4OO1H

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
353
structure length
279
Chain Sequence
ITITKRNGAFSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 69
structure length 279
sequence length 353
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1H01
1IYVA 2DN8A 5A35A 2F1MA 3VR5A 3QG1A 2V4DA 5BN4A 1FR3A 1O78A 2KCCA 5C0XH 1DD2A 3IKJA 1E2WA 5K36G 2A6ED 4TKOB 1T5EA 1HQMC 1ZKOA 2BA1A 5C0XG 4IQZA 2A68C 3QIAA 2BA0A 3LWUA 2BE5C 3SE0A 4G7HC 1ZYRC 3CRKC 1H9KA 3VR3A 2A6HC 1OXSC 2EVBA 4DK0A 3GQBA 4KKUA 1Y8PB 2D5DA 3T56B 1BDOA 4LK1C 5BN5A 3SDZA 3MFYA 3NE5B 3A7LA 3FMCA 2D62A 2NN6G 2Q8IB 3VA7A 1Y8NB 5K36H 3A7AB 4BA2I 3T51B 3LNNA 4BA1I 1Y69U 1GJXA 1G291 2KA7A 2LMCB 1Q1BA 1H9SA 1IW7D 5JEAG 3VR2A 2EDGA 4LJZC 3CRLC 1FYCA 1HPCA 2B8GA 4OGQC 3BG3A 4HR7B 4KKSA 1SMYC 3RLFA 3M4YA 3W3AA 4XTCS 1YNNC 4KN7C 1OXVA 4IFDH 2ZT9C 1GUGA 1GUTA 4KHZA 2BDOA 1Q12A 1Y8OB 1TKWB 4G7ZC 1LACA 2E76C 4IFDG 3A8IE 2NN6H 1Z6HA 1IYUA 4KI0A 2PCFB 2O5IC 3OW7A 4OO1G 3BDOA 2QF7A 4I7ZC 1Z7TA 3OOCA 3I72A 3T53B 2E75C 3PUZA 1H9RA 4DNRB 3I73A 3PUVA 2A69C 1K8OA 1E2ZA 1OXUA 5JEAH 3A8KE 1VDZA 1V8QA 3H94A 3D4RA 5KNCA 2L5TA 3PUWA 3ND9A 2EJMA 1OXTA 1YNJC 3MXUA 2YYZA 3HGBA 1IW7C 1CFMA 1GUOA 4DNTB 3PUYA 1E2VA 4JK1C 2BE5D 1B9MA 1VCIA 2K7VA 1GHKA 2D2CC 2A6EC 3AB9A 1H9JA 2EJFC 2K33A 3PUXA 1EWHA 2JEAI 1VF7A 3I4LA 4OO1H 2CW0C 4RCNA 3KLRA 4G7OC 1VF5C 1HTPA 1OXXK 2R6GA 1Q1EA 4KN4C 4H44C 3VR4A 1GHJA 3M85A 1CI3M 2K32A 2DNCA 1HCZA 2NN6I 1DCZA 4L8JA 4TQUS 3QJYA 2JXMB 1CTMA 3A8JE 1O7LA 1H9SB 2AUJD 1GUNA 2O5JC 2EJGC 3TZUA 1A6XA 3P20A 1TU2B 4H0LC 3M7NA 2A68D 3U9SA 1Q90A 4KMUC 4GZYC 1PMRA 5BN3A 1V43A 2IT1A 3OPOA 2A6HD 2PPBC 4PV1C 3ND8A 4DK1A 2AWOA 1H9MA 2JE6I 1LABA 3EQLC 2PNRC 4KKTA 2B8FA 3FPPA 3N6RA 1K8MA 3VR6A 2AUKA 3DXJC 1I6VC 2A69D 1B9NA 2E74C 2JEBI 3IFTA 3L7ZC 3GD7A 5KNBA 1QJOA 3PV0A 4XIGS 3D31A 4JBWA 5KNDA 1ONLA 2DNEA 1GUSA 4H13C 3WDNA 1DXMA
chains in the Genus database with same CATH superfamily
4HJ5A 1ZXTA 3A74A 4ID6A 1Q86C 4RGTA 2LKVA 5C3WA 2R92B 5A2QE 3DEPA 4IQZA 1C4QA 1EIYB 5M5WH 2FJ2A 2B2VA 3G71A 5CGKA 3T13A 3K81C 3OSOA 2B63B 3VA7A 1SEBD 1X3PA 3DM3A 4A3GH 1B2TA 2RVLA 4UP9A 3K59A 1G8ZD 2HT1A 4KK7A 4HIDA 1JWUD 2VQEL 4CKCA 5CMDA 1RTOA 4FVMA 1EQTA 4FF3A 4POFA 2BDOA 2IWHA 3GO5A 2CWPA 3V05A 3H6MA 4ZUJA 1N32Q 3IAYA 4DV7Q 3L3OC 5M5YH 1NJIC 1EIHA 4EGVA 4V0BA 1VQ7A 1X3QA 2IX3A 3PUWA 1VMCA 4HIOA 1VQCA 3I8ZA 3NTHA 1CA6A 4B08A 3UDIA 1B9MA 1S3OA 1SNDA 4A3DB 1JQYD 3GTJB 2K7VA 2WAQE 4NXMQ 1SE3A 4OO1H 3OYYA 5M3FG 3KLRA 4F7XA 2E2JH 3E6ZX 3W2DA 3MXNB 1R9TB 3K58A 3J80E 1EWCA 1TXYA 2Y0SE 4UDUC 4C3JB 1A6XA 1N36L 2YTYA 4BY7H 2O4XA 1ENCA 2HD3A 3CD6A 4YHHQ 4ZKCB 4HIMA 4DR6Q 1EZ6A 1EYAA 2EYOA 4YIJA 4HJAA 2VB3X 2XIWA 3DXJC 1CSQA 1QVFA 1E1OA 4IZ8A 4FO2A 2IW3A 1EYDA 3D31A 1RL2A 2WB1E 3BVZA 3HFZB 2JA6H 3IL8A 4GN4B 4IOAA 4YWLA 3VR5A 2R7DA 1PYSB 1YVCA 3BVMA 4BS9A 1VQGA 4TKOB 3D3RA 3UDXA 1JWSD 3CCVA 4FXKC 2BA0A 2F0HA 4YY3Q 3CCJA 3L9AX 3D0FA 1LTLA 1W6KA 3SDZA 1WTHA 2NN6G 3HOYH 2L15A 1SNOA 4O2DA 3GTGB 1AP0A 3T1HQ 1TWFB 3FPUB 3HOYG 1M90C 4B3RL 4Z9CB 3VR2A 4JOIA 1EY9A 3WOEA 2F0PA 2JA9A 5D3DA 4X62Q 1I4HA 4QMGA 3MEHA 2G9HD 4KN7C 1EEFD 5LL6S 2I5HA 1YHAA 3T1YQ 4G7ZC 2F0DA 1Z6HA 1E22A 2JA7H 2QF7A 1MHWC 2AQ1B 2IX1A 4A3FB 4DNRB 1YJWA 5C5MA 3K0XA 5LMUL 4GOPA 2K04A 3GTPH 1VQ5A 4KLKA 3SGIA 3HOZH 2GN5A 1JICA 4KJNA 4A3JG 4BBRG 1K8AC 5GAEC 1ML0D 5ELCA 3X3MA 3KF8A 3M3YB 2HHHQ 2F0OA 4K6DA 2JEAI 1M1KC 1I4QA 4GNXA 3J7AF 2K05A 5AFWA 1QB5D 3PIO3 2F0FA 3KK7A 1Y1WH 1Q1EA 2VUMB 4C1NK 3M9BA 1DCZA 4OXPA 1Y1WG 4KJOA 3HKZG 3K7UC 4C3HB 1ESFA 4QIWE 1U4MA 2X6GA 1TY0A 2R3ZA 1QVCA 2NBFA 1SYDA 3HRZC 3CHBD 1DJRD 2PPBC 2Q8RE 3AEVA 3C46A 2NVXB 4JI7L 3CCUA 3GTQB 2PW7A 4MHEA 1AZPA 1N32L 3PV0A 4RGMA 1K83B 4DV7L 1SMXA 2MNAA 2M9VA 2X69A 1DXMA 1C8CA 1KLUD 1Z9FA 4DXGA 3J7A5 1PVOA 5BN4A 1O78A 4N9TA 4DR5Q 1KRSA 1BCPD 1JB3A 1A62A 3ICEA 3J80i 2BA1A 4LUOA 2RBMA 1WYDA 2BE5C 2L0CA 1ZYRC 4C2MH 3PCOB 2EVBA 3J7YW 1YITA 1B1ZA 1GVPA 4NXML 1YHBA 1TWAH 1BCPB 4JBKA 3C1FA 3A7LA 2Q8IB 1KDCA 2D62A 3VDYA 1Y8NB 1SXTA 1T9HA 1PHJA 5JPMC 5KYLA 1PZKD 1S5BD 2K5NA 3AU7A 1U4RA 2UUBQ 4AYBB 4EQNA 4KKSA 1SMYC 1HRJA 5CV6A 1XX8A 1NAPA 5IYCH 3G7LA 2VW9A 2E76C 4YHHL 3A8IE 4WFN3 4DR6L 2PCFB 4A3EB 3CMAA 4BY1B 4A3IG 4DNIA 2NVQB 2E75C 4ZAIA 1GO3E 4L5RC 5FK9C 2SNSA 5LL6X 1PFBA 1BO0A 2L5TA 3WWVA 1IBMQ 1BBWA 3DHQA 2Z4IA 4TVAB 4LF5Q 1STNA 4F8MA 3WOFA 2EYPA 2PNHA 2K5HA 1MKHA 2WKDA 1QNUA 1GHKA 5FO7B 1V1OA 2K33A 3EJIA 4YY3L 3MXGA 2K01A 2PZWA 2R6GA 2UXDQ 4LAAA 1NUCA 1KIXA 1PTOF 2KENA 4QUFA 3K80C 1VQJA 1CI3M 3T1HL 1RTNA 4L8JA 3UDFA 1BBXC 2XRQD 2L1BA 1K0SA 1QE6A 1H9SB 3FP9A 3Q6SA 1UNSA 1Q90A 2LS01 3FEWX 1PH4A 1L0XB 2HCIA 2CCZA 4X62L 3M4OH 1SN8A 4K2KA 4KV6A 4HEDA 2V1CC 5M5WB 5D65A 2UU9Q 5ISRA 2K14A 3T1YL 1DGSA 1JJ2A 2RHSB 2JEBI 3L7ZC 1MGSA 2EYJA 2KQ3A 4A3GB 3VA5A 4HIKA 2F0WA 4RHSA 3STBD 1W6JA 2RA4A 1VQLA 1NR4A 1B4OA 3H0GH 1DD2A 2RKSA 4B3SQ 4NP5A 1WTQA 3HOUH 4RAUC 3S17H 1KC8C 4HJ9A 3OTOL 2HHHL 2A6HC 3UE1A 4APVA 3TSSA 1LT5D 3OMCA 3I90A 1E24A 1WI5A 4XT1B 5M5YB 2E8GA 1PH3A 4JBJA 2NYZD 2AKWB 3CRLC 1PV4A 5JEAJ 1WTXA 1D6EC 3BG3A 1IL2A 1UAPA 3RLFA 4K5XA 1K28A 4K5VA 4K8JA 1X9NA 1SYFA 2NWGA 1BR9A 4ZK9B 2FMCA 2VB2X 1KNEA 3M4QA 2E2JB 1IKMA 3QOLA 1E2ZA 4JI1Q 2Z6KC 4R4TA 4MIUA 3A8KE 2Z8LA 5I2XA 4I7AA 4XYQA 3MXUA 1KNAA 2B2TA 1RODA 1GUOA 2AQ3B 4IJHA 3H3VI 5E4XA 1ENFA 1SR3A 4DR5L 1SE2A 5J1ZA 2VXWA 4BY7B 3OMGA 4K8IA 1EIFA 3A5ZB 4GKJQ 1H9JA 1XJVA 4FF4A 4IPGA 5IGGA 4KN4C 1K3BC 2RDFA 4R4CA 2EYHA 2DNCA 3TQYA 4JC0A 4R8IA 2GVAA 4IALA 2K1BA 3TZUA 3E9HA 2UUBL 1QCBD 3I70A 5IOCA 5T1GA 1N8RC 1DOKA 3NP8A 2JA8G 1TR5A 1X32A 1VMPA 3TS2A 1KABA 2WAQB 2E5LQ 3N6RA 3HP3A 3IFTA 2E74C 5LMNW 4QCLA 1PDQA 3GV6A 4DA2A 3HOYB 2PQEA 2UUAQ 1E0BA 3KDFB 2E2DC 4ALPA 4LFAQ 2DY7A 5A35A 4A3KH 1IBML 2EE1A 2ALYB 4A3KG 4LF5L 3UI2A 4ABNA 2A68C 1MSGA 2LXJA 3DM1A 5GQOA 4IUNA 4G7HC 1F9PA 1PZID 4QJFA 1PYWD 3H3VC 2PQAA 5JOBA 1K9MC 3MXNA 3NE5B 2JA7B 4NXNL 1I50H 2ZJQA 2UXDL 3H3VH 4QB4A 5IYBH 1G51A 3LNNA 4YCWA 3A5UA 3GTPB 5M3MG 3HOZB 4BBRB 5IYBG 2G5DA 4NW2A 1KL9A 1PFNA 2BH2A 1XPRA 4FDBA 2RSOA 3M4PA 1HNZQ 1FGBD 4UY8C 1BXTA 2ZT9C 3D8GA 3RLNA 1X3GA 5E4WC 2KJXA 1LT6D 3CCMA 1LACA 1RDPD 1IYUA 1A15A 2UU9L 2JP1A 3FRPB 2RCNA 2MP1A 3MA2B 4MNOA 2F0VA 3C3LA 2IJ0A 3BDCA 1Y1WB 2B29A 4EQ5A 3HKZB 4CJ2C 5JEAH 5F2DA 2M00A 1BUVT 3NEMA 1V1PB 5KNCA 3OWEB 2JA5G 1OXTA 4QF4A 5I4DA 2WP8J 3NHHA 1CZWA 2PI2E 4FF2A 1DYQA 1X56A 1CHPD 1STAA 3U58A 4B3SL 2HUGA 5C4XH 2Z1CA 4PZ7A 3J7AV 1XNRQ 1EY7A 4Q0FA 1IBLQ 2CW0C 3NELA 3BYTB 3I55A 2J4XA 5C4XG 4V190 3BYYB 4K6LA 3UDGA 1ILPA 1OXXK 3M85A 3Q0AA 4JI2L 2A1AA 4EQPA 1OTCA 3D4DA 4DV2Q 2UXBQ 1LV9A 1PZJD 2O5JC 3P7JA 2RSNA 4GZYC 5C0XJ 4PV1C 5EKIA 4P72A 4GN3B 5CORA 5C3EG 3W5OA 5EAYA 4XT3B 4PMWA 1TWAB 1BF4A 2XVSA 2D9UA 2ENBA 3VYUA 1KXLA 3WDNA 5K36G 4A3LG 4RMFA 5EPJA 4JI1L 3HOXH 4IUQA 3BU2A 2E2IH 2F3WA 5BR8Q 3OIQA 4XXEA 1CSPA 1SMYD 4JBMA 3HOXG 4Y52H 2OF1A 2A6ED 5EBCA 4X6AH 5KGUA 1I4PA 5EKLA 4R4QA 4DUZQ 3I7FA 2F0TA 4JCVE 2F0KA 4KKUA 2CVRA 4BXXH 2N49A 2KCTA 2VS1A 1U9RA 3MFYA 4CHTB 1VQEA 1UE7A 4DAYA 2NVTH 4BXXG 2K28A 3CKIB 4OWWB 3I4MG 2KA7A 3S1NH 4IURA 3RUZA 2QEXA 2EDGA 2L9HA 2B2UA 1FNVA 3HOWH 3W3AA 1LT3D 1WJJA 3A54A 1BBUA 1WOCA 2VZAA 2WV6D 4X66Q 1ET9A 1GUTA 5C0XI 5GROA 3HOWG 1Y8OB 2PZTA 2K5QA 1LTAD 4X65Q 1UE6A 4M8AA 2E5LL 3BDOA 3ITPA 1Z7TA 3T53B 1J5EQ 3PO3G 2OT2A 2UUAL 1EYGA 2MO0A 1Q8IA 2GA4B 4LFAL 1S5FD 2YYZA 4IPDA 1AN8A 1NY4A 4HN7A 4JW0A 3STBC 2QGQA 1S5DD 3M4OB 2KVMA 1STHA 5JAVA 3URYA 2HQEA 2C5CA 3KLSX 2KBNA 4DKAC 1WTOA 1CHQD 2ZXRA 4H02A 5EPKA 2ES2A 2HCCA 2A19A 1PH8A 2ID0A 3VR4A 2KEDA 1HFNA 1YJNA 2K32A 2NN6I 5IT9L 2F0JA 2FMMA 1Q7YC 4A4IA 2AUJD 3H0GB 1LUZA 2L4NA 5I6YA 3NSWA 2KCNA 2FINB 4PQXA 3U9SA 1CQFA 3S17B 2F3VA 1HNZL 3HOUB 3SK4A 1IZ6A 2KHIA 2A6HD 3QOJA 5ELFA 5M3FH 2IPKD 3EQLC 1L0YB 4IOCA 2JK8A 5KNBA 1PH6A 2B39A 2HIXA 4QY7A 3GV3A 4KD4A 1JMCA 4H7BA 1FL0A 2F1MA 2P5ZX 3RD4A 1WTVA 3K6OA 1XPOA 1UEBA 4K5WA 1X3EA 5C0XH 3W1BA 3H91A 1HH2P 2QA4A 4FXGC 1T5EA 5C0XG 1CA5A 1LT4D 3B6YA 3QIAA 4X3TA 4R8NA 1LM0A 4K0KQ 1GD7A 2K6AA 4OHJA 3G4SA 2Z6BA 1XNRL 1JC7A 1IBLL 1K73C 1J8IA 1L2FA 2AHOB 3A7AB 2Z9HA 3KOJA 5C3XA 2BCOA 5LMNQ 3HEJA 1GJXA 1H9SA 2YU9H 2ZTEA 4DV2L 2UXBL 1NBWA 2B8GA 1QWYA 1PA6A 1JJCB 1KD1C 3M4YA 2NZHA 1CUKA 3RZOH 1D5ZC 1P16A 1X65A 3ERQA 1L0WA 3DEOA 1FJGQ 2NN6H 4PZ6A 1RD9D 1H9RA 3F2UA 4L5QA 3EVQA 3HKZE 3SK8A 3P1HA 3ND9A 4WJWA 1F2MA 5BR8L 3DUZA 1EY8A 3EIVA 3K0YA 4KHVA 2N8NA 1G2SA 4XQJA 3PMFA 1V1QA 1EWHA 2N55A 4DUZL 2YTXA 2XWJB 2PMZE 1ICFB 5G3LF 4JI8Q 2EZVA 4YWMA 2FFKB 3NENA 2ZJRA 1OO9B 1F9RA 5L37A 2DY8A 4CDFC 4A3JH 4BBRH 5C4JH 4A3KB 2B2WC 1HZAA 2A68D 3D6WA 1SLJA 3OPOA 1CQVA 3OTOQ 2CH4A 4X66L 1VQMA 1HQRD 4A76A 1O7IA 3SHLA 4NB3A 2UXCQ 3EROA 5IGDA 4X65L 1FVIA 1IKLA 1QJOA 3AQQA 1I50B 3SXHA 2MUYA 1J5EL 2F52A 1SJHD 5IGFA 5FJ8H 1TS3A 1WTWA 5JPNC 1GOZA 1FNWA 1HA5A 2EYFA 3QG1A 1WD0A 5FJ8G 1HZ9A 1KAAA 1PYBA 1UE5A 1WFQA 1F9QA 2JN4A 4N8FA 5IGEA 2UUCL 2D5DA 2ZTDA 1LLRD 1Q3LA 3FMCA 5J22A 2F0GA 1Q81C 3CW2C 5E1FA 1TY2A 4IO9A 3ER0A 1Y69U 2NTSA 4K2LA 2WIIB 2HIVA 2B2YC 3QO2A 1SYGA 1R4QB 2IL8A 5EKKA 3ZJYC 2VNUD 4LF7Q 4EQOA 2F0QA 5E7NA 1HXYD 2CW0D 5C4XB 4CGYB 4KHZA 3GTOH 3NQTA 2F03A 4O42A 5CV9A 5I9OA 3BDLA 3OOCA 2B3GA 3KDFA 5ELDA 3Q23A 3GTKB 1K8OA 3MEFA 3CCLA 4X64Q 3FKIG 1I4GA 4DR3Q 4P71A 5IYDH 3E9IA 4ULLA 1CFMA 4G4KA 4ZCKA 5IYDG 3AMUA 4DR7Q 1SNPA 2AQ2B 1VQHA 2A6EC 1VQNA 1YBYA 4A3IH 1VF7A 1Q8KA 1XWEA 4K0KL 5FOBB 3J81L 2OTJA 1JE4A 4RGNA 4DV0Q 1JB7A 2FHTA 1SFOH 1HCZA 1K8GA 1RKNA 3HOXB 5LMNL 2NVYH 2E2IB 2PYKA 3IRBA 1JE5A 1G91A 1PH5A 1ZEQX 2NTTA 4DAPA 1XMOQ 5DLQE 5IT9c 3KBGA 3P75A 1CKOA 1FJGL 4NXNQ 3I56A 1PRTF 5H1SE 1ENAA 3I4MB 2NVTB 1VQKA 5J39A 3KBXA 3G6EA 1V1PA 2DN8A 3S1NB 2HDLA 1QOHA 4HMIA 2R93H 4OWTB 3K57A 2R93G 5HY6A 3HOWB 1B53A 1EU4A 3W1GA 1HZCA 4B9WA 2R92G 5JJIA 4UAIA 1CKMA 3SE0A 1AH9A 1G2TA 5KEEA 3T56B 1SNCA 1EQRA 2F0IA 2Z4HA 2KHSA 4OIJA 4JI8L 2B63G 3AFPA 4MTNA 4S3SA 5CV5A 4ODGA 4PMCA 4TSSA 1Q1BA 1G6ZA 4IUPA 4KY6A 1HJPA 1DOMA 2J0TD 3MXPA 3NTKA 4CJ0B 1F2YA 5ELNA 1QG7A 4LWCA 4X3SA 2F4IA 1WTRA 2R7ZH 2UXCL 2OWOA 3ONAB 4A3MH 2RQXA 4JI2Q 2R7ZG 1VQPA 1UEAB 4DU9A 4RGOS 3BVGA 4PMBA 1SYCA 4A3MG 3E0JA 1WCMH 3R93A 3JAML 1B70B 4HSVA 1GXDC 1WCMG 4WJ3M 2MPMA 3HZXA 1NCVA 3KF6B 4A3DG 2EIFA 3G6JB 5M3FB 5FO9B 1D1KA 3EFXD 3K7AH 1MJCA 4LW1A 4ILWA 1CM9A 3PF4A 3E0EA 2LY7A 1YHQA 2IX0A 1BVSA 1WTPA 3A8JE 3NPPA 1GUNA 3GP7A 1BQQT 3QB3A 1I4RA 1S40A 4LF7L 1BKBA 1LTBD 3ND8A 2SNMA 1F9SA 1L1OC 4XDXA 1K8MA 5DM63 3CC2A 2XGTA 3SVMA 2X6LA 3NWSA 2K5DA 3R2IA 4XQNA 2CQOA 1M4VA 1VQOA 2NZOA 2SDFA 3L0OA 1QNKA 1IYVA 2A74C 4X64L 1B3AA 2XSCA 2JQOA 2MFIA 4RA8A 4DR3L 2YU9B 1FGUA 4R4IA 1KLGD 3G48A 1E2WA 3VYSA 2K03A 3ULPA 2JA8H 1ZKOA 5I9PA 3I3CA 3NUCA 4DR7L 3RNUA 3RZOB 1I6HH 1EZ8A 4HSPA 4N9PA 4DXFA 1F2ZA 3S14H 1KTKA 3EA6A 1KAWA 1EOTA 1QUQB 1TWCH 1B7YB 1LTID 4WORA 4DV0L 4JI0Q 4BA2I 5NUCA 4BA1I 3CAMA 4BBSH 1FD7D 4FP5D 4QQBX 3DLLA 2ICIA 2XN9C 4GLXA 4BBSG 1DM0B 4DV3Q 3MZ5A 5CV7A 5IODA 4GLAC 2Q8TA 2ASBA 2OXPA 5JVH3 1MD2D 5TSSA 3CQZH 5DNFA 1TKWB 5IP9G 1XMOL 1HTLD 4X3KA 1I4XA 2H5XA 5IE8A 1W3SA 2EPBA 5FLXL 4CDCC 4JYAQ 1HNWQ 5GAHC 3SK6A 5M3MH 1JT8A 4A3FG 1OXUA 3LX0A 1VDZA 4YCVA 4K14A 4A3JB 3OHXC 5C4JB 5EGTA 1D2BA 3J81j 3T16A 3Q22A 5DEHA 5ELBA 4Q5VA 3KJPA 1PH7A 3TREA 2ICEC 2D2CC 1P8LA 3MC0B 3PUXA 4DR2Q 2WFWA 3IFDA 3LGJA 1PH2A 1HR0Q 1Q46A 2C35B 2F4VQ 4OELB 3TZDA 3TDQA 1AE3A 4H44C 1SE4A 4FF1A 2JA5H 5CV8A 2VUMG 4CKBA 1YEZA 3DMUA 4DK6C 3S1MH 1TS2A 1O7LA 1ICWA 3F2DA 4OIKA 5C44H 2Z6KA 1KDBA 2I5LX 2MQHA 2MO1A 4R1JA 3J81c 1XMQQ 1LTTD 4DPGA 3BZCA 4KMUC 5C44G 2I0QA 4DV1Q 1VQ9A 1LABA 4P73A 1JOKA 2KHJA 3F1ZA 1HFGA 5K5PA 5IWAQ 2H1EA 2PMZB 2A69D 1B9NA 3ULJA 5CC4A 1PH9A 2E2HH 1TS5A 3GTKH 1ONLA 4DV5Q 1MI2A 1XXGA 4EX5A 1M8AA 1JOOA 5IGCA 1YIJA 1YJ9A 3VYRA 1TQOA 1D5XC 1FNUA 2G9DA 5I2YA 2HDMA 3TRZA 1U0LA 2K50A 4KHPQ 3I2ZA 2EXDA 1HQMC 2BDNA 1N9WA 3HOVH 2LXKA 5C3EH 5T1IA 2MHVA 4DAVA 5KYIA 3GTOB 4UHVA 3HOVG 4GKKQ 5BN5A 1SYEA 5K36H 4A3LH 2K5WA 3M7GA 4UP7A 1Q82C 5C6AA 5IT9E 1H95A 3KFUA 4F88A 1ET6A 1I3QH 3A0JA 1BCPF 1EUJA 2JYOA 2ZM6Q 4AYBG 1KDAA 4MN3A 1VQ8A 1TWGH 1YNNC 1XYIA 2F3IA 2Q2UA 1S5ED 3RN2A 4FNFA 4E6IA 4A3IB 1TT2A 2AWNA 2N3SA 4P2CB 2F0NA 4BY1G 4DK3C 4A3EG 3PUZA 3I4MH 3KLSA 5CR3A 5IY0A 1PTOD 3SEBA 1SFOB 2PW5A 3S2DH 3UE0A 2HQLA 4C3IH 4P74A 2NVYB 3NBHB 1A2TA 1C9OA 3T4AC 3L2PA 1IBKQ 4IPCA 1HUNA 1O80A 4JK1C 4C3IG 3NBIA 3HS0C 1N34Q 1PTOB 4YWKA 1VCIA 4UP8A 3R3OA 3SR1A 3RMHA 1PXUA 1N33L 1SBBB 2EJFC 3R2TA 3X3NA 1CKNB 4DUYL 3PO3H 3S2HH 3ERSX 3JAMc 2YTVA 2WKCA 5JJLA 4DF7A 4DGZA 4DR4Q 3K5MA 4JI0L 3ULLA 2JXMB 4ZLTF 3PF5A 1VQ6A 1J6QA 2R93B 1NNXA 4HJ7A 4DV3L 4JI5Q 2Q2TA 2IT1A 2D0PA 3GTMH 4KD3A 4B3MQ 2VQFQ 2PNRC 2UUCQ 1X54A 1EY4A 1I6VC 3MAQA 4JYAL 4J1MA 1HNWL 4JBWA 4JOIC 5KNDA 1SRUA 3PO2H 4H13C 4RWSC 2F0SA 4LFCQ 1EY0A 4A3GG 3PO2G 2RDHA 1Z47A 1FR3A 4HCSA 3LWEA 1X6OA 4A75A 4LFBQ 1TWHH 3CRKC 3RZDH 4RHRA 3CC4A 4IFDJ 4DR2L 4GOPC 4HMJA 1HR0L 2R7ZB 2KEEA 4J6HA 1SNMA 5D14A 2F4VL 1XPUA 1A3VA 4JI4Q 4A3MB 1C7YA 1SAPA 4M1UB 2LMCB 1AEXA 4G57A 2L55A 4RFBA 1WCMB 2PI2A 2DJFC 4IN3A 3RN5A 1AFPA 4DN4M 2F0EA 4ZQ3A 2QDLA 1PFSA 2PO4A 3RR5A 4GNXC 1XMQL 1EIGA 1F77A 1D5MC 3CMEA 2AMCB 4DV1L 1SDFA 4AIMA 2PQAB 3FDTA 4HJ8A 2XRSD 4OO1G 2JJQA 2XWBB 5IWAL 3I4NH 3K7AB 1JORA 3F2BA 3S15H 2N88A 4DV5L 3I4NG 1B50A 5FKAC 2EY6A 4IUVA 3VYTA 3OWFA 1VS0A 2IHEA 4Y7NH 4A93H 1IW7C 2KUMA 1QILA 1LTGD 1NMFA 1WD1A 5FLXc 4A93G 5CBAE 4KHPL 2RCFA 2VY3A 3TP7A 5A2QL 4BY7G 1EEID 1II3A 1AZQA 4LF6Q 5EJWA 3RLOA 1U5KA 3I91A 2D0OA 4IFDI 1HTPA 4GKKL 4CJ1B 1I94Q 4LF9Q 1L1OB 4U673 3QJYA 3DWAA 2RF4A 4RKLA 2JA6G 3S16H 1TU2B 2SEBD 1LTRD 2ZM6L 5JJZA 2JA8B 1V43A 3NK9A 2CHBD 1H9MA 2AWOA 1I6HB 1YNXA 1SNQA 3FPPA 3N52A 1DZ1A 3K8AA 3VR6A 2WAQG 1RF2D 3S14B 5C5LA 4AH6A 1EFID 4DAMA 1TWCB 4BBSB 3GTLH 3E3XA 4MZ9A 1STEA 2KCCA 3TN2A 5DAUA 2Y0SG 1IBKL 4IPHA 4JI6Q 3KF6A 4RG1A 1YZ6A 2XTIA 4J8QA 4LF4Q 5GADC 1N34L 1A2UA 3PIPA 3CQZB 1H9KA 3VR3A 3J81E 4B9XA 4L5SA 2LFNA 3TBIB 2BH8A 2JA7G 2RDGA 5M3MB 3J80L 3Q8DA 2M2LA 4J15A 1G291 2L12A 2WB1G 4DR4L 2WACA 1HNXQ 3D6CA 3GDEA 3S1RB 3HOZG 1FYCA 1HPCA 4OGQC 3EBEA 4HR7B 4B3TQ 1EYCA 1B44D 2KCMA 4JI5L 4IFDH 5M9OA 3JC66 2XNAC 5HURA 4JPBW 1EU3A 4NKLA 3NWTA 2EYMA 4B3ML 4IFDG 2VQFL 4F87A 3BZKA 3A56A 3CCQA 1EFWA 1ASYA 4A3BH 3CXCA 4DV6Q 1ILQA 5C4ZA 4LF8Q 1LYLA 4IUTA 4KTAA 4DAYB 3KJOA 2A69C 2JA5B 3C1EA 4A3BG 1DONA 4LFCL 5M5XH 1YNJC 3S1MB 3HGBA 4PNYA 5C44B 4RCOA 4RKBA 5I6WA 1D1IA 3KUPA 1IHZA 1HR0W 4LFBL 4POGA 3K5OA 2L11A 4RCNA 1VQAA 2CQAA 1I5FA 1QUQA 5FLMH 1XNQQ 1QZGA 1X3FA 2E2HB 5D3IB 1GHJA 1NMGA 3AFQA 3FKIH 1Y1VH 5FLMG 4JI4L 4CKEA 1QZHA 1NTGA 1Y1VG 1BNZA 3S1QH 5CV4A 3Q24A 1EY6A 1MSHA 3M7NA 2H4OA 3BZDB 3TEHB 1STGA 2ZXPA 1U4PA 3DWQA 3HOVB 5C3EB 1T5XD 2B8FA 3SK5A 5KRUA 4L5TA 2AUKA 3FHWA 5COYA 3TP6A 1EWIA 4LUZA 4QUCA 4CDEC 4HAEA 2DNEA 2Z0SA 1PRTC 2EQSA 3BS1A 1JCKB 5HGQA 2Q2HA 4O0AA 1PTOC 3JAME 1I3QB 3IKJA 1YNND 1AE2A 4JI3Q 5CBEE 4QGUA 2CH4W 2EY5A 3QWNA 2B2WA 1TWGB 1PTOH 3MTSA 1D8LA 5AJ3Q 2QW7A 2ZTCA 1QVGA 4DK0A 4NDXA 4LF6L 2NB0A 5IYCG 4LK1C 4ME3A 3C2PA 4ZYSA 1GKHA 2CWAA 1I94L 2B2TC 4I65A 3T51B 2K4KA 4LF9L 2IY5B 1VQDA 1IL8A 3S2DB 2IHFA 4C3IB 1O7ZA 2TSSA 2TMPA 3I4OA 3MWYW 3F2CA 2R92H 4OX9Q 5JVG3 3NQIA 2O5IC 2K75A 5LHY1 2B63H 5GAGC 3PO3B 3S2HB 1A3TA 1A63A 4XQQA 3KYHC 1NSNS 3CP0A 1C0AA 1JJGA 5IIFA 5IP7H 3H94A 3D4RA 3J81i 1CK1A 3CCEA 4DR1Q 1STYA 5IP7G 4O1NA 1SYBA 1SE8A 3R8BA 1UE1A 1MJEA 4JI6L 2OEOA 2B2YA 2Q2IA 4P75A 2QCPX 3GTMB 4JV5Q 4LF4L 1RIPA 4LMQD 2KECA 3I4LA 1JWMD 4LNQA 3FVQA 1IYJB 3QR8A 1J9OA 4NMZA 1CT1D 1KRTA 1HZBA 2MGSA 2A73B 4R9WA 2JSOA 3TP8A 3PO2B 1V9PA 2EXZA 2CKZB 4PZ8A 3PSIA 1HNXL 5ELEA 3U4VA 5KIXA 3H0GG 1G6PA 3BJUA 4A3DH 3GTJH 1PMRA 1TS4A 5BN3A 4B3TL 1B8AA 3E5SA 3A55A 3HOUG 4DK1A 2JE6I 1TWHB 3RZDB 5FLXE 4GS3A 2GVBA 1R9TH 3CU7A 3S9WA 1S72A 1DOLA 4DV6L 4LF8L 4GOPB 4LUVA 3NBHA 2A8VA 4C3JH 2V4DA 2C9OA 1EY5A 2LSSA 1AW7A 4C3JG 4EVOA 2ZJPA 3KF8B 1U4LA 4UPAA 4BWGB 1GM5A 4WJ4A 1XTDA 2CFMA 1CKNA 2R7FA 3GQBA 4AQYQ 1Y8PB 1WVLA 1BDOA 1F2LA 3J7ZC 4GNXB 1KHIA 4XYOA 1RHPA 3TP5A 5HGTA 1RCVD 1XNQL 3I4NB 3K5NA 4ME5A 5J3BA 2YV5A 3S15B 1IW7D 1CZGA 2R61A 1Y14B 1LO5D 4OL7A 1W2BA 4Y7NB 4U68A 4A93B 4PG3A 4GLVB 1VQIA 4DV4Q 1YI2A 1C48A 3MHBA 4ZUIA 1OXVA 1VQ4A 1N33Q 1O7YA 3J80c 1Q12A 1GUWA 3JAMi 5FO8B 4DUYQ 2F0LA 2OQ0A 2I07B 4I7ZC 3GTGH 5G3LD 1RJTA 4OWXB 2A5HA 4JI7Q 1TWFH 3PUVA 2VL6A 2JA6B 2F0MA 2O2LD 2K52A 1D7QA 1B3QA 3HKSA 2QDBA 2F0UA 1IXRA 3S16B 1E2VA 4JI3L 5IP9H 4HTHA 1KQSA 5AJ3L 5EQ0A 4L6TB 4G7OC 3O13A 4A3FH 3CCSA 4IUUA 1JR0D 5EBDA 3CCRA 1HHVA 2J7ZA 4KY5A 2Y0SB 4RH6A 2ZXOA 2VQEQ 3GTLB 3S1RH 3P20A 2RHQB 3M3YH 3KLWA 1UWVA 1VQFA 3ZYYX 4C56C 1A8VA 1E7ZA 3CC7A 1MIUA 4OX9L 2NZ1D 4CBVA 3PIP3 2ATWA 1A0IA 3PIOA 4WRDA 1STBA 2DGYA 3GD7A 2VUMH 4XIGS 2WB1B 1HUMA 2DUDA 5JJKA 2B2UC 2BOSA 4C1NI 2NUCA 4C3HH 1R4PB 4AYBE 4DR1L 2QEJC 4C3HG 2B2VC 3AYHB 1NR2A 4X3UA 3H09A 3LWUA 3TMEA 1ASZA 2EYLA 3H15A 3V2TA 4JV5L 4FXDA 1OXSC 2I46A 2NVXH 3GTQH 2DJGC 1S5CD 2EY2A 3OW2A 2OTLA 1K83H 2N78A 1K0RA 2WINB 1A3UA 1L1OA 3EN2A 4DFAA 4A3BB 4CDDC 4R4OA 1YNJD 2EY1A 5JEAG 1JOQA 5M5XB 4JVZA 4LJZC 1N36Q 3DWPA 3U9OA 4A3CH 2K5VA 4XTCS 1BCPC 4MTKA 4JG2A 1GUGA 3TS0A 1PH1A 4A3CG 1X55A 4L63B 1EQVA 2QKIC 4KI0A 3HG9A 3OW7A 2I5MX 1K3RA 1XTCD 3I72A 1SJED 1HA6A 3I73A 4ZKBB 1S4ZA 1EQQA 4HCEA 3FKIB 1Y1VB 1V8QA 4KY7A 3MVVA 2EJMA 2KOLA 1ESRA 1VQBA 4ZRZA 1EL0A 2PZUA 3S1QB 1E3PA 5ELOA 4DNTB 3PUYA 3PQIA 2BE5D 2SOBA 3NXWA 1NE3A 1SROA 1ZYRD 2QILA 3NTIA 5CYUA 5EPLA 3CF5A 1SSOA 2OCEA 4N8X1 1TVXA 3AB9A 4C2MB 3CPFA 3OIPA 1PLFA 4NPSA 4A3EH 4BY1H 3V96A 4AQYL 1VF5C 4TRDA 2NVQH 5IGBA 1PFMA 5E3FA 5DM73 1PRTD 1TIID 4GN5A 3CPWA 3S24A 4B3RQ 3K5LA 4TQUS 3D4WA 5C4HA 1CTMA 1BOSA 1UUPA 2OQKA 2MJ8A 4QIWB 2EJGC 4H0LC 4FYDA 1PRTB 3U4ZA 3U50C 2EOTA 4DV4L 3MFGA 1EOVA 4GKJL 1MBYA 3PGZA 4KKTA 1E1TA 4OEMB 4IJLA 1LTSD 5LMUQ 4YCUA 4OONA 2FXQA 4OO1I 1GUSA 3F8TA 4QL5A
chains in the Genus database with same CATH topology
1ZXTA 4ID6A 4RGTA 2LKVA 5C3WA 2R92B 5A2QE 3DEPA 4IQZA 1C4QA 2FJ2A 2B2VA 5CGKA 3T13A 3OSOA 2B63B 3VA7A 1SEBD 1X3PA 1B2TA 2RVLA 3K59A 1G8ZD 4KK7A 1JWUD 4CKCA 5CMDA 1RTOA 4FVMA 1EQTA 4FF3A 2BDOA 2IWHA 3GO5A 3V05A 3H6MA 4ZUJA 3IAYA 3L3OC 1EIHA 4EGVA 4V0BA 1X3QA 2IX3A 3PUWA 1VMCA 3I8ZA 3NTHA 1CA6A 4B08A 1B9MA 1SNDA 4A3DB 1JQYD 3GTJB 2K7VA 4OO1H 1SE3A 3KLRA 4F7XA 3E6ZX 3W2DA 1R9TB 3K58A 3J80E 1EWCA 4UDUC 4C3JB 1A6XA 2O4XA 1ENCA 4ZKCB 1EZ6A 1EYAA 2EYOA 4YIJA 2VB3X 2XIWA 3DXJC 4IZ8A 4FO2A 2IW3A 1EYDA 3D31A 3BVZA 3IL8A 3VR5A 3BVMA 4BS9A 4TKOB 3D3RA 1JWSD 4FXKC 2BA0A 2F0HA 3L9AX 1W6KA 3SDZA 2NN6G 3GTGB 1SNOA 1AP0A 1TWFB 3FPUB 4Z9CB 3VR2A 1EY9A 3WOEA 2F0PA 5D3DA 1I4HA 4QMGA 3MEHA 2G9HD 4KN7C 1EEFD 5LL6S 4G7ZC 2F0DA 1Z6HA 2QF7A 2IX1A 2AQ1B 4A3FB 4DNRB 5C5MA 2K04A 1JICA 4KJNA 1ML0D 5ELCA 3X3MA 3KF8A 3M3YB 2F0OA 4K6DA 2JEAI 1I4QA 3J7AF 2K05A 5AFWA 1QB5D 3PIO3 2F0FA 3KK7A 1Q1EA 2VUMB 4C1NK 1DCZA 4KJOA 4C3HB 1ESFA 1U4MA 2X6GA 1TY0A 2R3ZA 2NBFA 1SYDA 3HRZC 3CHBD 1DJRD 2PPBC 2Q8RE 3C46A 2NVXB 3GTQB 2PW7A 4MHEA 1AZPA 3PV0A 4RGMA 1K83B 2M9VA 2X69A 1DXMA 1C8CA 1KLUD 4DXGA 5BN4A 1O78A 4N9TA 1BCPD 1JB3A 2BA1A 2RBMA 2BE5C 2L0CA 1ZYRC 3J7YW 2EVBA 1B1ZA 1BCPB 3C1FA 3A7LA 2Q8IB 1KDCA 2D62A 1Y8NB 1SXTA 5JPMC 5KYLA 1PZKD 1S5BD 3AU7A 1U4RA 4AYBB 4EQNA 4KKSA 1SMYC 1HRJA 5CV6A 1XX8A 1NAPA 3G7LA 2E76C 3A8IE 4WFN3 2PCFB 4A3EB 4BY1B 2NVQB 2E75C 4ZAIA 5FK9C 2SNSA 5LL6X 1PFBA 1BO0A 2L5TA 3DHQA 2Z4IA 1STNA 4F8MA 3WOFA 2EYPA 2WKDA 1QNUA 1GHKA 5FO7B 1V1OA 2K33A 3EJIA 3MXGA 2K01A 2PZWA 2R6GA 4LAAA 1NUCA 1PTOF 4QUFA 1CI3M 1RTNA 4L8JA 1BBXC 2XRQD 2L1BA 1QE6A 1H9SB 3Q6SA 1UNSA 1Q90A 2LS01 3FEWX 1L0XB 2HCIA 4K2KA 4KV6A 4HEDA 5M5WB 5D65A 5ISRA 2JEBI 3L7ZC 1MGSA 2EYJA 2KQ3A 4A3GB 3VA5A 2F0WA 4RHSA 1W6JA 2RA4A 1NR4A 1B4OA 1DD2A 2RKSA 4NP5A 1WTQA 4RAUC 2A6HC 3TSSA 1LT5D 3OMCA 3I90A 4XT1B 5M5YB 2NYZD 3CRLC 5JEAJ 1WTXA 1D6EC 3BG3A 1UAPA 3RLFA 4K5XA 4K5VA 4K8JA 1SYFA 2NWGA 1BR9A 4ZK9B 2FMCA 2VB2X 1KNEA 2E2JB 1IKMA 3QOLA 1E2ZA 4MIUA 3A8KE 2Z8LA 5I2XA 4XYQA 3MXUA 1KNAA 2B2TA 1RODA 1GUOA 2AQ3B 5E4XA 1ENFA 1SE2A 5J1ZA 2VXWA 4BY7B 3OMGA 4K8IA 1H9JA 4FF4A 5IGGA 4KN4C 2RDFA 2EYHA 2DNCA 4R8IA 4IALA 2K1BA 3TZUA 1QCBD 3I70A 5IOCA 5T1GA 1DOKA 3NP8A 1TR5A 1X32A 1VMPA 1KABA 2WAQB 3N6RA 3HP3A 3IFTA 2E74C 4QCLA 1PDQA 3GV6A 4DA2A 3HOYB 2PQEA 1E0BA 2E2DC 2DY7A 5A35A 2EE1A 3UI2A 4ABNA 2A68C 1MSGA 3DM1A 4IUNA 4G7HC 1F9PA 1PZID 3H3VC 1PYWD 5JOBA 3MXNA 3NE5B 2JA7B 4QB4A 3LNNA 3GTPB 3HOZB 4BBRB 4NW2A 1PFNA 2RSOA 1FGBD 1BXTA 2ZT9C 3D8GA 5E4WC 2KJXA 1LT6D 1LACA 1RDPD 1IYUA 1A15A 2JP1A 3FRPB 3MA2B 2MP1A 2F0VA 3C3LA 2IJ0A 3BDCA 1Y1WB 3HKZB 4CJ2C 5JEAH 5F2DA 2M00A 1BUVT 5KNCA 1V1PB 3OWEB 1OXTA 4QF4A 5I4DA 2WP8J 3NHHA 1CZWA 4FF2A 1DYQA 1CHPD 1STAA 2HUGA 2Z1CA 3J7AV 1EY7A 4Q0FA 2CW0C 3BYTB 2J4XA 4V190 3BYYB 4K6LA 1ILPA 1OXXK 3M85A 3Q0AA 4EQPA 3D4DA 1LV9A 1PZJD 2O5JC 3P7JA 2RSNA 4GZYC 5C0XJ 4PV1C 5EKIA 5CORA 4XT3B 4PMWA 1TWAB 1BF4A 2XVSA 2D9UA 2ENBA 3VYUA 3WDNA 5K36G 5EPJA 4IUQA 2F3WA 3OIQA 4XXEA 1SMYD 2OF1A 2A6ED 5EBCA 5KGUA 1I4PA 5EKLA 2F0TA 2F0KA 4KKUA 2CVRA 1U9RA 3MFYA 4CHTB 4DAYA 2K28A 3CKIB 2KA7A 4IURA 3RUZA 2EDGA 2L9HA 2B2UA 1FNVA 3W3AA 1LT3D 3A54A 2WV6D 1ET9A 1GUTA 5C0XI 1Y8OB 2PZTA 2K5QA 1LTAD 4M8AA 3BDOA 3ITPA 1Z7TA 3T53B 2OT2A 1Q8IA 2GA4B 1S5FD 2YYZA 1AN8A 4HN7A 1S5DD 3M4OB 2KVMA 1STHA 5JAVA 3URYA 2HQEA 2C5CA 3KLSX 1WTOA 1CHQD 2ZXRA 5EPKA 2HCCA 2ID0A 3VR4A 2KEDA 1HFNA 2K32A 2NN6I 5IT9L 2F0JA 2FMMA 2AUJD 3H0GB 2L4NA 5I6YA 3NSWA 2KCNA 2FINB 4PQXA 3U9SA 1CQFA 3S17B 2F3VA 3HOUB 3SK4A 2A6HD 3QOJA 5ELFA 2IPKD 3EQLC 1L0YB 5KNBA 2B39A 3GV3A 4KD4A 4H7BA 3RD4A 2F1MA 1WTVA 3K6OA 4K5WA 5C0XH 3H91A 4FXGC 1T5EA 5C0XG 1CA5A 1LT4D 3QIAA 4X3TA 4R8NA 2K6AA 4OHJA 1JC7A 1J8IA 3A7AB 5C3XA 2BCOA 1GJXA 3HEJA 1H9SA 2B8GA 1QWYA 3M4YA 1D5ZC 3ERQA 3DEOA 2NN6H 1RD9D 1H9RA 3F2UA 3EVQA 3SK8A 3P1HA 3ND9A 4WJWA 1F2MA 3DUZA 1EY8A 3K0YA 4KHVA 1G2SA 4XQJA 3PMFA 2N55A 1EWHA 2XWJB 5G3LF 2EZVA 2FFKB 1OO9B 1F9RA 2DY8A 4A3KB 2B2WC 2A68D 3D6WA 3OPOA 1CQVA 1HQRD 3SHLA 3EROA 5IGDA 1IKLA 1QJOA 1I50B 3SXHA 2MUYA 1SJHD 5IGFA 1TS3A 1WTWA 5JPNC 1GOZA 1FNWA 1HA5A 2EYFA 3QG1A 1WD0A 1KAAA 1F9QA 5IGEA 2D5DA 1LLRD 1Q3LA 3FMCA 5J22A 2F0GA 5E1FA 1TY2A 1Y69U 2NTSA 4K2LA 2WIIB 3QO2A 2B2YC 1SYGA 1R4QB 2IL8A 5EKKA 2VNUD 4EQOA 2F0QA 1HXYD 2CW0D 5C4XB 4CGYB 4KHZA 3NQTA 2F03A 4O42A 5CV9A 5I9OA 3BDLA 3OOCA 5ELDA 3Q23A 3GTKB 1K8OA 1I4GA 4ULLA 1CFMA 4G4KA 3AMUA 1SNPA 2AQ2B 2A6EC 1VF7A 1XWEA 5FOBB 3J81L 1JE4A 4RGNA 2FHTA 1HCZA 1RKNA 3HOXB 2E2IB 2PYKA 1G91A 1ZEQX 2NTTA 4DAPA 3KBGA 3P75A 1PRTF 1ENAA 3I4MB 2NVTB 5J39A 3KBXA 1V1PA 2DN8A 3S1NB 2HDLA 1QOHA 4HMIA 3K57A 3HOWB 1B53A 1EU4A 4B9WA 4UAIA 3SE0A 1G2TA 5KEEA 3T56B 1SNCA 2F0IA 2Z4HA 2KHSA 4OIJA 4S3SA 5CV5A 4ODGA 4PMCA 4TSSA 1Q1BA 1G6ZA 4IUPA 4KY6A 1DOMA 2J0TD 3MXPA 3NTKA 4CJ0B 1F2YA 1QG7A 4X3SA 2F4IA 1WTRA 3ONAB 2RQXA 1UEAB 4DU9A 4RGOS 3BVGA 4PMBA 1SYCA 3E0JA 3R93A 3JAML 4HSVA 1GXDC 2MPMA 3HZXA 1NCVA 3G6JB 5M3FB 5FO9B 1D1KA 3EFXD 4ILWA 1CM9A 2LY7A 2IX0A 1WTPA 3A8JE 3NPPA 1GUNA 3GP7A 1BQQT 3QB3A 1I4RA 1LTBD 3ND8A 2SNMA 1F9SA 4XDXA 1K8MA 5DM63 3SVMA 2X6LA 3NWSA 2K5DA 3R2IA 4XQNA 1M4VA 2SDFA 1QNKA 1IYVA 2A74C 1B3AA 2XSCA 4RA8A 2YU9B 1KLGD 3VYSA 1E2WA 2K03A 1ZKOA 5I9PA 3I3CA 3NUCA 3RZOB 1EZ8A 4HSPA 4N9PA 4DXFA 1F2ZA 1KTKA 3EA6A 1EOTA 4WORA 1LTID 4BA2I 5NUCA 4BA1I 1FD7D 4FP5D 2ICIA 2XN9C 1DM0B 3MZ5A 5CV7A 5IODA 2Q8TA 2OXPA 5JVH3 1MD2D 5TSSA 5DNFA 1TKWB 1HTLD 4X3KA 1I4XA 2EPBA 5FLXL 3SK6A 1OXUA 3LX0A 1VDZA 4K14A 4A3JB 3OHXC 5C4JB 5EGTA 1D2BA 3T16A 3Q22A 5DEHA 5ELBA 4Q5VA 2ICEC 2D2CC 3MC0B 3PUXA 3IFDA 3TZDA 3TDQA 4H44C 1SE4A 4FF1A 5CV8A 4CKBA 3DMUA 1TS2A 1O7LA 1ICWA 4OIKA 1KDBA 1LTTD 4KMUC 1LABA 1JOKA 1HFGA 5K5PA 2H1EA 2PMZB 2A69D 1B9NA 5CC4A 1TS5A 1ONLA 1MI2A 1XXGA 1M8AA 1JOOA 5IGCA 3VYRA 1TQOA 1D5XC 1FNUA 2G9DA 5I2YA 2HDMA 1HQMC 2BDNA 5T1IA 2MHVA 4DAVA 5KYIA 3GTOB 5BN5A 1SYEA 5K36H 2K5WA 3M7GA 5C6AA 5IT9E 4F88A 1ET6A 1BCPF 2JYOA 1KDAA 4MN3A 1YNNC 1XYIA 1S5ED 4FNFA 4E6IA 4A3IB 1TT2A 2AWNA 4P2CB 2F0NA 3PUZA 3KLSA 5CR3A 1PTOD 3SEBA 1SFOB 2PW5A 2NVYB 1A2TA 1HUNA 3T4AC 1O80A 4JK1C 4C3IG 3NBIA 3HS0C 1PTOB 1VCIA 3R3OA 3SR1A 3RMHA 1PXUA 1SBBB 2EJFC 3R2TA 3X3NA 2WKCA 4DF7A 4DGZA 3K5MA 2JXMB 4ZLTF 2R93B 2IT1A 4KD3A 2PNRC 1EY4A 1I6VC 3MAQA 4J1MA 4JBWA 5KNDA 4H13C 4RWSC 2F0SA 1EY0A 2RDHA 1Z47A 1FR3A 4HCSA 3LWEA 3CRKC 4RHRA 4IFDJ 4HMJA 2R7ZB 2KEEA 4J6HA 1SNMA 5D14A 1A3VA 4A3MB 1SAPA 4M1UB 2LMCB 1AEXA 4G57A 2L55A 4RFBA 1WCMB 4IN3A 1AFPA 4DN4M 2F0EA 4ZQ3A 2PO4A 1EIGA 1F77A 1D5MC 1SDFA 3FDTA 2XRSD 4OO1G 2XWBB 3K7AB 1JORA 2N88A 1B50A 5FKAC 2EY6A 4IUVA 3VYTA 3OWFA 1IW7C 2KUMA 1QILA 1LTGD 1WD1A 5CBAE 3TP7A 5A2QL 1EEID 1II3A 1AZQA 5EJWA 3I91A 4IFDI 1HTPA 4CJ1B 4U673 3QJYA 3DWAA 4RKLA 1TU2B 2SEBD 1LTRD 5JJZA 2JA8B 1V43A 3NK9A 2CHBD 1H9MA 2AWOA 1I6HB 1SNQA 3FPPA 3N52A 1DZ1A 3VR6A 1RF2D 3S14B 5C5LA 1EFID 1TWCB 4BBSB 1STEA 2KCCA 3TN2A 5DAUA 4J8QA 1A2UA 3CQZB 1H9KA 3VR3A 3J81E 4B9XA 2LFNA 3TBIB 2RDGA 5M3MB 3J80L 2M2LA 1G291 2L12A 2WACA 3D6CA 3S1RB 1FYCA 1HPCA 4OGQC 4HR7B 1EYCA 1B44D 4IFDH 5M9OA 5HURA 2XNAC 1EU3A 4NKLA 3NWTA 2EYMA 4IFDG 4F87A 3A56A 1ILQA 5C4ZA 4KTAA 4IUTA 2A69C 2JA5B 3C1EA 1DONA 1YNJC 3S1MB 3HGBA 4PNYA 5C44B 4RCOA 4RKBA 5I6WA 1D1IA 3KUPA 1IHZA 3K5OA 2L11A 4RCNA 2CQAA 2E2HB 5D3IB 1GHJA 4CKEA 1BNZA 5CV4A 3Q24A 1EY6A 1MSHA 3M7NA 2H4OA 3BZDB 1STGA 2ZXPA 1U4PA 3DWQA 3HOVB 5C3EB 1T5XD 2B8FA 3SK5A 5KRUA 2AUKA 5COYA 3TP6A 4QUCA 4HAEA 2DNEA 1PRTC 3BS1A 1JCKB 1PTOC 3JAME 1I3QB 3IKJA 1YNND 5CBEE 2EY5A 3QWNA 2B2WA 1TWGB 1PTOH 3MTSA 4DK0A 4NDXA 2NB0A 4LK1C 3C2PA 4ZYSA 2B2TC 4I65A 3T51B 1IL8A 3S2DB 4C3IB 1O7ZA 2TSSA 2TMPA 3MWYW 5JVG3 3NQIA 2O5IC 5LHY1 3PO3B 3S2HB 1A3TA 4XQQA 1NSNS 5IIFA 3H94A 3D4RA 1CK1A 1STYA 4O1NA 1SYBA 3R8BA 2OEOA 2B2YA 2QCPX 3GTMB 4LMQD 2KECA 3I4LA 1JWMD 3FVQA 1J9OA 4NMZA 1CT1D 2MGSA 2A73B 4R9WA 2JSOA 3TP8A 3PO2B 2EXZA 5ELEA 5KIXA 1PMRA 1TS4A 5BN3A 3E5SA 3A55A 4DK1A 2JE6I 1TWHB 3RZDB 5FLXE 3CU7A 3S9WA 1DOLA 3NBHA 2V4DA 2C9OA 1EY5A 4C3JG 1AW7A 4EVOA 1U4LA 4BWGB 3GQBA 1Y8PB 1WVLA 1BDOA 1F2LA 4XYOA 1RHPA 3TP5A 5HGTA 1RCVD 3I4NB 3K5NA 4ME5A 3S15B 1IW7D 1CZGA 2R61A 4OL7A 1LO5D 4Y7NB 4U68A 4A93B 1C48A 3MHBA 4ZUIA 1OXVA 1O7YA 1Q12A 1GUWA 5FO8B 2F0LA 2I07B 4I7ZC 5G3LD 1RJTA 2A5HA 3PUVA 2JA6B 2F0MA 2O2LD 2QDBA 2F0UA 3S16B 1E2VA 4HTHA 5EQ0A 4L6TB 4G7OC 3O13A 4IUUA 1JR0D 5EBDA 1HHVA 2J7ZA 4KY5A 2Y0SB 4RH6A 2ZXOA 3GTLB 3P20A 3ZYYX 4C56C 2NZ1D 4CBVA 3PIP3 4WRDA 1STBA 3GD7A 4XIGS 2WB1B 1HUMA 2B2UC 2BOSA 4C1NI 2NUCA 1R4PB 2QEJC 4C3HG 2B2VC 1NR2A 4X3UA 3H09A 3LWUA 3TMEA 2EYLA 3V2TA 4FXDA 1OXSC 2I46A 1S5CD 2EY2A 2WINB 4DFAA 1A3UA 4A3BB 1YNJD 2EY1A 5JEAG 1JOQA 5M5XB 4LJZC 3DWPA 3U9OA 4XTCS 1BCPC 1GUGA 4L63B 1EQVA 2QKIC 4KI0A 3HG9A 3OW7A 1XTCD 3I72A 1SJED 1HA6A 3I73A 4ZKBB 1S4ZA 4HCEA 3FKIB 1Y1VB 1V8QA 4KY7A 3MVVA 2EJMA 2KOLA 1ESRA 4ZRZA 1EL0A 2PZUA 3S1QB 4DNTB 3PUYA 2BE5D 2SOBA 3NXWA 1ZYRD 5EPLA 2QILA 3NTIA 5CYUA 1SSOA 1TVXA 3AB9A 4C2MB 3OIPA 1PLFA 3V96A 1VF5C 4TRDA 5IGBA 1PFMA 5E3FA 5DM73 1PRTD 1TIID 3K5LA 4TQUS 3D4WA 5C4HA 1CTMA 1BOSA 1UUPA 2MJ8A 4QIWB 2EJGC 4H0LC 4FYDA 1PRTB 2EOTA 3MFGA 1MBYA 4KKTA 1LTSD 4OO1I 1GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYV A;  2DN8 A;  5A35 A;  2F1M A;  3VR5 A;  3QG1 A;  2V4D A;  5BN4 A;  1FR3 A;  1O78 A;  2KCC A;  5C0X H;  1DD2 A;  3IKJ A;  1E2W A;  5K36 G;  2A6E D;  4TKO B;  1T5E A;  1HQM C;  1ZKO A;  2BA1 A;  5C0X G;  4IQZ A;  2A68 C;  3QIA A;  2BA0 A;  3LWU A;  2BE5 C;  3SE0 A;  4G7H C;  1ZYR C;  3CRK C;  1H9K A;  3VR3 A;  2A6H C;  1OXS C;  2EVB A;  4DK0 A;  3GQB A;  4KKU A;  1Y8P B;  2D5D A;  3T56 B;  1BDO A;  4LK1 C;  5BN5 A;  3SDZ A;  3MFY A;  3NE5 B;  3A7L A;  3FMC A;  2D62 A;  2NN6 G;  2Q8I B;  3VA7 A;  1Y8N B;  5K36 H;  3A7A B;  4BA2 I;  3T51 B;  3LNN A;  4BA1 I;  1Y69 U;  1GJX A;  1G29 1;  2KA7 A;  2LMC B;  1Q1B A;  1H9S A;  1IW7 D;  5JEA G;  3VR2 A;  2EDG A;  4LJZ C;  3CRL C;  1FYC A;  1HPC A;  2B8G A;  4OGQ C;  3BG3 A;  4HR7 B;  4KKS A;  1SMY C;  3RLF A;  3M4Y A;  3W3A A;  4XTC S;  1YNN C;  4KN7 C;  1OXV A;  4IFD H;  2ZT9 C;  1GUG A;  1GUT A;  4KHZ A;  2BDO A;  1Q12 A;  1Y8O B;  1TKW B;  4G7Z C;  1LAC A;  2E76 C;  4IFD G;  3A8I E;  2NN6 H;  1Z6H A;  1IYU A;  4KI0 A;  2PCF B;  2O5I C;  3OW7 A;  4OO1 G;  3BDO A;  2QF7 A;  4I7Z C;  1Z7T A;  3OOC A;  3I72 A;  3T53 B;  2E75 C;  3PUZ A;  1H9R A;  4DNR B;  3I73 A;  3PUV A;  2A69 C;  1K8O A;  1E2Z A;  1OXU A;  5JEA H;  3A8K E;  1VDZ A;  1V8Q A;  3H94 A;  3D4R A;  5KNC A;  2L5T A;  3PUW A;  3ND9 A;  2EJM A;  1OXT A;  1YNJ C;  3MXU A;  2YYZ A;  3HGB A;  1IW7 C;  1CFM A;  1GUO A;  4DNT B;  3PUY A;  1E2V A;  4JK1 C;  2BE5 D;  1B9M A;  1VCI A;  2K7V A;  1GHK A;  2D2C C;  2A6E C;  3AB9 A;  1H9J A;  2EJF C;  2K33 A;  3PUX A;  1EWH A;  2JEA I;  1VF7 A;  3I4L A;  4OO1 H;  2CW0 C;  4RCN A;  3KLR A;  4G7O C;  1VF5 C;  1HTP A;  1OXX K;  2R6G A;  1Q1E A;  4KN4 C;  4H44 C;  3VR4 A;  1GHJ A;  3M85 A;  1CI3 M;  2K32 A;  2DNC A;  1HCZ A;  2NN6 I;  1DCZ A;  4L8J A;  4TQU S;  3QJY A;  2JXM B;  1CTM A;  3A8J E;  1O7L A;  1H9S B;  2AUJ D;  1GUN A;  2O5J C;  2EJG C;  3TZU A;  1A6X A;  3P20 A;  1TU2 B;  4H0L C;  3M7N A;  2A68 D;  3U9S A;  1Q90 A;  4KMU C;  4GZY C;  1PMR A;  5BN3 A;  1V43 A;  2IT1 A;  3OPO A;  2A6H D;  2PPB C;  4PV1 C;  3ND8 A;  4DK1 A;  2AWO A;  1H9M A;  2JE6 I;  1LAB A;  3EQL C;  2PNR C;  4KKT A;  2B8F A;  3FPP A;  3N6R A;  1K8M A;  3VR6 A;  2AUK A;  3DXJ C;  1I6V C;  2A69 D;  1B9N A;  2E74 C;  2JEB I;  3IFT A;  3L7Z C;  3GD7 A;  5KNB A;  1QJO A;  3PV0 A;  4XIG S;  3D31 A;  4JBW A;  5KND A;  1ONL A;  2DNE A;  1GUS A;  4H13 C;  3WDN A;  1DXM A; 
#chains in the Genus database with same CATH topology
 4HJ5 A;  1ZXT A;  3A74 A;  4ID6 A;  1Q86 C;  4RGT A;  2LKV A;  5C3W A;  2R92 B;  5A2Q E;  3DEP A;  4IQZ A;  1C4Q A;  1EIY B;  5M5W H;  2FJ2 A;  2B2V A;  3G71 A;  5CGK A;  3T13 A;  3K81 C;  3OSO A;  2B63 B;  3VA7 A;  1SEB D;  1X3P A;  3DM3 A;  4A3G H;  1B2T A;  2RVL A;  4UP9 A;  3K59 A;  1G8Z D;  2HT1 A;  4KK7 A;  4HID A;  1JWU D;  2VQE L;  4CKC A;  5CMD A;  1RTO A;  4FVM A;  1EQT A;  4FF3 A;  4POF A;  2BDO A;  2IWH A;  3GO5 A;  2CWP A;  3V05 A;  3H6M A;  4ZUJ A;  1N32 Q;  3IAY A;  4DV7 Q;  3L3O C;  5M5Y H;  1NJI C;  1EIH A;  4EGV A;  4V0B A;  1VQ7 A;  1X3Q A;  2IX3 A;  3PUW A;  1VMC A;  4HIO A;  1VQC A;  3I8Z A;  3NTH A;  1CA6 A;  4B08 A;  3UDI A;  1B9M A;  1S3O A;  1SND A;  4A3D B;  1JQY D;  3GTJ B;  2K7V A;  2WAQ E;  4NXM Q;  1SE3 A;  4OO1 H;  3OYY A;  5M3F G;  3KLR A;  4F7X A;  2E2J H;  3E6Z X;  3W2D A;  3MXN B;  1R9T B;  3K58 A;  3J80 E;  1EWC A;  1TXY A;  2Y0S E;  4UDU C;  4C3J B;  1A6X A;  1N36 L;  2YTY A;  4BY7 H;  2O4X A;  1ENC A;  2HD3 A;  3CD6 A;  4YHH Q;  4ZKC B;  4HIM A;  4DR6 Q;  1EZ6 A;  1EYA A;  2EYO A;  4YIJ A;  4HJA A;  2VB3 X;  2XIW A;  3DXJ C;  1CSQ A;  1QVF A;  1E1O A;  4IZ8 A;  4FO2 A;  2IW3 A;  1EYD A;  3D31 A;  1RL2 A;  2WB1 E;  3BVZ A;  3HFZ B;  2JA6 H;  3IL8 A;  4GN4 B;  4IOA A;  4YWL A;  3VR5 A;  2R7D A;  1PYS B;  1YVC A;  3BVM A;  4BS9 A;  1VQG A;  4TKO B;  3D3R A;  3UDX A;  1JWS D;  3CCV A;  4FXK C;  2BA0 A;  2F0H A;  4YY3 Q;  3CCJ A;  3L9A X;  3D0F A;  1LTL A;  1W6K A;  3SDZ A;  1WTH A;  2NN6 G;  3HOY H;  2L15 A;  1SNO A;  4O2D A;  3GTG B;  1AP0 A;  3T1H Q;  1TWF B;  3FPU B;  3HOY G;  1M90 C;  4B3R L;  4Z9C B;  3VR2 A;  4JOI A;  1EY9 A;  3WOE A;  2F0P A;  2JA9 A;  5D3D A;  4X62 Q;  1I4H A;  4QMG A;  3MEH A;  2G9H D;  4KN7 C;  1EEF D;  5LL6 S;  2I5H A;  1YHA A;  3T1Y Q;  4G7Z C;  2F0D A;  1Z6H A;  1E22 A;  2JA7 H;  2QF7 A;  1MHW C;  2AQ1 B;  2IX1 A;  4A3F B;  4DNR B;  1YJW A;  5C5M A;  3K0X A;  5LMU L;  4GOP A;  2K04 A;  3GTP H;  1VQ5 A;  4KLK A;  3SGI A;  3HOZ H;  2GN5 A;  1JIC A;  4KJN A;  4A3J G;  4BBR G;  1K8A C;  5GAE C;  1ML0 D;  5ELC A;  3X3M A;  3KF8 A;  3M3Y B;  2HHH Q;  2F0O A;  4K6D A;  2JEA I;  1M1K C;  1I4Q A;  4GNX A;  3J7A F;  2K05 A;  5AFW A;  1QB5 D;  3PIO 3;  2F0F A;  3KK7 A;  1Y1W H;  1Q1E A;  2VUM B;  4C1N K;  3M9B A;  1DCZ A;  4OXP A;  1Y1W G;  4KJO A;  3HKZ G;  3K7U C;  4C3H B;  1ESF A;  4QIW E;  1U4M A;  2X6G A;  1TY0 A;  2R3Z A;  1QVC A;  2NBF A;  1SYD A;  3HRZ C;  3CHB D;  1DJR D;  2PPB C;  2Q8R E;  3AEV A;  3C46 A;  2NVX B;  4JI7 L;  3CCU A;  3GTQ B;  2PW7 A;  4MHE A;  1AZP A;  1N32 L;  3PV0 A;  4RGM A;  1K83 B;  4DV7 L;  1SMX A;  2MNA A;  2M9V A;  2X69 A;  1DXM A;  1C8C A;  1KLU D;  1Z9F A;  4DXG A;  3J7A 5;  1PVO A;  5BN4 A;  1O78 A;  4N9T A;  4DR5 Q;  1KRS A;  1BCP D;  1JB3 A;  1A62 A;  3ICE A;  3J80 i;  2BA1 A;  4LUO A;  2RBM A;  1WYD A;  2BE5 C;  2L0C A;  1ZYR C;  4C2M H;  3PCO B;  2EVB A;  3J7Y W;  1YIT A;  1B1Z A;  1GVP A;  4NXM L;  1YHB A;  1TWA H;  1BCP B;  4JBK A;  3C1F A;  3A7L A;  2Q8I B;  1KDC A;  2D62 A;  3VDY A;  1Y8N B;  1SXT A;  1T9H A;  1PHJ A;  5JPM C;  5KYL A;  1PZK D;  1S5B D;  2K5N A;  3AU7 A;  1U4R A;  2UUB Q;  4AYB B;  4EQN A;  4KKS A;  1SMY C;  1HRJ A;  5CV6 A;  1XX8 A;  1NAP A;  5IYC H;  3G7L A;  2VW9 A;  2E76 C;  4YHH L;  3A8I E;  4WFN 3;  4DR6 L;  2PCF B;  4A3E B;  3CMA A;  4BY1 B;  4A3I G;  4DNI A;  2NVQ B;  2E75 C;  4ZAI A;  1GO3 E;  4L5R C;  5FK9 C;  2SNS A;  5LL6 X;  1PFB A;  1BO0 A;  2L5T A;  3WWV A;  1IBM Q;  1BBW A;  3DHQ A;  2Z4I A;  4TVA B;  4LF5 Q;  1STN A;  4F8M A;  3WOF A;  2EYP A;  2PNH A;  2K5H A;  1MKH A;  2WKD A;  1QNU A;  1GHK A;  5FO7 B;  1V1O A;  2K33 A;  3EJI A;  4YY3 L;  3MXG A;  2K01 A;  2PZW A;  2R6G A;  2UXD Q;  4LAA A;  1NUC A;  1KIX A;  1PTO F;  2KEN A;  4QUF A;  3K80 C;  1VQJ A;  1CI3 M;  3T1H L;  1RTN A;  4L8J A;  3UDF A;  1BBX C;  2XRQ D;  2L1B A;  1K0S A;  1QE6 A;  1H9S B;  3FP9 A;  3Q6S A;  1UNS A;  1Q90 A;  2LS0 1;  3FEW X;  1PH4 A;  1L0X B;  2HCI A;  2CCZ A;  4X62 L;  3M4O H;  1SN8 A;  4K2K A;  4KV6 A;  4HED A;  2V1C C;  5M5W B;  5D65 A;  2UU9 Q;  5ISR A;  2K14 A;  3T1Y L;  1DGS A;  1JJ2 A;  2RHS B;  2JEB I;  3L7Z C;  1MGS A;  2EYJ A;  2KQ3 A;  4A3G B;  3VA5 A;  4HIK A;  2F0W A;  4RHS A;  3STB D;  1W6J A;  2RA4 A;  1VQL A;  1NR4 A;  1B4O A;  3H0G H;  1DD2 A;  2RKS A;  4B3S Q;  4NP5 A;  1WTQ A;  3HOU H;  4RAU C;  3S17 H;  1KC8 C;  4HJ9 A;  3OTO L;  2HHH L;  2A6H C;  3UE1 A;  4APV A;  3TSS A;  1LT5 D;  3OMC A;  3I90 A;  1E24 A;  1WI5 A;  4XT1 B;  5M5Y B;  2E8G A;  1PH3 A;  4JBJ A;  2NYZ D;  2AKW B;  3CRL C;  1PV4 A;  5JEA J;  1WTX A;  1D6E C;  3BG3 A;  1IL2 A;  1UAP A;  3RLF A;  4K5X A;  1K28 A;  4K5V A;  4K8J A;  1X9N A;  1SYF A;  2NWG A;  1BR9 A;  4ZK9 B;  2FMC A;  2VB2 X;  1KNE A;  3M4Q A;  2E2J B;  1IKM A;  3QOL A;  1E2Z A;  4JI1 Q;  2Z6K C;  4R4T A;  4MIU A;  3A8K E;  2Z8L A;  5I2X A;  4I7A A;  4XYQ A;  3MXU A;  1KNA A;  2B2T A;  1ROD A;  1GUO A;  2AQ3 B;  4IJH A;  3H3V I;  5E4X A;  1ENF A;  1SR3 A;  4DR5 L;  1SE2 A;  5J1Z A;  2VXW A;  4BY7 B;  3OMG A;  4K8I A;  1EIF A;  3A5Z B;  4GKJ Q;  1H9J A;  1XJV A;  4FF4 A;  4IPG A;  5IGG A;  4KN4 C;  1K3B C;  2RDF A;  4R4C A;  2EYH A;  2DNC A;  3TQY A;  4JC0 A;  4R8I A;  2GVA A;  4IAL A;  2K1B A;  3TZU A;  3E9H A;  2UUB L;  1QCB D;  3I70 A;  5IOC A;  5T1G A;  1N8R C;  1DOK A;  3NP8 A;  2JA8 G;  1TR5 A;  1X32 A;  1VMP A;  3TS2 A;  1KAB A;  2WAQ B;  2E5L Q;  3N6R A;  3HP3 A;  3IFT A;  2E74 C;  5LMN W;  4QCL A;  1PDQ A;  3GV6 A;  4DA2 A;  3HOY B;  2PQE A;  2UUA Q;  1E0B A;  3KDF B;  2E2D C;  4ALP A;  4LFA Q;  2DY7 A;  5A35 A;  4A3K H;  1IBM L;  2EE1 A;  2ALY B;  4A3K G;  4LF5 L;  3UI2 A;  4ABN A;  2A68 C;  1MSG A;  2LXJ A;  3DM1 A;  5GQO A;  4IUN A;  4G7H C;  1F9P A;  1PZI D;  4QJF A;  1PYW D;  3H3V C;  2PQA A;  5JOB A;  1K9M C;  3MXN A;  3NE5 B;  2JA7 B;  4NXN L;  1I50 H;  2ZJQ A;  2UXD L;  3H3V H;  4QB4 A;  5IYB H;  1G51 A;  3LNN A;  4YCW A;  3A5U A;  3GTP B;  5M3M G;  3HOZ B;  4BBR B;  5IYB G;  2G5D A;  4NW2 A;  1KL9 A;  1PFN A;  2BH2 A;  1XPR A;  4FDB A;  2RSO A;  3M4P A;  1HNZ Q;  1FGB D;  4UY8 C;  1BXT A;  2ZT9 C;  3D8G A;  3RLN A;  1X3G A;  5E4W C;  2KJX A;  1LT6 D;  3CCM A;  1LAC A;  1RDP D;  1IYU A;  1A15 A;  2UU9 L;  2JP1 A;  3FRP B;  2RCN A;  2MP1 A;  3MA2 B;  4MNO A;  2F0V A;  3C3L A;  2IJ0 A;  3BDC A;  1Y1W B;  2B29 A;  4EQ5 A;  3HKZ B;  4CJ2 C;  5JEA H;  5F2D A;  2M00 A;  1BUV T;  3NEM A;  1V1P B;  5KNC A;  3OWE B;  2JA5 G;  1OXT A;  4QF4 A;  5I4D A;  2WP8 J;  3NHH A;  1CZW A;  2PI2 E;  4FF2 A;  1DYQ A;  1X56 A;  1CHP D;  1STA A;  3U58 A;  4B3S L;  2HUG A;  5C4X H;  2Z1C A;  4PZ7 A;  3J7A V;  1XNR Q;  1EY7 A;  4Q0F A;  1IBL Q;  2CW0 C;  3NEL A;  3BYT B;  3I55 A;  2J4X A;  5C4X G;  4V19 0;  3BYY B;  4K6L A;  3UDG A;  1ILP A;  1OXX K;  3M85 A;  3Q0A A;  4JI2 L;  2A1A A;  4EQP A;  1OTC A;  3D4D A;  4DV2 Q;  2UXB Q;  1LV9 A;  1PZJ D;  2O5J C;  3P7J A;  2RSN A;  4GZY C;  5C0X J;  4PV1 C;  5EKI A;  4P72 A;  4GN3 B;  5COR A;  5C3E G;  3W5O A;  5EAY A;  4XT3 B;  4PMW A;  1TWA B;  1BF4 A;  2XVS A;  2D9U A;  2ENB A;  3VYU A;  1KXL A;  3WDN A;  5K36 G;  4A3L G;  4RMF A;  5EPJ A;  4JI1 L;  3HOX H;  4IUQ A;  3BU2 A;  2E2I H;  2F3W A;  5BR8 Q;  3OIQ A;  4XXE A;  1CSP A;  1SMY D;  4JBM A;  3HOX G;  4Y52 H;  2OF1 A;  2A6E D;  5EBC A;  4X6A H;  5KGU A;  1I4P A;  5EKL A;  4R4Q A;  4DUZ Q;  3I7F A;  2F0T A;  4JCV E;  2F0K A;  4KKU A;  2CVR A;  4BXX H;  2N49 A;  2KCT A;  2VS1 A;  1U9R A;  3MFY A;  4CHT B;  1VQE A;  1UE7 A;  4DAY A;  2NVT H;  4BXX G;  2K28 A;  3CKI B;  4OWW B;  3I4M G;  2KA7 A;  3S1N H;  4IUR A;  3RUZ A;  2QEX A;  2EDG A;  2L9H A;  2B2U A;  1FNV A;  3HOW H;  3W3A A;  1LT3 D;  1WJJ A;  3A54 A;  1BBU A;  1WOC A;  2VZA A;  2WV6 D;  4X66 Q;  1ET9 A;  1GUT A;  5C0X I;  5GRO A;  3HOW G;  1Y8O B;  2PZT A;  2K5Q A;  1LTA D;  4X65 Q;  1UE6 A;  4M8A A;  2E5L L;  3BDO A;  3ITP A;  1Z7T A;  3T53 B;  1J5E Q;  3PO3 G;  2OT2 A;  2UUA L;  1EYG A;  2MO0 A;  1Q8I A;  2GA4 B;  4LFA L;  1S5F D;  2YYZ A;  4IPD A;  1AN8 A;  1NY4 A;  4HN7 A;  4JW0 A;  3STB C;  2QGQ A;  1S5D D;  3M4O B;  2KVM A;  1STH A;  5JAV A;  3URY A;  2HQE A;  2C5C A;  3KLS X;  2KBN A;  4DKA C;  1WTO A;  1CHQ D;  2ZXR A;  4H02 A;  5EPK A;  2ES2 A;  2HCC A;  2A19 A;  1PH8 A;  2ID0 A;  3VR4 A;  2KED A;  1HFN A;  1YJN A;  2K32 A;  2NN6 I;  5IT9 L;  2F0J A;  2FMM A;  1Q7Y C;  4A4I A;  2AUJ D;  3H0G B;  1LUZ A;  2L4N A;  5I6Y A;  3NSW A;  2KCN A;  2FIN B;  4PQX A;  3U9S A;  1CQF A;  3S17 B;  2F3V A;  1HNZ L;  3HOU B;  3SK4 A;  1IZ6 A;  2KHI A;  2A6H D;  3QOJ A;  5ELF A;  5M3F H;  2IPK D;  3EQL C;  1L0Y B;  4IOC A;  2JK8 A;  5KNB A;  1PH6 A;  2B39 A;  2HIX A;  4QY7 A;  3GV3 A;  4KD4 A;  1JMC A;  4H7B A;  1FL0 A;  2F1M A;  2P5Z X;  3RD4 A;  1WTV A;  3K6O A;  1XPO A;  1UEB A;  4K5W A;  1X3E A;  5C0X H;  3W1B A;  3H91 A;  1HH2 P;  2QA4 A;  4FXG C;  1T5E A;  5C0X G;  1CA5 A;  1LT4 D;  3B6Y A;  3QIA A;  4X3T A;  4R8N A;  1LM0 A;  4K0K Q;  1GD7 A;  2K6A A;  4OHJ A;  3G4S A;  2Z6B A;  1XNR L;  1JC7 A;  1IBL L;  1K73 C;  1J8I A;  1L2F A;  2AHO B;  3A7A B;  2Z9H A;  3KOJ A;  5C3X A;  2BCO A;  5LMN Q;  3HEJ A;  1GJX A;  1H9S A;  2YU9 H;  2ZTE A;  4DV2 L;  2UXB L;  1NBW A;  2B8G A;  1QWY A;  1PA6 A;  1JJC B;  1KD1 C;  3M4Y A;  2NZH A;  1CUK A;  3RZO H;  1D5Z C;  1P16 A;  1X65 A;  3ERQ A;  1L0W A;  3DEO A;  1FJG Q;  2NN6 H;  4PZ6 A;  1RD9 D;  1H9R A;  3F2U A;  4L5Q A;  3EVQ A;  3HKZ E;  3SK8 A;  3P1H A;  3ND9 A;  4WJW A;  1F2M A;  5BR8 L;  3DUZ A;  1EY8 A;  3EIV A;  3K0Y A;  4KHV A;  2N8N A;  1G2S A;  4XQJ A;  3PMF A;  1V1Q A;  1EWH A;  2N55 A;  4DUZ L;  2YTX A;  2XWJ B;  2PMZ E;  1ICF B;  5G3L F;  4JI8 Q;  2EZV A;  4YWM A;  2FFK B;  3NEN A;  2ZJR A;  1OO9 B;  1F9R A;  5L37 A;  2DY8 A;  4CDF C;  4A3J H;  4BBR H;  5C4J H;  4A3K B;  2B2W C;  1HZA A;  2A68 D;  3D6W A;  1SLJ A;  3OPO A;  1CQV A;  3OTO Q;  2CH4 A;  4X66 L;  1VQM A;  1HQR D;  4A76 A;  1O7I A;  3SHL A;  4NB3 A;  2UXC Q;  3ERO A;  5IGD A;  4X65 L;  1FVI A;  1IKL A;  1QJO A;  3AQQ A;  1I50 B;  3SXH A;  2MUY A;  1J5E L;  2F52 A;  1SJH D;  5IGF A;  5FJ8 H;  1TS3 A;  1WTW A;  5JPN C;  1GOZ A;  1FNW A;  1HA5 A;  2EYF A;  3QG1 A;  1WD0 A;  5FJ8 G;  1HZ9 A;  1KAA A;  1PYB A;  1UE5 A;  1WFQ A;  1F9Q A;  2JN4 A;  4N8F A;  5IGE A;  2UUC L;  2D5D A;  2ZTD A;  1LLR D;  1Q3L A;  3FMC A;  5J22 A;  2F0G A;  1Q81 C;  3CW2 C;  5E1F A;  1TY2 A;  4IO9 A;  3ER0 A;  1Y69 U;  2NTS A;  4K2L A;  2WII B;  2HIV A;  2B2Y C;  3QO2 A;  1SYG A;  1R4Q B;  2IL8 A;  5EKK A;  3ZJY C;  2VNU D;  4LF7 Q;  4EQO A;  2F0Q A;  5E7N A;  1HXY D;  2CW0 D;  5C4X B;  4CGY B;  4KHZ A;  3GTO H;  3NQT A;  2F03 A;  4O42 A;  5CV9 A;  5I9O A;  3BDL A;  3OOC A;  2B3G A;  3KDF A;  5ELD A;  3Q23 A;  3GTK B;  1K8O A;  3MEF A;  3CCL A;  4X64 Q;  3FKI G;  1I4G A;  4DR3 Q;  4P71 A;  5IYD H;  3E9I A;  4ULL A;  1CFM A;  4G4K A;  4ZCK A;  5IYD G;  3AMU A;  4DR7 Q;  1SNP A;  2AQ2 B;  1VQH A;  2A6E C;  1VQN A;  1YBY A;  4A3I H;  1VF7 A;  1Q8K A;  1XWE A;  4K0K L;  5FOB B;  3J81 L;  2OTJ A;  1JE4 A;  4RGN A;  4DV0 Q;  1JB7 A;  2FHT A;  1SFO H;  1HCZ A;  1K8G A;  1RKN A;  3HOX B;  5LMN L;  2NVY H;  2E2I B;  2PYK A;  3IRB A;  1JE5 A;  1G91 A;  1PH5 A;  1ZEQ X;  2NTT A;  4DAP A;  1XMO Q;  5DLQ E;  5IT9 c;  3KBG A;  3P75 A;  1CKO A;  1FJG L;  4NXN Q;  3I56 A;  1PRT F;  5H1S E;  1ENA A;  3I4M B;  2NVT B;  1VQK A;  5J39 A;  3KBX A;  3G6E A;  1V1P A;  2DN8 A;  3S1N B;  2HDL A;  1QOH A;  4HMI A;  2R93 H;  4OWT B;  3K57 A;  2R93 G;  5HY6 A;  3HOW B;  1B53 A;  1EU4 A;  3W1G A;  1HZC A;  4B9W A;  2R92 G;  5JJI A;  4UAI A;  1CKM A;  3SE0 A;  1AH9 A;  1G2T A;  5KEE A;  3T56 B;  1SNC A;  1EQR A;  2F0I A;  2Z4H A;  2KHS A;  4OIJ A;  4JI8 L;  2B63 G;  3AFP A;  4MTN A;  4S3S A;  5CV5 A;  4ODG A;  4PMC A;  4TSS A;  1Q1B A;  1G6Z A;  4IUP A;  4KY6 A;  1HJP A;  1DOM A;  2J0T D;  3MXP A;  3NTK A;  4CJ0 B;  1F2Y A;  5ELN A;  1QG7 A;  4LWC A;  4X3S A;  2F4I A;  1WTR A;  2R7Z H;  2UXC L;  2OWO A;  3ONA B;  4A3M H;  2RQX A;  4JI2 Q;  2R7Z G;  1VQP A;  1UEA B;  4DU9 A;  4RGO S;  3BVG A;  4PMB A;  1SYC A;  4A3M G;  3E0J A;  1WCM H;  3R93 A;  3JAM L;  1B70 B;  4HSV A;  1GXD C;  1WCM G;  4WJ3 M;  2MPM A;  3HZX A;  1NCV A;  3KF6 B;  4A3D G;  2EIF A;  3G6J B;  5M3F B;  5FO9 B;  1D1K A;  3EFX D;  3K7A H;  1MJC A;  4LW1 A;  4ILW A;  1CM9 A;  3PF4 A;  3E0E A;  2LY7 A;  1YHQ A;  2IX0 A;  1BVS A;  1WTP A;  3A8J E;  3NPP A;  1GUN A;  3GP7 A;  1BQQ T;  3QB3 A;  1I4R A;  1S40 A;  4LF7 L;  1BKB A;  1LTB D;  3ND8 A;  2SNM A;  1F9S A;  1L1O C;  4XDX A;  1K8M A;  5DM6 3;  3CC2 A;  2XGT A;  3SVM A;  2X6L A;  3NWS A;  2K5D A;  3R2I A;  4XQN A;  2CQO A;  1M4V A;  1VQO A;  2NZO A;  2SDF A;  3L0O A;  1QNK A;  1IYV A;  2A74 C;  4X64 L;  1B3A A;  2XSC A;  2JQO A;  2MFI A;  4RA8 A;  4DR3 L;  2YU9 B;  1FGU A;  4R4I A;  1KLG D;  3G48 A;  1E2W A;  3VYS A;  2K03 A;  3ULP A;  2JA8 H;  1ZKO A;  5I9P A;  3I3C A;  3NUC A;  4DR7 L;  3RNU A;  3RZO B;  1I6H H;  1EZ8 A;  4HSP A;  4N9P A;  4DXF A;  1F2Z A;  3S14 H;  1KTK A;  3EA6 A;  1KAW A;  1EOT A;  1QUQ B;  1TWC H;  1B7Y B;  1LTI D;  4WOR A;  4DV0 L;  4JI0 Q;  4BA2 I;  5NUC A;  4BA1 I;  3CAM A;  4BBS H;  1FD7 D;  4FP5 D;  4QQB X;  3DLL A;  2ICI A;  2XN9 C;  4GLX A;  4BBS G;  1DM0 B;  4DV3 Q;  3MZ5 A;  5CV7 A;  5IOD A;  4GLA C;  2Q8T A;  2ASB A;  2OXP A;  5JVH 3;  1MD2 D;  5TSS A;  3CQZ H;  5DNF A;  1TKW B;  5IP9 G;  1XMO L;  1HTL D;  4X3K A;  1I4X A;  2H5X A;  5IE8 A;  1W3S A;  2EPB A;  5FLX L;  4CDC C;  4JYA Q;  1HNW Q;  5GAH C;  3SK6 A;  5M3M H;  1JT8 A;  4A3F G;  1OXU A;  3LX0 A;  1VDZ A;  4YCV A;  4K14 A;  4A3J B;  3OHX C;  5C4J B;  5EGT A;  1D2B A;  3J81 j;  3T16 A;  3Q22 A;  5DEH A;  5ELB A;  4Q5V A;  3KJP A;  1PH7 A;  3TRE A;  2ICE C;  2D2C C;  1P8L A;  3MC0 B;  3PUX A;  4DR2 Q;  2WFW A;  3IFD A;  3LGJ A;  1PH2 A;  1HR0 Q;  1Q46 A;  2C35 B;  2F4V Q;  4OEL B;  3TZD A;  3TDQ A;  1AE3 A;  4H44 C;  1SE4 A;  4FF1 A;  2JA5 H;  5CV8 A;  2VUM G;  4CKB A;  1YEZ A;  3DMU A;  4DK6 C;  3S1M H;  1TS2 A;  1O7L A;  1ICW A;  3F2D A;  4OIK A;  5C44 H;  2Z6K A;  1KDB A;  2I5L X;  2MQH A;  2MO1 A;  4R1J A;  3J81 c;  1XMQ Q;  1LTT D;  4DPG A;  3BZC A;  4KMU C;  5C44 G;  2I0Q A;  4DV1 Q;  1VQ9 A;  1LAB A;  4P73 A;  1JOK A;  2KHJ A;  3F1Z A;  1HFG A;  5K5P A;  5IWA Q;  2H1E A;  2PMZ B;  2A69 D;  1B9N A;  3ULJ A;  5CC4 A;  1PH9 A;  2E2H H;  1TS5 A;  3GTK H;  1ONL A;  4DV5 Q;  1MI2 A;  1XXG A;  4EX5 A;  1M8A A;  1JOO A;  5IGC A;  1YIJ A;  1YJ9 A;  3VYR A;  1TQO A;  1D5X C;  1FNU A;  2G9D A;  5I2Y A;  2HDM A;  3TRZ A;  1U0L A;  2K50 A;  4KHP Q;  3I2Z A;  2EXD A;  1HQM C;  2BDN A;  1N9W A;  3HOV H;  2LXK A;  5C3E H;  5T1I A;  2MHV A;  4DAV A;  5KYI A;  3GTO B;  4UHV A;  3HOV G;  4GKK Q;  5BN5 A;  1SYE A;  5K36 H;  4A3L H;  2K5W A;  3M7G A;  4UP7 A;  1Q82 C;  5C6A A;  5IT9 E;  1H95 A;  3KFU A;  4F88 A;  1ET6 A;  1I3Q H;  3A0J A;  1BCP F;  1EUJ A;  2JYO A;  2ZM6 Q;  4AYB G;  1KDA A;  4MN3 A;  1VQ8 A;  1TWG H;  1YNN C;  1XYI A;  2F3I A;  2Q2U A;  1S5E D;  3RN2 A;  4FNF A;  4E6I A;  4A3I B;  1TT2 A;  2AWN A;  2N3S A;  4P2C B;  2F0N A;  4BY1 G;  4DK3 C;  4A3E G;  3PUZ A;  3I4M H;  3KLS A;  5CR3 A;  5IY0 A;  1PTO D;  3SEB A;  1SFO B;  2PW5 A;  3S2D H;  3UE0 A;  2HQL A;  4C3I H;  4P74 A;  2NVY B;  3NBH B;  1A2T A;  1C9O A;  3T4A C;  3L2P A;  1IBK Q;  4IPC A;  1HUN A;  1O80 A;  4JK1 C;  4C3I G;  3NBI A;  3HS0 C;  1N34 Q;  1PTO B;  4YWK A;  1VCI A;  4UP8 A;  3R3O A;  3SR1 A;  3RMH A;  1PXU A;  1N33 L;  1SBB B;  2EJF C;  3R2T A;  3X3N A;  1CKN B;  4DUY L;  3PO3 H;  3S2H H;  3ERS X;  3JAM c;  2YTV A;  2WKC A;  5JJL A;  4DF7 A;  4DGZ A;  4DR4 Q;  3K5M A;  4JI0 L;  3ULL A;  2JXM B;  4ZLT F;  3PF5 A;  1VQ6 A;  1J6Q A;  2R93 B;  1NNX A;  4HJ7 A;  4DV3 L;  4JI5 Q;  2Q2T A;  2IT1 A;  2D0P A;  3GTM H;  4KD3 A;  4B3M Q;  2VQF Q;  2PNR C;  2UUC Q;  1X54 A;  1EY4 A;  1I6V C;  3MAQ A;  4JYA L;  4J1M A;  1HNW L;  4JBW A;  4JOI C;  5KND A;  1SRU A;  3PO2 H;  4H13 C;  4RWS C;  2F0S A;  4LFC Q;  1EY0 A;  4A3G G;  3PO2 G;  2RDH A;  1Z47 A;  1FR3 A;  4HCS A;  3LWE A;  1X6O A;  4A75 A;  4LFB Q;  1TWH H;  3CRK C;  3RZD H;  4RHR A;  3CC4 A;  4IFD J;  4DR2 L;  4GOP C;  4HMJ A;  1HR0 L;  2R7Z B;  2KEE A;  4J6H A;  1SNM A;  5D14 A;  2F4V L;  1XPU A;  1A3V A;  4JI4 Q;  4A3M B;  1C7Y A;  1SAP A;  4M1U B;  2LMC B;  1AEX A;  4G57 A;  2L55 A;  4RFB A;  1WCM B;  2PI2 A;  2DJF C;  4IN3 A;  3RN5 A;  1AFP A;  4DN4 M;  2F0E A;  4ZQ3 A;  2QDL A;  1PFS A;  2PO4 A;  3RR5 A;  4GNX C;  1XMQ L;  1EIG A;  1F77 A;  1D5M C;  3CME A;  2AMC B;  4DV1 L;  1SDF A;  4AIM A;  2PQA B;  3FDT A;  4HJ8 A;  2XRS D;  4OO1 G;  2JJQ A;  2XWB B;  5IWA L;  3I4N H;  3K7A B;  1JOR A;  3F2B A;  3S15 H;  2N88 A;  4DV5 L;  3I4N G;  1B50 A;  5FKA C;  2EY6 A;  4IUV A;  3VYT A;  3OWF A;  1VS0 A;  2IHE A;  4Y7N H;  4A93 H;  1IW7 C;  2KUM A;  1QIL A;  1LTG D;  1NMF A;  1WD1 A;  5FLX c;  4A93 G;  5CBA E;  4KHP L;  2RCF A;  2VY3 A;  3TP7 A;  5A2Q L;  4BY7 G;  1EEI D;  1II3 A;  1AZQ A;  4LF6 Q;  5EJW A;  3RLO A;  1U5K A;  3I91 A;  2D0O A;  4IFD I;  1HTP A;  4GKK L;  4CJ1 B;  1I94 Q;  4LF9 Q;  1L1O B;  4U67 3;  3QJY A;  3DWA A;  2RF4 A;  4RKL A;  2JA6 G;  3S16 H;  1TU2 B;  2SEB D;  1LTR D;  2ZM6 L;  5JJZ A;  2JA8 B;  1V43 A;  3NK9 A;  2CHB D;  1H9M A;  2AWO A;  1I6H B;  1YNX A;  1SNQ A;  3FPP A;  3N52 A;  1DZ1 A;  3K8A A;  3VR6 A;  2WAQ G;  1RF2 D;  3S14 B;  5C5L A;  4AH6 A;  1EFI D;  4DAM A;  1TWC B;  4BBS B;  3GTL H;  3E3X A;  4MZ9 A;  1STE A;  2KCC A;  3TN2 A;  5DAU A;  2Y0S G;  1IBK L;  4IPH A;  4JI6 Q;  3KF6 A;  4RG1 A;  1YZ6 A;  2XTI A;  4J8Q A;  4LF4 Q;  5GAD C;  1N34 L;  1A2U A;  3PIP A;  3CQZ B;  1H9K A;  3VR3 A;  3J81 E;  4B9X A;  4L5S A;  2LFN A;  3TBI B;  2BH8 A;  2JA7 G;  2RDG A;  5M3M B;  3J80 L;  3Q8D A;  2M2L A;  4J15 A;  1G29 1;  2L12 A;  2WB1 G;  4DR4 L;  2WAC A;  1HNX Q;  3D6C A;  3GDE A;  3S1R B;  3HOZ G;  1FYC A;  1HPC A;  4OGQ C;  3EBE A;  4HR7 B;  4B3T Q;  1EYC A;  1B44 D;  2KCM A;  4JI5 L;  4IFD H;  5M9O A;  3JC6 6;  2XNA C;  5HUR A;  4JPB W;  1EU3 A;  4NKL A;  3NWT A;  2EYM A;  4B3M L;  4IFD G;  2VQF L;  4F87 A;  3BZK A;  3A56 A;  3CCQ A;  1EFW A;  1ASY A;  4A3B H;  3CXC A;  4DV6 Q;  1ILQ A;  5C4Z A;  4LF8 Q;  1LYL A;  4IUT A;  4KTA A;  4DAY B;  3KJO A;  2A69 C;  2JA5 B;  3C1E A;  4A3B G;  1DON A;  4LFC L;  5M5X H;  1YNJ C;  3S1M B;  3HGB A;  4PNY A;  5C44 B;  4RCO A;  4RKB A;  5I6W A;  1D1I A;  3KUP A;  1IHZ A;  1HR0 W;  4LFB L;  4POG A;  3K5O A;  2L11 A;  4RCN A;  1VQA A;  2CQA A;  1I5F A;  1QUQ A;  5FLM H;  1XNQ Q;  1QZG A;  1X3F A;  2E2H B;  5D3I B;  1GHJ A;  1NMG A;  3AFQ A;  3FKI H;  1Y1V H;  5FLM G;  4JI4 L;  4CKE A;  1QZH A;  1NTG A;  1Y1V G;  1BNZ A;  3S1Q H;  5CV4 A;  3Q24 A;  1EY6 A;  1MSH A;  3M7N A;  2H4O A;  3BZD B;  3TEH B;  1STG A;  2ZXP A;  1U4P A;  3DWQ A;  3HOV B;  5C3E B;  1T5X D;  2B8F A;  3SK5 A;  5KRU A;  4L5T A;  2AUK A;  3FHW A;  5COY A;  3TP6 A;  1EWI A;  4LUZ A;  4QUC A;  4CDE C;  4HAE A;  2DNE A;  2Z0S A;  1PRT C;  2EQS A;  3BS1 A;  1JCK B;  5HGQ A;  2Q2H A;  4O0A A;  1PTO C;  3JAM E;  1I3Q B;  3IKJ A;  1YNN D;  1AE2 A;  4JI3 Q;  5CBE E;  4QGU A;  2CH4 W;  2EY5 A;  3QWN A;  2B2W A;  1TWG B;  1PTO H;  3MTS A;  1D8L A;  5AJ3 Q;  2QW7 A;  2ZTC A;  1QVG A;  4DK0 A;  4NDX A;  4LF6 L;  2NB0 A;  5IYC G;  4LK1 C;  4ME3 A;  3C2P A;  4ZYS A;  1GKH A;  2CWA A;  1I94 L;  2B2T C;  4I65 A;  3T51 B;  2K4K A;  4LF9 L;  2IY5 B;  1VQD A;  1IL8 A;  3S2D B;  2IHF A;  4C3I B;  1O7Z A;  2TSS A;  2TMP A;  3I4O A;  3MWY W;  3F2C A;  2R92 H;  4OX9 Q;  5JVG 3;  3NQI A;  2O5I C;  2K75 A;  5LHY 1;  2B63 H;  5GAG C;  3PO3 B;  3S2H B;  1A3T A;  1A63 A;  4XQQ A;  3KYH C;  1NSN S;  3CP0 A;  1C0A A;  1JJG A;  5IIF A;  5IP7 H;  3H94 A;  3D4R A;  3J81 i;  1CK1 A;  3CCE A;  4DR1 Q;  1STY A;  5IP7 G;  4O1N A;  1SYB A;  1SE8 A;  3R8B A;  1UE1 A;  1MJE A;  4JI6 L;  2OEO A;  2B2Y A;  2Q2I A;  4P75 A;  2QCP X;  3GTM B;  4JV5 Q;  4LF4 L;  1RIP A;  4LMQ D;  2KEC A;  3I4L A;  1JWM D;  4LNQ A;  3FVQ A;  1IYJ B;  3QR8 A;  1J9O A;  4NMZ A;  1CT1 D;  1KRT A;  1HZB A;  2MGS A;  2A73 B;  4R9W A;  2JSO A;  3TP8 A;  3PO2 B;  1V9P A;  2EXZ A;  2CKZ B;  4PZ8 A;  3PSI A;  1HNX L;  5ELE A;  3U4V A;  5KIX A;  3H0G G;  1G6P A;  3BJU A;  4A3D H;  3GTJ H;  1PMR A;  1TS4 A;  5BN3 A;  4B3T L;  1B8A A;  3E5S A;  3A55 A;  3HOU G;  4DK1 A;  2JE6 I;  1TWH B;  3RZD B;  5FLX E;  4GS3 A;  2GVB A;  1R9T H;  3CU7 A;  3S9W A;  1S72 A;  1DOL A;  4DV6 L;  4LF8 L;  4GOP B;  4LUV A;  3NBH A;  2A8V A;  4C3J H;  2V4D A;  2C9O A;  1EY5 A;  2LSS A;  1AW7 A;  4C3J G;  4EVO A;  2ZJP A;  3KF8 B;  1U4L A;  4UPA A;  4BWG B;  1GM5 A;  4WJ4 A;  1XTD A;  2CFM A;  1CKN A;  2R7F A;  3GQB A;  4AQY Q;  1Y8P B;  1WVL A;  1BDO A;  1F2L A;  3J7Z C;  4GNX B;  1KHI A;  4XYO A;  1RHP A;  3TP5 A;  5HGT A;  1RCV D;  1XNQ L;  3I4N B;  3K5N A;  4ME5 A;  5J3B A;  2YV5 A;  3S15 B;  1IW7 D;  1CZG A;  2R61 A;  1Y14 B;  1LO5 D;  4OL7 A;  1W2B A;  4Y7N B;  4U68 A;  4A93 B;  4PG3 A;  4GLV B;  1VQI A;  4DV4 Q;  1YI2 A;  1C48 A;  3MHB A;  4ZUI A;  1OXV A;  1VQ4 A;  1N33 Q;  1O7Y A;  3J80 c;  1Q12 A;  1GUW A;  3JAM i;  5FO8 B;  4DUY Q;  2F0L A;  2OQ0 A;  2I07 B;  4I7Z C;  3GTG H;  5G3L D;  1RJT A;  4OWX B;  2A5H A;  4JI7 Q;  1TWF H;  3PUV A;  2VL6 A;  2JA6 B;  2F0M A;  2O2L D;  2K52 A;  1D7Q A;  1B3Q A;  3HKS A;  2QDB A;  2F0U A;  1IXR A;  3S16 B;  1E2V A;  4JI3 L;  5IP9 H;  4HTH A;  1KQS A;  5AJ3 L;  5EQ0 A;  4L6T B;  4G7O C;  3O13 A;  4A3F H;  3CCS A;  4IUU A;  1JR0 D;  5EBD A;  3CCR A;  1HHV A;  2J7Z A;  4KY5 A;  2Y0S B;  4RH6 A;  2ZXO A;  2VQE Q;  3GTL B;  3S1R H;  3P20 A;  2RHQ B;  3M3Y H;  3KLW A;  1UWV A;  1VQF A;  3ZYY X;  4C56 C;  1A8V A;  1E7Z A;  3CC7 A;  1MIU A;  4OX9 L;  2NZ1 D;  4CBV A;  3PIP 3;  2ATW A;  1A0I A;  3PIO A;  4WRD A;  1STB A;  2DGY A;  3GD7 A;  2VUM H;  4XIG S;  2WB1 B;  1HUM A;  2DUD A;  5JJK A;  2B2U C;  2BOS A;  4C1N I;  2NUC A;  4C3H H;  1R4P B;  4AYB E;  4DR1 L;  2QEJ C;  4C3H G;  2B2V C;  3AYH B;  1NR2 A;  4X3U A;  3H09 A;  3LWU A;  3TME A;  1ASZ A;  2EYL A;  3H15 A;  3V2T A;  4JV5 L;  4FXD A;  1OXS C;  2I46 A;  2NVX H;  3GTQ H;  2DJG C;  1S5C D;  2EY2 A;  3OW2 A;  2OTL A;  1K83 H;  2N78 A;  1K0R A;  2WIN B;  1A3U A;  1L1O A;  3EN2 A;  4DFA A;  4A3B B;  4CDD C;  4R4O A;  1YNJ D;  2EY1 A;  5JEA G;  1JOQ A;  5M5X B;  4JVZ A;  4LJZ C;  1N36 Q;  3DWP A;  3U9O A;  4A3C H;  2K5V A;  4XTC S;  1BCP C;  4MTK A;  4JG2 A;  1GUG A;  3TS0 A;  1PH1 A;  4A3C G;  1X55 A;  4L63 B;  1EQV A;  2QKI C;  4KI0 A;  3HG9 A;  3OW7 A;  2I5M X;  1K3R A;  1XTC D;  3I72 A;  1SJE D;  1HA6 A;  3I73 A;  4ZKB B;  1S4Z A;  1EQQ A;  4HCE A;  3FKI B;  1Y1V B;  1V8Q A;  4KY7 A;  3MVV A;  2EJM A;  2KOL A;  1ESR A;  1VQB A;  4ZRZ A;  1EL0 A;  2PZU A;  3S1Q B;  1E3P A;  5ELO A;  4DNT B;  3PUY A;  3PQI A;  2BE5 D;  2SOB A;  3NXW A;  1NE3 A;  1SRO A;  1ZYR D;  2QIL A;  3NTI A;  5CYU A;  5EPL A;  3CF5 A;  1SSO A;  2OCE A;  4N8X 1;  1TVX A;  3AB9 A;  4C2M B;  3CPF A;  3OIP A;  1PLF A;  4NPS A;  4A3E H;  4BY1 H;  3V96 A;  4AQY L;  1VF5 C;  4TRD A;  2NVQ H;  5IGB A;  1PFM A;  5E3F A;  5DM7 3;  1PRT D;  1TII D;  4GN5 A;  3CPW A;  3S24 A;  4B3R Q;  3K5L A;  4TQU S;  3D4W A;  5C4H A;  1CTM A;  1BOS A;  1UUP A;  2OQK A;  2MJ8 A;  4QIW B;  2EJG C;  4H0L C;  4FYD A;  1PRT B;  3U4Z A;  3U50 C;  2EOT A;  4DV4 L;  3MFG A;  1EOV A;  4GKJ L;  1MBY A;  3PGZ A;  4KKT A;  1E1T A;  4OEM B;  4IJL A;  1LTS D;  5LMU Q;  4YCU A;  4OON A;  2FXQ A;  4OO1 I;  1GUS A;  3F8T A;  4QL5 A; 
#chains in the Genus database with same CATH homology
 1ZXT A;  4ID6 A;  4RGT A;  2LKV A;  5C3W A;  2R92 B;  5A2Q E;  3DEP A;  4IQZ A;  1C4Q A;  2FJ2 A;  2B2V A;  5CGK A;  3T13 A;  3OSO A;  2B63 B;  3VA7 A;  1SEB D;  1X3P A;  1B2T A;  2RVL A;  3K59 A;  1G8Z D;  4KK7 A;  1JWU D;  4CKC A;  5CMD A;  1RTO A;  4FVM A;  1EQT A;  4FF3 A;  2BDO A;  2IWH A;  3GO5 A;  3V05 A;  3H6M A;  4ZUJ A;  3IAY A;  3L3O C;  1EIH A;  4EGV A;  4V0B A;  1X3Q A;  2IX3 A;  3PUW A;  1VMC A;  3I8Z A;  3NTH A;  1CA6 A;  4B08 A;  1B9M A;  1SND A;  4A3D B;  1JQY D;  3GTJ B;  2K7V A;  4OO1 H;  1SE3 A;  3KLR A;  4F7X A;  3E6Z X;  3W2D A;  1R9T B;  3K58 A;  3J80 E;  1EWC A;  4UDU C;  4C3J B;  1A6X A;  2O4X A;  1ENC A;  4ZKC B;  1EZ6 A;  1EYA A;  2EYO A;  4YIJ A;  2VB3 X;  2XIW A;  3DXJ C;  4IZ8 A;  4FO2 A;  2IW3 A;  1EYD A;  3D31 A;  3BVZ A;  3IL8 A;  3VR5 A;  3BVM A;  4BS9 A;  4TKO B;  3D3R A;  1JWS D;  4FXK C;  2BA0 A;  2F0H A;  3L9A X;  1W6K A;  3SDZ A;  2NN6 G;  3GTG B;  1SNO A;  1AP0 A;  1TWF B;  3FPU B;  4Z9C B;  3VR2 A;  1EY9 A;  3WOE A;  2F0P A;  5D3D A;  1I4H A;  4QMG A;  3MEH A;  2G9H D;  4KN7 C;  1EEF D;  5LL6 S;  4G7Z C;  2F0D A;  1Z6H A;  2QF7 A;  2IX1 A;  2AQ1 B;  4A3F B;  4DNR B;  5C5M A;  2K04 A;  1JIC A;  4KJN A;  1ML0 D;  5ELC A;  3X3M A;  3KF8 A;  3M3Y B;  2F0O A;  4K6D A;  2JEA I;  1I4Q A;  3J7A F;  2K05 A;  5AFW A;  1QB5 D;  3PIO 3;  2F0F A;  3KK7 A;  1Q1E A;  2VUM B;  4C1N K;  1DCZ A;  4KJO A;  4C3H B;  1ESF A;  1U4M A;  2X6G A;  1TY0 A;  2R3Z A;  2NBF A;  1SYD A;  3HRZ C;  3CHB D;  1DJR D;  2PPB C;  2Q8R E;  3C46 A;  2NVX B;  3GTQ B;  2PW7 A;  4MHE A;  1AZP A;  3PV0 A;  4RGM A;  1K83 B;  2M9V A;  2X69 A;  1DXM A;  1C8C A;  1KLU D;  4DXG A;  5BN4 A;  1O78 A;  4N9T A;  1BCP D;  1JB3 A;  2BA1 A;  2RBM A;  2BE5 C;  2L0C A;  1ZYR C;  3J7Y W;  2EVB A;  1B1Z A;  1BCP B;  3C1F A;  3A7L A;  2Q8I B;  1KDC A;  2D62 A;  1Y8N B;  1SXT A;  5JPM C;  5KYL A;  1PZK D;  1S5B D;  3AU7 A;  1U4R A;  4AYB B;  4EQN A;  4KKS A;  1SMY C;  1HRJ A;  5CV6 A;  1XX8 A;  1NAP A;  3G7L A;  2E76 C;  3A8I E;  4WFN 3;  2PCF B;  4A3E B;  4BY1 B;  2NVQ B;  2E75 C;  4ZAI A;  5FK9 C;  2SNS A;  5LL6 X;  1PFB A;  1BO0 A;  2L5T A;  3DHQ A;  2Z4I A;  1STN A;  4F8M A;  3WOF A;  2EYP A;  2WKD A;  1QNU A;  1GHK A;  5FO7 B;  1V1O A;  2K33 A;  3EJI A;  3MXG A;  2K01 A;  2PZW A;  2R6G A;  4LAA A;  1NUC A;  1PTO F;  4QUF A;  1CI3 M;  1RTN A;  4L8J A;  1BBX C;  2XRQ D;  2L1B A;  1QE6 A;  1H9S B;  3Q6S A;  1UNS A;  1Q90 A;  2LS0 1;  3FEW X;  1L0X B;  2HCI A;  4K2K A;  4KV6 A;  4HED A;  5M5W B;  5D65 A;  5ISR A;  2JEB I;  3L7Z C;  1MGS A;  2EYJ A;  2KQ3 A;  4A3G B;  3VA5 A;  2F0W A;  4RHS A;  1W6J A;  2RA4 A;  1NR4 A;  1B4O A;  1DD2 A;  2RKS A;  4NP5 A;  1WTQ A;  4RAU C;  2A6H C;  3TSS A;  1LT5 D;  3OMC A;  3I90 A;  4XT1 B;  5M5Y B;  2NYZ D;  3CRL C;  5JEA J;  1WTX A;  1D6E C;  3BG3 A;  1UAP A;  3RLF A;  4K5X A;  4K5V A;  4K8J A;  1SYF A;  2NWG A;  1BR9 A;  4ZK9 B;  2FMC A;  2VB2 X;  1KNE A;  2E2J B;  1IKM A;  3QOL A;  1E2Z A;  4MIU A;  3A8K E;  2Z8L A;  5I2X A;  4XYQ A;  3MXU A;  1KNA A;  2B2T A;  1ROD A;  1GUO A;  2AQ3 B;  5E4X A;  1ENF A;  1SE2 A;  5J1Z A;  2VXW A;  4BY7 B;  3OMG A;  4K8I A;  1H9J A;  4FF4 A;  5IGG A;  4KN4 C;  2RDF A;  2EYH A;  2DNC A;  4R8I A;  4IAL A;  2K1B A;  3TZU A;  1QCB D;  3I70 A;  5IOC A;  5T1G A;  1DOK A;  3NP8 A;  1TR5 A;  1X32 A;  1VMP A;  1KAB A;  2WAQ B;  3N6R A;  3HP3 A;  3IFT A;  2E74 C;  4QCL A;  1PDQ A;  3GV6 A;  4DA2 A;  3HOY B;  2PQE A;  1E0B A;  2E2D C;  2DY7 A;  5A35 A;  2EE1 A;  3UI2 A;  4ABN A;  2A68 C;  1MSG A;  3DM1 A;  4IUN A;  4G7H C;  1F9P A;  1PZI D;  3H3V C;  1PYW D;  5JOB A;  3MXN A;  3NE5 B;  2JA7 B;  4QB4 A;  3LNN A;  3GTP B;  3HOZ B;  4BBR B;  4NW2 A;  1PFN A;  2RSO A;  1FGB D;  1BXT A;  2ZT9 C;  3D8G A;  5E4W C;  2KJX A;  1LT6 D;  1LAC A;  1RDP D;  1IYU A;  1A15 A;  2JP1 A;  3FRP B;  3MA2 B;  2MP1 A;  2F0V A;  3C3L A;  2IJ0 A;  3BDC A;  1Y1W B;  3HKZ B;  4CJ2 C;  5JEA H;  5F2D A;  2M00 A;  1BUV T;  5KNC A;  1V1P B;  3OWE B;  1OXT A;  4QF4 A;  5I4D A;  2WP8 J;  3NHH A;  1CZW A;  4FF2 A;  1DYQ A;  1CHP D;  1STA A;  2HUG A;  2Z1C A;  3J7A V;  1EY7 A;  4Q0F A;  2CW0 C;  3BYT B;  2J4X A;  4V19 0;  3BYY B;  4K6L A;  1ILP A;  1OXX K;  3M85 A;  3Q0A A;  4EQP A;  3D4D A;  1LV9 A;  1PZJ D;  2O5J C;  3P7J A;  2RSN A;  4GZY C;  5C0X J;  4PV1 C;  5EKI A;  5COR A;  4XT3 B;  4PMW A;  1TWA B;  1BF4 A;  2XVS A;  2D9U A;  2ENB A;  3VYU A;  3WDN A;  5K36 G;  5EPJ A;  4IUQ A;  2F3W A;  3OIQ A;  4XXE A;  1SMY D;  2OF1 A;  2A6E D;  5EBC A;  5KGU A;  1I4P A;  5EKL A;  2F0T A;  2F0K A;  4KKU A;  2CVR A;  1U9R A;  3MFY A;  4CHT B;  4DAY A;  2K28 A;  3CKI B;  2KA7 A;  4IUR A;  3RUZ A;  2EDG A;  2L9H A;  2B2U A;  1FNV A;  3W3A A;  1LT3 D;  3A54 A;  2WV6 D;  1ET9 A;  1GUT A;  5C0X I;  1Y8O B;  2PZT A;  2K5Q A;  1LTA D;  4M8A A;  3BDO A;  3ITP A;  1Z7T A;  3T53 B;  2OT2 A;  1Q8I A;  2GA4 B;  1S5F D;  2YYZ A;  1AN8 A;  4HN7 A;  1S5D D;  3M4O B;  2KVM A;  1STH A;  5JAV A;  3URY A;  2HQE A;  2C5C A;  3KLS X;  1WTO A;  1CHQ D;  2ZXR A;  5EPK A;  2HCC A;  2ID0 A;  3VR4 A;  2KED A;  1HFN A;  2K32 A;  2NN6 I;  5IT9 L;  2F0J A;  2FMM A;  2AUJ D;  3H0G B;  2L4N A;  5I6Y A;  3NSW A;  2KCN A;  2FIN B;  4PQX A;  3U9S A;  1CQF A;  3S17 B;  2F3V A;  3HOU B;  3SK4 A;  2A6H D;  3QOJ A;  5ELF A;  2IPK D;  3EQL C;  1L0Y B;  5KNB A;  2B39 A;  3GV3 A;  4KD4 A;  4H7B A;  3RD4 A;  2F1M A;  1WTV A;  3K6O A;  4K5W A;  5C0X H;  3H91 A;  4FXG C;  1T5E A;  5C0X G;  1CA5 A;  1LT4 D;  3QIA A;  4X3T A;  4R8N A;  2K6A A;  4OHJ A;  1JC7 A;  1J8I A;  3A7A B;  5C3X A;  2BCO A;  1GJX A;  3HEJ A;  1H9S A;  2B8G A;  1QWY A;  3M4Y A;  1D5Z C;  3ERQ A;  3DEO A;  2NN6 H;  1RD9 D;  1H9R A;  3F2U A;  3EVQ A;  3SK8 A;  3P1H A;  3ND9 A;  4WJW A;  1F2M A;  3DUZ A;  1EY8 A;  3K0Y A;  4KHV A;  1G2S A;  4XQJ A;  3PMF A;  2N55 A;  1EWH A;  2XWJ B;  5G3L F;  2EZV A;  2FFK B;  1OO9 B;  1F9R A;  2DY8 A;  4A3K B;  2B2W C;  2A68 D;  3D6W A;  3OPO A;  1CQV A;  1HQR D;  3SHL A;  3ERO A;  5IGD A;  1IKL A;  1QJO A;  1I50 B;  3SXH A;  2MUY A;  1SJH D;  5IGF A;  1TS3 A;  1WTW A;  5JPN C;  1GOZ A;  1FNW A;  1HA5 A;  2EYF A;  3QG1 A;  1WD0 A;  1KAA A;  1F9Q A;  5IGE A;  2D5D A;  1LLR D;  1Q3L A;  3FMC A;  5J22 A;  2F0G A;  5E1F A;  1TY2 A;  1Y69 U;  2NTS A;  4K2L A;  2WII B;  3QO2 A;  2B2Y C;  1SYG A;  1R4Q B;  2IL8 A;  5EKK A;  2VNU D;  4EQO A;  2F0Q A;  1HXY D;  2CW0 D;  5C4X B;  4CGY B;  4KHZ A;  3NQT A;  2F03 A;  4O42 A;  5CV9 A;  5I9O A;  3BDL A;  3OOC A;  5ELD A;  3Q23 A;  3GTK B;  1K8O A;  1I4G A;  4ULL A;  1CFM A;  4G4K A;  3AMU A;  1SNP A;  2AQ2 B;  2A6E C;  1VF7 A;  1XWE A;  5FOB B;  3J81 L;  1JE4 A;  4RGN A;  2FHT A;  1HCZ A;  1RKN A;  3HOX B;  2E2I B;  2PYK A;  1G91 A;  1ZEQ X;  2NTT A;  4DAP A;  3KBG A;  3P75 A;  1PRT F;  1ENA A;  3I4M B;  2NVT B;  5J39 A;  3KBX A;  1V1P A;  2DN8 A;  3S1N B;  2HDL A;  1QOH A;  4HMI A;  3K57 A;  3HOW B;  1B53 A;  1EU4 A;  4B9W A;  4UAI A;  3SE0 A;  1G2T A;  5KEE A;  3T56 B;  1SNC A;  2F0I A;  2Z4H A;  2KHS A;  4OIJ A;  4S3S A;  5CV5 A;  4ODG A;  4PMC A;  4TSS A;  1Q1B A;  1G6Z A;  4IUP A;  4KY6 A;  1DOM A;  2J0T D;  3MXP A;  3NTK A;  4CJ0 B;  1F2Y A;  1QG7 A;  4X3S A;  2F4I A;  1WTR A;  3ONA B;  2RQX A;  1UEA B;  4DU9 A;  4RGO S;  3BVG A;  4PMB A;  1SYC A;  3E0J A;  3R93 A;  3JAM L;  4HSV A;  1GXD C;  2MPM A;  3HZX A;  1NCV A;  3G6J B;  5M3F B;  5FO9 B;  1D1K A;  3EFX D;  4ILW A;  1CM9 A;  2LY7 A;  2IX0 A;  1WTP A;  3A8J E;  3NPP A;  1GUN A;  3GP7 A;  1BQQ T;  3QB3 A;  1I4R A;  1LTB D;  3ND8 A;  2SNM A;  1F9S A;  4XDX A;  1K8M A;  5DM6 3;  3SVM A;  2X6L A;  3NWS A;  2K5D A;  3R2I A;  4XQN A;  1M4V A;  2SDF A;  1QNK A;  1IYV A;  2A74 C;  1B3A A;  2XSC A;  4RA8 A;  2YU9 B;  1KLG D;  3VYS A;  1E2W A;  2K03 A;  1ZKO A;  5I9P A;  3I3C A;  3NUC A;  3RZO B;  1EZ8 A;  4HSP A;  4N9P A;  4DXF A;  1F2Z A;  1KTK A;  3EA6 A;  1EOT A;  4WOR A;  1LTI D;  4BA2 I;  5NUC A;  4BA1 I;  1FD7 D;  4FP5 D;  2ICI A;  2XN9 C;  1DM0 B;  3MZ5 A;  5CV7 A;  5IOD A;  2Q8T A;  2OXP A;  5JVH 3;  1MD2 D;  5TSS A;  5DNF A;  1TKW B;  1HTL D;  4X3K A;  1I4X A;  2EPB A;  5FLX L;  3SK6 A;  1OXU A;  3LX0 A;  1VDZ A;  4K14 A;  4A3J B;  3OHX C;  5C4J B;  5EGT A;  1D2B A;  3T16 A;  3Q22 A;  5DEH A;  5ELB A;  4Q5V A;  2ICE C;  2D2C C;  3MC0 B;  3PUX A;  3IFD A;  3TZD A;  3TDQ A;  4H44 C;  1SE4 A;  4FF1 A;  5CV8 A;  4CKB A;  3DMU A;  1TS2 A;  1O7L A;  1ICW A;  4OIK A;  1KDB A;  1LTT D;  4KMU C;  1LAB A;  1JOK A;  1HFG A;  5K5P A;  2H1E A;  2PMZ B;  2A69 D;  1B9N A;  5CC4 A;  1TS5 A;  1ONL A;  1MI2 A;  1XXG A;  1M8A A;  1JOO A;  5IGC A;  3VYR A;  1TQO A;  1D5X C;  1FNU A;  2G9D A;  5I2Y A;  2HDM A;  1HQM C;  2BDN A;  5T1I A;  2MHV A;  4DAV A;  5KYI A;  3GTO B;  5BN5 A;  1SYE A;  5K36 H;  2K5W A;  3M7G A;  5C6A A;  5IT9 E;  4F88 A;  1ET6 A;  1BCP F;  2JYO A;  1KDA A;  4MN3 A;  1YNN C;  1XYI A;  1S5E D;  4FNF A;  4E6I A;  4A3I B;  1TT2 A;  2AWN A;  4P2C B;  2F0N A;  3PUZ A;  3KLS A;  5CR3 A;  1PTO D;  3SEB A;  1SFO B;  2PW5 A;  2NVY B;  1A2T A;  1HUN A;  3T4A C;  1O80 A;  4JK1 C;  4C3I G;  3NBI A;  3HS0 C;  1PTO B;  1VCI A;  3R3O A;  3SR1 A;  3RMH A;  1PXU A;  1SBB B;  2EJF C;  3R2T A;  3X3N A;  2WKC A;  4DF7 A;  4DGZ A;  3K5M A;  2JXM B;  4ZLT F;  2R93 B;  2IT1 A;  4KD3 A;  2PNR C;  1EY4 A;  1I6V C;  3MAQ A;  4J1M A;  4JBW A;  5KND A;  4H13 C;  4RWS C;  2F0S A;  1EY0 A;  2RDH A;  1Z47 A;  1FR3 A;  4HCS A;  3LWE A;  3CRK C;  4RHR A;  4IFD J;  4HMJ A;  2R7Z B;  2KEE A;  4J6H A;  1SNM A;  5D14 A;  1A3V A;  4A3M B;  1SAP A;  4M1U B;  2LMC B;  1AEX A;  4G57 A;  2L55 A;  4RFB A;  1WCM B;  4IN3 A;  1AFP A;  4DN4 M;  2F0E A;  4ZQ3 A;  2PO4 A;  1EIG A;  1F77 A;  1D5M C;  1SDF A;  3FDT A;  2XRS D;  4OO1 G;  2XWB B;  3K7A B;  1JOR A;  2N88 A;  1B50 A;  5FKA C;  2EY6 A;  4IUV A;  3VYT A;  3OWF A;  1IW7 C;  2KUM A;  1QIL A;  1LTG D;  1WD1 A;  5CBA E;  3TP7 A;  5A2Q L;  1EEI D;  1II3 A;  1AZQ A;  5EJW A;  3I91 A;  4IFD I;  1HTP A;  4CJ1 B;  4U67 3;  3QJY A;  3DWA A;  4RKL A;  1TU2 B;  2SEB D;  1LTR D;  5JJZ A;  2JA8 B;  1V43 A;  3NK9 A;  2CHB D;  1H9M A;  2AWO A;  1I6H B;  1SNQ A;  3FPP A;  3N52 A;  1DZ1 A;  3VR6 A;  1RF2 D;  3S14 B;  5C5L A;  1EFI D;  1TWC B;  4BBS B;  1STE A;  2KCC A;  3TN2 A;  5DAU A;  4J8Q A;  1A2U A;  3CQZ B;  1H9K A;  3VR3 A;  3J81 E;  4B9X A;  2LFN A;  3TBI B;  2RDG A;  5M3M B;  3J80 L;  2M2L A;  1G29 1;  2L12 A;  2WAC A;  3D6C A;  3S1R B;  1FYC A;  1HPC A;  4OGQ C;  4HR7 B;  1EYC A;  1B44 D;  4IFD H;  5M9O A;  5HUR A;  2XNA C;  1EU3 A;  4NKL A;  3NWT A;  2EYM A;  4IFD G;  4F87 A;  3A56 A;  1ILQ A;  5C4Z A;  4KTA A;  4IUT A;  2A69 C;  2JA5 B;  3C1E A;  1DON A;  1YNJ C;  3S1M B;  3HGB A;  4PNY A;  5C44 B;  4RCO A;  4RKB A;  5I6W A;  1D1I A;  3KUP A;  1IHZ A;  3K5O A;  2L11 A;  4RCN A;  2CQA A;  2E2H B;  5D3I B;  1GHJ A;  4CKE A;  1BNZ A;  5CV4 A;  3Q24 A;  1EY6 A;  1MSH A;  3M7N A;  2H4O A;  3BZD B;  1STG A;  2ZXP A;  1U4P A;  3DWQ A;  3HOV B;  5C3E B;  1T5X D;  2B8F A;  3SK5 A;  5KRU A;  2AUK A;  5COY A;  3TP6 A;  4QUC A;  4HAE A;  2DNE A;  1PRT C;  3BS1 A;  1JCK B;  1PTO C;  3JAM E;  1I3Q B;  3IKJ A;  1YNN D;  5CBE E;  2EY5 A;  3QWN A;  2B2W A;  1TWG B;  1PTO H;  3MTS A;  4DK0 A;  4NDX A;  2NB0 A;  4LK1 C;  3C2P A;  4ZYS A;  2B2T C;  4I65 A;  3T51 B;  1IL8 A;  3S2D B;  4C3I B;  1O7Z A;  2TSS A;  2TMP A;  3MWY W;  5JVG 3;  3NQI A;  2O5I C;  5LHY 1;  3PO3 B;  3S2H B;  1A3T A;  4XQQ A;  1NSN S;  5IIF A;  3H94 A;  3D4R A;  1CK1 A;  1STY A;  4O1N A;  1SYB A;  3R8B A;  2OEO A;  2B2Y A;  2QCP X;  3GTM B;  4LMQ D;  2KEC A;  3I4L A;  1JWM D;  3FVQ A;  1J9O A;  4NMZ A;  1CT1 D;  2MGS A;  2A73 B;  4R9W A;  2JSO A;  3TP8 A;  3PO2 B;  2EXZ A;  5ELE A;  5KIX A;  1PMR A;  1TS4 A;  5BN3 A;  3E5S A;  3A55 A;  4DK1 A;  2JE6 I;  1TWH B;  3RZD B;  5FLX E;  3CU7 A;  3S9W A;  1DOL A;  3NBH A;  2V4D A;  2C9O A;  1EY5 A;  4C3J G;  1AW7 A;  4EVO A;  1U4L A;  4BWG B;  3GQB A;  1Y8P B;  1WVL A;  1BDO A;  1F2L A;  4XYO A;  1RHP A;  3TP5 A;  5HGT A;  1RCV D;  3I4N B;  3K5N A;  4ME5 A;  3S15 B;  1IW7 D;  1CZG A;  2R61 A;  4OL7 A;  1LO5 D;  4Y7N B;  4U68 A;  4A93 B;  1C48 A;  3MHB A;  4ZUI A;  1OXV A;  1O7Y A;  1Q12 A;  1GUW A;  5FO8 B;  2F0L A;  2I07 B;  4I7Z C;  5G3L D;  1RJT A;  2A5H A;  3PUV A;  2JA6 B;  2F0M A;  2O2L D;  2QDB A;  2F0U A;  3S16 B;  1E2V A;  4HTH A;  5EQ0 A;  4L6T B;  4G7O C;  3O13 A;  4IUU A;  1JR0 D;  5EBD A;  1HHV A;  2J7Z A;  4KY5 A;  2Y0S B;  4RH6 A;  2ZXO A;  3GTL B;  3P20 A;  3ZYY X;  4C56 C;  2NZ1 D;  4CBV A;  3PIP 3;  4WRD A;  1STB A;  3GD7 A;  4XIG S;  2WB1 B;  1HUM A;  2B2U C;  2BOS A;  4C1N I;  2NUC A;  1R4P B;  2QEJ C;  4C3H G;  2B2V C;  1NR2 A;  4X3U A;  3H09 A;  3LWU A;  3TME A;  2EYL A;  3V2T A;  4FXD A;  1OXS C;  2I46 A;  1S5C D;  2EY2 A;  2WIN B;  4DFA A;  1A3U A;  4A3B B;  1YNJ D;  2EY1 A;  5JEA G;  1JOQ A;  5M5X B;  4LJZ C;  3DWP A;  3U9O A;  4XTC S;  1BCP C;  1GUG A;  4L63 B;  1EQV A;  2QKI C;  4KI0 A;  3HG9 A;  3OW7 A;  1XTC D;  3I72 A;  1SJE D;  1HA6 A;  3I73 A;  4ZKB B;  1S4Z A;  4HCE A;  3FKI B;  1Y1V B;  1V8Q A;  4KY7 A;  3MVV A;  2EJM A;  2KOL A;  1ESR A;  4ZRZ A;  1EL0 A;  2PZU A;  3S1Q B;  4DNT B;  3PUY A;  2BE5 D;  2SOB A;  3NXW A;  1ZYR D;  5EPL A;  2QIL A;  3NTI A;  5CYU A;  1SSO A;  1TVX A;  3AB9 A;  4C2M B;  3OIP A;  1PLF A;  3V96 A;  1VF5 C;  4TRD A;  5IGB A;  1PFM A;  5E3F A;  5DM7 3;  1PRT D;  1TII D;  3K5L A;  4TQU S;  3D4W A;  5C4H A;  1CTM A;  1BOS A;  1UUP A;  2MJ8 A;  4QIW B;  2EJG C;  4H0L C;  4FYD A;  1PRT B;  2EOT A;  3MFG A;  1MBY A;  4KKT A;  1LTS D;  4OO1 I;  1GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...