4OO1H

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
353
structure length
279
Chain Sequence
ITITKRNGAFSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 69
structure length 279
sequence length 353
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1H01
1OXTA 3BG3A 1E2ZA 4DK1A 1Z7TA 4KKTA 1BDOA 5A35A 2KCCA 4BA1I 2F1MA 5C0XH 1HCZA 5JEAH 3P20A 4H44C 3M4YA 1Q12A 3PUWA 3A8IE 3OW7A 2A6EC 3FPPA 3IFTA 3QG1A 5JEAG 4XIGS 1GUTA 3LWUA 1B9MA 2A69C 2A6HD 3T56B 1V43A 1Y8PB 2JE6I 1H9KA 3VA7A 3VR5A 4L8JA 1GUOA 3CRKC 4KHZA 2JEAI 1FYCA 2K32A 1GHKA 2Q8IB 2DN8A 1OXSC 3A8JE 3OPOA 1CTMA 1IYVA 3W3AA 2LMCB 3PUXA 4BA2I 3VR6A 2B8FA 4G7OC 2O5IC 4LJZC 2QF7A 1Y8OB 5KNBA 2K33A 3VR2A 3LNNA 1IW7D 3M7NA 3A7AB 2A68D 3L7ZC 3SDZA 5K36G 1Q90A 2D2CC 3T51B 2L5TA 4PV1C 4TKOB 1FR3A 2E75C 2V4DA 2B8GA 3KLRA 3M85A 1G291 1H9RA 1HQMC 2EVBA 2DNCA 1Y69U 1Q1BA 1E2VA 1Z6HA 2CW0C 2AUJD 3HGBA 1CFMA 3FMCA 2R6GA 5BN5A 1DD2A 1H9SB 1H9MA 3BDOA 2PNRC 3A7LA 3QIAA 3I72A 1O78A 4HR7B 2A69D 3GD7A 1VDZA 1GJXA 3SE0A 1IW7C 1E2WA 3D4RA 2A68C 3I4LA 1CI3M 1V8QA 1YNNC 2K7VA 3VR4A 3RLFA 1Q1EA 1OXXK 1TKWB 4XTCS 2E76C 3T53B 1LACA 4DNRB 1LABA 2A6HC 1H9JA 1HTPA 5BN4A 1GUGA 3MFYA 5KNDA 2JEBI 4KN7C 2BA1A 1Y8NB 3D31A 3NE5B 4JBWA 3PUYA 3MXUA 2AUKA 3CRLC 1T5EA 1YNJC 3A8KE 3U9SA 4DNTB 3H94A 4H13C 3IKJA 1GUSA 3ND9A 1K8OA 2IT1A 2NN6G 4OGQC 1VF5C 4KN4C 1GUNA 4TQUS 5KNCA 2PPBC 4LK1C 2NN6I 5C0XG 2ZT9C 1GHJA 3EQLC 1ZYRC 2KA7A 3I73A 3AB9A 2PCFB 1OXUA 1IYUA 2EJFC 2BDOA 2BE5C 1PMRA 2EDGA 3WDNA 4DK0A 3ND8A 5BN3A 2A6ED 3DXJC 1OXVA 2AWOA 1QJOA 2D62A 4KI0A 3GQBA 1ONLA 2EJGC 4OO1G 1HPCA 4OO1H 1DCZA 1ZKOA 2E74C 2YYZA 2JXMB 3PV0A 1K8MA 3PUVA 1O7LA 3N6RA 4JK1C 1A6XA 4IFDH 4H0LC 5K36H 1EWHA 4I7ZC 2EJMA 2DNEA 1VCIA 3QJYA 2O5JC 4IFDG 1I6VC 3VR3A 1DXMA 1B9NA 1TU2B 4KKUA 4IQZA 4G7HC 4GZYC 3TZUA 2D5DA 2BA0A 2NN6H 2BE5D 4KKSA 4RCNA 4KMUC 3OOCA 4G7ZC 3PUZA 1SMYC 1VF7A 1H9SA
chains in the Genus database with same CATH superfamily
2L11A 1PZJD 1E2ZA 3NK9A 4UP9A 2HQLA 1KXLA 3TP5A 3I55A 4BY7B 3MEFA 3QG1A 2EYHA 5JEAG 2JA6B 5EKIA 5A2QL 4BBSG 1PTOF 1YZ6A 3BVZA 1CHPD 4V190 2F0PA 1YVCA 3A8JE 3LX0A 3RN5A 2NVQH 2LMCB 1UE1A 4L5SA 2IX1A 1Y1WG 1Q8IA 4X65Q 3E9IA 2MP1A 1DONA 5M3FH 4RG1A 2CQOA 2CWAA 2A68D 3L7ZC 1X9NA 1L0WA 1SRUA 4LUOA 5T1IA 2B8GA 1XPUA 1Z6HA 2B3GA 2R6GA 1HNZQ 3QO2A 4OHJA 1QUQB 1H9MA 2VZAA 1QCBD 5C44H 3D6CA 1EQVA 1LTAD 4DR7L 3W1GA 3RLNA 1E2WA 4A75A 5IP7H 1OXXK 3M4QA 4JVZA 1VQLA 1JT8A 1H9JA 2EZVA 2QDBA 4QIWB 2ZTCA 3TRZA 3ERSX 3MFYA 3TQYA 5LMUQ 3GTQH 3NBHA 4P71A 3MXUA 2UXDL 3ULLA 5FKAC 4K6DA 2NN6G 1VF5C 3KDFA 1BO0A 1KAAA 4X66Q 5DLQE 1I3QH 3GP7A 5FOBB 1ZYRC 4A3IH 5EBCA 4EQNA 3GTJH 3UE1A 2NVTH 2WV6D 4A3EG 2OEOA 3JC66 4HMIA 4GOPC 2EJGC 2R7FA 1FGBD 4ME5A 3WOEA 4NMZA 5IGGA 4JI0Q 3MHBA 4PZ6A 3ULPA 1I4PA 1IBML 1B50A 4RKLA 4I7ZC 2LXKA 1WI5A 3P1HA 4DPGA 2Q8RE 3TSSA 3PO3H 1B9NA 5M5YH 4PQXA 4JI1Q 4GOPB 2F0IA 3KF6B 3KLSA 2RDFA 3DWPA 4MHEA 1JWMD 4DR4L 4KK7A 5KYIA 1NY4A 1TWGB 1HH2P 4JI6L 1FD7D 4MTKA 1D1KA 1BDOA 2DY8A 3PSIA 5EJWA 3QWNA 1C48A 3OHXC 1XJVA 3PIP3 1NMFA 4P73A 1IBKQ 1ASYA 4A3DH 2PI2A 2F0UA 1AFPA 5ELEA 1UE7A 1E1TA 1LTTD 4X64L 1HZ9A 4BY1B 2NVXH 3MC0B 4RHRA 5EGTA 1N8RC 4J8QA 3EJIA 2Q8IB 2HHHL 2CH4W 2XIWA 1YJ9A 1BCPC 5DEHA 3PGZA 2BOSA 1PH6A 1I3QB 2JA8H 1YNJD 5CV6A 4XQNA 2B2WC 3T1YL 3M3YH 4R1JA 1I6HH 1JICA 3CC7A 2IX0A 4CGYB 1XTDA 2K28A 4N8X1 1M4VA 1WTQA 3MEHA 4K0KQ 2QEJC 3I4MH 3VA5A 5IGFA 4B3TL 4DR6L 2E2HH 2PNRC 4EX5A 4LFCL 1PXUA 1STBA 1G2SA 2OCEA 1XMOL 5DNFA 3ONAB 5JPMC 3CQZH 1VS0A 4YCUA 3ICEA 1I5FA 1KL9A 1YHAA 2UUBQ 2L15A 1SROA 2KBNA 5E4WC 4DN4M 5C4XB 3RD4A 1T5EA 1UUPA 4KTAA 2G5DA 2CVRA 3RR5A 5FJ8G 1QZGA 1TXYA 2GA4B 1VQ8A 4HMJA 3CXCA 5IT9E 4LF8Q 2NVQB 4JI5Q 4RH6A 4J15A 5H1SE 4L6TB 2RKSA 1DCZA 4RGMA 1Y1VH 4KY6A 1EZ8A 2CFMA 2C9OA 4HIKA 2F4IA 1L1OB 4DV2L 1NCVA 3K7AB 3S16H 2DNEA 1TVXA 4LFAQ 3PO2H 5CGKA 1FJGL 2F0SA 2FMCA 1YNND 3E3XA 4POFA 2F0TA 1SJHD 3GV3A 4DGZA 4C1NK 3BG3A 1HA5A 2HIXA 1L2FA 1CK1A 1E24A 2HD3A 4ABNA 1LV9A 4BA1I 4G4KA 1WD0A 1YI2A 2R7ZH 3HOUH 1TWFB 3G6JB 3P20A 2V1CC 1S40A 3L2PA 2K1BA 3PCOB 5G3LF 3UE0A 1EU4A 4P72A 3VA7A 1EY5A 4CHTB 4WRDA 5KYLA 2DN8A 1OO9B 1OXSC 1CZWA 5IP9H 1X3EA 4LW1A 1VQ4A 4Y52H 2QEXA 2O5IC 2IW3A 1SYDA 5NUCA 5JJLA 3K5OA 4NXML 1JJ2A 1O7IA 4R9WA 1X56A 4ID6A 4UY8C 3O13A 4LF5L 2EY1A 2KVMA 3Q0AA 2CH4A 2O4XA 1TY2A 4K8IA 1PH9A 3KLRA 4LWCA 3JAMc 1HQMC 1RF2D 2UXBL 2DNCA 3W1BA 4IN3A 3T16A 2Z0SA 2KJXA 4GKJL 1X3QA 4A3GG 4LF6Q 1CKOA 3J80L 5LMNL 2FFKB 1PTOB 4IURA 4CDFC 1ZEQX 5IY0A 1STGA 3JAML 1TKWB 4JI0L 2VS1A 4JI8L 4M8AA 2R92H 3MXNA 4OX9L 5LMUL 4BY1G 4AYBB 1WCMG 3CQZB 4F8MA 2SDFA 3R2TA 4H13C 3ND9A 1HRJA 1UEAB 1EYGA 5HGQA 4HSPA 1JJCB 2NN6I 1ESFA 2JQOA 4FXDA 2E2HB 3G7LA 5I4DA 3EQLC 1PRTD 4BBSB 4JI3L 3QOJA 2F0WA 5M5WH 2Y0SB 1JJGA 2IWHA 4JI2Q 3S1QH 3I4NB 4EGVA 4KI0A 1NE3A 3A54A 3I90A 1XNRQ 2X69A 1LUZA 5D3IB 3N6RA 1GO3E 1SBBB 3J7YW 3GDEA 3BVMA 3HZXA 2PQAA 5I6WA 5JPNC 4DV1L 1HNWQ 2EY6A 3RLOA 1TU2B 1N36Q 4DR2Q 1RHPA 3DM1A 4GNXB 1A3VA 1WTVA 3DEPA 1JB7A 4X62L 1SMYC 1ILPA 2CKZB 3SK6A 5IGEA 1SMYD 2OF1A 4RAUC 4KD3A 1ENFA 3H0GH 4IZ8A 5EKKA 5M9OA 1MGSA 3Q6SA 4PMCA 2B63H 2F0OA 3J7A5 3AQQA 3WWVA 3K81C 3BZCA 3GTPH 1TWGH 3CCQA 1GUTA 3LWUA 3SK8A 5K5PA 4H02A 3HOYG 5CV4A 2JK8A 3I3CA 1TWAB 1GHKA 2F0KA 2E2JH 4IPGA 3W3AA 1V1PA 1ILQA 2QDLA 4QUCA 1C0AA 1G51A 2KHSA 2VQFL 4C3IH 1IL2A 3J81E 4HJAA 3AFQA 2Z4IA 1VQ6A 1Q90A 3CCRA 4O42A 3CC2A 2Q2UA 1B1ZA 1BOSA 4ALPA 1Y1VB 2B2YA 1IBLQ 3HGBA 4ZK9B 4R4OA 1ICFB 1WFQA 1PHJA 2Z6BA 4JYAL 3D8GA 3EFXD 2Q2HA 3DM3A 4OONA 3M4PA 1UEBA 2J0TD 3I4LA 1CI3M 3RMHA 2K6AA 2ZM6L 4A3JG 4A3MG 1EY9A 3F8TA 2QKIC 3KBGA 3RN2A 1BNZA 2XGTA 1TS5A 5BN4A 2X6GA 3PIPA 2JEBI 1ML0D 3PIO3 2N8NA 4EVOA 4HJ9A 1EOTA 4L5TA 4YWKA 1MSHA 1GUWA 4ZKCB 3GTLH 2PCFB 3HOWG 2EJFC 1X65A 2CWPA 2LKVA 2WB1B 3E0EA 1BBXC 2X6LA 4A3FB 1Q46A 4NDXA 3NTKA 5M3FB 4C3IG 2ES2A 4IFDH 4R4QA 1IKLA 1XPRA 3J7AV 3EROA 1KD1C 1X6OA 1EZ6A 2HCCA 3VR3A 1DXMA 3C46A 2YV5A 3FKIH 4U673 3HOVG 2CQAA 2IX3A 2UUAQ 4DAVA 4A4IA 1JOKA 3ULJA 2E76C 3DHQA 5G3LD 3F2BA 3CCVA 4TVAB 3BU2A 1KLUD 5DM73 2E2DC 2JA5G 2B63G 3S16B 3SEBA 4C3HG 1Q12A 3H0GG 1D8LA 5J1ZA 5GROA 1EY6A 1FL0A 2PYKA 1K73C 4RWSC 1A3TA 5IIFA 1C4QA 1KDCA 2NVYB 3IRBA 3AEVA 4Y7NB 5CBEE 1E7ZA 1QB5D 2UUCL 4QB4A 1YHBA 3BJUA 1R4QB 3MVVA 2UU9L 4ODGA 4A3GB 3UI2A 2TMPA 4LFBL 3H09A 3NBHB 5C4XH 3NWSA 4KLKA 4DNIA 5KGUA 4TKOB 2PQEA 1FR3A 2E75C 4JW0A 4CKBA 3HOZG 5GAGC 4ZYSA 1Y69U 1Q1BA 2CW0C 4K2LA 5CV8A 2XRQD 4RA8A 3H3VI 2WFWA 1N32Q 4HR7B 3FP9A 2F0GA 1WCMH 2NZHA 4IUTA 1VQNA 1CUKA 2Z6KA 4V0BA 1VQKA 2M00A 3D4WA 4MTNA 4C1NI 1DOKA 1I94L 2Q2TA 3D31A 4C2MB 3S2HH 3S1QB 1SEBD 4R8NA 4A3KG 4ZKBB 4KN4C 3I56A 1RL2A 4DR6Q 5C0XG 1A15A 4RHSA 4X65L 4JI2L 1RD9D 1PH1A 2D62A 1R9TB 2RCNA 2E74C 3CW2C 3PV0A 2I5LX 3I70A 2MO1A 3DWAA 2K5NA 3T13A 5FO7B 3BZDB 4DV6L 2ATWA 4CDDC 2ICEC 2FMMA 3Q23A 3RZOH 2I0QA 3BDCA 1TS4A 4DR1Q 1MBYA 4A3KH 2BE5D 2EXDA 4OXPA 2NUCA 3E5SA 2RF4A 4LAAA 2OWOA 4A3KB 4UAIA 3NPPA 4B3RL 4FVMA 4QJFA 1T9HA 4OWWB 2F52A 1NSNS 3NQTA 2A1AA 4NP5A 1M1KC 3BDLA 3HOYB 2A6EC 1VQFA 2HDMA 1XWEA 3JAMi 1XX8A 1JQYD 3MXPA 2KCMA 2NVTB 3C2PA 1IYVA 1DM0B 5CV7A 5KEEA 3I4OA 1JE5A 3NXWA 4ZRZA 3VYTA 3CCUA 2F3IA 4LF9L 3DWQA 1NBWA 3SGIA 1VQPA 1IBKL 1ZYRD 4GKKL 3GTKB 4A3BG 5D14A 3QOLA 3BVGA 3SDZA 2D2CC 4A3JB 4A3MB 1KNAA 4PV1C 3TMEA 5IYDH 2RHSB 1IKMA 1W2BA 5IGBA 1C9OA 1JR0D 4MNOA 1EY4A 3RUZA 5FJ8H 1LO5D 4IOCA 5C3WA 3CMAA 2A69D 4FO2A 3K5NA 2ALYB 1PRTB 4O1NA 3HFZB 4XTCS 3S1RB 2R92B 4CBVA 1VQGA 1VQ5A 5JJIA 1B70B 4KJOA 2BA1A 3DUZA 4A3FG 1YNJC 4ME3A 4EQ5A 3K5LA 4QQBX 1B53A 1J6QA 2NBFA 4LFCQ 1U4MA 1GUNA 2MQHA 2NB0A 5KNCA 3HOVH 2K5QA 3KJOA 4WJ4A 1PRTC 2DJFC 1S72A 1J8IA 1SR3A 4BWGB 1CT1D 5C4JB 2BCOA 2HIVA 2KEDA 5CV5A 1PH7A 3ITPA 1QJOA 3SVMA 1TR5A 1EIHA 1DJRD 1TT2A 3CCLA 1B7YB 1KABA 4F87A 4BBRB 3ER0A 4NXMQ 5EPJA 3I91A 2K52A 4N9PA 3J81i 5K36H 1EWHA 1JOOA 1RDPD 4KJNA 2O5JC 3P7JA 2L0CA 1SFOH 1JWUD 4MN3A 3HOWB 1S5CD 3CCSA 1ET6A 5FO9B 1KRTA 2XSCA 3S1NB 2F0HA 5M5XH 3L0OA 4FYDA 1A2UA 1SE4A 2HQEA 2EYMA 4A3JH 4A3MH 4A3DG 1VMPA 1HCZA 2LFNA 4CDCC 2MJ8A 1AZPA 1D5XC 3PUWA 3CF5A 2RDGA 5FLXc 3K0YA 4OIKA 1CZGA 4B3ML 1U4LA 4A3FH 1UAPA 2K05A 2XRSD 3S1NH 3C3LA 4OX9Q 2BH8A 4HIDA 4GLXA 1PDQA 1O7YA 3VR5A 4DUYQ 4HN7A 2UXBQ 1UE5A 2NVXB 1X54A 2WP8J 4U68A 4XDXA 3PO3G 2XTIA 4HJ5A 1CA5A 1UE6A 2JN4A 3J7AF 2K33A 1QZHA 1S5DD 4IUPA 1SLJA 5FLXE 5IE8A 1CKNA 1F9PA 5IYDG 1F2YA 3CKIB 4LUZA 2AUJD 2MPMA 2NZ1D 1HNZL 1J9OA 4QF4A 3MAQA 1LT6D 1G91A 2SEBD 3M4OH 3KF8B 3SE0A 1PLFA 3RLFA 1VQ9A 2VB2X 1QNUA 1LTLA 3L9AX 4HCEA 2A8VA 4YY3Q 4KN7C 1Y8NB 4DV6Q 1EQRA 1AW7A 5IP7G 2PW7A 1D7QA 1SXTA 3F2DA 5DAUA 3CCMA 4DR1L 2RCFA 4IALA 1PTOH 4DV1Q 2WKDA 2K5VA 1HNWL 2B2UC 3NTIA 4KY5A 2A6ED 5EQ0A 2AKWB 2NYZD 4BBRG 3D3RA 2IJ0A 2B63B 1VCIA 3NENA 3OSOA 1JB3A 1HZBA 2D5DA 4X3KA 1EIYB 4BY1H 1TWCH 3I8ZA 4JI8Q 2QGQA 3BZKA 2WB1E 3NWTA 4JI4L 5EBDA 5C0XH 5D65A 2AMCB 3AU7A 4C3HB 4LF7L 4H44C 1CQVA 2VQFQ 4GNXC 5E1FA 1D5MC 4YIJA 4A3GH 1X3PA 1IBMQ 5ELNA 3FEWX 3CU7A 2A69C 1M8AA 4A93B 1MHWC 1Q8KA 3G6EA 3CRKC 2AQ3B 1BUVT 4DUZQ 2JJQA 2N88A 1JE4A 3MA2B 1I4RA 5FK9C 4GKKQ 4P75A 1P8LA 4M1UB 3K7AH 1TWHB 4IPHA 3X3MA 2MFIA 5IP9G 4BBRH 1WVLA 3NUCA 4K5XA 4DF7A 5ELBA 2WB1G 1STAA 1DD2A 5C4XG 1L1OA 2K75A 4IJHA 1EUJA 2P5ZX 2L55A 1E3PA 3S17B 1BR9A 3FKIB 3NHHA 4QIWE 4POGA 1SN8A 1H95A 3GTGH 1SMXA 3GTQB 4DA2A 3T53B 1YJNA 1V1QA 4K2KA 5FLXL 3BYYB 1IBLL 3TZDA 1D5ZC 4G57A 1I50H 4JBWA 2DY7A 3EVQA 3K0XA 3R2IA 3KK7A 2VUMH 1EY0A 4B9XA 1S5BD 5AFWA 5C44B 2JA5H 1HA6A 2TSSA 4UHVA 4GLAC 1Y1VG 3R3OA 2UUAL 3I4MB 1ONLA 3K7UC 3M9BA 2WKCA 1WTOA 3EBEA 3E9HA 3FKIG 4OELB 1PZID 4B9WA 4AQYL 3S2DB 1WTRA 1STEA 1PH5A 4IFDG 1I6VC 1QOHA 4IPCA 2KENA 1TS3A 1VQMA 3F2UA 4G7ZC 1NTGA 1IYJB 1WTPA 5TSSA 1K28A 4DR7Q 3AYHB 4DV3Q 2YU9B 3HOWH 3J81j 4LF5Q 5IYCG 2EY5A 2F1MA 1PH2A 3A55A 2WAQB 1DZ1A 4B3SL 3KFUA 2UU9Q 4OWXB 3GTOB 4X6AH 3FPPA 4A3DB 2F03A 2UXDQ 3KDFB 2A6HD 1WD1A 3T56B 4DR3Q 3S1MB 1V43A 1G8ZD 4HJ8A 4L8JA 3NP8A 4DV7Q 1TWAH 1V1PB 1O80A 2D9UA 1SDFA 4Q5VA 5IWAQ 3TDQA 4DAYB 4UP7A 1I4XA 2I46A 2FXQA 3RZOB 3R8BA 2R3ZA 3M7NA 4YWLA 5K36G 5KIXA 3H0GB 2A19A 4ZAIA 2V4DA 3SHLA 1S4ZA 1EYDA 3BYTB 3AMUA 4JG2A 5EKLA 1Q86C 4JI3Q 3PF5A 1H9SB 4A3LG 1X32A 2K03A 3TBIB 3A7LA 1L1OC 1BQQT 4EQPA 1VDZA 1HUMA 1P16A 1SNCA 1IW7C 1Q3LA 1S5FD 2EY2A 3ZJYC 1JMCA 2VNUD 1V8QA 3SR1A 3VR4A 4AYBG 2H1EA 1BCPF 1E1OA 2SOBA 4B3RQ 1JORA 2ZM6Q 2XN9C 2B39A 1IHZA 4YHHQ 3D0FA 3QR8A 1K8OA 1N33L 2EYOA 2IL8A 2F3WA 3CC4A 1GHJA 1SE2A 1CA6A 2BE5C 3ND8A 3DLLA 3R93A 1D2BA 4XQJA 1EQQA 1STYA 1B4OA 4CJ1B 1XNRL 2PNHA 3A5ZB 3PUVA 1S5ED 1NAPA 4A3EH 1STNA 1VQ7A 3K57A 4ILWA 1LTID 3C1EA 4A3BH 1PH3A 5C6AA 5HY6A 4G7HC 1Z47A 2NN6H 2Y0SG 4KKSA 4XYQA 4IUUA 5LMNW 2ZTDA 1YNXA 1MSGA 4KHVA 5JJZA 3TS2A 2EXZA 4PMWA 1JC7A 2XWJB 3VYUA 2EYJA 2DGYA 2UUBL 3PO3B 2PZTA 5A35A 1LLRD 4IO9A 5EAYA 2OTJA 3OTOL 4QUFA 5JOBA 1LT5D 2R61A 1K3BC 4L5QA 2Z8LA 5C44G 1U9RA 1B9MA 1CSQA 2JA7H 1YIJA 1T5XD 4J1MA 1FNUA 1EEFD 3BS1A 1GUOA 2MNAA 3T1HL 2K32A 2IPKD 4DR5L 1XMQQ 4QMGA 4GNXA 1YITA 1HR0L 1KDAA 2JA9A 5C4HA 4O2DA 3D6WA 2F0JA 3T51B 2DJGC 3TP8A 3UDIA 4RGOS 4LMQD 5COYA 1RODA 5C3XA 1LTBD 1SYBA 1H9RA 3PQIA 1W6JA 1KHIA 2K5WA 2LY7A 2F4VQ 5LL6S 1ASZA 5BN5A 1MJCA 4BBSH 1SYGA 3STBD 1KIXA 4JYAQ 2XNAC 1K9MC 2OXPA 2QA4A 2JYOA 1DYQA 2A68C 4QGUA 1HZCA 3MFGA 3U9OA 2VUMB 3S14H 1K83B 1N34L 2RSNA 2IHFA 5CORA 3TP6A 4HAEA 2XWBB 1MD2D 1VQAA 3A8KE 3H94A 4KV6A 4DKAC 4LK1C 3GTGB 3GV6A 4H7BA 1TIID 2WAQE 4LF9Q 1GVPA 1D6EC 3VYRA 1OXUA 3N52A 2BDOA 3WDNA 4P2CB 1I4HA 2NTTA 5BN3A 2R93B 1OXVA 2AWOA 3A5UA 1Q7YC 2CW0D 3HOZH 4IUNA 3A74A 3PO2G 2QILA 4IFDI 2C35B 1ICWA 1VQOA 4DV4Q 3OMCA 3V05A 3CD6A 3NBIA 2N3SA 2RQXA 4IQZA 4C3IB 1TY0A 2HT1A 2HDLA 4X3TA 1EFWA 1ESRA 4KMUC 1AH9A 3PUZA 2LS01 4YCWA 1HR0W 1NNXA 2Z9HA 1SSOA 2FJ2A 4HEDA 1J5EL 3MTSA 3UDFA 3E0JA 4PG3A 1GD7A 1HQRD 1EY7A 1CKMA 5CC4A 4HTHA 1AN8A 2PMZB 5BR8Q 4C3HH 2KUMA 4XIGS 1EY8A 2G9DA 2D0PA 2UXCL 1QG7A 2MHVA 5I6YA 4DAPA 3ERQA 1Z9FA 1FYCA 2EYLA 1AE2A 3L3OC 2KOLA 3OPOA 1ET9A 1RTNA 3VR6A 1SFOB 3GTLB 2MO0A 3G48A 4G7OC 1NR4A 1PH4A 4DK3C 1Y8OB 4CJ2C 4KY7A 4BY7G 2HUGA 3ZYYX 1N9WA 1GXDC 3UDXA 1VQBA 1WJJA 2GVBA 4CKEA 5CR3A 3KBXA 1LTSD 2EVBA 4ZQ3A 3LGJA 3RNUA 1X55A 3I4NG 4C56C 5IGCA 1BCPD 3IFDA 1SAPA 3V2TA 4JI7L 3H3VH 3U58A 1VQCA 3S17H 1WTHA 2L12A 3CCEA 1BVSA 2UUCQ 3DMUA 3H3VC 3W2DA 2VQEQ 3MXNB 5E3FA 4HIOA 1I4QA 1CKNB 3S1RH 1HJPA 1TWHH 3HG9A 4YHHL 3PUYA 1BCPB 3VDYA 3TS0A 4TRDA 1KTKA 2IT1A 1W6KA 3VYSA 4TQUS 2EIFA 5T1GA 2WIIB 3KOJA 1TQOA 1XNQQ 2VB3X 3URYA 3FRPB 3M4OB 2MGSA 4DR4Q 1IYUA 1SNOA 2EQSA 4P74A 1KAWA 1UNSA 1K3RA 2PZWA 1AP0A 2H5XA 2YYZA 5ISRA 2OQ0A 1PFNA 4XT1B 4S3SA 4ULLA 2JA8B 1B8AA 3QJYA 5GQOA 1A8VA 1BBUA 2Y0SE 4XYOA 2KQ3A 1TWCB 4DAMA 1EIGA 3G4SA 2A74C 2GVAA 1EL0A 4O0AA 1PFSA 1H9SA 3U4ZA 5LMNQ 2J4XA 1HUNA 5FLMH 4A3IG 3SK4A 3HOYH 3KUPA 2N78A 3J81c 4MZ9A 3Q8DA 1SJED 1SYFA 4BS9A 5IYBG 4NXNL 4FXKC 3WOFA 2E5LQ 2K04A 1EIFA 4JV5L 1F9QA 3SK5A 3H15A 5M5XB 2HCIA 1CTMA 3PUXA 5I2YA 1HNXQ 1DOMA 3G71A 3CPFA 2AQ1B 5HURA 3OWEB 5IODA 4YWMA 1QVGA 2E2IH 3VR2A 3LNNA 3T1YQ 4DU9A 2JP1A 4A3CG 4KD4A 5F2DA 3K59A 2KECA 1EWCA 4X3SA 2QW7A 2Z6KC 4Z9CB 4DFAA 4DUZL 1VMCA 3HOXG 3HKZG 1HTLD 3S24A 2B2TC 5M3FG 3F2CA 4LF8L 1O78A 4FF4A 5DM63 2LXJA 4FDBA 2ZXPA 1Y1WH 3D4RA 1V1OA 3PIOA 3H6MA 3HOVB 4A93G 3H91A 4QY7A 5C0XJ 1LACA 3TEHB 4R8IA 1K0RA 2ZJRA 3FVQA 2R92G 2AUKA 3RZDH 3CRLC 4NXNQ 4YY3L 1PYSB 4DNTB 3J81L 3S14B 4JBMA 4OWTB 1KQSA 4DXFA 2PPBC 5JJKA 4R4IA 5JVH3 2WAQG 4RGTA 2KHIA 1AE3A 4GN4B 3I73A 1V9PA 2F4VL 1KRSA 4HSVA 1PMRA 4JI5L 4WFN3 4DV0Q 3RZDB 2JA6G 2YTVA 5CBAE 4ZUJA 4OO1H 4JI4Q 1K8MA 5ELOA 3TREA 3PF4A 3NQIA 1A6XA 3EN2A 1YJWA 1GOZA 1SE8A 2Q2IA 5J22A 2SNSA 3HRZC 1PTOC 4C3JB 1Q82C 1N34Q 1R4PB 4GZYC 1X3FA 5M3MG 2EOTA 2OQKA 3FHWA 2BDNA 1E0BA 2NVYH 3KF6A 1XYIA 2EYPA 1XXGA 4PZ7A 1ENAA 3FDTA 3X3NA 1E22A 1MIUA 5J3BA 5IYBH 5C5LA 3K8AA 4AQYQ 2WINB 3GTMB 3OTOQ 4DK6C 1G6ZA 3PO2B 1KNEA 2VW9A 3J7ZC 1IZ6A 4N9TA 2YTXA 4JBKA 2IY5B 4DV5L 2Q8TA 3M4YA 3F1ZA 1LTRD 3LWEA 4JC0A 1SNPA 3U50C 3S9WA 3GTMH 1EWIA 3OW7A 2PZUA 3IFTA 4UDUC 5L37A 1C7YA 3HOUG 2R7ZG 5C3EG 1U5KA 2JSOA 1SNMA 2HHHQ 1RTOA 1H9KA 2E2JB 1QNKA 1CHQD 4X66L 2AWNA 2I5MX 4NW2A 5GAHC 2B8FA 5C4ZA 1FNWA 5AJ3Q 5C0XI 5D3DA 4C3JG 2NTSA 1KDBA 2C5CA 5KNBA 4JBJA 5ELCA 4K8JA 1WYDA 2H4OA 2R93G 3KLSX 4DR3L 4XQQA 3K5MA 2F0EA 4N8FA 4FF3A 3K80C 4B3MQ 3CHBD 1B3QA 2K01A 3STBC 3OYYA 2F0MA 5CMDA 3E6ZX 1VQHA 1LT3D 5I2XA 1IL8A 1A2TA 4DV3L 1N33Q 5I9PA 3I72A 1HR0Q 5JEAJ 3K58A 1PYBA 3HP3A 5C3EB 1IXRA 4R4TA 1MJEA 1Q81C 2K14A 2PQAB 2G9HD 2VY3A 1HTPA 1VQDA 2RDHA 1GUGA 4C2MH 3JAME 3NE5B 3OW2A 3TP7A 5CV9A 1EFID 1NR2A 3J80i 4UP8A 5CYUA 4DR2L 1LYLA 4FF2A 4DAYA 1WCMB 1BF4A 3A0JA 1B44D 3KYHC 3U4VA 4GOPA 1DGSA 5EPKA 1XMQL 1WTWA 4LF7Q 1A3UA 1EU3A 4I65A 1CQFA 3GQBA 3I4MG 1G6PA 4FF1A 3S15B 2JA7B 1RJTA 1O7LA 4WJ3M 4JI6Q 4DV4L 3HKZB 5E4XA 1MI2A 4LF4L 1QE6A 2L1BA 4KKUA 2JA8G 2BA0A 1PFMA 4CDEC 2N55A 2F0LA 4DV7L 1GKHA 3PMFA 4RCNA 1K8AC 1AZQA 3OOCA 1N32L 4HCSA 1PYWD 4Y7NH 1Z7TA 4KHPL 3GTPB 4FNFA 4FXGC 4F7XA 5IGDA 3GTOH 2KCNA 5J39A 3HS0C 1F9RA 2I07B 1ZXTA 2ZJPA 1G2TA 4GN3B 3CCJA 1O7ZA 1HNXL 4A3IB 3V96A 3HKSA 2LSSA 2QF7A 2Z1CA 1I4GA 2EE1A 1FGUA 1RIPA 1CM9A 3HOUB 1F77A 2F3VA 3MZ5A 3OWFA 2R7ZB 3CPWA 2A5HA 4X64Q 5BR8L 1F9SA 2NZOA 2SNMA 4ZLTF 3A56A 3UDGA 2BH2A 5E7NA 1W3SA 3M85A 1JOQA 1G291 2RBMA 4R4CA 4IJLA 4JOIA 3FMCA 1A0IA 1U0LA 2CHBD 1PA6A 3BDOA 4K5VA 1II3A 4YCVA 5A2QE 2A73B 3GD7A 2PI2E 2K5HA 5ELDA 1JCKB 1C8CA 1JWSD 2RA4A 3OIQA 2K7VA 4LNQA 1FVIA 1LABA 2A6HC 3T4AC 4A76A 2B2UA 5KNDA 4AIMA 2I5HA 1STHA 5ELFA 3IKJA 3NELA 3T1HQ 5I9OA 4OGQC 2DUDA 2F0QA 5M3MH 4DR5Q 1A63A 3HKZE 4E6IA 3CMEA 4DXGA 4DUYL 2ZT9C 1Y1WB 4LFAL 1U4RA 4NB3A 4LF6L 2R7DA 2EDGA 2WACA 4K5WA 3CP0A 3DXJC 4B3SQ 2NWGA 2ID0A 1HZAA 5JVG3 4OO1G 3SXHA 2KHJA 1F2LA 2MUYA 4AH6A 2JA6H 3S1MH 1UWVA 2IHEA 4GS3A 2M9VA 4K6LA 1PVOA 4H0LC 1KLGD 4WORA 1F2MA 2YTYA 5C5MA 3KF8A 3HEJA 2PMZE 3Q24A 1U4PA 1L0XB 2YU9H 3I2ZA 4RGNA 2F0FA 1L0YB 2JA7G 1OXTA 3IL8A 4DK1A 2M2LA 3M7GA 2B29A 4QL5A 2KCTA 1ENCA 1M90C 4A93H 1B2TA 1FNVA 4DV0L 5JEAH 3OIPA 2E5LL 3GTKH 3MWYW 2L4NA 3KLWA 3NTHA 1YEZA 1Y8PB 2VL6A 3KJPA 4K0KL 2ZXRA 4KHZA 3HOXH 2JEAI 1HHVA 1RKNA 3OMGA 4K14A 4CJ0B 1Y14B 2FHTA 1XMOQ 3EA6A 4LJZC 3DEOA 2E8GA 1GM5A 4PZ8A 4A3CH 1LM0A 4XXEA 3HOZB 1DOLA 1PTOD 4MIUA 2XVSA 4IUQA 2L5TA 3TN2A 3FPUB 2EPBA 5C4JH 1RCVD 2B2TA 2PW5A 1PRTF 1E2VA 3NEMA 2ENBA 5GAEC 4GLVB 1EOVA 1EYAA 2F0NA 2N49A 2B2YC 5JAVA 5LHY1 1SNDA 1J5EQ 1SYCA 5M5YB 5M3MB 3QIAA 1QVCA 4JPBW 1WTXA 5IWAL 4X62Q 3B6YA 1Q1EA 1D1IA 4OO1I 4RMFA 4A3EB 1PZKD 4J6HA 2RSOA 3AFPA 5FLMG 3GO5A 4JCVE 3S15H 3D4DA 1R9TH 2UXCQ 4LUVA 1I94Q 4LF4Q 3U9SA 1HFGA 4DV2Q 4JI7Q 1KC8C 4GKJQ 2E2IB 5IOCA 4A3LH 1TS2A 2RHQB 4PMBA 2KA7A 2ZJQA 4IFDJ 5HGTA 4RCOA 1VQJA 1NUCA 1NJIC 3C1FA 4B08A 3S2HB 1YHQA 1HPCA 1ZKOA 1PFBA 2JXMB 2ZTEA 1BBWA 4JK1C 4F88A 3M3YB 2OT2A 4NKLA 1XNQL 4IUVA 5KRUA 4X3UA 1XPOA 4HJ7A 2CCZA 1EYCA 4OEMB 3TZUA 4JI1L 3P75A 3EIVA 1AEXA 4OL7A 1FJGQ 1X3GA 4IOAA 2L9HA 1QILA 1K8GA 4BXXH 5EPLA 2GN5A 4WJWA 1PH8A 3CAMA 5GADC 2AHOB 2VQEL 4KKTA 4CKCA 4DV5Q 1VQIA 4EQOA 2KCCA 2RVLA 2VXWA 4APVA 3A8IE 5IYCH 3MXGA 2Z4HA 1TWFH 1PV4A 1WOCA 2ZXOA 2K5DA 2K4KA 2JE6I 4RKBA 1BXTA 3Q22A 3I4NH 1B3AA 3J80E 3QB3A 5AJ3L 4BXXG 5M5WB 4UPAA 1QUQA 4L5RC 4BA2I 4QCLA 4A3BB 4OIJA 4BY7H 4RFBA 2F0DA 1IW7D 3K6OA 3A7AB 4GN5A 1LT4D 2B2WA 4KHPQ 4JV5Q 2K50A 2ASBA 3NSWA 3W5OA 4XT3B 1MKHA 1K0SA 3GTJB 1CFMA 3J80c 5FO8B 4AYBE 2R93H 1SE3A 2OTLA 4ZCKA 4C3JH 1S3OA 2VUMG 1GJXA 2O2LD 2QCPX 1NMGA 5IT9c 4I7AA 1YNNC 2ICIA 2FINB 3S2DH 4DNRB 4LFBQ 4JOIC 2J7ZA 4NPSA 1HFNA 1BKBA 1SNQA 1OTCA 1EQTA 2EYFA 5C3EH 1CSPA 1SYEA 1K83H 2AQ2B 1GUSA 1HXYD 2F0VA 4L63B 1N36L 4B3TQ 2JA5B 4Q0FA 3AB9A 2PO4A 1YBYA 4DK0A 3HOXB 4PNYA 1I50B 5LL6X 4FP5D 2B2VC 3IAYA 4TSSA 4ZUIA 2KEEA 2B2VA 1XTCD 1QWYA 2EJMA 4IPDA 2D0OA 1A62A 1I6HB 4HIMA 1QVFA 1F2ZA 1VQEA 5IT9L 1EEID 1VF7A 1LTGD 3I7FA
chains in the Genus database with same CATH topology
2L11A 1PZJD 1E2ZA 3NK9A 3TP5A 4BY7B 3QG1A 2EYHA 5JEAG 2JA6B 5EKIA 5A2QL 1PTOF 3BVZA 1CHPD 4V190 2F0PA 3A8JE 3LX0A 2LMCB 2IX1A 1Q8IA 2MP1A 1DONA 2A68D 3L7ZC 5T1IA 2B8GA 1Z6HA 2R6GA 3QO2A 4OHJA 1H9MA 1QCBD 3D6CA 1EQVA 1LTAD 1E2WA 1OXXK 1H9JA 2EZVA 2QDBA 4QIWB 3MFYA 3NBHA 3MXUA 5FKAC 4K6DA 2NN6G 1VF5C 1BO0A 1KAAA 3GP7A 5FOBB 1ZYRC 5EBCA 4EQNA 2WV6D 2OEOA 4HMIA 2EJGC 1FGBD 4ME5A 3WOEA 4NMZA 5IGGA 3MHBA 1I4PA 1B50A 4RKLA 4I7ZC 3P1HA 2Q8RE 3TSSA 1B9NA 4PQXA 2F0IA 3KLSA 2RDFA 3DWPA 4MHEA 1JWMD 4KK7A 5KYIA 1TWGB 1FD7D 1D1KA 1BDOA 2DY8A 5EJWA 3QWNA 1C48A 3OHXC 3PIP3 2F0UA 1AFPA 5ELEA 1LTTD 4BY1B 3MC0B 4RHRA 5EGTA 4J8QA 3EJIA 2Q8IB 2XIWA 1BCPC 5DEHA 2BOSA 1I3QB 1YNJD 5CV6A 4XQNA 2B2WC 1JICA 2IX0A 4CGYB 2K28A 1M4VA 1WTQA 3MEHA 2QEJC 3VA5A 5IGFA 2PNRC 1PXUA 1STBA 1G2SA 5DNFA 3ONAB 5JPMC 5E4WC 4DN4M 5C4XB 3RD4A 1T5EA 1UUPA 4KTAA 2CVRA 2GA4B 4HMJA 5IT9E 2NVQB 4RH6A 4L6TB 2RKSA 1DCZA 4RGMA 4KY6A 1EZ8A 2C9OA 2F4IA 1NCVA 3K7AB 2DNEA 1TVXA 5CGKA 2F0SA 2FMCA 1YNND 2F0TA 1SJHD 3GV3A 4DGZA 4C1NK 3BG3A 1HA5A 1CK1A 4ABNA 1LV9A 4BA1I 4G4KA 1WD0A 1TWFB 3G6JB 3P20A 2K1BA 5G3LF 1EU4A 3VA7A 1EY5A 4CHTB 4WRDA 5KYLA 2DN8A 1OO9B 1OXSC 1CZWA 2O5IC 2IW3A 1SYDA 5NUCA 3K5OA 4R9WA 4ID6A 3O13A 2EY1A 3Q0AA 2KVMA 2O4XA 1TY2A 4K8IA 3KLRA 1HQMC 1RF2D 2DNCA 4IN3A 3T16A 2KJXA 1X3QA 3J80L 2FFKB 1PTOB 4IURA 1ZEQX 3JAML 1STGA 1TKWB 4M8AA 3MXNA 4F8MA 3CQZB 4AYBB 2SDFA 3R2TA 4H13C 3ND9A 1HRJA 1UEAB 4HSPA 2NN6I 1ESFA 4FXDA 2E2HB 3G7LA 5I4DA 3EQLC 1PRTD 4BBSB 3QOJA 2F0WA 2Y0SB 2IWHA 3I4NB 4EGVA 4KI0A 3A54A 3I90A 2X69A 5D3IB 3N6RA 1SBBB 3J7YW 3BVMA 3HZXA 5I6WA 5JPNC 2EY6A 1TU2B 1RHPA 3DM1A 1A3VA 1WTVA 3DEPA 1SMYC 1ILPA 3SK6A 5IGEA 1SMYD 2OF1A 4RAUC 4KD3A 1ENFA 4IZ8A 5EKKA 5M9OA 1MGSA 3Q6SA 4PMCA 2F0OA 1GUTA 3LWUA 3SK8A 5K5PA 5CV4A 3I3CA 1TWAB 1GHKA 2F0KA 3W3AA 1V1PA 1ILQA 4QUCA 2KHSA 3J81E 2Z4IA 1Q90A 4O42A 1B1ZA 1BOSA 1Y1VB 2B2YA 3HGBA 4ZK9B 3D8GA 3EFXD 2J0TD 3I4LA 1CI3M 3RMHA 2K6AA 1EY9A 2QKIC 3KBGA 1BNZA 5BN4A 1TS5A 2X6GA 2JEBI 1ML0D 3PIO3 4EVOA 1EOTA 1MSHA 1GUWA 4ZKCB 2PCFB 2EJFC 2LKVA 2WB1B 1BBXC 2X6LA 4A3FB 4NDXA 3NTKA 5M3FB 4C3IG 4IFDH 1IKLA 3J7AV 3EROA 1EZ6A 2HCCA 3VR3A 1DXMA 3C46A 4U673 2CQAA 2IX3A 4DAVA 1JOKA 2E76C 3DHQA 5G3LD 1KLUD 5DM73 2E2DC 3S16B 3SEBA 4C3HG 1Q12A 5J1ZA 1EY6A 2PYKA 4RWSC 1A3TA 5IIFA 1C4QA 1KDCA 2NVYB 4Y7NB 5CBEE 1QB5D 4QB4A 1R4QB 3MVVA 4ODGA 4A3GB 3UI2A 2TMPA 3H09A 3NWSA 5KGUA 4TKOB 2PQEA 1FR3A 2E75C 4CKBA 4ZYSA 1Y69U 1Q1BA 2CW0C 4K2LA 5CV8A 2XRQD 4RA8A 4HR7B 2F0GA 4IUTA 4V0BA 2M00A 3D4WA 4C1NI 1DOKA 3D31A 4C2MB 3S1QB 1SEBD 4R8NA 4ZKBB 4KN4C 5C0XG 1A15A 4RHSA 1RD9D 2D62A 1R9TB 2E74C 3PV0A 3I70A 3DWAA 3T13A 5FO7B 3BZDB 2ICEC 2FMMA 3Q23A 3BDCA 1TS4A 1MBYA 2BE5D 2NUCA 3E5SA 4LAAA 4A3KB 4UAIA 3NPPA 4FVMA 1NSNS 3NQTA 4NP5A 3BDLA 3HOYB 2A6EC 2HDMA 1XWEA 1XX8A 1JQYD 3MXPA 2NVTB 3C2PA 1IYVA 1DM0B 5CV7A 5KEEA 3NXWA 4ZRZA 3VYTA 3DWQA 1ZYRD 3GTKB 5D14A 3QOLA 3BVGA 3SDZA 4A3MB 2D2CC 4A3JB 1KNAA 4PV1C 3TMEA 1IKMA 5IGBA 1JR0D 1EY4A 3RUZA 1LO5D 5C3WA 2A69D 4FO2A 3K5NA 1PRTB 4O1NA 4XTCS 3S1RB 2R92B 4CBVA 4KJOA 2BA1A 3DUZA 1YNJC 3K5LA 1B53A 2NBFA 1U4MA 1GUNA 2NB0A 5KNCA 2K5QA 1PRTC 1J8IA 4BWGB 1CT1D 5C4JB 2BCOA 2KEDA 5CV5A 3ITPA 1QJOA 3SVMA 1TR5A 1EIHA 1DJRD 1TT2A 1KABA 4F87A 4BBRB 5EPJA 3I91A 4N9PA 5K36H 1EWHA 1JOOA 1RDPD 4KJNA 2O5JC 3P7JA 2L0CA 1JWUD 4MN3A 3HOWB 1S5CD 1ET6A 5FO9B 2XSCA 3S1NB 2F0HA 4FYDA 1A2UA 1SE4A 2HQEA 2EYMA 1VMPA 1HCZA 2LFNA 2MJ8A 1AZPA 1D5XC 3PUWA 2RDGA 3K0YA 4OIKA 1CZGA 1U4LA 1UAPA 2K05A 2XRSD 3C3LA 1PDQA 1O7YA 3VR5A 4HN7A 2NVXB 2WP8J 4XDXA 4U68A 1CA5A 3J7AF 2K33A 1S5DD 4IUPA 5FLXE 1F9PA 1F2YA 3CKIB 2AUJD 2MPMA 2NZ1D 1J9OA 4QF4A 3MAQA 1LT6D 1G91A 2SEBD 3SE0A 1PLFA 3RLFA 2VB2X 1QNUA 3L9AX 4HCEA 4KN7C 1Y8NB 1AW7A 2PW7A 1SXTA 5DAUA 4IALA 1PTOH 2WKDA 2B2UC 3NTIA 4KY5A 2A6ED 5EQ0A 2NYZD 3D3RA 2IJ0A 2B63B 1VCIA 3OSOA 1JB3A 2D5DA 4X3KA 3I8ZA 3NWTA 5EBDA 5C0XH 5D65A 3AU7A 4C3HB 4H44C 1CQVA 5E1FA 1D5MC 4YIJA 1X3PA 3FEWX 3CU7A 2A69C 1M8AA 4A93B 3CRKC 2AQ3B 1BUVT 2N88A 1JE4A 3MA2B 1I4RA 5FK9C 4M1UB 1TWHB 3X3MA 1WVLA 3NUCA 4K5XA 4DF7A 5ELBA 1STAA 1DD2A 2L55A 3S17B 1BR9A 3FKIB 3NHHA 3GTQB 4DA2A 3T53B 5FLXL 4K2KA 3BYYB 3TZDA 1D5ZC 4G57A 4JBWA 2DY7A 3EVQA 3R2IA 3KK7A 1EY0A 4B9XA 1S5BD 5AFWA 5C44B 1HA6A 2TSSA 3R3OA 3I4MB 1ONLA 2WKCA 1WTOA 1PZID 4B9WA 3S2DB 1WTRA 1STEA 4IFDG 1I6VC 1QOHA 1TS3A 3F2UA 4G7ZC 1WTPA 5TSSA 2YU9B 2EY5A 2F1MA 3A55A 2WAQB 1DZ1A 3GTOB 3FPPA 4A3DB 2F03A 1WD1A 2A6HD 3T56B 3S1MB 1V43A 1G8ZD 4L8JA 3NP8A 1V1PB 1O80A 2D9UA 1SDFA 4Q5VA 3TDQA 1I4XA 2I46A 3RZOB 3R8BA 2R3ZA 3M7NA 5K36G 5KIXA 3H0GB 4ZAIA 2V4DA 3SHLA 1S4ZA 1EYDA 3BYTB 3AMUA 5EKLA 1H9SB 1X32A 2K03A 3TBIB 3A7LA 1BQQT 4EQPA 1VDZA 1HUMA 1SNCA 1IW7C 1Q3LA 1S5FD 2EY2A 2VNUD 1V8QA 3SR1A 3VR4A 2H1EA 1BCPF 2SOBA 1JORA 2XN9C 2B39A 1IHZA 1K8OA 2EYOA 2IL8A 2F3WA 1GHJA 1SE2A 1CA6A 2BE5C 3ND8A 1D2BA 3R93A 4XQJA 1STYA 1B4OA 4CJ1B 3PUVA 1S5ED 1NAPA 1STNA 3K57A 4ILWA 1LTID 3C1EA 5C6AA 4G7HC 1Z47A 2NN6H 4KKSA 4XYQA 4IUUA 1MSGA 4KHVA 5JJZA 2EXZA 4PMWA 1JC7A 2XWJB 3VYUA 2EYJA 3PO3B 2PZTA 5A35A 1LLRD 4QUFA 5JOBA 1LT5D 2R61A 2Z8LA 1U9RA 1B9MA 1T5XD 4J1MA 1FNUA 1EEFD 3BS1A 1GUOA 2K32A 2IPKD 4QMGA 1KDAA 5C4HA 3D6WA 2F0JA 3T51B 3TP8A 4RGOS 4LMQD 5COYA 1RODA 5C3XA 1LTBD 1SYBA 1H9RA 1W6JA 2K5WA 2LY7A 5LL6S 5BN5A 1SYGA 2XNAC 2OXPA 2JYOA 1DYQA 2A68C 3MFGA 3U9OA 2VUMB 1K83B 2RSNA 5CORA 3TP6A 4HAEA 2XWBB 1MD2D 3A8KE 3H94A 4KV6A 4LK1C 3GTGB 3GV6A 4H7BA 1TIID 3VYRA 1D6EC 1OXUA 3N52A 2BDOA 3WDNA 4P2CB 1I4HA 2NTTA 5BN3A 2R93B 1OXVA 2AWOA 2CW0D 4IUNA 2QILA 4IFDI 1ICWA 3OMCA 3V05A 3NBIA 4C3IB 2RQXA 4IQZA 1TY0A 2HDLA 4X3TA 1ESRA 4KMUC 3PUZA 2LS01 1SSOA 2FJ2A 4HEDA 3MTSA 3E0JA 1HQRD 1EY7A 5CC4A 4HTHA 1AN8A 2PMZB 2KUMA 4XIGS 1EY8A 2G9DA 1QG7A 2MHVA 5I6YA 4DAPA 3ERQA 1FYCA 2EYLA 3L3OC 2KOLA 3OPOA 1ET9A 1RTNA 3VR6A 1SFOB 3GTLB 4G7OC 1NR4A 1Y8OB 4CJ2C 4KY7A 2HUGA 3ZYYX 1GXDC 4CKEA 5CR3A 3KBXA 1LTSD 4ZQ3A 2EVBA 4C56C 5IGCA 1BCPD 3IFDA 1SAPA 3V2TA 2L12A 3DMUA 3H3VC 3W2DA 5E3FA 1I4QA 3HG9A 3PUYA 1BCPB 4TRDA 1KTKA 2IT1A 1W6KA 3VYSA 4TQUS 5T1GA 2WIIB 1TQOA 2VB3X 3URYA 3FRPB 3M4OB 2MGSA 1IYUA 1SNOA 1UNSA 2PZWA 1AP0A 2YYZA 5ISRA 1PFNA 4XT1B 4S3SA 4ULLA 2JA8B 3QJYA 4XYOA 2KQ3A 1TWCB 1EIGA 2A74C 1EL0A 1H9SA 2J4XA 1HUNA 3SK4A 3KUPA 1SJED 1SYFA 4BS9A 4FXKC 3WOFA 2K04A 1F9QA 3SK5A 5M5XB 2HCIA 1CTMA 3PUXA 5I2YA 1DOMA 2AQ1B 5HURA 3OWEB 5IODA 3VR2A 3LNNA 4DU9A 2JP1A 4KD4A 5F2DA 3K59A 2KECA 1EWCA 4X3SA 4DFAA 4Z9CB 1VMCA 1HTLD 2B2TC 1O78A 4FF4A 5DM63 2ZXPA 3D4RA 1V1OA 3H6MA 3HOVB 3H91A 5C0XJ 1LACA 4R8IA 3FVQA 2AUKA 3CRLC 4DNTB 3J81L 3S14B 4DXFA 2PPBC 5JVH3 4RGTA 3I73A 4HSVA 1PMRA 4WFN3 3RZDB 5CBAE 4ZUJA 4OO1H 1K8MA 3NQIA 1A6XA 1GOZA 5J22A 2SNSA 3HRZC 1PTOC 4C3JB 1R4PB 4GZYC 2EOTA 2BDNA 1E0BA 1XYIA 2EYPA 1XXGA 1ENAA 3FDTA 3X3NA 5C5LA 3GTMB 2WINB 1G6ZA 3PO2B 1KNEA 4N9TA 2Q8TA 3M4YA 1LTRD 3LWEA 1SNPA 3S9WA 3OW7A 2PZUA 3IFTA 4UDUC 2JSOA 1SNMA 1RTOA 1H9KA 2E2JB 1QNKA 1CHQD 2AWNA 4NW2A 2B8FA 5C4ZA 1FNWA 5C0XI 5D3DA 4C3JG 2NTSA 1KDBA 2C5CA 5KNBA 5ELCA 4K8JA 2H4OA 3KLSX 4XQQA 3K5MA 2F0EA 4FF3A 3CHBD 2K01A 2F0MA 5CMDA 3E6ZX 1LT3D 5I2XA 1IL8A 1A2TA 5I9PA 3I72A 5JEAJ 3K58A 3HP3A 5C3EB 2G9HD 1HTPA 2RDHA 1GUGA 3JAME 3NE5B 3TP7A 5CV9A 1EFID 1NR2A 5CYUA 4FF2A 4DAYA 1WCMB 1BF4A 1B44D 5EPKA 1WTWA 1A3UA 1EU3A 4I65A 1CQFA 3GQBA 4FF1A 3S15B 2JA7B 1RJTA 1O7LA 3HKZB 5E4XA 1MI2A 1QE6A 2L1BA 4KKUA 2BA0A 1PFMA 2N55A 2F0LA 3PMFA 4RCNA 1AZQA 3OOCA 4HCSA 1PYWD 1Z7TA 3GTPB 4FNFA 4FXGC 4F7XA 5IGDA 2KCNA 5J39A 3HS0C 1F9RA 2I07B 1ZXTA 1G2TA 1O7ZA 4A3IB 3V96A 2QF7A 2Z1CA 1I4GA 2EE1A 1CM9A 3HOUB 1F77A 2F3VA 3MZ5A 3OWFA 2R7ZB 2A5HA 1F9SA 2SNMA 4ZLTF 3A56A 3M85A 1JOQA 1G291 2RBMA 3FMCA 2CHBD 3BDOA 4K5VA 1II3A 5A2QE 2A73B 3GD7A 5ELDA 1JCKB 1C8CA 1JWSD 2RA4A 2K7VA 3OIQA 1LABA 2A6HC 3T4AC 2B2UA 5KNDA 1STHA 5ELFA 3IKJA 5I9OA 4OGQC 2F0QA 4E6IA 4DXGA 2ZT9C 1Y1WB 1U4RA 2EDGA 2WACA 4K5WA 3DXJC 2NWGA 2ID0A 5JVG3 4OO1G 3SXHA 2MUYA 1F2LA 2M9VA 4K6LA 4H0LC 1KLGD 4WORA 1F2MA 5C5MA 3KF8A 3HEJA 3Q24A 1U4PA 1L0XB 4RGNA 2F0FA 1L0YB 1OXTA 3IL8A 4DK1A 2M2LA 3M7GA 1ENCA 1B2TA 1FNVA 5JEAH 3OIPA 3MWYW 2L4NA 3NTHA 1Y8PB 2ZXRA 4KHZA 1HHVA 2JEAI 1RKNA 3OMGA 4K14A 4CJ0B 2FHTA 3EA6A 4LJZC 3DEOA 4XXEA 3HOZB 1DOLA 1PTOD 4MIUA 2XVSA 4IUQA 2L5TA 3TN2A 3FPUB 2EPBA 1RCVD 2B2TA 2PW5A 1PRTF 1E2VA 2ENBA 1EYAA 2F0NA 2B2YC 5JAVA 5LHY1 1SNDA 1SYCA 5M5YB 5M3MB 3QIAA 1WTXA 1Q1EA 1D1IA 4OO1I 4A3EB 1PZKD 4J6HA 2RSOA 3GO5A 3D4DA 3U9SA 1HFGA 2E2IB 5IOCA 1TS2A 4PMBA 2KA7A 4IFDJ 5HGTA 4RCOA 1NUCA 3C1FA 4B08A 3S2HB 1HPCA 1ZKOA 1PFBA 2JXMB 4JK1C 4F88A 3M3YB 2OT2A 4NKLA 4IUVA 5KRUA 4X3UA 1EYCA 3TZUA 3P75A 1AEXA 4OL7A 2L9HA 1QILA 5EPLA 4WJWA 4KKTA 4CKCA 4EQOA 2KCCA 2RVLA 2VXWA 3A8IE 3MXGA 2Z4HA 2ZXOA 2K5DA 4RKBA 2JE6I 1BXTA 3Q22A 1B3AA 3J80E 3QB3A 5M5WB 4BA2I 4QCLA 4A3BB 4OIJA 4RFBA 2F0DA 1IW7D 3K6OA 3A7AB 1LT4D 2B2WA 3NSWA 4XT3B 3GTJB 1CFMA 5FO8B 1SE3A 1GJXA 2O2LD 2QCPX 1YNNC 2ICIA 2FINB 4DNRB 2J7ZA 1HFNA 1SNQA 1EQTA 2EYFA 1SYEA 2AQ2B 1GUSA 1HXYD 2F0VA 4L63B 2JA5B 4Q0FA 3AB9A 2PO4A 4DK0A 3HOXB 4PNYA 1I50B 5LL6X 4FP5D 2B2VC 3IAYA 4TSSA 4ZUIA 2KEEA 2B2VA 1XTCD 1QWYA 2EJMA 1I6HB 1F2ZA 5IT9L 1EEID 1VF7A 1LTGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXT A;  3BG3 A;  1E2Z A;  4DK1 A;  1Z7T A;  4KKT A;  1BDO A;  5A35 A;  2KCC A;  4BA1 I;  2F1M A;  5C0X H;  1HCZ A;  5JEA H;  3P20 A;  4H44 C;  3M4Y A;  1Q12 A;  3PUW A;  3A8I E;  3OW7 A;  2A6E C;  3FPP A;  3IFT A;  3QG1 A;  5JEA G;  4XIG S;  1GUT A;  3LWU A;  1B9M A;  2A69 C;  2A6H D;  3T56 B;  1V43 A;  1Y8P B;  2JE6 I;  1H9K A;  3VA7 A;  3VR5 A;  4L8J A;  1GUO A;  3CRK C;  4KHZ A;  2JEA I;  1FYC A;  2K32 A;  1GHK A;  2Q8I B;  2DN8 A;  1OXS C;  3A8J E;  3OPO A;  1CTM A;  1IYV A;  3W3A A;  2LMC B;  3PUX A;  4BA2 I;  3VR6 A;  2B8F A;  4G7O C;  2O5I C;  4LJZ C;  2QF7 A;  1Y8O B;  5KNB A;  2K33 A;  3VR2 A;  3LNN A;  1IW7 D;  3M7N A;  3A7A B;  2A68 D;  3L7Z C;  3SDZ A;  5K36 G;  1Q90 A;  2D2C C;  3T51 B;  2L5T A;  4PV1 C;  4TKO B;  1FR3 A;  2E75 C;  2V4D A;  2B8G A;  3KLR A;  3M85 A;  1G29 1;  1H9R A;  1HQM C;  2EVB A;  2DNC A;  1Y69 U;  1Q1B A;  1E2V A;  1Z6H A;  2CW0 C;  2AUJ D;  3HGB A;  1CFM A;  3FMC A;  2R6G A;  5BN5 A;  1DD2 A;  1H9S B;  1H9M A;  3BDO A;  2PNR C;  3A7L A;  3QIA A;  3I72 A;  1O78 A;  4HR7 B;  2A69 D;  3GD7 A;  1VDZ A;  1GJX A;  3SE0 A;  1IW7 C;  1E2W A;  3D4R A;  2A68 C;  3I4L A;  1CI3 M;  1V8Q A;  1YNN C;  2K7V A;  3VR4 A;  3RLF A;  1Q1E A;  1OXX K;  1TKW B;  4XTC S;  2E76 C;  3T53 B;  1LAC A;  4DNR B;  1LAB A;  2A6H C;  1H9J A;  1HTP A;  5BN4 A;  1GUG A;  3MFY A;  5KND A;  2JEB I;  4KN7 C;  2BA1 A;  1Y8N B;  3D31 A;  3NE5 B;  4JBW A;  3PUY A;  3MXU A;  2AUK A;  3CRL C;  1T5E A;  1YNJ C;  3A8K E;  3U9S A;  4DNT B;  3H94 A;  4H13 C;  3IKJ A;  1GUS A;  3ND9 A;  1K8O A;  2IT1 A;  2NN6 G;  4OGQ C;  1VF5 C;  4KN4 C;  1GUN A;  4TQU S;  5KNC A;  2PPB C;  4LK1 C;  2NN6 I;  5C0X G;  2ZT9 C;  1GHJ A;  3EQL C;  1ZYR C;  2KA7 A;  3I73 A;  3AB9 A;  2PCF B;  1OXU A;  1IYU A;  2EJF C;  2BDO A;  2BE5 C;  1PMR A;  2EDG A;  3WDN A;  4DK0 A;  3ND8 A;  5BN3 A;  2A6E D;  3DXJ C;  1OXV A;  2AWO A;  1QJO A;  2D62 A;  4KI0 A;  3GQB A;  1ONL A;  2EJG C;  4OO1 G;  1HPC A;  4OO1 H;  1DCZ A;  1ZKO A;  2E74 C;  2YYZ A;  2JXM B;  3PV0 A;  1K8M A;  3PUV A;  1O7L A;  3N6R A;  4JK1 C;  1A6X A;  4IFD H;  4H0L C;  5K36 H;  1EWH A;  4I7Z C;  2EJM A;  2DNE A;  1VCI A;  3QJY A;  2O5J C;  4IFD G;  1I6V C;  3VR3 A;  1DXM A;  1B9N A;  1TU2 B;  4KKU A;  4IQZ A;  4G7H C;  4GZY C;  3TZU A;  2D5D A;  2BA0 A;  2NN6 H;  2BE5 D;  4KKS A;  4RCN A;  4KMU C;  3OOC A;  4G7Z C;  3PUZ A;  1SMY C;  1VF7 A;  1H9S A; 
#chains in the Genus database with same CATH topology
 2L11 A;  1PZJ D;  1E2Z A;  3NK9 A;  4UP9 A;  2HQL A;  1KXL A;  3TP5 A;  3I55 A;  4BY7 B;  3MEF A;  3QG1 A;  2EYH A;  5JEA G;  2JA6 B;  5EKI A;  5A2Q L;  4BBS G;  1PTO F;  1YZ6 A;  3BVZ A;  1CHP D;  4V19 0;  2F0P A;  1YVC A;  3A8J E;  3LX0 A;  3RN5 A;  2NVQ H;  2LMC B;  1UE1 A;  4L5S A;  2IX1 A;  1Y1W G;  1Q8I A;  4X65 Q;  3E9I A;  2MP1 A;  1DON A;  5M3F H;  4RG1 A;  2CQO A;  2CWA A;  2A68 D;  3L7Z C;  1X9N A;  1L0W A;  1SRU A;  4LUO A;  5T1I A;  2B8G A;  1XPU A;  1Z6H A;  2B3G A;  2R6G A;  1HNZ Q;  3QO2 A;  4OHJ A;  1QUQ B;  1H9M A;  2VZA A;  1QCB D;  5C44 H;  3D6C A;  1EQV A;  1LTA D;  4DR7 L;  3W1G A;  3RLN A;  1E2W A;  4A75 A;  5IP7 H;  1OXX K;  3M4Q A;  4JVZ A;  1VQL A;  1JT8 A;  1H9J A;  2EZV A;  2QDB A;  4QIW B;  2ZTC A;  3TRZ A;  3ERS X;  3MFY A;  3TQY A;  5LMU Q;  3GTQ H;  3NBH A;  4P71 A;  3MXU A;  2UXD L;  3ULL A;  5FKA C;  4K6D A;  2NN6 G;  1VF5 C;  3KDF A;  1BO0 A;  1KAA A;  4X66 Q;  5DLQ E;  1I3Q H;  3GP7 A;  5FOB B;  1ZYR C;  4A3I H;  5EBC A;  4EQN A;  3GTJ H;  3UE1 A;  2NVT H;  2WV6 D;  4A3E G;  2OEO A;  3JC6 6;  4HMI A;  4GOP C;  2EJG C;  2R7F A;  1FGB D;  4ME5 A;  3WOE A;  4NMZ A;  5IGG A;  4JI0 Q;  3MHB A;  4PZ6 A;  3ULP A;  1I4P A;  1IBM L;  1B50 A;  4RKL A;  4I7Z C;  2LXK A;  1WI5 A;  3P1H A;  4DPG A;  2Q8R E;  3TSS A;  3PO3 H;  1B9N A;  5M5Y H;  4PQX A;  4JI1 Q;  4GOP B;  2F0I A;  3KF6 B;  3KLS A;  2RDF A;  3DWP A;  4MHE A;  1JWM D;  4DR4 L;  4KK7 A;  5KYI A;  1NY4 A;  1TWG B;  1HH2 P;  4JI6 L;  1FD7 D;  4MTK A;  1D1K A;  1BDO A;  2DY8 A;  3PSI A;  5EJW A;  3QWN A;  1C48 A;  3OHX C;  1XJV A;  3PIP 3;  1NMF A;  4P73 A;  1IBK Q;  1ASY A;  4A3D H;  2PI2 A;  2F0U A;  1AFP A;  5ELE A;  1UE7 A;  1E1T A;  1LTT D;  4X64 L;  1HZ9 A;  4BY1 B;  2NVX H;  3MC0 B;  4RHR A;  5EGT A;  1N8R C;  4J8Q A;  3EJI A;  2Q8I B;  2HHH L;  2CH4 W;  2XIW A;  1YJ9 A;  1BCP C;  5DEH A;  3PGZ A;  2BOS A;  1PH6 A;  1I3Q B;  2JA8 H;  1YNJ D;  5CV6 A;  4XQN A;  2B2W C;  3T1Y L;  3M3Y H;  4R1J A;  1I6H H;  1JIC A;  3CC7 A;  2IX0 A;  4CGY B;  1XTD A;  2K28 A;  4N8X 1;  1M4V A;  1WTQ A;  3MEH A;  4K0K Q;  2QEJ C;  3I4M H;  3VA5 A;  5IGF A;  4B3T L;  4DR6 L;  2E2H H;  2PNR C;  4EX5 A;  4LFC L;  1PXU A;  1STB A;  1G2S A;  2OCE A;  1XMO L;  5DNF A;  3ONA B;  5JPM C;  3CQZ H;  1VS0 A;  4YCU A;  3ICE A;  1I5F A;  1KL9 A;  1YHA A;  2UUB Q;  2L15 A;  1SRO A;  2KBN A;  5E4W C;  4DN4 M;  5C4X B;  3RD4 A;  1T5E A;  1UUP A;  4KTA A;  2G5D A;  2CVR A;  3RR5 A;  5FJ8 G;  1QZG A;  1TXY A;  2GA4 B;  1VQ8 A;  4HMJ A;  3CXC A;  5IT9 E;  4LF8 Q;  2NVQ B;  4JI5 Q;  4RH6 A;  4J15 A;  5H1S E;  4L6T B;  2RKS A;  1DCZ A;  4RGM A;  1Y1V H;  4KY6 A;  1EZ8 A;  2CFM A;  2C9O A;  4HIK A;  2F4I A;  1L1O B;  4DV2 L;  1NCV A;  3K7A B;  3S16 H;  2DNE A;  1TVX A;  4LFA Q;  3PO2 H;  5CGK A;  1FJG L;  2F0S A;  2FMC A;  1YNN D;  3E3X A;  4POF A;  2F0T A;  1SJH D;  3GV3 A;  4DGZ A;  4C1N K;  3BG3 A;  1HA5 A;  2HIX A;  1L2F A;  1CK1 A;  1E24 A;  2HD3 A;  4ABN A;  1LV9 A;  4BA1 I;  4G4K A;  1WD0 A;  1YI2 A;  2R7Z H;  3HOU H;  1TWF B;  3G6J B;  3P20 A;  2V1C C;  1S40 A;  3L2P A;  2K1B A;  3PCO B;  5G3L F;  3UE0 A;  1EU4 A;  4P72 A;  3VA7 A;  1EY5 A;  4CHT B;  4WRD A;  5KYL A;  2DN8 A;  1OO9 B;  1OXS C;  1CZW A;  5IP9 H;  1X3E A;  4LW1 A;  1VQ4 A;  4Y52 H;  2QEX A;  2O5I C;  2IW3 A;  1SYD A;  5NUC A;  5JJL A;  3K5O A;  4NXM L;  1JJ2 A;  1O7I A;  4R9W A;  1X56 A;  4ID6 A;  4UY8 C;  3O13 A;  4LF5 L;  2EY1 A;  2KVM A;  3Q0A A;  2CH4 A;  2O4X A;  1TY2 A;  4K8I A;  1PH9 A;  3KLR A;  4LWC A;  3JAM c;  1HQM C;  1RF2 D;  2UXB L;  2DNC A;  3W1B A;  4IN3 A;  3T16 A;  2Z0S A;  2KJX A;  4GKJ L;  1X3Q A;  4A3G G;  4LF6 Q;  1CKO A;  3J80 L;  5LMN L;  2FFK B;  1PTO B;  4IUR A;  4CDF C;  1ZEQ X;  5IY0 A;  1STG A;  3JAM L;  1TKW B;  4JI0 L;  2VS1 A;  4JI8 L;  4M8A A;  2R92 H;  3MXN A;  4OX9 L;  5LMU L;  4BY1 G;  4AYB B;  1WCM G;  3CQZ B;  4F8M A;  2SDF A;  3R2T A;  4H13 C;  3ND9 A;  1HRJ A;  1UEA B;  1EYG A;  5HGQ A;  4HSP A;  1JJC B;  2NN6 I;  1ESF A;  2JQO A;  4FXD A;  2E2H B;  3G7L A;  5I4D A;  3EQL C;  1PRT D;  4BBS B;  4JI3 L;  3QOJ A;  2F0W A;  5M5W H;  2Y0S B;  1JJG A;  2IWH A;  4JI2 Q;  3S1Q H;  3I4N B;  4EGV A;  4KI0 A;  1NE3 A;  3A54 A;  3I90 A;  1XNR Q;  2X69 A;  1LUZ A;  5D3I B;  3N6R A;  1GO3 E;  1SBB B;  3J7Y W;  3GDE A;  3BVM A;  3HZX A;  2PQA A;  5I6W A;  5JPN C;  4DV1 L;  1HNW Q;  2EY6 A;  3RLO A;  1TU2 B;  1N36 Q;  4DR2 Q;  1RHP A;  3DM1 A;  4GNX B;  1A3V A;  1WTV A;  3DEP A;  1JB7 A;  4X62 L;  1SMY C;  1ILP A;  2CKZ B;  3SK6 A;  5IGE A;  1SMY D;  2OF1 A;  4RAU C;  4KD3 A;  1ENF A;  3H0G H;  4IZ8 A;  5EKK A;  5M9O A;  1MGS A;  3Q6S A;  4PMC A;  2B63 H;  2F0O A;  3J7A 5;  3AQQ A;  3WWV A;  3K81 C;  3BZC A;  3GTP H;  1TWG H;  3CCQ A;  1GUT A;  3LWU A;  3SK8 A;  5K5P A;  4H02 A;  3HOY G;  5CV4 A;  2JK8 A;  3I3C A;  1TWA B;  1GHK A;  2F0K A;  2E2J H;  4IPG A;  3W3A A;  1V1P A;  1ILQ A;  2QDL A;  4QUC A;  1C0A A;  1G51 A;  2KHS A;  2VQF L;  4C3I H;  1IL2 A;  3J81 E;  4HJA A;  3AFQ A;  2Z4I A;  1VQ6 A;  1Q90 A;  3CCR A;  4O42 A;  3CC2 A;  2Q2U A;  1B1Z A;  1BOS A;  4ALP A;  1Y1V B;  2B2Y A;  1IBL Q;  3HGB A;  4ZK9 B;  4R4O A;  1ICF B;  1WFQ A;  1PHJ A;  2Z6B A;  4JYA L;  3D8G A;  3EFX D;  2Q2H A;  3DM3 A;  4OON A;  3M4P A;  1UEB A;  2J0T D;  3I4L A;  1CI3 M;  3RMH A;  2K6A A;  2ZM6 L;  4A3J G;  4A3M G;  1EY9 A;  3F8T A;  2QKI C;  3KBG A;  3RN2 A;  1BNZ A;  2XGT A;  1TS5 A;  5BN4 A;  2X6G A;  3PIP A;  2JEB I;  1ML0 D;  3PIO 3;  2N8N A;  4EVO A;  4HJ9 A;  1EOT A;  4L5T A;  4YWK A;  1MSH A;  1GUW A;  4ZKC B;  3GTL H;  2PCF B;  3HOW G;  2EJF C;  1X65 A;  2CWP A;  2LKV A;  2WB1 B;  3E0E A;  1BBX C;  2X6L A;  4A3F B;  1Q46 A;  4NDX A;  3NTK A;  5M3F B;  4C3I G;  2ES2 A;  4IFD H;  4R4Q A;  1IKL A;  1XPR A;  3J7A V;  3ERO A;  1KD1 C;  1X6O A;  1EZ6 A;  2HCC A;  3VR3 A;  1DXM A;  3C46 A;  2YV5 A;  3FKI H;  4U67 3;  3HOV G;  2CQA A;  2IX3 A;  2UUA Q;  4DAV A;  4A4I A;  1JOK A;  3ULJ A;  2E76 C;  3DHQ A;  5G3L D;  3F2B A;  3CCV A;  4TVA B;  3BU2 A;  1KLU D;  5DM7 3;  2E2D C;  2JA5 G;  2B63 G;  3S16 B;  3SEB A;  4C3H G;  1Q12 A;  3H0G G;  1D8L A;  5J1Z A;  5GRO A;  1EY6 A;  1FL0 A;  2PYK A;  1K73 C;  4RWS C;  1A3T A;  5IIF A;  1C4Q A;  1KDC A;  2NVY B;  3IRB A;  3AEV A;  4Y7N B;  5CBE E;  1E7Z A;  1QB5 D;  2UUC L;  4QB4 A;  1YHB A;  3BJU A;  1R4Q B;  3MVV A;  2UU9 L;  4ODG A;  4A3G B;  3UI2 A;  2TMP A;  4LFB L;  3H09 A;  3NBH B;  5C4X H;  3NWS A;  4KLK A;  4DNI A;  5KGU A;  4TKO B;  2PQE A;  1FR3 A;  2E75 C;  4JW0 A;  4CKB A;  3HOZ G;  5GAG C;  4ZYS A;  1Y69 U;  1Q1B A;  2CW0 C;  4K2L A;  5CV8 A;  2XRQ D;  4RA8 A;  3H3V I;  2WFW A;  1N32 Q;  4HR7 B;  3FP9 A;  2F0G A;  1WCM H;  2NZH A;  4IUT A;  1VQN A;  1CUK A;  2Z6K A;  4V0B A;  1VQK A;  2M00 A;  3D4W A;  4MTN A;  4C1N I;  1DOK A;  1I94 L;  2Q2T A;  3D31 A;  4C2M B;  3S2H H;  3S1Q B;  1SEB D;  4R8N A;  4A3K G;  4ZKB B;  4KN4 C;  3I56 A;  1RL2 A;  4DR6 Q;  5C0X G;  1A15 A;  4RHS A;  4X65 L;  4JI2 L;  1RD9 D;  1PH1 A;  2D62 A;  1R9T B;  2RCN A;  2E74 C;  3CW2 C;  3PV0 A;  2I5L X;  3I70 A;  2MO1 A;  3DWA A;  2K5N A;  3T13 A;  5FO7 B;  3BZD B;  4DV6 L;  2ATW A;  4CDD C;  2ICE C;  2FMM A;  3Q23 A;  3RZO H;  2I0Q A;  3BDC A;  1TS4 A;  4DR1 Q;  1MBY A;  4A3K H;  2BE5 D;  2EXD A;  4OXP A;  2NUC A;  3E5S A;  2RF4 A;  4LAA A;  2OWO A;  4A3K B;  4UAI A;  3NPP A;  4B3R L;  4FVM A;  4QJF A;  1T9H A;  4OWW B;  2F52 A;  1NSN S;  3NQT A;  2A1A A;  4NP5 A;  1M1K C;  3BDL A;  3HOY B;  2A6E C;  1VQF A;  2HDM A;  1XWE A;  3JAM i;  1XX8 A;  1JQY D;  3MXP A;  2KCM A;  2NVT B;  3C2P A;  1IYV A;  1DM0 B;  5CV7 A;  5KEE A;  3I4O A;  1JE5 A;  3NXW A;  4ZRZ A;  3VYT A;  3CCU A;  2F3I A;  4LF9 L;  3DWQ A;  1NBW A;  3SGI A;  1VQP A;  1IBK L;  1ZYR D;  4GKK L;  3GTK B;  4A3B G;  5D14 A;  3QOL A;  3BVG A;  3SDZ A;  2D2C C;  4A3J B;  4A3M B;  1KNA A;  4PV1 C;  3TME A;  5IYD H;  2RHS B;  1IKM A;  1W2B A;  5IGB A;  1C9O A;  1JR0 D;  4MNO A;  1EY4 A;  3RUZ A;  5FJ8 H;  1LO5 D;  4IOC A;  5C3W A;  3CMA A;  2A69 D;  4FO2 A;  3K5N A;  2ALY B;  1PRT B;  4O1N A;  3HFZ B;  4XTC S;  3S1R B;  2R92 B;  4CBV A;  1VQG A;  1VQ5 A;  5JJI A;  1B70 B;  4KJO A;  2BA1 A;  3DUZ A;  4A3F G;  1YNJ C;  4ME3 A;  4EQ5 A;  3K5L A;  4QQB X;  1B53 A;  1J6Q A;  2NBF A;  4LFC Q;  1U4M A;  1GUN A;  2MQH A;  2NB0 A;  5KNC A;  3HOV H;  2K5Q A;  3KJO A;  4WJ4 A;  1PRT C;  2DJF C;  1S72 A;  1J8I A;  1SR3 A;  4BWG B;  1CT1 D;  5C4J B;  2BCO A;  2HIV A;  2KED A;  5CV5 A;  1PH7 A;  3ITP A;  1QJO A;  3SVM A;  1TR5 A;  1EIH A;  1DJR D;  1TT2 A;  3CCL A;  1B7Y B;  1KAB A;  4F87 A;  4BBR B;  3ER0 A;  4NXM Q;  5EPJ A;  3I91 A;  2K52 A;  4N9P A;  3J81 i;  5K36 H;  1EWH A;  1JOO A;  1RDP D;  4KJN A;  2O5J C;  3P7J A;  2L0C A;  1SFO H;  1JWU D;  4MN3 A;  3HOW B;  1S5C D;  3CCS A;  1ET6 A;  5FO9 B;  1KRT A;  2XSC A;  3S1N B;  2F0H A;  5M5X H;  3L0O A;  4FYD A;  1A2U A;  1SE4 A;  2HQE A;  2EYM A;  4A3J H;  4A3M H;  4A3D G;  1VMP A;  1HCZ A;  2LFN A;  4CDC C;  2MJ8 A;  1AZP A;  1D5X C;  3PUW A;  3CF5 A;  2RDG A;  5FLX c;  3K0Y A;  4OIK A;  1CZG A;  4B3M L;  1U4L A;  4A3F H;  1UAP A;  2K05 A;  2XRS D;  3S1N H;  3C3L A;  4OX9 Q;  2BH8 A;  4HID A;  4GLX A;  1PDQ A;  1O7Y A;  3VR5 A;  4DUY Q;  4HN7 A;  2UXB Q;  1UE5 A;  2NVX B;  1X54 A;  2WP8 J;  4U68 A;  4XDX A;  3PO3 G;  2XTI A;  4HJ5 A;  1CA5 A;  1UE6 A;  2JN4 A;  3J7A F;  2K33 A;  1QZH A;  1S5D D;  4IUP A;  1SLJ A;  5FLX E;  5IE8 A;  1CKN A;  1F9P A;  5IYD G;  1F2Y A;  3CKI B;  4LUZ A;  2AUJ D;  2MPM A;  2NZ1 D;  1HNZ L;  1J9O A;  4QF4 A;  3MAQ A;  1LT6 D;  1G91 A;  2SEB D;  3M4O H;  3KF8 B;  3SE0 A;  1PLF A;  3RLF A;  1VQ9 A;  2VB2 X;  1QNU A;  1LTL A;  3L9A X;  4HCE A;  2A8V A;  4YY3 Q;  4KN7 C;  1Y8N B;  4DV6 Q;  1EQR A;  1AW7 A;  5IP7 G;  2PW7 A;  1D7Q A;  1SXT A;  3F2D A;  5DAU A;  3CCM A;  4DR1 L;  2RCF A;  4IAL A;  1PTO H;  4DV1 Q;  2WKD A;  2K5V A;  1HNW L;  2B2U C;  3NTI A;  4KY5 A;  2A6E D;  5EQ0 A;  2AKW B;  2NYZ D;  4BBR G;  3D3R A;  2IJ0 A;  2B63 B;  1VCI A;  3NEN A;  3OSO A;  1JB3 A;  1HZB A;  2D5D A;  4X3K A;  1EIY B;  4BY1 H;  1TWC H;  3I8Z A;  4JI8 Q;  2QGQ A;  3BZK A;  2WB1 E;  3NWT A;  4JI4 L;  5EBD A;  5C0X H;  5D65 A;  2AMC B;  3AU7 A;  4C3H B;  4LF7 L;  4H44 C;  1CQV A;  2VQF Q;  4GNX C;  5E1F A;  1D5M C;  4YIJ A;  4A3G H;  1X3P A;  1IBM Q;  5ELN A;  3FEW X;  3CU7 A;  2A69 C;  1M8A A;  4A93 B;  1MHW C;  1Q8K A;  3G6E A;  3CRK C;  2AQ3 B;  1BUV T;  4DUZ Q;  2JJQ A;  2N88 A;  1JE4 A;  3MA2 B;  1I4R A;  5FK9 C;  4GKK Q;  4P75 A;  1P8L A;  4M1U B;  3K7A H;  1TWH B;  4IPH A;  3X3M A;  2MFI A;  5IP9 G;  4BBR H;  1WVL A;  3NUC A;  4K5X A;  4DF7 A;  5ELB A;  2WB1 G;  1STA A;  1DD2 A;  5C4X G;  1L1O A;  2K75 A;  4IJH A;  1EUJ A;  2P5Z X;  2L55 A;  1E3P A;  3S17 B;  1BR9 A;  3FKI B;  3NHH A;  4QIW E;  4POG A;  1SN8 A;  1H95 A;  3GTG H;  1SMX A;  3GTQ B;  4DA2 A;  3T53 B;  1YJN A;  1V1Q A;  4K2K A;  5FLX L;  3BYY B;  1IBL L;  3TZD A;  1D5Z C;  4G57 A;  1I50 H;  4JBW A;  2DY7 A;  3EVQ A;  3K0X A;  3R2I A;  3KK7 A;  2VUM H;  1EY0 A;  4B9X A;  1S5B D;  5AFW A;  5C44 B;  2JA5 H;  1HA6 A;  2TSS A;  4UHV A;  4GLA C;  1Y1V G;  3R3O A;  2UUA L;  3I4M B;  1ONL A;  3K7U C;  3M9B A;  2WKC A;  1WTO A;  3EBE A;  3E9H A;  3FKI G;  4OEL B;  1PZI D;  4B9W A;  4AQY L;  3S2D B;  1WTR A;  1STE A;  1PH5 A;  4IFD G;  1I6V C;  1QOH A;  4IPC A;  2KEN A;  1TS3 A;  1VQM A;  3F2U A;  4G7Z C;  1NTG A;  1IYJ B;  1WTP A;  5TSS A;  1K28 A;  4DR7 Q;  3AYH B;  4DV3 Q;  2YU9 B;  3HOW H;  3J81 j;  4LF5 Q;  5IYC G;  2EY5 A;  2F1M A;  1PH2 A;  3A55 A;  2WAQ B;  1DZ1 A;  4B3S L;  3KFU A;  2UU9 Q;  4OWX B;  3GTO B;  4X6A H;  3FPP A;  4A3D B;  2F03 A;  2UXD Q;  3KDF B;  2A6H D;  1WD1 A;  3T56 B;  4DR3 Q;  3S1M B;  1V43 A;  1G8Z D;  4HJ8 A;  4L8J A;  3NP8 A;  4DV7 Q;  1TWA H;  1V1P B;  1O80 A;  2D9U A;  1SDF A;  4Q5V A;  5IWA Q;  3TDQ A;  4DAY B;  4UP7 A;  1I4X A;  2I46 A;  2FXQ A;  3RZO B;  3R8B A;  2R3Z A;  3M7N A;  4YWL A;  5K36 G;  5KIX A;  3H0G B;  2A19 A;  4ZAI A;  2V4D A;  3SHL A;  1S4Z A;  1EYD A;  3BYT B;  3AMU A;  4JG2 A;  5EKL A;  1Q86 C;  4JI3 Q;  3PF5 A;  1H9S B;  4A3L G;  1X32 A;  2K03 A;  3TBI B;  3A7L A;  1L1O C;  1BQQ T;  4EQP A;  1VDZ A;  1HUM A;  1P16 A;  1SNC A;  1IW7 C;  1Q3L A;  1S5F D;  2EY2 A;  3ZJY C;  1JMC A;  2VNU D;  1V8Q A;  3SR1 A;  3VR4 A;  4AYB G;  2H1E A;  1BCP F;  1E1O A;  2SOB A;  4B3R Q;  1JOR A;  2ZM6 Q;  2XN9 C;  2B39 A;  1IHZ A;  4YHH Q;  3D0F A;  3QR8 A;  1K8O A;  1N33 L;  2EYO A;  2IL8 A;  2F3W A;  3CC4 A;  1GHJ A;  1SE2 A;  1CA6 A;  2BE5 C;  3ND8 A;  3DLL A;  3R93 A;  1D2B A;  4XQJ A;  1EQQ A;  1STY A;  1B4O A;  4CJ1 B;  1XNR L;  2PNH A;  3A5Z B;  3PUV A;  1S5E D;  1NAP A;  4A3E H;  1STN A;  1VQ7 A;  3K57 A;  4ILW A;  1LTI D;  3C1E A;  4A3B H;  1PH3 A;  5C6A A;  5HY6 A;  4G7H C;  1Z47 A;  2NN6 H;  2Y0S G;  4KKS A;  4XYQ A;  4IUU A;  5LMN W;  2ZTD A;  1YNX A;  1MSG A;  4KHV A;  5JJZ A;  3TS2 A;  2EXZ A;  4PMW A;  1JC7 A;  2XWJ B;  3VYU A;  2EYJ A;  2DGY A;  2UUB L;  3PO3 B;  2PZT A;  5A35 A;  1LLR D;  4IO9 A;  5EAY A;  2OTJ A;  3OTO L;  4QUF A;  5JOB A;  1LT5 D;  2R61 A;  1K3B C;  4L5Q A;  2Z8L A;  5C44 G;  1U9R A;  1B9M A;  1CSQ A;  2JA7 H;  1YIJ A;  1T5X D;  4J1M A;  1FNU A;  1EEF D;  3BS1 A;  1GUO A;  2MNA A;  3T1H L;  2K32 A;  2IPK D;  4DR5 L;  1XMQ Q;  4QMG A;  4GNX A;  1YIT A;  1HR0 L;  1KDA A;  2JA9 A;  5C4H A;  4O2D A;  3D6W A;  2F0J A;  3T51 B;  2DJG C;  3TP8 A;  3UDI A;  4RGO S;  4LMQ D;  5COY A;  1ROD A;  5C3X A;  1LTB D;  1SYB A;  1H9R A;  3PQI A;  1W6J A;  1KHI A;  2K5W A;  2LY7 A;  2F4V Q;  5LL6 S;  1ASZ A;  5BN5 A;  1MJC A;  4BBS H;  1SYG A;  3STB D;  1KIX A;  4JYA Q;  2XNA C;  1K9M C;  2OXP A;  2QA4 A;  2JYO A;  1DYQ A;  2A68 C;  4QGU A;  1HZC A;  3MFG A;  3U9O A;  2VUM B;  3S14 H;  1K83 B;  1N34 L;  2RSN A;  2IHF A;  5COR A;  3TP6 A;  4HAE A;  2XWB B;  1MD2 D;  1VQA A;  3A8K E;  3H94 A;  4KV6 A;  4DKA C;  4LK1 C;  3GTG B;  3GV6 A;  4H7B A;  1TII D;  2WAQ E;  4LF9 Q;  1GVP A;  1D6E C;  3VYR A;  1OXU A;  3N52 A;  2BDO A;  3WDN A;  4P2C B;  1I4H A;  2NTT A;  5BN3 A;  2R93 B;  1OXV A;  2AWO A;  3A5U A;  1Q7Y C;  2CW0 D;  3HOZ H;  4IUN A;  3A74 A;  3PO2 G;  2QIL A;  4IFD I;  2C35 B;  1ICW A;  1VQO A;  4DV4 Q;  3OMC A;  3V05 A;  3CD6 A;  3NBI A;  2N3S A;  2RQX A;  4IQZ A;  4C3I B;  1TY0 A;  2HT1 A;  2HDL A;  4X3T A;  1EFW A;  1ESR A;  4KMU C;  1AH9 A;  3PUZ A;  2LS0 1;  4YCW A;  1HR0 W;  1NNX A;  2Z9H A;  1SSO A;  2FJ2 A;  4HED A;  1J5E L;  3MTS A;  3UDF A;  3E0J A;  4PG3 A;  1GD7 A;  1HQR D;  1EY7 A;  1CKM A;  5CC4 A;  4HTH A;  1AN8 A;  2PMZ B;  5BR8 Q;  4C3H H;  2KUM A;  4XIG S;  1EY8 A;  2G9D A;  2D0P A;  2UXC L;  1QG7 A;  2MHV A;  5I6Y A;  4DAP A;  3ERQ A;  1Z9F A;  1FYC A;  2EYL A;  1AE2 A;  3L3O C;  2KOL A;  3OPO A;  1ET9 A;  1RTN A;  3VR6 A;  1SFO B;  3GTL B;  2MO0 A;  3G48 A;  4G7O C;  1NR4 A;  1PH4 A;  4DK3 C;  1Y8O B;  4CJ2 C;  4KY7 A;  4BY7 G;  2HUG A;  3ZYY X;  1N9W A;  1GXD C;  3UDX A;  1VQB A;  1WJJ A;  2GVB A;  4CKE A;  5CR3 A;  3KBX A;  1LTS D;  2EVB A;  4ZQ3 A;  3LGJ A;  3RNU A;  1X55 A;  3I4N G;  4C56 C;  5IGC A;  1BCP D;  3IFD A;  1SAP A;  3V2T A;  4JI7 L;  3H3V H;  3U58 A;  1VQC A;  3S17 H;  1WTH A;  2L12 A;  3CCE A;  1BVS A;  2UUC Q;  3DMU A;  3H3V C;  3W2D A;  2VQE Q;  3MXN B;  5E3F A;  4HIO A;  1I4Q A;  1CKN B;  3S1R H;  1HJP A;  1TWH H;  3HG9 A;  4YHH L;  3PUY A;  1BCP B;  3VDY A;  3TS0 A;  4TRD A;  1KTK A;  2IT1 A;  1W6K A;  3VYS A;  4TQU S;  2EIF A;  5T1G A;  2WII B;  3KOJ A;  1TQO A;  1XNQ Q;  2VB3 X;  3URY A;  3FRP B;  3M4O B;  2MGS A;  4DR4 Q;  1IYU A;  1SNO A;  2EQS A;  4P74 A;  1KAW A;  1UNS A;  1K3R A;  2PZW A;  1AP0 A;  2H5X A;  2YYZ A;  5ISR A;  2OQ0 A;  1PFN A;  4XT1 B;  4S3S A;  4ULL A;  2JA8 B;  1B8A A;  3QJY A;  5GQO A;  1A8V A;  1BBU A;  2Y0S E;  4XYO A;  2KQ3 A;  1TWC B;  4DAM A;  1EIG A;  3G4S A;  2A74 C;  2GVA A;  1EL0 A;  4O0A A;  1PFS A;  1H9S A;  3U4Z A;  5LMN Q;  2J4X A;  1HUN A;  5FLM H;  4A3I G;  3SK4 A;  3HOY H;  3KUP A;  2N78 A;  3J81 c;  4MZ9 A;  3Q8D A;  1SJE D;  1SYF A;  4BS9 A;  5IYB G;  4NXN L;  4FXK C;  3WOF A;  2E5L Q;  2K04 A;  1EIF A;  4JV5 L;  1F9Q A;  3SK5 A;  3H15 A;  5M5X B;  2HCI A;  1CTM A;  3PUX A;  5I2Y A;  1HNX Q;  1DOM A;  3G71 A;  3CPF A;  2AQ1 B;  5HUR A;  3OWE B;  5IOD A;  4YWM A;  1QVG A;  2E2I H;  3VR2 A;  3LNN A;  3T1Y Q;  4DU9 A;  2JP1 A;  4A3C G;  4KD4 A;  5F2D A;  3K59 A;  2KEC A;  1EWC A;  4X3S A;  2QW7 A;  2Z6K C;  4Z9C B;  4DFA A;  4DUZ L;  1VMC A;  3HOX G;  3HKZ G;  1HTL D;  3S24 A;  2B2T C;  5M3F G;  3F2C A;  4LF8 L;  1O78 A;  4FF4 A;  5DM6 3;  2LXJ A;  4FDB A;  2ZXP A;  1Y1W H;  3D4R A;  1V1O A;  3PIO A;  3H6M A;  3HOV B;  4A93 G;  3H91 A;  4QY7 A;  5C0X J;  1LAC A;  3TEH B;  4R8I A;  1K0R A;  2ZJR A;  3FVQ A;  2R92 G;  2AUK A;  3RZD H;  3CRL C;  4NXN Q;  4YY3 L;  1PYS B;  4DNT B;  3J81 L;  3S14 B;  4JBM A;  4OWT B;  1KQS A;  4DXF A;  2PPB C;  5JJK A;  4R4I A;  5JVH 3;  2WAQ G;  4RGT A;  2KHI A;  1AE3 A;  4GN4 B;  3I73 A;  1V9P A;  2F4V L;  1KRS A;  4HSV A;  1PMR A;  4JI5 L;  4WFN 3;  4DV0 Q;  3RZD B;  2JA6 G;  2YTV A;  5CBA E;  4ZUJ A;  4OO1 H;  4JI4 Q;  1K8M A;  5ELO A;  3TRE A;  3PF4 A;  3NQI A;  1A6X A;  3EN2 A;  1YJW A;  1GOZ A;  1SE8 A;  2Q2I A;  5J22 A;  2SNS A;  3HRZ C;  1PTO C;  4C3J B;  1Q82 C;  1N34 Q;  1R4P B;  4GZY C;  1X3F A;  5M3M G;  2EOT A;  2OQK A;  3FHW A;  2BDN A;  1E0B A;  2NVY H;  3KF6 A;  1XYI A;  2EYP A;  1XXG A;  4PZ7 A;  1ENA A;  3FDT A;  3X3N A;  1E22 A;  1MIU A;  5J3B A;  5IYB H;  5C5L A;  3K8A A;  4AQY Q;  2WIN B;  3GTM B;  3OTO Q;  4DK6 C;  1G6Z A;  3PO2 B;  1KNE A;  2VW9 A;  3J7Z C;  1IZ6 A;  4N9T A;  2YTX A;  4JBK A;  2IY5 B;  4DV5 L;  2Q8T A;  3M4Y A;  3F1Z A;  1LTR D;  3LWE A;  4JC0 A;  1SNP A;  3U50 C;  3S9W A;  3GTM H;  1EWI A;  3OW7 A;  2PZU A;  3IFT A;  4UDU C;  5L37 A;  1C7Y A;  3HOU G;  2R7Z G;  5C3E G;  1U5K A;  2JSO A;  1SNM A;  2HHH Q;  1RTO A;  1H9K A;  2E2J B;  1QNK A;  1CHQ D;  4X66 L;  2AWN A;  2I5M X;  4NW2 A;  5GAH C;  2B8F A;  5C4Z A;  1FNW A;  5AJ3 Q;  5C0X I;  5D3D A;  4C3J G;  2NTS A;  1KDB A;  2C5C A;  5KNB A;  4JBJ A;  5ELC A;  4K8J A;  1WYD A;  2H4O A;  2R93 G;  3KLS X;  4DR3 L;  4XQQ A;  3K5M A;  2F0E A;  4N8F A;  4FF3 A;  3K80 C;  4B3M Q;  3CHB D;  1B3Q A;  2K01 A;  3STB C;  3OYY A;  2F0M A;  5CMD A;  3E6Z X;  1VQH A;  1LT3 D;  5I2X A;  1IL8 A;  1A2T A;  4DV3 L;  1N33 Q;  5I9P A;  3I72 A;  1HR0 Q;  5JEA J;  3K58 A;  1PYB A;  3HP3 A;  5C3E B;  1IXR A;  4R4T A;  1MJE A;  1Q81 C;  2K14 A;  2PQA B;  2G9H D;  2VY3 A;  1HTP A;  1VQD A;  2RDH A;  1GUG A;  4C2M H;  3JAM E;  3NE5 B;  3OW2 A;  3TP7 A;  5CV9 A;  1EFI D;  1NR2 A;  3J80 i;  4UP8 A;  5CYU A;  4DR2 L;  1LYL A;  4FF2 A;  4DAY A;  1WCM B;  1BF4 A;  3A0J A;  1B44 D;  3KYH C;  3U4V A;  4GOP A;  1DGS A;  5EPK A;  1XMQ L;  1WTW A;  4LF7 Q;  1A3U A;  1EU3 A;  4I65 A;  1CQF A;  3GQB A;  3I4M G;  1G6P A;  4FF1 A;  3S15 B;  2JA7 B;  1RJT A;  1O7L A;  4WJ3 M;  4JI6 Q;  4DV4 L;  3HKZ B;  5E4X A;  1MI2 A;  4LF4 L;  1QE6 A;  2L1B A;  4KKU A;  2JA8 G;  2BA0 A;  1PFM A;  4CDE C;  2N55 A;  2F0L A;  4DV7 L;  1GKH A;  3PMF A;  4RCN A;  1K8A C;  1AZQ A;  3OOC A;  1N32 L;  4HCS A;  1PYW D;  4Y7N H;  1Z7T A;  4KHP L;  3GTP B;  4FNF A;  4FXG C;  4F7X A;  5IGD A;  3GTO H;  2KCN A;  5J39 A;  3HS0 C;  1F9R A;  2I07 B;  1ZXT A;  2ZJP A;  1G2T A;  4GN3 B;  3CCJ A;  1O7Z A;  1HNX L;  4A3I B;  3V96 A;  3HKS A;  2LSS A;  2QF7 A;  2Z1C A;  1I4G A;  2EE1 A;  1FGU A;  1RIP A;  1CM9 A;  3HOU B;  1F77 A;  2F3V A;  3MZ5 A;  3OWF A;  2R7Z B;  3CPW A;  2A5H A;  4X64 Q;  5BR8 L;  1F9S A;  2NZO A;  2SNM A;  4ZLT F;  3A56 A;  3UDG A;  2BH2 A;  5E7N A;  1W3S A;  3M85 A;  1JOQ A;  1G29 1;  2RBM A;  4R4C A;  4IJL A;  4JOI A;  3FMC A;  1A0I A;  1U0L A;  2CHB D;  1PA6 A;  3BDO A;  4K5V A;  1II3 A;  4YCV A;  5A2Q E;  2A73 B;  3GD7 A;  2PI2 E;  2K5H A;  5ELD A;  1JCK B;  1C8C A;  1JWS D;  2RA4 A;  3OIQ A;  2K7V A;  4LNQ A;  1FVI A;  1LAB A;  2A6H C;  3T4A C;  4A76 A;  2B2U A;  5KND A;  4AIM A;  2I5H A;  1STH A;  5ELF A;  3IKJ A;  3NEL A;  3T1H Q;  5I9O A;  4OGQ C;  2DUD A;  2F0Q A;  5M3M H;  4DR5 Q;  1A63 A;  3HKZ E;  4E6I A;  3CME A;  4DXG A;  4DUY L;  2ZT9 C;  1Y1W B;  4LFA L;  1U4R A;  4NB3 A;  4LF6 L;  2R7D A;  2EDG A;  2WAC A;  4K5W A;  3CP0 A;  3DXJ C;  4B3S Q;  2NWG A;  2ID0 A;  1HZA A;  5JVG 3;  4OO1 G;  3SXH A;  2KHJ A;  1F2L A;  2MUY A;  4AH6 A;  2JA6 H;  3S1M H;  1UWV A;  2IHE A;  4GS3 A;  2M9V A;  4K6L A;  1PVO A;  4H0L C;  1KLG D;  4WOR A;  1F2M A;  2YTY A;  5C5M A;  3KF8 A;  3HEJ A;  2PMZ E;  3Q24 A;  1U4P A;  1L0X B;  2YU9 H;  3I2Z A;  4RGN A;  2F0F A;  1L0Y B;  2JA7 G;  1OXT A;  3IL8 A;  4DK1 A;  2M2L A;  3M7G A;  2B29 A;  4QL5 A;  2KCT A;  1ENC A;  1M90 C;  4A93 H;  1B2T A;  1FNV A;  4DV0 L;  5JEA H;  3OIP A;  2E5L L;  3GTK H;  3MWY W;  2L4N A;  3KLW A;  3NTH A;  1YEZ A;  1Y8P B;  2VL6 A;  3KJP A;  4K0K L;  2ZXR A;  4KHZ A;  3HOX H;  2JEA I;  1HHV A;  1RKN A;  3OMG A;  4K14 A;  4CJ0 B;  1Y14 B;  2FHT A;  1XMO Q;  3EA6 A;  4LJZ C;  3DEO A;  2E8G A;  1GM5 A;  4PZ8 A;  4A3C H;  1LM0 A;  4XXE A;  3HOZ B;  1DOL A;  1PTO D;  4MIU A;  2XVS A;  4IUQ A;  2L5T A;  3TN2 A;  3FPU B;  2EPB A;  5C4J H;  1RCV D;  2B2T A;  2PW5 A;  1PRT F;  1E2V A;  3NEM A;  2ENB A;  5GAE C;  4GLV B;  1EOV A;  1EYA A;  2F0N A;  2N49 A;  2B2Y C;  5JAV A;  5LHY 1;  1SND A;  1J5E Q;  1SYC A;  5M5Y B;  5M3M B;  3QIA A;  1QVC A;  4JPB W;  1WTX A;  5IWA L;  4X62 Q;  3B6Y A;  1Q1E A;  1D1I A;  4OO1 I;  4RMF A;  4A3E B;  1PZK D;  4J6H A;  2RSO A;  3AFP A;  5FLM G;  3GO5 A;  4JCV E;  3S15 H;  3D4D A;  1R9T H;  2UXC Q;  4LUV A;  1I94 Q;  4LF4 Q;  3U9S A;  1HFG A;  4DV2 Q;  4JI7 Q;  1KC8 C;  4GKJ Q;  2E2I B;  5IOC A;  4A3L H;  1TS2 A;  2RHQ B;  4PMB A;  2KA7 A;  2ZJQ A;  4IFD J;  5HGT A;  4RCO A;  1VQJ A;  1NUC A;  1NJI C;  3C1F A;  4B08 A;  3S2H B;  1YHQ A;  1HPC A;  1ZKO A;  1PFB A;  2JXM B;  2ZTE A;  1BBW A;  4JK1 C;  4F88 A;  3M3Y B;  2OT2 A;  4NKL A;  1XNQ L;  4IUV A;  5KRU A;  4X3U A;  1XPO A;  4HJ7 A;  2CCZ A;  1EYC A;  4OEM B;  3TZU A;  4JI1 L;  3P75 A;  3EIV A;  1AEX A;  4OL7 A;  1FJG Q;  1X3G A;  4IOA A;  2L9H A;  1QIL A;  1K8G A;  4BXX H;  5EPL A;  2GN5 A;  4WJW A;  1PH8 A;  3CAM A;  5GAD C;  2AHO B;  2VQE L;  4KKT A;  4CKC A;  4DV5 Q;  1VQI A;  4EQO A;  2KCC A;  2RVL A;  2VXW A;  4APV A;  3A8I E;  5IYC H;  3MXG A;  2Z4H A;  1TWF H;  1PV4 A;  1WOC A;  2ZXO A;  2K5D A;  2K4K A;  2JE6 I;  4RKB A;  1BXT A;  3Q22 A;  3I4N H;  1B3A A;  3J80 E;  3QB3 A;  5AJ3 L;  4BXX G;  5M5W B;  4UPA A;  1QUQ A;  4L5R C;  4BA2 I;  4QCL A;  4A3B B;  4OIJ A;  4BY7 H;  4RFB A;  2F0D A;  1IW7 D;  3K6O A;  3A7A B;  4GN5 A;  1LT4 D;  2B2W A;  4KHP Q;  4JV5 Q;  2K50 A;  2ASB A;  3NSW A;  3W5O A;  4XT3 B;  1MKH A;  1K0S A;  3GTJ B;  1CFM A;  3J80 c;  5FO8 B;  4AYB E;  2R93 H;  1SE3 A;  2OTL A;  4ZCK A;  4C3J H;  1S3O A;  2VUM G;  1GJX A;  2O2L D;  2QCP X;  1NMG A;  5IT9 c;  4I7A A;  1YNN C;  2ICI A;  2FIN B;  3S2D H;  4DNR B;  4LFB Q;  4JOI C;  2J7Z A;  4NPS A;  1HFN A;  1BKB A;  1SNQ A;  1OTC A;  1EQT A;  2EYF A;  5C3E H;  1CSP A;  1SYE A;  1K83 H;  2AQ2 B;  1GUS A;  1HXY D;  2F0V A;  4L63 B;  1N36 L;  4B3T Q;  2JA5 B;  4Q0F A;  3AB9 A;  2PO4 A;  1YBY A;  4DK0 A;  3HOX B;  4PNY A;  1I50 B;  5LL6 X;  4FP5 D;  2B2V C;  3IAY A;  4TSS A;  4ZUI A;  2KEE A;  2B2V A;  1XTC D;  1QWY A;  2EJM A;  4IPD A;  2D0O A;  1A62 A;  1I6H B;  4HIM A;  1QVF A;  1F2Z A;  1VQE A;  5IT9 L;  1EEI D;  1VF7 A;  1LTG D;  3I7F A; 
#chains in the Genus database with same CATH homology
 2L11 A;  1PZJ D;  1E2Z A;  3NK9 A;  3TP5 A;  4BY7 B;  3QG1 A;  2EYH A;  5JEA G;  2JA6 B;  5EKI A;  5A2Q L;  1PTO F;  3BVZ A;  1CHP D;  4V19 0;  2F0P A;  3A8J E;  3LX0 A;  2LMC B;  2IX1 A;  1Q8I A;  2MP1 A;  1DON A;  2A68 D;  3L7Z C;  5T1I A;  2B8G A;  1Z6H A;  2R6G A;  3QO2 A;  4OHJ A;  1H9M A;  1QCB D;  3D6C A;  1EQV A;  1LTA D;  1E2W A;  1OXX K;  1H9J A;  2EZV A;  2QDB A;  4QIW B;  3MFY A;  3NBH A;  3MXU A;  5FKA C;  4K6D A;  2NN6 G;  1VF5 C;  1BO0 A;  1KAA A;  3GP7 A;  5FOB B;  1ZYR C;  5EBC A;  4EQN A;  2WV6 D;  2OEO A;  4HMI A;  2EJG C;  1FGB D;  4ME5 A;  3WOE A;  4NMZ A;  5IGG A;  3MHB A;  1I4P A;  1B50 A;  4RKL A;  4I7Z C;  3P1H A;  2Q8R E;  3TSS A;  1B9N A;  4PQX A;  2F0I A;  3KLS A;  2RDF A;  3DWP A;  4MHE A;  1JWM D;  4KK7 A;  5KYI A;  1TWG B;  1FD7 D;  1D1K A;  1BDO A;  2DY8 A;  5EJW A;  3QWN A;  1C48 A;  3OHX C;  3PIP 3;  2F0U A;  1AFP A;  5ELE A;  1LTT D;  4BY1 B;  3MC0 B;  4RHR A;  5EGT A;  4J8Q A;  3EJI A;  2Q8I B;  2XIW A;  1BCP C;  5DEH A;  2BOS A;  1I3Q B;  1YNJ D;  5CV6 A;  4XQN A;  2B2W C;  1JIC A;  2IX0 A;  4CGY B;  2K28 A;  1M4V A;  1WTQ A;  3MEH A;  2QEJ C;  3VA5 A;  5IGF A;  2PNR C;  1PXU A;  1STB A;  1G2S A;  5DNF A;  3ONA B;  5JPM C;  5E4W C;  4DN4 M;  5C4X B;  3RD4 A;  1T5E A;  1UUP A;  4KTA A;  2CVR A;  2GA4 B;  4HMJ A;  5IT9 E;  2NVQ B;  4RH6 A;  4L6T B;  2RKS A;  1DCZ A;  4RGM A;  4KY6 A;  1EZ8 A;  2C9O A;  2F4I A;  1NCV A;  3K7A B;  2DNE A;  1TVX A;  5CGK A;  2F0S A;  2FMC A;  1YNN D;  2F0T A;  1SJH D;  3GV3 A;  4DGZ A;  4C1N K;  3BG3 A;  1HA5 A;  1CK1 A;  4ABN A;  1LV9 A;  4BA1 I;  4G4K A;  1WD0 A;  1TWF B;  3G6J B;  3P20 A;  2K1B A;  5G3L F;  1EU4 A;  3VA7 A;  1EY5 A;  4CHT B;  4WRD A;  5KYL A;  2DN8 A;  1OO9 B;  1OXS C;  1CZW A;  2O5I C;  2IW3 A;  1SYD A;  5NUC A;  3K5O A;  4R9W A;  4ID6 A;  3O13 A;  2EY1 A;  3Q0A A;  2KVM A;  2O4X A;  1TY2 A;  4K8I A;  3KLR A;  1HQM C;  1RF2 D;  2DNC A;  4IN3 A;  3T16 A;  2KJX A;  1X3Q A;  3J80 L;  2FFK B;  1PTO B;  4IUR A;  1ZEQ X;  3JAM L;  1STG A;  1TKW B;  4M8A A;  3MXN A;  4F8M A;  3CQZ B;  4AYB B;  2SDF A;  3R2T A;  4H13 C;  3ND9 A;  1HRJ A;  1UEA B;  4HSP A;  2NN6 I;  1ESF A;  4FXD A;  2E2H B;  3G7L A;  5I4D A;  3EQL C;  1PRT D;  4BBS B;  3QOJ A;  2F0W A;  2Y0S B;  2IWH A;  3I4N B;  4EGV A;  4KI0 A;  3A54 A;  3I90 A;  2X69 A;  5D3I B;  3N6R A;  1SBB B;  3J7Y W;  3BVM A;  3HZX A;  5I6W A;  5JPN C;  2EY6 A;  1TU2 B;  1RHP A;  3DM1 A;  1A3V A;  1WTV A;  3DEP A;  1SMY C;  1ILP A;  3SK6 A;  5IGE A;  1SMY D;  2OF1 A;  4RAU C;  4KD3 A;  1ENF A;  4IZ8 A;  5EKK A;  5M9O A;  1MGS A;  3Q6S A;  4PMC A;  2F0O A;  1GUT A;  3LWU A;  3SK8 A;  5K5P A;  5CV4 A;  3I3C A;  1TWA B;  1GHK A;  2F0K A;  3W3A A;  1V1P A;  1ILQ A;  4QUC A;  2KHS A;  3J81 E;  2Z4I A;  1Q90 A;  4O42 A;  1B1Z A;  1BOS A;  1Y1V B;  2B2Y A;  3HGB A;  4ZK9 B;  3D8G A;  3EFX D;  2J0T D;  3I4L A;  1CI3 M;  3RMH A;  2K6A A;  1EY9 A;  2QKI C;  3KBG A;  1BNZ A;  5BN4 A;  1TS5 A;  2X6G A;  2JEB I;  1ML0 D;  3PIO 3;  4EVO A;  1EOT A;  1MSH A;  1GUW A;  4ZKC B;  2PCF B;  2EJF C;  2LKV A;  2WB1 B;  1BBX C;  2X6L A;  4A3F B;  4NDX A;  3NTK A;  5M3F B;  4C3I G;  4IFD H;  1IKL A;  3J7A V;  3ERO A;  1EZ6 A;  2HCC A;  3VR3 A;  1DXM A;  3C46 A;  4U67 3;  2CQA A;  2IX3 A;  4DAV A;  1JOK A;  2E76 C;  3DHQ A;  5G3L D;  1KLU D;  5DM7 3;  2E2D C;  3S16 B;  3SEB A;  4C3H G;  1Q12 A;  5J1Z A;  1EY6 A;  2PYK A;  4RWS C;  1A3T A;  5IIF A;  1C4Q A;  1KDC A;  2NVY B;  4Y7N B;  5CBE E;  1QB5 D;  4QB4 A;  1R4Q B;  3MVV A;  4ODG A;  4A3G B;  3UI2 A;  2TMP A;  3H09 A;  3NWS A;  5KGU A;  4TKO B;  2PQE A;  1FR3 A;  2E75 C;  4CKB A;  4ZYS A;  1Y69 U;  1Q1B A;  2CW0 C;  4K2L A;  5CV8 A;  2XRQ D;  4RA8 A;  4HR7 B;  2F0G A;  4IUT A;  4V0B A;  2M00 A;  3D4W A;  4C1N I;  1DOK A;  3D31 A;  4C2M B;  3S1Q B;  1SEB D;  4R8N A;  4ZKB B;  4KN4 C;  5C0X G;  1A15 A;  4RHS A;  1RD9 D;  2D62 A;  1R9T B;  2E74 C;  3PV0 A;  3I70 A;  3DWA A;  3T13 A;  5FO7 B;  3BZD B;  2ICE C;  2FMM A;  3Q23 A;  3BDC A;  1TS4 A;  1MBY A;  2BE5 D;  2NUC A;  3E5S A;  4LAA A;  4A3K B;  4UAI A;  3NPP A;  4FVM A;  1NSN S;  3NQT A;  4NP5 A;  3BDL A;  3HOY B;  2A6E C;  2HDM A;  1XWE A;  1XX8 A;  1JQY D;  3MXP A;  2NVT B;  3C2P A;  1IYV A;  1DM0 B;  5CV7 A;  5KEE A;  3NXW A;  4ZRZ A;  3VYT A;  3DWQ A;  1ZYR D;  3GTK B;  5D14 A;  3QOL A;  3BVG A;  3SDZ A;  4A3M B;  2D2C C;  4A3J B;  1KNA A;  4PV1 C;  3TME A;  1IKM A;  5IGB A;  1JR0 D;  1EY4 A;  3RUZ A;  1LO5 D;  5C3W A;  2A69 D;  4FO2 A;  3K5N A;  1PRT B;  4O1N A;  4XTC S;  3S1R B;  2R92 B;  4CBV A;  4KJO A;  2BA1 A;  3DUZ A;  1YNJ C;  3K5L A;  1B53 A;  2NBF A;  1U4M A;  1GUN A;  2NB0 A;  5KNC A;  2K5Q A;  1PRT C;  1J8I A;  4BWG B;  1CT1 D;  5C4J B;  2BCO A;  2KED A;  5CV5 A;  3ITP A;  1QJO A;  3SVM A;  1TR5 A;  1EIH A;  1DJR D;  1TT2 A;  1KAB A;  4F87 A;  4BBR B;  5EPJ A;  3I91 A;  4N9P A;  5K36 H;  1EWH A;  1JOO A;  1RDP D;  4KJN A;  2O5J C;  3P7J A;  2L0C A;  1JWU D;  4MN3 A;  3HOW B;  1S5C D;  1ET6 A;  5FO9 B;  2XSC A;  3S1N B;  2F0H A;  4FYD A;  1A2U A;  1SE4 A;  2HQE A;  2EYM A;  1VMP A;  1HCZ A;  2LFN A;  2MJ8 A;  1AZP A;  1D5X C;  3PUW A;  2RDG A;  3K0Y A;  4OIK A;  1CZG A;  1U4L A;  1UAP A;  2K05 A;  2XRS D;  3C3L A;  1PDQ A;  1O7Y A;  3VR5 A;  4HN7 A;  2NVX B;  2WP8 J;  4XDX A;  4U68 A;  1CA5 A;  3J7A F;  2K33 A;  1S5D D;  4IUP A;  5FLX E;  1F9P A;  1F2Y A;  3CKI B;  2AUJ D;  2MPM A;  2NZ1 D;  1J9O A;  4QF4 A;  3MAQ A;  1LT6 D;  1G91 A;  2SEB D;  3SE0 A;  1PLF A;  3RLF A;  2VB2 X;  1QNU A;  3L9A X;  4HCE A;  4KN7 C;  1Y8N B;  1AW7 A;  2PW7 A;  1SXT A;  5DAU A;  4IAL A;  1PTO H;  2WKD A;  2B2U C;  3NTI A;  4KY5 A;  2A6E D;  5EQ0 A;  2NYZ D;  3D3R A;  2IJ0 A;  2B63 B;  1VCI A;  3OSO A;  1JB3 A;  2D5D A;  4X3K A;  3I8Z A;  3NWT A;  5EBD A;  5C0X H;  5D65 A;  3AU7 A;  4C3H B;  4H44 C;  1CQV A;  5E1F A;  1D5M C;  4YIJ A;  1X3P A;  3FEW X;  3CU7 A;  2A69 C;  1M8A A;  4A93 B;  3CRK C;  2AQ3 B;  1BUV T;  2N88 A;  1JE4 A;  3MA2 B;  1I4R A;  5FK9 C;  4M1U B;  1TWH B;  3X3M A;  1WVL A;  3NUC A;  4K5X A;  4DF7 A;  5ELB A;  1STA A;  1DD2 A;  2L55 A;  3S17 B;  1BR9 A;  3FKI B;  3NHH A;  3GTQ B;  4DA2 A;  3T53 B;  5FLX L;  4K2K A;  3BYY B;  3TZD A;  1D5Z C;  4G57 A;  4JBW A;  2DY7 A;  3EVQ A;  3R2I A;  3KK7 A;  1EY0 A;  4B9X A;  1S5B D;  5AFW A;  5C44 B;  1HA6 A;  2TSS A;  3R3O A;  3I4M B;  1ONL A;  2WKC A;  1WTO A;  1PZI D;  4B9W A;  3S2D B;  1WTR A;  1STE A;  4IFD G;  1I6V C;  1QOH A;  1TS3 A;  3F2U A;  4G7Z C;  1WTP A;  5TSS A;  2YU9 B;  2EY5 A;  2F1M A;  3A55 A;  2WAQ B;  1DZ1 A;  3GTO B;  3FPP A;  4A3D B;  2F03 A;  1WD1 A;  2A6H D;  3T56 B;  3S1M B;  1V43 A;  1G8Z D;  4L8J A;  3NP8 A;  1V1P B;  1O80 A;  2D9U A;  1SDF A;  4Q5V A;  3TDQ A;  1I4X A;  2I46 A;  3RZO B;  3R8B A;  2R3Z A;  3M7N A;  5K36 G;  5KIX A;  3H0G B;  4ZAI A;  2V4D A;  3SHL A;  1S4Z A;  1EYD A;  3BYT B;  3AMU A;  5EKL A;  1H9S B;  1X32 A;  2K03 A;  3TBI B;  3A7L A;  1BQQ T;  4EQP A;  1VDZ A;  1HUM A;  1SNC A;  1IW7 C;  1Q3L A;  1S5F D;  2EY2 A;  2VNU D;  1V8Q A;  3SR1 A;  3VR4 A;  2H1E A;  1BCP F;  2SOB A;  1JOR A;  2XN9 C;  2B39 A;  1IHZ A;  1K8O A;  2EYO A;  2IL8 A;  2F3W A;  1GHJ A;  1SE2 A;  1CA6 A;  2BE5 C;  3ND8 A;  1D2B A;  3R93 A;  4XQJ A;  1STY A;  1B4O A;  4CJ1 B;  3PUV A;  1S5E D;  1NAP A;  1STN A;  3K57 A;  4ILW A;  1LTI D;  3C1E A;  5C6A A;  4G7H C;  1Z47 A;  2NN6 H;  4KKS A;  4XYQ A;  4IUU A;  1MSG A;  4KHV A;  5JJZ A;  2EXZ A;  4PMW A;  1JC7 A;  2XWJ B;  3VYU A;  2EYJ A;  3PO3 B;  2PZT A;  5A35 A;  1LLR D;  4QUF A;  5JOB A;  1LT5 D;  2R61 A;  2Z8L A;  1U9R A;  1B9M A;  1T5X D;  4J1M A;  1FNU A;  1EEF D;  3BS1 A;  1GUO A;  2K32 A;  2IPK D;  4QMG A;  1KDA A;  5C4H A;  3D6W A;  2F0J A;  3T51 B;  3TP8 A;  4RGO S;  4LMQ D;  5COY A;  1ROD A;  5C3X A;  1LTB D;  1SYB A;  1H9R A;  1W6J A;  2K5W A;  2LY7 A;  5LL6 S;  5BN5 A;  1SYG A;  2XNA C;  2OXP A;  2JYO A;  1DYQ A;  2A68 C;  3MFG A;  3U9O A;  2VUM B;  1K83 B;  2RSN A;  5COR A;  3TP6 A;  4HAE A;  2XWB B;  1MD2 D;  3A8K E;  3H94 A;  4KV6 A;  4LK1 C;  3GTG B;  3GV6 A;  4H7B A;  1TII D;  3VYR A;  1D6E C;  1OXU A;  3N52 A;  2BDO A;  3WDN A;  4P2C B;  1I4H A;  2NTT A;  5BN3 A;  2R93 B;  1OXV A;  2AWO A;  2CW0 D;  4IUN A;  2QIL A;  4IFD I;  1ICW A;  3OMC A;  3V05 A;  3NBI A;  4C3I B;  2RQX A;  4IQZ A;  1TY0 A;  2HDL A;  4X3T A;  1ESR A;  4KMU C;  3PUZ A;  2LS0 1;  1SSO A;  2FJ2 A;  4HED A;  3MTS A;  3E0J A;  1HQR D;  1EY7 A;  5CC4 A;  4HTH A;  1AN8 A;  2PMZ B;  2KUM A;  4XIG S;  1EY8 A;  2G9D A;  1QG7 A;  2MHV A;  5I6Y A;  4DAP A;  3ERQ A;  1FYC A;  2EYL A;  3L3O C;  2KOL A;  3OPO A;  1ET9 A;  1RTN A;  3VR6 A;  1SFO B;  3GTL B;  4G7O C;  1NR4 A;  1Y8O B;  4CJ2 C;  4KY7 A;  2HUG A;  3ZYY X;  1GXD C;  4CKE A;  5CR3 A;  3KBX A;  1LTS D;  4ZQ3 A;  2EVB A;  4C56 C;  5IGC A;  1BCP D;  3IFD A;  1SAP A;  3V2T A;  2L12 A;  3DMU A;  3H3V C;  3W2D A;  5E3F A;  1I4Q A;  3HG9 A;  3PUY A;  1BCP B;  4TRD A;  1KTK A;  2IT1 A;  1W6K A;  3VYS A;  4TQU S;  5T1G A;  2WII B;  1TQO A;  2VB3 X;  3URY A;  3FRP B;  3M4O B;  2MGS A;  1IYU A;  1SNO A;  1UNS A;  2PZW A;  1AP0 A;  2YYZ A;  5ISR A;  1PFN A;  4XT1 B;  4S3S A;  4ULL A;  2JA8 B;  3QJY A;  4XYO A;  2KQ3 A;  1TWC B;  1EIG A;  2A74 C;  1EL0 A;  1H9S A;  2J4X A;  1HUN A;  3SK4 A;  3KUP A;  1SJE D;  1SYF A;  4BS9 A;  4FXK C;  3WOF A;  2K04 A;  1F9Q A;  3SK5 A;  5M5X B;  2HCI A;  1CTM A;  3PUX A;  5I2Y A;  1DOM A;  2AQ1 B;  5HUR A;  3OWE B;  5IOD A;  3VR2 A;  3LNN A;  4DU9 A;  2JP1 A;  4KD4 A;  5F2D A;  3K59 A;  2KEC A;  1EWC A;  4X3S A;  4DFA A;  4Z9C B;  1VMC A;  1HTL D;  2B2T C;  1O78 A;  4FF4 A;  5DM6 3;  2ZXP A;  3D4R A;  1V1O A;  3H6M A;  3HOV B;  3H91 A;  5C0X J;  1LAC A;  4R8I A;  3FVQ A;  2AUK A;  3CRL C;  4DNT B;  3J81 L;  3S14 B;  4DXF A;  2PPB C;  5JVH 3;  4RGT A;  3I73 A;  4HSV A;  1PMR A;  4WFN 3;  3RZD B;  5CBA E;  4ZUJ A;  4OO1 H;  1K8M A;  3NQI A;  1A6X A;  1GOZ A;  5J22 A;  2SNS A;  3HRZ C;  1PTO C;  4C3J B;  1R4P B;  4GZY C;  2EOT A;  2BDN A;  1E0B A;  1XYI A;  2EYP A;  1XXG A;  1ENA A;  3FDT A;  3X3N A;  5C5L A;  3GTM B;  2WIN B;  1G6Z A;  3PO2 B;  1KNE A;  4N9T A;  2Q8T A;  3M4Y A;  1LTR D;  3LWE A;  1SNP A;  3S9W A;  3OW7 A;  2PZU A;  3IFT A;  4UDU C;  2JSO A;  1SNM A;  1RTO A;  1H9K A;  2E2J B;  1QNK A;  1CHQ D;  2AWN A;  4NW2 A;  2B8F A;  5C4Z A;  1FNW A;  5C0X I;  5D3D A;  4C3J G;  2NTS A;  1KDB A;  2C5C A;  5KNB A;  5ELC A;  4K8J A;  2H4O A;  3KLS X;  4XQQ A;  3K5M A;  2F0E A;  4FF3 A;  3CHB D;  2K01 A;  2F0M A;  5CMD A;  3E6Z X;  1LT3 D;  5I2X A;  1IL8 A;  1A2T A;  5I9P A;  3I72 A;  5JEA J;  3K58 A;  3HP3 A;  5C3E B;  2G9H D;  1HTP A;  2RDH A;  1GUG A;  3JAM E;  3NE5 B;  3TP7 A;  5CV9 A;  1EFI D;  1NR2 A;  5CYU A;  4FF2 A;  4DAY A;  1WCM B;  1BF4 A;  1B44 D;  5EPK A;  1WTW A;  1A3U A;  1EU3 A;  4I65 A;  1CQF A;  3GQB A;  4FF1 A;  3S15 B;  2JA7 B;  1RJT A;  1O7L A;  3HKZ B;  5E4X A;  1MI2 A;  1QE6 A;  2L1B A;  4KKU A;  2BA0 A;  1PFM A;  2N55 A;  2F0L A;  3PMF A;  4RCN A;  1AZQ A;  3OOC A;  4HCS A;  1PYW D;  1Z7T A;  3GTP B;  4FNF A;  4FXG C;  4F7X A;  5IGD A;  2KCN A;  5J39 A;  3HS0 C;  1F9R A;  2I07 B;  1ZXT A;  1G2T A;  1O7Z A;  4A3I B;  3V96 A;  2QF7 A;  2Z1C A;  1I4G A;  2EE1 A;  1CM9 A;  3HOU B;  1F77 A;  2F3V A;  3MZ5 A;  3OWF A;  2R7Z B;  2A5H A;  1F9S A;  2SNM A;  4ZLT F;  3A56 A;  3M85 A;  1JOQ A;  1G29 1;  2RBM A;  3FMC A;  2CHB D;  3BDO A;  4K5V A;  1II3 A;  5A2Q E;  2A73 B;  3GD7 A;  5ELD A;  1JCK B;  1C8C A;  1JWS D;  2RA4 A;  2K7V A;  3OIQ A;  1LAB A;  2A6H C;  3T4A C;  2B2U A;  5KND A;  1STH A;  5ELF A;  3IKJ A;  5I9O A;  4OGQ C;  2F0Q A;  4E6I A;  4DXG A;  2ZT9 C;  1Y1W B;  1U4R A;  2EDG A;  2WAC A;  4K5W A;  3DXJ C;  2NWG A;  2ID0 A;  5JVG 3;  4OO1 G;  3SXH A;  2MUY A;  1F2L A;  2M9V A;  4K6L A;  4H0L C;  1KLG D;  4WOR A;  1F2M A;  5C5M A;  3KF8 A;  3HEJ A;  3Q24 A;  1U4P A;  1L0X B;  4RGN A;  2F0F A;  1L0Y B;  1OXT A;  3IL8 A;  4DK1 A;  2M2L A;  3M7G A;  1ENC A;  1B2T A;  1FNV A;  5JEA H;  3OIP A;  3MWY W;  2L4N A;  3NTH A;  1Y8P B;  2ZXR A;  4KHZ A;  1HHV A;  2JEA I;  1RKN A;  3OMG A;  4K14 A;  4CJ0 B;  2FHT A;  3EA6 A;  4LJZ C;  3DEO A;  4XXE A;  3HOZ B;  1DOL A;  1PTO D;  4MIU A;  2XVS A;  4IUQ A;  2L5T A;  3TN2 A;  3FPU B;  2EPB A;  1RCV D;  2B2T A;  2PW5 A;  1PRT F;  1E2V A;  2ENB A;  1EYA A;  2F0N A;  2B2Y C;  5JAV A;  5LHY 1;  1SND A;  1SYC A;  5M5Y B;  5M3M B;  3QIA A;  1WTX A;  1Q1E A;  1D1I A;  4OO1 I;  4A3E B;  1PZK D;  4J6H A;  2RSO A;  3GO5 A;  3D4D A;  3U9S A;  1HFG A;  2E2I B;  5IOC A;  1TS2 A;  4PMB A;  2KA7 A;  4IFD J;  5HGT A;  4RCO A;  1NUC A;  3C1F A;  4B08 A;  3S2H B;  1HPC A;  1ZKO A;  1PFB A;  2JXM B;  4JK1 C;  4F88 A;  3M3Y B;  2OT2 A;  4NKL A;  4IUV A;  5KRU A;  4X3U A;  1EYC A;  3TZU A;  3P75 A;  1AEX A;  4OL7 A;  2L9H A;  1QIL A;  5EPL A;  4WJW A;  4KKT A;  4CKC A;  4EQO A;  2KCC A;  2RVL A;  2VXW A;  3A8I E;  3MXG A;  2Z4H A;  2ZXO A;  2K5D A;  4RKB A;  2JE6 I;  1BXT A;  3Q22 A;  1B3A A;  3J80 E;  3QB3 A;  5M5W B;  4BA2 I;  4QCL A;  4A3B B;  4OIJ A;  4RFB A;  2F0D A;  1IW7 D;  3K6O A;  3A7A B;  1LT4 D;  2B2W A;  3NSW A;  4XT3 B;  3GTJ B;  1CFM A;  5FO8 B;  1SE3 A;  1GJX A;  2O2L D;  2QCP X;  1YNN C;  2ICI A;  2FIN B;  4DNR B;  2J7Z A;  1HFN A;  1SNQ A;  1EQT A;  2EYF A;  1SYE A;  2AQ2 B;  1GUS A;  1HXY D;  2F0V A;  4L63 B;  2JA5 B;  4Q0F A;  3AB9 A;  2PO4 A;  4DK0 A;  3HOX B;  4PNY A;  1I50 B;  5LL6 X;  4FP5 D;  2B2V C;  3IAY A;  4TSS A;  4ZUI A;  2KEE A;  2B2V A;  1XTC D;  1QWY A;  2EJM A;  1I6H B;  1F2Z A;  5IT9 L;  1EEI D;  1VF7 A;  1LTG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...