4JBJA

Structural mimicry for functional antagonism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
198
structure length
198
Chain Sequence
MTPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Interferon-activable protein 202
publication title Structural basis for termination of AIM2-mediated signaling by p202
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbjA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbjA01
2OTJA 3TS2A 1GKHA 3U50C 5GADC 2UXCL 4P74A 4JOIC 1U0LA 1QUQA 4A3EH 1HNZQ 2QGQA 4OO1G 3J80c 1EUJA 3KLWA 4PZ8A 1HZBA 1GD7A 1XMOL 4A3BG 2ATWA 2A19A 2JK8A 3PGZA 1PH2A 1K73C 4JI0Q 4KHPQ 3AQQA 2MO1A 4DV4Q 1EFWA 4DR7L 3BZCA 1V43A 3PV0A 5C0XJ 4X64L 4HJ7A 4GN5A 3F8TA 2ZTCA 4WJ4A 5IE8A 5C4XG 4EX5A 2RCNA 4BY7G 1E22A 3E0EA 5C4JH 4A3CG 4BY1H 1WOCA 4DV0L 2V1CC 4A3MH 2IY5B 2F52A 1SR3A 1N32L 4UP7A 5HY6A 4KI0A 2K5VA 4A76A 1FJGL 4B3ML 2UXBL 2N3SA 5J3BA 5M3FH 1X3EA 4YY3Q 2BH8A 5C0XI 5JJKA 1OXVA 3NENA 2I5LX 1HR0L 2F3IA 4GKJL 1Q7YC 4UP9A 4KLKA 2UXDL 3KF6A 1I50H 4IPGA 2KHIA 3U4ZA 4DR4Q 4DK3C 1Y1WG 1RL2A 4JI8Q 4LUZA 4DR2Q 2VQEL 1WFQA 3AEVA 1LTLA 3TQYA 3ERSX 3U4VA 3G71A 5IP7G 1WI5A 3OYYA 1K9MC 2NN6I 3I4NH 3CXCA 4P73A 2N78A 3CMEA 1N33Q 5IYDH 3PUVA 4B3TQ 4JI3Q 2BA0A 3J81j 1S40A 1I3QH 1NJIC 1QVFA 4HIMA 1LM0A 3HOZH 1PVOA 4A3JG 2PMZE 2Q2IA 1I6HH 4PZ6A 4YHHL 2ZJQA 4B3RL 2ZM6L 1N36L 3FKIH 4B3SL 1QVCA 3I55A 3K80C 1SMXA 3GDEA 3CCRA 4Y7NH 1HNXL 1VQHA 1YJWA 4X6AH 1X3FA 3S2DH 5LMNL 3S16H 2ZTEA 1XNRL 1X56A 4OWXB 4YCVA 5LMNW 3CCSA 1TWGH 4IJLA 2N49A 4X62L 1N34Q 1JT8A 1IXRA 3HFZB 1HNZL 2A8VA 4R4QA 3S15H 4K0KQ 2MNAA 1CKOA 1UE7A 2PQAA 2JA6G 4YCWA 5GROA 3CCMA 3CPFA 3T1YQ 3TS0A 5GAGC 1VQPA 4JI0L 4KHPL 2ZJPA 4DV4L 5IP9H 2WAQE 1FGUA 3KJOA 4A3LG 4R1JA 4ALPA 3M9BA 3ULLA 4QY7A 5M5XH 5JJLA 2JQOA 1XMQQ 2OWOA 3I2ZA 2E8GA 3GO5A 1BKBA 2I5MX 2JEBI 3G48A 2KHJA 5ELOA 5IYBH 1OXSC 1X54A 3AYHB 3E9IA 4GNXA 3A5ZB 3K8AA 4A3IH 4MZ9A 4A3FG 3KYHC 3PO3H 1KQSA 3GTKH 2AMCB 3UE1A 4MTNA 1I5FA 2R6GA 4A93H 3HOVG 3GD7A 3T1HQ 1VQAA 1WCMH 3PF5A 2WB1G 4JBKA 5C44G 2B63H 4A3KG 1S72A 1VQFA 5EAYA 4DR4L 1SFOH 4DR2L 3HOXH 3GTOH 3CC7A 3EIVA 2LSSA 4JCVE 3M3YH 1A8VA 3GTMH 3VDYA 1N8RC 3M4QA 1JB7A 4JC0A 5C3EH 2PNHA 2XGTA 4O0AA 4XIGS 4IFDG 3RZDH 5FLXc 1G6PA 5IYCG 4B3TL 4JI3L 2AWOA 2NZOA 4TVAB 3LGJA 4O2DA 4AYBG 1VQ4A 1XNRQ 2HT1A 3HOWH 4LF9L 1VQNA 5IWAQ 3NEMA 3MEFA 4BBSG 3Q8DA 1YNXA 4JI5Q 2A1AA 2JA8G 4AYBE 1VQKA 3H3VH 1YHAA 4IJHA 1Y1VH 3RN5A 3S1RH 2VY3A 1JJGA 3CCLA 1MKHA 1C7YA 2VZAA 1Q46A 1N34L 3S2HH 3L0OA 4JI2Q 3I4MH 5FJ8G 4L5SA 4BXXH 1VQGA 2IHEA 1X3GA 4DR3Q 3T1YL 1Q1BA 4LFCQ 5FLMH 4QL5A 3UE0A 3PUZA 2RHSB 3UDGA 1QZGA 1YBYA 1XJVA 1L1OA 2ZJRA 2N8NA 3PUXA 4DV1Q 2WP8J 1IBLQ 4AIMA 3K7UC 2NVTH 4OWWB 3PIPA 2OQKA 4NPSA 4GOPB 4IPDA 4DKAC 4IPCA 1XNQQ 2BA1A 2DGYA 4LUOA 1A62A 4Y52H 1VCIA 4POGA 4LUVA 2RF4A 3J7ZC 2R93H 1L1OC 2Z0SA 5JEAJ 4HJ5A 3HKZE 4PMWA 1Q1EA 1K83H 2GVAA 3M4PA 4DPGA 3CMAA 4HIDA 3ZJYC 3T1HL 1EYGA 3GTQH 3S17H 4LFBQ 3CW2C 1XPOA 4GN3B 2E2JH 1PA6A 1VQ6A 3J7A5 4JI4Q 3S14H 2Y0SE 4A3BH 4DV6Q 2E5LQ 1BBUA 4A3DG 5AJ3Q 3RLNA 4YWKA 4GLXA 1HR0W 1CKNA 2L15A 3A5UA 5C0XG 1YJ9A 1J6QA 5C4XH 1VQLA 2YV5A 1ASYA 4LF8Q 4BY7H 4A3CH 1VQMA 2K5HA 2ZTDA 4LFAQ 3RLFA 4X65Q 1YZ6A 2OQ0A 4FDBA 3D0FA 3RR5A 4QGUA 2R92G 1GM5A 2YU9H 2JE6I 4DV7Q 1C9OA 1NMGA 4JI5L 1T9HA 5M3MG 2EQSA 1IL2A 1VQCA 1HZAA 4APVA 1P8LA 3A0JA 4C2MH 2VL6A 3CAMA 1Q81C 2NN6G 2PI2E 1CUKA 4JBMA 4DV3Q 3H0GG 1JMCA 3FHWA 2VQFQ 4A3GG 1X65A 4L5QA 1I94Q 1KC8C 2IHFA 3PF4A 1KL9A 2OCEA 1Y1WH 1C0AA 2K52A 4OWTB 3RLOA 4JI2L 1Q82C 1CSPA 1PYSB 1J5EL 1G51A 2K4KA 3D31A 4JI1Q 4DR3L 4LFCL 4BBRG 3F2DA 5LMUQ 1TWFH 5IP7H 1VQEA 1XTDA 2NVXH 4NXNQ 4HIKA 1OXXK 1B8AA 3WWVA 4DV1L 1IBLL 2WAQG 3IRBA 2I0QA 1NBWA 3G4SA 1FL0A 2VS1A 3TREA 3J81i 1Q12A 2CKZB 4HJ9A 3ULPA 1IBKQ 2YTVA 4DNIA 4GOPA 4LF7Q 2HIXA 1XNQL 5JJIA 1O7IA 3UDFA 1SE8A 2VW9A 1FVIA 2GVBA 4PG3A 2K14A 4LFBL 3EN2A 3F2BA 1VQ8A 5IY0A 4BA1I 5E7NA 1YVCA 4UY8C 2IX1A 1W2BA 4JI4L 2CFMA 1Z47A 4GOPC 2JA6H 4OONA 3CPWA 4X66Q 4QIWE 4DV6L 4JI6Q 2E5LL 4OX9Q 4YY3L 4DK6C 4RG1A 3UDIA 2HIVA 5AJ3L 1ASZA 3CD6A 4BA2I 1XPUA 2Q2TA 2JA7G 4LF6Q 2R7ZG 1OTCA 4A3LH 5HGQA 2UUCQ 4JI8L 1CSQA 5M5YH 1VQ5A 4DAYB 4DV5Q 2PI2A 4LF5Q 4LF8L 1GVPA 2UUAQ 2KCTA 1B7YB 4LFAL 5H1SE 4X65L 3HOUG 1PH7A 5C3EG 4DV7L 1N33L 1K8AC 4JBJA 2QEXA 4JG2A 2K50A 4YWMA 4A3FH 3KFUA 5IT9c 1AE2A 3HOVH 4NB3A 3PO2G 1PFSA 3BU2A 3JAMi 2B29A 1YJNA 4DV3L 1BVSA 3H3VI 2VQFL 2VUMH 5C44H 3CCJA 1K8GA 4A3KH 1I94L 1QVGA 4C3HH 4LF4Q 2C35B 1PYBA 1X6OA 2MQHA 3M4OH 2HQLA 5BR8Q 2UXBQ 4JYAQ 2ID0A 1VQOA 4JI1L 4IOAA 4IOCA 4LW1A 2B3GA 1HZCA 4IPHA 1D8LA 1EWIA 3W5OA 4NXMQ 3S1MH 3K7AH 2RHQB 2AKWB 1Q8KA 4LWCA 4GS3A 4NXNL 2E2IH 2UXDQ 4KHZA 3KF6B 4GLAC 3HOYG 1E24A 5IYCH 4POFA 3STBC 1LYLA 1QZHA 4GLVB 2EIFA 3I4MG 4K0KL 3GTJH 3CCQA 1S3OA 4B3RQ 1B70B 3KDFB 1TXYA 3KJPA 2JA5G 1IBKL 4LF7L 2XTIA 1PH4A 2ES2A 4BBSH 4DAMA 1H95A 2JA8H 4HJAA 4A3EG 1SROA 1M90C 3S1NH 1AH9A 2Z6KA 4QJFA 1XMQL 1X55A 3HKZG 3I7FA 2BH2A 3PIOA 1VQJA 5LMNQ 3PSIA 5FJ8H 1Z9FA 1DGSA 5ELNA 1V1QA 2Y0SG 4AQYQ 4OO1I 2AHOB 1UWVA 4OX9L 1PH5A 4BY1G 3CC2A 4X62Q 1MJCA 1NE3A 2YYZA 2Z6KC 4A3MG 1X9NA 4LF6L 2NVQH 1IZ6A 2JA9A 3NELA 2UUCL 3S1QH 3F2CA 1SRUA 3TEHB 1HNWQ 2PQAB 1L0WA 2EXDA 3W1GA 1W3SA 4DV5L 3H15A 1YIJA 1KXLA 3CP0A 4R4CA 4R4OA 5M3FG 2UUAL 4LF5L 3L2PA 4GKKQ 2K75A 2KCMA 3I56A 1NMFA 2D0PA 1UEBA 2IX0A 2JEAI 4JV5Q 3J80i 4DR5Q 2LXJA 4A4IA 1UE5A 5JEAG 4JI7Q 2UUBQ 5IWAL 1KHIA 3M7NA 1TWHH 2AWNA 3S24A 1UE6A 4QQBX 3U58A 4GNXB 2FXQA 2CCZA 3BJUA 1JE5A 1LUZA 2YTYA 5IYDG 4LF4L 5BR8L 2MFIA 3HOZG 3RNUA 3DM3A 4JYAL 2JJQA 5DLQE 3KOJA 1E1TA 3CCUA 1D7QA 4A3DH 1IBMQ 4NXML 4DV2Q 1PHJA 1UE1A 3FKIG 1E7ZA 3B6YA 1KRTA 4HJ8A 2R7DA 3OTOQ 3PUWA 3G6EA 3ICEA 4EQ5A 3J81c 3JC66 2D0OA 4YWLA 1NY4A 4DUZQ 1VQIA 3OW2A 3KDFA 1EQQA 4P75A 1VQ9A 2D62A 2GN5A 2R92H 3K81C 1KIXA 1L2FA 5K36G 5M3MH 1PH8A 1HZ9A 2Q2HA 4A3JH 1VQBA 4J15A 4R4IA 1IYJB 1YHBA 1TWCH 1A0IA 3CQZH 3F1ZA 3H0GH 4LNQA 3I4OA 4LF9Q 2WFWA 2F4VQ 2UU9Q 3K0XA 1EQRA 5IP9G 3GTGH 1K3RA 4IO9A 1PH1A 2DUDA 1A63A 2H5XA 1NTGA 4BBRH 4PZ7A 2HHHQ 2OTLA 4AQYL 4DUYQ 1EOVA 3AFPA 4DR1Q 1HJPA 3PCOB 5IYBG 1YEZA 1OXUA 2NVYH 2IT1A 4DR6Q 3W1BA 4A3IG 1E3PA 2K5NA 1JJCB 1U5KA 5GAHC 3PO3G 4RMFA 1HNWL 3AFQA 4YCUA 4A93G 2QA4A 2VNUD 2UXCQ 2LXKA 1BBWA 1WCMG 3PUYA 4GKKL 1L1OB 1QUQB 1VQDA 2KENA 2B63G 3L7ZC 4UPAA 3ER0A 1Q86C 1PH9A 4JV5L 3NBHB 4DR5L 3JAMc 3A74A 3HOXG 1KRSA 1CKMA 3DLLA 1YI2A 1XMOQ 1YHQA 4JI7L 4MNOA 2UUBL 1M1KC 4IFDJ 4DR7Q 1MIUA 4TQUS 4X64Q 1WYDA 3GTLH 4OXPA 4A75A 4L5TA 4A3GH 1Y14B 2Q2UA 4C3IH 5GQOA 3HOWG 1IBML 3HKSA 3STBD 4DV0Q 4DV2L 3CC4A 3M85A 3EBEA 2JA7H 2VUMG 2NZHA 2E2HH 2CQOA 2R7ZH 4XTCS 1N32Q 2YTXA 1E1OA 3OTOL 1RIPA 2CWPA 1VQ7A 3GTPH 1EIYB 1FJGQ 4B3MQ 1AE3A 1KAWA 4IFDI 1Y1VG 2WB1E 1N9WA 4P72A 4DUZL 4GNXC 3RN2A 3HOUH 5LMUL 3I4NG 1YITA 1HR0Q 4GKJQ 3ULJA 4WJ3M 4P71A 4HIOA 1PH6A 5GAEC 1PV4A 1CKNB 4ME3A 4BXXG 1G291 2VQEQ 3PO2H 1P16A 1GO3E 5M5WH 5FLMG 1PH3A 2F4VL 1OXTA 3BZKA 2UU9L 4GN4B 1XPRA 1KD1C 4C3JH 1EIFA 3KF8B 4JBWA 3UDXA 4UP8A 4R4TA 3CF5A 1SLJA 1WJJA 3MXNB 4JOIA 3CCVA 1SN8A 2R7FA 4YHHQ 1MJEA 2HHHL 4L5RC 4H02A 3RZOH 2I5HA 2ZM6Q 3CCEA 1HH2P 4AH6A 4DUYL 1VS0A 1N36Q 4B3SQ 1R9TH 2KBNA 1V9PA 3SGIA 4DR1L 1JJ2A 3HOYH 3TRZA 3E9HA 1K0RA 1TWAH 2MO0A 4DR6L 1HNXQ 2R93G 1J5EQ 2ALYB 2ASBA 2CWAA 4X66L 4JI6L 3FP9A 2JA5H
chains in the Genus database with same CATH superfamily
5GADC 1U0LA 2XWJB 1EUJA 3KLWA 1GD7A 1KDAA 2K6AA 4DR7L 4KD4A 4K5WA 3OMGA 5FK9C 4GN5A 2ZTCA 4RGOS 5C4JB 5CBAE 2RCNA 2FMMA 1A6XA 4BY7G 1E22A 3E0EA 5C4JH 4A3CG 1EZ8A 1UEAB 4UP7A 4KI0A 4A76A 4TRDA 1II3A 1FJGL 1X3EA 1NSNS 1HPCA 1WVLA 2I5LX 4GKJL 2F3IA 3C46A 1O7ZA 1I50H 3R93A 3A54A 4RFBA 3GP7A 4DK3C 4JI8Q 1F9SA 1SYDA 5JEAH 1SYEA 2VQEL 1JWUD 4DA2A 2K33A 5M3MB 1JE4A 2Z9HA 5IP7G 1HQRD 3G71A 5EJWA 4P73A 2N78A 3PUVA 4I65A 4B3TQ 4JI3Q 2BA0A 3L3OC 2OF1A 5A35A 4IUTA 3FKIB 4YHHL 5D65A 2ZM6L 3FKIH 1QVCA 1R4QB 3K80C 4C1NK 2G9DA 4Y7NB 3A56A 1D5ZC 3GDEA 3CCRA 4Y7NH 4OEMB 1ENFA 3NWTA 2ZTEA 5M9OA 2QEJC 3CCSA 1NAPA 2WAQB 2N49A 1STNA 2K05A 4K0KQ 1TR5A 3TS0A 4XXEA 2ICIA 1NUCA 4DV4L 1PRTB 2N88A 3KJOA 1AW7A 3M9BA 4QY7A 3LWUA 1X3QA 2E8GA 2CVRA 4WJWA 5IYBH 1ENCA 3GTKB 3A5ZB 4A3IH 2AQ1B 1KTKA 3GTKH 1WCMB 1G6ZA 2R6GA 1QNKA 3GD7A 2E2HB 1WCMH 2F0JA 1SFOB 5EGTA 4RH6A 1S72A 4DR4L 4DK0A 1SFOH 4DGZA 1STAA 4JCVE 4JW0A 3VDYA 2OEOA 2PNHA 4V190 4IFDG 2CW0D 4CKBA 5IYCG 2AWOA 1T5EA 4KKUA 4AYBG 2F0QA 4C3JB 3NEMA 4JI5Q 3E3XA 4ILWA 3H3VH 1MBYA 1Y1VH 1UAPA 1EIGA 2VY3A 1LTSD 1JJGA 3KBXA 3HS0C 3TN2A 1C7YA 4BWGB 1N34L 3L0OA 4B9WA 4BXXH 1ET6A 1L0YB 1X3GA 2O2LD 5CR3A 1CA6A 5IIFA 1YBYA 4K14A 2ZJRA 3K58A 1GOZA 2WP8J 5IGGA 2NVTH 2OQKA 4GOPB 1XNQQ 4DKAC 2XVSA 1A62A 4MHEA 4LUVA 3HG9A 4MN3A 3ERQA 2L5TA 1PRTC 1BO0A 4LFBQ 3CMAA 4A3MB 1BQQT 1XPOA 1VQ6A 4GN3B 5CV5A 2DN8A 2Y0SE 4DV6Q 2E5LQ 3I72A 3I70A 4A3DG 4OGQC 4Z9CB 1H9SA 1HR0W 1CKNA 5I2XA 5C0XG 3Q6SA 4O1NA 1VQLA 4BY7H 4A3CH 2K5HA 2ZTDA 4LJZC 4X65Q 4FDBA 1PLFA 4QGUA 3D0FA 1F9PA 5KNCA 1STYA 2R92G 2JE6I 1C9OA 5ISRA 2IJ0A 4HR7B 1P8LA 5C3XA 1CUKA 4C56C 4JBMA 3SK4A 4IUVA 1JMCA 1SNQA 3FHWA 2VQFQ 2PNRC 4L5QA 1KC8C 2IHFA 3OHXC 2OCEA 1C0AA 2K52A 3RLOA 4KKTA 1J5EL 3C3LA 2VXWA 4DR3L 1TWGB 3DWPA 1ML0D 4LFCL 5IP7H 5C3WA 3GQBA 4DV1L 4HCSA 2PZWA 2EJGC 2I0QA 1FL0A 1L0XB 5JJIA 2YTVA 2HIXA 5IGCA 1ICFB 4JVZA 2F0IA 1AN8A 4F8MA 3A8JE 1SE8A 2KUMA 2J4XA 2K14A 2SDFA 2Z4IA 2XRQD 3QB3A 4GOPC 4OONA 1CZWA 1A3VA 1HUNA 4C3IG 3C1EA 4DK6C 1ASZA 3D4RA 3EVQA 1XPUA 2Q2TA 3HOXB 1EY4A 1SEBD 3EJIA 3VYTA 1KLGD 2UUCQ 3M3YB 5CV7A 1ZEQX 4LF5Q 2F3VA 4LF8L 2UUAQ 1B7YB 3HOUG 1EU3A 1U4MA 1K8AC 2K50A 4QUCA 3KFUA 3MC0B 2Z4HA 2LMCB 4NB3A 4ODGA 1YJNA 2HCCA 2BDNA 5G3LF 3D4DA 3CCJA 1K8GA 1QVGA 1A3TA 4KY5A 5FO9B 2KEDA 2A6HD 4QCLA 4HMJA 4JI1L 2L1BA 2B3GA 1HZCA 4NXMQ 3I90A 1TS4A 3S2HB 3DWAA 4RGTA 1Q8KA 4IFDH 2NWGA 4GS3A 4NXNL 2UXDQ 3HOYG 3K5OA 1E24A 5IYCH 4POFA 2EIFA 3I4MG 3VR4A 3GTJH 1UUPA 2E76C 2FHTA 3W2DA 2SEBD 4FXGC 3WOEA 4LF7L 2XTIA 1PH4A 1DOMA 2QCPX 3NE5B 4A3EG 2R61A 3OIPA 4QJFA 5C6AA 3HKZG 1DM0B 3GV6A 3NP8A 3PSIA 4G7ZC 4LMQD 3IFDA 1V1QA 2B8FA 4AQYQ 1MJCA 2YYZA 2Z6KC 1X9NA 3S1QB 1HA6A 3V96A 2JA9A 2F0GA 3S1QH 1SRUA 3TEHB 4DAYA 1HNWQ 3TZUA 1PTOD 4R4CA 1D6EC 5EKLA 5IODA 5JAVA 5HGTA 2JSOA 1BXTA 3J80i 4DR5Q 1TIID 1S5BD 5IWAL 3S24A 4C2MB 2CCZA 4GNXB 2L4NA 1JE5A 2F0UA 2Z6BA 3BJUA 5ELEA 5BR8L 4EQPA 4A3DB 3BVGA 4KTAA 3KOJA 4A3DH 1BUVT 1IBMQ 1RF2D 1Y1WB 1DYQA 4ZYSA 5FO8B 1LTBD 2F03A 4ZUIA 5C0XH 3MWYW 3ICEA 4EQ5A 2CHBD 2LY7A 2PMZB 4YWLA 2Q8IB 2R92B 4V0BA 1EWCA 2D62A 1RCVD 4Q0FA 3U9OA 2R92H 5BN5A 3I73A 1DCZA 1EY9A 4ZAIA 4R8NA 1HZ9A 3EA6A 2OXPA 1JOOA 1VQBA 1D1KA 3CQZB 4FF3A 2KHSA 1ICWA 1YHBA 3CQZH 3ND8A 3TMEA 2WFWA 5IP9G 3GTGH 2CH4W 2H5XA 2HHHQ 1EOVA 4DR1Q 2XN9C 4HEDA 2JA6B 1YEZA 3FPPA 4FXKC 4OHJA 2IT1A 3K59A 4DR6Q 1JJCB 2K5NA 1ZYRD 5KNBA 2VNUD 4YCUA 4FYDA 1SXTA 1T5XD 2UXCQ 2KCNA 4H13C 1L1OB 1RJTA 1QWYA 5HURA 2KQ3A 2IX3A 2B63G 3ER0A 3S2DB 3FVQA 4CDEC 1VF7A 3S2DH 1YI2A 1M1KC 1LTGD 1MIUA 4TQUS 2F0FA 4X64Q 3H91A 1PRTF 2I46A 4C3IB 3OSOA 2K5DA 3J80L 2Q2UA 4C3IH 3HOWG 1H9RA 1HHVA 3DWQA 4DV0Q 4DV2L 2A5HA 2NZHA 3VR6A 4XTCS 2JN4A 1RIPA 2DJFC 1EIYB 1MI2A 1AE3A 1IW7D 1G8ZD 1HUMA 1PTOB 1N9WA 4P72A 4GNXC 3RN2A 3HOUH 1PTOH 1B3AA 3A55A 1O7YA 4P71A 2F0DA 3R2TA 5D14A 2B2TA 1PV4A 2K5WA 3NWSA 1CK1A 3A7LA 2F4VL 2A6ED 4IN3A 5C4HA 1KD1C 5JPNC 1NR4A 1EY8A 1EIFA 4PQXA 2EYMA 1SLJA 1WJJA 3RD4A 4DF7A 4JOIA 1SN8A 1MJEA 3HOYB 4DUYL 3HRZC 2NTTA 2MPMA 2KBNA 3HOYH 2EYPA 4ZK9B 2ASBA 2R93G 4HCEA 3FP9A 1XNRQ 3T51B 2XWBB 2X6GA 4HMIA 3TS2A 1GKHA 2EY2A 3U50C 4A3EB 4P74A 4A3EH 5JVH3 3TZDA 3HKZB 1XMOL 4A3BG 2A19A 2JK8A 1K73C 4KHPQ 3AQQA 2MO1A 1EFWA 1ZXTA 3BZCA 1V43A 3V05A 4PNYA 5IE8A 3WOFA 2QDBA 3D8GA 3AU7A 2ZXOA 1CQFA 2F52A 1SR3A 1N32L 2UXBL 2EXZA 4B3ML 5IGFA 1QOHA 4YY3Q 5JJKA 3IL8A 3FMCA 4PMBA 1HR0L 2G9HD 3U4ZA 2SNMA 1RL2A 4DR2Q 1TY2A 1GXDC 3U4VA 1K9MC 3OYYA 2NN6I 4PMCA 1N33Q 3J81j 3VYRA 1NJIC 3H0GB 1I6HB 3MXNA 2PMZE 1I6HH 4PZ6A 2F0NA 4B3RL 4B3SL 1BCPC 4U673 5CORA 3TP6A 1EQTA 3S16B 1X3FA 5FLXL 3S16H 3SK8A 3HZXA 2K01A 4OWXB 4YCVA 1STBA 5LMNW 1PYWD 2DNEA 4IJLA 1JT8A 1LT4D 5GROA 3T1YQ 1DONA 3MFYA 3NSWA 3J7YW 1VQPA 2ZJPA 5IP9H 5CGKA 3OMCA 1D5XC 4R1JA 2K04A 5M5XH 3QIAA 1XMQQ 4EGVA 3GO5A 3SK5A 4GNXA 3E9IA 1OXSC 1TU2B 3AYHB 3CRKC 3PIP3 4A3FG 1X32A 1KQSA 2AMCB 1I5FA 2EE1A 3PF5A 1HXYD 2B63B 2R7ZB 2WB1G 4O42A 4JBKA 1LV9A 2B63H 4A3KG 1RTNA 3K0YA 4C3HG 3GTOB 3M7GA 1BBXC 3T13A 3MEHA 3GTOH 2LSSA 5DEHA 5C3EB 1N8RC 4JC0A 1ZYRC 5C3EH 2XGTA 1H9SB 1JR0D 4B3TL 1IKLA 4JI3L 1J9OA 2NZOA 4TVAB 1YNJD 2BE5D 4NKLA 1VQ4A 3HOWH 1WTHA 4LF9L 3RUZA 3MEFA 1S5DD 3Q8DA 2NBFA 4XQNA 2JA8G 3BZDB 1YHAA 3RZOB 5FKAC 5EBCA 3MHBA 1EY0A 1TWAB 3PQIA 4KK7A 1QB5D 2IHEA 1I4RA 3UE0A 2RKSA 3J80E 4XQJA 1L1OA 5KYIA 1XJVA 2QW7A 1ILQA 5E3FA 2R3ZA 4NPSA 4IPCA 2EZVA 2DGYA 2F0KA 1VCIA 3LX0A 2RBMA 3MZ5A 2Y0SB 2R93H 2Z0SA 4HJ5A 3HKZE 4PMWA 4JI6L 1Q1EA 1K83H 2GVAA 1VMPA 1SMYD 3P20A 1PA6A 3S14B 1PFBA 4JI4Q 2RSNA 4A3BB 3S14H 1J8IA 4A3BH 4CDCC 5LHY1 1I4PA 2EOTA 3VYSA 2AQ2B 1I50B 5AJ3Q 1E2VA 3RLNA 4YWKA 1SYFA 2L15A 1F2ZA 4Q5VA 5J39A 2J0TD 4CJ2C 1VQMA 4LFAQ 3MVVA 3QWNA 3RR5A 1GM5A 4IURA 4DV7Q 4JI5L 4X3UA 3CU7A 1HZAA 4APVA 1AFPA 1Q81C 3ZYYX 1JOQA 4DV3Q 1E2ZA 1X65A 4OIJA 1JOKA 5EQ0A 1Y69U 1I94Q 5KEEA 2KVMA 3NUCA 4OWTB 5C4ZA 1KDBA 1CSPA 4DN4M 3D31A 5I4DA 4BBRG 3F2DA 4K5XA 5CV4A 5IT9L 2NVXH 2RDFA 3H94A 3IRBA 3R3OA 2VS1A 3J81i 2F0TA 1XNQL 3TSSA 1QG7A 4UDUC 2VW9A 1FVIA 2GVBA 1O80A 1RHPA 4LFBL 3F2BA 3D3RA 5E7NA 4A3IB 1YVCA 2CFMA 3F2UA 3LWEA 4RCOA 5AFWA 4DV6L 4JI6Q 2E5LL 4OX9Q 2D5DA 2HIVA 3SEBA 2DJGC 3NTIA 4F87A 1OTCA 1VQ5A 2EVBA 4DAYB 3SHLA 2WACA 3BYTB 5C5LA 4X65L 5FLXE 1VMCA 4A3FB 3J7AF 4JBJA 2QEXA 4JG2A 4KY7A 4RWSC 4YWMA 4A3FH 1STGA 2WB1B 3PO2G 2EYJA 3BU2A 2VUMB 1BVSA 4A3KB 3H3VI 2VQFL 2VUMH 4C3HB 3TDQA 4A3KH 3EROA 1STEA 1Y1VB 2C35B 4RAUC 5E4WC 4C3HH 3M4OH 2HQLA 1EFID 4JYAQ 3K5NA 4LWCA 2E2IH 2D9UA 4GLAC 1GHJA 3STBC 3BVZA 4GLVB 2K1BA 3FEWX 1Q8IA 4WFN3 1B70B 2JA5G 3KJPA 2JYOA 4DAMA 2GA4B 2NVTB 2JA8H 2MJ8A 1EIHA 1SROA 1M90C 1AH9A 1EEFD 4ZRZA 3J81L 1BCPF 2BH2A 1ENAA 3PIOA 1BOSA 4DU9A 4CJ1B 1RTOA 2BOSA 1A15A 1UWVA 5EBDA 1PH5A 2MP1A 4BY1G 2KCCA 3Q22A 1EEID 1IZ6A 1HFGA 1I6VC 1MGSA 3NELA 3KUPA 4IUNA 2UUCL 4LAAA 1KXLA 3CP0A 4R4OA 4LF5L 2UUAL 4GKKQ 1QNUA 2KCMA 2LFNA 2LS01 1W6JA 4FNFA 2O4XA 2PCFB 3K6OA 2JEAI 4BY7B 2EYOA 2LXJA 4A4IA 4JI7Q 1EWHA 2M2LA 1S5CD 1Z7TA 5I9PA 5IGEA 2UUBQ 1KHIA 4I7AA 4QQBX 3DEOA 1WTPA 1K28A 3HOZG 5DLQE 5JJZA 2Q8RE 4NXML 1UE1A 1CHQD 3B6YA 5EPKA 4HJ8A 3G6EA 3EQLC 1SMYC 1FNUA 3H3VC 1CQVA 4DUZQ 1RD9D 3OW2A 3KDFA 4P75A 1VQ9A 2GN5A 1KIXA 1L2FA 1B4OA 2FFKB 1TVXA 4KKSA 4LNQA 1TWCH 1EY6A 2M9VA 2MGSA 1K3RA 4IO9A 2DUDA 1A63A 4BBRH 4J8QA 4AQYL 2NVYB 4KHVA 2NVYH 2PZTA 1U5KA 5EPLA 5GAHC 1HNWL 3TBIB 3AFQA 4A93G 2QA4A 5COYA 4HSPA 2F0HA 3G7LA 3V2TA 3L7ZC 4UPAA 3R2IA 2F0EA 4DR5L 3PMFA 2C9OA 2BCOA 3MTSA 1EY5A 3NK9A 2IW3A 1WYDA 3NHHA 5IT9E 3T4AC 1CT1D 5GQOA 4L8JA 3URYA 1IBML 3QO2A 1SJHD 2CQOA 2YTXA 1U9RA 4IFDI 1SYBA 2WB1E 1EQVA 5LMUL 1YITA 3E6ZX 3GTJB 1PH6A 2WINB 1G91A 3D6WA 4ME3A 4AYBB 1PMRA 1Z6HA 2A69D 3PO2H 2EYLA 1GO3E 5M5WH 1JWSD 1XPRA 3OOCA 3J7AV 3KLSA 5CMDA 2CW0C 3MXNB 1SNCA 3CCVA 2B2TC 2HHHL 3L9AX 4J1MA 1N36Q 3DM1A 3I91A 4EVOA 1A2TA 4DR1L 3TRZA 2F3WA 1JJ2A 1M8AA 3KLSX 1OO9B 4DR6L 1HNXQ 2O5JC 1J5EQ 2ALYB 2JA5B 2CWAA 4X66L 5LMNQ 2JA5H 1IYUA 2OTJA 1YNND 4F7XA 2UXCL 1PZKD 3AB9A 4JOIC 2EDGA 1QUQA 1HNZQ 4OO1G 3J80c 5I9OA 1HZBA 4XYOA 3PGZA 1PH2A 4JI0Q 2FINB 3PV0A 4HJ7A 4X64L 3IFTA 2RSOA 3F8TA 1TQOA 3E0JA 5C4XG 4BY1B 1BR9A 4BY1H 1JC7A 4DV0L 5NUCA 3QG1A 1F9QA 5HY6A 3RMHA 2JP1A 1F9RA 5J3BA 5C0XI 2BH8A 2XSCA 3NENA 1V1OA 1Q7YC 1I4QA 3D6CA 1FD7D 4IPGA 3J81E 5I6WA 1PZID 4H0LC 1EZ6A 3ERSX 1WI5A 3NTKA 3CXCA 3CMEA 3HOZB 2EYHA 4K2LA 4N8X1 3X3NA 1S5FD 2HD3A 1S40A 1I3QH 3HOZH 4HIMA 1LM0A 4A3JG 4FF1A 2RA4A 1WD1A 2RDGA 3TP5A 2ZJQA 5LL6X 3GTGB 3I55A 4H7BA 5FOBB 3OWFA 4X6AH 1YJWA 4XT1B 1XNRL 3DMUA 1X56A 4X62L 1IXRA 5F2DA 4TKOB 1CKOA 1UE7A 4UAIA 1B3QA 3CPFA 3CCMA 2A68D 4KHPL 1JICA 1X3PA 2F0WA 4BS9A 4IUQA 1WTOA 1DXMA 2QF7A 1QILA 4IALA 4ALPA 4QIWB 3ULLA 3K5MA 2JQOA 3I2ZA 4ZKCB 2I5MX 2KHJA 2Z1CA 4RGNA 1PFMA 4MZ9A 4CDDC 3UE1A 4A93H 1NR2A 3SR1A 3HOVG 3T1HQ 4K5VA 5C44G 3KLRA 1DD2A 2Q8TA 4OIKA 4DR2L 3HOUB 3GTMB 2PO4A 3CC7A 3NBIA 3NQIA 4N9TA 2WV6D 1A8VA 3GTMH 3T53B 3RZDB 1JB7A 4O0AA 4XIGS 3RZDH 5FLXc 2G5DA 4O2DA 4XYQA 3K5LA 4HN7A 5IWAQ 2HQEA 2PZUA 1HQMC 4BBSG 2A1AA 5D3DA 2SOBA 4AYBE 1VQKA 3BDLA 3S1RH 3FDTA 3A8IE 1MKHA 3I4MB 1Q46A 5CC4A 1QE6A 4JI2Q 3I4MH 3T1YL 3QR8A 2RHSB 3MAQA 3UDGA 4B08A 2E75C 2A6HC 1D2BA 1D5MC 4MTKA 1WTRA 1IBLQ 1EY7A 1GUTA 5T1IA 5G3LD 4DXFA 3A8KE 4IPDA 4HAEA 4POGA 4X3SA 2AUJD 3GTQB 1L1OC 5JEAJ 3S17B 3GTQH 3M4PA 1EYGA 4HIDA 3OWEB 3ZJYC 3H6MA 3S17H 2E2JB 3TP8A 2PYKA 2E2JH 1SAPA 3J7A5 4OO1H 2F0MA 5JPMC 3KK7A 4K8JA 1ONLA 1LT6D 4ULLA 5IOCA 2IWHA 1LABA 1BBUA 4DK1A 1WTXA 5C4XB 3A5UA 2FMCA 1YJ9A 1J6QA 5C4XH 2YV5A 4FP5D 3NQTA 3DEPA 2YU9B 3RLFA 3OIQA 1YZ6A 2OQ0A 2RDHA 4PV1C 1SNPA 2EPBA 1PTOC 2YU9H 5M3MG 1IL2A 1T9HA 3LNNA 2A74C 3A0JA 2RVLA 2VL6A 3CAMA 2K7VA 1Q3LA 4DNRB 3AMUA 4KJNA 1TKWB 1EU4A 4B9XA 1Q82C 1HRJA 1G51A 4HIKA 2F0SA 3WWVA 5ELCA 2WAQG 1NBWA 3G4SA 1C4QA 4FXDA 4HJ9A 1GHKA 5K5PA 3ULPA 1IBKQ 3MXUA 2B39A 5M5XB 4ZCKA 2XIWA 2XRSD 3S9WA 5ELFA 1ESFA 3G6JB 4BA1I 1W2BA 4JI4L 1Z47A 2QKIC 1LTAD 1NNXA 1F77A 2ZT9C 3CPWA 1WTQA 4QIWE 2F0VA 3I4LA 5AJ3L 4LF6Q 5FO7B 1Y8PB 4JI8L 1CSQA 1I4HA 3A7AB 5M5YH 4DV5Q 2FJ2A 1GVPA 2ICEC 1B2TA 2F0PA 4LFAL 1HTPA 2BDOA 4OL7A 4DV7L 1GUWA 2V4DA 1EYAA 1CM9A 3HOWB 1KLUD 5IT9c 1AE2A 3HOVH 5C44B 3JAMi 2B2VA 2M00A 4DV3L 5C44H 2PW5A 1I94L 4C3JG 1TS2A 4LF4Q 1PYBA 1X6OA 3VYUA 2UXBQ 1O78A 4IOAA 3NXWA 5C5MA 1EWIA 3K7AH 2AKWB 4KHZA 3KF6B 3BVMA 5CYUA 5TSSA 1LYLA 3Q0AA 4K0KL 3BYYB 2OT2A 3KDFB 4BBSB 1TXYA 1CI3M 1IW7C 2ES2A 4BBSH 3CHBD 1PRTD 1H95A 2NUCA 1GJXA 4HJAA 1JCKB 4JK1C 3OPOA 1X55A 4RKBA 3I7FA 5KRUA 2R93B 1B1ZA 1R4PB 3BDOA 2A6EC 1Z9FA 4MIUA 1K83B 4M8AA 5ELNA 1DOKA 4XT3B 1KAAA 2H4OA 4OX9L 2NVQB 1EOTA 3CC2A 4QMGA 2NVQH 1NE3A 1ZKOA 4A3MG 2H1EA 2F4IA 1HFNA 2F1MA 4QB4A 3F2CA 2PQAB 3W1GA 2EXDA 1YIJA 1S5ED 5M3FG 3L2PA 2F0LA 5KIXA 2K75A 4QUFA 1H9MA 4KN4C 1F2YA 1FR3A 3I56A 4JV5Q 5DM73 5I6YA 1UE5A 1E0BA 3WDNA 1TWHB 4M1UB 4N9PA 1B9NA 4RHRA 1TWHH 2AWNA 2Z8LA 4ME5A 1GUOA 3I4NG 2FXQA 1LLRD 1LUZA 2YTYA 5IYDG 2MFIA 3DM3A 5DM63 4JYAL 1E1TA 2ENBA 1PHJA 3U9SA 3JAML 3IKJA 2B2UA 1KRTA 3OTOQ 2D2CC 1B53A 5ELBA 3J81c 3IAYA 2D0OA 3ND9A 4IZ8A 1EQQA 1V1PB 2NVXB 5CV9A 1MSHA 1RKNA 5M3MH 1PH8A 5K36G 4FVMA 4I7ZC 2Q2HA 1K3BC 1D1IA 5LL6S 1HCZA 1MHWC 3N6RA 4J15A 1XTCD 4KY6A 1IYJB 1A0IA 3BS1A 4LF9Q 5CBEE 2UU9Q 2B2YA 3UI2A 4ZUJA 3SK6A 1DOLA 1NTGA 4NW2A 4ZLTF 4XDXA 1HJPA 2I07B 1JORA 4KMUC 3T16A 3QOJA 4DFAA 3PO3G 1H9JA 4IUUA 1RODA 4IQZA 4GKKL 1QUQB 1Q86C 2DY8A 1PH9A 4YIJA 3NBHB 1CHPD 3DLLA 3HOXG 1KRSA 1CKMA 1YHQA 4JI7L 4MNOA 1IYVA 5CV8A 2UUBL 4IFDJ 4DR7Q 4NDXA 1TS5A 4OXPA 1A2UA 3VR2A 1LTID 1Y14B 1SYGA 3EBEA 3GTPB 4K8IA 3M4OB 2E2HH 3VA5A 3C1FA 2B2WA 1VQ7A 1E1OA 3GTPH 2CWPA 1FJGQ 1F2MA 1KAWA 1LT3D 4DUZL 2E2IB 1EL0A 1K0SA 4GKJQ 3ULJA 3QJYA 4WJ3M 3K57A 5KYLA 1G291 1KNEA 2VQEQ 1P16A 3VR5A 1W6KA 5FLMG 1KDCA 1PTOF 2JA8B 4GN4B 4L63B 4C3JH 3KF8B 4JBWA 3UDXA 4UP8A 4R4TA 3CF5A 1TY0A 1ESRA 2R7FA 3DXJC 3P7JA 1EYCA 4H02A 4YHHQ 4L5RC 2K5QA 2ZM6Q 1HH2P 4AH6A 1VS0A 3QOLA 1YNJC 2BE5C 3SGIA 2C5CA 3E9HA 2MO0A 2KOLA 1STHA 2TSSA 2QGQA 4PZ8A 4N8FA 2ATWA 4DV4Q 2EJFC 4HTHA 3T56B 2RCFA 5C0XJ 1VF5C 4WJ4A 1QJOA 2JXMB 4EX5A 4QF4A 1WOCA 2V1CC 2QILA 4A3MH 2IY5B 1V8QA 4WRDA 5M3FB 2K5VA 2O5IC 4K2KA 2N3SA 2B8GA 5M3FH 1FNWA 2VB3X 1OXVA 4UP9A 1U4LA 4KLKA 2UXDL 3KF6A 2KHIA 5J22A 2X69A 4DR4Q 1Y1WG 2AQ3B 4LUZA 5ELDA 1WFQA 3AEVA 3ONAB 1LTLA 3TQYA 3I4NB 3EFXD 5E4XA 3I4NH 2MHVA 2K28A 4CDFC 5IYDH 1RDPD 1TWCB 1PVOA 2WKCA 4F88A 2Q2IA 1CTMA 4HSVA 1SDFA 1N36L 3C2PA 5BN3A 2K32A 2N55A 1SMXA 4XQQA 2HUGA 4BBRB 1HNXL 1VQHA 1UNSA 5LMNL 1M4VA 2WIIB 3P1HA 3I3CA 1TWGH 5K36H 1N34Q 3HFZB 3S15B 1HNZL 2A8VA 1PZJD 4R4QA 2HDMA 2SNSA 3S15H 2MNAA 2JA6G 2PQAA 4CJ0B 4YCWA 5GAGC 1LT5D 4JI0L 2WAQE 1FGUA 3JAME 4A3LG 5L37A 5JVG3 5JJLA 4EQNA 2HCIA 2OWOA 2AUKA 5J1ZA 1BKBA 2JEBI 3G48A 1IHZA 5ELOA 1X54A 3PO3B 3K8AA 1VDZA 3D4WA 3KYHC 3PO3H 4NMZA 4MTNA 1VQAA 2ZXPA 1VQFA 5EAYA 1E2WA 1TT2A 2KJXA 3HOXH 2DNCA 3DHQA 3EIVA 3CRLC 1V1PA 3M3YH 2EJMA 3M4QA 3H09A 1ET9A 3FPUB 1G6PA 3PO2B 5EKIA 1WTVA 5M5WB 1U4RA 3LGJA 2HT1A 4CGYB 1SE3A 1Y8NB 5T1GA 1VQNA 2IL8A 1DJRD 1YNXA 2MUYA 4X3KA 3VA7A 4IJHA 4P2CB 3RN5A 3NTHA 1SNOA 1Y8OB 3CCLA 2VZAA 4FF4A 3S2HH 4OELB 4J6HA 5FJ8G 4L5SA 5KNDA 1VQGA 4DR3Q 1Q1BA 4LFCQ 1MD2D 4QL5A 5FLMH 3PUZA 1SE4A 1QZGA 1CZGA 1TS3A 2XNAC 2N8NA 5DAUA 3PUXA 4DV1Q 3HEJA 4AIMA 3K7UC 3NBHA 4OWWB 4KJOA 3Q23A 3PIPA 1FYCA 1B50A 2BA1A 4G57A 4LUOA 3E5SA 2KA7A 5DNFA 4Y52H 2CH4A 2RF4A 1SE2A 1LO5D 3J7ZC 2TMPA 4H44C 4DPGA 3T1HL 3CW2C 4ZKBB 4CKEA 3O13A 1B44D 2F0OA 1JB3A 2L9HA 3TP7A 4GLXA 4C1NI 4G7OC 1K8MA 4GZYC 1WTWA 2PPBC 4U68A 1BCPD 1ASYA 4LF8Q 1C48A 2EY1A 3P75A 1H9KA 4RGMA 1I3QB 1G2SA 2NZ1D 1NMGA 1I4XA 3KF8A 2EQSA 1VQCA 1JWMD 4C2MH 4R8IA 1BNZA 2NN6G 1SJED 2PI2E 4LK1C 3H0GG 4UHVA 4A3GG 4R9WA 3PF4A 1KL9A 1Y1WH 1XYIA 4JI2L 1KNAA 1PYSB 1F2LA 2K4KA 1TWFB 4JI1Q 2QDLA 5LMUQ 1QCBD 1TWFH 1VQEA 1XTDA 4NXNQ 1OXXK 1Q90A 1B8AA 1IBLL 1XXGA 3TREA 1Q12A 2CKZB 4LF7Q 1XWEA 4DNIA 4GOPA 1PFNA 5EKKA 1O7IA 3UDFA 4PG3A 1JQYD 4K6LA 2CQAA 3EN2A 1VQ8A 5IY0A 1G2TA 4UY8C 2IX1A 2L0CA 4A93B 4IUPA 1BF4A 2JA6H 2PW7A 3PIO3 4X66Q 1AZQA 4YY3L 4RG1A 1GUNA 3UDIA 3CD6A 5D3IB 4BA2I 3DUZA 3MA2B 2JA7G 1PXUA 2R7ZG 1HA5A 2PQEA 5HGQA 4A3LH 2PI2A 4X3TA 2KEEA 1C8CA 3FRPB 2KCTA 5H1SE 5A2QL 1PH7A 1AEXA 5C3EG 1N33L 4DNTB 1WD0A 1CFMA 4TSSA 1PFSA 3HGBA 2B29A 4FF2A 4KN7C 1B9MA 3S1RB 2MQHA 4DXGA 5BR8Q 2LKVA 1MSGA 3S1MB 1S4ZA 2ID0A 1VQOA 1SSOA 4LW1A 3W5OA 4IOCA 4IPHA 1D8LA 3S1MH 2RHQB 1QZHA 2B2VC 1LACA 3CCQA 5JOBA 1S3OA 1BCPB 3X3MA 2EY5A 4NP5A 1PDQA 5E1FA 1IBKL 2EY6A 4EQOA 3VR3A 3S1NB 1XX8A 3S1NH 3Q24A 2Z6KA 1FNVA 3SXHA 1XMQL 3HP3A 2A69C 1VQJA 5KGUA 5FJ8H 2VB2X 1DGSA 1EYDA 3MFGA 3BG3A 3R8BA 2Y0SG 4OO1I 2AHOB 4CBVA 1U4PA 4RCNA 4X62Q 4LF6L 1IL8A 4DV5L 1L0WA 1W3SA 3H15A 4ZQ3A 1YNNC 1SBBB 2X6LA 3SDZA 1NMFA 2D0PA 1UEBA 2IX0A 3CKIB 3N52A 5JEAG 1CA5A 3M7NA 4DAPA 2P5ZX 1UE6A 3M4YA 3U58A 4LF4L 2RQXA 2EYFA 4ID6A 3RNUA 2JJQA 1D7QA 4RHSA 3CCUA 3MXGA 1SYCA 4JPBW 4DV2Q 3FKIG 1E7ZA 3MXPA 2R7DA 3PUWA 5IGDA 1NCVA 1AZPA 2K03A 3JC66 1NY4A 1VQIA 4E6IA 3K81C 2KECA 3W3AA 1SNDA 4G7HC 4A3JB 1DZ1A 4A3JH 2B2UC 4S3SA 2NN6H 4R4IA 4A3GB 1GUSA 3H0GH 2WKDA 3F1ZA 2F4VQ 4A3GH 3I4OA 3OW7A 3K0XA 1EQRA 2NB0A 3I8ZA 1PH1A 3SVMA 3ITPA 4PZ7A 1LTTD 2OTLA 4DUYQ 4FO2A 1BDOA 3AFPA 4DAVA 3PCOB 5BN4A 5IYBG 1OXUA 2ZXRA 4L6TB 3W1BA 4A3IG 1E3PA 2B2YC 1GUGA 2L12A 4RMFA 1LTRD 1SNMA 2LXKA 1BBWA 1WCMG 3PUYA 5M5YB 1VQDA 2KENA 3NPPA 4K6DA 4JV5L 1HTLD 3JAMc 3A74A 1XMOQ 2J7ZA 4WORA 3GTLB 2A73B 4KV6A 2DY7A 2A68C 1I4GA 3GTLH 4A75A 3HOVB 4L5TA 1KABA 2NYZD 2E2DC 2JA7B 1K8OA 3HKSA 3STBD 4RA8A 3CC4A 3M85A 2JA7H 2VUMG 1AP0A 2R7ZH 2HDLA 2NTSA 1N32Q 3OTOL 5EPJA 4B3MQ 2E74C 1Y1VG 3K7AB 2L11A 1HR0Q 1IKMA 2IPKD 2L55A 3GV3A 4HIOA 5GAEC 1ILPA 1CKNB 4KD3A 4BXXG 2B2WC 5CV6A 1PH3A 1OXTA 1A3UA 4CKCA 3BZKA 2UU9L 5IGBA 5I2YA 4CHTB 3RZOH 4B3RQ 2I5HA 3CCEA 4B3SQ 1O7LA 1FGBD 1V9PA 1K0RA 1TWAH 4RKLA 5A2QE 3BDCA 1R9TB 4G4KA 4ABNA 3KBGA 1R9TH 3SE0A 1QVFA
chains in the Genus database with same CATH topology
2OTJA 3TS2A 1GKHA 3U50C 5GADC 2UXCL 4P74A 4JOIC 1U0LA 1QUQA 4A3EH 1HNZQ 2QGQA 4OO1G 3J80c 1EUJA 3KLWA 4PZ8A 1HZBA 1GD7A 1XMOL 4A3BG 2ATWA 2A19A 2JK8A 3PGZA 1PH2A 1K73C 4JI0Q 4KHPQ 3AQQA 2MO1A 4DV4Q 1EFWA 4DR7L 3BZCA 1V43A 3PV0A 5C0XJ 4X64L 4HJ7A 4GN5A 3F8TA 2ZTCA 4WJ4A 5IE8A 5C4XG 4EX5A 2RCNA 4BY7G 1E22A 3E0EA 5C4JH 4A3CG 4BY1H 1WOCA 4DV0L 2V1CC 4A3MH 2IY5B 2F52A 1SR3A 1N32L 4UP7A 5HY6A 4KI0A 2K5VA 4A76A 1FJGL 4B3ML 2UXBL 2N3SA 5J3BA 5M3FH 1X3EA 4YY3Q 2BH8A 5C0XI 5JJKA 1OXVA 3NENA 2I5LX 1HR0L 2F3IA 4GKJL 1Q7YC 4UP9A 4KLKA 2UXDL 3KF6A 1I50H 4IPGA 2KHIA 3U4ZA 4DR4Q 4DK3C 1Y1WG 1RL2A 4JI8Q 4LUZA 4DR2Q 2VQEL 1WFQA 3AEVA 1LTLA 3TQYA 3ERSX 3U4VA 3G71A 5IP7G 1WI5A 3OYYA 1K9MC 2NN6I 3I4NH 3CXCA 4P73A 2N78A 3CMEA 1N33Q 5IYDH 3PUVA 4B3TQ 4JI3Q 2BA0A 3J81j 1S40A 1I3QH 1NJIC 1QVFA 4HIMA 1LM0A 3HOZH 1PVOA 4A3JG 2PMZE 2Q2IA 1I6HH 4PZ6A 4YHHL 2ZJQA 4B3RL 2ZM6L 1N36L 3FKIH 4B3SL 1QVCA 3I55A 3K80C 1SMXA 3GDEA 3CCRA 4Y7NH 1HNXL 1VQHA 1YJWA 4X6AH 1X3FA 3S2DH 5LMNL 3S16H 2ZTEA 1XNRL 1X56A 4OWXB 4YCVA 5LMNW 3CCSA 1TWGH 4IJLA 2N49A 4X62L 1N34Q 1JT8A 1IXRA 3HFZB 1HNZL 2A8VA 4R4QA 3S15H 4K0KQ 2MNAA 1CKOA 1UE7A 2PQAA 2JA6G 4YCWA 5GROA 3CCMA 3CPFA 3T1YQ 3TS0A 5GAGC 1VQPA 4JI0L 4KHPL 2ZJPA 4DV4L 5IP9H 2WAQE 1FGUA 3KJOA 4A3LG 4R1JA 4ALPA 3M9BA 3ULLA 4QY7A 5M5XH 5JJLA 2JQOA 1XMQQ 2OWOA 3I2ZA 2E8GA 3GO5A 1BKBA 2I5MX 2JEBI 3G48A 2KHJA 5ELOA 5IYBH 1OXSC 1X54A 3AYHB 3E9IA 4GNXA 3A5ZB 3K8AA 4A3IH 4MZ9A 4A3FG 3KYHC 3PO3H 1KQSA 3GTKH 2AMCB 3UE1A 4MTNA 1I5FA 2R6GA 4A93H 3HOVG 3GD7A 3T1HQ 1VQAA 1WCMH 3PF5A 2WB1G 4JBKA 5C44G 2B63H 4A3KG 1S72A 1VQFA 5EAYA 4DR4L 1SFOH 4DR2L 3HOXH 3GTOH 3CC7A 3EIVA 2LSSA 4JCVE 3M3YH 1A8VA 3GTMH 3VDYA 1N8RC 3M4QA 1JB7A 4JC0A 5C3EH 2PNHA 2XGTA 4O0AA 4XIGS 4IFDG 3RZDH 5FLXc 1G6PA 5IYCG 4B3TL 4JI3L 2AWOA 2NZOA 4TVAB 3LGJA 4O2DA 4AYBG 1VQ4A 1XNRQ 2HT1A 3HOWH 4LF9L 1VQNA 5IWAQ 3NEMA 3MEFA 4BBSG 3Q8DA 1YNXA 4JI5Q 2A1AA 2JA8G 4AYBE 1VQKA 3H3VH 1YHAA 4IJHA 1Y1VH 3RN5A 3S1RH 2VY3A 1JJGA 3CCLA 1MKHA 1C7YA 2VZAA 1Q46A 1N34L 3S2HH 3L0OA 4JI2Q 3I4MH 5FJ8G 4L5SA 4BXXH 1VQGA 2IHEA 1X3GA 4DR3Q 3T1YL 1Q1BA 4LFCQ 5FLMH 4QL5A 3UE0A 3PUZA 2RHSB 3UDGA 1QZGA 1YBYA 1XJVA 1L1OA 2ZJRA 2N8NA 3PUXA 4DV1Q 2WP8J 1IBLQ 4AIMA 3K7UC 2NVTH 4OWWB 3PIPA 2OQKA 4NPSA 4GOPB 4IPDA 4DKAC 4IPCA 1XNQQ 2BA1A 2DGYA 4LUOA 1A62A 4Y52H 1VCIA 4POGA 4LUVA 2RF4A 3J7ZC 2R93H 1L1OC 2Z0SA 5JEAJ 4HJ5A 3HKZE 4PMWA 1Q1EA 1K83H 2GVAA 3M4PA 4DPGA 3CMAA 4HIDA 3ZJYC 3T1HL 1EYGA 3GTQH 3S17H 4LFBQ 3CW2C 1XPOA 4GN3B 2E2JH 1PA6A 1VQ6A 3J7A5 4JI4Q 3S14H 2Y0SE 4A3BH 4DV6Q 2E5LQ 1BBUA 4A3DG 5AJ3Q 3RLNA 4YWKA 4GLXA 1HR0W 1CKNA 2L15A 3A5UA 5C0XG 1YJ9A 1J6QA 5C4XH 1VQLA 2YV5A 1ASYA 4LF8Q 4BY7H 4A3CH 1VQMA 2K5HA 2ZTDA 4LFAQ 3RLFA 4X65Q 1YZ6A 2OQ0A 4FDBA 3D0FA 3RR5A 4QGUA 2R92G 1GM5A 2YU9H 2JE6I 4DV7Q 1C9OA 1NMGA 4JI5L 1T9HA 5M3MG 2EQSA 1IL2A 1VQCA 1HZAA 4APVA 1P8LA 3A0JA 4C2MH 2VL6A 3CAMA 1Q81C 2NN6G 2PI2E 1CUKA 4JBMA 4DV3Q 3H0GG 1JMCA 3FHWA 2VQFQ 4A3GG 1X65A 4L5QA 1I94Q 1KC8C 2IHFA 3PF4A 1KL9A 2OCEA 1Y1WH 1C0AA 2K52A 4OWTB 3RLOA 4JI2L 1Q82C 1CSPA 1PYSB 1J5EL 1G51A 2K4KA 3D31A 4JI1Q 4DR3L 4LFCL 4BBRG 3F2DA 5LMUQ 1TWFH 5IP7H 1VQEA 1XTDA 2NVXH 4NXNQ 4HIKA 1OXXK 1B8AA 3WWVA 4DV1L 1IBLL 2WAQG 3IRBA 2I0QA 1NBWA 3G4SA 1FL0A 2VS1A 3TREA 3J81i 1Q12A 2CKZB 4HJ9A 3ULPA 1IBKQ 2YTVA 4DNIA 4GOPA 4LF7Q 2HIXA 1XNQL 5JJIA 1O7IA 3UDFA 1SE8A 2VW9A 1FVIA 2GVBA 4PG3A 2K14A 4LFBL 3EN2A 3F2BA 1VQ8A 5IY0A 4BA1I 5E7NA 1YVCA 4UY8C 2IX1A 1W2BA 4JI4L 2CFMA 1Z47A 4GOPC 2JA6H 4OONA 3CPWA 4X66Q 4QIWE 4DV6L 4JI6Q 2E5LL 4OX9Q 4YY3L 4DK6C 4RG1A 3UDIA 2HIVA 5AJ3L 1ASZA 3CD6A 4BA2I 1XPUA 2Q2TA 2JA7G 4LF6Q 2R7ZG 1OTCA 4A3LH 5HGQA 2UUCQ 4JI8L 1CSQA 5M5YH 1VQ5A 4DAYB 4DV5Q 2PI2A 4LF5Q 4LF8L 1GVPA 2UUAQ 2KCTA 1B7YB 4LFAL 5H1SE 4X65L 3HOUG 1PH7A 5C3EG 4DV7L 1N33L 1K8AC 4JBJA 2QEXA 4JG2A 2K50A 4YWMA 4A3FH 3KFUA 5IT9c 1AE2A 3HOVH 4NB3A 3PO2G 1PFSA 3BU2A 3JAMi 2B29A 1YJNA 4DV3L 1BVSA 3H3VI 2VQFL 2VUMH 5C44H 3CCJA 1K8GA 4A3KH 1I94L 1QVGA 4C3HH 4LF4Q 2C35B 1PYBA 1X6OA 2MQHA 3M4OH 2HQLA 5BR8Q 2UXBQ 4JYAQ 2ID0A 1VQOA 4JI1L 4IOAA 4IOCA 4LW1A 2B3GA 1HZCA 4IPHA 1D8LA 1EWIA 3W5OA 4NXMQ 3S1MH 3K7AH 2RHQB 2AKWB 1Q8KA 4LWCA 4GS3A 4NXNL 2E2IH 2UXDQ 4KHZA 3KF6B 4GLAC 3HOYG 1E24A 5IYCH 4POFA 3STBC 1LYLA 1QZHA 4GLVB 2EIFA 3I4MG 4K0KL 3GTJH 3CCQA 1S3OA 4B3RQ 1B70B 3KDFB 1TXYA 3KJPA 2JA5G 1IBKL 4LF7L 2XTIA 1PH4A 2ES2A 4BBSH 4DAMA 1H95A 2JA8H 4HJAA 4A3EG 1SROA 1M90C 3S1NH 1AH9A 2Z6KA 4QJFA 1XMQL 1X55A 3HKZG 3I7FA 2BH2A 3PIOA 1VQJA 5LMNQ 3PSIA 5FJ8H 1Z9FA 1DGSA 5ELNA 1V1QA 2Y0SG 4AQYQ 4OO1I 2AHOB 1UWVA 4OX9L 1PH5A 4BY1G 3CC2A 4X62Q 1MJCA 1NE3A 2YYZA 2Z6KC 4A3MG 1X9NA 4LF6L 2NVQH 1IZ6A 2JA9A 3NELA 2UUCL 3S1QH 3F2CA 1SRUA 3TEHB 1HNWQ 2PQAB 1L0WA 2EXDA 3W1GA 1W3SA 4DV5L 3H15A 1YIJA 1KXLA 3CP0A 4R4CA 4R4OA 5M3FG 2UUAL 4LF5L 3L2PA 4GKKQ 2K75A 2KCMA 3I56A 1NMFA 2D0PA 1UEBA 2IX0A 2JEAI 4JV5Q 3J80i 4DR5Q 2LXJA 4A4IA 1UE5A 5JEAG 4JI7Q 2UUBQ 5IWAL 1KHIA 3M7NA 1TWHH 2AWNA 3S24A 1UE6A 4QQBX 3U58A 4GNXB 2FXQA 2CCZA 3BJUA 1JE5A 1LUZA 2YTYA 5IYDG 4LF4L 5BR8L 2MFIA 3HOZG 3RNUA 3DM3A 4JYAL 2JJQA 5DLQE 3KOJA 1E1TA 3CCUA 1D7QA 4A3DH 1IBMQ 4NXML 4DV2Q 1PHJA 1UE1A 3FKIG 1E7ZA 3B6YA 1KRTA 4HJ8A 2R7DA 3OTOQ 3PUWA 3G6EA 3ICEA 4EQ5A 3J81c 3JC66 2D0OA 4YWLA 1NY4A 4DUZQ 1VQIA 3OW2A 3KDFA 1EQQA 4P75A 1VQ9A 2D62A 2GN5A 2R92H 3K81C 1KIXA 1L2FA 5K36G 5M3MH 1PH8A 1HZ9A 2Q2HA 4A3JH 1VQBA 4J15A 4R4IA 1IYJB 1YHBA 1TWCH 1A0IA 3CQZH 3F1ZA 3H0GH 4LNQA 3I4OA 4LF9Q 2WFWA 2F4VQ 2UU9Q 3K0XA 1EQRA 5IP9G 3GTGH 1K3RA 4IO9A 1PH1A 2DUDA 1A63A 2H5XA 1NTGA 4BBRH 4PZ7A 2HHHQ 2OTLA 4AQYL 4DUYQ 1EOVA 3AFPA 4DR1Q 1HJPA 3PCOB 5IYBG 1YEZA 1OXUA 2NVYH 2IT1A 4DR6Q 3W1BA 4A3IG 1E3PA 2K5NA 1JJCB 1U5KA 5GAHC 3PO3G 4RMFA 1HNWL 3AFQA 4YCUA 4A93G 2QA4A 2VNUD 2UXCQ 2LXKA 1BBWA 1WCMG 3PUYA 4GKKL 1L1OB 1QUQB 1VQDA 2KENA 2B63G 3L7ZC 4UPAA 3ER0A 1Q86C 1PH9A 4JV5L 3NBHB 4DR5L 3JAMc 3A74A 3HOXG 1KRSA 1CKMA 3DLLA 1YI2A 1XMOQ 1YHQA 4JI7L 4MNOA 2UUBL 1M1KC 4IFDJ 4DR7Q 1MIUA 4TQUS 4X64Q 1WYDA 3GTLH 4OXPA 4A75A 4L5TA 4A3GH 1Y14B 2Q2UA 4C3IH 5GQOA 3HOWG 1IBML 3HKSA 3STBD 4DV0Q 4DV2L 3CC4A 3M85A 3EBEA 2JA7H 2VUMG 2NZHA 2E2HH 2CQOA 2R7ZH 4XTCS 1N32Q 2YTXA 1E1OA 3OTOL 1RIPA 2CWPA 1VQ7A 3GTPH 1EIYB 1FJGQ 4B3MQ 1AE3A 1KAWA 4IFDI 1Y1VG 2WB1E 1N9WA 4P72A 4DUZL 4GNXC 3RN2A 3HOUH 5LMUL 3I4NG 1YITA 1HR0Q 4GKJQ 3ULJA 4WJ3M 4P71A 4HIOA 1PH6A 5GAEC 1PV4A 1CKNB 4ME3A 4BXXG 1G291 2VQEQ 3PO2H 1P16A 1GO3E 5M5WH 5FLMG 1PH3A 2F4VL 1OXTA 3BZKA 2UU9L 4GN4B 1XPRA 1KD1C 4C3JH 1EIFA 3KF8B 4JBWA 3UDXA 4UP8A 4R4TA 3CF5A 1SLJA 1WJJA 3MXNB 4JOIA 3CCVA 1SN8A 2R7FA 4YHHQ 1MJEA 2HHHL 4L5RC 4H02A 3RZOH 2I5HA 2ZM6Q 3CCEA 1HH2P 4AH6A 4DUYL 1VS0A 1N36Q 4B3SQ 1R9TH 2KBNA 1V9PA 3SGIA 4DR1L 1JJ2A 3HOYH 3TRZA 3E9HA 1K0RA 1TWAH 2MO0A 4DR6L 1HNXQ 2R93G 1J5EQ 2ALYB 2ASBA 2CWAA 4X66L 4JI6L 3FP9A 2JA5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ A;  3TS2 A;  1GKH A;  3U50 C;  5GAD C;  2UXC L;  4P74 A;  4JOI C;  1U0L A;  1QUQ A;  4A3E H;  1HNZ Q;  2QGQ A;  4OO1 G;  3J80 c;  1EUJ A;  3KLW A;  4PZ8 A;  1HZB A;  1GD7 A;  1XMO L;  4A3B G;  2ATW A;  2A19 A;  2JK8 A;  3PGZ A;  1PH2 A;  1K73 C;  4JI0 Q;  4KHP Q;  3AQQ A;  2MO1 A;  4DV4 Q;  1EFW A;  4DR7 L;  3BZC A;  1V43 A;  3PV0 A;  5C0X J;  4X64 L;  4HJ7 A;  4GN5 A;  3F8T A;  2ZTC A;  4WJ4 A;  5IE8 A;  5C4X G;  4EX5 A;  2RCN A;  4BY7 G;  1E22 A;  3E0E A;  5C4J H;  4A3C G;  4BY1 H;  1WOC A;  4DV0 L;  2V1C C;  4A3M H;  2IY5 B;  2F52 A;  1SR3 A;  1N32 L;  4UP7 A;  5HY6 A;  4KI0 A;  2K5V A;  4A76 A;  1FJG L;  4B3M L;  2UXB L;  2N3S A;  5J3B A;  5M3F H;  1X3E A;  4YY3 Q;  2BH8 A;  5C0X I;  5JJK A;  1OXV A;  3NEN A;  2I5L X;  1HR0 L;  2F3I A;  4GKJ L;  1Q7Y C;  4UP9 A;  4KLK A;  2UXD L;  3KF6 A;  1I50 H;  4IPG A;  2KHI A;  3U4Z A;  4DR4 Q;  4DK3 C;  1Y1W G;  1RL2 A;  4JI8 Q;  4LUZ A;  4DR2 Q;  2VQE L;  1WFQ A;  3AEV A;  1LTL A;  3TQY A;  3ERS X;  3U4V A;  3G71 A;  5IP7 G;  1WI5 A;  3OYY A;  1K9M C;  2NN6 I;  3I4N H;  3CXC A;  4P73 A;  2N78 A;  3CME A;  1N33 Q;  5IYD H;  3PUV A;  4B3T Q;  4JI3 Q;  2BA0 A;  3J81 j;  1S40 A;  1I3Q H;  1NJI C;  1QVF A;  4HIM A;  1LM0 A;  3HOZ H;  1PVO A;  4A3J G;  2PMZ E;  2Q2I A;  1I6H H;  4PZ6 A;  4YHH L;  2ZJQ A;  4B3R L;  2ZM6 L;  1N36 L;  3FKI H;  4B3S L;  1QVC A;  3I55 A;  3K80 C;  1SMX A;  3GDE A;  3CCR A;  4Y7N H;  1HNX L;  1VQH A;  1YJW A;  4X6A H;  1X3F A;  3S2D H;  5LMN L;  3S16 H;  2ZTE A;  1XNR L;  1X56 A;  4OWX B;  4YCV A;  5LMN W;  3CCS A;  1TWG H;  4IJL A;  2N49 A;  4X62 L;  1N34 Q;  1JT8 A;  1IXR A;  3HFZ B;  1HNZ L;  2A8V A;  4R4Q A;  3S15 H;  4K0K Q;  2MNA A;  1CKO A;  1UE7 A;  2PQA A;  2JA6 G;  4YCW A;  5GRO A;  3CCM A;  3CPF A;  3T1Y Q;  3TS0 A;  5GAG C;  1VQP A;  4JI0 L;  4KHP L;  2ZJP A;  4DV4 L;  5IP9 H;  2WAQ E;  1FGU A;  3KJO A;  4A3L G;  4R1J A;  4ALP A;  3M9B A;  3ULL A;  4QY7 A;  5M5X H;  5JJL A;  2JQO A;  1XMQ Q;  2OWO A;  3I2Z A;  2E8G A;  3GO5 A;  1BKB A;  2I5M X;  2JEB I;  3G48 A;  2KHJ A;  5ELO A;  5IYB H;  1OXS C;  1X54 A;  3AYH B;  3E9I A;  4GNX A;  3A5Z B;  3K8A A;  4A3I H;  4MZ9 A;  4A3F G;  3KYH C;  3PO3 H;  1KQS A;  3GTK H;  2AMC B;  3UE1 A;  4MTN A;  1I5F A;  2R6G A;  4A93 H;  3HOV G;  3GD7 A;  3T1H Q;  1VQA A;  1WCM H;  3PF5 A;  2WB1 G;  4JBK A;  5C44 G;  2B63 H;  4A3K G;  1S72 A;  1VQF A;  5EAY A;  4DR4 L;  1SFO H;  4DR2 L;  3HOX H;  3GTO H;  3CC7 A;  3EIV A;  2LSS A;  4JCV E;  3M3Y H;  1A8V A;  3GTM H;  3VDY A;  1N8R C;  3M4Q A;  1JB7 A;  4JC0 A;  5C3E H;  2PNH A;  2XGT A;  4O0A A;  4XIG S;  4IFD G;  3RZD H;  5FLX c;  1G6P A;  5IYC G;  4B3T L;  4JI3 L;  2AWO A;  2NZO A;  4TVA B;  3LGJ A;  4O2D A;  4AYB G;  1VQ4 A;  1XNR Q;  2HT1 A;  3HOW H;  4LF9 L;  1VQN A;  5IWA Q;  3NEM A;  3MEF A;  4BBS G;  3Q8D A;  1YNX A;  4JI5 Q;  2A1A A;  2JA8 G;  4AYB E;  1VQK A;  3H3V H;  1YHA A;  4IJH A;  1Y1V H;  3RN5 A;  3S1R H;  2VY3 A;  1JJG A;  3CCL A;  1MKH A;  1C7Y A;  2VZA A;  1Q46 A;  1N34 L;  3S2H H;  3L0O A;  4JI2 Q;  3I4M H;  5FJ8 G;  4L5S A;  4BXX H;  1VQG A;  2IHE A;  1X3G A;  4DR3 Q;  3T1Y L;  1Q1B A;  4LFC Q;  5FLM H;  4QL5 A;  3UE0 A;  3PUZ A;  2RHS B;  3UDG A;  1QZG A;  1YBY A;  1XJV A;  1L1O A;  2ZJR A;  2N8N A;  3PUX A;  4DV1 Q;  2WP8 J;  1IBL Q;  4AIM A;  3K7U C;  2NVT H;  4OWW B;  3PIP A;  2OQK A;  4NPS A;  4GOP B;  4IPD A;  4DKA C;  4IPC A;  1XNQ Q;  2BA1 A;  2DGY A;  4LUO A;  1A62 A;  4Y52 H;  1VCI A;  4POG A;  4LUV A;  2RF4 A;  3J7Z C;  2R93 H;  1L1O C;  2Z0S A;  5JEA J;  4HJ5 A;  3HKZ E;  4PMW A;  1Q1E A;  1K83 H;  2GVA A;  3M4P A;  4DPG A;  3CMA A;  4HID A;  3ZJY C;  3T1H L;  1EYG A;  3GTQ H;  3S17 H;  4LFB Q;  3CW2 C;  1XPO A;  4GN3 B;  2E2J H;  1PA6 A;  1VQ6 A;  3J7A 5;  4JI4 Q;  3S14 H;  2Y0S E;  4A3B H;  4DV6 Q;  2E5L Q;  1BBU A;  4A3D G;  5AJ3 Q;  3RLN A;  4YWK A;  4GLX A;  1HR0 W;  1CKN A;  2L15 A;  3A5U A;  5C0X G;  1YJ9 A;  1J6Q A;  5C4X H;  1VQL A;  2YV5 A;  1ASY A;  4LF8 Q;  4BY7 H;  4A3C H;  1VQM A;  2K5H A;  2ZTD A;  4LFA Q;  3RLF A;  4X65 Q;  1YZ6 A;  2OQ0 A;  4FDB A;  3D0F A;  3RR5 A;  4QGU A;  2R92 G;  1GM5 A;  2YU9 H;  2JE6 I;  4DV7 Q;  1C9O A;  1NMG A;  4JI5 L;  1T9H A;  5M3M G;  2EQS A;  1IL2 A;  1VQC A;  1HZA A;  4APV A;  1P8L A;  3A0J A;  4C2M H;  2VL6 A;  3CAM A;  1Q81 C;  2NN6 G;  2PI2 E;  1CUK A;  4JBM A;  4DV3 Q;  3H0G G;  1JMC A;  3FHW A;  2VQF Q;  4A3G G;  1X65 A;  4L5Q A;  1I94 Q;  1KC8 C;  2IHF A;  3PF4 A;  1KL9 A;  2OCE A;  1Y1W H;  1C0A A;  2K52 A;  4OWT B;  3RLO A;  4JI2 L;  1Q82 C;  1CSP A;  1PYS B;  1J5E L;  1G51 A;  2K4K A;  3D31 A;  4JI1 Q;  4DR3 L;  4LFC L;  4BBR G;  3F2D A;  5LMU Q;  1TWF H;  5IP7 H;  1VQE A;  1XTD A;  2NVX H;  4NXN Q;  4HIK A;  1OXX K;  1B8A A;  3WWV A;  4DV1 L;  1IBL L;  2WAQ G;  3IRB A;  2I0Q A;  1NBW A;  3G4S A;  1FL0 A;  2VS1 A;  3TRE A;  3J81 i;  1Q12 A;  2CKZ B;  4HJ9 A;  3ULP A;  1IBK Q;  2YTV A;  4DNI A;  4GOP A;  4LF7 Q;  2HIX A;  1XNQ L;  5JJI A;  1O7I A;  3UDF A;  1SE8 A;  2VW9 A;  1FVI A;  2GVB A;  4PG3 A;  2K14 A;  4LFB L;  3EN2 A;  3F2B A;  1VQ8 A;  5IY0 A;  4BA1 I;  5E7N A;  1YVC A;  4UY8 C;  2IX1 A;  1W2B A;  4JI4 L;  2CFM A;  1Z47 A;  4GOP C;  2JA6 H;  4OON A;  3CPW A;  4X66 Q;  4QIW E;  4DV6 L;  4JI6 Q;  2E5L L;  4OX9 Q;  4YY3 L;  4DK6 C;  4RG1 A;  3UDI A;  2HIV A;  5AJ3 L;  1ASZ A;  3CD6 A;  4BA2 I;  1XPU A;  2Q2T A;  2JA7 G;  4LF6 Q;  2R7Z G;  1OTC A;  4A3L H;  5HGQ A;  2UUC Q;  4JI8 L;  1CSQ A;  5M5Y H;  1VQ5 A;  4DAY B;  4DV5 Q;  2PI2 A;  4LF5 Q;  4LF8 L;  1GVP A;  2UUA Q;  2KCT A;  1B7Y B;  4LFA L;  5H1S E;  4X65 L;  3HOU G;  1PH7 A;  5C3E G;  4DV7 L;  1N33 L;  1K8A C;  4JBJ A;  2QEX A;  4JG2 A;  2K50 A;  4YWM A;  4A3F H;  3KFU A;  5IT9 c;  1AE2 A;  3HOV H;  4NB3 A;  3PO2 G;  1PFS A;  3BU2 A;  3JAM i;  2B29 A;  1YJN A;  4DV3 L;  1BVS A;  3H3V I;  2VQF L;  2VUM H;  5C44 H;  3CCJ A;  1K8G A;  4A3K H;  1I94 L;  1QVG A;  4C3H H;  4LF4 Q;  2C35 B;  1PYB A;  1X6O A;  2MQH A;  3M4O H;  2HQL A;  5BR8 Q;  2UXB Q;  4JYA Q;  2ID0 A;  1VQO A;  4JI1 L;  4IOA A;  4IOC A;  4LW1 A;  2B3G A;  1HZC A;  4IPH A;  1D8L A;  1EWI A;  3W5O A;  4NXM Q;  3S1M H;  3K7A H;  2RHQ B;  2AKW B;  1Q8K A;  4LWC A;  4GS3 A;  4NXN L;  2E2I H;  2UXD Q;  4KHZ A;  3KF6 B;  4GLA C;  3HOY G;  1E24 A;  5IYC H;  4POF A;  3STB C;  1LYL A;  1QZH A;  4GLV B;  2EIF A;  3I4M G;  4K0K L;  3GTJ H;  3CCQ A;  1S3O A;  4B3R Q;  1B70 B;  3KDF B;  1TXY A;  3KJP A;  2JA5 G;  1IBK L;  4LF7 L;  2XTI A;  1PH4 A;  2ES2 A;  4BBS H;  4DAM A;  1H95 A;  2JA8 H;  4HJA A;  4A3E G;  1SRO A;  1M90 C;  3S1N H;  1AH9 A;  2Z6K A;  4QJF A;  1XMQ L;  1X55 A;  3HKZ G;  3I7F A;  2BH2 A;  3PIO A;  1VQJ A;  5LMN Q;  3PSI A;  5FJ8 H;  1Z9F A;  1DGS A;  5ELN A;  1V1Q A;  2Y0S G;  4AQY Q;  4OO1 I;  2AHO B;  1UWV A;  4OX9 L;  1PH5 A;  4BY1 G;  3CC2 A;  4X62 Q;  1MJC A;  1NE3 A;  2YYZ A;  2Z6K C;  4A3M G;  1X9N A;  4LF6 L;  2NVQ H;  1IZ6 A;  2JA9 A;  3NEL A;  2UUC L;  3S1Q H;  3F2C A;  1SRU A;  3TEH B;  1HNW Q;  2PQA B;  1L0W A;  2EXD A;  3W1G A;  1W3S A;  4DV5 L;  3H15 A;  1YIJ A;  1KXL A;  3CP0 A;  4R4C A;  4R4O A;  5M3F G;  2UUA L;  4LF5 L;  3L2P A;  4GKK Q;  2K75 A;  2KCM A;  3I56 A;  1NMF A;  2D0P A;  1UEB A;  2IX0 A;  2JEA I;  4JV5 Q;  3J80 i;  4DR5 Q;  2LXJ A;  4A4I A;  1UE5 A;  5JEA G;  4JI7 Q;  2UUB Q;  5IWA L;  1KHI A;  3M7N A;  1TWH H;  2AWN A;  3S24 A;  1UE6 A;  4QQB X;  3U58 A;  4GNX B;  2FXQ A;  2CCZ A;  3BJU A;  1JE5 A;  1LUZ A;  2YTY A;  5IYD G;  4LF4 L;  5BR8 L;  2MFI A;  3HOZ G;  3RNU A;  3DM3 A;  4JYA L;  2JJQ A;  5DLQ E;  3KOJ A;  1E1T A;  3CCU A;  1D7Q A;  4A3D H;  1IBM Q;  4NXM L;  4DV2 Q;  1PHJ A;  1UE1 A;  3FKI G;  1E7Z A;  3B6Y A;  1KRT A;  4HJ8 A;  2R7D A;  3OTO Q;  3PUW A;  3G6E A;  3ICE A;  4EQ5 A;  3J81 c;  3JC6 6;  2D0O A;  4YWL A;  1NY4 A;  4DUZ Q;  1VQI A;  3OW2 A;  3KDF A;  1EQQ A;  4P75 A;  1VQ9 A;  2D62 A;  2GN5 A;  2R92 H;  3K81 C;  1KIX A;  1L2F A;  5K36 G;  5M3M H;  1PH8 A;  1HZ9 A;  2Q2H A;  4A3J H;  1VQB A;  4J15 A;  4R4I A;  1IYJ B;  1YHB A;  1TWC H;  1A0I A;  3CQZ H;  3F1Z A;  3H0G H;  4LNQ A;  3I4O A;  4LF9 Q;  2WFW A;  2F4V Q;  2UU9 Q;  3K0X A;  1EQR A;  5IP9 G;  3GTG H;  1K3R A;  4IO9 A;  1PH1 A;  2DUD A;  1A63 A;  2H5X A;  1NTG A;  4BBR H;  4PZ7 A;  2HHH Q;  2OTL A;  4AQY L;  4DUY Q;  1EOV A;  3AFP A;  4DR1 Q;  1HJP A;  3PCO B;  5IYB G;  1YEZ A;  1OXU A;  2NVY H;  2IT1 A;  4DR6 Q;  3W1B A;  4A3I G;  1E3P A;  2K5N A;  1JJC B;  1U5K A;  5GAH C;  3PO3 G;  4RMF A;  1HNW L;  3AFQ A;  4YCU A;  4A93 G;  2QA4 A;  2VNU D;  2UXC Q;  2LXK A;  1BBW A;  1WCM G;  3PUY A;  4GKK L;  1L1O B;  1QUQ B;  1VQD A;  2KEN A;  2B63 G;  3L7Z C;  4UPA A;  3ER0 A;  1Q86 C;  1PH9 A;  4JV5 L;  3NBH B;  4DR5 L;  3JAM c;  3A74 A;  3HOX G;  1KRS A;  1CKM A;  3DLL A;  1YI2 A;  1XMO Q;  1YHQ A;  4JI7 L;  4MNO A;  2UUB L;  1M1K C;  4IFD J;  4DR7 Q;  1MIU A;  4TQU S;  4X64 Q;  1WYD A;  3GTL H;  4OXP A;  4A75 A;  4L5T A;  4A3G H;  1Y14 B;  2Q2U A;  4C3I H;  5GQO A;  3HOW G;  1IBM L;  3HKS A;  3STB D;  4DV0 Q;  4DV2 L;  3CC4 A;  3M85 A;  3EBE A;  2JA7 H;  2VUM G;  2NZH A;  2E2H H;  2CQO A;  2R7Z H;  4XTC S;  1N32 Q;  2YTX A;  1E1O A;  3OTO L;  1RIP A;  2CWP A;  1VQ7 A;  3GTP H;  1EIY B;  1FJG Q;  4B3M Q;  1AE3 A;  1KAW A;  4IFD I;  1Y1V G;  2WB1 E;  1N9W A;  4P72 A;  4DUZ L;  4GNX C;  3RN2 A;  3HOU H;  5LMU L;  3I4N G;  1YIT A;  1HR0 Q;  4GKJ Q;  3ULJ A;  4WJ3 M;  4P71 A;  4HIO A;  1PH6 A;  5GAE C;  1PV4 A;  1CKN B;  4ME3 A;  4BXX G;  1G29 1;  2VQE Q;  3PO2 H;  1P16 A;  1GO3 E;  5M5W H;  5FLM G;  1PH3 A;  2F4V L;  1OXT A;  3BZK A;  2UU9 L;  4GN4 B;  1XPR A;  1KD1 C;  4C3J H;  1EIF A;  3KF8 B;  4JBW A;  3UDX A;  4UP8 A;  4R4T A;  3CF5 A;  1SLJ A;  1WJJ A;  3MXN B;  4JOI A;  3CCV A;  1SN8 A;  2R7F A;  4YHH Q;  1MJE A;  2HHH L;  4L5R C;  4H02 A;  3RZO H;  2I5H A;  2ZM6 Q;  3CCE A;  1HH2 P;  4AH6 A;  4DUY L;  1VS0 A;  1N36 Q;  4B3S Q;  1R9T H;  2KBN A;  1V9P A;  3SGI A;  4DR1 L;  1JJ2 A;  3HOY H;  3TRZ A;  3E9H A;  1K0R A;  1TWA H;  2MO0 A;  4DR6 L;  1HNX Q;  2R93 G;  1J5E Q;  2ALY B;  2ASB A;  2CWA A;  4X66 L;  4JI6 L;  3FP9 A;  2JA5 H; 
#chains in the Genus database with same CATH topology
 5GAD C;  1U0L A;  2XWJ B;  1EUJ A;  3KLW A;  1GD7 A;  1KDA A;  2K6A A;  4DR7 L;  4KD4 A;  4K5W A;  3OMG A;  5FK9 C;  4GN5 A;  2ZTC A;  4RGO S;  5C4J B;  5CBA E;  2RCN A;  2FMM A;  1A6X A;  4BY7 G;  1E22 A;  3E0E A;  5C4J H;  4A3C G;  1EZ8 A;  1UEA B;  4UP7 A;  4KI0 A;  4A76 A;  4TRD A;  1II3 A;  1FJG L;  1X3E A;  1NSN S;  1HPC A;  1WVL A;  2I5L X;  4GKJ L;  2F3I A;  3C46 A;  1O7Z A;  1I50 H;  3R93 A;  3A54 A;  4RFB A;  3GP7 A;  4DK3 C;  4JI8 Q;  1F9S A;  1SYD A;  5JEA H;  1SYE A;  2VQE L;  1JWU D;  4DA2 A;  2K33 A;  5M3M B;  1JE4 A;  2Z9H A;  5IP7 G;  1HQR D;  3G71 A;  5EJW A;  4P73 A;  2N78 A;  3PUV A;  4I65 A;  4B3T Q;  4JI3 Q;  2BA0 A;  3L3O C;  2OF1 A;  5A35 A;  4IUT A;  3FKI B;  4YHH L;  5D65 A;  2ZM6 L;  3FKI H;  1QVC A;  1R4Q B;  3K80 C;  4C1N K;  2G9D A;  4Y7N B;  3A56 A;  1D5Z C;  3GDE A;  3CCR A;  4Y7N H;  4OEM B;  1ENF A;  3NWT A;  2ZTE A;  5M9O A;  2QEJ C;  3CCS A;  1NAP A;  2WAQ B;  2N49 A;  1STN A;  2K05 A;  4K0K Q;  1TR5 A;  3TS0 A;  4XXE A;  2ICI A;  1NUC A;  4DV4 L;  1PRT B;  2N88 A;  3KJO A;  1AW7 A;  3M9B A;  4QY7 A;  3LWU A;  1X3Q A;  2E8G A;  2CVR A;  4WJW A;  5IYB H;  1ENC A;  3GTK B;  3A5Z B;  4A3I H;  2AQ1 B;  1KTK A;  3GTK H;  1WCM B;  1G6Z A;  2R6G A;  1QNK A;  3GD7 A;  2E2H B;  1WCM H;  2F0J A;  1SFO B;  5EGT A;  4RH6 A;  1S72 A;  4DR4 L;  4DK0 A;  1SFO H;  4DGZ A;  1STA A;  4JCV E;  4JW0 A;  3VDY A;  2OEO A;  2PNH A;  4V19 0;  4IFD G;  2CW0 D;  4CKB A;  5IYC G;  2AWO A;  1T5E A;  4KKU A;  4AYB G;  2F0Q A;  4C3J B;  3NEM A;  4JI5 Q;  3E3X A;  4ILW A;  3H3V H;  1MBY A;  1Y1V H;  1UAP A;  1EIG A;  2VY3 A;  1LTS D;  1JJG A;  3KBX A;  3HS0 C;  3TN2 A;  1C7Y A;  4BWG B;  1N34 L;  3L0O A;  4B9W A;  4BXX H;  1ET6 A;  1L0Y B;  1X3G A;  2O2L D;  5CR3 A;  1CA6 A;  5IIF A;  1YBY A;  4K14 A;  2ZJR A;  3K58 A;  1GOZ A;  2WP8 J;  5IGG A;  2NVT H;  2OQK A;  4GOP B;  1XNQ Q;  4DKA C;  2XVS A;  1A62 A;  4MHE A;  4LUV A;  3HG9 A;  4MN3 A;  3ERQ A;  2L5T A;  1PRT C;  1BO0 A;  4LFB Q;  3CMA A;  4A3M B;  1BQQ T;  1XPO A;  1VQ6 A;  4GN3 B;  5CV5 A;  2DN8 A;  2Y0S E;  4DV6 Q;  2E5L Q;  3I72 A;  3I70 A;  4A3D G;  4OGQ C;  4Z9C B;  1H9S A;  1HR0 W;  1CKN A;  5I2X A;  5C0X G;  3Q6S A;  4O1N A;  1VQL A;  4BY7 H;  4A3C H;  2K5H A;  2ZTD A;  4LJZ C;  4X65 Q;  4FDB A;  1PLF A;  4QGU A;  3D0F A;  1F9P A;  5KNC A;  1STY A;  2R92 G;  2JE6 I;  1C9O A;  5ISR A;  2IJ0 A;  4HR7 B;  1P8L A;  5C3X A;  1CUK A;  4C56 C;  4JBM A;  3SK4 A;  4IUV A;  1JMC A;  1SNQ A;  3FHW A;  2VQF Q;  2PNR C;  4L5Q A;  1KC8 C;  2IHF A;  3OHX C;  2OCE A;  1C0A A;  2K52 A;  3RLO A;  4KKT A;  1J5E L;  3C3L A;  2VXW A;  4DR3 L;  1TWG B;  3DWP A;  1ML0 D;  4LFC L;  5IP7 H;  5C3W A;  3GQB A;  4DV1 L;  4HCS A;  2PZW A;  2EJG C;  2I0Q A;  1FL0 A;  1L0X B;  5JJI A;  2YTV A;  2HIX A;  5IGC A;  1ICF B;  4JVZ A;  2F0I A;  1AN8 A;  4F8M A;  3A8J E;  1SE8 A;  2KUM A;  2J4X A;  2K14 A;  2SDF A;  2Z4I A;  2XRQ D;  3QB3 A;  4GOP C;  4OON A;  1CZW A;  1A3V A;  1HUN A;  4C3I G;  3C1E A;  4DK6 C;  1ASZ A;  3D4R A;  3EVQ A;  1XPU A;  2Q2T A;  3HOX B;  1EY4 A;  1SEB D;  3EJI A;  3VYT A;  1KLG D;  2UUC Q;  3M3Y B;  5CV7 A;  1ZEQ X;  4LF5 Q;  2F3V A;  4LF8 L;  2UUA Q;  1B7Y B;  3HOU G;  1EU3 A;  1U4M A;  1K8A C;  2K50 A;  4QUC A;  3KFU A;  3MC0 B;  2Z4H A;  2LMC B;  4NB3 A;  4ODG A;  1YJN A;  2HCC A;  2BDN A;  5G3L F;  3D4D A;  3CCJ A;  1K8G A;  1QVG A;  1A3T A;  4KY5 A;  5FO9 B;  2KED A;  2A6H D;  4QCL A;  4HMJ A;  4JI1 L;  2L1B A;  2B3G A;  1HZC A;  4NXM Q;  3I90 A;  1TS4 A;  3S2H B;  3DWA A;  4RGT A;  1Q8K A;  4IFD H;  2NWG A;  4GS3 A;  4NXN L;  2UXD Q;  3HOY G;  3K5O A;  1E24 A;  5IYC H;  4POF A;  2EIF A;  3I4M G;  3VR4 A;  3GTJ H;  1UUP A;  2E76 C;  2FHT A;  3W2D A;  2SEB D;  4FXG C;  3WOE A;  4LF7 L;  2XTI A;  1PH4 A;  1DOM A;  2QCP X;  3NE5 B;  4A3E G;  2R61 A;  3OIP A;  4QJF A;  5C6A A;  3HKZ G;  1DM0 B;  3GV6 A;  3NP8 A;  3PSI A;  4G7Z C;  4LMQ D;  3IFD A;  1V1Q A;  2B8F A;  4AQY Q;  1MJC A;  2YYZ A;  2Z6K C;  1X9N A;  3S1Q B;  1HA6 A;  3V96 A;  2JA9 A;  2F0G A;  3S1Q H;  1SRU A;  3TEH B;  4DAY A;  1HNW Q;  3TZU A;  1PTO D;  4R4C A;  1D6E C;  5EKL A;  5IOD A;  5JAV A;  5HGT A;  2JSO A;  1BXT A;  3J80 i;  4DR5 Q;  1TII D;  1S5B D;  5IWA L;  3S24 A;  4C2M B;  2CCZ A;  4GNX B;  2L4N A;  1JE5 A;  2F0U A;  2Z6B A;  3BJU A;  5ELE A;  5BR8 L;  4EQP A;  4A3D B;  3BVG A;  4KTA A;  3KOJ A;  4A3D H;  1BUV T;  1IBM Q;  1RF2 D;  1Y1W B;  1DYQ A;  4ZYS A;  5FO8 B;  1LTB D;  2F03 A;  4ZUI A;  5C0X H;  3MWY W;  3ICE A;  4EQ5 A;  2CHB D;  2LY7 A;  2PMZ B;  4YWL A;  2Q8I B;  2R92 B;  4V0B A;  1EWC A;  2D62 A;  1RCV D;  4Q0F A;  3U9O A;  2R92 H;  5BN5 A;  3I73 A;  1DCZ A;  1EY9 A;  4ZAI A;  4R8N A;  1HZ9 A;  3EA6 A;  2OXP A;  1JOO A;  1VQB A;  1D1K A;  3CQZ B;  4FF3 A;  2KHS A;  1ICW A;  1YHB A;  3CQZ H;  3ND8 A;  3TME A;  2WFW A;  5IP9 G;  3GTG H;  2CH4 W;  2H5X A;  2HHH Q;  1EOV A;  4DR1 Q;  2XN9 C;  4HED A;  2JA6 B;  1YEZ A;  3FPP A;  4FXK C;  4OHJ A;  2IT1 A;  3K59 A;  4DR6 Q;  1JJC B;  2K5N A;  1ZYR D;  5KNB A;  2VNU D;  4YCU A;  4FYD A;  1SXT A;  1T5X D;  2UXC Q;  2KCN A;  4H13 C;  1L1O B;  1RJT A;  1QWY A;  5HUR A;  2KQ3 A;  2IX3 A;  2B63 G;  3ER0 A;  3S2D B;  3FVQ A;  4CDE C;  1VF7 A;  3S2D H;  1YI2 A;  1M1K C;  1LTG D;  1MIU A;  4TQU S;  2F0F A;  4X64 Q;  3H91 A;  1PRT F;  2I46 A;  4C3I B;  3OSO A;  2K5D A;  3J80 L;  2Q2U A;  4C3I H;  3HOW G;  1H9R A;  1HHV A;  3DWQ A;  4DV0 Q;  4DV2 L;  2A5H A;  2NZH A;  3VR6 A;  4XTC S;  2JN4 A;  1RIP A;  2DJF C;  1EIY B;  1MI2 A;  1AE3 A;  1IW7 D;  1G8Z D;  1HUM A;  1PTO B;  1N9W A;  4P72 A;  4GNX C;  3RN2 A;  3HOU H;  1PTO H;  1B3A A;  3A55 A;  1O7Y A;  4P71 A;  2F0D A;  3R2T A;  5D14 A;  2B2T A;  1PV4 A;  2K5W A;  3NWS A;  1CK1 A;  3A7L A;  2F4V L;  2A6E D;  4IN3 A;  5C4H A;  1KD1 C;  5JPN C;  1NR4 A;  1EY8 A;  1EIF A;  4PQX A;  2EYM A;  1SLJ A;  1WJJ A;  3RD4 A;  4DF7 A;  4JOI A;  1SN8 A;  1MJE A;  3HOY B;  4DUY L;  3HRZ C;  2NTT A;  2MPM A;  2KBN A;  3HOY H;  2EYP A;  4ZK9 B;  2ASB A;  2R93 G;  4HCE A;  3FP9 A;  1XNR Q;  3T51 B;  2XWB B;  2X6G A;  4HMI A;  3TS2 A;  1GKH A;  2EY2 A;  3U50 C;  4A3E B;  4P74 A;  4A3E H;  5JVH 3;  3TZD A;  3HKZ B;  1XMO L;  4A3B G;  2A19 A;  2JK8 A;  1K73 C;  4KHP Q;  3AQQ A;  2MO1 A;  1EFW A;  1ZXT A;  3BZC A;  1V43 A;  3V05 A;  4PNY A;  5IE8 A;  3WOF A;  2QDB A;  3D8G A;  3AU7 A;  2ZXO A;  1CQF A;  2F52 A;  1SR3 A;  1N32 L;  2UXB L;  2EXZ A;  4B3M L;  5IGF A;  1QOH A;  4YY3 Q;  5JJK A;  3IL8 A;  3FMC A;  4PMB A;  1HR0 L;  2G9H D;  3U4Z A;  2SNM A;  1RL2 A;  4DR2 Q;  1TY2 A;  1GXD C;  3U4V A;  1K9M C;  3OYY A;  2NN6 I;  4PMC A;  1N33 Q;  3J81 j;  3VYR A;  1NJI C;  3H0G B;  1I6H B;  3MXN A;  2PMZ E;  1I6H H;  4PZ6 A;  2F0N A;  4B3R L;  4B3S L;  1BCP C;  4U67 3;  5COR A;  3TP6 A;  1EQT A;  3S16 B;  1X3F A;  5FLX L;  3S16 H;  3SK8 A;  3HZX A;  2K01 A;  4OWX B;  4YCV A;  1STB A;  5LMN W;  1PYW D;  2DNE A;  4IJL A;  1JT8 A;  1LT4 D;  5GRO A;  3T1Y Q;  1DON A;  3MFY A;  3NSW A;  3J7Y W;  1VQP A;  2ZJP A;  5IP9 H;  5CGK A;  3OMC A;  1D5X C;  4R1J A;  2K04 A;  5M5X H;  3QIA A;  1XMQ Q;  4EGV A;  3GO5 A;  3SK5 A;  4GNX A;  3E9I A;  1OXS C;  1TU2 B;  3AYH B;  3CRK C;  3PIP 3;  4A3F G;  1X32 A;  1KQS A;  2AMC B;  1I5F A;  2EE1 A;  3PF5 A;  1HXY D;  2B63 B;  2R7Z B;  2WB1 G;  4O42 A;  4JBK A;  1LV9 A;  2B63 H;  4A3K G;  1RTN A;  3K0Y A;  4C3H G;  3GTO B;  3M7G A;  1BBX C;  3T13 A;  3MEH A;  3GTO H;  2LSS A;  5DEH A;  5C3E B;  1N8R C;  4JC0 A;  1ZYR C;  5C3E H;  2XGT A;  1H9S B;  1JR0 D;  4B3T L;  1IKL A;  4JI3 L;  1J9O A;  2NZO A;  4TVA B;  1YNJ D;  2BE5 D;  4NKL A;  1VQ4 A;  3HOW H;  1WTH A;  4LF9 L;  3RUZ A;  3MEF A;  1S5D D;  3Q8D A;  2NBF A;  4XQN A;  2JA8 G;  3BZD B;  1YHA A;  3RZO B;  5FKA C;  5EBC A;  3MHB A;  1EY0 A;  1TWA B;  3PQI A;  4KK7 A;  1QB5 D;  2IHE A;  1I4R A;  3UE0 A;  2RKS A;  3J80 E;  4XQJ A;  1L1O A;  5KYI A;  1XJV A;  2QW7 A;  1ILQ A;  5E3F A;  2R3Z A;  4NPS A;  4IPC A;  2EZV A;  2DGY A;  2F0K A;  1VCI A;  3LX0 A;  2RBM A;  3MZ5 A;  2Y0S B;  2R93 H;  2Z0S A;  4HJ5 A;  3HKZ E;  4PMW A;  4JI6 L;  1Q1E A;  1K83 H;  2GVA A;  1VMP A;  1SMY D;  3P20 A;  1PA6 A;  3S14 B;  1PFB A;  4JI4 Q;  2RSN A;  4A3B B;  3S14 H;  1J8I A;  4A3B H;  4CDC C;  5LHY 1;  1I4P A;  2EOT A;  3VYS A;  2AQ2 B;  1I50 B;  5AJ3 Q;  1E2V A;  3RLN A;  4YWK A;  1SYF A;  2L15 A;  1F2Z A;  4Q5V A;  5J39 A;  2J0T D;  4CJ2 C;  1VQM A;  4LFA Q;  3MVV A;  3QWN A;  3RR5 A;  1GM5 A;  4IUR A;  4DV7 Q;  4JI5 L;  4X3U A;  3CU7 A;  1HZA A;  4APV A;  1AFP A;  1Q81 C;  3ZYY X;  1JOQ A;  4DV3 Q;  1E2Z A;  1X65 A;  4OIJ A;  1JOK A;  5EQ0 A;  1Y69 U;  1I94 Q;  5KEE A;  2KVM A;  3NUC A;  4OWT B;  5C4Z A;  1KDB A;  1CSP A;  4DN4 M;  3D31 A;  5I4D A;  4BBR G;  3F2D A;  4K5X A;  5CV4 A;  5IT9 L;  2NVX H;  2RDF A;  3H94 A;  3IRB A;  3R3O A;  2VS1 A;  3J81 i;  2F0T A;  1XNQ L;  3TSS A;  1QG7 A;  4UDU C;  2VW9 A;  1FVI A;  2GVB A;  1O80 A;  1RHP A;  4LFB L;  3F2B A;  3D3R A;  5E7N A;  4A3I B;  1YVC A;  2CFM A;  3F2U A;  3LWE A;  4RCO A;  5AFW A;  4DV6 L;  4JI6 Q;  2E5L L;  4OX9 Q;  2D5D A;  2HIV A;  3SEB A;  2DJG C;  3NTI A;  4F87 A;  1OTC A;  1VQ5 A;  2EVB A;  4DAY B;  3SHL A;  2WAC A;  3BYT B;  5C5L A;  4X65 L;  5FLX E;  1VMC A;  4A3F B;  3J7A F;  4JBJ A;  2QEX A;  4JG2 A;  4KY7 A;  4RWS C;  4YWM A;  4A3F H;  1STG A;  2WB1 B;  3PO2 G;  2EYJ A;  3BU2 A;  2VUM B;  1BVS A;  4A3K B;  3H3V I;  2VQF L;  2VUM H;  4C3H B;  3TDQ A;  4A3K H;  3ERO A;  1STE A;  1Y1V B;  2C35 B;  4RAU C;  5E4W C;  4C3H H;  3M4O H;  2HQL A;  1EFI D;  4JYA Q;  3K5N A;  4LWC A;  2E2I H;  2D9U A;  4GLA C;  1GHJ A;  3STB C;  3BVZ A;  4GLV B;  2K1B A;  3FEW X;  1Q8I A;  4WFN 3;  1B70 B;  2JA5 G;  3KJP A;  2JYO A;  4DAM A;  2GA4 B;  2NVT B;  2JA8 H;  2MJ8 A;  1EIH A;  1SRO A;  1M90 C;  1AH9 A;  1EEF D;  4ZRZ A;  3J81 L;  1BCP F;  2BH2 A;  1ENA A;  3PIO A;  1BOS A;  4DU9 A;  4CJ1 B;  1RTO A;  2BOS A;  1A15 A;  1UWV A;  5EBD A;  1PH5 A;  2MP1 A;  4BY1 G;  2KCC A;  3Q22 A;  1EEI D;  1IZ6 A;  1HFG A;  1I6V C;  1MGS A;  3NEL A;  3KUP A;  4IUN A;  2UUC L;  4LAA A;  1KXL A;  3CP0 A;  4R4O A;  4LF5 L;  2UUA L;  4GKK Q;  1QNU A;  2KCM A;  2LFN A;  2LS0 1;  1W6J A;  4FNF A;  2O4X A;  2PCF B;  3K6O A;  2JEA I;  4BY7 B;  2EYO A;  2LXJ A;  4A4I A;  4JI7 Q;  1EWH A;  2M2L A;  1S5C D;  1Z7T A;  5I9P A;  5IGE A;  2UUB Q;  1KHI A;  4I7A A;  4QQB X;  3DEO A;  1WTP A;  1K28 A;  3HOZ G;  5DLQ E;  5JJZ A;  2Q8R E;  4NXM L;  1UE1 A;  1CHQ D;  3B6Y A;  5EPK A;  4HJ8 A;  3G6E A;  3EQL C;  1SMY C;  1FNU A;  3H3V C;  1CQV A;  4DUZ Q;  1RD9 D;  3OW2 A;  3KDF A;  4P75 A;  1VQ9 A;  2GN5 A;  1KIX A;  1L2F A;  1B4O A;  2FFK B;  1TVX A;  4KKS A;  4LNQ A;  1TWC H;  1EY6 A;  2M9V A;  2MGS A;  1K3R A;  4IO9 A;  2DUD A;  1A63 A;  4BBR H;  4J8Q A;  4AQY L;  2NVY B;  4KHV A;  2NVY H;  2PZT A;  1U5K A;  5EPL A;  5GAH C;  1HNW L;  3TBI B;  3AFQ A;  4A93 G;  2QA4 A;  5COY A;  4HSP A;  2F0H A;  3G7L A;  3V2T A;  3L7Z C;  4UPA A;  3R2I A;  2F0E A;  4DR5 L;  3PMF A;  2C9O A;  2BCO A;  3MTS A;  1EY5 A;  3NK9 A;  2IW3 A;  1WYD A;  3NHH A;  5IT9 E;  3T4A C;  1CT1 D;  5GQO A;  4L8J A;  3URY A;  1IBM L;  3QO2 A;  1SJH D;  2CQO A;  2YTX A;  1U9R A;  4IFD I;  1SYB A;  2WB1 E;  1EQV A;  5LMU L;  1YIT A;  3E6Z X;  3GTJ B;  1PH6 A;  2WIN B;  1G91 A;  3D6W A;  4ME3 A;  4AYB B;  1PMR A;  1Z6H A;  2A69 D;  3PO2 H;  2EYL A;  1GO3 E;  5M5W H;  1JWS D;  1XPR A;  3OOC A;  3J7A V;  3KLS A;  5CMD A;  2CW0 C;  3MXN B;  1SNC A;  3CCV A;  2B2T C;  2HHH L;  3L9A X;  4J1M A;  1N36 Q;  3DM1 A;  3I91 A;  4EVO A;  1A2T A;  4DR1 L;  3TRZ A;  2F3W A;  1JJ2 A;  1M8A A;  3KLS X;  1OO9 B;  4DR6 L;  1HNX Q;  2O5J C;  1J5E Q;  2ALY B;  2JA5 B;  2CWA A;  4X66 L;  5LMN Q;  2JA5 H;  1IYU A;  2OTJ A;  1YNN D;  4F7X A;  2UXC L;  1PZK D;  3AB9 A;  4JOI C;  2EDG A;  1QUQ A;  1HNZ Q;  4OO1 G;  3J80 c;  5I9O A;  1HZB A;  4XYO A;  3PGZ A;  1PH2 A;  4JI0 Q;  2FIN B;  3PV0 A;  4HJ7 A;  4X64 L;  3IFT A;  2RSO A;  3F8T A;  1TQO A;  3E0J A;  5C4X G;  4BY1 B;  1BR9 A;  4BY1 H;  1JC7 A;  4DV0 L;  5NUC A;  3QG1 A;  1F9Q A;  5HY6 A;  3RMH A;  2JP1 A;  1F9R A;  5J3B A;  5C0X I;  2BH8 A;  2XSC A;  3NEN A;  1V1O A;  1Q7Y C;  1I4Q A;  3D6C A;  1FD7 D;  4IPG A;  3J81 E;  5I6W A;  1PZI D;  4H0L C;  1EZ6 A;  3ERS X;  1WI5 A;  3NTK A;  3CXC A;  3CME A;  3HOZ B;  2EYH A;  4K2L A;  4N8X 1;  3X3N A;  1S5F D;  2HD3 A;  1S40 A;  1I3Q H;  3HOZ H;  4HIM A;  1LM0 A;  4A3J G;  4FF1 A;  2RA4 A;  1WD1 A;  2RDG A;  3TP5 A;  2ZJQ A;  5LL6 X;  3GTG B;  3I55 A;  4H7B A;  5FOB B;  3OWF A;  4X6A H;  1YJW A;  4XT1 B;  1XNR L;  3DMU A;  1X56 A;  4X62 L;  1IXR A;  5F2D A;  4TKO B;  1CKO A;  1UE7 A;  4UAI A;  1B3Q A;  3CPF A;  3CCM A;  2A68 D;  4KHP L;  1JIC A;  1X3P A;  2F0W A;  4BS9 A;  4IUQ A;  1WTO A;  1DXM A;  2QF7 A;  1QIL A;  4IAL A;  4ALP A;  4QIW B;  3ULL A;  3K5M A;  2JQO A;  3I2Z A;  4ZKC B;  2I5M X;  2KHJ A;  2Z1C A;  4RGN A;  1PFM A;  4MZ9 A;  4CDD C;  3UE1 A;  4A93 H;  1NR2 A;  3SR1 A;  3HOV G;  3T1H Q;  4K5V A;  5C44 G;  3KLR A;  1DD2 A;  2Q8T A;  4OIK A;  4DR2 L;  3HOU B;  3GTM B;  2PO4 A;  3CC7 A;  3NBI A;  3NQI A;  4N9T A;  2WV6 D;  1A8V A;  3GTM H;  3T53 B;  3RZD B;  1JB7 A;  4O0A A;  4XIG S;  3RZD H;  5FLX c;  2G5D A;  4O2D A;  4XYQ A;  3K5L A;  4HN7 A;  5IWA Q;  2HQE A;  2PZU A;  1HQM C;  4BBS G;  2A1A A;  5D3D A;  2SOB A;  4AYB E;  1VQK A;  3BDL A;  3S1R H;  3FDT A;  3A8I E;  1MKH A;  3I4M B;  1Q46 A;  5CC4 A;  1QE6 A;  4JI2 Q;  3I4M H;  3T1Y L;  3QR8 A;  2RHS B;  3MAQ A;  3UDG A;  4B08 A;  2E75 C;  2A6H C;  1D2B A;  1D5M C;  4MTK A;  1WTR A;  1IBL Q;  1EY7 A;  1GUT A;  5T1I A;  5G3L D;  4DXF A;  3A8K E;  4IPD A;  4HAE A;  4POG A;  4X3S A;  2AUJ D;  3GTQ B;  1L1O C;  5JEA J;  3S17 B;  3GTQ H;  3M4P A;  1EYG A;  4HID A;  3OWE B;  3ZJY C;  3H6M A;  3S17 H;  2E2J B;  3TP8 A;  2PYK A;  2E2J H;  1SAP A;  3J7A 5;  4OO1 H;  2F0M A;  5JPM C;  3KK7 A;  4K8J A;  1ONL A;  1LT6 D;  4ULL A;  5IOC A;  2IWH A;  1LAB A;  1BBU A;  4DK1 A;  1WTX A;  5C4X B;  3A5U A;  2FMC A;  1YJ9 A;  1J6Q A;  5C4X H;  2YV5 A;  4FP5 D;  3NQT A;  3DEP A;  2YU9 B;  3RLF A;  3OIQ A;  1YZ6 A;  2OQ0 A;  2RDH A;  4PV1 C;  1SNP A;  2EPB A;  1PTO C;  2YU9 H;  5M3M G;  1IL2 A;  1T9H A;  3LNN A;  2A74 C;  3A0J A;  2RVL A;  2VL6 A;  3CAM A;  2K7V A;  1Q3L A;  4DNR B;  3AMU A;  4KJN A;  1TKW B;  1EU4 A;  4B9X A;  1Q82 C;  1HRJ A;  1G51 A;  4HIK A;  2F0S A;  3WWV A;  5ELC A;  2WAQ G;  1NBW A;  3G4S A;  1C4Q A;  4FXD A;  4HJ9 A;  1GHK A;  5K5P A;  3ULP A;  1IBK Q;  3MXU A;  2B39 A;  5M5X B;  4ZCK A;  2XIW A;  2XRS D;  3S9W A;  5ELF A;  1ESF A;  3G6J B;  4BA1 I;  1W2B A;  4JI4 L;  1Z47 A;  2QKI C;  1LTA D;  1NNX A;  1F77 A;  2ZT9 C;  3CPW A;  1WTQ A;  4QIW E;  2F0V A;  3I4L A;  5AJ3 L;  4LF6 Q;  5FO7 B;  1Y8P B;  4JI8 L;  1CSQ A;  1I4H A;  3A7A B;  5M5Y H;  4DV5 Q;  2FJ2 A;  1GVP A;  2ICE C;  1B2T A;  2F0P A;  4LFA L;  1HTP A;  2BDO A;  4OL7 A;  4DV7 L;  1GUW A;  2V4D A;  1EYA A;  1CM9 A;  3HOW B;  1KLU D;  5IT9 c;  1AE2 A;  3HOV H;  5C44 B;  3JAM i;  2B2V A;  2M00 A;  4DV3 L;  5C44 H;  2PW5 A;  1I94 L;  4C3J G;  1TS2 A;  4LF4 Q;  1PYB A;  1X6O A;  3VYU A;  2UXB Q;  1O78 A;  4IOA A;  3NXW A;  5C5M A;  1EWI A;  3K7A H;  2AKW B;  4KHZ A;  3KF6 B;  3BVM A;  5CYU A;  5TSS A;  1LYL A;  3Q0A A;  4K0K L;  3BYY B;  2OT2 A;  3KDF B;  4BBS B;  1TXY A;  1CI3 M;  1IW7 C;  2ES2 A;  4BBS H;  3CHB D;  1PRT D;  1H95 A;  2NUC A;  1GJX A;  4HJA A;  1JCK B;  4JK1 C;  3OPO A;  1X55 A;  4RKB A;  3I7F A;  5KRU A;  2R93 B;  1B1Z A;  1R4P B;  3BDO A;  2A6E C;  1Z9F A;  4MIU A;  1K83 B;  4M8A A;  5ELN A;  1DOK A;  4XT3 B;  1KAA A;  2H4O A;  4OX9 L;  2NVQ B;  1EOT A;  3CC2 A;  4QMG A;  2NVQ H;  1NE3 A;  1ZKO A;  4A3M G;  2H1E A;  2F4I A;  1HFN A;  2F1M A;  4QB4 A;  3F2C A;  2PQA B;  3W1G A;  2EXD A;  1YIJ A;  1S5E D;  5M3F G;  3L2P A;  2F0L A;  5KIX A;  2K75 A;  4QUF A;  1H9M A;  4KN4 C;  1F2Y A;  1FR3 A;  3I56 A;  4JV5 Q;  5DM7 3;  5I6Y A;  1UE5 A;  1E0B A;  3WDN A;  1TWH B;  4M1U B;  4N9P A;  1B9N A;  4RHR A;  1TWH H;  2AWN A;  2Z8L A;  4ME5 A;  1GUO A;  3I4N G;  2FXQ A;  1LLR D;  1LUZ A;  2YTY A;  5IYD G;  2MFI A;  3DM3 A;  5DM6 3;  4JYA L;  1E1T A;  2ENB A;  1PHJ A;  3U9S A;  3JAM L;  3IKJ A;  2B2U A;  1KRT A;  3OTO Q;  2D2C C;  1B53 A;  5ELB A;  3J81 c;  3IAY A;  2D0O A;  3ND9 A;  4IZ8 A;  1EQQ A;  1V1P B;  2NVX B;  5CV9 A;  1MSH A;  1RKN A;  5M3M H;  1PH8 A;  5K36 G;  4FVM A;  4I7Z C;  2Q2H A;  1K3B C;  1D1I A;  5LL6 S;  1HCZ A;  1MHW C;  3N6R A;  4J15 A;  1XTC D;  4KY6 A;  1IYJ B;  1A0I A;  3BS1 A;  4LF9 Q;  5CBE E;  2UU9 Q;  2B2Y A;  3UI2 A;  4ZUJ A;  3SK6 A;  1DOL A;  1NTG A;  4NW2 A;  4ZLT F;  4XDX A;  1HJP A;  2I07 B;  1JOR A;  4KMU C;  3T16 A;  3QOJ A;  4DFA A;  3PO3 G;  1H9J A;  4IUU A;  1ROD A;  4IQZ A;  4GKK L;  1QUQ B;  1Q86 C;  2DY8 A;  1PH9 A;  4YIJ A;  3NBH B;  1CHP D;  3DLL A;  3HOX G;  1KRS A;  1CKM A;  1YHQ A;  4JI7 L;  4MNO A;  1IYV A;  5CV8 A;  2UUB L;  4IFD J;  4DR7 Q;  4NDX A;  1TS5 A;  4OXP A;  1A2U A;  3VR2 A;  1LTI D;  1Y14 B;  1SYG A;  3EBE A;  3GTP B;  4K8I A;  3M4O B;  2E2H H;  3VA5 A;  3C1F A;  2B2W A;  1VQ7 A;  1E1O A;  3GTP H;  2CWP A;  1FJG Q;  1F2M A;  1KAW A;  1LT3 D;  4DUZ L;  2E2I B;  1EL0 A;  1K0S A;  4GKJ Q;  3ULJ A;  3QJY A;  4WJ3 M;  3K57 A;  5KYL A;  1G29 1;  1KNE A;  2VQE Q;  1P16 A;  3VR5 A;  1W6K A;  5FLM G;  1KDC A;  1PTO F;  2JA8 B;  4GN4 B;  4L63 B;  4C3J H;  3KF8 B;  4JBW A;  3UDX A;  4UP8 A;  4R4T A;  3CF5 A;  1TY0 A;  1ESR A;  2R7F A;  3DXJ C;  3P7J A;  1EYC A;  4H02 A;  4YHH Q;  4L5R C;  2K5Q A;  2ZM6 Q;  1HH2 P;  4AH6 A;  1VS0 A;  3QOL A;  1YNJ C;  2BE5 C;  3SGI A;  2C5C A;  3E9H A;  2MO0 A;  2KOL A;  1STH A;  2TSS A;  2QGQ A;  4PZ8 A;  4N8F A;  2ATW A;  4DV4 Q;  2EJF C;  4HTH A;  3T56 B;  2RCF A;  5C0X J;  1VF5 C;  4WJ4 A;  1QJO A;  2JXM B;  4EX5 A;  4QF4 A;  1WOC A;  2V1C C;  2QIL A;  4A3M H;  2IY5 B;  1V8Q A;  4WRD A;  5M3F B;  2K5V A;  2O5I C;  4K2K A;  2N3S A;  2B8G A;  5M3F H;  1FNW A;  2VB3 X;  1OXV A;  4UP9 A;  1U4L A;  4KLK A;  2UXD L;  3KF6 A;  2KHI A;  5J22 A;  2X69 A;  4DR4 Q;  1Y1W G;  2AQ3 B;  4LUZ A;  5ELD A;  1WFQ A;  3AEV A;  3ONA B;  1LTL A;  3TQY A;  3I4N B;  3EFX D;  5E4X A;  3I4N H;  2MHV A;  2K28 A;  4CDF C;  5IYD H;  1RDP D;  1TWC B;  1PVO A;  2WKC A;  4F88 A;  2Q2I A;  1CTM A;  4HSV A;  1SDF A;  1N36 L;  3C2P A;  5BN3 A;  2K32 A;  2N55 A;  1SMX A;  4XQQ A;  2HUG A;  4BBR B;  1HNX L;  1VQH A;  1UNS A;  5LMN L;  1M4V A;  2WII B;  3P1H A;  3I3C A;  1TWG H;  5K36 H;  1N34 Q;  3HFZ B;  3S15 B;  1HNZ L;  2A8V A;  1PZJ D;  4R4Q A;  2HDM A;  2SNS A;  3S15 H;  2MNA A;  2JA6 G;  2PQA A;  4CJ0 B;  4YCW A;  5GAG C;  1LT5 D;  4JI0 L;  2WAQ E;  1FGU A;  3JAM E;  4A3L G;  5L37 A;  5JVG 3;  5JJL A;  4EQN A;  2HCI A;  2OWO A;  2AUK A;  5J1Z A;  1BKB A;  2JEB I;  3G48 A;  1IHZ A;  5ELO A;  1X54 A;  3PO3 B;  3K8A A;  1VDZ A;  3D4W A;  3KYH C;  3PO3 H;  4NMZ A;  4MTN A;  1VQA A;  2ZXP A;  1VQF A;  5EAY A;  1E2W A;  1TT2 A;  2KJX A;  3HOX H;  2DNC A;  3DHQ A;  3EIV A;  3CRL C;  1V1P A;  3M3Y H;  2EJM A;  3M4Q A;  3H09 A;  1ET9 A;  3FPU B;  1G6P A;  3PO2 B;  5EKI A;  1WTV A;  5M5W B;  1U4R A;  3LGJ A;  2HT1 A;  4CGY B;  1SE3 A;  1Y8N B;  5T1G A;  1VQN A;  2IL8 A;  1DJR D;  1YNX A;  2MUY A;  4X3K A;  3VA7 A;  4IJH A;  4P2C B;  3RN5 A;  3NTH A;  1SNO A;  1Y8O B;  3CCL A;  2VZA A;  4FF4 A;  3S2H H;  4OEL B;  4J6H A;  5FJ8 G;  4L5S A;  5KND A;  1VQG A;  4DR3 Q;  1Q1B A;  4LFC Q;  1MD2 D;  4QL5 A;  5FLM H;  3PUZ A;  1SE4 A;  1QZG A;  1CZG A;  1TS3 A;  2XNA C;  2N8N A;  5DAU A;  3PUX A;  4DV1 Q;  3HEJ A;  4AIM A;  3K7U C;  3NBH A;  4OWW B;  4KJO A;  3Q23 A;  3PIP A;  1FYC A;  1B50 A;  2BA1 A;  4G57 A;  4LUO A;  3E5S A;  2KA7 A;  5DNF A;  4Y52 H;  2CH4 A;  2RF4 A;  1SE2 A;  1LO5 D;  3J7Z C;  2TMP A;  4H44 C;  4DPG A;  3T1H L;  3CW2 C;  4ZKB B;  4CKE A;  3O13 A;  1B44 D;  2F0O A;  1JB3 A;  2L9H A;  3TP7 A;  4GLX A;  4C1N I;  4G7O C;  1K8M A;  4GZY C;  1WTW A;  2PPB C;  4U68 A;  1BCP D;  1ASY A;  4LF8 Q;  1C48 A;  2EY1 A;  3P75 A;  1H9K A;  4RGM A;  1I3Q B;  1G2S A;  2NZ1 D;  1NMG A;  1I4X A;  3KF8 A;  2EQS A;  1VQC A;  1JWM D;  4C2M H;  4R8I A;  1BNZ A;  2NN6 G;  1SJE D;  2PI2 E;  4LK1 C;  3H0G G;  4UHV A;  4A3G G;  4R9W A;  3PF4 A;  1KL9 A;  1Y1W H;  1XYI A;  4JI2 L;  1KNA A;  1PYS B;  1F2L A;  2K4K A;  1TWF B;  4JI1 Q;  2QDL A;  5LMU Q;  1QCB D;  1TWF H;  1VQE A;  1XTD A;  4NXN Q;  1OXX K;  1Q90 A;  1B8A A;  1IBL L;  1XXG A;  3TRE A;  1Q12 A;  2CKZ B;  4LF7 Q;  1XWE A;  4DNI A;  4GOP A;  1PFN A;  5EKK A;  1O7I A;  3UDF A;  4PG3 A;  1JQY D;  4K6L A;  2CQA A;  3EN2 A;  1VQ8 A;  5IY0 A;  1G2T A;  4UY8 C;  2IX1 A;  2L0C A;  4A93 B;  4IUP A;  1BF4 A;  2JA6 H;  2PW7 A;  3PIO 3;  4X66 Q;  1AZQ A;  4YY3 L;  4RG1 A;  1GUN A;  3UDI A;  3CD6 A;  5D3I B;  4BA2 I;  3DUZ A;  3MA2 B;  2JA7 G;  1PXU A;  2R7Z G;  1HA5 A;  2PQE A;  5HGQ A;  4A3L H;  2PI2 A;  4X3T A;  2KEE A;  1C8C A;  3FRP B;  2KCT A;  5H1S E;  5A2Q L;  1PH7 A;  1AEX A;  5C3E G;  1N33 L;  4DNT B;  1WD0 A;  1CFM A;  4TSS A;  1PFS A;  3HGB A;  2B29 A;  4FF2 A;  4KN7 C;  1B9M A;  3S1R B;  2MQH A;  4DXG A;  5BR8 Q;  2LKV A;  1MSG A;  3S1M B;  1S4Z A;  2ID0 A;  1VQO A;  1SSO A;  4LW1 A;  3W5O A;  4IOC A;  4IPH A;  1D8L A;  3S1M H;  2RHQ B;  1QZH A;  2B2V C;  1LAC A;  3CCQ A;  5JOB A;  1S3O A;  1BCP B;  3X3M A;  2EY5 A;  4NP5 A;  1PDQ A;  5E1F A;  1IBK L;  2EY6 A;  4EQO A;  3VR3 A;  3S1N B;  1XX8 A;  3S1N H;  3Q24 A;  2Z6K A;  1FNV A;  3SXH A;  1XMQ L;  3HP3 A;  2A69 C;  1VQJ A;  5KGU A;  5FJ8 H;  2VB2 X;  1DGS A;  1EYD A;  3MFG A;  3BG3 A;  3R8B A;  2Y0S G;  4OO1 I;  2AHO B;  4CBV A;  1U4P A;  4RCN A;  4X62 Q;  4LF6 L;  1IL8 A;  4DV5 L;  1L0W A;  1W3S A;  3H15 A;  4ZQ3 A;  1YNN C;  1SBB B;  2X6L A;  3SDZ A;  1NMF A;  2D0P A;  1UEB A;  2IX0 A;  3CKI B;  3N52 A;  5JEA G;  1CA5 A;  3M7N A;  4DAP A;  2P5Z X;  1UE6 A;  3M4Y A;  3U58 A;  4LF4 L;  2RQX A;  2EYF A;  4ID6 A;  3RNU A;  2JJQ A;  1D7Q A;  4RHS A;  3CCU A;  3MXG A;  1SYC A;  4JPB W;  4DV2 Q;  3FKI G;  1E7Z A;  3MXP A;  2R7D A;  3PUW A;  5IGD A;  1NCV A;  1AZP A;  2K03 A;  3JC6 6;  1NY4 A;  1VQI A;  4E6I A;  3K81 C;  2KEC A;  3W3A A;  1SND A;  4G7H C;  4A3J B;  1DZ1 A;  4A3J H;  2B2U C;  4S3S A;  2NN6 H;  4R4I A;  4A3G B;  1GUS A;  3H0G H;  2WKD A;  3F1Z A;  2F4V Q;  4A3G H;  3I4O A;  3OW7 A;  3K0X A;  1EQR A;  2NB0 A;  3I8Z A;  1PH1 A;  3SVM A;  3ITP A;  4PZ7 A;  1LTT D;  2OTL A;  4DUY Q;  4FO2 A;  1BDO A;  3AFP A;  4DAV A;  3PCO B;  5BN4 A;  5IYB G;  1OXU A;  2ZXR A;  4L6T B;  3W1B A;  4A3I G;  1E3P A;  2B2Y C;  1GUG A;  2L12 A;  4RMF A;  1LTR D;  1SNM A;  2LXK A;  1BBW A;  1WCM G;  3PUY A;  5M5Y B;  1VQD A;  2KEN A;  3NPP A;  4K6D A;  4JV5 L;  1HTL D;  3JAM c;  3A74 A;  1XMO Q;  2J7Z A;  4WOR A;  3GTL B;  2A73 B;  4KV6 A;  2DY7 A;  2A68 C;  1I4G A;  3GTL H;  4A75 A;  3HOV B;  4L5T A;  1KAB A;  2NYZ D;  2E2D C;  2JA7 B;  1K8O A;  3HKS A;  3STB D;  4RA8 A;  3CC4 A;  3M85 A;  2JA7 H;  2VUM G;  1AP0 A;  2R7Z H;  2HDL A;  2NTS A;  1N32 Q;  3OTO L;  5EPJ A;  4B3M Q;  2E74 C;  1Y1V G;  3K7A B;  2L11 A;  1HR0 Q;  1IKM A;  2IPK D;  2L55 A;  3GV3 A;  4HIO A;  5GAE C;  1ILP A;  1CKN B;  4KD3 A;  4BXX G;  2B2W C;  5CV6 A;  1PH3 A;  1OXT A;  1A3U A;  4CKC A;  3BZK A;  2UU9 L;  5IGB A;  5I2Y A;  4CHT B;  3RZO H;  4B3R Q;  2I5H A;  3CCE A;  4B3S Q;  1O7L A;  1FGB D;  1V9P A;  1K0R A;  1TWA H;  4RKL A;  5A2Q E;  3BDC A;  1R9T B;  4G4K A;  4ABN A;  3KBG A;  1R9T H;  3SE0 A;  1QVF A; 
#chains in the Genus database with same CATH homology
 2OTJ A;  3TS2 A;  1GKH A;  3U50 C;  5GAD C;  2UXC L;  4P74 A;  4JOI C;  1U0L A;  1QUQ A;  4A3E H;  1HNZ Q;  2QGQ A;  4OO1 G;  3J80 c;  1EUJ A;  3KLW A;  4PZ8 A;  1HZB A;  1GD7 A;  1XMO L;  4A3B G;  2ATW A;  2A19 A;  2JK8 A;  3PGZ A;  1PH2 A;  1K73 C;  4JI0 Q;  4KHP Q;  3AQQ A;  2MO1 A;  4DV4 Q;  1EFW A;  4DR7 L;  3BZC A;  1V43 A;  3PV0 A;  5C0X J;  4X64 L;  4HJ7 A;  4GN5 A;  3F8T A;  2ZTC A;  4WJ4 A;  5IE8 A;  5C4X G;  4EX5 A;  2RCN A;  4BY7 G;  1E22 A;  3E0E A;  5C4J H;  4A3C G;  4BY1 H;  1WOC A;  4DV0 L;  2V1C C;  4A3M H;  2IY5 B;  2F52 A;  1SR3 A;  1N32 L;  4UP7 A;  5HY6 A;  4KI0 A;  2K5V A;  4A76 A;  1FJG L;  4B3M L;  2UXB L;  2N3S A;  5J3B A;  5M3F H;  1X3E A;  4YY3 Q;  2BH8 A;  5C0X I;  5JJK A;  1OXV A;  3NEN A;  2I5L X;  1HR0 L;  2F3I A;  4GKJ L;  1Q7Y C;  4UP9 A;  4KLK A;  2UXD L;  3KF6 A;  1I50 H;  4IPG A;  2KHI A;  3U4Z A;  4DR4 Q;  4DK3 C;  1Y1W G;  1RL2 A;  4JI8 Q;  4LUZ A;  4DR2 Q;  2VQE L;  1WFQ A;  3AEV A;  1LTL A;  3TQY A;  3ERS X;  3U4V A;  3G71 A;  5IP7 G;  1WI5 A;  3OYY A;  1K9M C;  2NN6 I;  3I4N H;  3CXC A;  4P73 A;  2N78 A;  3CME A;  1N33 Q;  5IYD H;  3PUV A;  4B3T Q;  4JI3 Q;  2BA0 A;  3J81 j;  1S40 A;  1I3Q H;  1NJI C;  1QVF A;  4HIM A;  1LM0 A;  3HOZ H;  1PVO A;  4A3J G;  2PMZ E;  2Q2I A;  1I6H H;  4PZ6 A;  4YHH L;  2ZJQ A;  4B3R L;  2ZM6 L;  1N36 L;  3FKI H;  4B3S L;  1QVC A;  3I55 A;  3K80 C;  1SMX A;  3GDE A;  3CCR A;  4Y7N H;  1HNX L;  1VQH A;  1YJW A;  4X6A H;  1X3F A;  3S2D H;  5LMN L;  3S16 H;  2ZTE A;  1XNR L;  1X56 A;  4OWX B;  4YCV A;  5LMN W;  3CCS A;  1TWG H;  4IJL A;  2N49 A;  4X62 L;  1N34 Q;  1JT8 A;  1IXR A;  3HFZ B;  1HNZ L;  2A8V A;  4R4Q A;  3S15 H;  4K0K Q;  2MNA A;  1CKO A;  1UE7 A;  2PQA A;  2JA6 G;  4YCW A;  5GRO A;  3CCM A;  3CPF A;  3T1Y Q;  3TS0 A;  5GAG C;  1VQP A;  4JI0 L;  4KHP L;  2ZJP A;  4DV4 L;  5IP9 H;  2WAQ E;  1FGU A;  3KJO A;  4A3L G;  4R1J A;  4ALP A;  3M9B A;  3ULL A;  4QY7 A;  5M5X H;  5JJL A;  2JQO A;  1XMQ Q;  2OWO A;  3I2Z A;  2E8G A;  3GO5 A;  1BKB A;  2I5M X;  2JEB I;  3G48 A;  2KHJ A;  5ELO A;  5IYB H;  1OXS C;  1X54 A;  3AYH B;  3E9I A;  4GNX A;  3A5Z B;  3K8A A;  4A3I H;  4MZ9 A;  4A3F G;  3KYH C;  3PO3 H;  1KQS A;  3GTK H;  2AMC B;  3UE1 A;  4MTN A;  1I5F A;  2R6G A;  4A93 H;  3HOV G;  3GD7 A;  3T1H Q;  1VQA A;  1WCM H;  3PF5 A;  2WB1 G;  4JBK A;  5C44 G;  2B63 H;  4A3K G;  1S72 A;  1VQF A;  5EAY A;  4DR4 L;  1SFO H;  4DR2 L;  3HOX H;  3GTO H;  3CC7 A;  3EIV A;  2LSS A;  4JCV E;  3M3Y H;  1A8V A;  3GTM H;  3VDY A;  1N8R C;  3M4Q A;  1JB7 A;  4JC0 A;  5C3E H;  2PNH A;  2XGT A;  4O0A A;  4XIG S;  4IFD G;  3RZD H;  5FLX c;  1G6P A;  5IYC G;  4B3T L;  4JI3 L;  2AWO A;  2NZO A;  4TVA B;  3LGJ A;  4O2D A;  4AYB G;  1VQ4 A;  1XNR Q;  2HT1 A;  3HOW H;  4LF9 L;  1VQN A;  5IWA Q;  3NEM A;  3MEF A;  4BBS G;  3Q8D A;  1YNX A;  4JI5 Q;  2A1A A;  2JA8 G;  4AYB E;  1VQK A;  3H3V H;  1YHA A;  4IJH A;  1Y1V H;  3RN5 A;  3S1R H;  2VY3 A;  1JJG A;  3CCL A;  1MKH A;  1C7Y A;  2VZA A;  1Q46 A;  1N34 L;  3S2H H;  3L0O A;  4JI2 Q;  3I4M H;  5FJ8 G;  4L5S A;  4BXX H;  1VQG A;  2IHE A;  1X3G A;  4DR3 Q;  3T1Y L;  1Q1B A;  4LFC Q;  5FLM H;  4QL5 A;  3UE0 A;  3PUZ A;  2RHS B;  3UDG A;  1QZG A;  1YBY A;  1XJV A;  1L1O A;  2ZJR A;  2N8N A;  3PUX A;  4DV1 Q;  2WP8 J;  1IBL Q;  4AIM A;  3K7U C;  2NVT H;  4OWW B;  3PIP A;  2OQK A;  4NPS A;  4GOP B;  4IPD A;  4DKA C;  4IPC A;  1XNQ Q;  2BA1 A;  2DGY A;  4LUO A;  1A62 A;  4Y52 H;  1VCI A;  4POG A;  4LUV A;  2RF4 A;  3J7Z C;  2R93 H;  1L1O C;  2Z0S A;  5JEA J;  4HJ5 A;  3HKZ E;  4PMW A;  1Q1E A;  1K83 H;  2GVA A;  3M4P A;  4DPG A;  3CMA A;  4HID A;  3ZJY C;  3T1H L;  1EYG A;  3GTQ H;  3S17 H;  4LFB Q;  3CW2 C;  1XPO A;  4GN3 B;  2E2J H;  1PA6 A;  1VQ6 A;  3J7A 5;  4JI4 Q;  3S14 H;  2Y0S E;  4A3B H;  4DV6 Q;  2E5L Q;  1BBU A;  4A3D G;  5AJ3 Q;  3RLN A;  4YWK A;  4GLX A;  1HR0 W;  1CKN A;  2L15 A;  3A5U A;  5C0X G;  1YJ9 A;  1J6Q A;  5C4X H;  1VQL A;  2YV5 A;  1ASY A;  4LF8 Q;  4BY7 H;  4A3C H;  1VQM A;  2K5H A;  2ZTD A;  4LFA Q;  3RLF A;  4X65 Q;  1YZ6 A;  2OQ0 A;  4FDB A;  3D0F A;  3RR5 A;  4QGU A;  2R92 G;  1GM5 A;  2YU9 H;  2JE6 I;  4DV7 Q;  1C9O A;  1NMG A;  4JI5 L;  1T9H A;  5M3M G;  2EQS A;  1IL2 A;  1VQC A;  1HZA A;  4APV A;  1P8L A;  3A0J A;  4C2M H;  2VL6 A;  3CAM A;  1Q81 C;  2NN6 G;  2PI2 E;  1CUK A;  4JBM A;  4DV3 Q;  3H0G G;  1JMC A;  3FHW A;  2VQF Q;  4A3G G;  1X65 A;  4L5Q A;  1I94 Q;  1KC8 C;  2IHF A;  3PF4 A;  1KL9 A;  2OCE A;  1Y1W H;  1C0A A;  2K52 A;  4OWT B;  3RLO A;  4JI2 L;  1Q82 C;  1CSP A;  1PYS B;  1J5E L;  1G51 A;  2K4K A;  3D31 A;  4JI1 Q;  4DR3 L;  4LFC L;  4BBR G;  3F2D A;  5LMU Q;  1TWF H;  5IP7 H;  1VQE A;  1XTD A;  2NVX H;  4NXN Q;  4HIK A;  1OXX K;  1B8A A;  3WWV A;  4DV1 L;  1IBL L;  2WAQ G;  3IRB A;  2I0Q A;  1NBW A;  3G4S A;  1FL0 A;  2VS1 A;  3TRE A;  3J81 i;  1Q12 A;  2CKZ B;  4HJ9 A;  3ULP A;  1IBK Q;  2YTV A;  4DNI A;  4GOP A;  4LF7 Q;  2HIX A;  1XNQ L;  5JJI A;  1O7I A;  3UDF A;  1SE8 A;  2VW9 A;  1FVI A;  2GVB A;  4PG3 A;  2K14 A;  4LFB L;  3EN2 A;  3F2B A;  1VQ8 A;  5IY0 A;  4BA1 I;  5E7N A;  1YVC A;  4UY8 C;  2IX1 A;  1W2B A;  4JI4 L;  2CFM A;  1Z47 A;  4GOP C;  2JA6 H;  4OON A;  3CPW A;  4X66 Q;  4QIW E;  4DV6 L;  4JI6 Q;  2E5L L;  4OX9 Q;  4YY3 L;  4DK6 C;  4RG1 A;  3UDI A;  2HIV A;  5AJ3 L;  1ASZ A;  3CD6 A;  4BA2 I;  1XPU A;  2Q2T A;  2JA7 G;  4LF6 Q;  2R7Z G;  1OTC A;  4A3L H;  5HGQ A;  2UUC Q;  4JI8 L;  1CSQ A;  5M5Y H;  1VQ5 A;  4DAY B;  4DV5 Q;  2PI2 A;  4LF5 Q;  4LF8 L;  1GVP A;  2UUA Q;  2KCT A;  1B7Y B;  4LFA L;  5H1S E;  4X65 L;  3HOU G;  1PH7 A;  5C3E G;  4DV7 L;  1N33 L;  1K8A C;  4JBJ A;  2QEX A;  4JG2 A;  2K50 A;  4YWM A;  4A3F H;  3KFU A;  5IT9 c;  1AE2 A;  3HOV H;  4NB3 A;  3PO2 G;  1PFS A;  3BU2 A;  3JAM i;  2B29 A;  1YJN A;  4DV3 L;  1BVS A;  3H3V I;  2VQF L;  2VUM H;  5C44 H;  3CCJ A;  1K8G A;  4A3K H;  1I94 L;  1QVG A;  4C3H H;  4LF4 Q;  2C35 B;  1PYB A;  1X6O A;  2MQH A;  3M4O H;  2HQL A;  5BR8 Q;  2UXB Q;  4JYA Q;  2ID0 A;  1VQO A;  4JI1 L;  4IOA A;  4IOC A;  4LW1 A;  2B3G A;  1HZC A;  4IPH A;  1D8L A;  1EWI A;  3W5O A;  4NXM Q;  3S1M H;  3K7A H;  2RHQ B;  2AKW B;  1Q8K A;  4LWC A;  4GS3 A;  4NXN L;  2E2I H;  2UXD Q;  4KHZ A;  3KF6 B;  4GLA C;  3HOY G;  1E24 A;  5IYC H;  4POF A;  3STB C;  1LYL A;  1QZH A;  4GLV B;  2EIF A;  3I4M G;  4K0K L;  3GTJ H;  3CCQ A;  1S3O A;  4B3R Q;  1B70 B;  3KDF B;  1TXY A;  3KJP A;  2JA5 G;  1IBK L;  4LF7 L;  2XTI A;  1PH4 A;  2ES2 A;  4BBS H;  4DAM A;  1H95 A;  2JA8 H;  4HJA A;  4A3E G;  1SRO A;  1M90 C;  3S1N H;  1AH9 A;  2Z6K A;  4QJF A;  1XMQ L;  1X55 A;  3HKZ G;  3I7F A;  2BH2 A;  3PIO A;  1VQJ A;  5LMN Q;  3PSI A;  5FJ8 H;  1Z9F A;  1DGS A;  5ELN A;  1V1Q A;  2Y0S G;  4AQY Q;  4OO1 I;  2AHO B;  1UWV A;  4OX9 L;  1PH5 A;  4BY1 G;  3CC2 A;  4X62 Q;  1MJC A;  1NE3 A;  2YYZ A;  2Z6K C;  4A3M G;  1X9N A;  4LF6 L;  2NVQ H;  1IZ6 A;  2JA9 A;  3NEL A;  2UUC L;  3S1Q H;  3F2C A;  1SRU A;  3TEH B;  1HNW Q;  2PQA B;  1L0W A;  2EXD A;  3W1G A;  1W3S A;  4DV5 L;  3H15 A;  1YIJ A;  1KXL A;  3CP0 A;  4R4C A;  4R4O A;  5M3F G;  2UUA L;  4LF5 L;  3L2P A;  4GKK Q;  2K75 A;  2KCM A;  3I56 A;  1NMF A;  2D0P A;  1UEB A;  2IX0 A;  2JEA I;  4JV5 Q;  3J80 i;  4DR5 Q;  2LXJ A;  4A4I A;  1UE5 A;  5JEA G;  4JI7 Q;  2UUB Q;  5IWA L;  1KHI A;  3M7N A;  1TWH H;  2AWN A;  3S24 A;  1UE6 A;  4QQB X;  3U58 A;  4GNX B;  2FXQ A;  2CCZ A;  3BJU A;  1JE5 A;  1LUZ A;  2YTY A;  5IYD G;  4LF4 L;  5BR8 L;  2MFI A;  3HOZ G;  3RNU A;  3DM3 A;  4JYA L;  2JJQ A;  5DLQ E;  3KOJ A;  1E1T A;  3CCU A;  1D7Q A;  4A3D H;  1IBM Q;  4NXM L;  4DV2 Q;  1PHJ A;  1UE1 A;  3FKI G;  1E7Z A;  3B6Y A;  1KRT A;  4HJ8 A;  2R7D A;  3OTO Q;  3PUW A;  3G6E A;  3ICE A;  4EQ5 A;  3J81 c;  3JC6 6;  2D0O A;  4YWL A;  1NY4 A;  4DUZ Q;  1VQI A;  3OW2 A;  3KDF A;  1EQQ A;  4P75 A;  1VQ9 A;  2D62 A;  2GN5 A;  2R92 H;  3K81 C;  1KIX A;  1L2F A;  5K36 G;  5M3M H;  1PH8 A;  1HZ9 A;  2Q2H A;  4A3J H;  1VQB A;  4J15 A;  4R4I A;  1IYJ B;  1YHB A;  1TWC H;  1A0I A;  3CQZ H;  3F1Z A;  3H0G H;  4LNQ A;  3I4O A;  4LF9 Q;  2WFW A;  2F4V Q;  2UU9 Q;  3K0X A;  1EQR A;  5IP9 G;  3GTG H;  1K3R A;  4IO9 A;  1PH1 A;  2DUD A;  1A63 A;  2H5X A;  1NTG A;  4BBR H;  4PZ7 A;  2HHH Q;  2OTL A;  4AQY L;  4DUY Q;  1EOV A;  3AFP A;  4DR1 Q;  1HJP A;  3PCO B;  5IYB G;  1YEZ A;  1OXU A;  2NVY H;  2IT1 A;  4DR6 Q;  3W1B A;  4A3I G;  1E3P A;  2K5N A;  1JJC B;  1U5K A;  5GAH C;  3PO3 G;  4RMF A;  1HNW L;  3AFQ A;  4YCU A;  4A93 G;  2QA4 A;  2VNU D;  2UXC Q;  2LXK A;  1BBW A;  1WCM G;  3PUY A;  4GKK L;  1L1O B;  1QUQ B;  1VQD A;  2KEN A;  2B63 G;  3L7Z C;  4UPA A;  3ER0 A;  1Q86 C;  1PH9 A;  4JV5 L;  3NBH B;  4DR5 L;  3JAM c;  3A74 A;  3HOX G;  1KRS A;  1CKM A;  3DLL A;  1YI2 A;  1XMO Q;  1YHQ A;  4JI7 L;  4MNO A;  2UUB L;  1M1K C;  4IFD J;  4DR7 Q;  1MIU A;  4TQU S;  4X64 Q;  1WYD A;  3GTL H;  4OXP A;  4A75 A;  4L5T A;  4A3G H;  1Y14 B;  2Q2U A;  4C3I H;  5GQO A;  3HOW G;  1IBM L;  3HKS A;  3STB D;  4DV0 Q;  4DV2 L;  3CC4 A;  3M85 A;  3EBE A;  2JA7 H;  2VUM G;  2NZH A;  2E2H H;  2CQO A;  2R7Z H;  4XTC S;  1N32 Q;  2YTX A;  1E1O A;  3OTO L;  1RIP A;  2CWP A;  1VQ7 A;  3GTP H;  1EIY B;  1FJG Q;  4B3M Q;  1AE3 A;  1KAW A;  4IFD I;  1Y1V G;  2WB1 E;  1N9W A;  4P72 A;  4DUZ L;  4GNX C;  3RN2 A;  3HOU H;  5LMU L;  3I4N G;  1YIT A;  1HR0 Q;  4GKJ Q;  3ULJ A;  4WJ3 M;  4P71 A;  4HIO A;  1PH6 A;  5GAE C;  1PV4 A;  1CKN B;  4ME3 A;  4BXX G;  1G29 1;  2VQE Q;  3PO2 H;  1P16 A;  1GO3 E;  5M5W H;  5FLM G;  1PH3 A;  2F4V L;  1OXT A;  3BZK A;  2UU9 L;  4GN4 B;  1XPR A;  1KD1 C;  4C3J H;  1EIF A;  3KF8 B;  4JBW A;  3UDX A;  4UP8 A;  4R4T A;  3CF5 A;  1SLJ A;  1WJJ A;  3MXN B;  4JOI A;  3CCV A;  1SN8 A;  2R7F A;  4YHH Q;  1MJE A;  2HHH L;  4L5R C;  4H02 A;  3RZO H;  2I5H A;  2ZM6 Q;  3CCE A;  1HH2 P;  4AH6 A;  4DUY L;  1VS0 A;  1N36 Q;  4B3S Q;  1R9T H;  2KBN A;  1V9P A;  3SGI A;  4DR1 L;  1JJ2 A;  3HOY H;  3TRZ A;  3E9H A;  1K0R A;  1TWA H;  2MO0 A;  4DR6 L;  1HNX Q;  2R93 G;  1J5E Q;  2ALY B;  2ASB A;  2CWA A;  4X66 L;  4JI6 L;  3FP9 A;  2JA5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...