5ELFA

Cholera toxin el tor b-pentamer in complex with a-pentasaccharide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin subunit B
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5elfA00
3GP7A 3BYTB 3R8BA 2CHBD 1SE3A 2AQ2B 5ELDA 1SJHD 1I4XA 3R2TA 3OWEB 1D6EC 1PTOB 1UNSA 4ZYSA 1I4HA 1KTKA 1EEID 1TS2A 5I4DA 1V1OA 2IPKD 2R61A 1HA5A 1SE2A 4Z9CB 1BCPD 2ICIA 1ENFA 3EA6A 1RDPD 1F77A 5D3DA 1CT1D 5FKAC 1BCPC 1KLGD 1LT4D 2J4XA 3SEBA 1CHQD 5FK9C 4RCOA 4DXGA 1LTTD 1EWCA 2AQ1B 4RFBA 1PTOD 1XXGA 1HQRD 1SJED 1ET6A 1PRTC 1TS4A 1TY2A 4RHRA 1B44D 2SEBD 1KLUD 3BVMA 3DWQA 1T5XD 4OHJA 1PTOC 4C56C 4UDUC 1LO5D 5ELFA 3BVZA 2QEJC 2RDGA 1FGBD 1EFID 1I4PA 2AQ3B 4L63B 1S5FD 1S5CD 1I4RA 1AN8A 5ELEA 3DWPA 1CQVA 2XRSD 1XTCD 2XN9C 1B1ZA 1FD7D 1SEBD 1I4GA 1JWSD 1CK1A 4RGNA 2Z8LA 1D5ZC 1PZKD 2QILA 1S5BD 1PTOH 4RHSA 2RDHA 2IJ0A 1LTBD 4BWGB 1QILA 1JWUD 1RD9D 4DXFA 3V05A 2O2LD 1V1PB 1JQYD 2G9HD 1S5ED 1TY0A 1LT5D 1PYWD 1LTID 1LLRD 1LT3D 5TSSA 1UUPA 1EU3A 3EFXD 1AW7A 1PRTF 1TS5A 1DJRD 4RH6A 1D5MC 1HXYD 4K6LA 1RF2D 1LTAD 3BVGA 1JCKB 2WV6D 3W2DA 3BZDB 1LTSD 1DYQA 2XRQD 1TS3A 1L0XB 3BYYB 1PRTB 2XNAC 3MFGA 1RCVD 4RGTA 1STEA 1PZJD 1BCPF 2TSSA 1ET9A 1L0YB 3TSSA 1FNWA 2NTTA 1FNVA 1I4QA 1JWMD 1V1PA 1BXTA 3O13A 5ELCA 1EEFD 1EU4A 4L6TB 1PZID 1SE4A 4RGOS 1JR0D 1BCPB 1M4VA 2NTSA 3R2IA 5D3IB 1FNUA 1SXTA 1S5DD 1LTRD 1HTLD 1ESFA 1LTGD 3DWAA 3CHBD 1MD2D 4TSSA 1LT6D 1CHPD 1GOZA 1D5XC 1PTOF 4RGMA 3MC0B 1PRTD 1SBBB 3URYA 5ELBA 1G8ZD 4O1NA 3KLSX
chains in the Genus database with same CATH superfamily
1EY0A 4UAIA 2Z9HA 4ZK9B 2H1EA 2AQ2B 2DNCA 1GUTA 1VCIA 1TR5A 1EQQA 1KC8C 1TS2A 2IX3A 4DK1A 1VQ8A 5C0XG 1Q90A 2EY5A 3GTGH 1TWFH 4YY3L 3VR3A 1JC7A 5CV7A 1LM0A 3L7ZC 3SE0A 3CMAA 4WFN3 3S2DB 1IBML 1H9MA 5KRUA 5C4XB 3MZ5A 3S1NH 4LF8Q 4BBSB 5KYLA 1YNJC 5C44G 3CCQA 4LF5Q 1AH9A 1EIHA 5M5XB 2NVTB 4FDBA 2QCPX 5D14A 3OYYA 2JA8G 1PTOC 1NJIC 3K6OA 2X6GA 2KCCA 2ATWA 1YHQA 1GUWA 3DWPA 3LWUA 1WOCA 2CW0C 1EIGA 2EDGA 2K5QA 2BA0A 3A8IE 1YVCA 3SHLA 1B50A 4K5XA 1HZ9A 3T1YQ 4X66Q 3GTLH 4CJ2C 2HHHQ 4X3UA 1RD9D 1W6JA 4A3JH 4PZ8A 2B63H 4MN3A 3A5UA 1K0SA 3TP5A 5A35A 3J7AF 4I7ZC 4DV4Q 1LT5D 1LTID 1HZBA 4BBRH 1SDFA 2MO0A 4IFDH 1AW7A 2ZTDA 2NB0A 5M3MB 1LTAD 2HQLA 1M8AA 3S17H 2F0GA 2WV6D 3BZDB 1JB3A 1SYEA 1VQGA 1STBA 2BE5C 4B3TL 4K6DA 2K01A 3K0XA 5FLXE 5IP7G 4KKUA 1VDZA 1C7YA 3GTMB 5M3FB 1YNNC 1DD2A 4A3EH 4JBMA 3M9BA 1PYSB 3UE1A 3SDZA 4LF5L 1BXTA 1UEAB 1IBKL 1JJ2A 3K5MA 3HOZB 2A1AA 1SYFA 3FMCA 1UWVA 3JC66 1JORA 2OF1A 4R4OA 2DNEA 5JEAJ 3I4NB 5JJLA 3NTHA 1XMQQ 2NZOA 3UDXA 3C3LA 2UUBL 2H4OA 3CQZB 4LMQD 5DNFA 1CZWA 1SNPA 2BA1A 4A3IH 3K7AB 1U0LA 2X6LA 3I4MH 2HHHL 4Z9CB 4R4IA 3NBHB 1XNQL 5HY6A 4B3MQ 4C3IH 1R9TB 4DV4L 1OXUA 3D8GA 4IOAA 1L1OA 1SYGA 5LMNQ 2RDFA 3DEPA 3UDGA 4CDFC 2DN8A 5C0XJ 4P2CB 1A6XA 1K3RA 3U9OA 3M7GA 5M3FG 5FO9B 2SEBD 3SK5A 3OMGA 2F0TA 2PNRC 5ELFA 2H5XA 1PHJA 2MHVA 1H9SA 3HOZG 1TWAH 4DR6Q 5L37A 1I4RA 1AN8A 3GO5A 3QIAA 3D6CA 1CQVA 3I4NG 5H1SE 1W6KA 3MXUA 4FF2A 3I2ZA 1XMQL 4O42A 5E3FA 1IHZA 3L9AX 3R93A 1TWCB 2HIVA 3VYUA 4BWGB 2EYOA 3PIOA 4LF6Q 1V1PB 4CKEA 1E2VA 5AJ3Q 4IUTA 5IIFA 1EY7A 2G9HD 2JE6I 1Q8KA 1HXYD 1RF2D 1JCKB 4B3ML 3SVMA 1B70B 1B9MA 1SNCA 3BJUA 1Z9FA 2NZ1D 4DV6Q 1K73C 4KKTA 1CUKA 5JEAH 2WKCA 4R4TA 1MSHA 4F87A 3N52A 1I4QA 3T16A 4QUFA 5DAUA 4K5VA 3KDFB 1JE4A 3QOJA 1PZID 4P74A 3P20A 1YZ6A 3BDLA 1J9OA 1GUGA 2CKZB 1MJEA 2L9HA 3G4SA 3C2PA 2VW9A 1M4VA 3OWFA 1VMCA 5D3IB 1I6HH 1LTRD 4HTHA 1MD2D 1TWGH 4B9WA 4TVAB 1VQNA 2F4VL 4DR2Q 4LAAA 5EPLA 1N9WA 2FINB 2CCZA 5KNBA 1FJGQ 3G7LA 3KLSA 4H02A 4QJFA 3E6ZX 3I3CA 2F1MA 1PTOB 1UNSA 1PA6A 3AFPA 4QUCA 1X3EA 4WORA 3S14H 4HIMA 4Y7NB 1SE2A 5C0XH 3ULPA 1EY5A 4JBWA 2QW7A 5JPMC 1ENFA 4DR5Q 1G2SA 5AJ3L 3ND9A 1EOTA 1VQPA 3MXPA 4XT3B 5LMUQ 2B2VA 1LT4D 1PH2A 1K83H 3K59A 3OW7A 5C44H 4A76A 4DR1L 4X6AH 4FVMA 3TZDA 3CMEA 4JI8Q 1EIYB 2LSSA 4CJ1B 2JA8H 3KFUA 3F2UA 4C2MB 2PMZE 1TY2A 4IO9A 3BVMA 3ND8A 4XYOA 4DV6L 4GNXA 3ONAB 4UY8C 4DFAA 1YBYA 2E5LQ 4LFCQ 4HAEA 1ICFB 2SNSA 2OQ0A 2I46A 2WB1E 2NBFA 2AHOB 4IPDA 2B2VC 3TP6A 1X55A 3NEMA 1I4GA 4U68A 1KABA 2E74C 3KF6B 1D5ZC 1HTPA 3LGJA 4HCSA 2WKDA 3T51B 2EJMA 3D6WA 2KCTA 4DR2L 4LUVA 2F0NA 1SE8A 1B2TA 1FJGL 1BUVT 3SK6A 3CPFA 2EYPA 4RCNA 1K28A 4DPGA 2I5HA 3DUZA 1Q1EA 3HFZB 1LLRD 1NTGA 4DAYA 3HKZB 1HJPA 1K8AC 2OTJA 1EY6A 3D3RA 4KY6A 5LL6S 4JI2Q 4DR5L 5IP7H 3OHXC 2IWHA 3OSOA 3DEOA 2UXDL 5M5XH 1O7ZA 1C48A 4QL5A 1SRUA 4NDXA 3S9WA 3AYHB 2K14A 3X3MA 2ICEC 1CA5A 4JI8L 2B2WA 4GOPA 2WP8J 5K5PA 4OELB 4RGOS 4B3SQ 3K80C 1TXYA 2E5LL 1RTNA 4K0KQ 1Z47A 4G4KA 1ICWA 4L5RC 4DV1L 1E1TA 4Y52H 1GJXA 2Q2HA 5EKIA 1VQ5A 2K05A 1TWFB 1MBYA 4LK1C 5E1FA 5KNCA 2NVQB 4NP5A 4JV5Q 2F0KA 2E2IB 2IL8A 1O80A 1UE1A 2D9UA 3QOLA 5C6AA 1WTXA 1K8MA 1V1OA 2A73B 2B2WC 4GS3A 1EZ6A 1GHJA 5IT9L 1VQHA 4MTKA 1C8CA 3EA6A 3C1EA 3S1MB 2EIFA 1CT1D 5E4XA 3HKZG 3T13A 2F0WA 2K75A 2L55A 5JJKA 3GTMH 1G6PA 5DM63 5M3FH 3CU7A 2V1CC 5I6YA 1BQQT 4FXKC 2K1BA 3HOZH 1DM0B 3HP3A 4OEMB 1QZGA 3EBEA 3I4NH 2QEJC 2L4NA 3X3NA 4UPAA 1XMOQ 1GM5A 4CDCC 1CSPA 1FD7D 1F2YA 4ID6A 3CQZH 1K8OA 4XQNA 4C3JB 5IE8A 2EY2A 3I72A 2IJ0A 3K7AH 1D8LA 1NE3A 5C3EG 2B2UC 5GAEC 1ZXTA 3BZCA 3M7NA 4HIOA 1R9TH 2EXZA 1MJCA 4UHVA 4X65Q 2HQEA 2YTVA 1UAPA 1LACA 2QF7A 2VS1A 2NN6G 3TN2A 2XTIA 3CC2A 2L5TA 1W3SA 1VF7A 4LUZA 4PMBA 3TBIB 2M00A 1FR3A 5AFWA 4CGYB 4EX5A 3CCSA 3TEHB 5FO8B 5HURA 1XX8A 1HPCA 1PRTB 3DM1A 2JA9A 5EAYA 1QVGA 4JI5Q 5CGKA 3SGIA 1CM9A 3RMHA 3IKJA 1BBXC 4KTAA 1JWMD 4IUVA 5DEHA 4HR7B 3JAME 3A7AB 2OTLA 2VQFQ 2BOSA 4GKKL 4BXXG 5FO7B 3SK8A 4JCVE 3E5SA 1JOOA 2M2LA 5K36G 2B8FA 5CV8A 1EOVA 3BDCA 3CC4A 1SFOB 3NPPA 1E2WA 1TWCH 1CFMA 1U9RA 4M1UB 4C3JG 3BYTB 2OT2A 4GN3B 5JAVA 1PFBA 3MA2B 2VB2X 4HJ5A 2B8GA 4HJ8A 3HEJA 3J7ZC 3GTOH 1K9MC 1YI2A 2KHJA 2WACA 3I4LA 4WRDA 1A8VA 5FJ8G 4X65L 3A74A 1SSOA 1GUNA 3RZOB 3QJYA 5JVH3 4DXGA 3I90A 1E22A 1EWCA 2CH4W 2JQOA 3J81L 4U673 1O7LA 1HR0Q 1KLUD 4A3FG 4K5WA 3CCEA 5G3LF 4OX9L 2A5HA 2ID0A 1GHKA 1X3FA 3NBHA 3J7AV 1EFID 2PNHA 4JI4Q 2VQFL 3NHHA 1F2LA 4HIKA 1S4ZA 1VS0A 1XPRA 4XT1B 4E6IA 4DU9A 1RTOA 4LF4Q 1EQVA 3TP7A 3H6MA 1IBLL 1PTOH 4RHSA 1N32L 1VQLA 3NTIA 1F9QA 4Y7NH 3AB9A 3PO3B 4DXFA 1P8LA 3RN5A 2ZJPA 3PF4A 1TWHB 1S5ED 2NZHA 5I6WA 1QG7A 1J5EL 1PYWD 1I94L 2IX1A 1VQKA 1VQJA 1A2UA 3TS2A 2HDMA 1BR9A 1LTSD 4IUPA 2RCNA 4C2MH 4PMWA 2R7FA 5M5WB 2R6GA 3J81i 1BCPF 4OO1G 1N34Q 3PIPA 1FNWA 4K8JA 4DV2Q 1V1PA 4HN7A 4A3MB 3J80L 1FNUA 3A0JA 1HTLD 2BDNA 4NW2A 2R7ZB 1SYCA 2F0MA 4ILWA 4LUOA 1KXLA 1Q81C 4IFDI 1QNKA 5HGQA 1Y69U 4P73A 5C44B 3CRKC 1HR0W 2F0SA 3B6YA 3PO3G 1Q8IA 4P71A 2LY7A 1AE2A 2F03A 5I4DA 1G51A 2F3WA 2LMCB 4AH6A 1OXXK 3KDFA 4DNRB 2XIWA 2KHIA 5IYCG 3BG3A 3C1FA 1VQDA 1ASYA 1DOLA 1B3AA 4KN4C 3GTQH 4JG2A 5J22A 2WFWA 1BO0A 1XXGA 1F9RA 2K6AA 4F8MA 1RJTA 4JW0A 2A68D 4DAPA 2ES2A 4LFBQ 4R8IA 4G7OC 2OQKA 1LO5D 1NNXA 4OWXB 1WTWA 3G71A 3CCLA 3RLNA 4WJ4A 1MGSA 1SYBA 4QY7A 4R9WA 4A3MG 3J80i 3HOVG 2F0LA 1II3A 2R7ZG 4ZUJA 1AFPA 3VR5A 1F9SA 2XWBB 4NXNL 5C3EH 2NVQH 3E0EA 4A3KB 2E2IH 3H3VC 4DR4Q 5BN4A 2EZVA 1VQCA 1EZ8A 4ZLTF 1JWUD 3OW2A 1HNWQ 4GLXA 2C5CA 4LF9Q 1BOSA 1YJNA 3S1MH 2F0HA 4GKJQ 2NN6H 4HIDA 1NSNS 1R4QB 5J3BA 4JOIC 1N36L 1WTPA 4KD4A 3PUWA 3RLOA 1STAA 1ML0D 2ZXOA 3BVGA 3VYTA 4PQXA 5CR3A 2LFNA 3KF6A 2DGYA 2XNAC 2QEXA 4BXXH 2YTYA 3DHQA 1EU4A 1WTHA 1B4OA 4DNIA 1SMYC 5K36H 3SXHA 1JR0D 4ULLA 2A8VA 1ESFA 3P75A 3IFTA 1VQMA 1RIPA 4C3JH 3OOCA 1D5XC 1HCZA 1C4QA 3PIP3 2EY1A 1V8QA 4A3KG 4X64Q 5BN5A 2E2DC 1HFNA 3W5OA 4DAVA 5GAHC 3R2TA 4C1NK 4PV1C 3MTSA 1SYDA 5FJ8H 1SN8A 1SLJA 4FXGC 4HJ7A 4LF8L 5M5YH 1Y14B 4POGA 3M4OH 4R1JA 1I6VC 1F77A 5D3DA 1OO9B 4GKJL 3R3OA 3IAYA 2VQEQ 4H0LC 2B2TC 1YHBA 4I65A 4A3FH 1WYDA 2JK8A 3GV6A 1EQTA 1SJED 1WCMG 1ET6A 1Q3LA 4RA8A 1X3GA 3K5LA 3T1YL 1STYA 2OEOA 4X66L 4HJ9A 1I50B 4XQQA 4YWMA 1I4PA 2AQ3B 4HSPA 4LFAQ 2MO1A 4L63B 1U4PA 1SFOH 4OWTB 4DR7Q 1DCZA 2B3GA 4J15A 4C3HB 4L5SA 1X3QA 4MNOA 4B3RQ 3MWYW 3KF8B 4K8IA 3T56B 1KAAA 4CKBA 3K7UC 4KY7A 1G6ZA 1B7YB 4TRDA 2L12A 1MHWC 1Q82C 2RDHA 3L3OC 2R7DA 1EUJA 3I7FA 4X64L 5CV5A 3ULLA 2UU9Q 2JXMB 3KOJA 1JOQA 1SNMA 4ABNA 4F88A 1N8RC 5G3LD 5TSSA 3STBD 2B2YC 3RZOH 2KOLA 1XNRQ 1Z6HA 2ZTCA 4OO1H 1ONLA 3T53B 2PMZB 3NE5B 5C5MA 2NVXH 1A0IA 3EVQA 1I3QB 5D65A 2UXCQ 5CV6A 2TSSA 2Y0SE 1L0YB 1KHIA 3BU2A 2EYFA 1HA6A 1BVSA 3NQTA 5IT9c 1EEFD 2WB1B 3KBGA 3KYHC 5EKLA 3GTOB 3RD4A 1LTGD 2YV5A 2PZWA 4ZRZA 4C3HG 2YTXA 2D0OA 4LFAL 2DJFC 4DR7L 3JAML 1X32A 2BCOA 4RKLA 3PO3H 4B3RL 3PUXA 1BBUA 5LMNL 3EQLC 3PGZA 2CHBD 1KRSA 1TWHH 4EVOA 2QKIC 1I4XA 4CBVA 4DUZQ 3AFQA 2IPKD 5IYCH 5BR8Q 1BCPD 3W1GA 4JC0A 4J1MA 2V4DA 4M8AA 4XTCS 2ENBA 3TP8A 1HQMC 2CQOA 3M4YA 5M5WH 4UP8A 4N8FA 4DR6L 1CKNB 1HUMA 2UUCQ 1IW7D 3QWNA 1XNRL 2MJ8A 2E2HB 1K3BC 2X69A 4ZAIA 1JE5A 1PRTC 4S3SA 4IZ8A 4A3MH 1OTCA 2ALYB 4IOCA 3HOVH 5IGEA 2WB1G 1PH3A 5C4JB 2R7ZH 4LF6L 2A68C 1PFMA 3GTKH 5ELOA 1K8GA 4PNYA 3H15A 1ENCA 3QB3A 3GDEA 1SEBD 4MHEA 3E3XA 3NWTA 1ILQA 1PFSA 1UEBA 3CCJA 1GVPA 1PZKD 5IGFA 3JAMi 4IUNA 3NP8A 3I70A 4KKSA 1Y8OB 5GADC 4A3DB 3DMUA 4AYBE 2KEDA 1HH2P 3CAMA 2JA7B 1TVXA 3I4OA 4HSVA 4ME3A 5DLQE 4DV3Q 1MSGA 1S40A 2C9OA 3ER0A 3W2DA 2VZAA 3DM3A 3WDNA 3L2PA 4EQPA 1XPUA 1IXRA 1F9PA 3OIQA 2UUCL 3I73A 3VYRA 2R3ZA 3A5ZB 2ASBA 4HEDA 2AKWB 1LABA 1AEXA 1GD7A 1SE4A 2RHQB 2IW3A 1PDQA 1SXTA 3EN2A 1HNZQ 3HS0C 4A3KH 4JI6Q 1GOZA 5C3XA 1LUZA 1OXTA 2D5DA 3G6EA 1SBBB 2Z1CA 3G48A 5LMUL 3WWVA 4O2DA 3J81c 3PUVA 3PQIA 5ELDA 4RAUC 2EPBA 1NR4A 4A3DG 2CQAA 4ZYSA 3GTQB 1KTKA 1PLFA 2R61A 2NWGA 2JA7G 5IGBA 4MZ9A 4FNFA 3T1HQ 2K32A 4DR3Q 2ZXPA 1EY8A 4Q0FA 4LFCL 1VQ6A 2Q8IB 3A8KE 4A3CG 4JYAQ 1F2MA 3Q24A 1WCMH 4K2LA 4LF7Q 2Z6BA 1VQEA 3N6RA 1X56A 2AWNA 1RL2A 3UDIA 1PMRA 2EYLA 5IYBG 2PI2A 2EOTA 4KV6A 4P72A 1PH6A 4XQJA 3W1BA 1KL9A 4NB3A 5C3EB 5CORA 4K2KA 3J81j 2L0CA 1PH8A 4IURA 3NWSA 4EGVA 1KDBA 3S16B 1O7YA 1CKMA 4APVA 3K5NA 2FJ2A 1HNXQ 2EJGC 1A15A 2XRSD 4X3TA 3FEWX 1NMGA 1IYVA 4A3BG 1STHA 4KY5A 3WOFA 1GUOA 1PH4A 2K04A 3CF5A 4JI2L 4JI6L 4ALPA 2N55A 3S2HB 1QILA 2B2UA 2KCNA 3S15B 3DXJC 3V05A 1ZYRD 3HOXB 1Q46A 1OXVA 4IPGA 1CKOA 3J80c 4FF4A 2D62A 3KLRA 3S1RB 1UUPA 2RF4A 1QZHA 3IFDA 1G91A 1L1OB 2A6ED 4ODGA 2Q8TA 3NENA 5EJWA 4B3SL 3STBC 3CKIB 2JP1A 4K0KL 2E2JB 4RG1A 2Z0SA 1DOMA 2PZTA 4G7ZC 3E9HA 3K0YA 5IOCA 1I50H 1SNOA 1YJWA 2EE1A 4JV5L 4P75A 4C3HH 2JA6B 5EBCA 2J7ZA 5IWAQ 1STNA 5JJZA 1UE5A 3OTOQ 2FHTA 1X65A 5M5YB 5EBDA 3M4OB 1YNJD 3GTJB 1QE6A 3ICEA 2MQHA 2KQ3A 5JJIA 4CDDC 3ULJA 1IYUA 4GN4B 4KHZA 1LTLA 2EXDA 2ZT9C 3TMEA 4A3FB 1EEID 3FPPA 3HOXG 2CW0D 2RCFA 3K58A 2N88A 3IL8A 4A93B 3S24A 2G5DA 2JSOA 1B9NA 3MFYA 4FP5D 5FLXL 4RKBA 1A3UA 1BCPC 1QJOA 1B53A 3J7A5 1JT8A 1EQRA 1XMOL 2IHEA 1PVOA 1I3QH 2GN5A 2FMMA 2O5IC 3CCRA 1E0BA 1LTTD 2CVRA 3QO2A 4BS9A 2SNMA 1TS4A 3VA5A 1PV4A 3HOYB 1CSQA 4QIWB 1NY4A 4DGZA 4OHJA 2Z4IA 2KUMA 2LXKA 3EROA 4KHVA 1GKHA 1FGUA 4YCUA 2JA6G 2NYZD 4JK1C 3TZUA 1ENAA 1VMPA 2DY8A 5IWAL 1FL0A 4RGNA 5GAGC 2QILA 2QDLA 5IGCA 3D31A 2A19A 1HRJA 1JICA 3F2DA 4JBKA 2NVXB 2E75C 3Q8DA 1T5EA 1GXDC 4JI5L 2AWOA 4IJHA 4OGQC 4A93G 2K4KA 1MI2A 3W3AA 3H3VH 1DJRD 4A3LG 4PZ7A 2XRQD 3KF8A 2E2HH 4DK0A 3KJPA 3NXWA 1UE6A 2L11A 1RCVD 1BF4A 2VUMG 1E7ZA 2TMPA 4RGTA 1STEA 1E1OA 4EQOA 4GNXB 3HOYG 2NTTA 5C4JH 3T4AC 2F3VA 3O13A 2G9DA 1CA6A 3RZDB 2SDFA 1S5DD 1E2ZA 2KA7A 3DWAA 4OL7A 4LJZC 3VYSA 4TSSA 1LT6D 2NN6I 3Q22A 4QB4A 2I0QA 1XPOA 3HG9A 1N33Q 1X3PA 4N9TA 3M4PA 2FMCA 3CP0A 4UP9A 4A3DH 4NXMQ 2I07B 3R8BA 2XGTA 2J0TD 3LNNA 1STGA 4KHPQ 3OWEB 2JA7H 1D6EC 4DUYQ 3TQYA 2NVYH 1HR0L 2NUCA 2K5DA 4DAYB 4A3CH 4JI1Q 5ISRA 4RMFA 1KNAA 3HOVB 1KLGD 3U4ZA 2C35B 1TQOA 2HT1A 1VQOA 5IYBH 3GTKB 4JI4L 5I2YA 3PMFA 4RCOA 1H9KA 2FXQA 2Z6KC 2HDLA 4LF4L 2A74C 5I9PA 4GOPB 4DAMA 4BY1G 3QG1A 4H44C 4JI3Q 2K50A 2K5WA 4A3BH 1QB5D 4MTNA 1EYGA 1T9HA 1IBMQ 5CV9A 1Y1WB 4A3GG 1F2ZA 2PO4A 1CK1A 1BKBA 1CKNA 1QWYA 2R93B 4DK6C 5JOBA 5IGGA 4H13C 4KJNA 1L2FA 3FVQA 2F4IA 5IP9G 1EY9A 1KDCA 3U9SA 1Y8NB 3CRLC 5JPNC 4DUYL 4DV7Q 1N34L 3AMUA 4JOIA 4YHHQ 4DV2L 4NMZA 2A69D 1B3QA 1HHVA 1TKWB 5DM73 4IQZA 4WJ3M 3JAMc 3P1HA 2KVMA 5KYIA 4IUQA 1EY4A 4PZ6A 3M3YB 1QCBD 3PO2B 2A6HD 2A6EC 3QR8A 3HRZC 3PF5A 1Q7YC 2XSCA 4QCLA 4PMCA 3U58A 3VR6A 2WAQE 2KECA 2PW7A 2ZM6Q 3S16H 4IUUA 1G2TA 2KHSA 3KK7A 3E9IA 1QUQB 5JVG3 3BDOA 4KK7A 4ZUIA 4JI3L 1BCPB 2MPMA 3MXNB 1PXUA 3SK4A 3H94A 5A2QE 4HCEA 4B3TQ 4OWWB 1KRTA 5NUCA 1A2TA 4FF3A 1Y1WG 4RGMA 3S2HH 1VQFA 3OIPA 3I55A 3S15H 4HJAA 1WTOA 5IY0A 2R93G 4OONA 2N49A 2E76C 1BNZA 2F0DA 1WCMB 3HOXH 1IBKQ 4CDEC 1XWEA 1SJHD 1UE7A 1AZPA 4FYDA 2JA5B 4AQYQ 4OO1I 3EIVA 2YU9H 1R4PB 4JVZA 3S1RH 4BA2I 4I7AA 4ZQ3A 2BH2A 2ICIA 2Q2UA 1RDPD 4LFBL 2KBNA 4KLKA 1JB7A 1VQ7A 2UUBQ 4DV7L 1A62A 2E2JH 1TIID 4YHHL 1KD1C 4QQBX 1TT2A 4GLVB 3SEBA 1KIXA 5C3WA 2B2TA 3P7JA 3A54A 1M90C 2Y0SB 3I8ZA 3PO2G 4TQUS 1NBWA 1VQIA 2I5MX 1HQRD 2RA4A 3A56A 2PI2E 2RSNA 3AU7A 3RR5A 2K7VA 1XNQQ 3ITPA 3AQQA 4DR4L 1XJVA 2JA6H 4C56C 1Z7TA 2EY6A 4UDUC 2ZM6L 2VB3X 3K8AA 3CCMA 1HNWL 1FGBD 4LF9L 3GTJH 1S5FD 4PG3A 1S5CD 2BH8A 4MIUA 1BBWA 3NUCA 4QMGA 3H0GB 3KJOA 1YITA 3WOEA 1JWSD 2AUJD 1VQAA 2K33A 2MGSA 5M9OA 1S5BD 5C4XG 4JBJA 1KNEA 4BBSG 4TKOB 1LTBD 4X3SA 5IGDA 4N8X1 2JA5G 1WVLA 4JPBW 3HOUB 2LKVA 4A93H 2CWAA 1AZQA 4H7BA 3Q23A 5EKKA 4AQYL 4UP7A 4DF7A 3VR4A 2F0VA 1RODA 4A3LH 2B2YA 1LT3D 4AIMA 1V1QA 2SOBA 3FRPB 2WIIB 3UI2A 5C0XI 2VUMH 4R4CA 4YWKA 3HOYH 2Y0SG 1L0XB 1HFGA 1MIUA 1YEZA 5LL6X 4V0BA 1CZGA 3J81E 5BN3A 1EWHA 4X3KA 1EIFA 2L1BA 5M3MG 3H0GG 1NR2A 1YHAA 3A8JE 1PTOF 2HD3A 2B29A 1EYAA 1V9PA 3KLSX 4AYBB 1WFQA 1ILPA 2M9VA 2VQEL 3M85A 4KN7C 3HOUG 2PQAB 2D2CC 2WINB 4KD3A 2EYMA 3D4WA 1HA5A 3F8TA 4Q5VA 5GROA 3TS0A 2F4VQ 4XXEA 1S3OA 2IHFA 4L5QA 2LXJA 3CC7A 3ZJYC 2CFMA 1KDAA 3ZYYX 1L1OC 1YNXA 4IJLA 2IX0A 2JJQA 1KAWA 2JN4A 1EL0A 4BY1H 2GVBA 1SR3A 2RKSA 3L0OA 3ERQA 4EQ5A 3E0JA 3RZDH 3BVZA 3HOWB 3V96A 1DGSA 3PCOB 2UU9L 4A3GH 4DR1Q 2K5HA 5ELEA 2HCCA 1D2BA 1RKNA 1WI5A 1EYDA 3RLFA 3J80E 2Q8RE 5IP9H 4BY7B 2P5ZX 4AYBG 3LX0A 1X9NA 3SR1A 2DJGC 3NK9A 4R4QA 1ZKOA 3CW2C 2UXCL 5C4ZA 5CBAE 1GUSA 4RH6A 1D5MC 3F1ZA 3MEHA 5LMNW 1CI3M 2VL6A 2Z4HA 2A69C 2QDBA 1PH7A 1HZAA 2PZUA 3S1QB 4HMJA 2R92B 5IODA 4R8NA 1WTVA 4B08A 2A6HC 3TSSA 1KQSA 1FNVA 5FOBB 2E8GA 1PH9A 3MHBA 2MNAA 3FPUB 5FLXc 3HOWG 2F0QA 2VY3A 4GLAC 2JYOA 4YCVA 4ZKBB 1IKMA 4DUZL 1Y1WH 2UXDQ 2O4XA 2NVYB 5HGTA 2HUGA 3UE0A 5BR8L 4B9XA 2R93H 1G8ZD 4IN3A 1EWIA 3NQIA 4BY7G 4ZCKA 5C4HA 2DY7A 2F0UA 1VQ9A 1HZCA 1PH1A 4OIJA 2KCMA 3F2BA 3HZXA 2RSOA 5IYDG 1ESRA 1ASZA 3IRBA 1SAPA 1TU2B 2JEBI 3KBXA 1S72A 3TREA 1RHPA 4DV1Q 3C46A 1WTRA 4XDXA 1K0RA 1E3PA 1U5KA 3M3YH 3PO2H 4A75A 1WJJA 4JI7Q 2OCEA 4A3BB 2ZXRA 4DNTB 2ZJRA 2L15A 2PYKA 2PPBC 5CYUA 4RFBA 4DKAC 4G7HC 2R92G 1VQ4A 3M4QA 3K81C 3FKIB 3VA7A 5CBEE 1B44D 4F7XA 3DWQA 2EVBA 1EYCA 2RBMA 4GNXC 1NUCA 2RVLA 3BZKA 4BA1I 4CHTB 3GTPB 2F3IA 2OWOA 3VDYA 1GO3E 4OXPA 2K03A 2Q2IA 2XN9C 3S2DH 1Y1VB 3NBIA 5EPJA 5C4XH 3PIO3 4BBSH 4OIKA 5LHY1 4DV3L 2NVTH 4XYQA 2JEAI 2K28A 1WTQA 2KJXA 1Y8PB 4QF4A 2JA5H 5J1ZA 2ZTEA 4L5TA 3V2TA 2O2LD 3H91A 4JI0Q 2XVSA 5EGTA 2F0OA 2AMCB 5CMDA 2B39A 1SROA 1U4RA 1DXMA 1EU3A 1PRTF 2RHSB 1DYQA 3GTGB 1TS3A 1YJ9A 1HNZL 3KUPA 3GV3A 4J8QA 4JI7L 3MFGA 1DOKA 3K5OA 3FKIG 2N3SA 3S1NB 2N8NA 1U4MA 4GOPC 4EQNA 5M3MH 4O0AA 3H0GH 2F52A 2CH4A 4X62Q 5F2DA 2UUAQ 2YU9B 1IZ6A 1X6OA 3D0FA 4DV0Q 1Y1VG 3CHBD 2VXWA 3OMCA 3A55A 3RNUA 1A3TA 3NELA 3T1HL 4DR3L 5FLMG 3H3VI 3FDTA 3GP7A 3Q6SA 3HOUH 4JYAL 2RQXA 4GKKQ 3PUYA 3FHWA 4LF7L 1M1KC 3MXGA 5A2QL 5ELNA 5KEEA 1I4HA 1SNDA 3GTLB 2HCIA 1H9SB 1QUQA 4A3JB 2B63B 4XIGS 4JI0L 4FXDA 3H09A 1D7QA 4FO2A 2DUDA 3G6JB 3MXNA 5KNDA 2K5NA 2K5VA 2J4XA 4BBRB 3HKZE 5FK9C 1HNXL 3PSIA 2F0JA 2EYHA 4C1NI 3S17B 1QNUA 5E7NA 1PTOD 5J39A 1XTDA 1O78A 4G57A 1NAPA 4RHRA 3Q0AA 4K14A 3MEFA 2OXPA 1T5XD 1HUNA 4LWCA 3GQBA 1AE3A 1LYLA 4A3EB 1X54A 3HGBA 3CCUA 1JJCB 1VF5C 1V43A 1B1ZA 3GD7A 4NPSA 4X62L 2UUAL 2GA4B 5EPKA 1Q12A 2EQSA 4NKLA 2Z8LA 4DV0L 1LV9A 3CCVA 2F0PA 2FFKB 4OX9Q 2VUMB 1SMYD 3LWEA 5KGUA 3MVVA 2F0FA 1IW7C 2AUKA 1MKHA 2D0PA 5GQOA 1TY0A 4A3JG 1H95A 2B63G 4A3IB 4V190 1NCVA 1H9RA 2BE5D 3I4MB 1IBLQ 2MP1A 4K6LA 3CPWA 1B8AA 4DV5Q 4N9PA 4BBRG 4C3IB 1N32Q 2IT1A 1J8IA 4RWSC 4IFDG 1YNND 3OTOL 5C5LA 4DN4M 2UXBQ 3BYYB 1VQBA 2EJFC 3U50C 2PCFB 2GVAA 1PZJD 1I94Q 4IALA 1J5EQ 1ET9A 3HOWH 4DK3C 5EQ0A 3OPOA 3PUZA 5ELCA 1YIJA 3PV0A 4LNQA 4L6TB 4WJWA 3F2CA 4A3EG 4GN5A 2IY5B 1IL8A 2Q2TA 1I5FA 2NTSA 3R2IA 1JJGA 2MFIA 4BY7H 1TWAB 1BDOA 1QOHA 4ME5A 3URYA 1CQFA 4O1NA 4GZYC 4ZKCB 3I56A 5IYDH 2KEEA 5I2XA 2QGQA 1SE3A 2CWPA 2I5LX 1O7IA 1Q86C 4BY1B 2BDOA 2VNUD 1JMCA 2O5JC 4A3IG 1SNQA 1IYJB 1L0WA 1A63A 3I4MG 1AP0A 1OXSC 5FKAC 3TRZA 4J6HA 3S1QH 3CXCA 4C3IG 4QGUA 2R92H 4A3GB 1CHQD 3EJIA 4KJOA 2MUYA 3FP9A 5CC4A 2WAQB 4DV5L 1NMFA 2Z6KA 2AQ1B 2LS01 5CV4A 2XWJB 4IPCA 2F0EA 2N78A 1PH5A 2UXBL 1G291 3HKSA 3BS1A 1U4LA 5E4WC 1W2BA 2PQAA 2ZJQA 1PYBA 2RDGA 1H9JA 1IKLA 1D1IA 3RUZA 1XTCD 3AEVA 4KI0A 1I6HB 2K52A 2YYZA 3KLWA 3I91A 3DLLA 1TWGB 4CKCA 1C9OA 1J6QA 4L8JA 3UDFA 1JOKA 3ERSX 4DA2A 4HMIA 4IPHA 3J7YW 1C0AA 3CD6A 3D4DA 2QA4A 2F0IA 2KENA 4YWLA 1QVFA 4FF1A 4QIWE 1JQYD 2PW5A 4YY3Q 3U4VA 1CTMA 2PQEA 3D4RA 3S14B 3EFXD 1TS5A 3A7LA 1IL2A 4NXNQ 3K57A 1WD1A 1PFNA 3FKIH 1A3VA 1DZ1A 2WAQG 1FYCA 2HIXA 5I9OA 1EFWA 4CJ0B 1K83B 1Q1BA 1N33L 4IFDJ 3NSWA 1XYIA 3VR2A 3GTPH 1DONA 4A4IA 5KIXA 4NXML 1P16A 2JA8B 1N36Q 4YCWA 2EYJA 5JEAG 4KHPL 3NTKA 4YIJA 1Y1VH 5T1GA 5COYA 1ZYRC 5T1IA 1QVCA 4KMUC 1FVIA 3RN2A 3TDQA 5FLMH 1D1KA 4POFA 1CHPD 4JI1L 4LW1A 3MC0B 3MAQA 1PRTD 5IT9E 1WD0A 5ELBA 1SMXA 1ZEQX 1E24A
chains in the Genus database with same CATH topology
1EY0A 4UAIA 4ZK9B 2H1EA 2AQ2B 2DNCA 1GUTA 1VCIA 1TR5A 1TS2A 2IX3A 4DK1A 5C0XG 1Q90A 2EY5A 3VR3A 1JC7A 5CV7A 3L7ZC 3SE0A 4WFN3 3S2DB 1H9MA 5KRUA 5C4XB 3MZ5A 4BBSB 5KYLA 1YNJC 1EIHA 5M5XB 2NVTB 2QCPX 5D14A 1PTOC 3K6OA 2X6GA 2KCCA 1GUWA 3DWPA 3LWUA 2CW0C 1EIGA 2EDGA 2K5QA 2BA0A 3A8IE 3SHLA 1B50A 4K5XA 4CJ2C 4X3UA 1RD9D 1W6JA 4MN3A 3TP5A 5A35A 3J7AF 4I7ZC 1LT5D 1LTID 1SDFA 4IFDH 1AW7A 2NB0A 5M3MB 1LTAD 1M8AA 2F0GA 2WV6D 3BZDB 1JB3A 1SYEA 1STBA 2BE5C 4K6DA 2K01A 5FLXE 4KKUA 1VDZA 3GTMB 5M3FB 1YNNC 1DD2A 3SDZA 1BXTA 1UEAB 3K5MA 3HOZB 1SYFA 3FMCA 1JORA 2OF1A 2DNEA 5JEAJ 3I4NB 3NTHA 3C3LA 2H4OA 3CQZB 4LMQD 5DNFA 1CZWA 1SNPA 2BA1A 3K7AB 2X6LA 4Z9CB 1R9TB 1OXUA 3D8GA 1SYGA 2RDFA 3DEPA 2DN8A 5C0XJ 4P2CB 1A6XA 3U9OA 3M7GA 5FO9B 2SEBD 3SK5A 3OMGA 2F0TA 2PNRC 5ELFA 2MHVA 1H9SA 1I4RA 1AN8A 3GO5A 3QIAA 3D6CA 1CQVA 1W6KA 3MXUA 4FF2A 4O42A 5E3FA 1IHZA 3L9AX 3R93A 1TWCB 3VYUA 4BWGB 2EYOA 1V1PB 4CKEA 1E2VA 4IUTA 5IIFA 1EY7A 2G9HD 2JE6I 1HXYD 1RF2D 1JCKB 3SVMA 1B9MA 1SNCA 2NZ1D 4KKTA 5JEAH 2WKCA 1MSHA 4F87A 3N52A 1I4QA 3T16A 4QUFA 5DAUA 4K5VA 1JE4A 3QOJA 1PZID 3P20A 3BDLA 1J9OA 1GUGA 3C2PA 2L9HA 1M4VA 3OWFA 1VMCA 5D3IB 1LTRD 4HTHA 1MD2D 4B9WA 4LAAA 5EPLA 2FINB 5KNBA 3G7LA 3KLSA 3E6ZX 3I3CA 2F1MA 1PTOB 1UNSA 4QUCA 4WORA 4Y7NB 1SE2A 5C0XH 1EY5A 4JBWA 5JPMC 1ENFA 1G2SA 3ND9A 1EOTA 3MXPA 4XT3B 2B2VA 1LT4D 3K59A 3OW7A 4FVMA 3TZDA 4CJ1B 3F2UA 4C2MB 1TY2A 3BVMA 3ND8A 4XYOA 3ONAB 4DFAA 4HAEA 2SNSA 2I46A 2NBFA 2B2VC 3TP6A 1I4GA 4U68A 1KABA 2E74C 1D5ZC 1HTPA 4HCSA 2WKDA 3T51B 2EJMA 3D6WA 2F0NA 1B2TA 1BUVT 3SK6A 4RCNA 2EYPA 3DUZA 1Q1EA 1LLRD 4DAYA 3HKZB 1EY6A 3D3RA 4KY6A 5LL6S 3OHXC 2IWHA 3OSOA 3DEOA 1O7ZA 1C48A 4NDXA 3S9WA 3X3MA 2ICEC 1CA5A 2B2WA 2WP8J 5K5PA 4RGOS 1RTNA 1Z47A 4G4KA 1ICWA 1GJXA 5EKIA 2K05A 1TWFB 1MBYA 4LK1C 5E1FA 5KNCA 2NVQB 4NP5A 2E2IB 2F0KA 2IL8A 1O80A 2D9UA 5C6AA 3QOLA 1WTXA 1K8MA 1V1OA 2A73B 2B2WC 1EZ6A 1GHJA 5IT9L 1C8CA 3EA6A 3C1EA 3S1MB 1CT1D 5E4XA 3T13A 2F0WA 2L55A 5DM63 3CU7A 5I6YA 1BQQT 4FXKC 2K1BA 1DM0B 3HP3A 2QEJC 2L4NA 3X3NA 1FD7D 1F2YA 4ID6A 1K8OA 4XQNA 4C3JB 2EY2A 3I72A 2IJ0A 2B2UC 1ZXTA 3M7NA 2EXZA 2HQEA 1UAPA 1LACA 2QF7A 2NN6G 3TN2A 2L5TA 1VF7A 4PMBA 3TBIB 2M00A 1FR3A 5AFWA 4CGYB 5FO8B 5HURA 1XX8A 1HPCA 1PRTB 3DM1A 5CGKA 1CM9A 3RMHA 3IKJA 1BBXC 4KTAA 1JWMD 4IUVA 5DEHA 4HR7B 3JAME 3A7AB 2BOSA 5FO7B 3SK8A 3E5SA 1JOOA 2M2LA 5K36G 2B8FA 5CV8A 3BDCA 1SFOB 3NPPA 1E2WA 1CFMA 1U9RA 4M1UB 4C3JG 3BYTB 2OT2A 5JAVA 1PFBA 3MA2B 2VB2X 2B8GA 3HEJA 2WACA 3I4LA 4WRDA 1SSOA 1GUNA 3RZOB 3QJYA 5JVH3 4DXGA 3I90A 1EWCA 3J81L 4U673 1O7LA 1KLUD 4K5WA 5G3LF 2A5HA 2ID0A 1GHKA 3NBHA 3J7AV 1EFID 3NHHA 1F2LA 1S4ZA 4XT1B 4E6IA 4DU9A 1RTOA 1EQVA 3TP7A 3H6MA 1PTOH 4RHSA 3NTIA 1F9QA 3AB9A 3PO3B 4DXFA 1TWHB 1S5ED 5I6WA 2IX1A 1QG7A 1PYWD 1A2UA 2HDMA 1BR9A 1LTSD 4IUPA 4PMWA 5M5WB 2R6GA 1BCPF 4OO1G 1FNWA 4K8JA 1V1PA 4HN7A 4A3MB 3J80L 1FNUA 1HTLD 2BDNA 4NW2A 2R7ZB 1SYCA 2F0MA 4ILWA 4IFDI 1QNKA 1Y69U 5C44B 3CRKC 2F0SA 1Q8IA 2LY7A 2F03A 5I4DA 2F3WA 2LMCB 1OXXK 4DNRB 2XIWA 3BG3A 3C1FA 1DOLA 1B3AA 4KN4C 5J22A 1BO0A 1XXGA 1F9RA 2K6AA 4F8MA 1RJTA 2A68D 4DAPA 4R8IA 4G7OC 1LO5D 1WTWA 1MGSA 1SYBA 4R9WA 2F0LA 1II3A 4ZUJA 1AFPA 3VR5A 1F9SA 2XWBB 4A3KB 3H3VC 5BN4A 2EZVA 1EZ8A 4ZLTF 1JWUD 2C5CA 1BOSA 2F0HA 2NN6H 1NSNS 1R4QB 1WTPA 4KD4A 3PUWA 1STAA 1ML0D 2ZXOA 3BVGA 3VYTA 4PQXA 5CR3A 2LFNA 2XNAC 3DHQA 1EU4A 1B4OA 1SMYC 5K36H 3SXHA 1JR0D 4ULLA 1ESFA 3P75A 3IFTA 3OOCA 1D5XC 1HCZA 1C4QA 3PIP3 2EY1A 1V8QA 5BN5A 2E2DC 1HFNA 4DAVA 3R2TA 4C1NK 4PV1C 3MTSA 1SYDA 4FXGC 1I6VC 1F77A 5D3DA 1OO9B 3R3OA 3IAYA 4H0LC 2B2TC 4I65A 3GV6A 1EQTA 1SJED 1ET6A 1Q3LA 4RA8A 3K5LA 1STYA 2OEOA 1I50B 4XQQA 1I4PA 2AQ3B 4HSPA 4L63B 1U4PA 1DCZA 4C3HB 1X3QA 3MWYW 4K8IA 3T56B 1KAAA 4CKBA 4KY7A 1G6ZA 4TRDA 2L12A 2RDHA 3L3OC 5CV5A 2JXMB 1JOQA 1SNMA 4ABNA 4F88A 5G3LD 5TSSA 2B2YC 2KOLA 1Z6HA 4OO1H 1ONLA 3T53B 2PMZB 3NE5B 5C5MA 3EVQA 1I3QB 5D65A 5CV6A 2TSSA 1L0YB 2EYFA 1HA6A 3NQTA 1EEFD 2WB1B 3KBGA 5EKLA 3GTOB 3RD4A 1LTGD 2PZWA 4ZRZA 4C3HG 3JAML 1X32A 2BCOA 4RKLA 3PUXA 3EQLC 2CHBD 4EVOA 2QKIC 1I4XA 4CBVA 2IPKD 1BCPD 4J1MA 2V4DA 4M8AA 4XTCS 2ENBA 3TP8A 1HQMC 3M4YA 1HUMA 1IW7D 3QWNA 2MJ8A 2E2HB 2X69A 4ZAIA 1PRTC 4S3SA 4IZ8A 5IGEA 5C4JB 2A68C 1PFMA 4PNYA 1ENCA 3QB3A 1SEBD 4MHEA 3NWTA 1ILQA 5IGFA 1PZKD 4IUNA 3NP8A 3I70A 4KKSA 1Y8OB 4A3DB 3DMUA 2KEDA 2JA7B 1TVXA 4HSVA 1MSGA 2C9OA 3W2DA 3WDNA 4EQPA 1F9PA 3OIQA 3I73A 3VYRA 2R3ZA 4HEDA 1LABA 1AEXA 1SE4A 2IW3A 1PDQA 1SXTA 3HS0C 1GOZA 5C3XA 1OXTA 2D5DA 1SBBB 2Z1CA 3PUVA 5ELDA 4RAUC 2EPBA 1NR4A 2CQAA 4ZYSA 3GTQB 1KTKA 1PLFA 2R61A 2NWGA 5IGBA 4FNFA 2K32A 2ZXPA 1EY8A 4Q0FA 2Q8IB 3A8KE 1F2MA 3Q24A 4K2LA 3N6RA 2AWNA 1PMRA 2EYLA 2EOTA 4KV6A 4XQJA 5C3EB 5CORA 4K2KA 2L0CA 4IURA 3NWSA 4EGVA 1KDBA 3S16B 1O7YA 3K5NA 2FJ2A 2EJGC 1A15A 2XRSD 4X3TA 3FEWX 1IYVA 1STHA 4KY5A 3WOFA 1GUOA 2K04A 2N55A 3S2HB 1QILA 2B2UA 2KCNA 3S15B 3DXJC 3V05A 1ZYRD 3HOXB 1OXVA 4FF4A 2D62A 3KLRA 3S1RB 1UUPA 3IFDA 1G91A 2A6ED 4ODGA 2Q8TA 5EJWA 3CKIB 2JP1A 2E2JB 1DOMA 2PZTA 4G7ZC 3K0YA 5IOCA 1SNOA 2EE1A 2JA6B 5EBCA 2J7ZA 1STNA 5JJZA 2FHTA 5M5YB 5EBDA 3M4OB 1YNJD 3GTJB 1QE6A 2KQ3A 1IYUA 4KHZA 2ZT9C 3TMEA 4A3FB 1EEID 3FPPA 2CW0D 3K58A 2N88A 3IL8A 4A93B 2JSOA 1B9NA 3MFYA 4FP5D 5FLXL 4RKBA 1A3UA 1BCPC 1QJOA 1B53A 2FMMA 2O5IC 1E0BA 1LTTD 2CVRA 3QO2A 4BS9A 2SNMA 1TS4A 3VA5A 3HOYB 4QIWB 4DGZA 4OHJA 2Z4IA 2KUMA 3EROA 4KHVA 2NYZD 4JK1C 3TZUA 1ENAA 1VMPA 2DY8A 4RGNA 2QILA 5IGCA 3D31A 1HRJA 1JICA 2NVXB 2E75C 1T5EA 1GXDC 2AWOA 4OGQC 1MI2A 3W3AA 1DJRD 2XRQD 3KF8A 4DK0A 3NXWA 2L11A 1RCVD 1BF4A 2TMPA 4RGTA 1STEA 4EQOA 2NTTA 3T4AC 2F3VA 3O13A 2G9DA 1CA6A 3RZDB 2SDFA 1S5DD 1E2ZA 2KA7A 3DWAA 4OL7A 4LJZC 3VYSA 4TSSA 1LT6D 2NN6I 3Q22A 4QB4A 3HG9A 1X3PA 4N9TA 2FMCA 2I07B 3R8BA 2J0TD 3LNNA 1STGA 3OWEB 1D6EC 2NUCA 2K5DA 5ISRA 1KNAA 3HOVB 1KLGD 1TQOA 3GTKB 5I2YA 3PMFA 4RCOA 1H9KA 2HDLA 2A74C 5I9PA 3QG1A 4H44C 2K5WA 1QB5D 5CV9A 1Y1WB 1F2ZA 2PO4A 1CK1A 1QWYA 2R93B 5JOBA 5IGGA 4H13C 4KJNA 3FVQA 2F4IA 1EY9A 1KDCA 3U9SA 1Y8NB 3CRLC 5JPNC 3AMUA 4NMZA 2A69D 1HHVA 1TKWB 5DM73 4IQZA 3P1HA 2KVMA 5KYIA 4IUQA 1EY4A 3M3YB 1QCBD 3PO2B 2A6HD 2A6EC 3HRZC 4QCLA 2XSCA 4PMCA 3VR6A 2KECA 2PW7A 1G2TA 4IUUA 2KHSA 3KK7A 5JVG3 3BDOA 4KK7A 4ZUIA 1BCPB 2MPMA 3SK4A 1PXUA 5A2QE 3H94A 4HCEA 5NUCA 1A2TA 4FF3A 4RGMA 3OIPA 1WTOA 2E76C 1BNZA 2F0DA 1WCMB 1XWEA 1SJHD 1AZPA 4FYDA 2JA5B 4OO1I 1R4PB 4BA2I 4ZQ3A 2ICIA 1RDPD 1TIID 1TT2A 3SEBA 5C3WA 2B2TA 3P7JA 3A54A 2Y0SB 3I8ZA 4TQUS 1HQRD 2RA4A 3A56A 2RSNA 3AU7A 2K7VA 3ITPA 4C56C 1Z7TA 2EY6A 4UDUC 2VB3X 1FGBD 1S5FD 1S5CD 4MIUA 3NUCA 4QMGA 3H0GB 3WOEA 1JWSD 2AUJD 2K33A 2MGSA 5M9OA 1S5BD 1KNEA 4TKOB 1LTBD 4X3SA 5IGDA 1WVLA 3HOUB 2LKVA 1AZQA 4H7BA 3Q23A 5EKKA 4DF7A 3VR4A 2F0VA 1RODA 2B2YA 1LT3D 2SOBA 3FRPB 2WIIB 3UI2A 5C0XI 1L0XB 1HFGA 5LL6X 4V0BA 1CZGA 3J81E 5BN3A 1EWHA 4X3KA 2L1BA 1NR2A 3A8JE 1PTOF 1EYAA 3KLSX 4AYBB 1ILPA 2M9VA 3M85A 4KN7C 2D2CC 2WINB 4KD3A 2EYMA 3D4WA 1HA5A 4Q5VA 4XXEA 1KDAA 3ZYYX 2IX0A 1EL0A 2RKSA 3ERQA 3E0JA 3BVZA 3HOWB 3V96A 5ELEA 2HCCA 1D2BA 1RKNA 1EYDA 3RLFA 3J80E 2Q8RE 4BY7B 3LX0A 3SR1A 3NK9A 1ZKOA 5C4ZA 5CBAE 1GUSA 4RH6A 1D5MC 3MEHA 1CI3M 2Z4HA 2A69C 2QDBA 2PZUA 3S1QB 4HMJA 2R92B 5IODA 4R8NA 1WTVA 4B08A 2A6HC 3TSSA 1FNVA 5FOBB 3MHBA 3FPUB 1IKMA 2F0QA 2JYOA 4ZKBB 2O4XA 2NVYB 5HGTA 2HUGA 4B9XA 1G8ZD 4IN3A 3NQIA 5C4HA 2DY7A 2F0UA 4OIJA 3HZXA 2RSOA 1ESRA 1SAPA 1TU2B 2JEBI 3KBXA 3C46A 1RHPA 1WTRA 4XDXA 4A3BB 2ZXRA 4DNTB 2PYKA 2PPBC 5CYUA 4RFBA 4G7HC 3FKIB 3VA7A 5CBEE 4F7XA 1B44D 3DWQA 2EVBA 1EYCA 2RBMA 1NUCA 2RVLA 4BA1I 4CHTB 3GTPB 2K03A 2XN9C 1Y1VB 3NBIA 5EPJA 3PIO3 4OIKA 5LHY1 4XYQA 2JEAI 2K28A 1WTQA 2KJXA 1Y8PB 4QF4A 5J1ZA 3V2TA 2O2LD 3H91A 2XVSA 5EGTA 2F0OA 5CMDA 2B39A 1U4RA 1DXMA 1EU3A 1PRTF 1DYQA 3GTGB 1TS3A 3KUPA 3GV3A 4J8QA 3MFGA 1DOKA 3K5OA 3S1NB 1U4MA 4EQNA 5F2DA 2YU9B 3CHBD 2VXWA 3OMCA 3A55A 1A3TA 3FDTA 3GP7A 3Q6SA 2RQXA 3PUYA 3MXGA 5A2QL 5KEEA 1I4HA 1SNDA 3GTLB 2HCIA 1H9SB 4A3JB 2B63B 4XIGS 4FXDA 3H09A 4FO2A 3G6JB 3MXNA 5KNDA 2J4XA 4BBRB 5FK9C 2F0JA 2EYHA 4C1NI 3S17B 1QNUA 1PTOD 5J39A 1O78A 4G57A 1NAPA 4RHRA 3Q0AA 4K14A 2OXPA 1T5XD 1HUNA 3GQBA 4A3EB 3HGBA 1VF5C 1V43A 1B1ZA 3GD7A 2GA4B 5EPKA 1Q12A 4NKLA 2Z8LA 1LV9A 2F0PA 2FFKB 2VUMB 1SMYD 3LWEA 5KGUA 3MVVA 2F0FA 1IW7C 2AUKA 1TY0A 4A3IB 4V190 1NCVA 1H9RA 2BE5D 3I4MB 2MP1A 4K6LA 4N9PA 4C3IB 1J8IA 2IT1A 4RWSC 4IFDG 1YNND 5C5LA 4DN4M 3BYYB 2EJFC 2PCFB 1PZJD 4IALA 1ET9A 5EQ0A 3OPOA 3PUZA 5ELCA 3PV0A 4L6TB 4WJWA 1IL8A 2NTSA 3R2IA 1TWAB 1BDOA 1QOHA 4ME5A 3URYA 1CQFA 4O1NA 4GZYC 4ZKCB 2KEEA 5I2XA 1SE3A 4BY1B 2BDOA 2VNUD 2O5JC 1SNQA 1AP0A 1OXSC 5FKAC 4J6HA 4C3IG 4A3GB 1CHQD 3EJIA 4KJOA 2MUYA 5CC4A 2WAQB 2AQ1B 2LS01 5CV4A 2XWJB 2F0EA 1G291 3BS1A 1U4LA 5E4WC 2RDGA 1H9JA 1IKLA 1D1IA 3RUZA 1XTCD 4KI0A 1I6HB 2YYZA 3I91A 1TWGB 4CKCA 4L8JA 1JOKA 4DA2A 4HMIA 3J7YW 3D4DA 2F0IA 4FF1A 1JQYD 2PW5A 1CTMA 2PQEA 3D4RA 3S14B 3EFXD 1TS5A 3A7LA 3K57A 1WD1A 1PFNA 1A3VA 1DZ1A 1FYCA 5I9OA 4CJ0B 1K83B 1Q1BA 4IFDJ 3NSWA 1XYIA 3VR2A 1DONA 5KIXA 2JA8B 2EYJA 5JEAG 3NTKA 4YIJA 5T1GA 5COYA 1ZYRC 5T1IA 4KMUC 3TDQA 1D1KA 1CHPD 3MC0B 3MAQA 1PRTD 5IT9E 1WD0A 5ELBA 1ZEQX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP7 A;  3BYT B;  3R8B A;  2CHB D;  1SE3 A;  2AQ2 B;  5ELD A;  1SJH D;  1I4X A;  3R2T A;  3OWE B;  1D6E C;  1PTO B;  1UNS A;  4ZYS A;  1I4H A;  1KTK A;  1EEI D;  1TS2 A;  5I4D A;  1V1O A;  2IPK D;  2R61 A;  1HA5 A;  1SE2 A;  4Z9C B;  1BCP D;  2ICI A;  1ENF A;  3EA6 A;  1RDP D;  1F77 A;  5D3D A;  1CT1 D;  5FKA C;  1BCP C;  1KLG D;  1LT4 D;  2J4X A;  3SEB A;  1CHQ D;  5FK9 C;  4RCO A;  4DXG A;  1LTT D;  1EWC A;  2AQ1 B;  4RFB A;  1PTO D;  1XXG A;  1HQR D;  1SJE D;  1ET6 A;  1PRT C;  1TS4 A;  1TY2 A;  4RHR A;  1B44 D;  2SEB D;  1KLU D;  3BVM A;  3DWQ A;  1T5X D;  4OHJ A;  1PTO C;  4C56 C;  4UDU C;  1LO5 D;  5ELF A;  3BVZ A;  2QEJ C;  2RDG A;  1FGB D;  1EFI D;  1I4P A;  2AQ3 B;  4L63 B;  1S5F D;  1S5C D;  1I4R A;  1AN8 A;  5ELE A;  3DWP A;  1CQV A;  2XRS D;  1XTC D;  2XN9 C;  1B1Z A;  1FD7 D;  1SEB D;  1I4G A;  1JWS D;  1CK1 A;  4RGN A;  2Z8L A;  1D5Z C;  1PZK D;  2QIL A;  1S5B D;  1PTO H;  4RHS A;  2RDH A;  2IJ0 A;  1LTB D;  4BWG B;  1QIL A;  1JWU D;  1RD9 D;  4DXF A;  3V05 A;  2O2L D;  1V1P B;  1JQY D;  2G9H D;  1S5E D;  1TY0 A;  1LT5 D;  1PYW D;  1LTI D;  1LLR D;  1LT3 D;  5TSS A;  1UUP A;  1EU3 A;  3EFX D;  1AW7 A;  1PRT F;  1TS5 A;  1DJR D;  4RH6 A;  1D5M C;  1HXY D;  4K6L A;  1RF2 D;  1LTA D;  3BVG A;  1JCK B;  2WV6 D;  3W2D A;  3BZD B;  1LTS D;  1DYQ A;  2XRQ D;  1TS3 A;  1L0X B;  3BYY B;  1PRT B;  2XNA C;  3MFG A;  1RCV D;  4RGT A;  1STE A;  1PZJ D;  1BCP F;  2TSS A;  1ET9 A;  1L0Y B;  3TSS A;  1FNW A;  2NTT A;  1FNV A;  1I4Q A;  1JWM D;  1V1P A;  1BXT A;  3O13 A;  5ELC A;  1EEF D;  1EU4 A;  4L6T B;  1PZI D;  1SE4 A;  4RGO S;  1JR0 D;  1BCP B;  1M4V A;  2NTS A;  3R2I A;  5D3I B;  1FNU A;  1SXT A;  1S5D D;  1LTR D;  1HTL D;  1ESF A;  1LTG D;  3DWA A;  3CHB D;  1MD2 D;  4TSS A;  1LT6 D;  1CHP D;  1GOZ A;  1D5X C;  1PTO F;  4RGM A;  3MC0 B;  1PRT D;  1SBB B;  3URY A;  5ELB A;  1G8Z D;  4O1N A;  3KLS X; 
#chains in the Genus database with same CATH topology
 1EY0 A;  4UAI A;  2Z9H A;  4ZK9 B;  2H1E A;  2AQ2 B;  2DNC A;  1GUT A;  1VCI A;  1TR5 A;  1EQQ A;  1KC8 C;  1TS2 A;  2IX3 A;  4DK1 A;  1VQ8 A;  5C0X G;  1Q90 A;  2EY5 A;  3GTG H;  1TWF H;  4YY3 L;  3VR3 A;  1JC7 A;  5CV7 A;  1LM0 A;  3L7Z C;  3SE0 A;  3CMA A;  4WFN 3;  3S2D B;  1IBM L;  1H9M A;  5KRU A;  5C4X B;  3MZ5 A;  3S1N H;  4LF8 Q;  4BBS B;  5KYL A;  1YNJ C;  5C44 G;  3CCQ A;  4LF5 Q;  1AH9 A;  1EIH A;  5M5X B;  2NVT B;  4FDB A;  2QCP X;  5D14 A;  3OYY A;  2JA8 G;  1PTO C;  1NJI C;  3K6O A;  2X6G A;  2KCC A;  2ATW A;  1YHQ A;  1GUW A;  3DWP A;  3LWU A;  1WOC A;  2CW0 C;  1EIG A;  2EDG A;  2K5Q A;  2BA0 A;  3A8I E;  1YVC A;  3SHL A;  1B50 A;  4K5X A;  1HZ9 A;  3T1Y Q;  4X66 Q;  3GTL H;  4CJ2 C;  2HHH Q;  4X3U A;  1RD9 D;  1W6J A;  4A3J H;  4PZ8 A;  2B63 H;  4MN3 A;  3A5U A;  1K0S A;  3TP5 A;  5A35 A;  3J7A F;  4I7Z C;  4DV4 Q;  1LT5 D;  1LTI D;  1HZB A;  4BBR H;  1SDF A;  2MO0 A;  4IFD H;  1AW7 A;  2ZTD A;  2NB0 A;  5M3M B;  1LTA D;  2HQL A;  1M8A A;  3S17 H;  2F0G A;  2WV6 D;  3BZD B;  1JB3 A;  1SYE A;  1VQG A;  1STB A;  2BE5 C;  4B3T L;  4K6D A;  2K01 A;  3K0X A;  5FLX E;  5IP7 G;  4KKU A;  1VDZ A;  1C7Y A;  3GTM B;  5M3F B;  1YNN C;  1DD2 A;  4A3E H;  4JBM A;  3M9B A;  1PYS B;  3UE1 A;  3SDZ A;  4LF5 L;  1BXT A;  1UEA B;  1IBK L;  1JJ2 A;  3K5M A;  3HOZ B;  2A1A A;  1SYF A;  3FMC A;  1UWV A;  3JC6 6;  1JOR A;  2OF1 A;  4R4O A;  2DNE A;  5JEA J;  3I4N B;  5JJL A;  3NTH A;  1XMQ Q;  2NZO A;  3UDX A;  3C3L A;  2UUB L;  2H4O A;  3CQZ B;  4LMQ D;  5DNF A;  1CZW A;  1SNP A;  2BA1 A;  4A3I H;  3K7A B;  1U0L A;  2X6L A;  3I4M H;  2HHH L;  4Z9C B;  4R4I A;  3NBH B;  1XNQ L;  5HY6 A;  4B3M Q;  4C3I H;  1R9T B;  4DV4 L;  1OXU A;  3D8G A;  4IOA A;  1L1O A;  1SYG A;  5LMN Q;  2RDF A;  3DEP A;  3UDG A;  4CDF C;  2DN8 A;  5C0X J;  4P2C B;  1A6X A;  1K3R A;  3U9O A;  3M7G A;  5M3F G;  5FO9 B;  2SEB D;  3SK5 A;  3OMG A;  2F0T A;  2PNR C;  5ELF A;  2H5X A;  1PHJ A;  2MHV A;  1H9S A;  3HOZ G;  1TWA H;  4DR6 Q;  5L37 A;  1I4R A;  1AN8 A;  3GO5 A;  3QIA A;  3D6C A;  1CQV A;  3I4N G;  5H1S E;  1W6K A;  3MXU A;  4FF2 A;  3I2Z A;  1XMQ L;  4O42 A;  5E3F A;  1IHZ A;  3L9A X;  3R93 A;  1TWC B;  2HIV A;  3VYU A;  4BWG B;  2EYO A;  3PIO A;  4LF6 Q;  1V1P B;  4CKE A;  1E2V A;  5AJ3 Q;  4IUT A;  5IIF A;  1EY7 A;  2G9H D;  2JE6 I;  1Q8K A;  1HXY D;  1RF2 D;  1JCK B;  4B3M L;  3SVM A;  1B70 B;  1B9M A;  1SNC A;  3BJU A;  1Z9F A;  2NZ1 D;  4DV6 Q;  1K73 C;  4KKT A;  1CUK A;  5JEA H;  2WKC A;  4R4T A;  1MSH A;  4F87 A;  3N52 A;  1I4Q A;  3T16 A;  4QUF A;  5DAU A;  4K5V A;  3KDF B;  1JE4 A;  3QOJ A;  1PZI D;  4P74 A;  3P20 A;  1YZ6 A;  3BDL A;  1J9O A;  1GUG A;  2CKZ B;  1MJE A;  2L9H A;  3G4S A;  3C2P A;  2VW9 A;  1M4V A;  3OWF A;  1VMC A;  5D3I B;  1I6H H;  1LTR D;  4HTH A;  1MD2 D;  1TWG H;  4B9W A;  4TVA B;  1VQN A;  2F4V L;  4DR2 Q;  4LAA A;  5EPL A;  1N9W A;  2FIN B;  2CCZ A;  5KNB A;  1FJG Q;  3G7L A;  3KLS A;  4H02 A;  4QJF A;  3E6Z X;  3I3C A;  2F1M A;  1PTO B;  1UNS A;  1PA6 A;  3AFP A;  4QUC A;  1X3E A;  4WOR A;  3S14 H;  4HIM A;  4Y7N B;  1SE2 A;  5C0X H;  3ULP A;  1EY5 A;  4JBW A;  2QW7 A;  5JPM C;  1ENF A;  4DR5 Q;  1G2S A;  5AJ3 L;  3ND9 A;  1EOT A;  1VQP A;  3MXP A;  4XT3 B;  5LMU Q;  2B2V A;  1LT4 D;  1PH2 A;  1K83 H;  3K59 A;  3OW7 A;  5C44 H;  4A76 A;  4DR1 L;  4X6A H;  4FVM A;  3TZD A;  3CME A;  4JI8 Q;  1EIY B;  2LSS A;  4CJ1 B;  2JA8 H;  3KFU A;  3F2U A;  4C2M B;  2PMZ E;  1TY2 A;  4IO9 A;  3BVM A;  3ND8 A;  4XYO A;  4DV6 L;  4GNX A;  3ONA B;  4UY8 C;  4DFA A;  1YBY A;  2E5L Q;  4LFC Q;  4HAE A;  1ICF B;  2SNS A;  2OQ0 A;  2I46 A;  2WB1 E;  2NBF A;  2AHO B;  4IPD A;  2B2V C;  3TP6 A;  1X55 A;  3NEM A;  1I4G A;  4U68 A;  1KAB A;  2E74 C;  3KF6 B;  1D5Z C;  1HTP A;  3LGJ A;  4HCS A;  2WKD A;  3T51 B;  2EJM A;  3D6W A;  2KCT A;  4DR2 L;  4LUV A;  2F0N A;  1SE8 A;  1B2T A;  1FJG L;  1BUV T;  3SK6 A;  3CPF A;  2EYP A;  4RCN A;  1K28 A;  4DPG A;  2I5H A;  3DUZ A;  1Q1E A;  3HFZ B;  1LLR D;  1NTG A;  4DAY A;  3HKZ B;  1HJP A;  1K8A C;  2OTJ A;  1EY6 A;  3D3R A;  4KY6 A;  5LL6 S;  4JI2 Q;  4DR5 L;  5IP7 H;  3OHX C;  2IWH A;  3OSO A;  3DEO A;  2UXD L;  5M5X H;  1O7Z A;  1C48 A;  4QL5 A;  1SRU A;  4NDX A;  3S9W A;  3AYH B;  2K14 A;  3X3M A;  2ICE C;  1CA5 A;  4JI8 L;  2B2W A;  4GOP A;  2WP8 J;  5K5P A;  4OEL B;  4RGO S;  4B3S Q;  3K80 C;  1TXY A;  2E5L L;  1RTN A;  4K0K Q;  1Z47 A;  4G4K A;  1ICW A;  4L5R C;  4DV1 L;  1E1T A;  4Y52 H;  1GJX A;  2Q2H A;  5EKI A;  1VQ5 A;  2K05 A;  1TWF B;  1MBY A;  4LK1 C;  5E1F A;  5KNC A;  2NVQ B;  4NP5 A;  4JV5 Q;  2F0K A;  2E2I B;  2IL8 A;  1O80 A;  1UE1 A;  2D9U A;  3QOL A;  5C6A A;  1WTX A;  1K8M A;  1V1O A;  2A73 B;  2B2W C;  4GS3 A;  1EZ6 A;  1GHJ A;  5IT9 L;  1VQH A;  4MTK A;  1C8C A;  3EA6 A;  3C1E A;  3S1M B;  2EIF A;  1CT1 D;  5E4X A;  3HKZ G;  3T13 A;  2F0W A;  2K75 A;  2L55 A;  5JJK A;  3GTM H;  1G6P A;  5DM6 3;  5M3F H;  3CU7 A;  2V1C C;  5I6Y A;  1BQQ T;  4FXK C;  2K1B A;  3HOZ H;  1DM0 B;  3HP3 A;  4OEM B;  1QZG A;  3EBE A;  3I4N H;  2QEJ C;  2L4N A;  3X3N A;  4UPA A;  1XMO Q;  1GM5 A;  4CDC C;  1CSP A;  1FD7 D;  1F2Y A;  4ID6 A;  3CQZ H;  1K8O A;  4XQN A;  4C3J B;  5IE8 A;  2EY2 A;  3I72 A;  2IJ0 A;  3K7A H;  1D8L A;  1NE3 A;  5C3E G;  2B2U C;  5GAE C;  1ZXT A;  3BZC A;  3M7N A;  4HIO A;  1R9T H;  2EXZ A;  1MJC A;  4UHV A;  4X65 Q;  2HQE A;  2YTV A;  1UAP A;  1LAC A;  2QF7 A;  2VS1 A;  2NN6 G;  3TN2 A;  2XTI A;  3CC2 A;  2L5T A;  1W3S A;  1VF7 A;  4LUZ A;  4PMB A;  3TBI B;  2M00 A;  1FR3 A;  5AFW A;  4CGY B;  4EX5 A;  3CCS A;  3TEH B;  5FO8 B;  5HUR A;  1XX8 A;  1HPC A;  1PRT B;  3DM1 A;  2JA9 A;  5EAY A;  1QVG A;  4JI5 Q;  5CGK A;  3SGI A;  1CM9 A;  3RMH A;  3IKJ A;  1BBX C;  4KTA A;  1JWM D;  4IUV A;  5DEH A;  4HR7 B;  3JAM E;  3A7A B;  2OTL A;  2VQF Q;  2BOS A;  4GKK L;  4BXX G;  5FO7 B;  3SK8 A;  4JCV E;  3E5S A;  1JOO A;  2M2L A;  5K36 G;  2B8F A;  5CV8 A;  1EOV A;  3BDC A;  3CC4 A;  1SFO B;  3NPP A;  1E2W A;  1TWC H;  1CFM A;  1U9R A;  4M1U B;  4C3J G;  3BYT B;  2OT2 A;  4GN3 B;  5JAV A;  1PFB A;  3MA2 B;  2VB2 X;  4HJ5 A;  2B8G A;  4HJ8 A;  3HEJ A;  3J7Z C;  3GTO H;  1K9M C;  1YI2 A;  2KHJ A;  2WAC A;  3I4L A;  4WRD A;  1A8V A;  5FJ8 G;  4X65 L;  3A74 A;  1SSO A;  1GUN A;  3RZO B;  3QJY A;  5JVH 3;  4DXG A;  3I90 A;  1E22 A;  1EWC A;  2CH4 W;  2JQO A;  3J81 L;  4U67 3;  1O7L A;  1HR0 Q;  1KLU D;  4A3F G;  4K5W A;  3CCE A;  5G3L F;  4OX9 L;  2A5H A;  2ID0 A;  1GHK A;  1X3F A;  3NBH A;  3J7A V;  1EFI D;  2PNH A;  4JI4 Q;  2VQF L;  3NHH A;  1F2L A;  4HIK A;  1S4Z A;  1VS0 A;  1XPR A;  4XT1 B;  4E6I A;  4DU9 A;  1RTO A;  4LF4 Q;  1EQV A;  3TP7 A;  3H6M A;  1IBL L;  1PTO H;  4RHS A;  1N32 L;  1VQL A;  3NTI A;  1F9Q A;  4Y7N H;  3AB9 A;  3PO3 B;  4DXF A;  1P8L A;  3RN5 A;  2ZJP A;  3PF4 A;  1TWH B;  1S5E D;  2NZH A;  5I6W A;  1QG7 A;  1J5E L;  1PYW D;  1I94 L;  2IX1 A;  1VQK A;  1VQJ A;  1A2U A;  3TS2 A;  2HDM A;  1BR9 A;  1LTS D;  4IUP A;  2RCN A;  4C2M H;  4PMW A;  2R7F A;  5M5W B;  2R6G A;  3J81 i;  1BCP F;  4OO1 G;  1N34 Q;  3PIP A;  1FNW A;  4K8J A;  4DV2 Q;  1V1P A;  4HN7 A;  4A3M B;  3J80 L;  1FNU A;  3A0J A;  1HTL D;  2BDN A;  4NW2 A;  2R7Z B;  1SYC A;  2F0M A;  4ILW A;  4LUO A;  1KXL A;  1Q81 C;  4IFD I;  1QNK A;  5HGQ A;  1Y69 U;  4P73 A;  5C44 B;  3CRK C;  1HR0 W;  2F0S A;  3B6Y A;  3PO3 G;  1Q8I A;  4P71 A;  2LY7 A;  1AE2 A;  2F03 A;  5I4D A;  1G51 A;  2F3W A;  2LMC B;  4AH6 A;  1OXX K;  3KDF A;  4DNR B;  2XIW A;  2KHI A;  5IYC G;  3BG3 A;  3C1F A;  1VQD A;  1ASY A;  1DOL A;  1B3A A;  4KN4 C;  3GTQ H;  4JG2 A;  5J22 A;  2WFW A;  1BO0 A;  1XXG A;  1F9R A;  2K6A A;  4F8M A;  1RJT A;  4JW0 A;  2A68 D;  4DAP A;  2ES2 A;  4LFB Q;  4R8I A;  4G7O C;  2OQK A;  1LO5 D;  1NNX A;  4OWX B;  1WTW A;  3G71 A;  3CCL A;  3RLN A;  4WJ4 A;  1MGS A;  1SYB A;  4QY7 A;  4R9W A;  4A3M G;  3J80 i;  3HOV G;  2F0L A;  1II3 A;  2R7Z G;  4ZUJ A;  1AFP A;  3VR5 A;  1F9S A;  2XWB B;  4NXN L;  5C3E H;  2NVQ H;  3E0E A;  4A3K B;  2E2I H;  3H3V C;  4DR4 Q;  5BN4 A;  2EZV A;  1VQC A;  1EZ8 A;  4ZLT F;  1JWU D;  3OW2 A;  1HNW Q;  4GLX A;  2C5C A;  4LF9 Q;  1BOS A;  1YJN A;  3S1M H;  2F0H A;  4GKJ Q;  2NN6 H;  4HID A;  1NSN S;  1R4Q B;  5J3B A;  4JOI C;  1N36 L;  1WTP A;  4KD4 A;  3PUW A;  3RLO A;  1STA A;  1ML0 D;  2ZXO A;  3BVG A;  3VYT A;  4PQX A;  5CR3 A;  2LFN A;  3KF6 A;  2DGY A;  2XNA C;  2QEX A;  4BXX H;  2YTY A;  3DHQ A;  1EU4 A;  1WTH A;  1B4O A;  4DNI A;  1SMY C;  5K36 H;  3SXH A;  1JR0 D;  4ULL A;  2A8V A;  1ESF A;  3P75 A;  3IFT A;  1VQM A;  1RIP A;  4C3J H;  3OOC A;  1D5X C;  1HCZ A;  1C4Q A;  3PIP 3;  2EY1 A;  1V8Q A;  4A3K G;  4X64 Q;  5BN5 A;  2E2D C;  1HFN A;  3W5O A;  4DAV A;  5GAH C;  3R2T A;  4C1N K;  4PV1 C;  3MTS A;  1SYD A;  5FJ8 H;  1SN8 A;  1SLJ A;  4FXG C;  4HJ7 A;  4LF8 L;  5M5Y H;  1Y14 B;  4POG A;  3M4O H;  4R1J A;  1I6V C;  1F77 A;  5D3D A;  1OO9 B;  4GKJ L;  3R3O A;  3IAY A;  2VQE Q;  4H0L C;  2B2T C;  1YHB A;  4I65 A;  4A3F H;  1WYD A;  2JK8 A;  3GV6 A;  1EQT A;  1SJE D;  1WCM G;  1ET6 A;  1Q3L A;  4RA8 A;  1X3G A;  3K5L A;  3T1Y L;  1STY A;  2OEO A;  4X66 L;  4HJ9 A;  1I50 B;  4XQQ A;  4YWM A;  1I4P A;  2AQ3 B;  4HSP A;  4LFA Q;  2MO1 A;  4L63 B;  1U4P A;  1SFO H;  4OWT B;  4DR7 Q;  1DCZ A;  2B3G A;  4J15 A;  4C3H B;  4L5S A;  1X3Q A;  4MNO A;  4B3R Q;  3MWY W;  3KF8 B;  4K8I A;  3T56 B;  1KAA A;  4CKB A;  3K7U C;  4KY7 A;  1G6Z A;  1B7Y B;  4TRD A;  2L12 A;  1MHW C;  1Q82 C;  2RDH A;  3L3O C;  2R7D A;  1EUJ A;  3I7F A;  4X64 L;  5CV5 A;  3ULL A;  2UU9 Q;  2JXM B;  3KOJ A;  1JOQ A;  1SNM A;  4ABN A;  4F88 A;  1N8R C;  5G3L D;  5TSS A;  3STB D;  2B2Y C;  3RZO H;  2KOL A;  1XNR Q;  1Z6H A;  2ZTC A;  4OO1 H;  1ONL A;  3T53 B;  2PMZ B;  3NE5 B;  5C5M A;  2NVX H;  1A0I A;  3EVQ A;  1I3Q B;  5D65 A;  2UXC Q;  5CV6 A;  2TSS A;  2Y0S E;  1L0Y B;  1KHI A;  3BU2 A;  2EYF A;  1HA6 A;  1BVS A;  3NQT A;  5IT9 c;  1EEF D;  2WB1 B;  3KBG A;  3KYH C;  5EKL A;  3GTO B;  3RD4 A;  1LTG D;  2YV5 A;  2PZW A;  4ZRZ A;  4C3H G;  2YTX A;  2D0O A;  4LFA L;  2DJF C;  4DR7 L;  3JAM L;  1X32 A;  2BCO A;  4RKL A;  3PO3 H;  4B3R L;  3PUX A;  1BBU A;  5LMN L;  3EQL C;  3PGZ A;  2CHB D;  1KRS A;  1TWH H;  4EVO A;  2QKI C;  1I4X A;  4CBV A;  4DUZ Q;  3AFQ A;  2IPK D;  5IYC H;  5BR8 Q;  1BCP D;  3W1G A;  4JC0 A;  4J1M A;  2V4D A;  4M8A A;  4XTC S;  2ENB A;  3TP8 A;  1HQM C;  2CQO A;  3M4Y A;  5M5W H;  4UP8 A;  4N8F A;  4DR6 L;  1CKN B;  1HUM A;  2UUC Q;  1IW7 D;  3QWN A;  1XNR L;  2MJ8 A;  2E2H B;  1K3B C;  2X69 A;  4ZAI A;  1JE5 A;  1PRT C;  4S3S A;  4IZ8 A;  4A3M H;  1OTC A;  2ALY B;  4IOC A;  3HOV H;  5IGE A;  2WB1 G;  1PH3 A;  5C4J B;  2R7Z H;  4LF6 L;  2A68 C;  1PFM A;  3GTK H;  5ELO A;  1K8G A;  4PNY A;  3H15 A;  1ENC A;  3QB3 A;  3GDE A;  1SEB D;  4MHE A;  3E3X A;  3NWT A;  1ILQ A;  1PFS A;  1UEB A;  3CCJ A;  1GVP A;  1PZK D;  5IGF A;  3JAM i;  4IUN A;  3NP8 A;  3I70 A;  4KKS A;  1Y8O B;  5GAD C;  4A3D B;  3DMU A;  4AYB E;  2KED A;  1HH2 P;  3CAM A;  2JA7 B;  1TVX A;  3I4O A;  4HSV A;  4ME3 A;  5DLQ E;  4DV3 Q;  1MSG A;  1S40 A;  2C9O A;  3ER0 A;  3W2D A;  2VZA A;  3DM3 A;  3WDN A;  3L2P A;  4EQP A;  1XPU A;  1IXR A;  1F9P A;  3OIQ A;  2UUC L;  3I73 A;  3VYR A;  2R3Z A;  3A5Z B;  2ASB A;  4HED A;  2AKW B;  1LAB A;  1AEX A;  1GD7 A;  1SE4 A;  2RHQ B;  2IW3 A;  1PDQ A;  1SXT A;  3EN2 A;  1HNZ Q;  3HS0 C;  4A3K H;  4JI6 Q;  1GOZ A;  5C3X A;  1LUZ A;  1OXT A;  2D5D A;  3G6E A;  1SBB B;  2Z1C A;  3G48 A;  5LMU L;  3WWV A;  4O2D A;  3J81 c;  3PUV A;  3PQI A;  5ELD A;  4RAU C;  2EPB A;  1NR4 A;  4A3D G;  2CQA A;  4ZYS A;  3GTQ B;  1KTK A;  1PLF A;  2R61 A;  2NWG A;  2JA7 G;  5IGB A;  4MZ9 A;  4FNF A;  3T1H Q;  2K32 A;  4DR3 Q;  2ZXP A;  1EY8 A;  4Q0F A;  4LFC L;  1VQ6 A;  2Q8I B;  3A8K E;  4A3C G;  4JYA Q;  1F2M A;  3Q24 A;  1WCM H;  4K2L A;  4LF7 Q;  2Z6B A;  1VQE A;  3N6R A;  1X56 A;  2AWN A;  1RL2 A;  3UDI A;  1PMR A;  2EYL A;  5IYB G;  2PI2 A;  2EOT A;  4KV6 A;  4P72 A;  1PH6 A;  4XQJ A;  3W1B A;  1KL9 A;  4NB3 A;  5C3E B;  5COR A;  4K2K A;  3J81 j;  2L0C A;  1PH8 A;  4IUR A;  3NWS A;  4EGV A;  1KDB A;  3S16 B;  1O7Y A;  1CKM A;  4APV A;  3K5N A;  2FJ2 A;  1HNX Q;  2EJG C;  1A15 A;  2XRS D;  4X3T A;  3FEW X;  1NMG A;  1IYV A;  4A3B G;  1STH A;  4KY5 A;  3WOF A;  1GUO A;  1PH4 A;  2K04 A;  3CF5 A;  4JI2 L;  4JI6 L;  4ALP A;  2N55 A;  3S2H B;  1QIL A;  2B2U A;  2KCN A;  3S15 B;  3DXJ C;  3V05 A;  1ZYR D;  3HOX B;  1Q46 A;  1OXV A;  4IPG A;  1CKO A;  3J80 c;  4FF4 A;  2D62 A;  3KLR A;  3S1R B;  1UUP A;  2RF4 A;  1QZH A;  3IFD A;  1G91 A;  1L1O B;  2A6E D;  4ODG A;  2Q8T A;  3NEN A;  5EJW A;  4B3S L;  3STB C;  3CKI B;  2JP1 A;  4K0K L;  2E2J B;  4RG1 A;  2Z0S A;  1DOM A;  2PZT A;  4G7Z C;  3E9H A;  3K0Y A;  5IOC A;  1I50 H;  1SNO A;  1YJW A;  2EE1 A;  4JV5 L;  4P75 A;  4C3H H;  2JA6 B;  5EBC A;  2J7Z A;  5IWA Q;  1STN A;  5JJZ A;  1UE5 A;  3OTO Q;  2FHT A;  1X65 A;  5M5Y B;  5EBD A;  3M4O B;  1YNJ D;  3GTJ B;  1QE6 A;  3ICE A;  2MQH A;  2KQ3 A;  5JJI A;  4CDD C;  3ULJ A;  1IYU A;  4GN4 B;  4KHZ A;  1LTL A;  2EXD A;  2ZT9 C;  3TME A;  4A3F B;  1EEI D;  3FPP A;  3HOX G;  2CW0 D;  2RCF A;  3K58 A;  2N88 A;  3IL8 A;  4A93 B;  3S24 A;  2G5D A;  2JSO A;  1B9N A;  3MFY A;  4FP5 D;  5FLX L;  4RKB A;  1A3U A;  1BCP C;  1QJO A;  1B53 A;  3J7A 5;  1JT8 A;  1EQR A;  1XMO L;  2IHE A;  1PVO A;  1I3Q H;  2GN5 A;  2FMM A;  2O5I C;  3CCR A;  1E0B A;  1LTT D;  2CVR A;  3QO2 A;  4BS9 A;  2SNM A;  1TS4 A;  3VA5 A;  1PV4 A;  3HOY B;  1CSQ A;  4QIW B;  1NY4 A;  4DGZ A;  4OHJ A;  2Z4I A;  2KUM A;  2LXK A;  3ERO A;  4KHV A;  1GKH A;  1FGU A;  4YCU A;  2JA6 G;  2NYZ D;  4JK1 C;  3TZU A;  1ENA A;  1VMP A;  2DY8 A;  5IWA L;  1FL0 A;  4RGN A;  5GAG C;  2QIL A;  2QDL A;  5IGC A;  3D31 A;  2A19 A;  1HRJ A;  1JIC A;  3F2D A;  4JBK A;  2NVX B;  2E75 C;  3Q8D A;  1T5E A;  1GXD C;  4JI5 L;  2AWO A;  4IJH A;  4OGQ C;  4A93 G;  2K4K A;  1MI2 A;  3W3A A;  3H3V H;  1DJR D;  4A3L G;  4PZ7 A;  2XRQ D;  3KF8 A;  2E2H H;  4DK0 A;  3KJP A;  3NXW A;  1UE6 A;  2L11 A;  1RCV D;  1BF4 A;  2VUM G;  1E7Z A;  2TMP A;  4RGT A;  1STE A;  1E1O A;  4EQO A;  4GNX B;  3HOY G;  2NTT A;  5C4J H;  3T4A C;  2F3V A;  3O13 A;  2G9D A;  1CA6 A;  3RZD B;  2SDF A;  1S5D D;  1E2Z A;  2KA7 A;  3DWA A;  4OL7 A;  4LJZ C;  3VYS A;  4TSS A;  1LT6 D;  2NN6 I;  3Q22 A;  4QB4 A;  2I0Q A;  1XPO A;  3HG9 A;  1N33 Q;  1X3P A;  4N9T A;  3M4P A;  2FMC A;  3CP0 A;  4UP9 A;  4A3D H;  4NXM Q;  2I07 B;  3R8B A;  2XGT A;  2J0T D;  3LNN A;  1STG A;  4KHP Q;  3OWE B;  2JA7 H;  1D6E C;  4DUY Q;  3TQY A;  2NVY H;  1HR0 L;  2NUC A;  2K5D A;  4DAY B;  4A3C H;  4JI1 Q;  5ISR A;  4RMF A;  1KNA A;  3HOV B;  1KLG D;  3U4Z A;  2C35 B;  1TQO A;  2HT1 A;  1VQO A;  5IYB H;  3GTK B;  4JI4 L;  5I2Y A;  3PMF A;  4RCO A;  1H9K A;  2FXQ A;  2Z6K C;  2HDL A;  4LF4 L;  2A74 C;  5I9P A;  4GOP B;  4DAM A;  4BY1 G;  3QG1 A;  4H44 C;  4JI3 Q;  2K50 A;  2K5W A;  4A3B H;  1QB5 D;  4MTN A;  1EYG A;  1T9H A;  1IBM Q;  5CV9 A;  1Y1W B;  4A3G G;  1F2Z A;  2PO4 A;  1CK1 A;  1BKB A;  1CKN A;  1QWY A;  2R93 B;  4DK6 C;  5JOB A;  5IGG A;  4H13 C;  4KJN A;  1L2F A;  3FVQ A;  2F4I A;  5IP9 G;  1EY9 A;  1KDC A;  3U9S A;  1Y8N B;  3CRL C;  5JPN C;  4DUY L;  4DV7 Q;  1N34 L;  3AMU A;  4JOI A;  4YHH Q;  4DV2 L;  4NMZ A;  2A69 D;  1B3Q A;  1HHV A;  1TKW B;  5DM7 3;  4IQZ A;  4WJ3 M;  3JAM c;  3P1H A;  2KVM A;  5KYI A;  4IUQ A;  1EY4 A;  4PZ6 A;  3M3Y B;  1QCB D;  3PO2 B;  2A6H D;  2A6E C;  3QR8 A;  3HRZ C;  3PF5 A;  1Q7Y C;  2XSC A;  4QCL A;  4PMC A;  3U58 A;  3VR6 A;  2WAQ E;  2KEC A;  2PW7 A;  2ZM6 Q;  3S16 H;  4IUU A;  1G2T A;  2KHS A;  3KK7 A;  3E9I A;  1QUQ B;  5JVG 3;  3BDO A;  4KK7 A;  4ZUI A;  4JI3 L;  1BCP B;  2MPM A;  3MXN B;  1PXU A;  3SK4 A;  3H94 A;  5A2Q E;  4HCE A;  4B3T Q;  4OWW B;  1KRT A;  5NUC A;  1A2T A;  4FF3 A;  1Y1W G;  4RGM A;  3S2H H;  1VQF A;  3OIP A;  3I55 A;  3S15 H;  4HJA A;  1WTO A;  5IY0 A;  2R93 G;  4OON A;  2N49 A;  2E76 C;  1BNZ A;  2F0D A;  1WCM B;  3HOX H;  1IBK Q;  4CDE C;  1XWE A;  1SJH D;  1UE7 A;  1AZP A;  4FYD A;  2JA5 B;  4AQY Q;  4OO1 I;  3EIV A;  2YU9 H;  1R4P B;  4JVZ A;  3S1R H;  4BA2 I;  4I7A A;  4ZQ3 A;  2BH2 A;  2ICI A;  2Q2U A;  1RDP D;  4LFB L;  2KBN A;  4KLK A;  1JB7 A;  1VQ7 A;  2UUB Q;  4DV7 L;  1A62 A;  2E2J H;  1TII D;  4YHH L;  1KD1 C;  4QQB X;  1TT2 A;  4GLV B;  3SEB A;  1KIX A;  5C3W A;  2B2T A;  3P7J A;  3A54 A;  1M90 C;  2Y0S B;  3I8Z A;  3PO2 G;  4TQU S;  1NBW A;  1VQI A;  2I5M X;  1HQR D;  2RA4 A;  3A56 A;  2PI2 E;  2RSN A;  3AU7 A;  3RR5 A;  2K7V A;  1XNQ Q;  3ITP A;  3AQQ A;  4DR4 L;  1XJV A;  2JA6 H;  4C56 C;  1Z7T A;  2EY6 A;  4UDU C;  2ZM6 L;  2VB3 X;  3K8A A;  3CCM A;  1HNW L;  1FGB D;  4LF9 L;  3GTJ H;  1S5F D;  4PG3 A;  1S5C D;  2BH8 A;  4MIU A;  1BBW A;  3NUC A;  4QMG A;  3H0G B;  3KJO A;  1YIT A;  3WOE A;  1JWS D;  2AUJ D;  1VQA A;  2K33 A;  2MGS A;  5M9O A;  1S5B D;  5C4X G;  4JBJ A;  1KNE A;  4BBS G;  4TKO B;  1LTB D;  4X3S A;  5IGD A;  4N8X 1;  2JA5 G;  1WVL A;  4JPB W;  3HOU B;  2LKV A;  4A93 H;  2CWA A;  1AZQ A;  4H7B A;  3Q23 A;  5EKK A;  4AQY L;  4UP7 A;  4DF7 A;  3VR4 A;  2F0V A;  1ROD A;  4A3L H;  2B2Y A;  1LT3 D;  4AIM A;  1V1Q A;  2SOB A;  3FRP B;  2WII B;  3UI2 A;  5C0X I;  2VUM H;  4R4C A;  4YWK A;  3HOY H;  2Y0S G;  1L0X B;  1HFG A;  1MIU A;  1YEZ A;  5LL6 X;  4V0B A;  1CZG A;  3J81 E;  5BN3 A;  1EWH A;  4X3K A;  1EIF A;  2L1B A;  5M3M G;  3H0G G;  1NR2 A;  1YHA A;  3A8J E;  1PTO F;  2HD3 A;  2B29 A;  1EYA A;  1V9P A;  3KLS X;  4AYB B;  1WFQ A;  1ILP A;  2M9V A;  2VQE L;  3M85 A;  4KN7 C;  3HOU G;  2PQA B;  2D2C C;  2WIN B;  4KD3 A;  2EYM A;  3D4W A;  1HA5 A;  3F8T A;  4Q5V A;  5GRO A;  3TS0 A;  2F4V Q;  4XXE A;  1S3O A;  2IHF A;  4L5Q A;  2LXJ A;  3CC7 A;  3ZJY C;  2CFM A;  1KDA A;  3ZYY X;  1L1O C;  1YNX A;  4IJL A;  2IX0 A;  2JJQ A;  1KAW A;  2JN4 A;  1EL0 A;  4BY1 H;  2GVB A;  1SR3 A;  2RKS A;  3L0O A;  3ERQ A;  4EQ5 A;  3E0J A;  3RZD H;  3BVZ A;  3HOW B;  3V96 A;  1DGS A;  3PCO B;  2UU9 L;  4A3G H;  4DR1 Q;  2K5H A;  5ELE A;  2HCC A;  1D2B A;  1RKN A;  1WI5 A;  1EYD A;  3RLF A;  3J80 E;  2Q8R E;  5IP9 H;  4BY7 B;  2P5Z X;  4AYB G;  3LX0 A;  1X9N A;  3SR1 A;  2DJG C;  3NK9 A;  4R4Q A;  1ZKO A;  3CW2 C;  2UXC L;  5C4Z A;  5CBA E;  1GUS A;  4RH6 A;  1D5M C;  3F1Z A;  3MEH A;  5LMN W;  1CI3 M;  2VL6 A;  2Z4H A;  2A69 C;  2QDB A;  1PH7 A;  1HZA A;  2PZU A;  3S1Q B;  4HMJ A;  2R92 B;  5IOD A;  4R8N A;  1WTV A;  4B08 A;  2A6H C;  3TSS A;  1KQS A;  1FNV A;  5FOB B;  2E8G A;  1PH9 A;  3MHB A;  2MNA A;  3FPU B;  5FLX c;  3HOW G;  2F0Q A;  2VY3 A;  4GLA C;  2JYO A;  4YCV A;  4ZKB B;  1IKM A;  4DUZ L;  1Y1W H;  2UXD Q;  2O4X A;  2NVY B;  5HGT A;  2HUG A;  3UE0 A;  5BR8 L;  4B9X A;  2R93 H;  1G8Z D;  4IN3 A;  1EWI A;  3NQI A;  4BY7 G;  4ZCK A;  5C4H A;  2DY7 A;  2F0U A;  1VQ9 A;  1HZC A;  1PH1 A;  4OIJ A;  2KCM A;  3F2B A;  3HZX A;  2RSO A;  5IYD G;  1ESR A;  1ASZ A;  3IRB A;  1SAP A;  1TU2 B;  2JEB I;  3KBX A;  1S72 A;  3TRE A;  1RHP A;  4DV1 Q;  3C46 A;  1WTR A;  4XDX A;  1K0R A;  1E3P A;  1U5K A;  3M3Y H;  3PO2 H;  4A75 A;  1WJJ A;  4JI7 Q;  2OCE A;  4A3B B;  2ZXR A;  4DNT B;  2ZJR A;  2L15 A;  2PYK A;  2PPB C;  5CYU A;  4RFB A;  4DKA C;  4G7H C;  2R92 G;  1VQ4 A;  3M4Q A;  3K81 C;  3FKI B;  3VA7 A;  5CBE E;  1B44 D;  4F7X A;  3DWQ A;  2EVB A;  1EYC A;  2RBM A;  4GNX C;  1NUC A;  2RVL A;  3BZK A;  4BA1 I;  4CHT B;  3GTP B;  2F3I A;  2OWO A;  3VDY A;  1GO3 E;  4OXP A;  2K03 A;  2Q2I A;  2XN9 C;  3S2D H;  1Y1V B;  3NBI A;  5EPJ A;  5C4X H;  3PIO 3;  4BBS H;  4OIK A;  5LHY 1;  4DV3 L;  2NVT H;  4XYQ A;  2JEA I;  2K28 A;  1WTQ A;  2KJX A;  1Y8P B;  4QF4 A;  2JA5 H;  5J1Z A;  2ZTE A;  4L5T A;  3V2T A;  2O2L D;  3H91 A;  4JI0 Q;  2XVS A;  5EGT A;  2F0O A;  2AMC B;  5CMD A;  2B39 A;  1SRO A;  1U4R A;  1DXM A;  1EU3 A;  1PRT F;  2RHS B;  1DYQ A;  3GTG B;  1TS3 A;  1YJ9 A;  1HNZ L;  3KUP A;  3GV3 A;  4J8Q A;  4JI7 L;  3MFG A;  1DOK A;  3K5O A;  3FKI G;  2N3S A;  3S1N B;  2N8N A;  1U4M A;  4GOP C;  4EQN A;  5M3M H;  4O0A A;  3H0G H;  2F52 A;  2CH4 A;  4X62 Q;  5F2D A;  2UUA Q;  2YU9 B;  1IZ6 A;  1X6O A;  3D0F A;  4DV0 Q;  1Y1V G;  3CHB D;  2VXW A;  3OMC A;  3A55 A;  3RNU A;  1A3T A;  3NEL A;  3T1H L;  4DR3 L;  5FLM G;  3H3V I;  3FDT A;  3GP7 A;  3Q6S A;  3HOU H;  4JYA L;  2RQX A;  4GKK Q;  3PUY A;  3FHW A;  4LF7 L;  1M1K C;  3MXG A;  5A2Q L;  5ELN A;  5KEE A;  1I4H A;  1SND A;  3GTL B;  2HCI A;  1H9S B;  1QUQ A;  4A3J B;  2B63 B;  4XIG S;  4JI0 L;  4FXD A;  3H09 A;  1D7Q A;  4FO2 A;  2DUD A;  3G6J B;  3MXN A;  5KND A;  2K5N A;  2K5V A;  2J4X A;  4BBR B;  3HKZ E;  5FK9 C;  1HNX L;  3PSI A;  2F0J A;  2EYH A;  4C1N I;  3S17 B;  1QNU A;  5E7N A;  1PTO D;  5J39 A;  1XTD A;  1O78 A;  4G57 A;  1NAP A;  4RHR A;  3Q0A A;  4K14 A;  3MEF A;  2OXP A;  1T5X D;  1HUN A;  4LWC A;  3GQB A;  1AE3 A;  1LYL A;  4A3E B;  1X54 A;  3HGB A;  3CCU A;  1JJC B;  1VF5 C;  1V43 A;  1B1Z A;  3GD7 A;  4NPS A;  4X62 L;  2UUA L;  2GA4 B;  5EPK A;  1Q12 A;  2EQS A;  4NKL A;  2Z8L A;  4DV0 L;  1LV9 A;  3CCV A;  2F0P A;  2FFK B;  4OX9 Q;  2VUM B;  1SMY D;  3LWE A;  5KGU A;  3MVV A;  2F0F A;  1IW7 C;  2AUK A;  1MKH A;  2D0P A;  5GQO A;  1TY0 A;  4A3J G;  1H95 A;  2B63 G;  4A3I B;  4V19 0;  1NCV A;  1H9R A;  2BE5 D;  3I4M B;  1IBL Q;  2MP1 A;  4K6L A;  3CPW A;  1B8A A;  4DV5 Q;  4N9P A;  4BBR G;  4C3I B;  1N32 Q;  2IT1 A;  1J8I A;  4RWS C;  4IFD G;  1YNN D;  3OTO L;  5C5L A;  4DN4 M;  2UXB Q;  3BYY B;  1VQB A;  2EJF C;  3U50 C;  2PCF B;  2GVA A;  1PZJ D;  1I94 Q;  4IAL A;  1J5E Q;  1ET9 A;  3HOW H;  4DK3 C;  5EQ0 A;  3OPO A;  3PUZ A;  5ELC A;  1YIJ A;  3PV0 A;  4LNQ A;  4L6T B;  4WJW A;  3F2C A;  4A3E G;  4GN5 A;  2IY5 B;  1IL8 A;  2Q2T A;  1I5F A;  2NTS A;  3R2I A;  1JJG A;  2MFI A;  4BY7 H;  1TWA B;  1BDO A;  1QOH A;  4ME5 A;  3URY A;  1CQF A;  4O1N A;  4GZY C;  4ZKC B;  3I56 A;  5IYD H;  2KEE A;  5I2X A;  2QGQ A;  1SE3 A;  2CWP A;  2I5L X;  1O7I A;  1Q86 C;  4BY1 B;  2BDO A;  2VNU D;  1JMC A;  2O5J C;  4A3I G;  1SNQ A;  1IYJ B;  1L0W A;  1A63 A;  3I4M G;  1AP0 A;  1OXS C;  5FKA C;  3TRZ A;  4J6H A;  3S1Q H;  3CXC A;  4C3I G;  4QGU A;  2R92 H;  4A3G B;  1CHQ D;  3EJI A;  4KJO A;  2MUY A;  3FP9 A;  5CC4 A;  2WAQ B;  4DV5 L;  1NMF A;  2Z6K A;  2AQ1 B;  2LS0 1;  5CV4 A;  2XWJ B;  4IPC A;  2F0E A;  2N78 A;  1PH5 A;  2UXB L;  1G29 1;  3HKS A;  3BS1 A;  1U4L A;  5E4W C;  1W2B A;  2PQA A;  2ZJQ A;  1PYB A;  2RDG A;  1H9J A;  1IKL A;  1D1I A;  3RUZ A;  1XTC D;  3AEV A;  4KI0 A;  1I6H B;  2K52 A;  2YYZ A;  3KLW A;  3I91 A;  3DLL A;  1TWG B;  4CKC A;  1C9O A;  1J6Q A;  4L8J A;  3UDF A;  1JOK A;  3ERS X;  4DA2 A;  4HMI A;  4IPH A;  3J7Y W;  1C0A A;  3CD6 A;  3D4D A;  2QA4 A;  2F0I A;  2KEN A;  4YWL A;  1QVF A;  4FF1 A;  4QIW E;  1JQY D;  2PW5 A;  4YY3 Q;  3U4V A;  1CTM A;  2PQE A;  3D4R A;  3S14 B;  3EFX D;  1TS5 A;  3A7L A;  1IL2 A;  4NXN Q;  3K57 A;  1WD1 A;  1PFN A;  3FKI H;  1A3V A;  1DZ1 A;  2WAQ G;  1FYC A;  2HIX A;  5I9O A;  1EFW A;  4CJ0 B;  1K83 B;  1Q1B A;  1N33 L;  4IFD J;  3NSW A;  1XYI A;  3VR2 A;  3GTP H;  1DON A;  4A4I A;  5KIX A;  4NXM L;  1P16 A;  2JA8 B;  1N36 Q;  4YCW A;  2EYJ A;  5JEA G;  4KHP L;  3NTK A;  4YIJ A;  1Y1V H;  5T1G A;  5COY A;  1ZYR C;  5T1I A;  1QVC A;  4KMU C;  1FVI A;  3RN2 A;  3TDQ A;  5FLM H;  1D1K A;  4POF A;  1CHP D;  4JI1 L;  4LW1 A;  3MC0 B;  3MAQ A;  1PRT D;  5IT9 E;  1WD0 A;  5ELB A;  1SMX A;  1ZEQ X;  1E24 A; 
#chains in the Genus database with same CATH homology
 1EY0 A;  4UAI A;  4ZK9 B;  2H1E A;  2AQ2 B;  2DNC A;  1GUT A;  1VCI A;  1TR5 A;  1TS2 A;  2IX3 A;  4DK1 A;  5C0X G;  1Q90 A;  2EY5 A;  3VR3 A;  1JC7 A;  5CV7 A;  3L7Z C;  3SE0 A;  4WFN 3;  3S2D B;  1H9M A;  5KRU A;  5C4X B;  3MZ5 A;  4BBS B;  5KYL A;  1YNJ C;  1EIH A;  5M5X B;  2NVT B;  2QCP X;  5D14 A;  1PTO C;  3K6O A;  2X6G A;  2KCC A;  1GUW A;  3DWP A;  3LWU A;  2CW0 C;  1EIG A;  2EDG A;  2K5Q A;  2BA0 A;  3A8I E;  3SHL A;  1B50 A;  4K5X A;  4CJ2 C;  4X3U A;  1RD9 D;  1W6J A;  4MN3 A;  3TP5 A;  5A35 A;  3J7A F;  4I7Z C;  1LT5 D;  1LTI D;  1SDF A;  4IFD H;  1AW7 A;  2NB0 A;  5M3M B;  1LTA D;  1M8A A;  2F0G A;  2WV6 D;  3BZD B;  1JB3 A;  1SYE A;  1STB A;  2BE5 C;  4K6D A;  2K01 A;  5FLX E;  4KKU A;  1VDZ A;  3GTM B;  5M3F B;  1YNN C;  1DD2 A;  3SDZ A;  1BXT A;  1UEA B;  3K5M A;  3HOZ B;  1SYF A;  3FMC A;  1JOR A;  2OF1 A;  2DNE A;  5JEA J;  3I4N B;  3NTH A;  3C3L A;  2H4O A;  3CQZ B;  4LMQ D;  5DNF A;  1CZW A;  1SNP A;  2BA1 A;  3K7A B;  2X6L A;  4Z9C B;  1R9T B;  1OXU A;  3D8G A;  1SYG A;  2RDF A;  3DEP A;  2DN8 A;  5C0X J;  4P2C B;  1A6X A;  3U9O A;  3M7G A;  5FO9 B;  2SEB D;  3SK5 A;  3OMG A;  2F0T A;  2PNR C;  5ELF A;  2MHV A;  1H9S A;  1I4R A;  1AN8 A;  3GO5 A;  3QIA A;  3D6C A;  1CQV A;  1W6K A;  3MXU A;  4FF2 A;  4O42 A;  5E3F A;  1IHZ A;  3L9A X;  3R93 A;  1TWC B;  3VYU A;  4BWG B;  2EYO A;  1V1P B;  4CKE A;  1E2V A;  4IUT A;  5IIF A;  1EY7 A;  2G9H D;  2JE6 I;  1HXY D;  1RF2 D;  1JCK B;  3SVM A;  1B9M A;  1SNC A;  2NZ1 D;  4KKT A;  5JEA H;  2WKC A;  1MSH A;  4F87 A;  3N52 A;  1I4Q A;  3T16 A;  4QUF A;  5DAU A;  4K5V A;  1JE4 A;  3QOJ A;  1PZI D;  3P20 A;  3BDL A;  1J9O A;  1GUG A;  3C2P A;  2L9H A;  1M4V A;  3OWF A;  1VMC A;  5D3I B;  1LTR D;  4HTH A;  1MD2 D;  4B9W A;  4LAA A;  5EPL A;  2FIN B;  5KNB A;  3G7L A;  3KLS A;  3E6Z X;  3I3C A;  2F1M A;  1PTO B;  1UNS A;  4QUC A;  4WOR A;  4Y7N B;  1SE2 A;  5C0X H;  1EY5 A;  4JBW A;  5JPM C;  1ENF A;  1G2S A;  3ND9 A;  1EOT A;  3MXP A;  4XT3 B;  2B2V A;  1LT4 D;  3K59 A;  3OW7 A;  4FVM A;  3TZD A;  4CJ1 B;  3F2U A;  4C2M B;  1TY2 A;  3BVM A;  3ND8 A;  4XYO A;  3ONA B;  4DFA A;  4HAE A;  2SNS A;  2I46 A;  2NBF A;  2B2V C;  3TP6 A;  1I4G A;  4U68 A;  1KAB A;  2E74 C;  1D5Z C;  1HTP A;  4HCS A;  2WKD A;  3T51 B;  2EJM A;  3D6W A;  2F0N A;  1B2T A;  1BUV T;  3SK6 A;  4RCN A;  2EYP A;  3DUZ A;  1Q1E A;  1LLR D;  4DAY A;  3HKZ B;  1EY6 A;  3D3R A;  4KY6 A;  5LL6 S;  3OHX C;  2IWH A;  3OSO A;  3DEO A;  1O7Z A;  1C48 A;  4NDX A;  3S9W A;  3X3M A;  2ICE C;  1CA5 A;  2B2W A;  2WP8 J;  5K5P A;  4RGO S;  1RTN A;  1Z47 A;  4G4K A;  1ICW A;  1GJX A;  5EKI A;  2K05 A;  1TWF B;  1MBY A;  4LK1 C;  5E1F A;  5KNC A;  2NVQ B;  4NP5 A;  2E2I B;  2F0K A;  2IL8 A;  1O80 A;  2D9U A;  5C6A A;  3QOL A;  1WTX A;  1K8M A;  1V1O A;  2A73 B;  2B2W C;  1EZ6 A;  1GHJ A;  5IT9 L;  1C8C A;  3EA6 A;  3C1E A;  3S1M B;  1CT1 D;  5E4X A;  3T13 A;  2F0W A;  2L55 A;  5DM6 3;  3CU7 A;  5I6Y A;  1BQQ T;  4FXK C;  2K1B A;  1DM0 B;  3HP3 A;  2QEJ C;  2L4N A;  3X3N A;  1FD7 D;  1F2Y A;  4ID6 A;  1K8O A;  4XQN A;  4C3J B;  2EY2 A;  3I72 A;  2IJ0 A;  2B2U C;  1ZXT A;  3M7N A;  2EXZ A;  2HQE A;  1UAP A;  1LAC A;  2QF7 A;  2NN6 G;  3TN2 A;  2L5T A;  1VF7 A;  4PMB A;  3TBI B;  2M00 A;  1FR3 A;  5AFW A;  4CGY B;  5FO8 B;  5HUR A;  1XX8 A;  1HPC A;  1PRT B;  3DM1 A;  5CGK A;  1CM9 A;  3RMH A;  3IKJ A;  1BBX C;  4KTA A;  1JWM D;  4IUV A;  5DEH A;  4HR7 B;  3JAM E;  3A7A B;  2BOS A;  5FO7 B;  3SK8 A;  3E5S A;  1JOO A;  2M2L A;  5K36 G;  2B8F A;  5CV8 A;  3BDC A;  1SFO B;  3NPP A;  1E2W A;  1CFM A;  1U9R A;  4M1U B;  4C3J G;  3BYT B;  2OT2 A;  5JAV A;  1PFB A;  3MA2 B;  2VB2 X;  2B8G A;  3HEJ A;  2WAC A;  3I4L A;  4WRD A;  1SSO A;  1GUN A;  3RZO B;  3QJY A;  5JVH 3;  4DXG A;  3I90 A;  1EWC A;  3J81 L;  4U67 3;  1O7L A;  1KLU D;  4K5W A;  5G3L F;  2A5H A;  2ID0 A;  1GHK A;  3NBH A;  3J7A V;  1EFI D;  3NHH A;  1F2L A;  1S4Z A;  4XT1 B;  4E6I A;  4DU9 A;  1RTO A;  1EQV A;  3TP7 A;  3H6M A;  1PTO H;  4RHS A;  3NTI A;  1F9Q A;  3AB9 A;  3PO3 B;  4DXF A;  1TWH B;  1S5E D;  5I6W A;  2IX1 A;  1QG7 A;  1PYW D;  1A2U A;  2HDM A;  1BR9 A;  1LTS D;  4IUP A;  4PMW A;  5M5W B;  2R6G A;  1BCP F;  4OO1 G;  1FNW A;  4K8J A;  1V1P A;  4HN7 A;  4A3M B;  3J80 L;  1FNU A;  1HTL D;  2BDN A;  4NW2 A;  2R7Z B;  1SYC A;  2F0M A;  4ILW A;  4IFD I;  1QNK A;  1Y69 U;  5C44 B;  3CRK C;  2F0S A;  1Q8I A;  2LY7 A;  2F03 A;  5I4D A;  2F3W A;  2LMC B;  1OXX K;  4DNR B;  2XIW A;  3BG3 A;  3C1F A;  1DOL A;  1B3A A;  4KN4 C;  5J22 A;  1BO0 A;  1XXG A;  1F9R A;  2K6A A;  4F8M A;  1RJT A;  2A68 D;  4DAP A;  4R8I A;  4G7O C;  1LO5 D;  1WTW A;  1MGS A;  1SYB A;  4R9W A;  2F0L A;  1II3 A;  4ZUJ A;  1AFP A;  3VR5 A;  1F9S A;  2XWB B;  4A3K B;  3H3V C;  5BN4 A;  2EZV A;  1EZ8 A;  4ZLT F;  1JWU D;  2C5C A;  1BOS A;  2F0H A;  2NN6 H;  1NSN S;  1R4Q B;  1WTP A;  4KD4 A;  3PUW A;  1STA A;  1ML0 D;  2ZXO A;  3BVG A;  3VYT A;  4PQX A;  5CR3 A;  2LFN A;  2XNA C;  3DHQ A;  1EU4 A;  1B4O A;  1SMY C;  5K36 H;  3SXH A;  1JR0 D;  4ULL A;  1ESF A;  3P75 A;  3IFT A;  3OOC A;  1D5X C;  1HCZ A;  1C4Q A;  3PIP 3;  2EY1 A;  1V8Q A;  5BN5 A;  2E2D C;  1HFN A;  4DAV A;  3R2T A;  4C1N K;  4PV1 C;  3MTS A;  1SYD A;  4FXG C;  1I6V C;  1F77 A;  5D3D A;  1OO9 B;  3R3O A;  3IAY A;  4H0L C;  2B2T C;  4I65 A;  3GV6 A;  1EQT A;  1SJE D;  1ET6 A;  1Q3L A;  4RA8 A;  3K5L A;  1STY A;  2OEO A;  1I50 B;  4XQQ A;  1I4P A;  2AQ3 B;  4HSP A;  4L63 B;  1U4P A;  1DCZ A;  4C3H B;  1X3Q A;  3MWY W;  4K8I A;  3T56 B;  1KAA A;  4CKB A;  4KY7 A;  1G6Z A;  4TRD A;  2L12 A;  2RDH A;  3L3O C;  5CV5 A;  2JXM B;  1JOQ A;  1SNM A;  4ABN A;  4F88 A;  5G3L D;  5TSS A;  2B2Y C;  2KOL A;  1Z6H A;  4OO1 H;  1ONL A;  3T53 B;  2PMZ B;  3NE5 B;  5C5M A;  3EVQ A;  1I3Q B;  5D65 A;  5CV6 A;  2TSS A;  1L0Y B;  2EYF A;  1HA6 A;  3NQT A;  1EEF D;  2WB1 B;  3KBG A;  5EKL A;  3GTO B;  3RD4 A;  1LTG D;  2PZW A;  4ZRZ A;  4C3H G;  3JAM L;  1X32 A;  2BCO A;  4RKL A;  3PUX A;  3EQL C;  2CHB D;  4EVO A;  2QKI C;  1I4X A;  4CBV A;  2IPK D;  1BCP D;  4J1M A;  2V4D A;  4M8A A;  4XTC S;  2ENB A;  3TP8 A;  1HQM C;  3M4Y A;  1HUM A;  1IW7 D;  3QWN A;  2MJ8 A;  2E2H B;  2X69 A;  4ZAI A;  1PRT C;  4S3S A;  4IZ8 A;  5IGE A;  5C4J B;  2A68 C;  1PFM A;  4PNY A;  1ENC A;  3QB3 A;  1SEB D;  4MHE A;  3NWT A;  1ILQ A;  5IGF A;  1PZK D;  4IUN A;  3NP8 A;  3I70 A;  4KKS A;  1Y8O B;  4A3D B;  3DMU A;  2KED A;  2JA7 B;  1TVX A;  4HSV A;  1MSG A;  2C9O A;  3W2D A;  3WDN A;  4EQP A;  1F9P A;  3OIQ A;  3I73 A;  3VYR A;  2R3Z A;  4HED A;  1LAB A;  1AEX A;  1SE4 A;  2IW3 A;  1PDQ A;  1SXT A;  3HS0 C;  1GOZ A;  5C3X A;  1OXT A;  2D5D A;  1SBB B;  2Z1C A;  3PUV A;  5ELD A;  4RAU C;  2EPB A;  1NR4 A;  2CQA A;  4ZYS A;  3GTQ B;  1KTK A;  1PLF A;  2R61 A;  2NWG A;  5IGB A;  4FNF A;  2K32 A;  2ZXP A;  1EY8 A;  4Q0F A;  2Q8I B;  3A8K E;  1F2M A;  3Q24 A;  4K2L A;  3N6R A;  2AWN A;  1PMR A;  2EYL A;  2EOT A;  4KV6 A;  4XQJ A;  5C3E B;  5COR A;  4K2K A;  2L0C A;  4IUR A;  3NWS A;  4EGV A;  1KDB A;  3S16 B;  1O7Y A;  3K5N A;  2FJ2 A;  2EJG C;  1A15 A;  2XRS D;  4X3T A;  3FEW X;  1IYV A;  1STH A;  4KY5 A;  3WOF A;  1GUO A;  2K04 A;  2N55 A;  3S2H B;  1QIL A;  2B2U A;  2KCN A;  3S15 B;  3DXJ C;  3V05 A;  1ZYR D;  3HOX B;  1OXV A;  4FF4 A;  2D62 A;  3KLR A;  3S1R B;  1UUP A;  3IFD A;  1G91 A;  2A6E D;  4ODG A;  2Q8T A;  5EJW A;  3CKI B;  2JP1 A;  2E2J B;  1DOM A;  2PZT A;  4G7Z C;  3K0Y A;  5IOC A;  1SNO A;  2EE1 A;  2JA6 B;  5EBC A;  2J7Z A;  1STN A;  5JJZ A;  2FHT A;  5M5Y B;  5EBD A;  3M4O B;  1YNJ D;  3GTJ B;  1QE6 A;  2KQ3 A;  1IYU A;  4KHZ A;  2ZT9 C;  3TME A;  4A3F B;  1EEI D;  3FPP A;  2CW0 D;  3K58 A;  2N88 A;  3IL8 A;  4A93 B;  2JSO A;  1B9N A;  3MFY A;  4FP5 D;  5FLX L;  4RKB A;  1A3U A;  1BCP C;  1QJO A;  1B53 A;  2FMM A;  2O5I C;  1E0B A;  1LTT D;  2CVR A;  3QO2 A;  4BS9 A;  2SNM A;  1TS4 A;  3VA5 A;  3HOY B;  4QIW B;  4DGZ A;  4OHJ A;  2Z4I A;  2KUM A;  3ERO A;  4KHV A;  2NYZ D;  4JK1 C;  3TZU A;  1ENA A;  1VMP A;  2DY8 A;  4RGN A;  2QIL A;  5IGC A;  3D31 A;  1HRJ A;  1JIC A;  2NVX B;  2E75 C;  1T5E A;  1GXD C;  2AWO A;  4OGQ C;  1MI2 A;  3W3A A;  1DJR D;  2XRQ D;  3KF8 A;  4DK0 A;  3NXW A;  2L11 A;  1RCV D;  1BF4 A;  2TMP A;  4RGT A;  1STE A;  4EQO A;  2NTT A;  3T4A C;  2F3V A;  3O13 A;  2G9D A;  1CA6 A;  3RZD B;  2SDF A;  1S5D D;  1E2Z A;  2KA7 A;  3DWA A;  4OL7 A;  4LJZ C;  3VYS A;  4TSS A;  1LT6 D;  2NN6 I;  3Q22 A;  4QB4 A;  3HG9 A;  1X3P A;  4N9T A;  2FMC A;  2I07 B;  3R8B A;  2J0T D;  3LNN A;  1STG A;  3OWE B;  1D6E C;  2NUC A;  2K5D A;  5ISR A;  1KNA A;  3HOV B;  1KLG D;  1TQO A;  3GTK B;  5I2Y A;  3PMF A;  4RCO A;  1H9K A;  2HDL A;  2A74 C;  5I9P A;  3QG1 A;  4H44 C;  2K5W A;  1QB5 D;  5CV9 A;  1Y1W B;  1F2Z A;  2PO4 A;  1CK1 A;  1QWY A;  2R93 B;  5JOB A;  5IGG A;  4H13 C;  4KJN A;  3FVQ A;  2F4I A;  1EY9 A;  1KDC A;  3U9S A;  1Y8N B;  3CRL C;  5JPN C;  3AMU A;  4NMZ A;  2A69 D;  1HHV A;  1TKW B;  5DM7 3;  4IQZ A;  3P1H A;  2KVM A;  5KYI A;  4IUQ A;  1EY4 A;  3M3Y B;  1QCB D;  3PO2 B;  2A6H D;  2A6E C;  3HRZ C;  4QCL A;  2XSC A;  4PMC A;  3VR6 A;  2KEC A;  2PW7 A;  1G2T A;  4IUU A;  2KHS A;  3KK7 A;  5JVG 3;  3BDO A;  4KK7 A;  4ZUI A;  1BCP B;  2MPM A;  3SK4 A;  1PXU A;  5A2Q E;  3H94 A;  4HCE A;  5NUC A;  1A2T A;  4FF3 A;  4RGM A;  3OIP A;  1WTO A;  2E76 C;  1BNZ A;  2F0D A;  1WCM B;  1XWE A;  1SJH D;  1AZP A;  4FYD A;  2JA5 B;  4OO1 I;  1R4P B;  4BA2 I;  4ZQ3 A;  2ICI A;  1RDP D;  1TII D;  1TT2 A;  3SEB A;  5C3W A;  2B2T A;  3P7J A;  3A54 A;  2Y0S B;  3I8Z A;  4TQU S;  1HQR D;  2RA4 A;  3A56 A;  2RSN A;  3AU7 A;  2K7V A;  3ITP A;  4C56 C;  1Z7T A;  2EY6 A;  4UDU C;  2VB3 X;  1FGB D;  1S5F D;  1S5C D;  4MIU A;  3NUC A;  4QMG A;  3H0G B;  3WOE A;  1JWS D;  2AUJ D;  2K33 A;  2MGS A;  5M9O A;  1S5B D;  1KNE A;  4TKO B;  1LTB D;  4X3S A;  5IGD A;  1WVL A;  3HOU B;  2LKV A;  1AZQ A;  4H7B A;  3Q23 A;  5EKK A;  4DF7 A;  3VR4 A;  2F0V A;  1ROD A;  2B2Y A;  1LT3 D;  2SOB A;  3FRP B;  2WII B;  3UI2 A;  5C0X I;  1L0X B;  1HFG A;  5LL6 X;  4V0B A;  1CZG A;  3J81 E;  5BN3 A;  1EWH A;  4X3K A;  2L1B A;  1NR2 A;  3A8J E;  1PTO F;  1EYA A;  3KLS X;  4AYB B;  1ILP A;  2M9V A;  3M85 A;  4KN7 C;  2D2C C;  2WIN B;  4KD3 A;  2EYM A;  3D4W A;  1HA5 A;  4Q5V A;  4XXE A;  1KDA A;  3ZYY X;  2IX0 A;  1EL0 A;  2RKS A;  3ERQ A;  3E0J A;  3BVZ A;  3HOW B;  3V96 A;  5ELE A;  2HCC A;  1D2B A;  1RKN A;  1EYD A;  3RLF A;  3J80 E;  2Q8R E;  4BY7 B;  3LX0 A;  3SR1 A;  3NK9 A;  1ZKO A;  5C4Z A;  5CBA E;  1GUS A;  4RH6 A;  1D5M C;  3MEH A;  1CI3 M;  2Z4H A;  2A69 C;  2QDB A;  2PZU A;  3S1Q B;  4HMJ A;  2R92 B;  5IOD A;  4R8N A;  1WTV A;  4B08 A;  2A6H C;  3TSS A;  1FNV A;  5FOB B;  3MHB A;  3FPU B;  1IKM A;  2F0Q A;  2JYO A;  4ZKB B;  2O4X A;  2NVY B;  5HGT A;  2HUG A;  4B9X A;  1G8Z D;  4IN3 A;  3NQI A;  5C4H A;  2DY7 A;  2F0U A;  4OIJ A;  3HZX A;  2RSO A;  1ESR A;  1SAP A;  1TU2 B;  2JEB I;  3KBX A;  3C46 A;  1RHP A;  1WTR A;  4XDX A;  4A3B B;  2ZXR A;  4DNT B;  2PYK A;  2PPB C;  5CYU A;  4RFB A;  4G7H C;  3FKI B;  3VA7 A;  5CBE E;  4F7X A;  1B44 D;  3DWQ A;  2EVB A;  1EYC A;  2RBM A;  1NUC A;  2RVL A;  4BA1 I;  4CHT B;  3GTP B;  2K03 A;  2XN9 C;  1Y1V B;  3NBI A;  5EPJ A;  3PIO 3;  4OIK A;  5LHY 1;  4XYQ A;  2JEA I;  2K28 A;  1WTQ A;  2KJX A;  1Y8P B;  4QF4 A;  5J1Z A;  3V2T A;  2O2L D;  3H91 A;  2XVS A;  5EGT A;  2F0O A;  5CMD A;  2B39 A;  1U4R A;  1DXM A;  1EU3 A;  1PRT F;  1DYQ A;  3GTG B;  1TS3 A;  3KUP A;  3GV3 A;  4J8Q A;  3MFG A;  1DOK A;  3K5O A;  3S1N B;  1U4M A;  4EQN A;  5F2D A;  2YU9 B;  3CHB D;  2VXW A;  3OMC A;  3A55 A;  1A3T A;  3FDT A;  3GP7 A;  3Q6S A;  2RQX A;  3PUY A;  3MXG A;  5A2Q L;  5KEE A;  1I4H A;  1SND A;  3GTL B;  2HCI A;  1H9S B;  4A3J B;  2B63 B;  4XIG S;  4FXD A;  3H09 A;  4FO2 A;  3G6J B;  3MXN A;  5KND A;  2J4X A;  4BBR B;  5FK9 C;  2F0J A;  2EYH A;  4C1N I;  3S17 B;  1QNU A;  1PTO D;  5J39 A;  1O78 A;  4G57 A;  1NAP A;  4RHR A;  3Q0A A;  4K14 A;  2OXP A;  1T5X D;  1HUN A;  3GQB A;  4A3E B;  3HGB A;  1VF5 C;  1V43 A;  1B1Z A;  3GD7 A;  2GA4 B;  5EPK A;  1Q12 A;  4NKL A;  2Z8L A;  1LV9 A;  2F0P A;  2FFK B;  2VUM B;  1SMY D;  3LWE A;  5KGU A;  3MVV A;  2F0F A;  1IW7 C;  2AUK A;  1TY0 A;  4A3I B;  4V19 0;  1NCV A;  1H9R A;  2BE5 D;  3I4M B;  2MP1 A;  4K6L A;  4N9P A;  4C3I B;  1J8I A;  2IT1 A;  4RWS C;  4IFD G;  1YNN D;  5C5L A;  4DN4 M;  3BYY B;  2EJF C;  2PCF B;  1PZJ D;  4IAL A;  1ET9 A;  5EQ0 A;  3OPO A;  3PUZ A;  5ELC A;  3PV0 A;  4L6T B;  4WJW A;  1IL8 A;  2NTS A;  3R2I A;  1TWA B;  1BDO A;  1QOH A;  4ME5 A;  3URY A;  1CQF A;  4O1N A;  4GZY C;  4ZKC B;  2KEE A;  5I2X A;  1SE3 A;  4BY1 B;  2BDO A;  2VNU D;  2O5J C;  1SNQ A;  1AP0 A;  1OXS C;  5FKA C;  4J6H A;  4C3I G;  4A3G B;  1CHQ D;  3EJI A;  4KJO A;  2MUY A;  5CC4 A;  2WAQ B;  2AQ1 B;  2LS0 1;  5CV4 A;  2XWJ B;  2F0E A;  1G29 1;  3BS1 A;  1U4L A;  5E4W C;  2RDG A;  1H9J A;  1IKL A;  1D1I A;  3RUZ A;  1XTC D;  4KI0 A;  1I6H B;  2YYZ A;  3I91 A;  1TWG B;  4CKC A;  4L8J A;  1JOK A;  4DA2 A;  4HMI A;  3J7Y W;  3D4D A;  2F0I A;  4FF1 A;  1JQY D;  2PW5 A;  1CTM A;  2PQE A;  3D4R A;  3S14 B;  3EFX D;  1TS5 A;  3A7L A;  3K57 A;  1WD1 A;  1PFN A;  1A3V A;  1DZ1 A;  1FYC A;  5I9O A;  4CJ0 B;  1K83 B;  1Q1B A;  4IFD J;  3NSW A;  1XYI A;  3VR2 A;  1DON A;  5KIX A;  2JA8 B;  2EYJ A;  5JEA G;  3NTK A;  4YIJ A;  5T1G A;  5COY A;  1ZYR C;  5T1I A;  4KMU C;  3TDQ A;  1D1K A;  1CHP D;  3MC0 B;  3MAQ A;  1PRT D;  5IT9 E;  1WD0 A;  5ELB A;  1ZEQ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...