5ELFA

Cholera toxin el tor b-pentamer in complex with a-pentasaccharide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B
total genus 26
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5elfA00
3GP7A 5D3DA 1T5XD 4TSSA 5ELFA 3EFXD 1HA5A 4DXGA 2NTSA 1BCPF 1D5ZC 1PZJD 1B1ZA 1HQRD 4ZYSA 4UDUC 1LTSD 1MD2D 1CT1D 1PRTC 1EWCA 1L0YB 1TY0A 5FK9C 2G9HD 1V1PA 2O2LD 1LLRD 1HTLD 3BYYB 1BCPD 1PRTF 1KTKA 1STEA 1SBBB 3BYTB 1EEFD 1BCPC 1DJRD 1S5DD 4C56C 4OHJA 2IJ0A 3SEBA 1KLUD 1JR0D 3DWQA 1RD9D 2RDGA 1SE3A 3KLSX 2AQ2B 3BVGA 2RDHA 1FNWA 1LTTD 1LT3D 3URYA 1BXTA 1G8ZD 1L0XB 2Z8LA 1JWUD 1FD7D 1GOZA 1PTOB 1PTOD 1V1OA 1EEID 2XNAC 2XN9C 1D5MC 1SE4A 4RGNA 2CHBD 1I4XA 2QILA 4RGOS 1I4QA 1TS2A 3EA6A 1EU3A 1V1PB 1LTID 1PTOC 2XRQD 1I4HA 1LTAD 1JCKB 2J4XA 2TSSA 3BVZA 2WV6D 1S5FD 3R8BA 1S5BD 3V05A 1B44D 1CQVA 1XXGA 2AQ1B 2SEBD 5FKAC 1ET9A 1ET6A 1JWMD 1UUPA 1PTOH 1BCPB 4RHRA 2NTTA 1AW7A 4RGTA 1TY2A 1I4PA 4RHSA 1SE2A 1PZKD 1PYWD 1SEBD 1TS5A 2AQ3B 1JWSD 3MC0B 5TSSA 1M4VA 3CHBD 1LT5D 1PRTB 1CHQD 3BZDB 4L63B 1ENFA 3BVMA 4BWGB 1HXYD 3MFGA 2ICIA 1LTBD 5ELDA 1SJED 1FNUA 3TSSA 1LO5D 5ELCA 1LTRD 1LTGD 1PRTD 3R2IA 4O1NA 4RH6A 4DXFA 4K6LA 5I4DA 3W2DA 1CHPD 3O13A 1FGBD 4RCOA 1KLGD 3DWAA 1RF2D 5ELEA 3OWEB 1D5XC 4RFBA 1PTOF 1SXTA 2IPKD 1F77A 2QEJC 1CK1A 1JQYD 3DWPA 4Z9CB 2R61A 1XTCD 1I4GA 1EFID 1UNSA 1ESFA 1RCVD 4RGMA 1LT6D 1TS3A 1TS4A 1SJHD 1FNVA 1QILA 1RDPD 1S5CD 5ELBA 1LT4D 3R2TA 4L6TB 1PZID 1EU4A 5D3IB 1S5ED 1D6EC 1I4RA 1AN8A 2XRSD 1DYQA
chains in the Genus database with same CATH superfamily
2EE1A 5M5XB 3S2DB 3SDZA 3WOFA 2UUBL 4QIWE 3HOWB 4JI2L 1MJCA 4LF5L 1TIID 1TY0A 1TVXA 3MXNB 2QEXA 2O2LD 4UHVA 3PO3G 3OIPA 4BBSG 1E1TA 1VQMA 1STEA 1OXXK 4XT3B 3A8IE 1HR0L 4X65L 3VA7A 4LWCA 4R1JA 1WVLA 4LF8L 1GUGA 3WDNA 2HDLA 1KNEA 3G48A 2NB0A 4KV6A 2F0PA 3FEWX 3PQIA 2F0EA 2HIXA 3HOUB 2K14A 2QDLA 2WINB 4L5TA 3PUVA 4GLAC 4RGNA 3BDLA 2CCZA 4EX5A 1L1OA 4DGZA 5C0XG 3KF6B 1NJIC 1I4QA 2A5HA 3I2ZA 2R7ZG 2IX3A 2K4KA 2GVBA 1A3UA 2NYZD 1BBXC 3DXJC 2EY5A 5I6WA 1PH7A 1S5BD 2A74C 2UXCL 2M00A 2UUBQ 2O5JC 1XPOA 5C6AA 2F0IA 4OEMB 1X3PA 4C3HH 2WB1G 2GN5A 2LSSA 1K8GA 4CJ0B 4LF7Q 4BY7B 3T53B 2EY6A 1SE2A 3HKZG 5I2XA 5M3FH 2AQ3B 1EIHA 4IPHA 2TMPA 2B2VA 4IUQA 3G6JB 3KK7A 4IUNA 3GTOH 5IP7G 2R3ZA 2PNHA 3HOVB 3PIO3 5FJ8G 1LYLA 4KHVA 2CW0C 2EDGA 2F0UA 4K0KL 3S9WA 3S2HH 1RF2D 5LHY1 3J81E 1A0IA 3VYSA 2WFWA 3VA5A 1EOVA 5DNFA 5M5YH 3HOYH 5IT9c 2VNUD 4UAIA 2B2UA 3I4NG 2OQ0A 4ILWA 1TS3A 1K3BC 3GV6A 4M8AA 1QE6A 4DR4Q 5IODA 4R8IA 1QILA 1S5CD 4HCSA 4LJZC 5M3FB 4DV1Q 1A8VA 5C3EG 2AUJD 1Y1WH 1JJ2A 2R7ZB 4X62L 3QR8A 3QOLA 3Q8DA 2OEOA 1D5ZC 4K14A 2KBNA 1GM5A 2DNEA 4XXEA 3GTQH 1P16A 4N8X1 3HZXA 2PNRC 4QJFA 2E2JB 1IL8A 4GLVB 1BCPD 2PZUA 1L2FA 4C3HB 2QW7A 1O7IA 2A1AA 1K9MC 1F9PA 1DXMA 4JI7L 4GOPB 4LF6L 2X6LA 4JI4L 3EIVA 3CMAA 4C3JH 1GUSA 1AP0A 3BS1A 4BY1H 2ZXRA 4RKLA 1I3QB 1NBWA 2K05A 3ULPA 3BVGA 2RDHA 5K5PA 2FXQA 2EVBA 2N78A 3UE0A 2CHBD 1Q81C 1N36L 1WTRA 1FJGL 1LTID 4QF4A 4X62Q 3IAYA 1R4PB 4QQBX 5JAVA 2QDBA 1QZGA 3OPOA 5FOBB 1ZYRC 1VQHA 4HN7A 4LF4L 1WCMH 4BXXH 3IL8A 4I65A 5IYDH 1CQVA 3S1NB 4L5QA 2AQ1B 1VQ8A 1DCZA 2K52A 1FGUA 3CCUA 1RODA 2UUCL 2YU9B 5IWAL 1DOMA 3C2PA 1Y1WB 2K5QA 2YTVA 4JPBW 4JI4Q 5TSSA 3N52A 1XMOL 4G7HC 2Z6KC 1ENFA 3BU2A 4TVAB 3RMHA 1KAWA 2JA6G 1LTBD 2CH4W 4ZLTF 4N8FA 1N36Q 5JJIA 3D4WA 2QCPX 3CQZH 1KLGD 1HR0W 2OTJA 1U4RA 3I72A 2IPKD 3ULJA 3PF5A 2RCNA 5IT9L 2ZM6L 1HZBA 5F2DA 1LUZA 1B9NA 5JJZA 1SNQA 1GUTA 1PA6A 1FNVA 2UXDQ 5E3FA 2AMCB 1G6ZA 3KF8A 1HQMC 3NQTA 2CQAA 1ZXTA 4KK7A 4A3KG 1TWAH 1CUKA 4OWTB 1EZ6A 3TN2A 3H94A 3S15B 4A3FH 4JI1Q 5EPKA 4OO1H 2NN6I 3PUZA 4AQYQ 4H0LC 4CDFC 3ND9A 3V96A 4NXNL 4DV6L 3Q24A 5BR8L 1TWHB 2NN6G 1STYA 3CW2C 4DV7L 1KLUD 1Z47A 4DR3Q 5JOBA 3HOVG 4KN4C 4B3SQ 3CCJA 1KDBA 1XTDA 1BXTA 1G8ZD 1DOLA 1AEXA 4ZUJA 2JXMB 1Q12A 1TS2A 2E75C 2F0GA 4UPAA 5GROA 4MTNA 4BBRG 1LTAD 3KDFA 4A3MG 3S14H 3BZCA 2WAQE 1GUNA 3HKZB 2IL8A 1B44D 3MTSA 1WTHA 1EY9A 4F87A 4HMIA 1ESRA 3K80C 3A5UA 3PO2H 4NW2A 2NVTH 2JN4A 1YNND 3T56B 2MHVA 1I4PA 1CFMA 1XMQL 5IP9H 4A3CG 3PSIA 2XWJB 3PUWA 4DAPA 4DAVA 4IFDG 1ML0D 4HAEA 2E2JH 2CW0D 3BZDB 3MA2B 1Y14B 3KYHC 1J5EQ 4QGUA 2VS1A 1PVOA 4DU9A 1LO5D 4JI3L 1LTRD 4X64Q 4A3EG 4RH6A 1Y8NB 3KFUA 1RTOA 2PYKA 5ELOA 1CHPD 5EKIA 1VCIA 1XNRQ 4RCOA 4FYDA 1VQPA 4BBRB 5KNBA 4IUUA 4X3SA 1BBUA 5CC4A 2JA5G 3BDOA 5IGBA 1YZ6A 4YY3Q 1ENAA 1GHJA 4L5RC 3T13A 2JA8B 2FINB 2K32A 1V43A 2F4VL 2LMCB 3PIP3 4FDBA 3HG9A 1EWIA 3M4OH 2EYJA 1XMQQ 4FVMA 3F2UA 2L9HA 2MPMA 4AH6A 5D3DA 1WI5A 1SDFA 4QIWB 4JW0A 1LTSD 1SFOB 1YITA 2IX1A 2MO0A 1PYSB 5EBCA 3DM3A 1H9JA 1XNRL 1NMFA 1RIPA 2R7FA 3L3OC 5JEAJ 3L0OA 2SNSA 5I6YA 3J80L 2IY5B 4JBWA 1B3AA 3TEHB 3MVVA 4DUZQ 1X55A 3OIQA 4O42A 1HJPA 5C3EB 4YCVA 3J81c 3E6ZX 3EJIA 5GAGC 4DR6Q 4DAYB 1YVCA 3KF6A 3D0FA 1I4XA 2KCTA 3K5LA 1N32Q 2JK8A 4PMWA 3I4MH 4LF9L 1VQAA 5KYIA 2JEAI 1PFNA 2EXDA 2K7VA 1LABA 5E4WC 5BN4A 2R93H 4JI8Q 3SK4A 1K3RA 3BG3A 4B9XA 1B50A 2L0CA 1S4ZA 1HA6A 1HNZQ 3SVMA 2Y0SE 3E3XA 4UP8A 4GOPC 4POGA 3TP5A 1G91A 3UE1A 3AYHB 1SSOA 2IHFA 2KHIA 4C3IH 2IT1A 5C5LA 4DV5Q 1PZKD 2H5XA 2JEBI 5EKLA 4DR1Q 4OO1I 1CHQD 2BE5C 3J81i 1E2WA 4PV1C 4BWGB 3ZYYX 4GN5A 4NP5A 3K6OA 3TP6A 4CJ1B 3GTQB 2ICIA 3DLLA 3CMEA 4IALA 1X3GA 1VQOA 5DLQE 2OT2A 3H6MA 4O1NA 4RA8A 1YNJC 2KCMA 3U50C 1U9RA 2F0DA 1FGBD 2G9DA 3UI2A 3F1ZA 4J6HA 3HGBA 1JQYD 2PZTA 1K8MA 1TQOA 1KAAA 2JE6I 1DGSA 2RHQB 3DMUA 4CKEA 2PPBC 2NVQH 5IYDG 2B2VC 4XTCS 3S2HB 1EFID 1Q46A 1RCVD 5EKKA 4ZK9B 1AFPA 1PDQA 4PNYA 3NTHA 2N8NA 1RDPD 5D65A 1PFSA 4HEDA 3CF5A 1Q82C 5C0XH 2JA7H 4K2LA 2HQLA 1D6EC 2XRSD 1JOQA 4P71A 4A3BB 1TWCH 1BOSA 3M4PA 1VQ5A 3E0JA 2E5LL 4B3ML 3E9HA 4ZYSA 5C4XB 2D2CC 2H1EA 2JA6H 3D31A 3GDEA 5EBDA 3PIOA 1SROA 2YU9H 2VB2X 4A3IH 2B8GA 1VQKA 1FL0A 1LACA 2B2YC 1KABA 4FXGC 4OHJA 2IJ0A 5IGCA 1JB3A 2AWOA 1VQBA 5M3FG 2CH4A 4PZ6A 4OWXB 2KOLA 2MO1A 1K73C 1EYCA 2I5LX 1H9MA 4ZKBB 1NAPA 3IKJA 4DV0Q 1KD1C 3FMCA 4JI2Q 2ZJQA 2R6GA 1JWUD 1GOZA 1V1OA 3D4DA 1JICA 4GKJL 1YI2A 2KCNA 1ZYRD 2VB3X 1DONA 4DUYQ 3RN5A 3BJUA 2CVRA 2XRQD 1I4HA 2HQEA 3ULLA 5EPLA 5IY0A 4J15A 1HZ9A 3UDFA 2PQAA 4B3MQ 4X3TA 4ALPA 4C1NK 3T51B 5KGUA 1VQ7A 1O7ZA 3I4NH 1LM0A 5J39A 1PTOH 2EYOA 1SNOA 3K81C 1A62A 1E2ZA 2PQEA 4B3RQ 1H9SA 3CRKC 1N34L 3FPUB 4ZKCB 5I2YA 5C3EH 4A3DH 1W3SA 3CCRA 3VR3A 1A2TA 3G6EA 3GTGB 4HIKA 5KNCA 3H3VH 1DM0B 2PCFB 1UAPA 1ZKOA 2Q2IA 2XSCA 1LTLA 4O0AA 3ONAB 3CC4A 5I4DA 1WOCA 2KENA 4HR7B 2L1BA 5IT9E 4E6IA 4LF7L 4LK1C 2ID0A 4RFBA 4A3MH 1NR4A 2DUDA 3J7AV 4JV5L 4S3SA 3HOXB 1STAA 2VY3A 2EYPA 1MGSA 1XTCD 4MZ9A 2Z6KA 1ESFA 1SR3A 1II3A 4WRDA 4NB3A 3OMGA 3STBD 3HKSA 1O7YA 3KBXA 1XNQL 4UP9A 1JC7A 1TWFH 5C5MA 4L8JA 1C4QA 1PZID 1VQGA 2G5DA 3GV3A 3QG1A 3K5MA 3IFTA 4LMQD 1AE2A 2XTIA 4NXMQ 3GP7A 2HHHL 2RQXA 3OYYA 4UDUC 4JOIA 4DNRB 2VUMG 4JI5Q 3M3YH 1L0YB 5GQOA 5BN3A 5IP7H 5M5WB 4FF2A 5FJ8H 1LLRD 3EN2A 2CFMA 1SYEA 3NQIA 1PHJA 3IRBA 1M90C 3RZOH 3MHBA 3V2TA 3T4AC 2L55A 1PXUA 2KVMA 3HOXG 2RDGA 2RVLA 1MJEA 4IUPA 3CXCA 3KLSX 5KEEA 1TWGB 4P2CB 4FXDA 2F4IA 1X32A 2BA0A 1KC8C 2N55A 2NVXH 2EYFA 5LL6S 2ZT9C 3JAMi 1PTOC 3MXUA 1OXTA 4C2MH 4A3JH 2J4XA 4JI7Q 2QA4A 5A2QL 4JYAQ 1K8OA 3C3LA 4IJLA 2HHHQ 1EOTA 4CHTB 4LUZA 3WOEA 4TRDA 4JI5L 4FO2A 4EGVA 4RAUC 4KKUA 1UUPA 2VZAA 3CPWA 5HURA 3CRLC 1FJGQ 2Q2UA 2JA7B 4QUCA 1TWFB 2R7DA 5HGQA 4HSPA 2A69D 1PYWD 1U4MA 2M2LA 3S1MB 1JWSD 3DEPA 3OW7A 2KECA 1QNUA 3OSOA 3QJYA 3A55A 2NZOA 4LF4Q 4LF5Q 3C46A 3S17B 1WTVA 1JJCB 2NVQB 5ELCA 3Q0AA 1BVSA 2N88A 3C1FA 4BBSH 3MEHA 3S24A 4LFBQ 3FKIH 2KHSA 2Q2TA 1NTGA 2Z4IA 1TWAB 4FF3A 1STNA 5L37A 4LF8Q 2ZTCA 2X69A 1V1QA 4K8IA 1WCMG 3HOVH 2L15A 3RLFA 1QVFA 4DV2L 2YTYA 4IJHA 3A7AB 4GN3B 4A4IA 1Q3LA 3C1EA 1S72A 2A68D 3KBGA 3ZJYC 2IWHA 5COYA 1D2BA 1RHPA 4DA2A 3HOYB 4CJ2C 2B63G 1JMCA 2BCOA 4WFN3 4HIMA 1HA5A 4XIGS 4I7ZC 3VR2A 1HQRD 2K04A 2WKDA 4O2DA 5JPNC 1UWVA 3J7ZC 2D0OA 4A3LG 4X6AH 3CD6A 4HSVA 2AHOB 3UDIA 4HJAA 1I50H 3A5ZB 4C3HG 4OXPA 3S1MH 2UXDL 1CSPA 4WORA 1F2LA 2K03A 3AEVA 4K8JA 3JAMc 3E0EA 4RCNA 3TDQA 3GD7A 2UUAQ 5G3LD 2DY7A 3MXPA 2UXCQ 3S1NH 4LFCL 4DV2Q 2F0NA 1W6JA 5FLMH 4AQYL 1K83B 2HIVA 1ILPA 3NENA 1X65A 3J80i 4IO9A 2UU9L 1EU3A 4UP7A 3FRPB 4DV7Q 1T9HA 2J7ZA 4A3GB 3A7LA 4DNTB 5GAHC 1A3VA 4C1NI 3HP3A 2JA5H 3S16H 4A3JB 1U4PA 1S3OA 3D6WA 3HOZH 3KJPA 2E2DC 3SHLA 5FO9B 4JBMA 3GTJH 2RA4A 4A3IG 1ET6A 4IN3A 3LWEA 1JOOA 1E3PA 4R4OA 4JC0A 2CWPA 1YJ9A 5CBAE 3E9IA 3U9OA 2UUAL 3NEMA 3SGIA 4Y52H 1XX8A 3K8AA 2AUKA 1Q86C 1D1KA 4JI6L 3EQLC 4WJ4A 4DV1L 4CBVA 1IXRA 3DWAA 4KD4A 4RMFA 2WKCA 1WTWA 2KEEA 4I7AA 2C5CA 1F77A 3T1HL 3LX0A 4R4CA 1VQJA 4PMBA 1JE5A 4B9WA 1RTNA 2O4XA 2B29A 2EYHA 1HNXL 4KLKA 1BNZA 3PO2G 3CQZB 2RDFA 4F7XA 3HOUG 5IOCA 1BKBA 3J7AF 3HRZC 4IPCA 2YTXA 5ELFA 2MNAA 4XQQA 3KUPA 3U58A 1MD2D 2EYLA 1EWCA 3I4OA 2A6EC 1V1PA 3ICEA 3U4ZA 2PW7A 2WP8J 1N8RC 4PQXA 4JI6Q 2K5HA 3GTJB 1BCPC 1J9OA 4Q0FA 4ME5A 3I3CA 3T1YQ 1WD1A 1WCMB 4BY7H 2WACA 5CV5A 1JR0D 3K5NA 3GTGH 4L5SA 1SMYC 3QO2A 1E0BA 1R4QB 2EIFA 3K57A 4HMJA 1Q1EA 1SMYD 4ZQ3A 1PH9A 4A3GH 2H4OA 1GHKA 2VQEQ 4YCWA 1LTTD 5CV4A 2BDNA 1PTOB 3JC66 1IBLL 2UUCQ 2B8FA 5CV9A 3AFPA 5IWAQ 5M9OA 4R8NA 4KHPQ 4LUOA 4HTHA 4HJ7A 1I6VC 1O80A 4C3JB 1EQVA 2D5DA 4LFAL 2K6AA 2F03A 4XDXA 1EY8A 4IFDI 1OO9B 5I9OA 4YHHL 2A69C 5JVH3 4DR6L 4EQOA 2D0PA 4A93B 3NBHB 4FNFA 4IFDJ 4HCEA 3M3YB 2A68C 2F0WA 4LF9Q 2HCCA 2GVAA 1FR3A 1Y1VB 1SEBD 4XYQA 4A3IB 4KD3A 3OOCA 2PO4A 1SRUA 4L63B 4CKBA 3TRZA 2ZM6Q 4DV3Q 4R4QA 1HNZL 4JI1L 4A3FG 2K75A 3D8GA 1HZAA 5BN5A 1KXLA 3R2IA 1WTQA 4DV6Q 1MSHA 3W2DA 1B70B 2RSNA 5LL6X 4RG1A 4LNQA 3HOWH 3A8KE 1E2VA 1CTMA 3HEJA 4PZ7A 5ELEA 3P20A 2R93G 1PH3A 3M4YA 1I6HB 1TWCB 1AZQA 3SK6A 4DR1L 2KEDA 3FDTA 1SYDA 3KLSA 1X6OA 1A6XA 1JORA 1IYVA 5BR8Q 4KMUC 2K1BA 2DJGC 3P7JA 4C3IG 3LWUA 2OTLA 4ZCKA 4GNXC 1MBYA 3VYRA 1AN8A 4XYOA 1DYQA 3J7YW 1X3QA 2F1MA 3K58A 4FP5D 3KOJA 1BCPF 1IYUA 1FVIA 1GJXA 5C4XG 5DM63 1E22A 4CDEC 1JT8A 3H0GG 3J7A5 5AFWA 2DN8A 5T1GA 1AH9A 1KL9A 4NMZA 1Y1VH 2KHJA 5JVG3 2QF7A 3PIPA 4X66Q 1I5FA 2VW9A 2V4DA 4A3CH 4A3DG 1KDCA 2EJFC 3S1RH 1WD0A 4CDCC 1Z6HA 3J81L 2AQ2B 3TREA 2R92B 2A6HD 3STBC 3BDCA 1C7YA 4KI0A 1PTOD 4MNOA 1JB7A 3K0XA 1G291 4K2KA 1EY6A 1SYBA 1HPCA 3D6CA 3H91A 4H02A 3SR1A 4FF1A 4NDXA 4A76A 2R92H 2BOSA 1PFMA 4KHZA 3GTMH 1EQTA 3Q6SA 3CCVA 3BZKA 2K50A 1G2SA 4OIKA 3QWNA 1NNXA 1HCZA 2L5TA 5C4ZA 1B8AA 4HIOA 2F3IA 5T1IA 4GKJQ 3MZ5A 2Q8RE 2NUCA 2EZVA 1EY7A 1EY4A 2ZXPA 2I5HA 4QY7A 1YHAA 4RKBA 1YJNA 1OTCA 3FPPA 1EFWA 4DK3C 3TZUA 3KJOA 2I5MX 4A75A 2CWAA 4FF4A 4GNXB 2F4VQ 1PRTD 4DV4Q 3CU7A 1VQNA 3AMUA 2AWNA 2F0HA 5LMUQ 3QIAA 5LMNQ 1W2BA 1PTOF 2A19A 2QEJC 2RKSA 4ZAIA 3HOXH 5M3MH 3M85A 2F0LA 2ZXOA 4J1MA 3EBEA 3HS0C 3CCLA 5DM73 1EIYB 2KJXA 1QOHA 4KJNA 5C44G 1CA6A 1M8AA 2Z1CA 5C4HA 1TXYA 3TMEA 1PZJD 1B1ZA 3GTKH 3GTLB 1BUVT 1Z7TA 4K6DA 4DV4L 1C9OA 2L4NA 1KDAA 2NVYB 4C2MB 4KY7A 2JYOA 4DR5L 1ICWA 1H95A 5C0XI 5AJ3Q 5C3WA 1ONLA 3UDGA 2XVSA 2DNCA 1SNPA 5CORA 5K36G 4NXML 2K5NA 1RD9D 5CYUA 4H7BA 1SE3A 2NWGA 1Y8PB 2ES2A 3URYA 1Q8IA 3VYUA 1IBML 2VUMB 1WTOA 2XGTA 2FHTA 4OL7A 3JAME 3S14B 1MI2A 2D9UA 1CZWA 3S1RB 4ME3A 2QILA 1PH5A 1WFQA 2B3GA 3MWYW 5C44B 5A2QE 1HNWQ 3FKIG 3ER0A 3BVZA 3RZOB 1ASZA 4XQNA 3PF4A 1IBKL 5FLXL 3F2CA 2K01A 5EAYA 3AQQA 5IYCH 5GADC 1JWMD 3W1BA 1ENCA 1BCPB 4U673 2OWOA 2F3VA 1S40A 4DAYA 5AJ3L 2JA7G 2B2TA 3RZDH 1H9RA 3NE5B 5CBEE 1A63A 3CHBD 5CGKA 5JEAH 1NCVA 2PW5A 4WJWA 1TR5A 2E5LQ 1K0RA 1SE8A 5M3MB 2PZWA 1EY5A 4JBJA 1NR2A 2I07B 2ENBA 3RLOA 4GKKL 1FYCA 1SYGA 5IGGA 2F0JA 2QGQA 4K5XA 4APVA 5ELNA 5HY6A 3W1GA 1I4GA 4QMGA 3TZDA 1CSQA 1N9WA 4KKSA 1TS4A 5JJKA 5E1FA 2K28A 3PUXA 5C3XA 5ELBA 4JVZA 1C8CA 3ND8A 1H9SB 1I4RA 4IPDA 4DN4M 3R3OA 1T5XD 1U4LA 3EFXD 4R4IA 3AU7A 4A3MB 1IKMA 4HIDA 5G3LF 1XPUA 4AYBG 1BBWA 2PMZB 3CCEA 1OXVA 3TP8A 2O5IC 3M7GA 4A3BG 3EROA 3HOWG 4DUYL 2CQOA 1CZGA 2F0FA 2IX0A 1HUNA 1KRSA 2JA5B 1J8IA 2B2UC 2LS01 4LW1A 2IHEA 1QJOA 3NBIA 3PCOB 3K5OA 3SXHA 5JPMC 2ZTEA 2Q8TA 1Q90A 2JA8G 2VXWA 4YWLA 3Q22A 1ASYA 3D4RA 5D14A 2E76C 4NKLA 2SOBA 1PH6A 1N34Q 1HHVA 3RNUA 1RKNA 4N9PA 2B63H 5EJWA 4EQ5A 3NTKA 1HR0Q 1YHBA 4OELB 1S5FD 2E8GA 4KY5A 4P75A 4KTAA 4ODGA 3H0GH 2NBFA 3PO3H 1IL2A 5H1SE 2DY8A 3NSWA 4DR2Q 2NTTA 4RGTA 3HOUH 2I0QA 2UU9Q 2Z4HA 1GVPA 4G57A 4P74A 4POFA 2GA4B 4JI0Q 3U9SA 5FLMG 1JOKA 3MAQA 5M5WH 2A6HC 2XIWA 1QVGA 1T5EA 2R7ZH 2R92G 2MGSA 2P5ZX 1EIGA 1QG7A 2FFKB 4A93G 1K0SA 1HUMA 4P72A 1IYJB 5C0XJ 2F0OA 1UNSA 1VQLA 5DEHA 4ABNA 1YJWA 4DR2L 1EWHA 3KLWA 4NPSA 1G51A 1S5ED 1VQCA 4C3IB 1B2TA 3NWTA 1WYDA 3M4QA 4EVOA 3CC2A 3T1HQ 2NTSA 1KRTA 2UXBQ 2LY7A 4JI0L 1CKNB 1SMXA 2FMMA 1X54A 4ZUIA 1C0AA 4KN7C 2DJFC 1NY4A 2JJQA 4HJ8A 1UEAB 2EY1A 2F0TA 1F9QA 1IW7C 3EVQA 3MXNA 1SBBB 4DR4L 4F88A 4K0KQ 1QUQB 1PLFA 3CP0A 4C56C 3A56A 1QWYA 1TKWB 5IGFA 2BH8A 3IFDA 1EY0A 3S16B 1WJJA 4MTKA 1GUWA 5M3MG 4DR7Q 4A3DB 2K5VA 2KCCA 4V190 1LT3D 2XNAC 4A3EB 5IGDA 3ITPA 1DD2A 1AE3A 5C44H 2BE5D 1EYAA 1DZ1A 4JK1C 4IZ8A 1TWHH 1MKHA 2V1CC 4IPGA 1CA5A 4OWWB 2UXBL 2E74C 2PMZE 3W3AA 3R8BA 4DAMA 4IUVA 1ICFB 4JBKA 3I4MB 2VQEL 1XXGA 5KIXA 3OTOL 1L1OB 3K7AB 4DKAC 1E24A 3PMFA 4LFBL 3OMCA 1XPRA 3DEOA 4XQJA 2F52A 4OGQC 4BY7G 1GD7A 2F0VA 1UE5A 3J80E 4C3JG 2JQOA 1Y8OB 3G7LA 4Y7NH 1KQSA 4OIJA 2M9VA 3OW2A 1HXYD 4DFAA 3RLNA 5C4XH 4A3LH 4MN3A 1STHA 3NUCA 4IOAA 4GS3A 1EL0A 4DXFA 5IE8A 4CGYB 5NUCA 2C35B 1N33L 2JA6B 3JAML 1O78A 3S1QH 3ERSX 3DWPA 1WTXA 1XMOQ 4BXXG 3HKZE 1LV9A 3F2DA 2WAQB 4DK1A 3CCSA 1XWEA 2F0QA 2RHSB 2LFNA 4RGMA 3OTOQ 3TQYA 1EYDA 3A8JE 1I94Q 1KIXA 2RCFA 3QOJA 2AKWB 2B2WC 4MIUA 2Y0SG 4X65Q 5J1ZA 1HTPA 4PG3A 1GUOA 3GTPH 4EQPA 1B9MA 4TSSA 1A3TA 5KYLA 5JEAG 4DXGA 1BDOA 2JP1A 5IIFA 4LFCQ 3PO2B 3I90A 1CT1D 3KLRA 3VR6A 3HOZG 3H15A 3RR5A 3BYYB 3DM1A 2NZHA 5LMNW 3J80c 1VQ4A 1DJRD 1N33Q 2LKVA 4PZ8A 1XYIA 1VQEA 3DWQA 2ICEC 1D7QA 1HH2P 2OXPA 1X9NA 2E2HH 4DNIA 2Z8LA 1NSNS 4CDDC 4GN4B 1P8LA 1VQDA 1SE4A 3CKIB 2Q8IB 1I94L 1NMGA 3EA6A 2HD3A 2HDMA 1U0LA 2Y0SB 1TWGH 2E2HB 2EQSA 4X66L 1CKMA 1NE3A 3OWFA 1BF4A 2N49A 3VR4A 4ZRZA 3GO5A 3TP7A 1YNJD 4B3SL 2RF4A 3HOYG 4J8QA 1F2MA 1HNXQ 3NBHA 1L0WA 2F3WA 2B2YA 2SNMA 1YIJA 4GNXA 4NXNQ 4U68A 1EIFA 3I91A 2NN6H 1O7LA 1PH4A 4JG2A 4RHSA 3AFQA 3H09A 2A6ED 3MC0B 2NZ1D 2B2TC 1M4VA 3PV0A 1PFBA 3I73A 1IZ6A 4QL5A 5ELDA 1SJED 4GLXA 5CV6A 1I50B 1K8AC 5M5XH 2BH2A 3NELA 3M4OB 3T1YL 1IW7D 1W6KA 2Q2HA 1IHZA 3L2PA 2R61A 5CMDA 4A3GG 3CC7A 5I9PA 1IKLA 3D3RA 1QVCA 2KUMA 1SNCA 1B53A 4R4TA 5GAEC 1D8LA 1I6HH 3N6RA 5EQ0A 1AZPA 3WWVA 3M7NA 1OXUA 5D3IB 1NUCA 4L6TB 4KHPL 2FJ2A 4LF6Q 3CAMA 2B39A 1QUQA 1B4OA 3F8TA 1VF5C 4LFAQ 4EQNA 1JE4A 5FO8B 2ZJRA 1E7ZA 1YNNC 1PV4A 1G2TA 1PRTC 4YWMA 4YHHQ 2G9HD 1IBLQ 3I8ZA 2JA9A 4G7OC 3P75A 3NTIA 5KNDA 2OQKA 3U4VA 3K7AH 1SN8A 3Q23A 3BYTB 1H9KA 1S5DD 3G4SA 3E5SA 1L1OC 2VL6A 4A93H 1MHWC 3GTMB 4OX9L 3LNNA 4H44C 3H0GB 2JSOA 1FNWA 2NVTB 1L0XB 4WJ3M 1B3QA 2XN9C 1Y69U 3B6YA 1Y1WG 3R93A 4F8MA 4DR5Q 3G71A 2WAQG 3VR5A 2TSSA 5IGEA 1VDZA 2NVYH 1A2UA 3VYTA 1K83H 5IYBH 4DV3L 2F0MA 3NXWA 3V05A 2PI2A 3F2BA 2NVXB 1B7YB 5CV7A 3I7FA 2EXZA 1J6QA 2KA7A 1PMRA 2SEBD 1IBMQ 4N9TA 2EJGC 4OONA 3S2DH 4K5VA 2HT1A 1TY2A 2ZJPA 3KDFB 1N32L 1PH8A 2YYZA 2BA1A 3H3VC 2K33A 4OX9Q 3FVQA 4JI8L 3NPPA 4BY1G 4AIMA 4DUZL 3GTPB 3A54A 1R9TH 4M1UB 4QUFA 5FO7B 2XWBB 3TS2A 2ASBA 2PQAB 2RSOA 4DK0A 5FLXc 1Y1VG 3O13A 1F2ZA 4AYBE 2LXJA 4ULLA 2J0TD 3I4MG 4RWSC 5C4JB 1HZCA 3RN2A 4R9WA 3TS0A 2DGYA 4G7ZC 2ZTDA 3SK8A 3I4LA 3SE0A 2Z6BA 1VQIA 1EQRA 2WIIB 3X3NA 4DF7A 3NK9A 1GO3E 3OHXC 1F9SA 2VQFQ 2YV5A 5IYCG 3GQBA 3PGZA 4BA2I 1JJGA 1HFNA 3P1HA 1YBYA 2E2IH 4DR3L 4ID6A 1U5KA 4GKKQ 1BR9A 2N3SA 2HCIA 3RD4A 3I4NB 1SYCA 4DPGA 1VQFA 2OF1A 1VF7A 3AB9A 1M1KC 1BQQT 3K0YA 4CKCA 4QB4A 4QCLA 4AYBB 2MQHA 2CKZB 3K7UC 3CPFA 5DAUA 1HTLD 4FXKC 1PRTF 3RUZA 1PYBA 2B2WA 4JCVE 1EEFD 1STBA 3TBIB 1EQQA 4IQZA 3HOZB 1Z9FA 3I56A 1CM9A 2OCEA 2EOTA 4JOIC 4X3UA 3A74A 4A3KB 4IFDH 2Z0SA 3UDXA 3FP9A 2D62A 2F0SA 3RZDB 3PO3B 1QZHA 2VQFL 4Q5VA 1EEID 4HJ5A 1D5MC 3NWSA 1VQ9A 4A3EH 2B63B 1MSGA 1SNDA 1WTPA 1V1PB 4IOCA 3K59A 1JCKB 1EZ8A 4A3KH 2WV6D 5J3BA 1Q1BA 1VS0A 5CV8A 1J5EL 1C48A 3MFYA 5CR3A 2MP1A 4TQUS 1EYGA 1I3QH 4JI3Q 1XJVA 4X64L 4LAAA 5FKAC 4B08A 1ET9A 4IURA 5LMUL 4RHRA 4A3BH 1AW7A 1ILQA 1V9PA 5LMNL 3A0JA 3DHQA 2SDFA 5EGTA 4A3FB 3J81j 4YY3L 1Q7YC 1GXDC 3I55A 3BVMA 1VQ6A 5A35A 3X3MA 4B3TQ 1VMPA 4DV0L 3M9BA 3T16A 3L7ZC 4G4KA 1X3FA 2EYMA 1LTGD 4KJOA 4K6LA 1A15A 1SAPA 3LGJA 3S1QB 4BBRH 1STGA 4GOPA 1TU2B 1D5XC 1PH2A 2F0KA 4Z9CB 5K36H 1YNXA 2A73B 4BA1I 1CKNA 3CCMA 3PUYA 2PI2E 1RJTA 3FHWA 2ATWA 4Y7NB 1SJHD 1CQFA 4YWKA 3HFZB 2KQ3A 4TKOB 2EY2A 3SK5A 4B3RL 1KHIA 3I70A 3S17H 5IP9G 3H3VI 5E4XA 1R9TB 4BBSB 1EUJA 2K5DA 2IW3A 1DOKA 4KKTA 3GTOB 4B3TL 3MEFA 4KY6A 1UE1A 5FK9C 1IBKQ 1PH1A 4K5WA 1KNAA 4XT1B 1V8QA 1KTKA 2MUYA 1SNMA 1QNKA 1MIUA 1K28A 1HNWL 3SEBA 3ERQA 1YEZA 2RBMA 4JV5Q 4HJ9A 1G6PA 3QB3A 4UY8C 5JJLA 1GKHA 4MHEA 1FD7D 2EPBA 4YCUA 5ISRA 3VDYA 1XNQQ 1CI3M 2FMCA 4RGOS 5KRUA 2MJ8A 1QCBD 3MXGA 4LUVA 2EJMA 4DV5L 1D1IA 4BY1B 5E7NA 1QB5D 3NHHA 2R93B 4DR7L 2VUMH 1OXSC 1VMCA 2LXKA 1UE7A 2L11A 3NP8A 3S15H 3KF8B 4IUTA 3DUZA 2MFIA 4X3KA 1X3EA 1Q8KA 4DK6C 4PMCA 1F9RA 5FLXE 1E1OA 4V0BA 2E2IB 2C9OA 4P73A 1HFGA 1SYFA 1TS5A 1CKOA 4BS9A 1LT5D 1PRTB 2QKIC 4YIJA 3W5OA 3MFGA 3GTLH 1BO0A 3GTKB 4OO1G 1FNUA 3TSSA 3L9AX 2ALYB 4H13C 2A8VA 1TT2A 1HRJA 1SFOH 4A3JG 3OWEB 1F2YA 4JYAL 1SXTA 5M5YB 1CK1A 5IYBG 2I46A 2BDOA 2Z9HA 3CCQA 3FKIB 5HGTA 1ZEQX 2X6GA 5J22A 5C4JH 1X56A 1SLJA 2K5WA 1LT6D 1UE6A 2WB1E 2WB1B 1UEBA 2JA8H 2HUGA 1RL2A 1LT4D 5EPJA 3R2TA 1EU4A 4GZYC 2L12A 1YHQA
chains in the Genus database with same CATH topology
2EE1A 5M5XB 3S2DB 3SDZA 3WOFA 3HOWB 1TIID 1TY0A 1TVXA 2O2LD 3OIPA 1STEA 1OXXK 4XT3B 3A8IE 3VA7A 1WVLA 1GUGA 3WDNA 2HDLA 1KNEA 2NB0A 4KV6A 2F0PA 3FEWX 3HOUB 2F0EA 2WINB 3PUVA 4RGNA 3BDLA 4DGZA 5C0XG 1I4QA 2A5HA 2IX3A 1A3UA 2NYZD 1BBXC 3DXJC 2EY5A 5I6WA 1S5BD 2A74C 2M00A 2O5JC 5C6AA 2F0IA 1X3PA 4CJ0B 4BY7B 3T53B 2EY6A 1SE2A 5I2XA 2AQ3B 1EIHA 2TMPA 2B2VA 4IUQA 3G6JB 3KK7A 4IUNA 2R3ZA 3HOVB 3PIO3 4KHVA 2CW0C 2EDGA 2F0UA 3S9WA 1RF2D 5LHY1 3J81E 3VYSA 3VA5A 5DNFA 2VNUD 4UAIA 2B2UA 4ILWA 1TS3A 3GV6A 4M8AA 1QE6A 5IODA 4R8IA 1QILA 1S5CD 4HCSA 4LJZC 5M3FB 2AUJD 2R7ZB 3QOLA 2OEOA 1D5ZC 4K14A 2DNEA 4XXEA 3HZXA 2PNRC 2E2JB 1IL8A 1BCPD 2PZUA 4C3HB 1F9PA 1DXMA 2X6LA 1GUSA 1AP0A 3BS1A 2ZXRA 4RKLA 1I3QB 2K05A 3BVGA 2RDHA 5K5PA 2EVBA 2CHBD 1WTRA 1LTID 4QF4A 3IAYA 1R4PB 5JAVA 2QDBA 3OPOA 5FOBB 1ZYRC 4HN7A 3IL8A 4I65A 1CQVA 3S1NB 2AQ1B 1DCZA 1RODA 2YU9B 1DOMA 3C2PA 1Y1WB 2K5QA 5TSSA 3N52A 4G7HC 1ENFA 3RMHA 1LTBD 4ZLTF 3D4WA 2QCPX 1KLGD 1U4RA 3I72A 2IPKD 5IT9L 5F2DA 1B9NA 5JJZA 1SNQA 1GUTA 1FNVA 5E3FA 1G6ZA 3KF8A 1HQMC 3NQTA 2CQAA 1ZXTA 4KK7A 1EZ6A 3TN2A 3H94A 3S15B 5EPKA 4OO1H 2NN6I 3PUZA 4H0LC 3ND9A 3V96A 3Q24A 1TWHB 2NN6G 1STYA 1KLUD 1Z47A 5JOBA 4KN4C 1KDBA 1BXTA 1G8ZD 1DOLA 1AEXA 4ZUJA 2JXMB 1Q12A 1TS2A 2E75C 2F0GA 1LTAD 1GUNA 3HKZB 2IL8A 1B44D 3MTSA 1EY9A 4F87A 4HMIA 1ESRA 4NW2A 1YNND 3T56B 2MHVA 1I4PA 1CFMA 2XWJB 3PUWA 4DAPA 4DAVA 4IFDG 1ML0D 4HAEA 2CW0D 3BZDB 3MA2B 4DU9A 1LO5D 1LTRD 4RH6A 1Y8NB 1RTOA 2PYKA 1CHPD 5EKIA 1VCIA 4RCOA 4FYDA 4BBRB 5KNBA 4IUUA 4X3SA 5CC4A 3BDOA 5IGBA 1ENAA 1GHJA 3T13A 2JA8B 2FINB 2K32A 1V43A 2LMCB 3PIP3 3HG9A 2EYJA 4FVMA 3F2UA 2L9HA 2MPMA 5D3DA 1SDFA 4QIWB 1LTSD 1SFOB 2IX1A 5EBCA 1H9JA 3L3OC 5JEAJ 2SNSA 5I6YA 3J80L 4JBWA 1B3AA 3MVVA 3OIQA 4O42A 5C3EB 3E6ZX 3EJIA 1I4XA 3K5LA 4PMWA 5KYIA 2JEAI 1PFNA 2K7VA 1LABA 5E4WC 5BN4A 3SK4A 3BG3A 4B9XA 1B50A 2L0CA 1S4ZA 1HA6A 3SVMA 3TP5A 1G91A 1SSOA 2IT1A 5C5LA 1PZKD 2JEBI 5EKLA 4OO1I 1CHQD 2BE5C 1E2WA 4PV1C 4BWGB 3ZYYX 3TP6A 4NP5A 3K6OA 4CJ1B 3GTQB 2ICIA 4IALA 2OT2A 3H6MA 4O1NA 4RA8A 1YNJC 1U9RA 2F0DA 1FGBD 2G9DA 3UI2A 4J6HA 3HGBA 1JQYD 2PZTA 1K8MA 1TQOA 1KAAA 2JE6I 3DMUA 4CKEA 2PPBC 2B2VC 4XTCS 3S2HB 1EFID 1RCVD 5EKKA 4ZK9B 1AFPA 1PDQA 4PNYA 3NTHA 5D65A 1RDPD 4HEDA 5C0XH 4K2LA 1D6EC 2XRSD 1JOQA 4A3BB 1BOSA 3E0JA 4ZYSA 5C4XB 2D2CC 2H1EA 3D31A 5EBDA 2VB2X 2B8GA 2B2YC 1LACA 1KABA 4FXGC 4OHJA 2IJ0A 5IGCA 1JB3A 2AWOA 2KOLA 1EYCA 1H9MA 4ZKBB 1NAPA 3IKJA 3FMCA 2R6GA 1JWUD 1GOZA 1V1OA 3D4DA 1JICA 2KCNA 1ZYRD 2VB3X 1DONA 2CVRA 2XRQD 1I4HA 2HQEA 5EPLA 4X3TA 4C1NK 3T51B 5KGUA 1O7ZA 5J39A 1PTOH 2EYOA 1SNOA 1E2ZA 2PQEA 1H9SA 3CRKC 3FPUB 4ZKCB 5I2YA 3VR3A 1A2TA 3GTGB 5KNCA 1DM0B 2PCFB 1UAPA 1ZKOA 2XSCA 3ONAB 5I4DA 4HR7B 2L1BA 5IT9E 4E6IA 4LK1C 2ID0A 4RFBA 1NR4A 3J7AV 4S3SA 3HOXB 1STAA 2EYPA 1MGSA 1XTCD 1ESFA 1II3A 4WRDA 3OMGA 1O7YA 3KBXA 1JC7A 5C5MA 1C4QA 1PZID 4L8JA 3GV3A 3K5MA 3QG1A 3IFTA 4LMQD 3GP7A 2RQXA 4UDUC 4DNRB 1L0YB 5BN3A 5M5WB 4FF2A 1LLRD 1SYEA 3NQIA 3MHBA 3V2TA 3T4AC 2L55A 1PXUA 2KVMA 2RDGA 2RVLA 4IUPA 3KLSX 5KEEA 1TWGB 4P2CB 4FXDA 2F4IA 1X32A 2BA0A 2N55A 2EYFA 5LL6S 2ZT9C 1PTOC 3MXUA 1OXTA 1K8OA 2J4XA 5A2QL 3C3LA 1EOTA 4CHTB 3WOEA 4TRDA 4FO2A 4EGVA 4RAUC 4KKUA 1UUPA 5HURA 3CRLC 2JA7B 4QUCA 1TWFB 4HSPA 2A69D 1PYWD 1U4MA 2M2LA 3S1MB 1JWSD 3DEPA 3OW7A 2KECA 1QNUA 3OSOA 3QJYA 3A55A 3C46A 3S17B 1WTVA 2NVQB 5ELCA 3Q0AA 2N88A 3C1FA 3MEHA 2KHSA 2Z4IA 1TWAB 4FF3A 1STNA 2X69A 4K8IA 3RLFA 3A7AB 1Q3LA 3C1EA 2A68D 3KBGA 2IWHA 5COYA 1D2BA 1RHPA 4DA2A 3HOYB 4CJ2C 2BCOA 4WFN3 1HA5A 4XIGS 4I7ZC 3VR2A 1HQRD 2K04A 2WKDA 5JPNC 4HSVA 4C3HG 4WORA 1F2LA 2K03A 4K8JA 4RCNA 3TDQA 3GD7A 5G3LD 2DY7A 3MXPA 2F0NA 1W6JA 1K83B 1ILPA 1EU3A 3FRPB 2J7ZA 4A3GB 3A7LA 4DNTB 1A3VA 4C1NI 3HP3A 4A3JB 1U4PA 3D6WA 2E2DC 3SHLA 5FO9B 2RA4A 1ET6A 4IN3A 3LWEA 1JOOA 5CBAE 3U9OA 1XX8A 2AUKA 1D1KA 3EQLC 4CBVA 3DWAA 4KD4A 2WKCA 1WTWA 2KEEA 2C5CA 1F77A 3LX0A 4PMBA 4B9WA 1RTNA 2O4XA 2EYHA 1BNZA 3CQZB 2RDFA 4F7XA 5IOCA 3J7AF 3HRZC 5ELFA 4XQQA 3KUPA 1MD2D 2EYLA 1EWCA 2A6EC 1V1PA 2PW7A 2WP8J 4PQXA 3GTJB 1BCPC 1J9OA 4Q0FA 4ME5A 3I3CA 1WD1A 1WCMB 2WACA 5CV5A 1JR0D 3K5NA 1SMYC 3QO2A 1E0BA 1R4QB 3K57A 4HMJA 1Q1EA 1SMYD 4ZQ3A 2H4OA 1GHKA 1LTTD 5CV4A 2BDNA 1PTOB 2B8FA 5CV9A 5M9OA 4R8NA 4HTHA 1I6VC 1O80A 4C3JB 1EQVA 2D5DA 2K6AA 2F03A 4XDXA 1EY8A 4IFDI 1OO9B 5I9OA 2A69C 5JVH3 4EQOA 4A93B 4FNFA 4IFDJ 4HCEA 3M3YB 2A68C 2F0WA 2HCCA 1FR3A 1Y1VB 1SEBD 4XYQA 4A3IB 4KD3A 3OOCA 2PO4A 4CKBA 4L63B 3D8GA 5BN5A 1WTQA 3R2IA 1MSHA 3W2DA 2RSNA 5LL6X 3A8KE 1E2VA 1CTMA 3HEJA 5ELEA 3P20A 1I6HB 3M4YA 1TWCB 1AZQA 3SK6A 2KEDA 3FDTA 1SYDA 3KLSA 1A6XA 1JORA 1IYVA 4KMUC 2K1BA 3P7JA 4C3IG 3LWUA 1MBYA 3VYRA 1AN8A 4XYOA 1DYQA 3J7YW 1X3QA 2F1MA 3K58A 4FP5D 1BCPF 1IYUA 1GJXA 5DM63 5AFWA 2DN8A 5T1GA 4NMZA 5JVG3 2QF7A 2V4DA 1KDCA 2EJFC 1WD0A 1Z6HA 3J81L 2AQ2B 2R92B 2A6HD 3BDCA 4KI0A 1PTOD 1G291 4K2KA 1EY6A 1SYBA 1HPCA 3D6CA 3H91A 4FF1A 3SR1A 4NDXA 2BOSA 1PFMA 4KHZA 1EQTA 3Q6SA 1G2SA 4OIKA 3QWNA 1HCZA 2L5TA 5C4ZA 5T1IA 3MZ5A 2Q8RE 2NUCA 2EZVA 1EY7A 1EY4A 2ZXPA 4RKBA 3FPPA 3TZUA 4FF4A 1PRTD 3CU7A 3AMUA 2AWNA 2F0HA 3QIAA 1PTOF 2QEJC 2RKSA 4ZAIA 3M85A 2F0LA 2ZXOA 4J1MA 3HS0C 5DM73 2KJXA 1QOHA 4KJNA 1CA6A 1M8AA 2Z1CA 5C4HA 3TMEA 1PZJD 1B1ZA 3GTLB 1BUVT 1Z7TA 4K6DA 2L4NA 1KDAA 2NVYB 4C2MB 4KY7A 2JYOA 1ICWA 5C0XI 5C3WA 1ONLA 2XVSA 2DNCA 1SNPA 5CORA 5K36G 1RD9D 5CYUA 4H7BA 1SE3A 2NWGA 1Y8PB 3URYA 1Q8IA 3VYUA 2VUMB 1WTOA 2FHTA 4OL7A 3JAME 3S14B 1MI2A 2D9UA 1CZWA 3S1RB 2QILA 3MWYW 5C44B 5A2QE 3BVZA 3RZOB 4XQNA 5FLXL 2K01A 1JWMD 1ENCA 1BCPB 4U673 2F3VA 4DAYA 2B2TA 1H9RA 3NE5B 5CBEE 3CHBD 5CGKA 5JEAH 1NCVA 2PW5A 4WJWA 1TR5A 5M3MB 2PZWA 1EY5A 1NR2A 2I07B 2ENBA 1FYCA 1SYGA 5IGGA 2F0JA 4K5XA 1I4GA 4QMGA 3TZDA 4KKSA 1TS4A 5E1FA 2K28A 3PUXA 5C3XA 5ELBA 1C8CA 3ND8A 1H9SB 1I4RA 4DN4M 3R3OA 1T5XD 1U4LA 3EFXD 3AU7A 4A3MB 1IKMA 5G3LF 2PMZB 1OXVA 3TP8A 2O5IC 3M7GA 3EROA 1CZGA 2F0FA 2IX0A 1HUNA 2JA5B 1J8IA 2B2UC 2LS01 1QJOA 3NBIA 3SXHA 3K5OA 5JPMC 2Q8TA 1Q90A 2VXWA 3Q22A 3D4RA 5D14A 2E76C 4NKLA 2SOBA 1HHVA 1RKNA 4N9PA 5EJWA 3NTKA 1S5FD 4KY5A 4KTAA 4ODGA 2NBFA 2DY8A 3NSWA 2NTTA 4RGTA 2Z4HA 4G57A 2GA4B 3U9SA 1JOKA 3MAQA 2A6HC 2XIWA 1T5EA 2MGSA 1EIGA 1QG7A 2FFKB 1HUMA 5C0XJ 2F0OA 1UNSA 5DEHA 4ABNA 1EWHA 1S5ED 4C3IB 1B2TA 3NWTA 4EVOA 2NTSA 2LY7A 2FMMA 4ZUIA 4KN7C 1UEAB 2EY1A 2F0TA 1F9QA 1IW7C 3EVQA 3MXNA 1SBBB 4F88A 1PLFA 4C56C 3A56A 1QWYA 1TKWB 5IGFA 3IFDA 1EY0A 3S16B 1GUWA 4A3DB 2KCCA 4V190 1LT3D 2XNAC 4A3EB 5IGDA 3ITPA 1DD2A 2BE5D 1EYAA 1DZ1A 4JK1C 4IZ8A 1CA5A 2E74C 3R8BA 3W3AA 4IUVA 3I4MB 1XXGA 5KIXA 3K7AB 3PMFA 3OMCA 3DEOA 4XQJA 4OGQC 2F0VA 3J80E 4C3JG 1Y8OB 3G7LA 4OIJA 2M9VA 1HXYD 4DFAA 1STHA 3NUCA 4MN3A 1EL0A 4DXFA 4CGYB 5NUCA 2JA6B 3JAML 1O78A 3DWPA 1WTXA 1LV9A 2WAQB 4DK1A 1XWEA 2F0QA 2LFNA 4RGMA 1EYDA 3A8JE 3QOJA 2B2WC 4MIUA 5J1ZA 1HTPA 1GUOA 4EQPA 1B9MA 4TSSA 1A3TA 5KYLA 5JEAG 4DXGA 1BDOA 2JP1A 5IIFA 3PO2B 3I90A 1CT1D 3KLRA 3VR6A 3BYYB 3DM1A 1DJRD 2LKVA 1XYIA 3DWQA 2ICEC 2OXPA 2Z8LA 1NSNS 1SE4A 3CKIB 2Q8IB 3EA6A 2HDMA 2Y0SB 2E2HB 3OWFA 1BF4A 3VR4A 4ZRZA 3GO5A 3TP7A 1YNJD 4J8QA 1F2MA 3NBHA 2F3WA 2B2YA 2SNMA 4U68A 3I91A 2NN6H 1O7LA 4RHSA 3H09A 2A6ED 3MC0B 2NZ1D 2B2TC 1M4VA 3PV0A 1PFBA 3I73A 5ELDA 1SJED 5CV6A 1I50B 3M4OB 1IW7D 1W6KA 1IHZA 2R61A 5CMDA 5I9PA 1IKLA 3D3RA 2KUMA 1SNCA 1B53A 3N6RA 5EQ0A 1AZPA 3M7NA 1OXUA 5D3IB 1NUCA 4L6TB 2FJ2A 2B39A 1B4OA 1VF5C 4EQNA 1JE4A 5FO8B 1YNNC 1G2TA 1PRTC 2G9HD 3I8ZA 4G7OC 3P75A 3NTIA 5KNDA 3Q23A 3BYTB 1H9KA 1S5DD 3E5SA 3GTMB 3LNNA 4H44C 3H0GB 2JSOA 1FNWA 2NVTB 1L0XB 2XN9C 1Y69U 3R93A 4F8MA 3VR5A 2TSSA 5IGEA 1VDZA 1A2UA 3VYTA 2F0MA 3NXWA 3V05A 2NVXB 5CV7A 2EXZA 2KA7A 1PMRA 2SEBD 4N9TA 2EJGC 4K5VA 1TY2A 2YYZA 2BA1A 3H3VC 2K33A 3FVQA 3NPPA 3GTPB 3A54A 4M1UB 4QUFA 5FO7B 2XWBB 2RSOA 4DK0A 3O13A 1F2ZA 4ULLA 2J0TD 4RWSC 5C4JB 4R9WA 4G7ZC 3SK8A 3I4LA 3SE0A 4DF7A 2WIIB 3X3NA 3NK9A 3OHXC 1F9SA 3GQBA 4BA2I 1HFNA 3P1HA 4ID6A 1BR9A 2HCIA 3RD4A 3I4NB 1SYCA 2OF1A 1VF7A 3AB9A 1BQQT 3K0YA 4CKCA 4QB4A 4QCLA 4AYBB 5DAUA 1HTLD 4FXKC 1PRTF 3RUZA 2B2WA 1EEFD 1STBA 3TBIB 4IQZA 3HOZB 1CM9A 2EOTA 4X3UA 4A3KB 4IFDH 3PO3B 3RZDB 2D62A 2F0SA 4Q5VA 1EEID 1D5MC 3NWSA 2B63B 1MSGA 1SNDA 1WTPA 1V1PB 3K59A 1JCKB 1EZ8A 2WV6D 1Q1BA 5CV8A 1C48A 3MFYA 5CR3A 2MP1A 4TQUS 4LAAA 5FKAC 4B08A 1ET9A 4IURA 4RHRA 1AW7A 1ILQA 3DHQA 2SDFA 5EGTA 4A3FB 1GXDC 3BVMA 5A35A 3X3MA 1VMPA 3T16A 3L7ZC 4G4KA 2EYMA 1LTGD 4KJOA 4K6LA 1A15A 1SAPA 3S1QB 1STGA 1TU2B 1D5XC 2F0KA 4Z9CB 5K36H 2A73B 4BA1I 3PUYA 1RJTA 4Y7NB 1SJHD 1CQFA 2KQ3A 4TKOB 2EY2A 3SK5A 3I70A 5E4XA 1R9TB 4BBSB 2K5DA 2IW3A 1DOKA 4KKTA 3GTOB 4KY6A 5FK9C 4K5WA 1KNAA 4XT1B 1V8QA 1KTKA 2MUYA 1SNMA 1QNKA 3SEBA 3ERQA 2RBMA 3QB3A 4MHEA 1FD7D 2EPBA 5ISRA 1CI3M 2FMCA 4RGOS 5KRUA 2MJ8A 1QCBD 3MXGA 2EJMA 1D1IA 4BY1B 1QB5D 3NHHA 2R93B 1OXSC 1VMCA 2L11A 3NP8A 4IUTA 3DUZA 4X3KA 4PMCA 1F9RA 5FLXE 4V0BA 2E2IB 2C9OA 1HFGA 1SYFA 1TS5A 4BS9A 1LT5D 1PRTB 2QKIC 4YIJA 3MFGA 1BO0A 3GTKB 4OO1G 1FNUA 3TSSA 3L9AX 4H13C 1TT2A 1HRJA 3OWEB 1F2YA 1SXTA 5M5YB 1CK1A 2I46A 2BDOA 3FKIB 5HGTA 1ZEQX 2X6GA 5J22A 2K5WA 1LT6D 2WB1B 2HUGA 1LT4D 5EPJA 3R2TA 1EU4A 4GZYC 2L12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP7 A;  5D3D A;  1T5X D;  4TSS A;  5ELF A;  3EFX D;  1HA5 A;  4DXG A;  2NTS A;  1BCP F;  1D5Z C;  1PZJ D;  1B1Z A;  1HQR D;  4ZYS A;  4UDU C;  1LTS D;  1MD2 D;  1CT1 D;  1PRT C;  1EWC A;  1L0Y B;  1TY0 A;  5FK9 C;  2G9H D;  1V1P A;  2O2L D;  1LLR D;  1HTL D;  3BYY B;  1BCP D;  1PRT F;  1KTK A;  1STE A;  1SBB B;  3BYT B;  1EEF D;  1BCP C;  1DJR D;  1S5D D;  4C56 C;  4OHJ A;  2IJ0 A;  3SEB A;  1KLU D;  1JR0 D;  3DWQ A;  1RD9 D;  2RDG A;  1SE3 A;  3KLS X;  2AQ2 B;  3BVG A;  2RDH A;  1FNW A;  1LTT D;  1LT3 D;  3URY A;  1BXT A;  1G8Z D;  1L0X B;  2Z8L A;  1JWU D;  1FD7 D;  1GOZ A;  1PTO B;  1PTO D;  1V1O A;  1EEI D;  2XNA C;  2XN9 C;  1D5M C;  1SE4 A;  4RGN A;  2CHB D;  1I4X A;  2QIL A;  4RGO S;  1I4Q A;  1TS2 A;  3EA6 A;  1EU3 A;  1V1P B;  1LTI D;  1PTO C;  2XRQ D;  1I4H A;  1LTA D;  1JCK B;  2J4X A;  2TSS A;  3BVZ A;  2WV6 D;  1S5F D;  3R8B A;  1S5B D;  3V05 A;  1B44 D;  1CQV A;  1XXG A;  2AQ1 B;  2SEB D;  5FKA C;  1ET9 A;  1ET6 A;  1JWM D;  1UUP A;  1PTO H;  1BCP B;  4RHR A;  2NTT A;  1AW7 A;  4RGT A;  1TY2 A;  1I4P A;  4RHS A;  1SE2 A;  1PZK D;  1PYW D;  1SEB D;  1TS5 A;  2AQ3 B;  1JWS D;  3MC0 B;  5TSS A;  1M4V A;  3CHB D;  1LT5 D;  1PRT B;  1CHQ D;  3BZD B;  4L63 B;  1ENF A;  3BVM A;  4BWG B;  1HXY D;  3MFG A;  2ICI A;  1LTB D;  5ELD A;  1SJE D;  1FNU A;  3TSS A;  1LO5 D;  5ELC A;  1LTR D;  1LTG D;  1PRT D;  3R2I A;  4O1N A;  4RH6 A;  4DXF A;  4K6L A;  5I4D A;  3W2D A;  1CHP D;  3O13 A;  1FGB D;  4RCO A;  1KLG D;  3DWA A;  1RF2 D;  5ELE A;  3OWE B;  1D5X C;  4RFB A;  1PTO F;  1SXT A;  2IPK D;  1F77 A;  2QEJ C;  1CK1 A;  1JQY D;  3DWP A;  4Z9C B;  2R61 A;  1XTC D;  1I4G A;  1EFI D;  1UNS A;  1ESF A;  1RCV D;  4RGM A;  1LT6 D;  1TS3 A;  1TS4 A;  1SJH D;  1FNV A;  1QIL A;  1RDP D;  1S5C D;  5ELB A;  1LT4 D;  3R2T A;  4L6T B;  1PZI D;  1EU4 A;  5D3I B;  1S5E D;  1D6E C;  1I4R A;  1AN8 A;  2XRS D;  1DYQ A; 
#chains in the Genus database with same CATH topology
 2EE1 A;  5M5X B;  3S2D B;  3SDZ A;  3WOF A;  2UUB L;  4QIW E;  3HOW B;  4JI2 L;  1MJC A;  4LF5 L;  1TII D;  1TY0 A;  1TVX A;  3MXN B;  2QEX A;  2O2L D;  4UHV A;  3PO3 G;  3OIP A;  4BBS G;  1E1T A;  1VQM A;  1STE A;  1OXX K;  4XT3 B;  3A8I E;  1HR0 L;  4X65 L;  3VA7 A;  4LWC A;  4R1J A;  1WVL A;  4LF8 L;  1GUG A;  3WDN A;  2HDL A;  1KNE A;  3G48 A;  2NB0 A;  4KV6 A;  2F0P A;  3FEW X;  3PQI A;  2F0E A;  2HIX A;  3HOU B;  2K14 A;  2QDL A;  2WIN B;  4L5T A;  3PUV A;  4GLA C;  4RGN A;  3BDL A;  2CCZ A;  4EX5 A;  1L1O A;  4DGZ A;  5C0X G;  3KF6 B;  1NJI C;  1I4Q A;  2A5H A;  3I2Z A;  2R7Z G;  2IX3 A;  2K4K A;  2GVB A;  1A3U A;  2NYZ D;  1BBX C;  3DXJ C;  2EY5 A;  5I6W A;  1PH7 A;  1S5B D;  2A74 C;  2UXC L;  2M00 A;  2UUB Q;  2O5J C;  1XPO A;  5C6A A;  2F0I A;  4OEM B;  1X3P A;  4C3H H;  2WB1 G;  2GN5 A;  2LSS A;  1K8G A;  4CJ0 B;  4LF7 Q;  4BY7 B;  3T53 B;  2EY6 A;  1SE2 A;  3HKZ G;  5I2X A;  5M3F H;  2AQ3 B;  1EIH A;  4IPH A;  2TMP A;  2B2V A;  4IUQ A;  3G6J B;  3KK7 A;  4IUN A;  3GTO H;  5IP7 G;  2R3Z A;  2PNH A;  3HOV B;  3PIO 3;  5FJ8 G;  1LYL A;  4KHV A;  2CW0 C;  2EDG A;  2F0U A;  4K0K L;  3S9W A;  3S2H H;  1RF2 D;  5LHY 1;  3J81 E;  1A0I A;  3VYS A;  2WFW A;  3VA5 A;  1EOV A;  5DNF A;  5M5Y H;  3HOY H;  5IT9 c;  2VNU D;  4UAI A;  2B2U A;  3I4N G;  2OQ0 A;  4ILW A;  1TS3 A;  1K3B C;  3GV6 A;  4M8A A;  1QE6 A;  4DR4 Q;  5IOD A;  4R8I A;  1QIL A;  1S5C D;  4HCS A;  4LJZ C;  5M3F B;  4DV1 Q;  1A8V A;  5C3E G;  2AUJ D;  1Y1W H;  1JJ2 A;  2R7Z B;  4X62 L;  3QR8 A;  3QOL A;  3Q8D A;  2OEO A;  1D5Z C;  4K14 A;  2KBN A;  1GM5 A;  2DNE A;  4XXE A;  3GTQ H;  1P16 A;  4N8X 1;  3HZX A;  2PNR C;  4QJF A;  2E2J B;  1IL8 A;  4GLV B;  1BCP D;  2PZU A;  1L2F A;  4C3H B;  2QW7 A;  1O7I A;  2A1A A;  1K9M C;  1F9P A;  1DXM A;  4JI7 L;  4GOP B;  4LF6 L;  2X6L A;  4JI4 L;  3EIV A;  3CMA A;  4C3J H;  1GUS A;  1AP0 A;  3BS1 A;  4BY1 H;  2ZXR A;  4RKL A;  1I3Q B;  1NBW A;  2K05 A;  3ULP A;  3BVG A;  2RDH A;  5K5P A;  2FXQ A;  2EVB A;  2N78 A;  3UE0 A;  2CHB D;  1Q81 C;  1N36 L;  1WTR A;  1FJG L;  1LTI D;  4QF4 A;  4X62 Q;  3IAY A;  1R4P B;  4QQB X;  5JAV A;  2QDB A;  1QZG A;  3OPO A;  5FOB B;  1ZYR C;  1VQH A;  4HN7 A;  4LF4 L;  1WCM H;  4BXX H;  3IL8 A;  4I65 A;  5IYD H;  1CQV A;  3S1N B;  4L5Q A;  2AQ1 B;  1VQ8 A;  1DCZ A;  2K52 A;  1FGU A;  3CCU A;  1ROD A;  2UUC L;  2YU9 B;  5IWA L;  1DOM A;  3C2P A;  1Y1W B;  2K5Q A;  2YTV A;  4JPB W;  4JI4 Q;  5TSS A;  3N52 A;  1XMO L;  4G7H C;  2Z6K C;  1ENF A;  3BU2 A;  4TVA B;  3RMH A;  1KAW A;  2JA6 G;  1LTB D;  2CH4 W;  4ZLT F;  4N8F A;  1N36 Q;  5JJI A;  3D4W A;  2QCP X;  3CQZ H;  1KLG D;  1HR0 W;  2OTJ A;  1U4R A;  3I72 A;  2IPK D;  3ULJ A;  3PF5 A;  2RCN A;  5IT9 L;  2ZM6 L;  1HZB A;  5F2D A;  1LUZ A;  1B9N A;  5JJZ A;  1SNQ A;  1GUT A;  1PA6 A;  1FNV A;  2UXD Q;  5E3F A;  2AMC B;  1G6Z A;  3KF8 A;  1HQM C;  3NQT A;  2CQA A;  1ZXT A;  4KK7 A;  4A3K G;  1TWA H;  1CUK A;  4OWT B;  1EZ6 A;  3TN2 A;  3H94 A;  3S15 B;  4A3F H;  4JI1 Q;  5EPK A;  4OO1 H;  2NN6 I;  3PUZ A;  4AQY Q;  4H0L C;  4CDF C;  3ND9 A;  3V96 A;  4NXN L;  4DV6 L;  3Q24 A;  5BR8 L;  1TWH B;  2NN6 G;  1STY A;  3CW2 C;  4DV7 L;  1KLU D;  1Z47 A;  4DR3 Q;  5JOB A;  3HOV G;  4KN4 C;  4B3S Q;  3CCJ A;  1KDB A;  1XTD A;  1BXT A;  1G8Z D;  1DOL A;  1AEX A;  4ZUJ A;  2JXM B;  1Q12 A;  1TS2 A;  2E75 C;  2F0G A;  4UPA A;  5GRO A;  4MTN A;  4BBR G;  1LTA D;  3KDF A;  4A3M G;  3S14 H;  3BZC A;  2WAQ E;  1GUN A;  3HKZ B;  2IL8 A;  1B44 D;  3MTS A;  1WTH A;  1EY9 A;  4F87 A;  4HMI A;  1ESR A;  3K80 C;  3A5U A;  3PO2 H;  4NW2 A;  2NVT H;  2JN4 A;  1YNN D;  3T56 B;  2MHV A;  1I4P A;  1CFM A;  1XMQ L;  5IP9 H;  4A3C G;  3PSI A;  2XWJ B;  3PUW A;  4DAP A;  4DAV A;  4IFD G;  1ML0 D;  4HAE A;  2E2J H;  2CW0 D;  3BZD B;  3MA2 B;  1Y14 B;  3KYH C;  1J5E Q;  4QGU A;  2VS1 A;  1PVO A;  4DU9 A;  1LO5 D;  4JI3 L;  1LTR D;  4X64 Q;  4A3E G;  4RH6 A;  1Y8N B;  3KFU A;  1RTO A;  2PYK A;  5ELO A;  1CHP D;  5EKI A;  1VCI A;  1XNR Q;  4RCO A;  4FYD A;  1VQP A;  4BBR B;  5KNB A;  4IUU A;  4X3S A;  1BBU A;  5CC4 A;  2JA5 G;  3BDO A;  5IGB A;  1YZ6 A;  4YY3 Q;  1ENA A;  1GHJ A;  4L5R C;  3T13 A;  2JA8 B;  2FIN B;  2K32 A;  1V43 A;  2F4V L;  2LMC B;  3PIP 3;  4FDB A;  3HG9 A;  1EWI A;  3M4O H;  2EYJ A;  1XMQ Q;  4FVM A;  3F2U A;  2L9H A;  2MPM A;  4AH6 A;  5D3D A;  1WI5 A;  1SDF A;  4QIW B;  4JW0 A;  1LTS D;  1SFO B;  1YIT A;  2IX1 A;  2MO0 A;  1PYS B;  5EBC A;  3DM3 A;  1H9J A;  1XNR L;  1NMF A;  1RIP A;  2R7F A;  3L3O C;  5JEA J;  3L0O A;  2SNS A;  5I6Y A;  3J80 L;  2IY5 B;  4JBW A;  1B3A A;  3TEH B;  3MVV A;  4DUZ Q;  1X55 A;  3OIQ A;  4O42 A;  1HJP A;  5C3E B;  4YCV A;  3J81 c;  3E6Z X;  3EJI A;  5GAG C;  4DR6 Q;  4DAY B;  1YVC A;  3KF6 A;  3D0F A;  1I4X A;  2KCT A;  3K5L A;  1N32 Q;  2JK8 A;  4PMW A;  3I4M H;  4LF9 L;  1VQA A;  5KYI A;  2JEA I;  1PFN A;  2EXD A;  2K7V A;  1LAB A;  5E4W C;  5BN4 A;  2R93 H;  4JI8 Q;  3SK4 A;  1K3R A;  3BG3 A;  4B9X A;  1B50 A;  2L0C A;  1S4Z A;  1HA6 A;  1HNZ Q;  3SVM A;  2Y0S E;  3E3X A;  4UP8 A;  4GOP C;  4POG A;  3TP5 A;  1G91 A;  3UE1 A;  3AYH B;  1SSO A;  2IHF A;  2KHI A;  4C3I H;  2IT1 A;  5C5L A;  4DV5 Q;  1PZK D;  2H5X A;  2JEB I;  5EKL A;  4DR1 Q;  4OO1 I;  1CHQ D;  2BE5 C;  3J81 i;  1E2W A;  4PV1 C;  4BWG B;  3ZYY X;  4GN5 A;  4NP5 A;  3K6O A;  3TP6 A;  4CJ1 B;  3GTQ B;  2ICI A;  3DLL A;  3CME A;  4IAL A;  1X3G A;  1VQO A;  5DLQ E;  2OT2 A;  3H6M A;  4O1N A;  4RA8 A;  1YNJ C;  2KCM A;  3U50 C;  1U9R A;  2F0D A;  1FGB D;  2G9D A;  3UI2 A;  3F1Z A;  4J6H A;  3HGB A;  1JQY D;  2PZT A;  1K8M A;  1TQO A;  1KAA A;  2JE6 I;  1DGS A;  2RHQ B;  3DMU A;  4CKE A;  2PPB C;  2NVQ H;  5IYD G;  2B2V C;  4XTC S;  3S2H B;  1EFI D;  1Q46 A;  1RCV D;  5EKK A;  4ZK9 B;  1AFP A;  1PDQ A;  4PNY A;  3NTH A;  2N8N A;  1RDP D;  5D65 A;  1PFS A;  4HED A;  3CF5 A;  1Q82 C;  5C0X H;  2JA7 H;  4K2L A;  2HQL A;  1D6E C;  2XRS D;  1JOQ A;  4P71 A;  4A3B B;  1TWC H;  1BOS A;  3M4P A;  1VQ5 A;  3E0J A;  2E5L L;  4B3M L;  3E9H A;  4ZYS A;  5C4X B;  2D2C C;  2H1E A;  2JA6 H;  3D31 A;  3GDE A;  5EBD A;  3PIO A;  1SRO A;  2YU9 H;  2VB2 X;  4A3I H;  2B8G A;  1VQK A;  1FL0 A;  1LAC A;  2B2Y C;  1KAB A;  4FXG C;  4OHJ A;  2IJ0 A;  5IGC A;  1JB3 A;  2AWO A;  1VQB A;  5M3F G;  2CH4 A;  4PZ6 A;  4OWX B;  2KOL A;  2MO1 A;  1K73 C;  1EYC A;  2I5L X;  1H9M A;  4ZKB B;  1NAP A;  3IKJ A;  4DV0 Q;  1KD1 C;  3FMC A;  4JI2 Q;  2ZJQ A;  2R6G A;  1JWU D;  1GOZ A;  1V1O A;  3D4D A;  1JIC A;  4GKJ L;  1YI2 A;  2KCN A;  1ZYR D;  2VB3 X;  1DON A;  4DUY Q;  3RN5 A;  3BJU A;  2CVR A;  2XRQ D;  1I4H A;  2HQE A;  3ULL A;  5EPL A;  5IY0 A;  4J15 A;  1HZ9 A;  3UDF A;  2PQA A;  4B3M Q;  4X3T A;  4ALP A;  4C1N K;  3T51 B;  5KGU A;  1VQ7 A;  1O7Z A;  3I4N H;  1LM0 A;  5J39 A;  1PTO H;  2EYO A;  1SNO A;  3K81 C;  1A62 A;  1E2Z A;  2PQE A;  4B3R Q;  1H9S A;  3CRK C;  1N34 L;  3FPU B;  4ZKC B;  5I2Y A;  5C3E H;  4A3D H;  1W3S A;  3CCR A;  3VR3 A;  1A2T A;  3G6E A;  3GTG B;  4HIK A;  5KNC A;  3H3V H;  1DM0 B;  2PCF B;  1UAP A;  1ZKO A;  2Q2I A;  2XSC A;  1LTL A;  4O0A A;  3ONA B;  3CC4 A;  5I4D A;  1WOC A;  2KEN A;  4HR7 B;  2L1B A;  5IT9 E;  4E6I A;  4LF7 L;  4LK1 C;  2ID0 A;  4RFB A;  4A3M H;  1NR4 A;  2DUD A;  3J7A V;  4JV5 L;  4S3S A;  3HOX B;  1STA A;  2VY3 A;  2EYP A;  1MGS A;  1XTC D;  4MZ9 A;  2Z6K A;  1ESF A;  1SR3 A;  1II3 A;  4WRD A;  4NB3 A;  3OMG A;  3STB D;  3HKS A;  1O7Y A;  3KBX A;  1XNQ L;  4UP9 A;  1JC7 A;  1TWF H;  5C5M A;  4L8J A;  1C4Q A;  1PZI D;  1VQG A;  2G5D A;  3GV3 A;  3QG1 A;  3K5M A;  3IFT A;  4LMQ D;  1AE2 A;  2XTI A;  4NXM Q;  3GP7 A;  2HHH L;  2RQX A;  3OYY A;  4UDU C;  4JOI A;  4DNR B;  2VUM G;  4JI5 Q;  3M3Y H;  1L0Y B;  5GQO A;  5BN3 A;  5IP7 H;  5M5W B;  4FF2 A;  5FJ8 H;  1LLR D;  3EN2 A;  2CFM A;  1SYE A;  3NQI A;  1PHJ A;  3IRB A;  1M90 C;  3RZO H;  3MHB A;  3V2T A;  3T4A C;  2L55 A;  1PXU A;  2KVM A;  3HOX G;  2RDG A;  2RVL A;  1MJE A;  4IUP A;  3CXC A;  3KLS X;  5KEE A;  1TWG B;  4P2C B;  4FXD A;  2F4I A;  1X32 A;  2BA0 A;  1KC8 C;  2N55 A;  2NVX H;  2EYF A;  5LL6 S;  2ZT9 C;  3JAM i;  1PTO C;  3MXU A;  1OXT A;  4C2M H;  4A3J H;  2J4X A;  4JI7 Q;  2QA4 A;  5A2Q L;  4JYA Q;  1K8O A;  3C3L A;  4IJL A;  2HHH Q;  1EOT A;  4CHT B;  4LUZ A;  3WOE A;  4TRD A;  4JI5 L;  4FO2 A;  4EGV A;  4RAU C;  4KKU A;  1UUP A;  2VZA A;  3CPW A;  5HUR A;  3CRL C;  1FJG Q;  2Q2U A;  2JA7 B;  4QUC A;  1TWF B;  2R7D A;  5HGQ A;  4HSP A;  2A69 D;  1PYW D;  1U4M A;  2M2L A;  3S1M B;  1JWS D;  3DEP A;  3OW7 A;  2KEC A;  1QNU A;  3OSO A;  3QJY A;  3A55 A;  2NZO A;  4LF4 Q;  4LF5 Q;  3C46 A;  3S17 B;  1WTV A;  1JJC B;  2NVQ B;  5ELC A;  3Q0A A;  1BVS A;  2N88 A;  3C1F A;  4BBS H;  3MEH A;  3S24 A;  4LFB Q;  3FKI H;  2KHS A;  2Q2T A;  1NTG A;  2Z4I A;  1TWA B;  4FF3 A;  1STN A;  5L37 A;  4LF8 Q;  2ZTC A;  2X69 A;  1V1Q A;  4K8I A;  1WCM G;  3HOV H;  2L15 A;  3RLF A;  1QVF A;  4DV2 L;  2YTY A;  4IJH A;  3A7A B;  4GN3 B;  4A4I A;  1Q3L A;  3C1E A;  1S72 A;  2A68 D;  3KBG A;  3ZJY C;  2IWH A;  5COY A;  1D2B A;  1RHP A;  4DA2 A;  3HOY B;  4CJ2 C;  2B63 G;  1JMC A;  2BCO A;  4WFN 3;  4HIM A;  1HA5 A;  4XIG S;  4I7Z C;  3VR2 A;  1HQR D;  2K04 A;  2WKD A;  4O2D A;  5JPN C;  1UWV A;  3J7Z C;  2D0O A;  4A3L G;  4X6A H;  3CD6 A;  4HSV A;  2AHO B;  3UDI A;  4HJA A;  1I50 H;  3A5Z B;  4C3H G;  4OXP A;  3S1M H;  2UXD L;  1CSP A;  4WOR A;  1F2L A;  2K03 A;  3AEV A;  4K8J A;  3JAM c;  3E0E A;  4RCN A;  3TDQ A;  3GD7 A;  2UUA Q;  5G3L D;  2DY7 A;  3MXP A;  2UXC Q;  3S1N H;  4LFC L;  4DV2 Q;  2F0N A;  1W6J A;  5FLM H;  4AQY L;  1K83 B;  2HIV A;  1ILP A;  3NEN A;  1X65 A;  3J80 i;  4IO9 A;  2UU9 L;  1EU3 A;  4UP7 A;  3FRP B;  4DV7 Q;  1T9H A;  2J7Z A;  4A3G B;  3A7L A;  4DNT B;  5GAH C;  1A3V A;  4C1N I;  3HP3 A;  2JA5 H;  3S16 H;  4A3J B;  1U4P A;  1S3O A;  3D6W A;  3HOZ H;  3KJP A;  2E2D C;  3SHL A;  5FO9 B;  4JBM A;  3GTJ H;  2RA4 A;  4A3I G;  1ET6 A;  4IN3 A;  3LWE A;  1JOO A;  1E3P A;  4R4O A;  4JC0 A;  2CWP A;  1YJ9 A;  5CBA E;  3E9I A;  3U9O A;  2UUA L;  3NEM A;  3SGI A;  4Y52 H;  1XX8 A;  3K8A A;  2AUK A;  1Q86 C;  1D1K A;  4JI6 L;  3EQL C;  4WJ4 A;  4DV1 L;  4CBV A;  1IXR A;  3DWA A;  4KD4 A;  4RMF A;  2WKC A;  1WTW A;  2KEE A;  4I7A A;  2C5C A;  1F77 A;  3T1H L;  3LX0 A;  4R4C A;  1VQJ A;  4PMB A;  1JE5 A;  4B9W A;  1RTN A;  2O4X A;  2B29 A;  2EYH A;  1HNX L;  4KLK A;  1BNZ A;  3PO2 G;  3CQZ B;  2RDF A;  4F7X A;  3HOU G;  5IOC A;  1BKB A;  3J7A F;  3HRZ C;  4IPC A;  2YTX A;  5ELF A;  2MNA A;  4XQQ A;  3KUP A;  3U58 A;  1MD2 D;  2EYL A;  1EWC A;  3I4O A;  2A6E C;  1V1P A;  3ICE A;  3U4Z A;  2PW7 A;  2WP8 J;  1N8R C;  4PQX A;  4JI6 Q;  2K5H A;  3GTJ B;  1BCP C;  1J9O A;  4Q0F A;  4ME5 A;  3I3C A;  3T1Y Q;  1WD1 A;  1WCM B;  4BY7 H;  2WAC A;  5CV5 A;  1JR0 D;  3K5N A;  3GTG H;  4L5S A;  1SMY C;  3QO2 A;  1E0B A;  1R4Q B;  2EIF A;  3K57 A;  4HMJ A;  1Q1E A;  1SMY D;  4ZQ3 A;  1PH9 A;  4A3G H;  2H4O A;  1GHK A;  2VQE Q;  4YCW A;  1LTT D;  5CV4 A;  2BDN A;  1PTO B;  3JC6 6;  1IBL L;  2UUC Q;  2B8F A;  5CV9 A;  3AFP A;  5IWA Q;  5M9O A;  4R8N A;  4KHP Q;  4LUO A;  4HTH A;  4HJ7 A;  1I6V C;  1O80 A;  4C3J B;  1EQV A;  2D5D A;  4LFA L;  2K6A A;  2F03 A;  4XDX A;  1EY8 A;  4IFD I;  1OO9 B;  5I9O A;  4YHH L;  2A69 C;  5JVH 3;  4DR6 L;  4EQO A;  2D0P A;  4A93 B;  3NBH B;  4FNF A;  4IFD J;  4HCE A;  3M3Y B;  2A68 C;  2F0W A;  4LF9 Q;  2HCC A;  2GVA A;  1FR3 A;  1Y1V B;  1SEB D;  4XYQ A;  4A3I B;  4KD3 A;  3OOC A;  2PO4 A;  1SRU A;  4L63 B;  4CKB A;  3TRZ A;  2ZM6 Q;  4DV3 Q;  4R4Q A;  1HNZ L;  4JI1 L;  4A3F G;  2K75 A;  3D8G A;  1HZA A;  5BN5 A;  1KXL A;  3R2I A;  1WTQ A;  4DV6 Q;  1MSH A;  3W2D A;  1B70 B;  2RSN A;  5LL6 X;  4RG1 A;  4LNQ A;  3HOW H;  3A8K E;  1E2V A;  1CTM A;  3HEJ A;  4PZ7 A;  5ELE A;  3P20 A;  2R93 G;  1PH3 A;  3M4Y A;  1I6H B;  1TWC B;  1AZQ A;  3SK6 A;  4DR1 L;  2KED A;  3FDT A;  1SYD A;  3KLS A;  1X6O A;  1A6X A;  1JOR A;  1IYV A;  5BR8 Q;  4KMU C;  2K1B A;  2DJG C;  3P7J A;  4C3I G;  3LWU A;  2OTL A;  4ZCK A;  4GNX C;  1MBY A;  3VYR A;  1AN8 A;  4XYO A;  1DYQ A;  3J7Y W;  1X3Q A;  2F1M A;  3K58 A;  4FP5 D;  3KOJ A;  1BCP F;  1IYU A;  1FVI A;  1GJX A;  5C4X G;  5DM6 3;  1E22 A;  4CDE C;  1JT8 A;  3H0G G;  3J7A 5;  5AFW A;  2DN8 A;  5T1G A;  1AH9 A;  1KL9 A;  4NMZ A;  1Y1V H;  2KHJ A;  5JVG 3;  2QF7 A;  3PIP A;  4X66 Q;  1I5F A;  2VW9 A;  2V4D A;  4A3C H;  4A3D G;  1KDC A;  2EJF C;  3S1R H;  1WD0 A;  4CDC C;  1Z6H A;  3J81 L;  2AQ2 B;  3TRE A;  2R92 B;  2A6H D;  3STB C;  3BDC A;  1C7Y A;  4KI0 A;  1PTO D;  4MNO A;  1JB7 A;  3K0X A;  1G29 1;  4K2K A;  1EY6 A;  1SYB A;  1HPC A;  3D6C A;  3H91 A;  4H02 A;  3SR1 A;  4FF1 A;  4NDX A;  4A76 A;  2R92 H;  2BOS A;  1PFM A;  4KHZ A;  3GTM H;  1EQT A;  3Q6S A;  3CCV A;  3BZK A;  2K50 A;  1G2S A;  4OIK A;  3QWN A;  1NNX A;  1HCZ A;  2L5T A;  5C4Z A;  1B8A A;  4HIO A;  2F3I A;  5T1I A;  4GKJ Q;  3MZ5 A;  2Q8R E;  2NUC A;  2EZV A;  1EY7 A;  1EY4 A;  2ZXP A;  2I5H A;  4QY7 A;  1YHA A;  4RKB A;  1YJN A;  1OTC A;  3FPP A;  1EFW A;  4DK3 C;  3TZU A;  3KJO A;  2I5M X;  4A75 A;  2CWA A;  4FF4 A;  4GNX B;  2F4V Q;  1PRT D;  4DV4 Q;  3CU7 A;  1VQN A;  3AMU A;  2AWN A;  2F0H A;  5LMU Q;  3QIA A;  5LMN Q;  1W2B A;  1PTO F;  2A19 A;  2QEJ C;  2RKS A;  4ZAI A;  3HOX H;  5M3M H;  3M85 A;  2F0L A;  2ZXO A;  4J1M A;  3EBE A;  3HS0 C;  3CCL A;  5DM7 3;  1EIY B;  2KJX A;  1QOH A;  4KJN A;  5C44 G;  1CA6 A;  1M8A A;  2Z1C A;  5C4H A;  1TXY A;  3TME A;  1PZJ D;  1B1Z A;  3GTK H;  3GTL B;  1BUV T;  1Z7T A;  4K6D A;  4DV4 L;  1C9O A;  2L4N A;  1KDA A;  2NVY B;  4C2M B;  4KY7 A;  2JYO A;  4DR5 L;  1ICW A;  1H95 A;  5C0X I;  5AJ3 Q;  5C3W A;  1ONL A;  3UDG A;  2XVS A;  2DNC A;  1SNP A;  5COR A;  5K36 G;  4NXM L;  2K5N A;  1RD9 D;  5CYU A;  4H7B A;  1SE3 A;  2NWG A;  1Y8P B;  2ES2 A;  3URY A;  1Q8I A;  3VYU A;  1IBM L;  2VUM B;  1WTO A;  2XGT A;  2FHT A;  4OL7 A;  3JAM E;  3S14 B;  1MI2 A;  2D9U A;  1CZW A;  3S1R B;  4ME3 A;  2QIL A;  1PH5 A;  1WFQ A;  2B3G A;  3MWY W;  5C44 B;  5A2Q E;  1HNW Q;  3FKI G;  3ER0 A;  3BVZ A;  3RZO B;  1ASZ A;  4XQN A;  3PF4 A;  1IBK L;  5FLX L;  3F2C A;  2K01 A;  5EAY A;  3AQQ A;  5IYC H;  5GAD C;  1JWM D;  3W1B A;  1ENC A;  1BCP B;  4U67 3;  2OWO A;  2F3V A;  1S40 A;  4DAY A;  5AJ3 L;  2JA7 G;  2B2T A;  3RZD H;  1H9R A;  3NE5 B;  5CBE E;  1A63 A;  3CHB D;  5CGK A;  5JEA H;  1NCV A;  2PW5 A;  4WJW A;  1TR5 A;  2E5L Q;  1K0R A;  1SE8 A;  5M3M B;  2PZW A;  1EY5 A;  4JBJ A;  1NR2 A;  2I07 B;  2ENB A;  3RLO A;  4GKK L;  1FYC A;  1SYG A;  5IGG A;  2F0J A;  2QGQ A;  4K5X A;  4APV A;  5ELN A;  5HY6 A;  3W1G A;  1I4G A;  4QMG A;  3TZD A;  1CSQ A;  1N9W A;  4KKS A;  1TS4 A;  5JJK A;  5E1F A;  2K28 A;  3PUX A;  5C3X A;  5ELB A;  4JVZ A;  1C8C A;  3ND8 A;  1H9S B;  1I4R A;  4IPD A;  4DN4 M;  3R3O A;  1T5X D;  1U4L A;  3EFX D;  4R4I A;  3AU7 A;  4A3M B;  1IKM A;  4HID A;  5G3L F;  1XPU A;  4AYB G;  1BBW A;  2PMZ B;  3CCE A;  1OXV A;  3TP8 A;  2O5I C;  3M7G A;  4A3B G;  3ERO A;  3HOW G;  4DUY L;  2CQO A;  1CZG A;  2F0F A;  2IX0 A;  1HUN A;  1KRS A;  2JA5 B;  1J8I A;  2B2U C;  2LS0 1;  4LW1 A;  2IHE A;  1QJO A;  3NBI A;  3PCO B;  3K5O A;  3SXH A;  5JPM C;  2ZTE A;  2Q8T A;  1Q90 A;  2JA8 G;  2VXW A;  4YWL A;  3Q22 A;  1ASY A;  3D4R A;  5D14 A;  2E76 C;  4NKL A;  2SOB A;  1PH6 A;  1N34 Q;  1HHV A;  3RNU A;  1RKN A;  4N9P A;  2B63 H;  5EJW A;  4EQ5 A;  3NTK A;  1HR0 Q;  1YHB A;  4OEL B;  1S5F D;  2E8G A;  4KY5 A;  4P75 A;  4KTA A;  4ODG A;  3H0G H;  2NBF A;  3PO3 H;  1IL2 A;  5H1S E;  2DY8 A;  3NSW A;  4DR2 Q;  2NTT A;  4RGT A;  3HOU H;  2I0Q A;  2UU9 Q;  2Z4H A;  1GVP A;  4G57 A;  4P74 A;  4POF A;  2GA4 B;  4JI0 Q;  3U9S A;  5FLM G;  1JOK A;  3MAQ A;  5M5W H;  2A6H C;  2XIW A;  1QVG A;  1T5E A;  2R7Z H;  2R92 G;  2MGS A;  2P5Z X;  1EIG A;  1QG7 A;  2FFK B;  4A93 G;  1K0S A;  1HUM A;  4P72 A;  1IYJ B;  5C0X J;  2F0O A;  1UNS A;  1VQL A;  5DEH A;  4ABN A;  1YJW A;  4DR2 L;  1EWH A;  3KLW A;  4NPS A;  1G51 A;  1S5E D;  1VQC A;  4C3I B;  1B2T A;  3NWT A;  1WYD A;  3M4Q A;  4EVO A;  3CC2 A;  3T1H Q;  2NTS A;  1KRT A;  2UXB Q;  2LY7 A;  4JI0 L;  1CKN B;  1SMX A;  2FMM A;  1X54 A;  4ZUI A;  1C0A A;  4KN7 C;  2DJF C;  1NY4 A;  2JJQ A;  4HJ8 A;  1UEA B;  2EY1 A;  2F0T A;  1F9Q A;  1IW7 C;  3EVQ A;  3MXN A;  1SBB B;  4DR4 L;  4F88 A;  4K0K Q;  1QUQ B;  1PLF A;  3CP0 A;  4C56 C;  3A56 A;  1QWY A;  1TKW B;  5IGF A;  2BH8 A;  3IFD A;  1EY0 A;  3S16 B;  1WJJ A;  4MTK A;  1GUW A;  5M3M G;  4DR7 Q;  4A3D B;  2K5V A;  2KCC A;  4V19 0;  1LT3 D;  2XNA C;  4A3E B;  5IGD A;  3ITP A;  1DD2 A;  1AE3 A;  5C44 H;  2BE5 D;  1EYA A;  1DZ1 A;  4JK1 C;  4IZ8 A;  1TWH H;  1MKH A;  2V1C C;  4IPG A;  1CA5 A;  4OWW B;  2UXB L;  2E74 C;  2PMZ E;  3W3A A;  3R8B A;  4DAM A;  4IUV A;  1ICF B;  4JBK A;  3I4M B;  2VQE L;  1XXG A;  5KIX A;  3OTO L;  1L1O B;  3K7A B;  4DKA C;  1E24 A;  3PMF A;  4LFB L;  3OMC A;  1XPR A;  3DEO A;  4XQJ A;  2F52 A;  4OGQ C;  4BY7 G;  1GD7 A;  2F0V A;  1UE5 A;  3J80 E;  4C3J G;  2JQO A;  1Y8O B;  3G7L A;  4Y7N H;  1KQS A;  4OIJ A;  2M9V A;  3OW2 A;  1HXY D;  4DFA A;  3RLN A;  5C4X H;  4A3L H;  4MN3 A;  1STH A;  3NUC A;  4IOA A;  4GS3 A;  1EL0 A;  4DXF A;  5IE8 A;  4CGY B;  5NUC A;  2C35 B;  1N33 L;  2JA6 B;  3JAM L;  1O78 A;  3S1Q H;  3ERS X;  3DWP A;  1WTX A;  1XMO Q;  4BXX G;  3HKZ E;  1LV9 A;  3F2D A;  2WAQ B;  4DK1 A;  3CCS A;  1XWE A;  2F0Q A;  2RHS B;  2LFN A;  4RGM A;  3OTO Q;  3TQY A;  1EYD A;  3A8J E;  1I94 Q;  1KIX A;  2RCF A;  3QOJ A;  2AKW B;  2B2W C;  4MIU A;  2Y0S G;  4X65 Q;  5J1Z A;  1HTP A;  4PG3 A;  1GUO A;  3GTP H;  4EQP A;  1B9M A;  4TSS A;  1A3T A;  5KYL A;  5JEA G;  4DXG A;  1BDO A;  2JP1 A;  5IIF A;  4LFC Q;  3PO2 B;  3I90 A;  1CT1 D;  3KLR A;  3VR6 A;  3HOZ G;  3H15 A;  3RR5 A;  3BYY B;  3DM1 A;  2NZH A;  5LMN W;  3J80 c;  1VQ4 A;  1DJR D;  1N33 Q;  2LKV A;  4PZ8 A;  1XYI A;  1VQE A;  3DWQ A;  2ICE C;  1D7Q A;  1HH2 P;  2OXP A;  1X9N A;  2E2H H;  4DNI A;  2Z8L A;  1NSN S;  4CDD C;  4GN4 B;  1P8L A;  1VQD A;  1SE4 A;  3CKI B;  2Q8I B;  1I94 L;  1NMG A;  3EA6 A;  2HD3 A;  2HDM A;  1U0L A;  2Y0S B;  1TWG H;  2E2H B;  2EQS A;  4X66 L;  1CKM A;  1NE3 A;  3OWF A;  1BF4 A;  2N49 A;  3VR4 A;  4ZRZ A;  3GO5 A;  3TP7 A;  1YNJ D;  4B3S L;  2RF4 A;  3HOY G;  4J8Q A;  1F2M A;  1HNX Q;  3NBH A;  1L0W A;  2F3W A;  2B2Y A;  2SNM A;  1YIJ A;  4GNX A;  4NXN Q;  4U68 A;  1EIF A;  3I91 A;  2NN6 H;  1O7L A;  1PH4 A;  4JG2 A;  4RHS A;  3AFQ A;  3H09 A;  2A6E D;  3MC0 B;  2NZ1 D;  2B2T C;  1M4V A;  3PV0 A;  1PFB A;  3I73 A;  1IZ6 A;  4QL5 A;  5ELD A;  1SJE D;  4GLX A;  5CV6 A;  1I50 B;  1K8A C;  5M5X H;  2BH2 A;  3NEL A;  3M4O B;  3T1Y L;  1IW7 D;  1W6K A;  2Q2H A;  1IHZ A;  3L2P A;  2R61 A;  5CMD A;  4A3G G;  3CC7 A;  5I9P A;  1IKL A;  3D3R A;  1QVC A;  2KUM A;  1SNC A;  1B53 A;  4R4T A;  5GAE C;  1D8L A;  1I6H H;  3N6R A;  5EQ0 A;  1AZP A;  3WWV A;  3M7N A;  1OXU A;  5D3I B;  1NUC A;  4L6T B;  4KHP L;  2FJ2 A;  4LF6 Q;  3CAM A;  2B39 A;  1QUQ A;  1B4O A;  3F8T A;  1VF5 C;  4LFA Q;  4EQN A;  1JE4 A;  5FO8 B;  2ZJR A;  1E7Z A;  1YNN C;  1PV4 A;  1G2T A;  1PRT C;  4YWM A;  4YHH Q;  2G9H D;  1IBL Q;  3I8Z A;  2JA9 A;  4G7O C;  3P75 A;  3NTI A;  5KND A;  2OQK A;  3U4V A;  3K7A H;  1SN8 A;  3Q23 A;  3BYT B;  1H9K A;  1S5D D;  3G4S A;  3E5S A;  1L1O C;  2VL6 A;  4A93 H;  1MHW C;  3GTM B;  4OX9 L;  3LNN A;  4H44 C;  3H0G B;  2JSO A;  1FNW A;  2NVT B;  1L0X B;  4WJ3 M;  1B3Q A;  2XN9 C;  1Y69 U;  3B6Y A;  1Y1W G;  3R93 A;  4F8M A;  4DR5 Q;  3G71 A;  2WAQ G;  3VR5 A;  2TSS A;  5IGE A;  1VDZ A;  2NVY H;  1A2U A;  3VYT A;  1K83 H;  5IYB H;  4DV3 L;  2F0M A;  3NXW A;  3V05 A;  2PI2 A;  3F2B A;  2NVX B;  1B7Y B;  5CV7 A;  3I7F A;  2EXZ A;  1J6Q A;  2KA7 A;  1PMR A;  2SEB D;  1IBM Q;  4N9T A;  2EJG C;  4OON A;  3S2D H;  4K5V A;  2HT1 A;  1TY2 A;  2ZJP A;  3KDF B;  1N32 L;  1PH8 A;  2YYZ A;  2BA1 A;  3H3V C;  2K33 A;  4OX9 Q;  3FVQ A;  4JI8 L;  3NPP A;  4BY1 G;  4AIM A;  4DUZ L;  3GTP B;  3A54 A;  1R9T H;  4M1U B;  4QUF A;  5FO7 B;  2XWB B;  3TS2 A;  2ASB A;  2PQA B;  2RSO A;  4DK0 A;  5FLX c;  1Y1V G;  3O13 A;  1F2Z A;  4AYB E;  2LXJ A;  4ULL A;  2J0T D;  3I4M G;  4RWS C;  5C4J B;  1HZC A;  3RN2 A;  4R9W A;  3TS0 A;  2DGY A;  4G7Z C;  2ZTD A;  3SK8 A;  3I4L A;  3SE0 A;  2Z6B A;  1VQI A;  1EQR A;  2WII B;  3X3N A;  4DF7 A;  3NK9 A;  1GO3 E;  3OHX C;  1F9S A;  2VQF Q;  2YV5 A;  5IYC G;  3GQB A;  3PGZ A;  4BA2 I;  1JJG A;  1HFN A;  3P1H A;  1YBY A;  2E2I H;  4DR3 L;  4ID6 A;  1U5K A;  4GKK Q;  1BR9 A;  2N3S A;  2HCI A;  3RD4 A;  3I4N B;  1SYC A;  4DPG A;  1VQF A;  2OF1 A;  1VF7 A;  3AB9 A;  1M1K C;  1BQQ T;  3K0Y A;  4CKC A;  4QB4 A;  4QCL A;  4AYB B;  2MQH A;  2CKZ B;  3K7U C;  3CPF A;  5DAU A;  1HTL D;  4FXK C;  1PRT F;  3RUZ A;  1PYB A;  2B2W A;  4JCV E;  1EEF D;  1STB A;  3TBI B;  1EQQ A;  4IQZ A;  3HOZ B;  1Z9F A;  3I56 A;  1CM9 A;  2OCE A;  2EOT A;  4JOI C;  4X3U A;  3A74 A;  4A3K B;  4IFD H;  2Z0S A;  3UDX A;  3FP9 A;  2D62 A;  2F0S A;  3RZD B;  3PO3 B;  1QZH A;  2VQF L;  4Q5V A;  1EEI D;  4HJ5 A;  1D5M C;  3NWS A;  1VQ9 A;  4A3E H;  2B63 B;  1MSG A;  1SND A;  1WTP A;  1V1P B;  4IOC A;  3K59 A;  1JCK B;  1EZ8 A;  4A3K H;  2WV6 D;  5J3B A;  1Q1B A;  1VS0 A;  5CV8 A;  1J5E L;  1C48 A;  3MFY A;  5CR3 A;  2MP1 A;  4TQU S;  1EYG A;  1I3Q H;  4JI3 Q;  1XJV A;  4X64 L;  4LAA A;  5FKA C;  4B08 A;  1ET9 A;  4IUR A;  5LMU L;  4RHR A;  4A3B H;  1AW7 A;  1ILQ A;  1V9P A;  5LMN L;  3A0J A;  3DHQ A;  2SDF A;  5EGT A;  4A3F B;  3J81 j;  4YY3 L;  1Q7Y C;  1GXD C;  3I55 A;  3BVM A;  1VQ6 A;  5A35 A;  3X3M A;  4B3T Q;  1VMP A;  4DV0 L;  3M9B A;  3T16 A;  3L7Z C;  4G4K A;  1X3F A;  2EYM A;  1LTG D;  4KJO A;  4K6L A;  1A15 A;  1SAP A;  3LGJ A;  3S1Q B;  4BBR H;  1STG A;  4GOP A;  1TU2 B;  1D5X C;  1PH2 A;  2F0K A;  4Z9C B;  5K36 H;  1YNX A;  2A73 B;  4BA1 I;  1CKN A;  3CCM A;  3PUY A;  2PI2 E;  1RJT A;  3FHW A;  2ATW A;  4Y7N B;  1SJH D;  1CQF A;  4YWK A;  3HFZ B;  2KQ3 A;  4TKO B;  2EY2 A;  3SK5 A;  4B3R L;  1KHI A;  3I70 A;  3S17 H;  5IP9 G;  3H3V I;  5E4X A;  1R9T B;  4BBS B;  1EUJ A;  2K5D A;  2IW3 A;  1DOK A;  4KKT A;  3GTO B;  4B3T L;  3MEF A;  4KY6 A;  1UE1 A;  5FK9 C;  1IBK Q;  1PH1 A;  4K5W A;  1KNA A;  4XT1 B;  1V8Q A;  1KTK A;  2MUY A;  1SNM A;  1QNK A;  1MIU A;  1K28 A;  1HNW L;  3SEB A;  3ERQ A;  1YEZ A;  2RBM A;  4JV5 Q;  4HJ9 A;  1G6P A;  3QB3 A;  4UY8 C;  5JJL A;  1GKH A;  4MHE A;  1FD7 D;  2EPB A;  4YCU A;  5ISR A;  3VDY A;  1XNQ Q;  1CI3 M;  2FMC A;  4RGO S;  5KRU A;  2MJ8 A;  1QCB D;  3MXG A;  4LUV A;  2EJM A;  4DV5 L;  1D1I A;  4BY1 B;  5E7N A;  1QB5 D;  3NHH A;  2R93 B;  4DR7 L;  2VUM H;  1OXS C;  1VMC A;  2LXK A;  1UE7 A;  2L11 A;  3NP8 A;  3S15 H;  3KF8 B;  4IUT A;  3DUZ A;  2MFI A;  4X3K A;  1X3E A;  1Q8K A;  4DK6 C;  4PMC A;  1F9R A;  5FLX E;  1E1O A;  4V0B A;  2E2I B;  2C9O A;  4P73 A;  1HFG A;  1SYF A;  1TS5 A;  1CKO A;  4BS9 A;  1LT5 D;  1PRT B;  2QKI C;  4YIJ A;  3W5O A;  3MFG A;  3GTL H;  1BO0 A;  3GTK B;  4OO1 G;  1FNU A;  3TSS A;  3L9A X;  2ALY B;  4H13 C;  2A8V A;  1TT2 A;  1HRJ A;  1SFO H;  4A3J G;  3OWE B;  1F2Y A;  4JYA L;  1SXT A;  5M5Y B;  1CK1 A;  5IYB G;  2I46 A;  2BDO A;  2Z9H A;  3CCQ A;  3FKI B;  5HGT A;  1ZEQ X;  2X6G A;  5J22 A;  5C4J H;  1X56 A;  1SLJ A;  2K5W A;  1LT6 D;  1UE6 A;  2WB1 E;  2WB1 B;  1UEB A;  2JA8 H;  2HUG A;  1RL2 A;  1LT4 D;  5EPJ A;  3R2T A;  1EU4 A;  4GZY C;  2L12 A;  1YHQ A; 
#chains in the Genus database with same CATH homology
 2EE1 A;  5M5X B;  3S2D B;  3SDZ A;  3WOF A;  3HOW B;  1TII D;  1TY0 A;  1TVX A;  2O2L D;  3OIP A;  1STE A;  1OXX K;  4XT3 B;  3A8I E;  3VA7 A;  1WVL A;  1GUG A;  3WDN A;  2HDL A;  1KNE A;  2NB0 A;  4KV6 A;  2F0P A;  3FEW X;  3HOU B;  2F0E A;  2WIN B;  3PUV A;  4RGN A;  3BDL A;  4DGZ A;  5C0X G;  1I4Q A;  2A5H A;  2IX3 A;  1A3U A;  2NYZ D;  1BBX C;  3DXJ C;  2EY5 A;  5I6W A;  1S5B D;  2A74 C;  2M00 A;  2O5J C;  5C6A A;  2F0I A;  1X3P A;  4CJ0 B;  4BY7 B;  3T53 B;  2EY6 A;  1SE2 A;  5I2X A;  2AQ3 B;  1EIH A;  2TMP A;  2B2V A;  4IUQ A;  3G6J B;  3KK7 A;  4IUN A;  2R3Z A;  3HOV B;  3PIO 3;  4KHV A;  2CW0 C;  2EDG A;  2F0U A;  3S9W A;  1RF2 D;  5LHY 1;  3J81 E;  3VYS A;  3VA5 A;  5DNF A;  2VNU D;  4UAI A;  2B2U A;  4ILW A;  1TS3 A;  3GV6 A;  4M8A A;  1QE6 A;  5IOD A;  4R8I A;  1QIL A;  1S5C D;  4HCS A;  4LJZ C;  5M3F B;  2AUJ D;  2R7Z B;  3QOL A;  2OEO A;  1D5Z C;  4K14 A;  2DNE A;  4XXE A;  3HZX A;  2PNR C;  2E2J B;  1IL8 A;  1BCP D;  2PZU A;  4C3H B;  1F9P A;  1DXM A;  2X6L A;  1GUS A;  1AP0 A;  3BS1 A;  2ZXR A;  4RKL A;  1I3Q B;  2K05 A;  3BVG A;  2RDH A;  5K5P A;  2EVB A;  2CHB D;  1WTR A;  1LTI D;  4QF4 A;  3IAY A;  1R4P B;  5JAV A;  2QDB A;  3OPO A;  5FOB B;  1ZYR C;  4HN7 A;  3IL8 A;  4I65 A;  1CQV A;  3S1N B;  2AQ1 B;  1DCZ A;  1ROD A;  2YU9 B;  1DOM A;  3C2P A;  1Y1W B;  2K5Q A;  5TSS A;  3N52 A;  4G7H C;  1ENF A;  3RMH A;  1LTB D;  4ZLT F;  3D4W A;  2QCP X;  1KLG D;  1U4R A;  3I72 A;  2IPK D;  5IT9 L;  5F2D A;  1B9N A;  5JJZ A;  1SNQ A;  1GUT A;  1FNV A;  5E3F A;  1G6Z A;  3KF8 A;  1HQM C;  3NQT A;  2CQA A;  1ZXT A;  4KK7 A;  1EZ6 A;  3TN2 A;  3H94 A;  3S15 B;  5EPK A;  4OO1 H;  2NN6 I;  3PUZ A;  4H0L C;  3ND9 A;  3V96 A;  3Q24 A;  1TWH B;  2NN6 G;  1STY A;  1KLU D;  1Z47 A;  5JOB A;  4KN4 C;  1KDB A;  1BXT A;  1G8Z D;  1DOL A;  1AEX A;  4ZUJ A;  2JXM B;  1Q12 A;  1TS2 A;  2E75 C;  2F0G A;  1LTA D;  1GUN A;  3HKZ B;  2IL8 A;  1B44 D;  3MTS A;  1EY9 A;  4F87 A;  4HMI A;  1ESR A;  4NW2 A;  1YNN D;  3T56 B;  2MHV A;  1I4P A;  1CFM A;  2XWJ B;  3PUW A;  4DAP A;  4DAV A;  4IFD G;  1ML0 D;  4HAE A;  2CW0 D;  3BZD B;  3MA2 B;  4DU9 A;  1LO5 D;  1LTR D;  4RH6 A;  1Y8N B;  1RTO A;  2PYK A;  1CHP D;  5EKI A;  1VCI A;  4RCO A;  4FYD A;  4BBR B;  5KNB A;  4IUU A;  4X3S A;  5CC4 A;  3BDO A;  5IGB A;  1ENA A;  1GHJ A;  3T13 A;  2JA8 B;  2FIN B;  2K32 A;  1V43 A;  2LMC B;  3PIP 3;  3HG9 A;  2EYJ A;  4FVM A;  3F2U A;  2L9H A;  2MPM A;  5D3D A;  1SDF A;  4QIW B;  1LTS D;  1SFO B;  2IX1 A;  5EBC A;  1H9J A;  3L3O C;  5JEA J;  2SNS A;  5I6Y A;  3J80 L;  4JBW A;  1B3A A;  3MVV A;  3OIQ A;  4O42 A;  5C3E B;  3E6Z X;  3EJI A;  1I4X A;  3K5L A;  4PMW A;  5KYI A;  2JEA I;  1PFN A;  2K7V A;  1LAB A;  5E4W C;  5BN4 A;  3SK4 A;  3BG3 A;  4B9X A;  1B50 A;  2L0C A;  1S4Z A;  1HA6 A;  3SVM A;  3TP5 A;  1G91 A;  1SSO A;  2IT1 A;  5C5L A;  1PZK D;  2JEB I;  5EKL A;  4OO1 I;  1CHQ D;  2BE5 C;  1E2W A;  4PV1 C;  4BWG B;  3ZYY X;  3TP6 A;  4NP5 A;  3K6O A;  4CJ1 B;  3GTQ B;  2ICI A;  4IAL A;  2OT2 A;  3H6M A;  4O1N A;  4RA8 A;  1YNJ C;  1U9R A;  2F0D A;  1FGB D;  2G9D A;  3UI2 A;  4J6H A;  3HGB A;  1JQY D;  2PZT A;  1K8M A;  1TQO A;  1KAA A;  2JE6 I;  3DMU A;  4CKE A;  2PPB C;  2B2V C;  4XTC S;  3S2H B;  1EFI D;  1RCV D;  5EKK A;  4ZK9 B;  1AFP A;  1PDQ A;  4PNY A;  3NTH A;  5D65 A;  1RDP D;  4HED A;  5C0X H;  4K2L A;  1D6E C;  2XRS D;  1JOQ A;  4A3B B;  1BOS A;  3E0J A;  4ZYS A;  5C4X B;  2D2C C;  2H1E A;  3D31 A;  5EBD A;  2VB2 X;  2B8G A;  2B2Y C;  1LAC A;  1KAB A;  4FXG C;  4OHJ A;  2IJ0 A;  5IGC A;  1JB3 A;  2AWO A;  2KOL A;  1EYC A;  1H9M A;  4ZKB B;  1NAP A;  3IKJ A;  3FMC A;  2R6G A;  1JWU D;  1GOZ A;  1V1O A;  3D4D A;  1JIC A;  2KCN A;  1ZYR D;  2VB3 X;  1DON A;  2CVR A;  2XRQ D;  1I4H A;  2HQE A;  5EPL A;  4X3T A;  4C1N K;  3T51 B;  5KGU A;  1O7Z A;  5J39 A;  1PTO H;  2EYO A;  1SNO A;  1E2Z A;  2PQE A;  1H9S A;  3CRK C;  3FPU B;  4ZKC B;  5I2Y A;  3VR3 A;  1A2T A;  3GTG B;  5KNC A;  1DM0 B;  2PCF B;  1UAP A;  1ZKO A;  2XSC A;  3ONA B;  5I4D A;  4HR7 B;  2L1B A;  5IT9 E;  4E6I A;  4LK1 C;  2ID0 A;  4RFB A;  1NR4 A;  3J7A V;  4S3S A;  3HOX B;  1STA A;  2EYP A;  1MGS A;  1XTC D;  1ESF A;  1II3 A;  4WRD A;  3OMG A;  1O7Y A;  3KBX A;  1JC7 A;  5C5M A;  1C4Q A;  1PZI D;  4L8J A;  3GV3 A;  3K5M A;  3QG1 A;  3IFT A;  4LMQ D;  3GP7 A;  2RQX A;  4UDU C;  4DNR B;  1L0Y B;  5BN3 A;  5M5W B;  4FF2 A;  1LLR D;  1SYE A;  3NQI A;  3MHB A;  3V2T A;  3T4A C;  2L55 A;  1PXU A;  2KVM A;  2RDG A;  2RVL A;  4IUP A;  3KLS X;  5KEE A;  1TWG B;  4P2C B;  4FXD A;  2F4I A;  1X32 A;  2BA0 A;  2N55 A;  2EYF A;  5LL6 S;  2ZT9 C;  1PTO C;  3MXU A;  1OXT A;  1K8O A;  2J4X A;  5A2Q L;  3C3L A;  1EOT A;  4CHT B;  3WOE A;  4TRD A;  4FO2 A;  4EGV A;  4RAU C;  4KKU A;  1UUP A;  5HUR A;  3CRL C;  2JA7 B;  4QUC A;  1TWF B;  4HSP A;  2A69 D;  1PYW D;  1U4M A;  2M2L A;  3S1M B;  1JWS D;  3DEP A;  3OW7 A;  2KEC A;  1QNU A;  3OSO A;  3QJY A;  3A55 A;  3C46 A;  3S17 B;  1WTV A;  2NVQ B;  5ELC A;  3Q0A A;  2N88 A;  3C1F A;  3MEH A;  2KHS A;  2Z4I A;  1TWA B;  4FF3 A;  1STN A;  2X69 A;  4K8I A;  3RLF A;  3A7A B;  1Q3L A;  3C1E A;  2A68 D;  3KBG A;  2IWH A;  5COY A;  1D2B A;  1RHP A;  4DA2 A;  3HOY B;  4CJ2 C;  2BCO A;  4WFN 3;  1HA5 A;  4XIG S;  4I7Z C;  3VR2 A;  1HQR D;  2K04 A;  2WKD A;  5JPN C;  4HSV A;  4C3H G;  4WOR A;  1F2L A;  2K03 A;  4K8J A;  4RCN A;  3TDQ A;  3GD7 A;  5G3L D;  2DY7 A;  3MXP A;  2F0N A;  1W6J A;  1K83 B;  1ILP A;  1EU3 A;  3FRP B;  2J7Z A;  4A3G B;  3A7L A;  4DNT B;  1A3V A;  4C1N I;  3HP3 A;  4A3J B;  1U4P A;  3D6W A;  2E2D C;  3SHL A;  5FO9 B;  2RA4 A;  1ET6 A;  4IN3 A;  3LWE A;  1JOO A;  5CBA E;  3U9O A;  1XX8 A;  2AUK A;  1D1K A;  3EQL C;  4CBV A;  3DWA A;  4KD4 A;  2WKC A;  1WTW A;  2KEE A;  2C5C A;  1F77 A;  3LX0 A;  4PMB A;  4B9W A;  1RTN A;  2O4X A;  2EYH A;  1BNZ A;  3CQZ B;  2RDF A;  4F7X A;  5IOC A;  3J7A F;  3HRZ C;  5ELF A;  4XQQ A;  3KUP A;  1MD2 D;  2EYL A;  1EWC A;  2A6E C;  1V1P A;  2PW7 A;  2WP8 J;  4PQX A;  3GTJ B;  1BCP C;  1J9O A;  4Q0F A;  4ME5 A;  3I3C A;  1WD1 A;  1WCM B;  2WAC A;  5CV5 A;  1JR0 D;  3K5N A;  1SMY C;  3QO2 A;  1E0B A;  1R4Q B;  3K57 A;  4HMJ A;  1Q1E A;  1SMY D;  4ZQ3 A;  2H4O A;  1GHK A;  1LTT D;  5CV4 A;  2BDN A;  1PTO B;  2B8F A;  5CV9 A;  5M9O A;  4R8N A;  4HTH A;  1I6V C;  1O80 A;  4C3J B;  1EQV A;  2D5D A;  2K6A A;  2F03 A;  4XDX A;  1EY8 A;  4IFD I;  1OO9 B;  5I9O A;  2A69 C;  5JVH 3;  4EQO A;  4A93 B;  4FNF A;  4IFD J;  4HCE A;  3M3Y B;  2A68 C;  2F0W A;  2HCC A;  1FR3 A;  1Y1V B;  1SEB D;  4XYQ A;  4A3I B;  4KD3 A;  3OOC A;  2PO4 A;  4CKB A;  4L63 B;  3D8G A;  5BN5 A;  1WTQ A;  3R2I A;  1MSH A;  3W2D A;  2RSN A;  5LL6 X;  3A8K E;  1E2V A;  1CTM A;  3HEJ A;  5ELE A;  3P20 A;  1I6H B;  3M4Y A;  1TWC B;  1AZQ A;  3SK6 A;  2KED A;  3FDT A;  1SYD A;  3KLS A;  1A6X A;  1JOR A;  1IYV A;  4KMU C;  2K1B A;  3P7J A;  4C3I G;  3LWU A;  1MBY A;  3VYR A;  1AN8 A;  4XYO A;  1DYQ A;  3J7Y W;  1X3Q A;  2F1M A;  3K58 A;  4FP5 D;  1BCP F;  1IYU A;  1GJX A;  5DM6 3;  5AFW A;  2DN8 A;  5T1G A;  4NMZ A;  5JVG 3;  2QF7 A;  2V4D A;  1KDC A;  2EJF C;  1WD0 A;  1Z6H A;  3J81 L;  2AQ2 B;  2R92 B;  2A6H D;  3BDC A;  4KI0 A;  1PTO D;  1G29 1;  4K2K A;  1EY6 A;  1SYB A;  1HPC A;  3D6C A;  3H91 A;  4FF1 A;  3SR1 A;  4NDX A;  2BOS A;  1PFM A;  4KHZ A;  1EQT A;  3Q6S A;  1G2S A;  4OIK A;  3QWN A;  1HCZ A;  2L5T A;  5C4Z A;  5T1I A;  3MZ5 A;  2Q8R E;  2NUC A;  2EZV A;  1EY7 A;  1EY4 A;  2ZXP A;  4RKB A;  3FPP A;  3TZU A;  4FF4 A;  1PRT D;  3CU7 A;  3AMU A;  2AWN A;  2F0H A;  3QIA A;  1PTO F;  2QEJ C;  2RKS A;  4ZAI A;  3M85 A;  2F0L A;  2ZXO A;  4J1M A;  3HS0 C;  5DM7 3;  2KJX A;  1QOH A;  4KJN A;  1CA6 A;  1M8A A;  2Z1C A;  5C4H A;  3TME A;  1PZJ D;  1B1Z A;  3GTL B;  1BUV T;  1Z7T A;  4K6D A;  2L4N A;  1KDA A;  2NVY B;  4C2M B;  4KY7 A;  2JYO A;  1ICW A;  5C0X I;  5C3W A;  1ONL A;  2XVS A;  2DNC A;  1SNP A;  5COR A;  5K36 G;  1RD9 D;  5CYU A;  4H7B A;  1SE3 A;  2NWG A;  1Y8P B;  3URY A;  1Q8I A;  3VYU A;  2VUM B;  1WTO A;  2FHT A;  4OL7 A;  3JAM E;  3S14 B;  1MI2 A;  2D9U A;  1CZW A;  3S1R B;  2QIL A;  3MWY W;  5C44 B;  5A2Q E;  3BVZ A;  3RZO B;  4XQN A;  5FLX L;  2K01 A;  1JWM D;  1ENC A;  1BCP B;  4U67 3;  2F3V A;  4DAY A;  2B2T A;  1H9R A;  3NE5 B;  5CBE E;  3CHB D;  5CGK A;  5JEA H;  1NCV A;  2PW5 A;  4WJW A;  1TR5 A;  5M3M B;  2PZW A;  1EY5 A;  1NR2 A;  2I07 B;  2ENB A;  1FYC A;  1SYG A;  5IGG A;  2F0J A;  4K5X A;  1I4G A;  4QMG A;  3TZD A;  4KKS A;  1TS4 A;  5E1F A;  2K28 A;  3PUX A;  5C3X A;  5ELB A;  1C8C A;  3ND8 A;  1H9S B;  1I4R A;  4DN4 M;  3R3O A;  1T5X D;  1U4L A;  3EFX D;  3AU7 A;  4A3M B;  1IKM A;  5G3L F;  2PMZ B;  1OXV A;  3TP8 A;  2O5I C;  3M7G A;  3ERO A;  1CZG A;  2F0F A;  2IX0 A;  1HUN A;  2JA5 B;  1J8I A;  2B2U C;  2LS0 1;  1QJO A;  3NBI A;  3SXH A;  3K5O A;  5JPM C;  2Q8T A;  1Q90 A;  2VXW A;  3Q22 A;  3D4R A;  5D14 A;  2E76 C;  4NKL A;  2SOB A;  1HHV A;  1RKN A;  4N9P A;  5EJW A;  3NTK A;  1S5F D;  4KY5 A;  4KTA A;  4ODG A;  2NBF A;  2DY8 A;  3NSW A;  2NTT A;  4RGT A;  2Z4H A;  4G57 A;  2GA4 B;  3U9S A;  1JOK A;  3MAQ A;  2A6H C;  2XIW A;  1T5E A;  2MGS A;  1EIG A;  1QG7 A;  2FFK B;  1HUM A;  5C0X J;  2F0O A;  1UNS A;  5DEH A;  4ABN A;  1EWH A;  1S5E D;  4C3I B;  1B2T A;  3NWT A;  4EVO A;  2NTS A;  2LY7 A;  2FMM A;  4ZUI A;  4KN7 C;  1UEA B;  2EY1 A;  2F0T A;  1F9Q A;  1IW7 C;  3EVQ A;  3MXN A;  1SBB B;  4F88 A;  1PLF A;  4C56 C;  3A56 A;  1QWY A;  1TKW B;  5IGF A;  3IFD A;  1EY0 A;  3S16 B;  1GUW A;  4A3D B;  2KCC A;  4V19 0;  1LT3 D;  2XNA C;  4A3E B;  5IGD A;  3ITP A;  1DD2 A;  2BE5 D;  1EYA A;  1DZ1 A;  4JK1 C;  4IZ8 A;  1CA5 A;  2E74 C;  3R8B A;  3W3A A;  4IUV A;  3I4M B;  1XXG A;  5KIX A;  3K7A B;  3PMF A;  3OMC A;  3DEO A;  4XQJ A;  4OGQ C;  2F0V A;  3J80 E;  4C3J G;  1Y8O B;  3G7L A;  4OIJ A;  2M9V A;  1HXY D;  4DFA A;  1STH A;  3NUC A;  4MN3 A;  1EL0 A;  4DXF A;  4CGY B;  5NUC A;  2JA6 B;  3JAM L;  1O78 A;  3DWP A;  1WTX A;  1LV9 A;  2WAQ B;  4DK1 A;  1XWE A;  2F0Q A;  2LFN A;  4RGM A;  1EYD A;  3A8J E;  3QOJ A;  2B2W C;  4MIU A;  5J1Z A;  1HTP A;  1GUO A;  4EQP A;  1B9M A;  4TSS A;  1A3T A;  5KYL A;  5JEA G;  4DXG A;  1BDO A;  2JP1 A;  5IIF A;  3PO2 B;  3I90 A;  1CT1 D;  3KLR A;  3VR6 A;  3BYY B;  3DM1 A;  1DJR D;  2LKV A;  1XYI A;  3DWQ A;  2ICE C;  2OXP A;  2Z8L A;  1NSN S;  1SE4 A;  3CKI B;  2Q8I B;  3EA6 A;  2HDM A;  2Y0S B;  2E2H B;  3OWF A;  1BF4 A;  3VR4 A;  4ZRZ A;  3GO5 A;  3TP7 A;  1YNJ D;  4J8Q A;  1F2M A;  3NBH A;  2F3W A;  2B2Y A;  2SNM A;  4U68 A;  3I91 A;  2NN6 H;  1O7L A;  4RHS A;  3H09 A;  2A6E D;  3MC0 B;  2NZ1 D;  2B2T C;  1M4V A;  3PV0 A;  1PFB A;  3I73 A;  5ELD A;  1SJE D;  5CV6 A;  1I50 B;  3M4O B;  1IW7 D;  1W6K A;  1IHZ A;  2R61 A;  5CMD A;  5I9P A;  1IKL A;  3D3R A;  2KUM A;  1SNC A;  1B53 A;  3N6R A;  5EQ0 A;  1AZP A;  3M7N A;  1OXU A;  5D3I B;  1NUC A;  4L6T B;  2FJ2 A;  2B39 A;  1B4O A;  1VF5 C;  4EQN A;  1JE4 A;  5FO8 B;  1YNN C;  1G2T A;  1PRT C;  2G9H D;  3I8Z A;  4G7O C;  3P75 A;  3NTI A;  5KND A;  3Q23 A;  3BYT B;  1H9K A;  1S5D D;  3E5S A;  3GTM B;  3LNN A;  4H44 C;  3H0G B;  2JSO A;  1FNW A;  2NVT B;  1L0X B;  2XN9 C;  1Y69 U;  3R93 A;  4F8M A;  3VR5 A;  2TSS A;  5IGE A;  1VDZ A;  1A2U A;  3VYT A;  2F0M A;  3NXW A;  3V05 A;  2NVX B;  5CV7 A;  2EXZ A;  2KA7 A;  1PMR A;  2SEB D;  4N9T A;  2EJG C;  4K5V A;  1TY2 A;  2YYZ A;  2BA1 A;  3H3V C;  2K33 A;  3FVQ A;  3NPP A;  3GTP B;  3A54 A;  4M1U B;  4QUF A;  5FO7 B;  2XWB B;  2RSO A;  4DK0 A;  3O13 A;  1F2Z A;  4ULL A;  2J0T D;  4RWS C;  5C4J B;  4R9W A;  4G7Z C;  3SK8 A;  3I4L A;  3SE0 A;  4DF7 A;  2WII B;  3X3N A;  3NK9 A;  3OHX C;  1F9S A;  3GQB A;  4BA2 I;  1HFN A;  3P1H A;  4ID6 A;  1BR9 A;  2HCI A;  3RD4 A;  3I4N B;  1SYC A;  2OF1 A;  1VF7 A;  3AB9 A;  1BQQ T;  3K0Y A;  4CKC A;  4QB4 A;  4QCL A;  4AYB B;  5DAU A;  1HTL D;  4FXK C;  1PRT F;  3RUZ A;  2B2W A;  1EEF D;  1STB A;  3TBI B;  4IQZ A;  3HOZ B;  1CM9 A;  2EOT A;  4X3U A;  4A3K B;  4IFD H;  3PO3 B;  3RZD B;  2D62 A;  2F0S A;  4Q5V A;  1EEI D;  1D5M C;  3NWS A;  2B63 B;  1MSG A;  1SND A;  1WTP A;  1V1P B;  3K59 A;  1JCK B;  1EZ8 A;  2WV6 D;  1Q1B A;  5CV8 A;  1C48 A;  3MFY A;  5CR3 A;  2MP1 A;  4TQU S;  4LAA A;  5FKA C;  4B08 A;  1ET9 A;  4IUR A;  4RHR A;  1AW7 A;  1ILQ A;  3DHQ A;  2SDF A;  5EGT A;  4A3F B;  1GXD C;  3BVM A;  5A35 A;  3X3M A;  1VMP A;  3T16 A;  3L7Z C;  4G4K A;  2EYM A;  1LTG D;  4KJO A;  4K6L A;  1A15 A;  1SAP A;  3S1Q B;  1STG A;  1TU2 B;  1D5X C;  2F0K A;  4Z9C B;  5K36 H;  2A73 B;  4BA1 I;  3PUY A;  1RJT A;  4Y7N B;  1SJH D;  1CQF A;  2KQ3 A;  4TKO B;  2EY2 A;  3SK5 A;  3I70 A;  5E4X A;  1R9T B;  4BBS B;  2K5D A;  2IW3 A;  1DOK A;  4KKT A;  3GTO B;  4KY6 A;  5FK9 C;  4K5W A;  1KNA A;  4XT1 B;  1V8Q A;  1KTK A;  2MUY A;  1SNM A;  1QNK A;  3SEB A;  3ERQ A;  2RBM A;  3QB3 A;  4MHE A;  1FD7 D;  2EPB A;  5ISR A;  1CI3 M;  2FMC A;  4RGO S;  5KRU A;  2MJ8 A;  1QCB D;  3MXG A;  2EJM A;  1D1I A;  4BY1 B;  1QB5 D;  3NHH A;  2R93 B;  1OXS C;  1VMC A;  2L11 A;  3NP8 A;  4IUT A;  3DUZ A;  4X3K A;  4PMC A;  1F9R A;  5FLX E;  4V0B A;  2E2I B;  2C9O A;  1HFG A;  1SYF A;  1TS5 A;  4BS9 A;  1LT5 D;  1PRT B;  2QKI C;  4YIJ A;  3MFG A;  1BO0 A;  3GTK B;  4OO1 G;  1FNU A;  3TSS A;  3L9A X;  4H13 C;  1TT2 A;  1HRJ A;  3OWE B;  1F2Y A;  1SXT A;  5M5Y B;  1CK1 A;  2I46 A;  2BDO A;  3FKI B;  5HGT A;  1ZEQ X;  2X6G A;  5J22 A;  2K5W A;  1LT6 D;  2WB1 B;  2HUG A;  1LT4 D;  5EPJ A;  3R2T A;  1EU4 A;  4GZY C;  2L12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...