4B3ML

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mL00
1QUQB 4HJ5A 4DR7L 4QY7A 4ME3A 4B3RQ 4AYBE 4IOCA 4PG3A 3J80c 2UXDL 1UE7A 3HOZG 3KF6B 2JK8A 4BBRH 3AFPA 4YCUA 1B7YB 2NVYH 5C0XG 3U4VA 1L1OA 5C4JH 4Y52H 3EBEA 3GD7A 1XJVA 2CWPA 2F4VL 2PNHA 4DR7Q 3OTOL 1N8RC 2JA5G 2HT1A 4C3IH 4AYBG 3AYHB 2F52A 1L2FA 1NY4A 1WFQA 2FXQA 1J5EL 2WP8J 3OTOQ 1N36L 1PH5A 1VQAA 2Q2UA 2VUMG 5IE8A 1VQOA 5JJLA 5JJIA 3ER0A 2DUDA 5IP9H 3A5UA 5IWAL 2Z6KC 4B3TL 2JA6H 3I56A 4LNQA 1K73C 2R93H 1HZ9A 3BU2A 2UUAL 4DV6L 1WCMG 1IBLL 1MJEA 4NB3A 2B63H 4B3RL 4X6AH 3PO2H 4DUYQ 2VL6A 2KHIA 2K4KA 1XTDA 3WWVA 2JA8H 1JB7A 2AHOB 1OXTA 1S3OA 2D62A 3HOWH 2OQKA 2IX0A 4JOIC 4JBKA 1N9WA 2JEBI 4JBWA 4L5RC 3BJUA 3S2HH 2JA7H 3G4SA 5IYCH 2XTIA 4GN5A 3M4QA 2R92H 1P16A 4KI0A 1HH2P 2KENA 2R92G 1EQQA 1X65A 4DNIA 1VQKA 4BY7G 4LFBQ 4DV4L 1VQHA 4KHPL 3NELA 4P73A 1C9OA 1J5EQ 3PF4A 4IJHA 4JCVE 3CXCA 1B8AA 3I55A 1C7YA 2GVBA 3H3VH 1GM5A 2WB1G 1KC8C 3CCRA 4HIMA 3VDYA 4IPHA 1VQ5A 3JC66 5FJ8G 3FKIH 2ZTCA 3Q8DA 4A4IA 1KRTA 5LMNQ 4GKKL 2VUMH 1VQBA 5GADC 4MNOA 1SN8A 2AWOA 3PCOB 1Z47A 5IT9c 2PQAA 5C44H 3J7ZC 1E7ZA 5JEAJ 3STBC 3PIPA 2WB1E 3DLLA 4GLXA 3T1YL 1Q86C 5IYDH 4GN3B 4B3MQ 2L15A 4A3FG 3L7ZC 5LMUL 3NBHB 3BZCA 1TWGH 4O2DA 1HZBA 3OYYA 3ULJA 1E24A 5AJ3Q 3CF5A 3PF5A 1VQLA 2ES2A 4PZ7A 3E0EA 2HHHQ 3S1NH 3AQQA 1J6QA 2OCEA 3HOXG 3A74A 5AJ3L 2Z0SA 3G48A 4WJ3M 3TS0A 3M85A 4GOPB 1Y1WG 3HOUG 4A3KG 3RLOA 1OXSC 1VQJA 3F2CA 3FP9A 1CKOA 5IYCG 2RHSB 4DV3Q 3PUZA 4P74A 1Y1WH 1PH2A 2OTLA 1U0LA 3HOUH 1H95A 1XNRL 1PH8A 4UP8A 4LFBL 1PH7A 4BA1I 3M9BA 4J15A 2R7DA 5IYBH 2VQEQ 1KIXA 4LF4Q 1I50H 2ZTEA 1M90C 4NXNQ 1I6HH 1QUQA 4DV1L 1VQIA 4JYAL 1MKHA 1YEZA 4NXNL 3I4NH 3UDGA 1KD1C 4JI2L 1TXYA 4LF4L 3F8TA 1SR3A 1U5KA 4A3JG 2C35B 2MFIA 2UUBL 1XNRQ 3W1GA 2JEAI 1VCIA 1X3FA 1Q7YC 2GN5A 3CC7A 2E2HH 1YHBA 3GTOH 4TVAB 4DK6C 3TREA 1N36Q 4NPSA 3CW2C 2VNUD 4A3CG 2WAQG 5LMUQ 4DR3Q 1G6PA 2ZM6L 3TQYA 3J81c 3CCLA 1S40A 3MEFA 5C3EG 1I5FA 4GNXB 4DV6Q 1I3QH 1HNZL 4GS3A 1UWVA 1T9HA 1PH6A 2NVQH 2CFMA 4OWXB 1PH4A 3M3YH 5M3FG 3STBD 4NXML 2UU9Q 2CKZB 1JE5A 4LFCL 1VQFA 1W2BA 3S15H 2RF4A 2A1AA 4WJ4A 4FDBA 4LF9Q 2D0OA 5DLQE 1EYGA 3GTQH 2QA4A 1PH1A 3PO3G 1Y1VH 3M4PA 2I0QA 1JMCA 4OX9Q 2WFWA 3LGJA 4DV4Q 5HGQA 4A3LH 1PFSA 4LW1A 3W1BA 5BR8Q 2MNAA 1UE5A 1X3EA 5FLMH 2Y0SE 5GAHC 4DR6L 5FLMG 4L5QA 3TRZA 2IHEA 4OWWB 1K9MC 5M5YH 1FGUA 4DR1L 1E3PA 4IFDJ 4HJAA 1PH3A 1PYSB 4X66L 2JJQA 1PHJA 3S24A 2ZJPA 1B70B 3FKIG 1HZAA 1OTCA 3FHWA 1Q1BA 2K75A 1SFOH 1HR0W 1CKNB 3T1HQ 4POFA 4QL5A 1VQ9A 1CSPA 2OTJA 4A3GG 4OXPA 2VY3A 4GKJQ 2ZTDA 4QJFA 3CCQA 2N78A 1YIJA 1V43A 5JEAG 3AFQA 1DGSA 1BBUA 1HNXL 2I5LX 3HOWG 1ASZA 1HNWL 3A5ZB 4ALPA 4R4QA 2ID0A 2R7FA 1NBWA 2ZJRA 2UUCQ 3S1QH 5BR8L 4BXXG 1FL0A 4JYAQ 1VQMA 3UDXA 4LF5Q 3JAMc 2KCTA 2I5MX 2K5VA 4MZ9A 4QGUA 4HIOA 3KYHC 1PA6A 3GTGH 3HOYH 3S2DH 1K3RA 3T1YQ 1IBKL 1LTLA 1O7IA 1ASYA 4LF5L 1W3SA 3NEMA 3CCEA 3CCSA 1HNWQ 3G6EA 1CUKA 2Q2HA 4JI4L 4P72A 1EOVA 4DV7Q 1RIPA 3NENA 3B6YA 3GO5A 2NZOA 3KFUA 4K0KQ 1N32Q 4XTCS 1YJ9A 3PUXA 4HIKA 1NE3A 2EQSA 4GNXA 4XIGS 1VQEA 4JI1Q 2MO0A 2CCZA 3JAMi 4B3SL 1D7QA 1XMQQ 4JI4Q 2JA6G 1A8VA 1YITA 1GVPA 5FJ8H 2ASBA 1XNQQ 3I7FA 2UXDQ 1EIFA 4A93G 1Q82C 3PGZA 2PQAB 5M3MH 3GTJH 2RCNA 3S1RH 1NMGA 1VQGA 3U58A 2R7ZH 3H0GG 4IFDI 2UUCL 1WCMH 5IYDG 4DPGA 5LMNL 3K80C 2MQHA 4DV1Q 3D0FA 1OXVA 1HNXQ 3KJPA 1XPRA 4L5SA 2NN6G 3CPFA 4DR6Q 3GTLH 4BBSG 4HJ7A 4JV5L 3PUYA 1HZCA 1SROA 1VS0A 1BKBA 4OX9L 2PMZE 1L0WA 1IBML 5HY6A 1A0IA 1R9TH 1YVCA 1WYDA 1JJCB 5C4XH 3H15A 1AH9A 2UXCL 3L0OA 4EQ5A 3TEHB 3EN2A 4AH6A 3RLNA 2N3SA 1EUJA 1QVGA 4P71A 1VQ7A 4NXMQ 4DKAC 5IP7H 4A3IG 3U4ZA 3AEVA 1HJPA 3HKSA 3CCMA 3CPWA 1L1OB 4JBJA 4B3SQ 4A3BH 4DR4L 4DAMA 3J81i 1NMFA 2NVXH 4A3JH 2AKWB 4A3FH 4LF6L 3ICEA 1A62A 4DV2Q 3ZJYC 5GAGC 2B29A 3J80i 5ELNA 2LXKA 4DUZQ 4JV5Q 2IHFA 4YCWA 3ULPA 2NVTH 1PVOA 4A3MG 3EIVA 4AQYL 4A3CH 3KF6A 4A3MH 1SRUA 2KCMA 3UDIA 4IFDG 2JQOA 4LUVA 5IYBG 1C0AA 4YWLA 4R4IA 4DV5L 2E5LQ 3CC4A 3HKZG 4LF8L 4JI8Q 3G71A 2VQEL 1BBWA 4DV5Q 2E5LL 3GTPH 4Y7NH 1QZGA 2LSSA 4RMFA 1IBMQ 3I4NG 1YHAA 2JA9A 2V1CC 4APVA 2AWNA 2DGYA 1OXUA 4YWKA 2Q2TA 4RG1A 4BY1H 4JI7Q 4JI1L 1IXRA 2YV5A 5K36G 4JI2Q 1EIYB 3F2DA 1VQ8A 2A8VA 5GROA 4LF6Q 4LUZA 5C44G 2HQLA 5M5WH 2Z6KA 3I2ZA 1IZ6A 4IPCA 2KBNA 1QVFA 4A76A 4DR4Q 1N32L 5EAYA 4JBMA 3RR5A 1Y14B 4P75A 3CP0A 4DR1Q 3OW2A 4JI8L 1IL2A 4POGA 1GD7A 4JI0Q 1UE1A 1YBYA 2R6GA 3PV0A 1YNXA 1EQRA 1X54A 3CCVA 4JOIA 4QQBX 2QEXA 1HR0L 1I94L 2UXBQ 2E8GA 3E9IA 4H02A 2YU9H 4GKKQ 2BH8A 3HKZE 4X62L 3BZKA 4UP9A 4A3EH 4JI6Q 4JI0L 3RZOH 3HOVG 4A3EG 4TQUS 3GTKH 3M7NA 4IOAA 3IRBA 5ELOA 3S1MH 4LFCQ 4K0KL 1EFWA 3CMEA 2PI2E 4X62Q 2NN6I 2VZAA 2R93G 2WAQE 2AMCB 1AE3A 4BXXH 1QVCA 2H5XA 3T1HL 4BY1G 3CCJA 1RL2A 1K8GA 3PO2G 3S14H 3ERSX 4A3LG 1I94Q 1L1OC 2JA8G 1TWFH 2UXBL 3S17H 1Y1VG 1FJGQ 1Q46A 3I4OA 2UXCQ 1BVSA 1EWIA 2RHQB 4R4CA 3HOZH 1IBKQ 4DV0Q 2VS1A 4GNXC 4MTNA 1YJWA 3KLWA 3L2PA 4HIDA 4KHPQ 2B3GA 4BBRG 3K7AH 1LUZA 1NJIC 5IWAQ 1XMQL 3GDEA 3UDFA 2KHJA 1SE8A 1G291 2UUAQ 4JI3L 1KHIA 3PSIA 3K0XA 2JA5H 3RZDH 1CKMA 3CMAA 2E2IH 3KF8B 1N33Q 4JI7L 3UE1A 1K83H 1YZ6A 3E9HA 5IY0A 1S72A 2D0PA 2NZHA 4DK3C 3CQZH 4EX5A 4LFAQ 2I5HA 3H0GH 4IPDA 2OWOA 1PV4A 3H3VI 1IYJB 1M1KC 4LF8Q 1E1TA 3RN2A 1KAWA 4HJ8A 1Z9FA 1GKHA 1K0RA 4DR2L 1XPOA 2UU9L 2A19A 5LMNW 4AQYQ 2VQFL 2BA1A 4JI5Q 1TWHH 3M4OH 4BBSH 1XNQL 2ZM6Q 3HOXH 4JI5L 2VQFQ 2K50A 2JA7G 3PO3H 2QGQA 4A3KH 1CSQA 4DV2L 3RN5A 4A3DH 1N33L 2BA0A 4BY7H 5C0XJ 1E22A 3A0JA 4GN4B 3W5OA 2ATWA 4A3DG 4IJLA 4UY8C 4JI6L 4DR5L 4X64L 2Y0SG 4LF7Q 5M5XH 4DV7L 1K8AC 5M3FH 1VQPA 3J81j 1AE2A 2CQOA 4YY3Q 1X56A 1PH9A 5C0XI 1MJCA 5FLXc 5IP7G 4QIWE 4B3ML 4R4TA 1HR0Q 2K52A 2IX1A 3CC2A 1WOCA 3PUVA 4A93H 4UPAA 4X66Q 4LUOA 4X65Q 1KQSA 4DUYL 1WJJA 3D31A 2K5HA 1Q8KA 4JG2A 5M3MG 2UUBQ 3KJOA 3CCUA 3KDFB 2YTYA 3F1ZA 1V9PA 1N34Q 4GKJL 1UEBA 4DUZL 4O0AA 1TWAH 4R4OA 1CKNA 1G51A 1YHQA 1JJGA 2ZJQA 3K7UC 4YWMA 2BH2A 5GQOA 3KOJA 1X9NA 3S16H 2HHHL 4DR5Q 4LF7L 3U50C 1FVIA 4A3BG 3K8AA 2N8NA 1VQNA 3HOVH 4OWTB 5J3BA 2K5NA 4IO9A 5C3EH 2YYZA 1KXLA 2JE6I 4YHHL 1LYLA 1YJNA 3CAMA 4OONA 2F4VQ 1Q1EA 5C4XG 1Q81C 3UE0A 2PI2A 4A3GH 3PIOA 1E1OA 4C3HH 4DAYB 1GO3E 4A3IH 2N49A 4PZ8A 3RLFA 3SGIA 1OXXK 4LWCA 4X64Q 3F2BA 4DR2Q 4BA2I 1VQ4A 2F3IA 4YHHQ 1V1QA 1X6OA 4C2MH 2YTXA 3MXNB 5E7NA 1QZHA 2E2JH 4LFAL 2EXDA 3HFZB 4OO1G 3HOYG 1VQDA 1X3GA 1YI2A 4GOPC 1KL9A 2R7ZG 2IY5B 4IPGA 1NTGA 4KLKA 4PMWA 2ALYB 4L5TA 4JI3Q 1HNZQ 1XPUA 1WI5A 2XGTA 2YTVA 1JJ2A 1VQCA 4DV0L 1TWCH 1SLJA 4PZ6A 5H1SE 1MIUA 1XMOQ 2K14A 4OO1I 1FJGL 2HIXA 4DR3L 2CWAA 1XMOL 2VW9A 2MO1A 5IP9G 1D8LA 4C3JH 5GAEC 3I4MH 3PUWA 2Q2IA 2EIFA 4AIMA 4YY3L 3J7A5 1A63A 1VQ6A 3I4MG 2B63G 4DV3L 3CD6A 2GVAA 3TS2A 1IBLQ 3DM3A 1X55A 1KRSA 4GLVB 4R1JA 3ULLA 4UP7A 1UE6A 4GOPA 1SMXA 4B3TQ 5JJKA 1JT8A 4YCVA 4HJ9A 1N34L 2OQ0A 3KDFA 4GLAC 4LF9L 3GTMH 1P8LA 1LM0A 2IT1A 4JC0A 4X65L 1Q12A 2LXJA 3K81C 4KHZA 2HIVA 3RNUA 1PYBA 4A75A
chains in the Genus database with same CATH superfamily
4HMIA 1LT4D 5IGEA 1S5ED 4AYBE 3AB9A 4NKLA 2XNAC 3KF6B 4NP5A 1HCZA 3KUPA 3AFPA 2NVYH 4CKCA 3NXWA 3U4VA 2F4VL 3GD7A 4ZUJA 2JA5G 2HT1A 1SNDA 1WFQA 4DFAA 4C3IG 4ULLA 1VQOA 1JR0D 4IQZA 3A5UA 4CDEC 2B63H 1IBLL 4B3RL 3A54A 3PO2H 2JA8H 1OXTA 1S3OA 3SK8A 3HOWH 4JOIC 4IUPA 3BJUA 1NSNS 5IYCH 3BVZA 1IW7C 3J7AF 1P16A 1ZKOA 2KENA 1TWGB 1VQKA 4KHVA 4B9XA 1VQHA 4IZ8A 4P73A 1C9OA 3CXCA 5LHY1 1K8MA 4KK7A 1RCVD 2F0MA 4HIMA 3VDYA 5FJ8G 3Q8DA 5LMNQ 3HOWB 1KRTA 4GKKL 2VUMH 2F0GA 5ISRA 4MNOA 1ZEQX 1Z47A 1I4QA 1MD2D 5C44H 3J7ZC 3PIPA 3DLLA 4CDDC 4B3MQ 1Q90A 1SAPA 3L7ZC 5JVH3 1TWGH 4A3BG 3CF5A 3PF5A 1RTOA 5AJ3Q 4R8NA 2F0LA 1LV9A 3S1NH 4A3JB 5C4XB 3G48A 2ZXPA 4WJ3M 3TS0A 3M85A 5BN5A 3HS0C 1EZ8A 4GOPB 1Y1WG 1D2BA 1OXSC 1PH2A 1CKOA 2IWHA 2RHSB 2OTLA 1DONA 4UP8A 4LFBL 4BA1I 3M9BA 4J15A 4FF1A 3TP5A 1M90C 2NUCA 2IW3A 4BS9A 3C1EA 3NQIA 3EJIA 3TP8A 5CC4A 5FLXL 4JI2L 1JWMD 4IN3A 3LX0A 2NVYB 2UUBL 1CHQD 3J81E 2K5QA 3EROA 3NPPA 3CC7A 4CGYB 1N36Q 3S16B 2KCNA 4NPSA 5C4ZA 1WCMB 2WAQG 4ZAIA 1SEBD 5I6YA 5COYA 3TQYA 3J81c 1PZKD 3S2DB 1UWVA 4TKOB 5M3FG 2HUGA 2PW7A 2RF4A 4LF9Q 2N88A 1V1PB 3BYTB 3K6OA 2F0HA 4FYDA 2NB0A 3BDLA 4K6LA 1QJOA 3PO3G 5HGQA 4A3LH 5BR8Q 1GJXA 4QUCA 4L5QA 2IHEA 2PO4A 1K9MC 5CR3A 3VR6A 1PYSB 4X66L 1HTLD 3S24A 4NMZA 1B70B 2F0OA 1SXTA 3MFGA 1HR0W 1Y1VB 3H0GB 4J1MA 5D14A 2DY8A 4GKJQ 2LMCB 2ZTDA 4QJFA 4M8AA 1GHJA 3X3NA 2R3ZA 1DGSA 2DY7A 4H44C 1D5MC 1H9SB 1F2ZA 5BN4A 2ZJRA 1NBWA 4BXXG 1R4QB 1KDBA 4LF5Q 2KCTA 4MZ9A 4QGUA 1PA6A 3HOYH 3I4LA 1LTLA 3NEMA 5LL6X 1LTID 1EOVA 4K0KQ 4KKUA 4XTCS 3K5NA 2B2WC 1EOTA 4V190 5M5YB 2RKSA 2B8GA 5T1GA 4JI4Q 2BDNA 4IURA 2B2VC 1EIGA 1XNQQ 5HGTA 5M3MH 3S1RH 3Q23A 2D9UA 5FO9B 3J81L 3U58A 2R7ZH 5M5XB 1BCPB 2UUCL 3VYTA 5LMNL 2RDFA 1CA6A 4DV1Q 1HNXQ 3KJPA 4L5SA 2NN6G 3CPFA 4DR6Q 3GTLH 2E2IB 4JV5L 1PTOF 1STAA 1SROA 2BE5D 2L55A 3QR8A 4NW2A 4OX9L 2PMZE 1A0IA 1R9TH 4RGNA 1NCVA 3I4NB 2FHTA 3FVQA 1WTOA 2X6LA 3TEHB 4AH6A 2JXMB 2HQEA 4NXMQ 1EY4A 1V1PA 3GTPB 1B50A 3CPWA 4JBJA 1GUNA 2EYPA 3TMEA 2DNCA 4DR4L 3BZDB 2H4OA 2NVXH 2AKWB 4ABNA 2R93B 4DUZQ 1F2YA 3AU7A 1PZJD 4K2LA 2IHFA 2E74C 3ULPA 4BY1B 2YU9B 3MA2B 1DOKA 4A3MH 1SRUA 3UDIA 3G7LA 4HTHA 4R4IA 4J8QA 1SNPA 1BR9A 4JI8Q 2A68C 3A8KE 3GTPH 3K5LA 3I4NG 2V1CC 4APVA 2AWNA 2PNRC 4BY1H 4OO1H 3IFTA 4JI1L 4JI2Q 4QCLA 3F2DA 1VQ8A 4LUZA 4DR4Q 2NWGA 5EAYA 2M2LA 1U4RA 1Y14B 1YBYA 2CW0C 3KBGA 3W3AA 4EVOA 4JOIA 4QQBX 2QEXA 1HR0L 4IUTA 2E8GA 4GKKQ 5CV9A 4JI6Q 4H7BA 1EWHA 5EPLA 1LTTD 4TQUS 3GTKH 4L8JA 3CMEA 2A69C 2R93G 1ENCA 3MWYW 1QVCA 2VXWA 2WAQB 5AFWA 1FD7D 1K8GA 3DWAA 5D3IB 1STBA 5FOBB 1JE4A 1FJGQ 1Q46A 2VB3X 4R4CA 1IBKQ 3NWTA 1YJWA 4MTNA 5M3MB 4JVZA 4RGTA 1EEID 4BBRG 3K7AH 5T1IA 1K3BC 1JOKA 2XIWA 5JAVA 2UUAQ 2DNEA 4HN7A 3K0XA 2LS01 1R4PB 4R8IA 2L5TA 1N33Q 4TRDA 1YZ6A 3I3CA 5CORA 1Q8IA 3H6MA 4DK3C 3H0GH 4IPDA 5JEAH 2OWOA 3KLSA 1QNKA 3D4RA 1GOZA 3RN2A 1Z9FA 4XQJA 2A19A 4AQYQ 3M4OH 2BA1A 1M4VA 3N52A 3HOXH 4FP5D 2L9HA 4U673 1CM9A 1N33L 1E22A 4H13C 3WOFA 4LF7Q 2QDLA 2PZUA 1K8AC 1VQPA 1TR5A 2CQOA 4YY3Q 2G5DA 1MJCA 2D5DA 2F0VA 5FLXc 4QIWE 4B3ML 1RF2D 2B2UA 2XWJB 3S1QB 1WOCA 4BY7B 1IW7D 4A3KB 4DUYL 1WJJA 3D31A 5D65A 3NQTA 5M3MG 2KCCA 3A8JE 2E76C 2YTYA 1N34Q 1NR4A 4ZQ3A 1PXUA 4O0AA 3C2PA 2LY7A 1CKNA 2ZJQA 4YWMA 1PYWD 2RA4A 3KOJA 1HRJA 3S16H 1SE3A 1F9RA 5EKKA 1SNCA 1VQNA 4OWTB 3G6JB 1YJNA 3CAMA 4OONA 4RGMA 1Q1EA 2ZT9C 4K6DA 5IIFA 2G9DA 4IUQA 2F4VQ 1E1OA 1EFID 1GO3E 2L11A 1CK1A 1HHVA 1G2SA 2N49A 4PZ8A 3SGIA 4O42A 4X64Q 4BA2I 1PRTD 2BDOA 2F3IA 4YHHQ 1D1IA 2YTXA 2F0UA 3NE5B 3S17B 1VQDA 1KDAA 1YI2A 3V2TA 4PMWA 2WB1B 5IGFA 1X3QA 3D4WA 1GUGA 2A69D 1VQCA 4DV0L 1TWCH 1S5FD 4EQNA 1XMOQ 1RODA 2RDHA 4OO1I 2QILA 1HA5A 1BO0A 2E2HB 2MO1A 1DJRD 5IP9G 3A7AB 1IYUA 2O2LD 1A63A 2F0PA 3CD6A 3DEPA 2GVAA 2PMZB 1X55A 1UE6A 1M8AA 1SMXA 3DXJC 4B3TQ 4YCVA 4KD3A 4EQOA 4JC0A 1AZPA 4DXFA 3K81C 4EQPA 1IBKL 2QKIC 4DR7L 4HJ5A 2D2CC 3S14B 1CA5A 3HOZG 2JK8A 3MHBA 5C0XG 5C4JH 5E1FA 2PNHA 1WTVA 2CVRA 2A73B 1A3TA 2F52A 1ET9A 1NY4A 3E3XA 3AYHB 2FXQA 5E4XA 1AZQA 3OTOQ 5ELCA 2F0DA 2XRQD 4DXGA 3I8ZA 2DUDA 3A56A 3AMUA 2EOTA 4X6AH 1MJEA 4QMGA 1V8QA 4OELB 2I07B 4ZKBB 2KHIA 2K4KA 1XTDA 4R9WA 1JB7A 3HOUB 3T51B 2K1BA 5TSSA 4F88A 2IX0A 1JB3A 2B2WA 1X3PA 2JA7H 2R92H 4KI0A 1HH2P 4ZCKA 1BCPF 1X65A 3U9SA 1YNNC 2PZTA 2B2UC 4DV4L 1LO5D 3I73A 3NELA 1BXTA 4IJHA 4JCVE 1C7YA 1B8AA 3I55A 3H3VH 4FXKC 1GM5A 2ZTCA 1VQBA 2GA4B 1SN8A 5IT9c 3TRZA 2Y0SB 3T1YL 3STBC 1SE2A 2WB1E 4GLXA 1AEXA 2L15A 5LMUL 2JA6B 2ES2A 1HZBA 1E24A 2EZVA 2DJGC 3D6CA 2HHHQ 3HOXG 1S4ZA 3A74A 3F2CA 3VR2A 4Q5VA 1Y1WH 4P74A 1B9MA 1XNRL 1PZID 1PH7A 2F03A 1SYEA 2R7DA 3VA7A 1KIXA 4CJ1B 4UHVA 4UAIA 1AW7A 1VQIA 2PQEA 1MKHA 1YEZA 1QB5D 2OT2A 1PFBA 1KD1C 4RGOS 1TXYA 3ZYYX 4LF4L 2EVBA 1F2LA 1DM0B 2ICEC 2MHVA 1VCIA 3T4AC 1H9JA 2K05A 2EYLA 4DK6C 4QIWB 4OL7A 2VNUD 4DR3Q 1G6PA 1FNWA 3GTJB 3GV3A 5C3EG 1I3QH 3SK6A 1LTAD 4K5WA 1T9HA 1PH6A 2UU9Q 5EBDA 2CKZB 4XDXA 1JE5A 2A1AA 3IL8A 3L3OC 2B39A 3KLSX 3FPUB 1PH1A 5FKAC 2FJ2A 2I0QA 3P7JA 1ONLA 2MNAA 2RSOA 5GAHC 2HDMA 5CV6A 3LWUA 5M5YH 2XRSD 5IGGA 1PH3A 1TWHB 1TWAB 1CKNB 3T1HQ 1VQ9A 4QL5A 1U9RA 1CSPA 1GUOA 1UNSA 2OTJA 4OXPA 2HCCA 2VY3A 1MI2A 1Z7TA 1O78A 5EPKA 3AFQA 1BNZA 2K5WA 3HOWG 2I5LX 1A3VA 1RKNA 1XXGA 3A5ZB 4ALPA 1HNWL 4JYAQ 2R7FA 1LTSD 5HURA 1FL0A 3Q22A 3NTKA 1WD0A 2K5VA 1BCPC 4KJNA 1I4GA 1K3RA 2MGSA 1ASYA 1W3SA 3CCSA 2Z9HA 1STEA 3A7LA 3DUZA 1RIPA 3B6YA 3KFUA 2NZOA 3CKIB 3H91A 3I72A 1NE3A 2MO0A 1XMQQ 2JA6G 1K28A 5IGBA 3VR3A 3D4DA 1EIFA 3GTJH 4JW0A 3N6RA 5IYDG 4IUVA 3D0FA 1PTOC 2I46A 4BBSG 2NN6H 1HZCA 1VS0A 4S3SA 2F0SA 1L0WA 1IBML 1SMYC 1YVCA 1EQTA 1JJCB 5JPMC 3H15A 4WJWA 3R2TA 4C3HG 1B3AA 3L0OA 4EQ5A 3NWSA 1EU4A 5G3LF 2KVMA 2K5DA 5IP7H 4A3IG 2Z6BA 1O7YA 3GV6A 3U4ZA 3CCMA 1C48A 3R93A 1DZ1A 3F2UA 1A62A 3ZJYC 2Z4HA 2P5ZX 2FFKB 5FLXE 4QF4A 2K04A 4YCWA 3TP6A 1B53A 5F2DA 2NVTH 4AQYL 5I2XA 1O7ZA 2R92B 1STYA 4IFDG 2A6ED 4HMJA 5IYBG 1EYDA 5DAUA 1TY0A 2E5LQ 1TVXA 1HUNA 3G71A 2VQEL 1BBWA 2B2YC 1WVLA 4DV5Q 5JOBA 1IBMQ 3S1NB 3OHXC 4RMFA 4HSVA 1YHAA 4BBRB 2DGYA 4YWKA 2Q2TA 1XWEA 1K8OA 2A68D 3NBIA 2A6EC 1SNOA 4LF6Q 5C44G 2HQLA 1IZ6A 1QVFA 5CGKA 1EU3A 4JBMA 4I7ZC 3RR5A 1GUTA 1HTPA 4P75A 3WOEA 4DR1Q 2EY5A 1EQRA 3CCVA 1XTCD 2UXBQ 3BG3A 3BZKA 2KEEA 4UP9A 4A3EH 1D5ZC 1SNMA 2F0NA 4K5VA 3M7NA 3IRBA 4KJOA 3S1MH 1PLFA 4U68A 4DNRB 4K0KL 4HSPA 1QWYA 2PI2E 3HP3A 5C4JB 2AMCB 4BXXH 1FNUA 2H5XA 5EGTA 3T1HL 4XQNA 3S14H 2B63B 1I94Q 2JA8G 1TWFH 3SK5A 2E2JB 1G91A 1EWIA 2HCIA 3HOZH 3ITPA 3IFDA 1LTRD 4GNXC 4A3FB 3KLWA 5FK9C 4KHPQ 3GTGB 4H0LC 1KABA 5KYLA 5KGUA 3UDFA 2KHJA 1SE8A 1G291 1U4MA 1HA6A 3RZDH 3DHQA 5KEEA 1A3UA 4JI7L 3E9HA 1S72A 4DAVA 1EY9A 4F7XA 5BN3A 3H3VI 2EDGA 5I2YA 2NTTA 1M1KC 4LF8Q 1E1TA 5EBCA 1B44D 1TWCB 2UU9L 5LMNW 4G7HC 1G8ZD 2CH4A 2VQFL 4JI5Q 5A35A 2ZM6Q 2LFNA 2JA7G 3PO3H 3IAYA 1PRTF 4A3DH 1JORA 1KTKA 1PTOB 5C0XJ 2ATWA 5ELEA 3BVMA 4HEDA 4X64L 1STGA 4DV7L 1HFGA 2K6AA 1AE2A 1VMPA 1X56A 1PH9A 4PMBA 1DXMA 2ZXOA 3GTQB 1HR0Q 2IX1A 1PTOH 4A93H 4LUOA 5CV7A 4A3DB 2BOSA 2PYKA 3C1FA 4CDCC 1Q8KA 4JK1C 3CCUA 1UEBA 1WTWA 1SFOB 3SXHA 4X3SA 5C5LA 4B08A 2KHSA 2BH2A 1X9NA 4LF7L 1CI3M 2B2YA 1FVIA 5C3WA 1MGSA 5C4HA 5J3BA 1MSHA 1KXLA 2YYZA 2JE6I 3M3YB 3HOXB 4P2CB 4A3GH 2PI2A 4C3HH 1PFMA 1TU2B 4RKLA 5C6AA 3F2BA 4LWCA 5I9PA 4C2MH 1I6HB 2E2JH 4XQQA 1ILQA 3MC0B 3QG1A 2Z1CA 2R7ZG 2IY5B 5KNBA 4KLKA 5DNFA 3VYSA 1HNZQ 1XPUA 2YTVA 1SLJA 1SBBB 4TSSA 2K14A 4KN4C 5DEHA 5JVG3 2MPMA 3OSOA 2A5HA 3S15B 1VQ6A 1SYDA 2AUKA 2B63G 4DV3L 3TDQA 3TS2A 3D3RA 1X32A 4GLVB 2RQXA 5JJKA 1JT8A 4C56C 1T5EA 4HJ9A 3KDFA 4X65L 3U9OA 1QUQB 1I50B 1K83B 3J80L 4IOCA 1HQMC 1NAPA 4BBRH 4XT3B 2R61A 1L1OA 2PPBC 1XJVA 4DR7Q 4WORA 3OTOL 1XYIA 3RUZA 1DYQA 4KN7C 1L2FA 2WP8J 1N36L 1VQAA 2CQAA 2Q2UA 5IE8A 2VUMG 5JJLA 5ELBA 5IWAL 4B3TL 3FPPA 4IUUA 4LNQA 1K73C 3RD4A 1HZ9A 3BU2A 3UI2A 1WCMG 1E2ZA 4NB3A 4OHJA 4CKEA 1GXDC 1RHPA 2FMMA 2IX3A 4DUYQ 2VL6A 3WWVA 3ND8A 3A8IE 1TS3A 2AHOB 2D62A 4C3IB 1II3A 2FINB 2L0CA 2OQKA 5KRUA 4CKBA 1N9WA 3PMFA 4L5RC 2BCOA 3S2HH 4PNYA 3GQBA 4GN5A 3M4QA 2R92G 4DNIA 1NNXA 3HGBA 4BY7G 4LFBQ 4G4KA 1I4RA 2B2TA 1J5EQ 1LT3D 2E2DC 4QUFA 1HQRD 2WB1G 4CBVA 3CCRA 5FO8B 4IPHA 1VQ5A 3JC66 2A6HC 3FKIH 3EVQA 1B9NA 5EPJA 4OGQC 4FXDA 1CZWA 1KLGD 5GADC 1MSGA 1LACA 2PQAA 1E7ZA 5IYDH 1Q86C 1YNND 1VF5C 4A3FG 1W6JA 4I7AA 4B9WA 3NBHB 2J0TD 3PO2G 3ULJA 2V4DA 3E0EA 2XWBB 3AQQA 2OCEA 5AJ3L 2Z0SA 4ME5A 1SYGA 3CHBD 3HOUG 3RLOA 1VQJA 3FP9A 5IYCG 1JOQA 3PUZA 1JICA 1A2UA 1PH8A 1IL8A 5FO7B 2SEBD 4LF4Q 1B1ZA 1I50H 4RAUC 1SMYD 4NXNQ 4DK0A 1CTMA 1Z6HA 3VYUA 4DV1L 5J39A 4NXNL 2R7ZB 3K57A 3I4NH 3UDGA 4N8X1 2F1MA 2SDFA 1SR3A 1TS5A 1U5KA 2CHBD 3DM1A 2LKVA 1FGBD 2C35B 2MFIA 1XNRQ 2JEAI 1Q7YC 3CRLC 1EYCA 4K8IA 3R2IA 3CW2C 3MAQA 1QOHA 2ZM6L 1IKLA 3TSSA 1S40A 3TZUA 4GS3A 2F3WA 3DWQA 2AQ3B 2EJGC 1OO9B 3SHLA 2CFMA 4OWXB 1PH4A 2B2TC 4LFCL 1W2BA 3HOVB 2BE5C 3S15H 4FDBA 2D0OA 5DLQE 2QA4A 1E2VA 1Y1VH 2NZ1D 4DV4Q 2NBFA 3NBHA 4RCOA 5M3FB 1PFSA 3BS1A 2WV6D 4LW1A 4C3HB 1JOOA 2A74C 3NSWA 5ELFA 5FLMH 2X69A 1F9PA 2Y0SE 1E0BA 1UUPA 3X3MA 2ICIA 1FGUA 2SNMA 2QW7A 4IFDJ 4BBSB 2Q8RE 3FKIG 1Q1BA 2K75A 1BCPD 1SFOH 2EY1A 2IJ0A 2MUYA 1O80A 4LK1C 2N78A 1V43A 3D6WA 5JEAG 3VR4A 2L1BA 3BDOA 4R4QA 2ID0A 4IUNA 3NUCA 5BR8L 1VQMA 3UDXA 1TQOA 3JAMc 1JC7A 3S2DH 5KIXA 3OMGA 1BOSA 3G6EA 1SJHD 2Q2HA 2QCPX 4P72A 4DV7Q 3C46A 1Y8NB 1YJ9A 3PUXA 5NUCA 1VQEA 1D7QA 4XYQA 4L6TB 3PO3B 1ENAA 1GVPA 3KBXA 4HAEA 1EY7A 1Q82C 2PQAB 3TP7A 3OOCA 3LNNA 1NMGA 3O13A 4YIJA 4IFDI 1WCMH 1D1KA 2L12A 3E0JA 4DPGA 1JCKB 2MQHA 1OXVA 2EPBA 1XPRA 4PMCA 1G2TA 3OIPA 4KKTA 4HJ7A 2RCFA 2KA7A 3PUYA 1A6XA 1ZYRD 1FNVA 2WKCA 2NVQB 2F0FA 1DCZA 2L4NA 5HY6A 5C4XH 1AH9A 1QG7A 1LT5D 2CW0D 2UXCL 1C8CA 2QF7A 1D5XC 1EUJA 3QIAA 5CYUA 2XSCA 5C44B 1HJPA 4F8MA 3R3OA 1SDFA 2AQ1B 1L1OB 4B3SQ 3D8GA 1EWCA 3QB3A 4A3BH 4A3JH 4A3FH 3ICEA 4DV2Q 2ZXRA 2CH4W 4FF3A 1EL0A 5ELNA 2LXKA 1TWFB 1PVOA 4A3CH 2VB2X 1ICWA 4YWLA 2VUMB 5CV5A 4DV5L 5E4WC 1F77A 2KEDA 3IKJA 2E5LL 4Y7NH 1QZGA 2LSSA 3PO2B 2JA9A 1PFNA 5K36H 2AQ2B 3H3VC 1VDZA 1IXRA 3J80E 2YV5A 3NTIA 4FNFA 2A8VA 1KNEA 3M7GA 5GROA 4XYOA 3I2ZA 3V96A 1LLRD 4A3BB 2N55A 1IL2A 5JPNC 4POGA 4JI0Q 3PV0A 2R6GA 1YNXA 2M00A 1X54A 3JAML 3E9IA 4H02A 4CJ2C 2BH8A 4RHSA 4X62L 3TN2A 4BWGB 4DK1A 4CHTB 3HOVG 3MXUA 1WTRA 4A3EG 1G6ZA 1LTGD 4AYBB 4IOAA 2IL8A 5ELOA 1QILA 3MEHA 2NN6I 4RHRA 1Q3LA 1AE3A 1DOLA 4BY1G 3CCJA 4A3LG 1L1OC 2NVTB 3S17H 1Y1VG 3I4OA 2UXCQ 1BVSA 2RHQB 4RA8A 1GHKA 3NP8A 4DV0Q 3NK9A 2B3GA 2MJ8A 1LUZA 1B4OA 5IWAQ 2K03A 3SK4A 1FR3A 3GDEA 3PSIA 1KHIA 3HKZB 2JA5H 1EEFD 1IHZA 4C1NK 1CKMA 3CMAA 1L0XB 2EJMA 3KF8B 5IGCA 3UE1A 3J7AV 3NHHA 2G9HD 1PV4A 1TIID 4K5XA 1KAWA 1TS2A 4A3IB 2F0TA 3Q6SA 1EYAA 4BBSH 2XN9C 1H9SA 4JI5L 2VQFQ 4A3KH 1CSQA 2KQ3A 3R8BA 3RN5A 5C5MA 2F3VA 2BA0A 4BY7H 1HUMA 3W5OA 4A3DG 4ZKCB 4IJLA 4UY8C 5CBAE 3QOLA 5M3FH 5I4DA 3J81j 2EYJA 5EKLA 5C0XI 1EZ6A 5IP7G 4R4TA 2KECA 3PUVA 4UPAA 2J7ZA 3VYRA 3MZ5A 4X65Q 1FYCA 4FXGC 2UUBQ 3KJOA 1HPCA 2RSNA 2F0QA 1V9PA 2JSOA 1EY6A 1TWAH 4R4OA 1G51A 1YHQA 1JJGA 1AN8A 1BF4A 3K7UC 2HHHL 5CBEE 4DR5Q 3K0YA 2RBMA 3U50C 3H94A 2N8NA 1NUCA 4G57A 3HOVH 2K5NA 5C3EH 4YHHL 5A2QE 5C4XG 3TZDA 1Q81C 4HCEA 3K7AB 1F2MA 3ONAB 4ZLTF 1CQFA 4DR2Q 2RVLA 1VQ4A 1DD2A 2F0EA 1X6OA 4LFAL 1PDQA 1QZHA 1BQQT 3HFZB 1IYVA 3OW7A 3HOYG 1X3GA 3MXNA 4GOPC 1KL9A 5IT9E 2ENBA 1NTGA 1YNJD 2K7VA 4JI3Q 1T5XD 1GUWA 1L0YB 5CMDA 1ENFA 4PZ6A 1J8IA 3I91A 2OEOA 1FJGL 2HIXA 4DR3L 1BUVT 1E2WA 4OEMB 1DOMA 4F87A 4C3JH 3I4MH 3PUWA 2Q2IA 4AIMA 4DU9A 2PZWA 2F0KA 4RCNA 1H9KA 1IBLQ 3DM3A 1KRSA 1H9MA 4UP7A 2JN4A 2EY2A 4ID6A 1I3QB 4WFN3 1N34L 2OQ0A 4LF9L 3GTMH 2NYZD 2IT1A 1LM0A 4KY5A 2Q8IB 2WINB 2LXJA 3SEBA 4KHZA 5CV8A 4GZYC 4N9TA 1A2TA 4A75A 4MN3A 4QY7A 4ME3A 4B3RQ 1CZGA 4L63B 4PG3A 4Q0FA 1UE7A 4WRDA 3J80c 2UXDL 1AP0A 3OIQA 1RTNA 2F0IA 1IKMA 2DN8A 1B7YB 2OF1A 2Z8LA 3DWPA 4YCUA 3S2HB 4Y52H 3EBEA 4ZYSA 2CWPA 1N8RC 4C3IH 4AYBG 4OIJA 1WTXA 1J5EL 3EQLC 1TY2A 4IFDH 1PH5A 5JJIA 1CHPD 3RZOB 1J9OA 3ER0A 3HG9A 5IP9H 3BYYB 4KV6A 2Z6KC 2JA6H 2F0WA 1ICFB 3I56A 3T56B 4HCSA 2R93H 2UUAL 1SYBA 4DV6L 1EQVA 1WTPA 3E5SA 1Y8OB 1Y69U 3W2DA 1UAPA 1U4PA 2NVXB 1Y1WB 1SYCA 4JBKA 1TKWB 2JEBI 2E75C 4JBWA 1KLUD 3G4SA 2XTIA 5M5WB 3BDCA 5IODA 4DN4M 3L9AX 2IPKD 5CV4A 1EQQA 5EJWA 3DEOA 1RJTA 5DM73 4KHPL 1F9SA 3PF4A 4HR7B 2GVBA 2JA7B 2HDLA 3T16A 1KC8C 2B8FA 1STNA 1QCBD 3P1HA 3SDZA 4A4IA 3PCOB 2AWOA 4MTKA 3OPOA 5JEAJ 2JP1A 3J7YW 4GN3B 1ZXTA 3NTHA 1SE4A 3BZCA 3K58A 4O2DA 3OYYA 3P20A 2WACA 1VQLA 4PZ7A 5LL6S 4Y7NB 1J6QA 3MFYA 1CQVA 1I6VC 4A3KG 2QDBA 3HOUH 4DV3Q 3T53B 1U0LA 1H95A 4CDFC 3MXGA 1F9QA 4MIUA 3KF8A 4KY7A 5I9OA 5IYBH 2VQEQ 2ZTEA 2TSSA 3EFXD 4X3UA 3VA5A 1I6HH 1QUQA 4JYAL 4PQXA 1KAAA 3QOJA 4NDXA 1H9RA 3ND9A 2KJXA 1LTBD 3F8TA 3HZXA 5L37A 4DNTB 4A3JG 3W1GA 1X3FA 3KLRA 5KYIA 2GN5A 2E2HH 1YHBA 2MP1A 4LAAA 4TVAB 3GTOH 2SNSA 3TREA 4C2MB 4A3CG 3I70A 2O5JC 5LMUQ 1S5CD 3FDTA 3CCLA 3WDNA 3MEFA 4CJ0B 1I5FA 4GNXB 4DV6Q 1HNZL 3P75A 1V1OA 4A3GB 1NR2A 2UXDQ 2NVQH 2Q8TA 1WTQA 3M3YH 4NXML 3STBD 1ET6A 1VQFA 3Q24A 1S5DD 4WJ4A 5IGDA 4A93B 4G7OC 3TBIB 1EYGA 3GTQH 3H09A 3M4PA 1JMCA 4OX9Q 2WFWA 3LGJA 4X3TA 3W1BA 1PMRA 1UE5A 1X3EA 3S9WA 4DR6L 5FLMG 3HEJA 4OWWB 3CRKC 4DR1L 1E3PA 4ILWA 2KUMA 2C5CA 4HJAA 2JJQA 1PHJA 1AFPA 1O7LA 2ZJPA 1HZAA 1OTCA 3FHWA 3QJYA 4POFA 1B3QA 3M4YA 4A3GG 3CCQA 1YIJA 2QEJC 1BBUA 2B2VA 1HNXL 1ASZA 4DF7A 2UUCQ 3S1QH 4KMUC 2I5MX 4HIOA 3KYHC 3GTGH 3T1YQ 2K32A 1O7IA 1XX8A 4LF5L 3CCEA 1HNWQ 2X6GA 1SSOA 4KTAA 4XXEA 5C0XH 1EY0A 4JI4L 1CUKA 5ELDA 5JJZA 3NENA 3GO5A 4OIKA 1N32Q 3SVMA 4HIKA 5IOCA 2EQSA 4GNXA 3RZDB 4XIGS 2WIIB 1A15A 4JI1Q 2CCZA 3JAMi 4B3SL 1A8VA 2J4XA 1YITA 5FJ8H 1BDOA 2ASBA 4ZUIA 3I7FA 3M4OB 1D6EC 4A93G 3PGZA 2EE1A 3S1MB 2RCNA 1K0SA 1VQGA 2Z4IA 3H0GG 1ILPA 3HOZB 3K80C 1TS4A 4DAPA 3GTOB 1JQYD 1MBYA 3OWEB 4FVMA 4O1NA 5A2QL 5I6WA 1BKBA 5KNDA 2EY6A 4V0BA 3SE0A 1WYDA 2H1EA 2PW5A 2WKDA 4DA2A 3EN2A 5EKIA 4RWSC 3RLNA 2N3SA 4A3EB 2SOBA 1QVGA 4P71A 1VQ7A 1ML0D 4DKAC 1HXYD 1ZYRC 3AEVA 3MXPA 4JPBW 3HKSA 5D3DA 1RD9D 3PIP3 2HD3A 1ESRA 4DAMA 3J81i 4IALA 1NMFA 2JA8B 4DAYA 1PRTC 4LF6L 3GTKB 4LMQD 2NTSA 4EGVA 1JWUD 5GAGC 2B29A 1I4XA 3J80i 2K33A 2C9OA 4PV1C 4JV5Q 1LABA 4A3MG 3EIVA 5M9OA 3K5MA 3KF6A 2KCMA 4UDUC 2JQOA 4LUVA 3T13A 4FF2A 1C0AA 4DGZA 3CC4A 3HKZG 4LF8L 2OXPA 1BBXC 4Z9CB 5J22A 1WD1A 3PIO3 4K8JA 4JI7Q 1OXUA 1PTOD 4K14A 4RG1A 3SR1A 1VF7A 5K36G 1EIYB 5M5WH 2Z6KA 4IPCA 2KBNA 4A76A 1N32L 2AUJD 1EIHA 4ODGA 3FKIB 3URYA 3CP0A 3OW2A 4JI8L 3VR5A 1GD7A 1UE1A 3FEWX 3MTSA 3BVGA 1W6KA 1I94L 4KY6A 2YU9H 3HKZE 1CFMA 4C1NI 1ESFA 4JI0L 3RZOH 4M1UB 3FMCA 2KOLA 4K2KA 2XVSA 3GTMB 4LFCQ 1EFWA 4X62Q 4RFBA 3A55A 4RKBA 2VZAA 4ZRZA 2WAQE 1VMCA 4A3MB 1RL2A 1S5BD 3GP7A 3ERSX 4N8FA 4C3JB 3I4MB 2UXBL 4E6IA 3MVVA 3V05A 1PRTB 2VS1A 2EYFA 3L2PA 4HIDA 1JWSD 1RDPD 1NJIC 1XMQL 1QE6A 4JI3L 4X3KA 2E2IH 3GTLB 1K83H 2DJFC 3FRPB 5IY0A 2D0PA 2NZHA 3CQZH 4EX5A 1B2TA 4LFAQ 2I5HA 4RH6A 1IYJB 4HJ8A 3S1RB 1GKHA 1K0RA 4DR2L 1XPOA 2O5IC 4G7ZC 1R9TB 1TWHH 3E6ZX 1XNQL 5EQ0A 1KDCA 2K50A 2QGQA 2K28A 4DV2L 3A0JA 3KK7A 3LWEA 3OWFA 4GN4B 4JI6L 3Q0AA 4DR5L 2Y0SG 4KKSA 5M5XH 1Y8PB 4ZK9B 1SNQA 1GUSA 5K5PA 3I90A 1SYFA 1I4PA 4KD4A 2K52A 3CC2A 4X66Q 5C3EB 4LJZC 3RMHA 1KQSA 3HRZC 2K5HA 2RDGA 1UEAB 4JG2A 3DMUA 3OMCA 3KDFB 3F1ZA 4GKJL 1U4LA 4DUZL 3ERQA 1HFNA 4N9PA 3HOYB 2FMCA 1SJED 1WTHA 1C4QA 1LT6D 2EYMA 3CQZB 2PCFB 2F0JA 5GQOA 3K8AA 1YNJC 1I4HA 4XT1B 4IO9A 1LYLA 1TT2A 3C3LA 2TMPA 3UE0A 3K59A 3PIOA 5IT9L 4DAYB 4A3IH 3QWNA 3RLFA 1OXXK 5J1ZA 1V1QA 2K01A 1MHWC 1KNAA 1QNUA 3MXNB 5E3FA 5E7NA 2O4XA 3PQIA 4OO1G 2EXDA 1EY8A 2EYOA 3QO2A 4QB4A 4FF4A 4IPGA 4I65A 2ALYB 4L5TA 4FO2A 1WI5A 2XGTA 1JJ2A 2JYOA 5G3LD 4J6HA 3CU7A 3K5OA 2EYHA 5H1SE 1MIUA 5DM63 2CWAA 1XMOL 1CT1D 1EY5A 2VW9A 1D8LA 2F4IA 5GAEC 5C3XA 2EIFA 3J7A5 4YY3L 2EXZA 4C3JG 3I4MG 2JA5B 1STHA 3JAME 4R1JA 3ULLA 4GOPA 4MHEA 5KNCA 4GLAC 2A6HD 1P8LA 3EA6A 1Q12A 2EJFC 2HIVA 3RNUA 2M9VA 1PYBA
chains in the Genus database with same CATH topology
1QUQB 4HJ5A 4DR7L 4QY7A 4ME3A 4B3RQ 4AYBE 4IOCA 4PG3A 3J80c 2UXDL 1UE7A 3HOZG 3KF6B 2JK8A 4BBRH 3AFPA 4YCUA 1B7YB 2NVYH 5C0XG 3U4VA 1L1OA 5C4JH 4Y52H 3EBEA 3GD7A 1XJVA 2CWPA 2F4VL 2PNHA 4DR7Q 3OTOL 1N8RC 2JA5G 2HT1A 4C3IH 4AYBG 3AYHB 2F52A 1L2FA 1NY4A 1WFQA 2FXQA 1J5EL 2WP8J 3OTOQ 1N36L 1PH5A 1VQAA 2Q2UA 2VUMG 5IE8A 1VQOA 5JJLA 5JJIA 3ER0A 2DUDA 5IP9H 3A5UA 5IWAL 2Z6KC 4B3TL 2JA6H 3I56A 4LNQA 1K73C 2R93H 1HZ9A 3BU2A 2UUAL 4DV6L 1WCMG 1IBLL 1MJEA 4NB3A 2B63H 4B3RL 4X6AH 3PO2H 4DUYQ 2VL6A 2KHIA 2K4KA 1XTDA 3WWVA 2JA8H 1JB7A 2AHOB 1OXTA 1S3OA 2D62A 3HOWH 2OQKA 2IX0A 4JOIC 4JBKA 1N9WA 2JEBI 4JBWA 4L5RC 3BJUA 3S2HH 2JA7H 3G4SA 5IYCH 2XTIA 4GN5A 3M4QA 2R92H 1P16A 4KI0A 1HH2P 2KENA 2R92G 1EQQA 1X65A 4DNIA 1VQKA 4BY7G 4LFBQ 4DV4L 1VQHA 4KHPL 3NELA 4P73A 1C9OA 1J5EQ 3PF4A 4IJHA 4JCVE 3CXCA 1B8AA 3I55A 1C7YA 2GVBA 3H3VH 1GM5A 2WB1G 1KC8C 3CCRA 4HIMA 3VDYA 4IPHA 1VQ5A 3JC66 5FJ8G 3FKIH 2ZTCA 3Q8DA 4A4IA 1KRTA 5LMNQ 4GKKL 2VUMH 1VQBA 5GADC 4MNOA 1SN8A 2AWOA 3PCOB 1Z47A 5IT9c 2PQAA 5C44H 3J7ZC 1E7ZA 5JEAJ 3STBC 3PIPA 2WB1E 3DLLA 4GLXA 3T1YL 1Q86C 5IYDH 4GN3B 4B3MQ 2L15A 4A3FG 3L7ZC 5LMUL 3NBHB 3BZCA 1TWGH 4O2DA 1HZBA 3OYYA 3ULJA 1E24A 5AJ3Q 3CF5A 3PF5A 1VQLA 2ES2A 4PZ7A 3E0EA 2HHHQ 3S1NH 3AQQA 1J6QA 2OCEA 3HOXG 3A74A 5AJ3L 2Z0SA 3G48A 4WJ3M 3TS0A 3M85A 4GOPB 1Y1WG 3HOUG 4A3KG 3RLOA 1OXSC 1VQJA 3F2CA 3FP9A 1CKOA 5IYCG 2RHSB 4DV3Q 3PUZA 4P74A 1Y1WH 1PH2A 2OTLA 1U0LA 3HOUH 1H95A 1XNRL 1PH8A 4UP8A 4LFBL 1PH7A 4BA1I 3M9BA 4J15A 2R7DA 5IYBH 2VQEQ 1KIXA 4LF4Q 1I50H 2ZTEA 1M90C 4NXNQ 1I6HH 1QUQA 4DV1L 1VQIA 4JYAL 1MKHA 1YEZA 4NXNL 3I4NH 3UDGA 1KD1C 4JI2L 1TXYA 4LF4L 3F8TA 1SR3A 1U5KA 4A3JG 2C35B 2MFIA 2UUBL 1XNRQ 3W1GA 2JEAI 1VCIA 1X3FA 1Q7YC 2GN5A 3CC7A 2E2HH 1YHBA 3GTOH 4TVAB 4DK6C 3TREA 1N36Q 4NPSA 3CW2C 2VNUD 4A3CG 2WAQG 5LMUQ 4DR3Q 1G6PA 2ZM6L 3TQYA 3J81c 3CCLA 1S40A 3MEFA 5C3EG 1I5FA 4GNXB 4DV6Q 1I3QH 1HNZL 4GS3A 1UWVA 1T9HA 1PH6A 2NVQH 2CFMA 4OWXB 1PH4A 3M3YH 5M3FG 3STBD 4NXML 2UU9Q 2CKZB 1JE5A 4LFCL 1VQFA 1W2BA 3S15H 2RF4A 2A1AA 4WJ4A 4FDBA 4LF9Q 2D0OA 5DLQE 1EYGA 3GTQH 2QA4A 1PH1A 3PO3G 1Y1VH 3M4PA 2I0QA 1JMCA 4OX9Q 2WFWA 3LGJA 4DV4Q 5HGQA 4A3LH 1PFSA 4LW1A 3W1BA 5BR8Q 2MNAA 1UE5A 1X3EA 5FLMH 2Y0SE 5GAHC 4DR6L 5FLMG 4L5QA 3TRZA 2IHEA 4OWWB 1K9MC 5M5YH 1FGUA 4DR1L 1E3PA 4IFDJ 4HJAA 1PH3A 1PYSB 4X66L 2JJQA 1PHJA 3S24A 2ZJPA 1B70B 3FKIG 1HZAA 1OTCA 3FHWA 1Q1BA 2K75A 1SFOH 1HR0W 1CKNB 3T1HQ 4POFA 4QL5A 1VQ9A 1CSPA 2OTJA 4A3GG 4OXPA 2VY3A 4GKJQ 2ZTDA 4QJFA 3CCQA 2N78A 1YIJA 1V43A 5JEAG 3AFQA 1DGSA 1BBUA 1HNXL 2I5LX 3HOWG 1ASZA 1HNWL 3A5ZB 4ALPA 4R4QA 2ID0A 2R7FA 1NBWA 2ZJRA 2UUCQ 3S1QH 5BR8L 4BXXG 1FL0A 4JYAQ 1VQMA 3UDXA 4LF5Q 3JAMc 2KCTA 2I5MX 2K5VA 4MZ9A 4QGUA 4HIOA 3KYHC 1PA6A 3GTGH 3HOYH 3S2DH 1K3RA 3T1YQ 1IBKL 1LTLA 1O7IA 1ASYA 4LF5L 1W3SA 3NEMA 3CCEA 3CCSA 1HNWQ 3G6EA 1CUKA 2Q2HA 4JI4L 4P72A 1EOVA 4DV7Q 1RIPA 3NENA 3B6YA 3GO5A 2NZOA 3KFUA 4K0KQ 1N32Q 4XTCS 1YJ9A 3PUXA 4HIKA 1NE3A 2EQSA 4GNXA 4XIGS 1VQEA 4JI1Q 2MO0A 2CCZA 3JAMi 4B3SL 1D7QA 1XMQQ 4JI4Q 2JA6G 1A8VA 1YITA 1GVPA 5FJ8H 2ASBA 1XNQQ 3I7FA 2UXDQ 1EIFA 4A93G 1Q82C 3PGZA 2PQAB 5M3MH 3GTJH 2RCNA 3S1RH 1NMGA 1VQGA 3U58A 2R7ZH 3H0GG 4IFDI 2UUCL 1WCMH 5IYDG 4DPGA 5LMNL 3K80C 2MQHA 4DV1Q 3D0FA 1OXVA 1HNXQ 3KJPA 1XPRA 4L5SA 2NN6G 3CPFA 4DR6Q 3GTLH 4BBSG 4HJ7A 4JV5L 3PUYA 1HZCA 1SROA 1VS0A 1BKBA 4OX9L 2PMZE 1L0WA 1IBML 5HY6A 1A0IA 1R9TH 1YVCA 1WYDA 1JJCB 5C4XH 3H15A 1AH9A 2UXCL 3L0OA 4EQ5A 3TEHB 3EN2A 4AH6A 3RLNA 2N3SA 1EUJA 1QVGA 4P71A 1VQ7A 4NXMQ 4DKAC 5IP7H 4A3IG 3U4ZA 3AEVA 1HJPA 3HKSA 3CCMA 3CPWA 1L1OB 4JBJA 4B3SQ 4A3BH 4DR4L 4DAMA 3J81i 1NMFA 2NVXH 4A3JH 2AKWB 4A3FH 4LF6L 3ICEA 1A62A 4DV2Q 3ZJYC 5GAGC 2B29A 3J80i 5ELNA 2LXKA 4DUZQ 4JV5Q 2IHFA 4YCWA 3ULPA 2NVTH 1PVOA 4A3MG 3EIVA 4AQYL 4A3CH 3KF6A 4A3MH 1SRUA 2KCMA 3UDIA 4IFDG 2JQOA 4LUVA 5IYBG 1C0AA 4YWLA 4R4IA 4DV5L 2E5LQ 3CC4A 3HKZG 4LF8L 4JI8Q 3G71A 2VQEL 1BBWA 4DV5Q 2E5LL 3GTPH 4Y7NH 1QZGA 2LSSA 4RMFA 1IBMQ 3I4NG 1YHAA 2JA9A 2V1CC 4APVA 2AWNA 2DGYA 1OXUA 4YWKA 2Q2TA 4RG1A 4BY1H 4JI7Q 4JI1L 1IXRA 2YV5A 5K36G 4JI2Q 1EIYB 3F2DA 1VQ8A 2A8VA 5GROA 4LF6Q 4LUZA 5C44G 2HQLA 5M5WH 2Z6KA 3I2ZA 1IZ6A 4IPCA 2KBNA 1QVFA 4A76A 4DR4Q 1N32L 5EAYA 4JBMA 3RR5A 1Y14B 4P75A 3CP0A 4DR1Q 3OW2A 4JI8L 1IL2A 4POGA 1GD7A 4JI0Q 1UE1A 1YBYA 2R6GA 3PV0A 1YNXA 1EQRA 1X54A 3CCVA 4JOIA 4QQBX 2QEXA 1HR0L 1I94L 2UXBQ 2E8GA 3E9IA 4H02A 2YU9H 4GKKQ 2BH8A 3HKZE 4X62L 3BZKA 4UP9A 4A3EH 4JI6Q 4JI0L 3RZOH 3HOVG 4A3EG 4TQUS 3GTKH 3M7NA 4IOAA 3IRBA 5ELOA 3S1MH 4LFCQ 4K0KL 1EFWA 3CMEA 2PI2E 4X62Q 2NN6I 2VZAA 2R93G 2WAQE 2AMCB 1AE3A 4BXXH 1QVCA 2H5XA 3T1HL 4BY1G 3CCJA 1RL2A 1K8GA 3PO2G 3S14H 3ERSX 4A3LG 1I94Q 1L1OC 2JA8G 1TWFH 2UXBL 3S17H 1Y1VG 1FJGQ 1Q46A 3I4OA 2UXCQ 1BVSA 1EWIA 2RHQB 4R4CA 3HOZH 1IBKQ 4DV0Q 2VS1A 4GNXC 4MTNA 1YJWA 3KLWA 3L2PA 4HIDA 4KHPQ 2B3GA 4BBRG 3K7AH 1LUZA 1NJIC 5IWAQ 1XMQL 3GDEA 3UDFA 2KHJA 1SE8A 1G291 2UUAQ 4JI3L 1KHIA 3PSIA 3K0XA 2JA5H 3RZDH 1CKMA 3CMAA 2E2IH 3KF8B 1N33Q 4JI7L 3UE1A 1K83H 1YZ6A 3E9HA 5IY0A 1S72A 2D0PA 2NZHA 4DK3C 3CQZH 4EX5A 4LFAQ 2I5HA 3H0GH 4IPDA 2OWOA 1PV4A 3H3VI 1IYJB 1M1KC 4LF8Q 1E1TA 3RN2A 1KAWA 4HJ8A 1Z9FA 1GKHA 1K0RA 4DR2L 1XPOA 2UU9L 2A19A 5LMNW 4AQYQ 2VQFL 2BA1A 4JI5Q 1TWHH 3M4OH 4BBSH 1XNQL 2ZM6Q 3HOXH 4JI5L 2VQFQ 2K50A 2JA7G 3PO3H 2QGQA 4A3KH 1CSQA 4DV2L 3RN5A 4A3DH 1N33L 2BA0A 4BY7H 5C0XJ 1E22A 3A0JA 4GN4B 3W5OA 2ATWA 4A3DG 4IJLA 4UY8C 4JI6L 4DR5L 4X64L 2Y0SG 4LF7Q 5M5XH 4DV7L 1K8AC 5M3FH 1VQPA 3J81j 1AE2A 2CQOA 4YY3Q 1X56A 1PH9A 5C0XI 1MJCA 5FLXc 5IP7G 4QIWE 4B3ML 4R4TA 1HR0Q 2K52A 2IX1A 3CC2A 1WOCA 3PUVA 4A93H 4UPAA 4X66Q 4LUOA 4X65Q 1KQSA 4DUYL 1WJJA 3D31A 2K5HA 1Q8KA 4JG2A 5M3MG 2UUBQ 3KJOA 3CCUA 3KDFB 2YTYA 3F1ZA 1V9PA 1N34Q 4GKJL 1UEBA 4DUZL 4O0AA 1TWAH 4R4OA 1CKNA 1G51A 1YHQA 1JJGA 2ZJQA 3K7UC 4YWMA 2BH2A 5GQOA 3KOJA 1X9NA 3S16H 2HHHL 4DR5Q 4LF7L 3U50C 1FVIA 4A3BG 3K8AA 2N8NA 1VQNA 3HOVH 4OWTB 5J3BA 2K5NA 4IO9A 5C3EH 2YYZA 1KXLA 2JE6I 4YHHL 1LYLA 1YJNA 3CAMA 4OONA 2F4VQ 1Q1EA 5C4XG 1Q81C 3UE0A 2PI2A 4A3GH 3PIOA 1E1OA 4C3HH 4DAYB 1GO3E 4A3IH 2N49A 4PZ8A 3RLFA 3SGIA 1OXXK 4LWCA 4X64Q 3F2BA 4DR2Q 4BA2I 1VQ4A 2F3IA 4YHHQ 1V1QA 1X6OA 4C2MH 2YTXA 3MXNB 5E7NA 1QZHA 2E2JH 4LFAL 2EXDA 3HFZB 4OO1G 3HOYG 1VQDA 1X3GA 1YI2A 4GOPC 1KL9A 2R7ZG 2IY5B 4IPGA 1NTGA 4KLKA 4PMWA 2ALYB 4L5TA 4JI3Q 1HNZQ 1XPUA 1WI5A 2XGTA 2YTVA 1JJ2A 1VQCA 4DV0L 1TWCH 1SLJA 4PZ6A 5H1SE 1MIUA 1XMOQ 2K14A 4OO1I 1FJGL 2HIXA 4DR3L 2CWAA 1XMOL 2VW9A 2MO1A 5IP9G 1D8LA 4C3JH 5GAEC 3I4MH 3PUWA 2Q2IA 2EIFA 4AIMA 4YY3L 3J7A5 1A63A 1VQ6A 3I4MG 2B63G 4DV3L 3CD6A 2GVAA 3TS2A 1IBLQ 3DM3A 1X55A 1KRSA 4GLVB 4R1JA 3ULLA 4UP7A 1UE6A 4GOPA 1SMXA 4B3TQ 5JJKA 1JT8A 4YCVA 4HJ9A 1N34L 2OQ0A 3KDFA 4GLAC 4LF9L 3GTMH 1P8LA 1LM0A 2IT1A 4JC0A 4X65L 1Q12A 2LXJA 3K81C 4KHZA 2HIVA 3RNUA 1PYBA 4A75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUQ B;  4HJ5 A;  4DR7 L;  4QY7 A;  4ME3 A;  4B3R Q;  4AYB E;  4IOC A;  4PG3 A;  3J80 c;  2UXD L;  1UE7 A;  3HOZ G;  3KF6 B;  2JK8 A;  4BBR H;  3AFP A;  4YCU A;  1B7Y B;  2NVY H;  5C0X G;  3U4V A;  1L1O A;  5C4J H;  4Y52 H;  3EBE A;  3GD7 A;  1XJV A;  2CWP A;  2F4V L;  2PNH A;  4DR7 Q;  3OTO L;  1N8R C;  2JA5 G;  2HT1 A;  4C3I H;  4AYB G;  3AYH B;  2F52 A;  1L2F A;  1NY4 A;  1WFQ A;  2FXQ A;  1J5E L;  2WP8 J;  3OTO Q;  1N36 L;  1PH5 A;  1VQA A;  2Q2U A;  2VUM G;  5IE8 A;  1VQO A;  5JJL A;  5JJI A;  3ER0 A;  2DUD A;  5IP9 H;  3A5U A;  5IWA L;  2Z6K C;  4B3T L;  2JA6 H;  3I56 A;  4LNQ A;  1K73 C;  2R93 H;  1HZ9 A;  3BU2 A;  2UUA L;  4DV6 L;  1WCM G;  1IBL L;  1MJE A;  4NB3 A;  2B63 H;  4B3R L;  4X6A H;  3PO2 H;  4DUY Q;  2VL6 A;  2KHI A;  2K4K A;  1XTD A;  3WWV A;  2JA8 H;  1JB7 A;  2AHO B;  1OXT A;  1S3O A;  2D62 A;  3HOW H;  2OQK A;  2IX0 A;  4JOI C;  4JBK A;  1N9W A;  2JEB I;  4JBW A;  4L5R C;  3BJU A;  3S2H H;  2JA7 H;  3G4S A;  5IYC H;  2XTI A;  4GN5 A;  3M4Q A;  2R92 H;  1P16 A;  4KI0 A;  1HH2 P;  2KEN A;  2R92 G;  1EQQ A;  1X65 A;  4DNI A;  1VQK A;  4BY7 G;  4LFB Q;  4DV4 L;  1VQH A;  4KHP L;  3NEL A;  4P73 A;  1C9O A;  1J5E Q;  3PF4 A;  4IJH A;  4JCV E;  3CXC A;  1B8A A;  3I55 A;  1C7Y A;  2GVB A;  3H3V H;  1GM5 A;  2WB1 G;  1KC8 C;  3CCR A;  4HIM A;  3VDY A;  4IPH A;  1VQ5 A;  3JC6 6;  5FJ8 G;  3FKI H;  2ZTC A;  3Q8D A;  4A4I A;  1KRT A;  5LMN Q;  4GKK L;  2VUM H;  1VQB A;  5GAD C;  4MNO A;  1SN8 A;  2AWO A;  3PCO B;  1Z47 A;  5IT9 c;  2PQA A;  5C44 H;  3J7Z C;  1E7Z A;  5JEA J;  3STB C;  3PIP A;  2WB1 E;  3DLL A;  4GLX A;  3T1Y L;  1Q86 C;  5IYD H;  4GN3 B;  4B3M Q;  2L15 A;  4A3F G;  3L7Z C;  5LMU L;  3NBH B;  3BZC A;  1TWG H;  4O2D A;  1HZB A;  3OYY A;  3ULJ A;  1E24 A;  5AJ3 Q;  3CF5 A;  3PF5 A;  1VQL A;  2ES2 A;  4PZ7 A;  3E0E A;  2HHH Q;  3S1N H;  3AQQ A;  1J6Q A;  2OCE A;  3HOX G;  3A74 A;  5AJ3 L;  2Z0S A;  3G48 A;  4WJ3 M;  3TS0 A;  3M85 A;  4GOP B;  1Y1W G;  3HOU G;  4A3K G;  3RLO A;  1OXS C;  1VQJ A;  3F2C A;  3FP9 A;  1CKO A;  5IYC G;  2RHS B;  4DV3 Q;  3PUZ A;  4P74 A;  1Y1W H;  1PH2 A;  2OTL A;  1U0L A;  3HOU H;  1H95 A;  1XNR L;  1PH8 A;  4UP8 A;  4LFB L;  1PH7 A;  4BA1 I;  3M9B A;  4J15 A;  2R7D A;  5IYB H;  2VQE Q;  1KIX A;  4LF4 Q;  1I50 H;  2ZTE A;  1M90 C;  4NXN Q;  1I6H H;  1QUQ A;  4DV1 L;  1VQI A;  4JYA L;  1MKH A;  1YEZ A;  4NXN L;  3I4N H;  3UDG A;  1KD1 C;  4JI2 L;  1TXY A;  4LF4 L;  3F8T A;  1SR3 A;  1U5K A;  4A3J G;  2C35 B;  2MFI A;  2UUB L;  1XNR Q;  3W1G A;  2JEA I;  1VCI A;  1X3F A;  1Q7Y C;  2GN5 A;  3CC7 A;  2E2H H;  1YHB A;  3GTO H;  4TVA B;  4DK6 C;  3TRE A;  1N36 Q;  4NPS A;  3CW2 C;  2VNU D;  4A3C G;  2WAQ G;  5LMU Q;  4DR3 Q;  1G6P A;  2ZM6 L;  3TQY A;  3J81 c;  3CCL A;  1S40 A;  3MEF A;  5C3E G;  1I5F A;  4GNX B;  4DV6 Q;  1I3Q H;  1HNZ L;  4GS3 A;  1UWV A;  1T9H A;  1PH6 A;  2NVQ H;  2CFM A;  4OWX B;  1PH4 A;  3M3Y H;  5M3F G;  3STB D;  4NXM L;  2UU9 Q;  2CKZ B;  1JE5 A;  4LFC L;  1VQF A;  1W2B A;  3S15 H;  2RF4 A;  2A1A A;  4WJ4 A;  4FDB A;  4LF9 Q;  2D0O A;  5DLQ E;  1EYG A;  3GTQ H;  2QA4 A;  1PH1 A;  3PO3 G;  1Y1V H;  3M4P A;  2I0Q A;  1JMC A;  4OX9 Q;  2WFW A;  3LGJ A;  4DV4 Q;  5HGQ A;  4A3L H;  1PFS A;  4LW1 A;  3W1B A;  5BR8 Q;  2MNA A;  1UE5 A;  1X3E A;  5FLM H;  2Y0S E;  5GAH C;  4DR6 L;  5FLM G;  4L5Q A;  3TRZ A;  2IHE A;  4OWW B;  1K9M C;  5M5Y H;  1FGU A;  4DR1 L;  1E3P A;  4IFD J;  4HJA A;  1PH3 A;  1PYS B;  4X66 L;  2JJQ A;  1PHJ A;  3S24 A;  2ZJP A;  1B70 B;  3FKI G;  1HZA A;  1OTC A;  3FHW A;  1Q1B A;  2K75 A;  1SFO H;  1HR0 W;  1CKN B;  3T1H Q;  4POF A;  4QL5 A;  1VQ9 A;  1CSP A;  2OTJ A;  4A3G G;  4OXP A;  2VY3 A;  4GKJ Q;  2ZTD A;  4QJF A;  3CCQ A;  2N78 A;  1YIJ A;  1V43 A;  5JEA G;  3AFQ A;  1DGS A;  1BBU A;  1HNX L;  2I5L X;  3HOW G;  1ASZ A;  1HNW L;  3A5Z B;  4ALP A;  4R4Q A;  2ID0 A;  2R7F A;  1NBW A;  2ZJR A;  2UUC Q;  3S1Q H;  5BR8 L;  4BXX G;  1FL0 A;  4JYA Q;  1VQM A;  3UDX A;  4LF5 Q;  3JAM c;  2KCT A;  2I5M X;  2K5V A;  4MZ9 A;  4QGU A;  4HIO A;  3KYH C;  1PA6 A;  3GTG H;  3HOY H;  3S2D H;  1K3R A;  3T1Y Q;  1IBK L;  1LTL A;  1O7I A;  1ASY A;  4LF5 L;  1W3S A;  3NEM A;  3CCE A;  3CCS A;  1HNW Q;  3G6E A;  1CUK A;  2Q2H A;  4JI4 L;  4P72 A;  1EOV A;  4DV7 Q;  1RIP A;  3NEN A;  3B6Y A;  3GO5 A;  2NZO A;  3KFU A;  4K0K Q;  1N32 Q;  4XTC S;  1YJ9 A;  3PUX A;  4HIK A;  1NE3 A;  2EQS A;  4GNX A;  4XIG S;  1VQE A;  4JI1 Q;  2MO0 A;  2CCZ A;  3JAM i;  4B3S L;  1D7Q A;  1XMQ Q;  4JI4 Q;  2JA6 G;  1A8V A;  1YIT A;  1GVP A;  5FJ8 H;  2ASB A;  1XNQ Q;  3I7F A;  2UXD Q;  1EIF A;  4A93 G;  1Q82 C;  3PGZ A;  2PQA B;  5M3M H;  3GTJ H;  2RCN A;  3S1R H;  1NMG A;  1VQG A;  3U58 A;  2R7Z H;  3H0G G;  4IFD I;  2UUC L;  1WCM H;  5IYD G;  4DPG A;  5LMN L;  3K80 C;  2MQH A;  4DV1 Q;  3D0F A;  1OXV A;  1HNX Q;  3KJP A;  1XPR A;  4L5S A;  2NN6 G;  3CPF A;  4DR6 Q;  3GTL H;  4BBS G;  4HJ7 A;  4JV5 L;  3PUY A;  1HZC A;  1SRO A;  1VS0 A;  1BKB A;  4OX9 L;  2PMZ E;  1L0W A;  1IBM L;  5HY6 A;  1A0I A;  1R9T H;  1YVC A;  1WYD A;  1JJC B;  5C4X H;  3H15 A;  1AH9 A;  2UXC L;  3L0O A;  4EQ5 A;  3TEH B;  3EN2 A;  4AH6 A;  3RLN A;  2N3S A;  1EUJ A;  1QVG A;  4P71 A;  1VQ7 A;  4NXM Q;  4DKA C;  5IP7 H;  4A3I G;  3U4Z A;  3AEV A;  1HJP A;  3HKS A;  3CCM A;  3CPW A;  1L1O B;  4JBJ A;  4B3S Q;  4A3B H;  4DR4 L;  4DAM A;  3J81 i;  1NMF A;  2NVX H;  4A3J H;  2AKW B;  4A3F H;  4LF6 L;  3ICE A;  1A62 A;  4DV2 Q;  3ZJY C;  5GAG C;  2B29 A;  3J80 i;  5ELN A;  2LXK A;  4DUZ Q;  4JV5 Q;  2IHF A;  4YCW A;  3ULP A;  2NVT H;  1PVO A;  4A3M G;  3EIV A;  4AQY L;  4A3C H;  3KF6 A;  4A3M H;  1SRU A;  2KCM A;  3UDI A;  4IFD G;  2JQO A;  4LUV A;  5IYB G;  1C0A A;  4YWL A;  4R4I A;  4DV5 L;  2E5L Q;  3CC4 A;  3HKZ G;  4LF8 L;  4JI8 Q;  3G71 A;  2VQE L;  1BBW A;  4DV5 Q;  2E5L L;  3GTP H;  4Y7N H;  1QZG A;  2LSS A;  4RMF A;  1IBM Q;  3I4N G;  1YHA A;  2JA9 A;  2V1C C;  4APV A;  2AWN A;  2DGY A;  1OXU A;  4YWK A;  2Q2T A;  4RG1 A;  4BY1 H;  4JI7 Q;  4JI1 L;  1IXR A;  2YV5 A;  5K36 G;  4JI2 Q;  1EIY B;  3F2D A;  1VQ8 A;  2A8V A;  5GRO A;  4LF6 Q;  4LUZ A;  5C44 G;  2HQL A;  5M5W H;  2Z6K A;  3I2Z A;  1IZ6 A;  4IPC A;  2KBN A;  1QVF A;  4A76 A;  4DR4 Q;  1N32 L;  5EAY A;  4JBM A;  3RR5 A;  1Y14 B;  4P75 A;  3CP0 A;  4DR1 Q;  3OW2 A;  4JI8 L;  1IL2 A;  4POG A;  1GD7 A;  4JI0 Q;  1UE1 A;  1YBY A;  2R6G A;  3PV0 A;  1YNX A;  1EQR A;  1X54 A;  3CCV A;  4JOI A;  4QQB X;  2QEX A;  1HR0 L;  1I94 L;  2UXB Q;  2E8G A;  3E9I A;  4H02 A;  2YU9 H;  4GKK Q;  2BH8 A;  3HKZ E;  4X62 L;  3BZK A;  4UP9 A;  4A3E H;  4JI6 Q;  4JI0 L;  3RZO H;  3HOV G;  4A3E G;  4TQU S;  3GTK H;  3M7N A;  4IOA A;  3IRB A;  5ELO A;  3S1M H;  4LFC Q;  4K0K L;  1EFW A;  3CME A;  2PI2 E;  4X62 Q;  2NN6 I;  2VZA A;  2R93 G;  2WAQ E;  2AMC B;  1AE3 A;  4BXX H;  1QVC A;  2H5X A;  3T1H L;  4BY1 G;  3CCJ A;  1RL2 A;  1K8G A;  3PO2 G;  3S14 H;  3ERS X;  4A3L G;  1I94 Q;  1L1O C;  2JA8 G;  1TWF H;  2UXB L;  3S17 H;  1Y1V G;  1FJG Q;  1Q46 A;  3I4O A;  2UXC Q;  1BVS A;  1EWI A;  2RHQ B;  4R4C A;  3HOZ H;  1IBK Q;  4DV0 Q;  2VS1 A;  4GNX C;  4MTN A;  1YJW A;  3KLW A;  3L2P A;  4HID A;  4KHP Q;  2B3G A;  4BBR G;  3K7A H;  1LUZ A;  1NJI C;  5IWA Q;  1XMQ L;  3GDE A;  3UDF A;  2KHJ A;  1SE8 A;  1G29 1;  2UUA Q;  4JI3 L;  1KHI A;  3PSI A;  3K0X A;  2JA5 H;  3RZD H;  1CKM A;  3CMA A;  2E2I H;  3KF8 B;  1N33 Q;  4JI7 L;  3UE1 A;  1K83 H;  1YZ6 A;  3E9H A;  5IY0 A;  1S72 A;  2D0P A;  2NZH A;  4DK3 C;  3CQZ H;  4EX5 A;  4LFA Q;  2I5H A;  3H0G H;  4IPD A;  2OWO A;  1PV4 A;  3H3V I;  1IYJ B;  1M1K C;  4LF8 Q;  1E1T A;  3RN2 A;  1KAW A;  4HJ8 A;  1Z9F A;  1GKH A;  1K0R A;  4DR2 L;  1XPO A;  2UU9 L;  2A19 A;  5LMN W;  4AQY Q;  2VQF L;  2BA1 A;  4JI5 Q;  1TWH H;  3M4O H;  4BBS H;  1XNQ L;  2ZM6 Q;  3HOX H;  4JI5 L;  2VQF Q;  2K50 A;  2JA7 G;  3PO3 H;  2QGQ A;  4A3K H;  1CSQ A;  4DV2 L;  3RN5 A;  4A3D H;  1N33 L;  2BA0 A;  4BY7 H;  5C0X J;  1E22 A;  3A0J A;  4GN4 B;  3W5O A;  2ATW A;  4A3D G;  4IJL A;  4UY8 C;  4JI6 L;  4DR5 L;  4X64 L;  2Y0S G;  4LF7 Q;  5M5X H;  4DV7 L;  1K8A C;  5M3F H;  1VQP A;  3J81 j;  1AE2 A;  2CQO A;  4YY3 Q;  1X56 A;  1PH9 A;  5C0X I;  1MJC A;  5FLX c;  5IP7 G;  4QIW E;  4B3M L;  4R4T A;  1HR0 Q;  2K52 A;  2IX1 A;  3CC2 A;  1WOC A;  3PUV A;  4A93 H;  4UPA A;  4X66 Q;  4LUO A;  4X65 Q;  1KQS A;  4DUY L;  1WJJ A;  3D31 A;  2K5H A;  1Q8K A;  4JG2 A;  5M3M G;  2UUB Q;  3KJO A;  3CCU A;  3KDF B;  2YTY A;  3F1Z A;  1V9P A;  1N34 Q;  4GKJ L;  1UEB A;  4DUZ L;  4O0A A;  1TWA H;  4R4O A;  1CKN A;  1G51 A;  1YHQ A;  1JJG A;  2ZJQ A;  3K7U C;  4YWM A;  2BH2 A;  5GQO A;  3KOJ A;  1X9N A;  3S16 H;  2HHH L;  4DR5 Q;  4LF7 L;  3U50 C;  1FVI A;  4A3B G;  3K8A A;  2N8N A;  1VQN A;  3HOV H;  4OWT B;  5J3B A;  2K5N A;  4IO9 A;  5C3E H;  2YYZ A;  1KXL A;  2JE6 I;  4YHH L;  1LYL A;  1YJN A;  3CAM A;  4OON A;  2F4V Q;  1Q1E A;  5C4X G;  1Q81 C;  3UE0 A;  2PI2 A;  4A3G H;  3PIO A;  1E1O A;  4C3H H;  4DAY B;  1GO3 E;  4A3I H;  2N49 A;  4PZ8 A;  3RLF A;  3SGI A;  1OXX K;  4LWC A;  4X64 Q;  3F2B A;  4DR2 Q;  4BA2 I;  1VQ4 A;  2F3I A;  4YHH Q;  1V1Q A;  1X6O A;  4C2M H;  2YTX A;  3MXN B;  5E7N A;  1QZH A;  2E2J H;  4LFA L;  2EXD A;  3HFZ B;  4OO1 G;  3HOY G;  1VQD A;  1X3G A;  1YI2 A;  4GOP C;  1KL9 A;  2R7Z G;  2IY5 B;  4IPG A;  1NTG A;  4KLK A;  4PMW A;  2ALY B;  4L5T A;  4JI3 Q;  1HNZ Q;  1XPU A;  1WI5 A;  2XGT A;  2YTV A;  1JJ2 A;  1VQC A;  4DV0 L;  1TWC H;  1SLJ A;  4PZ6 A;  5H1S E;  1MIU A;  1XMO Q;  2K14 A;  4OO1 I;  1FJG L;  2HIX A;  4DR3 L;  2CWA A;  1XMO L;  2VW9 A;  2MO1 A;  5IP9 G;  1D8L A;  4C3J H;  5GAE C;  3I4M H;  3PUW A;  2Q2I A;  2EIF A;  4AIM A;  4YY3 L;  3J7A 5;  1A63 A;  1VQ6 A;  3I4M G;  2B63 G;  4DV3 L;  3CD6 A;  2GVA A;  3TS2 A;  1IBL Q;  3DM3 A;  1X55 A;  1KRS A;  4GLV B;  4R1J A;  3ULL A;  4UP7 A;  1UE6 A;  4GOP A;  1SMX A;  4B3T Q;  5JJK A;  1JT8 A;  4YCV A;  4HJ9 A;  1N34 L;  2OQ0 A;  3KDF A;  4GLA C;  4LF9 L;  3GTM H;  1P8L A;  1LM0 A;  2IT1 A;  4JC0 A;  4X65 L;  1Q12 A;  2LXJ A;  3K81 C;  4KHZ A;  2HIV A;  3RNU A;  1PYB A;  4A75 A; 
#chains in the Genus database with same CATH topology
 4HMI A;  1LT4 D;  5IGE A;  1S5E D;  4AYB E;  3AB9 A;  4NKL A;  2XNA C;  3KF6 B;  4NP5 A;  1HCZ A;  3KUP A;  3AFP A;  2NVY H;  4CKC A;  3NXW A;  3U4V A;  2F4V L;  3GD7 A;  4ZUJ A;  2JA5 G;  2HT1 A;  1SND A;  1WFQ A;  4DFA A;  4C3I G;  4ULL A;  1VQO A;  1JR0 D;  4IQZ A;  3A5U A;  4CDE C;  2B63 H;  1IBL L;  4B3R L;  3A54 A;  3PO2 H;  2JA8 H;  1OXT A;  1S3O A;  3SK8 A;  3HOW H;  4JOI C;  4IUP A;  3BJU A;  1NSN S;  5IYC H;  3BVZ A;  1IW7 C;  3J7A F;  1P16 A;  1ZKO A;  2KEN A;  1TWG B;  1VQK A;  4KHV A;  4B9X A;  1VQH A;  4IZ8 A;  4P73 A;  1C9O A;  3CXC A;  5LHY 1;  1K8M A;  4KK7 A;  1RCV D;  2F0M A;  4HIM A;  3VDY A;  5FJ8 G;  3Q8D A;  5LMN Q;  3HOW B;  1KRT A;  4GKK L;  2VUM H;  2F0G A;  5ISR A;  4MNO A;  1ZEQ X;  1Z47 A;  1I4Q A;  1MD2 D;  5C44 H;  3J7Z C;  3PIP A;  3DLL A;  4CDD C;  4B3M Q;  1Q90 A;  1SAP A;  3L7Z C;  5JVH 3;  1TWG H;  4A3B G;  3CF5 A;  3PF5 A;  1RTO A;  5AJ3 Q;  4R8N A;  2F0L A;  1LV9 A;  3S1N H;  4A3J B;  5C4X B;  3G48 A;  2ZXP A;  4WJ3 M;  3TS0 A;  3M85 A;  5BN5 A;  3HS0 C;  1EZ8 A;  4GOP B;  1Y1W G;  1D2B A;  1OXS C;  1PH2 A;  1CKO A;  2IWH A;  2RHS B;  2OTL A;  1DON A;  4UP8 A;  4LFB L;  4BA1 I;  3M9B A;  4J15 A;  4FF1 A;  3TP5 A;  1M90 C;  2NUC A;  2IW3 A;  4BS9 A;  3C1E A;  3NQI A;  3EJI A;  3TP8 A;  5CC4 A;  5FLX L;  4JI2 L;  1JWM D;  4IN3 A;  3LX0 A;  2NVY B;  2UUB L;  1CHQ D;  3J81 E;  2K5Q A;  3ERO A;  3NPP A;  3CC7 A;  4CGY B;  1N36 Q;  3S16 B;  2KCN A;  4NPS A;  5C4Z A;  1WCM B;  2WAQ G;  4ZAI A;  1SEB D;  5I6Y A;  5COY A;  3TQY A;  3J81 c;  1PZK D;  3S2D B;  1UWV A;  4TKO B;  5M3F G;  2HUG A;  2PW7 A;  2RF4 A;  4LF9 Q;  2N88 A;  1V1P B;  3BYT B;  3K6O A;  2F0H A;  4FYD A;  2NB0 A;  3BDL A;  4K6L A;  1QJO A;  3PO3 G;  5HGQ A;  4A3L H;  5BR8 Q;  1GJX A;  4QUC A;  4L5Q A;  2IHE A;  2PO4 A;  1K9M C;  5CR3 A;  3VR6 A;  1PYS B;  4X66 L;  1HTL D;  3S24 A;  4NMZ A;  1B70 B;  2F0O A;  1SXT A;  3MFG A;  1HR0 W;  1Y1V B;  3H0G B;  4J1M A;  5D14 A;  2DY8 A;  4GKJ Q;  2LMC B;  2ZTD A;  4QJF A;  4M8A A;  1GHJ A;  3X3N A;  2R3Z A;  1DGS A;  2DY7 A;  4H44 C;  1D5M C;  1H9S B;  1F2Z A;  5BN4 A;  2ZJR A;  1NBW A;  4BXX G;  1R4Q B;  1KDB A;  4LF5 Q;  2KCT A;  4MZ9 A;  4QGU A;  1PA6 A;  3HOY H;  3I4L A;  1LTL A;  3NEM A;  5LL6 X;  1LTI D;  1EOV A;  4K0K Q;  4KKU A;  4XTC S;  3K5N A;  2B2W C;  1EOT A;  4V19 0;  5M5Y B;  2RKS A;  2B8G A;  5T1G A;  4JI4 Q;  2BDN A;  4IUR A;  2B2V C;  1EIG A;  1XNQ Q;  5HGT A;  5M3M H;  3S1R H;  3Q23 A;  2D9U A;  5FO9 B;  3J81 L;  3U58 A;  2R7Z H;  5M5X B;  1BCP B;  2UUC L;  3VYT A;  5LMN L;  2RDF A;  1CA6 A;  4DV1 Q;  1HNX Q;  3KJP A;  4L5S A;  2NN6 G;  3CPF A;  4DR6 Q;  3GTL H;  2E2I B;  4JV5 L;  1PTO F;  1STA A;  1SRO A;  2BE5 D;  2L55 A;  3QR8 A;  4NW2 A;  4OX9 L;  2PMZ E;  1A0I A;  1R9T H;  4RGN A;  1NCV A;  3I4N B;  2FHT A;  3FVQ A;  1WTO A;  2X6L A;  3TEH B;  4AH6 A;  2JXM B;  2HQE A;  4NXM Q;  1EY4 A;  1V1P A;  3GTP B;  1B50 A;  3CPW A;  4JBJ A;  1GUN A;  2EYP A;  3TME A;  2DNC A;  4DR4 L;  3BZD B;  2H4O A;  2NVX H;  2AKW B;  4ABN A;  2R93 B;  4DUZ Q;  1F2Y A;  3AU7 A;  1PZJ D;  4K2L A;  2IHF A;  2E74 C;  3ULP A;  4BY1 B;  2YU9 B;  3MA2 B;  1DOK A;  4A3M H;  1SRU A;  3UDI A;  3G7L A;  4HTH A;  4R4I A;  4J8Q A;  1SNP A;  1BR9 A;  4JI8 Q;  2A68 C;  3A8K E;  3GTP H;  3K5L A;  3I4N G;  2V1C C;  4APV A;  2AWN A;  2PNR C;  4BY1 H;  4OO1 H;  3IFT A;  4JI1 L;  4JI2 Q;  4QCL A;  3F2D A;  1VQ8 A;  4LUZ A;  4DR4 Q;  2NWG A;  5EAY A;  2M2L A;  1U4R A;  1Y14 B;  1YBY A;  2CW0 C;  3KBG A;  3W3A A;  4EVO A;  4JOI A;  4QQB X;  2QEX A;  1HR0 L;  4IUT A;  2E8G A;  4GKK Q;  5CV9 A;  4JI6 Q;  4H7B A;  1EWH A;  5EPL A;  1LTT D;  4TQU S;  3GTK H;  4L8J A;  3CME A;  2A69 C;  2R93 G;  1ENC A;  3MWY W;  1QVC A;  2VXW A;  2WAQ B;  5AFW A;  1FD7 D;  1K8G A;  3DWA A;  5D3I B;  1STB A;  5FOB B;  1JE4 A;  1FJG Q;  1Q46 A;  2VB3 X;  4R4C A;  1IBK Q;  3NWT A;  1YJW A;  4MTN A;  5M3M B;  4JVZ A;  4RGT A;  1EEI D;  4BBR G;  3K7A H;  5T1I A;  1K3B C;  1JOK A;  2XIW A;  5JAV A;  2UUA Q;  2DNE A;  4HN7 A;  3K0X A;  2LS0 1;  1R4P B;  4R8I A;  2L5T A;  1N33 Q;  4TRD A;  1YZ6 A;  3I3C A;  5COR A;  1Q8I A;  3H6M A;  4DK3 C;  3H0G H;  4IPD A;  5JEA H;  2OWO A;  3KLS A;  1QNK A;  3D4R A;  1GOZ A;  3RN2 A;  1Z9F A;  4XQJ A;  2A19 A;  4AQY Q;  3M4O H;  2BA1 A;  1M4V A;  3N52 A;  3HOX H;  4FP5 D;  2L9H A;  4U67 3;  1CM9 A;  1N33 L;  1E22 A;  4H13 C;  3WOF A;  4LF7 Q;  2QDL A;  2PZU A;  1K8A C;  1VQP A;  1TR5 A;  2CQO A;  4YY3 Q;  2G5D A;  1MJC A;  2D5D A;  2F0V A;  5FLX c;  4QIW E;  4B3M L;  1RF2 D;  2B2U A;  2XWJ B;  3S1Q B;  1WOC A;  4BY7 B;  1IW7 D;  4A3K B;  4DUY L;  1WJJ A;  3D31 A;  5D65 A;  3NQT A;  5M3M G;  2KCC A;  3A8J E;  2E76 C;  2YTY A;  1N34 Q;  1NR4 A;  4ZQ3 A;  1PXU A;  4O0A A;  3C2P A;  2LY7 A;  1CKN A;  2ZJQ A;  4YWM A;  1PYW D;  2RA4 A;  3KOJ A;  1HRJ A;  3S16 H;  1SE3 A;  1F9R A;  5EKK A;  1SNC A;  1VQN A;  4OWT B;  3G6J B;  1YJN A;  3CAM A;  4OON A;  4RGM A;  1Q1E A;  2ZT9 C;  4K6D A;  5IIF A;  2G9D A;  4IUQ A;  2F4V Q;  1E1O A;  1EFI D;  1GO3 E;  2L11 A;  1CK1 A;  1HHV A;  1G2S A;  2N49 A;  4PZ8 A;  3SGI A;  4O42 A;  4X64 Q;  4BA2 I;  1PRT D;  2BDO A;  2F3I A;  4YHH Q;  1D1I A;  2YTX A;  2F0U A;  3NE5 B;  3S17 B;  1VQD A;  1KDA A;  1YI2 A;  3V2T A;  4PMW A;  2WB1 B;  5IGF A;  1X3Q A;  3D4W A;  1GUG A;  2A69 D;  1VQC A;  4DV0 L;  1TWC H;  1S5F D;  4EQN A;  1XMO Q;  1ROD A;  2RDH A;  4OO1 I;  2QIL A;  1HA5 A;  1BO0 A;  2E2H B;  2MO1 A;  1DJR D;  5IP9 G;  3A7A B;  1IYU A;  2O2L D;  1A63 A;  2F0P A;  3CD6 A;  3DEP A;  2GVA A;  2PMZ B;  1X55 A;  1UE6 A;  1M8A A;  1SMX A;  3DXJ C;  4B3T Q;  4YCV A;  4KD3 A;  4EQO A;  4JC0 A;  1AZP A;  4DXF A;  3K81 C;  4EQP A;  1IBK L;  2QKI C;  4DR7 L;  4HJ5 A;  2D2C C;  3S14 B;  1CA5 A;  3HOZ G;  2JK8 A;  3MHB A;  5C0X G;  5C4J H;  5E1F A;  2PNH A;  1WTV A;  2CVR A;  2A73 B;  1A3T A;  2F52 A;  1ET9 A;  1NY4 A;  3E3X A;  3AYH B;  2FXQ A;  5E4X A;  1AZQ A;  3OTO Q;  5ELC A;  2F0D A;  2XRQ D;  4DXG A;  3I8Z A;  2DUD A;  3A56 A;  3AMU A;  2EOT A;  4X6A H;  1MJE A;  4QMG A;  1V8Q A;  4OEL B;  2I07 B;  4ZKB B;  2KHI A;  2K4K A;  1XTD A;  4R9W A;  1JB7 A;  3HOU B;  3T51 B;  2K1B A;  5TSS A;  4F88 A;  2IX0 A;  1JB3 A;  2B2W A;  1X3P A;  2JA7 H;  2R92 H;  4KI0 A;  1HH2 P;  4ZCK A;  1BCP F;  1X65 A;  3U9S A;  1YNN C;  2PZT A;  2B2U C;  4DV4 L;  1LO5 D;  3I73 A;  3NEL A;  1BXT A;  4IJH A;  4JCV E;  1C7Y A;  1B8A A;  3I55 A;  3H3V H;  4FXK C;  1GM5 A;  2ZTC A;  1VQB A;  2GA4 B;  1SN8 A;  5IT9 c;  3TRZ A;  2Y0S B;  3T1Y L;  3STB C;  1SE2 A;  2WB1 E;  4GLX A;  1AEX A;  2L15 A;  5LMU L;  2JA6 B;  2ES2 A;  1HZB A;  1E24 A;  2EZV A;  2DJG C;  3D6C A;  2HHH Q;  3HOX G;  1S4Z A;  3A74 A;  3F2C A;  3VR2 A;  4Q5V A;  1Y1W H;  4P74 A;  1B9M A;  1XNR L;  1PZI D;  1PH7 A;  2F03 A;  1SYE A;  2R7D A;  3VA7 A;  1KIX A;  4CJ1 B;  4UHV A;  4UAI A;  1AW7 A;  1VQI A;  2PQE A;  1MKH A;  1YEZ A;  1QB5 D;  2OT2 A;  1PFB A;  1KD1 C;  4RGO S;  1TXY A;  3ZYY X;  4LF4 L;  2EVB A;  1F2L A;  1DM0 B;  2ICE C;  2MHV A;  1VCI A;  3T4A C;  1H9J A;  2K05 A;  2EYL A;  4DK6 C;  4QIW B;  4OL7 A;  2VNU D;  4DR3 Q;  1G6P A;  1FNW A;  3GTJ B;  3GV3 A;  5C3E G;  1I3Q H;  3SK6 A;  1LTA D;  4K5W A;  1T9H A;  1PH6 A;  2UU9 Q;  5EBD A;  2CKZ B;  4XDX A;  1JE5 A;  2A1A A;  3IL8 A;  3L3O C;  2B39 A;  3KLS X;  3FPU B;  1PH1 A;  5FKA C;  2FJ2 A;  2I0Q A;  3P7J A;  1ONL A;  2MNA A;  2RSO A;  5GAH C;  2HDM A;  5CV6 A;  3LWU A;  5M5Y H;  2XRS D;  5IGG A;  1PH3 A;  1TWH B;  1TWA B;  1CKN B;  3T1H Q;  1VQ9 A;  4QL5 A;  1U9R A;  1CSP A;  1GUO A;  1UNS A;  2OTJ A;  4OXP A;  2HCC A;  2VY3 A;  1MI2 A;  1Z7T A;  1O78 A;  5EPK A;  3AFQ A;  1BNZ A;  2K5W A;  3HOW G;  2I5L X;  1A3V A;  1RKN A;  1XXG A;  3A5Z B;  4ALP A;  1HNW L;  4JYA Q;  2R7F A;  1LTS D;  5HUR A;  1FL0 A;  3Q22 A;  3NTK A;  1WD0 A;  2K5V A;  1BCP C;  4KJN A;  1I4G A;  1K3R A;  2MGS A;  1ASY A;  1W3S A;  3CCS A;  2Z9H A;  1STE A;  3A7L A;  3DUZ A;  1RIP A;  3B6Y A;  3KFU A;  2NZO A;  3CKI B;  3H91 A;  3I72 A;  1NE3 A;  2MO0 A;  1XMQ Q;  2JA6 G;  1K28 A;  5IGB A;  3VR3 A;  3D4D A;  1EIF A;  3GTJ H;  4JW0 A;  3N6R A;  5IYD G;  4IUV A;  3D0F A;  1PTO C;  2I46 A;  4BBS G;  2NN6 H;  1HZC A;  1VS0 A;  4S3S A;  2F0S A;  1L0W A;  1IBM L;  1SMY C;  1YVC A;  1EQT A;  1JJC B;  5JPM C;  3H15 A;  4WJW A;  3R2T A;  4C3H G;  1B3A A;  3L0O A;  4EQ5 A;  3NWS A;  1EU4 A;  5G3L F;  2KVM A;  2K5D A;  5IP7 H;  4A3I G;  2Z6B A;  1O7Y A;  3GV6 A;  3U4Z A;  3CCM A;  1C48 A;  3R93 A;  1DZ1 A;  3F2U A;  1A62 A;  3ZJY C;  2Z4H A;  2P5Z X;  2FFK B;  5FLX E;  4QF4 A;  2K04 A;  4YCW A;  3TP6 A;  1B53 A;  5F2D A;  2NVT H;  4AQY L;  5I2X A;  1O7Z A;  2R92 B;  1STY A;  4IFD G;  2A6E D;  4HMJ A;  5IYB G;  1EYD A;  5DAU A;  1TY0 A;  2E5L Q;  1TVX A;  1HUN A;  3G71 A;  2VQE L;  1BBW A;  2B2Y C;  1WVL A;  4DV5 Q;  5JOB A;  1IBM Q;  3S1N B;  3OHX C;  4RMF A;  4HSV A;  1YHA A;  4BBR B;  2DGY A;  4YWK A;  2Q2T A;  1XWE A;  1K8O A;  2A68 D;  3NBI A;  2A6E C;  1SNO A;  4LF6 Q;  5C44 G;  2HQL A;  1IZ6 A;  1QVF A;  5CGK A;  1EU3 A;  4JBM A;  4I7Z C;  3RR5 A;  1GUT A;  1HTP A;  4P75 A;  3WOE A;  4DR1 Q;  2EY5 A;  1EQR A;  3CCV A;  1XTC D;  2UXB Q;  3BG3 A;  3BZK A;  2KEE A;  4UP9 A;  4A3E H;  1D5Z C;  1SNM A;  2F0N A;  4K5V A;  3M7N A;  3IRB A;  4KJO A;  3S1M H;  1PLF A;  4U68 A;  4DNR B;  4K0K L;  4HSP A;  1QWY A;  2PI2 E;  3HP3 A;  5C4J B;  2AMC B;  4BXX H;  1FNU A;  2H5X A;  5EGT A;  3T1H L;  4XQN A;  3S14 H;  2B63 B;  1I94 Q;  2JA8 G;  1TWF H;  3SK5 A;  2E2J B;  1G91 A;  1EWI A;  2HCI A;  3HOZ H;  3ITP A;  3IFD A;  1LTR D;  4GNX C;  4A3F B;  3KLW A;  5FK9 C;  4KHP Q;  3GTG B;  4H0L C;  1KAB A;  5KYL A;  5KGU A;  3UDF A;  2KHJ A;  1SE8 A;  1G29 1;  1U4M A;  1HA6 A;  3RZD H;  3DHQ A;  5KEE A;  1A3U A;  4JI7 L;  3E9H A;  1S72 A;  4DAV A;  1EY9 A;  4F7X A;  5BN3 A;  3H3V I;  2EDG A;  5I2Y A;  2NTT A;  1M1K C;  4LF8 Q;  1E1T A;  5EBC A;  1B44 D;  1TWC B;  2UU9 L;  5LMN W;  4G7H C;  1G8Z D;  2CH4 A;  2VQF L;  4JI5 Q;  5A35 A;  2ZM6 Q;  2LFN A;  2JA7 G;  3PO3 H;  3IAY A;  1PRT F;  4A3D H;  1JOR A;  1KTK A;  1PTO B;  5C0X J;  2ATW A;  5ELE A;  3BVM A;  4HED A;  4X64 L;  1STG A;  4DV7 L;  1HFG A;  2K6A A;  1AE2 A;  1VMP A;  1X56 A;  1PH9 A;  4PMB A;  1DXM A;  2ZXO A;  3GTQ B;  1HR0 Q;  2IX1 A;  1PTO H;  4A93 H;  4LUO A;  5CV7 A;  4A3D B;  2BOS A;  2PYK A;  3C1F A;  4CDC C;  1Q8K A;  4JK1 C;  3CCU A;  1UEB A;  1WTW A;  1SFO B;  3SXH A;  4X3S A;  5C5L A;  4B08 A;  2KHS A;  2BH2 A;  1X9N A;  4LF7 L;  1CI3 M;  2B2Y A;  1FVI A;  5C3W A;  1MGS A;  5C4H A;  5J3B A;  1MSH A;  1KXL A;  2YYZ A;  2JE6 I;  3M3Y B;  3HOX B;  4P2C B;  4A3G H;  2PI2 A;  4C3H H;  1PFM A;  1TU2 B;  4RKL A;  5C6A A;  3F2B A;  4LWC A;  5I9P A;  4C2M H;  1I6H B;  2E2J H;  4XQQ A;  1ILQ A;  3MC0 B;  3QG1 A;  2Z1C A;  2R7Z G;  2IY5 B;  5KNB A;  4KLK A;  5DNF A;  3VYS A;  1HNZ Q;  1XPU A;  2YTV A;  1SLJ A;  1SBB B;  4TSS A;  2K14 A;  4KN4 C;  5DEH A;  5JVG 3;  2MPM A;  3OSO A;  2A5H A;  3S15 B;  1VQ6 A;  1SYD A;  2AUK A;  2B63 G;  4DV3 L;  3TDQ A;  3TS2 A;  3D3R A;  1X32 A;  4GLV B;  2RQX A;  5JJK A;  1JT8 A;  4C56 C;  1T5E A;  4HJ9 A;  3KDF A;  4X65 L;  3U9O A;  1QUQ B;  1I50 B;  1K83 B;  3J80 L;  4IOC A;  1HQM C;  1NAP A;  4BBR H;  4XT3 B;  2R61 A;  1L1O A;  2PPB C;  1XJV A;  4DR7 Q;  4WOR A;  3OTO L;  1XYI A;  3RUZ A;  1DYQ A;  4KN7 C;  1L2F A;  2WP8 J;  1N36 L;  1VQA A;  2CQA A;  2Q2U A;  5IE8 A;  2VUM G;  5JJL A;  5ELB A;  5IWA L;  4B3T L;  3FPP A;  4IUU A;  4LNQ A;  1K73 C;  3RD4 A;  1HZ9 A;  3BU2 A;  3UI2 A;  1WCM G;  1E2Z A;  4NB3 A;  4OHJ A;  4CKE A;  1GXD C;  1RHP A;  2FMM A;  2IX3 A;  4DUY Q;  2VL6 A;  3WWV A;  3ND8 A;  3A8I E;  1TS3 A;  2AHO B;  2D62 A;  4C3I B;  1II3 A;  2FIN B;  2L0C A;  2OQK A;  5KRU A;  4CKB A;  1N9W A;  3PMF A;  4L5R C;  2BCO A;  3S2H H;  4PNY A;  3GQB A;  4GN5 A;  3M4Q A;  2R92 G;  4DNI A;  1NNX A;  3HGB A;  4BY7 G;  4LFB Q;  4G4K A;  1I4R A;  2B2T A;  1J5E Q;  1LT3 D;  2E2D C;  4QUF A;  1HQR D;  2WB1 G;  4CBV A;  3CCR A;  5FO8 B;  4IPH A;  1VQ5 A;  3JC6 6;  2A6H C;  3FKI H;  3EVQ A;  1B9N A;  5EPJ A;  4OGQ C;  4FXD A;  1CZW A;  1KLG D;  5GAD C;  1MSG A;  1LAC A;  2PQA A;  1E7Z A;  5IYD H;  1Q86 C;  1YNN D;  1VF5 C;  4A3F G;  1W6J A;  4I7A A;  4B9W A;  3NBH B;  2J0T D;  3PO2 G;  3ULJ A;  2V4D A;  3E0E A;  2XWB B;  3AQQ A;  2OCE A;  5AJ3 L;  2Z0S A;  4ME5 A;  1SYG A;  3CHB D;  3HOU G;  3RLO A;  1VQJ A;  3FP9 A;  5IYC G;  1JOQ A;  3PUZ A;  1JIC A;  1A2U A;  1PH8 A;  1IL8 A;  5FO7 B;  2SEB D;  4LF4 Q;  1B1Z A;  1I50 H;  4RAU C;  1SMY D;  4NXN Q;  4DK0 A;  1CTM A;  1Z6H A;  3VYU A;  4DV1 L;  5J39 A;  4NXN L;  2R7Z B;  3K57 A;  3I4N H;  3UDG A;  4N8X 1;  2F1M A;  2SDF A;  1SR3 A;  1TS5 A;  1U5K A;  2CHB D;  3DM1 A;  2LKV A;  1FGB D;  2C35 B;  2MFI A;  1XNR Q;  2JEA I;  1Q7Y C;  3CRL C;  1EYC A;  4K8I A;  3R2I A;  3CW2 C;  3MAQ A;  1QOH A;  2ZM6 L;  1IKL A;  3TSS A;  1S40 A;  3TZU A;  4GS3 A;  2F3W A;  3DWQ A;  2AQ3 B;  2EJG C;  1OO9 B;  3SHL A;  2CFM A;  4OWX B;  1PH4 A;  2B2T C;  4LFC L;  1W2B A;  3HOV B;  2BE5 C;  3S15 H;  4FDB A;  2D0O A;  5DLQ E;  2QA4 A;  1E2V A;  1Y1V H;  2NZ1 D;  4DV4 Q;  2NBF A;  3NBH A;  4RCO A;  5M3F B;  1PFS A;  3BS1 A;  2WV6 D;  4LW1 A;  4C3H B;  1JOO A;  2A74 C;  3NSW A;  5ELF A;  5FLM H;  2X69 A;  1F9P A;  2Y0S E;  1E0B A;  1UUP A;  3X3M A;  2ICI A;  1FGU A;  2SNM A;  2QW7 A;  4IFD J;  4BBS B;  2Q8R E;  3FKI G;  1Q1B A;  2K75 A;  1BCP D;  1SFO H;  2EY1 A;  2IJ0 A;  2MUY A;  1O80 A;  4LK1 C;  2N78 A;  1V43 A;  3D6W A;  5JEA G;  3VR4 A;  2L1B A;  3BDO A;  4R4Q A;  2ID0 A;  4IUN A;  3NUC A;  5BR8 L;  1VQM A;  3UDX A;  1TQO A;  3JAM c;  1JC7 A;  3S2D H;  5KIX A;  3OMG A;  1BOS A;  3G6E A;  1SJH D;  2Q2H A;  2QCP X;  4P72 A;  4DV7 Q;  3C46 A;  1Y8N B;  1YJ9 A;  3PUX A;  5NUC A;  1VQE A;  1D7Q A;  4XYQ A;  4L6T B;  3PO3 B;  1ENA A;  1GVP A;  3KBX A;  4HAE A;  1EY7 A;  1Q82 C;  2PQA B;  3TP7 A;  3OOC A;  3LNN A;  1NMG A;  3O13 A;  4YIJ A;  4IFD I;  1WCM H;  1D1K A;  2L12 A;  3E0J A;  4DPG A;  1JCK B;  2MQH A;  1OXV A;  2EPB A;  1XPR A;  4PMC A;  1G2T A;  3OIP A;  4KKT A;  4HJ7 A;  2RCF A;  2KA7 A;  3PUY A;  1A6X A;  1ZYR D;  1FNV A;  2WKC A;  2NVQ B;  2F0F A;  1DCZ A;  2L4N A;  5HY6 A;  5C4X H;  1AH9 A;  1QG7 A;  1LT5 D;  2CW0 D;  2UXC L;  1C8C A;  2QF7 A;  1D5X C;  1EUJ A;  3QIA A;  5CYU A;  2XSC A;  5C44 B;  1HJP A;  4F8M A;  3R3O A;  1SDF A;  2AQ1 B;  1L1O B;  4B3S Q;  3D8G A;  1EWC A;  3QB3 A;  4A3B H;  4A3J H;  4A3F H;  3ICE A;  4DV2 Q;  2ZXR A;  2CH4 W;  4FF3 A;  1EL0 A;  5ELN A;  2LXK A;  1TWF B;  1PVO A;  4A3C H;  2VB2 X;  1ICW A;  4YWL A;  2VUM B;  5CV5 A;  4DV5 L;  5E4W C;  1F77 A;  2KED A;  3IKJ A;  2E5L L;  4Y7N H;  1QZG A;  2LSS A;  3PO2 B;  2JA9 A;  1PFN A;  5K36 H;  2AQ2 B;  3H3V C;  1VDZ A;  1IXR A;  3J80 E;  2YV5 A;  3NTI A;  4FNF A;  2A8V A;  1KNE A;  3M7G A;  5GRO A;  4XYO A;  3I2Z A;  3V96 A;  1LLR D;  4A3B B;  2N55 A;  1IL2 A;  5JPN C;  4POG A;  4JI0 Q;  3PV0 A;  2R6G A;  1YNX A;  2M00 A;  1X54 A;  3JAM L;  3E9I A;  4H02 A;  4CJ2 C;  2BH8 A;  4RHS A;  4X62 L;  3TN2 A;  4BWG B;  4DK1 A;  4CHT B;  3HOV G;  3MXU A;  1WTR A;  4A3E G;  1G6Z A;  1LTG D;  4AYB B;  4IOA A;  2IL8 A;  5ELO A;  1QIL A;  3MEH A;  2NN6 I;  4RHR A;  1Q3L A;  1AE3 A;  1DOL A;  4BY1 G;  3CCJ A;  4A3L G;  1L1O C;  2NVT B;  3S17 H;  1Y1V G;  3I4O A;  2UXC Q;  1BVS A;  2RHQ B;  4RA8 A;  1GHK A;  3NP8 A;  4DV0 Q;  3NK9 A;  2B3G A;  2MJ8 A;  1LUZ A;  1B4O A;  5IWA Q;  2K03 A;  3SK4 A;  1FR3 A;  3GDE A;  3PSI A;  1KHI A;  3HKZ B;  2JA5 H;  1EEF D;  1IHZ A;  4C1N K;  1CKM A;  3CMA A;  1L0X B;  2EJM A;  3KF8 B;  5IGC A;  3UE1 A;  3J7A V;  3NHH A;  2G9H D;  1PV4 A;  1TII D;  4K5X A;  1KAW A;  1TS2 A;  4A3I B;  2F0T A;  3Q6S A;  1EYA A;  4BBS H;  2XN9 C;  1H9S A;  4JI5 L;  2VQF Q;  4A3K H;  1CSQ A;  2KQ3 A;  3R8B A;  3RN5 A;  5C5M A;  2F3V A;  2BA0 A;  4BY7 H;  1HUM A;  3W5O A;  4A3D G;  4ZKC B;  4IJL A;  4UY8 C;  5CBA E;  3QOL A;  5M3F H;  5I4D A;  3J81 j;  2EYJ A;  5EKL A;  5C0X I;  1EZ6 A;  5IP7 G;  4R4T A;  2KEC A;  3PUV A;  4UPA A;  2J7Z A;  3VYR A;  3MZ5 A;  4X65 Q;  1FYC A;  4FXG C;  2UUB Q;  3KJO A;  1HPC A;  2RSN A;  2F0Q A;  1V9P A;  2JSO A;  1EY6 A;  1TWA H;  4R4O A;  1G51 A;  1YHQ A;  1JJG A;  1AN8 A;  1BF4 A;  3K7U C;  2HHH L;  5CBE E;  4DR5 Q;  3K0Y A;  2RBM A;  3U50 C;  3H94 A;  2N8N A;  1NUC A;  4G57 A;  3HOV H;  2K5N A;  5C3E H;  4YHH L;  5A2Q E;  5C4X G;  3TZD A;  1Q81 C;  4HCE A;  3K7A B;  1F2M A;  3ONA B;  4ZLT F;  1CQF A;  4DR2 Q;  2RVL A;  1VQ4 A;  1DD2 A;  2F0E A;  1X6O A;  4LFA L;  1PDQ A;  1QZH A;  1BQQ T;  3HFZ B;  1IYV A;  3OW7 A;  3HOY G;  1X3G A;  3MXN A;  4GOP C;  1KL9 A;  5IT9 E;  2ENB A;  1NTG A;  1YNJ D;  2K7V A;  4JI3 Q;  1T5X D;  1GUW A;  1L0Y B;  5CMD A;  1ENF A;  4PZ6 A;  1J8I A;  3I91 A;  2OEO A;  1FJG L;  2HIX A;  4DR3 L;  1BUV T;  1E2W A;  4OEM B;  1DOM A;  4F87 A;  4C3J H;  3I4M H;  3PUW A;  2Q2I A;  4AIM A;  4DU9 A;  2PZW A;  2F0K A;  4RCN A;  1H9K A;  1IBL Q;  3DM3 A;  1KRS A;  1H9M A;  4UP7 A;  2JN4 A;  2EY2 A;  4ID6 A;  1I3Q B;  4WFN 3;  1N34 L;  2OQ0 A;  4LF9 L;  3GTM H;  2NYZ D;  2IT1 A;  1LM0 A;  4KY5 A;  2Q8I B;  2WIN B;  2LXJ A;  3SEB A;  4KHZ A;  5CV8 A;  4GZY C;  4N9T A;  1A2T A;  4A75 A;  4MN3 A;  4QY7 A;  4ME3 A;  4B3R Q;  1CZG A;  4L63 B;  4PG3 A;  4Q0F A;  1UE7 A;  4WRD A;  3J80 c;  2UXD L;  1AP0 A;  3OIQ A;  1RTN A;  2F0I A;  1IKM A;  2DN8 A;  1B7Y B;  2OF1 A;  2Z8L A;  3DWP A;  4YCU A;  3S2H B;  4Y52 H;  3EBE A;  4ZYS A;  2CWP A;  1N8R C;  4C3I H;  4AYB G;  4OIJ A;  1WTX A;  1J5E L;  3EQL C;  1TY2 A;  4IFD H;  1PH5 A;  5JJI A;  1CHP D;  3RZO B;  1J9O A;  3ER0 A;  3HG9 A;  5IP9 H;  3BYY B;  4KV6 A;  2Z6K C;  2JA6 H;  2F0W A;  1ICF B;  3I56 A;  3T56 B;  4HCS A;  2R93 H;  2UUA L;  1SYB A;  4DV6 L;  1EQV A;  1WTP A;  3E5S A;  1Y8O B;  1Y69 U;  3W2D A;  1UAP A;  1U4P A;  2NVX B;  1Y1W B;  1SYC A;  4JBK A;  1TKW B;  2JEB I;  2E75 C;  4JBW A;  1KLU D;  3G4S A;  2XTI A;  5M5W B;  3BDC A;  5IOD A;  4DN4 M;  3L9A X;  2IPK D;  5CV4 A;  1EQQ A;  5EJW A;  3DEO A;  1RJT A;  5DM7 3;  4KHP L;  1F9S A;  3PF4 A;  4HR7 B;  2GVB A;  2JA7 B;  2HDL A;  3T16 A;  1KC8 C;  2B8F A;  1STN A;  1QCB D;  3P1H A;  3SDZ A;  4A4I A;  3PCO B;  2AWO A;  4MTK A;  3OPO A;  5JEA J;  2JP1 A;  3J7Y W;  4GN3 B;  1ZXT A;  3NTH A;  1SE4 A;  3BZC A;  3K58 A;  4O2D A;  3OYY A;  3P20 A;  2WAC A;  1VQL A;  4PZ7 A;  5LL6 S;  4Y7N B;  1J6Q A;  3MFY A;  1CQV A;  1I6V C;  4A3K G;  2QDB A;  3HOU H;  4DV3 Q;  3T53 B;  1U0L A;  1H95 A;  4CDF C;  3MXG A;  1F9Q A;  4MIU A;  3KF8 A;  4KY7 A;  5I9O A;  5IYB H;  2VQE Q;  2ZTE A;  2TSS A;  3EFX D;  4X3U A;  3VA5 A;  1I6H H;  1QUQ A;  4JYA L;  4PQX A;  1KAA A;  3QOJ A;  4NDX A;  1H9R A;  3ND9 A;  2KJX A;  1LTB D;  3F8T A;  3HZX A;  5L37 A;  4DNT B;  4A3J G;  3W1G A;  1X3F A;  3KLR A;  5KYI A;  2GN5 A;  2E2H H;  1YHB A;  2MP1 A;  4LAA A;  4TVA B;  3GTO H;  2SNS A;  3TRE A;  4C2M B;  4A3C G;  3I70 A;  2O5J C;  5LMU Q;  1S5C D;  3FDT A;  3CCL A;  3WDN A;  3MEF A;  4CJ0 B;  1I5F A;  4GNX B;  4DV6 Q;  1HNZ L;  3P75 A;  1V1O A;  4A3G B;  1NR2 A;  2UXD Q;  2NVQ H;  2Q8T A;  1WTQ A;  3M3Y H;  4NXM L;  3STB D;  1ET6 A;  1VQF A;  3Q24 A;  1S5D D;  4WJ4 A;  5IGD A;  4A93 B;  4G7O C;  3TBI B;  1EYG A;  3GTQ H;  3H09 A;  3M4P A;  1JMC A;  4OX9 Q;  2WFW A;  3LGJ A;  4X3T A;  3W1B A;  1PMR A;  1UE5 A;  1X3E A;  3S9W A;  4DR6 L;  5FLM G;  3HEJ A;  4OWW B;  3CRK C;  4DR1 L;  1E3P A;  4ILW A;  2KUM A;  2C5C A;  4HJA A;  2JJQ A;  1PHJ A;  1AFP A;  1O7L A;  2ZJP A;  1HZA A;  1OTC A;  3FHW A;  3QJY A;  4POF A;  1B3Q A;  3M4Y A;  4A3G G;  3CCQ A;  1YIJ A;  2QEJ C;  1BBU A;  2B2V A;  1HNX L;  1ASZ A;  4DF7 A;  2UUC Q;  3S1Q H;  4KMU C;  2I5M X;  4HIO A;  3KYH C;  3GTG H;  3T1Y Q;  2K32 A;  1O7I A;  1XX8 A;  4LF5 L;  3CCE A;  1HNW Q;  2X6G A;  1SSO A;  4KTA A;  4XXE A;  5C0X H;  1EY0 A;  4JI4 L;  1CUK A;  5ELD A;  5JJZ A;  3NEN A;  3GO5 A;  4OIK A;  1N32 Q;  3SVM A;  4HIK A;  5IOC A;  2EQS A;  4GNX A;  3RZD B;  4XIG S;  2WII B;  1A15 A;  4JI1 Q;  2CCZ A;  3JAM i;  4B3S L;  1A8V A;  2J4X A;  1YIT A;  5FJ8 H;  1BDO A;  2ASB A;  4ZUI A;  3I7F A;  3M4O B;  1D6E C;  4A93 G;  3PGZ A;  2EE1 A;  3S1M B;  2RCN A;  1K0S A;  1VQG A;  2Z4I A;  3H0G G;  1ILP A;  3HOZ B;  3K80 C;  1TS4 A;  4DAP A;  3GTO B;  1JQY D;  1MBY A;  3OWE B;  4FVM A;  4O1N A;  5A2Q L;  5I6W A;  1BKB A;  5KND A;  2EY6 A;  4V0B A;  3SE0 A;  1WYD A;  2H1E A;  2PW5 A;  2WKD A;  4DA2 A;  3EN2 A;  5EKI A;  4RWS C;  3RLN A;  2N3S A;  4A3E B;  2SOB A;  1QVG A;  4P71 A;  1VQ7 A;  1ML0 D;  4DKA C;  1HXY D;  1ZYR C;  3AEV A;  3MXP A;  4JPB W;  3HKS A;  5D3D A;  1RD9 D;  3PIP 3;  2HD3 A;  1ESR A;  4DAM A;  3J81 i;  4IAL A;  1NMF A;  2JA8 B;  4DAY A;  1PRT C;  4LF6 L;  3GTK B;  4LMQ D;  2NTS A;  4EGV A;  1JWU D;  5GAG C;  2B29 A;  1I4X A;  3J80 i;  2K33 A;  2C9O A;  4PV1 C;  4JV5 Q;  1LAB A;  4A3M G;  3EIV A;  5M9O A;  3K5M A;  3KF6 A;  2KCM A;  4UDU C;  2JQO A;  4LUV A;  3T13 A;  4FF2 A;  1C0A A;  4DGZ A;  3CC4 A;  3HKZ G;  4LF8 L;  2OXP A;  1BBX C;  4Z9C B;  5J22 A;  1WD1 A;  3PIO 3;  4K8J A;  4JI7 Q;  1OXU A;  1PTO D;  4K14 A;  4RG1 A;  3SR1 A;  1VF7 A;  5K36 G;  1EIY B;  5M5W H;  2Z6K A;  4IPC A;  2KBN A;  4A76 A;  1N32 L;  2AUJ D;  1EIH A;  4ODG A;  3FKI B;  3URY A;  3CP0 A;  3OW2 A;  4JI8 L;  3VR5 A;  1GD7 A;  1UE1 A;  3FEW X;  3MTS A;  3BVG A;  1W6K A;  1I94 L;  4KY6 A;  2YU9 H;  3HKZ E;  1CFM A;  4C1N I;  1ESF A;  4JI0 L;  3RZO H;  4M1U B;  3FMC A;  2KOL A;  4K2K A;  2XVS A;  3GTM B;  4LFC Q;  1EFW A;  4X62 Q;  4RFB A;  3A55 A;  4RKB A;  2VZA A;  4ZRZ A;  2WAQ E;  1VMC A;  4A3M B;  1RL2 A;  1S5B D;  3GP7 A;  3ERS X;  4N8F A;  4C3J B;  3I4M B;  2UXB L;  4E6I A;  3MVV A;  3V05 A;  1PRT B;  2VS1 A;  2EYF A;  3L2P A;  4HID A;  1JWS D;  1RDP D;  1NJI C;  1XMQ L;  1QE6 A;  4JI3 L;  4X3K A;  2E2I H;  3GTL B;  1K83 H;  2DJF C;  3FRP B;  5IY0 A;  2D0P A;  2NZH A;  3CQZ H;  4EX5 A;  1B2T A;  4LFA Q;  2I5H A;  4RH6 A;  1IYJ B;  4HJ8 A;  3S1R B;  1GKH A;  1K0R A;  4DR2 L;  1XPO A;  2O5I C;  4G7Z C;  1R9T B;  1TWH H;  3E6Z X;  1XNQ L;  5EQ0 A;  1KDC A;  2K50 A;  2QGQ A;  2K28 A;  4DV2 L;  3A0J A;  3KK7 A;  3LWE A;  3OWF A;  4GN4 B;  4JI6 L;  3Q0A A;  4DR5 L;  2Y0S G;  4KKS A;  5M5X H;  1Y8P B;  4ZK9 B;  1SNQ A;  1GUS A;  5K5P A;  3I90 A;  1SYF A;  1I4P A;  4KD4 A;  2K52 A;  3CC2 A;  4X66 Q;  5C3E B;  4LJZ C;  3RMH A;  1KQS A;  3HRZ C;  2K5H A;  2RDG A;  1UEA B;  4JG2 A;  3DMU A;  3OMC A;  3KDF B;  3F1Z A;  4GKJ L;  1U4L A;  4DUZ L;  3ERQ A;  1HFN A;  4N9P A;  3HOY B;  2FMC A;  1SJE D;  1WTH A;  1C4Q A;  1LT6 D;  2EYM A;  3CQZ B;  2PCF B;  2F0J A;  5GQO A;  3K8A A;  1YNJ C;  1I4H A;  4XT1 B;  4IO9 A;  1LYL A;  1TT2 A;  3C3L A;  2TMP A;  3UE0 A;  3K59 A;  3PIO A;  5IT9 L;  4DAY B;  4A3I H;  3QWN A;  3RLF A;  1OXX K;  5J1Z A;  1V1Q A;  2K01 A;  1MHW C;  1KNA A;  1QNU A;  3MXN B;  5E3F A;  5E7N A;  2O4X A;  3PQI A;  4OO1 G;  2EXD A;  1EY8 A;  2EYO A;  3QO2 A;  4QB4 A;  4FF4 A;  4IPG A;  4I65 A;  2ALY B;  4L5T A;  4FO2 A;  1WI5 A;  2XGT A;  1JJ2 A;  2JYO A;  5G3L D;  4J6H A;  3CU7 A;  3K5O A;  2EYH A;  5H1S E;  1MIU A;  5DM6 3;  2CWA A;  1XMO L;  1CT1 D;  1EY5 A;  2VW9 A;  1D8L A;  2F4I A;  5GAE C;  5C3X A;  2EIF A;  3J7A 5;  4YY3 L;  2EXZ A;  4C3J G;  3I4M G;  2JA5 B;  1STH A;  3JAM E;  4R1J A;  3ULL A;  4GOP A;  4MHE A;  5KNC A;  4GLA C;  2A6H D;  1P8L A;  3EA6 A;  1Q12 A;  2EJF C;  2HIV A;  3RNU A;  2M9V A;  1PYB A; 
#chains in the Genus database with same CATH homology
 1QUQ B;  4HJ5 A;  4DR7 L;  4QY7 A;  4ME3 A;  4B3R Q;  4AYB E;  4IOC A;  4PG3 A;  3J80 c;  2UXD L;  1UE7 A;  3HOZ G;  3KF6 B;  2JK8 A;  4BBR H;  3AFP A;  4YCU A;  1B7Y B;  2NVY H;  5C0X G;  3U4V A;  1L1O A;  5C4J H;  4Y52 H;  3EBE A;  3GD7 A;  1XJV A;  2CWP A;  2F4V L;  2PNH A;  4DR7 Q;  3OTO L;  1N8R C;  2JA5 G;  2HT1 A;  4C3I H;  4AYB G;  3AYH B;  2F52 A;  1L2F A;  1NY4 A;  1WFQ A;  2FXQ A;  1J5E L;  2WP8 J;  3OTO Q;  1N36 L;  1PH5 A;  1VQA A;  2Q2U A;  2VUM G;  5IE8 A;  1VQO A;  5JJL A;  5JJI A;  3ER0 A;  2DUD A;  5IP9 H;  3A5U A;  5IWA L;  2Z6K C;  4B3T L;  2JA6 H;  3I56 A;  4LNQ A;  1K73 C;  2R93 H;  1HZ9 A;  3BU2 A;  2UUA L;  4DV6 L;  1WCM G;  1IBL L;  1MJE A;  4NB3 A;  2B63 H;  4B3R L;  4X6A H;  3PO2 H;  4DUY Q;  2VL6 A;  2KHI A;  2K4K A;  1XTD A;  3WWV A;  2JA8 H;  1JB7 A;  2AHO B;  1OXT A;  1S3O A;  2D62 A;  3HOW H;  2OQK A;  2IX0 A;  4JOI C;  4JBK A;  1N9W A;  2JEB I;  4JBW A;  4L5R C;  3BJU A;  3S2H H;  2JA7 H;  3G4S A;  5IYC H;  2XTI A;  4GN5 A;  3M4Q A;  2R92 H;  1P16 A;  4KI0 A;  1HH2 P;  2KEN A;  2R92 G;  1EQQ A;  1X65 A;  4DNI A;  1VQK A;  4BY7 G;  4LFB Q;  4DV4 L;  1VQH A;  4KHP L;  3NEL A;  4P73 A;  1C9O A;  1J5E Q;  3PF4 A;  4IJH A;  4JCV E;  3CXC A;  1B8A A;  3I55 A;  1C7Y A;  2GVB A;  3H3V H;  1GM5 A;  2WB1 G;  1KC8 C;  3CCR A;  4HIM A;  3VDY A;  4IPH A;  1VQ5 A;  3JC6 6;  5FJ8 G;  3FKI H;  2ZTC A;  3Q8D A;  4A4I A;  1KRT A;  5LMN Q;  4GKK L;  2VUM H;  1VQB A;  5GAD C;  4MNO A;  1SN8 A;  2AWO A;  3PCO B;  1Z47 A;  5IT9 c;  2PQA A;  5C44 H;  3J7Z C;  1E7Z A;  5JEA J;  3STB C;  3PIP A;  2WB1 E;  3DLL A;  4GLX A;  3T1Y L;  1Q86 C;  5IYD H;  4GN3 B;  4B3M Q;  2L15 A;  4A3F G;  3L7Z C;  5LMU L;  3NBH B;  3BZC A;  1TWG H;  4O2D A;  1HZB A;  3OYY A;  3ULJ A;  1E24 A;  5AJ3 Q;  3CF5 A;  3PF5 A;  1VQL A;  2ES2 A;  4PZ7 A;  3E0E A;  2HHH Q;  3S1N H;  3AQQ A;  1J6Q A;  2OCE A;  3HOX G;  3A74 A;  5AJ3 L;  2Z0S A;  3G48 A;  4WJ3 M;  3TS0 A;  3M85 A;  4GOP B;  1Y1W G;  3HOU G;  4A3K G;  3RLO A;  1OXS C;  1VQJ A;  3F2C A;  3FP9 A;  1CKO A;  5IYC G;  2RHS B;  4DV3 Q;  3PUZ A;  4P74 A;  1Y1W H;  1PH2 A;  2OTL A;  1U0L A;  3HOU H;  1H95 A;  1XNR L;  1PH8 A;  4UP8 A;  4LFB L;  1PH7 A;  4BA1 I;  3M9B A;  4J15 A;  2R7D A;  5IYB H;  2VQE Q;  1KIX A;  4LF4 Q;  1I50 H;  2ZTE A;  1M90 C;  4NXN Q;  1I6H H;  1QUQ A;  4DV1 L;  1VQI A;  4JYA L;  1MKH A;  1YEZ A;  4NXN L;  3I4N H;  3UDG A;  1KD1 C;  4JI2 L;  1TXY A;  4LF4 L;  3F8T A;  1SR3 A;  1U5K A;  4A3J G;  2C35 B;  2MFI A;  2UUB L;  1XNR Q;  3W1G A;  2JEA I;  1VCI A;  1X3F A;  1Q7Y C;  2GN5 A;  3CC7 A;  2E2H H;  1YHB A;  3GTO H;  4TVA B;  4DK6 C;  3TRE A;  1N36 Q;  4NPS A;  3CW2 C;  2VNU D;  4A3C G;  2WAQ G;  5LMU Q;  4DR3 Q;  1G6P A;  2ZM6 L;  3TQY A;  3J81 c;  3CCL A;  1S40 A;  3MEF A;  5C3E G;  1I5F A;  4GNX B;  4DV6 Q;  1I3Q H;  1HNZ L;  4GS3 A;  1UWV A;  1T9H A;  1PH6 A;  2NVQ H;  2CFM A;  4OWX B;  1PH4 A;  3M3Y H;  5M3F G;  3STB D;  4NXM L;  2UU9 Q;  2CKZ B;  1JE5 A;  4LFC L;  1VQF A;  1W2B A;  3S15 H;  2RF4 A;  2A1A A;  4WJ4 A;  4FDB A;  4LF9 Q;  2D0O A;  5DLQ E;  1EYG A;  3GTQ H;  2QA4 A;  1PH1 A;  3PO3 G;  1Y1V H;  3M4P A;  2I0Q A;  1JMC A;  4OX9 Q;  2WFW A;  3LGJ A;  4DV4 Q;  5HGQ A;  4A3L H;  1PFS A;  4LW1 A;  3W1B A;  5BR8 Q;  2MNA A;  1UE5 A;  1X3E A;  5FLM H;  2Y0S E;  5GAH C;  4DR6 L;  5FLM G;  4L5Q A;  3TRZ A;  2IHE A;  4OWW B;  1K9M C;  5M5Y H;  1FGU A;  4DR1 L;  1E3P A;  4IFD J;  4HJA A;  1PH3 A;  1PYS B;  4X66 L;  2JJQ A;  1PHJ A;  3S24 A;  2ZJP A;  1B70 B;  3FKI G;  1HZA A;  1OTC A;  3FHW A;  1Q1B A;  2K75 A;  1SFO H;  1HR0 W;  1CKN B;  3T1H Q;  4POF A;  4QL5 A;  1VQ9 A;  1CSP A;  2OTJ A;  4A3G G;  4OXP A;  2VY3 A;  4GKJ Q;  2ZTD A;  4QJF A;  3CCQ A;  2N78 A;  1YIJ A;  1V43 A;  5JEA G;  3AFQ A;  1DGS A;  1BBU A;  1HNX L;  2I5L X;  3HOW G;  1ASZ A;  1HNW L;  3A5Z B;  4ALP A;  4R4Q A;  2ID0 A;  2R7F A;  1NBW A;  2ZJR A;  2UUC Q;  3S1Q H;  5BR8 L;  4BXX G;  1FL0 A;  4JYA Q;  1VQM A;  3UDX A;  4LF5 Q;  3JAM c;  2KCT A;  2I5M X;  2K5V A;  4MZ9 A;  4QGU A;  4HIO A;  3KYH C;  1PA6 A;  3GTG H;  3HOY H;  3S2D H;  1K3R A;  3T1Y Q;  1IBK L;  1LTL A;  1O7I A;  1ASY A;  4LF5 L;  1W3S A;  3NEM A;  3CCE A;  3CCS A;  1HNW Q;  3G6E A;  1CUK A;  2Q2H A;  4JI4 L;  4P72 A;  1EOV A;  4DV7 Q;  1RIP A;  3NEN A;  3B6Y A;  3GO5 A;  2NZO A;  3KFU A;  4K0K Q;  1N32 Q;  4XTC S;  1YJ9 A;  3PUX A;  4HIK A;  1NE3 A;  2EQS A;  4GNX A;  4XIG S;  1VQE A;  4JI1 Q;  2MO0 A;  2CCZ A;  3JAM i;  4B3S L;  1D7Q A;  1XMQ Q;  4JI4 Q;  2JA6 G;  1A8V A;  1YIT A;  1GVP A;  5FJ8 H;  2ASB A;  1XNQ Q;  3I7F A;  2UXD Q;  1EIF A;  4A93 G;  1Q82 C;  3PGZ A;  2PQA B;  5M3M H;  3GTJ H;  2RCN A;  3S1R H;  1NMG A;  1VQG A;  3U58 A;  2R7Z H;  3H0G G;  4IFD I;  2UUC L;  1WCM H;  5IYD G;  4DPG A;  5LMN L;  3K80 C;  2MQH A;  4DV1 Q;  3D0F A;  1OXV A;  1HNX Q;  3KJP A;  1XPR A;  4L5S A;  2NN6 G;  3CPF A;  4DR6 Q;  3GTL H;  4BBS G;  4HJ7 A;  4JV5 L;  3PUY A;  1HZC A;  1SRO A;  1VS0 A;  1BKB A;  4OX9 L;  2PMZ E;  1L0W A;  1IBM L;  5HY6 A;  1A0I A;  1R9T H;  1YVC A;  1WYD A;  1JJC B;  5C4X H;  3H15 A;  1AH9 A;  2UXC L;  3L0O A;  4EQ5 A;  3TEH B;  3EN2 A;  4AH6 A;  3RLN A;  2N3S A;  1EUJ A;  1QVG A;  4P71 A;  1VQ7 A;  4NXM Q;  4DKA C;  5IP7 H;  4A3I G;  3U4Z A;  3AEV A;  1HJP A;  3HKS A;  3CCM A;  3CPW A;  1L1O B;  4JBJ A;  4B3S Q;  4A3B H;  4DR4 L;  4DAM A;  3J81 i;  1NMF A;  2NVX H;  4A3J H;  2AKW B;  4A3F H;  4LF6 L;  3ICE A;  1A62 A;  4DV2 Q;  3ZJY C;  5GAG C;  2B29 A;  3J80 i;  5ELN A;  2LXK A;  4DUZ Q;  4JV5 Q;  2IHF A;  4YCW A;  3ULP A;  2NVT H;  1PVO A;  4A3M G;  3EIV A;  4AQY L;  4A3C H;  3KF6 A;  4A3M H;  1SRU A;  2KCM A;  3UDI A;  4IFD G;  2JQO A;  4LUV A;  5IYB G;  1C0A A;  4YWL A;  4R4I A;  4DV5 L;  2E5L Q;  3CC4 A;  3HKZ G;  4LF8 L;  4JI8 Q;  3G71 A;  2VQE L;  1BBW A;  4DV5 Q;  2E5L L;  3GTP H;  4Y7N H;  1QZG A;  2LSS A;  4RMF A;  1IBM Q;  3I4N G;  1YHA A;  2JA9 A;  2V1C C;  4APV A;  2AWN A;  2DGY A;  1OXU A;  4YWK A;  2Q2T A;  4RG1 A;  4BY1 H;  4JI7 Q;  4JI1 L;  1IXR A;  2YV5 A;  5K36 G;  4JI2 Q;  1EIY B;  3F2D A;  1VQ8 A;  2A8V A;  5GRO A;  4LF6 Q;  4LUZ A;  5C44 G;  2HQL A;  5M5W H;  2Z6K A;  3I2Z A;  1IZ6 A;  4IPC A;  2KBN A;  1QVF A;  4A76 A;  4DR4 Q;  1N32 L;  5EAY A;  4JBM A;  3RR5 A;  1Y14 B;  4P75 A;  3CP0 A;  4DR1 Q;  3OW2 A;  4JI8 L;  1IL2 A;  4POG A;  1GD7 A;  4JI0 Q;  1UE1 A;  1YBY A;  2R6G A;  3PV0 A;  1YNX A;  1EQR A;  1X54 A;  3CCV A;  4JOI A;  4QQB X;  2QEX A;  1HR0 L;  1I94 L;  2UXB Q;  2E8G A;  3E9I A;  4H02 A;  2YU9 H;  4GKK Q;  2BH8 A;  3HKZ E;  4X62 L;  3BZK A;  4UP9 A;  4A3E H;  4JI6 Q;  4JI0 L;  3RZO H;  3HOV G;  4A3E G;  4TQU S;  3GTK H;  3M7N A;  4IOA A;  3IRB A;  5ELO A;  3S1M H;  4LFC Q;  4K0K L;  1EFW A;  3CME A;  2PI2 E;  4X62 Q;  2NN6 I;  2VZA A;  2R93 G;  2WAQ E;  2AMC B;  1AE3 A;  4BXX H;  1QVC A;  2H5X A;  3T1H L;  4BY1 G;  3CCJ A;  1RL2 A;  1K8G A;  3PO2 G;  3S14 H;  3ERS X;  4A3L G;  1I94 Q;  1L1O C;  2JA8 G;  1TWF H;  2UXB L;  3S17 H;  1Y1V G;  1FJG Q;  1Q46 A;  3I4O A;  2UXC Q;  1BVS A;  1EWI A;  2RHQ B;  4R4C A;  3HOZ H;  1IBK Q;  4DV0 Q;  2VS1 A;  4GNX C;  4MTN A;  1YJW A;  3KLW A;  3L2P A;  4HID A;  4KHP Q;  2B3G A;  4BBR G;  3K7A H;  1LUZ A;  1NJI C;  5IWA Q;  1XMQ L;  3GDE A;  3UDF A;  2KHJ A;  1SE8 A;  1G29 1;  2UUA Q;  4JI3 L;  1KHI A;  3PSI A;  3K0X A;  2JA5 H;  3RZD H;  1CKM A;  3CMA A;  2E2I H;  3KF8 B;  1N33 Q;  4JI7 L;  3UE1 A;  1K83 H;  1YZ6 A;  3E9H A;  5IY0 A;  1S72 A;  2D0P A;  2NZH A;  4DK3 C;  3CQZ H;  4EX5 A;  4LFA Q;  2I5H A;  3H0G H;  4IPD A;  2OWO A;  1PV4 A;  3H3V I;  1IYJ B;  1M1K C;  4LF8 Q;  1E1T A;  3RN2 A;  1KAW A;  4HJ8 A;  1Z9F A;  1GKH A;  1K0R A;  4DR2 L;  1XPO A;  2UU9 L;  2A19 A;  5LMN W;  4AQY Q;  2VQF L;  2BA1 A;  4JI5 Q;  1TWH H;  3M4O H;  4BBS H;  1XNQ L;  2ZM6 Q;  3HOX H;  4JI5 L;  2VQF Q;  2K50 A;  2JA7 G;  3PO3 H;  2QGQ A;  4A3K H;  1CSQ A;  4DV2 L;  3RN5 A;  4A3D H;  1N33 L;  2BA0 A;  4BY7 H;  5C0X J;  1E22 A;  3A0J A;  4GN4 B;  3W5O A;  2ATW A;  4A3D G;  4IJL A;  4UY8 C;  4JI6 L;  4DR5 L;  4X64 L;  2Y0S G;  4LF7 Q;  5M5X H;  4DV7 L;  1K8A C;  5M3F H;  1VQP A;  3J81 j;  1AE2 A;  2CQO A;  4YY3 Q;  1X56 A;  1PH9 A;  5C0X I;  1MJC A;  5FLX c;  5IP7 G;  4QIW E;  4B3M L;  4R4T A;  1HR0 Q;  2K52 A;  2IX1 A;  3CC2 A;  1WOC A;  3PUV A;  4A93 H;  4UPA A;  4X66 Q;  4LUO A;  4X65 Q;  1KQS A;  4DUY L;  1WJJ A;  3D31 A;  2K5H A;  1Q8K A;  4JG2 A;  5M3M G;  2UUB Q;  3KJO A;  3CCU A;  3KDF B;  2YTY A;  3F1Z A;  1V9P A;  1N34 Q;  4GKJ L;  1UEB A;  4DUZ L;  4O0A A;  1TWA H;  4R4O A;  1CKN A;  1G51 A;  1YHQ A;  1JJG A;  2ZJQ A;  3K7U C;  4YWM A;  2BH2 A;  5GQO A;  3KOJ A;  1X9N A;  3S16 H;  2HHH L;  4DR5 Q;  4LF7 L;  3U50 C;  1FVI A;  4A3B G;  3K8A A;  2N8N A;  1VQN A;  3HOV H;  4OWT B;  5J3B A;  2K5N A;  4IO9 A;  5C3E H;  2YYZ A;  1KXL A;  2JE6 I;  4YHH L;  1LYL A;  1YJN A;  3CAM A;  4OON A;  2F4V Q;  1Q1E A;  5C4X G;  1Q81 C;  3UE0 A;  2PI2 A;  4A3G H;  3PIO A;  1E1O A;  4C3H H;  4DAY B;  1GO3 E;  4A3I H;  2N49 A;  4PZ8 A;  3RLF A;  3SGI A;  1OXX K;  4LWC A;  4X64 Q;  3F2B A;  4DR2 Q;  4BA2 I;  1VQ4 A;  2F3I A;  4YHH Q;  1V1Q A;  1X6O A;  4C2M H;  2YTX A;  3MXN B;  5E7N A;  1QZH A;  2E2J H;  4LFA L;  2EXD A;  3HFZ B;  4OO1 G;  3HOY G;  1VQD A;  1X3G A;  1YI2 A;  4GOP C;  1KL9 A;  2R7Z G;  2IY5 B;  4IPG A;  1NTG A;  4KLK A;  4PMW A;  2ALY B;  4L5T A;  4JI3 Q;  1HNZ Q;  1XPU A;  1WI5 A;  2XGT A;  2YTV A;  1JJ2 A;  1VQC A;  4DV0 L;  1TWC H;  1SLJ A;  4PZ6 A;  5H1S E;  1MIU A;  1XMO Q;  2K14 A;  4OO1 I;  1FJG L;  2HIX A;  4DR3 L;  2CWA A;  1XMO L;  2VW9 A;  2MO1 A;  5IP9 G;  1D8L A;  4C3J H;  5GAE C;  3I4M H;  3PUW A;  2Q2I A;  2EIF A;  4AIM A;  4YY3 L;  3J7A 5;  1A63 A;  1VQ6 A;  3I4M G;  2B63 G;  4DV3 L;  3CD6 A;  2GVA A;  3TS2 A;  1IBL Q;  3DM3 A;  1X55 A;  1KRS A;  4GLV B;  4R1J A;  3ULL A;  4UP7 A;  1UE6 A;  4GOP A;  1SMX A;  4B3T Q;  5JJK A;  1JT8 A;  4YCV A;  4HJ9 A;  1N34 L;  2OQ0 A;  3KDF A;  4GLA C;  4LF9 L;  3GTM H;  1P8L A;  1LM0 A;  2IT1 A;  4JC0 A;  4X65 L;  1Q12 A;  2LXJ A;  3K81 C;  4KHZ A;  2HIV A;  3RNU A;  1PYB A;  4A75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...