2B2VC

Crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 20
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vC00
4X3UA 1RTNA 2HDMA 2EOTA 5EKIA 4ZAIA 5T1IA 1WTPA 1CA5A 1B3AA 5EPKA 2B2YA 2DY7A 2FHTA 5COYA 1NAPA 1ML0D 1VMPA 3G7LA 3R93A 1PFNA 1GUWA 1QNKA 3I3CA 1IKMA 4XT1B 5E4XA 5CBAE 4IURA 4ZKBB 2MP1A 1X3QA 1M8AA 2Q8TA 1RODA 2K1BA 2RA4A 4IUUA 1IKLA 3I91A 2MGSA 3DEOA 1EIGA 1EIHA 1U4RA 2B2YC 2XIWA 1O7ZA 2KVMA 4QUFA 5DNFA 1U4MA 3I8ZA 1WTOA 1ILPA 1Q3LA 4OIKA 1B50A 1ILQA 1MSGA 1AZPA 1PFMA 4DN4M 1O7YA 1NCVA 2NWGA 1QE6A 3Q6SA 4IUPA 1HUMA 1SSOA 2N55A 3SVMA 2DY8A 1WTQA 1B4OA 4MN3A 5D65A 1JE4A 3MTSA 2HCCA 4RAUC 2MPMA 5EPJA 1HFNA 2D9UA 2SDFA 3IFDA 2J7ZA 1MGSA 1BNZA 4CJ1B 1CA6A 4HEDA 1B2TA 2K28A 2FMMA 1S4ZA 1DOLA 1B53A 2B2UA 2FFKB 2KOLA 2K01A 4IUTA 1XX8A 1TVXA 2EPBA 2X6GA 5T1GA 1BO0A 3UI2A 4O42A 1DONA 1WTXA 3GV3A 1O80A 3MWYW 5EQ0A 2Q8RE 2NYZD 1KNEA 2VXWA 4R9WA 1PFBA 3IL8A 2HCIA 1BBXC 1F2LA 3D6WA 2BDNA 4XDXA 2B2TC 4XT3B 1RJTA 1WVLA 3KUPA 1X3PA 1G6ZA 2B2WC 1WD0A 2MJ8A 2L1BA 1RHPA 2RSOA 5E4WC 2K03A 3HP3A 3TN2A 1F9QA 5CBEE 3N52A 1ZXTA 3I90A 4R8IA 2RSNA 1NR2A 4QUCA 3H91A 2KEDA 2KUMA 3GV6A 2KEEA 2X6LA 1J9OA 2L4NA 4CJ2C 4ZLTF 1EQTA 2B2VC 2IL8A 5JJZA 1G2TA 4IUVA 5EPLA 3TZDA 1HA6A 1JICA 1HUNA 2JP1A 2L9HA 1WTWA 4ZK9B 2KECA 2N88A 1AP0A 1DZ1A 1WTRA 2K05A 3DM1A 3FPUB 1LV9A 4MHEA 1WTVA 1KNAA 2HUGA 3LWEA 4X3TA 1NR4A 1G2SA 1SAPA 1WD1A 2FJ2A 2HDLA 2JYOA 4X3SA 2R3ZA 1DOMA 1X32A 2B2VA 3QO2A 3KBXA 5AFWA 2B2UC 3P7JA 1F9PA 4UAIA 1XYIA 1CM9A 1MI2A 4ZKCB 2H1EA 1ESRA 4NW2A 5CORA 1HRJA 1U4LA 3ONAB 1VMCA 4IUQA 5EJWA 4CJ0B 1G91A 2B2WA 3DEPA 1SDFA 2CVRA 4U68A 1MSHA 3FDTA 1IL8A 1RTOA 2B2TA 3F2UA 1HFGA 1QG7A 5CMDA 2M2LA 1E0BA 1PDQA 1EOTA 2NZ1D 4LMQD 1PLFA 1A15A 1F9SA 1J8IA 2L11A 4X3KA 1EL0A 4HAEA 4RA8A 4RWSC 1BF4A 2EE1A 2X69A 1U4PA 2K04A 2L12A 1F9RA 1C8CA 5D14A 4OIJA 1DOKA 4HCSA 1AZQA 2FINB 2RVLA 1ICWA 1HHVA 4HSVA
chains in the Genus database with same CATH superfamily
4FDBA 5EKKA 3TSSA 4IPHA 5LMUQ 1UNSA 1VQ7A 3GP7A 1DXMA 1ASZA 2P5ZX 3J81j 4NKLA 5IYCH 2E2IH 3UDGA 4FF2A 1GUWA 4B3SL 1HNXQ 1YHQA 1SMXA 3HOXH 3I3CA 1C0AA 2EYJA 5ELDA 3R2IA 2N8NA 3TS0A 1A2TA 1JE5A 3E6ZX 3S17H 3NWTA 5BN4A 4DR3Q 2RHSB 5LMNQ 1B50A 4B3TQ 2F0PA 3E0EA 3CC7A 1VF7A 3X3MA 1PYBA 3K80C 3T1HL 1SE2A 2I5LX 4KJNA 3CPFA 1JWMD 5IODA 3V96A 1OXUA 2J7ZA 3A5ZB 2FXQA 5M9OA 2EXZA 1BCPD 3D4DA 1HR0Q 1QB5D 4CDCC 4QMGA 2KENA 1JJ2A 1CQFA 4HMIA 1YNXA 2VXWA 2LXKA 3T51B 2JN4A 4IQZA 4AQYL 2IX0A 3VR3A 1B1ZA 4DXFA 3G6JB 1KIXA 4CDDC 3HOZH 1VF5C 1MKHA 1Y1WH 2K5WA 4IPCA 4DV2L 4DV1Q 1LTSD 3E9IA 3EIVA 4K2KA 4QUCA 4P2CB 2KUMA 3GTLH 4A3EH 4KI0A 2E5LQ 1I6HB 5I4DA 2JA5H 2KBNA 3VYSA 1EWIA 4LFCQ 1X3EA 3H15A 2OTLA 1PRTB 5LHY1 1JR0D 5C4HA 3HKZE 4ID6A 5CC4A 4ZUIA 1RIPA 3D8GA 2BE5D 4P73A 4GN3B 1IBLQ 4RGNA 4CDEC 3QO2A 4C3JH 1BOSA 2B2UC 3P7JA 4DR4Q 4BBSG 2VQFQ 4EQPA 2BH8A 5FOBB 3NUCA 4JI5L 3SEBA 3F2UA 1K3BC 1H9KA 3NEMA 1JT8A 2NZ1D 4RFBA 2PO4A 1J8IA 1TQOA 4KKTA 2AKWB 3QOJA 5ELBA 2JE6I 2L12A 3C1FA 5M3FG 1JCKB 3B6YA 4OIJA 4GKJL 1A3TA 4HCSA 1RKNA 1IHZA 4JI1L 1JB7A 1K8OA 4IFDH 2Z1CA 4G57A 5E4WC 1H9SB 1VQOA 3I4MH 1HZBA 2E2HB 4YWMA 2B8GA 1LTBD 1EFID 1PRTC 1BVSA 1VQEA 3SR1A 4CHTB 3HOYB 4IUUA 5KIXA 4IJHA 5CGKA 4IOAA 4XTCS 3CCLA 3I8ZA 1GD7A 3PIO3 2EDGA 1YNJC 3HOUG 2OTJA 3VR4A 4LF8Q 3ND9A 1HZCA 4WORA 1SE4A 4GN4B 4MN3A 1TWFB 4RAUC 5FLMG 2NVTH 4XXEA 2N78A 1L0WA 4JI3L 3ND8A 1ENFA 3Q0AA 4A3CG 4XIGS 4EQ5A 1S3OA 1BO0A 1D1KA 3BYTB 5A2QE 4AYBE 5I2XA 2JA6H 3SK8A 3BG3A 1A62A 3PIPA 3M4YA 1XMOQ 3UDIA 1PMRA 1UAPA 1F2LA 4XDXA 2VNUD 1O7IA 2B2TC 1RJTA 2CKZB 2B2WC 3RMHA 3S16H 2G9DA 3P75A 2WV6D 2MO0A 1TS2A 4A3IH 5ELOA 1U0LA 2EVBA 3HKZG 5IYDH 1EZ6A 4IUVA 2EYLA 4DA2A 3OSOA 2F3IA 4DR5Q 1TR5A 2F0MA 1YNND 4K5XA 4MHEA 5HY6A 2YTVA 4DAVA 5M3FH 3GTKB 1PA6A 1J5EL 1IXRA 1LYLA 3BU2A 2UXDL 4LUVA 1D5MC 2K75A 3AQQA 2ICIA 4IN3A 4A3KB 2CCZA 1MI2A 3BVMA 3BDOA 2OF1A 3CCSA 2AQ3B 5J39A 3J81c 2EJGC 3S24A 1Y1VG 1BR9A 1SR3A 4RMFA 5C44G 4QQBX 3D0FA 3NBIA 1Z9FA 1I4PA 2E2IB 4DNRB 4B3RL 1PYWD 3NTIA 1TS5A 1HJPA 1A3UA 2IHFA 2F3WA 3CU7A 4HMJA 4FNFA 1D7QA 1N34L 4K0KL 2C5CA 2F0FA 3CAMA 1IKMA 4BY7B 1XXGA 1SJED 4PZ6A 5EAYA 4LK1C 4KHPL 5GROA 3LX0A 4MNOA 3K81C 2EY6A 1ICFB 1STGA 2VW9A 1J6QA 3TP7A 1PZJD 1R9TH 3ITPA 4OL7A 1PV4A 2F52A 3EVQA 1SSOA 1FNUA 4FXGC 4R4IA 5J1ZA 4Y7NB 2PMZB 4L6TB 2UUAL 4OWWB 1MGSA 2XRQD 4CJ1B 3H0GB 2A8VA 4JI8Q 2O2LD 1NNXA 3K7AH 1W3SA 1WJJA 3AU7A 1S5DD 1IBKQ 1O80A 2D0PA 4A3MB 2Q8RE 2NYZD 4LUOA 4S3SA 1SROA 1TIID 3TZUA 1PH9A 1WVLA 3PO3G 5JEAH 1CK1A 4J8QA 3I72A 1G6ZA 1VQ4A 4OX9L 1YEZA 3HP3A 5CBEE 2EY1A 3RUZA 4DUYL 4RHSA 4POGA 1CKOA 2XVSA 1EWCA 4FO2A 1V1QA 3VYUA 3M7NA 1X56A 1YHBA 5M5YH 2NVYB 1HUNA 4IOCA 2KCCA 2A69C 4WFN3 3QWNA 2UUBL 4Y7NH 1N32L 2ZJRA 2K4KA 1K28A 4C2MH 3J81i 4XYOA 3PUVA 5D3DA 3C1EA 1MD2D 1I50B 5IP9H 4PNYA 4FXKC 3BVGA 3RLNA 2MUYA 4ZKCB 3CP0A 1B70B 4ZQ3A 3T13A 1HRJA 1IL8A 1XMQL 3MVVA 2XWBB 1CHQD 3S14B 3PGZA 1HCZA 5L37A 3PF4A 4KKSA 2KHIA 1SBBB 1A2UA 2RBMA 3HZXA 2E76C 5I6WA 4A3BB 1EIFA 1RTNA 4A3IG 1EQQA 1C4QA 5DAUA 2UXCQ 2WB1E 1NAPA 1U5KA 2K50A 3NTKA 2B8FA 2BE5C 2F0QA 2OWOA 2PW5A 4QIWB 1PH3A 4KJOA 1T9HA 4LF9L 1H9JA 1KQSA 1N32Q 2A1AA 4GOPB 2UUBQ 3JAMi 1GOZA 5KYLA 2IX1A 2JJQA 1I4GA 3JAME 1VQ5A 3KJPA 1SNQA 2Q2HA 4YCVA 1B4OA 1I6VC 1X6OA 3PF5A 1STBA 2VB2X 1QVFA 1BUVT 2QDLA 1EY8A 3GTGB 1QWYA 2K28A 2B2UA 4A3DB 2ZT9C 2WAQG 4BA1I 4YHHL 1EY9A 1GUNA 1H9RA 4HJAA 4FVMA 4K6DA 4A3EG 4XQQA 1NE3A 2MO1A 1IW7D 1K0RA 4DV4L 1DD2A 3QOLA 2JA6B 1JC7A 4YY3L 1F9QA 4IZ8A 3I90A 5F2DA 3E0JA 3PO3B 4C3JB 1V9PA 4O0AA 5IT9c 4L5SA 3J7AF 2Z6KA 1E2ZA 1C9OA 2K52A 4UY8C 3A5UA 1YI2A 3HOVG 2N88A 4RH6A 3W1GA 1STNA 3VA7A 1K8MA 3S1MH 4HTHA 1W6KA 4X3TA 1JJCB 4B08A 2PQEA 5FKAC 2F3VA 2CHBD 5AFWA 1XYIA 3GDEA 5IE8A 5C44H 3S15B 4DK0A 5EGTA 3ER0A 3FDTA 3RD4A 4E6IA 1HFGA 1PDQA 1HZ9A 5D3IB 1GKHA 1VQNA 2R7ZG 4X3KA 4QL5A 1TWCB 3MZ5A 3W5OA 1WYDA 3Q8DA 1F9RA 2PQAB 4J6HA 3SDZA 1SFOB 3BDLA 3CCEA 3VA5A 1STEA 2YYZA 1WTPA 5EKIA 3J81L 4DXGA 1B3AA 1XPUA 2XSCA 2R92B 3AEVA 1XPOA 2WFWA 1NMFA 1CKNA 1QNKA 2EYPA 5I6YA 2QEXA 3M7GA 4A3JB 4YWLA 2PYKA 2QILA 1J5EQ 3WDNA 4LF7Q 3S15H 1SNPA 3SK4A 1UE6A 2EJMA 1TWGH 4IUNA 5C44B 1P8LA 4JYAQ 1QILA 2NZOA 3RZDB 1NCVA 1GJXA 2PCFB 2HHHQ 2N49A 1WCMB 4KN7C 4X65Q 4H02A 1QOHA 4HCEA 5JPNC 1BCPB 4F88A 3VYTA 2PMZE 4Q5VA 3HG9A 1N33Q 4X64L 2XN9C 1XTCD 1SE3A 3KLWA 2F0JA 1HHVA 5C5LA 1B53A 4N9PA 5DM73 4PMBA 4DKAC 4C3HB 1XMOL 4FP5D 4TVAB 2NN6I 4A3MG 3WOFA 3FEWX 1EU3A 1VQHA 3KJOA 3RR5A 2HCIA 1BBXC 2ZM6L 4X66Q 2Q2TA 2CH4W 4KTAA 3CQZB 2C35B 2K03A 4LF5L 1AE3A 3VR2A 4DAYB 4K14A 4NP5A 4X6AH 4R4QA 2F0NA 2RSNA 1TWGB 5GADC 2F0DA 4A3KH 4LUZA 1EQTA 1IL2A 2AHOB 3A0JA 4JBWA 1NBWA 1XPRA 1EUJA 4HIDA 4LF6Q 1Q90A 3FVQA 1EIYB 1CTMA 1WI5A 3DM1A 3FPUB 3M4QA 1HNWL 4F7XA 2B63G 1HH2P 4A93H 5AJ3Q 1SAPA 2WINB 5AJ3L 1SMYD 3OTOQ 1Z47A 4Z9CB 1FL0A 5E1FA 2LS01 1A3VA 1SYCA 3QR8A 4HIKA 5C4ZA 1UE5A 1U9RA 3Q22A 3FRPB 5C3XA 4C3HG 1N36L 3D3RA 4KD3A 4AH6A 3U9OA 4BBRG 5CV5A 4FF3A 1KAWA 1T5EA 2JA9A 1MJCA 2HT1A 1KTKA 4A3IB 3C2PA 3H0GH 2Z6BA 5A2QL 4HJ5A 4KY7A 3T1YL 4DR2L 4X64Q 1LLRD 3EROA 1XTDA 3BZDB 1M90C 4QIWE 1JOKA 2C9OA 3P1HA 2G5DA 4Q0FA 1OXSC 3P20A 4EQNA 4LAAA 4HN7A 3MXNB 2KHSA 1B9MA 1HQMC 3OOCA 4O2DA 1CQVA 4JYAL 1HFNA 1CZWA 3F2DA 1PH6A 4DV1L 1BNZA 1E24A 1HZAA 5C4JB 5M3MH 1HXYD 4H13C 2OCEA 4IFDJ 5BR8L 1BBUA 2KCMA 3CCJA 1AH9A 2X6GA 3DWAA 1LT6D 1F2MA 3C3LA 1UE7A 5EQ0A 1HR0L 1MBYA 3HFZB 2VQEQ 3IKJA 3FKIG 4DV5Q 2YTYA 1MJEA 3RZDH 2DN8A 2AMCB 5IGGA 2JA5G 3CF5A 4CJ2C 3KLRA 2EIFA 4B3TL 3NQTA 1Q8KA 3CQZH 4LNQA 1STYA 3CMEA 1TU2B 2A6HC 4HIMA 1EFWA 2B2VA 3KBXA 3KK7A 4A3EB 3KLSX 4KD4A 4MTKA 3OYYA 3G6EA 4B3SQ 3K0YA 4WJ4A 3CCRA 2LFNA 4IUQA 4IPDA 1U4LA 1GUSA 4XQNA 5FLXc 3NE5B 5LMUL 2NVTB 1LTGD 1E0BA 1YJWA 3GTOB 2Z9HA 3RZOB 1B3QA 1EL0A 1TT2A 5M5WB 1LM0A 2PNHA 1C8CA 4DV4Q 3PQIA 3L9AX 4CKEA 1Q1EA 1B44D 2OQ0A 4QF4A 3AMUA 3A8IE 1N9WA 2R6GA 3OWEB 3RLFA 4ILWA 3I56A 2M9VA 4A93G 3ULLA 4YHHQ 4TSSA 2QA4A 5IYDG 4K5WA 5IGCA 1IBMQ 4JI0L 2F03A 1V1PB 1FVIA 3GQBA 1VCIA 2KQ3A 2B2YC 3HOWH 1LUZA 3BVZA 1ZYRD 3I4MB 1SLJA 1Q8IA 2RF4A 4DK1A 2BOSA 4A3GB 1SEBD 1UEAB 1JJGA 3PUYA 3NSWA 3NBHB 1PTOF 2DY8A 2ES2A 2L0CA 2SDFA 4FYDA 2JQOA 4C3IG 1CA6A 2GN5A 4BXXH 5JJKA 2OT2A 4GS3A 3MA2B 1PRTF 2LMCB 1XWEA 1XX8A 2VQEL 5C3EG 1FD7D 3CD6A 1DONA 1WTXA 5M5XH 1TXYA 2K14A 4OEMB 3A74A 2NUCA 4K2LA 4C1NI 3RLOA 4BY7H 5BR8Q 3KUPA 1X3PA 2WKCA 2JA7G 3V05A 1I94Q 1WTHA 1HTPA 2UXBQ 3I4NG 1G51A 2RHQB 1I6HH 4JG2A 4YCWA 2KEEA 2X6LA 3HOYG 1NTGA 4A76A 2WIIB 4FF1A 2WB1G 3QB3A 4I65A 2K5VA 2L9HA 4KY6A 1X9NA 3S16B 1WTRA 5IY0A 1LTAD 1YJ9A 2E74C 1DCZA 1TS4A 3M9BA 3S9WA 3JC66 1G2SA 1SYDA 2CQOA 2B29A 3H0GG 2F0KA 2HDLA 4X3SA 4P71A 2AQ1B 1X32A 2B3GA 3F8TA 5M5XB 2CW0C 1ASYA 1F9PA 3U4VA 3M3YH 1TS3A 3PV0A 5C4XH 2AUKA 3Q24A 5IWAQ 2B39A 5E7NA 2FMCA 5DEHA 3OIPA 4HAEA 3T16A 3ERSX 3ULPA 1N36Q 1U4PA 1RCVD 3F2CA 4LWCA 3DEOA 1EY5A 3AFPA 2ZTDA 2RKSA 4RKBA 4X3UA 5EBDA 1YNNC 1H9MA 2IHEA 5COYA 3KOJA 1IBKL 4KV6A 4GLXA 3G48A 3M4PA 2F1MA 4K5VA 2VY3A 2A69D 4IURA 1X3QA 2ATWA 3R8BA 2K1BA 2RA4A 3DHQA 4JC0A 3TP8A 5K36G 1E2VA 2CH4A 4KY5A 1K83B 3N6RA 4F87A 5NUCA 1Q3LA 4LF6L 5FJ8G 3CRKC 1SXTA 2QW7A 4GKKL 3PIP3 2E2JH 5EBCA 4L5QA 3CXCA 2JXMB 1Y1VH 4UPAA 3I73A 1I4HA 3IFDA 4WJWA 1G291 1Z6HA 5EPJA 4EQOA 4LF5Q 3OPOA 3CC4A 4CGYB 2JA6G 1B2TA 5ELNA 4DAMA 1EIHA 5KEEA 2ZM6Q 1CUKA 1QNUA 1TVXA 3NPPA 4DV7Q 4DR1L 4O42A 5FLXL 3K58A 5M3MB 1XNQL 3MWYW 1KABA 1CT1D 2RDHA 1HA5A 1RF2D 5FO8B 5GQOA 2JA8G 3QG1A 1D8LA 1X3FA 1GM5A 2JSOA 1A63A 1EU4A 4A3KG 1K9MC 3MC0B 3D6WA 5C3EB 4A75A 1I4RA 2EZVA 4A3DG 3DWQA 2TMPA 1VQBA 2MJ8A 1N33L 3VR6A 1LO5D 2NBFA 3VYRA 1OXXK 4B3ML 2B63H 2MHVA 1VQ6A 2BA0A 1SNMA 2L4NA 4YCUA 2QDBA 2HHHL 3OWFA 2B2VC 2F0GA 2JA8B 4DV3L 1FGBD 4APVA 4LFBL 2Q8IB 1BDOA 3J81E 3CC2A 3MAQA 5KRUA 5ELCA 1GHJA 5ELEA 2E2HH 1IYJB 5KNBA 3CCQA 2ASBA 4NDXA 1EYCA 3TRZA 4A3DH 1EYGA 2PI2E 3S17B 1ESRA 3ONAB 4LFBQ 1CSPA 1G91A 4U68A 2F0LA 4DV3Q 1JOQA 3U9SA 3H09A 2CFMA 1A15A 4OO1I 4B3MQ 3K5LA 4RA8A 5G3LF 2K04A 2NTTA 3NTHA 3WOEA 4ZYSA 4GLAC 4HSVA 3TMEA 2G9HD 4H44C 2R61A 2D0OA 2A6ED 2VUMH 3J80c 4CDFC 2YU9B 3E3XA 1QZGA 1OXTA 3MXUA 4RGOS 1XNQQ 2DGYA 4DR1Q 2RCFA 4DV7L 4ZKBB 1PZKD 4QB4A 1R9TB 1EYDA 2IY5B 1IKLA 4GN5A 1EIGA 3PO2B 1Y1WG 1DGSA 3AFQA 1NJIC 2PW7A 4OIKA 2IT1A 4EGVA 1W2BA 1FGUA 5JAVA 3Q6SA 4LF8L 3LWUA 1KDAA 2K33A 5IGDA 1RDPD 2D9UA 3K5MA 2R93B 1KRSA 1FNVA 5FJ8H 2VUMB 1S4ZA 2KOLA 5FO7B 5T1GA 1UEBA 3GV3A 1F77A 3L3OC 3R2TA 3NP8A 3IL8A 4JI1Q 3STBD 1WD0A 1X3GA 4LFAL 3W3AA 2NVYH 3I4MG 4PZ8A 5JJLA 4XQJA 1ENCA 4KHVA 4PZ7A 1B8AA 3HOVH 1JOOA 1HA6A 1BXTA 5K5PA 2Q2UA 1L0XB 1VQCA 1KRTA 4DR4L 1JB3A 4C3IB 2I46A 4J15A 4GNXA 2YTXA 4ZRZA 3H94A 1BCPF 4IJLA 4ME3A 1PXUA 2KCNA 2A74C 4C3HH 4BY7G 5C4JH 4UAIA 2F0SA 3ZYYX 2UXCL 3A55A 4CJ0B 2B2WA 3DEPA 1SDFA 3TDQA 5HURA 4BXXG 3DM3A 3I7FA 5CMDA 2E5LL 2LSSA 4LMQD 3J80i 3ZJYC 1STAA 1NUCA 2JK8A 1LACA 1BF4A 5C4XB 3STBC 3GTLB 4DV2Q 1PRTD 2A6HD 1QZHA 3SXHA 3I70A 1LT5D 1YNJD 4P75A 5JVH3 2HD3A 4V0BA 3I4NH 4MTNA 2LXJA 1EYAA 3S2DH 1KAAA 3R93A 4OWTB 5E4XA 2ZXOA 4M8AA 2O4XA 4UP7A 1VQIA 5IYCG 2MGSA 1JQYD 1C48A 1IW7C 2EXDA 1C7YA 4QUFA 4A3FG 1LTRD 1FYCA 2AWOA 2PNRC 2K7VA 1V43A 1ZEQX 2F0EA 5IOCA 3T1HQ 1YJNA 1ILQA 4L5TA 3A7AB 4GNXC 3TEHB 2KCTA 1QE6A 1VDZA 3I55A 1VQJA 1SE8A 3IFTA 4DUYQ 1Q82C 2O5JC 5C3WA 4LF4Q 4ODGA 1MIUA 4NXNL 4ULLA 1G6PA 2N3SA 1WCMG 3FMCA 1QVGA 2K01A 3FHWA 1CKMA 2EPBA 1IBML 4JPBW 3EFXD 2YV5A 5GAGC 3H3VI 4GZYC 4L8JA 3HKSA 1PH8A 2K5QA 1GO3E 4A4IA 1PH2A 1A0IA 2A73B 5IT9E 2F0VA 3X3NA 5H1SE 3NWSA 1SJHD 4BBSB 3TN2A 3K7UC 2O5IC 2ZTEA 2SEBD 4R4CA 1B7YB 1NR2A 1AE2A 4OXPA 2KEDA 3CCMA 5IYBH 4JBMA 1LT3D 2JEBI 4DNTB 1GVPA 1DZ1A 2CW0D 4H0LC 5CYUA 4EX5A 1KNAA 4JV5L 3U50C 2MNAA 3LWEA 2EYOA 4KHPQ 2IPKD 2F0IA 2JA8H 5CV7A 3S1RB 5GAEC 1PHJA 4JI4Q 4A3BH 3SGIA 4KKUA 3S2HH 1EQRA 4IALA 1N8RC 1W6JA 1VMCA 5EJWA 4RGMA 2PI2A 1N34Q 1IYUA 1TWFH 1RTOA 4JOIC 5IGBA 1Y8PB 2L55A 4JK1C 2Y0SE 3L2PA 1FJGL 3H3VH 2YU9H 2R92H 1QUQA 1O78A 1WFQA 4DV5L 4RG1A 2F0WA 4PMCA 5C5MA 1TY0A 1SNCA 3K57A 3TBIB 4P74A 4G7ZC 1L0YB 1PFNA 1EY6A 3BJUA 2VS1A 4ME5A 1RODA 2IW3A 2UXDQ 1S40A 3J7AV 3KF6B 4OELB 5DNFA 3A8JE 3M85A 3J80L 1AZPA 3OMGA 1O7YA 2NB0A 2HIXA 3J80E 5ELFA 3K0XA 2PZTA 4N8X1 4AYBG 1WTQA 2R93H 5D65A 3PSIA 1ZYRC 5C3EH 1D2BA 3SE0A 5M3MG 4X62Q 3EJIA 1K3RA 3GTMB 3MXPA 3SK5A 3KF6A 3KDFB 2JA7B 4DR2Q 1YZ6A 3T1YQ 2B63B 4CBVA 2QGQA 4A3GG 4MIUA 4DR6L 1I50H 2CWAA 1PTOC 1SMYC 1VS0A 1KNEA 3UDFA 1PFBA 1Y1WB 1EEID 4OWXB 3CKIB 1CHPD 1KLGD 2BDNA 3BYYB 4KLKA 3HOUB 1B9NA 2NN6G 3MEHA 3NELA 4JI3Q 1F2YA 2SNMA 3A7LA 1UE1A 2XTIA 1QUQB 3H91A 1L2FA 4NXML 1NMGA 1GHKA 4P72A 2ZJQA 4ZK9B 2K05A 1RL2A 1K73C 5JOBA 3OTOL 1K0SA 2E2JB 3G4SA 4IO9A 1I3QH 2FJ2A 2A68C 2JA7H 5KNDA 3V2TA 1HNWQ 3W2DA 3GTGH 2AWNA 2H1EA 4L5RC 4DV0L 1BQQT 4JI7Q 3I2ZA 3TP6A 4GNXB 4N8FA 4B9XA 1PLFA 3JAML 1AEXA 1F9SA 2Z8LA 4CKBA 3HOWG 2R7DA 3GO5A 1BKBA 1TWAB 3HOXB 4A3LH 3I4NB 1BCPC 2PZUA 5D14A 1DOKA 5GAHC 4X66L 2DJGC 2OXPA 1VQGA 2EOTA 4XYQA 5LL6X 2B2YA 1DM0B 1SNOA 4KHZA 2A5HA 1KLUD 1CZGA 1VMPA 2GVBA 2MFIA 1EY0A 3UDXA 5ISRA 5C0XI 1A6XA 4IFDG 1EEFD 4XT1B 1SYBA 2F0TA 3KFUA 3S2DB 4WJ3M 5E3FA 3FPPA 3S1MB 1ET9A 2DNEA 2ENBA 5C0XJ 1E22A 2XIWA 3HGBA 4R8NA 1T5XD 4N9TA 3PO3H 2A68D 4PMWA 4X65L 3SHLA 4RKLA 3S14H 4IUPA 1HNZL 1I4QA 2TSSA 4TKOB 2K5NA 2EY5A 2SNSA 4LF7L 3S1QB 3L7ZC 2FMMA 1CI3M 1DOLA 1RD9D 3CPWA 2ZTCA 4AQYQ 3URYA 2NVQH 2BA1A 4DK3C 4DV6L 1VQAA 1S5ED 4BBSH 4C56C 4H7BA 4DFAA 1X54A 3LNNA 4DGZA 4X62L 3N52A 4JI2Q 5DM63 4I7AA 2UU9L 3ERQA 2WAQB 4K8IA 3TP5A 2EYHA 4YWKA 3RN2A 2NN6H 5IIFA 1ENAA 1JORA 5LMNL 3DLLA 3HOZG 4DR3L 3TREA 1L1OC 3VR5A 1E7ZA 4ALPA 3HOXG 3MFGA 3BDCA 5LL6S 2L15A 3EBEA 3PUWA 4HSPA 2RDFA 2EJFC 4IPGA 2HIVA 2R3ZA 2Y0SG 4TRDA 1ONLA 3GTJH 1KDBA 3K5NA 1YVCA 5KGUA 1V1OA 1VQ8A 4KN4C 3U58A 3NK9A 4PV1C 1UUPA 4G4KA 4I7ZC 3RN5A 4KK7A 2B2TA 1DJRD 2D2CC 3S1NB 5M5WH 1SRUA 5C6AA 5IGEA 1FNWA 4UP9A 4V190 2IWHA 4LW1A 4RWSC 4YY3Q 2Y0SB 3M3YB 4FF4A 2SOBA 5CV6A 2E8GA 1X55A 1SN8A 1L1OB 1ML0D 3G7LA 3WWVA 1OO9B 3GTQH 2J4XA 2WB1B 3M4OH 3J7ZC 1YHAA 3E9HA 1M8AA 3MHBA 1Y69U 3I91A 4F8MA 2M00A 1U4RA 4JV5Q 1PVOA 2KVMA 5JVG3 1U4MA 1FR3A 4DU9A 1MSGA 2R92G 1BBWA 2BCOA 1QCBD 2DJFC 4GLVB 3T4AC 2F4VL 5G3LD 4JI6L 4A3BG 3MTSA 2MPMA 4A3CH 3CCUA 2EQSA 3PO2G 3IRBA 1II3A 4A3MH 4LF9Q 1M1KC 1OTCA 3J7A5 1XJVA 2DUDA 5FK9C 3CW2C 4JBJA 1Q81C 2K32A 3UI2A 1PYSB 5IGFA 1S72A 3KBGA 1I5FA 3PIOA 2I0QA 3K6OA 1I4XA 2K5DA 4JBKA 2L5TA 3JAMc 3HOUH 2Q2IA 5CR3A 1AW7A 4XT3B 3H3VC 3FKIB 3M4OB 3PUZA 5JEAJ 2V1CC 4LJZC 4BY1B 5IT9L 1Q46A 1RHPA 4NXNQ 1DYQA 4LF4L 3TS2A 2WAQE 4R8IA 1UWVA 3GV6A 1J9OA 1KD1C 2Z4HA 1G2TA 3ULJA 1XMQQ 4A3LG 1V8QA 1HPCA 4KMUC 1WTWA 4U673 1JMCA 2ZJPA 1WTVA 3GTOH 2Z4IA 3OW2A 3IAYA 1H95A 2F0OA 1D1IA 2CWPA 2VB3X 3GD7A 4DPGA 3F2BA 1Q86C 1CSQA 5EKLA 1CM9A 4JVZA 1EWHA 1PZID 2BH2A 1E2WA 1MSHA 1VQPA 1MHWC 2M2LA 4TQUS 4B9WA 1EOTA 3A54A 4M1UB 4HJ7A 4IFDI 3NHHA 1E3PA 2L11A 3D4WA 1GUGA 1STHA 1SNDA 2D62A 4OX9Q 3OW7A 3HOVB 3O13A 2EY2A 2FINB 4NB3A 5KNCA 1VQDA 3NXWA 1NSNS 2OEOA 2HDMA 5T1IA 4G7HC 1VQKA 1Y8OB 2DY7A 3GTMH 3FKIH 2JEAI 1EZ8A 4DR7Q 1L1OA 1Q7YC 2I5HA 4PQXA 2A6EC 2F0HA 4JI8L 4QCLA 3OIQA 1O7ZA 5JEAG 1AN8A 1EY7A 1WTOA 2UUAQ 1ILPA 4JI6Q 2F4VQ 2H5XA 1PH4A 4OO1G 1PFSA 3MXGA 5J22A 2N55A 4A93B 4A3JH 1JE4A 5JPMC 3GTPH 3OMCA 4LFAQ 5C4XG 4HEDA 4Y52H 1XNRQ 1LTTD 1S5FD 2NZHA 2NVQB 1H9SA 3DWPA 1Q12A 2RDGA 3FP9A 4UP8A 2GA4B 1AFPA 5CV8A 3S1QH 1I3QB 1D5ZC 4O1NA 4K0KQ 2E75C 2OQKA 4AIMA 5TSSA 2R7FA 2RSOA 5I9OA 4B3RQ 3D6CA 1LT4D 2ZXRA 1HR0W 2ZXPA 4ZUJA 4GOPC 1YITA 3K5OA 1PH1A 4DUZQ 4QY7A 4ABNA 1D6EC 5IP7H 1E1TA 5EPLA 3L0OA 4BBRH 2DNCA 3Q23A 4GOPA 2UUCL 4BY1H 2KECA 5C0XH 3HOZB 1EQVA 3PMFA 1LV9A 2RCNA 2K6AA 4C1NK 4FXDA 1SYFA 2XWJB 1S5CD 1HTLD 1WD1A 3CHBD 2NVXB 5DLQE 3MXNA 2JA5B 1JWSD 2NTSA 1IZ6A 5I9PA 3BS1A 3KF8A 2XRSD 3A56A 5BN5A 5A35A 3HOWB 1CFMA 4DR5L 3BZCA 3E5SA 1TY2A 4C3IH 1YBYA 1QG7A 3GTPB 2UU9Q 1D5XC 2QF7A 4JI2L 4ZCKA 4HJ8A 5JJIA 2WACA 2KJXA 1R4QB 4BS9A 5IYBG 3K7AB 1K83H 2F0UA 2PZWA 4OONA 1LTID 4L63B 3R3OA 3D4RA 2E2DC 2PPBC 5EPKA 3OHXC 1TWCH 4DV6Q 2IJ0A 5M3FB 3GTKH 4R4TA 4JOIA 3C46A 1OXVA 2LKVA 1ZKOA 3G71A 3S2HB 3K59A 3BZKA 2HQEA 2KHJA 2UUCQ 2K5HA 3HEJA 1Q1BA 1HNZQ 3UE0A 3PO2H 3QJYA 1HUMA 3SVMA 4DUZL 1PH5A 4DK6C 3EN2A 5LMNW 1WCMH 4RHRA 2XGTA 4RCNA 3NQIA 3MEFA 1NY4A 1QVCA 4NW2A 3UE1A 4QJFA 4IUTA 1Y8NB 1ESFA 2EYMA 1E1OA 4JW0A 5I2YA 2PQAA 1V1PA 1PH7A 1VQ9A 4DNIA 3CRLC 3KDFA 2J0TD 3RNUA 5IP7G 3RZOH 1ET6A 4C3JG 4UDUC 4A3FH 4BY1G 5C0XG 2IX3A 1XNRL 4GKJQ 3TQYA 3NBHA 4QGUA 3VDYA 4GKKQ 2IL8A 5JJZA 3TZDA 4JI5Q 4JI7L 3W1BA 4RGTA 5K36H 4DV0Q 1AP0A 2VQFL 3HKZB 4PG3A 2QEJC 1YIJA 2HUGA 1KHIA 1K8AC 1NR4A 1IBLL 3U4ZA 3D31A 2CQAA 2JYOA 4BA2I 3T56B 3HRZC 4DR7L 1R4PB 4A3GH 5HGQA 1SFOH 2ICEC 1PTOB 2R7ZB 4EVOA 3AB9A 2CVRA 4A3FB 4YIJA 4LFCL 1Z7TA 5HGTA 3MFYA 2AQ2B 2ALYB 4K6LA 1KDCA 4POFA 4NXMQ 3KYHC 3AYHB 3H6MA 2KA7A 1HQRD 1CKNB 5KYIA 1LTLA 2EE1A 4G7OC 4WRDA 2QKIC 1X65A 2VL6A 1TKWB 1O7LA 1ICWA 4A3JG 4ZAIA 2R93G 1CA5A 5IWAL 2I07B 4K8JA 4HR7B 2FHTA 1P16A 5FLXE 5CV9A 1IYVA 4DR6Q 3HOYH 2Z0SA 5CBAE 4NMZA 2I5MX 3DMUA 4C2MB 1QJOA 1KC8C 2MP1A 4RCOA 2Q8TA 2XNAC 4MZ9A 3DUZA 3PCOB 4CKCA 4HJ9A 2R7ZH 3CMAA 4OGQC 2ID0A 1TWHH 1VQLA 4OHJA 3F1ZA 1PFMA 2A19A 4DN4M 2NWGA 1WOCA 3J7YW 2QCPX 4JCVE 1Y14B 1SYGA 1TWAH 3LGJA 2H4OA 2HCCA 2MQHA 1LABA 2VZAA 3S1NH 1EY4A 3T53B 2UXBL 3ICEA 1I94L 1PTOH 1VQFA 1M4VA 2HQLA 4AYBB 2FFKB 3GTJB 3QIAA 5FLMH 2WKDA 1KL9A 1HNXL 4OO1H 1SYEA 4R4OA 5BN3A 4DF7A 4R9WA 2WP8J 1K8GA 1G8ZD 3SK6A 2L1BA 3EQLC 3HS0C 4BBRB 1VQMA 3KLSA 2V4DA 1ZXTA 1FJGQ 4UHVA 4ZLTF 2GVAA 1F2ZA 1GUOA 3A8KE 2AUJD 1KXLA 4NPSA 1JICA 2NVXH 2VUMG 2JP1A 4DAYA 3K8AA 4HIOA 3DXJC 4JI4L 3GTQB 1EOVA 4J1MA 4DAPA 1JWUD 1TWHB 2Z6KC 4JI0Q 1DOMA 1PTOD 3CCVA 3EA6A 2RQXA 2LY7A 4R1JA 3PUXA 5J3BA 3I4LA 5CORA 4BWGB 2F4IA 3S1RH 1S5BD 1Y1VB 3NENA 1A8VA 5IP9G 2BDOA 3I4OA 1GXDC 2D5DA 2X69A 5M5YB 3KF8B 2EYFA 5CV4A 5FO9B 1AZQA 2RVLA 1GUTA
chains in the Genus database with same CATH topology
3TSSA 5EKKA 1UNSA 3GP7A 1DXMA 4NKLA 4FF2A 1GUWA 3I3CA 2EYJA 5ELDA 3R2IA 1A2TA 3E6ZX 3NWTA 5BN4A 1B50A 2F0PA 1VF7A 3X3MA 1SE2A 4KJNA 1JWMD 5IODA 3V96A 1OXUA 2J7ZA 5M9OA 2EXZA 1BCPD 3D4DA 1QB5D 4QMGA 1CQFA 4HMIA 2VXWA 3T51B 4IQZA 2IX0A 3VR3A 1B1ZA 4DXFA 3G6JB 1VF5C 2K5WA 1LTSD 4K2KA 4QUCA 4P2CB 2KUMA 4KI0A 1I6HB 5I4DA 3VYSA 1PRTB 5LHY1 1JR0D 5C4HA 4ID6A 5CC4A 4ZUIA 3D8GA 2BE5D 4RGNA 3QO2A 1BOSA 2B2UC 3P7JA 4EQPA 5FOBB 3NUCA 3SEBA 3F2UA 1H9KA 2NZ1D 4RFBA 2PO4A 1J8IA 1TQOA 4KKTA 3QOJA 5ELBA 2JE6I 2L12A 3C1FA 1JCKB 4OIJA 1A3TA 4HCSA 1RKNA 1IHZA 1K8OA 4IFDH 2Z1CA 4G57A 5E4WC 1H9SB 2E2HB 2B8GA 1LTBD 1EFID 1PRTC 3SR1A 4CHTB 3HOYB 4IUUA 5KIXA 5CGKA 4XTCS 3I8ZA 3PIO3 2EDGA 1YNJC 3VR4A 3ND9A 4WORA 1SE4A 4MN3A 1TWFB 4RAUC 4XXEA 3ND8A 1ENFA 3Q0AA 4XIGS 1BO0A 1D1KA 3BYTB 5A2QE 5I2XA 3SK8A 3BG3A 3M4YA 1PMRA 1UAPA 1F2LA 4XDXA 2VNUD 2B2TC 1RJTA 2B2WC 3RMHA 2G9DA 3P75A 2WV6D 1TS2A 2EVBA 1EZ6A 4IUVA 2EYLA 4DA2A 3OSOA 1TR5A 2F0MA 1YNND 4K5XA 4MHEA 4DAVA 3GTKB 1D5MC 2ICIA 4IN3A 4A3KB 1MI2A 3BVMA 3BDOA 2OF1A 2AQ3B 5J39A 2EJGC 1BR9A 3NBIA 1I4PA 2E2IB 4DNRB 1PYWD 3NTIA 1TS5A 1A3UA 2F3WA 3CU7A 4HMJA 4FNFA 2C5CA 2F0FA 1IKMA 4BY7B 1XXGA 1SJED 4LK1C 3LX0A 2EY6A 1STGA 3TP7A 1PZJD 3ITPA 4OL7A 3EVQA 1SSOA 1FNUA 4FXGC 5J1ZA 4Y7NB 2PMZB 4L6TB 1MGSA 2XRQD 4CJ1B 3H0GB 2O2LD 3AU7A 1S5DD 1O80A 4A3MB 2Q8RE 2NYZD 4S3SA 3TZUA 1TIID 1WVLA 5JEAH 1CK1A 4J8QA 3I72A 1G6ZA 3HP3A 5CBEE 2EY1A 3RUZA 4RHSA 2XVSA 1EWCA 4FO2A 3VYUA 3M7NA 2NVYB 1HUNA 2KCCA 2A69C 4WFN3 3QWNA 4XYOA 3PUVA 5D3DA 3C1EA 1MD2D 1I50B 4PNYA 4FXKC 3BVGA 2MUYA 4ZKCB 4ZQ3A 3T13A 1HRJA 1IL8A 3MVVA 2XWBB 1CHQD 3S14B 1HCZA 2RVLA 4KKSA 1SBBB 1A2UA 2RBMA 3HZXA 2E76C 5I6WA 4A3BB 1RTNA 1C4QA 5DAUA 1NAPA 3NTKA 2B8FA 2BE5C 2F0QA 2PW5A 4QIWB 4KJOA 1H9JA 1GOZA 5KYLA 2IX1A 1I4GA 3JAME 1SNQA 1B4OA 1I6VC 1STBA 2VB2X 1BUVT 1EY8A 3GTGB 1QWYA 2K28A 2B2UA 4A3DB 2ZT9C 4BA1I 1EY9A 1GUNA 1H9RA 4FVMA 4K6DA 4XQQA 1IW7D 1DD2A 3QOLA 2JA6B 1JC7A 1F9QA 4IZ8A 3I90A 5F2DA 3E0JA 3PO3B 4C3JB 3J7AF 1E2ZA 2N88A 4RH6A 3VA7A 1STNA 1K8MA 4HTHA 1W6KA 4X3TA 4B08A 2PQEA 5FKAC 2F3VA 2CHBD 5AFWA 1XYIA 3S15B 4DK0A 5EGTA 3FDTA 3RD4A 4E6IA 1HFGA 1PDQA 5D3IB 4X3KA 1TWCB 3MZ5A 1F9RA 4J6HA 3SDZA 1SFOB 3BDLA 3VA5A 1STEA 2YYZA 1WTPA 5EKIA 3J81L 4DXGA 1B3AA 2XSCA 2R92B 1QNKA 2EYPA 5I6YA 3M7GA 4A3JB 2PYKA 2QILA 3WDNA 1SNPA 3SK4A 2EJMA 4IUNA 5C44B 1QILA 3RZDB 1NCVA 1GJXA 2PCFB 4KN7C 1WCMB 1QOHA 4HCEA 5JPNC 1BCPB 4F88A 3VYTA 4Q5VA 3HG9A 2XN9C 1XTCD 1SE3A 2F0JA 1HHVA 5C5LA 1B53A 4N9PA 5DM73 4PMBA 4C3HB 4FP5D 2NN6I 3WOFA 3FEWX 1EU3A 2HCIA 1BBXC 4KTAA 3CQZB 2K03A 3VR2A 4K14A 4NP5A 2F0NA 2RSNA 1TWGB 2F0DA 1EQTA 4JBWA 1Q90A 3FVQA 1CTMA 3DM1A 3FPUB 4F7XA 1SAPA 2WINB 1SMYD 1Z47A 4Z9CB 5E1FA 2LS01 1A3VA 1SYCA 5C4ZA 1U9RA 3Q22A 3FRPB 5C3XA 4C3HG 3D3RA 4KD3A 3U9OA 4FF3A 5CV5A 1T5EA 1KTKA 4A3IB 3C2PA 5A2QL 4KY7A 1LLRD 3EROA 3BZDB 1JOKA 2C9OA 3P1HA 4Q0FA 1OXSC 3P20A 4EQNA 4LAAA 4HN7A 2KHSA 1B9MA 1HQMC 3OOCA 1CQVA 1HFNA 1CZWA 1BNZA 5C4JB 1HXYD 4H13C 4IFDJ 2X6GA 3DWAA 1LT6D 1F2MA 3C3LA 5EQ0A 1MBYA 3IKJA 2DN8A 5IGGA 4CJ2C 3KLRA 3NQTA 1STYA 1TU2B 2A6HC 2B2VA 3KBXA 3KK7A 4A3EB 3KLSX 4KD4A 3K0YA 2LFNA 1U4LA 4IUQA 4XQNA 1GUSA 3NE5B 2NVTB 1LTGD 1E0BA 3GTOB 3RZOB 1EL0A 1TT2A 5M5WB 1C8CA 3L9AX 4CKEA 1Q1EA 3AMUA 1B44D 4QF4A 3A8IE 2R6GA 3OWEB 3RLFA 4ILWA 2M9VA 4TSSA 4K5WA 5IGCA 2F03A 1V1PB 3GQBA 1VCIA 2KQ3A 2B2YC 3BVZA 1ZYRD 3I4MB 1Q8IA 4DK1A 2BOSA 4A3GB 1SEBD 1UEAB 3PUYA 3NSWA 1PTOF 2DY8A 2L0CA 2SDFA 4FYDA 4C3IG 1CA6A 2OT2A 3MA2B 1PRTF 2LMCB 1XWEA 1XX8A 1FD7D 1DONA 1WTXA 2NUCA 4K2LA 4C1NI 3KUPA 1X3PA 2WKCA 3V05A 1HTPA 2KEEA 2X6LA 2WIIB 4FF1A 3QB3A 4I65A 2L9HA 4KY6A 3S16B 1WTRA 1LTAD 2E74C 1DCZA 1TS4A 3S9WA 1G2SA 1SYDA 2F0KA 2HDLA 4X3SA 2AQ1B 1X32A 5M5XB 2CW0C 1F9PA 1TS3A 3PV0A 3Q24A 2AUKA 2B39A 2FMCA 5DEHA 3OIPA 4HAEA 1U4PA 1RCVD 3DEOA 1EY5A 5EBDA 2RKSA 4RKBA 4X3UA 1YNNC 1H9MA 5COYA 4KV6A 2F1MA 4K5VA 2A69D 4IURA 1X3QA 3R8BA 2K1BA 2RA4A 3DHQA 3TP8A 5K36G 1E2VA 4KY5A 1K83B 3N6RA 4F87A 5NUCA 1Q3LA 3CRKC 1SXTA 3PIP3 5EBCA 2JXMB 5EPJA 1I4HA 3I73A 3IFDA 4WJWA 1G291 1Z6HA 4EQOA 3OPOA 4CGYB 1B2TA 1EIHA 5KEEA 1QNUA 1TVXA 3NPPA 4O42A 5FLXL 3K58A 5M3MB 3MWYW 1KABA 1CT1D 2RDHA 1HA5A 1RF2D 5FO8B 3QG1A 2JSOA 1EU4A 3MC0B 3D6WA 5C3EB 1I4RA 2EZVA 3DWQA 2TMPA 2MJ8A 3VR6A 1LO5D 2NBFA 3VYRA 1OXXK 2MHVA 2BA0A 1SNMA 2L4NA 2QDBA 3OWFA 2B2VC 2F0GA 2JA8B 1FGBD 2Q8IB 1BDOA 3J81E 3MAQA 5KRUA 5ELCA 1GHJA 5ELEA 5KNBA 4NDXA 1EYCA 3S17B 1ESRA 3ONAB 1G91A 4U68A 2F0LA 1JOQA 3U9SA 3H09A 1A15A 4OO1I 3K5LA 4RA8A 5G3LF 2K04A 2NTTA 3NTHA 3WOEA 4ZYSA 4HSVA 3TMEA 2G9HD 4H44C 2R61A 2A6ED 2YU9B 1OXTA 3MXUA 4RGOS 4ZKBB 1PZKD 4QB4A 1R9TB 1EYDA 1IKLA 1EIGA 3PO2B 2PW7A 4OIKA 2IT1A 4EGVA 5JAVA 3Q6SA 3LWUA 1KDAA 2K33A 5IGDA 1RDPD 2D9UA 3K5MA 2R93B 1FNVA 2VUMB 1S4ZA 2KOLA 5FO7B 5T1GA 3GV3A 1F77A 3L3OC 3R2TA 3NP8A 3IL8A 1WD0A 3W3AA 4XQJA 1ENCA 4KHVA 1JOOA 1HA6A 1BXTA 5K5PA 1L0XB 1JB3A 4C3IB 2I46A 4ZRZA 3H94A 1BCPF 1PXUA 2KCNA 2A74C 4UAIA 2F0SA 3ZYYX 3A55A 4CJ0B 2B2WA 3DEPA 1SDFA 3TDQA 5HURA 5CMDA 4LMQD 1STAA 1NUCA 1LACA 1BF4A 5C4XB 3GTLB 1PRTD 2A6HD 3SXHA 3I70A 1LT5D 1YNJD 5JVH3 4V0BA 1EYAA 1KAAA 3R93A 5E4XA 2ZXOA 4M8AA 2O4XA 2MGSA 1JQYD 1C48A 1IW7C 4QUFA 1LTRD 1FYCA 2AWOA 2PNRC 2K7VA 1V43A 1ZEQX 2F0EA 5IOCA 1ILQA 3A7AB 1QE6A 1VDZA 3IFTA 2O5JC 5C3WA 4ODGA 4ULLA 3FMCA 2K01A 2EPBA 3EFXD 4GZYC 4L8JA 2K5QA 2A73B 5IT9E 2F0VA 3X3NA 3NWSA 1SJHD 4BBSB 3TN2A 2O5IC 2SEBD 1NR2A 2KEDA 1LT3D 2JEBI 4DNTB 1DZ1A 2CW0D 4H0LC 5CYUA 1KNAA 3LWEA 2EYOA 2IPKD 2F0IA 5CV7A 3S1RB 4KKUA 4IALA 1W6JA 1VMCA 5EJWA 4RGMA 1IYUA 1RTOA 5IGBA 1Y8PB 2L55A 4JK1C 1O78A 2F0WA 4PMCA 5C5MA 1TY0A 1SNCA 3K57A 3TBIB 4G7ZC 1L0YB 1PFNA 1EY6A 4ME5A 1RODA 2IW3A 3J7AV 5DNFA 3A8JE 3M85A 3J80L 1AZPA 3OMGA 1O7YA 2NB0A 3J80E 5ELFA 2PZTA 1WTQA 5D65A 1ZYRC 1D2BA 3SE0A 3EJIA 3GTMB 3MXPA 3SK5A 2JA7B 2B63B 4CBVA 4MIUA 1PTOC 1SMYC 1KNEA 1PFBA 1Y1WB 1EEID 3CKIB 1CHPD 1KLGD 2BDNA 3BYYB 3HOUB 1B9NA 2NN6G 3MEHA 1F2YA 2SNMA 3A7LA 3H91A 1GHKA 4ZK9B 2K05A 5JOBA 2E2JB 2FJ2A 2A68C 5KNDA 3V2TA 3W2DA 2AWNA 2H1EA 1BQQT 3TP6A 4B9XA 1PLFA 3JAML 1AEXA 1F9SA 2Z8LA 4CKBA 3GO5A 1TWAB 3HOXB 3I4NB 1BCPC 2PZUA 5D14A 1DOKA 2OXPA 2EOTA 4XYQA 5LL6X 2B2YA 1DM0B 1SNOA 4KHZA 2A5HA 1KLUD 1CZGA 1VMPA 5C0XI 1EY0A 5ISRA 1A6XA 4IFDG 1EEFD 4XT1B 1SYBA 2F0TA 3S2DB 5E3FA 3FPPA 3S1MB 1ET9A 2DNEA 2ENBA 5C0XJ 2XIWA 3HGBA 4R8NA 1T5XD 4N9TA 2A68D 4PMWA 3SHLA 4RKLA 4IUPA 1I4QA 2TSSA 4TKOB 2EY5A 2SNSA 3S1QB 3L7ZC 2FMMA 1CI3M 1DOLA 1RD9D 3URYA 2BA1A 1S5ED 4C56C 4H7BA 4DFAA 3LNNA 4DGZA 3N52A 5DM63 3ERQA 2WAQB 4K8IA 3TP5A 2EYHA 2NN6H 5IIFA 1ENAA 1JORA 3VR5A 3MFGA 3BDCA 5LL6S 3PUWA 4HSPA 2RDFA 2EJFC 2R3ZA 4TRDA 1ONLA 1KDBA 3K5NA 5KGUA 1V1OA 4KN4C 3NK9A 4PV1C 1UUPA 4G4KA 4I7ZC 4KK7A 2B2TA 1DJRD 2D2CC 3S1NB 5C6AA 5IGEA 1FNWA 4V190 2IWHA 4RWSC 2Y0SB 3M3YB 4FF4A 2SOBA 5CV6A 1ML0D 3G7LA 1OO9B 2J4XA 2WB1B 3MHBA 1M8AA 1Y69U 3I91A 4F8MA 2M00A 1U4RA 2KVMA 5JVG3 1U4MA 1FR3A 4DU9A 1MSGA 2BCOA 1QCBD 3T4AC 5G3LD 3MTSA 2MPMA 1II3A 5FK9C 2K32A 3UI2A 5IGFA 3KBGA 3K6OA 1I4XA 2K5DA 2L5TA 5CR3A 1AW7A 4XT3B 3H3VC 3FKIB 3M4OB 3PUZA 5JEAJ 4LJZC 4BY1B 5IT9L 1RHPA 1DYQA 4R8IA 3GV6A 1J9OA 2Z4HA 1G2TA 1V8QA 1HPCA 4KMUC 1WTWA 4U673 1WTVA 2Z4IA 3IAYA 2F0OA 1D1IA 2VB3X 3GD7A 5EKLA 1CM9A 1EWHA 1PZID 1E2WA 1MSHA 2M2LA 4TQUS 4B9WA 1EOTA 3A54A 4M1UB 4IFDI 3NHHA 3D4WA 2L11A 1GUGA 1STHA 1SNDA 2D62A 3OW7A 3HOVB 3O13A 2EY2A 2FINB 5KNCA 3NXWA 1NSNS 2OEOA 2HDMA 5T1IA 4G7HC 1Y8OB 2DY7A 2JEAI 1EZ8A 4PQXA 2A6EC 2F0HA 4QCLA 3OIQA 1O7ZA 5JEAG 1AN8A 1EY7A 1WTOA 1ILPA 4OO1G 3MXGA 5J22A 2N55A 4A93B 1JE4A 5JPMC 3OMCA 4HEDA 1LTTD 1S5FD 2NVQB 1H9SA 3DWPA 1Q12A 2RDGA 2GA4B 1AFPA 5CV8A 1I3QB 1D5ZC 4O1NA 2E75C 5TSSA 2RSOA 5I9OA 3D6CA 1LT4D 2ZXRA 2ZXPA 4ZUJA 3K5OA 4ABNA 1D6EC 5EPLA 2DNCA 3Q23A 2KECA 5C0XH 3HOZB 1EQVA 3PMFA 1LV9A 2K6AA 4C1NK 4FXDA 1SYFA 2XWJB 1S5CD 1HTLD 1WD1A 3CHBD 2NVXB 2JA5B 3MXNA 1JWSD 2NTSA 5I9PA 3BS1A 2XRSD 3KF8A 3A56A 5BN5A 5A35A 3HOWB 1CFMA 3E5SA 1TY2A 1QG7A 3GTPB 1D5XC 2QF7A 2WACA 2KJXA 1R4QB 4BS9A 3K7AB 2F0UA 2PZWA 1LTID 4L63B 3R3OA 3D4RA 2E2DC 2PPBC 5EPKA 3OHXC 2IJ0A 5M3FB 3C46A 1OXVA 2LKVA 1ZKOA 3S2HB 3K59A 2HQEA 3HEJA 1Q1BA 3QJYA 1HUMA 3SVMA 4RHRA 4RCNA 3NQIA 4NW2A 4IUTA 1Y8NB 1ESFA 2EYMA 5I2YA 1V1PA 3CRLC 2J0TD 1ET6A 4C3JG 4UDUC 5C0XG 2IX3A 3NBHA 2IL8A 5JJZA 3TZDA 4RGTA 5K36H 1AP0A 3HKZB 2QEJC 2HUGA 1NR4A 3D31A 2CQAA 2JYOA 4BA2I 3T56B 3HRZC 1R4PB 2ICEC 1PTOB 2R7ZB 4EVOA 3AB9A 2CVRA 4A3FB 4YIJA 1Z7TA 5HGTA 3MFYA 2AQ2B 4K6LA 1KDCA 3H6MA 2KA7A 1HQRD 5KYIA 2EE1A 4G7OC 4WRDA 2QKIC 1TKWB 1O7LA 1ICWA 4ZAIA 1CA5A 2I07B 4K8JA 4HR7B 2FHTA 5FLXE 5CV9A 1IYVA 5CBAE 4NMZA 3DMUA 4C2MB 1QJOA 2MP1A 2Q8TA 4RCOA 2XNAC 3DUZA 4CKCA 4OGQC 2ID0A 4OHJA 1PFMA 4DN4M 3J7YW 2NWGA 2QCPX 1SYGA 2H4OA 2HCCA 1LABA 1EY4A 3T53B 1PTOH 1M4VA 4AYBB 2FFKB 3GTJB 3QIAA 2WKDA 4OO1H 1SYEA 5BN3A 4DF7A 4R9WA 2WP8J 1G8ZD 3SK6A 2L1BA 3EQLC 3HS0C 4BBRB 3KLSA 2V4DA 1ZXTA 4ZLTF 1F2ZA 1GUOA 3A8KE 2AUJD 1JICA 2JP1A 4DAYA 3DXJC 3GTQB 4J1MA 4DAPA 1JWUD 1TWHB 1DOMA 1PTOD 3EA6A 2RQXA 2LY7A 3PUXA 4BWGB 3I4LA 5CORA 2F4IA 1S5BD 1Y1VB 2BDOA 1GXDC 2D5DA 2X69A 5M5YB 2EYFA 5CV4A 5FO9B 1AZQA 3T16A 1GUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3U A;  1RTN A;  2HDM A;  2EOT A;  5EKI A;  4ZAI A;  5T1I A;  1WTP A;  1CA5 A;  1B3A A;  5EPK A;  2B2Y A;  2DY7 A;  2FHT A;  5COY A;  1NAP A;  1ML0 D;  1VMP A;  3G7L A;  3R93 A;  1PFN A;  1GUW A;  1QNK A;  3I3C A;  1IKM A;  4XT1 B;  5E4X A;  5CBA E;  4IUR A;  4ZKB B;  2MP1 A;  1X3Q A;  1M8A A;  2Q8T A;  1ROD A;  2K1B A;  2RA4 A;  4IUU A;  1IKL A;  3I91 A;  2MGS A;  3DEO A;  1EIG A;  1EIH A;  1U4R A;  2B2Y C;  2XIW A;  1O7Z A;  2KVM A;  4QUF A;  5DNF A;  1U4M A;  3I8Z A;  1WTO A;  1ILP A;  1Q3L A;  4OIK A;  1B50 A;  1ILQ A;  1MSG A;  1AZP A;  1PFM A;  4DN4 M;  1O7Y A;  1NCV A;  2NWG A;  1QE6 A;  3Q6S A;  4IUP A;  1HUM A;  1SSO A;  2N55 A;  3SVM A;  2DY8 A;  1WTQ A;  1B4O A;  4MN3 A;  5D65 A;  1JE4 A;  3MTS A;  2HCC A;  4RAU C;  2MPM A;  5EPJ A;  1HFN A;  2D9U A;  2SDF A;  3IFD A;  2J7Z A;  1MGS A;  1BNZ A;  4CJ1 B;  1CA6 A;  4HED A;  1B2T A;  2K28 A;  2FMM A;  1S4Z A;  1DOL A;  1B53 A;  2B2U A;  2FFK B;  2KOL A;  2K01 A;  4IUT A;  1XX8 A;  1TVX A;  2EPB A;  2X6G A;  5T1G A;  1BO0 A;  3UI2 A;  4O42 A;  1DON A;  1WTX A;  3GV3 A;  1O80 A;  3MWY W;  5EQ0 A;  2Q8R E;  2NYZ D;  1KNE A;  2VXW A;  4R9W A;  1PFB A;  3IL8 A;  2HCI A;  1BBX C;  1F2L A;  3D6W A;  2BDN A;  4XDX A;  2B2T C;  4XT3 B;  1RJT A;  1WVL A;  3KUP A;  1X3P A;  1G6Z A;  2B2W C;  1WD0 A;  2MJ8 A;  2L1B A;  1RHP A;  2RSO A;  5E4W C;  2K03 A;  3HP3 A;  3TN2 A;  1F9Q A;  5CBE E;  3N52 A;  1ZXT A;  3I90 A;  4R8I A;  2RSN A;  1NR2 A;  4QUC A;  3H91 A;  2KED A;  2KUM A;  3GV6 A;  2KEE A;  2X6L A;  1J9O A;  2L4N A;  4CJ2 C;  4ZLT F;  1EQT A;  2B2V C;  2IL8 A;  5JJZ A;  1G2T A;  4IUV A;  5EPL A;  3TZD A;  1HA6 A;  1JIC A;  1HUN A;  2JP1 A;  2L9H A;  1WTW A;  4ZK9 B;  2KEC A;  2N88 A;  1AP0 A;  1DZ1 A;  1WTR A;  2K05 A;  3DM1 A;  3FPU B;  1LV9 A;  4MHE A;  1WTV A;  1KNA A;  2HUG A;  3LWE A;  4X3T A;  1NR4 A;  1G2S A;  1SAP A;  1WD1 A;  2FJ2 A;  2HDL A;  2JYO A;  4X3S A;  2R3Z A;  1DOM A;  1X32 A;  2B2V A;  3QO2 A;  3KBX A;  5AFW A;  2B2U C;  3P7J A;  1F9P A;  4UAI A;  1XYI A;  1CM9 A;  1MI2 A;  4ZKC B;  2H1E A;  1ESR A;  4NW2 A;  5COR A;  1HRJ A;  1U4L A;  3ONA B;  1VMC A;  4IUQ A;  5EJW A;  4CJ0 B;  1G91 A;  2B2W A;  3DEP A;  1SDF A;  2CVR A;  4U68 A;  1MSH A;  3FDT A;  1IL8 A;  1RTO A;  2B2T A;  3F2U A;  1HFG A;  1QG7 A;  5CMD A;  2M2L A;  1E0B A;  1PDQ A;  1EOT A;  2NZ1 D;  4LMQ D;  1PLF A;  1A15 A;  1F9S A;  1J8I A;  2L11 A;  4X3K A;  1EL0 A;  4HAE A;  4RA8 A;  4RWS C;  1BF4 A;  2EE1 A;  2X69 A;  1U4P A;  2K04 A;  2L12 A;  1F9R A;  1C8C A;  5D14 A;  4OIJ A;  1DOK A;  4HCS A;  1AZQ A;  2FIN B;  2RVL A;  1ICW A;  1HHV A;  4HSV A; 
#chains in the Genus database with same CATH topology
 4FDB A;  5EKK A;  3TSS A;  4IPH A;  5LMU Q;  1UNS A;  1VQ7 A;  3GP7 A;  1DXM A;  1ASZ A;  2P5Z X;  3J81 j;  4NKL A;  5IYC H;  2E2I H;  3UDG A;  4FF2 A;  1GUW A;  4B3S L;  1HNX Q;  1YHQ A;  1SMX A;  3HOX H;  3I3C A;  1C0A A;  2EYJ A;  5ELD A;  3R2I A;  2N8N A;  3TS0 A;  1A2T A;  1JE5 A;  3E6Z X;  3S17 H;  3NWT A;  5BN4 A;  4DR3 Q;  2RHS B;  5LMN Q;  1B50 A;  4B3T Q;  2F0P A;  3E0E A;  3CC7 A;  1VF7 A;  3X3M A;  1PYB A;  3K80 C;  3T1H L;  1SE2 A;  2I5L X;  4KJN A;  3CPF A;  1JWM D;  5IOD A;  3V96 A;  1OXU A;  2J7Z A;  3A5Z B;  2FXQ A;  5M9O A;  2EXZ A;  1BCP D;  3D4D A;  1HR0 Q;  1QB5 D;  4CDC C;  4QMG A;  2KEN A;  1JJ2 A;  1CQF A;  4HMI A;  1YNX A;  2VXW A;  2LXK A;  3T51 B;  2JN4 A;  4IQZ A;  4AQY L;  2IX0 A;  3VR3 A;  1B1Z A;  4DXF A;  3G6J B;  1KIX A;  4CDD C;  3HOZ H;  1VF5 C;  1MKH A;  1Y1W H;  2K5W A;  4IPC A;  4DV2 L;  4DV1 Q;  1LTS D;  3E9I A;  3EIV A;  4K2K A;  4QUC A;  4P2C B;  2KUM A;  3GTL H;  4A3E H;  4KI0 A;  2E5L Q;  1I6H B;  5I4D A;  2JA5 H;  2KBN A;  3VYS A;  1EWI A;  4LFC Q;  1X3E A;  3H15 A;  2OTL A;  1PRT B;  5LHY 1;  1JR0 D;  5C4H A;  3HKZ E;  4ID6 A;  5CC4 A;  4ZUI A;  1RIP A;  3D8G A;  2BE5 D;  4P73 A;  4GN3 B;  1IBL Q;  4RGN A;  4CDE C;  3QO2 A;  4C3J H;  1BOS A;  2B2U C;  3P7J A;  4DR4 Q;  4BBS G;  2VQF Q;  4EQP A;  2BH8 A;  5FOB B;  3NUC A;  4JI5 L;  3SEB A;  3F2U A;  1K3B C;  1H9K A;  3NEM A;  1JT8 A;  2NZ1 D;  4RFB A;  2PO4 A;  1J8I A;  1TQO A;  4KKT A;  2AKW B;  3QOJ A;  5ELB A;  2JE6 I;  2L12 A;  3C1F A;  5M3F G;  1JCK B;  3B6Y A;  4OIJ A;  4GKJ L;  1A3T A;  4HCS A;  1RKN A;  1IHZ A;  4JI1 L;  1JB7 A;  1K8O A;  4IFD H;  2Z1C A;  4G57 A;  5E4W C;  1H9S B;  1VQO A;  3I4M H;  1HZB A;  2E2H B;  4YWM A;  2B8G A;  1LTB D;  1EFI D;  1PRT C;  1BVS A;  1VQE A;  3SR1 A;  4CHT B;  3HOY B;  4IUU A;  5KIX A;  4IJH A;  5CGK A;  4IOA A;  4XTC S;  3CCL A;  3I8Z A;  1GD7 A;  3PIO 3;  2EDG A;  1YNJ C;  3HOU G;  2OTJ A;  3VR4 A;  4LF8 Q;  3ND9 A;  1HZC A;  4WOR A;  1SE4 A;  4GN4 B;  4MN3 A;  1TWF B;  4RAU C;  5FLM G;  2NVT H;  4XXE A;  2N78 A;  1L0W A;  4JI3 L;  3ND8 A;  1ENF A;  3Q0A A;  4A3C G;  4XIG S;  4EQ5 A;  1S3O A;  1BO0 A;  1D1K A;  3BYT B;  5A2Q E;  4AYB E;  5I2X A;  2JA6 H;  3SK8 A;  3BG3 A;  1A62 A;  3PIP A;  3M4Y A;  1XMO Q;  3UDI A;  1PMR A;  1UAP A;  1F2L A;  4XDX A;  2VNU D;  1O7I A;  2B2T C;  1RJT A;  2CKZ B;  2B2W C;  3RMH A;  3S16 H;  2G9D A;  3P75 A;  2WV6 D;  2MO0 A;  1TS2 A;  4A3I H;  5ELO A;  1U0L A;  2EVB A;  3HKZ G;  5IYD H;  1EZ6 A;  4IUV A;  2EYL A;  4DA2 A;  3OSO A;  2F3I A;  4DR5 Q;  1TR5 A;  2F0M A;  1YNN D;  4K5X A;  4MHE A;  5HY6 A;  2YTV A;  4DAV A;  5M3F H;  3GTK B;  1PA6 A;  1J5E L;  1IXR A;  1LYL A;  3BU2 A;  2UXD L;  4LUV A;  1D5M C;  2K75 A;  3AQQ A;  2ICI A;  4IN3 A;  4A3K B;  2CCZ A;  1MI2 A;  3BVM A;  3BDO A;  2OF1 A;  3CCS A;  2AQ3 B;  5J39 A;  3J81 c;  2EJG C;  3S24 A;  1Y1V G;  1BR9 A;  1SR3 A;  4RMF A;  5C44 G;  4QQB X;  3D0F A;  3NBI A;  1Z9F A;  1I4P A;  2E2I B;  4DNR B;  4B3R L;  1PYW D;  3NTI A;  1TS5 A;  1HJP A;  1A3U A;  2IHF A;  2F3W A;  3CU7 A;  4HMJ A;  4FNF A;  1D7Q A;  1N34 L;  4K0K L;  2C5C A;  2F0F A;  3CAM A;  1IKM A;  4BY7 B;  1XXG A;  1SJE D;  4PZ6 A;  5EAY A;  4LK1 C;  4KHP L;  5GRO A;  3LX0 A;  4MNO A;  3K81 C;  2EY6 A;  1ICF B;  1STG A;  2VW9 A;  1J6Q A;  3TP7 A;  1PZJ D;  1R9T H;  3ITP A;  4OL7 A;  1PV4 A;  2F52 A;  3EVQ A;  1SSO A;  1FNU A;  4FXG C;  4R4I A;  5J1Z A;  4Y7N B;  2PMZ B;  4L6T B;  2UUA L;  4OWW B;  1MGS A;  2XRQ D;  4CJ1 B;  3H0G B;  2A8V A;  4JI8 Q;  2O2L D;  1NNX A;  3K7A H;  1W3S A;  1WJJ A;  3AU7 A;  1S5D D;  1IBK Q;  1O80 A;  2D0P A;  4A3M B;  2Q8R E;  2NYZ D;  4LUO A;  4S3S A;  1SRO A;  1TII D;  3TZU A;  1PH9 A;  1WVL A;  3PO3 G;  5JEA H;  1CK1 A;  4J8Q A;  3I72 A;  1G6Z A;  1VQ4 A;  4OX9 L;  1YEZ A;  3HP3 A;  5CBE E;  2EY1 A;  3RUZ A;  4DUY L;  4RHS A;  4POG A;  1CKO A;  2XVS A;  1EWC A;  4FO2 A;  1V1Q A;  3VYU A;  3M7N A;  1X56 A;  1YHB A;  5M5Y H;  2NVY B;  1HUN A;  4IOC A;  2KCC A;  2A69 C;  4WFN 3;  3QWN A;  2UUB L;  4Y7N H;  1N32 L;  2ZJR A;  2K4K A;  1K28 A;  4C2M H;  3J81 i;  4XYO A;  3PUV A;  5D3D A;  3C1E A;  1MD2 D;  1I50 B;  5IP9 H;  4PNY A;  4FXK C;  3BVG A;  3RLN A;  2MUY A;  4ZKC B;  3CP0 A;  1B70 B;  4ZQ3 A;  3T13 A;  1HRJ A;  1IL8 A;  1XMQ L;  3MVV A;  2XWB B;  1CHQ D;  3S14 B;  3PGZ A;  1HCZ A;  5L37 A;  3PF4 A;  4KKS A;  2KHI A;  1SBB B;  1A2U A;  2RBM A;  3HZX A;  2E76 C;  5I6W A;  4A3B B;  1EIF A;  1RTN A;  4A3I G;  1EQQ A;  1C4Q A;  5DAU A;  2UXC Q;  2WB1 E;  1NAP A;  1U5K A;  2K50 A;  3NTK A;  2B8F A;  2BE5 C;  2F0Q A;  2OWO A;  2PW5 A;  4QIW B;  1PH3 A;  4KJO A;  1T9H A;  4LF9 L;  1H9J A;  1KQS A;  1N32 Q;  2A1A A;  4GOP B;  2UUB Q;  3JAM i;  1GOZ A;  5KYL A;  2IX1 A;  2JJQ A;  1I4G A;  3JAM E;  1VQ5 A;  3KJP A;  1SNQ A;  2Q2H A;  4YCV A;  1B4O A;  1I6V C;  1X6O A;  3PF5 A;  1STB A;  2VB2 X;  1QVF A;  1BUV T;  2QDL A;  1EY8 A;  3GTG B;  1QWY A;  2K28 A;  2B2U A;  4A3D B;  2ZT9 C;  2WAQ G;  4BA1 I;  4YHH L;  1EY9 A;  1GUN A;  1H9R A;  4HJA A;  4FVM A;  4K6D A;  4A3E G;  4XQQ A;  1NE3 A;  2MO1 A;  1IW7 D;  1K0R A;  4DV4 L;  1DD2 A;  3QOL A;  2JA6 B;  1JC7 A;  4YY3 L;  1F9Q A;  4IZ8 A;  3I90 A;  5F2D A;  3E0J A;  3PO3 B;  4C3J B;  1V9P A;  4O0A A;  5IT9 c;  4L5S A;  3J7A F;  2Z6K A;  1E2Z A;  1C9O A;  2K52 A;  4UY8 C;  3A5U A;  1YI2 A;  3HOV G;  2N88 A;  4RH6 A;  3W1G A;  1STN A;  3VA7 A;  1K8M A;  3S1M H;  4HTH A;  1W6K A;  4X3T A;  1JJC B;  4B08 A;  2PQE A;  5FKA C;  2F3V A;  2CHB D;  5AFW A;  1XYI A;  3GDE A;  5IE8 A;  5C44 H;  3S15 B;  4DK0 A;  5EGT A;  3ER0 A;  3FDT A;  3RD4 A;  4E6I A;  1HFG A;  1PDQ A;  1HZ9 A;  5D3I B;  1GKH A;  1VQN A;  2R7Z G;  4X3K A;  4QL5 A;  1TWC B;  3MZ5 A;  3W5O A;  1WYD A;  3Q8D A;  1F9R A;  2PQA B;  4J6H A;  3SDZ A;  1SFO B;  3BDL A;  3CCE A;  3VA5 A;  1STE A;  2YYZ A;  1WTP A;  5EKI A;  3J81 L;  4DXG A;  1B3A A;  1XPU A;  2XSC A;  2R92 B;  3AEV A;  1XPO A;  2WFW A;  1NMF A;  1CKN A;  1QNK A;  2EYP A;  5I6Y A;  2QEX A;  3M7G A;  4A3J B;  4YWL A;  2PYK A;  2QIL A;  1J5E Q;  3WDN A;  4LF7 Q;  3S15 H;  1SNP A;  3SK4 A;  1UE6 A;  2EJM A;  1TWG H;  4IUN A;  5C44 B;  1P8L A;  4JYA Q;  1QIL A;  2NZO A;  3RZD B;  1NCV A;  1GJX A;  2PCF B;  2HHH Q;  2N49 A;  1WCM B;  4KN7 C;  4X65 Q;  4H02 A;  1QOH A;  4HCE A;  5JPN C;  1BCP B;  4F88 A;  3VYT A;  2PMZ E;  4Q5V A;  3HG9 A;  1N33 Q;  4X64 L;  2XN9 C;  1XTC D;  1SE3 A;  3KLW A;  2F0J A;  1HHV A;  5C5L A;  1B53 A;  4N9P A;  5DM7 3;  4PMB A;  4DKA C;  4C3H B;  1XMO L;  4FP5 D;  4TVA B;  2NN6 I;  4A3M G;  3WOF A;  3FEW X;  1EU3 A;  1VQH A;  3KJO A;  3RR5 A;  2HCI A;  1BBX C;  2ZM6 L;  4X66 Q;  2Q2T A;  2CH4 W;  4KTA A;  3CQZ B;  2C35 B;  2K03 A;  4LF5 L;  1AE3 A;  3VR2 A;  4DAY B;  4K14 A;  4NP5 A;  4X6A H;  4R4Q A;  2F0N A;  2RSN A;  1TWG B;  5GAD C;  2F0D A;  4A3K H;  4LUZ A;  1EQT A;  1IL2 A;  2AHO B;  3A0J A;  4JBW A;  1NBW A;  1XPR A;  1EUJ A;  4HID A;  4LF6 Q;  1Q90 A;  3FVQ A;  1EIY B;  1CTM A;  1WI5 A;  3DM1 A;  3FPU B;  3M4Q A;  1HNW L;  4F7X A;  2B63 G;  1HH2 P;  4A93 H;  5AJ3 Q;  1SAP A;  2WIN B;  5AJ3 L;  1SMY D;  3OTO Q;  1Z47 A;  4Z9C B;  1FL0 A;  5E1F A;  2LS0 1;  1A3V A;  1SYC A;  3QR8 A;  4HIK A;  5C4Z A;  1UE5 A;  1U9R A;  3Q22 A;  3FRP B;  5C3X A;  4C3H G;  1N36 L;  3D3R A;  4KD3 A;  4AH6 A;  3U9O A;  4BBR G;  5CV5 A;  4FF3 A;  1KAW A;  1T5E A;  2JA9 A;  1MJC A;  2HT1 A;  1KTK A;  4A3I B;  3C2P A;  3H0G H;  2Z6B A;  5A2Q L;  4HJ5 A;  4KY7 A;  3T1Y L;  4DR2 L;  4X64 Q;  1LLR D;  3ERO A;  1XTD A;  3BZD B;  1M90 C;  4QIW E;  1JOK A;  2C9O A;  3P1H A;  2G5D A;  4Q0F A;  1OXS C;  3P20 A;  4EQN A;  4LAA A;  4HN7 A;  3MXN B;  2KHS A;  1B9M A;  1HQM C;  3OOC A;  4O2D A;  1CQV A;  4JYA L;  1HFN A;  1CZW A;  3F2D A;  1PH6 A;  4DV1 L;  1BNZ A;  1E24 A;  1HZA A;  5C4J B;  5M3M H;  1HXY D;  4H13 C;  2OCE A;  4IFD J;  5BR8 L;  1BBU A;  2KCM A;  3CCJ A;  1AH9 A;  2X6G A;  3DWA A;  1LT6 D;  1F2M A;  3C3L A;  1UE7 A;  5EQ0 A;  1HR0 L;  1MBY A;  3HFZ B;  2VQE Q;  3IKJ A;  3FKI G;  4DV5 Q;  2YTY A;  1MJE A;  3RZD H;  2DN8 A;  2AMC B;  5IGG A;  2JA5 G;  3CF5 A;  4CJ2 C;  3KLR A;  2EIF A;  4B3T L;  3NQT A;  1Q8K A;  3CQZ H;  4LNQ A;  1STY A;  3CME A;  1TU2 B;  2A6H C;  4HIM A;  1EFW A;  2B2V A;  3KBX A;  3KK7 A;  4A3E B;  3KLS X;  4KD4 A;  4MTK A;  3OYY A;  3G6E A;  4B3S Q;  3K0Y A;  4WJ4 A;  3CCR A;  2LFN A;  4IUQ A;  4IPD A;  1U4L A;  1GUS A;  4XQN A;  5FLX c;  3NE5 B;  5LMU L;  2NVT B;  1LTG D;  1E0B A;  1YJW A;  3GTO B;  2Z9H A;  3RZO B;  1B3Q A;  1EL0 A;  1TT2 A;  5M5W B;  1LM0 A;  2PNH A;  1C8C A;  4DV4 Q;  3PQI A;  3L9A X;  4CKE A;  1Q1E A;  1B44 D;  2OQ0 A;  4QF4 A;  3AMU A;  3A8I E;  1N9W A;  2R6G A;  3OWE B;  3RLF A;  4ILW A;  3I56 A;  2M9V A;  4A93 G;  3ULL A;  4YHH Q;  4TSS A;  2QA4 A;  5IYD G;  4K5W A;  5IGC A;  1IBM Q;  4JI0 L;  2F03 A;  1V1P B;  1FVI A;  3GQB A;  1VCI A;  2KQ3 A;  2B2Y C;  3HOW H;  1LUZ A;  3BVZ A;  1ZYR D;  3I4M B;  1SLJ A;  1Q8I A;  2RF4 A;  4DK1 A;  2BOS A;  4A3G B;  1SEB D;  1UEA B;  1JJG A;  3PUY A;  3NSW A;  3NBH B;  1PTO F;  2DY8 A;  2ES2 A;  2L0C A;  2SDF A;  4FYD A;  2JQO A;  4C3I G;  1CA6 A;  2GN5 A;  4BXX H;  5JJK A;  2OT2 A;  4GS3 A;  3MA2 B;  1PRT F;  2LMC B;  1XWE A;  1XX8 A;  2VQE L;  5C3E G;  1FD7 D;  3CD6 A;  1DON A;  1WTX A;  5M5X H;  1TXY A;  2K14 A;  4OEM B;  3A74 A;  2NUC A;  4K2L A;  4C1N I;  3RLO A;  4BY7 H;  5BR8 Q;  3KUP A;  1X3P A;  2WKC A;  2JA7 G;  3V05 A;  1I94 Q;  1WTH A;  1HTP A;  2UXB Q;  3I4N G;  1G51 A;  2RHQ B;  1I6H H;  4JG2 A;  4YCW A;  2KEE A;  2X6L A;  3HOY G;  1NTG A;  4A76 A;  2WII B;  4FF1 A;  2WB1 G;  3QB3 A;  4I65 A;  2K5V A;  2L9H A;  4KY6 A;  1X9N A;  3S16 B;  1WTR A;  5IY0 A;  1LTA D;  1YJ9 A;  2E74 C;  1DCZ A;  1TS4 A;  3M9B A;  3S9W A;  3JC6 6;  1G2S A;  1SYD A;  2CQO A;  2B29 A;  3H0G G;  2F0K A;  2HDL A;  4X3S A;  4P71 A;  2AQ1 B;  1X32 A;  2B3G A;  3F8T A;  5M5X B;  2CW0 C;  1ASY A;  1F9P A;  3U4V A;  3M3Y H;  1TS3 A;  3PV0 A;  5C4X H;  2AUK A;  3Q24 A;  5IWA Q;  2B39 A;  5E7N A;  2FMC A;  5DEH A;  3OIP A;  4HAE A;  3T16 A;  3ERS X;  3ULP A;  1N36 Q;  1U4P A;  1RCV D;  3F2C A;  4LWC A;  3DEO A;  1EY5 A;  3AFP A;  2ZTD A;  2RKS A;  4RKB A;  4X3U A;  5EBD A;  1YNN C;  1H9M A;  2IHE A;  5COY A;  3KOJ A;  1IBK L;  4KV6 A;  4GLX A;  3G48 A;  3M4P A;  2F1M A;  4K5V A;  2VY3 A;  2A69 D;  4IUR A;  1X3Q A;  2ATW A;  3R8B A;  2K1B A;  2RA4 A;  3DHQ A;  4JC0 A;  3TP8 A;  5K36 G;  1E2V A;  2CH4 A;  4KY5 A;  1K83 B;  3N6R A;  4F87 A;  5NUC A;  1Q3L A;  4LF6 L;  5FJ8 G;  3CRK C;  1SXT A;  2QW7 A;  4GKK L;  3PIP 3;  2E2J H;  5EBC A;  4L5Q A;  3CXC A;  2JXM B;  1Y1V H;  4UPA A;  3I73 A;  1I4H A;  3IFD A;  4WJW A;  1G29 1;  1Z6H A;  5EPJ A;  4EQO A;  4LF5 Q;  3OPO A;  3CC4 A;  4CGY B;  2JA6 G;  1B2T A;  5ELN A;  4DAM A;  1EIH A;  5KEE A;  2ZM6 Q;  1CUK A;  1QNU A;  1TVX A;  3NPP A;  4DV7 Q;  4DR1 L;  4O42 A;  5FLX L;  3K58 A;  5M3M B;  1XNQ L;  3MWY W;  1KAB A;  1CT1 D;  2RDH A;  1HA5 A;  1RF2 D;  5FO8 B;  5GQO A;  2JA8 G;  3QG1 A;  1D8L A;  1X3F A;  1GM5 A;  2JSO A;  1A63 A;  1EU4 A;  4A3K G;  1K9M C;  3MC0 B;  3D6W A;  5C3E B;  4A75 A;  1I4R A;  2EZV A;  4A3D G;  3DWQ A;  2TMP A;  1VQB A;  2MJ8 A;  1N33 L;  3VR6 A;  1LO5 D;  2NBF A;  3VYR A;  1OXX K;  4B3M L;  2B63 H;  2MHV A;  1VQ6 A;  2BA0 A;  1SNM A;  2L4N A;  4YCU A;  2QDB A;  2HHH L;  3OWF A;  2B2V C;  2F0G A;  2JA8 B;  4DV3 L;  1FGB D;  4APV A;  4LFB L;  2Q8I B;  1BDO A;  3J81 E;  3CC2 A;  3MAQ A;  5KRU A;  5ELC A;  1GHJ A;  5ELE A;  2E2H H;  1IYJ B;  5KNB A;  3CCQ A;  2ASB A;  4NDX A;  1EYC A;  3TRZ A;  4A3D H;  1EYG A;  2PI2 E;  3S17 B;  1ESR A;  3ONA B;  4LFB Q;  1CSP A;  1G91 A;  4U68 A;  2F0L A;  4DV3 Q;  1JOQ A;  3U9S A;  3H09 A;  2CFM A;  1A15 A;  4OO1 I;  4B3M Q;  3K5L A;  4RA8 A;  5G3L F;  2K04 A;  2NTT A;  3NTH A;  3WOE A;  4ZYS A;  4GLA C;  4HSV A;  3TME A;  2G9H D;  4H44 C;  2R61 A;  2D0O A;  2A6E D;  2VUM H;  3J80 c;  4CDF C;  2YU9 B;  3E3X A;  1QZG A;  1OXT A;  3MXU A;  4RGO S;  1XNQ Q;  2DGY A;  4DR1 Q;  2RCF A;  4DV7 L;  4ZKB B;  1PZK D;  4QB4 A;  1R9T B;  1EYD A;  2IY5 B;  1IKL A;  4GN5 A;  1EIG A;  3PO2 B;  1Y1W G;  1DGS A;  3AFQ A;  1NJI C;  2PW7 A;  4OIK A;  2IT1 A;  4EGV A;  1W2B A;  1FGU A;  5JAV A;  3Q6S A;  4LF8 L;  3LWU A;  1KDA A;  2K33 A;  5IGD A;  1RDP D;  2D9U A;  3K5M A;  2R93 B;  1KRS A;  1FNV A;  5FJ8 H;  2VUM B;  1S4Z A;  2KOL A;  5FO7 B;  5T1G A;  1UEB A;  3GV3 A;  1F77 A;  3L3O C;  3R2T A;  3NP8 A;  3IL8 A;  4JI1 Q;  3STB D;  1WD0 A;  1X3G A;  4LFA L;  3W3A A;  2NVY H;  3I4M G;  4PZ8 A;  5JJL A;  4XQJ A;  1ENC A;  4KHV A;  4PZ7 A;  1B8A A;  3HOV H;  1JOO A;  1HA6 A;  1BXT A;  5K5P A;  2Q2U A;  1L0X B;  1VQC A;  1KRT A;  4DR4 L;  1JB3 A;  4C3I B;  2I46 A;  4J15 A;  4GNX A;  2YTX A;  4ZRZ A;  3H94 A;  1BCP F;  4IJL A;  4ME3 A;  1PXU A;  2KCN A;  2A74 C;  4C3H H;  4BY7 G;  5C4J H;  4UAI A;  2F0S A;  3ZYY X;  2UXC L;  3A55 A;  4CJ0 B;  2B2W A;  3DEP A;  1SDF A;  3TDQ A;  5HUR A;  4BXX G;  3DM3 A;  3I7F A;  5CMD A;  2E5L L;  2LSS A;  4LMQ D;  3J80 i;  3ZJY C;  1STA A;  1NUC A;  2JK8 A;  1LAC A;  1BF4 A;  5C4X B;  3STB C;  3GTL B;  4DV2 Q;  1PRT D;  2A6H D;  1QZH A;  3SXH A;  3I70 A;  1LT5 D;  1YNJ D;  4P75 A;  5JVH 3;  2HD3 A;  4V0B A;  3I4N H;  4MTN A;  2LXJ A;  1EYA A;  3S2D H;  1KAA A;  3R93 A;  4OWT B;  5E4X A;  2ZXO A;  4M8A A;  2O4X A;  4UP7 A;  1VQI A;  5IYC G;  2MGS A;  1JQY D;  1C48 A;  1IW7 C;  2EXD A;  1C7Y A;  4QUF A;  4A3F G;  1LTR D;  1FYC A;  2AWO A;  2PNR C;  2K7V A;  1V43 A;  1ZEQ X;  2F0E A;  5IOC A;  3T1H Q;  1YJN A;  1ILQ A;  4L5T A;  3A7A B;  4GNX C;  3TEH B;  2KCT A;  1QE6 A;  1VDZ A;  3I55 A;  1VQJ A;  1SE8 A;  3IFT A;  4DUY Q;  1Q82 C;  2O5J C;  5C3W A;  4LF4 Q;  4ODG A;  1MIU A;  4NXN L;  4ULL A;  1G6P A;  2N3S A;  1WCM G;  3FMC A;  1QVG A;  2K01 A;  3FHW A;  1CKM A;  2EPB A;  1IBM L;  4JPB W;  3EFX D;  2YV5 A;  5GAG C;  3H3V I;  4GZY C;  4L8J A;  3HKS A;  1PH8 A;  2K5Q A;  1GO3 E;  4A4I A;  1PH2 A;  1A0I A;  2A73 B;  5IT9 E;  2F0V A;  3X3N A;  5H1S E;  3NWS A;  1SJH D;  4BBS B;  3TN2 A;  3K7U C;  2O5I C;  2ZTE A;  2SEB D;  4R4C A;  1B7Y B;  1NR2 A;  1AE2 A;  4OXP A;  2KED A;  3CCM A;  5IYB H;  4JBM A;  1LT3 D;  2JEB I;  4DNT B;  1GVP A;  1DZ1 A;  2CW0 D;  4H0L C;  5CYU A;  4EX5 A;  1KNA A;  4JV5 L;  3U50 C;  2MNA A;  3LWE A;  2EYO A;  4KHP Q;  2IPK D;  2F0I A;  2JA8 H;  5CV7 A;  3S1R B;  5GAE C;  1PHJ A;  4JI4 Q;  4A3B H;  3SGI A;  4KKU A;  3S2H H;  1EQR A;  4IAL A;  1N8R C;  1W6J A;  1VMC A;  5EJW A;  4RGM A;  2PI2 A;  1N34 Q;  1IYU A;  1TWF H;  1RTO A;  4JOI C;  5IGB A;  1Y8P B;  2L55 A;  4JK1 C;  2Y0S E;  3L2P A;  1FJG L;  3H3V H;  2YU9 H;  2R92 H;  1QUQ A;  1O78 A;  1WFQ A;  4DV5 L;  4RG1 A;  2F0W A;  4PMC A;  5C5M A;  1TY0 A;  1SNC A;  3K57 A;  3TBI B;  4P74 A;  4G7Z C;  1L0Y B;  1PFN A;  1EY6 A;  3BJU A;  2VS1 A;  4ME5 A;  1ROD A;  2IW3 A;  2UXD Q;  1S40 A;  3J7A V;  3KF6 B;  4OEL B;  5DNF A;  3A8J E;  3M85 A;  3J80 L;  1AZP A;  3OMG A;  1O7Y A;  2NB0 A;  2HIX A;  3J80 E;  5ELF A;  3K0X A;  2PZT A;  4N8X 1;  4AYB G;  1WTQ A;  2R93 H;  5D65 A;  3PSI A;  1ZYR C;  5C3E H;  1D2B A;  3SE0 A;  5M3M G;  4X62 Q;  3EJI A;  1K3R A;  3GTM B;  3MXP A;  3SK5 A;  3KF6 A;  3KDF B;  2JA7 B;  4DR2 Q;  1YZ6 A;  3T1Y Q;  2B63 B;  4CBV A;  2QGQ A;  4A3G G;  4MIU A;  4DR6 L;  1I50 H;  2CWA A;  1PTO C;  1SMY C;  1VS0 A;  1KNE A;  3UDF A;  1PFB A;  1Y1W B;  1EEI D;  4OWX B;  3CKI B;  1CHP D;  1KLG D;  2BDN A;  3BYY B;  4KLK A;  3HOU B;  1B9N A;  2NN6 G;  3MEH A;  3NEL A;  4JI3 Q;  1F2Y A;  2SNM A;  3A7L A;  1UE1 A;  2XTI A;  1QUQ B;  3H91 A;  1L2F A;  4NXM L;  1NMG A;  1GHK A;  4P72 A;  2ZJQ A;  4ZK9 B;  2K05 A;  1RL2 A;  1K73 C;  5JOB A;  3OTO L;  1K0S A;  2E2J B;  3G4S A;  4IO9 A;  1I3Q H;  2FJ2 A;  2A68 C;  2JA7 H;  5KND A;  3V2T A;  1HNW Q;  3W2D A;  3GTG H;  2AWN A;  2H1E A;  4L5R C;  4DV0 L;  1BQQ T;  4JI7 Q;  3I2Z A;  3TP6 A;  4GNX B;  4N8F A;  4B9X A;  1PLF A;  3JAM L;  1AEX A;  1F9S A;  2Z8L A;  4CKB A;  3HOW G;  2R7D A;  3GO5 A;  1BKB A;  1TWA B;  3HOX B;  4A3L H;  3I4N B;  1BCP C;  2PZU A;  5D14 A;  1DOK A;  5GAH C;  4X66 L;  2DJG C;  2OXP A;  1VQG A;  2EOT A;  4XYQ A;  5LL6 X;  2B2Y A;  1DM0 B;  1SNO A;  4KHZ A;  2A5H A;  1KLU D;  1CZG A;  1VMP A;  2GVB A;  2MFI A;  1EY0 A;  3UDX A;  5ISR A;  5C0X I;  1A6X A;  4IFD G;  1EEF D;  4XT1 B;  1SYB A;  2F0T A;  3KFU A;  3S2D B;  4WJ3 M;  5E3F A;  3FPP A;  3S1M B;  1ET9 A;  2DNE A;  2ENB A;  5C0X J;  1E22 A;  2XIW A;  3HGB A;  4R8N A;  1T5X D;  4N9T A;  3PO3 H;  2A68 D;  4PMW A;  4X65 L;  3SHL A;  4RKL A;  3S14 H;  4IUP A;  1HNZ L;  1I4Q A;  2TSS A;  4TKO B;  2K5N A;  2EY5 A;  2SNS A;  4LF7 L;  3S1Q B;  3L7Z C;  2FMM A;  1CI3 M;  1DOL A;  1RD9 D;  3CPW A;  2ZTC A;  4AQY Q;  3URY A;  2NVQ H;  2BA1 A;  4DK3 C;  4DV6 L;  1VQA A;  1S5E D;  4BBS H;  4C56 C;  4H7B A;  4DFA A;  1X54 A;  3LNN A;  4DGZ A;  4X62 L;  3N52 A;  4JI2 Q;  5DM6 3;  4I7A A;  2UU9 L;  3ERQ A;  2WAQ B;  4K8I A;  3TP5 A;  2EYH A;  4YWK A;  3RN2 A;  2NN6 H;  5IIF A;  1ENA A;  1JOR A;  5LMN L;  3DLL A;  3HOZ G;  4DR3 L;  3TRE A;  1L1O C;  3VR5 A;  1E7Z A;  4ALP A;  3HOX G;  3MFG A;  3BDC A;  5LL6 S;  2L15 A;  3EBE A;  3PUW A;  4HSP A;  2RDF A;  2EJF C;  4IPG A;  2HIV A;  2R3Z A;  2Y0S G;  4TRD A;  1ONL A;  3GTJ H;  1KDB A;  3K5N A;  1YVC A;  5KGU A;  1V1O A;  1VQ8 A;  4KN4 C;  3U58 A;  3NK9 A;  4PV1 C;  1UUP A;  4G4K A;  4I7Z C;  3RN5 A;  4KK7 A;  2B2T A;  1DJR D;  2D2C C;  3S1N B;  5M5W H;  1SRU A;  5C6A A;  5IGE A;  1FNW A;  4UP9 A;  4V19 0;  2IWH A;  4LW1 A;  4RWS C;  4YY3 Q;  2Y0S B;  3M3Y B;  4FF4 A;  2SOB A;  5CV6 A;  2E8G A;  1X55 A;  1SN8 A;  1L1O B;  1ML0 D;  3G7L A;  3WWV A;  1OO9 B;  3GTQ H;  2J4X A;  2WB1 B;  3M4O H;  3J7Z C;  1YHA A;  3E9H A;  1M8A A;  3MHB A;  1Y69 U;  3I91 A;  4F8M A;  2M00 A;  1U4R A;  4JV5 Q;  1PVO A;  2KVM A;  5JVG 3;  1U4M A;  1FR3 A;  4DU9 A;  1MSG A;  2R92 G;  1BBW A;  2BCO A;  1QCB D;  2DJF C;  4GLV B;  3T4A C;  2F4V L;  5G3L D;  4JI6 L;  4A3B G;  3MTS A;  2MPM A;  4A3C H;  3CCU A;  2EQS A;  3PO2 G;  3IRB A;  1II3 A;  4A3M H;  4LF9 Q;  1M1K C;  1OTC A;  3J7A 5;  1XJV A;  2DUD A;  5FK9 C;  3CW2 C;  4JBJ A;  1Q81 C;  2K32 A;  3UI2 A;  1PYS B;  5IGF A;  1S72 A;  3KBG A;  1I5F A;  3PIO A;  2I0Q A;  3K6O A;  1I4X A;  2K5D A;  4JBK A;  2L5T A;  3JAM c;  3HOU H;  2Q2I A;  5CR3 A;  1AW7 A;  4XT3 B;  3H3V C;  3FKI B;  3M4O B;  3PUZ A;  5JEA J;  2V1C C;  4LJZ C;  4BY1 B;  5IT9 L;  1Q46 A;  1RHP A;  4NXN Q;  1DYQ A;  4LF4 L;  3TS2 A;  2WAQ E;  4R8I A;  1UWV A;  3GV6 A;  1J9O A;  1KD1 C;  2Z4H A;  1G2T A;  3ULJ A;  1XMQ Q;  4A3L G;  1V8Q A;  1HPC A;  4KMU C;  1WTW A;  4U67 3;  1JMC A;  2ZJP A;  1WTV A;  3GTO H;  2Z4I A;  3OW2 A;  3IAY A;  1H95 A;  2F0O A;  1D1I A;  2CWP A;  2VB3 X;  3GD7 A;  4DPG A;  3F2B A;  1Q86 C;  1CSQ A;  5EKL A;  1CM9 A;  4JVZ A;  1EWH A;  1PZI D;  2BH2 A;  1E2W A;  1MSH A;  1VQP A;  1MHW C;  2M2L A;  4TQU S;  4B9W A;  1EOT A;  3A54 A;  4M1U B;  4HJ7 A;  4IFD I;  3NHH A;  1E3P A;  2L11 A;  3D4W A;  1GUG A;  1STH A;  1SND A;  2D62 A;  4OX9 Q;  3OW7 A;  3HOV B;  3O13 A;  2EY2 A;  2FIN B;  4NB3 A;  5KNC A;  1VQD A;  3NXW A;  1NSN S;  2OEO A;  2HDM A;  5T1I A;  4G7H C;  1VQK A;  1Y8O B;  2DY7 A;  3GTM H;  3FKI H;  2JEA I;  1EZ8 A;  4DR7 Q;  1L1O A;  1Q7Y C;  2I5H A;  4PQX A;  2A6E C;  2F0H A;  4JI8 L;  4QCL A;  3OIQ A;  1O7Z A;  5JEA G;  1AN8 A;  1EY7 A;  1WTO A;  2UUA Q;  1ILP A;  4JI6 Q;  2F4V Q;  2H5X A;  1PH4 A;  4OO1 G;  1PFS A;  3MXG A;  5J22 A;  2N55 A;  4A93 B;  4A3J H;  1JE4 A;  5JPM C;  3GTP H;  3OMC A;  4LFA Q;  5C4X G;  4HED A;  4Y52 H;  1XNR Q;  1LTT D;  1S5F D;  2NZH A;  2NVQ B;  1H9S A;  3DWP A;  1Q12 A;  2RDG A;  3FP9 A;  4UP8 A;  2GA4 B;  1AFP A;  5CV8 A;  3S1Q H;  1I3Q B;  1D5Z C;  4O1N A;  4K0K Q;  2E75 C;  2OQK A;  4AIM A;  5TSS A;  2R7F A;  2RSO A;  5I9O A;  4B3R Q;  3D6C A;  1LT4 D;  2ZXR A;  1HR0 W;  2ZXP A;  4ZUJ A;  4GOP C;  1YIT A;  3K5O A;  1PH1 A;  4DUZ Q;  4QY7 A;  4ABN A;  1D6E C;  5IP7 H;  1E1T A;  5EPL A;  3L0O A;  4BBR H;  2DNC A;  3Q23 A;  4GOP A;  2UUC L;  4BY1 H;  2KEC A;  5C0X H;  3HOZ B;  1EQV A;  3PMF A;  1LV9 A;  2RCN A;  2K6A A;  4C1N K;  4FXD A;  1SYF A;  2XWJ B;  1S5C D;  1HTL D;  1WD1 A;  3CHB D;  2NVX B;  5DLQ E;  3MXN A;  2JA5 B;  1JWS D;  2NTS A;  1IZ6 A;  5I9P A;  3BS1 A;  3KF8 A;  2XRS D;  3A56 A;  5BN5 A;  5A35 A;  3HOW B;  1CFM A;  4DR5 L;  3BZC A;  3E5S A;  1TY2 A;  4C3I H;  1YBY A;  1QG7 A;  3GTP B;  2UU9 Q;  1D5X C;  2QF7 A;  4JI2 L;  4ZCK A;  4HJ8 A;  5JJI A;  2WAC A;  2KJX A;  1R4Q B;  4BS9 A;  5IYB G;  3K7A B;  1K83 H;  2F0U A;  2PZW A;  4OON A;  1LTI D;  4L63 B;  3R3O A;  3D4R A;  2E2D C;  2PPB C;  5EPK A;  3OHX C;  1TWC H;  4DV6 Q;  2IJ0 A;  5M3F B;  3GTK H;  4R4T A;  4JOI A;  3C46 A;  1OXV A;  2LKV A;  1ZKO A;  3G71 A;  3S2H B;  3K59 A;  3BZK A;  2HQE A;  2KHJ A;  2UUC Q;  2K5H A;  3HEJ A;  1Q1B A;  1HNZ Q;  3UE0 A;  3PO2 H;  3QJY A;  1HUM A;  3SVM A;  4DUZ L;  1PH5 A;  4DK6 C;  3EN2 A;  5LMN W;  1WCM H;  4RHR A;  2XGT A;  4RCN A;  3NQI A;  3MEF A;  1NY4 A;  1QVC A;  4NW2 A;  3UE1 A;  4QJF A;  4IUT A;  1Y8N B;  1ESF A;  2EYM A;  1E1O A;  4JW0 A;  5I2Y A;  2PQA A;  1V1P A;  1PH7 A;  1VQ9 A;  4DNI A;  3CRL C;  3KDF A;  2J0T D;  3RNU A;  5IP7 G;  3RZO H;  1ET6 A;  4C3J G;  4UDU C;  4A3F H;  4BY1 G;  5C0X G;  2IX3 A;  1XNR L;  4GKJ Q;  3TQY A;  3NBH A;  4QGU A;  3VDY A;  4GKK Q;  2IL8 A;  5JJZ A;  3TZD A;  4JI5 Q;  4JI7 L;  3W1B A;  4RGT A;  5K36 H;  4DV0 Q;  1AP0 A;  2VQF L;  3HKZ B;  4PG3 A;  2QEJ C;  1YIJ A;  2HUG A;  1KHI A;  1K8A C;  1NR4 A;  1IBL L;  3U4Z A;  3D31 A;  2CQA A;  2JYO A;  4BA2 I;  3T56 B;  3HRZ C;  4DR7 L;  1R4P B;  4A3G H;  5HGQ A;  1SFO H;  2ICE C;  1PTO B;  2R7Z B;  4EVO A;  3AB9 A;  2CVR A;  4A3F B;  4YIJ A;  4LFC L;  1Z7T A;  5HGT A;  3MFY A;  2AQ2 B;  2ALY B;  4K6L A;  1KDC A;  4POF A;  4NXM Q;  3KYH C;  3AYH B;  3H6M A;  2KA7 A;  1HQR D;  1CKN B;  5KYI A;  1LTL A;  2EE1 A;  4G7O C;  4WRD A;  2QKI C;  1X65 A;  2VL6 A;  1TKW B;  1O7L A;  1ICW A;  4A3J G;  4ZAI A;  2R93 G;  1CA5 A;  5IWA L;  2I07 B;  4K8J A;  4HR7 B;  2FHT A;  1P16 A;  5FLX E;  5CV9 A;  1IYV A;  4DR6 Q;  3HOY H;  2Z0S A;  5CBA E;  4NMZ A;  2I5M X;  3DMU A;  4C2M B;  1QJO A;  1KC8 C;  2MP1 A;  4RCO A;  2Q8T A;  2XNA C;  4MZ9 A;  3DUZ A;  3PCO B;  4CKC A;  4HJ9 A;  2R7Z H;  3CMA A;  4OGQ C;  2ID0 A;  1TWH H;  1VQL A;  4OHJ A;  3F1Z A;  1PFM A;  2A19 A;  4DN4 M;  2NWG A;  1WOC A;  3J7Y W;  2QCP X;  4JCV E;  1Y14 B;  1SYG A;  1TWA H;  3LGJ A;  2H4O A;  2HCC A;  2MQH A;  1LAB A;  2VZA A;  3S1N H;  1EY4 A;  3T53 B;  2UXB L;  3ICE A;  1I94 L;  1PTO H;  1VQF A;  1M4V A;  2HQL A;  4AYB B;  2FFK B;  3GTJ B;  3QIA A;  5FLM H;  2WKD A;  1KL9 A;  1HNX L;  4OO1 H;  1SYE A;  4R4O A;  5BN3 A;  4DF7 A;  4R9W A;  2WP8 J;  1K8G A;  1G8Z D;  3SK6 A;  2L1B A;  3EQL C;  3HS0 C;  4BBR B;  1VQM A;  3KLS A;  2V4D A;  1ZXT A;  1FJG Q;  4UHV A;  4ZLT F;  2GVA A;  1F2Z A;  1GUO A;  3A8K E;  2AUJ D;  1KXL A;  4NPS A;  1JIC A;  2NVX H;  2VUM G;  2JP1 A;  4DAY A;  3K8A A;  4HIO A;  3DXJ C;  4JI4 L;  3GTQ B;  1EOV A;  4J1M A;  4DAP A;  1JWU D;  1TWH B;  2Z6K C;  4JI0 Q;  1DOM A;  1PTO D;  3CCV A;  3EA6 A;  2RQX A;  2LY7 A;  4R1J A;  3PUX A;  5J3B A;  3I4L A;  5COR A;  4BWG B;  2F4I A;  3S1R H;  1S5B D;  1Y1V B;  3NEN A;  1A8V A;  5IP9 G;  2BDO A;  3I4O A;  1GXD C;  2D5D A;  2X69 A;  5M5Y B;  3KF8 B;  2EYF A;  5CV4 A;  5FO9 B;  1AZQ A;  2RVL A;  1GUT A; 
#chains in the Genus database with same CATH homology
 3TSS A;  5EKK A;  1UNS A;  3GP7 A;  1DXM A;  4NKL A;  4FF2 A;  1GUW A;  3I3C A;  2EYJ A;  5ELD A;  3R2I A;  1A2T A;  3E6Z X;  3NWT A;  5BN4 A;  1B50 A;  2F0P A;  1VF7 A;  3X3M A;  1SE2 A;  4KJN A;  1JWM D;  5IOD A;  3V96 A;  1OXU A;  2J7Z A;  5M9O A;  2EXZ A;  1BCP D;  3D4D A;  1QB5 D;  4QMG A;  1CQF A;  4HMI A;  2VXW A;  3T51 B;  4IQZ A;  2IX0 A;  3VR3 A;  1B1Z A;  4DXF A;  3G6J B;  1VF5 C;  2K5W A;  1LTS D;  4K2K A;  4QUC A;  4P2C B;  2KUM A;  4KI0 A;  1I6H B;  5I4D A;  3VYS A;  1PRT B;  5LHY 1;  1JR0 D;  5C4H A;  4ID6 A;  5CC4 A;  4ZUI A;  3D8G A;  2BE5 D;  4RGN A;  3QO2 A;  1BOS A;  2B2U C;  3P7J A;  4EQP A;  5FOB B;  3NUC A;  3SEB A;  3F2U A;  1H9K A;  2NZ1 D;  4RFB A;  2PO4 A;  1J8I A;  1TQO A;  4KKT A;  3QOJ A;  5ELB A;  2JE6 I;  2L12 A;  3C1F A;  1JCK B;  4OIJ A;  1A3T A;  4HCS A;  1RKN A;  1IHZ A;  1K8O A;  4IFD H;  2Z1C A;  4G57 A;  5E4W C;  1H9S B;  2E2H B;  2B8G A;  1LTB D;  1EFI D;  1PRT C;  3SR1 A;  4CHT B;  3HOY B;  4IUU A;  5KIX A;  5CGK A;  4XTC S;  3I8Z A;  3PIO 3;  2EDG A;  1YNJ C;  3VR4 A;  3ND9 A;  4WOR A;  1SE4 A;  4MN3 A;  1TWF B;  4RAU C;  4XXE A;  3ND8 A;  1ENF A;  3Q0A A;  4XIG S;  1BO0 A;  1D1K A;  3BYT B;  5A2Q E;  5I2X A;  3SK8 A;  3BG3 A;  3M4Y A;  1PMR A;  1UAP A;  1F2L A;  4XDX A;  2VNU D;  2B2T C;  1RJT A;  2B2W C;  3RMH A;  2G9D A;  3P75 A;  2WV6 D;  1TS2 A;  2EVB A;  1EZ6 A;  4IUV A;  2EYL A;  4DA2 A;  3OSO A;  1TR5 A;  2F0M A;  1YNN D;  4K5X A;  4MHE A;  4DAV A;  3GTK B;  1D5M C;  2ICI A;  4IN3 A;  4A3K B;  1MI2 A;  3BVM A;  3BDO A;  2OF1 A;  2AQ3 B;  5J39 A;  2EJG C;  1BR9 A;  3NBI A;  1I4P A;  2E2I B;  4DNR B;  1PYW D;  3NTI A;  1TS5 A;  1A3U A;  2F3W A;  3CU7 A;  4HMJ A;  4FNF A;  2C5C A;  2F0F A;  1IKM A;  4BY7 B;  1XXG A;  1SJE D;  4LK1 C;  3LX0 A;  2EY6 A;  1STG A;  3TP7 A;  1PZJ D;  3ITP A;  4OL7 A;  3EVQ A;  1SSO A;  1FNU A;  4FXG C;  5J1Z A;  4Y7N B;  2PMZ B;  4L6T B;  1MGS A;  2XRQ D;  4CJ1 B;  3H0G B;  2O2L D;  3AU7 A;  1S5D D;  1O80 A;  4A3M B;  2Q8R E;  2NYZ D;  4S3S A;  3TZU A;  1TII D;  1WVL A;  5JEA H;  1CK1 A;  4J8Q A;  3I72 A;  1G6Z A;  3HP3 A;  5CBE E;  2EY1 A;  3RUZ A;  4RHS A;  2XVS A;  1EWC A;  4FO2 A;  3VYU A;  3M7N A;  2NVY B;  1HUN A;  2KCC A;  2A69 C;  4WFN 3;  3QWN A;  4XYO A;  3PUV A;  5D3D A;  3C1E A;  1MD2 D;  1I50 B;  4PNY A;  4FXK C;  3BVG A;  2MUY A;  4ZKC B;  4ZQ3 A;  3T13 A;  1HRJ A;  1IL8 A;  3MVV A;  2XWB B;  1CHQ D;  3S14 B;  1HCZ A;  2RVL A;  4KKS A;  1SBB B;  1A2U A;  2RBM A;  3HZX A;  2E76 C;  5I6W A;  4A3B B;  1RTN A;  1C4Q A;  5DAU A;  1NAP A;  3NTK A;  2B8F A;  2BE5 C;  2F0Q A;  2PW5 A;  4QIW B;  4KJO A;  1H9J A;  1GOZ A;  5KYL A;  2IX1 A;  1I4G A;  3JAM E;  1SNQ A;  1B4O A;  1I6V C;  1STB A;  2VB2 X;  1BUV T;  1EY8 A;  3GTG B;  1QWY A;  2K28 A;  2B2U A;  4A3D B;  2ZT9 C;  4BA1 I;  1EY9 A;  1GUN A;  1H9R A;  4FVM A;  4K6D A;  4XQQ A;  1IW7 D;  1DD2 A;  3QOL A;  2JA6 B;  1JC7 A;  1F9Q A;  4IZ8 A;  3I90 A;  5F2D A;  3E0J A;  3PO3 B;  4C3J B;  3J7A F;  1E2Z A;  2N88 A;  4RH6 A;  3VA7 A;  1STN A;  1K8M A;  4HTH A;  1W6K A;  4X3T A;  4B08 A;  2PQE A;  5FKA C;  2F3V A;  2CHB D;  5AFW A;  1XYI A;  3S15 B;  4DK0 A;  5EGT A;  3FDT A;  3RD4 A;  4E6I A;  1HFG A;  1PDQ A;  5D3I B;  4X3K A;  1TWC B;  3MZ5 A;  1F9R A;  4J6H A;  3SDZ A;  1SFO B;  3BDL A;  3VA5 A;  1STE A;  2YYZ A;  1WTP A;  5EKI A;  3J81 L;  4DXG A;  1B3A A;  2XSC A;  2R92 B;  1QNK A;  2EYP A;  5I6Y A;  3M7G A;  4A3J B;  2PYK A;  2QIL A;  3WDN A;  1SNP A;  3SK4 A;  2EJM A;  4IUN A;  5C44 B;  1QIL A;  3RZD B;  1NCV A;  1GJX A;  2PCF B;  4KN7 C;  1WCM B;  1QOH A;  4HCE A;  5JPN C;  1BCP B;  4F88 A;  3VYT A;  4Q5V A;  3HG9 A;  2XN9 C;  1XTC D;  1SE3 A;  2F0J A;  1HHV A;  5C5L A;  1B53 A;  4N9P A;  5DM7 3;  4PMB A;  4C3H B;  4FP5 D;  2NN6 I;  3WOF A;  3FEW X;  1EU3 A;  2HCI A;  1BBX C;  4KTA A;  3CQZ B;  2K03 A;  3VR2 A;  4K14 A;  4NP5 A;  2F0N A;  2RSN A;  1TWG B;  2F0D A;  1EQT A;  4JBW A;  1Q90 A;  3FVQ A;  1CTM A;  3DM1 A;  3FPU B;  4F7X A;  1SAP A;  2WIN B;  1SMY D;  1Z47 A;  4Z9C B;  5E1F A;  2LS0 1;  1A3V A;  1SYC A;  5C4Z A;  1U9R A;  3Q22 A;  3FRP B;  5C3X A;  4C3H G;  3D3R A;  4KD3 A;  3U9O A;  4FF3 A;  5CV5 A;  1T5E A;  1KTK A;  4A3I B;  3C2P A;  5A2Q L;  4KY7 A;  1LLR D;  3ERO A;  3BZD B;  1JOK A;  2C9O A;  3P1H A;  4Q0F A;  1OXS C;  3P20 A;  4EQN A;  4LAA A;  4HN7 A;  2KHS A;  1B9M A;  1HQM C;  3OOC A;  1CQV A;  1HFN A;  1CZW A;  1BNZ A;  5C4J B;  1HXY D;  4H13 C;  4IFD J;  2X6G A;  3DWA A;  1LT6 D;  1F2M A;  3C3L A;  5EQ0 A;  1MBY A;  3IKJ A;  2DN8 A;  5IGG A;  4CJ2 C;  3KLR A;  3NQT A;  1STY A;  1TU2 B;  2A6H C;  2B2V A;  3KBX A;  3KK7 A;  4A3E B;  3KLS X;  4KD4 A;  3K0Y A;  2LFN A;  1U4L A;  4IUQ A;  4XQN A;  1GUS A;  3NE5 B;  2NVT B;  1LTG D;  1E0B A;  3GTO B;  3RZO B;  1EL0 A;  1TT2 A;  5M5W B;  1C8C A;  3L9A X;  4CKE A;  1Q1E A;  3AMU A;  1B44 D;  4QF4 A;  3A8I E;  2R6G A;  3OWE B;  3RLF A;  4ILW A;  2M9V A;  4TSS A;  4K5W A;  5IGC A;  2F03 A;  1V1P B;  3GQB A;  1VCI A;  2KQ3 A;  2B2Y C;  3BVZ A;  1ZYR D;  3I4M B;  1Q8I A;  4DK1 A;  2BOS A;  4A3G B;  1SEB D;  1UEA B;  3PUY A;  3NSW A;  1PTO F;  2DY8 A;  2L0C A;  2SDF A;  4FYD A;  4C3I G;  1CA6 A;  2OT2 A;  3MA2 B;  1PRT F;  2LMC B;  1XWE A;  1XX8 A;  1FD7 D;  1DON A;  1WTX A;  2NUC A;  4K2L A;  4C1N I;  3KUP A;  1X3P A;  2WKC A;  3V05 A;  1HTP A;  2KEE A;  2X6L A;  2WII B;  4FF1 A;  3QB3 A;  4I65 A;  2L9H A;  4KY6 A;  3S16 B;  1WTR A;  1LTA D;  2E74 C;  1DCZ A;  1TS4 A;  3S9W A;  1G2S A;  1SYD A;  2F0K A;  2HDL A;  4X3S A;  2AQ1 B;  1X32 A;  5M5X B;  2CW0 C;  1F9P A;  1TS3 A;  3PV0 A;  3Q24 A;  2AUK A;  2B39 A;  2FMC A;  5DEH A;  3OIP A;  4HAE A;  1U4P A;  1RCV D;  3DEO A;  1EY5 A;  5EBD A;  2RKS A;  4RKB A;  4X3U A;  1YNN C;  1H9M A;  5COY A;  4KV6 A;  2F1M A;  4K5V A;  2A69 D;  4IUR A;  1X3Q A;  3R8B A;  2K1B A;  2RA4 A;  3DHQ A;  3TP8 A;  5K36 G;  1E2V A;  4KY5 A;  1K83 B;  3N6R A;  4F87 A;  5NUC A;  1Q3L A;  3CRK C;  1SXT A;  3PIP 3;  5EBC A;  2JXM B;  5EPJ A;  1I4H A;  3I73 A;  3IFD A;  4WJW A;  1G29 1;  1Z6H A;  4EQO A;  3OPO A;  4CGY B;  1B2T A;  1EIH A;  5KEE A;  1QNU A;  1TVX A;  3NPP A;  4O42 A;  5FLX L;  3K58 A;  5M3M B;  3MWY W;  1KAB A;  1CT1 D;  2RDH A;  1HA5 A;  1RF2 D;  5FO8 B;  3QG1 A;  2JSO A;  1EU4 A;  3MC0 B;  3D6W A;  5C3E B;  1I4R A;  2EZV A;  3DWQ A;  2TMP A;  2MJ8 A;  3VR6 A;  1LO5 D;  2NBF A;  3VYR A;  1OXX K;  2MHV A;  2BA0 A;  1SNM A;  2L4N A;  2QDB A;  3OWF A;  2B2V C;  2F0G A;  2JA8 B;  1FGB D;  2Q8I B;  1BDO A;  3J81 E;  3MAQ A;  5KRU A;  5ELC A;  1GHJ A;  5ELE A;  5KNB A;  4NDX A;  1EYC A;  3S17 B;  1ESR A;  3ONA B;  1G91 A;  4U68 A;  2F0L A;  1JOQ A;  3U9S A;  3H09 A;  1A15 A;  4OO1 I;  3K5L A;  4RA8 A;  5G3L F;  2K04 A;  2NTT A;  3NTH A;  3WOE A;  4ZYS A;  4HSV A;  3TME A;  2G9H D;  4H44 C;  2R61 A;  2A6E D;  2YU9 B;  1OXT A;  3MXU A;  4RGO S;  4ZKB B;  1PZK D;  4QB4 A;  1R9T B;  1EYD A;  1IKL A;  1EIG A;  3PO2 B;  2PW7 A;  4OIK A;  2IT1 A;  4EGV A;  5JAV A;  3Q6S A;  3LWU A;  1KDA A;  2K33 A;  5IGD A;  1RDP D;  2D9U A;  3K5M A;  2R93 B;  1FNV A;  2VUM B;  1S4Z A;  2KOL A;  5FO7 B;  5T1G A;  3GV3 A;  1F77 A;  3L3O C;  3R2T A;  3NP8 A;  3IL8 A;  1WD0 A;  3W3A A;  4XQJ A;  1ENC A;  4KHV A;  1JOO A;  1HA6 A;  1BXT A;  5K5P A;  1L0X B;  1JB3 A;  4C3I B;  2I46 A;  4ZRZ A;  3H94 A;  1BCP F;  1PXU A;  2KCN A;  2A74 C;  4UAI A;  2F0S A;  3ZYY X;  3A55 A;  4CJ0 B;  2B2W A;  3DEP A;  1SDF A;  3TDQ A;  5HUR A;  5CMD A;  4LMQ D;  1STA A;  1NUC A;  1LAC A;  1BF4 A;  5C4X B;  3GTL B;  1PRT D;  2A6H D;  3SXH A;  3I70 A;  1LT5 D;  1YNJ D;  5JVH 3;  4V0B A;  1EYA A;  1KAA A;  3R93 A;  5E4X A;  2ZXO A;  4M8A A;  2O4X A;  2MGS A;  1JQY D;  1C48 A;  1IW7 C;  4QUF A;  1LTR D;  1FYC A;  2AWO A;  2PNR C;  2K7V A;  1V43 A;  1ZEQ X;  2F0E A;  5IOC A;  1ILQ A;  3A7A B;  1QE6 A;  1VDZ A;  3IFT A;  2O5J C;  5C3W A;  4ODG A;  4ULL A;  3FMC A;  2K01 A;  2EPB A;  3EFX D;  4GZY C;  4L8J A;  2K5Q A;  2A73 B;  5IT9 E;  2F0V A;  3X3N A;  3NWS A;  1SJH D;  4BBS B;  3TN2 A;  2O5I C;  2SEB D;  1NR2 A;  2KED A;  1LT3 D;  2JEB I;  4DNT B;  1DZ1 A;  2CW0 D;  4H0L C;  5CYU A;  1KNA A;  3LWE A;  2EYO A;  2IPK D;  2F0I A;  5CV7 A;  3S1R B;  4KKU A;  4IAL A;  1W6J A;  1VMC A;  5EJW A;  4RGM A;  1IYU A;  1RTO A;  5IGB A;  1Y8P B;  2L55 A;  4JK1 C;  1O78 A;  2F0W A;  4PMC A;  5C5M A;  1TY0 A;  1SNC A;  3K57 A;  3TBI B;  4G7Z C;  1L0Y B;  1PFN A;  1EY6 A;  4ME5 A;  1ROD A;  2IW3 A;  3J7A V;  5DNF A;  3A8J E;  3M85 A;  3J80 L;  1AZP A;  3OMG A;  1O7Y A;  2NB0 A;  3J80 E;  5ELF A;  2PZT A;  1WTQ A;  5D65 A;  1ZYR C;  1D2B A;  3SE0 A;  3EJI A;  3GTM B;  3MXP A;  3SK5 A;  2JA7 B;  2B63 B;  4CBV A;  4MIU A;  1PTO C;  1SMY C;  1KNE A;  1PFB A;  1Y1W B;  1EEI D;  3CKI B;  1CHP D;  1KLG D;  2BDN A;  3BYY B;  3HOU B;  1B9N A;  2NN6 G;  3MEH A;  1F2Y A;  2SNM A;  3A7L A;  3H91 A;  1GHK A;  4ZK9 B;  2K05 A;  5JOB A;  2E2J B;  2FJ2 A;  2A68 C;  5KND A;  3V2T A;  3W2D A;  2AWN A;  2H1E A;  1BQQ T;  3TP6 A;  4B9X A;  1PLF A;  3JAM L;  1AEX A;  1F9S A;  2Z8L A;  4CKB A;  3GO5 A;  1TWA B;  3HOX B;  3I4N B;  1BCP C;  2PZU A;  5D14 A;  1DOK A;  2OXP A;  2EOT A;  4XYQ A;  5LL6 X;  2B2Y A;  1DM0 B;  1SNO A;  4KHZ A;  2A5H A;  1KLU D;  1CZG A;  1VMP A;  5C0X I;  1EY0 A;  5ISR A;  1A6X A;  4IFD G;  1EEF D;  4XT1 B;  1SYB A;  2F0T A;  3S2D B;  5E3F A;  3FPP A;  3S1M B;  1ET9 A;  2DNE A;  2ENB A;  5C0X J;  2XIW A;  3HGB A;  4R8N A;  1T5X D;  4N9T A;  2A68 D;  4PMW A;  3SHL A;  4RKL A;  4IUP A;  1I4Q A;  2TSS A;  4TKO B;  2EY5 A;  2SNS A;  3S1Q B;  3L7Z C;  2FMM A;  1CI3 M;  1DOL A;  1RD9 D;  3URY A;  2BA1 A;  1S5E D;  4C56 C;  4H7B A;  4DFA A;  3LNN A;  4DGZ A;  3N52 A;  5DM6 3;  3ERQ A;  2WAQ B;  4K8I A;  3TP5 A;  2EYH A;  2NN6 H;  5IIF A;  1ENA A;  1JOR A;  3VR5 A;  3MFG A;  3BDC A;  5LL6 S;  3PUW A;  4HSP A;  2RDF A;  2EJF C;  2R3Z A;  4TRD A;  1ONL A;  1KDB A;  3K5N A;  5KGU A;  1V1O A;  4KN4 C;  3NK9 A;  4PV1 C;  1UUP A;  4G4K A;  4I7Z C;  4KK7 A;  2B2T A;  1DJR D;  2D2C C;  3S1N B;  5C6A A;  5IGE A;  1FNW A;  4V19 0;  2IWH A;  4RWS C;  2Y0S B;  3M3Y B;  4FF4 A;  2SOB A;  5CV6 A;  1ML0 D;  3G7L A;  1OO9 B;  2J4X A;  2WB1 B;  3MHB A;  1M8A A;  1Y69 U;  3I91 A;  4F8M A;  2M00 A;  1U4R A;  2KVM A;  5JVG 3;  1U4M A;  1FR3 A;  4DU9 A;  1MSG A;  2BCO A;  1QCB D;  3T4A C;  5G3L D;  3MTS A;  2MPM A;  1II3 A;  5FK9 C;  2K32 A;  3UI2 A;  5IGF A;  3KBG A;  3K6O A;  1I4X A;  2K5D A;  2L5T A;  5CR3 A;  1AW7 A;  4XT3 B;  3H3V C;  3FKI B;  3M4O B;  3PUZ A;  5JEA J;  4LJZ C;  4BY1 B;  5IT9 L;  1RHP A;  1DYQ A;  4R8I A;  3GV6 A;  1J9O A;  2Z4H A;  1G2T A;  1V8Q A;  1HPC A;  4KMU C;  1WTW A;  4U67 3;  1WTV A;  2Z4I A;  3IAY A;  2F0O A;  1D1I A;  2VB3 X;  3GD7 A;  5EKL A;  1CM9 A;  1EWH A;  1PZI D;  1E2W A;  1MSH A;  2M2L A;  4TQU S;  4B9W A;  1EOT A;  3A54 A;  4M1U B;  4IFD I;  3NHH A;  3D4W A;  2L11 A;  1GUG A;  1STH A;  1SND A;  2D62 A;  3OW7 A;  3HOV B;  3O13 A;  2EY2 A;  2FIN B;  5KNC A;  3NXW A;  1NSN S;  2OEO A;  2HDM A;  5T1I A;  4G7H C;  1Y8O B;  2DY7 A;  2JEA I;  1EZ8 A;  4PQX A;  2A6E C;  2F0H A;  4QCL A;  3OIQ A;  1O7Z A;  5JEA G;  1AN8 A;  1EY7 A;  1WTO A;  1ILP A;  4OO1 G;  3MXG A;  5J22 A;  2N55 A;  4A93 B;  1JE4 A;  5JPM C;  3OMC A;  4HED A;  1LTT D;  1S5F D;  2NVQ B;  1H9S A;  3DWP A;  1Q12 A;  2RDG A;  2GA4 B;  1AFP A;  5CV8 A;  1I3Q B;  1D5Z C;  4O1N A;  2E75 C;  5TSS A;  2RSO A;  5I9O A;  3D6C A;  1LT4 D;  2ZXR A;  2ZXP A;  4ZUJ A;  3K5O A;  4ABN A;  1D6E C;  5EPL A;  2DNC A;  3Q23 A;  2KEC A;  5C0X H;  3HOZ B;  1EQV A;  3PMF A;  1LV9 A;  2K6A A;  4C1N K;  4FXD A;  1SYF A;  2XWJ B;  1S5C D;  1HTL D;  1WD1 A;  3CHB D;  2NVX B;  2JA5 B;  3MXN A;  1JWS D;  2NTS A;  5I9P A;  3BS1 A;  2XRS D;  3KF8 A;  3A56 A;  5BN5 A;  5A35 A;  3HOW B;  1CFM A;  3E5S A;  1TY2 A;  1QG7 A;  3GTP B;  1D5X C;  2QF7 A;  2WAC A;  2KJX A;  1R4Q B;  4BS9 A;  3K7A B;  2F0U A;  2PZW A;  1LTI D;  4L63 B;  3R3O A;  3D4R A;  2E2D C;  2PPB C;  5EPK A;  3OHX C;  2IJ0 A;  5M3F B;  3C46 A;  1OXV A;  2LKV A;  1ZKO A;  3S2H B;  3K59 A;  2HQE A;  3HEJ A;  1Q1B A;  3QJY A;  1HUM A;  3SVM A;  4RHR A;  4RCN A;  3NQI A;  4NW2 A;  4IUT A;  1Y8N B;  1ESF A;  2EYM A;  5I2Y A;  1V1P A;  3CRL C;  2J0T D;  1ET6 A;  4C3J G;  4UDU C;  5C0X G;  2IX3 A;  3NBH A;  2IL8 A;  5JJZ A;  3TZD A;  4RGT A;  5K36 H;  1AP0 A;  3HKZ B;  2QEJ C;  2HUG A;  1NR4 A;  3D31 A;  2CQA A;  2JYO A;  4BA2 I;  3T56 B;  3HRZ C;  1R4P B;  2ICE C;  1PTO B;  2R7Z B;  4EVO A;  3AB9 A;  2CVR A;  4A3F B;  4YIJ A;  1Z7T A;  5HGT A;  3MFY A;  2AQ2 B;  4K6L A;  1KDC A;  3H6M A;  2KA7 A;  1HQR D;  5KYI A;  2EE1 A;  4G7O C;  4WRD A;  2QKI C;  1TKW B;  1O7L A;  1ICW A;  4ZAI A;  1CA5 A;  2I07 B;  4K8J A;  4HR7 B;  2FHT A;  5FLX E;  5CV9 A;  1IYV A;  5CBA E;  4NMZ A;  3DMU A;  4C2M B;  1QJO A;  2MP1 A;  2Q8T A;  4RCO A;  2XNA C;  3DUZ A;  4CKC A;  4OGQ C;  2ID0 A;  4OHJ A;  1PFM A;  4DN4 M;  3J7Y W;  2NWG A;  2QCP X;  1SYG A;  2H4O A;  2HCC A;  1LAB A;  1EY4 A;  3T53 B;  1PTO H;  1M4V A;  4AYB B;  2FFK B;  3GTJ B;  3QIA A;  2WKD A;  4OO1 H;  1SYE A;  5BN3 A;  4DF7 A;  4R9W A;  2WP8 J;  1G8Z D;  3SK6 A;  2L1B A;  3EQL C;  3HS0 C;  4BBR B;  3KLS A;  2V4D A;  1ZXT A;  4ZLT F;  1F2Z A;  1GUO A;  3A8K E;  2AUJ D;  1JIC A;  2JP1 A;  4DAY A;  3DXJ C;  3GTQ B;  4J1M A;  4DAP A;  1JWU D;  1TWH B;  1DOM A;  1PTO D;  3EA6 A;  2RQX A;  2LY7 A;  3PUX A;  4BWG B;  3I4L A;  5COR A;  2F4I A;  1S5B D;  1Y1V B;  2BDO A;  1GXD C;  2D5D A;  2X69 A;  5M5Y B;  2EYF A;  5CV4 A;  5FO9 B;  1AZQ A;  3T16 A;  1GUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...