1IL8A

Three-dimensional structure of interleukin 8 in solution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERLEUKIN-8
publication title Three-dimensional structure of interleukin 8 in solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1il8A00
1ILQA 1AZPA 2XIWA 4QUFA 1LV9A 1EIGA 2X6LA 4X3TA 1WTRA 1WTXA 1B50A 1HUNA 1CM9A 1U4PA 1G6ZA 3G7LA 4HSVA 2NYZD 1J8IA 1GUWA 3TN2A 1NCVA 2VXWA 1QG7A 2Q8RE 3N52A 1KNEA 5D14A 2KOLA 4ZLTF 4HCSA 2FFKB 4XDXA 5T1IA 4O42A 4CJ0B 1XYIA 2HCIA 2KVMA 2L4NA 1EQTA 2BDNA 4HAEA 3SVMA 5EKIA 1XX8A 1NR4A 2B2YC 4LMQD 1O7ZA 1HFGA 2B2VC 2N55A 4R9WA 1AZQA 1J9OA 3I8ZA 5CMDA 1O80A 2HDLA 2JP1A 1EIHA 4RA8A 2K05A 1B2TA 2B2UC 2SDFA 4R8IA 1MI2A 1DONA 1IKLA 2MP1A 4ZKBB 1DOLA 5DNFA 5T1GA 3FPUB 3IL8A 1SDFA 3I91A 1IKMA 3I3CA 3KUPA 1HRJA 2B2TA 5EPKA 1RTOA 5CBEE 2FINB 1HUMA 2X6GA 1DZ1A 2B2WC 4CJ2C 2MPMA 1NR2A 5CORA 1F9QA 2HUGA 4MN3A 1BO0A 1X3QA 1G2SA 2D9UA 2K01A 1F2LA 4RWSC 4IUVA 2L9HA 1RODA 2X69A 1TVXA 2CVRA 3LWEA 3MTSA 4RAUC 4UAIA 5COYA 5E4WC 3MWYW 1MSGA 5AFWA 5EQ0A 2MGSA 4ZK9B 2MJ8A 1MSHA 1PFMA 1SSOA 1CA6A 2L12A 3I90A 1X32A 1VMCA 4IUUA 5D65A 4IUQA 4OIKA 2L1BA 2M2LA 3H91A 1HA6A 1A15A 1U4LA 1IL8A 1B53A 1ZXTA 2HDMA 1NAPA 2K1BA 3R93A 1S4ZA 5JJZA 1WVLA 1WTWA 1U4RA 2EOTA 1HFNA 1RTNA 1Q3LA 2NWGA 1F9RA 4X3UA 1KNAA 1AP0A 4IURA 1QE6A 1WTPA 1HHVA 1U4MA 1JE4A 2DY7A 3TZDA 1ESRA 4XT3B 3QO2A 1F9PA 2J7ZA 2KEDA 1DOMA 3P7JA 1M8AA 5EPLA 3DM1A 1QNKA 2RSOA 1RHPA 2H1EA 2EE1A 1EOTA 4HEDA 3GV3A 4DN4M 4XT1B 1VMPA 4ZKCB 1JICA 4IUTA 1E0BA 3Q6SA 2FHTA 2K03A 2HCCA 4MHEA 4QUCA 5EJWA 2EPBA 1WTOA 2KECA 2B2TC 1PFNA 4X3SA 4ZAIA 1WTVA 1ML0D 2B2YA 3IFDA 1RJTA 2B2VA 5EPJA 4U68A 1BNZA 3UI2A 4NW2A 1CA5A 2DY8A 4IUPA 3ONAB 3DEPA 2NZ1D 2K28A 1BBXC 1DOKA 1O7YA 2K04A 1B3AA 5E4XA 3DEOA 1WD1A 1F9SA 1PDQA 1G2TA 2B2UA 1X3PA 2Q8TA 2FJ2A 5CBAE 2IL8A 3HP3A 1C8CA 1PFBA 1BF4A 2L11A 1EL0A 1WTQA 2KUMA 1SAPA 4OIJA 1G91A 1ICWA 2N88A 2FMMA 2JYOA 2KEEA 2RSNA 4CJ1B 3F2UA 1PLFA 4X3KA 1ILPA 3FDTA 1MGSA 3KBXA 2RA4A 2B2WA 3GV6A 1WD0A 3D6WA 2RVLA 2R3ZA 1B4OA
chains in the Genus database with same CATH superfamily
1G6PA 4N8FA 2Z0SA 1NBWA 4JI1Q 4C3HH 1SR3A 4MTNA 1J8IA 1CFMA 3KLSA 2DUDA 3U9SA 3K0XA 5KRUA 1H95A 4ZYSA 3RLNA 3SK5A 4OGQC 1L0WA 3DWPA 2VB2X 5IP9G 3MXPA 2NVXB 5EKIA 1EEID 1NR4A 4DUZL 4B08A 1IW7C 1DYQA 3TP5A 4UY8C 2I0QA 3PO2G 3S2DH 2HDLA 1EIYB 1SYDA 1WI5A 4F7XA 3CPWA 2PQEA 3BYTB 4JYAQ 3DLLA 4B3RL 4X66Q 2R7DA 2MP1A 3F2DA 1VCIA 4LJZC 1NSNS 1GUOA 4KHVA 3TZUA 1FYCA 1BBWA 2OTJA 2IWHA 4B3SL 1K83B 2FINB 2F4VL 1H9KA 2PW5A 2CKZB 2HUGA 3CXCA 4GKKL 3WWVA 1LTSD 4DAMA 1JWSD 1LACA 1PH8A 1EU3A 4F8MA 3C2PA 4DK6C 1W6KA 4RH6A 2A74C 4K5XA 1S3OA 3OTOL 1X32A 3NBIA 4IUQA 4YCWA 3STBD 3C46A 1E1OA 1A0IA 1CUKA 4WORA 1JWMD 2WAQE 3X3NA 5F2DA 4OO1H 5I9PA 1A6XA 5ELDA 4DV3L 1FJGQ 4X3UA 3U58A 5I6YA 3TS2A 1KNAA 1K8GA 5JJLA 3OMCA 3DM1A 3T53B 4PV1C 1PVOA 1PH2A 3D3RA 3BG3A 1CI3M 1JOOA 4HTHA 4EGVA 3IFDA 2F0IA 3V2TA 1NMGA 5FLXL 3NHHA 5AJ3Q 2F0KA 3J80c 2H4OA 3GTMB 2E76C 1SYBA 1D5MC 1PFBA 2V4DA 3NWSA 1DCZA 3M3YH 4CJ1B 1QZGA 3R8BA 1GJXA 4BA2I 3PGZA 1EQQA 1O7LA 2SOBA 1GXDC 5C6AA 1EY0A 2WKCA 3RZDB 3BVZA 3KDFA 3TN2A 4FO2A 1V1PA 3VA7A 1TU2B 1QJOA 3D4DA 1AW7A 5FLXc 3JAMi 4HIMA 2EQSA 2F52A 4RGTA 5BN5A 4KHPQ 3OHXC 5KYLA 3TS0A 1IBKL 5ELFA 4HJ8A 3D4RA 1ZYRD 3CRLC 4OWTB 2BDOA 2O5JC 2JP1A 2I5HA 3BVMA 1STYA 1TWCH 1SMYD 5FLMG 5HY6A 1VQKA 4LF9L 4L8JA 4JV5Q 1OXVA 2DNCA 2UUAL 3S1RH 4XQJA 2NVTH 4LW1A 3R2TA 2DNEA 1SN8A 1ET9A 2XRQD 4GLVB 1SROA 3FPUB 1CZWA 4PZ8A 4JI5L 4K5WA 4OWWB 3A8IE 3IRBA 4V190 3OPOA 2QF7A 2AWOA 4IUVA 3CU7A 4DAYA 2VW9A 2HT1A 3FKIG 1NTGA 4K0KQ 5IP9H 4EQPA 2XWBB 3TSSA 2IY5B 3B6YA 3MXNB 2EYPA 4JI6L 3T13A 4DR3L 1BKBA 1Y1WG 3GTQH 2EJFC 3K7AH 1C0AA 1JE4A 3P7JA 1KABA 2D62A 2JA7B 1SYEA 1EOTA 2F0GA 3CMAA 2R93B 5CC4A 4FYDA 1A2TA 2EYHA 1UEAB 1Q1EA 2DN8A 2KCTA 3O13A 3RR5A 5JPMC 2ENBA 4ABNA 2E5LQ 2B2VA 2TMPA 3LWUA 1LTAD 4LF8L 4RGMA 1C9OA 1EUJA 1KDAA 4GKJL 3DEOA 2LMCB 4HJ5A 4C3JB 1KDBA 3IFTA 2F0WA 2BE5D 4A3GB 3I55A 3HKZB 1ET6A 2CWPA 2CHBD 5IGEA 3HOYG 2RA4A 2B2WA 2G9DA 2LFNA 4IJHA 4F88A 3CCEA 2LS01 4QUFA 2VQEL 1EIGA 5IGCA 4XQNA 1B50A 2AQ2B 3G7LA 4HSVA 2PW7A 2CCZA 1RKNA 4CKBA 4R4CA 1SRUA 3J7ZC 3I4LA 1UE5A 2NTTA 1K73C 2MO0A 3Q0AA 4LMQD 5C5LA 5JJIA 2B2VC 4RCOA 3SK6A 3AB9A 4DK1A 1IZ6A 1V1PB 1HH2P 3QB3A 2J0TD 3CD6A 2A69D 2XSCA 4K2KA 1KQSA 2Q2HA 5DNFA 2RCFA 1Q90A 2JA6B 4DNIA 1I4XA 2B2WC 1MBYA 3QG1A 4OEMB 1BO0A 1X3QA 4MIUA 1QVFA 4DF7A 3HOXG 4NDXA 2N8NA 2UUCQ 3D4WA 3MTSA 3NWTA 3KLSX 2MGSA 3PUVA 1TWGB 3BZCA 1QCBD 1VF5C 2L12A 4KKSA 2R92B 4TKOB 4K8IA 1PTOH 4U673 5C4HA 3GTOH 2EY5A 4DR4L 1IL8A 4B3TQ 3LNNA 1BCPF 4RHSA 3OMGA 5FLMH 3CCJA 3JAME 5C4XG 3WDNA 3CCRA 1HHVA 4X62Q 3CMEA 1WTPA 2VUMB 1A3VA 1TY2A 4G57A 3K0YA 2O4XA 3C1FA 2G9HD 2C9OA 4L5TA 2WINB 4QY7A 1XPUA 3MXGA 1JICA 2PNHA 1PH5A 4CGYB 1KRSA 3E9HA 3KLWA 1D5XC 2CQAA 2QEJC 5EPJA 3HEJA 1B8AA 4DAPA 5LMNQ 3JAML 4L5SA 5IODA 2DY8A 1TY0A 1IXRA 2I07B 3NSWA 3MHBA 4WJWA 2L15A 1EL0A 1XTCD 4IJLA 3SHLA 1XWEA 2B63B 1C4QA 1ENAA 2KEEA 2F0UA 3S24A 2CW0C 4A93H 1Y1VG 2EDGA 1GHKA 3OOCA 5LL6S 3H3VC 4A3JG 5CV9A 2PZWA 3SEBA 4X3TA 4CDDC 1VDZA 3MFYA 3HOVB 5GAGC 1NCVA 2UU9Q 2JA5B 2MQHA 2K5VA 3U50C 3BDLA 2OWOA 3AQQA 2FFKB 5I4DA 3ERSX 3MXUA 4NMZA 4IFDG 3EJIA 3K7UC 1JORA 3DWQA 1K83H 4YHHL 1VQNA 1HTLD 1D5ZC 4A3MG 1K3RA 1J9OA 1SE3A 4AIMA 1STNA 4BWGB 3SR1A 3CHBD 3KF6A 2DGYA 1JR0D 1AFPA 2E2JH 1MI2A 3A7LA 4DV6L 1UNSA 1X3GA 3TP7A 1IKMA 1HA5A 3NXWA 5EPKA 3CC4A 4R8NA 3BU2A 1YJNA 5EKLA 3PSIA 5LMUQ 2F0OA 5DEHA 2NB0A 1EEFD 1EY7A 1BCPC 4NXML 1TWHB 4X65Q 3M7GA 2XNAC 1GOZA 1HZCA 4C2MH 4OIKA 3UDFA 2WAQG 3QWNA 5BN4A 2ZTCA 1QWYA 1B53A 3PO3B 1S4ZA 4MTKA 4FXKC 2Q2IA 4MNOA 4XYQA 1N36L 4L5RC 4ZUIA 4DR5L 2A6HC 3FP9A 2GA4B 3K6OA 3VA5A 4CBVA 2R6GA 1SNPA 1YNNC 2B3GA 3VDYA 1N33Q 2EYMA 2NVQH 3GTMH 4OL7A 3NQIA 1BVSA 1SLJA 3K58A 1U9RA 3TREA 1PFNA 1ENCA 3HOXH 2K5WA 2PMZB 1R9TH 4DUYL 1J6QA 2K28A 2EY1A 2MHVA 4A3KB 1HPCA 4IPCA 3A8KE 4IALA 2NN6G 4OHJA 4DV5L 1C8CA 4BBRG 4DV0L 1IBLQ 4DFAA 3NBHA 5GAEC 3A5UA 5C4XH 1Y8OB 1UWVA 4QIWB 3D6WA 2QILA 3K80C 3CF5A 2D2CC 3AYHB 3BZKA 1G291 1GUWA 4ALPA 4QMGA 1YBYA 1I4RA 3J80i 2BH2A 1IBMQ 1M90C 1CSQA 5D3IB 2RHQB 1TWAB 4LAAA 4DV7L 3PO2B 3M4OB 3A54A 4JI2Q 1BCPB 1EYDA 1HZBA 1KL9A 1TXYA 3M9BA 2N78A 2F0MA 3MZ5A 1LT4D 4RA8A 2K05A 3LGJA 1PYSB 1Q8IA 2F0VA 4R8IA 1I6HH 5M3MB 1MHWC 2Z4HA 1Y1VH 3GTLH 4GLAC 4HMJA 5T1GA 1HNXL 3CC2A 4A3JH 1FNUA 4KY5A 2VQFL 3D31A 1DM0B 2YU9H 4JI7L 1KC8C 4XYOA 2WV6D 3PF5A 3K57A 1I3QB 2BOSA 2UUAQ 5FOBB 4RKBA 3K59A 1F2YA 4JI8L 4KY7A 5GADC 1WFQA 1FL0A 2MJ8A 3DMUA 4EQNA 1TS5A 1X56A 1A3UA 4RFBA 1SJHD 4A3MH 1NAPA 2K5QA 1V43A 1U4RA 2R93H 4ILWA 1QZHA 1EYCA 1Q3LA 1NY4A 3H0GG 3PUWA 4IOAA 3VR6A 4LF7L 5I9OA 1JB7A 1EY4A 5D3DA 4ZRZA 2J7ZA 4BA1I 2D0PA 1UE7A 1XPOA 3CKIB 4A76A 4DN4M 2E2HH 3STBC 1BBUA 5GROA 4ZAIA 3I4NH 3EBEA 4IPDA 4A3GH 2IHEA 2UXCQ 1O78A 3I73A 5FJ8H 1MKHA 2RDGA 4LF5L 3GTJB 1O7YA 3EQLC 5C3EB 3LX0A 3K5OA 2PYKA 2HHHL 2IL8A 1LTBD 4KMUC 3RUZA 1K9MC 1SBBB 1SNCA 2ZTDA 4OX9L 3IAYA 1ILPA 1CT1D 1EWIA 5JAVA 3S1QB 2GVAA 5L37A 4APVA 5DLQE 3RLFA 1N32Q 1BDOA 1KDCA 1LTLA 5E1FA 3I72A 3SDZA 2X6LA 2AUJD 4C3IH 5C4JB 1O7IA 1N8RC 4LFAL 3NBHB 1VQCA 1OXXK 4DV1Q 1LUZA 4XDXA 2NBFA 3KJPA 5HURA 4A3FB 2FXQA 1KAWA 3PV0A 1K8AC 5J39A 4ME3A 1OXSC 4K2LA 3M4YA 1I94L 1PA6A 2NN6H 2WB1B 4Y7NB 4BBRH 4DV2L 5JVH3 3I4MG 2N49A 1UE1A 4BBSH 3NQTA 1IKLA 3WOEA 3OIPA 4ZCKA 1G51A 4A3IH 1TWGH 4IFDI 3T4AC 3KUPA 3NP8A 3HGBA 2R92H 1AH9A 2VL6A 3EA6A 1EQVA 3H94A 1ZYRC 5K36H 3T1HL 2ZM6L 4O0AA 5BN3A 3S16H 3S2HH 1F2LA 3FKIB 5H1SE 2WIIB 1PTOD 4K6DA 1RODA 4GN5A 1SMYC 5COYA 2JN4A 1MSHA 1LLRD 2VUMH 4R4OA 2L1BA 4HJAA 2M2LA 3H91A 1RF2D 3TMEA 1Y1WB 2EOTA 4POGA 3J80E 1E7ZA 3AMUA 4X64Q 2QW7A 1J5EQ 3MXNA 3G6JB 3TP6A 1EZ8A 3K5LA 4AH6A 3I70A 1U4MA 1YITA 2YTXA 4H13C 2H1EA 2EE1A 2IPKD 2A6ED 5DM63 1PZID 4XT1B 2K50A 3HKZE 4K14A 1XNRL 2HCCA 2K6AA 1V1OA 2RCNA 1D1IA 2CQOA 4LFCL 3J80L 3W5OA 3MFGA 1H9RA 1CA5A 3J7AV 2E2IH 1R4PB 5FLXE 3KF8A 2K32A 2F3VA 1Y8NB 4DR7L 2KA7A 2FMCA 3HOVH 3S9WA 1HJPA 5IE8A 4N8X1 3HOYB 3H0GH 1PLFA 2HIVA 3GTGB 1SMXA 3L9AX 1GD7A 4I7AA 2UXDL 1FNWA 3EFXD 2RKSA 5IYDH 4GNXA 1VQMA 1XMOQ 2ICIA 1D7QA 2AQ1B 2KBNA 4Q5VA 3EN2A 5EGTA 5IWAQ 2UUBQ 4FDBA 2BE5C 4DR6Q 5T1IA 3C3LA 4RG1A 1STGA 1XMQL 2MFIA 2Z1CA 2N3SA 4HAEA 1QOHA 5DM73 4I65A 1GUNA 4HIDA 1GKHA 2ZXOA 4AQYQ 3E0JA 2SNSA 1IHZA 1PYBA 1FVIA 2OEOA 1D8LA 3S1NH 1SFOB 3OW2A 2LSSA 4NKLA 4BY1H 1LTGD 1EY5A 2JK8A 4ZKBB 2R7ZH 1PHJA 1DOLA 1YNJD 1VQ5A 3KBGA 1TWHH 3CCMA 4IO9A 4YIJA 2JA8G 1DZ1A 3NENA 4G7HC 2XN9C 5M3FG 3NELA 4MN3A 2Y0SB 1P16A 1WTQA 4GNXC 1TVXA 2QDLA 3D8GA 1TS2A 2PNRC 1YHBA 2A69C 4CDEC 4BY7H 5ELEA 3KYHC 1U4LA 1PRTF 1TWFH 1Q8KA 1ONLA 5CV7A 4YY3Q 1IL2A 1OO9B 2BA0A 5KIXA 1H9JA 1GHJA 4NXMQ 3H3VH 3I4MH 2CH4W 1XJVA 3J7A5 3S17H 1L0XB 3GTKB 1H9SA 4TQUS 2L5TA 3CC7A 4TSSA 4B9XA 1NE3A 2L0CA 3E0EA 4OO1I 1LYLA 3IKJA 1OTCA 3GV3A 4YWMA 1WTVA 1PXUA 1SNOA 3F2BA 1VQLA 1CQVA 2ID0A 3F1ZA 4AYBG 3GTPH 1R4QB 1B3AA 2RHSB 1QB5D 1BF4A 3L0OA 4A93G 2G5DA 2FMMA 4FF2A 2AMCB 4NXNQ 1MGSA 4G7ZC 4A3EH 3GV6A 2Q2UA 1N34Q 5M5WH 1AZPA 2XIWA 3KF8B 2R7FA 5ELCA 4CKEA 5CGKA 1CZGA 2Q8RE 4PG3A 2PQAA 5ELBA 3HOZH 4JI0L 2HCIA 5JVG3 1EQTA 3SVMA 5K5PA 2PI2A 1SJED 2WP8J 1Y8PB 2VS1A 1AZQA 4GNXB 2IHFA 3CW2C 3ER0A 2EZVA 3KK7A 1ESFA 5M5XH 5BR8L 1KRTA 2UXBL 3S14B 1X6OA 1F2MA 3A55A 4ID6A 3QJYA 3UE1A 3RN5A 1LT6D 2NZOA 4DGZA 3KJOA 1OXUA 1WCMH 3S1MB 1IYJB 4LUVA 3MC0B 2IJ0A 4UP8A 5M5YH 2B2TA 1RD9D 3OWEB 5CBEE 3HOWH 1Q82C 2OF1A 4G7OC 1JE5A 2KQ3A 5IT9L 1TQOA 2TSSA 4C1NK 3TRZA 1AE2A 1JT8A 1LT5D 4I7ZC 5JJKA 4RAUC 4UAIA 4UDUC 5AFWA 3HOUH 4DXGA 1SSOA 1CA6A 4B3MQ 4A3DB 2L55A 4YWKA 5IY0A 4F87A 1G8ZD 3FRPB 2NVYB 4X6AH 2PMZE 2HQLA 4P71A 3UDXA 1K8MA 3KOJA 4JI1L 1AP0A 1SE4A 3NEMA 1I50B 4N9TA 4A3BB 1QNKA 3CRKC 5C0XJ 5C3EH 5IT9c 3DXJC 2K4KA 2JA8H 5M3FH 1VS0A 2KECA 2B2TC 3CP0A 4QIWE 3VYTA 1H9SB 4IUPA 3ONAB 4A3LH 3ULPA 3SK4A 3S1QH 5JEAJ 3E5SA 1WD1A 4P73A 4JYAL 2Q8TA 5KNDA 3OIQA 1BXTA 2L11A 4DV4Q 4FXGC 3DUZA 2F0NA 3UDIA 5C4JH 4C3HB 2AKWB 2JYOA 1EIFA 3KFUA 3TBIB 1PYWD 4XXEA 2O5IC 1ZEQX 2A68D 3BDCA 2K5HA 1KD1C 3R2IA 2PO4A 4JOIA 1XNQQ 1HR0Q 2HHHQ 3OWFA 1HCZA 4ZUJA 3GD7A 1F2ZA 1IYUA 1YVCA 3A7AB 4O1NA 5KGUA 5C44H 1VQIA 4Y7NH 4LK1C 3UDGA 3S2DB 3N52A 1EY9A 1TT2A 1Y69U 4NB3A 4O42A 1NMFA 1HZ9A 2OQ0A 1Z6HA 4R9WA 1FJGL 1JOQA 3EIVA 3PQIA 5C3XA 5CV5A 2PQAB 2NVXH 1HNWQ 2AQ3B 1UEBA 2K5DA 1I4PA 4RMFA 3VR5A 2ZJRA 1XPRA 1HNZQ 3A0JA 1Q46A 2DJGC 4LF4Q 2VZAA 4FNFA 4JOIC 5AJ3L 4KY6A 4HMIA 1TKWB 1BQQT 3UE0A 2JA7G 1PRTD 4YCVA 2R93G 3I90A 1EWHA 3RLOA 3R93A 1AE3A 4ZQ3A 4HIOA 1YIJA 4DNTB 5EBCA 1RTNA 4DUZQ 2Z8LA 1F9RA 1I4GA 1KTKA 4KLKA 3QO2A 1DOMA 4B3RQ 3I4NG 4A3GG 4KN7C 4P72A 4B3SQ 5FJ8G 3DWAA 4IUTA 2K03A 4KHPL 1GO3E 3K5NA 2F4VQ 1K8OA 3NTKA 1L1OA 1PTOF 4GKKQ 3VYSA 4EQOA 4JC0A 3A74A 4OONA 3L3OC 2MO1A 4LFBL 5LHY1 3RMHA 4JV5L 1CSPA 3OTOQ 3T1YL 5IYCG 2AWNA 1G91A 2N88A 1F77A 1E2VA 1VQ9A 2WACA 4X3KA 4A4IA 1JCKB 4C3IG 5IGGA 2KCNA 4DV3Q 1LV9A 2WB1E 1HUNA 4LF6L 1SNQA 4M1UB 2RDFA 4K0KL 3NPPA 3G4SA 2QDBA 1KNEA 2KOLA 4L5QA 1TWCB 2BDNA 1JB3A 3RZDH 2JQOA 1UUPA 3S1RB 1L1OC 2OXPA 2NVTB 2N55A 4UPAA 4BBSG 2IX1A 5IIFA 1LTTD 4R4TA 1EU4A 3S15B 4A3IG 1KLUD 4J8QA 5J1ZA 3CAMA 2R92G 1XMQQ 1SYGA 4DK0A 4PNYA 3L2PA 5K36G 1I4HA 1A3TA 2RF4A 3J81L 4N9PA 2JSOA 5FK9C 3V05A 3NK9A 1DXMA 4CJ2C 2E5LL 4FF3A 4WRDA 3QR8A 1LO5D 4KV6A 2VUMG 3F2CA 4EVOA 4HR7B 1CHQD 3A5ZB 3MWYW 1MSGA 2CFMA 1EFWA 2ES2A 1H9MA 3GDEA 3GTQB 2B39A 2PZTA 3P75A 3K7AB 2MNAA 3CCQA 1LT3D 2F4IA 1ENFA 3T51B 2HIXA 1IBKQ 3TQYA 1MIUA 1HQRD 5IP7G 3K81C 4NP5A 4DXFA 2OCEA 1PTOC 3CCLA 3J81c 1II3A 4LF9Q 5C0XH 1NUCA 2AUKA 2B63G 1D6EC 1M4VA 4JI4L 1UE6A 4HEDA 4NPSA 4ZKCB 1RDPD 1LABA 4QUCA 1B3QA 3SE0A 4JI5Q 5HGQA 1WOCA 2B2YA 2PZUA 1YI2A 3PUYA 1GUGA 2JA7H 4A75A 3RN2A 1BBXC 3HOVG 2K04A 2IX0A 3JC66 2ATWA 5CBAE 4PMBA 1HXYD 3M85A 2A6EC 2EJGC 3FPPA 4E6IA 1L1OB 2O2LD 3HKSA 4CHTB 5IYDG 4JI6Q 5J3BA 3P20A 4DR3Q 4C3JH 1QILA 4FP5D 2R3ZA 1B4OA 3G71A 2WKDA 2EYLA 2YYZA 4QF4A 2UUCL 1G6ZA 5ISRA 1X65A 5D14A 4TVAB 4TRDA 2XRSD 4KKTA 4B3TL 5C5MA 2QCPX 2Z6KA 1PV4A 4BY1G 2B2YC 1HFGA 4LF8Q 1EWCA 2Y0SE 2NTSA 1TS4A 2R7ZG 1DJRD 4X62L 4GKJQ 1FGUA 5IYCH 3ZJYC 1AEXA 1FNVA 1BUVT 4UP7A 3PO3G 3EVQA 1SE2A 4A3DH 3I3CA 3BDOA 1RTOA 3QIAA 2UXBQ 4BS9A 5LMNL 2F3WA 1PTOB 3GTOB 1VQEA 2VQEQ 4BY7G 1GVPA 1EY8A 4DR2L 2JA6H 1S5CD 2EXDA 4DPGA 3GQBA 1YNJC 4A3BH 1ZXTA 3H15A 1B70B 4QB4A 1WTWA 4DU9A 4KHZA 1EOVA 2Z6KC 4FVMA 5EKKA 2ZT9C 3RZOB 2RBMA 1HR0W 3W3AA 1LTRD 2A5HA 5LMNW 3PUZA 4XT3B 2GVBA 5E3FA 1Q7YC 4IZ8A 3PIO3 2UU9L 4GOPB 2ALYB 1STHA 4L6TB 1M1KC 1RJTA 1A8VA 4U68A 4AYBB 3UI2A 4KN4C 4P74A 1VQHA 2NZ1D 1CK1A 3VR3A 4A93B 1W6JA 1PDQA 3VYUA 5GAHC 4J15A 1NJIC 1JJ2A 3FVQA 3NUCA 4A3EG 3W2DA 2F0FA 1K0SA 3GO5A 3K8AA 1ICWA 4DR4Q 4J6HA 2JEBI 5IP7H 3CQZB 3KBXA 4DR1L 1PH1A 4IPHA 4C56C 1KHIA 1ILQA 2LXKA 1B9NA 3K5MA 5LMUL 3HOZG 4GN4B 2B63H 5KEEA 2OQKA 1WTXA 1SXTA 3PF4A 2KHIA 5M3MG 2NYZD 1S5ED 2K5NA 3FEWX 4B9WA 4X65L 2QEXA 3QOJA 1SNMA 1FR3A 3E6ZX 2E2DC 1PH3A 2E2JB 4S3SA 4KD4A 1HQMC 2LY7A 2JA5H 2QKIC 4IUNA 4KKUA 4P75A 1E24A 1I6VC 1WCMG 3A56A 1ASZA 5I6WA 4PMWA 4IQZA 1B2TA 1N33L 4QGUA 1YJWA 3HOWG 4FXDA 2CWAA 1VQGA 1FD7D 3N6RA 5IYBH 1JC7A 2NN6I 5C3WA 3SK8A 3OYYA 2X6GA 1MJEA 2F0DA 1NR2A 3HOUG 2A19A 2C35B 4C2MB 2D9UA 2I46A 4YCUA 2H5XA 3KLRA 3D0FA 4HCEA 5IGFA 2L9HA 3HRZC 2CVRA 4ME5A 3VYRA 1KAAA 2K7VA 4QCLA 1VQ7A 1VMCA 1IBLL 3I7FA 5D65A 1YJ9A 1Z9FA 4R4QA 1YZ6A 2RDHA 2NVQB 4YHHQ 1HFNA 3RD4A 3ULJA 5C3EG 3TP8A 1QE6A 2DY7A 3PO3H 3P1HA 3HOXB 1R9TB 2A73B 3EROA 1IBML 4DV6Q 2KHSA 4HSPA 4QL5A 2CH4A 1VQAA 1AN8A 1E0BA 3Q6SA 4KJNA 4MHEA 4A3LG 2ASBA 4FF1A 3M4QA 1A62A 3MVVA 2F0QA 4HJ9A 1EFID 4CKCA 4CDCC 4RGNA 3U9OA 4LUZA 1PH4A 2B29A 4JI2L 5C4XB 4DA2A 1TR5A 3VR4A 1PFSA 1S5FD 4POFA 2FJ2A 5TSSA 4A3FG 1PH7A 3PIOA 1KXLA 1P8LA 2RSNA 4A3CH 4A3KH 2HD3A 4GS3A 1IW7D 1N36Q 4QQBX 4DR5Q 5C44G 2WB1G 4LFBQ 1EY6A 4PQXA 1VQ6A 3T1YQ 1C7YA 5CV4A 3BZDB 3M4PA 1KLGD 2VY3A 3X3MA 4UHVA 2JEAI 2VXWA 1QG7A 4R1JA 3S15H 3Q23A 2F0EA 3MEHA 4KD3A 4WJ4A 2PI2E 5CR3A 3MAQA 5FKAC 1I6HB 3H6MA 3CCVA 2A68C 2E8GA 4LF6Q 1CTMA 2IT1A 3CCUA 2EVBA 1Y1VB 4DUYQ 3GTLB 2F0SA 2HQEA 2E74C 1BOSA 4A3JB 1EIHA 4HIKA 1TWAH 2PCFB 3PIP3 2YU9B 4DV5Q 2BH8A 2F03A 2Z6BA 1DONA 4DV0Q 3PO2H 3M4OH 1PMRA 1SYFA 4DK3C 5KNCA 2YV5A 4LWCA 2F0TA 2M9VA 2K75A 1HRJA 2RQXA 2UXCL 1F9QA 1JQYD 4ODGA 5M3MH 1V9PA 4J1MA 4ULLA 1CKNA 2K01A 3PCOB 4A3MB 5E4WC 2X69A 5IT9E 1PFMA 1BR9A 1Z47A 5NUCA 4IOCA 4IUUA 2F0LA 5JOBA 5A35A 5JPNC 1I3QH 4G4KA 5I2YA 2HDMA 1EZ6A 4DV7Q 2OTLA 1Z7TA 2B8FA 4EQ5A 4P2CB 2E2HB 1N32L 2C5CA 1QVCA 1HZAA 3I4NB 1ESRA 1E2WA 1PRTC 1M8AA 2I5LX 1VQBA 2RSOA 3D6CA 1A63A 1JJCB 1SNDA 3H3VI 4DV1L 1GM5A 1STBA 2K33A 1HNXQ 4JI3L 3Q22A 1WTOA 5EJWA 1SYCA 2ZJQA 2VQFQ 2WAQB 2XWJB 4X3SA 1KIXA 1ML0D 3HZXA 1PZJD 1B7YB 1BNZA 1HTPA 1STEA 1YNXA 1SEBD 4JI7Q 1E2ZA 4K5VA 3DEPA 1WTHA 4JI4Q 3VR2A 1F9SA 4JI8Q 3HP3A 3DM3A 1GUTA 1T5XD 2D5DA 1U5KA 4IN3A 4RHRA 3J81i 5ELNA 2B8GA 5DAUA 2KHJA 4C3IB 3GTJH 2Z9HA 1Q86C 2F0JA 3KDFB 5A2QE 1STAA 1D2BA 1UAPA 5C4ZA 4LF7Q 1L0YB 3SGIA 1WTRA 2IW3A 2XVSA 3FMCA 4ZLTF 4HCSA 4BBRB 1XYIA 4XQQA 2J4XA 4X66L 1OXTA 3OW7A 5A2QL 4BBSB 2Y0SG 4X64L 1S5BD 3I8ZA 4H02A 4A3IB 1W2BA 4LF5Q 1J5EL 4IFDJ 1T9HA 3AFQA 3SXHA 4A3FH 1QVGA 3E3XA 3S16B 3S2HB 1LM0A 3IL8A 1SDFA 1X3EA 3ITPA 4OX9Q 3BVGA 4DAYB 4JPBW 3TEHB 2GN5A 1VQDA 3MA2B 2JJQA 2P5ZX 1PRTB 3RZOH 3LWEA 5EBDA 4RKLA 4M8AA 4LFAQ 3A8JE 3C1EA 3PIPA 4O2DA 1K3BC 5FO8B 2BA1A 2EYOA 4PZ7A 2ZJPA 1QNUA 3FKIH 5JJZA 1WVLA 4JBKA 2NWGA 4DR2Q 1CKNB 5C0XG 3W1GA 2JE6I 1Q81C 3AU7A 1I94Q 1C48A 4KK7A 4IURA 4RCNA 4DV2Q 1XMOL 1TS3A 3J81j 1F9PA 1Y1WH 2KEDA 1CKOA 1B1ZA 5IWAL 2UUBL 2QA4A 1YHAA 4DR6L 1JOKA 2E2IB 2LKVA 5HGTA 5JEAG 4CDFC 4GLXA 2EPBA 4JBWA 2EJMA 3FHWA 3BJUA 1B9MA 3W1BA 4AQYL 5G3LF 3T1HQ 2ZM6Q 2WFWA 2SEBD 4NW2A 1I5FA 3RNUA 3CQZH 3H0GB 1JWUD 5E4XA 1V1QA 3JAMc 1G2TA 1I4QA 1Y14B 3ERQA 1RCVD 4UP9A 1GUSA 4BXXG 4C3JG 2KUMA 3ZYYX 1W3SA 3HKZG 1WD0A 4JK1C 4OIJA 4H0LC 3OSOA 4XTCS 3HOYH 1CHPD 2OT2A 1X9NA 3GTGH 3AEVA 3PUXA 3M3YB 2JXMB 2ZXPA 3Q24A 3S1NB 4DR1Q 2KCCA 3URYA 1XNRQ 2KVMA 1XTDA 4BY1B 1X55A 2ICEC 3T56B 2F0PA 4YY3L 1CKMA 4LFCQ 4Y52H 3CPFA 1O7ZA 2R7ZB 1A2UA 4GZYC 1X3FA 4KTAA 3BS1A 3H09A 4A3DG 5IGBA 2EY6A 3HG9A 4QJFA 4DR7Q 4YWLA 3T16A 2KCMA 3I4OA 1SFOH 3I91A 2F0HA 5GQOA 1HUMA 1YEZA 1ZKOA 3MEFA 4OWXB 4DNRB 1S40A 2JA6G 1EYAA 2MPMA 4V0BA 2EYFA 5CORA 5J22A 4K6LA 4BY7B 3NTIA 1WYDA 2EYJA 3J81E 5KNBA 4PMCA 2UXDQ 1TWFB 4RWSC 5EPLA 4A3BG 2AHOB 1YHQA 5EQ0A 5FO9B 4ZK9B 3I4MB 1JMCA 3WOFA 3L7ZC 3S17B 1VQJA 1V8QA 4IPGA 4Z9CB 3NTHA 1HA6A 4OXPA 5IGDA 4HJ7A 1D1KA 4NXNL 1VQOA 1NNXA 2A1AA 2EIFA 5ELOA 3DHQA 4AYBE 1N34L 2ZXRA 1E3PA 3F8TA 1TIID 1VQ4A 3TZDA 2VB3X 3J7AF 4C3HG 1RHPA 5I2XA 1RIPA 3NE5B 4XIGS 4K8JA 2XTIA 3GTPB 3GTKH 3I2ZA 2CW0D 1K0RA 5CYUA 4JVZA 2BCOA 4GOPA 1QUQA 3E9IA 4LUOA 4DKAC 3ND8A 3ICEA 4DAVA 3BYYB 2B2UA 4A3EB 2YTVA 2M00A 1ICFB 1B44D 1VQPA 5M5WB 1E22A 1SAPA 2F1MA 2K14A 2D0OA 3F2UA 1CQFA 3M7NA 4KJOA 2KENA 3I56A 1EYGA 2Q8IB 2RVLA 3CCSA 3HOZB 2QGQA 1CM9A 1U4PA 4Q0FA 2MUYA 5JEAH 4B3ML 3PMFA 2JA5G 5M5XB 1X54A 2L4NA 3KF6B 1LTID 1E1TA 1MD2D 1DGSA 2EXZA 4WFN3 2Q2TA 1XX8A 3HFZB 3ULLA 1WCMB 1T5EA 2I5MX 2K52A 4GOPC 5CMDA 3G48A 4IFDH 1O80A 4GN3B 4JCVE 5KYIA 4HN7A 5IYBG 4OO1G 5M5YB 3HOWB 4BXXH 1BCPD 1RL2A 2B2UC 3GP7A 2SDFA 3G6EA 1PH6A 1ASYA 1JJGA 4C1NI 3HS0C 3U4ZA 1S72A 2A8VA 2SNMA 1Q12A 1FGBD 3HOUB 3S14H 3AFPA 1PH9A 4JG2A 1K28A 4EX5A 4R4IA 5IOCA 2A6HD 1G2SA 2V1CC 4JBJA 3S1MH 2F3IA 5LL6X 1YNND 4RGOS 1Q1BA 4DV4L 4JI0Q 4JW0A 1A15A 2K1BA 2KJXA 5CV6A 2NZHA 1L2FA 1WJJA 3Q8DA 5E7NA 1EQRA 4FF4A 2EY2A 4OELB 2JA8B 2DJFC 1XNQL 1HR0L 5CV8A 5M3FB 1DD2A 1U0LA 5BR8Q 2R61A 3J7YW 5M9OA 5EAYA 1S5DD 2NVYH 1IYVA 1VQ8A 2E75C 3QOLA 1VMPA 5G3LD 4CJ0B 2FHTA 4LNQA 2LXJA 2NUCA 4MZ9A 2VNUD 4L63B 1MJCA 1N9WA 1I50H 2ZTEA 3U4VA 5C0XI 2XGTA 1VF7A 4H44C 3ND9A 1DOKA 4WJ3M 3TDQA 5FO7B 3R3OA 1XXGA 4PZ6A 4A3CG 1HNWL 1X3PA 4JI3Q 4A3KG 4JBMA 2JA9A 2YTYA 1VQFA 2Z4IA 2IX3A 1HNZL 4KI0A 1PZKD 1SE8A 2PPBC 3FDTA 5C44B 3V96A 1QUQB 4LF4L 4H7BA
chains in the Genus database with same CATH topology
1J8IA 1CFMA 3KLSA 3U9SA 5KRUA 4ZYSA 3SK5A 4OGQC 3DWPA 2VB2X 2NVXB 3MXPA 5EKIA 1EEID 1NR4A 4B08A 1IW7C 1DYQA 3TP5A 2HDLA 1SYDA 4F7XA 2PQEA 3BYTB 2MP1A 1VCIA 4LJZC 1NSNS 1GUOA 4KHVA 3TZUA 1FYCA 2IWHA 1K83B 2FINB 1H9KA 2PW5A 2HUGA 1LTSD 1JWSD 1LACA 1EU3A 4F8MA 3C2PA 1W6KA 4RH6A 2A74C 4K5XA 1X32A 3NBIA 4IUQA 3C46A 4WORA 1JWMD 3X3NA 5F2DA 4OO1H 5I9PA 1A6XA 5ELDA 4X3UA 5I6YA 1KNAA 3OMCA 3DM1A 3T53B 4PV1C 3D3RA 3BG3A 1CI3M 1JOOA 4HTHA 4EGVA 3IFDA 2F0IA 3V2TA 5FLXL 3NHHA 2F0KA 2H4OA 3GTMB 2E76C 1SYBA 1D5MC 1PFBA 2V4DA 3NWSA 1DCZA 4CJ1B 3R8BA 1GJXA 4BA2I 1O7LA 2SOBA 1GXDC 5C6AA 1EY0A 2WKCA 3RZDB 3BVZA 3TN2A 4FO2A 1V1PA 3VA7A 1TU2B 1QJOA 3D4DA 1AW7A 4RGTA 5BN5A 3OHXC 5KYLA 5ELFA 3D4RA 1ZYRD 3CRLC 2BDOA 2O5JC 2JP1A 3BVMA 1STYA 1SMYD 4L8JA 1OXVA 2DNCA 4XQJA 3R2TA 2DNEA 1ET9A 2XRQD 3FPUB 1CZWA 4K5WA 3A8IE 4V190 3OPOA 2QF7A 2AWOA 4IUVA 3CU7A 4DAYA 4EQPA 2XWBB 3TSSA 2EYPA 3T13A 2EJFC 1JE4A 3P7JA 1KABA 2D62A 2JA7B 1SYEA 1EOTA 2F0GA 2R93B 5CC4A 4FYDA 1A2TA 2EYHA 1UEAB 1Q1EA 2DN8A 5JPMC 3O13A 2ENBA 4ABNA 2B2VA 2TMPA 3LWUA 1LTAD 4RGMA 1KDAA 3DEOA 2LMCB 4C3JB 1KDBA 3IFTA 2F0WA 2BE5D 4A3GB 3HKZB 1ET6A 2CHBD 5IGEA 2RA4A 2B2WA 2G9DA 2LFNA 4F88A 2LS01 4QUFA 1EIGA 5IGCA 4XQNA 1B50A 2AQ2B 3G7LA 4HSVA 2PW7A 1RKNA 4CKBA 3I4LA 2NTTA 3Q0AA 4LMQD 5C5LA 2B2VC 4RCOA 3SK6A 3AB9A 4DK1A 1V1PB 3QB3A 2J0TD 2A69D 2XSCA 4K2KA 5DNFA 1Q90A 2JA6B 1I4XA 2B2WC 1MBYA 3QG1A 1BO0A 1X3QA 4MIUA 4DF7A 4NDXA 3D4WA 3MTSA 3NWTA 3KLSX 2MGSA 3PUVA 1TWGB 1QCBD 1VF5C 2L12A 4KKSA 2R92B 4TKOB 4K8IA 1PTOH 4U673 5C4HA 2EY5A 1IL8A 3LNNA 1BCPF 4RHSA 3OMGA 3JAME 3WDNA 1HHVA 1WTPA 2VUMB 1A3VA 1TY2A 4G57A 3K0YA 2O4XA 3C1FA 2G9HD 2C9OA 2WINB 3MXGA 1JICA 4CGYB 1D5XC 2CQAA 2QEJC 5EPJA 3HEJA 4DAPA 3JAML 5IODA 2DY8A 1TY0A 2I07B 3NSWA 3MHBA 4WJWA 1EL0A 1XTCD 3SHLA 1XWEA 2B63B 1C4QA 1ENAA 2KEEA 2F0UA 2CW0C 2EDGA 1GHKA 3OOCA 5LL6S 3H3VC 5CV9A 2PZWA 3SEBA 4X3TA 1VDZA 3MFYA 3HOVB 1NCVA 2JA5B 3BDLA 5I4DA 2FFKB 3MXUA 4NMZA 4IFDG 3EJIA 1JORA 3DWQA 1HTLD 1D5ZC 1J9OA 1SE3A 4BWGB 1STNA 3SR1A 3CHBD 1JR0D 1AFPA 1MI2A 3A7LA 1UNSA 3TP7A 1IKMA 1HA5A 3NXWA 5EPKA 4R8NA 5EKLA 2F0OA 5DEHA 2NB0A 1EEFD 1EY7A 1BCPC 1TWHB 3M7GA 2XNAC 1GOZA 4OIKA 3QWNA 5BN4A 1QWYA 1B53A 3PO3B 1S4ZA 4FXKC 4XYQA 4ZUIA 2A6HC 2GA4B 3K6OA 3VA5A 4CBVA 2R6GA 1SNPA 1YNNC 2EYMA 4OL7A 3NQIA 3K58A 1U9RA 1PFNA 1ENCA 2K5WA 2PMZB 2K28A 2EY1A 2MHVA 4A3KB 1HPCA 3A8KE 4IALA 2NN6G 4OHJA 1C8CA 4DFAA 3NBHA 1Y8OB 4QIWB 3D6WA 2QILA 2D2CC 1G291 1GUWA 4QMGA 1I4RA 5D3IB 1TWAB 4LAAA 3PO2B 3M4OB 3A54A 1BCPB 1EYDA 3MZ5A 2F0MA 1LT4D 4RA8A 2K05A 1Q8IA 2F0VA 4R8IA 5M3MB 2Z4HA 4HMJA 5T1GA 1FNUA 4KY5A 3D31A 1DM0B 4XYOA 2WV6D 3K57A 1I3QB 2BOSA 5FOBB 4RKBA 3K59A 1F2YA 4KY7A 2MJ8A 3DMUA 4EQNA 1TS5A 1A3UA 4RFBA 1SJHD 1NAPA 2K5QA 1V43A 1U4RA 4ILWA 1EYCA 1Q3LA 3PUWA 3VR6A 5I9OA 1EY4A 5D3DA 4ZRZA 2J7ZA 4BA1I 3CKIB 4DN4M 4ZAIA 1O78A 3I73A 2RDGA 3GTJB 1O7YA 3EQLC 5C3EB 3LX0A 3K5OA 2PYKA 2IL8A 1LTBD 4KMUC 3RUZA 1SBBB 1SNCA 3IAYA 1ILPA 1CT1D 5JAVA 3S1QB 3RLFA 1BDOA 1KDCA 5E1FA 3I72A 3SDZA 2X6LA 2AUJD 5C4JB 1OXXK 4XDXA 2NBFA 5HURA 4A3FB 3PV0A 5J39A 1OXSC 4K2LA 3M4YA 2NN6H 2WB1B 4Y7NB 5JVH3 3NQTA 1IKLA 3WOEA 3OIPA 4IFDI 3T4AC 3KUPA 3NP8A 3HGBA 3EA6A 1EQVA 3H94A 1ZYRC 5K36H 5BN3A 1F2LA 3FKIB 2WIIB 1PTOD 4K6DA 1RODA 1SMYC 5COYA 1MSHA 1LLRD 2L1BA 2M2LA 3H91A 1RF2D 3TMEA 1Y1WB 2EOTA 3J80E 3AMUA 3MXNA 3G6JB 3TP6A 1EZ8A 3K5LA 3I70A 1U4MA 4H13C 2H1EA 2EE1A 2IPKD 2A6ED 5DM63 1PZID 4XT1B 4K14A 2HCCA 2K6AA 1V1OA 1D1IA 3J80L 3MFGA 1H9RA 1CA5A 3J7AV 1R4PB 5FLXE 3KF8A 2K32A 2F3VA 1Y8NB 2KA7A 2FMCA 3S9WA 3HOYB 1PLFA 3GTGB 3L9AX 1FNWA 3EFXD 2RKSA 2ICIA 2AQ1B 4Q5VA 5EGTA 2BE5C 5T1IA 3C3LA 1STGA 2Z1CA 5DM73 4HAEA 1QOHA 4I65A 1GUNA 2ZXOA 3E0JA 2SNSA 1IHZA 2OEOA 1SFOB 4NKLA 1LTGD 1EY5A 4ZKBB 1DOLA 1YNJD 3KBGA 1DZ1A 4YIJA 4G7HC 2XN9C 4MN3A 2Y0SB 1WTQA 1TVXA 3D8GA 1TS2A 2PNRC 2A69C 5ELEA 1U4LA 1PRTF 1ONLA 5CV7A 1OO9B 2BA0A 5KIXA 1H9JA 1GHJA 1L0XB 3GTKB 1H9SA 4TQUS 2L5TA 4TSSA 4B9XA 2L0CA 4OO1I 3IKJA 3GV3A 1WTVA 1PXUA 1SNOA 1CQVA 2ID0A 1R4QB 1B3AA 1QB5D 1BF4A 2FMMA 4FF2A 1MGSA 4G7ZC 3GV6A 1AZPA 2XIWA 5ELCA 4CKEA 5CGKA 1CZGA 2Q8RE 5ELBA 2HCIA 5JVG3 1EQTA 3SVMA 5K5PA 1SJED 2WP8J 1Y8PB 1AZQA 2EZVA 3KK7A 1ESFA 3S14B 1F2MA 3A55A 4ID6A 3QJYA 1LT6D 4DGZA 1OXUA 3S1MB 3MC0B 2IJ0A 2B2TA 1RD9D 3OWEB 5CBEE 2OF1A 4G7OC 2KQ3A 5IT9L 1TQOA 2TSSA 4C1NK 1LT5D 4I7ZC 4UDUC 4RAUC 4UAIA 5AFWA 4DXGA 1SSOA 1CA6A 4A3DB 2L55A 4F87A 1G8ZD 3FRPB 2NVYB 1K8MA 1AP0A 1SE4A 1I50B 4N9TA 4A3BB 1QNKA 3CRKC 5C0XJ 3DXJC 2KECA 2B2TC 3VYTA 1H9SB 4IUPA 3ONAB 3SK4A 5JEAJ 3E5SA 1WD1A 2Q8TA 5KNDA 3OIQA 1BXTA 2L11A 4FXGC 3DUZA 2F0NA 4C3HB 2JYOA 3TBIB 1PYWD 4XXEA 2O5IC 1ZEQX 2A68D 3BDCA 3R2IA 2PO4A 3OWFA 1HCZA 4ZUJA 3GD7A 1F2ZA 1IYUA 3A7AB 4O1NA 5KGUA 4LK1C 3S2DB 3N52A 1EY9A 1TT2A 1Y69U 4O42A 1Z6HA 4R9WA 1JOQA 5C3XA 5CV5A 2AQ3B 2K5DA 1I4PA 3VR5A 4FNFA 4KY6A 4HMIA 1TKWB 1BQQT 1PRTD 3I90A 1EWHA 3R93A 4ZQ3A 4DNTB 5EBCA 1RTNA 2Z8LA 1F9RA 1I4GA 1KTKA 3QO2A 1DOMA 4KN7C 3DWAA 4IUTA 2K03A 3K5NA 1K8OA 3NTKA 1PTOF 3VYSA 4EQOA 3L3OC 5LHY1 3RMHA 2AWNA 1G91A 2N88A 1F77A 1E2VA 2WACA 4X3KA 1JCKB 4C3IG 5IGGA 2KCNA 1LV9A 1HUNA 1SNQA 4M1UB 2RDFA 3NPPA 2QDBA 1KNEA 2KOLA 1TWCB 2BDNA 1JB3A 1UUPA 3S1RB 2OXPA 2NVTB 2N55A 2IX1A 5IIFA 1LTTD 1EU4A 3S15B 1KLUD 4J8QA 5J1ZA 1SYGA 4DK0A 4PNYA 5K36G 1I4HA 1A3TA 3J81L 4N9PA 2JSOA 5FK9C 3V05A 3NK9A 1DXMA 4CJ2C 4FF3A 4WRDA 1LO5D 4KV6A 4EVOA 4HR7B 1CHQD 3MWYW 1MSGA 1H9MA 3GTQB 2B39A 2PZTA 3P75A 3K7AB 1LT3D 2F4IA 1ENFA 3T51B 1HQRD 4NP5A 4DXFA 1PTOC 1II3A 5C0XH 1NUCA 2AUKA 1D6EC 1M4VA 4HEDA 4ZKCB 1RDPD 1LABA 4QUCA 3SE0A 2B2YA 2PZUA 3PUYA 1GUGA 1BBXC 2K04A 2IX0A 5CBAE 4PMBA 1HXYD 3M85A 2A6EC 2EJGC 3FPPA 4E6IA 2O2LD 4CHTB 3P20A 1QILA 4FP5D 2R3ZA 1B4OA 2WKDA 2EYLA 2YYZA 4QF4A 1G6ZA 5ISRA 5D14A 4TRDA 2XRSD 4KKTA 5C5MA 2QCPX 2B2YC 1HFGA 1EWCA 2NTSA 1TS4A 1DJRD 1AEXA 1FNVA 1BUVT 3EVQA 1SE2A 3I3CA 3BDOA 1RTOA 3QIAA 4BS9A 2F3WA 1PTOB 3GTOB 1EY8A 1S5CD 3GQBA 1YNJC 1ZXTA 4QB4A 1WTWA 4DU9A 4KHZA 4FVMA 5EKKA 2ZT9C 3RZOB 2RBMA 3W3AA 1LTRD 2A5HA 3PUZA 4XT3B 5E3FA 4IZ8A 3PIO3 1STHA 4L6TB 1RJTA 4AYBB 4U68A 3UI2A 4KN4C 2NZ1D 1CK1A 3VR3A 4A93B 1W6JA 1PDQA 3VYUA 3FVQA 3NUCA 3W2DA 2F0FA 3GO5A 1ICWA 4J6HA 2JEBI 3CQZB 3KBXA 4C56C 1ILQA 1B9NA 3K5MA 5KEEA 1WTXA 1SXTA 2NYZD 1S5ED 3FEWX 4B9WA 3QOJA 1SNMA 1FR3A 3E6ZX 2E2DC 2E2JB 4S3SA 4KD4A 1HQMC 2LY7A 2QKIC 4IUNA 4KKUA 1I6VC 3A56A 5I6WA 4PMWA 4IQZA 1B2TA 4FXDA 1FD7D 3N6RA 1JC7A 2NN6I 5C3WA 3SK8A 2X6GA 2F0DA 1NR2A 4C2MB 2D9UA 2I46A 3KLRA 4HCEA 5IGFA 2L9HA 3HRZC 2CVRA 4ME5A 3VYRA 1KAAA 2K7VA 4QCLA 1VMCA 5D65A 2RDHA 2NVQB 1HFNA 3RD4A 3TP8A 1QE6A 2DY7A 3P1HA 3HOXB 1R9TB 2A73B 3EROA 2KHSA 4HSPA 1AN8A 1E0BA 3Q6SA 4KJNA 4MHEA 4FF1A 3MVVA 2F0QA 1EFID 4CKCA 4RGNA 3U9OA 5C4XB 4DA2A 1TR5A 3VR4A 1S5FD 2FJ2A 5TSSA 2RSNA 1IW7D 1EY6A 4PQXA 5CV4A 3BZDB 1KLGD 3X3MA 2JEAI 2VXWA 1QG7A 3Q23A 2F0EA 3MEHA 4KD3A 5CR3A 3MAQA 5FKAC 1I6HB 3H6MA 2A68C 1CTMA 2IT1A 2EVBA 1Y1VB 3GTLB 2F0SA 2HQEA 2E74C 1BOSA 4A3JB 1EIHA 2PCFB 3PIP3 2YU9B 2F03A 1DONA 1PMRA 1SYFA 5KNCA 2F0TA 2M9VA 1HRJA 2RQXA 1F9QA 1JQYD 4ODGA 4J1MA 4ULLA 2K01A 4A3MB 5E4WC 2X69A 5IT9E 1PFMA 1BR9A 1Z47A 5NUCA 4IUUA 2F0LA 5JOBA 5A35A 5JPNC 4G4KA 5I2YA 2HDMA 1EZ6A 1Z7TA 2B8FA 4P2CB 2E2HB 2C5CA 3I4NB 1ESRA 1E2WA 1PRTC 1M8AA 3D6CA 2RSOA 1SNDA 1STBA 2K33A 3Q22A 1WTOA 5EJWA 1SYCA 2WAQB 2XWJB 4X3SA 1ML0D 3HZXA 1PZJD 1BNZA 1HTPA 1STEA 1SEBD 1E2ZA 4K5VA 3DEPA 3VR2A 1F9SA 3HP3A 1GUTA 1T5XD 2D5DA 4IN3A 4RHRA 2B8GA 5DAUA 4C3IB 2F0JA 5A2QE 1STAA 1D2BA 1UAPA 5C4ZA 1L0YB 1WTRA 2IW3A 2XVSA 3FMCA 4ZLTF 4HCSA 4BBRB 1XYIA 4XQQA 2J4XA 1OXTA 3OW7A 5A2QL 4BBSB 1S5BD 3I8ZA 4A3IB 4IFDJ 3SXHA 3S16B 3S2HB 3IL8A 1SDFA 3ITPA 3BVGA 3MA2B 1PRTB 3LWEA 5EBDA 4RKLA 4M8AA 3A8JE 3C1EA 5FO8B 2BA1A 2EYOA 1QNUA 5JJZA 1WVLA 2NWGA 5C0XG 2JE6I 3AU7A 1C48A 4KK7A 4IURA 4RCNA 1TS3A 1F9PA 2KEDA 1B1ZA 1JOKA 2E2IB 2LKVA 5HGTA 5JEAG 2EPBA 4JBWA 2EJMA 1B9MA 5G3LF 4NW2A 2SEBD 3H0GB 1JWUD 5E4XA 1G2TA 1I4QA 3ERQA 1RCVD 1GUSA 4C3JG 2KUMA 3ZYYX 1WD0A 4JK1C 4OIJA 4H0LC 3OSOA 4XTCS 1CHPD 2OT2A 3PUXA 3M3YB 2JXMB 2ZXPA 3Q24A 3S1NB 2KCCA 3URYA 2KVMA 4BY1B 3T56B 2ICEC 2F0PA 1O7ZA 2R7ZB 1A2UA 4GZYC 4KTAA 3BS1A 3H09A 5IGBA 2EY6A 3HG9A 3T16A 3I91A 2F0HA 1HUMA 1ZKOA 4DNRB 1EYAA 2MPMA 4V0BA 2EYFA 5CORA 5J22A 4K6LA 4BY7B 3NTIA 2EYJA 3J81E 5KNBA 4PMCA 1TWFB 4RWSC 5EPLA 5EQ0A 5FO9B 4ZK9B 3I4MB 3WOFA 3L7ZC 3S17B 1V8QA 4Z9CB 3NTHA 1HA6A 5IGDA 1D1KA 3DHQA 2ZXRA 1TIID 3TZDA 2VB3X 3J7AF 4C3HG 1RHPA 5I2XA 3NE5B 4XIGS 4K8JA 3GTPB 2CW0D 5CYUA 2BCOA 3ND8A 4DAVA 3BYYB 2B2UA 4A3EB 2M00A 1B44D 5M5WB 1SAPA 2F1MA 3F2UA 1CQFA 3M7NA 4KJOA 2Q8IB 2RVLA 3HOZB 1CM9A 1U4PA 4Q0FA 2MUYA 5JEAH 3PMFA 5M5XB 2L4NA 1LTID 2EXZA 1MD2D 4WFN3 1XX8A 1WCMB 1T5EA 5CMDA 4IFDH 1O80A 4OO1G 5KYIA 4HN7A 5M5YB 3HOWB 1BCPD 2B2UC 3GP7A 2SDFA 4C1NI 3HS0C 2SNMA 1Q12A 1FGBD 3HOUB 5IOCA 2A6HD 1G2SA 5LL6X 1YNND 4RGOS 1Q1BA 1A15A 2K1BA 2KJXA 5CV6A 4FF4A 2EY2A 2JA8B 5CV8A 5M3FB 1DD2A 2R61A 3J7YW 5M9OA 1S5DD 1IYVA 2E75C 3QOLA 1VMPA 5G3LD 4CJ0B 2FHTA 2VNUD 2NUCA 4L63B 5C0XI 1VF7A 4H44C 3ND9A 1DOKA 3TDQA 5FO7B 3R3OA 1XXGA 1X3PA 2Z4IA 2IX3A 4KI0A 1PZKD 2PPBC 3FDTA 5C44B 3V96A 4H7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILQ A;  1AZP A;  2XIW A;  4QUF A;  1LV9 A;  1EIG A;  2X6L A;  4X3T A;  1WTR A;  1WTX A;  1B50 A;  1HUN A;  1CM9 A;  1U4P A;  1G6Z A;  3G7L A;  4HSV A;  2NYZ D;  1J8I A;  1GUW A;  3TN2 A;  1NCV A;  2VXW A;  1QG7 A;  2Q8R E;  3N52 A;  1KNE A;  5D14 A;  2KOL A;  4ZLT F;  4HCS A;  2FFK B;  4XDX A;  5T1I A;  4O42 A;  4CJ0 B;  1XYI A;  2HCI A;  2KVM A;  2L4N A;  1EQT A;  2BDN A;  4HAE A;  3SVM A;  5EKI A;  1XX8 A;  1NR4 A;  2B2Y C;  4LMQ D;  1O7Z A;  1HFG A;  2B2V C;  2N55 A;  4R9W A;  1AZQ A;  1J9O A;  3I8Z A;  5CMD A;  1O80 A;  2HDL A;  2JP1 A;  1EIH A;  4RA8 A;  2K05 A;  1B2T A;  2B2U C;  2SDF A;  4R8I A;  1MI2 A;  1DON A;  1IKL A;  2MP1 A;  4ZKB B;  1DOL A;  5DNF A;  5T1G A;  3FPU B;  3IL8 A;  1SDF A;  3I91 A;  1IKM A;  3I3C A;  3KUP A;  1HRJ A;  2B2T A;  5EPK A;  1RTO A;  5CBE E;  2FIN B;  1HUM A;  2X6G A;  1DZ1 A;  2B2W C;  4CJ2 C;  2MPM A;  1NR2 A;  5COR A;  1F9Q A;  2HUG A;  4MN3 A;  1BO0 A;  1X3Q A;  1G2S A;  2D9U A;  2K01 A;  1F2L A;  4RWS C;  4IUV A;  2L9H A;  1ROD A;  2X69 A;  1TVX A;  2CVR A;  3LWE A;  3MTS A;  4RAU C;  4UAI A;  5COY A;  5E4W C;  3MWY W;  1MSG A;  5AFW A;  5EQ0 A;  2MGS A;  4ZK9 B;  2MJ8 A;  1MSH A;  1PFM A;  1SSO A;  1CA6 A;  2L12 A;  3I90 A;  1X32 A;  1VMC A;  4IUU A;  5D65 A;  4IUQ A;  4OIK A;  2L1B A;  2M2L A;  3H91 A;  1HA6 A;  1A15 A;  1U4L A;  1IL8 A;  1B53 A;  1ZXT A;  2HDM A;  1NAP A;  2K1B A;  3R93 A;  1S4Z A;  5JJZ A;  1WVL A;  1WTW A;  1U4R A;  2EOT A;  1HFN A;  1RTN A;  1Q3L A;  2NWG A;  1F9R A;  4X3U A;  1KNA A;  1AP0 A;  4IUR A;  1QE6 A;  1WTP A;  1HHV A;  1U4M A;  1JE4 A;  2DY7 A;  3TZD A;  1ESR A;  4XT3 B;  3QO2 A;  1F9P A;  2J7Z A;  2KED A;  1DOM A;  3P7J A;  1M8A A;  5EPL A;  3DM1 A;  1QNK A;  2RSO A;  1RHP A;  2H1E A;  2EE1 A;  1EOT A;  4HED A;  3GV3 A;  4DN4 M;  4XT1 B;  1VMP A;  4ZKC B;  1JIC A;  4IUT A;  1E0B A;  3Q6S A;  2FHT A;  2K03 A;  2HCC A;  4MHE A;  4QUC A;  5EJW A;  2EPB A;  1WTO A;  2KEC A;  2B2T C;  1PFN A;  4X3S A;  4ZAI A;  1WTV A;  1ML0 D;  2B2Y A;  3IFD A;  1RJT A;  2B2V A;  5EPJ A;  4U68 A;  1BNZ A;  3UI2 A;  4NW2 A;  1CA5 A;  2DY8 A;  4IUP A;  3ONA B;  3DEP A;  2NZ1 D;  2K28 A;  1BBX C;  1DOK A;  1O7Y A;  2K04 A;  1B3A A;  5E4X A;  3DEO A;  1WD1 A;  1F9S A;  1PDQ A;  1G2T A;  2B2U A;  1X3P A;  2Q8T A;  2FJ2 A;  5CBA E;  2IL8 A;  3HP3 A;  1C8C A;  1PFB A;  1BF4 A;  2L11 A;  1EL0 A;  1WTQ A;  2KUM A;  1SAP A;  4OIJ A;  1G91 A;  1ICW A;  2N88 A;  2FMM A;  2JYO A;  2KEE A;  2RSN A;  4CJ1 B;  3F2U A;  1PLF A;  4X3K A;  1ILP A;  3FDT A;  1MGS A;  3KBX A;  2RA4 A;  2B2W A;  3GV6 A;  1WD0 A;  3D6W A;  2RVL A;  2R3Z A;  1B4O A; 
#chains in the Genus database with same CATH topology
 1G6P A;  4N8F A;  2Z0S A;  1NBW A;  4JI1 Q;  4C3H H;  1SR3 A;  4MTN A;  1J8I A;  1CFM A;  3KLS A;  2DUD A;  3U9S A;  3K0X A;  5KRU A;  1H95 A;  4ZYS A;  3RLN A;  3SK5 A;  4OGQ C;  1L0W A;  3DWP A;  2VB2 X;  5IP9 G;  3MXP A;  2NVX B;  5EKI A;  1EEI D;  1NR4 A;  4DUZ L;  4B08 A;  1IW7 C;  1DYQ A;  3TP5 A;  4UY8 C;  2I0Q A;  3PO2 G;  3S2D H;  2HDL A;  1EIY B;  1SYD A;  1WI5 A;  4F7X A;  3CPW A;  2PQE A;  3BYT B;  4JYA Q;  3DLL A;  4B3R L;  4X66 Q;  2R7D A;  2MP1 A;  3F2D A;  1VCI A;  4LJZ C;  1NSN S;  1GUO A;  4KHV A;  3TZU A;  1FYC A;  1BBW A;  2OTJ A;  2IWH A;  4B3S L;  1K83 B;  2FIN B;  2F4V L;  1H9K A;  2PW5 A;  2CKZ B;  2HUG A;  3CXC A;  4GKK L;  3WWV A;  1LTS D;  4DAM A;  1JWS D;  1LAC A;  1PH8 A;  1EU3 A;  4F8M A;  3C2P A;  4DK6 C;  1W6K A;  4RH6 A;  2A74 C;  4K5X A;  1S3O A;  3OTO L;  1X32 A;  3NBI A;  4IUQ A;  4YCW A;  3STB D;  3C46 A;  1E1O A;  1A0I A;  1CUK A;  4WOR A;  1JWM D;  2WAQ E;  3X3N A;  5F2D A;  4OO1 H;  5I9P A;  1A6X A;  5ELD A;  4DV3 L;  1FJG Q;  4X3U A;  3U58 A;  5I6Y A;  3TS2 A;  1KNA A;  1K8G A;  5JJL A;  3OMC A;  3DM1 A;  3T53 B;  4PV1 C;  1PVO A;  1PH2 A;  3D3R A;  3BG3 A;  1CI3 M;  1JOO A;  4HTH A;  4EGV A;  3IFD A;  2F0I A;  3V2T A;  1NMG A;  5FLX L;  3NHH A;  5AJ3 Q;  2F0K A;  3J80 c;  2H4O A;  3GTM B;  2E76 C;  1SYB A;  1D5M C;  1PFB A;  2V4D A;  3NWS A;  1DCZ A;  3M3Y H;  4CJ1 B;  1QZG A;  3R8B A;  1GJX A;  4BA2 I;  3PGZ A;  1EQQ A;  1O7L A;  2SOB A;  1GXD C;  5C6A A;  1EY0 A;  2WKC A;  3RZD B;  3BVZ A;  3KDF A;  3TN2 A;  4FO2 A;  1V1P A;  3VA7 A;  1TU2 B;  1QJO A;  3D4D A;  1AW7 A;  5FLX c;  3JAM i;  4HIM A;  2EQS A;  2F52 A;  4RGT A;  5BN5 A;  4KHP Q;  3OHX C;  5KYL A;  3TS0 A;  1IBK L;  5ELF A;  4HJ8 A;  3D4R A;  1ZYR D;  3CRL C;  4OWT B;  2BDO A;  2O5J C;  2JP1 A;  2I5H A;  3BVM A;  1STY A;  1TWC H;  1SMY D;  5FLM G;  5HY6 A;  1VQK A;  4LF9 L;  4L8J A;  4JV5 Q;  1OXV A;  2DNC A;  2UUA L;  3S1R H;  4XQJ A;  2NVT H;  4LW1 A;  3R2T A;  2DNE A;  1SN8 A;  1ET9 A;  2XRQ D;  4GLV B;  1SRO A;  3FPU B;  1CZW A;  4PZ8 A;  4JI5 L;  4K5W A;  4OWW B;  3A8I E;  3IRB A;  4V19 0;  3OPO A;  2QF7 A;  2AWO A;  4IUV A;  3CU7 A;  4DAY A;  2VW9 A;  2HT1 A;  3FKI G;  1NTG A;  4K0K Q;  5IP9 H;  4EQP A;  2XWB B;  3TSS A;  2IY5 B;  3B6Y A;  3MXN B;  2EYP A;  4JI6 L;  3T13 A;  4DR3 L;  1BKB A;  1Y1W G;  3GTQ H;  2EJF C;  3K7A H;  1C0A A;  1JE4 A;  3P7J A;  1KAB A;  2D62 A;  2JA7 B;  1SYE A;  1EOT A;  2F0G A;  3CMA A;  2R93 B;  5CC4 A;  4FYD A;  1A2T A;  2EYH A;  1UEA B;  1Q1E A;  2DN8 A;  2KCT A;  3O13 A;  3RR5 A;  5JPM C;  2ENB A;  4ABN A;  2E5L Q;  2B2V A;  2TMP A;  3LWU A;  1LTA D;  4LF8 L;  4RGM A;  1C9O A;  1EUJ A;  1KDA A;  4GKJ L;  3DEO A;  2LMC B;  4HJ5 A;  4C3J B;  1KDB A;  3IFT A;  2F0W A;  2BE5 D;  4A3G B;  3I55 A;  3HKZ B;  1ET6 A;  2CWP A;  2CHB D;  5IGE A;  3HOY G;  2RA4 A;  2B2W A;  2G9D A;  2LFN A;  4IJH A;  4F88 A;  3CCE A;  2LS0 1;  4QUF A;  2VQE L;  1EIG A;  5IGC A;  4XQN A;  1B50 A;  2AQ2 B;  3G7L A;  4HSV A;  2PW7 A;  2CCZ A;  1RKN A;  4CKB A;  4R4C A;  1SRU A;  3J7Z C;  3I4L A;  1UE5 A;  2NTT A;  1K73 C;  2MO0 A;  3Q0A A;  4LMQ D;  5C5L A;  5JJI A;  2B2V C;  4RCO A;  3SK6 A;  3AB9 A;  4DK1 A;  1IZ6 A;  1V1P B;  1HH2 P;  3QB3 A;  2J0T D;  3CD6 A;  2A69 D;  2XSC A;  4K2K A;  1KQS A;  2Q2H A;  5DNF A;  2RCF A;  1Q90 A;  2JA6 B;  4DNI A;  1I4X A;  2B2W C;  1MBY A;  3QG1 A;  4OEM B;  1BO0 A;  1X3Q A;  4MIU A;  1QVF A;  4DF7 A;  3HOX G;  4NDX A;  2N8N A;  2UUC Q;  3D4W A;  3MTS A;  3NWT A;  3KLS X;  2MGS A;  3PUV A;  1TWG B;  3BZC A;  1QCB D;  1VF5 C;  2L12 A;  4KKS A;  2R92 B;  4TKO B;  4K8I A;  1PTO H;  4U67 3;  5C4H A;  3GTO H;  2EY5 A;  4DR4 L;  1IL8 A;  4B3T Q;  3LNN A;  1BCP F;  4RHS A;  3OMG A;  5FLM H;  3CCJ A;  3JAM E;  5C4X G;  3WDN A;  3CCR A;  1HHV A;  4X62 Q;  3CME A;  1WTP A;  2VUM B;  1A3V A;  1TY2 A;  4G57 A;  3K0Y A;  2O4X A;  3C1F A;  2G9H D;  2C9O A;  4L5T A;  2WIN B;  4QY7 A;  1XPU A;  3MXG A;  1JIC A;  2PNH A;  1PH5 A;  4CGY B;  1KRS A;  3E9H A;  3KLW A;  1D5X C;  2CQA A;  2QEJ C;  5EPJ A;  3HEJ A;  1B8A A;  4DAP A;  5LMN Q;  3JAM L;  4L5S A;  5IOD A;  2DY8 A;  1TY0 A;  1IXR A;  2I07 B;  3NSW A;  3MHB A;  4WJW A;  2L15 A;  1EL0 A;  1XTC D;  4IJL A;  3SHL A;  1XWE A;  2B63 B;  1C4Q A;  1ENA A;  2KEE A;  2F0U A;  3S24 A;  2CW0 C;  4A93 H;  1Y1V G;  2EDG A;  1GHK A;  3OOC A;  5LL6 S;  3H3V C;  4A3J G;  5CV9 A;  2PZW A;  3SEB A;  4X3T A;  4CDD C;  1VDZ A;  3MFY A;  3HOV B;  5GAG C;  1NCV A;  2UU9 Q;  2JA5 B;  2MQH A;  2K5V A;  3U50 C;  3BDL A;  2OWO A;  3AQQ A;  2FFK B;  5I4D A;  3ERS X;  3MXU A;  4NMZ A;  4IFD G;  3EJI A;  3K7U C;  1JOR A;  3DWQ A;  1K83 H;  4YHH L;  1VQN A;  1HTL D;  1D5Z C;  4A3M G;  1K3R A;  1J9O A;  1SE3 A;  4AIM A;  1STN A;  4BWG B;  3SR1 A;  3CHB D;  3KF6 A;  2DGY A;  1JR0 D;  1AFP A;  2E2J H;  1MI2 A;  3A7L A;  4DV6 L;  1UNS A;  1X3G A;  3TP7 A;  1IKM A;  1HA5 A;  3NXW A;  5EPK A;  3CC4 A;  4R8N A;  3BU2 A;  1YJN A;  5EKL A;  3PSI A;  5LMU Q;  2F0O A;  5DEH A;  2NB0 A;  1EEF D;  1EY7 A;  1BCP C;  4NXM L;  1TWH B;  4X65 Q;  3M7G A;  2XNA C;  1GOZ A;  1HZC A;  4C2M H;  4OIK A;  3UDF A;  2WAQ G;  3QWN A;  5BN4 A;  2ZTC A;  1QWY A;  1B53 A;  3PO3 B;  1S4Z A;  4MTK A;  4FXK C;  2Q2I A;  4MNO A;  4XYQ A;  1N36 L;  4L5R C;  4ZUI A;  4DR5 L;  2A6H C;  3FP9 A;  2GA4 B;  3K6O A;  3VA5 A;  4CBV A;  2R6G A;  1SNP A;  1YNN C;  2B3G A;  3VDY A;  1N33 Q;  2EYM A;  2NVQ H;  3GTM H;  4OL7 A;  3NQI A;  1BVS A;  1SLJ A;  3K58 A;  1U9R A;  3TRE A;  1PFN A;  1ENC A;  3HOX H;  2K5W A;  2PMZ B;  1R9T H;  4DUY L;  1J6Q A;  2K28 A;  2EY1 A;  2MHV A;  4A3K B;  1HPC A;  4IPC A;  3A8K E;  4IAL A;  2NN6 G;  4OHJ A;  4DV5 L;  1C8C A;  4BBR G;  4DV0 L;  1IBL Q;  4DFA A;  3NBH A;  5GAE C;  3A5U A;  5C4X H;  1Y8O B;  1UWV A;  4QIW B;  3D6W A;  2QIL A;  3K80 C;  3CF5 A;  2D2C C;  3AYH B;  3BZK A;  1G29 1;  1GUW A;  4ALP A;  4QMG A;  1YBY A;  1I4R A;  3J80 i;  2BH2 A;  1IBM Q;  1M90 C;  1CSQ A;  5D3I B;  2RHQ B;  1TWA B;  4LAA A;  4DV7 L;  3PO2 B;  3M4O B;  3A54 A;  4JI2 Q;  1BCP B;  1EYD A;  1HZB A;  1KL9 A;  1TXY A;  3M9B A;  2N78 A;  2F0M A;  3MZ5 A;  1LT4 D;  4RA8 A;  2K05 A;  3LGJ A;  1PYS B;  1Q8I A;  2F0V A;  4R8I A;  1I6H H;  5M3M B;  1MHW C;  2Z4H A;  1Y1V H;  3GTL H;  4GLA C;  4HMJ A;  5T1G A;  1HNX L;  3CC2 A;  4A3J H;  1FNU A;  4KY5 A;  2VQF L;  3D31 A;  1DM0 B;  2YU9 H;  4JI7 L;  1KC8 C;  4XYO A;  2WV6 D;  3PF5 A;  3K57 A;  1I3Q B;  2BOS A;  2UUA Q;  5FOB B;  4RKB A;  3K59 A;  1F2Y A;  4JI8 L;  4KY7 A;  5GAD C;  1WFQ A;  1FL0 A;  2MJ8 A;  3DMU A;  4EQN A;  1TS5 A;  1X56 A;  1A3U A;  4RFB A;  1SJH D;  4A3M H;  1NAP A;  2K5Q A;  1V43 A;  1U4R A;  2R93 H;  4ILW A;  1QZH A;  1EYC A;  1Q3L A;  1NY4 A;  3H0G G;  3PUW A;  4IOA A;  3VR6 A;  4LF7 L;  5I9O A;  1JB7 A;  1EY4 A;  5D3D A;  4ZRZ A;  2J7Z A;  4BA1 I;  2D0P A;  1UE7 A;  1XPO A;  3CKI B;  4A76 A;  4DN4 M;  2E2H H;  3STB C;  1BBU A;  5GRO A;  4ZAI A;  3I4N H;  3EBE A;  4IPD A;  4A3G H;  2IHE A;  2UXC Q;  1O78 A;  3I73 A;  5FJ8 H;  1MKH A;  2RDG A;  4LF5 L;  3GTJ B;  1O7Y A;  3EQL C;  5C3E B;  3LX0 A;  3K5O A;  2PYK A;  2HHH L;  2IL8 A;  1LTB D;  4KMU C;  3RUZ A;  1K9M C;  1SBB B;  1SNC A;  2ZTD A;  4OX9 L;  3IAY A;  1ILP A;  1CT1 D;  1EWI A;  5JAV A;  3S1Q B;  2GVA A;  5L37 A;  4APV A;  5DLQ E;  3RLF A;  1N32 Q;  1BDO A;  1KDC A;  1LTL A;  5E1F A;  3I72 A;  3SDZ A;  2X6L A;  2AUJ D;  4C3I H;  5C4J B;  1O7I A;  1N8R C;  4LFA L;  3NBH B;  1VQC A;  1OXX K;  4DV1 Q;  1LUZ A;  4XDX A;  2NBF A;  3KJP A;  5HUR A;  4A3F B;  2FXQ A;  1KAW A;  3PV0 A;  1K8A C;  5J39 A;  4ME3 A;  1OXS C;  4K2L A;  3M4Y A;  1I94 L;  1PA6 A;  2NN6 H;  2WB1 B;  4Y7N B;  4BBR H;  4DV2 L;  5JVH 3;  3I4M G;  2N49 A;  1UE1 A;  4BBS H;  3NQT A;  1IKL A;  3WOE A;  3OIP A;  4ZCK A;  1G51 A;  4A3I H;  1TWG H;  4IFD I;  3T4A C;  3KUP A;  3NP8 A;  3HGB A;  2R92 H;  1AH9 A;  2VL6 A;  3EA6 A;  1EQV A;  3H94 A;  1ZYR C;  5K36 H;  3T1H L;  2ZM6 L;  4O0A A;  5BN3 A;  3S16 H;  3S2H H;  1F2L A;  3FKI B;  5H1S E;  2WII B;  1PTO D;  4K6D A;  1ROD A;  4GN5 A;  1SMY C;  5COY A;  2JN4 A;  1MSH A;  1LLR D;  2VUM H;  4R4O A;  2L1B A;  4HJA A;  2M2L A;  3H91 A;  1RF2 D;  3TME A;  1Y1W B;  2EOT A;  4POG A;  3J80 E;  1E7Z A;  3AMU A;  4X64 Q;  2QW7 A;  1J5E Q;  3MXN A;  3G6J B;  3TP6 A;  1EZ8 A;  3K5L A;  4AH6 A;  3I70 A;  1U4M A;  1YIT A;  2YTX A;  4H13 C;  2H1E A;  2EE1 A;  2IPK D;  2A6E D;  5DM6 3;  1PZI D;  4XT1 B;  2K50 A;  3HKZ E;  4K14 A;  1XNR L;  2HCC A;  2K6A A;  1V1O A;  2RCN A;  1D1I A;  2CQO A;  4LFC L;  3J80 L;  3W5O A;  3MFG A;  1H9R A;  1CA5 A;  3J7A V;  2E2I H;  1R4P B;  5FLX E;  3KF8 A;  2K32 A;  2F3V A;  1Y8N B;  4DR7 L;  2KA7 A;  2FMC A;  3HOV H;  3S9W A;  1HJP A;  5IE8 A;  4N8X 1;  3HOY B;  3H0G H;  1PLF A;  2HIV A;  3GTG B;  1SMX A;  3L9A X;  1GD7 A;  4I7A A;  2UXD L;  1FNW A;  3EFX D;  2RKS A;  5IYD H;  4GNX A;  1VQM A;  1XMO Q;  2ICI A;  1D7Q A;  2AQ1 B;  2KBN A;  4Q5V A;  3EN2 A;  5EGT A;  5IWA Q;  2UUB Q;  4FDB A;  2BE5 C;  4DR6 Q;  5T1I A;  3C3L A;  4RG1 A;  1STG A;  1XMQ L;  2MFI A;  2Z1C A;  2N3S A;  4HAE A;  1QOH A;  5DM7 3;  4I65 A;  1GUN A;  4HID A;  1GKH A;  2ZXO A;  4AQY Q;  3E0J A;  2SNS A;  1IHZ A;  1PYB A;  1FVI A;  2OEO A;  1D8L A;  3S1N H;  1SFO B;  3OW2 A;  2LSS A;  4NKL A;  4BY1 H;  1LTG D;  1EY5 A;  2JK8 A;  4ZKB B;  2R7Z H;  1PHJ A;  1DOL A;  1YNJ D;  1VQ5 A;  3KBG A;  1TWH H;  3CCM A;  4IO9 A;  4YIJ A;  2JA8 G;  1DZ1 A;  3NEN A;  4G7H C;  2XN9 C;  5M3F G;  3NEL A;  4MN3 A;  2Y0S B;  1P16 A;  1WTQ A;  4GNX C;  1TVX A;  2QDL A;  3D8G A;  1TS2 A;  2PNR C;  1YHB A;  2A69 C;  4CDE C;  4BY7 H;  5ELE A;  3KYH C;  1U4L A;  1PRT F;  1TWF H;  1Q8K A;  1ONL A;  5CV7 A;  4YY3 Q;  1IL2 A;  1OO9 B;  2BA0 A;  5KIX A;  1H9J A;  1GHJ A;  4NXM Q;  3H3V H;  3I4M H;  2CH4 W;  1XJV A;  3J7A 5;  3S17 H;  1L0X B;  3GTK B;  1H9S A;  4TQU S;  2L5T A;  3CC7 A;  4TSS A;  4B9X A;  1NE3 A;  2L0C A;  3E0E A;  4OO1 I;  1LYL A;  3IKJ A;  1OTC A;  3GV3 A;  4YWM A;  1WTV A;  1PXU A;  1SNO A;  3F2B A;  1VQL A;  1CQV A;  2ID0 A;  3F1Z A;  4AYB G;  3GTP H;  1R4Q B;  1B3A A;  2RHS B;  1QB5 D;  1BF4 A;  3L0O A;  4A93 G;  2G5D A;  2FMM A;  4FF2 A;  2AMC B;  4NXN Q;  1MGS A;  4G7Z C;  4A3E H;  3GV6 A;  2Q2U A;  1N34 Q;  5M5W H;  1AZP A;  2XIW A;  3KF8 B;  2R7F A;  5ELC A;  4CKE A;  5CGK A;  1CZG A;  2Q8R E;  4PG3 A;  2PQA A;  5ELB A;  3HOZ H;  4JI0 L;  2HCI A;  5JVG 3;  1EQT A;  3SVM A;  5K5P A;  2PI2 A;  1SJE D;  2WP8 J;  1Y8P B;  2VS1 A;  1AZQ A;  4GNX B;  2IHF A;  3CW2 C;  3ER0 A;  2EZV A;  3KK7 A;  1ESF A;  5M5X H;  5BR8 L;  1KRT A;  2UXB L;  3S14 B;  1X6O A;  1F2M A;  3A55 A;  4ID6 A;  3QJY A;  3UE1 A;  3RN5 A;  1LT6 D;  2NZO A;  4DGZ A;  3KJO A;  1OXU A;  1WCM H;  3S1M B;  1IYJ B;  4LUV A;  3MC0 B;  2IJ0 A;  4UP8 A;  5M5Y H;  2B2T A;  1RD9 D;  3OWE B;  5CBE E;  3HOW H;  1Q82 C;  2OF1 A;  4G7O C;  1JE5 A;  2KQ3 A;  5IT9 L;  1TQO A;  2TSS A;  4C1N K;  3TRZ A;  1AE2 A;  1JT8 A;  1LT5 D;  4I7Z C;  5JJK A;  4RAU C;  4UAI A;  4UDU C;  5AFW A;  3HOU H;  4DXG A;  1SSO A;  1CA6 A;  4B3M Q;  4A3D B;  2L55 A;  4YWK A;  5IY0 A;  4F87 A;  1G8Z D;  3FRP B;  2NVY B;  4X6A H;  2PMZ E;  2HQL A;  4P71 A;  3UDX A;  1K8M A;  3KOJ A;  4JI1 L;  1AP0 A;  1SE4 A;  3NEM A;  1I50 B;  4N9T A;  4A3B B;  1QNK A;  3CRK C;  5C0X J;  5C3E H;  5IT9 c;  3DXJ C;  2K4K A;  2JA8 H;  5M3F H;  1VS0 A;  2KEC A;  2B2T C;  3CP0 A;  4QIW E;  3VYT A;  1H9S B;  4IUP A;  3ONA B;  4A3L H;  3ULP A;  3SK4 A;  3S1Q H;  5JEA J;  3E5S A;  1WD1 A;  4P73 A;  4JYA L;  2Q8T A;  5KND A;  3OIQ A;  1BXT A;  2L11 A;  4DV4 Q;  4FXG C;  3DUZ A;  2F0N A;  3UDI A;  5C4J H;  4C3H B;  2AKW B;  2JYO A;  1EIF A;  3KFU A;  3TBI B;  1PYW D;  4XXE A;  2O5I C;  1ZEQ X;  2A68 D;  3BDC A;  2K5H A;  1KD1 C;  3R2I A;  2PO4 A;  4JOI A;  1XNQ Q;  1HR0 Q;  2HHH Q;  3OWF A;  1HCZ A;  4ZUJ A;  3GD7 A;  1F2Z A;  1IYU A;  1YVC A;  3A7A B;  4O1N A;  5KGU A;  5C44 H;  1VQI A;  4Y7N H;  4LK1 C;  3UDG A;  3S2D B;  3N52 A;  1EY9 A;  1TT2 A;  1Y69 U;  4NB3 A;  4O42 A;  1NMF A;  1HZ9 A;  2OQ0 A;  1Z6H A;  4R9W A;  1FJG L;  1JOQ A;  3EIV A;  3PQI A;  5C3X A;  5CV5 A;  2PQA B;  2NVX H;  1HNW Q;  2AQ3 B;  1UEB A;  2K5D A;  1I4P A;  4RMF A;  3VR5 A;  2ZJR A;  1XPR A;  1HNZ Q;  3A0J A;  1Q46 A;  2DJG C;  4LF4 Q;  2VZA A;  4FNF A;  4JOI C;  5AJ3 L;  4KY6 A;  4HMI A;  1TKW B;  1BQQ T;  3UE0 A;  2JA7 G;  1PRT D;  4YCV A;  2R93 G;  3I90 A;  1EWH A;  3RLO A;  3R93 A;  1AE3 A;  4ZQ3 A;  4HIO A;  1YIJ A;  4DNT B;  5EBC A;  1RTN A;  4DUZ Q;  2Z8L A;  1F9R A;  1I4G A;  1KTK A;  4KLK A;  3QO2 A;  1DOM A;  4B3R Q;  3I4N G;  4A3G G;  4KN7 C;  4P72 A;  4B3S Q;  5FJ8 G;  3DWA A;  4IUT A;  2K03 A;  4KHP L;  1GO3 E;  3K5N A;  2F4V Q;  1K8O A;  3NTK A;  1L1O A;  1PTO F;  4GKK Q;  3VYS A;  4EQO A;  4JC0 A;  3A74 A;  4OON A;  3L3O C;  2MO1 A;  4LFB L;  5LHY 1;  3RMH A;  4JV5 L;  1CSP A;  3OTO Q;  3T1Y L;  5IYC G;  2AWN A;  1G91 A;  2N88 A;  1F77 A;  1E2V A;  1VQ9 A;  2WAC A;  4X3K A;  4A4I A;  1JCK B;  4C3I G;  5IGG A;  2KCN A;  4DV3 Q;  1LV9 A;  2WB1 E;  1HUN A;  4LF6 L;  1SNQ A;  4M1U B;  2RDF A;  4K0K L;  3NPP A;  3G4S A;  2QDB A;  1KNE A;  2KOL A;  4L5Q A;  1TWC B;  2BDN A;  1JB3 A;  3RZD H;  2JQO A;  1UUP A;  3S1R B;  1L1O C;  2OXP A;  2NVT B;  2N55 A;  4UPA A;  4BBS G;  2IX1 A;  5IIF A;  1LTT D;  4R4T A;  1EU4 A;  3S15 B;  4A3I G;  1KLU D;  4J8Q A;  5J1Z A;  3CAM A;  2R92 G;  1XMQ Q;  1SYG A;  4DK0 A;  4PNY A;  3L2P A;  5K36 G;  1I4H A;  1A3T A;  2RF4 A;  3J81 L;  4N9P A;  2JSO A;  5FK9 C;  3V05 A;  3NK9 A;  1DXM A;  4CJ2 C;  2E5L L;  4FF3 A;  4WRD A;  3QR8 A;  1LO5 D;  4KV6 A;  2VUM G;  3F2C A;  4EVO A;  4HR7 B;  1CHQ D;  3A5Z B;  3MWY W;  1MSG A;  2CFM A;  1EFW A;  2ES2 A;  1H9M A;  3GDE A;  3GTQ B;  2B39 A;  2PZT A;  3P75 A;  3K7A B;  2MNA A;  3CCQ A;  1LT3 D;  2F4I A;  1ENF A;  3T51 B;  2HIX A;  1IBK Q;  3TQY A;  1MIU A;  1HQR D;  5IP7 G;  3K81 C;  4NP5 A;  4DXF A;  2OCE A;  1PTO C;  3CCL A;  3J81 c;  1II3 A;  4LF9 Q;  5C0X H;  1NUC A;  2AUK A;  2B63 G;  1D6E C;  1M4V A;  4JI4 L;  1UE6 A;  4HED A;  4NPS A;  4ZKC B;  1RDP D;  1LAB A;  4QUC A;  1B3Q A;  3SE0 A;  4JI5 Q;  5HGQ A;  1WOC A;  2B2Y A;  2PZU A;  1YI2 A;  3PUY A;  1GUG A;  2JA7 H;  4A75 A;  3RN2 A;  1BBX C;  3HOV G;  2K04 A;  2IX0 A;  3JC6 6;  2ATW A;  5CBA E;  4PMB A;  1HXY D;  3M85 A;  2A6E C;  2EJG C;  3FPP A;  4E6I A;  1L1O B;  2O2L D;  3HKS A;  4CHT B;  5IYD G;  4JI6 Q;  5J3B A;  3P20 A;  4DR3 Q;  4C3J H;  1QIL A;  4FP5 D;  2R3Z A;  1B4O A;  3G71 A;  2WKD A;  2EYL A;  2YYZ A;  4QF4 A;  2UUC L;  1G6Z A;  5ISR A;  1X65 A;  5D14 A;  4TVA B;  4TRD A;  2XRS D;  4KKT A;  4B3T L;  5C5M A;  2QCP X;  2Z6K A;  1PV4 A;  4BY1 G;  2B2Y C;  1HFG A;  4LF8 Q;  1EWC A;  2Y0S E;  2NTS A;  1TS4 A;  2R7Z G;  1DJR D;  4X62 L;  4GKJ Q;  1FGU A;  5IYC H;  3ZJY C;  1AEX A;  1FNV A;  1BUV T;  4UP7 A;  3PO3 G;  3EVQ A;  1SE2 A;  4A3D H;  3I3C A;  3BDO A;  1RTO A;  3QIA A;  2UXB Q;  4BS9 A;  5LMN L;  2F3W A;  1PTO B;  3GTO B;  1VQE A;  2VQE Q;  4BY7 G;  1GVP A;  1EY8 A;  4DR2 L;  2JA6 H;  1S5C D;  2EXD A;  4DPG A;  3GQB A;  1YNJ C;  4A3B H;  1ZXT A;  3H15 A;  1B70 B;  4QB4 A;  1WTW A;  4DU9 A;  4KHZ A;  1EOV A;  2Z6K C;  4FVM A;  5EKK A;  2ZT9 C;  3RZO B;  2RBM A;  1HR0 W;  3W3A A;  1LTR D;  2A5H A;  5LMN W;  3PUZ A;  4XT3 B;  2GVB A;  5E3F A;  1Q7Y C;  4IZ8 A;  3PIO 3;  2UU9 L;  4GOP B;  2ALY B;  1STH A;  4L6T B;  1M1K C;  1RJT A;  1A8V A;  4U68 A;  4AYB B;  3UI2 A;  4KN4 C;  4P74 A;  1VQH A;  2NZ1 D;  1CK1 A;  3VR3 A;  4A93 B;  1W6J A;  1PDQ A;  3VYU A;  5GAH C;  4J15 A;  1NJI C;  1JJ2 A;  3FVQ A;  3NUC A;  4A3E G;  3W2D A;  2F0F A;  1K0S A;  3GO5 A;  3K8A A;  1ICW A;  4DR4 Q;  4J6H A;  2JEB I;  5IP7 H;  3CQZ B;  3KBX A;  4DR1 L;  1PH1 A;  4IPH A;  4C56 C;  1KHI A;  1ILQ A;  2LXK A;  1B9N A;  3K5M A;  5LMU L;  3HOZ G;  4GN4 B;  2B63 H;  5KEE A;  2OQK A;  1WTX A;  1SXT A;  3PF4 A;  2KHI A;  5M3M G;  2NYZ D;  1S5E D;  2K5N A;  3FEW X;  4B9W A;  4X65 L;  2QEX A;  3QOJ A;  1SNM A;  1FR3 A;  3E6Z X;  2E2D C;  1PH3 A;  2E2J B;  4S3S A;  4KD4 A;  1HQM C;  2LY7 A;  2JA5 H;  2QKI C;  4IUN A;  4KKU A;  4P75 A;  1E24 A;  1I6V C;  1WCM G;  3A56 A;  1ASZ A;  5I6W A;  4PMW A;  4IQZ A;  1B2T A;  1N33 L;  4QGU A;  1YJW A;  3HOW G;  4FXD A;  2CWA A;  1VQG A;  1FD7 D;  3N6R A;  5IYB H;  1JC7 A;  2NN6 I;  5C3W A;  3SK8 A;  3OYY A;  2X6G A;  1MJE A;  2F0D A;  1NR2 A;  3HOU G;  2A19 A;  2C35 B;  4C2M B;  2D9U A;  2I46 A;  4YCU A;  2H5X A;  3KLR A;  3D0F A;  4HCE A;  5IGF A;  2L9H A;  3HRZ C;  2CVR A;  4ME5 A;  3VYR A;  1KAA A;  2K7V A;  4QCL A;  1VQ7 A;  1VMC A;  1IBL L;  3I7F A;  5D65 A;  1YJ9 A;  1Z9F A;  4R4Q A;  1YZ6 A;  2RDH A;  2NVQ B;  4YHH Q;  1HFN A;  3RD4 A;  3ULJ A;  5C3E G;  3TP8 A;  1QE6 A;  2DY7 A;  3PO3 H;  3P1H A;  3HOX B;  1R9T B;  2A73 B;  3ERO A;  1IBM L;  4DV6 Q;  2KHS A;  4HSP A;  4QL5 A;  2CH4 A;  1VQA A;  1AN8 A;  1E0B A;  3Q6S A;  4KJN A;  4MHE A;  4A3L G;  2ASB A;  4FF1 A;  3M4Q A;  1A62 A;  3MVV A;  2F0Q A;  4HJ9 A;  1EFI D;  4CKC A;  4CDC C;  4RGN A;  3U9O A;  4LUZ A;  1PH4 A;  2B29 A;  4JI2 L;  5C4X B;  4DA2 A;  1TR5 A;  3VR4 A;  1PFS A;  1S5F D;  4POF A;  2FJ2 A;  5TSS A;  4A3F G;  1PH7 A;  3PIO A;  1KXL A;  1P8L A;  2RSN A;  4A3C H;  4A3K H;  2HD3 A;  4GS3 A;  1IW7 D;  1N36 Q;  4QQB X;  4DR5 Q;  5C44 G;  2WB1 G;  4LFB Q;  1EY6 A;  4PQX A;  1VQ6 A;  3T1Y Q;  1C7Y A;  5CV4 A;  3BZD B;  3M4P A;  1KLG D;  2VY3 A;  3X3M A;  4UHV A;  2JEA I;  2VXW A;  1QG7 A;  4R1J A;  3S15 H;  3Q23 A;  2F0E A;  3MEH A;  4KD3 A;  4WJ4 A;  2PI2 E;  5CR3 A;  3MAQ A;  5FKA C;  1I6H B;  3H6M A;  3CCV A;  2A68 C;  2E8G A;  4LF6 Q;  1CTM A;  2IT1 A;  3CCU A;  2EVB A;  1Y1V B;  4DUY Q;  3GTL B;  2F0S A;  2HQE A;  2E74 C;  1BOS A;  4A3J B;  1EIH A;  4HIK A;  1TWA H;  2PCF B;  3PIP 3;  2YU9 B;  4DV5 Q;  2BH8 A;  2F03 A;  2Z6B A;  1DON A;  4DV0 Q;  3PO2 H;  3M4O H;  1PMR A;  1SYF A;  4DK3 C;  5KNC A;  2YV5 A;  4LWC A;  2F0T A;  2M9V A;  2K75 A;  1HRJ A;  2RQX A;  2UXC L;  1F9Q A;  1JQY D;  4ODG A;  5M3M H;  1V9P A;  4J1M A;  4ULL A;  1CKN A;  2K01 A;  3PCO B;  4A3M B;  5E4W C;  2X69 A;  5IT9 E;  1PFM A;  1BR9 A;  1Z47 A;  5NUC A;  4IOC A;  4IUU A;  2F0L A;  5JOB A;  5A35 A;  5JPN C;  1I3Q H;  4G4K A;  5I2Y A;  2HDM A;  1EZ6 A;  4DV7 Q;  2OTL A;  1Z7T A;  2B8F A;  4EQ5 A;  4P2C B;  2E2H B;  1N32 L;  2C5C A;  1QVC A;  1HZA A;  3I4N B;  1ESR A;  1E2W A;  1PRT C;  1M8A A;  2I5L X;  1VQB A;  2RSO A;  3D6C A;  1A63 A;  1JJC B;  1SND A;  3H3V I;  4DV1 L;  1GM5 A;  1STB A;  2K33 A;  1HNX Q;  4JI3 L;  3Q22 A;  1WTO A;  5EJW A;  1SYC A;  2ZJQ A;  2VQF Q;  2WAQ B;  2XWJ B;  4X3S A;  1KIX A;  1ML0 D;  3HZX A;  1PZJ D;  1B7Y B;  1BNZ A;  1HTP A;  1STE A;  1YNX A;  1SEB D;  4JI7 Q;  1E2Z A;  4K5V A;  3DEP A;  1WTH A;  4JI4 Q;  3VR2 A;  1F9S A;  4JI8 Q;  3HP3 A;  3DM3 A;  1GUT A;  1T5X D;  2D5D A;  1U5K A;  4IN3 A;  4RHR A;  3J81 i;  5ELN A;  2B8G A;  5DAU A;  2KHJ A;  4C3I B;  3GTJ H;  2Z9H A;  1Q86 C;  2F0J A;  3KDF B;  5A2Q E;  1STA A;  1D2B A;  1UAP A;  5C4Z A;  4LF7 Q;  1L0Y B;  3SGI A;  1WTR A;  2IW3 A;  2XVS A;  3FMC A;  4ZLT F;  4HCS A;  4BBR B;  1XYI A;  4XQQ A;  2J4X A;  4X66 L;  1OXT A;  3OW7 A;  5A2Q L;  4BBS B;  2Y0S G;  4X64 L;  1S5B D;  3I8Z A;  4H02 A;  4A3I B;  1W2B A;  4LF5 Q;  1J5E L;  4IFD J;  1T9H A;  3AFQ A;  3SXH A;  4A3F H;  1QVG A;  3E3X A;  3S16 B;  3S2H B;  1LM0 A;  3IL8 A;  1SDF A;  1X3E A;  3ITP A;  4OX9 Q;  3BVG A;  4DAY B;  4JPB W;  3TEH B;  2GN5 A;  1VQD A;  3MA2 B;  2JJQ A;  2P5Z X;  1PRT B;  3RZO H;  3LWE A;  5EBD A;  4RKL A;  4M8A A;  4LFA Q;  3A8J E;  3C1E A;  3PIP A;  4O2D A;  1K3B C;  5FO8 B;  2BA1 A;  2EYO A;  4PZ7 A;  2ZJP A;  1QNU A;  3FKI H;  5JJZ A;  1WVL A;  4JBK A;  2NWG A;  4DR2 Q;  1CKN B;  5C0X G;  3W1G A;  2JE6 I;  1Q81 C;  3AU7 A;  1I94 Q;  1C48 A;  4KK7 A;  4IUR A;  4RCN A;  4DV2 Q;  1XMO L;  1TS3 A;  3J81 j;  1F9P A;  1Y1W H;  2KED A;  1CKO A;  1B1Z A;  5IWA L;  2UUB L;  2QA4 A;  1YHA A;  4DR6 L;  1JOK A;  2E2I B;  2LKV A;  5HGT A;  5JEA G;  4CDF C;  4GLX A;  2EPB A;  4JBW A;  2EJM A;  3FHW A;  3BJU A;  1B9M A;  3W1B A;  4AQY L;  5G3L F;  3T1H Q;  2ZM6 Q;  2WFW A;  2SEB D;  4NW2 A;  1I5F A;  3RNU A;  3CQZ H;  3H0G B;  1JWU D;  5E4X A;  1V1Q A;  3JAM c;  1G2T A;  1I4Q A;  1Y14 B;  3ERQ A;  1RCV D;  4UP9 A;  1GUS A;  4BXX G;  4C3J G;  2KUM A;  3ZYY X;  1W3S A;  3HKZ G;  1WD0 A;  4JK1 C;  4OIJ A;  4H0L C;  3OSO A;  4XTC S;  3HOY H;  1CHP D;  2OT2 A;  1X9N A;  3GTG H;  3AEV A;  3PUX A;  3M3Y B;  2JXM B;  2ZXP A;  3Q24 A;  3S1N B;  4DR1 Q;  2KCC A;  3URY A;  1XNR Q;  2KVM A;  1XTD A;  4BY1 B;  1X55 A;  2ICE C;  3T56 B;  2F0P A;  4YY3 L;  1CKM A;  4LFC Q;  4Y52 H;  3CPF A;  1O7Z A;  2R7Z B;  1A2U A;  4GZY C;  1X3F A;  4KTA A;  3BS1 A;  3H09 A;  4A3D G;  5IGB A;  2EY6 A;  3HG9 A;  4QJF A;  4DR7 Q;  4YWL A;  3T16 A;  2KCM A;  3I4O A;  1SFO H;  3I91 A;  2F0H A;  5GQO A;  1HUM A;  1YEZ A;  1ZKO A;  3MEF A;  4OWX B;  4DNR B;  1S40 A;  2JA6 G;  1EYA A;  2MPM A;  4V0B A;  2EYF A;  5COR A;  5J22 A;  4K6L A;  4BY7 B;  3NTI A;  1WYD A;  2EYJ A;  3J81 E;  5KNB A;  4PMC A;  2UXD Q;  1TWF B;  4RWS C;  5EPL A;  4A3B G;  2AHO B;  1YHQ A;  5EQ0 A;  5FO9 B;  4ZK9 B;  3I4M B;  1JMC A;  3WOF A;  3L7Z C;  3S17 B;  1VQJ A;  1V8Q A;  4IPG A;  4Z9C B;  3NTH A;  1HA6 A;  4OXP A;  5IGD A;  4HJ7 A;  1D1K A;  4NXN L;  1VQO A;  1NNX A;  2A1A A;  2EIF A;  5ELO A;  3DHQ A;  4AYB E;  1N34 L;  2ZXR A;  1E3P A;  3F8T A;  1TII D;  1VQ4 A;  3TZD A;  2VB3 X;  3J7A F;  4C3H G;  1RHP A;  5I2X A;  1RIP A;  3NE5 B;  4XIG S;  4K8J A;  2XTI A;  3GTP B;  3GTK H;  3I2Z A;  2CW0 D;  1K0R A;  5CYU A;  4JVZ A;  2BCO A;  4GOP A;  1QUQ A;  3E9I A;  4LUO A;  4DKA C;  3ND8 A;  3ICE A;  4DAV A;  3BYY B;  2B2U A;  4A3E B;  2YTV A;  2M00 A;  1ICF B;  1B44 D;  1VQP A;  5M5W B;  1E22 A;  1SAP A;  2F1M A;  2K14 A;  2D0O A;  3F2U A;  1CQF A;  3M7N A;  4KJO A;  2KEN A;  3I56 A;  1EYG A;  2Q8I B;  2RVL A;  3CCS A;  3HOZ B;  2QGQ A;  1CM9 A;  1U4P A;  4Q0F A;  2MUY A;  5JEA H;  4B3M L;  3PMF A;  2JA5 G;  5M5X B;  1X54 A;  2L4N A;  3KF6 B;  1LTI D;  1E1T A;  1MD2 D;  1DGS A;  2EXZ A;  4WFN 3;  2Q2T A;  1XX8 A;  3HFZ B;  3ULL A;  1WCM B;  1T5E A;  2I5M X;  2K52 A;  4GOP C;  5CMD A;  3G48 A;  4IFD H;  1O80 A;  4GN3 B;  4JCV E;  5KYI A;  4HN7 A;  5IYB G;  4OO1 G;  5M5Y B;  3HOW B;  4BXX H;  1BCP D;  1RL2 A;  2B2U C;  3GP7 A;  2SDF A;  3G6E A;  1PH6 A;  1ASY A;  1JJG A;  4C1N I;  3HS0 C;  3U4Z A;  1S72 A;  2A8V A;  2SNM A;  1Q12 A;  1FGB D;  3HOU B;  3S14 H;  3AFP A;  1PH9 A;  4JG2 A;  1K28 A;  4EX5 A;  4R4I A;  5IOC A;  2A6H D;  1G2S A;  2V1C C;  4JBJ A;  3S1M H;  2F3I A;  5LL6 X;  1YNN D;  4RGO S;  1Q1B A;  4DV4 L;  4JI0 Q;  4JW0 A;  1A15 A;  2K1B A;  2KJX A;  5CV6 A;  2NZH A;  1L2F A;  1WJJ A;  3Q8D A;  5E7N A;  1EQR A;  4FF4 A;  2EY2 A;  4OEL B;  2JA8 B;  2DJF C;  1XNQ L;  1HR0 L;  5CV8 A;  5M3F B;  1DD2 A;  1U0L A;  5BR8 Q;  2R61 A;  3J7Y W;  5M9O A;  5EAY A;  1S5D D;  2NVY H;  1IYV A;  1VQ8 A;  2E75 C;  3QOL A;  1VMP A;  5G3L D;  4CJ0 B;  2FHT A;  4LNQ A;  2LXJ A;  2NUC A;  4MZ9 A;  2VNU D;  4L63 B;  1MJC A;  1N9W A;  1I50 H;  2ZTE A;  3U4V A;  5C0X I;  2XGT A;  1VF7 A;  4H44 C;  3ND9 A;  1DOK A;  4WJ3 M;  3TDQ A;  5FO7 B;  3R3O A;  1XXG A;  4PZ6 A;  4A3C G;  1HNW L;  1X3P A;  4JI3 Q;  4A3K G;  4JBM A;  2JA9 A;  2YTY A;  1VQF A;  2Z4I A;  2IX3 A;  1HNZ L;  4KI0 A;  1PZK D;  1SE8 A;  2PPB C;  3FDT A;  5C44 B;  3V96 A;  1QUQ B;  4LF4 L;  4H7B A; 
#chains in the Genus database with same CATH homology
 1J8I A;  1CFM A;  3KLS A;  3U9S A;  5KRU A;  4ZYS A;  3SK5 A;  4OGQ C;  3DWP A;  2VB2 X;  2NVX B;  3MXP A;  5EKI A;  1EEI D;  1NR4 A;  4B08 A;  1IW7 C;  1DYQ A;  3TP5 A;  2HDL A;  1SYD A;  4F7X A;  2PQE A;  3BYT B;  2MP1 A;  1VCI A;  4LJZ C;  1NSN S;  1GUO A;  4KHV A;  3TZU A;  1FYC A;  2IWH A;  1K83 B;  2FIN B;  1H9K A;  2PW5 A;  2HUG A;  1LTS D;  1JWS D;  1LAC A;  1EU3 A;  4F8M A;  3C2P A;  1W6K A;  4RH6 A;  2A74 C;  4K5X A;  1X32 A;  3NBI A;  4IUQ A;  3C46 A;  4WOR A;  1JWM D;  3X3N A;  5F2D A;  4OO1 H;  5I9P A;  1A6X A;  5ELD A;  4X3U A;  5I6Y A;  1KNA A;  3OMC A;  3DM1 A;  3T53 B;  4PV1 C;  3D3R A;  3BG3 A;  1CI3 M;  1JOO A;  4HTH A;  4EGV A;  3IFD A;  2F0I A;  3V2T A;  5FLX L;  3NHH A;  2F0K A;  2H4O A;  3GTM B;  2E76 C;  1SYB A;  1D5M C;  1PFB A;  2V4D A;  3NWS A;  1DCZ A;  4CJ1 B;  3R8B A;  1GJX A;  4BA2 I;  1O7L A;  2SOB A;  1GXD C;  5C6A A;  1EY0 A;  2WKC A;  3RZD B;  3BVZ A;  3TN2 A;  4FO2 A;  1V1P A;  3VA7 A;  1TU2 B;  1QJO A;  3D4D A;  1AW7 A;  4RGT A;  5BN5 A;  3OHX C;  5KYL A;  5ELF A;  3D4R A;  1ZYR D;  3CRL C;  2BDO A;  2O5J C;  2JP1 A;  3BVM A;  1STY A;  1SMY D;  4L8J A;  1OXV A;  2DNC A;  4XQJ A;  3R2T A;  2DNE A;  1ET9 A;  2XRQ D;  3FPU B;  1CZW A;  4K5W A;  3A8I E;  4V19 0;  3OPO A;  2QF7 A;  2AWO A;  4IUV A;  3CU7 A;  4DAY A;  4EQP A;  2XWB B;  3TSS A;  2EYP A;  3T13 A;  2EJF C;  1JE4 A;  3P7J A;  1KAB A;  2D62 A;  2JA7 B;  1SYE A;  1EOT A;  2F0G A;  2R93 B;  5CC4 A;  4FYD A;  1A2T A;  2EYH A;  1UEA B;  1Q1E A;  2DN8 A;  5JPM C;  3O13 A;  2ENB A;  4ABN A;  2B2V A;  2TMP A;  3LWU A;  1LTA D;  4RGM A;  1KDA A;  3DEO A;  2LMC B;  4C3J B;  1KDB A;  3IFT A;  2F0W A;  2BE5 D;  4A3G B;  3HKZ B;  1ET6 A;  2CHB D;  5IGE A;  2RA4 A;  2B2W A;  2G9D A;  2LFN A;  4F88 A;  2LS0 1;  4QUF A;  1EIG A;  5IGC A;  4XQN A;  1B50 A;  2AQ2 B;  3G7L A;  4HSV A;  2PW7 A;  1RKN A;  4CKB A;  3I4L A;  2NTT A;  3Q0A A;  4LMQ D;  5C5L A;  2B2V C;  4RCO A;  3SK6 A;  3AB9 A;  4DK1 A;  1V1P B;  3QB3 A;  2J0T D;  2A69 D;  2XSC A;  4K2K A;  5DNF A;  1Q90 A;  2JA6 B;  1I4X A;  2B2W C;  1MBY A;  3QG1 A;  1BO0 A;  1X3Q A;  4MIU A;  4DF7 A;  4NDX A;  3D4W A;  3MTS A;  3NWT A;  3KLS X;  2MGS A;  3PUV A;  1TWG B;  1QCB D;  1VF5 C;  2L12 A;  4KKS A;  2R92 B;  4TKO B;  4K8I A;  1PTO H;  4U67 3;  5C4H A;  2EY5 A;  1IL8 A;  3LNN A;  1BCP F;  4RHS A;  3OMG A;  3JAM E;  3WDN A;  1HHV A;  1WTP A;  2VUM B;  1A3V A;  1TY2 A;  4G57 A;  3K0Y A;  2O4X A;  3C1F A;  2G9H D;  2C9O A;  2WIN B;  3MXG A;  1JIC A;  4CGY B;  1D5X C;  2CQA A;  2QEJ C;  5EPJ A;  3HEJ A;  4DAP A;  3JAM L;  5IOD A;  2DY8 A;  1TY0 A;  2I07 B;  3NSW A;  3MHB A;  4WJW A;  1EL0 A;  1XTC D;  3SHL A;  1XWE A;  2B63 B;  1C4Q A;  1ENA A;  2KEE A;  2F0U A;  2CW0 C;  2EDG A;  1GHK A;  3OOC A;  5LL6 S;  3H3V C;  5CV9 A;  2PZW A;  3SEB A;  4X3T A;  1VDZ A;  3MFY A;  3HOV B;  1NCV A;  2JA5 B;  3BDL A;  5I4D A;  2FFK B;  3MXU A;  4NMZ A;  4IFD G;  3EJI A;  1JOR A;  3DWQ A;  1HTL D;  1D5Z C;  1J9O A;  1SE3 A;  4BWG B;  1STN A;  3SR1 A;  3CHB D;  1JR0 D;  1AFP A;  1MI2 A;  3A7L A;  1UNS A;  3TP7 A;  1IKM A;  1HA5 A;  3NXW A;  5EPK A;  4R8N A;  5EKL A;  2F0O A;  5DEH A;  2NB0 A;  1EEF D;  1EY7 A;  1BCP C;  1TWH B;  3M7G A;  2XNA C;  1GOZ A;  4OIK A;  3QWN A;  5BN4 A;  1QWY A;  1B53 A;  3PO3 B;  1S4Z A;  4FXK C;  4XYQ A;  4ZUI A;  2A6H C;  2GA4 B;  3K6O A;  3VA5 A;  4CBV A;  2R6G A;  1SNP A;  1YNN C;  2EYM A;  4OL7 A;  3NQI A;  3K58 A;  1U9R A;  1PFN A;  1ENC A;  2K5W A;  2PMZ B;  2K28 A;  2EY1 A;  2MHV A;  4A3K B;  1HPC A;  3A8K E;  4IAL A;  2NN6 G;  4OHJ A;  1C8C A;  4DFA A;  3NBH A;  1Y8O B;  4QIW B;  3D6W A;  2QIL A;  2D2C C;  1G29 1;  1GUW A;  4QMG A;  1I4R A;  5D3I B;  1TWA B;  4LAA A;  3PO2 B;  3M4O B;  3A54 A;  1BCP B;  1EYD A;  3MZ5 A;  2F0M A;  1LT4 D;  4RA8 A;  2K05 A;  1Q8I A;  2F0V A;  4R8I A;  5M3M B;  2Z4H A;  4HMJ A;  5T1G A;  1FNU A;  4KY5 A;  3D31 A;  1DM0 B;  4XYO A;  2WV6 D;  3K57 A;  1I3Q B;  2BOS A;  5FOB B;  4RKB A;  3K59 A;  1F2Y A;  4KY7 A;  2MJ8 A;  3DMU A;  4EQN A;  1TS5 A;  1A3U A;  4RFB A;  1SJH D;  1NAP A;  2K5Q A;  1V43 A;  1U4R A;  4ILW A;  1EYC A;  1Q3L A;  3PUW A;  3VR6 A;  5I9O A;  1EY4 A;  5D3D A;  4ZRZ A;  2J7Z A;  4BA1 I;  3CKI B;  4DN4 M;  4ZAI A;  1O78 A;  3I73 A;  2RDG A;  3GTJ B;  1O7Y A;  3EQL C;  5C3E B;  3LX0 A;  3K5O A;  2PYK A;  2IL8 A;  1LTB D;  4KMU C;  3RUZ A;  1SBB B;  1SNC A;  3IAY A;  1ILP A;  1CT1 D;  5JAV A;  3S1Q B;  3RLF A;  1BDO A;  1KDC A;  5E1F A;  3I72 A;  3SDZ A;  2X6L A;  2AUJ D;  5C4J B;  1OXX K;  4XDX A;  2NBF A;  5HUR A;  4A3F B;  3PV0 A;  5J39 A;  1OXS C;  4K2L A;  3M4Y A;  2NN6 H;  2WB1 B;  4Y7N B;  5JVH 3;  3NQT A;  1IKL A;  3WOE A;  3OIP A;  4IFD I;  3T4A C;  3KUP A;  3NP8 A;  3HGB A;  3EA6 A;  1EQV A;  3H94 A;  1ZYR C;  5K36 H;  5BN3 A;  1F2L A;  3FKI B;  2WII B;  1PTO D;  4K6D A;  1ROD A;  1SMY C;  5COY A;  1MSH A;  1LLR D;  2L1B A;  2M2L A;  3H91 A;  1RF2 D;  3TME A;  1Y1W B;  2EOT A;  3J80 E;  3AMU A;  3MXN A;  3G6J B;  3TP6 A;  1EZ8 A;  3K5L A;  3I70 A;  1U4M A;  4H13 C;  2H1E A;  2EE1 A;  2IPK D;  2A6E D;  5DM6 3;  1PZI D;  4XT1 B;  4K14 A;  2HCC A;  2K6A A;  1V1O A;  1D1I A;  3J80 L;  3MFG A;  1H9R A;  1CA5 A;  3J7A V;  1R4P B;  5FLX E;  3KF8 A;  2K32 A;  2F3V A;  1Y8N B;  2KA7 A;  2FMC A;  3S9W A;  3HOY B;  1PLF A;  3GTG B;  3L9A X;  1FNW A;  3EFX D;  2RKS A;  2ICI A;  2AQ1 B;  4Q5V A;  5EGT A;  2BE5 C;  5T1I A;  3C3L A;  1STG A;  2Z1C A;  5DM7 3;  4HAE A;  1QOH A;  4I65 A;  1GUN A;  2ZXO A;  3E0J A;  2SNS A;  1IHZ A;  2OEO A;  1SFO B;  4NKL A;  1LTG D;  1EY5 A;  4ZKB B;  1DOL A;  1YNJ D;  3KBG A;  1DZ1 A;  4YIJ A;  4G7H C;  2XN9 C;  4MN3 A;  2Y0S B;  1WTQ A;  1TVX A;  3D8G A;  1TS2 A;  2PNR C;  2A69 C;  5ELE A;  1U4L A;  1PRT F;  1ONL A;  5CV7 A;  1OO9 B;  2BA0 A;  5KIX A;  1H9J A;  1GHJ A;  1L0X B;  3GTK B;  1H9S A;  4TQU S;  2L5T A;  4TSS A;  4B9X A;  2L0C A;  4OO1 I;  3IKJ A;  3GV3 A;  1WTV A;  1PXU A;  1SNO A;  1CQV A;  2ID0 A;  1R4Q B;  1B3A A;  1QB5 D;  1BF4 A;  2FMM A;  4FF2 A;  1MGS A;  4G7Z C;  3GV6 A;  1AZP A;  2XIW A;  5ELC A;  4CKE A;  5CGK A;  1CZG A;  2Q8R E;  5ELB A;  2HCI A;  5JVG 3;  1EQT A;  3SVM A;  5K5P A;  1SJE D;  2WP8 J;  1Y8P B;  1AZQ A;  2EZV A;  3KK7 A;  1ESF A;  3S14 B;  1F2M A;  3A55 A;  4ID6 A;  3QJY A;  1LT6 D;  4DGZ A;  1OXU A;  3S1M B;  3MC0 B;  2IJ0 A;  2B2T A;  1RD9 D;  3OWE B;  5CBE E;  2OF1 A;  4G7O C;  2KQ3 A;  5IT9 L;  1TQO A;  2TSS A;  4C1N K;  1LT5 D;  4I7Z C;  4UDU C;  4RAU C;  4UAI A;  5AFW A;  4DXG A;  1SSO A;  1CA6 A;  4A3D B;  2L55 A;  4F87 A;  1G8Z D;  3FRP B;  2NVY B;  1K8M A;  1AP0 A;  1SE4 A;  1I50 B;  4N9T A;  4A3B B;  1QNK A;  3CRK C;  5C0X J;  3DXJ C;  2KEC A;  2B2T C;  3VYT A;  1H9S B;  4IUP A;  3ONA B;  3SK4 A;  5JEA J;  3E5S A;  1WD1 A;  2Q8T A;  5KND A;  3OIQ A;  1BXT A;  2L11 A;  4FXG C;  3DUZ A;  2F0N A;  4C3H B;  2JYO A;  3TBI B;  1PYW D;  4XXE A;  2O5I C;  1ZEQ X;  2A68 D;  3BDC A;  3R2I A;  2PO4 A;  3OWF A;  1HCZ A;  4ZUJ A;  3GD7 A;  1F2Z A;  1IYU A;  3A7A B;  4O1N A;  5KGU A;  4LK1 C;  3S2D B;  3N52 A;  1EY9 A;  1TT2 A;  1Y69 U;  4O42 A;  1Z6H A;  4R9W A;  1JOQ A;  5C3X A;  5CV5 A;  2AQ3 B;  2K5D A;  1I4P A;  3VR5 A;  4FNF A;  4KY6 A;  4HMI A;  1TKW B;  1BQQ T;  1PRT D;  3I90 A;  1EWH A;  3R93 A;  4ZQ3 A;  4DNT B;  5EBC A;  1RTN A;  2Z8L A;  1F9R A;  1I4G A;  1KTK A;  3QO2 A;  1DOM A;  4KN7 C;  3DWA A;  4IUT A;  2K03 A;  3K5N A;  1K8O A;  3NTK A;  1PTO F;  3VYS A;  4EQO A;  3L3O C;  5LHY 1;  3RMH A;  2AWN A;  1G91 A;  2N88 A;  1F77 A;  1E2V A;  2WAC A;  4X3K A;  1JCK B;  4C3I G;  5IGG A;  2KCN A;  1LV9 A;  1HUN A;  1SNQ A;  4M1U B;  2RDF A;  3NPP A;  2QDB A;  1KNE A;  2KOL A;  1TWC B;  2BDN A;  1JB3 A;  1UUP A;  3S1R B;  2OXP A;  2NVT B;  2N55 A;  2IX1 A;  5IIF A;  1LTT D;  1EU4 A;  3S15 B;  1KLU D;  4J8Q A;  5J1Z A;  1SYG A;  4DK0 A;  4PNY A;  5K36 G;  1I4H A;  1A3T A;  3J81 L;  4N9P A;  2JSO A;  5FK9 C;  3V05 A;  3NK9 A;  1DXM A;  4CJ2 C;  4FF3 A;  4WRD A;  1LO5 D;  4KV6 A;  4EVO A;  4HR7 B;  1CHQ D;  3MWY W;  1MSG A;  1H9M A;  3GTQ B;  2B39 A;  2PZT A;  3P75 A;  3K7A B;  1LT3 D;  2F4I A;  1ENF A;  3T51 B;  1HQR D;  4NP5 A;  4DXF A;  1PTO C;  1II3 A;  5C0X H;  1NUC A;  2AUK A;  1D6E C;  1M4V A;  4HED A;  4ZKC B;  1RDP D;  1LAB A;  4QUC A;  3SE0 A;  2B2Y A;  2PZU A;  3PUY A;  1GUG A;  1BBX C;  2K04 A;  2IX0 A;  5CBA E;  4PMB A;  1HXY D;  3M85 A;  2A6E C;  2EJG C;  3FPP A;  4E6I A;  2O2L D;  4CHT B;  3P20 A;  1QIL A;  4FP5 D;  2R3Z A;  1B4O A;  2WKD A;  2EYL A;  2YYZ A;  4QF4 A;  1G6Z A;  5ISR A;  5D14 A;  4TRD A;  2XRS D;  4KKT A;  5C5M A;  2QCP X;  2B2Y C;  1HFG A;  1EWC A;  2NTS A;  1TS4 A;  1DJR D;  1AEX A;  1FNV A;  1BUV T;  3EVQ A;  1SE2 A;  3I3C A;  3BDO A;  1RTO A;  3QIA A;  4BS9 A;  2F3W A;  1PTO B;  3GTO B;  1EY8 A;  1S5C D;  3GQB A;  1YNJ C;  1ZXT A;  4QB4 A;  1WTW A;  4DU9 A;  4KHZ A;  4FVM A;  5EKK A;  2ZT9 C;  3RZO B;  2RBM A;  3W3A A;  1LTR D;  2A5H A;  3PUZ A;  4XT3 B;  5E3F A;  4IZ8 A;  3PIO 3;  1STH A;  4L6T B;  1RJT A;  4AYB B;  4U68 A;  3UI2 A;  4KN4 C;  2NZ1 D;  1CK1 A;  3VR3 A;  4A93 B;  1W6J A;  1PDQ A;  3VYU A;  3FVQ A;  3NUC A;  3W2D A;  2F0F A;  3GO5 A;  1ICW A;  4J6H A;  2JEB I;  3CQZ B;  3KBX A;  4C56 C;  1ILQ A;  1B9N A;  3K5M A;  5KEE A;  1WTX A;  1SXT A;  2NYZ D;  1S5E D;  3FEW X;  4B9W A;  3QOJ A;  1SNM A;  1FR3 A;  3E6Z X;  2E2D C;  2E2J B;  4S3S A;  4KD4 A;  1HQM C;  2LY7 A;  2QKI C;  4IUN A;  4KKU A;  1I6V C;  3A56 A;  5I6W A;  4PMW A;  4IQZ A;  1B2T A;  4FXD A;  1FD7 D;  3N6R A;  1JC7 A;  2NN6 I;  5C3W A;  3SK8 A;  2X6G A;  2F0D A;  1NR2 A;  4C2M B;  2D9U A;  2I46 A;  3KLR A;  4HCE A;  5IGF A;  2L9H A;  3HRZ C;  2CVR A;  4ME5 A;  3VYR A;  1KAA A;  2K7V A;  4QCL A;  1VMC A;  5D65 A;  2RDH A;  2NVQ B;  1HFN A;  3RD4 A;  3TP8 A;  1QE6 A;  2DY7 A;  3P1H A;  3HOX B;  1R9T B;  2A73 B;  3ERO A;  2KHS A;  4HSP A;  1AN8 A;  1E0B A;  3Q6S A;  4KJN A;  4MHE A;  4FF1 A;  3MVV A;  2F0Q A;  1EFI D;  4CKC A;  4RGN A;  3U9O A;  5C4X B;  4DA2 A;  1TR5 A;  3VR4 A;  1S5F D;  2FJ2 A;  5TSS A;  2RSN A;  1IW7 D;  1EY6 A;  4PQX A;  5CV4 A;  3BZD B;  1KLG D;  3X3M A;  2JEA I;  2VXW A;  1QG7 A;  3Q23 A;  2F0E A;  3MEH A;  4KD3 A;  5CR3 A;  3MAQ A;  5FKA C;  1I6H B;  3H6M A;  2A68 C;  1CTM A;  2IT1 A;  2EVB A;  1Y1V B;  3GTL B;  2F0S A;  2HQE A;  2E74 C;  1BOS A;  4A3J B;  1EIH A;  2PCF B;  3PIP 3;  2YU9 B;  2F03 A;  1DON A;  1PMR A;  1SYF A;  5KNC A;  2F0T A;  2M9V A;  1HRJ A;  2RQX A;  1F9Q A;  1JQY D;  4ODG A;  4J1M A;  4ULL A;  2K01 A;  4A3M B;  5E4W C;  2X69 A;  5IT9 E;  1PFM A;  1BR9 A;  1Z47 A;  5NUC A;  4IUU A;  2F0L A;  5JOB A;  5A35 A;  5JPN C;  4G4K A;  5I2Y A;  2HDM A;  1EZ6 A;  1Z7T A;  2B8F A;  4P2C B;  2E2H B;  2C5C A;  3I4N B;  1ESR A;  1E2W A;  1PRT C;  1M8A A;  3D6C A;  2RSO A;  1SND A;  1STB A;  2K33 A;  3Q22 A;  1WTO A;  5EJW A;  1SYC A;  2WAQ B;  2XWJ B;  4X3S A;  1ML0 D;  3HZX A;  1PZJ D;  1BNZ A;  1HTP A;  1STE A;  1SEB D;  1E2Z A;  4K5V A;  3DEP A;  3VR2 A;  1F9S A;  3HP3 A;  1GUT A;  1T5X D;  2D5D A;  4IN3 A;  4RHR A;  2B8G A;  5DAU A;  4C3I B;  2F0J A;  5A2Q E;  1STA A;  1D2B A;  1UAP A;  5C4Z A;  1L0Y B;  1WTR A;  2IW3 A;  2XVS A;  3FMC A;  4ZLT F;  4HCS A;  4BBR B;  1XYI A;  4XQQ A;  2J4X A;  1OXT A;  3OW7 A;  5A2Q L;  4BBS B;  1S5B D;  3I8Z A;  4A3I B;  4IFD J;  3SXH A;  3S16 B;  3S2H B;  3IL8 A;  1SDF A;  3ITP A;  3BVG A;  3MA2 B;  1PRT B;  3LWE A;  5EBD A;  4RKL A;  4M8A A;  3A8J E;  3C1E A;  5FO8 B;  2BA1 A;  2EYO A;  1QNU A;  5JJZ A;  1WVL A;  2NWG A;  5C0X G;  2JE6 I;  3AU7 A;  1C48 A;  4KK7 A;  4IUR A;  4RCN A;  1TS3 A;  1F9P A;  2KED A;  1B1Z A;  1JOK A;  2E2I B;  2LKV A;  5HGT A;  5JEA G;  2EPB A;  4JBW A;  2EJM A;  1B9M A;  5G3L F;  4NW2 A;  2SEB D;  3H0G B;  1JWU D;  5E4X A;  1G2T A;  1I4Q A;  3ERQ A;  1RCV D;  1GUS A;  4C3J G;  2KUM A;  3ZYY X;  1WD0 A;  4JK1 C;  4OIJ A;  4H0L C;  3OSO A;  4XTC S;  1CHP D;  2OT2 A;  3PUX A;  3M3Y B;  2JXM B;  2ZXP A;  3Q24 A;  3S1N B;  2KCC A;  3URY A;  2KVM A;  4BY1 B;  3T56 B;  2ICE C;  2F0P A;  1O7Z A;  2R7Z B;  1A2U A;  4GZY C;  4KTA A;  3BS1 A;  3H09 A;  5IGB A;  2EY6 A;  3HG9 A;  3T16 A;  3I91 A;  2F0H A;  1HUM A;  1ZKO A;  4DNR B;  1EYA A;  2MPM A;  4V0B A;  2EYF A;  5COR A;  5J22 A;  4K6L A;  4BY7 B;  3NTI A;  2EYJ A;  3J81 E;  5KNB A;  4PMC A;  1TWF B;  4RWS C;  5EPL A;  5EQ0 A;  5FO9 B;  4ZK9 B;  3I4M B;  3WOF A;  3L7Z C;  3S17 B;  1V8Q A;  4Z9C B;  3NTH A;  1HA6 A;  5IGD A;  1D1K A;  3DHQ A;  2ZXR A;  1TII D;  3TZD A;  2VB3 X;  3J7A F;  4C3H G;  1RHP A;  5I2X A;  3NE5 B;  4XIG S;  4K8J A;  3GTP B;  2CW0 D;  5CYU A;  2BCO A;  3ND8 A;  4DAV A;  3BYY B;  2B2U A;  4A3E B;  2M00 A;  1B44 D;  5M5W B;  1SAP A;  2F1M A;  3F2U A;  1CQF A;  3M7N A;  4KJO A;  2Q8I B;  2RVL A;  3HOZ B;  1CM9 A;  1U4P A;  4Q0F A;  2MUY A;  5JEA H;  3PMF A;  5M5X B;  2L4N A;  1LTI D;  2EXZ A;  1MD2 D;  4WFN 3;  1XX8 A;  1WCM B;  1T5E A;  5CMD A;  4IFD H;  1O80 A;  4OO1 G;  5KYI A;  4HN7 A;  5M5Y B;  3HOW B;  1BCP D;  2B2U C;  3GP7 A;  2SDF A;  4C1N I;  3HS0 C;  2SNM A;  1Q12 A;  1FGB D;  3HOU B;  5IOC A;  2A6H D;  1G2S A;  5LL6 X;  1YNN D;  4RGO S;  1Q1B A;  1A15 A;  2K1B A;  2KJX A;  5CV6 A;  4FF4 A;  2EY2 A;  2JA8 B;  5CV8 A;  5M3F B;  1DD2 A;  2R61 A;  3J7Y W;  5M9O A;  1S5D D;  1IYV A;  2E75 C;  3QOL A;  1VMP A;  5G3L D;  4CJ0 B;  2FHT A;  2VNU D;  2NUC A;  4L63 B;  5C0X I;  1VF7 A;  4H44 C;  3ND9 A;  1DOK A;  3TDQ A;  5FO7 B;  3R3O A;  1XXG A;  1X3P A;  2Z4I A;  2IX3 A;  4KI0 A;  1PZK D;  2PPB C;  3FDT A;  5C44 B;  3V96 A;  4H7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...