2Z9HA

Ethanolamine utilization protein, eutn
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of ethanolamine utilization protein EutN from E. coli
rcsb
source organism Escherichia coli
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein eutN
total genus 16
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2z9hA00
4JVZA 2Z9HA 4JW0A 2QW7A 5L37A 2HD3A 4N8FA 4N8X1 2RCFA 4I7AA
chains in the Genus database with same CATH superfamily
2N55A 1PTOB 3KF6B 5JAVA 2NTSA 1PYWD 4KY5A 4DR5L 2K14A 2I5LX 4ILWA 3S1RH 4IZ8A 4LFAQ 2JSOA 4JI2Q 1N33Q 5M9OA 5FO7B 1TWGH 5C44H 1CQFA 2R93H 4G7OC 1PYSB 3U4ZA 1D1IA 2JA5B 4PMCA 1E24A 2IHEA 5C4XB 1I4RA 4KI0A 4A3BG 4A3CG 3A56A 3VYRA 1HH2P 1TY2A 2E2JH 1SLJA 2OQ0A 1PTOF 4PMBA 3U9SA 3LGJA 4R8NA 2EYJA 3ERSX 1GD7A 4X66Q 4IPCA 3PIPA 1O80A 3PO3H 1X65A 1KD1C 3J7AF 4YY3Q 5JOBA 2VZAA 4X65Q 4X6AH 1KABA 2DNCA 2KEEA 3D3RA 1CK1A 2F0JA 1STNA 5ELEA 2VQFQ 4X3SA 2JA8B 5T1IA 2K52A 5CGKA 2B2UC 3KF8B 3HOYG 1PH9A 3FKIH 1IYVA 3KBGA 4KKTA 1UE6A 2XSCA 1M4VA 3GTLH 2CVRA 2NVYB 4KY6A 3KJOA 1NNXA 2D0PA 2NZOA 5EBCA 1C0AA 3M4PA 3FHWA 1VQJA 3A7AB 3VR3A 3BZKA 3PUZA 1JT8A 4LUZA 5M3MB 3MEFA 4XQJA 4UPAA 5NUCA 3H0GB 5FLXE 3HOZB 1J8IA 2D5DA 4LF7L 3D0FA 1VQGA 2HCIA 1VQ4A 1GM5A 3DMUA 4DFAA 2JA7H 3KOJA 3JAMi 1KRSA 2I0QA 3FPUB 3HOYH 1CUKA 2UU9Q 1SSOA 1X9NA 1JQYD 1AE3A 3FKIG 4DV1Q 1DCZA 2IT1A 4FXDA 1G6PA 1TWFH 5EBDA 1MJCA 4I65A 2XVSA 3CCSA 1I50H 1HNWQ 3HOVH 5CV7A 4FP5D 4N8FA 3SR1A 5LMNQ 2HT1A 5ELFA 4XIGS 1KLUD 4XXEA 4BBSH 3OPOA 5C44G 1JMCA 1SDFA 3IRBA 2L12A 5FO8B 4DV1L 4JI6L 1GHKA 1RIPA 1A15A 1NCVA 4KHPL 4G4KA 4A3GH 1ZEQX 2R93B 4YHHL 1HR0W 3M7GA 2VL6A 1NMFA 4LF5L 1Q12A 4F87A 3GTMB 5I6YA 3I55A 2PZWA 3HOVG 4DV2L 1H95A 4K6LA 1SAPA 2WAQB 3MA2B 1VMPA 1ASYA 2G5DA 1A3TA 1S72A 1TWHB 3M7NA 3MVVA 5M5WH 1XJVA 5M5XB 1MGSA 4A3EH 1STBA 4PMWA 1EY7A 1I6VC 3CC4A 2A68C 2JA6H 3E0JA 1QG7A 1UEBA 1SNDA 2F0IA 4A4IA 4TQUS 3STBD 4APVA 4F7XA 4LJZC 1S3OA 1UE5A 1PH8A 2SDFA 4HEDA 1I94L 1RODA 2AHOB 3EJIA 2MFIA 5HGQA 3CKIB 4H7BA 2AUKA 4PNYA 4HTHA 1PYBA 4EQOA 4B3ML 1KLGD 1JC7A 3I91A 3A54A 3NTIA 4JPBW 4JI0L 4BXXH 1YHBA 3W3AA 4X62L 5A35A 1A2UA 1FVIA 5DM73 1HNWL 3R2IA 2ENBA 3BVMA 2NN6I 3KUPA 1HHVA 2PQAB 3A7LA 3MAQA 2ZTCA 4C3JH 1U5KA 4M1UB 1OXSC 2WB1B 4GN5A 5G3LF 3GTQB 4A3DB 2F0WA 1CKOA 1CQVA 4ULLA 2EYMA 2MGSA 2F1MA 5KRUA 3PQIA 1Q90A 1X3PA 3GTGH 2XWBB 3KLSA 1BDOA 1VQNA 2CFMA 3BDLA 2B63G 4DR3Q 1MBYA 3QOLA 3RUZA 1TWFB 3AYHB 1TIID 3D6WA 3CCJA 1AN8A 3PF4A 4GLXA 3I90A 2B2WC 1IBKQ 2GA4B 2I07B 3CC2A 1O7LA 4BBSG 2Q2HA 1WTPA 2ZT9C 4B3RL 4LF6Q 2PQAA 1SNQA 1EY6A 3J81i 5C4HA 2J7ZA 1YJNA 1JWSD 1H9SA 4BY7G 4ZKCB 1YITA 4C3IH 3CCQA 3N6RA 5BN3A 2AMCB 1PH2A 5C3XA 5KEEA 1R9TH 4DR1Q 2NVXH 4XYOA 1FGUA 3BG3A 4NXML 4H0LC 4JI7L 1GUWA 1YNNC 3A0JA 1XNRQ 1EQTA 3K57A 3EA6A 4AQYQ 2YTVA 3PIOA 3S2DB 5C0XG 1LT3D 2A6HC 1O7YA 4P2CB 5ELDA 3UDXA 3SK4A 4UAIA 1AP0A 1W6JA 3NELA 5CBAE 3JAML 2UUAL 4EQNA 1BUVT 4QUFA 1TT2A 3OYYA 3S2HB 1VQIA 3S16B 1X56A 4F8MA 5K36G 2EY1A 2BDNA 4PZ6A 4LFCQ 3PF5A 4DR6Q 2PI2E 1YBYA 2OTJA 1C48A 2K1BA 1O78A 2EPBA 5LMNW 1SROA 5LMUL 4J15A 2JQOA 1PLFA 2PZUA 4A3LG 1HZ9A 1V1PA 2SNSA 3PIO3 4IPHA 4LMQD 3K59A 1EWHA 4PQXA 5JVG3 4DV7Q 5I9PA 1KAAA 4JI3Q 1JICA 3S14H 3AQQA 2MO1A 5FLXL 3UE1A 1X3GA 1QWYA 1PRTD 4DAMA 1MI2A 1T9HA 1OTCA 1EZ6A 3EVQA 4MIUA 3SXHA 4X65L 1B9NA 5FKAC 4ZKBB 4DUYQ 1DZ1A 1YVCA 1JB7A 5D3IB 2BDOA 2A5HA 3RLOA 1YEZA 2IX3A 1QVGA 2OCEA 1WI5A 4NKLA 3SHLA 4LF6L 4CKCA 4BY1H 2K5DA 2B2VC 3MXUA 1DOMA 1EWCA 3VR2A 3S15B 4QQBX 1E2ZA 4TSSA 3H3VI 5H1SE 1M90C 2AUJD 1F2ZA 1S5BD 2DUDA 4DR5Q 5KGUA 3SK5A 4GZYC 1WTVA 3L0OA 4KN4C 3MZ5A 3GTPB 3AB9A 4XQQA 5CBEE 3ICEA 2LXJA 2OEOA 1K8AC 4JI7Q 2LS01 2QILA 3HOWH 1OXTA 1Y8NB 3OMCA 3OTOL 1XMOQ 4X3TA 1PFBA 2RCNA 3QJYA 1A8VA 1N33L 1PXUA 1FGBD 1KDAA 4JOIC 1IL2A 1VQ9A 5C3EH 3H09A 2QEXA 1PZKD 3HS0C 4R8IA 4A3FG 4C3IG 4A3JH 1V1QA 3CCVA 4BY1G 1Z9FA 1HA5A 2KOLA 3VA5A 4KN7C 4O2DA 1VQAA 4CDCC 1WTXA 4C3IB 4J8QA 3K5NA 2LFNA 5C0XH 3M4OB 3K7AB 4CBVA 5CMDA 2KVMA 1IBML 1STGA 4ZK9B 1PTOH 2F0NA 5J1ZA 5K36H 1I94Q 4GLAC 1GUGA 1A0IA 1LLRD 1SNPA 2MUYA 1II3A 2NVQH 1PRTC 4BBRB 1BVSA 4HSPA 3D31A 3C46A 4B3MQ 4KJOA 1EYDA 2JYOA 2R7ZH 3FMCA 5M5XH 3F2BA 1S5DD 3PV0A 4OX9L 1T5EA 3MHBA 4WJWA 4EQ5A 1GXDC 2Z0SA 3ERQA 1DOKA 4FYDA 1LTBD 3H6MA 1Q1EA 1NE3A 5AJ3Q 2HDMA 2ZM6L 2KQ3A 2Y0SB 3K8AA 4QB4A 1EZ8A 2MP1A 3NWSA 5FLXc 1WTQA 4OL7A 2YV5A 1H9SB 1BBWA 2FMMA 3P7JA 2YYZA 4K6DA 2OF1A 3RN2A 2GVAA 1W3SA 1L0XB 3NEMA 4HJAA 5GAGC 3C3LA 3NTHA 5FOBB 1A2TA 1CZGA 2E2HB 5A2QL 3RNUA 5IYCH 2WAQE 2LY7A 2BA0A 3HKZG 4LFCL 2DNEA 2KECA 4X64Q 1U4RA 1KXLA 1SYCA 4YWLA 1Z6HA 1GJXA 1VQKA 1L1OC 5CC4A 2A6ED 1SMYC 4RKBA 4YWKA 1HUMA 1BCPD 1KL9A 1A3UA 3A5UA 4KHVA 4DNIA 2K4KA 4JOIA 1NY4A 3FDTA 2X6GA 1RTOA 1KAWA 3E9IA 3U58A 4ZQ3A 2RDGA 3HOWG 4A3MH 2N49A 1SE8A 5C4ZA 1EOTA 1K83H 4K2KA 4BY7B 3SK8A 3RN5A 4AYBB 2MPMA 4ODGA 4DR7Q 4A3BB 2IY5B 1SR3A 5IT9L 5C4XG 3RZOH 3PUYA 4L5QA 2RHSB 3QG1A 1F77A 4X62Q 1UE7A 2CQOA 3K6OA 1DJRD 4AQYL 3B6YA 5ELOA 5D14A 1KTKA 2I5MX 3H94A 1XWEA 2DY7A 4FXKC 2UXBL 1Q8KA 3D4DA 1S5CD 2B39A 4OO1H 4AYBE 1K0SA 3ULLA 4HSVA 1E2WA 4TKOB 1SEBD 1J5EL 3T16A 1P16A 4CJ2C 4N9TA 1AEXA 1OXVA 2WB1E 4A3MG 2JN4A 2KHIA 1IHZA 4P73A 4MZ9A 3K7AH 1I4GA 2K50A 5ISRA 4ME5A 1B3AA 1NBWA 1MKHA 1IKLA 1LM0A 4MTKA 1PV4A 2ATWA 3CCEA 2K5VA 5E7NA 2NYZD 3K0XA 3CPWA 2DY8A 3O13A 4K0KL 1O7IA 4IPDA 1ZYRC 2D62A 3P20A 4JI3L 4FF2A 2PMZE 1OXXK 1JORA 2IW3A 3G6JB 4J1MA 5IGDA 3S16H 2IHFA 2F3IA 2WIIB 1I3QB 3RLFA 5IGFA 3PUXA 3CQZH 1WCMH 3S1QB 2N3SA 1HNXQ 3CCRA 1TQOA 1XNRL 4S3SA 1TVXA 4B3SQ 3S14B 4AH6A 2CCZA 5DLQE 1S4ZA 1B4OA 1IL8A 1CTMA 1HZAA 2RBMA 1IW7C 2VXWA 1EQQA 2MJ8A 1BBUA 3KBXA 5EGTA 4IUTA 2OXPA 4GOPB 1X54A 1RDPD 3WOFA 2EJGC 5EKKA 2EYOA 4DUZQ 2QA4A 3RR5A 4YCVA 3E9HA 1YI2A 3HOUG 3EN2A 4A76A 2VY3A 4UP9A 1L0YB 5AJ3L 2ZM6Q 3J81c 2BE5C 1QE6A 4RH6A 2QF7A 4OWWB 1YNND 1DM0B 1N8RC 1H9RA 4DU9A 3MXPA 5CR3A 1HNZL 4GKKQ 1UEAB 3DXJC 1PFSA 4JV5Q 1UE1A 1H9JA 1Q81C 4HJ9A 4A93H 1AW7A 1V9PA 2K01A 4L63B 1TWCH 3U4VA 1AZQA 1KQSA 4QCLA 1I6HH 3TDQA 2F52A 3NP8A 1GO3E 1CKMA 2NVTB 2AKWB 5E3FA 1HQRD 2RA4A 3MC0B 2SNMA 4A3JB 1EEFD 1VDZA 1FJGL 1EFID 1K73C 4HJ7A 3OIPA 2PO4A 3VR5A 1VQ6A 4H02A 4DK0A 2L1BA 3NWTA 4B3TQ 3T1HQ 2ZJPA 1BCPB 3OHXC 3M4OH 1STEA 2E8GA 1KNEA 3I7FA 4A3KG 1E3PA 2O4XA 1SMXA 4OIKA 4JI5Q 2LMCB 5BN4A 4J6HA 2B2TA 4A93G 3MXNA 3WOEA 3AFQA 1BCPC 3V2TA 4POGA 2VUMG 1ESRA 5IGBA 3M4YA 1HZCA 4R4OA 2XTIA 1PH6A 2F03A 1EWIA 1XMOL 1J6QA 4RGNA 4RKLA 1NR2A 4POFA 1B3QA 1B1ZA 1VQDA 2NVXB 3K7UC 1Q86C 1Z47A 5C4JH 3QR8A 1EY5A 2K33A 2CWPA 3UI2A 2L4NA 4AIMA 4CGYB 3W5OA 1CHPD 4RHSA 1VQ5A 2EYLA 2F0MA 5FO9B 1Y1WH 4CDFC 3MEHA 1AZPA 3U9OA 2CH4A 1JOOA 2KCTA 3D8GA 4YCUA 2EQSA 1TS2A 3CU7A 1Y8PB 4YHHQ 5FJ8G 4G7ZC 3MXGA 5IP9H 3KLWA 2K05A 2B2YA 2Z8LA 3VA7A 2L5TA 2RDFA 5ELBA 1E0BA 4L5TA 1LACA 2EYHA 3J7ZC 3AU7A 5I4DA 3TZDA 2ZXOA 2UXCL 5LHY1 2XN9C 2K5NA 1X55A 3VDYA 4I7AA 2MQHA 2F0HA 3MWYW 4JYAL 3K5OA 3HOUH 4MHEA 4FF3A 3ITPA 3TP5A 4A3DG 2DJFC 1VQCA 3MFYA 2A74C 1Y1WG 3IFTA 3R2TA 1ET6A 5FLMH 1B53A 3CC7A 2ICEC 1VQ8A 1XPUA 2FXQA 4GLVB 3S15H 1RF2D 3TBIB 2CKZB 5JPMC 5IYDH 1SNCA 3Q23A 4JBKA 2VW9A 3I4NB 4B3TL 1SNOA 2ICIA 1G6ZA 3M4QA 3G4SA 4A3BH 2E75C 4JI8L 4RG1A 4UP8A 4HJ8A 2HD3A 3C1FA 1CT1D 3KLSX 1Y1VB 1WD1A 4H13C 1EQVA 5EJWA 5KIXA 3I4NG 4QF4A 1ASZA 1VQHA 3I3CA 4V190 4KHPQ 2KHJA 3PUWA 2HHHQ 1WTHA 2KHSA 1M8AA 4ZLTF 2X6LA 3F2UA 1J9OA 3GTPH 2Z4HA 1AE2A 2B2VA 3AFPA 1FNVA 1PH1A 3HOWB 4DR2Q 1L1OB 3IFDA 4KHZA 4C3HG 2NN6G 4L5RC 4OHJA 2M00A 3IAYA 2F4IA 2RVLA 4BBSB 4BBRG 2A69C 1A63A 3PUVA 4DR3L 1JOKA 1G51A 4DAYA 1QVFA 3N52A 2FFKB 1SMYD 1BNZA 1LTTD 4ALPA 2R92G 1KNAA 1SXTA 1I4HA 1SYFA 1TWGB 2QCPX 4CHTB 1HCZA 1X3FA 2JXMB 3BVGA 3RLNA 4HIOA 4DPGA 4HIMA 1RCVD 3WDNA 3AEVA 1BKBA 3HOXB 3BJUA 3FVQA 1QVCA 2ZTDA 1I4XA 2IX0A 3CF5A 2UUBQ 3GTKH 1STYA 1L1OA 3T1HL 4IPGA 2BCOA 5FJ8H 4X64L 4JI0Q 1KDCA 4HN7A 3EQLC 2Z1CA 4DUZL 1ILPA 4OEMB 1UAPA 4BBRH 1RKNA 4IOCA 1QNUA 1YNJC 1QZGA 1H9MA 3CP0A 3D4WA 1CHQD 3S1MB 2BH8A 4RCNA 2B63B 1UWVA 4ABNA 3GTOH 1GVPA 4NDXA 4RHRA 5IWAL 1X3QA 2K03A 2VUMB 4RMFA 2JA8H 4KJNA 4FO2A 2NTTA 4X66L 5CV6A 3TP6A 2PMZB 3PO2B 4A3KB 5FLMG 1GUSA 1SBBB 1LO5D 3QIAA 4YY3L 2PPBC 4DV6Q 2EY5A 1PA6A 2PZTA 3A8KE 5GAEC 2YU9B 3NUCA 1RD9D 4KKSA 4UP7A 1EIGA 3QO2A 3V05A 5IP7H 4R1JA 5CORA 3TN2A 5IE8A 1WOCA 3X3NA 2K6AA 3HZXA 4Q0FA 1VQMA 4O0AA 1U9RA 3I4NH 1I6HB 3TS0A 3WWVA 1EOVA 1N36Q 1Y69U 1SFOH 2NVTH 5M3FG 1HJPA 4JW0A 1I50B 1SE4A 3DEPA 3CRLC 4KD4A 2GVBA 4IUPA 2D0OA 3HOYB 4ZUIA 1K8GA 3A74A 3H15A 3BU2A 5EAYA 2XGTA 3NQIA 4PV1C 1W2BA 2JP1A 2NN6H 4K5XA 3VR4A 2F0UA 1DYQA 1TWAH 3VR6A 2FINB 4MTNA 2HQEA 3C2PA 3VYSA 3SVMA 3OMGA 4DV4L 3HOVB 3EFXD 3F8TA 2K32A 2PYKA 3UDGA 3I4MB 4DXGA 4JBMA 4LAAA 2EE1A 3KDFB 1X6OA 2A6EC 3MTSA 2CWAA 2PW7A 3M9BA 1HR0Q 3KF8A 1R9TB 3SGIA 3H0GG 3J7A5 5IGGA 4OGQC 1D5ZC 1YJ9A 1PMRA 1K28A 2HIXA 1F9SA 5C4JB 1IBKL 4B3SL 2CW0D 1B8AA 2EXDA 3L3OC 1KC8C 2UUCQ 3S2DH 1BR9A 4IN3A 4O42A 4CDDC 1YIJA 2C35B 5COYA 5D65A 1GOZA 1Y1WB 2E76C 2OTLA 3QWNA 4E6IA 3NPPA 3SK6A 2F0TA 1JWMD 4JK1C 4HMJA 1PTOD 2WFWA 2H5XA 2K5HA 2EOTA 1AFPA 1ZXTA 1PZID 4R4QA 2IWHA 4EGVA 3JC66 5TSSA 3V96A 1AH9A 1B7YB 2B29A 3I8ZA 1DXMA 2QGQA 2A19A 1TS4A 2A73B 2JA8G 5GQOA 1GKHA 1N34L 2I5HA 4DAVA 5KNCA 3F2DA 1Q7YC 2K75A 2O5IC 2B63H 4GNXB 3FKIB 4DV3Q 3Q0AA 4Q5VA 1YZ6A 1VQEA 2UUAQ 2CH4W 1TU2B 1BQQT 1EYAA 1EFWA 4C56C 4JI1Q 1K0RA 1QILA 3ER0A 5E4XA 4K5WA 1D7QA 1SJHD 1CM9A 5I2XA 1IBLQ 5GROA 1QJOA 2YTXA 4LUOA 4LF4L 2JA7G 3R3OA 1CFMA 4A3EG 3CXCA 3GDEA 1U4LA 4GKJL 2XWJB 1F9RA 4R4CA 1G291 3L7ZC 2ZJQA 1FD7D 1PDQA 3KF6A 1EY0A 2RCFA 1Q46A 5GAHC 1VQ7A 1QNKA 1VMCA 4AYBG 4Z9CB 1CKNA 3I72A 1XPOA 3MFGA 4NXNQ 4DR2L 5M3FH 3SEBA 1ENFA 2H1EA 2B2YC 4A93B 4DN4M 4U673 4JBWA 2ES2A 3TRZA 1GUOA 2CW0C 4BXXG 1LTID 3PMFA 4P74A 1LTSD 1VCIA 1LABA 2XIWA 3DM3A 1IBMQ 1LT4D 4WJ3M 1ML0D 1V1PB 5I6WA 3LWUA 4RGOS 1MSGA 3CPFA 2KA7A 2NUCA 1ENCA 1HQMC 2QEJC 4C3JG 5I2YA 2KEDA 2AQ1B 4DV5Q 4GNXA 1ESFA 5DNFA 3CD6A 2NB0A 4BA2I 1NSNS 4N8X1 4ZYSA 4A3GG 1U4PA 4NXNL 1DOLA 4P71A 4GOPA 2H4OA 3Q8DA 2C9OA 3J81L 3HGBA 2AWNA 1A62A 3CAMA 2K5QA 2D9UA 4LFBL 2G9DA 1K8MA 5LL6X 1IXRA 1C7YA 3JAMc 4JI4Q 1MJEA 3HKZB 4QGUA 2F0FA 4GOPC 3CHBD 2ZXPA 3GTKB 1SE3A 2Y0SE 1S40A 2LKVA 3I4MG 4LK1C 5LMNL 2B2UA 3M3YB 1CA5A 1O7ZA 3CMAA 5KYLA 3HRZC 3BDCA 4P75A 1IBLL 2B8GA 4XYQA 2Z9HA 3PO2G 2EDGA 3LX0A 5M5WB 4YCWA 4CDEC 3K5LA 1QB5D 1HXYD 4HR7B 3J80c 1Q1BA 4K14A 2B8FA 3A55A 1PRTB 1HR0L 2XNAC 3PGZA 2EIFA 3S1NB 5KNDA 1BO0A 2F0GA 4P72A 2N78A 2XRSD 4OXPA 5C0XI 4BS9A 1RHPA 2RF4A 2RQXA 3HKZE 2QDBA 3M85A 5JJLA 2WAQG 3GTOB 1TS5A 3BZDB 4C1NK 5BN5A 2WB1G 5C3EG 1E1TA 1EYGA 2UUBL 4WJ4A 2SEBD 1F9PA 4RA8A 1HZBA 1C9OA 1PFNA 3PO2H 1I4QA 2Q2TA 5HURA 4L8JA 3BYTB 1RTNA 1HNXL 3I56A 5EQ0A 1CZWA 3G48A 4C3JB 1FNWA 3T1YQ 3HOUB 3NK9A 1MSHA 1D1KA 4A3IH 2O2LD 2JEAI 2A69D 3HOZH 4TVAB 3VYUA 2B2WA 3VYTA 2Z6KC 1MD2D 3T4AC 1QUQA 2MNAA 3T51B 1R4QB 4JI5L 1NJIC 1UUPA 3NBHB 2VQEL 3CCMA 3RMHA 1HPCA 4LFBQ 2JA9A 1B50A 1VQLA 4BY7H 3F1ZA 3NHHA 3A5ZB 4RAUC 1JE5A 4XQNA 2JA6G 3Q22A 2CHBD 3ND9A 3AMUA 1CI3M 4QJFA 2HDLA 5ELNA 4FF1A 3H3VH 3RZOB 3K58A 1BXTA 1XMQL 2R6GA 1HNZQ 3Q24A 2UUCL 1NTGA 2RDHA 5A2QE 4A3IG 2A8VA 4DNRB 5M5YB 4EX5A 4CJ0B 3HOZG 3S17B 4LF7Q 1UNSA 2MHVA 4OIJA 4DKAC 3KLRA 4LNQA 3E5SA 2ZXRA 5KNBA 2UU9L 3KFUA 1Y8OB 2WKCA 3I4MH 3C1EA 1WD0A 4YWMA 2E5LL 2FJ2A 5IYCG 1EYCA 2Q2IA 1NR4A 4LW1A 4ZRZA 3FPPA 3URYA 3S2HH 3OW7A 4LUVA 1QUQB 5J22A 5IWAQ 1SYBA 4OO1I 1EY4A 4DF7A 5IGCA 3D4RA 3DWAA 1XTDA 1FL0A 2VS1A 3EIVA 2FHTA 1SYDA 2PNHA 1ONLA 4B08A 4NB3A 1TWHH 1HRJA 2R7ZB 2HCCA 4C2MH 3S24A 3J7YW 5L37A 2JE6I 3NBIA 3R93A 1JCKB 4OWXB 4KMUC 3NENA 3RZDH 1TXYA 1YHAA 2QDLA 4R4IA 5FK9C 1YHQA 3E3XA 2R7ZG 4ID6A 1Q8IA 1EY9A 4UDUC 1WTRA 4RGTA 3PSIA 5DEHA 2RHQB 1B9MA 2XRQD 1OXUA 5C5MA 4NMZA 3E6ZX 4DV0Q 1K3BC 4OX9Q 1N36L 4LF8L 4H44C 4CKBA 4TRDA 1JE4A 1LTAD 2KJXA 2F4VL 3ONAB 2GN5A 1FJGQ 4O1NA 3J7AV 4ZUJA 3LWEA 4Y7NH 4U68A 2QW7A 3OIQA 3W1GA 1NAPA 3J80i 3PIP3 2ZTEA 1KHIA 3W1BA 1GUNA 3G7LA 1JR0D 1HUNA 1K83B 3U50C 3DLLA 1YNJD 2DGYA 1BOSA 1Q3LA 3I73A 3L2PA 2EJMA 2L55A 1BF4A 5BR8Q 1KDBA 2AWOA 1JJ2A 3BZCA 4DV4Q 2TSSA 2A68D 5IGEA 3QOJA 1F2MA 4BY1B 1LT6D 5D3DA 2Z4IA 3GV6A 4ZCKA 1J5EQ 4OWTB 1D8LA 4IFDJ 3T56B 1L0WA 4HJ5A 4A3LH 2F0VA 1CSQA 2RSOA 4Y52H 1TWAB 1W6KA 2EYFA 1ET9A 2EXZA 2AQ3B 5C6AA 4XTCS 1C8CA 4DA2A 2R61A 2R7DA 4IJLA 3GTJB 4RFBA 1ILQA 4FVMA 4MNOA 5T1GA 4RCOA 1PHJA 2F0DA 1H9KA 4KV6A 4B9XA 1PVOA 2ZJRA 5JVH3 5C44B 5C3EB 4XT3B 1DONA 2V1CC 1XXGA 2VB3X 2KCCA 2F3WA 5C4XH 5J39A 1SYGA 4DR7L 1XTCD 4K2LA 4IQZA 3ND8A 1SN8A 2NZHA 1E7ZA 1EEID 4IOAA 1N34Q 4DK6C 4JG2A 5HY6A 3TS2A 3M3YH 1SRUA 5CV4A 1NUCA 2UXDQ 3I4LA 2PNRC 4C1NI 2NVQB 2J4XA 3KYHC 4IUQA 3BVZA 2NZ1D 4HCSA 2WKDA 2X69A 4JYAQ 2LSSA 2I46A 1QOHA 1A3VA 5LL6S 3T53B 4XDXA 4CKEA 4LF8Q 3FEWX 4FXGC 2E74C 3GO5A 4PZ8A 2L11A 4GKJQ 2LXKA 3DHQA 4MN3A 3HOXG 2AQ2B 4DGZA 2C5CA 4KD3A 3PO3B 1VF7A 2VB2X 4X3KA 4A3FH 5HGTA 4IALA 3FP9A 4KTAA 4A3JG 4LF5Q 3IL8A 2BOSA 5JEAH 1EIYB 1P8LA 3CMEA 3S1QH 4HMIA 3T1YL 1OO9B 5CV8A 1TR5A 3S1NH 1HFGA 1L2FA 3A8JE 2BH2A 2VQEQ 1F2YA 2L0CA 4JI8Q 1HTLD 1T5XD 2K28A 2BA1A 4LF9Q 2K5WA 1VQPA 2EYPA 4YIJA 5EKIA 1JOQA 1WCMG 2K04A 4IFDH 3H91A 1IYUA 2IJ0A 2PCFB 3QB3A 5JJKA 4M8AA 4QY7A 5EPKA 2E2HH 2L9HA 3GQBA 2Q2UA 1JJCB 2L15A 4XT1B 3NQTA 1DGSA 3DWQA 4BWGB 1EL0A 1D5MC 5JPNC 5JEAG 4A3MB 1PH4A 4DAYB 1IYJB 1XMQQ 4B3RQ 3F2CA 1EY8A 1FR3A 3CCUA 1I4PA 1D2BA 3UDIA 3STBC 1X3EA 1LTGD 1LYLA 1RL2A 3EROA 3OOCA 2JK8A 4DAPA 2E2IH 1B44D 2FMCA 1E22A 1Z7TA 4JCVE 5E4WC 4LFAL 4CJ1B 4JI4L 3SE0A 1K8OA 1WYDA 4R4TA 4DK3C 2RSNA 4PG3A 2KBNA 5K5PA 2UXDL 5IT9E 4IFDG 4NXMQ 2R92B 2NBFA 2SOBA 2HQLA 2QKIC 5EPLA 2DJGC 1D5XC 2Q8RE 3TQYA 1SE2A 3A8IE 1MHWC 4UY8C 1YJWA 5GADC 2KCNA 1ZKOA 4PZ7A 5JJZA 4X3UA 1VQFA 2TMPA 4GNXC 1STAA 5BR8L 1VQBA 1PH3A 2F0LA 4A3GB 4RGMA 4IFDI 2E2DC 4K8JA 1KIXA 2IX1A 1WVLA 2G9HD 1E2VA 2JEBI 3KJPA 3OWEB 3S17H 3L9AX 3CCLA 1CKNB 2F3VA 4ZAIA 1Q82C 3RD4A 2PQEA 2YTYA 2EY2A 1BBXC 1STHA 4GS3A 4OELB 4LWCA 3DM1A 2WP8J 5F2DA 2OWOA 2Q8TA 1U0LA 2KENA 4HIDA 1PH5A 1MIUA 3HOXH 3S9WA 4DV0L 3GTMH 4LF9L 4C2MB 4JVZA 2UXCQ 1E1OA 4GN3B 5J3BA 5IYDG 3BS1A 3NSWA 1PFMA 1S5FD 5EKLA 1PH7A 5M3MG 2E2JB 1QCBD 2RKSA 4QL5A 4EVOA 3GP7A 4G7HC 1QZHA 3KK7A 1M1KC 2F0SA 4DR4L 1JWUD 3I70A 2Y0SG 1IKMA 2ALYB 2EZVA 1Y1VG 4A3EB 4OO1G 4JC0A 1DD2A 1PRTF 1S5ED 2MO0A 5KYIA 3J80L 1LT5D 3TP7A 5C3WA 4DV2Q 2JA6B 3IKJA 1WCMB 4IO9A 4IUVA 3RZDB 4HAEA 5EPJA 5IIFA 1C4QA 3NXWA 1HA6A 2M9VA 1ICWA 3K5MA 4JV5L 1PZJD 4DR6L 3K80C 4NP5A 1LTLA 1XPRA 1CA6A 2K7VA 2VQFL 1ZYRD 1EU4A 2DN8A 2WINB 5M3MH 4IUNA 2YU9H 1YNXA 3NE5B 3I2ZA 3OTOQ 2HHHL 1G2SA 1SNMA 2F0PA 3GTGB 4DR4Q 1G2TA 1LTRD 3KDFA 3GD7A 4QMGA 1WFQA 3FRPB 2F0QA 2ID0A 1Y1VH 4GN4B 1XNQQ 1TKWB 1PTOC 2NWGA 3HKSA 4JBJA 4QIWB 1A6XA 4C3HB 4DV7L 4A3DH 2A6HD 1SFOB 1EQRA 3JAME 2A1AA 5JJIA 1RJTA 5IYBG 4A3IB 4DV6L 1JB3A 1N9WA 4IURA 1GUTA 2N8NA 2JA5G 5CV5A 4FNFA 1LUZA 3BDOA 2HUGA 1EU3A 2OQKA 1TWCB 3HG9A 3TP8A 1N32Q 3D6CA 4DUYL 1IZ6A 5DM63 2F0EA 3ULJA 4G57A 3UE0A 2HIVA 3SDZA 4NW2A 3J81E 1VF5C 4BA1I 1FNUA 2V4DA 1SYEA 3OWFA 1NMGA 4K0KQ 4K8IA 5ELCA 2Q8IB 3TEHB 2D2CC 5CYUA 3J80E 3S1RB 5AFWA 2P5ZX 2PW5A 4KK7A 4B9WA 4FDBA 5JEAJ 3H3VC 5M5YH 5IYBH 1EIHA 1V8QA 3OW2A 4QUCA 4WFN3 2JA5H 1F2LA 3K0YA 3TSSA 1VQOA 1F9QA 3HEJA 4DK1A 3GTJH 1K9MC 1WTOA 2F0OA 2ASBA 1N32L 3CRKC 2KUMA 4WRDA 5E1FA 3K81C 3OSOA 4JI1L 5IT9c 5G3LD 4KY7A 4A3FB 3NTKA 3S1MH 4V0BA 4ME3A 2F4VQ 1HTPA 2B2TC 2Z6BA 3GV3A 4FF4A 1I3QH 4LF4Q 4KKUA 3CQZB 1XX8A 2O5JC 2B3GA 4JI2L 3PO3G 3MXNB 1B2TA 5C0XJ 4I7ZC 2R3ZA 1X32A 1TY0A 4A3KH 1XYIA 4HIKA 2EY6A 2F0KA 3NBHA 3W2DA 1V43A 2M2LA 5IODA 1SJED 2WACA 1Y14B 1D6EC 4EQPA 1G8ZD 2VUMH 3GTLB 1WJJA 2NVYH 1WTWA 1EIFA 1CSPA 3TREA 1VS0A 2IPKD 1K3RA 3TZUA 3R8BA 4DV5L 1FYCA 2OT2A 2R7FA 3BYYB 3G71A 2CQAA 3DUZA 2N88A 4R9WA 4RWSC 5DAUA 3GTQH 2J0TD 2EVBA 4DV3L 3H0GH 4OONA 4IUUA 5LMUQ 3HP3A 3T13A 1R4PB 1TS3A 3DEOA 5M3FB 3X3MA 3PCOB 3J81j 3HFZB 2JA7B 2KCMA 2WV6D 1ICFB 4KLKA 5IY0A 2EJFC 4DXFA 4Y7NB 2UXBQ 4C3HH 3EBEA 1V1OA 3I4OA 4DR1L 3DWPA 5IOCA 5IP9G 3G6EA 1G91A 2R93G 4JI6Q 1ENAA 3LNNA 3E0EA 4IJHA 3ULPA 5I9OA 3CW2C 1BCPF 4UHVA 2E2IB 1EUJA 2IL8A 5IP7G 1IW7D 3TMEA 3Q6SA 4L5SA 4A75A 4L6TB 4A3CH 4N9PA 1KRTA 2E5LQ 4HCEA 4WORA 2VNUD 1B70B 3UDFA 4NPSA 2Z6KA 4GKKL 1GHJA 1JJGA 2R92H 5CV9A 1I5FA 3P1HA 4K5VA 1LV9A 4QIWE 1HFNA 3P75A 1XNQL 2JJQA 2PI2A 3ZJYC 3ZYYX 2BE5D 1U4MA 5C5LA 4F88A 4DNTB
chains in the Genus database with same CATH topology
4JVZA 2Z9HA 4JW0A 2QW7A 5L37A 2HD3A 4N8FA 4N8X1 2RCFA 4I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVZ A;  2Z9H A;  4JW0 A;  2QW7 A;  5L37 A;  2HD3 A;  4N8F A;  4N8X 1;  2RCF A;  4I7A A; 
#chains in the Genus database with same CATH topology
 2N55 A;  1PTO B;  3KF6 B;  5JAV A;  2NTS A;  1PYW D;  4KY5 A;  4DR5 L;  2K14 A;  2I5L X;  4ILW A;  3S1R H;  4IZ8 A;  4LFA Q;  2JSO A;  4JI2 Q;  1N33 Q;  5M9O A;  5FO7 B;  1TWG H;  5C44 H;  1CQF A;  2R93 H;  4G7O C;  1PYS B;  3U4Z A;  1D1I A;  2JA5 B;  4PMC A;  1E24 A;  2IHE A;  5C4X B;  1I4R A;  4KI0 A;  4A3B G;  4A3C G;  3A56 A;  3VYR A;  1HH2 P;  1TY2 A;  2E2J H;  1SLJ A;  2OQ0 A;  1PTO F;  4PMB A;  3U9S A;  3LGJ A;  4R8N A;  2EYJ A;  3ERS X;  1GD7 A;  4X66 Q;  4IPC A;  3PIP A;  1O80 A;  3PO3 H;  1X65 A;  1KD1 C;  3J7A F;  4YY3 Q;  5JOB A;  2VZA A;  4X65 Q;  4X6A H;  1KAB A;  2DNC A;  2KEE A;  3D3R A;  1CK1 A;  2F0J A;  1STN A;  5ELE A;  2VQF Q;  4X3S A;  2JA8 B;  5T1I A;  2K52 A;  5CGK A;  2B2U C;  3KF8 B;  3HOY G;  1PH9 A;  3FKI H;  1IYV A;  3KBG A;  4KKT A;  1UE6 A;  2XSC A;  1M4V A;  3GTL H;  2CVR A;  2NVY B;  4KY6 A;  3KJO A;  1NNX A;  2D0P A;  2NZO A;  5EBC A;  1C0A A;  3M4P A;  3FHW A;  1VQJ A;  3A7A B;  3VR3 A;  3BZK A;  3PUZ A;  1JT8 A;  4LUZ A;  5M3M B;  3MEF A;  4XQJ A;  4UPA A;  5NUC A;  3H0G B;  5FLX E;  3HOZ B;  1J8I A;  2D5D A;  4LF7 L;  3D0F A;  1VQG A;  2HCI A;  1VQ4 A;  1GM5 A;  3DMU A;  4DFA A;  2JA7 H;  3KOJ A;  3JAM i;  1KRS A;  2I0Q A;  3FPU B;  3HOY H;  1CUK A;  2UU9 Q;  1SSO A;  1X9N A;  1JQY D;  1AE3 A;  3FKI G;  4DV1 Q;  1DCZ A;  2IT1 A;  4FXD A;  1G6P A;  1TWF H;  5EBD A;  1MJC A;  4I65 A;  2XVS A;  3CCS A;  1I50 H;  1HNW Q;  3HOV H;  5CV7 A;  4FP5 D;  4N8F A;  3SR1 A;  5LMN Q;  2HT1 A;  5ELF A;  4XIG S;  1KLU D;  4XXE A;  4BBS H;  3OPO A;  5C44 G;  1JMC A;  1SDF A;  3IRB A;  2L12 A;  5FO8 B;  4DV1 L;  4JI6 L;  1GHK A;  1RIP A;  1A15 A;  1NCV A;  4KHP L;  4G4K A;  4A3G H;  1ZEQ X;  2R93 B;  4YHH L;  1HR0 W;  3M7G A;  2VL6 A;  1NMF A;  4LF5 L;  1Q12 A;  4F87 A;  3GTM B;  5I6Y A;  3I55 A;  2PZW A;  3HOV G;  4DV2 L;  1H95 A;  4K6L A;  1SAP A;  2WAQ B;  3MA2 B;  1VMP A;  1ASY A;  2G5D A;  1A3T A;  1S72 A;  1TWH B;  3M7N A;  3MVV A;  5M5W H;  1XJV A;  5M5X B;  1MGS A;  4A3E H;  1STB A;  4PMW A;  1EY7 A;  1I6V C;  3CC4 A;  2A68 C;  2JA6 H;  3E0J A;  1QG7 A;  1UEB A;  1SND A;  2F0I A;  4A4I A;  4TQU S;  3STB D;  4APV A;  4F7X A;  4LJZ C;  1S3O A;  1UE5 A;  1PH8 A;  2SDF A;  4HED A;  1I94 L;  1ROD A;  2AHO B;  3EJI A;  2MFI A;  5HGQ A;  3CKI B;  4H7B A;  2AUK A;  4PNY A;  4HTH A;  1PYB A;  4EQO A;  4B3M L;  1KLG D;  1JC7 A;  3I91 A;  3A54 A;  3NTI A;  4JPB W;  4JI0 L;  4BXX H;  1YHB A;  3W3A A;  4X62 L;  5A35 A;  1A2U A;  1FVI A;  5DM7 3;  1HNW L;  3R2I A;  2ENB A;  3BVM A;  2NN6 I;  3KUP A;  1HHV A;  2PQA B;  3A7L A;  3MAQ A;  2ZTC A;  4C3J H;  1U5K A;  4M1U B;  1OXS C;  2WB1 B;  4GN5 A;  5G3L F;  3GTQ B;  4A3D B;  2F0W A;  1CKO A;  1CQV A;  4ULL A;  2EYM A;  2MGS A;  2F1M A;  5KRU A;  3PQI A;  1Q90 A;  1X3P A;  3GTG H;  2XWB B;  3KLS A;  1BDO A;  1VQN A;  2CFM A;  3BDL A;  2B63 G;  4DR3 Q;  1MBY A;  3QOL A;  3RUZ A;  1TWF B;  3AYH B;  1TII D;  3D6W A;  3CCJ A;  1AN8 A;  3PF4 A;  4GLX A;  3I90 A;  2B2W C;  1IBK Q;  2GA4 B;  2I07 B;  3CC2 A;  1O7L A;  4BBS G;  2Q2H A;  1WTP A;  2ZT9 C;  4B3R L;  4LF6 Q;  2PQA A;  1SNQ A;  1EY6 A;  3J81 i;  5C4H A;  2J7Z A;  1YJN A;  1JWS D;  1H9S A;  4BY7 G;  4ZKC B;  1YIT A;  4C3I H;  3CCQ A;  3N6R A;  5BN3 A;  2AMC B;  1PH2 A;  5C3X A;  5KEE A;  1R9T H;  4DR1 Q;  2NVX H;  4XYO A;  1FGU A;  3BG3 A;  4NXM L;  4H0L C;  4JI7 L;  1GUW A;  1YNN C;  3A0J A;  1XNR Q;  1EQT A;  3K57 A;  3EA6 A;  4AQY Q;  2YTV A;  3PIO A;  3S2D B;  5C0X G;  1LT3 D;  2A6H C;  1O7Y A;  4P2C B;  5ELD A;  3UDX A;  3SK4 A;  4UAI A;  1AP0 A;  1W6J A;  3NEL A;  5CBA E;  3JAM L;  2UUA L;  4EQN A;  1BUV T;  4QUF A;  1TT2 A;  3OYY A;  3S2H B;  1VQI A;  3S16 B;  1X56 A;  4F8M A;  5K36 G;  2EY1 A;  2BDN A;  4PZ6 A;  4LFC Q;  3PF5 A;  4DR6 Q;  2PI2 E;  1YBY A;  2OTJ A;  1C48 A;  2K1B A;  1O78 A;  2EPB A;  5LMN W;  1SRO A;  5LMU L;  4J15 A;  2JQO A;  1PLF A;  2PZU A;  4A3L G;  1HZ9 A;  1V1P A;  2SNS A;  3PIO 3;  4IPH A;  4LMQ D;  3K59 A;  1EWH A;  4PQX A;  5JVG 3;  4DV7 Q;  5I9P A;  1KAA A;  4JI3 Q;  1JIC A;  3S14 H;  3AQQ A;  2MO1 A;  5FLX L;  3UE1 A;  1X3G A;  1QWY A;  1PRT D;  4DAM A;  1MI2 A;  1T9H A;  1OTC A;  1EZ6 A;  3EVQ A;  4MIU A;  3SXH A;  4X65 L;  1B9N A;  5FKA C;  4ZKB B;  4DUY Q;  1DZ1 A;  1YVC A;  1JB7 A;  5D3I B;  2BDO A;  2A5H A;  3RLO A;  1YEZ A;  2IX3 A;  1QVG A;  2OCE A;  1WI5 A;  4NKL A;  3SHL A;  4LF6 L;  4CKC A;  4BY1 H;  2K5D A;  2B2V C;  3MXU A;  1DOM A;  1EWC A;  3VR2 A;  3S15 B;  4QQB X;  1E2Z A;  4TSS A;  3H3V I;  5H1S E;  1M90 C;  2AUJ D;  1F2Z A;  1S5B D;  2DUD A;  4DR5 Q;  5KGU A;  3SK5 A;  4GZY C;  1WTV A;  3L0O A;  4KN4 C;  3MZ5 A;  3GTP B;  3AB9 A;  4XQQ A;  5CBE E;  3ICE A;  2LXJ A;  2OEO A;  1K8A C;  4JI7 Q;  2LS0 1;  2QIL A;  3HOW H;  1OXT A;  1Y8N B;  3OMC A;  3OTO L;  1XMO Q;  4X3T A;  1PFB A;  2RCN A;  3QJY A;  1A8V A;  1N33 L;  1PXU A;  1FGB D;  1KDA A;  4JOI C;  1IL2 A;  1VQ9 A;  5C3E H;  3H09 A;  2QEX A;  1PZK D;  3HS0 C;  4R8I A;  4A3F G;  4C3I G;  4A3J H;  1V1Q A;  3CCV A;  4BY1 G;  1Z9F A;  1HA5 A;  2KOL A;  3VA5 A;  4KN7 C;  4O2D A;  1VQA A;  4CDC C;  1WTX A;  4C3I B;  4J8Q A;  3K5N A;  2LFN A;  5C0X H;  3M4O B;  3K7A B;  4CBV A;  5CMD A;  2KVM A;  1IBM L;  1STG A;  4ZK9 B;  1PTO H;  2F0N A;  5J1Z A;  5K36 H;  1I94 Q;  4GLA C;  1GUG A;  1A0I A;  1LLR D;  1SNP A;  2MUY A;  1II3 A;  2NVQ H;  1PRT C;  4BBR B;  1BVS A;  4HSP A;  3D31 A;  3C46 A;  4B3M Q;  4KJO A;  1EYD A;  2JYO A;  2R7Z H;  3FMC A;  5M5X H;  3F2B A;  1S5D D;  3PV0 A;  4OX9 L;  1T5E A;  3MHB A;  4WJW A;  4EQ5 A;  1GXD C;  2Z0S A;  3ERQ A;  1DOK A;  4FYD A;  1LTB D;  3H6M A;  1Q1E A;  1NE3 A;  5AJ3 Q;  2HDM A;  2ZM6 L;  2KQ3 A;  2Y0S B;  3K8A A;  4QB4 A;  1EZ8 A;  2MP1 A;  3NWS A;  5FLX c;  1WTQ A;  4OL7 A;  2YV5 A;  1H9S B;  1BBW A;  2FMM A;  3P7J A;  2YYZ A;  4K6D A;  2OF1 A;  3RN2 A;  2GVA A;  1W3S A;  1L0X B;  3NEM A;  4HJA A;  5GAG C;  3C3L A;  3NTH A;  5FOB B;  1A2T A;  1CZG A;  2E2H B;  5A2Q L;  3RNU A;  5IYC H;  2WAQ E;  2LY7 A;  2BA0 A;  3HKZ G;  4LFC L;  2DNE A;  2KEC A;  4X64 Q;  1U4R A;  1KXL A;  1SYC A;  4YWL A;  1Z6H A;  1GJX A;  1VQK A;  1L1O C;  5CC4 A;  2A6E D;  1SMY C;  4RKB A;  4YWK A;  1HUM A;  1BCP D;  1KL9 A;  1A3U A;  3A5U A;  4KHV A;  4DNI A;  2K4K A;  4JOI A;  1NY4 A;  3FDT A;  2X6G A;  1RTO A;  1KAW A;  3E9I A;  3U58 A;  4ZQ3 A;  2RDG A;  3HOW G;  4A3M H;  2N49 A;  1SE8 A;  5C4Z A;  1EOT A;  1K83 H;  4K2K A;  4BY7 B;  3SK8 A;  3RN5 A;  4AYB B;  2MPM A;  4ODG A;  4DR7 Q;  4A3B B;  2IY5 B;  1SR3 A;  5IT9 L;  5C4X G;  3RZO H;  3PUY A;  4L5Q A;  2RHS B;  3QG1 A;  1F77 A;  4X62 Q;  1UE7 A;  2CQO A;  3K6O A;  1DJR D;  4AQY L;  3B6Y A;  5ELO A;  5D14 A;  1KTK A;  2I5M X;  3H94 A;  1XWE A;  2DY7 A;  4FXK C;  2UXB L;  1Q8K A;  3D4D A;  1S5C D;  2B39 A;  4OO1 H;  4AYB E;  1K0S A;  3ULL A;  4HSV A;  1E2W A;  4TKO B;  1SEB D;  1J5E L;  3T16 A;  1P16 A;  4CJ2 C;  4N9T A;  1AEX A;  1OXV A;  2WB1 E;  4A3M G;  2JN4 A;  2KHI A;  1IHZ A;  4P73 A;  4MZ9 A;  3K7A H;  1I4G A;  2K50 A;  5ISR A;  4ME5 A;  1B3A A;  1NBW A;  1MKH A;  1IKL A;  1LM0 A;  4MTK A;  1PV4 A;  2ATW A;  3CCE A;  2K5V A;  5E7N A;  2NYZ D;  3K0X A;  3CPW A;  2DY8 A;  3O13 A;  4K0K L;  1O7I A;  4IPD A;  1ZYR C;  2D62 A;  3P20 A;  4JI3 L;  4FF2 A;  2PMZ E;  1OXX K;  1JOR A;  2IW3 A;  3G6J B;  4J1M A;  5IGD A;  3S16 H;  2IHF A;  2F3I A;  2WII B;  1I3Q B;  3RLF A;  5IGF A;  3PUX A;  3CQZ H;  1WCM H;  3S1Q B;  2N3S A;  1HNX Q;  3CCR A;  1TQO A;  1XNR L;  4S3S A;  1TVX A;  4B3S Q;  3S14 B;  4AH6 A;  2CCZ A;  5DLQ E;  1S4Z A;  1B4O A;  1IL8 A;  1CTM A;  1HZA A;  2RBM A;  1IW7 C;  2VXW A;  1EQQ A;  2MJ8 A;  1BBU A;  3KBX A;  5EGT A;  4IUT A;  2OXP A;  4GOP B;  1X54 A;  1RDP D;  3WOF A;  2EJG C;  5EKK A;  2EYO A;  4DUZ Q;  2QA4 A;  3RR5 A;  4YCV A;  3E9H A;  1YI2 A;  3HOU G;  3EN2 A;  4A76 A;  2VY3 A;  4UP9 A;  1L0Y B;  5AJ3 L;  2ZM6 Q;  3J81 c;  2BE5 C;  1QE6 A;  4RH6 A;  2QF7 A;  4OWW B;  1YNN D;  1DM0 B;  1N8R C;  1H9R A;  4DU9 A;  3MXP A;  5CR3 A;  1HNZ L;  4GKK Q;  1UEA B;  3DXJ C;  1PFS A;  4JV5 Q;  1UE1 A;  1H9J A;  1Q81 C;  4HJ9 A;  4A93 H;  1AW7 A;  1V9P A;  2K01 A;  4L63 B;  1TWC H;  3U4V A;  1AZQ A;  1KQS A;  4QCL A;  1I6H H;  3TDQ A;  2F52 A;  3NP8 A;  1GO3 E;  1CKM A;  2NVT B;  2AKW B;  5E3F A;  1HQR D;  2RA4 A;  3MC0 B;  2SNM A;  4A3J B;  1EEF D;  1VDZ A;  1FJG L;  1EFI D;  1K73 C;  4HJ7 A;  3OIP A;  2PO4 A;  3VR5 A;  1VQ6 A;  4H02 A;  4DK0 A;  2L1B A;  3NWT A;  4B3T Q;  3T1H Q;  2ZJP A;  1BCP B;  3OHX C;  3M4O H;  1STE A;  2E8G A;  1KNE A;  3I7F A;  4A3K G;  1E3P A;  2O4X A;  1SMX A;  4OIK A;  4JI5 Q;  2LMC B;  5BN4 A;  4J6H A;  2B2T A;  4A93 G;  3MXN A;  3WOE A;  3AFQ A;  1BCP C;  3V2T A;  4POG A;  2VUM G;  1ESR A;  5IGB A;  3M4Y A;  1HZC A;  4R4O A;  2XTI A;  1PH6 A;  2F03 A;  1EWI A;  1XMO L;  1J6Q A;  4RGN A;  4RKL A;  1NR2 A;  4POF A;  1B3Q A;  1B1Z A;  1VQD A;  2NVX B;  3K7U C;  1Q86 C;  1Z47 A;  5C4J H;  3QR8 A;  1EY5 A;  2K33 A;  2CWP A;  3UI2 A;  2L4N A;  4AIM A;  4CGY B;  3W5O A;  1CHP D;  4RHS A;  1VQ5 A;  2EYL A;  2F0M A;  5FO9 B;  1Y1W H;  4CDF C;  3MEH A;  1AZP A;  3U9O A;  2CH4 A;  1JOO A;  2KCT A;  3D8G A;  4YCU A;  2EQS A;  1TS2 A;  3CU7 A;  1Y8P B;  4YHH Q;  5FJ8 G;  4G7Z C;  3MXG A;  5IP9 H;  3KLW A;  2K05 A;  2B2Y A;  2Z8L A;  3VA7 A;  2L5T A;  2RDF A;  5ELB A;  1E0B A;  4L5T A;  1LAC A;  2EYH A;  3J7Z C;  3AU7 A;  5I4D A;  3TZD A;  2ZXO A;  2UXC L;  5LHY 1;  2XN9 C;  2K5N A;  1X55 A;  3VDY A;  4I7A A;  2MQH A;  2F0H A;  3MWY W;  4JYA L;  3K5O A;  3HOU H;  4MHE A;  4FF3 A;  3ITP A;  3TP5 A;  4A3D G;  2DJF C;  1VQC A;  3MFY A;  2A74 C;  1Y1W G;  3IFT A;  3R2T A;  1ET6 A;  5FLM H;  1B53 A;  3CC7 A;  2ICE C;  1VQ8 A;  1XPU A;  2FXQ A;  4GLV B;  3S15 H;  1RF2 D;  3TBI B;  2CKZ B;  5JPM C;  5IYD H;  1SNC A;  3Q23 A;  4JBK A;  2VW9 A;  3I4N B;  4B3T L;  1SNO A;  2ICI A;  1G6Z A;  3M4Q A;  3G4S A;  4A3B H;  2E75 C;  4JI8 L;  4RG1 A;  4UP8 A;  4HJ8 A;  2HD3 A;  3C1F A;  1CT1 D;  3KLS X;  1Y1V B;  1WD1 A;  4H13 C;  1EQV A;  5EJW A;  5KIX A;  3I4N G;  4QF4 A;  1ASZ A;  1VQH A;  3I3C A;  4V19 0;  4KHP Q;  2KHJ A;  3PUW A;  2HHH Q;  1WTH A;  2KHS A;  1M8A A;  4ZLT F;  2X6L A;  3F2U A;  1J9O A;  3GTP H;  2Z4H A;  1AE2 A;  2B2V A;  3AFP A;  1FNV A;  1PH1 A;  3HOW B;  4DR2 Q;  1L1O B;  3IFD A;  4KHZ A;  4C3H G;  2NN6 G;  4L5R C;  4OHJ A;  2M00 A;  3IAY A;  2F4I A;  2RVL A;  4BBS B;  4BBR G;  2A69 C;  1A63 A;  3PUV A;  4DR3 L;  1JOK A;  1G51 A;  4DAY A;  1QVF A;  3N52 A;  2FFK B;  1SMY D;  1BNZ A;  1LTT D;  4ALP A;  2R92 G;  1KNA A;  1SXT A;  1I4H A;  1SYF A;  1TWG B;  2QCP X;  4CHT B;  1HCZ A;  1X3F A;  2JXM B;  3BVG A;  3RLN A;  4HIO A;  4DPG A;  4HIM A;  1RCV D;  3WDN A;  3AEV A;  1BKB A;  3HOX B;  3BJU A;  3FVQ A;  1QVC A;  2ZTD A;  1I4X A;  2IX0 A;  3CF5 A;  2UUB Q;  3GTK H;  1STY A;  1L1O A;  3T1H L;  4IPG A;  2BCO A;  5FJ8 H;  4X64 L;  4JI0 Q;  1KDC A;  4HN7 A;  3EQL C;  2Z1C A;  4DUZ L;  1ILP A;  4OEM B;  1UAP A;  4BBR H;  1RKN A;  4IOC A;  1QNU A;  1YNJ C;  1QZG A;  1H9M A;  3CP0 A;  3D4W A;  1CHQ D;  3S1M B;  2BH8 A;  4RCN A;  2B63 B;  1UWV A;  4ABN A;  3GTO H;  1GVP A;  4NDX A;  4RHR A;  5IWA L;  1X3Q A;  2K03 A;  2VUM B;  4RMF A;  2JA8 H;  4KJN A;  4FO2 A;  2NTT A;  4X66 L;  5CV6 A;  3TP6 A;  2PMZ B;  3PO2 B;  4A3K B;  5FLM G;  1GUS A;  1SBB B;  1LO5 D;  3QIA A;  4YY3 L;  2PPB C;  4DV6 Q;  2EY5 A;  1PA6 A;  2PZT A;  3A8K E;  5GAE C;  2YU9 B;  3NUC A;  1RD9 D;  4KKS A;  4UP7 A;  1EIG A;  3QO2 A;  3V05 A;  5IP7 H;  4R1J A;  5COR A;  3TN2 A;  5IE8 A;  1WOC A;  3X3N A;  2K6A A;  3HZX A;  4Q0F A;  1VQM A;  4O0A A;  1U9R A;  3I4N H;  1I6H B;  3TS0 A;  3WWV A;  1EOV A;  1N36 Q;  1Y69 U;  1SFO H;  2NVT H;  5M3F G;  1HJP A;  4JW0 A;  1I50 B;  1SE4 A;  3DEP A;  3CRL C;  4KD4 A;  2GVB A;  4IUP A;  2D0O A;  3HOY B;  4ZUI A;  1K8G A;  3A74 A;  3H15 A;  3BU2 A;  5EAY A;  2XGT A;  3NQI A;  4PV1 C;  1W2B A;  2JP1 A;  2NN6 H;  4K5X A;  3VR4 A;  2F0U A;  1DYQ A;  1TWA H;  3VR6 A;  2FIN B;  4MTN A;  2HQE A;  3C2P A;  3VYS A;  3SVM A;  3OMG A;  4DV4 L;  3HOV B;  3EFX D;  3F8T A;  2K32 A;  2PYK A;  3UDG A;  3I4M B;  4DXG A;  4JBM A;  4LAA A;  2EE1 A;  3KDF B;  1X6O A;  2A6E C;  3MTS A;  2CWA A;  2PW7 A;  3M9B A;  1HR0 Q;  3KF8 A;  1R9T B;  3SGI A;  3H0G G;  3J7A 5;  5IGG A;  4OGQ C;  1D5Z C;  1YJ9 A;  1PMR A;  1K28 A;  2HIX A;  1F9S A;  5C4J B;  1IBK L;  4B3S L;  2CW0 D;  1B8A A;  2EXD A;  3L3O C;  1KC8 C;  2UUC Q;  3S2D H;  1BR9 A;  4IN3 A;  4O42 A;  4CDD C;  1YIJ A;  2C35 B;  5COY A;  5D65 A;  1GOZ A;  1Y1W B;  2E76 C;  2OTL A;  3QWN A;  4E6I A;  3NPP A;  3SK6 A;  2F0T A;  1JWM D;  4JK1 C;  4HMJ A;  1PTO D;  2WFW A;  2H5X A;  2K5H A;  2EOT A;  1AFP A;  1ZXT A;  1PZI D;  4R4Q A;  2IWH A;  4EGV A;  3JC6 6;  5TSS A;  3V96 A;  1AH9 A;  1B7Y B;  2B29 A;  3I8Z A;  1DXM A;  2QGQ A;  2A19 A;  1TS4 A;  2A73 B;  2JA8 G;  5GQO A;  1GKH A;  1N34 L;  2I5H A;  4DAV A;  5KNC A;  3F2D A;  1Q7Y C;  2K75 A;  2O5I C;  2B63 H;  4GNX B;  3FKI B;  4DV3 Q;  3Q0A A;  4Q5V A;  1YZ6 A;  1VQE A;  2UUA Q;  2CH4 W;  1TU2 B;  1BQQ T;  1EYA A;  1EFW A;  4C56 C;  4JI1 Q;  1K0R A;  1QIL A;  3ER0 A;  5E4X A;  4K5W A;  1D7Q A;  1SJH D;  1CM9 A;  5I2X A;  1IBL Q;  5GRO A;  1QJO A;  2YTX A;  4LUO A;  4LF4 L;  2JA7 G;  3R3O A;  1CFM A;  4A3E G;  3CXC A;  3GDE A;  1U4L A;  4GKJ L;  2XWJ B;  1F9R A;  4R4C A;  1G29 1;  3L7Z C;  2ZJQ A;  1FD7 D;  1PDQ A;  3KF6 A;  1EY0 A;  2RCF A;  1Q46 A;  5GAH C;  1VQ7 A;  1QNK A;  1VMC A;  4AYB G;  4Z9C B;  1CKN A;  3I72 A;  1XPO A;  3MFG A;  4NXN Q;  4DR2 L;  5M3F H;  3SEB A;  1ENF A;  2H1E A;  2B2Y C;  4A93 B;  4DN4 M;  4U67 3;  4JBW A;  2ES2 A;  3TRZ A;  1GUO A;  2CW0 C;  4BXX G;  1LTI D;  3PMF A;  4P74 A;  1LTS D;  1VCI A;  1LAB A;  2XIW A;  3DM3 A;  1IBM Q;  1LT4 D;  4WJ3 M;  1ML0 D;  1V1P B;  5I6W A;  3LWU A;  4RGO S;  1MSG A;  3CPF A;  2KA7 A;  2NUC A;  1ENC A;  1HQM C;  2QEJ C;  4C3J G;  5I2Y A;  2KED A;  2AQ1 B;  4DV5 Q;  4GNX A;  1ESF A;  5DNF A;  3CD6 A;  2NB0 A;  4BA2 I;  1NSN S;  4N8X 1;  4ZYS A;  4A3G G;  1U4P A;  4NXN L;  1DOL A;  4P71 A;  4GOP A;  2H4O A;  3Q8D A;  2C9O A;  3J81 L;  3HGB A;  2AWN A;  1A62 A;  3CAM A;  2K5Q A;  2D9U A;  4LFB L;  2G9D A;  1K8M A;  5LL6 X;  1IXR A;  1C7Y A;  3JAM c;  4JI4 Q;  1MJE A;  3HKZ B;  4QGU A;  2F0F A;  4GOP C;  3CHB D;  2ZXP A;  3GTK B;  1SE3 A;  2Y0S E;  1S40 A;  2LKV A;  3I4M G;  4LK1 C;  5LMN L;  2B2U A;  3M3Y B;  1CA5 A;  1O7Z A;  3CMA A;  5KYL A;  3HRZ C;  3BDC A;  4P75 A;  1IBL L;  2B8G A;  4XYQ A;  2Z9H A;  3PO2 G;  2EDG A;  3LX0 A;  5M5W B;  4YCW A;  4CDE C;  3K5L A;  1QB5 D;  1HXY D;  4HR7 B;  3J80 c;  1Q1B A;  4K14 A;  2B8F A;  3A55 A;  1PRT B;  1HR0 L;  2XNA C;  3PGZ A;  2EIF A;  3S1N B;  5KND A;  1BO0 A;  2F0G A;  4P72 A;  2N78 A;  2XRS D;  4OXP A;  5C0X I;  4BS9 A;  1RHP A;  2RF4 A;  2RQX A;  3HKZ E;  2QDB A;  3M85 A;  5JJL A;  2WAQ G;  3GTO B;  1TS5 A;  3BZD B;  4C1N K;  5BN5 A;  2WB1 G;  5C3E G;  1E1T A;  1EYG A;  2UUB L;  4WJ4 A;  2SEB D;  1F9P A;  4RA8 A;  1HZB A;  1C9O A;  1PFN A;  3PO2 H;  1I4Q A;  2Q2T A;  5HUR A;  4L8J A;  3BYT B;  1RTN A;  1HNX L;  3I56 A;  5EQ0 A;  1CZW A;  3G48 A;  4C3J B;  1FNW A;  3T1Y Q;  3HOU B;  3NK9 A;  1MSH A;  1D1K A;  4A3I H;  2O2L D;  2JEA I;  2A69 D;  3HOZ H;  4TVA B;  3VYU A;  2B2W A;  3VYT A;  2Z6K C;  1MD2 D;  3T4A C;  1QUQ A;  2MNA A;  3T51 B;  1R4Q B;  4JI5 L;  1NJI C;  1UUP A;  3NBH B;  2VQE L;  3CCM A;  3RMH A;  1HPC A;  4LFB Q;  2JA9 A;  1B50 A;  1VQL A;  4BY7 H;  3F1Z A;  3NHH A;  3A5Z B;  4RAU C;  1JE5 A;  4XQN A;  2JA6 G;  3Q22 A;  2CHB D;  3ND9 A;  3AMU A;  1CI3 M;  4QJF A;  2HDL A;  5ELN A;  4FF1 A;  3H3V H;  3RZO B;  3K58 A;  1BXT A;  1XMQ L;  2R6G A;  1HNZ Q;  3Q24 A;  2UUC L;  1NTG A;  2RDH A;  5A2Q E;  4A3I G;  2A8V A;  4DNR B;  5M5Y B;  4EX5 A;  4CJ0 B;  3HOZ G;  3S17 B;  4LF7 Q;  1UNS A;  2MHV A;  4OIJ A;  4DKA C;  3KLR A;  4LNQ A;  3E5S A;  2ZXR A;  5KNB A;  2UU9 L;  3KFU A;  1Y8O B;  2WKC A;  3I4M H;  3C1E A;  1WD0 A;  4YWM A;  2E5L L;  2FJ2 A;  5IYC G;  1EYC A;  2Q2I A;  1NR4 A;  4LW1 A;  4ZRZ A;  3FPP A;  3URY A;  3S2H H;  3OW7 A;  4LUV A;  1QUQ B;  5J22 A;  5IWA Q;  1SYB A;  4OO1 I;  1EY4 A;  4DF7 A;  5IGC A;  3D4R A;  3DWA A;  1XTD A;  1FL0 A;  2VS1 A;  3EIV A;  2FHT A;  1SYD A;  2PNH A;  1ONL A;  4B08 A;  4NB3 A;  1TWH H;  1HRJ A;  2R7Z B;  2HCC A;  4C2M H;  3S24 A;  3J7Y W;  5L37 A;  2JE6 I;  3NBI A;  3R93 A;  1JCK B;  4OWX B;  4KMU C;  3NEN A;  3RZD H;  1TXY A;  1YHA A;  2QDL A;  4R4I A;  5FK9 C;  1YHQ A;  3E3X A;  2R7Z G;  4ID6 A;  1Q8I A;  1EY9 A;  4UDU C;  1WTR A;  4RGT A;  3PSI A;  5DEH A;  2RHQ B;  1B9M A;  2XRQ D;  1OXU A;  5C5M A;  4NMZ A;  3E6Z X;  4DV0 Q;  1K3B C;  4OX9 Q;  1N36 L;  4LF8 L;  4H44 C;  4CKB A;  4TRD A;  1JE4 A;  1LTA D;  2KJX A;  2F4V L;  3ONA B;  2GN5 A;  1FJG Q;  4O1N A;  3J7A V;  4ZUJ A;  3LWE A;  4Y7N H;  4U68 A;  2QW7 A;  3OIQ A;  3W1G A;  1NAP A;  3J80 i;  3PIP 3;  2ZTE A;  1KHI A;  3W1B A;  1GUN A;  3G7L A;  1JR0 D;  1HUN A;  1K83 B;  3U50 C;  3DLL A;  1YNJ D;  2DGY A;  1BOS A;  1Q3L A;  3I73 A;  3L2P A;  2EJM A;  2L55 A;  1BF4 A;  5BR8 Q;  1KDB A;  2AWO A;  1JJ2 A;  3BZC A;  4DV4 Q;  2TSS A;  2A68 D;  5IGE A;  3QOJ A;  1F2M A;  4BY1 B;  1LT6 D;  5D3D A;  2Z4I A;  3GV6 A;  4ZCK A;  1J5E Q;  4OWT B;  1D8L A;  4IFD J;  3T56 B;  1L0W A;  4HJ5 A;  4A3L H;  2F0V A;  1CSQ A;  2RSO A;  4Y52 H;  1TWA B;  1W6K A;  2EYF A;  1ET9 A;  2EXZ A;  2AQ3 B;  5C6A A;  4XTC S;  1C8C A;  4DA2 A;  2R61 A;  2R7D A;  4IJL A;  3GTJ B;  4RFB A;  1ILQ A;  4FVM A;  4MNO A;  5T1G A;  4RCO A;  1PHJ A;  2F0D A;  1H9K A;  4KV6 A;  4B9X A;  1PVO A;  2ZJR A;  5JVH 3;  5C44 B;  5C3E B;  4XT3 B;  1DON A;  2V1C C;  1XXG A;  2VB3 X;  2KCC A;  2F3W A;  5C4X H;  5J39 A;  1SYG A;  4DR7 L;  1XTC D;  4K2L A;  4IQZ A;  3ND8 A;  1SN8 A;  2NZH A;  1E7Z A;  1EEI D;  4IOA A;  1N34 Q;  4DK6 C;  4JG2 A;  5HY6 A;  3TS2 A;  3M3Y H;  1SRU A;  5CV4 A;  1NUC A;  2UXD Q;  3I4L A;  2PNR C;  4C1N I;  2NVQ B;  2J4X A;  3KYH C;  4IUQ A;  3BVZ A;  2NZ1 D;  4HCS A;  2WKD A;  2X69 A;  4JYA Q;  2LSS A;  2I46 A;  1QOH A;  1A3V A;  5LL6 S;  3T53 B;  4XDX A;  4CKE A;  4LF8 Q;  3FEW X;  4FXG C;  2E74 C;  3GO5 A;  4PZ8 A;  2L11 A;  4GKJ Q;  2LXK A;  3DHQ A;  4MN3 A;  3HOX G;  2AQ2 B;  4DGZ A;  2C5C A;  4KD3 A;  3PO3 B;  1VF7 A;  2VB2 X;  4X3K A;  4A3F H;  5HGT A;  4IAL A;  3FP9 A;  4KTA A;  4A3J G;  4LF5 Q;  3IL8 A;  2BOS A;  5JEA H;  1EIY B;  1P8L A;  3CME A;  3S1Q H;  4HMI A;  3T1Y L;  1OO9 B;  5CV8 A;  1TR5 A;  3S1N H;  1HFG A;  1L2F A;  3A8J E;  2BH2 A;  2VQE Q;  1F2Y A;  2L0C A;  4JI8 Q;  1HTL D;  1T5X D;  2K28 A;  2BA1 A;  4LF9 Q;  2K5W A;  1VQP A;  2EYP A;  4YIJ A;  5EKI A;  1JOQ A;  1WCM G;  2K04 A;  4IFD H;  3H91 A;  1IYU A;  2IJ0 A;  2PCF B;  3QB3 A;  5JJK A;  4M8A A;  4QY7 A;  5EPK A;  2E2H H;  2L9H A;  3GQB A;  2Q2U A;  1JJC B;  2L15 A;  4XT1 B;  3NQT A;  1DGS A;  3DWQ A;  4BWG B;  1EL0 A;  1D5M C;  5JPN C;  5JEA G;  4A3M B;  1PH4 A;  4DAY B;  1IYJ B;  1XMQ Q;  4B3R Q;  3F2C A;  1EY8 A;  1FR3 A;  3CCU A;  1I4P A;  1D2B A;  3UDI A;  3STB C;  1X3E A;  1LTG D;  1LYL A;  1RL2 A;  3ERO A;  3OOC A;  2JK8 A;  4DAP A;  2E2I H;  1B44 D;  2FMC A;  1E22 A;  1Z7T A;  4JCV E;  5E4W C;  4LFA L;  4CJ1 B;  4JI4 L;  3SE0 A;  1K8O A;  1WYD A;  4R4T A;  4DK3 C;  2RSN A;  4PG3 A;  2KBN A;  5K5P A;  2UXD L;  5IT9 E;  4IFD G;  4NXM Q;  2R92 B;  2NBF A;  2SOB A;  2HQL A;  2QKI C;  5EPL A;  2DJG C;  1D5X C;  2Q8R E;  3TQY A;  1SE2 A;  3A8I E;  1MHW C;  4UY8 C;  1YJW A;  5GAD C;  2KCN A;  1ZKO A;  4PZ7 A;  5JJZ A;  4X3U A;  1VQF A;  2TMP A;  4GNX C;  1STA A;  5BR8 L;  1VQB A;  1PH3 A;  2F0L A;  4A3G B;  4RGM A;  4IFD I;  2E2D C;  4K8J A;  1KIX A;  2IX1 A;  1WVL A;  2G9H D;  1E2V A;  2JEB I;  3KJP A;  3OWE B;  3S17 H;  3L9A X;  3CCL A;  1CKN B;  2F3V A;  4ZAI A;  1Q82 C;  3RD4 A;  2PQE A;  2YTY A;  2EY2 A;  1BBX C;  1STH A;  4GS3 A;  4OEL B;  4LWC A;  3DM1 A;  2WP8 J;  5F2D A;  2OWO A;  2Q8T A;  1U0L A;  2KEN A;  4HID A;  1PH5 A;  1MIU A;  3HOX H;  3S9W A;  4DV0 L;  3GTM H;  4LF9 L;  4C2M B;  4JVZ A;  2UXC Q;  1E1O A;  4GN3 B;  5J3B A;  5IYD G;  3BS1 A;  3NSW A;  1PFM A;  1S5F D;  5EKL A;  1PH7 A;  5M3M G;  2E2J B;  1QCB D;  2RKS A;  4QL5 A;  4EVO A;  3GP7 A;  4G7H C;  1QZH A;  3KK7 A;  1M1K C;  2F0S A;  4DR4 L;  1JWU D;  3I70 A;  2Y0S G;  1IKM A;  2ALY B;  2EZV A;  1Y1V G;  4A3E B;  4OO1 G;  4JC0 A;  1DD2 A;  1PRT F;  1S5E D;  2MO0 A;  5KYI A;  3J80 L;  1LT5 D;  3TP7 A;  5C3W A;  4DV2 Q;  2JA6 B;  3IKJ A;  1WCM B;  4IO9 A;  4IUV A;  3RZD B;  4HAE A;  5EPJ A;  5IIF A;  1C4Q A;  3NXW A;  1HA6 A;  2M9V A;  1ICW A;  3K5M A;  4JV5 L;  1PZJ D;  4DR6 L;  3K80 C;  4NP5 A;  1LTL A;  1XPR A;  1CA6 A;  2K7V A;  2VQF L;  1ZYR D;  1EU4 A;  2DN8 A;  2WIN B;  5M3M H;  4IUN A;  2YU9 H;  1YNX A;  3NE5 B;  3I2Z A;  3OTO Q;  2HHH L;  1G2S A;  1SNM A;  2F0P A;  3GTG B;  4DR4 Q;  1G2T A;  1LTR D;  3KDF A;  3GD7 A;  4QMG A;  1WFQ A;  3FRP B;  2F0Q A;  2ID0 A;  1Y1V H;  4GN4 B;  1XNQ Q;  1TKW B;  1PTO C;  2NWG A;  3HKS A;  4JBJ A;  4QIW B;  1A6X A;  4C3H B;  4DV7 L;  4A3D H;  2A6H D;  1SFO B;  1EQR A;  3JAM E;  2A1A A;  5JJI A;  1RJT A;  5IYB G;  4A3I B;  4DV6 L;  1JB3 A;  1N9W A;  4IUR A;  1GUT A;  2N8N A;  2JA5 G;  5CV5 A;  4FNF A;  1LUZ A;  3BDO A;  2HUG A;  1EU3 A;  2OQK A;  1TWC B;  3HG9 A;  3TP8 A;  1N32 Q;  3D6C A;  4DUY L;  1IZ6 A;  5DM6 3;  2F0E A;  3ULJ A;  4G57 A;  3UE0 A;  2HIV A;  3SDZ A;  4NW2 A;  3J81 E;  1VF5 C;  4BA1 I;  1FNU A;  2V4D A;  1SYE A;  3OWF A;  1NMG A;  4K0K Q;  4K8I A;  5ELC A;  2Q8I B;  3TEH B;  2D2C C;  5CYU A;  3J80 E;  3S1R B;  5AFW A;  2P5Z X;  2PW5 A;  4KK7 A;  4B9W A;  4FDB A;  5JEA J;  3H3V C;  5M5Y H;  5IYB H;  1EIH A;  1V8Q A;  3OW2 A;  4QUC A;  4WFN 3;  2JA5 H;  1F2L A;  3K0Y A;  3TSS A;  1VQO A;  1F9Q A;  3HEJ A;  4DK1 A;  3GTJ H;  1K9M C;  1WTO A;  2F0O A;  2ASB A;  1N32 L;  3CRK C;  2KUM A;  4WRD A;  5E1F A;  3K81 C;  3OSO A;  4JI1 L;  5IT9 c;  5G3L D;  4KY7 A;  4A3F B;  3NTK A;  3S1M H;  4V0B A;  4ME3 A;  2F4V Q;  1HTP A;  2B2T C;  2Z6B A;  3GV3 A;  4FF4 A;  1I3Q H;  4LF4 Q;  4KKU A;  3CQZ B;  1XX8 A;  2O5J C;  2B3G A;  4JI2 L;  3PO3 G;  3MXN B;  1B2T A;  5C0X J;  4I7Z C;  2R3Z A;  1X32 A;  1TY0 A;  4A3K H;  1XYI A;  4HIK A;  2EY6 A;  2F0K A;  3NBH A;  3W2D A;  1V43 A;  2M2L A;  5IOD A;  1SJE D;  2WAC A;  1Y14 B;  1D6E C;  4EQP A;  1G8Z D;  2VUM H;  3GTL B;  1WJJ A;  2NVY H;  1WTW A;  1EIF A;  1CSP A;  3TRE A;  1VS0 A;  2IPK D;  1K3R A;  3TZU A;  3R8B A;  4DV5 L;  1FYC A;  2OT2 A;  2R7F A;  3BYY B;  3G71 A;  2CQA A;  3DUZ A;  2N88 A;  4R9W A;  4RWS C;  5DAU A;  3GTQ H;  2J0T D;  2EVB A;  4DV3 L;  3H0G H;  4OON A;  4IUU A;  5LMU Q;  3HP3 A;  3T13 A;  1R4P B;  1TS3 A;  3DEO A;  5M3F B;  3X3M A;  3PCO B;  3J81 j;  3HFZ B;  2JA7 B;  2KCM A;  2WV6 D;  1ICF B;  4KLK A;  5IY0 A;  2EJF C;  4DXF A;  4Y7N B;  2UXB Q;  4C3H H;  3EBE A;  1V1O A;  3I4O A;  4DR1 L;  3DWP A;  5IOC A;  5IP9 G;  3G6E A;  1G91 A;  2R93 G;  4JI6 Q;  1ENA A;  3LNN A;  3E0E A;  4IJH A;  3ULP A;  5I9O A;  3CW2 C;  1BCP F;  4UHV A;  2E2I B;  1EUJ A;  2IL8 A;  5IP7 G;  1IW7 D;  3TME A;  3Q6S A;  4L5S A;  4A75 A;  4L6T B;  4A3C H;  4N9P A;  1KRT A;  2E5L Q;  4HCE A;  4WOR A;  2VNU D;  1B70 B;  3UDF A;  4NPS A;  2Z6K A;  4GKK L;  1GHJ A;  1JJG A;  2R92 H;  5CV9 A;  1I5F A;  3P1H A;  4K5V A;  1LV9 A;  4QIW E;  1HFN A;  3P75 A;  1XNQ L;  2JJQ A;  2PI2 A;  3ZJY C;  3ZYY X;  2BE5 D;  1U4M A;  5C5L A;  4F88 A;  4DNT B; 
#chains in the Genus database with same CATH homology
 4JVZ A;  2Z9H A;  4JW0 A;  2QW7 A;  5L37 A;  2HD3 A;  4N8F A;  4N8X 1;  2RCF A;  4I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...