2VB3X

Crystal structure of ag(i)cusf
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
b'PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATION EFFLUX SYSTEM PROTEIN CUSF
publication title Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vb3X01
1ZEQX 2QCPX 2VB2X 3E6ZX 2L55A 2VB3X 3TDQA
chains in the Genus database with same CATH superfamily
5BN3A 4C1NK 3KFUA 5E3FA 5M5WB 4FYDA 4H13C 2XSCA 4IUTA 4K14A 3GTQH 4PG3A 3GTJH 1EZ6A 3DWAA 2TSSA 3H6MA 4DAPA 1A6XA 4TRDA 2IHEA 1XTDA 4YY3L 2WKDA 1VQ9A 2B2UC 4YY3Q 3S1RB 4LF4L 1QUQB 1SNCA 4LF4Q 4XDXA 3BG3A 4Z9CB 4M1UB 2KCTA 5LL6X 1VF5C 3U50C 5KIXA 1BKBA 4A3DB 1H9KA 1EIFA 3I90A 4RHRA 3J81j 4QJFA 1GD7A 2MO0A 2KEEA 2E2JB 1PRTC 2QCPX 5M3MB 1FGBD 3NPPA 4BY1G 1RTNA 1K83H 3A56A 5CORA 3OYYA 4B3RL 1SE3A 5C5MA 3CF5A 1I6HB 4B3RQ 3S17B 2WV6D 2VB3X 3ERSX 2OT2A 3HOUH 1KXLA 4ME3A 2J0TD 1SJED 2RQXA 4LF5L 1FYCA 3V96A 1MJEA 1R4PB 2A1AA 4ZRZA 4LF5Q 4YCWA 1LYLA 3PF4A 3HOVB 1O7LA 3W1BA 2R7ZH 5GROA 2NN6G 3M9BA 4PMWA 4Y7NB 3NTKA 2AQ1B 1JOQA 3EJIA 1GM5A 2ATWA 4X6AH 3PMFA 5C4XB 1PH5A 4HIDA 1Q7YC 3S2DB 1MBYA 4A75A 1SXTA 3K59A 2XRQD 4A3JH 4RCNA 1V8QA 1DM0B 1HR0L 5NUCA 1HR0Q 2WACA 2I5MX 2KHIA 3LGJA 1TWAH 5IE8A 2AKWB 4A3CG 3EROA 3GP7A 1EYCA 3N6RA 4OX9L 3KJPA 1QUQA 4OX9Q 5IY0A 1X3QA 1HNWL 3DWPA 5LL6S 4ID6A 1KHIA 1HNWQ 4NXNL 3PO2G 3AFQA 2HQLA 1A8VA 2F0SA 5JEAH 4NXNQ 1EIHA 4A93G 2NUCA 4KY7A 4RHSA 3C1FA 2F4VL 3N52A 3PV0A 3HOZG 2F4VQ 1C0AA 1HHVA 4BA1I 3I4MH 2B39A 3NK9A 4DU9A 3L7ZC 4FP5D 2B2VC 1JOKA 5I4DA 4FF4A 1NBWA 4EQOA 2NVQB 1K3BC 1QOHA 4QCLA 3I72A 5I2XA 2Z6KC 3FDTA 4B3ML 2EXZA 2M00A 2E76C 2UXCL 4B3MQ 2UXCQ 1PFNA 1ESFA 2K5HA 3QR8A 2K4KA 1AP0A 1U4PA 2KHJA 1Q90A 1NY4A 3TS2A 4GN4B 4R1JA 1ESRA 1L2FA 2RKSA 3I4OA 5E4XA 3KUPA 2F0FA 2K5DA 4YCVA 1PYSB 4PZ6A 3TP6A 3Q23A 2Y0SE 2O4XA 1EQQA 3BU2A 2D2CC 1EZ8A 4BY7G 1JICA 1X6OA 2JXMB 3OOCA 2JA8H 1V43A 3FP9A 5DM73 4A3IH 1PHJA 4CBVA 1I50H 5KEEA 4FXDA 2GN5A 1Q46A 3Q0AA 3OHXC 3PIP3 3D3RA 2XTIA 1H9RA 1QJOA 1JMCA 3E5SA 5HURA 5IGBA 1G6PA 1HCZA 1XXGA 1WCMG 2DJGC 2VB2X 3RLNA 5K36H 4IN3A 5ELNA 2QILA 3T16A 2Y0SG 1X3FA 2IJ0A 1KTKA 3K5MA 4A3KG 1VQ5A 1EQRA 3H15A 2EYJA 2KEDA 3NBHB 4FF1A 1V1PB 4P72A 1STYA 2A68C 2OQ0A 3I70A 3MHBA 4JI1L 3JAME 4JI1Q 4LF9L 1ENFA 1PXUA 1EEID 1K8GA 1LABA 5IODA 4LF9Q 1EYDA 1PRTD 2F3VA 3EVQA 3SK5A 5FO8B 2F0KA 1CSPA 2Z4IA 2JEBI 4K6LA 2K33A 4QY7A 3I4NG 2I5HA 3M3YH 4BY1H 3H0GB 1QZHA 3BDCA 2ZXRA 3K5LA 4LUZA 1CKOA 1PH1A 2YYZA 2L11A 3NBIA 3NWSA 3VA7A 2UXDL 1ASZA 2UXBL 4X64L 2UXDQ 2UXBQ 4X64Q 4HR7B 5EKIA 4BY7B 1E2ZA 2JN4A 5BN5A 5KNCA 3HOWH 4M8AA 2N78A 2KA7A 2WAQE 4UHVA 1TWHH 1PFBA 4YIJA 4P71A 2MFIA 1A63A 2EY1A 3T13A 3F2BA 4XXEA 1S72A 5DEHA 2XN9C 3T4AC 4P2CB 1I3QH 1AN8A 5C0XH 3S14B 3PQIA 4ILWA 4HJ8A 4RGOS 3O13A 1WTRA 3KK7A 1P8LA 4N8X1 2Y0SB 1Y8OB 3D6WA 3P20A 1AFPA 1B9NA 1VMCA 5CGKA 4A3KB 4BBSB 2L4NA 3NBHA 2JSOA 1G2SA 1PRTB 1AW7A 1SYBA 2EDGA 3EA6A 5JEAJ 2E8GA 1VQJA 1VQMA 2F3WA 4K0KL 3PO2H 1DYQA 1EOVA 4K0KQ 1ZKOA 3OTOL 1VS0A 3QO2A 2RDFA 3OTOQ 1YNJC 5CV9A 4RKLA 2YTXA 3TQYA 1WI5A 4I7ZC 4HAEA 1UNSA 1CKNB 4R4IA 1TR5A 3CCVA 1KDBA 4WRDA 1WTQA 3FPPA 4EGVA 1EIYB 5IP9G 2A6ED 4IURA 1YJ9A 1DXMA 2K5VA 1U0LA 4YWKA 1A15A 4DK6C 4OONA 2K52A 4CDEC 3MAQA 1BVSA 4KN7C 5AJ3L 1JOOA 1YNND 3BVMA 5AJ3Q 2SNSA 2RSNA 3TP7A 4FF2A 2E2IB 3NWTA 3RN5A 1U4MA 3PUVA 1BXTA 3CQZB 4C3IB 1D2BA 3QOLA 1STHA 3CHBD 2XIWA 1OXXK 2B2UA 1EQTA 2B2TC 2D0PA 2NBFA 1GUOA 1G2TA 3W5OA 4L5RC 1MHWC 3IRBA 5HY6A 3SR1A 1G51A 1R9TB 1IKLA 1IYUA 1LTRD 2WAQB 3L0OA 4HSPA 3KBGA 3OIQA 1NUCA 3W3AA 1LV9A 3SK8A 2Z1CA 2RHQB 1GUSA 2DNEA 4UAIA 2LY7A 1NNXA 4KKSA 2F0DA 3OMGA 5AFWA 2R6GA 4RMFA 1DOKA 2RF4A 5C4JH 1CKNA 5GAHC 3UDIA 1YJWA 1NCVA 2HD3A 1JE5A 3R2TA 3AB9A 1EY9A 4GKKL 3S2HH 2NVTB 1PYWD 4FF3A 1SE2A 1I4PA 1B9MA 1HXYD 2FJ2A 2A68D 4GKKQ 3MVVA 4MN3A 3GTOB 1JWUD 2F0EA 3SXHA 2R93G 4IPCA 4GN5A 4L8JA 4AIMA 3RZDB 2JJQA 1QE6A 3ND9A 5M9OA 1K8OA 4H7BA 1I4RA 3ONAB 3V05A 1PV4A 3I4NH 1STEA 2IPKD 2JK8A 4CKEA 1ILQA 3SVMA 1J9OA 1BBXC 1PFSA 3H3VH 4IUPA 1U4RA 3VR5A 1WD1A 3OW2A 2HT1A 1Q12A 1S3OA 2R7DA 3G6EA 1LTID 3ZYYX 2K32A 2EJGC 2F52A 3E0EA 3M85A 4BA2I 4JPBW 4QGUA 1HZ9A 4A3BH 4ABNA 4QF4A 4I65A 4KLKA 3DMUA 1RHPA 3CRLC 3R3OA 5FJ8H 3TMEA 3QIAA 2J4XA 4IFDH 1N9WA 5ELCA 4CHTB 4LNQA 5C0XJ 3KDFA 3ND8A 4A76A 1D1KA 1IBKL 5BR8L 1K28A 2N8NA 1UAPA 2OF1A 2B2VA 5M5XH 3NSWA 5BR8Q 3HG9A 5C4ZA 2EQSA 1IBKQ 2NVXB 4OHJA 2F0JA 5IGEA 2Z6KA 2EYHA 1WTOA 2I07B 4POFA 5C44H 1PDQA 3RUZA 1VQKA 2F1MA 4NP5A 3W1GA 2K5QA 3CMEA 4E6IA 4XIGS 1E24A 3KJOA 2B2YC 4DV4L 1XNQL 1V9PA 1A2UA 4DV4Q 2CHBD 1SMXA 2ZXPA 3F2DA 5ELFA 1LT4D 1K0SA 1YNJD 2Q2HA 5KYIA 5E4WC 1LT3D 4XYOA 1OXTA 1JB3A 3HOUG 2JA7G 1EU4A 1SBBB 1I4HA 3CMAA 1SE4A 1SNDA 5C0XI 2E2HH 4POGA 4ZQ3A 2DY7A 4APVA 4PMCA 1J6QA 1Z6HA 5KRUA 1FGUA 3DHQA 2R7ZG 3TP8A 3MWYW 2HIVA 3A8JE 1VDZA 5EQ0A 1PH3A 4KJOA 3GQBA 1Q1EA 1SNQA 2EYPA 4JYAL 4JV5L 1O7IA 4K2KA 1VQ4A 4GLXA 2VUMH 4JV5Q 4JYAQ 5E1FA 1IBML 4N9TA 3GTQB 5DAUA 4K8IA 1IBMQ 2CW0C 4A3JG 2F0GA 4RWSC 3Q6SA 5T1GA 1X32A 1L0YB 5C3EB 1L1OC 1OO9B 1OXVA 3HRZC 4AH6A 1FJGL 1LT5D 4DAMA 1FJGQ 1BCPC 1O7YA 1SNMA 3VYSA 3PO3H 1E0BA 1TWCH 3FMCA 2JA6B 4RGTA 1D5XC 4H0LC 4RKBA 1U5KA 1Q81C 2VY3A 2PZUA 5JEAG 2JQOA 2VS1A 2WB1G 1NR2A 2PYKA 2AWOA 1VQGA 2KVMA 3ULLA 4A3MH 3LX0A 2XWBB 1ZEQX 1K83B 2GVBA 4K5WA 1V1QA 3I4MG 4JI6L 2IWHA 4X3TA 4JI6Q 2SOBA 1FNUA 5HGTA 1HNZQ 1HUNA 2JP1A 3HOUB 1E2VA 3FKIG 4IUUA 1CA6A 2PW7A 4RAUC 1VQHA 1H95A 1LUZA 3MC0B 4ZKCB 5C6AA 3FEWX 4UDUC 5IYBH 1HNXL 1ZXTA 1R4QB 4JVZA 3I91A 4GZYC 1HNXQ 3D4DA 4DR3L 4RGMA 2RSOA 4DR3Q 1EL0A 1HZCA 3S1NH 1IZ6A 3IFTA 1L0XB 4TQUS 1PVOA 4V190 4C3JH 4DV0L 1E1OA 2ZJPA 3F8TA 4DV0Q 2RA4A 5EJWA 4QQBX 3PUYA 1FD7D 2F0WA 5DNFA 4OWTB 3FRPB 4A3JB 1CZGA 5KNDA 1HA5A 1X3PA 1D5MC 4LUVA 4IJHA 4KJNA 4TSSA 2JA8G 4AYBG 1AH9A 2F0LA 2IX0A 1TWAB 4A3IG 3GTPB 1SNOA 1PZKD 3PGZA 3J81i 1WTPA 1YHBA 5C5LA 3K7AB 1CTMA 3WOEA 4IFDJ 4JI2L 1NR4A 4JI2Q 4XTCS 1JWMD 4LF7L 1T5EA 3HKSA 4LF7Q 1IW7C 5K36G 3GTKB 2KBNA 1RF2D 4XT1B 2ASBA 3MZ5A 3DM1A 1TT2A 4IJLA 5JJKA 1DCZA 2O5JC 1HQMC 5EAYA 1C9OA 4C2MH 4HCEA 2SDFA 3S15B 3H3VI 1FR3A 2KCMA 5M5YB 3HOXB 1IYVA 3RZOB 1DGSA 2OCEA 3IAYA 4F8MA 3CU7A 3U58A 4YWMA 2K6AA 3QJYA 3DEPA 1FVIA 2AUKA 2H5XA 4L5QA 4IFDI 4U673 3GTGB 2B2TA 1D1IA 1DZ1A 2JA7H 4KMUC 5JJZA 1EY8A 1F2ZA 2F0IA 4YHHL 3VYRA 5JPMC 1KD1C 2ZTEA 4JBJA 2J7ZA 3SK4A 5FLXc 4YHHQ 4DR1L 3S16B 3VDYA 2VZAA 4DR1Q 1VQ7A 5M3FB 3H3VC 1MI2A 3HOWG 3FHWA 4JI4L 4JI4Q 2AQ2B 4PV1C 2F3IA 5FKAC 2K01A 1Y1WH 1BQQT 3MEHA 3BZDB 2QGQA 1ML0D 1EFWA 1MIUA 5C0XG 2H1EA 2D5DA 2ZJRA 1SFOH 1HUMA 1M4VA 2BE5C 1A0IA 2CW0D 4HMJA 5DLQE 1BCPF 3ULPA 2IHFA 1LTTD 1Z47A 5IGGA 5LMNW 1LO5D 4RA8A 3AMUA 1BCPD 2KHSA 1H9MA 3NTHA 4DV6L 1IHZA 1UE5A 4OL7A 3CCQA 4DV6Q 3RLFA 4G7HC 2MPMA 4KK7A 3Q22A 3Q24A 4KY6A 2M2LA 1E3PA 5IOCA 3J7YW 1UUPA 1D5ZC 5D65A 3J7ZC 2I46A 3M3YB 3KF8A 4BY1B 2EYLA 4NB3A 2HDMA 1RODA 4F7XA 1UE1A 1ZYRC 4ULLA 5D14A 2LS01 3L2PA 2JA5H 1EY5A 1ET6A 3U9OA 3BS1A 1CK1A 1SLJA 4DPGA 3FKIH 3CC2A 1B3QA 4C3HH 4DGZA 4LJZC 5CBEE 3I8ZA 2Q8TA 5M5WH 1BF4A 1TY2A 4RFBA 4H44C 4HJ9A 2HHHL 2R61A 3DUZA 2HHHQ 1TWHB 3X3NA 3M4OB 1KAAA 4HMIA 3CCLA 4C56C 1PH4A 3I73A 3RD4A 1JCKB 3CC7A 4OWXB 1L1OB 3EBEA 1JWSD 3EQLC 5CC4A 4L5SA 2VQFL 1BCPB 4NXML 4IUNA 2VQFQ 5C3WA 4NXMQ 4JW0A 3CW2C 4JI5L 4LMQD 1IKMA 4JI5Q 1B3AA 3CPFA 1ILPA 2CWPA 2B2YA 3NHHA 2RHSB 3HOYH 3PIOA 5ELEA 2F0HA 4IPGA 3BYTB 3PO2B 1VQNA 5LMNL 2N3SA 3M7NA 2A74C 4A93B 3F2CA 1M90C 1QNKA 5LMNQ 1IW7D 3K57A 4OIKA 3LNNA 3Q8DA 3HOZB 5HGQA 1VQPA 1EOTA 1KRSA 2NZOA 1HQRD 1L0WA 4EX5A 1YHQA 3QWNA 1PTOH 1BR9A 2CCZA 4DNTB 4IALA 1CZWA 2PCFB 4A3FG 1CA5A 1J8IA 1N32L 3S2DH 1N32Q 1T9HA 1KAWA 3CCSA 3I56A 2L15A 3IFDA 3CXCA 4R4CA 4BXXG 1L1OA 2K50A 3W2DA 2DJFC 1MGSA 5IGCA 4HJ5A 2EZVA 2ZJQA 4KD4A 1LLRD 4KHPL 1X56A 3NXWA 2ICEC 4Y52H 1CHPD 1TU2B 4A3BG 2DUDA 4UP8A 4KHPQ 4HIOA 1JQYD 1EY4A 1XJVA 4OGQC 2H4OA 1B8AA 5FJ8G 4YWLA 4IOCA 3A74A 2OTLA 4LF8L 4IFDG 3T1YL 1AZPA 3J81c 2IX3A 4LF8Q 5J1ZA 4DUYL 4HJ7A 1F9RA 3NE5B 3T1YQ 3K5NA 3D6CA 2NVQH 2YTYA 4MTKA 2BE5D 2FHTA 1QB5D 1VMPA 4ME5A 4UPAA 1WCMB 2CKZB 2R92H 5C44G 4J6HA 2OTJA 2CQOA 1UE7A 1I5FA 4J1MA 5C4HA 4G57A 5IP7H 4XYQA 3S2HB 2BH8A 2OQKA 3I2ZA 4DK1A 1D6EC 2EYOA 1J5EL 1YITA 4DR7L 1J5EQ 1SRUA 1HH2P 4DR7Q 5GAEC 3C46A 3E6ZX 1F9SA 2R7FA 2R3ZA 4I7AA 4GNXC 2RDHA 4Q5VA 1WFQA 3U4VA 3URYA 3MA2B 2XNAC 2UUCL 1JJGA 2A73B 2LXKA 3I4NB 2UUCQ 2CVRA 1WTHA 1CHQD 1H9SB 2YU9H 4KV6A 1ZYRD 3J7AF 3UDFA 4DV3L 3B6YA 5D3IB 4KY5A 4DV3Q 2XRSD 1JT8A 4B3TL 5JJLA 4KHZA 4B3TQ 4TVAB 3CRKC 5H1SE 1B70B 1QNUA 3KF6B 2RBMA 3MFYA 1NE3A 4DF7A 4A3GH 4XQJA 4OWWB 4NMZA 2VUMG 2ZTCA 1QZGA 2NVYB 5IT9c 1WTWA 3VR3A 4ZUJA 1UE6A 3G71A 3OW7A 3KBXA 2D9UA 2MO1A 3K7UC 5M5XB 4RH6A 3NQTA 5IYDG 2HCIA 3RN2A 3HKZG 2ALYB 3GO5A 4DNIA 3PO3G 4N9PA 3A8IE 3BDLA 2LXJA 3H09A 1WYDA 1B44D 3EIVA 3M4PA 3MXPA 3M4QA 4X3SA 3J80i 3K8AA 3EN2A 1ICFB 1KDAA 4ZCKA 3NENA 4MHEA 2BA1A 1Q8IA 3KDFB 4A3MG 2D62A 3ICEA 2L12A 2IL8A 2L5TA 4JC0A 1U4LA 4X66L 4JI0L 2Q2TA 1VCIA 4X66Q 1VQIA 4JI0Q 1QVGA 3S1MH 1TWFH 4DXFA 4LK1C 4DKAC 1H9SA 4MTNA 3CPWA 4G7ZC 2E2HB 2MUYA 5D3DA 1WTVA 1LTSD 4GLVB 3A7LA 2EY2A 1RD9D 4DA2A 3ITPA 5IYBG 1JORA 1GXDC 3BZCA 2QF7A 4A3FH 4DAYB 1W2BA 3KF6A 4H02A 1EWIA 2JE6I 1RTOA 3A8KE 2L1BA 3MEFA 4C3JG 1ICWA 3MXNB 1QVCA 4A3EG 1WVLA 1KIXA 1LT6D 2K28A 2A19A 2MJ8A 4UY8C 4JG2A 4BBSH 3H94A 4BXXH 1EY0A 4WJWA 4JBKA 2N49A 1XTCD 2PPBC 5JJIA 1PZJD 1VF7A 4GS3A 2ZTDA 4LWCA 1G291 2N88A 2IY5B 2LMCB 2EY5A 3PO3B 1JJCB 1PYBA 1ET9A 2F0PA 4RCOA 1SR3A 2V4DA 2FMCA 3LWEA 1XYIA 1HTPA 4A3MB 4IPHA 1EYGA 2CH4W 2ZXOA 5CBAE 4K5XA 1S40A 1F2YA 3DLLA 3UE0A 4NW2A 3CKIB 3TP5A 1P16A 3PUXA 4GN3B 1DONA 1Y8NB 2B29A 3QB3A 2CFMA 2RDGA 2Z0SA 4F88A 5A2QL 1K9MC 2DNCA 5IT9L 2LFNA 4DR6L 1PTOC 4DFAA 2R93B 2HUGA 4QMGA 4DR6Q 3CQZH 4DV1L 2K75A 4IPDA 1XNQQ 3MTSA 4DAYA 4JI7L 1QILA 4BWGB 4DV1Q 1ASYA 4JI7Q 3S1NB 2C9OA 2F0UA 3OWEB 4R8NA 4HIMA 3MXNA 1VQLA 2MQHA 1BBWA 2PI2E 5J22A 1S5CD 2EVBA 1XMQL 3T56B 4BBRH 1CI3M 2VL6A 1CFMA 5J3BA 1R9TH 1ONLA 3CCEA 4ZAIA 3M4YA 3K5OA 2EY6A 2QDBA 3GTLH 3OMCA 4EQ5A 1B7YB 4L63B 3A55A 1Y1WG 2ICIA 2WB1E 3VR2A 4FDBA 3TS0A 2BOSA 4PQXA 3AYHB 4RG1A 4CGYB 3TBIB 5A35A 5JAVA 3GTJB 2NVTH 2AWNA 1G6ZA 4P73A 1Q3LA 1TS4A 4X62L 2UUAL 1B50A 4X62Q 2UUAQ 1MJCA 2B8FA 5IYDH 1TS2A 3RZDH 5IGDA 1SYFA 3WWVA 5IYCG 4C2MB 3BJUA 2KENA 1XPRA 4GNXB 1FNVA 1CT1D 3C2PA 4PZ7A 2FINB 2Q2IA 4L5TA 1TWGH 3NELA 3DM3A 3E9HA 3RNUA 1E1TA 5GAGC 3PCOB 3D0FA 2AHOB 1BUVT 1X3GA 2JA5G 2KOLA 3C1EA 2F0NA 3NTIA 2JA7B 2PMZE 4C3HG 2CQAA 4LW1A 4XQNA 1BBUA 4X3UA 2EPBA 1AE3A 4AYBE 2FMMA 1TVXA 3S1QH 1GO3E 2R7ZB 1VQAA 3R2IA 4OO1H 2P5ZX 4CJ2C 4WFN3 3JAMi 1PA6A 4R4OA 2NVXH 4QL5A 4ZYSA 1HJPA 4DAVA 5KGUA 2B63H 1EIGA 1EYAA 4NPSA 4A3EH 3A7AB 2CH4A 2K05A 1QVFA 1A62A 1SN8A 5JVG3 3OSOA 4TKOB 1EU3A 4A3DG 1VQDA 3MFGA 2B2WC 1QG7A 4O2DA 2G9DA 2GVAA 5M3MG 2O5IC 2PQAA 1CUKA 1JE4A 1RIPA 3HOYG 3AEVA 1N33L 4DR4Q 1VQ6A 4IZ8A 3V2TA 1N33Q 4JOIC 3J7A5 1EEFD 5CMDA 4GNXA 1KLUD 1VQCA 4K2LA 2WB1B 3KYHC 3G48A 1BOSA 1STGA 3J80c 1IBLL 2WFWA 2X6LA 1EY7A 1A3UA 1IBLQ 3T1HL 3I4MB 3D4WA 1EFID 3TN2A 4IUVA 3G7LA 2JA5B 1YI2A 1PTOF 3FKIB 4C3HB 1LTGD 1Y8PB 1CM9A 5C4XG 1PTOD 1YHAA 1QCBD 5JPNC 2ZM6L 1NJIC 3KLSA 4MNOA 2XWJB 2ZM6Q 2EIFA 2Q8RE 3TZDA 3CCMA 4EVOA 5C3EH 2VW9A 2VXWA 3HGBA 3KF8B 1HRJA 4DN4M 1WD0A 1EY6A 3K58A 1K73C 3KLSX 3GV3A 1SYEA 3AU7A 2JA6H 5GADC 4BS9A 2WIIB 2PI2A 2PMZB 3A0JA 1SYCA 2MNAA 3CC4A 1SYGA 4QUCA 2JA8B 4AYBB 4HCSA 3STBC 2Z9HA 1B1ZA 4A3IB 3HOYB 5FLXE 5FOBB 1I50B 1PH2A 1XPOA 2GA4B 2L55A 4CDFC 2OWOA 1YEZA 1II3A 1Y1VH 1CSQA 4DUZL 3PIPA 4LF6L 1Q1BA 3KLWA 4DUZQ 2Z4HA 4LF6Q 2A5HA 2R92G 4PMBA 3A5UA 3TSSA 3VYUA 4S3SA 3GTMH 2X6GA 3F2UA 1PZID 4K5VA 5IP7G 1EWCA 3K0YA 1PTOB 1D7QA 3HEJA 3K80C 5IYCH 3I4LA 3HS0C 2PO4A 3D31A 2KCNA 3CCRA 2G5DA 1LACA 5KNBA 2E5LL 2WINB 2QA4A 4Q0FA 2E5LQ 4HSVA 1KNEA 4P74A 2K03A 4DXGA 4QB4A 1F9QA 1E22A 3GTPH 3AFPA 3UI2A 3K7AH 2DGYA 4KTAA 3P75A 3WDNA 4GKJL 1PLFA 1SROA 2E74C 4R9WA 1S5FD 2A6HC 4GKJQ 1GJXA 4NKLA 4OXPA 1BO0A 3A54A 2IW3A 3VR4A 5IIFA 1N8RC 2SNMA 4DR2L 1IL8A 3D4RA 1A2TA 1LM0A 4DR2Q 4B3SL 2V1CC 2CWAA 4B3SQ 1MSHA 1SMYC 3ERQA 3J80L 2Q8IB 3HOWB 4A3GG 3GTKH 1K8AC 1ENCA 4IQZA 2AQ3B 2NB0A 1X54A 1C48A 5C3XA 3I55A 3FPUB 1W6JA 3KOJA 1I3QB 1DOMA 3S1RH 1X65A 3TDQA 3CCUA 1X55A 3S15H 2LSSA 4DR5L 2NZHA 2A6EC 5L37A 3SHLA 1GUTA 3ZJYC 5M5YH 3HOXH 4DR5Q 4GOPC 4A3DH 2R92B 3RZOH 4ODGA 1GUWA 3TREA 4FXKC 2RCNA 1PH9A 1VQ8A 4QUFA 2E2JH 5M3MH 1YNNC 4K8JA 1Y69U 1C4QA 3H0GG 5JVH3 1S4ZA 4CDCC 1YZ6A 2X69A 1I6HH 3NP8A 1RCVD 3S17H 3GTGH 2XGTA 1V1OA 1X9NA 1TXYA 3U4ZA 5FLMH 4OO1I 3EFXD 2F4IA 3S16H 2PNHA 4L6TB 1N34L 2UU9L 3HOVH 5KYLA 3VR6A 4EQPA 5M3FH 2YU9B 4AQYL 1N34Q 3BVGA 5EPJA 5FLXL 5F2DA 2UU9Q 4AQYQ 3R93A 4A3LH 1XPUA 3K6OA 1S5BD 2FXQA 1OXSC 1B4OA 4OEMB 4Y7NH 2KJXA 4X65L 5ELDA 3L3OC 5FO9B 3F1ZA 2KQ3A 4X65Q 4HTHA 3CCJA 3UE1A 4FXGC 4ZLTF 4R4TA 5C4XH 2A69C 2EE1A 4O0AA 1BDOA 1YNXA 4DV5L 4A3GB 1HZBA 4YCUA 1CKMA 4DV5Q 4DV2L 1G8ZD 1SE8A 1F2LA 3UDXA 4DV2Q 1XX8A 3BDOA 3JAMc 4BBSG 2EJMA 1RJTA 1TIID 2ID0A 1VQFA 1NSNS 3CAMA 3OIPA 1PRTF 4F87A 5ELBA 4LUOA 1H9JA 1NMGA 1SSOA 3SDZA 1SNPA 4DV7L 1GHKA 5CV6A 5K5PA 4DV7Q 2E75C 2JYOA 2QKIC 3AQQA 4KN4C 2IX1A 3STBD 3QOJA 2C35B 4A4IA 1RKNA 1GUNA 5DM63 1XMOL 2F0QA 2RCFA 1XMOQ 3HZXA 1B2TA 1S5DD 3KLRA 4LAAA 3J7AV 2NWGA 2K7VA 3HFZB 3SE0A 4DUYQ 4ZK9B 4FO2A 1I94L 4R8IA 2F0OA 3J81E 2Q2UA 1TS5A 1PH6A 1I94Q 2KECA 1DD2A 3S1MB 5EKKA 1TWFB 3OPOA 5C4JB 1PFMA 5FK9C 1LTAD 2WP8J 3PUWA 5LMUL 2NN6H 3M4OH 3E3XA 1JB7A 5LMUQ 4HEDA 4XQQA 2KCCA 3SGIA 1HA6A 2NYZD 2VQEL 5CV8A 1D8LA 2VQEQ 4C3IG 4ALPA 4A3FB 2K5NA 4KI0A 2O2LD 3M7GA 3OWFA 4JK1C 1C7YA 1UWVA 3ER0A 2Z6BA 2BDNA 3PIO3 2K5WA 3UDGA 2N55A 2QEJC 2TMPA 2ZT9C 1NTGA 2B2WA 2K04A 4J8QA 4NDXA 4BBRG 4A3CH 4FNFA 1PH8A 4JI3L 1V1PA 2WAQG 4X3KA 4ZUIA 4JI3Q 2A6HD 3HKZE 1CQVA 2ENBA 4OELB 4JOIA 4A93H 1IXRA 3HP3A 1SMYD 4A3BB 3PF5A 1IYJB 4CKBA 4LFCL 3HOZH 1Q86C 4LFCQ 1LTBD 3G6JB 3I3CA 2AUJD 5EPKA 2MP1A 3G4SA 5A2QE 5COYA 1MSGA 4KKUA 5IT9E 1VQOA 4R4QA 3FVQA 3T53B 2DN8A 3MXGA 1UEBA 1F2MA 1TQOA 4J15A 1FNWA 2C5CA 5I6YA 2NTTA 1KC8C 3GD7A 3CP0A 5C44B 5CR3A 1STNA 5I2YA 3NQIA 5BN4A 1KQSA 2F03A 3RLOA 1Q82C 3CD6A 4KHVA 4IO9A 3H0GH 4IOAA 2F0VA 1K3RA 4JI8L 1C8CA 2HCCA 3JAML 3TZUA 4JCVE 4JI8Q 2HDLA 2BDOA 1E2WA 4UP7A 3A5ZB 3SEBA 4V0BA 4BY7H 1GOZA 2L9HA 3K0XA 1FL0A 1NAPA 4BBRB 3S24A 4FVMA 1A3TA 2MGSA 4G7OC 1T5XD 3JC66 4CJ1B 3RMHA 3GTLB 1WTXA 2SEBD 3R8BA 4OO1G 3J81L 2A69D 4IUQA 3S14H 1KLGD 1KRTA 1VQBA 3RR5A 1G91A 1YVCA 3I7FA 4CJ0B 1N36L 1WCMH 2B63G 1N36Q 2EYFA 3VA5A 1M8AA 4UP9A 2VUMB 4N8FA 1K8MA 2L0CA 2UUBL 4GOPB 1CQFA 2UUBQ 3E0JA 2BCOA 4A3KH 4LFAL 1Z7TA 3NEMA 4HIKA 2B8GA 2OEOA 1VQEA 1JR0D 5FO7B 4LFAQ 5GQOA 5CV4A 3BYYB 3BZKA 1W6KA 3HKZB 4B08A 2ES2A 1HFGA 1TWCB 4WJ3M 5G3LF 3GDEA 5CV7A 2LKVA 3U9SA 1O78A 1TWGB 1XNRL 1K0RA 2K1BA 1EUJA 4PNYA 4OIJA 5G3LD 3IKJA 1W3SA 1XNRQ 2F0TA 2BA0A 2G9HD 4MZ9A 1ENAA 1I6VC 4P75A 4XT3B 2Z8LA 1LTLA 2EYMA 5T1IA 1PH7A 1E7ZA 2IT1A 3K81C 1TY0A 1RDPD 4KKTA 2NVYH 4MIUA 5I6WA 2JEAI 2EOTA 1HFNA 3D8GA 1NMFA 3S1QB 2E2IH 1SEBD 2A8VA 4JBMA 1O7ZA 4LFBL 4C3IH 5EGTA 1YIJA 4LFBQ 1KL9A 2DY8A 5C3EG 3PSIA 3PUZA 2D0OA 2B63B 1S5ED 1WJJA 1B53A 4C3JB 4A3EB 1YJNA 3WOFA 2JA6G 4GOPA 3GV6A 1KDCA 1DOLA 4GLAC 1XMQQ 2EXDA 1HPCA 1HZAA 3P7JA 5JOBA 3TEHB 1U9RA 2EJFC 2HIXA 2I0QA 1QWYA 4PZ8A 1JC7A 2NN6I 1OTCA 4QIWE 3DXJC 1Q8KA 3NUCA 1JJ2A 5EKLA 2K14A 1Y1VG 4C1NI 2KUMA 2AMCB 4DK3C 4B9XA 4WORA 5ISRA 2QEXA 1GHJA 5IGFA 3GTOH 1KABA 1F77A 2I5LX 5EBDA 2YV5A 5LHY1 1OXUA 4ZKBB 5IP9H 1Y14B 1GVPA 5E7NA 2PQAB 3BVZA 1SAPA 2HQEA 4RGNA 1XWEA 3QG1A 4DNRB 1Z9FA 2RVLA 2PZTA 2WKCA 3X3MA 1AE2A 3ULJA 2QW7A 1IL2A 1MD2D 5I9PA 3L9AX 1BNZA 4HJAA 1HTLD 3MXUA 3P1HA 2VNUD 1TKWB 2PZWA 1DJRD 2PNRC 5EPLA 3DWQA 1I4GA 2FFKB 4G4KA 4U68A 4O42A 2XVSA 1MKHA 1SJHD 2M9VA 2JA9A 1KNAA 4HN7A 3DEOA 1SDFA 3LWUA 1I4QA 2BH2A 1I4XA 1TS3A 4JBWA 1EWHA 1X3EA 2YTVA 1HNZL 2MHVA 1Y1WB 3S9WA 1A3VA 1PMRA 1YBYA 1M1KC 4CDDC 3TRZA 4KD3A 3VYTA 5EBCA 1Y1VB 2PQEA 1SFOB 1AZQA 1GUGA 4O1NA 1GKHA 2NTSA 5IWAL 3HOXG 2OXPA 5IWAQ 3T51B 2NZ1D 2R93H 2F0MA 3GTMB 5I9OA 1STAA 5CYUA 4EQNA 3E9IA 4B9WA 3SK6A 1SYDA 1UEAB 4QIWB 4K6DA 1EQVA 5CV5A 2QDLA 5FLMG 1WOCA 1STBA 4CKCA 5J39A 3C3LA 3IL8A 3HOVG 5M3FG 3J80E 1RL2A 2E2DC 4DK0A 3T1HQ 2PW5A 3H91A 5TSSA 4A3LG 1O80A 4WJ4A 1AEXA 5ELOA 1F9PA 4DR4L 2B3GA 1HR0W
chains in the Genus database with same CATH topology
5BN3A 4C1NK 5E3FA 5M5WB 4FYDA 4H13C 2XSCA 4IUTA 4K14A 1EZ6A 3DWAA 2TSSA 3H6MA 4DAPA 1A6XA 4TRDA 2WKDA 2B2UC 3S1RB 1SNCA 4XDXA 3BG3A 4Z9CB 4M1UB 5LL6X 1VF5C 5KIXA 4A3DB 1H9KA 3I90A 4RHRA 2KEEA 2E2JB 1PRTC 2QCPX 5M3MB 1FGBD 3NPPA 1RTNA 3A56A 5CORA 1SE3A 5C5MA 1I6HB 3S17B 2WV6D 2VB3X 2OT2A 2J0TD 1SJED 2RQXA 1FYCA 3V96A 1R4PB 4ZRZA 3HOVB 1O7LA 2NN6G 4PMWA 4Y7NB 3NTKA 2AQ1B 1JOQA 3EJIA 3PMFA 5C4XB 3S2DB 1MBYA 1SXTA 3K59A 2XRQD 4RCNA 1V8QA 1DM0B 5NUCA 2WACA 3EROA 3GP7A 1EYCA 3N6RA 1X3QA 3DWPA 5LL6S 4ID6A 2F0SA 5JEAH 1EIHA 2NUCA 4KY7A 4RHSA 3C1FA 3N52A 3PV0A 1HHVA 4BA1I 2B39A 3NK9A 4DU9A 3L7ZC 4FP5D 2B2VC 1JOKA 5I4DA 4FF4A 4EQOA 2NVQB 1QOHA 4QCLA 3I72A 5I2XA 3FDTA 2EXZA 2M00A 2E76C 1PFNA 1ESFA 1AP0A 1U4PA 1Q90A 1ESRA 2RKSA 5E4XA 3KUPA 2F0FA 2K5DA 3TP6A 3Q23A 2O4XA 2D2CC 1EZ8A 1JICA 2JXMB 3OOCA 1V43A 5DM73 4CBVA 5KEEA 4FXDA 3Q0AA 3OHXC 3PIP3 3D3RA 1H9RA 1QJOA 3E5SA 5HURA 5IGBA 1HCZA 1XXGA 2VB2X 5K36H 4IN3A 2QILA 3T16A 2IJ0A 1KTKA 3K5MA 2EYJA 2KEDA 4FF1A 1V1PB 1STYA 2A68C 3I70A 3MHBA 3JAME 1ENFA 1PXUA 1EEID 1LABA 5IODA 1EYDA 1PRTD 2F3VA 3EVQA 3SK5A 5FO8B 2F0KA 2Z4IA 2JEBI 4K6LA 2K33A 3H0GB 3BDCA 2ZXRA 3K5LA 2YYZA 2L11A 3NBIA 3NWSA 3VA7A 4HR7B 5EKIA 4BY7B 1E2ZA 5BN5A 5KNCA 4M8AA 2KA7A 1PFBA 4YIJA 2EY1A 3T13A 4XXEA 5DEHA 2XN9C 3T4AC 4P2CB 1AN8A 5C0XH 3S14B 4ILWA 4RGOS 3O13A 1WTRA 3KK7A 2Y0SB 1Y8OB 3D6WA 3P20A 1AFPA 1B9NA 1VMCA 5CGKA 4A3KB 4BBSB 2L4NA 3NBHA 2JSOA 1G2SA 1PRTB 1AW7A 1SYBA 2EDGA 3EA6A 5JEAJ 2F3WA 1DYQA 1ZKOA 3QO2A 2RDFA 1YNJC 5CV9A 4RKLA 4I7ZC 4HAEA 1UNSA 1TR5A 1KDBA 4WRDA 1WTQA 3FPPA 4EGVA 2A6ED 4IURA 1DXMA 1A15A 3MAQA 4KN7C 1JOOA 1YNND 3BVMA 2SNSA 2RSNA 3TP7A 4FF2A 2E2IB 3NWTA 1U4MA 3PUVA 1BXTA 3CQZB 4C3IB 1D2BA 3QOLA 1STHA 3CHBD 2XIWA 1OXXK 2B2UA 1EQTA 2B2TC 2NBFA 1GUOA 1G2TA 1R9TB 3SR1A 1IKLA 1IYUA 1LTRD 2WAQB 4HSPA 3KBGA 3OIQA 1NUCA 3W3AA 1LV9A 3SK8A 2Z1CA 1GUSA 2DNEA 4UAIA 2LY7A 4KKSA 2F0DA 3OMGA 5AFWA 2R6GA 1DOKA 1NCVA 3R2TA 3AB9A 1EY9A 2NVTB 1PYWD 4FF3A 1SE2A 1I4PA 1B9MA 1HXYD 2FJ2A 2A68D 3MVVA 4MN3A 3GTOB 1JWUD 2F0EA 3SXHA 4L8JA 3RZDB 1QE6A 3ND9A 5M9OA 1K8OA 4H7BA 1I4RA 3ONAB 3V05A 1STEA 2IPKD 4CKEA 1ILQA 3SVMA 1J9OA 1BBXC 4IUPA 1U4RA 3VR5A 1WD1A 1Q12A 1LTID 3ZYYX 2K32A 2EJGC 3M85A 4BA2I 4ABNA 4QF4A 4I65A 3DMUA 1RHPA 3CRLC 3R3OA 3TMEA 3QIAA 2J4XA 4IFDH 5ELCA 4CHTB 5C0XJ 3ND8A 1D1KA 1UAPA 2OF1A 2B2VA 2NVXB 3NSWA 3HG9A 5C4ZA 4OHJA 2F0JA 5IGEA 2EYHA 1WTOA 2I07B 1PDQA 3RUZA 2F1MA 4NP5A 2K5QA 4E6IA 4XIGS 2B2YC 1A2UA 2CHBD 2ZXPA 5ELFA 1LT4D 1YNJD 5KYIA 5E4WC 1LT3D 4XYOA 1OXTA 1JB3A 1EU4A 1SBBB 1I4HA 1SE4A 1SNDA 5C0XI 4ZQ3A 2DY7A 4PMCA 1Z6HA 5KRUA 3DHQA 3TP8A 3MWYW 3A8JE 1VDZA 5EQ0A 4KJOA 3GQBA 1Q1EA 1SNQA 2EYPA 4K2KA 5E1FA 4N9TA 3GTQB 5DAUA 4K8IA 2CW0C 2F0GA 4RWSC 3Q6SA 5T1GA 1X32A 1L0YB 5C3EB 1OO9B 1OXVA 3HRZC 1LT5D 1BCPC 1O7YA 1SNMA 3VYSA 1E0BA 3FMCA 2JA6B 4RGTA 1D5XC 4H0LC 4RKBA 2PZUA 5JEAG 1NR2A 2PYKA 2AWOA 2KVMA 3LX0A 2XWBB 1ZEQX 1K83B 4K5WA 2IWHA 4X3TA 2SOBA 1FNUA 5HGTA 1HUNA 2JP1A 3HOUB 1E2VA 4IUUA 1CA6A 2PW7A 4RAUC 3MC0B 4ZKCB 5C6AA 3FEWX 4UDUC 1ZXTA 1R4QB 3I91A 4GZYC 3D4DA 4RGMA 2RSOA 1EL0A 3IFTA 1L0XB 4TQUS 4V190 2RA4A 5EJWA 3PUYA 1FD7D 2F0WA 5DNFA 3FRPB 4A3JB 1CZGA 5KNDA 1HA5A 1X3PA 1D5MC 4KJNA 4TSSA 2F0LA 2IX0A 1TWAB 3GTPB 1SNOA 1PZKD 1WTPA 5C5LA 3K7AB 1CTMA 3WOEA 4IFDJ 1NR4A 4XTCS 1JWMD 1T5EA 1IW7C 5K36G 3GTKB 1RF2D 4XT1B 3MZ5A 3DM1A 1TT2A 1DCZA 2O5JC 1HQMC 4HCEA 2SDFA 3S15B 1FR3A 5M5YB 3HOXB 1IYVA 3RZOB 3IAYA 4F8MA 3CU7A 2K6AA 3QJYA 3DEPA 2AUKA 4IFDI 4U673 3GTGB 2B2TA 1D1IA 1DZ1A 4KMUC 5JJZA 1EY8A 1F2ZA 2F0IA 3VYRA 5JPMC 2J7ZA 3SK4A 3S16B 5M3FB 3H3VC 1MI2A 2AQ2B 4PV1C 5FKAC 2K01A 1BQQT 3MEHA 3BZDB 1ML0D 5C0XG 2H1EA 2D5DA 1HUMA 1M4VA 2BE5C 2CW0D 4HMJA 1BCPF 1LTTD 1Z47A 5IGGA 1LO5D 4RA8A 3AMUA 1BCPD 2KHSA 1H9MA 3NTHA 1IHZA 4G7HC 4OL7A 3RLFA 2MPMA 4KK7A 3Q22A 3Q24A 4KY6A 2M2LA 5IOCA 3J7YW 1UUPA 1D5ZC 5D65A 2I46A 3M3YB 3KF8A 4BY1B 2EYLA 2HDMA 1RODA 4F7XA 1ZYRC 4ULLA 5D14A 2LS01 1EY5A 1ET6A 3U9OA 3BS1A 1CK1A 4DGZA 4LJZC 5CBEE 3I8ZA 2Q8TA 1BF4A 1TY2A 4RFBA 4H44C 2R61A 3DUZA 1TWHB 3X3NA 3M4OB 1KAAA 4HMIA 4C56C 3I73A 3RD4A 1JCKB 1JWSD 3EQLC 5CC4A 1BCPB 4IUNA 5C3WA 4LMQD 1IKMA 1B3AA 1ILPA 2B2YA 3NHHA 5ELEA 2F0HA 3BYTB 3PO2B 3M7NA 2A74C 4A93B 1QNKA 1IW7D 3K57A 4OIKA 3LNNA 3HOZB 1EOTA 1HQRD 3QWNA 1PTOH 1BR9A 4DNTB 4IALA 1CZWA 2PCFB 1CA5A 1J8IA 3IFDA 3W2DA 1MGSA 5IGCA 2EZVA 4KD4A 1LLRD 2ICEC 3NXWA 1CHPD 1TU2B 1JQYD 1EY4A 4OGQC 2H4OA 4IFDG 1AZPA 2IX3A 5J1ZA 1F9RA 3NE5B 3K5NA 3D6CA 2BE5D 2FHTA 1QB5D 1VMPA 4ME5A 1WCMB 4J6HA 4J1MA 5C4HA 4G57A 4XYQA 3S2HB 4DK1A 1D6EC 2EYOA 3C46A 3E6ZX 1F9SA 2R3ZA 2RDHA 4Q5VA 3URYA 3MA2B 2XNAC 2A73B 3I4NB 2CVRA 1CHQD 1H9SB 4KV6A 1ZYRD 3J7AF 5D3IB 4KY5A 2XRSD 4KHZA 3CRKC 1QNUA 2RBMA 3MFYA 4DF7A 4XQJA 4NMZA 2NVYB 1WTWA 3VR3A 4ZUJA 3OW7A 3KBXA 2D9UA 5M5XB 4RH6A 3NQTA 2HCIA 3GO5A 4N9PA 3A8IE 3BDLA 3H09A 1B44D 3MXPA 4X3SA 1KDAA 4MHEA 2BA1A 1Q8IA 2D62A 2L12A 2IL8A 2L5TA 1U4LA 1VCIA 4DXFA 4LK1C 1H9SA 4G7ZC 2E2HB 2MUYA 5D3DA 1WTVA 1LTSD 3A7LA 2EY2A 1RD9D 4DA2A 3ITPA 1JORA 1GXDC 2QF7A 2JE6I 1RTOA 3A8KE 2L1BA 4C3JG 1ICWA 1WVLA 1LT6D 2K28A 2MJ8A 3H94A 1EY0A 4WJWA 1XTCD 2PPBC 1PZJD 1VF7A 1G291 2N88A 2LMCB 2EY5A 3PO3B 2F0PA 1ET9A 4RCOA 2V4DA 2FMCA 3LWEA 1XYIA 1HTPA 4A3MB 2ZXOA 5CBAE 4K5XA 1F2YA 4NW2A 3CKIB 3TP5A 3PUXA 1DONA 1Y8NB 3QB3A 2RDGA 5A2QL 4F88A 2DNCA 5IT9L 2LFNA 1PTOC 4DFAA 2R93B 2HUGA 4QMGA 3MTSA 4DAYA 1QILA 4BWGB 3S1NB 2C9OA 2F0UA 3OWEB 4R8NA 3MXNA 5J22A 1S5CD 2EVBA 3T56B 1CI3M 1CFMA 1ONLA 4ZAIA 3M4YA 3K5OA 2EY6A 2QDBA 3OMCA 4L63B 3A55A 2ICIA 3VR2A 2BOSA 4PQXA 4CGYB 3TBIB 5A35A 5JAVA 3GTJB 2AWNA 1G6ZA 1Q3LA 1TS4A 1B50A 2B8FA 1TS2A 5IGDA 1SYFA 4C2MB 1FNVA 1CT1D 3C2PA 2FINB 1BUVT 2KOLA 3C1EA 2F0NA 3NTIA 2JA7B 4C3HG 2CQAA 4XQNA 4X3UA 2EPBA 2FMMA 1TVXA 2R7ZB 3R2IA 4OO1H 4CJ2C 4WFN3 4ZYSA 4DAVA 5KGUA 1EIGA 1EYAA 3A7AB 2K05A 5JVG3 3OSOA 4TKOB 1EU3A 3MFGA 2B2WC 1QG7A 2G9DA 2O5IC 1JE4A 4IZ8A 3V2TA 1EEFD 5CMDA 1KLUD 4K2LA 2WB1B 1BOSA 1STGA 2X6LA 1EY7A 1A3UA 3I4MB 3D4WA 1EFID 3TN2A 4IUVA 3G7LA 2JA5B 1PTOF 3FKIB 4C3HB 1LTGD 1Y8PB 1CM9A 1PTOD 1QCBD 5JPNC 3KLSA 2XWJB 2Q8RE 3TZDA 4EVOA 2VXWA 3HGBA 1HRJA 4DN4M 1WD0A 1EY6A 3K58A 3KLSX 3GV3A 1SYEA 3AU7A 4BS9A 2WIIB 2PMZB 1SYCA 1SYGA 4QUCA 2JA8B 4AYBB 4HCSA 1B1ZA 4A3IB 3HOYB 5FLXE 5FOBB 1I50B 2GA4B 2L55A 1II3A 1Q1BA 2Z4HA 2A5HA 4PMBA 3TSSA 3VYUA 4S3SA 2X6GA 3F2UA 1PZID 4K5VA 1EWCA 3K0YA 1PTOB 3HEJA 3I4LA 3HS0C 2PO4A 3D31A 2KCNA 1LACA 5KNBA 2WINB 4Q0FA 4HSVA 1KNEA 2K03A 4DXGA 4QB4A 1F9QA 3UI2A 4KTAA 3P75A 3WDNA 1PLFA 2E74C 4R9WA 1S5FD 2A6HC 1GJXA 4NKLA 1BO0A 3A54A 5IIFA 2IW3A 3VR4A 2SNMA 1IL8A 3D4RA 1A2TA 1MSHA 1SMYC 3ERQA 3J80L 2Q8IB 3HOWB 1ENCA 4IQZA 2AQ3B 2NB0A 1C48A 5C3XA 3FPUB 1W6JA 1I3QB 1DOMA 3TDQA 2A6EC 3SHLA 1GUTA 2R92B 1GUWA 4ODGA 4FXKC 4QUFA 1Y69U 4K8JA 1YNNC 1C4QA 5JVH3 1S4ZA 2X69A 3NP8A 1RCVD 1V1OA 4OO1I 3EFXD 2F4IA 4L6TB 5KYLA 3VR6A 4EQPA 2YU9B 3BVGA 5EPJA 5FLXL 5F2DA 3R93A 3K6OA 1S5BD 1OXSC 1B4OA 2KJXA 5ELDA 3L3OC 5FO9B 2KQ3A 4HTHA 4FXGC 4ZLTF 2A69C 2EE1A 1BDOA 4A3GB 1G8ZD 1F2LA 1XX8A 3BDOA 2EJMA 1RJTA 1TIID 2ID0A 1NSNS 3OIPA 1PRTF 4F87A 5ELBA 1H9JA 1SSOA 3SDZA 1SNPA 1GHKA 5CV6A 5K5PA 2E75C 2JYOA 2QKIC 4KN4C 2IX1A 3QOJA 1RKNA 1GUNA 5DM63 2F0QA 3HZXA 1B2TA 1S5DD 3KLRA 4LAAA 3J7AV 2NWGA 2K7VA 3SE0A 4ZK9B 4FO2A 4R8IA 2F0OA 3J81E 1TS5A 2KECA 1DD2A 3S1MB 5EKKA 1TWFB 3OPOA 5C4JB 1PFMA 5FK9C 1LTAD 2WP8J 3PUWA 2NN6H 4HEDA 4XQQA 2KCCA 1HA6A 2NYZD 5CV8A 4C3IG 4A3FB 4KI0A 2O2LD 3M7GA 3OWFA 4JK1C 2BDNA 3PIO3 2K5WA 2N55A 2QEJC 2TMPA 2ZT9C 2K04A 2B2WA 4J8QA 4NDXA 4FNFA 1V1PA 4X3KA 4ZUIA 2A6HD 1CQVA 2ENBA 3HP3A 1SMYD 4A3BB 4CKBA 1LTBD 3G6JB 3I3CA 2AUJD 5EPKA 2MP1A 5A2QE 5COYA 1MSGA 4KKUA 5IT9E 3FVQA 3T53B 2DN8A 3MXGA 1F2MA 1TQOA 1FNWA 2C5CA 5I6YA 2NTTA 3GD7A 5C44B 5CR3A 1STNA 5I2YA 3NQIA 5BN4A 2F03A 4KHVA 2F0VA 1C8CA 2HCCA 3JAML 3TZUA 2HDLA 2BDOA 1E2WA 3SEBA 4V0BA 1GOZA 2L9HA 1NAPA 4BBRB 4FVMA 1A3TA 2MGSA 4G7OC 1T5XD 4CJ1B 3GTLB 3RMHA 1WTXA 2SEBD 3R8BA 4OO1G 3J81L 2A69D 4IUQA 1KLGD 1G91A 4CJ0B 2EYFA 3VA5A 1M8AA 2VUMB 1K8MA 2L0CA 1CQFA 3E0JA 2BCOA 1Z7TA 2B8GA 2OEOA 5FO7B 1JR0D 5CV4A 3BYYB 1W6KA 3HKZB 4B08A 1HFGA 1TWCB 5G3LF 5CV7A 2LKVA 3U9SA 1O78A 1TWGB 2K1BA 4PNYA 4OIJA 5G3LD 3IKJA 2F0TA 2BA0A 2G9HD 1ENAA 1I6VC 4XT3B 2Z8LA 2EYMA 5T1IA 2IT1A 1TY0A 1RDPD 4KKTA 4MIUA 5I6WA 2JEAI 2EOTA 1HFNA 3D8GA 3S1QB 1SEBD 1O7ZA 5EGTA 2DY8A 3PUZA 2B63B 1S5ED 1B53A 4C3JB 4A3EB 3WOFA 3GV6A 1KDCA 1DOLA 1HPCA 3P7JA 5JOBA 1U9RA 2EJFC 1QWYA 1JC7A 2NN6I 3DXJC 3NUCA 5EKLA 4C1NI 2KUMA 4B9XA 4WORA 5ISRA 1GHJA 5IGFA 1KABA 1F77A 5EBDA 5LHY1 1OXUA 4ZKBB 3BVZA 1SAPA 2HQEA 4RGNA 1XWEA 3QG1A 4DNRB 2RVLA 2PZTA 2WKCA 3X3MA 1MD2D 5I9PA 3L9AX 1BNZA 1HTLD 3MXUA 3P1HA 2VNUD 1TKWB 2PZWA 1DJRD 2PNRC 5EPLA 3DWQA 1I4GA 4U68A 2FFKB 4G4KA 4O42A 2XVSA 1SJHD 2M9VA 1KNAA 4HN7A 3DEOA 1SDFA 3LWUA 1I4QA 1I4XA 1TS3A 4JBWA 1EWHA 2MHVA 1Y1WB 3S9WA 1A3VA 1PMRA 4KD3A 3VYTA 5EBCA 1Y1VB 2PQEA 1SFOB 1AZQA 1GUGA 4O1NA 2NTSA 2OXPA 3T51B 2NZ1D 2F0MA 3GTMB 5I9OA 1STAA 5CYUA 4EQNA 4B9WA 3SK6A 1SYDA 1UEAB 4QIWB 4K6DA 1EQVA 5CV5A 1STBA 4CKCA 5J39A 3C3LA 3IL8A 3J80E 2E2DC 4DK0A 2PW5A 3H91A 5TSSA 1O80A 1AEXA 1F9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEQ X;  2QCP X;  2VB2 X;  3E6Z X;  2L55 A;  2VB3 X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 5BN3 A;  4C1N K;  3KFU A;  5E3F A;  5M5W B;  4FYD A;  4H13 C;  2XSC A;  4IUT A;  4K14 A;  3GTQ H;  4PG3 A;  3GTJ H;  1EZ6 A;  3DWA A;  2TSS A;  3H6M A;  4DAP A;  1A6X A;  4TRD A;  2IHE A;  1XTD A;  4YY3 L;  2WKD A;  1VQ9 A;  2B2U C;  4YY3 Q;  3S1R B;  4LF4 L;  1QUQ B;  1SNC A;  4LF4 Q;  4XDX A;  3BG3 A;  4Z9C B;  4M1U B;  2KCT A;  5LL6 X;  1VF5 C;  3U50 C;  5KIX A;  1BKB A;  4A3D B;  1H9K A;  1EIF A;  3I90 A;  4RHR A;  3J81 j;  4QJF A;  1GD7 A;  2MO0 A;  2KEE A;  2E2J B;  1PRT C;  2QCP X;  5M3M B;  1FGB D;  3NPP A;  4BY1 G;  1RTN A;  1K83 H;  3A56 A;  5COR A;  3OYY A;  4B3R L;  1SE3 A;  5C5M A;  3CF5 A;  1I6H B;  4B3R Q;  3S17 B;  2WV6 D;  2VB3 X;  3ERS X;  2OT2 A;  3HOU H;  1KXL A;  4ME3 A;  2J0T D;  1SJE D;  2RQX A;  4LF5 L;  1FYC A;  3V96 A;  1MJE A;  1R4P B;  2A1A A;  4ZRZ A;  4LF5 Q;  4YCW A;  1LYL A;  3PF4 A;  3HOV B;  1O7L A;  3W1B A;  2R7Z H;  5GRO A;  2NN6 G;  3M9B A;  4PMW A;  4Y7N B;  3NTK A;  2AQ1 B;  1JOQ A;  3EJI A;  1GM5 A;  2ATW A;  4X6A H;  3PMF A;  5C4X B;  1PH5 A;  4HID A;  1Q7Y C;  3S2D B;  1MBY A;  4A75 A;  1SXT A;  3K59 A;  2XRQ D;  4A3J H;  4RCN A;  1V8Q A;  1DM0 B;  1HR0 L;  5NUC A;  1HR0 Q;  2WAC A;  2I5M X;  2KHI A;  3LGJ A;  1TWA H;  5IE8 A;  2AKW B;  4A3C G;  3ERO A;  3GP7 A;  1EYC A;  3N6R A;  4OX9 L;  3KJP A;  1QUQ A;  4OX9 Q;  5IY0 A;  1X3Q A;  1HNW L;  3DWP A;  5LL6 S;  4ID6 A;  1KHI A;  1HNW Q;  4NXN L;  3PO2 G;  3AFQ A;  2HQL A;  1A8V A;  2F0S A;  5JEA H;  4NXN Q;  1EIH A;  4A93 G;  2NUC A;  4KY7 A;  4RHS A;  3C1F A;  2F4V L;  3N52 A;  3PV0 A;  3HOZ G;  2F4V Q;  1C0A A;  1HHV A;  4BA1 I;  3I4M H;  2B39 A;  3NK9 A;  4DU9 A;  3L7Z C;  4FP5 D;  2B2V C;  1JOK A;  5I4D A;  4FF4 A;  1NBW A;  4EQO A;  2NVQ B;  1K3B C;  1QOH A;  4QCL A;  3I72 A;  5I2X A;  2Z6K C;  3FDT A;  4B3M L;  2EXZ A;  2M00 A;  2E76 C;  2UXC L;  4B3M Q;  2UXC Q;  1PFN A;  1ESF A;  2K5H A;  3QR8 A;  2K4K A;  1AP0 A;  1U4P A;  2KHJ A;  1Q90 A;  1NY4 A;  3TS2 A;  4GN4 B;  4R1J A;  1ESR A;  1L2F A;  2RKS A;  3I4O A;  5E4X A;  3KUP A;  2F0F A;  2K5D A;  4YCV A;  1PYS B;  4PZ6 A;  3TP6 A;  3Q23 A;  2Y0S E;  2O4X A;  1EQQ A;  3BU2 A;  2D2C C;  1EZ8 A;  4BY7 G;  1JIC A;  1X6O A;  2JXM B;  3OOC A;  2JA8 H;  1V43 A;  3FP9 A;  5DM7 3;  4A3I H;  1PHJ A;  4CBV A;  1I50 H;  5KEE A;  4FXD A;  2GN5 A;  1Q46 A;  3Q0A A;  3OHX C;  3PIP 3;  3D3R A;  2XTI A;  1H9R A;  1QJO A;  1JMC A;  3E5S A;  5HUR A;  5IGB A;  1G6P A;  1HCZ A;  1XXG A;  1WCM G;  2DJG C;  2VB2 X;  3RLN A;  5K36 H;  4IN3 A;  5ELN A;  2QIL A;  3T16 A;  2Y0S G;  1X3F A;  2IJ0 A;  1KTK A;  3K5M A;  4A3K G;  1VQ5 A;  1EQR A;  3H15 A;  2EYJ A;  2KED A;  3NBH B;  4FF1 A;  1V1P B;  4P72 A;  1STY A;  2A68 C;  2OQ0 A;  3I70 A;  3MHB A;  4JI1 L;  3JAM E;  4JI1 Q;  4LF9 L;  1ENF A;  1PXU A;  1EEI D;  1K8G A;  1LAB A;  5IOD A;  4LF9 Q;  1EYD A;  1PRT D;  2F3V A;  3EVQ A;  3SK5 A;  5FO8 B;  2F0K A;  1CSP A;  2Z4I A;  2JEB I;  4K6L A;  2K33 A;  4QY7 A;  3I4N G;  2I5H A;  3M3Y H;  4BY1 H;  3H0G B;  1QZH A;  3BDC A;  2ZXR A;  3K5L A;  4LUZ A;  1CKO A;  1PH1 A;  2YYZ A;  2L11 A;  3NBI A;  3NWS A;  3VA7 A;  2UXD L;  1ASZ A;  2UXB L;  4X64 L;  2UXD Q;  2UXB Q;  4X64 Q;  4HR7 B;  5EKI A;  4BY7 B;  1E2Z A;  2JN4 A;  5BN5 A;  5KNC A;  3HOW H;  4M8A A;  2N78 A;  2KA7 A;  2WAQ E;  4UHV A;  1TWH H;  1PFB A;  4YIJ A;  4P71 A;  2MFI A;  1A63 A;  2EY1 A;  3T13 A;  3F2B A;  4XXE A;  1S72 A;  5DEH A;  2XN9 C;  3T4A C;  4P2C B;  1I3Q H;  1AN8 A;  5C0X H;  3S14 B;  3PQI A;  4ILW A;  4HJ8 A;  4RGO S;  3O13 A;  1WTR A;  3KK7 A;  1P8L A;  4N8X 1;  2Y0S B;  1Y8O B;  3D6W A;  3P20 A;  1AFP A;  1B9N A;  1VMC A;  5CGK A;  4A3K B;  4BBS B;  2L4N A;  3NBH A;  2JSO A;  1G2S A;  1PRT B;  1AW7 A;  1SYB A;  2EDG A;  3EA6 A;  5JEA J;  2E8G A;  1VQJ A;  1VQM A;  2F3W A;  4K0K L;  3PO2 H;  1DYQ A;  1EOV A;  4K0K Q;  1ZKO A;  3OTO L;  1VS0 A;  3QO2 A;  2RDF A;  3OTO Q;  1YNJ C;  5CV9 A;  4RKL A;  2YTX A;  3TQY A;  1WI5 A;  4I7Z C;  4HAE A;  1UNS A;  1CKN B;  4R4I A;  1TR5 A;  3CCV A;  1KDB A;  4WRD A;  1WTQ A;  3FPP A;  4EGV A;  1EIY B;  5IP9 G;  2A6E D;  4IUR A;  1YJ9 A;  1DXM A;  2K5V A;  1U0L A;  4YWK A;  1A15 A;  4DK6 C;  4OON A;  2K52 A;  4CDE C;  3MAQ A;  1BVS A;  4KN7 C;  5AJ3 L;  1JOO A;  1YNN D;  3BVM A;  5AJ3 Q;  2SNS A;  2RSN A;  3TP7 A;  4FF2 A;  2E2I B;  3NWT A;  3RN5 A;  1U4M A;  3PUV A;  1BXT A;  3CQZ B;  4C3I B;  1D2B A;  3QOL A;  1STH A;  3CHB D;  2XIW A;  1OXX K;  2B2U A;  1EQT A;  2B2T C;  2D0P A;  2NBF A;  1GUO A;  1G2T A;  3W5O A;  4L5R C;  1MHW C;  3IRB A;  5HY6 A;  3SR1 A;  1G51 A;  1R9T B;  1IKL A;  1IYU A;  1LTR D;  2WAQ B;  3L0O A;  4HSP A;  3KBG A;  3OIQ A;  1NUC A;  3W3A A;  1LV9 A;  3SK8 A;  2Z1C A;  2RHQ B;  1GUS A;  2DNE A;  4UAI A;  2LY7 A;  1NNX A;  4KKS A;  2F0D A;  3OMG A;  5AFW A;  2R6G A;  4RMF A;  1DOK A;  2RF4 A;  5C4J H;  1CKN A;  5GAH C;  3UDI A;  1YJW A;  1NCV A;  2HD3 A;  1JE5 A;  3R2T A;  3AB9 A;  1EY9 A;  4GKK L;  3S2H H;  2NVT B;  1PYW D;  4FF3 A;  1SE2 A;  1I4P A;  1B9M A;  1HXY D;  2FJ2 A;  2A68 D;  4GKK Q;  3MVV A;  4MN3 A;  3GTO B;  1JWU D;  2F0E A;  3SXH A;  2R93 G;  4IPC A;  4GN5 A;  4L8J A;  4AIM A;  3RZD B;  2JJQ A;  1QE6 A;  3ND9 A;  5M9O A;  1K8O A;  4H7B A;  1I4R A;  3ONA B;  3V05 A;  1PV4 A;  3I4N H;  1STE A;  2IPK D;  2JK8 A;  4CKE A;  1ILQ A;  3SVM A;  1J9O A;  1BBX C;  1PFS A;  3H3V H;  4IUP A;  1U4R A;  3VR5 A;  1WD1 A;  3OW2 A;  2HT1 A;  1Q12 A;  1S3O A;  2R7D A;  3G6E A;  1LTI D;  3ZYY X;  2K32 A;  2EJG C;  2F52 A;  3E0E A;  3M85 A;  4BA2 I;  4JPB W;  4QGU A;  1HZ9 A;  4A3B H;  4ABN A;  4QF4 A;  4I65 A;  4KLK A;  3DMU A;  1RHP A;  3CRL C;  3R3O A;  5FJ8 H;  3TME A;  3QIA A;  2J4X A;  4IFD H;  1N9W A;  5ELC A;  4CHT B;  4LNQ A;  5C0X J;  3KDF A;  3ND8 A;  4A76 A;  1D1K A;  1IBK L;  5BR8 L;  1K28 A;  2N8N A;  1UAP A;  2OF1 A;  2B2V A;  5M5X H;  3NSW A;  5BR8 Q;  3HG9 A;  5C4Z A;  2EQS A;  1IBK Q;  2NVX B;  4OHJ A;  2F0J A;  5IGE A;  2Z6K A;  2EYH A;  1WTO A;  2I07 B;  4POF A;  5C44 H;  1PDQ A;  3RUZ A;  1VQK A;  2F1M A;  4NP5 A;  3W1G A;  2K5Q A;  3CME A;  4E6I A;  4XIG S;  1E24 A;  3KJO A;  2B2Y C;  4DV4 L;  1XNQ L;  1V9P A;  1A2U A;  4DV4 Q;  2CHB D;  1SMX A;  2ZXP A;  3F2D A;  5ELF A;  1LT4 D;  1K0S A;  1YNJ D;  2Q2H A;  5KYI A;  5E4W C;  1LT3 D;  4XYO A;  1OXT A;  1JB3 A;  3HOU G;  2JA7 G;  1EU4 A;  1SBB B;  1I4H A;  3CMA A;  1SE4 A;  1SND A;  5C0X I;  2E2H H;  4POG A;  4ZQ3 A;  2DY7 A;  4APV A;  4PMC A;  1J6Q A;  1Z6H A;  5KRU A;  1FGU A;  3DHQ A;  2R7Z G;  3TP8 A;  3MWY W;  2HIV A;  3A8J E;  1VDZ A;  5EQ0 A;  1PH3 A;  4KJO A;  3GQB A;  1Q1E A;  1SNQ A;  2EYP A;  4JYA L;  4JV5 L;  1O7I A;  4K2K A;  1VQ4 A;  4GLX A;  2VUM H;  4JV5 Q;  4JYA Q;  5E1F A;  1IBM L;  4N9T A;  3GTQ B;  5DAU A;  4K8I A;  1IBM Q;  2CW0 C;  4A3J G;  2F0G A;  4RWS C;  3Q6S A;  5T1G A;  1X32 A;  1L0Y B;  5C3E B;  1L1O C;  1OO9 B;  1OXV A;  3HRZ C;  4AH6 A;  1FJG L;  1LT5 D;  4DAM A;  1FJG Q;  1BCP C;  1O7Y A;  1SNM A;  3VYS A;  3PO3 H;  1E0B A;  1TWC H;  3FMC A;  2JA6 B;  4RGT A;  1D5X C;  4H0L C;  4RKB A;  1U5K A;  1Q81 C;  2VY3 A;  2PZU A;  5JEA G;  2JQO A;  2VS1 A;  2WB1 G;  1NR2 A;  2PYK A;  2AWO A;  1VQG A;  2KVM A;  3ULL A;  4A3M H;  3LX0 A;  2XWB B;  1ZEQ X;  1K83 B;  2GVB A;  4K5W A;  1V1Q A;  3I4M G;  4JI6 L;  2IWH A;  4X3T A;  4JI6 Q;  2SOB A;  1FNU A;  5HGT A;  1HNZ Q;  1HUN A;  2JP1 A;  3HOU B;  1E2V A;  3FKI G;  4IUU A;  1CA6 A;  2PW7 A;  4RAU C;  1VQH A;  1H95 A;  1LUZ A;  3MC0 B;  4ZKC B;  5C6A A;  3FEW X;  4UDU C;  5IYB H;  1HNX L;  1ZXT A;  1R4Q B;  4JVZ A;  3I91 A;  4GZY C;  1HNX Q;  3D4D A;  4DR3 L;  4RGM A;  2RSO A;  4DR3 Q;  1EL0 A;  1HZC A;  3S1N H;  1IZ6 A;  3IFT A;  1L0X B;  4TQU S;  1PVO A;  4V19 0;  4C3J H;  4DV0 L;  1E1O A;  2ZJP A;  3F8T A;  4DV0 Q;  2RA4 A;  5EJW A;  4QQB X;  3PUY A;  1FD7 D;  2F0W A;  5DNF A;  4OWT B;  3FRP B;  4A3J B;  1CZG A;  5KND A;  1HA5 A;  1X3P A;  1D5M C;  4LUV A;  4IJH A;  4KJN A;  4TSS A;  2JA8 G;  4AYB G;  1AH9 A;  2F0L A;  2IX0 A;  1TWA B;  4A3I G;  3GTP B;  1SNO A;  1PZK D;  3PGZ A;  3J81 i;  1WTP A;  1YHB A;  5C5L A;  3K7A B;  1CTM A;  3WOE A;  4IFD J;  4JI2 L;  1NR4 A;  4JI2 Q;  4XTC S;  1JWM D;  4LF7 L;  1T5E A;  3HKS A;  4LF7 Q;  1IW7 C;  5K36 G;  3GTK B;  2KBN A;  1RF2 D;  4XT1 B;  2ASB A;  3MZ5 A;  3DM1 A;  1TT2 A;  4IJL A;  5JJK A;  1DCZ A;  2O5J C;  1HQM C;  5EAY A;  1C9O A;  4C2M H;  4HCE A;  2SDF A;  3S15 B;  3H3V I;  1FR3 A;  2KCM A;  5M5Y B;  3HOX B;  1IYV A;  3RZO B;  1DGS A;  2OCE A;  3IAY A;  4F8M A;  3CU7 A;  3U58 A;  4YWM A;  2K6A A;  3QJY A;  3DEP A;  1FVI A;  2AUK A;  2H5X A;  4L5Q A;  4IFD I;  4U67 3;  3GTG B;  2B2T A;  1D1I A;  1DZ1 A;  2JA7 H;  4KMU C;  5JJZ A;  1EY8 A;  1F2Z A;  2F0I A;  4YHH L;  3VYR A;  5JPM C;  1KD1 C;  2ZTE A;  4JBJ A;  2J7Z A;  3SK4 A;  5FLX c;  4YHH Q;  4DR1 L;  3S16 B;  3VDY A;  2VZA A;  4DR1 Q;  1VQ7 A;  5M3F B;  3H3V C;  1MI2 A;  3HOW G;  3FHW A;  4JI4 L;  4JI4 Q;  2AQ2 B;  4PV1 C;  2F3I A;  5FKA C;  2K01 A;  1Y1W H;  1BQQ T;  3MEH A;  3BZD B;  2QGQ A;  1ML0 D;  1EFW A;  1MIU A;  5C0X G;  2H1E A;  2D5D A;  2ZJR A;  1SFO H;  1HUM A;  1M4V A;  2BE5 C;  1A0I A;  2CW0 D;  4HMJ A;  5DLQ E;  1BCP F;  3ULP A;  2IHF A;  1LTT D;  1Z47 A;  5IGG A;  5LMN W;  1LO5 D;  4RA8 A;  3AMU A;  1BCP D;  2KHS A;  1H9M A;  3NTH A;  4DV6 L;  1IHZ A;  1UE5 A;  4OL7 A;  3CCQ A;  4DV6 Q;  3RLF A;  4G7H C;  2MPM A;  4KK7 A;  3Q22 A;  3Q24 A;  4KY6 A;  2M2L A;  1E3P A;  5IOC A;  3J7Y W;  1UUP A;  1D5Z C;  5D65 A;  3J7Z C;  2I46 A;  3M3Y B;  3KF8 A;  4BY1 B;  2EYL A;  4NB3 A;  2HDM A;  1ROD A;  4F7X A;  1UE1 A;  1ZYR C;  4ULL A;  5D14 A;  2LS0 1;  3L2P A;  2JA5 H;  1EY5 A;  1ET6 A;  3U9O A;  3BS1 A;  1CK1 A;  1SLJ A;  4DPG A;  3FKI H;  3CC2 A;  1B3Q A;  4C3H H;  4DGZ A;  4LJZ C;  5CBE E;  3I8Z A;  2Q8T A;  5M5W H;  1BF4 A;  1TY2 A;  4RFB A;  4H44 C;  4HJ9 A;  2HHH L;  2R61 A;  3DUZ A;  2HHH Q;  1TWH B;  3X3N A;  3M4O B;  1KAA A;  4HMI A;  3CCL A;  4C56 C;  1PH4 A;  3I73 A;  3RD4 A;  1JCK B;  3CC7 A;  4OWX B;  1L1O B;  3EBE A;  1JWS D;  3EQL C;  5CC4 A;  4L5S A;  2VQF L;  1BCP B;  4NXM L;  4IUN A;  2VQF Q;  5C3W A;  4NXM Q;  4JW0 A;  3CW2 C;  4JI5 L;  4LMQ D;  1IKM A;  4JI5 Q;  1B3A A;  3CPF A;  1ILP A;  2CWP A;  2B2Y A;  3NHH A;  2RHS B;  3HOY H;  3PIO A;  5ELE A;  2F0H A;  4IPG A;  3BYT B;  3PO2 B;  1VQN A;  5LMN L;  2N3S A;  3M7N A;  2A74 C;  4A93 B;  3F2C A;  1M90 C;  1QNK A;  5LMN Q;  1IW7 D;  3K57 A;  4OIK A;  3LNN A;  3Q8D A;  3HOZ B;  5HGQ A;  1VQP A;  1EOT A;  1KRS A;  2NZO A;  1HQR D;  1L0W A;  4EX5 A;  1YHQ A;  3QWN A;  1PTO H;  1BR9 A;  2CCZ A;  4DNT B;  4IAL A;  1CZW A;  2PCF B;  4A3F G;  1CA5 A;  1J8I A;  1N32 L;  3S2D H;  1N32 Q;  1T9H A;  1KAW A;  3CCS A;  3I56 A;  2L15 A;  3IFD A;  3CXC A;  4R4C A;  4BXX G;  1L1O A;  2K50 A;  3W2D A;  2DJF C;  1MGS A;  5IGC A;  4HJ5 A;  2EZV A;  2ZJQ A;  4KD4 A;  1LLR D;  4KHP L;  1X56 A;  3NXW A;  2ICE C;  4Y52 H;  1CHP D;  1TU2 B;  4A3B G;  2DUD A;  4UP8 A;  4KHP Q;  4HIO A;  1JQY D;  1EY4 A;  1XJV A;  4OGQ C;  2H4O A;  1B8A A;  5FJ8 G;  4YWL A;  4IOC A;  3A74 A;  2OTL A;  4LF8 L;  4IFD G;  3T1Y L;  1AZP A;  3J81 c;  2IX3 A;  4LF8 Q;  5J1Z A;  4DUY L;  4HJ7 A;  1F9R A;  3NE5 B;  3T1Y Q;  3K5N A;  3D6C A;  2NVQ H;  2YTY A;  4MTK A;  2BE5 D;  2FHT A;  1QB5 D;  1VMP A;  4ME5 A;  4UPA A;  1WCM B;  2CKZ B;  2R92 H;  5C44 G;  4J6H A;  2OTJ A;  2CQO A;  1UE7 A;  1I5F A;  4J1M A;  5C4H A;  4G57 A;  5IP7 H;  4XYQ A;  3S2H B;  2BH8 A;  2OQK A;  3I2Z A;  4DK1 A;  1D6E C;  2EYO A;  1J5E L;  1YIT A;  4DR7 L;  1J5E Q;  1SRU A;  1HH2 P;  4DR7 Q;  5GAE C;  3C46 A;  3E6Z X;  1F9S A;  2R7F A;  2R3Z A;  4I7A A;  4GNX C;  2RDH A;  4Q5V A;  1WFQ A;  3U4V A;  3URY A;  3MA2 B;  2XNA C;  2UUC L;  1JJG A;  2A73 B;  2LXK A;  3I4N B;  2UUC Q;  2CVR A;  1WTH A;  1CHQ D;  1H9S B;  2YU9 H;  4KV6 A;  1ZYR D;  3J7A F;  3UDF A;  4DV3 L;  3B6Y A;  5D3I B;  4KY5 A;  4DV3 Q;  2XRS D;  1JT8 A;  4B3T L;  5JJL A;  4KHZ A;  4B3T Q;  4TVA B;  3CRK C;  5H1S E;  1B70 B;  1QNU A;  3KF6 B;  2RBM A;  3MFY A;  1NE3 A;  4DF7 A;  4A3G H;  4XQJ A;  4OWW B;  4NMZ A;  2VUM G;  2ZTC A;  1QZG A;  2NVY B;  5IT9 c;  1WTW A;  3VR3 A;  4ZUJ A;  1UE6 A;  3G71 A;  3OW7 A;  3KBX A;  2D9U A;  2MO1 A;  3K7U C;  5M5X B;  4RH6 A;  3NQT A;  5IYD G;  2HCI A;  3RN2 A;  3HKZ G;  2ALY B;  3GO5 A;  4DNI A;  3PO3 G;  4N9P A;  3A8I E;  3BDL A;  2LXJ A;  3H09 A;  1WYD A;  1B44 D;  3EIV A;  3M4P A;  3MXP A;  3M4Q A;  4X3S A;  3J80 i;  3K8A A;  3EN2 A;  1ICF B;  1KDA A;  4ZCK A;  3NEN A;  4MHE A;  2BA1 A;  1Q8I A;  3KDF B;  4A3M G;  2D62 A;  3ICE A;  2L12 A;  2IL8 A;  2L5T A;  4JC0 A;  1U4L A;  4X66 L;  4JI0 L;  2Q2T A;  1VCI A;  4X66 Q;  1VQI A;  4JI0 Q;  1QVG A;  3S1M H;  1TWF H;  4DXF A;  4LK1 C;  4DKA C;  1H9S A;  4MTN A;  3CPW A;  4G7Z C;  2E2H B;  2MUY A;  5D3D A;  1WTV A;  1LTS D;  4GLV B;  3A7L A;  2EY2 A;  1RD9 D;  4DA2 A;  3ITP A;  5IYB G;  1JOR A;  1GXD C;  3BZC A;  2QF7 A;  4A3F H;  4DAY B;  1W2B A;  3KF6 A;  4H02 A;  1EWI A;  2JE6 I;  1RTO A;  3A8K E;  2L1B A;  3MEF A;  4C3J G;  1ICW A;  3MXN B;  1QVC A;  4A3E G;  1WVL A;  1KIX A;  1LT6 D;  2K28 A;  2A19 A;  2MJ8 A;  4UY8 C;  4JG2 A;  4BBS H;  3H94 A;  4BXX H;  1EY0 A;  4WJW A;  4JBK A;  2N49 A;  1XTC D;  2PPB C;  5JJI A;  1PZJ D;  1VF7 A;  4GS3 A;  2ZTD A;  4LWC A;  1G29 1;  2N88 A;  2IY5 B;  2LMC B;  2EY5 A;  3PO3 B;  1JJC B;  1PYB A;  1ET9 A;  2F0P A;  4RCO A;  1SR3 A;  2V4D A;  2FMC A;  3LWE A;  1XYI A;  1HTP A;  4A3M B;  4IPH A;  1EYG A;  2CH4 W;  2ZXO A;  5CBA E;  4K5X A;  1S40 A;  1F2Y A;  3DLL A;  3UE0 A;  4NW2 A;  3CKI B;  3TP5 A;  1P16 A;  3PUX A;  4GN3 B;  1DON A;  1Y8N B;  2B29 A;  3QB3 A;  2CFM A;  2RDG A;  2Z0S A;  4F88 A;  5A2Q L;  1K9M C;  2DNC A;  5IT9 L;  2LFN A;  4DR6 L;  1PTO C;  4DFA A;  2R93 B;  2HUG A;  4QMG A;  4DR6 Q;  3CQZ H;  4DV1 L;  2K75 A;  4IPD A;  1XNQ Q;  3MTS A;  4DAY A;  4JI7 L;  1QIL A;  4BWG B;  4DV1 Q;  1ASY A;  4JI7 Q;  3S1N B;  2C9O A;  2F0U A;  3OWE B;  4R8N A;  4HIM A;  3MXN A;  1VQL A;  2MQH A;  1BBW A;  2PI2 E;  5J22 A;  1S5C D;  2EVB A;  1XMQ L;  3T56 B;  4BBR H;  1CI3 M;  2VL6 A;  1CFM A;  5J3B A;  1R9T H;  1ONL A;  3CCE A;  4ZAI A;  3M4Y A;  3K5O A;  2EY6 A;  2QDB A;  3GTL H;  3OMC A;  4EQ5 A;  1B7Y B;  4L63 B;  3A55 A;  1Y1W G;  2ICI A;  2WB1 E;  3VR2 A;  4FDB A;  3TS0 A;  2BOS A;  4PQX A;  3AYH B;  4RG1 A;  4CGY B;  3TBI B;  5A35 A;  5JAV A;  3GTJ B;  2NVT H;  2AWN A;  1G6Z A;  4P73 A;  1Q3L A;  1TS4 A;  4X62 L;  2UUA L;  1B50 A;  4X62 Q;  2UUA Q;  1MJC A;  2B8F A;  5IYD H;  1TS2 A;  3RZD H;  5IGD A;  1SYF A;  3WWV A;  5IYC G;  4C2M B;  3BJU A;  2KEN A;  1XPR A;  4GNX B;  1FNV A;  1CT1 D;  3C2P A;  4PZ7 A;  2FIN B;  2Q2I A;  4L5T A;  1TWG H;  3NEL A;  3DM3 A;  3E9H A;  3RNU A;  1E1T A;  5GAG C;  3PCO B;  3D0F A;  2AHO B;  1BUV T;  1X3G A;  2JA5 G;  2KOL A;  3C1E A;  2F0N A;  3NTI A;  2JA7 B;  2PMZ E;  4C3H G;  2CQA A;  4LW1 A;  4XQN A;  1BBU A;  4X3U A;  2EPB A;  1AE3 A;  4AYB E;  2FMM A;  1TVX A;  3S1Q H;  1GO3 E;  2R7Z B;  1VQA A;  3R2I A;  4OO1 H;  2P5Z X;  4CJ2 C;  4WFN 3;  3JAM i;  1PA6 A;  4R4O A;  2NVX H;  4QL5 A;  4ZYS A;  1HJP A;  4DAV A;  5KGU A;  2B63 H;  1EIG A;  1EYA A;  4NPS A;  4A3E H;  3A7A B;  2CH4 A;  2K05 A;  1QVF A;  1A62 A;  1SN8 A;  5JVG 3;  3OSO A;  4TKO B;  1EU3 A;  4A3D G;  1VQD A;  3MFG A;  2B2W C;  1QG7 A;  4O2D A;  2G9D A;  2GVA A;  5M3M G;  2O5I C;  2PQA A;  1CUK A;  1JE4 A;  1RIP A;  3HOY G;  3AEV A;  1N33 L;  4DR4 Q;  1VQ6 A;  4IZ8 A;  3V2T A;  1N33 Q;  4JOI C;  3J7A 5;  1EEF D;  5CMD A;  4GNX A;  1KLU D;  1VQC A;  4K2L A;  2WB1 B;  3KYH C;  3G48 A;  1BOS A;  1STG A;  3J80 c;  1IBL L;  2WFW A;  2X6L A;  1EY7 A;  1A3U A;  1IBL Q;  3T1H L;  3I4M B;  3D4W A;  1EFI D;  3TN2 A;  4IUV A;  3G7L A;  2JA5 B;  1YI2 A;  1PTO F;  3FKI B;  4C3H B;  1LTG D;  1Y8P B;  1CM9 A;  5C4X G;  1PTO D;  1YHA A;  1QCB D;  5JPN C;  2ZM6 L;  1NJI C;  3KLS A;  4MNO A;  2XWJ B;  2ZM6 Q;  2EIF A;  2Q8R E;  3TZD A;  3CCM A;  4EVO A;  5C3E H;  2VW9 A;  2VXW A;  3HGB A;  3KF8 B;  1HRJ A;  4DN4 M;  1WD0 A;  1EY6 A;  3K58 A;  1K73 C;  3KLS X;  3GV3 A;  1SYE A;  3AU7 A;  2JA6 H;  5GAD C;  4BS9 A;  2WII B;  2PI2 A;  2PMZ B;  3A0J A;  1SYC A;  2MNA A;  3CC4 A;  1SYG A;  4QUC A;  2JA8 B;  4AYB B;  4HCS A;  3STB C;  2Z9H A;  1B1Z A;  4A3I B;  3HOY B;  5FLX E;  5FOB B;  1I50 B;  1PH2 A;  1XPO A;  2GA4 B;  2L55 A;  4CDF C;  2OWO A;  1YEZ A;  1II3 A;  1Y1V H;  1CSQ A;  4DUZ L;  3PIP A;  4LF6 L;  1Q1B A;  3KLW A;  4DUZ Q;  2Z4H A;  4LF6 Q;  2A5H A;  2R92 G;  4PMB A;  3A5U A;  3TSS A;  3VYU A;  4S3S A;  3GTM H;  2X6G A;  3F2U A;  1PZI D;  4K5V A;  5IP7 G;  1EWC A;  3K0Y A;  1PTO B;  1D7Q A;  3HEJ A;  3K80 C;  5IYC H;  3I4L A;  3HS0 C;  2PO4 A;  3D31 A;  2KCN A;  3CCR A;  2G5D A;  1LAC A;  5KNB A;  2E5L L;  2WIN B;  2QA4 A;  4Q0F A;  2E5L Q;  4HSV A;  1KNE A;  4P74 A;  2K03 A;  4DXG A;  4QB4 A;  1F9Q A;  1E22 A;  3GTP H;  3AFP A;  3UI2 A;  3K7A H;  2DGY A;  4KTA A;  3P75 A;  3WDN A;  4GKJ L;  1PLF A;  1SRO A;  2E74 C;  4R9W A;  1S5F D;  2A6H C;  4GKJ Q;  1GJX A;  4NKL A;  4OXP A;  1BO0 A;  3A54 A;  2IW3 A;  3VR4 A;  5IIF A;  1N8R C;  2SNM A;  4DR2 L;  1IL8 A;  3D4R A;  1A2T A;  1LM0 A;  4DR2 Q;  4B3S L;  2V1C C;  2CWA A;  4B3S Q;  1MSH A;  1SMY C;  3ERQ A;  3J80 L;  2Q8I B;  3HOW B;  4A3G G;  3GTK H;  1K8A C;  1ENC A;  4IQZ A;  2AQ3 B;  2NB0 A;  1X54 A;  1C48 A;  5C3X A;  3I55 A;  3FPU B;  1W6J A;  3KOJ A;  1I3Q B;  1DOM A;  3S1R H;  1X65 A;  3TDQ A;  3CCU A;  1X55 A;  3S15 H;  2LSS A;  4DR5 L;  2NZH A;  2A6E C;  5L37 A;  3SHL A;  1GUT A;  3ZJY C;  5M5Y H;  3HOX H;  4DR5 Q;  4GOP C;  4A3D H;  2R92 B;  3RZO H;  4ODG A;  1GUW A;  3TRE A;  4FXK C;  2RCN A;  1PH9 A;  1VQ8 A;  4QUF A;  2E2J H;  5M3M H;  1YNN C;  4K8J A;  1Y69 U;  1C4Q A;  3H0G G;  5JVH 3;  1S4Z A;  4CDC C;  1YZ6 A;  2X69 A;  1I6H H;  3NP8 A;  1RCV D;  3S17 H;  3GTG H;  2XGT A;  1V1O A;  1X9N A;  1TXY A;  3U4Z A;  5FLM H;  4OO1 I;  3EFX D;  2F4I A;  3S16 H;  2PNH A;  4L6T B;  1N34 L;  2UU9 L;  3HOV H;  5KYL A;  3VR6 A;  4EQP A;  5M3F H;  2YU9 B;  4AQY L;  1N34 Q;  3BVG A;  5EPJ A;  5FLX L;  5F2D A;  2UU9 Q;  4AQY Q;  3R93 A;  4A3L H;  1XPU A;  3K6O A;  1S5B D;  2FXQ A;  1OXS C;  1B4O A;  4OEM B;  4Y7N H;  2KJX A;  4X65 L;  5ELD A;  3L3O C;  5FO9 B;  3F1Z A;  2KQ3 A;  4X65 Q;  4HTH A;  3CCJ A;  3UE1 A;  4FXG C;  4ZLT F;  4R4T A;  5C4X H;  2A69 C;  2EE1 A;  4O0A A;  1BDO A;  1YNX A;  4DV5 L;  4A3G B;  1HZB A;  4YCU A;  1CKM A;  4DV5 Q;  4DV2 L;  1G8Z D;  1SE8 A;  1F2L A;  3UDX A;  4DV2 Q;  1XX8 A;  3BDO A;  3JAM c;  4BBS G;  2EJM A;  1RJT A;  1TII D;  2ID0 A;  1VQF A;  1NSN S;  3CAM A;  3OIP A;  1PRT F;  4F87 A;  5ELB A;  4LUO A;  1H9J A;  1NMG A;  1SSO A;  3SDZ A;  1SNP A;  4DV7 L;  1GHK A;  5CV6 A;  5K5P A;  4DV7 Q;  2E75 C;  2JYO A;  2QKI C;  3AQQ A;  4KN4 C;  2IX1 A;  3STB D;  3QOJ A;  2C35 B;  4A4I A;  1RKN A;  1GUN A;  5DM6 3;  1XMO L;  2F0Q A;  2RCF A;  1XMO Q;  3HZX A;  1B2T A;  1S5D D;  3KLR A;  4LAA A;  3J7A V;  2NWG A;  2K7V A;  3HFZ B;  3SE0 A;  4DUY Q;  4ZK9 B;  4FO2 A;  1I94 L;  4R8I A;  2F0O A;  3J81 E;  2Q2U A;  1TS5 A;  1PH6 A;  1I94 Q;  2KEC A;  1DD2 A;  3S1M B;  5EKK A;  1TWF B;  3OPO A;  5C4J B;  1PFM A;  5FK9 C;  1LTA D;  2WP8 J;  3PUW A;  5LMU L;  2NN6 H;  3M4O H;  3E3X A;  1JB7 A;  5LMU Q;  4HED A;  4XQQ A;  2KCC A;  3SGI A;  1HA6 A;  2NYZ D;  2VQE L;  5CV8 A;  1D8L A;  2VQE Q;  4C3I G;  4ALP A;  4A3F B;  2K5N A;  4KI0 A;  2O2L D;  3M7G A;  3OWF A;  4JK1 C;  1C7Y A;  1UWV A;  3ER0 A;  2Z6B A;  2BDN A;  3PIO 3;  2K5W A;  3UDG A;  2N55 A;  2QEJ C;  2TMP A;  2ZT9 C;  1NTG A;  2B2W A;  2K04 A;  4J8Q A;  4NDX A;  4BBR G;  4A3C H;  4FNF A;  1PH8 A;  4JI3 L;  1V1P A;  2WAQ G;  4X3K A;  4ZUI A;  4JI3 Q;  2A6H D;  3HKZ E;  1CQV A;  2ENB A;  4OEL B;  4JOI A;  4A93 H;  1IXR A;  3HP3 A;  1SMY D;  4A3B B;  3PF5 A;  1IYJ B;  4CKB A;  4LFC L;  3HOZ H;  1Q86 C;  4LFC Q;  1LTB D;  3G6J B;  3I3C A;  2AUJ D;  5EPK A;  2MP1 A;  3G4S A;  5A2Q E;  5COY A;  1MSG A;  4KKU A;  5IT9 E;  1VQO A;  4R4Q A;  3FVQ A;  3T53 B;  2DN8 A;  3MXG A;  1UEB A;  1F2M A;  1TQO A;  4J15 A;  1FNW A;  2C5C A;  5I6Y A;  2NTT A;  1KC8 C;  3GD7 A;  3CP0 A;  5C44 B;  5CR3 A;  1STN A;  5I2Y A;  3NQI A;  5BN4 A;  1KQS A;  2F03 A;  3RLO A;  1Q82 C;  3CD6 A;  4KHV A;  4IO9 A;  3H0G H;  4IOA A;  2F0V A;  1K3R A;  4JI8 L;  1C8C A;  2HCC A;  3JAM L;  3TZU A;  4JCV E;  4JI8 Q;  2HDL A;  2BDO A;  1E2W A;  4UP7 A;  3A5Z B;  3SEB A;  4V0B A;  4BY7 H;  1GOZ A;  2L9H A;  3K0X A;  1FL0 A;  1NAP A;  4BBR B;  3S24 A;  4FVM A;  1A3T A;  2MGS A;  4G7O C;  1T5X D;  3JC6 6;  4CJ1 B;  3RMH A;  3GTL B;  1WTX A;  2SEB D;  3R8B A;  4OO1 G;  3J81 L;  2A69 D;  4IUQ A;  3S14 H;  1KLG D;  1KRT A;  1VQB A;  3RR5 A;  1G91 A;  1YVC A;  3I7F A;  4CJ0 B;  1N36 L;  1WCM H;  2B63 G;  1N36 Q;  2EYF A;  3VA5 A;  1M8A A;  4UP9 A;  2VUM B;  4N8F A;  1K8M A;  2L0C A;  2UUB L;  4GOP B;  1CQF A;  2UUB Q;  3E0J A;  2BCO A;  4A3K H;  4LFA L;  1Z7T A;  3NEM A;  4HIK A;  2B8G A;  2OEO A;  1VQE A;  1JR0 D;  5FO7 B;  4LFA Q;  5GQO A;  5CV4 A;  3BYY B;  3BZK A;  1W6K A;  3HKZ B;  4B08 A;  2ES2 A;  1HFG A;  1TWC B;  4WJ3 M;  5G3L F;  3GDE A;  5CV7 A;  2LKV A;  3U9S A;  1O78 A;  1TWG B;  1XNR L;  1K0R A;  2K1B A;  1EUJ A;  4PNY A;  4OIJ A;  5G3L D;  3IKJ A;  1W3S A;  1XNR Q;  2F0T A;  2BA0 A;  2G9H D;  4MZ9 A;  1ENA A;  1I6V C;  4P75 A;  4XT3 B;  2Z8L A;  1LTL A;  2EYM A;  5T1I A;  1PH7 A;  1E7Z A;  2IT1 A;  3K81 C;  1TY0 A;  1RDP D;  4KKT A;  2NVY H;  4MIU A;  5I6W A;  2JEA I;  2EOT A;  1HFN A;  3D8G A;  1NMF A;  3S1Q B;  2E2I H;  1SEB D;  2A8V A;  4JBM A;  1O7Z A;  4LFB L;  4C3I H;  5EGT A;  1YIJ A;  4LFB Q;  1KL9 A;  2DY8 A;  5C3E G;  3PSI A;  3PUZ A;  2D0O A;  2B63 B;  1S5E D;  1WJJ A;  1B53 A;  4C3J B;  4A3E B;  1YJN A;  3WOF A;  2JA6 G;  4GOP A;  3GV6 A;  1KDC A;  1DOL A;  4GLA C;  1XMQ Q;  2EXD A;  1HPC A;  1HZA A;  3P7J A;  5JOB A;  3TEH B;  1U9R A;  2EJF C;  2HIX A;  2I0Q A;  1QWY A;  4PZ8 A;  1JC7 A;  2NN6 I;  1OTC A;  4QIW E;  3DXJ C;  1Q8K A;  3NUC A;  1JJ2 A;  5EKL A;  2K14 A;  1Y1V G;  4C1N I;  2KUM A;  2AMC B;  4DK3 C;  4B9X A;  4WOR A;  5ISR A;  2QEX A;  1GHJ A;  5IGF A;  3GTO H;  1KAB A;  1F77 A;  2I5L X;  5EBD A;  2YV5 A;  5LHY 1;  1OXU A;  4ZKB B;  5IP9 H;  1Y14 B;  1GVP A;  5E7N A;  2PQA B;  3BVZ A;  1SAP A;  2HQE A;  4RGN A;  1XWE A;  3QG1 A;  4DNR B;  1Z9F A;  2RVL A;  2PZT A;  2WKC A;  3X3M A;  1AE2 A;  3ULJ A;  2QW7 A;  1IL2 A;  1MD2 D;  5I9P A;  3L9A X;  1BNZ A;  4HJA A;  1HTL D;  3MXU A;  3P1H A;  2VNU D;  1TKW B;  2PZW A;  1DJR D;  2PNR C;  5EPL A;  3DWQ A;  1I4G A;  2FFK B;  4G4K A;  4U68 A;  4O42 A;  2XVS A;  1MKH A;  1SJH D;  2M9V A;  2JA9 A;  1KNA A;  4HN7 A;  3DEO A;  1SDF A;  3LWU A;  1I4Q A;  2BH2 A;  1I4X A;  1TS3 A;  4JBW A;  1EWH A;  1X3E A;  2YTV A;  1HNZ L;  2MHV A;  1Y1W B;  3S9W A;  1A3V A;  1PMR A;  1YBY A;  1M1K C;  4CDD C;  3TRZ A;  4KD3 A;  3VYT A;  5EBC A;  1Y1V B;  2PQE A;  1SFO B;  1AZQ A;  1GUG A;  4O1N A;  1GKH A;  2NTS A;  5IWA L;  3HOX G;  2OXP A;  5IWA Q;  3T51 B;  2NZ1 D;  2R93 H;  2F0M A;  3GTM B;  5I9O A;  1STA A;  5CYU A;  4EQN A;  3E9I A;  4B9W A;  3SK6 A;  1SYD A;  1UEA B;  4QIW B;  4K6D A;  1EQV A;  5CV5 A;  2QDL A;  5FLM G;  1WOC A;  1STB A;  4CKC A;  5J39 A;  3C3L A;  3IL8 A;  3HOV G;  5M3F G;  3J80 E;  1RL2 A;  2E2D C;  4DK0 A;  3T1H Q;  2PW5 A;  3H91 A;  5TSS A;  4A3L G;  1O80 A;  4WJ4 A;  1AEX A;  5ELO A;  1F9P A;  4DR4 L;  2B3G A;  1HR0 W; 
#chains in the Genus database with same CATH homology
 5BN3 A;  4C1N K;  5E3F A;  5M5W B;  4FYD A;  4H13 C;  2XSC A;  4IUT A;  4K14 A;  1EZ6 A;  3DWA A;  2TSS A;  3H6M A;  4DAP A;  1A6X A;  4TRD A;  2WKD A;  2B2U C;  3S1R B;  1SNC A;  4XDX A;  3BG3 A;  4Z9C B;  4M1U B;  5LL6 X;  1VF5 C;  5KIX A;  4A3D B;  1H9K A;  3I90 A;  4RHR A;  2KEE A;  2E2J B;  1PRT C;  2QCP X;  5M3M B;  1FGB D;  3NPP A;  1RTN A;  3A56 A;  5COR A;  1SE3 A;  5C5M A;  1I6H B;  3S17 B;  2WV6 D;  2VB3 X;  2OT2 A;  2J0T D;  1SJE D;  2RQX A;  1FYC A;  3V96 A;  1R4P B;  4ZRZ A;  3HOV B;  1O7L A;  2NN6 G;  4PMW A;  4Y7N B;  3NTK A;  2AQ1 B;  1JOQ A;  3EJI A;  3PMF A;  5C4X B;  3S2D B;  1MBY A;  1SXT A;  3K59 A;  2XRQ D;  4RCN A;  1V8Q A;  1DM0 B;  5NUC A;  2WAC A;  3ERO A;  3GP7 A;  1EYC A;  3N6R A;  1X3Q A;  3DWP A;  5LL6 S;  4ID6 A;  2F0S A;  5JEA H;  1EIH A;  2NUC A;  4KY7 A;  4RHS A;  3C1F A;  3N52 A;  3PV0 A;  1HHV A;  4BA1 I;  2B39 A;  3NK9 A;  4DU9 A;  3L7Z C;  4FP5 D;  2B2V C;  1JOK A;  5I4D A;  4FF4 A;  4EQO A;  2NVQ B;  1QOH A;  4QCL A;  3I72 A;  5I2X A;  3FDT A;  2EXZ A;  2M00 A;  2E76 C;  1PFN A;  1ESF A;  1AP0 A;  1U4P A;  1Q90 A;  1ESR A;  2RKS A;  5E4X A;  3KUP A;  2F0F A;  2K5D A;  3TP6 A;  3Q23 A;  2O4X A;  2D2C C;  1EZ8 A;  1JIC A;  2JXM B;  3OOC A;  1V43 A;  5DM7 3;  4CBV A;  5KEE A;  4FXD A;  3Q0A A;  3OHX C;  3PIP 3;  3D3R A;  1H9R A;  1QJO A;  3E5S A;  5HUR A;  5IGB A;  1HCZ A;  1XXG A;  2VB2 X;  5K36 H;  4IN3 A;  2QIL A;  3T16 A;  2IJ0 A;  1KTK A;  3K5M A;  2EYJ A;  2KED A;  4FF1 A;  1V1P B;  1STY A;  2A68 C;  3I70 A;  3MHB A;  3JAM E;  1ENF A;  1PXU A;  1EEI D;  1LAB A;  5IOD A;  1EYD A;  1PRT D;  2F3V A;  3EVQ A;  3SK5 A;  5FO8 B;  2F0K A;  2Z4I A;  2JEB I;  4K6L A;  2K33 A;  3H0G B;  3BDC A;  2ZXR A;  3K5L A;  2YYZ A;  2L11 A;  3NBI A;  3NWS A;  3VA7 A;  4HR7 B;  5EKI A;  4BY7 B;  1E2Z A;  5BN5 A;  5KNC A;  4M8A A;  2KA7 A;  1PFB A;  4YIJ A;  2EY1 A;  3T13 A;  4XXE A;  5DEH A;  2XN9 C;  3T4A C;  4P2C B;  1AN8 A;  5C0X H;  3S14 B;  4ILW A;  4RGO S;  3O13 A;  1WTR A;  3KK7 A;  2Y0S B;  1Y8O B;  3D6W A;  3P20 A;  1AFP A;  1B9N A;  1VMC A;  5CGK A;  4A3K B;  4BBS B;  2L4N A;  3NBH A;  2JSO A;  1G2S A;  1PRT B;  1AW7 A;  1SYB A;  2EDG A;  3EA6 A;  5JEA J;  2F3W A;  1DYQ A;  1ZKO A;  3QO2 A;  2RDF A;  1YNJ C;  5CV9 A;  4RKL A;  4I7Z C;  4HAE A;  1UNS A;  1TR5 A;  1KDB A;  4WRD A;  1WTQ A;  3FPP A;  4EGV A;  2A6E D;  4IUR A;  1DXM A;  1A15 A;  3MAQ A;  4KN7 C;  1JOO A;  1YNN D;  3BVM A;  2SNS A;  2RSN A;  3TP7 A;  4FF2 A;  2E2I B;  3NWT A;  1U4M A;  3PUV A;  1BXT A;  3CQZ B;  4C3I B;  1D2B A;  3QOL A;  1STH A;  3CHB D;  2XIW A;  1OXX K;  2B2U A;  1EQT A;  2B2T C;  2NBF A;  1GUO A;  1G2T A;  1R9T B;  3SR1 A;  1IKL A;  1IYU A;  1LTR D;  2WAQ B;  4HSP A;  3KBG A;  3OIQ A;  1NUC A;  3W3A A;  1LV9 A;  3SK8 A;  2Z1C A;  1GUS A;  2DNE A;  4UAI A;  2LY7 A;  4KKS A;  2F0D A;  3OMG A;  5AFW A;  2R6G A;  1DOK A;  1NCV A;  3R2T A;  3AB9 A;  1EY9 A;  2NVT B;  1PYW D;  4FF3 A;  1SE2 A;  1I4P A;  1B9M A;  1HXY D;  2FJ2 A;  2A68 D;  3MVV A;  4MN3 A;  3GTO B;  1JWU D;  2F0E A;  3SXH A;  4L8J A;  3RZD B;  1QE6 A;  3ND9 A;  5M9O A;  1K8O A;  4H7B A;  1I4R A;  3ONA B;  3V05 A;  1STE A;  2IPK D;  4CKE A;  1ILQ A;  3SVM A;  1J9O A;  1BBX C;  4IUP A;  1U4R A;  3VR5 A;  1WD1 A;  1Q12 A;  1LTI D;  3ZYY X;  2K32 A;  2EJG C;  3M85 A;  4BA2 I;  4ABN A;  4QF4 A;  4I65 A;  3DMU A;  1RHP A;  3CRL C;  3R3O A;  3TME A;  3QIA A;  2J4X A;  4IFD H;  5ELC A;  4CHT B;  5C0X J;  3ND8 A;  1D1K A;  1UAP A;  2OF1 A;  2B2V A;  2NVX B;  3NSW A;  3HG9 A;  5C4Z A;  4OHJ A;  2F0J A;  5IGE A;  2EYH A;  1WTO A;  2I07 B;  1PDQ A;  3RUZ A;  2F1M A;  4NP5 A;  2K5Q A;  4E6I A;  4XIG S;  2B2Y C;  1A2U A;  2CHB D;  2ZXP A;  5ELF A;  1LT4 D;  1YNJ D;  5KYI A;  5E4W C;  1LT3 D;  4XYO A;  1OXT A;  1JB3 A;  1EU4 A;  1SBB B;  1I4H A;  1SE4 A;  1SND A;  5C0X I;  4ZQ3 A;  2DY7 A;  4PMC A;  1Z6H A;  5KRU A;  3DHQ A;  3TP8 A;  3MWY W;  3A8J E;  1VDZ A;  5EQ0 A;  4KJO A;  3GQB A;  1Q1E A;  1SNQ A;  2EYP A;  4K2K A;  5E1F A;  4N9T A;  3GTQ B;  5DAU A;  4K8I A;  2CW0 C;  2F0G A;  4RWS C;  3Q6S A;  5T1G A;  1X32 A;  1L0Y B;  5C3E B;  1OO9 B;  1OXV A;  3HRZ C;  1LT5 D;  1BCP C;  1O7Y A;  1SNM A;  3VYS A;  1E0B A;  3FMC A;  2JA6 B;  4RGT A;  1D5X C;  4H0L C;  4RKB A;  2PZU A;  5JEA G;  1NR2 A;  2PYK A;  2AWO A;  2KVM A;  3LX0 A;  2XWB B;  1ZEQ X;  1K83 B;  4K5W A;  2IWH A;  4X3T A;  2SOB A;  1FNU A;  5HGT A;  1HUN A;  2JP1 A;  3HOU B;  1E2V A;  4IUU A;  1CA6 A;  2PW7 A;  4RAU C;  3MC0 B;  4ZKC B;  5C6A A;  3FEW X;  4UDU C;  1ZXT A;  1R4Q B;  3I91 A;  4GZY C;  3D4D A;  4RGM A;  2RSO A;  1EL0 A;  3IFT A;  1L0X B;  4TQU S;  4V19 0;  2RA4 A;  5EJW A;  3PUY A;  1FD7 D;  2F0W A;  5DNF A;  3FRP B;  4A3J B;  1CZG A;  5KND A;  1HA5 A;  1X3P A;  1D5M C;  4KJN A;  4TSS A;  2F0L A;  2IX0 A;  1TWA B;  3GTP B;  1SNO A;  1PZK D;  1WTP A;  5C5L A;  3K7A B;  1CTM A;  3WOE A;  4IFD J;  1NR4 A;  4XTC S;  1JWM D;  1T5E A;  1IW7 C;  5K36 G;  3GTK B;  1RF2 D;  4XT1 B;  3MZ5 A;  3DM1 A;  1TT2 A;  1DCZ A;  2O5J C;  1HQM C;  4HCE A;  2SDF A;  3S15 B;  1FR3 A;  5M5Y B;  3HOX B;  1IYV A;  3RZO B;  3IAY A;  4F8M A;  3CU7 A;  2K6A A;  3QJY A;  3DEP A;  2AUK A;  4IFD I;  4U67 3;  3GTG B;  2B2T A;  1D1I A;  1DZ1 A;  4KMU C;  5JJZ A;  1EY8 A;  1F2Z A;  2F0I A;  3VYR A;  5JPM C;  2J7Z A;  3SK4 A;  3S16 B;  5M3F B;  3H3V C;  1MI2 A;  2AQ2 B;  4PV1 C;  5FKA C;  2K01 A;  1BQQ T;  3MEH A;  3BZD B;  1ML0 D;  5C0X G;  2H1E A;  2D5D A;  1HUM A;  1M4V A;  2BE5 C;  2CW0 D;  4HMJ A;  1BCP F;  1LTT D;  1Z47 A;  5IGG A;  1LO5 D;  4RA8 A;  3AMU A;  1BCP D;  2KHS A;  1H9M A;  3NTH A;  1IHZ A;  4G7H C;  4OL7 A;  3RLF A;  2MPM A;  4KK7 A;  3Q22 A;  3Q24 A;  4KY6 A;  2M2L A;  5IOC A;  3J7Y W;  1UUP A;  1D5Z C;  5D65 A;  2I46 A;  3M3Y B;  3KF8 A;  4BY1 B;  2EYL A;  2HDM A;  1ROD A;  4F7X A;  1ZYR C;  4ULL A;  5D14 A;  2LS0 1;  1EY5 A;  1ET6 A;  3U9O A;  3BS1 A;  1CK1 A;  4DGZ A;  4LJZ C;  5CBE E;  3I8Z A;  2Q8T A;  1BF4 A;  1TY2 A;  4RFB A;  4H44 C;  2R61 A;  3DUZ A;  1TWH B;  3X3N A;  3M4O B;  1KAA A;  4HMI A;  4C56 C;  3I73 A;  3RD4 A;  1JCK B;  1JWS D;  3EQL C;  5CC4 A;  1BCP B;  4IUN A;  5C3W A;  4LMQ D;  1IKM A;  1B3A A;  1ILP A;  2B2Y A;  3NHH A;  5ELE A;  2F0H A;  3BYT B;  3PO2 B;  3M7N A;  2A74 C;  4A93 B;  1QNK A;  1IW7 D;  3K57 A;  4OIK A;  3LNN A;  3HOZ B;  1EOT A;  1HQR D;  3QWN A;  1PTO H;  1BR9 A;  4DNT B;  4IAL A;  1CZW A;  2PCF B;  1CA5 A;  1J8I A;  3IFD A;  3W2D A;  1MGS A;  5IGC A;  2EZV A;  4KD4 A;  1LLR D;  2ICE C;  3NXW A;  1CHP D;  1TU2 B;  1JQY D;  1EY4 A;  4OGQ C;  2H4O A;  4IFD G;  1AZP A;  2IX3 A;  5J1Z A;  1F9R A;  3NE5 B;  3K5N A;  3D6C A;  2BE5 D;  2FHT A;  1QB5 D;  1VMP A;  4ME5 A;  1WCM B;  4J6H A;  4J1M A;  5C4H A;  4G57 A;  4XYQ A;  3S2H B;  4DK1 A;  1D6E C;  2EYO A;  3C46 A;  3E6Z X;  1F9S A;  2R3Z A;  2RDH A;  4Q5V A;  3URY A;  3MA2 B;  2XNA C;  2A73 B;  3I4N B;  2CVR A;  1CHQ D;  1H9S B;  4KV6 A;  1ZYR D;  3J7A F;  5D3I B;  4KY5 A;  2XRS D;  4KHZ A;  3CRK C;  1QNU A;  2RBM A;  3MFY A;  4DF7 A;  4XQJ A;  4NMZ A;  2NVY B;  1WTW A;  3VR3 A;  4ZUJ A;  3OW7 A;  3KBX A;  2D9U A;  5M5X B;  4RH6 A;  3NQT A;  2HCI A;  3GO5 A;  4N9P A;  3A8I E;  3BDL A;  3H09 A;  1B44 D;  3MXP A;  4X3S A;  1KDA A;  4MHE A;  2BA1 A;  1Q8I A;  2D62 A;  2L12 A;  2IL8 A;  2L5T A;  1U4L A;  1VCI A;  4DXF A;  4LK1 C;  1H9S A;  4G7Z C;  2E2H B;  2MUY A;  5D3D A;  1WTV A;  1LTS D;  3A7L A;  2EY2 A;  1RD9 D;  4DA2 A;  3ITP A;  1JOR A;  1GXD C;  2QF7 A;  2JE6 I;  1RTO A;  3A8K E;  2L1B A;  4C3J G;  1ICW A;  1WVL A;  1LT6 D;  2K28 A;  2MJ8 A;  3H94 A;  1EY0 A;  4WJW A;  1XTC D;  2PPB C;  1PZJ D;  1VF7 A;  1G29 1;  2N88 A;  2LMC B;  2EY5 A;  3PO3 B;  2F0P A;  1ET9 A;  4RCO A;  2V4D A;  2FMC A;  3LWE A;  1XYI A;  1HTP A;  4A3M B;  2ZXO A;  5CBA E;  4K5X A;  1F2Y A;  4NW2 A;  3CKI B;  3TP5 A;  3PUX A;  1DON A;  1Y8N B;  3QB3 A;  2RDG A;  5A2Q L;  4F88 A;  2DNC A;  5IT9 L;  2LFN A;  1PTO C;  4DFA A;  2R93 B;  2HUG A;  4QMG A;  3MTS A;  4DAY A;  1QIL A;  4BWG B;  3S1N B;  2C9O A;  2F0U A;  3OWE B;  4R8N A;  3MXN A;  5J22 A;  1S5C D;  2EVB A;  3T56 B;  1CI3 M;  1CFM A;  1ONL A;  4ZAI A;  3M4Y A;  3K5O A;  2EY6 A;  2QDB A;  3OMC A;  4L63 B;  3A55 A;  2ICI A;  3VR2 A;  2BOS A;  4PQX A;  4CGY B;  3TBI B;  5A35 A;  5JAV A;  3GTJ B;  2AWN A;  1G6Z A;  1Q3L A;  1TS4 A;  1B50 A;  2B8F A;  1TS2 A;  5IGD A;  1SYF A;  4C2M B;  1FNV A;  1CT1 D;  3C2P A;  2FIN B;  1BUV T;  2KOL A;  3C1E A;  2F0N A;  3NTI A;  2JA7 B;  4C3H G;  2CQA A;  4XQN A;  4X3U A;  2EPB A;  2FMM A;  1TVX A;  2R7Z B;  3R2I A;  4OO1 H;  4CJ2 C;  4WFN 3;  4ZYS A;  4DAV A;  5KGU A;  1EIG A;  1EYA A;  3A7A B;  2K05 A;  5JVG 3;  3OSO A;  4TKO B;  1EU3 A;  3MFG A;  2B2W C;  1QG7 A;  2G9D A;  2O5I C;  1JE4 A;  4IZ8 A;  3V2T A;  1EEF D;  5CMD A;  1KLU D;  4K2L A;  2WB1 B;  1BOS A;  1STG A;  2X6L A;  1EY7 A;  1A3U A;  3I4M B;  3D4W A;  1EFI D;  3TN2 A;  4IUV A;  3G7L A;  2JA5 B;  1PTO F;  3FKI B;  4C3H B;  1LTG D;  1Y8P B;  1CM9 A;  1PTO D;  1QCB D;  5JPN C;  3KLS A;  2XWJ B;  2Q8R E;  3TZD A;  4EVO A;  2VXW A;  3HGB A;  1HRJ A;  4DN4 M;  1WD0 A;  1EY6 A;  3K58 A;  3KLS X;  3GV3 A;  1SYE A;  3AU7 A;  4BS9 A;  2WII B;  2PMZ B;  1SYC A;  1SYG A;  4QUC A;  2JA8 B;  4AYB B;  4HCS A;  1B1Z A;  4A3I B;  3HOY B;  5FLX E;  5FOB B;  1I50 B;  2GA4 B;  2L55 A;  1II3 A;  1Q1B A;  2Z4H A;  2A5H A;  4PMB A;  3TSS A;  3VYU A;  4S3S A;  2X6G A;  3F2U A;  1PZI D;  4K5V A;  1EWC A;  3K0Y A;  1PTO B;  3HEJ A;  3I4L A;  3HS0 C;  2PO4 A;  3D31 A;  2KCN A;  1LAC A;  5KNB A;  2WIN B;  4Q0F A;  4HSV A;  1KNE A;  2K03 A;  4DXG A;  4QB4 A;  1F9Q A;  3UI2 A;  4KTA A;  3P75 A;  3WDN A;  1PLF A;  2E74 C;  4R9W A;  1S5F D;  2A6H C;  1GJX A;  4NKL A;  1BO0 A;  3A54 A;  5IIF A;  2IW3 A;  3VR4 A;  2SNM A;  1IL8 A;  3D4R A;  1A2T A;  1MSH A;  1SMY C;  3ERQ A;  3J80 L;  2Q8I B;  3HOW B;  1ENC A;  4IQZ A;  2AQ3 B;  2NB0 A;  1C48 A;  5C3X A;  3FPU B;  1W6J A;  1I3Q B;  1DOM A;  3TDQ A;  2A6E C;  3SHL A;  1GUT A;  2R92 B;  1GUW A;  4ODG A;  4FXK C;  4QUF A;  1Y69 U;  4K8J A;  1YNN C;  1C4Q A;  5JVH 3;  1S4Z A;  2X69 A;  3NP8 A;  1RCV D;  1V1O A;  4OO1 I;  3EFX D;  2F4I A;  4L6T B;  5KYL A;  3VR6 A;  4EQP A;  2YU9 B;  3BVG A;  5EPJ A;  5FLX L;  5F2D A;  3R93 A;  3K6O A;  1S5B D;  1OXS C;  1B4O A;  2KJX A;  5ELD A;  3L3O C;  5FO9 B;  2KQ3 A;  4HTH A;  4FXG C;  4ZLT F;  2A69 C;  2EE1 A;  1BDO A;  4A3G B;  1G8Z D;  1F2L A;  1XX8 A;  3BDO A;  2EJM A;  1RJT A;  1TII D;  2ID0 A;  1NSN S;  3OIP A;  1PRT F;  4F87 A;  5ELB A;  1H9J A;  1SSO A;  3SDZ A;  1SNP A;  1GHK A;  5CV6 A;  5K5P A;  2E75 C;  2JYO A;  2QKI C;  4KN4 C;  2IX1 A;  3QOJ A;  1RKN A;  1GUN A;  5DM6 3;  2F0Q A;  3HZX A;  1B2T A;  1S5D D;  3KLR A;  4LAA A;  3J7A V;  2NWG A;  2K7V A;  3SE0 A;  4ZK9 B;  4FO2 A;  4R8I A;  2F0O A;  3J81 E;  1TS5 A;  2KEC A;  1DD2 A;  3S1M B;  5EKK A;  1TWF B;  3OPO A;  5C4J B;  1PFM A;  5FK9 C;  1LTA D;  2WP8 J;  3PUW A;  2NN6 H;  4HED A;  4XQQ A;  2KCC A;  1HA6 A;  2NYZ D;  5CV8 A;  4C3I G;  4A3F B;  4KI0 A;  2O2L D;  3M7G A;  3OWF A;  4JK1 C;  2BDN A;  3PIO 3;  2K5W A;  2N55 A;  2QEJ C;  2TMP A;  2ZT9 C;  2K04 A;  2B2W A;  4J8Q A;  4NDX A;  4FNF A;  1V1P A;  4X3K A;  4ZUI A;  2A6H D;  1CQV A;  2ENB A;  3HP3 A;  1SMY D;  4A3B B;  4CKB A;  1LTB D;  3G6J B;  3I3C A;  2AUJ D;  5EPK A;  2MP1 A;  5A2Q E;  5COY A;  1MSG A;  4KKU A;  5IT9 E;  3FVQ A;  3T53 B;  2DN8 A;  3MXG A;  1F2M A;  1TQO A;  1FNW A;  2C5C A;  5I6Y A;  2NTT A;  3GD7 A;  5C44 B;  5CR3 A;  1STN A;  5I2Y A;  3NQI A;  5BN4 A;  2F03 A;  4KHV A;  2F0V A;  1C8C A;  2HCC A;  3JAM L;  3TZU A;  2HDL A;  2BDO A;  1E2W A;  3SEB A;  4V0B A;  1GOZ A;  2L9H A;  1NAP A;  4BBR B;  4FVM A;  1A3T A;  2MGS A;  4G7O C;  1T5X D;  4CJ1 B;  3GTL B;  3RMH A;  1WTX A;  2SEB D;  3R8B A;  4OO1 G;  3J81 L;  2A69 D;  4IUQ A;  1KLG D;  1G91 A;  4CJ0 B;  2EYF A;  3VA5 A;  1M8A A;  2VUM B;  1K8M A;  2L0C A;  1CQF A;  3E0J A;  2BCO A;  1Z7T A;  2B8G A;  2OEO A;  5FO7 B;  1JR0 D;  5CV4 A;  3BYY B;  1W6K A;  3HKZ B;  4B08 A;  1HFG A;  1TWC B;  5G3L F;  5CV7 A;  2LKV A;  3U9S A;  1O78 A;  1TWG B;  2K1B A;  4PNY A;  4OIJ A;  5G3L D;  3IKJ A;  2F0T A;  2BA0 A;  2G9H D;  1ENA A;  1I6V C;  4XT3 B;  2Z8L A;  2EYM A;  5T1I A;  2IT1 A;  1TY0 A;  1RDP D;  4KKT A;  4MIU A;  5I6W A;  2JEA I;  2EOT A;  1HFN A;  3D8G A;  3S1Q B;  1SEB D;  1O7Z A;  5EGT A;  2DY8 A;  3PUZ A;  2B63 B;  1S5E D;  1B53 A;  4C3J B;  4A3E B;  3WOF A;  3GV6 A;  1KDC A;  1DOL A;  1HPC A;  3P7J A;  5JOB A;  1U9R A;  2EJF C;  1QWY A;  1JC7 A;  2NN6 I;  3DXJ C;  3NUC A;  5EKL A;  4C1N I;  2KUM A;  4B9X A;  4WOR A;  5ISR A;  1GHJ A;  5IGF A;  1KAB A;  1F77 A;  5EBD A;  5LHY 1;  1OXU A;  4ZKB B;  3BVZ A;  1SAP A;  2HQE A;  4RGN A;  1XWE A;  3QG1 A;  4DNR B;  2RVL A;  2PZT A;  2WKC A;  3X3M A;  1MD2 D;  5I9P A;  3L9A X;  1BNZ A;  1HTL D;  3MXU A;  3P1H A;  2VNU D;  1TKW B;  2PZW A;  1DJR D;  2PNR C;  5EPL A;  3DWQ A;  1I4G A;  4U68 A;  2FFK B;  4G4K A;  4O42 A;  2XVS A;  1SJH D;  2M9V A;  1KNA A;  4HN7 A;  3DEO A;  1SDF A;  3LWU A;  1I4Q A;  1I4X A;  1TS3 A;  4JBW A;  1EWH A;  2MHV A;  1Y1W B;  3S9W A;  1A3V A;  1PMR A;  4KD3 A;  3VYT A;  5EBC A;  1Y1V B;  2PQE A;  1SFO B;  1AZQ A;  1GUG A;  4O1N A;  2NTS A;  2OXP A;  3T51 B;  2NZ1 D;  2F0M A;  3GTM B;  5I9O A;  1STA A;  5CYU A;  4EQN A;  4B9W A;  3SK6 A;  1SYD A;  1UEA B;  4QIW B;  4K6D A;  1EQV A;  5CV5 A;  1STB A;  4CKC A;  5J39 A;  3C3L A;  3IL8 A;  3J80 E;  2E2D C;  4DK0 A;  2PW5 A;  3H91 A;  5TSS A;  1O80 A;  1AEX A;  1F9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...