4JBJA

Structural mimicry for functional antagonism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
198
structure length
198
Chain Sequence
MTPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Structural basis for termination of AIM2-mediated signaling by p202
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 43
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbjA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbjA01
2CKZB 3JC66 1PH8A 2RHSB 5JEAJ 3W1BA 4HJ5A 3GTQH 4BY7H 4DR7L 3OTOL 4QL5A 2BH8A 3BU2A 1IBKQ 3VDYA 4LF9Q 1S40A 2AHOB 4OX9Q 3F8TA 1A63A 3K80C 4YCWA 1UE1A 3U50C 3CP0A 2UUCL 4DV7L 1V9PA 1XNQQ 3MXNB 4DV6L 3ICEA 3S1NH 4GN5A 3CPFA 1EQRA 3NEMA 4BBSG 3GDEA 1HNZQ 2KHIA 3PUWA 4LF4Q 1N34L 2A1AA 4DPGA 3S17H 4NXNL 2ZM6Q 1VQEA 4YCVA 1S72A 1VQLA 2JA7H 2R93H 1KD1C 2YTVA 2VUMH 1OXTA 4DV0Q 3CD6A 3CXCA 2HHHL 4MZ9A 4A3EG 1CSQA 4GNXC 1QVGA 4LF6L 4IPGA 2E2IH 5K36G 1BBUA 1E1OA 1Q1EA 4LW1A 5IWAL 1WOCA 1IL2A 4JI0L 1ASYA 4B3TQ 2UUBQ 3H3VI 2AMCB 4JI6L 3H3VH 3HOUG 5DLQE 1YJ9A 2ASBA 1NMFA 1PH4A 2HIXA 4IPDA 4GOPC 4Y52H 2JE6I 2N8NA 3E9HA 3K8AA 4JBMA 1HNWQ 4OO1G 5C3EG 4IO9A 1XMOQ 2EXDA 3J80c 2ZJPA 2VY3A 1YITA 1XMQQ 1J5EQ 1VQMA 1IBKL 2I0QA 4B3ML 3PIPA 3G6EA 3CCMA 3B6YA 1N32L 3I4MG 3PO3H 4HJ9A 2Z6KC 1KL9A 1M1KC 1N33L 1X55A 2C35B 4O0AA 4JYAQ 2V1CC 2OQKA 5GQOA 4IOAA 4BBRG 3S24A 1XPOA 2JA5G 4LF4L 1XPUA 2F4VQ 4A3FH 1SN8A 1VQJA 1CSPA 2BA0A 4P72A 4LWCA 1YZ6A 3HOYH 3A5ZB 3PSIA 3A5UA 4DV0L 3TS0A 3S1QH 1E22A 3T1HQ 1HZBA 1ASZA 4A3IH 1VQGA 3L2PA 4KHPQ 1I5FA 4APVA 3M85A 1OTCA 4GOPA 2Q2IA 1KC8C 1E7ZA 2UUBL 1V1QA 4A3JG 2JK8A 3UE0A 5IT9c 5FLMH 1PH6A 5IP7H 3U4ZA 1KIXA 4LUVA 1YJNA 1HNWL 2UXCQ 1V43A 1JJCB 2I5MX 3KLWA 1I50H 4QIWE 2Z6KA 2JA7G 2R93G 4DR5Q 1QUQB 2WAQE 4LF8L 3S14H 3D31A 2IHFA 1GO3E 2OTJA 4MNOA 3RR5A 4X64L 4ALPA 1VQHA 1WFQA 2YTXA 5HGQA 3I4NH 2HIVA 1KRTA 3PIOA 3Q8DA 3U58A 3HKSA 1VQ8A 1FJGQ 2R7ZH 3HOWH 1SMXA 4JC0A 1NJIC 3GTPH 1N36Q 3NBHB 3PGZA 3STBC 2F4VL 4X62L 2JA8H 5JJLA 2VL6A 2KBNA 5JJIA 1TXYA 4YWMA 1VS0A 5BR8L 1HZCA 3CW2C 4UP9A 5GAHC 2MNAA 4A93H 2WAQG 4JI7Q 2N49A 4DAYB 3PUYA 3T1YL 4DR6L 2F3IA 4AH6A 2VW9A 1JMCA 4BA1I 4PZ6A 1WYDA 4K0KL 1XNRL 1TWCH 1NE3A 4GNXB 2UUAQ 1TWFH 2UXBQ 3A0JA 1MKHA 2D0OA 1B8AA 2IHEA 1EUJA 3HKZE 4DV2L 1NBWA 1M90C 4C3HH 1PA6A 1D7QA 4DV3Q 2ZJRA 4A3FG 3CPWA 3S16H 4DR5L 4GOPB 4YHHQ 2Q2TA 1HR0Q 1PH2A 3ZJYC 3S15H 4A3IG 2K14A 2E2HH 1L0WA 4YY3Q 1C0AA 3BJUA 4IFDG 4GKJL 1PFSA 2E8GA 2NN6I 1EOVA 2PQAA 4DV5Q 3DM3A 2VQEL 4KHZA 4X65L 1N36L 1GKHA 1L1OC 3HKZG 3PUVA 1EQQA 5FLMG 1FL0A 5IP7G 1VQBA 4HJ7A 3PO2H 4NXMQ 1AE2A 4DNIA 1T9HA 1UE6A 2KENA 3UE1A 4HIDA 1GD7A 3G48A 4IFDJ 3CCEA 5IYCH 3F2BA 1PH3A 4OO1I 1G291 1A62A 1GVPA 1Q46A 3I4OA 1E1TA 1SRUA 4L5TA 3E0EA 4P74A 5GAEC 4JI5Q 1C7YA 2NVYH 3I4NG 2K5HA 1RIPA 3FP9A 3NELA 1PH9A 4DV1L 3HOWG 2R7ZG 5GAGC 1Q12A 3F1ZA 2JA8G 1X54A 5IE8A 3D0FA 4A3MH 1QVFA 2NVQH 1HJPA 4BA2I 4DUYQ 4JI3L 3M9BA 2IX1A 3CQZH 4POGA 4GKKQ 2H5XA 3A74A 1VQAA 4A93G 4B3RQ 4DR1L 2I5HA 3KOJA 1L1OA 4TQUS 2WB1E 2K52A 4YY3L 3LGJA 4LFCQ 4BXXH 5H1SE 1JJGA 2Z0SA 4P75A 5LMUQ 4A76A 4QJFA 4HIOA 4A3JH 3CCUA 1CUKA 1Y14B 3KJOA 5IYDG 2OTLA 3CCSA 4X6AH 4R4IA 2KCTA 1U5KA 5M3FH 2HT1A 1TWHH 2PQAB 3ERSX 1HZAA 1VQDA 4HJ8A 2ES2A 2UU9Q 2WB1G 3K81C 3PV0A 3GTMH 2BH2A 4C3IH 2NZOA 3HOXH 2CQOA 5M5YH 4JI8Q 2LXJA 2NN6G 4JI2Q 2N3SA 3I7FA 1PYBA 5LMNL 4MTNA 1QUQA 4LFAQ 4LFBQ 5E7NA 1YHQA 3MEFA 2ATWA 4DUYL 1IBML 1JE5A 3PO2G 4YCUA 4A3BH 5C4XH 4GKKL 2PMZE 1VQPA 1N8RC 5IYCG 4DAMA 1KAWA 1I94Q 3RLNA 1P8LA 3K0XA 2XTIA 4LF9L 1A0IA 2YV5A 2QA4A 2LSSA 3J7A5 4OX9L 4R1JA 2ID0A 1Q82C 1X9NA 3RNUA 1VQ9A 2LXKA 1XNQL 3PF4A 1L1OB 3HOVH 1HNXQ 1XTDA 1HNZL 3F2CA 3U4VA 4A3MG 1VQNA 4HIKA 4DV4Q 4AYBE 3FKIH 4OXPA 1U0LA 4JI1Q 2ZM6L 1YHAA 4GNXA 2CFMA 1IXRA 2RCNA 1YVCA 4JBWA 2JQOA 1VQIA 1TWGH 1X3EA 1TWAH 3S1RH 4JI4Q 3J81j 3L7ZC 4IFDI 4JI8L 2FXQA 4BXXG 1WI5A 2VNUD 2PI2A 2EQSA 1YI2A 1X56A 4A75A 4LFBL 3CCLA 4B3TL 4DR4Q 2QGQA 2MO0A 3CCQA 4JV5Q 4A3LH 4WJ4A 2YTYA 1LYLA 3OW2A 1J6QA 1N9WA 4AYBG 5AJ3Q 4UY8C 5M3FG 4IOCA 1BBWA 4QY7A 1XMOL 1XMQL 4BY1H 4EQ5A 2D62A 1J5EL 1FVIA 3AFPA 3GTGH 1SROA 3F2DA 1A8VA 4X66Q 1X65A 3K7AH 4A3DH 4GN3B 3AEVA 5EAYA 4LNQA 3DLLA 4PMWA 2IY5B 3EN2A 4KI0A 3HOXG 3H0GH 4JYAL 2WP8J 3L0OA 1C9OA 5C0XG 5IY0A 4A3BG 1QZHA 1OXVA 3PUZA 3ULLA 5C4XG 1LTLA 2D0PA 4GLAC 4R4CA 4GLVB 2VQFQ 3M4QA 4IJLA 4UPAA 4XIGS 2ZTEA 3T1HL 5IYBH 2PNHA 2R6GA 5C0XJ 3HFZB 3M3YH 4KHPL 2JA6H 4NB3A 4OWXB 2AKWB 3CF5A 4DR4L 3RN2A 2HQLA 4DK6C 1PHJA 2K4KA 3S2DH 4LF7Q 1KHIA 5HY6A 3M4OH 2Q2HA 1Z9FA 2R92H 1VQOA 3HOVG 5AJ3L 2UXCL 4R4OA 2CWAA 2GN5A 2RHQB 3AYHB 4LUZA 4NPSA 4AQYQ 1MJEA 3RLFA 4IPHA 5IYDH 3FKIG 2ZJQA 3GTJH 1KRSA 3CCJA 3PCOB 2JEAI 4FDBA 1WJJA 1EWIA 2MFIA 1FJGL 1L2FA 4DUZQ 5LMNW 1PV4A 2AWOA 5IP9H 4R4TA 3AFQA 4A3LG 4PG3A 2VQFL 1EYGA 1EIFA 4A3GH 4RMFA 1K8AC 4JI7L 5ELNA 1SFOH 4BY1G 3RZDH 2GVBA 2CCZA 2E5LQ 4L5RC 3M7NA 1NY4A 3WWVA 1IBLQ 2NVXH 4L5SA 4A3DG 2I5LX 2UUAL 2UXBL 5GADC 4DR2Q 3KF6A 2UUCQ 3H0GG 2PI2E 2DGYA 5FLXc 4DR7Q 2MQHA 2GVAA 4JBKA 2IT1A 4DV3L 4AQYL 4HIMA 1AE3A 3W1GA 3OYYA 1YJWA 2F52A 4H02A 5C4JH 4YHHL 4PZ7A 1YHBA 1HR0L 1Q1BA 1EIYB 1VQ6A 1OXSC 4JG2A 5IYBG 3FHWA 3EBEA 4DV7Q 3CCRA 4DV6Q 2JA6G 3H15A 3J81i 1XJVA 1D8LA 4DV5L 2CWPA 1N34Q 1XPRA 4NXNQ 3I2ZA 1MIUA 3TQYA 4NXML 3G71A 4GS3A 2R92G 1PH1A 1PH5A 4XTCS 2HHHQ 3JAMc 2JA9A 5M5XH 3KFUA 4KLKA 2R7DA 4UP7A 1K8GA 1IBLL 3PF5A 4B3SQ 2OQ0A 4JI0Q 4JI5L 4JI6Q 1BKBA 4DR2L 2EIFA 3GD7A 1PYSB 1VQCA 1MJCA 3W5OA 2WFWA 3K7UC 1YBYA 5ELOA 2K50A 5IP9G 3UDIA 5C0XI 2L15A 4B3MQ 1YNXA 1JT8A 4J15A 1X3FA 3SGIA 1N32Q 4A3GG 3UDXA 3KF6B 4GN4B 4B3RL 1NTGA 1PH7A 3CMEA 3J7ZC 5M5WH 1Q81C 1N33Q 1QZGA 4DR3Q 3ULJA 4LFCL 2YYZA 5LMUL 2Y0SE 5M3MH 3E9IA 5GROA 4Y7NH 2QEXA 5FJ8G 3STBD 3S2HH 5J3BA 1CKOA 5C44H 4QGUA 1EFWA 2Q2UA 4B3SL 1JJ2A 4JOIC 2UU9L 2DUDA 1WCMG 2B63H 3UDFA 2K5VA 4GKJQ 4A3KH 2Y0SG 3M4PA 1RL2A 4WJ3M 4EX5A 4JI2L 5JJKA 1JB7A 1K3RA 4C2MH 3CC4A 4LFAL 2A8VA 1YEZA 3CCVA 4LF8Q 3ULPA 1SLJA 1G51A 3RZOH 4X64Q 1DGSA 1I94L 1UE5A 4YWLA 3KYHC 4DR3L 1QVCA 4JBJA 3JAMi 1KXLA 1K83H 2JEBI 2YU9H 4A3CH 1PVOA 1IZ6A 4O2DA 2BA1A 1Y1WH 4X62Q 1X6OA 4UP8A 1Y1VH 1UE7A 5BR8Q 4JOIA 4BY7G 2ALYB 1HNXL 3T1YQ 4DR6Q 4P71A 4C3JH 1K73C 2NZHA 1P16A 2K5NA 4P73A 4DV4L 1W3SA 1K9MC 2E2JH 3HOZH 3AQQA 3KF8B 4JI1L 4YWKA 1SE8A 1KQSA 1XNRQ 1HR0W 1AH9A 1VQKA 1W2BA 3IRBA 3CMAA 3ER0A 4OONA 3J81c 4R4QA 4DV2Q 1S3OA 2ZTCA 1FGUA 4JI4L 2RF4A 2N78A 2OWOA 1E24A 3GTKH 5M3MG 1CKMA 4DK3C 3CC2A 2XGTA 2VUMG 4L5QA 4JV5L 3KJPA 4IPCA 5C44G 2VS1A 1YIJA 3G4SA 1HH2P 1HZ9A 1LUZA 4LUOA 1NMGA 2B29A 1G6PA 1Q86C 2VQEQ 4X66L 4X65Q 1VQ7A 1I3QH 1BVSA 1VQ4A 2B63G 2KHJA 3TRZA 1UWVA 3CAMA 4K0KQ 4A3KG 3UDGA 2ZTDA 1UEBA 3KDFA 1OXUA 1R9TH 4QQBX 1Q7YC 2JJQA 1LM0A 2MO1A 1CKNA 1X3GA 3J80i 3TREA 4OWTB 3PO3G 3PUXA 1IYJB 4JCVE 2NVTH 3BZKA 4IJHA 1K0RA 4DV1Q 2VZAA 3GO5A 4A3CG 3TS2A 4POFA 4BBSH 2A19A 1Y1WG 2UXDQ 1Y1VG 2IX0A 4JI3Q 4LF5Q 3HOYG 2B3GA 2UXDL 4LF7L 3I55A 3S1MH 5FJ8H 4DR1Q 3CC7A 1O7IA 1H95A 4A3EH 3OTOQ 3HOZG 1OXXK 2AWNA 2K75A 4A4IA 4HJAA 1VQ5A 4RG1A 3RN5A 1VCIA 4TVAB 1WCMH 3GTLH 2KCMA 3HOUH 3NENA 4AIMA 2R7FA 4OWWB 4DUZL 5C3EH 1B7YB 1E3PA 4GLXA 3EIVA 2OCEA 3I4MH 3RLOA 4LF6Q 3KDFB 5JEAG 2E5LL 4DKAC 3TEHB 3GTOH 1I6HH 5IWAQ 4PZ8A 5LMNQ 4BBRH 1Q8KA 1Z47A 1B70B 1CKNB 1SR3A 3I56A 1GM5A 1IBMQ 2JA5H 4LF5L 1VQFA 4ME3A 3BZCA
chains in the Genus database with same CATH superfamily
2E74C 2CKZB 4HJ5A 4H44C 4BY7H 1DZ1A 3OTOL 4U68A 5CV4A 1WTQA 1S40A 2AHOB 5E3FA 4OX9Q 3K80C 3D4WA 1XYIA 1XNQQ 4GN5A 3CPFA 4ZCKA 3SXHA 3PUWA 5J1ZA 1N34L 3W2DA 4NXNL 2ZM6Q 3FVQA 2VUMH 4A3JB 1EFID 3DWAA 4DV0Q 3I4LA 4A3EG 1ZKOA 1RJTA 4IUVA 4GNXC 1E1OA 4LW1A 1PZKD 4KN4C 5JVH3 1ASYA 4JI0L 2UUBQ 2AMCB 4JI6L 3H3VH 5DLQE 4G4KA 2ASBA 5BN3A 1PH4A 3E9HA 3U9OA 4OO1G 2K5DA 4IO9A 1XMOQ 1J5EQ 3G6EA 4XQJA 1V8QA 1QG7A 1SNCA 2P5ZX 4HJ9A 1MGSA 3L9AX 1KL9A 2V1CC 3MXUA 4HAEA 1PRTB 2HD3A 4IN3A 4X3TA 1Z6HA 3I8ZA 3S24A 4LF4L 1E2ZA 1WTHA 5CV8A 4P72A 4IUQA 1EU3A 3PSIA 1E22A 1HZBA 3URYA 2XN9C 1SMYD 1XX8A 3M85A 3FKIB 4DK0A 1QNKA 3WOEA 1H9RA 3UE0A 3U4ZA 1RHPA 2O2LD 1HNWL 3PIP3 1V43A 1WVLA 2JA7G 2AUJD 2R93G 3S14H 4QMGA 3NQIA 2EYFA 1VQHA 4FVMA 1B53A 3H94A 1KRTA 2Z4HA 1CZWA 3GTPH 1N36Q 3STBC 1SYGA 4YWMA 2CW0D 3CW2C 1SNOA 2MNAA 5GAHC 1SE3A 4DAPA 1CHQD 2WAQG 4K14A 2KA7A 1HHVA 4AH6A 3GTPB 3N6RA 4K0KL 2JP1A 5FKAC 1XNRL 2A6HC 3OIQA 1TWFH 1B9NA 2L5TA 2D0OA 1MD2D 2IHEA 1EIGA 1EUJA 3HKZE 4DV2L 1NBWA 1Y8PB 1FD7D 1PA6A 3CPWA 1A6XA 1TWFB 3PIO3 1QNUA 3M4OB 3ZJYC 4N9TA 3MXNA 1C0AA 2EOTA 4NKLA 1CA6A 2QDBA 1PFSA 2NN6I 2PQAA 3DM3A 1LT4D 1GKHA 1FL0A 5IP7G 1AE2A 4DNIA 2RDHA 2XIWA 2RCFA 3GQBA 2HDMA 1E1TA 2CH4W 3E0EA 2SNSA 2KEDA 1ET9A 1G2SA 5ELCA 3IL8A 2KVMA 4DV1L 1X3QA 1Q12A 3I3CA 3A8KE 2DJGC 2UXDL 2IX1A 4EQPA 4A93G 1A15A 3MWYW 3CRKC 4RKLA 4B3RQ 3X3NA 2PMZB 4BXXH 4A76A 5C4JB 2EYLA 4QJFA 4V190 4R4IA 2KCTA 5M3FH 4EVOA 1TWHH 3J81E 2VB2X 3ERSX 3K81C 1ZYRD 3PV0A 3GTMH 4C3IH 1SJHD 1D2BA 1TWHB 4MIUA 2N3SA 1PYBA 4RGOS 2NTTA 4LFAQ 5E7NA 4A3BH 1EWCA 5C4XH 2JN4A 3DXJC 1GUTA 3VYUA 1VQPA 4C3IB 5IYCG 1I94Q 1KAWA 1ICWA 1MBYA 4A3BB 1LTRD 3J7A5 1SXTA 1JORA 4G7ZC 5JOBA 2EYPA 1X9NA 3QOLA 1EY9A 2LXKA 3PQIA 3HOVH 2EZVA 1SYBA 1HNZL 1U4LA 5DM63 3K5MA 1IXRA 2RCNA 4J1MA 1VQIA 4K2KA 4BS9A 2HUGA 1M4VA 4CDEC 4BWGB 2MHVA 2EQSA 2Q8TA 4B3TL 1EYAA 2QGQA 2MO0A 4JV5Q 1ML0D 1N9WA 1QJOA 4IOCA 1XMQL 4EQ5A 2D62A 4C2MB 1FVIA 1IHZA 3AFPA 1PXUA 1A8VA 1DXMA 2MJ8A 3K7AH 4A3DH 3A54A 4GN3B 4IUTA 3DLLA 3N52A 3HOXG 1O7ZA 1PRTD 3L0OA 5C0XG 2KEEA 3DHQA 1Y1WB 3K7AB 1DJRD 3I90A 1LTLA 2TSSA 3AU7A 3FEWX 2VQFQ 4IUNA 5I2XA 2A6EC 3T1HL 4H7BA 5IYBH 1TVXA 3EFXD 1TT2A 1YNJD 4FF4A 1O7YA 3CF5A 4FO2A 1KHIA 2Q2HA 2DNEA 1HQMC 2GN5A 4LUZA 4AQYQ 3RLFA 4ZKBB 1KRSA 3K5OA 2JEAI 1WJJA 1EY8A 1EWIA 1JOOA 1FJGL 2ZT9C 1L2FA 1WD0A 4DUZQ 1T5EA 5LMNW 5IP9H 4R4TA 4HN7A 3WOFA 1MSHA 1EYGA 1F9PA 1K8AC 3NPPA 5ELNA 1SFOH 2CQAA 4BY1G 2E5LQ 1SYCA 2CH4A 2G5DA 2PCFB 4L5RC 4L5SA 2F0UA 2I5LX 3SK8A 1DOKA 3J80E 4DR2Q 4RWSC 2NVTB 3H0GG 2WKCA 1SFOB 2MQHA 3H3VC 1HXYD 1AE3A 4I7AA 3W1GA 1G2TA 2F52A 1GUGA 4RH6A 1OXSC 2JA6G 3H15A 3J81i 2IJ0A 1D8LA 4UHVA 2CWPA 1N34Q 1XPRA 4NXNQ 3I2ZA 4HCEA 4NXML 2R92G 1PH5A 2F0LA 4DU9A 4KLKA 3DEPA 1IBLL 3VR5A 2OQ0A 4JI0Q 2PZWA 4JI6Q 1U9RA 1SNDA 1PYSB 4FF3A 2AQ2B 1YBYA 5IGCA 3UDIA 2PYKA 3J81L 4KV6A 5E1FA 3SGIA 2L12A 3UDXA 4XXEA 4HTHA 1PH7A 3J7ZC 5M5WH 2QKIC 1QZGA 3NUCA 1EY7A 5CBAE 1F2LA 2Y0SE 5M3MH 5CBEE 1I4XA 3DWPA 1I4GA 3S2HH 4JK1C 5J3BA 1FYCA 4QGUA 1EFWA 2DY8A 4B3SL 2UU9L 2R93B 1WCMG 1CQFA 4GKJQ 4A3KH 2D5DA 3M4PA 2F0GA 5C5LA 3NBIA 2F3WA 5KYIA 2EJFC 1RD9D 3H6MA 1CQVA 3D3RA 4DR3L 5FLXL 1IW7C 2YU9H 3NHHA 4O2DA 5ELDA 5T1IA 1Y1VH 1MHWC 3DWQA 4BY7G 4ULLA 4C3JH 3Q6SA 2E2JH 1K9MC 4CKCA 4K0KQ 3KF8B 4JI1L 1XNRQ 1KQSA 1AH9A 3HOYB 2FHTA 3J81c 4DV2Q 3P20A 5EKKA 3PMFA 1NR2A 3GTKH 1SJED 3CC2A 2B39A 1L0XB 2VUMG 1YIJA 3RD4A 3G4SA 4LUOA 3GTKB 2B29A 3IFTA 1VQ7A 4DN4M 2B63G 1UWVA 3DEOA 2EJGC 1R9TH 1I4PA 2V4DA 4LMQD 3J80i 3TREA 5CV9A 1IYJB 2L11A 4PQXA 3KK7A 4DV1Q 1R9TB 3GO5A 1B3AA 2Q8IB 2UXDQ 1TS5A 2IX0A 4LF7L 5FJ8H 3P1HA 1BO0A 4CJ2C 3NXWA 1W6KA 2K75A 4FF2A 1VQ5A 1HPCA 3J80L 1D1KA 2A68C 4TVAB 3GTLH 2KCMA 3NENA 2Z1CA 1Y69U 4OWWB 1IYUA 5C3EH 1B7YB 3ERQA 1F77A 4LK1C 5COYA 3EVQA 3EIVA 3K59A 3RLOA 1BDOA 5JEAG 3NQTA 4DKAC 5KYLA 5C3EB 3GTOH 4PZ8A 1ONLA 3OWEB 2UUCL 2PO4A 3JC66 3GTQH 2RHSB 3W1BA 4DR7L 3BDOA 3KLSX 3GTOB 1IBKQ 2WIIB 2LMCB 2NVQB 3F8TA 1A63A 3MXNB 4DV6L 3S1NH 3TP6A 2Z6BA 3GDEA 1HNZQ 2X69A 3S17H 1VQLA 1KD1C 2YTVA 1I4RA 2F0PA 4K6LA 1F2YA 1OXTA 3CD6A 4JVZA 1TS3A 4MZ9A 1CSQA 3I91A 4IZ8A 5K36G 3S17B 1CI3M 5IWAL 1EZ8A 1WOCA 4B3TQ 1EYDA 4KN7C 1YJ9A 4CHTB 4IPDA 4GOPC 2JE6I 3F2UA 3RMHA 1YITA 3J80c 4WRDA 1XMQQ 3SR1A 1VQMA 2DJFC 3PIPA 4NW2A 3CCMA 3B6YA 2PNRC 1BR9A 2EDGA 3PO3H 2A73B 1JQYD 2Z6KC 2F0NA 1M1KC 1N33L 1X55A 3MA2B 4IOAA 1EOTA 2RSOA 4BBRG 5IGDA 2JA5G 2F4VQ 4A3FH 5CYUA 1YZ6A 5I9OA 3A5UA 3TS0A 3S1QH 3T1HQ 1ASZA 2M9VA 4A3IH 2VXWA 4APVA 4A3FB 4GOPA 3GP7A 2F0WA 2WKDA 2NWGA 1KIXA 4A3IB 3S1RB 4K6DA 2F0MA 2G9HD 1STEA 3BVMA 3KLWA 2LS01 2Z6KA 4DR5Q 2WAQE 4DA2A 4ALPA 3RR5A 2HIVA 3PIOA 3Q8DA 1FJGQ 1SMXA 4WJWA 4BY1B 3JAME 3NBHB 2VL6A 2RA4A 3VR4A 1VS0A 1HZCA 4UP9A 4I7ZC 4RGMA 1OO9B 4DR6L 2F3IA 3NK9A 1JMCA 5CV7A 4CDFC 1VMPA 1TWCH 3A0JA 4Q0FA 4O42A 3V05A 1LTTD 3VYRA 2ZJRA 3S16H 3WDNA 2CHBD 3SDZA 2Q2TA 3S2DB 3OHXC 3S15H 1YNND 2HQEA 2K14A 2KECA 2R92B 1L0WA 4IFDG 1PRTF 3S16B 2NN6H 1BF4A 1B9MA 1L1OC 5FLMG 2EXZA 4NXMQ 1T9HA 1UE6A 3V2TA 4HIDA 3G48A 1PTOC 1G291 1LT6D 1KLGD 4N8X1 4L5TA 1SRUA 4R9WA 3R93A 1STYA 2NVYH 1EU4A 3I4NG 1RIPA 4KY6A 5M9OA 2R7ZG 3HOWG 2K01A 3F1ZA 2JA8G 1X54A 4BA2I 5D3DA 4DUYQ 3M9BA 1UUPA 1VQAA 1LACA 1PZJD 1L1OA 4YY3L 1E0BA 4G7HC 1D6EC 5H1SE 4HIOA 4A3JH 3KJOA 1V1OA 4C3HG 1BQQT 2OTLA 4K2LA 3CCSA 1NNXA 1IL8A 4HJ8A 1VQDA 1GUSA 2ES2A 2UU9Q 2F0DA 4XQQA 2CQOA 1NAPA 4HCSA 2LXJA 3ZYYX 4LFBQ 4JW0A 1C8CA 3PO2G 1HUNA 1IBML 4GKKL 4RKBA 5C6AA 1N8RC 3EROA 1ET6A 4GZYC 3NSWA 3RLNA 4HR7B 3T51B 1AN8A 5ISRA 1LTBD 1A0IA 2QA4A 2LSSA 1V1PA 2XVSA 2F1MA 1GOZA 1QCBD 1FNWA 3RNUA 2ZXPA 4ZRZA 2D2CC 1BCPB 3MEHA 2TMPA 3F2CA 1S5DD 4A3MG 3FKIH 4OXPA 1U0LA 4JI1Q 4GNXA 4CJ1B 5L37A 2A6HD 5J22A 5T1GA 1JWUD 4JI8L 4UDUC 1WI5A 2B2YC 1X56A 4A75A 3R2IA 3CCLA 5JPMC 3CCQA 4M1UB 2B63B 1LYLA 4NP5A 4YIJA 4AYBG 5AJ3Q 1BBWA 1PFNA 3GTGH 3TBIB 2DY7A 2HCCA 2BE5C 4LNQA 3RZOB 4KI0A 1F9SA 5ELFA 1C9OA 3GTGB 5IY0A 1FR3A 1QZHA 1AEXA 2F0EA 3M4QA 1PDQA 4IJLA 2B2YA 1RODA 2R6GA 3M3YH 3HFZB 3D8GA 3FDTA 3D4DA 4DR4L 1PHJA 3P75A 2K4KA 1LTGD 4LF7Q 3M4OH 4HMJA 1Z9FA 5A35A 4R4OA 3M3YB 4NPSA 5IYDH 1MJEA 1STAA 1VDZA 3DMUA 4I65A 2AWOA 4HSVA 5IGGA 2K05A 4A3LG 3CU7A 3AMUA 2KCCA 3NWSA 1J8IA 3A7AB 4EGVA 1SMYC 4JI7L 1HFNA 2ICEC 1K8OA 2GVBA 3T13A 2K5QA 3M7NA 1SBBB 1NY4A 2R61A 2UUAL 5GADC 1I4HA 4RA8A 2UUCQ 1NR4A 4DR7Q 2FINB 2IT1A 4EQOA 4CJ0B 5JPNC 1STGA 1YJWA 4H02A 5C4JH 4YHHL 4PZ7A 1YHBA 4IUUA 1HR0L 4KKTA 2DN8A 4DV6Q 2F3VA 2CW0C 2KQ3A 3OOCA 1MIUA 1WTOA 3TQYA 3G71A 4GS3A 1F2ZA 1PH1A 1SAPA 5IGEA 3JAMc 5IT9E 2Y0SB 3KFUA 2K5WA 5I2YA 2R7DA 4DF7A 5G3LD 4DNRB 4PNYA 3PF5A 1VMCA 4FXGC 3IFDA 4JI5L 3TP5A 3GD7A 5D65A 3A56A 5NUCA 3K7UC 1X32A 1I6HB 2L15A 4BBRB 1YNXA 3KBGA 2JA5B 4J15A 1CA5A 1B50A 4A3GG 3KF6B 1NTGA 1N33Q 4LFCL 3E9IA 5GROA 4M8AA 5FJ8G 2SOBA 1BOSA 5KRUA 2H1EA 1S5FD 1XWEA 5IGFA 4IALA 2Q2UA 2A6ED 1SYEA 5EPJA 5KNCA 1DYQA 5KEEA 5JJKA 3FMCA 2EY2A 5K5PA 3HEJA 4C2MH 2A8VA 1YEZA 1XTCD 1G51A 2JYOA 3BVGA 1I4QA 1W6JA 1UE5A 4QIWB 4YWLA 3M7GA 3NTIA 4A3CH 3K0YA 1H9SB 1Y1WH 2BA1A 4G57A 1X6OA 1UE7A 4KJNA 1BCPD 1HNXL 4DR6Q 5AFWA 4P71A 1IKLA 1K73C 2NZHA 1P16A 2K5NA 1ZYRC 1W3SA 4DV4L 1W2BA 2QEJC 3IRBA 4OONA 4JI4L 1S3OA 2GA4B 2N78A 2OWOA 2K03A 4KD4A 4DK3C 1ILQA 4DK1A 2XGTA 1JCKB 3KJPA 4MN3A 4IPCA 5C44G 1I50B 4B9WA 4K5XA 1D5ZC 2RBMA 4X66L 1BVSA 3HG9A 3TRZA 4X3SA 4F7XA 4RGTA 3KDFA 1OXUA 2R7ZB 5BN4A 2JA8B 3FPUB 4O1NA 3PO3G 3PUXA 4JCVE 2NVTH 4IJHA 2N55A 4CKBA 2FJ2A 2A5HA 3OSOA 1EWHA 3TS2A 3SE0A 4POFA 1X3PA 2A19A 1EQVA 1G91A 2RQXA 1JOQA 2RSNA 2B3GA 3SK6A 1HRJA 1H95A 4C3HB 4A3EH 3HZXA 3OTOQ 3HOZG 1OXXK 4A4IA 3CKIB 3RN5A 1VCIA 1PRTC 3R8BA 3KUPA 4A3EB 4OO1H 3VR2A 2MP1A 4RFBA 3PO2B 3RUZA 1Z7TA 2ENBA 1YNJC 3T16A 2AUKA 1AZPA 1GHJA 5JAVA 4IURA 5DEHA 1TR5A 1B70B 1CKNB 1SR3A 4RCOA 1BNZA 1IBMQ 2PZUA 4LF5L 1BXTA 4ME3A 3BZCA 4LJZC 1EEFD 1HA5A 1JICA 5IT9L 1PH8A 1JE4A 1A3UA 2BH8A 1DOLA 2IL8A 2K28A 1IW7D 4YCWA 3I72A 3ICEA 4BBSG 1G8ZD 1EQRA 3NEMA 4LF4Q 1C4QA 2A1AA 4DPGA 3NE5B 3C3LA 2RKSA 1VQEA 4YCVA 1S72A 2JA7H 2R93H 1SSOA 3D4RA 1WTVA 1U4PA 3CXCA 2HHHL 1DD2A 2D9UA 4LF6L 4AYBB 3K6OA 4IPGA 1RTNA 5CC4A 1IYVA 1PLFA 1ZXTA 2JA7B 4ZLTF 3HOUG 3MZ5A 2HIXA 2N8NA 3K8AA 1HNWQ 5M5YB 3QG1A 2B8GA 2EXDA 5CMDA 5I6YA 2ZJPA 4F88A 3I4MG 1TS4A 1ENFA 2F0KA 5DAUA 1QILA 2WAQB 1CM9A 3LNNA 1XPOA 5I9PA 2N88A 1XPUA 2BA0A 4LWCA 1PTOB 3H91A 3HOYH 1B3QA 4DV0L 1VQGA 5LL6S 2FFKB 1I5FA 2Q2IA 1KC8C 1U4MA 1WD1A 1E7ZA 2UUBL 3SK5A 4A3JG 2JK8A 5IT9c 1CTMA 1PH6A 5IP7H 1TWGB 5C5MA 4LUVA 1YJNA 1JJCB 1LLRD 2I5MX 3X3MA 4QIWE 1HCZA 2ZXOA 4LF8L 3D31A 1TY2A 1RDPD 4QB4A 4MNOA 2PW7A 4X64L 2OTJA 2YTXA 1WFQA 5HGQA 2OXPA 3U58A 2RVLA 2A68D 4JC0A 2F0IA 4XDXA 5FK9C 5JJIA 5JJLA 1ZEQX 4X62L 2KBNA 1TXYA 4X3KA 2A69D 4C1NK 4DXGA 1RF2D 4JI7Q 4A93H 4PMBA 2F0VA 4L63B 3PUYA 2Z9HA 3C1EA 3T1YL 1R4QB 4BA1I 4PZ6A 1WYDA 1I6VC 3ND8A 4GNXB 2UUAQ 4CBVA 1B8AA 5EKIA 4A93B 2DNCA 5C3WA 1D7QA 3NWTA 1F9QA 1MI2A 3FPPA 4YHHQ 4P2CB 1HR0Q 3U9SA 2E2HH 1ESRA 1PFMA 4ODGA 4XT1B 3K5NA 2E8GA 1EOVA 2LFNA 1N36L 2VQEL 4KHZA 3FRPB 4X65L 4KY5A 1EQQA 1VQBA 1FNUA 3ONAB 3UE1A 5HGTA 3HGBA 2E2HB 3G7LA 1GD7A 3CCEA 5IYCH 2LKVA 4OO1I 1A62A 1GVPA 1Q46A 3I4OA 2O5JC 4P74A 2MGSA 4JI5Q 1C7YA 4WFN3 2K5HA 2X6LA 3NELA 4CDCC 1PH9A 3RZDB 4ZAIA 5IE8A 1QVFA 2NVQH 1HJPA 2IX3A 4JI3L 5EJWA 4J6HA 3A55A 3CQZH 2H5XA 2MPMA 3A74A 3G6JB 2WACA 3MFYA 4UAIA 5D14A 5C4HA 1SDFA 3KOJA 2F0HA 3LGJA 4LFCQ 3LWEA 3VA7A 2L1BA 1A2UA 2HDLA 2Z0SA 1Q90A 2J0TD 2Z4IA 3CQZB 4P75A 5DM73 2F03A 4K8JA 4DXFA 1KNEA 2QCPX 3VYTA 2K1BA 5IYDG 1SYDA 1U5KA 2HT1A 2QF7A 2PQAB 2WB1G 1JWMD 3TP8A 2BH2A 3HOXH 3E5SA 5LMNL 3I7FA 5C0XH 1QUQA 1RKNA 2PW5A 3Q0AA 1YHQA 4YCUA 2OT2A 1GUOA 1FGBD 4DAMA 3HOXB 3OPOA 1ENCA 4FYDA 1JR0D 2K33A 3K0XA 1IKMA 3D6WA 4LF9L 2E76C 2ID0A 4V0BA 1GUNA 1VQ9A 3EQLC 4DAYA 5EQ0A 1HNXQ 1XTDA 5I4DA 3UI2A 4HIKA 1H9KA 4DV4Q 4AYBE 1A2TA 5G3LF 1YHAA 1X3EA 5C44B 1PMRA 2QDLA 3S1RH 3L7ZC 4JI4Q 2FXQA 4BXXG 1F2MA 2PI2A 4WJ4A 3GV6A 2KJXA 4UY8C 3SK4A 5M3FG 4QY7A 4BY1H 2HCIA 1PYWD 1SROA 3F2DA 4X66Q 3SHLA 4PMWA 4C3IG 1G6ZA 3H0GH 3CHBD 4JYAL 4A3BG 4B9XA 1LV9A 1OXVA 2B2TC 2L4NA 3PUZA 3ULLA 3HRZC 1PTOD 5C4XG 4GLAC 4R4CA 1A3TA 3QIAA 4UPAA 3H0GB 2ZTEA 1U4RA 2PNHA 5C0XJ 4KHPL 4RAUC 4KY7A 2JA6H 2F4IA 2AKWB 3S2DH 3Q24A 2CVRA 3ND9A 5HY6A 1BBXC 2R92H 1VQOA 3HOVG 2K7VA 2UXCL 1JB3A 1J9OA 2RHQB 3AYHB 3LX0A 2JA6B 3MXPA 4IPHA 2ZJQA 3GTJH 3CCJA 3TP7A 4ZYSA 2EYOA 2QILA 2FMMA 2B2TA 1CZGA 3E6ZX 1BCPF 1EQTA 2ZXRA 1F9RA 3GTJB 1DOMA 3AFQA 4PG3A 2VQFL 2B2UC 4RMFA 4HEDA 3WWVA 5HURA 1IBLQ 2NVXH 4A3DG 5KNBA 3A8IE 2UXBL 4FF1A 2K6AA 3H09A 3TDQA 1H9MA 2NVXB 4DV3L 4AQYL 1B1ZA 3OYYA 1VQ6A 3S1MB 2F0JA 4JG2A 4G7OC 5IYBG 3CRLC 4KMUC 4L6TB 1EEID 2B2UA 2XNAC 2I07B 4RHSA 4DV5L 3I70A 4IQZA 3QJYA 1VF7A 1WCMB 3E3XA 2HHHQ 2JA9A 5M5XH 2KUMA 3E0JA 3MC0B 4UP7A 4B3SQ 1S5BD 2NB0A 4DR2L 2EIFA 3I4MB 1MJCA 5M5XB 2WFWA 5IP9G 5C0XI 1YNNC 1JT8A 2EVBA 1SE4A 1X3FA 1K8MA 3MFGA 3CMEA 4BY7B 4MTKA 4LAAA 4DR3Q 2BE5D 1NSNS 2YYZA 3KF8A 5LMUL 3VYSA 2B2VC 2QEXA 2JSOA 3STBD 2KOLA 4ZUIA 2PQEA 1CKOA 3VR6A 1JJ2A 5KIXA 1TY0A 2EY1A 2VUMB 3BYTB 2B63H 3UDFA 3A8JE 4JI2L 2OEOA 1JB7A 1K3RA 3CCVA 4LF8Q 3ULPA 2NYZD 3RZOH 4X64Q 2B2VA 1KXLA 3JAMi 2JEBI 4X62Q 1II3A 4UP8A 2WV6D 4FXKC 5FO9B 5EPLA 3K58A 4C1NI 4FP5D 1M8AA 3T1YQ 2BCOA 2ICIA 4NMZA 4P73A 3AQQA 4YWKA 1SE8A 4ABNA 1D5XC 1CT1D 1VQKA 2IW3A 4F87A 4GKJL 3CMAA 1HUMA 4R4QA 2RF4A 3JAML 3BG3A 2RDGA 5M3MG 2L9HA 3J7AV 4L5QA 1GHKA 1ICFB 3BYYB 2VS1A 1NCVA 1SNMA 4RCNA 1HH2P 1HZ9A 3L3OC 1LUZA 5JEAH 2VQEQ 4X65Q 3S14B 1I3QH 1HFGA 2BDOA 1VQ4A 1SYFA 4A3KG 3UDGA 3KLRA 2BOSA 1XXGA 1EY6A 4ZKCB 4QQBX 4KKUA 5EBDA 2MO1A 1I3QB 1X3GA 4IUPA 3S9WA 3BZKA 1K0RA 3R3OA 1EZ6A 1DCZA 3M4YA 2XRQD 2AQ3B 1Y1VG 3SVMA 4JI3Q 3HOYG 3LWUA 4KK7A 5KGUA 1O7IA 4KD3A 4C3JG 4KKSA 4XQNA 3OMGA 3K5LA 5K36H 5IGBA 2C5CA 2BDNA 2C9OA 2WB1B 3BDCA 4X3UA 4ZQ3A 3GV3A 2KCNA 1EIHA 4AIMA 1B44D 2R7FA 1NUCA 1SNQA 4GLXA 1UAPA 1TIID 5F2DA 3C1FA 2F0SA 4HSPA 3TEHB 1I6HH 5IWAQ 5LMNQ 4BBRH 1QE6A 1Q8KA 4OIKA 2JA5H 1K0SA 3KBXA 5JEAJ 4QL5A 3BU2A 5ELBA 3VDYA 4LF9Q 5LHY1 1UE1A 3U50C 3CP0A 5FO8B 2SDFA 4DV7L 1V9PA 5BN5A 4ME5A 4OL7A 1H9JA 3Q22A 4DGZA 2KHIA 3VR3A 1QWYA 1WTWA 4FXDA 5CV5A 1KDCA 1QVGA 5M3FB 2E2IH 1BBUA 1Q1EA 4Q5VA 1IL2A 5EPKA 4EQNA 3H3VI 3OMCA 2M2LA 3GTMB 2EE1A 1NMFA 4Y52H 4JBMA 2E2IB 4F8MA 5C3EG 2L0CA 5E4WC 2VY3A 4B3ML 3NBHA 1IBKL 2I0QA 3OIPA 1ILPA 3DUZA 1N32L 5C4XB 2EYMA 2C35B 4O0AA 4JYAQ 5GQOA 2OQKA 2B2WC 3MVVA 1SN8A 1VQJA 1CSPA 2O4XA 2M00A 2XWBB 3A5ZB 2QW7A 2NUCA 3HOVB 4QUFA 3L2PA 4KHPQ 4IFDH 5FLXE 1OTCA 2EY6A 1V1QA 1TKWB 5FLMH 2H4OA 2F0TA 2UXCQ 3V96A 1I50H 1Q3LA 1QUQB 2IHFA 1GO3E 2J4XA 4OELB 2B2WA 4H13C 3I4NH 4B08A 1LT3D 3HKSA 1VQ8A 5IODA 4HMIA 4S3SA 2R7ZH 1SE2A 1NJIC 3HOWH 1WTXA 4TKOB 2F4VL 3PGZA 1EYCA 2JA8H 4A3DB 1Y8OB 2PZTA 2AQ1B 5BR8L 3I4NB 3VA5A 3SEBA 2N49A 4WORA 4DAYB 3HOWB 2VW9A 5FOBB 1NE3A 2UXBQ 1MKHA 1KLUD 4KTAA 3QO2A 1O7LA 1M90C 4C3HH 4DV3Q 1HA6A 4A3FG 4K5VA 1UNSA 3QB3A 4OGQC 4DR5L 4GOPB 1AZQA 1PH2A 1EY4A 2E2DC 2WINB 4A3IG 3MHBA 4YY3Q 3BJUA 3HS0C 3TN2A 4DV5Q 3HKZG 1QB5D 1BCPC 3PUVA 4QUCA 4HJ7A 3PO2H 3I73A 1PTOF 3T56B 2KENA 4IFDJ 1CFMA 3F2BA 1PH3A 3NP8A 4QCLA 4JPBW 1B4OA 5IIFA 4ILWA 5GAEC 1LABA 3FP9A 2F0OA 5GAGC 4R8NA 2A74C 1Q8IA 3D0FA 5KNDA 4A3MH 4GKKQ 4POGA 5LL6X 4KJOA 1STBA 4Z9CB 1EL0A 4DR1L 1KTKA 2I5HA 2NBFA 3A7LA 4TQUS 2WB1E 2K52A 4NDXA 3BVZA 4A3MB 2EPBA 4PV1C 5LMUQ 1JJGA 3C2PA 2SNMA 3CCUA 2KHSA 1CUKA 1Y14B 2MUYA 4X6AH 1HZAA 1VF5C 1VQFA 1RTOA 3DM1A 2XWJB 2NZOA 5M5YH 1GUWA 4JI8Q 2NN6G 4JI2Q 2IPKD 4K8IA 4MTNA 3K57A 3MEFA 2ATWA 5CR3A 4DUYL 1JE5A 2PMZE 1HQRD 1DONA 3EA6A 1K3BC 4XT3B 1STNA 1STHA 1P8LA 1AP0A 2XTIA 2RDFA 5C3XA 2YV5A 4J8QA 3BS1A 4OX9L 4R1JA 1Q82C 1PTOH 4XYQA 4OIJA 1XNQL 5M5WB 3PF4A 1L1OB 3BDLA 3U4VA 1VQNA 3HP3A 5M3MB 2ZM6L 5EBCA 5FO7B 2CFMA 4U673 1YVCA 1PZID 2E75C 3R2TA 4JBWA 2JQOA 3ITPA 1E2VA 4CKEA 3S2HB 1TWGH 1TWAH 3J81j 4IFDI 4DAVA 2VNUD 4ID6A 4LFBL 1YI2A 1S4ZA 4DR4Q 1LO5D 4A3LH 2YTYA 3OW2A 2F0FA 1J6QA 1TWAB 1DM0B 4RGNA 5A2QE 1TS2A 4A3KB 4QF4A 4CGYB 3T4AC 1XMOL 2EYHA 1J5EL 1LTAD 1LTSD 1EY5A 1QOHA 1X65A 5ELEA 3AEVA 5EAYA 4DNTB 2IY5B 3EN2A 1PFBA 2WP8J 1T5XD 2L55A 3QWNA 2PPBC 2YU9B 2D0PA 1V1PB 5IOCA 1Y1VB 4GLVB 4XIGS 2X6GA 3Q23A 2EYJA 3QOJA 4C3JB 2E2JB 4NB3A 4OWXB 3RN2A 2HQLA 4DK6C 1AFPA 5AJ3L 4DFAA 2CWAA 3OWFA 4XYOA 3FKIG 3PCOB 4MHEA 4FDBA 2MFIA 5J39A 1PV4A 4ZUJA 1AW7A 2XRSD 3EJIA 1EIFA 4A3GH 3RZDH 2CCZA 1EY0A 2LY7A 1JWSD 3KF6A 3MTSA 1RCVD 2PI2E 2DGYA 1CK1A 4N9PA 3TMEA 4A3GB 5FLXc 1WTPA 2GVAA 4JBKA 1GXDC 4R8IA 5EGTA 4HIMA 4H0LC 1ENAA 1R4PB 2O5IC 1ESFA 3IKJA 4KHVA 1Q1BA 4TRDA 1EIYB 3FHWA 3EBEA 4DV7Q 5C4ZA 3CCRA 3J7AF 3O13A 1D1IA 1D5MC 3MXGA 1JOKA 1XJVA 1E2WA 2NZ1D 2A69C 4OHJA 1JC7A 2K32A 5D3IB 4CDDC 3GTLB 1KDAA 3C46A 4XTCS 2XSCA 1HTPA 1LTID 1K8GA 2EJMA 1BKBA 1BUVT 1VQCA 3W5OA 5ELOA 2K50A 4B3MQ 1H9SA 2R3ZA 1SNPA 4ZK9B 5DNFA 2IWHA 1N32Q 4GN4B 4B3RL 3GTQB 3TZUA 1Q81C 4L8JA 3AB9A 3ULJA 3MAQA 4PMCA 4FNFA 4C56C 4Y7NH 2G9DA 1MSGA 1A3VA 5EKLA 5C44H 3S1NB 1HTLD 1S5ED 2NTSA 5JJZA 3OW7A 4JOIC 4Y7NB 2DUDA 3NTHA 1Y8NB 2K5VA 2Y0SG 1RL2A 4WJ3M 4EX5A 2EY5A 3CC4A 4LFAL 5I6WA 1C48A 1SLJA 1DGSA 2J7ZA 1I94L 3KYHC 1QVCA 4JBJA 1K83H 1PVOA 1IZ6A 3PO3B 5BR8Q 5CV6A 5A2QL 4JOIA 1O78A 2VB3X 1S5CD 2ALYB 1K83B 2FMCA 3HOZH 3BZDB 1HR0W 1KABA 3S1QB 5JVG3 4K5WA 1O80A 3ER0A 3W3AA 1SEBD 1FGUA 2ZTCA 5CGKA 2K04A 1E24A 3HOZB 1CKMA 1UEAB 1GJXA 1B2TA 1LT5D 1KAAA 3HKZB 4JV5L 3NTKA 3TSSA 1KDBA 1NMGA 1G6PA 1Q86C 2I46A 3IAYA 2KHJA 4OEMB 3CAMA 2SEBD 2ZTDA 1UEBA 3KLSA 1Q7YC 2JJQA 1LM0A 1CKNA 2OF1A 4OWTB 1L0YB 1TQOA 1FNVA 2VZAA 4A3CG 3T53B 4BBSH 1Y1WG 3QR8A 3P7JA 1TWCB 1CHPD 3TZDA 4LF5Q 2Q8RE 2JXMB 4N8FA 3I55A 3S1MH 4DR1Q 3CC7A 5E4XA 2F0QA 4BBSB 5CORA 2Z8LA 4TSSA 4HJAA 2AWNA 4RG1A 1TU2B 3S15B 1WCMH 3HOUH 4RHRA 2B8FA 3D6CA 4DUZL 1E3PA 4E6IA 1K28A 3HOUB 2OCEA 1WTRA 3I4MH 4LF6Q 3J7YW 3KDFB 2E5LL 5TSSA 1Z47A 1GM5A 1KNAA 3I56A 2NVYB
chains in the Genus database with same CATH topology
2CKZB 3JC66 1PH8A 2RHSB 5JEAJ 3W1BA 4HJ5A 3GTQH 4BY7H 4DR7L 3OTOL 4QL5A 2BH8A 3BU2A 1IBKQ 3VDYA 4LF9Q 1S40A 2AHOB 4OX9Q 3F8TA 1A63A 3K80C 4YCWA 1UE1A 3U50C 3CP0A 2UUCL 4DV7L 1V9PA 1XNQQ 3MXNB 4DV6L 3ICEA 3S1NH 4GN5A 3CPFA 1EQRA 3NEMA 4BBSG 3GDEA 1HNZQ 2KHIA 3PUWA 4LF4Q 1N34L 2A1AA 4DPGA 3S17H 4NXNL 2ZM6Q 1VQEA 4YCVA 1S72A 1VQLA 2JA7H 2R93H 1KD1C 2YTVA 2VUMH 1OXTA 4DV0Q 3CD6A 3CXCA 2HHHL 4MZ9A 4A3EG 1CSQA 4GNXC 1QVGA 4LF6L 4IPGA 2E2IH 5K36G 1BBUA 1E1OA 1Q1EA 4LW1A 5IWAL 1WOCA 1IL2A 4JI0L 1ASYA 4B3TQ 2UUBQ 3H3VI 2AMCB 4JI6L 3H3VH 3HOUG 5DLQE 1YJ9A 2ASBA 1NMFA 1PH4A 2HIXA 4IPDA 4GOPC 4Y52H 2JE6I 2N8NA 3E9HA 3K8AA 4JBMA 1HNWQ 4OO1G 5C3EG 4IO9A 1XMOQ 2EXDA 3J80c 2ZJPA 2VY3A 1YITA 1XMQQ 1J5EQ 1VQMA 1IBKL 2I0QA 4B3ML 3PIPA 3G6EA 3CCMA 3B6YA 1N32L 3I4MG 3PO3H 4HJ9A 2Z6KC 1KL9A 1M1KC 1N33L 1X55A 2C35B 4O0AA 4JYAQ 2V1CC 2OQKA 5GQOA 4IOAA 4BBRG 3S24A 1XPOA 2JA5G 4LF4L 1XPUA 2F4VQ 4A3FH 1SN8A 1VQJA 1CSPA 2BA0A 4P72A 4LWCA 1YZ6A 3HOYH 3A5ZB 3PSIA 3A5UA 4DV0L 3TS0A 3S1QH 1E22A 3T1HQ 1HZBA 1ASZA 4A3IH 1VQGA 3L2PA 4KHPQ 1I5FA 4APVA 3M85A 1OTCA 4GOPA 2Q2IA 1KC8C 1E7ZA 2UUBL 1V1QA 4A3JG 2JK8A 3UE0A 5IT9c 5FLMH 1PH6A 5IP7H 3U4ZA 1KIXA 4LUVA 1YJNA 1HNWL 2UXCQ 1V43A 1JJCB 2I5MX 3KLWA 1I50H 4QIWE 2Z6KA 2JA7G 2R93G 4DR5Q 1QUQB 2WAQE 4LF8L 3S14H 3D31A 2IHFA 1GO3E 2OTJA 4MNOA 3RR5A 4X64L 4ALPA 1VQHA 1WFQA 2YTXA 5HGQA 3I4NH 2HIVA 1KRTA 3PIOA 3Q8DA 3U58A 3HKSA 1VQ8A 1FJGQ 2R7ZH 3HOWH 1SMXA 4JC0A 1NJIC 3GTPH 1N36Q 3NBHB 3PGZA 3STBC 2F4VL 4X62L 2JA8H 5JJLA 2VL6A 2KBNA 5JJIA 1TXYA 4YWMA 1VS0A 5BR8L 1HZCA 3CW2C 4UP9A 5GAHC 2MNAA 4A93H 2WAQG 4JI7Q 2N49A 4DAYB 3PUYA 3T1YL 4DR6L 2F3IA 4AH6A 2VW9A 1JMCA 4BA1I 4PZ6A 1WYDA 4K0KL 1XNRL 1TWCH 1NE3A 4GNXB 2UUAQ 1TWFH 2UXBQ 3A0JA 1MKHA 2D0OA 1B8AA 2IHEA 1EUJA 3HKZE 4DV2L 1NBWA 1M90C 4C3HH 1PA6A 1D7QA 4DV3Q 2ZJRA 4A3FG 3CPWA 3S16H 4DR5L 4GOPB 4YHHQ 2Q2TA 1HR0Q 1PH2A 3ZJYC 3S15H 4A3IG 2K14A 2E2HH 1L0WA 4YY3Q 1C0AA 3BJUA 4IFDG 4GKJL 1PFSA 2E8GA 2NN6I 1EOVA 2PQAA 4DV5Q 3DM3A 2VQEL 4KHZA 4X65L 1N36L 1GKHA 1L1OC 3HKZG 3PUVA 1EQQA 5FLMG 1FL0A 5IP7G 1VQBA 4HJ7A 3PO2H 4NXMQ 1AE2A 4DNIA 1T9HA 1UE6A 2KENA 3UE1A 4HIDA 1GD7A 3G48A 4IFDJ 3CCEA 5IYCH 3F2BA 1PH3A 4OO1I 1G291 1A62A 1GVPA 1Q46A 3I4OA 1E1TA 1SRUA 4L5TA 3E0EA 4P74A 5GAEC 4JI5Q 1C7YA 2NVYH 3I4NG 2K5HA 1RIPA 3FP9A 3NELA 1PH9A 4DV1L 3HOWG 2R7ZG 5GAGC 1Q12A 3F1ZA 2JA8G 1X54A 5IE8A 3D0FA 4A3MH 1QVFA 2NVQH 1HJPA 4BA2I 4DUYQ 4JI3L 3M9BA 2IX1A 3CQZH 4POGA 4GKKQ 2H5XA 3A74A 1VQAA 4A93G 4B3RQ 4DR1L 2I5HA 3KOJA 1L1OA 4TQUS 2WB1E 2K52A 4YY3L 3LGJA 4LFCQ 4BXXH 5H1SE 1JJGA 2Z0SA 4P75A 5LMUQ 4A76A 4QJFA 4HIOA 4A3JH 3CCUA 1CUKA 1Y14B 3KJOA 5IYDG 2OTLA 3CCSA 4X6AH 4R4IA 2KCTA 1U5KA 5M3FH 2HT1A 1TWHH 2PQAB 3ERSX 1HZAA 1VQDA 4HJ8A 2ES2A 2UU9Q 2WB1G 3K81C 3PV0A 3GTMH 2BH2A 4C3IH 2NZOA 3HOXH 2CQOA 5M5YH 4JI8Q 2LXJA 2NN6G 4JI2Q 2N3SA 3I7FA 1PYBA 5LMNL 4MTNA 1QUQA 4LFAQ 4LFBQ 5E7NA 1YHQA 3MEFA 2ATWA 4DUYL 1IBML 1JE5A 3PO2G 4YCUA 4A3BH 5C4XH 4GKKL 2PMZE 1VQPA 1N8RC 5IYCG 4DAMA 1KAWA 1I94Q 3RLNA 1P8LA 3K0XA 2XTIA 4LF9L 1A0IA 2YV5A 2QA4A 2LSSA 3J7A5 4OX9L 4R1JA 2ID0A 1Q82C 1X9NA 3RNUA 1VQ9A 2LXKA 1XNQL 3PF4A 1L1OB 3HOVH 1HNXQ 1XTDA 1HNZL 3F2CA 3U4VA 4A3MG 1VQNA 4HIKA 4DV4Q 4AYBE 3FKIH 4OXPA 1U0LA 4JI1Q 2ZM6L 1YHAA 4GNXA 2CFMA 1IXRA 2RCNA 1YVCA 4JBWA 2JQOA 1VQIA 1TWGH 1X3EA 1TWAH 3S1RH 4JI4Q 3J81j 3L7ZC 4IFDI 4JI8L 2FXQA 4BXXG 1WI5A 2VNUD 2PI2A 2EQSA 1YI2A 1X56A 4A75A 4LFBL 3CCLA 4B3TL 4DR4Q 2QGQA 2MO0A 3CCQA 4JV5Q 4A3LH 4WJ4A 2YTYA 1LYLA 3OW2A 1J6QA 1N9WA 4AYBG 5AJ3Q 4UY8C 5M3FG 4IOCA 1BBWA 4QY7A 1XMOL 1XMQL 4BY1H 4EQ5A 2D62A 1J5EL 1FVIA 3AFPA 3GTGH 1SROA 3F2DA 1A8VA 4X66Q 1X65A 3K7AH 4A3DH 4GN3B 3AEVA 5EAYA 4LNQA 3DLLA 4PMWA 2IY5B 3EN2A 4KI0A 3HOXG 3H0GH 4JYAL 2WP8J 3L0OA 1C9OA 5C0XG 5IY0A 4A3BG 1QZHA 1OXVA 3PUZA 3ULLA 5C4XG 1LTLA 2D0PA 4GLAC 4R4CA 4GLVB 2VQFQ 3M4QA 4IJLA 4UPAA 4XIGS 2ZTEA 3T1HL 5IYBH 2PNHA 2R6GA 5C0XJ 3HFZB 3M3YH 4KHPL 2JA6H 4NB3A 4OWXB 2AKWB 3CF5A 4DR4L 3RN2A 2HQLA 4DK6C 1PHJA 2K4KA 3S2DH 4LF7Q 1KHIA 5HY6A 3M4OH 2Q2HA 1Z9FA 2R92H 1VQOA 3HOVG 5AJ3L 2UXCL 4R4OA 2CWAA 2GN5A 2RHQB 3AYHB 4LUZA 4NPSA 4AQYQ 1MJEA 3RLFA 4IPHA 5IYDH 3FKIG 2ZJQA 3GTJH 1KRSA 3CCJA 3PCOB 2JEAI 4FDBA 1WJJA 1EWIA 2MFIA 1FJGL 1L2FA 4DUZQ 5LMNW 1PV4A 2AWOA 5IP9H 4R4TA 3AFQA 4A3LG 4PG3A 2VQFL 1EYGA 1EIFA 4A3GH 4RMFA 1K8AC 4JI7L 5ELNA 1SFOH 4BY1G 3RZDH 2GVBA 2CCZA 2E5LQ 4L5RC 3M7NA 1NY4A 3WWVA 1IBLQ 2NVXH 4L5SA 4A3DG 2I5LX 2UUAL 2UXBL 5GADC 4DR2Q 3KF6A 2UUCQ 3H0GG 2PI2E 2DGYA 5FLXc 4DR7Q 2MQHA 2GVAA 4JBKA 2IT1A 4DV3L 4AQYL 4HIMA 1AE3A 3W1GA 3OYYA 1YJWA 2F52A 4H02A 5C4JH 4YHHL 4PZ7A 1YHBA 1HR0L 1Q1BA 1EIYB 1VQ6A 1OXSC 4JG2A 5IYBG 3FHWA 3EBEA 4DV7Q 3CCRA 4DV6Q 2JA6G 3H15A 3J81i 1XJVA 1D8LA 4DV5L 2CWPA 1N34Q 1XPRA 4NXNQ 3I2ZA 1MIUA 3TQYA 4NXML 3G71A 4GS3A 2R92G 1PH1A 1PH5A 4XTCS 2HHHQ 3JAMc 2JA9A 5M5XH 3KFUA 4KLKA 2R7DA 4UP7A 1K8GA 1IBLL 3PF5A 4B3SQ 2OQ0A 4JI0Q 4JI5L 4JI6Q 1BKBA 4DR2L 2EIFA 3GD7A 1PYSB 1VQCA 1MJCA 3W5OA 2WFWA 3K7UC 1YBYA 5ELOA 2K50A 5IP9G 3UDIA 5C0XI 2L15A 4B3MQ 1YNXA 1JT8A 4J15A 1X3FA 3SGIA 1N32Q 4A3GG 3UDXA 3KF6B 4GN4B 4B3RL 1NTGA 1PH7A 3CMEA 3J7ZC 5M5WH 1Q81C 1N33Q 1QZGA 4DR3Q 3ULJA 4LFCL 2YYZA 5LMUL 2Y0SE 5M3MH 3E9IA 5GROA 4Y7NH 2QEXA 5FJ8G 3STBD 3S2HH 5J3BA 1CKOA 5C44H 4QGUA 1EFWA 2Q2UA 4B3SL 1JJ2A 4JOIC 2UU9L 2DUDA 1WCMG 2B63H 3UDFA 2K5VA 4GKJQ 4A3KH 2Y0SG 3M4PA 1RL2A 4WJ3M 4EX5A 4JI2L 5JJKA 1JB7A 1K3RA 4C2MH 3CC4A 4LFAL 2A8VA 1YEZA 3CCVA 4LF8Q 3ULPA 1SLJA 1G51A 3RZOH 4X64Q 1DGSA 1I94L 1UE5A 4YWLA 3KYHC 4DR3L 1QVCA 4JBJA 3JAMi 1KXLA 1K83H 2JEBI 2YU9H 4A3CH 1PVOA 1IZ6A 4O2DA 2BA1A 1Y1WH 4X62Q 1X6OA 4UP8A 1Y1VH 1UE7A 5BR8Q 4JOIA 4BY7G 2ALYB 1HNXL 3T1YQ 4DR6Q 4P71A 4C3JH 1K73C 2NZHA 1P16A 2K5NA 4P73A 4DV4L 1W3SA 1K9MC 2E2JH 3HOZH 3AQQA 3KF8B 4JI1L 4YWKA 1SE8A 1KQSA 1XNRQ 1HR0W 1AH9A 1VQKA 1W2BA 3IRBA 3CMAA 3ER0A 4OONA 3J81c 4R4QA 4DV2Q 1S3OA 2ZTCA 1FGUA 4JI4L 2RF4A 2N78A 2OWOA 1E24A 3GTKH 5M3MG 1CKMA 4DK3C 3CC2A 2XGTA 2VUMG 4L5QA 4JV5L 3KJPA 4IPCA 5C44G 2VS1A 1YIJA 3G4SA 1HH2P 1HZ9A 1LUZA 4LUOA 1NMGA 2B29A 1G6PA 1Q86C 2VQEQ 4X66L 4X65Q 1VQ7A 1I3QH 1BVSA 1VQ4A 2B63G 2KHJA 3TRZA 1UWVA 3CAMA 4K0KQ 4A3KG 3UDGA 2ZTDA 1UEBA 3KDFA 1OXUA 1R9TH 4QQBX 1Q7YC 2JJQA 1LM0A 2MO1A 1CKNA 1X3GA 3J80i 3TREA 4OWTB 3PO3G 3PUXA 1IYJB 4JCVE 2NVTH 3BZKA 4IJHA 1K0RA 4DV1Q 2VZAA 3GO5A 4A3CG 3TS2A 4POFA 4BBSH 2A19A 1Y1WG 2UXDQ 1Y1VG 2IX0A 4JI3Q 4LF5Q 3HOYG 2B3GA 2UXDL 4LF7L 3I55A 3S1MH 5FJ8H 4DR1Q 3CC7A 1O7IA 1H95A 4A3EH 3OTOQ 3HOZG 1OXXK 2AWNA 2K75A 4A4IA 4HJAA 1VQ5A 4RG1A 3RN5A 1VCIA 4TVAB 1WCMH 3GTLH 2KCMA 3HOUH 3NENA 4AIMA 2R7FA 4OWWB 4DUZL 5C3EH 1B7YB 1E3PA 4GLXA 3EIVA 2OCEA 3I4MH 3RLOA 4LF6Q 3KDFB 5JEAG 2E5LL 4DKAC 3TEHB 3GTOH 1I6HH 5IWAQ 4PZ8A 5LMNQ 4BBRH 1Q8KA 1Z47A 1B70B 1CKNB 1SR3A 3I56A 1GM5A 1IBMQ 2JA5H 4LF5L 1VQFA 4ME3A 3BZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKZ B;  3JC6 6;  1PH8 A;  2RHS B;  5JEA J;  3W1B A;  4HJ5 A;  3GTQ H;  4BY7 H;  4DR7 L;  3OTO L;  4QL5 A;  2BH8 A;  3BU2 A;  1IBK Q;  3VDY A;  4LF9 Q;  1S40 A;  2AHO B;  4OX9 Q;  3F8T A;  1A63 A;  3K80 C;  4YCW A;  1UE1 A;  3U50 C;  3CP0 A;  2UUC L;  4DV7 L;  1V9P A;  1XNQ Q;  3MXN B;  4DV6 L;  3ICE A;  3S1N H;  4GN5 A;  3CPF A;  1EQR A;  3NEM A;  4BBS G;  3GDE A;  1HNZ Q;  2KHI A;  3PUW A;  4LF4 Q;  1N34 L;  2A1A A;  4DPG A;  3S17 H;  4NXN L;  2ZM6 Q;  1VQE A;  4YCV A;  1S72 A;  1VQL A;  2JA7 H;  2R93 H;  1KD1 C;  2YTV A;  2VUM H;  1OXT A;  4DV0 Q;  3CD6 A;  3CXC A;  2HHH L;  4MZ9 A;  4A3E G;  1CSQ A;  4GNX C;  1QVG A;  4LF6 L;  4IPG A;  2E2I H;  5K36 G;  1BBU A;  1E1O A;  1Q1E A;  4LW1 A;  5IWA L;  1WOC A;  1IL2 A;  4JI0 L;  1ASY A;  4B3T Q;  2UUB Q;  3H3V I;  2AMC B;  4JI6 L;  3H3V H;  3HOU G;  5DLQ E;  1YJ9 A;  2ASB A;  1NMF A;  1PH4 A;  2HIX A;  4IPD A;  4GOP C;  4Y52 H;  2JE6 I;  2N8N A;  3E9H A;  3K8A A;  4JBM A;  1HNW Q;  4OO1 G;  5C3E G;  4IO9 A;  1XMO Q;  2EXD A;  3J80 c;  2ZJP A;  2VY3 A;  1YIT A;  1XMQ Q;  1J5E Q;  1VQM A;  1IBK L;  2I0Q A;  4B3M L;  3PIP A;  3G6E A;  3CCM A;  3B6Y A;  1N32 L;  3I4M G;  3PO3 H;  4HJ9 A;  2Z6K C;  1KL9 A;  1M1K C;  1N33 L;  1X55 A;  2C35 B;  4O0A A;  4JYA Q;  2V1C C;  2OQK A;  5GQO A;  4IOA A;  4BBR G;  3S24 A;  1XPO A;  2JA5 G;  4LF4 L;  1XPU A;  2F4V Q;  4A3F H;  1SN8 A;  1VQJ A;  1CSP A;  2BA0 A;  4P72 A;  4LWC A;  1YZ6 A;  3HOY H;  3A5Z B;  3PSI A;  3A5U A;  4DV0 L;  3TS0 A;  3S1Q H;  1E22 A;  3T1H Q;  1HZB A;  1ASZ A;  4A3I H;  1VQG A;  3L2P A;  4KHP Q;  1I5F A;  4APV A;  3M85 A;  1OTC A;  4GOP A;  2Q2I A;  1KC8 C;  1E7Z A;  2UUB L;  1V1Q A;  4A3J G;  2JK8 A;  3UE0 A;  5IT9 c;  5FLM H;  1PH6 A;  5IP7 H;  3U4Z A;  1KIX A;  4LUV A;  1YJN A;  1HNW L;  2UXC Q;  1V43 A;  1JJC B;  2I5M X;  3KLW A;  1I50 H;  4QIW E;  2Z6K A;  2JA7 G;  2R93 G;  4DR5 Q;  1QUQ B;  2WAQ E;  4LF8 L;  3S14 H;  3D31 A;  2IHF A;  1GO3 E;  2OTJ A;  4MNO A;  3RR5 A;  4X64 L;  4ALP A;  1VQH A;  1WFQ A;  2YTX A;  5HGQ A;  3I4N H;  2HIV A;  1KRT A;  3PIO A;  3Q8D A;  3U58 A;  3HKS A;  1VQ8 A;  1FJG Q;  2R7Z H;  3HOW H;  1SMX A;  4JC0 A;  1NJI C;  3GTP H;  1N36 Q;  3NBH B;  3PGZ A;  3STB C;  2F4V L;  4X62 L;  2JA8 H;  5JJL A;  2VL6 A;  2KBN A;  5JJI A;  1TXY A;  4YWM A;  1VS0 A;  5BR8 L;  1HZC A;  3CW2 C;  4UP9 A;  5GAH C;  2MNA A;  4A93 H;  2WAQ G;  4JI7 Q;  2N49 A;  4DAY B;  3PUY A;  3T1Y L;  4DR6 L;  2F3I A;  4AH6 A;  2VW9 A;  1JMC A;  4BA1 I;  4PZ6 A;  1WYD A;  4K0K L;  1XNR L;  1TWC H;  1NE3 A;  4GNX B;  2UUA Q;  1TWF H;  2UXB Q;  3A0J A;  1MKH A;  2D0O A;  1B8A A;  2IHE A;  1EUJ A;  3HKZ E;  4DV2 L;  1NBW A;  1M90 C;  4C3H H;  1PA6 A;  1D7Q A;  4DV3 Q;  2ZJR A;  4A3F G;  3CPW A;  3S16 H;  4DR5 L;  4GOP B;  4YHH Q;  2Q2T A;  1HR0 Q;  1PH2 A;  3ZJY C;  3S15 H;  4A3I G;  2K14 A;  2E2H H;  1L0W A;  4YY3 Q;  1C0A A;  3BJU A;  4IFD G;  4GKJ L;  1PFS A;  2E8G A;  2NN6 I;  1EOV A;  2PQA A;  4DV5 Q;  3DM3 A;  2VQE L;  4KHZ A;  4X65 L;  1N36 L;  1GKH A;  1L1O C;  3HKZ G;  3PUV A;  1EQQ A;  5FLM G;  1FL0 A;  5IP7 G;  1VQB A;  4HJ7 A;  3PO2 H;  4NXM Q;  1AE2 A;  4DNI A;  1T9H A;  1UE6 A;  2KEN A;  3UE1 A;  4HID A;  1GD7 A;  3G48 A;  4IFD J;  3CCE A;  5IYC H;  3F2B A;  1PH3 A;  4OO1 I;  1G29 1;  1A62 A;  1GVP A;  1Q46 A;  3I4O A;  1E1T A;  1SRU A;  4L5T A;  3E0E A;  4P74 A;  5GAE C;  4JI5 Q;  1C7Y A;  2NVY H;  3I4N G;  2K5H A;  1RIP A;  3FP9 A;  3NEL A;  1PH9 A;  4DV1 L;  3HOW G;  2R7Z G;  5GAG C;  1Q12 A;  3F1Z A;  2JA8 G;  1X54 A;  5IE8 A;  3D0F A;  4A3M H;  1QVF A;  2NVQ H;  1HJP A;  4BA2 I;  4DUY Q;  4JI3 L;  3M9B A;  2IX1 A;  3CQZ H;  4POG A;  4GKK Q;  2H5X A;  3A74 A;  1VQA A;  4A93 G;  4B3R Q;  4DR1 L;  2I5H A;  3KOJ A;  1L1O A;  4TQU S;  2WB1 E;  2K52 A;  4YY3 L;  3LGJ A;  4LFC Q;  4BXX H;  5H1S E;  1JJG A;  2Z0S A;  4P75 A;  5LMU Q;  4A76 A;  4QJF A;  4HIO A;  4A3J H;  3CCU A;  1CUK A;  1Y14 B;  3KJO A;  5IYD G;  2OTL A;  3CCS A;  4X6A H;  4R4I A;  2KCT A;  1U5K A;  5M3F H;  2HT1 A;  1TWH H;  2PQA B;  3ERS X;  1HZA A;  1VQD A;  4HJ8 A;  2ES2 A;  2UU9 Q;  2WB1 G;  3K81 C;  3PV0 A;  3GTM H;  2BH2 A;  4C3I H;  2NZO A;  3HOX H;  2CQO A;  5M5Y H;  4JI8 Q;  2LXJ A;  2NN6 G;  4JI2 Q;  2N3S A;  3I7F A;  1PYB A;  5LMN L;  4MTN A;  1QUQ A;  4LFA Q;  4LFB Q;  5E7N A;  1YHQ A;  3MEF A;  2ATW A;  4DUY L;  1IBM L;  1JE5 A;  3PO2 G;  4YCU A;  4A3B H;  5C4X H;  4GKK L;  2PMZ E;  1VQP A;  1N8R C;  5IYC G;  4DAM A;  1KAW A;  1I94 Q;  3RLN A;  1P8L A;  3K0X A;  2XTI A;  4LF9 L;  1A0I A;  2YV5 A;  2QA4 A;  2LSS A;  3J7A 5;  4OX9 L;  4R1J A;  2ID0 A;  1Q82 C;  1X9N A;  3RNU A;  1VQ9 A;  2LXK A;  1XNQ L;  3PF4 A;  1L1O B;  3HOV H;  1HNX Q;  1XTD A;  1HNZ L;  3F2C A;  3U4V A;  4A3M G;  1VQN A;  4HIK A;  4DV4 Q;  4AYB E;  3FKI H;  4OXP A;  1U0L A;  4JI1 Q;  2ZM6 L;  1YHA A;  4GNX A;  2CFM A;  1IXR A;  2RCN A;  1YVC A;  4JBW A;  2JQO A;  1VQI A;  1TWG H;  1X3E A;  1TWA H;  3S1R H;  4JI4 Q;  3J81 j;  3L7Z C;  4IFD I;  4JI8 L;  2FXQ A;  4BXX G;  1WI5 A;  2VNU D;  2PI2 A;  2EQS A;  1YI2 A;  1X56 A;  4A75 A;  4LFB L;  3CCL A;  4B3T L;  4DR4 Q;  2QGQ A;  2MO0 A;  3CCQ A;  4JV5 Q;  4A3L H;  4WJ4 A;  2YTY A;  1LYL A;  3OW2 A;  1J6Q A;  1N9W A;  4AYB G;  5AJ3 Q;  4UY8 C;  5M3F G;  4IOC A;  1BBW A;  4QY7 A;  1XMO L;  1XMQ L;  4BY1 H;  4EQ5 A;  2D62 A;  1J5E L;  1FVI A;  3AFP A;  3GTG H;  1SRO A;  3F2D A;  1A8V A;  4X66 Q;  1X65 A;  3K7A H;  4A3D H;  4GN3 B;  3AEV A;  5EAY A;  4LNQ A;  3DLL A;  4PMW A;  2IY5 B;  3EN2 A;  4KI0 A;  3HOX G;  3H0G H;  4JYA L;  2WP8 J;  3L0O A;  1C9O A;  5C0X G;  5IY0 A;  4A3B G;  1QZH A;  1OXV A;  3PUZ A;  3ULL A;  5C4X G;  1LTL A;  2D0P A;  4GLA C;  4R4C A;  4GLV B;  2VQF Q;  3M4Q A;  4IJL A;  4UPA A;  4XIG S;  2ZTE A;  3T1H L;  5IYB H;  2PNH A;  2R6G A;  5C0X J;  3HFZ B;  3M3Y H;  4KHP L;  2JA6 H;  4NB3 A;  4OWX B;  2AKW B;  3CF5 A;  4DR4 L;  3RN2 A;  2HQL A;  4DK6 C;  1PHJ A;  2K4K A;  3S2D H;  4LF7 Q;  1KHI A;  5HY6 A;  3M4O H;  2Q2H A;  1Z9F A;  2R92 H;  1VQO A;  3HOV G;  5AJ3 L;  2UXC L;  4R4O A;  2CWA A;  2GN5 A;  2RHQ B;  3AYH B;  4LUZ A;  4NPS A;  4AQY Q;  1MJE A;  3RLF A;  4IPH A;  5IYD H;  3FKI G;  2ZJQ A;  3GTJ H;  1KRS A;  3CCJ A;  3PCO B;  2JEA I;  4FDB A;  1WJJ A;  1EWI A;  2MFI A;  1FJG L;  1L2F A;  4DUZ Q;  5LMN W;  1PV4 A;  2AWO A;  5IP9 H;  4R4T A;  3AFQ A;  4A3L G;  4PG3 A;  2VQF L;  1EYG A;  1EIF A;  4A3G H;  4RMF A;  1K8A C;  4JI7 L;  5ELN A;  1SFO H;  4BY1 G;  3RZD H;  2GVB A;  2CCZ A;  2E5L Q;  4L5R C;  3M7N A;  1NY4 A;  3WWV A;  1IBL Q;  2NVX H;  4L5S A;  4A3D G;  2I5L X;  2UUA L;  2UXB L;  5GAD C;  4DR2 Q;  3KF6 A;  2UUC Q;  3H0G G;  2PI2 E;  2DGY A;  5FLX c;  4DR7 Q;  2MQH A;  2GVA A;  4JBK A;  2IT1 A;  4DV3 L;  4AQY L;  4HIM A;  1AE3 A;  3W1G A;  3OYY A;  1YJW A;  2F52 A;  4H02 A;  5C4J H;  4YHH L;  4PZ7 A;  1YHB A;  1HR0 L;  1Q1B A;  1EIY B;  1VQ6 A;  1OXS C;  4JG2 A;  5IYB G;  3FHW A;  3EBE A;  4DV7 Q;  3CCR A;  4DV6 Q;  2JA6 G;  3H15 A;  3J81 i;  1XJV A;  1D8L A;  4DV5 L;  2CWP A;  1N34 Q;  1XPR A;  4NXN Q;  3I2Z A;  1MIU A;  3TQY A;  4NXM L;  3G71 A;  4GS3 A;  2R92 G;  1PH1 A;  1PH5 A;  4XTC S;  2HHH Q;  3JAM c;  2JA9 A;  5M5X H;  3KFU A;  4KLK A;  2R7D A;  4UP7 A;  1K8G A;  1IBL L;  3PF5 A;  4B3S Q;  2OQ0 A;  4JI0 Q;  4JI5 L;  4JI6 Q;  1BKB A;  4DR2 L;  2EIF A;  3GD7 A;  1PYS B;  1VQC A;  1MJC A;  3W5O A;  2WFW A;  3K7U C;  1YBY A;  5ELO A;  2K50 A;  5IP9 G;  3UDI A;  5C0X I;  2L15 A;  4B3M Q;  1YNX A;  1JT8 A;  4J15 A;  1X3F A;  3SGI A;  1N32 Q;  4A3G G;  3UDX A;  3KF6 B;  4GN4 B;  4B3R L;  1NTG A;  1PH7 A;  3CME A;  3J7Z C;  5M5W H;  1Q81 C;  1N33 Q;  1QZG A;  4DR3 Q;  3ULJ A;  4LFC L;  2YYZ A;  5LMU L;  2Y0S E;  5M3M H;  3E9I A;  5GRO A;  4Y7N H;  2QEX A;  5FJ8 G;  3STB D;  3S2H H;  5J3B A;  1CKO A;  5C44 H;  4QGU A;  1EFW A;  2Q2U A;  4B3S L;  1JJ2 A;  4JOI C;  2UU9 L;  2DUD A;  1WCM G;  2B63 H;  3UDF A;  2K5V A;  4GKJ Q;  4A3K H;  2Y0S G;  3M4P A;  1RL2 A;  4WJ3 M;  4EX5 A;  4JI2 L;  5JJK A;  1JB7 A;  1K3R A;  4C2M H;  3CC4 A;  4LFA L;  2A8V A;  1YEZ A;  3CCV A;  4LF8 Q;  3ULP A;  1SLJ A;  1G51 A;  3RZO H;  4X64 Q;  1DGS A;  1I94 L;  1UE5 A;  4YWL A;  3KYH C;  4DR3 L;  1QVC A;  4JBJ A;  3JAM i;  1KXL A;  1K83 H;  2JEB I;  2YU9 H;  4A3C H;  1PVO A;  1IZ6 A;  4O2D A;  2BA1 A;  1Y1W H;  4X62 Q;  1X6O A;  4UP8 A;  1Y1V H;  1UE7 A;  5BR8 Q;  4JOI A;  4BY7 G;  2ALY B;  1HNX L;  3T1Y Q;  4DR6 Q;  4P71 A;  4C3J H;  1K73 C;  2NZH A;  1P16 A;  2K5N A;  4P73 A;  4DV4 L;  1W3S A;  1K9M C;  2E2J H;  3HOZ H;  3AQQ A;  3KF8 B;  4JI1 L;  4YWK A;  1SE8 A;  1KQS A;  1XNR Q;  1HR0 W;  1AH9 A;  1VQK A;  1W2B A;  3IRB A;  3CMA A;  3ER0 A;  4OON A;  3J81 c;  4R4Q A;  4DV2 Q;  1S3O A;  2ZTC A;  1FGU A;  4JI4 L;  2RF4 A;  2N78 A;  2OWO A;  1E24 A;  3GTK H;  5M3M G;  1CKM A;  4DK3 C;  3CC2 A;  2XGT A;  2VUM G;  4L5Q A;  4JV5 L;  3KJP A;  4IPC A;  5C44 G;  2VS1 A;  1YIJ A;  3G4S A;  1HH2 P;  1HZ9 A;  1LUZ A;  4LUO A;  1NMG A;  2B29 A;  1G6P A;  1Q86 C;  2VQE Q;  4X66 L;  4X65 Q;  1VQ7 A;  1I3Q H;  1BVS A;  1VQ4 A;  2B63 G;  2KHJ A;  3TRZ A;  1UWV A;  3CAM A;  4K0K Q;  4A3K G;  3UDG A;  2ZTD A;  1UEB A;  3KDF A;  1OXU A;  1R9T H;  4QQB X;  1Q7Y C;  2JJQ A;  1LM0 A;  2MO1 A;  1CKN A;  1X3G A;  3J80 i;  3TRE A;  4OWT B;  3PO3 G;  3PUX A;  1IYJ B;  4JCV E;  2NVT H;  3BZK A;  4IJH A;  1K0R A;  4DV1 Q;  2VZA A;  3GO5 A;  4A3C G;  3TS2 A;  4POF A;  4BBS H;  2A19 A;  1Y1W G;  2UXD Q;  1Y1V G;  2IX0 A;  4JI3 Q;  4LF5 Q;  3HOY G;  2B3G A;  2UXD L;  4LF7 L;  3I55 A;  3S1M H;  5FJ8 H;  4DR1 Q;  3CC7 A;  1O7I A;  1H95 A;  4A3E H;  3OTO Q;  3HOZ G;  1OXX K;  2AWN A;  2K75 A;  4A4I A;  4HJA A;  1VQ5 A;  4RG1 A;  3RN5 A;  1VCI A;  4TVA B;  1WCM H;  3GTL H;  2KCM A;  3HOU H;  3NEN A;  4AIM A;  2R7F A;  4OWW B;  4DUZ L;  5C3E H;  1B7Y B;  1E3P A;  4GLX A;  3EIV A;  2OCE A;  3I4M H;  3RLO A;  4LF6 Q;  3KDF B;  5JEA G;  2E5L L;  4DKA C;  3TEH B;  3GTO H;  1I6H H;  5IWA Q;  4PZ8 A;  5LMN Q;  4BBR H;  1Q8K A;  1Z47 A;  1B70 B;  1CKN B;  1SR3 A;  3I56 A;  1GM5 A;  1IBM Q;  2JA5 H;  4LF5 L;  1VQF A;  4ME3 A;  3BZC A; 
#chains in the Genus database with same CATH topology
 2E74 C;  2CKZ B;  4HJ5 A;  4H44 C;  4BY7 H;  1DZ1 A;  3OTO L;  4U68 A;  5CV4 A;  1WTQ A;  1S40 A;  2AHO B;  5E3F A;  4OX9 Q;  3K80 C;  3D4W A;  1XYI A;  1XNQ Q;  4GN5 A;  3CPF A;  4ZCK A;  3SXH A;  3PUW A;  5J1Z A;  1N34 L;  3W2D A;  4NXN L;  2ZM6 Q;  3FVQ A;  2VUM H;  4A3J B;  1EFI D;  3DWA A;  4DV0 Q;  3I4L A;  4A3E G;  1ZKO A;  1RJT A;  4IUV A;  4GNX C;  1E1O A;  4LW1 A;  1PZK D;  4KN4 C;  5JVH 3;  1ASY A;  4JI0 L;  2UUB Q;  2AMC B;  4JI6 L;  3H3V H;  5DLQ E;  4G4K A;  2ASB A;  5BN3 A;  1PH4 A;  3E9H A;  3U9O A;  4OO1 G;  2K5D A;  4IO9 A;  1XMO Q;  1J5E Q;  3G6E A;  4XQJ A;  1V8Q A;  1QG7 A;  1SNC A;  2P5Z X;  4HJ9 A;  1MGS A;  3L9A X;  1KL9 A;  2V1C C;  3MXU A;  4HAE A;  1PRT B;  2HD3 A;  4IN3 A;  4X3T A;  1Z6H A;  3I8Z A;  3S24 A;  4LF4 L;  1E2Z A;  1WTH A;  5CV8 A;  4P72 A;  4IUQ A;  1EU3 A;  3PSI A;  1E22 A;  1HZB A;  3URY A;  2XN9 C;  1SMY D;  1XX8 A;  3M85 A;  3FKI B;  4DK0 A;  1QNK A;  3WOE A;  1H9R A;  3UE0 A;  3U4Z A;  1RHP A;  2O2L D;  1HNW L;  3PIP 3;  1V43 A;  1WVL A;  2JA7 G;  2AUJ D;  2R93 G;  3S14 H;  4QMG A;  3NQI A;  2EYF A;  1VQH A;  4FVM A;  1B53 A;  3H94 A;  1KRT A;  2Z4H A;  1CZW A;  3GTP H;  1N36 Q;  3STB C;  1SYG A;  4YWM A;  2CW0 D;  3CW2 C;  1SNO A;  2MNA A;  5GAH C;  1SE3 A;  4DAP A;  1CHQ D;  2WAQ G;  4K14 A;  2KA7 A;  1HHV A;  4AH6 A;  3GTP B;  3N6R A;  4K0K L;  2JP1 A;  5FKA C;  1XNR L;  2A6H C;  3OIQ A;  1TWF H;  1B9N A;  2L5T A;  2D0O A;  1MD2 D;  2IHE A;  1EIG A;  1EUJ A;  3HKZ E;  4DV2 L;  1NBW A;  1Y8P B;  1FD7 D;  1PA6 A;  3CPW A;  1A6X A;  1TWF B;  3PIO 3;  1QNU A;  3M4O B;  3ZJY C;  4N9T A;  3MXN A;  1C0A A;  2EOT A;  4NKL A;  1CA6 A;  2QDB A;  1PFS A;  2NN6 I;  2PQA A;  3DM3 A;  1LT4 D;  1GKH A;  1FL0 A;  5IP7 G;  1AE2 A;  4DNI A;  2RDH A;  2XIW A;  2RCF A;  3GQB A;  2HDM A;  1E1T A;  2CH4 W;  3E0E A;  2SNS A;  2KED A;  1ET9 A;  1G2S A;  5ELC A;  3IL8 A;  2KVM A;  4DV1 L;  1X3Q A;  1Q12 A;  3I3C A;  3A8K E;  2DJG C;  2UXD L;  2IX1 A;  4EQP A;  4A93 G;  1A15 A;  3MWY W;  3CRK C;  4RKL A;  4B3R Q;  3X3N A;  2PMZ B;  4BXX H;  4A76 A;  5C4J B;  2EYL A;  4QJF A;  4V19 0;  4R4I A;  2KCT A;  5M3F H;  4EVO A;  1TWH H;  3J81 E;  2VB2 X;  3ERS X;  3K81 C;  1ZYR D;  3PV0 A;  3GTM H;  4C3I H;  1SJH D;  1D2B A;  1TWH B;  4MIU A;  2N3S A;  1PYB A;  4RGO S;  2NTT A;  4LFA Q;  5E7N A;  4A3B H;  1EWC A;  5C4X H;  2JN4 A;  3DXJ C;  1GUT A;  3VYU A;  1VQP A;  4C3I B;  5IYC G;  1I94 Q;  1KAW A;  1ICW A;  1MBY A;  4A3B B;  1LTR D;  3J7A 5;  1SXT A;  1JOR A;  4G7Z C;  5JOB A;  2EYP A;  1X9N A;  3QOL A;  1EY9 A;  2LXK A;  3PQI A;  3HOV H;  2EZV A;  1SYB A;  1HNZ L;  1U4L A;  5DM6 3;  3K5M A;  1IXR A;  2RCN A;  4J1M A;  1VQI A;  4K2K A;  4BS9 A;  2HUG A;  1M4V A;  4CDE C;  4BWG B;  2MHV A;  2EQS A;  2Q8T A;  4B3T L;  1EYA A;  2QGQ A;  2MO0 A;  4JV5 Q;  1ML0 D;  1N9W A;  1QJO A;  4IOC A;  1XMQ L;  4EQ5 A;  2D62 A;  4C2M B;  1FVI A;  1IHZ A;  3AFP A;  1PXU A;  1A8V A;  1DXM A;  2MJ8 A;  3K7A H;  4A3D H;  3A54 A;  4GN3 B;  4IUT A;  3DLL A;  3N52 A;  3HOX G;  1O7Z A;  1PRT D;  3L0O A;  5C0X G;  2KEE A;  3DHQ A;  1Y1W B;  3K7A B;  1DJR D;  3I90 A;  1LTL A;  2TSS A;  3AU7 A;  3FEW X;  2VQF Q;  4IUN A;  5I2X A;  2A6E C;  3T1H L;  4H7B A;  5IYB H;  1TVX A;  3EFX D;  1TT2 A;  1YNJ D;  4FF4 A;  1O7Y A;  3CF5 A;  4FO2 A;  1KHI A;  2Q2H A;  2DNE A;  1HQM C;  2GN5 A;  4LUZ A;  4AQY Q;  3RLF A;  4ZKB B;  1KRS A;  3K5O A;  2JEA I;  1WJJ A;  1EY8 A;  1EWI A;  1JOO A;  1FJG L;  2ZT9 C;  1L2F A;  1WD0 A;  4DUZ Q;  1T5E A;  5LMN W;  5IP9 H;  4R4T A;  4HN7 A;  3WOF A;  1MSH A;  1EYG A;  1F9P A;  1K8A C;  3NPP A;  5ELN A;  1SFO H;  2CQA A;  4BY1 G;  2E5L Q;  1SYC A;  2CH4 A;  2G5D A;  2PCF B;  4L5R C;  4L5S A;  2F0U A;  2I5L X;  3SK8 A;  1DOK A;  3J80 E;  4DR2 Q;  4RWS C;  2NVT B;  3H0G G;  2WKC A;  1SFO B;  2MQH A;  3H3V C;  1HXY D;  1AE3 A;  4I7A A;  3W1G A;  1G2T A;  2F52 A;  1GUG A;  4RH6 A;  1OXS C;  2JA6 G;  3H15 A;  3J81 i;  2IJ0 A;  1D8L A;  4UHV A;  2CWP A;  1N34 Q;  1XPR A;  4NXN Q;  3I2Z A;  4HCE A;  4NXM L;  2R92 G;  1PH5 A;  2F0L A;  4DU9 A;  4KLK A;  3DEP A;  1IBL L;  3VR5 A;  2OQ0 A;  4JI0 Q;  2PZW A;  4JI6 Q;  1U9R A;  1SND A;  1PYS B;  4FF3 A;  2AQ2 B;  1YBY A;  5IGC A;  3UDI A;  2PYK A;  3J81 L;  4KV6 A;  5E1F A;  3SGI A;  2L12 A;  3UDX A;  4XXE A;  4HTH A;  1PH7 A;  3J7Z C;  5M5W H;  2QKI C;  1QZG A;  3NUC A;  1EY7 A;  5CBA E;  1F2L A;  2Y0S E;  5M3M H;  5CBE E;  1I4X A;  3DWP A;  1I4G A;  3S2H H;  4JK1 C;  5J3B A;  1FYC A;  4QGU A;  1EFW A;  2DY8 A;  4B3S L;  2UU9 L;  2R93 B;  1WCM G;  1CQF A;  4GKJ Q;  4A3K H;  2D5D A;  3M4P A;  2F0G A;  5C5L A;  3NBI A;  2F3W A;  5KYI A;  2EJF C;  1RD9 D;  3H6M A;  1CQV A;  3D3R A;  4DR3 L;  5FLX L;  1IW7 C;  2YU9 H;  3NHH A;  4O2D A;  5ELD A;  5T1I A;  1Y1V H;  1MHW C;  3DWQ A;  4BY7 G;  4ULL A;  4C3J H;  3Q6S A;  2E2J H;  1K9M C;  4CKC A;  4K0K Q;  3KF8 B;  4JI1 L;  1XNR Q;  1KQS A;  1AH9 A;  3HOY B;  2FHT A;  3J81 c;  4DV2 Q;  3P20 A;  5EKK A;  3PMF A;  1NR2 A;  3GTK H;  1SJE D;  3CC2 A;  2B39 A;  1L0X B;  2VUM G;  1YIJ A;  3RD4 A;  3G4S A;  4LUO A;  3GTK B;  2B29 A;  3IFT A;  1VQ7 A;  4DN4 M;  2B63 G;  1UWV A;  3DEO A;  2EJG C;  1R9T H;  1I4P A;  2V4D A;  4LMQ D;  3J80 i;  3TRE A;  5CV9 A;  1IYJ B;  2L11 A;  4PQX A;  3KK7 A;  4DV1 Q;  1R9T B;  3GO5 A;  1B3A A;  2Q8I B;  2UXD Q;  1TS5 A;  2IX0 A;  4LF7 L;  5FJ8 H;  3P1H A;  1BO0 A;  4CJ2 C;  3NXW A;  1W6K A;  2K75 A;  4FF2 A;  1VQ5 A;  1HPC A;  3J80 L;  1D1K A;  2A68 C;  4TVA B;  3GTL H;  2KCM A;  3NEN A;  2Z1C A;  1Y69 U;  4OWW B;  1IYU A;  5C3E H;  1B7Y B;  3ERQ A;  1F77 A;  4LK1 C;  5COY A;  3EVQ A;  3EIV A;  3K59 A;  3RLO A;  1BDO A;  5JEA G;  3NQT A;  4DKA C;  5KYL A;  5C3E B;  3GTO H;  4PZ8 A;  1ONL A;  3OWE B;  2UUC L;  2PO4 A;  3JC6 6;  3GTQ H;  2RHS B;  3W1B A;  4DR7 L;  3BDO A;  3KLS X;  3GTO B;  1IBK Q;  2WII B;  2LMC B;  2NVQ B;  3F8T A;  1A63 A;  3MXN B;  4DV6 L;  3S1N H;  3TP6 A;  2Z6B A;  3GDE A;  1HNZ Q;  2X69 A;  3S17 H;  1VQL A;  1KD1 C;  2YTV A;  1I4R A;  2F0P A;  4K6L A;  1F2Y A;  1OXT A;  3CD6 A;  4JVZ A;  1TS3 A;  4MZ9 A;  1CSQ A;  3I91 A;  4IZ8 A;  5K36 G;  3S17 B;  1CI3 M;  5IWA L;  1EZ8 A;  1WOC A;  4B3T Q;  1EYD A;  4KN7 C;  1YJ9 A;  4CHT B;  4IPD A;  4GOP C;  2JE6 I;  3F2U A;  3RMH A;  1YIT A;  3J80 c;  4WRD A;  1XMQ Q;  3SR1 A;  1VQM A;  2DJF C;  3PIP A;  4NW2 A;  3CCM A;  3B6Y A;  2PNR C;  1BR9 A;  2EDG A;  3PO3 H;  2A73 B;  1JQY D;  2Z6K C;  2F0N A;  1M1K C;  1N33 L;  1X55 A;  3MA2 B;  4IOA A;  1EOT A;  2RSO A;  4BBR G;  5IGD A;  2JA5 G;  2F4V Q;  4A3F H;  5CYU A;  1YZ6 A;  5I9O A;  3A5U A;  3TS0 A;  3S1Q H;  3T1H Q;  1ASZ A;  2M9V A;  4A3I H;  2VXW A;  4APV A;  4A3F B;  4GOP A;  3GP7 A;  2F0W A;  2WKD A;  2NWG A;  1KIX A;  4A3I B;  3S1R B;  4K6D A;  2F0M A;  2G9H D;  1STE A;  3BVM A;  3KLW A;  2LS0 1;  2Z6K A;  4DR5 Q;  2WAQ E;  4DA2 A;  4ALP A;  3RR5 A;  2HIV A;  3PIO A;  3Q8D A;  1FJG Q;  1SMX A;  4WJW A;  4BY1 B;  3JAM E;  3NBH B;  2VL6 A;  2RA4 A;  3VR4 A;  1VS0 A;  1HZC A;  4UP9 A;  4I7Z C;  4RGM A;  1OO9 B;  4DR6 L;  2F3I A;  3NK9 A;  1JMC A;  5CV7 A;  4CDF C;  1VMP A;  1TWC H;  3A0J A;  4Q0F A;  4O42 A;  3V05 A;  1LTT D;  3VYR A;  2ZJR A;  3S16 H;  3WDN A;  2CHB D;  3SDZ A;  2Q2T A;  3S2D B;  3OHX C;  3S15 H;  1YNN D;  2HQE A;  2K14 A;  2KEC A;  2R92 B;  1L0W A;  4IFD G;  1PRT F;  3S16 B;  2NN6 H;  1BF4 A;  1B9M A;  1L1O C;  5FLM G;  2EXZ A;  4NXM Q;  1T9H A;  1UE6 A;  3V2T A;  4HID A;  3G48 A;  1PTO C;  1G29 1;  1LT6 D;  1KLG D;  4N8X 1;  4L5T A;  1SRU A;  4R9W A;  3R93 A;  1STY A;  2NVY H;  1EU4 A;  3I4N G;  1RIP A;  4KY6 A;  5M9O A;  2R7Z G;  3HOW G;  2K01 A;  3F1Z A;  2JA8 G;  1X54 A;  4BA2 I;  5D3D A;  4DUY Q;  3M9B A;  1UUP A;  1VQA A;  1LAC A;  1PZJ D;  1L1O A;  4YY3 L;  1E0B A;  4G7H C;  1D6E C;  5H1S E;  4HIO A;  4A3J H;  3KJO A;  1V1O A;  4C3H G;  1BQQ T;  2OTL A;  4K2L A;  3CCS A;  1NNX A;  1IL8 A;  4HJ8 A;  1VQD A;  1GUS A;  2ES2 A;  2UU9 Q;  2F0D A;  4XQQ A;  2CQO A;  1NAP A;  4HCS A;  2LXJ A;  3ZYY X;  4LFB Q;  4JW0 A;  1C8C A;  3PO2 G;  1HUN A;  1IBM L;  4GKK L;  4RKB A;  5C6A A;  1N8R C;  3ERO A;  1ET6 A;  4GZY C;  3NSW A;  3RLN A;  4HR7 B;  3T51 B;  1AN8 A;  5ISR A;  1LTB D;  1A0I A;  2QA4 A;  2LSS A;  1V1P A;  2XVS A;  2F1M A;  1GOZ A;  1QCB D;  1FNW A;  3RNU A;  2ZXP A;  4ZRZ A;  2D2C C;  1BCP B;  3MEH A;  2TMP A;  3F2C A;  1S5D D;  4A3M G;  3FKI H;  4OXP A;  1U0L A;  4JI1 Q;  4GNX A;  4CJ1 B;  5L37 A;  2A6H D;  5J22 A;  5T1G A;  1JWU D;  4JI8 L;  4UDU C;  1WI5 A;  2B2Y C;  1X56 A;  4A75 A;  3R2I A;  3CCL A;  5JPM C;  3CCQ A;  4M1U B;  2B63 B;  1LYL A;  4NP5 A;  4YIJ A;  4AYB G;  5AJ3 Q;  1BBW A;  1PFN A;  3GTG H;  3TBI B;  2DY7 A;  2HCC A;  2BE5 C;  4LNQ A;  3RZO B;  4KI0 A;  1F9S A;  5ELF A;  1C9O A;  3GTG B;  5IY0 A;  1FR3 A;  1QZH A;  1AEX A;  2F0E A;  3M4Q A;  1PDQ A;  4IJL A;  2B2Y A;  1ROD A;  2R6G A;  3M3Y H;  3HFZ B;  3D8G A;  3FDT A;  3D4D A;  4DR4 L;  1PHJ A;  3P75 A;  2K4K A;  1LTG D;  4LF7 Q;  3M4O H;  4HMJ A;  1Z9F A;  5A35 A;  4R4O A;  3M3Y B;  4NPS A;  5IYD H;  1MJE A;  1STA A;  1VDZ A;  3DMU A;  4I65 A;  2AWO A;  4HSV A;  5IGG A;  2K05 A;  4A3L G;  3CU7 A;  3AMU A;  2KCC A;  3NWS A;  1J8I A;  3A7A B;  4EGV A;  1SMY C;  4JI7 L;  1HFN A;  2ICE C;  1K8O A;  2GVB A;  3T13 A;  2K5Q A;  3M7N A;  1SBB B;  1NY4 A;  2R61 A;  2UUA L;  5GAD C;  1I4H A;  4RA8 A;  2UUC Q;  1NR4 A;  4DR7 Q;  2FIN B;  2IT1 A;  4EQO A;  4CJ0 B;  5JPN C;  1STG A;  1YJW A;  4H02 A;  5C4J H;  4YHH L;  4PZ7 A;  1YHB A;  4IUU A;  1HR0 L;  4KKT A;  2DN8 A;  4DV6 Q;  2F3V A;  2CW0 C;  2KQ3 A;  3OOC A;  1MIU A;  1WTO A;  3TQY A;  3G71 A;  4GS3 A;  1F2Z A;  1PH1 A;  1SAP A;  5IGE A;  3JAM c;  5IT9 E;  2Y0S B;  3KFU A;  2K5W A;  5I2Y A;  2R7D A;  4DF7 A;  5G3L D;  4DNR B;  4PNY A;  3PF5 A;  1VMC A;  4FXG C;  3IFD A;  4JI5 L;  3TP5 A;  3GD7 A;  5D65 A;  3A56 A;  5NUC A;  3K7U C;  1X32 A;  1I6H B;  2L15 A;  4BBR B;  1YNX A;  3KBG A;  2JA5 B;  4J15 A;  1CA5 A;  1B50 A;  4A3G G;  3KF6 B;  1NTG A;  1N33 Q;  4LFC L;  3E9I A;  5GRO A;  4M8A A;  5FJ8 G;  2SOB A;  1BOS A;  5KRU A;  2H1E A;  1S5F D;  1XWE A;  5IGF A;  4IAL A;  2Q2U A;  2A6E D;  1SYE A;  5EPJ A;  5KNC A;  1DYQ A;  5KEE A;  5JJK A;  3FMC A;  2EY2 A;  5K5P A;  3HEJ A;  4C2M H;  2A8V A;  1YEZ A;  1XTC D;  1G51 A;  2JYO A;  3BVG A;  1I4Q A;  1W6J A;  1UE5 A;  4QIW B;  4YWL A;  3M7G A;  3NTI A;  4A3C H;  3K0Y A;  1H9S B;  1Y1W H;  2BA1 A;  4G57 A;  1X6O A;  1UE7 A;  4KJN A;  1BCP D;  1HNX L;  4DR6 Q;  5AFW A;  4P71 A;  1IKL A;  1K73 C;  2NZH A;  1P16 A;  2K5N A;  1ZYR C;  1W3S A;  4DV4 L;  1W2B A;  2QEJ C;  3IRB A;  4OON A;  4JI4 L;  1S3O A;  2GA4 B;  2N78 A;  2OWO A;  2K03 A;  4KD4 A;  4DK3 C;  1ILQ A;  4DK1 A;  2XGT A;  1JCK B;  3KJP A;  4MN3 A;  4IPC A;  5C44 G;  1I50 B;  4B9W A;  4K5X A;  1D5Z C;  2RBM A;  4X66 L;  1BVS A;  3HG9 A;  3TRZ A;  4X3S A;  4F7X A;  4RGT A;  3KDF A;  1OXU A;  2R7Z B;  5BN4 A;  2JA8 B;  3FPU B;  4O1N A;  3PO3 G;  3PUX A;  4JCV E;  2NVT H;  4IJH A;  2N55 A;  4CKB A;  2FJ2 A;  2A5H A;  3OSO A;  1EWH A;  3TS2 A;  3SE0 A;  4POF A;  1X3P A;  2A19 A;  1EQV A;  1G91 A;  2RQX A;  1JOQ A;  2RSN A;  2B3G A;  3SK6 A;  1HRJ A;  1H95 A;  4C3H B;  4A3E H;  3HZX A;  3OTO Q;  3HOZ G;  1OXX K;  4A4I A;  3CKI B;  3RN5 A;  1VCI A;  1PRT C;  3R8B A;  3KUP A;  4A3E B;  4OO1 H;  3VR2 A;  2MP1 A;  4RFB A;  3PO2 B;  3RUZ A;  1Z7T A;  2ENB A;  1YNJ C;  3T16 A;  2AUK A;  1AZP A;  1GHJ A;  5JAV A;  4IUR A;  5DEH A;  1TR5 A;  1B70 B;  1CKN B;  1SR3 A;  4RCO A;  1BNZ A;  1IBM Q;  2PZU A;  4LF5 L;  1BXT A;  4ME3 A;  3BZC A;  4LJZ C;  1EEF D;  1HA5 A;  1JIC A;  5IT9 L;  1PH8 A;  1JE4 A;  1A3U A;  2BH8 A;  1DOL A;  2IL8 A;  2K28 A;  1IW7 D;  4YCW A;  3I72 A;  3ICE A;  4BBS G;  1G8Z D;  1EQR A;  3NEM A;  4LF4 Q;  1C4Q A;  2A1A A;  4DPG A;  3NE5 B;  3C3L A;  2RKS A;  1VQE A;  4YCV A;  1S72 A;  2JA7 H;  2R93 H;  1SSO A;  3D4R A;  1WTV A;  1U4P A;  3CXC A;  2HHH L;  1DD2 A;  2D9U A;  4LF6 L;  4AYB B;  3K6O A;  4IPG A;  1RTN A;  5CC4 A;  1IYV A;  1PLF A;  1ZXT A;  2JA7 B;  4ZLT F;  3HOU G;  3MZ5 A;  2HIX A;  2N8N A;  3K8A A;  1HNW Q;  5M5Y B;  3QG1 A;  2B8G A;  2EXD A;  5CMD A;  5I6Y A;  2ZJP A;  4F88 A;  3I4M G;  1TS4 A;  1ENF A;  2F0K A;  5DAU A;  1QIL A;  2WAQ B;  1CM9 A;  3LNN A;  1XPO A;  5I9P A;  2N88 A;  1XPU A;  2BA0 A;  4LWC A;  1PTO B;  3H91 A;  3HOY H;  1B3Q A;  4DV0 L;  1VQG A;  5LL6 S;  2FFK B;  1I5F A;  2Q2I A;  1KC8 C;  1U4M A;  1WD1 A;  1E7Z A;  2UUB L;  3SK5 A;  4A3J G;  2JK8 A;  5IT9 c;  1CTM A;  1PH6 A;  5IP7 H;  1TWG B;  5C5M A;  4LUV A;  1YJN A;  1JJC B;  1LLR D;  2I5M X;  3X3M A;  4QIW E;  1HCZ A;  2ZXO A;  4LF8 L;  3D31 A;  1TY2 A;  1RDP D;  4QB4 A;  4MNO A;  2PW7 A;  4X64 L;  2OTJ A;  2YTX A;  1WFQ A;  5HGQ A;  2OXP A;  3U58 A;  2RVL A;  2A68 D;  4JC0 A;  2F0I A;  4XDX A;  5FK9 C;  5JJI A;  5JJL A;  1ZEQ X;  4X62 L;  2KBN A;  1TXY A;  4X3K A;  2A69 D;  4C1N K;  4DXG A;  1RF2 D;  4JI7 Q;  4A93 H;  4PMB A;  2F0V A;  4L63 B;  3PUY A;  2Z9H A;  3C1E A;  3T1Y L;  1R4Q B;  4BA1 I;  4PZ6 A;  1WYD A;  1I6V C;  3ND8 A;  4GNX B;  2UUA Q;  4CBV A;  1B8A A;  5EKI A;  4A93 B;  2DNC A;  5C3W A;  1D7Q A;  3NWT A;  1F9Q A;  1MI2 A;  3FPP A;  4YHH Q;  4P2C B;  1HR0 Q;  3U9S A;  2E2H H;  1ESR A;  1PFM A;  4ODG A;  4XT1 B;  3K5N A;  2E8G A;  1EOV A;  2LFN A;  1N36 L;  2VQE L;  4KHZ A;  3FRP B;  4X65 L;  4KY5 A;  1EQQ A;  1VQB A;  1FNU A;  3ONA B;  3UE1 A;  5HGT A;  3HGB A;  2E2H B;  3G7L A;  1GD7 A;  3CCE A;  5IYC H;  2LKV A;  4OO1 I;  1A62 A;  1GVP A;  1Q46 A;  3I4O A;  2O5J C;  4P74 A;  2MGS A;  4JI5 Q;  1C7Y A;  4WFN 3;  2K5H A;  2X6L A;  3NEL A;  4CDC C;  1PH9 A;  3RZD B;  4ZAI A;  5IE8 A;  1QVF A;  2NVQ H;  1HJP A;  2IX3 A;  4JI3 L;  5EJW A;  4J6H A;  3A55 A;  3CQZ H;  2H5X A;  2MPM A;  3A74 A;  3G6J B;  2WAC A;  3MFY A;  4UAI A;  5D14 A;  5C4H A;  1SDF A;  3KOJ A;  2F0H A;  3LGJ A;  4LFC Q;  3LWE A;  3VA7 A;  2L1B A;  1A2U A;  2HDL A;  2Z0S A;  1Q90 A;  2J0T D;  2Z4I A;  3CQZ B;  4P75 A;  5DM7 3;  2F03 A;  4K8J A;  4DXF A;  1KNE A;  2QCP X;  3VYT A;  2K1B A;  5IYD G;  1SYD A;  1U5K A;  2HT1 A;  2QF7 A;  2PQA B;  2WB1 G;  1JWM D;  3TP8 A;  2BH2 A;  3HOX H;  3E5S A;  5LMN L;  3I7F A;  5C0X H;  1QUQ A;  1RKN A;  2PW5 A;  3Q0A A;  1YHQ A;  4YCU A;  2OT2 A;  1GUO A;  1FGB D;  4DAM A;  3HOX B;  3OPO A;  1ENC A;  4FYD A;  1JR0 D;  2K33 A;  3K0X A;  1IKM A;  3D6W A;  4LF9 L;  2E76 C;  2ID0 A;  4V0B A;  1GUN A;  1VQ9 A;  3EQL C;  4DAY A;  5EQ0 A;  1HNX Q;  1XTD A;  5I4D A;  3UI2 A;  4HIK A;  1H9K A;  4DV4 Q;  4AYB E;  1A2T A;  5G3L F;  1YHA A;  1X3E A;  5C44 B;  1PMR A;  2QDL A;  3S1R H;  3L7Z C;  4JI4 Q;  2FXQ A;  4BXX G;  1F2M A;  2PI2 A;  4WJ4 A;  3GV6 A;  2KJX A;  4UY8 C;  3SK4 A;  5M3F G;  4QY7 A;  4BY1 H;  2HCI A;  1PYW D;  1SRO A;  3F2D A;  4X66 Q;  3SHL A;  4PMW A;  4C3I G;  1G6Z A;  3H0G H;  3CHB D;  4JYA L;  4A3B G;  4B9X A;  1LV9 A;  1OXV A;  2B2T C;  2L4N A;  3PUZ A;  3ULL A;  3HRZ C;  1PTO D;  5C4X G;  4GLA C;  4R4C A;  1A3T A;  3QIA A;  4UPA A;  3H0G B;  2ZTE A;  1U4R A;  2PNH A;  5C0X J;  4KHP L;  4RAU C;  4KY7 A;  2JA6 H;  2F4I A;  2AKW B;  3S2D H;  3Q24 A;  2CVR A;  3ND9 A;  5HY6 A;  1BBX C;  2R92 H;  1VQO A;  3HOV G;  2K7V A;  2UXC L;  1JB3 A;  1J9O A;  2RHQ B;  3AYH B;  3LX0 A;  2JA6 B;  3MXP A;  4IPH A;  2ZJQ A;  3GTJ H;  3CCJ A;  3TP7 A;  4ZYS A;  2EYO A;  2QIL A;  2FMM A;  2B2T A;  1CZG A;  3E6Z X;  1BCP F;  1EQT A;  2ZXR A;  1F9R A;  3GTJ B;  1DOM A;  3AFQ A;  4PG3 A;  2VQF L;  2B2U C;  4RMF A;  4HED A;  3WWV A;  5HUR A;  1IBL Q;  2NVX H;  4A3D G;  5KNB A;  3A8I E;  2UXB L;  4FF1 A;  2K6A A;  3H09 A;  3TDQ A;  1H9M A;  2NVX B;  4DV3 L;  4AQY L;  1B1Z A;  3OYY A;  1VQ6 A;  3S1M B;  2F0J A;  4JG2 A;  4G7O C;  5IYB G;  3CRL C;  4KMU C;  4L6T B;  1EEI D;  2B2U A;  2XNA C;  2I07 B;  4RHS A;  4DV5 L;  3I70 A;  4IQZ A;  3QJY A;  1VF7 A;  1WCM B;  3E3X A;  2HHH Q;  2JA9 A;  5M5X H;  2KUM A;  3E0J A;  3MC0 B;  4UP7 A;  4B3S Q;  1S5B D;  2NB0 A;  4DR2 L;  2EIF A;  3I4M B;  1MJC A;  5M5X B;  2WFW A;  5IP9 G;  5C0X I;  1YNN C;  1JT8 A;  2EVB A;  1SE4 A;  1X3F A;  1K8M A;  3MFG A;  3CME A;  4BY7 B;  4MTK A;  4LAA A;  4DR3 Q;  2BE5 D;  1NSN S;  2YYZ A;  3KF8 A;  5LMU L;  3VYS A;  2B2V C;  2QEX A;  2JSO A;  3STB D;  2KOL A;  4ZUI A;  2PQE A;  1CKO A;  3VR6 A;  1JJ2 A;  5KIX A;  1TY0 A;  2EY1 A;  2VUM B;  3BYT B;  2B63 H;  3UDF A;  3A8J E;  4JI2 L;  2OEO A;  1JB7 A;  1K3R A;  3CCV A;  4LF8 Q;  3ULP A;  2NYZ D;  3RZO H;  4X64 Q;  2B2V A;  1KXL A;  3JAM i;  2JEB I;  4X62 Q;  1II3 A;  4UP8 A;  2WV6 D;  4FXK C;  5FO9 B;  5EPL A;  3K58 A;  4C1N I;  4FP5 D;  1M8A A;  3T1Y Q;  2BCO A;  2ICI A;  4NMZ A;  4P73 A;  3AQQ A;  4YWK A;  1SE8 A;  4ABN A;  1D5X C;  1CT1 D;  1VQK A;  2IW3 A;  4F87 A;  4GKJ L;  3CMA A;  1HUM A;  4R4Q A;  2RF4 A;  3JAM L;  3BG3 A;  2RDG A;  5M3M G;  2L9H A;  3J7A V;  4L5Q A;  1GHK A;  1ICF B;  3BYY B;  2VS1 A;  1NCV A;  1SNM A;  4RCN A;  1HH2 P;  1HZ9 A;  3L3O C;  1LUZ A;  5JEA H;  2VQE Q;  4X65 Q;  3S14 B;  1I3Q H;  1HFG A;  2BDO A;  1VQ4 A;  1SYF A;  4A3K G;  3UDG A;  3KLR A;  2BOS A;  1XXG A;  1EY6 A;  4ZKC B;  4QQB X;  4KKU A;  5EBD A;  2MO1 A;  1I3Q B;  1X3G A;  4IUP A;  3S9W A;  3BZK A;  1K0R A;  3R3O A;  1EZ6 A;  1DCZ A;  3M4Y A;  2XRQ D;  2AQ3 B;  1Y1V G;  3SVM A;  4JI3 Q;  3HOY G;  3LWU A;  4KK7 A;  5KGU A;  1O7I A;  4KD3 A;  4C3J G;  4KKS A;  4XQN A;  3OMG A;  3K5L A;  5K36 H;  5IGB A;  2C5C A;  2BDN A;  2C9O A;  2WB1 B;  3BDC A;  4X3U A;  4ZQ3 A;  3GV3 A;  2KCN A;  1EIH A;  4AIM A;  1B44 D;  2R7F A;  1NUC A;  1SNQ A;  4GLX A;  1UAP A;  1TII D;  5F2D A;  3C1F A;  2F0S A;  4HSP A;  3TEH B;  1I6H H;  5IWA Q;  5LMN Q;  4BBR H;  1QE6 A;  1Q8K A;  4OIK A;  2JA5 H;  1K0S A;  3KBX A;  5JEA J;  4QL5 A;  3BU2 A;  5ELB A;  3VDY A;  4LF9 Q;  5LHY 1;  1UE1 A;  3U50 C;  3CP0 A;  5FO8 B;  2SDF A;  4DV7 L;  1V9P A;  5BN5 A;  4ME5 A;  4OL7 A;  1H9J A;  3Q22 A;  4DGZ A;  2KHI A;  3VR3 A;  1QWY A;  1WTW A;  4FXD A;  5CV5 A;  1KDC A;  1QVG A;  5M3F B;  2E2I H;  1BBU A;  1Q1E A;  4Q5V A;  1IL2 A;  5EPK A;  4EQN A;  3H3V I;  3OMC A;  2M2L A;  3GTM B;  2EE1 A;  1NMF A;  4Y52 H;  4JBM A;  2E2I B;  4F8M A;  5C3E G;  2L0C A;  5E4W C;  2VY3 A;  4B3M L;  3NBH A;  1IBK L;  2I0Q A;  3OIP A;  1ILP A;  3DUZ A;  1N32 L;  5C4X B;  2EYM A;  2C35 B;  4O0A A;  4JYA Q;  5GQO A;  2OQK A;  2B2W C;  3MVV A;  1SN8 A;  1VQJ A;  1CSP A;  2O4X A;  2M00 A;  2XWB B;  3A5Z B;  2QW7 A;  2NUC A;  3HOV B;  4QUF A;  3L2P A;  4KHP Q;  4IFD H;  5FLX E;  1OTC A;  2EY6 A;  1V1Q A;  1TKW B;  5FLM H;  2H4O A;  2F0T A;  2UXC Q;  3V96 A;  1I50 H;  1Q3L A;  1QUQ B;  2IHF A;  1GO3 E;  2J4X A;  4OEL B;  2B2W A;  4H13 C;  3I4N H;  4B08 A;  1LT3 D;  3HKS A;  1VQ8 A;  5IOD A;  4HMI A;  4S3S A;  2R7Z H;  1SE2 A;  1NJI C;  3HOW H;  1WTX A;  4TKO B;  2F4V L;  3PGZ A;  1EYC A;  2JA8 H;  4A3D B;  1Y8O B;  2PZT A;  2AQ1 B;  5BR8 L;  3I4N B;  3VA5 A;  3SEB A;  2N49 A;  4WOR A;  4DAY B;  3HOW B;  2VW9 A;  5FOB B;  1NE3 A;  2UXB Q;  1MKH A;  1KLU D;  4KTA A;  3QO2 A;  1O7L A;  1M90 C;  4C3H H;  4DV3 Q;  1HA6 A;  4A3F G;  4K5V A;  1UNS A;  3QB3 A;  4OGQ C;  4DR5 L;  4GOP B;  1AZQ A;  1PH2 A;  1EY4 A;  2E2D C;  2WIN B;  4A3I G;  3MHB A;  4YY3 Q;  3BJU A;  3HS0 C;  3TN2 A;  4DV5 Q;  3HKZ G;  1QB5 D;  1BCP C;  3PUV A;  4QUC A;  4HJ7 A;  3PO2 H;  3I73 A;  1PTO F;  3T56 B;  2KEN A;  4IFD J;  1CFM A;  3F2B A;  1PH3 A;  3NP8 A;  4QCL A;  4JPB W;  1B4O A;  5IIF A;  4ILW A;  5GAE C;  1LAB A;  3FP9 A;  2F0O A;  5GAG C;  4R8N A;  2A74 C;  1Q8I A;  3D0F A;  5KND A;  4A3M H;  4GKK Q;  4POG A;  5LL6 X;  4KJO A;  1STB A;  4Z9C B;  1EL0 A;  4DR1 L;  1KTK A;  2I5H A;  2NBF A;  3A7L A;  4TQU S;  2WB1 E;  2K52 A;  4NDX A;  3BVZ A;  4A3M B;  2EPB A;  4PV1 C;  5LMU Q;  1JJG A;  3C2P A;  2SNM A;  3CCU A;  2KHS A;  1CUK A;  1Y14 B;  2MUY A;  4X6A H;  1HZA A;  1VF5 C;  1VQF A;  1RTO A;  3DM1 A;  2XWJ B;  2NZO A;  5M5Y H;  1GUW A;  4JI8 Q;  2NN6 G;  4JI2 Q;  2IPK D;  4K8I A;  4MTN A;  3K57 A;  3MEF A;  2ATW A;  5CR3 A;  4DUY L;  1JE5 A;  2PMZ E;  1HQR D;  1DON A;  3EA6 A;  1K3B C;  4XT3 B;  1STN A;  1STH A;  1P8L A;  1AP0 A;  2XTI A;  2RDF A;  5C3X A;  2YV5 A;  4J8Q A;  3BS1 A;  4OX9 L;  4R1J A;  1Q82 C;  1PTO H;  4XYQ A;  4OIJ A;  1XNQ L;  5M5W B;  3PF4 A;  1L1O B;  3BDL A;  3U4V A;  1VQN A;  3HP3 A;  5M3M B;  2ZM6 L;  5EBC A;  5FO7 B;  2CFM A;  4U67 3;  1YVC A;  1PZI D;  2E75 C;  3R2T A;  4JBW A;  2JQO A;  3ITP A;  1E2V A;  4CKE A;  3S2H B;  1TWG H;  1TWA H;  3J81 j;  4IFD I;  4DAV A;  2VNU D;  4ID6 A;  4LFB L;  1YI2 A;  1S4Z A;  4DR4 Q;  1LO5 D;  4A3L H;  2YTY A;  3OW2 A;  2F0F A;  1J6Q A;  1TWA B;  1DM0 B;  4RGN A;  5A2Q E;  1TS2 A;  4A3K B;  4QF4 A;  4CGY B;  3T4A C;  1XMO L;  2EYH A;  1J5E L;  1LTA D;  1LTS D;  1EY5 A;  1QOH A;  1X65 A;  5ELE A;  3AEV A;  5EAY A;  4DNT B;  2IY5 B;  3EN2 A;  1PFB A;  2WP8 J;  1T5X D;  2L55 A;  3QWN A;  2PPB C;  2YU9 B;  2D0P A;  1V1P B;  5IOC A;  1Y1V B;  4GLV B;  4XIG S;  2X6G A;  3Q23 A;  2EYJ A;  3QOJ A;  4C3J B;  2E2J B;  4NB3 A;  4OWX B;  3RN2 A;  2HQL A;  4DK6 C;  1AFP A;  5AJ3 L;  4DFA A;  2CWA A;  3OWF A;  4XYO A;  3FKI G;  3PCO B;  4MHE A;  4FDB A;  2MFI A;  5J39 A;  1PV4 A;  4ZUJ A;  1AW7 A;  2XRS D;  3EJI A;  1EIF A;  4A3G H;  3RZD H;  2CCZ A;  1EY0 A;  2LY7 A;  1JWS D;  3KF6 A;  3MTS A;  1RCV D;  2PI2 E;  2DGY A;  1CK1 A;  4N9P A;  3TME A;  4A3G B;  5FLX c;  1WTP A;  2GVA A;  4JBK A;  1GXD C;  4R8I A;  5EGT A;  4HIM A;  4H0L C;  1ENA A;  1R4P B;  2O5I C;  1ESF A;  3IKJ A;  4KHV A;  1Q1B A;  4TRD A;  1EIY B;  3FHW A;  3EBE A;  4DV7 Q;  5C4Z A;  3CCR A;  3J7A F;  3O13 A;  1D1I A;  1D5M C;  3MXG A;  1JOK A;  1XJV A;  1E2W A;  2NZ1 D;  2A69 C;  4OHJ A;  1JC7 A;  2K32 A;  5D3I B;  4CDD C;  3GTL B;  1KDA A;  3C46 A;  4XTC S;  2XSC A;  1HTP A;  1LTI D;  1K8G A;  2EJM A;  1BKB A;  1BUV T;  1VQC A;  3W5O A;  5ELO A;  2K50 A;  4B3M Q;  1H9S A;  2R3Z A;  1SNP A;  4ZK9 B;  5DNF A;  2IWH A;  1N32 Q;  4GN4 B;  4B3R L;  3GTQ B;  3TZU A;  1Q81 C;  4L8J A;  3AB9 A;  3ULJ A;  3MAQ A;  4PMC A;  4FNF A;  4C56 C;  4Y7N H;  2G9D A;  1MSG A;  1A3V A;  5EKL A;  5C44 H;  3S1N B;  1HTL D;  1S5E D;  2NTS A;  5JJZ A;  3OW7 A;  4JOI C;  4Y7N B;  2DUD A;  3NTH A;  1Y8N B;  2K5V A;  2Y0S G;  1RL2 A;  4WJ3 M;  4EX5 A;  2EY5 A;  3CC4 A;  4LFA L;  5I6W A;  1C48 A;  1SLJ A;  1DGS A;  2J7Z A;  1I94 L;  3KYH C;  1QVC A;  4JBJ A;  1K83 H;  1PVO A;  1IZ6 A;  3PO3 B;  5BR8 Q;  5CV6 A;  5A2Q L;  4JOI A;  1O78 A;  2VB3 X;  1S5C D;  2ALY B;  1K83 B;  2FMC A;  3HOZ H;  3BZD B;  1HR0 W;  1KAB A;  3S1Q B;  5JVG 3;  4K5W A;  1O80 A;  3ER0 A;  3W3A A;  1SEB D;  1FGU A;  2ZTC A;  5CGK A;  2K04 A;  1E24 A;  3HOZ B;  1CKM A;  1UEA B;  1GJX A;  1B2T A;  1LT5 D;  1KAA A;  3HKZ B;  4JV5 L;  3NTK A;  3TSS A;  1KDB A;  1NMG A;  1G6P A;  1Q86 C;  2I46 A;  3IAY A;  2KHJ A;  4OEM B;  3CAM A;  2SEB D;  2ZTD A;  1UEB A;  3KLS A;  1Q7Y C;  2JJQ A;  1LM0 A;  1CKN A;  2OF1 A;  4OWT B;  1L0Y B;  1TQO A;  1FNV A;  2VZA A;  4A3C G;  3T53 B;  4BBS H;  1Y1W G;  3QR8 A;  3P7J A;  1TWC B;  1CHP D;  3TZD A;  4LF5 Q;  2Q8R E;  2JXM B;  4N8F A;  3I55 A;  3S1M H;  4DR1 Q;  3CC7 A;  5E4X A;  2F0Q A;  4BBS B;  5COR A;  2Z8L A;  4TSS A;  4HJA A;  2AWN A;  4RG1 A;  1TU2 B;  3S15 B;  1WCM H;  3HOU H;  4RHR A;  2B8F A;  3D6C A;  4DUZ L;  1E3P A;  4E6I A;  1K28 A;  3HOU B;  2OCE A;  1WTR A;  3I4M H;  4LF6 Q;  3J7Y W;  3KDF B;  2E5L L;  5TSS A;  1Z47 A;  1GM5 A;  1KNA A;  3I56 A;  2NVY B; 
#chains in the Genus database with same CATH homology
 2CKZ B;  3JC6 6;  1PH8 A;  2RHS B;  5JEA J;  3W1B A;  4HJ5 A;  3GTQ H;  4BY7 H;  4DR7 L;  3OTO L;  4QL5 A;  2BH8 A;  3BU2 A;  1IBK Q;  3VDY A;  4LF9 Q;  1S40 A;  2AHO B;  4OX9 Q;  3F8T A;  1A63 A;  3K80 C;  4YCW A;  1UE1 A;  3U50 C;  3CP0 A;  2UUC L;  4DV7 L;  1V9P A;  1XNQ Q;  3MXN B;  4DV6 L;  3ICE A;  3S1N H;  4GN5 A;  3CPF A;  1EQR A;  3NEM A;  4BBS G;  3GDE A;  1HNZ Q;  2KHI A;  3PUW A;  4LF4 Q;  1N34 L;  2A1A A;  4DPG A;  3S17 H;  4NXN L;  2ZM6 Q;  1VQE A;  4YCV A;  1S72 A;  1VQL A;  2JA7 H;  2R93 H;  1KD1 C;  2YTV A;  2VUM H;  1OXT A;  4DV0 Q;  3CD6 A;  3CXC A;  2HHH L;  4MZ9 A;  4A3E G;  1CSQ A;  4GNX C;  1QVG A;  4LF6 L;  4IPG A;  2E2I H;  5K36 G;  1BBU A;  1E1O A;  1Q1E A;  4LW1 A;  5IWA L;  1WOC A;  1IL2 A;  4JI0 L;  1ASY A;  4B3T Q;  2UUB Q;  3H3V I;  2AMC B;  4JI6 L;  3H3V H;  3HOU G;  5DLQ E;  1YJ9 A;  2ASB A;  1NMF A;  1PH4 A;  2HIX A;  4IPD A;  4GOP C;  4Y52 H;  2JE6 I;  2N8N A;  3E9H A;  3K8A A;  4JBM A;  1HNW Q;  4OO1 G;  5C3E G;  4IO9 A;  1XMO Q;  2EXD A;  3J80 c;  2ZJP A;  2VY3 A;  1YIT A;  1XMQ Q;  1J5E Q;  1VQM A;  1IBK L;  2I0Q A;  4B3M L;  3PIP A;  3G6E A;  3CCM A;  3B6Y A;  1N32 L;  3I4M G;  3PO3 H;  4HJ9 A;  2Z6K C;  1KL9 A;  1M1K C;  1N33 L;  1X55 A;  2C35 B;  4O0A A;  4JYA Q;  2V1C C;  2OQK A;  5GQO A;  4IOA A;  4BBR G;  3S24 A;  1XPO A;  2JA5 G;  4LF4 L;  1XPU A;  2F4V Q;  4A3F H;  1SN8 A;  1VQJ A;  1CSP A;  2BA0 A;  4P72 A;  4LWC A;  1YZ6 A;  3HOY H;  3A5Z B;  3PSI A;  3A5U A;  4DV0 L;  3TS0 A;  3S1Q H;  1E22 A;  3T1H Q;  1HZB A;  1ASZ A;  4A3I H;  1VQG A;  3L2P A;  4KHP Q;  1I5F A;  4APV A;  3M85 A;  1OTC A;  4GOP A;  2Q2I A;  1KC8 C;  1E7Z A;  2UUB L;  1V1Q A;  4A3J G;  2JK8 A;  3UE0 A;  5IT9 c;  5FLM H;  1PH6 A;  5IP7 H;  3U4Z A;  1KIX A;  4LUV A;  1YJN A;  1HNW L;  2UXC Q;  1V43 A;  1JJC B;  2I5M X;  3KLW A;  1I50 H;  4QIW E;  2Z6K A;  2JA7 G;  2R93 G;  4DR5 Q;  1QUQ B;  2WAQ E;  4LF8 L;  3S14 H;  3D31 A;  2IHF A;  1GO3 E;  2OTJ A;  4MNO A;  3RR5 A;  4X64 L;  4ALP A;  1VQH A;  1WFQ A;  2YTX A;  5HGQ A;  3I4N H;  2HIV A;  1KRT A;  3PIO A;  3Q8D A;  3U58 A;  3HKS A;  1VQ8 A;  1FJG Q;  2R7Z H;  3HOW H;  1SMX A;  4JC0 A;  1NJI C;  3GTP H;  1N36 Q;  3NBH B;  3PGZ A;  3STB C;  2F4V L;  4X62 L;  2JA8 H;  5JJL A;  2VL6 A;  2KBN A;  5JJI A;  1TXY A;  4YWM A;  1VS0 A;  5BR8 L;  1HZC A;  3CW2 C;  4UP9 A;  5GAH C;  2MNA A;  4A93 H;  2WAQ G;  4JI7 Q;  2N49 A;  4DAY B;  3PUY A;  3T1Y L;  4DR6 L;  2F3I A;  4AH6 A;  2VW9 A;  1JMC A;  4BA1 I;  4PZ6 A;  1WYD A;  4K0K L;  1XNR L;  1TWC H;  1NE3 A;  4GNX B;  2UUA Q;  1TWF H;  2UXB Q;  3A0J A;  1MKH A;  2D0O A;  1B8A A;  2IHE A;  1EUJ A;  3HKZ E;  4DV2 L;  1NBW A;  1M90 C;  4C3H H;  1PA6 A;  1D7Q A;  4DV3 Q;  2ZJR A;  4A3F G;  3CPW A;  3S16 H;  4DR5 L;  4GOP B;  4YHH Q;  2Q2T A;  1HR0 Q;  1PH2 A;  3ZJY C;  3S15 H;  4A3I G;  2K14 A;  2E2H H;  1L0W A;  4YY3 Q;  1C0A A;  3BJU A;  4IFD G;  4GKJ L;  1PFS A;  2E8G A;  2NN6 I;  1EOV A;  2PQA A;  4DV5 Q;  3DM3 A;  2VQE L;  4KHZ A;  4X65 L;  1N36 L;  1GKH A;  1L1O C;  3HKZ G;  3PUV A;  1EQQ A;  5FLM G;  1FL0 A;  5IP7 G;  1VQB A;  4HJ7 A;  3PO2 H;  4NXM Q;  1AE2 A;  4DNI A;  1T9H A;  1UE6 A;  2KEN A;  3UE1 A;  4HID A;  1GD7 A;  3G48 A;  4IFD J;  3CCE A;  5IYC H;  3F2B A;  1PH3 A;  4OO1 I;  1G29 1;  1A62 A;  1GVP A;  1Q46 A;  3I4O A;  1E1T A;  1SRU A;  4L5T A;  3E0E A;  4P74 A;  5GAE C;  4JI5 Q;  1C7Y A;  2NVY H;  3I4N G;  2K5H A;  1RIP A;  3FP9 A;  3NEL A;  1PH9 A;  4DV1 L;  3HOW G;  2R7Z G;  5GAG C;  1Q12 A;  3F1Z A;  2JA8 G;  1X54 A;  5IE8 A;  3D0F A;  4A3M H;  1QVF A;  2NVQ H;  1HJP A;  4BA2 I;  4DUY Q;  4JI3 L;  3M9B A;  2IX1 A;  3CQZ H;  4POG A;  4GKK Q;  2H5X A;  3A74 A;  1VQA A;  4A93 G;  4B3R Q;  4DR1 L;  2I5H A;  3KOJ A;  1L1O A;  4TQU S;  2WB1 E;  2K52 A;  4YY3 L;  3LGJ A;  4LFC Q;  4BXX H;  5H1S E;  1JJG A;  2Z0S A;  4P75 A;  5LMU Q;  4A76 A;  4QJF A;  4HIO A;  4A3J H;  3CCU A;  1CUK A;  1Y14 B;  3KJO A;  5IYD G;  2OTL A;  3CCS A;  4X6A H;  4R4I A;  2KCT A;  1U5K A;  5M3F H;  2HT1 A;  1TWH H;  2PQA B;  3ERS X;  1HZA A;  1VQD A;  4HJ8 A;  2ES2 A;  2UU9 Q;  2WB1 G;  3K81 C;  3PV0 A;  3GTM H;  2BH2 A;  4C3I H;  2NZO A;  3HOX H;  2CQO A;  5M5Y H;  4JI8 Q;  2LXJ A;  2NN6 G;  4JI2 Q;  2N3S A;  3I7F A;  1PYB A;  5LMN L;  4MTN A;  1QUQ A;  4LFA Q;  4LFB Q;  5E7N A;  1YHQ A;  3MEF A;  2ATW A;  4DUY L;  1IBM L;  1JE5 A;  3PO2 G;  4YCU A;  4A3B H;  5C4X H;  4GKK L;  2PMZ E;  1VQP A;  1N8R C;  5IYC G;  4DAM A;  1KAW A;  1I94 Q;  3RLN A;  1P8L A;  3K0X A;  2XTI A;  4LF9 L;  1A0I A;  2YV5 A;  2QA4 A;  2LSS A;  3J7A 5;  4OX9 L;  4R1J A;  2ID0 A;  1Q82 C;  1X9N A;  3RNU A;  1VQ9 A;  2LXK A;  1XNQ L;  3PF4 A;  1L1O B;  3HOV H;  1HNX Q;  1XTD A;  1HNZ L;  3F2C A;  3U4V A;  4A3M G;  1VQN A;  4HIK A;  4DV4 Q;  4AYB E;  3FKI H;  4OXP A;  1U0L A;  4JI1 Q;  2ZM6 L;  1YHA A;  4GNX A;  2CFM A;  1IXR A;  2RCN A;  1YVC A;  4JBW A;  2JQO A;  1VQI A;  1TWG H;  1X3E A;  1TWA H;  3S1R H;  4JI4 Q;  3J81 j;  3L7Z C;  4IFD I;  4JI8 L;  2FXQ A;  4BXX G;  1WI5 A;  2VNU D;  2PI2 A;  2EQS A;  1YI2 A;  1X56 A;  4A75 A;  4LFB L;  3CCL A;  4B3T L;  4DR4 Q;  2QGQ A;  2MO0 A;  3CCQ A;  4JV5 Q;  4A3L H;  4WJ4 A;  2YTY A;  1LYL A;  3OW2 A;  1J6Q A;  1N9W A;  4AYB G;  5AJ3 Q;  4UY8 C;  5M3F G;  4IOC A;  1BBW A;  4QY7 A;  1XMO L;  1XMQ L;  4BY1 H;  4EQ5 A;  2D62 A;  1J5E L;  1FVI A;  3AFP A;  3GTG H;  1SRO A;  3F2D A;  1A8V A;  4X66 Q;  1X65 A;  3K7A H;  4A3D H;  4GN3 B;  3AEV A;  5EAY A;  4LNQ A;  3DLL A;  4PMW A;  2IY5 B;  3EN2 A;  4KI0 A;  3HOX G;  3H0G H;  4JYA L;  2WP8 J;  3L0O A;  1C9O A;  5C0X G;  5IY0 A;  4A3B G;  1QZH A;  1OXV A;  3PUZ A;  3ULL A;  5C4X G;  1LTL A;  2D0P A;  4GLA C;  4R4C A;  4GLV B;  2VQF Q;  3M4Q A;  4IJL A;  4UPA A;  4XIG S;  2ZTE A;  3T1H L;  5IYB H;  2PNH A;  2R6G A;  5C0X J;  3HFZ B;  3M3Y H;  4KHP L;  2JA6 H;  4NB3 A;  4OWX B;  2AKW B;  3CF5 A;  4DR4 L;  3RN2 A;  2HQL A;  4DK6 C;  1PHJ A;  2K4K A;  3S2D H;  4LF7 Q;  1KHI A;  5HY6 A;  3M4O H;  2Q2H A;  1Z9F A;  2R92 H;  1VQO A;  3HOV G;  5AJ3 L;  2UXC L;  4R4O A;  2CWA A;  2GN5 A;  2RHQ B;  3AYH B;  4LUZ A;  4NPS A;  4AQY Q;  1MJE A;  3RLF A;  4IPH A;  5IYD H;  3FKI G;  2ZJQ A;  3GTJ H;  1KRS A;  3CCJ A;  3PCO B;  2JEA I;  4FDB A;  1WJJ A;  1EWI A;  2MFI A;  1FJG L;  1L2F A;  4DUZ Q;  5LMN W;  1PV4 A;  2AWO A;  5IP9 H;  4R4T A;  3AFQ A;  4A3L G;  4PG3 A;  2VQF L;  1EYG A;  1EIF A;  4A3G H;  4RMF A;  1K8A C;  4JI7 L;  5ELN A;  1SFO H;  4BY1 G;  3RZD H;  2GVB A;  2CCZ A;  2E5L Q;  4L5R C;  3M7N A;  1NY4 A;  3WWV A;  1IBL Q;  2NVX H;  4L5S A;  4A3D G;  2I5L X;  2UUA L;  2UXB L;  5GAD C;  4DR2 Q;  3KF6 A;  2UUC Q;  3H0G G;  2PI2 E;  2DGY A;  5FLX c;  4DR7 Q;  2MQH A;  2GVA A;  4JBK A;  2IT1 A;  4DV3 L;  4AQY L;  4HIM A;  1AE3 A;  3W1G A;  3OYY A;  1YJW A;  2F52 A;  4H02 A;  5C4J H;  4YHH L;  4PZ7 A;  1YHB A;  1HR0 L;  1Q1B A;  1EIY B;  1VQ6 A;  1OXS C;  4JG2 A;  5IYB G;  3FHW A;  3EBE A;  4DV7 Q;  3CCR A;  4DV6 Q;  2JA6 G;  3H15 A;  3J81 i;  1XJV A;  1D8L A;  4DV5 L;  2CWP A;  1N34 Q;  1XPR A;  4NXN Q;  3I2Z A;  1MIU A;  3TQY A;  4NXM L;  3G71 A;  4GS3 A;  2R92 G;  1PH1 A;  1PH5 A;  4XTC S;  2HHH Q;  3JAM c;  2JA9 A;  5M5X H;  3KFU A;  4KLK A;  2R7D A;  4UP7 A;  1K8G A;  1IBL L;  3PF5 A;  4B3S Q;  2OQ0 A;  4JI0 Q;  4JI5 L;  4JI6 Q;  1BKB A;  4DR2 L;  2EIF A;  3GD7 A;  1PYS B;  1VQC A;  1MJC A;  3W5O A;  2WFW A;  3K7U C;  1YBY A;  5ELO A;  2K50 A;  5IP9 G;  3UDI A;  5C0X I;  2L15 A;  4B3M Q;  1YNX A;  1JT8 A;  4J15 A;  1X3F A;  3SGI A;  1N32 Q;  4A3G G;  3UDX A;  3KF6 B;  4GN4 B;  4B3R L;  1NTG A;  1PH7 A;  3CME A;  3J7Z C;  5M5W H;  1Q81 C;  1N33 Q;  1QZG A;  4DR3 Q;  3ULJ A;  4LFC L;  2YYZ A;  5LMU L;  2Y0S E;  5M3M H;  3E9I A;  5GRO A;  4Y7N H;  2QEX A;  5FJ8 G;  3STB D;  3S2H H;  5J3B A;  1CKO A;  5C44 H;  4QGU A;  1EFW A;  2Q2U A;  4B3S L;  1JJ2 A;  4JOI C;  2UU9 L;  2DUD A;  1WCM G;  2B63 H;  3UDF A;  2K5V A;  4GKJ Q;  4A3K H;  2Y0S G;  3M4P A;  1RL2 A;  4WJ3 M;  4EX5 A;  4JI2 L;  5JJK A;  1JB7 A;  1K3R A;  4C2M H;  3CC4 A;  4LFA L;  2A8V A;  1YEZ A;  3CCV A;  4LF8 Q;  3ULP A;  1SLJ A;  1G51 A;  3RZO H;  4X64 Q;  1DGS A;  1I94 L;  1UE5 A;  4YWL A;  3KYH C;  4DR3 L;  1QVC A;  4JBJ A;  3JAM i;  1KXL A;  1K83 H;  2JEB I;  2YU9 H;  4A3C H;  1PVO A;  1IZ6 A;  4O2D A;  2BA1 A;  1Y1W H;  4X62 Q;  1X6O A;  4UP8 A;  1Y1V H;  1UE7 A;  5BR8 Q;  4JOI A;  4BY7 G;  2ALY B;  1HNX L;  3T1Y Q;  4DR6 Q;  4P71 A;  4C3J H;  1K73 C;  2NZH A;  1P16 A;  2K5N A;  4P73 A;  4DV4 L;  1W3S A;  1K9M C;  2E2J H;  3HOZ H;  3AQQ A;  3KF8 B;  4JI1 L;  4YWK A;  1SE8 A;  1KQS A;  1XNR Q;  1HR0 W;  1AH9 A;  1VQK A;  1W2B A;  3IRB A;  3CMA A;  3ER0 A;  4OON A;  3J81 c;  4R4Q A;  4DV2 Q;  1S3O A;  2ZTC A;  1FGU A;  4JI4 L;  2RF4 A;  2N78 A;  2OWO A;  1E24 A;  3GTK H;  5M3M G;  1CKM A;  4DK3 C;  3CC2 A;  2XGT A;  2VUM G;  4L5Q A;  4JV5 L;  3KJP A;  4IPC A;  5C44 G;  2VS1 A;  1YIJ A;  3G4S A;  1HH2 P;  1HZ9 A;  1LUZ A;  4LUO A;  1NMG A;  2B29 A;  1G6P A;  1Q86 C;  2VQE Q;  4X66 L;  4X65 Q;  1VQ7 A;  1I3Q H;  1BVS A;  1VQ4 A;  2B63 G;  2KHJ A;  3TRZ A;  1UWV A;  3CAM A;  4K0K Q;  4A3K G;  3UDG A;  2ZTD A;  1UEB A;  3KDF A;  1OXU A;  1R9T H;  4QQB X;  1Q7Y C;  2JJQ A;  1LM0 A;  2MO1 A;  1CKN A;  1X3G A;  3J80 i;  3TRE A;  4OWT B;  3PO3 G;  3PUX A;  1IYJ B;  4JCV E;  2NVT H;  3BZK A;  4IJH A;  1K0R A;  4DV1 Q;  2VZA A;  3GO5 A;  4A3C G;  3TS2 A;  4POF A;  4BBS H;  2A19 A;  1Y1W G;  2UXD Q;  1Y1V G;  2IX0 A;  4JI3 Q;  4LF5 Q;  3HOY G;  2B3G A;  2UXD L;  4LF7 L;  3I55 A;  3S1M H;  5FJ8 H;  4DR1 Q;  3CC7 A;  1O7I A;  1H95 A;  4A3E H;  3OTO Q;  3HOZ G;  1OXX K;  2AWN A;  2K75 A;  4A4I A;  4HJA A;  1VQ5 A;  4RG1 A;  3RN5 A;  1VCI A;  4TVA B;  1WCM H;  3GTL H;  2KCM A;  3HOU H;  3NEN A;  4AIM A;  2R7F A;  4OWW B;  4DUZ L;  5C3E H;  1B7Y B;  1E3P A;  4GLX A;  3EIV A;  2OCE A;  3I4M H;  3RLO A;  4LF6 Q;  3KDF B;  5JEA G;  2E5L L;  4DKA C;  3TEH B;  3GTO H;  1I6H H;  5IWA Q;  4PZ8 A;  5LMN Q;  4BBR H;  1Q8K A;  1Z47 A;  1B70 B;  1CKN B;  1SR3 A;  3I56 A;  1GM5 A;  1IBM Q;  2JA5 H;  4LF5 L;  1VQF A;  4ME3 A;  3BZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...