2VB3X

Crystal structure of ag(i)cusf
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords CATION EFFLUX SYSTEM PROTEIN CUSF
publication title Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vb3X01
1ZEQX 2L55A 3E6ZX 2VB2X 2QCPX 2VB3X 3TDQA
chains in the Genus database with same CATH superfamily
1FVIA 4RGOS 1S5CD 5DM73 1STAA 3M4OH 4DNRB 2R6GA 4DK3C 5JVH3 4M8AA 4GKKQ 4Y52H 5C4HA 4DU9A 2H1EA 1TQOA 4AYBG 1LT6D 4DAVA 1Z7TA 2JA8G 3U4VA 3CMAA 4NMZA 1BCPC 4GZYC 4IUQA 3M4OB 1SRUA 2R61A 2F0EA 3KDFB 1HQMC 4LF9L 1SFOH 2B2VA 1GUTA 2LS01 4ME5A 3ITPA 3STBD 1FJGQ 3PIO3 5BR8L 1JOOA 1YIJA 4LK1C 4ZQ3A 4GOPB 4BBSH 5C4XG 4BA2I 2A8VA 1SNMA 1TWFH 1UUPA 3MFYA 1B70B 1Q1EA 1PYWD 2XNAC 3NELA 4C56C 1GUWA 1V1QA 1V1PA 1HUMA 4O2DA 1QUQB 1DJRD 2K04A 1FD7D 3W5OA 1NNXA 4BBSB 1LTSD 4IFDG 2HD3A 3V96A 2WB1E 2JXMB 4BY7G 1YJNA 1PH1A 5IODA 4Y7NH 1CHPD 3TN2A 2RCFA 4C3HG 1GHJA 3D31A 4PZ8A 1GM5A 1Z47A 3RZOB 4DV4L 3RLNA 4L6TB 3ULJA 2EJFC 4LFBQ 2K5HA 4Y7NB 3AMUA 1ZYRD 5KRUA 4LFAQ 3KJOA 3J81c 1SYDA 5HGTA 1EIFA 2N49A 4BWGB 4K0KL 5C0XG 1ML0D 1NJIC 5KNCA 4MHEA 1RTNA 2DJFC 3TP6A 4A3IG 1JOQA 3GV3A 1LUZA 1CQVA 2PQEA 1J6QA 5A2QL 4ID6A 3KOJA 2JA9A 1S5FD 4BY1H 3PQIA 3EN2A 5E1FA 4N9PA 1ESFA 3OIPA 5C6AA 1VQNA 4JK1C 3NXWA 1A62A 3I4NH 1YZ6A 4G7ZC 2M9VA 4CDCC 3FPUB 3LWUA 1KRSA 4FF2A 1B1ZA 3D4RA 1O7YA 1E2ZA 1E3PA 1IKLA 1EL0A 4MZ9A 1FGBD 1K0SA 2JJQA 5IGBA 1NTGA 1OXSC 3RUZA 1VQOA 2SDFA 4RHRA 1B50A 2VB2X 1NMFA 1Q86C 3E5SA 5JEAH 1E0BA 1PH3A 1CZWA 5ELCA 4RWSC 1KLUD 4JI0L 3L9AX 2UUCL 2HDMA 5LMUL 2Z0SA 3CF5A 2AMCB 3D3RA 2RKSA 2XWBB 1TS5A 3J7AV 2B63H 3D6WA 1D6EC 4OX9L 1X3GA 2IW3A 5IYBH 4HIKA 4HJ8A 1PH5A 2WAQE 1C8CA 1MGSA 3UDFA 1B9NA 2CVRA 2Y0SE 2EXZA 2I5LX 2MQHA 2PI2E 3NTIA 4LF5Q 3EA6A 2B63B 4KK7A 1YNJC 4S3SA 4TSSA 4JI3L 1V43A 4JI2L 1EWHA 2E74C 2OQ0A 5D3IB 3H3VC 5EQ0A 3NQIA 4R4QA 4MN3A 5J22A 1N33L 3PUZA 1NUCA 4K5WA 1RHPA 4LF9Q 1RCVD 4R8NA 1SNQA 1VQGA 3MEFA 2Z6KA 3PGZA 5L37A 3Q6SA 1QG7A 1PTOC 3K0XA 5BR8Q 2SNMA 1E2WA 3F2UA 1BF4A 2ES2A 4P73A 1EIYB 4HSVA 4TQUS 1LT4D 1PLFA 1QVGA 3J81i 1SJHD 2AHOB 2X6GA 2F0LA 3BDCA 3CCVA 3TRZA 3CCUA 2NN6I 1STGA 3C2PA 2NZHA 2VQFQ 3NHHA 4F88A 1VQBA 2CCZA 2QEJC 3T13A 4FP5D 4K8JA 3T1YL 1J8IA 4DV4Q 5CV9A 3NEMA 1UAPA 1O7IA 2EIFA 5GADC 5G3LF 2QEXA 1ILQA 4HN7A 4B3SL 4KKSA 5T1IA 2FMCA 4U68A 2CKZB 3PUYA 1U4LA 3KFUA 1GO3E 1RIPA 3CKIB 4K0KQ 4A3GH 4RAUC 1Q8IA 1QZGA 3MAQA 2PNHA 2MUYA 1J5EL 4C2MB 1SSOA 5M3MB 1VQDA 3NTKA 1JE4A 3NPPA 1PRTB 4P75A 3ULLA 3NK9A 5CV7A 2DY8A 4FXDA 1X3QA 5J3BA 5K36G 4A3GB 1OXUA 1U4RA 1QCBD 1WTHA 2F0UA 4EGVA 2F0NA 1KDAA 4NXMQ 3HEJA 4ZKBB 1YNJD 1YNXA 4JBJA 1NR2A 3KYHC 1EZ8A 3S1MH 3CW2C 4DAMA 2F52A 1Q7YC 4A93H 5AFWA 5FOBB 1S72A 1F9RA 1S4ZA 1PRTF 2Z6KC 5E3FA 3I70A 2VXWA 4H44C 3I4LA 1I3QH 3PSIA 1EQVA 1JQYD 3DEOA 3S1MB 2E5LL 4O42A 2EJMA 4A93B 4L5RC 3HOUH 3KJPA 4JI0Q 4LF6L 1O78A 1XPOA 3F8TA 5LMUQ 2CFMA 1I3QB 4X65Q 1SNPA 5E7NA 3GTQB 4C3IH 4OGQC 2NB0A 3F2CA 1EEID 4NKLA 4CDFC 1JICA 1WCMG 4OX9Q 5KNBA 1QE6A 3HOUB 2ALYB 2XVSA 3VYSA 2KECA 1X32A 2F0GA 1AE3A 1D2BA 5IP9H 1EOTA 5IGGA 2F0KA 3A7LA 4CGYB 1MSGA 4C3IB 3CRLC 4DV2Q 2WAQB 3R2IA 4JI3Q 1CA5A 1GUSA 4V190 3K8AA 1OXVA 2Y0SB 1EFID 1HNWL 2KUMA 1EU4A 3IAYA 4GN5A 2F0OA 2IX0A 2RQXA 3GTJH 1I5FA 1JJ2A 4A3BG 1A0IA 4N8X1 4XQJA 4RA8A 3CC7A 2NVQH 2AQ2B 2K03A 4HJ5A 1DM0B 3BZCA 1SYBA 3MXNB 3GTMH 4FXGC 4HR7B 2IPKD 2HCIA 2K5DA 4UP8A 1VQ7A 3T51B 1BVSA 4DUZL 4J15A 2OT2A 2I46A 2RDGA 3Q8DA 1M8AA 4C1NI 2WV6D 3T53B 1VQCA 2CH4W 4IUVA 2VY3A 4KKTA 4HIOA 2NVQB 1T5XD 3BYTB 3GTMB 2JA6H 2K1BA 1LTRD 1EEFD 5IGCA 3SEBA 4GNXC 5C0XI 4GKJL 1L1OC 1DD2A 4IJHA 4ALPA 1CUKA 1D5MC 1LT5D 1Q1BA 3T1YQ 2EYMA 4K2LA 3MWYW 1CKNA 4RMFA 3NENA 4JYAL 5EGTA 2IHFA 1NAPA 1HFGA 5JJKA 3DMUA 1VQMA 1XMOQ 4B3SQ 3UDGA 5IT9L 2JA8H 4KHZA 5DLQE 2I0QA 1STBA 1TWGB 4X66L 3H6MA 4L5QA 4Q5VA 5D14A 1J5EQ 1TWCH 3CP0A 1IYJB 2F0TA 1LLRD 1XNRL 2JA8B 3CC4A 2K5NA 1TVXA 2JK8A 2JQOA 5C4XH 3HG9A 4DR1Q 3GV6A 3J81E 2IX1A 2RBMA 3KF6A 3CXCA 1CA6A 3G4SA 2YTXA 1GKHA 2C35B 1TT2A 4ZUJA 3DWPA 5GROA 3HOYG 1ASZA 3J7YW 3S14B 4IFDH 4ME3A 2F1MA 2BCOA 1ILPA 1FJGL 4HIDA 3E6ZX 3AB9A 2B2WA 4IO9A 2JEBI 2A69C 4FVMA 3S1QH 4C3HH 2K28A 1WJJA 1K8MA 3OIQA 5KIXA 1U5KA 5C44G 2M00A 5EKIA 1I4HA 4DV7L 3GQBA 2BH8A 4LNQA 4IPHA 4DV1L 1QB5D 4QGUA 1JT8A 4P72A 1WVLA 2CH4A 1HZBA 1G2TA 2PCFB 2B2UA 2EYJA 5D65A 5LMNW 1UE6A 4HAEA 4C3HB 3LX0A 1QNKA 5C0XH 2L5TA 3JAME 2NVTH 4X6AH 2VUMG 4B3RL 3A55A 2E2JH 1QWYA 1H9JA 4XT3B 2F0MA 1RTOA 2LXJA 3S15H 2EXDA 1VMPA 1KC8C 2NVTB 2V4DA 4OONA 5A35A 2A19A 1S3OA 3K0YA 3PV0A 1UNSA 3U9OA 3FKIG 4A75A 2Z6BA 1K83H 4IUPA 1AZPA 1HR0L 2E2JB 2Q8TA 2LY7A 2X6LA 2A73B 3PCOB 3A54A 3S15B 3I72A 2I5MX 3K81C 2QDLA 5FO7B 4ABNA 3Q0AA 1B8AA 4PMWA 2ZTEA 1YI2A 5CV4A 1YJWA 5FLXc 3SHLA 4DV6L 5FO9B 4G7OC 4JC0A 2AQ3B 1L2FA 4PG3A 4BXXG 1YHAA 4JI6Q 4KLKA 3K5NA 1EY4A 1VQ6A 4PQXA 2G9DA 5HURA 2EY6A 2AWOA 3G6EA 2OTJA 4CBVA 5FO8B 1BO0A 1WD1A 2KCCA 3HKZE 1HCZA 3DM3A 3K57A 4KJNA 2Z9HA 3VYTA 5M3FG 4QUFA 4POGA 4GKJQ 1G6ZA 2F4VQ 2A69D 4H0LC 3EVQA 4IALA 1A3TA 3J7A5 1ESRA 4JYAQ 4QB4A 1GUOA 2PW5A 4ZAIA 1E1TA 4JI7L 4A3FG 2ICEC 2JP1A 1LO5D 2Q2TA 2B2UC 3AFQA 4C1NK 4X66Q 2UUBL 1HPCA 4BA1I 3TS0A 1VQKA 1EYCA 3O13A 3TQYA 2LMCB 4YHHL 1DGSA 4KV6A 2E75C 5C3EB 3PO2G 4JBKA 1XNRQ 4IPCA 2ZJQA 3X3NA 2IJ0A 4LF5L 3I8ZA 3CCEA 4CJ2C 2Q2HA 3A8JE 2GVAA 3G7LA 1IXRA 1AN8A 3K80C 1Y1WH 4LFCL 4DR3L 1OTCA 1OO9B 1SE8A 1KAWA 1WOCA 1B4OA 3LNNA 1TS4A 1IBKQ 3MXUA 1WTRA 3CRKC 3FPPA 3A5UA 5FLXL 3M7NA 1EY0A 3R3OA 5C5LA 2DNCA 3SR1A 1Y1WB 4KY7A 3M9BA 1PH2A 1TWHH 4DNIA 2EZVA 1X9NA 4DV7Q 4PNYA 1SFOB 4FF3A 2L1BA 4DV1Q 4ZCKA 2E2IH 2JN4A 3ERSX 2H4OA 5IYDG 3QB3A 1DZ1A 1QILA 3C46A 5COYA 4PZ7A 2F0HA 4DK6C 1TWHB 2QF7A 2QCPX 1M90C 2UXCL 1Z9FA 3H0GG 2VQFL 1IBLQ 4LUVA 1TWFB 3KUPA 5CR3A 1AZQA 3G6JB 1CQFA 4OWXB 1Y14B 1LYLA 2MP1A 4QJFA 4B3RQ 4DN4M 4MTNA 2RF4A 2PQAA 3GD7A 5I2YA 5K36H 2ATWA 1K28A 1S5BD 2K14A 2BE5C 2B2TC 1TS3A 4N8FA 1E2VA 5DNFA 4A3EG 2XWJB 1P16A 3CPFA 1HR0Q 3A5ZB 2ZJPA 3KBGA 5JJLA 1HZ9A 3FHWA 1FNWA 4IOAA 3KLRA 1Y1VG 2Z1CA 2EDGA 1A8VA 2JA5G 1X6OA 1JMCA 3R93A 1BUVT 4A3KG 4RH6A 1KD1C 3WOFA 2KEEA 1CT1D 1D1KA 2F0DA 1BCPB 4DV6Q 1JCKB 2K7VA 4OHJA 4FNFA 4BBRG 1N34L 2BOSA 4XDXA 4XQNA 2VW9A 4NXML 3K7AH 3WOEA 2RHSB 4M1UB 3OPOA 2IX3A 3GTGH 2B29A 3ONAB 1C9OA 1SMXA 1GXDC 3J80c 1E22A 1BCPD 1PHJA 4BY1B 4LMQD 4JVZA 3ZJYC 2F0SA 1A63A 3BDLA 1U4MA 2ZTDA 3L3OC 4ILWA 3MXGA 1BBUA 3I4NB 2HCCA 1WCMH 3GTGB 1JC7A 3HKZB 4KY5A 2R3ZA 5CGKA 2UXDL 4EQNA 2HT1A 1OXTA 2FJ2A 3D4DA 1S5DD 5JAVA 4ULLA 3IRBA 3U4ZA 3A8IE 2BA0A 4L63B 4K2KA 2UU9L 3TEHB 4DR7L 4RKBA 4JI7Q 2QW7A 3S17H 1GUGA 2DY7A 4L5SA 3MVVA 4JCVE 4X65L 2R7ZG 1B3AA 2QDBA 2OQKA 3H91A 3TS2A 1E7ZA 1CSPA 5M5XH 2UUBQ 1JB3A 2IL8A 2JA7H 3H3VI 4FXKC 5IGEA 3PF5A 4A3BH 4OIKA 4YHHQ 2K75A 3DLLA 2NVYH 1UE7A 5IYCH 2K5WA 1I6HH 1VQAA 4C3JG 5JPMC 3K7UC 3PIP3 3P1HA 3S17B 1CZGA 1IYUA 1XTDA 3KF8A 2QKIC 1D5XC 1PA6A 1HNZL 4DV2L 2JA7B 3L2PA 4NB3A 1WYDA 3CD6A 1TR5A 2F0QA 3SVMA 5J39A 1PYSB 1IKMA 4LFCQ 3QG1A 2NVYB 4DR3Q 4ZLTF 4DV0L 3RN2A 1I6HB 2ZXRA 1HZCA 1P8LA 1EWCA 2R93H 2DN8A 4HJ9A 1EY6A 2DGYA 4KMUC 1PH6A 2V1CC 5BN3A 4YWMA 2Q2IA 4X64L 1XJVA 1B7YB 4YWKA 1K8GA 2WINB 1H9SA 2J4XA 2DNEA 1MHWC 2JSOA 4R4CA 3SE0A 1R9TH 5C3WA 2E2HH 2UUAQ 3ERQA 4I7ZC 2R93B 4ZYSA 5CV6A 4B9XA 1VDZA 5JPNC 1PFBA 3D8GA 3J80L 1STHA 2C9OA 1AW7A 3NSWA 2PYKA 3GTKH 4LAAA 3PUXA 3AEVA 4XXEA 2ZM6Q 2F3IA 2UXCQ 1R9TB 4RFBA 4OELB 5ELNA 3VA7A 1PDQA 3RLOA 4RKLA 2NZ1D 2XSCA 1K8AC 1BBWA 2I5HA 3NE5B 4CJ0B 3GTKB 4LW1A 1LTLA 3S2DH 1V1PB 5IP7G 1SMYC 3CCSA 2EY2A 2TSSA 4FYDA 1EQTA 3BYYB 3M3YH 3D4WA 4Q0FA 3HOXG 2BH2A 1MJEA 1XMOL 3J80i 2CWPA 2KHSA 3H3VH 4A3CG 4AYBE 4CKEA 1NMGA 2ASBA 3M4PA 3HOYH 3S2DB 2D2CC 3CQZH 3S24A 2TMPA 3DWAA 2A1AA 2IY5B 4IZ8A 1PTOH 3BVZA 1X65A 3S9WA 2E8GA 3PIPA 2F0IA 3T56B 1LTID 1H9RA 4H02A 4LF7L 4DR1L 3NBHA 5NUCA 2OXPA 1F2MA 4KJOA 3QOLA 1N34Q 1TXYA 2HHHL 3I4MG 1RL2A 4IUUA 2B39A 2NTTA 3CQZB 3I7FA 3KLSX 4F87A 3UDIA 4V0BA 1I50H 4YWLA 1PTOB 2CQOA 5EAYA 3SXHA 5CORA 1XPUA 2F3VA 3EBEA 4GNXA 1L1OA 2D5DA 2J0TD 4RG1A 4DUYL 2WKDA 1KHIA 4NPSA 1LABA 2RCNA 3GTOH 1A6XA 3I3CA 4PMCA 3CCRA 1KNEA 2HQLA 2VUMH 1I50B 1PTOD 3HRZC 3E9IA 2UXDQ 1AFPA 1PZJD 2I07B 2FXQA 1NR4A 2KA7A 1RJTA 1AP0A 2NYZD 2NWGA 1VQLA 2OCEA 2EY5A 3NUCA 4XQQA 2ZXOA 1JJGA 5EPLA 1PZKD 3FKIH 2VUMB 2UU9Q 3S16H 4DR7Q 1PTOF 5CC4A 5IT9c 3VR6A 2GA4B 3Q23A 1Y69U 1SEBD 2FINB 2WACA 4N9TA 4IUNA 1WTOA 1ET6A 1WFQA 3FKIB 3S16B 3NTHA 5BN4A 1SNOA 3BS1A 1SJED 1EZ6A 1HNZQ 1PV4A 5ELEA 3CCJA 1KIXA 5M5YH 1EY5A 3MTSA 5IGDA 1EY7A 3L7ZC 4J6HA 4DV0Q 1SR3A 4QMGA 1I94L 4L8JA 4JG2A 4LF8L 3S1NH 4A4IA 1C4QA 5AJ3L 4A3DG 2ZJRA 3EFXD 5M5YB 2MJ8A 5A2QE 4IFDI 1K0RA 1GVPA 3KF8B 5M3FH 2ZT9C 4IURA 1ET9A 4UP9A 4X64Q 4DR2L 3G48A 1SE2A 4I7AA 1F2ZA 1SYGA 4B08A 3GTJB 4JI6L 1PH4A 4DXFA 3S1NB 3I90A 5I2XA 3HFZB 3OWFA 3SDZA 1BOSA 2KHJA 5M3FB 2VL6A 2PW7A 4IQZA 1OXXK 1B44D 3TP8A 2A5HA 5I4DA 2GVBA 3OSOA 2SOBA 3A7AB 5DAUA 1H9SB 1AEXA 3PUVA 2F4VL 2AWNA 1EFWA 3D0FA 3PO2H 2JA6B 3DEPA 4KHVA 4KN4C 3LGJA 4R1JA 4WORA 2KOLA 1QJOA 2F4IA 4OWTB 3DM1A 4GS3A 1BBXC 1RDPD 1BXTA 2P5ZX 1W6KA 3BZKA 3PO2B 1ASYA 2QILA 4GLVB 4BS9A 1VQIA 4R9WA 4KHPL 2N55A 1ENAA 2EY1A 1G6PA 1SYFA 1VQ4A 1FL0A 4AYBB 3RLFA 5JEAJ 2EE1A 5DEHA 2Q2UA 2WB1G 1KDBA 4DK0A 3CC2A 4LF7Q 1A3VA 4EQ5A 3A0JA 2FHTA 4OO1G 2B2YC 2HHHQ 1CK1A 3BVGA 5ELFA 2OF1A 2N8NA 2EYHA 4B9WA 1I4PA 1TWCB 5CBEE 4OIJA 5IYDH 2F0VA 3KDFA 3GP7A 4GN4B 1CM9A 1HXYD 4BY7H 1BKBA 5C4XB 1IBKL 1RD9D 1PYBA 3H0GH 4DK1A 4DUYQ 1SNDA 4TRDA 3NBHB 4GOPA 3H94A 4TVAB 5M3MG 1PVOA 1D1IA 1H9KA 3LWEA 2WP8J 1IW7C 4CHTB 4BY7B 1YEZA 4A3GG 3H0GB 4DKAC 3H09A 3K59A 4GLXA 4GNXB 2O5JC 3HOVG 1L1OB 4A3EH 4NXNQ 2FFKB 3S1QB 4QUCA 2EVBA 1AE2A 1MD2D 2VZAA 1IBLL 1J9OA 4UHVA 4A3MG 4WJ4A 5M5WH 5LHY1 5LL6S 3QOJA 4YCWA 5EJWA 1Y1VH 1A2TA 3I73A 3PUWA 4A3IH 4FF1A 4JW0A 2JA5H 4A3KH 5HY6A 4X62Q 2RDFA 4A3EB 1LV9A 3E0EA 4XTCS 5I9PA 4BBRH 2JYOA 1IL2A 3NQTA 3TREA 4JOIC 3TP7A 4PMBA 4A3IB 1Y1VB 1VQFA 3GTLH 1E1OA 1F9SA 1HUNA 3ZYYX 5ELBA 4A3KB 3IKJA 4HJAA 2Z4HA 4AIMA 3R2TA 3CCLA 1XXGA 3UE1A 3J7AF 1I94Q 3OOCA 2K01A 5IE8A 1NY4A 4LF8Q 1Q46A 1G91A 2K52A 5AJ3Q 1TWAH 3HGBA 4QL5A 3K5OA 2NN6G 3GTLB 1K83B 3CPWA 2OEOA 1SLJA 1PMRA 2J7ZA 3HOUG 4FDBA 2NBFA 4DR2Q 5CV8A 1I4GA 4CJ1B 1DYQA 3E9HA 2HIXA 3S1RH 5E4WC 1N36L 4DR5L 3STBC 3QO2A 1K73C 4A3LG 1TWAB 2WAQG 1O7ZA 4F8MA 1EYGA 1JORA 1S5ED 2L9HA 3T4AC 4IOCA 3A56A 2KQ3A 1UE5A 1H95A 5FJ8G 1EY8A 2LFNA 2R7ZH 2JEAI 3ICEA 1EWIA 5EKKA 5JJIA 2N88A 3S1RB 1FYCA 4LUOA 5GAHC 1V1OA 2B2TA 2SEBD 5KGUA 4C3JH 1PFSA 4GOPC 4JBMA 2KCTA 5CYUA 1B9MA 1IW7D 1GUNA 2PNRC 4YY3Q 4JI4L 4AQYL 1KDCA 1WI5A 3IFDA 1WTWA 1UE1A 3E0JA 2E2DC 2O2LD 2LXKA 5ELOA 1WTVA 2VNUD 4ODGA 1L0XB 4C3JB 3N6RA 4WJ3M 4XT1B 3EQLC 1II3A 1VQ8A 1Q82C 1GOZA 1BNZA 4KHPQ 1UEBA 3BDOA 1Y8PB 5CMDA 2MGSA 1CKNB 1ZYRC 1IBML 3CCQA 4QF4A 3FP9A 4O0AA 2EJGC 2G9HD 1SYEA 2F0PA 3VA5A 1SAPA 3SK6A 1TY2A 1DONA 1QVCA 1C0AA 1BQQT 2XIWA 1U4PA 4P71A 1RF2D 1LM0A 4QIWE 2XRQD 2H5XA 5IWAQ 4DV3L 1KL9A 5IIFA 4DAYA 4JI1L 3KBXA 2XTIA 1SBBB 3CHBD 4JV5Q 1D7QA 1LACA 1G8ZD 1JE5A 4WRDA 2B8FA 1HNXL 2D62A 4UP7A 3F1ZA 1Q3LA 4R4IA 4I65A 3KF6B 2QGQA 1ONLA 3MXPA 1WTPA 1E24A 1HA5A 2UUAL 5IP7H 3GDEA 4EX5A 1M4VA 4HCSA 2E76C 1IL8A 3HOXH 3T1HL 2AUKA 2EYOA 1YHBA 4J1MA 3MHBA 1JWUD 4G7HC 3CCMA 2ZM6L 2EYPA 3M85A 4A3CH 2IT1A 1Q81C 2O5IC 2NZOA 1W3SA 5M9OA 2Z4IA 3HS0C 2PPBC 2UXBL 2F0FA 2F0WA 2YYZA 2R7DA 2E2IB 3HOZG 4B3ML 3HOXB 1HR0W 1XPRA 4A3JG 4CDDC 4HEDA 2K5QA 4X3TA 1ICFB 3M4QA 4RCOA 3RZOH 3B6YA 4RCNA 1CSQA 1GJXA 3I4MH 1TY0A 1FNUA 4JPBW 3MA2B 5IT9E 5BN5A 4B3TQ 1D8LA 1XX8A 2R92G 4HSPA 3IL8A 1EUJA 5FLMG 3RNUA 4WFN3 1W6JA 2YV5A 1YHQA 3HZXA 2YU9H 1HFNA 5EPJA 3I4MB 3NWSA 3DWQA 2KENA 4YIJA 5ISRA 2WKCA 2XN9C 1MSHA 5JJZA 1T9HA 3FVQA 1QVFA 2ICIA 4ZRZA 4LWCA 3W1BA 3GO5A 4E6IA 2YU9B 2B3GA 3TP5A 1CHQD 3FRPB 2AQ1B 3MZ5A 4IPDA 4DR5Q 1N36Q 3UE0A 3VYRA 3DXJC 3PO3G 4UPAA 1X56A 3OW2A 1DOKA 1G51A 1NBWA 3BZDB 4L5TA 1KRTA 3A8KE 1NE3A 2JE6I 3K7AB 4DA2A 1F2YA 1RODA 1EU3A 1EIHA 1Q90A 2CQAA 4MTKA 1F9QA 3VR5A 1W2BA 3OWEB 3OYYA 1A2UA 1BCPF 3UI2A 4NP5A 3C3LA 1DOLA 1Q12A 2A6HC 4WJWA 4JI4Q 4IFDJ 4AQYQ 4RGNA 1F77A 1WCMB 4XYOA 3PIOA 3K6OA 4OO1I 4DFAA 1U9RA 3JAMc 1Y8OB 3TSSA 1C48A 2N3SA 2B2VC 1R4PB 1PZID 3TMEA 3G71A 1CFMA 1MKHA 4GLAC 5EKLA 2NUCA 4A3DH 1IBMQ 3RN5A 3FEWX 1YBYA 3EROA 1TU2B 5LL6X 2MFIA 3AQQA 3HOWG 5M5XB 1K3RA 3OTOQ 2L4NA 3HP3A 5C0XJ 1LTAD 4G4KA 2BE5D 4A3BB 3JC66 3S2HH 3BG3A 4A3DB 2PI2A 5C4JH 3TDQA 4DV3Q 4HJ7A 3I4OA 1TKWB 1SN8A 1N9WA 4JI1Q 1QZHA 1HRJA 2R7FA 1STYA 4QIWB 1EQQA 1G2SA 1VF5C 4MIUA 1HNXQ 3L0OA 3MXNA 4XYQA 3GTPH 1O7LA 3J81L 3S2HB 5C4JB 2EYFA 1PRTC 5C3EG 2A68C 2EOTA 4GN3B 1VQ5A 5KEEA 4K6DA 4HMJA 3QWNA 2K5VA 1SNCA 4HCEA 4DAYB 2L15A 4F7XA 3T1HQ 4QQBX 3ER0A 4EVOA 2KVMA 4LF4L 3GTPB 3DUZA 1ICWA 3K5MA 1V8QA 3SK5A 2L12A 2E2HB 5I6WA 3AYHB 1HTLD 2UXBQ 5GAEC 1HJPA 4B3MQ 1GD7A 1QOHA 1N32L 5F2DA 2Q8IB 1BR9A 1IHZA 1Y1WG 3Q22A 4LUZA 1KQSA 1EYDA 1PFNA 1VQEA 3IFTA 1HHVA 2L11A 1JOKA 1EY9A 4IN3A 4OO1H 1X54A 1EIGA 3RD4A 3T16A 2OWOA 2A6HD 5G3LD 5HGQA 3JAML 3D6CA 3TZDA 4R8IA 4HMIA 3F2BA 2RDHA 2M2LA 5GAGC 1A3UA 1PH7A 4OWWB 4LJZC 4BBSG 2WB1B 5GQOA 2BDNA 3M3YB 1YJ9A 2PQAB 2VS1A 3TBIB 3A74A 2RSNA 3BU2A 4C2MH 3OHXC 5M3MH 4RHSA 4DGZA 3FMCA 2K33A 3E3XA 4KD3A 2A6EC 1K3BC 1Y8NB 2HIVA 5C44H 3PMFA 1VCIA 4KI0A 3HOYB 1HA6A 2RSOA 4DPGA 1NSNS 3KLSA 1B2TA 2XRSD 2CWAA 3JAMi 5JOBA 3HOVH 4EQOA 1U0LA 3CU7A 4OXPA 1N8RC 5IOCA 5C44B 5FLXE 4A3MH 2D9UA 1X3FA 3QR8A 5D3DA 4KD4A 1K9MC 1XNQL 2HQEA 3P7JA 3HOVB 4HIMA 4DF7A 1PRTD 1VMCA 4DR4L 1I4XA 2A68D 2RA4A 4A3MB 4RGMA 4JI8L 3K5LA 2K32A 2PZTA 1C7YA 3GTOB 1RKNA 1XTCD 3BVMA 4O1NA 4NXNL 3SK4A 3NWTA 4P74A 1LTTD 3C1FA 3C1EA 4JI5L 3V2TA 1S40A 4IPGA 1I4RA 3AFPA 4DV5L 4BY1G 2VB3X 3I2ZA 3W2DA 4K8IA 4CKCA 3GTQH 2MO0A 3MC0B 1QNUA 4P2CB 4POFA 4X62L 2YTVA 2B2YA 2NN6H 3I4NG 1JR0D 3VR3A 2L0CA 1A15A 1HQRD 3VR2A 1EQRA 3HKZG 1K8OA 4FO2A 2K50A 3VYUA 2UUCQ 1SMYD 2ENBA 1VQPA 1R4QB 1AH9A 4BXXH 3MFGA 1VS0A 4A3LH 3HKSA 3M4YA 5LMNL 3M7GA 3EIVA 4G57A 5FJ8H 1TS2A 2IHEA 1BDOA 1T5EA 4EQPA 2ZXPA 5ELDA 4KKUA 4K5VA 4R4TA 1SDFA 1PFMA 3P75A 5JEAG 1CKOA 2LSSA 3I91A 3KLWA 1NCVA 1MBYA 1ZEQX 4TKOB 4PV1C 4RGTA 4JI2Q 1XYIA 2A6ED 3J81j 1WD0A 4K6LA 1HZAA 1N33Q 1KNAA 3NP8A 2B63G 2JA7G 1IZ6A 5IYBG 5TSSA 4A3FH 2L55A 1SXTA 4LF4Q 1EYAA 2HUGA 5IYCG 3I55A 3H15A 3DHQA 4QY7A 2QA4A 2KHIA 2ID0A 1M1KC 3I56A 1SYCA 2K05A 4IJLA 2MPMA 1B3QA 4Z9CB 1N32Q 4A3FB 2DJGC 4JOIA 1VF7A 2LKVA 2N78A 4DR6L 5C3XA 3W3AA 4YY3L 1KAAA 2R93G 3U9SA 5E4XA 1IYVA 3NBIA 3OMGA 2PMZE 2CHBD 3BJUA 2OTLA 1KLGD 1PH9A 1I4QA 2Q8RE 1ENCA 1XMQL 3U50C 1X3PA 2MHVA 3AU7A 2KEDA 3R8BA 1GHKA 1TWGH 1FR3A 3FDTA 2VQEL 2C5CA 2DUDA 1JB7A 5KNDA 3ULPA 4DNTB 2O4XA 5KYIA 4APVA 2NVXH 3J7ZC 5EBDA 1JWSD 1CTMA 2ZTCA 3OMCA 2KBNA 5IY0A 5IWAL 4OL7A 4H7BA 5DM63 5JVG3 2NVXB 1KXLA 5CV5A 4JV5L 2CW0C 3RR5A 4FF4A 1Z6HA 1YNNC 3U58A 3S14H 1I6VC 2XGTA 4GKKL 2RVLA 1YITA 2D0PA 3HOZH 1L0WA 3SGIA 1XNQQ 4OEMB 4K5XA 4A3JH 1LTBD 2EQSA 3N52A 2WIIB 4CKBA 4DR4Q 3V05A 2F3WA 1ZKOA 4NW2A 1QUQA 4JI8Q 3J80E 4H13C 4X3KA 3CMEA 2KCNA 2MNAA 3VR4A 3HOZB 2B8GA 1CI3M 4NDXA 2R92H 5I9OA 3RZDH 4A3JB 1LTGD 4JI5Q 1FGUA 4JBWA 5FLMH 2BDOA 2IWHA 1DXMA 1DOMA 1JWMD 4DV5Q 4IUTA 5KYLA 2F0JA 3VDYA 1VQJA 1MJCA 1ZXTA 2YTYA 5EBCA 3W1GA 3SK8A 4A76A 3K58A 2HDLA 2NTSA 2E5LQ 5FKAC 2R92B 1STNA 3RZDB 3ND8A 1TIID 4AH6A 4LF6Q 1SE3A 1MIUA 4PZ6A 5K5PA 5M5WB 4KTAA 3CAMA 2Z8LA 3ND9A 4B3TL 2JA5B 1UWVA 3PO3H 4A93G 2FMMA 4X3SA 3X3MA 2X69A 1X55A 5LMNQ 1O80A 4BBRB 1HTPA 4YCVA 2PZWA 3KK7A 1G291 1JJCB 4LFBL 5CBAE 1V9PA 1X3EA 4LFAL 3PO3B 3EJIA 4K14A 2KCMA 1UEAB 1LT3D 1STEA 1VQ9A 4XIGS 1CKMA 5T1GA 3Q24A 3PF4A 1KTKA 1EOVA 2A74C 2K6AA 4CDEC 4J8QA 3WDNA 4MNOA 2RHQB 2WFWA 1HNWQ 4C3IG 3RMHA 1D5ZC 1HH2P 1KABA 3P20A 2Y0SG 3URYA 1WTQA 2SNSA 3MEHA 3QJYA 4ZUIA 1Q8KA 4DXGA 1L0YB 1F9PA 2CW0D 2PZUA 5IP9G 1YNND 3TZUA 3QIAA 4YCUA 2EPBA 4X3UA 1F2LA 2PO4A 4DUZQ 4HTHA 1VQHA 4UAIA 4KY6A 3WWVA 4DR6Q 1SE4A 5FK9C 1DCZA 1YVCA 2R7ZB 5IGFA 3HOWH 4UY8C 1WTXA 2BA1A 4UDUC 4DAPA 2AKWB 5EPKA 4KN7C 5H1SE 3OW7A 1FNVA 4U673 4ZK9B 1XMQQ 2G5DA 2EYLA 2B2WC 1PXUA 1PH8A 3HOWB 2VQEQ 5C4ZA 2K4KA 2PMZB 3UDXA 3F2DA 1B53A 4ZKCB 1MI2A 4R4OA 1SROA 4QCLA 5C3EH 1ENFA 5J1ZA 2JA6G 1H9MA 3OTOL 2F03A 1XWEA 2AUJD 5C5MA 2GN5A 2KJXA 2D0OA 5I6YA 2MO1A
chains in the Genus database with same CATH topology
4RGOS 1S5CD 5DM73 1STAA 4DNRB 2R6GA 5JVH3 4M8AA 5C4HA 4DU9A 2H1EA 1TQOA 1LT6D 4DAVA 1Z7TA 4NMZA 1BCPC 4GZYC 4IUQA 3M4OB 2R61A 2F0EA 1HQMC 2B2VA 1GUTA 2LS01 4ME5A 3ITPA 3PIO3 1JOOA 4LK1C 4ZQ3A 4BA2I 1SNMA 1UUPA 3MFYA 1Q1EA 1PYWD 2XNAC 4C56C 1GUWA 1V1PA 1HUMA 1DJRD 2K04A 1FD7D 4BBSB 1LTSD 4IFDG 3V96A 2JXMB 5IODA 1CHPD 3TN2A 4C3HG 1GHJA 3D31A 1Z47A 3RZOB 4L6TB 2EJFC 4Y7NB 3AMUA 1ZYRD 5KRUA 1SYDA 5HGTA 4BWGB 5C0XG 1ML0D 5KNCA 4MHEA 1RTNA 3TP6A 1JOQA 3GV3A 1CQVA 2PQEA 5A2QL 4ID6A 1S5FD 5E1FA 4N9PA 1ESFA 3OIPA 5C6AA 4JK1C 3NXWA 4G7ZC 2M9VA 3FPUB 3LWUA 4FF2A 1B1ZA 3D4RA 1O7YA 1E2ZA 1IKLA 1EL0A 1FGBD 5IGBA 1OXSC 3RUZA 2SDFA 4RHRA 1B50A 2VB2X 3E5SA 5JEAH 1E0BA 1CZWA 5ELCA 4RWSC 1KLUD 3L9AX 2HDMA 3D3RA 2RKSA 2XWBB 1TS5A 3J7AV 3D6WA 1D6EC 2IW3A 1C8CA 1MGSA 1B9NA 2CVRA 2EXZA 3NTIA 3EA6A 2B63B 4KK7A 1YNJC 4S3SA 4TSSA 1V43A 1EWHA 2E74C 5D3IB 3H3VC 5EQ0A 3NQIA 4MN3A 5J22A 3PUZA 1NUCA 4K5WA 1RHPA 1RCVD 4R8NA 1SNQA 3Q6SA 1QG7A 1PTOC 2SNMA 1E2WA 3F2UA 1BF4A 4HSVA 4TQUS 1LT4D 1PLFA 1SJHD 2X6GA 2F0LA 3BDCA 2NN6I 1STGA 3C2PA 3NHHA 4F88A 2QEJC 3T13A 4FP5D 4K8JA 1J8IA 5CV9A 1UAPA 5G3LF 1ILQA 4HN7A 4KKSA 5T1IA 2FMCA 4U68A 3PUYA 1U4LA 3CKIB 4RAUC 1Q8IA 3MAQA 2MUYA 4C2MB 1SSOA 5M3MB 3NTKA 1JE4A 3NPPA 1PRTB 3NK9A 5CV7A 2DY8A 4FXDA 1X3QA 5K36G 4A3GB 1OXUA 1U4RA 1QCBD 2F0UA 4EGVA 2F0NA 1KDAA 3HEJA 4ZKBB 1YNJD 1NR2A 1EZ8A 5AFWA 5FOBB 1F9RA 1S4ZA 1PRTF 5E3FA 3I70A 2VXWA 4H44C 3I4LA 1EQVA 1JQYD 3DEOA 3S1MB 4O42A 2EJMA 4A93B 1O78A 1I3QB 1SNPA 3GTQB 4OGQC 2NB0A 1EEID 4NKLA 1JICA 5KNBA 1QE6A 3HOUB 2XVSA 3VYSA 2KECA 1X32A 2F0GA 1D2BA 1EOTA 5IGGA 2F0KA 3A7LA 4CGYB 1MSGA 4C3IB 3CRLC 2WAQB 3R2IA 1CA5A 1GUSA 4V190 1OXVA 2Y0SB 1EFID 2KUMA 1EU4A 3IAYA 2F0OA 2IX0A 2RQXA 4XQJA 4RA8A 2AQ2B 2K03A 1DM0B 1SYBA 4FXGC 4HR7B 2IPKD 2HCIA 2K5DA 3T51B 2OT2A 2I46A 2RDGA 1M8AA 4C1NI 2WV6D 3T53B 4IUVA 4KKTA 2NVQB 1T5XD 3BYTB 3GTMB 2K1BA 1LTRD 1EEFD 5IGCA 3SEBA 5C0XI 1DD2A 1D5MC 1LT5D 1Q1BA 2EYMA 4K2LA 3MWYW 5EGTA 1NAPA 1HFGA 3DMUA 5IT9L 4KHZA 1STBA 1TWGB 3H6MA 4Q5VA 5D14A 2F0TA 1LLRD 2JA8B 1TVXA 3HG9A 3GV6A 3J81E 2IX1A 2RBMA 1CA6A 1TT2A 4ZUJA 3DWPA 3J7YW 3S14B 4IFDH 2F1MA 2BCOA 1ILPA 3E6ZX 3AB9A 2B2WA 2JEBI 2A69C 4FVMA 2K28A 1K8MA 3OIQA 5KIXA 2M00A 5EKIA 1I4HA 3GQBA 1QB5D 1WVLA 1G2TA 2PCFB 2B2UA 2EYJA 5D65A 4HAEA 4C3HB 3LX0A 1QNKA 5C0XH 2L5TA 3JAME 3A55A 1QWYA 1H9JA 4XT3B 2F0MA 1RTOA 1VMPA 2NVTB 2V4DA 5A35A 3K0YA 3PV0A 1UNSA 3U9OA 4IUPA 1AZPA 2E2JB 2Q8TA 2LY7A 2X6LA 2A73B 3A54A 3S15B 3I72A 5FO7B 4ABNA 3Q0AA 4PMWA 5CV4A 3SHLA 5FO9B 4G7OC 2AQ3B 3K5NA 1EY4A 4PQXA 2G9DA 5HURA 2EY6A 2AWOA 4CBVA 5FO8B 1BO0A 1WD1A 2KCCA 1HCZA 3K57A 4KJNA 3VYTA 4QUFA 1G6ZA 2A69D 4H0LC 3EVQA 4IALA 1A3TA 1ESRA 4QB4A 1GUOA 2PW5A 4ZAIA 2ICEC 2JP1A 1LO5D 2B2UC 4C1NK 1HPCA 4BA1I 1EYCA 3O13A 2LMCB 4KV6A 2E75C 5C3EB 3X3NA 2IJ0A 3I8ZA 4CJ2C 3A8JE 3G7LA 1AN8A 1OO9B 1B4OA 3LNNA 1TS4A 3MXUA 1WTRA 3CRKC 3FPPA 3M7NA 5FLXL 1EY0A 3R3OA 5C5LA 2DNCA 3SR1A 1Y1WB 4KY7A 2EZVA 4PNYA 1SFOB 4FF3A 2L1BA 2H4OA 3QB3A 1DZ1A 1QILA 3C46A 5COYA 2F0HA 1TWHB 2QF7A 2QCPX 1TWFB 3KUPA 5CR3A 1AZQA 3G6JB 1CQFA 2MP1A 4DN4M 3GD7A 5I2YA 5K36H 1S5BD 2BE5C 2B2TC 1TS3A 1E2VA 5DNFA 2XWJB 3KBGA 1FNWA 3KLRA 2Z1CA 2EDGA 3R93A 1BUVT 4RH6A 3WOFA 2KEEA 1CT1D 1D1KA 2F0DA 1BCPB 1JCKB 2K7VA 4OHJA 4FNFA 2BOSA 4XDXA 4XQNA 3WOEA 4M1UB 2IX3A 3OPOA 3ONAB 1GXDC 1BCPD 4BY1B 4LMQD 2F0SA 3BDLA 1U4MA 3L3OC 4ILWA 3MXGA 3I4NB 2HCCA 3GTGB 1JC7A 3HKZB 4KY5A 2R3ZA 5CGKA 4EQNA 1OXTA 2FJ2A 3D4DA 1S5DD 5JAVA 4ULLA 3A8IE 2BA0A 4L63B 4K2KA 4RKBA 1GUGA 2DY7A 3MVVA 1B3AA 2QDBA 3H91A 1JB3A 2IL8A 4FXKC 5IGEA 4OIKA 2K5WA 4C3JG 5JPMC 3PIP3 3P1HA 3S17B 1CZGA 1IYUA 3KF8A 2QKIC 1D5XC 2JA7B 1TR5A 2F0QA 3SVMA 5J39A 1IKMA 3QG1A 2NVYB 4ZLTF 1I6HB 2ZXRA 1EWCA 2DN8A 1EY6A 4KMUC 5BN3A 2WINB 1H9SA 2J4XA 2DNEA 2JSOA 3SE0A 5C3WA 3ERQA 4I7ZC 2R93B 4ZYSA 5CV6A 4B9XA 1VDZA 5JPNC 1PFBA 3D8GA 3J80L 1STHA 2C9OA 1AW7A 3NSWA 2PYKA 4LAAA 3PUXA 4XXEA 1R9TB 4RFBA 3VA7A 1PDQA 4RKLA 2NZ1D 2XSCA 3NE5B 4CJ0B 3GTKB 1V1PB 1SMYC 2EY2A 2TSSA 4FYDA 1EQTA 3BYYB 3D4WA 4Q0FA 2KHSA 4CKEA 3S2DB 2D2CC 2TMPA 3DWAA 4IZ8A 1PTOH 3BVZA 3S9WA 2F0IA 3T56B 1LTID 1H9RA 3NBHA 5NUCA 2OXPA 1F2MA 4KJOA 3QOLA 4IUUA 2B39A 2NTTA 3CQZB 3KLSX 4F87A 4V0BA 1PTOB 3SXHA 5CORA 2F3VA 2D5DA 2J0TD 2WKDA 1LABA 1A6XA 3I3CA 4PMCA 1KNEA 1I50B 1PTOD 3HRZC 1AFPA 1PZJD 2I07B 1NR4A 2KA7A 1RJTA 1AP0A 2NYZD 2NWGA 2EY5A 3NUCA 4XQQA 2ZXOA 5EPLA 1PZKD 2VUMB 1PTOF 5CC4A 3VR6A 2GA4B 3Q23A 1Y69U 1SEBD 2FINB 2WACA 4N9TA 4IUNA 1WTOA 1ET6A 3FKIB 3S16B 3NTHA 5BN4A 1SNOA 3BS1A 1SJED 1EZ6A 5ELEA 1EY5A 3MTSA 5IGDA 1EY7A 3L7ZC 4J6HA 4QMGA 4L8JA 1C4QA 3EFXD 5M5YB 2MJ8A 5A2QE 4IFDI 2ZT9C 4IURA 1ET9A 1SE2A 1F2ZA 1SYGA 4B08A 3GTJB 4DXFA 3S1NB 3I90A 5I2XA 3OWFA 3SDZA 1BOSA 5M3FB 2PW7A 4IQZA 1OXXK 1B44D 3TP8A 2A5HA 5I4DA 3OSOA 2SOBA 3A7AB 5DAUA 1H9SB 1AEXA 3PUVA 2AWNA 2JA6B 3DEPA 4KHVA 4KN4C 4WORA 2KOLA 1QJOA 2F4IA 3DM1A 1BBXC 1RDPD 1BXTA 1W6KA 3PO2B 2QILA 4BS9A 4R9WA 2N55A 1ENAA 2EY1A 1SYFA 4AYBB 3RLFA 5JEAJ 2EE1A 5DEHA 1KDBA 4DK0A 1A3VA 2FHTA 4OO1G 2B2YC 1CK1A 3BVGA 5ELFA 2OF1A 2EYHA 4B9WA 1I4PA 1TWCB 5CBEE 4OIJA 2F0VA 3GP7A 1CM9A 1HXYD 5C4XB 4DK1A 1RD9D 1SNDA 4TRDA 3H94A 1D1IA 1H9KA 3LWEA 2WP8J 1IW7C 4CHTB 4BY7B 3H0GB 3H09A 3K59A 2O5JC 2FFKB 3S1QB 4QUCA 2EVBA 1MD2D 1J9OA 5LHY1 5LL6S 3QOJA 5EJWA 4FF1A 3I73A 1A2TA 3PUWA 4A3EB 2RDFA 1LV9A 4XTCS 5I9PA 2JYOA 3NQTA 3TP7A 4PMBA 4A3IB 1Y1VB 1F9SA 1HUNA 3ZYYX 5ELBA 4A3KB 3IKJA 2Z4HA 3R2TA 1XXGA 3J7AF 3OOCA 2K01A 1G91A 3HGBA 3K5OA 2NN6G 3GTLB 1K83B 2OEOA 1PMRA 2J7ZA 2NBFA 5CV8A 1I4GA 4CJ1B 1DYQA 5E4WC 3QO2A 1TWAB 4F8MA 1O7ZA 1JORA 1S5ED 2L9HA 3T4AC 3A56A 2KQ3A 1EY8A 2LFNA 2JEAI 5EKKA 2N88A 3S1RB 1FYCA 1V1OA 2B2TA 2SEBD 5KGUA 5CYUA 1B9MA 1IW7D 1GUNA 2PNRC 1KDCA 3IFDA 1WTWA 3E0JA 2E2DC 2O2LD 1WTVA 2VNUD 4ODGA 4C3JB 1L0XB 3N6RA 4XT1B 3EQLC 1II3A 1GOZA 1BNZA 3BDOA 1Y8PB 5CMDA 2MGSA 1ZYRC 4QF4A 2EJGC 2G9HD 1SYEA 2F0PA 3VA5A 1SAPA 3SK6A 1TY2A 1DONA 1BQQT 2XIWA 1U4PA 1RF2D 2XRQD 5IIFA 4DAYA 3KBXA 1SBBB 3CHBD 1LACA 1G8ZD 4WRDA 2B8FA 2D62A 1Q3LA 4I65A 1ONLA 3MXPA 1WTPA 1HA5A 1M4VA 4HCSA 2E76C 1IL8A 2AUKA 2EYOA 4J1MA 3MHBA 1JWUD 4G7HC 2EYPA 3M85A 2IT1A 2O5IC 5M9OA 2Z4IA 3HS0C 2PPBC 2F0FA 2F0WA 2YYZA 2E2IB 3HOXB 4HEDA 2K5QA 4X3TA 4RCOA 4RCNA 1GJXA 1TY0A 1FNUA 3MA2B 5IT9E 5BN5A 1XX8A 4HSPA 3IL8A 4WFN3 1W6JA 3HZXA 1HFNA 5EPJA 3I4MB 3NWSA 3DWQA 4YIJA 5ISRA 2WKCA 2XN9C 1MSHA 5JJZA 3FVQA 2ICIA 4ZRZA 3GO5A 4E6IA 2YU9B 3TP5A 1CHQD 3FRPB 2AQ1B 3MZ5A 3VYRA 3DXJC 1DOKA 3BZDB 3A8KE 2JE6I 3K7AB 4DA2A 1F2YA 1RODA 1EU3A 1EIHA 1Q90A 2CQAA 1F9QA 3VR5A 3OWEB 1A2UA 1BCPF 3UI2A 4NP5A 3C3LA 1DOLA 1Q12A 2A6HC 4WJWA 4IFDJ 4RGNA 1F77A 1WCMB 4XYOA 3K6OA 4OO1I 4DFAA 1U9RA 1Y8OB 3TSSA 1C48A 2B2VC 1R4PB 1PZID 3TMEA 1CFMA 5EKLA 2NUCA 3FEWX 3EROA 1TU2B 5LL6X 5M5XB 2L4NA 3HP3A 5C0XJ 1LTAD 4G4KA 2BE5D 4A3BB 4A3DB 3BG3A 3TDQA 1TKWB 1HRJA 1STYA 4QIWB 1G2SA 1VF5C 4MIUA 3MXNA 4XYQA 1O7LA 3J81L 3S2HB 5C4JB 2EYFA 1PRTC 2A68C 2EOTA 5KEEA 4K6DA 4HMJA 3QWNA 1SNCA 4HCEA 4F7XA 4EVOA 2KVMA 3GTPB 3DUZA 1ICWA 3K5MA 1V8QA 3SK5A 2L12A 2E2HB 5I6WA 1HTLD 1QOHA 5F2DA 2Q8IB 1BR9A 1IHZA 3Q22A 1EYDA 1PFNA 3IFTA 1HHVA 2L11A 1JOKA 1EY9A 4IN3A 4OO1H 1EIGA 3RD4A 3T16A 2A6HD 5G3LD 3JAML 3D6CA 3TZDA 4R8IA 4HMIA 2RDHA 2M2LA 1A3UA 4LJZC 2WB1B 2BDNA 3M3YB 3TBIB 2RSNA 3OHXC 4RHSA 4DGZA 3FMCA 2K33A 4KD3A 2A6EC 1Y8NB 3PMFA 1VCIA 4KI0A 3HOYB 1HA6A 2RSOA 1NSNS 3KLSA 1B2TA 2XRSD 5JOBA 4EQOA 3CU7A 5IOCA 5C44B 5FLXE 2D9UA 5D3DA 4KD4A 2HQEA 3P7JA 3HOVB 4DF7A 1PRTD 1VMCA 1I4XA 2A68D 2RA4A 4A3MB 4RGMA 3K5LA 2K32A 2PZTA 3GTOB 1RKNA 1XTCD 3BVMA 4O1NA 3SK4A 3NWTA 1LTTD 3C1FA 3C1EA 3V2TA 1I4RA 2VB3X 3W2DA 4K8IA 4CKCA 3MC0B 1QNUA 4P2CB 2B2YA 2NN6H 1JR0D 3VR3A 2L0CA 1A15A 1HQRD 3VR2A 1K8OA 4FO2A 3VYUA 1SMYD 2ENBA 1R4QB 3MFGA 3M4YA 3M7GA 4G57A 1TS2A 1BDOA 1T5EA 4EQPA 2ZXPA 5ELDA 4KKUA 4K5VA 1SDFA 1PFMA 3P75A 5JEAG 3I91A 1NCVA 1MBYA 1ZEQX 4TKOB 4PV1C 4RGTA 1XYIA 2A6ED 1WD0A 4K6LA 1KNAA 3NP8A 5TSSA 2L55A 1SXTA 1EYAA 2HUGA 3DHQA 2ID0A 1SYCA 2K05A 2MPMA 4Z9CB 4A3FB 1VF7A 2LKVA 5C3XA 3W3AA 1KAAA 3U9SA 5E4XA 1IYVA 3NBIA 3OMGA 2CHBD 1KLGD 1I4QA 2Q8RE 1ENCA 1X3PA 2MHVA 3AU7A 2KEDA 3R8BA 1GHKA 3FDTA 1FR3A 2C5CA 5KNDA 4DNTB 2O4XA 5KYIA 5EBDA 1JWSD 1CTMA 3OMCA 4OL7A 4H7BA 5DM63 5JVG3 2NVXB 5CV5A 2CW0C 4FF4A 1Z6HA 1YNNC 1I6VC 2RVLA 4K5XA 1LTBD 3N52A 2WIIB 4CKBA 3V05A 2F3WA 1ZKOA 4NW2A 3J80E 4H13C 4X3KA 2KCNA 3VR4A 3HOZB 2B8GA 1CI3M 4NDXA 5I9OA 4A3JB 1LTGD 4JBWA 2BDOA 2IWHA 1DXMA 1DOMA 1JWMD 4IUTA 5KYLA 2F0JA 1ZXTA 5EBCA 3SK8A 3K58A 2HDLA 2NTSA 2R92B 5FKAC 1STNA 3RZDB 3ND8A 1TIID 1SE3A 5K5PA 5M5WB 4KTAA 2Z8LA 3ND9A 2JA5B 2FMMA 4X3SA 3X3MA 2X69A 1O80A 4BBRB 1HTPA 2PZWA 3KK7A 1G291 5CBAE 3PO3B 3EJIA 4K14A 1UEAB 1LT3D 1STEA 4XIGS 5T1GA 3Q24A 1KTKA 2A74C 2K6AA 4J8QA 3WDNA 4C3IG 3RMHA 1D5ZC 1KABA 3P20A 3URYA 1WTQA 2SNSA 3MEHA 3QJYA 4ZUIA 4DXGA 1L0YB 1F9PA 2CW0D 2PZUA 1YNND 3TZUA 3QIAA 2EPBA 4X3UA 1F2LA 2PO4A 4HTHA 4UAIA 4KY6A 1SE4A 5FK9C 1DCZA 2R7ZB 5IGFA 1WTXA 2BA1A 4UDUC 4DAPA 5EPKA 4KN7C 3OW7A 1FNVA 4U673 4ZK9B 2EYLA 2B2WC 1PXUA 3HOWB 5C4ZA 2PMZB 1B53A 4ZKCB 1MI2A 4QCLA 1ENFA 5J1ZA 1H9MA 2F03A 1XWEA 2AUJD 5C5MA 2KJXA 5I6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEQ X;  2L55 A;  3E6Z X;  2VB2 X;  2QCP X;  2VB3 X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 1FVI A;  4RGO S;  1S5C D;  5DM7 3;  1STA A;  3M4O H;  4DNR B;  2R6G A;  4DK3 C;  5JVH 3;  4M8A A;  4GKK Q;  4Y52 H;  5C4H A;  4DU9 A;  2H1E A;  1TQO A;  4AYB G;  1LT6 D;  4DAV A;  1Z7T A;  2JA8 G;  3U4V A;  3CMA A;  4NMZ A;  1BCP C;  4GZY C;  4IUQ A;  3M4O B;  1SRU A;  2R61 A;  2F0E A;  3KDF B;  1HQM C;  4LF9 L;  1SFO H;  2B2V A;  1GUT A;  2LS0 1;  4ME5 A;  3ITP A;  3STB D;  1FJG Q;  3PIO 3;  5BR8 L;  1JOO A;  1YIJ A;  4LK1 C;  4ZQ3 A;  4GOP B;  4BBS H;  5C4X G;  4BA2 I;  2A8V A;  1SNM A;  1TWF H;  1UUP A;  3MFY A;  1B70 B;  1Q1E A;  1PYW D;  2XNA C;  3NEL A;  4C56 C;  1GUW A;  1V1Q A;  1V1P A;  1HUM A;  4O2D A;  1QUQ B;  1DJR D;  2K04 A;  1FD7 D;  3W5O A;  1NNX A;  4BBS B;  1LTS D;  4IFD G;  2HD3 A;  3V96 A;  2WB1 E;  2JXM B;  4BY7 G;  1YJN A;  1PH1 A;  5IOD A;  4Y7N H;  1CHP D;  3TN2 A;  2RCF A;  4C3H G;  1GHJ A;  3D31 A;  4PZ8 A;  1GM5 A;  1Z47 A;  3RZO B;  4DV4 L;  3RLN A;  4L6T B;  3ULJ A;  2EJF C;  4LFB Q;  2K5H A;  4Y7N B;  3AMU A;  1ZYR D;  5KRU A;  4LFA Q;  3KJO A;  3J81 c;  1SYD A;  5HGT A;  1EIF A;  2N49 A;  4BWG B;  4K0K L;  5C0X G;  1ML0 D;  1NJI C;  5KNC A;  4MHE A;  1RTN A;  2DJF C;  3TP6 A;  4A3I G;  1JOQ A;  3GV3 A;  1LUZ A;  1CQV A;  2PQE A;  1J6Q A;  5A2Q L;  4ID6 A;  3KOJ A;  2JA9 A;  1S5F D;  4BY1 H;  3PQI A;  3EN2 A;  5E1F A;  4N9P A;  1ESF A;  3OIP A;  5C6A A;  1VQN A;  4JK1 C;  3NXW A;  1A62 A;  3I4N H;  1YZ6 A;  4G7Z C;  2M9V A;  4CDC C;  3FPU B;  3LWU A;  1KRS A;  4FF2 A;  1B1Z A;  3D4R A;  1O7Y A;  1E2Z A;  1E3P A;  1IKL A;  1EL0 A;  4MZ9 A;  1FGB D;  1K0S A;  2JJQ A;  5IGB A;  1NTG A;  1OXS C;  3RUZ A;  1VQO A;  2SDF A;  4RHR A;  1B50 A;  2VB2 X;  1NMF A;  1Q86 C;  3E5S A;  5JEA H;  1E0B A;  1PH3 A;  1CZW A;  5ELC A;  4RWS C;  1KLU D;  4JI0 L;  3L9A X;  2UUC L;  2HDM A;  5LMU L;  2Z0S A;  3CF5 A;  2AMC B;  3D3R A;  2RKS A;  2XWB B;  1TS5 A;  3J7A V;  2B63 H;  3D6W A;  1D6E C;  4OX9 L;  1X3G A;  2IW3 A;  5IYB H;  4HIK A;  4HJ8 A;  1PH5 A;  2WAQ E;  1C8C A;  1MGS A;  3UDF A;  1B9N A;  2CVR A;  2Y0S E;  2EXZ A;  2I5L X;  2MQH A;  2PI2 E;  3NTI A;  4LF5 Q;  3EA6 A;  2B63 B;  4KK7 A;  1YNJ C;  4S3S A;  4TSS A;  4JI3 L;  1V43 A;  4JI2 L;  1EWH A;  2E74 C;  2OQ0 A;  5D3I B;  3H3V C;  5EQ0 A;  3NQI A;  4R4Q A;  4MN3 A;  5J22 A;  1N33 L;  3PUZ A;  1NUC A;  4K5W A;  1RHP A;  4LF9 Q;  1RCV D;  4R8N A;  1SNQ A;  1VQG A;  3MEF A;  2Z6K A;  3PGZ A;  5L37 A;  3Q6S A;  1QG7 A;  1PTO C;  3K0X A;  5BR8 Q;  2SNM A;  1E2W A;  3F2U A;  1BF4 A;  2ES2 A;  4P73 A;  1EIY B;  4HSV A;  4TQU S;  1LT4 D;  1PLF A;  1QVG A;  3J81 i;  1SJH D;  2AHO B;  2X6G A;  2F0L A;  3BDC A;  3CCV A;  3TRZ A;  3CCU A;  2NN6 I;  1STG A;  3C2P A;  2NZH A;  2VQF Q;  3NHH A;  4F88 A;  1VQB A;  2CCZ A;  2QEJ C;  3T13 A;  4FP5 D;  4K8J A;  3T1Y L;  1J8I A;  4DV4 Q;  5CV9 A;  3NEM A;  1UAP A;  1O7I A;  2EIF A;  5GAD C;  5G3L F;  2QEX A;  1ILQ A;  4HN7 A;  4B3S L;  4KKS A;  5T1I A;  2FMC A;  4U68 A;  2CKZ B;  3PUY A;  1U4L A;  3KFU A;  1GO3 E;  1RIP A;  3CKI B;  4K0K Q;  4A3G H;  4RAU C;  1Q8I A;  1QZG A;  3MAQ A;  2PNH A;  2MUY A;  1J5E L;  4C2M B;  1SSO A;  5M3M B;  1VQD A;  3NTK A;  1JE4 A;  3NPP A;  1PRT B;  4P75 A;  3ULL A;  3NK9 A;  5CV7 A;  2DY8 A;  4FXD A;  1X3Q A;  5J3B A;  5K36 G;  4A3G B;  1OXU A;  1U4R A;  1QCB D;  1WTH A;  2F0U A;  4EGV A;  2F0N A;  1KDA A;  4NXM Q;  3HEJ A;  4ZKB B;  1YNJ D;  1YNX A;  4JBJ A;  1NR2 A;  3KYH C;  1EZ8 A;  3S1M H;  3CW2 C;  4DAM A;  2F52 A;  1Q7Y C;  4A93 H;  5AFW A;  5FOB B;  1S72 A;  1F9R A;  1S4Z A;  1PRT F;  2Z6K C;  5E3F A;  3I70 A;  2VXW A;  4H44 C;  3I4L A;  1I3Q H;  3PSI A;  1EQV A;  1JQY D;  3DEO A;  3S1M B;  2E5L L;  4O42 A;  2EJM A;  4A93 B;  4L5R C;  3HOU H;  3KJP A;  4JI0 Q;  4LF6 L;  1O78 A;  1XPO A;  3F8T A;  5LMU Q;  2CFM A;  1I3Q B;  4X65 Q;  1SNP A;  5E7N A;  3GTQ B;  4C3I H;  4OGQ C;  2NB0 A;  3F2C A;  1EEI D;  4NKL A;  4CDF C;  1JIC A;  1WCM G;  4OX9 Q;  5KNB A;  1QE6 A;  3HOU B;  2ALY B;  2XVS A;  3VYS A;  2KEC A;  1X32 A;  2F0G A;  1AE3 A;  1D2B A;  5IP9 H;  1EOT A;  5IGG A;  2F0K A;  3A7L A;  4CGY B;  1MSG A;  4C3I B;  3CRL C;  4DV2 Q;  2WAQ B;  3R2I A;  4JI3 Q;  1CA5 A;  1GUS A;  4V19 0;  3K8A A;  1OXV A;  2Y0S B;  1EFI D;  1HNW L;  2KUM A;  1EU4 A;  3IAY A;  4GN5 A;  2F0O A;  2IX0 A;  2RQX A;  3GTJ H;  1I5F A;  1JJ2 A;  4A3B G;  1A0I A;  4N8X 1;  4XQJ A;  4RA8 A;  3CC7 A;  2NVQ H;  2AQ2 B;  2K03 A;  4HJ5 A;  1DM0 B;  3BZC A;  1SYB A;  3MXN B;  3GTM H;  4FXG C;  4HR7 B;  2IPK D;  2HCI A;  2K5D A;  4UP8 A;  1VQ7 A;  3T51 B;  1BVS A;  4DUZ L;  4J15 A;  2OT2 A;  2I46 A;  2RDG A;  3Q8D A;  1M8A A;  4C1N I;  2WV6 D;  3T53 B;  1VQC A;  2CH4 W;  4IUV A;  2VY3 A;  4KKT A;  4HIO A;  2NVQ B;  1T5X D;  3BYT B;  3GTM B;  2JA6 H;  2K1B A;  1LTR D;  1EEF D;  5IGC A;  3SEB A;  4GNX C;  5C0X I;  4GKJ L;  1L1O C;  1DD2 A;  4IJH A;  4ALP A;  1CUK A;  1D5M C;  1LT5 D;  1Q1B A;  3T1Y Q;  2EYM A;  4K2L A;  3MWY W;  1CKN A;  4RMF A;  3NEN A;  4JYA L;  5EGT A;  2IHF A;  1NAP A;  1HFG A;  5JJK A;  3DMU A;  1VQM A;  1XMO Q;  4B3S Q;  3UDG A;  5IT9 L;  2JA8 H;  4KHZ A;  5DLQ E;  2I0Q A;  1STB A;  1TWG B;  4X66 L;  3H6M A;  4L5Q A;  4Q5V A;  5D14 A;  1J5E Q;  1TWC H;  3CP0 A;  1IYJ B;  2F0T A;  1LLR D;  1XNR L;  2JA8 B;  3CC4 A;  2K5N A;  1TVX A;  2JK8 A;  2JQO A;  5C4X H;  3HG9 A;  4DR1 Q;  3GV6 A;  3J81 E;  2IX1 A;  2RBM A;  3KF6 A;  3CXC A;  1CA6 A;  3G4S A;  2YTX A;  1GKH A;  2C35 B;  1TT2 A;  4ZUJ A;  3DWP A;  5GRO A;  3HOY G;  1ASZ A;  3J7Y W;  3S14 B;  4IFD H;  4ME3 A;  2F1M A;  2BCO A;  1ILP A;  1FJG L;  4HID A;  3E6Z X;  3AB9 A;  2B2W A;  4IO9 A;  2JEB I;  2A69 C;  4FVM A;  3S1Q H;  4C3H H;  2K28 A;  1WJJ A;  1K8M A;  3OIQ A;  5KIX A;  1U5K A;  5C44 G;  2M00 A;  5EKI A;  1I4H A;  4DV7 L;  3GQB A;  2BH8 A;  4LNQ A;  4IPH A;  4DV1 L;  1QB5 D;  4QGU A;  1JT8 A;  4P72 A;  1WVL A;  2CH4 A;  1HZB A;  1G2T A;  2PCF B;  2B2U A;  2EYJ A;  5D65 A;  5LMN W;  1UE6 A;  4HAE A;  4C3H B;  3LX0 A;  1QNK A;  5C0X H;  2L5T A;  3JAM E;  2NVT H;  4X6A H;  2VUM G;  4B3R L;  3A55 A;  2E2J H;  1QWY A;  1H9J A;  4XT3 B;  2F0M A;  1RTO A;  2LXJ A;  3S15 H;  2EXD A;  1VMP A;  1KC8 C;  2NVT B;  2V4D A;  4OON A;  5A35 A;  2A19 A;  1S3O A;  3K0Y A;  3PV0 A;  1UNS A;  3U9O A;  3FKI G;  4A75 A;  2Z6B A;  1K83 H;  4IUP A;  1AZP A;  1HR0 L;  2E2J B;  2Q8T A;  2LY7 A;  2X6L A;  2A73 B;  3PCO B;  3A54 A;  3S15 B;  3I72 A;  2I5M X;  3K81 C;  2QDL A;  5FO7 B;  4ABN A;  3Q0A A;  1B8A A;  4PMW A;  2ZTE A;  1YI2 A;  5CV4 A;  1YJW A;  5FLX c;  3SHL A;  4DV6 L;  5FO9 B;  4G7O C;  4JC0 A;  2AQ3 B;  1L2F A;  4PG3 A;  4BXX G;  1YHA A;  4JI6 Q;  4KLK A;  3K5N A;  1EY4 A;  1VQ6 A;  4PQX A;  2G9D A;  5HUR A;  2EY6 A;  2AWO A;  3G6E A;  2OTJ A;  4CBV A;  5FO8 B;  1BO0 A;  1WD1 A;  2KCC A;  3HKZ E;  1HCZ A;  3DM3 A;  3K57 A;  4KJN A;  2Z9H A;  3VYT A;  5M3F G;  4QUF A;  4POG A;  4GKJ Q;  1G6Z A;  2F4V Q;  2A69 D;  4H0L C;  3EVQ A;  4IAL A;  1A3T A;  3J7A 5;  1ESR A;  4JYA Q;  4QB4 A;  1GUO A;  2PW5 A;  4ZAI A;  1E1T A;  4JI7 L;  4A3F G;  2ICE C;  2JP1 A;  1LO5 D;  2Q2T A;  2B2U C;  3AFQ A;  4C1N K;  4X66 Q;  2UUB L;  1HPC A;  4BA1 I;  3TS0 A;  1VQK A;  1EYC A;  3O13 A;  3TQY A;  2LMC B;  4YHH L;  1DGS A;  4KV6 A;  2E75 C;  5C3E B;  3PO2 G;  4JBK A;  1XNR Q;  4IPC A;  2ZJQ A;  3X3N A;  2IJ0 A;  4LF5 L;  3I8Z A;  3CCE A;  4CJ2 C;  2Q2H A;  3A8J E;  2GVA A;  3G7L A;  1IXR A;  1AN8 A;  3K80 C;  1Y1W H;  4LFC L;  4DR3 L;  1OTC A;  1OO9 B;  1SE8 A;  1KAW A;  1WOC A;  1B4O A;  3LNN A;  1TS4 A;  1IBK Q;  3MXU A;  1WTR A;  3CRK C;  3FPP A;  3A5U A;  5FLX L;  3M7N A;  1EY0 A;  3R3O A;  5C5L A;  2DNC A;  3SR1 A;  1Y1W B;  4KY7 A;  3M9B A;  1PH2 A;  1TWH H;  4DNI A;  2EZV A;  1X9N A;  4DV7 Q;  4PNY A;  1SFO B;  4FF3 A;  2L1B A;  4DV1 Q;  4ZCK A;  2E2I H;  2JN4 A;  3ERS X;  2H4O A;  5IYD G;  3QB3 A;  1DZ1 A;  1QIL A;  3C46 A;  5COY A;  4PZ7 A;  2F0H A;  4DK6 C;  1TWH B;  2QF7 A;  2QCP X;  1M90 C;  2UXC L;  1Z9F A;  3H0G G;  2VQF L;  1IBL Q;  4LUV A;  1TWF B;  3KUP A;  5CR3 A;  1AZQ A;  3G6J B;  1CQF A;  4OWX B;  1Y14 B;  1LYL A;  2MP1 A;  4QJF A;  4B3R Q;  4DN4 M;  4MTN A;  2RF4 A;  2PQA A;  3GD7 A;  5I2Y A;  5K36 H;  2ATW A;  1K28 A;  1S5B D;  2K14 A;  2BE5 C;  2B2T C;  1TS3 A;  4N8F A;  1E2V A;  5DNF A;  4A3E G;  2XWJ B;  1P16 A;  3CPF A;  1HR0 Q;  3A5Z B;  2ZJP A;  3KBG A;  5JJL A;  1HZ9 A;  3FHW A;  1FNW A;  4IOA A;  3KLR A;  1Y1V G;  2Z1C A;  2EDG A;  1A8V A;  2JA5 G;  1X6O A;  1JMC A;  3R93 A;  1BUV T;  4A3K G;  4RH6 A;  1KD1 C;  3WOF A;  2KEE A;  1CT1 D;  1D1K A;  2F0D A;  1BCP B;  4DV6 Q;  1JCK B;  2K7V A;  4OHJ A;  4FNF A;  4BBR G;  1N34 L;  2BOS A;  4XDX A;  4XQN A;  2VW9 A;  4NXM L;  3K7A H;  3WOE A;  2RHS B;  4M1U B;  3OPO A;  2IX3 A;  3GTG H;  2B29 A;  3ONA B;  1C9O A;  1SMX A;  1GXD C;  3J80 c;  1E22 A;  1BCP D;  1PHJ A;  4BY1 B;  4LMQ D;  4JVZ A;  3ZJY C;  2F0S A;  1A63 A;  3BDL A;  1U4M A;  2ZTD A;  3L3O C;  4ILW A;  3MXG A;  1BBU A;  3I4N B;  2HCC A;  1WCM H;  3GTG B;  1JC7 A;  3HKZ B;  4KY5 A;  2R3Z A;  5CGK A;  2UXD L;  4EQN A;  2HT1 A;  1OXT A;  2FJ2 A;  3D4D A;  1S5D D;  5JAV A;  4ULL A;  3IRB A;  3U4Z A;  3A8I E;  2BA0 A;  4L63 B;  4K2K A;  2UU9 L;  3TEH B;  4DR7 L;  4RKB A;  4JI7 Q;  2QW7 A;  3S17 H;  1GUG A;  2DY7 A;  4L5S A;  3MVV A;  4JCV E;  4X65 L;  2R7Z G;  1B3A A;  2QDB A;  2OQK A;  3H91 A;  3TS2 A;  1E7Z A;  1CSP A;  5M5X H;  2UUB Q;  1JB3 A;  2IL8 A;  2JA7 H;  3H3V I;  4FXK C;  5IGE A;  3PF5 A;  4A3B H;  4OIK A;  4YHH Q;  2K75 A;  3DLL A;  2NVY H;  1UE7 A;  5IYC H;  2K5W A;  1I6H H;  1VQA A;  4C3J G;  5JPM C;  3K7U C;  3PIP 3;  3P1H A;  3S17 B;  1CZG A;  1IYU A;  1XTD A;  3KF8 A;  2QKI C;  1D5X C;  1PA6 A;  1HNZ L;  4DV2 L;  2JA7 B;  3L2P A;  4NB3 A;  1WYD A;  3CD6 A;  1TR5 A;  2F0Q A;  3SVM A;  5J39 A;  1PYS B;  1IKM A;  4LFC Q;  3QG1 A;  2NVY B;  4DR3 Q;  4ZLT F;  4DV0 L;  3RN2 A;  1I6H B;  2ZXR A;  1HZC A;  1P8L A;  1EWC A;  2R93 H;  2DN8 A;  4HJ9 A;  1EY6 A;  2DGY A;  4KMU C;  1PH6 A;  2V1C C;  5BN3 A;  4YWM A;  2Q2I A;  4X64 L;  1XJV A;  1B7Y B;  4YWK A;  1K8G A;  2WIN B;  1H9S A;  2J4X A;  2DNE A;  1MHW C;  2JSO A;  4R4C A;  3SE0 A;  1R9T H;  5C3W A;  2E2H H;  2UUA Q;  3ERQ A;  4I7Z C;  2R93 B;  4ZYS A;  5CV6 A;  4B9X A;  1VDZ A;  5JPN C;  1PFB A;  3D8G A;  3J80 L;  1STH A;  2C9O A;  1AW7 A;  3NSW A;  2PYK A;  3GTK H;  4LAA A;  3PUX A;  3AEV A;  4XXE A;  2ZM6 Q;  2F3I A;  2UXC Q;  1R9T B;  4RFB A;  4OEL B;  5ELN A;  3VA7 A;  1PDQ A;  3RLO A;  4RKL A;  2NZ1 D;  2XSC A;  1K8A C;  1BBW A;  2I5H A;  3NE5 B;  4CJ0 B;  3GTK B;  4LW1 A;  1LTL A;  3S2D H;  1V1P B;  5IP7 G;  1SMY C;  3CCS A;  2EY2 A;  2TSS A;  4FYD A;  1EQT A;  3BYY B;  3M3Y H;  3D4W A;  4Q0F A;  3HOX G;  2BH2 A;  1MJE A;  1XMO L;  3J80 i;  2CWP A;  2KHS A;  3H3V H;  4A3C G;  4AYB E;  4CKE A;  1NMG A;  2ASB A;  3M4P A;  3HOY H;  3S2D B;  2D2C C;  3CQZ H;  3S24 A;  2TMP A;  3DWA A;  2A1A A;  2IY5 B;  4IZ8 A;  1PTO H;  3BVZ A;  1X65 A;  3S9W A;  2E8G A;  3PIP A;  2F0I A;  3T56 B;  1LTI D;  1H9R A;  4H02 A;  4LF7 L;  4DR1 L;  3NBH A;  5NUC A;  2OXP A;  1F2M A;  4KJO A;  3QOL A;  1N34 Q;  1TXY A;  2HHH L;  3I4M G;  1RL2 A;  4IUU A;  2B39 A;  2NTT A;  3CQZ B;  3I7F A;  3KLS X;  4F87 A;  3UDI A;  4V0B A;  1I50 H;  4YWL A;  1PTO B;  2CQO A;  5EAY A;  3SXH A;  5COR A;  1XPU A;  2F3V A;  3EBE A;  4GNX A;  1L1O A;  2D5D A;  2J0T D;  4RG1 A;  4DUY L;  2WKD A;  1KHI A;  4NPS A;  1LAB A;  2RCN A;  3GTO H;  1A6X A;  3I3C A;  4PMC A;  3CCR A;  1KNE A;  2HQL A;  2VUM H;  1I50 B;  1PTO D;  3HRZ C;  3E9I A;  2UXD Q;  1AFP A;  1PZJ D;  2I07 B;  2FXQ A;  1NR4 A;  2KA7 A;  1RJT A;  1AP0 A;  2NYZ D;  2NWG A;  1VQL A;  2OCE A;  2EY5 A;  3NUC A;  4XQQ A;  2ZXO A;  1JJG A;  5EPL A;  1PZK D;  3FKI H;  2VUM B;  2UU9 Q;  3S16 H;  4DR7 Q;  1PTO F;  5CC4 A;  5IT9 c;  3VR6 A;  2GA4 B;  3Q23 A;  1Y69 U;  1SEB D;  2FIN B;  2WAC A;  4N9T A;  4IUN A;  1WTO A;  1ET6 A;  1WFQ A;  3FKI B;  3S16 B;  3NTH A;  5BN4 A;  1SNO A;  3BS1 A;  1SJE D;  1EZ6 A;  1HNZ Q;  1PV4 A;  5ELE A;  3CCJ A;  1KIX A;  5M5Y H;  1EY5 A;  3MTS A;  5IGD A;  1EY7 A;  3L7Z C;  4J6H A;  4DV0 Q;  1SR3 A;  4QMG A;  1I94 L;  4L8J A;  4JG2 A;  4LF8 L;  3S1N H;  4A4I A;  1C4Q A;  5AJ3 L;  4A3D G;  2ZJR A;  3EFX D;  5M5Y B;  2MJ8 A;  5A2Q E;  4IFD I;  1K0R A;  1GVP A;  3KF8 B;  5M3F H;  2ZT9 C;  4IUR A;  1ET9 A;  4UP9 A;  4X64 Q;  4DR2 L;  3G48 A;  1SE2 A;  4I7A A;  1F2Z A;  1SYG A;  4B08 A;  3GTJ B;  4JI6 L;  1PH4 A;  4DXF A;  3S1N B;  3I90 A;  5I2X A;  3HFZ B;  3OWF A;  3SDZ A;  1BOS A;  2KHJ A;  5M3F B;  2VL6 A;  2PW7 A;  4IQZ A;  1OXX K;  1B44 D;  3TP8 A;  2A5H A;  5I4D A;  2GVB A;  3OSO A;  2SOB A;  3A7A B;  5DAU A;  1H9S B;  1AEX A;  3PUV A;  2F4V L;  2AWN A;  1EFW A;  3D0F A;  3PO2 H;  2JA6 B;  3DEP A;  4KHV A;  4KN4 C;  3LGJ A;  4R1J A;  4WOR A;  2KOL A;  1QJO A;  2F4I A;  4OWT B;  3DM1 A;  4GS3 A;  1BBX C;  1RDP D;  1BXT A;  2P5Z X;  1W6K A;  3BZK A;  3PO2 B;  1ASY A;  2QIL A;  4GLV B;  4BS9 A;  1VQI A;  4R9W A;  4KHP L;  2N55 A;  1ENA A;  2EY1 A;  1G6P A;  1SYF A;  1VQ4 A;  1FL0 A;  4AYB B;  3RLF A;  5JEA J;  2EE1 A;  5DEH A;  2Q2U A;  2WB1 G;  1KDB A;  4DK0 A;  3CC2 A;  4LF7 Q;  1A3V A;  4EQ5 A;  3A0J A;  2FHT A;  4OO1 G;  2B2Y C;  2HHH Q;  1CK1 A;  3BVG A;  5ELF A;  2OF1 A;  2N8N A;  2EYH A;  4B9W A;  1I4P A;  1TWC B;  5CBE E;  4OIJ A;  5IYD H;  2F0V A;  3KDF A;  3GP7 A;  4GN4 B;  1CM9 A;  1HXY D;  4BY7 H;  1BKB A;  5C4X B;  1IBK L;  1RD9 D;  1PYB A;  3H0G H;  4DK1 A;  4DUY Q;  1SND A;  4TRD A;  3NBH B;  4GOP A;  3H94 A;  4TVA B;  5M3M G;  1PVO A;  1D1I A;  1H9K A;  3LWE A;  2WP8 J;  1IW7 C;  4CHT B;  4BY7 B;  1YEZ A;  4A3G G;  3H0G B;  4DKA C;  3H09 A;  3K59 A;  4GLX A;  4GNX B;  2O5J C;  3HOV G;  1L1O B;  4A3E H;  4NXN Q;  2FFK B;  3S1Q B;  4QUC A;  2EVB A;  1AE2 A;  1MD2 D;  2VZA A;  1IBL L;  1J9O A;  4UHV A;  4A3M G;  4WJ4 A;  5M5W H;  5LHY 1;  5LL6 S;  3QOJ A;  4YCW A;  5EJW A;  1Y1V H;  1A2T A;  3I73 A;  3PUW A;  4A3I H;  4FF1 A;  4JW0 A;  2JA5 H;  4A3K H;  5HY6 A;  4X62 Q;  2RDF A;  4A3E B;  1LV9 A;  3E0E A;  4XTC S;  5I9P A;  4BBR H;  2JYO A;  1IL2 A;  3NQT A;  3TRE A;  4JOI C;  3TP7 A;  4PMB A;  4A3I B;  1Y1V B;  1VQF A;  3GTL H;  1E1O A;  1F9S A;  1HUN A;  3ZYY X;  5ELB A;  4A3K B;  3IKJ A;  4HJA A;  2Z4H A;  4AIM A;  3R2T A;  3CCL A;  1XXG A;  3UE1 A;  3J7A F;  1I94 Q;  3OOC A;  2K01 A;  5IE8 A;  1NY4 A;  4LF8 Q;  1Q46 A;  1G91 A;  2K52 A;  5AJ3 Q;  1TWA H;  3HGB A;  4QL5 A;  3K5O A;  2NN6 G;  3GTL B;  1K83 B;  3CPW A;  2OEO A;  1SLJ A;  1PMR A;  2J7Z A;  3HOU G;  4FDB A;  2NBF A;  4DR2 Q;  5CV8 A;  1I4G A;  4CJ1 B;  1DYQ A;  3E9H A;  2HIX A;  3S1R H;  5E4W C;  1N36 L;  4DR5 L;  3STB C;  3QO2 A;  1K73 C;  4A3L G;  1TWA B;  2WAQ G;  1O7Z A;  4F8M A;  1EYG A;  1JOR A;  1S5E D;  2L9H A;  3T4A C;  4IOC A;  3A56 A;  2KQ3 A;  1UE5 A;  1H95 A;  5FJ8 G;  1EY8 A;  2LFN A;  2R7Z H;  2JEA I;  3ICE A;  1EWI A;  5EKK A;  5JJI A;  2N88 A;  3S1R B;  1FYC A;  4LUO A;  5GAH C;  1V1O A;  2B2T A;  2SEB D;  5KGU A;  4C3J H;  1PFS A;  4GOP C;  4JBM A;  2KCT A;  5CYU A;  1B9M A;  1IW7 D;  1GUN A;  2PNR C;  4YY3 Q;  4JI4 L;  4AQY L;  1KDC A;  1WI5 A;  3IFD A;  1WTW A;  1UE1 A;  3E0J A;  2E2D C;  2O2L D;  2LXK A;  5ELO A;  1WTV A;  2VNU D;  4ODG A;  1L0X B;  4C3J B;  3N6R A;  4WJ3 M;  4XT1 B;  3EQL C;  1II3 A;  1VQ8 A;  1Q82 C;  1GOZ A;  1BNZ A;  4KHP Q;  1UEB A;  3BDO A;  1Y8P B;  5CMD A;  2MGS A;  1CKN B;  1ZYR C;  1IBM L;  3CCQ A;  4QF4 A;  3FP9 A;  4O0A A;  2EJG C;  2G9H D;  1SYE A;  2F0P A;  3VA5 A;  1SAP A;  3SK6 A;  1TY2 A;  1DON A;  1QVC A;  1C0A A;  1BQQ T;  2XIW A;  1U4P A;  4P71 A;  1RF2 D;  1LM0 A;  4QIW E;  2XRQ D;  2H5X A;  5IWA Q;  4DV3 L;  1KL9 A;  5IIF A;  4DAY A;  4JI1 L;  3KBX A;  2XTI A;  1SBB B;  3CHB D;  4JV5 Q;  1D7Q A;  1LAC A;  1G8Z D;  1JE5 A;  4WRD A;  2B8F A;  1HNX L;  2D62 A;  4UP7 A;  3F1Z A;  1Q3L A;  4R4I A;  4I65 A;  3KF6 B;  2QGQ A;  1ONL A;  3MXP A;  1WTP A;  1E24 A;  1HA5 A;  2UUA L;  5IP7 H;  3GDE A;  4EX5 A;  1M4V A;  4HCS A;  2E76 C;  1IL8 A;  3HOX H;  3T1H L;  2AUK A;  2EYO A;  1YHB A;  4J1M A;  3MHB A;  1JWU D;  4G7H C;  3CCM A;  2ZM6 L;  2EYP A;  3M85 A;  4A3C H;  2IT1 A;  1Q81 C;  2O5I C;  2NZO A;  1W3S A;  5M9O A;  2Z4I A;  3HS0 C;  2PPB C;  2UXB L;  2F0F A;  2F0W A;  2YYZ A;  2R7D A;  2E2I B;  3HOZ G;  4B3M L;  3HOX B;  1HR0 W;  1XPR A;  4A3J G;  4CDD C;  4HED A;  2K5Q A;  4X3T A;  1ICF B;  3M4Q A;  4RCO A;  3RZO H;  3B6Y A;  4RCN A;  1CSQ A;  1GJX A;  3I4M H;  1TY0 A;  1FNU A;  4JPB W;  3MA2 B;  5IT9 E;  5BN5 A;  4B3T Q;  1D8L A;  1XX8 A;  2R92 G;  4HSP A;  3IL8 A;  1EUJ A;  5FLM G;  3RNU A;  4WFN 3;  1W6J A;  2YV5 A;  1YHQ A;  3HZX A;  2YU9 H;  1HFN A;  5EPJ A;  3I4M B;  3NWS A;  3DWQ A;  2KEN A;  4YIJ A;  5ISR A;  2WKC A;  2XN9 C;  1MSH A;  5JJZ A;  1T9H A;  3FVQ A;  1QVF A;  2ICI A;  4ZRZ A;  4LWC A;  3W1B A;  3GO5 A;  4E6I A;  2YU9 B;  2B3G A;  3TP5 A;  1CHQ D;  3FRP B;  2AQ1 B;  3MZ5 A;  4IPD A;  4DR5 Q;  1N36 Q;  3UE0 A;  3VYR A;  3DXJ C;  3PO3 G;  4UPA A;  1X56 A;  3OW2 A;  1DOK A;  1G51 A;  1NBW A;  3BZD B;  4L5T A;  1KRT A;  3A8K E;  1NE3 A;  2JE6 I;  3K7A B;  4DA2 A;  1F2Y A;  1ROD A;  1EU3 A;  1EIH A;  1Q90 A;  2CQA A;  4MTK A;  1F9Q A;  3VR5 A;  1W2B A;  3OWE B;  3OYY A;  1A2U A;  1BCP F;  3UI2 A;  4NP5 A;  3C3L A;  1DOL A;  1Q12 A;  2A6H C;  4WJW A;  4JI4 Q;  4IFD J;  4AQY Q;  4RGN A;  1F77 A;  1WCM B;  4XYO A;  3PIO A;  3K6O A;  4OO1 I;  4DFA A;  1U9R A;  3JAM c;  1Y8O B;  3TSS A;  1C48 A;  2N3S A;  2B2V C;  1R4P B;  1PZI D;  3TME A;  3G71 A;  1CFM A;  1MKH A;  4GLA C;  5EKL A;  2NUC A;  4A3D H;  1IBM Q;  3RN5 A;  3FEW X;  1YBY A;  3ERO A;  1TU2 B;  5LL6 X;  2MFI A;  3AQQ A;  3HOW G;  5M5X B;  1K3R A;  3OTO Q;  2L4N A;  3HP3 A;  5C0X J;  1LTA D;  4G4K A;  2BE5 D;  4A3B B;  3JC6 6;  3S2H H;  3BG3 A;  4A3D B;  2PI2 A;  5C4J H;  3TDQ A;  4DV3 Q;  4HJ7 A;  3I4O A;  1TKW B;  1SN8 A;  1N9W A;  4JI1 Q;  1QZH A;  1HRJ A;  2R7F A;  1STY A;  4QIW B;  1EQQ A;  1G2S A;  1VF5 C;  4MIU A;  1HNX Q;  3L0O A;  3MXN A;  4XYQ A;  3GTP H;  1O7L A;  3J81 L;  3S2H B;  5C4J B;  2EYF A;  1PRT C;  5C3E G;  2A68 C;  2EOT A;  4GN3 B;  1VQ5 A;  5KEE A;  4K6D A;  4HMJ A;  3QWN A;  2K5V A;  1SNC A;  4HCE A;  4DAY B;  2L15 A;  4F7X A;  3T1H Q;  4QQB X;  3ER0 A;  4EVO A;  2KVM A;  4LF4 L;  3GTP B;  3DUZ A;  1ICW A;  3K5M A;  1V8Q A;  3SK5 A;  2L12 A;  2E2H B;  5I6W A;  3AYH B;  1HTL D;  2UXB Q;  5GAE C;  1HJP A;  4B3M Q;  1GD7 A;  1QOH A;  1N32 L;  5F2D A;  2Q8I B;  1BR9 A;  1IHZ A;  1Y1W G;  3Q22 A;  4LUZ A;  1KQS A;  1EYD A;  1PFN A;  1VQE A;  3IFT A;  1HHV A;  2L11 A;  1JOK A;  1EY9 A;  4IN3 A;  4OO1 H;  1X54 A;  1EIG A;  3RD4 A;  3T16 A;  2OWO A;  2A6H D;  5G3L D;  5HGQ A;  3JAM L;  3D6C A;  3TZD A;  4R8I A;  4HMI A;  3F2B A;  2RDH A;  2M2L A;  5GAG C;  1A3U A;  1PH7 A;  4OWW B;  4LJZ C;  4BBS G;  2WB1 B;  5GQO A;  2BDN A;  3M3Y B;  1YJ9 A;  2PQA B;  2VS1 A;  3TBI B;  3A74 A;  2RSN A;  3BU2 A;  4C2M H;  3OHX C;  5M3M H;  4RHS A;  4DGZ A;  3FMC A;  2K33 A;  3E3X A;  4KD3 A;  2A6E C;  1K3B C;  1Y8N B;  2HIV A;  5C44 H;  3PMF A;  1VCI A;  4KI0 A;  3HOY B;  1HA6 A;  2RSO A;  4DPG A;  1NSN S;  3KLS A;  1B2T A;  2XRS D;  2CWA A;  3JAM i;  5JOB A;  3HOV H;  4EQO A;  1U0L A;  3CU7 A;  4OXP A;  1N8R C;  5IOC A;  5C44 B;  5FLX E;  4A3M H;  2D9U A;  1X3F A;  3QR8 A;  5D3D A;  4KD4 A;  1K9M C;  1XNQ L;  2HQE A;  3P7J A;  3HOV B;  4HIM A;  4DF7 A;  1PRT D;  1VMC A;  4DR4 L;  1I4X A;  2A68 D;  2RA4 A;  4A3M B;  4RGM A;  4JI8 L;  3K5L A;  2K32 A;  2PZT A;  1C7Y A;  3GTO B;  1RKN A;  1XTC D;  3BVM A;  4O1N A;  4NXN L;  3SK4 A;  3NWT A;  4P74 A;  1LTT D;  3C1F A;  3C1E A;  4JI5 L;  3V2T A;  1S40 A;  4IPG A;  1I4R A;  3AFP A;  4DV5 L;  4BY1 G;  2VB3 X;  3I2Z A;  3W2D A;  4K8I A;  4CKC A;  3GTQ H;  2MO0 A;  3MC0 B;  1QNU A;  4P2C B;  4POF A;  4X62 L;  2YTV A;  2B2Y A;  2NN6 H;  3I4N G;  1JR0 D;  3VR3 A;  2L0C A;  1A15 A;  1HQR D;  3VR2 A;  1EQR A;  3HKZ G;  1K8O A;  4FO2 A;  2K50 A;  3VYU A;  2UUC Q;  1SMY D;  2ENB A;  1VQP A;  1R4Q B;  1AH9 A;  4BXX H;  3MFG A;  1VS0 A;  4A3L H;  3HKS A;  3M4Y A;  5LMN L;  3M7G A;  3EIV A;  4G57 A;  5FJ8 H;  1TS2 A;  2IHE A;  1BDO A;  1T5E A;  4EQP A;  2ZXP A;  5ELD A;  4KKU A;  4K5V A;  4R4T A;  1SDF A;  1PFM A;  3P75 A;  5JEA G;  1CKO A;  2LSS A;  3I91 A;  3KLW A;  1NCV A;  1MBY A;  1ZEQ X;  4TKO B;  4PV1 C;  4RGT A;  4JI2 Q;  1XYI A;  2A6E D;  3J81 j;  1WD0 A;  4K6L A;  1HZA A;  1N33 Q;  1KNA A;  3NP8 A;  2B63 G;  2JA7 G;  1IZ6 A;  5IYB G;  5TSS A;  4A3F H;  2L55 A;  1SXT A;  4LF4 Q;  1EYA A;  2HUG A;  5IYC G;  3I55 A;  3H15 A;  3DHQ A;  4QY7 A;  2QA4 A;  2KHI A;  2ID0 A;  1M1K C;  3I56 A;  1SYC A;  2K05 A;  4IJL A;  2MPM A;  1B3Q A;  4Z9C B;  1N32 Q;  4A3F B;  2DJG C;  4JOI A;  1VF7 A;  2LKV A;  2N78 A;  4DR6 L;  5C3X A;  3W3A A;  4YY3 L;  1KAA A;  2R93 G;  3U9S A;  5E4X A;  1IYV A;  3NBI A;  3OMG A;  2PMZ E;  2CHB D;  3BJU A;  2OTL A;  1KLG D;  1PH9 A;  1I4Q A;  2Q8R E;  1ENC A;  1XMQ L;  3U50 C;  1X3P A;  2MHV A;  3AU7 A;  2KED A;  3R8B A;  1GHK A;  1TWG H;  1FR3 A;  3FDT A;  2VQE L;  2C5C A;  2DUD A;  1JB7 A;  5KND A;  3ULP A;  4DNT B;  2O4X A;  5KYI A;  4APV A;  2NVX H;  3J7Z C;  5EBD A;  1JWS D;  1CTM A;  2ZTC A;  3OMC A;  2KBN A;  5IY0 A;  5IWA L;  4OL7 A;  4H7B A;  5DM6 3;  5JVG 3;  2NVX B;  1KXL A;  5CV5 A;  4JV5 L;  2CW0 C;  3RR5 A;  4FF4 A;  1Z6H A;  1YNN C;  3U58 A;  3S14 H;  1I6V C;  2XGT A;  4GKK L;  2RVL A;  1YIT A;  2D0P A;  3HOZ H;  1L0W A;  3SGI A;  1XNQ Q;  4OEM B;  4K5X A;  4A3J H;  1LTB D;  2EQS A;  3N52 A;  2WII B;  4CKB A;  4DR4 Q;  3V05 A;  2F3W A;  1ZKO A;  4NW2 A;  1QUQ A;  4JI8 Q;  3J80 E;  4H13 C;  4X3K A;  3CME A;  2KCN A;  2MNA A;  3VR4 A;  3HOZ B;  2B8G A;  1CI3 M;  4NDX A;  2R92 H;  5I9O A;  3RZD H;  4A3J B;  1LTG D;  4JI5 Q;  1FGU A;  4JBW A;  5FLM H;  2BDO A;  2IWH A;  1DXM A;  1DOM A;  1JWM D;  4DV5 Q;  4IUT A;  5KYL A;  2F0J A;  3VDY A;  1VQJ A;  1MJC A;  1ZXT A;  2YTY A;  5EBC A;  3W1G A;  3SK8 A;  4A76 A;  3K58 A;  2HDL A;  2NTS A;  2E5L Q;  5FKA C;  2R92 B;  1STN A;  3RZD B;  3ND8 A;  1TII D;  4AH6 A;  4LF6 Q;  1SE3 A;  1MIU A;  4PZ6 A;  5K5P A;  5M5W B;  4KTA A;  3CAM A;  2Z8L A;  3ND9 A;  4B3T L;  2JA5 B;  1UWV A;  3PO3 H;  4A93 G;  2FMM A;  4X3S A;  3X3M A;  2X69 A;  1X55 A;  5LMN Q;  1O80 A;  4BBR B;  1HTP A;  4YCV A;  2PZW A;  3KK7 A;  1G29 1;  1JJC B;  4LFB L;  5CBA E;  1V9P A;  1X3E A;  4LFA L;  3PO3 B;  3EJI A;  4K14 A;  2KCM A;  1UEA B;  1LT3 D;  1STE A;  1VQ9 A;  4XIG S;  1CKM A;  5T1G A;  3Q24 A;  3PF4 A;  1KTK A;  1EOV A;  2A74 C;  2K6A A;  4CDE C;  4J8Q A;  3WDN A;  4MNO A;  2RHQ B;  2WFW A;  1HNW Q;  4C3I G;  3RMH A;  1D5Z C;  1HH2 P;  1KAB A;  3P20 A;  2Y0S G;  3URY A;  1WTQ A;  2SNS A;  3MEH A;  3QJY A;  4ZUI A;  1Q8K A;  4DXG A;  1L0Y B;  1F9P A;  2CW0 D;  2PZU A;  5IP9 G;  1YNN D;  3TZU A;  3QIA A;  4YCU A;  2EPB A;  4X3U A;  1F2L A;  2PO4 A;  4DUZ Q;  4HTH A;  1VQH A;  4UAI A;  4KY6 A;  3WWV A;  4DR6 Q;  1SE4 A;  5FK9 C;  1DCZ A;  1YVC A;  2R7Z B;  5IGF A;  3HOW H;  4UY8 C;  1WTX A;  2BA1 A;  4UDU C;  4DAP A;  2AKW B;  5EPK A;  4KN7 C;  5H1S E;  3OW7 A;  1FNV A;  4U67 3;  4ZK9 B;  1XMQ Q;  2G5D A;  2EYL A;  2B2W C;  1PXU A;  1PH8 A;  3HOW B;  2VQE Q;  5C4Z A;  2K4K A;  2PMZ B;  3UDX A;  3F2D A;  1B53 A;  4ZKC B;  1MI2 A;  4R4O A;  1SRO A;  4QCL A;  5C3E H;  1ENF A;  5J1Z A;  2JA6 G;  1H9M A;  3OTO L;  2F03 A;  1XWE A;  2AUJ D;  5C5M A;  2GN5 A;  2KJX A;  2D0O A;  5I6Y A;  2MO1 A; 
#chains in the Genus database with same CATH homology
 4RGO S;  1S5C D;  5DM7 3;  1STA A;  4DNR B;  2R6G A;  5JVH 3;  4M8A A;  5C4H A;  4DU9 A;  2H1E A;  1TQO A;  1LT6 D;  4DAV A;  1Z7T A;  4NMZ A;  1BCP C;  4GZY C;  4IUQ A;  3M4O B;  2R61 A;  2F0E A;  1HQM C;  2B2V A;  1GUT A;  2LS0 1;  4ME5 A;  3ITP A;  3PIO 3;  1JOO A;  4LK1 C;  4ZQ3 A;  4BA2 I;  1SNM A;  1UUP A;  3MFY A;  1Q1E A;  1PYW D;  2XNA C;  4C56 C;  1GUW A;  1V1P A;  1HUM A;  1DJR D;  2K04 A;  1FD7 D;  4BBS B;  1LTS D;  4IFD G;  3V96 A;  2JXM B;  5IOD A;  1CHP D;  3TN2 A;  4C3H G;  1GHJ A;  3D31 A;  1Z47 A;  3RZO B;  4L6T B;  2EJF C;  4Y7N B;  3AMU A;  1ZYR D;  5KRU A;  1SYD A;  5HGT A;  4BWG B;  5C0X G;  1ML0 D;  5KNC A;  4MHE A;  1RTN A;  3TP6 A;  1JOQ A;  3GV3 A;  1CQV A;  2PQE A;  5A2Q L;  4ID6 A;  1S5F D;  5E1F A;  4N9P A;  1ESF A;  3OIP A;  5C6A A;  4JK1 C;  3NXW A;  4G7Z C;  2M9V A;  3FPU B;  3LWU A;  4FF2 A;  1B1Z A;  3D4R A;  1O7Y A;  1E2Z A;  1IKL A;  1EL0 A;  1FGB D;  5IGB A;  1OXS C;  3RUZ A;  2SDF A;  4RHR A;  1B50 A;  2VB2 X;  3E5S A;  5JEA H;  1E0B A;  1CZW A;  5ELC A;  4RWS C;  1KLU D;  3L9A X;  2HDM A;  3D3R A;  2RKS A;  2XWB B;  1TS5 A;  3J7A V;  3D6W A;  1D6E C;  2IW3 A;  1C8C A;  1MGS A;  1B9N A;  2CVR A;  2EXZ A;  3NTI A;  3EA6 A;  2B63 B;  4KK7 A;  1YNJ C;  4S3S A;  4TSS A;  1V43 A;  1EWH A;  2E74 C;  5D3I B;  3H3V C;  5EQ0 A;  3NQI A;  4MN3 A;  5J22 A;  3PUZ A;  1NUC A;  4K5W A;  1RHP A;  1RCV D;  4R8N A;  1SNQ A;  3Q6S A;  1QG7 A;  1PTO C;  2SNM A;  1E2W A;  3F2U A;  1BF4 A;  4HSV A;  4TQU S;  1LT4 D;  1PLF A;  1SJH D;  2X6G A;  2F0L A;  3BDC A;  2NN6 I;  1STG A;  3C2P A;  3NHH A;  4F88 A;  2QEJ C;  3T13 A;  4FP5 D;  4K8J A;  1J8I A;  5CV9 A;  1UAP A;  5G3L F;  1ILQ A;  4HN7 A;  4KKS A;  5T1I A;  2FMC A;  4U68 A;  3PUY A;  1U4L A;  3CKI B;  4RAU C;  1Q8I A;  3MAQ A;  2MUY A;  4C2M B;  1SSO A;  5M3M B;  3NTK A;  1JE4 A;  3NPP A;  1PRT B;  3NK9 A;  5CV7 A;  2DY8 A;  4FXD A;  1X3Q A;  5K36 G;  4A3G B;  1OXU A;  1U4R A;  1QCB D;  2F0U A;  4EGV A;  2F0N A;  1KDA A;  3HEJ A;  4ZKB B;  1YNJ D;  1NR2 A;  1EZ8 A;  5AFW A;  5FOB B;  1F9R A;  1S4Z A;  1PRT F;  5E3F A;  3I70 A;  2VXW A;  4H44 C;  3I4L A;  1EQV A;  1JQY D;  3DEO A;  3S1M B;  4O42 A;  2EJM A;  4A93 B;  1O78 A;  1I3Q B;  1SNP A;  3GTQ B;  4OGQ C;  2NB0 A;  1EEI D;  4NKL A;  1JIC A;  5KNB A;  1QE6 A;  3HOU B;  2XVS A;  3VYS A;  2KEC A;  1X32 A;  2F0G A;  1D2B A;  1EOT A;  5IGG A;  2F0K A;  3A7L A;  4CGY B;  1MSG A;  4C3I B;  3CRL C;  2WAQ B;  3R2I A;  1CA5 A;  1GUS A;  4V19 0;  1OXV A;  2Y0S B;  1EFI D;  2KUM A;  1EU4 A;  3IAY A;  2F0O A;  2IX0 A;  2RQX A;  4XQJ A;  4RA8 A;  2AQ2 B;  2K03 A;  1DM0 B;  1SYB A;  4FXG C;  4HR7 B;  2IPK D;  2HCI A;  2K5D A;  3T51 B;  2OT2 A;  2I46 A;  2RDG A;  1M8A A;  4C1N I;  2WV6 D;  3T53 B;  4IUV A;  4KKT A;  2NVQ B;  1T5X D;  3BYT B;  3GTM B;  2K1B A;  1LTR D;  1EEF D;  5IGC A;  3SEB A;  5C0X I;  1DD2 A;  1D5M C;  1LT5 D;  1Q1B A;  2EYM A;  4K2L A;  3MWY W;  5EGT A;  1NAP A;  1HFG A;  3DMU A;  5IT9 L;  4KHZ A;  1STB A;  1TWG B;  3H6M A;  4Q5V A;  5D14 A;  2F0T A;  1LLR D;  2JA8 B;  1TVX A;  3HG9 A;  3GV6 A;  3J81 E;  2IX1 A;  2RBM A;  1CA6 A;  1TT2 A;  4ZUJ A;  3DWP A;  3J7Y W;  3S14 B;  4IFD H;  2F1M A;  2BCO A;  1ILP A;  3E6Z X;  3AB9 A;  2B2W A;  2JEB I;  2A69 C;  4FVM A;  2K28 A;  1K8M A;  3OIQ A;  5KIX A;  2M00 A;  5EKI A;  1I4H A;  3GQB A;  1QB5 D;  1WVL A;  1G2T A;  2PCF B;  2B2U A;  2EYJ A;  5D65 A;  4HAE A;  4C3H B;  3LX0 A;  1QNK A;  5C0X H;  2L5T A;  3JAM E;  3A55 A;  1QWY A;  1H9J A;  4XT3 B;  2F0M A;  1RTO A;  1VMP A;  2NVT B;  2V4D A;  5A35 A;  3K0Y A;  3PV0 A;  1UNS A;  3U9O A;  4IUP A;  1AZP A;  2E2J B;  2Q8T A;  2LY7 A;  2X6L A;  2A73 B;  3A54 A;  3S15 B;  3I72 A;  5FO7 B;  4ABN A;  3Q0A A;  4PMW A;  5CV4 A;  3SHL A;  5FO9 B;  4G7O C;  2AQ3 B;  3K5N A;  1EY4 A;  4PQX A;  2G9D A;  5HUR A;  2EY6 A;  2AWO A;  4CBV A;  5FO8 B;  1BO0 A;  1WD1 A;  2KCC A;  1HCZ A;  3K57 A;  4KJN A;  3VYT A;  4QUF A;  1G6Z A;  2A69 D;  4H0L C;  3EVQ A;  4IAL A;  1A3T A;  1ESR A;  4QB4 A;  1GUO A;  2PW5 A;  4ZAI A;  2ICE C;  2JP1 A;  1LO5 D;  2B2U C;  4C1N K;  1HPC A;  4BA1 I;  1EYC A;  3O13 A;  2LMC B;  4KV6 A;  2E75 C;  5C3E B;  3X3N A;  2IJ0 A;  3I8Z A;  4CJ2 C;  3A8J E;  3G7L A;  1AN8 A;  1OO9 B;  1B4O A;  3LNN A;  1TS4 A;  3MXU A;  1WTR A;  3CRK C;  3FPP A;  3M7N A;  5FLX L;  1EY0 A;  3R3O A;  5C5L A;  2DNC A;  3SR1 A;  1Y1W B;  4KY7 A;  2EZV A;  4PNY A;  1SFO B;  4FF3 A;  2L1B A;  2H4O A;  3QB3 A;  1DZ1 A;  1QIL A;  3C46 A;  5COY A;  2F0H A;  1TWH B;  2QF7 A;  2QCP X;  1TWF B;  3KUP A;  5CR3 A;  1AZQ A;  3G6J B;  1CQF A;  2MP1 A;  4DN4 M;  3GD7 A;  5I2Y A;  5K36 H;  1S5B D;  2BE5 C;  2B2T C;  1TS3 A;  1E2V A;  5DNF A;  2XWJ B;  3KBG A;  1FNW A;  3KLR A;  2Z1C A;  2EDG A;  3R93 A;  1BUV T;  4RH6 A;  3WOF A;  2KEE A;  1CT1 D;  1D1K A;  2F0D A;  1BCP B;  1JCK B;  2K7V A;  4OHJ A;  4FNF A;  2BOS A;  4XDX A;  4XQN A;  3WOE A;  4M1U B;  2IX3 A;  3OPO A;  3ONA B;  1GXD C;  1BCP D;  4BY1 B;  4LMQ D;  2F0S A;  3BDL A;  1U4M A;  3L3O C;  4ILW A;  3MXG A;  3I4N B;  2HCC A;  3GTG B;  1JC7 A;  3HKZ B;  4KY5 A;  2R3Z A;  5CGK A;  4EQN A;  1OXT A;  2FJ2 A;  3D4D A;  1S5D D;  5JAV A;  4ULL A;  3A8I E;  2BA0 A;  4L63 B;  4K2K A;  4RKB A;  1GUG A;  2DY7 A;  3MVV A;  1B3A A;  2QDB A;  3H91 A;  1JB3 A;  2IL8 A;  4FXK C;  5IGE A;  4OIK A;  2K5W A;  4C3J G;  5JPM C;  3PIP 3;  3P1H A;  3S17 B;  1CZG A;  1IYU A;  3KF8 A;  2QKI C;  1D5X C;  2JA7 B;  1TR5 A;  2F0Q A;  3SVM A;  5J39 A;  1IKM A;  3QG1 A;  2NVY B;  4ZLT F;  1I6H B;  2ZXR A;  1EWC A;  2DN8 A;  1EY6 A;  4KMU C;  5BN3 A;  2WIN B;  1H9S A;  2J4X A;  2DNE A;  2JSO A;  3SE0 A;  5C3W A;  3ERQ A;  4I7Z C;  2R93 B;  4ZYS A;  5CV6 A;  4B9X A;  1VDZ A;  5JPN C;  1PFB A;  3D8G A;  3J80 L;  1STH A;  2C9O A;  1AW7 A;  3NSW A;  2PYK A;  4LAA A;  3PUX A;  4XXE A;  1R9T B;  4RFB A;  3VA7 A;  1PDQ A;  4RKL A;  2NZ1 D;  2XSC A;  3NE5 B;  4CJ0 B;  3GTK B;  1V1P B;  1SMY C;  2EY2 A;  2TSS A;  4FYD A;  1EQT A;  3BYY B;  3D4W A;  4Q0F A;  2KHS A;  4CKE A;  3S2D B;  2D2C C;  2TMP A;  3DWA A;  4IZ8 A;  1PTO H;  3BVZ A;  3S9W A;  2F0I A;  3T56 B;  1LTI D;  1H9R A;  3NBH A;  5NUC A;  2OXP A;  1F2M A;  4KJO A;  3QOL A;  4IUU A;  2B39 A;  2NTT A;  3CQZ B;  3KLS X;  4F87 A;  4V0B A;  1PTO B;  3SXH A;  5COR A;  2F3V A;  2D5D A;  2J0T D;  2WKD A;  1LAB A;  1A6X A;  3I3C A;  4PMC A;  1KNE A;  1I50 B;  1PTO D;  3HRZ C;  1AFP A;  1PZJ D;  2I07 B;  1NR4 A;  2KA7 A;  1RJT A;  1AP0 A;  2NYZ D;  2NWG A;  2EY5 A;  3NUC A;  4XQQ A;  2ZXO A;  5EPL A;  1PZK D;  2VUM B;  1PTO F;  5CC4 A;  3VR6 A;  2GA4 B;  3Q23 A;  1Y69 U;  1SEB D;  2FIN B;  2WAC A;  4N9T A;  4IUN A;  1WTO A;  1ET6 A;  3FKI B;  3S16 B;  3NTH A;  5BN4 A;  1SNO A;  3BS1 A;  1SJE D;  1EZ6 A;  5ELE A;  1EY5 A;  3MTS A;  5IGD A;  1EY7 A;  3L7Z C;  4J6H A;  4QMG A;  4L8J A;  1C4Q A;  3EFX D;  5M5Y B;  2MJ8 A;  5A2Q E;  4IFD I;  2ZT9 C;  4IUR A;  1ET9 A;  1SE2 A;  1F2Z A;  1SYG A;  4B08 A;  3GTJ B;  4DXF A;  3S1N B;  3I90 A;  5I2X A;  3OWF A;  3SDZ A;  1BOS A;  5M3F B;  2PW7 A;  4IQZ A;  1OXX K;  1B44 D;  3TP8 A;  2A5H A;  5I4D A;  3OSO A;  2SOB A;  3A7A B;  5DAU A;  1H9S B;  1AEX A;  3PUV A;  2AWN A;  2JA6 B;  3DEP A;  4KHV A;  4KN4 C;  4WOR A;  2KOL A;  1QJO A;  2F4I A;  3DM1 A;  1BBX C;  1RDP D;  1BXT A;  1W6K A;  3PO2 B;  2QIL A;  4BS9 A;  4R9W A;  2N55 A;  1ENA A;  2EY1 A;  1SYF A;  4AYB B;  3RLF A;  5JEA J;  2EE1 A;  5DEH A;  1KDB A;  4DK0 A;  1A3V A;  2FHT A;  4OO1 G;  2B2Y C;  1CK1 A;  3BVG A;  5ELF A;  2OF1 A;  2EYH A;  4B9W A;  1I4P A;  1TWC B;  5CBE E;  4OIJ A;  2F0V A;  3GP7 A;  1CM9 A;  1HXY D;  5C4X B;  4DK1 A;  1RD9 D;  1SND A;  4TRD A;  3H94 A;  1D1I A;  1H9K A;  3LWE A;  2WP8 J;  1IW7 C;  4CHT B;  4BY7 B;  3H0G B;  3H09 A;  3K59 A;  2O5J C;  2FFK B;  3S1Q B;  4QUC A;  2EVB A;  1MD2 D;  1J9O A;  5LHY 1;  5LL6 S;  3QOJ A;  5EJW A;  4FF1 A;  3I73 A;  1A2T A;  3PUW A;  4A3E B;  2RDF A;  1LV9 A;  4XTC S;  5I9P A;  2JYO A;  3NQT A;  3TP7 A;  4PMB A;  4A3I B;  1Y1V B;  1F9S A;  1HUN A;  3ZYY X;  5ELB A;  4A3K B;  3IKJ A;  2Z4H A;  3R2T A;  1XXG A;  3J7A F;  3OOC A;  2K01 A;  1G91 A;  3HGB A;  3K5O A;  2NN6 G;  3GTL B;  1K83 B;  2OEO A;  1PMR A;  2J7Z A;  2NBF A;  5CV8 A;  1I4G A;  4CJ1 B;  1DYQ A;  5E4W C;  3QO2 A;  1TWA B;  4F8M A;  1O7Z A;  1JOR A;  1S5E D;  2L9H A;  3T4A C;  3A56 A;  2KQ3 A;  1EY8 A;  2LFN A;  2JEA I;  5EKK A;  2N88 A;  3S1R B;  1FYC A;  1V1O A;  2B2T A;  2SEB D;  5KGU A;  5CYU A;  1B9M A;  1IW7 D;  1GUN A;  2PNR C;  1KDC A;  3IFD A;  1WTW A;  3E0J A;  2E2D C;  2O2L D;  1WTV A;  2VNU D;  4ODG A;  4C3J B;  1L0X B;  3N6R A;  4XT1 B;  3EQL C;  1II3 A;  1GOZ A;  1BNZ A;  3BDO A;  1Y8P B;  5CMD A;  2MGS A;  1ZYR C;  4QF4 A;  2EJG C;  2G9H D;  1SYE A;  2F0P A;  3VA5 A;  1SAP A;  3SK6 A;  1TY2 A;  1DON A;  1BQQ T;  2XIW A;  1U4P A;  1RF2 D;  2XRQ D;  5IIF A;  4DAY A;  3KBX A;  1SBB B;  3CHB D;  1LAC A;  1G8Z D;  4WRD A;  2B8F A;  2D62 A;  1Q3L A;  4I65 A;  1ONL A;  3MXP A;  1WTP A;  1HA5 A;  1M4V A;  4HCS A;  2E76 C;  1IL8 A;  2AUK A;  2EYO A;  4J1M A;  3MHB A;  1JWU D;  4G7H C;  2EYP A;  3M85 A;  2IT1 A;  2O5I C;  5M9O A;  2Z4I A;  3HS0 C;  2PPB C;  2F0F A;  2F0W A;  2YYZ A;  2E2I B;  3HOX B;  4HED A;  2K5Q A;  4X3T A;  4RCO A;  4RCN A;  1GJX A;  1TY0 A;  1FNU A;  3MA2 B;  5IT9 E;  5BN5 A;  1XX8 A;  4HSP A;  3IL8 A;  4WFN 3;  1W6J A;  3HZX A;  1HFN A;  5EPJ A;  3I4M B;  3NWS A;  3DWQ A;  4YIJ A;  5ISR A;  2WKC A;  2XN9 C;  1MSH A;  5JJZ A;  3FVQ A;  2ICI A;  4ZRZ A;  3GO5 A;  4E6I A;  2YU9 B;  3TP5 A;  1CHQ D;  3FRP B;  2AQ1 B;  3MZ5 A;  3VYR A;  3DXJ C;  1DOK A;  3BZD B;  3A8K E;  2JE6 I;  3K7A B;  4DA2 A;  1F2Y A;  1ROD A;  1EU3 A;  1EIH A;  1Q90 A;  2CQA A;  1F9Q A;  3VR5 A;  3OWE B;  1A2U A;  1BCP F;  3UI2 A;  4NP5 A;  3C3L A;  1DOL A;  1Q12 A;  2A6H C;  4WJW A;  4IFD J;  4RGN A;  1F77 A;  1WCM B;  4XYO A;  3K6O A;  4OO1 I;  4DFA A;  1U9R A;  1Y8O B;  3TSS A;  1C48 A;  2B2V C;  1R4P B;  1PZI D;  3TME A;  1CFM A;  5EKL A;  2NUC A;  3FEW X;  3ERO A;  1TU2 B;  5LL6 X;  5M5X B;  2L4N A;  3HP3 A;  5C0X J;  1LTA D;  4G4K A;  2BE5 D;  4A3B B;  4A3D B;  3BG3 A;  3TDQ A;  1TKW B;  1HRJ A;  1STY A;  4QIW B;  1G2S A;  1VF5 C;  4MIU A;  3MXN A;  4XYQ A;  1O7L A;  3J81 L;  3S2H B;  5C4J B;  2EYF A;  1PRT C;  2A68 C;  2EOT A;  5KEE A;  4K6D A;  4HMJ A;  3QWN A;  1SNC A;  4HCE A;  4F7X A;  4EVO A;  2KVM A;  3GTP B;  3DUZ A;  1ICW A;  3K5M A;  1V8Q A;  3SK5 A;  2L12 A;  2E2H B;  5I6W A;  1HTL D;  1QOH A;  5F2D A;  2Q8I B;  1BR9 A;  1IHZ A;  3Q22 A;  1EYD A;  1PFN A;  3IFT A;  1HHV A;  2L11 A;  1JOK A;  1EY9 A;  4IN3 A;  4OO1 H;  1EIG A;  3RD4 A;  3T16 A;  2A6H D;  5G3L D;  3JAM L;  3D6C A;  3TZD A;  4R8I A;  4HMI A;  2RDH A;  2M2L A;  1A3U A;  4LJZ C;  2WB1 B;  2BDN A;  3M3Y B;  3TBI B;  2RSN A;  3OHX C;  4RHS A;  4DGZ A;  3FMC A;  2K33 A;  4KD3 A;  2A6E C;  1Y8N B;  3PMF A;  1VCI A;  4KI0 A;  3HOY B;  1HA6 A;  2RSO A;  1NSN S;  3KLS A;  1B2T A;  2XRS D;  5JOB A;  4EQO A;  3CU7 A;  5IOC A;  5C44 B;  5FLX E;  2D9U A;  5D3D A;  4KD4 A;  2HQE A;  3P7J A;  3HOV B;  4DF7 A;  1PRT D;  1VMC A;  1I4X A;  2A68 D;  2RA4 A;  4A3M B;  4RGM A;  3K5L A;  2K32 A;  2PZT A;  3GTO B;  1RKN A;  1XTC D;  3BVM A;  4O1N A;  3SK4 A;  3NWT A;  1LTT D;  3C1F A;  3C1E A;  3V2T A;  1I4R A;  2VB3 X;  3W2D A;  4K8I A;  4CKC A;  3MC0 B;  1QNU A;  4P2C B;  2B2Y A;  2NN6 H;  1JR0 D;  3VR3 A;  2L0C A;  1A15 A;  1HQR D;  3VR2 A;  1K8O A;  4FO2 A;  3VYU A;  1SMY D;  2ENB A;  1R4Q B;  3MFG A;  3M4Y A;  3M7G A;  4G57 A;  1TS2 A;  1BDO A;  1T5E A;  4EQP A;  2ZXP A;  5ELD A;  4KKU A;  4K5V A;  1SDF A;  1PFM A;  3P75 A;  5JEA G;  3I91 A;  1NCV A;  1MBY A;  1ZEQ X;  4TKO B;  4PV1 C;  4RGT A;  1XYI A;  2A6E D;  1WD0 A;  4K6L A;  1KNA A;  3NP8 A;  5TSS A;  2L55 A;  1SXT A;  1EYA A;  2HUG A;  3DHQ A;  2ID0 A;  1SYC A;  2K05 A;  2MPM A;  4Z9C B;  4A3F B;  1VF7 A;  2LKV A;  5C3X A;  3W3A A;  1KAA A;  3U9S A;  5E4X A;  1IYV A;  3NBI A;  3OMG A;  2CHB D;  1KLG D;  1I4Q A;  2Q8R E;  1ENC A;  1X3P A;  2MHV A;  3AU7 A;  2KED A;  3R8B A;  1GHK A;  3FDT A;  1FR3 A;  2C5C A;  5KND A;  4DNT B;  2O4X A;  5KYI A;  5EBD A;  1JWS D;  1CTM A;  3OMC A;  4OL7 A;  4H7B A;  5DM6 3;  5JVG 3;  2NVX B;  5CV5 A;  2CW0 C;  4FF4 A;  1Z6H A;  1YNN C;  1I6V C;  2RVL A;  4K5X A;  1LTB D;  3N52 A;  2WII B;  4CKB A;  3V05 A;  2F3W A;  1ZKO A;  4NW2 A;  3J80 E;  4H13 C;  4X3K A;  2KCN A;  3VR4 A;  3HOZ B;  2B8G A;  1CI3 M;  4NDX A;  5I9O A;  4A3J B;  1LTG D;  4JBW A;  2BDO A;  2IWH A;  1DXM A;  1DOM A;  1JWM D;  4IUT A;  5KYL A;  2F0J A;  1ZXT A;  5EBC A;  3SK8 A;  3K58 A;  2HDL A;  2NTS A;  2R92 B;  5FKA C;  1STN A;  3RZD B;  3ND8 A;  1TII D;  1SE3 A;  5K5P A;  5M5W B;  4KTA A;  2Z8L A;  3ND9 A;  2JA5 B;  2FMM A;  4X3S A;  3X3M A;  2X69 A;  1O80 A;  4BBR B;  1HTP A;  2PZW A;  3KK7 A;  1G29 1;  5CBA E;  3PO3 B;  3EJI A;  4K14 A;  1UEA B;  1LT3 D;  1STE A;  4XIG S;  5T1G A;  3Q24 A;  1KTK A;  2A74 C;  2K6A A;  4J8Q A;  3WDN A;  4C3I G;  3RMH A;  1D5Z C;  1KAB A;  3P20 A;  3URY A;  1WTQ A;  2SNS A;  3MEH A;  3QJY A;  4ZUI A;  4DXG A;  1L0Y B;  1F9P A;  2CW0 D;  2PZU A;  1YNN D;  3TZU A;  3QIA A;  2EPB A;  4X3U A;  1F2L A;  2PO4 A;  4HTH A;  4UAI A;  4KY6 A;  1SE4 A;  5FK9 C;  1DCZ A;  2R7Z B;  5IGF A;  1WTX A;  2BA1 A;  4UDU C;  4DAP A;  5EPK A;  4KN7 C;  3OW7 A;  1FNV A;  4U67 3;  4ZK9 B;  2EYL A;  2B2W C;  1PXU A;  3HOW B;  5C4Z A;  2PMZ B;  1B53 A;  4ZKC B;  1MI2 A;  4QCL A;  1ENF A;  5J1Z A;  1H9M A;  2F03 A;  1XWE A;  2AUJ D;  5C5M A;  2KJX A;  5I6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...