4B3ML

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mL00
4R4CA 2DGYA 3J81i 4DV5L 2F4VQ 3STBD 4BY7G 2C35B 3F1ZA 4DR1L 1BBUA 4QIWE 2YTVA 1C9OA 5JEAG 1Y1VG 2FXQA 2A19A 1LTLA 1OXUA 2BH2A 4YCVA 3T1YQ 3U4VA 1E1TA 4DV5Q 1K0RA 4A3BH 3CCEA 3M4PA 1R9TH 3I7FA 4YCWA 3ER0A 3W1BA 4AQYL 1GD7A 1G291 1RIPA 2JA5H 1WJJA 2VW9A 3HOWH 2E5LQ 3E0EA 2N3SA 4BBSG 2IX1A 2BA0A 3D31A 1X9NA 3J7A5 2B29A 2MNAA 1Q1EA 4YWMA 5FLMG 4FDBA 2I5HA 3PUZA 3RN5A 4PZ7A 4LF7L 2VQFQ 3T1HQ 1WYDA 1HZAA 3PCOB 4QL5A 2HHHQ 4GN3B 5C4XG 4JOIA 4QGUA 1PH7A 3J81c 2KCTA 3HOUH 4A3JH 4C2MH 1YI2A 3HOYH 3J80i 1OXXK 1Q1BA 4DR4L 3H3VH 1YBYA 3HOXH 3M7NA 1PVOA 1I50H 1OXTA 2V1CC 4R4TA 1UE6A 4IPGA 4LNQA 3BZKA 3I4NH 3K0XA 2ZJPA 4L5QA 4DV0Q 4BXXH 1KXLA 2ALYB 5ELNA 3CW2C 1QUQB 1EQRA 4BY1H 4YCUA 5M3MG 1V1QA 2UUBQ 1I5FA 1HNZQ 2VUMH 3EIVA 2VQFL 2K4KA 1KIXA 2F4VL 4X62Q 4B3SQ 4OO1I 4GKJL 1N32L 3KJOA 2JA5G 4DV3L 3HOWG 1ASYA 1H95A 4A75A 3MEFA 4A3DH 4HJAA 2D0PA 1N33L 2Z6KA 3PUXA 4IJHA 1BBWA 4JI4L 1N9WA 3CCSA 4A3EG 1WI5A 3PF4A 3OTOL 3ERSX 4TVAB 4O0AA 4K0KQ 3DLLA 5IWAL 2K5VA 4EQ5A 1KHIA 1IL2A 3PO3H 3U58A 1XMQL 1X56A 2OWOA 3S1NH 1EQQA 3HOXG 1WCMG 1C7YA 4A93H 2MO0A 1PHJA 2D62A 2OTLA 3AEVA 3B6YA 2AHOB 3RZDH 1K73C 2R93G 3PO2G 1BVSA 1A63A 1N8RC 1P16A 4LW1A 3F2BA 3M4QA 3A5ZB 2NZOA 4APVA 3G71A 1IBKQ 4IFDG 2EIFA 1MJEA 2JE6I 4LF6Q 5K36G 2EXDA 2VNUD 2R7ZH 3H0GH 2JA8H 3T1HL 4A3GH 1GKHA 4JOIC 1I94Q 4JBJA 4DV2Q 4DV0L 5IYBG 1J6QA 3I4OA 3CCUA 4QJFA 3S1MH 2JK8A 2Z6KC 1E7ZA 1WFQA 1VQJA 4DUZL 2UUCL 1U0LA 4AQYQ 3JC66 3M85A 1XTDA 3FHWA 4IPDA 4NPSA 3TQYA 5FJ8G 1VQ8A 2N8NA 2ES2A 2CCZA 3CMAA 3AQQA 1QZGA 2QEXA 2HHHL 3PUWA 4JI5Q 1SROA 3PUYA 4A3MG 3S15H 2F52A 4PG3A 4JCVE 3AFQA 5C0XJ 1VQ5A 5EAYA 4DR7Q 1L1OC 1S40A 4JC0A 3HFZB 4JI8L 1QVCA 4DV4L 1HH2P 4P72A 4A93G 5GAGC 1YHAA 4OX9L 4IO9A 3KF8B 3RN2A 1PH1A 4KHPQ 4A3CH 4HIMA 4LFBQ 4DKAC 2KHIA 2ZM6L 4LF5Q 1AE2A 1KD1C 3JAMi 4KHPL 3GTPH 2N49A 4X65L 3BZCA 1VCIA 5HY6A 4X66Q 4DV6Q 1HNXL 1Z47A 2Q2HA 5IP9G 1SMXA 5GAHC 1HJPA 3M4OH 1SLJA 4YWKA 2NVQH 1YJ9A 3A0JA 1V9PA 1NE3A 3L7ZC 4DUYL 4DR7L 1XNQQ 1P8LA 5C3EH 1IXRA 3HOYG 1W3SA 5FJ8H 4JI2L 4BA1I 5JJIA 4C3IH 4R1JA 2D0OA 4JI6Q 1HNWL 3Q8DA 4A3KG 1JT8A 3G4SA 1VQAA 3HKSA 5IYDG 3CCVA 3CPFA 2E2HH 4LF6L 4LF5L 1EIFA 3L0OA 5M5YH 4DR5Q 1X6OA 3IRBA 4NXML 3UDIA 2RCNA 3W1GA 2WFWA 5AJ3L 4GKJQ 4DUZQ 5JJKA 3S24A 3HOUG 1UEBA 3H3VI 3CCJA 3HOVH 4PZ8A 2AMCB 3KF6A 3M9BA 3S16H 4OWXB 4JYAQ 1MIUA 4TQUS 4NXNL 1XPOA 1TWAH 3K7AH 3HOZH 4DAMA 2OCEA 4LF4L 1LM0A 4A3DG 3KDFA 3RLOA 1YHQA 3I4NG 2RF4A 4NXNQ 4BXXG 2ID0A 3CC7A 4BBRH 4DUYQ 1UWVA 4LF8Q 3GTOH 4BY1G 4EX5A 2VUMG 5JEAJ 2IHFA 3MXNB 4IOAA 5BR8Q 4JG2A 4B3RL 1QVGA 5LMUL 1PH6A 4JI0Q 1CKOA 2VQEL 2Q2TA 3GTMH 1FL0A 1VQFA 1N33Q 2YU9H 4A3IH 3M3YH 2DUDA 2E2IH 2PI2E 3RR5A 4HIDA 1L1OA 3OYYA 5IY0A 4DR3L 1JJGA 1Y1WH 3KJPA 4A3KH 1IBLQ 1I94L 1XMQQ 1L1OB 3CPWA 3CCMA 4OWTB 1PH4A 1N34Q 4NB3A 1Q46A 4DK6C 5GAEC 2K5HA 4A3FG 1FGUA 3PIOA 4YWLA 4MTNA 2IY5B 2NZHA 1A62A 1K83H 4X64L 4GNXC 1LYLA 4JI5L 2KENA 4GN5A 1Y14B 4DV6L 4PMWA 2R7ZG 4B3RQ 3H0GG 1Q8KA 3KYHC 4GOPB 2NVYH 4JI7L 2JA8G 1WCMH 3I56A 2BA1A 2KBNA 4P74A 3ULJA 1QVFA 4A3GG 2E2JH 4A3BG 4BBSH 2R93H 3PF5A 4WJ3M 1VQ4A 1EFWA 4JV5L 4DV1L 5IE8A 5C44G 4DV7Q 3KF6B 4AIMA 1C0AA 1YHBA 1VQMA 4A3LG 3PGZA 4JYAL 3WWVA 1HZCA 2K52A 3CCQA 2NVXH 4POFA 3UE0A 2CWAA 3A5UA 1Q81C 1Q86C 3OW2A 1XNRQ 2UXBL 4A3IG 4QY7A 3TREA 1NJIC 2CQOA 4YY3L 3PUVA 1HR0L 2Y0SG 1CSQA 4OO1G 1HZ9A 2MO1A 1E22A 2OQ0A 5IYBH 2EQSA 4DNIA 3KOJA 4KI0A 1VQPA 2UU9Q 4JI3Q 2UXDQ 3ICEA 2K75A 4C3JH 2B3GA 5C4XH 5GADC 4LFAL 3U50C 1L0WA 4A76A 1JJ2A 1QZHA 2AKWB 2JA6H 4Y7NH 5C0XG 4C3HH 1XNQL 1KQSA 5IWAQ 2PQAA 1J5EL 1VQ7A 1SE8A 3K8AA 4A3CG 3OTOQ 3BU2A 3F8TA 5M5WH 4ME3A 1VQBA 4JI1L 2K14A 2GVBA 1NMGA 4X65Q 2PNHA 2XTIA 2E5LL 2UUAL 2WB1G 4GLXA 3J7ZC 1PYBA 1X54A 4B3ML 1VQIA 1VQCA 3EBEA 1T9HA 4DPGA 5IP7H 1XMOQ 5C3EG 1N36L 4X62L 2WB1E 5M5XH 2F3IA 5HGQA 4L5TA 1PFSA 3I4MH 2R92H 3G48A 1VQ9A 1AH9A 1NBWA 3TEHB 5DLQE 4UP9A 4GNXA 2JA7H 3GDEA 1EIYB 4UPAA 4DV7L 1PH3A 2A8VA 4DV1Q 1M90C 1MJCA 4DR4Q 1SFOH 4IFDJ 3RLFA 1VQLA 3HOVG 3TS0A 1Q82C 3FP9A 3HKZG 4RG1A 1PH8A 2UUCQ 3CCLA 2H5XA 2LXKA 1HR0Q 1A8VA 2Z0SA 5LMNQ 1TWFH 4OXPA 3K80C 4ALPA 3T1YL 3FKIH 1XNRL 2UXBQ 4XIGS 3PV0A 3CQZH 2YV5A 4DK3C 1GO3E 1YZ6A 3LGJA 3UDFA 4DR1Q 3BJUA 4UP7A 3RLNA 1SRUA 1HNZL 1ASZA 4GLVB 2PQAB 1YJNA 1K8GA 4AYBG 4LFAQ 3GTLH 2IHEA 2VL6A 1SN8A 2CKZB 3KDFB 2HIVA 3CMEA 1M1KC 3HOZG 1WOCA 2UU9L 2UXDL 4XTCS 3I4MG 2XGTA 4JI7Q 3CD6A 2I0QA 1Y1WG 2VQEQ 3UDGA 5BR8L 2LSSA 4LUVA 4DR6L 2RHSB 3GD7A 4A3FH 4UY8C 4A4IA 3KFUA 3PIPA 3UE1A 3NENA 2YYZA 5IYCG 2R6GA 2ASBA 3CCRA 2MFIA 2BH8A 3RZOH 1B7YB 1YJWA 4R4QA 3PSIA 4HIKA 1JB7A 4LF7Q 4LF9Q 2IX0A 1KAWA 4P75A 1JJCB 3S1QH 2ATWA 1N36Q 1NMFA 3SGIA 3CP0A 3U4ZA 2OQKA 4R4OA 4JI3L 5M3MH 1E3PA 1GM5A 4NXMQ 5C44H 1PH9A 4YHHQ 3HKZE 4DV3Q 3NBHB 4DAYB 5M3FG 4HJ9A 1HNWQ 4JI1Q 1E24A 1JE5A 5ELOA 4DR2Q 2RHQB 3K81C 3K7UC 1MKHA 1VQ6A 1S72A 2LXJA 4L5SA 1BKBA 1OXVA 1VQHA 1IYJB 2I5LX 3JAMc 1HZBA 1TXYA 1DGSA 3W5OA 2I5MX 3D0FA 3AFPA 3ZJYC 5C4JH 1CUKA 5LMNL 1XMOL 2WP8J 3GTQH 4HJ5A 2B63G 2JA6G 2A1AA 3UDXA 3CF5A 2MQHA 1E1OA 3GTGH 4JBMA 4LFBL 1PYSB 2JJQA 3CC4A 4POGA 2Q2IA 1D8LA 1Y1VH 5IYDH 3CXCA 4RMFA 1NY4A 3I2ZA 1UE5A 1CKMA 1IBLL 1VS0A 3DM3A 3J80c 1U5KA 1FJGQ 3CC2A 1YIJA 3PO2H 1TWHH 4O2DA 4DR3Q 3VDYA 4LUZA 2NN6I 3EN2A 4KHZA 2ZJRA 1KRSA 1JMCA 3F2CA 4X66L 5M3FH 1Z9FA 1TWGH 2Y0SE 1KC8C 1HNXQ 4B3MQ 3S2DH 1YNXA 1K8AC 2UUAQ 4BBRG 4PZ6A 1V43A 4GNXB 2ZTCA 2JA7G 2JEBI 1IBMQ 1EWIA 1VQEA 2CWPA 2VY3A 4LFCQ 1B70B 4BA2I 5LMNW 4LF8L 1J5EQ 4HJ8A 3NELA 2WAQG 5IP7G 3AYHB 1YVCA 1X3GA 2IT1A 1K3RA 1X55A 2HQLA 2PMZE 2WAQE 5H1SE 1X65A 4L5RC 4JV5Q 5FLMH 2KHJA 1LUZA 1G6PA 1I3QH 4DR5L 2VS1A 3E9IA 2NVTH 2N78A 2JQOA 4OX9Q 4YY3Q 1EUJA 3A74A 2PI2A 4IJLA 4X64Q 3L2PA 3ULPA 4WJ4A 2K5NA 4JI8Q 4A3JG 2YTYA 1XJVA 2UXCL 2HT1A 1S3OA 4H02A 3E9HA 1VQGA 4Y52H 3GO5A 3CAMA 4JI2Q 4LF9L 2ZTDA 4LFCL 1XPRA 1PH5A 4LF4Q 4IFDI 1B8AA 1OXSC 4X6AH 3FKIG 4GS3A 3J81j 2CFMA 4OONA 5JJLA 2UXCQ 4GN4B 1KL9A 4JBWA 4GKKL 5IP9H 5FLXc 4A3EH 1RL2A 1AE3A 3GTKH 3NEMA 5J3BA 1YITA 4A3LH 5LMUQ 4JI0L 2R7DA 1IBKL 5E7NA 4IPCA 3RNUA 5IYCH 3STBC 1W2BA 3I55A 1CSPA 1GVPA 5GQOA 1EYGA 4GKKQ 1HR0W 1CKNA 4B3TQ 3G6EA 1VQNA 4JI6L 2GVAA 1FJGL 2L15A 4R4IA 4P73A 1N34L 4B3SL 1VQKA 3S2HH 1KRTA 1N32Q 4AYBE 1UE7A 3GTJH 3S14H 2R7FA 3S17H 2UUBL 4QQBX 1VQOA 1Q12A 4GOPA 4B3TL 4K0KL 1D7QA 3KLWA 3PO3G 1EOVA 4BY7H 1A0IA 1QUQA 4LUOA 2QGQA 3S1RH 1X3EA 4UP8A 5C0XI 4JI4Q 1O7IA 1UE1A 1L2FA 2AWOA 2K50A 4KLKA 4AH6A 2QA4A 3F2DA 1K9MC 2ZJQA 1VQDA 4HIOA 1TWCH 4JBKA 5GROA 4DV2L 4HJ7A 4MNOA 1Q7YC 1CKNB 2YTXA 1OTCA 2Q2UA 4GLAC 4J15A 4P71A 1PA6A 2JEAI 1XPUA 2AWNA 2ZTEA 4DV4Q 1G51A 2KCMA 4YHHL 1PH2A 4OWWB 2B63H 5IT9c 3TS2A 1SR3A 4DR6Q 2OTJA 4DR2L 4IOCA 2GN5A 1PV4A 4LWCA 2NN6G 1FVIA 5AJ3Q 1IBML 2R92G 4GOPC 4IPHA 4A3MH 2JA9A 1NTGA 2E8GA 2ZM6Q 1I6HH 2HIXA 3TRZA 2VZAA 1IZ6A 1X3FA 4MZ9A 1YEZA 3ULLA 3H15A
chains in the Genus database with same CATH superfamily
4FF1A 3STBD 4X3KA 2F0SA 4DNTB 1ZKOA 2BH2A 1GUTA 3OW7A 4ZYSA 4XXEA 4A3IB 3T1YQ 1K8MA 3U4VA 4DV5Q 1U4RA 1SDFA 1Y8OB 2LY7A 3W1BA 1AW7A 1RIPA 2JA5H 3HOWH 2VW9A 2J4XA 2IX1A 3J7A5 2NUCA 1HQMC 3H91A 4FDBA 3BDCA 1HRJA 4CBVA 5J39A 4ME5A 1EY0A 1WYDA 3PCOB 3KLRA 1I50B 1NSNS 1S5ED 1CZGA 3KLSX 1CHPD 4Z9CB 4QGUA 5EKKA 1EFID 4B9WA 4A3JH 4XYQA 1V1PB 1AFPA 1KDCA 3A55A 4DR4L 3M7NA 1PVOA 1OXTA 4C1NK 3BZKA 3I4NH 4BXXH 2ALYB 3CW2C 4ZKCB 2NVQB 2ENBA 3BVGA 2WIIB 2VUMH 5CV5A 4ZUIA 4GKJL 4PQXA 2F3WA 1ASYA 2RSOA 2X6LA 4HJAA 4EQPA 2JA6B 2E2HB 3NTIA 3J7AV 5KNCA 1EYAA 2Z6KA 3MXUA 3NUCA 1BBWA 4RHSA 1N9WA 2IWHA 1WI5A 3PF4A 4K5WA 5KNBA 3ERSX 4O0AA 1BO0A 4EQ5A 2CHBD 4UHVA 3UI2A 1WCMG 3HOXG 2MO0A 2D62A 3AEVA 3K5MA 1BVSA 3EROA 4K6LA 1ENAA 5K36G 4RKLA 2EXDA 2DJFC 1I94Q 5C4XB 1I4HA 5CV7A 4A3GB 3S1MH 1GUNA 1D6EC 4I7ZC 4IQZA 4BWGB 1WFQA 2SEBD 4DUZL 4BY1B 2UUCL 3JC66 1XTDA 3FHWA 2BCOA 4NPSA 1EY5A 1YNJD 2ES2A 2CCZA 1ICFB 1G8ZD 3PUWA 2NTTA 4A3MG 3PUYA 1DONA 4DR7Q 1LO5D 1GUSA 3V96A 1L1OC 3SHLA 5IODA 4JI8L 1HH2P 5TSSA 1YHAA 4OX9L 1PRTC 2KJXA 2MGSA 2MP1A 3KF8B 3TP6A 3U9OA 5KIXA 4IO9A 4G7OC 4A3CH 2HCIA 1HA5A 3JAMi 2N49A 4X65L 2EDGA 4X66Q 2PPBC 1Z47A 2Q2HA 3A8IE 4M1UB 5IP9G 5GAHC 3GV6A 3KF8A 4YWKA 1CFMA 1R9TB 1MHWC 4QIWB 5KGUA 4JI2L 1EY6A 4JI6Q 1HNWL 1JT8A 5IYDG 1PRTB 3HKSA 3CCVA 3CPFA 5CV4A 4LF6L 1EIFA 1CHQD 3UDIA 1LT6D 3W1GA 3S24A 3HOUG 3HOVH 3WOEA 1SXTA 1II3A 1MIUA 4TQUS 3K7AH 1KAAA 3RLOA 2YU9B 1QE6A 3CC7A 2CVRA 2QDLA 5JEAJ 3S1QB 3MXNB 1JOOA 5BR8Q 4JG2A 2E74C 1CKOA 2Q2TA 1FL0A 2YU9H 3CRKC 2DUDA 2E2IH 3M3YH 4R9WA 2Z4HA 4HIDA 1LLRD 1HTPA 1NAPA 2ZXOA 3CQZB 1IBLQ 1PH4A 5IGEA 5GAEC 4Q0FA 4TKOB 3GTJB 3SK5A 2E2DC 4X64L 3HOZB 2EYMA 4OL7A 2EJMA 4B3RQ 5DEHA 2PO4A 1HQRD 4JI7L 1JC7A 2BA1A 2KBNA 3ULJA 1QVFA 1JOQA 1LT4D 2R93H 5J1ZA 3PF5A 1EFWA 3ONAB 1BCPF 5C44G 4DV7Q 3KF6B 1C0AA 3ZYYX 2IW3A 3BYYB 4A3LG 3WWVA 1HZCA 5HURA 3HGBA 2CWAA 1EIHA 2UXBL 4A3IG 4QY7A 2OEOA 3PUVA 5IGBA 5BN3A 4NP5A 3GV3A 1HZ9A 2OQ0A 2C5CA 2RDHA 3KOJA 1VQPA 2UU9Q 2JA7B 1L0WA 1PMRA 2IPKD 3V05A 3HS0C 5CBAE 1RTOA 2B2TC 3PQIA 3AU7A 5M5WH 4ME3A 4JI1L 2GVBA 2PNHA 4FXGC 3HZXA 4B3ML 1VQCA 3EBEA 4K5VA 1XMOQ 2FINB 4QMGA 3I4MH 3DUZA 1XX8A 1ENCA 1VQ9A 4DV7L 1PH3A 2NWGA 3URYA 1ONLA 4DV1Q 1X32A 3G7LA 1M90C 1PFMA 4DNRB 4DR4Q 4IFDJ 3TS0A 3FP9A 1I4XA 2H5XA 5ISRA 2A69C 4R8NA 1A8VA 2Z0SA 1HR0Q 3K80C 3T1YL 3EFXD 2UXBQ 1CZWA 2JP1A 2YV5A 4DK3C 4J1MA 1GO3E 1HA6A 1YZ6A 4IFDH 1SMYD 2XN9C 3I3CA 2CH4W 1TR5A 2B2TA 1PTOH 1WTHA 1KLUD 4MHEA 2DJGC 3I4MG 5KNDA 3CD6A 2I0QA 1LT5D 4RWSC 1U4PA 5KRUA 3PIO3 2RHSB 1CI3M 2KEDA 3GD7A 3KFUA 1VMCA 3I70A 3CCRA 3MAQA 3NTHA 1B7YB 1UNSA 1TWFB 2WAQB 1YJWA 1JB7A 4HR7B 2A5HA 2C9OA 3IAYA 1WVLA 2ATWA 1D2BA 1KNAA 1TVXA 4XQJA 1PXUA 3OOCA 4NXMQ 5C44H 2GA4B 4CJ0B 3W2DA 1E24A 3T51B 4DR2Q 3IL8A 1XYIA 2F0FA 1VQHA 1STHA 4YIJA 1DGSA 3MFGA 2I5MX 1GJXA 4C56C 3D0FA 3K5LA 5C4JH 4ODGA 2A69D 4CKEA 2NTSA 4XQNA 1KDBA 1ZYRD 4HJ5A 2B63G 2L1BA 1E1OA 2AUKA 4QF4A 3GTGH 2Q2IA 4X3UA 1LTTD 1WTVA 3PO2B 4L6TB 4RMFA 3Q22A 1BBXC 3VYRA 3PO2H 1YIJA 1TWHH 2NN6I 3RZOB 4TRDA 1UEAB 3EA6A 1SNOA 5CV9A 3F2CA 1GOZA 4X66L 1KC8C 1I4RA 4B3MQ 4IUQA 1STAA 2LMCB 1CK1A 1FYCA 1TWHB 2ZTCA 2JEBI 2CWPA 2VY3A 4CKBA 1QNUA 5LMNW 4LF8L 1J5EQ 3NELA 2IT1A 1X55A 1DYQA 2PMZE 5KYLA 5FLMH 2KHJA 1G6PA 4DR5L 5M5XB 2LS01 3E9IA 3LWEA 4KTAA 2KOLA 2NVXB 1BCPB 4IJLA 3ULPA 4CJ2C 4JI8Q 1L0YB 2NVYB 2YTYA 3TZDA 1XJVA 4RH6A 3S2DB 1S3OA 3E9HA 4Y52H 4LFCL 4IFDI 4X6AH 3BG3A 1AZQA 4GS3A 2WV6D 4OONA 2E75C 1Y8PB 5T1IA 1AP0A 3A7AB 1RL2A 1MD2D 1AE3A 3NEMA 1YITA 2K1BA 2JN4A 5E7NA 3RNUA 1B3AA 5I6WA 2PZWA 3FMCA 1JWMD 5D3IB 5E4XA 2DY8A 5JAVA 3G6EA 1B53A 3A7LA 4JI6L 1VQNA 1FJGL 2MHVA 3R93A 4B3SL 1XTCD 4AYBE 3J81E 1UE7A 3K6OA 5C4ZA 3GTJH 2UUBL 4QQBX 1Q12A 1U9RA 1D7QA 3PO3G 5JPNC 1A0IA 2VXWA 4QUFA 4WJWA 1QUQA 1X3EA 4JI4Q 1I3QB 1TKWB 1ET9A 3E0JA 1EYCA 2K50A 1DOMA 4KLKA 4FF2A 2X6GA 2MJ8A 4XT3B 3J81L 4F87A 2I07B 2DNEA 1D1KA 5GROA 2NVTB 3OWEB 1CKNB 1TU2B 2AUJD 2RDFA 2A68D 1XPUA 2AWNA 2ZTEA 3OMGA 4OWWB 3ND8A 3TS2A 2F0VA 4RGMA 1SR3A 4LWCA 4HAEA 5ELBA 4A3MH 2ZM6Q 1WTRA 1I6HH 3GTPB 2QDBA 2F1MA 3ULLA 4DV5L 3BS1A 2EJFC 4BY7G 4DR1L 4QIWE 2OT2A 5JEAG 2FXQA 4RCOA 1ML0D 3H3VC 1S5FD 1RKNA 1ICWA 1K0RA 3DM1A 1O7YA 3M4PA 1R9TH 3EQLC 2X69A 4ID6A 3I8ZA 1Y1VB 2B8FA 1A2UA 3E0EA 4U673 4BBSG 1STEA 4XYOA 2CW0C 2AQ2B 2J0TD 1Q1EA 3D4RA 5CORA 4IURA 1FD7D 5A2QE 2B39A 3P75A 2A73B 4ABNA 3TDQA 2HHHQ 4P2CB 3JAML 1R4QB 3J81c 3HOUH 4C2MH 5I9PA 1FGBD 1OXXK 1O78A 4ZRZA 1Q1BA 1YBYA 2RVLA 1I50H 2V1CC 3HOYB 3KK7A 4MIUA 4KKSA 4BY1H 2B2VA 1HNZQ 1EQVA 2VQFL 1KIXA 2E2IB 5C3EB 3KBXA 1PTOD 1A3UA 4A75A 3QOJA 3OIPA 1SYFA 4A3DH 1ESRA 2D0PA 2RDGA 3L9AX 2Z1CA 1EYDA 4A3EG 3OTOL 1WTWA 4LAAA 4TVAB 4B9XA 1WD0A 5EBDA 5IWAL 4IN3A 1IL2A 4A3EB 4IZ8A 5I4DA 2RA4A 1EQQA 1C7YA 1I4PA 3DEPA 3QIAA 1D5ZC 2K04A 3RD4A 2OTLA 3RZDH 1K73C 2R93G 5EPKA 1SNDA 1IBKQ 3M4QA 3A5ZB 4APVA 3G71A 4IFDG 2EIFA 4LF6Q 3MC0B 1C48A 1KTKA 3H0GH 2JA8H 1GKHA 4DV2Q 1B9MA 2PQEA 1J6QA 1JOKA 2JK8A 2Z6KC 1VQJA 3D4WA 1U0LA 4AQYQ 3M7GA 5EPLA 1RODA 2N8NA 3CMAA 3RMHA 2QEXA 3D6CA 4XQQA 3BZDB 1TT2A 4LJZC 4RAUC 3N6RA 3AFQA 4IUUA 5EAYA 5JVH3 1S40A 2HCCA 5IGGA 4DV4L 1MSHA 3RN2A 1PH1A 4KHPQ 1LTRD 2KHIA 3FRPB 3T4AC 4KHPL 5EQ0A 3GTPH 3BZCA 5CV6A 1HJPA 3M4OH 1H9MA 1SLJA 1Z6HA 1YJ9A 2F0MA 3PIP3 1S5CD 3SK8A 5JJIA 2LKVA 2TSSA 3QJYA 4FP5D 1VQAA 3S1MB 1V1OA 3QWNA 4DR5Q 1X3QA 1X6OA 1I4GA 2JXMB 3QB3A 3Q24A 4EGVA 4ZK9B 5A2QL 4FXKC 4DUZQ 4I65A 3H3VI 2K5QA 3KF6A 2F0JA 4OWXB 1TWAH 4DAMA 1EY8A 2OCEA 1LACA 3J80E 2RF4A 2OF1A 4DUYQ 1VDZA 1LTAD 1VMPA 3GTOH 5EGTA 1BCPD 2IHFA 1B50A 1NUCA 4ZCKA 3M4YA 4B3RL 2IJ0A 2F0PA 1QVGA 1STNA 2XWBB 3SE0A 3NK9A 4V0BA 1Y1WH 3KJPA 4A3KH 1EL0A 1V8QA 3CPWA 3CCMA 4NB3A 1IYVA 2Q8RE 4AYBB 4A3FG 3S14B 4MTNA 3P20A 3TMEA 4JI5L 4F8MA 1LABA 1Y14B 4PMWA 3KYHC 2JA8G 4BBRB 2F0GA 2NVYH 3I56A 1BCPC 5BN5A 4A3JB 5I2YA 2XVSA 4NDXA 2NVXH 3OHXC 5EKLA 1XNRQ 2CQOA 4YY3L 2WKCA 1CSQA 1NR2A 3AB9A 2EQSA 4H44C 3E3XA 4JI3Q 3X3NA 2K75A 2B3GA 3TSSA 3VR6A 4FVMA 5GADC 1IKLA 1JJ2A 2FMCA 3C3LA 4C3HH 1XNQL 3DEOA 1VQ7A 2A74C 3K8AA 3OTOQ 4A3CG 3BU2A 3F8TA 1DOLA 1HCZA 1JR0D 4X65Q 2WB1G 1K83B 1LV9A 1RD9D 3D8GA 3HOVB 4X3SA 5C4JB 2L4NA 5KEEA 1T9HA 3AMUA 1STBA 4X62L 4L5TA 1PFSA 4RGOS 1PZJD 2R92H 1AH9A 2L0CA 1K0SA 1GHKA 1A2TA 4K2KA 2B2VC 4G57A 1VQLA 3D3RA 3TN2A 3NE5B 3HKZG 5CR3A 1PH8A 1KNEA 2UUCQ 3CCLA 3HOUB 2LXKA 4HCEA 2AQ1B 1TWFH 5C44B 1XNRL 1QCBD 3PV0A 1SNPA 3LGJA 1OO9B 1B3QA 1NNXA 4DR1Q 5J22A 3BJUA 1HNZL 3RLNA 3NWSA 3VR5A 1ASZA 1YJNA 1K8GA 4AYBG 2HIVA 1WOCA 2UXDL 1EZ6A 1JCKB 1E2VA 4R8IA 5DM73 3UDGA 4HTHA 2O4XA 2RSNA 2KECA 3NENA 2MFIA 1TS5A 4R4QA 4F7XA 3MZ5A 1VF7A 1SJHD 1NMFA 1TWAB 3U4ZA 4K6DA 1PH9A 2EY2A 4K2LA 2G9DA 2F0OA 3HKZE 4YHHQ 5M3FG 2M9VA 3A8JE 3QOLA 1Y69U 3K81C 1VQ6A 1S72A 3MEHA 1GXDC 1BKBA 1PTOC 1IYJB 2HDMA 4OO1H 2Z9HA 3W5OA 3VR2A 1O7ZA 1UUPA 3ZJYC 4CJ1B 4IUPA 5JVG3 2JA6G 2A1AA 3UDXA 1R4PB 2MQHA 1F2YA 1PYSB 3CC4A 1A3VA 4POGA 1PFNA 1GUWA 3TBIB 1EIGA 3I2ZA 2EY5A 1UE5A 1IBLL 4CDFC 1U5KA 1FJGQ 2CQAA 3J7AF 4Q5VA 2XIWA 3EN2A 1KRSA 2RKSA 1JMCA 3NQIA 1C8CA 1TWGH 1O7LA 4CGYB 3S2DH 4BBRG 2QKIC 4PZ6A 3SXHA 1IBMQ 1EWIA 1VQEA 1ZEQX 1TIID 1Q8IA 4EQNA 5KYIA 1M4VA 2O2LD 4C3IB 3AYHB 5H1SE 2HQLA 4L5RC 1UAPA 3FPUB 5FOBB 3FDTA 1CA6A 3L3OC 4OX9Q 4YY3Q 4KY6A 1EUJA 3A74A 4KMUC 4FF3A 3NHHA 4H02A 4IUNA 2OXPA 3GO5A 4LF9L 1HHVA 3MXGA 2EY1A 3C1EA 3NTKA 1OXSC 5IT9E 1STGA 1PH5A 2CFMA 5JJLA 2UXCQ 4GN4B 4JBWA 2F0UA 2KCNA 5IP9H 5FLXc 4A3EH 3S15B 1RTNA 4V190 5CMDA 3K5OA 1EEID 3FVQA 3VYUA 1CSPA 4U68A 4IALA 3S2HB 1SNCA 3DMUA 2L15A 2LFNA 1N34L 1VQKA 3S2HH 1N32Q 3HG9A 1VQOA 4K0KL 3MWYW 2ZXPA 1EU4A 2SNMA 4BY7H 4A3DB 4UP8A 5JEAH 2A68C 1QILA 2TMPA 1O7IA 1L2FA 2AWOA 3GTGB 1IW7D 4JBKA 1BUVT 2B2UA 4DV2L 5JOBA 1OTCA 2Q2UA 4GLAC 1PA6A 1E2ZA 3EVQA 1PH2A 2B63H 1F9RA 2EYLA 2K33A 3FEWX 5AJ3Q 1PV4A 4ZQ3A 3ND9A 4CKCA 4HEDA 3D6WA 4ZAIA 1IZ6A 1DOKA 3H15A 4R4CA 3J81i 2C35B 1BBUA 1F9SA 1LTSD 4O1NA 1LTLA 1OXUA 1T5XD 2KVMA 3IFDA 1E1TA 4RCNA 1Y1WB 4YCWA 2VB3X 2K32A 1GD7A 1G291 1WJJA 1DJRD 2E5LQ 1PTOF 4CHTB 2BA0A 3D31A 1X9NA 1CM9A 5M9OA 4YWMA 5FLMG 4PZ7A 5F2DA 4LF7L 2M00A 2K03A 2FMMA 2M2LA 2VQFQ 1HZAA 4QL5A 2F0KA 2K01A 4ZLTF 5JPMC 4GN3B 2KCTA 1SE4A 2HUGA 1YI2A 5E4WC 4BS9A 1ZYRC 3J80i 5IT9L 4KK7A 1GUOA 5FLXE 3HOXH 2A6EC 1I6HB 5G3LD 4DAVA 4LNQA 1KXLA 3K0XA 4L5QA 4DV0Q 3KBGA 5ELNA 1LTID 3TP8A 1SAPA 1QUQB 1EQRA 2UUBQ 1I5FA 1NR4A 3M4OB 4B3SQ 3MHBA 4IUVA 1SNMA 4QCLA 4DV3L 3MEFA 2L5TA 1V1PA 2EYJA 1SYEA 3A54A 3PUXA 2BDNA 4JI4L 1XXGA 3U9SA 5M3FB 3DLLA 2K5VA 3PO3H 4A93B 2AQ3B 3K57A 1X56A 4N8X1 2QILA 4DXFA 2A6HD 5COYA 1O80A 1F2MA 3PO2G 2ICIA 2L12A 4WRDA 1A63A 2EXZA 2F0NA 2NZOA 1EWHA 1MJEA 4TSSA 2JE6I 4PV1C 2VNUD 1KABA 2R7ZH 1YNJC 3T1HL 1RF2D 4QB4A 1RDPD 2XSCA 3WOFA 3G6JB 5L37A 2HQEA 3I4OA 3CCUA 4OELB 1VF5C 4OEMB 4RA8A 3H0GB 3M85A 1E0BA 1AEXA 4N9PA 4WFN3 3VA5A 4E6IA 1PZKD 4RFBA 2F0IA 2J7ZA 1QG7A 1E2WA 2PW7A 1EY4A 4DF7A 3I91A 3NP8A 5D65A 4HIMA 4LFBQ 4IUTA 3M3YB 3LX0A 1SSOA 4NKLA 1VCIA 5LL6X 1HNXL 1IHZA 1SMXA 1SNQA 1JORA 2A6ED 3L7ZC 2K6AA 2DY7A 5C3EH 1G2SA 2MUYA 1WCMB 4BA1I 5C3XA 3Q8DA 4A3KG 2H1EA 3G4SA 1CT1D 2N55A 4LF5L 4QUCA 3L0OA 5M5YH 2K5WA 2O5JC 2WFWA 5AJ3L 1UEBA 3E5SA 5K5PA 5IGCA 3CCJA 2JSOA 3M9BA 5EPJA 3S16H 4UAIA 2EY6A 1STYA 1XPOA 4NXNL 1J9OA 1LM0A 3KDFA 2E76C 1YHQA 3I4NG 1HXYD 4NXNQ 1TS4A 2ID0A 4BXXG 4BBRH 3MVVA 4LF8Q 4BY1G 4C2MB 4N8FA 3IKJA 4M8AA 4IOAA 4UDUC 2QEJC 3S1NB 1S5BD 1PH6A 1VQFA 1N33Q 3BYTB 3DWQA 2PI2E 4OGQC 1L1OA 3OYYA 1JJGA 5IGFA 4O42A 1WTQA 4HCSA 3C46A 1I94L 4OIKA 1H9JA 1N34Q 1PTOB 1KDAA 1Q46A 5EJWA 4DK6C 4EQOA 3PIOA 4EVOA 4YWLA 3GQBA 3CU7A 1A62A 4GNXC 3MXNA 2K7VA 2KENA 2EE1A 4GN5A 4DV6L 2R7ZG 3H0GG 1WCMH 3CHBD 4A93G 4P74A 4A3GG 2E2JH 4A3BG 2B2YA 4WJ3M 1IL8A 4JV5L 5IE8A 1ILQA 3OIQA 2CW0D 1VQMA 3R2IA 2KUMA 3PGZA 2K52A 4POFA 1SJED 3OW2A 5JJZA 2Y0SG 5DM63 4OO1G 2MO1A 1E22A 3Q6SA 3I4MB 4DNIA 2UXDQ 3HOXB 2KQ3A 1IYUA 3DWPA 4C3JH 5C4XH 1DCZA 4LFAL 2EYHA 2G9HD 2KEEA 4A76A 1QZHA 2AKWB 2JA6H 5C0XG 5IWAQ 1J5EL 1SE8A 1SYDA 5C6AA 3I90A 1VQBA 1NMGA 2E5LL 1PYBA 1G91A 1GUGA 1VQIA 3IFTA 2B2YC 4DPGA 5IP7H 2MPMA 5ELFA 5C3EG 1S5DD 2EYFA 2WB1E 4ZKBB 5HGQA 4ILWA 3G48A 5EBCA 1NBWA 2F0HA 4GNXA 2JA7H 4PMBA 3GDEA 3LWUA 1EIYB 2Z6BA 1MJCA 3BDLA 1K3BC 4RG1A 4C3HG 5LMNQ 4ALPA 4OXPA 4XIGS 1D5XC 2JA8B 1ENFA 2VB2X 4A3KB 1I6VC 1EU3A 2XNAC 4UP7A 4ZUJA 5C5LA 2PQAB 1PRTD 3NPPA 1W6JA 3S17B 4LFAQ 3VYTA 3GTLH 3KDFB 2R92B 3CMEA 1JB3A 3NQTA 1M1KC 4XTCS 1L0XB 4JI7Q 1PDQA 5C4HA 2O5IC 2LSSA 4DN4M 5CC4A 4DR6L 4A3FH 4UY8C 4A4IA 1MSGA 4KY5A 4NMZA 3PIPA 3DWAA 2YYZA 5IYCG 2R6GA 1YNNC 1K8OA 2BH8A 3RZOH 2PMZB 4LF7Q 1BQQT 1KAWA 1PFBA 2G5DA 1SBBB 4FNFA 1SYCA 3S1QH 5ELEA 4KN4C 3SGIA 4C3JB 4H7BA 1SFOB 3NWTA 1GM5A 3BDOA 3HRZC 4DV3Q 4DAYB 1EZ8A 4JI1Q 2RHQB 1MKHA 5LL6S 2LXJA 4L5SA 1OXVA 3JAMc 2K5DA 3PMFA 3H6MA 5LMNL 1XMOL 2FJ2A 2WP8J 3CF5A 4JBMA 4LFBL 1G6ZA 2F0WA 1Y1VH 3T13A 2D5DA 5IYDH 3MXPA 1B9NA 5IGDA 3CXCA 1CA5A 1IW7C 5IOCA 3CC2A 3VDYA 1SYBA 3J7YW 2SDFA 1PLFA 3SR1A 4KHZA 2WB1B 2ZJRA 5T1GA 1HNXQ 1Z9FA 2Y0SE 3H09A 3SK6A 1BNZA 3BVMA 1K8AC 2UUAQ 3MA2B 1V43A 4GNXB 1WD1A 3QR8A 4LK1C 4LFCQ 4KN7C 4KY7A 4HJ8A 2WAQG 1YVCA 1K3RA 4XDXA 2WAQE 4JV5Q 2RBMA 1J8IA 5IIFA 1H9SA 1F2ZA 2VS1A 2NVTH 4DA2A 2A6HC 2EJGC 1SE3A 3KLSA 5FK9C 4X64Q 3L2PA 5C3WA 4WJ4A 1B2TA 1BOSA 2UXCL 1EEFD 2HT1A 1VQGA 2KCCA 5AFWA 2RCFA 2ZTDA 1XPRA 1B8AA 3NXWA 3FKIG 3J81j 3J80L 3NSWA 3TP7A 2IL8A 1KL9A 5J3BA 4A3LH 5LMUQ 4JI0L 2R7DA 1IBKL 1WTXA 3STBC 1W2BA 5M5WB 4GKKQ 1HR0W 1BDOA 3QO2A 1FR3A 2GVAA 4P73A 4K5XA 3S17H 2WKDA 4GOPA 4B3TL 4DXGA 2PYKA 2VUMB 1EOVA 4MTKA 2K28A 4LUOA 5C0XI 2Y0SB 4JK1C 4H0LC 1TWCH 3GTQB 5FO8B 4KV6A 4HJ7A 1Q7YC 2NBFA 2YTXA 4P71A 3T53B 2JEAI 2HDLA 1A15A 1G51A 2F0TA 1DXMA 5IT9c 3W3AA 4KJOA 4DR2L 2OTJA 2GN5A 2NN6G 1FVIA 2R92G 4GOPC 1NTGA 2E8GA 2HIXA 2D9UA 2DN8A 4CDEC 4HMJA 1YEZA 3I4LA 4DV4Q 5I6YA 2DGYA 4GKJQ 2EYOA 2F4VQ 1LTGD 3F1ZA 3NBIA 2YTVA 1BXTA 1C9OA 2XRQD 1Y1VG 2A19A 4YCVA 5G3LF 1RJTA 4A3BH 3CCEA 3I7FA 1JWUD 2PZUA 3ER0A 4BY7B 3R8BA 5BN4A 4AQYL 3V2TA 4N9TA 5HGTA 3X3MA 4L8JA 2N3SA 2L55A 2B29A 3HEJA 2MNAA 1HFGA 4C3IG 3K5NA 1BF4A 2I5HA 3PUZA 3RN5A 3NBHA 1AZPA 3T1HQ 1S4ZA 4BBSB 5C4XG 4JOIA 4KJNA 1PH7A 1B1ZA 4PNYA 5A35A 4HSPA 3HOYH 4H13C 3H3VH 2BE5D 4R4TA 1UE6A 4IPGA 1Q3LA 4RKBA 2ZJPA 3VA7A 3TZUA 3BVZA 1DD2A 4YCUA 5M3MG 1V1QA 4HN7A 2Z8LA 3EIVA 4RGNA 2K4KA 5K36H 2F4VL 4X62Q 1N32L 4OO1I 2L11A 3KJOA 2FHTA 2JA5G 1TY2A 3HOWG 1H95A 1QWYA 3C2PA 3F2UA 1W6KA 1N33L 4J8QA 4IJHA 1M8AA 4RGTA 3CCSA 3RUZA 4FXDA 2PZTA 3OMCA 1MBYA 4K0KQ 4DK1A 1KHIA 3U58A 4G4KA 2EZVA 1XMQL 1HUNA 4FF4A 2F4IA 2OWOA 3K0YA 3S1NH 3T56B 4A93H 4K8IA 1YNND 3VYSA 1PHJA 3B6YA 1TWGB 2AHOB 1TS3A 4LMQD 1N8RC 1P16A 1CQVA 4LW1A 3F2BA 4L63B 1CQFA 2NZ1D 2P5ZX 1Y8NB 3MFYA 1JWSD 4WORA 4A3GH 1F2LA 4JOIC 1SMYC 4JBJA 3MTSA 4DV0L 5IYBG 4QJFA 1E7ZA 4IPDA 5FJ8G 3TQYA 1VQ8A 2EPBA 3AQQA 1QZGA 2HHHL 4JI5Q 1SROA 2EVBA 3S15H 2F52A 4PG3A 4JCVE 4CDCC 5C0XJ 1VQ5A 2R61A 3HKZB 4B08A 4G7HC 4JC0A 3HFZB 1ET6A 1QVCA 1HUMA 4P72A 5GAGC 3O13A 1JQYD 3K58A 4DKAC 2IX3A 2ZM6L 4LF5Q 4FYDA 1AE2A 2BDOA 1KD1C 4DV6Q 5HY6A 3P7JA 2L9HA 4KKTA 1DM0B 4MN3A 1FNWA 1Z7TA 3K59A 2NVQH 3A0JA 1V9PA 2R7ZB 1NE3A 4DUYL 4DR7L 1XNQQ 1P8LA 3I4NB 3S9WA 1A3TA 1IXRA 3HOYG 1W3SA 5FJ8H 5D14A 4C3IH 3GTMB 4R1JA 2D0OA 2E2HH 4NXML 4DAYA 3IRBA 3SDZA 2RCNA 1PZID 5JJKA 4PMCA 4PZ8A 2AMCB 2F0QA 5E1FA 2BE5C 4JYAQ 1ZXTA 1QOHA 3TP5A 3HOZH 4LF4L 4A3DG 5I2XA 5M3MB 3Q0AA 1UWVA 1TS2A 2D2CC 4EX5A 1MI2A 2VUMG 1FNUA 4K14A 5LMUL 1JICA 4JI0Q 2VQEL 3GTMH 1BR9A 4A3IH 2WINB 2NN6H 3I72A 2RQXA 3RR5A 5IY0A 4DR3L 1WTPA 1B44D 2Q8TA 5CYUA 1L1OB 1XMQQ 4OWTB 2K5HA 1FGUA 3LNNA 2IY5B 2NZHA 1K83H 2H4OA 3K7AB 1LYLA 5C0XH 1Q8KA 4GOPB 1EY7A 4ULLA 2XRSD 1U4LA 5CGKA 1VQ4A 2F0LA 4DV1L 4AIMA 1YHBA 2F0EA 4JYAL 3CCQA 2V4DA 1Q86C 3UE0A 1Q81C 1F9PA 3A5UA 3VR4A 4DGZA 2ICEC 3TREA 1NJIC 4K8JA 1HR0L 1EQTA 2SOBA 1B4OA 5IYBH 1G2TA 4KI0A 1TQOA 3ICEA 3CKIB 4JW0A 3FPPA 3U50C 4Y7NH 1KQSA 2PQAA 2SNSA 5DNFA 3N52A 2FFKB 1HFNA 1ESFA 3VR3A 2K14A 2XTIA 5D3DA 2UUAL 5FKAC 3A56A 3I73A 4GLXA 3J7ZC 1X54A 1PRTF 3SEBA 1N36L 5M5YB 5M5XH 2F3IA 2PW5A 3A8KE 3T16A 5FLXL 1EWCA 3TEHB 5DLQE 4UP9A 3ITPA 4UPAA 3JAME 2A8VA 2B63B 1D1IA 2BOSA 3GP7A 2QW7A 4NW2A 2B2WC 4F88A 1SEBD 1SFOH 2F03A 3RLFA 4X3TA 3HOVG 1Q82C 3GTOB 2F3VA 3C1FA 5E3FA 4DFAA 3DHQA 3FKIH 2N88A 2ZXRA 3CQZH 1PYWD 1ILPA 5I9OA 2KHSA 4J6HA 4JPBW 4A3BB 3UDFA 1SRUA 4I7AA 5FO7B 2KA7A 4GLVB 3SK4A 2IHEA 2VL6A 1SN8A 2CKZB 3HOZG 2UU9L 1XWEA 2XGTA 2EOTA 4DK0A 2VQEQ 1Y1WG 3GTLB 4A3FB 2K05A 5BR8L 4LUVA 1SE2A 4C1NI 2EYPA 3R2TA 4KHVA 3UE1A 2DNCA 2ASBA 4GZYC 1RHPA 2QCPX 1LTBD 3PSIA 2F0DA 4HIKA 4LF9Q 2IX0A 1FNVA 4P75A 1JJCB 1HTLD 1N36Q 3CP0A 3E6ZX 3CRLC 4XT1B 1AN8A 2OQKA 2Z4IA 4R4OA 4JI3L 1E3PA 5M3MH 3OSOA 4S3SA 3DXJC 1CTMA 1F9QA 4HJ9A 3NBHB 1DZ1A 1HNWQ 1JE5A 5ELOA 3K7UC 4G7ZC 1QNKA 2I5LX 1HZBA 1TXYA 4KD3A 3AFPA 1CUKA 1X3PA 3GTQH 5ELCA 2JJQA 4FO2A 3R3OA 1D8LA 4OHJA 3HOWB 2JA5B 1SYGA 2I46A 1LT3D 1NY4A 4KD4A 2WACA 3PO3B 1CKMA 3OWFA 1VS0A 1TWCB 3DM3A 3J80c 1A6XA 4O2DA 4DR3Q 4LUZA 5ELDA 5M3FH 3RZDB 4HSVA 1YNXA 3H94A 3WDNA 2JA7G 3ERQA 1B70B 4BA2I 5IP7G 3FKIB 2B8GA 3Q23A 1X3GA 2XWJB 2Q8IB 1X65A 1LUZA 1TY0A 1I3QH 4C3HB 1GHJA 1KLGD 1Q90A 4DAPA 5CBEE 2N78A 2JQOA 2PCFB 2E2JB 2PI2A 3OPOA 5FO9B 2K5NA 1QJOA 4A3JG 3KUPA 1MGSA 1RCVD 1JE4A 1F77A 4JI2Q 3CAMA 1T5EA 4HMIA 4LF4Q 2B2WA 1C4QA 1H9KA 4GKKL 2CH4A 2ZT9C 3GTKH 1H9SB 4IPCA 5IYCH 3I55A 5C5MA 1GVPA 5GQOA 1EYGA 3QG1A 1CKNA 1WTOA 4B3TQ 1H9RA 4R4IA 3S1RB 4Y7NB 3GTKB 1KRTA 3P1HA 2QF7A 3S14H 1K28A 2R7FA 4RHRA 2PNRC 4C3JG 3KLWA 3HP3A 2QGQA 3S1RH 1UE1A 1I4QA 2NB0A 1QB5D 4AH6A 3SVMA 2QA4A 3F2DA 1K9MC 2ZJQA 2R93B 4CDDC 1VQDA 2HD3A 4DU9A 4HIOA 2R3ZA 1U4MA 2B2UC 3S16B 4MNOA 4OIJA 1IKMA 4J15A 1EOTA 1NCVA 4BBSH 2KCMA 5NUCA 4YHHL 1D5MC 1EY9A 4DR6Q 4A3MB 5EKIA 4IOCA 1IBML 4KKUA 5DAUA 5CV8A 2JYOA 4IPHA 5LHY1 2JA9A 3TRZA 2VZAA 3EJIA 2NYZD 4JVZA 1X3FA 4MZ9A 1HPCA 3D4DA
chains in the Genus database with same CATH topology
4R4CA 2DGYA 3J81i 4DV5L 2F4VQ 3STBD 4BY7G 2C35B 3F1ZA 4DR1L 1BBUA 4QIWE 2YTVA 1C9OA 5JEAG 1Y1VG 2FXQA 2A19A 1LTLA 1OXUA 2BH2A 4YCVA 3T1YQ 3U4VA 1E1TA 4DV5Q 1K0RA 4A3BH 3CCEA 3M4PA 1R9TH 3I7FA 4YCWA 3ER0A 3W1BA 4AQYL 1GD7A 1G291 1RIPA 2JA5H 1WJJA 2VW9A 3HOWH 2E5LQ 3E0EA 2N3SA 4BBSG 2IX1A 2BA0A 3D31A 1X9NA 3J7A5 2B29A 2MNAA 1Q1EA 4YWMA 5FLMG 4FDBA 2I5HA 3PUZA 3RN5A 4PZ7A 4LF7L 2VQFQ 3T1HQ 1WYDA 1HZAA 3PCOB 4QL5A 2HHHQ 4GN3B 5C4XG 4JOIA 4QGUA 1PH7A 3J81c 2KCTA 3HOUH 4A3JH 4C2MH 1YI2A 3HOYH 3J80i 1OXXK 1Q1BA 4DR4L 3H3VH 1YBYA 3HOXH 3M7NA 1PVOA 1I50H 1OXTA 2V1CC 4R4TA 1UE6A 4IPGA 4LNQA 3BZKA 3I4NH 3K0XA 2ZJPA 4L5QA 4DV0Q 4BXXH 1KXLA 2ALYB 5ELNA 3CW2C 1QUQB 1EQRA 4BY1H 4YCUA 5M3MG 1V1QA 2UUBQ 1I5FA 1HNZQ 2VUMH 3EIVA 2VQFL 2K4KA 1KIXA 2F4VL 4X62Q 4B3SQ 4OO1I 4GKJL 1N32L 3KJOA 2JA5G 4DV3L 3HOWG 1ASYA 1H95A 4A75A 3MEFA 4A3DH 4HJAA 2D0PA 1N33L 2Z6KA 3PUXA 4IJHA 1BBWA 4JI4L 1N9WA 3CCSA 4A3EG 1WI5A 3PF4A 3OTOL 3ERSX 4TVAB 4O0AA 4K0KQ 3DLLA 5IWAL 2K5VA 4EQ5A 1KHIA 1IL2A 3PO3H 3U58A 1XMQL 1X56A 2OWOA 3S1NH 1EQQA 3HOXG 1WCMG 1C7YA 4A93H 2MO0A 1PHJA 2D62A 2OTLA 3AEVA 3B6YA 2AHOB 3RZDH 1K73C 2R93G 3PO2G 1BVSA 1A63A 1N8RC 1P16A 4LW1A 3F2BA 3M4QA 3A5ZB 2NZOA 4APVA 3G71A 1IBKQ 4IFDG 2EIFA 1MJEA 2JE6I 4LF6Q 5K36G 2EXDA 2VNUD 2R7ZH 3H0GH 2JA8H 3T1HL 4A3GH 1GKHA 4JOIC 1I94Q 4JBJA 4DV2Q 4DV0L 5IYBG 1J6QA 3I4OA 3CCUA 4QJFA 3S1MH 2JK8A 2Z6KC 1E7ZA 1WFQA 1VQJA 4DUZL 2UUCL 1U0LA 4AQYQ 3JC66 3M85A 1XTDA 3FHWA 4IPDA 4NPSA 3TQYA 5FJ8G 1VQ8A 2N8NA 2ES2A 2CCZA 3CMAA 3AQQA 1QZGA 2QEXA 2HHHL 3PUWA 4JI5Q 1SROA 3PUYA 4A3MG 3S15H 2F52A 4PG3A 4JCVE 3AFQA 5C0XJ 1VQ5A 5EAYA 4DR7Q 1L1OC 1S40A 4JC0A 3HFZB 4JI8L 1QVCA 4DV4L 1HH2P 4P72A 4A93G 5GAGC 1YHAA 4OX9L 4IO9A 3KF8B 3RN2A 1PH1A 4KHPQ 4A3CH 4HIMA 4LFBQ 4DKAC 2KHIA 2ZM6L 4LF5Q 1AE2A 1KD1C 3JAMi 4KHPL 3GTPH 2N49A 4X65L 3BZCA 1VCIA 5HY6A 4X66Q 4DV6Q 1HNXL 1Z47A 2Q2HA 5IP9G 1SMXA 5GAHC 1HJPA 3M4OH 1SLJA 4YWKA 2NVQH 1YJ9A 3A0JA 1V9PA 1NE3A 3L7ZC 4DUYL 4DR7L 1XNQQ 1P8LA 5C3EH 1IXRA 3HOYG 1W3SA 5FJ8H 4JI2L 4BA1I 5JJIA 4C3IH 4R1JA 2D0OA 4JI6Q 1HNWL 3Q8DA 4A3KG 1JT8A 3G4SA 1VQAA 3HKSA 5IYDG 3CCVA 3CPFA 2E2HH 4LF6L 4LF5L 1EIFA 3L0OA 5M5YH 4DR5Q 1X6OA 3IRBA 4NXML 3UDIA 2RCNA 3W1GA 2WFWA 5AJ3L 4GKJQ 4DUZQ 5JJKA 3S24A 3HOUG 1UEBA 3H3VI 3CCJA 3HOVH 4PZ8A 2AMCB 3KF6A 3M9BA 3S16H 4OWXB 4JYAQ 1MIUA 4TQUS 4NXNL 1XPOA 1TWAH 3K7AH 3HOZH 4DAMA 2OCEA 4LF4L 1LM0A 4A3DG 3KDFA 3RLOA 1YHQA 3I4NG 2RF4A 4NXNQ 4BXXG 2ID0A 3CC7A 4BBRH 4DUYQ 1UWVA 4LF8Q 3GTOH 4BY1G 4EX5A 2VUMG 5JEAJ 2IHFA 3MXNB 4IOAA 5BR8Q 4JG2A 4B3RL 1QVGA 5LMUL 1PH6A 4JI0Q 1CKOA 2VQEL 2Q2TA 3GTMH 1FL0A 1VQFA 1N33Q 2YU9H 4A3IH 3M3YH 2DUDA 2E2IH 2PI2E 3RR5A 4HIDA 1L1OA 3OYYA 5IY0A 4DR3L 1JJGA 1Y1WH 3KJPA 4A3KH 1IBLQ 1I94L 1XMQQ 1L1OB 3CPWA 3CCMA 4OWTB 1PH4A 1N34Q 4NB3A 1Q46A 4DK6C 5GAEC 2K5HA 4A3FG 1FGUA 3PIOA 4YWLA 4MTNA 2IY5B 2NZHA 1A62A 1K83H 4X64L 4GNXC 1LYLA 4JI5L 2KENA 4GN5A 1Y14B 4DV6L 4PMWA 2R7ZG 4B3RQ 3H0GG 1Q8KA 3KYHC 4GOPB 2NVYH 4JI7L 2JA8G 1WCMH 3I56A 2BA1A 2KBNA 4P74A 3ULJA 1QVFA 4A3GG 2E2JH 4A3BG 4BBSH 2R93H 3PF5A 4WJ3M 1VQ4A 1EFWA 4JV5L 4DV1L 5IE8A 5C44G 4DV7Q 3KF6B 4AIMA 1C0AA 1YHBA 1VQMA 4A3LG 3PGZA 4JYAL 3WWVA 1HZCA 2K52A 3CCQA 2NVXH 4POFA 3UE0A 2CWAA 3A5UA 1Q81C 1Q86C 3OW2A 1XNRQ 2UXBL 4A3IG 4QY7A 3TREA 1NJIC 2CQOA 4YY3L 3PUVA 1HR0L 2Y0SG 1CSQA 4OO1G 1HZ9A 2MO1A 1E22A 2OQ0A 5IYBH 2EQSA 4DNIA 3KOJA 4KI0A 1VQPA 2UU9Q 4JI3Q 2UXDQ 3ICEA 2K75A 4C3JH 2B3GA 5C4XH 5GADC 4LFAL 3U50C 1L0WA 4A76A 1JJ2A 1QZHA 2AKWB 2JA6H 4Y7NH 5C0XG 4C3HH 1XNQL 1KQSA 5IWAQ 2PQAA 1J5EL 1VQ7A 1SE8A 3K8AA 4A3CG 3OTOQ 3BU2A 3F8TA 5M5WH 4ME3A 1VQBA 4JI1L 2K14A 2GVBA 1NMGA 4X65Q 2PNHA 2XTIA 2E5LL 2UUAL 2WB1G 4GLXA 3J7ZC 1PYBA 1X54A 4B3ML 1VQIA 1VQCA 3EBEA 1T9HA 4DPGA 5IP7H 1XMOQ 5C3EG 1N36L 4X62L 2WB1E 5M5XH 2F3IA 5HGQA 4L5TA 1PFSA 3I4MH 2R92H 3G48A 1VQ9A 1AH9A 1NBWA 3TEHB 5DLQE 4UP9A 4GNXA 2JA7H 3GDEA 1EIYB 4UPAA 4DV7L 1PH3A 2A8VA 4DV1Q 1M90C 1MJCA 4DR4Q 1SFOH 4IFDJ 3RLFA 1VQLA 3HOVG 3TS0A 1Q82C 3FP9A 3HKZG 4RG1A 1PH8A 2UUCQ 3CCLA 2H5XA 2LXKA 1HR0Q 1A8VA 2Z0SA 5LMNQ 1TWFH 4OXPA 3K80C 4ALPA 3T1YL 3FKIH 1XNRL 2UXBQ 4XIGS 3PV0A 3CQZH 2YV5A 4DK3C 1GO3E 1YZ6A 3LGJA 3UDFA 4DR1Q 3BJUA 4UP7A 3RLNA 1SRUA 1HNZL 1ASZA 4GLVB 2PQAB 1YJNA 1K8GA 4AYBG 4LFAQ 3GTLH 2IHEA 2VL6A 1SN8A 2CKZB 3KDFB 2HIVA 3CMEA 1M1KC 3HOZG 1WOCA 2UU9L 2UXDL 4XTCS 3I4MG 2XGTA 4JI7Q 3CD6A 2I0QA 1Y1WG 2VQEQ 3UDGA 5BR8L 2LSSA 4LUVA 4DR6L 2RHSB 3GD7A 4A3FH 4UY8C 4A4IA 3KFUA 3PIPA 3UE1A 3NENA 2YYZA 5IYCG 2R6GA 2ASBA 3CCRA 2MFIA 2BH8A 3RZOH 1B7YB 1YJWA 4R4QA 3PSIA 4HIKA 1JB7A 4LF7Q 4LF9Q 2IX0A 1KAWA 4P75A 1JJCB 3S1QH 2ATWA 1N36Q 1NMFA 3SGIA 3CP0A 3U4ZA 2OQKA 4R4OA 4JI3L 5M3MH 1E3PA 1GM5A 4NXMQ 5C44H 1PH9A 4YHHQ 3HKZE 4DV3Q 3NBHB 4DAYB 5M3FG 4HJ9A 1HNWQ 4JI1Q 1E24A 1JE5A 5ELOA 4DR2Q 2RHQB 3K81C 3K7UC 1MKHA 1VQ6A 1S72A 2LXJA 4L5SA 1BKBA 1OXVA 1VQHA 1IYJB 2I5LX 3JAMc 1HZBA 1TXYA 1DGSA 3W5OA 2I5MX 3D0FA 3AFPA 3ZJYC 5C4JH 1CUKA 5LMNL 1XMOL 2WP8J 3GTQH 4HJ5A 2B63G 2JA6G 2A1AA 3UDXA 3CF5A 2MQHA 1E1OA 3GTGH 4JBMA 4LFBL 1PYSB 2JJQA 3CC4A 4POGA 2Q2IA 1D8LA 1Y1VH 5IYDH 3CXCA 4RMFA 1NY4A 3I2ZA 1UE5A 1CKMA 1IBLL 1VS0A 3DM3A 3J80c 1U5KA 1FJGQ 3CC2A 1YIJA 3PO2H 1TWHH 4O2DA 4DR3Q 3VDYA 4LUZA 2NN6I 3EN2A 4KHZA 2ZJRA 1KRSA 1JMCA 3F2CA 4X66L 5M3FH 1Z9FA 1TWGH 2Y0SE 1KC8C 1HNXQ 4B3MQ 3S2DH 1YNXA 1K8AC 2UUAQ 4BBRG 4PZ6A 1V43A 4GNXB 2ZTCA 2JA7G 2JEBI 1IBMQ 1EWIA 1VQEA 2CWPA 2VY3A 4LFCQ 1B70B 4BA2I 5LMNW 4LF8L 1J5EQ 4HJ8A 3NELA 2WAQG 5IP7G 3AYHB 1YVCA 1X3GA 2IT1A 1K3RA 1X55A 2HQLA 2PMZE 2WAQE 5H1SE 1X65A 4L5RC 4JV5Q 5FLMH 2KHJA 1LUZA 1G6PA 1I3QH 4DR5L 2VS1A 3E9IA 2NVTH 2N78A 2JQOA 4OX9Q 4YY3Q 1EUJA 3A74A 2PI2A 4IJLA 4X64Q 3L2PA 3ULPA 4WJ4A 2K5NA 4JI8Q 4A3JG 2YTYA 1XJVA 2UXCL 2HT1A 1S3OA 4H02A 3E9HA 1VQGA 4Y52H 3GO5A 3CAMA 4JI2Q 4LF9L 2ZTDA 4LFCL 1XPRA 1PH5A 4LF4Q 4IFDI 1B8AA 1OXSC 4X6AH 3FKIG 4GS3A 3J81j 2CFMA 4OONA 5JJLA 2UXCQ 4GN4B 1KL9A 4JBWA 4GKKL 5IP9H 5FLXc 4A3EH 1RL2A 1AE3A 3GTKH 3NEMA 5J3BA 1YITA 4A3LH 5LMUQ 4JI0L 2R7DA 1IBKL 5E7NA 4IPCA 3RNUA 5IYCH 3STBC 1W2BA 3I55A 1CSPA 1GVPA 5GQOA 1EYGA 4GKKQ 1HR0W 1CKNA 4B3TQ 3G6EA 1VQNA 4JI6L 2GVAA 1FJGL 2L15A 4R4IA 4P73A 1N34L 4B3SL 1VQKA 3S2HH 1KRTA 1N32Q 4AYBE 1UE7A 3GTJH 3S14H 2R7FA 3S17H 2UUBL 4QQBX 1VQOA 1Q12A 4GOPA 4B3TL 4K0KL 1D7QA 3KLWA 3PO3G 1EOVA 4BY7H 1A0IA 1QUQA 4LUOA 2QGQA 3S1RH 1X3EA 4UP8A 5C0XI 4JI4Q 1O7IA 1UE1A 1L2FA 2AWOA 2K50A 4KLKA 4AH6A 2QA4A 3F2DA 1K9MC 2ZJQA 1VQDA 4HIOA 1TWCH 4JBKA 5GROA 4DV2L 4HJ7A 4MNOA 1Q7YC 1CKNB 2YTXA 1OTCA 2Q2UA 4GLAC 4J15A 4P71A 1PA6A 2JEAI 1XPUA 2AWNA 2ZTEA 4DV4Q 1G51A 2KCMA 4YHHL 1PH2A 4OWWB 2B63H 5IT9c 3TS2A 1SR3A 4DR6Q 2OTJA 4DR2L 4IOCA 2GN5A 1PV4A 4LWCA 2NN6G 1FVIA 5AJ3Q 1IBML 2R92G 4GOPC 4IPHA 4A3MH 2JA9A 1NTGA 2E8GA 2ZM6Q 1I6HH 2HIXA 3TRZA 2VZAA 1IZ6A 1X3FA 4MZ9A 1YEZA 3ULLA 3H15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4C A;  2DGY A;  3J81 i;  4DV5 L;  2F4V Q;  3STB D;  4BY7 G;  2C35 B;  3F1Z A;  4DR1 L;  1BBU A;  4QIW E;  2YTV A;  1C9O A;  5JEA G;  1Y1V G;  2FXQ A;  2A19 A;  1LTL A;  1OXU A;  2BH2 A;  4YCV A;  3T1Y Q;  3U4V A;  1E1T A;  4DV5 Q;  1K0R A;  4A3B H;  3CCE A;  3M4P A;  1R9T H;  3I7F A;  4YCW A;  3ER0 A;  3W1B A;  4AQY L;  1GD7 A;  1G29 1;  1RIP A;  2JA5 H;  1WJJ A;  2VW9 A;  3HOW H;  2E5L Q;  3E0E A;  2N3S A;  4BBS G;  2IX1 A;  2BA0 A;  3D31 A;  1X9N A;  3J7A 5;  2B29 A;  2MNA A;  1Q1E A;  4YWM A;  5FLM G;  4FDB A;  2I5H A;  3PUZ A;  3RN5 A;  4PZ7 A;  4LF7 L;  2VQF Q;  3T1H Q;  1WYD A;  1HZA A;  3PCO B;  4QL5 A;  2HHH Q;  4GN3 B;  5C4X G;  4JOI A;  4QGU A;  1PH7 A;  3J81 c;  2KCT A;  3HOU H;  4A3J H;  4C2M H;  1YI2 A;  3HOY H;  3J80 i;  1OXX K;  1Q1B A;  4DR4 L;  3H3V H;  1YBY A;  3HOX H;  3M7N A;  1PVO A;  1I50 H;  1OXT A;  2V1C C;  4R4T A;  1UE6 A;  4IPG A;  4LNQ A;  3BZK A;  3I4N H;  3K0X A;  2ZJP A;  4L5Q A;  4DV0 Q;  4BXX H;  1KXL A;  2ALY B;  5ELN A;  3CW2 C;  1QUQ B;  1EQR A;  4BY1 H;  4YCU A;  5M3M G;  1V1Q A;  2UUB Q;  1I5F A;  1HNZ Q;  2VUM H;  3EIV A;  2VQF L;  2K4K A;  1KIX A;  2F4V L;  4X62 Q;  4B3S Q;  4OO1 I;  4GKJ L;  1N32 L;  3KJO A;  2JA5 G;  4DV3 L;  3HOW G;  1ASY A;  1H95 A;  4A75 A;  3MEF A;  4A3D H;  4HJA A;  2D0P A;  1N33 L;  2Z6K A;  3PUX A;  4IJH A;  1BBW A;  4JI4 L;  1N9W A;  3CCS A;  4A3E G;  1WI5 A;  3PF4 A;  3OTO L;  3ERS X;  4TVA B;  4O0A A;  4K0K Q;  3DLL A;  5IWA L;  2K5V A;  4EQ5 A;  1KHI A;  1IL2 A;  3PO3 H;  3U58 A;  1XMQ L;  1X56 A;  2OWO A;  3S1N H;  1EQQ A;  3HOX G;  1WCM G;  1C7Y A;  4A93 H;  2MO0 A;  1PHJ A;  2D62 A;  2OTL A;  3AEV A;  3B6Y A;  2AHO B;  3RZD H;  1K73 C;  2R93 G;  3PO2 G;  1BVS A;  1A63 A;  1N8R C;  1P16 A;  4LW1 A;  3F2B A;  3M4Q A;  3A5Z B;  2NZO A;  4APV A;  3G71 A;  1IBK Q;  4IFD G;  2EIF A;  1MJE A;  2JE6 I;  4LF6 Q;  5K36 G;  2EXD A;  2VNU D;  2R7Z H;  3H0G H;  2JA8 H;  3T1H L;  4A3G H;  1GKH A;  4JOI C;  1I94 Q;  4JBJ A;  4DV2 Q;  4DV0 L;  5IYB G;  1J6Q A;  3I4O A;  3CCU A;  4QJF A;  3S1M H;  2JK8 A;  2Z6K C;  1E7Z A;  1WFQ A;  1VQJ A;  4DUZ L;  2UUC L;  1U0L A;  4AQY Q;  3JC6 6;  3M85 A;  1XTD A;  3FHW A;  4IPD A;  4NPS A;  3TQY A;  5FJ8 G;  1VQ8 A;  2N8N A;  2ES2 A;  2CCZ A;  3CMA A;  3AQQ A;  1QZG A;  2QEX A;  2HHH L;  3PUW A;  4JI5 Q;  1SRO A;  3PUY A;  4A3M G;  3S15 H;  2F52 A;  4PG3 A;  4JCV E;  3AFQ A;  5C0X J;  1VQ5 A;  5EAY A;  4DR7 Q;  1L1O C;  1S40 A;  4JC0 A;  3HFZ B;  4JI8 L;  1QVC A;  4DV4 L;  1HH2 P;  4P72 A;  4A93 G;  5GAG C;  1YHA A;  4OX9 L;  4IO9 A;  3KF8 B;  3RN2 A;  1PH1 A;  4KHP Q;  4A3C H;  4HIM A;  4LFB Q;  4DKA C;  2KHI A;  2ZM6 L;  4LF5 Q;  1AE2 A;  1KD1 C;  3JAM i;  4KHP L;  3GTP H;  2N49 A;  4X65 L;  3BZC A;  1VCI A;  5HY6 A;  4X66 Q;  4DV6 Q;  1HNX L;  1Z47 A;  2Q2H A;  5IP9 G;  1SMX A;  5GAH C;  1HJP A;  3M4O H;  1SLJ A;  4YWK A;  2NVQ H;  1YJ9 A;  3A0J A;  1V9P A;  1NE3 A;  3L7Z C;  4DUY L;  4DR7 L;  1XNQ Q;  1P8L A;  5C3E H;  1IXR A;  3HOY G;  1W3S A;  5FJ8 H;  4JI2 L;  4BA1 I;  5JJI A;  4C3I H;  4R1J A;  2D0O A;  4JI6 Q;  1HNW L;  3Q8D A;  4A3K G;  1JT8 A;  3G4S A;  1VQA A;  3HKS A;  5IYD G;  3CCV A;  3CPF A;  2E2H H;  4LF6 L;  4LF5 L;  1EIF A;  3L0O A;  5M5Y H;  4DR5 Q;  1X6O A;  3IRB A;  4NXM L;  3UDI A;  2RCN A;  3W1G A;  2WFW A;  5AJ3 L;  4GKJ Q;  4DUZ Q;  5JJK A;  3S24 A;  3HOU G;  1UEB A;  3H3V I;  3CCJ A;  3HOV H;  4PZ8 A;  2AMC B;  3KF6 A;  3M9B A;  3S16 H;  4OWX B;  4JYA Q;  1MIU A;  4TQU S;  4NXN L;  1XPO A;  1TWA H;  3K7A H;  3HOZ H;  4DAM A;  2OCE A;  4LF4 L;  1LM0 A;  4A3D G;  3KDF A;  3RLO A;  1YHQ A;  3I4N G;  2RF4 A;  4NXN Q;  4BXX G;  2ID0 A;  3CC7 A;  4BBR H;  4DUY Q;  1UWV A;  4LF8 Q;  3GTO H;  4BY1 G;  4EX5 A;  2VUM G;  5JEA J;  2IHF A;  3MXN B;  4IOA A;  5BR8 Q;  4JG2 A;  4B3R L;  1QVG A;  5LMU L;  1PH6 A;  4JI0 Q;  1CKO A;  2VQE L;  2Q2T A;  3GTM H;  1FL0 A;  1VQF A;  1N33 Q;  2YU9 H;  4A3I H;  3M3Y H;  2DUD A;  2E2I H;  2PI2 E;  3RR5 A;  4HID A;  1L1O A;  3OYY A;  5IY0 A;  4DR3 L;  1JJG A;  1Y1W H;  3KJP A;  4A3K H;  1IBL Q;  1I94 L;  1XMQ Q;  1L1O B;  3CPW A;  3CCM A;  4OWT B;  1PH4 A;  1N34 Q;  4NB3 A;  1Q46 A;  4DK6 C;  5GAE C;  2K5H A;  4A3F G;  1FGU A;  3PIO A;  4YWL A;  4MTN A;  2IY5 B;  2NZH A;  1A62 A;  1K83 H;  4X64 L;  4GNX C;  1LYL A;  4JI5 L;  2KEN A;  4GN5 A;  1Y14 B;  4DV6 L;  4PMW A;  2R7Z G;  4B3R Q;  3H0G G;  1Q8K A;  3KYH C;  4GOP B;  2NVY H;  4JI7 L;  2JA8 G;  1WCM H;  3I56 A;  2BA1 A;  2KBN A;  4P74 A;  3ULJ A;  1QVF A;  4A3G G;  2E2J H;  4A3B G;  4BBS H;  2R93 H;  3PF5 A;  4WJ3 M;  1VQ4 A;  1EFW A;  4JV5 L;  4DV1 L;  5IE8 A;  5C44 G;  4DV7 Q;  3KF6 B;  4AIM A;  1C0A A;  1YHB A;  1VQM A;  4A3L G;  3PGZ A;  4JYA L;  3WWV A;  1HZC A;  2K52 A;  3CCQ A;  2NVX H;  4POF A;  3UE0 A;  2CWA A;  3A5U A;  1Q81 C;  1Q86 C;  3OW2 A;  1XNR Q;  2UXB L;  4A3I G;  4QY7 A;  3TRE A;  1NJI C;  2CQO A;  4YY3 L;  3PUV A;  1HR0 L;  2Y0S G;  1CSQ A;  4OO1 G;  1HZ9 A;  2MO1 A;  1E22 A;  2OQ0 A;  5IYB H;  2EQS A;  4DNI A;  3KOJ A;  4KI0 A;  1VQP A;  2UU9 Q;  4JI3 Q;  2UXD Q;  3ICE A;  2K75 A;  4C3J H;  2B3G A;  5C4X H;  5GAD C;  4LFA L;  3U50 C;  1L0W A;  4A76 A;  1JJ2 A;  1QZH A;  2AKW B;  2JA6 H;  4Y7N H;  5C0X G;  4C3H H;  1XNQ L;  1KQS A;  5IWA Q;  2PQA A;  1J5E L;  1VQ7 A;  1SE8 A;  3K8A A;  4A3C G;  3OTO Q;  3BU2 A;  3F8T A;  5M5W H;  4ME3 A;  1VQB A;  4JI1 L;  2K14 A;  2GVB A;  1NMG A;  4X65 Q;  2PNH A;  2XTI A;  2E5L L;  2UUA L;  2WB1 G;  4GLX A;  3J7Z C;  1PYB A;  1X54 A;  4B3M L;  1VQI A;  1VQC A;  3EBE A;  1T9H A;  4DPG A;  5IP7 H;  1XMO Q;  5C3E G;  1N36 L;  4X62 L;  2WB1 E;  5M5X H;  2F3I A;  5HGQ A;  4L5T A;  1PFS A;  3I4M H;  2R92 H;  3G48 A;  1VQ9 A;  1AH9 A;  1NBW A;  3TEH B;  5DLQ E;  4UP9 A;  4GNX A;  2JA7 H;  3GDE A;  1EIY B;  4UPA A;  4DV7 L;  1PH3 A;  2A8V A;  4DV1 Q;  1M90 C;  1MJC A;  4DR4 Q;  1SFO H;  4IFD J;  3RLF A;  1VQL A;  3HOV G;  3TS0 A;  1Q82 C;  3FP9 A;  3HKZ G;  4RG1 A;  1PH8 A;  2UUC Q;  3CCL A;  2H5X A;  2LXK A;  1HR0 Q;  1A8V A;  2Z0S A;  5LMN Q;  1TWF H;  4OXP A;  3K80 C;  4ALP A;  3T1Y L;  3FKI H;  1XNR L;  2UXB Q;  4XIG S;  3PV0 A;  3CQZ H;  2YV5 A;  4DK3 C;  1GO3 E;  1YZ6 A;  3LGJ A;  3UDF A;  4DR1 Q;  3BJU A;  4UP7 A;  3RLN A;  1SRU A;  1HNZ L;  1ASZ A;  4GLV B;  2PQA B;  1YJN A;  1K8G A;  4AYB G;  4LFA Q;  3GTL H;  2IHE A;  2VL6 A;  1SN8 A;  2CKZ B;  3KDF B;  2HIV A;  3CME A;  1M1K C;  3HOZ G;  1WOC A;  2UU9 L;  2UXD L;  4XTC S;  3I4M G;  2XGT A;  4JI7 Q;  3CD6 A;  2I0Q A;  1Y1W G;  2VQE Q;  3UDG A;  5BR8 L;  2LSS A;  4LUV A;  4DR6 L;  2RHS B;  3GD7 A;  4A3F H;  4UY8 C;  4A4I A;  3KFU A;  3PIP A;  3UE1 A;  3NEN A;  2YYZ A;  5IYC G;  2R6G A;  2ASB A;  3CCR A;  2MFI A;  2BH8 A;  3RZO H;  1B7Y B;  1YJW A;  4R4Q A;  3PSI A;  4HIK A;  1JB7 A;  4LF7 Q;  4LF9 Q;  2IX0 A;  1KAW A;  4P75 A;  1JJC B;  3S1Q H;  2ATW A;  1N36 Q;  1NMF A;  3SGI A;  3CP0 A;  3U4Z A;  2OQK A;  4R4O A;  4JI3 L;  5M3M H;  1E3P A;  1GM5 A;  4NXM Q;  5C44 H;  1PH9 A;  4YHH Q;  3HKZ E;  4DV3 Q;  3NBH B;  4DAY B;  5M3F G;  4HJ9 A;  1HNW Q;  4JI1 Q;  1E24 A;  1JE5 A;  5ELO A;  4DR2 Q;  2RHQ B;  3K81 C;  3K7U C;  1MKH A;  1VQ6 A;  1S72 A;  2LXJ A;  4L5S A;  1BKB A;  1OXV A;  1VQH A;  1IYJ B;  2I5L X;  3JAM c;  1HZB A;  1TXY A;  1DGS A;  3W5O A;  2I5M X;  3D0F A;  3AFP A;  3ZJY C;  5C4J H;  1CUK A;  5LMN L;  1XMO L;  2WP8 J;  3GTQ H;  4HJ5 A;  2B63 G;  2JA6 G;  2A1A A;  3UDX A;  3CF5 A;  2MQH A;  1E1O A;  3GTG H;  4JBM A;  4LFB L;  1PYS B;  2JJQ A;  3CC4 A;  4POG A;  2Q2I A;  1D8L A;  1Y1V H;  5IYD H;  3CXC A;  4RMF A;  1NY4 A;  3I2Z A;  1UE5 A;  1CKM A;  1IBL L;  1VS0 A;  3DM3 A;  3J80 c;  1U5K A;  1FJG Q;  3CC2 A;  1YIJ A;  3PO2 H;  1TWH H;  4O2D A;  4DR3 Q;  3VDY A;  4LUZ A;  2NN6 I;  3EN2 A;  4KHZ A;  2ZJR A;  1KRS A;  1JMC A;  3F2C A;  4X66 L;  5M3F H;  1Z9F A;  1TWG H;  2Y0S E;  1KC8 C;  1HNX Q;  4B3M Q;  3S2D H;  1YNX A;  1K8A C;  2UUA Q;  4BBR G;  4PZ6 A;  1V43 A;  4GNX B;  2ZTC A;  2JA7 G;  2JEB I;  1IBM Q;  1EWI A;  1VQE A;  2CWP A;  2VY3 A;  4LFC Q;  1B70 B;  4BA2 I;  5LMN W;  4LF8 L;  1J5E Q;  4HJ8 A;  3NEL A;  2WAQ G;  5IP7 G;  3AYH B;  1YVC A;  1X3G A;  2IT1 A;  1K3R A;  1X55 A;  2HQL A;  2PMZ E;  2WAQ E;  5H1S E;  1X65 A;  4L5R C;  4JV5 Q;  5FLM H;  2KHJ A;  1LUZ A;  1G6P A;  1I3Q H;  4DR5 L;  2VS1 A;  3E9I A;  2NVT H;  2N78 A;  2JQO A;  4OX9 Q;  4YY3 Q;  1EUJ A;  3A74 A;  2PI2 A;  4IJL A;  4X64 Q;  3L2P A;  3ULP A;  4WJ4 A;  2K5N A;  4JI8 Q;  4A3J G;  2YTY A;  1XJV A;  2UXC L;  2HT1 A;  1S3O A;  4H02 A;  3E9H A;  1VQG A;  4Y52 H;  3GO5 A;  3CAM A;  4JI2 Q;  4LF9 L;  2ZTD A;  4LFC L;  1XPR A;  1PH5 A;  4LF4 Q;  4IFD I;  1B8A A;  1OXS C;  4X6A H;  3FKI G;  4GS3 A;  3J81 j;  2CFM A;  4OON A;  5JJL A;  2UXC Q;  4GN4 B;  1KL9 A;  4JBW A;  4GKK L;  5IP9 H;  5FLX c;  4A3E H;  1RL2 A;  1AE3 A;  3GTK H;  3NEM A;  5J3B A;  1YIT A;  4A3L H;  5LMU Q;  4JI0 L;  2R7D A;  1IBK L;  5E7N A;  4IPC A;  3RNU A;  5IYC H;  3STB C;  1W2B A;  3I55 A;  1CSP A;  1GVP A;  5GQO A;  1EYG A;  4GKK Q;  1HR0 W;  1CKN A;  4B3T Q;  3G6E A;  1VQN A;  4JI6 L;  2GVA A;  1FJG L;  2L15 A;  4R4I A;  4P73 A;  1N34 L;  4B3S L;  1VQK A;  3S2H H;  1KRT A;  1N32 Q;  4AYB E;  1UE7 A;  3GTJ H;  3S14 H;  2R7F A;  3S17 H;  2UUB L;  4QQB X;  1VQO A;  1Q12 A;  4GOP A;  4B3T L;  4K0K L;  1D7Q A;  3KLW A;  3PO3 G;  1EOV A;  4BY7 H;  1A0I A;  1QUQ A;  4LUO A;  2QGQ A;  3S1R H;  1X3E A;  4UP8 A;  5C0X I;  4JI4 Q;  1O7I A;  1UE1 A;  1L2F A;  2AWO A;  2K50 A;  4KLK A;  4AH6 A;  2QA4 A;  3F2D A;  1K9M C;  2ZJQ A;  1VQD A;  4HIO A;  1TWC H;  4JBK A;  5GRO A;  4DV2 L;  4HJ7 A;  4MNO A;  1Q7Y C;  1CKN B;  2YTX A;  1OTC A;  2Q2U A;  4GLA C;  4J15 A;  4P71 A;  1PA6 A;  2JEA I;  1XPU A;  2AWN A;  2ZTE A;  4DV4 Q;  1G51 A;  2KCM A;  4YHH L;  1PH2 A;  4OWW B;  2B63 H;  5IT9 c;  3TS2 A;  1SR3 A;  4DR6 Q;  2OTJ A;  4DR2 L;  4IOC A;  2GN5 A;  1PV4 A;  4LWC A;  2NN6 G;  1FVI A;  5AJ3 Q;  1IBM L;  2R92 G;  4GOP C;  4IPH A;  4A3M H;  2JA9 A;  1NTG A;  2E8G A;  2ZM6 Q;  1I6H H;  2HIX A;  3TRZ A;  2VZA A;  1IZ6 A;  1X3F A;  4MZ9 A;  1YEZ A;  3ULL A;  3H15 A; 
#chains in the Genus database with same CATH topology
 4FF1 A;  3STB D;  4X3K A;  2F0S A;  4DNT B;  1ZKO A;  2BH2 A;  1GUT A;  3OW7 A;  4ZYS A;  4XXE A;  4A3I B;  3T1Y Q;  1K8M A;  3U4V A;  4DV5 Q;  1U4R A;  1SDF A;  1Y8O B;  2LY7 A;  3W1B A;  1AW7 A;  1RIP A;  2JA5 H;  3HOW H;  2VW9 A;  2J4X A;  2IX1 A;  3J7A 5;  2NUC A;  1HQM C;  3H91 A;  4FDB A;  3BDC A;  1HRJ A;  4CBV A;  5J39 A;  4ME5 A;  1EY0 A;  1WYD A;  3PCO B;  3KLR A;  1I50 B;  1NSN S;  1S5E D;  1CZG A;  3KLS X;  1CHP D;  4Z9C B;  4QGU A;  5EKK A;  1EFI D;  4B9W A;  4A3J H;  4XYQ A;  1V1P B;  1AFP A;  1KDC A;  3A55 A;  4DR4 L;  3M7N A;  1PVO A;  1OXT A;  4C1N K;  3BZK A;  3I4N H;  4BXX H;  2ALY B;  3CW2 C;  4ZKC B;  2NVQ B;  2ENB A;  3BVG A;  2WII B;  2VUM H;  5CV5 A;  4ZUI A;  4GKJ L;  4PQX A;  2F3W A;  1ASY A;  2RSO A;  2X6L A;  4HJA A;  4EQP A;  2JA6 B;  2E2H B;  3NTI A;  3J7A V;  5KNC A;  1EYA A;  2Z6K A;  3MXU A;  3NUC A;  1BBW A;  4RHS A;  1N9W A;  2IWH A;  1WI5 A;  3PF4 A;  4K5W A;  5KNB A;  3ERS X;  4O0A A;  1BO0 A;  4EQ5 A;  2CHB D;  4UHV A;  3UI2 A;  1WCM G;  3HOX G;  2MO0 A;  2D62 A;  3AEV A;  3K5M A;  1BVS A;  3ERO A;  4K6L A;  1ENA A;  5K36 G;  4RKL A;  2EXD A;  2DJF C;  1I94 Q;  5C4X B;  1I4H A;  5CV7 A;  4A3G B;  3S1M H;  1GUN A;  1D6E C;  4I7Z C;  4IQZ A;  4BWG B;  1WFQ A;  2SEB D;  4DUZ L;  4BY1 B;  2UUC L;  3JC6 6;  1XTD A;  3FHW A;  2BCO A;  4NPS A;  1EY5 A;  1YNJ D;  2ES2 A;  2CCZ A;  1ICF B;  1G8Z D;  3PUW A;  2NTT A;  4A3M G;  3PUY A;  1DON A;  4DR7 Q;  1LO5 D;  1GUS A;  3V96 A;  1L1O C;  3SHL A;  5IOD A;  4JI8 L;  1HH2 P;  5TSS A;  1YHA A;  4OX9 L;  1PRT C;  2KJX A;  2MGS A;  2MP1 A;  3KF8 B;  3TP6 A;  3U9O A;  5KIX A;  4IO9 A;  4G7O C;  4A3C H;  2HCI A;  1HA5 A;  3JAM i;  2N49 A;  4X65 L;  2EDG A;  4X66 Q;  2PPB C;  1Z47 A;  2Q2H A;  3A8I E;  4M1U B;  5IP9 G;  5GAH C;  3GV6 A;  3KF8 A;  4YWK A;  1CFM A;  1R9T B;  1MHW C;  4QIW B;  5KGU A;  4JI2 L;  1EY6 A;  4JI6 Q;  1HNW L;  1JT8 A;  5IYD G;  1PRT B;  3HKS A;  3CCV A;  3CPF A;  5CV4 A;  4LF6 L;  1EIF A;  1CHQ D;  3UDI A;  1LT6 D;  3W1G A;  3S24 A;  3HOU G;  3HOV H;  3WOE A;  1SXT A;  1II3 A;  1MIU A;  4TQU S;  3K7A H;  1KAA A;  3RLO A;  2YU9 B;  1QE6 A;  3CC7 A;  2CVR A;  2QDL A;  5JEA J;  3S1Q B;  3MXN B;  1JOO A;  5BR8 Q;  4JG2 A;  2E74 C;  1CKO A;  2Q2T A;  1FL0 A;  2YU9 H;  3CRK C;  2DUD A;  2E2I H;  3M3Y H;  4R9W A;  2Z4H A;  4HID A;  1LLR D;  1HTP A;  1NAP A;  2ZXO A;  3CQZ B;  1IBL Q;  1PH4 A;  5IGE A;  5GAE C;  4Q0F A;  4TKO B;  3GTJ B;  3SK5 A;  2E2D C;  4X64 L;  3HOZ B;  2EYM A;  4OL7 A;  2EJM A;  4B3R Q;  5DEH A;  2PO4 A;  1HQR D;  4JI7 L;  1JC7 A;  2BA1 A;  2KBN A;  3ULJ A;  1QVF A;  1JOQ A;  1LT4 D;  2R93 H;  5J1Z A;  3PF5 A;  1EFW A;  3ONA B;  1BCP F;  5C44 G;  4DV7 Q;  3KF6 B;  1C0A A;  3ZYY X;  2IW3 A;  3BYY B;  4A3L G;  3WWV A;  1HZC A;  5HUR A;  3HGB A;  2CWA A;  1EIH A;  2UXB L;  4A3I G;  4QY7 A;  2OEO A;  3PUV A;  5IGB A;  5BN3 A;  4NP5 A;  3GV3 A;  1HZ9 A;  2OQ0 A;  2C5C A;  2RDH A;  3KOJ A;  1VQP A;  2UU9 Q;  2JA7 B;  1L0W A;  1PMR A;  2IPK D;  3V05 A;  3HS0 C;  5CBA E;  1RTO A;  2B2T C;  3PQI A;  3AU7 A;  5M5W H;  4ME3 A;  4JI1 L;  2GVB A;  2PNH A;  4FXG C;  3HZX A;  4B3M L;  1VQC A;  3EBE A;  4K5V A;  1XMO Q;  2FIN B;  4QMG A;  3I4M H;  3DUZ A;  1XX8 A;  1ENC A;  1VQ9 A;  4DV7 L;  1PH3 A;  2NWG A;  3URY A;  1ONL A;  4DV1 Q;  1X32 A;  3G7L A;  1M90 C;  1PFM A;  4DNR B;  4DR4 Q;  4IFD J;  3TS0 A;  3FP9 A;  1I4X A;  2H5X A;  5ISR A;  2A69 C;  4R8N A;  1A8V A;  2Z0S A;  1HR0 Q;  3K80 C;  3T1Y L;  3EFX D;  2UXB Q;  1CZW A;  2JP1 A;  2YV5 A;  4DK3 C;  4J1M A;  1GO3 E;  1HA6 A;  1YZ6 A;  4IFD H;  1SMY D;  2XN9 C;  3I3C A;  2CH4 W;  1TR5 A;  2B2T A;  1PTO H;  1WTH A;  1KLU D;  4MHE A;  2DJG C;  3I4M G;  5KND A;  3CD6 A;  2I0Q A;  1LT5 D;  4RWS C;  1U4P A;  5KRU A;  3PIO 3;  2RHS B;  1CI3 M;  2KED A;  3GD7 A;  3KFU A;  1VMC A;  3I70 A;  3CCR A;  3MAQ A;  3NTH A;  1B7Y B;  1UNS A;  1TWF B;  2WAQ B;  1YJW A;  1JB7 A;  4HR7 B;  2A5H A;  2C9O A;  3IAY A;  1WVL A;  2ATW A;  1D2B A;  1KNA A;  1TVX A;  4XQJ A;  1PXU A;  3OOC A;  4NXM Q;  5C44 H;  2GA4 B;  4CJ0 B;  3W2D A;  1E24 A;  3T51 B;  4DR2 Q;  3IL8 A;  1XYI A;  2F0F A;  1VQH A;  1STH A;  4YIJ A;  1DGS A;  3MFG A;  2I5M X;  1GJX A;  4C56 C;  3D0F A;  3K5L A;  5C4J H;  4ODG A;  2A69 D;  4CKE A;  2NTS A;  4XQN A;  1KDB A;  1ZYR D;  4HJ5 A;  2B63 G;  2L1B A;  1E1O A;  2AUK A;  4QF4 A;  3GTG H;  2Q2I A;  4X3U A;  1LTT D;  1WTV A;  3PO2 B;  4L6T B;  4RMF A;  3Q22 A;  1BBX C;  3VYR A;  3PO2 H;  1YIJ A;  1TWH H;  2NN6 I;  3RZO B;  4TRD A;  1UEA B;  3EA6 A;  1SNO A;  5CV9 A;  3F2C A;  1GOZ A;  4X66 L;  1KC8 C;  1I4R A;  4B3M Q;  4IUQ A;  1STA A;  2LMC B;  1CK1 A;  1FYC A;  1TWH B;  2ZTC A;  2JEB I;  2CWP A;  2VY3 A;  4CKB A;  1QNU A;  5LMN W;  4LF8 L;  1J5E Q;  3NEL A;  2IT1 A;  1X55 A;  1DYQ A;  2PMZ E;  5KYL A;  5FLM H;  2KHJ A;  1G6P A;  4DR5 L;  5M5X B;  2LS0 1;  3E9I A;  3LWE A;  4KTA A;  2KOL A;  2NVX B;  1BCP B;  4IJL A;  3ULP A;  4CJ2 C;  4JI8 Q;  1L0Y B;  2NVY B;  2YTY A;  3TZD A;  1XJV A;  4RH6 A;  3S2D B;  1S3O A;  3E9H A;  4Y52 H;  4LFC L;  4IFD I;  4X6A H;  3BG3 A;  1AZQ A;  4GS3 A;  2WV6 D;  4OON A;  2E75 C;  1Y8P B;  5T1I A;  1AP0 A;  3A7A B;  1RL2 A;  1MD2 D;  1AE3 A;  3NEM A;  1YIT A;  2K1B A;  2JN4 A;  5E7N A;  3RNU A;  1B3A A;  5I6W A;  2PZW A;  3FMC A;  1JWM D;  5D3I B;  5E4X A;  2DY8 A;  5JAV A;  3G6E A;  1B53 A;  3A7L A;  4JI6 L;  1VQN A;  1FJG L;  2MHV A;  3R93 A;  4B3S L;  1XTC D;  4AYB E;  3J81 E;  1UE7 A;  3K6O A;  5C4Z A;  3GTJ H;  2UUB L;  4QQB X;  1Q12 A;  1U9R A;  1D7Q A;  3PO3 G;  5JPN C;  1A0I A;  2VXW A;  4QUF A;  4WJW A;  1QUQ A;  1X3E A;  4JI4 Q;  1I3Q B;  1TKW B;  1ET9 A;  3E0J A;  1EYC A;  2K50 A;  1DOM A;  4KLK A;  4FF2 A;  2X6G A;  2MJ8 A;  4XT3 B;  3J81 L;  4F87 A;  2I07 B;  2DNE A;  1D1K A;  5GRO A;  2NVT B;  3OWE B;  1CKN B;  1TU2 B;  2AUJ D;  2RDF A;  2A68 D;  1XPU A;  2AWN A;  2ZTE A;  3OMG A;  4OWW B;  3ND8 A;  3TS2 A;  2F0V A;  4RGM A;  1SR3 A;  4LWC A;  4HAE A;  5ELB A;  4A3M H;  2ZM6 Q;  1WTR A;  1I6H H;  3GTP B;  2QDB A;  2F1M A;  3ULL A;  4DV5 L;  3BS1 A;  2EJF C;  4BY7 G;  4DR1 L;  4QIW E;  2OT2 A;  5JEA G;  2FXQ A;  4RCO A;  1ML0 D;  3H3V C;  1S5F D;  1RKN A;  1ICW A;  1K0R A;  3DM1 A;  1O7Y A;  3M4P A;  1R9T H;  3EQL C;  2X69 A;  4ID6 A;  3I8Z A;  1Y1V B;  2B8F A;  1A2U A;  3E0E A;  4U67 3;  4BBS G;  1STE A;  4XYO A;  2CW0 C;  2AQ2 B;  2J0T D;  1Q1E A;  3D4R A;  5COR A;  4IUR A;  1FD7 D;  5A2Q E;  2B39 A;  3P75 A;  2A73 B;  4ABN A;  3TDQ A;  2HHH Q;  4P2C B;  3JAM L;  1R4Q B;  3J81 c;  3HOU H;  4C2M H;  5I9P A;  1FGB D;  1OXX K;  1O78 A;  4ZRZ A;  1Q1B A;  1YBY A;  2RVL A;  1I50 H;  2V1C C;  3HOY B;  3KK7 A;  4MIU A;  4KKS A;  4BY1 H;  2B2V A;  1HNZ Q;  1EQV A;  2VQF L;  1KIX A;  2E2I B;  5C3E B;  3KBX A;  1PTO D;  1A3U A;  4A75 A;  3QOJ A;  3OIP A;  1SYF A;  4A3D H;  1ESR A;  2D0P A;  2RDG A;  3L9A X;  2Z1C A;  1EYD A;  4A3E G;  3OTO L;  1WTW A;  4LAA A;  4TVA B;  4B9X A;  1WD0 A;  5EBD A;  5IWA L;  4IN3 A;  1IL2 A;  4A3E B;  4IZ8 A;  5I4D A;  2RA4 A;  1EQQ A;  1C7Y A;  1I4P A;  3DEP A;  3QIA A;  1D5Z C;  2K04 A;  3RD4 A;  2OTL A;  3RZD H;  1K73 C;  2R93 G;  5EPK A;  1SND A;  1IBK Q;  3M4Q A;  3A5Z B;  4APV A;  3G71 A;  4IFD G;  2EIF A;  4LF6 Q;  3MC0 B;  1C48 A;  1KTK A;  3H0G H;  2JA8 H;  1GKH A;  4DV2 Q;  1B9M A;  2PQE A;  1J6Q A;  1JOK A;  2JK8 A;  2Z6K C;  1VQJ A;  3D4W A;  1U0L A;  4AQY Q;  3M7G A;  5EPL A;  1ROD A;  2N8N A;  3CMA A;  3RMH A;  2QEX A;  3D6C A;  4XQQ A;  3BZD B;  1TT2 A;  4LJZ C;  4RAU C;  3N6R A;  3AFQ A;  4IUU A;  5EAY A;  5JVH 3;  1S40 A;  2HCC A;  5IGG A;  4DV4 L;  1MSH A;  3RN2 A;  1PH1 A;  4KHP Q;  1LTR D;  2KHI A;  3FRP B;  3T4A C;  4KHP L;  5EQ0 A;  3GTP H;  3BZC A;  5CV6 A;  1HJP A;  3M4O H;  1H9M A;  1SLJ A;  1Z6H A;  1YJ9 A;  2F0M A;  3PIP 3;  1S5C D;  3SK8 A;  5JJI A;  2LKV A;  2TSS A;  3QJY A;  4FP5 D;  1VQA A;  3S1M B;  1V1O A;  3QWN A;  4DR5 Q;  1X3Q A;  1X6O A;  1I4G A;  2JXM B;  3QB3 A;  3Q24 A;  4EGV A;  4ZK9 B;  5A2Q L;  4FXK C;  4DUZ Q;  4I65 A;  3H3V I;  2K5Q A;  3KF6 A;  2F0J A;  4OWX B;  1TWA H;  4DAM A;  1EY8 A;  2OCE A;  1LAC A;  3J80 E;  2RF4 A;  2OF1 A;  4DUY Q;  1VDZ A;  1LTA D;  1VMP A;  3GTO H;  5EGT A;  1BCP D;  2IHF A;  1B50 A;  1NUC A;  4ZCK A;  3M4Y A;  4B3R L;  2IJ0 A;  2F0P A;  1QVG A;  1STN A;  2XWB B;  3SE0 A;  3NK9 A;  4V0B A;  1Y1W H;  3KJP A;  4A3K H;  1EL0 A;  1V8Q A;  3CPW A;  3CCM A;  4NB3 A;  1IYV A;  2Q8R E;  4AYB B;  4A3F G;  3S14 B;  4MTN A;  3P20 A;  3TME A;  4JI5 L;  4F8M A;  1LAB A;  1Y14 B;  4PMW A;  3KYH C;  2JA8 G;  4BBR B;  2F0G A;  2NVY H;  3I56 A;  1BCP C;  5BN5 A;  4A3J B;  5I2Y A;  2XVS A;  4NDX A;  2NVX H;  3OHX C;  5EKL A;  1XNR Q;  2CQO A;  4YY3 L;  2WKC A;  1CSQ A;  1NR2 A;  3AB9 A;  2EQS A;  4H44 C;  3E3X A;  4JI3 Q;  3X3N A;  2K75 A;  2B3G A;  3TSS A;  3VR6 A;  4FVM A;  5GAD C;  1IKL A;  1JJ2 A;  2FMC A;  3C3L A;  4C3H H;  1XNQ L;  3DEO A;  1VQ7 A;  2A74 C;  3K8A A;  3OTO Q;  4A3C G;  3BU2 A;  3F8T A;  1DOL A;  1HCZ A;  1JR0 D;  4X65 Q;  2WB1 G;  1K83 B;  1LV9 A;  1RD9 D;  3D8G A;  3HOV B;  4X3S A;  5C4J B;  2L4N A;  5KEE A;  1T9H A;  3AMU A;  1STB A;  4X62 L;  4L5T A;  1PFS A;  4RGO S;  1PZJ D;  2R92 H;  1AH9 A;  2L0C A;  1K0S A;  1GHK A;  1A2T A;  4K2K A;  2B2V C;  4G57 A;  1VQL A;  3D3R A;  3TN2 A;  3NE5 B;  3HKZ G;  5CR3 A;  1PH8 A;  1KNE A;  2UUC Q;  3CCL A;  3HOU B;  2LXK A;  4HCE A;  2AQ1 B;  1TWF H;  5C44 B;  1XNR L;  1QCB D;  3PV0 A;  1SNP A;  3LGJ A;  1OO9 B;  1B3Q A;  1NNX A;  4DR1 Q;  5J22 A;  3BJU A;  1HNZ L;  3RLN A;  3NWS A;  3VR5 A;  1ASZ A;  1YJN A;  1K8G A;  4AYB G;  2HIV A;  1WOC A;  2UXD L;  1EZ6 A;  1JCK B;  1E2V A;  4R8I A;  5DM7 3;  3UDG A;  4HTH A;  2O4X A;  2RSN A;  2KEC A;  3NEN A;  2MFI A;  1TS5 A;  4R4Q A;  4F7X A;  3MZ5 A;  1VF7 A;  1SJH D;  1NMF A;  1TWA B;  3U4Z A;  4K6D A;  1PH9 A;  2EY2 A;  4K2L A;  2G9D A;  2F0O A;  3HKZ E;  4YHH Q;  5M3F G;  2M9V A;  3A8J E;  3QOL A;  1Y69 U;  3K81 C;  1VQ6 A;  1S72 A;  3MEH A;  1GXD C;  1BKB A;  1PTO C;  1IYJ B;  2HDM A;  4OO1 H;  2Z9H A;  3W5O A;  3VR2 A;  1O7Z A;  1UUP A;  3ZJY C;  4CJ1 B;  4IUP A;  5JVG 3;  2JA6 G;  2A1A A;  3UDX A;  1R4P B;  2MQH A;  1F2Y A;  1PYS B;  3CC4 A;  1A3V A;  4POG A;  1PFN A;  1GUW A;  3TBI B;  1EIG A;  3I2Z A;  2EY5 A;  1UE5 A;  1IBL L;  4CDF C;  1U5K A;  1FJG Q;  2CQA A;  3J7A F;  4Q5V A;  2XIW A;  3EN2 A;  1KRS A;  2RKS A;  1JMC A;  3NQI A;  1C8C A;  1TWG H;  1O7L A;  4CGY B;  3S2D H;  4BBR G;  2QKI C;  4PZ6 A;  3SXH A;  1IBM Q;  1EWI A;  1VQE A;  1ZEQ X;  1TII D;  1Q8I A;  4EQN A;  5KYI A;  1M4V A;  2O2L D;  4C3I B;  3AYH B;  5H1S E;  2HQL A;  4L5R C;  1UAP A;  3FPU B;  5FOB B;  3FDT A;  1CA6 A;  3L3O C;  4OX9 Q;  4YY3 Q;  4KY6 A;  1EUJ A;  3A74 A;  4KMU C;  4FF3 A;  3NHH A;  4H02 A;  4IUN A;  2OXP A;  3GO5 A;  4LF9 L;  1HHV A;  3MXG A;  2EY1 A;  3C1E A;  3NTK A;  1OXS C;  5IT9 E;  1STG A;  1PH5 A;  2CFM A;  5JJL A;  2UXC Q;  4GN4 B;  4JBW A;  2F0U A;  2KCN A;  5IP9 H;  5FLX c;  4A3E H;  3S15 B;  1RTN A;  4V19 0;  5CMD A;  3K5O A;  1EEI D;  3FVQ A;  3VYU A;  1CSP A;  4U68 A;  4IAL A;  3S2H B;  1SNC A;  3DMU A;  2L15 A;  2LFN A;  1N34 L;  1VQK A;  3S2H H;  1N32 Q;  3HG9 A;  1VQO A;  4K0K L;  3MWY W;  2ZXP A;  1EU4 A;  2SNM A;  4BY7 H;  4A3D B;  4UP8 A;  5JEA H;  2A68 C;  1QIL A;  2TMP A;  1O7I A;  1L2F A;  2AWO A;  3GTG B;  1IW7 D;  4JBK A;  1BUV T;  2B2U A;  4DV2 L;  5JOB A;  1OTC A;  2Q2U A;  4GLA C;  1PA6 A;  1E2Z A;  3EVQ A;  1PH2 A;  2B63 H;  1F9R A;  2EYL A;  2K33 A;  3FEW X;  5AJ3 Q;  1PV4 A;  4ZQ3 A;  3ND9 A;  4CKC A;  4HED A;  3D6W A;  4ZAI A;  1IZ6 A;  1DOK A;  3H15 A;  4R4C A;  3J81 i;  2C35 B;  1BBU A;  1F9S A;  1LTS D;  4O1N A;  1LTL A;  1OXU A;  1T5X D;  2KVM A;  3IFD A;  1E1T A;  4RCN A;  1Y1W B;  4YCW A;  2VB3 X;  2K32 A;  1GD7 A;  1G29 1;  1WJJ A;  1DJR D;  2E5L Q;  1PTO F;  4CHT B;  2BA0 A;  3D31 A;  1X9N A;  1CM9 A;  5M9O A;  4YWM A;  5FLM G;  4PZ7 A;  5F2D A;  4LF7 L;  2M00 A;  2K03 A;  2FMM A;  2M2L A;  2VQF Q;  1HZA A;  4QL5 A;  2F0K A;  2K01 A;  4ZLT F;  5JPM C;  4GN3 B;  2KCT A;  1SE4 A;  2HUG A;  1YI2 A;  5E4W C;  4BS9 A;  1ZYR C;  3J80 i;  5IT9 L;  4KK7 A;  1GUO A;  5FLX E;  3HOX H;  2A6E C;  1I6H B;  5G3L D;  4DAV A;  4LNQ A;  1KXL A;  3K0X A;  4L5Q A;  4DV0 Q;  3KBG A;  5ELN A;  1LTI D;  3TP8 A;  1SAP A;  1QUQ B;  1EQR A;  2UUB Q;  1I5F A;  1NR4 A;  3M4O B;  4B3S Q;  3MHB A;  4IUV A;  1SNM A;  4QCL A;  4DV3 L;  3MEF A;  2L5T A;  1V1P A;  2EYJ A;  1SYE A;  3A54 A;  3PUX A;  2BDN A;  4JI4 L;  1XXG A;  3U9S A;  5M3F B;  3DLL A;  2K5V A;  3PO3 H;  4A93 B;  2AQ3 B;  3K57 A;  1X56 A;  4N8X 1;  2QIL A;  4DXF A;  2A6H D;  5COY A;  1O80 A;  1F2M A;  3PO2 G;  2ICI A;  2L12 A;  4WRD A;  1A63 A;  2EXZ A;  2F0N A;  2NZO A;  1EWH A;  1MJE A;  4TSS A;  2JE6 I;  4PV1 C;  2VNU D;  1KAB A;  2R7Z H;  1YNJ C;  3T1H L;  1RF2 D;  4QB4 A;  1RDP D;  2XSC A;  3WOF A;  3G6J B;  5L37 A;  2HQE A;  3I4O A;  3CCU A;  4OEL B;  1VF5 C;  4OEM B;  4RA8 A;  3H0G B;  3M85 A;  1E0B A;  1AEX A;  4N9P A;  4WFN 3;  3VA5 A;  4E6I A;  1PZK D;  4RFB A;  2F0I A;  2J7Z A;  1QG7 A;  1E2W A;  2PW7 A;  1EY4 A;  4DF7 A;  3I91 A;  3NP8 A;  5D65 A;  4HIM A;  4LFB Q;  4IUT A;  3M3Y B;  3LX0 A;  1SSO A;  4NKL A;  1VCI A;  5LL6 X;  1HNX L;  1IHZ A;  1SMX A;  1SNQ A;  1JOR A;  2A6E D;  3L7Z C;  2K6A A;  2DY7 A;  5C3E H;  1G2S A;  2MUY A;  1WCM B;  4BA1 I;  5C3X A;  3Q8D A;  4A3K G;  2H1E A;  3G4S A;  1CT1 D;  2N55 A;  4LF5 L;  4QUC A;  3L0O A;  5M5Y H;  2K5W A;  2O5J C;  2WFW A;  5AJ3 L;  1UEB A;  3E5S A;  5K5P A;  5IGC A;  3CCJ A;  2JSO A;  3M9B A;  5EPJ A;  3S16 H;  4UAI A;  2EY6 A;  1STY A;  1XPO A;  4NXN L;  1J9O A;  1LM0 A;  3KDF A;  2E76 C;  1YHQ A;  3I4N G;  1HXY D;  4NXN Q;  1TS4 A;  2ID0 A;  4BXX G;  4BBR H;  3MVV A;  4LF8 Q;  4BY1 G;  4C2M B;  4N8F A;  3IKJ A;  4M8A A;  4IOA A;  4UDU C;  2QEJ C;  3S1N B;  1S5B D;  1PH6 A;  1VQF A;  1N33 Q;  3BYT B;  3DWQ A;  2PI2 E;  4OGQ C;  1L1O A;  3OYY A;  1JJG A;  5IGF A;  4O42 A;  1WTQ A;  4HCS A;  3C46 A;  1I94 L;  4OIK A;  1H9J A;  1N34 Q;  1PTO B;  1KDA A;  1Q46 A;  5EJW A;  4DK6 C;  4EQO A;  3PIO A;  4EVO A;  4YWL A;  3GQB A;  3CU7 A;  1A62 A;  4GNX C;  3MXN A;  2K7V A;  2KEN A;  2EE1 A;  4GN5 A;  4DV6 L;  2R7Z G;  3H0G G;  1WCM H;  3CHB D;  4A93 G;  4P74 A;  4A3G G;  2E2J H;  4A3B G;  2B2Y A;  4WJ3 M;  1IL8 A;  4JV5 L;  5IE8 A;  1ILQ A;  3OIQ A;  2CW0 D;  1VQM A;  3R2I A;  2KUM A;  3PGZ A;  2K52 A;  4POF A;  1SJE D;  3OW2 A;  5JJZ A;  2Y0S G;  5DM6 3;  4OO1 G;  2MO1 A;  1E22 A;  3Q6S A;  3I4M B;  4DNI A;  2UXD Q;  3HOX B;  2KQ3 A;  1IYU A;  3DWP A;  4C3J H;  5C4X H;  1DCZ A;  4LFA L;  2EYH A;  2G9H D;  2KEE A;  4A76 A;  1QZH A;  2AKW B;  2JA6 H;  5C0X G;  5IWA Q;  1J5E L;  1SE8 A;  1SYD A;  5C6A A;  3I90 A;  1VQB A;  1NMG A;  2E5L L;  1PYB A;  1G91 A;  1GUG A;  1VQI A;  3IFT A;  2B2Y C;  4DPG A;  5IP7 H;  2MPM A;  5ELF A;  5C3E G;  1S5D D;  2EYF A;  2WB1 E;  4ZKB B;  5HGQ A;  4ILW A;  3G48 A;  5EBC A;  1NBW A;  2F0H A;  4GNX A;  2JA7 H;  4PMB A;  3GDE A;  3LWU A;  1EIY B;  2Z6B A;  1MJC A;  3BDL A;  1K3B C;  4RG1 A;  4C3H G;  5LMN Q;  4ALP A;  4OXP A;  4XIG S;  1D5X C;  2JA8 B;  1ENF A;  2VB2 X;  4A3K B;  1I6V C;  1EU3 A;  2XNA C;  4UP7 A;  4ZUJ A;  5C5L A;  2PQA B;  1PRT D;  3NPP A;  1W6J A;  3S17 B;  4LFA Q;  3VYT A;  3GTL H;  3KDF B;  2R92 B;  3CME A;  1JB3 A;  3NQT A;  1M1K C;  4XTC S;  1L0X B;  4JI7 Q;  1PDQ A;  5C4H A;  2O5I C;  2LSS A;  4DN4 M;  5CC4 A;  4DR6 L;  4A3F H;  4UY8 C;  4A4I A;  1MSG A;  4KY5 A;  4NMZ A;  3PIP A;  3DWA A;  2YYZ A;  5IYC G;  2R6G A;  1YNN C;  1K8O A;  2BH8 A;  3RZO H;  2PMZ B;  4LF7 Q;  1BQQ T;  1KAW A;  1PFB A;  2G5D A;  1SBB B;  4FNF A;  1SYC A;  3S1Q H;  5ELE A;  4KN4 C;  3SGI A;  4C3J B;  4H7B A;  1SFO B;  3NWT A;  1GM5 A;  3BDO A;  3HRZ C;  4DV3 Q;  4DAY B;  1EZ8 A;  4JI1 Q;  2RHQ B;  1MKH A;  5LL6 S;  2LXJ A;  4L5S A;  1OXV A;  3JAM c;  2K5D A;  3PMF A;  3H6M A;  5LMN L;  1XMO L;  2FJ2 A;  2WP8 J;  3CF5 A;  4JBM A;  4LFB L;  1G6Z A;  2F0W A;  1Y1V H;  3T13 A;  2D5D A;  5IYD H;  3MXP A;  1B9N A;  5IGD A;  3CXC A;  1CA5 A;  1IW7 C;  5IOC A;  3CC2 A;  3VDY A;  1SYB A;  3J7Y W;  2SDF A;  1PLF A;  3SR1 A;  4KHZ A;  2WB1 B;  2ZJR A;  5T1G A;  1HNX Q;  1Z9F A;  2Y0S E;  3H09 A;  3SK6 A;  1BNZ A;  3BVM A;  1K8A C;  2UUA Q;  3MA2 B;  1V43 A;  4GNX B;  1WD1 A;  3QR8 A;  4LK1 C;  4LFC Q;  4KN7 C;  4KY7 A;  4HJ8 A;  2WAQ G;  1YVC A;  1K3R A;  4XDX A;  2WAQ E;  4JV5 Q;  2RBM A;  1J8I A;  5IIF A;  1H9S A;  1F2Z A;  2VS1 A;  2NVT H;  4DA2 A;  2A6H C;  2EJG C;  1SE3 A;  3KLS A;  5FK9 C;  4X64 Q;  3L2P A;  5C3W A;  4WJ4 A;  1B2T A;  1BOS A;  2UXC L;  1EEF D;  2HT1 A;  1VQG A;  2KCC A;  5AFW A;  2RCF A;  2ZTD A;  1XPR A;  1B8A A;  3NXW A;  3FKI G;  3J81 j;  3J80 L;  3NSW A;  3TP7 A;  2IL8 A;  1KL9 A;  5J3B A;  4A3L H;  5LMU Q;  4JI0 L;  2R7D A;  1IBK L;  1WTX A;  3STB C;  1W2B A;  5M5W B;  4GKK Q;  1HR0 W;  1BDO A;  3QO2 A;  1FR3 A;  2GVA A;  4P73 A;  4K5X A;  3S17 H;  2WKD A;  4GOP A;  4B3T L;  4DXG A;  2PYK A;  2VUM B;  1EOV A;  4MTK A;  2K28 A;  4LUO A;  5C0X I;  2Y0S B;  4JK1 C;  4H0L C;  1TWC H;  3GTQ B;  5FO8 B;  4KV6 A;  4HJ7 A;  1Q7Y C;  2NBF A;  2YTX A;  4P71 A;  3T53 B;  2JEA I;  2HDL A;  1A15 A;  1G51 A;  2F0T A;  1DXM A;  5IT9 c;  3W3A A;  4KJO A;  4DR2 L;  2OTJ A;  2GN5 A;  2NN6 G;  1FVI A;  2R92 G;  4GOP C;  1NTG A;  2E8G A;  2HIX A;  2D9U A;  2DN8 A;  4CDE C;  4HMJ A;  1YEZ A;  3I4L A;  4DV4 Q;  5I6Y A;  2DGY A;  4GKJ Q;  2EYO A;  2F4V Q;  1LTG D;  3F1Z A;  3NBI A;  2YTV A;  1BXT A;  1C9O A;  2XRQ D;  1Y1V G;  2A19 A;  4YCV A;  5G3L F;  1RJT A;  4A3B H;  3CCE A;  3I7F A;  1JWU D;  2PZU A;  3ER0 A;  4BY7 B;  3R8B A;  5BN4 A;  4AQY L;  3V2T A;  4N9T A;  5HGT A;  3X3M A;  4L8J A;  2N3S A;  2L55 A;  2B29 A;  3HEJ A;  2MNA A;  1HFG A;  4C3I G;  3K5N A;  1BF4 A;  2I5H A;  3PUZ A;  3RN5 A;  3NBH A;  1AZP A;  3T1H Q;  1S4Z A;  4BBS B;  5C4X G;  4JOI A;  4KJN A;  1PH7 A;  1B1Z A;  4PNY A;  5A35 A;  4HSP A;  3HOY H;  4H13 C;  3H3V H;  2BE5 D;  4R4T A;  1UE6 A;  4IPG A;  1Q3L A;  4RKB A;  2ZJP A;  3VA7 A;  3TZU A;  3BVZ A;  1DD2 A;  4YCU A;  5M3M G;  1V1Q A;  4HN7 A;  2Z8L A;  3EIV A;  4RGN A;  2K4K A;  5K36 H;  2F4V L;  4X62 Q;  1N32 L;  4OO1 I;  2L11 A;  3KJO A;  2FHT A;  2JA5 G;  1TY2 A;  3HOW G;  1H95 A;  1QWY A;  3C2P A;  3F2U A;  1W6K A;  1N33 L;  4J8Q A;  4IJH A;  1M8A A;  4RGT A;  3CCS A;  3RUZ A;  4FXD A;  2PZT A;  3OMC A;  1MBY A;  4K0K Q;  4DK1 A;  1KHI A;  3U58 A;  4G4K A;  2EZV A;  1XMQ L;  1HUN A;  4FF4 A;  2F4I A;  2OWO A;  3K0Y A;  3S1N H;  3T56 B;  4A93 H;  4K8I A;  1YNN D;  3VYS A;  1PHJ A;  3B6Y A;  1TWG B;  2AHO B;  1TS3 A;  4LMQ D;  1N8R C;  1P16 A;  1CQV A;  4LW1 A;  3F2B A;  4L63 B;  1CQF A;  2NZ1 D;  2P5Z X;  1Y8N B;  3MFY A;  1JWS D;  4WOR A;  4A3G H;  1F2L A;  4JOI C;  1SMY C;  4JBJ A;  3MTS A;  4DV0 L;  5IYB G;  4QJF A;  1E7Z A;  4IPD A;  5FJ8 G;  3TQY A;  1VQ8 A;  2EPB A;  3AQQ A;  1QZG A;  2HHH L;  4JI5 Q;  1SRO A;  2EVB A;  3S15 H;  2F52 A;  4PG3 A;  4JCV E;  4CDC C;  5C0X J;  1VQ5 A;  2R61 A;  3HKZ B;  4B08 A;  4G7H C;  4JC0 A;  3HFZ B;  1ET6 A;  1QVC A;  1HUM A;  4P72 A;  5GAG C;  3O13 A;  1JQY D;  3K58 A;  4DKA C;  2IX3 A;  2ZM6 L;  4LF5 Q;  4FYD A;  1AE2 A;  2BDO A;  1KD1 C;  4DV6 Q;  5HY6 A;  3P7J A;  2L9H A;  4KKT A;  1DM0 B;  4MN3 A;  1FNW A;  1Z7T A;  3K59 A;  2NVQ H;  3A0J A;  1V9P A;  2R7Z B;  1NE3 A;  4DUY L;  4DR7 L;  1XNQ Q;  1P8L A;  3I4N B;  3S9W A;  1A3T A;  1IXR A;  3HOY G;  1W3S A;  5FJ8 H;  5D14 A;  4C3I H;  3GTM B;  4R1J A;  2D0O A;  2E2H H;  4NXM L;  4DAY A;  3IRB A;  3SDZ A;  2RCN A;  1PZI D;  5JJK A;  4PMC A;  4PZ8 A;  2AMC B;  2F0Q A;  5E1F A;  2BE5 C;  4JYA Q;  1ZXT A;  1QOH A;  3TP5 A;  3HOZ H;  4LF4 L;  4A3D G;  5I2X A;  5M3M B;  3Q0A A;  1UWV A;  1TS2 A;  2D2C C;  4EX5 A;  1MI2 A;  2VUM G;  1FNU A;  4K14 A;  5LMU L;  1JIC A;  4JI0 Q;  2VQE L;  3GTM H;  1BR9 A;  4A3I H;  2WIN B;  2NN6 H;  3I72 A;  2RQX A;  3RR5 A;  5IY0 A;  4DR3 L;  1WTP A;  1B44 D;  2Q8T A;  5CYU A;  1L1O B;  1XMQ Q;  4OWT B;  2K5H A;  1FGU A;  3LNN A;  2IY5 B;  2NZH A;  1K83 H;  2H4O A;  3K7A B;  1LYL A;  5C0X H;  1Q8K A;  4GOP B;  1EY7 A;  4ULL A;  2XRS D;  1U4L A;  5CGK A;  1VQ4 A;  2F0L A;  4DV1 L;  4AIM A;  1YHB A;  2F0E A;  4JYA L;  3CCQ A;  2V4D A;  1Q86 C;  3UE0 A;  1Q81 C;  1F9P A;  3A5U A;  3VR4 A;  4DGZ A;  2ICE C;  3TRE A;  1NJI C;  4K8J A;  1HR0 L;  1EQT A;  2SOB A;  1B4O A;  5IYB H;  1G2T A;  4KI0 A;  1TQO A;  3ICE A;  3CKI B;  4JW0 A;  3FPP A;  3U50 C;  4Y7N H;  1KQS A;  2PQA A;  2SNS A;  5DNF A;  3N52 A;  2FFK B;  1HFN A;  1ESF A;  3VR3 A;  2K14 A;  2XTI A;  5D3D A;  2UUA L;  5FKA C;  3A56 A;  3I73 A;  4GLX A;  3J7Z C;  1X54 A;  1PRT F;  3SEB A;  1N36 L;  5M5Y B;  5M5X H;  2F3I A;  2PW5 A;  3A8K E;  3T16 A;  5FLX L;  1EWC A;  3TEH B;  5DLQ E;  4UP9 A;  3ITP A;  4UPA A;  3JAM E;  2A8V A;  2B63 B;  1D1I A;  2BOS A;  3GP7 A;  2QW7 A;  4NW2 A;  2B2W C;  4F88 A;  1SEB D;  1SFO H;  2F03 A;  3RLF A;  4X3T A;  3HOV G;  1Q82 C;  3GTO B;  2F3V A;  3C1F A;  5E3F A;  4DFA A;  3DHQ A;  3FKI H;  2N88 A;  2ZXR A;  3CQZ H;  1PYW D;  1ILP A;  5I9O A;  2KHS A;  4J6H A;  4JPB W;  4A3B B;  3UDF A;  1SRU A;  4I7A A;  5FO7 B;  2KA7 A;  4GLV B;  3SK4 A;  2IHE A;  2VL6 A;  1SN8 A;  2CKZ B;  3HOZ G;  2UU9 L;  1XWE A;  2XGT A;  2EOT A;  4DK0 A;  2VQE Q;  1Y1W G;  3GTL B;  4A3F B;  2K05 A;  5BR8 L;  4LUV A;  1SE2 A;  4C1N I;  2EYP A;  3R2T A;  4KHV A;  3UE1 A;  2DNC A;  2ASB A;  4GZY C;  1RHP A;  2QCP X;  1LTB D;  3PSI A;  2F0D A;  4HIK A;  4LF9 Q;  2IX0 A;  1FNV A;  4P75 A;  1JJC B;  1HTL D;  1N36 Q;  3CP0 A;  3E6Z X;  3CRL C;  4XT1 B;  1AN8 A;  2OQK A;  2Z4I A;  4R4O A;  4JI3 L;  1E3P A;  5M3M H;  3OSO A;  4S3S A;  3DXJ C;  1CTM A;  1F9Q A;  4HJ9 A;  3NBH B;  1DZ1 A;  1HNW Q;  1JE5 A;  5ELO A;  3K7U C;  4G7Z C;  1QNK A;  2I5L X;  1HZB A;  1TXY A;  4KD3 A;  3AFP A;  1CUK A;  1X3P A;  3GTQ H;  5ELC A;  2JJQ A;  4FO2 A;  3R3O A;  1D8L A;  4OHJ A;  3HOW B;  2JA5 B;  1SYG A;  2I46 A;  1LT3 D;  1NY4 A;  4KD4 A;  2WAC A;  3PO3 B;  1CKM A;  3OWF A;  1VS0 A;  1TWC B;  3DM3 A;  3J80 c;  1A6X A;  4O2D A;  4DR3 Q;  4LUZ A;  5ELD A;  5M3F H;  3RZD B;  4HSV A;  1YNX A;  3H94 A;  3WDN A;  2JA7 G;  3ERQ A;  1B70 B;  4BA2 I;  5IP7 G;  3FKI B;  2B8G A;  3Q23 A;  1X3G A;  2XWJ B;  2Q8I B;  1X65 A;  1LUZ A;  1TY0 A;  1I3Q H;  4C3H B;  1GHJ A;  1KLG D;  1Q90 A;  4DAP A;  5CBE E;  2N78 A;  2JQO A;  2PCF B;  2E2J B;  2PI2 A;  3OPO A;  5FO9 B;  2K5N A;  1QJO A;  4A3J G;  3KUP A;  1MGS A;  1RCV D;  1JE4 A;  1F77 A;  4JI2 Q;  3CAM A;  1T5E A;  4HMI A;  4LF4 Q;  2B2W A;  1C4Q A;  1H9K A;  4GKK L;  2CH4 A;  2ZT9 C;  3GTK H;  1H9S B;  4IPC A;  5IYC H;  3I55 A;  5C5M A;  1GVP A;  5GQO A;  1EYG A;  3QG1 A;  1CKN A;  1WTO A;  4B3T Q;  1H9R A;  4R4I A;  3S1R B;  4Y7N B;  3GTK B;  1KRT A;  3P1H A;  2QF7 A;  3S14 H;  1K28 A;  2R7F A;  4RHR A;  2PNR C;  4C3J G;  3KLW A;  3HP3 A;  2QGQ A;  3S1R H;  1UE1 A;  1I4Q A;  2NB0 A;  1QB5 D;  4AH6 A;  3SVM A;  2QA4 A;  3F2D A;  1K9M C;  2ZJQ A;  2R93 B;  4CDD C;  1VQD A;  2HD3 A;  4DU9 A;  4HIO A;  2R3Z A;  1U4M A;  2B2U C;  3S16 B;  4MNO A;  4OIJ A;  1IKM A;  4J15 A;  1EOT A;  1NCV A;  4BBS H;  2KCM A;  5NUC A;  4YHH L;  1D5M C;  1EY9 A;  4DR6 Q;  4A3M B;  5EKI A;  4IOC A;  1IBM L;  4KKU A;  5DAU A;  5CV8 A;  2JYO A;  4IPH A;  5LHY 1;  2JA9 A;  3TRZ A;  2VZA A;  3EJI A;  2NYZ D;  4JVZ A;  1X3F A;  4MZ9 A;  1HPC A;  3D4D A; 
#chains in the Genus database with same CATH homology
 4R4C A;  2DGY A;  3J81 i;  4DV5 L;  2F4V Q;  3STB D;  4BY7 G;  2C35 B;  3F1Z A;  4DR1 L;  1BBU A;  4QIW E;  2YTV A;  1C9O A;  5JEA G;  1Y1V G;  2FXQ A;  2A19 A;  1LTL A;  1OXU A;  2BH2 A;  4YCV A;  3T1Y Q;  3U4V A;  1E1T A;  4DV5 Q;  1K0R A;  4A3B H;  3CCE A;  3M4P A;  1R9T H;  3I7F A;  4YCW A;  3ER0 A;  3W1B A;  4AQY L;  1GD7 A;  1G29 1;  1RIP A;  2JA5 H;  1WJJ A;  2VW9 A;  3HOW H;  2E5L Q;  3E0E A;  2N3S A;  4BBS G;  2IX1 A;  2BA0 A;  3D31 A;  1X9N A;  3J7A 5;  2B29 A;  2MNA A;  1Q1E A;  4YWM A;  5FLM G;  4FDB A;  2I5H A;  3PUZ A;  3RN5 A;  4PZ7 A;  4LF7 L;  2VQF Q;  3T1H Q;  1WYD A;  1HZA A;  3PCO B;  4QL5 A;  2HHH Q;  4GN3 B;  5C4X G;  4JOI A;  4QGU A;  1PH7 A;  3J81 c;  2KCT A;  3HOU H;  4A3J H;  4C2M H;  1YI2 A;  3HOY H;  3J80 i;  1OXX K;  1Q1B A;  4DR4 L;  3H3V H;  1YBY A;  3HOX H;  3M7N A;  1PVO A;  1I50 H;  1OXT A;  2V1C C;  4R4T A;  1UE6 A;  4IPG A;  4LNQ A;  3BZK A;  3I4N H;  3K0X A;  2ZJP A;  4L5Q A;  4DV0 Q;  4BXX H;  1KXL A;  2ALY B;  5ELN A;  3CW2 C;  1QUQ B;  1EQR A;  4BY1 H;  4YCU A;  5M3M G;  1V1Q A;  2UUB Q;  1I5F A;  1HNZ Q;  2VUM H;  3EIV A;  2VQF L;  2K4K A;  1KIX A;  2F4V L;  4X62 Q;  4B3S Q;  4OO1 I;  4GKJ L;  1N32 L;  3KJO A;  2JA5 G;  4DV3 L;  3HOW G;  1ASY A;  1H95 A;  4A75 A;  3MEF A;  4A3D H;  4HJA A;  2D0P A;  1N33 L;  2Z6K A;  3PUX A;  4IJH A;  1BBW A;  4JI4 L;  1N9W A;  3CCS A;  4A3E G;  1WI5 A;  3PF4 A;  3OTO L;  3ERS X;  4TVA B;  4O0A A;  4K0K Q;  3DLL A;  5IWA L;  2K5V A;  4EQ5 A;  1KHI A;  1IL2 A;  3PO3 H;  3U58 A;  1XMQ L;  1X56 A;  2OWO A;  3S1N H;  1EQQ A;  3HOX G;  1WCM G;  1C7Y A;  4A93 H;  2MO0 A;  1PHJ A;  2D62 A;  2OTL A;  3AEV A;  3B6Y A;  2AHO B;  3RZD H;  1K73 C;  2R93 G;  3PO2 G;  1BVS A;  1A63 A;  1N8R C;  1P16 A;  4LW1 A;  3F2B A;  3M4Q A;  3A5Z B;  2NZO A;  4APV A;  3G71 A;  1IBK Q;  4IFD G;  2EIF A;  1MJE A;  2JE6 I;  4LF6 Q;  5K36 G;  2EXD A;  2VNU D;  2R7Z H;  3H0G H;  2JA8 H;  3T1H L;  4A3G H;  1GKH A;  4JOI C;  1I94 Q;  4JBJ A;  4DV2 Q;  4DV0 L;  5IYB G;  1J6Q A;  3I4O A;  3CCU A;  4QJF A;  3S1M H;  2JK8 A;  2Z6K C;  1E7Z A;  1WFQ A;  1VQJ A;  4DUZ L;  2UUC L;  1U0L A;  4AQY Q;  3JC6 6;  3M85 A;  1XTD A;  3FHW A;  4IPD A;  4NPS A;  3TQY A;  5FJ8 G;  1VQ8 A;  2N8N A;  2ES2 A;  2CCZ A;  3CMA A;  3AQQ A;  1QZG A;  2QEX A;  2HHH L;  3PUW A;  4JI5 Q;  1SRO A;  3PUY A;  4A3M G;  3S15 H;  2F52 A;  4PG3 A;  4JCV E;  3AFQ A;  5C0X J;  1VQ5 A;  5EAY A;  4DR7 Q;  1L1O C;  1S40 A;  4JC0 A;  3HFZ B;  4JI8 L;  1QVC A;  4DV4 L;  1HH2 P;  4P72 A;  4A93 G;  5GAG C;  1YHA A;  4OX9 L;  4IO9 A;  3KF8 B;  3RN2 A;  1PH1 A;  4KHP Q;  4A3C H;  4HIM A;  4LFB Q;  4DKA C;  2KHI A;  2ZM6 L;  4LF5 Q;  1AE2 A;  1KD1 C;  3JAM i;  4KHP L;  3GTP H;  2N49 A;  4X65 L;  3BZC A;  1VCI A;  5HY6 A;  4X66 Q;  4DV6 Q;  1HNX L;  1Z47 A;  2Q2H A;  5IP9 G;  1SMX A;  5GAH C;  1HJP A;  3M4O H;  1SLJ A;  4YWK A;  2NVQ H;  1YJ9 A;  3A0J A;  1V9P A;  1NE3 A;  3L7Z C;  4DUY L;  4DR7 L;  1XNQ Q;  1P8L A;  5C3E H;  1IXR A;  3HOY G;  1W3S A;  5FJ8 H;  4JI2 L;  4BA1 I;  5JJI A;  4C3I H;  4R1J A;  2D0O A;  4JI6 Q;  1HNW L;  3Q8D A;  4A3K G;  1JT8 A;  3G4S A;  1VQA A;  3HKS A;  5IYD G;  3CCV A;  3CPF A;  2E2H H;  4LF6 L;  4LF5 L;  1EIF A;  3L0O A;  5M5Y H;  4DR5 Q;  1X6O A;  3IRB A;  4NXM L;  3UDI A;  2RCN A;  3W1G A;  2WFW A;  5AJ3 L;  4GKJ Q;  4DUZ Q;  5JJK A;  3S24 A;  3HOU G;  1UEB A;  3H3V I;  3CCJ A;  3HOV H;  4PZ8 A;  2AMC B;  3KF6 A;  3M9B A;  3S16 H;  4OWX B;  4JYA Q;  1MIU A;  4TQU S;  4NXN L;  1XPO A;  1TWA H;  3K7A H;  3HOZ H;  4DAM A;  2OCE A;  4LF4 L;  1LM0 A;  4A3D G;  3KDF A;  3RLO A;  1YHQ A;  3I4N G;  2RF4 A;  4NXN Q;  4BXX G;  2ID0 A;  3CC7 A;  4BBR H;  4DUY Q;  1UWV A;  4LF8 Q;  3GTO H;  4BY1 G;  4EX5 A;  2VUM G;  5JEA J;  2IHF A;  3MXN B;  4IOA A;  5BR8 Q;  4JG2 A;  4B3R L;  1QVG A;  5LMU L;  1PH6 A;  4JI0 Q;  1CKO A;  2VQE L;  2Q2T A;  3GTM H;  1FL0 A;  1VQF A;  1N33 Q;  2YU9 H;  4A3I H;  3M3Y H;  2DUD A;  2E2I H;  2PI2 E;  3RR5 A;  4HID A;  1L1O A;  3OYY A;  5IY0 A;  4DR3 L;  1JJG A;  1Y1W H;  3KJP A;  4A3K H;  1IBL Q;  1I94 L;  1XMQ Q;  1L1O B;  3CPW A;  3CCM A;  4OWT B;  1PH4 A;  1N34 Q;  4NB3 A;  1Q46 A;  4DK6 C;  5GAE C;  2K5H A;  4A3F G;  1FGU A;  3PIO A;  4YWL A;  4MTN A;  2IY5 B;  2NZH A;  1A62 A;  1K83 H;  4X64 L;  4GNX C;  1LYL A;  4JI5 L;  2KEN A;  4GN5 A;  1Y14 B;  4DV6 L;  4PMW A;  2R7Z G;  4B3R Q;  3H0G G;  1Q8K A;  3KYH C;  4GOP B;  2NVY H;  4JI7 L;  2JA8 G;  1WCM H;  3I56 A;  2BA1 A;  2KBN A;  4P74 A;  3ULJ A;  1QVF A;  4A3G G;  2E2J H;  4A3B G;  4BBS H;  2R93 H;  3PF5 A;  4WJ3 M;  1VQ4 A;  1EFW A;  4JV5 L;  4DV1 L;  5IE8 A;  5C44 G;  4DV7 Q;  3KF6 B;  4AIM A;  1C0A A;  1YHB A;  1VQM A;  4A3L G;  3PGZ A;  4JYA L;  3WWV A;  1HZC A;  2K52 A;  3CCQ A;  2NVX H;  4POF A;  3UE0 A;  2CWA A;  3A5U A;  1Q81 C;  1Q86 C;  3OW2 A;  1XNR Q;  2UXB L;  4A3I G;  4QY7 A;  3TRE A;  1NJI C;  2CQO A;  4YY3 L;  3PUV A;  1HR0 L;  2Y0S G;  1CSQ A;  4OO1 G;  1HZ9 A;  2MO1 A;  1E22 A;  2OQ0 A;  5IYB H;  2EQS A;  4DNI A;  3KOJ A;  4KI0 A;  1VQP A;  2UU9 Q;  4JI3 Q;  2UXD Q;  3ICE A;  2K75 A;  4C3J H;  2B3G A;  5C4X H;  5GAD C;  4LFA L;  3U50 C;  1L0W A;  4A76 A;  1JJ2 A;  1QZH A;  2AKW B;  2JA6 H;  4Y7N H;  5C0X G;  4C3H H;  1XNQ L;  1KQS A;  5IWA Q;  2PQA A;  1J5E L;  1VQ7 A;  1SE8 A;  3K8A A;  4A3C G;  3OTO Q;  3BU2 A;  3F8T A;  5M5W H;  4ME3 A;  1VQB A;  4JI1 L;  2K14 A;  2GVB A;  1NMG A;  4X65 Q;  2PNH A;  2XTI A;  2E5L L;  2UUA L;  2WB1 G;  4GLX A;  3J7Z C;  1PYB A;  1X54 A;  4B3M L;  1VQI A;  1VQC A;  3EBE A;  1T9H A;  4DPG A;  5IP7 H;  1XMO Q;  5C3E G;  1N36 L;  4X62 L;  2WB1 E;  5M5X H;  2F3I A;  5HGQ A;  4L5T A;  1PFS A;  3I4M H;  2R92 H;  3G48 A;  1VQ9 A;  1AH9 A;  1NBW A;  3TEH B;  5DLQ E;  4UP9 A;  4GNX A;  2JA7 H;  3GDE A;  1EIY B;  4UPA A;  4DV7 L;  1PH3 A;  2A8V A;  4DV1 Q;  1M90 C;  1MJC A;  4DR4 Q;  1SFO H;  4IFD J;  3RLF A;  1VQL A;  3HOV G;  3TS0 A;  1Q82 C;  3FP9 A;  3HKZ G;  4RG1 A;  1PH8 A;  2UUC Q;  3CCL A;  2H5X A;  2LXK A;  1HR0 Q;  1A8V A;  2Z0S A;  5LMN Q;  1TWF H;  4OXP A;  3K80 C;  4ALP A;  3T1Y L;  3FKI H;  1XNR L;  2UXB Q;  4XIG S;  3PV0 A;  3CQZ H;  2YV5 A;  4DK3 C;  1GO3 E;  1YZ6 A;  3LGJ A;  3UDF A;  4DR1 Q;  3BJU A;  4UP7 A;  3RLN A;  1SRU A;  1HNZ L;  1ASZ A;  4GLV B;  2PQA B;  1YJN A;  1K8G A;  4AYB G;  4LFA Q;  3GTL H;  2IHE A;  2VL6 A;  1SN8 A;  2CKZ B;  3KDF B;  2HIV A;  3CME A;  1M1K C;  3HOZ G;  1WOC A;  2UU9 L;  2UXD L;  4XTC S;  3I4M G;  2XGT A;  4JI7 Q;  3CD6 A;  2I0Q A;  1Y1W G;  2VQE Q;  3UDG A;  5BR8 L;  2LSS A;  4LUV A;  4DR6 L;  2RHS B;  3GD7 A;  4A3F H;  4UY8 C;  4A4I A;  3KFU A;  3PIP A;  3UE1 A;  3NEN A;  2YYZ A;  5IYC G;  2R6G A;  2ASB A;  3CCR A;  2MFI A;  2BH8 A;  3RZO H;  1B7Y B;  1YJW A;  4R4Q A;  3PSI A;  4HIK A;  1JB7 A;  4LF7 Q;  4LF9 Q;  2IX0 A;  1KAW A;  4P75 A;  1JJC B;  3S1Q H;  2ATW A;  1N36 Q;  1NMF A;  3SGI A;  3CP0 A;  3U4Z A;  2OQK A;  4R4O A;  4JI3 L;  5M3M H;  1E3P A;  1GM5 A;  4NXM Q;  5C44 H;  1PH9 A;  4YHH Q;  3HKZ E;  4DV3 Q;  3NBH B;  4DAY B;  5M3F G;  4HJ9 A;  1HNW Q;  4JI1 Q;  1E24 A;  1JE5 A;  5ELO A;  4DR2 Q;  2RHQ B;  3K81 C;  3K7U C;  1MKH A;  1VQ6 A;  1S72 A;  2LXJ A;  4L5S A;  1BKB A;  1OXV A;  1VQH A;  1IYJ B;  2I5L X;  3JAM c;  1HZB A;  1TXY A;  1DGS A;  3W5O A;  2I5M X;  3D0F A;  3AFP A;  3ZJY C;  5C4J H;  1CUK A;  5LMN L;  1XMO L;  2WP8 J;  3GTQ H;  4HJ5 A;  2B63 G;  2JA6 G;  2A1A A;  3UDX A;  3CF5 A;  2MQH A;  1E1O A;  3GTG H;  4JBM A;  4LFB L;  1PYS B;  2JJQ A;  3CC4 A;  4POG A;  2Q2I A;  1D8L A;  1Y1V H;  5IYD H;  3CXC A;  4RMF A;  1NY4 A;  3I2Z A;  1UE5 A;  1CKM A;  1IBL L;  1VS0 A;  3DM3 A;  3J80 c;  1U5K A;  1FJG Q;  3CC2 A;  1YIJ A;  3PO2 H;  1TWH H;  4O2D A;  4DR3 Q;  3VDY A;  4LUZ A;  2NN6 I;  3EN2 A;  4KHZ A;  2ZJR A;  1KRS A;  1JMC A;  3F2C A;  4X66 L;  5M3F H;  1Z9F A;  1TWG H;  2Y0S E;  1KC8 C;  1HNX Q;  4B3M Q;  3S2D H;  1YNX A;  1K8A C;  2UUA Q;  4BBR G;  4PZ6 A;  1V43 A;  4GNX B;  2ZTC A;  2JA7 G;  2JEB I;  1IBM Q;  1EWI A;  1VQE A;  2CWP A;  2VY3 A;  4LFC Q;  1B70 B;  4BA2 I;  5LMN W;  4LF8 L;  1J5E Q;  4HJ8 A;  3NEL A;  2WAQ G;  5IP7 G;  3AYH B;  1YVC A;  1X3G A;  2IT1 A;  1K3R A;  1X55 A;  2HQL A;  2PMZ E;  2WAQ E;  5H1S E;  1X65 A;  4L5R C;  4JV5 Q;  5FLM H;  2KHJ A;  1LUZ A;  1G6P A;  1I3Q H;  4DR5 L;  2VS1 A;  3E9I A;  2NVT H;  2N78 A;  2JQO A;  4OX9 Q;  4YY3 Q;  1EUJ A;  3A74 A;  2PI2 A;  4IJL A;  4X64 Q;  3L2P A;  3ULP A;  4WJ4 A;  2K5N A;  4JI8 Q;  4A3J G;  2YTY A;  1XJV A;  2UXC L;  2HT1 A;  1S3O A;  4H02 A;  3E9H A;  1VQG A;  4Y52 H;  3GO5 A;  3CAM A;  4JI2 Q;  4LF9 L;  2ZTD A;  4LFC L;  1XPR A;  1PH5 A;  4LF4 Q;  4IFD I;  1B8A A;  1OXS C;  4X6A H;  3FKI G;  4GS3 A;  3J81 j;  2CFM A;  4OON A;  5JJL A;  2UXC Q;  4GN4 B;  1KL9 A;  4JBW A;  4GKK L;  5IP9 H;  5FLX c;  4A3E H;  1RL2 A;  1AE3 A;  3GTK H;  3NEM A;  5J3B A;  1YIT A;  4A3L H;  5LMU Q;  4JI0 L;  2R7D A;  1IBK L;  5E7N A;  4IPC A;  3RNU A;  5IYC H;  3STB C;  1W2B A;  3I55 A;  1CSP A;  1GVP A;  5GQO A;  1EYG A;  4GKK Q;  1HR0 W;  1CKN A;  4B3T Q;  3G6E A;  1VQN A;  4JI6 L;  2GVA A;  1FJG L;  2L15 A;  4R4I A;  4P73 A;  1N34 L;  4B3S L;  1VQK A;  3S2H H;  1KRT A;  1N32 Q;  4AYB E;  1UE7 A;  3GTJ H;  3S14 H;  2R7F A;  3S17 H;  2UUB L;  4QQB X;  1VQO A;  1Q12 A;  4GOP A;  4B3T L;  4K0K L;  1D7Q A;  3KLW A;  3PO3 G;  1EOV A;  4BY7 H;  1A0I A;  1QUQ A;  4LUO A;  2QGQ A;  3S1R H;  1X3E A;  4UP8 A;  5C0X I;  4JI4 Q;  1O7I A;  1UE1 A;  1L2F A;  2AWO A;  2K50 A;  4KLK A;  4AH6 A;  2QA4 A;  3F2D A;  1K9M C;  2ZJQ A;  1VQD A;  4HIO A;  1TWC H;  4JBK A;  5GRO A;  4DV2 L;  4HJ7 A;  4MNO A;  1Q7Y C;  1CKN B;  2YTX A;  1OTC A;  2Q2U A;  4GLA C;  4J15 A;  4P71 A;  1PA6 A;  2JEA I;  1XPU A;  2AWN A;  2ZTE A;  4DV4 Q;  1G51 A;  2KCM A;  4YHH L;  1PH2 A;  4OWW B;  2B63 H;  5IT9 c;  3TS2 A;  1SR3 A;  4DR6 Q;  2OTJ A;  4DR2 L;  4IOC A;  2GN5 A;  1PV4 A;  4LWC A;  2NN6 G;  1FVI A;  5AJ3 Q;  1IBM L;  2R92 G;  4GOP C;  4IPH A;  4A3M H;  2JA9 A;  1NTG A;  2E8G A;  2ZM6 Q;  1I6H H;  2HIX A;  3TRZ A;  2VZA A;  1IZ6 A;  1X3F A;  4MZ9 A;  1YEZ A;  3ULL A;  3H15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...