2B2VC

Crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 20
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vC00
2KECA 2EOTA 1B53A 1X32A 2KEEA 1WVLA 1JICA 4ZLTF 5COYA 2N55A 1DONA 5E4WC 3TZDA 1ZXTA 2L11A 1WTXA 1O7YA 2RSNA 4HAEA 3GV6A 1DOMA 1KNEA 3HP3A 2K04A 1KNAA 3IL8A 1CA6A 3KBXA 3SVMA 1HFGA 1ILPA 1WTQA 2B2UC 4HCSA 5AFWA 2B2TC 2B2UA 1X3PA 1DOKA 1O80A 1VMPA 2B2TA 2L12A 4UAIA 1PDQA 3MWYW 4CJ0B 1U4LA 1IL8A 1SDFA 2X69A 3FDTA 4LMQD 1S4ZA 2B2YC 3DEOA 1NAPA 2HDMA 3FPUB 2KVMA 3I3CA 2DY7A 3D6WA 1ICWA 4QUCA 4XDXA 4ZKBB 3TN2A 4XT3B 4ZKCB 1HUNA 1BO0A 2FJ2A 1O7ZA 2K1BA 1U4PA 1DOLA 2HUGA 2Q8TA 1DZ1A 4IUTA 1EIGA 4NW2A 1C8CA 1B4OA 1QG7A 2JYOA 2FFKB 1J8IA 1U4MA 1WTRA 5T1IA 2D9UA 4OIKA 2XIWA 2K28A 1MSGA 3H91A 1CM9A 1PFBA 1F9QA 1G91A 1MGSA 5D65A 4MN3A 5DNFA 2HCIA 2RSOA 2EE1A 2IL8A 3ONAB 1G2SA 1WD0A 1EIHA 2MP1A 4IUQA 2K01A 5EKIA 2HDLA 1AZPA 1E0BA 2KOLA 2X6GA 1F9RA 3I90A 5EQ0A 4HSVA 1HHVA 1ESRA 2VXWA 3LWEA 4RAUC 4QUFA 2MGSA 2B2VC 4HEDA 1JE4A 2B2VA 2RVLA 3I91A 1A15A 4MHEA 1HFNA 1EOTA 2Q8RE 2CVRA 3QO2A 1PFMA 5EPKA 1PFNA 4CJ2C 1HA6A 5JJZA 1BF4A 3F2UA 2NYZD 2M2LA 3P7JA 4XT1B 2EPBA 2FHTA 4IUPA 1WD1A 5EPLA 3Q6SA 2HCCA 4RWSC 1LV9A 4CJ1B 5CMDA 1XX8A 2B2WA 5EJWA 3GV3A 2KEDA 1U4RA 3IFDA 2FMMA 4X3TA 1EQTA 2K05A 1CA5A 3DM1A 4IURA 5CBEE 1NCVA 2J7ZA 5E4XA 1EL0A 2JP1A 1MSHA 2KUMA 1ILQA 1ML0D 2L9HA 2X6LA 4U68A 5D14A 1WTWA 1WTPA 3I8ZA 3DEPA 1NR2A 1AP0A 1QE6A 1SSOA 4R8IA 1TVXA 4OIJA 1BBXC 1QNKA 2K03A 2MPMA 1G2TA 1B3AA 4X3KA 2N88A 4X3UA 1RHPA 1XYIA 1G6ZA 1B50A 2R3ZA 2NZ1D 1B2TA 1X3QA 1SAPA 4IUVA 4IUUA 1AZQA 1HUMA 3MTSA 1WTOA 1PLFA 1IKMA 1RJTA 2FINB 3KUPA 2H1EA 1RODA 2RA4A 1J9OA 1RTOA 2NWGA 4RA8A 4ZK9B 3N52A 1BNZA 5T1GA 4DN4M 2B2WC 4X3SA 1WTVA 2MJ8A 1HRJA 5CORA 5CBAE 3UI2A 1VMCA 4O42A 1F2LA 1GUWA 2L1BA 2B2YA 2BDNA 4ZAIA 1F9SA 1Q3LA 2L4NA 2SDFA 2DY8A 1RTNA 1F9PA 1IKLA 4R9WA 5EPJA 1NR4A 1M8AA 3R93A 1MI2A 3G7LA
chains in the Genus database with same CATH superfamily
4A3EB 2UU9L 4X65Q 3GTOH 1EZ8A 3SEBA 1HNWQ 1GUOA 1JT8A 2NVXB 5CV8A 2B2UC 2RHSB 1PDQA 1VF5C 4LFAQ 3M85A 1Y8NB 2X69A 1GHJA 5IYDH 3K5LA 3ZJYC 3H0GB 4Y52H 4ZUIA 1EY0A 5FO8B 4MZ9A 3HG9A 4LF7Q 2OQ0A 3D3RA 4H7BA 4JI8Q 5KNBA 4KN7C 2N8NA 1SMXA 1NUCA 4LW1A 5C5MA 1KRSA 1PMRA 2NVQH 3DWQA 1F9QA 5D65A 2LY7A 4HJ9A 1ENFA 4QIWE 1G2SA 2WAQE 1EIHA 4IUQA 2A8VA 5EKIA 2NB0A 4FO2A 2F52A 4WJ3M 5LMUL 4DR2L 3CQZB 1VQHA 3CW2C 1GUGA 4XIGS 2RVLA 1XWEA 3NSWA 1JOOA 2R6GA 3FMCA 4A3KG 5IGFA 3W1BA 1HCZA 5FO9B 5AJ3Q 2LXJA 3GDEA 4LJZC 3S17H 4JYAQ 1MSHA 4BY1H 3K0XA 1KQSA 1G51A 1LO5D 1TU2B 2JA5H 4L63B 4IJLA 2O5JC 1WCMB 1I4XA 5FJ8G 1Q1BA 4CHTB 2NWGA 4O1NA 3S16B 3WDNA 3HOXH 2MJ8A 2NN6I 2KCTA 1PH4A 2B2YA 4P75A 2UXBL 5JJIA 1FJGQ 3GTPB 3TBIB 1ZYRD 4LF6L 2TSSA 1CSQA 1S72A 4LFCQ 2H5XA 4IOAA 3J81c 4DXFA 2C9OA 1E7ZA 1JICA 2AWNA 4AQYL 4K14A 1JB7A 1C0AA 2GN5A 1X56A 3GV6A 4B9XA 5JEAH 3KOJA 4HCSA 3IAYA 1HA5A 5IODA 1IW7D 1I94L 5I4DA 3TSSA 4JI3Q 3PQIA 1ENAA 1EU4A 2B2YC 3NENA 3CC4A 3PUXA 2F0QA 1VQCA 1KIXA 1IW7C 3F2BA 2FJ2A 1O7ZA 4LFBL 4BBSB 3PIOA 1Q8IA 5M3FG 1C8CA 4G7OC 2FFKB 4C3IH 5HGQA 3PO2B 3PIPA 3KBGA 3TP5A 1MSGA 2WB1B 1OXXK 4V190 2EYPA 4MN3A 1ZKOA 2F1MA 4DU9A 3PO3G 2UXDQ 2K01A 4OXPA 3GTJB 5IIFA 2AUKA 4LF5Q 4J8QA 4KD3A 4RGOS 4K0KL 2B2VC 4G7HC 1DYQA 4IUNA 4C3JB 4GN3B 2WP8J 5M3MG 4KD4A 1H9SA 2A6HD 4X66L 1BBWA 1Y1WG 4K2KA 4MTKA 5IP7G 3D4DA 2F0EA 1RCVD 2B8FA 3VR5A 3AFQA 2F0OA 2PO4A 3K5OA 1PH6A 2R7ZB 4JI2Q 2JP1A 1CKOA 1ML0D 3S1RB 4X64L 1V43A 4CDCC 1T9HA 1QNKA 4UP9A 4OX9L 2FMCA 2XNAC 1I6HB 2VQFL 1VQDA 5M5WH 1EU3A 1KRTA 3P1HA 2EY5A 3MTSA 1PLFA 5LMNL 4WJWA 2FINB 4A3BB 2ZTCA 3BVMA 1CKNA 4K5VA 4EQNA 5DM73 5E7NA 2F0JA 1FNUA 1A8VA 2JA6G 1YZ6A 5G3LD 3S1MB 1ZEQX 2K14A 3UE0A 4R1JA 4DGZA 4IPCA 1KL9A 1T5EA 1E3PA 2PZTA 3G7LA 4DUZL 4GOPA 4J1MA 2KECA 1IXRA 1PTOH 1X32A 4A3EG 4JI0L 3ITPA 3AMUA 5BR8L 1YHBA 3FKIH 4Z9CB 3W1GA 2K5WA 3HOYH 1LT4D 1KNEA 3AB9A 2OTJA 1BCPD 2B2TC 4IFDJ 4TVAB 1LACA 1EEID 1BQQT 4DUYL 1TWFB 5ELDA 1J5EQ 3J7A5 1BCPC 1Q90A 3HOUB 1YVCA 4DV7Q 1A3TA 4YY3Q 2BE5D 4GOPC 1PV4A 1AW7A 4PZ7A 3SK8A 1U4MA 4B9WA 4C2MB 1QB5D 1SYEA 1F77A 2OQKA 1UE1A 2BE5C 3E3XA 5IP9G 1BR9A 4FVMA 3I4MB 4KI0A 3JAML 3PIP3 4HN7A 3K7AB 4F87A 3TREA 4H13C 1PVOA 1L0YB 2CW0D 3GD7A 1STGA 3RLNA 4X62Q 1I3QH 1H9KA 2MGSA 1E2VA 3KF6B 1JE4A 1TWAH 4A3CG 4POGA 3J7AF 3D8GA 2ZTDA 5C0XJ 2IT1A 2YTVA 4X6AH 1U9RA 4JI5L 2ZM6L 1U4RA 2K05A 5LHY1 3HKSA 1EY6A 2HQLA 2J7ZA 1EL0A 3S9WA 3TDQA 1JQYD 4NXNL 1DD2A 3L7ZC 1NR2A 1NY4A 2B29A 4DR7Q 2MNAA 1HR0Q 4JI6L 1RIPA 1X3QA 1GOZA 3A55A 2EXZA 4NDXA 5IYCH 1L1OA 3KDFA 4R4IA 5EKLA 5A2QL 4Y7NH 2CWPA 3GTQB 3GTKB 3ND9A 3HOZB 1VCIA 5K36H 4HJ8A 1JWMD 1KC8C 1HXYD 2P5ZX 5DM63 1CKMA 2SOBA 5FO7B 4QMGA 3AEVA 1KDCA 2NTSA 3G6EA 3QR8A 2NTTA 4B3SQ 4HAEA 4C3HH 4A3DG 1NBWA 3M7GA 3R8BA 5LMNW 3FDTA 2OTLA 3I2ZA 2F0UA 2JA7B 1EEFD 1H9SB 2Y0SB 3G6JB 4NP5A 2QEXA 5KNDA 2LSSA 1MD2D 3OIQA 3GTMH 2Q8TA 5FLXc 1AEXA 4HIMA 4BBSG 3C1FA 1BKBA 4A3GH 4A3LH 1JJ2A 4RMFA 1UAPA 4DR3L 1SNCA 4IPHA 3QWNA 2JA9A 5KGUA 2WB1G 2Y0SE 1GJXA 3A7LA 1H9JA 4BBRH 4OO1I 2VB3X 3GTGH 1AE3A 1LTID 5A35A 3I90A 2A68C 3EBEA 2F0HA 1X55A 1X65A 4EQPA 1HFNA 2I5MX 3M3YB 2ICEC 1ENCA 1CKNB 1WI5A 2KCNA 1O7LA 5JJZA 1XMQQ 4AH6A 5KEEA 2O4XA 4K5XA 5IY0A 2A5HA 4L8JA 1DGSA 3Q6SA 2E2IH 2UUCL 2NVYB 3BZKA 1XX8A 4EQ5A 1FVIA 4FF3A 3I4NG 1BCPB 1V1OA 2R7ZG 4HIOA 4KY6A 3DWPA 5CGKA 3F1ZA 4GOPB 3KJOA 2EY2A 2SEBD 1W6KA 3GTLH 3DM3A 1AN8A 1TVXA 1D1KA 4OIJA 3S15H 3M4OB 4GZYC 1G2TA 2L0CA 2F4VQ 1XYIA 1HNXQ 4R4OA 1KXLA 4NKLA 4IUUA 1LTLA 3U58A 3OTOL 2H1EA 2RA4A 1BNZA 4RA8A 1EYAA 3PUZA 4O42A 1K0SA 1N36Q 5C6AA 2ZTEA 1LABA 2SDFA 2DY8A 4YWKA 4EQOA 4A3MG 1WFQA 1XMOQ 1I4GA 5GAGC 3S2DB 1I4PA 4PG3A 2I0QA 3KF8A 4DF7A 2E2JB 5IGDA 3MXPA 3U50C 3CMAA 1B8AA 4QQBX 2NVQB 5M5YB 3OMCA 2R7FA 3CF5A 1X3PA 1XPOA 4CJ0B 1IL8A 3I3CA 2F3WA 2PW5A 2KHSA 4UY8C 3E0JA 4XDXA 2QGQA 3HOUG 1SNOA 1XNRQ 3HOVG 1PTOD 1XXGA 1X6OA 5EBCA 4PV1C 1SNPA 4JI4L 2XGTA 4RH6A 4HMJA 1R4QB 5C3WA 3T1HL 4B3RQ 4A3FH 2JA8H 1CM9A 1PTOC 4WRDA 3SK4A 2EJGC 4CKBA 1YHQA 4DNRB 1EY7A 1Z7TA 2NVTH 3A5UA 1JORA 5KIXA 4K2LA 1PA6A 4HSVA 3TP7A 3H3VI 2R92H 2MHVA 2CH4W 1S5CD 4IN3A 3MZ5A 2V1CC 1L1OB 1STAA 3KDFB 5M3FB 2M2LA 3W5OA 2FHTA 2G9HD 1TT2A 1QUQA 4BY7H 1PZJD 4YCVA 4JV5Q 2LKVA 1KABA 3PO3B 3S14H 4NPSA 2KUMA 2X6LA 1N32Q 2A69D 5D14A 3K7UC 3I8ZA 1K0RA 3RZOH 3J80L 1ET6A 4CKCA 5ELCA 2K75A 1K8GA 5M3MB 2A69C 2Z8LA 4DV1Q 4GN5A 4JOIA 4ZQ3A 3KUPA 1DXMA 5CV7A 1TWGH 2I46A 1JE5A 4YHHL 3RMHA 2QEJC 5CV6A 2K5NA 4KY7A 3AFPA 4CDFC 4P73A 5C3EG 1S5FD 3LX0A 4GS3A 3T13A 4CBVA 5C44H 1J6QA 5IWAL 1TY0A 2IX3A 3J80E 2F0LA 2M00A 3ULPA 2ENBA 2Z0SA 5C0XI 1EQVA 5GQOA 2DUDA 5D3DA 4XQNA 3TS0A 2VUMG 3K57A 1JB3A 4M1UB 3TZDA 3RN2A 4JOIC 4DR1Q 5JAVA 1Y14B 4JI1L 1KNAA 2LMCB 4DAVA 1D2BA 2B39A 2R61A 5AFWA 1CZGA 2B2UA 1SYBA 3B6YA 1WJJA 1GUTA 3MWYW 2Q2IA 1R9TB 1Y1VG 4IO9A 1Q7YC 2KVMA 2JA7G 4A3IH 2CQOA 1DM0B 1NJIC 5FOBB 2FXQA 4B3ML 3X3NA 4HIKA 3S1NH 1CHPD 1VQIA 3J80i 1IBMQ 3STBC 2EXDA 3CRLC 1LT3D 1YJWA 1EIFA 1NMGA 2YTYA 2HHHQ 1IL2A 1EFID 1HNZL 4GKKL 3CU7A 4LFCL 2PNRC 4JCVE 3CC7A 4ULLA 1F9RA 2K5HA 1PHJA 5EGTA 1EUJA 3K80C 4HJ5A 4RGMA 3ER0A 1ICFB 4PMCA 3I91A 3SR1A 1S5BD 4A3KH 1MJEA 4ME5A 3BYTB 3BDCA 1N8RC 1JJGA 4JI3L 1SEBD 4HJ7A 5K5PA 1LV9A 4A3JH 2UUAL 2B63H 4YCWA 2AQ3B 2KEDA 1O78A 3IFDA 4KKSA 5M5XH 1OO9B 3Q22A 1TWHB 2IHFA 1VQEA 1ILQA 4U673 3E5SA 4DK3C 4DV5L 1IYJB 3KF8B 4OO1H 2JQOA 3SE0A 2F0NA 4XYQA 4X3KA 4YIJA 3ND8A 5FJ8H 4OL7A 4NXMQ 4A93B 1LTRD 1KTKA 1XNQQ 2MQHA 1HUMA 4DAYA 4DV2Q 1E1OA 1L0WA 4MTNA 1HZBA 4K8IA 1V1PA 1GUWA 2JSOA 2QKIC 3I7FA 2QW7A 3SDZA 1F9SA 4RCNA 4QGUA 4I7ZC 1SJHD 1A6XA 1IKLA 1DJRD 2YV5A 3MFYA 3T51B 4C56C 1IBKL 3T56B 3KLSA 3S1QH 2RDHA 5C4ZA 5CV9A 1K83B 1VQNA 1SROA 5COYA 3ICEA 2LXKA 2E2DC 3KF6A 2EYMA 3TMEA 1VQJA 1HTLD 2MO0A 1JR0D 5IGEA 2QA4A 4DKAC 1RF2D 3I73A 4RKBA 5ELFA 3PGZA 3F2CA 1HHVA 3TQYA 2B3GA 2F0DA 1VQMA 3U9SA 2RCFA 1BBUA 3LGJA 3T1YQ 1RDPD 4KMUC 1QUQB 2KCCA 2R93H 5BN4A 3OSOA 3J81j 2K6AA 3VR6A 1HZAA 1ZYRC 3DHQA 2IX0A 1HPCA 5C4XH 4GLVB 3PUYA 2DGYA 5T1IA 5C4JH 1XTCD 2UU9Q 2RBMA 1G91A 3NPPA 4A3DB 3OWFA 4XYOA 1YJ9A 3CCSA 2A74C 1SNQA 2QCPX 5D3IB 4ZUJA 1AE2A 2KOLA 3K5NA 4RAUC 4TSSA 2B2VA 4OWTB 2JA5G 1K3BC 2JEBI 1L0XB 4EGVA 1Y1WH 2PMZB 1TWCB 2XRQD 4H0LC 2C5CA 4H02A 5G3LF 3RZDB 3PV0A 1HQRD 2Q2TA 4CDEC 2F0IA 4C1NI 3NQTA 4BXXG 1N34L 5LL6X 1YEZA 2B2WA 3HOXG 2YU9B 2B8GA 3BG3A 2UUBL 1WTPA 1D1IA 2XWBB 1BVSA 4KKUA 3VYSA 2OF1A 2WB1E 5LMUQ 1BCPF 1WYDA 4DR2Q 1SFOB 1EWHA 4DR4L 3H3VH 2F0VA 4PMWA 1WTOA 1HTPA 4XXEA 1TS2A 2JA6H 2CH4A 2B2WC 3I4NB 1I6VC 2ID0A 1Q86C 1PH7A 1JWUD 2K5QA 2I5LX 2A6HC 3CXCA 1SN8A 1GKHA 5LL6S 2BDNA 4IFDH 4FXGC 3MXGA 1M8AA 4A3EH 1UE6A 1W6JA 1XPRA 1B53A 2AUJD 1EQRA 2OT2A 3CKIB 4HIDA 4DK1A 1WTXA 4C3IG 1O7YA 2RSNA 2NVXH 3IL8A 5KNCA 3I4OA 1QILA 2B2TA 3KLRA 5JOBA 3VYUA 1K28A 3EROA 1D6EC 1EY5A 3CHBD 3OPOA 5JJLA 2QF7A 4FNFA 3H0GH 2DY7A 4IOCA 3GP7A 4QUCA 1ASZA 4XT3B 4A3MB 3RLOA 4BA1I 2E2HB 2UXBQ 4KTAA 1NNXA 4LF6Q 1SR3A 2JYOA 3CPWA 4QF4A 4R8NA 2D9UA 1XPUA 2IJ0A 2VB2X 3NP8A 5C0XH 2PZUA 4AQYQ 1V9PA 1VQKA 2XSCA 2EYJA 2A73B 2J4XA 3OMGA 4DV0L 1LT6D 4UDUC 3KFUA 3CQZH 1U5KA 3SK6A 4A3CH 1I94Q 3LWEA 5I6WA 2OEOA 4ZYSA 1YI2A 4GKJL 2QDLA 1LTBD 3HOVB 1EOTA 4DAYB 1PFNA 4HTHA 4DV4L 3V2TA 3EFXD 1W2BA 2E75C 2NYZD 1R4PB 5CR3A 1V1PB 4LFBQ 4TKOB 2AQ2B 3BYYB 4UP8A 2OWOA 3PIO3 3HS0C 3P20A 5ELNA 1NCVA 1LTSD 4L5RC 4U68A 4ZCKA 3DEPA 2GVBA 2ZJPA 1SE3A 2MPMA 3N6RA 1M90C 2WFWA 1WCMH 3K6OA 3MEHA 1B2TA 2GA4B 3HEJA 1HH2P 2CW0C 4A93G 2AQ1B 4K0KQ 1SAPA 3OW7A 1OXUA 1IKMA 4EVOA 4BWGB 3S16H 1NE3A 3N52A 4XQQA 1JC7A 4X66Q 4JI7L 3WOFA 1KAAA 5FLMH 3JAME 1TS4A 1STNA 2Z6KC 1SNDA 3R2TA 2E5LL 2OCEA 4DR6L 4FXDA 1S5DD 1OXSC 2RDGA 1MI2A 3HOWB 3CCEA 2XRSD 1KLUD 2EYOA 3I72A 1H95A 4H44C 4X64Q 2NBFA 3E0EA 4OX9Q 3TZUA 4I7AA 2VQFQ 3S2HB 3HP3A 1K8AC 3U4VA 3SVMA 2F3IA 1X3GA 3NELA 3K81C 3C46A 4KHPL 2SNMA 1DOKA 5LMNQ 1Y8OB 5C3EB 1U4LA 3NK9A 1STYA 3DEOA 3FPUB 5IT9L 1GM5A 2BA1A 4R4TA 2WV6D 3TN2A 2R7DA 3JAMi 1WOCA 3PF4A 3L2PA 1U4PA 3MEFA 3NTIA 3I55A 4LF4L 5F2DA 4L5QA 3PO2H 1K3RA 2YYZA 3RR5A 2VUMB 4DUZQ 1TS3A 3VR4A 4JI0Q 2E74C 5BR8Q 2Z4IA 4P2CB 5JPMC 1PH2A 5A2QE 3IFTA 1N33L 1QVFA 3GTJH 3CCUA 5FLXL 4KN4C 4FYDA 1Y1VB 4UP7A 1K9MC 3DMUA 3SXHA 1E0BA 4DV3L 5NUCA 3GQBA 4DUYQ 5JVG3 4C3JH 4N9PA 4NMZA 1LYLA 2CVRA 1I50B 1QWYA 2HIXA 1HR0W 3NTHA 4LF8L 1B3QA 1MHWC 3NBIA 1WD1A 5EPLA 2K4KA 1BXTA 2R7ZH 1Q12A 4CGYB 1XNRL 1EY8A 2K7VA 3GO5A 4DV6L 5K36G 1WTWA 4J6HA 3S1RH 2KHJA 4BS9A 1W3SA 1YNJD 4R8IA 3G71A 1I6HH 3CCQA 1KDBA 3NBHA 1SYCA 1PYWD 1ESFA 3CC2A 4LAAA 1VQ5A 4A3BH 1RJTA 1Y69U 2ICIA 4C3HG 1GVPA 3NQIA 5JPNC 5GADC 1GHKA 2O5IC 2ASBA 3FRPB 3S1MH 5IGCA 1GUNA 4JI5Q 1PTOF 1Q3LA 2ZM6Q 4ODGA 2VNUD 3OW2A 2UXCL 2NN6G 5C3XA 4G57A 1FD7D 3R93A 4GNXC 4DR5L 2PYKA 2V4DA 4NXNQ 1GD7A 1FNVA 2I07B 3I56A 1TS5A 2N55A 3GTOB 4A3GG 3PMFA 3M4QA 1Q1EA 4JI6Q 3U4ZA 1SNMA 1Z9FA 3A54A 1VQOA 1EOVA 1S40A 2ALYB 4OGQC 1G8ZD 4MIUA 4RGNA 4BBRG 3WOEA 1TWFH 5IYBH 3SK5A 2IY5B 1S4ZA 1D5MC 5BN5A 3HOUH 1CT1D 3A5ZB 2EVBA 1EYGA 3RD4A 1KLGD 3F8TA 1BO0A 2K1BA 1A2TA 1A0IA 2HT1A 1DZ1A 4LNQA 3VR2A 2F0KA 1QG7A 4C2MH 3ZYYX 3Q0AA 1J8IA 2JJQA 4OIKA 2EZVA 4KLKA 1I5FA 3EIVA 2K28A 3H91A 3I4MH 2B63B 4DAMA 1ASYA 3PUVA 3CCLA 3K7AH 3ONAB 5I2XA 2MP1A 1TIID 1V8QA 1LT5D 5ISRA 4LF9L 2VXWA 4YWLA 1LTAD 3IRBA 1IBLL 4I65A 1A15A 3V05A 1K8MA 3TP8A 4DPGA 3L3OC 1JOKA 2KA7A 1CTMA 3NWSA 2N78A 1KAWA 2VY3A 5CMDA 3MFGA 4X3TA 4B3TL 1Q8KA 3HKZG 4A75A 4PZ6A 1I4HA 3S17B 4DR3Q 1IYUA 4BY1B 4OWXB 2IPKD 3E9HA 4X65L 3CCJA 3I70A 2JA5B 4X3UA 1HNWL 4GN4B 1G291 2NZ1D 4B08A 4ZRZA 3H15A 1I4RA 3BZDB 2F0TA 4KKTA 4OELB 2ES2A 4LFAL 2E76C 3RN5A 2Z4HA 3GTQH 4IFDI 2VS1A 4JBJA 3Q24A 4RFBA 2EJMA 3GTKH 4J15A 3HOXB 1U0LA 3HOZH 2UUCQ 4JBMA 3NTKA 4ZAIA 3H94A 4IQZA 4JW0A 3PF5A 4R9WA 4LF7L 2HQEA 3AQQA 4JI8L 3HOWG 3VDYA 3MXNA 3AYHB 3NHHA 5IOCA 4ZLTF 5HURA 3LWUA 3R2IA 1E2WA 4CDDC 2L55A 4A3FG 2JA8G 4JG2A 2O2LD 3KBXA 1HFGA 1C9OA 1WTQA 5IGGA 3OTOQ 3EQLC 3P75A 3MA2B 1TXYA 4F8MA 4BA2I 2JA7H 3MVVA 1UEBA 3KYHC 5C5LA 4P72A 2R92G 3FP9A 1CQVA 1VQ7A 5AJ3L 5DLQE 5FKAC 3J80c 1B44D 3JC66 1P8LA 4C3IB 1VQ4A 3UE1A 4JYAL 3NE5B 1VQ9A 2XIWA 2K33A 1OTCA 4NB3A 1CUKA 2VQEQ 2HCIA 2RSOA 5I6YA 1PRTD 4FDBA 1STBA 3D6CA 1HQMC 3FVQA 3OHXC 2RHQB 1SXTA 2X6GA 2F4IA 3NBHB 3CRKC 3FEWX 3CCVA 2D5DA 4QUFA 1PRTC 4QL5A 3EVQA 2Q8RE 1M4VA 4AYBB 4KK7A 1F2MA 2N49A 4IUPA 2NVYH 1VQLA 4DNTB 2PNHA 1FJGL 1X3FA 3T16A 3A8KE 3HFZB 3T1HQ 1X3EA 1SRUA 2JN4A 1PYSB 2JE6I 5C44G 2BH8A 3M4OH 1K8OA 3OWEB 3CCMA 2Z6BA 1B3AA 4JVZA 3QG1A 1LLRD 2EJFC 3H6MA 3VA5A 5M5WB 4O0AA 2XWJB 4GLAC 1CZWA 1J9OA 2AMCB 2L15A 2K52A 4LWCA 1EYDA 1WTVA 1HRJA 3UI2A 1VMCA 1IYVA 4YCUA 3O13A 1QNUA 3RLFA 2QDBA 4FF1A 4N8FA 4OWWB 2SNSA 1FL0A 4CKEA 1N9WA 1BUVT 1EFWA 4OEMB 2CQAA 3KLWA 4QIWB 3S2DH 3M9BA 2WAQB 2VW9A 4A3IG 4XQJA 3DXJC 1PTOB 4Q0FA 2E2JH 1L2FA 1ZXTA 3FKIB 2UXDL 5M5YH 3HOYB 3OOCA 2PZWA 2TMPA 1XTDA 3C3LA 1ILPA 4FXKC 4KHZA 4LF5L 1O80A 2NZHA 5CYUA 3R3OA 2HDMA 4YHHQ 3UDIA 2KCMA 5IYDG 4JBKA 1UE7A 4G7ZC 2JK8A 5IWAQ 2HUGA 3E9IA 4IUTA 4DK0A 1EIGA 4NW2A 3NUCA 4E6IA 1G6PA 4JI2L 5HY6A 1PFBA 2N3SA 1Z47A 4JBWA 1MGSA 4A3JG 2Z9HA 2B63G 1GUSA 2LFNA 2WIIB 1D7QA 3D4RA 1WD0A 4JI1Q 1BOSA 3J81L 2HDLA 1SE8A 1EQQA 2G5DA 1XJVA 3S24A 3A74A 3LNNA 1VQFA 1B1ZA 1E1TA 1I3QB 4EX5A 3VYRA 2BA0A 4OO1G 2XTIA 1TWAB 5EPKA 1EWCA 1CI3M 4JK1C 5M3FH 4DA2A 4WFN3 1STHA 3OIPA 3ULLA 4XT1B 2OXPA 2EYFA 1SJED 1PH5A 2CCZA 4BXXH 4RCOA 4B3MQ 3CPFA 1CQFA 3DUZA 1H9MA 2J0TD 1JCKB 2BH2A 1EQTA 3PO3H 4L5SA 2EQSA 5CBEE 4TRDA 2IHEA 3QB3A 1EY9A 3J81E 3MXNB 2PQEA 1PFSA 4BY1G 4DXGA 1HNZQ 4GKKQ 5J3BA 2F0WA 4KY5A 5M3MH 1UWVA 1LTGD 3WWVA 3MC0B 2VL6A 1SE4A 5IP7H 2Q2HA 4HR7B 1A3VA 1CSPA 4DN4M 1FYCA 2YTXA 4X3SA 3W2DA 3J7YW 2IWHA 5I2YA 4Y7NB 1QZGA 1J5EL 4LUZA 1A62A 1PRTB 3UDXA 5I9OA 4DV7L 2UUAQ 2PMZE 4YY3L 1B9MA 1X54A 4V0BA 2VZAA 4A4IA 2Q8IB 2LS01 4OONA 1SE2A 3NEMA 1KHIA 3EN2A 3BDOA 3J81i 2EOTA 4S3SA 4DV5Q 2R93G 1CK1A 4KJNA 1II3A 1E24A 1ET9A 3Q23A 5C4XG 2PCFB 4C3HB 1LM0A 3I4LA 2F03A 1Y8PB 5TSSA 3TEHB 5JEAG 4OHJA 4UAIA 4X62L 2NZOA 4K5WA 1R9TH 4AIMA 1ONLA 2RKSA 4ZKCB 1OXTA 3HGBA 3K5MA 4GLXA 3DLLA 3GTMB 2K5VA 1FR3A 1IBKQ 4R4QA 5JEAJ 2K5DA 4XTCS 3BU2A 1SYDA 4L6TB 3K59A 4A3GB 1H9RA 3C1EA 2D0OA 4JPBW 2A6ED 4MNOA 4DR7L 4BBRB 3BZCA 1VQAA 3KK7A 4POFA 3GTGB 1YJNA 1F2YA 2A6EC 2RF4A 1HR0L 2D2CC 2F0MA 3FHWA 3QOLA 1AFPA 3G4SA 4MHEA 1UE5A 3ERSX 3HZXA 3QO2A 1OXVA 1HJPA 5HGTA 1QCBD 4AYBG 3D4WA 3M4YA 1BF4A 5KYIA 4QY7A 5IP9H 2AKWB 3E6ZX 2E2IB 1FGBD 3X3MA 1JWSD 1TWHH 1CA5A 3MXUA 5E4XA 3MHBA 4FF4A 2BCOA 2Z1CA 4KHVA 1BBXC 2L9HA 3A56A 4IFDG 2XN9C 5J22A 3GTLB 1E22A 3F2DA 3RNUA 3FPPA 2CWAA 2PQAA 2DJGC 4B3SL 4JC0A 3S15B 1RHPA 4A93H 3TP6A 3K58A 1UNSA 3SHLA 4IPGA 1VQBA 4IZ8A 1RODA 4IPDA 3HKZB 1NTGA 1A63A 1C48A 2CKZB 4IJHA 2RQXA 1N34Q 1Q82C 2Z6KA 3H0GG 3VYTA 4IALA 1NR4A 3PSIA 1MBYA 2MUYA 2UUBQ 2ZJQA 3OYYA 1PH9A 1K83H 3BDLA 3KLSX 3HKZE 2WAQG 4PMBA 2KEEA 1WVLA 3D0FA 4P74A 3J7AV 2WACA 5E4WC 4DFAA 2I5HA 3FKIG 4UHVA 2K04A 5C0XG 3HOYG 1PYBA 1Z6HA 1RD9D 5IE8A 4DR4Q 1VMPA 1QJOA 4L5TA 1S5ED 2KJXA 2XVSA 4LMQD 5M9OA 1NAPA 5H1SE 1SLJA 3GTPH 3D6WA 2WKDA 1XMQL 2C35B 1O7IA 2EY6A 2HD3A 3CAMA 3TS2A 3JAMc 5DEHA 1DOLA 1BDOA 2ZXPA 1MIUA 4KJOA 1WTRA 4PNYA 3A7AB 4DK6C 4A3FB 2JA8B 2PI2A 1NSNS 2EDGA 4A3DH 3DWAA 5DNFA 4RKLA 3CD6A 5L37A 1T5XD 4Q5VA 1AZPA 2NVTB 2F4VL 5J1ZA 2BOSA 1HNXL 2KENA 2JEAI 3TRZA 5EQ0A 1TR5A 1ESRA 1E2ZA 4HEDA 1PH8A 4PZ8A 5E1FA 2R92B 1A2UA 1TWCH 2E8GA 1WCMG 4CJ2C 4BBSH 3RZDH 3T53B 5EAYA 2EPBA 5IGBA 3BJUA 1MKHA 5GAHC 1N36L 4RWSC 3PUWA 2MO1A 1B70B 1UUPA 3CMEA 1C4QA 2YU9H 4BY7B 4RHRA 1D5ZC 5FLMG 1XMOL 3S14B 5KRUA 3RUZA 1AP0A 4UPAA 5IT9E 1SSOA 3RZOB 3K0YA 4APVA 4N8X1 4DV0Q 1G6ZA 2ZJRA 1B50A 1SFOH 5IT9c 1YITA 4GKJQ 2ZXRA 1IHZA 1KDAA 3ULJA 3EA6A 3V96A 4DV4Q 2EIFA 1L1OC 1KD1C 4ZK9B 1EY4A 2A19A 3QJYA 1TWGB 2EY1A 5CV4A 5IYCG 3I4NH 5C4HA 1D8LA 4YWMA 3KJPA 4QB4A 1FNWA 2L1BA 4HCEA 5FLXE 5C44B 2NN6H 3QIAA 4QJFA 2RCNA 3BS1A 1TQOA 4GNXA 4B3RL 2WKCA 3CP0A 2A1AA 1A3UA 5GROA 4FF2A 1Q81C 1PH1A 3PO2G 1DONA 1QVCA 1YNJC 4KV6A 1JOQA 1FGUA 3EJIA 2A68D 1EWIA 1HA6A 2PW7A 1RL2A 2DNEA 3SGIA 1QVGA 1SDFA 5J39A 2CFMA 1QOHA 2GVAA 1ICWA 4A3MH 4JI7Q 3J7ZC 1HUNA 2E2HH 4C3JG 1B7YB 4ABNA 2Q2UA 2E5LQ 4ME3A 4A3IB 4DR6Q 1AH9A 2F0GA 3S1NB 4P71A 4HJAA 4ALPA 1VQ8A 4JV5L 3QOJA 5I9PA 3UDGA 4ILWA 4PQXA 4A3LG 1N32L 2F0FA 1TKWB 2DN8A 2EYLA 3G48A 2EE1A 2IL8A 4FP5D 2PQAB 3H3VC 2F3VA 3ERQA 4RGTA 4KHPQ 4DV1L 4G4KA 2F0PA 3HOVH 1PFMA 5E3FA 4A3KB 2DNCA 1EYCA 3F2UA 5BN3A 3AU7A 3P7JA 3H09A 4A3BG 2K32A 3VA7A 1HZCA 2HCCA 2H4OA 4LF4Q 1PH3A 1P16A 4CJ1B 3GV3A 4A3JB 1VS0A 2G9DA 5M5XB 3DM1A 4IURA 4HSPA 1QE6A 1N33Q 4DAPA 2N88A 5JJKA 4M8AA 4DR1L 1STEA 2R3ZA 4DV3Q 3VR3A 1GO3E 2MFIA 5EBDA 1F2ZA 2VQEL 4IUVA 1NMFA 1AZQA 4RG1A 2KQ3A 3M7NA 4C1NK 3UDFA 3U9OA 1YIJA 4LF8Q 1VQGA 3URYA 2WINB 4O2DA 3HRZC 5IYBG 2JXMB 4K6DA 1YNXA 1RTNA 3C2PA 5EPJA 4N9TA 5EKKA 1PXUA 1IBML 3HOWH 2DJFC 5GAEC 4DV6Q 3S1QB 4QCLA 4RHSA 4K8JA 2ZT9C 5CV5A 5DAUA 2HHHL 1PRTF 3S2HH 3M4PA 2L11A 1B9NA 5ELEA 1LTTD 1DOMA 1S3OA 1YBYA 1V1QA 1K73C 1QZHA 1CA6A 1WTHA 3I4MG 2KHIA 2L12A 5C3EH 2PI2E 4TQUS 2NUCA 1I4QA 3A8IE 1MJCA 1IZ6A 2IX1A 2L5TA 4ZKBB 2HIVA 2IW3A 3D31A 3Q8DA 5JVH3 2KBNA 2R93B 2UXCQ 1B4OA 1SBBB 4HMIA 4F7XA 2VUMH 1SYFA 4DR5Q 1JMCA 5C4JB 1LUZA 3A8JE 5C4XB 1TY2A 1SYGA 1Y1VH 4K6LA 1VDZA 1M1KC 3NWTA 1C7YA 4NXML 2RDFA 2PPBC 1XNQL 1X9NA 4WJ4A 2F0SA 1I50H 4LUVA 1EIYB 4DV2L 1D5XC 1Y1WB 2AWOA 3PCOB 4F88A 3CCRA 2D0PA 3L0OA 1RKNA 5ELOA 3NXWA 3K8AA 4DNIA 5EJWA 4A76A 1CFMA 1PZID 2FMMA 4BY7G 5CC4A 4WORA 1UEAB 3HOZG 2CHBD 5FK9C 3MAQA 4GNXB 1PZKD 1YNND 3A0JA 4R4CA 2ZXOA 3W3AA 3BVZA 2AHOB 1GXDC 2K03A 4LUOA 3M3YH 1DCZA 2D62A 1YNNC 1CHQD 2K50A 4LK1C 4LF9Q 1IBLQ 1Q46A 1RTOA 3IKJA 1VQ6A 5T1GA 1SMYD 2JA6B 2BDOA 2EYHA 3BVGA 5CORA 5CBAE 5KYLA 4JI4Q 1F2LA 1YHAA 3T1YL 1HZ9A 1VQPA 2QILA 4AYBE 2L4NA 1EZ6A 3L9AX 4B3TQ 3T4AC 1F9PA 1SMYC 3STBD 5ELBA 4ID6A 2ATWA 2M9VA 1JJCB 2Y0SG 1VF7A
chains in the Genus database with same CATH topology
4A3EB 1EZ8A 3SEBA 1GUOA 2NVXB 5CV8A 2B2UC 1PDQA 1VF5C 3M85A 1Y8NB 2X69A 1GHJA 3K5LA 3H0GB 4ZUIA 1EY0A 5FO8B 3HG9A 3D3RA 4H7BA 5KNBA 4KN7C 5C5MA 1NUCA 1PMRA 3DWQA 1F9QA 5D65A 2LY7A 1ENFA 1G2SA 1EIHA 4IUQA 5EKIA 2NB0A 4FO2A 3CQZB 1GUGA 4XIGS 2RVLA 1XWEA 3NSWA 1JOOA 2R6GA 3FMCA 5IGFA 1HCZA 5FO9B 4LJZC 1MSHA 1LO5D 1TU2B 4L63B 2O5JC 1WCMB 1I4XA 1Q1BA 4CHTB 2NWGA 4O1NA 3S16B 3WDNA 2MJ8A 2NN6I 2B2YA 3GTPB 3TBIB 1ZYRD 2TSSA 4DXFA 2C9OA 1JICA 2AWNA 4K14A 3GV6A 4B9XA 5JEAH 4HCSA 3IAYA 1HA5A 5IODA 1IW7D 5I4DA 3TSSA 1ENAA 1EU4A 2B2YC 3PUXA 2F0QA 1IW7C 2FJ2A 1O7ZA 4BBSB 1Q8IA 1C8CA 4G7OC 2FFKB 3PO2B 3KBGA 3TP5A 1MSGA 2WB1B 1OXXK 4V190 2EYPA 4MN3A 1ZKOA 2F1MA 4DU9A 2K01A 3GTJB 5IIFA 2AUKA 4J8QA 4KD3A 4RGOS 2B2VC 4G7HC 1DYQA 4IUNA 4C3JB 2WP8J 4KD4A 1H9SA 2A6HD 4K2KA 3D4DA 2F0EA 1RCVD 2B8FA 3VR5A 2F0OA 2PO4A 3K5OA 2R7ZB 2JP1A 1ML0D 3S1RB 1V43A 1QNKA 1I6HB 2FMCA 2XNAC 1EU3A 3P1HA 2EY5A 3MTSA 1PLFA 4WJWA 2FINB 4A3BB 3BVMA 4K5VA 4EQNA 5DM73 2F0JA 1FNUA 5G3LD 3S1MB 1ZEQX 4DGZA 1T5EA 2PZTA 3G7LA 4J1MA 2KECA 1PTOH 1X32A 3ITPA 3AMUA 4Z9CB 2K5WA 1LT4D 1KNEA 3AB9A 1BCPD 2B2TC 4IFDJ 1LACA 1EEID 1BQQT 1TWFB 5ELDA 1BCPC 1Q90A 3HOUB 1A3TA 2BE5D 1AW7A 3SK8A 1U4MA 4B9WA 4C2MB 1QB5D 1SYEA 1F77A 2BE5C 1BR9A 4FVMA 3I4MB 4KI0A 3JAML 3PIP3 4HN7A 3K7AB 4F87A 4H13C 1L0YB 2CW0D 3GD7A 1STGA 1H9KA 2MGSA 1E2VA 1JE4A 3J7AF 3D8GA 5C0XJ 2IT1A 1U9RA 1U4RA 2K05A 5LHY1 1EY6A 2J7ZA 1EL0A 3S9WA 3TDQA 1JQYD 1DD2A 3L7ZC 1NR2A 1X3QA 1GOZA 3A55A 2EXZA 4NDXA 5EKLA 5A2QL 3GTQB 3GTKB 3ND9A 3HOZB 1VCIA 5K36H 1JWMD 1HXYD 5DM63 2SOBA 5FO7B 4QMGA 1KDCA 2NTSA 2NTTA 4HAEA 3M7GA 3R8BA 3FDTA 2F0UA 2JA7B 1EEFD 1H9SB 2Y0SB 3G6JB 4NP5A 5KNDA 1MD2D 3OIQA 2Q8TA 1AEXA 3C1FA 1UAPA 1SNCA 3QWNA 1GJXA 5KGUA 3A7LA 1H9JA 4OO1I 2VB3X 1LTID 5A35A 3I90A 2A68C 2F0HA 4EQPA 1HFNA 3M3YB 2ICEC 1ENCA 2KCNA 1O7LA 5JJZA 5KEEA 2O4XA 4K5XA 2A5HA 4L8JA 3Q6SA 2NVYB 1XX8A 4FF3A 1BCPB 1V1OA 4KY6A 3DWPA 5CGKA 2EY2A 2SEBD 1W6KA 1AN8A 1TVXA 1D1KA 4OIJA 3M4OB 4GZYC 1G2TA 2L0CA 1XYIA 4NKLA 4IUUA 2H1EA 2RA4A 1BNZA 4RA8A 1EYAA 3PUZA 4O42A 5C6AA 1LABA 2SDFA 2DY8A 4EQOA 1I4GA 3S2DB 1I4PA 3KF8A 4DF7A 2E2JB 5IGDA 3MXPA 5M5YB 2NVQB 3OMCA 1X3PA 4CJ0B 1IL8A 3I3CA 2F3WA 2PW5A 2KHSA 3E0JA 4XDXA 1SNOA 1PTOD 1XXGA 5EBCA 4PV1C 1SNPA 4RH6A 4HMJA 1R4QB 5C3WA 1CM9A 1PTOC 4WRDA 3SK4A 2EJGC 4CKBA 4DNRB 1EY7A 1Z7TA 1JORA 5KIXA 4K2LA 4HSVA 3TP7A 2MHVA 1S5CD 4IN3A 3MZ5A 1STAA 5M3FB 2M2LA 2FHTA 2G9HD 1TT2A 1PZJD 2LKVA 1KABA 3PO3B 2KUMA 2X6LA 2A69D 5D14A 3I8ZA 3J80L 1ET6A 4CKCA 5ELCA 5M3MB 2A69C 2Z8LA 4ZQ3A 3KUPA 1DXMA 5CV7A 2I46A 3RMHA 2QEJC 5CV6A 4KY7A 1S5FD 3LX0A 3T13A 4CBVA 1TY0A 2IX3A 3J80E 2F0LA 2M00A 2ENBA 5C0XI 1EQVA 5D3DA 4XQNA 3K57A 1JB3A 4M1UB 3TZDA 5JAVA 1KNAA 2LMCB 4DAVA 1D2BA 2B39A 2R61A 5AFWA 1CZGA 2B2UA 1SYBA 1GUTA 3MWYW 1R9TB 2KVMA 1DM0B 5FOBB 3X3NA 1CHPD 3CRLC 1LT3D 1EFID 3CU7A 2PNRC 4ULLA 1F9RA 5EGTA 4RGMA 4PMCA 3I91A 3SR1A 1S5BD 4ME5A 3BYTB 3BDCA 1SEBD 5K5PA 1LV9A 2AQ3B 2KEDA 1O78A 3IFDA 4KKSA 1OO9B 3Q22A 1TWHB 1ILQA 4U673 3E5SA 4OO1H 3SE0A 2F0NA 4XYQA 4X3KA 4YIJA 3ND8A 4A93B 4OL7A 1LTRD 1KTKA 1HUMA 4DAYA 4K8IA 1V1PA 1GUWA 2JSOA 2QKIC 3SDZA 1F9SA 4RCNA 4I7ZC 1SJHD 1A6XA 1IKLA 1DJRD 3MFYA 3T51B 4C56C 3T56B 3KLSA 2RDHA 5C4ZA 5CV9A 1K83B 5COYA 2E2DC 2EYMA 3TMEA 1HTLD 1JR0D 5IGEA 1RF2D 3I73A 4RKBA 5ELFA 1HHVA 2F0DA 3U9SA 1RDPD 4KMUC 2KCCA 5BN4A 3OSOA 2K6AA 3VR6A 1ZYRC 3DHQA 2IX0A 1HPCA 5T1IA 3PUYA 1XTCD 2RBMA 1G91A 3NPPA 4A3DB 3OWFA 4XYOA 2A74C 1SNQA 2QCPX 5D3IB 4ZUJA 2KOLA 3K5NA 4RAUC 4TSSA 2B2VA 2JEBI 1L0XB 4EGVA 2PMZB 1TWCB 2XRQD 4H0LC 2C5CA 5G3LF 3RZDB 3PV0A 1HQRD 2F0IA 4C1NI 3NQTA 5LL6X 2B2WA 2YU9B 2B8GA 3BG3A 1WTPA 1D1IA 2XWBB 3VYSA 4KKUA 2OF1A 1BCPF 1SFOB 1EWHA 2F0VA 4PMWA 1WTOA 1HTPA 4XXEA 1TS2A 2B2WC 3I4NB 1I6VC 2ID0A 1JWUD 2K5QA 2A6HC 5LL6S 2BDNA 4IFDH 4FXGC 3MXGA 1M8AA 1W6JA 1B53A 2AUJD 2OT2A 3CKIB 4DK1A 1WTXA 4C3IG 1O7YA 2RSNA 3IL8A 5KNCA 1QILA 2B2TA 3KLRA 5JOBA 3VYUA 3EROA 1D6EC 1EY5A 3CHBD 3OPOA 2QF7A 4FNFA 2DY7A 3GP7A 4QUCA 4XT3B 4A3MB 4BA1I 2E2HB 4KTAA 2JYOA 4QF4A 4R8NA 2D9UA 2IJ0A 2VB2X 3NP8A 5C0XH 2PZUA 2XSCA 2EYJA 2A73B 2J4XA 3OMGA 1LT6D 4UDUC 3SK6A 3LWEA 5I6WA 2OEOA 4ZYSA 1LTBD 3HOVB 1EOTA 1PFNA 4HTHA 3V2TA 3EFXD 2E75C 2NYZD 1R4PB 5CR3A 1V1PB 4TKOB 2AQ2B 3BYYB 3PIO3 3HS0C 3P20A 1NCVA 1LTSD 4U68A 3DEPA 1SE3A 2MPMA 3N6RA 3K6OA 3MEHA 1B2TA 2GA4B 3HEJA 2CW0C 2AQ1B 1SAPA 3OW7A 1OXUA 1IKMA 4EVOA 4BWGB 3N52A 4XQQA 1JC7A 3WOFA 1KAAA 3JAME 1TS4A 1STNA 1SNDA 3R2TA 4FXDA 1S5DD 1OXSC 2RDGA 1MI2A 3HOWB 2XRSD 1KLUD 2EYOA 3I72A 4H44C 2NBFA 3TZUA 3S2HB 3HP3A 3SVMA 3C46A 2SNMA 1DOKA 1Y8OB 5C3EB 1U4LA 3NK9A 1STYA 3DEOA 3FPUB 5IT9L 2BA1A 2WV6D 3TN2A 1U4PA 3NTIA 5F2DA 2YYZA 2VUMB 1TS3A 3VR4A 2E74C 2Z4IA 4P2CB 5JPMC 5A2QE 3IFTA 5FLXL 4KN4C 4FYDA 1Y1VB 3DMUA 3SXHA 1E0BA 5NUCA 3GQBA 5JVG3 4N9PA 4NMZA 2CVRA 1I50B 1QWYA 3NTHA 3NBIA 1WD1A 5EPLA 1BXTA 1Q12A 4CGYB 1EY8A 2K7VA 3GO5A 5K36G 1WTWA 4J6HA 4BS9A 1YNJD 4R8IA 1KDBA 3NBHA 1SYCA 1PYWD 1ESFA 4LAAA 1RJTA 1Y69U 2ICIA 4C3HG 3NQIA 5JPNC 1GHKA 2O5IC 3FRPB 5IGCA 1GUNA 1PTOF 1Q3LA 4ODGA 2VNUD 2NN6G 5C3XA 4G57A 1FD7D 3R93A 2PYKA 2V4DA 1FNVA 2I07B 1TS5A 2N55A 3GTOB 3PMFA 1Q1EA 1SNMA 3A54A 4OGQC 4RGNA 1G8ZD 4MIUA 3WOEA 3SK5A 1S4ZA 1D5MC 5BN5A 1CT1D 2EVBA 3RD4A 1KLGD 1BO0A 2K1BA 1A2TA 1DZ1A 3VR2A 2F0KA 1QG7A 3ZYYX 3Q0AA 1J8IA 4OIKA 2EZVA 2K28A 3H91A 2B63B 3PUVA 3ONAB 5I2XA 2MP1A 1TIID 1V8QA 1LT5D 5ISRA 2VXWA 1LTAD 4I65A 1A15A 3V05A 1K8MA 3TP8A 3L3OC 1JOKA 2KA7A 1CTMA 3NWSA 5CMDA 3MFGA 4X3TA 1I4HA 3S17B 1IYUA 4BY1B 2IPKD 3I70A 2JA5B 4X3UA 1G291 2NZ1D 4B08A 4ZRZA 1I4RA 3BZDB 2F0TA 4KKTA 2E76C 2Z4HA 4IFDI 3Q24A 4RFBA 2EJMA 3HOXB 3NTKA 4ZAIA 3H94A 4IQZA 4R9WA 2HQEA 3MXNA 3NHHA 5IOCA 4ZLTF 5HURA 3LWUA 3R2IA 1E2WA 2L55A 2O2LD 3KBXA 1HFGA 1WTQA 5IGGA 3EQLC 3P75A 3MA2B 4F8MA 4BA2I 3MVVA 5C5LA 1CQVA 5FKAC 1B44D 4C3IB 3NE5B 2XIWA 2K33A 2HCIA 2RSOA 5I6YA 1PRTD 1STBA 3D6CA 1HQMC 3FVQA 3OHXC 1SXTA 2X6GA 2F4IA 3CRKC 3FEWX 2D5DA 4QUFA 1PRTC 3EVQA 2Q8RE 1M4VA 4AYBB 4KK7A 1F2MA 4IUPA 4DNTB 3T16A 3A8KE 2JE6I 1K8OA 3OWEB 1B3AA 3QG1A 1LLRD 2EJFC 3H6MA 3VA5A 5M5WB 2XWJB 1CZWA 1J9OA 1WTVA 1EYDA 1HRJA 3UI2A 1VMCA 1IYVA 3O13A 1QNUA 3RLFA 2QDBA 4FF1A 2SNSA 4CKEA 1BUVT 2CQAA 4QIWB 2WAQB 4XQJA 3DXJC 1PTOB 4Q0FA 1ZXTA 3FKIB 3HOYB 3OOCA 2PZWA 2TMPA 3C3LA 1ILPA 4FXKC 4KHZA 1O80A 5CYUA 3R3OA 2HDMA 4G7ZC 2HUGA 4IUTA 4DK0A 1EIGA 4NW2A 3NUCA 4E6IA 1PFBA 1Z47A 4JBWA 1MGSA 1GUSA 2LFNA 2WIIB 3D4RA 1WD0A 1BOSA 3J81L 2HDLA 3LNNA 1B1ZA 1I3QB 4OO1G 3VYRA 2BA0A 5EPKA 1TWAB 1EWCA 1CI3M 4JK1C 4DA2A 4WFN3 1STHA 3OIPA 4XT1B 2OXPA 2EYFA 1SJED 4RCOA 1CQFA 3DUZA 1H9MA 2J0TD 1JCKB 1EQTA 5CBEE 4TRDA 3QB3A 1EY9A 3J81E 2PQEA 4DXGA 2F0WA 4KY5A 1LTGD 3MC0B 1SE4A 4HR7B 1A3VA 4DN4M 1FYCA 4X3SA 3W2DA 3J7YW 2IWHA 5I2YA 4Y7NB 1PRTB 5I9OA 1B9MA 4V0BA 2Q8IB 2LS01 1SE2A 3BDOA 2EOTA 4S3SA 1CK1A 4KJNA 1II3A 1ET9A 3Q23A 2PCFB 4C3HB 3I4LA 2F03A 1Y8PB 5TSSA 5JEAG 4OHJA 4UAIA 4K5WA 1ONLA 2RKSA 4ZKCB 1OXTA 3HGBA 3K5MA 3GTMB 1FR3A 5JEAJ 2K5DA 4XTCS 4L6TB 1SYDA 3K59A 4A3GB 1H9RA 3C1EA 2A6ED 4BBRB 3KK7A 3GTGB 1F2YA 2A6EC 2D2CC 2F0MA 3QOLA 1AFPA 4MHEA 3HZXA 3QO2A 1OXVA 5HGTA 1QCBD 3D4WA 3M4YA 1BF4A 5KYIA 3E6ZX 2E2IB 1FGBD 3X3MA 1JWSD 1CA5A 3MXUA 5E4XA 3MHBA 4FF4A 2BCOA 2Z1CA 4KHVA 1BBXC 2L9HA 3A56A 4IFDG 2XN9C 5J22A 3GTLB 3FPPA 3S15B 1RHPA 3TP6A 3K58A 1UNSA 3SHLA 4IZ8A 1RODA 3HKZB 1C48A 2RQXA 3VYTA 4IALA 1NR4A 1MBYA 2MUYA 3BDLA 3KLSX 4PMBA 2KEEA 1WVLA 3J7AV 2WACA 5E4WC 4DFAA 2K04A 5C0XG 1Z6HA 1RD9D 1VMPA 1QJOA 1S5ED 2KJXA 2XVSA 4LMQD 5M9OA 1NAPA 3D6WA 2WKDA 2EY6A 5DEHA 1DOLA 1BDOA 2ZXPA 4KJOA 1WTRA 4PNYA 3A7AB 4A3FB 2JA8B 1NSNS 2EDGA 3DWAA 5DNFA 4RKLA 1T5XD 4Q5VA 1AZPA 2NVTB 5J1ZA 2BOSA 2JEAI 5EQ0A 1TR5A 1ESRA 1E2ZA 4HEDA 2R92B 5E1FA 1A2UA 4CJ2C 3T53B 2EPBA 5IGBA 4RWSC 3PUWA 1UUPA 1C4QA 4BY7B 4RHRA 1D5ZC 3S14B 5KRUA 3RUZA 1AP0A 5IT9E 1SSOA 3RZOB 3K0YA 1G6ZA 1B50A 2ZXRA 1IHZA 1KDAA 3V96A 3EA6A 4ZK9B 1EY4A 3QJYA 1TWGB 2EY1A 5CV4A 5C4HA 4QB4A 1FNWA 2L1BA 4HCEA 5FLXE 5C44B 2NN6H 3QIAA 3BS1A 1TQOA 2WKCA 1A3UA 4FF2A 1DONA 1YNJC 4KV6A 1JOQA 3EJIA 2A68D 1HA6A 2PW7A 2DNEA 1SDFA 5J39A 1QOHA 1ICWA 1HUNA 4C3JG 4ABNA 4A3IB 2F0GA 3S1NB 3QOJA 5I9PA 4ILWA 4PQXA 2F0FA 1TKWB 2DN8A 2EYLA 2EE1A 2IL8A 4FP5D 3H3VC 2F3VA 3ERQA 4RGTA 4G4KA 2F0PA 1PFMA 5E3FA 4A3KB 2DNCA 1EYCA 3F2UA 5BN3A 3AU7A 3P7JA 3H09A 2K32A 3VA7A 2HCCA 2H4OA 4CJ1B 3GV3A 4A3JB 2G9DA 5M5XB 3DM1A 4IURA 4HSPA 1QE6A 4DAPA 2N88A 4M8AA 1STEA 2R3ZA 3VR3A 5EBDA 1F2ZA 4IUVA 1AZQA 2KQ3A 3M7NA 4C1NK 3U9OA 3URYA 2WINB 3HRZC 2JXMB 4K6DA 1RTNA 3C2PA 5EPJA 4N9TA 5EKKA 1PXUA 3S1QB 4QCLA 4RHSA 4K8JA 2ZT9C 5CV5A 5DAUA 1PRTF 2L11A 1B9NA 5ELEA 1LTTD 1DOMA 1CA6A 2L12A 4TQUS 2NUCA 1I4QA 3A8IE 2IX1A 2L5TA 4ZKBB 2IW3A 3D31A 5JVH3 2R93B 1B4OA 1SBBB 4HMIA 4F7XA 1SYFA 5C4JB 3A8JE 5C4XB 1TY2A 1SYGA 4K6LA 1VDZA 3NWTA 2RDFA 2PPBC 2F0SA 1D5XC 1Y1WB 2AWOA 4F88A 1RKNA 3NXWA 5EJWA 1CFMA 1PZID 2FMMA 5CC4A 4WORA 1UEAB 2CHBD 5FK9C 3MAQA 1PZKD 1YNND 2ZXOA 3W3AA 3BVZA 1GXDC 2K03A 1DCZA 2D62A 1YNNC 1CHQD 4LK1C 1RTOA 3IKJA 5T1GA 1SMYD 2JA6B 2BDOA 2EYHA 3BVGA 5CORA 5CBAE 5KYLA 1F2LA 2QILA 2L4NA 1EZ6A 3L9AX 3T4AC 1F9PA 1SMYC 5ELBA 4ID6A 2M9VA 1VF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEC A;  2EOT A;  1B53 A;  1X32 A;  2KEE A;  1WVL A;  1JIC A;  4ZLT F;  5COY A;  2N55 A;  1DON A;  5E4W C;  3TZD A;  1ZXT A;  2L11 A;  1WTX A;  1O7Y A;  2RSN A;  4HAE A;  3GV6 A;  1DOM A;  1KNE A;  3HP3 A;  2K04 A;  1KNA A;  3IL8 A;  1CA6 A;  3KBX A;  3SVM A;  1HFG A;  1ILP A;  1WTQ A;  2B2U C;  4HCS A;  5AFW A;  2B2T C;  2B2U A;  1X3P A;  1DOK A;  1O80 A;  1VMP A;  2B2T A;  2L12 A;  4UAI A;  1PDQ A;  3MWY W;  4CJ0 B;  1U4L A;  1IL8 A;  1SDF A;  2X69 A;  3FDT A;  4LMQ D;  1S4Z A;  2B2Y C;  3DEO A;  1NAP A;  2HDM A;  3FPU B;  2KVM A;  3I3C A;  2DY7 A;  3D6W A;  1ICW A;  4QUC A;  4XDX A;  4ZKB B;  3TN2 A;  4XT3 B;  4ZKC B;  1HUN A;  1BO0 A;  2FJ2 A;  1O7Z A;  2K1B A;  1U4P A;  1DOL A;  2HUG A;  2Q8T A;  1DZ1 A;  4IUT A;  1EIG A;  4NW2 A;  1C8C A;  1B4O A;  1QG7 A;  2JYO A;  2FFK B;  1J8I A;  1U4M A;  1WTR A;  5T1I A;  2D9U A;  4OIK A;  2XIW A;  2K28 A;  1MSG A;  3H91 A;  1CM9 A;  1PFB A;  1F9Q A;  1G91 A;  1MGS A;  5D65 A;  4MN3 A;  5DNF A;  2HCI A;  2RSO A;  2EE1 A;  2IL8 A;  3ONA B;  1G2S A;  1WD0 A;  1EIH A;  2MP1 A;  4IUQ A;  2K01 A;  5EKI A;  2HDL A;  1AZP A;  1E0B A;  2KOL A;  2X6G A;  1F9R A;  3I90 A;  5EQ0 A;  4HSV A;  1HHV A;  1ESR A;  2VXW A;  3LWE A;  4RAU C;  4QUF A;  2MGS A;  2B2V C;  4HED A;  1JE4 A;  2B2V A;  2RVL A;  3I91 A;  1A15 A;  4MHE A;  1HFN A;  1EOT A;  2Q8R E;  2CVR A;  3QO2 A;  1PFM A;  5EPK A;  1PFN A;  4CJ2 C;  1HA6 A;  5JJZ A;  1BF4 A;  3F2U A;  2NYZ D;  2M2L A;  3P7J A;  4XT1 B;  2EPB A;  2FHT A;  4IUP A;  1WD1 A;  5EPL A;  3Q6S A;  2HCC A;  4RWS C;  1LV9 A;  4CJ1 B;  5CMD A;  1XX8 A;  2B2W A;  5EJW A;  3GV3 A;  2KED A;  1U4R A;  3IFD A;  2FMM A;  4X3T A;  1EQT A;  2K05 A;  1CA5 A;  3DM1 A;  4IUR A;  5CBE E;  1NCV A;  2J7Z A;  5E4X A;  1EL0 A;  2JP1 A;  1MSH A;  2KUM A;  1ILQ A;  1ML0 D;  2L9H A;  2X6L A;  4U68 A;  5D14 A;  1WTW A;  1WTP A;  3I8Z A;  3DEP A;  1NR2 A;  1AP0 A;  1QE6 A;  1SSO A;  4R8I A;  1TVX A;  4OIJ A;  1BBX C;  1QNK A;  2K03 A;  2MPM A;  1G2T A;  1B3A A;  4X3K A;  2N88 A;  4X3U A;  1RHP A;  1XYI A;  1G6Z A;  1B50 A;  2R3Z A;  2NZ1 D;  1B2T A;  1X3Q A;  1SAP A;  4IUV A;  4IUU A;  1AZQ A;  1HUM A;  3MTS A;  1WTO A;  1PLF A;  1IKM A;  1RJT A;  2FIN B;  3KUP A;  2H1E A;  1ROD A;  2RA4 A;  1J9O A;  1RTO A;  2NWG A;  4RA8 A;  4ZK9 B;  3N52 A;  1BNZ A;  5T1G A;  4DN4 M;  2B2W C;  4X3S A;  1WTV A;  2MJ8 A;  1HRJ A;  5COR A;  5CBA E;  3UI2 A;  1VMC A;  4O42 A;  1F2L A;  1GUW A;  2L1B A;  2B2Y A;  2BDN A;  4ZAI A;  1F9S A;  1Q3L A;  2L4N A;  2SDF A;  2DY8 A;  1RTN A;  1F9P A;  1IKL A;  4R9W A;  5EPJ A;  1NR4 A;  1M8A A;  3R93 A;  1MI2 A;  3G7L A; 
#chains in the Genus database with same CATH topology
 4A3E B;  2UU9 L;  4X65 Q;  3GTO H;  1EZ8 A;  3SEB A;  1HNW Q;  1GUO A;  1JT8 A;  2NVX B;  5CV8 A;  2B2U C;  2RHS B;  1PDQ A;  1VF5 C;  4LFA Q;  3M85 A;  1Y8N B;  2X69 A;  1GHJ A;  5IYD H;  3K5L A;  3ZJY C;  3H0G B;  4Y52 H;  4ZUI A;  1EY0 A;  5FO8 B;  4MZ9 A;  3HG9 A;  4LF7 Q;  2OQ0 A;  3D3R A;  4H7B A;  4JI8 Q;  5KNB A;  4KN7 C;  2N8N A;  1SMX A;  1NUC A;  4LW1 A;  5C5M A;  1KRS A;  1PMR A;  2NVQ H;  3DWQ A;  1F9Q A;  5D65 A;  2LY7 A;  4HJ9 A;  1ENF A;  4QIW E;  1G2S A;  2WAQ E;  1EIH A;  4IUQ A;  2A8V A;  5EKI A;  2NB0 A;  4FO2 A;  2F52 A;  4WJ3 M;  5LMU L;  4DR2 L;  3CQZ B;  1VQH A;  3CW2 C;  1GUG A;  4XIG S;  2RVL A;  1XWE A;  3NSW A;  1JOO A;  2R6G A;  3FMC A;  4A3K G;  5IGF A;  3W1B A;  1HCZ A;  5FO9 B;  5AJ3 Q;  2LXJ A;  3GDE A;  4LJZ C;  3S17 H;  4JYA Q;  1MSH A;  4BY1 H;  3K0X A;  1KQS A;  1G51 A;  1LO5 D;  1TU2 B;  2JA5 H;  4L63 B;  4IJL A;  2O5J C;  1WCM B;  1I4X A;  5FJ8 G;  1Q1B A;  4CHT B;  2NWG A;  4O1N A;  3S16 B;  3WDN A;  3HOX H;  2MJ8 A;  2NN6 I;  2KCT A;  1PH4 A;  2B2Y A;  4P75 A;  2UXB L;  5JJI A;  1FJG Q;  3GTP B;  3TBI B;  1ZYR D;  4LF6 L;  2TSS A;  1CSQ A;  1S72 A;  4LFC Q;  2H5X A;  4IOA A;  3J81 c;  4DXF A;  2C9O A;  1E7Z A;  1JIC A;  2AWN A;  4AQY L;  4K14 A;  1JB7 A;  1C0A A;  2GN5 A;  1X56 A;  3GV6 A;  4B9X A;  5JEA H;  3KOJ A;  4HCS A;  3IAY A;  1HA5 A;  5IOD A;  1IW7 D;  1I94 L;  5I4D A;  3TSS A;  4JI3 Q;  3PQI A;  1ENA A;  1EU4 A;  2B2Y C;  3NEN A;  3CC4 A;  3PUX A;  2F0Q A;  1VQC A;  1KIX A;  1IW7 C;  3F2B A;  2FJ2 A;  1O7Z A;  4LFB L;  4BBS B;  3PIO A;  1Q8I A;  5M3F G;  1C8C A;  4G7O C;  2FFK B;  4C3I H;  5HGQ A;  3PO2 B;  3PIP A;  3KBG A;  3TP5 A;  1MSG A;  2WB1 B;  1OXX K;  4V19 0;  2EYP A;  4MN3 A;  1ZKO A;  2F1M A;  4DU9 A;  3PO3 G;  2UXD Q;  2K01 A;  4OXP A;  3GTJ B;  5IIF A;  2AUK A;  4LF5 Q;  4J8Q A;  4KD3 A;  4RGO S;  4K0K L;  2B2V C;  4G7H C;  1DYQ A;  4IUN A;  4C3J B;  4GN3 B;  2WP8 J;  5M3M G;  4KD4 A;  1H9S A;  2A6H D;  4X66 L;  1BBW A;  1Y1W G;  4K2K A;  4MTK A;  5IP7 G;  3D4D A;  2F0E A;  1RCV D;  2B8F A;  3VR5 A;  3AFQ A;  2F0O A;  2PO4 A;  3K5O A;  1PH6 A;  2R7Z B;  4JI2 Q;  2JP1 A;  1CKO A;  1ML0 D;  3S1R B;  4X64 L;  1V43 A;  4CDC C;  1T9H A;  1QNK A;  4UP9 A;  4OX9 L;  2FMC A;  2XNA C;  1I6H B;  2VQF L;  1VQD A;  5M5W H;  1EU3 A;  1KRT A;  3P1H A;  2EY5 A;  3MTS A;  1PLF A;  5LMN L;  4WJW A;  2FIN B;  4A3B B;  2ZTC A;  3BVM A;  1CKN A;  4K5V A;  4EQN A;  5DM7 3;  5E7N A;  2F0J A;  1FNU A;  1A8V A;  2JA6 G;  1YZ6 A;  5G3L D;  3S1M B;  1ZEQ X;  2K14 A;  3UE0 A;  4R1J A;  4DGZ A;  4IPC A;  1KL9 A;  1T5E A;  1E3P A;  2PZT A;  3G7L A;  4DUZ L;  4GOP A;  4J1M A;  2KEC A;  1IXR A;  1PTO H;  1X32 A;  4A3E G;  4JI0 L;  3ITP A;  3AMU A;  5BR8 L;  1YHB A;  3FKI H;  4Z9C B;  3W1G A;  2K5W A;  3HOY H;  1LT4 D;  1KNE A;  3AB9 A;  2OTJ A;  1BCP D;  2B2T C;  4IFD J;  4TVA B;  1LAC A;  1EEI D;  1BQQ T;  4DUY L;  1TWF B;  5ELD A;  1J5E Q;  3J7A 5;  1BCP C;  1Q90 A;  3HOU B;  1YVC A;  4DV7 Q;  1A3T A;  4YY3 Q;  2BE5 D;  4GOP C;  1PV4 A;  1AW7 A;  4PZ7 A;  3SK8 A;  1U4M A;  4B9W A;  4C2M B;  1QB5 D;  1SYE A;  1F77 A;  2OQK A;  1UE1 A;  2BE5 C;  3E3X A;  5IP9 G;  1BR9 A;  4FVM A;  3I4M B;  4KI0 A;  3JAM L;  3PIP 3;  4HN7 A;  3K7A B;  4F87 A;  3TRE A;  4H13 C;  1PVO A;  1L0Y B;  2CW0 D;  3GD7 A;  1STG A;  3RLN A;  4X62 Q;  1I3Q H;  1H9K A;  2MGS A;  1E2V A;  3KF6 B;  1JE4 A;  1TWA H;  4A3C G;  4POG A;  3J7A F;  3D8G A;  2ZTD A;  5C0X J;  2IT1 A;  2YTV A;  4X6A H;  1U9R A;  4JI5 L;  2ZM6 L;  1U4R A;  2K05 A;  5LHY 1;  3HKS A;  1EY6 A;  2HQL A;  2J7Z A;  1EL0 A;  3S9W A;  3TDQ A;  1JQY D;  4NXN L;  1DD2 A;  3L7Z C;  1NR2 A;  1NY4 A;  2B29 A;  4DR7 Q;  2MNA A;  1HR0 Q;  4JI6 L;  1RIP A;  1X3Q A;  1GOZ A;  3A55 A;  2EXZ A;  4NDX A;  5IYC H;  1L1O A;  3KDF A;  4R4I A;  5EKL A;  5A2Q L;  4Y7N H;  2CWP A;  3GTQ B;  3GTK B;  3ND9 A;  3HOZ B;  1VCI A;  5K36 H;  4HJ8 A;  1JWM D;  1KC8 C;  1HXY D;  2P5Z X;  5DM6 3;  1CKM A;  2SOB A;  5FO7 B;  4QMG A;  3AEV A;  1KDC A;  2NTS A;  3G6E A;  3QR8 A;  2NTT A;  4B3S Q;  4HAE A;  4C3H H;  4A3D G;  1NBW A;  3M7G A;  3R8B A;  5LMN W;  3FDT A;  2OTL A;  3I2Z A;  2F0U A;  2JA7 B;  1EEF D;  1H9S B;  2Y0S B;  3G6J B;  4NP5 A;  2QEX A;  5KND A;  2LSS A;  1MD2 D;  3OIQ A;  3GTM H;  2Q8T A;  5FLX c;  1AEX A;  4HIM A;  4BBS G;  3C1F A;  1BKB A;  4A3G H;  4A3L H;  1JJ2 A;  4RMF A;  1UAP A;  4DR3 L;  1SNC A;  4IPH A;  3QWN A;  2JA9 A;  5KGU A;  2WB1 G;  2Y0S E;  1GJX A;  3A7L A;  1H9J A;  4BBR H;  4OO1 I;  2VB3 X;  3GTG H;  1AE3 A;  1LTI D;  5A35 A;  3I90 A;  2A68 C;  3EBE A;  2F0H A;  1X55 A;  1X65 A;  4EQP A;  1HFN A;  2I5M X;  3M3Y B;  2ICE C;  1ENC A;  1CKN B;  1WI5 A;  2KCN A;  1O7L A;  5JJZ A;  1XMQ Q;  4AH6 A;  5KEE A;  2O4X A;  4K5X A;  5IY0 A;  2A5H A;  4L8J A;  1DGS A;  3Q6S A;  2E2I H;  2UUC L;  2NVY B;  3BZK A;  1XX8 A;  4EQ5 A;  1FVI A;  4FF3 A;  3I4N G;  1BCP B;  1V1O A;  2R7Z G;  4HIO A;  4KY6 A;  3DWP A;  5CGK A;  3F1Z A;  4GOP B;  3KJO A;  2EY2 A;  2SEB D;  1W6K A;  3GTL H;  3DM3 A;  1AN8 A;  1TVX A;  1D1K A;  4OIJ A;  3S15 H;  3M4O B;  4GZY C;  1G2T A;  2L0C A;  2F4V Q;  1XYI A;  1HNX Q;  4R4O A;  1KXL A;  4NKL A;  4IUU A;  1LTL A;  3U58 A;  3OTO L;  2H1E A;  2RA4 A;  1BNZ A;  4RA8 A;  1EYA A;  3PUZ A;  4O42 A;  1K0S A;  1N36 Q;  5C6A A;  2ZTE A;  1LAB A;  2SDF A;  2DY8 A;  4YWK A;  4EQO A;  4A3M G;  1WFQ A;  1XMO Q;  1I4G A;  5GAG C;  3S2D B;  1I4P A;  4PG3 A;  2I0Q A;  3KF8 A;  4DF7 A;  2E2J B;  5IGD A;  3MXP A;  3U50 C;  3CMA A;  1B8A A;  4QQB X;  2NVQ B;  5M5Y B;  3OMC A;  2R7F A;  3CF5 A;  1X3P A;  1XPO A;  4CJ0 B;  1IL8 A;  3I3C A;  2F3W A;  2PW5 A;  2KHS A;  4UY8 C;  3E0J A;  4XDX A;  2QGQ A;  3HOU G;  1SNO A;  1XNR Q;  3HOV G;  1PTO D;  1XXG A;  1X6O A;  5EBC A;  4PV1 C;  1SNP A;  4JI4 L;  2XGT A;  4RH6 A;  4HMJ A;  1R4Q B;  5C3W A;  3T1H L;  4B3R Q;  4A3F H;  2JA8 H;  1CM9 A;  1PTO C;  4WRD A;  3SK4 A;  2EJG C;  4CKB A;  1YHQ A;  4DNR B;  1EY7 A;  1Z7T A;  2NVT H;  3A5U A;  1JOR A;  5KIX A;  4K2L A;  1PA6 A;  4HSV A;  3TP7 A;  3H3V I;  2R92 H;  2MHV A;  2CH4 W;  1S5C D;  4IN3 A;  3MZ5 A;  2V1C C;  1L1O B;  1STA A;  3KDF B;  5M3F B;  2M2L A;  3W5O A;  2FHT A;  2G9H D;  1TT2 A;  1QUQ A;  4BY7 H;  1PZJ D;  4YCV A;  4JV5 Q;  2LKV A;  1KAB A;  3PO3 B;  3S14 H;  4NPS A;  2KUM A;  2X6L A;  1N32 Q;  2A69 D;  5D14 A;  3K7U C;  3I8Z A;  1K0R A;  3RZO H;  3J80 L;  1ET6 A;  4CKC A;  5ELC A;  2K75 A;  1K8G A;  5M3M B;  2A69 C;  2Z8L A;  4DV1 Q;  4GN5 A;  4JOI A;  4ZQ3 A;  3KUP A;  1DXM A;  5CV7 A;  1TWG H;  2I46 A;  1JE5 A;  4YHH L;  3RMH A;  2QEJ C;  5CV6 A;  2K5N A;  4KY7 A;  3AFP A;  4CDF C;  4P73 A;  5C3E G;  1S5F D;  3LX0 A;  4GS3 A;  3T13 A;  4CBV A;  5C44 H;  1J6Q A;  5IWA L;  1TY0 A;  2IX3 A;  3J80 E;  2F0L A;  2M00 A;  3ULP A;  2ENB A;  2Z0S A;  5C0X I;  1EQV A;  5GQO A;  2DUD A;  5D3D A;  4XQN A;  3TS0 A;  2VUM G;  3K57 A;  1JB3 A;  4M1U B;  3TZD A;  3RN2 A;  4JOI C;  4DR1 Q;  5JAV A;  1Y14 B;  4JI1 L;  1KNA A;  2LMC B;  4DAV A;  1D2B A;  2B39 A;  2R61 A;  5AFW A;  1CZG A;  2B2U A;  1SYB A;  3B6Y A;  1WJJ A;  1GUT A;  3MWY W;  2Q2I A;  1R9T B;  1Y1V G;  4IO9 A;  1Q7Y C;  2KVM A;  2JA7 G;  4A3I H;  2CQO A;  1DM0 B;  1NJI C;  5FOB B;  2FXQ A;  4B3M L;  3X3N A;  4HIK A;  3S1N H;  1CHP D;  1VQI A;  3J80 i;  1IBM Q;  3STB C;  2EXD A;  3CRL C;  1LT3 D;  1YJW A;  1EIF A;  1NMG A;  2YTY A;  2HHH Q;  1IL2 A;  1EFI D;  1HNZ L;  4GKK L;  3CU7 A;  4LFC L;  2PNR C;  4JCV E;  3CC7 A;  4ULL A;  1F9R A;  2K5H A;  1PHJ A;  5EGT A;  1EUJ A;  3K80 C;  4HJ5 A;  4RGM A;  3ER0 A;  1ICF B;  4PMC A;  3I91 A;  3SR1 A;  1S5B D;  4A3K H;  1MJE A;  4ME5 A;  3BYT B;  3BDC A;  1N8R C;  1JJG A;  4JI3 L;  1SEB D;  4HJ7 A;  5K5P A;  1LV9 A;  4A3J H;  2UUA L;  2B63 H;  4YCW A;  2AQ3 B;  2KED A;  1O78 A;  3IFD A;  4KKS A;  5M5X H;  1OO9 B;  3Q22 A;  1TWH B;  2IHF A;  1VQE A;  1ILQ A;  4U67 3;  3E5S A;  4DK3 C;  4DV5 L;  1IYJ B;  3KF8 B;  4OO1 H;  2JQO A;  3SE0 A;  2F0N A;  4XYQ A;  4X3K A;  4YIJ A;  3ND8 A;  5FJ8 H;  4OL7 A;  4NXM Q;  4A93 B;  1LTR D;  1KTK A;  1XNQ Q;  2MQH A;  1HUM A;  4DAY A;  4DV2 Q;  1E1O A;  1L0W A;  4MTN A;  1HZB A;  4K8I A;  1V1P A;  1GUW A;  2JSO A;  2QKI C;  3I7F A;  2QW7 A;  3SDZ A;  1F9S A;  4RCN A;  4QGU A;  4I7Z C;  1SJH D;  1A6X A;  1IKL A;  1DJR D;  2YV5 A;  3MFY A;  3T51 B;  4C56 C;  1IBK L;  3T56 B;  3KLS A;  3S1Q H;  2RDH A;  5C4Z A;  5CV9 A;  1K83 B;  1VQN A;  1SRO A;  5COY A;  3ICE A;  2LXK A;  2E2D C;  3KF6 A;  2EYM A;  3TME A;  1VQJ A;  1HTL D;  2MO0 A;  1JR0 D;  5IGE A;  2QA4 A;  4DKA C;  1RF2 D;  3I73 A;  4RKB A;  5ELF A;  3PGZ A;  3F2C A;  1HHV A;  3TQY A;  2B3G A;  2F0D A;  1VQM A;  3U9S A;  2RCF A;  1BBU A;  3LGJ A;  3T1Y Q;  1RDP D;  4KMU C;  1QUQ B;  2KCC A;  2R93 H;  5BN4 A;  3OSO A;  3J81 j;  2K6A A;  3VR6 A;  1HZA A;  1ZYR C;  3DHQ A;  2IX0 A;  1HPC A;  5C4X H;  4GLV B;  3PUY A;  2DGY A;  5T1I A;  5C4J H;  1XTC D;  2UU9 Q;  2RBM A;  1G91 A;  3NPP A;  4A3D B;  3OWF A;  4XYO A;  1YJ9 A;  3CCS A;  2A74 C;  1SNQ A;  2QCP X;  5D3I B;  4ZUJ A;  1AE2 A;  2KOL A;  3K5N A;  4RAU C;  4TSS A;  2B2V A;  4OWT B;  2JA5 G;  1K3B C;  2JEB I;  1L0X B;  4EGV A;  1Y1W H;  2PMZ B;  1TWC B;  2XRQ D;  4H0L C;  2C5C A;  4H02 A;  5G3L F;  3RZD B;  3PV0 A;  1HQR D;  2Q2T A;  4CDE C;  2F0I A;  4C1N I;  3NQT A;  4BXX G;  1N34 L;  5LL6 X;  1YEZ A;  2B2W A;  3HOX G;  2YU9 B;  2B8G A;  3BG3 A;  2UUB L;  1WTP A;  1D1I A;  2XWB B;  1BVS A;  4KKU A;  3VYS A;  2OF1 A;  2WB1 E;  5LMU Q;  1BCP F;  1WYD A;  4DR2 Q;  1SFO B;  1EWH A;  4DR4 L;  3H3V H;  2F0V A;  4PMW A;  1WTO A;  1HTP A;  4XXE A;  1TS2 A;  2JA6 H;  2CH4 A;  2B2W C;  3I4N B;  1I6V C;  2ID0 A;  1Q86 C;  1PH7 A;  1JWU D;  2K5Q A;  2I5L X;  2A6H C;  3CXC A;  1SN8 A;  1GKH A;  5LL6 S;  2BDN A;  4IFD H;  4FXG C;  3MXG A;  1M8A A;  4A3E H;  1UE6 A;  1W6J A;  1XPR A;  1B53 A;  2AUJ D;  1EQR A;  2OT2 A;  3CKI B;  4HID A;  4DK1 A;  1WTX A;  4C3I G;  1O7Y A;  2RSN A;  2NVX H;  3IL8 A;  5KNC A;  3I4O A;  1QIL A;  2B2T A;  3KLR A;  5JOB A;  3VYU A;  1K28 A;  3ERO A;  1D6E C;  1EY5 A;  3CHB D;  3OPO A;  5JJL A;  2QF7 A;  4FNF A;  3H0G H;  2DY7 A;  4IOC A;  3GP7 A;  4QUC A;  1ASZ A;  4XT3 B;  4A3M B;  3RLO A;  4BA1 I;  2E2H B;  2UXB Q;  4KTA A;  1NNX A;  4LF6 Q;  1SR3 A;  2JYO A;  3CPW A;  4QF4 A;  4R8N A;  2D9U A;  1XPU A;  2IJ0 A;  2VB2 X;  3NP8 A;  5C0X H;  2PZU A;  4AQY Q;  1V9P A;  1VQK A;  2XSC A;  2EYJ A;  2A73 B;  2J4X A;  3OMG A;  4DV0 L;  1LT6 D;  4UDU C;  3KFU A;  3CQZ H;  1U5K A;  3SK6 A;  4A3C H;  1I94 Q;  3LWE A;  5I6W A;  2OEO A;  4ZYS A;  1YI2 A;  4GKJ L;  2QDL A;  1LTB D;  3HOV B;  1EOT A;  4DAY B;  1PFN A;  4HTH A;  4DV4 L;  3V2T A;  3EFX D;  1W2B A;  2E75 C;  2NYZ D;  1R4P B;  5CR3 A;  1V1P B;  4LFB Q;  4TKO B;  2AQ2 B;  3BYY B;  4UP8 A;  2OWO A;  3PIO 3;  3HS0 C;  3P20 A;  5ELN A;  1NCV A;  1LTS D;  4L5R C;  4U68 A;  4ZCK A;  3DEP A;  2GVB A;  2ZJP A;  1SE3 A;  2MPM A;  3N6R A;  1M90 C;  2WFW A;  1WCM H;  3K6O A;  3MEH A;  1B2T A;  2GA4 B;  3HEJ A;  1HH2 P;  2CW0 C;  4A93 G;  2AQ1 B;  4K0K Q;  1SAP A;  3OW7 A;  1OXU A;  1IKM A;  4EVO A;  4BWG B;  3S16 H;  1NE3 A;  3N52 A;  4XQQ A;  1JC7 A;  4X66 Q;  4JI7 L;  3WOF A;  1KAA A;  5FLM H;  3JAM E;  1TS4 A;  1STN A;  2Z6K C;  1SND A;  3R2T A;  2E5L L;  2OCE A;  4DR6 L;  4FXD A;  1S5D D;  1OXS C;  2RDG A;  1MI2 A;  3HOW B;  3CCE A;  2XRS D;  1KLU D;  2EYO A;  3I72 A;  1H95 A;  4H44 C;  4X64 Q;  2NBF A;  3E0E A;  4OX9 Q;  3TZU A;  4I7A A;  2VQF Q;  3S2H B;  3HP3 A;  1K8A C;  3U4V A;  3SVM A;  2F3I A;  1X3G A;  3NEL A;  3K81 C;  3C46 A;  4KHP L;  2SNM A;  1DOK A;  5LMN Q;  1Y8O B;  5C3E B;  1U4L A;  3NK9 A;  1STY A;  3DEO A;  3FPU B;  5IT9 L;  1GM5 A;  2BA1 A;  4R4T A;  2WV6 D;  3TN2 A;  2R7D A;  3JAM i;  1WOC A;  3PF4 A;  3L2P A;  1U4P A;  3MEF A;  3NTI A;  3I55 A;  4LF4 L;  5F2D A;  4L5Q A;  3PO2 H;  1K3R A;  2YYZ A;  3RR5 A;  2VUM B;  4DUZ Q;  1TS3 A;  3VR4 A;  4JI0 Q;  2E74 C;  5BR8 Q;  2Z4I A;  4P2C B;  5JPM C;  1PH2 A;  5A2Q E;  3IFT A;  1N33 L;  1QVF A;  3GTJ H;  3CCU A;  5FLX L;  4KN4 C;  4FYD A;  1Y1V B;  4UP7 A;  1K9M C;  3DMU A;  3SXH A;  1E0B A;  4DV3 L;  5NUC A;  3GQB A;  4DUY Q;  5JVG 3;  4C3J H;  4N9P A;  4NMZ A;  1LYL A;  2CVR A;  1I50 B;  1QWY A;  2HIX A;  1HR0 W;  3NTH A;  4LF8 L;  1B3Q A;  1MHW C;  3NBI A;  1WD1 A;  5EPL A;  2K4K A;  1BXT A;  2R7Z H;  1Q12 A;  4CGY B;  1XNR L;  1EY8 A;  2K7V A;  3GO5 A;  4DV6 L;  5K36 G;  1WTW A;  4J6H A;  3S1R H;  2KHJ A;  4BS9 A;  1W3S A;  1YNJ D;  4R8I A;  3G71 A;  1I6H H;  3CCQ A;  1KDB A;  3NBH A;  1SYC A;  1PYW D;  1ESF A;  3CC2 A;  4LAA A;  1VQ5 A;  4A3B H;  1RJT A;  1Y69 U;  2ICI A;  4C3H G;  1GVP A;  3NQI A;  5JPN C;  5GAD C;  1GHK A;  2O5I C;  2ASB A;  3FRP B;  3S1M H;  5IGC A;  1GUN A;  4JI5 Q;  1PTO F;  1Q3L A;  2ZM6 Q;  4ODG A;  2VNU D;  3OW2 A;  2UXC L;  2NN6 G;  5C3X A;  4G57 A;  1FD7 D;  3R93 A;  4GNX C;  4DR5 L;  2PYK A;  2V4D A;  4NXN Q;  1GD7 A;  1FNV A;  2I07 B;  3I56 A;  1TS5 A;  2N55 A;  3GTO B;  4A3G G;  3PMF A;  3M4Q A;  1Q1E A;  4JI6 Q;  3U4Z A;  1SNM A;  1Z9F A;  3A54 A;  1VQO A;  1EOV A;  1S40 A;  2ALY B;  4OGQ C;  1G8Z D;  4MIU A;  4RGN A;  4BBR G;  3WOE A;  1TWF H;  5IYB H;  3SK5 A;  2IY5 B;  1S4Z A;  1D5M C;  5BN5 A;  3HOU H;  1CT1 D;  3A5Z B;  2EVB A;  1EYG A;  3RD4 A;  1KLG D;  3F8T A;  1BO0 A;  2K1B A;  1A2T A;  1A0I A;  2HT1 A;  1DZ1 A;  4LNQ A;  3VR2 A;  2F0K A;  1QG7 A;  4C2M H;  3ZYY X;  3Q0A A;  1J8I A;  2JJQ A;  4OIK A;  2EZV A;  4KLK A;  1I5F A;  3EIV A;  2K28 A;  3H91 A;  3I4M H;  2B63 B;  4DAM A;  1ASY A;  3PUV A;  3CCL A;  3K7A H;  3ONA B;  5I2X A;  2MP1 A;  1TII D;  1V8Q A;  1LT5 D;  5ISR A;  4LF9 L;  2VXW A;  4YWL A;  1LTA D;  3IRB A;  1IBL L;  4I65 A;  1A15 A;  3V05 A;  1K8M A;  3TP8 A;  4DPG A;  3L3O C;  1JOK A;  2KA7 A;  1CTM A;  3NWS A;  2N78 A;  1KAW A;  2VY3 A;  5CMD A;  3MFG A;  4X3T A;  4B3T L;  1Q8K A;  3HKZ G;  4A75 A;  4PZ6 A;  1I4H A;  3S17 B;  4DR3 Q;  1IYU A;  4BY1 B;  4OWX B;  2IPK D;  3E9H A;  4X65 L;  3CCJ A;  3I70 A;  2JA5 B;  4X3U A;  1HNW L;  4GN4 B;  1G29 1;  2NZ1 D;  4B08 A;  4ZRZ A;  3H15 A;  1I4R A;  3BZD B;  2F0T A;  4KKT A;  4OEL B;  2ES2 A;  4LFA L;  2E76 C;  3RN5 A;  2Z4H A;  3GTQ H;  4IFD I;  2VS1 A;  4JBJ A;  3Q24 A;  4RFB A;  2EJM A;  3GTK H;  4J15 A;  3HOX B;  1U0L A;  3HOZ H;  2UUC Q;  4JBM A;  3NTK A;  4ZAI A;  3H94 A;  4IQZ A;  4JW0 A;  3PF5 A;  4R9W A;  4LF7 L;  2HQE A;  3AQQ A;  4JI8 L;  3HOW G;  3VDY A;  3MXN A;  3AYH B;  3NHH A;  5IOC A;  4ZLT F;  5HUR A;  3LWU A;  3R2I A;  1E2W A;  4CDD C;  2L55 A;  4A3F G;  2JA8 G;  4JG2 A;  2O2L D;  3KBX A;  1HFG A;  1C9O A;  1WTQ A;  5IGG A;  3OTO Q;  3EQL C;  3P75 A;  3MA2 B;  1TXY A;  4F8M A;  4BA2 I;  2JA7 H;  3MVV A;  1UEB A;  3KYH C;  5C5L A;  4P72 A;  2R92 G;  3FP9 A;  1CQV A;  1VQ7 A;  5AJ3 L;  5DLQ E;  5FKA C;  3J80 c;  1B44 D;  3JC6 6;  1P8L A;  4C3I B;  1VQ4 A;  3UE1 A;  4JYA L;  3NE5 B;  1VQ9 A;  2XIW A;  2K33 A;  1OTC A;  4NB3 A;  1CUK A;  2VQE Q;  2HCI A;  2RSO A;  5I6Y A;  1PRT D;  4FDB A;  1STB A;  3D6C A;  1HQM C;  3FVQ A;  3OHX C;  2RHQ B;  1SXT A;  2X6G A;  2F4I A;  3NBH B;  3CRK C;  3FEW X;  3CCV A;  2D5D A;  4QUF A;  1PRT C;  4QL5 A;  3EVQ A;  2Q8R E;  1M4V A;  4AYB B;  4KK7 A;  1F2M A;  2N49 A;  4IUP A;  2NVY H;  1VQL A;  4DNT B;  2PNH A;  1FJG L;  1X3F A;  3T16 A;  3A8K E;  3HFZ B;  3T1H Q;  1X3E A;  1SRU A;  2JN4 A;  1PYS B;  2JE6 I;  5C44 G;  2BH8 A;  3M4O H;  1K8O A;  3OWE B;  3CCM A;  2Z6B A;  1B3A A;  4JVZ A;  3QG1 A;  1LLR D;  2EJF C;  3H6M A;  3VA5 A;  5M5W B;  4O0A A;  2XWJ B;  4GLA C;  1CZW A;  1J9O A;  2AMC B;  2L15 A;  2K52 A;  4LWC A;  1EYD A;  1WTV A;  1HRJ A;  3UI2 A;  1VMC A;  1IYV A;  4YCU A;  3O13 A;  1QNU A;  3RLF A;  2QDB A;  4FF1 A;  4N8F A;  4OWW B;  2SNS A;  1FL0 A;  4CKE A;  1N9W A;  1BUV T;  1EFW A;  4OEM B;  2CQA A;  3KLW A;  4QIW B;  3S2D H;  3M9B A;  2WAQ B;  2VW9 A;  4A3I G;  4XQJ A;  3DXJ C;  1PTO B;  4Q0F A;  2E2J H;  1L2F A;  1ZXT A;  3FKI B;  2UXD L;  5M5Y H;  3HOY B;  3OOC A;  2PZW A;  2TMP A;  1XTD A;  3C3L A;  1ILP A;  4FXK C;  4KHZ A;  4LF5 L;  1O80 A;  2NZH A;  5CYU A;  3R3O A;  2HDM A;  4YHH Q;  3UDI A;  2KCM A;  5IYD G;  4JBK A;  1UE7 A;  4G7Z C;  2JK8 A;  5IWA Q;  2HUG A;  3E9I A;  4IUT A;  4DK0 A;  1EIG A;  4NW2 A;  3NUC A;  4E6I A;  1G6P A;  4JI2 L;  5HY6 A;  1PFB A;  2N3S A;  1Z47 A;  4JBW A;  1MGS A;  4A3J G;  2Z9H A;  2B63 G;  1GUS A;  2LFN A;  2WII B;  1D7Q A;  3D4R A;  1WD0 A;  4JI1 Q;  1BOS A;  3J81 L;  2HDL A;  1SE8 A;  1EQQ A;  2G5D A;  1XJV A;  3S24 A;  3A74 A;  3LNN A;  1VQF A;  1B1Z A;  1E1T A;  1I3Q B;  4EX5 A;  3VYR A;  2BA0 A;  4OO1 G;  2XTI A;  1TWA B;  5EPK A;  1EWC A;  1CI3 M;  4JK1 C;  5M3F H;  4DA2 A;  4WFN 3;  1STH A;  3OIP A;  3ULL A;  4XT1 B;  2OXP A;  2EYF A;  1SJE D;  1PH5 A;  2CCZ A;  4BXX H;  4RCO A;  4B3M Q;  3CPF A;  1CQF A;  3DUZ A;  1H9M A;  2J0T D;  1JCK B;  2BH2 A;  1EQT A;  3PO3 H;  4L5S A;  2EQS A;  5CBE E;  4TRD A;  2IHE A;  3QB3 A;  1EY9 A;  3J81 E;  3MXN B;  2PQE A;  1PFS A;  4BY1 G;  4DXG A;  1HNZ Q;  4GKK Q;  5J3B A;  2F0W A;  4KY5 A;  5M3M H;  1UWV A;  1LTG D;  3WWV A;  3MC0 B;  2VL6 A;  1SE4 A;  5IP7 H;  2Q2H A;  4HR7 B;  1A3V A;  1CSP A;  4DN4 M;  1FYC A;  2YTX A;  4X3S A;  3W2D A;  3J7Y W;  2IWH A;  5I2Y A;  4Y7N B;  1QZG A;  1J5E L;  4LUZ A;  1A62 A;  1PRT B;  3UDX A;  5I9O A;  4DV7 L;  2UUA Q;  2PMZ E;  4YY3 L;  1B9M A;  1X54 A;  4V0B A;  2VZA A;  4A4I A;  2Q8I B;  2LS0 1;  4OON A;  1SE2 A;  3NEM A;  1KHI A;  3EN2 A;  3BDO A;  3J81 i;  2EOT A;  4S3S A;  4DV5 Q;  2R93 G;  1CK1 A;  4KJN A;  1II3 A;  1E24 A;  1ET9 A;  3Q23 A;  5C4X G;  2PCF B;  4C3H B;  1LM0 A;  3I4L A;  2F03 A;  1Y8P B;  5TSS A;  3TEH B;  5JEA G;  4OHJ A;  4UAI A;  4X62 L;  2NZO A;  4K5W A;  1R9T H;  4AIM A;  1ONL A;  2RKS A;  4ZKC B;  1OXT A;  3HGB A;  3K5M A;  4GLX A;  3DLL A;  3GTM B;  2K5V A;  1FR3 A;  1IBK Q;  4R4Q A;  5JEA J;  2K5D A;  4XTC S;  3BU2 A;  1SYD A;  4L6T B;  3K59 A;  4A3G B;  1H9R A;  3C1E A;  2D0O A;  4JPB W;  2A6E D;  4MNO A;  4DR7 L;  4BBR B;  3BZC A;  1VQA A;  3KK7 A;  4POF A;  3GTG B;  1YJN A;  1F2Y A;  2A6E C;  2RF4 A;  1HR0 L;  2D2C C;  2F0M A;  3FHW A;  3QOL A;  1AFP A;  3G4S A;  4MHE A;  1UE5 A;  3ERS X;  3HZX A;  3QO2 A;  1OXV A;  1HJP A;  5HGT A;  1QCB D;  4AYB G;  3D4W A;  3M4Y A;  1BF4 A;  5KYI A;  4QY7 A;  5IP9 H;  2AKW B;  3E6Z X;  2E2I B;  1FGB D;  3X3M A;  1JWS D;  1TWH H;  1CA5 A;  3MXU A;  5E4X A;  3MHB A;  4FF4 A;  2BCO A;  2Z1C A;  4KHV A;  1BBX C;  2L9H A;  3A56 A;  4IFD G;  2XN9 C;  5J22 A;  3GTL B;  1E22 A;  3F2D A;  3RNU A;  3FPP A;  2CWA A;  2PQA A;  2DJG C;  4B3S L;  4JC0 A;  3S15 B;  1RHP A;  4A93 H;  3TP6 A;  3K58 A;  1UNS A;  3SHL A;  4IPG A;  1VQB A;  4IZ8 A;  1ROD A;  4IPD A;  3HKZ B;  1NTG A;  1A63 A;  1C48 A;  2CKZ B;  4IJH A;  2RQX A;  1N34 Q;  1Q82 C;  2Z6K A;  3H0G G;  3VYT A;  4IAL A;  1NR4 A;  3PSI A;  1MBY A;  2MUY A;  2UUB Q;  2ZJQ A;  3OYY A;  1PH9 A;  1K83 H;  3BDL A;  3KLS X;  3HKZ E;  2WAQ G;  4PMB A;  2KEE A;  1WVL A;  3D0F A;  4P74 A;  3J7A V;  2WAC A;  5E4W C;  4DFA A;  2I5H A;  3FKI G;  4UHV A;  2K04 A;  5C0X G;  3HOY G;  1PYB A;  1Z6H A;  1RD9 D;  5IE8 A;  4DR4 Q;  1VMP A;  1QJO A;  4L5T A;  1S5E D;  2KJX A;  2XVS A;  4LMQ D;  5M9O A;  1NAP A;  5H1S E;  1SLJ A;  3GTP H;  3D6W A;  2WKD A;  1XMQ L;  2C35 B;  1O7I A;  2EY6 A;  2HD3 A;  3CAM A;  3TS2 A;  3JAM c;  5DEH A;  1DOL A;  1BDO A;  2ZXP A;  1MIU A;  4KJO A;  1WTR A;  4PNY A;  3A7A B;  4DK6 C;  4A3F B;  2JA8 B;  2PI2 A;  1NSN S;  2EDG A;  4A3D H;  3DWA A;  5DNF A;  4RKL A;  3CD6 A;  5L37 A;  1T5X D;  4Q5V A;  1AZP A;  2NVT B;  2F4V L;  5J1Z A;  2BOS A;  1HNX L;  2KEN A;  2JEA I;  3TRZ A;  5EQ0 A;  1TR5 A;  1ESR A;  1E2Z A;  4HED A;  1PH8 A;  4PZ8 A;  5E1F A;  2R92 B;  1A2U A;  1TWC H;  2E8G A;  1WCM G;  4CJ2 C;  4BBS H;  3RZD H;  3T53 B;  5EAY A;  2EPB A;  5IGB A;  3BJU A;  1MKH A;  5GAH C;  1N36 L;  4RWS C;  3PUW A;  2MO1 A;  1B70 B;  1UUP A;  3CME A;  1C4Q A;  2YU9 H;  4BY7 B;  4RHR A;  1D5Z C;  5FLM G;  1XMO L;  3S14 B;  5KRU A;  3RUZ A;  1AP0 A;  4UPA A;  5IT9 E;  1SSO A;  3RZO B;  3K0Y A;  4APV A;  4N8X 1;  4DV0 Q;  1G6Z A;  2ZJR A;  1B50 A;  1SFO H;  5IT9 c;  1YIT A;  4GKJ Q;  2ZXR A;  1IHZ A;  1KDA A;  3ULJ A;  3EA6 A;  3V96 A;  4DV4 Q;  2EIF A;  1L1O C;  1KD1 C;  4ZK9 B;  1EY4 A;  2A19 A;  3QJY A;  1TWG B;  2EY1 A;  5CV4 A;  5IYC G;  3I4N H;  5C4H A;  1D8L A;  4YWM A;  3KJP A;  4QB4 A;  1FNW A;  2L1B A;  4HCE A;  5FLX E;  5C44 B;  2NN6 H;  3QIA A;  4QJF A;  2RCN A;  3BS1 A;  1TQO A;  4GNX A;  4B3R L;  2WKC A;  3CP0 A;  2A1A A;  1A3U A;  5GRO A;  4FF2 A;  1Q81 C;  1PH1 A;  3PO2 G;  1DON A;  1QVC A;  1YNJ C;  4KV6 A;  1JOQ A;  1FGU A;  3EJI A;  2A68 D;  1EWI A;  1HA6 A;  2PW7 A;  1RL2 A;  2DNE A;  3SGI A;  1QVG A;  1SDF A;  5J39 A;  2CFM A;  1QOH A;  2GVA A;  1ICW A;  4A3M H;  4JI7 Q;  3J7Z C;  1HUN A;  2E2H H;  4C3J G;  1B7Y B;  4ABN A;  2Q2U A;  2E5L Q;  4ME3 A;  4A3I B;  4DR6 Q;  1AH9 A;  2F0G A;  3S1N B;  4P71 A;  4HJA A;  4ALP A;  1VQ8 A;  4JV5 L;  3QOJ A;  5I9P A;  3UDG A;  4ILW A;  4PQX A;  4A3L G;  1N32 L;  2F0F A;  1TKW B;  2DN8 A;  2EYL A;  3G48 A;  2EE1 A;  2IL8 A;  4FP5 D;  2PQA B;  3H3V C;  2F3V A;  3ERQ A;  4RGT A;  4KHP Q;  4DV1 L;  4G4K A;  2F0P A;  3HOV H;  1PFM A;  5E3F A;  4A3K B;  2DNC A;  1EYC A;  3F2U A;  5BN3 A;  3AU7 A;  3P7J A;  3H09 A;  4A3B G;  2K32 A;  3VA7 A;  1HZC A;  2HCC A;  2H4O A;  4LF4 Q;  1PH3 A;  1P16 A;  4CJ1 B;  3GV3 A;  4A3J B;  1VS0 A;  2G9D A;  5M5X B;  3DM1 A;  4IUR A;  4HSP A;  1QE6 A;  1N33 Q;  4DAP A;  2N88 A;  5JJK A;  4M8A A;  4DR1 L;  1STE A;  2R3Z A;  4DV3 Q;  3VR3 A;  1GO3 E;  2MFI A;  5EBD A;  1F2Z A;  2VQE L;  4IUV A;  1NMF A;  1AZQ A;  4RG1 A;  2KQ3 A;  3M7N A;  4C1N K;  3UDF A;  3U9O A;  1YIJ A;  4LF8 Q;  1VQG A;  3URY A;  2WIN B;  4O2D A;  3HRZ C;  5IYB G;  2JXM B;  4K6D A;  1YNX A;  1RTN A;  3C2P A;  5EPJ A;  4N9T A;  5EKK A;  1PXU A;  1IBM L;  3HOW H;  2DJF C;  5GAE C;  4DV6 Q;  3S1Q B;  4QCL A;  4RHS A;  4K8J A;  2ZT9 C;  5CV5 A;  5DAU A;  2HHH L;  1PRT F;  3S2H H;  3M4P A;  2L11 A;  1B9N A;  5ELE A;  1LTT D;  1DOM A;  1S3O A;  1YBY A;  1V1Q A;  1K73 C;  1QZH A;  1CA6 A;  1WTH A;  3I4M G;  2KHI A;  2L12 A;  5C3E H;  2PI2 E;  4TQU S;  2NUC A;  1I4Q A;  3A8I E;  1MJC A;  1IZ6 A;  2IX1 A;  2L5T A;  4ZKB B;  2HIV A;  2IW3 A;  3D31 A;  3Q8D A;  5JVH 3;  2KBN A;  2R93 B;  2UXC Q;  1B4O A;  1SBB B;  4HMI A;  4F7X A;  2VUM H;  1SYF A;  4DR5 Q;  1JMC A;  5C4J B;  1LUZ A;  3A8J E;  5C4X B;  1TY2 A;  1SYG A;  1Y1V H;  4K6L A;  1VDZ A;  1M1K C;  3NWT A;  1C7Y A;  4NXM L;  2RDF A;  2PPB C;  1XNQ L;  1X9N A;  4WJ4 A;  2F0S A;  1I50 H;  4LUV A;  1EIY B;  4DV2 L;  1D5X C;  1Y1W B;  2AWO A;  3PCO B;  4F88 A;  3CCR A;  2D0P A;  3L0O A;  1RKN A;  5ELO A;  3NXW A;  3K8A A;  4DNI A;  5EJW A;  4A76 A;  1CFM A;  1PZI D;  2FMM A;  4BY7 G;  5CC4 A;  4WOR A;  1UEA B;  3HOZ G;  2CHB D;  5FK9 C;  3MAQ A;  4GNX B;  1PZK D;  1YNN D;  3A0J A;  4R4C A;  2ZXO A;  3W3A A;  3BVZ A;  2AHO B;  1GXD C;  2K03 A;  4LUO A;  3M3Y H;  1DCZ A;  2D62 A;  1YNN C;  1CHQ D;  2K50 A;  4LK1 C;  4LF9 Q;  1IBL Q;  1Q46 A;  1RTO A;  3IKJ A;  1VQ6 A;  5T1G A;  1SMY D;  2JA6 B;  2BDO A;  2EYH A;  3BVG A;  5COR A;  5CBA E;  5KYL A;  4JI4 Q;  1F2L A;  1YHA A;  3T1Y L;  1HZ9 A;  1VQP A;  2QIL A;  4AYB E;  2L4N A;  1EZ6 A;  3L9A X;  4B3T Q;  3T4A C;  1F9P A;  1SMY C;  3STB D;  5ELB A;  4ID6 A;  2ATW A;  2M9V A;  1JJC B;  2Y0S G;  1VF7 A; 
#chains in the Genus database with same CATH homology
 4A3E B;  1EZ8 A;  3SEB A;  1GUO A;  2NVX B;  5CV8 A;  2B2U C;  1PDQ A;  1VF5 C;  3M85 A;  1Y8N B;  2X69 A;  1GHJ A;  3K5L A;  3H0G B;  4ZUI A;  1EY0 A;  5FO8 B;  3HG9 A;  3D3R A;  4H7B A;  5KNB A;  4KN7 C;  5C5M A;  1NUC A;  1PMR A;  3DWQ A;  1F9Q A;  5D65 A;  2LY7 A;  1ENF A;  1G2S A;  1EIH A;  4IUQ A;  5EKI A;  2NB0 A;  4FO2 A;  3CQZ B;  1GUG A;  4XIG S;  2RVL A;  1XWE A;  3NSW A;  1JOO A;  2R6G A;  3FMC A;  5IGF A;  1HCZ A;  5FO9 B;  4LJZ C;  1MSH A;  1LO5 D;  1TU2 B;  4L63 B;  2O5J C;  1WCM B;  1I4X A;  1Q1B A;  4CHT B;  2NWG A;  4O1N A;  3S16 B;  3WDN A;  2MJ8 A;  2NN6 I;  2B2Y A;  3GTP B;  3TBI B;  1ZYR D;  2TSS A;  4DXF A;  2C9O A;  1JIC A;  2AWN A;  4K14 A;  3GV6 A;  4B9X A;  5JEA H;  4HCS A;  3IAY A;  1HA5 A;  5IOD A;  1IW7 D;  5I4D A;  3TSS A;  1ENA A;  1EU4 A;  2B2Y C;  3PUX A;  2F0Q A;  1IW7 C;  2FJ2 A;  1O7Z A;  4BBS B;  1Q8I A;  1C8C A;  4G7O C;  2FFK B;  3PO2 B;  3KBG A;  3TP5 A;  1MSG A;  2WB1 B;  1OXX K;  4V19 0;  2EYP A;  4MN3 A;  1ZKO A;  2F1M A;  4DU9 A;  2K01 A;  3GTJ B;  5IIF A;  2AUK A;  4J8Q A;  4KD3 A;  4RGO S;  2B2V C;  4G7H C;  1DYQ A;  4IUN A;  4C3J B;  2WP8 J;  4KD4 A;  1H9S A;  2A6H D;  4K2K A;  3D4D A;  2F0E A;  1RCV D;  2B8F A;  3VR5 A;  2F0O A;  2PO4 A;  3K5O A;  2R7Z B;  2JP1 A;  1ML0 D;  3S1R B;  1V43 A;  1QNK A;  1I6H B;  2FMC A;  2XNA C;  1EU3 A;  3P1H A;  2EY5 A;  3MTS A;  1PLF A;  4WJW A;  2FIN B;  4A3B B;  3BVM A;  4K5V A;  4EQN A;  5DM7 3;  2F0J A;  1FNU A;  5G3L D;  3S1M B;  1ZEQ X;  4DGZ A;  1T5E A;  2PZT A;  3G7L A;  4J1M A;  2KEC A;  1PTO H;  1X32 A;  3ITP A;  3AMU A;  4Z9C B;  2K5W A;  1LT4 D;  1KNE A;  3AB9 A;  1BCP D;  2B2T C;  4IFD J;  1LAC A;  1EEI D;  1BQQ T;  1TWF B;  5ELD A;  1BCP C;  1Q90 A;  3HOU B;  1A3T A;  2BE5 D;  1AW7 A;  3SK8 A;  1U4M A;  4B9W A;  4C2M B;  1QB5 D;  1SYE A;  1F77 A;  2BE5 C;  1BR9 A;  4FVM A;  3I4M B;  4KI0 A;  3JAM L;  3PIP 3;  4HN7 A;  3K7A B;  4F87 A;  4H13 C;  1L0Y B;  2CW0 D;  3GD7 A;  1STG A;  1H9K A;  2MGS A;  1E2V A;  1JE4 A;  3J7A F;  3D8G A;  5C0X J;  2IT1 A;  1U9R A;  1U4R A;  2K05 A;  5LHY 1;  1EY6 A;  2J7Z A;  1EL0 A;  3S9W A;  3TDQ A;  1JQY D;  1DD2 A;  3L7Z C;  1NR2 A;  1X3Q A;  1GOZ A;  3A55 A;  2EXZ A;  4NDX A;  5EKL A;  5A2Q L;  3GTQ B;  3GTK B;  3ND9 A;  3HOZ B;  1VCI A;  5K36 H;  1JWM D;  1HXY D;  5DM6 3;  2SOB A;  5FO7 B;  4QMG A;  1KDC A;  2NTS A;  2NTT A;  4HAE A;  3M7G A;  3R8B A;  3FDT A;  2F0U A;  2JA7 B;  1EEF D;  1H9S B;  2Y0S B;  3G6J B;  4NP5 A;  5KND A;  1MD2 D;  3OIQ A;  2Q8T A;  1AEX A;  3C1F A;  1UAP A;  1SNC A;  3QWN A;  1GJX A;  5KGU A;  3A7L A;  1H9J A;  4OO1 I;  2VB3 X;  1LTI D;  5A35 A;  3I90 A;  2A68 C;  2F0H A;  4EQP A;  1HFN A;  3M3Y B;  2ICE C;  1ENC A;  2KCN A;  1O7L A;  5JJZ A;  5KEE A;  2O4X A;  4K5X A;  2A5H A;  4L8J A;  3Q6S A;  2NVY B;  1XX8 A;  4FF3 A;  1BCP B;  1V1O A;  4KY6 A;  3DWP A;  5CGK A;  2EY2 A;  2SEB D;  1W6K A;  1AN8 A;  1TVX A;  1D1K A;  4OIJ A;  3M4O B;  4GZY C;  1G2T A;  2L0C A;  1XYI A;  4NKL A;  4IUU A;  2H1E A;  2RA4 A;  1BNZ A;  4RA8 A;  1EYA A;  3PUZ A;  4O42 A;  5C6A A;  1LAB A;  2SDF A;  2DY8 A;  4EQO A;  1I4G A;  3S2D B;  1I4P A;  3KF8 A;  4DF7 A;  2E2J B;  5IGD A;  3MXP A;  5M5Y B;  2NVQ B;  3OMC A;  1X3P A;  4CJ0 B;  1IL8 A;  3I3C A;  2F3W A;  2PW5 A;  2KHS A;  3E0J A;  4XDX A;  1SNO A;  1PTO D;  1XXG A;  5EBC A;  4PV1 C;  1SNP A;  4RH6 A;  4HMJ A;  1R4Q B;  5C3W A;  1CM9 A;  1PTO C;  4WRD A;  3SK4 A;  2EJG C;  4CKB A;  4DNR B;  1EY7 A;  1Z7T A;  1JOR A;  5KIX A;  4K2L A;  4HSV A;  3TP7 A;  2MHV A;  1S5C D;  4IN3 A;  3MZ5 A;  1STA A;  5M3F B;  2M2L A;  2FHT A;  2G9H D;  1TT2 A;  1PZJ D;  2LKV A;  1KAB A;  3PO3 B;  2KUM A;  2X6L A;  2A69 D;  5D14 A;  3I8Z A;  3J80 L;  1ET6 A;  4CKC A;  5ELC A;  5M3M B;  2A69 C;  2Z8L A;  4ZQ3 A;  3KUP A;  1DXM A;  5CV7 A;  2I46 A;  3RMH A;  2QEJ C;  5CV6 A;  4KY7 A;  1S5F D;  3LX0 A;  3T13 A;  4CBV A;  1TY0 A;  2IX3 A;  3J80 E;  2F0L A;  2M00 A;  2ENB A;  5C0X I;  1EQV A;  5D3D A;  4XQN A;  3K57 A;  1JB3 A;  4M1U B;  3TZD A;  5JAV A;  1KNA A;  2LMC B;  4DAV A;  1D2B A;  2B39 A;  2R61 A;  5AFW A;  1CZG A;  2B2U A;  1SYB A;  1GUT A;  3MWY W;  1R9T B;  2KVM A;  1DM0 B;  5FOB B;  3X3N A;  1CHP D;  3CRL C;  1LT3 D;  1EFI D;  3CU7 A;  2PNR C;  4ULL A;  1F9R A;  5EGT A;  4RGM A;  4PMC A;  3I91 A;  3SR1 A;  1S5B D;  4ME5 A;  3BYT B;  3BDC A;  1SEB D;  5K5P A;  1LV9 A;  2AQ3 B;  2KED A;  1O78 A;  3IFD A;  4KKS A;  1OO9 B;  3Q22 A;  1TWH B;  1ILQ A;  4U67 3;  3E5S A;  4OO1 H;  3SE0 A;  2F0N A;  4XYQ A;  4X3K A;  4YIJ A;  3ND8 A;  4A93 B;  4OL7 A;  1LTR D;  1KTK A;  1HUM A;  4DAY A;  4K8I A;  1V1P A;  1GUW A;  2JSO A;  2QKI C;  3SDZ A;  1F9S A;  4RCN A;  4I7Z C;  1SJH D;  1A6X A;  1IKL A;  1DJR D;  3MFY A;  3T51 B;  4C56 C;  3T56 B;  3KLS A;  2RDH A;  5C4Z A;  5CV9 A;  1K83 B;  5COY A;  2E2D C;  2EYM A;  3TME A;  1HTL D;  1JR0 D;  5IGE A;  1RF2 D;  3I73 A;  4RKB A;  5ELF A;  1HHV A;  2F0D A;  3U9S A;  1RDP D;  4KMU C;  2KCC A;  5BN4 A;  3OSO A;  2K6A A;  3VR6 A;  1ZYR C;  3DHQ A;  2IX0 A;  1HPC A;  5T1I A;  3PUY A;  1XTC D;  2RBM A;  1G91 A;  3NPP A;  4A3D B;  3OWF A;  4XYO A;  2A74 C;  1SNQ A;  2QCP X;  5D3I B;  4ZUJ A;  2KOL A;  3K5N A;  4RAU C;  4TSS A;  2B2V A;  2JEB I;  1L0X B;  4EGV A;  2PMZ B;  1TWC B;  2XRQ D;  4H0L C;  2C5C A;  5G3L F;  3RZD B;  3PV0 A;  1HQR D;  2F0I A;  4C1N I;  3NQT A;  5LL6 X;  2B2W A;  2YU9 B;  2B8G A;  3BG3 A;  1WTP A;  1D1I A;  2XWB B;  3VYS A;  4KKU A;  2OF1 A;  1BCP F;  1SFO B;  1EWH A;  2F0V A;  4PMW A;  1WTO A;  1HTP A;  4XXE A;  1TS2 A;  2B2W C;  3I4N B;  1I6V C;  2ID0 A;  1JWU D;  2K5Q A;  2A6H C;  5LL6 S;  2BDN A;  4IFD H;  4FXG C;  3MXG A;  1M8A A;  1W6J A;  1B53 A;  2AUJ D;  2OT2 A;  3CKI B;  4DK1 A;  1WTX A;  4C3I G;  1O7Y A;  2RSN A;  3IL8 A;  5KNC A;  1QIL A;  2B2T A;  3KLR A;  5JOB A;  3VYU A;  3ERO A;  1D6E C;  1EY5 A;  3CHB D;  3OPO A;  2QF7 A;  4FNF A;  2DY7 A;  3GP7 A;  4QUC A;  4XT3 B;  4A3M B;  4BA1 I;  2E2H B;  4KTA A;  2JYO A;  4QF4 A;  4R8N A;  2D9U A;  2IJ0 A;  2VB2 X;  3NP8 A;  5C0X H;  2PZU A;  2XSC A;  2EYJ A;  2A73 B;  2J4X A;  3OMG A;  1LT6 D;  4UDU C;  3SK6 A;  3LWE A;  5I6W A;  2OEO A;  4ZYS A;  1LTB D;  3HOV B;  1EOT A;  1PFN A;  4HTH A;  3V2T A;  3EFX D;  2E75 C;  2NYZ D;  1R4P B;  5CR3 A;  1V1P B;  4TKO B;  2AQ2 B;  3BYY B;  3PIO 3;  3HS0 C;  3P20 A;  1NCV A;  1LTS D;  4U68 A;  3DEP A;  1SE3 A;  2MPM A;  3N6R A;  3K6O A;  3MEH A;  1B2T A;  2GA4 B;  3HEJ A;  2CW0 C;  2AQ1 B;  1SAP A;  3OW7 A;  1OXU A;  1IKM A;  4EVO A;  4BWG B;  3N52 A;  4XQQ A;  1JC7 A;  3WOF A;  1KAA A;  3JAM E;  1TS4 A;  1STN A;  1SND A;  3R2T A;  4FXD A;  1S5D D;  1OXS C;  2RDG A;  1MI2 A;  3HOW B;  2XRS D;  1KLU D;  2EYO A;  3I72 A;  4H44 C;  2NBF A;  3TZU A;  3S2H B;  3HP3 A;  3SVM A;  3C46 A;  2SNM A;  1DOK A;  1Y8O B;  5C3E B;  1U4L A;  3NK9 A;  1STY A;  3DEO A;  3FPU B;  5IT9 L;  2BA1 A;  2WV6 D;  3TN2 A;  1U4P A;  3NTI A;  5F2D A;  2YYZ A;  2VUM B;  1TS3 A;  3VR4 A;  2E74 C;  2Z4I A;  4P2C B;  5JPM C;  5A2Q E;  3IFT A;  5FLX L;  4KN4 C;  4FYD A;  1Y1V B;  3DMU A;  3SXH A;  1E0B A;  5NUC A;  3GQB A;  5JVG 3;  4N9P A;  4NMZ A;  2CVR A;  1I50 B;  1QWY A;  3NTH A;  3NBI A;  1WD1 A;  5EPL A;  1BXT A;  1Q12 A;  4CGY B;  1EY8 A;  2K7V A;  3GO5 A;  5K36 G;  1WTW A;  4J6H A;  4BS9 A;  1YNJ D;  4R8I A;  1KDB A;  3NBH A;  1SYC A;  1PYW D;  1ESF A;  4LAA A;  1RJT A;  1Y69 U;  2ICI A;  4C3H G;  3NQI A;  5JPN C;  1GHK A;  2O5I C;  3FRP B;  5IGC A;  1GUN A;  1PTO F;  1Q3L A;  4ODG A;  2VNU D;  2NN6 G;  5C3X A;  4G57 A;  1FD7 D;  3R93 A;  2PYK A;  2V4D A;  1FNV A;  2I07 B;  1TS5 A;  2N55 A;  3GTO B;  3PMF A;  1Q1E A;  1SNM A;  3A54 A;  4OGQ C;  4RGN A;  1G8Z D;  4MIU A;  3WOE A;  3SK5 A;  1S4Z A;  1D5M C;  5BN5 A;  1CT1 D;  2EVB A;  3RD4 A;  1KLG D;  1BO0 A;  2K1B A;  1A2T A;  1DZ1 A;  3VR2 A;  2F0K A;  1QG7 A;  3ZYY X;  3Q0A A;  1J8I A;  4OIK A;  2EZV A;  2K28 A;  3H91 A;  2B63 B;  3PUV A;  3ONA B;  5I2X A;  2MP1 A;  1TII D;  1V8Q A;  1LT5 D;  5ISR A;  2VXW A;  1LTA D;  4I65 A;  1A15 A;  3V05 A;  1K8M A;  3TP8 A;  3L3O C;  1JOK A;  2KA7 A;  1CTM A;  3NWS A;  5CMD A;  3MFG A;  4X3T A;  1I4H A;  3S17 B;  1IYU A;  4BY1 B;  2IPK D;  3I70 A;  2JA5 B;  4X3U A;  1G29 1;  2NZ1 D;  4B08 A;  4ZRZ A;  1I4R A;  3BZD B;  2F0T A;  4KKT A;  2E76 C;  2Z4H A;  4IFD I;  3Q24 A;  4RFB A;  2EJM A;  3HOX B;  3NTK A;  4ZAI A;  3H94 A;  4IQZ A;  4R9W A;  2HQE A;  3MXN A;  3NHH A;  5IOC A;  4ZLT F;  5HUR A;  3LWU A;  3R2I A;  1E2W A;  2L55 A;  2O2L D;  3KBX A;  1HFG A;  1WTQ A;  5IGG A;  3EQL C;  3P75 A;  3MA2 B;  4F8M A;  4BA2 I;  3MVV A;  5C5L A;  1CQV A;  5FKA C;  1B44 D;  4C3I B;  3NE5 B;  2XIW A;  2K33 A;  2HCI A;  2RSO A;  5I6Y A;  1PRT D;  1STB A;  3D6C A;  1HQM C;  3FVQ A;  3OHX C;  1SXT A;  2X6G A;  2F4I A;  3CRK C;  3FEW X;  2D5D A;  4QUF A;  1PRT C;  3EVQ A;  2Q8R E;  1M4V A;  4AYB B;  4KK7 A;  1F2M A;  4IUP A;  4DNT B;  3T16 A;  3A8K E;  2JE6 I;  1K8O A;  3OWE B;  1B3A A;  3QG1 A;  1LLR D;  2EJF C;  3H6M A;  3VA5 A;  5M5W B;  2XWJ B;  1CZW A;  1J9O A;  1WTV A;  1EYD A;  1HRJ A;  3UI2 A;  1VMC A;  1IYV A;  3O13 A;  1QNU A;  3RLF A;  2QDB A;  4FF1 A;  2SNS A;  4CKE A;  1BUV T;  2CQA A;  4QIW B;  2WAQ B;  4XQJ A;  3DXJ C;  1PTO B;  4Q0F A;  1ZXT A;  3FKI B;  3HOY B;  3OOC A;  2PZW A;  2TMP A;  3C3L A;  1ILP A;  4FXK C;  4KHZ A;  1O80 A;  5CYU A;  3R3O A;  2HDM A;  4G7Z C;  2HUG A;  4IUT A;  4DK0 A;  1EIG A;  4NW2 A;  3NUC A;  4E6I A;  1PFB A;  1Z47 A;  4JBW A;  1MGS A;  1GUS A;  2LFN A;  2WII B;  3D4R A;  1WD0 A;  1BOS A;  3J81 L;  2HDL A;  3LNN A;  1B1Z A;  1I3Q B;  4OO1 G;  3VYR A;  2BA0 A;  5EPK A;  1TWA B;  1EWC A;  1CI3 M;  4JK1 C;  4DA2 A;  4WFN 3;  1STH A;  3OIP A;  4XT1 B;  2OXP A;  2EYF A;  1SJE D;  4RCO A;  1CQF A;  3DUZ A;  1H9M A;  2J0T D;  1JCK B;  1EQT A;  5CBE E;  4TRD A;  3QB3 A;  1EY9 A;  3J81 E;  2PQE A;  4DXG A;  2F0W A;  4KY5 A;  1LTG D;  3MC0 B;  1SE4 A;  4HR7 B;  1A3V A;  4DN4 M;  1FYC A;  4X3S A;  3W2D A;  3J7Y W;  2IWH A;  5I2Y A;  4Y7N B;  1PRT B;  5I9O A;  1B9M A;  4V0B A;  2Q8I B;  2LS0 1;  1SE2 A;  3BDO A;  2EOT A;  4S3S A;  1CK1 A;  4KJN A;  1II3 A;  1ET9 A;  3Q23 A;  2PCF B;  4C3H B;  3I4L A;  2F03 A;  1Y8P B;  5TSS A;  5JEA G;  4OHJ A;  4UAI A;  4K5W A;  1ONL A;  2RKS A;  4ZKC B;  1OXT A;  3HGB A;  3K5M A;  3GTM B;  1FR3 A;  5JEA J;  2K5D A;  4XTC S;  4L6T B;  1SYD A;  3K59 A;  4A3G B;  1H9R A;  3C1E A;  2A6E D;  4BBR B;  3KK7 A;  3GTG B;  1F2Y A;  2A6E C;  2D2C C;  2F0M A;  3QOL A;  1AFP A;  4MHE A;  3HZX A;  3QO2 A;  1OXV A;  5HGT A;  1QCB D;  3D4W A;  3M4Y A;  1BF4 A;  5KYI A;  3E6Z X;  2E2I B;  1FGB D;  3X3M A;  1JWS D;  1CA5 A;  3MXU A;  5E4X A;  3MHB A;  4FF4 A;  2BCO A;  2Z1C A;  4KHV A;  1BBX C;  2L9H A;  3A56 A;  4IFD G;  2XN9 C;  5J22 A;  3GTL B;  3FPP A;  3S15 B;  1RHP A;  3TP6 A;  3K58 A;  1UNS A;  3SHL A;  4IZ8 A;  1ROD A;  3HKZ B;  1C48 A;  2RQX A;  3VYT A;  4IAL A;  1NR4 A;  1MBY A;  2MUY A;  3BDL A;  3KLS X;  4PMB A;  2KEE A;  1WVL A;  3J7A V;  2WAC A;  5E4W C;  4DFA A;  2K04 A;  5C0X G;  1Z6H A;  1RD9 D;  1VMP A;  1QJO A;  1S5E D;  2KJX A;  2XVS A;  4LMQ D;  5M9O A;  1NAP A;  3D6W A;  2WKD A;  2EY6 A;  5DEH A;  1DOL A;  1BDO A;  2ZXP A;  4KJO A;  1WTR A;  4PNY A;  3A7A B;  4A3F B;  2JA8 B;  1NSN S;  2EDG A;  3DWA A;  5DNF A;  4RKL A;  1T5X D;  4Q5V A;  1AZP A;  2NVT B;  5J1Z A;  2BOS A;  2JEA I;  5EQ0 A;  1TR5 A;  1ESR A;  1E2Z A;  4HED A;  2R92 B;  5E1F A;  1A2U A;  4CJ2 C;  3T53 B;  2EPB A;  5IGB A;  4RWS C;  3PUW A;  1UUP A;  1C4Q A;  4BY7 B;  4RHR A;  1D5Z C;  3S14 B;  5KRU A;  3RUZ A;  1AP0 A;  5IT9 E;  1SSO A;  3RZO B;  3K0Y A;  1G6Z A;  1B50 A;  2ZXR A;  1IHZ A;  1KDA A;  3V96 A;  3EA6 A;  4ZK9 B;  1EY4 A;  3QJY A;  1TWG B;  2EY1 A;  5CV4 A;  5C4H A;  4QB4 A;  1FNW A;  2L1B A;  4HCE A;  5FLX E;  5C44 B;  2NN6 H;  3QIA A;  3BS1 A;  1TQO A;  2WKC A;  1A3U A;  4FF2 A;  1DON A;  1YNJ C;  4KV6 A;  1JOQ A;  3EJI A;  2A68 D;  1HA6 A;  2PW7 A;  2DNE A;  1SDF A;  5J39 A;  1QOH A;  1ICW A;  1HUN A;  4C3J G;  4ABN A;  4A3I B;  2F0G A;  3S1N B;  3QOJ A;  5I9P A;  4ILW A;  4PQX A;  2F0F A;  1TKW B;  2DN8 A;  2EYL A;  2EE1 A;  2IL8 A;  4FP5 D;  3H3V C;  2F3V A;  3ERQ A;  4RGT A;  4G4K A;  2F0P A;  1PFM A;  5E3F A;  4A3K B;  2DNC A;  1EYC A;  3F2U A;  5BN3 A;  3AU7 A;  3P7J A;  3H09 A;  2K32 A;  3VA7 A;  2HCC A;  2H4O A;  4CJ1 B;  3GV3 A;  4A3J B;  2G9D A;  5M5X B;  3DM1 A;  4IUR A;  4HSP A;  1QE6 A;  4DAP A;  2N88 A;  4M8A A;  1STE A;  2R3Z A;  3VR3 A;  5EBD A;  1F2Z A;  4IUV A;  1AZQ A;  2KQ3 A;  3M7N A;  4C1N K;  3U9O A;  3URY A;  2WIN B;  3HRZ C;  2JXM B;  4K6D A;  1RTN A;  3C2P A;  5EPJ A;  4N9T A;  5EKK A;  1PXU A;  3S1Q B;  4QCL A;  4RHS A;  4K8J A;  2ZT9 C;  5CV5 A;  5DAU A;  1PRT F;  2L11 A;  1B9N A;  5ELE A;  1LTT D;  1DOM A;  1CA6 A;  2L12 A;  4TQU S;  2NUC A;  1I4Q A;  3A8I E;  2IX1 A;  2L5T A;  4ZKB B;  2IW3 A;  3D31 A;  5JVH 3;  2R93 B;  1B4O A;  1SBB B;  4HMI A;  4F7X A;  1SYF A;  5C4J B;  3A8J E;  5C4X B;  1TY2 A;  1SYG A;  4K6L A;  1VDZ A;  3NWT A;  2RDF A;  2PPB C;  2F0S A;  1D5X C;  1Y1W B;  2AWO A;  4F88 A;  1RKN A;  3NXW A;  5EJW A;  1CFM A;  1PZI D;  2FMM A;  5CC4 A;  4WOR A;  1UEA B;  2CHB D;  5FK9 C;  3MAQ A;  1PZK D;  1YNN D;  2ZXO A;  3W3A A;  3BVZ A;  1GXD C;  2K03 A;  1DCZ A;  2D62 A;  1YNN C;  1CHQ D;  4LK1 C;  1RTO A;  3IKJ A;  5T1G A;  1SMY D;  2JA6 B;  2BDO A;  2EYH A;  3BVG A;  5COR A;  5CBA E;  5KYL A;  1F2L A;  2QIL A;  2L4N A;  1EZ6 A;  3L9A X;  3T4A C;  1F9P A;  1SMY C;  5ELB A;  4ID6 A;  2M9V A;  1VF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...