW1 A;  3T56 B;  4GLV B;  3RN5 A;  3MAQ A;  3I4M B;  4I65 A;  2VQF Q;  4DK1 A;  1VQK A;  2MPM A;  4H44 C;  5C3E G;  3CHB D;  4C3I B;  4DUZ L;  3GTQ H;  1H9K A;  3DWP A;  2X69 A;  3ND9 A;  4H02 A;  4ME5 A;  2E5L L;  3S17 B;  1IBL Q;  3U50 C;  3WDN A;  1JJC B;  3F2D A;  1VQA A;  2VY3 A;  2F52 A;  1SLJ A;  1UE7 A;  3TRE A;  1B1Z A;  5JJK A;  1I4P A;  1Z9F A;  4DNI A;  3FKI B;  2F0N A;  2MNA A;  3CC4 A;  2KVM A;  4BBS B;  3BDC A;  2N55 A;  4CDE C;  1O7L A;  5FLM H;  5C0X I;  3CXC A;  2B63 G;  3GTL H;  4A3C H;  4JI7 Q;  3T51 B;  4R4O A;  2AMC B;  5IWA Q;  1XNR L;  5G3L D;  4PZ8 A;  3H0G H;  2Q8I B;  3PO2 B;  2MO1 A;  4A3M H;  2VZA A;  3I4M H;  3MA2 B;  2A68 D;  3NTI A;  1LTL A;  4C3I H;  1YNN C;  2I46 A;  1M90 C;  3AMU A;  3B6Y A;  1VQC A;  5LMN W;  3T1Y Q;  3UDI A;  4NXN L;  2VW9 A;  4HIM A;  3CMA A;  5A35 A;  4GNX A;  3T4A C;  2NVQ B;  3KLS A;  4LFB L;  2AUK A;  4JYA L;  1E2Z A;  2Q2U A;  1GUN A;  2PZT A;  3HS0 C;  4KHV A;  3FKI H;  4NKL A;  4BY1 G;  4MN3 A;  4TSS A;  3WWV A;  3BZK A;  4BBS H;  2D62 A;  4DV7 Q;  4CDC C;  3J80 i;  1SMY D;  3L9A X;  1N34 L;  1V1Q A;  1X3G A;  4V19 0;  3PO2 H;  3PIP A;  1FNU A;  2I5H A;  4GNX C;  2R7D A;  3S2H B;  2EJG C;  2RKS A;  2UXB Q;  3RR5 A;  1D5X C;  1S5B D;  1FNV A;  3MXP A;  2ENB A;  4JI3 L;  3EVQ A;  4BWG B;  3KBX A;  3NTK A;  4JV5 Q;  3AYH B;  5IP9 H;  2VQE Q;  3A5U A;  1SRU A;  2QDB A;  1IYU A;  1HRJ A;  2OF1 A;  4A3E G;  2E2H B;  1PZI D;  1EYD A;  1ENC A;  3K7A H;  2UUB Q;  4DAY B;  2F0F A;  1CKM A;  4DV1 L;  1QNK A;  3J7A V;  3J81 j;  4EGV A;  3FRP B;  4K0K Q;  5GQO A;  1TWF H;  2XWJ B;  4DUY L;  3CU7 A;  4C1N I;  1YHB A;  1TS2 A;  3H0G G;  1K3R A;  4PMW A;  4ABN A;  1K3B C;  3I4M G;  5FLX E;  2R6G A;  4C3I G;  4UP9 A;  2UUA Q;  1X54 A;  2LXJ A;  4ODG A;  3CCQ A;  3S2H H;  1E1T A;  1SFO B;  3I4L A;  5BR8 Q;  4OX9 L;  1FR3 A;  3BS1 A;  2ICI A;  4Z9C B;  3VR2 A;  1VQD A;  4X66 Q;  1SEB D;  3J80 E;  1QVC A;  4CDD C;  2VS1 A;  3SVM A;  2D5D A;  2E2H H;  2IHE A;  1VMP A;  3MEF A;  4S3S A;  2HT1 A;  3FKI G;  4DR2 Q;  3D4W A;  1I4R A;  1W3S A;  3C3L A;  1KLG D;  1STG A;  2RSO A;  4BBS G;  1VQJ A;  4HN7 A;  4OHJ A;  4DV3 Q;  4KMU C;  3GV6 A;  1T9H A;  4P73 A;  2ZM6 L;  2F0P A;  1J5E Q;  3P75 A;  1GD7 A;  4FF3 A;  3PO2 G;  1VQ9 A;  3NBI A;  1KL9 A;  1E2V A;  4JI1 Q;  1TWA H;  3ERQ A;  4IUT A;  1U4P A;  3M3Y H;  2WAC A;  4A76 A;  1AEX A;  4OIK A;  1KDB A;  2JA8 H;  3L7Z C;  1BQQ T;  3CCL A;  3TP5 A;  3QG1 A;  1SFO H;  2A68 C;  1C4Q A;  1TR5 A;  3VYS A;  3PUZ A;  4CHT B;  3CD6 A;  4DKA C;  2LSS A;  4O2D A;  1PTO B;  2KQ3 A;  2B8F A;  2DGY A;  4FVM A;  1XPU A;  4WJ4 A;  1FJG Q;  1V1P A;  2D0O A;  1R9T B;  4AYB E;  1E1O A;  1Z7T A;  3MEH A;  2CWP A;  4OGQ C;  1K8O A;  2HDL A;  5C4J B;  1Y14 B;  5CMD A;  4B3T L;  1OXS C;  1G29 1;  1CKN B;  2EXZ A;  3MWY W;  3J7Z C;  3RUZ A;  4B3S Q;  1SMY C;  1K8A C;  5ELO A;  2VL6 A;  4WFN 3;  1KC8 C;  5KRU A;  5IGD A;  1B3A A;  1PFS A;  1VQB A;  3GD7 A;  4M1U B;  2OTJ A;  3K5N A;  2WKC A;  5IOD A;  3CCU A;  1FNW A;  2B8G A;  2XRQ D;  1JOO A;  3WOE A;  4YWK A;  4OO1 I;  1U4R A;  4ALP A;  5IIF A;  3S14 H;  2K33 A;  4LF6 Q;  5HUR A;  5C0X H;  2RF4 A; 
#chains in the Genus database with same CATH homology
 1KAW A;  3K81 C;  5JJL A;  1MJE A;  4BXX G;  3UDX A;  1TWG H;  2PMZ E;  4YHH L;  3T1H Q;  1GM5 A;  3K80 C;  5GRO A;  2UU9 L;  3SGI A;  3HOU G;  2Z6K C;  2DUD A;  3IRB A;  2AWN A;  3KF6 A;  4DPG A;  4L5R C;  1NTG A;  3H3V I;  4RG1 A;  5IYB H;  5FLM G;  4A3C G;  2MQH A;  3HOX G;  5C4J H;  1J6Q A;  2ID0 A;  1N36 L;  1N34 Q;  2VQF L;  4A4I A;  4DV2 Q;  4LNQ A;  1SRO A;  1GVP A;  4JI4 Q;  1EFW A;  1EQR A;  2EQS A;  1AE2 A;  2OQK A;  4XTC S;  4A3M G;  1ASY A;  3I4O A;  2UXC L;  3PV0 A;  2VUM G;  1IBL L;  3W1G A;  4PZ7 A;  3UDG A;  3DM3 A;  4AQY Q;  2KCT A;  4LUO A;  4JC0 A;  5HGQ A;  2E2I H;  1X3F A;  3PSI A;  5C0X J;  1X56 A;  1EIF A;  4QIW E;  1JJG A;  3DLL A;  3CW2 C;  4JI3 Q;  5FJ8 H;  3GTP H;  3AQQ A;  4GKK Q;  3CP0 A;  3CC2 A;  2F4V L;  2N3S A;  3OTO L;  1NJI C;  1Q1E A;  4OWT B;  2YU9 H;  3I4N G;  1FVI A;  1Q81 C;  3F2B A;  3K7U C;  1UE6 A;  3ULJ A;  5JEA G;  1KQS A;  4OWW B;  3M4Q A;  3CCR A;  3RZO H;  3I55 A;  4QQB X;  1DGS A;  1RL2 A;  4DV1 Q;  4POF A;  2V1C C;  1SN8 A;  1HNX Q;  1HR0 L;  1VQL A;  1YIT A;  4JI7 L;  2AHO B;  3TEH B;  1TWC H;  3ULP A;  4A75 A;  4GOP A;  5IWA L;  4X64 L;  4A3D H;  4DUY Q;  5C4X G;  4IJL A;  1XMO Q;  4FDB A;  3KYH C;  4JI6 Q;  1UEB A;  3PF4 A;  1QVF A;  4A93 G;  1PH5 A;  1KRS A;  2WAQ G;  3TQY A;  1U5K A;  4GNX B;  3HFZ B;  2IY5 B;  4X6A H;  4P74 A;  4DK6 C;  1ASZ A;  1I50 H;  2H5X A;  3J81 i;  1IZ6 A;  1HJP A;  4BY7 H;  2RCN A;  5IYC H;  2PQA B;  4AIM A;  2Y0S E;  4A3K H;  1WI5 A;  4R4C A;  3LGJ A;  2N49 A;  3PIO A;  1OXX K;  2ZJQ A;  3T1Y L;  2CFM A;  2B29 A;  3RLO A;  4A3F H;  2AKW B;  4C3J H;  1VQ4 A;  4A3E H;  3EIV A;  2WFW A;  3RNU A;  2RHS B;  3PUV A;  1LM0 A;  4OX9 Q;  1Q86 C;  3F1Z A;  4C2M H;  1AE3 A;  4IFD I;  1MKH A;  4Y7N H;  2MFI A;  4IFD G;  5IYD H;  4GOP C;  3HOW H;  3S1M H;  3NEM A;  3STB C;  5IP9 G;  1JE5 A;  2I0Q A;  1IXR A;  4EX5 A;  3I2Z A;  4DV0 L;  2C35 B;  2Q2I A;  2K52 A;  1HR0 Q;  1H95 A;  4MTN A;  3A74 A;  4DV7 L;  3S15 H;  4BBR H;  3AFQ A;  1EQQ A;  2IX1 A;  3RN2 A;  1VQH A;  1X55 A;  5M3M H;  3L2P A;  1X6O A;  1YVC A;  2A8V A;  3PO3 H;  5E7N A;  4AH6 A;  5H1S E;  1VQ7 A;  3HOZ H;  3G48 A;  4PZ6 A;  4GN3 B;  4P72 A;  4B3M L;  4LFA L;  2JA9 A;  1VQP A;  5IYB G;  3S2D H;  4RMF A;  2K4K A;  4IOA A;  3GDE A;  2GVA A;  1VQ8 A;  4DR3 L;  1EUJ A;  5IT9 c;  2ZM6 Q;  2E2J H;  3M4O H;  2YTV A;  3U4Z A;  4DR6 Q;  2NVT H;  5C3E H;  1PH1 A;  1UWV A;  2A19 A;  2AWO A;  2LXK A;  1TXY A;  3S17 H;  3I56 A;  2UXB L;  1PHJ A;  4GKJ L;  3CQZ H;  1OXV A;  1PH9 A;  4A3I H;  2CWA A;  2Z6K A;  4JBW A;  5LMU Q;  4DK3 C;  1G51 A;  4JI0 L;  1JMC A;  1WCM H;  1NBW A;  4HIO A;  1L1O A;  5FJ8 G;  4R4I A;  3RZD H;  4AYB G;  1QZG A;  3J7A 5;  4TVA B;  1CUK A;  4YWM A;  1KRT A;  3W5O A;  4X65 Q;  1IBK Q;  1D8L A;  4LF8 L;  2UUB L;  1KD1 C;  1QZH A;  3HOV G;  3CF5 A;  2JA7 H;  4J15 A;  2WP8 J;  3S1N H;  4A3L G;  4UPA A;  2B3G A;  4GN4 B;  2QEX A;  3JAM i;  2KBN A;  5GAH C;  1S72 A;  4K0K L;  1PH8 A;  4LFC Q;  4LF9 Q;  1W2B A;  2JE6 I;  3K0X A;  4NXM L;  2I5M X;  2B63 H;  2UXD L;  1X9N A;  2YV5 A;  3CCV A;  1VQ5 A;  4IPG A;  1LYL A;  3A5Z B;  3G4S A;  4A3D G;  3S16 H;  1Z47 A;  4JG2 A;  2R7Z G;  1B70 B;  4JI8 L;  3ULL A;  1JB7 A;  4DV4 Q;  2ZTC A;  4B3T Q;  4JI5 L;  3HOY H;  2RHQ B;  1C9O A;  1YBY A;  1L1O C;  1YJN A;  1VQE A;  3TS2 A;  2R7F A;  5DLQ E;  5LMN Q;  1NE3 A;  1OXU A;  3UE1 A;  2UUA L;  4A3B G;  1HNZ L;  4BY7 G;  4LF7 Q;  3F8T A;  4YY3 L;  1Q8K A;  3PCO B;  4NPS A;  1M1K C;  4APV A;  5FLX c;  1N33 L;  1I94 Q;  5BR8 L;  4A3F G;  1IBM Q;  2UUC L;  2F3I A;  2NVQ H;  2WAQ E;  3CCE A;  1A0I A;  1CKN A;  4L5Q A;  2JQO A;  3OW2 A;  4LF8 Q;  3UDF A;  4QGU A;  2JA8 G;  2MO0 A;  4PG3 A;  5IYD G;  5AJ3 Q;  2NZH A;  2XTI A;  3TS0 A;  2HHH Q;  1YIJ A;  1I5F A;  4DR1 L;  4DV6 L;  1K0R A;  1EWI A;  4XIG S;  1A62 A;  4DR2 L;  3GTM H;  3ZJY C;  1N32 L;  2K5H A;  2JJQ A;  3FHW A;  4BY1 H;  3J80 c;  1UE1 A;  4BBR G;  2ALY B;  3EN2 A;  3KF8 B;  5M3M G;  3EBE A;  2UU9 Q;  1BVS A;  2A1A A;  2K75 A;  2NZO A;  4YHH Q;  1HR0 W;  4DV3 L;  3PO3 G;  1E24 A;  3BZC A;  5GAE C;  3ER0 A;  2R92 H;  4LW1 A;  1J5E L;  4GLV B;  3RN5 A;  4X62 L;  1WFQ A;  2CCZ A;  1TWH H;  2YTX A;  1PV4 A;  1N36 Q;  4LUV A;  1GO3 E;  2VQF Q;  4JI1 L;  1VQK A;  5C3E G;  2BH2 A;  3GTQ H;  4DUZ L;  2BA0 A;  2N78 A;  1IYJ B;  2IHF A;  4H02 A;  2UXC Q;  4DV5 L;  2E5L L;  1IBL Q;  1CSP A;  3U50 C;  1C0A A;  4A3I G;  2JA6 H;  1JJC B;  3F2D A;  1VQA A;  3M7N A;  2CKZ B;  2VY3 A;  1Q1B A;  1HNW L;  4MNO A;  1WYD A;  2F52 A;  1JJ2 A;  1WCM G;  1SLJ A;  4MZ9 A;  1UE7 A;  4JI2 L;  3PUY A;  2JEB I;  3GO5 A;  1Y1V H;  3TRE A;  4A3J G;  1SMX A;  2HQL A;  3RLN A;  1BKB A;  4DV6 Q;  2F4V Q;  5JJK A;  1FGU A;  4L5T A;  4YCV A;  3OTO Q;  3I7F A;  3CCS A;  4BXX H;  1Z9F A;  4DNI A;  3HOU H;  1QVG A;  1EIY B;  1QUQ B;  2JA7 G;  1YZ6 A;  2MNA A;  3CC4 A;  1RIP A;  3ICE A;  2B63 G;  5FLM H;  5C0X I;  3GTL H;  3HOX H;  3CXC A;  4A3C H;  4IPC A;  5C0X G;  3NBH B;  4JI7 Q;  4KLK A;  1N9W A;  4LF5 L;  1XPR A;  4UY8 C;  4R4O A;  4DR5 L;  2AMC B;  5IWA Q;  4X64 Q;  1XNR L;  1D7Q A;  4PZ8 A;  3H0G H;  3KDF B;  2MO1 A;  2PNH A;  2ZTD A;  4A3M H;  1KXL A;  2VZA A;  2VUM H;  3JC6 6;  3HOY G;  4A3G H;  3I4M H;  2IT1 A;  4ME3 A;  4B3S L;  3CME A;  2JA5 H;  4LF4 L;  3CPF A;  1SE8 A;  4HJ7 A;  1YJ9 A;  5C44 H;  1LTL A;  4C3I H;  3CPW A;  1E22 A;  1B8A A;  5IY0 A;  1M90 C;  4GN5 A;  2KEN A;  1HZ9 A;  3B6Y A;  1YHA A;  4LUZ A;  3E0E A;  1VQC A;  4P71 A;  2KHI A;  5LMN W;  3T1Y Q;  2PI2 E;  1K9M C;  3L0O A;  3UDI A;  4NXN L;  2VW9 A;  4IOC A;  4B3R L;  4HIM A;  3CMA A;  2BA1 A;  1XMQ L;  1I6H H;  2VNU D;  4O0A A;  3PF5 A;  4GNX A;  4JV5 L;  3UE0 A;  4DR4 L;  2VQE L;  3KF6 B;  4TQU S;  5GAD C;  1S40 A;  4LF6 L;  4LFB L;  2PQA A;  4JYA L;  5J3B A;  2Q2U A;  4NB3 A;  1Q46 A;  5IE8 A;  2K5N A;  3FKI H;  4DV0 Q;  4BY1 G;  1VQO A;  3GTG H;  4UP7 A;  4BA1 I;  3CC7 A;  3T1H L;  1C7Y A;  3WWV A;  3BZK A;  4BBS H;  1K83 H;  2EIF A;  2D62 A;  4DV7 Q;  5IP7 H;  3J81 c;  1G6P A;  3Q8D A;  3J80 i;  3KLW A;  1MJC A;  2R92 G;  1K73 C;  1VQG A;  1P16 A;  1N34 L;  4R4T A;  4B3M Q;  4DV2 L;  1V1Q A;  1A8V A;  4GLA C;  4LFA Q;  1L0W A;  1IL2 A;  1O7I A;  1X3G A;  1VQ6 A;  3PO2 H;  3PIP A;  1NY4 A;  4HJ9 A;  4DR3 Q;  2I5H A;  4IO9 A;  1KIX A;  5M5X H;  4GNX C;  5JEA J;  5K36 G;  2R7D A;  2L15 A;  5M5W H;  2UXB Q;  3GTK H;  4GKJ Q;  1XMQ Q;  3RR5 A;  1Q7Y C;  2QA4 A;  2Q2T A;  2JA6 G;  4JI3 L;  5IYC G;  2GN5 A;  2ATW A;  4JV5 Q;  4A3K G;  3AYH B;  3S24 A;  5IP9 H;  3OYY A;  2VQE Q;  1YHQ A;  3A5U A;  4JI0 Q;  1MIU A;  1SRU A;  5GAG C;  3G6E A;  3D31 A;  1Y1V G;  4GOP B;  1HZC A;  3CCM A;  4A3E G;  4X66 L;  1PH3 A;  4BA2 I;  1PH2 A;  3K7A H;  4KHP L;  2UUB Q;  2K50 A;  4JBJ A;  2WB1 G;  4DAY B;  1CKM A;  4DV1 L;  2HIV A;  1R9T H;  1HNX L;  3HOW G;  4L5S A;  2ZTE A;  4C3H H;  3J81 j;  3KJO A;  2XGT A;  4K0K Q;  2QGQ A;  5GQO A;  2CQO A;  1U0L A;  4WJ3 M;  1SR3 A;  1PH6 A;  1TWF H;  4NXM Q;  2UXD Q;  4DUY L;  4IJH A;  3AEV A;  1XMO L;  1B7Y B;  1YHB A;  4HJ5 A;  4JI6 L;  3H0G G;  1K3R A;  4PMW A;  3KJP A;  1NMF A;  1EYG A;  2ASB A;  5JJI A;  4JI8 Q;  3GTJ H;  2OTL A;  3A0J A;  3U58 A;  3HOZ G;  4IFD J;  4A3G G;  3I4M G;  4JI5 Q;  2JA5 G;  1HZA A;  4R4Q A;  3BU2 A;  1L2F A;  3VDY A;  5C44 G;  2R6G A;  1PH4 A;  1VQN A;  4UP9 A;  2R93 H;  2UUA Q;  1X54 A;  1WOC A;  1WJJ A;  2LXJ A;  1HNZ Q;  3CCQ A;  3S2H H;  2ZJR A;  3NEL A;  3M85 A;  4YY3 Q;  3AFP A;  1E1T A;  3HKZ G;  1N33 Q;  5BR8 Q;  1Q12 A;  2I5L X;  2HIX A;  3JAM c;  1PYB A;  2D0P A;  2UUC Q;  4OX9 L;  4OXP A;  3KOJ A;  1VQD A;  4X66 Q;  1YJW A;  4KHZ A;  2OWO A;  3HOV H;  4A3L H;  1AH9 A;  1QVC A;  1BBW A;  1V9P A;  2VS1 A;  1N8R C;  1VQM A;  4KHP Q;  2PI2 A;  2KHJ A;  3E9H A;  2E2H H;  5M3F H;  1Y1W H;  3U4V A;  2Q2H A;  2EXD A;  2IHE A;  3M4P A;  3MEF A;  1I3Q H;  2HT1 A;  2NVY H;  3FKI G;  1VS0 A;  4UP8 A;  4DR1 Q;  1BBU A;  4OON A;  4DR2 Q;  1N32 Q;  1W3S A;  3S1Q H;  4JOI A;  1V43 A;  3CAM A;  1XPO A;  2R7Z H;  4BBS G;  3W1B A;  4R1J A;  1VQJ A;  2E8G A;  5IP7 G;  3ERS X;  1FJG L;  3GTO H;  1CKO A;  4DV3 Q;  3G71 A;  3FP9 A;  5M5Y H;  1XNQ L;  3H3V H;  1T9H A;  4P73 A;  2ZM6 L;  1J5E Q;  4A3B H;  3PUW A;  1GD7 A;  4X62 Q;  3PO2 G;  3S1R H;  1VQ9 A;  1L1O B;  4DR6 L;  1KL9 A;  1PVO A;  1NMG A;  4KI0 A;  2FXQ A;  1S3O A;  1CSQ A;  4LWC A;  1TWA H;  1VQF A;  4JI1 Q;  4HJA A;  2NN6 I;  3TRZ A;  4DR7 L;  4DUZ Q;  3M3Y H;  4HID A;  2NN6 G;  4A76 A;  4YCU A;  2YYZ A;  2ZJP A;  5LMU L;  3M9B A;  1OTC A;  3STB D;  4DV5 Q;  1GKH A;  2E5L Q;  3E9I A;  3NEN A;  2JA8 H;  3L7Z C;  1EOV A;  3CCL A;  1HNW Q;  1HZB A;  1SFO H;  4YCW A;  4JOI C;  2ES2 A;  2OCE A;  4X65 L;  1VQI A;  1YI2 A;  1IBK L;  2OQ0 A;  2K5V A;  4JI2 Q;  4EQ5 A;  3I4N H;  3PUZ A;  3CD6 A;  1JT8 A;  2KCM A;  4JCV E;  4DKA C;  4P75 A;  3F2C A;  2LSS A;  4O2D A;  3KFU A;  2GVB A;  3K8A A;  1VCI A;  3CCJ A;  4JBK A;  3D0F A;  2DGY A;  2JK8 A;  1YNX A;  4DAM A;  1P8L A;  4LFC L;  1E3P A;  4LF9 L;  1XPU A;  4WJ4 A;  1FJG Q;  1Q82 C;  3HKS A;  2D0O A;  4IPD A;  4AYB E;  1E1O A;  1X65 A;  2IX0 A;  4OWX B;  4HJ8 A;  2CWP A;  1XNQ Q;  3MXN B;  4Y52 H;  1XJV A;  1PYS B;  5C4X H;  4LF5 Q;  2WB1 E;  1Y14 B;  2Y0S G;  4DV4 L;  4DR5 Q;  4B3T L;  1XNR Q;  1OXS C;  1YEZ A;  1G29 1;  4GLX A;  1QUQ A;  1CKN B;  4DR7 Q;  4A93 H;  2BH8 A;  2K14 A;  4POG A;  3J7Z C;  1K8G A;  2YTY A;  5LMN L;  4B3S Q;  4LF7 L;  1K8A C;  4QL5 A;  4JI4 L;  4GS3 A;  2VL6 A;  5ELO A;  4LF4 Q;  1IBM L;  2R93 G;  1PA6 A;  1FL0 A;  1LUZ A;  1I94 L;  4YWL A;  1X3E A;  1KC8 C;  2Z0S A;  4QJF A;  1PH7 A;  2N8N A;  4A3J H;  1PFS A;  1VQB A;  3KDF A;  3H15 A;  3GD7 A;  5HY6 A;  2JEA I;  3PUX A;  3PGZ A;  5ELN A;  4AQY L;  2OTJ A;  3CCU A;  4B3R Q;  1A63 A;  4NXN Q;  3RLF A;  4YWK A;  5AJ3 L;  4OO1 I;  2HHH L;  4IPH A;  2NVX H;  1E7Z A;  1OXT A;  4ALP A;  4GKK L;  4OO1 G;  1XTD A;  3S14 H;  4DR4 Q;  4HIK A;  5M3F G;  4JBM A;  1Y1W G;  4LFB Q;  1HH2 P;  4LF6 Q;  1KHI A;  4JYA Q;  1UE5 A;  3HKZ E;  3BJU A;  2RF4 A;  5EAY A;  4QY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...