4B3ML

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mL00
4JV5Q 3D0FA 5C4JH 1XMOL 2E2IH 2V1CC 5JJKA 1S72A 2PMZE 1C7YA 1VQIA 1RL2A 1PYBA 1Q8KA 1WJJA 2YTXA 3KLWA 2VQFQ 1B8AA 4DR3Q 4DUZL 1KQSA 1G291 1EYGA 4GKKQ 3PGZA 2E5LL 4QL5A 3B6YA 2NN6I 4JI4Q 3HOXH 4JI5Q 1VQEA 1HR0L 4A3BG 5AJ3L 1PH6A 1HR0W 4A3BH 4HJ9A 1HZ9A 4NPSA 4X66Q 4P73A 3CXCA 1HJPA 1CKOA 2CWAA 4UP8A 3VDYA 2JEAI 4C3HH 3MXNB 4DR4Q 4RMFA 3CCQA 1S40A 2N3SA 3RNUA 5M3FG 1KXLA 2EQSA 1HZCA 1TWCH 2H5XA 4R4TA 1MJCA 2E8GA 5M3FH 4HIKA 1HNXQ 4LF9L 1K3RA 2B3GA 1IBML 2R93H 4PG3A 3AFPA 2F3IA 3UDFA 4A76A 4BY7G 5M5YH 3ULJA 4A3CH 4BY7H 3S1QH 2ZJPA 5K36G 1PH2A 3PF4A 4JI6L 2VS1A 3L7ZC 2DUDA 1XJVA 1E24A 3M85A 3E9IA 5BR8Q 5C44G 4TQUS 3PF5A 5C44H 1VQHA 1YNXA 1XTDA 3ER0A 2WFWA 3K0XA 3ZJYC 1NBWA 2Z6KC 1P8LA 5E7NA 3CP0A 1DGSA 3PCOB 1K9MC 4DR3L 2VQFL 2KENA 3GTKH 4GKKL 4YWMA 1YHAA 2I5HA 1MJEA 3H3VH 3S15H 2E2HH 2AMCB 1LTLA 4R4OA 4JI4L 4JI5L 4DKAC 2CQOA 4DV3Q 1QUQB 2VY3A 1HNZQ 2K52A 1VQCA 3GTPH 3GTLH 3FHWA 4DR4L 2NN6G 5LMNQ 3S14H 5IYDG 1FGUA 5IYDH 1KL9A 1WFQA 3STBC 4A75A 4KI0A 2ATWA 1D7QA 3U58A 4WJ4A 4QJFA 3NENA 4KLKA 4BBRG 1SN8A 2AWOA 3PUXA 4IPHA 4QIWE 3RLNA 4BBRH 2E2JH 5FLMH 3HOZG 3HOZH 4WJ3M 4OO1I 4Y52H 2A1AA 3HFZB 1L1OA 3MEFA 4GKJQ 1ASZA 1AE2A 2K50A 3CCSA 1N32L 3GD7A 3PO3G 2JJQA 5BR8L 2JA6H 1C9OA 1VCIA 3F8TA 5J3BA 4DK3C 1IL2A 1U5KA 1I94Q 3PO3H 3AFQA 4RG1A 4YWLA 4IFDG 2CWPA 1B7YB 1A8VA 1KAWA 1TWGH 1Q86C 5H1SE 1E1TA 3HOYH 3KDFB 4X65Q 5GADC 4DUYQ 4HJ7A 1EQQA 4BA1I 3GTOH 2F52A 3PUZA 1PH4A 3KYHC 1VQGA 3LGJA 4JI1Q 2UUAQ 1SR3A 2JE6I 4DAYB 1YJNA 1YJWA 4UP7A 3J81i 2MQHA 3T1YL 3HOWH 3TRZA 4DV3L 4B3MQ 1E3PA 1E7ZA 4P75A 4AYBG 1SE8A 3OTOQ 1IBKL 1VQBA 1VQDA 2PNHA 1HNZL 3GTMH 3JAMi 2ZJRA 2KCTA 5C3EG 4A3MG 5GQOA 5C3EH 4A3MH 1VQFA 1M1KC 2K75A 1YHQA 1A62A 4YCWA 3S1RH 2UXDQ 2KHIA 3GTQH 3F1ZA 4OXPA 4OONA 1YEZA 2PQAA 2EXDA 1WCMH 2MO0A 2JQOA 2R7ZG 1SLJA 4BA2I 4GKJL 2R7DA 3U4VA 2Q2UA 1I3QH 5HY6A 1C0AA 1VQAA 4A3DG 3HOUH 1OXXK 2JEBI 2AWNA 3G71A 1NY4A 4OO1G 2K14A 4K0KQ 2N8NA 1PH3A 4GLVB 3KJPA 4JYAQ 3S16H 4A93H 4X65L 1CSQA 1XMQQ 4DUYL 3RZOH 1JJGA 3CC4A 3TS2A 4DAMA 3J81c 1CKNB 2KCMA 4JI1L 2UUAL 3AYHB 3OW2A 4JC0A 3EBEA 1CUKA 4UP9A 4A3EG 3SGIA 4C3IH 2Y0SG 4A3EH 1YIJA 1KRSA 2MFIA 2K4KA 4B3ML 5IYBG 2HT1A 5IYBH 1A63A 2Z0SA 1EWIA 1E22A 3OTOL 3HOYG 3TREA 2PI2A 3GTGH 2Z6KA 2VQEQ 1X3EA 4HJ8A 3J7ZC 1Q46A 1EQRA 2WB1G 4AYBE 3STBD 4DV1Q 1K73C 3ERSX 1PH9A 3CCLA 3AEVA 1Y1WG 3CMEA 1NMFA 1Y1WH 2HHHQ 4JI2Q 4IOCA 1OXUA 2JA8G 4J15A 1VQ8A 2UXDL 1J6QA 4H02A 1EUJA 3M4QA 3NELA 2YU9H 4A3LG 4X64Q 4GS3A 4L5QA 4ALPA 1XNRQ 3K7AH 4YY3Q 1YJ9A 2HIXA 1YI2A 2VL6A 2R6GA 2KHJA 3BZCA 2IHEA 3JC66 4DK6C 2JA7G 3G6EA 1OTCA 2JA7H 1G6PA 4K0KL 4LUZA 3M7NA 2IX0A 3I55A 1E1OA 2HQLA 3KF6B 1N33Q 1YZ6A 4IFDI 4JYAL 4JI0Q 1LYLA 1CKMA 1QUQA 5IP7G 3NBHB 1XMQL 2YYZA 5IP7H 4DR2Q 1K8GA 1UE7A 3BJUA 3T1HQ 3H0GG 2R92G 1HNWQ 2R92H 1N32Q 3H0GH 4GNXB 1L0WA 1PH8A 1D8LA 1EIFA 2D0OA 3K8AA 3CPFA 1KC8C 2Y0SE 5GROA 1MIUA 5FLXc 3BZKA 4JOIC 2Q2TA 4LF7Q 2VQEL 4MTNA 4DV1L 3E0EA 1PH1A 4DR6Q 4DNIA 4JCVE 1NTGA 1TXYA 1JJCB 1U0LA 2JK8A 1X6OA 2WB1E 1JJ2A 1VQLA 1VQOA 4R4IA 2UXBQ 2KBNA 4GNXC 4DR1Q 2HHHL 5M5XH 1VQ7A 3CCUA 3T1YQ 4JI2L 3PUVA 4LFBQ 4GOPA 2QGQA 2UU9Q 1IBKQ 2YV5A 4JBJA 3S24A 4DV7Q 4LFCQ 4A4IA 4X64L 1X54A 1XNRL 2NVYH 4YY3L 4JG2A 4IJLA 2YTYA 3KDFA 1PHJA 2MO1A 2IHFA 3CCJA 2WAQG 1YITA 4XIGS 4B3RQ 4LF4Q 1TWAH 4EX5A 1N33L 4NB3A 5ELOA 2Q2IA 3I4MG 4OX9Q 1PVOA 3I4MH 4JI0L 1XPUA 4IO9A 2FXQA 4DR2L 1HNWL 3PUWA 3T1HL 5JEAJ 3E9HA 4GOPB 1X9NA 1PV4A 4O2DA 1KHIA 4APVA 3KOJA 5M3MG 5M3MH 1JB7A 1G51A 4IJHA 4QGUA 5GAEC 1X3FA 4AIMA 4JI7Q 1GVPA 1VS0A 4GN4B 3KF8B 4LF7L 5C0XJ 1QZGA 4DV6Q 1Z9FA 3RR5A 5IWAQ 3CAMA 3CPWA 1Q12A 2IX1A 4DR6L 1SFOH 3A74A 1UE6A 2UXBL 1I5FA 1J5EQ 3PSIA 2ALYB 4DR1L 5ELNA 4GOPC 4A3IG 2YTVA 5IP9G 3I56A 5IP9H 4LFBL 1VQJA 3A5ZB 3K7UC 3ULLA 1T9HA 2UU9L 1FJGL 4JBMA 4DV7L 4LFCL 1K8AC 1Q7YC 4FDBA 1OXSC 1AH9A 2D62A 1O7IA 1N34Q 2OTJA 4TVAB 2BA0A 4AQYQ 2VZAA 2BH2A 1PFSA 3DM3A 3S17H 1MKHA 4MZ9A 5FJ8G 1CKNA 4A3FG 4LF4L 3S1MH 2WAQE 1IXRA 2ZM6Q 4A3FH 1VQ5A 4NXNQ 5C4XG 5C4XH 2VUMG 4OX9L 2VUMH 1X3GA 3GTJH 2QEXA 4HIMA 3A5UA 2R7ZH 4KHPQ 4LW1A 4POGA 3PUYA 4IPDA 3GDEA 1N9WA 3UE0A 3CW2C 4A3DH 4HIDA 4XTCS 3CMAA 1V9PA 3M4PA 4UY8C 3S2HH 1S3OA 5JJLA 1XPRA 2PI2E 4LUOA 2AHOB 3M3YH 4JI7L 1OXVA 2JA9A 4DV6L 5IWAL 3D31A 3S2DH 1V43A 4PMWA 2OQ0A 3ULPA 1K0RA 2LXKA 2NZOA 1W2BA 3J7A5 2OQKA 1J5EL 3UDGA 3I4OA 4JBKA 1XNQQ 1H95A 2JA5G 3JAMc 5M5WH 2JA5H 3L2PA 1M90C 5IE8A 4NXMQ 2UUBQ 2UUCQ 2LXJA 4O0AA 3EN2A 2EIFA 1JT8A 1UE5A 4C3JH 3H15A 4JOIA 3KF6A 3RN5A 4PZ7A 3CCRA 1XPOA 3TQYA 1PH5A 1N34L 1TWFH 4AQYL 1IBLQ 4IOAA 2GVBA 2JA8H 2I5LX 4DR5Q 3CC2A 4QY7A 2XGTA 4GNXA 3CD6A 2IY5B 2ZM6L 3F2DA 4NXNL 3AQQA 2NVXH 4LWCA 4A3LH 4DV4Q 3KJOA 3BU2A 1CSPA 3K80C 4C2MH 4KHPL 1GM5A 4HIOA 4EQ5A 3HOVG 4JI8Q 1Z47A 3RLOA 3HOVH 4IPGA 1L2FA 1VQ6A 2OCEA 2MNAA 3M4OH 1NMGA 4HJ5A 3RN2A 4OWXB 3HOXG 3M9BA 2ZTCA 4DR7Q 1X65A 4B3TQ 3W1GA 4BBSG 3CQZH 4P74A 3CCVA 1PA6A 4BBSH 5JJIA 4YHHQ 4JI3Q 1HZAA 2GVAA 1B70B 1IZ6A 3I2ZA 1VQ4A 1XNQL 1GKHA 1QVGA 5LMUQ 2QA4A 3A0JA 4B3SQ 4NXML 1HZBA 2UUCL 2UUBL 1A0IA 4A3GG 1Y14B 2RCNA 4GN3B 3IRBA 4A3GH 2R93G 2RHQB 1LM0A 2OWOA 1EFWA 1VQMA 4A3CG 1FL0A 4MNOA 2RF4A 1Q1BA 2VW9A 1IBLL 2N49A 1UEBA 2F4VQ 2ASBA 4DR5L 2A19A 1QVCA 4DPGA 1FJGQ 3CCMA 3K81C 4R4QA 5C0XI 3HKZG 2NVQH 4B3RL 4DV4L 5GAHC 3OYYA 4PZ6A 1KIXA 5EAYA 5IY0A 2R7FA 4JI8L 3W5OA 1Q82C 4GN5A 4JV5L 3RZDH 3FP9A 2A8VA 2NVTH 4LFAQ 2IT1A 2Q2HA 4OWWB 2UXCQ 3H3VI 3GO5A 3U4ZA 1IYJB 4LNQA 1I6HH 4P71A 1OXTA 2C35B 4UPAA 1YVCA 4R1JA 4DV5Q 1YHBA 5IT9c 4DV0Q 4DR7L 4B3TL 4X66L 3W1BA 4LF5Q 4YHHL 5DLQE 4JI3L 1FVIA 4BY1G 4IFDJ 4BY1H 1I50H 4A3KG 5LMUL 2B29A 4A3KH 3KFUA 4B3SL 2WP8J 3FKIG 1LUZA 1VQKA 3FKIH 1GD7A 1BKBA 4BXXG 1Y1VG 4BXXH 1BVSA 1Y1VH 3J81j 1HNXL 3CCEA 4L5SA 4GLAC 3F2BA 4IPCA 2L15A 1UE1A 4YWKA 5FLMG 1VQPA 1YBYA 5GAGC 4KHZA 3J80i 1Q81C 4A3IH 2NZHA 2F4VL 1N36Q 1GO3E 2VNUD 3G48A 2K5HA 5IYCG 3CC7A 3PO2G 3CF5A 5IYCH 2JA6G 1VQNA 4LF8Q 5JEAG 3DLLA 4LUVA 3PO2H 4X62Q 4A3JG 3I7FA 3RLFA 3F2CA 4A3JH 1EOVA 1TWHH 2CFMA 3HKZE 3U50C 4AH6A 2B63H 2B63G 3WWVA 4ME3A 1SRUA 1NE3A 2BH8A 2LSSA 2XTIA 1EIYB 5C0XG 4Y7NH 4DV2Q 1KRTA 4LFAL 2K5NA 5FJ8H 2AKWB 1WYDA 1X55A 3UE1A 2ZJQA 2UXCL 1R9TH 3S1NH 1RIPA 4JBWA 3TS0A 1K83H 2D0PA 4LF6Q 2RHSB 4OWTB 2CCZA 3HOWG 2ZTDA 1SROA 1ASYA 3TEHB 4DV5L 4YCUA 1L1OB 2BA1A 4DV0L 2I0QA 1XMOQ 1BBUA 4QQBX 2OTLA 3PIPA 2DGYA 1W3SA 4LF5L 3UDIA 2ZTEA 4POFA 4DUZQ 5LMNL 5LMNW 2HIVA 2K5VA 3L0OA 1VQ9A 2E5LQ 1N8RC 2I5MX 3UDXA 1HR0Q 3PV0A 5AJ3Q 3J80c 4PZ8A 3PIOA 3NEMA 1JMCA 1L1OC 1WCMG 2ID0A 1PYSB 1KD1C 1N36L 3Q8DA 1NJIC 1WI5A 1QVFA 4LF8L 3HOUG 4LF9Q 4X62L 1I94L 1IBMQ 3ICEA 5HGQA 1AE3A 1SMXA 4A93G 2CKZB 1V1QA 1X56A 4JI6Q 4L5RC 3I4NG 4DV2L 3I4NH 4X6AH 1HH2P 1BBWA 4P72A 1P16A 4R4CA 1UWVA 1JE5A 1Q1EA 4YCVA 1QZHA 4HJAA 1PH7A 2N78A 3G4SA 2PQAB 4LF6L 4L5TA 3EIVA 2GN5A 3HKSA 2ES2A 1WOCA 4GLXA
chains in the Genus database with same CATH superfamily
1RJTA 1XMOL 3NHHA 4N8FA 1S72A 1VQIA 3PIP3 4GKKQ 1IYUA 1DOLA 2E5LL 1GXDC 2LS01 2NN6I 4JI4Q 1HR0L 2WAQB 1WTRA 5CMDA 1HR0W 4HJ9A 4P73A 3CXCA 1CKOA 2JEAI 4KHVA 1A2TA 3SEBA 2NTSA 1L0XB 1HNXQ 3AFPA 2F3IA 2RBMA 4H44C 4BY7G 5M5YH 4A3CH 1G91A 2ZJPA 2HD3A 4JI6L 1JR0D 1E24A 1SAPA 1AZPA 1O7ZA 1VQHA 4A3IB 3D4DA 1KAAA 1SJED 1B53A 1U4RA 4ZQ3A 3PCOB 1DGSA 1SNCA 4G7ZC 4ZKCB 1YHAA 1MJEA 2TSSA 2B2WA 1GJXA 4R4OA 2EYJA 1QUQB 3E0JA 4QCLA 5HGTA 4F7XA 3GTPH 1F9RA 2NN6G 1FGUA 3BDCA 1KL9A 5IYDH 3STBC 3I70A 3U58A 3P1HA 2LKVA 5ISRA 4WJ4A 4XYQA 2E2JH 3RLNA 1T5EA 4QIWE 4DN4M 2F0FA 3HOZG 4IN3A 4QUFA 3M3YB 4Y52H 3HFZB 2EYFA 1FGBD 2K50A 5CV4A 2XRSD 3CCSA 1N32L 3GD7A 2JJQA 2WACA 1SNMA 4DK3C 2IW3A 4RG1A 1TR5A 1B7YB 1TWGH 1DJRD 1BBXC 4HJ7A 4BA1I 4XT3B 1Z7TA 4JI1Q 4P2CB 2UUAQ 1YJNA 1YNJD 1AEXA 3BDOA 4PQXA 5KGUA 2EY1A 4DV3L 3UI2A 4KN7C 3MXGA 3OTOQ 5CBEE 1HNZL 3GTMH 3I3CA 3JAMi 3QOJA 4A3MG 2F03A 2B2VA 1M1KC 4PNYA 4OXPA 1NCVA 2PQAA 3NWTA 4JK1C 1PRTC 3ND9A 1HHVA 1SLJA 4BA2I 3HZXA 3CQZB 4A3DG 1OXXK 1NY4A 5C4ZA 2K14A 4OO1H 2G9DA 3OOCA 4LAAA 4QF4A 4S3SA 1GHKA 3KJPA 4G7HC 1CSQA 1XMQQ 4V190 1JJGA 3MFGA 3TS2A 1CKNB 2KCMA 4FF4A 2L12A 2F0MA 1HCZA 4JC0A 1H9SA 1I4GA 5G3LD 4B3ML 1HTLD 2IX3A 1U9RA 4QMGA 5IYBH 1EWIA 3TZUA 3GTGH 5JJKA 1K73C 4HJ8A 4C3JG 4H0LC 2SDFA 1PH9A 3AEVA 4WORA 1JOOA 3H09A 5D3IB 5L37A 2HHHQ 2JA8G 2CQAA 3M4QA 4GS3A 1XNRQ 2E2HB 1V1PB 3BS1A 3K7AH 1YI2A 1RCVD 2KHJA 2JA7H 4HEDA 4K0KL 1E1OA 3S14B 4IFDI 2KQ3A 1CKMA 1Y1VB 5IP7G 3NBHB 1K8GA 4DR2Q 1PRTF 1N32Q 3T1HQ 4FXKC 2R92H 3QB3A 4XQJA 4MTKA 4ODGA 3ZYYX 1V1OA 1CTMA 2DNCA 2KCCA 1PH8A 1A15A 2D0OA 3K8AA 3PO2B 3CPFA 1F9PA 1MIUA 2Q2TA 2AUJD 3SK4A 2A6HD 4DV1L 2PYKA 1PH1A 2HCCA 2SNSA 2A68D 1NTGA 1TXYA 1U0LA 3SVMA 2B2TA 1JJ2A 4EQPA 1VQOA 4KMUC 2KOLA 2MUYA 3CCUA 4DFAA 2QGQA 3A54A 2YV5A 4JBJA 2FMCA 3MAQA 4LFCQ 1FYCA 1X54A 4YY3L 2KUMA 1STNA 4K14A 3KDFA 3CCJA 4XIGS 3M7GA 3QR8A 3NSWA 4B3RQ 1XXGA 1B9NA 2HCIA 3S1RB 3F2UA 5IODA 1HNWL 3PUWA 1S5CD 1IW7C 1LACA 4O2DA 2ZXRA 1LTGD 3P75A 4IJHA 3L3OC 1TIID 1I3QB 1QZGA 2CW0D 2OXPA 3CAMA 3CPWA 4F87A 4MN3A 2P5ZX 4CDFC 2ALYB 1R4PB 5ELNA 4GOPC 4A93B 3SK5A 3I4NB 4R8IA 1PDQA 4C3IB 1OXSC 2D62A 1TS2A 2BA0A 4AQYQ 2BH2A 3T51B 1PFSA 1TU2B 3QG1A 5FJ8G 4LF4L 1VQ5A 3VYTA 3Q23A 5C4XH 5CGKA 4KHPQ 3PUYA 3SK6A 4A3BB 1PTOD 3CW2C 4A3DH 4HIDA 1SNDA 1V9PA 3J81L 1T5XD 3TP6A 1G2TA 2PI2E 4LUOA 2B2YA 5J1ZA 3SXHA 1IHZA 1JORA 3TP5A 1J8IA 1YNNC 3S2DH 1I4QA 3NWSA 1W2BA 1JWMD 5DM63 3S1QB 3P20A 1J5EL 3J7A5 1DZ1A 3I91A 3I4OA 2JA5H 3L2PA 1NSNS 4C3JH 3KF6A 1XPOA 2MP1A 5EBCA 1C48A 2PZTA 1KLGD 1TWFH 3HS0C 5CR3A 3HRZC 2A6ED 2GVBA 2JA8H 4QY7A 4GNXA 2IY5B 2TMPA 4LJZC 1DYQA 4N9PA 4RAUC 5FO8B 4MIUA 4C1NI 1SYFA 1GUOA 1VF5C 2QEJC 1BCPB 2K1BA 2OCEA 4EVOA 1STEA 3K0YA 3PQIA 1WTHA 4IUUA 1EY8A 4R8NA 4OWXB 3MTSA 3HOXG 5LL6S 2ZTCA 2KEEA 4DF7A 3W1GA 4BBSG 5JJIA 1JOKA 2EOTA 3FEWX 4YHHQ 1EIHA 1VQ4A 1XNQL 1GKHA 5LMUQ 1UNSA 2B8FA 4B3SQ 3PO3B 2R93G 4HMJA 1TY2A 1LM0A 2Z8LA 5CC4A 5JVH3 4DAPA 2RSNA 2FHTA 3GV6A 1EFWA 1A6XA 2HDMA 2N49A 1GUSA 1QVCA 4DPGA 3CCMA 4G7OC 4DV4L 4O1NA 5GAHC 4FXGC 1PZID 5EJWA 4JV5L 2F0NA 1ENFA 2NVTH 2EJGC 4LFAQ 4FVMA 5C5LA 5C3EB 4LNQA 4P71A 3VR6A 1CA6A 2C35B 4CKBA 3BG3A 4DV5Q 5IT9c 4DV0Q 3S1MB 4DR7L 1EL0A 3K5MA 4B3TL 3SE0A 4X66L 3W1BA 4LF5Q 3OIQA 4J8QA 4A3KG 2PNRC 2EE1A 1VQKA 3FKIG 1PZJD 1BKBA 5TSSA 4BXXG 2BE5D 5KEEA 3J81j 4L5SA 1DONA 4K6DA 4N8X1 4OIKA 1ENCA 3OWEB 3S16B 1Q81C 2F4VL 3G48A 3CC7A 5IYCH 2JA6G 5JEAG 2K6AA 2AUKA 3RLFA 1VMCA 4ZCKA 2CFMA 4IURA 1EEID 3U50C 2B63H 5M5WB 1ESRA 5KNCA 3QO2A 1HQMC 2BH8A 2LSSA 2XTIA 1KRTA 1W6KA 3UE1A 4HR7B 5FJ8H 5IGDA 2ZJQA 2B2WC 2PW5A 1R9TH 5CV6A 1STYA 1Y1WB 3TS0A 1K8OA 1K83H 2D0PA 5I6WA 2CCZA 1MD2D 1TS4A 3PIPA 2DGYA 2NVXB 1PRTB 4POFA 4C2MB 1JOQA 3J7YW 4IQZA 2RCFA 1EQTA 2HIVA 3I72A 2I5MX 3P7JA 3PV0A 3X3NA 3J80c 4PZ8A 3NEMA 3X3MA 1WCMG 1PYSB 2HUGA 5EPKA 5FK9C 1KTKA 1QVFA 2PZUA 4LF8L 3H0GB 4BBSB 1IBMQ 1LV9A 5I9PA 5HGQA 1SMXA 1EY6A 2CKZB 2K7VA 4DV2L 1HH2P 1UWVA 4CGYB 5NUCA 4YCVA 4HJAA 1PH7A 2N78A 3OMGA 3EIVA 1QNUA 5JPNC 3DWAA 3KUPA 4JV5Q 2EYMA 5C4JH 2V1CC 2PMZE 2L4NA 1BUVT 1Q8KA 1WJJA 2NVYB 3E5SA 2QW7A 1B8AA 1EWHA 3VR4A 2VQFQ 3FPUB 4DR3Q 1KQSA 2EY6A 4QL5A 3HOXH 2BDOA 5AJ3L 1TWAB 1HZ9A 4QB4A 4X66Q 4C3HH 3MXNB 4DR4Q 4IZ8A 1GUWA 3CCQA 1KXLA 2K05A 2EQSA 5M3FH 1B3QA 1MJCA 3DEPA 4LF9L 1SDFA 1LTID 2R93H 3EFXD 1CI3M 2A73B 3O13A 1XYIA 2EYPA 1XWEA 3R2IA 5CV7A 2VS1A 4U673 1XJVA 1HQRD 3M85A 2AQ3B 4TQUS 3DWQA 3T4AC 3K0XA 1XTDA 3NK9A 3ZJYC 4RGTA 1G2SA 1P8LA 5E7NA 3CP0A 1TWHB 2KENA 4GKKL 1RKNA 4FF1A 4YWMA 2I5HA 4RH6A 3H3VH 2AMCB 3MC0B 4JI4L 4DKAC 4C1NK 4Y7NB 2CQOA 1LT5D 4A3FB 2RA4A 1CM9A 1VQCA 2VUMB 3GTLH 1EOTA 2CH4W 5IYDG 4I7AA 4ZYSA 4KI0A 3CRKC 1LTRD 1SN8A 1ZEQX 2AWOA 4DK1A 2NUCA 4BBRH 4B08A 3EROA 4OO1I 4G57A 2A1AA 4GKJQ 1SMYC 1ASZA 2RDHA 2JA6H 1C9OA 4U68A 5J3BA 5JEAH 1U5KA 1EYAA 1CK1A 1LABA 1A8VA 1E1TA 4DUYQ 1D6EC 1EQQA 3GTOH 3PUZA 5I2YA 4DAYB 1YJWA 4UP7A 3VR3A 3J81i 2MQHA 4L6TB 2K5DA 4AYBG 5T1IA 2ZJRA 2KCTA 2JYOA 5C5MA 5C3XA 3HOVB 2K75A 3DXJC 1YHQA 2UXDQ 2KHIA 3GTQH 3F1ZA 5BN4A 2D2CC 2EXDA 1WCMH 2DJFC 4K8JA 3U4VA 2Q2UA 2A5HA 1Y8OB 4EQOA 2KCNA 2DN8A 3I90A 4OO1G 1GUNA 3MA2B 1PH3A 1EY0A 1B50A 4O42A 1DCZA 4A3GB 3RZOH 3GP7A 2MGSA 3G7LA 3N52A 4V0BA 5ELDA 4JI1L 2UUAL 3AYHB 3EBEA 2HT1A 1KRSA 3NBIA 5IYBG 1JICA 4K5WA 3OTOL 2NVQB 2Z6KA 3HKZB 2EJMA 4AYBE 1EQRA 3STBD 3ERSX 3CCLA 1NMFA 4ZLTF 3H91A 4J15A 4DXFA 1J6QA 4H02A 2HQEA 4ALPA 1LLRD 1EU3A 1YJ9A 2HIXA 1ZXTA 4K6LA 1PTOB 1QILA 3JC66 2JA7G 1HFNA 1QJOA 1B3AA 1OTCA 2B2YC 1A3UA 1MBYA 3NXWA 2F0GA 1YZ6A 4ZUJA 4JI0Q 1LYLA 2JXMB 3VR2A 1XMQL 1QUQA 4FXDA 3BJUA 1FNUA 2R92G 2E2JB 3GQBA 4CBVA 2O2LD 3DM1A 1L0WA 2Z4IA 3BZKA 4MTNA 5FO7B 1Q8IA 3E0EA 1ZKOA 4A3JB 4DR6Q 4JCVE 2K01A 2JK8A 2RKSA 1X6OA 2UXBQ 4R4IA 2HHHL 4GNXC 1LO5D 2WKDA 3PUVA 2SOBA 4HSVA 2O4XA 2F0QA 2NTTA 2UU9Q 1PRTD 4DV7Q 1XNRL 1HUMA 2KJXA 2XWJB 4JG2A 2YTYA 1JWSD 3V05A 2Q8IB 2MO1A 1YITA 1Q3LA 2Z1CA 5I2XA 3MXUA 2X69A 4G4KA 4TKOB 1WTXA 3EA6A 4ME5A 3I4MH 4FYDA 1XPUA 4IO9A 2FXQA 4ID6A 4DR2L 3Q24A 5JEAJ 3T1HL 1ZYRC 3E9HA 1PV4A 4APVA 5M3MH 1JB7A 1G51A 5GAEC 1X3FA 2N55A 4JI7Q 1H9KA 4DV6Q 3I8ZA 3URYA 5IWAQ 1UE6A 3PSIA 3J7AF 3ULLA 1T9HA 4CKEA 4LFCL 1A2UA 4FDBA 4RHSA 1N34Q 4TVAB 1EIGA 2A69C 3K5LA 3DM3A 1C8CA 4B3RL 1CKNA 2RSOA 2ZM6Q 4NXNQ 5C4XG 5LHY1 1X3GA 4X3UA 1KLUD 1HPCA 4IPDA 4RKLA 2ICIA 3UE0A 1HRJA 3CMAA 3QWNA 3VYRA 3K7AB 2AHOB 1HXYD 2L0CA 3C3LA 3M3YH 1TWCB 3R93A 1VMPA 3NQTA 2NB0A 2I07B 2C5CA 4QIWB 4PMWA 2LXKA 1B4OA 4BY7B 1V1PA 3UDGA 4DGZA 1H95A 2JA5G 1LTAD 5IE8A 4O0AA 5EQ0A 2EIFA 3H15A 4J6HA 3CCRA 1SYBA 1F2ZA 4AQYL 3NBHA 1IBLQ 1DD2A 3W2DA 3T16A 1ENAA 3CC2A 3GTKB 4EQNA 5DM73 1EY7A 3S15B 3KJOA 5EBDA 1CSPA 1SEBD 4KHPL 3A55A 1GM5A 1IW7D 4HIOA 3T56B 4JI8Q 5KRUA 1Y8PB 4IPGA 1L2FA 1UAPA 1NMGA 4NP5A 4HJ5A 4KKUA 3H3VC 5CV8A 1WD0A 2OT2A 4ILWA 3CQZH 3CCVA 3HOZB 1IZ6A 1LTBD 4IUQA 2QA4A 3A0JA 5A35A 3K59A 1A0IA 1Y14B 3IRBA 2K32A 2ICEC 3TBIB 1FL0A 3HP3A 4MNOA 1EZ8A 5D65A 3A7LA 2A19A 4CDEC 3NUCA 4HCEA 3BZDB 4TRDA 2LY7A 4PZ6A 3HG9A 5IY0A 2R7FA 3RZDH 3FP9A 5IT9L 1PMRA 4OWWB 2K28A 1SNQA 1PFNA 2M9VA 4HN7A 1YNND 3KLSX 4A3MB 2PW7A 1I6HH 1WD1A 4UPAA 1YHBA 4YHHL 4X3SA 5DLQE 4BY1H 5LMUL 3KFUA 4KJOA 2WP8J 4B3SL 4A3DB 1Y1VH 3NE5B 3CCEA 3G6JB 1MI2A 2F0PA 5CORA 2K33A 5GAGC 3BVMA 1E2VA 4L8JA 2NZHA 1N36Q 4N9TA 2K5HA 5IYCG 3S2DB 2XIWA 3PO2H 3DLLA 3OPOA 4X62Q 5FO9B 2B63G 2LMCB 4ME3A 4HCSA 3ERQA 5C0XH 4LFAL 2K5NA 1WYDA 2IWHA 4C3JB 1RIPA 4FNFA 4LF6Q 3M4YA 4QUCA 3HOWG 3S17H 4RGNA 3PMFA 1L1OB 4YCUA 4DV0L 4DV5L 2JA8B 1BBUA 2YU9B 2DY7A 4LF5L 3J80L 4RCNA 2CVRA 2F0UA 4DUZQ 5LMNL 5LMNW 3KLSA 2K5VA 3UDXA 2F0DA 1JMCA 3GV3A 3I73A 2ID0A 2KVMA 4F88A 5A2QE 1E2WA 2E75C 1WI5A 3Q8DA 5JJZA 2K03A 1CT1D 3HOUG 1I94L 3ICEA 2B2UA 1ICWA 1TS3A 4IUTA 3I4NH 3EJIA 4P72A 1P16A 5IGBA 1JE5A 2FJ2A 5KNBA 1LT4D 3S9WA 4L5TA 5M5XB 5CV5A 4ABNA 1E2ZA 2ES2A 1WOCA 3H3VI 3ONAB 1BF4A 2E2IH 5D14A 1EY4A 3BYTB 1K28A 1RL2A 1PYBA 2YTXA 3Q6SA 3KLWA 3LWUA 1EYGA 1G291 3PGZA 1IYVA 3B6YA 1II3A 2F0SA 2PQEA 2NVTB 3D3RA 3U9SA 4JI5Q 4A3BH 4KJNA 1PH6A 3BDLA 2L11A 3MFYA 3IAYA 3BVGA 1B9MA 4UP8A 4C3HG 3PIO3 3VDYA 4GZYC 3K57A 2BOSA 3E6ZX 3NTHA 3RNUA 5M3FG 1HZCA 2H5XA 2E8GA 2LFNA 2BDNA 2HDLA 1IBML 4PG3A 1GUGA 1LTSD 1M8AA 3UDFA 4A76A 3S1QH 5BN3A 1CFMA 5K36G 3D4WA 1PH2A 5EPLA 3L7ZC 4MHEA 3D8GA 3E9IA 1U4LA 5CYUA 5BR8Q 1S5ED 3QJYA 4JPBW 3PF5A 5C44H 1YNXA 2WFWA 1NBWA 2Z6KC 1QG7A 2VXWA 3QIAA 2SEBD 1K9MC 4DR3L 2VQFL 4HMIA 3AB9A 4K8IA 5M9OA 1HA6A 4JW0A 2ENBA 2VY3A 1R9TB 2Q8RE 3FHWA 1K83B 4TSSA 4DR4L 4LK1C 5LMNQ 1D5ZC 4E6IA 2ATWA 4QJFA 1I4XA 1SSOA 3NENA 4BBRG 4IPHA 4WJ3M 1AE2A 3F8TA 5EPJA 3PO3H 1I94Q 1XTCD 2CWPA 4KY6A 1KAWA 1Q86C 1MHWC 5H1SE 5CV9A 3TP7A 4X65Q 1I6VC 1W6JA 1PH4A 2AQ2B 3KYHC 2J4XA 1VQGA 3KK7A 2JE6I 1NAPA 4WRDA 3HOWH 2KECA 1E3PA 4P75A 1SE8A 1LT6D 4XYOA 3KLRA 3OW7A 4XT1B 5GQOA 5C3EH 1VQFA 5C4JB 3BYYB 4YCWA 3T13A 4DXGA 1YEZA 1Z6HA 2KEDA 3DEOA 2R7ZG 4GKJL 3HOXB 2R7DA 3DUZA 3LNNA 2IL8A 3KBXA 2IPKD 3HOUH 2JEBI 2AWNA 3G71A 3C46A 2D9UA 2N8NA 4CJ0B 1RDPD 5J39A 1CQFA 4JYAQ 3S16H 5BN5A 1ET6A 4DUYL 3CC4A 2R93B 1XX8A 3J81c 1QE6A 1Y69U 3MXNA 3OW2A 3DMUA 3SGIA 4A3EH 2Y0SG 2K4KA 5J22A 5I9OA 1A63A 5C3WA 1E22A 2G5DA 3HOYH 4KD4A 1X3EA 2VQEQ 3J7ZC 2WB1G 2D5DA 2B2VC 3CU7A 2E2DC 3N6RA 1Y1WH 4JI2Q 2UXDL 1OXUA 1VQ8A 1I4PA 1SYGA 3FPPA 3NELA 1SMYD 2J0TD 4X64Q 3TN2A 2DY8A 3ITPA 3NP8A 3BZCA 2ZT9C 2IHEA 3G6EA 3NTKA 5IT9E 1G6PA 1I50B 4A3KB 4ZUIA 2HQLA 1N33Q 3FKIB 5K36H 3W3AA 1STHA 3H0GH 1D8LA 1EIFA 5CBAE 3LX0A 2Y0SE 5FLXc 4LF7Q 2JA6B 3WOEA 3MZ5A 1VQLA 1K3BC 1RHPA 2WB1E 1ESFA 2KBNA 2VB3X 4DR1Q 5KIXA 1VQ7A 2DNEA 4LFBQ 1D1KA 4GOPA 3GTOB 1SYCA 3S1NB 3S24A 4A4IA 2F0IA 4LMQD 2NVYH 1TT2A 2EDGA 3RD4A 1DXMA 1KDBA 1PHJA 2PMZB 2IHFA 2WAQG 4B9WA 1O7LA 1BR9A 1TWAH 4UDUC 4EX5A 4DAYA 3IKJA 5ELOA 3I4MG 4OX9Q 4JI0L 1QOHA 3D4RA 3SDZA 2E76C 5JOBA 2NBFA 3GTQB 5DEHA 1EU4A 5HURA 4GOPB 2FMMA 3J80E 1PFMA 1KHIA 1WCMB 5M3MG 2EYOA 3FRPB 1GVPA 4GN4B 1AW7A 3KF8B 5COYA 3TSSA 1Z9FA 1RODA 2B2TC 4DR6L 4OELB 1SFOH 3A74A 3MVVA 3NTIA 2PZWA 4NKLA 2UXBL 4A3IG 2MHVA 3I56A 3RZOB 4ZAIA 5E1FA 5IP9H 2UU9L 1FJGL 1V8QA 4DV7L 1K8AC 1Q7YC 3D6WA 4RWSC 1O7IA 3L9AX 4BS9A 2VZAA 1MKHA 2WAQE 1IXRA 4A3FH 1G6ZA 4XDXA 1SE2A 5LL6X 2QILA 2VUMH 3GTJH 2QEXA 2R7ZH 2XVSA 1JB3A 3A5UA 3GDEA 2F0TA 3OHXC 1ET9A 1F9QA 4XTCS 4UY8C 3S2HH 1S3OA 2WINB 1XPRA 2RDGA 1Y8NB 1PYWD 4JI7L 1OXVA 1RF2D 4DV6L 2L1BA 5IWAL 3D31A 1GHJA 1JE4A 1V43A 2OQ0A 3ULPA 1K0RA 4KD3A 5M5YB 4FF2A 1O78A 5KNDA 2I46A 4Z9CB 3JAMc 2N88A 3MWYW 1M90C 4NXMQ 2UUBQ 2UUCQ 1STGA 2LXJA 1SNPA 3EN2A 1U4PA 3BVZA 1UE5A 4JOIA 3RN5A 1N34L 2KA7A 3VA7A 4IOAA 2I5LX 4DR5Q 2XGTA 2X6LA 2ZM6L 1EFID 4NXNL 3VA5A 2CHBD 3BU2A 3K80C 1ZYRD 4DK0A 5A2QL 3RLOA 3HOVH 2RVLA 1VQ6A 5FKAC 2L5TA 3GTPB 2F0OA 5E4XA 1BDOA 3M4OH 5ELEA 2A74C 1PFBA 2ZXOA 1PLFA 1SBBB 5C4HA 3OIPA 1EYDA 1B2TA 4J1MA 2K5QA 3DWPA 4P74A 1PA6A 2QF7A 4JI3Q 1B70B 1HZAA 1TY0A 3I2ZA 2GVAA 3MEHA 4L63B 1SJHD 5EKIA 1BCPC 2MPMA 3WOFA 4BWGB 1SXTA 1QVGA 1A3TA 4KKSA 1HZBA 4DA2A 2B2UC 4GN3B 4A3GH 2RHQB 5KYLA 5M3MB 2OWOA 2A69D 1TWGB 1F77A 1IBLL 1UEBA 2ASBA 2F1MA 1FJGQ 2JSOA 3K81C 4R4QA 5C0XI 2NVQH 3OYYA 4XQNA 4JI8L 1Q82C 4GN5A 4AYBB 3GTMB 1I4HA 2Q8TA 1SNOA 2IT1A 2UXCQ 2M00A 1F2YA 2EYLA 1OXTA 1KNAA 1SYDA 4Q5VA 2F0LA 5EKKA 5IGGA 2H4OA 1PTOH 3VYUA 1IKMA 4BY1G 3FDTA 2EVBA 4CDDC 1Y1VG 2OF1A 4IPCA 4DAVA 1UE1A 5FLMG 3V96A 4CHTB 4KHZA 1CHPD 2GA4B 4A3IH 2VNUD 1GO3E 5D3DA 3PO2G 1D5MC 1BCPF 3CF5A 1S4ZA 4LUVA 3FMCA 1R4QB 2XRQD 2KHSA 3I7FA 3F2CA 1HUNA 4A3JH 1EOVA 4AH6A 2NZ1D 3WWVA 4KKTA 1SRUA 1EYCA 3GTGB 3JAME 5C0XG 3T53B 4X3KA 1X55A 5K5PA 4JBWA 2RHSB 4OWTB 1SROA 1ASYA 2I0QA 2EJFC 1XMOQ 4QQBX 1W3SA 2EZVA 3UDIA 5C6AA 4UHVA 2F0WA 1VQ9A 2E5LQ 1C4QA 2JA7B 1HR0Q 3PIOA 2RQXA 1KD1C 1N36L 5JPMC 2R92B 1STBA 4X62L 4HAEA 1K8MA 2FINB 1J9OA 1WVLA 2O5IC 4A93G 1AN8A 1DOKA 3D6CA 1X56A 3AMUA 3A56A 3Q22A 4JI6Q 4L5RC 3I4NG 4X6AH 2EYHA 1BBWA 4R4CA 2V4DA 1I4RA 1EEFD 1Q1EA 3H6MA 4OIJA 3G4SA 2PQAB 3NQIA 4LF6L 1MGSA 4C3IG 3D0FA 3A7AB 2B39A 3EVQA 1C7YA 1UEAB 4KV6A 4DUZL 4IUVA 1TS5A 3WDNA 3RZDB 1KDAA 4A3BG 1VQEA 5I6YA 1QCBD 1YNJC 4NPSA 1HJPA 3K6OA 2CWAA 1KDCA 4RCOA 1I6HB 4FF3A 4RMFA 1H9SB 1M4VA 1S40A 4RGOS 2N3SA 5E4WC 3TMEA 4HIKA 1TWCH 1TVXA 4R4TA 4XQQA 1K3RA 2B3GA 4NW2A 4BY1B 1LT3D 4FO2A 3ULJA 2F4IA 4BY7H 4KY7A 1Q90A 2JP1A 3PF4A 1D5XC 2NYZD 2DUDA 1PXUA 4DNTB 3RUZA 3Q0AA 4OHJA 4I7ZC 5C44G 3CHBD 2F0KA 3ER0A 2K04A 2F0EA 4M8AA 3TZDA 1F2MA 1IKLA 3FVQA 3GTKH 1TKWB 2R61A 5I4DA 3S15H 2E2HH 4IUNA 5T1GA 4KY5A 1LTLA 1MSHA 4CJ2C 4JI5L 1FNVA 4DV3Q 2VB2X 3AU7A 4RGMA 2CH4A 1ILPA 5C4XB 1HNZQ 2K52A 2EPBA 3DHQA 3S14H 3S17B 2NN6H 3H94A 2OEOA 1WFQA 4A75A 4OGQC 4H7BA 5F2DA 4KLKA 3PUXA 4NDXA 1D7QA 5FLMH 2XSCA 3HOZH 3OSOA 1CZGA 2Z6BA 4RA8A 1L1OA 3MEFA 3SK8A 3PO3G 5BR8L 1VCIA 1IL2A 4OL7A 1NUCA 3AFQA 4YWLA 4IFDG 2JA5B 2PCFB 1S5BD 3KDFB 3SR1A 5GADC 1ILQA 3IFTA 2F52A 3LGJA 1SR3A 1TWFB 4ZK9B 3HEJA 5DAUA 3T1YL 3TRZA 4IUPA 4B3MQ 1E7ZA 2F0JA 1IBKL 1VQBA 1VQDA 2PNHA 1B44D 3MXPA 5IGFA 1K0SA 1B1ZA 5C3EG 2A6HC 4A3MH 4CDCC 2E2IB 2A68C 1ONLA 1A62A 3S1RH 4OONA 5G3LF 2L55A 2MO0A 2JQOA 1I3QH 5HY6A 1C0AA 1VQAA 2B8GA 1G8ZD 4K0KQ 1QB5D 4GLVB 3MHBA 4A93H 2F0VA 4X65L 4DAMA 4UP9A 4A3EG 1CUKA 1AFPA 4C3IH 1YIJA 2MFIA 2Z0SA 4YIJA 3HOYG 3TREA 2PI2A 3C1FA 1PVOA 4DV1Q 1Q46A 5C44B 2F3WA 2CW0C 1Y1WG 3CMEA 1U4MA 5E3FA 4KK7A 4XXEA 2QCPX 4IOCA 2QKIC 4C56C 1EUJA 2YU9H 4A3LG 4L5QA 1RTNA 4Q0FA 4HTHA 4YY3Q 1FNWA 2EY2A 3R3OA 2VL6A 2R6GA 4DK6C 5ELCA 3K5OA 4LUZA 3M7NA 2IX0A 3I55A 3KF6B 2XWBB 4JYAL 2DJGC 1EWCA 2ZXPA 2FFKB 2YYZA 5IP7H 1HNWQ 1UE7A 2Z4HA 5FOBB 3H0GG 5FLXL 4GNXB 1PTOC 3IL8A 5ELFA 2F3VA 2WV6D 1L0YB 5GROA 1KC8C 3E3XA 4JOIC 3CKIB 4R9WA 2VQEL 3A8KE 4DNIA 2B63B 2M2LA 1JJCB 3HGBA 1TQOA 1IL8A 5M5XH 4JI2L 2RDFA 3T1YQ 5JVG3 2J7ZA 1IBKQ 4X64L 3NPPA 1QWYA 1HFGA 3HOWB 4IJLA 1H9JA 1LTTD 4DU9A 2MJ8A 4LF4Q 1N33L 4FP5D 2A6EC 4NB3A 4NMZA 2Q2IA 1JWUD 4RFBA 1X9NA 3KOJA 3ND8A 3R8BA 3U9OA 1H9RA 4QGUA 4IFDH 4AIMA 1VS0A 4UAIA 4LF7L 5C0XJ 3HOUB 3RR5A 2IX1A 1Q12A 3LWEA 1I5FA 1J5EQ 1ML0D 2BCOA 4DR1L 1PTOF 2YTVA 2Z9HA 5IP9G 4LFBL 1VQJA 3A5ZB 1GUTA 3K7UC 1FD7D 4JBMA 3SHLA 4WJWA 4A3EB 1SE3A 1AH9A 2OTJA 1D2BA 2O5JC 1DOMA 5AFWA 3HOYB 4MZ9A 4A3FG 3S1MH 1E0BA 1X32A 2VUMG 3CRLC 3VR5A 4OX9L 3I4MB 4WFN3 2XNAC 4HIMA 4LW1A 4POGA 1KNEA 1N9WA 1OO9B 4C3HB 5DNFA 3M4PA 1BNZA 3A8JE 4RHRA 5JJLA 3QOLA 5M3FB 2JA9A 1CZWA 3JAML 3R2TA 1WTOA 5IIFA 4I65A 1D1IA 2NZOA 3V2TA 2IJ0A 2OQKA 4JBKA 1XNQQ 1CQVA 5M5WH 2PPBC 2JN4A 1PZKD 4K5VA 4PZ7A 2BE5C 3TQYA 1HA5A 4HSPA 1PH5A 2XN9C 2WKCA 1EZ6A 1SE4A 5EGTA 4OEMB 3CD6A 2K5WA 3TP8A 3F2DA 3AQQA 4EGVA 4LWCA 2NVXH 4A3LH 4DV4Q 1S5DD 2F0HA 4C2MH 4EQ5A 3HOVG 1Z47A 2QDLA 1NNXA 1EQVA 3GTLB 2MNAA 1NR2A 4KN4C 3OWFA 3RN2A 1O7YA 1CHQD 3M9BA 4CKCA 5EKLA 4DR7Q 1X65A 4B3TQ 4BBRB 3K5NA 4BBSH 2WIIB 4RKBA 1JCKB 2EXZA 1AP0A 1WTPA 4NXML 2UUCL 2UUBL 4A3GG 2RCNA 4PMBA 1EY9A 1VQMA 4A3CG 1X3PA 1QNKA 2RF4A 1Q1BA 4X3TA 5ELBA 1AZQA 2VW9A 2SNMA 2F4VQ 1F2LA 2PO4A 4DR5L 3KBGA 1SFOB 3HKZG 4ZRZA 1JQYD 1KIXA 5EAYA 3W5OA 3IFDA 3KF8A 2E74C 1RTOA 2A8VA 1H9MA 2Q2HA 4IALA 3GO5A 3U4ZA 3I4LA 1IYJB 3RMHA 4ULLA 1YVCA 1GOZA 4R1JA 3K58A 2X6GA 2EY5A 4JI3L 1WTQA 1FVIA 4IFDJ 1I50H 1STAA 3GTJB 2R7ZB 2B29A 4A3KH 1X3QA 3J7AV 1LUZA 4CJ1B 3FKIH 1GD7A 4BXXH 1BVSA 1HNXL 4GLAC 3F2BA 3S2HB 2L15A 4YWKA 1WTWA 1VQPA 1YBYA 1A3VA 3J80i 1JT8A 1NR4A 2L9HA 1VQNA 4LF8Q 3OMCA 1BXTA 4KTAA 4A3JG 2QDBA 3J81E 1TWHH 3HKZE 4B9XA 2Y0SB 4K2LA 4PV1C 1CA5A 4DNRB 1NE3A 5IGCA 1EIYB 4Y7NH 4DV2Q 1WTVA 2AKWB 2UXCL 2WB1B 1O80A 3VYSA 1VDZA 5IGEA 3S1NH 1UUPA 2H1EA 1EY5A 2ZTDA 1VF7A 3C1EA 3TEHB 2BA1A 3A8IE 1MSGA 2OTLA 1BCPD 1FR3A 1KABA 2G9HD 1SYEA 2ZTEA 3EQLC 1RD9D 1JC7A 2C9OA 3L0OA 1N8RC 5JAVA 4ZKBB 5AJ3Q 4K5XA 1BOSA 3M4OB 4JVZA 1L1OC 1S5FD 2AQ1B 1ICFB 4K2KA 1NJIC 1F9SA 4LF9Q 4F8MA 1DM0B 5IOCA 1BO0A 2NWGA 4H13C 1AE3A 4M1UB 1V1QA 3TDQA 4PMCA 5FLXE 1HTPA 1BQQT 5KYIA 1QZHA 2R3ZA 3C2PA 2GN5A 3HKSA 4GLXA
chains in the Genus database with same CATH topology
4JV5Q 3D0FA 5C4JH 1XMOL 2E2IH 2V1CC 5JJKA 1S72A 2PMZE 1C7YA 1VQIA 1RL2A 1PYBA 1Q8KA 1WJJA 2YTXA 3KLWA 2VQFQ 1B8AA 4DR3Q 4DUZL 1KQSA 1G291 1EYGA 4GKKQ 3PGZA 2E5LL 4QL5A 3B6YA 2NN6I 4JI4Q 3HOXH 4JI5Q 1VQEA 1HR0L 4A3BG 5AJ3L 1PH6A 1HR0W 4A3BH 4HJ9A 1HZ9A 4NPSA 4X66Q 4P73A 3CXCA 1HJPA 1CKOA 2CWAA 4UP8A 3VDYA 2JEAI 4C3HH 3MXNB 4DR4Q 4RMFA 3CCQA 1S40A 2N3SA 3RNUA 5M3FG 1KXLA 2EQSA 1HZCA 1TWCH 2H5XA 4R4TA 1MJCA 2E8GA 5M3FH 4HIKA 1HNXQ 4LF9L 1K3RA 2B3GA 1IBML 2R93H 4PG3A 3AFPA 2F3IA 3UDFA 4A76A 4BY7G 5M5YH 3ULJA 4A3CH 4BY7H 3S1QH 2ZJPA 5K36G 1PH2A 3PF4A 4JI6L 2VS1A 3L7ZC 2DUDA 1XJVA 1E24A 3M85A 3E9IA 5BR8Q 5C44G 4TQUS 3PF5A 5C44H 1VQHA 1YNXA 1XTDA 3ER0A 2WFWA 3K0XA 3ZJYC 1NBWA 2Z6KC 1P8LA 5E7NA 3CP0A 1DGSA 3PCOB 1K9MC 4DR3L 2VQFL 2KENA 3GTKH 4GKKL 4YWMA 1YHAA 2I5HA 1MJEA 3H3VH 3S15H 2E2HH 2AMCB 1LTLA 4R4OA 4JI4L 4JI5L 4DKAC 2CQOA 4DV3Q 1QUQB 2VY3A 1HNZQ 2K52A 1VQCA 3GTPH 3GTLH 3FHWA 4DR4L 2NN6G 5LMNQ 3S14H 5IYDG 1FGUA 5IYDH 1KL9A 1WFQA 3STBC 4A75A 4KI0A 2ATWA 1D7QA 3U58A 4WJ4A 4QJFA 3NENA 4KLKA 4BBRG 1SN8A 2AWOA 3PUXA 4IPHA 4QIWE 3RLNA 4BBRH 2E2JH 5FLMH 3HOZG 3HOZH 4WJ3M 4OO1I 4Y52H 2A1AA 3HFZB 1L1OA 3MEFA 4GKJQ 1ASZA 1AE2A 2K50A 3CCSA 1N32L 3GD7A 3PO3G 2JJQA 5BR8L 2JA6H 1C9OA 1VCIA 3F8TA 5J3BA 4DK3C 1IL2A 1U5KA 1I94Q 3PO3H 3AFQA 4RG1A 4YWLA 4IFDG 2CWPA 1B7YB 1A8VA 1KAWA 1TWGH 1Q86C 5H1SE 1E1TA 3HOYH 3KDFB 4X65Q 5GADC 4DUYQ 4HJ7A 1EQQA 4BA1I 3GTOH 2F52A 3PUZA 1PH4A 3KYHC 1VQGA 3LGJA 4JI1Q 2UUAQ 1SR3A 2JE6I 4DAYB 1YJNA 1YJWA 4UP7A 3J81i 2MQHA 3T1YL 3HOWH 3TRZA 4DV3L 4B3MQ 1E3PA 1E7ZA 4P75A 4AYBG 1SE8A 3OTOQ 1IBKL 1VQBA 1VQDA 2PNHA 1HNZL 3GTMH 3JAMi 2ZJRA 2KCTA 5C3EG 4A3MG 5GQOA 5C3EH 4A3MH 1VQFA 1M1KC 2K75A 1YHQA 1A62A 4YCWA 3S1RH 2UXDQ 2KHIA 3GTQH 3F1ZA 4OXPA 4OONA 1YEZA 2PQAA 2EXDA 1WCMH 2MO0A 2JQOA 2R7ZG 1SLJA 4BA2I 4GKJL 2R7DA 3U4VA 2Q2UA 1I3QH 5HY6A 1C0AA 1VQAA 4A3DG 3HOUH 1OXXK 2JEBI 2AWNA 3G71A 1NY4A 4OO1G 2K14A 4K0KQ 2N8NA 1PH3A 4GLVB 3KJPA 4JYAQ 3S16H 4A93H 4X65L 1CSQA 1XMQQ 4DUYL 3RZOH 1JJGA 3CC4A 3TS2A 4DAMA 3J81c 1CKNB 2KCMA 4JI1L 2UUAL 3AYHB 3OW2A 4JC0A 3EBEA 1CUKA 4UP9A 4A3EG 3SGIA 4C3IH 2Y0SG 4A3EH 1YIJA 1KRSA 2MFIA 2K4KA 4B3ML 5IYBG 2HT1A 5IYBH 1A63A 2Z0SA 1EWIA 1E22A 3OTOL 3HOYG 3TREA 2PI2A 3GTGH 2Z6KA 2VQEQ 1X3EA 4HJ8A 3J7ZC 1Q46A 1EQRA 2WB1G 4AYBE 3STBD 4DV1Q 1K73C 3ERSX 1PH9A 3CCLA 3AEVA 1Y1WG 3CMEA 1NMFA 1Y1WH 2HHHQ 4JI2Q 4IOCA 1OXUA 2JA8G 4J15A 1VQ8A 2UXDL 1J6QA 4H02A 1EUJA 3M4QA 3NELA 2YU9H 4A3LG 4X64Q 4GS3A 4L5QA 4ALPA 1XNRQ 3K7AH 4YY3Q 1YJ9A 2HIXA 1YI2A 2VL6A 2R6GA 2KHJA 3BZCA 2IHEA 3JC66 4DK6C 2JA7G 3G6EA 1OTCA 2JA7H 1G6PA 4K0KL 4LUZA 3M7NA 2IX0A 3I55A 1E1OA 2HQLA 3KF6B 1N33Q 1YZ6A 4IFDI 4JYAL 4JI0Q 1LYLA 1CKMA 1QUQA 5IP7G 3NBHB 1XMQL 2YYZA 5IP7H 4DR2Q 1K8GA 1UE7A 3BJUA 3T1HQ 3H0GG 2R92G 1HNWQ 2R92H 1N32Q 3H0GH 4GNXB 1L0WA 1PH8A 1D8LA 1EIFA 2D0OA 3K8AA 3CPFA 1KC8C 2Y0SE 5GROA 1MIUA 5FLXc 3BZKA 4JOIC 2Q2TA 4LF7Q 2VQEL 4MTNA 4DV1L 3E0EA 1PH1A 4DR6Q 4DNIA 4JCVE 1NTGA 1TXYA 1JJCB 1U0LA 2JK8A 1X6OA 2WB1E 1JJ2A 1VQLA 1VQOA 4R4IA 2UXBQ 2KBNA 4GNXC 4DR1Q 2HHHL 5M5XH 1VQ7A 3CCUA 3T1YQ 4JI2L 3PUVA 4LFBQ 4GOPA 2QGQA 2UU9Q 1IBKQ 2YV5A 4JBJA 3S24A 4DV7Q 4LFCQ 4A4IA 4X64L 1X54A 1XNRL 2NVYH 4YY3L 4JG2A 4IJLA 2YTYA 3KDFA 1PHJA 2MO1A 2IHFA 3CCJA 2WAQG 1YITA 4XIGS 4B3RQ 4LF4Q 1TWAH 4EX5A 1N33L 4NB3A 5ELOA 2Q2IA 3I4MG 4OX9Q 1PVOA 3I4MH 4JI0L 1XPUA 4IO9A 2FXQA 4DR2L 1HNWL 3PUWA 3T1HL 5JEAJ 3E9HA 4GOPB 1X9NA 1PV4A 4O2DA 1KHIA 4APVA 3KOJA 5M3MG 5M3MH 1JB7A 1G51A 4IJHA 4QGUA 5GAEC 1X3FA 4AIMA 4JI7Q 1GVPA 1VS0A 4GN4B 3KF8B 4LF7L 5C0XJ 1QZGA 4DV6Q 1Z9FA 3RR5A 5IWAQ 3CAMA 3CPWA 1Q12A 2IX1A 4DR6L 1SFOH 3A74A 1UE6A 2UXBL 1I5FA 1J5EQ 3PSIA 2ALYB 4DR1L 5ELNA 4GOPC 4A3IG 2YTVA 5IP9G 3I56A 5IP9H 4LFBL 1VQJA 3A5ZB 3K7UC 3ULLA 1T9HA 2UU9L 1FJGL 4JBMA 4DV7L 4LFCL 1K8AC 1Q7YC 4FDBA 1OXSC 1AH9A 2D62A 1O7IA 1N34Q 2OTJA 4TVAB 2BA0A 4AQYQ 2VZAA 2BH2A 1PFSA 3DM3A 3S17H 1MKHA 4MZ9A 5FJ8G 1CKNA 4A3FG 4LF4L 3S1MH 2WAQE 1IXRA 2ZM6Q 4A3FH 1VQ5A 4NXNQ 5C4XG 5C4XH 2VUMG 4OX9L 2VUMH 1X3GA 3GTJH 2QEXA 4HIMA 3A5UA 2R7ZH 4KHPQ 4LW1A 4POGA 3PUYA 4IPDA 3GDEA 1N9WA 3UE0A 3CW2C 4A3DH 4HIDA 4XTCS 3CMAA 1V9PA 3M4PA 4UY8C 3S2HH 1S3OA 5JJLA 1XPRA 2PI2E 4LUOA 2AHOB 3M3YH 4JI7L 1OXVA 2JA9A 4DV6L 5IWAL 3D31A 3S2DH 1V43A 4PMWA 2OQ0A 3ULPA 1K0RA 2LXKA 2NZOA 1W2BA 3J7A5 2OQKA 1J5EL 3UDGA 3I4OA 4JBKA 1XNQQ 1H95A 2JA5G 3JAMc 5M5WH 2JA5H 3L2PA 1M90C 5IE8A 4NXMQ 2UUBQ 2UUCQ 2LXJA 4O0AA 3EN2A 2EIFA 1JT8A 1UE5A 4C3JH 3H15A 4JOIA 3KF6A 3RN5A 4PZ7A 3CCRA 1XPOA 3TQYA 1PH5A 1N34L 1TWFH 4AQYL 1IBLQ 4IOAA 2GVBA 2JA8H 2I5LX 4DR5Q 3CC2A 4QY7A 2XGTA 4GNXA 3CD6A 2IY5B 2ZM6L 3F2DA 4NXNL 3AQQA 2NVXH 4LWCA 4A3LH 4DV4Q 3KJOA 3BU2A 1CSPA 3K80C 4C2MH 4KHPL 1GM5A 4HIOA 4EQ5A 3HOVG 4JI8Q 1Z47A 3RLOA 3HOVH 4IPGA 1L2FA 1VQ6A 2OCEA 2MNAA 3M4OH 1NMGA 4HJ5A 3RN2A 4OWXB 3HOXG 3M9BA 2ZTCA 4DR7Q 1X65A 4B3TQ 3W1GA 4BBSG 3CQZH 4P74A 3CCVA 1PA6A 4BBSH 5JJIA 4YHHQ 4JI3Q 1HZAA 2GVAA 1B70B 1IZ6A 3I2ZA 1VQ4A 1XNQL 1GKHA 1QVGA 5LMUQ 2QA4A 3A0JA 4B3SQ 4NXML 1HZBA 2UUCL 2UUBL 1A0IA 4A3GG 1Y14B 2RCNA 4GN3B 3IRBA 4A3GH 2R93G 2RHQB 1LM0A 2OWOA 1EFWA 1VQMA 4A3CG 1FL0A 4MNOA 2RF4A 1Q1BA 2VW9A 1IBLL 2N49A 1UEBA 2F4VQ 2ASBA 4DR5L 2A19A 1QVCA 4DPGA 1FJGQ 3CCMA 3K81C 4R4QA 5C0XI 3HKZG 2NVQH 4B3RL 4DV4L 5GAHC 3OYYA 4PZ6A 1KIXA 5EAYA 5IY0A 2R7FA 4JI8L 3W5OA 1Q82C 4GN5A 4JV5L 3RZDH 3FP9A 2A8VA 2NVTH 4LFAQ 2IT1A 2Q2HA 4OWWB 2UXCQ 3H3VI 3GO5A 3U4ZA 1IYJB 4LNQA 1I6HH 4P71A 1OXTA 2C35B 4UPAA 1YVCA 4R1JA 4DV5Q 1YHBA 5IT9c 4DV0Q 4DR7L 4B3TL 4X66L 3W1BA 4LF5Q 4YHHL 5DLQE 4JI3L 1FVIA 4BY1G 4IFDJ 4BY1H 1I50H 4A3KG 5LMUL 2B29A 4A3KH 3KFUA 4B3SL 2WP8J 3FKIG 1LUZA 1VQKA 3FKIH 1GD7A 1BKBA 4BXXG 1Y1VG 4BXXH 1BVSA 1Y1VH 3J81j 1HNXL 3CCEA 4L5SA 4GLAC 3F2BA 4IPCA 2L15A 1UE1A 4YWKA 5FLMG 1VQPA 1YBYA 5GAGC 4KHZA 3J80i 1Q81C 4A3IH 2NZHA 2F4VL 1N36Q 1GO3E 2VNUD 3G48A 2K5HA 5IYCG 3CC7A 3PO2G 3CF5A 5IYCH 2JA6G 1VQNA 4LF8Q 5JEAG 3DLLA 4LUVA 3PO2H 4X62Q 4A3JG 3I7FA 3RLFA 3F2CA 4A3JH 1EOVA 1TWHH 2CFMA 3HKZE 3U50C 4AH6A 2B63H 2B63G 3WWVA 4ME3A 1SRUA 1NE3A 2BH8A 2LSSA 2XTIA 1EIYB 5C0XG 4Y7NH 4DV2Q 1KRTA 4LFAL 2K5NA 5FJ8H 2AKWB 1WYDA 1X55A 3UE1A 2ZJQA 2UXCL 1R9TH 3S1NH 1RIPA 4JBWA 3TS0A 1K83H 2D0PA 4LF6Q 2RHSB 4OWTB 2CCZA 3HOWG 2ZTDA 1SROA 1ASYA 3TEHB 4DV5L 4YCUA 1L1OB 2BA1A 4DV0L 2I0QA 1XMOQ 1BBUA 4QQBX 2OTLA 3PIPA 2DGYA 1W3SA 4LF5L 3UDIA 2ZTEA 4POFA 4DUZQ 5LMNL 5LMNW 2HIVA 2K5VA 3L0OA 1VQ9A 2E5LQ 1N8RC 2I5MX 3UDXA 1HR0Q 3PV0A 5AJ3Q 3J80c 4PZ8A 3PIOA 3NEMA 1JMCA 1L1OC 1WCMG 2ID0A 1PYSB 1KD1C 1N36L 3Q8DA 1NJIC 1WI5A 1QVFA 4LF8L 3HOUG 4LF9Q 4X62L 1I94L 1IBMQ 3ICEA 5HGQA 1AE3A 1SMXA 4A93G 2CKZB 1V1QA 1X56A 4JI6Q 4L5RC 3I4NG 4DV2L 3I4NH 4X6AH 1HH2P 1BBWA 4P72A 1P16A 4R4CA 1UWVA 1JE5A 1Q1EA 4YCVA 1QZHA 4HJAA 1PH7A 2N78A 3G4SA 2PQAB 4LF6L 4L5TA 3EIVA 2GN5A 3HKSA 2ES2A 1WOCA 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 Q;  3D0F A;  5C4J H;  1XMO L;  2E2I H;  2V1C C;  5JJK A;  1S72 A;  2PMZ E;  1C7Y A;  1VQI A;  1RL2 A;  1PYB A;  1Q8K A;  1WJJ A;  2YTX A;  3KLW A;  2VQF Q;  1B8A A;  4DR3 Q;  4DUZ L;  1KQS A;  1G29 1;  1EYG A;  4GKK Q;  3PGZ A;  2E5L L;  4QL5 A;  3B6Y A;  2NN6 I;  4JI4 Q;  3HOX H;  4JI5 Q;  1VQE A;  1HR0 L;  4A3B G;  5AJ3 L;  1PH6 A;  1HR0 W;  4A3B H;  4HJ9 A;  1HZ9 A;  4NPS A;  4X66 Q;  4P73 A;  3CXC A;  1HJP A;  1CKO A;  2CWA A;  4UP8 A;  3VDY A;  2JEA I;  4C3H H;  3MXN B;  4DR4 Q;  4RMF A;  3CCQ A;  1S40 A;  2N3S A;  3RNU A;  5M3F G;  1KXL A;  2EQS A;  1HZC A;  1TWC H;  2H5X A;  4R4T A;  1MJC A;  2E8G A;  5M3F H;  4HIK A;  1HNX Q;  4LF9 L;  1K3R A;  2B3G A;  1IBM L;  2R93 H;  4PG3 A;  3AFP A;  2F3I A;  3UDF A;  4A76 A;  4BY7 G;  5M5Y H;  3ULJ A;  4A3C H;  4BY7 H;  3S1Q H;  2ZJP A;  5K36 G;  1PH2 A;  3PF4 A;  4JI6 L;  2VS1 A;  3L7Z C;  2DUD A;  1XJV A;  1E24 A;  3M85 A;  3E9I A;  5BR8 Q;  5C44 G;  4TQU S;  3PF5 A;  5C44 H;  1VQH A;  1YNX A;  1XTD A;  3ER0 A;  2WFW A;  3K0X A;  3ZJY C;  1NBW A;  2Z6K C;  1P8L A;  5E7N A;  3CP0 A;  1DGS A;  3PCO B;  1K9M C;  4DR3 L;  2VQF L;  2KEN A;  3GTK H;  4GKK L;  4YWM A;  1YHA A;  2I5H A;  1MJE A;  3H3V H;  3S15 H;  2E2H H;  2AMC B;  1LTL A;  4R4O A;  4JI4 L;  4JI5 L;  4DKA C;  2CQO A;  4DV3 Q;  1QUQ B;  2VY3 A;  1HNZ Q;  2K52 A;  1VQC A;  3GTP H;  3GTL H;  3FHW A;  4DR4 L;  2NN6 G;  5LMN Q;  3S14 H;  5IYD G;  1FGU A;  5IYD H;  1KL9 A;  1WFQ A;  3STB C;  4A75 A;  4KI0 A;  2ATW A;  1D7Q A;  3U58 A;  4WJ4 A;  4QJF A;  3NEN A;  4KLK A;  4BBR G;  1SN8 A;  2AWO A;  3PUX A;  4IPH A;  4QIW E;  3RLN A;  4BBR H;  2E2J H;  5FLM H;  3HOZ G;  3HOZ H;  4WJ3 M;  4OO1 I;  4Y52 H;  2A1A A;  3HFZ B;  1L1O A;  3MEF A;  4GKJ Q;  1ASZ A;  1AE2 A;  2K50 A;  3CCS A;  1N32 L;  3GD7 A;  3PO3 G;  2JJQ A;  5BR8 L;  2JA6 H;  1C9O A;  1VCI A;  3F8T A;  5J3B A;  4DK3 C;  1IL2 A;  1U5K A;  1I94 Q;  3PO3 H;  3AFQ A;  4RG1 A;  4YWL A;  4IFD G;  2CWP A;  1B7Y B;  1A8V A;  1KAW A;  1TWG H;  1Q86 C;  5H1S E;  1E1T A;  3HOY H;  3KDF B;  4X65 Q;  5GAD C;  4DUY Q;  4HJ7 A;  1EQQ A;  4BA1 I;  3GTO H;  2F52 A;  3PUZ A;  1PH4 A;  3KYH C;  1VQG A;  3LGJ A;  4JI1 Q;  2UUA Q;  1SR3 A;  2JE6 I;  4DAY B;  1YJN A;  1YJW A;  4UP7 A;  3J81 i;  2MQH A;  3T1Y L;  3HOW H;  3TRZ A;  4DV3 L;  4B3M Q;  1E3P A;  1E7Z A;  4P75 A;  4AYB G;  1SE8 A;  3OTO Q;  1IBK L;  1VQB A;  1VQD A;  2PNH A;  1HNZ L;  3GTM H;  3JAM i;  2ZJR A;  2KCT A;  5C3E G;  4A3M G;  5GQO A;  5C3E H;  4A3M H;  1VQF A;  1M1K C;  2K75 A;  1YHQ A;  1A62 A;  4YCW A;  3S1R H;  2UXD Q;  2KHI A;  3GTQ H;  3F1Z A;  4OXP A;  4OON A;  1YEZ A;  2PQA A;  2EXD A;  1WCM H;  2MO0 A;  2JQO A;  2R7Z G;  1SLJ A;  4BA2 I;  4GKJ L;  2R7D A;  3U4V A;  2Q2U A;  1I3Q H;  5HY6 A;  1C0A A;  1VQA A;  4A3D G;  3HOU H;  1OXX K;  2JEB I;  2AWN A;  3G71 A;  1NY4 A;  4OO1 G;  2K14 A;  4K0K Q;  2N8N A;  1PH3 A;  4GLV B;  3KJP A;  4JYA Q;  3S16 H;  4A93 H;  4X65 L;  1CSQ A;  1XMQ Q;  4DUY L;  3RZO H;  1JJG A;  3CC4 A;  3TS2 A;  4DAM A;  3J81 c;  1CKN B;  2KCM A;  4JI1 L;  2UUA L;  3AYH B;  3OW2 A;  4JC0 A;  3EBE A;  1CUK A;  4UP9 A;  4A3E G;  3SGI A;  4C3I H;  2Y0S G;  4A3E H;  1YIJ A;  1KRS A;  2MFI A;  2K4K A;  4B3M L;  5IYB G;  2HT1 A;  5IYB H;  1A63 A;  2Z0S A;  1EWI A;  1E22 A;  3OTO L;  3HOY G;  3TRE A;  2PI2 A;  3GTG H;  2Z6K A;  2VQE Q;  1X3E A;  4HJ8 A;  3J7Z C;  1Q46 A;  1EQR A;  2WB1 G;  4AYB E;  3STB D;  4DV1 Q;  1K73 C;  3ERS X;  1PH9 A;  3CCL A;  3AEV A;  1Y1W G;  3CME A;  1NMF A;  1Y1W H;  2HHH Q;  4JI2 Q;  4IOC A;  1OXU A;  2JA8 G;  4J15 A;  1VQ8 A;  2UXD L;  1J6Q A;  4H02 A;  1EUJ A;  3M4Q A;  3NEL A;  2YU9 H;  4A3L G;  4X64 Q;  4GS3 A;  4L5Q A;  4ALP A;  1XNR Q;  3K7A H;  4YY3 Q;  1YJ9 A;  2HIX A;  1YI2 A;  2VL6 A;  2R6G A;  2KHJ A;  3BZC A;  2IHE A;  3JC6 6;  4DK6 C;  2JA7 G;  3G6E A;  1OTC A;  2JA7 H;  1G6P A;  4K0K L;  4LUZ A;  3M7N A;  2IX0 A;  3I55 A;  1E1O A;  2HQL A;  3KF6 B;  1N33 Q;  1YZ6 A;  4IFD I;  4JYA L;  4JI0 Q;  1LYL A;  1CKM A;  1QUQ A;  5IP7 G;  3NBH B;  1XMQ L;  2YYZ A;  5IP7 H;  4DR2 Q;  1K8G A;  1UE7 A;  3BJU A;  3T1H Q;  3H0G G;  2R92 G;  1HNW Q;  2R92 H;  1N32 Q;  3H0G H;  4GNX B;  1L0W A;  1PH8 A;  1D8L A;  1EIF A;  2D0O A;  3K8A A;  3CPF A;  1KC8 C;  2Y0S E;  5GRO A;  1MIU A;  5FLX c;  3BZK A;  4JOI C;  2Q2T A;  4LF7 Q;  2VQE L;  4MTN A;  4DV1 L;  3E0E A;  1PH1 A;  4DR6 Q;  4DNI A;  4JCV E;  1NTG A;  1TXY A;  1JJC B;  1U0L A;  2JK8 A;  1X6O A;  2WB1 E;  1JJ2 A;  1VQL A;  1VQO A;  4R4I A;  2UXB Q;  2KBN A;  4GNX C;  4DR1 Q;  2HHH L;  5M5X H;  1VQ7 A;  3CCU A;  3T1Y Q;  4JI2 L;  3PUV A;  4LFB Q;  4GOP A;  2QGQ A;  2UU9 Q;  1IBK Q;  2YV5 A;  4JBJ A;  3S24 A;  4DV7 Q;  4LFC Q;  4A4I A;  4X64 L;  1X54 A;  1XNR L;  2NVY H;  4YY3 L;  4JG2 A;  4IJL A;  2YTY A;  3KDF A;  1PHJ A;  2MO1 A;  2IHF A;  3CCJ A;  2WAQ G;  1YIT A;  4XIG S;  4B3R Q;  4LF4 Q;  1TWA H;  4EX5 A;  1N33 L;  4NB3 A;  5ELO A;  2Q2I A;  3I4M G;  4OX9 Q;  1PVO A;  3I4M H;  4JI0 L;  1XPU A;  4IO9 A;  2FXQ A;  4DR2 L;  1HNW L;  3PUW A;  3T1H L;  5JEA J;  3E9H A;  4GOP B;  1X9N A;  1PV4 A;  4O2D A;  1KHI A;  4APV A;  3KOJ A;  5M3M G;  5M3M H;  1JB7 A;  1G51 A;  4IJH A;  4QGU A;  5GAE C;  1X3F A;  4AIM A;  4JI7 Q;  1GVP A;  1VS0 A;  4GN4 B;  3KF8 B;  4LF7 L;  5C0X J;  1QZG A;  4DV6 Q;  1Z9F A;  3RR5 A;  5IWA Q;  3CAM A;  3CPW A;  1Q12 A;  2IX1 A;  4DR6 L;  1SFO H;  3A74 A;  1UE6 A;  2UXB L;  1I5F A;  1J5E Q;  3PSI A;  2ALY B;  4DR1 L;  5ELN A;  4GOP C;  4A3I G;  2YTV A;  5IP9 G;  3I56 A;  5IP9 H;  4LFB L;  1VQJ A;  3A5Z B;  3K7U C;  3ULL A;  1T9H A;  2UU9 L;  1FJG L;  4JBM A;  4DV7 L;  4LFC L;  1K8A C;  1Q7Y C;  4FDB A;  1OXS C;  1AH9 A;  2D62 A;  1O7I A;  1N34 Q;  2OTJ A;  4TVA B;  2BA0 A;  4AQY Q;  2VZA A;  2BH2 A;  1PFS A;  3DM3 A;  3S17 H;  1MKH A;  4MZ9 A;  5FJ8 G;  1CKN A;  4A3F G;  4LF4 L;  3S1M H;  2WAQ E;  1IXR A;  2ZM6 Q;  4A3F H;  1VQ5 A;  4NXN Q;  5C4X G;  5C4X H;  2VUM G;  4OX9 L;  2VUM H;  1X3G A;  3GTJ H;  2QEX A;  4HIM A;  3A5U A;  2R7Z H;  4KHP Q;  4LW1 A;  4POG A;  3PUY A;  4IPD A;  3GDE A;  1N9W A;  3UE0 A;  3CW2 C;  4A3D H;  4HID A;  4XTC S;  3CMA A;  1V9P A;  3M4P A;  4UY8 C;  3S2H H;  1S3O A;  5JJL A;  1XPR A;  2PI2 E;  4LUO A;  2AHO B;  3M3Y H;  4JI7 L;  1OXV A;  2JA9 A;  4DV6 L;  5IWA L;  3D31 A;  3S2D H;  1V43 A;  4PMW A;  2OQ0 A;  3ULP A;  1K0R A;  2LXK A;  2NZO A;  1W2B A;  3J7A 5;  2OQK A;  1J5E L;  3UDG A;  3I4O A;  4JBK A;  1XNQ Q;  1H95 A;  2JA5 G;  3JAM c;  5M5W H;  2JA5 H;  3L2P A;  1M90 C;  5IE8 A;  4NXM Q;  2UUB Q;  2UUC Q;  2LXJ A;  4O0A A;  3EN2 A;  2EIF A;  1JT8 A;  1UE5 A;  4C3J H;  3H15 A;  4JOI A;  3KF6 A;  3RN5 A;  4PZ7 A;  3CCR A;  1XPO A;  3TQY A;  1PH5 A;  1N34 L;  1TWF H;  4AQY L;  1IBL Q;  4IOA A;  2GVB A;  2JA8 H;  2I5L X;  4DR5 Q;  3CC2 A;  4QY7 A;  2XGT A;  4GNX A;  3CD6 A;  2IY5 B;  2ZM6 L;  3F2D A;  4NXN L;  3AQQ A;  2NVX H;  4LWC A;  4A3L H;  4DV4 Q;  3KJO A;  3BU2 A;  1CSP A;  3K80 C;  4C2M H;  4KHP L;  1GM5 A;  4HIO A;  4EQ5 A;  3HOV G;  4JI8 Q;  1Z47 A;  3RLO A;  3HOV H;  4IPG A;  1L2F A;  1VQ6 A;  2OCE A;  2MNA A;  3M4O H;  1NMG A;  4HJ5 A;  3RN2 A;  4OWX B;  3HOX G;  3M9B A;  2ZTC A;  4DR7 Q;  1X65 A;  4B3T Q;  3W1G A;  4BBS G;  3CQZ H;  4P74 A;  3CCV A;  1PA6 A;  4BBS H;  5JJI A;  4YHH Q;  4JI3 Q;  1HZA A;  2GVA A;  1B70 B;  1IZ6 A;  3I2Z A;  1VQ4 A;  1XNQ L;  1GKH A;  1QVG A;  5LMU Q;  2QA4 A;  3A0J A;  4B3S Q;  4NXM L;  1HZB A;  2UUC L;  2UUB L;  1A0I A;  4A3G G;  1Y14 B;  2RCN A;  4GN3 B;  3IRB A;  4A3G H;  2R93 G;  2RHQ B;  1LM0 A;  2OWO A;  1EFW A;  1VQM A;  4A3C G;  1FL0 A;  4MNO A;  2RF4 A;  1Q1B A;  2VW9 A;  1IBL L;  2N49 A;  1UEB A;  2F4V Q;  2ASB A;  4DR5 L;  2A19 A;  1QVC A;  4DPG A;  1FJG Q;  3CCM A;  3K81 C;  4R4Q A;  5C0X I;  3HKZ G;  2NVQ H;  4B3R L;  4DV4 L;  5GAH C;  3OYY A;  4PZ6 A;  1KIX A;  5EAY A;  5IY0 A;  2R7F A;  4JI8 L;  3W5O A;  1Q82 C;  4GN5 A;  4JV5 L;  3RZD H;  3FP9 A;  2A8V A;  2NVT H;  4LFA Q;  2IT1 A;  2Q2H A;  4OWW B;  2UXC Q;  3H3V I;  3GO5 A;  3U4Z A;  1IYJ B;  4LNQ A;  1I6H H;  4P71 A;  1OXT A;  2C35 B;  4UPA A;  1YVC A;  4R1J A;  4DV5 Q;  1YHB A;  5IT9 c;  4DV0 Q;  4DR7 L;  4B3T L;  4X66 L;  3W1B A;  4LF5 Q;  4YHH L;  5DLQ E;  4JI3 L;  1FVI A;  4BY1 G;  4IFD J;  4BY1 H;  1I50 H;  4A3K G;  5LMU L;  2B29 A;  4A3K H;  3KFU A;  4B3S L;  2WP8 J;  3FKI G;  1LUZ A;  1VQK A;  3FKI H;  1GD7 A;  1BKB A;  4BXX G;  1Y1V G;  4BXX H;  1BVS A;  1Y1V H;  3J81 j;  1HNX L;  3CCE A;  4L5S A;  4GLA C;  3F2B A;  4IPC A;  2L15 A;  1UE1 A;  4YWK A;  5FLM G;  1VQP A;  1YBY A;  5GAG C;  4KHZ A;  3J80 i;  1Q81 C;  4A3I H;  2NZH A;  2F4V L;  1N36 Q;  1GO3 E;  2VNU D;  3G48 A;  2K5H A;  5IYC G;  3CC7 A;  3PO2 G;  3CF5 A;  5IYC H;  2JA6 G;  1VQN A;  4LF8 Q;  5JEA G;  3DLL A;  4LUV A;  3PO2 H;  4X62 Q;  4A3J G;  3I7F A;  3RLF A;  3F2C A;  4A3J H;  1EOV A;  1TWH H;  2CFM A;  3HKZ E;  3U50 C;  4AH6 A;  2B63 H;  2B63 G;  3WWV A;  4ME3 A;  1SRU A;  1NE3 A;  2BH8 A;  2LSS A;  2XTI A;  1EIY B;  5C0X G;  4Y7N H;  4DV2 Q;  1KRT A;  4LFA L;  2K5N A;  5FJ8 H;  2AKW B;  1WYD A;  1X55 A;  3UE1 A;  2ZJQ A;  2UXC L;  1R9T H;  3S1N H;  1RIP A;  4JBW A;  3TS0 A;  1K83 H;  2D0P A;  4LF6 Q;  2RHS B;  4OWT B;  2CCZ A;  3HOW G;  2ZTD A;  1SRO A;  1ASY A;  3TEH B;  4DV5 L;  4YCU A;  1L1O B;  2BA1 A;  4DV0 L;  2I0Q A;  1XMO Q;  1BBU A;  4QQB X;  2OTL A;  3PIP A;  2DGY A;  1W3S A;  4LF5 L;  3UDI A;  2ZTE A;  4POF A;  4DUZ Q;  5LMN L;  5LMN W;  2HIV A;  2K5V A;  3L0O A;  1VQ9 A;  2E5L Q;  1N8R C;  2I5M X;  3UDX A;  1HR0 Q;  3PV0 A;  5AJ3 Q;  3J80 c;  4PZ8 A;  3PIO A;  3NEM A;  1JMC A;  1L1O C;  1WCM G;  2ID0 A;  1PYS B;  1KD1 C;  1N36 L;  3Q8D A;  1NJI C;  1WI5 A;  1QVF A;  4LF8 L;  3HOU G;  4LF9 Q;  4X62 L;  1I94 L;  1IBM Q;  3ICE A;  5HGQ A;  1AE3 A;  1SMX A;  4A93 G;  2CKZ B;  1V1Q A;  1X56 A;  4JI6 Q;  4L5R C;  3I4N G;  4DV2 L;  3I4N H;  4X6A H;  1HH2 P;  1BBW A;  4P72 A;  1P16 A;  4R4C A;  1UWV A;  1JE5 A;  1Q1E A;  4YCV A;  1QZH A;  4HJA A;  1PH7 A;  2N78 A;  3G4S A;  2PQA B;  4LF6 L;  4L5T A;  3EIV A;  2GN5 A;  3HKS A;  2ES2 A;  1WOC A;  4GLX A; 
#chains in the Genus database with same CATH topology
 1RJT A;  1XMO L;  3NHH A;  4N8F A;  1S72 A;  1VQI A;  3PIP 3;  4GKK Q;  1IYU A;  1DOL A;  2E5L L;  1GXD C;  2LS0 1;  2NN6 I;  4JI4 Q;  1HR0 L;  2WAQ B;  1WTR A;  5CMD A;  1HR0 W;  4HJ9 A;  4P73 A;  3CXC A;  1CKO A;  2JEA I;  4KHV A;  1A2T A;  3SEB A;  2NTS A;  1L0X B;  1HNX Q;  3AFP A;  2F3I A;  2RBM A;  4H44 C;  4BY7 G;  5M5Y H;  4A3C H;  1G91 A;  2ZJP A;  2HD3 A;  4JI6 L;  1JR0 D;  1E24 A;  1SAP A;  1AZP A;  1O7Z A;  1VQH A;  4A3I B;  3D4D A;  1KAA A;  1SJE D;  1B53 A;  1U4R A;  4ZQ3 A;  3PCO B;  1DGS A;  1SNC A;  4G7Z C;  4ZKC B;  1YHA A;  1MJE A;  2TSS A;  2B2W A;  1GJX A;  4R4O A;  2EYJ A;  1QUQ B;  3E0J A;  4QCL A;  5HGT A;  4F7X A;  3GTP H;  1F9R A;  2NN6 G;  1FGU A;  3BDC A;  1KL9 A;  5IYD H;  3STB C;  3I70 A;  3U58 A;  3P1H A;  2LKV A;  5ISR A;  4WJ4 A;  4XYQ A;  2E2J H;  3RLN A;  1T5E A;  4QIW E;  4DN4 M;  2F0F A;  3HOZ G;  4IN3 A;  4QUF A;  3M3Y B;  4Y52 H;  3HFZ B;  2EYF A;  1FGB D;  2K50 A;  5CV4 A;  2XRS D;  3CCS A;  1N32 L;  3GD7 A;  2JJQ A;  2WAC A;  1SNM A;  4DK3 C;  2IW3 A;  4RG1 A;  1TR5 A;  1B7Y B;  1TWG H;  1DJR D;  1BBX C;  4HJ7 A;  4BA1 I;  4XT3 B;  1Z7T A;  4JI1 Q;  4P2C B;  2UUA Q;  1YJN A;  1YNJ D;  1AEX A;  3BDO A;  4PQX A;  5KGU A;  2EY1 A;  4DV3 L;  3UI2 A;  4KN7 C;  3MXG A;  3OTO Q;  5CBE E;  1HNZ L;  3GTM H;  3I3C A;  3JAM i;  3QOJ A;  4A3M G;  2F03 A;  2B2V A;  1M1K C;  4PNY A;  4OXP A;  1NCV A;  2PQA A;  3NWT A;  4JK1 C;  1PRT C;  3ND9 A;  1HHV A;  1SLJ A;  4BA2 I;  3HZX A;  3CQZ B;  4A3D G;  1OXX K;  1NY4 A;  5C4Z A;  2K14 A;  4OO1 H;  2G9D A;  3OOC A;  4LAA A;  4QF4 A;  4S3S A;  1GHK A;  3KJP A;  4G7H C;  1CSQ A;  1XMQ Q;  4V19 0;  1JJG A;  3MFG A;  3TS2 A;  1CKN B;  2KCM A;  4FF4 A;  2L12 A;  2F0M A;  1HCZ A;  4JC0 A;  1H9S A;  1I4G A;  5G3L D;  4B3M L;  1HTL D;  2IX3 A;  1U9R A;  4QMG A;  5IYB H;  1EWI A;  3TZU A;  3GTG H;  5JJK A;  1K73 C;  4HJ8 A;  4C3J G;  4H0L C;  2SDF A;  1PH9 A;  3AEV A;  4WOR A;  1JOO A;  3H09 A;  5D3I B;  5L37 A;  2HHH Q;  2JA8 G;  2CQA A;  3M4Q A;  4GS3 A;  1XNR Q;  2E2H B;  1V1P B;  3BS1 A;  3K7A H;  1YI2 A;  1RCV D;  2KHJ A;  2JA7 H;  4HED A;  4K0K L;  1E1O A;  3S14 B;  4IFD I;  2KQ3 A;  1CKM A;  1Y1V B;  5IP7 G;  3NBH B;  1K8G A;  4DR2 Q;  1PRT F;  1N32 Q;  3T1H Q;  4FXK C;  2R92 H;  3QB3 A;  4XQJ A;  4MTK A;  4ODG A;  3ZYY X;  1V1O A;  1CTM A;  2DNC A;  2KCC A;  1PH8 A;  1A15 A;  2D0O A;  3K8A A;  3PO2 B;  3CPF A;  1F9P A;  1MIU A;  2Q2T A;  2AUJ D;  3SK4 A;  2A6H D;  4DV1 L;  2PYK A;  1PH1 A;  2HCC A;  2SNS A;  2A68 D;  1NTG A;  1TXY A;  1U0L A;  3SVM A;  2B2T A;  1JJ2 A;  4EQP A;  1VQO A;  4KMU C;  2KOL A;  2MUY A;  3CCU A;  4DFA A;  2QGQ A;  3A54 A;  2YV5 A;  4JBJ A;  2FMC A;  3MAQ A;  4LFC Q;  1FYC A;  1X54 A;  4YY3 L;  2KUM A;  1STN A;  4K14 A;  3KDF A;  3CCJ A;  4XIG S;  3M7G A;  3QR8 A;  3NSW A;  4B3R Q;  1XXG A;  1B9N A;  2HCI A;  3S1R B;  3F2U A;  5IOD A;  1HNW L;  3PUW A;  1S5C D;  1IW7 C;  1LAC A;  4O2D A;  2ZXR A;  1LTG D;  3P75 A;  4IJH A;  3L3O C;  1TII D;  1I3Q B;  1QZG A;  2CW0 D;  2OXP A;  3CAM A;  3CPW A;  4F87 A;  4MN3 A;  2P5Z X;  4CDF C;  2ALY B;  1R4P B;  5ELN A;  4GOP C;  4A93 B;  3SK5 A;  3I4N B;  4R8I A;  1PDQ A;  4C3I B;  1OXS C;  2D62 A;  1TS2 A;  2BA0 A;  4AQY Q;  2BH2 A;  3T51 B;  1PFS A;  1TU2 B;  3QG1 A;  5FJ8 G;  4LF4 L;  1VQ5 A;  3VYT A;  3Q23 A;  5C4X H;  5CGK A;  4KHP Q;  3PUY A;  3SK6 A;  4A3B B;  1PTO D;  3CW2 C;  4A3D H;  4HID A;  1SND A;  1V9P A;  3J81 L;  1T5X D;  3TP6 A;  1G2T A;  2PI2 E;  4LUO A;  2B2Y A;  5J1Z A;  3SXH A;  1IHZ A;  1JOR A;  3TP5 A;  1J8I A;  1YNN C;  3S2D H;  1I4Q A;  3NWS A;  1W2B A;  1JWM D;  5DM6 3;  3S1Q B;  3P20 A;  1J5E L;  3J7A 5;  1DZ1 A;  3I91 A;  3I4O A;  2JA5 H;  3L2P A;  1NSN S;  4C3J H;  3KF6 A;  1XPO A;  2MP1 A;  5EBC A;  1C48 A;  2PZT A;  1KLG D;  1TWF H;  3HS0 C;  5CR3 A;  3HRZ C;  2A6E D;  2GVB A;  2JA8 H;  4QY7 A;  4GNX A;  2IY5 B;  2TMP A;  4LJZ C;  1DYQ A;  4N9P A;  4RAU C;  5FO8 B;  4MIU A;  4C1N I;  1SYF A;  1GUO A;  1VF5 C;  2QEJ C;  1BCP B;  2K1B A;  2OCE A;  4EVO A;  1STE A;  3K0Y A;  3PQI A;  1WTH A;  4IUU A;  1EY8 A;  4R8N A;  4OWX B;  3MTS A;  3HOX G;  5LL6 S;  2ZTC A;  2KEE A;  4DF7 A;  3W1G A;  4BBS G;  5JJI A;  1JOK A;  2EOT A;  3FEW X;  4YHH Q;  1EIH A;  1VQ4 A;  1XNQ L;  1GKH A;  5LMU Q;  1UNS A;  2B8F A;  4B3S Q;  3PO3 B;  2R93 G;  4HMJ A;  1TY2 A;  1LM0 A;  2Z8L A;  5CC4 A;  5JVH 3;  4DAP A;  2RSN A;  2FHT A;  3GV6 A;  1EFW A;  1A6X A;  2HDM A;  2N49 A;  1GUS A;  1QVC A;  4DPG A;  3CCM A;  4G7O C;  4DV4 L;  4O1N A;  5GAH C;  4FXG C;  1PZI D;  5EJW A;  4JV5 L;  2F0N A;  1ENF A;  2NVT H;  2EJG C;  4LFA Q;  4FVM A;  5C5L A;  5C3E B;  4LNQ A;  4P71 A;  3VR6 A;  1CA6 A;  2C35 B;  4CKB A;  3BG3 A;  4DV5 Q;  5IT9 c;  4DV0 Q;  3S1M B;  4DR7 L;  1EL0 A;  3K5M A;  4B3T L;  3SE0 A;  4X66 L;  3W1B A;  4LF5 Q;  3OIQ A;  4J8Q A;  4A3K G;  2PNR C;  2EE1 A;  1VQK A;  3FKI G;  1PZJ D;  1BKB A;  5TSS A;  4BXX G;  2BE5 D;  5KEE A;  3J81 j;  4L5S A;  1DON A;  4K6D A;  4N8X 1;  4OIK A;  1ENC A;  3OWE B;  3S16 B;  1Q81 C;  2F4V L;  3G48 A;  3CC7 A;  5IYC H;  2JA6 G;  5JEA G;  2K6A A;  2AUK A;  3RLF A;  1VMC A;  4ZCK A;  2CFM A;  4IUR A;  1EEI D;  3U50 C;  2B63 H;  5M5W B;  1ESR A;  5KNC A;  3QO2 A;  1HQM C;  2BH8 A;  2LSS A;  2XTI A;  1KRT A;  1W6K A;  3UE1 A;  4HR7 B;  5FJ8 H;  5IGD A;  2ZJQ A;  2B2W C;  2PW5 A;  1R9T H;  5CV6 A;  1STY A;  1Y1W B;  3TS0 A;  1K8O A;  1K83 H;  2D0P A;  5I6W A;  2CCZ A;  1MD2 D;  1TS4 A;  3PIP A;  2DGY A;  2NVX B;  1PRT B;  4POF A;  4C2M B;  1JOQ A;  3J7Y W;  4IQZ A;  2RCF A;  1EQT A;  2HIV A;  3I72 A;  2I5M X;  3P7J A;  3PV0 A;  3X3N A;  3J80 c;  4PZ8 A;  3NEM A;  3X3M A;  1WCM G;  1PYS B;  2HUG A;  5EPK A;  5FK9 C;  1KTK A;  1QVF A;  2PZU A;  4LF8 L;  3H0G B;  4BBS B;  1IBM Q;  1LV9 A;  5I9P A;  5HGQ A;  1SMX A;  1EY6 A;  2CKZ B;  2K7V A;  4DV2 L;  1HH2 P;  1UWV A;  4CGY B;  5NUC A;  4YCV A;  4HJA A;  1PH7 A;  2N78 A;  3OMG A;  3EIV A;  1QNU A;  5JPN C;  3DWA A;  3KUP A;  4JV5 Q;  2EYM A;  5C4J H;  2V1C C;  2PMZ E;  2L4N A;  1BUV T;  1Q8K A;  1WJJ A;  2NVY B;  3E5S A;  2QW7 A;  1B8A A;  1EWH A;  3VR4 A;  2VQF Q;  3FPU B;  4DR3 Q;  1KQS A;  2EY6 A;  4QL5 A;  3HOX H;  2BDO A;  5AJ3 L;  1TWA B;  1HZ9 A;  4QB4 A;  4X66 Q;  4C3H H;  3MXN B;  4DR4 Q;  4IZ8 A;  1GUW A;  3CCQ A;  1KXL A;  2K05 A;  2EQS A;  5M3F H;  1B3Q A;  1MJC A;  3DEP A;  4LF9 L;  1SDF A;  1LTI D;  2R93 H;  3EFX D;  1CI3 M;  2A73 B;  3O13 A;  1XYI A;  2EYP A;  1XWE A;  3R2I A;  5CV7 A;  2VS1 A;  4U67 3;  1XJV A;  1HQR D;  3M85 A;  2AQ3 B;  4TQU S;  3DWQ A;  3T4A C;  3K0X A;  1XTD A;  3NK9 A;  3ZJY C;  4RGT A;  1G2S A;  1P8L A;  5E7N A;  3CP0 A;  1TWH B;  2KEN A;  4GKK L;  1RKN A;  4FF1 A;  4YWM A;  2I5H A;  4RH6 A;  3H3V H;  2AMC B;  3MC0 B;  4JI4 L;  4DKA C;  4C1N K;  4Y7N B;  2CQO A;  1LT5 D;  4A3F B;  2RA4 A;  1CM9 A;  1VQC A;  2VUM B;  3GTL H;  1EOT A;  2CH4 W;  5IYD G;  4I7A A;  4ZYS A;  4KI0 A;  3CRK C;  1LTR D;  1SN8 A;  1ZEQ X;  2AWO A;  4DK1 A;  2NUC A;  4BBR H;  4B08 A;  3ERO A;  4OO1 I;  4G57 A;  2A1A A;  4GKJ Q;  1SMY C;  1ASZ A;  2RDH A;  2JA6 H;  1C9O A;  4U68 A;  5J3B A;  5JEA H;  1U5K A;  1EYA A;  1CK1 A;  1LAB A;  1A8V A;  1E1T A;  4DUY Q;  1D6E C;  1EQQ A;  3GTO H;  3PUZ A;  5I2Y A;  4DAY B;  1YJW A;  4UP7 A;  3VR3 A;  3J81 i;  2MQH A;  4L6T B;  2K5D A;  4AYB G;  5T1I A;  2ZJR A;  2KCT A;  2JYO A;  5C5M A;  5C3X A;  3HOV B;  2K75 A;  3DXJ C;  1YHQ A;  2UXD Q;  2KHI A;  3GTQ H;  3F1Z A;  5BN4 A;  2D2C C;  2EXD A;  1WCM H;  2DJF C;  4K8J A;  3U4V A;  2Q2U A;  2A5H A;  1Y8O B;  4EQO A;  2KCN A;  2DN8 A;  3I90 A;  4OO1 G;  1GUN A;  3MA2 B;  1PH3 A;  1EY0 A;  1B50 A;  4O42 A;  1DCZ A;  4A3G B;  3RZO H;  3GP7 A;  2MGS A;  3G7L A;  3N52 A;  4V0B A;  5ELD A;  4JI1 L;  2UUA L;  3AYH B;  3EBE A;  2HT1 A;  1KRS A;  3NBI A;  5IYB G;  1JIC A;  4K5W A;  3OTO L;  2NVQ B;  2Z6K A;  3HKZ B;  2EJM A;  4AYB E;  1EQR A;  3STB D;  3ERS X;  3CCL A;  1NMF A;  4ZLT F;  3H91 A;  4J15 A;  4DXF A;  1J6Q A;  4H02 A;  2HQE A;  4ALP A;  1LLR D;  1EU3 A;  1YJ9 A;  2HIX A;  1ZXT A;  4K6L A;  1PTO B;  1QIL A;  3JC6 6;  2JA7 G;  1HFN A;  1QJO A;  1B3A A;  1OTC A;  2B2Y C;  1A3U A;  1MBY A;  3NXW A;  2F0G A;  1YZ6 A;  4ZUJ A;  4JI0 Q;  1LYL A;  2JXM B;  3VR2 A;  1XMQ L;  1QUQ A;  4FXD A;  3BJU A;  1FNU A;  2R92 G;  2E2J B;  3GQB A;  4CBV A;  2O2L D;  3DM1 A;  1L0W A;  2Z4I A;  3BZK A;  4MTN A;  5FO7 B;  1Q8I A;  3E0E A;  1ZKO A;  4A3J B;  4DR6 Q;  4JCV E;  2K01 A;  2JK8 A;  2RKS A;  1X6O A;  2UXB Q;  4R4I A;  2HHH L;  4GNX C;  1LO5 D;  2WKD A;  3PUV A;  2SOB A;  4HSV A;  2O4X A;  2F0Q A;  2NTT A;  2UU9 Q;  1PRT D;  4DV7 Q;  1XNR L;  1HUM A;  2KJX A;  2XWJ B;  4JG2 A;  2YTY A;  1JWS D;  3V05 A;  2Q8I B;  2MO1 A;  1YIT A;  1Q3L A;  2Z1C A;  5I2X A;  3MXU A;  2X69 A;  4G4K A;  4TKO B;  1WTX A;  3EA6 A;  4ME5 A;  3I4M H;  4FYD A;  1XPU A;  4IO9 A;  2FXQ A;  4ID6 A;  4DR2 L;  3Q24 A;  5JEA J;  3T1H L;  1ZYR C;  3E9H A;  1PV4 A;  4APV A;  5M3M H;  1JB7 A;  1G51 A;  5GAE C;  1X3F A;  2N55 A;  4JI7 Q;  1H9K A;  4DV6 Q;  3I8Z A;  3URY A;  5IWA Q;  1UE6 A;  3PSI A;  3J7A F;  3ULL A;  1T9H A;  4CKE A;  4LFC L;  1A2U A;  4FDB A;  4RHS A;  1N34 Q;  4TVA B;  1EIG A;  2A69 C;  3K5L A;  3DM3 A;  1C8C A;  4B3R L;  1CKN A;  2RSO A;  2ZM6 Q;  4NXN Q;  5C4X G;  5LHY 1;  1X3G A;  4X3U A;  1KLU D;  1HPC A;  4IPD A;  4RKL A;  2ICI A;  3UE0 A;  1HRJ A;  3CMA A;  3QWN A;  3VYR A;  3K7A B;  2AHO B;  1HXY D;  2L0C A;  3C3L A;  3M3Y H;  1TWC B;  3R93 A;  1VMP A;  3NQT A;  2NB0 A;  2I07 B;  2C5C A;  4QIW B;  4PMW A;  2LXK A;  1B4O A;  4BY7 B;  1V1P A;  3UDG A;  4DGZ A;  1H95 A;  2JA5 G;  1LTA D;  5IE8 A;  4O0A A;  5EQ0 A;  2EIF A;  3H15 A;  4J6H A;  3CCR A;  1SYB A;  1F2Z A;  4AQY L;  3NBH A;  1IBL Q;  1DD2 A;  3W2D A;  3T16 A;  1ENA A;  3CC2 A;  3GTK B;  4EQN A;  5DM7 3;  1EY7 A;  3S15 B;  3KJO A;  5EBD A;  1CSP A;  1SEB D;  4KHP L;  3A55 A;  1GM5 A;  1IW7 D;  4HIO A;  3T56 B;  4JI8 Q;  5KRU A;  1Y8P B;  4IPG A;  1L2F A;  1UAP A;  1NMG A;  4NP5 A;  4HJ5 A;  4KKU A;  3H3V C;  5CV8 A;  1WD0 A;  2OT2 A;  4ILW A;  3CQZ H;  3CCV A;  3HOZ B;  1IZ6 A;  1LTB D;  4IUQ A;  2QA4 A;  3A0J A;  5A35 A;  3K59 A;  1A0I A;  1Y14 B;  3IRB A;  2K32 A;  2ICE C;  3TBI B;  1FL0 A;  3HP3 A;  4MNO A;  1EZ8 A;  5D65 A;  3A7L A;  2A19 A;  4CDE C;  3NUC A;  4HCE A;  3BZD B;  4TRD A;  2LY7 A;  4PZ6 A;  3HG9 A;  5IY0 A;  2R7F A;  3RZD H;  3FP9 A;  5IT9 L;  1PMR A;  4OWW B;  2K28 A;  1SNQ A;  1PFN A;  2M9V A;  4HN7 A;  1YNN D;  3KLS X;  4A3M B;  2PW7 A;  1I6H H;  1WD1 A;  4UPA A;  1YHB A;  4YHH L;  4X3S A;  5DLQ E;  4BY1 H;  5LMU L;  3KFU A;  4KJO A;  2WP8 J;  4B3S L;  4A3D B;  1Y1V H;  3NE5 B;  3CCE A;  3G6J B;  1MI2 A;  2F0P A;  5COR A;  2K33 A;  5GAG C;  3BVM A;  1E2V A;  4L8J A;  2NZH A;  1N36 Q;  4N9T A;  2K5H A;  5IYC G;  3S2D B;  2XIW A;  3PO2 H;  3DLL A;  3OPO A;  4X62 Q;  5FO9 B;  2B63 G;  2LMC B;  4ME3 A;  4HCS A;  3ERQ A;  5C0X H;  4LFA L;  2K5N A;  1WYD A;  2IWH A;  4C3J B;  1RIP A;  4FNF A;  4LF6 Q;  3M4Y A;  4QUC A;  3HOW G;  3S17 H;  4RGN A;  3PMF A;  1L1O B;  4YCU A;  4DV0 L;  4DV5 L;  2JA8 B;  1BBU A;  2YU9 B;  2DY7 A;  4LF5 L;  3J80 L;  4RCN A;  2CVR A;  2F0U A;  4DUZ Q;  5LMN L;  5LMN W;  3KLS A;  2K5V A;  3UDX A;  2F0D A;  1JMC A;  3GV3 A;  3I73 A;  2ID0 A;  2KVM A;  4F88 A;  5A2Q E;  1E2W A;  2E75 C;  1WI5 A;  3Q8D A;  5JJZ A;  2K03 A;  1CT1 D;  3HOU G;  1I94 L;  3ICE A;  2B2U A;  1ICW A;  1TS3 A;  4IUT A;  3I4N H;  3EJI A;  4P72 A;  1P16 A;  5IGB A;  1JE5 A;  2FJ2 A;  5KNB A;  1LT4 D;  3S9W A;  4L5T A;  5M5X B;  5CV5 A;  4ABN A;  1E2Z A;  2ES2 A;  1WOC A;  3H3V I;  3ONA B;  1BF4 A;  2E2I H;  5D14 A;  1EY4 A;  3BYT B;  1K28 A;  1RL2 A;  1PYB A;  2YTX A;  3Q6S A;  3KLW A;  3LWU A;  1EYG A;  1G29 1;  3PGZ A;  1IYV A;  3B6Y A;  1II3 A;  2F0S A;  2PQE A;  2NVT B;  3D3R A;  3U9S A;  4JI5 Q;  4A3B H;  4KJN A;  1PH6 A;  3BDL A;  2L11 A;  3MFY A;  3IAY A;  3BVG A;  1B9M A;  4UP8 A;  4C3H G;  3PIO 3;  3VDY A;  4GZY C;  3K57 A;  2BOS A;  3E6Z X;  3NTH A;  3RNU A;  5M3F G;  1HZC A;  2H5X A;  2E8G A;  2LFN A;  2BDN A;  2HDL A;  1IBM L;  4PG3 A;  1GUG A;  1LTS D;  1M8A A;  3UDF A;  4A76 A;  3S1Q H;  5BN3 A;  1CFM A;  5K36 G;  3D4W A;  1PH2 A;  5EPL A;  3L7Z C;  4MHE A;  3D8G A;  3E9I A;  1U4L A;  5CYU A;  5BR8 Q;  1S5E D;  3QJY A;  4JPB W;  3PF5 A;  5C44 H;  1YNX A;  2WFW A;  1NBW A;  2Z6K C;  1QG7 A;  2VXW A;  3QIA A;  2SEB D;  1K9M C;  4DR3 L;  2VQF L;  4HMI A;  3AB9 A;  4K8I A;  5M9O A;  1HA6 A;  4JW0 A;  2ENB A;  2VY3 A;  1R9T B;  2Q8R E;  3FHW A;  1K83 B;  4TSS A;  4DR4 L;  4LK1 C;  5LMN Q;  1D5Z C;  4E6I A;  2ATW A;  4QJF A;  1I4X A;  1SSO A;  3NEN A;  4BBR G;  4IPH A;  4WJ3 M;  1AE2 A;  3F8T A;  5EPJ A;  3PO3 H;  1I94 Q;  1XTC D;  2CWP A;  4KY6 A;  1KAW A;  1Q86 C;  1MHW C;  5H1S E;  5CV9 A;  3TP7 A;  4X65 Q;  1I6V C;  1W6J A;  1PH4 A;  2AQ2 B;  3KYH C;  2J4X A;  1VQG A;  3KK7 A;  2JE6 I;  1NAP A;  4WRD A;  3HOW H;  2KEC A;  1E3P A;  4P75 A;  1SE8 A;  1LT6 D;  4XYO A;  3KLR A;  3OW7 A;  4XT1 B;  5GQO A;  5C3E H;  1VQF A;  5C4J B;  3BYY B;  4YCW A;  3T13 A;  4DXG A;  1YEZ A;  1Z6H A;  2KED A;  3DEO A;  2R7Z G;  4GKJ L;  3HOX B;  2R7D A;  3DUZ A;  3LNN A;  2IL8 A;  3KBX A;  2IPK D;  3HOU H;  2JEB I;  2AWN A;  3G71 A;  3C46 A;  2D9U A;  2N8N A;  4CJ0 B;  1RDP D;  5J39 A;  1CQF A;  4JYA Q;  3S16 H;  5BN5 A;  1ET6 A;  4DUY L;  3CC4 A;  2R93 B;  1XX8 A;  3J81 c;  1QE6 A;  1Y69 U;  3MXN A;  3OW2 A;  3DMU A;  3SGI A;  4A3E H;  2Y0S G;  2K4K A;  5J22 A;  5I9O A;  1A63 A;  5C3W A;  1E22 A;  2G5D A;  3HOY H;  4KD4 A;  1X3E A;  2VQE Q;  3J7Z C;  2WB1 G;  2D5D A;  2B2V C;  3CU7 A;  2E2D C;  3N6R A;  1Y1W H;  4JI2 Q;  2UXD L;  1OXU A;  1VQ8 A;  1I4P A;  1SYG A;  3FPP A;  3NEL A;  1SMY D;  2J0T D;  4X64 Q;  3TN2 A;  2DY8 A;  3ITP A;  3NP8 A;  3BZC A;  2ZT9 C;  2IHE A;  3G6E A;  3NTK A;  5IT9 E;  1G6P A;  1I50 B;  4A3K B;  4ZUI A;  2HQL A;  1N33 Q;  3FKI B;  5K36 H;  3W3A A;  1STH A;  3H0G H;  1D8L A;  1EIF A;  5CBA E;  3LX0 A;  2Y0S E;  5FLX c;  4LF7 Q;  2JA6 B;  3WOE A;  3MZ5 A;  1VQL A;  1K3B C;  1RHP A;  2WB1 E;  1ESF A;  2KBN A;  2VB3 X;  4DR1 Q;  5KIX A;  1VQ7 A;  2DNE A;  4LFB Q;  1D1K A;  4GOP A;  3GTO B;  1SYC A;  3S1N B;  3S24 A;  4A4I A;  2F0I A;  4LMQ D;  2NVY H;  1TT2 A;  2EDG A;  3RD4 A;  1DXM A;  1KDB A;  1PHJ A;  2PMZ B;  2IHF A;  2WAQ G;  4B9W A;  1O7L A;  1BR9 A;  1TWA H;  4UDU C;  4EX5 A;  4DAY A;  3IKJ A;  5ELO A;  3I4M G;  4OX9 Q;  4JI0 L;  1QOH A;  3D4R A;  3SDZ A;  2E76 C;  5JOB A;  2NBF A;  3GTQ B;  5DEH A;  1EU4 A;  5HUR A;  4GOP B;  2FMM A;  3J80 E;  1PFM A;  1KHI A;  1WCM B;  5M3M G;  2EYO A;  3FRP B;  1GVP A;  4GN4 B;  1AW7 A;  3KF8 B;  5COY A;  3TSS A;  1Z9F A;  1ROD A;  2B2T C;  4DR6 L;  4OEL B;  1SFO H;  3A74 A;  3MVV A;  3NTI A;  2PZW A;  4NKL A;  2UXB L;  4A3I G;  2MHV A;  3I56 A;  3RZO B;  4ZAI A;  5E1F A;  5IP9 H;  2UU9 L;  1FJG L;  1V8Q A;  4DV7 L;  1K8A C;  1Q7Y C;  3D6W A;  4RWS C;  1O7I A;  3L9A X;  4BS9 A;  2VZA A;  1MKH A;  2WAQ E;  1IXR A;  4A3F H;  1G6Z A;  4XDX A;  1SE2 A;  5LL6 X;  2QIL A;  2VUM H;  3GTJ H;  2QEX A;  2R7Z H;  2XVS A;  1JB3 A;  3A5U A;  3GDE A;  2F0T A;  3OHX C;  1ET9 A;  1F9Q A;  4XTC S;  4UY8 C;  3S2H H;  1S3O A;  2WIN B;  1XPR A;  2RDG A;  1Y8N B;  1PYW D;  4JI7 L;  1OXV A;  1RF2 D;  4DV6 L;  2L1B A;  5IWA L;  3D31 A;  1GHJ A;  1JE4 A;  1V43 A;  2OQ0 A;  3ULP A;  1K0R A;  4KD3 A;  5M5Y B;  4FF2 A;  1O78 A;  5KND A;  2I46 A;  4Z9C B;  3JAM c;  2N88 A;  3MWY W;  1M90 C;  4NXM Q;  2UUB Q;  2UUC Q;  1STG A;  2LXJ A;  1SNP A;  3EN2 A;  1U4P A;  3BVZ A;  1UE5 A;  4JOI A;  3RN5 A;  1N34 L;  2KA7 A;  3VA7 A;  4IOA A;  2I5L X;  4DR5 Q;  2XGT A;  2X6L A;  2ZM6 L;  1EFI D;  4NXN L;  3VA5 A;  2CHB D;  3BU2 A;  3K80 C;  1ZYR D;  4DK0 A;  5A2Q L;  3RLO A;  3HOV H;  2RVL A;  1VQ6 A;  5FKA C;  2L5T A;  3GTP B;  2F0O A;  5E4X A;  1BDO A;  3M4O H;  5ELE A;  2A74 C;  1PFB A;  2ZXO A;  1PLF A;  1SBB B;  5C4H A;  3OIP A;  1EYD A;  1B2T A;  4J1M A;  2K5Q A;  3DWP A;  4P74 A;  1PA6 A;  2QF7 A;  4JI3 Q;  1B70 B;  1HZA A;  1TY0 A;  3I2Z A;  2GVA A;  3MEH A;  4L63 B;  1SJH D;  5EKI A;  1BCP C;  2MPM A;  3WOF A;  4BWG B;  1SXT A;  1QVG A;  1A3T A;  4KKS A;  1HZB A;  4DA2 A;  2B2U C;  4GN3 B;  4A3G H;  2RHQ B;  5KYL A;  5M3M B;  2OWO A;  2A69 D;  1TWG B;  1F77 A;  1IBL L;  1UEB A;  2ASB A;  2F1M A;  1FJG Q;  2JSO A;  3K81 C;  4R4Q A;  5C0X I;  2NVQ H;  3OYY A;  4XQN A;  4JI8 L;  1Q82 C;  4GN5 A;  4AYB B;  3GTM B;  1I4H A;  2Q8T A;  1SNO A;  2IT1 A;  2UXC Q;  2M00 A;  1F2Y A;  2EYL A;  1OXT A;  1KNA A;  1SYD A;  4Q5V A;  2F0L A;  5EKK A;  5IGG A;  2H4O A;  1PTO H;  3VYU A;  1IKM A;  4BY1 G;  3FDT A;  2EVB A;  4CDD C;  1Y1V G;  2OF1 A;  4IPC A;  4DAV A;  1UE1 A;  5FLM G;  3V96 A;  4CHT B;  4KHZ A;  1CHP D;  2GA4 B;  4A3I H;  2VNU D;  1GO3 E;  5D3D A;  3PO2 G;  1D5M C;  1BCP F;  3CF5 A;  1S4Z A;  4LUV A;  3FMC A;  1R4Q B;  2XRQ D;  2KHS A;  3I7F A;  3F2C A;  1HUN A;  4A3J H;  1EOV A;  4AH6 A;  2NZ1 D;  3WWV A;  4KKT A;  1SRU A;  1EYC A;  3GTG B;  3JAM E;  5C0X G;  3T53 B;  4X3K A;  1X55 A;  5K5P A;  4JBW A;  2RHS B;  4OWT B;  1SRO A;  1ASY A;  2I0Q A;  2EJF C;  1XMO Q;  4QQB X;  1W3S A;  2EZV A;  3UDI A;  5C6A A;  4UHV A;  2F0W A;  1VQ9 A;  2E5L Q;  1C4Q A;  2JA7 B;  1HR0 Q;  3PIO A;  2RQX A;  1KD1 C;  1N36 L;  5JPM C;  2R92 B;  1STB A;  4X62 L;  4HAE A;  1K8M A;  2FIN B;  1J9O A;  1WVL A;  2O5I C;  4A93 G;  1AN8 A;  1DOK A;  3D6C A;  1X56 A;  3AMU A;  3A56 A;  3Q22 A;  4JI6 Q;  4L5R C;  3I4N G;  4X6A H;  2EYH A;  1BBW A;  4R4C A;  2V4D A;  1I4R A;  1EEF D;  1Q1E A;  3H6M A;  4OIJ A;  3G4S A;  2PQA B;  3NQI A;  4LF6 L;  1MGS A;  4C3I G;  3D0F A;  3A7A B;  2B39 A;  3EVQ A;  1C7Y A;  1UEA B;  4KV6 A;  4DUZ L;  4IUV A;  1TS5 A;  3WDN A;  3RZD B;  1KDA A;  4A3B G;  1VQE A;  5I6Y A;  1QCB D;  1YNJ C;  4NPS A;  1HJP A;  3K6O A;  2CWA A;  1KDC A;  4RCO A;  1I6H B;  4FF3 A;  4RMF A;  1H9S B;  1M4V A;  1S40 A;  4RGO S;  2N3S A;  5E4W C;  3TME A;  4HIK A;  1TWC H;  1TVX A;  4R4T A;  4XQQ A;  1K3R A;  2B3G A;  4NW2 A;  4BY1 B;  1LT3 D;  4FO2 A;  3ULJ A;  2F4I A;  4BY7 H;  4KY7 A;  1Q90 A;  2JP1 A;  3PF4 A;  1D5X C;  2NYZ D;  2DUD A;  1PXU A;  4DNT B;  3RUZ A;  3Q0A A;  4OHJ A;  4I7Z C;  5C44 G;  3CHB D;  2F0K A;  3ER0 A;  2K04 A;  2F0E A;  4M8A A;  3TZD A;  1F2M A;  1IKL A;  3FVQ A;  3GTK H;  1TKW B;  2R61 A;  5I4D A;  3S15 H;  2E2H H;  4IUN A;  5T1G A;  4KY5 A;  1LTL A;  1MSH A;  4CJ2 C;  4JI5 L;  1FNV A;  4DV3 Q;  2VB2 X;  3AU7 A;  4RGM A;  2CH4 A;  1ILP A;  5C4X B;  1HNZ Q;  2K52 A;  2EPB A;  3DHQ A;  3S14 H;  3S17 B;  2NN6 H;  3H94 A;  2OEO A;  1WFQ A;  4A75 A;  4OGQ C;  4H7B A;  5F2D A;  4KLK A;  3PUX A;  4NDX A;  1D7Q A;  5FLM H;  2XSC A;  3HOZ H;  3OSO A;  1CZG A;  2Z6B A;  4RA8 A;  1L1O A;  3MEF A;  3SK8 A;  3PO3 G;  5BR8 L;  1VCI A;  1IL2 A;  4OL7 A;  1NUC A;  3AFQ A;  4YWL A;  4IFD G;  2JA5 B;  2PCF B;  1S5B D;  3KDF B;  3SR1 A;  5GAD C;  1ILQ A;  3IFT A;  2F52 A;  3LGJ A;  1SR3 A;  1TWF B;  4ZK9 B;  3HEJ A;  5DAU A;  3T1Y L;  3TRZ A;  4IUP A;  4B3M Q;  1E7Z A;  2F0J A;  1IBK L;  1VQB A;  1VQD A;  2PNH A;  1B44 D;  3MXP A;  5IGF A;  1K0S A;  1B1Z A;  5C3E G;  2A6H C;  4A3M H;  4CDC C;  2E2I B;  2A68 C;  1ONL A;  1A62 A;  3S1R H;  4OON A;  5G3L F;  2L55 A;  2MO0 A;  2JQO A;  1I3Q H;  5HY6 A;  1C0A A;  1VQA A;  2B8G A;  1G8Z D;  4K0K Q;  1QB5 D;  4GLV B;  3MHB A;  4A93 H;  2F0V A;  4X65 L;  4DAM A;  4UP9 A;  4A3E G;  1CUK A;  1AFP A;  4C3I H;  1YIJ A;  2MFI A;  2Z0S A;  4YIJ A;  3HOY G;  3TRE A;  2PI2 A;  3C1F A;  1PVO A;  4DV1 Q;  1Q46 A;  5C44 B;  2F3W A;  2CW0 C;  1Y1W G;  3CME A;  1U4M A;  5E3F A;  4KK7 A;  4XXE A;  2QCP X;  4IOC A;  2QKI C;  4C56 C;  1EUJ A;  2YU9 H;  4A3L G;  4L5Q A;  1RTN A;  4Q0F A;  4HTH A;  4YY3 Q;  1FNW A;  2EY2 A;  3R3O A;  2VL6 A;  2R6G A;  4DK6 C;  5ELC A;  3K5O A;  4LUZ A;  3M7N A;  2IX0 A;  3I55 A;  3KF6 B;  2XWB B;  4JYA L;  2DJG C;  1EWC A;  2ZXP A;  2FFK B;  2YYZ A;  5IP7 H;  1HNW Q;  1UE7 A;  2Z4H A;  5FOB B;  3H0G G;  5FLX L;  4GNX B;  1PTO C;  3IL8 A;  5ELF A;  2F3V A;  2WV6 D;  1L0Y B;  5GRO A;  1KC8 C;  3E3X A;  4JOI C;  3CKI B;  4R9W A;  2VQE L;  3A8K E;  4DNI A;  2B63 B;  2M2L A;  1JJC B;  3HGB A;  1TQO A;  1IL8 A;  5M5X H;  4JI2 L;  2RDF A;  3T1Y Q;  5JVG 3;  2J7Z A;  1IBK Q;  4X64 L;  3NPP A;  1QWY A;  1HFG A;  3HOW B;  4IJL A;  1H9J A;  1LTT D;  4DU9 A;  2MJ8 A;  4LF4 Q;  1N33 L;  4FP5 D;  2A6E C;  4NB3 A;  4NMZ A;  2Q2I A;  1JWU D;  4RFB A;  1X9N A;  3KOJ A;  3ND8 A;  3R8B A;  3U9O A;  1H9R A;  4QGU A;  4IFD H;  4AIM A;  1VS0 A;  4UAI A;  4LF7 L;  5C0X J;  3HOU B;  3RR5 A;  2IX1 A;  1Q12 A;  3LWE A;  1I5F A;  1J5E Q;  1ML0 D;  2BCO A;  4DR1 L;  1PTO F;  2YTV A;  2Z9H A;  5IP9 G;  4LFB L;  1VQJ A;  3A5Z B;  1GUT A;  3K7U C;  1FD7 D;  4JBM A;  3SHL A;  4WJW A;  4A3E B;  1SE3 A;  1AH9 A;  2OTJ A;  1D2B A;  2O5J C;  1DOM A;  5AFW A;  3HOY B;  4MZ9 A;  4A3F G;  3S1M H;  1E0B A;  1X32 A;  2VUM G;  3CRL C;  3VR5 A;  4OX9 L;  3I4M B;  4WFN 3;  2XNA C;  4HIM A;  4LW1 A;  4POG A;  1KNE A;  1N9W A;  1OO9 B;  4C3H B;  5DNF A;  3M4P A;  1BNZ A;  3A8J E;  4RHR A;  5JJL A;  3QOL A;  5M3F B;  2JA9 A;  1CZW A;  3JAM L;  3R2T A;  1WTO A;  5IIF A;  4I65 A;  1D1I A;  2NZO A;  3V2T A;  2IJ0 A;  2OQK A;  4JBK A;  1XNQ Q;  1CQV A;  5M5W H;  2PPB C;  2JN4 A;  1PZK D;  4K5V A;  4PZ7 A;  2BE5 C;  3TQY A;  1HA5 A;  4HSP A;  1PH5 A;  2XN9 C;  2WKC A;  1EZ6 A;  1SE4 A;  5EGT A;  4OEM B;  3CD6 A;  2K5W A;  3TP8 A;  3F2D A;  3AQQ A;  4EGV A;  4LWC A;  2NVX H;  4A3L H;  4DV4 Q;  1S5D D;  2F0H A;  4C2M H;  4EQ5 A;  3HOV G;  1Z47 A;  2QDL A;  1NNX A;  1EQV A;  3GTL B;  2MNA A;  1NR2 A;  4KN4 C;  3OWF A;  3RN2 A;  1O7Y A;  1CHQ D;  3M9B A;  4CKC A;  5EKL A;  4DR7 Q;  1X65 A;  4B3T Q;  4BBR B;  3K5N A;  4BBS H;  2WII B;  4RKB A;  1JCK B;  2EXZ A;  1AP0 A;  1WTP A;  4NXM L;  2UUC L;  2UUB L;  4A3G G;  2RCN A;  4PMB A;  1EY9 A;  1VQM A;  4A3C G;  1X3P A;  1QNK A;  2RF4 A;  1Q1B A;  4X3T A;  5ELB A;  1AZQ A;  2VW9 A;  2SNM A;  2F4V Q;  1F2L A;  2PO4 A;  4DR5 L;  3KBG A;  1SFO B;  3HKZ G;  4ZRZ A;  1JQY D;  1KIX A;  5EAY A;  3W5O A;  3IFD A;  3KF8 A;  2E74 C;  1RTO A;  2A8V A;  1H9M A;  2Q2H A;  4IAL A;  3GO5 A;  3U4Z A;  3I4L A;  1IYJ B;  3RMH A;  4ULL A;  1YVC A;  1GOZ A;  4R1J A;  3K58 A;  2X6G A;  2EY5 A;  4JI3 L;  1WTQ A;  1FVI A;  4IFD J;  1I50 H;  1STA A;  3GTJ B;  2R7Z B;  2B29 A;  4A3K H;  1X3Q A;  3J7A V;  1LUZ A;  4CJ1 B;  3FKI H;  1GD7 A;  4BXX H;  1BVS A;  1HNX L;  4GLA C;  3F2B A;  3S2H B;  2L15 A;  4YWK A;  1WTW A;  1VQP A;  1YBY A;  1A3V A;  3J80 i;  1JT8 A;  1NR4 A;  2L9H A;  1VQN A;  4LF8 Q;  3OMC A;  1BXT A;  4KTA A;  4A3J G;  2QDB A;  3J81 E;  1TWH H;  3HKZ E;  4B9X A;  2Y0S B;  4K2L A;  4PV1 C;  1CA5 A;  4DNR B;  1NE3 A;  5IGC A;  1EIY B;  4Y7N H;  4DV2 Q;  1WTV A;  2AKW B;  2UXC L;  2WB1 B;  1O80 A;  3VYS A;  1VDZ A;  5IGE A;  3S1N H;  1UUP A;  2H1E A;  1EY5 A;  2ZTD A;  1VF7 A;  3C1E A;  3TEH B;  2BA1 A;  3A8I E;  1MSG A;  2OTL A;  1BCP D;  1FR3 A;  1KAB A;  2G9H D;  1SYE A;  2ZTE A;  3EQL C;  1RD9 D;  1JC7 A;  2C9O A;  3L0O A;  1N8R C;  5JAV A;  4ZKB B;  5AJ3 Q;  4K5X A;  1BOS A;  3M4O B;  4JVZ A;  1L1O C;  1S5F D;  2AQ1 B;  1ICF B;  4K2K A;  1NJI C;  1F9S A;  4LF9 Q;  4F8M A;  1DM0 B;  5IOC A;  1BO0 A;  2NWG A;  4H13 C;  1AE3 A;  4M1U B;  1V1Q A;  3TDQ A;  4PMC A;  5FLX E;  1HTP A;  1BQQ T;  5KYI A;  1QZH A;  2R3Z A;  3C2P A;  2GN5 A;  3HKS A;  4GLX A; 
#chains in the Genus database with same CATH homology
 4JV5 Q;  3D0F A;  5C4J H;  1XMO L;  2E2I H;  2V1C C;  5JJK A;  1S72 A;  2PMZ E;  1C7Y A;  1VQI A;  1RL2 A;  1PYB A;  1Q8K A;  1WJJ A;  2YTX A;  3KLW A;  2VQF Q;  1B8A A;  4DR3 Q;  4DUZ L;  1KQS A;  1G29 1;  1EYG A;  4GKK Q;  3PGZ A;  2E5L L;  4QL5 A;  3B6Y A;  2NN6 I;  4JI4 Q;  3HOX H;  4JI5 Q;  1VQE A;  1HR0 L;  4A3B G;  5AJ3 L;  1PH6 A;  1HR0 W;  4A3B H;  4HJ9 A;  1HZ9 A;  4NPS A;  4X66 Q;  4P73 A;  3CXC A;  1HJP A;  1CKO A;  2CWA A;  4UP8 A;  3VDY A;  2JEA I;  4C3H H;  3MXN B;  4DR4 Q;  4RMF A;  3CCQ A;  1S40 A;  2N3S A;  3RNU A;  5M3F G;  1KXL A;  2EQS A;  1HZC A;  1TWC H;  2H5X A;  4R4T A;  1MJC A;  2E8G A;  5M3F H;  4HIK A;  1HNX Q;  4LF9 L;  1K3R A;  2B3G A;  1IBM L;  2R93 H;  4PG3 A;  3AFP A;  2F3I A;  3UDF A;  4A76 A;  4BY7 G;  5M5Y H;  3ULJ A;  4A3C H;  4BY7 H;  3S1Q H;  2ZJP A;  5K36 G;  1PH2 A;  3PF4 A;  4JI6 L;  2VS1 A;  3L7Z C;  2DUD A;  1XJV A;  1E24 A;  3M85 A;  3E9I A;  5BR8 Q;  5C44 G;  4TQU S;  3PF5 A;  5C44 H;  1VQH A;  1YNX A;  1XTD A;  3ER0 A;  2WFW A;  3K0X A;  3ZJY C;  1NBW A;  2Z6K C;  1P8L A;  5E7N A;  3CP0 A;  1DGS A;  3PCO B;  1K9M C;  4DR3 L;  2VQF L;  2KEN A;  3GTK H;  4GKK L;  4YWM A;  1YHA A;  2I5H A;  1MJE A;  3H3V H;  3S15 H;  2E2H H;  2AMC B;  1LTL A;  4R4O A;  4JI4 L;  4JI5 L;  4DKA C;  2CQO A;  4DV3 Q;  1QUQ B;  2VY3 A;  1HNZ Q;  2K52 A;  1VQC A;  3GTP H;  3GTL H;  3FHW A;  4DR4 L;  2NN6 G;  5LMN Q;  3S14 H;  5IYD G;  1FGU A;  5IYD H;  1KL9 A;  1WFQ A;  3STB C;  4A75 A;  4KI0 A;  2ATW A;  1D7Q A;  3U58 A;  4WJ4 A;  4QJF A;  3NEN A;  4KLK A;  4BBR G;  1SN8 A;  2AWO A;  3PUX A;  4IPH A;  4QIW E;  3RLN A;  4BBR H;  2E2J H;  5FLM H;  3HOZ G;  3HOZ H;  4WJ3 M;  4OO1 I;  4Y52 H;  2A1A A;  3HFZ B;  1L1O A;  3MEF A;  4GKJ Q;  1ASZ A;  1AE2 A;  2K50 A;  3CCS A;  1N32 L;  3GD7 A;  3PO3 G;  2JJQ A;  5BR8 L;  2JA6 H;  1C9O A;  1VCI A;  3F8T A;  5J3B A;  4DK3 C;  1IL2 A;  1U5K A;  1I94 Q;  3PO3 H;  3AFQ A;  4RG1 A;  4YWL A;  4IFD G;  2CWP A;  1B7Y B;  1A8V A;  1KAW A;  1TWG H;  1Q86 C;  5H1S E;  1E1T A;  3HOY H;  3KDF B;  4X65 Q;  5GAD C;  4DUY Q;  4HJ7 A;  1EQQ A;  4BA1 I;  3GTO H;  2F52 A;  3PUZ A;  1PH4 A;  3KYH C;  1VQG A;  3LGJ A;  4JI1 Q;  2UUA Q;  1SR3 A;  2JE6 I;  4DAY B;  1YJN A;  1YJW A;  4UP7 A;  3J81 i;  2MQH A;  3T1Y L;  3HOW H;  3TRZ A;  4DV3 L;  4B3M Q;  1E3P A;  1E7Z A;  4P75 A;  4AYB G;  1SE8 A;  3OTO Q;  1IBK L;  1VQB A;  1VQD A;  2PNH A;  1HNZ L;  3GTM H;  3JAM i;  2ZJR A;  2KCT A;  5C3E G;  4A3M G;  5GQO A;  5C3E H;  4A3M H;  1VQF A;  1M1K C;  2K75 A;  1YHQ A;  1A62 A;  4YCW A;  3S1R H;  2UXD Q;  2KHI A;  3GTQ H;  3F1Z A;  4OXP A;  4OON A;  1YEZ A;  2PQA A;  2EXD A;  1WCM H;  2MO0 A;  2JQO A;  2R7Z G;  1SLJ A;  4BA2 I;  4GKJ L;  2R7D A;  3U4V A;  2Q2U A;  1I3Q H;  5HY6 A;  1C0A A;  1VQA A;  4A3D G;  3HOU H;  1OXX K;  2JEB I;  2AWN A;  3G71 A;  1NY4 A;  4OO1 G;  2K14 A;  4K0K Q;  2N8N A;  1PH3 A;  4GLV B;  3KJP A;  4JYA Q;  3S16 H;  4A93 H;  4X65 L;  1CSQ A;  1XMQ Q;  4DUY L;  3RZO H;  1JJG A;  3CC4 A;  3TS2 A;  4DAM A;  3J81 c;  1CKN B;  2KCM A;  4JI1 L;  2UUA L;  3AYH B;  3OW2 A;  4JC0 A;  3EBE A;  1CUK A;  4UP9 A;  4A3E G;  3SGI A;  4C3I H;  2Y0S G;  4A3E H;  1YIJ A;  1KRS A;  2MFI A;  2K4K A;  4B3M L;  5IYB G;  2HT1 A;  5IYB H;  1A63 A;  2Z0S A;  1EWI A;  1E22 A;  3OTO L;  3HOY G;  3TRE A;  2PI2 A;  3GTG H;  2Z6K A;  2VQE Q;  1X3E A;  4HJ8 A;  3J7Z C;  1Q46 A;  1EQR A;  2WB1 G;  4AYB E;  3STB D;  4DV1 Q;  1K73 C;  3ERS X;  1PH9 A;  3CCL A;  3AEV A;  1Y1W G;  3CME A;  1NMF A;  1Y1W H;  2HHH Q;  4JI2 Q;  4IOC A;  1OXU A;  2JA8 G;  4J15 A;  1VQ8 A;  2UXD L;  1J6Q A;  4H02 A;  1EUJ A;  3M4Q A;  3NEL A;  2YU9 H;  4A3L G;  4X64 Q;  4GS3 A;  4L5Q A;  4ALP A;  1XNR Q;  3K7A H;  4YY3 Q;  1YJ9 A;  2HIX A;  1YI2 A;  2VL6 A;  2R6G A;  2KHJ A;  3BZC A;  2IHE A;  3JC6 6;  4DK6 C;  2JA7 G;  3G6E A;  1OTC A;  2JA7 H;  1G6P A;  4K0K L;  4LUZ A;  3M7N A;  2IX0 A;  3I55 A;  1E1O A;  2HQL A;  3KF6 B;  1N33 Q;  1YZ6 A;  4IFD I;  4JYA L;  4JI0 Q;  1LYL A;  1CKM A;  1QUQ A;  5IP7 G;  3NBH B;  1XMQ L;  2YYZ A;  5IP7 H;  4DR2 Q;  1K8G A;  1UE7 A;  3BJU A;  3T1H Q;  3H0G G;  2R92 G;  1HNW Q;  2R92 H;  1N32 Q;  3H0G H;  4GNX B;  1L0W A;  1PH8 A;  1D8L A;  1EIF A;  2D0O A;  3K8A A;  3CPF A;  1KC8 C;  2Y0S E;  5GRO A;  1MIU A;  5FLX c;  3BZK A;  4JOI C;  2Q2T A;  4LF7 Q;  2VQE L;  4MTN A;  4DV1 L;  3E0E A;  1PH1 A;  4DR6 Q;  4DNI A;  4JCV E;  1NTG A;  1TXY A;  1JJC B;  1U0L A;  2JK8 A;  1X6O A;  2WB1 E;  1JJ2 A;  1VQL A;  1VQO A;  4R4I A;  2UXB Q;  2KBN A;  4GNX C;  4DR1 Q;  2HHH L;  5M5X H;  1VQ7 A;  3CCU A;  3T1Y Q;  4JI2 L;  3PUV A;  4LFB Q;  4GOP A;  2QGQ A;  2UU9 Q;  1IBK Q;  2YV5 A;  4JBJ A;  3S24 A;  4DV7 Q;  4LFC Q;  4A4I A;  4X64 L;  1X54 A;  1XNR L;  2NVY H;  4YY3 L;  4JG2 A;  4IJL A;  2YTY A;  3KDF A;  1PHJ A;  2MO1 A;  2IHF A;  3CCJ A;  2WAQ G;  1YIT A;  4XIG S;  4B3R Q;  4LF4 Q;  1TWA H;  4EX5 A;  1N33 L;  4NB3 A;  5ELO A;  2Q2I A;  3I4M G;  4OX9 Q;  1PVO A;  3I4M H;  4JI0 L;  1XPU A;  4IO9 A;  2FXQ A;  4DR2 L;  1HNW L;  3PUW A;  3T1H L;  5JEA J;  3E9H A;  4GOP B;  1X9N A;  1PV4 A;  4O2D A;  1KHI A;  4APV A;  3KOJ A;  5M3M G;  5M3M H;  1JB7 A;  1G51 A;  4IJH A;  4QGU A;  5GAE C;  1X3F A;  4AIM A;  4JI7 Q;  1GVP A;  1VS0 A;  4GN4 B;  3KF8 B;  4LF7 L;  5C0X J;  1QZG A;  4DV6 Q;  1Z9F A;  3RR5 A;  5IWA Q;  3CAM A;  3CPW A;  1Q12 A;  2IX1 A;  4DR6 L;  1SFO H;  3A74 A;  1UE6 A;  2UXB L;  1I5F A;  1J5E Q;  3PSI A;  2ALY B;  4DR1 L;  5ELN A;  4GOP C;  4A3I G;  2YTV A;  5IP9 G;  3I56 A;  5IP9 H;  4LFB L;  1VQJ A;  3A5Z B;  3K7U C;  3ULL A;  1T9H A;  2UU9 L;  1FJG L;  4JBM A;  4DV7 L;  4LFC L;  1K8A C;  1Q7Y C;  4FDB A;  1OXS C;  1AH9 A;  2D62 A;  1O7I A;  1N34 Q;  2OTJ A;  4TVA B;  2BA0 A;  4AQY Q;  2VZA A;  2BH2 A;  1PFS A;  3DM3 A;  3S17 H;  1MKH A;  4MZ9 A;  5FJ8 G;  1CKN A;  4A3F G;  4LF4 L;  3S1M H;  2WAQ E;  1IXR A;  2ZM6 Q;  4A3F H;  1VQ5 A;  4NXN Q;  5C4X G;  5C4X H;  2VUM G;  4OX9 L;  2VUM H;  1X3G A;  3GTJ H;  2QEX A;  4HIM A;  3A5U A;  2R7Z H;  4KHP Q;  4LW1 A;  4POG A;  3PUY A;  4IPD A;  3GDE A;  1N9W A;  3UE0 A;  3CW2 C;  4A3D H;  4HID A;  4XTC S;  3CMA A;  1V9P A;  3M4P A;  4UY8 C;  3S2H H;  1S3O A;  5JJL A;  1XPR A;  2PI2 E;  4LUO A;  2AHO B;  3M3Y H;  4JI7 L;  1OXV A;  2JA9 A;  4DV6 L;  5IWA L;  3D31 A;  3S2D H;  1V43 A;  4PMW A;  2OQ0 A;  3ULP A;  1K0R A;  2LXK A;  2NZO A;  1W2B A;  3J7A 5;  2OQK A;  1J5E L;  3UDG A;  3I4O A;  4JBK A;  1XNQ Q;  1H95 A;  2JA5 G;  3JAM c;  5M5W H;  2JA5 H;  3L2P A;  1M90 C;  5IE8 A;  4NXM Q;  2UUB Q;  2UUC Q;  2LXJ A;  4O0A A;  3EN2 A;  2EIF A;  1JT8 A;  1UE5 A;  4C3J H;  3H15 A;  4JOI A;  3KF6 A;  3RN5 A;  4PZ7 A;  3CCR A;  1XPO A;  3TQY A;  1PH5 A;  1N34 L;  1TWF H;  4AQY L;  1IBL Q;  4IOA A;  2GVB A;  2JA8 H;  2I5L X;  4DR5 Q;  3CC2 A;  4QY7 A;  2XGT A;  4GNX A;  3CD6 A;  2IY5 B;  2ZM6 L;  3F2D A;  4NXN L;  3AQQ A;  2NVX H;  4LWC A;  4A3L H;  4DV4 Q;  3KJO A;  3BU2 A;  1CSP A;  3K80 C;  4C2M H;  4KHP L;  1GM5 A;  4HIO A;  4EQ5 A;  3HOV G;  4JI8 Q;  1Z47 A;  3RLO A;  3HOV H;  4IPG A;  1L2F A;  1VQ6 A;  2OCE A;  2MNA A;  3M4O H;  1NMG A;  4HJ5 A;  3RN2 A;  4OWX B;  3HOX G;  3M9B A;  2ZTC A;  4DR7 Q;  1X65 A;  4B3T Q;  3W1G A;  4BBS G;  3CQZ H;  4P74 A;  3CCV A;  1PA6 A;  4BBS H;  5JJI A;  4YHH Q;  4JI3 Q;  1HZA A;  2GVA A;  1B70 B;  1IZ6 A;  3I2Z A;  1VQ4 A;  1XNQ L;  1GKH A;  1QVG A;  5LMU Q;  2QA4 A;  3A0J A;  4B3S Q;  4NXM L;  1HZB A;  2UUC L;  2UUB L;  1A0I A;  4A3G G;  1Y14 B;  2RCN A;  4GN3 B;  3IRB A;  4A3G H;  2R93 G;  2RHQ B;  1LM0 A;  2OWO A;  1EFW A;  1VQM A;  4A3C G;  1FL0 A;  4MNO A;  2RF4 A;  1Q1B A;  2VW9 A;  1IBL L;  2N49 A;  1UEB A;  2F4V Q;  2ASB A;  4DR5 L;  2A19 A;  1QVC A;  4DPG A;  1FJG Q;  3CCM A;  3K81 C;  4R4Q A;  5C0X I;  3HKZ G;  2NVQ H;  4B3R L;  4DV4 L;  5GAH C;  3OYY A;  4PZ6 A;  1KIX A;  5EAY A;  5IY0 A;  2R7F A;  4JI8 L;  3W5O A;  1Q82 C;  4GN5 A;  4JV5 L;  3RZD H;  3FP9 A;  2A8V A;  2NVT H;  4LFA Q;  2IT1 A;  2Q2H A;  4OWW B;  2UXC Q;  3H3V I;  3GO5 A;  3U4Z A;  1IYJ B;  4LNQ A;  1I6H H;  4P71 A;  1OXT A;  2C35 B;  4UPA A;  1YVC A;  4R1J A;  4DV5 Q;  1YHB A;  5IT9 c;  4DV0 Q;  4DR7 L;  4B3T L;  4X66 L;  3W1B A;  4LF5 Q;  4YHH L;  5DLQ E;  4JI3 L;  1FVI A;  4BY1 G;  4IFD J;  4BY1 H;  1I50 H;  4A3K G;  5LMU L;  2B29 A;  4A3K H;  3KFU A;  4B3S L;  2WP8 J;  3FKI G;  1LUZ A;  1VQK A;  3FKI H;  1GD7 A;  1BKB A;  4BXX G;  1Y1V G;  4BXX H;  1BVS A;  1Y1V H;  3J81 j;  1HNX L;  3CCE A;  4L5S A;  4GLA C;  3F2B A;  4IPC A;  2L15 A;  1UE1 A;  4YWK A;  5FLM G;  1VQP A;  1YBY A;  5GAG C;  4KHZ A;  3J80 i;  1Q81 C;  4A3I H;  2NZH A;  2F4V L;  1N36 Q;  1GO3 E;  2VNU D;  3G48 A;  2K5H A;  5IYC G;  3CC7 A;  3PO2 G;  3CF5 A;  5IYC H;  2JA6 G;  1VQN A;  4LF8 Q;  5JEA G;  3DLL A;  4LUV A;  3PO2 H;  4X62 Q;  4A3J G;  3I7F A;  3RLF A;  3F2C A;  4A3J H;  1EOV A;  1TWH H;  2CFM A;  3HKZ E;  3U50 C;  4AH6 A;  2B63 H;  2B63 G;  3WWV A;  4ME3 A;  1SRU A;  1NE3 A;  2BH8 A;  2LSS A;  2XTI A;  1EIY B;  5C0X G;  4Y7N H;  4DV2 Q;  1KRT A;  4LFA L;  2K5N A;  5FJ8 H;  2AKW B;  1WYD A;  1X55 A;  3UE1 A;  2ZJQ A;  2UXC L;  1R9T H;  3S1N H;  1RIP A;  4JBW A;  3TS0 A;  1K83 H;  2D0P A;  4LF6 Q;  2RHS B;  4OWT B;  2CCZ A;  3HOW G;  2ZTD A;  1SRO A;  1ASY A;  3TEH B;  4DV5 L;  4YCU A;  1L1O B;  2BA1 A;  4DV0 L;  2I0Q A;  1XMO Q;  1BBU A;  4QQB X;  2OTL A;  3PIP A;  2DGY A;  1W3S A;  4LF5 L;  3UDI A;  2ZTE A;  4POF A;  4DUZ Q;  5LMN L;  5LMN W;  2HIV A;  2K5V A;  3L0O A;  1VQ9 A;  2E5L Q;  1N8R C;  2I5M X;  3UDX A;  1HR0 Q;  3PV0 A;  5AJ3 Q;  3J80 c;  4PZ8 A;  3PIO A;  3NEM A;  1JMC A;  1L1O C;  1WCM G;  2ID0 A;  1PYS B;  1KD1 C;  1N36 L;  3Q8D A;  1NJI C;  1WI5 A;  1QVF A;  4LF8 L;  3HOU G;  4LF9 Q;  4X62 L;  1I94 L;  1IBM Q;  3ICE A;  5HGQ A;  1AE3 A;  1SMX A;  4A93 G;  2CKZ B;  1V1Q A;  1X56 A;  4JI6 Q;  4L5R C;  3I4N G;  4DV2 L;  3I4N H;  4X6A H;  1HH2 P;  1BBW A;  4P72 A;  1P16 A;  4R4C A;  1UWV A;  1JE5 A;  1Q1E A;  4YCV A;  1QZH A;  4HJA A;  1PH7 A;  2N78 A;  3G4S A;  2PQA B;  4LF6 L;  4L5T A;  3EIV A;  2GN5 A;  3HKS A;  2ES2 A;  1WOC A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...