3FKIH

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
136
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fkiH00
4LF7Q 1TWHH 3STBC 2R7ZH 2ZJRA 5C0XG 4R4IA 2YV5A 1KRTA 3SGIA 2RHQB 1VQLA 1VQJA 2BA1A 1K83H 3BU2A 5GROA 2D0OA 4DV3Q 4OX9L 4BBSH 1N33L 1XNQL 4IJHA 1CSQA 3K7AH 1XPOA 2PI2A 5IP9H 2C35B 3K7UC 4A3JH 4DR7Q 1LTLA 3FKIG 4K0KQ 4JC0A 3UDFA 4BY1H 4IO9A 3NEMA 2Y0SE 4IJLA 4QIWE 2VQEQ 1B7YB 4KHZA 3GTKH 1M90C 4DUYQ 3EBEA 3UE1A 1FJGL 4LFCL 5GAHC 4X64L 4AH6A 1X65A 1BBWA 4GNXC 1X3EA 2CQOA 1YJNA 1C7YA 3ICEA 4P72A 2Q2IA 2JA7G 4B3RQ 2ZM6L 1Q86C 4O0AA 1VQEA 2IX1A 4JOIC 1SMXA 2K14A 3M4OH 4BY7H 2B63G 1AH9A 2VQFL 4A3IG 4JI3Q 3I7FA 1Y14B 4KHPL 3CC4A 4OX9Q 3JAMc 1QUQB 1X6OA 2MQHA 4LFAQ 5EAYA 5FLMH 2NVTH 1Z9FA 3M4QA 1PVOA 1MJCA 1XNQQ 3CCVA 2R6GA 2F3IA 4A3LH 2QGQA 5C0XI 4BXXG 1SLJA 2E5LL 4GS3A 3RZOH 4IFDJ 1UE6A 4HIMA 2MO1A 5E7NA 1HR0L 2I5HA 5JEAG 3CMAA 3M9BA 3S24A 4C3HH 4FDBA 3DM3A 3OTOQ 3J7A5 3J80c 4A76A 1E24A 1S3OA 3K8AA 4DV7L 1YJWA 4DR3L 1XNRQ 5LMUQ 4JI4Q 1BBUA 1X9NA 1YEZA 1UE1A 4AYBG 2ZM6Q 2ZJQA 1NY4A 2JK8A 1YI2A 1A8VA 3AFQA 3T1YL 2VY3A 1Q81C 3CCLA 2MO0A 3W1BA 2ES2A 2VQFQ 5IP9G 2K75A 4KHPQ 3FHWA 2DUDA 3HOXH 4A3JG 1G6PA 2FXQA 1IBMQ 4A3GH 2EQSA 2YTVA 3GD7A 5IP7H 4BY1G 1K8AC 1VQMA 4O2DA 4PMWA 1Q46A 4C2MH 2UXCL 5ELNA 3J80i 3HOZH 1SE8A 2LXJA 3L0OA 4X65Q 3E9HA 4BA1I 4B3ML 3RN5A 2BH2A 1VQ4A 1EIYB 4JI0L 3G6EA 4B3TL 2KCTA 1XTDA 1HR0Q 4GN4B 5HGQA 4B3SL 4OWWB 4YCUA 4PZ7A 1VQ6A 3LGJA 3AFPA 3KF6A 4LF5L 4A93H 1OXUA 4JI2Q 1PYBA 2WP8J 1EOVA 3A5ZB 1VQDA 5J3BA 4BY7G 4GNXB 4HJ7A 2QEXA 4MNOA 4QGUA 4L5QA 4DK3C 3PGZA 3GO5A 1EWIA 3PCOB 2UUBQ 3GTGH 3DLLA 1C9OA 3CPWA 4IPCA 4ALPA 3EN2A 4LFBQ 1GD7A 4LF7L 1E1OA 3M85A 1VQOA 2JEBI 1CUKA 1D7QA 2JA7H 4A3LG 1IBKL 2LXKA 2MNAA 2E2JH 3I4NG 4DV3L 3I2ZA 3A0JA 1UEBA 2ZTDA 3PSIA 4A3IH 3D31A 3ULJA 3A74A 4POFA 4HIKA 1VQKA 4DAYB 2WAQE 4DR7L 3CF5A 4B3MQ 2KHJA 4K0KL 2R93H 3K0XA 1AE2A 2DGYA 2JA8H 2H5XA 2VQEL 1HZ9A 3GTJH 1EQQA 3OW2A 4BXXH 1G291 4JCVE 5DLQE 2D0PA 2K5HA 4P71A 4DUYL 4B3SQ 1PA6A 4WJ3M 1MIUA 2K5VA 4PZ6A 4DV0Q 1VQGA 3M4PA 4WJ4A 1OXVA 1RIPA 4DV1L 3H0GG 4A3KG 1YZ6A 1WOCA 2I5LX 3GTQH 2IY5B 3TRZA 5AJ3L 3RLFA 1KAWA 4YWMA 4B3RL 5JJLA 2WB1E 2YYZA 2LSSA 1JJ2A 2XTIA 1VQFA 3S2DH 4DUZL 3HOXG 1YVCA 4A3DH 1T9HA 1S72A 1IXRA 1I3QH 5IP7G 3VDYA 1Q82C 1PH9A 2AWNA 1BKBA 1XMOQ 4JI3L 1IBKQ 1PHJA 3HOZG 5IY0A 4GOPA 2UXBL 5M5YH 4LFAL 1JT8A 2CKZB 1U5KA 3ULLA 1X54A 3HOWG 4GLAC 1R9TH 2F4VL 1TWGH 2JQOA 3S1QH 1HNZL 2UUAQ 4HJ8A 1YHBA 2XGTA 4YWLA 2D62A 3F2DA 1P16A 4APVA 1XJVA 4JI7L 1D8LA 5M5WH 4A93G 3KDFA 3RNUA 2HQLA 2NVXH 1E3PA 1LUZA 2CWPA 4GLXA 4JI1Q 1W2BA 1YBYA 4JBKA 5IT9c 1Q8KA 1A0IA 1WYDA 2RF4A 4YHHQ 3OTOL 1VS0A 2Y0SG 4DV4L 2QA4A 1HZAA 2VZAA 4IOCA 1QZHA 2Q2UA 1PYSB 4A3GG 1XNRL 3TREA 4DV1Q 1TXYA 5LMUL 4JI4L 4BA2I 1V43A 3F8TA 3IRBA 5AJ3Q 3J7ZC 3K80C 4JBMA 5IYBH 3UDXA 1CKNA 1FVIA 2PQAA 4NPSA 1L2FA 4JI8L 4DUZQ 4LUZA 3TS0A 3J81c 4TVAB 2GN5A 2N3SA 4OONA 3STBD 2K4KA 3CW2C 5ELOA 1LYLA 3T1HQ 3G71A 1M1KC 1OTCA 2ASBA 1HH2P 2UXBQ 4PG3A 2UUCL 1IBML 1OXSC 1HJPA 2R93G 1PH5A 3HOYG 4GKJL 1Q1BA 5IWAL 4JG2A 2JA8G 1NJIC 2F4VQ 3I4NH 4LF9L 1HNZQ 1N32L 4X65L 2YTYA 4JV5L 4NXNQ 1S40A 4JI7Q 2VW9A 4GOPC 1G51A 2OQ0A 3BZKA 3PF5A 1I94Q 2R7DA 3J81i 4X6AH 1IL2A 1VCIA 2ID0A 2OWOA 1PH3A 1TWCH 1WI5A 3KJOA 5C0XJ 4A3CH 4DV4Q 4JI2L 3RLNA 3PUXA 4R4OA 1QVGA 4A3DG 1L0WA 2YTXA 3W1GA 2CCZA 5FJ8G 4QL5A 3HFZB 4JI5Q 4R4QA 1CKMA 2JJQA 3JC66 3W5OA 4JI8Q 2UUBL 3CD6A 1GM5A 1BVSA 1X55A 3H0GH 4A3KH 1NBWA 3RLOA 1HR0W 3L2PA 4LFBL 1XMQQ 3S1NH 3CCSA 3I4OA 3KF6B 5LMNQ 3BZCA 2ZJPA 1NMFA 1P8LA 1WCMH 2UUCQ 2MFIA 1Y1WH 5C44H 4GKJQ 5IWAQ 1KC8C 3OYYA 1LM0A 4A3FH 2E2IH 3KJPA 4LF9Q 1N32Q 4RMFA 3HKSA 4QJFA 3E9IA 4JV5Q 2OTJA 4R1JA 4A3MH 1QUQA 3HOWH 2B3GA 4HIOA 3Q8DA 3PUYA 2CFMA 2OCEA 4BBRG 3RN2A 1KXLA 4J15A 4JBWA 4C3IH 2IX0A 4HJ9A 4A3BG 2HIXA 2EIFA 5IYBG 4LNQA 4QQBX 1NTGA 4DV0L 1XPUA 4A3EH 4JYAQ 1HNWQ 5H1SE 4DAMA 1OXXK 1VQHA 5C3EH 1SROA 4P75A 2NN6G 4RG1A 1PH1A 3HOVG 3KYHC 4GKKQ 2VS1A 4OXPA 3S1RH 2OTLA 3GTOH 1MKHA 2Z0SA 3UDIA 3CCRA 4X66L 1EYGA 1N36L 4DR6Q 3U50C 5GAEC 1XMOL 3PF4A 4XTCS 1PH7A 2YU9H 1X3GA 1H95A 1HZBA 4YCVA 3G4SA 4HIDA 3FP9A 4L5TA 3ULPA 1O7IA 1YHAA 4IPGA 2JE6I 1WFQA 2UUAL 2ATWA 3PO2G 1HNXQ 2IHFA 2GVAA 5FLXc 3H15A 1MJEA 4A3CG 3HOYH 3EIVA 4AIMA 1JJGA 1VQCA 3HKZE 3KOJA 4R4TA 1SRUA 4GOPB 2WAQG 2HHHQ 1VQNA 2L15A 4JI1L 2WFWA 3AQQA 5HY6A 1YIJA 4YHHL 1J5EQ 1Z47A 1VQ7A 1KIXA 3CAMA 2UXDQ 1A62A 2AWOA 2E8GA 2VL6A 2I0QA 3KLWA 1PH8A 4ME3A 4MZ9A 1WCMG 4X62Q 4X66Q 1Y1WG 3E0EA 5FJ8H 3B6YA 5C44G 1N36Q 2NN6I 4LF8Q 5C4XG 2WB1G 1FL0A 3ER0A 3NBHB 4C3JH 4A3FG 2E2HH 3T1HL 5JJKA 4GNXA 1TWAH 3PIOA 4UY8C 2ZTEA 3F1ZA 3G48A 5M5XH 2CWAA 3I55A 3CCUA 4LWCA 4A3MG 4L5RC 4LF6Q 1GKHA 1KD1C 1X56A 1IYJB 4L5SA 1KRSA 4NXNL 1EFWA 3WWVA 1HZCA 4A3EG 5M3MG 4DR4L 3UE0A 4IFDG 4PZ8A 1I94L 1YNXA 5C3EG 2UU9Q 4KLKA 3F2CA 4DV2L 5IYCH 1OXTA 4LW1A 3GTLH 1JJCB 3PUVA 2Z6KA 2AKWB 3MEFA 4LUOA 5GQOA 1KL9A 4BBRH 4DR1L 2R92H 4JI5L 2BA0A 1PH4A 4A3BH 2AMCB 1Q12A 5BR8L 1VQ8A 2VUMH 4YWKA 4A4IA 3H3VI 3HOUH 1B70B 2A19A 3BJUA 3CCJA 3CCEA 3U58A 2KENA 1XMQL 5LMNL 3HOVH 2K50A 3PO3H 1L1OA 3L7ZC 1TWFH 1N34Q 2PNHA 1I6HH 3TQYA 3S17H 4P74A 1QVCA 1PH6A 3MXNB 1Y1VH 3NELA 1PV4A 1UE7A 1IBLL 4DV6Q 1I5FA 3PIPA 4XIGS 3K81C 4DV5Q 4LF4L 5LMNW 3S14H 4DR4Q 4DR2L 1QVFA 2RCNA 3PO2H 1J6QA 2PI2E 4DV2Q 1KQSA 1W3SA 4HJ5A 1HNWL 4JYAL 2OQKA 4IFDI 2NZOA 4AQYL 4JBJA 1EUJA 2JA9A 4DR1Q 1NMGA 4YCWA 1VQPA 1GO3E 1EQRA 4GKKL 2NZHA 5BR8Q 5GAGC 1GVPA 2B29A 1N33Q 3GTMH 2N8NA 3I56A 3H3VH 2GVBA 1YJ9A 4NXML 4DR5L 4DR6L 2Q2HA 1UWVA 2Z6KC 1X3FA 1XPRA 3AYHB 3U4VA 5IYDG 4A75A 1AE3A 3I4MG 3TEHB 4IOAA 5M3FG 1K73C 3CP0A 1PH2A 2K52A 5C4XH 4IPDA 4KI0A 4YY3L 2JA5G 4LFCQ 1K3RA 4MTNA 1Q1EA 4POGA 4DPGA 1FJGQ 4OO1G 4AYBE 3CCQA 2JA6H 4X64Q 1HNXL 3S2HH 5IYCG 3JAMi 1WJJA 2HT1A 1IBLQ 1L1OC 4LF4Q 2R7ZG 3S1MH 2HHHL 4DR2Q 4JI6L 2R92G 4GN5A 4OWXB 1RL2A 1ASYA 2R7FA 1K0RA 1U0LA 1EIFA 3KF8B 2VUMG 4BBSG 1J5EL 3CQZH 4OWTB 5M3MH 4R4CA 4AQYQ 3HOUG 2UXDL 4Y52H 1FGUA 4DK6C 3GTPH 2HIVA 1E7ZA 4UP9A 3PO3G 2N49A 3CC2A 4X62L 3TS2A 4LF8L 1UE5A 2E5LQ 4DR5Q 4NXMQ 4NB3A 2PMZE 1QZGA 3RR5A 2KBNA 5IE8A 4HJAA 2A8VA 1B8AA 5JEAJ 1Y1VG 5JJIA 4H02A 5C4JH 2V1CC 2KCMA 4UP8A 2EXDA 1SN8A 4DKAC 4YY3Q 4LF6L 1JE5A 3FKIH 4EQ5A 3NENA 3D0FA 1VQIA 2BH8A 2ALYB 4EX5A 3PV0A 1A63A 2N78A 4DV7Q 2VNUD 4DR3Q 3CPFA 3ZJYC 1N8RC 4LUVA 4OO1I 1SR3A 4JI6Q 2UU9L 1V1QA 5FLMG 2NVQH 1VQAA 3T1YQ 4GLVB 3HKZG 1YITA 4UP7A 1N9WA 3U4ZA 1K9MC 3CXCA 2JEAI 4IPHA 3M7NA 3KDFB 4DNIA 4TQUS 4UPAA 3AEVA 4GN3B 3PUWA 1VQ9A 2B63H 3UDGA 3GDEA 2UXCQ 4Y7NH 1PFSA 1E1TA 1CSPA 3CMEA 1I50H 2RHSB 3CCMA 2A1AA 2F52A 5GADC 4JI0Q 5K36G 4B3TQ 3RZDH 2JA6G 3PUZA 1Q7YC 1N34L 3CC7A 1JB7A 1V9PA 3J81j 1KHIA 1IZ6A 1CKNB 1E22A 2PQAB 4JOIA 1ASZA 2Q2TA 2ZTCA 1YHQA 1CKOA 3ERSX 4LF5Q 3S16H 3F2BA 2I5MX 1VQ5A 3I4MH 2NVYH 5IYDH 1C0AA 4P73A 5M3FH 3M3YH 2IT1A 2AHOB 3A5UA 4DV6L 4DV5L 1K8GA 1VQBA 3KFUA 3S15H 2JA5H 2K5NA 4QY7A 1SFOH 2IHEA 1L1OB 1DGSA 1NE3A 2KHIA 1JMCA
chains in the Genus database with same CATH superfamily
2ZXOA 5HURA 4LF7Q 1J9OA 4OGQC 5C0XG 4R4IA 3M3YB 2Z6BA 1CFMA 4NMZA 3WOEA 5M9OA 2F0PA 1XNQL 1FNUA 3K7AH 1TWHB 4K6LA 4G7HC 4JVZA 3FKIG 2RSOA 2R92B 3J7AF 4UAIA 4QIWE 2VQEQ 4BBSB 1M90C 4DUYQ 3UE1A 1Y8PB 4LFCL 1BBWA 3D3RA 2CQOA 1YJNA 1B1ZA 1Q86C 4ZCKA 1VQEA 3RD4A 3S17B 1PFBA 3BVZA 2M9VA 4BY7H 1XYIA 4A3IG 1Y14B 3CC4A 4OX9Q 1VF7A 2MQHA 5FLMH 3JAMc 2NVTH 5LHY1 2TMPA 2R6GA 2FHTA 2IW3A 1SNMA 2K7VA 1MSHA 4J1MA 5CBEE 4HIMA 2MO1A 2ICIA 1HR0L 2F0KA 3HKZB 1SNOA 4HAEA 3CRLC 3DM3A 3UI2A 3J7A5 1E24A 4DV7L 2EYFA 4JI4Q 4OIKA 1A2TA 1VMPA 3NK9A 1X9NA 2JK8A 3WOFA 1K8MA 1A8VA 3MXNA 2VY3A 1Q81C 3CCLA 2MO0A 4XT1B 4ZKBB 1AZQA 3VR4A 4XDXA 3HOXH 3BS1A 4A3JG 4A3GH 4K5VA 2EQSA 3GD7A 5IP7H 1VQMA 4C2MH 3OWEB 5C0XH 2UXCL 3TP6A 4X65Q 3E9HA 1EIYB 4JI0L 4B3TL 1HA5A 4L63B 2EVBA 1HA6A 4GN4B 2F1MA 1B3AA 1CZWA 4OWWB 4PZ7A 4X3KA 1VQ6A 3LGJA 3AFPA 3Q24A 1II3A 5EKKA 1EOVA 3A5ZB 1VQDA 1JC7A 4GNXB 4HJ7A 3E0JA 5C4JB 1BCPB 4QGUA 4L5QA 4CDFC 3ND9A 4WJWA 3DLLA 1GD7A 2LXKA 1DXMA 2XN9C 4TKOB 3C1FA 1BR9A 4A3IH 3ULJA 1IYVA 4DAYB 5D3IB 1GUNA 2WAQE 5IGCA 4K0KL 4C3HG 2L1BA 3VR3A 5CMDA 2H5XA 3GTJH 1EQQA 2LFNA 5DLQE 2D0PA 4DGZA 2B63B 2HUGA 4DXFA 4WJ3M 4Y7NB 1MIUA 3MZ5A 4DV0Q 2G9DA 3M4PA 1SNPA 2LMCB 4UDUC 1RIPA 3H0GG 3G7LA 3RLFA 4B3RL 2ZT9C 5EGTA 3S2DH 2XTIA 2DY7A 4DUZL 4A3DH 3R3OA 4QMGA 1BKBA 3HOZG 4GOPA 2JA5B 4LFAL 1X54A 3A8IE 1BUVT 5KGUA 1HNZL 1YHBA 2XGTA 3QB3A 3F2DA 1P16A 1RTNA 1D8LA 4PV1C 3RNUA 4LMQD 1LT3D 2ZXRA 3PIP3 1YBYA 5IT9c 5DM73 1A0IA 1WYDA 1PXUA 1HZAA 1D1KA 3EA6A 2Q2UA 5I2YA 1ML0D 5EBCA 5M5WB 4BA2I 1TS2A 3J7ZC 1LT4D 1CKNA 1FVIA 4NPSA 4JI8L 1L2FA 1X3QA 1A15A 5I9PA 3D4RA 5IGDA 4ZYSA 1LO5D 4OONA 5CV6A 3I90A 2QDLA 2PMZB 1AEXA 3H94A 2UXBQ 4RCOA 1IBML 1PH5A 3HOYG 4GKJL 3U9SA 2PCFB 2JA8G 1NJIC 2F4VQ 3C46A 1N32L 2F0WA 4BY7B 1H9MA 1DOMA 2VW9A 4GOPC 2NVTB 2OQ0A 3BZKA 3PF5A 2R7DA 4B9WA 3J81i 3T13A 1VCIA 2ID0A 4IUNA 3SXHA 2X6LA 1WI5A 4DV4Q 4JI2L 4YIJA 4DXGA 2YTXA 5FJ8G 3NHHA 1CKMA 3TSSA 2EPBA 5EJWA 4J8QA 3H0GH 2B2YA 3L2PA 3CCSA 3KF6B 2MFIA 1H9RA 2BOSA 3VR2A 5A35A 1EIHA 1B4OA 1KC8C 1LM0A 4RMFA 3GQBA 4JV5Q 4R1JA 4A3MH 1QUQA 3DWQA 3T56B 3HOXB 3Q8DA 3PUYA 5FLXL 3I73A 1STBA 4JBWA 4A3BG 4C2MB 2E2IB 2B8FA 4LNQA 1M8AA 1AN8A 2O5IC 1QOHA 4DAMA 1OXXK 1VQHA 1SROA 3HOVG 5LL6S 4ILWA 4GKKQ 3J7AV 4K8JA 1N36L 5CV8A 2F0SA 5F2DA 4IUVA 1H95A 4ZQ3A 2HCIA 4QIWB 3FP9A 2JE6I 2B2YC 2ATWA 2F03A 1HNXQ 2GVAA 1MJEA 3HOYH 5FKAC 2RA4A 4AIMA 5BN5A 2HHHQ 4C1NI 4DK1A 1ICFB 4JI1L 1SE3A 1SNDA 3IFTA 1VQ7A 1A62A 1G8ZD 1BO0A 4LK1C 2VL6A 3EVQA 3KLWA 2PW5A 4MZ9A 3MXUA 4X66Q 1Y1WG 4LF8Q 5FJ8H 3BYYB 2NN6I 1BBXC 3T1HL 4V0BA 1X3PA 1TWAH 3PIOA 2LY7A 3F1ZA 2CWAA 3S2DB 4LWCA 4L5RC 4HMIA 4A3DB 1GOZA 1T5EA 2FFKB 1BDOA 2IWHA 5M5XB 5C3EG 5G3LF 2UU9Q 1BF4A 4FF3A 5IYCH 1JJCB 3MEFA 4RKLA 1PH4A 4A3BH 5T1GA 1VQ8A 4YWKA 3M4YA 3A55A 3BJUA 3CCJA 3HOVH 2X69A 1LTBD 3PO3H 1L1OA 3U9OA 2B8GA 2PNHA 2V4DA 1DYQA 4P74A 1W6JA 3C2PA 4X3TA 4RGTA 4DU9A 1I5FA 2M00A 1B9NA 1TWFB 2EYPA 4LF4L 1ONLA 2RCNA 5JPNC 2NZOA 4JBJA 3MHBA 4RWSC 1EQRA 1HFGA 3J80E 1EFID 2EDGA 5BR8Q 1H9JA 1YJ9A 5KEEA 2K28A 2WAQB 5KYIA 5IYDG 1KAAA 4ZK9B 4RA8A 1EY6A 1G91A 1ICWA 1K3RA 2F0NA 4OO1G 2AQ3B 3CCQA 2JA6H 3A56A 4X64Q 5D14A 3JAMi 3P7JA 2HT1A 3NWSA 1CHQD 1HQMC 1L1OC 5EKLA 4DR2Q 1F9PA 4JI6L 2R92G 2PZUA 1RL2A 4BBSG 1SYFA 1SYDA 4HR7B 4R4CA 4A3MB 3I4LA 1V1OA 4DK6C 1EEID 3S1MB 3DM1A 1LTTD 2KEEA 1GHKA 3NTHA 1DM0B 4NXMQ 4CHTB 3CQZB 1QZGA 3RR5A 2L9HA 5IE8A 3GP7A 1WD0A 5JJIA 3I70A 2V1CC 1WTPA 4KD3A 4ZKCB 4F8MA 5BN4A 4YY3Q 3CHBD 1VQIA 2BH8A 4EX5A 2N78A 1EOTA 3CPFA 1N8RC 3VA7A 4LUVA 1K8OA 1V1QA 4M8AA 1VQAA 3FMCA 4GLVB 3HKZG 3ERQA 1YITA 4CJ1B 2H4OA 3AEVA 3TZUA 2NTTA 4GN3B 4CGYB 3GDEA 4ZUIA 1PFSA 1E1TA 5J1ZA 1FR3A 1I50H 5ELBA 2F0OA 1LTAD 3RZDH 2MGSA 3J81j 4CDDC 1E22A 2PQAB 4JOIA 4KKUA 5IYDH 2NVYH 4RGOS 3KLRA 5A2QE 3M3YH 2M2LA 3A5UA 2K5NA 3ITPA 4OO1H 4KN7C 2BDNA 1CSQA 2CH4W 1O7LA 1TWHH 3BDOA 4DF7A 4HEDA 1KRTA 2KEDA 4L6TB 1VQLA 4OX9L 4DV3Q 1EYAA 4S3SA 4BBSH 2EOTA 1N33L 2J7ZA 3JAML 1XPOA 1S4ZA 3I72A 1NR2A 4DR7Q 4JC0A 4BY1H 4IO9A 4A3BB 4KHZA 4G7OC 3EBEA 4KK7A 1FJGL 3HP3A 5GAHC 3QOLA 2EJFC 2F0HA 2WKDA 3HOVB 4AH6A 3PO3B 2JA7G 1QNKA 3GV3A 3OMGA 2FINB 4O0AA 4DNRB 3R8BA 1LACA 2IX1A 4JOIC 4DAVA 2K14A 3M4OH 2L0CA 3MFGA 4LJZC 2B63G 4RHRA 4JI3Q 1L0XB 1XWEA 1RDPD 3M4QA 1PVOA 1MJCA 3O13A 3CCVA 2F3IA 5ELEA 2E5LL 1TQOA 4B08A 4IUPA 1C8CA 3QJYA 4RKBA 3G6JB 1LLRD 3PQIA 3CMAA 3RZOB 3J80c 4A76A 5CV9A 1S3OA 2XRSD 1YJWA 3EFXD 1PZID 1UE1A 3QR8A 2MUYA 1YI2A 3AFQA 3VR5A 4EQOA 1LT6D 2JA6B 3W1BA 2MP1A 2VQFQ 3AB9A 5EBDA 2NZ1D 1EU3A 1Q8IA 2FXQA 2YTVA 1K8AC 1STEA 4O2DA 5ELNA 4WORA 1SE8A 1SYGA 1MD2D 1K3BC 1VQ4A 5FO9B 4HTHA 4DFAA 2KCTA 5CYUA 1UEAB 3X3MA 2IX3A 4ODGA 4YCUA 3I91A 1WTWA 4OEMB 1D5MC 5J3BA 1GUOA 1TY2A 4QUFA 4BY7G 2NB0A 4L8JA 5J22A 3PGZA 3PCOB 2UUBQ 3GTGH 3CPWA 1NR4A 3OIPA 4ALPA 3EN2A 2JEBI 1CUKA 2R3ZA 2JA7H 3A0JA 2A73B 1EYDA 3KF8A 1I4RA 3MXGA 3D31A 4POFA 1VQKA 3LNNA 1DZ1A 4ZLTF 4Z9CB 4F88A 2R93H 3NXWA 1AE2A 4H0LC 2DGYA 1HZ9A 2FJ2A 3E6ZX 4J6HA 1G291 5I4DA 3OW2A 2DNEA 1U4PA 4P71A 3VYTA 4B3SQ 1TU2B 1HRJA 3EJIA 2E74C 1I50B 5IT9L 1WOCA 2I5LX 4RAUC 3GTQH 3RZDB 1KAWA 1SE2A 4YWMA 2XSCA 1EY9A 2WB1E 3K6OA 1VQFA 2HDMA 3HOXG 4FYDA 1S72A 5IP7G 2AWNA 2NVYB 3GV6A 4R9WA 1IBKQ 2UXBL 2G5DA 3LWEA 5M5YH 2A74C 1U5KA 3ULLA 2A6HD 2F4VL 2UUAQ 3SK4A 4YWLA 1MGSA 3KK7A 4K2LA 5M5WH 3KDFA 4U68A 2HQLA 5CGKA 2PPBC 3A7LA 1W2BA 2Q8RE 4PQXA 1Q8KA 2RF4A 4YHHQ 3OTOL 4DV4L 1QZHA 1VS0A 3C1EA 1KXLA 2QA4A 4CBVA 3K5NA 4IOCA 1NCVA 1XNRL 1UNSA 3TREA 1TXYA 3D4WA 5LMUL 4BY1B 3F8TA 2ICEC 3IRBA 1V1PA 5IYBH 2NVXB 3IKJA 1I4XA 5ELFA 4XYQA 4TVAB 2GN5A 2N3SA 4KV6A 3TP8A 3STBD 4DAPA 2K4KA 1OTCA 1LYLA 3G71A 2ASBA 2K32A 1HH2P 1Q1BA 1CZGA 3V2TA 1SSOA 3M4OB 1ZYRD 4JV5L 4JI7Q 1G51A 2D2CC 1I94Q 1A6XA 4X6AH 1IL2A 1DD2A 3I4NB 4A3CH 4ZRZA 3PUXA 3RLNA 4A3DG 2PZWA 3W1GA 2QCPX 1ESRA 1MSGA 2RBMA 4RCNA 1RODA 2IJ0A 2GA4B 1TWCB 4FNFA 3MTSA 1BVSA 4LFBL 1NBWA 1S5CD 3NWTA 5LMNQ 1NMFA 1WCMH 2K1BA 4F87A 5IWAQ 1FYCA 1H9SA 2E2IH 2EYOA 3KJPA 4LF9Q 4G4KA 2OTJA 4HIOA 2OCEA 5JOBA 1CI3M 4J15A 1B9MA 2IX0A 2HIXA 1HNWQ 4JYAQ 4A3EH 3KLSX 5IGGA 3ONAB 4P75A 4XYOA 3KYHC 1MI2A 1E0BA 1I4HA 2VS1A 3P20A 4JW0A 5LL6X 3LWUA 1MKHA 3UDIA 3CCRA 4X66L 1EYGA 4DR6Q 2C5CA 1XMOL 3PF4A 1EZ6A 1PFNA 4CKBA 2F0EA 1X3GA 1PDQA 3HGBA 3GTGB 4N8X1 3ULPA 1O7IA 1YHAA 3P75A 4IPGA 1WFQA 2K5DA 2RKSA 2JA7B 2IHFA 3H15A 1IKLA 5BN3A 2YU9B 1JJGA 2VB3X 1HUNA 5TSSA 4GOPB 2WAQG 5HY6A 2DNCA 3OIQA 4UHVA 1J5EQ 2MJ8A 3V05A 1Z47A 1KIXA 1IL8A 2R93B 5EPLA 4QUCA 2AWOA 1L0YB 1CA6A 1R4PB 1F9RA 3E0EA 3MA2B 4GNXA 3GTQB 4HSPA 1SMYD 2CHBD 3G48A 4KD4A 5M5XH 4A3MG 1TS5A 2F0TA 3QO2A 1FNWA 1X56A 1IYJB 2N88A 4C3JB 4NXNL 4L5SA 3WWVA 1HZCA 5M5YB 5C4HA 4PZ8A 1YNXA 1CQVA 4QF4A 3F2CA 5JAVA 2KCNA 1AFPA 1OXTA 3R2TA 4KTAA 1KL9A 2I07B 4JI5L 2BA0A 1B50A 5BR8L 1Q12A 2KECA 1HHVA 3DXJC 3NUCA 4A4IA 3EQLC 5D65A 3H3VI 5L37A 3HOUH 1EYCA 2A19A 4H7BA 3GTLB 1F9SA 1XMQL 2RQXA 3S9WA 1RD9D 4BS9A 1YNJD 1GUSA 4Q0FA 2F0VA 1TWFH 2K5WA 1I6HH 1SYEA 1C48A 1Y1VH 1NAPA 4PMBA 3NELA 1V8QA 4KJNA 4DV6Q 4DV5Q 3QWNA 4XIGS 4KMUC 5LMNW 4FXDA 4DR2L 3SR1A 3OMCA 5JVH3 4IFDI 1X32A 1F2MA 4EGVA 1NMGA 2F0QA 4YCWA 1VQPA 2AUJD 4C56C 4FXKC 1CTMA 4CKCA 1STGA 1GVPA 2EJMA 3PO2B 2GVBA 4NXML 2JP1A 1E2WA 3BVMA 1JICA 1AE3A 3TEHB 1Q90A 1K73C 3GTMB 1PH2A 2K5QA 4YY3L 4LFCQ 1Q1EA 4DPGA 4AYBE 5KIXA 5IYCG 1U4MA 1KDCA 1HPCA 1M4VA 1IBLQ 4HSVA 2OF1A 3S1MH 1WCMB 2WB1B 2EYMA 1U0LA 1EIFA 2HCCA 2F3WA 3CQZH 4OWTB 4AQYQ 2UXDL 2EY1A 3ZYYX 2XNAC 5E4XA 1GXDC 4UP9A 3PO3G 1PYWD 4X62L 3TS2A 1WTQA 2OXPA 4A3EB 1EQVA 5M3MB 2KBNA 2A8VA 5JEAJ 1O78A 3SDZA 4TSSA 2EXDA 4LF6L 4ULLA 5KNBA 3NENA 4HMJA 3PMFA 5IODA 2Q8TA 4R8IA 2VNUD 4DV7Q 1TT2A 3ZJYC 1G6ZA 1B3QA 5FLXE 5IOCA 4CJ2C 1CT1D 2KOLA 4UP7A 1N9WA 3U4ZA 1K9MC 1H9KA 2JEAI 2IL8A 3M7NA 5CORA 2D9UA 4TQUS 4KY6A 4UPAA 1VQ9A 1SYBA 3SEBA 2A6HC 2UXCQ 1LTRD 3CMEA 2WACA 2F52A 1K0SA 4JI0Q 4B3TQ 2JA6G 1N34L 1V9PA 1KHIA 1IZ6A 1AW7A 1ASZA 2ZTCA 4N9PA 1CKOA 4MN3A 2HDLA 4P73A 2IT1A 2AHOB 5EPKA 1VQBA 1L1OB 1DGSA 1NE3A 1E2VA 4IN3A 4ZUJA 1JMCA 3S16B 1QILA 3STBC 2ZJRA 5M3FB 1CHPD 3S15B 2DJFC 1VQJA 3BDCA 3BU2A 2BCOA 2A6ED 4IJHA 5IP9H 2C35B 3K7UC 1ZYRC 1LTLA 3J81E 2R7ZB 4K0KQ 1PZJD 1K83B 2Y0SE 2KCCA 1B7YB 4MIUA 3HOUB 2B2VA 3KBGA 5JVG3 3FRPB 2QEJC 3TP7A 1C7YA 3FVQA 4P72A 2Q2IA 3J80L 4B3RQ 5I6YA 1I6HB 4Q5VA 1Y1VB 1AH9A 2VQFL 5JJZA 3I7FA 4ME5A 1X6OA 4LFAQ 1Z9FA 2ENBA 4A3LH 2QGQA 5C0XI 1SLJA 3RZOH 4IFDJ 1UE6A 3K5OA 1JOOA 2EYHA 3RUZA 3EROA 1E2ZA 1ILQA 3N52A 5E7NA 1SYCA 2IPKD 2I5HA 5JEAG 3M9BA 1O7YA 1HFNA 3W2DA 4FDBA 1DONA 1EY7A 4NP5A 5FO8B 3K8AA 2EE1A 4H13C 4DR3L 1GJXA 1PTOD 2ZM6Q 1PRTD 5CR3A 1VDZA 2R61A 3T1YL 3SK5A 4OL7A 2C9OA 2JN4A 2K75A 4KHPQ 3FHWA 4I7ZC 1G6PA 1IBMQ 1EY5A 4BY1G 3I3CA 2K6AA 4IURA 2KJXA 3L0OA 4BA1I 3RN5A 4X3SA 3G6EA 1QG7A 1PMRA 1ENAA 1XTDA 3T4AC 4B3SL 2Z9HA 3X3NA 2Q8IB 2OT2A 4LF5L 4JI2Q 4A93H 1DOLA 3L9AX 1PYBA 2WP8J 3DWAA 4XXEA 2QEXA 2Z8LA 1BNZA 3D6CA 1S5FD 1ZEQX 5T1IA 4IZ8A 4QB4A 4LF7L 1JR0D 1E1OA 1D7QA 2LKVA 1IBKL 2MNAA 3I4NG 1SMYC 3I2ZA 2OEOA 3PIO3 3A74A 4HIKA 5A2QL 3QIAA 2K01A 3CF5A 4B3MQ 2E2JB 2KHJA 2KUMA 1STNA 2VQEL 4JCVE 3TP5A 4DUYL 2K5HA 2VB2X 4V190 1O7ZA 2K5VA 4PZ6A 1VQGA 4EVOA 1F77A 1OXVA 2IY5B 1YZ6A 5JEAH 3TRZA 2YYZA 4K5XA 1IKMA 1T9HA 1IXRA 3VDYA 2J0TD 1Q82C 1PH9A 1AZPA 1YNJC 4IQZA 1JT8A 3AMUA 2CKZB 4HCEA 1RHPA 2F0UA 2CW0D 4GLAC 3CKIB 2JQOA 1I3QB 2ZXPA 3S1QH 2D62A 5E4WC 5CV5A 4APVA 4AYBB 4JI7L 2BE5D 2EY2A 1ET9A 2NVXH 1TR5A 3M7GA 3VYSA 1I6VC 4RGMA 4JI1Q 4X3UA 1TWGB 3BZDB 1WTOA 3NBHA 4EQNA 3HS0C 3Q6SA 2VZAA 1PYSB 1RF2D 1ILPA 4DV1Q 4JI4L 1V43A 4NW2A 5AJ3Q 4JBMA 5D3DA 3UDXA 2PQAA 4LUZA 3TS0A 2PYKA 3J81c 2B2WA 3NTIA 2E2DC 1BXTA 5ELOA 3T1HQ 1FD7D 2O4XA 1M1KC 3DUZA 1SXTA 1A2UA 4CJ0B 1OXSC 2DJGC 2R93G 2XRQD 5IWAL 2WV6D 3JAME 1HUMA 1JOKA 3I4NH 4O42A 4LF9L 4X65L 1S5ED 1S40A 2QDBA 5FOBB 1XTCD 5CBAE 2OWOA 1PH3A 1TWCH 3KJOA 5C0XJ 1STYA 4CKEA 1L0WA 1DOKA 1PLFA 1QVGA 2CCZA 3LX0A 1BCPD 3HFZB 4MTKA 1WVLA 3L3OC 4C3JG 3JC66 3W5OA 3CD6A 4KY5A 4O1NA 1S5DD 3RLOA 1QJOA 1TY0A 4I7AA 3F2UA 1P8LA 2ZJPA 1JQYD 2UUCQ 5C44H 2KHSA 4JK1C 3OYYA 1KABA 4A3FH 2K05A 5C3XA 4A3KB 3NPPA 3S1NB 1GHJA 3D6WA 2L55A 1ENFA 4BBRG 3QG1A 1SJHD 1W6KA 4HJ9A 2VXWA 5IYBG 1NTGA 4DV0L 1XPUA 3Q23A 5H1SE 5C5MA 3HOWB 2NN6G 4K5WA 5KNDA 3S1RH 3BVGA 4C3IB 3GTOH 2Z0SA 4A93B 3U50C 2B2UA 1PH7A 2YU9H 4YCVA 2Y0SB 2WIIB 1KNEA 2SNSA 2Z1CA 1I4GA 1KDBA 3PO2G 4A3CG 5J39A 3EIVA 1XX8A 1U9RA 1VQNA 5I2XA 1SRUA 3BG3A 4HCSA 1YIJA 1GUTA 1G2SA 2A6EC 2I0QA 1WCMG 2X6GA 2WB1G 3ER0A 4C3JH 5JJKA 2ZTEA 3CCUA 3I55A 1V1PB 2NBFA 3IL8A 1JWSD 1G2TA 1STHA 4JPBW 3C3LA 1EFWA 4A3EG 5M3MG 2EZVA 3UE0A 1ZKOA 1JWUD 4LW1A 3GTLH 3S1QB 3VYUA 2A69D 3PUVA 4LUOA 4BBRH 5IT9E 1DCZA 1F9QA 2AMCB 1I4QA 2VUMH 1Q3LA 1NSNS 3HZXA 2EY5A 4KHVA 1EQTA 2F0MA 1IHZA 3CCEA 5COYA 2NN6H 2NYZD 1QE6A 3T51B 1QB5D 3Q0AA 3TQYA 5IGEA 1LTGD 1QVCA 1PH6A 3MXNB 1BQQT 4K6DA 1PV4A 1IBLL 3PIPA 4DR4Q 2A68D 3DMUA 1PTOC 1PRTC 3PO2H 4DV2Q 1KQSA 1H9SB 2OQKA 4AQYL 2JA9A 4DR1Q 1A3VA 5FK9C 3OOCA 4ID6A 1GO3E 3S14B 4GKKL 2D5DA 2NZHA 3GTMH 2XIWA 2B29A 5JPMC 1N33Q 4XQNA 2N8NA 1QWYA 4P2CB 2Q2HA 2F4IA 5DEHA 3U4VA 4GZYC 1HXYD 4A75A 3I4MG 4IOAA 1HTLD 4U673 5M3FG 2TSSA 2F0DA 2J4XA 4IPDA 4KI0A 3A8KE 2G9HD 1FJGQ 4MTNA 4CDCC 4POGA 3WDNA 2RDHA 1WD1A 1HNXL 3S2HH 4K8IA 2R7ZG 2HHHL 2L11A 5C44B 1EWCA 2MHVA 4GN5A 5C4XB 4OWXB 4A3FB 2SDFA 5M3MH 3HOUG 2EYJA 3TZDA 3MXPA 2DY8A 4RGNA 1E7ZA 3BYTB 2N49A 4IALA 4WFN3 4LF8L 1UE5A 2E5LQ 4DR5Q 1TIID 4NB3A 2H1EA 3CRKC 2HQEA 1QNUA 1S5BD 1Y1VG 3DEPA 1CM9A 2L4NA 4H02A 2QW7A 3RMHA 3GTPB 3S1RB 2KCMA 3GTOB 3DHQA 1SN8A 3D4DA 3FKIH 4EQ5A 5ELDA 3D0FA 3HRZC 2ALYB 3PV0A 4DK0A 2XWBB 4NDXA 3DEOA 4OO1I 4IUTA 1SR3A 2UU9L 2EXZA 1HTPA 2EY6A 1KDAA 2NVQH 1D1IA 2SOBA 4LAAA 1SJED 1DJRD 2RDFA 3BDLA 3CXCA 5C5LA 5K5PA 4IPHA 2HD3A 2CW0C 4DA2A 2B2TA 3SHLA 1WTHA 3CCMA 5K36G 5GADC 4NKLA 1JOQA 2BE5C 4DN4M 3H3VC 1CKNB 4IUQA 2Q2TA 1SEBD 3S16H 1SNCA 3F2BA 2I5MX 4KKTA 4G7ZC 1VQ5A 3I4MH 5M3FH 2BDOA 3KFUA 3S15H 4QY7A 3AU7A 2IHEA 2I46A 5CC4A 1LV9A 4DAYA 2KHIA 2FMMA 2R7ZH 2YV5A 2F3VA 3OW7A 2RHQB 3SGIA 2BA1A 1K83H 4HN7A 5GROA 2D0OA 1SFOB 1WTRA 2PI2A 4A3JH 4BBRB 5E1FA 3UDFA 3NEMA 4CDEC 4IJLA 5DNFA 3GTKH 2VUMB 2B2TC 1F2LA 3K7AB 4I65A 2E75C 1IW7D 4X64L 1F2ZA 1X65A 2O2LD 3TMEA 1X3EA 2Z4IA 4DNTB 1BCPC 4GNXC 3ICEA 1Z6HA 2ZM6L 3P1HA 2CQAA 1SMXA 2JYOA 4K14A 4MHEA 4KHPL 2SNMA 1QUQB 5EAYA 4KKSA 1XNQQ 1TKWB 2QILA 2PQEA 4BXXG 1Y69U 3VYRA 2AUKA 4GS3A 1T5XD 5IIFA 4PNYA 3SVMA 3FPPA 1RKNA 1EIGA 2E76C 2CVRA 1CQFA 1LABA 2F0GA 3MC0B 1NNXA 3S24A 4C3HH 3OTOQ 5K36H 2A5HA 1XNRQ 3T53B 2RCFA 3NTKA 1JWMD 5LMUQ 1BBUA 2ZJQA 1YEZA 4FP5D 4AYBG 1NY4A 3D8GA 2RSNA 2JXMB 2ES2A 3S2HB 4FO2A 5IP9G 1A3TA 2DUDA 1LT5D 1IYUA 5G3LD 4PMWA 1Q46A 5DAUA 3OPOA 3J80i 1C4QA 3HOZH 2LXJA 4B3ML 4PMCA 2BH2A 1UAPA 1EWHA 2L12A 2LS01 4A3GB 1HR0Q 5HGQA 3VA5A 3TBIB 3KF6A 1OXUA 1K28A 1D5XC 5KNCA 5ISRA 3MAQA 2KA7A 4FF2A 4MNOA 4DK3C 3GO5A 1EWIA 1C9OA 2Z4HA 4IPCA 3FKIB 4LFBQ 4F7XA 3M85A 1VQOA 4A3LG 1STAA 2E2JH 3R2IA 1ZXTA 4DV3L 1UEBA 2ZTDA 1YNNC 3PSIA 4N8FA 5EKIA 2NVQB 4DR7L 1JE4A 4OHJA 3K0XA 2JA8H 1HCZA 4BXXH 3HEJA 4QCLA 1RTOA 2B39A 4A3IB 1PA6A 4H44C 2A69C 1BOSA 4WJ4A 1EZ8A 4DV1L 4A3KG 2KVMA 5AJ3L 1EL0A 5JJLA 1PZKD 3GTJB 2LSSA 1JJ2A 1YVCA 2RDGA 1GUGA 1RCVD 1I3QH 3I4MB 3J81L 1XMOQ 3MFYA 4JI3L 1PHJA 5I9OA 2K33A 5IY0A 1JB3A 3ND8A 3HG9A 5EPJA 3SK6A 3HOWG 1U4LA 4IUUA 1R9TH 1TWGH 4E6IA 4HJ8A 4C3IG 3A7AB 1XJVA 4N9TA 4A93G 2A68C 1SNQA 1CA5A 1E3PA 1LUZA 2CWPA 4GLXA 1B44D 4JBKA 1Z7TA 2Y0SG 1ESFA 1LTSD 4A3JB 4FVMA 1O80A 4TRDA 3K80C 4C1NK 3R93A 3GTKB 1D2BA 2K04A 4DUZQ 1B2TA 3Q22A 3CW2C 1OO9B 2QF7A 1D5ZC 4PG3A 4KN4C 2UUCL 1HJPA 4JG2A 2FMCA 1WTVA 2RVLA 4EQPA 4ZAIA 1HNZQ 2YTYA 1TVXA 4XQQA 3KLSA 4NXNQ 3H6MA 2DN8A 2QKIC 4BWGB 3SE0A 5IGFA 1FNVA 2WINB 4R4OA 3K58A 2F0FA 4QL5A 4JI5Q 1MHWC 4R4QA 4B9XA 1RJTA 2JJQA 4JI8Q 4OELB 2UUBL 4WRDA 1GM5A 3K0YA 1X55A 2NUCA 4A3KH 2N55A 2B2VC 4C3HB 1HR0W 1XMQQ 3S1NH 3I4OA 3BZCA 3H09A 1Y1WH 4GKJQ 5HGTA 3H0GB 1N32Q 3OSOA 3J7YW 3HKSA 4QJFA 5DM63 3E9IA 3NBIA 5E3FA 1GUWA 3HOWH 2B3GA 2WKCA 3RN2A 2CFMA 3K59A 4C3IH 4QQBX 2EIFA 4FXGC 3HOZB 1SDFA 1FGBD 5C3EH 4RG1A 1PH1A 4OXPA 2OTLA 5GAEC 4XTCS 1HZBA 3G4SA 4HIDA 1PTOH 4L5TA 1TS3A 2XWJB 5C3WA 2UUAL 5FLXc 3E5SA 5KRUA 1VQCA 3HKZE 3KOJA 4R4TA 4G57A 2L15A 3QOJA 2WFWA 3AQQA 3NQTA 3OHXC 1EY8A 4YHHL 2EYLA 3CAMA 2UXDQ 3HOYB 3IAYA 1R4QB 2JA8B 2E8GA 2EJGC 3CU7A 2CH4A 1B53A 3A8JE 1PH8A 4ME3A 2P5ZX 1AP0A 3MEHA 4X62Q 5C44G 3B6YA 1N36Q 2MPMA 5C4XG 3NBHB 1FL0A 2E2HH 4A3FG 5EQ0A 3VR6A 4UY8C 5AFWA 1PTOF 3E3XA 1PRTF 1EY4A 4LF6Q 1GKHA 2L5TA 1KD1C 1IW7C 1CK1A 1EEFD 1KRSA 1QCBD 5CV4A 2F0LA 2PW7A 1TWAB 4IFDG 4DR4L 4FF4A 1I94L 3N6RA 2F0IA 4KJOA 4KLKA 3T16A 3MVVA 4DV2L 1R9TB 2O5JC 2SEBD 1Y8OB 2Z6KA 2AKWB 4DR1L 5GQOA 3SK8A 2R92H 3KUPA 3OWFA 5ELCA 3K5MA 3K57A 1B70B 3TDQA 5FO7B 3W3AA 4RHSA 2KENA 3U58A 5LMNL 1SE4A 2K50A 1UUPA 3L7ZC 2NTSA 1N34Q 1SAPA 3S17H 1TS4A 1UE7A 1U4RA 3K81C 3S14H 1QVFA 3DWPA 1J6QA 2PI2E 1F2YA 1W3SA 4HJ5A 1HNWL 4JYAL 3IFDA 1EUJA 2F0JA 3A54A 5C6AA 5GAGC 1KLGD 3I56A 3H3VH 4DR5L 4DR6L 1UWVA 2Z6KC 1X3FA 4RFBA 1XPRA 3AYHB 4R8NA 3CP0A 2K52A 5C4XH 4K2KA 3URYA 2JA5G 2B2WC 1SBBB 3H91A 1WTXA 1EY0A 1WJJA 1VF5C 4XT3B 1HQRD 4LF4Q 2KQ3A 3NE5B 1Y1WB 2PZTA 3FPUB 3FDTA 1ASYA 2R7FA 1K0RA 1KTKA 3KF8B 2VUMG 1J5EL 4IFDH 5I6WA 2XVSA 3MWYW 4Y52H 1FGUA 3GTPH 1D6EC 2HIVA 3CC2A 5KYLA 1EU4A 2PMZE 5CV7A 2PO4A 1A3UA 5C3EB 4HJAA 2K03A 1B8AA 5C4JH 4UP8A 4DKAC 1ET6A 3K5LA 1JE5A 3NQIA 4OIJA 3V96A 4RH6A 3NSWA 1A63A 3TN2A 5IGBA 1J8IA 4DR3Q 3KBXA 1JCKB 1MBYA 3FEWX 1LTID 4JI6Q 1PTOB 5NUCA 5FLMG 4KY7A 1PRTB 3T1YQ 2NWGA 4XQJA 1KNAA 4FF1A 1XXGA 1I4PA 2JSOA 2PNRC 1ENCA 3KDFB 4DNIA 3PUWA 1VMCA 2B63H 3UDGA 4Y7NH 1CSPA 2RHSB 1PFMA 2A1AA 5C4ZA 2AQ1B 1BCPF 3PUZA 1Q7YC 3CC7A 3NP8A 1JB7A 1YNND 1YHQA 3ERSX 4LF5Q 2E2HB 3I8ZA 1JORA 1NUCA 1C0AA 2B2UC 1KLUD 1Y8NB 4DV5L 4DV6L 4M1UB 1K8GA 2JA5H 1SFOH 2AQ2B 4ABNA 4A3GG
chains in the Genus database with same CATH topology
4LF7Q 1TWHH 3STBC 2R7ZH 2ZJRA 5C0XG 4R4IA 2YV5A 1KRTA 3SGIA 2RHQB 1VQLA 1VQJA 2BA1A 1K83H 3BU2A 5GROA 2D0OA 4DV3Q 4OX9L 4BBSH 1N33L 1XNQL 4IJHA 1CSQA 3K7AH 1XPOA 2PI2A 5IP9H 2C35B 3K7UC 4A3JH 4DR7Q 1LTLA 3FKIG 4K0KQ 4JC0A 3UDFA 4BY1H 4IO9A 3NEMA 2Y0SE 4IJLA 4QIWE 2VQEQ 1B7YB 4KHZA 3GTKH 1M90C 4DUYQ 3EBEA 3UE1A 1FJGL 4LFCL 5GAHC 4X64L 4AH6A 1X65A 1BBWA 4GNXC 1X3EA 2CQOA 1YJNA 1C7YA 3ICEA 4P72A 2Q2IA 2JA7G 4B3RQ 2ZM6L 1Q86C 4O0AA 1VQEA 2IX1A 4JOIC 1SMXA 2K14A 3M4OH 4BY7H 2B63G 1AH9A 2VQFL 4A3IG 4JI3Q 3I7FA 1Y14B 4KHPL 3CC4A 4OX9Q 3JAMc 1QUQB 1X6OA 2MQHA 4LFAQ 5EAYA 5FLMH 2NVTH 1Z9FA 3M4QA 1PVOA 1MJCA 1XNQQ 3CCVA 2R6GA 2F3IA 4A3LH 2QGQA 5C0XI 4BXXG 1SLJA 2E5LL 4GS3A 3RZOH 4IFDJ 1UE6A 4HIMA 2MO1A 5E7NA 1HR0L 2I5HA 5JEAG 3CMAA 3M9BA 3S24A 4C3HH 4FDBA 3DM3A 3OTOQ 3J7A5 3J80c 4A76A 1E24A 1S3OA 3K8AA 4DV7L 1YJWA 4DR3L 1XNRQ 5LMUQ 4JI4Q 1BBUA 1X9NA 1YEZA 1UE1A 4AYBG 2ZM6Q 2ZJQA 1NY4A 2JK8A 1YI2A 1A8VA 3AFQA 3T1YL 2VY3A 1Q81C 3CCLA 2MO0A 3W1BA 2ES2A 2VQFQ 5IP9G 2K75A 4KHPQ 3FHWA 2DUDA 3HOXH 4A3JG 1G6PA 2FXQA 1IBMQ 4A3GH 2EQSA 2YTVA 3GD7A 5IP7H 4BY1G 1K8AC 1VQMA 4O2DA 4PMWA 1Q46A 4C2MH 2UXCL 5ELNA 3J80i 3HOZH 1SE8A 2LXJA 3L0OA 4X65Q 3E9HA 4BA1I 4B3ML 3RN5A 2BH2A 1VQ4A 1EIYB 4JI0L 3G6EA 4B3TL 2KCTA 1XTDA 1HR0Q 4GN4B 5HGQA 4B3SL 4OWWB 4YCUA 4PZ7A 1VQ6A 3LGJA 3AFPA 3KF6A 4LF5L 4A93H 1OXUA 4JI2Q 1PYBA 2WP8J 1EOVA 3A5ZB 1VQDA 5J3BA 4BY7G 4GNXB 4HJ7A 2QEXA 4MNOA 4QGUA 4L5QA 4DK3C 3PGZA 3GO5A 1EWIA 3PCOB 2UUBQ 3GTGH 3DLLA 1C9OA 3CPWA 4IPCA 4ALPA 3EN2A 4LFBQ 1GD7A 4LF7L 1E1OA 3M85A 1VQOA 2JEBI 1CUKA 1D7QA 2JA7H 4A3LG 1IBKL 2LXKA 2MNAA 2E2JH 3I4NG 4DV3L 3I2ZA 3A0JA 1UEBA 2ZTDA 3PSIA 4A3IH 3D31A 3ULJA 3A74A 4POFA 4HIKA 1VQKA 4DAYB 2WAQE 4DR7L 3CF5A 4B3MQ 2KHJA 4K0KL 2R93H 3K0XA 1AE2A 2DGYA 2JA8H 2H5XA 2VQEL 1HZ9A 3GTJH 1EQQA 3OW2A 4BXXH 1G291 4JCVE 5DLQE 2D0PA 2K5HA 4P71A 4DUYL 4B3SQ 1PA6A 4WJ3M 1MIUA 2K5VA 4PZ6A 4DV0Q 1VQGA 3M4PA 4WJ4A 1OXVA 1RIPA 4DV1L 3H0GG 4A3KG 1YZ6A 1WOCA 2I5LX 3GTQH 2IY5B 3TRZA 5AJ3L 3RLFA 1KAWA 4YWMA 4B3RL 5JJLA 2WB1E 2YYZA 2LSSA 1JJ2A 2XTIA 1VQFA 3S2DH 4DUZL 3HOXG 1YVCA 4A3DH 1T9HA 1S72A 1IXRA 1I3QH 5IP7G 3VDYA 1Q82C 1PH9A 2AWNA 1BKBA 1XMOQ 4JI3L 1IBKQ 1PHJA 3HOZG 5IY0A 4GOPA 2UXBL 5M5YH 4LFAL 1JT8A 2CKZB 1U5KA 3ULLA 1X54A 3HOWG 4GLAC 1R9TH 2F4VL 1TWGH 2JQOA 3S1QH 1HNZL 2UUAQ 4HJ8A 1YHBA 2XGTA 4YWLA 2D62A 3F2DA 1P16A 4APVA 1XJVA 4JI7L 1D8LA 5M5WH 4A93G 3KDFA 3RNUA 2HQLA 2NVXH 1E3PA 1LUZA 2CWPA 4GLXA 4JI1Q 1W2BA 1YBYA 4JBKA 5IT9c 1Q8KA 1A0IA 1WYDA 2RF4A 4YHHQ 3OTOL 1VS0A 2Y0SG 4DV4L 2QA4A 1HZAA 2VZAA 4IOCA 1QZHA 2Q2UA 1PYSB 4A3GG 1XNRL 3TREA 4DV1Q 1TXYA 5LMUL 4JI4L 4BA2I 1V43A 3F8TA 3IRBA 5AJ3Q 3J7ZC 3K80C 4JBMA 5IYBH 3UDXA 1CKNA 1FVIA 2PQAA 4NPSA 1L2FA 4JI8L 4DUZQ 4LUZA 3TS0A 3J81c 4TVAB 2GN5A 2N3SA 4OONA 3STBD 2K4KA 3CW2C 5ELOA 1LYLA 3T1HQ 3G71A 1M1KC 1OTCA 2ASBA 1HH2P 2UXBQ 4PG3A 2UUCL 1IBML 1OXSC 1HJPA 2R93G 1PH5A 3HOYG 4GKJL 1Q1BA 5IWAL 4JG2A 2JA8G 1NJIC 2F4VQ 3I4NH 4LF9L 1HNZQ 1N32L 4X65L 2YTYA 4JV5L 4NXNQ 1S40A 4JI7Q 2VW9A 4GOPC 1G51A 2OQ0A 3BZKA 3PF5A 1I94Q 2R7DA 3J81i 4X6AH 1IL2A 1VCIA 2ID0A 2OWOA 1PH3A 1TWCH 1WI5A 3KJOA 5C0XJ 4A3CH 4DV4Q 4JI2L 3RLNA 3PUXA 4R4OA 1QVGA 4A3DG 1L0WA 2YTXA 3W1GA 2CCZA 5FJ8G 4QL5A 3HFZB 4JI5Q 4R4QA 1CKMA 2JJQA 3JC66 3W5OA 4JI8Q 2UUBL 3CD6A 1GM5A 1BVSA 1X55A 3H0GH 4A3KH 1NBWA 3RLOA 1HR0W 3L2PA 4LFBL 1XMQQ 3S1NH 3CCSA 3I4OA 3KF6B 5LMNQ 3BZCA 2ZJPA 1NMFA 1P8LA 1WCMH 2UUCQ 2MFIA 1Y1WH 5C44H 4GKJQ 5IWAQ 1KC8C 3OYYA 1LM0A 4A3FH 2E2IH 3KJPA 4LF9Q 1N32Q 4RMFA 3HKSA 4QJFA 3E9IA 4JV5Q 2OTJA 4R1JA 4A3MH 1QUQA 3HOWH 2B3GA 4HIOA 3Q8DA 3PUYA 2CFMA 2OCEA 4BBRG 3RN2A 1KXLA 4J15A 4JBWA 4C3IH 2IX0A 4HJ9A 4A3BG 2HIXA 2EIFA 5IYBG 4LNQA 4QQBX 1NTGA 4DV0L 1XPUA 4A3EH 4JYAQ 1HNWQ 5H1SE 4DAMA 1OXXK 1VQHA 5C3EH 1SROA 4P75A 2NN6G 4RG1A 1PH1A 3HOVG 3KYHC 4GKKQ 2VS1A 4OXPA 3S1RH 2OTLA 3GTOH 1MKHA 2Z0SA 3UDIA 3CCRA 4X66L 1EYGA 1N36L 4DR6Q 3U50C 5GAEC 1XMOL 3PF4A 4XTCS 1PH7A 2YU9H 1X3GA 1H95A 1HZBA 4YCVA 3G4SA 4HIDA 3FP9A 4L5TA 3ULPA 1O7IA 1YHAA 4IPGA 2JE6I 1WFQA 2UUAL 2ATWA 3PO2G 1HNXQ 2IHFA 2GVAA 5FLXc 3H15A 1MJEA 4A3CG 3HOYH 3EIVA 4AIMA 1JJGA 1VQCA 3HKZE 3KOJA 4R4TA 1SRUA 4GOPB 2WAQG 2HHHQ 1VQNA 2L15A 4JI1L 2WFWA 3AQQA 5HY6A 1YIJA 4YHHL 1J5EQ 1Z47A 1VQ7A 1KIXA 3CAMA 2UXDQ 1A62A 2AWOA 2E8GA 2VL6A 2I0QA 3KLWA 1PH8A 4ME3A 4MZ9A 1WCMG 4X62Q 4X66Q 1Y1WG 3E0EA 5FJ8H 3B6YA 5C44G 1N36Q 2NN6I 4LF8Q 5C4XG 2WB1G 1FL0A 3ER0A 3NBHB 4C3JH 4A3FG 2E2HH 3T1HL 5JJKA 4GNXA 1TWAH 3PIOA 4UY8C 2ZTEA 3F1ZA 3G48A 5M5XH 2CWAA 3I55A 3CCUA 4LWCA 4A3MG 4L5RC 4LF6Q 1GKHA 1KD1C 1X56A 1IYJB 4L5SA 1KRSA 4NXNL 1EFWA 3WWVA 1HZCA 4A3EG 5M3MG 4DR4L 3UE0A 4IFDG 4PZ8A 1I94L 1YNXA 5C3EG 2UU9Q 4KLKA 3F2CA 4DV2L 5IYCH 1OXTA 4LW1A 3GTLH 1JJCB 3PUVA 2Z6KA 2AKWB 3MEFA 4LUOA 5GQOA 1KL9A 4BBRH 4DR1L 2R92H 4JI5L 2BA0A 1PH4A 4A3BH 2AMCB 1Q12A 5BR8L 1VQ8A 2VUMH 4YWKA 4A4IA 3H3VI 3HOUH 1B70B 2A19A 3BJUA 3CCJA 3CCEA 3U58A 2KENA 1XMQL 5LMNL 3HOVH 2K50A 3PO3H 1L1OA 3L7ZC 1TWFH 1N34Q 2PNHA 1I6HH 3TQYA 3S17H 4P74A 1QVCA 1PH6A 3MXNB 1Y1VH 3NELA 1PV4A 1UE7A 1IBLL 4DV6Q 1I5FA 3PIPA 4XIGS 3K81C 4DV5Q 4LF4L 5LMNW 3S14H 4DR4Q 4DR2L 1QVFA 2RCNA 3PO2H 1J6QA 2PI2E 4DV2Q 1KQSA 1W3SA 4HJ5A 1HNWL 4JYAL 2OQKA 4IFDI 2NZOA 4AQYL 4JBJA 1EUJA 2JA9A 4DR1Q 1NMGA 4YCWA 1VQPA 1GO3E 1EQRA 4GKKL 2NZHA 5BR8Q 5GAGC 1GVPA 2B29A 1N33Q 3GTMH 2N8NA 3I56A 3H3VH 2GVBA 1YJ9A 4NXML 4DR5L 4DR6L 2Q2HA 1UWVA 2Z6KC 1X3FA 1XPRA 3AYHB 3U4VA 5IYDG 4A75A 1AE3A 3I4MG 3TEHB 4IOAA 5M3FG 1K73C 3CP0A 1PH2A 2K52A 5C4XH 4IPDA 4KI0A 4YY3L 2JA5G 4LFCQ 1K3RA 4MTNA 1Q1EA 4POGA 4DPGA 1FJGQ 4OO1G 4AYBE 3CCQA 2JA6H 4X64Q 1HNXL 3S2HH 5IYCG 3JAMi 1WJJA 2HT1A 1IBLQ 1L1OC 4LF4Q 2R7ZG 3S1MH 2HHHL 4DR2Q 4JI6L 2R92G 4GN5A 4OWXB 1RL2A 1ASYA 2R7FA 1K0RA 1U0LA 1EIFA 3KF8B 2VUMG 4BBSG 1J5EL 3CQZH 4OWTB 5M3MH 4R4CA 4AQYQ 3HOUG 2UXDL 4Y52H 1FGUA 4DK6C 3GTPH 2HIVA 1E7ZA 4UP9A 3PO3G 2N49A 3CC2A 4X62L 3TS2A 4LF8L 1UE5A 2E5LQ 4DR5Q 4NXMQ 4NB3A 2PMZE 1QZGA 3RR5A 2KBNA 5IE8A 4HJAA 2A8VA 1B8AA 5JEAJ 1Y1VG 5JJIA 4H02A 5C4JH 2V1CC 2KCMA 4UP8A 2EXDA 1SN8A 4DKAC 4YY3Q 4LF6L 1JE5A 3FKIH 4EQ5A 3NENA 3D0FA 1VQIA 2BH8A 2ALYB 4EX5A 3PV0A 1A63A 2N78A 4DV7Q 2VNUD 4DR3Q 3CPFA 3ZJYC 1N8RC 4LUVA 4OO1I 1SR3A 4JI6Q 2UU9L 1V1QA 5FLMG 2NVQH 1VQAA 3T1YQ 4GLVB 3HKZG 1YITA 4UP7A 1N9WA 3U4ZA 1K9MC 3CXCA 2JEAI 4IPHA 3M7NA 3KDFB 4DNIA 4TQUS 4UPAA 3AEVA 4GN3B 3PUWA 1VQ9A 2B63H 3UDGA 3GDEA 2UXCQ 4Y7NH 1PFSA 1E1TA 1CSPA 3CMEA 1I50H 2RHSB 3CCMA 2A1AA 2F52A 5GADC 4JI0Q 5K36G 4B3TQ 3RZDH 2JA6G 3PUZA 1Q7YC 1N34L 3CC7A 1JB7A 1V9PA 3J81j 1KHIA 1IZ6A 1CKNB 1E22A 2PQAB 4JOIA 1ASZA 2Q2TA 2ZTCA 1YHQA 1CKOA 3ERSX 4LF5Q 3S16H 3F2BA 2I5MX 1VQ5A 3I4MH 2NVYH 5IYDH 1C0AA 4P73A 5M3FH 3M3YH 2IT1A 2AHOB 3A5UA 4DV6L 4DV5L 1K8GA 1VQBA 3KFUA 3S15H 2JA5H 2K5NA 4QY7A 1SFOH 2IHEA 1L1OB 1DGSA 1NE3A 2KHIA 1JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 Q;  1TWH H;  3STB C;  2R7Z H;  2ZJR A;  5C0X G;  4R4I A;  2YV5 A;  1KRT A;  3SGI A;  2RHQ B;  1VQL A;  1VQJ A;  2BA1 A;  1K83 H;  3BU2 A;  5GRO A;  2D0O A;  4DV3 Q;  4OX9 L;  4BBS H;  1N33 L;  1XNQ L;  4IJH A;  1CSQ A;  3K7A H;  1XPO A;  2PI2 A;  5IP9 H;  2C35 B;  3K7U C;  4A3J H;  4DR7 Q;  1LTL A;  3FKI G;  4K0K Q;  4JC0 A;  3UDF A;  4BY1 H;  4IO9 A;  3NEM A;  2Y0S E;  4IJL A;  4QIW E;  2VQE Q;  1B7Y B;  4KHZ A;  3GTK H;  1M90 C;  4DUY Q;  3EBE A;  3UE1 A;  1FJG L;  4LFC L;  5GAH C;  4X64 L;  4AH6 A;  1X65 A;  1BBW A;  4GNX C;  1X3E A;  2CQO A;  1YJN A;  1C7Y A;  3ICE A;  4P72 A;  2Q2I A;  2JA7 G;  4B3R Q;  2ZM6 L;  1Q86 C;  4O0A A;  1VQE A;  2IX1 A;  4JOI C;  1SMX A;  2K14 A;  3M4O H;  4BY7 H;  2B63 G;  1AH9 A;  2VQF L;  4A3I G;  4JI3 Q;  3I7F A;  1Y14 B;  4KHP L;  3CC4 A;  4OX9 Q;  3JAM c;  1QUQ B;  1X6O A;  2MQH A;  4LFA Q;  5EAY A;  5FLM H;  2NVT H;  1Z9F A;  3M4Q A;  1PVO A;  1MJC A;  1XNQ Q;  3CCV A;  2R6G A;  2F3I A;  4A3L H;  2QGQ A;  5C0X I;  4BXX G;  1SLJ A;  2E5L L;  4GS3 A;  3RZO H;  4IFD J;  1UE6 A;  4HIM A;  2MO1 A;  5E7N A;  1HR0 L;  2I5H A;  5JEA G;  3CMA A;  3M9B A;  3S24 A;  4C3H H;  4FDB A;  3DM3 A;  3OTO Q;  3J7A 5;  3J80 c;  4A76 A;  1E24 A;  1S3O A;  3K8A A;  4DV7 L;  1YJW A;  4DR3 L;  1XNR Q;  5LMU Q;  4JI4 Q;  1BBU A;  1X9N A;  1YEZ A;  1UE1 A;  4AYB G;  2ZM6 Q;  2ZJQ A;  1NY4 A;  2JK8 A;  1YI2 A;  1A8V A;  3AFQ A;  3T1Y L;  2VY3 A;  1Q81 C;  3CCL A;  2MO0 A;  3W1B A;  2ES2 A;  2VQF Q;  5IP9 G;  2K75 A;  4KHP Q;  3FHW A;  2DUD A;  3HOX H;  4A3J G;  1G6P A;  2FXQ A;  1IBM Q;  4A3G H;  2EQS A;  2YTV A;  3GD7 A;  5IP7 H;  4BY1 G;  1K8A C;  1VQM A;  4O2D A;  4PMW A;  1Q46 A;  4C2M H;  2UXC L;  5ELN A;  3J80 i;  3HOZ H;  1SE8 A;  2LXJ A;  3L0O A;  4X65 Q;  3E9H A;  4BA1 I;  4B3M L;  3RN5 A;  2BH2 A;  1VQ4 A;  1EIY B;  4JI0 L;  3G6E A;  4B3T L;  2KCT A;  1XTD A;  1HR0 Q;  4GN4 B;  5HGQ A;  4B3S L;  4OWW B;  4YCU A;  4PZ7 A;  1VQ6 A;  3LGJ A;  3AFP A;  3KF6 A;  4LF5 L;  4A93 H;  1OXU A;  4JI2 Q;  1PYB A;  2WP8 J;  1EOV A;  3A5Z B;  1VQD A;  5J3B A;  4BY7 G;  4GNX B;  4HJ7 A;  2QEX A;  4MNO A;  4QGU A;  4L5Q A;  4DK3 C;  3PGZ A;  3GO5 A;  1EWI A;  3PCO B;  2UUB Q;  3GTG H;  3DLL A;  1C9O A;  3CPW A;  4IPC A;  4ALP A;  3EN2 A;  4LFB Q;  1GD7 A;  4LF7 L;  1E1O A;  3M85 A;  1VQO A;  2JEB I;  1CUK A;  1D7Q A;  2JA7 H;  4A3L G;  1IBK L;  2LXK A;  2MNA A;  2E2J H;  3I4N G;  4DV3 L;  3I2Z A;  3A0J A;  1UEB A;  2ZTD A;  3PSI A;  4A3I H;  3D31 A;  3ULJ A;  3A74 A;  4POF A;  4HIK A;  1VQK A;  4DAY B;  2WAQ E;  4DR7 L;  3CF5 A;  4B3M Q;  2KHJ A;  4K0K L;  2R93 H;  3K0X A;  1AE2 A;  2DGY A;  2JA8 H;  2H5X A;  2VQE L;  1HZ9 A;  3GTJ H;  1EQQ A;  3OW2 A;  4BXX H;  1G29 1;  4JCV E;  5DLQ E;  2D0P A;  2K5H A;  4P71 A;  4DUY L;  4B3S Q;  1PA6 A;  4WJ3 M;  1MIU A;  2K5V A;  4PZ6 A;  4DV0 Q;  1VQG A;  3M4P A;  4WJ4 A;  1OXV A;  1RIP A;  4DV1 L;  3H0G G;  4A3K G;  1YZ6 A;  1WOC A;  2I5L X;  3GTQ H;  2IY5 B;  3TRZ A;  5AJ3 L;  3RLF A;  1KAW A;  4YWM A;  4B3R L;  5JJL A;  2WB1 E;  2YYZ A;  2LSS A;  1JJ2 A;  2XTI A;  1VQF A;  3S2D H;  4DUZ L;  3HOX G;  1YVC A;  4A3D H;  1T9H A;  1S72 A;  1IXR A;  1I3Q H;  5IP7 G;  3VDY A;  1Q82 C;  1PH9 A;  2AWN A;  1BKB A;  1XMO Q;  4JI3 L;  1IBK Q;  1PHJ A;  3HOZ G;  5IY0 A;  4GOP A;  2UXB L;  5M5Y H;  4LFA L;  1JT8 A;  2CKZ B;  1U5K A;  3ULL A;  1X54 A;  3HOW G;  4GLA C;  1R9T H;  2F4V L;  1TWG H;  2JQO A;  3S1Q H;  1HNZ L;  2UUA Q;  4HJ8 A;  1YHB A;  2XGT A;  4YWL A;  2D62 A;  3F2D A;  1P16 A;  4APV A;  1XJV A;  4JI7 L;  1D8L A;  5M5W H;  4A93 G;  3KDF A;  3RNU A;  2HQL A;  2NVX H;  1E3P A;  1LUZ A;  2CWP A;  4GLX A;  4JI1 Q;  1W2B A;  1YBY A;  4JBK A;  5IT9 c;  1Q8K A;  1A0I A;  1WYD A;  2RF4 A;  4YHH Q;  3OTO L;  1VS0 A;  2Y0S G;  4DV4 L;  2QA4 A;  1HZA A;  2VZA A;  4IOC A;  1QZH A;  2Q2U A;  1PYS B;  4A3G G;  1XNR L;  3TRE A;  4DV1 Q;  1TXY A;  5LMU L;  4JI4 L;  4BA2 I;  1V43 A;  3F8T A;  3IRB A;  5AJ3 Q;  3J7Z C;  3K80 C;  4JBM A;  5IYB H;  3UDX A;  1CKN A;  1FVI A;  2PQA A;  4NPS A;  1L2F A;  4JI8 L;  4DUZ Q;  4LUZ A;  3TS0 A;  3J81 c;  4TVA B;  2GN5 A;  2N3S A;  4OON A;  3STB D;  2K4K A;  3CW2 C;  5ELO A;  1LYL A;  3T1H Q;  3G71 A;  1M1K C;  1OTC A;  2ASB A;  1HH2 P;  2UXB Q;  4PG3 A;  2UUC L;  1IBM L;  1OXS C;  1HJP A;  2R93 G;  1PH5 A;  3HOY G;  4GKJ L;  1Q1B A;  5IWA L;  4JG2 A;  2JA8 G;  1NJI C;  2F4V Q;  3I4N H;  4LF9 L;  1HNZ Q;  1N32 L;  4X65 L;  2YTY A;  4JV5 L;  4NXN Q;  1S40 A;  4JI7 Q;  2VW9 A;  4GOP C;  1G51 A;  2OQ0 A;  3BZK A;  3PF5 A;  1I94 Q;  2R7D A;  3J81 i;  4X6A H;  1IL2 A;  1VCI A;  2ID0 A;  2OWO A;  1PH3 A;  1TWC H;  1WI5 A;  3KJO A;  5C0X J;  4A3C H;  4DV4 Q;  4JI2 L;  3RLN A;  3PUX A;  4R4O A;  1QVG A;  4A3D G;  1L0W A;  2YTX A;  3W1G A;  2CCZ A;  5FJ8 G;  4QL5 A;  3HFZ B;  4JI5 Q;  4R4Q A;  1CKM A;  2JJQ A;  3JC6 6;  3W5O A;  4JI8 Q;  2UUB L;  3CD6 A;  1GM5 A;  1BVS A;  1X55 A;  3H0G H;  4A3K H;  1NBW A;  3RLO A;  1HR0 W;  3L2P A;  4LFB L;  1XMQ Q;  3S1N H;  3CCS A;  3I4O A;  3KF6 B;  5LMN Q;  3BZC A;  2ZJP A;  1NMF A;  1P8L A;  1WCM H;  2UUC Q;  2MFI A;  1Y1W H;  5C44 H;  4GKJ Q;  5IWA Q;  1KC8 C;  3OYY A;  1LM0 A;  4A3F H;  2E2I H;  3KJP A;  4LF9 Q;  1N32 Q;  4RMF A;  3HKS A;  4QJF A;  3E9I A;  4JV5 Q;  2OTJ A;  4R1J A;  4A3M H;  1QUQ A;  3HOW H;  2B3G A;  4HIO A;  3Q8D A;  3PUY A;  2CFM A;  2OCE A;  4BBR G;  3RN2 A;  1KXL A;  4J15 A;  4JBW A;  4C3I H;  2IX0 A;  4HJ9 A;  4A3B G;  2HIX A;  2EIF A;  5IYB G;  4LNQ A;  4QQB X;  1NTG A;  4DV0 L;  1XPU A;  4A3E H;  4JYA Q;  1HNW Q;  5H1S E;  4DAM A;  1OXX K;  1VQH A;  5C3E H;  1SRO A;  4P75 A;  2NN6 G;  4RG1 A;  1PH1 A;  3HOV G;  3KYH C;  4GKK Q;  2VS1 A;  4OXP A;  3S1R H;  2OTL A;  3GTO H;  1MKH A;  2Z0S A;  3UDI A;  3CCR A;  4X66 L;  1EYG A;  1N36 L;  4DR6 Q;  3U50 C;  5GAE C;  1XMO L;  3PF4 A;  4XTC S;  1PH7 A;  2YU9 H;  1X3G A;  1H95 A;  1HZB A;  4YCV A;  3G4S A;  4HID A;  3FP9 A;  4L5T A;  3ULP A;  1O7I A;  1YHA A;  4IPG A;  2JE6 I;  1WFQ A;  2UUA L;  2ATW A;  3PO2 G;  1HNX Q;  2IHF A;  2GVA A;  5FLX c;  3H15 A;  1MJE A;  4A3C G;  3HOY H;  3EIV A;  4AIM A;  1JJG A;  1VQC A;  3HKZ E;  3KOJ A;  4R4T A;  1SRU A;  4GOP B;  2WAQ G;  2HHH Q;  1VQN A;  2L15 A;  4JI1 L;  2WFW A;  3AQQ A;  5HY6 A;  1YIJ A;  4YHH L;  1J5E Q;  1Z47 A;  1VQ7 A;  1KIX A;  3CAM A;  2UXD Q;  1A62 A;  2AWO A;  2E8G A;  2VL6 A;  2I0Q A;  3KLW A;  1PH8 A;  4ME3 A;  4MZ9 A;  1WCM G;  4X62 Q;  4X66 Q;  1Y1W G;  3E0E A;  5FJ8 H;  3B6Y A;  5C44 G;  1N36 Q;  2NN6 I;  4LF8 Q;  5C4X G;  2WB1 G;  1FL0 A;  3ER0 A;  3NBH B;  4C3J H;  4A3F G;  2E2H H;  3T1H L;  5JJK A;  4GNX A;  1TWA H;  3PIO A;  4UY8 C;  2ZTE A;  3F1Z A;  3G48 A;  5M5X H;  2CWA A;  3I55 A;  3CCU A;  4LWC A;  4A3M G;  4L5R C;  4LF6 Q;  1GKH A;  1KD1 C;  1X56 A;  1IYJ B;  4L5S A;  1KRS A;  4NXN L;  1EFW A;  3WWV A;  1HZC A;  4A3E G;  5M3M G;  4DR4 L;  3UE0 A;  4IFD G;  4PZ8 A;  1I94 L;  1YNX A;  5C3E G;  2UU9 Q;  4KLK A;  3F2C A;  4DV2 L;  5IYC H;  1OXT A;  4LW1 A;  3GTL H;  1JJC B;  3PUV A;  2Z6K A;  2AKW B;  3MEF A;  4LUO A;  5GQO A;  1KL9 A;  4BBR H;  4DR1 L;  2R92 H;  4JI5 L;  2BA0 A;  1PH4 A;  4A3B H;  2AMC B;  1Q12 A;  5BR8 L;  1VQ8 A;  2VUM H;  4YWK A;  4A4I A;  3H3V I;  3HOU H;  1B70 B;  2A19 A;  3BJU A;  3CCJ A;  3CCE A;  3U58 A;  2KEN A;  1XMQ L;  5LMN L;  3HOV H;  2K50 A;  3PO3 H;  1L1O A;  3L7Z C;  1TWF H;  1N34 Q;  2PNH A;  1I6H H;  3TQY A;  3S17 H;  4P74 A;  1QVC A;  1PH6 A;  3MXN B;  1Y1V H;  3NEL A;  1PV4 A;  1UE7 A;  1IBL L;  4DV6 Q;  1I5F A;  3PIP A;  4XIG S;  3K81 C;  4DV5 Q;  4LF4 L;  5LMN W;  3S14 H;  4DR4 Q;  4DR2 L;  1QVF A;  2RCN A;  3PO2 H;  1J6Q A;  2PI2 E;  4DV2 Q;  1KQS A;  1W3S A;  4HJ5 A;  1HNW L;  4JYA L;  2OQK A;  4IFD I;  2NZO A;  4AQY L;  4JBJ A;  1EUJ A;  2JA9 A;  4DR1 Q;  1NMG A;  4YCW A;  1VQP A;  1GO3 E;  1EQR A;  4GKK L;  2NZH A;  5BR8 Q;  5GAG C;  1GVP A;  2B29 A;  1N33 Q;  3GTM H;  2N8N A;  3I56 A;  3H3V H;  2GVB A;  1YJ9 A;  4NXM L;  4DR5 L;  4DR6 L;  2Q2H A;  1UWV A;  2Z6K C;  1X3F A;  1XPR A;  3AYH B;  3U4V A;  5IYD G;  4A75 A;  1AE3 A;  3I4M G;  3TEH B;  4IOA A;  5M3F G;  1K73 C;  3CP0 A;  1PH2 A;  2K52 A;  5C4X H;  4IPD A;  4KI0 A;  4YY3 L;  2JA5 G;  4LFC Q;  1K3R A;  4MTN A;  1Q1E A;  4POG A;  4DPG A;  1FJG Q;  4OO1 G;  4AYB E;  3CCQ A;  2JA6 H;  4X64 Q;  1HNX L;  3S2H H;  5IYC G;  3JAM i;  1WJJ A;  2HT1 A;  1IBL Q;  1L1O C;  4LF4 Q;  2R7Z G;  3S1M H;  2HHH L;  4DR2 Q;  4JI6 L;  2R92 G;  4GN5 A;  4OWX B;  1RL2 A;  1ASY A;  2R7F A;  1K0R A;  1U0L A;  1EIF A;  3KF8 B;  2VUM G;  4BBS G;  1J5E L;  3CQZ H;  4OWT B;  5M3M H;  4R4C A;  4AQY Q;  3HOU G;  2UXD L;  4Y52 H;  1FGU A;  4DK6 C;  3GTP H;  2HIV A;  1E7Z A;  4UP9 A;  3PO3 G;  2N49 A;  3CC2 A;  4X62 L;  3TS2 A;  4LF8 L;  1UE5 A;  2E5L Q;  4DR5 Q;  4NXM Q;  4NB3 A;  2PMZ E;  1QZG A;  3RR5 A;  2KBN A;  5IE8 A;  4HJA A;  2A8V A;  1B8A A;  5JEA J;  1Y1V G;  5JJI A;  4H02 A;  5C4J H;  2V1C C;  2KCM A;  4UP8 A;  2EXD A;  1SN8 A;  4DKA C;  4YY3 Q;  4LF6 L;  1JE5 A;  3FKI H;  4EQ5 A;  3NEN A;  3D0F A;  1VQI A;  2BH8 A;  2ALY B;  4EX5 A;  3PV0 A;  1A63 A;  2N78 A;  4DV7 Q;  2VNU D;  4DR3 Q;  3CPF A;  3ZJY C;  1N8R C;  4LUV A;  4OO1 I;  1SR3 A;  4JI6 Q;  2UU9 L;  1V1Q A;  5FLM G;  2NVQ H;  1VQA A;  3T1Y Q;  4GLV B;  3HKZ G;  1YIT A;  4UP7 A;  1N9W A;  3U4Z A;  1K9M C;  3CXC A;  2JEA I;  4IPH A;  3M7N A;  3KDF B;  4DNI A;  4TQU S;  4UPA A;  3AEV A;  4GN3 B;  3PUW A;  1VQ9 A;  2B63 H;  3UDG A;  3GDE A;  2UXC Q;  4Y7N H;  1PFS A;  1E1T A;  1CSP A;  3CME A;  1I50 H;  2RHS B;  3CCM A;  2A1A A;  2F52 A;  5GAD C;  4JI0 Q;  5K36 G;  4B3T Q;  3RZD H;  2JA6 G;  3PUZ A;  1Q7Y C;  1N34 L;  3CC7 A;  1JB7 A;  1V9P A;  3J81 j;  1KHI A;  1IZ6 A;  1CKN B;  1E22 A;  2PQA B;  4JOI A;  1ASZ A;  2Q2T A;  2ZTC A;  1YHQ A;  1CKO A;  3ERS X;  4LF5 Q;  3S16 H;  3F2B A;  2I5M X;  1VQ5 A;  3I4M H;  2NVY H;  5IYD H;  1C0A A;  4P73 A;  5M3F H;  3M3Y H;  2IT1 A;  2AHO B;  3A5U A;  4DV6 L;  4DV5 L;  1K8G A;  1VQB A;  3KFU A;  3S15 H;  2JA5 H;  2K5N A;  4QY7 A;  1SFO H;  2IHE A;  1L1O B;  1DGS A;  1NE3 A;  2KHI A;  1JMC A; 
#chains in the Genus database with same CATH topology
 2ZXO A;  5HUR A;  4LF7 Q;  1J9O A;  4OGQ C;  5C0X G;  4R4I A;  3M3Y B;  2Z6B A;  1CFM A;  4NMZ A;  3WOE A;  5M9O A;  2F0P A;  1XNQ L;  1FNU A;  3K7A H;  1TWH B;  4K6L A;  4G7H C;  4JVZ A;  3FKI G;  2RSO A;  2R92 B;  3J7A F;  4UAI A;  4QIW E;  2VQE Q;  4BBS B;  1M90 C;  4DUY Q;  3UE1 A;  1Y8P B;  4LFC L;  1BBW A;  3D3R A;  2CQO A;  1YJN A;  1B1Z A;  1Q86 C;  4ZCK A;  1VQE A;  3RD4 A;  3S17 B;  1PFB A;  3BVZ A;  2M9V A;  4BY7 H;  1XYI A;  4A3I G;  1Y14 B;  3CC4 A;  4OX9 Q;  1VF7 A;  2MQH A;  5FLM H;  3JAM c;  2NVT H;  5LHY 1;  2TMP A;  2R6G A;  2FHT A;  2IW3 A;  1SNM A;  2K7V A;  1MSH A;  4J1M A;  5CBE E;  4HIM A;  2MO1 A;  2ICI A;  1HR0 L;  2F0K A;  3HKZ B;  1SNO A;  4HAE A;  3CRL C;  3DM3 A;  3UI2 A;  3J7A 5;  1E24 A;  4DV7 L;  2EYF A;  4JI4 Q;  4OIK A;  1A2T A;  1VMP A;  3NK9 A;  1X9N A;  2JK8 A;  3WOF A;  1K8M A;  1A8V A;  3MXN A;  2VY3 A;  1Q81 C;  3CCL A;  2MO0 A;  4XT1 B;  4ZKB B;  1AZQ A;  3VR4 A;  4XDX A;  3HOX H;  3BS1 A;  4A3J G;  4A3G H;  4K5V A;  2EQS A;  3GD7 A;  5IP7 H;  1VQM A;  4C2M H;  3OWE B;  5C0X H;  2UXC L;  3TP6 A;  4X65 Q;  3E9H A;  1EIY B;  4JI0 L;  4B3T L;  1HA5 A;  4L63 B;  2EVB A;  1HA6 A;  4GN4 B;  2F1M A;  1B3A A;  1CZW A;  4OWW B;  4PZ7 A;  4X3K A;  1VQ6 A;  3LGJ A;  3AFP A;  3Q24 A;  1II3 A;  5EKK A;  1EOV A;  3A5Z B;  1VQD A;  1JC7 A;  4GNX B;  4HJ7 A;  3E0J A;  5C4J B;  1BCP B;  4QGU A;  4L5Q A;  4CDF C;  3ND9 A;  4WJW A;  3DLL A;  1GD7 A;  2LXK A;  1DXM A;  2XN9 C;  4TKO B;  3C1F A;  1BR9 A;  4A3I H;  3ULJ A;  1IYV A;  4DAY B;  5D3I B;  1GUN A;  2WAQ E;  5IGC A;  4K0K L;  4C3H G;  2L1B A;  3VR3 A;  5CMD A;  2H5X A;  3GTJ H;  1EQQ A;  2LFN A;  5DLQ E;  2D0P A;  4DGZ A;  2B63 B;  2HUG A;  4DXF A;  4WJ3 M;  4Y7N B;  1MIU A;  3MZ5 A;  4DV0 Q;  2G9D A;  3M4P A;  1SNP A;  2LMC B;  4UDU C;  1RIP A;  3H0G G;  3G7L A;  3RLF A;  4B3R L;  2ZT9 C;  5EGT A;  3S2D H;  2XTI A;  2DY7 A;  4DUZ L;  4A3D H;  3R3O A;  4QMG A;  1BKB A;  3HOZ G;  4GOP A;  2JA5 B;  4LFA L;  1X54 A;  3A8I E;  1BUV T;  5KGU A;  1HNZ L;  1YHB A;  2XGT A;  3QB3 A;  3F2D A;  1P16 A;  1RTN A;  1D8L A;  4PV1 C;  3RNU A;  4LMQ D;  1LT3 D;  2ZXR A;  3PIP 3;  1YBY A;  5IT9 c;  5DM7 3;  1A0I A;  1WYD A;  1PXU A;  1HZA A;  1D1K A;  3EA6 A;  2Q2U A;  5I2Y A;  1ML0 D;  5EBC A;  5M5W B;  4BA2 I;  1TS2 A;  3J7Z C;  1LT4 D;  1CKN A;  1FVI A;  4NPS A;  4JI8 L;  1L2F A;  1X3Q A;  1A15 A;  5I9P A;  3D4R A;  5IGD A;  4ZYS A;  1LO5 D;  4OON A;  5CV6 A;  3I90 A;  2QDL A;  2PMZ B;  1AEX A;  3H94 A;  2UXB Q;  4RCO A;  1IBM L;  1PH5 A;  3HOY G;  4GKJ L;  3U9S A;  2PCF B;  2JA8 G;  1NJI C;  2F4V Q;  3C46 A;  1N32 L;  2F0W A;  4BY7 B;  1H9M A;  1DOM A;  2VW9 A;  4GOP C;  2NVT B;  2OQ0 A;  3BZK A;  3PF5 A;  2R7D A;  4B9W A;  3J81 i;  3T13 A;  1VCI A;  2ID0 A;  4IUN A;  3SXH A;  2X6L A;  1WI5 A;  4DV4 Q;  4JI2 L;  4YIJ A;  4DXG A;  2YTX A;  5FJ8 G;  3NHH A;  1CKM A;  3TSS A;  2EPB A;  5EJW A;  4J8Q A;  3H0G H;  2B2Y A;  3L2P A;  3CCS A;  3KF6 B;  2MFI A;  1H9R A;  2BOS A;  3VR2 A;  5A35 A;  1EIH A;  1B4O A;  1KC8 C;  1LM0 A;  4RMF A;  3GQB A;  4JV5 Q;  4R1J A;  4A3M H;  1QUQ A;  3DWQ A;  3T56 B;  3HOX B;  3Q8D A;  3PUY A;  5FLX L;  3I73 A;  1STB A;  4JBW A;  4A3B G;  4C2M B;  2E2I B;  2B8F A;  4LNQ A;  1M8A A;  1AN8 A;  2O5I C;  1QOH A;  4DAM A;  1OXX K;  1VQH A;  1SRO A;  3HOV G;  5LL6 S;  4ILW A;  4GKK Q;  3J7A V;  4K8J A;  1N36 L;  5CV8 A;  2F0S A;  5F2D A;  4IUV A;  1H95 A;  4ZQ3 A;  2HCI A;  4QIW B;  3FP9 A;  2JE6 I;  2B2Y C;  2ATW A;  2F03 A;  1HNX Q;  2GVA A;  1MJE A;  3HOY H;  5FKA C;  2RA4 A;  4AIM A;  5BN5 A;  2HHH Q;  4C1N I;  4DK1 A;  1ICF B;  4JI1 L;  1SE3 A;  1SND A;  3IFT A;  1VQ7 A;  1A62 A;  1G8Z D;  1BO0 A;  4LK1 C;  2VL6 A;  3EVQ A;  3KLW A;  2PW5 A;  4MZ9 A;  3MXU A;  4X66 Q;  1Y1W G;  4LF8 Q;  5FJ8 H;  3BYY B;  2NN6 I;  1BBX C;  3T1H L;  4V0B A;  1X3P A;  1TWA H;  3PIO A;  2LY7 A;  3F1Z A;  2CWA A;  3S2D B;  4LWC A;  4L5R C;  4HMI A;  4A3D B;  1GOZ A;  1T5E A;  2FFK B;  1BDO A;  2IWH A;  5M5X B;  5C3E G;  5G3L F;  2UU9 Q;  1BF4 A;  4FF3 A;  5IYC H;  1JJC B;  3MEF A;  4RKL A;  1PH4 A;  4A3B H;  5T1G A;  1VQ8 A;  4YWK A;  3M4Y A;  3A55 A;  3BJU A;  3CCJ A;  3HOV H;  2X69 A;  1LTB D;  3PO3 H;  1L1O A;  3U9O A;  2B8G A;  2PNH A;  2V4D A;  1DYQ A;  4P74 A;  1W6J A;  3C2P A;  4X3T A;  4RGT A;  4DU9 A;  1I5F A;  2M00 A;  1B9N A;  1TWF B;  2EYP A;  4LF4 L;  1ONL A;  2RCN A;  5JPN C;  2NZO A;  4JBJ A;  3MHB A;  4RWS C;  1EQR A;  1HFG A;  3J80 E;  1EFI D;  2EDG A;  5BR8 Q;  1H9J A;  1YJ9 A;  5KEE A;  2K28 A;  2WAQ B;  5KYI A;  5IYD G;  1KAA A;  4ZK9 B;  4RA8 A;  1EY6 A;  1G91 A;  1ICW A;  1K3R A;  2F0N A;  4OO1 G;  2AQ3 B;  3CCQ A;  2JA6 H;  3A56 A;  4X64 Q;  5D14 A;  3JAM i;  3P7J A;  2HT1 A;  3NWS A;  1CHQ D;  1HQM C;  1L1O C;  5EKL A;  4DR2 Q;  1F9P A;  4JI6 L;  2R92 G;  2PZU A;  1RL2 A;  4BBS G;  1SYF A;  1SYD A;  4HR7 B;  4R4C A;  4A3M B;  3I4L A;  1V1O A;  4DK6 C;  1EEI D;  3S1M B;  3DM1 A;  1LTT D;  2KEE A;  1GHK A;  3NTH A;  1DM0 B;  4NXM Q;  4CHT B;  3CQZ B;  1QZG A;  3RR5 A;  2L9H A;  5IE8 A;  3GP7 A;  1WD0 A;  5JJI A;  3I70 A;  2V1C C;  1WTP A;  4KD3 A;  4ZKC B;  4F8M A;  5BN4 A;  4YY3 Q;  3CHB D;  1VQI A;  2BH8 A;  4EX5 A;  2N78 A;  1EOT A;  3CPF A;  1N8R C;  3VA7 A;  4LUV A;  1K8O A;  1V1Q A;  4M8A A;  1VQA A;  3FMC A;  4GLV B;  3HKZ G;  3ERQ A;  1YIT A;  4CJ1 B;  2H4O A;  3AEV A;  3TZU A;  2NTT A;  4GN3 B;  4CGY B;  3GDE A;  4ZUI A;  1PFS A;  1E1T A;  5J1Z A;  1FR3 A;  1I50 H;  5ELB A;  2F0O A;  1LTA D;  3RZD H;  2MGS A;  3J81 j;  4CDD C;  1E22 A;  2PQA B;  4JOI A;  4KKU A;  5IYD H;  2NVY H;  4RGO S;  3KLR A;  5A2Q E;  3M3Y H;  2M2L A;  3A5U A;  2K5N A;  3ITP A;  4OO1 H;  4KN7 C;  2BDN A;  1CSQ A;  2CH4 W;  1O7L A;  1TWH H;  3BDO A;  4DF7 A;  4HED A;  1KRT A;  2KED A;  4L6T B;  1VQL A;  4OX9 L;  4DV3 Q;  1EYA A;  4S3S A;  4BBS H;  2EOT A;  1N33 L;  2J7Z A;  3JAM L;  1XPO A;  1S4Z A;  3I72 A;  1NR2 A;  4DR7 Q;  4JC0 A;  4BY1 H;  4IO9 A;  4A3B B;  4KHZ A;  4G7O C;  3EBE A;  4KK7 A;  1FJG L;  3HP3 A;  5GAH C;  3QOL A;  2EJF C;  2F0H A;  2WKD A;  3HOV B;  4AH6 A;  3PO3 B;  2JA7 G;  1QNK A;  3GV3 A;  3OMG A;  2FIN B;  4O0A A;  4DNR B;  3R8B A;  1LAC A;  2IX1 A;  4JOI C;  4DAV A;  2K14 A;  3M4O H;  2L0C A;  3MFG A;  4LJZ C;  2B63 G;  4RHR A;  4JI3 Q;  1L0X B;  1XWE A;  1RDP D;  3M4Q A;  1PVO A;  1MJC A;  3O13 A;  3CCV A;  2F3I A;  5ELE A;  2E5L L;  1TQO A;  4B08 A;  4IUP A;  1C8C A;  3QJY A;  4RKB A;  3G6J B;  1LLR D;  3PQI A;  3CMA A;  3RZO B;  3J80 c;  4A76 A;  5CV9 A;  1S3O A;  2XRS D;  1YJW A;  3EFX D;  1PZI D;  1UE1 A;  3QR8 A;  2MUY A;  1YI2 A;  3AFQ A;  3VR5 A;  4EQO A;  1LT6 D;  2JA6 B;  3W1B A;  2MP1 A;  2VQF Q;  3AB9 A;  5EBD A;  2NZ1 D;  1EU3 A;  1Q8I A;  2FXQ A;  2YTV A;  1K8A C;  1STE A;  4O2D A;  5ELN A;  4WOR A;  1SE8 A;  1SYG A;  1MD2 D;  1K3B C;  1VQ4 A;  5FO9 B;  4HTH A;  4DFA A;  2KCT A;  5CYU A;  1UEA B;  3X3M A;  2IX3 A;  4ODG A;  4YCU A;  3I91 A;  1WTW A;  4OEM B;  1D5M C;  5J3B A;  1GUO A;  1TY2 A;  4QUF A;  4BY7 G;  2NB0 A;  4L8J A;  5J22 A;  3PGZ A;  3PCO B;  2UUB Q;  3GTG H;  3CPW A;  1NR4 A;  3OIP A;  4ALP A;  3EN2 A;  2JEB I;  1CUK A;  2R3Z A;  2JA7 H;  3A0J A;  2A73 B;  1EYD A;  3KF8 A;  1I4R A;  3MXG A;  3D31 A;  4POF A;  1VQK A;  3LNN A;  1DZ1 A;  4ZLT F;  4Z9C B;  4F88 A;  2R93 H;  3NXW A;  1AE2 A;  4H0L C;  2DGY A;  1HZ9 A;  2FJ2 A;  3E6Z X;  4J6H A;  1G29 1;  5I4D A;  3OW2 A;  2DNE A;  1U4P A;  4P71 A;  3VYT A;  4B3S Q;  1TU2 B;  1HRJ A;  3EJI A;  2E74 C;  1I50 B;  5IT9 L;  1WOC A;  2I5L X;  4RAU C;  3GTQ H;  3RZD B;  1KAW A;  1SE2 A;  4YWM A;  2XSC A;  1EY9 A;  2WB1 E;  3K6O A;  1VQF A;  2HDM A;  3HOX G;  4FYD A;  1S72 A;  5IP7 G;  2AWN A;  2NVY B;  3GV6 A;  4R9W A;  1IBK Q;  2UXB L;  2G5D A;  3LWE A;  5M5Y H;  2A74 C;  1U5K A;  3ULL A;  2A6H D;  2F4V L;  2UUA Q;  3SK4 A;  4YWL A;  1MGS A;  3KK7 A;  4K2L A;  5M5W H;  3KDF A;  4U68 A;  2HQL A;  5CGK A;  2PPB C;  3A7L A;  1W2B A;  2Q8R E;  4PQX A;  1Q8K A;  2RF4 A;  4YHH Q;  3OTO L;  4DV4 L;  1QZH A;  1VS0 A;  3C1E A;  1KXL A;  2QA4 A;  4CBV A;  3K5N A;  4IOC A;  1NCV A;  1XNR L;  1UNS A;  3TRE A;  1TXY A;  3D4W A;  5LMU L;  4BY1 B;  3F8T A;  2ICE C;  3IRB A;  1V1P A;  5IYB H;  2NVX B;  3IKJ A;  1I4X A;  5ELF A;  4XYQ A;  4TVA B;  2GN5 A;  2N3S A;  4KV6 A;  3TP8 A;  3STB D;  4DAP A;  2K4K A;  1OTC A;  1LYL A;  3G71 A;  2ASB A;  2K32 A;  1HH2 P;  1Q1B A;  1CZG A;  3V2T A;  1SSO A;  3M4O B;  1ZYR D;  4JV5 L;  4JI7 Q;  1G51 A;  2D2C C;  1I94 Q;  1A6X A;  4X6A H;  1IL2 A;  1DD2 A;  3I4N B;  4A3C H;  4ZRZ A;  3PUX A;  3RLN A;  4A3D G;  2PZW A;  3W1G A;  2QCP X;  1ESR A;  1MSG A;  2RBM A;  4RCN A;  1ROD A;  2IJ0 A;  2GA4 B;  1TWC B;  4FNF A;  3MTS A;  1BVS A;  4LFB L;  1NBW A;  1S5C D;  3NWT A;  5LMN Q;  1NMF A;  1WCM H;  2K1B A;  4F87 A;  5IWA Q;  1FYC A;  1H9S A;  2E2I H;  2EYO A;  3KJP A;  4LF9 Q;  4G4K A;  2OTJ A;  4HIO A;  2OCE A;  5JOB A;  1CI3 M;  4J15 A;  1B9M A;  2IX0 A;  2HIX A;  1HNW Q;  4JYA Q;  4A3E H;  3KLS X;  5IGG A;  3ONA B;  4P75 A;  4XYO A;  3KYH C;  1MI2 A;  1E0B A;  1I4H A;  2VS1 A;  3P20 A;  4JW0 A;  5LL6 X;  3LWU A;  1MKH A;  3UDI A;  3CCR A;  4X66 L;  1EYG A;  4DR6 Q;  2C5C A;  1XMO L;  3PF4 A;  1EZ6 A;  1PFN A;  4CKB A;  2F0E A;  1X3G A;  1PDQ A;  3HGB A;  3GTG B;  4N8X 1;  3ULP A;  1O7I A;  1YHA A;  3P75 A;  4IPG A;  1WFQ A;  2K5D A;  2RKS A;  2JA7 B;  2IHF A;  3H15 A;  1IKL A;  5BN3 A;  2YU9 B;  1JJG A;  2VB3 X;  1HUN A;  5TSS A;  4GOP B;  2WAQ G;  5HY6 A;  2DNC A;  3OIQ A;  4UHV A;  1J5E Q;  2MJ8 A;  3V05 A;  1Z47 A;  1KIX A;  1IL8 A;  2R93 B;  5EPL A;  4QUC A;  2AWO A;  1L0Y B;  1CA6 A;  1R4P B;  1F9R A;  3E0E A;  3MA2 B;  4GNX A;  3GTQ B;  4HSP A;  1SMY D;  2CHB D;  3G48 A;  4KD4 A;  5M5X H;  4A3M G;  1TS5 A;  2F0T A;  3QO2 A;  1FNW A;  1X56 A;  1IYJ B;  2N88 A;  4C3J B;  4NXN L;  4L5S A;  3WWV A;  1HZC A;  5M5Y B;  5C4H A;  4PZ8 A;  1YNX A;  1CQV A;  4QF4 A;  3F2C A;  5JAV A;  2KCN A;  1AFP A;  1OXT A;  3R2T A;  4KTA A;  1KL9 A;  2I07 B;  4JI5 L;  2BA0 A;  1B50 A;  5BR8 L;  1Q12 A;  2KEC A;  1HHV A;  3DXJ C;  3NUC A;  4A4I A;  3EQL C;  5D65 A;  3H3V I;  5L37 A;  3HOU H;  1EYC A;  2A19 A;  4H7B A;  3GTL B;  1F9S A;  1XMQ L;  2RQX A;  3S9W A;  1RD9 D;  4BS9 A;  1YNJ D;  1GUS A;  4Q0F A;  2F0V A;  1TWF H;  2K5W A;  1I6H H;  1SYE A;  1C48 A;  1Y1V H;  1NAP A;  4PMB A;  3NEL A;  1V8Q A;  4KJN A;  4DV6 Q;  4DV5 Q;  3QWN A;  4XIG S;  4KMU C;  5LMN W;  4FXD A;  4DR2 L;  3SR1 A;  3OMC A;  5JVH 3;  4IFD I;  1X32 A;  1F2M A;  4EGV A;  1NMG A;  2F0Q A;  4YCW A;  1VQP A;  2AUJ D;  4C56 C;  4FXK C;  1CTM A;  4CKC A;  1STG A;  1GVP A;  2EJM A;  3PO2 B;  2GVB A;  4NXM L;  2JP1 A;  1E2W A;  3BVM A;  1JIC A;  1AE3 A;  3TEH B;  1Q90 A;  1K73 C;  3GTM B;  1PH2 A;  2K5Q A;  4YY3 L;  4LFC Q;  1Q1E A;  4DPG A;  4AYB E;  5KIX A;  5IYC G;  1U4M A;  1KDC A;  1HPC A;  1M4V A;  1IBL Q;  4HSV A;  2OF1 A;  3S1M H;  1WCM B;  2WB1 B;  2EYM A;  1U0L A;  1EIF A;  2HCC A;  2F3W A;  3CQZ H;  4OWT B;  4AQY Q;  2UXD L;  2EY1 A;  3ZYY X;  2XNA C;  5E4X A;  1GXD C;  4UP9 A;  3PO3 G;  1PYW D;  4X62 L;  3TS2 A;  1WTQ A;  2OXP A;  4A3E B;  1EQV A;  5M3M B;  2KBN A;  2A8V A;  5JEA J;  1O78 A;  3SDZ A;  4TSS A;  2EXD A;  4LF6 L;  4ULL A;  5KNB A;  3NEN A;  4HMJ A;  3PMF A;  5IOD A;  2Q8T A;  4R8I A;  2VNU D;  4DV7 Q;  1TT2 A;  3ZJY C;  1G6Z A;  1B3Q A;  5FLX E;  5IOC A;  4CJ2 C;  1CT1 D;  2KOL A;  4UP7 A;  1N9W A;  3U4Z A;  1K9M C;  1H9K A;  2JEA I;  2IL8 A;  3M7N A;  5COR A;  2D9U A;  4TQU S;  4KY6 A;  4UPA A;  1VQ9 A;  1SYB A;  3SEB A;  2A6H C;  2UXC Q;  1LTR D;  3CME A;  2WAC A;  2F52 A;  1K0S A;  4JI0 Q;  4B3T Q;  2JA6 G;  1N34 L;  1V9P A;  1KHI A;  1IZ6 A;  1AW7 A;  1ASZ A;  2ZTC A;  4N9P A;  1CKO A;  4MN3 A;  2HDL A;  4P73 A;  2IT1 A;  2AHO B;  5EPK A;  1VQB A;  1L1O B;  1DGS A;  1NE3 A;  1E2V A;  4IN3 A;  4ZUJ A;  1JMC A;  3S16 B;  1QIL A;  3STB C;  2ZJR A;  5M3F B;  1CHP D;  3S15 B;  2DJF C;  1VQJ A;  3BDC A;  3BU2 A;  2BCO A;  2A6E D;  4IJH A;  5IP9 H;  2C35 B;  3K7U C;  1ZYR C;  1LTL A;  3J81 E;  2R7Z B;  4K0K Q;  1PZJ D;  1K83 B;  2Y0S E;  2KCC A;  1B7Y B;  4MIU A;  3HOU B;  2B2V A;  3KBG A;  5JVG 3;  3FRP B;  2QEJ C;  3TP7 A;  1C7Y A;  3FVQ A;  4P72 A;  2Q2I A;  3J80 L;  4B3R Q;  5I6Y A;  1I6H B;  4Q5V A;  1Y1V B;  1AH9 A;  2VQF L;  5JJZ A;  3I7F A;  4ME5 A;  1X6O A;  4LFA Q;  1Z9F A;  2ENB A;  4A3L H;  2QGQ A;  5C0X I;  1SLJ A;  3RZO H;  4IFD J;  1UE6 A;  3K5O A;  1JOO A;  2EYH A;  3RUZ A;  3ERO A;  1E2Z A;  1ILQ A;  3N52 A;  5E7N A;  1SYC A;  2IPK D;  2I5H A;  5JEA G;  3M9B A;  1O7Y A;  1HFN A;  3W2D A;  4FDB A;  1DON A;  1EY7 A;  4NP5 A;  5FO8 B;  3K8A A;  2EE1 A;  4H13 C;  4DR3 L;  1GJX A;  1PTO D;  2ZM6 Q;  1PRT D;  5CR3 A;  1VDZ A;  2R61 A;  3T1Y L;  3SK5 A;  4OL7 A;  2C9O A;  2JN4 A;  2K75 A;  4KHP Q;  3FHW A;  4I7Z C;  1G6P A;  1IBM Q;  1EY5 A;  4BY1 G;  3I3C A;  2K6A A;  4IUR A;  2KJX A;  3L0O A;  4BA1 I;  3RN5 A;  4X3S A;  3G6E A;  1QG7 A;  1PMR A;  1ENA A;  1XTD A;  3T4A C;  4B3S L;  2Z9H A;  3X3N A;  2Q8I B;  2OT2 A;  4LF5 L;  4JI2 Q;  4A93 H;  1DOL A;  3L9A X;  1PYB A;  2WP8 J;  3DWA A;  4XXE A;  2QEX A;  2Z8L A;  1BNZ A;  3D6C A;  1S5F D;  1ZEQ X;  5T1I A;  4IZ8 A;  4QB4 A;  4LF7 L;  1JR0 D;  1E1O A;  1D7Q A;  2LKV A;  1IBK L;  2MNA A;  3I4N G;  1SMY C;  3I2Z A;  2OEO A;  3PIO 3;  3A74 A;  4HIK A;  5A2Q L;  3QIA A;  2K01 A;  3CF5 A;  4B3M Q;  2E2J B;  2KHJ A;  2KUM A;  1STN A;  2VQE L;  4JCV E;  3TP5 A;  4DUY L;  2K5H A;  2VB2 X;  4V19 0;  1O7Z A;  2K5V A;  4PZ6 A;  1VQG A;  4EVO A;  1F77 A;  1OXV A;  2IY5 B;  1YZ6 A;  5JEA H;  3TRZ A;  2YYZ A;  4K5X A;  1IKM A;  1T9H A;  1IXR A;  3VDY A;  2J0T D;  1Q82 C;  1PH9 A;  1AZP A;  1YNJ C;  4IQZ A;  1JT8 A;  3AMU A;  2CKZ B;  4HCE A;  1RHP A;  2F0U A;  2CW0 D;  4GLA C;  3CKI B;  2JQO A;  1I3Q B;  2ZXP A;  3S1Q H;  2D62 A;  5E4W C;  5CV5 A;  4APV A;  4AYB B;  4JI7 L;  2BE5 D;  2EY2 A;  1ET9 A;  2NVX H;  1TR5 A;  3M7G A;  3VYS A;  1I6V C;  4RGM A;  4JI1 Q;  4X3U A;  1TWG B;  3BZD B;  1WTO A;  3NBH A;  4EQN A;  3HS0 C;  3Q6S A;  2VZA A;  1PYS B;  1RF2 D;  1ILP A;  4DV1 Q;  4JI4 L;  1V43 A;  4NW2 A;  5AJ3 Q;  4JBM A;  5D3D A;  3UDX A;  2PQA A;  4LUZ A;  3TS0 A;  2PYK A;  3J81 c;  2B2W A;  3NTI A;  2E2D C;  1BXT A;  5ELO A;  3T1H Q;  1FD7 D;  2O4X A;  1M1K C;  3DUZ A;  1SXT A;  1A2U A;  4CJ0 B;  1OXS C;  2DJG C;  2R93 G;  2XRQ D;  5IWA L;  2WV6 D;  3JAM E;  1HUM A;  1JOK A;  3I4N H;  4O42 A;  4LF9 L;  4X65 L;  1S5E D;  1S40 A;  2QDB A;  5FOB B;  1XTC D;  5CBA E;  2OWO A;  1PH3 A;  1TWC H;  3KJO A;  5C0X J;  1STY A;  4CKE A;  1L0W A;  1DOK A;  1PLF A;  1QVG A;  2CCZ A;  3LX0 A;  1BCP D;  3HFZ B;  4MTK A;  1WVL A;  3L3O C;  4C3J G;  3JC6 6;  3W5O A;  3CD6 A;  4KY5 A;  4O1N A;  1S5D D;  3RLO A;  1QJO A;  1TY0 A;  4I7A A;  3F2U A;  1P8L A;  2ZJP A;  1JQY D;  2UUC Q;  5C44 H;  2KHS A;  4JK1 C;  3OYY A;  1KAB A;  4A3F H;  2K05 A;  5C3X A;  4A3K B;  3NPP A;  3S1N B;  1GHJ A;  3D6W A;  2L55 A;  1ENF A;  4BBR G;  3QG1 A;  1SJH D;  1W6K A;  4HJ9 A;  2VXW A;  5IYB G;  1NTG A;  4DV0 L;  1XPU A;  3Q23 A;  5H1S E;  5C5M A;  3HOW B;  2NN6 G;  4K5W A;  5KND A;  3S1R H;  3BVG A;  4C3I B;  3GTO H;  2Z0S A;  4A93 B;  3U50 C;  2B2U A;  1PH7 A;  2YU9 H;  4YCV A;  2Y0S B;  2WII B;  1KNE A;  2SNS A;  2Z1C A;  1I4G A;  1KDB A;  3PO2 G;  4A3C G;  5J39 A;  3EIV A;  1XX8 A;  1U9R A;  1VQN A;  5I2X A;  1SRU A;  3BG3 A;  4HCS A;  1YIJ A;  1GUT A;  1G2S A;  2A6E C;  2I0Q A;  1WCM G;  2X6G A;  2WB1 G;  3ER0 A;  4C3J H;  5JJK A;  2ZTE A;  3CCU A;  3I55 A;  1V1P B;  2NBF A;  3IL8 A;  1JWS D;  1G2T A;  1STH A;  4JPB W;  3C3L A;  1EFW A;  4A3E G;  5M3M G;  2EZV A;  3UE0 A;  1ZKO A;  1JWU D;  4LW1 A;  3GTL H;  3S1Q B;  3VYU A;  2A69 D;  3PUV A;  4LUO A;  4BBR H;  5IT9 E;  1DCZ A;  1F9Q A;  2AMC B;  1I4Q A;  2VUM H;  1Q3L A;  1NSN S;  3HZX A;  2EY5 A;  4KHV A;  1EQT A;  2F0M A;  1IHZ A;  3CCE A;  5COY A;  2NN6 H;  2NYZ D;  1QE6 A;  3T51 B;  1QB5 D;  3Q0A A;  3TQY A;  5IGE A;  1LTG D;  1QVC A;  1PH6 A;  3MXN B;  1BQQ T;  4K6D A;  1PV4 A;  1IBL L;  3PIP A;  4DR4 Q;  2A68 D;  3DMU A;  1PTO C;  1PRT C;  3PO2 H;  4DV2 Q;  1KQS A;  1H9S B;  2OQK A;  4AQY L;  2JA9 A;  4DR1 Q;  1A3V A;  5FK9 C;  3OOC A;  4ID6 A;  1GO3 E;  3S14 B;  4GKK L;  2D5D A;  2NZH A;  3GTM H;  2XIW A;  2B29 A;  5JPM C;  1N33 Q;  4XQN A;  2N8N A;  1QWY A;  4P2C B;  2Q2H A;  2F4I A;  5DEH A;  3U4V A;  4GZY C;  1HXY D;  4A75 A;  3I4M G;  4IOA A;  1HTL D;  4U67 3;  5M3F G;  2TSS A;  2F0D A;  2J4X A;  4IPD A;  4KI0 A;  3A8K E;  2G9H D;  1FJG Q;  4MTN A;  4CDC C;  4POG A;  3WDN A;  2RDH A;  1WD1 A;  1HNX L;  3S2H H;  4K8I A;  2R7Z G;  2HHH L;  2L11 A;  5C44 B;  1EWC A;  2MHV A;  4GN5 A;  5C4X B;  4OWX B;  4A3F B;  2SDF A;  5M3M H;  3HOU G;  2EYJ A;  3TZD A;  3MXP A;  2DY8 A;  4RGN A;  1E7Z A;  3BYT B;  2N49 A;  4IAL A;  4WFN 3;  4LF8 L;  1UE5 A;  2E5L Q;  4DR5 Q;  1TII D;  4NB3 A;  2H1E A;  3CRK C;  2HQE A;  1QNU A;  1S5B D;  1Y1V G;  3DEP A;  1CM9 A;  2L4N A;  4H02 A;  2QW7 A;  3RMH A;  3GTP B;  3S1R B;  2KCM A;  3GTO B;  3DHQ A;  1SN8 A;  3D4D A;  3FKI H;  4EQ5 A;  5ELD A;  3D0F A;  3HRZ C;  2ALY B;  3PV0 A;  4DK0 A;  2XWB B;  4NDX A;  3DEO A;  4OO1 I;  4IUT A;  1SR3 A;  2UU9 L;  2EXZ A;  1HTP A;  2EY6 A;  1KDA A;  2NVQ H;  1D1I A;  2SOB A;  4LAA A;  1SJE D;  1DJR D;  2RDF A;  3BDL A;  3CXC A;  5C5L A;  5K5P A;  4IPH A;  2HD3 A;  2CW0 C;  4DA2 A;  2B2T A;  3SHL A;  1WTH A;  3CCM A;  5K36 G;  5GAD C;  4NKL A;  1JOQ A;  2BE5 C;  4DN4 M;  3H3V C;  1CKN B;  4IUQ A;  2Q2T A;  1SEB D;  3S16 H;  1SNC A;  3F2B A;  2I5M X;  4KKT A;  4G7Z C;  1VQ5 A;  3I4M H;  5M3F H;  2BDO A;  3KFU A;  3S15 H;  4QY7 A;  3AU7 A;  2IHE A;  2I46 A;  5CC4 A;  1LV9 A;  4DAY A;  2KHI A;  2FMM A;  2R7Z H;  2YV5 A;  2F3V A;  3OW7 A;  2RHQ B;  3SGI A;  2BA1 A;  1K83 H;  4HN7 A;  5GRO A;  2D0O A;  1SFO B;  1WTR A;  2PI2 A;  4A3J H;  4BBR B;  5E1F A;  3UDF A;  3NEM A;  4CDE C;  4IJL A;  5DNF A;  3GTK H;  2VUM B;  2B2T C;  1F2L A;  3K7A B;  4I65 A;  2E75 C;  1IW7 D;  4X64 L;  1F2Z A;  1X65 A;  2O2L D;  3TME A;  1X3E A;  2Z4I A;  4DNT B;  1BCP C;  4GNX C;  3ICE A;  1Z6H A;  2ZM6 L;  3P1H A;  2CQA A;  1SMX A;  2JYO A;  4K14 A;  4MHE A;  4KHP L;  2SNM A;  1QUQ B;  5EAY A;  4KKS A;  1XNQ Q;  1TKW B;  2QIL A;  2PQE A;  4BXX G;  1Y69 U;  3VYR A;  2AUK A;  4GS3 A;  1T5X D;  5IIF A;  4PNY A;  3SVM A;  3FPP A;  1RKN A;  1EIG A;  2E76 C;  2CVR A;  1CQF A;  1LAB A;  2F0G A;  3MC0 B;  1NNX A;  3S24 A;  4C3H H;  3OTO Q;  5K36 H;  2A5H A;  1XNR Q;  3T53 B;  2RCF A;  3NTK A;  1JWM D;  5LMU Q;  1BBU A;  2ZJQ A;  1YEZ A;  4FP5 D;  4AYB G;  1NY4 A;  3D8G A;  2RSN A;  2JXM B;  2ES2 A;  3S2H B;  4FO2 A;  5IP9 G;  1A3T A;  2DUD A;  1LT5 D;  1IYU A;  5G3L D;  4PMW A;  1Q46 A;  5DAU A;  3OPO A;  3J80 i;  1C4Q A;  3HOZ H;  2LXJ A;  4B3M L;  4PMC A;  2BH2 A;  1UAP A;  1EWH A;  2L12 A;  2LS0 1;  4A3G B;  1HR0 Q;  5HGQ A;  3VA5 A;  3TBI B;  3KF6 A;  1OXU A;  1K28 A;  1D5X C;  5KNC A;  5ISR A;  3MAQ A;  2KA7 A;  4FF2 A;  4MNO A;  4DK3 C;  3GO5 A;  1EWI A;  1C9O A;  2Z4H A;  4IPC A;  3FKI B;  4LFB Q;  4F7X A;  3M85 A;  1VQO A;  4A3L G;  1STA A;  2E2J H;  3R2I A;  1ZXT A;  4DV3 L;  1UEB A;  2ZTD A;  1YNN C;  3PSI A;  4N8F A;  5EKI A;  2NVQ B;  4DR7 L;  1JE4 A;  4OHJ A;  3K0X A;  2JA8 H;  1HCZ A;  4BXX H;  3HEJ A;  4QCL A;  1RTO A;  2B39 A;  4A3I B;  1PA6 A;  4H44 C;  2A69 C;  1BOS A;  4WJ4 A;  1EZ8 A;  4DV1 L;  4A3K G;  2KVM A;  5AJ3 L;  1EL0 A;  5JJL A;  1PZK D;  3GTJ B;  2LSS A;  1JJ2 A;  1YVC A;  2RDG A;  1GUG A;  1RCV D;  1I3Q H;  3I4M B;  3J81 L;  1XMO Q;  3MFY A;  4JI3 L;  1PHJ A;  5I9O A;  2K33 A;  5IY0 A;  1JB3 A;  3ND8 A;  3HG9 A;  5EPJ A;  3SK6 A;  3HOW G;  1U4L A;  4IUU A;  1R9T H;  1TWG H;  4E6I A;  4HJ8 A;  4C3I G;  3A7A B;  1XJV A;  4N9T A;  4A93 G;  2A68 C;  1SNQ A;  1CA5 A;  1E3P A;  1LUZ A;  2CWP A;  4GLX A;  1B44 D;  4JBK A;  1Z7T A;  2Y0S G;  1ESF A;  1LTS D;  4A3J B;  4FVM A;  1O80 A;  4TRD A;  3K80 C;  4C1N K;  3R93 A;  3GTK B;  1D2B A;  2K04 A;  4DUZ Q;  1B2T A;  3Q22 A;  3CW2 C;  1OO9 B;  2QF7 A;  1D5Z C;  4PG3 A;  4KN4 C;  2UUC L;  1HJP A;  4JG2 A;  2FMC A;  1WTV A;  2RVL A;  4EQP A;  4ZAI A;  1HNZ Q;  2YTY A;  1TVX A;  4XQQ A;  3KLS A;  4NXN Q;  3H6M A;  2DN8 A;  2QKI C;  4BWG B;  3SE0 A;  5IGF A;  1FNV A;  2WIN B;  4R4O A;  3K58 A;  2F0F A;  4QL5 A;  4JI5 Q;  1MHW C;  4R4Q A;  4B9X A;  1RJT A;  2JJQ A;  4JI8 Q;  4OEL B;  2UUB L;  4WRD A;  1GM5 A;  3K0Y A;  1X55 A;  2NUC A;  4A3K H;  2N55 A;  2B2V C;  4C3H B;  1HR0 W;  1XMQ Q;  3S1N H;  3I4O A;  3BZC A;  3H09 A;  1Y1W H;  4GKJ Q;  5HGT A;  3H0G B;  1N32 Q;  3OSO A;  3J7Y W;  3HKS A;  4QJF A;  5DM6 3;  3E9I A;  3NBI A;  5E3F A;  1GUW A;  3HOW H;  2B3G A;  2WKC A;  3RN2 A;  2CFM A;  3K59 A;  4C3I H;  4QQB X;  2EIF A;  4FXG C;  3HOZ B;  1SDF A;  1FGB D;  5C3E H;  4RG1 A;  1PH1 A;  4OXP A;  2OTL A;  5GAE C;  4XTC S;  1HZB A;  3G4S A;  4HID A;  1PTO H;  4L5T A;  1TS3 A;  2XWJ B;  5C3W A;  2UUA L;  5FLX c;  3E5S A;  5KRU A;  1VQC A;  3HKZ E;  3KOJ A;  4R4T A;  4G57 A;  2L15 A;  3QOJ A;  2WFW A;  3AQQ A;  3NQT A;  3OHX C;  1EY8 A;  4YHH L;  2EYL A;  3CAM A;  2UXD Q;  3HOY B;  3IAY A;  1R4Q B;  2JA8 B;  2E8G A;  2EJG C;  3CU7 A;  2CH4 A;  1B53 A;  3A8J E;  1PH8 A;  4ME3 A;  2P5Z X;  1AP0 A;  3MEH A;  4X62 Q;  5C44 G;  3B6Y A;  1N36 Q;  2MPM A;  5C4X G;  3NBH B;  1FL0 A;  2E2H H;  4A3F G;  5EQ0 A;  3VR6 A;  4UY8 C;  5AFW A;  1PTO F;  3E3X A;  1PRT F;  1EY4 A;  4LF6 Q;  1GKH A;  2L5T A;  1KD1 C;  1IW7 C;  1CK1 A;  1EEF D;  1KRS A;  1QCB D;  5CV4 A;  2F0L A;  2PW7 A;  1TWA B;  4IFD G;  4DR4 L;  4FF4 A;  1I94 L;  3N6R A;  2F0I A;  4KJO A;  4KLK A;  3T16 A;  3MVV A;  4DV2 L;  1R9T B;  2O5J C;  2SEB D;  1Y8O B;  2Z6K A;  2AKW B;  4DR1 L;  5GQO A;  3SK8 A;  2R92 H;  3KUP A;  3OWF A;  5ELC A;  3K5M A;  3K57 A;  1B70 B;  3TDQ A;  5FO7 B;  3W3A A;  4RHS A;  2KEN A;  3U58 A;  5LMN L;  1SE4 A;  2K50 A;  1UUP A;  3L7Z C;  2NTS A;  1N34 Q;  1SAP A;  3S17 H;  1TS4 A;  1UE7 A;  1U4R A;  3K81 C;  3S14 H;  1QVF A;  3DWP A;  1J6Q A;  2PI2 E;  1F2Y A;  1W3S A;  4HJ5 A;  1HNW L;  4JYA L;  3IFD A;  1EUJ A;  2F0J A;  3A54 A;  5C6A A;  5GAG C;  1KLG D;  3I56 A;  3H3V H;  4DR5 L;  4DR6 L;  1UWV A;  2Z6K C;  1X3F A;  4RFB A;  1XPR A;  3AYH B;  4R8N A;  3CP0 A;  2K52 A;  5C4X H;  4K2K A;  3URY A;  2JA5 G;  2B2W C;  1SBB B;  3H91 A;  1WTX A;  1EY0 A;  1WJJ A;  1VF5 C;  4XT3 B;  1HQR D;  4LF4 Q;  2KQ3 A;  3NE5 B;  1Y1W B;  2PZT A;  3FPU B;  3FDT A;  1ASY A;  2R7F A;  1K0R A;  1KTK A;  3KF8 B;  2VUM G;  1J5E L;  4IFD H;  5I6W A;  2XVS A;  3MWY W;  4Y52 H;  1FGU A;  3GTP H;  1D6E C;  2HIV A;  3CC2 A;  5KYL A;  1EU4 A;  2PMZ E;  5CV7 A;  2PO4 A;  1A3U A;  5C3E B;  4HJA A;  2K03 A;  1B8A A;  5C4J H;  4UP8 A;  4DKA C;  1ET6 A;  3K5L A;  1JE5 A;  3NQI A;  4OIJ A;  3V96 A;  4RH6 A;  3NSW A;  1A63 A;  3TN2 A;  5IGB A;  1J8I A;  4DR3 Q;  3KBX A;  1JCK B;  1MBY A;  3FEW X;  1LTI D;  4JI6 Q;  1PTO B;  5NUC A;  5FLM G;  4KY7 A;  1PRT B;  3T1Y Q;  2NWG A;  4XQJ A;  1KNA A;  4FF1 A;  1XXG A;  1I4P A;  2JSO A;  2PNR C;  1ENC A;  3KDF B;  4DNI A;  3PUW A;  1VMC A;  2B63 H;  3UDG A;  4Y7N H;  1CSP A;  2RHS B;  1PFM A;  2A1A A;  5C4Z A;  2AQ1 B;  1BCP F;  3PUZ A;  1Q7Y C;  3CC7 A;  3NP8 A;  1JB7 A;  1YNN D;  1YHQ A;  3ERS X;  4LF5 Q;  2E2H B;  3I8Z A;  1JOR A;  1NUC A;  1C0A A;  2B2U C;  1KLU D;  1Y8N B;  4DV5 L;  4DV6 L;  4M1U B;  1K8G A;  2JA5 H;  1SFO H;  2AQ2 B;  4ABN A;  4A3G G; 
#chains in the Genus database with same CATH homology
 4LF7 Q;  1TWH H;  3STB C;  2R7Z H;  2ZJR A;  5C0X G;  4R4I A;  2YV5 A;  1KRT A;  3SGI A;  2RHQ B;  1VQL A;  1VQJ A;  2BA1 A;  1K83 H;  3BU2 A;  5GRO A;  2D0O A;  4DV3 Q;  4OX9 L;  4BBS H;  1N33 L;  1XNQ L;  4IJH A;  1CSQ A;  3K7A H;  1XPO A;  2PI2 A;  5IP9 H;  2C35 B;  3K7U C;  4A3J H;  4DR7 Q;  1LTL A;  3FKI G;  4K0K Q;  4JC0 A;  3UDF A;  4BY1 H;  4IO9 A;  3NEM A;  2Y0S E;  4IJL A;  4QIW E;  2VQE Q;  1B7Y B;  4KHZ A;  3GTK H;  1M90 C;  4DUY Q;  3EBE A;  3UE1 A;  1FJG L;  4LFC L;  5GAH C;  4X64 L;  4AH6 A;  1X65 A;  1BBW A;  4GNX C;  1X3E A;  2CQO A;  1YJN A;  1C7Y A;  3ICE A;  4P72 A;  2Q2I A;  2JA7 G;  4B3R Q;  2ZM6 L;  1Q86 C;  4O0A A;  1VQE A;  2IX1 A;  4JOI C;  1SMX A;  2K14 A;  3M4O H;  4BY7 H;  2B63 G;  1AH9 A;  2VQF L;  4A3I G;  4JI3 Q;  3I7F A;  1Y14 B;  4KHP L;  3CC4 A;  4OX9 Q;  3JAM c;  1QUQ B;  1X6O A;  2MQH A;  4LFA Q;  5EAY A;  5FLM H;  2NVT H;  1Z9F A;  3M4Q A;  1PVO A;  1MJC A;  1XNQ Q;  3CCV A;  2R6G A;  2F3I A;  4A3L H;  2QGQ A;  5C0X I;  4BXX G;  1SLJ A;  2E5L L;  4GS3 A;  3RZO H;  4IFD J;  1UE6 A;  4HIM A;  2MO1 A;  5E7N A;  1HR0 L;  2I5H A;  5JEA G;  3CMA A;  3M9B A;  3S24 A;  4C3H H;  4FDB A;  3DM3 A;  3OTO Q;  3J7A 5;  3J80 c;  4A76 A;  1E24 A;  1S3O A;  3K8A A;  4DV7 L;  1YJW A;  4DR3 L;  1XNR Q;  5LMU Q;  4JI4 Q;  1BBU A;  1X9N A;  1YEZ A;  1UE1 A;  4AYB G;  2ZM6 Q;  2ZJQ A;  1NY4 A;  2JK8 A;  1YI2 A;  1A8V A;  3AFQ A;  3T1Y L;  2VY3 A;  1Q81 C;  3CCL A;  2MO0 A;  3W1B A;  2ES2 A;  2VQF Q;  5IP9 G;  2K75 A;  4KHP Q;  3FHW A;  2DUD A;  3HOX H;  4A3J G;  1G6P A;  2FXQ A;  1IBM Q;  4A3G H;  2EQS A;  2YTV A;  3GD7 A;  5IP7 H;  4BY1 G;  1K8A C;  1VQM A;  4O2D A;  4PMW A;  1Q46 A;  4C2M H;  2UXC L;  5ELN A;  3J80 i;  3HOZ H;  1SE8 A;  2LXJ A;  3L0O A;  4X65 Q;  3E9H A;  4BA1 I;  4B3M L;  3RN5 A;  2BH2 A;  1VQ4 A;  1EIY B;  4JI0 L;  3G6E A;  4B3T L;  2KCT A;  1XTD A;  1HR0 Q;  4GN4 B;  5HGQ A;  4B3S L;  4OWW B;  4YCU A;  4PZ7 A;  1VQ6 A;  3LGJ A;  3AFP A;  3KF6 A;  4LF5 L;  4A93 H;  1OXU A;  4JI2 Q;  1PYB A;  2WP8 J;  1EOV A;  3A5Z B;  1VQD A;  5J3B A;  4BY7 G;  4GNX B;  4HJ7 A;  2QEX A;  4MNO A;  4QGU A;  4L5Q A;  4DK3 C;  3PGZ A;  3GO5 A;  1EWI A;  3PCO B;  2UUB Q;  3GTG H;  3DLL A;  1C9O A;  3CPW A;  4IPC A;  4ALP A;  3EN2 A;  4LFB Q;  1GD7 A;  4LF7 L;  1E1O A;  3M85 A;  1VQO A;  2JEB I;  1CUK A;  1D7Q A;  2JA7 H;  4A3L G;  1IBK L;  2LXK A;  2MNA A;  2E2J H;  3I4N G;  4DV3 L;  3I2Z A;  3A0J A;  1UEB A;  2ZTD A;  3PSI A;  4A3I H;  3D31 A;  3ULJ A;  3A74 A;  4POF A;  4HIK A;  1VQK A;  4DAY B;  2WAQ E;  4DR7 L;  3CF5 A;  4B3M Q;  2KHJ A;  4K0K L;  2R93 H;  3K0X A;  1AE2 A;  2DGY A;  2JA8 H;  2H5X A;  2VQE L;  1HZ9 A;  3GTJ H;  1EQQ A;  3OW2 A;  4BXX H;  1G29 1;  4JCV E;  5DLQ E;  2D0P A;  2K5H A;  4P71 A;  4DUY L;  4B3S Q;  1PA6 A;  4WJ3 M;  1MIU A;  2K5V A;  4PZ6 A;  4DV0 Q;  1VQG A;  3M4P A;  4WJ4 A;  1OXV A;  1RIP A;  4DV1 L;  3H0G G;  4A3K G;  1YZ6 A;  1WOC A;  2I5L X;  3GTQ H;  2IY5 B;  3TRZ A;  5AJ3 L;  3RLF A;  1KAW A;  4YWM A;  4B3R L;  5JJL A;  2WB1 E;  2YYZ A;  2LSS A;  1JJ2 A;  2XTI A;  1VQF A;  3S2D H;  4DUZ L;  3HOX G;  1YVC A;  4A3D H;  1T9H A;  1S72 A;  1IXR A;  1I3Q H;  5IP7 G;  3VDY A;  1Q82 C;  1PH9 A;  2AWN A;  1BKB A;  1XMO Q;  4JI3 L;  1IBK Q;  1PHJ A;  3HOZ G;  5IY0 A;  4GOP A;  2UXB L;  5M5Y H;  4LFA L;  1JT8 A;  2CKZ B;  1U5K A;  3ULL A;  1X54 A;  3HOW G;  4GLA C;  1R9T H;  2F4V L;  1TWG H;  2JQO A;  3S1Q H;  1HNZ L;  2UUA Q;  4HJ8 A;  1YHB A;  2XGT A;  4YWL A;  2D62 A;  3F2D A;  1P16 A;  4APV A;  1XJV A;  4JI7 L;  1D8L A;  5M5W H;  4A93 G;  3KDF A;  3RNU A;  2HQL A;  2NVX H;  1E3P A;  1LUZ A;  2CWP A;  4GLX A;  4JI1 Q;  1W2B A;  1YBY A;  4JBK A;  5IT9 c;  1Q8K A;  1A0I A;  1WYD A;  2RF4 A;  4YHH Q;  3OTO L;  1VS0 A;  2Y0S G;  4DV4 L;  2QA4 A;  1HZA A;  2VZA A;  4IOC A;  1QZH A;  2Q2U A;  1PYS B;  4A3G G;  1XNR L;  3TRE A;  4DV1 Q;  1TXY A;  5LMU L;  4JI4 L;  4BA2 I;  1V43 A;  3F8T A;  3IRB A;  5AJ3 Q;  3J7Z C;  3K80 C;  4JBM A;  5IYB H;  3UDX A;  1CKN A;  1FVI A;  2PQA A;  4NPS A;  1L2F A;  4JI8 L;  4DUZ Q;  4LUZ A;  3TS0 A;  3J81 c;  4TVA B;  2GN5 A;  2N3S A;  4OON A;  3STB D;  2K4K A;  3CW2 C;  5ELO A;  1LYL A;  3T1H Q;  3G71 A;  1M1K C;  1OTC A;  2ASB A;  1HH2 P;  2UXB Q;  4PG3 A;  2UUC L;  1IBM L;  1OXS C;  1HJP A;  2R93 G;  1PH5 A;  3HOY G;  4GKJ L;  1Q1B A;  5IWA L;  4JG2 A;  2JA8 G;  1NJI C;  2F4V Q;  3I4N H;  4LF9 L;  1HNZ Q;  1N32 L;  4X65 L;  2YTY A;  4JV5 L;  4NXN Q;  1S40 A;  4JI7 Q;  2VW9 A;  4GOP C;  1G51 A;  2OQ0 A;  3BZK A;  3PF5 A;  1I94 Q;  2R7D A;  3J81 i;  4X6A H;  1IL2 A;  1VCI A;  2ID0 A;  2OWO A;  1PH3 A;  1TWC H;  1WI5 A;  3KJO A;  5C0X J;  4A3C H;  4DV4 Q;  4JI2 L;  3RLN A;  3PUX A;  4R4O A;  1QVG A;  4A3D G;  1L0W A;  2YTX A;  3W1G A;  2CCZ A;  5FJ8 G;  4QL5 A;  3HFZ B;  4JI5 Q;  4R4Q A;  1CKM A;  2JJQ A;  3JC6 6;  3W5O A;  4JI8 Q;  2UUB L;  3CD6 A;  1GM5 A;  1BVS A;  1X55 A;  3H0G H;  4A3K H;  1NBW A;  3RLO A;  1HR0 W;  3L2P A;  4LFB L;  1XMQ Q;  3S1N H;  3CCS A;  3I4O A;  3KF6 B;  5LMN Q;  3BZC A;  2ZJP A;  1NMF A;  1P8L A;  1WCM H;  2UUC Q;  2MFI A;  1Y1W H;  5C44 H;  4GKJ Q;  5IWA Q;  1KC8 C;  3OYY A;  1LM0 A;  4A3F H;  2E2I H;  3KJP A;  4LF9 Q;  1N32 Q;  4RMF A;  3HKS A;  4QJF A;  3E9I A;  4JV5 Q;  2OTJ A;  4R1J A;  4A3M H;  1QUQ A;  3HOW H;  2B3G A;  4HIO A;  3Q8D A;  3PUY A;  2CFM A;  2OCE A;  4BBR G;  3RN2 A;  1KXL A;  4J15 A;  4JBW A;  4C3I H;  2IX0 A;  4HJ9 A;  4A3B G;  2HIX A;  2EIF A;  5IYB G;  4LNQ A;  4QQB X;  1NTG A;  4DV0 L;  1XPU A;  4A3E H;  4JYA Q;  1HNW Q;  5H1S E;  4DAM A;  1OXX K;  1VQH A;  5C3E H;  1SRO A;  4P75 A;  2NN6 G;  4RG1 A;  1PH1 A;  3HOV G;  3KYH C;  4GKK Q;  2VS1 A;  4OXP A;  3S1R H;  2OTL A;  3GTO H;  1MKH A;  2Z0S A;  3UDI A;  3CCR A;  4X66 L;  1EYG A;  1N36 L;  4DR6 Q;  3U50 C;  5GAE C;  1XMO L;  3PF4 A;  4XTC S;  1PH7 A;  2YU9 H;  1X3G A;  1H95 A;  1HZB A;  4YCV A;  3G4S A;  4HID A;  3FP9 A;  4L5T A;  3ULP A;  1O7I A;  1YHA A;  4IPG A;  2JE6 I;  1WFQ A;  2UUA L;  2ATW A;  3PO2 G;  1HNX Q;  2IHF A;  2GVA A;  5FLX c;  3H15 A;  1MJE A;  4A3C G;  3HOY H;  3EIV A;  4AIM A;  1JJG A;  1VQC A;  3HKZ E;  3KOJ A;  4R4T A;  1SRU A;  4GOP B;  2WAQ G;  2HHH Q;  1VQN A;  2L15 A;  4JI1 L;  2WFW A;  3AQQ A;  5HY6 A;  1YIJ A;  4YHH L;  1J5E Q;  1Z47 A;  1VQ7 A;  1KIX A;  3CAM A;  2UXD Q;  1A62 A;  2AWO A;  2E8G A;  2VL6 A;  2I0Q A;  3KLW A;  1PH8 A;  4ME3 A;  4MZ9 A;  1WCM G;  4X62 Q;  4X66 Q;  1Y1W G;  3E0E A;  5FJ8 H;  3B6Y A;  5C44 G;  1N36 Q;  2NN6 I;  4LF8 Q;  5C4X G;  2WB1 G;  1FL0 A;  3ER0 A;  3NBH B;  4C3J H;  4A3F G;  2E2H H;  3T1H L;  5JJK A;  4GNX A;  1TWA H;  3PIO A;  4UY8 C;  2ZTE A;  3F1Z A;  3G48 A;  5M5X H;  2CWA A;  3I55 A;  3CCU A;  4LWC A;  4A3M G;  4L5R C;  4LF6 Q;  1GKH A;  1KD1 C;  1X56 A;  1IYJ B;  4L5S A;  1KRS A;  4NXN L;  1EFW A;  3WWV A;  1HZC A;  4A3E G;  5M3M G;  4DR4 L;  3UE0 A;  4IFD G;  4PZ8 A;  1I94 L;  1YNX A;  5C3E G;  2UU9 Q;  4KLK A;  3F2C A;  4DV2 L;  5IYC H;  1OXT A;  4LW1 A;  3GTL H;  1JJC B;  3PUV A;  2Z6K A;  2AKW B;  3MEF A;  4LUO A;  5GQO A;  1KL9 A;  4BBR H;  4DR1 L;  2R92 H;  4JI5 L;  2BA0 A;  1PH4 A;  4A3B H;  2AMC B;  1Q12 A;  5BR8 L;  1VQ8 A;  2VUM H;  4YWK A;  4A4I A;  3H3V I;  3HOU H;  1B70 B;  2A19 A;  3BJU A;  3CCJ A;  3CCE A;  3U58 A;  2KEN A;  1XMQ L;  5LMN L;  3HOV H;  2K50 A;  3PO3 H;  1L1O A;  3L7Z C;  1TWF H;  1N34 Q;  2PNH A;  1I6H H;  3TQY A;  3S17 H;  4P74 A;  1QVC A;  1PH6 A;  3MXN B;  1Y1V H;  3NEL A;  1PV4 A;  1UE7 A;  1IBL L;  4DV6 Q;  1I5F A;  3PIP A;  4XIG S;  3K81 C;  4DV5 Q;  4LF4 L;  5LMN W;  3S14 H;  4DR4 Q;  4DR2 L;  1QVF A;  2RCN A;  3PO2 H;  1J6Q A;  2PI2 E;  4DV2 Q;  1KQS A;  1W3S A;  4HJ5 A;  1HNW L;  4JYA L;  2OQK A;  4IFD I;  2NZO A;  4AQY L;  4JBJ A;  1EUJ A;  2JA9 A;  4DR1 Q;  1NMG A;  4YCW A;  1VQP A;  1GO3 E;  1EQR A;  4GKK L;  2NZH A;  5BR8 Q;  5GAG C;  1GVP A;  2B29 A;  1N33 Q;  3GTM H;  2N8N A;  3I56 A;  3H3V H;  2GVB A;  1YJ9 A;  4NXM L;  4DR5 L;  4DR6 L;  2Q2H A;  1UWV A;  2Z6K C;  1X3F A;  1XPR A;  3AYH B;  3U4V A;  5IYD G;  4A75 A;  1AE3 A;  3I4M G;  3TEH B;  4IOA A;  5M3F G;  1K73 C;  3CP0 A;  1PH2 A;  2K52 A;  5C4X H;  4IPD A;  4KI0 A;  4YY3 L;  2JA5 G;  4LFC Q;  1K3R A;  4MTN A;  1Q1E A;  4POG A;  4DPG A;  1FJG Q;  4OO1 G;  4AYB E;  3CCQ A;  2JA6 H;  4X64 Q;  1HNX L;  3S2H H;  5IYC G;  3JAM i;  1WJJ A;  2HT1 A;  1IBL Q;  1L1O C;  4LF4 Q;  2R7Z G;  3S1M H;  2HHH L;  4DR2 Q;  4JI6 L;  2R92 G;  4GN5 A;  4OWX B;  1RL2 A;  1ASY A;  2R7F A;  1K0R A;  1U0L A;  1EIF A;  3KF8 B;  2VUM G;  4BBS G;  1J5E L;  3CQZ H;  4OWT B;  5M3M H;  4R4C A;  4AQY Q;  3HOU G;  2UXD L;  4Y52 H;  1FGU A;  4DK6 C;  3GTP H;  2HIV A;  1E7Z A;  4UP9 A;  3PO3 G;  2N49 A;  3CC2 A;  4X62 L;  3TS2 A;  4LF8 L;  1UE5 A;  2E5L Q;  4DR5 Q;  4NXM Q;  4NB3 A;  2PMZ E;  1QZG A;  3RR5 A;  2KBN A;  5IE8 A;  4HJA A;  2A8V A;  1B8A A;  5JEA J;  1Y1V G;  5JJI A;  4H02 A;  5C4J H;  2V1C C;  2KCM A;  4UP8 A;  2EXD A;  1SN8 A;  4DKA C;  4YY3 Q;  4LF6 L;  1JE5 A;  3FKI H;  4EQ5 A;  3NEN A;  3D0F A;  1VQI A;  2BH8 A;  2ALY B;  4EX5 A;  3PV0 A;  1A63 A;  2N78 A;  4DV7 Q;  2VNU D;  4DR3 Q;  3CPF A;  3ZJY C;  1N8R C;  4LUV A;  4OO1 I;  1SR3 A;  4JI6 Q;  2UU9 L;  1V1Q A;  5FLM G;  2NVQ H;  1VQA A;  3T1Y Q;  4GLV B;  3HKZ G;  1YIT A;  4UP7 A;  1N9W A;  3U4Z A;  1K9M C;  3CXC A;  2JEA I;  4IPH A;  3M7N A;  3KDF B;  4DNI A;  4TQU S;  4UPA A;  3AEV A;  4GN3 B;  3PUW A;  1VQ9 A;  2B63 H;  3UDG A;  3GDE A;  2UXC Q;  4Y7N H;  1PFS A;  1E1T A;  1CSP A;  3CME A;  1I50 H;  2RHS B;  3CCM A;  2A1A A;  2F52 A;  5GAD C;  4JI0 Q;  5K36 G;  4B3T Q;  3RZD H;  2JA6 G;  3PUZ A;  1Q7Y C;  1N34 L;  3CC7 A;  1JB7 A;  1V9P A;  3J81 j;  1KHI A;  1IZ6 A;  1CKN B;  1E22 A;  2PQA B;  4JOI A;  1ASZ A;  2Q2T A;  2ZTC A;  1YHQ A;  1CKO A;  3ERS X;  4LF5 Q;  3S16 H;  3F2B A;  2I5M X;  1VQ5 A;  3I4M H;  2NVY H;  5IYD H;  1C0A A;  4P73 A;  5M3F H;  3M3Y H;  2IT1 A;  2AHO B;  3A5U A;  4DV6 L;  4DV5 L;  1K8G A;  1VQB A;  3KFU A;  3S15 H;  2JA5 H;  2K5N A;  4QY7 A;  1SFO H;  2IHE A;  1L1O B;  1DGS A;  1NE3 A;  2KHI A;  1JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...