3FKIH

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
total genus 13
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiH00
3I56A 3PF4A 4IPCA 3GTJH 2ASBA 2ZJQA 2VW9A 1VQCA 2YV5A 1N8RC 2JA5H 1E7ZA 1G291 2Q2IA 2RF4A 2WAQG 2MQHA 4JI3Q 2Z6KC 4YCVA 1PH9A 3BU2A 5FLXc 3J81i 3PIPA 3PO2H 1GVPA 4JI5Q 5BR8Q 1Q8KA 1J5EL 5GAGC 1YJWA 1HR0L 4A3DH 1VQAA 1VQDA 3E9HA 4UP8A 5E7NA 4JI7Q 1EFWA 4X6AH 1TWGH 4DR5Q 3M9BA 3S1NH 4JBMA 4LF5L 4GN4B 1A62A 5C4XH 4LFAQ 2IT1A 4A3FG 2R92H 2KCTA 2QGQA 4O2DA 2ZJPA 5AJ3L 1VS0A 2VZAA 3A74A 4KHPL 1N32L 3J81j 3WWVA 1N36L 5GADC 2OTLA 2JA8H 3JC66 3RN2A 4B3RL 2B29A 2LXJA 3CCLA 1Q81C 4TVAB 1VQMA 3I4MG 4GKJL 1V1QA 4JBKA 2IY5B 3OTOQ 3GTOH 1IBKQ 4DV4Q 4JI1L 4DV3Q 5IWAL 4BY1H 2VL6A 2F4VQ 4XTCS 2NVQH 3PV0A 4QJFA 4POGA 4OXPA 4X64L 4A93H 1EOVA 3W1GA 4DR6L 1X54A 1Q46A 2IHFA 1EWIA 1PH3A 1PH7A 3RZOH 1KL9A 2N8NA 3CCMA 1LUZA 1I50H 2Q2UA 2H5XA 1XNQL 1X3GA 2YYZA 2IHEA 4YCWA 1L2FA 2KHIA 5JEAG 1Q7YC 4GKKL 4RMFA 4DR3L 4JYAQ 1PH8A 1NBWA 4O0AA 3K7AH 1IBLL 4LF6L 3KF6B 4DV1Q 2CFMA 4B3SL 4X66L 4LFBL 2PQAA 1BKBA 1YNXA 2UXCQ 1C9OA 4BA1I 2XTIA 5LMUL 3CQZH 2KHJA 2GN5A 4PZ8A 4BXXH 2E2JH 4L5TA 4GOPA 4AQYL 3HOZH 1YITA 3NEMA 4R4OA 4QIWE 3L2PA 4B3TQ 2PQAB 1TXYA 4HIOA 1HZAA 3NELA 2E2IH 1Q12A 2GVAA 1PH5A 4BA2I 1VCIA 5IYCH 2K5HA 1BBUA 3CCUA 4JI4Q 4IOCA 2R7ZG 1SROA 3EIVA 2RCNA 3RR5A 2A8VA 1CKNA 2JQOA 1HR0Q 1JB7A 2VQEL 5C4JH 1XNRL 4IPGA 5IP7H 1S40A 4POFA 1HNXL 4LF9L 3GTMH 4C3JH 4LF5Q 2JA5G 2L15A 2JEBI 1QVCA 1X6OA 2ZM6L 3BZCA 5M3MH 4UP7A 3CMAA 4P75A 4HJ9A 5AJ3Q 1NMFA 2KENA 4OONA 1E1OA 1N36Q 1CKNB 3PO2G 2MNAA 2EIFA 4B3RQ 2N3SA 1FGUA 2NN6I 4LW1A 1GO3E 4DUYQ 3S1MH 4A3DG 4HIMA 4IFDJ 4A3EH 4GKJQ 1JJGA 2VY3A 1WYDA 3CCEA 1K83H 3CP0A 4DV7L 1XPUA 1UEBA 4A3IH 5C4XG 1I94Q 1I3QH 4JI1Q 2R92G 2BA1A 4GS3A 2Y0SG 2WB1E 5IWAQ 4DUZL 4X62L 1Q1EA 1NMGA 4DV0L 1QZGA 3UE0A 1SRUA 4P72A 1GM5A 3M3YH 4X64Q 2JA8G 1Y1WH 4FDBA 5M3FH 3L0OA 4MNOA 4DR6Q 2UUCL 2Q2TA 3HOVH 1RL2A 3KJPA 3I4NH 4X65L 4HJAA 3GDEA 1XNQQ 1SLJA 4GKKQ 1YJ9A 2WB1G 4BY1G 5IYBH 1KD1C 4C2MH 3F8TA 1ASYA 4EX5A 4YY3L 1PYSB 3KJOA 1GKHA 1IBLQ 1QVFA 4LF6Q 3KDFA 1T9HA 2DUDA 3PUVA 1CSQA 4JBWA 4X66Q 3HOXH 2UU9L 4B3SQ 4LFBQ 3TS0A 4LF7L 5EAYA 5LMUQ 3A5UA 1Q86C 3M4OH 2RHQB 4YWKA 4LUVA 3F2DA 4GOPC 2OTJA 1L1OB 2E5LL 2D0PA 3DM3A 3PUXA 4R4IA 3CXCA 4GLXA 1PA6A 3TRZA 2B3GA 2HIVA 4WJ3M 4LUOA 2K50A 3U58A 2K14A 2XGTA 2CQOA 2ATWA 2BA0A 4DKAC 1UE6A 5IY0A 3S17H 1HR0W 1V43A 3D31A 4K0KQ 4BXXG 4BBRH 2K75A 3ICEA 3ULPA 4C3IH 3SGIA 3PSIA 4OWTB 3HOZG 1VQ8A 2R6GA 3RLNA 2VQEQ 2BH8A 4IFDG 1XNRQ 4B3ML 1NJIC 4APVA 1HNXQ 4LF9Q 3CCSA 4DV2L 3UDFA 1PVOA 2OWOA 5C0XJ 2ZM6Q 5IYCG 1SFOH 2MO1A 1VQ6A 1UE7A 1YEZA 3CF5A 5M5WH 2VNUD 3H15A 1FVIA 1V9PA 2AWNA 3T1YL 3GO5A 2JA6H 1U0LA 1IL2A 1RIPA 5IP7G 1DGSA 3CD6A 3F1ZA 4P71A 4J15A 2QEXA 2KBNA 1KC8C 3EN2A 4DV7Q 4TQUS 1K8AC 1X65A 5M3MG 1N34L 4LF4L 3TQYA 4DUZQ 5C3EG 4X62Q 1KRSA 4DV0Q 3S1RH 2HQLA 4DAYB 4MTNA 3B6YA 1LM0A 4EQ5A 2NVXH 2UUBL 2YU9H 2UUCQ 4R1JA 4A3KH 3A5ZB 4QGUA 4A3EG 1CKOA 4X65Q 1EUJA 3AFQA 1IBML 4IPHA 4A3IG 1JJCB 4OX9L 1KQSA 3Q8DA 4KHZA 2JA7H 4YY3Q 2ALYB 2LSSA 1N33L 3OYYA 3GTGH 1OXVA 2K4KA 1WCMH 1Y1WG 2UU9Q 1G6PA 5M3FG 3CCQA 4JBJA 3U4ZA 1B70B 3I55A 4LF7Q 3HOVG 3I4NG 1UWVA 1HNZL 4A3MH 5LMNQ 3HOWH 3HOUH 3RLOA 5IYBG 4BBSH 3F2BA 3U50C 3JAMi 2E5LQ 4KLKA 2HT1A 1Y1VH 2VUMH 2UXBL 3FKIH 3HOXG 1VQOA 1EIFA 3K81C 4IJLA 2MFIA 1VQBA 4YHHL 1E3PA 1KAWA 2VQFL 1X3EA 1PH6A 4NB3A 3ULJA 1W3SA 1YVCA 3J81c 1OXXK 3STBD 3CCRA 1M90C 1P8LA 4A75A 1YJNA 1N32Q 2ID0A 4B3MQ 3TS2A 3G71A 4DV5L 4DV2Q 4AH6A 3PGZA 4UP9A 1PHJA 3H0GH 4NXNL 4DR2L 3S15H 1QUQA 4GOPB 3G6EA 3F2CA 1J5EQ 4BBRG 3GTPH 1XPOA 2IX0A 3KFUA 4YWLA 3HOYH 1NY4A 2D62A 4GLAC 4HJ7A 2B63H 3W5OA 4UPAA 2HHHL 4YWMA 2JJQA 3M4PA 5K36G 1S72A 2PI2E 3AYHB 3K80C 5C3EH 2Z0SA 2Y0SE 4KHPQ 1VQGA 1QUQB 1N34Q 1CKMA 4LF4Q 4LWCA 1SR3A 1WI5A 2OCEA 4DNIA 4QL5A 1KIXA 1MJCA 3UDXA 2IX1A 1SN8A 3K7UC 2UUBQ 1YHQA 2D0OA 1YZ6A 2JA6G 5FLMH 1NTGA 1FJGL 1X56A 2E2HH 1IBMQ 2ES2A 4IOAA 1G51A 3CC2A 4L5QA 3J80i 5IP9H 4OX9Q 4JI8L 3CMEA 1XJVA 4A3CH 1BVSA 4LNQA 4JI3L 1XMQL 1IYJB 2WP8J 2K5NA 2ZTDA 3KYHC 3A0JA 4DK3C 3AFPA 4JI5L 4A3GH 1X9NA 5LMNW 1C0AA 4A3KG 3RN5A 3S2HH 1HNZQ 1K73C 4DR3Q 4JI7L 1AH9A 5M5YH 3KF8B 4JCVE 2JA7G 1LYLA 4LFCL 2UXBQ 3BZKA 5JJIA 3CAMA 1WCMG 3IRBA 2I5HA 2N78A 4YHHQ 1SE8A 2VQFQ 1QZHA 1JMCA 2AHOB 4JV5L 4A3MG 1B8AA 4AQYQ 3HOWG 3HOUG 4BBSG 3KDFB 4JI2L 1VQNA 4A3LH 2CCZA 1Y1VG 4NXML 3MEFA 3FKIG 3NENA 2VUMG 3CC4A 1A0IA 3S2DH 3M85A 2LXKA 1K3RA 1PH2A 4NXNQ 4DR2Q 5IYDH 1OXUA 3T1HL 3LGJA 2ZJRA 3S14H 2F3IA 3E9IA 2NVYH 3MXNB 1WOCA 1YIJA 1VQJA 4R4CA 4JI6L 4PMWA 5H1SE 2I5LX 4NPSA 4R4TA 3ERSX 2HHHQ 2NVTH 4QY7A 4A4IA 2I0QA 2UUAL 2CKZB 4IPDA 3H0GG 1OTCA 4DR4L 3RNUA 4A3BH 4H02A 1U5KA 1Z9FA 3HKZG 4MZ9A 3HOYG 3I2ZA 4GNXC 1HZBA 1UE1A 5DLQE 3I4OA 5JEAJ 1XMOL 1QVGA 1VQ4A 2B63G 2EXDA 2ZTEA 2OQ0A 3VDYA 3DLLA 1FJGQ 4P73A 3J7A5 4B3TL 3K8AA 5JJKA 1WFQA 4IJHA 5GROA 3KOJA 4JI8Q 1H95A 4IFDI 1I6HH 1OXTA 4LUZA 4DAMA 4DV6L 3UDIA 2F52A 4AIMA 3CPWA 1XMQQ 2PNHA 4HJ8A 4BY7H 1TWAH 5HY6A 3KLWA 5J3BA 5M5XH 1VQFA 1VQPA 4JI4L 4UY8C 5FLMG 3H3VH 4HIKA 1VQLA 5IE8A 1PYBA 3CCVA 1CUKA 4OWWB 5GAEC 1MJEA 5IP9G 3J7ZC 3GD7A 1MKHA 5FJ8H 4A3CG 1PFSA 2QA4A 1IXRA 2HIXA 1S3OA 4LFCQ 1C7YA 4JI0L 1Z47A 3L7ZC 4A3GG 1Y14B 4IO9A 2R93H 1XTDA 4DUYL 3G48A 4JV5Q 2UXDL 1EQRA 1AE3A 3AQQA 4OWXB 3GTLH 2MO0A 2OQKA 1K0RA 4JI2Q 2AMCB 3GTQH 3S1QH 1I94L 4NXMQ 1L1OC 1EQQA 5C0XG 5GQOA 3KF6A 4AYBE 1Q1BA 4OO1G 4JOIC 3W1BA 4HIDA 3M4QA 2K52A 3HKSA 3T1HQ 4A3JH 1D8LA 2NZOA 1EIYB 4L5RC 4JG2A 4DR1L 3S24A 2E8GA 3PIOA 4JI6Q 3M7NA 5C44H 4A3LG 4WJ4A 1GD7A 3TREA 5ELOA 1N9WA 2I5MX 1YHAA 3PO3H 2UUAQ 1A63A 4AYBG 3U4VA 4DR4Q 3ZJYC 2Q2HA 5IYDG 1ASZA 2JE6I 4KI0A 4R4QA 1CSPA 4DR7L 3T1YQ 1L0WA 1EYGA 2K5VA 5C0XI 1I5FA 1MIUA 3D0FA 4QQBX 1XMOQ 1JE5A 1XPRA 4GN5A 1YI2A 1HNWL 4OO1I 2CWPA 2KCMA 4LF8L 1BBWA 1E22A 1HZCA 3STBC 1VQ9A 2PMZE 1KHIA 2AKWB 4ME3A 4HJ5A 2R7FA 4A3BG 2NN6G 2R7DA 1X3FA 2RHSB 3ULLA 4DV6Q 3E0EA 3K0XA 2CWAA 4GNXA 4K0KL 3PCOB 3UDGA 4L5SA 3CW2C 4GLVB 2NZHA 4JC0A 5IT9c 1Q82C 3EBEA 1JJ2A 3UE1A 1HH2P 2PI2A 4XIGS 1KXLA 3JAMc 1VQ7A 4A3FH 1N33Q 2FXQA 1JT8A 1SMXA 5GAHC 1K8GA 3PF5A 3CPFA 2Z6KA 3I7FA 4GNXB 4JI0Q 5JJLA 3CCJA 5BR8L 4BY7G 1X55A 1J6QA 4PZ6A 2YTVA 3FHWA 4RG1A 4Y7NH 4ALPA 1TWCH 1PH1A 3GTKH 4PG3A 1AE2A 4C3HH 4A76A 4DR5L 3I4MH 1E24A 2UXDQ 4LFAL 1K9MC 3AEVA 2EQSA 5FJ8G 2YTXA 4PZ7A 3ER0A 1VQHA 3PUYA 3PUWA 1A8VA 1OXSC 2A1AA 1VQKA 1YHBA 3S16H 3TEHB 2R93G 2VS1A 2GVBA 2YTYA 3OTOL 2WFWA 1E1TA 1TWHH 1O7IA 4DV4L 1R9TH 1IBKL 4DV3L 1LTLA 2DGYA 5HGQA 4DR1Q 3H3VI 1W2BA 2F4VL 2ZTCA 1L1OA 4DV5Q 1UE5A 4A93G 2JEAI 3OW2A 3CC7A 1VQ5A 3FP9A 4JOIA 1P16A 3PUZA 3HKZE 4GN3B 4A3JG 2JA9A 2N49A 4DR7Q 2V1CC 4P74A 4JYAL 1B7YB 5LMNL 5C44G 1IZ6A 1NE3A 5ELNA 3G4SA 4DV1L 1PV4A 1HNWQ 1HZ9A 4LF8Q 3RLFA 2BH2A 2UXCL 3J80c 3PO3G 1VQIA 4DK6C 3RZDH 1D7QA 2JK8A 2AWOA 3NBHB 1VQEA 3HFZB 1HJPA 2WAQE 1PH4A 4DPGA 2C35B 1M1KC 4Y52H 1WJJA 1YBYA 1FL0A 2A19A 1KRTA 2R7ZH 4YCUA 3BJUA 1TWFH
chains in the Genus database with same CATH superfamily
1AN8A 2ASBA 5HURA 4EGVA 5C4HA 2YV5A 1NR2A 1E7ZA 2Q2IA 2RF4A 4JI3Q 1BCPC 2WIIB 3BU2A 3JAME 1TVXA 5IGGA 4XQQA 3J81i 1YNND 2B8GA 3Q22A 4A3DH 2Z8LA 1VQAA 4F88A 4X6AH 4C3JB 4DR5Q 4LF5L 5C4XH 1LV9A 2IL8A 4LFAQ 1K8OA 4RCNA 2R92H 2KCTA 5K5PA 2VZAA 1H9JA 3DHQA 5EPLA 1O80A 4A3EB 1Q81C 1VQMA 4MN3A 2D2CC 4C3HG 3GP7A 2R61A 2IY5B 1BNZA 3GTOH 5IWAL 4XXEA 3S16B 2DN8A 4POGA 4C1NI 1B3QA 4OXPA 1EOVA 3W1GA 1Q46A 2IHFA 1EWIA 1V1PB 5G3LF 2Q2UA 2YYZA 2IHEA 4YCWA 3T51B 1L2FA 4FO2A 4I7AA 4GKKL 3NQIA 1PH8A 3KUPA 3K7AH 1IBLL 3K0YA 4X66L 1YNXA 1PTOC 3T56B 4BA1I 1B4OA 1C4QA 3J7YW 1STYA 2F0IA 2GN5A 2E2JH 4L5TA 4AQYL 4R4OA 4R9WA 1TXYA 1J8IA 3NELA 2E2IH 1SNDA 3DM1A 1DJRD 5ELBA 2R7ZG 3QWNA 1SROA 3EIVA 3Q24A 2A8VA 5EJWA 1EYDA 5CV6A 5C4JH 1KDCA 1G2SA 5E3FA 1HNXL 2EYPA 4IUUA 2JA5G 2JEBI 2ICIA 4OL7A 2E74C 5M5WB 5AJ3Q 1NMFA 3PO2G 1E2ZA 1N36Q 3K5NA 1TWGB 2JA6B 4B3RQ 1FGUA 2NN6I 4DAPA 1DCZA 3X3NA 1PZJD 1JJGA 3CP0A 1ESFA 4JI1Q 4GS3A 2WB1E 4DUZL 2A6HD 1Q1EA 1NMGA 3KF8A 4FXDA 1RKNA 2JA8G 4DR6Q 4ZRZA 5I9OA 3HOVH 1BUVT 3FMCA 3C3LA 2EYMA 1SLJA 1ET9A 4CJ2C 1EY8A 5IYBH 1ASYA 4YY3L 3DWAA 1PYSB 1QVFA 1CSQA 4B3SQ 3TS0A 2F0QA 4RHRA 4B9WA 1T5XD 5CBAE 4KMUC 3HOWB 1MD2D 3HOUB 3F2DA 2VUMB 3DM3A 3PUXA 3CXCA 2B3GA 4WJ3M 3OMCA 5DAUA 2K01A 2G9HD 4KJOA 4K0KQ 4BXXG 2K75A 4ZLTF 3A55A 3C46A 3D6CA 2VQEQ 2BH8A 2DY7A 2A68C 4APVA 1NJIC 5K36H 1WTHA 4LF9Q 5EKLA 3H0GB 1R4QB 3UDFA 4IUNA 1PLFA 2ZM6Q 4FF3A 2F0SA 2L55A 1NAPA 3HKZB 1UE7A 5EKKA 3TZDA 4HEDA 3H15A 2HDLA 2AWNA 4H0LC 3T1YL 5IOCA 2PYKA 1U0LA 1EY4A 1RIPA 1DGSA 5C3EB 3EN2A 4TQUS 3S9WA 1K8AC 1X65A 1N34L 3TQYA 4DV0Q 3V96A 2HQLA 4KKUA 2UUBL 5CV9A 3H94A 3MAQA 2UUCQ 1UAPA 2VB2X 4KV6A 4OX9L 3ONAB 1YNNC 1ENFA 2TMPA 1OXVA 2E2DC 1WCMH 4A3GB 3U4ZA 2KHSA 3H91A 4ODGA 4A3MH 3EFXD 3MXGA 3U50C 4L63B 3K5OA 4KLKA 3HOXG 4IJLA 4G7ZC 1LLRD 4YHHL 1KAWA 2VQFL 1PH6A 4JK1C 3NPPA 4YIJA 1A15A 1SBBB 1VMCA 5KNBA 2KCCA 1WD1A 2CVRA 3U9SA 1LTSD 2ID0A 2IX3A 2PZWA 1SMYD 1EYCA 4B3MQ 4QCLA 4DA2A 4DV2Q 4AH6A 1PHJA 2A6ED 3OIQA 1PMRA 1EY6A 3QB3A 1SNPA 3G6EA 3F2CA 1U9RA 4BBRG 1ZKOA 2IX0A 3GTPH 4C3IG 1A2UA 4GLAC 2SNSA 2B63H 1SE2A 3W5OA 4UPAA 2V4DA 1MHWC 2JJQA 3M4PA 2EYFA 2PI2E 4A3BB 2Y0SE 4LF4Q 3DWQA 4LWCA 2OCEA 1TS2A 1T5EA 3BYTB 1SN8A 4N8X1 4S3SA 2RQXA 1FJGL 1SYCA 4IOAA 3S1RB 3J80i 2L0CA 4JI3L 5M5XB 1RJTA 2K5NA 5I2YA 3RN5A 3S2HH 1HNZQ 1K73C 1EEID 1EWCA 3RD4A 2WACA 1D5MC 4K6LA 4LFCL 2UXBQ 1Q8IA 4LJZC 5JJIA 3CAMA 4UDUC 2N78A 2OXPA 5CGKA 3R93A 1JMCA 1SE8A 5CC4A 4Q5VA 2A6HC 2MHVA 3KDFB 2F0FA 3NHHA 3SK5A 4E6IA 4OIJA 2CCZA 4ZYSA 3MEFA 3FKIG 1PDQA 3NUCA 3SR1A 1K3RA 1QJOA 1PH2A 4A3JB 4DR2Q 1UEAB 2F3IA 4NP5A 3E9IA 3MXNB 3NBHA 4JI6L 4FXGC 5H1SE 2I5LX 4IQZA 2K5DA 2NVTH 1WTWA 4IPDA 1OTCA 5A35A 2B2VA 2CQAA 4CDFC 1WTVA 4LAAA 3I2ZA 1ML0D 1HQRD 1HZBA 2F0GA 5DLQE 1XMOL 3RUZA 1GUSA 2EXDA 2ZTEA 2OQ0A 4CKEA 3VDYA 2OT2A 2WAQB 4DF7A 1OXTA 4LUZA 1HRJA 4DV6L 2F52A 1TWAH 1VQPA 3KLWA 4UY8C 4DGZA 1VQFA 5I6WA 3CCVA 4OWWB 5GAEC 1JICA 3J7ZC 3GD7A 1B53A 4Q0FA 1IXRA 1S3OA 4PMBA 1IHZA 3GTKB 3L7ZC 1Y14B 5M5YB 4IO9A 2R93H 3T13A 4JV5Q 1X32A 1EQRA 3KLRA 3GTLH 1II3A 2OQKA 3S1QH 2AMCB 4NXMQ 5T1IA 2DNCA 4RHSA 4FXKC 1EQQA 3FDTA 1I4GA 1EFID 2K03A 1WTOA 4OO1G 1PRTD 3R8BA 1TWHB 3FPPA 4XT3B 2OF1A 3IFDA 3P75A 4L5RC 3S24A 2E8GA 3PIOA 4WJ4A 4MHEA 2WKCA 3TREA 1FD7D 2I5MX 1QE6A 2DJFC 4AYBG 4CKBA 3U4VA 2RA4A 4DR4Q 2O5JC 4DR7L 1D1KA 1EYGA 3K58A 1MIUA 1KABA 4HCSA 4GN5A 3Q23A 2XWJB 4EQNA 2CWPA 2EY5A 1EZ6A 3IFTA 2PMZE 4HJ5A 5ELCA 2RHSB 4ILWA 3E0EA 3BDOA 3LX0A 5NUCA 2CWAA 4K0KL 3PCOB 1SMYC 1F2YA 4KKTA 1W6KA 3CW2C 2A6EC 1B1ZA 1JJ2A 5D3DA 1HH2P 4XIGS 2B2WC 3MXUA 1F9PA 3CPFA 1SNCA 3VR5A 4BY7G 1X55A 1A3TA 2HCIA 1PH1A 1QWYA 1TWCH 1AE2A 4Z9CB 4C3HH 5C4XB 2I07B 4B9XA 2R92B 1HTPA 1D5ZC 1DOKA 1ZYRD 5FJ8G 4CDCC 3ER0A 4R8IA 2AUJD 2A1AA 1MBYA 3TSSA 2YTYA 3GTOB 4H44C 2WB1B 1E1TA 1PRTF 2XSCA 4DV4L 1IBKL 1SDFA 3X3MA 5HGQA 1W2BA 4H13C 1L1OA 4CHTB 2BCOA 1FNVA 1O7LA 3TMEA 3DEOA 2Q8IB 4DXFA 1XX8A 1P16A 4GN3B 3HKZE 4MIUA 3NTKA 3K7AB 2RBMA 3G4SA 1CQFA 4JPBW 5C3WA 4LF8Q 3RLFA 2BH2A 4I7ZC 3PO3G 5CV8A 4XYOA 4DK6C 2AWOA 3BVZA 1VQEA 1PH4A 1LT4D 2KJXA 1X3QA 4DPGA 1WJJA 1HUNA 1GXDC 2A19A 2R7ZH 3SE0A 3BJUA 1GVPA 3LWEA 1BQQT 2IWHA 2ZJQA 2B2UA 1N8RC 2JA5H 3I73A 2IPKD 4OGQC 3CRKC 3PO2H 4JI5Q 2F0DA 1HR0L 1YJWA 5C4JB 1SYFA 4FYDA 1SEBD 1CK1A 4UP8A 1D5XC 1EFWA 1ICWA 3M9BA 4IN3A 3S1NH 2IT1A 1MGSA 2N88A 1Z7TA 2OTLA 1HA6A 2JA8H 3JC66 3RN2A 2B29A 2K5QA 1Y8OB 3CCLA 4GKJL 5L37A 2Z1CA 1FNUA 1V1QA 4KD3A 4JBKA 5BN3A 4G7HC 3P7JA 4DV3Q 2E76C 4X64L 4A93H 3HOVB 4U68A 1ENAA 1O7YA 1PH3A 2N8NA 1R9TB 1I50H 1XNQL 3AU7A 3OOCA 1E2WA 3QG1A 1HA5A 4JYAQ 4K5VA 5EBDA 1TS4A 4O0AA 3IKJA 1JOQA 3KF6B 4DV1Q 1S5CD 4LFBL 1BKBA 1I4RA 2UXCQ 2XTIA 5LMUL 5IGEA 4RGOS 4BXXH 2F0VA 1DD2A 1BR9A 2D5DA 3NEMA 3L2PA 1PRTC 4HSPA 1HZAA 1Q12A 2DNEA 2GVAA 1CKNA 3Q6SA 4PMCA 1S40A 4POFA 2L15A 2F0PA 3VR2A 3BZCA 4UP7A 5J1ZA 1N32Q 2Z4IA 1CKNB 1EU3A 2EIFA 3VR3A 4LW1A 4DNRB 1GO3E 1KLGD 3N52A 2Y0SB 1WYDA 2EJMA 1K83H 2K28A 1UEBA 1GUOA 4I65A 1BCPB 1I3QH 2BA1A 4P72A 1S5DD 3CRLC 3L0OA 3J81L 1RL2A 3KJPA 2HUGA 4X65L 2BDNA 1JQYD 5CV5A 2NVQB 1QILA 4BY1G 1KD1C 2N55A 3RZOB 1WCMB 1CHQD 4LF6Q 3W2DA 2DUDA 3HOXH 2UU9L 2QW7A 4RAUC 4LF7L 1Q86C 3M4OH 2RHQB 4A3MB 1ZYRC 1MSHA 3A8JE 3BS1A 3PIP3 3G6JB 4LUVA 3A56A 2OTJA 3KBGA 4ZQ3A 2E5LL 2D0PA 4GLXA 3F2UA 1PA6A 3TRZA 5I9PA 3O13A 4LUOA 4IUTA 5FK9C 2K14A 4L6TB 5CMDA 2AQ1B 2L4NA 1EY7A 4DKAC 1UE6A 2KA7A 5T1GA 1V43A 3KBXA 3OIPA 4BBRH 3ICEA 3ULPA 4C3IH 4OWTB 3HOZG 3GV3A 1XTCD 3RLNA 4IFDG 1PTOB 4KD4A 1XNRQ 2NYZD 3CCSA 2FHTA 4U673 1MSGA 1PVOA 1EYAA 3GTPB 5IYCG 4MTKA 3CF5A 1YEZA 2BE5D 3HZXA 1FVIA 2B63B 2CW0D 5COYA 3H3VC 1IL2A 2EXZA 3K57A 3CD6A 1D1IA 4J15A 2QEXA 2EOTA 4DV7Q 3A8IE 5M3MG 3NQTA 5C3EG 4X62Q 1UNSA 2NVXH 4WRDA 2YU9H 2F0OA 3A5ZB 4QGUA 2CHBD 1JCKB 4IPHA 1VMPA 4ABNA 1JJCB 4A3IG 3M3YB 1E2VA 3Q8DA 3GTGH 2HD3A 3MFGA 1Y1WG 1G6PA 5M3FG 3I4NG 1IYVA 1EZ8A 3RLOA 3FKIH 2PCFB 1EIFA 3TP7A 2MFIA 3ITPA 3VR6A 1HPCA 1E3PA 4K8IA 1W3SA 3J81c 3STBD 1M90C 1EQVA 5LL6X 3FEWX 2AUKA 4KY6A 4KTAA 4A75A 1JWUD 1NNXA 4DN4M 3TS2A 2K5WA 3S17B 2VB3X 4UP9A 1IL8A 1QUQA 3SK6A 1J5EQ 4HMJA 4HJ7A 2NVTB 4H7BA 2F03A 3I3CA 4CDDC 1L0XB 1SFOB 2NZ1D 3K80C 4RKLA 1QUQB 4X3TA 1CKMA 1WI5A 4KY7A 3UDXA 4XYQA 1I6VC 3K7UC 1YHQA 1YZ6A 1CHPD 2ENBA 2PMZB 1HCZA 1B9NA 1IBMQ 2ES2A 1G51A 4L5QA 1HTLD 5E4XA 2HCCA 2QDBA 1XMQL 3KYHC 3A0JA 2LMCB 4JI5L 4IUQA 4RH6A 4A3KG 5LHY1 1AH9A 3KF8B 4JCVE 2JA7G 3OPOA 4IZ8A 4RCOA 3IRBA 5CV7A 1TQOA 2NUCA 3M7GA 5JAVA 4OO1H 5HGTA 3GTLB 3S1QB 4OEMB 4BBSG 3J81E 4JI2L 1VQNA 1SJED 1KLUD 1Y1VG 3SK4A 3KK7A 2F0UA 3M85A 4K2KA 4NXNQ 4FF2A 1B50A 1F77A 2X69A 2NVYH 1WOCA 4NDXA 2HHHQ 2JYOA 4FVMA 1QB5D 1HFNA 2KOLA 1KDBA 2UUAL 2F0WA 3RNUA 4H02A 3EVQA 2MJ8A 1LABA 1ET6A 1F2LA 1JE4A 3HOYG 4GNXC 1UE1A 1KNAA 1VQ4A 2PO4A 3IL8A 4P73A 1GHKA 3BDLA 5JJKA 4IJHA 3EQLC 5GROA 3SDZA 4JI8Q 1H95A 4DAMA 2F0TA 3UDIA 4AIMA 3CPWA 2HDMA 1M8AA 4HJ8A 4BY7H 2E2HB 2EY6A 1EL0A 3H3VH 5FLMG 4HIKA 1Y69U 1CUKA 2BE5C 5CBEE 5FJ8H 5EGTA 1SYDA 2CW0C 3FPUB 2HIXA 4V190 1C7YA 4JI0L 2A73B 2M00A 1XWEA 5EPKA 4C3HB 1XTDA 2PZUA 4X3SA 2B2YC 2LFNA 4OWXB 3J80L 4M8AA 2XRQD 4RGTA 3Q0AA 1EY5A 5C0XG 4CKCA 4K8JA 4AYBE 1H9KA 3W1BA 3T1HQ 3HKSA 1EIYB 3M7NA 4DR1L 4A3LG 3VA7A 2EJFC 1SE3A 1GUGA 1N9WA 3PO3H 2Q2HA 5IYDG 1CSPA 2Q8RE 1EY0A 1SAPA 1I5FA 4QQBX 2MUYA 1XPRA 4OO1I 1BBWA 1E22A 3STBC 4HR7B 1VF7A 5LL6S 2R7FA 1AP0A 2NN6G 1X3FA 3VA5A 2R7ZB 2VXWA 2TSSA 3UDGA 1QOHA 4L5SA 4NW2A 3WOFA 2A69D 2JA5B 2EYHA 1N33Q 1JT8A 1K8GA 3PO2B 3PF5A 2Z6KA 1TR5A 1EIGA 1JORA 4PZ6A 2M9VA 4Y7NH 3S1NB 4PG3A 4DR5L 4RWSC 2UXDQ 4LFAL 3AEVA 2EQSA 1IKMA 2YTXA 1O7ZA 3MWYW 1PZID 2JA8B 1A3UA 1JOOA 1OXSC 1VQKA 3S16H 3TEHB 5JOBA 1KAAA 2GVBA 2F0MA 3I70A 2WFWA 4IUVA 5KIXA 2DGYA 3H3VI 1D2BA 3I4LA 4A93B 1EIHA 3NP8A 1LACA 1STEA 1STHA 4DV5Q 5CV4A 1KTKA 2XVSA 2F0HA 2Z6BA 4BWGB 3PUZA 5C44B 1IZ6A 1NE3A 1EEFD 4J6HA 5ELNA 1J9OA 1HNWQ 1HZ9A 5IGBA 1ENCA 3J80c 1CI3M 1TY2A 4IURA 1D7QA 3NBHB 4Y52H 1HJPA 1ESRA 1YBYA 1KRTA 3TP6A 4YCUA 5KNCA 1DONA 3I56A 1H9SA 3GTJH 3T53B 4PQXA 2F3WA 4RKBA 1VDZA 5FOBB 1F9SA 3BYYB 2MQHA 2Z6KC 3M4YA 4OHJA 3DUZA 3J7AV 3PIPA 5BR8Q 1Q8KA 1J5EL 1H9SB 4O42A 1QG7A 4ME5A 4JI7Q 1TWGH 3TDQA 4ULLA 4JBMA 4GN4B 2B2WA 1E0BA 4A3FG 2ZJPA 1FYCA 5AJ3L 3A74A 3I4MB 3WWVA 1SSOA 5JVH3 1N36L 4B3RL 2EPBA 2LXJA 4TSSA 1STBA 1G2TA 4TVAB 4CDEC 1XXGA 1I3QB 3OTOQ 2QDLA 1R4PB 4JI1L 4BY1H 2KECA 3H6MA 2VL6A 2F4VQ 4XTCS 3PV0A 1AEXA 3MEHA 2B8FA 3VYTA 4DR6L 1X54A 3K6OA 2KEDA 2H5XA 1X3GA 3LNNA 2F3VA 5JEAG 1Q7YC 4RMFA 1Q3LA 4B3SL 2XRSD 2SOBA 3M4OB 3ND9A 1RHPA 3J80E 3CQZH 1DOMA 4ZKCB 4PZ8A 4ZCKA 4GOPA 3R2IA 3HOZH 1SYEA 4B3TQ 4IFDH 1KDAA 4C56C 1PH5A 4BA2I 1VCIA 4BBRB 5IYCH 4FP5D 2K5HA 4C3IB 3CCUA 4JI4Q 4IOCA 2RCNA 5J39A 1U4PA 4KN7C 2VQEL 5IODA 4F8MA 2PW5A 3R2TA 4LF9L 3GTMH 5KEEA 4LF5Q 1QVCA 1PFMA 1I4HA 2ZM6L 5M3MH 2J0TD 1WTXA 4P75A 4A3DB 3NTHA 4OONA 1E1OA 2IJ0A 5C4ZA 3S1MH 4DUYQ 4FF1A 3EJIA 2VY3A 3MC0B 1XPUA 4A3IH 1EY9A 2Y0SG 5IWAQ 1JR0D 4WORA 3HP3A 4DV0L 1QZGA 1SRUA 1GM5A 2NVXB 2A69C 1Y1WH 4FDBA 5M3FH 4MNOA 2A5HA 2UUCL 2Q2TA 1WVLA 3I4NH 3GDEA 1WTPA 1BXTA 4J1MA 4GKKQ 4C2MH 2NTTA 3GTGB 1DXMA 3QO2A 1GKHA 1IBLQ 1LT3D 2XIWA 1PXUA 3PUVA 4X66Q 1RDPD 1TU2B 3A5UA 3OW7A 4YWKA 3T4AC 4GOPC 1L1OB 4HAEA 3DWPA 3PQIA 1GOZA 3FKIB 2RDGA 2EYJA 5C3XA 3SXHA 4LK1C 2E2JB 2CQOA 1I4QA 2ATWA 2CH4A 1HR0W 3D31A 4TRDA 5AFWA 2O4XA 3PSIA 2LS01 2E2IB 3VYRA 1MI2A 4B3ML 5IIFA 1HNXQ 4DV2L 2OWOA 5C0XJ 4CBVA 1VQ6A 2EYOA 1HUMA 2VNUD 3OSOA 4LMQD 4HTHA 4DAYA 2ZT9C 3GO5A 1PRTB 2XWBB 5IP7G 3TP8A 4P71A 2B2TA 2KBNA 1KC8C 4C3JG 2H1EA 4LF4L 1G6ZA 4N9TA 4DUZQ 2ICEC 1KRSA 3VYSA 3S1RH 4DAYB 1AZPA 1S5BD 4R1JA 1ICFB 2L1BA 4A3EG 4A3KH 1CKOA 1EUJA 1F9RA 3AFQA 3J7AF 5JPMC 1WTQA 1AZQA 3D4RA 1KQSA 2JA7H 1K0SA 1H9MA 4YY3Q 1N33L 3OYYA 1PFNA 2K4KA 4JBJA 1B70B 1HNZL 5I6YA 3A8KE 4BBSH 3JAMi 2HT1A 4K5WA 1Y1VH 5FO7B 2UXBL 3VR4A 3HS0C 1VQOA 4HMIA 4F7XA 1X3EA 4NB3A 1V1OA 3ULJA 4K5XA 3CCRA 1P8LA 2ZXPA 4DXGA 3C1FA 5D65A 4AYBB 4DV5L 3PGZA 4DR2L 4K2LA 3S15H 3G7LA 2NVYB 2P5ZX 3IAYA 2LY7A 3HOYH 1NY4A 2D62A 2K05A 1LTID 2B2TC 4YWMA 3AYHB 2Z0SA 4KHPQ 1VQGA 1N34Q 2F0NA 1NCVA 2OEOA 1KIXA 1MJCA 2UUBQ 2D0OA 1WD0A 5A2QL 2JA6G 5I4DA 5FLMH 1CM9A 1U4MA 1NTGA 1K28A 1K8MA 1X56A 2K6AA 2QEJC 3CC2A 4OX9Q 3SK8A 1LTTD 1XJVA 2BOSA 1BO0A 4R8NA 4BY7B 1IYJB 2WP8J 1JWMD 2QF7A 3VYUA 5I2XA 1C0AA 5LMNW 1STGA 4DR3Q 4JI7L 1CQVA 5M5YH 1HFGA 1S4ZA 1LYLA 1W6JA 1VF5C 2X6GA 3BZKA 2I5HA 2F1MA 5C0XH 4K14A 4YHHQ 1QZHA 2VQFQ 4G4KA 4F87A 1Y8PB 2AHOB 4JV5L 3HOWG 3HOUG 3QIAA 4A3LH 4NXML 2VUMG 1NSNS 1Q90A 2SDFA 3NENA 3CC4A 3S2DH 4KK7A 2PW7A 2O2LD 2KUMA 2JSOA 3MVVA 4DK1A 5IYDH 2ZJRA 3S14H 5IT9L 3V05A 5C5LA 3TZUA 4PMWA 4EQPA 4R4TA 3PO3B 2FFKB 1HHVA 4QY7A 4A4IA 2XNAC 4TKOB 3H0GG 4DR4L 1TS5A 4RGNA 5F2DA 1TT2A 1U5KA 1Z9FA 3HKZG 4MZ9A 1PYWD 3I4OA 5JEAJ 2KQ3A 1FJGQ 3J7A5 4B3TL 1O78A 1SYBA 1WFQA 1I6HH 1Z6HA 2L11A 3L3OC 5HY6A 5J3BA 4JI4L 4FF4A 1BOSA 1U4LA 1VQLA 5IE8A 2FJ2A 1MJEA 5IP9G 4A3CG 3CKIB 3PIO3 1SE4A 2QKIC 2QA4A 4LFCQ 3S2HB 4C1NK 4Y7NB 1D6EC 4A3GG 4RA8A 4RGMA 3SVMA 4N8FA 4DUYL 1F2MA 2L12A 1V1PA 5EKIA 3PMFA 5DNFA 1AE3A 3U9OA 2MO0A 3GTQH 3ZYYX 2C9OA 1C8CA 1NR4A 4KKSA 1CZWA 3OWEB 3OHXC 3MHBA 1CTMA 1Q1BA 4JOIC 3M4QA 3AMUA 4G7OC 4JG2A 4JI6Q 2EDGA 3FVQA 1GD7A 2F4IA 3K5LA 5ELOA 1A63A 5FLXL 3TP5A 2RDFA 2EYLA 1GUNA 1ASZA 2JE6I 4HN7A 1L0WA 1K3BC 5C0XI 3D0FA 1XMOQ 2AQ3B 1JE5A 1YI2A 3DEPA 4LF8L 2KCMA 2AQ2B 1HZCA 1KNEA 1BDOA 1STAA 5E4WC 1VQ9A 1I4XA 2PNRC 4ME3A 4A3BG 2R7DA 5BN5A 3ULLA 3BVGA 3MTSA 4DV6Q 4UAIA 4GNXA 3GTJB 2BDOA 5IT9c 3EBEA 1KXLA 4A3FH 1TWAB 1GJXA 2FXQA 1SMXA 4G57A 3I7FA 1S5FD 4GNXB 2EJGC 1DOLA 3FHWA 4RG1A 4ALPA 2SEBD 4KY5A 1LTRD 4DAVA 3D8GA 4QUCA 5A2QE 4OELB 4PZ7A 1VQHA 2R93B 1HXYD 4OIKA 5E1FA 1YHBA 1ILQA 4BY1B 2B2YA 3D4WA 5JEAH 1R9TH 3L9AX 4DV3L 1CA5A 2LKVA 1FNWA 2G5DA 2RSNA 2ZTCA 4A93G 2FINB 4JW0A 3CC7A 1VQ5A 3FP9A 4A3JG 2JA9A 4DR7Q 4JYAL 3K5MA 1LTBD 3SHLA 5C44G 1WTRA 2B39A 3NTIA 4DV1L 1PV4A 5KYLA 2UXCL 1VQIA 3CQZB 3RZDH 1LO5D 1S5ED 2JK8A 3HRZC 3HFZB 2C35B 1FL0A 3HOZB 2XN9C 1TWFH 3PF4A 4IPCA 3E0JA 3E3XA 2VW9A 1VQCA 1A3VA 5IT9E 1G291 1JWSD 2WAQG 4YCVA 1PH9A 3I90A 1AW7A 1U4RA 2WINB 5FLXc 5GAGC 2O5IC 2C5CA 1VQDA 3E9HA 5E7NA 3GTMB 4KHVA 2DJGC 1A62A 2K04A 5M3MB 2QGQA 2RSOA 4O2DA 1VS0A 4KHPL 1N32L 1TWCB 3BVMA 1SYGA 5GADC 3J81j 5IGCA 3S1MB 3I4MG 5CORA 3I72A 4A3IB 4IALA 4GZYC 1IBKQ 4DV4Q 1LTAD 1DM0B 2GA4B 5FO9B 1XYIA 3WOEA 1CFMA 5CR3A 2NVQH 4QJFA 1Y1WB 5M3FB 5DM73 1PH7A 3I4NB 5KNDA 3RZOH 1KL9A 3CCMA 1LUZA 4EVOA 2KHIA 2K32A 4C2MB 2DY8A 4DR3L 1NBWA 4LF6L 2CFMA 2PQAA 2J7ZA 1C9OA 3BZDB 3A54A 3MA2B 1B2TA 2KHJA 3QOLA 4XQNA 1H9RA 1YITA 4QIWE 3TN2A 2PQAB 4HIOA 3AB9A 1PTOH 1I4PA 3NSWA 2Z9HA 1DZ1A 1BBUA 5JVG3 3RR5A 5FLXE 1HR0Q 2JQOA 1JB7A 5DM63 1XNRL 4IPGA 5IP7H 2JN4A 4C3JH 1X6OA 4KN4C 4CJ1B 3NWSA 3CMAA 4HJ9A 2EVBA 2KENA 4XDXA 2MNAA 3P1HA 2N3SA 2NTSA 4A3DG 4HIMA 1FGBD 4IFDJ 4A3EH 4GKJQ 1RCVD 1QCBD 3CCEA 4DV7L 5C4XG 1F2ZA 5C6AA 2RVLA 1I94Q 2R92G 4WFN3 4X62L 2L9HA 3UE0A 3M3YH 4EQOA 4X64Q 2MP1A 3HEJA 1EOTA 4A3KB 1B44D 5M9OA 4HJAA 1XNQQ 1YJ9A 2JA7B 2WB1G 4JVZA 3F8TA 4EX5A 3KJOA 1I50B 1T9HA 3KDFA 4JBWA 4LFBQ 4ZK9B 5EAYA 5LMUQ 2IW3A 1IW7D 3GV6A 4ZAIA 4BBSB 4KJNA 1Y1VB 3P20A 4NKLA 1CA6A 4R4IA 2RDHA 3MXNA 2HIVA 5KGUA 5JJZA 2K50A 3NXWA 3U58A 4XT1B 2XGTA 2BA0A 2EZVA 1GUWA 5IY0A 3S17H 2H4OA 3I8ZA 2A74C 3SGIA 1VQ8A 2R6GA 2JXMB 3ERQA 3E5SA 3S15B 2I46A 2NWGA 2K1BA 4ZUIA 1SFOH 2MO1A 3HOYB 1M4VA 5M5WH 2E75C 1V9PA 2JA6H 1JC7A 5FO8B 3WDNA 3F1ZA 3MFYA 2G9DA 1RTNA 4MTNA 3B6YA 1LM0A 1TKWB 2SNMA 1SNOA 1K83B 4EQ5A 3EROA 2Q8TA 5DEHA 1G8ZD 4X65Q 1IBML 2NB0A 4DU9A 4KHZA 1YNJD 2ALYB 2LSSA 4QMGA 2UU9Q 1SNQA 3CCQA 3I55A 1L0YB 4LF7Q 3HOVG 1UWVA 5KRUA 1ZEQX 5LMNQ 3HOWH 3HOXB 3HOUH 5IYBG 3F2BA 3URYA 2E5LQ 3NK9A 1TY0A 2VUMH 5ISRA 2KVMA 5ELEA 3K81C 3HGBA 3SEBA 2X6LA 2F0EA 1LT6D 1VQBA 2ZXRA 1YVCA 5C5MA 1OXXK 3MXPA 2QCPX 2KEEA 1YJNA 4NMZA 1BBXC 3S2DB 3G71A 3EA6A 3H0GH 4NXNL 3T16A 3S14B 2B2VC 1RF2D 4GOPB 1XPOA 3KFUA 4YWLA 3C2PA 1OO9B 2F0JA 3CHBD 3QR8A 3NBIA 4O1NA 2HHHL 4DNTB 5EPJA 5K36G 4N9PA 1RTOA 1S72A 5C3EH 5J22A 4QUFA 3MZ5A 2L5TA 1SR3A 4DNIA 4QL5A 1ILPA 2IX1A 3A7LA 1EQTA 5D14A 1FR3A 4M1UB 1STNA 3OMGA 2E2HH 1QNKA 3C1EA 3FRPB 3DMUA 5IP9H 1I6HB 4JI8L 3CMEA 2ZXOA 4V0BA 3QJYA 1BVSA 3W3AA 2YU9B 4A3CH 4LNQA 1C48A 3UI2A 2ZTDA 4DK3C 4P2CB 1HQMC 3AFPA 4X3KA 3TBIB 1X9NA 4A3GH 1PFBA 2MGSA 1NUCA 1WCMG 5BN4A 1RODA 1EWHA 4PV1C 1UUPA 3ND8A 4CGYB 4A3MG 1B8AA 4AQYQ 3GTQB 1B9MA 2WV6D 3H09A 1A0IA 3CU7A 1X3PA 2LXKA 4PNYA 1OXUA 5IGDA 3T1HL 3LGJA 1G91A 5ELDA 1YIJA 1VQJA 4R4CA 2PZTA 1BCPD 4HSVA 4NPSA 3ERSX 3JAML 3K59A 3LWUA 2EE1A 4J8QA 2I0QA 1IW7C 2CKZB 3I91A 3R3OA 4A3BH 1GUTA 1A2TA 2D9UA 2B63G 1QVGA 4DK0A 4IUPA 3DLLA 1JB3A 3K8AA 3BDCA 3KOJA 1SXTA 4IFDI 2RCFA 1XMQQ 3BG3A 3QOJA 2PNHA 5M5XH 2RKSA 1PYBA 4XQJA 4A3FB 5IGFA 1MKHA 1IYUA 4QF4A 2R3ZA 1Z47A 2QILA 3KLSX 2J4XA 3D3RA 3GQBA 3G48A 1PTOD 2UXDL 2Z4HA 3AQQA 4JI2Q 1K0RA 1I94L 5CYUA 3KLSA 1L1OC 1IKLA 1Y8NB 5GQOA 3HG9A 1EU4A 3KF6A 2KCNA 4ZUJA 3RMHA 4L8JA 4HIDA 5EBCA 1YNJC 2K52A 4A3JH 1D8LA 2NZOA 2EY2A 4B08A 4BS9A 5C44H 1BCPF 1ZXTA 1YHAA 2EY1A 2UUAQ 5EQ0A 3E6ZX 3ZJYC 1CZGA 1B3AA 4KI0A 2WKDA 4R4QA 3T1YQ 4ZKBB 2K5VA 4K6DA 1LT5D 1JOKA 1SNMA 3D6WA 1HNWL 4HCEA 4ID6A 2HQEA 2B2UC 3RZDB 1KHIA 2AKWB 5FKAC 2K33A 2MPMA 1TWFB 3K0XA 1F9QA 4QIWB 4X3UA 1V8QA 4GLVB 2NZHA 2K7VA 4JC0A 1Q82C 3UE1A 1TIID 2CH4W 2PI2A 3JAMc 1VQ7A 2PQEA 3DXJC 1PZKD 5GAHC 4JI0Q 5JJLA 3CCJA 5BR8L 5JPNC 1J6QA 1CT1D 2PPBC 2YTVA 3GTKH 3I4MH 1BF4A 4A76A 1AFPA 1E24A 1GHJA 4RFBA 1K9MC 1PTOF 3NWTA 3NE5B 1SJHD 3PUYA 3PUWA 5D3IB 1A8VA 2JP1A 2M2LA 1RD9D 2R93G 4UHVA 2VS1A 3V2TA 3OTOL 1QNUA 1TWHH 1O7IA 4QB4A 1LTLA 4DR1Q 1ONLA 3OWFA 4WJWA 1DYQA 2F4VL 1LTGD 3A7AB 3N6RA 5KYIA 5G3LD 3D4DA 1UE5A 2JEAI 3OW2A 2A68D 4JOIA 5TSSA 2N49A 2V1CC 4P74A 1B7YB 5LMNL 2FMCA 1A6XA 4FNFA 2NN6H 4DFAA 2FMMA 1M1KC 2WAQE 2F0KA 1TS3A 2F0LA 5ELFA 1PFSA 4CJ0B 2NBFA
chains in the Genus database with same CATH topology
3I56A 3PF4A 4IPCA 3GTJH 2ASBA 2ZJQA 2VW9A 1VQCA 2YV5A 1N8RC 2JA5H 1E7ZA 1G291 2Q2IA 2RF4A 2WAQG 2MQHA 4JI3Q 2Z6KC 4YCVA 1PH9A 3BU2A 5FLXc 3J81i 3PIPA 3PO2H 1GVPA 4JI5Q 5BR8Q 1Q8KA 1J5EL 5GAGC 1YJWA 1HR0L 4A3DH 1VQAA 1VQDA 3E9HA 4UP8A 5E7NA 4JI7Q 1EFWA 4X6AH 1TWGH 4DR5Q 3M9BA 3S1NH 4JBMA 4LF5L 4GN4B 1A62A 5C4XH 4LFAQ 2IT1A 4A3FG 2R92H 2KCTA 2QGQA 4O2DA 2ZJPA 5AJ3L 1VS0A 2VZAA 3A74A 4KHPL 1N32L 3J81j 3WWVA 1N36L 5GADC 2OTLA 2JA8H 3JC66 3RN2A 4B3RL 2B29A 2LXJA 3CCLA 1Q81C 4TVAB 1VQMA 3I4MG 4GKJL 1V1QA 4JBKA 2IY5B 3OTOQ 3GTOH 1IBKQ 4DV4Q 4JI1L 4DV3Q 5IWAL 4BY1H 2VL6A 2F4VQ 4XTCS 2NVQH 3PV0A 4QJFA 4POGA 4OXPA 4X64L 4A93H 1EOVA 3W1GA 4DR6L 1X54A 1Q46A 2IHFA 1EWIA 1PH3A 1PH7A 3RZOH 1KL9A 2N8NA 3CCMA 1LUZA 1I50H 2Q2UA 2H5XA 1XNQL 1X3GA 2YYZA 2IHEA 4YCWA 1L2FA 2KHIA 5JEAG 1Q7YC 4GKKL 4RMFA 4DR3L 4JYAQ 1PH8A 1NBWA 4O0AA 3K7AH 1IBLL 4LF6L 3KF6B 4DV1Q 2CFMA 4B3SL 4X66L 4LFBL 2PQAA 1BKBA 1YNXA 2UXCQ 1C9OA 4BA1I 2XTIA 5LMUL 3CQZH 2KHJA 2GN5A 4PZ8A 4BXXH 2E2JH 4L5TA 4GOPA 4AQYL 3HOZH 1YITA 3NEMA 4R4OA 4QIWE 3L2PA 4B3TQ 2PQAB 1TXYA 4HIOA 1HZAA 3NELA 2E2IH 1Q12A 2GVAA 1PH5A 4BA2I 1VCIA 5IYCH 2K5HA 1BBUA 3CCUA 4JI4Q 4IOCA 2R7ZG 1SROA 3EIVA 2RCNA 3RR5A 2A8VA 1CKNA 2JQOA 1HR0Q 1JB7A 2VQEL 5C4JH 1XNRL 4IPGA 5IP7H 1S40A 4POFA 1HNXL 4LF9L 3GTMH 4C3JH 4LF5Q 2JA5G 2L15A 2JEBI 1QVCA 1X6OA 2ZM6L 3BZCA 5M3MH 4UP7A 3CMAA 4P75A 4HJ9A 5AJ3Q 1NMFA 2KENA 4OONA 1E1OA 1N36Q 1CKNB 3PO2G 2MNAA 2EIFA 4B3RQ 2N3SA 1FGUA 2NN6I 4LW1A 1GO3E 4DUYQ 3S1MH 4A3DG 4HIMA 4IFDJ 4A3EH 4GKJQ 1JJGA 2VY3A 1WYDA 3CCEA 1K83H 3CP0A 4DV7L 1XPUA 1UEBA 4A3IH 5C4XG 1I94Q 1I3QH 4JI1Q 2R92G 2BA1A 4GS3A 2Y0SG 2WB1E 5IWAQ 4DUZL 4X62L 1Q1EA 1NMGA 4DV0L 1QZGA 3UE0A 1SRUA 4P72A 1GM5A 3M3YH 4X64Q 2JA8G 1Y1WH 4FDBA 5M3FH 3L0OA 4MNOA 4DR6Q 2UUCL 2Q2TA 3HOVH 1RL2A 3KJPA 3I4NH 4X65L 4HJAA 3GDEA 1XNQQ 1SLJA 4GKKQ 1YJ9A 2WB1G 4BY1G 5IYBH 1KD1C 4C2MH 3F8TA 1ASYA 4EX5A 4YY3L 1PYSB 3KJOA 1GKHA 1IBLQ 1QVFA 4LF6Q 3KDFA 1T9HA 2DUDA 3PUVA 1CSQA 4JBWA 4X66Q 3HOXH 2UU9L 4B3SQ 4LFBQ 3TS0A 4LF7L 5EAYA 5LMUQ 3A5UA 1Q86C 3M4OH 2RHQB 4YWKA 4LUVA 3F2DA 4GOPC 2OTJA 1L1OB 2E5LL 2D0PA 3DM3A 3PUXA 4R4IA 3CXCA 4GLXA 1PA6A 3TRZA 2B3GA 2HIVA 4WJ3M 4LUOA 2K50A 3U58A 2K14A 2XGTA 2CQOA 2ATWA 2BA0A 4DKAC 1UE6A 5IY0A 3S17H 1HR0W 1V43A 3D31A 4K0KQ 4BXXG 4BBRH 2K75A 3ICEA 3ULPA 4C3IH 3SGIA 3PSIA 4OWTB 3HOZG 1VQ8A 2R6GA 3RLNA 2VQEQ 2BH8A 4IFDG 1XNRQ 4B3ML 1NJIC 4APVA 1HNXQ 4LF9Q 3CCSA 4DV2L 3UDFA 1PVOA 2OWOA 5C0XJ 2ZM6Q 5IYCG 1SFOH 2MO1A 1VQ6A 1UE7A 1YEZA 3CF5A 5M5WH 2VNUD 3H15A 1FVIA 1V9PA 2AWNA 3T1YL 3GO5A 2JA6H 1U0LA 1IL2A 1RIPA 5IP7G 1DGSA 3CD6A 3F1ZA 4P71A 4J15A 2QEXA 2KBNA 1KC8C 3EN2A 4DV7Q 4TQUS 1K8AC 1X65A 5M3MG 1N34L 4LF4L 3TQYA 4DUZQ 5C3EG 4X62Q 1KRSA 4DV0Q 3S1RH 2HQLA 4DAYB 4MTNA 3B6YA 1LM0A 4EQ5A 2NVXH 2UUBL 2YU9H 2UUCQ 4R1JA 4A3KH 3A5ZB 4QGUA 4A3EG 1CKOA 4X65Q 1EUJA 3AFQA 1IBML 4IPHA 4A3IG 1JJCB 4OX9L 1KQSA 3Q8DA 4KHZA 2JA7H 4YY3Q 2ALYB 2LSSA 1N33L 3OYYA 3GTGH 1OXVA 2K4KA 1WCMH 1Y1WG 2UU9Q 1G6PA 5M3FG 3CCQA 4JBJA 3U4ZA 1B70B 3I55A 4LF7Q 3HOVG 3I4NG 1UWVA 1HNZL 4A3MH 5LMNQ 3HOWH 3HOUH 3RLOA 5IYBG 4BBSH 3F2BA 3U50C 3JAMi 2E5LQ 4KLKA 2HT1A 1Y1VH 2VUMH 2UXBL 3FKIH 3HOXG 1VQOA 1EIFA 3K81C 4IJLA 2MFIA 1VQBA 4YHHL 1E3PA 1KAWA 2VQFL 1X3EA 1PH6A 4NB3A 3ULJA 1W3SA 1YVCA 3J81c 1OXXK 3STBD 3CCRA 1M90C 1P8LA 4A75A 1YJNA 1N32Q 2ID0A 4B3MQ 3TS2A 3G71A 4DV5L 4DV2Q 4AH6A 3PGZA 4UP9A 1PHJA 3H0GH 4NXNL 4DR2L 3S15H 1QUQA 4GOPB 3G6EA 3F2CA 1J5EQ 4BBRG 3GTPH 1XPOA 2IX0A 3KFUA 4YWLA 3HOYH 1NY4A 2D62A 4GLAC 4HJ7A 2B63H 3W5OA 4UPAA 2HHHL 4YWMA 2JJQA 3M4PA 5K36G 1S72A 2PI2E 3AYHB 3K80C 5C3EH 2Z0SA 2Y0SE 4KHPQ 1VQGA 1QUQB 1N34Q 1CKMA 4LF4Q 4LWCA 1SR3A 1WI5A 2OCEA 4DNIA 4QL5A 1KIXA 1MJCA 3UDXA 2IX1A 1SN8A 3K7UC 2UUBQ 1YHQA 2D0OA 1YZ6A 2JA6G 5FLMH 1NTGA 1FJGL 1X56A 2E2HH 1IBMQ 2ES2A 4IOAA 1G51A 3CC2A 4L5QA 3J80i 5IP9H 4OX9Q 4JI8L 3CMEA 1XJVA 4A3CH 1BVSA 4LNQA 4JI3L 1XMQL 1IYJB 2WP8J 2K5NA 2ZTDA 3KYHC 3A0JA 4DK3C 3AFPA 4JI5L 4A3GH 1X9NA 5LMNW 1C0AA 4A3KG 3RN5A 3S2HH 1HNZQ 1K73C 4DR3Q 4JI7L 1AH9A 5M5YH 3KF8B 4JCVE 2JA7G 1LYLA 4LFCL 2UXBQ 3BZKA 5JJIA 3CAMA 1WCMG 3IRBA 2I5HA 2N78A 4YHHQ 1SE8A 2VQFQ 1QZHA 1JMCA 2AHOB 4JV5L 4A3MG 1B8AA 4AQYQ 3HOWG 3HOUG 4BBSG 3KDFB 4JI2L 1VQNA 4A3LH 2CCZA 1Y1VG 4NXML 3MEFA 3FKIG 3NENA 2VUMG 3CC4A 1A0IA 3S2DH 3M85A 2LXKA 1K3RA 1PH2A 4NXNQ 4DR2Q 5IYDH 1OXUA 3T1HL 3LGJA 2ZJRA 3S14H 2F3IA 3E9IA 2NVYH 3MXNB 1WOCA 1YIJA 1VQJA 4R4CA 4JI6L 4PMWA 5H1SE 2I5LX 4NPSA 4R4TA 3ERSX 2HHHQ 2NVTH 4QY7A 4A4IA 2I0QA 2UUAL 2CKZB 4IPDA 3H0GG 1OTCA 4DR4L 3RNUA 4A3BH 4H02A 1U5KA 1Z9FA 3HKZG 4MZ9A 3HOYG 3I2ZA 4GNXC 1HZBA 1UE1A 5DLQE 3I4OA 5JEAJ 1XMOL 1QVGA 1VQ4A 2B63G 2EXDA 2ZTEA 2OQ0A 3VDYA 3DLLA 1FJGQ 4P73A 3J7A5 4B3TL 3K8AA 5JJKA 1WFQA 4IJHA 5GROA 3KOJA 4JI8Q 1H95A 4IFDI 1I6HH 1OXTA 4LUZA 4DAMA 4DV6L 3UDIA 2F52A 4AIMA 3CPWA 1XMQQ 2PNHA 4HJ8A 4BY7H 1TWAH 5HY6A 3KLWA 5J3BA 5M5XH 1VQFA 1VQPA 4JI4L 4UY8C 5FLMG 3H3VH 4HIKA 1VQLA 5IE8A 1PYBA 3CCVA 1CUKA 4OWWB 5GAEC 1MJEA 5IP9G 3J7ZC 3GD7A 1MKHA 5FJ8H 4A3CG 1PFSA 2QA4A 1IXRA 2HIXA 1S3OA 4LFCQ 1C7YA 4JI0L 1Z47A 3L7ZC 4A3GG 1Y14B 4IO9A 2R93H 1XTDA 4DUYL 3G48A 4JV5Q 2UXDL 1EQRA 1AE3A 3AQQA 4OWXB 3GTLH 2MO0A 2OQKA 1K0RA 4JI2Q 2AMCB 3GTQH 3S1QH 1I94L 4NXMQ 1L1OC 1EQQA 5C0XG 5GQOA 3KF6A 4AYBE 1Q1BA 4OO1G 4JOIC 3W1BA 4HIDA 3M4QA 2K52A 3HKSA 3T1HQ 4A3JH 1D8LA 2NZOA 1EIYB 4L5RC 4JG2A 4DR1L 3S24A 2E8GA 3PIOA 4JI6Q 3M7NA 5C44H 4A3LG 4WJ4A 1GD7A 3TREA 5ELOA 1N9WA 2I5MX 1YHAA 3PO3H 2UUAQ 1A63A 4AYBG 3U4VA 4DR4Q 3ZJYC 2Q2HA 5IYDG 1ASZA 2JE6I 4KI0A 4R4QA 1CSPA 4DR7L 3T1YQ 1L0WA 1EYGA 2K5VA 5C0XI 1I5FA 1MIUA 3D0FA 4QQBX 1XMOQ 1JE5A 1XPRA 4GN5A 1YI2A 1HNWL 4OO1I 2CWPA 2KCMA 4LF8L 1BBWA 1E22A 1HZCA 3STBC 1VQ9A 2PMZE 1KHIA 2AKWB 4ME3A 4HJ5A 2R7FA 4A3BG 2NN6G 2R7DA 1X3FA 2RHSB 3ULLA 4DV6Q 3E0EA 3K0XA 2CWAA 4GNXA 4K0KL 3PCOB 3UDGA 4L5SA 3CW2C 4GLVB 2NZHA 4JC0A 5IT9c 1Q82C 3EBEA 1JJ2A 3UE1A 1HH2P 2PI2A 4XIGS 1KXLA 3JAMc 1VQ7A 4A3FH 1N33Q 2FXQA 1JT8A 1SMXA 5GAHC 1K8GA 3PF5A 3CPFA 2Z6KA 3I7FA 4GNXB 4JI0Q 5JJLA 3CCJA 5BR8L 4BY7G 1X55A 1J6QA 4PZ6A 2YTVA 3FHWA 4RG1A 4Y7NH 4ALPA 1TWCH 1PH1A 3GTKH 4PG3A 1AE2A 4C3HH 4A76A 4DR5L 3I4MH 1E24A 2UXDQ 4LFAL 1K9MC 3AEVA 2EQSA 5FJ8G 2YTXA 4PZ7A 3ER0A 1VQHA 3PUYA 3PUWA 1A8VA 1OXSC 2A1AA 1VQKA 1YHBA 3S16H 3TEHB 2R93G 2VS1A 2GVBA 2YTYA 3OTOL 2WFWA 1E1TA 1TWHH 1O7IA 4DV4L 1R9TH 1IBKL 4DV3L 1LTLA 2DGYA 5HGQA 4DR1Q 3H3VI 1W2BA 2F4VL 2ZTCA 1L1OA 4DV5Q 1UE5A 4A93G 2JEAI 3OW2A 3CC7A 1VQ5A 3FP9A 4JOIA 1P16A 3PUZA 3HKZE 4GN3B 4A3JG 2JA9A 2N49A 4DR7Q 2V1CC 4P74A 4JYAL 1B7YB 5LMNL 5C44G 1IZ6A 1NE3A 5ELNA 3G4SA 4DV1L 1PV4A 1HNWQ 1HZ9A 4LF8Q 3RLFA 2BH2A 2UXCL 3J80c 3PO3G 1VQIA 4DK6C 3RZDH 1D7QA 2JK8A 2AWOA 3NBHB 1VQEA 3HFZB 1HJPA 2WAQE 1PH4A 4DPGA 2C35B 1M1KC 4Y52H 1WJJA 1YBYA 1FL0A 2A19A 1KRTA 2R7ZH 4YCUA 3BJUA 1TWFH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 A;  3PF4 A;  4IPC A;  3GTJ H;  2ASB A;  2ZJQ A;  2VW9 A;  1VQC A;  2YV5 A;  1N8R C;  2JA5 H;  1E7Z A;  1G29 1;  2Q2I A;  2RF4 A;  2WAQ G;  2MQH A;  4JI3 Q;  2Z6K C;  4YCV A;  1PH9 A;  3BU2 A;  5FLX c;  3J81 i;  3PIP A;  3PO2 H;  1GVP A;  4JI5 Q;  5BR8 Q;  1Q8K A;  1J5E L;  5GAG C;  1YJW A;  1HR0 L;  4A3D H;  1VQA A;  1VQD A;  3E9H A;  4UP8 A;  5E7N A;  4JI7 Q;  1EFW A;  4X6A H;  1TWG H;  4DR5 Q;  3M9B A;  3S1N H;  4JBM A;  4LF5 L;  4GN4 B;  1A62 A;  5C4X H;  4LFA Q;  2IT1 A;  4A3F G;  2R92 H;  2KCT A;  2QGQ A;  4O2D A;  2ZJP A;  5AJ3 L;  1VS0 A;  2VZA A;  3A74 A;  4KHP L;  1N32 L;  3J81 j;  3WWV A;  1N36 L;  5GAD C;  2OTL A;  2JA8 H;  3JC6 6;  3RN2 A;  4B3R L;  2B29 A;  2LXJ A;  3CCL A;  1Q81 C;  4TVA B;  1VQM A;  3I4M G;  4GKJ L;  1V1Q A;  4JBK A;  2IY5 B;  3OTO Q;  3GTO H;  1IBK Q;  4DV4 Q;  4JI1 L;  4DV3 Q;  5IWA L;  4BY1 H;  2VL6 A;  2F4V Q;  4XTC S;  2NVQ H;  3PV0 A;  4QJF A;  4POG A;  4OXP A;  4X64 L;  4A93 H;  1EOV A;  3W1G A;  4DR6 L;  1X54 A;  1Q46 A;  2IHF A;  1EWI A;  1PH3 A;  1PH7 A;  3RZO H;  1KL9 A;  2N8N A;  3CCM A;  1LUZ A;  1I50 H;  2Q2U A;  2H5X A;  1XNQ L;  1X3G A;  2YYZ A;  2IHE A;  4YCW A;  1L2F A;  2KHI A;  5JEA G;  1Q7Y C;  4GKK L;  4RMF A;  4DR3 L;  4JYA Q;  1PH8 A;  1NBW A;  4O0A A;  3K7A H;  1IBL L;  4LF6 L;  3KF6 B;  4DV1 Q;  2CFM A;  4B3S L;  4X66 L;  4LFB L;  2PQA A;  1BKB A;  1YNX A;  2UXC Q;  1C9O A;  4BA1 I;  2XTI A;  5LMU L;  3CQZ H;  2KHJ A;  2GN5 A;  4PZ8 A;  4BXX H;  2E2J H;  4L5T A;  4GOP A;  4AQY L;  3HOZ H;  1YIT A;  3NEM A;  4R4O A;  4QIW E;  3L2P A;  4B3T Q;  2PQA B;  1TXY A;  4HIO A;  1HZA A;  3NEL A;  2E2I H;  1Q12 A;  2GVA A;  1PH5 A;  4BA2 I;  1VCI A;  5IYC H;  2K5H A;  1BBU A;  3CCU A;  4JI4 Q;  4IOC A;  2R7Z G;  1SRO A;  3EIV A;  2RCN A;  3RR5 A;  2A8V A;  1CKN A;  2JQO A;  1HR0 Q;  1JB7 A;  2VQE L;  5C4J H;  1XNR L;  4IPG A;  5IP7 H;  1S40 A;  4POF A;  1HNX L;  4LF9 L;  3GTM H;  4C3J H;  4LF5 Q;  2JA5 G;  2L15 A;  2JEB I;  1QVC A;  1X6O A;  2ZM6 L;  3BZC A;  5M3M H;  4UP7 A;  3CMA A;  4P75 A;  4HJ9 A;  5AJ3 Q;  1NMF A;  2KEN A;  4OON A;  1E1O A;  1N36 Q;  1CKN B;  3PO2 G;  2MNA A;  2EIF A;  4B3R Q;  2N3S A;  1FGU A;  2NN6 I;  4LW1 A;  1GO3 E;  4DUY Q;  3S1M H;  4A3D G;  4HIM A;  4IFD J;  4A3E H;  4GKJ Q;  1JJG A;  2VY3 A;  1WYD A;  3CCE A;  1K83 H;  3CP0 A;  4DV7 L;  1XPU A;  1UEB A;  4A3I H;  5C4X G;  1I94 Q;  1I3Q H;  4JI1 Q;  2R92 G;  2BA1 A;  4GS3 A;  2Y0S G;  2WB1 E;  5IWA Q;  4DUZ L;  4X62 L;  1Q1E A;  1NMG A;  4DV0 L;  1QZG A;  3UE0 A;  1SRU A;  4P72 A;  1GM5 A;  3M3Y H;  4X64 Q;  2JA8 G;  1Y1W H;  4FDB A;  5M3F H;  3L0O A;  4MNO A;  4DR6 Q;  2UUC L;  2Q2T A;  3HOV H;  1RL2 A;  3KJP A;  3I4N H;  4X65 L;  4HJA A;  3GDE A;  1XNQ Q;  1SLJ A;  4GKK Q;  1YJ9 A;  2WB1 G;  4BY1 G;  5IYB H;  1KD1 C;  4C2M H;  3F8T A;  1ASY A;  4EX5 A;  4YY3 L;  1PYS B;  3KJO A;  1GKH A;  1IBL Q;  1QVF A;  4LF6 Q;  3KDF A;  1T9H A;  2DUD A;  3PUV A;  1CSQ A;  4JBW A;  4X66 Q;  3HOX H;  2UU9 L;  4B3S Q;  4LFB Q;  3TS0 A;  4LF7 L;  5EAY A;  5LMU Q;  3A5U A;  1Q86 C;  3M4O H;  2RHQ B;  4YWK A;  4LUV A;  3F2D A;  4GOP C;  2OTJ A;  1L1O B;  2E5L L;  2D0P A;  3DM3 A;  3PUX A;  4R4I A;  3CXC A;  4GLX A;  1PA6 A;  3TRZ A;  2B3G A;  2HIV A;  4WJ3 M;  4LUO A;  2K50 A;  3U58 A;  2K14 A;  2XGT A;  2CQO A;  2ATW A;  2BA0 A;  4DKA C;  1UE6 A;  5IY0 A;  3S17 H;  1HR0 W;  1V43 A;  3D31 A;  4K0K Q;  4BXX G;  4BBR H;  2K75 A;  3ICE A;  3ULP A;  4C3I H;  3SGI A;  3PSI A;  4OWT B;  3HOZ G;  1VQ8 A;  2R6G A;  3RLN A;  2VQE Q;  2BH8 A;  4IFD G;  1XNR Q;  4B3M L;  1NJI C;  4APV A;  1HNX Q;  4LF9 Q;  3CCS A;  4DV2 L;  3UDF A;  1PVO A;  2OWO A;  5C0X J;  2ZM6 Q;  5IYC G;  1SFO H;  2MO1 A;  1VQ6 A;  1UE7 A;  1YEZ A;  3CF5 A;  5M5W H;  2VNU D;  3H15 A;  1FVI A;  1V9P A;  2AWN A;  3T1Y L;  3GO5 A;  2JA6 H;  1U0L A;  1IL2 A;  1RIP A;  5IP7 G;  1DGS A;  3CD6 A;  3F1Z A;  4P71 A;  4J15 A;  2QEX A;  2KBN A;  1KC8 C;  3EN2 A;  4DV7 Q;  4TQU S;  1K8A C;  1X65 A;  5M3M G;  1N34 L;  4LF4 L;  3TQY A;  4DUZ Q;  5C3E G;  4X62 Q;  1KRS A;  4DV0 Q;  3S1R H;  2HQL A;  4DAY B;  4MTN A;  3B6Y A;  1LM0 A;  4EQ5 A;  2NVX H;  2UUB L;  2YU9 H;  2UUC Q;  4R1J A;  4A3K H;  3A5Z B;  4QGU A;  4A3E G;  1CKO A;  4X65 Q;  1EUJ A;  3AFQ A;  1IBM L;  4IPH A;  4A3I G;  1JJC B;  4OX9 L;  1KQS A;  3Q8D A;  4KHZ A;  2JA7 H;  4YY3 Q;  2ALY B;  2LSS A;  1N33 L;  3OYY A;  3GTG H;  1OXV A;  2K4K A;  1WCM H;  1Y1W G;  2UU9 Q;  1G6P A;  5M3F G;  3CCQ A;  4JBJ A;  3U4Z A;  1B70 B;  3I55 A;  4LF7 Q;  3HOV G;  3I4N G;  1UWV A;  1HNZ L;  4A3M H;  5LMN Q;  3HOW H;  3HOU H;  3RLO A;  5IYB G;  4BBS H;  3F2B A;  3U50 C;  3JAM i;  2E5L Q;  4KLK A;  2HT1 A;  1Y1V H;  2VUM H;  2UXB L;  3FKI H;  3HOX G;  1VQO A;  1EIF A;  3K81 C;  4IJL A;  2MFI A;  1VQB A;  4YHH L;  1E3P A;  1KAW A;  2VQF L;  1X3E A;  1PH6 A;  4NB3 A;  3ULJ A;  1W3S A;  1YVC A;  3J81 c;  1OXX K;  3STB D;  3CCR A;  1M90 C;  1P8L A;  4A75 A;  1YJN A;  1N32 Q;  2ID0 A;  4B3M Q;  3TS2 A;  3G71 A;  4DV5 L;  4DV2 Q;  4AH6 A;  3PGZ A;  4UP9 A;  1PHJ A;  3H0G H;  4NXN L;  4DR2 L;  3S15 H;  1QUQ A;  4GOP B;  3G6E A;  3F2C A;  1J5E Q;  4BBR G;  3GTP H;  1XPO A;  2IX0 A;  3KFU A;  4YWL A;  3HOY H;  1NY4 A;  2D62 A;  4GLA C;  4HJ7 A;  2B63 H;  3W5O A;  4UPA A;  2HHH L;  4YWM A;  2JJQ A;  3M4P A;  5K36 G;  1S72 A;  2PI2 E;  3AYH B;  3K80 C;  5C3E H;  2Z0S A;  2Y0S E;  4KHP Q;  1VQG A;  1QUQ B;  1N34 Q;  1CKM A;  4LF4 Q;  4LWC A;  1SR3 A;  1WI5 A;  2OCE A;  4DNI A;  4QL5 A;  1KIX A;  1MJC A;  3UDX A;  2IX1 A;  1SN8 A;  3K7U C;  2UUB Q;  1YHQ A;  2D0O A;  1YZ6 A;  2JA6 G;  5FLM H;  1NTG A;  1FJG L;  1X56 A;  2E2H H;  1IBM Q;  2ES2 A;  4IOA A;  1G51 A;  3CC2 A;  4L5Q A;  3J80 i;  5IP9 H;  4OX9 Q;  4JI8 L;  3CME A;  1XJV A;  4A3C H;  1BVS A;  4LNQ A;  4JI3 L;  1XMQ L;  1IYJ B;  2WP8 J;  2K5N A;  2ZTD A;  3KYH C;  3A0J A;  4DK3 C;  3AFP A;  4JI5 L;  4A3G H;  1X9N A;  5LMN W;  1C0A A;  4A3K G;  3RN5 A;  3S2H H;  1HNZ Q;  1K73 C;  4DR3 Q;  4JI7 L;  1AH9 A;  5M5Y H;  3KF8 B;  4JCV E;  2JA7 G;  1LYL A;  4LFC L;  2UXB Q;  3BZK A;  5JJI A;  3CAM A;  1WCM G;  3IRB A;  2I5H A;  2N78 A;  4YHH Q;  1SE8 A;  2VQF Q;  1QZH A;  1JMC A;  2AHO B;  4JV5 L;  4A3M G;  1B8A A;  4AQY Q;  3HOW G;  3HOU G;  4BBS G;  3KDF B;  4JI2 L;  1VQN A;  4A3L H;  2CCZ A;  1Y1V G;  4NXM L;  3MEF A;  3FKI G;  3NEN A;  2VUM G;  3CC4 A;  1A0I A;  3S2D H;  3M85 A;  2LXK A;  1K3R A;  1PH2 A;  4NXN Q;  4DR2 Q;  5IYD H;  1OXU A;  3T1H L;  3LGJ A;  2ZJR A;  3S14 H;  2F3I A;  3E9I A;  2NVY H;  3MXN B;  1WOC A;  1YIJ A;  1VQJ A;  4R4C A;  4JI6 L;  4PMW A;  5H1S E;  2I5L X;  4NPS A;  4R4T A;  3ERS X;  2HHH Q;  2NVT H;  4QY7 A;  4A4I A;  2I0Q A;  2UUA L;  2CKZ B;  4IPD A;  3H0G G;  1OTC A;  4DR4 L;  3RNU A;  4A3B H;  4H02 A;  1U5K A;  1Z9F A;  3HKZ G;  4MZ9 A;  3HOY G;  3I2Z A;  4GNX C;  1HZB A;  1UE1 A;  5DLQ E;  3I4O A;  5JEA J;  1XMO L;  1QVG A;  1VQ4 A;  2B63 G;  2EXD A;  2ZTE A;  2OQ0 A;  3VDY A;  3DLL A;  1FJG Q;  4P73 A;  3J7A 5;  4B3T L;  3K8A A;  5JJK A;  1WFQ A;  4IJH A;  5GRO A;  3KOJ A;  4JI8 Q;  1H95 A;  4IFD I;  1I6H H;  1OXT A;  4LUZ A;  4DAM A;  4DV6 L;  3UDI A;  2F52 A;  4AIM A;  3CPW A;  1XMQ Q;  2PNH A;  4HJ8 A;  4BY7 H;  1TWA H;  5HY6 A;  3KLW A;  5J3B A;  5M5X H;  1VQF A;  1VQP A;  4JI4 L;  4UY8 C;  5FLM G;  3H3V H;  4HIK A;  1VQL A;  5IE8 A;  1PYB A;  3CCV A;  1CUK A;  4OWW B;  5GAE C;  1MJE A;  5IP9 G;  3J7Z C;  3GD7 A;  1MKH A;  5FJ8 H;  4A3C G;  1PFS A;  2QA4 A;  1IXR A;  2HIX A;  1S3O A;  4LFC Q;  1C7Y A;  4JI0 L;  1Z47 A;  3L7Z C;  4A3G G;  1Y14 B;  4IO9 A;  2R93 H;  1XTD A;  4DUY L;  3G48 A;  4JV5 Q;  2UXD L;  1EQR A;  1AE3 A;  3AQQ A;  4OWX B;  3GTL H;  2MO0 A;  2OQK A;  1K0R A;  4JI2 Q;  2AMC B;  3GTQ H;  3S1Q H;  1I94 L;  4NXM Q;  1L1O C;  1EQQ A;  5C0X G;  5GQO A;  3KF6 A;  4AYB E;  1Q1B A;  4OO1 G;  4JOI C;  3W1B A;  4HID A;  3M4Q A;  2K52 A;  3HKS A;  3T1H Q;  4A3J H;  1D8L A;  2NZO A;  1EIY B;  4L5R C;  4JG2 A;  4DR1 L;  3S24 A;  2E8G A;  3PIO A;  4JI6 Q;  3M7N A;  5C44 H;  4A3L G;  4WJ4 A;  1GD7 A;  3TRE A;  5ELO A;  1N9W A;  2I5M X;  1YHA A;  3PO3 H;  2UUA Q;  1A63 A;  4AYB G;  3U4V A;  4DR4 Q;  3ZJY C;  2Q2H A;  5IYD G;  1ASZ A;  2JE6 I;  4KI0 A;  4R4Q A;  1CSP A;  4DR7 L;  3T1Y Q;  1L0W A;  1EYG A;  2K5V A;  5C0X I;  1I5F A;  1MIU A;  3D0F A;  4QQB X;  1XMO Q;  1JE5 A;  1XPR A;  4GN5 A;  1YI2 A;  1HNW L;  4OO1 I;  2CWP A;  2KCM A;  4LF8 L;  1BBW A;  1E22 A;  1HZC A;  3STB C;  1VQ9 A;  2PMZ E;  1KHI A;  2AKW B;  4ME3 A;  4HJ5 A;  2R7F A;  4A3B G;  2NN6 G;  2R7D A;  1X3F A;  2RHS B;  3ULL A;  4DV6 Q;  3E0E A;  3K0X A;  2CWA A;  4GNX A;  4K0K L;  3PCO B;  3UDG A;  4L5S A;  3CW2 C;  4GLV B;  2NZH A;  4JC0 A;  5IT9 c;  1Q82 C;  3EBE A;  1JJ2 A;  3UE1 A;  1HH2 P;  2PI2 A;  4XIG S;  1KXL A;  3JAM c;  1VQ7 A;  4A3F H;  1N33 Q;  2FXQ A;  1JT8 A;  1SMX A;  5GAH C;  1K8G A;  3PF5 A;  3CPF A;  2Z6K A;  3I7F A;  4GNX B;  4JI0 Q;  5JJL A;  3CCJ A;  5BR8 L;  4BY7 G;  1X55 A;  1J6Q A;  4PZ6 A;  2YTV A;  3FHW A;  4RG1 A;  4Y7N H;  4ALP A;  1TWC H;  1PH1 A;  3GTK H;  4PG3 A;  1AE2 A;  4C3H H;  4A76 A;  4DR5 L;  3I4M H;  1E24 A;  2UXD Q;  4LFA L;  1K9M C;  3AEV A;  2EQS A;  5FJ8 G;  2YTX A;  4PZ7 A;  3ER0 A;  1VQH A;  3PUY A;  3PUW A;  1A8V A;  1OXS C;  2A1A A;  1VQK A;  1YHB A;  3S16 H;  3TEH B;  2R93 G;  2VS1 A;  2GVB A;  2YTY A;  3OTO L;  2WFW A;  1E1T A;  1TWH H;  1O7I A;  4DV4 L;  1R9T H;  1IBK L;  4DV3 L;  1LTL A;  2DGY A;  5HGQ A;  4DR1 Q;  3H3V I;  1W2B A;  2F4V L;  2ZTC A;  1L1O A;  4DV5 Q;  1UE5 A;  4A93 G;  2JEA I;  3OW2 A;  3CC7 A;  1VQ5 A;  3FP9 A;  4JOI A;  1P16 A;  3PUZ A;  3HKZ E;  4GN3 B;  4A3J G;  2JA9 A;  2N49 A;  4DR7 Q;  2V1C C;  4P74 A;  4JYA L;  1B7Y B;  5LMN L;  5C44 G;  1IZ6 A;  1NE3 A;  5ELN A;  3G4S A;  4DV1 L;  1PV4 A;  1HNW Q;  1HZ9 A;  4LF8 Q;  3RLF A;  2BH2 A;  2UXC L;  3J80 c;  3PO3 G;  1VQI A;  4DK6 C;  3RZD H;  1D7Q A;  2JK8 A;  2AWO A;  3NBH B;  1VQE A;  3HFZ B;  1HJP A;  2WAQ E;  1PH4 A;  4DPG A;  2C35 B;  1M1K C;  4Y52 H;  1WJJ A;  1YBY A;  1FL0 A;  2A19 A;  1KRT A;  2R7Z H;  4YCU A;  3BJU A;  1TWF H; 
#chains in the Genus database with same CATH topology
 1AN8 A;  2ASB A;  5HUR A;  4EGV A;  5C4H A;  2YV5 A;  1NR2 A;  1E7Z A;  2Q2I A;  2RF4 A;  4JI3 Q;  1BCP C;  2WII B;  3BU2 A;  3JAM E;  1TVX A;  5IGG A;  4XQQ A;  3J81 i;  1YNN D;  2B8G A;  3Q22 A;  4A3D H;  2Z8L A;  1VQA A;  4F88 A;  4X6A H;  4C3J B;  4DR5 Q;  4LF5 L;  5C4X H;  1LV9 A;  2IL8 A;  4LFA Q;  1K8O A;  4RCN A;  2R92 H;  2KCT A;  5K5P A;  2VZA A;  1H9J A;  3DHQ A;  5EPL A;  1O80 A;  4A3E B;  1Q81 C;  1VQM A;  4MN3 A;  2D2C C;  4C3H G;  3GP7 A;  2R61 A;  2IY5 B;  1BNZ A;  3GTO H;  5IWA L;  4XXE A;  3S16 B;  2DN8 A;  4POG A;  4C1N I;  1B3Q A;  4OXP A;  1EOV A;  3W1G A;  1Q46 A;  2IHF A;  1EWI A;  1V1P B;  5G3L F;  2Q2U A;  2YYZ A;  2IHE A;  4YCW A;  3T51 B;  1L2F A;  4FO2 A;  4I7A A;  4GKK L;  3NQI A;  1PH8 A;  3KUP A;  3K7A H;  1IBL L;  3K0Y A;  4X66 L;  1YNX A;  1PTO C;  3T56 B;  4BA1 I;  1B4O A;  1C4Q A;  3J7Y W;  1STY A;  2F0I A;  2GN5 A;  2E2J H;  4L5T A;  4AQY L;  4R4O A;  4R9W A;  1TXY A;  1J8I A;  3NEL A;  2E2I H;  1SND A;  3DM1 A;  1DJR D;  5ELB A;  2R7Z G;  3QWN A;  1SRO A;  3EIV A;  3Q24 A;  2A8V A;  5EJW A;  1EYD A;  5CV6 A;  5C4J H;  1KDC A;  1G2S A;  5E3F A;  1HNX L;  2EYP A;  4IUU A;  2JA5 G;  2JEB I;  2ICI A;  4OL7 A;  2E74 C;  5M5W B;  5AJ3 Q;  1NMF A;  3PO2 G;  1E2Z A;  1N36 Q;  3K5N A;  1TWG B;  2JA6 B;  4B3R Q;  1FGU A;  2NN6 I;  4DAP A;  1DCZ A;  3X3N A;  1PZJ D;  1JJG A;  3CP0 A;  1ESF A;  4JI1 Q;  4GS3 A;  2WB1 E;  4DUZ L;  2A6H D;  1Q1E A;  1NMG A;  3KF8 A;  4FXD A;  1RKN A;  2JA8 G;  4DR6 Q;  4ZRZ A;  5I9O A;  3HOV H;  1BUV T;  3FMC A;  3C3L A;  2EYM A;  1SLJ A;  1ET9 A;  4CJ2 C;  1EY8 A;  5IYB H;  1ASY A;  4YY3 L;  3DWA A;  1PYS B;  1QVF A;  1CSQ A;  4B3S Q;  3TS0 A;  2F0Q A;  4RHR A;  4B9W A;  1T5X D;  5CBA E;  4KMU C;  3HOW B;  1MD2 D;  3HOU B;  3F2D A;  2VUM B;  3DM3 A;  3PUX A;  3CXC A;  2B3G A;  4WJ3 M;  3OMC A;  5DAU A;  2K01 A;  2G9H D;  4KJO A;  4K0K Q;  4BXX G;  2K75 A;  4ZLT F;  3A55 A;  3C46 A;  3D6C A;  2VQE Q;  2BH8 A;  2DY7 A;  2A68 C;  4APV A;  1NJI C;  5K36 H;  1WTH A;  4LF9 Q;  5EKL A;  3H0G B;  1R4Q B;  3UDF A;  4IUN A;  1PLF A;  2ZM6 Q;  4FF3 A;  2F0S A;  2L55 A;  1NAP A;  3HKZ B;  1UE7 A;  5EKK A;  3TZD A;  4HED A;  3H15 A;  2HDL A;  2AWN A;  4H0L C;  3T1Y L;  5IOC A;  2PYK A;  1U0L A;  1EY4 A;  1RIP A;  1DGS A;  5C3E B;  3EN2 A;  4TQU S;  3S9W A;  1K8A C;  1X65 A;  1N34 L;  3TQY A;  4DV0 Q;  3V96 A;  2HQL A;  4KKU A;  2UUB L;  5CV9 A;  3H94 A;  3MAQ A;  2UUC Q;  1UAP A;  2VB2 X;  4KV6 A;  4OX9 L;  3ONA B;  1YNN C;  1ENF A;  2TMP A;  1OXV A;  2E2D C;  1WCM H;  4A3G B;  3U4Z A;  2KHS A;  3H91 A;  4ODG A;  4A3M H;  3EFX D;  3MXG A;  3U50 C;  4L63 B;  3K5O A;  4KLK A;  3HOX G;  4IJL A;  4G7Z C;  1LLR D;  4YHH L;  1KAW A;  2VQF L;  1PH6 A;  4JK1 C;  3NPP A;  4YIJ A;  1A15 A;  1SBB B;  1VMC A;  5KNB A;  2KCC A;  1WD1 A;  2CVR A;  3U9S A;  1LTS D;  2ID0 A;  2IX3 A;  2PZW A;  1SMY D;  1EYC A;  4B3M Q;  4QCL A;  4DA2 A;  4DV2 Q;  4AH6 A;  1PHJ A;  2A6E D;  3OIQ A;  1PMR A;  1EY6 A;  3QB3 A;  1SNP A;  3G6E A;  3F2C A;  1U9R A;  4BBR G;  1ZKO A;  2IX0 A;  3GTP H;  4C3I G;  1A2U A;  4GLA C;  2SNS A;  2B63 H;  1SE2 A;  3W5O A;  4UPA A;  2V4D A;  1MHW C;  2JJQ A;  3M4P A;  2EYF A;  2PI2 E;  4A3B B;  2Y0S E;  4LF4 Q;  3DWQ A;  4LWC A;  2OCE A;  1TS2 A;  1T5E A;  3BYT B;  1SN8 A;  4N8X 1;  4S3S A;  2RQX A;  1FJG L;  1SYC A;  4IOA A;  3S1R B;  3J80 i;  2L0C A;  4JI3 L;  5M5X B;  1RJT A;  2K5N A;  5I2Y A;  3RN5 A;  3S2H H;  1HNZ Q;  1K73 C;  1EEI D;  1EWC A;  3RD4 A;  2WAC A;  1D5M C;  4K6L A;  4LFC L;  2UXB Q;  1Q8I A;  4LJZ C;  5JJI A;  3CAM A;  4UDU C;  2N78 A;  2OXP A;  5CGK A;  3R93 A;  1JMC A;  1SE8 A;  5CC4 A;  4Q5V A;  2A6H C;  2MHV A;  3KDF B;  2F0F A;  3NHH A;  3SK5 A;  4E6I A;  4OIJ A;  2CCZ A;  4ZYS A;  3MEF A;  3FKI G;  1PDQ A;  3NUC A;  3SR1 A;  1K3R A;  1QJO A;  1PH2 A;  4A3J B;  4DR2 Q;  1UEA B;  2F3I A;  4NP5 A;  3E9I A;  3MXN B;  3NBH A;  4JI6 L;  4FXG C;  5H1S E;  2I5L X;  4IQZ A;  2K5D A;  2NVT H;  1WTW A;  4IPD A;  1OTC A;  5A35 A;  2B2V A;  2CQA A;  4CDF C;  1WTV A;  4LAA A;  3I2Z A;  1ML0 D;  1HQR D;  1HZB A;  2F0G A;  5DLQ E;  1XMO L;  3RUZ A;  1GUS A;  2EXD A;  2ZTE A;  2OQ0 A;  4CKE A;  3VDY A;  2OT2 A;  2WAQ B;  4DF7 A;  1OXT A;  4LUZ A;  1HRJ A;  4DV6 L;  2F52 A;  1TWA H;  1VQP A;  3KLW A;  4UY8 C;  4DGZ A;  1VQF A;  5I6W A;  3CCV A;  4OWW B;  5GAE C;  1JIC A;  3J7Z C;  3GD7 A;  1B53 A;  4Q0F A;  1IXR A;  1S3O A;  4PMB A;  1IHZ A;  3GTK B;  3L7Z C;  1Y14 B;  5M5Y B;  4IO9 A;  2R93 H;  3T13 A;  4JV5 Q;  1X32 A;  1EQR A;  3KLR A;  3GTL H;  1II3 A;  2OQK A;  3S1Q H;  2AMC B;  4NXM Q;  5T1I A;  2DNC A;  4RHS A;  4FXK C;  1EQQ A;  3FDT A;  1I4G A;  1EFI D;  2K03 A;  1WTO A;  4OO1 G;  1PRT D;  3R8B A;  1TWH B;  3FPP A;  4XT3 B;  2OF1 A;  3IFD A;  3P75 A;  4L5R C;  3S24 A;  2E8G A;  3PIO A;  4WJ4 A;  4MHE A;  2WKC A;  3TRE A;  1FD7 D;  2I5M X;  1QE6 A;  2DJF C;  4AYB G;  4CKB A;  3U4V A;  2RA4 A;  4DR4 Q;  2O5J C;  4DR7 L;  1D1K A;  1EYG A;  3K58 A;  1MIU A;  1KAB A;  4HCS A;  4GN5 A;  3Q23 A;  2XWJ B;  4EQN A;  2CWP A;  2EY5 A;  1EZ6 A;  3IFT A;  2PMZ E;  4HJ5 A;  5ELC A;  2RHS B;  4ILW A;  3E0E A;  3BDO A;  3LX0 A;  5NUC A;  2CWA A;  4K0K L;  3PCO B;  1SMY C;  1F2Y A;  4KKT A;  1W6K A;  3CW2 C;  2A6E C;  1B1Z A;  1JJ2 A;  5D3D A;  1HH2 P;  4XIG S;  2B2W C;  3MXU A;  1F9P A;  3CPF A;  1SNC A;  3VR5 A;  4BY7 G;  1X55 A;  1A3T A;  2HCI A;  1PH1 A;  1QWY A;  1TWC H;  1AE2 A;  4Z9C B;  4C3H H;  5C4X B;  2I07 B;  4B9X A;  2R92 B;  1HTP A;  1D5Z C;  1DOK A;  1ZYR D;  5FJ8 G;  4CDC C;  3ER0 A;  4R8I A;  2AUJ D;  2A1A A;  1MBY A;  3TSS A;  2YTY A;  3GTO B;  4H44 C;  2WB1 B;  1E1T A;  1PRT F;  2XSC A;  4DV4 L;  1IBK L;  1SDF A;  3X3M A;  5HGQ A;  1W2B A;  4H13 C;  1L1O A;  4CHT B;  2BCO A;  1FNV A;  1O7L A;  3TME A;  3DEO A;  2Q8I B;  4DXF A;  1XX8 A;  1P16 A;  4GN3 B;  3HKZ E;  4MIU A;  3NTK A;  3K7A B;  2RBM A;  3G4S A;  1CQF A;  4JPB W;  5C3W A;  4LF8 Q;  3RLF A;  2BH2 A;  4I7Z C;  3PO3 G;  5CV8 A;  4XYO A;  4DK6 C;  2AWO A;  3BVZ A;  1VQE A;  1PH4 A;  1LT4 D;  2KJX A;  1X3Q A;  4DPG A;  1WJJ A;  1HUN A;  1GXD C;  2A19 A;  2R7Z H;  3SE0 A;  3BJU A;  1GVP A;  3LWE A;  1BQQ T;  2IWH A;  2ZJQ A;  2B2U A;  1N8R C;  2JA5 H;  3I73 A;  2IPK D;  4OGQ C;  3CRK C;  3PO2 H;  4JI5 Q;  2F0D A;  1HR0 L;  1YJW A;  5C4J B;  1SYF A;  4FYD A;  1SEB D;  1CK1 A;  4UP8 A;  1D5X C;  1EFW A;  1ICW A;  3M9B A;  4IN3 A;  3S1N H;  2IT1 A;  1MGS A;  2N88 A;  1Z7T A;  2OTL A;  1HA6 A;  2JA8 H;  3JC6 6;  3RN2 A;  2B29 A;  2K5Q A;  1Y8O B;  3CCL A;  4GKJ L;  5L37 A;  2Z1C A;  1FNU A;  1V1Q A;  4KD3 A;  4JBK A;  5BN3 A;  4G7H C;  3P7J A;  4DV3 Q;  2E76 C;  4X64 L;  4A93 H;  3HOV B;  4U68 A;  1ENA A;  1O7Y A;  1PH3 A;  2N8N A;  1R9T B;  1I50 H;  1XNQ L;  3AU7 A;  3OOC A;  1E2W A;  3QG1 A;  1HA5 A;  4JYA Q;  4K5V A;  5EBD A;  1TS4 A;  4O0A A;  3IKJ A;  1JOQ A;  3KF6 B;  4DV1 Q;  1S5C D;  4LFB L;  1BKB A;  1I4R A;  2UXC Q;  2XTI A;  5LMU L;  5IGE A;  4RGO S;  4BXX H;  2F0V A;  1DD2 A;  1BR9 A;  2D5D A;  3NEM A;  3L2P A;  1PRT C;  4HSP A;  1HZA A;  1Q12 A;  2DNE A;  2GVA A;  1CKN A;  3Q6S A;  4PMC A;  1S40 A;  4POF A;  2L15 A;  2F0P A;  3VR2 A;  3BZC A;  4UP7 A;  5J1Z A;  1N32 Q;  2Z4I A;  1CKN B;  1EU3 A;  2EIF A;  3VR3 A;  4LW1 A;  4DNR B;  1GO3 E;  1KLG D;  3N52 A;  2Y0S B;  1WYD A;  2EJM A;  1K83 H;  2K28 A;  1UEB A;  1GUO A;  4I65 A;  1BCP B;  1I3Q H;  2BA1 A;  4P72 A;  1S5D D;  3CRL C;  3L0O A;  3J81 L;  1RL2 A;  3KJP A;  2HUG A;  4X65 L;  2BDN A;  1JQY D;  5CV5 A;  2NVQ B;  1QIL A;  4BY1 G;  1KD1 C;  2N55 A;  3RZO B;  1WCM B;  1CHQ D;  4LF6 Q;  3W2D A;  2DUD A;  3HOX H;  2UU9 L;  2QW7 A;  4RAU C;  4LF7 L;  1Q86 C;  3M4O H;  2RHQ B;  4A3M B;  1ZYR C;  1MSH A;  3A8J E;  3BS1 A;  3PIP 3;  3G6J B;  4LUV A;  3A56 A;  2OTJ A;  3KBG A;  4ZQ3 A;  2E5L L;  2D0P A;  4GLX A;  3F2U A;  1PA6 A;  3TRZ A;  5I9P A;  3O13 A;  4LUO A;  4IUT A;  5FK9 C;  2K14 A;  4L6T B;  5CMD A;  2AQ1 B;  2L4N A;  1EY7 A;  4DKA C;  1UE6 A;  2KA7 A;  5T1G A;  1V43 A;  3KBX A;  3OIP A;  4BBR H;  3ICE A;  3ULP A;  4C3I H;  4OWT B;  3HOZ G;  3GV3 A;  1XTC D;  3RLN A;  4IFD G;  1PTO B;  4KD4 A;  1XNR Q;  2NYZ D;  3CCS A;  2FHT A;  4U67 3;  1MSG A;  1PVO A;  1EYA A;  3GTP B;  5IYC G;  4MTK A;  3CF5 A;  1YEZ A;  2BE5 D;  3HZX A;  1FVI A;  2B63 B;  2CW0 D;  5COY A;  3H3V C;  1IL2 A;  2EXZ A;  3K57 A;  3CD6 A;  1D1I A;  4J15 A;  2QEX A;  2EOT A;  4DV7 Q;  3A8I E;  5M3M G;  3NQT A;  5C3E G;  4X62 Q;  1UNS A;  2NVX H;  4WRD A;  2YU9 H;  2F0O A;  3A5Z B;  4QGU A;  2CHB D;  1JCK B;  4IPH A;  1VMP A;  4ABN A;  1JJC B;  4A3I G;  3M3Y B;  1E2V A;  3Q8D A;  3GTG H;  2HD3 A;  3MFG A;  1Y1W G;  1G6P A;  5M3F G;  3I4N G;  1IYV A;  1EZ8 A;  3RLO A;  3FKI H;  2PCF B;  1EIF A;  3TP7 A;  2MFI A;  3ITP A;  3VR6 A;  1HPC A;  1E3P A;  4K8I A;  1W3S A;  3J81 c;  3STB D;  1M90 C;  1EQV A;  5LL6 X;  3FEW X;  2AUK A;  4KY6 A;  4KTA A;  4A75 A;  1JWU D;  1NNX A;  4DN4 M;  3TS2 A;  2K5W A;  3S17 B;  2VB3 X;  4UP9 A;  1IL8 A;  1QUQ A;  3SK6 A;  1J5E Q;  4HMJ A;  4HJ7 A;  2NVT B;  4H7B A;  2F03 A;  3I3C A;  4CDD C;  1L0X B;  1SFO B;  2NZ1 D;  3K80 C;  4RKL A;  1QUQ B;  4X3T A;  1CKM A;  1WI5 A;  4KY7 A;  3UDX A;  4XYQ A;  1I6V C;  3K7U C;  1YHQ A;  1YZ6 A;  1CHP D;  2ENB A;  2PMZ B;  1HCZ A;  1B9N A;  1IBM Q;  2ES2 A;  1G51 A;  4L5Q A;  1HTL D;  5E4X A;  2HCC A;  2QDB A;  1XMQ L;  3KYH C;  3A0J A;  2LMC B;  4JI5 L;  4IUQ A;  4RH6 A;  4A3K G;  5LHY 1;  1AH9 A;  3KF8 B;  4JCV E;  2JA7 G;  3OPO A;  4IZ8 A;  4RCO A;  3IRB A;  5CV7 A;  1TQO A;  2NUC A;  3M7G A;  5JAV A;  4OO1 H;  5HGT A;  3GTL B;  3S1Q B;  4OEM B;  4BBS G;  3J81 E;  4JI2 L;  1VQN A;  1SJE D;  1KLU D;  1Y1V G;  3SK4 A;  3KK7 A;  2F0U A;  3M85 A;  4K2K A;  4NXN Q;  4FF2 A;  1B50 A;  1F77 A;  2X69 A;  2NVY H;  1WOC A;  4NDX A;  2HHH Q;  2JYO A;  4FVM A;  1QB5 D;  1HFN A;  2KOL A;  1KDB A;  2UUA L;  2F0W A;  3RNU A;  4H02 A;  3EVQ A;  2MJ8 A;  1LAB A;  1ET6 A;  1F2L A;  1JE4 A;  3HOY G;  4GNX C;  1UE1 A;  1KNA A;  1VQ4 A;  2PO4 A;  3IL8 A;  4P73 A;  1GHK A;  3BDL A;  5JJK A;  4IJH A;  3EQL C;  5GRO A;  3SDZ A;  4JI8 Q;  1H95 A;  4DAM A;  2F0T A;  3UDI A;  4AIM A;  3CPW A;  2HDM A;  1M8A A;  4HJ8 A;  4BY7 H;  2E2H B;  2EY6 A;  1EL0 A;  3H3V H;  5FLM G;  4HIK A;  1Y69 U;  1CUK A;  2BE5 C;  5CBE E;  5FJ8 H;  5EGT A;  1SYD A;  2CW0 C;  3FPU B;  2HIX A;  4V19 0;  1C7Y A;  4JI0 L;  2A73 B;  2M00 A;  1XWE A;  5EPK A;  4C3H B;  1XTD A;  2PZU A;  4X3S A;  2B2Y C;  2LFN A;  4OWX B;  3J80 L;  4M8A A;  2XRQ D;  4RGT A;  3Q0A A;  1EY5 A;  5C0X G;  4CKC A;  4K8J A;  4AYB E;  1H9K A;  3W1B A;  3T1H Q;  3HKS A;  1EIY B;  3M7N A;  4DR1 L;  4A3L G;  3VA7 A;  2EJF C;  1SE3 A;  1GUG A;  1N9W A;  3PO3 H;  2Q2H A;  5IYD G;  1CSP A;  2Q8R E;  1EY0 A;  1SAP A;  1I5F A;  4QQB X;  2MUY A;  1XPR A;  4OO1 I;  1BBW A;  1E22 A;  3STB C;  4HR7 B;  1VF7 A;  5LL6 S;  2R7F A;  1AP0 A;  2NN6 G;  1X3F A;  3VA5 A;  2R7Z B;  2VXW A;  2TSS A;  3UDG A;  1QOH A;  4L5S A;  4NW2 A;  3WOF A;  2A69 D;  2JA5 B;  2EYH A;  1N33 Q;  1JT8 A;  1K8G A;  3PO2 B;  3PF5 A;  2Z6K A;  1TR5 A;  1EIG A;  1JOR A;  4PZ6 A;  2M9V A;  4Y7N H;  3S1N B;  4PG3 A;  4DR5 L;  4RWS C;  2UXD Q;  4LFA L;  3AEV A;  2EQS A;  1IKM A;  2YTX A;  1O7Z A;  3MWY W;  1PZI D;  2JA8 B;  1A3U A;  1JOO A;  1OXS C;  1VQK A;  3S16 H;  3TEH B;  5JOB A;  1KAA A;  2GVB A;  2F0M A;  3I70 A;  2WFW A;  4IUV A;  5KIX A;  2DGY A;  3H3V I;  1D2B A;  3I4L A;  4A93 B;  1EIH A;  3NP8 A;  1LAC A;  1STE A;  1STH A;  4DV5 Q;  5CV4 A;  1KTK A;  2XVS A;  2F0H A;  2Z6B A;  4BWG B;  3PUZ A;  5C44 B;  1IZ6 A;  1NE3 A;  1EEF D;  4J6H A;  5ELN A;  1J9O A;  1HNW Q;  1HZ9 A;  5IGB A;  1ENC A;  3J80 c;  1CI3 M;  1TY2 A;  4IUR A;  1D7Q A;  3NBH B;  4Y52 H;  1HJP A;  1ESR A;  1YBY A;  1KRT A;  3TP6 A;  4YCU A;  5KNC A;  1DON A;  3I56 A;  1H9S A;  3GTJ H;  3T53 B;  4PQX A;  2F3W A;  4RKB A;  1VDZ A;  5FOB B;  1F9S A;  3BYY B;  2MQH A;  2Z6K C;  3M4Y A;  4OHJ A;  3DUZ A;  3J7A V;  3PIP A;  5BR8 Q;  1Q8K A;  1J5E L;  1H9S B;  4O42 A;  1QG7 A;  4ME5 A;  4JI7 Q;  1TWG H;  3TDQ A;  4ULL A;  4JBM A;  4GN4 B;  2B2W A;  1E0B A;  4A3F G;  2ZJP A;  1FYC A;  5AJ3 L;  3A74 A;  3I4M B;  3WWV A;  1SSO A;  5JVH 3;  1N36 L;  4B3R L;  2EPB A;  2LXJ A;  4TSS A;  1STB A;  1G2T A;  4TVA B;  4CDE C;  1XXG A;  1I3Q B;  3OTO Q;  2QDL A;  1R4P B;  4JI1 L;  4BY1 H;  2KEC A;  3H6M A;  2VL6 A;  2F4V Q;  4XTC S;  3PV0 A;  1AEX A;  3MEH A;  2B8F A;  3VYT A;  4DR6 L;  1X54 A;  3K6O A;  2KED A;  2H5X A;  1X3G A;  3LNN A;  2F3V A;  5JEA G;  1Q7Y C;  4RMF A;  1Q3L A;  4B3S L;  2XRS D;  2SOB A;  3M4O B;  3ND9 A;  1RHP A;  3J80 E;  3CQZ H;  1DOM A;  4ZKC B;  4PZ8 A;  4ZCK A;  4GOP A;  3R2I A;  3HOZ H;  1SYE A;  4B3T Q;  4IFD H;  1KDA A;  4C56 C;  1PH5 A;  4BA2 I;  1VCI A;  4BBR B;  5IYC H;  4FP5 D;  2K5H A;  4C3I B;  3CCU A;  4JI4 Q;  4IOC A;  2RCN A;  5J39 A;  1U4P A;  4KN7 C;  2VQE L;  5IOD A;  4F8M A;  2PW5 A;  3R2T A;  4LF9 L;  3GTM H;  5KEE A;  4LF5 Q;  1QVC A;  1PFM A;  1I4H A;  2ZM6 L;  5M3M H;  2J0T D;  1WTX A;  4P75 A;  4A3D B;  3NTH A;  4OON A;  1E1O A;  2IJ0 A;  5C4Z A;  3S1M H;  4DUY Q;  4FF1 A;  3EJI A;  2VY3 A;  3MC0 B;  1XPU A;  4A3I H;  1EY9 A;  2Y0S G;  5IWA Q;  1JR0 D;  4WOR A;  3HP3 A;  4DV0 L;  1QZG A;  1SRU A;  1GM5 A;  2NVX B;  2A69 C;  1Y1W H;  4FDB A;  5M3F H;  4MNO A;  2A5H A;  2UUC L;  2Q2T A;  1WVL A;  3I4N H;  3GDE A;  1WTP A;  1BXT A;  4J1M A;  4GKK Q;  4C2M H;  2NTT A;  3GTG B;  1DXM A;  3QO2 A;  1GKH A;  1IBL Q;  1LT3 D;  2XIW A;  1PXU A;  3PUV A;  4X66 Q;  1RDP D;  1TU2 B;  3A5U A;  3OW7 A;  4YWK A;  3T4A C;  4GOP C;  1L1O B;  4HAE A;  3DWP A;  3PQI A;  1GOZ A;  3FKI B;  2RDG A;  2EYJ A;  5C3X A;  3SXH A;  4LK1 C;  2E2J B;  2CQO A;  1I4Q A;  2ATW A;  2CH4 A;  1HR0 W;  3D31 A;  4TRD A;  5AFW A;  2O4X A;  3PSI A;  2LS0 1;  2E2I B;  3VYR A;  1MI2 A;  4B3M L;  5IIF A;  1HNX Q;  4DV2 L;  2OWO A;  5C0X J;  4CBV A;  1VQ6 A;  2EYO A;  1HUM A;  2VNU D;  3OSO A;  4LMQ D;  4HTH A;  4DAY A;  2ZT9 C;  3GO5 A;  1PRT B;  2XWB B;  5IP7 G;  3TP8 A;  4P71 A;  2B2T A;  2KBN A;  1KC8 C;  4C3J G;  2H1E A;  4LF4 L;  1G6Z A;  4N9T A;  4DUZ Q;  2ICE C;  1KRS A;  3VYS A;  3S1R H;  4DAY B;  1AZP A;  1S5B D;  4R1J A;  1ICF B;  2L1B A;  4A3E G;  4A3K H;  1CKO A;  1EUJ A;  1F9R A;  3AFQ A;  3J7A F;  5JPM C;  1WTQ A;  1AZQ A;  3D4R A;  1KQS A;  2JA7 H;  1K0S A;  1H9M A;  4YY3 Q;  1N33 L;  3OYY A;  1PFN A;  2K4K A;  4JBJ A;  1B70 B;  1HNZ L;  5I6Y A;  3A8K E;  4BBS H;  3JAM i;  2HT1 A;  4K5W A;  1Y1V H;  5FO7 B;  2UXB L;  3VR4 A;  3HS0 C;  1VQO A;  4HMI A;  4F7X A;  1X3E A;  4NB3 A;  1V1O A;  3ULJ A;  4K5X A;  3CCR A;  1P8L A;  2ZXP A;  4DXG A;  3C1F A;  5D65 A;  4AYB B;  4DV5 L;  3PGZ A;  4DR2 L;  4K2L A;  3S15 H;  3G7L A;  2NVY B;  2P5Z X;  3IAY A;  2LY7 A;  3HOY H;  1NY4 A;  2D62 A;  2K05 A;  1LTI D;  2B2T C;  4YWM A;  3AYH B;  2Z0S A;  4KHP Q;  1VQG A;  1N34 Q;  2F0N A;  1NCV A;  2OEO A;  1KIX A;  1MJC A;  2UUB Q;  2D0O A;  1WD0 A;  5A2Q L;  2JA6 G;  5I4D A;  5FLM H;  1CM9 A;  1U4M A;  1NTG A;  1K28 A;  1K8M A;  1X56 A;  2K6A A;  2QEJ C;  3CC2 A;  4OX9 Q;  3SK8 A;  1LTT D;  1XJV A;  2BOS A;  1BO0 A;  4R8N A;  4BY7 B;  1IYJ B;  2WP8 J;  1JWM D;  2QF7 A;  3VYU A;  5I2X A;  1C0A A;  5LMN W;  1STG A;  4DR3 Q;  4JI7 L;  1CQV A;  5M5Y H;  1HFG A;  1S4Z A;  1LYL A;  1W6J A;  1VF5 C;  2X6G A;  3BZK A;  2I5H A;  2F1M A;  5C0X H;  4K14 A;  4YHH Q;  1QZH A;  2VQF Q;  4G4K A;  4F87 A;  1Y8P B;  2AHO B;  4JV5 L;  3HOW G;  3HOU G;  3QIA A;  4A3L H;  4NXM L;  2VUM G;  1NSN S;  1Q90 A;  2SDF A;  3NEN A;  3CC4 A;  3S2D H;  4KK7 A;  2PW7 A;  2O2L D;  2KUM A;  2JSO A;  3MVV A;  4DK1 A;  5IYD H;  2ZJR A;  3S14 H;  5IT9 L;  3V05 A;  5C5L A;  3TZU A;  4PMW A;  4EQP A;  4R4T A;  3PO3 B;  2FFK B;  1HHV A;  4QY7 A;  4A4I A;  2XNA C;  4TKO B;  3H0G G;  4DR4 L;  1TS5 A;  4RGN A;  5F2D A;  1TT2 A;  1U5K A;  1Z9F A;  3HKZ G;  4MZ9 A;  1PYW D;  3I4O A;  5JEA J;  2KQ3 A;  1FJG Q;  3J7A 5;  4B3T L;  1O78 A;  1SYB A;  1WFQ A;  1I6H H;  1Z6H A;  2L11 A;  3L3O C;  5HY6 A;  5J3B A;  4JI4 L;  4FF4 A;  1BOS A;  1U4L A;  1VQL A;  5IE8 A;  2FJ2 A;  1MJE A;  5IP9 G;  4A3C G;  3CKI B;  3PIO 3;  1SE4 A;  2QKI C;  2QA4 A;  4LFC Q;  3S2H B;  4C1N K;  4Y7N B;  1D6E C;  4A3G G;  4RA8 A;  4RGM A;  3SVM A;  4N8F A;  4DUY L;  1F2M A;  2L12 A;  1V1P A;  5EKI A;  3PMF A;  5DNF A;  1AE3 A;  3U9O A;  2MO0 A;  3GTQ H;  3ZYY X;  2C9O A;  1C8C A;  1NR4 A;  4KKS A;  1CZW A;  3OWE B;  3OHX C;  3MHB A;  1CTM A;  1Q1B A;  4JOI C;  3M4Q A;  3AMU A;  4G7O C;  4JG2 A;  4JI6 Q;  2EDG A;  3FVQ A;  1GD7 A;  2F4I A;  3K5L A;  5ELO A;  1A63 A;  5FLX L;  3TP5 A;  2RDF A;  2EYL A;  1GUN A;  1ASZ A;  2JE6 I;  4HN7 A;  1L0W A;  1K3B C;  5C0X I;  3D0F A;  1XMO Q;  2AQ3 B;  1JE5 A;  1YI2 A;  3DEP A;  4LF8 L;  2KCM A;  2AQ2 B;  1HZC A;  1KNE A;  1BDO A;  1STA A;  5E4W C;  1VQ9 A;  1I4X A;  2PNR C;  4ME3 A;  4A3B G;  2R7D A;  5BN5 A;  3ULL A;  3BVG A;  3MTS A;  4DV6 Q;  4UAI A;  4GNX A;  3GTJ B;  2BDO A;  5IT9 c;  3EBE A;  1KXL A;  4A3F H;  1TWA B;  1GJX A;  2FXQ A;  1SMX A;  4G57 A;  3I7F A;  1S5F D;  4GNX B;  2EJG C;  1DOL A;  3FHW A;  4RG1 A;  4ALP A;  2SEB D;  4KY5 A;  1LTR D;  4DAV A;  3D8G A;  4QUC A;  5A2Q E;  4OEL B;  4PZ7 A;  1VQH A;  2R93 B;  1HXY D;  4OIK A;  5E1F A;  1YHB A;  1ILQ A;  4BY1 B;  2B2Y A;  3D4W A;  5JEA H;  1R9T H;  3L9A X;  4DV3 L;  1CA5 A;  2LKV A;  1FNW A;  2G5D A;  2RSN A;  2ZTC A;  4A93 G;  2FIN B;  4JW0 A;  3CC7 A;  1VQ5 A;  3FP9 A;  4A3J G;  2JA9 A;  4DR7 Q;  4JYA L;  3K5M A;  1LTB D;  3SHL A;  5C44 G;  1WTR A;  2B39 A;  3NTI A;  4DV1 L;  1PV4 A;  5KYL A;  2UXC L;  1VQI A;  3CQZ B;  3RZD H;  1LO5 D;  1S5E D;  2JK8 A;  3HRZ C;  3HFZ B;  2C35 B;  1FL0 A;  3HOZ B;  2XN9 C;  1TWF H;  3PF4 A;  4IPC A;  3E0J A;  3E3X A;  2VW9 A;  1VQC A;  1A3V A;  5IT9 E;  1G29 1;  1JWS D;  2WAQ G;  4YCV A;  1PH9 A;  3I90 A;  1AW7 A;  1U4R A;  2WIN B;  5FLX c;  5GAG C;  2O5I C;  2C5C A;  1VQD A;  3E9H A;  5E7N A;  3GTM B;  4KHV A;  2DJG C;  1A62 A;  2K04 A;  5M3M B;  2QGQ A;  2RSO A;  4O2D A;  1VS0 A;  4KHP L;  1N32 L;  1TWC B;  3BVM A;  1SYG A;  5GAD C;  3J81 j;  5IGC A;  3S1M B;  3I4M G;  5COR A;  3I72 A;  4A3I B;  4IAL A;  4GZY C;  1IBK Q;  4DV4 Q;  1LTA D;  1DM0 B;  2GA4 B;  5FO9 B;  1XYI A;  3WOE A;  1CFM A;  5CR3 A;  2NVQ H;  4QJF A;  1Y1W B;  5M3F B;  5DM7 3;  1PH7 A;  3I4N B;  5KND A;  3RZO H;  1KL9 A;  3CCM A;  1LUZ A;  4EVO A;  2KHI A;  2K32 A;  4C2M B;  2DY8 A;  4DR3 L;  1NBW A;  4LF6 L;  2CFM A;  2PQA A;  2J7Z A;  1C9O A;  3BZD B;  3A54 A;  3MA2 B;  1B2T A;  2KHJ A;  3QOL A;  4XQN A;  1H9R A;  1YIT A;  4QIW E;  3TN2 A;  2PQA B;  4HIO A;  3AB9 A;  1PTO H;  1I4P A;  3NSW A;  2Z9H A;  1DZ1 A;  1BBU A;  5JVG 3;  3RR5 A;  5FLX E;  1HR0 Q;  2JQO A;  1JB7 A;  5DM6 3;  1XNR L;  4IPG A;  5IP7 H;  2JN4 A;  4C3J H;  1X6O A;  4KN4 C;  4CJ1 B;  3NWS A;  3CMA A;  4HJ9 A;  2EVB A;  2KEN A;  4XDX A;  2MNA A;  3P1H A;  2N3S A;  2NTS A;  4A3D G;  4HIM A;  1FGB D;  4IFD J;  4A3E H;  4GKJ Q;  1RCV D;  1QCB D;  3CCE A;  4DV7 L;  5C4X G;  1F2Z A;  5C6A A;  2RVL A;  1I94 Q;  2R92 G;  4WFN 3;  4X62 L;  2L9H A;  3UE0 A;  3M3Y H;  4EQO A;  4X64 Q;  2MP1 A;  3HEJ A;  1EOT A;  4A3K B;  1B44 D;  5M9O A;  4HJA A;  1XNQ Q;  1YJ9 A;  2JA7 B;  2WB1 G;  4JVZ A;  3F8T A;  4EX5 A;  3KJO A;  1I50 B;  1T9H A;  3KDF A;  4JBW A;  4LFB Q;  4ZK9 B;  5EAY A;  5LMU Q;  2IW3 A;  1IW7 D;  3GV6 A;  4ZAI A;  4BBS B;  4KJN A;  1Y1V B;  3P20 A;  4NKL A;  1CA6 A;  4R4I A;  2RDH A;  3MXN A;  2HIV A;  5KGU A;  5JJZ A;  2K50 A;  3NXW A;  3U58 A;  4XT1 B;  2XGT A;  2BA0 A;  2EZV A;  1GUW A;  5IY0 A;  3S17 H;  2H4O A;  3I8Z A;  2A74 C;  3SGI A;  1VQ8 A;  2R6G A;  2JXM B;  3ERQ A;  3E5S A;  3S15 B;  2I46 A;  2NWG A;  2K1B A;  4ZUI A;  1SFO H;  2MO1 A;  3HOY B;  1M4V A;  5M5W H;  2E75 C;  1V9P A;  2JA6 H;  1JC7 A;  5FO8 B;  3WDN A;  3F1Z A;  3MFY A;  2G9D A;  1RTN A;  4MTN A;  3B6Y A;  1LM0 A;  1TKW B;  2SNM A;  1SNO A;  1K83 B;  4EQ5 A;  3ERO A;  2Q8T A;  5DEH A;  1G8Z D;  4X65 Q;  1IBM L;  2NB0 A;  4DU9 A;  4KHZ A;  1YNJ D;  2ALY B;  2LSS A;  4QMG A;  2UU9 Q;  1SNQ A;  3CCQ A;  3I55 A;  1L0Y B;  4LF7 Q;  3HOV G;  1UWV A;  5KRU A;  1ZEQ X;  5LMN Q;  3HOW H;  3HOX B;  3HOU H;  5IYB G;  3F2B A;  3URY A;  2E5L Q;  3NK9 A;  1TY0 A;  2VUM H;  5ISR A;  2KVM A;  5ELE A;  3K81 C;  3HGB A;  3SEB A;  2X6L A;  2F0E A;  1LT6 D;  1VQB A;  2ZXR A;  1YVC A;  5C5M A;  1OXX K;  3MXP A;  2QCP X;  2KEE A;  1YJN A;  4NMZ A;  1BBX C;  3S2D B;  3G71 A;  3EA6 A;  3H0G H;  4NXN L;  3T16 A;  3S14 B;  2B2V C;  1RF2 D;  4GOP B;  1XPO A;  3KFU A;  4YWL A;  3C2P A;  1OO9 B;  2F0J A;  3CHB D;  3QR8 A;  3NBI A;  4O1N A;  2HHH L;  4DNT B;  5EPJ A;  5K36 G;  4N9P A;  1RTO A;  1S72 A;  5C3E H;  5J22 A;  4QUF A;  3MZ5 A;  2L5T A;  1SR3 A;  4DNI A;  4QL5 A;  1ILP A;  2IX1 A;  3A7L A;  1EQT A;  5D14 A;  1FR3 A;  4M1U B;  1STN A;  3OMG A;  2E2H H;  1QNK A;  3C1E A;  3FRP B;  3DMU A;  5IP9 H;  1I6H B;  4JI8 L;  3CME A;  2ZXO A;  4V0B A;  3QJY A;  1BVS A;  3W3A A;  2YU9 B;  4A3C H;  4LNQ A;  1C48 A;  3UI2 A;  2ZTD A;  4DK3 C;  4P2C B;  1HQM C;  3AFP A;  4X3K A;  3TBI B;  1X9N A;  4A3G H;  1PFB A;  2MGS A;  1NUC A;  1WCM G;  5BN4 A;  1ROD A;  1EWH A;  4PV1 C;  1UUP A;  3ND8 A;  4CGY B;  4A3M G;  1B8A A;  4AQY Q;  3GTQ B;  1B9M A;  2WV6 D;  3H09 A;  1A0I A;  3CU7 A;  1X3P A;  2LXK A;  4PNY A;  1OXU A;  5IGD A;  3T1H L;  3LGJ A;  1G91 A;  5ELD A;  1YIJ A;  1VQJ A;  4R4C A;  2PZT A;  1BCP D;  4HSV A;  4NPS A;  3ERS X;  3JAM L;  3K59 A;  3LWU A;  2EE1 A;  4J8Q A;  2I0Q A;  1IW7 C;  2CKZ B;  3I91 A;  3R3O A;  4A3B H;  1GUT A;  1A2T A;  2D9U A;  2B63 G;  1QVG A;  4DK0 A;  4IUP A;  3DLL A;  1JB3 A;  3K8A A;  3BDC A;  3KOJ A;  1SXT A;  4IFD I;  2RCF A;  1XMQ Q;  3BG3 A;  3QOJ A;  2PNH A;  5M5X H;  2RKS A;  1PYB A;  4XQJ A;  4A3F B;  5IGF A;  1MKH A;  1IYU A;  4QF4 A;  2R3Z A;  1Z47 A;  2QIL A;  3KLS X;  2J4X A;  3D3R A;  3GQB A;  3G48 A;  1PTO D;  2UXD L;  2Z4H A;  3AQQ A;  4JI2 Q;  1K0R A;  1I94 L;  5CYU A;  3KLS A;  1L1O C;  1IKL A;  1Y8N B;  5GQO A;  3HG9 A;  1EU4 A;  3KF6 A;  2KCN A;  4ZUJ A;  3RMH A;  4L8J A;  4HID A;  5EBC A;  1YNJ C;  2K52 A;  4A3J H;  1D8L A;  2NZO A;  2EY2 A;  4B08 A;  4BS9 A;  5C44 H;  1BCP F;  1ZXT A;  1YHA A;  2EY1 A;  2UUA Q;  5EQ0 A;  3E6Z X;  3ZJY C;  1CZG A;  1B3A A;  4KI0 A;  2WKD A;  4R4Q A;  3T1Y Q;  4ZKB B;  2K5V A;  4K6D A;  1LT5 D;  1JOK A;  1SNM A;  3D6W A;  1HNW L;  4HCE A;  4ID6 A;  2HQE A;  2B2U C;  3RZD B;  1KHI A;  2AKW B;  5FKA C;  2K33 A;  2MPM A;  1TWF B;  3K0X A;  1F9Q A;  4QIW B;  4X3U A;  1V8Q A;  4GLV B;  2NZH A;  2K7V A;  4JC0 A;  1Q82 C;  3UE1 A;  1TII D;  2CH4 W;  2PI2 A;  3JAM c;  1VQ7 A;  2PQE A;  3DXJ C;  1PZK D;  5GAH C;  4JI0 Q;  5JJL A;  3CCJ A;  5BR8 L;  5JPN C;  1J6Q A;  1CT1 D;  2PPB C;  2YTV A;  3GTK H;  3I4M H;  1BF4 A;  4A76 A;  1AFP A;  1E24 A;  1GHJ A;  4RFB A;  1K9M C;  1PTO F;  3NWT A;  3NE5 B;  1SJH D;  3PUY A;  3PUW A;  5D3I B;  1A8V A;  2JP1 A;  2M2L A;  1RD9 D;  2R93 G;  4UHV A;  2VS1 A;  3V2T A;  3OTO L;  1QNU A;  1TWH H;  1O7I A;  4QB4 A;  1LTL A;  4DR1 Q;  1ONL A;  3OWF A;  4WJW A;  1DYQ A;  2F4V L;  1LTG D;  3A7A B;  3N6R A;  5KYI A;  5G3L D;  3D4D A;  1UE5 A;  2JEA I;  3OW2 A;  2A68 D;  4JOI A;  5TSS A;  2N49 A;  2V1C C;  4P74 A;  1B7Y B;  5LMN L;  2FMC A;  1A6X A;  4FNF A;  2NN6 H;  4DFA A;  2FMM A;  1M1K C;  2WAQ E;  2F0K A;  1TS3 A;  2F0L A;  5ELF A;  1PFS A;  4CJ0 B;  2NBF A; 
#chains in the Genus database with same CATH homology
 3I56 A;  3PF4 A;  4IPC A;  3GTJ H;  2ASB A;  2ZJQ A;  2VW9 A;  1VQC A;  2YV5 A;  1N8R C;  2JA5 H;  1E7Z A;  1G29 1;  2Q2I A;  2RF4 A;  2WAQ G;  2MQH A;  4JI3 Q;  2Z6K C;  4YCV A;  1PH9 A;  3BU2 A;  5FLX c;  3J81 i;  3PIP A;  3PO2 H;  1GVP A;  4JI5 Q;  5BR8 Q;  1Q8K A;  1J5E L;  5GAG C;  1YJW A;  1HR0 L;  4A3D H;  1VQA A;  1VQD A;  3E9H A;  4UP8 A;  5E7N A;  4JI7 Q;  1EFW A;  4X6A H;  1TWG H;  4DR5 Q;  3M9B A;  3S1N H;  4JBM A;  4LF5 L;  4GN4 B;  1A62 A;  5C4X H;  4LFA Q;  2IT1 A;  4A3F G;  2R92 H;  2KCT A;  2QGQ A;  4O2D A;  2ZJP A;  5AJ3 L;  1VS0 A;  2VZA A;  3A74 A;  4KHP L;  1N32 L;  3J81 j;  3WWV A;  1N36 L;  5GAD C;  2OTL A;  2JA8 H;  3JC6 6;  3RN2 A;  4B3R L;  2B29 A;  2LXJ A;  3CCL A;  1Q81 C;  4TVA B;  1VQM A;  3I4M G;  4GKJ L;  1V1Q A;  4JBK A;  2IY5 B;  3OTO Q;  3GTO H;  1IBK Q;  4DV4 Q;  4JI1 L;  4DV3 Q;  5IWA L;  4BY1 H;  2VL6 A;  2F4V Q;  4XTC S;  2NVQ H;  3PV0 A;  4QJF A;  4POG A;  4OXP A;  4X64 L;  4A93 H;  1EOV A;  3W1G A;  4DR6 L;  1X54 A;  1Q46 A;  2IHF A;  1EWI A;  1PH3 A;  1PH7 A;  3RZO H;  1KL9 A;  2N8N A;  3CCM A;  1LUZ A;  1I50 H;  2Q2U A;  2H5X A;  1XNQ L;  1X3G A;  2YYZ A;  2IHE A;  4YCW A;  1L2F A;  2KHI A;  5JEA G;  1Q7Y C;  4GKK L;  4RMF A;  4DR3 L;  4JYA Q;  1PH8 A;  1NBW A;  4O0A A;  3K7A H;  1IBL L;  4LF6 L;  3KF6 B;  4DV1 Q;  2CFM A;  4B3S L;  4X66 L;  4LFB L;  2PQA A;  1BKB A;  1YNX A;  2UXC Q;  1C9O A;  4BA1 I;  2XTI A;  5LMU L;  3CQZ H;  2KHJ A;  2GN5 A;  4PZ8 A;  4BXX H;  2E2J H;  4L5T A;  4GOP A;  4AQY L;  3HOZ H;  1YIT A;  3NEM A;  4R4O A;  4QIW E;  3L2P A;  4B3T Q;  2PQA B;  1TXY A;  4HIO A;  1HZA A;  3NEL A;  2E2I H;  1Q12 A;  2GVA A;  1PH5 A;  4BA2 I;  1VCI A;  5IYC H;  2K5H A;  1BBU A;  3CCU A;  4JI4 Q;  4IOC A;  2R7Z G;  1SRO A;  3EIV A;  2RCN A;  3RR5 A;  2A8V A;  1CKN A;  2JQO A;  1HR0 Q;  1JB7 A;  2VQE L;  5C4J H;  1XNR L;  4IPG A;  5IP7 H;  1S40 A;  4POF A;  1HNX L;  4LF9 L;  3GTM H;  4C3J H;  4LF5 Q;  2JA5 G;  2L15 A;  2JEB I;  1QVC A;  1X6O A;  2ZM6 L;  3BZC A;  5M3M H;  4UP7 A;  3CMA A;  4P75 A;  4HJ9 A;  5AJ3 Q;  1NMF A;  2KEN A;  4OON A;  1E1O A;  1N36 Q;  1CKN B;  3PO2 G;  2MNA A;  2EIF A;  4B3R Q;  2N3S A;  1FGU A;  2NN6 I;  4LW1 A;  1GO3 E;  4DUY Q;  3S1M H;  4A3D G;  4HIM A;  4IFD J;  4A3E H;  4GKJ Q;  1JJG A;  2VY3 A;  1WYD A;  3CCE A;  1K83 H;  3CP0 A;  4DV7 L;  1XPU A;  1UEB A;  4A3I H;  5C4X G;  1I94 Q;  1I3Q H;  4JI1 Q;  2R92 G;  2BA1 A;  4GS3 A;  2Y0S G;  2WB1 E;  5IWA Q;  4DUZ L;  4X62 L;  1Q1E A;  1NMG A;  4DV0 L;  1QZG A;  3UE0 A;  1SRU A;  4P72 A;  1GM5 A;  3M3Y H;  4X64 Q;  2JA8 G;  1Y1W H;  4FDB A;  5M3F H;  3L0O A;  4MNO A;  4DR6 Q;  2UUC L;  2Q2T A;  3HOV H;  1RL2 A;  3KJP A;  3I4N H;  4X65 L;  4HJA A;  3GDE A;  1XNQ Q;  1SLJ A;  4GKK Q;  1YJ9 A;  2WB1 G;  4BY1 G;  5IYB H;  1KD1 C;  4C2M H;  3F8T A;  1ASY A;  4EX5 A;  4YY3 L;  1PYS B;  3KJO A;  1GKH A;  1IBL Q;  1QVF A;  4LF6 Q;  3KDF A;  1T9H A;  2DUD A;  3PUV A;  1CSQ A;  4JBW A;  4X66 Q;  3HOX H;  2UU9 L;  4B3S Q;  4LFB Q;  3TS0 A;  4LF7 L;  5EAY A;  5LMU Q;  3A5U A;  1Q86 C;  3M4O H;  2RHQ B;  4YWK A;  4LUV A;  3F2D A;  4GOP C;  2OTJ A;  1L1O B;  2E5L L;  2D0P A;  3DM3 A;  3PUX A;  4R4I A;  3CXC A;  4GLX A;  1PA6 A;  3TRZ A;  2B3G A;  2HIV A;  4WJ3 M;  4LUO A;  2K50 A;  3U58 A;  2K14 A;  2XGT A;  2CQO A;  2ATW A;  2BA0 A;  4DKA C;  1UE6 A;  5IY0 A;  3S17 H;  1HR0 W;  1V43 A;  3D31 A;  4K0K Q;  4BXX G;  4BBR H;  2K75 A;  3ICE A;  3ULP A;  4C3I H;  3SGI A;  3PSI A;  4OWT B;  3HOZ G;  1VQ8 A;  2R6G A;  3RLN A;  2VQE Q;  2BH8 A;  4IFD G;  1XNR Q;  4B3M L;  1NJI C;  4APV A;  1HNX Q;  4LF9 Q;  3CCS A;  4DV2 L;  3UDF A;  1PVO A;  2OWO A;  5C0X J;  2ZM6 Q;  5IYC G;  1SFO H;  2MO1 A;  1VQ6 A;  1UE7 A;  1YEZ A;  3CF5 A;  5M5W H;  2VNU D;  3H15 A;  1FVI A;  1V9P A;  2AWN A;  3T1Y L;  3GO5 A;  2JA6 H;  1U0L A;  1IL2 A;  1RIP A;  5IP7 G;  1DGS A;  3CD6 A;  3F1Z A;  4P71 A;  4J15 A;  2QEX A;  2KBN A;  1KC8 C;  3EN2 A;  4DV7 Q;  4TQU S;  1K8A C;  1X65 A;  5M3M G;  1N34 L;  4LF4 L;  3TQY A;  4DUZ Q;  5C3E G;  4X62 Q;  1KRS A;  4DV0 Q;  3S1R H;  2HQL A;  4DAY B;  4MTN A;  3B6Y A;  1LM0 A;  4EQ5 A;  2NVX H;  2UUB L;  2YU9 H;  2UUC Q;  4R1J A;  4A3K H;  3A5Z B;  4QGU A;  4A3E G;  1CKO A;  4X65 Q;  1EUJ A;  3AFQ A;  1IBM L;  4IPH A;  4A3I G;  1JJC B;  4OX9 L;  1KQS A;  3Q8D A;  4KHZ A;  2JA7 H;  4YY3 Q;  2ALY B;  2LSS A;  1N33 L;  3OYY A;  3GTG H;  1OXV A;  2K4K A;  1WCM H;  1Y1W G;  2UU9 Q;  1G6P A;  5M3F G;  3CCQ A;  4JBJ A;  3U4Z A;  1B70 B;  3I55 A;  4LF7 Q;  3HOV G;  3I4N G;  1UWV A;  1HNZ L;  4A3M H;  5LMN Q;  3HOW H;  3HOU H;  3RLO A;  5IYB G;  4BBS H;  3F2B A;  3U50 C;  3JAM i;  2E5L Q;  4KLK A;  2HT1 A;  1Y1V H;  2VUM H;  2UXB L;  3FKI H;  3HOX G;  1VQO A;  1EIF A;  3K81 C;  4IJL A;  2MFI A;  1VQB A;  4YHH L;  1E3P A;  1KAW A;  2VQF L;  1X3E A;  1PH6 A;  4NB3 A;  3ULJ A;  1W3S A;  1YVC A;  3J81 c;  1OXX K;  3STB D;  3CCR A;  1M90 C;  1P8L A;  4A75 A;  1YJN A;  1N32 Q;  2ID0 A;  4B3M Q;  3TS2 A;  3G71 A;  4DV5 L;  4DV2 Q;  4AH6 A;  3PGZ A;  4UP9 A;  1PHJ A;  3H0G H;  4NXN L;  4DR2 L;  3S15 H;  1QUQ A;  4GOP B;  3G6E A;  3F2C A;  1J5E Q;  4BBR G;  3GTP H;  1XPO A;  2IX0 A;  3KFU A;  4YWL A;  3HOY H;  1NY4 A;  2D62 A;  4GLA C;  4HJ7 A;  2B63 H;  3W5O A;  4UPA A;  2HHH L;  4YWM A;  2JJQ A;  3M4P A;  5K36 G;  1S72 A;  2PI2 E;  3AYH B;  3K80 C;  5C3E H;  2Z0S A;  2Y0S E;  4KHP Q;  1VQG A;  1QUQ B;  1N34 Q;  1CKM A;  4LF4 Q;  4LWC A;  1SR3 A;  1WI5 A;  2OCE A;  4DNI A;  4QL5 A;  1KIX A;  1MJC A;  3UDX A;  2IX1 A;  1SN8 A;  3K7U C;  2UUB Q;  1YHQ A;  2D0O A;  1YZ6 A;  2JA6 G;  5FLM H;  1NTG A;  1FJG L;  1X56 A;  2E2H H;  1IBM Q;  2ES2 A;  4IOA A;  1G51 A;  3CC2 A;  4L5Q A;  3J80 i;  5IP9 H;  4OX9 Q;  4JI8 L;  3CME A;  1XJV A;  4A3C H;  1BVS A;  4LNQ A;  4JI3 L;  1XMQ L;  1IYJ B;  2WP8 J;  2K5N A;  2ZTD A;  3KYH C;  3A0J A;  4DK3 C;  3AFP A;  4JI5 L;  4A3G H;  1X9N A;  5LMN W;  1C0A A;  4A3K G;  3RN5 A;  3S2H H;  1HNZ Q;  1K73 C;  4DR3 Q;  4JI7 L;  1AH9 A;  5M5Y H;  3KF8 B;  4JCV E;  2JA7 G;  1LYL A;  4LFC L;  2UXB Q;  3BZK A;  5JJI A;  3CAM A;  1WCM G;  3IRB A;  2I5H A;  2N78 A;  4YHH Q;  1SE8 A;  2VQF Q;  1QZH A;  1JMC A;  2AHO B;  4JV5 L;  4A3M G;  1B8A A;  4AQY Q;  3HOW G;  3HOU G;  4BBS G;  3KDF B;  4JI2 L;  1VQN A;  4A3L H;  2CCZ A;  1Y1V G;  4NXM L;  3MEF A;  3FKI G;  3NEN A;  2VUM G;  3CC4 A;  1A0I A;  3S2D H;  3M85 A;  2LXK A;  1K3R A;  1PH2 A;  4NXN Q;  4DR2 Q;  5IYD H;  1OXU A;  3T1H L;  3LGJ A;  2ZJR A;  3S14 H;  2F3I A;  3E9I A;  2NVY H;  3MXN B;  1WOC A;  1YIJ A;  1VQJ A;  4R4C A;  4JI6 L;  4PMW A;  5H1S E;  2I5L X;  4NPS A;  4R4T A;  3ERS X;  2HHH Q;  2NVT H;  4QY7 A;  4A4I A;  2I0Q A;  2UUA L;  2CKZ B;  4IPD A;  3H0G G;  1OTC A;  4DR4 L;  3RNU A;  4A3B H;  4H02 A;  1U5K A;  1Z9F A;  3HKZ G;  4MZ9 A;  3HOY G;  3I2Z A;  4GNX C;  1HZB A;  1UE1 A;  5DLQ E;  3I4O A;  5JEA J;  1XMO L;  1QVG A;  1VQ4 A;  2B63 G;  2EXD A;  2ZTE A;  2OQ0 A;  3VDY A;  3DLL A;  1FJG Q;  4P73 A;  3J7A 5;  4B3T L;  3K8A A;  5JJK A;  1WFQ A;  4IJH A;  5GRO A;  3KOJ A;  4JI8 Q;  1H95 A;  4IFD I;  1I6H H;  1OXT A;  4LUZ A;  4DAM A;  4DV6 L;  3UDI A;  2F52 A;  4AIM A;  3CPW A;  1XMQ Q;  2PNH A;  4HJ8 A;  4BY7 H;  1TWA H;  5HY6 A;  3KLW A;  5J3B A;  5M5X H;  1VQF A;  1VQP A;  4JI4 L;  4UY8 C;  5FLM G;  3H3V H;  4HIK A;  1VQL A;  5IE8 A;  1PYB A;  3CCV A;  1CUK A;  4OWW B;  5GAE C;  1MJE A;  5IP9 G;  3J7Z C;  3GD7 A;  1MKH A;  5FJ8 H;  4A3C G;  1PFS A;  2QA4 A;  1IXR A;  2HIX A;  1S3O A;  4LFC Q;  1C7Y A;  4JI0 L;  1Z47 A;  3L7Z C;  4A3G G;  1Y14 B;  4IO9 A;  2R93 H;  1XTD A;  4DUY L;  3G48 A;  4JV5 Q;  2UXD L;  1EQR A;  1AE3 A;  3AQQ A;  4OWX B;  3GTL H;  2MO0 A;  2OQK A;  1K0R A;  4JI2 Q;  2AMC B;  3GTQ H;  3S1Q H;  1I94 L;  4NXM Q;  1L1O C;  1EQQ A;  5C0X G;  5GQO A;  3KF6 A;  4AYB E;  1Q1B A;  4OO1 G;  4JOI C;  3W1B A;  4HID A;  3M4Q A;  2K52 A;  3HKS A;  3T1H Q;  4A3J H;  1D8L A;  2NZO A;  1EIY B;  4L5R C;  4JG2 A;  4DR1 L;  3S24 A;  2E8G A;  3PIO A;  4JI6 Q;  3M7N A;  5C44 H;  4A3L G;  4WJ4 A;  1GD7 A;  3TRE A;  5ELO A;  1N9W A;  2I5M X;  1YHA A;  3PO3 H;  2UUA Q;  1A63 A;  4AYB G;  3U4V A;  4DR4 Q;  3ZJY C;  2Q2H A;  5IYD G;  1ASZ A;  2JE6 I;  4KI0 A;  4R4Q A;  1CSP A;  4DR7 L;  3T1Y Q;  1L0W A;  1EYG A;  2K5V A;  5C0X I;  1I5F A;  1MIU A;  3D0F A;  4QQB X;  1XMO Q;  1JE5 A;  1XPR A;  4GN5 A;  1YI2 A;  1HNW L;  4OO1 I;  2CWP A;  2KCM A;  4LF8 L;  1BBW A;  1E22 A;  1HZC A;  3STB C;  1VQ9 A;  2PMZ E;  1KHI A;  2AKW B;  4ME3 A;  4HJ5 A;  2R7F A;  4A3B G;  2NN6 G;  2R7D A;  1X3F A;  2RHS B;  3ULL A;  4DV6 Q;  3E0E A;  3K0X A;  2CWA A;  4GNX A;  4K0K L;  3PCO B;  3UDG A;  4L5S A;  3CW2 C;  4GLV B;  2NZH A;  4JC0 A;  5IT9 c;  1Q82 C;  3EBE A;  1JJ2 A;  3UE1 A;  1HH2 P;  2PI2 A;  4XIG S;  1KXL A;  3JAM c;  1VQ7 A;  4A3F H;  1N33 Q;  2FXQ A;  1JT8 A;  1SMX A;  5GAH C;  1K8G A;  3PF5 A;  3CPF A;  2Z6K A;  3I7F A;  4GNX B;  4JI0 Q;  5JJL A;  3CCJ A;  5BR8 L;  4BY7 G;  1X55 A;  1J6Q A;  4PZ6 A;  2YTV A;  3FHW A;  4RG1 A;  4Y7N H;  4ALP A;  1TWC H;  1PH1 A;  3GTK H;  4PG3 A;  1AE2 A;  4C3H H;  4A76 A;  4DR5 L;  3I4M H;  1E24 A;  2UXD Q;  4LFA L;  1K9M C;  3AEV A;  2EQS A;  5FJ8 G;  2YTX A;  4PZ7 A;  3ER0 A;  1VQH A;  3PUY A;  3PUW A;  1A8V A;  1OXS C;  2A1A A;  1VQK A;  1YHB A;  3S16 H;  3TEH B;  2R93 G;  2VS1 A;  2GVB A;  2YTY A;  3OTO L;  2WFW A;  1E1T A;  1TWH H;  1O7I A;  4DV4 L;  1R9T H;  1IBK L;  4DV3 L;  1LTL A;  2DGY A;  5HGQ A;  4DR1 Q;  3H3V I;  1W2B A;  2F4V L;  2ZTC A;  1L1O A;  4DV5 Q;  1UE5 A;  4A93 G;  2JEA I;  3OW2 A;  3CC7 A;  1VQ5 A;  3FP9 A;  4JOI A;  1P16 A;  3PUZ A;  3HKZ E;  4GN3 B;  4A3J G;  2JA9 A;  2N49 A;  4DR7 Q;  2V1C C;  4P74 A;  4JYA L;  1B7Y B;  5LMN L;  5C44 G;  1IZ6 A;  1NE3 A;  5ELN A;  3G4S A;  4DV1 L;  1PV4 A;  1HNW Q;  1HZ9 A;  4LF8 Q;  3RLF A;  2BH2 A;  2UXC L;  3J80 c;  3PO3 G;  1VQI A;  4DK6 C;  3RZD H;  1D7Q A;  2JK8 A;  2AWO A;  3NBH B;  1VQE A;  3HFZ B;  1HJP A;  2WAQ E;  1PH4 A;  4DPG A;  2C35 B;  1M1K C;  4Y52 H;  1WJJ A;  1YBY A;  1FL0 A;  2A19 A;  1KRT A;  2R7Z H;  4YCU A;  3BJU A;  1TWF H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...