2Z9HA

Ethanolamine utilization protein, eutn
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein eutN
publication title The crystal structure of ethanolamine utilization protein EutN from E. coli
rcsb
source organism Escherichia coli
total genus 16
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2z9hA00
2QW7A 2HD3A 4N8X1 5L37A 4JVZA 2RCFA 4I7AA 4JW0A 2Z9HA 4N8FA
chains in the Genus database with same CATH superfamily
5DLQE 1N36L 2J0TD 4IPCA 5EPJA 1B44D 3K7UC 1J8IA 1NR2A 3K5NA 4HMIA 1SYDA 2ICEC 3DWQA 3GO5A 5LL6S 4U673 3T1HQ 4A3KB 1VQLA 1ENAA 4F88A 3BVGA 1U4PA 1N33Q 2B3GA 2CCZA 2XRQD 4P72A 5T1IA 3J7A5 3NBHB 5KGUA 2ATWA 1MI2A 1JWUD 3CCMA 1GUGA 1HZCA 3CRKC 1KNAA 1IW7D 3B6YA 2GN5A 2CFMA 4GOPB 5IGBA 4ZK9B 5C4JH 4NXML 1VCIA 2A74C 2JA8G 2VXWA 2A69C 4LMQD 5C5LA 2WAQG 4KV6A 4LFAQ 1MJEA 1SXTA 4GN5A 1VQFA 1UE7A 3S17B 3VR4A 4KKTA 1U5KA 2K5VA 3OW7A 3D4RA 4G7OC 1VQ8A 4CJ0B 4BY7H 1G2TA 4ZQ3A 4JBWA 3FKIH 1UE1A 3S2HH 2F0NA 4HCEA 1SYCA 4KKSA 1PXUA 1A3TA 4YWKA 1U0LA 2B63H 2WAQE 1JJCB 2F0LA 3VA7A 2NN6I 2KCNA 1EOTA 3HOVH 2JA5B 3I8ZA 1BR9A 2AWNA 1Q8KA 2DGYA 2E2JB 1I6HH 2AUKA 1PH5A 3S16H 3FPPA 2JA7H 5IGCA 1VQBA 4NXNQ 1JT8A 4JI2Q 3F2CA 1B1ZA 3MFGA 1AZQA 2CH4W 4WJ3M 2GVBA 2K05A 4DAVA 3PIO3 2MHVA 2DNCA 5HY6A 1H9SA 1XJVA 1HNWL 4OO1G 1K0SA 1EY8A 2WB1B 5D3IB 4A3IG 4P2CB 2EYHA 2K6AA 2MJ8A 4GLVB 2K1BA 2F0SA 3E3XA 1PRTF 4MTNA 3KF6B 3BG3A 1SMYD 2K5QA 3H09A 4BXXG 1OTCA 4A3KG 3KBGA 1QILA 4DNRB 3F2DA 1PTOD 2OCEA 3GTLH 1KNEA 1YZ6A 4JYAQ 1K8MA 2UXBQ 3GDEA 2IX3A 1YVCA 5GAEC 2EYPA 2L1BA 1J5EL 4ZUIA 1VQ4A 1BQQT 1Q8IA 1PMRA 3HZXA 3A5ZB 3NWTA 3URYA 2I46A 1EY7A 3OIPA 2JXMB 4DPGA 3GP7A 4DNIA 1XMQQ 2HIVA 4OELB 3JAME 1HPCA 1LT4D 2F3VA 3MXPA 4A3FB 4IZ8A 4A3GG 3QB3A 4LUVA 3J7AF 1GO3E 2YV5A 2ZTEA 1PH4A 3H3VC 1TQOA 2N49A 5J3BA 2F0TA 4ME3A 2AHOB 3PF5A 2Q2TA 2OT2A 4YWLA 2F0MA 4G57A 1HUNA 3FEWX 2WINB 3RMHA 2LFNA 5DM63 4FXDA 1BCPF 1E24A 3R8BA 3A8JE 3M3YB 3QR8A 4XT1B 5K36H 3L9AX 3RLOA 1CKNA 3DHQA 3U58A 4PG3A 1XNQL 3A7LA 2IX0A 1QZHA 4A3BB 4HIKA 1U4RA 1EEFD 3EIVA 2XTIA 2A5HA 2ENBA 3SGIA 3WDNA 3RN2A 2I5MX 1PH7A 1IYVA 4IFDH 2RQXA 3PO2H 1UE6A 1CFMA 3CPWA 1Q81C 3K59A 3RLFA 3Q8DA 3EFXD 4GKKL 1UAPA 4JV5L 3BDCA 2ZXRA 3K8AA 5E3FA 1KC8C 4DNTB 3H6MA 2UXCL 2V4DA 3OMGA 3SR1A 3EVQA 3AEVA 3GV6A 1O7LA 1DJRD 2KECA 5FK9C 1Y1VB 1GHKA 3LWUA 4POGA 1JE4A 5IP9H 3GTOB 2WB1E 4JI8L 3H3VH 5IOCA 1RIPA 2PQAB 4JI6L 1JC7A 2OTJA 1HH2P 2NVTB 3H15A 1PH1A 3HKZB 4N9TA 1LTID 1A2TA 3QIAA 4C56C 3CCUA 2B2WC 3BVMA 3VR5A 4UP7A 4B08A 4IQZA 2CW0D 1SNMA 3D4WA 4A3FG 1VS0A 1FGUA 2ZXOA 3G6EA 4GOPA 4RGMA 4EQNA 1DGSA 3J80E 5ELBA 4LNQA 3S1QB 1KTKA 3T1HL 3PO3H 2CHBD 5JPNC 1A62A 2GA4B 3GTPB 1WTWA 4J1MA 4BBSG 1EQRA 3NXWA 1OXVA 1N33L 1IL2A 2RCFA 1TWGH 5DEHA 1QOHA 2CKZB 3T51B 1Q12A 2CWPA 1UUPA 2I07B 3A56A 3BYYB 1B8AA 2CQAA 4TQUS 1M90C 2WKCA 3HRZC 3EA6A 5C4XB 3LWEA 1HZ9A 2RSNA 1FR3A 4A3BG 1I50H 3DXJC 3AFPA 1TWAH 2DJFC 3W1BA 4PNYA 2H5XA 1BCPD 5A2QL 5C44B 3FDTA 1BXTA 4JPBW 4KHZA 4K2LA 1F9RA 1SYEA 3RZOB 4KJNA 4EGVA 1LTAD 2VUMB 2PI2A 4RKLA 2VW9A 1C4QA 2L5TA 1Y14B 4KLKA 3M4OB 4X66Q 1HZBA 1V1OA 1Y1VG 4XQJA 4K5XA 4TRDA 2B8FA 1PZKD 3ER0A 2A73B 4A76A 3TEHB 4CHTB 3PUZA 3BJUA 2R7ZH 4APVA 5LMNQ 1HNZQ 3K5LA 1SMXA 3AMUA 1PLFA 3HKZG 3CCJA 2KEEA 5HGQA 1EU4A 2JEBI 1BBUA 2K5HA 1C9OA 1CZGA 1VQPA 1GM5A 1PV4A 4RG1A 1N32Q 2EPBA 2OF1A 3PCOB 2CVRA 2PZTA 4RHRA 2UUCQ 1EWHA 3NQTA 5CV7A 4EQOA 5JJZA 4F7XA 1LTLA 4OWTB 4UPAA 2Q2HA 1VQDA 1AE2A 3S1NB 2EQSA 3HKZE 1HR0W 1E2VA 1KDCA 3BZKA 4DUZQ 1CSPA 3PUYA 3PV0A 4ABNA 3LNNA 3TRZA 1RODA 4XQNA 4DGZA 2DJGC 4DV3Q 2YTYA 4DK6C 1VQ7A 5IGFA 3CCSA 1T5XD 4BXXH 3HS0C 5CR3A 1D2BA 4N9PA 2NB0A 1B3QA 1MBYA 5GAGC 4LF5Q 3QOJA 5H1SE 1V1PB 3MXNA 2NWGA 4JOIA 1X54A 4FXGC 1WTRA 1PYSB 4B9WA 1HQRD 3A55A 1XMQL 4DV0Q 2Z1CA 2EYMA 2SNSA 5C3XA 1N34Q 1I4GA 4O0AA 3NHHA 3PGZA 2EYOA 3P7JA 5IT9L 1TT2A 3TZUA 4DR7L 3BS1A 4NMZA 2F4IA 4C1NK 4HN7A 2OXPA 1X56A 1X6OA 1M1KC 3STBD 4ILWA 1JR0D 3MHBA 3I4NB 1LLRD 3D6CA 1KXLA 1VQHA 1ICWA 2C35B 3S17H 1J9OA 1VQ9A 5JVH3 1P16A 1NR4A 4DA2A 1Z6HA 4A3MB 1B70B 1N9WA 2DY7A 1HRJA 2F3WA 3VYTA 3V96A 1YNXA 5C3WA 4OL7A 5CV9A 2M00A 5EPKA 5FO7B 1HR0L 3G7LA 3M7NA 1NAPA 3J81i 1Y8OB 1YEZA 1JOQA 1S5CD 1CQFA 1Y1WG 4RCNA 3KLWA 3NBIA 4LF7Q 1V9PA 3ONAB 4PZ7A 5F2DA 4FYDA 1S5BD 2JA5H 3A0JA 5IYBG 1BNZA 1JJ2A 2E2JH 3FRPB 2AMCB 4IUTA 5CV6A 2PQEA 2JN4A 2NN6G 4DKAC 3M85A 1KIXA 1I94L 4KN7C 5EJWA 1MHWC 3KYHC 1KD1C 4A93H 3NTKA 3AU7A 3BU2A 4V0BA 4C3JB 4JBMA 5C0XI 1FYCA 5JAVA 1A3UA 4WJWA 4DV4Q 3AB9A 3HG9A 2F0GA 2L0CA 1UNSA 4FF4A 2EYFA 3P1HA 1EYGA 1AZPA 1ESFA 1EEID 3ICEA 4LAAA 2R93H 2KCCA 3D4DA 3F2BA 1STAA 3NENA 3TP5A 5IYDG 1VQGA 1TKWB 1PFBA 1U4LA 2BCOA 4RWSC 5M5YH 5G3LF 3BZDB 3S2DB 2FHTA 1STEA 1LUZA 2RHQB 3MFYA 4P71A 1IKMA 2A6ED 5J1ZA 3U9OA 1QVGA 5IYCG 3I55A 4IUQA 2JP1A 2Y0SB 3BDLA 4DV2Q 2I0QA 4YCWA 1TR5A 1QVFA 3KLSA 2B8GA 2AQ2B 3HOYB 3TZDA 5LMNW 4HEDA 3CXCA 5M3FG 3TS2A 4OIJA 2EIFA 3OHXC 5BN4A 1JQYD 4A3EH 2R92B 4A3MG 3CD6A 2MO0A 2B39A 2ASBA 3G71A 1RJTA 1OXUA 2BOSA 4OHJA 4CGYB 2IW3A 3I73A 3J81L 2L12A 2BA0A 1V1QA 1TWCB 1TS3A 3GV3A 3H0GB 5CV4A 4KHPQ 3HOZB 4K14A 1XYIA 1B9NA 4LW1A 2PNHA 2ES2A 3I90A 3NP8A 1R9TH 1Q1BA 1GKHA 4JCVE 4JI5L 1WTQA 4A3BH 4C3JG 1QZGA 4L5RC 4A4IA 2F0VA 5CYUA 3HP3A 3TN2A 2WV6D 1IZ6A 2EY5A 2JA8B 4I65A 4DK0A 1CA6A 2KVMA 1SJED 1TVXA 4L63B 3CW2C 3QOLA 1X32A 4OONA 3PIP3 4N8X1 5LMNL 1HNZL 5JJKA 1JCKB 1CUKA 2F0FA 2E5LQ 3L7ZC 2V1CC 3HOWB 1PRTC 2QEJC 1YNND 4BA2I 4OGQC 3K0XA 4JW0A 4CDDC 1Y1VH 2OTLA 4CDEC 1N32L 4ZLTF 3JAMc 3GTOH 1WTOA 4BBRB 1K8OA 1DOMA 2Y0SG 2BE5D 2NVTH 2SOBA 5M5XB 4MN3A 3T56B 2O5IC 5EBDA 4IALA 1ASZA 3OW2A 4BY1B 4ZYSA 5LMUQ 5M3MG 5ISRA 1PH9A 1ILPA 5G3LD 3UE0A 4DV3L 3FPUB 1WYDA 3S1QH 2ZXPA 1SE4A 1VMCA 3SE0A 4LF5L 5E4WC 1K83B 2F0WA 2Y0SE 3RLNA 4JK1C 5GADC 4U68A 1FNVA 1FVIA 4O2DA 5ELFA 5J22A 1WCMB 4DV0L 1TWFB 1H9RA 1KAAA 1NY4A 1SE3A 3W1GA 3C3LA 1N34L 3H0GG 3HOZG 4QCLA 2ALYB 2VB2X 1W3SA 3W2DA 4KD3A 4UAIA 3UE1A 1L0YB 1FD7D 2KJXA 4JC0A 2IY5B 1KDAA 4Y52H 1BCPC 4AQYQ 3U50C 3A7AB 5C4XH 4IN3A 3S9WA 2ZM6Q 1UEAB 1STGA 4B3TQ 1VF5C 2E2HB 1JB7A 1KHIA 3SEBA 5FO8B 3I56A 1EY6A 1F2YA 2O5JC 1CQVA 3NSWA 3FP9A 2YU9B 3HOUB 1L0XB 2LY7A 3SVMA 3K5OA 2M2LA 3DMUA 1D7QA 3HOXG 5C44H 3Q6SA 3CCVA 2SDFA 4K6LA 3LGJA 4A3GB 3RZOH 5CBEE 2VUMH 1A0IA 3HOWG 3U9SA 4LF7L 3M4OH 1FGBD 4C3IG 2ICIA 1L1OB 4LF9Q 3MEFA 1ZYRD 3KFUA 2IPKD 1NSNS 4BBRG 1D5XC 1NUCA 3TP7A 2MO1A 3J80c 1QUQA 2E2DC 4L5QA 4DV7Q 2E2IB 4C3HB 4FF3A 3CU7A 4DV4L 4IUNA 1SFOB 4NB3A 5IYBH 4BY1G 4HAEA 3K7AB 1QVCA 2B2YC 3PUVA 2B2TC 3Q24A 3I4MH 1GVPA 1TS4A 3HEJA 1BF4A 3GD7A 3S15B 4XYOA 2R6GA 4A3JB 2NYZD 3UDGA 1Q7YC 2HUGA 3G6JB 1F2LA 4FO2A 4AIMA 3S1NH 1F2MA 3ULJA 4UDUC 1WCMG 1RTOA 4C2MH 2F0JA 4P75A 1PH8A 2QDBA 3BYTB 1O80A 4L5SA 1VQ5A 2XWJB 1S5FD 2ZJRA 3ND9A 1B3AA 2Q2UA 4DV2L 3ULPA 4RGOS 4BWGB 4LF8Q 5FLMG 3QO2A 1SROA 3HGBA 1VQ6A 5TSSA 2CQOA 2F0HA 4FXKC 2MNAA 1EQVA 1S5DD 1UEBA 2C9OA 4QMGA 1TWHB 3HOUG 3GTQB 1VQMA 3HFZB 5C4ZA 2WIIB 1STHA 2WACA 1RHPA 1CKOA 1RDPD 5I6WA 3KK7A 4ZKBB 2JA6B 1NCVA 2K04A 3I4NH 1V8QA 1SE8A 3C1EA 2Z8LA 4JVZA 2B2WA 3MA2B 4KKUA 2K01A 4DR7Q 4KHPL 2D0OA 2N55A 2PZWA 4JI3L 2L9HA 4JI4Q 4A3MH 1C0AA 5IODA 2RCNA 2B2UC 4YHHQ 4BBSB 1EYDA 1JICA 3R3OA 1SE2A 2E74C 2NTTA 3NPPA 3IRBA 1PTOB 2PNRC 3SK5A 5E1FA 1YHQA 3PIOA 4A3CG 5FLXE 1LT3D 1CZWA 2HCCA 4C3HG 1P8LA 1EWCA 3VR3A 1RCVD 1HR0Q 2D0PA 3ERQA 2EJMA 4ME5A 1FNWA 5C3EG 1H9KA 5JEAG 3KBXA 4LFCQ 3J81E 1X9NA 1SNOA 2HD3A 1WD1A 1STYA 3W5OA 4A3JG 2B2VC 4C3JH 2OWOA 2E5LL 4ZRZA 1EOVA 2Z4IA 1B2TA 2D5DA 1VQIA 4IFDI 1I94Q 1AE3A 5C0XG 3SK4A 1HZAA 2F0KA 3TQYA 3T16A 2A68D 3E9IA 4NDXA 1NTGA 1II3A 4K8IA 4DAMA 3IFDA 1CHQD 2E8GA 1S5ED 2B29A 4DK1A 3N52A 4B3RQ 4RGNA 2EOTA 1EY4A 1KDBA 5LMUL 5EAYA 2UUBQ 1PYBA 4B3MQ 3S2DH 3H3VI 1SSOA 2Z6KC 4X62Q 5J39A 1TS5A 5GAHC 3NBHA 1KRTA 1K73C 4DAPA 1SYGA 4C1NI 1VQAA 1N8RC 4KY6A 3CF5A 3EJIA 1OXSC 2JA6G 3HOYH 5JEAJ 2A19A 2I5HA 4GS3A 2BDNA 5CV8A 3KF8B 2YYZA 1JB3A 1LABA 1XPRA 2R92H 5EBCA 4GLAC 5C0XJ 3J81j 2QF7A 4AQYL 2R7FA 3CCQA 2ZM6L 4A3DB 4B3TL 3S1RB 2L4NA 4CJ1B 1XX8A 4XXEA 1TWCH 1QNUA 4Q5VA 4JI7Q 3IAYA 2MFIA 4HJAA 3HOZH 1CT1D 4IUVA 5ELEA 1PRTB 2C5CA 4M1UB 1E7ZA 1SAPA 3U4VA 5IIFA 5FJ8G 3L2PA 3WOFA 3P75A 2MGSA 4DR2Q 4POFA 1MJCA 5FKAC 1IKLA 2VQEQ 4GNXC 2F0DA 1ICFB 5EKIA 3RZDB 3DM3A 4NP5A 1VQEA 1Y69U 4HSVA 1YNNC 3A74A 4JG2A 4QB4A 4LF9L 5ELNA 4OWWB 2JSOA 2JA8H 4JI5Q 2F0OA 3KDFB 5HURA 1EYAA 4GKJQ 2O4XA 3DEPA 3KF6A 4DV7L 5C4JB 1AH9A 1CHPD 1OO9B 1HTLD 2XNAC 1TS2A 2RBMA 5AJ3Q 4NKLA 3T1YQ 3HKSA 1Y1WB 1YJ9A 1X55A 4BBRH 4RFBA 2XGTA 4WORA 2X6LA 2K5WA 1XPUA 3C1FA 1GUWA 2A1AA 2A69D 5M5XH 3I91A 1IBLL 4CDCC 4K6DA 2K7VA 1BCPB 3RD4A 4BY1H 4DR1Q 4TSSA 3FMCA 4KTAA 1EFID 1S4ZA 1CSQA 4FDBA 2R61A 3IKJA 1E2WA 1L1OC 1WVLA 4OO1H 2MPMA 2NVYB 3K58A 5KNBA 1K83H 1WD0A 2EVBA 4IPDA 4A3IH 1YITA 4LF8L 4K5WA 1SLJA 1WCMH 4A3DG 1TWFH 1Q82C 1Q1EA 3I72A 4TKOB 2PW7A 1ET9A 4A3KH 1RD9D 2SNMA 1DCZA 2WKDA 3G48A 4G7ZC 1IW7C 4DR3Q 4LF4L 2J4XA 1T5EA 1GJXA 3OIQA 2AQ1B 3PMFA 1LT5D 4QGUA 2E2HH 1B53A 5M9OA 4OWXB 4JI4L 2YU9H 2XVSA 3HOUH 3TS0A 4YHHL 5E4XA 5M3FB 2F0IA 1IBKQ 4A3GH 1ESRA 2G9DA 1IXRA 1A3VA 3PSIA 1YHBA 5FOBB 3AFQA 4P73A 1VDZA 3GTGB 4LK1C 2P5ZX 3I4OA 1HFNA 3IL8A 3CC7A 3ITPA 3CQZB 1AEXA 4PZ6A 1GUNA 3AQQA 1PFNA 1W6JA 1KQSA 2EYLA 4LFCL 4R9WA 1LACA 4PMCA 3EQLC 2PQAA 2Q2IA 1DXMA 2ZJQA 2YTVA 3PF4A 2E2IH 1L2FA 4C3HH 3VR2A 1SFOH 3GQBA 5D65A 3MXGA 4LUZA 2RF4A 1XNRQ 1O78A 1PFMA 1HNXQ 2B63G 3K7AH 1PA6A 1PHJA 2UUAQ 2AQ3B 4RCOA 2JJQA 3GTJB 3HOVG 4I7ZC 1SJHD 1SMYC 4EQPA 2PO4A 1Z47A 3S15H 2F0UA 1D5MC 4A3JH 2EY1A 2JA7G 1PTOC 1AN8A 1R4QB 4B3RL 1GUTA 2UUBL 1CKMA 4B3ML 3EBEA 5JJIA 4DK3C 2ZTCA 1BVSA 3W3AA 4X62L 1EWIA 1G91A 1HXYD 2XWBB 1NNXA 1TIID 4A3LG 3X3MA 1LM0A 2QILA 2JE6I 5CORA 1JJGA 5DM73 1XTDA 4OIKA 4ALPA 2VQFQ 1EIYB 1CI3M 3BVZA 1I3QB 4J6HA 2ID0A 5A35A 1TWHH 3CC2A 3GTQH 1A6XA 3JAML 2TMPA 1K3RA 1LTTD 2ZT9C 3A54A 4X3TA 4YIJA 4R4TA 1QB5D 1VF7A 5M3MB 1DM0B 3EN2A 5IGDA 4A3FH 2JA6H 1XWEA 4H13C 1SEBD 1QCBD 4WFN3 2UXDQ 5BN3A 4LFBQ 4JI7L 5IE8A 2IWHA 1X3FA 4LUOA 4OEMB 2A8VA 4X3KA 1G291 2FXQA 4X64Q 4HJ5A 2JEAI 4F8MA 4BBSH 1H9SB 1GUOA 1FL0A 3I7FA 4DR2L 1C8CA 1PTOH 4QUCA 4UP9A 1A2UA 1PH6A 2TSSA 3A8IE 1BKBA 4JI3Q 1QG7A 3NUCA 4L8JA 2VQEL 3M3YH 3I2ZA 1HHVA 1X3PA 3K81C 4DV6Q 4AH6A 1QJOA 4XYQA 2FMMA 2KUMA 1E1OA 3TP6A 1Z7TA 4ODGA 4IUPA 1YNJD 2RA4A 2MP1A 5NUCA 1K8GA 3EROA 3O13A 3V2TA 1AFPA 4NPSA 2OQKA 4EX5A 1QWYA 1DOKA 1YHAA 2VNUD 5K36G 1IYJB 2D62A 4JBJA 4GKJL 2KHJA 2A68C 4PZ8A 5EQ0A 4KD4A 3HOXB 2EYJA 2MUYA 3JC66 3FVQA 1JE5A 1EQQA 1LTGD 3OPOA 4ZCKA 5JVG3 5AJ3L 5COYA 1O7YA 3OOCA 4KJOA 3E0JA 4YY3Q 2H4OA 3T1YL 3M7GA 4XQQA 2Z0SA 1KL9A 4R4QA 2IJ0A 2IT1A 1K0RA 3DWPA 5HGTA 4IFDG 3PO2G 1SNCA 1LTBD 2RKSA 4C3IB 5A2QE 1IYUA 3C46A 3KUPA 1G6ZA 1VMPA 2HT1A 5AFWA 1JORA 2UU9Q 2CW0C 1V1PA 2K03A 4DR1L 1HUMA 3A8KE 4RHSA 2I5LX 3VYUA 3CCLA 1EL0A 3LX0A 1I4RA 4DV1Q 2NZOA 3MEHA 5IP9G 4DAYB 1O7IA 2J7ZA 3D8GA 1LO5D 1KLGD 2AUJD 1XMOL 2FJ2A 1CKNB 4F87A 1Z9FA 3DLLA 2AKWB 2L55A 5BR8L 4MZ9A 5FLXc 2Z9HA 3L0OA 4R4OA 2RHSB 4GNXB 2B2YA 4DR3L 3GTPH 1YJWA 2B2TA 3V05A 2NVXB 3NTHA 5CMDA 1EY0A 2N88A 1JOOA 5EGTA 3IFTA 1QE6A 4KK7A 5EPLA 3PO3G 4IFDJ 3E0EA 4A3DH 5IY0A 4R4CA 1ZXTA 1X65A 5ELDA 3J81c 2N78A 2NUCA 3WWVA 1PH3A 5EKKA 2XRSD 2LXKA 4YWMA 3I70A 4H02A 1K3BC 4Z9CB 3PIPA 1CK1A 4PV1C 4HIOA 1IBKL 5I9OA 1GOZA 4JI1Q 3H91A 1PH2A 4RMFA 1ET6A 2ZJPA 4R8NA 3RZDH 3VDYA 1BOSA 4JI0L 4ID6A 3NK9A 3TP8A 1VQOA 2A6HD 4G4KA 3KLSX 2LSSA 3SK8A 2HQLA 4X3SA 5BN5A 1FNUA 1SR3A 4UY8C 1Q90A 4E6IA 5K5PA 4K0KQ 1BUVT 1YJNA 2Z4HA 5IT9E 1WJJA 5JOBA 1ENCA 2K32A 5IWAQ 3MXUA 4ZKCB 2IHEA 1B50A 1E1TA 1WTPA 1XNRL 4DR4L 1ZEQX 1HNXL 1EY9A 1NE3A 4IJLA 2UUAL 2BA1A 1HTPA 2B2UA 1STBA 2F1MA 1Y1WH 1JOKA 3G4SA 1MIUA 2OQ0A 2AWOA 5KNDA 3ND8A 1K8AC 3T13A 4X65Q 2R7ZG 3CPFA 5C3EB 5CC4A 1RF2D 2NN6H 3NTIA 1X3QA 1HJPA 3BZCA 1M8AA 4CKCA 1J6QA 3GTMB 1SN8A 2RDGA 1IBLQ 1C48A 2NVYH 4G7HC 3N6RA 4HR7B 1F77A 4A93B 1A15A 2B2VA 2O2LD 3SXHA 2PPBC 2VQFL 2LMCB 2VL6A 5IYDH 1DONA 2HHHL 5I2YA 3NE5B 3K57A 1SYBA 5GQOA 2K28A 1X3EA 2F03A 4A3LH 3OMCA 3CMAA 3K5MA 2KQ3A 1IBMQ 2NZ1D 1F9QA 3OWEB 3STBC 2R93B 1NBWA 2PCFB 2EXZA 3S14B 2F0EA 4GN3B 5IYCH 1QNKA 3T53B 2XIWA 2K52A 5ELOA 4Y7NB 4LF4Q 2UXDL 1OXTA 1SNDA 1UWVA 4LFBL 4O42A 5M5YB 1SNPA 1MSGA 2QDLA 1I6VC 1E2ZA 4X64L 3S1MB 1EQTA 2Z6KA 1CA5A 3DUZA 4CKEA 3CCRA 3U4ZA 3CCEA 1ML0D 5M3FH 2NTSA 2F4VQ 3CP0A 2FFKB 3MVVA 1K28A 1Y8NB 2WP8J 4DF7A 1EFWA 1Q46A 3F8TA 2EY6A 4QJFA 1D5ZC 4DV6L 4B3SQ 3GTGH 2X6GA 2NVQB 3KLRA 2RDHA 3K80C 1XTCD 4M8AA 4IPGA 4QL5A 5CGKA 4KN4C 2PZUA 3DWAA 3OYYA 2HCIA 3CQZH 4A3EB 3J7AV 1KAWA 1D1KA 2EY2A 2N8NA 4FF2A 1E3PA 1PDQA 1G8ZD 3M4QA 4KHVA 3GTKB 1HA5A 2KHSA 4LWCA 5CBAE 3MXNB 5KEEA 2F52A 2CWAA 1BDOA 5I2XA 4YY3L 1WOCA 3I4LA 4H0LC 4DAYA 1WTXA 1GXDC 3Q22A 3GTJH 2JA5G 3DM1A 4MNOA 1R9TB 1M4VA 1NMGA 3NEMA 3D6WA 3E5SA 4EVOA 1TY2A 4A93G 4PMWA 2UU9L 4IUUA 1BO0A 4OX9Q 4GNXA 4ZAIA 4HSPA 2K75A 3VYRA 3L3OC 2EE1A 4EQ5A 4DR5Q 2A6EC 2D9UA 5LHY1 2LXJA 4DFAA 4DV1L 2WB1G 1KLUD 3M4PA 5L37A 1XPOA 3UDIA 1NJIC 4CKBA 2JQOA 1XXGA 1FJGL 2R93G 3OSOA 1V43A 2EXDA 5DAUA 2IX1A 2EZVA 1GHJA 2HDMA 2NZHA 3S24A 1LTRD 1SBBB 1YI2A 5JJLA 1I3QH 1O7ZA 2RSOA 2PI2E 3MWYW 4MHEA 1EIGA 4RA8A 1UE5A 5KYIA 2VY3A 2KCTA 4QQBX 4J8QA 5M3MH 4ZUJA 1HA6A 2Q8TA 1PRTD 4B9XA 4L5TA 2KEDA 3MAQA 1PVOA 4NW2A 4Q0FA 2N3SA 5M5WB 5IGEA 1E0BA 2R7DA 1Y8PB 2D2CC 2WFWA 3TMEA 1AP0A 2QGQA 1EIFA 4A3EG 2JYOA 3RUZA 4WJ4A 4QIWB 1L1OA 4IPHA 1TY0A 3F1ZA 4JI1L 3H0GH 1YNJC 4IURA 3R93A 1LV9A 2QA4A 1TU2B 3SK6A 3KOJA 4CDFC 4K0KL 5IP7G 5FO9B 4FVMA 5CV5A 2QCPX 4WRDA 2GVAA 4HMJA 3HOXH 2G9HD 2HDLA 1ENFA 2E76C 3D3RA 5IWAL 3OTOQ 1I4PA 1U9RA 5I9PA 4LFAL 1B9MA 2VB3X 1IL8A 4GZYC 2EDGA 3QWNA 1YBYA 3KJPA 2L11A 3HOWH 4MTKA 2BE5C 3MC0B 4CBVA 1EYCA 1JWMD 1BBXC 4C3IH 2ZTDA 4X65L 3ERSX 4LF6Q 4DU9A 4KI0A 1I4QA 1F2ZA 4BY7B 2R3ZA 2KHIA 3PUWA 1JMCA 1EY5A 3K0YA 3J7ZC 4K5VA 1RTNA 3FKIB 2SEBD 1S72A 3S2HB 1W6KA 2QW7A 2E75C 1H95A 2F0PA 1F9SA 2K4KA 2B63B 1VQKA 3D31A 1AW7A 4NXNL 4KMUC 4JI2L 3HOVB 1YIJA 4FNFA 1A8VA 1LT6D 4GOPC 3VYSA 2DN8A 1I6HB 3S16B 3X3NA 2JA7B 4FF1A 4OO1I 1MKHA 1HFGA 1S3OA 2HQEA 1CTMA 1XMOQ 2NVXH 1A63A 3I4MB 1IBML 1MD2D 4DXFA 4O1NA 1G6PA 5BR8Q 1K9MC 5KIXA 3WOEA 4HCSA 3FHWA 2EJFC 5DNFA 2FMCA 4JBKA 3K6OA 4DV5Q 2G5DA 4C2MB 3CMEA 3UDFA 1C7YA 4JYAL 2K5NA 5FLMH 1GUSA 4QF4A 5GROA 1Q3LA 2UXBL 4ULLA 4X3UA 4XDXA 2A6HC 3TREA 4DR6Q 1EZ6A 2F4VL 4DUYQ 2JK8A 4QIWE 2BH2A 3GTLB 2F0QA 1WTVA 4X6AH 5ELCA 3JAMi 2F3IA 5C4HA 1N36Q 2PW5A 4B3SL 5C4XG 2KCMA 2PMZB 1I4XA 4H7BA 4UHVA 1D6EC 4R4IA 1ZYRC 5E7NA 2DUDA 1VQNA 2DY8A 3CAMA 2Q8RE 4R8IA 2K50A 1WI5A 3NELA 5C44G 3CC4A 4KY5A 4JI0Q 4CJ2C 3BDOA 2K33A 2VUMG 3M4YA 1MSHA 1STNA 4BY7G 4A3CH 1KABA 4AYBB 3FKIG 4A75A 2BDOA 2QKIC 5I4DA 4NXMQ 4DR4Q 2L15A 1DOLA 1BBWA 2RDFA 3NQIA 4K8JA 4OX9L 5C3EH 2IL8A 1JWSD 1OXXK 5JEAH 1G51A 2EJGC 4HTHA 4DR5L 1PZID 5KYLA 3MTSA 4J15A 4V190 3KF8A 1MGSA 1B4OA 3GTMH 1T9HA 2RVLA 3SDZA 4BS9A 3I4MG 5C0XH 1ILQA 5LL6X 3D0FA 4XT3B 3OWFA 4RGTA 3PO2B 3CRLC 4RKBA 1ONLA 1TXYA 3NWSA 5IGGA 1LYLA 4R1JA 2HIXA 1Q86C 4JOIC 4S3SA 2H1EA 1R4PB 3AYHB 3P20A 4DXGA 4YCVA 2KA7A 3TBIB 1SRUA 1HNWQ 4HJ7A 3ULLA 3S14H 2HHHQ 4L6TB 1PYWD 4Y7NH 4HJ8A 4H44C 4QY7A 1RKNA 5IT9c 1WTHA 1L0WA 3F2UA 1QUQB 1SYFA 3J80i 3S1MH 4I7AA 3RR5A 3ZYYX 2JA9A 3KJOA 1DD2A 5D14A 5KNCA 3C2PA 2XSCA 5JPMC 3KDFA 4RH6A 2IHFA 2CH4A 1LTSD 2OEOA 1U4MA 2Z6BA 1J5EQ 2NVQH 3I4NG 4TVAB 1HQMC 5FLXL 2PMZE 2M9VA 3PO3B 2BH8A 3TDQA 2KBNA 4AYBG 4K2KA 1PFSA 5C5MA 3J7YW 4RAUC 1G2SA 4N8FA 4YCUA 1TWGB 3VA5A 4XTCS 1WFQA 4MIUA 1EU3A 1X3GA 3OTOL 3GTKH 2DNEA 5FJ8H 4BA1I 2LS01 3M9BA 3CHBD 3ZJYC 5EKLA 1E22A 5D3DA 4GLXA 5KRUA 2VZAA 5IP7H 4UP8A 1KRSA 4FP5D 4AYBE 5C6AA 3UI2A 1I50B 1RL2A 3A5UA 1SDFA 1TWAB 4LF6L 3Q23A 2KENA 2VS1A 1CM9A 4P74A 1DYQA 3CKIB 1ASYA 4HJ9A 3I3CA 1VQJA 4PMBA 1NMFA 3RN5A 2QEXA 3R2TA 4DN4M 2MQHA 3Q0AA 4X66L 1F9PA 3PUXA 1XNQQ 1EUJA 2YTXA 3E6ZX 3T4AC 1D8LA 2WAQB 3QG1A 1SNQA 3UDXA 1EIHA 1PZJD 3QJYA 2LKVA 1D1IA 1I5FA 1ZKOA 2X69A 1HCZA 2K14A 4OXPA 1H9MA 1GD7A 4GN4B 2Q8IB 2PYKA 4LJZC 3VR6A 1W2BA 2FINB 4GKKQ 4JV5Q 1I4HA 1EZ8A 2NBFA 4IJHA 3J80L 4HIDA 1FJGQ 2R7ZB 3MZ5A 2UXCQ 5T1GA 4IO9A 1B7YB 3RNUA 1S40A 3PQIA 4PQXA 4IOCA 4IOAA 4QUFA 2UUCL 1H9JA 2KOLA 3SHLA 3E9HA 3H94A 4XIGS 3DEOA 4DV5L 5M5WH 3HOYG 1VQCA 4JI8Q 4JI6Q 4DUZL 2K5DA 3R2IA 2XN9C 5I6YA 1PTOF 3S1RH 4KY7A 2R92G 4DR6L 4DUYL 1IHZA 3TSSA 1DZ1A 4A3IB 4HIMA
chains in the Genus database with same CATH topology
2QW7A 2HD3A 4N8X1 5L37A 4JVZA 2RCFA 4I7AA 4JW0A 2Z9HA 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  2HD3 A;  4N8X 1;  5L37 A;  4JVZ A;  2RCF A;  4I7A A;  4JW0 A;  2Z9H A;  4N8F A; 
#chains in the Genus database with same CATH topology
 5DLQ E;  1N36 L;  2J0T D;  4IPC A;  5EPJ A;  1B44 D;  3K7U C;  1J8I A;  1NR2 A;  3K5N A;  4HMI A;  1SYD A;  2ICE C;  3DWQ A;  3GO5 A;  5LL6 S;  4U67 3;  3T1H Q;  4A3K B;  1VQL A;  1ENA A;  4F88 A;  3BVG A;  1U4P A;  1N33 Q;  2B3G A;  2CCZ A;  2XRQ D;  4P72 A;  5T1I A;  3J7A 5;  3NBH B;  5KGU A;  2ATW A;  1MI2 A;  1JWU D;  3CCM A;  1GUG A;  1HZC A;  3CRK C;  1KNA A;  1IW7 D;  3B6Y A;  2GN5 A;  2CFM A;  4GOP B;  5IGB A;  4ZK9 B;  5C4J H;  4NXM L;  1VCI A;  2A74 C;  2JA8 G;  2VXW A;  2A69 C;  4LMQ D;  5C5L A;  2WAQ G;  4KV6 A;  4LFA Q;  1MJE A;  1SXT A;  4GN5 A;  1VQF A;  1UE7 A;  3S17 B;  3VR4 A;  4KKT A;  1U5K A;  2K5V A;  3OW7 A;  3D4R A;  4G7O C;  1VQ8 A;  4CJ0 B;  4BY7 H;  1G2T A;  4ZQ3 A;  4JBW A;  3FKI H;  1UE1 A;  3S2H H;  2F0N A;  4HCE A;  1SYC A;  4KKS A;  1PXU A;  1A3T A;  4YWK A;  1U0L A;  2B63 H;  2WAQ E;  1JJC B;  2F0L A;  3VA7 A;  2NN6 I;  2KCN A;  1EOT A;  3HOV H;  2JA5 B;  3I8Z A;  1BR9 A;  2AWN A;  1Q8K A;  2DGY A;  2E2J B;  1I6H H;  2AUK A;  1PH5 A;  3S16 H;  3FPP A;  2JA7 H;  5IGC A;  1VQB A;  4NXN Q;  1JT8 A;  4JI2 Q;  3F2C A;  1B1Z A;  3MFG A;  1AZQ A;  2CH4 W;  4WJ3 M;  2GVB A;  2K05 A;  4DAV A;  3PIO 3;  2MHV A;  2DNC A;  5HY6 A;  1H9S A;  1XJV A;  1HNW L;  4OO1 G;  1K0S A;  1EY8 A;  2WB1 B;  5D3I B;  4A3I G;  4P2C B;  2EYH A;  2K6A A;  2MJ8 A;  4GLV B;  2K1B A;  2F0S A;  3E3X A;  1PRT F;  4MTN A;  3KF6 B;  3BG3 A;  1SMY D;  2K5Q A;  3H09 A;  4BXX G;  1OTC A;  4A3K G;  3KBG A;  1QIL A;  4DNR B;  3F2D A;  1PTO D;  2OCE A;  3GTL H;  1KNE A;  1YZ6 A;  4JYA Q;  1K8M A;  2UXB Q;  3GDE A;  2IX3 A;  1YVC A;  5GAE C;  2EYP A;  2L1B A;  1J5E L;  4ZUI A;  1VQ4 A;  1BQQ T;  1Q8I A;  1PMR A;  3HZX A;  3A5Z B;  3NWT A;  3URY A;  2I46 A;  1EY7 A;  3OIP A;  2JXM B;  4DPG A;  3GP7 A;  4DNI A;  1XMQ Q;  2HIV A;  4OEL B;  3JAM E;  1HPC A;  1LT4 D;  2F3V A;  3MXP A;  4A3F B;  4IZ8 A;  4A3G G;  3QB3 A;  4LUV A;  3J7A F;  1GO3 E;  2YV5 A;  2ZTE A;  1PH4 A;  3H3V C;  1TQO A;  2N49 A;  5J3B A;  2F0T A;  4ME3 A;  2AHO B;  3PF5 A;  2Q2T A;  2OT2 A;  4YWL A;  2F0M A;  4G57 A;  1HUN A;  3FEW X;  2WIN B;  3RMH A;  2LFN A;  5DM6 3;  4FXD A;  1BCP F;  1E24 A;  3R8B A;  3A8J E;  3M3Y B;  3QR8 A;  4XT1 B;  5K36 H;  3L9A X;  3RLO A;  1CKN A;  3DHQ A;  3U58 A;  4PG3 A;  1XNQ L;  3A7L A;  2IX0 A;  1QZH A;  4A3B B;  4HIK A;  1U4R A;  1EEF D;  3EIV A;  2XTI A;  2A5H A;  2ENB A;  3SGI A;  3WDN A;  3RN2 A;  2I5M X;  1PH7 A;  1IYV A;  4IFD H;  2RQX A;  3PO2 H;  1UE6 A;  1CFM A;  3CPW A;  1Q81 C;  3K59 A;  3RLF A;  3Q8D A;  3EFX D;  4GKK L;  1UAP A;  4JV5 L;  3BDC A;  2ZXR A;  3K8A A;  5E3F A;  1KC8 C;  4DNT B;  3H6M A;  2UXC L;  2V4D A;  3OMG A;  3SR1 A;  3EVQ A;  3AEV A;  3GV6 A;  1O7L A;  1DJR D;  2KEC A;  5FK9 C;  1Y1V B;  1GHK A;  3LWU A;  4POG A;  1JE4 A;  5IP9 H;  3GTO B;  2WB1 E;  4JI8 L;  3H3V H;  5IOC A;  1RIP A;  2PQA B;  4JI6 L;  1JC7 A;  2OTJ A;  1HH2 P;  2NVT B;  3H15 A;  1PH1 A;  3HKZ B;  4N9T A;  1LTI D;  1A2T A;  3QIA A;  4C56 C;  3CCU A;  2B2W C;  3BVM A;  3VR5 A;  4UP7 A;  4B08 A;  4IQZ A;  2CW0 D;  1SNM A;  3D4W A;  4A3F G;  1VS0 A;  1FGU A;  2ZXO A;  3G6E A;  4GOP A;  4RGM A;  4EQN A;  1DGS A;  3J80 E;  5ELB A;  4LNQ A;  3S1Q B;  1KTK A;  3T1H L;  3PO3 H;  2CHB D;  5JPN C;  1A62 A;  2GA4 B;  3GTP B;  1WTW A;  4J1M A;  4BBS G;  1EQR A;  3NXW A;  1OXV A;  1N33 L;  1IL2 A;  2RCF A;  1TWG H;  5DEH A;  1QOH A;  2CKZ B;  3T51 B;  1Q12 A;  2CWP A;  1UUP A;  2I07 B;  3A56 A;  3BYY B;  1B8A A;  2CQA A;  4TQU S;  1M90 C;  2WKC A;  3HRZ C;  3EA6 A;  5C4X B;  3LWE A;  1HZ9 A;  2RSN A;  1FR3 A;  4A3B G;  1I50 H;  3DXJ C;  3AFP A;  1TWA H;  2DJF C;  3W1B A;  4PNY A;  2H5X A;  1BCP D;  5A2Q L;  5C44 B;  3FDT A;  1BXT A;  4JPB W;  4KHZ A;  4K2L A;  1F9R A;  1SYE A;  3RZO B;  4KJN A;  4EGV A;  1LTA D;  2VUM B;  2PI2 A;  4RKL A;  2VW9 A;  1C4Q A;  2L5T A;  1Y14 B;  4KLK A;  3M4O B;  4X66 Q;  1HZB A;  1V1O A;  1Y1V G;  4XQJ A;  4K5X A;  4TRD A;  2B8F A;  1PZK D;  3ER0 A;  2A73 B;  4A76 A;  3TEH B;  4CHT B;  3PUZ A;  3BJU A;  2R7Z H;  4APV A;  5LMN Q;  1HNZ Q;  3K5L A;  1SMX A;  3AMU A;  1PLF A;  3HKZ G;  3CCJ A;  2KEE A;  5HGQ A;  1EU4 A;  2JEB I;  1BBU A;  2K5H A;  1C9O A;  1CZG A;  1VQP A;  1GM5 A;  1PV4 A;  4RG1 A;  1N32 Q;  2EPB A;  2OF1 A;  3PCO B;  2CVR A;  2PZT A;  4RHR A;  2UUC Q;  1EWH A;  3NQT A;  5CV7 A;  4EQO A;  5JJZ A;  4F7X A;  1LTL A;  4OWT B;  4UPA A;  2Q2H A;  1VQD A;  1AE2 A;  3S1N B;  2EQS A;  3HKZ E;  1HR0 W;  1E2V A;  1KDC A;  3BZK A;  4DUZ Q;  1CSP A;  3PUY A;  3PV0 A;  4ABN A;  3LNN A;  3TRZ A;  1ROD A;  4XQN A;  4DGZ A;  2DJG C;  4DV3 Q;  2YTY A;  4DK6 C;  1VQ7 A;  5IGF A;  3CCS A;  1T5X D;  4BXX H;  3HS0 C;  5CR3 A;  1D2B A;  4N9P A;  2NB0 A;  1B3Q A;  1MBY A;  5GAG C;  4LF5 Q;  3QOJ A;  5H1S E;  1V1P B;  3MXN A;  2NWG A;  4JOI A;  1X54 A;  4FXG C;  1WTR A;  1PYS B;  4B9W A;  1HQR D;  3A55 A;  1XMQ L;  4DV0 Q;  2Z1C A;  2EYM A;  2SNS A;  5C3X A;  1N34 Q;  1I4G A;  4O0A A;  3NHH A;  3PGZ A;  2EYO A;  3P7J A;  5IT9 L;  1TT2 A;  3TZU A;  4DR7 L;  3BS1 A;  4NMZ A;  2F4I A;  4C1N K;  4HN7 A;  2OXP A;  1X56 A;  1X6O A;  1M1K C;  3STB D;  4ILW A;  1JR0 D;  3MHB A;  3I4N B;  1LLR D;  3D6C A;  1KXL A;  1VQH A;  1ICW A;  2C35 B;  3S17 H;  1J9O A;  1VQ9 A;  5JVH 3;  1P16 A;  1NR4 A;  4DA2 A;  1Z6H A;  4A3M B;  1B70 B;  1N9W A;  2DY7 A;  1HRJ A;  2F3W A;  3VYT A;  3V96 A;  1YNX A;  5C3W A;  4OL7 A;  5CV9 A;  2M00 A;  5EPK A;  5FO7 B;  1HR0 L;  3G7L A;  3M7N A;  1NAP A;  3J81 i;  1Y8O B;  1YEZ A;  1JOQ A;  1S5C D;  1CQF A;  1Y1W G;  4RCN A;  3KLW A;  3NBI A;  4LF7 Q;  1V9P A;  3ONA B;  4PZ7 A;  5F2D A;  4FYD A;  1S5B D;  2JA5 H;  3A0J A;  5IYB G;  1BNZ A;  1JJ2 A;  2E2J H;  3FRP B;  2AMC B;  4IUT A;  5CV6 A;  2PQE A;  2JN4 A;  2NN6 G;  4DKA C;  3M85 A;  1KIX A;  1I94 L;  4KN7 C;  5EJW A;  1MHW C;  3KYH C;  1KD1 C;  4A93 H;  3NTK A;  3AU7 A;  3BU2 A;  4V0B A;  4C3J B;  4JBM A;  5C0X I;  1FYC A;  5JAV A;  1A3U A;  4WJW A;  4DV4 Q;  3AB9 A;  3HG9 A;  2F0G A;  2L0C A;  1UNS A;  4FF4 A;  2EYF A;  3P1H A;  1EYG A;  1AZP A;  1ESF A;  1EEI D;  3ICE A;  4LAA A;  2R93 H;  2KCC A;  3D4D A;  3F2B A;  1STA A;  3NEN A;  3TP5 A;  5IYD G;  1VQG A;  1TKW B;  1PFB A;  1U4L A;  2BCO A;  4RWS C;  5M5Y H;  5G3L F;  3BZD B;  3S2D B;  2FHT A;  1STE A;  1LUZ A;  2RHQ B;  3MFY A;  4P71 A;  1IKM A;  2A6E D;  5J1Z A;  3U9O A;  1QVG A;  5IYC G;  3I55 A;  4IUQ A;  2JP1 A;  2Y0S B;  3BDL A;  4DV2 Q;  2I0Q A;  4YCW A;  1TR5 A;  1QVF A;  3KLS A;  2B8G A;  2AQ2 B;  3HOY B;  3TZD A;  5LMN W;  4HED A;  3CXC A;  5M3F G;  3TS2 A;  4OIJ A;  2EIF A;  3OHX C;  5BN4 A;  1JQY D;  4A3E H;  2R92 B;  4A3M G;  3CD6 A;  2MO0 A;  2B39 A;  2ASB A;  3G71 A;  1RJT A;  1OXU A;  2BOS A;  4OHJ A;  4CGY B;  2IW3 A;  3I73 A;  3J81 L;  2L12 A;  2BA0 A;  1V1Q A;  1TWC B;  1TS3 A;  3GV3 A;  3H0G B;  5CV4 A;  4KHP Q;  3HOZ B;  4K14 A;  1XYI A;  1B9N A;  4LW1 A;  2PNH A;  2ES2 A;  3I90 A;  3NP8 A;  1R9T H;  1Q1B A;  1GKH A;  4JCV E;  4JI5 L;  1WTQ A;  4A3B H;  4C3J G;  1QZG A;  4L5R C;  4A4I A;  2F0V A;  5CYU A;  3HP3 A;  3TN2 A;  2WV6 D;  1IZ6 A;  2EY5 A;  2JA8 B;  4I65 A;  4DK0 A;  1CA6 A;  2KVM A;  1SJE D;  1TVX A;  4L63 B;  3CW2 C;  3QOL A;  1X32 A;  4OON A;  3PIP 3;  4N8X 1;  5LMN L;  1HNZ L;  5JJK A;  1JCK B;  1CUK A;  2F0F A;  2E5L Q;  3L7Z C;  2V1C C;  3HOW B;  1PRT C;  2QEJ C;  1YNN D;  4BA2 I;  4OGQ C;  3K0X A;  4JW0 A;  4CDD C;  1Y1V H;  2OTL A;  4CDE C;  1N32 L;  4ZLT F;  3JAM c;  3GTO H;  1WTO A;  4BBR B;  1K8O A;  1DOM A;  2Y0S G;  2BE5 D;  2NVT H;  2SOB A;  5M5X B;  4MN3 A;  3T56 B;  2O5I C;  5EBD A;  4IAL A;  1ASZ A;  3OW2 A;  4BY1 B;  4ZYS A;  5LMU Q;  5M3M G;  5ISR A;  1PH9 A;  1ILP A;  5G3L D;  3UE0 A;  4DV3 L;  3FPU B;  1WYD A;  3S1Q H;  2ZXP A;  1SE4 A;  1VMC A;  3SE0 A;  4LF5 L;  5E4W C;  1K83 B;  2F0W A;  2Y0S E;  3RLN A;  4JK1 C;  5GAD C;  4U68 A;  1FNV A;  1FVI A;  4O2D A;  5ELF A;  5J22 A;  1WCM B;  4DV0 L;  1TWF B;  1H9R A;  1KAA A;  1NY4 A;  1SE3 A;  3W1G A;  3C3L A;  1N34 L;  3H0G G;  3HOZ G;  4QCL A;  2ALY B;  2VB2 X;  1W3S A;  3W2D A;  4KD3 A;  4UAI A;  3UE1 A;  1L0Y B;  1FD7 D;  2KJX A;  4JC0 A;  2IY5 B;  1KDA A;  4Y52 H;  1BCP C;  4AQY Q;  3U50 C;  3A7A B;  5C4X H;  4IN3 A;  3S9W A;  2ZM6 Q;  1UEA B;  1STG A;  4B3T Q;  1VF5 C;  2E2H B;  1JB7 A;  1KHI A;  3SEB A;  5FO8 B;  3I56 A;  1EY6 A;  1F2Y A;  2O5J C;  1CQV A;  3NSW A;  3FP9 A;  2YU9 B;  3HOU B;  1L0X B;  2LY7 A;  3SVM A;  3K5O A;  2M2L A;  3DMU A;  1D7Q A;  3HOX G;  5C44 H;  3Q6S A;  3CCV A;  2SDF A;  4K6L A;  3LGJ A;  4A3G B;  3RZO H;  5CBE E;  2VUM H;  1A0I A;  3HOW G;  3U9S A;  4LF7 L;  3M4O H;  1FGB D;  4C3I G;  2ICI A;  1L1O B;  4LF9 Q;  3MEF A;  1ZYR D;  3KFU A;  2IPK D;  1NSN S;  4BBR G;  1D5X C;  1NUC A;  3TP7 A;  2MO1 A;  3J80 c;  1QUQ A;  2E2D C;  4L5Q A;  4DV7 Q;  2E2I B;  4C3H B;  4FF3 A;  3CU7 A;  4DV4 L;  4IUN A;  1SFO B;  4NB3 A;  5IYB H;  4BY1 G;  4HAE A;  3K7A B;  1QVC A;  2B2Y C;  3PUV A;  2B2T C;  3Q24 A;  3I4M H;  1GVP A;  1TS4 A;  3HEJ A;  1BF4 A;  3GD7 A;  3S15 B;  4XYO A;  2R6G A;  4A3J B;  2NYZ D;  3UDG A;  1Q7Y C;  2HUG A;  3G6J B;  1F2L A;  4FO2 A;  4AIM A;  3S1N H;  1F2M A;  3ULJ A;  4UDU C;  1WCM G;  1RTO A;  4C2M H;  2F0J A;  4P75 A;  1PH8 A;  2QDB A;  3BYT B;  1O80 A;  4L5S A;  1VQ5 A;  2XWJ B;  1S5F D;  2ZJR A;  3ND9 A;  1B3A A;  2Q2U A;  4DV2 L;  3ULP A;  4RGO S;  4BWG B;  4LF8 Q;  5FLM G;  3QO2 A;  1SRO A;  3HGB A;  1VQ6 A;  5TSS A;  2CQO A;  2F0H A;  4FXK C;  2MNA A;  1EQV A;  1S5D D;  1UEB A;  2C9O A;  4QMG A;  1TWH B;  3HOU G;  3GTQ B;  1VQM A;  3HFZ B;  5C4Z A;  2WII B;  1STH A;  2WAC A;  1RHP A;  1CKO A;  1RDP D;  5I6W A;  3KK7 A;  4ZKB B;  2JA6 B;  1NCV A;  2K04 A;  3I4N H;  1V8Q A;  1SE8 A;  3C1E A;  2Z8L A;  4JVZ A;  2B2W A;  3MA2 B;  4KKU A;  2K01 A;  4DR7 Q;  4KHP L;  2D0O A;  2N55 A;  2PZW A;  4JI3 L;  2L9H A;  4JI4 Q;  4A3M H;  1C0A A;  5IOD A;  2RCN A;  2B2U C;  4YHH Q;  4BBS B;  1EYD A;  1JIC A;  3R3O A;  1SE2 A;  2E74 C;  2NTT A;  3NPP A;  3IRB A;  1PTO B;  2PNR C;  3SK5 A;  5E1F A;  1YHQ A;  3PIO A;  4A3C G;  5FLX E;  1LT3 D;  1CZW A;  2HCC A;  4C3H G;  1P8L A;  1EWC A;  3VR3 A;  1RCV D;  1HR0 Q;  2D0P A;  3ERQ A;  2EJM A;  4ME5 A;  1FNW A;  5C3E G;  1H9K A;  5JEA G;  3KBX A;  4LFC Q;  3J81 E;  1X9N A;  1SNO A;  2HD3 A;  1WD1 A;  1STY A;  3W5O A;  4A3J G;  2B2V C;  4C3J H;  2OWO A;  2E5L L;  4ZRZ A;  1EOV A;  2Z4I A;  1B2T A;  2D5D A;  1VQI A;  4IFD I;  1I94 Q;  1AE3 A;  5C0X G;  3SK4 A;  1HZA A;  2F0K A;  3TQY A;  3T16 A;  2A68 D;  3E9I A;  4NDX A;  1NTG A;  1II3 A;  4K8I A;  4DAM A;  3IFD A;  1CHQ D;  2E8G A;  1S5E D;  2B29 A;  4DK1 A;  3N52 A;  4B3R Q;  4RGN A;  2EOT A;  1EY4 A;  1KDB A;  5LMU L;  5EAY A;  2UUB Q;  1PYB A;  4B3M Q;  3S2D H;  3H3V I;  1SSO A;  2Z6K C;  4X62 Q;  5J39 A;  1TS5 A;  5GAH C;  3NBH A;  1KRT A;  1K73 C;  4DAP A;  1SYG A;  4C1N I;  1VQA A;  1N8R C;  4KY6 A;  3CF5 A;  3EJI A;  1OXS C;  2JA6 G;  3HOY H;  5JEA J;  2A19 A;  2I5H A;  4GS3 A;  2BDN A;  5CV8 A;  3KF8 B;  2YYZ A;  1JB3 A;  1LAB A;  1XPR A;  2R92 H;  5EBC A;  4GLA C;  5C0X J;  3J81 j;  2QF7 A;  4AQY L;  2R7F A;  3CCQ A;  2ZM6 L;  4A3D B;  4B3T L;  3S1R B;  2L4N A;  4CJ1 B;  1XX8 A;  4XXE A;  1TWC H;  1QNU A;  4Q5V A;  4JI7 Q;  3IAY A;  2MFI A;  4HJA A;  3HOZ H;  1CT1 D;  4IUV A;  5ELE A;  1PRT B;  2C5C A;  4M1U B;  1E7Z A;  1SAP A;  3U4V A;  5IIF A;  5FJ8 G;  3L2P A;  3WOF A;  3P75 A;  2MGS A;  4DR2 Q;  4POF A;  1MJC A;  5FKA C;  1IKL A;  2VQE Q;  4GNX C;  2F0D A;  1ICF B;  5EKI A;  3RZD B;  3DM3 A;  4NP5 A;  1VQE A;  1Y69 U;  4HSV A;  1YNN C;  3A74 A;  4JG2 A;  4QB4 A;  4LF9 L;  5ELN A;  4OWW B;  2JSO A;  2JA8 H;  4JI5 Q;  2F0O A;  3KDF B;  5HUR A;  1EYA A;  4GKJ Q;  2O4X A;  3DEP A;  3KF6 A;  4DV7 L;  5C4J B;  1AH9 A;  1CHP D;  1OO9 B;  1HTL D;  2XNA C;  1TS2 A;  2RBM A;  5AJ3 Q;  4NKL A;  3T1Y Q;  3HKS A;  1Y1W B;  1YJ9 A;  1X55 A;  4BBR H;  4RFB A;  2XGT A;  4WOR A;  2X6L A;  2K5W A;  1XPU A;  3C1F A;  1GUW A;  2A1A A;  2A69 D;  5M5X H;  3I91 A;  1IBL L;  4CDC C;  4K6D A;  2K7V A;  1BCP B;  3RD4 A;  4BY1 H;  4DR1 Q;  4TSS A;  3FMC A;  4KTA A;  1EFI D;  1S4Z A;  1CSQ A;  4FDB A;  2R61 A;  3IKJ A;  1E2W A;  1L1O C;  1WVL A;  4OO1 H;  2MPM A;  2NVY B;  3K58 A;  5KNB A;  1K83 H;  1WD0 A;  2EVB A;  4IPD A;  4A3I H;  1YIT A;  4LF8 L;  4K5W A;  1SLJ A;  1WCM H;  4A3D G;  1TWF H;  1Q82 C;  1Q1E A;  3I72 A;  4TKO B;  2PW7 A;  1ET9 A;  4A3K H;  1RD9 D;  2SNM A;  1DCZ A;  2WKD A;  3G48 A;  4G7Z C;  1IW7 C;  4DR3 Q;  4LF4 L;  2J4X A;  1T5E A;  1GJX A;  3OIQ A;  2AQ1 B;  3PMF A;  1LT5 D;  4QGU A;  2E2H H;  1B53 A;  5M9O A;  4OWX B;  4JI4 L;  2YU9 H;  2XVS A;  3HOU H;  3TS0 A;  4YHH L;  5E4X A;  5M3F B;  2F0I A;  1IBK Q;  4A3G H;  1ESR A;  2G9D A;  1IXR A;  1A3V A;  3PSI A;  1YHB A;  5FOB B;  3AFQ A;  4P73 A;  1VDZ A;  3GTG B;  4LK1 C;  2P5Z X;  3I4O A;  1HFN A;  3IL8 A;  3CC7 A;  3ITP A;  3CQZ B;  1AEX A;  4PZ6 A;  1GUN A;  3AQQ A;  1PFN A;  1W6J A;  1KQS A;  2EYL A;  4LFC L;  4R9W A;  1LAC A;  4PMC A;  3EQL C;  2PQA A;  2Q2I A;  1DXM A;  2ZJQ A;  2YTV A;  3PF4 A;  2E2I H;  1L2F A;  4C3H H;  3VR2 A;  1SFO H;  3GQB A;  5D65 A;  3MXG A;  4LUZ A;  2RF4 A;  1XNR Q;  1O78 A;  1PFM A;  1HNX Q;  2B63 G;  3K7A H;  1PA6 A;  1PHJ A;  2UUA Q;  2AQ3 B;  4RCO A;  2JJQ A;  3GTJ B;  3HOV G;  4I7Z C;  1SJH D;  1SMY C;  4EQP A;  2PO4 A;  1Z47 A;  3S15 H;  2F0U A;  1D5M C;  4A3J H;  2EY1 A;  2JA7 G;  1PTO C;  1AN8 A;  1R4Q B;  4B3R L;  1GUT A;  2UUB L;  1CKM A;  4B3M L;  3EBE A;  5JJI A;  4DK3 C;  2ZTC A;  1BVS A;  3W3A A;  4X62 L;  1EWI A;  1G91 A;  1HXY D;  2XWB B;  1NNX A;  1TII D;  4A3L G;  3X3M A;  1LM0 A;  2QIL A;  2JE6 I;  5COR A;  1JJG A;  5DM7 3;  1XTD A;  4OIK A;  4ALP A;  2VQF Q;  1EIY B;  1CI3 M;  3BVZ A;  1I3Q B;  4J6H A;  2ID0 A;  5A35 A;  1TWH H;  3CC2 A;  3GTQ H;  1A6X A;  3JAM L;  2TMP A;  1K3R A;  1LTT D;  2ZT9 C;  3A54 A;  4X3T A;  4YIJ A;  4R4T A;  1QB5 D;  1VF7 A;  5M3M B;  1DM0 B;  3EN2 A;  5IGD A;  4A3F H;  2JA6 H;  1XWE A;  4H13 C;  1SEB D;  1QCB D;  4WFN 3;  2UXD Q;  5BN3 A;  4LFB Q;  4JI7 L;  5IE8 A;  2IWH A;  1X3F A;  4LUO A;  4OEM B;  2A8V A;  4X3K A;  1G29 1;  2FXQ A;  4X64 Q;  4HJ5 A;  2JEA I;  4F8M A;  4BBS H;  1H9S B;  1GUO A;  1FL0 A;  3I7F A;  4DR2 L;  1C8C A;  1PTO H;  4QUC A;  4UP9 A;  1A2U A;  1PH6 A;  2TSS A;  3A8I E;  1BKB A;  4JI3 Q;  1QG7 A;  3NUC A;  4L8J A;  2VQE L;  3M3Y H;  3I2Z A;  1HHV A;  1X3P A;  3K81 C;  4DV6 Q;  4AH6 A;  1QJO A;  4XYQ A;  2FMM A;  2KUM A;  1E1O A;  3TP6 A;  1Z7T A;  4ODG A;  4IUP A;  1YNJ D;  2RA4 A;  2MP1 A;  5NUC A;  1K8G A;  3ERO A;  3O13 A;  3V2T A;  1AFP A;  4NPS A;  2OQK A;  4EX5 A;  1QWY A;  1DOK A;  1YHA A;  2VNU D;  5K36 G;  1IYJ B;  2D62 A;  4JBJ A;  4GKJ L;  2KHJ A;  2A68 C;  4PZ8 A;  5EQ0 A;  4KD4 A;  3HOX B;  2EYJ A;  2MUY A;  3JC6 6;  3FVQ A;  1JE5 A;  1EQQ A;  1LTG D;  3OPO A;  4ZCK A;  5JVG 3;  5AJ3 L;  5COY A;  1O7Y A;  3OOC A;  4KJO A;  3E0J A;  4YY3 Q;  2H4O A;  3T1Y L;  3M7G A;  4XQQ A;  2Z0S A;  1KL9 A;  4R4Q A;  2IJ0 A;  2IT1 A;  1K0R A;  3DWP A;  5HGT A;  4IFD G;  3PO2 G;  1SNC A;  1LTB D;  2RKS A;  4C3I B;  5A2Q E;  1IYU A;  3C46 A;  3KUP A;  1G6Z A;  1VMP A;  2HT1 A;  5AFW A;  1JOR A;  2UU9 Q;  2CW0 C;  1V1P A;  2K03 A;  4DR1 L;  1HUM A;  3A8K E;  4RHS A;  2I5L X;  3VYU A;  3CCL A;  1EL0 A;  3LX0 A;  1I4R A;  4DV1 Q;  2NZO A;  3MEH A;  5IP9 G;  4DAY B;  1O7I A;  2J7Z A;  3D8G A;  1LO5 D;  1KLG D;  2AUJ D;  1XMO L;  2FJ2 A;  1CKN B;  4F87 A;  1Z9F A;  3DLL A;  2AKW B;  2L55 A;  5BR8 L;  4MZ9 A;  5FLX c;  2Z9H A;  3L0O A;  4R4O A;  2RHS B;  4GNX B;  2B2Y A;  4DR3 L;  3GTP H;  1YJW A;  2B2T A;  3V05 A;  2NVX B;  3NTH A;  5CMD A;  1EY0 A;  2N88 A;  1JOO A;  5EGT A;  3IFT A;  1QE6 A;  4KK7 A;  5EPL A;  3PO3 G;  4IFD J;  3E0E A;  4A3D H;  5IY0 A;  4R4C A;  1ZXT A;  1X65 A;  5ELD A;  3J81 c;  2N78 A;  2NUC A;  3WWV A;  1PH3 A;  5EKK A;  2XRS D;  2LXK A;  4YWM A;  3I70 A;  4H02 A;  1K3B C;  4Z9C B;  3PIP A;  1CK1 A;  4PV1 C;  4HIO A;  1IBK L;  5I9O A;  1GOZ A;  4JI1 Q;  3H91 A;  1PH2 A;  4RMF A;  1ET6 A;  2ZJP A;  4R8N A;  3RZD H;  3VDY A;  1BOS A;  4JI0 L;  4ID6 A;  3NK9 A;  3TP8 A;  1VQO A;  2A6H D;  4G4K A;  3KLS X;  2LSS A;  3SK8 A;  2HQL A;  4X3S A;  5BN5 A;  1FNU A;  1SR3 A;  4UY8 C;  1Q90 A;  4E6I A;  5K5P A;  4K0K Q;  1BUV T;  1YJN A;  2Z4H A;  5IT9 E;  1WJJ A;  5JOB A;  1ENC A;  2K32 A;  5IWA Q;  3MXU A;  4ZKC B;  2IHE A;  1B50 A;  1E1T A;  1WTP A;  1XNR L;  4DR4 L;  1ZEQ X;  1HNX L;  1EY9 A;  1NE3 A;  4IJL A;  2UUA L;  2BA1 A;  1HTP A;  2B2U A;  1STB A;  2F1M A;  1Y1W H;  1JOK A;  3G4S A;  1MIU A;  2OQ0 A;  2AWO A;  5KND A;  3ND8 A;  1K8A C;  3T13 A;  4X65 Q;  2R7Z G;  3CPF A;  5C3E B;  5CC4 A;  1RF2 D;  2NN6 H;  3NTI A;  1X3Q A;  1HJP A;  3BZC A;  1M8A A;  4CKC A;  1J6Q A;  3GTM B;  1SN8 A;  2RDG A;  1IBL Q;  1C48 A;  2NVY H;  4G7H C;  3N6R A;  4HR7 B;  1F77 A;  4A93 B;  1A15 A;  2B2V A;  2O2L D;  3SXH A;  2PPB C;  2VQF L;  2LMC B;  2VL6 A;  5IYD H;  1DON A;  2HHH L;  5I2Y A;  3NE5 B;  3K57 A;  1SYB A;  5GQO A;  2K28 A;  1X3E A;  2F03 A;  4A3L H;  3OMC A;  3CMA A;  3K5M A;  2KQ3 A;  1IBM Q;  2NZ1 D;  1F9Q A;  3OWE B;  3STB C;  2R93 B;  1NBW A;  2PCF B;  2EXZ A;  3S14 B;  2F0E A;  4GN3 B;  5IYC H;  1QNK A;  3T53 B;  2XIW A;  2K52 A;  5ELO A;  4Y7N B;  4LF4 Q;  2UXD L;  1OXT A;  1SND A;  1UWV A;  4LFB L;  4O42 A;  5M5Y B;  1SNP A;  1MSG A;  2QDL A;  1I6V C;  1E2Z A;  4X64 L;  3S1M B;  1EQT A;  2Z6K A;  1CA5 A;  3DUZ A;  4CKE A;  3CCR A;  3U4Z A;  3CCE A;  1ML0 D;  5M3F H;  2NTS A;  2F4V Q;  3CP0 A;  2FFK B;  3MVV A;  1K28 A;  1Y8N B;  2WP8 J;  4DF7 A;  1EFW A;  1Q46 A;  3F8T A;  2EY6 A;  4QJF A;  1D5Z C;  4DV6 L;  4B3S Q;  3GTG H;  2X6G A;  2NVQ B;  3KLR A;  2RDH A;  3K80 C;  1XTC D;  4M8A A;  4IPG A;  4QL5 A;  5CGK A;  4KN4 C;  2PZU A;  3DWA A;  3OYY A;  2HCI A;  3CQZ H;  4A3E B;  3J7A V;  1KAW A;  1D1K A;  2EY2 A;  2N8N A;  4FF2 A;  1E3P A;  1PDQ A;  1G8Z D;  3M4Q A;  4KHV A;  3GTK B;  1HA5 A;  2KHS A;  4LWC A;  5CBA E;  3MXN B;  5KEE A;  2F52 A;  2CWA A;  1BDO A;  5I2X A;  4YY3 L;  1WOC A;  3I4L A;  4H0L C;  4DAY A;  1WTX A;  1GXD C;  3Q22 A;  3GTJ H;  2JA5 G;  3DM1 A;  4MNO A;  1R9T B;  1M4V A;  1NMG A;  3NEM A;  3D6W A;  3E5S A;  4EVO A;  1TY2 A;  4A93 G;  4PMW A;  2UU9 L;  4IUU A;  1BO0 A;  4OX9 Q;  4GNX A;  4ZAI A;  4HSP A;  2K75 A;  3VYR A;  3L3O C;  2EE1 A;  4EQ5 A;  4DR5 Q;  2A6E C;  2D9U A;  5LHY 1;  2LXJ A;  4DFA A;  4DV1 L;  2WB1 G;  1KLU D;  3M4P A;  5L37 A;  1XPO A;  3UDI A;  1NJI C;  4CKB A;  2JQO A;  1XXG A;  1FJG L;  2R93 G;  3OSO A;  1V43 A;  2EXD A;  5DAU A;  2IX1 A;  2EZV A;  1GHJ A;  2HDM A;  2NZH A;  3S24 A;  1LTR D;  1SBB B;  1YI2 A;  5JJL A;  1I3Q H;  1O7Z A;  2RSO A;  2PI2 E;  3MWY W;  4MHE A;  1EIG A;  4RA8 A;  1UE5 A;  5KYI A;  2VY3 A;  2KCT A;  4QQB X;  4J8Q A;  5M3M H;  4ZUJ A;  1HA6 A;  2Q8T A;  1PRT D;  4B9X A;  4L5T A;  2KED A;  3MAQ A;  1PVO A;  4NW2 A;  4Q0F A;  2N3S A;  5M5W B;  5IGE A;  1E0B A;  2R7D A;  1Y8P B;  2D2C C;  2WFW A;  3TME A;  1AP0 A;  2QGQ A;  1EIF A;  4A3E G;  2JYO A;  3RUZ A;  4WJ4 A;  4QIW B;  1L1O A;  4IPH A;  1TY0 A;  3F1Z A;  4JI1 L;  3H0G H;  1YNJ C;  4IUR A;  3R93 A;  1LV9 A;  2QA4 A;  1TU2 B;  3SK6 A;  3KOJ A;  4CDF C;  4K0K L;  5IP7 G;  5FO9 B;  4FVM A;  5CV5 A;  2QCP X;  4WRD A;  2GVA A;  4HMJ A;  3HOX H;  2G9H D;  2HDL A;  1ENF A;  2E76 C;  3D3R A;  5IWA L;  3OTO Q;  1I4P A;  1U9R A;  5I9P A;  4LFA L;  1B9M A;  2VB3 X;  1IL8 A;  4GZY C;  2EDG A;  3QWN A;  1YBY A;  3KJP A;  2L11 A;  3HOW H;  4MTK A;  2BE5 C;  3MC0 B;  4CBV A;  1EYC A;  1JWM D;  1BBX C;  4C3I H;  2ZTD A;  4X65 L;  3ERS X;  4LF6 Q;  4DU9 A;  4KI0 A;  1I4Q A;  1F2Z A;  4BY7 B;  2R3Z A;  2KHI A;  3PUW A;  1JMC A;  1EY5 A;  3K0Y A;  3J7Z C;  4K5V A;  1RTN A;  3FKI B;  2SEB D;  1S72 A;  3S2H B;  1W6K A;  2QW7 A;  2E75 C;  1H95 A;  2F0P A;  1F9S A;  2K4K A;  2B63 B;  1VQK A;  3D31 A;  1AW7 A;  4NXN L;  4KMU C;  4JI2 L;  3HOV B;  1YIJ A;  4FNF A;  1A8V A;  1LT6 D;  4GOP C;  3VYS A;  2DN8 A;  1I6H B;  3S16 B;  3X3N A;  2JA7 B;  4FF1 A;  4OO1 I;  1MKH A;  1HFG A;  1S3O A;  2HQE A;  1CTM A;  1XMO Q;  2NVX H;  1A63 A;  3I4M B;  1IBM L;  1MD2 D;  4DXF A;  4O1N A;  1G6P A;  5BR8 Q;  1K9M C;  5KIX A;  3WOE A;  4HCS A;  3FHW A;  2EJF C;  5DNF A;  2FMC A;  4JBK A;  3K6O A;  4DV5 Q;  2G5D A;  4C2M B;  3CME A;  3UDF A;  1C7Y A;  4JYA L;  2K5N A;  5FLM H;  1GUS A;  4QF4 A;  5GRO A;  1Q3L A;  2UXB L;  4ULL A;  4X3U A;  4XDX A;  2A6H C;  3TRE A;  4DR6 Q;  1EZ6 A;  2F4V L;  4DUY Q;  2JK8 A;  4QIW E;  2BH2 A;  3GTL B;  2F0Q A;  1WTV A;  4X6A H;  5ELC A;  3JAM i;  2F3I A;  5C4H A;  1N36 Q;  2PW5 A;  4B3S L;  5C4X G;  2KCM A;  2PMZ B;  1I4X A;  4H7B A;  4UHV A;  1D6E C;  4R4I A;  1ZYR C;  5E7N A;  2DUD A;  1VQN A;  2DY8 A;  3CAM A;  2Q8R E;  4R8I A;  2K50 A;  1WI5 A;  3NEL A;  5C44 G;  3CC4 A;  4KY5 A;  4JI0 Q;  4CJ2 C;  3BDO A;  2K33 A;  2VUM G;  3M4Y A;  1MSH A;  1STN A;  4BY7 G;  4A3C H;  1KAB A;  4AYB B;  3FKI G;  4A75 A;  2BDO A;  2QKI C;  5I4D A;  4NXM Q;  4DR4 Q;  2L15 A;  1DOL A;  1BBW A;  2RDF A;  3NQI A;  4K8J A;  4OX9 L;  5C3E H;  2IL8 A;  1JWS D;  1OXX K;  5JEA H;  1G51 A;  2EJG C;  4HTH A;  4DR5 L;  1PZI D;  5KYL A;  3MTS A;  4J15 A;  4V19 0;  3KF8 A;  1MGS A;  1B4O A;  3GTM H;  1T9H A;  2RVL A;  3SDZ A;  4BS9 A;  3I4M G;  5C0X H;  1ILQ A;  5LL6 X;  3D0F A;  4XT3 B;  3OWF A;  4RGT A;  3PO2 B;  3CRL C;  4RKB A;  1ONL A;  1TXY A;  3NWS A;  5IGG A;  1LYL A;  4R1J A;  2HIX A;  1Q86 C;  4JOI C;  4S3S A;  2H1E A;  1R4P B;  3AYH B;  3P20 A;  4DXG A;  4YCV A;  2KA7 A;  3TBI B;  1SRU A;  1HNW Q;  4HJ7 A;  3ULL A;  3S14 H;  2HHH Q;  4L6T B;  1PYW D;  4Y7N H;  4HJ8 A;  4H44 C;  4QY7 A;  1RKN A;  5IT9 c;  1WTH A;  1L0W A;  3F2U A;  1QUQ B;  1SYF A;  3J80 i;  3S1M H;  4I7A A;  3RR5 A;  3ZYY X;  2JA9 A;  3KJO A;  1DD2 A;  5D14 A;  5KNC A;  3C2P A;  2XSC A;  5JPM C;  3KDF A;  4RH6 A;  2IHF A;  2CH4 A;  1LTS D;  2OEO A;  1U4M A;  2Z6B A;  1J5E Q;  2NVQ H;  3I4N G;  4TVA B;  1HQM C;  5FLX L;  2PMZ E;  2M9V A;  3PO3 B;  2BH8 A;  3TDQ A;  2KBN A;  4AYB G;  4K2K A;  1PFS A;  5C5M A;  3J7Y W;  4RAU C;  1G2S A;  4N8F A;  4YCU A;  1TWG B;  3VA5 A;  4XTC S;  1WFQ A;  4MIU A;  1EU3 A;  1X3G A;  3OTO L;  3GTK H;  2DNE A;  5FJ8 H;  4BA1 I;  2LS0 1;  3M9B A;  3CHB D;  3ZJY C;  5EKL A;  1E22 A;  5D3D A;  4GLX A;  5KRU A;  2VZA A;  5IP7 H;  4UP8 A;  1KRS A;  4FP5 D;  4AYB E;  5C6A A;  3UI2 A;  1I50 B;  1RL2 A;  3A5U A;  1SDF A;  1TWA B;  4LF6 L;  3Q23 A;  2KEN A;  2VS1 A;  1CM9 A;  4P74 A;  1DYQ A;  3CKI B;  1ASY A;  4HJ9 A;  3I3C A;  1VQJ A;  4PMB A;  1NMF A;  3RN5 A;  2QEX A;  3R2T A;  4DN4 M;  2MQH A;  3Q0A A;  4X66 L;  1F9P A;  3PUX A;  1XNQ Q;  1EUJ A;  2YTX A;  3E6Z X;  3T4A C;  1D8L A;  2WAQ B;  3QG1 A;  1SNQ A;  3UDX A;  1EIH A;  1PZJ D;  3QJY A;  2LKV A;  1D1I A;  1I5F A;  1ZKO A;  2X69 A;  1HCZ A;  2K14 A;  4OXP A;  1H9M A;  1GD7 A;  4GN4 B;  2Q8I B;  2PYK A;  4LJZ C;  3VR6 A;  1W2B A;  2FIN B;  4GKK Q;  4JV5 Q;  1I4H A;  1EZ8 A;  2NBF A;  4IJH A;  3J80 L;  4HID A;  1FJG Q;  2R7Z B;  3MZ5 A;  2UXC Q;  5T1G A;  4IO9 A;  1B7Y B;  3RNU A;  1S40 A;  3PQI A;  4PQX A;  4IOC A;  4IOA A;  4QUF A;  2UUC L;  1H9J A;  2KOL A;  3SHL A;  3E9H A;  3H94 A;  4XIG S;  3DEO A;  4DV5 L;  5M5W H;  3HOY G;  1VQC A;  4JI8 Q;  4JI6 Q;  4DUZ L;  2K5D A;  3R2I A;  2XN9 C;  5I6Y A;  1PTO F;  3S1R H;  4KY7 A;  2R92 G;  4DR6 L;  4DUY L;  1IHZ A;  3TSS A;  1DZ1 A;  4A3I B;  4HIM A; 
#chains in the Genus database with same CATH homology
 2QW7 A;  2HD3 A;  4N8X 1;  5L37 A;  4JVZ A;  2RCF A;  4I7A A;  4JW0 A;  2Z9H A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...