2B2VC

Crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vC00
3ONAB 5DNFA 4HAEA 5COYA 1QG7A 2K04A 2B2YA 2B2VA 3N52A 2B2UC 1X32A 2L11A 1HFGA 2NWGA 3I3CA 1XYIA 4X3TA 1WD0A 1G2TA 1RHPA 1PDQA 3I90A 1U4RA 4OIJA 4HEDA 2B2UA 2D9UA 1DOMA 1A15A 1MI2A 1WTWA 1AZQA 3LWEA 2J7ZA 2EPBA 3SVMA 1B53A 1PFNA 3DEOA 3MWYW 1PLFA 1MSHA 5T1IA 1LV9A 3D6WA 1HHVA 2K1BA 2HCCA 1SAPA 1ILQA 1ESRA 2K01A 3I91A 2DY8A 5EPKA 2X6LA 2FINB 1B3AA 4IUUA 4XT1B 5CBAE 1GUWA 1J9OA 2BDNA 2X69A 2X6GA 1NR2A 4ZK9B 2HUGA 4IUQA 2XIWA 5D14A 2DY7A 1WVLA 1JICA 1U4MA 1ML0D 2B2WC 1O7YA 2K03A 2N88A 4MN3A 4IUTA 4NW2A 2MJ8A 1DOLA 5CBEE 3H91A 4U68A 1WTVA 1B50A 1HFNA 1VMCA 1MSGA 1DOKA 2B2WA 1TVXA 2MPMA 2K28A 4IUVA 1F2LA 1F9SA 1WTOA 1ILPA 1CM9A 2HCIA 5E4WC 2MGSA 2JP1A 1WTXA 4O42A 5EQ0A 2CVRA 1PFBA 4X3SA 1HA6A 2RSNA 1IL8A 1SDFA 2FHTA 3KBXA 4ZAIA 2L4NA 1E0BA 1Q3LA 2R3ZA 4OIKA 1BO0A 4IURA 1F9RA 3I8ZA 1B4OA 3R93A 2FFKB 1G2SA 1J8IA 2Q8RE 4LMQD 3TZDA 2FMMA 1HUMA 2KEEA 4XDXA 2HDLA 3GV6A 1XX8A 1IKLA 1JE4A 1WD1A 1NR4A 4IUPA 2Q8TA 1WTPA 1EQTA 5EPJA 2VXWA 1F9QA 1PFMA 1BF4A 1DONA 1HRJA 2RVLA 2B2TC 5D65A 2H1EA 4HSVA 1KNAA 1NCVA 1B2TA 1EIGA 1SSOA 2SDFA 4RWSC 2B2TA 1M8AA 2N55A 2IL8A 4MHEA 1KNEA 2KUMA 4CJ0B 4QUCA 5CMDA 1ICWA 1C8CA 4RAUC 2EE1A 2NYZD 4QUFA 1F9PA 2RA4A 3DEPA 2NZ1D 1EOTA 1HUNA 1AZPA 4R8IA 1G6ZA 5AFWA 3F2UA 2M2LA 4UAIA 2RSOA 3IL8A 4XT3B 1RJTA 1O7ZA 3TN2A 4ZLTF 2L12A 5JJZA 2JYOA 3FDTA 5EJWA 1IKMA 5CORA 3G7LA 2KECA 1X3QA 5T1GA 4DN4M 1X3PA 1NAPA 3Q6SA 1G91A 1BNZA 3QO2A 1CA6A 2FJ2A 4RA8A 4CJ2C 2L9HA 2K05A 3MTSA 1QE6A 2HDMA 1EIHA 3GV3A 1AP0A 3HP3A 3P7JA 5EKIA 1CA5A 1QNKA 1S4ZA 4X3KA 5EPLA 2L1BA 4HCSA 2KEDA 1WTQA 3FPUB 2KOLA 3DM1A 2MP1A 1MGSA 4R9WA 1RODA 1EL0A 1O80A 4ZKCB 4ZKBB 5E4XA 2KVMA 3KUPA 4CJ1B 1WTRA 1U4LA 1RTNA 3UI2A 1RTOA 1DZ1A 2B2YC 2B2VC 4X3UA 1ZXTA 3IFDA 1U4PA 2EOTA 1BBXC 1VMPA
chains in the Genus database with same CATH superfamily
2GVBA 1SYEA 2G5DA 1YNJD 4LFCQ 2NVTH 1WD0A 1GJXA 5E3FA 4LF9Q 3CRLC 4DF7A 3SK6A 1QZGA 4IALA 1A15A 2TMPA 3QOJA 5M5XB 4LFBQ 1TQOA 2AQ1B 5IWAQ 4LF6L 2XWBB 3H0GB 4HCEA 1SRUA 1STNA 2WB1B 5T1IA 4DV0Q 3S14B 5M5WB 1GOZA 3WDNA 2AWNA 4DNRB 3M9BA 4XT1B 3MHBA 1JE5A 2EYPA 2PZTA 3B6YA 2N88A 4N9PA 5ELCA 5HURA 1HTLD 4H7BA 1EY4A 2R93G 2B2WA 1TVXA 2O2LD 3L3OC 2UXDQ 3I2ZA 1ILPA 3L7ZC 4A93B 1Q8KA 1X3EA 2RF4A 5EQ0A 1FL0A 4JI8Q 4Z9CB 3T53B 4LF5Q 4DR4L 1C48A 1EU4A 3CCQA 2O5IC 4A3CH 2YU9H 4OO1G 4IUNA 4JI4Q 2KENA 1HUMA 3T1HQ 5IGDA 2KEEA 1EY6A 2HDLA 1U9RA 1B3QA 2Z1CA 1CZWA 5CV7A 5C5MA 3GTQB 2E2HH 1IBLL 4LAAA 3OWFA 3RUZA 5D65A 1VQPA 2UXBQ 2F3VA 4DR2Q 1DYQA 4ABNA 2F0DA 2MFIA 3K6OA 1HQMC 1PYWD 3HOWG 1X54A 4DV5L 1Q12A 3SR1A 4RAUC 2WINB 1GUOA 3MZ5A 4R8IA 1NJIC 4X62Q 2M2LA 2PI2E 1LT3D 1UUPA 1NNXA 3HKSA 2R93H 1A3TA 4DR3L 2IY5B 3S1MH 3HOUG 1O78A 5BN4A 2B8FA 2QW7A 4CJ2C 1PZJD 4QCLA 2HDMA 4OO1H 2VQEQ 1VQGA 2E2DC 1QNKA 1TWFB 3A55A 2HD3A 4RCNA 5EPLA 3TEHB 1VQ6A 1EYAA 1QILA 2KOLA 1Q46A 1J5EQ 3AQQA 3BZDB 3GQBA 4DR7L 3KF8B 1UE6A 5M5YH 4JI3Q 4TKOB 2RQXA 3DWPA 3E5SA 3VR5A 1KDAA 2PYKA 1QVGA 2R7DA 1QVFA 1L1OC 1B53A 1PFNA 2RCFA 2HCCA 3J7A5 4K5VA 3KF6B 3TP8A 2NUCA 3RD4A 1TWAH 2X6GA 2AQ2B 4S3SA 1PTOC 1TU2B 3A8JE 4A3IH 4A3KH 3S2DB 2EJGC 1HFNA 2K52A 1I4PA 2ZJPA 3HOYG 5BN5A 1IL8A 1B44D 2A6ED 1HNZQ 1HR0Q 1O7LA 2ZT9C 1CI3M 1VQAA 3BYTB 4BBRB 1PRTC 2Z8LA 1SYDA 1X6OA 1XNRQ 1BXTA 1SBBB 2KCMA 2Q8RE 4BA1I 1UE5A 3I55A 3C1FA 3A5UA 1GUTA 4LFAQ 3S1RH 1EY7A 4JW0A 4MTKA 4DV3L 1HRJA 2Q8IB 1KTKA 2ID0A 1E2ZA 1VF5C 1HZAA 1BDOA 4IOCA 5GQOA 1SYGA 2KUMA 3I4MB 5BN3A 3TSSA 1PTOF 2XSCA 1EY5A 5BR8L 1R9TB 4IFDI 2ICIA 5TSSA 1K3BC 5C3EH 1WCMB 1QVCA 2QILA 2F0NA 1PRTF 4OONA 4C3JB 3IKJA 4QMGA 3PF5A 2MO0A 3OIQA 1Q7YC 2FMCA 4A3EG 2F0SA 2K05A 1XMOL 1RIPA 4H13C 1F2YA 2EYOA 3I56A 1N34L 1LTAD 1V43A 1OO9B 2VQFQ 3ND9A 3TZUA 3HOVH 1V1PA 3UDGA 1CTMA 4DK1A 2WB1E 1ZXTA 3PUVA 4A3DH 1IZ6A 3AFQA 2HHHL 2KHIA 5I2XA 1PH1A 3IFTA 3T51B 4DV6Q 2ATWA 5FLMH 1XYIA 1CZGA 1WTWA 1AZQA 3DXJC 1XTCD 1VDZA 2F0JA 4GNXB 3DEOA 5LHY1 3H0GG 1I50B 2DN8A 2BA1A 1PRTD 4DV7L 3I91A 1N32L 1CFMA 4OX9L 4DV2L 3QR8A 1WVLA 1N36L 1VQDA 2I5MX 3M4OH 3J80E 4A3EH 1IBMQ 2CW0C 3UE0A 1CT1D 1MD2D 4X64Q 2IT1A 4A93G 4KI0A 1WFQA 1KL9A 4UY8C 4K2KA 4KHPQ 2R3ZA 2R92B 5C4JB 1H9KA 4PV1C 2FXQA 4LMQD 3E9IA 3HFZB 5JVG3 1PXUA 4JI0Q 4PZ6A 2WACA 4ZRZA 3X3MA 2UUAQ 5CV6A 1S40A 3CHBD 4X65L 5IOCA 4ZUIA 4R4IA 1ZYRC 1JOKA 3DUZA 1N8RC 1Z6HA 2JA6B 2IHEA 4GKKQ 4B3TQ 3OWEB 2QGQA 3H0GH 4L5TA 4ZYSA 3S14H 5M5WH 3NEMA 4GS3A 4L5SA 1RF2D 3D4WA 1WJJA 1EWIA 1EOTA 2L5TA 2F4IA 1I94Q 1AZPA 4A3MB 1A8VA 2JA5H 2I46A 1Q1EA 2RSOA 1PYBA 1O7ZA 1HNXL 4HJ9A 3NTIA 1XMQL 5EBCA 5I6WA 1BNZA 3QO2A 1XWEA 3K58A 3MFYA 5FLXL 1X3GA 1S5CD 1EIHA 3BU2A 3KLRA 5GAGC 4FF2A 5IT9L 1BBWA 1DJRD 5GAHC 2PI2A 3J80c 3CCMA 1VQ5A 4CBVA 4DGZA 1UEBA 5IWAL 4GOPA 1O80A 1SNPA 5KYLA 1CKNA 4L63B 1RTNA 4N8FA 4WJ3M 5LMUQ 1PZID 4DAMA 2JN4A 2VB2X 4A3LG 1VMPA 5IGGA 2NZHA 4JV5L 4DUYL 2B2YA 4GKJQ 1FNWA 1AN8A 4GN4B 3PQIA 2UU9L 2JQOA 1G2TA 2CW0D 3SGIA 2KCTA 1BVSA 1ENCA 1LTRD 1KLGD 2ZJQA 1H9MA 2UXDL 3CPFA 1YNNC 2KA7A 4UP7A 2F0MA 4JI8L 4LF5L 2NN6I 4FP5D 2KCNA 3MXGA 2K5NA 5JPMC 1V1PB 4A3GB 4LF4L 3J7ZC 5KGUA 1LLRD 1HNWQ 1W3SA 3P20A 1JICA 3T1HL 1W6JA 5M3MH 5CBEE 4BXXG 1HA6A 1DOLA 1KQSA 3K81C 3ZYYX 1ZYRD 2K32A 1ASZA 2Z6KA 4F8MA 1TWFH 2F52A 4FXGC 4X3SA 1C9OA 4LF7Q 2RSNA 4XQQA 4R4CA 3W2DA 3ULPA 4FNFA 1GUNA 3I73A 1C4QA 4BBRG 3CW2C 3K8AA 3I8ZA 4BY1B 2KHJA 4A3LH 1VQFA 4LUVA 4EVOA 3NQTA 4HTHA 2XVSA 2ZXOA 1YJ9A 3PO2B 3E6ZX 3J81L 4PMCA 5ELDA 3FP9A 3CU7A 1X65A 3PIPA 4PNYA 1LYLA 1HZ9A 4HSVA 1KNAA 4KLKA 4KJNA 2AQ3B 1MBYA 5KEEA 2A1AA 1MIUA 1JB7A 2WAQB 3H3VI 3I4MG 2Z9HA 1PZKD 5IYCG 3GTKH 2NZ1D 3KDFA 4MTNA 1G6ZA 2KQ3A 1J5EL 2F03A 4UAIA 4XT3B 3IL8A 5C4ZA 1RJTA 1JJGA 4K0KQ 3SK4A 1WCMG 5EGTA 1E24A 1K8AC 4DU9A 2PCFB 4C3JG 2XRSD 4Y52H 5IT9E 4OELB 3M3YH 3HP3A 4G7ZC 2WKCA 1GVPA 1SE2A 1CA5A 2L1BA 4KKSA 4NPSA 2D5DA 1LTSD 1FNVA 1STHA 2A73B 2GA4B 5CC4A 1QUQA 4X3UA 3ZJYC 1K83B 1U4PA 3IFDA 3W1GA 1EQQA 1RCVD 2R7ZB 1X9NA 1RDPD 5ISRA 5I4DA 3KFUA 4JBMA 2YYZA 4IPCA 2JEBI 2NWGA 2G9DA 1L2FA 1RHPA 4HIOA 3I4MH 2E2JB 4HJ8A 1VQ9A 2NTSA 4R4QA 5C0XJ 2EXZA 1P8LA 3LWEA 4TSSA 1SYBA 1B1ZA 2CQOA 5DM63 4JYAQ 3MWYW 1R9TH 2OWOA 1A0IA 3GTPB 4MNOA 4C56C 5GADC 1HR0L 4A3BB 1WCMH 4C1NK 2X6LA 2FINB 4IUUA 2CWPA 2VUMG 1BUVT 1CKOA 5CV9A 4G7HC 4K5XA 1PFSA 3SK5A 1E22A 3ERSX 3M4PA 4IUVA 3S1RB 2LS01 3PMFA 4PG3A 3KBXA 2QEJC 2BH8A 1E0BA 2BCOA 2J0TD 3M4YA 1KD1C 2R92G 2QDBA 3R93A 3J81E 4ODGA 4X66Q 4P73A 3A8KE 1D5XC 2F0QA 5IGFA 3MEHA 2Q8TA 2I0QA 4KKTA 1EQTA 4DNTB 4YY3Q 1PFMA 4HIDA 1DONA 3AYHB 5C3EB 2XTIA 1B8AA 1X56A 5CYUA 2JA6G 3URYA 5C0XG 4GOPC 1I50H 2XNAC 5IGCA 3K5MA 4CJ0B 1YNXA 5D3IB 4K6DA 2EE1A 5JVH3 5ELEA 2ZTDA 3C2PA 3LNNA 2B3GA 3PGZA 5AFWA 3NXWA 4A3MG 2K14A 3KYHC 3KOJA 1N33Q 2VQFL 3D0FA 2JYOA 1IKMA 2V1CC 3BDOA 5IGBA 4R4TA 1EIFA 3ER0A 1NAPA 1HZCA 4HJ7A 4A3DB 2L9HA 3I4LA 4MIUA 4OO1I 1F77A 1PHJA 2R92H 4WORA 2P5ZX 3LWUA 1D5MC 2UUCQ 3DM1A 2D0PA 4ME3A 1SXTA 2O4XA 4O0AA 4RGMA 2F0LA 3KLSA 4GLXA 4K2LA 1WTRA 2OTLA 1NBWA 3S1NB 1E3PA 3KF8A 5LL6S 3JAML 4DV4Q 1LUZA 5C0XH 4KD3A 3ITPA 1WYDA 1NY4A 1DD2A 1Y1VB 4HJ5A 2OF1A 2YTVA 4FXDA 4X64L 4C3IB 4JPBW 2F0HA 4A3MH 1D1IA 1JJCB 5G3LF 1Q90A 4ME5A 1QCBD 1ESRA 5C5LA 5J1ZA 5L37A 1B3AA 3KF6A 4ZQ3A 2B39A 1LT6D 4A3GG 4A3CG 2X69A 3V96A 3CP0A 4JI0L 1SJED 1U4MA 3H91A 3WWVA 3GD7A 2CH4W 1WTOA 3VYTA 1A2UA 1PFBA 2M9VA 4FF4A 4GKKL 1UEAB 4XYQA 3HOXB 3NHHA 4C2MB 1SE4A 5JEAJ 2IHFA 1STAA 1Y8PB 4BY1G 4B3MQ 2WAQE 2EYLA 4TQUS 4XDXA 2IWHA 4CDDC 1CUKA 2JA5B 1BCPC 1E2WA 1R4PB 5C6AA 1AH9A 5G3LD 1TS5A 1E2VA 3K7AB 5HY6A 4TVAB 2AUKA 1JT8A 2XWJB 1GXDC 4KV6A 3GTJH 2WAQG 5CMDA 4YWKA 3PUXA 3OSOA 4A3GH 3DWAA 4DPGA 1CSQA 4P74A 4JI6Q 1U5KA 5CR3A 2R6GA 4GLAC 1EY0A 3D31A 3NP8A 2OT2A 4WRDA 5LMUL 3QG1A 4DN4M 4HMIA 4JK1C 1UE7A 1X3PA 4DR6L 1CA6A 3J7AV 2PNRC 1LTID 2A6EC 1QE6A 3GV3A 4EX5A 3PO3H 3I4OA 4P71A 4BY1H 4YHHL 1BCPF 4JBJA 3PO2H 1EL0A 1LO5D 3JAME 1PH8A 4PZ7A 1A62A 3U50C 5DLQE 2R7ZG 2A8VA 4HAEA 2A6HC 1TR5A 5H1SE 1YZ6A 2L11A 4DV1Q 1STBA 5M3MB 4A3IG 1EYDA 1LACA 2B2UA 1TWCB 3K80C 4A3KG 2OCEA 1Q86C 3NBIA 1YHQA 3RZOH 3SVMA 4LF7L 3HOZB 5JOBA 2QDLA 4GNXA 1EEFD 2EYHA 4F7XA 4IPDA 3FEWX 1VS0A 3VYSA 1E1TA 4A3BG 3S17B 1B70B 5EKLA 5CBAE 5JJKA 1A2TA 3W1BA 4IUQA 2SEBD 1O7YA 1EIYB 4HJAA 2MJ8A 1PTOB 1B50A 3EIVA 1SMXA 1BCPD 2TSSA 4OL7A 5E4WC 3DM3A 3X3NA 3AMUA 3OW2A 5JEAH 3J81j 1NMFA 2E2IH 1LM0A 3J7AF 1LT5D 1BO0A 1Z9FA 4IURA 1PRTB 3ERQA 1K83H 2R7ZH 1D6EC 1TXYA 1SMYC 1EY8A 3GTKB 3EQLC 1K8OA 1GUGA 4NXNL 3CCSA 2E2JH 4CDCC 1H95A 5C3EG 5JJLA 1B2TA 3S24A 1SSOA 4Q0FA 3F2DA 4RMFA 1XNQL 2N55A 3UDXA 3GTPH 1YHAA 2K5WA 1GM5A 3KLWA 4LJZC 4A3BH 2UXCQ 4QUFA 2LKVA 4IQZA 3M3YB 1HUNA 1K8GA 4XQNA 3NQIA 3GDEA 3F1ZA 3C1EA 3U9SA 3TN2A 1MJEA 1AW7A 4I7ZC 3A56A 3EN2A 3HOVG 2ZM6Q 2EY2A 2KBNA 4POGA 2A6HD 4FO2A 4A3DG 4ILWA 3I70A 4RKBA 3S16B 3VYUA 4A3FB 5FLMG 1ASYA 3FPUB 2F0UA 2ASBA 3LGJA 4R4OA 4QJFA 4DAPA 1S5BD 2ZXRA 1HZBA 4JYAL 4IJHA 3T1YL 3W5OA 4L6TB 3MXPA 4WJWA 1RTOA 1U0LA 4AYBB 1V1QA 3S15H 3SE0A 4HIKA 1YVCA 3BJUA 4JI1Q 2OQ0A 1VCIA 2BE5C 2C5CA 4UPAA 1U4RA 1Y1VG 3G6EA 4DNIA 3VDYA 4B3SL 3PUWA 2J7ZA 4UDUC 4C3IG 1ESFA 4HMJA 3D6WA 2JXMB 3M7NA 2F4VL 5AJ3L 1A63A 5KIXA 1GUWA 3MA2B 4X66L 2B2WC 2F0VA 1SMYD 3OTOQ 4O1NA 1DOKA 3CC4A 1STEA 4GZYC 1IW7D 1TKWB 3NENA 2L4NA 3K59A 4JVZA 4OWTB 5A35A 4A75A 5GROA 3S1NH 3Q24A 1JR0D 2EZVA 3HOXG 3TP5A 5LMNQ 2WB1G 5NUCA 2LSSA 1FJGL 1UNSA 2J4XA 4IUPA 4IFDJ 2JA5G 1Y1VH 3HKZB 2NVQB 1SE8A 5C3WA 3K7UC 5ELBA 2ZTEA 5HGQA 1NCVA 4CKBA 1Y8NB 1X3FA 4C3IH 5FO9B 1VQMA 4MHEA 1KNEA 4DK0A 2K6AA 3VR3A 4R8NA 3G48A 3K5NA 4I65A 4LUOA 4A4IA 2UUBL 3Q22A 1VQ8A 4FDBA 2ALYB 1IBKQ 2MO1A 1VQOA 1C0AA 5I9OA 2Q2IA 4DAYA 1PH9A 1KAWA 4DR1L 1TS2A 2PO4A 2VY3A 2WKDA 4JOIA 2ZXPA 3A54A 3G7LA 3NSWA 1G51A 3NPPA 1G91A 5KYIA 2BE5D 3HOXH 1AP0A 2I5LX 4C2MH 1GO3E 4KD4A 3UDFA 1FD7D 3GTLB 1I3QB 4LUZA 2XGTA 4YIJA 3NBHB 4CJ1B 1VQ4A 4LK1C 1K73C 1EU3A 3GTOB 3F2BA 4A76A 3U58A 2YV5A 5A2QL 2I5HA 3HG9A 4AIMA 5DNFA 3G6JB 1JWUD 2K04A 2B2VA 3K7AH 1G8ZD 3N52A 2EYFA 2EVBA 1GHKA 2SOBA 1Q82C 3SEBA 3I90A 4LF6Q 5M3MG 3C3LA 3VR4A 4LFCL 2PMZB 2JJQA 4BBSB 1II3A 4LF9L 1C7YA 1EY9A 3HOZG 4LFBL 3H3VC 4U673 1SAPA 5K36H 2B8GA 4DV0L 5KRUA 1OXXK 2DNEA 2EJMA 1NR2A 2XN9C 2DY7A 1Q8IA 2C9OA 4QL5A 5KNCA 4POFA 1RL2A 3D4RA 5FKAC 3PIOA 4LWCA 1B9NA 4V190 1HCZA 1RKNA 3E0EA 2RDGA 3FHWA 3CQZB 4UP8A 2F0KA 1PMRA 3GTJB 1J8IA 4I7AA 4IFDH 2OXPA 1WTHA 3EJIA 1IBLQ 4FF3A 1IKLA 1PV4A 4JI4L 1NSNS 1TT2A 3CRKC 2JSOA 1XTDA 3VR6A 2M00A 1TWCH 3T13A 2A69C 1SLJA 2PNHA 3S1QB 2B2TA 3BYYB 3HOZH 1BKBA 2UXBL 4DR2L 4IPGA 1ET6A 3PUYA 4NKLA 4DAVA 3S17H 1MHWC 2RA4A 3DEPA 5ELOA 3PO3B 3SHLA 3T56B 4KTAA 4YCUA 4DR3Q 3CF5A 1BOSA 2K5VA 4ULLA 1PTOH 3VR2A 4JC0A 2AKWB 2RHSB 4X62L 1Z7TA 1KHIA 1Q1BA 4EQOA 4AYBE 4RA8A 4YWMA 4OEMB 3Q23A 1OXUA 2N8NA 2ES2A 4X3KA 1CK1A 4A3FG 4WJ4A 5JJIA 1A6XA 3PCOB 4IO9A 3RN2A 4R9WA 2KHSA 2VQEL 4HIMA 1I4HA 4JG2A 3HGBA 4RKLA 3RZOB 4DAYB 4DXFA 5A2QE 3AU7A 4AYBG 3RN5A 5E1FA 5C0XI 3L0OA 4K5WA 3BVMA 4JI3L 1SE3A 1JJ2A 3OMCA 4A3JB 3BVGA 5FLXE 4X3TA 5IE8A 4HEDA 1DOMA 2NBFA 2EPBA 4KY6A 1ENAA 1MSHA 2E2IB 2LMCB 1ILQA 4X6AH 2K75A 3T4AC 1BBUA 2BDNA 4ZK9B 1PH2A 1D5ZC 3TP7A 3IAYA 4CKEA 3BZCA 3H09A 1P16A 5FK9C 3CPWA 4J15A 3NELA 1YIJA 2KCCA 1F2LA 1NTGA 4OHJA 4LW1A 3S16H 2JP1A 4A3FH 1I4GA 2IW3A 1G291 1FR3A 1V9PA 3HKZE 2A69D 1ET9A 2LXJA 4DK6C 3A7AB 1VQNA 2AHOB 1STYA 1HNZL 1B4OA 2UXCL 4C3HB 4ID6A 3CXCA 3WOEA 2JA8H 4DV3Q 1XNRL 3GV6A 1EFID 2SNMA 1JE4A 1WD1A 5I9PA 4GN3B 1WTPA 3CCLA 2RDHA 3NTKA 1EYCA 1L0YB 1VQLA 3FKIH 1A3VA 3HKZG 4LFAL 3TQYA 2EY6A 1M8AA 2R61A 1TS4A 3H94A 1EWHA 2PZWA 1XPRA 2F0PA 1I6VC 4P2CB 1L0XB 5FLXc 1YJNA 5IYBH 4DFAA 1QNUA 3DHQA 3FPPA 5IT9c 1JWMD 5CORA 1T9HA 5T1GA 1AE2A 3BS1A 1PH3A 3S15B 4HR7B 2C35B 3RLOA 4XQJA 4IOAA 5IP7H 2CWAA 1H9SA 5JPNC 3GTMH 3DLLA 2NN6H 2HHHQ 1SNCA 4PMWA 2PMZE 1DZ1A 2B2YC 2NVQH 3R8BA 2EDGA 2AUJD 1EWCA 1DGSA 4P72A 4CDEC 4JI5Q 1KDBA 1PDQA 3UDIA 3FMCA 4J1MA 1S5ED 1SN8A 4XIGS 3HS0C 4DV6L 1K9MC 4BBSG 4DV7Q 1F2ZA 1PLFA 1KDCA 4OX9Q 5LMNW 3KJPA 1TY0A 1L1OA 4DKAC 5E7NA 3TDQA 1K28A 5EBDA 4CHTB 5D14A 3J80i 5ELFA 1ML0D 1QOHA 4OGQC 1CHQD 2Z6KC 3ULJA 1YITA 2JEAI 3A0JA 3TMEA 4BWGB 3K57A 1F9SA 3EFXD 1WTXA 1IBML 4NP5A 1I6HH 3J81c 2BA0A 4PMBA 3BG3A 3GTLH 1I3QH 1MJCA 3H6MA 2PQAB 2NVXH 3CCUA 4RHRA 2QEXA 1UAPA 2NZOA 4TRDA 2AMCB 5FOBB 3GTOH 1G2SA 4LF8Q 4KHPL 1XX8A 3MXNA 2YTYA 1K0SA 1NR4A 4C1NI 2JA7H 2JE6I 2Q2TA 2UUAL 3RLFA 4DR5Q 4KKUA 1BCPB 4Y7NH 4MZ9A 1JWSD 4APVA 1FGUA 3OYYA 3L2PA 1YEZA 3RR5A 1EIGA 4BBSH 1IYVA 2F0GA 3GTGB 4QUCA 4B3TL 1VQ7A 1AE3A 1C8CA 2D0OA 3K0YA 1JORA 3CKIB 1XJVA 1QB5D 1M1KC 3PO3G 2DUDA 4AQYQ 1SFOH 1XMQQ 2F3IA 2K5DA 2ZJRA 1I94L 3PO2G 3H15A 2PPBC 4DA2A 1X3QA 4KHZA 1OXVA 2LY7A 3CQZH 4WFN3 1K8MA 3UE1A 1BQQT 2E8GA 2HQEA 5FJ8G 1PH6A 2CFMA 3TS2A 3QJYA 2KVMA 1JQYD 1XPUA 1G6PA 1EOVA 5CGKA 1XPOA 4JV5Q 3UI2A 4DUYQ 3CCRA 3BZKA 1JCKB 5M9OA 2UU9Q 2K28A 4JI7Q 1UE1A 1I5FA 1MKHA 1IL2A 2N49A 4IPHA 3S1QH 3DWQA 1EZ6A 4A3JG 4G4KA 1PH7A 4GKJL 1FVIA 2D9UA 1H9SB 3L9AX 5J39A 1NUCA 3FVQA 2DJFC 3PV0A 4LF4Q 1D2BA 1ZKOA 2K1BA 5JEAG 5I6YA 1YBYA 2K01A 5EPKA 5DM73 1J9OA 3RNUA 3R2TA 3VYRA 2K03A 2K50A 4NXMQ 4IUTA 2HQLA 5CV4A 2EYJA 3QWNA 2D2CC 1HNWL 3TRZA 3TBIB 1CM9A 2OEOA 4KJOA 3CCJA 4O42A 1VQKA 5FJ8H 1QWYA 3SXHA 2WP8J 2FHTA 3CC7A 1EQVA 2LFNA 5DEHA 1QJOA 1L1OB 1VQJA 3TZDA 4C3HG 2NVYB 5KNBA 1PA6A 1D1KA 1Y1WB 5GAEC 5IY0A 4A3JH 2E5LQ 2VXWA 1BF4A 1SNMA 2A68C 5IYDG 3EVQA 4NDXA 4EQNA 3FRPB 4XXEA 4GLVB 2B29A 4IJLA 3QIAA 3EA6A 1TY2A 4FVMA 4FF1A 1W2BA 2AWOA 1EEID 3MXNB 2A5HA 1EFWA 3T16A 4B9XA 4XYOA 2PZUA 1SNQA 2KECA 2RHQB 5M3FB 1S72A 3RZDB 1J6QA 4O2DA 1SJHD 3HOWH 4K0KL 3OMGA 1IW7C 1LTTD 3JAMc 5EKIA 4HCSA 1T5EA 4C3HH 2F0TA 1SEBD 1EYGA 1HXYD 3GP7A 3HOUH 4EQPA 3K5LA 1D7QA 3NBHA 1STGA 3R2IA 3NUCA 5IYDH 3F8TA 1JOOA 1VQBA 2MQHA 3J80L 2EXDA 1X32A 3I3CA 2Z6BA 1EZ8A 3SDZA 1LTBD 1VQCA 2ENBA 2DGYA 1L0WA 4KN4C 2BH2A 1LV9A 3AB9A 4JCVE 4Q5VA 1TWGH 2RDFA 3K5OA 4RFBA 3SK8A 4B3RQ 4JBWA 4YWLA 1KRTA 3D4DA 5K5PA 2VL6A 1PH5A 1Z47A 2HUGA 4MN3A 4K8IA 2JA8B 2RBMA 3E9HA 4CKCA 4DUZQ 1KC8C 3E0JA 4OXPA 4N9TA 3BDLA 2B63B 1V1OA 3TREA 2I07B 2MGSA 2CVRA 3FKIB 2A68D 1SR3A 3PUZA 2HIXA 1Q3LA 3ND8A 3V2TA 3S2HB 3R3OA 3J81i 2N3SA 3S9WA 3P75A 2FMMA 1F2MA 3U9OA 1SNOA 2N78A 3M85A 3HOYH 5EPJA 4OWXB 3NK9A 3KK7A 1TS3A 1HTPA 3MVVA 3QOLA 2EIFA 4YY3L 2L55A 3KLSX 2JK8A 2OQKA 4UP9A 2WV6D 2F0OA 3CAMA 2DJGC 2EJFC 1FNUA 3EROA 2G9HD 3Q8DA 3W3AA 3I4NB 2VW9A 3F2UA 4RGNA 3GTMB 2PQEA 4GN5A 4V0BA 1M90C 4ZLTF 1HJPA 3TS0A 4JI2Q 1YI2A 2CHBD 1B9MA 1HQRD 1PTOD 1N33L 2F0WA 1JOQA 2CQAA 2E76C 3Q6SA 4CDFC 3MAQA 1I4RA 2WIIB 3A5ZB 3N6RA 4QY7A 4JI5L 2D62A 2IX3A 2F3WA 4M1UB 2VS1A 5HGTA 2BOSA 2PW7A 3KBGA 2UUCL 3KUPA 2L0CA 2F0IA 2VUMB 2F1MA 1EUJA 2EOTA 4UHVA 5C3XA 4ZUJA 5C4HA 5K36G 1CQFA 4CGYB 2B2UC 1TIID 1FYCA 4DV4L 5C4XB 5C44B 1GKHA 3GTGH 4KN7C 2CCZA 5CV8A 5IP9G 2XRQD 2L15A 3D3RA 5J3BA 4GNXC 2H4OA 1KAAA 3V05A 3NE5B 1I6HB 5ELNA 3RMHA 2NVXB 2DY8A 1S5DD 3HRZC 1LT4D 2A74C 1Y8OB 2HT1A 3AEVA 4RG1A 4LF8L 1HHVA 3J7YW 3IRBA 4H02A 4IFDG 3MFGA 5M5XH 2MPMA 2JA7B 3PIO3 1TWHB 4DR5L 2SNSA 2YTXA 4BY7B 1SNDA 4G57A 4Y7NB 2QA4A 5IGEA 1DM0B 1IXRA 5KNDA 1IYUA 2NTTA 1F9RA 5CV5A 3Q0AA 2FFKB 2Y0SB 1LTGD 3A7LA 1Y1WG 4B3ML 1VF7A 4AQYL 4A93H 3D8GA 4AH6A 3PSIA 1SFOB 5IP9H 1JC7A 4EGVA 4DR4Q 1XXGA 1GHJA 4OWWB 4L8JA 4PQXA 4RWSC 4RGTA 3U4ZA 2NVTB 1OTCA 4ALPA 3HEJA 1D8LA 1ICWA 2K5HA 2K5QA 2WFWA 3CCEA 1F9PA 5F2DA 1BR9A 3GTQH 1YHBA 3DMUA 1VQIA 1CHPD 4KMUC 3OHXC 4DR6Q 4JI6L 5JJZA 4F88A 2CH4A 3K0XA 3PIP3 4L5RC 5M3FG 4FYDA 3AFPA 4JI7L 1LTLA 4QIWB 4QGUA 1RD9D 1OXSC 1I4XA 4XTCS 3CMEA 4YHHQ 4DV5Q 1VQEA 5I2YA 5J22A 1GUSA 4IN3A 3D6CA 2MHVA 1S4ZA 2PW5A 1IYJB 3U4VA 1KLUD 1M4VA 2NVYH 3O13A 1GD7A 1RODA 1Y69U 1Y1WH 1ICFB 4YCWA 3LX0A 5E4XA 2ZTCA 2IPKD 4E6IA 3JAMi 2K33A 1JMCA 2YU9B 2H5XA 1KRSA 2F0FA 1BBXC 2Z0SA 3MXUA 4RCOA 2O5JC 2V4DA 1QG7A 5COYA 2E75C 1X55A 1CQVA 3I7FA 5FO7B 4NXML 2MUYA 1Y14B 2E2HB 4F87A 2Z4IA 4OIJA 2F0EA 4LNQA 3ICEA 2HIVA 4IZ8A 1K0RA 4DV1L 3F2CA 1I4QA 4DR7Q 4FXKC 1NMGA 2K7VA 2DNCA 4P75A 2QF7A 2EQSA 3M4QA 4H44C 1V8QA 5M3FH 3RZDH 1VQHA 3NWTA 2VNUD 1WOCA 1R4QB 4U68A 1WTVA 2JA8G 2R93B 1MSGA 1K3RA 2NB0A 2E5LL 3S1MB 2EY5A 2B63G 4BA2I 1O7IA 3FKIG 4ZAIA 1Q81C 1H9JA 3A74A 2PQAA 2VZAA 4M8AA 1S3OA 1E7ZA 4BXXH 1E1OA 4RH6A 3S2DH 4KHVA 4YCVA 4NXNQ 3CD6A 4EQ5A 2R7FA 4L5QA 1F9QA 5M5YB 1XNQQ 2IX0A 4PZ8A 5IYBG 1DCZA 4BBRH 2SDFA 4NMZA 2BDOA 2EY1A 4HN7A 2IX1A 3HOWB 4B08A 1W6KA 2IJ0A 2OTJA 1T5XD 1YNND 4QB4A 3STBC 5IP7G 5IIFA 3I4NG 3P1HA 1PYSB 4JOIC 2Q2HA 2NN6G 2E74C 1A3UA 3HOUB 2B63H 1TWAB 4RHSA 2JA9A 1WI5A 3WOFA 3VA5A 4A3IB 2FJ2A 4A3KB 2EYMA 5IYCH 1PVOA 1N9WA 2ZM6L 3BVZA 3S2HH 1HR0W 3NWSA 5DAUA 2KEDA 3JC66 3T1YQ 4GOPB 5BR8Q 3MEFA 1IHZA 1MGSA 2MP1A 3GO5A 3CMAA 1FGBD 4G7OC 1B7YB 1CKNB 4ZKBB 1KIXA 4KY5A 1U4LA 3MC0B 1SROA 1AFPA 2LXKA 3HZXA 4B3RL 2B2VC 4C3JH 1TWGB 3OW7A 2VB3X 4KK7A 3M7GA 3NTHA 3ONAB 5EKKA 1XMOQ 2K4KA 4B3SQ 1HFGA 4DUZL 5C4XG 5C44G 4JI1L 1N34Q 1MI2A 4R1JA 2F4VQ 3I4NH 5AJ3Q 4KY7A 1KABA 1HPCA 4QQBX 3OOCA 4H0LC 1CSPA 4K8JA 1HA5A 3G71A 1YJWA 2XIWA 5FO8B 1YNJC 4NW2A 5IODA 2RCNA 4J6HA 4JBKA 1VMCA 2Y0SE 3PF4A 1H9RA 3HOYB 4RGOS 2HCIA 2JA7G 3OTOL 4BY7G 3EBEA 2CKZB 1SDFA 4K6LA 4BS9A 1QZHA 1SYFA 1PH4A 1OXTA 1FJGQ 4OIKA 3OPOA 2VUMH 1N32Q 3VA7A 4DV2Q 3A8IE 1N36Q 1HH2P 4DK3C 1ZEQX 2KJXA 3CC2A 3STBD 5LMNL 1EQRA 2Y0SG 3TP6A 2Q2UA 3CCVA 3HOVB 5C4XH 1LABA 2MNAA 4DXGA 5C44H 4K14A 1UWVA 5EAYA 4JI2L 2RVLA 2B2TC 2H1EA 2ICEC 4HSPA 2UUBQ 5C4JH 4NB3A 2IL8A 4J8QA 3KJOA 2GN5A 3E3XA 4QIWE 4ZCKA 3H3VH 3KDFB 4QF4A 2NYZD 2QCPX 4DR1Q 3ULLA 4X65Q 3QB3A 2Z4HA 2L12A 1IBKL 2RKSA 4N8X1 2JA6H 3FDTA 5EJWA 1KXLA 5JAVA 1TWHH 1DXMA 4BY7H 1ENFA 5LL6X 3C46A 3M4OB 3OIPA 4A3EB 5D3DA 3MTSA 1S5FD 4B9WA 1JB3A 3P7JA 2QKIC 1ONLA 3RLNA 1WTQA 1AEXA 3G4SA 2A19A 4ZKCB 1HNXQ 1SYCA 3I72A 1QUQB 3BDCA 1CKMA 1NE3A 2GVAA
chains in the Genus database with same CATH topology
1SYEA 1YNJD 1WD0A 1GJXA 5E3FA 3CRLC 4DF7A 3SK6A 4IALA 1A15A 2TMPA 3QOJA 5M5XB 1TQOA 2AQ1B 2XWBB 3H0GB 4HCEA 1STNA 2WB1B 5T1IA 3S14B 5M5WB 1GOZA 3WDNA 2AWNA 4DNRB 4XT1B 3MHBA 2EYPA 2PZTA 4N9PA 2N88A 5ELCA 5HURA 1HTLD 4H7BA 1EY4A 2B2WA 1TVXA 2O2LD 3L3OC 1ILPA 3L7ZC 4A93B 5EQ0A 4Z9CB 3T53B 1C48A 1EU4A 2O5IC 4OO1G 4IUNA 1HUMA 5IGDA 2KEEA 1EY6A 2HDLA 1U9RA 2Z1CA 1CZWA 5CV7A 5C5MA 3GTQB 4LAAA 3OWFA 3RUZA 5D65A 2F3VA 1DYQA 4ABNA 2F0DA 3K6OA 1HQMC 1PYWD 1Q12A 3SR1A 4RAUC 2WINB 1GUOA 3MZ5A 4R8IA 2M2LA 1LT3D 1UUPA 1A3TA 1O78A 5BN4A 2B8FA 4CJ2C 1PZJD 4QCLA 2HDMA 4OO1H 2E2DC 1QNKA 1TWFB 3A55A 5EPLA 4RCNA 1EYAA 1QILA 2KOLA 3BZDB 3GQBA 4TKOB 2RQXA 3DWPA 3E5SA 3VR5A 1KDAA 2PYKA 1B53A 1PFNA 2HCCA 4K5VA 3TP8A 2NUCA 3RD4A 2X6GA 2AQ2B 4S3SA 1PTOC 1TU2B 3A8JE 3S2DB 2EJGC 1HFNA 1I4PA 5BN5A 1IL8A 1B44D 2A6ED 1O7LA 2ZT9C 1CI3M 3BYTB 4BBRB 1PRTC 2Z8LA 1SYDA 1BXTA 1SBBB 2Q8RE 4BA1I 3C1FA 1GUTA 1EY7A 1HRJA 2Q8IB 1KTKA 2ID0A 1E2ZA 1VF5C 1BDOA 1SYGA 2KUMA 3I4MB 5BN3A 3TSSA 1PTOF 2XSCA 1EY5A 1R9TB 4IFDI 2ICIA 5TSSA 1WCMB 2QILA 2F0NA 1PRTF 4C3JB 3IKJA 4QMGA 3OIQA 2FMCA 2F0SA 2K05A 4H13C 1F2YA 2EYOA 1LTAD 1V43A 1OO9B 3ND9A 3TZUA 1V1PA 1CTMA 4DK1A 1ZXTA 3PUVA 5I2XA 3IFTA 3T51B 1XYIA 1CZGA 1WTWA 1AZQA 3DXJC 1XTCD 1VDZA 2F0JA 3DEOA 5LHY1 1I50B 2DN8A 2BA1A 1PRTD 3I91A 1CFMA 1WVLA 3J80E 2CW0C 1CT1D 1MD2D 2IT1A 4KI0A 4K2KA 2R3ZA 2R92B 5C4JB 1H9KA 4PV1C 4LMQD 5JVG3 1PXUA 4ZRZA 2WACA 3X3MA 5CV6A 3CHBD 5IOCA 4ZUIA 1ZYRC 1JOKA 3DUZA 1Z6HA 2JA6B 3OWEB 4ZYSA 1RF2D 3D4WA 1EOTA 2L5TA 2F4IA 1AZPA 4A3MB 2I46A 1Q1EA 2RSOA 1O7ZA 3NTIA 5EBCA 5I6WA 1BNZA 3QO2A 1XWEA 3K58A 3MFYA 5FLXL 1S5CD 1EIHA 3KLRA 4FF2A 5IT9L 1DJRD 4CBVA 4DGZA 1O80A 1SNPA 5KYLA 4L63B 1RTNA 1PZID 2VB2X 1VMPA 5IGGA 2B2YA 1FNWA 1AN8A 1G2TA 2CW0D 1ENCA 1LTRD 1KLGD 1H9MA 1YNNC 2KA7A 2F0MA 2NN6I 4FP5D 2KCNA 3MXGA 5JPMC 1V1PB 4A3GB 5KGUA 1LLRD 3P20A 1JICA 1W6JA 1HA6A 5CBEE 1DOLA 3ZYYX 1ZYRD 2K32A 4F8MA 4FXGC 4X3SA 2RSNA 4XQQA 3W2DA 4FNFA 1GUNA 3I73A 1C4QA 3I8ZA 4BY1B 4EVOA 3NQTA 4HTHA 2XVSA 2ZXOA 3PO2B 3E6ZX 3J81L 4PMCA 5ELDA 3CU7A 4PNYA 4HSVA 1KNAA 4KJNA 2AQ3B 1MBYA 5KEEA 2WAQB 1PZKD 2NZ1D 1G6ZA 2KQ3A 2F03A 4UAIA 4XT3B 3IL8A 5C4ZA 1RJTA 3SK4A 5EGTA 4DU9A 2PCFB 4C3JG 2XRSD 5IT9E 3HP3A 4G7ZC 2WKCA 1SE2A 1CA5A 2L1BA 4KKSA 2D5DA 1LTSD 1FNVA 1STHA 2A73B 2GA4B 5CC4A 4X3UA 1K83B 1U4PA 3IFDA 2R7ZB 1RCVD 1RDPD 5ISRA 5I4DA 2YYZA 2JEBI 2NWGA 2G9DA 1RHPA 2E2JB 2NTSA 5C0XJ 2EXZA 3LWEA 4TSSA 1SYBA 1B1ZA 5DM63 3MWYW 3GTPB 4C56C 4A3BB 4C1NK 2X6LA 2FINB 4IUUA 1BUVT 5CV9A 4G7HC 4K5XA 3SK5A 4IUVA 3S1RB 2LS01 3PMFA 3KBXA 2QEJC 1E0BA 2BCOA 2J0TD 3M4YA 2QDBA 3R93A 3J81E 4ODGA 3A8KE 1D5XC 2F0QA 5IGFA 3MEHA 2Q8TA 4KKTA 1EQTA 4DNTB 1PFMA 1DONA 5C3EB 5CYUA 3URYA 5C0XG 2XNAC 5IGCA 3K5MA 4CJ0B 5D3IB 4K6DA 2EE1A 5JVH3 5ELEA 3C2PA 3LNNA 5AFWA 3NXWA 2JYOA 1IKMA 3BDOA 5IGBA 1NAPA 4A3DB 2L9HA 3I4LA 4MIUA 4OO1I 1F77A 4WORA 3LWUA 1D5MC 3DM1A 1SXTA 2O4XA 4RGMA 2F0LA 3KLSA 1WTRA 4K2LA 3S1NB 3KF8A 5LL6S 3JAML 5C0XH 4KD3A 3ITPA 1DD2A 1Y1VB 2OF1A 4FXDA 4C3IB 2F0HA 1D1IA 5G3LF 1Q90A 4ME5A 1QCBD 1ESRA 5C5LA 5J1ZA 1B3AA 4ZQ3A 2B39A 1LT6D 2X69A 3V96A 1SJED 1U4MA 3H91A 3GD7A 1WTOA 3VYTA 1A2UA 1PFBA 2M9VA 4FF4A 1UEAB 4XYQA 3HOXB 3NHHA 4C2MB 1SE4A 5JEAJ 1STAA 1Y8PB 2EYLA 4TQUS 4XDXA 2IWHA 2JA5B 1BCPC 1E2WA 1R4PB 5C6AA 5G3LD 1TS5A 1E2VA 3K7AB 2AUKA 2XWJB 1GXDC 4KV6A 5CMDA 3PUXA 3OSOA 3DWAA 5CR3A 2R6GA 1EY0A 3D31A 3NP8A 2OT2A 4WRDA 3QG1A 4DN4M 4HMIA 4JK1C 1X3PA 1CA6A 3J7AV 2PNRC 1LTID 2A6EC 1QE6A 3GV3A 1BCPF 1EL0A 1LO5D 3JAME 4HAEA 2A6HC 1TR5A 2L11A 1STBA 5M3MB 1EYDA 1LACA 2B2UA 1TWCB 3NBIA 3SVMA 3HOZB 5JOBA 1EEFD 2EYHA 4F7XA 3FEWX 3VYSA 3S17B 5CBAE 5EKLA 1A2TA 4IUQA 2SEBD 1O7YA 2MJ8A 1PTOB 1B50A 1BCPD 2TSSA 4OL7A 5E4WC 3X3NA 3AMUA 5JEAH 3J7AF 1LT5D 1BO0A 4IURA 1PRTB 3ERQA 1D6EC 1SMYC 1EY8A 3GTKB 3EQLC 1K8OA 1GUGA 1B2TA 1SSOA 4Q0FA 2N55A 2K5WA 4LJZC 4QUFA 2LKVA 4IQZA 3M3YB 1HUNA 4XQNA 3NQIA 3C1EA 3U9SA 3TN2A 1AW7A 4I7ZC 3A56A 2EY2A 2A6HD 4FO2A 4ILWA 3I70A 4RKBA 3S16B 3VYUA 4A3FB 3FPUB 2F0UA 4DAPA 1S5BD 2ZXRA 4L6TB 3MXPA 4WJWA 1RTOA 4AYBB 3SE0A 1VCIA 2BE5C 2C5CA 1U4RA 3PUWA 2J7ZA 4UDUC 4C3IG 1ESFA 4HMJA 3D6WA 2JXMB 3M7NA 5KIXA 1GUWA 3MA2B 2B2WC 2F0VA 1SMYD 4O1NA 1DOKA 1STEA 4GZYC 1IW7D 1TKWB 2L4NA 3K59A 5A35A 3Q24A 1JR0D 2EZVA 3TP5A 5NUCA 1UNSA 2J4XA 4IUPA 4IFDJ 3HKZB 2NVQB 5C3WA 5ELBA 1NCVA 4CKBA 1Y8NB 5FO9B 4MHEA 1KNEA 4DK0A 2K6AA 3VR3A 4R8NA 3K5NA 4I65A 3Q22A 5I9OA 4DAYA 1TS2A 2PO4A 2WKDA 2ZXPA 3A54A 3G7LA 3NSWA 3NPPA 1G91A 5KYIA 2BE5D 1AP0A 4KD4A 1FD7D 3GTLB 1I3QB 4YIJA 4CJ1B 4LK1C 1EU3A 3GTOB 5A2QL 3HG9A 5DNFA 3G6JB 1JWUD 2K04A 2B2VA 1G8ZD 3N52A 2EYFA 2EVBA 1GHKA 2SOBA 3SEBA 3I90A 3C3LA 3VR4A 2PMZB 4BBSB 1II3A 1EY9A 3H3VC 4U673 1SAPA 5K36H 2B8GA 5KRUA 1OXXK 2DNEA 2EJMA 1NR2A 2XN9C 2DY7A 1Q8IA 2C9OA 5KNCA 3D4RA 5FKAC 1B9NA 4V190 1HCZA 1RKNA 2RDGA 3CQZB 2F0KA 1PMRA 3GTJB 1J8IA 4IFDH 2OXPA 3EJIA 4FF3A 1IKLA 1NSNS 1TT2A 3CRKC 2JSOA 3VR6A 2M00A 3T13A 2A69C 3S1QB 2B2TA 3BYYB 1ET6A 3PUYA 4NKLA 4DAVA 3DEPA 2RA4A 3PO3B 3SHLA 3T56B 4KTAA 1BOSA 4ULLA 1PTOH 3VR2A 1Z7TA 4EQOA 1Q1BA 4RA8A 3Q23A 1OXUA 4X3KA 1CK1A 1A6XA 4R9WA 2KHSA 1I4HA 3HGBA 4RKLA 3RZOB 4DXFA 5A2QE 3AU7A 5E1FA 5C0XI 4K5WA 3BVMA 1SE3A 3OMCA 4A3JB 3BVGA 5FLXE 4X3TA 4HEDA 1DOMA 2NBFA 2EPBA 4KY6A 1ENAA 1MSHA 2E2IB 2LMCB 1ILQA 3T4AC 2BDNA 4ZK9B 1D5ZC 3TP7A 3IAYA 4CKEA 3H09A 5FK9C 2KCCA 1F2LA 4OHJA 2JP1A 1I4GA 2IW3A 1G291 1FR3A 2A69D 1ET9A 3A7AB 1STYA 1B4OA 4C3HB 4ID6A 3WOEA 3GV6A 1EFID 2SNMA 1JE4A 1WD1A 5I9PA 1WTPA 2RDHA 3NTKA 1EYCA 1L0YB 1A3VA 2EY6A 1M8AA 2R61A 1TS4A 3H94A 1EWHA 2PZWA 2F0PA 1I6VC 4P2CB 1L0XB 4DFAA 1QNUA 3DHQA 3FPPA 1JWMD 5CORA 5T1GA 3BS1A 3S15B 4HR7B 4XQJA 1H9SA 5JPNC 2NN6H 1SNCA 4PMWA 1DZ1A 2B2YC 3R8BA 2EDGA 2AUJD 1EWCA 1KDBA 1PDQA 3FMCA 4J1MA 1S5ED 4XIGS 3HS0C 1PLFA 1F2ZA 1KDCA 1TY0A 3TDQA 5EBDA 4CHTB 5D14A 5ELFA 1ML0D 1QOHA 4OGQC 1CHQD 2JEAI 3TMEA 4BWGB 3K57A 1F9SA 3EFXD 1WTXA 4NP5A 2BA0A 4PMBA 3BG3A 3H6MA 4RHRA 1UAPA 4TRDA 5FOBB 1G2SA 1XX8A 3MXNA 1NR4A 4C1NI 2JE6I 3RLFA 4KKUA 1BCPB 1JWSD 1IYVA 1EIGA 2F0GA 3GTGB 4QUCA 1C8CA 3K0YA 1JORA 3CKIB 1QB5D 2K5DA 2PPBC 4DA2A 1X3QA 4KHZA 1OXVA 2LY7A 4WFN3 1K8MA 1BQQT 2HQEA 3QJYA 2KVMA 1JQYD 5CGKA 3UI2A 1JCKB 5M9OA 2K28A 3DWQA 1EZ6A 4G4KA 2D9UA 1H9SB 3L9AX 5J39A 1NUCA 3FVQA 3PV0A 1D2BA 1ZKOA 2K1BA 5JEAG 5I6YA 2K01A 5EPKA 5DM73 1J9OA 3R2TA 3VYRA 2K03A 4IUTA 5CV4A 2EYJA 3QWNA 2D2CC 3TBIB 1CM9A 2OEOA 4KJOA 4O42A 1QWYA 3SXHA 2WP8J 2FHTA 1EQVA 2LFNA 5DEHA 1QJOA 3TZDA 4C3HG 2NVYB 5KNBA 1D1KA 1Y1WB 2VXWA 1BF4A 1SNMA 2A68C 3EVQA 4NDXA 4EQNA 3FRPB 4XXEA 3QIAA 3EA6A 1TY2A 4FVMA 4FF1A 2AWOA 1EEID 2A5HA 3T16A 4B9XA 4XYOA 2PZUA 1SNQA 2KECA 5M3FB 3RZDB 1SJHD 3OMGA 1IW7C 1LTTD 5EKIA 4HCSA 1T5EA 2F0TA 1SEBD 1HXYD 3GP7A 4EQPA 3K5LA 3NBHA 1STGA 3R2IA 3NUCA 1JOOA 3J80L 1X32A 3I3CA 1EZ8A 3SDZA 1LTBD 2ENBA 4KN4C 1LV9A 3AB9A 4Q5VA 2RDFA 3K5OA 4RFBA 3SK8A 4JBWA 3D4DA 5K5PA 1Z47A 2HUGA 4MN3A 4K8IA 2JA8B 2RBMA 4CKCA 3E0JA 4N9TA 3BDLA 2B63B 1V1OA 2I07B 2MGSA 2CVRA 3FKIB 2A68D 3PUZA 1Q3LA 3ND8A 3V2TA 3S2HB 3R3OA 3S9WA 3P75A 2FMMA 1F2MA 3U9OA 1SNOA 3M85A 5EPJA 3NK9A 3KK7A 1TS3A 1HTPA 3MVVA 3QOLA 2L55A 3KLSX 2WV6D 2F0OA 2EJFC 1FNUA 3EROA 2G9HD 3W3AA 3I4NB 3F2UA 4RGNA 3GTMB 2PQEA 4V0BA 4ZLTF 2CHBD 1B9MA 1HQRD 1PTOD 1JOQA 2F0WA 2CQAA 2E76C 3Q6SA 3MAQA 1I4RA 2WIIB 3N6RA 2D62A 2IX3A 2F3WA 4M1UB 5HGTA 2BOSA 2PW7A 3KBGA 3KUPA 2L0CA 2F0IA 2VUMB 2F1MA 2EOTA 5C3XA 4ZUJA 5C4HA 5K36G 1CQFA 4CGYB 2B2UC 1TIID 1FYCA 5C4XB 5C44B 4KN7C 5CV8A 2XRQD 3D3RA 2H4OA 1KAAA 3V05A 3NE5B 1I6HB 3RMHA 2NVXB 2DY8A 1S5DD 3HRZC 1LT4D 2A74C 1Y8OB 1HHVA 3J7YW 4IFDG 3MFGA 2MPMA 2JA7B 3PIO3 1TWHB 2SNSA 4BY7B 1SNDA 4G57A 4Y7NB 5IGEA 1DM0B 5KNDA 1IYUA 2NTTA 1F9RA 5CV5A 3Q0AA 2FFKB 2Y0SB 1LTGD 3A7LA 1VF7A 3D8GA 1SFOB 1JC7A 4EGVA 1XXGA 1GHJA 4L8JA 4PQXA 4RWSC 4RGTA 2NVTB 3HEJA 1ICWA 2K5QA 1F9PA 5F2DA 1BR9A 3DMUA 1CHPD 4KMUC 3OHXC 5JJZA 4F88A 3PIP3 4FYDA 4QIWB 1RD9D 1OXSC 1I4XA 4XTCS 5I2YA 5J22A 1GUSA 4IN3A 3D6CA 2MHVA 1S4ZA 2PW5A 1KLUD 1M4VA 3O13A 1RODA 1Y69U 3LX0A 5E4XA 4E6IA 2IPKD 2K33A 2YU9B 2F0FA 1BBXC 3MXUA 4RCOA 2O5JC 2V4DA 1QG7A 5COYA 2E75C 1CQVA 5FO7B 2MUYA 2E2HB 4F87A 2Z4IA 4OIJA 2F0EA 4IZ8A 1I4QA 4FXKC 2K7VA 2DNCA 2QF7A 4H44C 1V8QA 3NWTA 2VNUD 4U68A 1R4QB 1WTVA 2R93B 1MSGA 2NB0A 3S1MB 2EY5A 4BA2I 4ZAIA 1H9JA 4M8AA 4RH6A 4KHVA 1F9QA 5M5YB 2IX0A 1DCZA 2SDFA 4NMZA 2BDOA 2EY1A 4HN7A 2IX1A 3HOWB 4B08A 1W6KA 2IJ0A 1T5XD 1YNND 4QB4A 5IIFA 3P1HA 2NN6G 2E74C 1A3UA 3HOUB 1TWAB 4RHSA 3WOFA 3VA5A 4A3IB 2FJ2A 4A3KB 2EYMA 3BVZA 3NWSA 5DAUA 2KEDA 1IHZA 1MGSA 2MP1A 3GO5A 1FGBD 4G7OC 4ZKBB 4KY5A 1U4LA 3MC0B 1AFPA 3HZXA 2B2VC 1TWGB 3OW7A 2VB3X 4KK7A 3M7GA 3NTHA 3ONAB 5EKKA 1HFGA 1MI2A 4KY7A 1KABA 1HPCA 3OOCA 4H0LC 4K8JA 1HA5A 2XIWA 5FO8B 1YNJC 4NW2A 5IODA 4J6HA 1VMCA 1H9RA 3HOYB 4RGOS 2HCIA 1SDFA 4K6LA 4BS9A 1SYFA 1OXTA 4OIKA 3OPOA 3VA7A 3A8IE 1ZEQX 2KJXA 3TP6A 3HOVB 1LABA 4DXGA 4K14A 2RVLA 2B2TC 2H1EA 2ICEC 4HSPA 2IL8A 4J8QA 4QF4A 2NYZD 2QCPX 3QB3A 2Z4HA 2L12A 2RKSA 3FDTA 5EJWA 5JAVA 1DXMA 1ENFA 5LL6X 3C46A 3M4OB 3OIPA 4A3EB 5D3DA 3MTSA 1S5FD 4B9WA 1JB3A 3P7JA 2QKIC 1ONLA 1WTQA 1AEXA 4ZKCB 1SYCA 3I72A 3BDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONA B;  5DNF A;  4HAE A;  5COY A;  1QG7 A;  2K04 A;  2B2Y A;  2B2V A;  3N52 A;  2B2U C;  1X32 A;  2L11 A;  1HFG A;  2NWG A;  3I3C A;  1XYI A;  4X3T A;  1WD0 A;  1G2T A;  1RHP A;  1PDQ A;  3I90 A;  1U4R A;  4OIJ A;  4HED A;  2B2U A;  2D9U A;  1DOM A;  1A15 A;  1MI2 A;  1WTW A;  1AZQ A;  3LWE A;  2J7Z A;  2EPB A;  3SVM A;  1B53 A;  1PFN A;  3DEO A;  3MWY W;  1PLF A;  1MSH A;  5T1I A;  1LV9 A;  3D6W A;  1HHV A;  2K1B A;  2HCC A;  1SAP A;  1ILQ A;  1ESR A;  2K01 A;  3I91 A;  2DY8 A;  5EPK A;  2X6L A;  2FIN B;  1B3A A;  4IUU A;  4XT1 B;  5CBA E;  1GUW A;  1J9O A;  2BDN A;  2X69 A;  2X6G A;  1NR2 A;  4ZK9 B;  2HUG A;  4IUQ A;  2XIW A;  5D14 A;  2DY7 A;  1WVL A;  1JIC A;  1U4M A;  1ML0 D;  2B2W C;  1O7Y A;  2K03 A;  2N88 A;  4MN3 A;  4IUT A;  4NW2 A;  2MJ8 A;  1DOL A;  5CBE E;  3H91 A;  4U68 A;  1WTV A;  1B50 A;  1HFN A;  1VMC A;  1MSG A;  1DOK A;  2B2W A;  1TVX A;  2MPM A;  2K28 A;  4IUV A;  1F2L A;  1F9S A;  1WTO A;  1ILP A;  1CM9 A;  2HCI A;  5E4W C;  2MGS A;  2JP1 A;  1WTX A;  4O42 A;  5EQ0 A;  2CVR A;  1PFB A;  4X3S A;  1HA6 A;  2RSN A;  1IL8 A;  1SDF A;  2FHT A;  3KBX A;  4ZAI A;  2L4N A;  1E0B A;  1Q3L A;  2R3Z A;  4OIK A;  1BO0 A;  4IUR A;  1F9R A;  3I8Z A;  1B4O A;  3R93 A;  2FFK B;  1G2S A;  1J8I A;  2Q8R E;  4LMQ D;  3TZD A;  2FMM A;  1HUM A;  2KEE A;  4XDX A;  2HDL A;  3GV6 A;  1XX8 A;  1IKL A;  1JE4 A;  1WD1 A;  1NR4 A;  4IUP A;  2Q8T A;  1WTP A;  1EQT A;  5EPJ A;  2VXW A;  1F9Q A;  1PFM A;  1BF4 A;  1DON A;  1HRJ A;  2RVL A;  2B2T C;  5D65 A;  2H1E A;  4HSV A;  1KNA A;  1NCV A;  1B2T A;  1EIG A;  1SSO A;  2SDF A;  4RWS C;  2B2T A;  1M8A A;  2N55 A;  2IL8 A;  4MHE A;  1KNE A;  2KUM A;  4CJ0 B;  4QUC A;  5CMD A;  1ICW A;  1C8C A;  4RAU C;  2EE1 A;  2NYZ D;  4QUF A;  1F9P A;  2RA4 A;  3DEP A;  2NZ1 D;  1EOT A;  1HUN A;  1AZP A;  4R8I A;  1G6Z A;  5AFW A;  3F2U A;  2M2L A;  4UAI A;  2RSO A;  3IL8 A;  4XT3 B;  1RJT A;  1O7Z A;  3TN2 A;  4ZLT F;  2L12 A;  5JJZ A;  2JYO A;  3FDT A;  5EJW A;  1IKM A;  5COR A;  3G7L A;  2KEC A;  1X3Q A;  5T1G A;  4DN4 M;  1X3P A;  1NAP A;  3Q6S A;  1G91 A;  1BNZ A;  3QO2 A;  1CA6 A;  2FJ2 A;  4RA8 A;  4CJ2 C;  2L9H A;  2K05 A;  3MTS A;  1QE6 A;  2HDM A;  1EIH A;  3GV3 A;  1AP0 A;  3HP3 A;  3P7J A;  5EKI A;  1CA5 A;  1QNK A;  1S4Z A;  4X3K A;  5EPL A;  2L1B A;  4HCS A;  2KED A;  1WTQ A;  3FPU B;  2KOL A;  3DM1 A;  2MP1 A;  1MGS A;  4R9W A;  1ROD A;  1EL0 A;  1O80 A;  4ZKC B;  4ZKB B;  5E4X A;  2KVM A;  3KUP A;  4CJ1 B;  1WTR A;  1U4L A;  1RTN A;  3UI2 A;  1RTO A;  1DZ1 A;  2B2Y C;  2B2V C;  4X3U A;  1ZXT A;  3IFD A;  1U4P A;  2EOT A;  1BBX C;  1VMP A; 
#chains in the Genus database with same CATH topology
 2GVB A;  1SYE A;  2G5D A;  1YNJ D;  4LFC Q;  2NVT H;  1WD0 A;  1GJX A;  5E3F A;  4LF9 Q;  3CRL C;  4DF7 A;  3SK6 A;  1QZG A;  4IAL A;  1A15 A;  2TMP A;  3QOJ A;  5M5X B;  4LFB Q;  1TQO A;  2AQ1 B;  5IWA Q;  4LF6 L;  2XWB B;  3H0G B;  4HCE A;  1SRU A;  1STN A;  2WB1 B;  5T1I A;  4DV0 Q;  3S14 B;  5M5W B;  1GOZ A;  3WDN A;  2AWN A;  4DNR B;  3M9B A;  4XT1 B;  3MHB A;  1JE5 A;  2EYP A;  2PZT A;  3B6Y A;  2N88 A;  4N9P A;  5ELC A;  5HUR A;  1HTL D;  4H7B A;  1EY4 A;  2R93 G;  2B2W A;  1TVX A;  2O2L D;  3L3O C;  2UXD Q;  3I2Z A;  1ILP A;  3L7Z C;  4A93 B;  1Q8K A;  1X3E A;  2RF4 A;  5EQ0 A;  1FL0 A;  4JI8 Q;  4Z9C B;  3T53 B;  4LF5 Q;  4DR4 L;  1C48 A;  1EU4 A;  3CCQ A;  2O5I C;  4A3C H;  2YU9 H;  4OO1 G;  4IUN A;  4JI4 Q;  2KEN A;  1HUM A;  3T1H Q;  5IGD A;  2KEE A;  1EY6 A;  2HDL A;  1U9R A;  1B3Q A;  2Z1C A;  1CZW A;  5CV7 A;  5C5M A;  3GTQ B;  2E2H H;  1IBL L;  4LAA A;  3OWF A;  3RUZ A;  5D65 A;  1VQP A;  2UXB Q;  2F3V A;  4DR2 Q;  1DYQ A;  4ABN A;  2F0D A;  2MFI A;  3K6O A;  1HQM C;  1PYW D;  3HOW G;  1X54 A;  4DV5 L;  1Q12 A;  3SR1 A;  4RAU C;  2WIN B;  1GUO A;  3MZ5 A;  4R8I A;  1NJI C;  4X62 Q;  2M2L A;  2PI2 E;  1LT3 D;  1UUP A;  1NNX A;  3HKS A;  2R93 H;  1A3T A;  4DR3 L;  2IY5 B;  3S1M H;  3HOU G;  1O78 A;  5BN4 A;  2B8F A;  2QW7 A;  4CJ2 C;  1PZJ D;  4QCL A;  2HDM A;  4OO1 H;  2VQE Q;  1VQG A;  2E2D C;  1QNK A;  1TWF B;  3A55 A;  2HD3 A;  4RCN A;  5EPL A;  3TEH B;  1VQ6 A;  1EYA A;  1QIL A;  2KOL A;  1Q46 A;  1J5E Q;  3AQQ A;  3BZD B;  3GQB A;  4DR7 L;  3KF8 B;  1UE6 A;  5M5Y H;  4JI3 Q;  4TKO B;  2RQX A;  3DWP A;  3E5S A;  3VR5 A;  1KDA A;  2PYK A;  1QVG A;  2R7D A;  1QVF A;  1L1O C;  1B53 A;  1PFN A;  2RCF A;  2HCC A;  3J7A 5;  4K5V A;  3KF6 B;  3TP8 A;  2NUC A;  3RD4 A;  1TWA H;  2X6G A;  2AQ2 B;  4S3S A;  1PTO C;  1TU2 B;  3A8J E;  4A3I H;  4A3K H;  3S2D B;  2EJG C;  1HFN A;  2K52 A;  1I4P A;  2ZJP A;  3HOY G;  5BN5 A;  1IL8 A;  1B44 D;  2A6E D;  1HNZ Q;  1HR0 Q;  1O7L A;  2ZT9 C;  1CI3 M;  1VQA A;  3BYT B;  4BBR B;  1PRT C;  2Z8L A;  1SYD A;  1X6O A;  1XNR Q;  1BXT A;  1SBB B;  2KCM A;  2Q8R E;  4BA1 I;  1UE5 A;  3I55 A;  3C1F A;  3A5U A;  1GUT A;  4LFA Q;  3S1R H;  1EY7 A;  4JW0 A;  4MTK A;  4DV3 L;  1HRJ A;  2Q8I B;  1KTK A;  2ID0 A;  1E2Z A;  1VF5 C;  1HZA A;  1BDO A;  4IOC A;  5GQO A;  1SYG A;  2KUM A;  3I4M B;  5BN3 A;  3TSS A;  1PTO F;  2XSC A;  1EY5 A;  5BR8 L;  1R9T B;  4IFD I;  2ICI A;  5TSS A;  1K3B C;  5C3E H;  1WCM B;  1QVC A;  2QIL A;  2F0N A;  1PRT F;  4OON A;  4C3J B;  3IKJ A;  4QMG A;  3PF5 A;  2MO0 A;  3OIQ A;  1Q7Y C;  2FMC A;  4A3E G;  2F0S A;  2K05 A;  1XMO L;  1RIP A;  4H13 C;  1F2Y A;  2EYO A;  3I56 A;  1N34 L;  1LTA D;  1V43 A;  1OO9 B;  2VQF Q;  3ND9 A;  3TZU A;  3HOV H;  1V1P A;  3UDG A;  1CTM A;  4DK1 A;  2WB1 E;  1ZXT A;  3PUV A;  4A3D H;  1IZ6 A;  3AFQ A;  2HHH L;  2KHI A;  5I2X A;  1PH1 A;  3IFT A;  3T51 B;  4DV6 Q;  2ATW A;  5FLM H;  1XYI A;  1CZG A;  1WTW A;  1AZQ A;  3DXJ C;  1XTC D;  1VDZ A;  2F0J A;  4GNX B;  3DEO A;  5LHY 1;  3H0G G;  1I50 B;  2DN8 A;  2BA1 A;  1PRT D;  4DV7 L;  3I91 A;  1N32 L;  1CFM A;  4OX9 L;  4DV2 L;  3QR8 A;  1WVL A;  1N36 L;  1VQD A;  2I5M X;  3M4O H;  3J80 E;  4A3E H;  1IBM Q;  2CW0 C;  3UE0 A;  1CT1 D;  1MD2 D;  4X64 Q;  2IT1 A;  4A93 G;  4KI0 A;  1WFQ A;  1KL9 A;  4UY8 C;  4K2K A;  4KHP Q;  2R3Z A;  2R92 B;  5C4J B;  1H9K A;  4PV1 C;  2FXQ A;  4LMQ D;  3E9I A;  3HFZ B;  5JVG 3;  1PXU A;  4JI0 Q;  4PZ6 A;  2WAC A;  4ZRZ A;  3X3M A;  2UUA Q;  5CV6 A;  1S40 A;  3CHB D;  4X65 L;  5IOC A;  4ZUI A;  4R4I A;  1ZYR C;  1JOK A;  3DUZ A;  1N8R C;  1Z6H A;  2JA6 B;  2IHE A;  4GKK Q;  4B3T Q;  3OWE B;  2QGQ A;  3H0G H;  4L5T A;  4ZYS A;  3S14 H;  5M5W H;  3NEM A;  4GS3 A;  4L5S A;  1RF2 D;  3D4W A;  1WJJ A;  1EWI A;  1EOT A;  2L5T A;  2F4I A;  1I94 Q;  1AZP A;  4A3M B;  1A8V A;  2JA5 H;  2I46 A;  1Q1E A;  2RSO A;  1PYB A;  1O7Z A;  1HNX L;  4HJ9 A;  3NTI A;  1XMQ L;  5EBC A;  5I6W A;  1BNZ A;  3QO2 A;  1XWE A;  3K58 A;  3MFY A;  5FLX L;  1X3G A;  1S5C D;  1EIH A;  3BU2 A;  3KLR A;  5GAG C;  4FF2 A;  5IT9 L;  1BBW A;  1DJR D;  5GAH C;  2PI2 A;  3J80 c;  3CCM A;  1VQ5 A;  4CBV A;  4DGZ A;  1UEB A;  5IWA L;  4GOP A;  1O80 A;  1SNP A;  5KYL A;  1CKN A;  4L63 B;  1RTN A;  4N8F A;  4WJ3 M;  5LMU Q;  1PZI D;  4DAM A;  2JN4 A;  2VB2 X;  4A3L G;  1VMP A;  5IGG A;  2NZH A;  4JV5 L;  4DUY L;  2B2Y A;  4GKJ Q;  1FNW A;  1AN8 A;  4GN4 B;  3PQI A;  2UU9 L;  2JQO A;  1G2T A;  2CW0 D;  3SGI A;  2KCT A;  1BVS A;  1ENC A;  1LTR D;  1KLG D;  2ZJQ A;  1H9M A;  2UXD L;  3CPF A;  1YNN C;  2KA7 A;  4UP7 A;  2F0M A;  4JI8 L;  4LF5 L;  2NN6 I;  4FP5 D;  2KCN A;  3MXG A;  2K5N A;  5JPM C;  1V1P B;  4A3G B;  4LF4 L;  3J7Z C;  5KGU A;  1LLR D;  1HNW Q;  1W3S A;  3P20 A;  1JIC A;  3T1H L;  1W6J A;  5M3M H;  5CBE E;  4BXX G;  1HA6 A;  1DOL A;  1KQS A;  3K81 C;  3ZYY X;  1ZYR D;  2K32 A;  1ASZ A;  2Z6K A;  4F8M A;  1TWF H;  2F52 A;  4FXG C;  4X3S A;  1C9O A;  4LF7 Q;  2RSN A;  4XQQ A;  4R4C A;  3W2D A;  3ULP A;  4FNF A;  1GUN A;  3I73 A;  1C4Q A;  4BBR G;  3CW2 C;  3K8A A;  3I8Z A;  4BY1 B;  2KHJ A;  4A3L H;  1VQF A;  4LUV A;  4EVO A;  3NQT A;  4HTH A;  2XVS A;  2ZXO A;  1YJ9 A;  3PO2 B;  3E6Z X;  3J81 L;  4PMC A;  5ELD A;  3FP9 A;  3CU7 A;  1X65 A;  3PIP A;  4PNY A;  1LYL A;  1HZ9 A;  4HSV A;  1KNA A;  4KLK A;  4KJN A;  2AQ3 B;  1MBY A;  5KEE A;  2A1A A;  1MIU A;  1JB7 A;  2WAQ B;  3H3V I;  3I4M G;  2Z9H A;  1PZK D;  5IYC G;  3GTK H;  2NZ1 D;  3KDF A;  4MTN A;  1G6Z A;  2KQ3 A;  1J5E L;  2F03 A;  4UAI A;  4XT3 B;  3IL8 A;  5C4Z A;  1RJT A;  1JJG A;  4K0K Q;  3SK4 A;  1WCM G;  5EGT A;  1E24 A;  1K8A C;  4DU9 A;  2PCF B;  4C3J G;  2XRS D;  4Y52 H;  5IT9 E;  4OEL B;  3M3Y H;  3HP3 A;  4G7Z C;  2WKC A;  1GVP A;  1SE2 A;  1CA5 A;  2L1B A;  4KKS A;  4NPS A;  2D5D A;  1LTS D;  1FNV A;  1STH A;  2A73 B;  2GA4 B;  5CC4 A;  1QUQ A;  4X3U A;  3ZJY C;  1K83 B;  1U4P A;  3IFD A;  3W1G A;  1EQQ A;  1RCV D;  2R7Z B;  1X9N A;  1RDP D;  5ISR A;  5I4D A;  3KFU A;  4JBM A;  2YYZ A;  4IPC A;  2JEB I;  2NWG A;  2G9D A;  1L2F A;  1RHP A;  4HIO A;  3I4M H;  2E2J B;  4HJ8 A;  1VQ9 A;  2NTS A;  4R4Q A;  5C0X J;  2EXZ A;  1P8L A;  3LWE A;  4TSS A;  1SYB A;  1B1Z A;  2CQO A;  5DM6 3;  4JYA Q;  3MWY W;  1R9T H;  2OWO A;  1A0I A;  3GTP B;  4MNO A;  4C56 C;  5GAD C;  1HR0 L;  4A3B B;  1WCM H;  4C1N K;  2X6L A;  2FIN B;  4IUU A;  2CWP A;  2VUM G;  1BUV T;  1CKO A;  5CV9 A;  4G7H C;  4K5X A;  1PFS A;  3SK5 A;  1E22 A;  3ERS X;  3M4P A;  4IUV A;  3S1R B;  2LS0 1;  3PMF A;  4PG3 A;  3KBX A;  2QEJ C;  2BH8 A;  1E0B A;  2BCO A;  2J0T D;  3M4Y A;  1KD1 C;  2R92 G;  2QDB A;  3R93 A;  3J81 E;  4ODG A;  4X66 Q;  4P73 A;  3A8K E;  1D5X C;  2F0Q A;  5IGF A;  3MEH A;  2Q8T A;  2I0Q A;  4KKT A;  1EQT A;  4DNT B;  4YY3 Q;  1PFM A;  4HID A;  1DON A;  3AYH B;  5C3E B;  2XTI A;  1B8A A;  1X56 A;  5CYU A;  2JA6 G;  3URY A;  5C0X G;  4GOP C;  1I50 H;  2XNA C;  5IGC A;  3K5M A;  4CJ0 B;  1YNX A;  5D3I B;  4K6D A;  2EE1 A;  5JVH 3;  5ELE A;  2ZTD A;  3C2P A;  3LNN A;  2B3G A;  3PGZ A;  5AFW A;  3NXW A;  4A3M G;  2K14 A;  3KYH C;  3KOJ A;  1N33 Q;  2VQF L;  3D0F A;  2JYO A;  1IKM A;  2V1C C;  3BDO A;  5IGB A;  4R4T A;  1EIF A;  3ER0 A;  1NAP A;  1HZC A;  4HJ7 A;  4A3D B;  2L9H A;  3I4L A;  4MIU A;  4OO1 I;  1F77 A;  1PHJ A;  2R92 H;  4WOR A;  2P5Z X;  3LWU A;  1D5M C;  2UUC Q;  3DM1 A;  2D0P A;  4ME3 A;  1SXT A;  2O4X A;  4O0A A;  4RGM A;  2F0L A;  3KLS A;  4GLX A;  4K2L A;  1WTR A;  2OTL A;  1NBW A;  3S1N B;  1E3P A;  3KF8 A;  5LL6 S;  3JAM L;  4DV4 Q;  1LUZ A;  5C0X H;  4KD3 A;  3ITP A;  1WYD A;  1NY4 A;  1DD2 A;  1Y1V B;  4HJ5 A;  2OF1 A;  2YTV A;  4FXD A;  4X64 L;  4C3I B;  4JPB W;  2F0H A;  4A3M H;  1D1I A;  1JJC B;  5G3L F;  1Q90 A;  4ME5 A;  1QCB D;  1ESR A;  5C5L A;  5J1Z A;  5L37 A;  1B3A A;  3KF6 A;  4ZQ3 A;  2B39 A;  1LT6 D;  4A3G G;  4A3C G;  2X69 A;  3V96 A;  3CP0 A;  4JI0 L;  1SJE D;  1U4M A;  3H91 A;  3WWV A;  3GD7 A;  2CH4 W;  1WTO A;  3VYT A;  1A2U A;  1PFB A;  2M9V A;  4FF4 A;  4GKK L;  1UEA B;  4XYQ A;  3HOX B;  3NHH A;  4C2M B;  1SE4 A;  5JEA J;  2IHF A;  1STA A;  1Y8P B;  4BY1 G;  4B3M Q;  2WAQ E;  2EYL A;  4TQU S;  4XDX A;  2IWH A;  4CDD C;  1CUK A;  2JA5 B;  1BCP C;  1E2W A;  1R4P B;  5C6A A;  1AH9 A;  5G3L D;  1TS5 A;  1E2V A;  3K7A B;  5HY6 A;  4TVA B;  2AUK A;  1JT8 A;  2XWJ B;  1GXD C;  4KV6 A;  3GTJ H;  2WAQ G;  5CMD A;  4YWK A;  3PUX A;  3OSO A;  4A3G H;  3DWA A;  4DPG A;  1CSQ A;  4P74 A;  4JI6 Q;  1U5K A;  5CR3 A;  2R6G A;  4GLA C;  1EY0 A;  3D31 A;  3NP8 A;  2OT2 A;  4WRD A;  5LMU L;  3QG1 A;  4DN4 M;  4HMI A;  4JK1 C;  1UE7 A;  1X3P A;  4DR6 L;  1CA6 A;  3J7A V;  2PNR C;  1LTI D;  2A6E C;  1QE6 A;  3GV3 A;  4EX5 A;  3PO3 H;  3I4O A;  4P71 A;  4BY1 H;  4YHH L;  1BCP F;  4JBJ A;  3PO2 H;  1EL0 A;  1LO5 D;  3JAM E;  1PH8 A;  4PZ7 A;  1A62 A;  3U50 C;  5DLQ E;  2R7Z G;  2A8V A;  4HAE A;  2A6H C;  1TR5 A;  5H1S E;  1YZ6 A;  2L11 A;  4DV1 Q;  1STB A;  5M3M B;  4A3I G;  1EYD A;  1LAC A;  2B2U A;  1TWC B;  3K80 C;  4A3K G;  2OCE A;  1Q86 C;  3NBI A;  1YHQ A;  3RZO H;  3SVM A;  4LF7 L;  3HOZ B;  5JOB A;  2QDL A;  4GNX A;  1EEF D;  2EYH A;  4F7X A;  4IPD A;  3FEW X;  1VS0 A;  3VYS A;  1E1T A;  4A3B G;  3S17 B;  1B70 B;  5EKL A;  5CBA E;  5JJK A;  1A2T A;  3W1B A;  4IUQ A;  2SEB D;  1O7Y A;  1EIY B;  4HJA A;  2MJ8 A;  1PTO B;  1B50 A;  3EIV A;  1SMX A;  1BCP D;  2TSS A;  4OL7 A;  5E4W C;  3DM3 A;  3X3N A;  3AMU A;  3OW2 A;  5JEA H;  3J81 j;  1NMF A;  2E2I H;  1LM0 A;  3J7A F;  1LT5 D;  1BO0 A;  1Z9F A;  4IUR A;  1PRT B;  3ERQ A;  1K83 H;  2R7Z H;  1D6E C;  1TXY A;  1SMY C;  1EY8 A;  3GTK B;  3EQL C;  1K8O A;  1GUG A;  4NXN L;  3CCS A;  2E2J H;  4CDC C;  1H95 A;  5C3E G;  5JJL A;  1B2T A;  3S24 A;  1SSO A;  4Q0F A;  3F2D A;  4RMF A;  1XNQ L;  2N55 A;  3UDX A;  3GTP H;  1YHA A;  2K5W A;  1GM5 A;  3KLW A;  4LJZ C;  4A3B H;  2UXC Q;  4QUF A;  2LKV A;  4IQZ A;  3M3Y B;  1HUN A;  1K8G A;  4XQN A;  3NQI A;  3GDE A;  3F1Z A;  3C1E A;  3U9S A;  3TN2 A;  1MJE A;  1AW7 A;  4I7Z C;  3A56 A;  3EN2 A;  3HOV G;  2ZM6 Q;  2EY2 A;  2KBN A;  4POG A;  2A6H D;  4FO2 A;  4A3D G;  4ILW A;  3I70 A;  4RKB A;  3S16 B;  3VYU A;  4A3F B;  5FLM G;  1ASY A;  3FPU B;  2F0U A;  2ASB A;  3LGJ A;  4R4O A;  4QJF A;  4DAP A;  1S5B D;  2ZXR A;  1HZB A;  4JYA L;  4IJH A;  3T1Y L;  3W5O A;  4L6T B;  3MXP A;  4WJW A;  1RTO A;  1U0L A;  4AYB B;  1V1Q A;  3S15 H;  3SE0 A;  4HIK A;  1YVC A;  3BJU A;  4JI1 Q;  2OQ0 A;  1VCI A;  2BE5 C;  2C5C A;  4UPA A;  1U4R A;  1Y1V G;  3G6E A;  4DNI A;  3VDY A;  4B3S L;  3PUW A;  2J7Z A;  4UDU C;  4C3I G;  1ESF A;  4HMJ A;  3D6W A;  2JXM B;  3M7N A;  2F4V L;  5AJ3 L;  1A63 A;  5KIX A;  1GUW A;  3MA2 B;  4X66 L;  2B2W C;  2F0V A;  1SMY D;  3OTO Q;  4O1N A;  1DOK A;  3CC4 A;  1STE A;  4GZY C;  1IW7 D;  1TKW B;  3NEN A;  2L4N A;  3K59 A;  4JVZ A;  4OWT B;  5A35 A;  4A75 A;  5GRO A;  3S1N H;  3Q24 A;  1JR0 D;  2EZV A;  3HOX G;  3TP5 A;  5LMN Q;  2WB1 G;  5NUC A;  2LSS A;  1FJG L;  1UNS A;  2J4X A;  4IUP A;  4IFD J;  2JA5 G;  1Y1V H;  3HKZ B;  2NVQ B;  1SE8 A;  5C3W A;  3K7U C;  5ELB A;  2ZTE A;  5HGQ A;  1NCV A;  4CKB A;  1Y8N B;  1X3F A;  4C3I H;  5FO9 B;  1VQM A;  4MHE A;  1KNE A;  4DK0 A;  2K6A A;  3VR3 A;  4R8N A;  3G48 A;  3K5N A;  4I65 A;  4LUO A;  4A4I A;  2UUB L;  3Q22 A;  1VQ8 A;  4FDB A;  2ALY B;  1IBK Q;  2MO1 A;  1VQO A;  1C0A A;  5I9O A;  2Q2I A;  4DAY A;  1PH9 A;  1KAW A;  4DR1 L;  1TS2 A;  2PO4 A;  2VY3 A;  2WKD A;  4JOI A;  2ZXP A;  3A54 A;  3G7L A;  3NSW A;  1G51 A;  3NPP A;  1G91 A;  5KYI A;  2BE5 D;  3HOX H;  1AP0 A;  2I5L X;  4C2M H;  1GO3 E;  4KD4 A;  3UDF A;  1FD7 D;  3GTL B;  1I3Q B;  4LUZ A;  2XGT A;  4YIJ A;  3NBH B;  4CJ1 B;  1VQ4 A;  4LK1 C;  1K73 C;  1EU3 A;  3GTO B;  3F2B A;  4A76 A;  3U58 A;  2YV5 A;  5A2Q L;  2I5H A;  3HG9 A;  4AIM A;  5DNF A;  3G6J B;  1JWU D;  2K04 A;  2B2V A;  3K7A H;  1G8Z D;  3N52 A;  2EYF A;  2EVB A;  1GHK A;  2SOB A;  1Q82 C;  3SEB A;  3I90 A;  4LF6 Q;  5M3M G;  3C3L A;  3VR4 A;  4LFC L;  2PMZ B;  2JJQ A;  4BBS B;  1II3 A;  4LF9 L;  1C7Y A;  1EY9 A;  3HOZ G;  4LFB L;  3H3V C;  4U67 3;  1SAP A;  5K36 H;  2B8G A;  4DV0 L;  5KRU A;  1OXX K;  2DNE A;  2EJM A;  1NR2 A;  2XN9 C;  2DY7 A;  1Q8I A;  2C9O A;  4QL5 A;  5KNC A;  4POF A;  1RL2 A;  3D4R A;  5FKA C;  3PIO A;  4LWC A;  1B9N A;  4V19 0;  1HCZ A;  1RKN A;  3E0E A;  2RDG A;  3FHW A;  3CQZ B;  4UP8 A;  2F0K A;  1PMR A;  3GTJ B;  1J8I A;  4I7A A;  4IFD H;  2OXP A;  1WTH A;  3EJI A;  1IBL Q;  4FF3 A;  1IKL A;  1PV4 A;  4JI4 L;  1NSN S;  1TT2 A;  3CRK C;  2JSO A;  1XTD A;  3VR6 A;  2M00 A;  1TWC H;  3T13 A;  2A69 C;  1SLJ A;  2PNH A;  3S1Q B;  2B2T A;  3BYY B;  3HOZ H;  1BKB A;  2UXB L;  4DR2 L;  4IPG A;  1ET6 A;  3PUY A;  4NKL A;  4DAV A;  3S17 H;  1MHW C;  2RA4 A;  3DEP A;  5ELO A;  3PO3 B;  3SHL A;  3T56 B;  4KTA A;  4YCU A;  4DR3 Q;  3CF5 A;  1BOS A;  2K5V A;  4ULL A;  1PTO H;  3VR2 A;  4JC0 A;  2AKW B;  2RHS B;  4X62 L;  1Z7T A;  1KHI A;  1Q1B A;  4EQO A;  4AYB E;  4RA8 A;  4YWM A;  4OEM B;  3Q23 A;  1OXU A;  2N8N A;  2ES2 A;  4X3K A;  1CK1 A;  4A3F G;  4WJ4 A;  5JJI A;  1A6X A;  3PCO B;  4IO9 A;  3RN2 A;  4R9W A;  2KHS A;  2VQE L;  4HIM A;  1I4H A;  4JG2 A;  3HGB A;  4RKL A;  3RZO B;  4DAY B;  4DXF A;  5A2Q E;  3AU7 A;  4AYB G;  3RN5 A;  5E1F A;  5C0X I;  3L0O A;  4K5W A;  3BVM A;  4JI3 L;  1SE3 A;  1JJ2 A;  3OMC A;  4A3J B;  3BVG A;  5FLX E;  4X3T A;  5IE8 A;  4HED A;  1DOM A;  2NBF A;  2EPB A;  4KY6 A;  1ENA A;  1MSH A;  2E2I B;  2LMC B;  1ILQ A;  4X6A H;  2K75 A;  3T4A C;  1BBU A;  2BDN A;  4ZK9 B;  1PH2 A;  1D5Z C;  3TP7 A;  3IAY A;  4CKE A;  3BZC A;  3H09 A;  1P16 A;  5FK9 C;  3CPW A;  4J15 A;  3NEL A;  1YIJ A;  2KCC A;  1F2L A;  1NTG A;  4OHJ A;  4LW1 A;  3S16 H;  2JP1 A;  4A3F H;  1I4G A;  2IW3 A;  1G29 1;  1FR3 A;  1V9P A;  3HKZ E;  2A69 D;  1ET9 A;  2LXJ A;  4DK6 C;  3A7A B;  1VQN A;  2AHO B;  1STY A;  1HNZ L;  1B4O A;  2UXC L;  4C3H B;  4ID6 A;  3CXC A;  3WOE A;  2JA8 H;  4DV3 Q;  1XNR L;  3GV6 A;  1EFI D;  2SNM A;  1JE4 A;  1WD1 A;  5I9P A;  4GN3 B;  1WTP A;  3CCL A;  2RDH A;  3NTK A;  1EYC A;  1L0Y B;  1VQL A;  3FKI H;  1A3V A;  3HKZ G;  4LFA L;  3TQY A;  2EY6 A;  1M8A A;  2R61 A;  1TS4 A;  3H94 A;  1EWH A;  2PZW A;  1XPR A;  2F0P A;  1I6V C;  4P2C B;  1L0X B;  5FLX c;  1YJN A;  5IYB H;  4DFA A;  1QNU A;  3DHQ A;  3FPP A;  5IT9 c;  1JWM D;  5COR A;  1T9H A;  5T1G A;  1AE2 A;  3BS1 A;  1PH3 A;  3S15 B;  4HR7 B;  2C35 B;  3RLO A;  4XQJ A;  4IOA A;  5IP7 H;  2CWA A;  1H9S A;  5JPN C;  3GTM H;  3DLL A;  2NN6 H;  2HHH Q;  1SNC A;  4PMW A;  2PMZ E;  1DZ1 A;  2B2Y C;  2NVQ H;  3R8B A;  2EDG A;  2AUJ D;  1EWC A;  1DGS A;  4P72 A;  4CDE C;  4JI5 Q;  1KDB A;  1PDQ A;  3UDI A;  3FMC A;  4J1M A;  1S5E D;  1SN8 A;  4XIG S;  3HS0 C;  4DV6 L;  1K9M C;  4BBS G;  4DV7 Q;  1F2Z A;  1PLF A;  1KDC A;  4OX9 Q;  5LMN W;  3KJP A;  1TY0 A;  1L1O A;  4DKA C;  5E7N A;  3TDQ A;  1K28 A;  5EBD A;  4CHT B;  5D14 A;  3J80 i;  5ELF A;  1ML0 D;  1QOH A;  4OGQ C;  1CHQ D;  2Z6K C;  3ULJ A;  1YIT A;  2JEA I;  3A0J A;  3TME A;  4BWG B;  3K57 A;  1F9S A;  3EFX D;  1WTX A;  1IBM L;  4NP5 A;  1I6H H;  3J81 c;  2BA0 A;  4PMB A;  3BG3 A;  3GTL H;  1I3Q H;  1MJC A;  3H6M A;  2PQA B;  2NVX H;  3CCU A;  4RHR A;  2QEX A;  1UAP A;  2NZO A;  4TRD A;  2AMC B;  5FOB B;  3GTO H;  1G2S A;  4LF8 Q;  4KHP L;  1XX8 A;  3MXN A;  2YTY A;  1K0S A;  1NR4 A;  4C1N I;  2JA7 H;  2JE6 I;  2Q2T A;  2UUA L;  3RLF A;  4DR5 Q;  4KKU A;  1BCP B;  4Y7N H;  4MZ9 A;  1JWS D;  4APV A;  1FGU A;  3OYY A;  3L2P A;  1YEZ A;  3RR5 A;  1EIG A;  4BBS H;  1IYV A;  2F0G A;  3GTG B;  4QUC A;  4B3T L;  1VQ7 A;  1AE3 A;  1C8C A;  2D0O A;  3K0Y A;  1JOR A;  3CKI B;  1XJV A;  1QB5 D;  1M1K C;  3PO3 G;  2DUD A;  4AQY Q;  1SFO H;  1XMQ Q;  2F3I A;  2K5D A;  2ZJR A;  1I94 L;  3PO2 G;  3H15 A;  2PPB C;  4DA2 A;  1X3Q A;  4KHZ A;  1OXV A;  2LY7 A;  3CQZ H;  4WFN 3;  1K8M A;  3UE1 A;  1BQQ T;  2E8G A;  2HQE A;  5FJ8 G;  1PH6 A;  2CFM A;  3TS2 A;  3QJY A;  2KVM A;  1JQY D;  1XPU A;  1G6P A;  1EOV A;  5CGK A;  1XPO A;  4JV5 Q;  3UI2 A;  4DUY Q;  3CCR A;  3BZK A;  1JCK B;  5M9O A;  2UU9 Q;  2K28 A;  4JI7 Q;  1UE1 A;  1I5F A;  1MKH A;  1IL2 A;  2N49 A;  4IPH A;  3S1Q H;  3DWQ A;  1EZ6 A;  4A3J G;  4G4K A;  1PH7 A;  4GKJ L;  1FVI A;  2D9U A;  1H9S B;  3L9A X;  5J39 A;  1NUC A;  3FVQ A;  2DJF C;  3PV0 A;  4LF4 Q;  1D2B A;  1ZKO A;  2K1B A;  5JEA G;  5I6Y A;  1YBY A;  2K01 A;  5EPK A;  5DM7 3;  1J9O A;  3RNU A;  3R2T A;  3VYR A;  2K03 A;  2K50 A;  4NXM Q;  4IUT A;  2HQL A;  5CV4 A;  2EYJ A;  3QWN A;  2D2C C;  1HNW L;  3TRZ A;  3TBI B;  1CM9 A;  2OEO A;  4KJO A;  3CCJ A;  4O42 A;  1VQK A;  5FJ8 H;  1QWY A;  3SXH A;  2WP8 J;  2FHT A;  3CC7 A;  1EQV A;  2LFN A;  5DEH A;  1QJO A;  1L1O B;  1VQJ A;  3TZD A;  4C3H G;  2NVY B;  5KNB A;  1PA6 A;  1D1K A;  1Y1W B;  5GAE C;  5IY0 A;  4A3J H;  2E5L Q;  2VXW A;  1BF4 A;  1SNM A;  2A68 C;  5IYD G;  3EVQ A;  4NDX A;  4EQN A;  3FRP B;  4XXE A;  4GLV B;  2B29 A;  4IJL A;  3QIA A;  3EA6 A;  1TY2 A;  4FVM A;  4FF1 A;  1W2B A;  2AWO A;  1EEI D;  3MXN B;  2A5H A;  1EFW A;  3T16 A;  4B9X A;  4XYO A;  2PZU A;  1SNQ A;  2KEC A;  2RHQ B;  5M3F B;  1S72 A;  3RZD B;  1J6Q A;  4O2D A;  1SJH D;  3HOW H;  4K0K L;  3OMG A;  1IW7 C;  1LTT D;  3JAM c;  5EKI A;  4HCS A;  1T5E A;  4C3H H;  2F0T A;  1SEB D;  1EYG A;  1HXY D;  3GP7 A;  3HOU H;  4EQP A;  3K5L A;  1D7Q A;  3NBH A;  1STG A;  3R2I A;  3NUC A;  5IYD H;  3F8T A;  1JOO A;  1VQB A;  2MQH A;  3J80 L;  2EXD A;  1X32 A;  3I3C A;  2Z6B A;  1EZ8 A;  3SDZ A;  1LTB D;  1VQC A;  2ENB A;  2DGY A;  1L0W A;  4KN4 C;  2BH2 A;  1LV9 A;  3AB9 A;  4JCV E;  4Q5V A;  1TWG H;  2RDF A;  3K5O A;  4RFB A;  3SK8 A;  4B3R Q;  4JBW A;  4YWL A;  1KRT A;  3D4D A;  5K5P A;  2VL6 A;  1PH5 A;  1Z47 A;  2HUG A;  4MN3 A;  4K8I A;  2JA8 B;  2RBM A;  3E9H A;  4CKC A;  4DUZ Q;  1KC8 C;  3E0J A;  4OXP A;  4N9T A;  3BDL A;  2B63 B;  1V1O A;  3TRE A;  2I07 B;  2MGS A;  2CVR A;  3FKI B;  2A68 D;  1SR3 A;  3PUZ A;  2HIX A;  1Q3L A;  3ND8 A;  3V2T A;  3S2H B;  3R3O A;  3J81 i;  2N3S A;  3S9W A;  3P75 A;  2FMM A;  1F2M A;  3U9O A;  1SNO A;  2N78 A;  3M85 A;  3HOY H;  5EPJ A;  4OWX B;  3NK9 A;  3KK7 A;  1TS3 A;  1HTP A;  3MVV A;  3QOL A;  2EIF A;  4YY3 L;  2L55 A;  3KLS X;  2JK8 A;  2OQK A;  4UP9 A;  2WV6 D;  2F0O A;  3CAM A;  2DJG C;  2EJF C;  1FNU A;  3ERO A;  2G9H D;  3Q8D A;  3W3A A;  3I4N B;  2VW9 A;  3F2U A;  4RGN A;  3GTM B;  2PQE A;  4GN5 A;  4V0B A;  1M90 C;  4ZLT F;  1HJP A;  3TS0 A;  4JI2 Q;  1YI2 A;  2CHB D;  1B9M A;  1HQR D;  1PTO D;  1N33 L;  2F0W A;  1JOQ A;  2CQA A;  2E76 C;  3Q6S A;  4CDF C;  3MAQ A;  1I4R A;  2WII B;  3A5Z B;  3N6R A;  4QY7 A;  4JI5 L;  2D62 A;  2IX3 A;  2F3W A;  4M1U B;  2VS1 A;  5HGT A;  2BOS A;  2PW7 A;  3KBG A;  2UUC L;  3KUP A;  2L0C A;  2F0I A;  2VUM B;  2F1M A;  1EUJ A;  2EOT A;  4UHV A;  5C3X A;  4ZUJ A;  5C4H A;  5K36 G;  1CQF A;  4CGY B;  2B2U C;  1TII D;  1FYC A;  4DV4 L;  5C4X B;  5C44 B;  1GKH A;  3GTG H;  4KN7 C;  2CCZ A;  5CV8 A;  5IP9 G;  2XRQ D;  2L15 A;  3D3R A;  5J3B A;  4GNX C;  2H4O A;  1KAA A;  3V05 A;  3NE5 B;  1I6H B;  5ELN A;  3RMH A;  2NVX B;  2DY8 A;  1S5D D;  3HRZ C;  1LT4 D;  2A74 C;  1Y8O B;  2HT1 A;  3AEV A;  4RG1 A;  4LF8 L;  1HHV A;  3J7Y W;  3IRB A;  4H02 A;  4IFD G;  3MFG A;  5M5X H;  2MPM A;  2JA7 B;  3PIO 3;  1TWH B;  4DR5 L;  2SNS A;  2YTX A;  4BY7 B;  1SND A;  4G57 A;  4Y7N B;  2QA4 A;  5IGE A;  1DM0 B;  1IXR A;  5KND A;  1IYU A;  2NTT A;  1F9R A;  5CV5 A;  3Q0A A;  2FFK B;  2Y0S B;  1LTG D;  3A7L A;  1Y1W G;  4B3M L;  1VF7 A;  4AQY L;  4A93 H;  3D8G A;  4AH6 A;  3PSI A;  1SFO B;  5IP9 H;  1JC7 A;  4EGV A;  4DR4 Q;  1XXG A;  1GHJ A;  4OWW B;  4L8J A;  4PQX A;  4RWS C;  4RGT A;  3U4Z A;  2NVT B;  1OTC A;  4ALP A;  3HEJ A;  1D8L A;  1ICW A;  2K5H A;  2K5Q A;  2WFW A;  3CCE A;  1F9P A;  5F2D A;  1BR9 A;  3GTQ H;  1YHB A;  3DMU A;  1VQI A;  1CHP D;  4KMU C;  3OHX C;  4DR6 Q;  4JI6 L;  5JJZ A;  4F88 A;  2CH4 A;  3K0X A;  3PIP 3;  4L5R C;  5M3F G;  4FYD A;  3AFP A;  4JI7 L;  1LTL A;  4QIW B;  4QGU A;  1RD9 D;  1OXS C;  1I4X A;  4XTC S;  3CME A;  4YHH Q;  4DV5 Q;  1VQE A;  5I2Y A;  5J22 A;  1GUS A;  4IN3 A;  3D6C A;  2MHV A;  1S4Z A;  2PW5 A;  1IYJ B;  3U4V A;  1KLU D;  1M4V A;  2NVY H;  3O13 A;  1GD7 A;  1ROD A;  1Y69 U;  1Y1W H;  1ICF B;  4YCW A;  3LX0 A;  5E4X A;  2ZTC A;  2IPK D;  4E6I A;  3JAM i;  2K33 A;  1JMC A;  2YU9 B;  2H5X A;  1KRS A;  2F0F A;  1BBX C;  2Z0S A;  3MXU A;  4RCO A;  2O5J C;  2V4D A;  1QG7 A;  5COY A;  2E75 C;  1X55 A;  1CQV A;  3I7F A;  5FO7 B;  4NXM L;  2MUY A;  1Y14 B;  2E2H B;  4F87 A;  2Z4I A;  4OIJ A;  2F0E A;  4LNQ A;  3ICE A;  2HIV A;  4IZ8 A;  1K0R A;  4DV1 L;  3F2C A;  1I4Q A;  4DR7 Q;  4FXK C;  1NMG A;  2K7V A;  2DNC A;  4P75 A;  2QF7 A;  2EQS A;  3M4Q A;  4H44 C;  1V8Q A;  5M3F H;  3RZD H;  1VQH A;  3NWT A;  2VNU D;  1WOC A;  1R4Q B;  4U68 A;  1WTV A;  2JA8 G;  2R93 B;  1MSG A;  1K3R A;  2NB0 A;  2E5L L;  3S1M B;  2EY5 A;  2B63 G;  4BA2 I;  1O7I A;  3FKI G;  4ZAI A;  1Q81 C;  1H9J A;  3A74 A;  2PQA A;  2VZA A;  4M8A A;  1S3O A;  1E7Z A;  4BXX H;  1E1O A;  4RH6 A;  3S2D H;  4KHV A;  4YCV A;  4NXN Q;  3CD6 A;  4EQ5 A;  2R7F A;  4L5Q A;  1F9Q A;  5M5Y B;  1XNQ Q;  2IX0 A;  4PZ8 A;  5IYB G;  1DCZ A;  4BBR H;  2SDF A;  4NMZ A;  2BDO A;  2EY1 A;  4HN7 A;  2IX1 A;  3HOW B;  4B08 A;  1W6K A;  2IJ0 A;  2OTJ A;  1T5X D;  1YNN D;  4QB4 A;  3STB C;  5IP7 G;  5IIF A;  3I4N G;  3P1H A;  1PYS B;  4JOI C;  2Q2H A;  2NN6 G;  2E74 C;  1A3U A;  3HOU B;  2B63 H;  1TWA B;  4RHS A;  2JA9 A;  1WI5 A;  3WOF A;  3VA5 A;  4A3I B;  2FJ2 A;  4A3K B;  2EYM A;  5IYC H;  1PVO A;  1N9W A;  2ZM6 L;  3BVZ A;  3S2H H;  1HR0 W;  3NWS A;  5DAU A;  2KED A;  3JC6 6;  3T1Y Q;  4GOP B;  5BR8 Q;  3MEF A;  1IHZ A;  1MGS A;  2MP1 A;  3GO5 A;  3CMA A;  1FGB D;  4G7O C;  1B7Y B;  1CKN B;  4ZKB B;  1KIX A;  4KY5 A;  1U4L A;  3MC0 B;  1SRO A;  1AFP A;  2LXK A;  3HZX A;  4B3R L;  2B2V C;  4C3J H;  1TWG B;  3OW7 A;  2VB3 X;  4KK7 A;  3M7G A;  3NTH A;  3ONA B;  5EKK A;  1XMO Q;  2K4K A;  4B3S Q;  1HFG A;  4DUZ L;  5C4X G;  5C44 G;  4JI1 L;  1N34 Q;  1MI2 A;  4R1J A;  2F4V Q;  3I4N H;  5AJ3 Q;  4KY7 A;  1KAB A;  1HPC A;  4QQB X;  3OOC A;  4H0L C;  1CSP A;  4K8J A;  1HA5 A;  3G71 A;  1YJW A;  2XIW A;  5FO8 B;  1YNJ C;  4NW2 A;  5IOD A;  2RCN A;  4J6H A;  4JBK A;  1VMC A;  2Y0S E;  3PF4 A;  1H9R A;  3HOY B;  4RGO S;  2HCI A;  2JA7 G;  3OTO L;  4BY7 G;  3EBE A;  2CKZ B;  1SDF A;  4K6L A;  4BS9 A;  1QZH A;  1SYF A;  1PH4 A;  1OXT A;  1FJG Q;  4OIK A;  3OPO A;  2VUM H;  1N32 Q;  3VA7 A;  4DV2 Q;  3A8I E;  1N36 Q;  1HH2 P;  4DK3 C;  1ZEQ X;  2KJX A;  3CC2 A;  3STB D;  5LMN L;  1EQR A;  2Y0S G;  3TP6 A;  2Q2U A;  3CCV A;  3HOV B;  5C4X H;  1LAB A;  2MNA A;  4DXG A;  5C44 H;  4K14 A;  1UWV A;  5EAY A;  4JI2 L;  2RVL A;  2B2T C;  2H1E A;  2ICE C;  4HSP A;  2UUB Q;  5C4J H;  4NB3 A;  2IL8 A;  4J8Q A;  3KJO A;  2GN5 A;  3E3X A;  4QIW E;  4ZCK A;  3H3V H;  3KDF B;  4QF4 A;  2NYZ D;  2QCP X;  4DR1 Q;  3ULL A;  4X65 Q;  3QB3 A;  2Z4H A;  2L12 A;  1IBK L;  2RKS A;  4N8X 1;  2JA6 H;  3FDT A;  5EJW A;  1KXL A;  5JAV A;  1TWH H;  1DXM A;  4BY7 H;  1ENF A;  5LL6 X;  3C46 A;  3M4O B;  3OIP A;  4A3E B;  5D3D A;  3MTS A;  1S5F D;  4B9W A;  1JB3 A;  3P7J A;  2QKI C;  1ONL A;  3RLN A;  1WTQ A;  1AEX A;  3G4S A;  2A19 A;  4ZKC B;  1HNX Q;  1SYC A;  3I72 A;  1QUQ B;  3BDC A;  1CKM A;  1NE3 A;  2GVA A; 
#chains in the Genus database with same CATH homology
 1SYE A;  1YNJ D;  1WD0 A;  1GJX A;  5E3F A;  3CRL C;  4DF7 A;  3SK6 A;  4IAL A;  1A15 A;  2TMP A;  3QOJ A;  5M5X B;  1TQO A;  2AQ1 B;  2XWB B;  3H0G B;  4HCE A;  1STN A;  2WB1 B;  5T1I A;  3S14 B;  5M5W B;  1GOZ A;  3WDN A;  2AWN A;  4DNR B;  4XT1 B;  3MHB A;  2EYP A;  2PZT A;  4N9P A;  2N88 A;  5ELC A;  5HUR A;  1HTL D;  4H7B A;  1EY4 A;  2B2W A;  1TVX A;  2O2L D;  3L3O C;  1ILP A;  3L7Z C;  4A93 B;  5EQ0 A;  4Z9C B;  3T53 B;  1C48 A;  1EU4 A;  2O5I C;  4OO1 G;  4IUN A;  1HUM A;  5IGD A;  2KEE A;  1EY6 A;  2HDL A;  1U9R A;  2Z1C A;  1CZW A;  5CV7 A;  5C5M A;  3GTQ B;  4LAA A;  3OWF A;  3RUZ A;  5D65 A;  2F3V A;  1DYQ A;  4ABN A;  2F0D A;  3K6O A;  1HQM C;  1PYW D;  1Q12 A;  3SR1 A;  4RAU C;  2WIN B;  1GUO A;  3MZ5 A;  4R8I A;  2M2L A;  1LT3 D;  1UUP A;  1A3T A;  1O78 A;  5BN4 A;  2B8F A;  4CJ2 C;  1PZJ D;  4QCL A;  2HDM A;  4OO1 H;  2E2D C;  1QNK A;  1TWF B;  3A55 A;  5EPL A;  4RCN A;  1EYA A;  1QIL A;  2KOL A;  3BZD B;  3GQB A;  4TKO B;  2RQX A;  3DWP A;  3E5S A;  3VR5 A;  1KDA A;  2PYK A;  1B53 A;  1PFN A;  2HCC A;  4K5V A;  3TP8 A;  2NUC A;  3RD4 A;  2X6G A;  2AQ2 B;  4S3S A;  1PTO C;  1TU2 B;  3A8J E;  3S2D B;  2EJG C;  1HFN A;  1I4P A;  5BN5 A;  1IL8 A;  1B44 D;  2A6E D;  1O7L A;  2ZT9 C;  1CI3 M;  3BYT B;  4BBR B;  1PRT C;  2Z8L A;  1SYD A;  1BXT A;  1SBB B;  2Q8R E;  4BA1 I;  3C1F A;  1GUT A;  1EY7 A;  1HRJ A;  2Q8I B;  1KTK A;  2ID0 A;  1E2Z A;  1VF5 C;  1BDO A;  1SYG A;  2KUM A;  3I4M B;  5BN3 A;  3TSS A;  1PTO F;  2XSC A;  1EY5 A;  1R9T B;  4IFD I;  2ICI A;  5TSS A;  1WCM B;  2QIL A;  2F0N A;  1PRT F;  4C3J B;  3IKJ A;  4QMG A;  3OIQ A;  2FMC A;  2F0S A;  2K05 A;  4H13 C;  1F2Y A;  2EYO A;  1LTA D;  1V43 A;  1OO9 B;  3ND9 A;  3TZU A;  1V1P A;  1CTM A;  4DK1 A;  1ZXT A;  3PUV A;  5I2X A;  3IFT A;  3T51 B;  1XYI A;  1CZG A;  1WTW A;  1AZQ A;  3DXJ C;  1XTC D;  1VDZ A;  2F0J A;  3DEO A;  5LHY 1;  1I50 B;  2DN8 A;  2BA1 A;  1PRT D;  3I91 A;  1CFM A;  1WVL A;  3J80 E;  2CW0 C;  1CT1 D;  1MD2 D;  2IT1 A;  4KI0 A;  4K2K A;  2R3Z A;  2R92 B;  5C4J B;  1H9K A;  4PV1 C;  4LMQ D;  5JVG 3;  1PXU A;  4ZRZ A;  2WAC A;  3X3M A;  5CV6 A;  3CHB D;  5IOC A;  4ZUI A;  1ZYR C;  1JOK A;  3DUZ A;  1Z6H A;  2JA6 B;  3OWE B;  4ZYS A;  1RF2 D;  3D4W A;  1EOT A;  2L5T A;  2F4I A;  1AZP A;  4A3M B;  2I46 A;  1Q1E A;  2RSO A;  1O7Z A;  3NTI A;  5EBC A;  5I6W A;  1BNZ A;  3QO2 A;  1XWE A;  3K58 A;  3MFY A;  5FLX L;  1S5C D;  1EIH A;  3KLR A;  4FF2 A;  5IT9 L;  1DJR D;  4CBV A;  4DGZ A;  1O80 A;  1SNP A;  5KYL A;  4L63 B;  1RTN A;  1PZI D;  2VB2 X;  1VMP A;  5IGG A;  2B2Y A;  1FNW A;  1AN8 A;  1G2T A;  2CW0 D;  1ENC A;  1LTR D;  1KLG D;  1H9M A;  1YNN C;  2KA7 A;  2F0M A;  2NN6 I;  4FP5 D;  2KCN A;  3MXG A;  5JPM C;  1V1P B;  4A3G B;  5KGU A;  1LLR D;  3P20 A;  1JIC A;  1W6J A;  1HA6 A;  5CBE E;  1DOL A;  3ZYY X;  1ZYR D;  2K32 A;  4F8M A;  4FXG C;  4X3S A;  2RSN A;  4XQQ A;  3W2D A;  4FNF A;  1GUN A;  3I73 A;  1C4Q A;  3I8Z A;  4BY1 B;  4EVO A;  3NQT A;  4HTH A;  2XVS A;  2ZXO A;  3PO2 B;  3E6Z X;  3J81 L;  4PMC A;  5ELD A;  3CU7 A;  4PNY A;  4HSV A;  1KNA A;  4KJN A;  2AQ3 B;  1MBY A;  5KEE A;  2WAQ B;  1PZK D;  2NZ1 D;  1G6Z A;  2KQ3 A;  2F03 A;  4UAI A;  4XT3 B;  3IL8 A;  5C4Z A;  1RJT A;  3SK4 A;  5EGT A;  4DU9 A;  2PCF B;  4C3J G;  2XRS D;  5IT9 E;  3HP3 A;  4G7Z C;  2WKC A;  1SE2 A;  1CA5 A;  2L1B A;  4KKS A;  2D5D A;  1LTS D;  1FNV A;  1STH A;  2A73 B;  2GA4 B;  5CC4 A;  4X3U A;  1K83 B;  1U4P A;  3IFD A;  2R7Z B;  1RCV D;  1RDP D;  5ISR A;  5I4D A;  2YYZ A;  2JEB I;  2NWG A;  2G9D A;  1RHP A;  2E2J B;  2NTS A;  5C0X J;  2EXZ A;  3LWE A;  4TSS A;  1SYB A;  1B1Z A;  5DM6 3;  3MWY W;  3GTP B;  4C56 C;  4A3B B;  4C1N K;  2X6L A;  2FIN B;  4IUU A;  1BUV T;  5CV9 A;  4G7H C;  4K5X A;  3SK5 A;  4IUV A;  3S1R B;  2LS0 1;  3PMF A;  3KBX A;  2QEJ C;  1E0B A;  2BCO A;  2J0T D;  3M4Y A;  2QDB A;  3R93 A;  3J81 E;  4ODG A;  3A8K E;  1D5X C;  2F0Q A;  5IGF A;  3MEH A;  2Q8T A;  4KKT A;  1EQT A;  4DNT B;  1PFM A;  1DON A;  5C3E B;  5CYU A;  3URY A;  5C0X G;  2XNA C;  5IGC A;  3K5M A;  4CJ0 B;  5D3I B;  4K6D A;  2EE1 A;  5JVH 3;  5ELE A;  3C2P A;  3LNN A;  5AFW A;  3NXW A;  2JYO A;  1IKM A;  3BDO A;  5IGB A;  1NAP A;  4A3D B;  2L9H A;  3I4L A;  4MIU A;  4OO1 I;  1F77 A;  4WOR A;  3LWU A;  1D5M C;  3DM1 A;  1SXT A;  2O4X A;  4RGM A;  2F0L A;  3KLS A;  1WTR A;  4K2L A;  3S1N B;  3KF8 A;  5LL6 S;  3JAM L;  5C0X H;  4KD3 A;  3ITP A;  1DD2 A;  1Y1V B;  2OF1 A;  4FXD A;  4C3I B;  2F0H A;  1D1I A;  5G3L F;  1Q90 A;  4ME5 A;  1QCB D;  1ESR A;  5C5L A;  5J1Z A;  1B3A A;  4ZQ3 A;  2B39 A;  1LT6 D;  2X69 A;  3V96 A;  1SJE D;  1U4M A;  3H91 A;  3GD7 A;  1WTO A;  3VYT A;  1A2U A;  1PFB A;  2M9V A;  4FF4 A;  1UEA B;  4XYQ A;  3HOX B;  3NHH A;  4C2M B;  1SE4 A;  5JEA J;  1STA A;  1Y8P B;  2EYL A;  4TQU S;  4XDX A;  2IWH A;  2JA5 B;  1BCP C;  1E2W A;  1R4P B;  5C6A A;  5G3L D;  1TS5 A;  1E2V A;  3K7A B;  2AUK A;  2XWJ B;  1GXD C;  4KV6 A;  5CMD A;  3PUX A;  3OSO A;  3DWA A;  5CR3 A;  2R6G A;  1EY0 A;  3D31 A;  3NP8 A;  2OT2 A;  4WRD A;  3QG1 A;  4DN4 M;  4HMI A;  4JK1 C;  1X3P A;  1CA6 A;  3J7A V;  2PNR C;  1LTI D;  2A6E C;  1QE6 A;  3GV3 A;  1BCP F;  1EL0 A;  1LO5 D;  3JAM E;  4HAE A;  2A6H C;  1TR5 A;  2L11 A;  1STB A;  5M3M B;  1EYD A;  1LAC A;  2B2U A;  1TWC B;  3NBI A;  3SVM A;  3HOZ B;  5JOB A;  1EEF D;  2EYH A;  4F7X A;  3FEW X;  3VYS A;  3S17 B;  5CBA E;  5EKL A;  1A2T A;  4IUQ A;  2SEB D;  1O7Y A;  2MJ8 A;  1PTO B;  1B50 A;  1BCP D;  2TSS A;  4OL7 A;  5E4W C;  3X3N A;  3AMU A;  5JEA H;  3J7A F;  1LT5 D;  1BO0 A;  4IUR A;  1PRT B;  3ERQ A;  1D6E C;  1SMY C;  1EY8 A;  3GTK B;  3EQL C;  1K8O A;  1GUG A;  1B2T A;  1SSO A;  4Q0F A;  2N55 A;  2K5W A;  4LJZ C;  4QUF A;  2LKV A;  4IQZ A;  3M3Y B;  1HUN A;  4XQN A;  3NQI A;  3C1E A;  3U9S A;  3TN2 A;  1AW7 A;  4I7Z C;  3A56 A;  2EY2 A;  2A6H D;  4FO2 A;  4ILW A;  3I70 A;  4RKB A;  3S16 B;  3VYU A;  4A3F B;  3FPU B;  2F0U A;  4DAP A;  1S5B D;  2ZXR A;  4L6T B;  3MXP A;  4WJW A;  1RTO A;  4AYB B;  3SE0 A;  1VCI A;  2BE5 C;  2C5C A;  1U4R A;  3PUW A;  2J7Z A;  4UDU C;  4C3I G;  1ESF A;  4HMJ A;  3D6W A;  2JXM B;  3M7N A;  5KIX A;  1GUW A;  3MA2 B;  2B2W C;  2F0V A;  1SMY D;  4O1N A;  1DOK A;  1STE A;  4GZY C;  1IW7 D;  1TKW B;  2L4N A;  3K59 A;  5A35 A;  3Q24 A;  1JR0 D;  2EZV A;  3TP5 A;  5NUC A;  1UNS A;  2J4X A;  4IUP A;  4IFD J;  3HKZ B;  2NVQ B;  5C3W A;  5ELB A;  1NCV A;  4CKB A;  1Y8N B;  5FO9 B;  4MHE A;  1KNE A;  4DK0 A;  2K6A A;  3VR3 A;  4R8N A;  3K5N A;  4I65 A;  3Q22 A;  5I9O A;  4DAY A;  1TS2 A;  2PO4 A;  2WKD A;  2ZXP A;  3A54 A;  3G7L A;  3NSW A;  3NPP A;  1G91 A;  5KYI A;  2BE5 D;  1AP0 A;  4KD4 A;  1FD7 D;  3GTL B;  1I3Q B;  4YIJ A;  4CJ1 B;  4LK1 C;  1EU3 A;  3GTO B;  5A2Q L;  3HG9 A;  5DNF A;  3G6J B;  1JWU D;  2K04 A;  2B2V A;  1G8Z D;  3N52 A;  2EYF A;  2EVB A;  1GHK A;  2SOB A;  3SEB A;  3I90 A;  3C3L A;  3VR4 A;  2PMZ B;  4BBS B;  1II3 A;  1EY9 A;  3H3V C;  4U67 3;  1SAP A;  5K36 H;  2B8G A;  5KRU A;  1OXX K;  2DNE A;  2EJM A;  1NR2 A;  2XN9 C;  2DY7 A;  1Q8I A;  2C9O A;  5KNC A;  3D4R A;  5FKA C;  1B9N A;  4V19 0;  1HCZ A;  1RKN A;  2RDG A;  3CQZ B;  2F0K A;  1PMR A;  3GTJ B;  1J8I A;  4IFD H;  2OXP A;  3EJI A;  4FF3 A;  1IKL A;  1NSN S;  1TT2 A;  3CRK C;  2JSO A;  3VR6 A;  2M00 A;  3T13 A;  2A69 C;  3S1Q B;  2B2T A;  3BYY B;  1ET6 A;  3PUY A;  4NKL A;  4DAV A;  3DEP A;  2RA4 A;  3PO3 B;  3SHL A;  3T56 B;  4KTA A;  1BOS A;  4ULL A;  1PTO H;  3VR2 A;  1Z7T A;  4EQO A;  1Q1B A;  4RA8 A;  3Q23 A;  1OXU A;  4X3K A;  1CK1 A;  1A6X A;  4R9W A;  2KHS A;  1I4H A;  3HGB A;  4RKL A;  3RZO B;  4DXF A;  5A2Q E;  3AU7 A;  5E1F A;  5C0X I;  4K5W A;  3BVM A;  1SE3 A;  3OMC A;  4A3J B;  3BVG A;  5FLX E;  4X3T A;  4HED A;  1DOM A;  2NBF A;  2EPB A;  4KY6 A;  1ENA A;  1MSH A;  2E2I B;  2LMC B;  1ILQ A;  3T4A C;  2BDN A;  4ZK9 B;  1D5Z C;  3TP7 A;  3IAY A;  4CKE A;  3H09 A;  5FK9 C;  2KCC A;  1F2L A;  4OHJ A;  2JP1 A;  1I4G A;  2IW3 A;  1G29 1;  1FR3 A;  2A69 D;  1ET9 A;  3A7A B;  1STY A;  1B4O A;  4C3H B;  4ID6 A;  3WOE A;  3GV6 A;  1EFI D;  2SNM A;  1JE4 A;  1WD1 A;  5I9P A;  1WTP A;  2RDH A;  3NTK A;  1EYC A;  1L0Y B;  1A3V A;  2EY6 A;  1M8A A;  2R61 A;  1TS4 A;  3H94 A;  1EWH A;  2PZW A;  2F0P A;  1I6V C;  4P2C B;  1L0X B;  4DFA A;  1QNU A;  3DHQ A;  3FPP A;  1JWM D;  5COR A;  5T1G A;  3BS1 A;  3S15 B;  4HR7 B;  4XQJ A;  1H9S A;  5JPN C;  2NN6 H;  1SNC A;  4PMW A;  1DZ1 A;  2B2Y C;  3R8B A;  2EDG A;  2AUJ D;  1EWC A;  1KDB A;  1PDQ A;  3FMC A;  4J1M A;  1S5E D;  4XIG S;  3HS0 C;  1PLF A;  1F2Z A;  1KDC A;  1TY0 A;  3TDQ A;  5EBD A;  4CHT B;  5D14 A;  5ELF A;  1ML0 D;  1QOH A;  4OGQ C;  1CHQ D;  2JEA I;  3TME A;  4BWG B;  3K57 A;  1F9S A;  3EFX D;  1WTX A;  4NP5 A;  2BA0 A;  4PMB A;  3BG3 A;  3H6M A;  4RHR A;  1UAP A;  4TRD A;  5FOB B;  1G2S A;  1XX8 A;  3MXN A;  1NR4 A;  4C1N I;  2JE6 I;  3RLF A;  4KKU A;  1BCP B;  1JWS D;  1IYV A;  1EIG A;  2F0G A;  3GTG B;  4QUC A;  1C8C A;  3K0Y A;  1JOR A;  3CKI B;  1QB5 D;  2K5D A;  2PPB C;  4DA2 A;  1X3Q A;  4KHZ A;  1OXV A;  2LY7 A;  4WFN 3;  1K8M A;  1BQQ T;  2HQE A;  3QJY A;  2KVM A;  1JQY D;  5CGK A;  3UI2 A;  1JCK B;  5M9O A;  2K28 A;  3DWQ A;  1EZ6 A;  4G4K A;  2D9U A;  1H9S B;  3L9A X;  5J39 A;  1NUC A;  3FVQ A;  3PV0 A;  1D2B A;  1ZKO A;  2K1B A;  5JEA G;  5I6Y A;  2K01 A;  5EPK A;  5DM7 3;  1J9O A;  3R2T A;  3VYR A;  2K03 A;  4IUT A;  5CV4 A;  2EYJ A;  3QWN A;  2D2C C;  3TBI B;  1CM9 A;  2OEO A;  4KJO A;  4O42 A;  1QWY A;  3SXH A;  2WP8 J;  2FHT A;  1EQV A;  2LFN A;  5DEH A;  1QJO A;  3TZD A;  4C3H G;  2NVY B;  5KNB A;  1D1K A;  1Y1W B;  2VXW A;  1BF4 A;  1SNM A;  2A68 C;  3EVQ A;  4NDX A;  4EQN A;  3FRP B;  4XXE A;  3QIA A;  3EA6 A;  1TY2 A;  4FVM A;  4FF1 A;  2AWO A;  1EEI D;  2A5H A;  3T16 A;  4B9X A;  4XYO A;  2PZU A;  1SNQ A;  2KEC A;  5M3F B;  3RZD B;  1SJH D;  3OMG A;  1IW7 C;  1LTT D;  5EKI A;  4HCS A;  1T5E A;  2F0T A;  1SEB D;  1HXY D;  3GP7 A;  4EQP A;  3K5L A;  3NBH A;  1STG A;  3R2I A;  3NUC A;  1JOO A;  3J80 L;  1X32 A;  3I3C A;  1EZ8 A;  3SDZ A;  1LTB D;  2ENB A;  4KN4 C;  1LV9 A;  3AB9 A;  4Q5V A;  2RDF A;  3K5O A;  4RFB A;  3SK8 A;  4JBW A;  3D4D A;  5K5P A;  1Z47 A;  2HUG A;  4MN3 A;  4K8I A;  2JA8 B;  2RBM A;  4CKC A;  3E0J A;  4N9T A;  3BDL A;  2B63 B;  1V1O A;  2I07 B;  2MGS A;  2CVR A;  3FKI B;  2A68 D;  3PUZ A;  1Q3L A;  3ND8 A;  3V2T A;  3S2H B;  3R3O A;  3S9W A;  3P75 A;  2FMM A;  1F2M A;  3U9O A;  1SNO A;  3M85 A;  5EPJ A;  3NK9 A;  3KK7 A;  1TS3 A;  1HTP A;  3MVV A;  3QOL A;  2L55 A;  3KLS X;  2WV6 D;  2F0O A;  2EJF C;  1FNU A;  3ERO A;  2G9H D;  3W3A A;  3I4N B;  3F2U A;  4RGN A;  3GTM B;  2PQE A;  4V0B A;  4ZLT F;  2CHB D;  1B9M A;  1HQR D;  1PTO D;  1JOQ A;  2F0W A;  2CQA A;  2E76 C;  3Q6S A;  3MAQ A;  1I4R A;  2WII B;  3N6R A;  2D62 A;  2IX3 A;  2F3W A;  4M1U B;  5HGT A;  2BOS A;  2PW7 A;  3KBG A;  3KUP A;  2L0C A;  2F0I A;  2VUM B;  2F1M A;  2EOT A;  5C3X A;  4ZUJ A;  5C4H A;  5K36 G;  1CQF A;  4CGY B;  2B2U C;  1TII D;  1FYC A;  5C4X B;  5C44 B;  4KN7 C;  5CV8 A;  2XRQ D;  3D3R A;  2H4O A;  1KAA A;  3V05 A;  3NE5 B;  1I6H B;  3RMH A;  2NVX B;  2DY8 A;  1S5D D;  3HRZ C;  1LT4 D;  2A74 C;  1Y8O B;  1HHV A;  3J7Y W;  4IFD G;  3MFG A;  2MPM A;  2JA7 B;  3PIO 3;  1TWH B;  2SNS A;  4BY7 B;  1SND A;  4G57 A;  4Y7N B;  5IGE A;  1DM0 B;  5KND A;  1IYU A;  2NTT A;  1F9R A;  5CV5 A;  3Q0A A;  2FFK B;  2Y0S B;  1LTG D;  3A7L A;  1VF7 A;  3D8G A;  1SFO B;  1JC7 A;  4EGV A;  1XXG A;  1GHJ A;  4L8J A;  4PQX A;  4RWS C;  4RGT A;  2NVT B;  3HEJ A;  1ICW A;  2K5Q A;  1F9P A;  5F2D A;  1BR9 A;  3DMU A;  1CHP D;  4KMU C;  3OHX C;  5JJZ A;  4F88 A;  3PIP 3;  4FYD A;  4QIW B;  1RD9 D;  1OXS C;  1I4X A;  4XTC S;  5I2Y A;  5J22 A;  1GUS A;  4IN3 A;  3D6C A;  2MHV A;  1S4Z A;  2PW5 A;  1KLU D;  1M4V A;  3O13 A;  1ROD A;  1Y69 U;  3LX0 A;  5E4X A;  4E6I A;  2IPK D;  2K33 A;  2YU9 B;  2F0F A;  1BBX C;  3MXU A;  4RCO A;  2O5J C;  2V4D A;  1QG7 A;  5COY A;  2E75 C;  1CQV A;  5FO7 B;  2MUY A;  2E2H B;  4F87 A;  2Z4I A;  4OIJ A;  2F0E A;  4IZ8 A;  1I4Q A;  4FXK C;  2K7V A;  2DNC A;  2QF7 A;  4H44 C;  1V8Q A;  3NWT A;  2VNU D;  4U68 A;  1R4Q B;  1WTV A;  2R93 B;  1MSG A;  2NB0 A;  3S1M B;  2EY5 A;  4BA2 I;  4ZAI A;  1H9J A;  4M8A A;  4RH6 A;  4KHV A;  1F9Q A;  5M5Y B;  2IX0 A;  1DCZ A;  2SDF A;  4NMZ A;  2BDO A;  2EY1 A;  4HN7 A;  2IX1 A;  3HOW B;  4B08 A;  1W6K A;  2IJ0 A;  1T5X D;  1YNN D;  4QB4 A;  5IIF A;  3P1H A;  2NN6 G;  2E74 C;  1A3U A;  3HOU B;  1TWA B;  4RHS A;  3WOF A;  3VA5 A;  4A3I B;  2FJ2 A;  4A3K B;  2EYM A;  3BVZ A;  3NWS A;  5DAU A;  2KED A;  1IHZ A;  1MGS A;  2MP1 A;  3GO5 A;  1FGB D;  4G7O C;  4ZKB B;  4KY5 A;  1U4L A;  3MC0 B;  1AFP A;  3HZX A;  2B2V C;  1TWG B;  3OW7 A;  2VB3 X;  4KK7 A;  3M7G A;  3NTH A;  3ONA B;  5EKK A;  1HFG A;  1MI2 A;  4KY7 A;  1KAB A;  1HPC A;  3OOC A;  4H0L C;  4K8J A;  1HA5 A;  2XIW A;  5FO8 B;  1YNJ C;  4NW2 A;  5IOD A;  4J6H A;  1VMC A;  1H9R A;  3HOY B;  4RGO S;  2HCI A;  1SDF A;  4K6L A;  4BS9 A;  1SYF A;  1OXT A;  4OIK A;  3OPO A;  3VA7 A;  3A8I E;  1ZEQ X;  2KJX A;  3TP6 A;  3HOV B;  1LAB A;  4DXG A;  4K14 A;  2RVL A;  2B2T C;  2H1E A;  2ICE C;  4HSP A;  2IL8 A;  4J8Q A;  4QF4 A;  2NYZ D;  2QCP X;  3QB3 A;  2Z4H A;  2L12 A;  2RKS A;  3FDT A;  5EJW A;  5JAV A;  1DXM A;  1ENF A;  5LL6 X;  3C46 A;  3M4O B;  3OIP A;  4A3E B;  5D3D A;  3MTS A;  1S5F D;  4B9W A;  1JB3 A;  3P7J A;  2QKI C;  1ONL A;  1WTQ A;  1AEX A;  4ZKC B;  1SYC A;  3I72 A;  3BDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...