3D4WA

Crystal structure of staphylococcal nuclease variant delta+phs a109r at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLRKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4wA00
3C1FA 4KHVA 1U9RA 2OXPA 3EJIA 2F3WA 2EY2A 4K6DA 2LKVA 4YIJA 4ZQ3A 5KRUA 1EYAA 3P1HA 3SK8A 4H7BA 1KDAA 4K5WA 5EKKA 4J1MA 4G57A 4QB4A 3SK5A 4HTHA 5C3XA 1TT2A 2RBMA 5IOCA 2F0OA 3MEHA 4KD3A 1STNA 3NHHA 4DGZA 3D6CA 4K2KA 4LAAA 3D4DA 3NUCA 3ITPA 3PMFA 4ODGA 2M00A 3SHLA 5KEEA 2F0MA 2PZTA 5C6AA 5DEHA 1A3TA 5KIXA 1TR5A 5IGBA 3SK6A 4EQPA 4ZUJA 2F0QA 1EQVA 5I6WA 2F0JA 4K14A 5CV8A 2EYMA 2KHSA 2F0EA 2EY5A 4R8NA 4KJOA 5IGDA 4K8JA 5M9OA 3EVQA 5J1ZA 5CC4A 2SOBA 2F0KA 4ID6A 2F0SA 3DHQA 4EQNA 3C1EA 3NQTA 1EYDA 2PZUA 1EYCA 4QF4A 1EY9A 2F0NA 1ENCA 5IODA 4ME5A 5C3WA 5J22A 3QOJA 4IALA 4NP5A 5CV4A 2F0TA 2PYKA 3OWFA 5E1FA 2NUCA 1SNDA 2PQEA 3MHBA 5EGTA 5CV6A 5JOBA 5C5LA 3TMEA 1EY0A 2EYHA 2PZWA 4PMBA 1SYEA 3SR1A 2EYFA 4B9XA 4EVOA 2EYLA 5CV7A 5F2DA 5J39A 1SNPA 3QB3A 4KY7A 2OEOA 3TP5A 5I9OA 2ENBA 3QOLA 4KD4A 5KYLA 1KABA 1JOQA 3OSOA 2EXZA 2O4XA 5CR3A 3TP7A 3OMGA 5KYIA 4NKLA 5ISRA 1A3UA 3MXPA 4RKBA 4KY6A 5K5PA 1RKNA 4B9WA 1STYA 2F3VA 5CV5A 3MVVA 3BDCA 5IGFA 2KQ3A 1II3A 1STBA 1EY4A 1A2TA 3NK9A 1STGA 2PW7A 3D4WA 2F0DA 5IGEA 2WACA 1SYBA 5IGCA 3RUZA 3TP6A 4F7XA 3LX0A 1IHZA 1F2YA 2HQEA 1EZ6A 3DMUA 1TQOA 2F0IA 4HMIA 1JOKA 5CGKA 3T16A 4PMCA 4K5VA 3HEJA 2PW5A 1SYFA 4RKLA 3V2TA 1EY5A 1SYDA 4TRDA 3P75A 2F0VA 1ENAA 1NUCA 2F0HA 4MIUA 5IIFA 2SNSA 5I9PA 1SNMA 2EY6A 1KDCA 2RDFA 4E6IA 2EYPA 1KAAA 2OF1A 4QMGA 4K5XA 4N9PA 1SNCA 1SNQA 1SYGA 3BDLA 3ERQA 5C4HA 1JORA 4WRDA 1AEXA 2F0WA 1STAA 1STHA 1NSNS 2EY1A 2EYOA 4K2LA 4KJNA 2EYJA 1EY8A 3VA5A 5IGGA 4OL7A 5JAVA 1JOOA 2F0PA 4KTAA 3MZ5A 4I65A 3U9OA 4S3SA 5E3FA 3NP8A 4DF7A 5KGUA 5NUCA 1SYCA 4KV6A 2F0UA 4DU9A 3EROA 3S9WA 3D8GA 4HMJA 3R3OA 4NDXA 4WORA 2F0FA 4F8MA 5C4ZA 2F0GA 2RKSA 2SNMA 3OMCA 3E5SA 1A3VA 1EY7A 3HZXA 5I6YA 4IUNA 1F2ZA 1SNOA 4J6HA 5CV9A 5C5MA 1EZ8A 3H6MA 1F2MA 2QDBA 4N9TA 4K8IA 4PNYA 5DAUA 4DFAA 4IZ8A 1KDBA 4KY5A 1EY6A 5EKLA 2F0LA 3SK4A 3SXHA 1A2UA 3TP8A 4EQOA 4ZUIA 3NXWA 3T13A 5HURA 4NMZA 5HGTA
chains in the Genus database with same CATH superfamily
2Z6BA 5EBCA 4YIJA 1BBXC 3EN2A 3K80C 4RCNA 1QZGA 2BOSA 3T1YL 5IT9E 1NNXA 3HOYG 5C44B 1TWAH 2C35B 2CQAA 2B63B 4JBKA 1TIID 2L11A 2VY3A 2WINB 4KK7A 1X9NA 5FO7B 4DNTB 4A3IB 4DV5Q 3HOXB 4LF7Q 1EQVA 2N55A 2E2JB 2EY5A 5CBEE 1Y14B 2VQFQ 1CT1D 4TKOB 5M3MB 2K5VA 4ID6A 4EQNA 5IWAL 1MJEA 4X64Q 4RWSC 4AQYL 1CSPA 4OX9L 2E5LL 3H09A 3IL8A 3T1HQ 1PFSA 3KUPA 4JC0A 1EY0A 1G2TA 2R92B 1NMFA 3GV3A 2RA4A 3FPUB 4HCSA 5CV7A 2E5LQ 2L1BA 4BBRB 3M4PA 3OSOA 2Z1CA 4IUUA 1MKHA 1GUTA 3P7JA 2ZJRA 1SAPA 4IPHA 1HFGA 4WFN3 1VQKA 1SE3A 3KK7A 5FO8B 2F3VA 1FYCA 1EIHA 1IKLA 2XTIA 4RG1A 5FOBB 3AU7A 2PMZE 5IGCA 5IYDH 5C4XH 4F7XA 1Q12A 4R4QA 4RH6A 3HP3A 3NPPA 1PRTC 4A3DG 2MHVA 4OO1H 2KOLA 2RDFA 1KDCA 2PQAB 4E6IA 1A8VA 4QMGA 1JJ2A 1VQAA 4R8IA 3K5NA 3S1RH 4CKBA 3PCOB 4K2LA 3HS0C 3OIQA 4DUZL 4LF7L 5CYUA 1HCZA 1HNXQ 2A8VA 1K0RA 3J7AV 1N33L 5EJWA 1D1IA 1LO5D 1GHKA 5I2XA 4DK1A 3D8GA 2B39A 2IW3A 4P2CB 4LJZC 4DR5Q 3TS0A 2C5CA 4DNRB 3NSWA 1P8LA 1H9RA 3KYHC 4ZUIA 4DK6C 5HURA 2K5HA 4BY1B 5A35A 4X3TA 3RLOA 2F3WA 2EY2A 1X3PA 2EJFC 4H7BA 4DV4Q 4MHEA 2QEJC 1KDAA 1K9MC 4KN7C 3A8IE 1B70B 3S17B 3HOWB 4K2KA 2BE5C 5GAEC 4BY1H 1HR0Q 4FF1A 4F88A 1HNZL 5HGQA 3HOVB 2RVLA 4DR3Q 2K5WA 2IX1A 4EQPA 1E3PA 1JC7A 3I4MB 2OQKA 4RFBA 3J80c 2BE5D 2F0KA 5IWAQ 1JT8A 3GQBA 5IODA 1UUPA 2A19A 4X65Q 1E24A 1BCPC 5C5LA 4B9XA 1B3AA 3HKZB 3NBIA 4JOIA 1VMCA 3K7AB 1WOCA 3OMGA 1SMYD 1RIPA 1PH3A 2JN4A 1VQJA 5M3FB 4FP5D 3CCUA 1CKMA 3GP7A 3NELA 1TWFH 3HOWG 1EY4A 4ILWA 4LF8L 4C3IG 4ZLTF 3LX0A 3DMUA 4XDXA 3H0GH 1UE1A 4DN4M 2LSSA 1FNVA 3D4RA 2D5DA 3FKIH 4KMUC 3V2TA 5CMDA 1LT3D 1Y1WB 1NUCA 2K5NA 1QNKA 1YNND 1Q8IA 4JI5L 2OF1A 4IJHA 3MWYW 2WIIB 3I8ZA 4BBSH 1O7ZA 5FKAC 1Q1EA 2D0PA 2CW0C 3DM3A 1D1KA 3VYRA 4S3SA 3DWQA 1YNJD 1PYSB 2K14A 3H0GG 3FVQA 2A6EC 4IJLA 2E2IH 5JPMC 3R3OA 3C3LA 1HNWL 1RF2D 2D2CC 4UAIA 1B7YB 4J6HA 1VF7A 1QE6A 2A5HA 1FR3A 5ELBA 5GADC 4DFAA 2VUMH 1SMXA 1NAPA 4KY5A 4YCVA 3TP8A 4ZK9B 1S72A 3I4NH 3Q6SA 5HGTA 4JI8Q 4L5SA 4JK1C 2OXPA 4IPCA 3PV0A 3SK8A 4B3SL 1V1PB 4POGA 1I50H 5KNCA 1DM0B 3SK5A 4JI4Q 2HHHQ 4HIMA 1SBBB 2F0OA 1RTOA 5FK9C 4JYAQ 5FO9B 2XSCA 1RL2A 4R4CA 4GKJQ 3GTOB 1V43A 3KLWA 2NVXH 2JYOA 1A3TA 3I4LA 1VQ5A 5C0XH 4A3KG 1EEFD 1VQDA 3SDZA 1FJGL 4GKJL 2LFNA 1ESFA 2KHJA 3HOZB 4R8NA 3GTMB 4JI5Q 1M1KC 3GTJH 1EYDA 2H4OA 4IALA 2B2VC 1YJ9A 3S1NH 4X3SA 2RQXA 2NVQB 1WFQA 1N34L 3LGJA 2NWGA 4LK1C 3CCLA 1B3QA 4A3BB 2ASBA 2K5QA 3RZDB 1JOQA 2O4XA 1B44D 4CGYB 4EX5A 1IKMA 1KIXA 1YHBA 1MI2A 4IO9A 1HZ9A 1C9OA 4QJFA 1Y8OB 2PCFB 2XWBB 5HY6A 5K5PA 1SJHD 3UDGA 2FMCA 4O1NA 3J81j 2F03A 3CCJA 5IGFA 1YJNA 2IT1A 3D4WA 1S40A 4R4IA 4JI8L 2ZXOA 4CDEC 4A3JB 1GUWA 4JI2L 3T16A 4CBVA 5ELOA 3KJPA 1IBLL 1YIJA 3HG9A 2RHQB 1SNQA 5J3BA 2LY7A 3ERSX 1AEXA 1XWEA 1E0BA 4R9WA 2RCNA 1UE7A 1AN8A 5E7NA 1MD2D 2EVBA 3I70A 1Q3LA 3T1YQ 4I65A 3U9OA 4GOPC 1PH1A 4AIMA 2F4VL 5LL6S 5C4JH 1B1ZA 3EROA 1W6KA 2FMMA 1MIUA 2KEDA 5BN3A 4DV4L 3MXGA 3HOYB 3F1ZA 4PZ8A 3R2TA 3KLSA 3NE5B 4J15A 4C2MH 2XNAC 4JCVE 3I3CA 1ML0D 5I9OA 4HTHA 4DV0Q 3MEHA 4A3GB 3NHHA 4KKTA 3DM1A 1EIGA 1C8CA 3GTJB 1TY2A 2X69A 1V8QA 1ET6A 1N32Q 3TN2A 3DWAA 3CD6A 3BZKA 4DAVA 2G9HD 3OOCA 4C56C 1WCMH 4XQJA 4DV7L 4A3EG 3J80i 3R8BA 5IT9L 1ASZA 4J8QA 3STBD 1L1OA 3DHQA 4TQUS 5FLMG 4OO1I 4DV7Q 4IPGA 4FXGC 1LACA 2MPMA 4L5QA 5I6YA 1SNDA 3FDTA 4HAEA 1GD7A 2MJ8A 2OEOA 3TP5A 4DR1L 2XIWA 3W2DA 5KYLA 1KABA 1BKBA 4L63B 3FMCA 3LNNA 1PZJD 2E76C 1TWHH 1PH2A 2L0CA 5ELNA 3PO2B 4A3DB 1VS0A 1QUQB 3CMAA 3I90A 2DUDA 2PW7A 1B4OA 3HOXG 2HIXA 2OTLA 1WTRA 1KRTA 1AW7A 5AJ3L 4RKLA 2A6HC 2VQEL 3CCRA 4AYBB 4JI0Q 2HDMA 1CHPD 2LMCB 1TKWB 3F2UA 2CWPA 3K7AH 2A1AA 2IHFA 1SNCA 5C4HA 1YNNC 2JA7H 5JVG3 4NXML 3GTKH 1YVCA 2F52A 5DM63 1DXMA 1GUOA 1EQTA 3CQZH 4FXKC 3T56B 3E9IA 4G7ZC 2JA8B 1ZEQX 4LFAQ 3K5MA 4BA1I 1SYCA 5EBDA 3S15H 4WORA 1FL0A 2Y0SE 2Z6KA 2CKZB 2OQ0A 3OMCA 2UUBQ 3E3XA 1AE2A 3HZXA 2O5IC 1YEZA 2VXWA 3GTGH 3M4QA 3GTPH 1KDBA 5IYDG 4NPSA 1SROA 4NMZA 3TP6A 5C3XA 4DV1Q 1JE5A 2IL8A 3EJIA 5KRUA 3UE1A 2LKVA 1WI5A 1OXSC 1IL2A 3K57A 1VQMA 2YU9H 4QB4A 4OONA 5EAYA 1HH2P 1E2WA 1PTOC 1QVFA 2EQSA 2B29A 2Z9HA 4DGZA 3CP0A 1F2LA 1QG7A 3W5OA 1LABA 1X65A 3SHLA 4X65L 1I4GA 1HQMC 2KCNA 3BDOA 4DAYA 4HJ5A 3PUZA 3SK6A 3CCSA 2WB1E 4ZUJA 1TVXA 4HR7B 2RSOA 3KF8A 2ICIA 2NZOA 2OTJA 3PUWA 2ID0A 1K8OA 5G3LF 2RDGA 4XXEA 3A7AB 5D3IB 1D5XC 1HA5A 3NQTA 1EY9A 3ER0A 5JEAJ 2KENA 5C3WA 2B63G 3I4MG 1OXXK 3GD7A 1JB7A 4GN3B 3NTHA 1G291 2VL6A 1L0XB 4PQXA 1NR2A 1LLRD 3M4OH 1DOLA 3MC0B 5CR3A 4LF4Q 4CDCC 3RZOH 4NKLA 1A3UA 3MXPA 3G6EA 1IBMQ 3CRKC 3QR8A 1T9HA 4BXXH 3PUYA 5IP9G 5C44H 3L0OA 1PTOD 3GV6A 1L0WA 4JG2A 1EQRA 1PZID 4HIOA 1BF4A 1QUQA 1XJVA 4TRDA 2DGYA 3G7LA 3S1MB 4JI0L 2BH8A 4YWMA 1HNWQ 2EYPA 1HR0L 2OWOA 3M7GA 4P73A 2I5MX 1YNJC 1X3FA 5IGGA 3D31A 3S1NB 2XRQD 3C2PA 3FHWA 3UE0A 4GN5A 2R6GA 1LT6D 3S16H 2D62A 3J80E 3Q24A 3VR6A 3BS1A 1VDZA 4HMJA 4Y7NH 1N32L 2EJGC 4X3KA 5C0XJ 5CV9A 4QUFA 1EZ8A 2N8NA 2QDBA 4H02A 1WTXA 3HOVH 3SXHA 2B2TC 2UUCQ 1NBWA 5BR8Q 2F1MA 4Q0FA 4PV1C 2R3ZA 4I7AA 1EQQA 4A93B 4ZQ3A 4K6DA 2UUCL 3VYTA 2JJQA 2CWAA 3AQQA 4LF9Q 1CK1A 2NZHA 1F9QA 2RBMA 5ELEA 4QIWE 1DCZA 1A0IA 1K8MA 2YYZA 4XT3B 1H9JA 1AE3A 4A3MH 2F0MA 4OWXB 3UDIA 5DEHA 1OO9B 1Y1VB 5IGBA 3CC7A 2GN5A 3V96A 1BCPD 2EYMA 4B3RL 4OIJA 1EOTA 4P75A 1S5FD 1Z47A 2JEAI 3EFXD 1WCMG 5EKIA 5M3MG 4GLAC 4DAMA 4M8AA 3QOJA 2VUMG 3S17H 1IZ6A 2E2HH 5CV6A 2EYLA 3ULJA 2B8GA 1Q90A 3PO3G 2B2YC 4YCUA 1D6EC 1IBML 3BU2A 3I4OA 4R1JA 1IBKL 1ZYRD 4LFCL 5IYCH 1STGA 2V1CC 4C1NI 1WTWA 2F0DA 1F2YA 1X32A 5GQOA 1EIYB 3KDFB 2K05A 2UXCL 4DR7Q 2MO0A 4PMCA 4K5VA 3NWTA 2PW5A 4RCOA 3FKIG 3M7NA 2JA7B 4C3JB 3KF6A 2QCPX 4FYDA 2EY6A 4JI6Q 4NXNL 1WCMB 2JXMB 1SYGA 3BG3A 1RTNA 3VYUA 1U4MA 2HDLA 1YNXA 1GKHA 2IWHA 1LTSD 4A3BG 2X6LA 1EY8A 1VQBA 5G3LD 4NXNQ 5LL6X 5BR8L 1LM0A 1HFNA 2WFWA 3M3YH 5C4XG 2MQHA 1PFNA 4IQZA 2IJ0A 3H3VH 4ZYSA 1K73C 1NJIC 3B6YA 1A3VA 3L3OC 3OHXC 4DR4L 3PO2H 1KLGD 5EKLA 1EWCA 1EL0A 1HR0W 1ZKOA 1CKNA 3FEWX 4JI3Q 2HCIA 1X54A 2L12A 1DZ1A 5IOCA 1O7YA 3A0JA 4XQQA 4NXMQ 3HRZC 1CQVA 5IP7H 4B3MQ 3CC4A 4MTNA 4IFDG 2CQOA 1H9KA 2CH4W 1HNXL 4FO2A 1IW7D 4H0LC 4YHHL 2PNRC 1XPUA 2UXBL 4GS3A 2O2LD 5CV8A 2UXDL 2NBFA 4P71A 4JBMA 3JAME 2AUJD 4K8JA 2R92G 1CI3M 1UE6A 3MA2B 4JI4L 2SOBA 3S1QH 1KHIA 1H9MA 1SR3A 3OIPA 4DV5L 2BH2A 1IBKQ 2K7VA 2AUKA 1KC8C 2EZVA 1A63A 3WWVA 5AJ3Q 4P74A 3U58A 3PO3H 3MFGA 4DR3L 4QY7A 3IAYA 4WJ4A 1VQ7A 1SFOB 2JA5G 2MFIA 2CCZA 3I4NB 1SJED 1H9SB 2Q8TA 4RKBA 3A5UA 4DR6Q 4CKEA 2QKIC 4JW0A 3BDCA 3K81C 4GNXA 4A3JH 1A2TA 1JWUD 1PH8A 4JBWA 4QL5A 4DAYB 1CKNB 1IYJB 3OTOQ 3PF4A 3EA6A 4A3CG 2KCMA 3MTSA 2R93G 2ZXPA 3HEJA 4FNFA 1R4PB 4IURA 4UP7A 1M4VA 1K3RA 2RHSB 4QQBX 4PG3A 1YI2A 3HOZH 2RDHA 5IYBG 1L0YB 2F0WA 2JP1A 4IN3A 4DA2A 2EYJA 4NB3A 1Q82C 3RR5A 2K33A 3OW2A 1AP0A 1JOOA 2JSOA 3RNUA 1M90C 3NBHA 3NP8A 1O80A 5IT9c 5JJKA 4LF6L 1B53A 2BDNA 3M9BA 2G5DA 3CRLC 5C4ZA 1FGBD 3WDNA 2F0FA 1F9PA 3CPWA 2K32A 4K0KL 3K5LA 3UDXA 5T1GA 3U9SA 4L8JA 1F2MA 5BN5A 5KYIA 4A93H 4MTKA 1A6XA 1ICWA 1A2UA 1QVCA 5DLQE 3T13A 4RAUC 3CCEA 3DLLA 3EBEA 1N8RC 3QIAA 1K28A 5E4WC 1F77A 1Q81C 1SLJA 2NN6I 1EWIA 2PPBC 4POFA 4ZKCB 1W6JA 3ITPA 4P72A 4ODGA 2YTVA 1TU2B 1Y1WG 2KUMA 1E1OA 3BZDB 1HNZQ 1DGSA 1BQQT 2ZT9C 2NZ1D 4IFDI 5I6WA 2XRSD 2D9UA 3L9AX 2AMCB 2F0EA 2KHIA 2UXCQ 5IGDA 1MJCA 4AH6A 1WTVA 4RMFA 3RD4A 1BCPB 4OELB 2H1EA 3OYYA 1L1OB 2NVYH 1K83H 4DV2Q 2E8GA 3KOJA 4BBRG 3H0GB 5I4DA 3MHBA 4X62Q 5JOBA 1IYUA 1RJTA 3VDYA 2K03A 2R7FA 4PMBA 3SR1A 2HCCA 2VZAA 5J39A 2MNAA 3RZOB 4KD4A 1KLUD 4IUQA 2HUGA 4A3CH 1QWYA 1EIFA 5ISRA 1NY4A 2A6HD 3QJYA 3J81E 2Q8IB 4I7ZC 3QO2A 4X66Q 1QZHA 2UUAQ 3AFPA 3RUZA 2HQEA 4WJWA 3TRZA 4QGUA 2F0IA 1BNZA 4HMIA 2FHTA 1S5CD 1VQOA 1DOMA 4B3RQ 2AKWB 4JVZA 1SYDA 3ICEA 4A75A 3CW2C 3FRPB 1JWSD 1L2FA 4MIUA 2SNSA 4OIKA 3CF5A 4B3TL 2K1BA 4OGQC 3MEFA 1HZAA 2K5DA 1X3EA 5KNBA 1I4XA 1STHA 2L9HA 1GXDC 4IPDA 2QILA 1A15A 1FGUA 5JAVA 4KTAA 4CDFC 1PH5A 1PFMA 1VQ6A 1K3BC 4DF7A 1PYWD 4BWGB 2L5TA 1GUGA 3IKJA 4A76A 2K28A 1LT5D 5E4XA 5L37A 1O7LA 4F8MA 2TSSA 1CZWA 2PMZB 4KHPL 3LWEA 1VMPA 1I3QB 2I46A 4H44C 5AFWA 1Q86C 1F2ZA 1DONA 4KHPQ 2DN8A 2DNEA 3GTGB 4KN4C 3RZDH 1JR0D 4KHVA 1AZQA 1J6QA 3A55A 4DXFA 1PVOA 1C0AA 2JA8H 3CXCA 3CHBD 1LYLA 3A8KE 4KD3A 4A3JG 1G2SA 1PYBA 3NUCA 1E22A 3X3MA 3PMFA 5KEEA 4PZ6A 1OXUA 3GTKB 1J9OA 2NN6H 5FLXE 1ILPA 3EVQA 1XMQQ 2DJFC 3E9HA 4B3SQ 3C1EA 2PZUA 3S14H 2F0NA 3Q8DA 2WAQB 5BN4A 2K52A 3SEBA 1Q46A 1TWGH 5EGTA 4XT1B 2EYHA 1DYQA 3F2DA 4O0AA 4Y52H 3J7AF 1V1OA 1SNPA 3J7ZC 2A6ED 4GLVB 1VQLA 1W2BA 4DPGA 3JC66 2Z4HA 3E0JA 3HOYH 4LUOA 2B2VA 5D3DA 4WJ3M 3A8JE 1D5ZC 1WD1A 1STYA 3H3VI 1R9TH 1X55A 1QVGA 3S16B 4LNQA 1OXTA 3TQYA 1JOKA 1QJOA 2R61A 1SYFA 1EOVA 1RCVD 1PH6A 1TS3A 4NW2A 5I9PA 1SE4A 1JJCB 5COYA 3I72A 1ONLA 3ERQA 4DK3C 1JORA 3J7YW 2RSNA 2EYOA 2Z6KC 3C46A 4BBSG 5IE8A 1EWHA 3EIVA 1U4LA 4RA8A 1U4PA 2GVBA 3GTQH 4G4KA 3J81L 2R93H 1XTDA 5A2QE 3PO3B 1KRSA 2Q2TA 2R7DA 4JBJA 1E2VA 1YITA 2EXDA 3FPPA 4RGNA 4GOPB 2SNMA 4LF4L 1ICFB 2HT1A 3J7A5 3F2BA 3H6MA 1NE3A 2IX3A 4B3ML 4L5TA 3G6JB 2LS01 1HJPA 3K5OA 2VUMB 2NB0A 3M85A 3NBHB 1PDQA 1FNUA 4C3JG 4DUYL 2CW0D 3P1HA 3PIPA 1HUNA 2R92H 3Q0AA 2P5ZX 4HJ7A 2RCFA 1J8IA 1IW7C 1ENFA 2J7ZA 3G4SA 1B50A 3ZJYC 1HZCA 2JE6I 1EFID 1S4ZA 5ELCA 5A2QL 1SSOA 3N6RA 1BOSA 2B2UA 1Y1WH 1Y1VH 4AYBG 1Q1BA 1TS5A 3J81c 4HSPA 2HHHL 2YV5A 3ULPA 2ZTCA 3RN5A 3IRBA 3JAML 2E2HB 1BDOA 1PA6A 3QG1A 3PO2G 2PQEA 2HQLA 3U4VA 3ULLA 1STEA 2EYFA 1YZ6A 3NTIA 1HTLD 3UI2A 1KAWA 1Z7TA 3L2PA 1BVSA 3ZYYX 4IUTA 1PRTB 3L7ZC 5M3FG 1C4QA 2ZTEA 4FF4A 4F87A 2ALYB 4O42A 1QCBD 1JQYD 4KKUA 3BVMA 1KNAA 1Q7YC 1PXUA 3S2DB 2PO4A 2WV6D 1JCKB 4DR2Q 3GTMH 2BDOA 5CGKA 2B2UC 1NTGA 4GLXA 2YU9B 2UXBQ 2F0VA 2B2YA 1M8AA 3H15A 4ZAIA 1U0LA 4LFCQ 3MAQA 1XTCD 3M4OB 3TBIB 3I73A 3HOWH 4HJ9A 1LTAD 4V190 1LT4D 2NN6G 2V4DA 2FJ2A 5E3FA 4C3IB 3VR5A 4RHRA 4KV6A 1ET9A 2FINB 4DU9A 3M3YB 1VQEA 1R4QB 2XGTA 3E5SA 4Z9CB 5M3FH 1UAPA 5C3EB 1B9NA 2ZJQA 4A3KB 4HN7A 1SFOH 4JYAL 3W1GA 2QGQA 5M5WB 4LUVA 1WYDA 5H1SE 4X62L 2PNHA 1JMCA 1XNRL 2K75A 4A3FG 5EPJA 1I4RA 2Q2IA 2A74C 2Y0SG 4K5WA 5EKKA 4V0BA 1D2BA 1GUNA 4APVA 1BCPF 2MO1A 3MXUA 5LMNW 1TY0A 4A3FB 4YY3L 4JI6L 2UU9Q 3OTOL 2JA9A 2PZTA 4UPAA 1I4HA 1WD0A 3I4MH 4BS9A 2UUAL 1KXLA 1Z6HA 1Y1VG 2J4XA 2Z0SA 3M4YA 1HPCA 1CQFA 2TMPA 4DV0L 1FJGQ 3GDEA 1Y69U 3GTOH 3T4AC 4H13C 3CCQA 4YWLA 3VA7A 3A74A 5D65A 1RD9D 4NP5A 3BVGA 3S1QB 5E1FA 4G7OC 2WB1G 5CBAE 2RF4A 1SYEA 1WTQA 2DNCA 1QB5D 3K59A 1DOKA 3K8AA 3TP7A 5JJLA 4CJ1B 4HSVA 4JI7Q 1EFWA 2CFMA 4BY7B 2WP8J 2KQ3A 3AB9A 1PH9A 3CC2A 3S1MH 1G91A 3CU7A 1XNRQ 3NEMA 4LWCA 2ZJPA 4CHTB 5I2YA 5FLXc 1T5XD 1GM5A 4C3HG 3W1BA 1WTHA 1TWFB 4ZRZA 1I6VC 3TREA 3V05A 1IL8A 4K5XA 4FXDA 1SE2A 1V1QA 1NSNS 2EY1A 3W3AA 2R7ZB 3HOUG 1K0SA 3GTLB 3FP9A 5LMNQ 4GKKQ 1LTID 1GHJA 4GNXB 2SDFA 1CFMA 3VYSA 3CQZB 3S9WA 3DWPA 1E1TA 3BYYB 5C3EG 3J81i 2QF7A 2HD3A 2C9OA 3N52A 3K7UC 4EQOA 4O2DA 4HEDA 4DK0A 4IUVA 1UNSA 3KBXA 1XX8A 3U50C 1XMQL 4A3EB 3IFTA 1Z9FA 3PSIA 4FDBA 4ULLA 4JI7L 1QILA 1EYAA 4QCLA 4G57A 2B2TA 1UE5A 3A7LA 5FLXL 2QDLA 2MUYA 3DEOA 3TDQA 1CM9A 3E0EA 4XQNA 4K6LA 3T51B 1N34Q 2B3GA 2D0OA 2Q8RE 2F0QA 3S1RB 2A69D 1N33Q 3U4ZA 1PTOB 5EPLA 2ZM6L 1NR4A 1SN8A 2F0SA 4U68A 4LF8Q 2ES2A 4KI0A 3HOZG 3RN2A 2F0TA 2FFKB 5EQ0A 2NUCA 1C7YA 2NVYB 2JA6H 1JE4A 3DEPA 5CORA 4AYBE 1S3OA 3H3VC 4OHJA 5GROA 3PF5A 1TWCH 4BY7G 4FF2A 5M5YB 1G6ZA 1WVLA 3MVVA 3IFDA 1II3A 3CPFA 1STBA 2PI2E 4A3BH 4JV5Q 2WACA 4YHHQ 1X3GA 2CH4A 1ASYA 2I5HA 4IOCA 1VQ9A 3AMUA 3O13A 4MZ9A 4JPBW 4RGTA 1PTOH 1SNMA 3KF6B 1QOHA 4Q5VA 5DM73 3BDLA 4JI1Q 1CSQA 4DR7L 5LMUQ 2HIVA 4DR6L 3VA5A 1TS2A 5D14A 2BA1A 5LHY1 3MZ5A 3HKZG 1LTLA 4B08A 5NUCA 4DV3Q 2UXDQ 2BA0A 1HZBA 3JAMc 1E7ZA 1N36Q 3Q23A 2RKSA 1T5EA 1B9MA 1EY7A 4A3GG 2NVTB 4OWTB 2N78A 4IZ8A 4BBRH 3WOEA 1EY6A 2F0LA 5M5XH 4DV6L 4A3KH 3SGIA 1VCIA 1LUZA 2A69C 1LV9A 1FVIA 4LF5Q 5JJIA 3A5ZB 2NVTH 3I91A 1I4QA 1PTOF 4J1MA 2B63H 5JVH3 5FJ8G 1PLFA 1PFBA 5GAHC 4N8X1 3D0FA 1EU3A 1VQHA 3G48A 4OX9Q 2LXKA 2E2JH 1H95A 5KIXA 1LTTD 1SXTA 2VB2X 4A93G 1MHWC 2A68C 5ELDA 3PUVA 2JEBI 4K14A 1G51A 3MFYA 5ELFA 1GUSA 2KVMA 2R7ZG 4JI3L 2F3IA 2JA5B 4OWWB 3FKIB 1D8LA 2GVAA 1XMOL 1PZKD 1MGSA 5J22A 3CMEA 1K83B 1RODA 3TMEA 1SMYC 4EVOA 3H94A 4FF3A 3KDFA 4UDUC 2K04A 4MN3A 4TVAB 4KY7A 5GAGC 4LFAL 4BBSB 2NYZD 3QOLA 4BY7H 4BA2I 5M5YH 4HIDA 1FD7D 2E74C 2NVQH 2JA6B 2I5LX 1DD2A 3NWSA 1GO3E 4L5RC 2E2IB 2CHBD 4FVMA 5IYBH 5IGEA 2WKCA 2N49A 3VR2A 4UP8A 1F9RA 1LTRD 4MNOA 4DV1L 3OW7A 3D3RA 4UP9A 3BZCA 1KNEA 1CKOA 4QIWB 2Z4IA 1D5MC 2JA8G 1CA5A 1NCVA 2Y0SB 3P75A 4DV3L 4A3DH 2F0HA 1X6OA 2PQAA 2KCTA 3AEVA 3EQLC 1VQPA 4PMWA 2PI2A 3HFZB 2E2DC 3KLSX 1PH7A 2AQ3B 2B8FA 1S5ED 4BXXG 2EOTA 1MSHA 2KBNA 1OTCA 2MP1A 3CAMA 2N3SA 1HQRD 4A3FH 1KL9A 4JOIC 1I94Q 2WKDA 2K01A 4KHZA 1CA6A 1F9SA 3TEHB 2BCOA 1CTMA 1BO0A 4ZCKA 4B3TQ 1CHQD 2F0GA 1OXVA 2OCEA 4IUNA 1SNOA 1VQIA 3SK4A 5EPKA 1P16A 4DUZQ 3OWEB 4R4TA 2M9VA 4HCEA 1U9RA 4C3JH 2ZTDA 1PH4A 1AZPA 1XPRA 1HTPA 1X56A 3K58A 1YBYA 4DNIA 4ABNA 2EDGA 3URYA 1STNA 4LAAA 3I2ZA 3D4DA 2DY8A 1CZGA 4DR4Q 4GZYC 1EU4A 4C2MB 3KF8B 1TXYA 1PRTF 1LTBD 4CDDC 2R7ZH 1J5EL 3K0XA 5JEAG 3D6WA 2VS1A 3KLRA 4XYOA 1VQCA 4DUYQ 1XNQQ 3LWUA 1JWMD 4KJOA 5M9OA 2LXJA 2O5JC 5CC4A 5IP7G 4A3LG 4DAPA 1U5KA 5CV4A 3NQIA 4JI1L 1VQ8A 4N8FA 4RHSA 5FLMH 1J5EQ 2PZWA 1EUJA 1L1OC 3BJUA 3F2CA 5F2DA 1UEAB 5KNDA 2EE1A 1I4PA 2ENBA 4A3EH 4DR5L 1B2TA 1KTKA 3HGBA 4X3UA 5C44G 1VQFA 5CV5A 2VQFL 3CCMA 4A3GH 3KJOA 1N9WA 3QWNA 3PIP3 3X3NA 4RGMA 3ND9A 4C3IH 1EZ6A 2GA4B 2K4KA 3NTKA 5JEAH 2UU9L 3PIOA 3T1HL 3HKZE 4UHVA 3A54A 1ENAA 3A56A 4XTCS 5IIFA 1G6PA 4A4IA 3J80L 2B2WC 4N9PA 3HOXH 5LMUL 2L55A 1BXTA 1A62A 2ZXRA 4RGOS 4LFBL 4Y7NB 4KJNA 1WTPA 1WTOA 1MBYA 4C3HB 5C4JB 1WJJA 1BBUA 1EEID 2YTYA 3S15B 5TSSA 2H5XA 4HJAA 3JAMi 5K36H 1Y8NB 5DNFA 4OO1G 4NDXA 3R2IA 2KEEA 2VB3X 5M5WH 1SRUA 1TWCB 2AQ1B 5C5MA 3STBC 1BUVT 4JV5L 4PNYA 5DAUA 5JJZA 4U673 4IUPA 2AWNA 4X6AH 2WAQE 4A3MB 3TZDA 4DXGA 1PV4A 4LF9L 2L15A 4DKAC 3S24A 1BBWA 2ICEC 5T1IA 3VR4A 4M1UB 3HOUB 2L4NA 2JK8A 4A3MG 5M3MH 3GTQB 3NENA 4DR1Q 2IY5B 4LMQD 1TR5A 1U4RA 3GTPB 3PIO3 2JA5H 1I5FA 4YWKA 2F0JA 1G8ZD 1AFPA 3WOFA 1FNWA 2KHSA 4A3IH 4OXPA 1MSGA 4HJ8A 3S2HH 2VNUD 5J1ZA 3P20A 1ENCA 4ME5A 3HKSA 3GTLH 4XYQA 1SEBD 4YY3Q 2K50A 2M2LA 4LW1A 3S14B 1V9PA 1I6HB 3MXNB 4QUCA 4EQ5A 4XIGS 3SE0A 1S5DD 1HXYD 4AQYQ 3CCVA 1PHJA 2JA7G 1GVPA 2I07B 1N36L 3DXJC 1I6HH 3CKIB 3NK9A 4X66L 2QEXA 4IFDH 4X64L 3RLFA 1YHAA 1IHZA 2R93B 1TQOA 4IOAA 1ZYRC 1ILQA 2I0QA 1JJGA 3OPOA 5C4XB 1EY5A 4C3HH 3GO5A 1HHVA 3PQIA 1PRTD 1K8AC 3Q22A 1C48A 1KAAA 1IXRA 2AWOA 4CKCA 4LFBQ 1KD1C 1JB3A 2JQOA 3K0YA 4IFDJ 1RDPD 1AH9A 2VW9A 2XVSA 1VQNA 3HOUH 1W3SA 2OT2A 3MXNA 4R4OA 2F0PA 1QNUA 2K6AA 1BR9A 2NTTA 3PGZA 5KGUA 5FJ8H 2A68D 1HA6A 2EPBA 2F0UA 3AYHB 2Q2HA 4DR2L 4A3LH 1IBLQ 2XN9C 4KLKA 4EGVA 3RMHA 1KQSA 1Q8KA 4OEMB 5M5XB 2SEBD 4K8IA 4K0KQ 3TSSA 1CUKA 5JPNC 3E6ZX 3BYTB 1XYIA 2Q2UA 3SVMA 4KKSA 3C1FA 2KECA 4LF6Q 4C1NK 5LMNL 4GKKL 1H9SA 3I56A 2ZM6Q 1S5BD 1TT2A 4YCWA 1O7IA 3D6CA 3S2HB 1TWAB 1X3QA 2A73B 1V1PA 1HUMA 2M00A 3H91A 5IYCG 1D7QA 5C6AA 1SDFA 3I7FA 2IPKD 3ONAB 1YHQA 3TZUA 4CJ0B 2NTSA 1Y8PB 4A3IG 1EYGA 1TWHB 2MGSA 1VF5C 1I3QH 4DV2L 2F4VQ 4PZ7A 1TS4A 2G9DA 2Z8LA 1YJWA 1GOZA 2KJXA 1EYCA 4QF4A 4UY8C 1E2ZA 2KA7A 2KCCA 2PYKA 1HRJA 3OWFA 2UUBL 3S2DH 1R9TB 2QW7A 1UEBA 1K8GA 2IHEA 3ND8A 3QB3A 5K36G 4ALPA 2VQEQ 2EXZA 1I94L 3KFUA 2FXQA 4L6TB 3G71A 2N88A 4LF5L 3F8TA 2AHOB 4KY6A 2NVXB 1RKNA 4B9WA 5C3EH 3DUZA 4BY1G 1TWGB 4G7HC 4DV6Q 1XPOA 1RHPA 5C0XI 4TSSA 2DJGC 3RLNA 2YTXA 1SYBA 2AQ2B 2EJMA 2IX0A 2B2WA 1O78A 3I55A 2ATWA 1XNQL 3UDFA 3KBGA 1I50B 3R93A 2X6GA 3AFQA 3T53B 4ME3A 1DJRD 3PUXA 4ZKBB 1B8AA 4GOPA 4GNXC 4HIKA 3HOVG 4WRDA 1STAA 1SE8A 1XMOQ 1VQ4A 4OL7A 4GN4B 1VQGA 5IY0A 2CVRA 2XWJB 2E75C 2QA4A 2WAQG 3I4NG 2F4IA 1ESRA 4CJ2C 3TS2A 3BVZA 4JI2Q 1JICA 4LUZA 1ZXTA 2J0TD 1IYVA 1PMRA 1GJXA 3VR3A 3K6OA 2EIFA 2JA6G 1LTGD 4N9TA 2DY7A 2WB1B 1UWVA 1NMGA 1XXGA 3NXWA 5IP9H 5C0XG
chains in the Genus database with same CATH topology
5EBCA 4YIJA 1BBXC 4RCNA 2BOSA 5IT9E 5C44B 2CQAA 2B63B 1TIID 2L11A 2WINB 4KK7A 5FO7B 4DNTB 4A3IB 3HOXB 1EQVA 2N55A 2E2JB 2EY5A 5CBEE 1CT1D 4TKOB 5M3MB 4ID6A 4EQNA 4RWSC 3H09A 3IL8A 3KUPA 1EY0A 1G2TA 2R92B 3GV3A 2RA4A 3FPUB 4HCSA 5CV7A 2L1BA 4BBRB 3OSOA 2Z1CA 4IUUA 1GUTA 3P7JA 1SAPA 4WFN3 1HFGA 1SE3A 3KK7A 5FO8B 2F3VA 1FYCA 1EIHA 1IKLA 5FOBB 3AU7A 5IGCA 4F7XA 1Q12A 4RH6A 3HP3A 3NPPA 1PRTC 2MHVA 4OO1H 2KOLA 2RDFA 1KDCA 4E6IA 4QMGA 4R8IA 3K5NA 4CKBA 4K2LA 3HS0C 3OIQA 5CYUA 1HCZA 3J7AV 5EJWA 1D1IA 1LO5D 1GHKA 5I2XA 4DK1A 3D8GA 2B39A 2IW3A 4P2CB 4LJZC 2C5CA 4DNRB 3NSWA 1H9RA 4ZUIA 5HURA 4BY1B 5A35A 4X3TA 2F3WA 2EY2A 1X3PA 2EJFC 4H7BA 4MHEA 2QEJC 1KDAA 4KN7C 3A8IE 3S17B 3HOWB 4K2KA 2BE5C 4FF1A 4F88A 3HOVB 2RVLA 2K5WA 2IX1A 4EQPA 1JC7A 3I4MB 4RFBA 2BE5D 2F0KA 3GQBA 5IODA 1UUPA 1BCPC 5C5LA 4B9XA 1B3AA 3HKZB 3NBIA 1VMCA 3K7AB 3OMGA 1SMYD 5M3FB 4FP5D 3GP7A 1EY4A 4ILWA 4C3IG 4ZLTF 3LX0A 3DMUA 4XDXA 4DN4M 1FNVA 3D4RA 2D5DA 4KMUC 3V2TA 5CMDA 1LT3D 1Y1WB 1NUCA 1QNKA 1YNND 1Q8IA 2OF1A 3MWYW 2WIIB 3I8ZA 1O7ZA 5FKAC 1Q1EA 2CW0C 1D1KA 3VYRA 4S3SA 3DWQA 1YNJD 3FVQA 2A6EC 5JPMC 3R3OA 3C3LA 1RF2D 2D2CC 4UAIA 4J6HA 1VF7A 1QE6A 2A5HA 1FR3A 5ELBA 4DFAA 1NAPA 4KY5A 3TP8A 4ZK9B 3Q6SA 5HGTA 4JK1C 2OXPA 3PV0A 3SK8A 1V1PB 5KNCA 1DM0B 3SK5A 1SBBB 2F0OA 1RTOA 5FK9C 5FO9B 2XSCA 3GTOB 1V43A 2JYOA 1A3TA 3I4LA 5C0XH 1EEFD 3SDZA 2LFNA 1ESFA 3HOZB 4R8NA 3GTMB 1EYDA 2H4OA 4IALA 2B2VC 4X3SA 2RQXA 2NVQB 2NWGA 4LK1C 4A3BB 2K5QA 3RZDB 1JOQA 2O4XA 1B44D 4CGYB 1IKMA 1MI2A 1Y8OB 2PCFB 2XWBB 5K5PA 1SJHD 2FMCA 4O1NA 2F03A 5IGFA 2IT1A 3D4WA 2ZXOA 4A3JB 1GUWA 3T16A 4CBVA 3HG9A 1SNQA 2LY7A 1AEXA 1XWEA 1E0BA 4R9WA 1AN8A 1MD2D 2EVBA 3I70A 1Q3LA 4I65A 3U9OA 5LL6S 1B1ZA 3EROA 1W6KA 2FMMA 2KEDA 5BN3A 3MXGA 3HOYB 3R2TA 3KLSA 3NE5B 2XNAC 3I3CA 1ML0D 5I9OA 4HTHA 3MEHA 4A3GB 3NHHA 4KKTA 3DM1A 1EIGA 1C8CA 3GTJB 1TY2A 2X69A 1V8QA 1ET6A 3TN2A 3DWAA 4DAVA 2G9HD 3OOCA 4C56C 4XQJA 3R8BA 5IT9L 4J8QA 3DHQA 4TQUS 4OO1I 4FXGC 1LACA 2MPMA 5I6YA 1SNDA 3FDTA 4HAEA 2MJ8A 2OEOA 3TP5A 5KYLA 2XIWA 3W2DA 1KABA 3LNNA 3FMCA 4L63B 1PZJD 2E76C 2L0CA 3PO2B 4A3DB 3I90A 2PW7A 1B4OA 1WTRA 1AW7A 4RKLA 2A6HC 4AYBB 2HDMA 1CHPD 2LMCB 1TKWB 3F2UA 1SNCA 5C4HA 1YNNC 5JVG3 5DM63 1DXMA 1GUOA 1EQTA 4FXKC 3T56B 2JA8B 4G7ZC 1ZEQX 3K5MA 4BA1I 1SYCA 5EBDA 4WORA 3OMCA 3HZXA 2O5IC 2VXWA 1KDBA 3TP6A 5C3XA 4NMZA 2IL8A 3EJIA 5KRUA 2LKVA 1OXSC 3K57A 4QB4A 1E2WA 1PTOC 4DGZA 1F2LA 1QG7A 1LABA 3SHLA 1I4GA 1HQMC 2KCNA 3BDOA 4DAYA 3PUZA 3SK6A 4ZUJA 1TVXA 4HR7B 2RSOA 3KF8A 2ICIA 3PUWA 2ID0A 1K8OA 5G3LF 2RDGA 4XXEA 3A7AB 5D3IB 1D5XC 1HA5A 3NQTA 1EY9A 5JEAJ 5C3WA 1OXXK 3GD7A 3NTHA 1G291 1L0XB 4PQXA 1NR2A 1LLRD 1DOLA 3MC0B 5CR3A 4NKLA 1A3UA 3MXPA 3CRKC 3PUYA 1PTOD 3GV6A 1PZID 1BF4A 4TRDA 3G7LA 3S1MB 2EYPA 3M7GA 1YNJC 5IGGA 3D31A 3S1NB 2XRQD 3C2PA 2R6GA 1LT6D 2D62A 3J80E 3Q24A 3VR6A 3BS1A 1VDZA 4HMJA 2EJGC 4X3KA 5C0XJ 5CV9A 4QUFA 1EZ8A 2QDBA 1WTXA 3SXHA 2B2TC 2F1MA 4Q0FA 4PV1C 2R3ZA 4A93B 4ZQ3A 4K6DA 3VYTA 1CK1A 1F9QA 2RBMA 5ELEA 1DCZA 1K8MA 2YYZA 4XT3B 1H9JA 2F0MA 5DEHA 1OO9B 1Y1VB 5IGBA 3V96A 1BCPD 2EYMA 4OIJA 1EOTA 1S5FD 1Z47A 2JEAI 3EFXD 5EKIA 4M8AA 3QOJA 5CV6A 2EYLA 2B8GA 1Q90A 2B2YC 1D6EC 1ZYRD 1STGA 4C1NI 1WTWA 2F0DA 1F2YA 1X32A 2K05A 4PMCA 4K5VA 3NWTA 2PW5A 4RCOA 3M7NA 2JA7B 4C3JB 2QCPX 4FYDA 2EY6A 1WCMB 2JXMB 1SYGA 3BG3A 1RTNA 3VYUA 1U4MA 2HDLA 2IWHA 1LTSD 2X6LA 1EY8A 5G3LD 5LL6X 1HFNA 1PFNA 4IQZA 2IJ0A 4ZYSA 1A3VA 3L3OC 3OHXC 1KLGD 5EKLA 1EWCA 1EL0A 1ZKOA 3FEWX 2HCIA 2L12A 1DZ1A 5IOCA 1O7YA 4XQQA 3HRZC 1CQVA 4IFDG 1H9KA 4FO2A 1IW7D 4H0LC 2PNRC 2O2LD 5CV8A 2NBFA 3JAME 2AUJD 4K8JA 1CI3M 3MA2B 2SOBA 1H9MA 3OIPA 2K7VA 2AUKA 2EZVA 3MFGA 3IAYA 1SFOB 3I4NB 1SJED 1H9SB 2Q8TA 4RKBA 4CKEA 2QKIC 3BDCA 1A2TA 1JWUD 4JBWA 3EA6A 3MTSA 2ZXPA 3HEJA 4FNFA 1R4PB 4IURA 1M4VA 2RDHA 1L0YB 2F0WA 2JP1A 4IN3A 4DA2A 2EYJA 2K33A 1AP0A 1JOOA 2JSOA 3NBHA 3NP8A 1O80A 1B53A 2BDNA 3CRLC 5C4ZA 1FGBD 3WDNA 2F0FA 1F9PA 2K32A 3K5LA 5T1GA 3U9SA 4L8JA 1F2MA 5BN5A 5KYIA 1A6XA 1ICWA 1A2UA 3T13A 4RAUC 3QIAA 5E4WC 1F77A 2NN6I 2PPBC 4ZKCB 1W6JA 3ITPA 4ODGA 1TU2B 2KUMA 3BZDB 1BQQT 2ZT9C 2NZ1D 4IFDI 5I6WA 2XRSD 2D9UA 3L9AX 2F0EA 5IGDA 1WTVA 3RD4A 1BCPB 2H1EA 3H0GB 5I4DA 3MHBA 5JOBA 1IYUA 1RJTA 2K03A 4PMBA 3SR1A 2HCCA 5J39A 3RZOB 4KD4A 1KLUD 4IUQA 2HUGA 1QWYA 5ISRA 2A6HD 3QJYA 3J81E 2Q8IB 4I7ZC 3QO2A 3RUZA 2HQEA 4WJWA 2F0IA 1BNZA 4HMIA 2FHTA 1S5CD 1DOMA 1SYDA 3FRPB 1JWSD 4MIUA 2SNSA 4OIKA 2K1BA 4OGQC 2K5DA 5KNBA 1I4XA 1STHA 2L9HA 1GXDC 2QILA 1A15A 5JAVA 4KTAA 1PFMA 4DF7A 1PYWD 4BWGB 2L5TA 1GUGA 3IKJA 2K28A 1LT5D 5E4XA 1O7LA 4F8MA 2TSSA 1CZWA 2PMZB 3LWEA 1VMPA 1I3QB 2I46A 4H44C 5AFWA 1F2ZA 1DONA 2DN8A 2DNEA 3GTGB 4KN4C 1JR0D 4KHVA 1AZQA 3A55A 4DXFA 3CHBD 3A8KE 4KD3A 1G2SA 3NUCA 3X3MA 3PMFA 5KEEA 1OXUA 3GTKB 1J9OA 2NN6H 5FLXE 1ILPA 3EVQA 3C1EA 2PZUA 2F0NA 2WAQB 5BN4A 3SEBA 5EGTA 4XT1B 2EYHA 1DYQA 3J7AF 1V1OA 1SNPA 2A6ED 2Z4HA 3E0JA 2B2VA 5D3DA 3A8JE 1D5ZC 1WD1A 1STYA 3S16B 1OXTA 1JOKA 1QJOA 2R61A 1SYFA 1RCVD 1TS3A 4NW2A 5I9PA 1SE4A 5COYA 3I72A 1ONLA 3ERQA 1JORA 3J7YW 2RSNA 2EYOA 3C46A 1EWHA 1U4LA 4RA8A 1U4PA 4G4KA 3J81L 5A2QE 3PO3B 1E2VA 3FPPA 4RGNA 2SNMA 3H6MA 2IX3A 3G6JB 2LS01 3K5OA 2VUMB 2NB0A 3M85A 1PDQA 1FNUA 4C3JG 2CW0D 3P1HA 1HUNA 3Q0AA 1J8IA 1IW7C 1ENFA 2J7ZA 1B50A 2JE6I 1EFID 1S4ZA 5ELCA 5A2QL 1SSOA 3N6RA 1BOSA 2B2UA 1Q1BA 1TS5A 4HSPA 2E2HB 3JAML 1BDOA 3QG1A 2PQEA 1STEA 2EYFA 3NTIA 1HTLD 3UI2A 1Z7TA 3ZYYX 4IUTA 1PRTB 3L7ZC 1C4QA 4FF4A 4F87A 4O42A 1QCBD 1JQYD 4KKUA 3BVMA 1KNAA 1PXUA 3S2DB 2PO4A 2WV6D 1JCKB 2BDOA 5CGKA 2B2UC 2YU9B 2F0VA 2B2YA 1M8AA 4ZAIA 3MAQA 1XTCD 3M4OB 3TBIB 3I73A 1LTAD 4V190 1LT4D 2NN6G 2V4DA 2FJ2A 5E3FA 4C3IB 3VR5A 4RHRA 4KV6A 1ET9A 2FINB 4DU9A 3M3YB 1R4QB 3E5SA 4Z9CB 1UAPA 5C3EB 1B9NA 4A3KB 4HN7A 5M5WB 5EPJA 1I4RA 2A74C 4K5WA 5EKKA 4V0BA 1D2BA 1GUNA 1BCPF 3MXUA 1TY0A 4A3FB 2PZTA 1I4HA 1WD0A 4BS9A 1Z6HA 2J4XA 3M4YA 1HPCA 1CQFA 2TMPA 1Y69U 3T4AC 4H13C 3VA7A 5D65A 1RD9D 4NP5A 3BVGA 3S1QB 5E1FA 4G7OC 5CBAE 1SYEA 1WTQA 2DNCA 1QB5D 3K59A 1DOKA 3TP7A 4CJ1B 4HSVA 4BY7B 2WP8J 2KQ3A 3AB9A 1G91A 3CU7A 4CHTB 5I2YA 1T5XD 4C3HG 1TWFB 4ZRZA 1I6VC 3V05A 1IL8A 4K5XA 4FXDA 1SE2A 1NSNS 2EY1A 3W3AA 2R7ZB 3GTLB 1LTID 1GHJA 2SDFA 1CFMA 3VYSA 3CQZB 3S9WA 3DWPA 3BYYB 2QF7A 2C9OA 3N52A 4EQOA 4HEDA 4DK0A 4IUVA 1UNSA 3KBXA 1XX8A 4A3EB 3IFTA 4ULLA 1QILA 1EYAA 4QCLA 4G57A 2B2TA 5FLXL 3A7LA 2MUYA 3DEOA 3TDQA 1CM9A 4XQNA 4K6LA 3T51B 2Q8RE 2F0QA 3S1RB 2A69D 1PTOB 5EPLA 1NR4A 2F0SA 4U68A 4KI0A 2F0TA 2FFKB 5EQ0A 2NUCA 2NVYB 1JE4A 3DEPA 5CORA 3H3VC 4OHJA 4FF2A 5M5YB 1G6ZA 1WVLA 3MVVA 3IFDA 1II3A 1STBA 2WACA 3AMUA 3O13A 4RGTA 1PTOH 1SNMA 1QOHA 4Q5VA 5DM73 3BDLA 3VA5A 1TS2A 5D14A 2BA1A 5LHY1 3MZ5A 4B08A 5NUCA 2BA0A 3Q23A 2RKSA 1T5EA 1B9MA 1EY7A 2NVTB 4IZ8A 3WOEA 1EY6A 2F0LA 1VCIA 2A69C 1LV9A 3I91A 1I4QA 1PTOF 4J1MA 5JVH3 1PLFA 1PFBA 1EU3A 5KIXA 1LTTD 1SXTA 2VB2X 2A68C 5ELDA 3PUVA 2JEBI 4K14A 3MFYA 5ELFA 1GUSA 2KVMA 2JA5B 3FKIB 1PZKD 1MGSA 5J22A 1K83B 1RODA 3TMEA 1SMYC 4EVOA 3H94A 4FF3A 4UDUC 2K04A 4MN3A 4KY7A 4BBSB 2NYZD 3QOLA 4BA2I 1FD7D 2E74C 2JA6B 1DD2A 3NWSA 2E2IB 2CHBD 4FVMA 5IGEA 2WKCA 3VR2A 1F9RA 1LTRD 3OW7A 3D3RA 1KNEA 4QIWB 2Z4IA 1D5MC 1CA5A 1NCVA 2Y0SB 3P75A 2F0HA 3EQLC 4PMWA 2E2DC 3KLSX 2AQ3B 2B8FA 1S5ED 2EOTA 1MSHA 2MP1A 1HQRD 2WKDA 2K01A 4KHZA 1CA6A 1F9SA 2BCOA 1CTMA 1BO0A 1CHQD 2F0GA 1OXVA 4IUNA 1SNOA 3SK4A 5EPKA 3OWEB 2M9VA 4HCEA 1U9RA 1AZPA 1HTPA 3K58A 4ABNA 2EDGA 3URYA 1STNA 4LAAA 3D4DA 2DY8A 1CZGA 4GZYC 1EU4A 4C2MB 1PRTF 1LTBD 5JEAG 3D6WA 3KLRA 4XYOA 3LWUA 1JWMD 4KJOA 5M9OA 2O5JC 5CC4A 4DAPA 5CV4A 3NQIA 4RHSA 2PZWA 5F2DA 1UEAB 5KNDA 2EE1A 1I4PA 2ENBA 1B2TA 1KTKA 3HGBA 4X3UA 5CV5A 3QWNA 3PIP3 3X3NA 4RGMA 3ND9A 1EZ6A 2GA4B 3NTKA 5JEAH 3A54A 1ENAA 3A56A 4XTCS 5IIFA 3J80L 2B2WC 4N9PA 2L55A 1BXTA 2ZXRA 4RGOS 4Y7NB 4KJNA 1WTPA 1WTOA 1MBYA 4C3HB 5C4JB 1EEID 3S15B 5TSSA 5K36H 1Y8NB 5DNFA 4OO1G 4NDXA 3R2IA 2KEEA 2VB3X 2AQ1B 5C5MA 1TWCB 1BUVT 4PNYA 5DAUA 5JJZA 4U673 4IUPA 2AWNA 4A3MB 3TZDA 4DXGA 2ICEC 3HOUB 5T1IA 4M1UB 3VR4A 2L4NA 3GTQB 4LMQD 1TR5A 1U4RA 3GTPB 3PIO3 2F0JA 1G8ZD 1AFPA 3WOFA 1FNWA 2KHSA 1MSGA 2VNUD 5J1ZA 3P20A 1ENCA 4ME5A 4XYQA 1SEBD 2M2LA 3S14B 1I6HB 4QUCA 4XIGS 3SE0A 1S5DD 1HXYD 2I07B 3DXJC 3CKIB 3NK9A 4IFDH 3RLFA 1IHZA 2R93B 1TQOA 1ZYRC 1ILQA 3OPOA 5C4XB 1EY5A 3GO5A 1HHVA 1PRTD 3Q22A 1C48A 1KAAA 4CKCA 2AWOA 1JB3A 3K0YA 4IFDJ 1RDPD 2XVSA 2OT2A 3MXNA 2F0PA 1QNUA 2K6AA 1BR9A 2NTTA 5KGUA 2A68D 1HA6A 2EPBA 2F0UA 2XN9C 4EGVA 3RMHA 5M5XB 2SEBD 4K8IA 3TSSA 5JPNC 3E6ZX 3BYTB 1XYIA 3SVMA 4KKSA 3C1FA 2KECA 4C1NK 1H9SA 1S5BD 1TT2A 3D6CA 3S2HB 1TWAB 1X3QA 2A73B 1V1PA 1HUMA 2M00A 3H91A 5C6AA 1SDFA 2IPKD 3ONAB 3TZUA 4CJ0B 2NTSA 1Y8PB 1TWHB 2MGSA 1VF5C 1TS4A 2G9DA 2Z8LA 1GOZA 2KJXA 1EYCA 4QF4A 1E2ZA 2KA7A 2KCCA 2PYKA 1HRJA 3OWFA 1R9TB 3ND8A 3QB3A 5K36G 2EXZA 4L6TB 2N88A 4KY6A 2NVXB 1RKNA 4B9WA 3DUZA 4G7HC 1TWGB 1RHPA 5C0XI 4TSSA 1SYBA 2AQ2B 2EJMA 2IX0A 2B2WA 1O78A 3KBGA 1I50B 3R93A 2X6GA 3T53B 1DJRD 3PUXA 4ZKBB 4WRDA 1STAA 4OL7A 2CVRA 2XWJB 2E75C 2F4IA 1ESRA 4CJ2C 3BVZA 1JICA 1ZXTA 2J0TD 1IYVA 1PMRA 1GJXA 3VR3A 3K6OA 1LTGD 4N9TA 2DY7A 2WB1B 1XXGA 3NXWA 5C0XG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1F A;  4KHV A;  1U9R A;  2OXP A;  3EJI A;  2F3W A;  2EY2 A;  4K6D A;  2LKV A;  4YIJ A;  4ZQ3 A;  5KRU A;  1EYA A;  3P1H A;  3SK8 A;  4H7B A;  1KDA A;  4K5W A;  5EKK A;  4J1M A;  4G57 A;  4QB4 A;  3SK5 A;  4HTH A;  5C3X A;  1TT2 A;  2RBM A;  5IOC A;  2F0O A;  3MEH A;  4KD3 A;  1STN A;  3NHH A;  4DGZ A;  3D6C A;  4K2K A;  4LAA A;  3D4D A;  3NUC A;  3ITP A;  3PMF A;  4ODG A;  2M00 A;  3SHL A;  5KEE A;  2F0M A;  2PZT A;  5C6A A;  5DEH A;  1A3T A;  5KIX A;  1TR5 A;  5IGB A;  3SK6 A;  4EQP A;  4ZUJ A;  2F0Q A;  1EQV A;  5I6W A;  2F0J A;  4K14 A;  5CV8 A;  2EYM A;  2KHS A;  2F0E A;  2EY5 A;  4R8N A;  4KJO A;  5IGD A;  4K8J A;  5M9O A;  3EVQ A;  5J1Z A;  5CC4 A;  2SOB A;  2F0K A;  4ID6 A;  2F0S A;  3DHQ A;  4EQN A;  3C1E A;  3NQT A;  1EYD A;  2PZU A;  1EYC A;  4QF4 A;  1EY9 A;  2F0N A;  1ENC A;  5IOD A;  4ME5 A;  5C3W A;  5J22 A;  3QOJ A;  4IAL A;  4NP5 A;  5CV4 A;  2F0T A;  2PYK A;  3OWF A;  5E1F A;  2NUC A;  1SND A;  2PQE A;  3MHB A;  5EGT A;  5CV6 A;  5JOB A;  5C5L A;  3TME A;  1EY0 A;  2EYH A;  2PZW A;  4PMB A;  1SYE A;  3SR1 A;  2EYF A;  4B9X A;  4EVO A;  2EYL A;  5CV7 A;  5F2D A;  5J39 A;  1SNP A;  3QB3 A;  4KY7 A;  2OEO A;  3TP5 A;  5I9O A;  2ENB A;  3QOL A;  4KD4 A;  5KYL A;  1KAB A;  1JOQ A;  3OSO A;  2EXZ A;  2O4X A;  5CR3 A;  3TP7 A;  3OMG A;  5KYI A;  4NKL A;  5ISR A;  1A3U A;  3MXP A;  4RKB A;  4KY6 A;  5K5P A;  1RKN A;  4B9W A;  1STY A;  2F3V A;  5CV5 A;  3MVV A;  3BDC A;  5IGF A;  2KQ3 A;  1II3 A;  1STB A;  1EY4 A;  1A2T A;  3NK9 A;  1STG A;  2PW7 A;  3D4W A;  2F0D A;  5IGE A;  2WAC A;  1SYB A;  5IGC A;  3RUZ A;  3TP6 A;  4F7X A;  3LX0 A;  1IHZ A;  1F2Y A;  2HQE A;  1EZ6 A;  3DMU A;  1TQO A;  2F0I A;  4HMI A;  1JOK A;  5CGK A;  3T16 A;  4PMC A;  4K5V A;  3HEJ A;  2PW5 A;  1SYF A;  4RKL A;  3V2T A;  1EY5 A;  1SYD A;  4TRD A;  3P75 A;  2F0V A;  1ENA A;  1NUC A;  2F0H A;  4MIU A;  5IIF A;  2SNS A;  5I9P A;  1SNM A;  2EY6 A;  1KDC A;  2RDF A;  4E6I A;  2EYP A;  1KAA A;  2OF1 A;  4QMG A;  4K5X A;  4N9P A;  1SNC A;  1SNQ A;  1SYG A;  3BDL A;  3ERQ A;  5C4H A;  1JOR A;  4WRD A;  1AEX A;  2F0W A;  1STA A;  1STH A;  1NSN S;  2EY1 A;  2EYO A;  4K2L A;  4KJN A;  2EYJ A;  1EY8 A;  3VA5 A;  5IGG A;  4OL7 A;  5JAV A;  1JOO A;  2F0P A;  4KTA A;  3MZ5 A;  4I65 A;  3U9O A;  4S3S A;  5E3F A;  3NP8 A;  4DF7 A;  5KGU A;  5NUC A;  1SYC A;  4KV6 A;  2F0U A;  4DU9 A;  3ERO A;  3S9W A;  3D8G A;  4HMJ A;  3R3O A;  4NDX A;  4WOR A;  2F0F A;  4F8M A;  5C4Z A;  2F0G A;  2RKS A;  2SNM A;  3OMC A;  3E5S A;  1A3V A;  1EY7 A;  3HZX A;  5I6Y A;  4IUN A;  1F2Z A;  1SNO A;  4J6H A;  5CV9 A;  5C5M A;  1EZ8 A;  3H6M A;  1F2M A;  2QDB A;  4N9T A;  4K8I A;  4PNY A;  5DAU A;  4DFA A;  4IZ8 A;  1KDB A;  4KY5 A;  1EY6 A;  5EKL A;  2F0L A;  3SK4 A;  3SXH A;  1A2U A;  3TP8 A;  4EQO A;  4ZUI A;  3NXW A;  3T13 A;  5HUR A;  4NMZ A;  5HGT A; 
#chains in the Genus database with same CATH topology
 2Z6B A;  5EBC A;  4YIJ A;  1BBX C;  3EN2 A;  3K80 C;  4RCN A;  1QZG A;  2BOS A;  3T1Y L;  5IT9 E;  1NNX A;  3HOY G;  5C44 B;  1TWA H;  2C35 B;  2CQA A;  2B63 B;  4JBK A;  1TII D;  2L11 A;  2VY3 A;  2WIN B;  4KK7 A;  1X9N A;  5FO7 B;  4DNT B;  4A3I B;  4DV5 Q;  3HOX B;  4LF7 Q;  1EQV A;  2N55 A;  2E2J B;  2EY5 A;  5CBE E;  1Y14 B;  2VQF Q;  1CT1 D;  4TKO B;  5M3M B;  2K5V A;  4ID6 A;  4EQN A;  5IWA L;  1MJE A;  4X64 Q;  4RWS C;  4AQY L;  1CSP A;  4OX9 L;  2E5L L;  3H09 A;  3IL8 A;  3T1H Q;  1PFS A;  3KUP A;  4JC0 A;  1EY0 A;  1G2T A;  2R92 B;  1NMF A;  3GV3 A;  2RA4 A;  3FPU B;  4HCS A;  5CV7 A;  2E5L Q;  2L1B A;  4BBR B;  3M4P A;  3OSO A;  2Z1C A;  4IUU A;  1MKH A;  1GUT A;  3P7J A;  2ZJR A;  1SAP A;  4IPH A;  1HFG A;  4WFN 3;  1VQK A;  1SE3 A;  3KK7 A;  5FO8 B;  2F3V A;  1FYC A;  1EIH A;  1IKL A;  2XTI A;  4RG1 A;  5FOB B;  3AU7 A;  2PMZ E;  5IGC A;  5IYD H;  5C4X H;  4F7X A;  1Q12 A;  4R4Q A;  4RH6 A;  3HP3 A;  3NPP A;  1PRT C;  4A3D G;  2MHV A;  4OO1 H;  2KOL A;  2RDF A;  1KDC A;  2PQA B;  4E6I A;  1A8V A;  4QMG A;  1JJ2 A;  1VQA A;  4R8I A;  3K5N A;  3S1R H;  4CKB A;  3PCO B;  4K2L A;  3HS0 C;  3OIQ A;  4DUZ L;  4LF7 L;  5CYU A;  1HCZ A;  1HNX Q;  2A8V A;  1K0R A;  3J7A V;  1N33 L;  5EJW A;  1D1I A;  1LO5 D;  1GHK A;  5I2X A;  4DK1 A;  3D8G A;  2B39 A;  2IW3 A;  4P2C B;  4LJZ C;  4DR5 Q;  3TS0 A;  2C5C A;  4DNR B;  3NSW A;  1P8L A;  1H9R A;  3KYH C;  4ZUI A;  4DK6 C;  5HUR A;  2K5H A;  4BY1 B;  5A35 A;  4X3T A;  3RLO A;  2F3W A;  2EY2 A;  1X3P A;  2EJF C;  4H7B A;  4DV4 Q;  4MHE A;  2QEJ C;  1KDA A;  1K9M C;  4KN7 C;  3A8I E;  1B70 B;  3S17 B;  3HOW B;  4K2K A;  2BE5 C;  5GAE C;  4BY1 H;  1HR0 Q;  4FF1 A;  4F88 A;  1HNZ L;  5HGQ A;  3HOV B;  2RVL A;  4DR3 Q;  2K5W A;  2IX1 A;  4EQP A;  1E3P A;  1JC7 A;  3I4M B;  2OQK A;  4RFB A;  3J80 c;  2BE5 D;  2F0K A;  5IWA Q;  1JT8 A;  3GQB A;  5IOD A;  1UUP A;  2A19 A;  4X65 Q;  1E24 A;  1BCP C;  5C5L A;  4B9X A;  1B3A A;  3HKZ B;  3NBI A;  4JOI A;  1VMC A;  3K7A B;  1WOC A;  3OMG A;  1SMY D;  1RIP A;  1PH3 A;  2JN4 A;  1VQJ A;  5M3F B;  4FP5 D;  3CCU A;  1CKM A;  3GP7 A;  3NEL A;  1TWF H;  3HOW G;  1EY4 A;  4ILW A;  4LF8 L;  4C3I G;  4ZLT F;  3LX0 A;  3DMU A;  4XDX A;  3H0G H;  1UE1 A;  4DN4 M;  2LSS A;  1FNV A;  3D4R A;  2D5D A;  3FKI H;  4KMU C;  3V2T A;  5CMD A;  1LT3 D;  1Y1W B;  1NUC A;  2K5N A;  1QNK A;  1YNN D;  1Q8I A;  4JI5 L;  2OF1 A;  4IJH A;  3MWY W;  2WII B;  3I8Z A;  4BBS H;  1O7Z A;  5FKA C;  1Q1E A;  2D0P A;  2CW0 C;  3DM3 A;  1D1K A;  3VYR A;  4S3S A;  3DWQ A;  1YNJ D;  1PYS B;  2K14 A;  3H0G G;  3FVQ A;  2A6E C;  4IJL A;  2E2I H;  5JPM C;  3R3O A;  3C3L A;  1HNW L;  1RF2 D;  2D2C C;  4UAI A;  1B7Y B;  4J6H A;  1VF7 A;  1QE6 A;  2A5H A;  1FR3 A;  5ELB A;  5GAD C;  4DFA A;  2VUM H;  1SMX A;  1NAP A;  4KY5 A;  4YCV A;  3TP8 A;  4ZK9 B;  1S72 A;  3I4N H;  3Q6S A;  5HGT A;  4JI8 Q;  4L5S A;  4JK1 C;  2OXP A;  4IPC A;  3PV0 A;  3SK8 A;  4B3S L;  1V1P B;  4POG A;  1I50 H;  5KNC A;  1DM0 B;  3SK5 A;  4JI4 Q;  2HHH Q;  4HIM A;  1SBB B;  2F0O A;  1RTO A;  5FK9 C;  4JYA Q;  5FO9 B;  2XSC A;  1RL2 A;  4R4C A;  4GKJ Q;  3GTO B;  1V43 A;  3KLW A;  2NVX H;  2JYO A;  1A3T A;  3I4L A;  1VQ5 A;  5C0X H;  4A3K G;  1EEF D;  1VQD A;  3SDZ A;  1FJG L;  4GKJ L;  2LFN A;  1ESF A;  2KHJ A;  3HOZ B;  4R8N A;  3GTM B;  4JI5 Q;  1M1K C;  3GTJ H;  1EYD A;  2H4O A;  4IAL A;  2B2V C;  1YJ9 A;  3S1N H;  4X3S A;  2RQX A;  2NVQ B;  1WFQ A;  1N34 L;  3LGJ A;  2NWG A;  4LK1 C;  3CCL A;  1B3Q A;  4A3B B;  2ASB A;  2K5Q A;  3RZD B;  1JOQ A;  2O4X A;  1B44 D;  4CGY B;  4EX5 A;  1IKM A;  1KIX A;  1YHB A;  1MI2 A;  4IO9 A;  1HZ9 A;  1C9O A;  4QJF A;  1Y8O B;  2PCF B;  2XWB B;  5HY6 A;  5K5P A;  1SJH D;  3UDG A;  2FMC A;  4O1N A;  3J81 j;  2F03 A;  3CCJ A;  5IGF A;  1YJN A;  2IT1 A;  3D4W A;  1S40 A;  4R4I A;  4JI8 L;  2ZXO A;  4CDE C;  4A3J B;  1GUW A;  4JI2 L;  3T16 A;  4CBV A;  5ELO A;  3KJP A;  1IBL L;  1YIJ A;  3HG9 A;  2RHQ B;  1SNQ A;  5J3B A;  2LY7 A;  3ERS X;  1AEX A;  1XWE A;  1E0B A;  4R9W A;  2RCN A;  1UE7 A;  1AN8 A;  5E7N A;  1MD2 D;  2EVB A;  3I70 A;  1Q3L A;  3T1Y Q;  4I65 A;  3U9O A;  4GOP C;  1PH1 A;  4AIM A;  2F4V L;  5LL6 S;  5C4J H;  1B1Z A;  3ERO A;  1W6K A;  2FMM A;  1MIU A;  2KED A;  5BN3 A;  4DV4 L;  3MXG A;  3HOY B;  3F1Z A;  4PZ8 A;  3R2T A;  3KLS A;  3NE5 B;  4J15 A;  4C2M H;  2XNA C;  4JCV E;  3I3C A;  1ML0 D;  5I9O A;  4HTH A;  4DV0 Q;  3MEH A;  4A3G B;  3NHH A;  4KKT A;  3DM1 A;  1EIG A;  1C8C A;  3GTJ B;  1TY2 A;  2X69 A;  1V8Q A;  1ET6 A;  1N32 Q;  3TN2 A;  3DWA A;  3CD6 A;  3BZK A;  4DAV A;  2G9H D;  3OOC A;  4C56 C;  1WCM H;  4XQJ A;  4DV7 L;  4A3E G;  3J80 i;  3R8B A;  5IT9 L;  1ASZ A;  4J8Q A;  3STB D;  1L1O A;  3DHQ A;  4TQU S;  5FLM G;  4OO1 I;  4DV7 Q;  4IPG A;  4FXG C;  1LAC A;  2MPM A;  4L5Q A;  5I6Y A;  1SND A;  3FDT A;  4HAE A;  1GD7 A;  2MJ8 A;  2OEO A;  3TP5 A;  4DR1 L;  2XIW A;  3W2D A;  5KYL A;  1KAB A;  1BKB A;  4L63 B;  3FMC A;  3LNN A;  1PZJ D;  2E76 C;  1TWH H;  1PH2 A;  2L0C A;  5ELN A;  3PO2 B;  4A3D B;  1VS0 A;  1QUQ B;  3CMA A;  3I90 A;  2DUD A;  2PW7 A;  1B4O A;  3HOX G;  2HIX A;  2OTL A;  1WTR A;  1KRT A;  1AW7 A;  5AJ3 L;  4RKL A;  2A6H C;  2VQE L;  3CCR A;  4AYB B;  4JI0 Q;  2HDM A;  1CHP D;  2LMC B;  1TKW B;  3F2U A;  2CWP A;  3K7A H;  2A1A A;  2IHF A;  1SNC A;  5C4H A;  1YNN C;  2JA7 H;  5JVG 3;  4NXM L;  3GTK H;  1YVC A;  2F52 A;  5DM6 3;  1DXM A;  1GUO A;  1EQT A;  3CQZ H;  4FXK C;  3T56 B;  3E9I A;  4G7Z C;  2JA8 B;  1ZEQ X;  4LFA Q;  3K5M A;  4BA1 I;  1SYC A;  5EBD A;  3S15 H;  4WOR A;  1FL0 A;  2Y0S E;  2Z6K A;  2CKZ B;  2OQ0 A;  3OMC A;  2UUB Q;  3E3X A;  1AE2 A;  3HZX A;  2O5I C;  1YEZ A;  2VXW A;  3GTG H;  3M4Q A;  3GTP H;  1KDB A;  5IYD G;  4NPS A;  1SRO A;  4NMZ A;  3TP6 A;  5C3X A;  4DV1 Q;  1JE5 A;  2IL8 A;  3EJI A;  5KRU A;  3UE1 A;  2LKV A;  1WI5 A;  1OXS C;  1IL2 A;  3K57 A;  1VQM A;  2YU9 H;  4QB4 A;  4OON A;  5EAY A;  1HH2 P;  1E2W A;  1PTO C;  1QVF A;  2EQS A;  2B29 A;  2Z9H A;  4DGZ A;  3CP0 A;  1F2L A;  1QG7 A;  3W5O A;  1LAB A;  1X65 A;  3SHL A;  4X65 L;  1I4G A;  1HQM C;  2KCN A;  3BDO A;  4DAY A;  4HJ5 A;  3PUZ A;  3SK6 A;  3CCS A;  2WB1 E;  4ZUJ A;  1TVX A;  4HR7 B;  2RSO A;  3KF8 A;  2ICI A;  2NZO A;  2OTJ A;  3PUW A;  2ID0 A;  1K8O A;  5G3L F;  2RDG A;  4XXE A;  3A7A B;  5D3I B;  1D5X C;  1HA5 A;  3NQT A;  1EY9 A;  3ER0 A;  5JEA J;  2KEN A;  5C3W A;  2B63 G;  3I4M G;  1OXX K;  3GD7 A;  1JB7 A;  4GN3 B;  3NTH A;  1G29 1;  2VL6 A;  1L0X B;  4PQX A;  1NR2 A;  1LLR D;  3M4O H;  1DOL A;  3MC0 B;  5CR3 A;  4LF4 Q;  4CDC C;  3RZO H;  4NKL A;  1A3U A;  3MXP A;  3G6E A;  1IBM Q;  3CRK C;  3QR8 A;  1T9H A;  4BXX H;  3PUY A;  5IP9 G;  5C44 H;  3L0O A;  1PTO D;  3GV6 A;  1L0W A;  4JG2 A;  1EQR A;  1PZI D;  4HIO A;  1BF4 A;  1QUQ A;  1XJV A;  4TRD A;  2DGY A;  3G7L A;  3S1M B;  4JI0 L;  2BH8 A;  4YWM A;  1HNW Q;  2EYP A;  1HR0 L;  2OWO A;  3M7G A;  4P73 A;  2I5M X;  1YNJ C;  1X3F A;  5IGG A;  3D31 A;  3S1N B;  2XRQ D;  3C2P A;  3FHW A;  3UE0 A;  4GN5 A;  2R6G A;  1LT6 D;  3S16 H;  2D62 A;  3J80 E;  3Q24 A;  3VR6 A;  3BS1 A;  1VDZ A;  4HMJ A;  4Y7N H;  1N32 L;  2EJG C;  4X3K A;  5C0X J;  5CV9 A;  4QUF A;  1EZ8 A;  2N8N A;  2QDB A;  4H02 A;  1WTX A;  3HOV H;  3SXH A;  2B2T C;  2UUC Q;  1NBW A;  5BR8 Q;  2F1M A;  4Q0F A;  4PV1 C;  2R3Z A;  4I7A A;  1EQQ A;  4A93 B;  4ZQ3 A;  4K6D A;  2UUC L;  3VYT A;  2JJQ A;  2CWA A;  3AQQ A;  4LF9 Q;  1CK1 A;  2NZH A;  1F9Q A;  2RBM A;  5ELE A;  4QIW E;  1DCZ A;  1A0I A;  1K8M A;  2YYZ A;  4XT3 B;  1H9J A;  1AE3 A;  4A3M H;  2F0M A;  4OWX B;  3UDI A;  5DEH A;  1OO9 B;  1Y1V B;  5IGB A;  3CC7 A;  2GN5 A;  3V96 A;  1BCP D;  2EYM A;  4B3R L;  4OIJ A;  1EOT A;  4P75 A;  1S5F D;  1Z47 A;  2JEA I;  3EFX D;  1WCM G;  5EKI A;  5M3M G;  4GLA C;  4DAM A;  4M8A A;  3QOJ A;  2VUM G;  3S17 H;  1IZ6 A;  2E2H H;  5CV6 A;  2EYL A;  3ULJ A;  2B8G A;  1Q90 A;  3PO3 G;  2B2Y C;  4YCU A;  1D6E C;  1IBM L;  3BU2 A;  3I4O A;  4R1J A;  1IBK L;  1ZYR D;  4LFC L;  5IYC H;  1STG A;  2V1C C;  4C1N I;  1WTW A;  2F0D A;  1F2Y A;  1X32 A;  5GQO A;  1EIY B;  3KDF B;  2K05 A;  2UXC L;  4DR7 Q;  2MO0 A;  4PMC A;  4K5V A;  3NWT A;  2PW5 A;  4RCO A;  3FKI G;  3M7N A;  2JA7 B;  4C3J B;  3KF6 A;  2QCP X;  4FYD A;  2EY6 A;  4JI6 Q;  4NXN L;  1WCM B;  2JXM B;  1SYG A;  3BG3 A;  1RTN A;  3VYU A;  1U4M A;  2HDL A;  1YNX A;  1GKH A;  2IWH A;  1LTS D;  4A3B G;  2X6L A;  1EY8 A;  1VQB A;  5G3L D;  4NXN Q;  5LL6 X;  5BR8 L;  1LM0 A;  1HFN A;  2WFW A;  3M3Y H;  5C4X G;  2MQH A;  1PFN A;  4IQZ A;  2IJ0 A;  3H3V H;  4ZYS A;  1K73 C;  1NJI C;  3B6Y A;  1A3V A;  3L3O C;  3OHX C;  4DR4 L;  3PO2 H;  1KLG D;  5EKL A;  1EWC A;  1EL0 A;  1HR0 W;  1ZKO A;  1CKN A;  3FEW X;  4JI3 Q;  2HCI A;  1X54 A;  2L12 A;  1DZ1 A;  5IOC A;  1O7Y A;  3A0J A;  4XQQ A;  4NXM Q;  3HRZ C;  1CQV A;  5IP7 H;  4B3M Q;  3CC4 A;  4MTN A;  4IFD G;  2CQO A;  1H9K A;  2CH4 W;  1HNX L;  4FO2 A;  1IW7 D;  4H0L C;  4YHH L;  2PNR C;  1XPU A;  2UXB L;  4GS3 A;  2O2L D;  5CV8 A;  2UXD L;  2NBF A;  4P71 A;  4JBM A;  3JAM E;  2AUJ D;  4K8J A;  2R92 G;  1CI3 M;  1UE6 A;  3MA2 B;  4JI4 L;  2SOB A;  3S1Q H;  1KHI A;  1H9M A;  1SR3 A;  3OIP A;  4DV5 L;  2BH2 A;  1IBK Q;  2K7V A;  2AUK A;  1KC8 C;  2EZV A;  1A63 A;  3WWV A;  5AJ3 Q;  4P74 A;  3U58 A;  3PO3 H;  3MFG A;  4DR3 L;  4QY7 A;  3IAY A;  4WJ4 A;  1VQ7 A;  1SFO B;  2JA5 G;  2MFI A;  2CCZ A;  3I4N B;  1SJE D;  1H9S B;  2Q8T A;  4RKB A;  3A5U A;  4DR6 Q;  4CKE A;  2QKI C;  4JW0 A;  3BDC A;  3K81 C;  4GNX A;  4A3J H;  1A2T A;  1JWU D;  1PH8 A;  4JBW A;  4QL5 A;  4DAY B;  1CKN B;  1IYJ B;  3OTO Q;  3PF4 A;  3EA6 A;  4A3C G;  2KCM A;  3MTS A;  2R93 G;  2ZXP A;  3HEJ A;  4FNF A;  1R4P B;  4IUR A;  4UP7 A;  1M4V A;  1K3R A;  2RHS B;  4QQB X;  4PG3 A;  1YI2 A;  3HOZ H;  2RDH A;  5IYB G;  1L0Y B;  2F0W A;  2JP1 A;  4IN3 A;  4DA2 A;  2EYJ A;  4NB3 A;  1Q82 C;  3RR5 A;  2K33 A;  3OW2 A;  1AP0 A;  1JOO A;  2JSO A;  3RNU A;  1M90 C;  3NBH A;  3NP8 A;  1O80 A;  5IT9 c;  5JJK A;  4LF6 L;  1B53 A;  2BDN A;  3M9B A;  2G5D A;  3CRL C;  5C4Z A;  1FGB D;  3WDN A;  2F0F A;  1F9P A;  3CPW A;  2K32 A;  4K0K L;  3K5L A;  3UDX A;  5T1G A;  3U9S A;  4L8J A;  1F2M A;  5BN5 A;  5KYI A;  4A93 H;  4MTK A;  1A6X A;  1ICW A;  1A2U A;  1QVC A;  5DLQ E;  3T13 A;  4RAU C;  3CCE A;  3DLL A;  3EBE A;  1N8R C;  3QIA A;  1K28 A;  5E4W C;  1F77 A;  1Q81 C;  1SLJ A;  2NN6 I;  1EWI A;  2PPB C;  4POF A;  4ZKC B;  1W6J A;  3ITP A;  4P72 A;  4ODG A;  2YTV A;  1TU2 B;  1Y1W G;  2KUM A;  1E1O A;  3BZD B;  1HNZ Q;  1DGS A;  1BQQ T;  2ZT9 C;  2NZ1 D;  4IFD I;  5I6W A;  2XRS D;  2D9U A;  3L9A X;  2AMC B;  2F0E A;  2KHI A;  2UXC Q;  5IGD A;  1MJC A;  4AH6 A;  1WTV A;  4RMF A;  3RD4 A;  1BCP B;  4OEL B;  2H1E A;  3OYY A;  1L1O B;  2NVY H;  1K83 H;  4DV2 Q;  2E8G A;  3KOJ A;  4BBR G;  3H0G B;  5I4D A;  3MHB A;  4X62 Q;  5JOB A;  1IYU A;  1RJT A;  3VDY A;  2K03 A;  2R7F A;  4PMB A;  3SR1 A;  2HCC A;  2VZA A;  5J39 A;  2MNA A;  3RZO B;  4KD4 A;  1KLU D;  4IUQ A;  2HUG A;  4A3C H;  1QWY A;  1EIF A;  5ISR A;  1NY4 A;  2A6H D;  3QJY A;  3J81 E;  2Q8I B;  4I7Z C;  3QO2 A;  4X66 Q;  1QZH A;  2UUA Q;  3AFP A;  3RUZ A;  2HQE A;  4WJW A;  3TRZ A;  4QGU A;  2F0I A;  1BNZ A;  4HMI A;  2FHT A;  1S5C D;  1VQO A;  1DOM A;  4B3R Q;  2AKW B;  4JVZ A;  1SYD A;  3ICE A;  4A75 A;  3CW2 C;  3FRP B;  1JWS D;  1L2F A;  4MIU A;  2SNS A;  4OIK A;  3CF5 A;  4B3T L;  2K1B A;  4OGQ C;  3MEF A;  1HZA A;  2K5D A;  1X3E A;  5KNB A;  1I4X A;  1STH A;  2L9H A;  1GXD C;  4IPD A;  2QIL A;  1A15 A;  1FGU A;  5JAV A;  4KTA A;  4CDF C;  1PH5 A;  1PFM A;  1VQ6 A;  1K3B C;  4DF7 A;  1PYW D;  4BWG B;  2L5T A;  1GUG A;  3IKJ A;  4A76 A;  2K28 A;  1LT5 D;  5E4X A;  5L37 A;  1O7L A;  4F8M A;  2TSS A;  1CZW A;  2PMZ B;  4KHP L;  3LWE A;  1VMP A;  1I3Q B;  2I46 A;  4H44 C;  5AFW A;  1Q86 C;  1F2Z A;  1DON A;  4KHP Q;  2DN8 A;  2DNE A;  3GTG B;  4KN4 C;  3RZD H;  1JR0 D;  4KHV A;  1AZQ A;  1J6Q A;  3A55 A;  4DXF A;  1PVO A;  1C0A A;  2JA8 H;  3CXC A;  3CHB D;  1LYL A;  3A8K E;  4KD3 A;  4A3J G;  1G2S A;  1PYB A;  3NUC A;  1E22 A;  3X3M A;  3PMF A;  5KEE A;  4PZ6 A;  1OXU A;  3GTK B;  1J9O A;  2NN6 H;  5FLX E;  1ILP A;  3EVQ A;  1XMQ Q;  2DJF C;  3E9H A;  4B3S Q;  3C1E A;  2PZU A;  3S14 H;  2F0N A;  3Q8D A;  2WAQ B;  5BN4 A;  2K52 A;  3SEB A;  1Q46 A;  1TWG H;  5EGT A;  4XT1 B;  2EYH A;  1DYQ A;  3F2D A;  4O0A A;  4Y52 H;  3J7A F;  1V1O A;  1SNP A;  3J7Z C;  2A6E D;  4GLV B;  1VQL A;  1W2B A;  4DPG A;  3JC6 6;  2Z4H A;  3E0J A;  3HOY H;  4LUO A;  2B2V A;  5D3D A;  4WJ3 M;  3A8J E;  1D5Z C;  1WD1 A;  1STY A;  3H3V I;  1R9T H;  1X55 A;  1QVG A;  3S16 B;  4LNQ A;  1OXT A;  3TQY A;  1JOK A;  1QJO A;  2R61 A;  1SYF A;  1EOV A;  1RCV D;  1PH6 A;  1TS3 A;  4NW2 A;  5I9P A;  1SE4 A;  1JJC B;  5COY A;  3I72 A;  1ONL A;  3ERQ A;  4DK3 C;  1JOR A;  3J7Y W;  2RSN A;  2EYO A;  2Z6K C;  3C46 A;  4BBS G;  5IE8 A;  1EWH A;  3EIV A;  1U4L A;  4RA8 A;  1U4P A;  2GVB A;  3GTQ H;  4G4K A;  3J81 L;  2R93 H;  1XTD A;  5A2Q E;  3PO3 B;  1KRS A;  2Q2T A;  2R7D A;  4JBJ A;  1E2V A;  1YIT A;  2EXD A;  3FPP A;  4RGN A;  4GOP B;  2SNM A;  4LF4 L;  1ICF B;  2HT1 A;  3J7A 5;  3F2B A;  3H6M A;  1NE3 A;  2IX3 A;  4B3M L;  4L5T A;  3G6J B;  2LS0 1;  1HJP A;  3K5O A;  2VUM B;  2NB0 A;  3M85 A;  3NBH B;  1PDQ A;  1FNU A;  4C3J G;  4DUY L;  2CW0 D;  3P1H A;  3PIP A;  1HUN A;  2R92 H;  3Q0A A;  2P5Z X;  4HJ7 A;  2RCF A;  1J8I A;  1IW7 C;  1ENF A;  2J7Z A;  3G4S A;  1B50 A;  3ZJY C;  1HZC A;  2JE6 I;  1EFI D;  1S4Z A;  5ELC A;  5A2Q L;  1SSO A;  3N6R A;  1BOS A;  2B2U A;  1Y1W H;  1Y1V H;  4AYB G;  1Q1B A;  1TS5 A;  3J81 c;  4HSP A;  2HHH L;  2YV5 A;  3ULP A;  2ZTC A;  3RN5 A;  3IRB A;  3JAM L;  2E2H B;  1BDO A;  1PA6 A;  3QG1 A;  3PO2 G;  2PQE A;  2HQL A;  3U4V A;  3ULL A;  1STE A;  2EYF A;  1YZ6 A;  3NTI A;  1HTL D;  3UI2 A;  1KAW A;  1Z7T A;  3L2P A;  1BVS A;  3ZYY X;  4IUT A;  1PRT B;  3L7Z C;  5M3F G;  1C4Q A;  2ZTE A;  4FF4 A;  4F87 A;  2ALY B;  4O42 A;  1QCB D;  1JQY D;  4KKU A;  3BVM A;  1KNA A;  1Q7Y C;  1PXU A;  3S2D B;  2PO4 A;  2WV6 D;  1JCK B;  4DR2 Q;  3GTM H;  2BDO A;  5CGK A;  2B2U C;  1NTG A;  4GLX A;  2YU9 B;  2UXB Q;  2F0V A;  2B2Y A;  1M8A A;  3H15 A;  4ZAI A;  1U0L A;  4LFC Q;  3MAQ A;  1XTC D;  3M4O B;  3TBI B;  3I73 A;  3HOW H;  4HJ9 A;  1LTA D;  4V19 0;  1LT4 D;  2NN6 G;  2V4D A;  2FJ2 A;  5E3F A;  4C3I B;  3VR5 A;  4RHR A;  4KV6 A;  1ET9 A;  2FIN B;  4DU9 A;  3M3Y B;  1VQE A;  1R4Q B;  2XGT A;  3E5S A;  4Z9C B;  5M3F H;  1UAP A;  5C3E B;  1B9N A;  2ZJQ A;  4A3K B;  4HN7 A;  1SFO H;  4JYA L;  3W1G A;  2QGQ A;  5M5W B;  4LUV A;  1WYD A;  5H1S E;  4X62 L;  2PNH A;  1JMC A;  1XNR L;  2K75 A;  4A3F G;  5EPJ A;  1I4R A;  2Q2I A;  2A74 C;  2Y0S G;  4K5W A;  5EKK A;  4V0B A;  1D2B A;  1GUN A;  4APV A;  1BCP F;  2MO1 A;  3MXU A;  5LMN W;  1TY0 A;  4A3F B;  4YY3 L;  4JI6 L;  2UU9 Q;  3OTO L;  2JA9 A;  2PZT A;  4UPA A;  1I4H A;  1WD0 A;  3I4M H;  4BS9 A;  2UUA L;  1KXL A;  1Z6H A;  1Y1V G;  2J4X A;  2Z0S A;  3M4Y A;  1HPC A;  1CQF A;  2TMP A;  4DV0 L;  1FJG Q;  3GDE A;  1Y69 U;  3GTO H;  3T4A C;  4H13 C;  3CCQ A;  4YWL A;  3VA7 A;  3A74 A;  5D65 A;  1RD9 D;  4NP5 A;  3BVG A;  3S1Q B;  5E1F A;  4G7O C;  2WB1 G;  5CBA E;  2RF4 A;  1SYE A;  1WTQ A;  2DNC A;  1QB5 D;  3K59 A;  1DOK A;  3K8A A;  3TP7 A;  5JJL A;  4CJ1 B;  4HSV A;  4JI7 Q;  1EFW A;  2CFM A;  4BY7 B;  2WP8 J;  2KQ3 A;  3AB9 A;  1PH9 A;  3CC2 A;  3S1M H;  1G91 A;  3CU7 A;  1XNR Q;  3NEM A;  4LWC A;  2ZJP A;  4CHT B;  5I2Y A;  5FLX c;  1T5X D;  1GM5 A;  4C3H G;  3W1B A;  1WTH A;  1TWF B;  4ZRZ A;  1I6V C;  3TRE A;  3V05 A;  1IL8 A;  4K5X A;  4FXD A;  1SE2 A;  1V1Q A;  1NSN S;  2EY1 A;  3W3A A;  2R7Z B;  3HOU G;  1K0S A;  3GTL B;  3FP9 A;  5LMN Q;  4GKK Q;  1LTI D;  1GHJ A;  4GNX B;  2SDF A;  1CFM A;  3VYS A;  3CQZ B;  3S9W A;  3DWP A;  1E1T A;  3BYY B;  5C3E G;  3J81 i;  2QF7 A;  2HD3 A;  2C9O A;  3N52 A;  3K7U C;  4EQO A;  4O2D A;  4HED A;  4DK0 A;  4IUV A;  1UNS A;  3KBX A;  1XX8 A;  3U50 C;  1XMQ L;  4A3E B;  3IFT A;  1Z9F A;  3PSI A;  4FDB A;  4ULL A;  4JI7 L;  1QIL A;  1EYA A;  4QCL A;  4G57 A;  2B2T A;  1UE5 A;  3A7L A;  5FLX L;  2QDL A;  2MUY A;  3DEO A;  3TDQ A;  1CM9 A;  3E0E A;  4XQN A;  4K6L A;  3T51 B;  1N34 Q;  2B3G A;  2D0O A;  2Q8R E;  2F0Q A;  3S1R B;  2A69 D;  1N33 Q;  3U4Z A;  1PTO B;  5EPL A;  2ZM6 L;  1NR4 A;  1SN8 A;  2F0S A;  4U68 A;  4LF8 Q;  2ES2 A;  4KI0 A;  3HOZ G;  3RN2 A;  2F0T A;  2FFK B;  5EQ0 A;  2NUC A;  1C7Y A;  2NVY B;  2JA6 H;  1JE4 A;  3DEP A;  5COR A;  4AYB E;  1S3O A;  3H3V C;  4OHJ A;  5GRO A;  3PF5 A;  1TWC H;  4BY7 G;  4FF2 A;  5M5Y B;  1G6Z A;  1WVL A;  3MVV A;  3IFD A;  1II3 A;  3CPF A;  1STB A;  2PI2 E;  4A3B H;  4JV5 Q;  2WAC A;  4YHH Q;  1X3G A;  2CH4 A;  1ASY A;  2I5H A;  4IOC A;  1VQ9 A;  3AMU A;  3O13 A;  4MZ9 A;  4JPB W;  4RGT A;  1PTO H;  1SNM A;  3KF6 B;  1QOH A;  4Q5V A;  5DM7 3;  3BDL A;  4JI1 Q;  1CSQ A;  4DR7 L;  5LMU Q;  2HIV A;  4DR6 L;  3VA5 A;  1TS2 A;  5D14 A;  2BA1 A;  5LHY 1;  3MZ5 A;  3HKZ G;  1LTL A;  4B08 A;  5NUC A;  4DV3 Q;  2UXD Q;  2BA0 A;  1HZB A;  3JAM c;  1E7Z A;  1N36 Q;  3Q23 A;  2RKS A;  1T5E A;  1B9M A;  1EY7 A;  4A3G G;  2NVT B;  4OWT B;  2N78 A;  4IZ8 A;  4BBR H;  3WOE A;  1EY6 A;  2F0L A;  5M5X H;  4DV6 L;  4A3K H;  3SGI A;  1VCI A;  1LUZ A;  2A69 C;  1LV9 A;  1FVI A;  4LF5 Q;  5JJI A;  3A5Z B;  2NVT H;  3I91 A;  1I4Q A;  1PTO F;  4J1M A;  2B63 H;  5JVH 3;  5FJ8 G;  1PLF A;  1PFB A;  5GAH C;  4N8X 1;  3D0F A;  1EU3 A;  1VQH A;  3G48 A;  4OX9 Q;  2LXK A;  2E2J H;  1H95 A;  5KIX A;  1LTT D;  1SXT A;  2VB2 X;  4A93 G;  1MHW C;  2A68 C;  5ELD A;  3PUV A;  2JEB I;  4K14 A;  1G51 A;  3MFY A;  5ELF A;  1GUS A;  2KVM A;  2R7Z G;  4JI3 L;  2F3I A;  2JA5 B;  4OWW B;  3FKI B;  1D8L A;  2GVA A;  1XMO L;  1PZK D;  1MGS A;  5J22 A;  3CME A;  1K83 B;  1ROD A;  3TME A;  1SMY C;  4EVO A;  3H94 A;  4FF3 A;  3KDF A;  4UDU C;  2K04 A;  4MN3 A;  4TVA B;  4KY7 A;  5GAG C;  4LFA L;  4BBS B;  2NYZ D;  3QOL A;  4BY7 H;  4BA2 I;  5M5Y H;  4HID A;  1FD7 D;  2E74 C;  2NVQ H;  2JA6 B;  2I5L X;  1DD2 A;  3NWS A;  1GO3 E;  4L5R C;  2E2I B;  2CHB D;  4FVM A;  5IYB H;  5IGE A;  2WKC A;  2N49 A;  3VR2 A;  4UP8 A;  1F9R A;  1LTR D;  4MNO A;  4DV1 L;  3OW7 A;  3D3R A;  4UP9 A;  3BZC A;  1KNE A;  1CKO A;  4QIW B;  2Z4I A;  1D5M C;  2JA8 G;  1CA5 A;  1NCV A;  2Y0S B;  3P75 A;  4DV3 L;  4A3D H;  2F0H A;  1X6O A;  2PQA A;  2KCT A;  3AEV A;  3EQL C;  1VQP A;  4PMW A;  2PI2 A;  3HFZ B;  2E2D C;  3KLS X;  1PH7 A;  2AQ3 B;  2B8F A;  1S5E D;  4BXX G;  2EOT A;  1MSH A;  2KBN A;  1OTC A;  2MP1 A;  3CAM A;  2N3S A;  1HQR D;  4A3F H;  1KL9 A;  4JOI C;  1I94 Q;  2WKD A;  2K01 A;  4KHZ A;  1CA6 A;  1F9S A;  3TEH B;  2BCO A;  1CTM A;  1BO0 A;  4ZCK A;  4B3T Q;  1CHQ D;  2F0G A;  1OXV A;  2OCE A;  4IUN A;  1SNO A;  1VQI A;  3SK4 A;  5EPK A;  1P16 A;  4DUZ Q;  3OWE B;  4R4T A;  2M9V A;  4HCE A;  1U9R A;  4C3J H;  2ZTD A;  1PH4 A;  1AZP A;  1XPR A;  1HTP A;  1X56 A;  3K58 A;  1YBY A;  4DNI A;  4ABN A;  2EDG A;  3URY A;  1STN A;  4LAA A;  3I2Z A;  3D4D A;  2DY8 A;  1CZG A;  4DR4 Q;  4GZY C;  1EU4 A;  4C2M B;  3KF8 B;  1TXY A;  1PRT F;  1LTB D;  4CDD C;  2R7Z H;  1J5E L;  3K0X A;  5JEA G;  3D6W A;  2VS1 A;  3KLR A;  4XYO A;  1VQC A;  4DUY Q;  1XNQ Q;  3LWU A;  1JWM D;  4KJO A;  5M9O A;  2LXJ A;  2O5J C;  5CC4 A;  5IP7 G;  4A3L G;  4DAP A;  1U5K A;  5CV4 A;  3NQI A;  4JI1 L;  1VQ8 A;  4N8F A;  4RHS A;  5FLM H;  1J5E Q;  2PZW A;  1EUJ A;  1L1O C;  3BJU A;  3F2C A;  5F2D A;  1UEA B;  5KND A;  2EE1 A;  1I4P A;  2ENB A;  4A3E H;  4DR5 L;  1B2T A;  1KTK A;  3HGB A;  4X3U A;  5C44 G;  1VQF A;  5CV5 A;  2VQF L;  3CCM A;  4A3G H;  3KJO A;  1N9W A;  3QWN A;  3PIP 3;  3X3N A;  4RGM A;  3ND9 A;  4C3I H;  1EZ6 A;  2GA4 B;  2K4K A;  3NTK A;  5JEA H;  2UU9 L;  3PIO A;  3T1H L;  3HKZ E;  4UHV A;  3A54 A;  1ENA A;  3A56 A;  4XTC S;  5IIF A;  1G6P A;  4A4I A;  3J80 L;  2B2W C;  4N9P A;  3HOX H;  5LMU L;  2L55 A;  1BXT A;  1A62 A;  2ZXR A;  4RGO S;  4LFB L;  4Y7N B;  4KJN A;  1WTP A;  1WTO A;  1MBY A;  4C3H B;  5C4J B;  1WJJ A;  1BBU A;  1EEI D;  2YTY A;  3S15 B;  5TSS A;  2H5X A;  4HJA A;  3JAM i;  5K36 H;  1Y8N B;  5DNF A;  4OO1 G;  4NDX A;  3R2I A;  2KEE A;  2VB3 X;  5M5W H;  1SRU A;  1TWC B;  2AQ1 B;  5C5M A;  3STB C;  1BUV T;  4JV5 L;  4PNY A;  5DAU A;  5JJZ A;  4U67 3;  4IUP A;  2AWN A;  4X6A H;  2WAQ E;  4A3M B;  3TZD A;  4DXG A;  1PV4 A;  4LF9 L;  2L15 A;  4DKA C;  3S24 A;  1BBW A;  2ICE C;  5T1I A;  3VR4 A;  4M1U B;  3HOU B;  2L4N A;  2JK8 A;  4A3M G;  5M3M H;  3GTQ B;  3NEN A;  4DR1 Q;  2IY5 B;  4LMQ D;  1TR5 A;  1U4R A;  3GTP B;  3PIO 3;  2JA5 H;  1I5F A;  4YWK A;  2F0J A;  1G8Z D;  1AFP A;  3WOF A;  1FNW A;  2KHS A;  4A3I H;  4OXP A;  1MSG A;  4HJ8 A;  3S2H H;  2VNU D;  5J1Z A;  3P20 A;  1ENC A;  4ME5 A;  3HKS A;  3GTL H;  4XYQ A;  1SEB D;  4YY3 Q;  2K50 A;  2M2L A;  4LW1 A;  3S14 B;  1V9P A;  1I6H B;  3MXN B;  4QUC A;  4EQ5 A;  4XIG S;  3SE0 A;  1S5D D;  1HXY D;  4AQY Q;  3CCV A;  1PHJ A;  2JA7 G;  1GVP A;  2I07 B;  1N36 L;  3DXJ C;  1I6H H;  3CKI B;  3NK9 A;  4X66 L;  2QEX A;  4IFD H;  4X64 L;  3RLF A;  1YHA A;  1IHZ A;  2R93 B;  1TQO A;  4IOA A;  1ZYR C;  1ILQ A;  2I0Q A;  1JJG A;  3OPO A;  5C4X B;  1EY5 A;  4C3H H;  3GO5 A;  1HHV A;  3PQI A;  1PRT D;  1K8A C;  3Q22 A;  1C48 A;  1KAA A;  1IXR A;  2AWO A;  4CKC A;  4LFB Q;  1KD1 C;  1JB3 A;  2JQO A;  3K0Y A;  4IFD J;  1RDP D;  1AH9 A;  2VW9 A;  2XVS A;  1VQN A;  3HOU H;  1W3S A;  2OT2 A;  3MXN A;  4R4O A;  2F0P A;  1QNU A;  2K6A A;  1BR9 A;  2NTT A;  3PGZ A;  5KGU A;  5FJ8 H;  2A68 D;  1HA6 A;  2EPB A;  2F0U A;  3AYH B;  2Q2H A;  4DR2 L;  4A3L H;  1IBL Q;  2XN9 C;  4KLK A;  4EGV A;  3RMH A;  1KQS A;  1Q8K A;  4OEM B;  5M5X B;  2SEB D;  4K8I A;  4K0K Q;  3TSS A;  1CUK A;  5JPN C;  3E6Z X;  3BYT B;  1XYI A;  2Q2U A;  3SVM A;  4KKS A;  3C1F A;  2KEC A;  4LF6 Q;  4C1N K;  5LMN L;  4GKK L;  1H9S A;  3I56 A;  2ZM6 Q;  1S5B D;  1TT2 A;  4YCW A;  1O7I A;  3D6C A;  3S2H B;  1TWA B;  1X3Q A;  2A73 B;  1V1P A;  1HUM A;  2M00 A;  3H91 A;  5IYC G;  1D7Q A;  5C6A A;  1SDF A;  3I7F A;  2IPK D;  3ONA B;  1YHQ A;  3TZU A;  4CJ0 B;  2NTS A;  1Y8P B;  4A3I G;  1EYG A;  1TWH B;  2MGS A;  1VF5 C;  1I3Q H;  4DV2 L;  2F4V Q;  4PZ7 A;  1TS4 A;  2G9D A;  2Z8L A;  1YJW A;  1GOZ A;  2KJX A;  1EYC A;  4QF4 A;  4UY8 C;  1E2Z A;  2KA7 A;  2KCC A;  2PYK A;  1HRJ A;  3OWF A;  2UUB L;  3S2D H;  1R9T B;  2QW7 A;  1UEB A;  1K8G A;  2IHE A;  3ND8 A;  3QB3 A;  5K36 G;  4ALP A;  2VQE Q;  2EXZ A;  1I94 L;  3KFU A;  2FXQ A;  4L6T B;  3G71 A;  2N88 A;  4LF5 L;  3F8T A;  2AHO B;  4KY6 A;  2NVX B;  1RKN A;  4B9W A;  5C3E H;  3DUZ A;  4BY1 G;  1TWG B;  4G7H C;  4DV6 Q;  1XPO A;  1RHP A;  5C0X I;  4TSS A;  2DJG C;  3RLN A;  2YTX A;  1SYB A;  2AQ2 B;  2EJM A;  2IX0 A;  2B2W A;  1O78 A;  3I55 A;  2ATW A;  1XNQ L;  3UDF A;  3KBG A;  1I50 B;  3R93 A;  2X6G A;  3AFQ A;  3T53 B;  4ME3 A;  1DJR D;  3PUX A;  4ZKB B;  1B8A A;  4GOP A;  4GNX C;  4HIK A;  3HOV G;  4WRD A;  1STA A;  1SE8 A;  1XMO Q;  1VQ4 A;  4OL7 A;  4GN4 B;  1VQG A;  5IY0 A;  2CVR A;  2XWJ B;  2E75 C;  2QA4 A;  2WAQ G;  3I4N G;  2F4I A;  1ESR A;  4CJ2 C;  3TS2 A;  3BVZ A;  4JI2 Q;  1JIC A;  4LUZ A;  1ZXT A;  2J0T D;  1IYV A;  1PMR A;  1GJX A;  3VR3 A;  3K6O A;  2EIF A;  2JA6 G;  1LTG D;  4N9T A;  2DY7 A;  2WB1 B;  1UWV A;  1NMG A;  1XXG A;  3NXW A;  5IP9 H;  5C0X G; 
#chains in the Genus database with same CATH homology
 5EBC A;  4YIJ A;  1BBX C;  4RCN A;  2BOS A;  5IT9 E;  5C44 B;  2CQA A;  2B63 B;  1TII D;  2L11 A;  2WIN B;  4KK7 A;  5FO7 B;  4DNT B;  4A3I B;  3HOX B;  1EQV A;  2N55 A;  2E2J B;  2EY5 A;  5CBE E;  1CT1 D;  4TKO B;  5M3M B;  4ID6 A;  4EQN A;  4RWS C;  3H09 A;  3IL8 A;  3KUP A;  1EY0 A;  1G2T A;  2R92 B;  3GV3 A;  2RA4 A;  3FPU B;  4HCS A;  5CV7 A;  2L1B A;  4BBR B;  3OSO A;  2Z1C A;  4IUU A;  1GUT A;  3P7J A;  1SAP A;  4WFN 3;  1HFG A;  1SE3 A;  3KK7 A;  5FO8 B;  2F3V A;  1FYC A;  1EIH A;  1IKL A;  5FOB B;  3AU7 A;  5IGC A;  4F7X A;  1Q12 A;  4RH6 A;  3HP3 A;  3NPP A;  1PRT C;  2MHV A;  4OO1 H;  2KOL A;  2RDF A;  1KDC A;  4E6I A;  4QMG A;  4R8I A;  3K5N A;  4CKB A;  4K2L A;  3HS0 C;  3OIQ A;  5CYU A;  1HCZ A;  3J7A V;  5EJW A;  1D1I A;  1LO5 D;  1GHK A;  5I2X A;  4DK1 A;  3D8G A;  2B39 A;  2IW3 A;  4P2C B;  4LJZ C;  2C5C A;  4DNR B;  3NSW A;  1H9R A;  4ZUI A;  5HUR A;  4BY1 B;  5A35 A;  4X3T A;  2F3W A;  2EY2 A;  1X3P A;  2EJF C;  4H7B A;  4MHE A;  2QEJ C;  1KDA A;  4KN7 C;  3A8I E;  3S17 B;  3HOW B;  4K2K A;  2BE5 C;  4FF1 A;  4F88 A;  3HOV B;  2RVL A;  2K5W A;  2IX1 A;  4EQP A;  1JC7 A;  3I4M B;  4RFB A;  2BE5 D;  2F0K A;  3GQB A;  5IOD A;  1UUP A;  1BCP C;  5C5L A;  4B9X A;  1B3A A;  3HKZ B;  3NBI A;  1VMC A;  3K7A B;  3OMG A;  1SMY D;  5M3F B;  4FP5 D;  3GP7 A;  1EY4 A;  4ILW A;  4C3I G;  4ZLT F;  3LX0 A;  3DMU A;  4XDX A;  4DN4 M;  1FNV A;  3D4R A;  2D5D A;  4KMU C;  3V2T A;  5CMD A;  1LT3 D;  1Y1W B;  1NUC A;  1QNK A;  1YNN D;  1Q8I A;  2OF1 A;  3MWY W;  2WII B;  3I8Z A;  1O7Z A;  5FKA C;  1Q1E A;  2CW0 C;  1D1K A;  3VYR A;  4S3S A;  3DWQ A;  1YNJ D;  3FVQ A;  2A6E C;  5JPM C;  3R3O A;  3C3L A;  1RF2 D;  2D2C C;  4UAI A;  4J6H A;  1VF7 A;  1QE6 A;  2A5H A;  1FR3 A;  5ELB A;  4DFA A;  1NAP A;  4KY5 A;  3TP8 A;  4ZK9 B;  3Q6S A;  5HGT A;  4JK1 C;  2OXP A;  3PV0 A;  3SK8 A;  1V1P B;  5KNC A;  1DM0 B;  3SK5 A;  1SBB B;  2F0O A;  1RTO A;  5FK9 C;  5FO9 B;  2XSC A;  3GTO B;  1V43 A;  2JYO A;  1A3T A;  3I4L A;  5C0X H;  1EEF D;  3SDZ A;  2LFN A;  1ESF A;  3HOZ B;  4R8N A;  3GTM B;  1EYD A;  2H4O A;  4IAL A;  2B2V C;  4X3S A;  2RQX A;  2NVQ B;  2NWG A;  4LK1 C;  4A3B B;  2K5Q A;  3RZD B;  1JOQ A;  2O4X A;  1B44 D;  4CGY B;  1IKM A;  1MI2 A;  1Y8O B;  2PCF B;  2XWB B;  5K5P A;  1SJH D;  2FMC A;  4O1N A;  2F03 A;  5IGF A;  2IT1 A;  3D4W A;  2ZXO A;  4A3J B;  1GUW A;  3T16 A;  4CBV A;  3HG9 A;  1SNQ A;  2LY7 A;  1AEX A;  1XWE A;  1E0B A;  4R9W A;  1AN8 A;  1MD2 D;  2EVB A;  3I70 A;  1Q3L A;  4I65 A;  3U9O A;  5LL6 S;  1B1Z A;  3ERO A;  1W6K A;  2FMM A;  2KED A;  5BN3 A;  3MXG A;  3HOY B;  3R2T A;  3KLS A;  3NE5 B;  2XNA C;  3I3C A;  1ML0 D;  5I9O A;  4HTH A;  3MEH A;  4A3G B;  3NHH A;  4KKT A;  3DM1 A;  1EIG A;  1C8C A;  3GTJ B;  1TY2 A;  2X69 A;  1V8Q A;  1ET6 A;  3TN2 A;  3DWA A;  4DAV A;  2G9H D;  3OOC A;  4C56 C;  4XQJ A;  3R8B A;  5IT9 L;  4J8Q A;  3DHQ A;  4TQU S;  4OO1 I;  4FXG C;  1LAC A;  2MPM A;  5I6Y A;  1SND A;  3FDT A;  4HAE A;  2MJ8 A;  2OEO A;  3TP5 A;  5KYL A;  2XIW A;  3W2D A;  1KAB A;  3LNN A;  3FMC A;  4L63 B;  1PZJ D;  2E76 C;  2L0C A;  3PO2 B;  4A3D B;  3I90 A;  2PW7 A;  1B4O A;  1WTR A;  1AW7 A;  4RKL A;  2A6H C;  4AYB B;  2HDM A;  1CHP D;  2LMC B;  1TKW B;  3F2U A;  1SNC A;  5C4H A;  1YNN C;  5JVG 3;  5DM6 3;  1DXM A;  1GUO A;  1EQT A;  4FXK C;  3T56 B;  2JA8 B;  4G7Z C;  1ZEQ X;  3K5M A;  4BA1 I;  1SYC A;  5EBD A;  4WOR A;  3OMC A;  3HZX A;  2O5I C;  2VXW A;  1KDB A;  3TP6 A;  5C3X A;  4NMZ A;  2IL8 A;  3EJI A;  5KRU A;  2LKV A;  1OXS C;  3K57 A;  4QB4 A;  1E2W A;  1PTO C;  4DGZ A;  1F2L A;  1QG7 A;  1LAB A;  3SHL A;  1I4G A;  1HQM C;  2KCN A;  3BDO A;  4DAY A;  3PUZ A;  3SK6 A;  4ZUJ A;  1TVX A;  4HR7 B;  2RSO A;  3KF8 A;  2ICI A;  3PUW A;  2ID0 A;  1K8O A;  5G3L F;  2RDG A;  4XXE A;  3A7A B;  5D3I B;  1D5X C;  1HA5 A;  3NQT A;  1EY9 A;  5JEA J;  5C3W A;  1OXX K;  3GD7 A;  3NTH A;  1G29 1;  1L0X B;  4PQX A;  1NR2 A;  1LLR D;  1DOL A;  3MC0 B;  5CR3 A;  4NKL A;  1A3U A;  3MXP A;  3CRK C;  3PUY A;  1PTO D;  3GV6 A;  1PZI D;  1BF4 A;  4TRD A;  3G7L A;  3S1M B;  2EYP A;  3M7G A;  1YNJ C;  5IGG A;  3D31 A;  3S1N B;  2XRQ D;  3C2P A;  2R6G A;  1LT6 D;  2D62 A;  3J80 E;  3Q24 A;  3VR6 A;  3BS1 A;  1VDZ A;  4HMJ A;  2EJG C;  4X3K A;  5C0X J;  5CV9 A;  4QUF A;  1EZ8 A;  2QDB A;  1WTX A;  3SXH A;  2B2T C;  2F1M A;  4Q0F A;  4PV1 C;  2R3Z A;  4A93 B;  4ZQ3 A;  4K6D A;  3VYT A;  1CK1 A;  1F9Q A;  2RBM A;  5ELE A;  1DCZ A;  1K8M A;  2YYZ A;  4XT3 B;  1H9J A;  2F0M A;  5DEH A;  1OO9 B;  1Y1V B;  5IGB A;  3V96 A;  1BCP D;  2EYM A;  4OIJ A;  1EOT A;  1S5F D;  1Z47 A;  2JEA I;  3EFX D;  5EKI A;  4M8A A;  3QOJ A;  5CV6 A;  2EYL A;  2B8G A;  1Q90 A;  2B2Y C;  1D6E C;  1ZYR D;  1STG A;  4C1N I;  1WTW A;  2F0D A;  1F2Y A;  1X32 A;  2K05 A;  4PMC A;  4K5V A;  3NWT A;  2PW5 A;  4RCO A;  3M7N A;  2JA7 B;  4C3J B;  2QCP X;  4FYD A;  2EY6 A;  1WCM B;  2JXM B;  1SYG A;  3BG3 A;  1RTN A;  3VYU A;  1U4M A;  2HDL A;  2IWH A;  1LTS D;  2X6L A;  1EY8 A;  5G3L D;  5LL6 X;  1HFN A;  1PFN A;  4IQZ A;  2IJ0 A;  4ZYS A;  1A3V A;  3L3O C;  3OHX C;  1KLG D;  5EKL A;  1EWC A;  1EL0 A;  1ZKO A;  3FEW X;  2HCI A;  2L12 A;  1DZ1 A;  5IOC A;  1O7Y A;  4XQQ A;  3HRZ C;  1CQV A;  4IFD G;  1H9K A;  4FO2 A;  1IW7 D;  4H0L C;  2PNR C;  2O2L D;  5CV8 A;  2NBF A;  3JAM E;  2AUJ D;  4K8J A;  1CI3 M;  3MA2 B;  2SOB A;  1H9M A;  3OIP A;  2K7V A;  2AUK A;  2EZV A;  3MFG A;  3IAY A;  1SFO B;  3I4N B;  1SJE D;  1H9S B;  2Q8T A;  4RKB A;  4CKE A;  2QKI C;  3BDC A;  1A2T A;  1JWU D;  4JBW A;  3EA6 A;  3MTS A;  2ZXP A;  3HEJ A;  4FNF A;  1R4P B;  4IUR A;  1M4V A;  2RDH A;  1L0Y B;  2F0W A;  2JP1 A;  4IN3 A;  4DA2 A;  2EYJ A;  2K33 A;  1AP0 A;  1JOO A;  2JSO A;  3NBH A;  3NP8 A;  1O80 A;  1B53 A;  2BDN A;  3CRL C;  5C4Z A;  1FGB D;  3WDN A;  2F0F A;  1F9P A;  2K32 A;  3K5L A;  5T1G A;  3U9S A;  4L8J A;  1F2M A;  5BN5 A;  5KYI A;  1A6X A;  1ICW A;  1A2U A;  3T13 A;  4RAU C;  3QIA A;  5E4W C;  1F77 A;  2NN6 I;  2PPB C;  4ZKC B;  1W6J A;  3ITP A;  4ODG A;  1TU2 B;  2KUM A;  3BZD B;  1BQQ T;  2ZT9 C;  2NZ1 D;  4IFD I;  5I6W A;  2XRS D;  2D9U A;  3L9A X;  2F0E A;  5IGD A;  1WTV A;  3RD4 A;  1BCP B;  2H1E A;  3H0G B;  5I4D A;  3MHB A;  5JOB A;  1IYU A;  1RJT A;  2K03 A;  4PMB A;  3SR1 A;  2HCC A;  5J39 A;  3RZO B;  4KD4 A;  1KLU D;  4IUQ A;  2HUG A;  1QWY A;  5ISR A;  2A6H D;  3QJY A;  3J81 E;  2Q8I B;  4I7Z C;  3QO2 A;  3RUZ A;  2HQE A;  4WJW A;  2F0I A;  1BNZ A;  4HMI A;  2FHT A;  1S5C D;  1DOM A;  1SYD A;  3FRP B;  1JWS D;  4MIU A;  2SNS A;  4OIK A;  2K1B A;  4OGQ C;  2K5D A;  5KNB A;  1I4X A;  1STH A;  2L9H A;  1GXD C;  2QIL A;  1A15 A;  5JAV A;  4KTA A;  1PFM A;  4DF7 A;  1PYW D;  4BWG B;  2L5T A;  1GUG A;  3IKJ A;  2K28 A;  1LT5 D;  5E4X A;  1O7L A;  4F8M A;  2TSS A;  1CZW A;  2PMZ B;  3LWE A;  1VMP A;  1I3Q B;  2I46 A;  4H44 C;  5AFW A;  1F2Z A;  1DON A;  2DN8 A;  2DNE A;  3GTG B;  4KN4 C;  1JR0 D;  4KHV A;  1AZQ A;  3A55 A;  4DXF A;  3CHB D;  3A8K E;  4KD3 A;  1G2S A;  3NUC A;  3X3M A;  3PMF A;  5KEE A;  1OXU A;  3GTK B;  1J9O A;  2NN6 H;  5FLX E;  1ILP A;  3EVQ A;  3C1E A;  2PZU A;  2F0N A;  2WAQ B;  5BN4 A;  3SEB A;  5EGT A;  4XT1 B;  2EYH A;  1DYQ A;  3J7A F;  1V1O A;  1SNP A;  2A6E D;  2Z4H A;  3E0J A;  2B2V A;  5D3D A;  3A8J E;  1D5Z C;  1WD1 A;  1STY A;  3S16 B;  1OXT A;  1JOK A;  1QJO A;  2R61 A;  1SYF A;  1RCV D;  1TS3 A;  4NW2 A;  5I9P A;  1SE4 A;  5COY A;  3I72 A;  1ONL A;  3ERQ A;  1JOR A;  3J7Y W;  2RSN A;  2EYO A;  3C46 A;  1EWH A;  1U4L A;  4RA8 A;  1U4P A;  4G4K A;  3J81 L;  5A2Q E;  3PO3 B;  1E2V A;  3FPP A;  4RGN A;  2SNM A;  3H6M A;  2IX3 A;  3G6J B;  2LS0 1;  3K5O A;  2VUM B;  2NB0 A;  3M85 A;  1PDQ A;  1FNU A;  4C3J G;  2CW0 D;  3P1H A;  1HUN A;  3Q0A A;  1J8I A;  1IW7 C;  1ENF A;  2J7Z A;  1B50 A;  2JE6 I;  1EFI D;  1S4Z A;  5ELC A;  5A2Q L;  1SSO A;  3N6R A;  1BOS A;  2B2U A;  1Q1B A;  1TS5 A;  4HSP A;  2E2H B;  3JAM L;  1BDO A;  3QG1 A;  2PQE A;  1STE A;  2EYF A;  3NTI A;  1HTL D;  3UI2 A;  1Z7T A;  3ZYY X;  4IUT A;  1PRT B;  3L7Z C;  1C4Q A;  4FF4 A;  4F87 A;  4O42 A;  1QCB D;  1JQY D;  4KKU A;  3BVM A;  1KNA A;  1PXU A;  3S2D B;  2PO4 A;  2WV6 D;  1JCK B;  2BDO A;  5CGK A;  2B2U C;  2YU9 B;  2F0V A;  2B2Y A;  1M8A A;  4ZAI A;  3MAQ A;  1XTC D;  3M4O B;  3TBI B;  3I73 A;  1LTA D;  4V19 0;  1LT4 D;  2NN6 G;  2V4D A;  2FJ2 A;  5E3F A;  4C3I B;  3VR5 A;  4RHR A;  4KV6 A;  1ET9 A;  2FIN B;  4DU9 A;  3M3Y B;  1R4Q B;  3E5S A;  4Z9C B;  1UAP A;  5C3E B;  1B9N A;  4A3K B;  4HN7 A;  5M5W B;  5EPJ A;  1I4R A;  2A74 C;  4K5W A;  5EKK A;  4V0B A;  1D2B A;  1GUN A;  1BCP F;  3MXU A;  1TY0 A;  4A3F B;  2PZT A;  1I4H A;  1WD0 A;  4BS9 A;  1Z6H A;  2J4X A;  3M4Y A;  1HPC A;  1CQF A;  2TMP A;  1Y69 U;  3T4A C;  4H13 C;  3VA7 A;  5D65 A;  1RD9 D;  4NP5 A;  3BVG A;  3S1Q B;  5E1F A;  4G7O C;  5CBA E;  1SYE A;  1WTQ A;  2DNC A;  1QB5 D;  3K59 A;  1DOK A;  3TP7 A;  4CJ1 B;  4HSV A;  4BY7 B;  2WP8 J;  2KQ3 A;  3AB9 A;  1G91 A;  3CU7 A;  4CHT B;  5I2Y A;  1T5X D;  4C3H G;  1TWF B;  4ZRZ A;  1I6V C;  3V05 A;  1IL8 A;  4K5X A;  4FXD A;  1SE2 A;  1NSN S;  2EY1 A;  3W3A A;  2R7Z B;  3GTL B;  1LTI D;  1GHJ A;  2SDF A;  1CFM A;  3VYS A;  3CQZ B;  3S9W A;  3DWP A;  3BYY B;  2QF7 A;  2C9O A;  3N52 A;  4EQO A;  4HED A;  4DK0 A;  4IUV A;  1UNS A;  3KBX A;  1XX8 A;  4A3E B;  3IFT A;  4ULL A;  1QIL A;  1EYA A;  4QCL A;  4G57 A;  2B2T A;  5FLX L;  3A7L A;  2MUY A;  3DEO A;  3TDQ A;  1CM9 A;  4XQN A;  4K6L A;  3T51 B;  2Q8R E;  2F0Q A;  3S1R B;  2A69 D;  1PTO B;  5EPL A;  1NR4 A;  2F0S A;  4U68 A;  4KI0 A;  2F0T A;  2FFK B;  5EQ0 A;  2NUC A;  2NVY B;  1JE4 A;  3DEP A;  5COR A;  3H3V C;  4OHJ A;  4FF2 A;  5M5Y B;  1G6Z A;  1WVL A;  3MVV A;  3IFD A;  1II3 A;  1STB A;  2WAC A;  3AMU A;  3O13 A;  4RGT A;  1PTO H;  1SNM A;  1QOH A;  4Q5V A;  5DM7 3;  3BDL A;  3VA5 A;  1TS2 A;  5D14 A;  2BA1 A;  5LHY 1;  3MZ5 A;  4B08 A;  5NUC A;  2BA0 A;  3Q23 A;  2RKS A;  1T5E A;  1B9M A;  1EY7 A;  2NVT B;  4IZ8 A;  3WOE A;  1EY6 A;  2F0L A;  1VCI A;  2A69 C;  1LV9 A;  3I91 A;  1I4Q A;  1PTO F;  4J1M A;  5JVH 3;  1PLF A;  1PFB A;  1EU3 A;  5KIX A;  1LTT D;  1SXT A;  2VB2 X;  2A68 C;  5ELD A;  3PUV A;  2JEB I;  4K14 A;  3MFY A;  5ELF A;  1GUS A;  2KVM A;  2JA5 B;  3FKI B;  1PZK D;  1MGS A;  5J22 A;  1K83 B;  1ROD A;  3TME A;  1SMY C;  4EVO A;  3H94 A;  4FF3 A;  4UDU C;  2K04 A;  4MN3 A;  4KY7 A;  4BBS B;  2NYZ D;  3QOL A;  4BA2 I;  1FD7 D;  2E74 C;  2JA6 B;  1DD2 A;  3NWS A;  2E2I B;  2CHB D;  4FVM A;  5IGE A;  2WKC A;  3VR2 A;  1F9R A;  1LTR D;  3OW7 A;  3D3R A;  1KNE A;  4QIW B;  2Z4I A;  1D5M C;  1CA5 A;  1NCV A;  2Y0S B;  3P75 A;  2F0H A;  3EQL C;  4PMW A;  2E2D C;  3KLS X;  2AQ3 B;  2B8F A;  1S5E D;  2EOT A;  1MSH A;  2MP1 A;  1HQR D;  2WKD A;  2K01 A;  4KHZ A;  1CA6 A;  1F9S A;  2BCO A;  1CTM A;  1BO0 A;  1CHQ D;  2F0G A;  1OXV A;  4IUN A;  1SNO A;  3SK4 A;  5EPK A;  3OWE B;  2M9V A;  4HCE A;  1U9R A;  1AZP A;  1HTP A;  3K58 A;  4ABN A;  2EDG A;  3URY A;  1STN A;  4LAA A;  3D4D A;  2DY8 A;  1CZG A;  4GZY C;  1EU4 A;  4C2M B;  1PRT F;  1LTB D;  5JEA G;  3D6W A;  3KLR A;  4XYO A;  3LWU A;  1JWM D;  4KJO A;  5M9O A;  2O5J C;  5CC4 A;  4DAP A;  5CV4 A;  3NQI A;  4RHS A;  2PZW A;  5F2D A;  1UEA B;  5KND A;  2EE1 A;  1I4P A;  2ENB A;  1B2T A;  1KTK A;  3HGB A;  4X3U A;  5CV5 A;  3QWN A;  3PIP 3;  3X3N A;  4RGM A;  3ND9 A;  1EZ6 A;  2GA4 B;  3NTK A;  5JEA H;  3A54 A;  1ENA A;  3A56 A;  4XTC S;  5IIF A;  3J80 L;  2B2W C;  4N9P A;  2L55 A;  1BXT A;  2ZXR A;  4RGO S;  4Y7N B;  4KJN A;  1WTP A;  1WTO A;  1MBY A;  4C3H B;  5C4J B;  1EEI D;  3S15 B;  5TSS A;  5K36 H;  1Y8N B;  5DNF A;  4OO1 G;  4NDX A;  3R2I A;  2KEE A;  2VB3 X;  2AQ1 B;  5C5M A;  1TWC B;  1BUV T;  4PNY A;  5DAU A;  5JJZ A;  4U67 3;  4IUP A;  2AWN A;  4A3M B;  3TZD A;  4DXG A;  2ICE C;  3HOU B;  5T1I A;  4M1U B;  3VR4 A;  2L4N A;  3GTQ B;  4LMQ D;  1TR5 A;  1U4R A;  3GTP B;  3PIO 3;  2F0J A;  1G8Z D;  1AFP A;  3WOF A;  1FNW A;  2KHS A;  1MSG A;  2VNU D;  5J1Z A;  3P20 A;  1ENC A;  4ME5 A;  4XYQ A;  1SEB D;  2M2L A;  3S14 B;  1I6H B;  4QUC A;  4XIG S;  3SE0 A;  1S5D D;  1HXY D;  2I07 B;  3DXJ C;  3CKI B;  3NK9 A;  4IFD H;  3RLF A;  1IHZ A;  2R93 B;  1TQO A;  1ZYR C;  1ILQ A;  3OPO A;  5C4X B;  1EY5 A;  3GO5 A;  1HHV A;  1PRT D;  3Q22 A;  1C48 A;  1KAA A;  4CKC A;  2AWO A;  1JB3 A;  3K0Y A;  4IFD J;  1RDP D;  2XVS A;  2OT2 A;  3MXN A;  2F0P A;  1QNU A;  2K6A A;  1BR9 A;  2NTT A;  5KGU A;  2A68 D;  1HA6 A;  2EPB A;  2F0U A;  2XN9 C;  4EGV A;  3RMH A;  5M5X B;  2SEB D;  4K8I A;  3TSS A;  5JPN C;  3E6Z X;  3BYT B;  1XYI A;  3SVM A;  4KKS A;  3C1F A;  2KEC A;  4C1N K;  1H9S A;  1S5B D;  1TT2 A;  3D6C A;  3S2H B;  1TWA B;  1X3Q A;  2A73 B;  1V1P A;  1HUM A;  2M00 A;  3H91 A;  5C6A A;  1SDF A;  2IPK D;  3ONA B;  3TZU A;  4CJ0 B;  2NTS A;  1Y8P B;  1TWH B;  2MGS A;  1VF5 C;  1TS4 A;  2G9D A;  2Z8L A;  1GOZ A;  2KJX A;  1EYC A;  4QF4 A;  1E2Z A;  2KA7 A;  2KCC A;  2PYK A;  1HRJ A;  3OWF A;  1R9T B;  3ND8 A;  3QB3 A;  5K36 G;  2EXZ A;  4L6T B;  2N88 A;  4KY6 A;  2NVX B;  1RKN A;  4B9W A;  3DUZ A;  4G7H C;  1TWG B;  1RHP A;  5C0X I;  4TSS A;  1SYB A;  2AQ2 B;  2EJM A;  2IX0 A;  2B2W A;  1O78 A;  3KBG A;  1I50 B;  3R93 A;  2X6G A;  3T53 B;  1DJR D;  3PUX A;  4ZKB B;  4WRD A;  1STA A;  4OL7 A;  2CVR A;  2XWJ B;  2E75 C;  2F4I A;  1ESR A;  4CJ2 C;  3BVZ A;  1JIC A;  1ZXT A;  2J0T D;  1IYV A;  1PMR A;  1GJX A;  3VR3 A;  3K6O A;  1LTG D;  4N9T A;  2DY7 A;  2WB1 B;  1XXG A;  3NXW A;  5C0X G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...