2VB3X

Crystal structure of ag(i)cusf
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords CATION EFFLUX SYSTEM PROTEIN CUSF
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vb3X01
2VB3X 2L55A 3TDQA 1ZEQX 3E6ZX 2QCPX 2VB2X
chains in the Genus database with same CATH superfamily
1SYFA 1QVGA 1W6JA 3NXWA 4NPSA 2K5HA 5CV9A 2AQ3B 1DONA 4F87A 2LXJA 4P74A 2V4DA 2PNRC 5IOCA 2X6GA 2HCCA 3K7AB 5I9PA 3PSIA 4DAVA 5JJIA 3S2HB 2EYJA 4DV6Q 1FNVA 4UP7A 1QUQA 1ZKOA 4JI8Q 4L5SA 4P75A 1Q86C 3P75A 3U9OA 1TWAB 2N8NA 2EYHA 5C44H 1BCPD 1NR2A 1B53A 3PO3H 1CKNA 1Q1BA 4DXGA 1LTSD 1QG7A 4J8QA 3J81j 4DR5Q 1Q1EA 4A3EB 3ER0A 1E1OA 4IPDA 3C1EA 4OXPA 4PG3A 2K14A 1HJPA 1GHKA 1CUKA 5IYCH 2Z4HA 1I4RA 1O7IA 2JA9A 3E0EA 4PZ7A 3MEFA 3M3YH 4K2LA 1SE2A 5FO7B 2OQ0A 3QG1A 3JAML 2K5NA 1EEID 3R8BA 4LAAA 3VR3A 1PTOD 2FMMA 1CHPD 2MGSA 4A3LH 3OMCA 5I2XA 3BU2A 5M5YH 2ZJQA 2OWOA 4IFDH 3GTQB 1ESFA 2IHEA 5CV4A 3UDFA 1U0LA 2KECA 4M8AA 4JG2A 1TXYA 1YNNC 1QB5D 4GNXC 4LF5L 2L4NA 1ASYA 1PYSB 3X3NA 1W2BA 4YY3L 3A54A 4KN4C 1TWFB 1D5MC 3MXNA 2OTJA 2FINB 1JWMD 4A3JB 3MA2B 2ZT9C 2IPKD 1A3UA 1C4QA 3K8AA 4UP9A 3AB9A 3I4NG 4JCVE 1GUWA 2SNSA 2A6HD 1VQBA 1UEBA 2UUAL 3HGBA 2Y0SE 4A4IA 4K5XA 4JK1C 2YTXA 1X32A 3OTOQ 3OHXC 3NBHB 1AZQA 1ZEQX 3CCQA 3PCOB 4A3KH 3S1RB 3IFTA 1XPOA 1KQSA 1PZKD 1MJEA 4DR4L 1FJGL 3TQYA 3S17H 3HS0C 4XT3B 1BVSA 3GD7A 4BY7H 1M8AA 1RTOA 3PIP3 2OTLA 2K32A 1EZ6A 4DR5L 3CCRA 4OWWB 1CI3M 2BA1A 2EJMA 4H02A 4UDUC 3DWQA 3DEPA 1M1KC 1MJCA 3A7LA 4K6LA 2JXMB 4JI6L 2H4OA 1SXTA 1X56A 2CVRA 1Y8OB 1WTQA 1WTOA 3QB3A 3HOWG 3NPPA 5EPJA 3WWVA 1MD2D 1EL0A 2MJ8A 4X64L 2R93H 1H9SA 1X3GA 3CCMA 3OW7A 4MNOA 3I73A 2BOSA 2B63B 3F1ZA 4X64Q 2O5JC 1HNXQ 4BBRH 2VL6A 3I56A 1U4LA 4C1NK 3A55A 4B9WA 1IW7C 2SNMA 2K5WA 1VMPA 1EFWA 4B3RQ 1VQKA 4MTNA 3TZDA 4RAUC 4YWMA 1AZPA 5DLQE 2IY5B 4JI5L 1EIYB 1NR4A 1NJIC 1EZ8A 2VQFL 2RF4A 2KUMA 3HOXH 5NUCA 3GTMB 4RGOS 3J80c 1D2BA 4K5WA 4LFAQ 1KDAA 4A3MG 4KHPL 1CFMA 2G9DA 1AE3A 3S1NH 1OXSC 3SK4A 1IW7D 2EJGC 3DUZA 2CKZB 3SXHA 3SEBA 1GJXA 3BZKA 2Z4IA 1SMXA 2PYKA 1U5KA 1Q8IA 3M7NA 1II3A 3JAMc 2A74C 3QO2A 4RGTA 1STBA 1EFID 3HOVB 3S1QH 1TVXA 2F0LA 3T53B 4MIUA 2EY6A 4Y7NH 2UUBL 2FHTA 5IODA 2K50A 2O4XA 3FKIH 2BA0A 1YZ6A 5C3XA 3PO3G 2L1BA 4FF4A 2F0QA 3Q8DA 5HGQA 3A8IE 1E24A 2AUKA 3FDTA 1EU4A 4Q5VA 1KNAA 3UE0A 3G71A 4A75A 3AFQA 4XTCS 3PGZA 1UNSA 4BY1H 2J4XA 4OEMB 2NN6I 4YCVA 3WOEA 4B3ML 3TEHB 2RHQB 5ELCA 1SYEA 2MFIA 4DV3Q 2F0DA 1W3SA 1BQQT 4PZ6A 4G4KA 3V2TA 2Z6KA 2GA4B 1VQPA 5EKKA 5ELFA 2EY2A 2PI2A 2B2VA 3DHQA 1LM0A 5C4XB 3I3CA 3K7AH 1B2TA 2EY1A 2EYOA 4A3DH 3CPWA 3CRLC 2GVAA 1TWCB 3HOUG 4RCOA 2D9UA 1PH5A 3C1FA 2K03A 1GUGA 4NXMQ 2JEAI 2XIWA 4DR7L 4L5QA 4A3CG 1GUNA 2CH4W 3HKZE 1B1ZA 1VQGA 1TS4A 4R8NA 1AEXA 4IUQA 4HSVA 3RZDH 1XNQL 1WTPA 1F9SA 4IFDG 2O2LD 2Z6KC 3FVQA 3PUXA 3H3VH 1AP0A 3FKIB 2K1BA 1NNXA 3GP7A 4NXML 2F0SA 1HNXL 4FP5D 3NK9A 4DK6C 2KBNA 3T1YL 1LTTD 2WP8J 5T1GA 1I50H 1YNXA 1MSGA 3A0JA 2PMZE 1S5FD 5C0XJ 2RVLA 4A3BG 1K3RA 2VXWA 3KFUA 2AKWB 3SGIA 3OW2A 3AFPA 3OIQA 4A3BB 1Q46A 2MO0A 2QKIC 5JAVA 2L55A 4CGYB 2WAQE 4BY7G 4ALPA 2PW7A 4LF8Q 3A8JE 1SRUA 2J7ZA 2QA4A 1VQFA 3CKIB 1KNEA 1Q12A 4BA2I 4EVOA 3VR4A 1ICWA 3FPPA 1YJWA 2A73B 4A93H 2JA6G 2UUAQ 4JI8L 1C7YA 1JE5A 1SEBD 4ZUIA 1JICA 5JVH3 3TDQA 4DR2Q 1PRTF 4S3SA 5CV6A 3KBGA 2PMZB 5IGFA 5M5XH 2F0HA 2QDBA 5EBCA 2NVTH 2RSOA 1EYDA 3CPFA 5IT9E 3DXJC 1JWUD 2LMCB 1PH3A 2TSSA 2PO4A 1P16A 4X3SA 4B3TL 3AEVA 2NZHA 4A3LG 2DN8A 5EAYA 1YIJA 4A3DG 2VNUD 4DR1L 4LF5Q 2IL8A 1SJED 5D3IB 4P72A 5JPNC 1Q82C 1HZCA 2KHSA 2Z0SA 5TSSA 5C0XI 2EE1A 3F2BA 1L2FA 4ZUJA 1BF4A 4IUTA 2JE6I 3E3XA 2F0PA 4UPAA 1BR9A 2K28A 5M3FG 2JK8A 4AYBG 3STBD 4RGMA 2R7DA 1V43A 3HRZC 2OT2A 1HQRD 4WRDA 1WTWA 4DV6L 1SYBA 1JT8A 1I4GA 1WCMH 3BG3A 4GLAC 2UU9Q 5BR8Q 3LWEA 4IPHA 2NZ1D 1EQTA 1OXXK 1K28A 1FGUA 1QWYA 4JPBW 1X3QA 2LS01 3EBEA 4TSSA 1PRTB 2XWBB 2XRQD 1WYDA 4EQNA 1KTKA 1FL0A 3LWUA 2N55A 2K05A 4GOPC 2OEOA 3I55A 1S5DD 4X3UA 1L1OB 2E5LL 1I3QB 3QOJA 4JI0Q 2A6ED 4KMUC 2ZM6Q 4FF1A 2O5IC 2Q2HA 1STHA 3EN2A 4K2KA 4KKSA 4Z9CB 1A0IA 4YWLA 3RMHA 4FXGC 1E22A 1VQMA 1XMOQ 2NWGA 1Q3LA 4CKBA 1CZWA 3QR8A 1B44D 4JYAL 2VZAA 3CCJA 1KIXA 3TBIB 2KCTA 4JI4L 3M4QA 4IUVA 1PMRA 2WV6D 3RNUA 1YEZA 1E0BA 2R6GA 4DV4Q 2K7VA 1DOMA 2CW0D 5E3FA 3TP8A 4CBVA 4LF6Q 2VQFQ 3AYHB 2K52A 3E9HA 1GM5A 2NYZD 1VQJA 2IX3A 3HOVH 3S1QB 5FK9C 1R4PB 1FVIA 1WTRA 3DM3A 3ICEA 4LF4L 1IBKQ 5CMDA 2ZM6L 4GKKL 1G2SA 1G291 4KJNA 4NKLA 3R2TA 1TS3A 2AHOB 2WFWA 3HOYH 3GTOB 1K83H 1EWIA 3ZYYX 5KNBA 1PH8A 1IL2A 2SDFA 4DR3L 1N33L 2EZVA 1ICFB 2R7ZH 2HT1A 1XNRL 4YHHL 1VQ9A 1B50A 1RDPD 3TMEA 2K5DA 2L12A 1K8GA 5M5YB 4C3HH 3SE0A 2HQLA 1SNPA 3D0FA 1A15A 3DM1A 1PV4A 2DNCA 3CQZH 1GO3E 2NUCA 1I94L 2L9HA 1ENFA 1L0XB 1X3FA 4C3IH 4AQYL 2UXBQ 5KYLA 2VB3X 1PDQA 1HFNA 3S16B 1PH2A 4DV0Q 3L7ZC 2VQEQ 4DUZQ 5KIXA 3VA7A 2ZTDA 4DV2Q 2EIFA 1YNJC 1IBMQ 3A5ZB 1JJCB 2BE5C 1X55A 2LFNA 4BBSB 4X62L 5C5LA 5C4XG 4O1NA 4DR6Q 4HCSA 2R3ZA 3J7ZC 2CHBD 3E9IA 3TREA 1IBML 2Q2IA 4ULLA 2RQXA 1ENAA 4DFAA 5A35A 1SE8A 3MFGA 1VQ6A 3A5UA 5E4XA 4X66L 1JCKB 2JSOA 1NE3A 4DU9A 4X6AH 4LK1C 1TWGH 1VQDA 1B8AA 2NVQH 2DY7A 1SR3A 1CKOA 5COYA 3T13A 4DV7L 4HJAA 2Q2UA 4WJ4A 2TMPA 3BJUA 5DEHA 5I6WA 2RDHA 1CSPA 3J81L 4G7OC 1H95A 1SFOH 1S5BD 2N3SA 3AQQA 1SMYD 1IBLQ 1D7QA 2Y0SG 3V96A 2QGQA 3N6RA 3T16A 4JV5Q 3K0YA 1K0SA 4ZKBB 1RIPA 2ASBA 1X3EA 1Z47A 3FPUB 1A62A 4F8MA 1VDZA 3FP9A 2NN6G 1YHQA 1N8RC 1LTGD 4XQNA 1IBKL 4A3EG 3NHHA 1WVLA 5EPKA 1UUPA 1IZ6A 3KLSA 2B2WA 2EDGA 3UDGA 3SHLA 5LL6X 4HN7A 1SMYC 3EROA 5CC4A 4EQ5A 1PH9A 4DN4M 3F2CA 1XTCD 1V8QA 2K75A 1DYQA 1H9JA 4KY7A 2QEXA 1F77A 2Q8RE 1S40A 1BCPF 2C5CA 3BDOA 4L5TA 1O78A 4KY6A 5E4WC 1VQIA 2KHJA 1WTHA 1SROA 4DV0L 4QMGA 3JC66 3RUZA 2NVXH 1LTRD 3MAQA 2WB1B 1XTDA 3VYRA 1EY7A 5K36H 3M4PA 3QOLA 4JBMA 2XN9C 3BYTB 4IUPA 3TS0A 4V0BA 3MTSA 4PQXA 4N8FA 2KCMA 3D4RA 3BDCA 3T4AC 2Q8TA 3T1YQ 3RLNA 3VR2A 1GXDC 1EWCA 1X65A 5ELDA 2NVTB 2F0JA 2YYZA 1LACA 4LF4Q 2CQOA 2UUBQ 1Q90A 4O42A 3H3VI 3H91A 1A8VA 1A2UA 4L5RC 5IT9L 4PMBA 2CQAA 4F7XA 4X65Q 1LT4D 1PVOA 1UE6A 3S15B 4RWSC 2QEJC 3T1HL 3GTLB 4GOPB 4A76A 2K33A 2QW7A 4TRDA 5GADC 1SYCA 5CBAE 5JEAJ 1YJ9A 5LHY1 2VW9A 3HOWB 1IL8A 1SLJA 2E2HH 1TU2B 2XWJB 5T1IA 3CU7A 3MXNB 4MTKA 4I7ZC 4Y7NB 4GNXA 2PPBC 1EY0A 4A3EH 1NAPA 1HA5A 5DAUA 3EVQA 3S24A 2X6LA 4K8JA 2RDFA 2JEBI 5IYDH 5I4DA 4GS3A 3CMAA 4JI4Q 3R2IA 4RH6A 2B8FA 3EJIA 3T1HQ 2F1MA 1XX8A 1A3TA 1AH9A 2E5LQ 4LUOA 4HJ8A 1XPUA 2A68C 3RN2A 2F0VA 4LMQD 4APVA 3J81i 4ODGA 1ZYRC 2K01A 1I6HH 4KI0A 1A63A 2HQEA 3I4LA 4IO9A 2IWHA 2I5HA 5EQ0A 1G2TA 2F0NA 4GKJQ 1IBLL 1EYGA 1Y1WH 3T51B 5DM73 1E3PA 4H13C 2SEBD 1YNND 4UAIA 2HIVA 1ASZA 5CV7A 5FJ8G 3KDFA 1DGSA 4A3KB 2EYPA 3D4DA 2VUMB 1EOTA 1V1PB 3HOWH 1L0YB 1DXMA 5JJKA 3BYYB 1L0WA 2AWOA 4XQQA 3CXCA 1SAPA 3KF8A 4KD3A 4A3IB 3RD4A 5ELNA 1UE7A 4ZRZA 1XMOL 2XVSA 4RCNA 1H9RA 1WCMG 1GOZA 2B2TA 2F0GA 2M9VA 5C4ZA 5ELEA 1RJTA 3SVMA 5C6AA 2D2CC 2JA8G 5M3FH 5L37A 1I94Q 1YI2A 1B3QA 3URYA 4JI1Q 3S16H 4K14A 4A3MH 3PUYA 3PIOA 1PTOF 2VB2X 1PH6A 3HOYB 4YY3Q 4OIJA 4LNQA 1QJOA 3MVVA 1Q7YC 4BBSH 4A3FB 1QOHA 4DR2L 2JA8H 5IYDG 3PIO3 1VQ7A 5JPMC 1CHQD 4QGUA 3ITPA 1VMCA 3I4OA 4QL5A 4JI1L 1HHVA 2LSSA 5J1ZA 3PMFA 1STNA 4QF4A 3IKJA 4A3GB 4KTAA 4DV4L 3E0JA 3U9SA 5C0XH 3CD6A 3U4ZA 2R93B 2A19A 1MSHA 4CJ2C 4ME5A 2B63H 1R4QB 2CH4A 4LFAL 2Z8LA 4LWCA 2F0OA 4O0AA 1VQOA 4HTHA 2WAQB 2ZTEA 4J15A 4DNRB 4A93G 1BCPB 1JOKA 2ZXRA 4UHVA 4AYBE 1STGA 4RKLA 4EQOA 1Z7TA 4X65L 1PHJA 1Y1WG 2RSNA 5GAEC 1QNUA 4DK3C 3S14B 1KRTA 1SE3A 1KLUD 1TWGB 5JVG3 4A3FG 2PZUA 4QY7A 2EXDA 4DR1Q 3HOYG 5C3EB 1JQYD 2R7FA 5CV5A 5DM63 3DWPA 3HKZG 2ENBA 1DCZA 3B6YA 3W5OA 2D5DA 1Y69U 1ZXTA 4XDXA 2F0FA 3M7GA 1H9KA 3VYTA 5IIFA 2RCNA 1S5ED 3L9AX 2KEDA 1L1OC 1JOQA 1PTOB 1S5CD 5C44B 2MUYA 2A8VA 2L11A 1SNOA 4HMJA 1JMCA 4ABNA 1CK1A 1Y1VB 4CJ0B 1QUQB 4PNYA 2F52A 1FYCA 4X66Q 1PTOC 1CT1D 4A3GH 2EJFC 1BNZA 4KN7C 4A3IG 2R61A 3ND9A 1U4MA 4LF7Q 4DPGA 1HZBA 2B8GA 4POFA 3TSSA 4GOPA 2VUMG 1PRTD 1CKMA 1EY9A 3HOUH 1I3QH 1SE4A 5IWAQ 4IALA 1TWCH 1F2MA 3G48A 3VR5A 3GTLH 4LFCL 1H9SB 4AQYQ 3HOXG 4JV5L 1TY0A 2B2YA 4ILWA 3UE1A 3PO2B 5JJZA 2NZOA 2I5MX 1UAPA 5KGUA 3J81c 4GZYC 4H7BA 1PH1A 5IY0A 1SN8A 4BBRG 1QILA 1YHBA 1TT2A 5K36G 1NMGA 1YITA 1TWHB 4KJOA 5C44G 2SOBA 3L3OC 5EJWA 1YVCA 2PQAB 2MNAA 4RMFA 3S1MH 2F0WA 3CC7A 1I50B 3OWFA 1PZID 5M3MG 3J7AF 3PUWA 4LUVA 1HCZA 1Y8PB 1XYIA 4LF6L 2QILA 2EYLA 4X3KA 1K8OA 4A3BH 3MC0B 3HOZB 2BCOA 2XTIA 4JBKA 1WJJA 4KHPQ 1B70B 5CORA 4OIKA 1HZAA 3RZOB 1FNWA 1TS5A 1YBYA 4B08A 1BCPC 1F2YA 4LF8L 3TP7A 1Y1WB 4MN3A 3FRPB 5EGTA 4A93B 4C2MB 4K5VA 2AWNA 2EOTA 2WAQG 2NB0A 1SNCA 3SK5A 4DAMA 1XNRQ 3NTHA 2Q8IB 4IUUA 2RDGA 1T9HA 1BBXC 1MGSA 5C0XG 1OO9B 3GDEA 1NUCA 4KHVA 5CBEE 5KNCA 4G7HC 4IOCA 4C56C 3NE5B 3KBXA 1SDFA 3AU7A 4C3IB 2FXQA 3I91A 3Q0AA 4DUYQ 2CWAA 3S2DB 1IKLA 1RKNA 5ELBA 2JA5B 1VS0A 5J22A 3NWSA 1HQMC 1F9RA 4E6IA 4TVAB 2RCFA 5KNDA 2WB1G 5IGCA 1A2TA 2EY5A 1HTLD 2GVBA 1XNQQ 1EWHA 4DNIA 1S4ZA 5BN3A 4GN3B 3H0GB 1G6ZA 4JI7Q 1RCVD 1Q81C 2RA4A 3CC2A 1I6VC 3ERSX 4OL7A 3D6CA 3LGJA 2HDLA 3KDFB 1SFOB 1G8ZD 3HZXA 4JYAQ 5M5XB 2Q2TA 4JI2Q 4BY1G 3I72A 5M5WB 1QVFA 3GTGB 4B3SQ 4JOIC 2ZTCA 1F9PA 2HDMA 2JA8B 1A3VA 3PIPA 1EYCA 4GN5A 4JI2L 1DM0B 1ET6A 3P1HA 1U4RA 4RKBA 1SNQA 4YIJA 1EUJA 3MFYA 1WCMB 2YTYA 4LUZA 3MZ5A 1O7LA 2I46A 1J6QA 4FDBA 1WD0A 1WOCA 5D3DA 2B2UC 1EIFA 2ICIA 5LMUL 1EIHA 1E2ZA 2Y0SB 1EU3A 1LUZA 3OWEB 2RKSA 1VQEA 4DKAC 3I70A 2YU9B 1UWVA 4K8IA 4A3KG 2B2VC 3ULJA 5J39A 4JOIA 4RFBA 4A3JH 3DMUA 1XJVA 4DA2A 2JA5H 1ILPA 1NTGA 3C3LA 2DUDA 2PNHA 1ZYRD 2IW3A 5AJ3L 2N49A 1BUVT 1K3BC 2BE5D 1KABA 2M2LA 3J7AV 4R4OA 1ENCA 3A74A 3I4NH 1JJGA 3K5MA 4RHRA 3S14H 4QUFA 3PUZA 4BBSG 3CCLA 2JQOA 4N9PA 5DNFA 1SNDA 3TP5A 2ALYB 3VA5A 4NB3A 4O2DA 4L8JA 4BS9A 4XYQA 3H09A 2HD3A 3J80L 4PZ8A 5H1SE 4QUCA 3F8TA 4HJ9A 5IE8A 3GTGH 3QJYA 4CJ1B 1X9NA 1RL2A 3NBHA 2D0OA 5HGTA 3CRKC 5FLMH 1IYJB 2E2JB 1JC7A 3RLOA 1EIGA 1EY8A 3IAYA 3NUCA 3VYUA 2F03A 1B3AA 1Y1VH 3OYYA 2A5HA 2E2HB 4JI5Q 3CCVA 1SSOA 1N9WA 2VS1A 2AQ2B 4BXXG 1X3PA 3DLLA 4FF3A 1K9MC 2V1CC 3GTOH 2BH2A 4I7AA 4FVMA 1JR0D 1KL9A 1B4OA 3ULLA 4IZ8A 2HHHQ 3EQLC 2A69D 3TP6A 5C4JB 1TQOA 4C3HB 5KEEA 4K0KQ 4RHSA 2P5ZX 2PI2E 3CQZB 5D14A 3WOFA 2WIIB 5FLMG 5IYBH 3CCSA 4KKTA 4HIMA 2OXPA 4IN3A 4DR7Q 1FGBD 3KF6A 1F2LA 2E2IH 2I07B 3GV3A 1DOLA 2ICEC 2NVYB 1G6PA 5IWAL 2RHSB 5M9OA 4R4QA 1YJNA 3DWAA 3R93A 1STEA 4ZAIA 1VF7A 3FHWA 3G4SA 1JOOA 2ATWA 2K5VA 1KDCA 4B9XA 2IX1A 2KA7A 2XSCA 2PCFB 1XPRA 1HRJA 2ID0A 1KAWA 3SDZA 4HR7B 1CTMA 3A7AB 4R1JA 5GROA 5FLXE 4TKOB 2VUMH 1PH7A 3OSOA 2F3VA 5LL6S 2F0IA 2ZJRA 4DK0A 1Y14B 2NVQB 1BBUA 4K0KL 1Z9FA 1SNMA 1VQ8A 4Y52H 3K5NA 4CDFC 1OXUA 4OO1H 1Q8KA 1RF2D 1M4VA 2G5DA 2JJQA 1ESRA 1W6KA 3EA6A 3CW2C 4I65A 3L0OA 1QNKA 4NMZA 4OHJA 3I7FA 5ISRA 1EY5A 5EKIA 3D31A 2QCPX 5GAHC 5FO8B 4R8IA 4DXFA 3J7A5 1TWAH 2PQEA 1G51A 1QE6A 1S3OA 1GUSA 4AYBB 2N88A 2PQAA 2JA7B 5M3FB 1X6OA 4OWXB 1EQRA 1JORA 1MIUA 4MHEA 4N9TA 4LFCQ 5ELOA 3VR6A 5LMNQ 4IPCA 1N32Q 4IPGA 1STYA 3G6EA 3F2DA 4DUZL 3M4OH 3RZOH 3RR5A 3C2PA 4ZK9B 1AFPA 3GTKB 4P71A 2A1AA 1N32L 4B3SL 3SK8A 1VCIA 1KHIA 1PZJD 4LF7L 4JC0A 3VYSA 1V1OA 4NW2A 1LTLA 1PA6A 2A6HC 3CF5A 3HP3A 4L6TB 4B3RL 3H6MA 4OO1G 3CHBD 4QQBX 2E8GA 4N8X1 3S2DH 4GLXA 3K5OA 4M1UB 4HIKA 4H44C 1C0AA 2R92B 2R7ZG 3BVMA 1CZGA 4GN4B 2H1EA 2L5TA 2BH8A 1NSNS 2DY8A 4DUYL 2F4VL 2NN6H 3BVZA 3OPOA 1R9TB 3CMEA 4FF2A 3M4YA 1EEFD 1HNWQ 4ZQ3A 4EGVA 4Q0FA 3S1RH 5GAGC 5IYCG 2XNAC 3TZUA 5KRUA 3S17B 3ERQA 5C5MA 1D5ZC 4CDCC 4BY7B 4LF9Q 3AMUA 3P20A 4FXKC 2E74C 4HAEA 4JVZA 2B3GA 1PXUA 4XIGS 5JOBA 5IP9G 4ID6A 4X62Q 3NWTA 1IKMA 2IX0A 1S72A 1M90C 4R4CA 3RLFA 3GTPH 1GHJA 2UXCQ 1TKWB 4OX9Q 3CC4A 4IJHA 3BVGA 3BS1A 1RODA 3PV0A 2UXDL 2AMCB 4JI7L 3KF8B 1GVPA 3FKIG 1TR5A 1AE2A 5EKLA 3HKSA 1XMQL 2K6AA 1BDOA 1HR0Q 2K5QA 4FXDA 5FLXc 2A6EC 1EQQA 2Z6BA 2AUJD 4V190 3A56A 2R7ZB 2R92G 5HY6A 2DNEA 2KENA 3PQIA 3E5SA 1BKBA 2L0CA 1FR3A 2B2TC 1GUTA 3W1BA 2UU9L 1O7ZA 2UXCL 2FMCA 5FOBB 4L63B 3IFDA 5LMNW 1N36Q 1PH4A 4F88A 1K8AC 4IFDI 4WORA 4HCEA 1KC8C 1Y8NB 3KK7A 1PLFA 3KYHC 2CW0C 4G57A 3GTMH 1QVCA 4EX5A 2JN4A 3NEMA 2HIXA 4DF7A 3TS2A 1I6HB 5HURA 4ZYSA 4DR4Q 3QWNA 5JJLA 4JI3Q 4R9WA 1WTVA 1LO5D 4CHTB 3KOJA 5I6YA 3OTOL 1PYBA 4NDXA 1WD1A 4J1MA 5IGEA 2I5LX 4C3JH 3VDYA 4K6DA 1IHZA 4AH6A 2ES2A 3FEWX 5EPLA 4DNTB 1CQFA 2JA7G 2KQ3A 4PMWA 4CKEA 4DV1L 5F2DA 1I4QA 5GQOA 3J80E 2F0MA 3KJOA 1F2ZA 2B2WC 3EFXD 1CKNB 2CWPA 3HFZB 1P8LA 4HSPA 3NQTA 2F0UA 5A2QE 1LT6D 2LY7A 4A3FH 4A3DB 4DV1Q 4H0LC 4C2MH 4HIOA 3FMCA 1YHAA 3ONAB 5A2QL 4BY1B 3IL8A 1HR0L 1XXGA 1IYUA 1KAAA 1E2WA 1HFGA 4KHZA 1HTPA 4HEDA 1LV9A 5M3MH 3D4WA 2WKCA 3SR1A 2UUCQ 2MPMA 1TWFH 4KD4A 1HA6A 4OO1I 3H0GG 3O13A 2MHVA 1KLGD 3KF6B 4WJ3M 2QF7A 3TRZA 3UDXA 2KOLA 1PFBA 1NBWA 3GQBA 3J7YW 1AW7A 3X3MA 2DJGC 2ZXOA 1VQLA 2F3IA 3NTKA 2JA6B 1K0RA 4IUNA 2KHIA 2NVXB 3H0GH 4OWTB 2FFKB 4JI0L 2J0TD 2VQEL 3MXGA 1OXVA 4U673 1HR0W 5BN4A 5IP7G 3K59A 5AFWA 5I9OA 4C3IG 4QIWB 5IP9H 2UXBL 4KK7A 2NBFA 3D6WA 4HJ5A 1Z6HA 1BOSA 1XWEA 2H5XA 2IT1A 2F0KA 4C3HG 3QIAA 4JBWA 4CDEC 3SK6A 5C3EH 4BWGB 1DOKA 2E2DC 2KCCA 2C9OA 4ME3A 5FLXL 1V1QA 4LFBL 1MHWC 1J8IA 1SBBB 4RG1A 1XMQQ 3M4OB 1T5EA 4FO2A 3U4VA 1H9MA 5M5WH 3CCUA 3L2PA 3R3OA 4IURA 2UXDQ 5E1FA 1D1KA 1J9OA 1RHPA 2MO1A 3H3VC 3Q24A 1I4PA 4DV7Q 1PTOH 4OGQC 4P73A 4GKKQ 3BZCA 1GUOA 1I4XA 4P2CB 3KLSX 3HOZG 2F4IA 3NELA 1LTID 1KRSA 4GNXB 2JA7H 3STBC 1VQHA 1GD7A 1LYLA 3KLWA 1ONLA 1QCBD 4IFDJ 1IYVA 2MQHA 4ZCKA 2OCEA 3KJPA 4XQJA 2Z9HA 1KD1C 1GKHA 1C8CA 2EYMA 4X3TA 4IOAA 1E7ZA 1HH2P 1CA5A 3GTKH 2WINB 2IHFA 1HNZL 1D6EC 4HIDA 3I90A 2G9HD 3JAME 3HOUB 4B3MQ 4YWKA 1WI5A 4CKCA 4YCUA 1VQ4A 1MKHA 4DV5Q 4XXEA 1CA6A 4B3TQ 2X69A 2F4VQ 3Q23A 2F3WA 1FD7D 3PO2G 2CFMA 1YNJD 1HUMA 2PZWA 3NSWA 1UE5A 1LT5D 3M9BA 3HOXB 1OTCA 2Z1CA 3ULPA 2M00A 4NXNQ 3U58A 2YTVA 3UI2A 1V1PA 4DR3Q 1ILQA 3U50C 1BO0A 4IJLA 1PFSA 5JEAH 2R92H 3I4MH 1JJ2A 4J6HA 3S2HH 4JBJA 5BR8L 4FNFA 1NY4A 4HMIA 2QDLA 3K7UC 3OOCA 4DV5L 1R9TH 1U4PA 2E2JH 2LXKA 1N34L 1HNZQ 1EY6A 3PO3B 1QZHA 1B7YB 1OXTA 1O7YA 1LABA 1UEAB 4DV2L 3CP0A 1K73C 3J80i 4A3IH 1Y1VG 2K4KA 1ML0D 3HOZH 1E2VA 4KY5A 2UUCL 1D1IA 3H94A 3MHBA 2KEEA 1K8MA 3HOVG 1DJRD 1N34Q 3NENA 1JWSD 5C4JH 4TQUS 3KUPA 1HNWL 2L15A 3D3RA 4LF9L 4EQPA 3GTPB 2B39A 5C3EG 1LTAD 2HUGA 1TIID 1JE4A 4HJ7A 3K58A 2E2IB 4CDDC 2EYFA 3D8GA 1N33Q 1RD9D 4UY8C 1I4HA 2NVYH 1J5EL 1I5FA 1QZGA 4A3MB 3NBIA 2LKVA 3K5LA 2A69C 4LFBQ 5IP7H 1VQAA 2EQSA 2WACA 3E6ZX 1EY4A 4G7ZC 3RN5A 1TS2A 1CSQA 2F0TA 4YHHQ 2VY3A 2A68D 2JA5G 5C4XH 1T5XD 1HPCA 4AIMA 3JAMi 1EYAA 3K81C 3I4MB 4R4TA 4R4IA 4ZKCB 2PW5A 4JI6Q 1VQ5A 2OF1A 3C46A 5J3BA 4KV6A 3GTQH 2R93G 4DR6L 4C1NI 3I2ZA 4QB4A 3WDNA 3A8KE 2KVMA 1D8LA 1EOVA 1NMFA 2B2UA 1O80A 4PMCA 2B63G 1ET9A 3GV6A 3G6JB 2NTTA 1CQVA 3OMGA 3RZDB 2D62A 4FYDA 1KDBA 4QCLA 1C9OA 1TY2A 5CYUA 1K83B 2OQKA 1SYDA 5FO9B 3F2UA 1FJGQ 4IQZA 1DD2A 1WTXA 4RGNA 4MZ9A 4GLVB 2IJ0A 3LX0A 1RTNA 4OELB 4LJZC 4C3JB 5I2YA 1SJHD 1L1OA 2CCZA 2HHHL 2FJ2A 3M85A 5M3MB 3DEOA 4DAPA 4DAYA 3CCEA 1STAA 2BDNA 3GTJH 5IGDA 3K57A 3H15A 2F0EA 5KYIA 2E76C 1DZ1A 4WFN3 5K5PA 2E75C 3K6OA 1SYGA 4U68A 1B9MA 2DGYA 2N78A 3PF5A 1J5EQ 1D5XC 1UE1A 4YCWA 1A6XA 3W2DA 3MWYW 3HG9A 4XT1B 1B9NA 3K80C 2KCNA 3BZDB 3ZJYC 4BBRB 2PZTA 1HXYD 5CV8A 4NXNL 3UDIA 5C3WA 5IT9c 4OX9L 4JW0A 5G3LF 2EXZA 3MXPA 2GN5A 2BDOA 2RBMA 3T56B 3I4NB 3NP8A 5LMUQ 4A3JG 4NP5A 4A3CH 1PRTC 3V05A 2KJXA 1X54A 3G7LA 4LW1A 1JB7A 1WFQA 5CR3A 2B2YC 5G3LD 3NQIA 1LLRD 3LNNA 2NTSA 2I0QA 4OONA 2YU9H 2C35B 2MP1A 2ZXPA 2JP1A 5E7NA 1IXRA 1G91A 4DV3L 5FJ8H 3TN2A 3KLRA 2XRSD 1EQVA 2DJFC 5LMNL 2JA6H 1N36L 1BXTA 1PFMA 3Q6SA 3S9WA 3NTIA 2B29A 1C48A 5BN5A 5AJ3Q 4KLKA 3PO2H 4PV1C 4UP8A 1HUNA 1JB3A 1VQCA 5IYBG 2HCIA 1HZ9A 1AN8A 1MI2A 1LTBD 3J81E 3GTJB 3W3AA 3MEHA 5FKAC 3CAMA 2JYOA 3S1NB 4RA8A 4GKJL 1V9PA 4XYOA 1VQNA 1TWHH 3GO5A 3N52A 2EPBA 3HKZB 5D65A 5CGKA 1KXLA 2YV5A 2WB1E 3S1MB 4BXXH 2AQ1B 4WJWA 4DAYB 2WKDA 4C3JG 1CM9A 3PF4A 2D0PA 3ND8A 5IGBA 1MBYA 1F9QA 1U9RA 5C4HA 3Q22A 3K0XA 3EIVA 3OIPA 1BBWA 1PYWD 2EVBA 4QIWE 3I8ZA 3IRBA 3MXUA 4ZLTF 1NCVA 4DGZA 5IGGA 1PFNA 4QJFA 3M3YB 1VF5C 4JI3L 2ZJPA 1FNUA 1LT3D 3S15H 4DK1A 3W1GA 4BA1I 1E1TA 3BDLA 3I4MG 2K04A 3P7JA 3PUVA 3HEJA 5JEAG 2XGTA 5EBDA 4A3GG 4POGA 4KKUA
chains in the Genus database with same CATH topology
1SYFA 1W6JA 3NXWA 5CV9A 2AQ3B 1DONA 4F87A 2V4DA 2PNRC 5IOCA 2X6GA 2HCCA 3K7AB 5I9PA 4DAVA 3S2HB 2EYJA 1FNVA 1ZKOA 3P75A 3U9OA 1TWAB 2EYHA 1BCPD 1NR2A 1B53A 1Q1BA 4DXGA 1LTSD 1QG7A 4J8QA 1Q1EA 4A3EB 3C1EA 1GHKA 2Z4HA 1I4RA 4K2LA 1SE2A 5FO7B 3JAML 3QG1A 1EEID 3R8BA 4LAAA 3VR3A 1PTOD 2FMMA 1CHPD 2MGSA 3OMCA 5I2XA 4IFDH 3GTQB 1ESFA 5CV4A 2KECA 4M8AA 1YNNC 1QB5D 2L4NA 3X3NA 3A54A 4KN4C 1TWFB 1D5MC 3MXNA 2FINB 1JWMD 4A3JB 3MA2B 2ZT9C 2IPKD 1A3UA 1C4QA 3AB9A 1GUWA 2SNSA 2A6HD 3HGBA 4K5XA 4JK1C 1X32A 3OHXC 1AZQA 1ZEQX 3S1RB 3IFTA 1PZKD 3HS0C 4XT3B 3GD7A 1RTOA 1M8AA 3PIP3 2K32A 1EZ6A 1CI3M 2BA1A 2EJMA 4UDUC 3DWQA 3DEPA 3A7LA 4K6LA 2JXMB 2H4OA 1SXTA 2CVRA 1Y8OB 1WTQA 1WTOA 3QB3A 3NPPA 5EPJA 1MD2D 1EL0A 2MJ8A 1H9SA 3OW7A 3I73A 2BOSA 2B63B 2O5JC 1U4LA 4C1NK 3A55A 4B9WA 1IW7C 2SNMA 2K5WA 1VMPA 3TZDA 4RAUC 1AZPA 1NR4A 1EZ8A 2KUMA 5NUCA 3GTMB 4RGOS 1D2BA 4K5WA 1KDAA 1CFMA 2G9DA 1OXSC 3SK4A 1IW7D 2EJGC 3DUZA 3SXHA 3SEBA 1GJXA 2Z4IA 2PYKA 1Q8IA 3M7NA 1II3A 2A74C 3QO2A 4RGTA 1STBA 1EFID 3HOVB 1TVXA 2F0LA 3T53B 4MIUA 2EY6A 2FHTA 5IODA 2O4XA 2BA0A 5C3XA 2L1BA 4FF4A 2F0QA 3A8IE 2AUKA 3FDTA 1EU4A 4Q5VA 1KNAA 4XTCS 1UNSA 2J4XA 2NN6I 3WOEA 5ELCA 1SYEA 2F0DA 1BQQT 4G4KA 3V2TA 2GA4B 5EKKA 5ELFA 2EY2A 2B2VA 3DHQA 5C4XB 3I3CA 1B2TA 2EY1A 2EYOA 3CRLC 1TWCB 4RCOA 2D9UA 3C1FA 2K03A 1GUGA 2JEAI 2XIWA 1GUNA 1B1ZA 1TS4A 4R8NA 1AEXA 4IUQA 4HSVA 1WTPA 1F9SA 4IFDG 2O2LD 3FVQA 3PUXA 1AP0A 3FKIB 2K1BA 3GP7A 2F0SA 4FP5D 3NK9A 1LTTD 2WP8J 5T1GA 1MSGA 1S5FD 5C0XJ 2RVLA 2VXWA 3OIQA 4A3BB 2QKIC 5JAVA 2L55A 4CGYB 2PW7A 3A8JE 2J7ZA 3CKIB 1KNEA 1Q12A 4BA2I 4EVOA 3VR4A 1ICWA 3FPPA 2A73B 1SEBD 4ZUIA 1JICA 5JVH3 3TDQA 1PRTF 4S3SA 5CV6A 3KBGA 2PMZB 5IGFA 2F0HA 2QDBA 5EBCA 2RSOA 1EYDA 5IT9E 3DXJC 1JWUD 2LMCB 2TSSA 2PO4A 4X3SA 2DN8A 2VNUD 2IL8A 1SJED 5D3IB 5JPNC 2KHSA 5TSSA 5C0XI 2EE1A 4ZUJA 1BF4A 4IUTA 2JE6I 2F0PA 1BR9A 2K28A 4RGMA 1V43A 3HRZC 2OT2A 1HQRD 4WRDA 1WTWA 1SYBA 1I4GA 3BG3A 3LWEA 2NZ1D 1EQTA 1OXXK 1QWYA 1X3QA 2LS01 4TSSA 1PRTB 2XWBB 2XRQD 4EQNA 1KTKA 3LWUA 2N55A 2K05A 2OEOA 1S5DD 4X3UA 1I3QB 3QOJA 2A6ED 4KMUC 4FF1A 2O5IC 4K2KA 1STHA 4KKSA 4Z9CB 3RMHA 4FXGC 2NWGA 1Q3LA 4CKBA 1CZWA 1B44D 3TBIB 4IUVA 1PMRA 2WV6D 1E0BA 2R6GA 2K7VA 1DOMA 2CW0D 5E3FA 3TP8A 4CBVA 2NYZD 2IX3A 3S1QB 5FK9C 1R4PB 1WTRA 5CMDA 1G2SA 1G291 4KJNA 4NKLA 3R2TA 1TS3A 3GTOB 3ZYYX 5KNBA 2SDFA 2EZVA 1B50A 1RDPD 3TMEA 2K5DA 2L12A 5M5YB 3SE0A 1SNPA 1A15A 3DM1A 2DNCA 2NUCA 2L9HA 1ENFA 1L0XB 5KYLA 2VB3X 1PDQA 1HFNA 3S16B 3L7ZC 5KIXA 3VA7A 1YNJC 2BE5C 2LFNA 4BBSB 5C5LA 4O1NA 4HCSA 2R3ZA 2CHBD 4ULLA 2RQXA 1ENAA 4DFAA 5A35A 3MFGA 5E4XA 1JCKB 2JSOA 4DU9A 4LK1C 2DY7A 3T13A 5COYA 2TMPA 5I6WA 5DEHA 2RDHA 3J81L 4G7OC 1S5BD 1SMYD 3V96A 3N6RA 3T16A 3K0YA 4ZKBB 1Z47A 3FPUB 4F8MA 1VDZA 2NN6G 1LTGD 4XQNA 3NHHA 1WVLA 5EPKA 1UUPA 3KLSA 2B2WA 2EDGA 3SHLA 5LL6X 4HN7A 1SMYC 3EROA 5CC4A 4DN4M 1XTCD 1V8QA 1DYQA 1H9JA 4KY7A 1F77A 2Q8RE 1BCPF 2C5CA 3BDOA 1O78A 4KY6A 5E4WC 4QMGA 3RUZA 1LTRD 3MAQA 2WB1B 3VYRA 1EY7A 5K36H 3QOLA 2XN9C 3BYTB 4IUPA 4V0BA 3MTSA 4PQXA 3D4RA 3BDCA 3T4AC 2Q8TA 3VR2A 1GXDC 1EWCA 5ELDA 2NVTB 2F0JA 2YYZA 1LACA 1Q90A 4O42A 3H91A 1A2UA 5IT9L 4PMBA 2CQAA 4F7XA 1LT4D 3S15B 4RWSC 2QEJC 3GTLB 2K33A 4TRDA 1SYCA 5CBAE 5JEAJ 5LHY1 3HOWB 1IL8A 1TU2B 2XWJB 5T1IA 3CU7A 4I7ZC 4Y7NB 2PPBC 1EY0A 1NAPA 1HA5A 5DAUA 3EVQA 2X6LA 4K8JA 2RDFA 2JEBI 5I4DA 3R2IA 4RH6A 2B8FA 3EJIA 2F1MA 1XX8A 1A3TA 2A68C 2F0VA 4LMQD 4ODGA 1ZYRC 2K01A 4KI0A 2HQEA 3I4LA 2IWHA 5EQ0A 1G2TA 2F0NA 3T51B 5DM73 4H13C 2SEBD 1YNND 4UAIA 5CV7A 4A3KB 2EYPA 3D4DA 2VUMB 1EOTA 1V1PB 1L0YB 1DXMA 3BYYB 4XQQA 2AWOA 1SAPA 3KF8A 4KD3A 4A3IB 3RD4A 4ZRZA 2XVSA 4RCNA 1H9RA 1GOZA 2B2TA 2F0GA 2M9VA 5C4ZA 5ELEA 1RJTA 3SVMA 5C6AA 2D2CC 3URYA 4K14A 3PUYA 1PTOF 2VB2X 3HOYB 4OIJA 1QJOA 3MVVA 4A3FB 1QOHA 3PIO3 5JPMC 1CHQD 3ITPA 1VMCA 1HHVA 5J1ZA 3PMFA 1STNA 4QF4A 3IKJA 4A3GB 4KTAA 3E0JA 3U9SA 5C0XH 2R93B 1MSHA 4CJ2C 4ME5A 1R4QB 2Z8LA 2F0OA 4HTHA 2WAQB 4DNRB 1BCPB 1JOKA 2ZXRA 1STGA 4RKLA 4EQOA 1Z7TA 2RSNA 1QNUA 3S14B 1SE3A 1KLUD 1TWGB 5JVG3 2PZUA 5C3EB 1JQYD 5CV5A 5DM63 3DWPA 2ENBA 1DCZA 2D5DA 1Y69U 1ZXTA 4XDXA 2F0FA 3M7GA 1H9KA 3VYTA 5IIFA 1S5ED 3L9AX 2KEDA 1JOQA 1PTOB 1S5CD 5C44B 2MUYA 2L11A 1SNOA 4HMJA 4ABNA 4CJ0B 1CK1A 1Y1VB 4PNYA 1FYCA 1PTOC 1CT1D 2EJFC 1BNZA 4KN7C 2R61A 3ND9A 1U4MA 2B8GA 3TSSA 1PRTD 1EY9A 1SE4A 4IALA 3VR5A 1F2MA 1H9SB 1TY0A 2B2YA 4ILWA 3PO2B 5JJZA 5KGUA 1UAPA 4GZYC 4H7BA 1QILA 1TT2A 5K36G 1TWHB 4KJOA 2SOBA 3L3OC 5EJWA 2F0WA 1I50B 3OWFA 1PZID 3J7AF 3PUWA 1HCZA 1Y8PB 1XYIA 2QILA 2EYLA 4X3KA 1K8OA 3MC0B 3HOZB 2BCOA 5CORA 4OIKA 3RZOB 1FNWA 1TS5A 4B08A 1BCPC 1F2YA 3TP7A 1Y1WB 4MN3A 3FRPB 5EGTA 4A93B 4C2MB 4K5VA 2AWNA 2EOTA 3SK5A 2NB0A 1SNCA 3NTHA 2Q8IB 4IUUA 2RDGA 1BBXC 1MGSA 5C0XG 1OO9B 1NUCA 4KHVA 5CBEE 5KNCA 4G7HC 4C56C 3NE5B 3KBXA 1SDFA 3AU7A 4C3IB 3I91A 3Q0AA 3S2DB 1IKLA 1RKNA 5ELBA 2JA5B 5J22A 3NWSA 1HQMC 1F9RA 4E6IA 5KNDA 5IGCA 1A2TA 2EY5A 1HTLD 1EWHA 1S4ZA 5BN3A 3H0GB 1G6ZA 1RCVD 2RA4A 1I6VC 4OL7A 3D6CA 2HDLA 1SFOB 1G8ZD 3HZXA 5M5XB 5M5WB 3I72A 3GTGB 1F9PA 2HDMA 2JA8B 1A3VA 1EYCA 1DM0B 1ET6A 3P1HA 1U4RA 4RKBA 1SNQA 4YIJA 3MFYA 1WCMB 1O7LA 3MZ5A 2I46A 1WD0A 5D3DA 2B2UC 2ICIA 1EIHA 1E2ZA 2Y0SB 1EU3A 3OWEB 2RKSA 3I70A 2YU9B 4K8IA 2B2VC 5J39A 4RFBA 3DMUA 4DA2A 1ILPA 3C3LA 1ZYRD 2IW3A 1BUVT 2BE5D 1KABA 2M2LA 3J7AV 1ENCA 3K5MA 4RHRA 4QUFA 3PUZA 4N9PA 5DNFA 1SNDA 3TP5A 3VA5A 4BS9A 4L8JA 4XYQA 3H09A 3J80L 4QUCA 3QJYA 4CJ1B 3NBHA 5HGTA 3CRKC 2E2JB 1JC7A 1EIGA 1EY8A 3IAYA 3NUCA 3VYUA 2F03A 1B3AA 2A5HA 2E2HB 1SSOA 2AQ2B 1X3PA 4FF3A 4FVMA 1JR0D 1B4OA 4IZ8A 3EQLC 2A69D 3TP6A 5C4JB 1TQOA 4C3HB 5KEEA 4RHSA 3CQZB 5D14A 3WOFA 2WIIB 4KKTA 2OXPA 4IN3A 1FGBD 1F2LA 2I07B 3GV3A 1DOLA 2ICEC 2NVYB 5M9OA 3DWAA 3R93A 1STEA 4ZAIA 1VF7A 1JOOA 1KDCA 4B9XA 2IX1A 2KA7A 2XSCA 2PCFB 1HRJA 2ID0A 3SDZA 4HR7B 1CTMA 3A7AB 5FLXE 4TKOB 3OSOA 2F3VA 5LL6S 2F0IA 4DK0A 2NVQB 1SNMA 3K5NA 4OO1H 1OXUA 1RF2D 1M4VA 1ESRA 1W6KA 3EA6A 4I65A 1QNKA 4NMZA 4OHJA 5ISRA 1EY5A 5EKIA 3D31A 2QCPX 5FO8B 4R8IA 4DXFA 2PQEA 1QE6A 1GUSA 4AYBB 2N88A 2JA7B 5M3FB 1JORA 4MHEA 4N9TA 3VR6A 1STYA 3C2PA 4ZK9B 1AFPA 3GTKB 3SK8A 1VCIA 1PZJD 3VYSA 1V1OA 4NW2A 2A6HC 3HP3A 4L6TB 3H6MA 4OO1G 3CHBD 3K5OA 4M1UB 4H44C 2R92B 3BVMA 1CZGA 2H1EA 2L5TA 1NSNS 2DY8A 2NN6H 3BVZA 3OPOA 1R9TB 4FF2A 3M4YA 1EEFD 4ZQ3A 4EGVA 4Q0FA 2XNAC 3TZUA 5KRUA 3S17B 3ERQA 5C5MA 1D5ZC 4BY7B 3AMUA 3P20A 4FXKC 2E74C 4HAEA 1PXUA 4XIGS 5JOBA 1IKMA 4ID6A 3NWTA 2IX0A 3RLFA 1GHJA 1TKWB 3BVGA 3BS1A 1RODA 3PV0A 1TR5A 5EKLA 2K6AA 1BDOA 2K5QA 4FXDA 2A6EC 2AUJD 4V190 3A56A 2R7ZB 2DNEA 3E5SA 2L0CA 1FR3A 2B2TC 1GUTA 1O7ZA 2FMCA 5FOBB 4L63B 3IFDA 4F88A 4IFDI 4WORA 4HCEA 1Y8NB 3KK7A 1PLFA 2CW0C 4G57A 4DF7A 1I6HB 5HURA 4ZYSA 3QWNA 4R9WA 1WTVA 1LO5D 4CHTB 5I6YA 4NDXA 1WD1A 4J1MA 5IGEA 4K6DA 1IHZA 3FEWX 5EPLA 4DNTB 1CQFA 2KQ3A 4PMWA 4CKEA 5F2DA 1I4QA 3J80E 2F0MA 1F2ZA 2B2WC 3EFXD 4HSPA 3NQTA 2F0UA 5A2QE 1LT6D 2LY7A 4A3DB 4H0LC 3FMCA 3ONAB 5A2QL 4BY1B 3IL8A 1XXGA 1IYUA 1KAAA 1E2WA 1HFGA 4KHZA 1HTPA 4HEDA 1LV9A 3D4WA 2WKCA 3SR1A 2MPMA 4KD4A 1HA6A 4OO1I 3O13A 2MHVA 1KLGD 2QF7A 2KOLA 1PFBA 3J7YW 3GQBA 1AW7A 3X3MA 2ZXOA 3NTKA 2JA6B 4IUNA 2NVXB 2FFKB 2J0TD 3MXGA 1OXVA 4U673 5BN4A 3K59A 5AFWA 5I9OA 4C3IG 4QIWB 4KK7A 2NBFA 3D6WA 1Z6HA 1BOSA 1XWEA 2IT1A 2F0KA 4C3HG 3QIAA 4JBWA 3SK6A 4BWGB 1DOKA 2E2DC 2KCCA 2C9OA 1J8IA 5FLXL 1SBBB 3M4OB 1T5EA 4FO2A 1H9MA 3R3OA 4IURA 5E1FA 1D1KA 1J9OA 1RHPA 3H3VC 3Q24A 1I4PA 1PTOH 4OGQC 1GUOA 1I4XA 4P2CB 3KLSX 2F4IA 1LTID 1ONLA 1QCBD 4IFDJ 1IYVA 4XQJA 1C8CA 2EYMA 4X3TA 1CA5A 2WINB 1D6EC 3I90A 2G9HD 3JAME 3HOUB 4CKCA 4XXEA 1CA6A 2X69A 3Q23A 2F3WA 1FD7D 1YNJD 1HUMA 2PZWA 3NSWA 1LT5D 3HOXB 2Z1CA 2M00A 3UI2A 1V1PA 1ILQA 1BO0A 5JEAH 4J6HA 4FNFA 4HMIA 3OOCA 1U4PA 1EY6A 3PO3B 1OXTA 1O7YA 1LABA 1UEAB 1ML0D 1E2VA 4KY5A 1D1IA 3H94A 3MHBA 2KEEA 1K8MA 1DJRD 1JWSD 4TQUS 3KUPA 3D3RA 4EQPA 3GTPB 2B39A 1LTAD 2HUGA 1TIID 1JE4A 3K58A 2E2IB 2EYFA 3D8GA 1RD9D 1I4HA 4A3MB 3NBIA 2LKVA 3K5LA 2A69C 2WACA 3E6ZX 1EY4A 4G7ZC 1TS2A 2F0TA 2A68D 1T5XD 1HPCA 1EYAA 3I4MB 4ZKCB 2PW5A 2OF1A 3C46A 4KV6A 4C1NI 4QB4A 3WDNA 3A8KE 2KVMA 2B2UA 1O80A 4PMCA 1ET9A 3GV6A 3G6JB 2NTTA 1CQVA 3OMGA 3RZDB 2D62A 4FYDA 1KDBA 4QCLA 1TY2A 5CYUA 1K83B 1SYDA 5FO9B 3F2UA 4IQZA 1DD2A 1WTXA 4RGNA 2IJ0A 3LX0A 1RTNA 4LJZC 4C3JB 5I2YA 1SJHD 2FJ2A 3M85A 5M3MB 3DEOA 4DAPA 4DAYA 1STAA 2BDNA 5IGDA 3K57A 2F0EA 5KYIA 2E76C 1DZ1A 4WFN3 5K5PA 2E75C 3K6OA 1SYGA 4U68A 1B9MA 1D5XC 1A6XA 3W2DA 3MWYW 3HG9A 4XT1B 1B9NA 2KCNA 3BZDB 4BBRB 2PZTA 1HXYD 5CV8A 5C3WA 5G3LF 2EXZA 3MXPA 2BDOA 2RBMA 3T56B 3I4NB 3NP8A 4NP5A 1PRTC 3V05A 2KJXA 3G7LA 5CR3A 2B2YC 5G3LD 3NQIA 1LLRD 3LNNA 2NTSA 2MP1A 2ZXPA 2JP1A 1G91A 3TN2A 3KLRA 2XRSD 1EQVA 1BXTA 1PFMA 3Q6SA 3S9WA 3NTIA 1C48A 5BN5A 4PV1C 1HUNA 1JB3A 2HCIA 1AN8A 1MI2A 1LTBD 3J81E 3GTJB 3W3AA 3MEHA 5FKAC 2JYOA 3S1NB 4RA8A 4XYOA 3GO5A 3N52A 2EPBA 3HKZB 5D65A 5CGKA 3S1MB 2AQ1B 4WJWA 2WKDA 4C3JG 1CM9A 3ND8A 5IGBA 1MBYA 1F9QA 1U9RA 5C4HA 3Q22A 3OIPA 1PYWD 2EVBA 3I8ZA 3MXUA 4ZLTF 1NCVA 4DGZA 5IGGA 1PFNA 3M3YB 1VF5C 1FNUA 1LT3D 4DK1A 4BA1I 3BDLA 2K04A 3P7JA 3PUVA 3HEJA 5JEAG 5EBDA 4KKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  2L55 A;  3TDQ A;  1ZEQ X;  3E6Z X;  2QCP X;  2VB2 X; 
#chains in the Genus database with same CATH topology
 1SYF A;  1QVG A;  1W6J A;  3NXW A;  4NPS A;  2K5H A;  5CV9 A;  2AQ3 B;  1DON A;  4F87 A;  2LXJ A;  4P74 A;  2V4D A;  2PNR C;  5IOC A;  2X6G A;  2HCC A;  3K7A B;  5I9P A;  3PSI A;  4DAV A;  5JJI A;  3S2H B;  2EYJ A;  4DV6 Q;  1FNV A;  4UP7 A;  1QUQ A;  1ZKO A;  4JI8 Q;  4L5S A;  4P75 A;  1Q86 C;  3P75 A;  3U9O A;  1TWA B;  2N8N A;  2EYH A;  5C44 H;  1BCP D;  1NR2 A;  1B53 A;  3PO3 H;  1CKN A;  1Q1B A;  4DXG A;  1LTS D;  1QG7 A;  4J8Q A;  3J81 j;  4DR5 Q;  1Q1E A;  4A3E B;  3ER0 A;  1E1O A;  4IPD A;  3C1E A;  4OXP A;  4PG3 A;  2K14 A;  1HJP A;  1GHK A;  1CUK A;  5IYC H;  2Z4H A;  1I4R A;  1O7I A;  2JA9 A;  3E0E A;  4PZ7 A;  3MEF A;  3M3Y H;  4K2L A;  1SE2 A;  5FO7 B;  2OQ0 A;  3QG1 A;  3JAM L;  2K5N A;  1EEI D;  3R8B A;  4LAA A;  3VR3 A;  1PTO D;  2FMM A;  1CHP D;  2MGS A;  4A3L H;  3OMC A;  5I2X A;  3BU2 A;  5M5Y H;  2ZJQ A;  2OWO A;  4IFD H;  3GTQ B;  1ESF A;  2IHE A;  5CV4 A;  3UDF A;  1U0L A;  2KEC A;  4M8A A;  4JG2 A;  1TXY A;  1YNN C;  1QB5 D;  4GNX C;  4LF5 L;  2L4N A;  1ASY A;  1PYS B;  3X3N A;  1W2B A;  4YY3 L;  3A54 A;  4KN4 C;  1TWF B;  1D5M C;  3MXN A;  2OTJ A;  2FIN B;  1JWM D;  4A3J B;  3MA2 B;  2ZT9 C;  2IPK D;  1A3U A;  1C4Q A;  3K8A A;  4UP9 A;  3AB9 A;  3I4N G;  4JCV E;  1GUW A;  2SNS A;  2A6H D;  1VQB A;  1UEB A;  2UUA L;  3HGB A;  2Y0S E;  4A4I A;  4K5X A;  4JK1 C;  2YTX A;  1X32 A;  3OTO Q;  3OHX C;  3NBH B;  1AZQ A;  1ZEQ X;  3CCQ A;  3PCO B;  4A3K H;  3S1R B;  3IFT A;  1XPO A;  1KQS A;  1PZK D;  1MJE A;  4DR4 L;  1FJG L;  3TQY A;  3S17 H;  3HS0 C;  4XT3 B;  1BVS A;  3GD7 A;  4BY7 H;  1M8A A;  1RTO A;  3PIP 3;  2OTL A;  2K32 A;  1EZ6 A;  4DR5 L;  3CCR A;  4OWW B;  1CI3 M;  2BA1 A;  2EJM A;  4H02 A;  4UDU C;  3DWQ A;  3DEP A;  1M1K C;  1MJC A;  3A7L A;  4K6L A;  2JXM B;  4JI6 L;  2H4O A;  1SXT A;  1X56 A;  2CVR A;  1Y8O B;  1WTQ A;  1WTO A;  3QB3 A;  3HOW G;  3NPP A;  5EPJ A;  3WWV A;  1MD2 D;  1EL0 A;  2MJ8 A;  4X64 L;  2R93 H;  1H9S A;  1X3G A;  3CCM A;  3OW7 A;  4MNO A;  3I73 A;  2BOS A;  2B63 B;  3F1Z A;  4X64 Q;  2O5J C;  1HNX Q;  4BBR H;  2VL6 A;  3I56 A;  1U4L A;  4C1N K;  3A55 A;  4B9W A;  1IW7 C;  2SNM A;  2K5W A;  1VMP A;  1EFW A;  4B3R Q;  1VQK A;  4MTN A;  3TZD A;  4RAU C;  4YWM A;  1AZP A;  5DLQ E;  2IY5 B;  4JI5 L;  1EIY B;  1NR4 A;  1NJI C;  1EZ8 A;  2VQF L;  2RF4 A;  2KUM A;  3HOX H;  5NUC A;  3GTM B;  4RGO S;  3J80 c;  1D2B A;  4K5W A;  4LFA Q;  1KDA A;  4A3M G;  4KHP L;  1CFM A;  2G9D A;  1AE3 A;  3S1N H;  1OXS C;  3SK4 A;  1IW7 D;  2EJG C;  3DUZ A;  2CKZ B;  3SXH A;  3SEB A;  1GJX A;  3BZK A;  2Z4I A;  1SMX A;  2PYK A;  1U5K A;  1Q8I A;  3M7N A;  1II3 A;  3JAM c;  2A74 C;  3QO2 A;  4RGT A;  1STB A;  1EFI D;  3HOV B;  3S1Q H;  1TVX A;  2F0L A;  3T53 B;  4MIU A;  2EY6 A;  4Y7N H;  2UUB L;  2FHT A;  5IOD A;  2K50 A;  2O4X A;  3FKI H;  2BA0 A;  1YZ6 A;  5C3X A;  3PO3 G;  2L1B A;  4FF4 A;  2F0Q A;  3Q8D A;  5HGQ A;  3A8I E;  1E24 A;  2AUK A;  3FDT A;  1EU4 A;  4Q5V A;  1KNA A;  3UE0 A;  3G71 A;  4A75 A;  3AFQ A;  4XTC S;  3PGZ A;  1UNS A;  4BY1 H;  2J4X A;  4OEM B;  2NN6 I;  4YCV A;  3WOE A;  4B3M L;  3TEH B;  2RHQ B;  5ELC A;  1SYE A;  2MFI A;  4DV3 Q;  2F0D A;  1W3S A;  1BQQ T;  4PZ6 A;  4G4K A;  3V2T A;  2Z6K A;  2GA4 B;  1VQP A;  5EKK A;  5ELF A;  2EY2 A;  2PI2 A;  2B2V A;  3DHQ A;  1LM0 A;  5C4X B;  3I3C A;  3K7A H;  1B2T A;  2EY1 A;  2EYO A;  4A3D H;  3CPW A;  3CRL C;  2GVA A;  1TWC B;  3HOU G;  4RCO A;  2D9U A;  1PH5 A;  3C1F A;  2K03 A;  1GUG A;  4NXM Q;  2JEA I;  2XIW A;  4DR7 L;  4L5Q A;  4A3C G;  1GUN A;  2CH4 W;  3HKZ E;  1B1Z A;  1VQG A;  1TS4 A;  4R8N A;  1AEX A;  4IUQ A;  4HSV A;  3RZD H;  1XNQ L;  1WTP A;  1F9S A;  4IFD G;  2O2L D;  2Z6K C;  3FVQ A;  3PUX A;  3H3V H;  1AP0 A;  3FKI B;  2K1B A;  1NNX A;  3GP7 A;  4NXM L;  2F0S A;  1HNX L;  4FP5 D;  3NK9 A;  4DK6 C;  2KBN A;  3T1Y L;  1LTT D;  2WP8 J;  5T1G A;  1I50 H;  1YNX A;  1MSG A;  3A0J A;  2PMZ E;  1S5F D;  5C0X J;  2RVL A;  4A3B G;  1K3R A;  2VXW A;  3KFU A;  2AKW B;  3SGI A;  3OW2 A;  3AFP A;  3OIQ A;  4A3B B;  1Q46 A;  2MO0 A;  2QKI C;  5JAV A;  2L55 A;  4CGY B;  2WAQ E;  4BY7 G;  4ALP A;  2PW7 A;  4LF8 Q;  3A8J E;  1SRU A;  2J7Z A;  2QA4 A;  1VQF A;  3CKI B;  1KNE A;  1Q12 A;  4BA2 I;  4EVO A;  3VR4 A;  1ICW A;  3FPP A;  1YJW A;  2A73 B;  4A93 H;  2JA6 G;  2UUA Q;  4JI8 L;  1C7Y A;  1JE5 A;  1SEB D;  4ZUI A;  1JIC A;  5JVH 3;  3TDQ A;  4DR2 Q;  1PRT F;  4S3S A;  5CV6 A;  3KBG A;  2PMZ B;  5IGF A;  5M5X H;  2F0H A;  2QDB A;  5EBC A;  2NVT H;  2RSO A;  1EYD A;  3CPF A;  5IT9 E;  3DXJ C;  1JWU D;  2LMC B;  1PH3 A;  2TSS A;  2PO4 A;  1P16 A;  4X3S A;  4B3T L;  3AEV A;  2NZH A;  4A3L G;  2DN8 A;  5EAY A;  1YIJ A;  4A3D G;  2VNU D;  4DR1 L;  4LF5 Q;  2IL8 A;  1SJE D;  5D3I B;  4P72 A;  5JPN C;  1Q82 C;  1HZC A;  2KHS A;  2Z0S A;  5TSS A;  5C0X I;  2EE1 A;  3F2B A;  1L2F A;  4ZUJ A;  1BF4 A;  4IUT A;  2JE6 I;  3E3X A;  2F0P A;  4UPA A;  1BR9 A;  2K28 A;  5M3F G;  2JK8 A;  4AYB G;  3STB D;  4RGM A;  2R7D A;  1V43 A;  3HRZ C;  2OT2 A;  1HQR D;  4WRD A;  1WTW A;  4DV6 L;  1SYB A;  1JT8 A;  1I4G A;  1WCM H;  3BG3 A;  4GLA C;  2UU9 Q;  5BR8 Q;  3LWE A;  4IPH A;  2NZ1 D;  1EQT A;  1OXX K;  1K28 A;  1FGU A;  1QWY A;  4JPB W;  1X3Q A;  2LS0 1;  3EBE A;  4TSS A;  1PRT B;  2XWB B;  2XRQ D;  1WYD A;  4EQN A;  1KTK A;  1FL0 A;  3LWU A;  2N55 A;  2K05 A;  4GOP C;  2OEO A;  3I55 A;  1S5D D;  4X3U A;  1L1O B;  2E5L L;  1I3Q B;  3QOJ A;  4JI0 Q;  2A6E D;  4KMU C;  2ZM6 Q;  4FF1 A;  2O5I C;  2Q2H A;  1STH A;  3EN2 A;  4K2K A;  4KKS A;  4Z9C B;  1A0I A;  4YWL A;  3RMH A;  4FXG C;  1E22 A;  1VQM A;  1XMO Q;  2NWG A;  1Q3L A;  4CKB A;  1CZW A;  3QR8 A;  1B44 D;  4JYA L;  2VZA A;  3CCJ A;  1KIX A;  3TBI B;  2KCT A;  4JI4 L;  3M4Q A;  4IUV A;  1PMR A;  2WV6 D;  3RNU A;  1YEZ A;  1E0B A;  2R6G A;  4DV4 Q;  2K7V A;  1DOM A;  2CW0 D;  5E3F A;  3TP8 A;  4CBV A;  4LF6 Q;  2VQF Q;  3AYH B;  2K52 A;  3E9H A;  1GM5 A;  2NYZ D;  1VQJ A;  2IX3 A;  3HOV H;  3S1Q B;  5FK9 C;  1R4P B;  1FVI A;  1WTR A;  3DM3 A;  3ICE A;  4LF4 L;  1IBK Q;  5CMD A;  2ZM6 L;  4GKK L;  1G2S A;  1G29 1;  4KJN A;  4NKL A;  3R2T A;  1TS3 A;  2AHO B;  2WFW A;  3HOY H;  3GTO B;  1K83 H;  1EWI A;  3ZYY X;  5KNB A;  1PH8 A;  1IL2 A;  2SDF A;  4DR3 L;  1N33 L;  2EZV A;  1ICF B;  2R7Z H;  2HT1 A;  1XNR L;  4YHH L;  1VQ9 A;  1B50 A;  1RDP D;  3TME A;  2K5D A;  2L12 A;  1K8G A;  5M5Y B;  4C3H H;  3SE0 A;  2HQL A;  1SNP A;  3D0F A;  1A15 A;  3DM1 A;  1PV4 A;  2DNC A;  3CQZ H;  1GO3 E;  2NUC A;  1I94 L;  2L9H A;  1ENF A;  1L0X B;  1X3F A;  4C3I H;  4AQY L;  2UXB Q;  5KYL A;  2VB3 X;  1PDQ A;  1HFN A;  3S16 B;  1PH2 A;  4DV0 Q;  3L7Z C;  2VQE Q;  4DUZ Q;  5KIX A;  3VA7 A;  2ZTD A;  4DV2 Q;  2EIF A;  1YNJ C;  1IBM Q;  3A5Z B;  1JJC B;  2BE5 C;  1X55 A;  2LFN A;  4BBS B;  4X62 L;  5C5L A;  5C4X G;  4O1N A;  4DR6 Q;  4HCS A;  2R3Z A;  3J7Z C;  2CHB D;  3E9I A;  3TRE A;  1IBM L;  2Q2I A;  4ULL A;  2RQX A;  1ENA A;  4DFA A;  5A35 A;  1SE8 A;  3MFG A;  1VQ6 A;  3A5U A;  5E4X A;  4X66 L;  1JCK B;  2JSO A;  1NE3 A;  4DU9 A;  4X6A H;  4LK1 C;  1TWG H;  1VQD A;  1B8A A;  2NVQ H;  2DY7 A;  1SR3 A;  1CKO A;  5COY A;  3T13 A;  4DV7 L;  4HJA A;  2Q2U A;  4WJ4 A;  2TMP A;  3BJU A;  5DEH A;  5I6W A;  2RDH A;  1CSP A;  3J81 L;  4G7O C;  1H95 A;  1SFO H;  1S5B D;  2N3S A;  3AQQ A;  1SMY D;  1IBL Q;  1D7Q A;  2Y0S G;  3V96 A;  2QGQ A;  3N6R A;  3T16 A;  4JV5 Q;  3K0Y A;  1K0S A;  4ZKB B;  1RIP A;  2ASB A;  1X3E A;  1Z47 A;  3FPU B;  1A62 A;  4F8M A;  1VDZ A;  3FP9 A;  2NN6 G;  1YHQ A;  1N8R C;  1LTG D;  4XQN A;  1IBK L;  4A3E G;  3NHH A;  1WVL A;  5EPK A;  1UUP A;  1IZ6 A;  3KLS A;  2B2W A;  2EDG A;  3UDG A;  3SHL A;  5LL6 X;  4HN7 A;  1SMY C;  3ERO A;  5CC4 A;  4EQ5 A;  1PH9 A;  4DN4 M;  3F2C A;  1XTC D;  1V8Q A;  2K75 A;  1DYQ A;  1H9J A;  4KY7 A;  2QEX A;  1F77 A;  2Q8R E;  1S40 A;  1BCP F;  2C5C A;  3BDO A;  4L5T A;  1O78 A;  4KY6 A;  5E4W C;  1VQI A;  2KHJ A;  1WTH A;  1SRO A;  4DV0 L;  4QMG A;  3JC6 6;  3RUZ A;  2NVX H;  1LTR D;  3MAQ A;  2WB1 B;  1XTD A;  3VYR A;  1EY7 A;  5K36 H;  3M4P A;  3QOL A;  4JBM A;  2XN9 C;  3BYT B;  4IUP A;  3TS0 A;  4V0B A;  3MTS A;  4PQX A;  4N8F A;  2KCM A;  3D4R A;  3BDC A;  3T4A C;  2Q8T A;  3T1Y Q;  3RLN A;  3VR2 A;  1GXD C;  1EWC A;  1X65 A;  5ELD A;  2NVT B;  2F0J A;  2YYZ A;  1LAC A;  4LF4 Q;  2CQO A;  2UUB Q;  1Q90 A;  4O42 A;  3H3V I;  3H91 A;  1A8V A;  1A2U A;  4L5R C;  5IT9 L;  4PMB A;  2CQA A;  4F7X A;  4X65 Q;  1LT4 D;  1PVO A;  1UE6 A;  3S15 B;  4RWS C;  2QEJ C;  3T1H L;  3GTL B;  4GOP B;  4A76 A;  2K33 A;  2QW7 A;  4TRD A;  5GAD C;  1SYC A;  5CBA E;  5JEA J;  1YJ9 A;  5LHY 1;  2VW9 A;  3HOW B;  1IL8 A;  1SLJ A;  2E2H H;  1TU2 B;  2XWJ B;  5T1I A;  3CU7 A;  3MXN B;  4MTK A;  4I7Z C;  4Y7N B;  4GNX A;  2PPB C;  1EY0 A;  4A3E H;  1NAP A;  1HA5 A;  5DAU A;  3EVQ A;  3S24 A;  2X6L A;  4K8J A;  2RDF A;  2JEB I;  5IYD H;  5I4D A;  4GS3 A;  3CMA A;  4JI4 Q;  3R2I A;  4RH6 A;  2B8F A;  3EJI A;  3T1H Q;  2F1M A;  1XX8 A;  1A3T A;  1AH9 A;  2E5L Q;  4LUO A;  4HJ8 A;  1XPU A;  2A68 C;  3RN2 A;  2F0V A;  4LMQ D;  4APV A;  3J81 i;  4ODG A;  1ZYR C;  2K01 A;  1I6H H;  4KI0 A;  1A63 A;  2HQE A;  3I4L A;  4IO9 A;  2IWH A;  2I5H A;  5EQ0 A;  1G2T A;  2F0N A;  4GKJ Q;  1IBL L;  1EYG A;  1Y1W H;  3T51 B;  5DM7 3;  1E3P A;  4H13 C;  2SEB D;  1YNN D;  4UAI A;  2HIV A;  1ASZ A;  5CV7 A;  5FJ8 G;  3KDF A;  1DGS A;  4A3K B;  2EYP A;  3D4D A;  2VUM B;  1EOT A;  1V1P B;  3HOW H;  1L0Y B;  1DXM A;  5JJK A;  3BYY B;  1L0W A;  2AWO A;  4XQQ A;  3CXC A;  1SAP A;  3KF8 A;  4KD3 A;  4A3I B;  3RD4 A;  5ELN A;  1UE7 A;  4ZRZ A;  1XMO L;  2XVS A;  4RCN A;  1H9R A;  1WCM G;  1GOZ A;  2B2T A;  2F0G A;  2M9V A;  5C4Z A;  5ELE A;  1RJT A;  3SVM A;  5C6A A;  2D2C C;  2JA8 G;  5M3F H;  5L37 A;  1I94 Q;  1YI2 A;  1B3Q A;  3URY A;  4JI1 Q;  3S16 H;  4K14 A;  4A3M H;  3PUY A;  3PIO A;  1PTO F;  2VB2 X;  1PH6 A;  3HOY B;  4YY3 Q;  4OIJ A;  4LNQ A;  1QJO A;  3MVV A;  1Q7Y C;  4BBS H;  4A3F B;  1QOH A;  4DR2 L;  2JA8 H;  5IYD G;  3PIO 3;  1VQ7 A;  5JPM C;  1CHQ D;  4QGU A;  3ITP A;  1VMC A;  3I4O A;  4QL5 A;  4JI1 L;  1HHV A;  2LSS A;  5J1Z A;  3PMF A;  1STN A;  4QF4 A;  3IKJ A;  4A3G B;  4KTA A;  4DV4 L;  3E0J A;  3U9S A;  5C0X H;  3CD6 A;  3U4Z A;  2R93 B;  2A19 A;  1MSH A;  4CJ2 C;  4ME5 A;  2B63 H;  1R4Q B;  2CH4 A;  4LFA L;  2Z8L A;  4LWC A;  2F0O A;  4O0A A;  1VQO A;  4HTH A;  2WAQ B;  2ZTE A;  4J15 A;  4DNR B;  4A93 G;  1BCP B;  1JOK A;  2ZXR A;  4UHV A;  4AYB E;  1STG A;  4RKL A;  4EQO A;  1Z7T A;  4X65 L;  1PHJ A;  1Y1W G;  2RSN A;  5GAE C;  1QNU A;  4DK3 C;  3S14 B;  1KRT A;  1SE3 A;  1KLU D;  1TWG B;  5JVG 3;  4A3F G;  2PZU A;  4QY7 A;  2EXD A;  4DR1 Q;  3HOY G;  5C3E B;  1JQY D;  2R7F A;  5CV5 A;  5DM6 3;  3DWP A;  3HKZ G;  2ENB A;  1DCZ A;  3B6Y A;  3W5O A;  2D5D A;  1Y69 U;  1ZXT A;  4XDX A;  2F0F A;  3M7G A;  1H9K A;  3VYT A;  5IIF A;  2RCN A;  1S5E D;  3L9A X;  2KED A;  1L1O C;  1JOQ A;  1PTO B;  1S5C D;  5C44 B;  2MUY A;  2A8V A;  2L11 A;  1SNO A;  4HMJ A;  1JMC A;  4ABN A;  1CK1 A;  1Y1V B;  4CJ0 B;  1QUQ B;  4PNY A;  2F52 A;  1FYC A;  4X66 Q;  1PTO C;  1CT1 D;  4A3G H;  2EJF C;  1BNZ A;  4KN7 C;  4A3I G;  2R61 A;  3ND9 A;  1U4M A;  4LF7 Q;  4DPG A;  1HZB A;  2B8G A;  4POF A;  3TSS A;  4GOP A;  2VUM G;  1PRT D;  1CKM A;  1EY9 A;  3HOU H;  1I3Q H;  1SE4 A;  5IWA Q;  4IAL A;  1TWC H;  1F2M A;  3G48 A;  3VR5 A;  3GTL H;  4LFC L;  1H9S B;  4AQY Q;  3HOX G;  4JV5 L;  1TY0 A;  2B2Y A;  4ILW A;  3UE1 A;  3PO2 B;  5JJZ A;  2NZO A;  2I5M X;  1UAP A;  5KGU A;  3J81 c;  4GZY C;  4H7B A;  1PH1 A;  5IY0 A;  1SN8 A;  4BBR G;  1QIL A;  1YHB A;  1TT2 A;  5K36 G;  1NMG A;  1YIT A;  1TWH B;  4KJO A;  5C44 G;  2SOB A;  3L3O C;  5EJW A;  1YVC A;  2PQA B;  2MNA A;  4RMF A;  3S1M H;  2F0W A;  3CC7 A;  1I50 B;  3OWF A;  1PZI D;  5M3M G;  3J7A F;  3PUW A;  4LUV A;  1HCZ A;  1Y8P B;  1XYI A;  4LF6 L;  2QIL A;  2EYL A;  4X3K A;  1K8O A;  4A3B H;  3MC0 B;  3HOZ B;  2BCO A;  2XTI A;  4JBK A;  1WJJ A;  4KHP Q;  1B70 B;  5COR A;  4OIK A;  1HZA A;  3RZO B;  1FNW A;  1TS5 A;  1YBY A;  4B08 A;  1BCP C;  1F2Y A;  4LF8 L;  3TP7 A;  1Y1W B;  4MN3 A;  3FRP B;  5EGT A;  4A93 B;  4C2M B;  4K5V A;  2AWN A;  2EOT A;  2WAQ G;  2NB0 A;  1SNC A;  3SK5 A;  4DAM A;  1XNR Q;  3NTH A;  2Q8I B;  4IUU A;  2RDG A;  1T9H A;  1BBX C;  1MGS A;  5C0X G;  1OO9 B;  3GDE A;  1NUC A;  4KHV A;  5CBE E;  5KNC A;  4G7H C;  4IOC A;  4C56 C;  3NE5 B;  3KBX A;  1SDF A;  3AU7 A;  4C3I B;  2FXQ A;  3I91 A;  3Q0A A;  4DUY Q;  2CWA A;  3S2D B;  1IKL A;  1RKN A;  5ELB A;  2JA5 B;  1VS0 A;  5J22 A;  3NWS A;  1HQM C;  1F9R A;  4E6I A;  4TVA B;  2RCF A;  5KND A;  2WB1 G;  5IGC A;  1A2T A;  2EY5 A;  1HTL D;  2GVB A;  1XNQ Q;  1EWH A;  4DNI A;  1S4Z A;  5BN3 A;  4GN3 B;  3H0G B;  1G6Z A;  4JI7 Q;  1RCV D;  1Q81 C;  2RA4 A;  3CC2 A;  1I6V C;  3ERS X;  4OL7 A;  3D6C A;  3LGJ A;  2HDL A;  3KDF B;  1SFO B;  1G8Z D;  3HZX A;  4JYA Q;  5M5X B;  2Q2T A;  4JI2 Q;  4BY1 G;  3I72 A;  5M5W B;  1QVF A;  3GTG B;  4B3S Q;  4JOI C;  2ZTC A;  1F9P A;  2HDM A;  2JA8 B;  1A3V A;  3PIP A;  1EYC A;  4GN5 A;  4JI2 L;  1DM0 B;  1ET6 A;  3P1H A;  1U4R A;  4RKB A;  1SNQ A;  4YIJ A;  1EUJ A;  3MFY A;  1WCM B;  2YTY A;  4LUZ A;  3MZ5 A;  1O7L A;  2I46 A;  1J6Q A;  4FDB A;  1WD0 A;  1WOC A;  5D3D A;  2B2U C;  1EIF A;  2ICI A;  5LMU L;  1EIH A;  1E2Z A;  2Y0S B;  1EU3 A;  1LUZ A;  3OWE B;  2RKS A;  1VQE A;  4DKA C;  3I70 A;  2YU9 B;  1UWV A;  4K8I A;  4A3K G;  2B2V C;  3ULJ A;  5J39 A;  4JOI A;  4RFB A;  4A3J H;  3DMU A;  1XJV A;  4DA2 A;  2JA5 H;  1ILP A;  1NTG A;  3C3L A;  2DUD A;  2PNH A;  1ZYR D;  2IW3 A;  5AJ3 L;  2N49 A;  1BUV T;  1K3B C;  2BE5 D;  1KAB A;  2M2L A;  3J7A V;  4R4O A;  1ENC A;  3A74 A;  3I4N H;  1JJG A;  3K5M A;  4RHR A;  3S14 H;  4QUF A;  3PUZ A;  4BBS G;  3CCL A;  2JQO A;  4N9P A;  5DNF A;  1SND A;  3TP5 A;  2ALY B;  3VA5 A;  4NB3 A;  4O2D A;  4L8J A;  4BS9 A;  4XYQ A;  3H09 A;  2HD3 A;  3J80 L;  4PZ8 A;  5H1S E;  4QUC A;  3F8T A;  4HJ9 A;  5IE8 A;  3GTG H;  3QJY A;  4CJ1 B;  1X9N A;  1RL2 A;  3NBH A;  2D0O A;  5HGT A;  3CRK C;  5FLM H;  1IYJ B;  2E2J B;  1JC7 A;  3RLO A;  1EIG A;  1EY8 A;  3IAY A;  3NUC A;  3VYU A;  2F03 A;  1B3A A;  1Y1V H;  3OYY A;  2A5H A;  2E2H B;  4JI5 Q;  3CCV A;  1SSO A;  1N9W A;  2VS1 A;  2AQ2 B;  4BXX G;  1X3P A;  3DLL A;  4FF3 A;  1K9M C;  2V1C C;  3GTO H;  2BH2 A;  4I7A A;  4FVM A;  1JR0 D;  1KL9 A;  1B4O A;  3ULL A;  4IZ8 A;  2HHH Q;  3EQL C;  2A69 D;  3TP6 A;  5C4J B;  1TQO A;  4C3H B;  5KEE A;  4K0K Q;  4RHS A;  2P5Z X;  2PI2 E;  3CQZ B;  5D14 A;  3WOF A;  2WII B;  5FLM G;  5IYB H;  3CCS A;  4KKT A;  4HIM A;  2OXP A;  4IN3 A;  4DR7 Q;  1FGB D;  3KF6 A;  1F2L A;  2E2I H;  2I07 B;  3GV3 A;  1DOL A;  2ICE C;  2NVY B;  1G6P A;  5IWA L;  2RHS B;  5M9O A;  4R4Q A;  1YJN A;  3DWA A;  3R93 A;  1STE A;  4ZAI A;  1VF7 A;  3FHW A;  3G4S A;  1JOO A;  2ATW A;  2K5V A;  1KDC A;  4B9X A;  2IX1 A;  2KA7 A;  2XSC A;  2PCF B;  1XPR A;  1HRJ A;  2ID0 A;  1KAW A;  3SDZ A;  4HR7 B;  1CTM A;  3A7A B;  4R1J A;  5GRO A;  5FLX E;  4TKO B;  2VUM H;  1PH7 A;  3OSO A;  2F3V A;  5LL6 S;  2F0I A;  2ZJR A;  4DK0 A;  1Y14 B;  2NVQ B;  1BBU A;  4K0K L;  1Z9F A;  1SNM A;  1VQ8 A;  4Y52 H;  3K5N A;  4CDF C;  1OXU A;  4OO1 H;  1Q8K A;  1RF2 D;  1M4V A;  2G5D A;  2JJQ A;  1ESR A;  1W6K A;  3EA6 A;  3CW2 C;  4I65 A;  3L0O A;  1QNK A;  4NMZ A;  4OHJ A;  3I7F A;  5ISR A;  1EY5 A;  5EKI A;  3D31 A;  2QCP X;  5GAH C;  5FO8 B;  4R8I A;  4DXF A;  3J7A 5;  1TWA H;  2PQE A;  1G51 A;  1QE6 A;  1S3O A;  1GUS A;  4AYB B;  2N88 A;  2PQA A;  2JA7 B;  5M3F B;  1X6O A;  4OWX B;  1EQR A;  1JOR A;  1MIU A;  4MHE A;  4N9T A;  4LFC Q;  5ELO A;  3VR6 A;  5LMN Q;  4IPC A;  1N32 Q;  4IPG A;  1STY A;  3G6E A;  3F2D A;  4DUZ L;  3M4O H;  3RZO H;  3RR5 A;  3C2P A;  4ZK9 B;  1AFP A;  3GTK B;  4P71 A;  2A1A A;  1N32 L;  4B3S L;  3SK8 A;  1VCI A;  1KHI A;  1PZJ D;  4LF7 L;  4JC0 A;  3VYS A;  1V1O A;  4NW2 A;  1LTL A;  1PA6 A;  2A6H C;  3CF5 A;  3HP3 A;  4L6T B;  4B3R L;  3H6M A;  4OO1 G;  3CHB D;  4QQB X;  2E8G A;  4N8X 1;  3S2D H;  4GLX A;  3K5O A;  4M1U B;  4HIK A;  4H44 C;  1C0A A;  2R92 B;  2R7Z G;  3BVM A;  1CZG A;  4GN4 B;  2H1E A;  2L5T A;  2BH8 A;  1NSN S;  2DY8 A;  4DUY L;  2F4V L;  2NN6 H;  3BVZ A;  3OPO A;  1R9T B;  3CME A;  4FF2 A;  3M4Y A;  1EEF D;  1HNW Q;  4ZQ3 A;  4EGV A;  4Q0F A;  3S1R H;  5GAG C;  5IYC G;  2XNA C;  3TZU A;  5KRU A;  3S17 B;  3ERQ A;  5C5M A;  1D5Z C;  4CDC C;  4BY7 B;  4LF9 Q;  3AMU A;  3P20 A;  4FXK C;  2E74 C;  4HAE A;  4JVZ A;  2B3G A;  1PXU A;  4XIG S;  5JOB A;  5IP9 G;  4ID6 A;  4X62 Q;  3NWT A;  1IKM A;  2IX0 A;  1S72 A;  1M90 C;  4R4C A;  3RLF A;  3GTP H;  1GHJ A;  2UXC Q;  1TKW B;  4OX9 Q;  3CC4 A;  4IJH A;  3BVG A;  3BS1 A;  1ROD A;  3PV0 A;  2UXD L;  2AMC B;  4JI7 L;  3KF8 B;  1GVP A;  3FKI G;  1TR5 A;  1AE2 A;  5EKL A;  3HKS A;  1XMQ L;  2K6A A;  1BDO A;  1HR0 Q;  2K5Q A;  4FXD A;  5FLX c;  2A6E C;  1EQQ A;  2Z6B A;  2AUJ D;  4V19 0;  3A56 A;  2R7Z B;  2R92 G;  5HY6 A;  2DNE A;  2KEN A;  3PQI A;  3E5S A;  1BKB A;  2L0C A;  1FR3 A;  2B2T C;  1GUT A;  3W1B A;  2UU9 L;  1O7Z A;  2UXC L;  2FMC A;  5FOB B;  4L63 B;  3IFD A;  5LMN W;  1N36 Q;  1PH4 A;  4F88 A;  1K8A C;  4IFD I;  4WOR A;  4HCE A;  1KC8 C;  1Y8N B;  3KK7 A;  1PLF A;  3KYH C;  2CW0 C;  4G57 A;  3GTM H;  1QVC A;  4EX5 A;  2JN4 A;  3NEM A;  2HIX A;  4DF7 A;  3TS2 A;  1I6H B;  5HUR A;  4ZYS A;  4DR4 Q;  3QWN A;  5JJL A;  4JI3 Q;  4R9W A;  1WTV A;  1LO5 D;  4CHT B;  3KOJ A;  5I6Y A;  3OTO L;  1PYB A;  4NDX A;  1WD1 A;  4J1M A;  5IGE A;  2I5L X;  4C3J H;  3VDY A;  4K6D A;  1IHZ A;  4AH6 A;  2ES2 A;  3FEW X;  5EPL A;  4DNT B;  1CQF A;  2JA7 G;  2KQ3 A;  4PMW A;  4CKE A;  4DV1 L;  5F2D A;  1I4Q A;  5GQO A;  3J80 E;  2F0M A;  3KJO A;  1F2Z A;  2B2W C;  3EFX D;  1CKN B;  2CWP A;  3HFZ B;  1P8L A;  4HSP A;  3NQT A;  2F0U A;  5A2Q E;  1LT6 D;  2LY7 A;  4A3F H;  4A3D B;  4DV1 Q;  4H0L C;  4C2M H;  4HIO A;  3FMC A;  1YHA A;  3ONA B;  5A2Q L;  4BY1 B;  3IL8 A;  1HR0 L;  1XXG A;  1IYU A;  1KAA A;  1E2W A;  1HFG A;  4KHZ A;  1HTP A;  4HED A;  1LV9 A;  5M3M H;  3D4W A;  2WKC A;  3SR1 A;  2UUC Q;  2MPM A;  1TWF H;  4KD4 A;  1HA6 A;  4OO1 I;  3H0G G;  3O13 A;  2MHV A;  1KLG D;  3KF6 B;  4WJ3 M;  2QF7 A;  3TRZ A;  3UDX A;  2KOL A;  1PFB A;  1NBW A;  3GQB A;  3J7Y W;  1AW7 A;  3X3M A;  2DJG C;  2ZXO A;  1VQL A;  2F3I A;  3NTK A;  2JA6 B;  1K0R A;  4IUN A;  2KHI A;  2NVX B;  3H0G H;  4OWT B;  2FFK B;  4JI0 L;  2J0T D;  2VQE L;  3MXG A;  1OXV A;  4U67 3;  1HR0 W;  5BN4 A;  5IP7 G;  3K59 A;  5AFW A;  5I9O A;  4C3I G;  4QIW B;  5IP9 H;  2UXB L;  4KK7 A;  2NBF A;  3D6W A;  4HJ5 A;  1Z6H A;  1BOS A;  1XWE A;  2H5X A;  2IT1 A;  2F0K A;  4C3H G;  3QIA A;  4JBW A;  4CDE C;  3SK6 A;  5C3E H;  4BWG B;  1DOK A;  2E2D C;  2KCC A;  2C9O A;  4ME3 A;  5FLX L;  1V1Q A;  4LFB L;  1MHW C;  1J8I A;  1SBB B;  4RG1 A;  1XMQ Q;  3M4O B;  1T5E A;  4FO2 A;  3U4V A;  1H9M A;  5M5W H;  3CCU A;  3L2P A;  3R3O A;  4IUR A;  2UXD Q;  5E1F A;  1D1K A;  1J9O A;  1RHP A;  2MO1 A;  3H3V C;  3Q24 A;  1I4P A;  4DV7 Q;  1PTO H;  4OGQ C;  4P73 A;  4GKK Q;  3BZC A;  1GUO A;  1I4X A;  4P2C B;  3KLS X;  3HOZ G;  2F4I A;  3NEL A;  1LTI D;  1KRS A;  4GNX B;  2JA7 H;  3STB C;  1VQH A;  1GD7 A;  1LYL A;  3KLW A;  1ONL A;  1QCB D;  4IFD J;  1IYV A;  2MQH A;  4ZCK A;  2OCE A;  3KJP A;  4XQJ A;  2Z9H A;  1KD1 C;  1GKH A;  1C8C A;  2EYM A;  4X3T A;  4IOA A;  1E7Z A;  1HH2 P;  1CA5 A;  3GTK H;  2WIN B;  2IHF A;  1HNZ L;  1D6E C;  4HID A;  3I90 A;  2G9H D;  3JAM E;  3HOU B;  4B3M Q;  4YWK A;  1WI5 A;  4CKC A;  4YCU A;  1VQ4 A;  1MKH A;  4DV5 Q;  4XXE A;  1CA6 A;  4B3T Q;  2X69 A;  2F4V Q;  3Q23 A;  2F3W A;  1FD7 D;  3PO2 G;  2CFM A;  1YNJ D;  1HUM A;  2PZW A;  3NSW A;  1UE5 A;  1LT5 D;  3M9B A;  3HOX B;  1OTC A;  2Z1C A;  3ULP A;  2M00 A;  4NXN Q;  3U58 A;  2YTV A;  3UI2 A;  1V1P A;  4DR3 Q;  1ILQ A;  3U50 C;  1BO0 A;  4IJL A;  1PFS A;  5JEA H;  2R92 H;  3I4M H;  1JJ2 A;  4J6H A;  3S2H H;  4JBJ A;  5BR8 L;  4FNF A;  1NY4 A;  4HMI A;  2QDL A;  3K7U C;  3OOC A;  4DV5 L;  1R9T H;  1U4P A;  2E2J H;  2LXK A;  1N34 L;  1HNZ Q;  1EY6 A;  3PO3 B;  1QZH A;  1B7Y B;  1OXT A;  1O7Y A;  1LAB A;  1UEA B;  4DV2 L;  3CP0 A;  1K73 C;  3J80 i;  4A3I H;  1Y1V G;  2K4K A;  1ML0 D;  3HOZ H;  1E2V A;  4KY5 A;  2UUC L;  1D1I A;  3H94 A;  3MHB A;  2KEE A;  1K8M A;  3HOV G;  1DJR D;  1N34 Q;  3NEN A;  1JWS D;  5C4J H;  4TQU S;  3KUP A;  1HNW L;  2L15 A;  3D3R A;  4LF9 L;  4EQP A;  3GTP B;  2B39 A;  5C3E G;  1LTA D;  2HUG A;  1TII D;  1JE4 A;  4HJ7 A;  3K58 A;  2E2I B;  4CDD C;  2EYF A;  3D8G A;  1N33 Q;  1RD9 D;  4UY8 C;  1I4H A;  2NVY H;  1J5E L;  1I5F A;  1QZG A;  4A3M B;  3NBI A;  2LKV A;  3K5L A;  2A69 C;  4LFB Q;  5IP7 H;  1VQA A;  2EQS A;  2WAC A;  3E6Z X;  1EY4 A;  4G7Z C;  3RN5 A;  1TS2 A;  1CSQ A;  2F0T A;  4YHH Q;  2VY3 A;  2A68 D;  2JA5 G;  5C4X H;  1T5X D;  1HPC A;  4AIM A;  3JAM i;  1EYA A;  3K81 C;  3I4M B;  4R4T A;  4R4I A;  4ZKC B;  2PW5 A;  4JI6 Q;  1VQ5 A;  2OF1 A;  3C46 A;  5J3B A;  4KV6 A;  3GTQ H;  2R93 G;  4DR6 L;  4C1N I;  3I2Z A;  4QB4 A;  3WDN A;  3A8K E;  2KVM A;  1D8L A;  1EOV A;  1NMF A;  2B2U A;  1O80 A;  4PMC A;  2B63 G;  1ET9 A;  3GV6 A;  3G6J B;  2NTT A;  1CQV A;  3OMG A;  3RZD B;  2D62 A;  4FYD A;  1KDB A;  4QCL A;  1C9O A;  1TY2 A;  5CYU A;  1K83 B;  2OQK A;  1SYD A;  5FO9 B;  3F2U A;  1FJG Q;  4IQZ A;  1DD2 A;  1WTX A;  4RGN A;  4MZ9 A;  4GLV B;  2IJ0 A;  3LX0 A;  1RTN A;  4OEL B;  4LJZ C;  4C3J B;  5I2Y A;  1SJH D;  1L1O A;  2CCZ A;  2HHH L;  2FJ2 A;  3M85 A;  5M3M B;  3DEO A;  4DAP A;  4DAY A;  3CCE A;  1STA A;  2BDN A;  3GTJ H;  5IGD A;  3K57 A;  3H15 A;  2F0E A;  5KYI A;  2E76 C;  1DZ1 A;  4WFN 3;  5K5P A;  2E75 C;  3K6O A;  1SYG A;  4U68 A;  1B9M A;  2DGY A;  2N78 A;  3PF5 A;  1J5E Q;  1D5X C;  1UE1 A;  4YCW A;  1A6X A;  3W2D A;  3MWY W;  3HG9 A;  4XT1 B;  1B9N A;  3K80 C;  2KCN A;  3BZD B;  3ZJY C;  4BBR B;  2PZT A;  1HXY D;  5CV8 A;  4NXN L;  3UDI A;  5C3W A;  5IT9 c;  4OX9 L;  4JW0 A;  5G3L F;  2EXZ A;  3MXP A;  2GN5 A;  2BDO A;  2RBM A;  3T56 B;  3I4N B;  3NP8 A;  5LMU Q;  4A3J G;  4NP5 A;  4A3C H;  1PRT C;  3V05 A;  2KJX A;  1X54 A;  3G7L A;  4LW1 A;  1JB7 A;  1WFQ A;  5CR3 A;  2B2Y C;  5G3L D;  3NQI A;  1LLR D;  3LNN A;  2NTS A;  2I0Q A;  4OON A;  2YU9 H;  2C35 B;  2MP1 A;  2ZXP A;  2JP1 A;  5E7N A;  1IXR A;  1G91 A;  4DV3 L;  5FJ8 H;  3TN2 A;  3KLR A;  2XRS D;  1EQV A;  2DJF C;  5LMN L;  2JA6 H;  1N36 L;  1BXT A;  1PFM A;  3Q6S A;  3S9W A;  3NTI A;  2B29 A;  1C48 A;  5BN5 A;  5AJ3 Q;  4KLK A;  3PO2 H;  4PV1 C;  4UP8 A;  1HUN A;  1JB3 A;  1VQC A;  5IYB G;  2HCI A;  1HZ9 A;  1AN8 A;  1MI2 A;  1LTB D;  3J81 E;  3GTJ B;  3W3A A;  3MEH A;  5FKA C;  3CAM A;  2JYO A;  3S1N B;  4RA8 A;  4GKJ L;  1V9P A;  4XYO A;  1VQN A;  1TWH H;  3GO5 A;  3N52 A;  2EPB A;  3HKZ B;  5D65 A;  5CGK A;  1KXL A;  2YV5 A;  2WB1 E;  3S1M B;  4BXX H;  2AQ1 B;  4WJW A;  4DAY B;  2WKD A;  4C3J G;  1CM9 A;  3PF4 A;  2D0P A;  3ND8 A;  5IGB A;  1MBY A;  1F9Q A;  1U9R A;  5C4H A;  3Q22 A;  3K0X A;  3EIV A;  3OIP A;  1BBW A;  1PYW D;  2EVB A;  4QIW E;  3I8Z A;  3IRB A;  3MXU A;  4ZLT F;  1NCV A;  4DGZ A;  5IGG A;  1PFN A;  4QJF A;  3M3Y B;  1VF5 C;  4JI3 L;  2ZJP A;  1FNU A;  1LT3 D;  3S15 H;  4DK1 A;  3W1G A;  4BA1 I;  1E1T A;  3BDL A;  3I4M G;  2K04 A;  3P7J A;  3PUV A;  3HEJ A;  5JEA G;  2XGT A;  5EBD A;  4A3G G;  4POG A;  4KKU A; 
#chains in the Genus database with same CATH homology
 1SYF A;  1W6J A;  3NXW A;  5CV9 A;  2AQ3 B;  1DON A;  4F87 A;  2V4D A;  2PNR C;  5IOC A;  2X6G A;  2HCC A;  3K7A B;  5I9P A;  4DAV A;  3S2H B;  2EYJ A;  1FNV A;  1ZKO A;  3P75 A;  3U9O A;  1TWA B;  2EYH A;  1BCP D;  1NR2 A;  1B53 A;  1Q1B A;  4DXG A;  1LTS D;  1QG7 A;  4J8Q A;  1Q1E A;  4A3E B;  3C1E A;  1GHK A;  2Z4H A;  1I4R A;  4K2L A;  1SE2 A;  5FO7 B;  3JAM L;  3QG1 A;  1EEI D;  3R8B A;  4LAA A;  3VR3 A;  1PTO D;  2FMM A;  1CHP D;  2MGS A;  3OMC A;  5I2X A;  4IFD H;  3GTQ B;  1ESF A;  5CV4 A;  2KEC A;  4M8A A;  1YNN C;  1QB5 D;  2L4N A;  3X3N A;  3A54 A;  4KN4 C;  1TWF B;  1D5M C;  3MXN A;  2FIN B;  1JWM D;  4A3J B;  3MA2 B;  2ZT9 C;  2IPK D;  1A3U A;  1C4Q A;  3AB9 A;  1GUW A;  2SNS A;  2A6H D;  3HGB A;  4K5X A;  4JK1 C;  1X32 A;  3OHX C;  1AZQ A;  1ZEQ X;  3S1R B;  3IFT A;  1PZK D;  3HS0 C;  4XT3 B;  3GD7 A;  1RTO A;  1M8A A;  3PIP 3;  2K32 A;  1EZ6 A;  1CI3 M;  2BA1 A;  2EJM A;  4UDU C;  3DWQ A;  3DEP A;  3A7L A;  4K6L A;  2JXM B;  2H4O A;  1SXT A;  2CVR A;  1Y8O B;  1WTQ A;  1WTO A;  3QB3 A;  3NPP A;  5EPJ A;  1MD2 D;  1EL0 A;  2MJ8 A;  1H9S A;  3OW7 A;  3I73 A;  2BOS A;  2B63 B;  2O5J C;  1U4L A;  4C1N K;  3A55 A;  4B9W A;  1IW7 C;  2SNM A;  2K5W A;  1VMP A;  3TZD A;  4RAU C;  1AZP A;  1NR4 A;  1EZ8 A;  2KUM A;  5NUC A;  3GTM B;  4RGO S;  1D2B A;  4K5W A;  1KDA A;  1CFM A;  2G9D A;  1OXS C;  3SK4 A;  1IW7 D;  2EJG C;  3DUZ A;  3SXH A;  3SEB A;  1GJX A;  2Z4I A;  2PYK A;  1Q8I A;  3M7N A;  1II3 A;  2A74 C;  3QO2 A;  4RGT A;  1STB A;  1EFI D;  3HOV B;  1TVX A;  2F0L A;  3T53 B;  4MIU A;  2EY6 A;  2FHT A;  5IOD A;  2O4X A;  2BA0 A;  5C3X A;  2L1B A;  4FF4 A;  2F0Q A;  3A8I E;  2AUK A;  3FDT A;  1EU4 A;  4Q5V A;  1KNA A;  4XTC S;  1UNS A;  2J4X A;  2NN6 I;  3WOE A;  5ELC A;  1SYE A;  2F0D A;  1BQQ T;  4G4K A;  3V2T A;  2GA4 B;  5EKK A;  5ELF A;  2EY2 A;  2B2V A;  3DHQ A;  5C4X B;  3I3C A;  1B2T A;  2EY1 A;  2EYO A;  3CRL C;  1TWC B;  4RCO A;  2D9U A;  3C1F A;  2K03 A;  1GUG A;  2JEA I;  2XIW A;  1GUN A;  1B1Z A;  1TS4 A;  4R8N A;  1AEX A;  4IUQ A;  4HSV A;  1WTP A;  1F9S A;  4IFD G;  2O2L D;  3FVQ A;  3PUX A;  1AP0 A;  3FKI B;  2K1B A;  3GP7 A;  2F0S A;  4FP5 D;  3NK9 A;  1LTT D;  2WP8 J;  5T1G A;  1MSG A;  1S5F D;  5C0X J;  2RVL A;  2VXW A;  3OIQ A;  4A3B B;  2QKI C;  5JAV A;  2L55 A;  4CGY B;  2PW7 A;  3A8J E;  2J7Z A;  3CKI B;  1KNE A;  1Q12 A;  4BA2 I;  4EVO A;  3VR4 A;  1ICW A;  3FPP A;  2A73 B;  1SEB D;  4ZUI A;  1JIC A;  5JVH 3;  3TDQ A;  1PRT F;  4S3S A;  5CV6 A;  3KBG A;  2PMZ B;  5IGF A;  2F0H A;  2QDB A;  5EBC A;  2RSO A;  1EYD A;  5IT9 E;  3DXJ C;  1JWU D;  2LMC B;  2TSS A;  2PO4 A;  4X3S A;  2DN8 A;  2VNU D;  2IL8 A;  1SJE D;  5D3I B;  5JPN C;  2KHS A;  5TSS A;  5C0X I;  2EE1 A;  4ZUJ A;  1BF4 A;  4IUT A;  2JE6 I;  2F0P A;  1BR9 A;  2K28 A;  4RGM A;  1V43 A;  3HRZ C;  2OT2 A;  1HQR D;  4WRD A;  1WTW A;  1SYB A;  1I4G A;  3BG3 A;  3LWE A;  2NZ1 D;  1EQT A;  1OXX K;  1QWY A;  1X3Q A;  2LS0 1;  4TSS A;  1PRT B;  2XWB B;  2XRQ D;  4EQN A;  1KTK A;  3LWU A;  2N55 A;  2K05 A;  2OEO A;  1S5D D;  4X3U A;  1I3Q B;  3QOJ A;  2A6E D;  4KMU C;  4FF1 A;  2O5I C;  4K2K A;  1STH A;  4KKS A;  4Z9C B;  3RMH A;  4FXG C;  2NWG A;  1Q3L A;  4CKB A;  1CZW A;  1B44 D;  3TBI B;  4IUV A;  1PMR A;  2WV6 D;  1E0B A;  2R6G A;  2K7V A;  1DOM A;  2CW0 D;  5E3F A;  3TP8 A;  4CBV A;  2NYZ D;  2IX3 A;  3S1Q B;  5FK9 C;  1R4P B;  1WTR A;  5CMD A;  1G2S A;  1G29 1;  4KJN A;  4NKL A;  3R2T A;  1TS3 A;  3GTO B;  3ZYY X;  5KNB A;  2SDF A;  2EZV A;  1B50 A;  1RDP D;  3TME A;  2K5D A;  2L12 A;  5M5Y B;  3SE0 A;  1SNP A;  1A15 A;  3DM1 A;  2DNC A;  2NUC A;  2L9H A;  1ENF A;  1L0X B;  5KYL A;  2VB3 X;  1PDQ A;  1HFN A;  3S16 B;  3L7Z C;  5KIX A;  3VA7 A;  1YNJ C;  2BE5 C;  2LFN A;  4BBS B;  5C5L A;  4O1N A;  4HCS A;  2R3Z A;  2CHB D;  4ULL A;  2RQX A;  1ENA A;  4DFA A;  5A35 A;  3MFG A;  5E4X A;  1JCK B;  2JSO A;  4DU9 A;  4LK1 C;  2DY7 A;  3T13 A;  5COY A;  2TMP A;  5I6W A;  5DEH A;  2RDH A;  3J81 L;  4G7O C;  1S5B D;  1SMY D;  3V96 A;  3N6R A;  3T16 A;  3K0Y A;  4ZKB B;  1Z47 A;  3FPU B;  4F8M A;  1VDZ A;  2NN6 G;  1LTG D;  4XQN A;  3NHH A;  1WVL A;  5EPK A;  1UUP A;  3KLS A;  2B2W A;  2EDG A;  3SHL A;  5LL6 X;  4HN7 A;  1SMY C;  3ERO A;  5CC4 A;  4DN4 M;  1XTC D;  1V8Q A;  1DYQ A;  1H9J A;  4KY7 A;  1F77 A;  2Q8R E;  1BCP F;  2C5C A;  3BDO A;  1O78 A;  4KY6 A;  5E4W C;  4QMG A;  3RUZ A;  1LTR D;  3MAQ A;  2WB1 B;  3VYR A;  1EY7 A;  5K36 H;  3QOL A;  2XN9 C;  3BYT B;  4IUP A;  4V0B A;  3MTS A;  4PQX A;  3D4R A;  3BDC A;  3T4A C;  2Q8T A;  3VR2 A;  1GXD C;  1EWC A;  5ELD A;  2NVT B;  2F0J A;  2YYZ A;  1LAC A;  1Q90 A;  4O42 A;  3H91 A;  1A2U A;  5IT9 L;  4PMB A;  2CQA A;  4F7X A;  1LT4 D;  3S15 B;  4RWS C;  2QEJ C;  3GTL B;  2K33 A;  4TRD A;  1SYC A;  5CBA E;  5JEA J;  5LHY 1;  3HOW B;  1IL8 A;  1TU2 B;  2XWJ B;  5T1I A;  3CU7 A;  4I7Z C;  4Y7N B;  2PPB C;  1EY0 A;  1NAP A;  1HA5 A;  5DAU A;  3EVQ A;  2X6L A;  4K8J A;  2RDF A;  2JEB I;  5I4D A;  3R2I A;  4RH6 A;  2B8F A;  3EJI A;  2F1M A;  1XX8 A;  1A3T A;  2A68 C;  2F0V A;  4LMQ D;  4ODG A;  1ZYR C;  2K01 A;  4KI0 A;  2HQE A;  3I4L A;  2IWH A;  5EQ0 A;  1G2T A;  2F0N A;  3T51 B;  5DM7 3;  4H13 C;  2SEB D;  1YNN D;  4UAI A;  5CV7 A;  4A3K B;  2EYP A;  3D4D A;  2VUM B;  1EOT A;  1V1P B;  1L0Y B;  1DXM A;  3BYY B;  4XQQ A;  2AWO A;  1SAP A;  3KF8 A;  4KD3 A;  4A3I B;  3RD4 A;  4ZRZ A;  2XVS A;  4RCN A;  1H9R A;  1GOZ A;  2B2T A;  2F0G A;  2M9V A;  5C4Z A;  5ELE A;  1RJT A;  3SVM A;  5C6A A;  2D2C C;  3URY A;  4K14 A;  3PUY A;  1PTO F;  2VB2 X;  3HOY B;  4OIJ A;  1QJO A;  3MVV A;  4A3F B;  1QOH A;  3PIO 3;  5JPM C;  1CHQ D;  3ITP A;  1VMC A;  1HHV A;  5J1Z A;  3PMF A;  1STN A;  4QF4 A;  3IKJ A;  4A3G B;  4KTA A;  3E0J A;  3U9S A;  5C0X H;  2R93 B;  1MSH A;  4CJ2 C;  4ME5 A;  1R4Q B;  2Z8L A;  2F0O A;  4HTH A;  2WAQ B;  4DNR B;  1BCP B;  1JOK A;  2ZXR A;  1STG A;  4RKL A;  4EQO A;  1Z7T A;  2RSN A;  1QNU A;  3S14 B;  1SE3 A;  1KLU D;  1TWG B;  5JVG 3;  2PZU A;  5C3E B;  1JQY D;  5CV5 A;  5DM6 3;  3DWP A;  2ENB A;  1DCZ A;  2D5D A;  1Y69 U;  1ZXT A;  4XDX A;  2F0F A;  3M7G A;  1H9K A;  3VYT A;  5IIF A;  1S5E D;  3L9A X;  2KED A;  1JOQ A;  1PTO B;  1S5C D;  5C44 B;  2MUY A;  2L11 A;  1SNO A;  4HMJ A;  4ABN A;  4CJ0 B;  1CK1 A;  1Y1V B;  4PNY A;  1FYC A;  1PTO C;  1CT1 D;  2EJF C;  1BNZ A;  4KN7 C;  2R61 A;  3ND9 A;  1U4M A;  2B8G A;  3TSS A;  1PRT D;  1EY9 A;  1SE4 A;  4IAL A;  3VR5 A;  1F2M A;  1H9S B;  1TY0 A;  2B2Y A;  4ILW A;  3PO2 B;  5JJZ A;  5KGU A;  1UAP A;  4GZY C;  4H7B A;  1QIL A;  1TT2 A;  5K36 G;  1TWH B;  4KJO A;  2SOB A;  3L3O C;  5EJW A;  2F0W A;  1I50 B;  3OWF A;  1PZI D;  3J7A F;  3PUW A;  1HCZ A;  1Y8P B;  1XYI A;  2QIL A;  2EYL A;  4X3K A;  1K8O A;  3MC0 B;  3HOZ B;  2BCO A;  5COR A;  4OIK A;  3RZO B;  1FNW A;  1TS5 A;  4B08 A;  1BCP C;  1F2Y A;  3TP7 A;  1Y1W B;  4MN3 A;  3FRP B;  5EGT A;  4A93 B;  4C2M B;  4K5V A;  2AWN A;  2EOT A;  3SK5 A;  2NB0 A;  1SNC A;  3NTH A;  2Q8I B;  4IUU A;  2RDG A;  1BBX C;  1MGS A;  5C0X G;  1OO9 B;  1NUC A;  4KHV A;  5CBE E;  5KNC A;  4G7H C;  4C56 C;  3NE5 B;  3KBX A;  1SDF A;  3AU7 A;  4C3I B;  3I91 A;  3Q0A A;  3S2D B;  1IKL A;  1RKN A;  5ELB A;  2JA5 B;  5J22 A;  3NWS A;  1HQM C;  1F9R A;  4E6I A;  5KND A;  5IGC A;  1A2T A;  2EY5 A;  1HTL D;  1EWH A;  1S4Z A;  5BN3 A;  3H0G B;  1G6Z A;  1RCV D;  2RA4 A;  1I6V C;  4OL7 A;  3D6C A;  2HDL A;  1SFO B;  1G8Z D;  3HZX A;  5M5X B;  5M5W B;  3I72 A;  3GTG B;  1F9P A;  2HDM A;  2JA8 B;  1A3V A;  1EYC A;  1DM0 B;  1ET6 A;  3P1H A;  1U4R A;  4RKB A;  1SNQ A;  4YIJ A;  3MFY A;  1WCM B;  1O7L A;  3MZ5 A;  2I46 A;  1WD0 A;  5D3D A;  2B2U C;  2ICI A;  1EIH A;  1E2Z A;  2Y0S B;  1EU3 A;  3OWE B;  2RKS A;  3I70 A;  2YU9 B;  4K8I A;  2B2V C;  5J39 A;  4RFB A;  3DMU A;  4DA2 A;  1ILP A;  3C3L A;  1ZYR D;  2IW3 A;  1BUV T;  2BE5 D;  1KAB A;  2M2L A;  3J7A V;  1ENC A;  3K5M A;  4RHR A;  4QUF A;  3PUZ A;  4N9P A;  5DNF A;  1SND A;  3TP5 A;  3VA5 A;  4BS9 A;  4L8J A;  4XYQ A;  3H09 A;  3J80 L;  4QUC A;  3QJY A;  4CJ1 B;  3NBH A;  5HGT A;  3CRK C;  2E2J B;  1JC7 A;  1EIG A;  1EY8 A;  3IAY A;  3NUC A;  3VYU A;  2F03 A;  1B3A A;  2A5H A;  2E2H B;  1SSO A;  2AQ2 B;  1X3P A;  4FF3 A;  4FVM A;  1JR0 D;  1B4O A;  4IZ8 A;  3EQL C;  2A69 D;  3TP6 A;  5C4J B;  1TQO A;  4C3H B;  5KEE A;  4RHS A;  3CQZ B;  5D14 A;  3WOF A;  2WII B;  4KKT A;  2OXP A;  4IN3 A;  1FGB D;  1F2L A;  2I07 B;  3GV3 A;  1DOL A;  2ICE C;  2NVY B;  5M9O A;  3DWA A;  3R93 A;  1STE A;  4ZAI A;  1VF7 A;  1JOO A;  1KDC A;  4B9X A;  2IX1 A;  2KA7 A;  2XSC A;  2PCF B;  1HRJ A;  2ID0 A;  3SDZ A;  4HR7 B;  1CTM A;  3A7A B;  5FLX E;  4TKO B;  3OSO A;  2F3V A;  5LL6 S;  2F0I A;  4DK0 A;  2NVQ B;  1SNM A;  3K5N A;  4OO1 H;  1OXU A;  1RF2 D;  1M4V A;  1ESR A;  1W6K A;  3EA6 A;  4I65 A;  1QNK A;  4NMZ A;  4OHJ A;  5ISR A;  1EY5 A;  5EKI A;  3D31 A;  2QCP X;  5FO8 B;  4R8I A;  4DXF A;  2PQE A;  1QE6 A;  1GUS A;  4AYB B;  2N88 A;  2JA7 B;  5M3F B;  1JOR A;  4MHE A;  4N9T A;  3VR6 A;  1STY A;  3C2P A;  4ZK9 B;  1AFP A;  3GTK B;  3SK8 A;  1VCI A;  1PZJ D;  3VYS A;  1V1O A;  4NW2 A;  2A6H C;  3HP3 A;  4L6T B;  3H6M A;  4OO1 G;  3CHB D;  3K5O A;  4M1U B;  4H44 C;  2R92 B;  3BVM A;  1CZG A;  2H1E A;  2L5T A;  1NSN S;  2DY8 A;  2NN6 H;  3BVZ A;  3OPO A;  1R9T B;  4FF2 A;  3M4Y A;  1EEF D;  4ZQ3 A;  4EGV A;  4Q0F A;  2XNA C;  3TZU A;  5KRU A;  3S17 B;  3ERQ A;  5C5M A;  1D5Z C;  4BY7 B;  3AMU A;  3P20 A;  4FXK C;  2E74 C;  4HAE A;  1PXU A;  4XIG S;  5JOB A;  1IKM A;  4ID6 A;  3NWT A;  2IX0 A;  3RLF A;  1GHJ A;  1TKW B;  3BVG A;  3BS1 A;  1ROD A;  3PV0 A;  1TR5 A;  5EKL A;  2K6A A;  1BDO A;  2K5Q A;  4FXD A;  2A6E C;  2AUJ D;  4V19 0;  3A56 A;  2R7Z B;  2DNE A;  3E5S A;  2L0C A;  1FR3 A;  2B2T C;  1GUT A;  1O7Z A;  2FMC A;  5FOB B;  4L63 B;  3IFD A;  4F88 A;  4IFD I;  4WOR A;  4HCE A;  1Y8N B;  3KK7 A;  1PLF A;  2CW0 C;  4G57 A;  4DF7 A;  1I6H B;  5HUR A;  4ZYS A;  3QWN A;  4R9W A;  1WTV A;  1LO5 D;  4CHT B;  5I6Y A;  4NDX A;  1WD1 A;  4J1M A;  5IGE A;  4K6D A;  1IHZ A;  3FEW X;  5EPL A;  4DNT B;  1CQF A;  2KQ3 A;  4PMW A;  4CKE A;  5F2D A;  1I4Q A;  3J80 E;  2F0M A;  1F2Z A;  2B2W C;  3EFX D;  4HSP A;  3NQT A;  2F0U A;  5A2Q E;  1LT6 D;  2LY7 A;  4A3D B;  4H0L C;  3FMC A;  3ONA B;  5A2Q L;  4BY1 B;  3IL8 A;  1XXG A;  1IYU A;  1KAA A;  1E2W A;  1HFG A;  4KHZ A;  1HTP A;  4HED A;  1LV9 A;  3D4W A;  2WKC A;  3SR1 A;  2MPM A;  4KD4 A;  1HA6 A;  4OO1 I;  3O13 A;  2MHV A;  1KLG D;  2QF7 A;  2KOL A;  1PFB A;  3J7Y W;  3GQB A;  1AW7 A;  3X3M A;  2ZXO A;  3NTK A;  2JA6 B;  4IUN A;  2NVX B;  2FFK B;  2J0T D;  3MXG A;  1OXV A;  4U67 3;  5BN4 A;  3K59 A;  5AFW A;  5I9O A;  4C3I G;  4QIW B;  4KK7 A;  2NBF A;  3D6W A;  1Z6H A;  1BOS A;  1XWE A;  2IT1 A;  2F0K A;  4C3H G;  3QIA A;  4JBW A;  3SK6 A;  4BWG B;  1DOK A;  2E2D C;  2KCC A;  2C9O A;  1J8I A;  5FLX L;  1SBB B;  3M4O B;  1T5E A;  4FO2 A;  1H9M A;  3R3O A;  4IUR A;  5E1F A;  1D1K A;  1J9O A;  1RHP A;  3H3V C;  3Q24 A;  1I4P A;  1PTO H;  4OGQ C;  1GUO A;  1I4X A;  4P2C B;  3KLS X;  2F4I A;  1LTI D;  1ONL A;  1QCB D;  4IFD J;  1IYV A;  4XQJ A;  1C8C A;  2EYM A;  4X3T A;  1CA5 A;  2WIN B;  1D6E C;  3I90 A;  2G9H D;  3JAM E;  3HOU B;  4CKC A;  4XXE A;  1CA6 A;  2X69 A;  3Q23 A;  2F3W A;  1FD7 D;  1YNJ D;  1HUM A;  2PZW A;  3NSW A;  1LT5 D;  3HOX B;  2Z1C A;  2M00 A;  3UI2 A;  1V1P A;  1ILQ A;  1BO0 A;  5JEA H;  4J6H A;  4FNF A;  4HMI A;  3OOC A;  1U4P A;  1EY6 A;  3PO3 B;  1OXT A;  1O7Y A;  1LAB A;  1UEA B;  1ML0 D;  1E2V A;  4KY5 A;  1D1I A;  3H94 A;  3MHB A;  2KEE A;  1K8M A;  1DJR D;  1JWS D;  4TQU S;  3KUP A;  3D3R A;  4EQP A;  3GTP B;  2B39 A;  1LTA D;  2HUG A;  1TII D;  1JE4 A;  3K58 A;  2E2I B;  2EYF A;  3D8G A;  1RD9 D;  1I4H A;  4A3M B;  3NBI A;  2LKV A;  3K5L A;  2A69 C;  2WAC A;  3E6Z X;  1EY4 A;  4G7Z C;  1TS2 A;  2F0T A;  2A68 D;  1T5X D;  1HPC A;  1EYA A;  3I4M B;  4ZKC B;  2PW5 A;  2OF1 A;  3C46 A;  4KV6 A;  4C1N I;  4QB4 A;  3WDN A;  3A8K E;  2KVM A;  2B2U A;  1O80 A;  4PMC A;  1ET9 A;  3GV6 A;  3G6J B;  2NTT A;  1CQV A;  3OMG A;  3RZD B;  2D62 A;  4FYD A;  1KDB A;  4QCL A;  1TY2 A;  5CYU A;  1K83 B;  1SYD A;  5FO9 B;  3F2U A;  4IQZ A;  1DD2 A;  1WTX A;  4RGN A;  2IJ0 A;  3LX0 A;  1RTN A;  4LJZ C;  4C3J B;  5I2Y A;  1SJH D;  2FJ2 A;  3M85 A;  5M3M B;  3DEO A;  4DAP A;  4DAY A;  1STA A;  2BDN A;  5IGD A;  3K57 A;  2F0E A;  5KYI A;  2E76 C;  1DZ1 A;  4WFN 3;  5K5P A;  2E75 C;  3K6O A;  1SYG A;  4U68 A;  1B9M A;  1D5X C;  1A6X A;  3W2D A;  3MWY W;  3HG9 A;  4XT1 B;  1B9N A;  2KCN A;  3BZD B;  4BBR B;  2PZT A;  1HXY D;  5CV8 A;  5C3W A;  5G3L F;  2EXZ A;  3MXP A;  2BDO A;  2RBM A;  3T56 B;  3I4N B;  3NP8 A;  4NP5 A;  1PRT C;  3V05 A;  2KJX A;  3G7L A;  5CR3 A;  2B2Y C;  5G3L D;  3NQI A;  1LLR D;  3LNN A;  2NTS A;  2MP1 A;  2ZXP A;  2JP1 A;  1G91 A;  3TN2 A;  3KLR A;  2XRS D;  1EQV A;  1BXT A;  1PFM A;  3Q6S A;  3S9W A;  3NTI A;  1C48 A;  5BN5 A;  4PV1 C;  1HUN A;  1JB3 A;  2HCI A;  1AN8 A;  1MI2 A;  1LTB D;  3J81 E;  3GTJ B;  3W3A A;  3MEH A;  5FKA C;  2JYO A;  3S1N B;  4RA8 A;  4XYO A;  3GO5 A;  3N52 A;  2EPB A;  3HKZ B;  5D65 A;  5CGK A;  3S1M B;  2AQ1 B;  4WJW A;  2WKD A;  4C3J G;  1CM9 A;  3ND8 A;  5IGB A;  1MBY A;  1F9Q A;  1U9R A;  5C4H A;  3Q22 A;  3OIP A;  1PYW D;  2EVB A;  3I8Z A;  3MXU A;  4ZLT F;  1NCV A;  4DGZ A;  5IGG A;  1PFN A;  3M3Y B;  1VF5 C;  1FNU A;  1LT3 D;  4DK1 A;  4BA1 I;  3BDL A;  2K04 A;  3P7J A;  3PUV A;  3HEJ A;  5JEA G;  5EBD A;  4KKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...