3D4WA

Crystal structure of staphylococcal nuclease variant delta+phs a109r at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLRKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4wA00
4PMBA 5DEHA 3SK5A 1SYBA 3SK6A 5JAVA 4HTHA 5C6AA 3LX0A 4K2LA 3NQTA 4NMZA 3OWFA 5CV9A 4PMCA 5IGGA 4IALA 4KTAA 2F0QA 4F7XA 5C4HA 3ITPA 4ME5A 5I6YA 1EY6A 3MHBA 4ID6A 1JOQA 1STGA 1SNOA 2OXPA 3OMGA 4EQPA 4J6HA 4TRDA 1RKNA 1SYEA 3C1EA 5C5MA 3C1FA 2F0TA 3P1HA 1SYDA 3EJIA 1EQVA 1F2YA 1KDCA 3DMUA 4N9PA 2HQEA 4K2KA 4HMIA 1EYAA 2F0KA 2F0GA 5C3WA 1STAA 4DU9A 3BDLA 1STHA 1A3VA 3OSOA 3T16A 5J22A 3MXPA 5M9OA 2F0NA 3TP5A 4EQNA 1TQOA 5HGTA 3H6MA 4K5WA 2SNSA 4KY6A 5EGTA 5C5LA 2F0SA 3VA5A 2F0FA 1A2UA 5ISRA 2WACA 3NP8A 4G57A 2F3WA 5CR3A 4DGZA 5J39A 1KABA 1ENCA 2KQ3A 5EKLA 3P75A 3TP7A 2F0WA 1A3UA 4WORA 2PZWA 5CC4A 5CV4A 3NUCA 1JOOA 3RUZA 3SR1A 5CV8A 1EZ6A 1STNA 3TP6A 5F2DA 1SYGA 4DFAA 1TR5A 1SNPA 2EY1A 2EYLA 5C4ZA 2EYFA 2F0VA 2EYHA 4MIUA 2EYPA 4E6IA 4K8IA 2PYKA 2F0MA 2QDBA 3NXWA 4IUNA 1STYA 2ENBA 4NKLA 1EY7A 3TP8A 3MVVA 3NK9A 4YIJA 5E3FA 5IGCA 2F0EA 3TMEA 2F0JA 3QOLA 5NUCA 4H7BA 4KHVA 4DF7A 5KIXA 4N9TA 4OL7A 4HMJA 4QF4A 5J1ZA 4IZ8A 3EROA 5I9OA 4NP5A 5K5PA 5IGEA 2PQEA 2SNMA 3D4DA 3EVQA 5E1FA 4NDXA 3SXHA 3SK8A 4K8JA 3R3OA 3OMCA 3MZ5A 1KAAA 4ZUIA 3V2TA 5C3XA 3D6CA 5IIFA 3MEHA 2F0IA 4KV6A 2PZUA 3SK4A 4KJNA 1EY0A 4K14A 4EVOA 1SYFA 4WRDA 3T13A 3HEJA 2F0OA 2EYMA 2KHSA 5IGFA 5IOCA 5CV7A 5KRUA 4RKBA 1A2TA 1EY8A 4PNYA 2M00A 1F2ZA 2EY2A 3ERQA 3PMFA 1SYCA 4KY7A 1U9RA 2EYOA 5KYLA 3QB3A 5KYIA 1KDBA 2EY6A 5CGKA 1KDAA 5I9PA 2F0LA 1JOKA 5IGBA 5IODA 1EY4A 1F2MA 3U9OA 2OF1A 3SHLA 3D4WA 4ZUJA 4B9WA 5HURA 1JORA 1IHZA 1EYDA 4K6DA 4KJOA 1STBA 2SOBA 1SNQA 4KD4A 2F0UA 4B9XA 3E5SA 3BDCA 4ODGA 2F3VA 3HZXA 5CV5A 4J1MA 2PW5A 4KY5A 1EZ8A 3DHQA 5EKKA 2LKVA 3S9WA 1SNMA 4K5VA 4LAAA 5KEEA 4KD3A 4R8NA 2OEOA 3D8GA 1EY5A 2RBMA 5JOBA 2F0HA 1NUCA 2F0DA 2EXZA 2EYJA 1NSNS 3QOJA 1SNDA 4I65A 5CV6A 4S3SA 5KGUA 1II3A 1EY9A 1TT2A 2O4XA 1EYCA 2RDFA 2NUCA 5I6WA 4EQOA 1SNCA 5DAUA 2F0PA 1ENAA 2PZTA 1AEXA 2PW7A 4F8MA 4QB4A 4RKLA 1A3TA 4QMGA 2EY5A 2RKSA 4ZQ3A 4K5XA 3NHHA 5IGDA
chains in the Genus database with same CATH superfamily
1AH9A 1I6VC 1SMXA 3SK5A 1JE5A 1EUJA 3DWQA 4LFAQ 4C1NI 1FJGQ 4PMCA 2CKZB 1TS4A 3Q22A 1HUNA 2K5HA 1LT6D 3D6WA 4EX5A 5D65A 3R8BA 4C3HH 1PV4A 1BBXC 4DXFA 5C3WA 1L1OA 4DR5L 2HUGA 3MXPA 1TQOA 2B8FA 4H02A 4C3JH 1VQBA 1N33L 3JAMi 4DGZA 3WOFA 1WTWA 5C4XG 1VQNA 1L2FA 4LFBQ 1E2WA 2KCMA 1B3QA 4IPCA 1CTMA 2RF4A 2RDGA 4X3UA 3QR8A 5C4XB 5C4ZA 3S2DB 3HRZC 4OGQC 4JI7L 4X6AH 2B8GA 2LXJA 2XRQD 2NVXH 1NNXA 2QA4A 2NN6G 2CFMA 3SK8A 2BH2A 3M7GA 4C56C 2QW7A 3D6CA 3D31A 2Z0SA 3OWEB 1OXXK 3NBHA 3GTOB 1Q81C 1QVFA 2M00A 1V1PA 1IZ6A 4JI2Q 2XVSA 1KAWA 2VUMG 4DR1L 3S1QB 1KDAA 1E0BA 2AUKA 3UDIA 2AKWB 1G2SA 1VF5C 4DR2Q 4DK1A 2DY8A 2VUMB 4MTKA 2ATWA 1N36Q 3E5SA 3CQZH 2CQAA 4NXNQ 1PYSB 2KCNA 1C0AA 4RGOS 4B3ML 1EQRA 3D8GA 3G7LA 1GHJA 5CV6A 3RZDB 1LLRD 2LMCB 4JOIA 3J81j 4DXGA 1O80A 3S17B 5IT9c 4OEMB 1Z6HA 5C6AA 2HIVA 2E2IB 4K0KL 2K7VA 2EJGC 5IGGA 4ME5A 5LMNL 4JCVE 2OXPA 4X3KA 5J3BA 1S4ZA 4FF4A 1X32A 1SYDA 3EJIA 3T1HL 3DMUA 4CJ1B 5IYBG 4DAMA 5J22A 4ZLTF 3DEOA 1XPRA 1JC7A 3CCQA 1RIPA 3NP8A 1PTOH 3UE0A 2ASBA 3OHXC 2NYZD 3PCOB 5J39A 3M7NA 1GM5A 3J80E 3MXUA 2JA6H 2UXDL 1TR5A 2G9HD 1P16A 4IOCA 4JI3Q 3S1RB 1NMGA 2QDLA 2F0EA 2FJ2A 5G3LF 1PH8A 5NUCA 4Y7NB 1HH2P 1YNND 1U4MA 1CQFA 4IOAA 4DAYB 4N8X1 1PTOF 4QGUA 4ULLA 2WB1E 1N34L 1X54A 2XWBB 4K6LA 4EVOA 1YBYA 2F1MA 2OTLA 3ERQA 4ZKBB 1X55A 4A3IH 1QWYA 2PO4A 4LF4Q 3M4OB 3PIOA 4A4IA 4YCWA 5IGBA 2VW9A 3J81L 1KXLA 5C0XH 1IHZA 4A3JH 1WTRA 4BY7G 4KHPL 3J81E 4X3TA 2CH4W 1E2VA 2B39A 1PH3A 2ZXRA 3GQBA 1RD9D 4JI4L 1IBLQ 4BY7B 4MZ9A 5IP7G 5JEAG 1EU3A 3OW2A 1FGBD 1BO0A 4AYBG 4DNIA 1CT1D 4R1JA 2ALYB 2RDFA 5JJZA 1S5CD 4JVZA 1IBKL 2F0PA 2E75C 3AEVA 1VQEA 4AYBB 1U4PA 2N78A 1Z7TA 4H0LC 2OCEA 4OX9L 2XNAC 3G71A 1AN8A 1O7ZA 3S2HH 3I3CA 4CKEA 1M90C 5I2XA 2R7FA 1YVCA 2J7ZA 5C4JH 1CSPA 4F7XA 4L5SA 1H9RA 1CHQD 2I5MX 1SXTA 5C5MA 4JI8L 2F0TA 3E6ZX 4N8FA 4RHSA 3VR6A 2I0QA 2RCFA 4P75A 4RCNA 2UUCQ 3PF4A 2F0KA 2F0GA 3H09A 5ELFA 4L6TB 3C46A 2F52A 3T16A 1BCPB 2K28A 1CM9A 3A5UA 4IJLA 4HAEA 1SFOB 2LY7A 2QGQA 3BU2A 1A2UA 4B08A 1XNQL 1JR0D 4HR7B 3F1ZA 3R93A 3S14H 1N32Q 2NVTH 1X3PA 4XYOA 1Q1EA 2F03A 5C3EG 1HR0L 5D14A 2IWHA 1EZ6A 4V0BA 2A6HC 2EYHA 3ERSX 1E1OA 3OTOQ 3R2TA 1TWFH 4X65L 3A74A 4DUYQ 1GUGA 2NTTA 4DAYA 4ME3A 4H13C 3I91A 2NB0A 3D4DA 4HJ9A 3IAYA 1B2TA 2IW3A 1VMCA 3R3OA 2YU9B 1OO9B 3TQYA 3OW7A 5EBDA 1IL2A 4GOPC 2Z4IA 3TBIB 2IJ0A 5LL6S 4KJNA 4JI0Q 3T13A 3MFGA 3K6OA 3M4QA 3KLSA 4LUVA 2A68D 1ML0D 3NEMA 3T56B 5IWAQ 1BCPF 4GLVB 2Z4HA 1HNXQ 3RMHA 3GD7A 1VQ6A 5IYDH 3SEBA 4A3DG 2ZT9C 4GLAC 5FLMH 4OWWB 2E2DC 1CFMA 4JI5Q 2NTSA 4L63B 2R7ZH 1EYDA 4K6DA 5T1GA 4A3DB 2LXKA 1YZ6A 1TWHB 1W3SA 2FHTA 4DV1Q 1VQ9A 2ICIA 2PNHA 1HZBA 3VR2A 2EOTA 3M85A 2RBMA 3QOJA 4LF7L 1R9TB 3GTJB 1XNRQ 3CPWA 4M1UB 2B2TA 1KRSA 1QVCA 2AHOB 4X62Q 5FJ8G 4OXPA 2PZTA 4C2MH 2HHHQ 3J7AF 1S40A 4DV6Q 1TS2A 4IFDH 2EY5A 1UWVA 1VQAA 5IGDA 4A3EG 2GA4B 2UXBQ 4BXXH 4K2LA 1FNUA 4CJ0B 1C7YA 1B70B 4KTAA 4PV1C 3ITPA 4A3EB 4LF9Q 1CZGA 4C3IG 2NVQH 4ID6A 3GTMB 2JA9A 1W6JA 1Y14B 4JYAQ 1VQIA 1CKNB 1WTPA 4C3IB 5I4DA 2JA8H 4LF5Q 2X6GA 4DV2L 3JAMc 4DR7L 2F4VL 4QIWB 2SNSA 3BDOA 3HG9A 2R92H 1LTSD 3MFYA 4ZKCB 1KABA 3OIPA 1AP0A 1CUKA 1ENCA 1B9MA 1EFID 2BE5C 1A3UA 3V96A 4OWTB 5CV4A 3E9IA 2WKDA 3TEHB 5F2DA 2NVYB 2FFKB 2EYFA 2UU9L 1SE4A 1H9SB 4KK7A 4HJ7A 4QY7A 1H9MA 3CC4A 1RL2A 2EJFC 4IPHA 4FXKC 2JE6I 3CAMA 3WDNA 2HDMA 2B2UC 4A76A 2D5DA 3CP0A 5M5WB 4IZ8A 2JK8A 1SE8A 5IGEA 4GLXA 2QILA 1RJTA 4NDXA 4B3SL 3S15H 1HZ9A 5IIFA 4A3CH 1CKOA 2BA1A 2E2JB 3QJYA 4KV6A 3CXCA 2B2WC 2N55A 3RLOA 5IOCA 4LF6L 5T1IA 2KHSA 5ELNA 4DR4Q 3D3RA 1WCMG 3S16B 2XWJB 2H5XA 2Y0SE 4WJ4A 3HGBA 5ELDA 4DV4L 1WCMB 5GAHC 4KD4A 4B3TQ 1ILPA 3A54A 1UE5A 3N52A 5CV5A 1WTOA 4HIMA 1EZ8A 5FO7B 1V43A 2RSNA 4IPGA 4LAAA 1WD1A 4UY8C 1J8IA 1EQTA 4R8NA 1EYGA 3PO2H 3HOYH 5M5XB 1SJED 4O1NA 4S3SA 1II3A 3I4OA 3Q0AA 1VQ5A 2BDNA 3RLNA 3U4ZA 5DAUA 4DV7Q 4APVA 1YEZA 2CWPA 3A7LA 4JPBW 4ZUIA 1BDOA 1LTLA 1K73C 3CF5A 3NQTA 2E2HH 3A7AB 3K0XA 1WTHA 3RR5A 3BYYB 4BWGB 5C4HA 3GTQH 3NPPA 2QCPX 3W2DA 1V8QA 1BVSA 1TWAH 4BY1H 4V190 1CKNA 2A69C 2DJGC 1KHIA 1G91A 2D2CC 3GTKB 1HRJA 3V05A 1T5EA 4XYQA 1XMQL 1MJCA 2L11A 3FHWA 5C0XJ 1Y1VG 3AFPA 3SGIA 1PZID 3OPOA 2IL8A 1Q7YC 1EIYB 1Y1VB 3TRZA 1ONLA 1LABA 1DOLA 2Q8IB 3B6YA 1EEID 1YNJC 5K36G 4RGNA 1B7YB 2Q8RE 4P71A 4LFAL 1TWGH 2AUJD 3STBC 2ZJQA 2Q2UA 5IP9G 1QZHA 3TP8A 5FK9C 2ZM6Q 1I5FA 3TMEA 5BN4A 5M5YB 3F2BA 4HIKA 1X9NA 4XQQA 2JP1A 2DUDA 1LUZA 1DM0B 5I9OA 4F87A 3NTKA 3RD4A 3PO3H 3NSWA 4WJ3M 3A0JA 3ER0A 4X66L 5G3LD 2MP1A 1IL8A 2KECA 5IGFA 2QEJC 2YYZA 2VQFL 5IT9E 2EY2A 2K75A 2MO1A 3EQLC 3UE1A 5JVH3 1SMYD 2Z6KC 1PTOD 5C0XI 1F2MA 1JWUD 4NXMQ 1SAPA 2JSOA 3ULLA 1D6EC 3H0GH 1XX8A 2N8NA 4KLKA 4DAPA 4JI6Q 1N9WA 1QUQB 1VS0A 2NBFA 3HOUH 2HIXA 3DHQA 4YHHL 1NTGA 4CDCC 3S9WA 2WIIB 1GUNA 5EPKA 3PIP3 4RG1A 3NBHB 3FMCA 5I6WA 5LMUQ 1V1PB 3S1NH 3S24A 3IL8A 4LMQD 2ZJPA 1SE2A 4ZQ3A 3J7YW 1BUVT 3ZJYC 3CCSA 1PTOC 3Q8DA 1S5FD 3T1YQ 4HTHA 1W2BA 4NMZA 3CMEA 2IX3A 3NQIA 3TZDA 3IRBA 1SNOA 1BR9A 4R8IA 5M3FB 5CYUA 3PIO3 2HQEA 4HMIA 4DV5Q 5E4WC 1K8OA 1VQ7A 2WINB 4FF1A 2B2YA 2EPBA 2M9VA 3CPFA 4KY6A 2D9UA 2L5TA 4IUTA 4DR6Q 2E74C 1DJRD 2MUYA 3FPPA 3TN2A 4HSPA 2SEBD 5CBEE 1K83B 5CC4A 1QJOA 4IUUA 4NW2A 3VDYA 4LFCQ 2YTVA 3CRLC 3HOXG 4PQXA 2XGTA 5DLQE 4DFAA 2YTXA 2EYLA 2NWGA 2DGYA 3L9AX 3HFZB 1STYA 4IFDJ 3K5OA 3M3YB 5IGCA 3HOXB 1BNZA 3UI2A 2F0JA 3FPUB 3I72A 2K01A 4YY3Q 3MAQA 1TY2A 1PYBA 1DCZA 3W1GA 1DD2A 3MEHA 1K8GA 3A55A 4Z9CB 2RHQB 3CHBD 2F0OA 5KRUA 1VQ4A 1MSHA 1Q12A 1Z9FA 1HPCA 5HY6A 5BR8L 1IKMA 3L7ZC 1UUPA 4I7ZC 5COYA 5CGKA 5JVG3 1J5EQ 4R4TA 3CMAA 1FL0A 3KF8B 3BZCA 2X69A 1XWEA 1PHJA 1HNZL 1G8ZD 1X3QA 1PRTB 1QUQA 1K3BC 2B29A 3F2DA 1XPOA 4JI3L 2NVXB 1BCPD 1UNSA 1TU2B 4LF8Q 5C4XH 3S2DH 4FXGC 1G6PA 1HQMC 1Y8OB 3A8KE 1D5MC 3PSIA 4LUOA 2GVAA 1VCIA 3K5NA 2EXZA 4GNXC 1YI2A 5IE8A 3VA7A 3PUWA 4CDFC 3KF6A 3TREA 4IFDI 4F8MA 4AQYQ 3H94A 2K52A 3NHHA 4EQ5A 3GP7A 1YHQA 1Z47A 4PZ7A 2NN6H 4HN7A 4QCLA 1JWMD 3QG1A 4XQJA 1WYDA 3CQZB 2AMCB 3NTHA 3VYSA 1GUWA 3G4SA 2HD3A 4OO1G 1EQVA 4K2KA 2VUMH 1VQHA 1U4RA 3BVZA 1DXMA 5LL6X 1HQRD 1YHAA 1STHA 1PRTF 2JA7G 1VQOA 4C1NK 3TP5A 1TWCB 1HA5A 1ZYRD 2Z1CA 1HNWL 2C9OA 5EGTA 1NBWA 2RCNA 3GTPB 5FO9B 2WACA 2JA7B 4GZYC 1IBMQ 2KQ3A 4DV0Q 3RZDH 2L12A 1JMCA 5AFWA 3I4NG 2CVRA 2KEEA 2JEAI 3BG3A 2NZ1D 2O5JC 1SNPA 3S17H 1I4XA 3I4NB 3AU7A 1VDZA 1EY7A 2IHFA 1O7LA 2RVLA 2E2IH 3IFDA 3H91A 1VQPA 3J80L 3I8ZA 1FNWA 1EWIA 3SXHA 2I46A 4DR5Q 4A3FG 4K14A 1KQSA 2JA6G 3KLRA 1PH9A 4BA2I 2K14A 3CU7A 4UPAA 3GTGB 1N33Q 3HOVG 4UP9A 4A3FB 1N32L 5IYBH 1PH7A 3KF8A 2JA6B 1EEFD 2WAQG 2EY6A 3HOZG 1GVPA 4LNQA 1TIID 3SHLA 3HOVB 3LWUA 3CCRA 4B9WA 3DLLA 4A3KG 1VQFA 2OQ0A 3DEPA 2E5LL 2WAQB 5FKAC 3HOZB 5EKIA 3BDCA 1XJVA 4A3KB 2PI2A 3JAML 3SVMA 4KY5A 2KOLA 4JI7Q 3VR3A 4O42A 1LV9A 3S1RH 3JAME 1NUCA 2L1BA 5LHY1 4Y7NH 1Q86C 1EYCA 5GAEC 1VQCA 2JJQA 1ASZA 1ENAA 4CBVA 3W1BA 4B3RQ 4CDEC 3I56A 1ZKOA 2JA5G 4DR1Q 4KN4C 2TMPA 1YNNC 2JA5B 3M4OH 3FRPB 3QIAA 2B2VC 1LTRD 1IW7D 5JJLA 4GN3B 2K05A 3GV6A 1CKMA 3E3XA 1BKBA 4GKJL 1E2ZA 4DU9A 1VQDA 1RTOA 1ASYA 4B3MQ 3DXJC 1IYUA 5FLXL 1EIFA 4BY7H 4BBSG 4HEDA 1PYWD 2PMZB 4G57A 2F3WA 1WTVA 1VQGA 5FLXE 2GN5A 5A2QL 4DV6L 4P73A 1JCKB 4WORA 5IP7H 4BBSB 1LACA 5JEAH 5A2QE 4KN7C 2SDFA 3HKZE 3UDFA 4NKLA 4IUNA 1IW7C 1ET9A 2WV6D 4YIJA 5LMNQ 4LUZA 3J7AV 4UP8A 5E7NA 5KIXA 1GUOA 5CBAE 1PFMA 3HOWG 2HQLA 3CCEA 3OMCA 4L5QA 1L0WA 3J7ZC 3SK4A 2EYMA 3ND8A 4DV3Q 1WTXA 3HOWB 4HIDA 2K5VA 4FVMA 1BQQT 3S14B 1I3QB 1R4QB 1HFNA 4DUZL 5KYLA 3KBXA 1SFOH 1SSOA 3BZDB 1N8RC 1PZKD 1G2TA 2VB2X 3U9OA 3NBIA 3I2ZA 1H9JA 3FKIG 4L8JA 2UXDQ 3K7AB 4ODGA 4FXDA 2FMCA 4MNOA 2LS01 3FKIB 3TS2A 5C3EH 1JJ2A 4KD3A 1XYIA 2L9HA 4JV5L 2HCIA 4UDUC 4R9WA 5KGUA 1LTTD 3KYHC 3F8TA 2BA0A 2HCCA 3MEFA 2Z8LA 1PH6A 1R4PB 5EJWA 5FLMG 1A3TA 2EE1A 1I50B 3R2IA 2YU9H 3EFXD 4K5XA 4CJ2C 1UE6A 2A5HA 2BDOA 1PVOA 4OIKA 5DEHA 1KIXA 3LX0A 2QKIC 2DN8A 1EOTA 1KL9A 1YJNA 1QG7A 5D3IB 4HIOA 2VS1A 3C1FA 4IUPA 1AFPA 1HUMA 1MSGA 3H3VH 4KHPQ 1JWSD 3K5LA 4DPGA 4WFN3 4MN3A 3SE0A 4JI4Q 4J15A 3ND9A 2A68C 1T9HA 1X3GA 4A3DH 2G5DA 3RN5A 2UUBL 1SEBD 4HJ5A 1IYJB 1TWHH 1NE3A 3K0YA 2MFIA 3MC0B 2B63G 5ISRA 4ILWA 1S3OA 4QUFA 3I4LA 1IBKQ 3GTJH 2B63B 2VZAA 2AWOA 4F88A 4LW1A 3URYA 1NMFA 4OX9Q 1L1OC 2YV5A 2CHBD 4FP5D 3M4PA 3Q6SA 4MIUA 2EYPA 2F0MA 5FJ8H 2EQSA 2ENBA 3GTLB 4DN4M 3MVVA 1B50A 1SJHD 3AQQA 3SDZA 4XIGS 1LYLA 4ZRZA 1VQKA 5EBCA 4A3EH 1VQMA 1H9KA 4JI8Q 2JN4A 4DNRB 3GTMH 2HDLA 1BF4A 2CH4A 1K8AC 2PQEA 2ES2A 4A3BG 1CI3M 2L4NA 4X64L 2PZUA 4A75A 4C3IH 1DYQA 5CV7A 4A3BB 1I4HA 4PNYA 1K0SA 5M3MG 1LTID 1I94L 2UUAL 5KYIA 2F0LA 2PCFB 5A35A 1EY4A 2OF1A 2ZXPA 2K50A 1HR0Q 4GKKL 2FINB 2A73B 3BS1A 5M3MB 2KHIA 1SNQA 2SOBA 4B9XA 3JC66 1JQYD 4HJ8A 1BBWA 5ELBA 2NVYH 5EPJA 2PW5A 1ESRA 3K7UC 5EKKA 2NZHA 1B8AA 4X65Q 2WFWA 3Q24A 4ZAIA 3CKIB 1EL0A 1XXGA 1CHPD 4RA8A 2O4XA 3G6JB 4RAUC 1LT3D 1RF2D 4EQOA 5M5WH 4JK1C 5ELCA 2B3GA 4QB4A 1X3FA 2DNCA 1MIUA 2F4IA 3OOCA 2E2JH 4PMBA 1FNVA 1Y8PB 3W5OA 2NN6I 3J7A5 4XXEA 1H95A 4CGYB 3GO5A 2WB1G 4JI1Q 3S16H 4NXML 1TS3A 4JOIC 3C1EA 4LK1C 1G6ZA 2ZTCA 2L0CA 1IYVA 1WCMH 2WB1B 3NWTA 2C5CA 2MQHA 2XRSD 4BBRG 1VQ8A 3MXNB 1F9QA 3AMUA 5AJ3Q 3EBEA 4LF7Q 4YWLA 1YJ9A 1A0IA 4BBRB 3WOEA 4Y52H 5FOBB 2K5WA 4DAVA 1OXUA 1PRTD 1I6HB 2L15A 1UE1A 1XMOL 3T1YL 4JG2A 3TP6A 3K8AA 4GOPB 1LTGD 3L3OC 4A3LG 4YWMA 3QOLA 4DF7A 2EVBA 3ULPA 3RN2A 2FMMA 3IFTA 1WOCA 2UXCQ 2VQEL 2Q8TA 2SNMA 3EVQA 3QWNA 3DUZA 4G7HC 4DR3L 3GTKH 5IYCG 2R93G 4DV2Q 4DR7Q 4A93G 4WRDA 2VB3X 2F4VQ 3H15A 5JPNC 1C8CA 3KLWA 1FJGL 4G7ZC 1PRTC 1NY4A 3I4MG 2R93B 4A93B 1LTBD 3KBGA 4OHJA 1DGSA 5I9PA 1Y1VH 1JORA 1P8LA 4HSVA 3I4MB 4KJOA 2KA7A 4JW0A 1QVGA 4HCEA 1O7IA 2UU9Q 2F3VA 1E24A 4XQNA 4J1MA 1JE4A 4DK3C 1FR3A 5JEAJ 5IT9L 3RZOB 5K36H 4L5RC 2OEOA 1EY5A 3PO3B 2F0HA 2F0DA 4I65A 1NSNS 2H1EA 5M5YH 4CKCA 1EY9A 5IP9H 1AZQA 4B3SQ 4LFBL 1AEXA 3OIQA 3EN2A 3U50C 4QMGA 2IX1A 4LF6Q 2R3ZA 4ABNA 4P72A 1I4PA 1Y1WG 3CW2C 1HZCA 1SLJA 2A74C 3NE5B 1ZXTA 4DV4Q 1K28A 2XSCA 2P5ZX 1Y1WB 3KDFA 2KEDA 1LT5D 2KVMA 4A3GG 1F2YA 2VNUD 3F2UA 3MXNA 1RCVD 2D62A 1BOSA 3OSOA 4A3GB 5C44G 3KF6B 5HGTA 3H6MA 4RWSC 5E4XA 1SMYC 5C5LA 3HP3A 4JI2L 1YHBA 5C44B 1Q8IA 1WI5A 5M3FG 2R7DA 5EKLA 5EPLA 3T53B 4CKBA 4DR2L 1U0LA 1CA6A 4AYBE 4GOPA 3S1MB 2I5HA 1N36L 3K59A 1D5ZC 2F0VA 1GOZA 4NXNL 1EIGA 1UEBA 3NXWA 4A3MG 1JB3A 3HS0C 1X56A 2OT2A 4RFBA 3CC7A 4FDBA 4PMWA 2K1BA 1CK1A 1JT8A 4IPDA 4HMJA 5J1ZA 1O78A 2I07B 4A3MB 5JAVA 2DJFC 1S5BD 1O7YA 2ID0A 3RLFA 1E3PA 1NCVA 1XMQQ 1TVXA 3KJOA 3TZUA 4YCVA 4J8QA 3GDEA 4C3HG 3E0EA 4EGVA 2KHJA 2JQOA 3D4WA 1LM0A 4ZUJA 4C3HB 4BA1I 2VL6A 4C3JG 2ZTEA 3CCUA 2CCZA 1K83H 1GJXA 1NR4A 1DOKA 1AE2A 2K03A 4C3JB 2D0PA 1PMRA 4GN4B 2BCOA 2PNRC 1PDQA 4UAIA 1B9NA 3M3YH 5BN5A 3HOXH 1FVIA 3I70A 4WJWA 3C3LA 4POGA 2CWAA 2K5QA 1GKHA 1SNCA 5H1SE 3GV3A 2J4XA 1D1IA 1K0RA 1SROA 4X66Q 2RKSA 2RHSB 3AFQA 1A62A 1L0YB 1VF7A 2ZTDA 2VQFQ 2N88A 3OWFA 5CV9A 3I7FA 3LNNA 4O2DA 3U4VA 1DZ1A 2ICEC 4TSSA 1EY6A 2K04A 4PZ6A 3MA2B 4TRDA 1KD1C 2B2TC 1SYEA 1VQJA 3H3VI 1TKWB 3A8JE 1QNUA 1KDCA 1Q1BA 1D1KA 1HFGA 2N3SA 3J81i 2XIWA 2Y0SG 4FO2A 1Q90A 1AE3A 5KNBA 4YHHQ 1W6KA 3EA6A 4EQNA 2K5NA 2PQAB 1PH1A 3FVQA 4K5WA 2F0SA 3G48A 4PZ8A 4AIMA 2Y0SB 1TS5A 4LF4L 2B2UA 3GTOH 4TKOB 4KI0A 4B3RL 3TP7A 1EWHA 3AB9A 2Q2TA 3NUCA 3RUZA 3S1QH 1IKLA 1BCPC 3D0FA 2B2WA 4U673 3C2PA 3QO2A 1F2LA 1IBLL 2KENA 2BOSA 5E3FA 1NR2A 1UEAB 2OWOA 4N9TA 1LT4D 1J6QA 3D4RA 5K5PA 3EROA 3BZKA 1V1OA 1MI2A 3BVMA 2TSSA 2F0IA 1EY0A 5KEEA 3K58A 1U4LA 4RKBA 4UHVA 4OO1H 1TWCH 3PUYA 4QIWE 4L5TA 1A8VA 4JBWA 3GTPH 3T4AC 2JA7H 4QUCA 3L2PA 4ZK9B 3G6EA 2AQ1B 3U58A 1D5XC 1QNKA 2KBNA 2UUCL 4UP7A 5IY0A 1MBYA 1QB5D 1ZYRC 3OYYA 4KKUA 3UDGA 1HTLD 3I4NH 1PTOB 3BJUA 3H3VC 1A15A 2EYJA 4JBJA 1TT2A 4I7AA 3CCMA 1HCZA 2LSSA 1WVLA 3MTSA 1EIHA 4DV3L 2VXWA 4XT3B 1FYCA 1PFSA 1EOVA 1RTNA 4RCOA 5BR8Q 3OTOL 2KCCA 4FF2A 3GTGH 2F0QA 3L0OA 5I2YA 2JXMB 5I6YA 2A8VA 4A3FH 2FXQA 4DUYL 3MHBA 1JOQA 5EAYA 3A8IE 1HNZQ 1OXTA 1EU4A 2EDGA 3HOVH 3PIPA 1PFBA 3ULJA 4A3IG 1EYAA 4OONA 1STAA 1UAPA 3BDLA 2PQAA 3HOZH 4JI0L 5JJKA 5M9OA 5C0XG 4A3KH 4A3JG 1GUSA 1MHWC 4AH6A 4A3IB 4KHZA 3VA5A 3LGJA 5IWAL 1Y69U 5GQOA 4DA2A 1HNXL 2E8GA 4A3JB 4GN5A 3P75A 3F2CA 5FO8B 5JJIA 3MXGA 4R4QA 4JI5L 1RODA 3M4YA 4NPSA 1KLUD 1LO5D 4E6IA 2OTJA 2IT1A 1K9MC 4DV1L 3BYTB 1PH5A 1HA6A 2Z6KA 2JA5H 1XNRL 2QEXA 1TXYA 5E1FA 1PA6A 1UE7A 4X62L 2HHHL 3V2TA 3S2HB 1B44D 1HNWQ 1AW7A 1VQLA 5C4JB 2UXBL 1C4QA 1F2ZA 1SN8A 3PMFA 1J9OA 3KUPA 4KKTA 4HJAA 2DNEA 1WTQA 4K0KQ 4LF9L 1JOKA 4JC0A 4Q0FA 1D2BA 4GNXB 4Q5VA 1X3EA 4ZCKA 2AWNA 2KJXA 4JYAL 1X6OA 1ICFB 4BBSH 1X65A 1V9PA 3T1HQ 1MKHA 3HZXA 4KMUC 4LF5L 2A6HD 2V1CC 2KUMA 4OELB 3ZYYX 4MTNA 1WD0A 2NVTB 1GUTA 1OXSC 1S72A 5KNDA 5TSSA 4ALPA 1JICA 4IUVA 1VMPA 1NAPA 2EXDA 4R4IA 5EQ0A 1JJCB 1TWFB 1CQVA 3HOWH 4XTCS 1PXUA 1TY0A 1I3QH 2A19A 2RQXA 5HGQA 4EQPA 3OMGA 1SE3A 1E1TA 4J6HA 4FYDA 1RKNA 3DWAA 3A5ZB 2E5LQ 3FEWX 3PUZA 5C3EB 1K3RA 5IYDG 1RDPD 2YTYA 3K7AH 1BXTA 1A3VA 3X3MA 1N34Q 2R7ZG 4DR4L 3FKIH 1PLFA 1OTCA 1T5XD 1YITA 4HCSA 4QJFA 4TQUS 2IPKD 2R7ZB 3DM3A 2C35B 2E76C 2PZWA 3P20A 4R4CA 2QF7A 1JOOA 2HT1A 1YNXA 3SR1A 4H44C 5CV8A 1GD7A 4B3TL 1SYGA 2IY5B 2B2YC 1PZJD 1I50H 3FDTA 2PYKA 2QDBA 4M8AA 2O5IC 4JI1L 4IFDG 1JJGA 1NJIC 1FGUA 4OWXB 1Y8NB 2MHVA 2KCTA 3WWVA 4FNFA 4C2MB 4BXXG 3PV0A 4K8JA 2K6AA 4GKJQ 4DV7L 1KAAA 3W3AA 1EQQA 2RDHA 5ELOA 1G51A 1R9TH 4R4OA 3K5MA 5AJ3L 1EY8A 1PH4A 1HTPA 4QL5A 1ENFA 1QILA 1SYCA 4KY7A 3J80c 2PPBC 2NVQB 1U9RA 5LMNW 4G7OC 1ESFA 3QB3A 4GNXA 1ET6A 2IHEA 4U68A 2JA8G 3KK7A 2G9DA 1C48A 3CCJA 2IX0A 1KLGD 2BE5D 1STBA 1QOHA 2B63H 2F0UA 2XTIA 1Q8KA 2JA8B 4DK6C 2R92G 1HJPA 5JPMC 1DOMA 2A6ED 4BS9A 2LKVA 2Z6BA 4K5VA 4X3SA 1E7ZA 4P2CB 3GTLH 2R92B 2M2LA 2UXCL 1B53A 4IUQA 3BVGA 1PFNA 3N6RA 1XNQQ 3ICEA 3KLSX 4IURA 2NUCA 1ZEQX 2WKCA 4IN3A 4RKLA 5CORA 3PQIA 1F9RA 3VYTA 4MHEA 4RH6A 1SYBA 4DUZQ 3VR4A 1I4RA 4A3BH 2AQ2B 4IALA 1F9PA 4A3CG 2ZM6L 4GS3A 3DWPA 3X3NA 4JBKA 3J81c 3S15B 3CCVA 2A6EC 3P1HA 4P74A 4QQBX 3A56A 4N9PA 1C9OA 5M3MH 1D7QA 4RMFA 4TVAB 3MWYW 1M4VA 1HHVA 2F0NA 4XDXA 3TDQA 1K8MA 4LJZC 4XT1B 3KOJA 1SRUA 2PI2E 4JV5Q 4RHRA 2RA4A 3K81C 1KTKA 4DNTB 2ZXOA 2K4KA 1OXVA 1CA5A 1U5KA 1B3AA 4YCUA 3P7JA 2F0WA 3PO2G 3DM1A 1STNA 5FLXc 3HOYG 2O2LD 4JI6L 3KDFB 3NTIA 4K8IA 5C3XA 2X6LA 1Q46A 1HXYD 3PO2B 1XPUA 3HOYB 5GROA 3PF5A 5GADC 2EJMA 2JYOA 1MD2D 1S5ED 4NP5A 3FP9A 5LMUL 2A69D 1M1KC 1L0XB 5KNCA 2Z9HA 1CZWA 4G4KA 5M5XH 2A1AA 1JB7A 3PGZA 2UUBQ 3HEJA 2LFNA 4BY1G 2E2HB 2MNAA 1A2TA 4OO1I 2L55A 1MGSA 1GXDC 3GTQB 3U9SA 2R6GA 2EYOA 1TWAB 2EZVA 4BY1B 1KDBA 3AYHB 5IODA 1ILQA 4BBRH 5HURA 4ZYSA 3ONAB 1HZAA 1S5DD 1G291 1QE6A 4IJHA 1YNJD 3I73A 1I6HH 2K33A 4DV5L 1MJEA 3RNUA 3KJPA 2K5DA 3STBD 1QCBD 4IQZA 4IO9A 2MJ8A 3PUXA 1A6XA 3EIVA 4OIJA 2J0TD 4LWCA 4JBMA 4DR6L 1SNDA 1F77A 2B2VA 3HKZG 4A3LH 1HR0W 5CMDA 1TWGB 3CC2A 4PG3A 4X64Q 1SBBB 4LFCL 3HKZB 1RHPA 4RGMA 2MPMA 5D3DA 1KRTA 3SK6A 3O13A 1ICWA 2Q2HA 3VYRA 3PO3G 2XN9C 1I94Q 2UUAQ 4O0AA 5IYCH 2R93H 1STGA 2ZJRA 4A93H 5GAGC 1Q3LA 4YY3L 1H9SA 4GKKQ 3NELA 1Q82C 1FD7D 4RGTA 3E0JA 3I4MH 3KFUA 2R61A 4NB3A 2CW0D 2WAQE 1D8LA 1KNEA 2K32A 1EWCA 2RSOA 4POFA 1L1OB 2F3IA 1XTCD 3E9HA 2F0FA 3H0GG 3RZOH 5CR3A 3HOUG 3TS0A 1GO3E 2H4OA 1J5EL 3I90A 5L37A 3HKSA 1QZGA 3TSSA 3H0GB 3CCLA 1YIJA 3M9BA 5DM63 3HOUB 1BBUA 5ELEA 2EY1A 1WJJA 3NWSA 4LF8L 2D0OA 3NENA 2MO0A 3NK9A 2N49A 4H7BA 4KHVA 1GHKA 5DM73 2CW0C 1DONA 4OL7A 2WP8J 4QF4A 4CHTB 3S1NB 1Y1WH 1V1QA 3VYUA 2OQKA 3K57A 1LTAD 2JEBI 1E22A 3MZ5A 4AQYL 1XTDA 4DKAC 1CSQA 1SYFA 1KNAA 2Q2IA 4FF3A 4YWKA 3PUVA 1SDFA 4A3GH 3Q23A 5DNFA 2BH8A 2VY3A 2EIFA 2PMZE 1I4GA 1A63A 1AZPA 5BN3A 5C44H 2GVBA 3LWEA 1XMOQ 4DK0A 2CQOA 3CRKC 1M8AA 2DY7A 3S1MH 3UDXA 5M3FH 1F9SA 2MGSA 1WFQA 1PH2A 1B4OA 1SNMA 1IXRA 2AQ3B 3K80C 1I4QA 1STEA 5JOBA 1EFWA 3CD6A 3I55A 1KC8C 3VR5A 2VQEQ 4CDDC 1YJWA 1IBML 4KKSA 3T51B 2V4DA 4DR3Q 4DV0L 1B1ZA 2PW7A 4A3MH 1SR3A 3J80i 2I5LX 3IKJA 2NZOA
chains in the Genus database with same CATH topology
1I6VC 3SK5A 3DWQA 4C1NI 4PMCA 1TS4A 3Q22A 1HUNA 1LT6D 3D6WA 5D65A 3R8BA 1BBXC 4DXFA 5C3WA 2HUGA 3MXPA 1TQOA 2B8FA 4DGZA 3WOFA 1WTWA 1E2WA 1CTMA 2RDGA 4X3UA 5C4XB 5C4ZA 3S2DB 3HRZC 4OGQC 2B8GA 2XRQD 2NN6G 3SK8A 3M7GA 4C56C 3D6CA 3D31A 3OWEB 1OXXK 3NBHA 3GTOB 2M00A 1V1PA 2XVSA 3S1QB 1KDAA 1E0BA 2AUKA 1G2SA 1VF5C 4DK1A 2DY8A 2VUMB 3E5SA 2CQAA 2KCNA 4RGOS 3D8GA 3G7LA 1GHJA 5CV6A 3RZDB 1LLRD 2LMCB 4DXGA 1O80A 3S17B 1Z6HA 5C6AA 2E2IB 2K7VA 2EJGC 5IGGA 4ME5A 2OXPA 4X3KA 1S4ZA 4FF4A 1X32A 1SYDA 3EJIA 3DMUA 4CJ1B 5J22A 4ZLTF 3DEOA 1JC7A 3NP8A 1PTOH 3OHXC 2NYZD 5J39A 3M7NA 3J80E 3MXUA 1TR5A 2G9HD 3S1RB 2F0EA 2FJ2A 5G3LF 5NUCA 4Y7NB 1YNND 1U4MA 1CQFA 1PTOF 4ULLA 2XWBB 4K6LA 4EVOA 2F1MA 3ERQA 4ZKBB 3M4OB 1QWYA 2PO4A 5IGBA 3J81L 5C0XH 1IHZA 1WTRA 3J81E 4X3TA 1E2VA 2B39A 2ZXRA 3GQBA 1RD9D 4BY7B 5JEAG 1EU3A 1FGBD 1BO0A 1CT1D 2RDFA 5JJZA 1S5CD 2F0PA 2E75C 4AYBB 1U4PA 1Z7TA 4H0LC 2XNAC 1AN8A 1O7ZA 3I3CA 4CKEA 5I2XA 2J7ZA 4F7XA 1H9RA 1CHQD 1SXTA 5C5MA 2F0TA 3E6ZX 4RHSA 3VR6A 4RCNA 2F0KA 2F0GA 3H09A 5ELFA 4L6TB 3C46A 3T16A 1BCPB 2K28A 1CM9A 4HAEA 1SFOB 2LY7A 4B08A 1A2UA 1JR0D 4HR7B 3R93A 1X3PA 4XYOA 1Q1EA 2F03A 5D14A 2IWHA 1EZ6A 4V0BA 2A6HC 2EYHA 3R2TA 1GUGA 2NTTA 4DAYA 4H13C 3I91A 2NB0A 3D4DA 3IAYA 1B2TA 2IW3A 1VMCA 3R3OA 2YU9B 1OO9B 3OW7A 5EBDA 2Z4IA 3TBIB 2IJ0A 5LL6S 4KJNA 3T13A 3MFGA 3K6OA 3KLSA 2A68D 1ML0D 3T56B 1BCPF 2Z4HA 3RMHA 3GD7A 3SEBA 2ZT9C 2E2DC 1CFMA 2NTSA 4L63B 1EYDA 4K6DA 5T1GA 4A3DB 1TWHB 2FHTA 2ICIA 3VR2A 2EOTA 3M85A 2RBMA 3QOJA 1R9TB 3GTJB 4M1UB 2B2TA 2PZTA 3J7AF 4IFDH 1TS2A 2EY5A 5IGDA 2GA4B 4K2LA 1FNUA 4CJ0B 4KTAA 4PV1C 3ITPA 4A3EB 1CZGA 4C3IG 4ID6A 3GTMB 1W6JA 1WTPA 4C3IB 5I4DA 2X6GA 4QIWB 2SNSA 3BDOA 3HG9A 1LTSD 3MFYA 4ZKCB 1KABA 3OIPA 1AP0A 1ENCA 1B9MA 1EFID 2BE5C 1A3UA 3V96A 5CV4A 2WKDA 5F2DA 2NVYB 2FFKB 2EYFA 1SE4A 1H9SB 4KK7A 1H9MA 2EJFC 4FXKC 2JE6I 3WDNA 2HDMA 2B2UC 2D5DA 5M5WB 4IZ8A 5IGEA 2QILA 1RJTA 4NDXA 5IIFA 2BA1A 2E2JB 3QJYA 4KV6A 2B2WC 2N55A 5IOCA 5T1IA 2KHSA 3D3RA 3S16B 2XWJB 3HGBA 5ELDA 1WCMB 4KD4A 1ILPA 3A54A 3N52A 5CV5A 1WTOA 1EZ8A 5FO7B 1V43A 2RSNA 4LAAA 1WD1A 1J8IA 1EQTA 4R8NA 5M5XB 1SJED 4O1NA 4S3SA 1II3A 3Q0AA 2BDNA 5DAUA 3A7LA 4ZUIA 1BDOA 3NQTA 3A7AB 3BYYB 4BWGB 5C4HA 3NPPA 2QCPX 3W2DA 1V8QA 4V190 2A69C 1G91A 2D2CC 3GTKB 1HRJA 3V05A 1T5EA 4XYQA 2L11A 5C0XJ 1PZID 3OPOA 2IL8A 1Y1VB 1ONLA 1LABA 1DOLA 2Q8IB 1EEID 1YNJC 5K36G 4RGNA 2Q8RE 2AUJD 3TP8A 5FK9C 3TMEA 5BN4A 5M5YB 4XQQA 2JP1A 1DM0B 5I9OA 4F87A 3NTKA 3RD4A 3NSWA 5G3LD 2MP1A 1IL8A 2KECA 5IGFA 2QEJC 2YYZA 5IT9E 2EY2A 3EQLC 5JVH3 1SMYD 1PTOD 5C0XI 1F2MA 1JWUD 1SAPA 2JSOA 1D6EC 1XX8A 4DAPA 2NBFA 3DHQA 3S9WA 2WIIB 1GUNA 5EPKA 3PIP3 3FMCA 5I6WA 1V1PB 3IL8A 4LMQD 1SE2A 4ZQ3A 3J7YW 1BUVT 1PTOC 1S5FD 4HTHA 4NMZA 2IX3A 3NQIA 3TZDA 1SNOA 1BR9A 4R8IA 5M3FB 5CYUA 3PIO3 2HQEA 4HMIA 5E4WC 1K8OA 2WINB 4FF1A 2B2YA 2EPBA 2M9VA 4KY6A 2D9UA 2L5TA 4IUTA 2E74C 1DJRD 2MUYA 3FPPA 3TN2A 4HSPA 2SEBD 5CBEE 1K83B 5CC4A 1QJOA 4IUUA 4NW2A 3CRLC 4PQXA 4DFAA 2EYLA 2NWGA 3L9AX 1STYA 4IFDJ 3K5OA 3M3YB 5IGCA 3HOXB 1BNZA 3UI2A 2F0JA 3FPUB 3I72A 2K01A 3MAQA 1TY2A 1DCZA 1DD2A 3MEHA 3A55A 4Z9CB 3CHBD 2F0OA 5KRUA 1MSHA 1Q12A 1HPCA 1IKMA 3L7ZC 1UUPA 4I7ZC 5COYA 5CGKA 5JVG3 2X69A 1XWEA 1G8ZD 1X3QA 1PRTB 2NVXB 1BCPD 1UNSA 1TU2B 4FXGC 1HQMC 1Y8OB 3A8KE 1D5MC 1VCIA 3K5NA 2EXZA 3VA7A 3PUWA 4IFDI 4F8MA 3H94A 3NHHA 3GP7A 1Z47A 2NN6H 4HN7A 4QCLA 1JWMD 3QG1A 4XQJA 3CQZB 3NTHA 3VYSA 1GUWA 4OO1G 1EQVA 4K2KA 1U4RA 3BVZA 1DXMA 5LL6X 1HQRD 1STHA 1PRTF 4C1NK 3TP5A 1TWCB 1HA5A 1ZYRD 2Z1CA 2C9OA 5EGTA 3GTPB 5FO9B 2WACA 2JA7B 4GZYC 2KQ3A 2L12A 5AFWA 2CVRA 2KEEA 2JEAI 3BG3A 2NZ1D 2O5JC 1SNPA 1I4XA 3I4NB 3AU7A 1VDZA 1EY7A 1O7LA 2RVLA 3IFDA 3H91A 3J80L 3I8ZA 1FNWA 3SXHA 2I46A 4K14A 3KLRA 4BA2I 3CU7A 3GTGB 4A3FB 3KF8A 2JA6B 1EEFD 2EY6A 1TIID 3SHLA 3HOVB 3LWUA 4B9WA 3DEPA 2WAQB 5FKAC 3HOZB 5EKIA 3BDCA 4A3KB 3JAML 3SVMA 4KY5A 2KOLA 3VR3A 4O42A 1LV9A 3JAME 1NUCA 2L1BA 5LHY1 1EYCA 1ENAA 4CBVA 1ZKOA 4KN4C 2TMPA 1YNNC 2JA5B 3FRPB 3QIAA 2B2VC 1LTRD 1IW7D 2K05A 3GV6A 1E2ZA 4DU9A 1RTOA 3DXJC 1IYUA 5FLXL 4HEDA 1PYWD 2PMZB 4G57A 2F3WA 1WTVA 5FLXE 5A2QL 1JCKB 4WORA 4BBSB 1LACA 5JEAH 5A2QE 4KN7C 2SDFA 4NKLA 4IUNA 1IW7C 1ET9A 2WV6D 4YIJA 3J7AV 5KIXA 1GUOA 5CBAE 1PFMA 3OMCA 3SK4A 2EYMA 3ND8A 1WTXA 3HOWB 3S14B 4FVMA 1BQQT 1I3QB 1R4QB 1HFNA 5KYLA 3KBXA 1SSOA 3BZDB 1PZKD 1G2TA 2VB2X 3U9OA 3NBIA 1H9JA 4L8JA 3K7AB 4ODGA 4FXDA 2FMCA 2LS01 3FKIB 4KD3A 1XYIA 2L9HA 2HCIA 4UDUC 4R9WA 5KGUA 1LTTD 2BA0A 2HCCA 2Z8LA 1R4PB 5EJWA 1A3TA 2EE1A 1I50B 3R2IA 3EFXD 4K5XA 4CJ2C 2A5HA 2BDOA 4OIKA 5DEHA 3LX0A 2QKIC 2DN8A 1EOTA 1QG7A 5D3IB 3C1FA 4IUPA 1AFPA 1HUMA 1MSGA 1JWSD 3K5LA 4WFN3 4MN3A 3SE0A 3ND9A 2A68C 1SEBD 3K0YA 3MC0B 5ISRA 4ILWA 4QUFA 3I4LA 2B63B 2AWOA 4F88A 3URYA 2CHBD 4FP5D 3Q6SA 4MIUA 2EYPA 2F0MA 2ENBA 3GTLB 4DN4M 3MVVA 1B50A 1SJHD 3SDZA 4XIGS 4ZRZA 5EBCA 1H9KA 4DNRB 2HDLA 1BF4A 2PQEA 1CI3M 2L4NA 2PZUA 1DYQA 5CV7A 4A3BB 1I4HA 4PNYA 1LTID 5KYIA 2F0LA 2PCFB 5A35A 1EY4A 2OF1A 2ZXPA 2FINB 2A73B 3BS1A 5M3MB 2SOBA 1SNQA 4B9XA 1JQYD 5ELBA 5EPJA 2PW5A 1ESRA 5EKKA 3Q24A 4ZAIA 3CKIB 1EL0A 1XXGA 1CHPD 4RA8A 2O4XA 3G6JB 4RAUC 1LT3D 1RF2D 4EQOA 4JK1C 5ELCA 4QB4A 2DNCA 2F4IA 3OOCA 4PMBA 1FNVA 1Y8PB 2NN6I 4XXEA 4CGYB 3GO5A 1TS3A 4LK1C 3C1EA 1G6ZA 2L0CA 1IYVA 2WB1B 3NWTA 2C5CA 2XRSD 1F9QA 3AMUA 4BBRB 3WOEA 5FOBB 2K5WA 4DAVA 1OXUA 1PRTD 1I6HB 3TP6A 1LTGD 3L3OC 3QOLA 4DF7A 2EVBA 2FMMA 3IFTA 2Q8TA 2SNMA 3EVQA 3QWNA 3DUZA 4G7HC 4WRDA 2VB3X 5JPNC 1C8CA 4G7ZC 1PRTC 2R93B 4A93B 1LTBD 3KBGA 4OHJA 5I9PA 1JORA 3I4MB 4HSVA 4KJOA 2KA7A 4HCEA 2F3VA 4XQNA 4J1MA 1JE4A 1FR3A 5JEAJ 5IT9L 3RZOB 5K36H 2OEOA 1EY5A 3PO3B 2F0HA 2F0DA 4I65A 1NSNS 2H1EA 4CKCA 1EY9A 1AZQA 1AEXA 3OIQA 4QMGA 2IX1A 2R3ZA 4ABNA 1I4PA 2A74C 3NE5B 1ZXTA 2XSCA 1Y1WB 2KEDA 1LT5D 2KVMA 1F2YA 2VNUD 3F2UA 3MXNA 1RCVD 2D62A 1BOSA 3OSOA 4A3GB 5HGTA 3H6MA 4RWSC 5E4XA 1SMYC 5C5LA 3HP3A 5C44B 1Q8IA 5EKLA 5EPLA 3T53B 4CKBA 1CA6A 3S1MB 3K59A 1D5ZC 2F0VA 1GOZA 1EIGA 3NXWA 1JB3A 3HS0C 2OT2A 4RFBA 4PMWA 2K1BA 1CK1A 4HMJA 5J1ZA 1O78A 2I07B 4A3MB 5JAVA 1S5BD 1O7YA 2ID0A 3RLFA 1NCVA 1TVXA 3TZUA 4J8QA 4C3HG 4EGVA 3D4WA 4ZUJA 4C3HB 4BA1I 4C3JG 1GJXA 1NR4A 1DOKA 2K03A 4C3JB 1PMRA 2BCOA 2PNRC 1PDQA 4UAIA 1B9NA 5BN5A 3I70A 4WJWA 3C3LA 2K5QA 1SNCA 3GV3A 2J4XA 1D1IA 2RKSA 1L0YB 1VF7A 2N88A 3OWFA 5CV9A 3LNNA 1DZ1A 2ICEC 4TSSA 1EY6A 2K04A 3MA2B 4TRDA 2B2TC 1SYEA 1TKWB 3A8JE 1QNUA 1KDCA 1Q1BA 1D1KA 1HFGA 2XIWA 4FO2A 1Q90A 5KNBA 1W6KA 3EA6A 4EQNA 3FVQA 4K5WA 2F0SA 2Y0SB 1TS5A 2B2UA 4TKOB 4KI0A 3TP7A 1EWHA 3AB9A 3NUCA 3RUZA 1IKLA 1BCPC 2B2WA 4U673 3C2PA 3QO2A 1F2LA 2BOSA 5E3FA 1NR2A 1UEAB 4N9TA 1LT4D 3D4RA 5K5PA 3EROA 1V1OA 1MI2A 3BVMA 2TSSA 2F0IA 1EY0A 5KEEA 3K58A 1U4LA 4RKBA 4OO1H 3PUYA 4JBWA 3T4AC 4QUCA 4ZK9B 2AQ1B 1D5XC 1QNKA 1MBYA 1QB5D 1ZYRC 4KKUA 1HTLD 1PTOB 3H3VC 1A15A 2EYJA 1TT2A 1HCZA 1WVLA 3MTSA 1EIHA 2VXWA 4XT3B 1FYCA 1RTNA 4RCOA 2KCCA 4FF2A 2F0QA 5I2YA 5I6YA 2JXMB 3MHBA 1JOQA 3A8IE 1OXTA 1EU4A 2EDGA 1PFBA 1EYAA 1STAA 1UAPA 3BDLA 5M9OA 5C0XG 1GUSA 4A3IB 4KHZA 3VA5A 1Y69U 4DA2A 4A3JB 3P75A 5FO8B 3MXGA 1RODA 3M4YA 1KLUD 1LO5D 4E6IA 2IT1A 3BYTB 1HA6A 5E1FA 3V2TA 3S2HB 1B44D 1AW7A 5C4JB 1C4QA 1F2ZA 3PMFA 1J9OA 3KUPA 4KKTA 1WTQA 2DNEA 1JOKA 4Q0FA 1D2BA 4Q5VA 2AWNA 2KJXA 3HZXA 4KMUC 2A6HD 2KUMA 3ZYYX 1WD0A 2NVTB 1GUTA 1OXSC 5KNDA 5TSSA 1JICA 4IUVA 1VMPA 1NAPA 5EQ0A 1TWFB 1CQVA 4XTCS 1PXUA 1TY0A 2RQXA 4EQPA 3OMGA 1SE3A 4J6HA 4FYDA 1RKNA 3DWAA 3FEWX 3PUZA 5C3EB 1RDPD 1BXTA 1A3VA 3X3MA 1PLFA 1T5XD 4HCSA 4TQUS 2IPKD 2R7ZB 2E76C 2PZWA 3P20A 2QF7A 1JOOA 3SR1A 4H44C 5CV8A 1SYGA 2B2YC 1PZJD 3FDTA 2PYKA 2QDBA 4M8AA 2O5IC 4IFDG 1Y8NB 2MHVA 4FNFA 4C2MB 3PV0A 4K8JA 2K6AA 1KAAA 3W3AA 2RDHA 3K5MA 1EY8A 1HTPA 1ENFA 1QILA 1SYCA 4KY7A 2PPBC 2NVQB 1U9RA 4G7OC 1ESFA 3QB3A 1ET6A 4U68A 3KK7A 2G9DA 1C48A 2IX0A 1KLGD 2BE5D 1STBA 1QOHA 2F0UA 2JA8B 5JPMC 1DOMA 2A6ED 4BS9A 2LKVA 4K5VA 4X3SA 4P2CB 2R92B 2M2LA 1B53A 4IUQA 3BVGA 1PFNA 3N6RA 3KLSX 4IURA 2NUCA 1ZEQX 2WKCA 4IN3A 4RKLA 5CORA 1F9RA 3VYTA 4MHEA 4RH6A 1SYBA 3VR4A 1I4RA 2AQ2B 4IALA 1F9PA 3DWPA 3X3NA 3S15B 2A6EC 3P1HA 3A56A 4N9PA 3MWYW 1M4VA 1HHVA 2F0NA 4XDXA 3TDQA 1K8MA 4LJZC 4XT1B 4RHRA 2RA4A 1KTKA 4DNTB 2ZXOA 1OXVA 1CA5A 1B3AA 3P7JA 2F0WA 3DM1A 1STNA 2O2LD 3NTIA 4K8IA 5C3XA 2X6LA 1HXYD 3PO2B 3HOYB 2EJMA 2JYOA 1MD2D 1S5ED 4NP5A 2A69D 1L0XB 5KNCA 1CZWA 4G4KA 3HEJA 2LFNA 2E2HB 1A2TA 4OO1I 2L55A 1MGSA 1GXDC 3GTQB 3U9SA 2R6GA 2EYOA 1TWAB 2EZVA 4BY1B 1KDBA 5IODA 1ILQA 5HURA 4ZYSA 3ONAB 1S5DD 1G291 1QE6A 1YNJD 3I73A 2K33A 2K5DA 1QCBD 4IQZA 2MJ8A 3PUXA 1A6XA 4OIJA 2J0TD 1SNDA 1F77A 2B2VA 5CMDA 1TWGB 1SBBB 3HKZB 1RHPA 4RGMA 2MPMA 5D3DA 3SK6A 3O13A 1ICWA 3VYRA 2XN9C 1STGA 1Q3LA 1H9SA 1FD7D 4RGTA 3E0JA 2R61A 2CW0D 1KNEA 2K32A 1EWCA 2RSOA 1XTCD 2F0FA 5CR3A 2H4OA 3I90A 3TSSA 3H0GB 5DM63 3HOUB 5ELEA 2EY1A 3NWSA 3NK9A 4H7BA 4KHVA 1GHKA 5DM73 2CW0C 1DONA 4OL7A 2WP8J 4QF4A 4CHTB 3S1NB 3VYUA 3K57A 1LTAD 2JEBI 3MZ5A 1SYFA 1KNAA 4FF3A 3PUVA 1SDFA 3Q23A 5DNFA 1I4GA 1AZPA 5BN3A 3LWEA 4DK0A 3CRKC 1M8AA 2DY7A 1F9SA 2MGSA 1B4OA 1SNMA 2AQ3B 1I4QA 1STEA 5JOBA 3VR5A 4KKSA 3T51B 2V4DA 1B1ZA 2PW7A 3IKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMB A;  5DEH A;  3SK5 A;  1SYB A;  3SK6 A;  5JAV A;  4HTH A;  5C6A A;  3LX0 A;  4K2L A;  3NQT A;  4NMZ A;  3OWF A;  5CV9 A;  4PMC A;  5IGG A;  4IAL A;  4KTA A;  2F0Q A;  4F7X A;  5C4H A;  3ITP A;  4ME5 A;  5I6Y A;  1EY6 A;  3MHB A;  4ID6 A;  1JOQ A;  1STG A;  1SNO A;  2OXP A;  3OMG A;  4EQP A;  4J6H A;  4TRD A;  1RKN A;  1SYE A;  3C1E A;  5C5M A;  3C1F A;  2F0T A;  3P1H A;  1SYD A;  3EJI A;  1EQV A;  1F2Y A;  1KDC A;  3DMU A;  4N9P A;  2HQE A;  4K2K A;  4HMI A;  1EYA A;  2F0K A;  2F0G A;  5C3W A;  1STA A;  4DU9 A;  3BDL A;  1STH A;  1A3V A;  3OSO A;  3T16 A;  5J22 A;  3MXP A;  5M9O A;  2F0N A;  3TP5 A;  4EQN A;  1TQO A;  5HGT A;  3H6M A;  4K5W A;  2SNS A;  4KY6 A;  5EGT A;  5C5L A;  2F0S A;  3VA5 A;  2F0F A;  1A2U A;  5ISR A;  2WAC A;  3NP8 A;  4G57 A;  2F3W A;  5CR3 A;  4DGZ A;  5J39 A;  1KAB A;  1ENC A;  2KQ3 A;  5EKL A;  3P75 A;  3TP7 A;  2F0W A;  1A3U A;  4WOR A;  2PZW A;  5CC4 A;  5CV4 A;  3NUC A;  1JOO A;  3RUZ A;  3SR1 A;  5CV8 A;  1EZ6 A;  1STN A;  3TP6 A;  5F2D A;  1SYG A;  4DFA A;  1TR5 A;  1SNP A;  2EY1 A;  2EYL A;  5C4Z A;  2EYF A;  2F0V A;  2EYH A;  4MIU A;  2EYP A;  4E6I A;  4K8I A;  2PYK A;  2F0M A;  2QDB A;  3NXW A;  4IUN A;  1STY A;  2ENB A;  4NKL A;  1EY7 A;  3TP8 A;  3MVV A;  3NK9 A;  4YIJ A;  5E3F A;  5IGC A;  2F0E A;  3TME A;  2F0J A;  3QOL A;  5NUC A;  4H7B A;  4KHV A;  4DF7 A;  5KIX A;  4N9T A;  4OL7 A;  4HMJ A;  4QF4 A;  5J1Z A;  4IZ8 A;  3ERO A;  5I9O A;  4NP5 A;  5K5P A;  5IGE A;  2PQE A;  2SNM A;  3D4D A;  3EVQ A;  5E1F A;  4NDX A;  3SXH A;  3SK8 A;  4K8J A;  3R3O A;  3OMC A;  3MZ5 A;  1KAA A;  4ZUI A;  3V2T A;  5C3X A;  3D6C A;  5IIF A;  3MEH A;  2F0I A;  4KV6 A;  2PZU A;  3SK4 A;  4KJN A;  1EY0 A;  4K14 A;  4EVO A;  1SYF A;  4WRD A;  3T13 A;  3HEJ A;  2F0O A;  2EYM A;  2KHS A;  5IGF A;  5IOC A;  5CV7 A;  5KRU A;  4RKB A;  1A2T A;  1EY8 A;  4PNY A;  2M00 A;  1F2Z A;  2EY2 A;  3ERQ A;  3PMF A;  1SYC A;  4KY7 A;  1U9R A;  2EYO A;  5KYL A;  3QB3 A;  5KYI A;  1KDB A;  2EY6 A;  5CGK A;  1KDA A;  5I9P A;  2F0L A;  1JOK A;  5IGB A;  5IOD A;  1EY4 A;  1F2M A;  3U9O A;  2OF1 A;  3SHL A;  3D4W A;  4ZUJ A;  4B9W A;  5HUR A;  1JOR A;  1IHZ A;  1EYD A;  4K6D A;  4KJO A;  1STB A;  2SOB A;  1SNQ A;  4KD4 A;  2F0U A;  4B9X A;  3E5S A;  3BDC A;  4ODG A;  2F3V A;  3HZX A;  5CV5 A;  4J1M A;  2PW5 A;  4KY5 A;  1EZ8 A;  3DHQ A;  5EKK A;  2LKV A;  3S9W A;  1SNM A;  4K5V A;  4LAA A;  5KEE A;  4KD3 A;  4R8N A;  2OEO A;  3D8G A;  1EY5 A;  2RBM A;  5JOB A;  2F0H A;  1NUC A;  2F0D A;  2EXZ A;  2EYJ A;  1NSN S;  3QOJ A;  1SND A;  4I65 A;  5CV6 A;  4S3S A;  5KGU A;  1II3 A;  1EY9 A;  1TT2 A;  2O4X A;  1EYC A;  2RDF A;  2NUC A;  5I6W A;  4EQO A;  1SNC A;  5DAU A;  2F0P A;  1ENA A;  2PZT A;  1AEX A;  2PW7 A;  4F8M A;  4QB4 A;  4RKL A;  1A3T A;  4QMG A;  2EY5 A;  2RKS A;  4ZQ3 A;  4K5X A;  3NHH A;  5IGD A; 
#chains in the Genus database with same CATH topology
 1AH9 A;  1I6V C;  1SMX A;  3SK5 A;  1JE5 A;  1EUJ A;  3DWQ A;  4LFA Q;  4C1N I;  1FJG Q;  4PMC A;  2CKZ B;  1TS4 A;  3Q22 A;  1HUN A;  2K5H A;  1LT6 D;  3D6W A;  4EX5 A;  5D65 A;  3R8B A;  4C3H H;  1PV4 A;  1BBX C;  4DXF A;  5C3W A;  1L1O A;  4DR5 L;  2HUG A;  3MXP A;  1TQO A;  2B8F A;  4H02 A;  4C3J H;  1VQB A;  1N33 L;  3JAM i;  4DGZ A;  3WOF A;  1WTW A;  5C4X G;  1VQN A;  1L2F A;  4LFB Q;  1E2W A;  2KCM A;  1B3Q A;  4IPC A;  1CTM A;  2RF4 A;  2RDG A;  4X3U A;  3QR8 A;  5C4X B;  5C4Z A;  3S2D B;  3HRZ C;  4OGQ C;  4JI7 L;  4X6A H;  2B8G A;  2LXJ A;  2XRQ D;  2NVX H;  1NNX A;  2QA4 A;  2NN6 G;  2CFM A;  3SK8 A;  2BH2 A;  3M7G A;  4C56 C;  2QW7 A;  3D6C A;  3D31 A;  2Z0S A;  3OWE B;  1OXX K;  3NBH A;  3GTO B;  1Q81 C;  1QVF A;  2M00 A;  1V1P A;  1IZ6 A;  4JI2 Q;  2XVS A;  1KAW A;  2VUM G;  4DR1 L;  3S1Q B;  1KDA A;  1E0B A;  2AUK A;  3UDI A;  2AKW B;  1G2S A;  1VF5 C;  4DR2 Q;  4DK1 A;  2DY8 A;  2VUM B;  4MTK A;  2ATW A;  1N36 Q;  3E5S A;  3CQZ H;  2CQA A;  4NXN Q;  1PYS B;  2KCN A;  1C0A A;  4RGO S;  4B3M L;  1EQR A;  3D8G A;  3G7L A;  1GHJ A;  5CV6 A;  3RZD B;  1LLR D;  2LMC B;  4JOI A;  3J81 j;  4DXG A;  1O80 A;  3S17 B;  5IT9 c;  4OEM B;  1Z6H A;  5C6A A;  2HIV A;  2E2I B;  4K0K L;  2K7V A;  2EJG C;  5IGG A;  4ME5 A;  5LMN L;  4JCV E;  2OXP A;  4X3K A;  5J3B A;  1S4Z A;  4FF4 A;  1X32 A;  1SYD A;  3EJI A;  3T1H L;  3DMU A;  4CJ1 B;  5IYB G;  4DAM A;  5J22 A;  4ZLT F;  3DEO A;  1XPR A;  1JC7 A;  3CCQ A;  1RIP A;  3NP8 A;  1PTO H;  3UE0 A;  2ASB A;  3OHX C;  2NYZ D;  3PCO B;  5J39 A;  3M7N A;  1GM5 A;  3J80 E;  3MXU A;  2JA6 H;  2UXD L;  1TR5 A;  2G9H D;  1P16 A;  4IOC A;  4JI3 Q;  3S1R B;  1NMG A;  2QDL A;  2F0E A;  2FJ2 A;  5G3L F;  1PH8 A;  5NUC A;  4Y7N B;  1HH2 P;  1YNN D;  1U4M A;  1CQF A;  4IOA A;  4DAY B;  4N8X 1;  1PTO F;  4QGU A;  4ULL A;  2WB1 E;  1N34 L;  1X54 A;  2XWB B;  4K6L A;  4EVO A;  1YBY A;  2F1M A;  2OTL A;  3ERQ A;  4ZKB B;  1X55 A;  4A3I H;  1QWY A;  2PO4 A;  4LF4 Q;  3M4O B;  3PIO A;  4A4I A;  4YCW A;  5IGB A;  2VW9 A;  3J81 L;  1KXL A;  5C0X H;  1IHZ A;  4A3J H;  1WTR A;  4BY7 G;  4KHP L;  3J81 E;  4X3T A;  2CH4 W;  1E2V A;  2B39 A;  1PH3 A;  2ZXR A;  3GQB A;  1RD9 D;  4JI4 L;  1IBL Q;  4BY7 B;  4MZ9 A;  5IP7 G;  5JEA G;  1EU3 A;  3OW2 A;  1FGB D;  1BO0 A;  4AYB G;  4DNI A;  1CT1 D;  4R1J A;  2ALY B;  2RDF A;  5JJZ A;  1S5C D;  4JVZ A;  1IBK L;  2F0P A;  2E75 C;  3AEV A;  1VQE A;  4AYB B;  1U4P A;  2N78 A;  1Z7T A;  4H0L C;  2OCE A;  4OX9 L;  2XNA C;  3G71 A;  1AN8 A;  1O7Z A;  3S2H H;  3I3C A;  4CKE A;  1M90 C;  5I2X A;  2R7F A;  1YVC A;  2J7Z A;  5C4J H;  1CSP A;  4F7X A;  4L5S A;  1H9R A;  1CHQ D;  2I5M X;  1SXT A;  5C5M A;  4JI8 L;  2F0T A;  3E6Z X;  4N8F A;  4RHS A;  3VR6 A;  2I0Q A;  2RCF A;  4P75 A;  4RCN A;  2UUC Q;  3PF4 A;  2F0K A;  2F0G A;  3H09 A;  5ELF A;  4L6T B;  3C46 A;  2F52 A;  3T16 A;  1BCP B;  2K28 A;  1CM9 A;  3A5U A;  4IJL A;  4HAE A;  1SFO B;  2LY7 A;  2QGQ A;  3BU2 A;  1A2U A;  4B08 A;  1XNQ L;  1JR0 D;  4HR7 B;  3F1Z A;  3R93 A;  3S14 H;  1N32 Q;  2NVT H;  1X3P A;  4XYO A;  1Q1E A;  2F03 A;  5C3E G;  1HR0 L;  5D14 A;  2IWH A;  1EZ6 A;  4V0B A;  2A6H C;  2EYH A;  3ERS X;  1E1O A;  3OTO Q;  3R2T A;  1TWF H;  4X65 L;  3A74 A;  4DUY Q;  1GUG A;  2NTT A;  4DAY A;  4ME3 A;  4H13 C;  3I91 A;  2NB0 A;  3D4D A;  4HJ9 A;  3IAY A;  1B2T A;  2IW3 A;  1VMC A;  3R3O A;  2YU9 B;  1OO9 B;  3TQY A;  3OW7 A;  5EBD A;  1IL2 A;  4GOP C;  2Z4I A;  3TBI B;  2IJ0 A;  5LL6 S;  4KJN A;  4JI0 Q;  3T13 A;  3MFG A;  3K6O A;  3M4Q A;  3KLS A;  4LUV A;  2A68 D;  1ML0 D;  3NEM A;  3T56 B;  5IWA Q;  1BCP F;  4GLV B;  2Z4H A;  1HNX Q;  3RMH A;  3GD7 A;  1VQ6 A;  5IYD H;  3SEB A;  4A3D G;  2ZT9 C;  4GLA C;  5FLM H;  4OWW B;  2E2D C;  1CFM A;  4JI5 Q;  2NTS A;  4L63 B;  2R7Z H;  1EYD A;  4K6D A;  5T1G A;  4A3D B;  2LXK A;  1YZ6 A;  1TWH B;  1W3S A;  2FHT A;  4DV1 Q;  1VQ9 A;  2ICI A;  2PNH A;  1HZB A;  3VR2 A;  2EOT A;  3M85 A;  2RBM A;  3QOJ A;  4LF7 L;  1R9T B;  3GTJ B;  1XNR Q;  3CPW A;  4M1U B;  2B2T A;  1KRS A;  1QVC A;  2AHO B;  4X62 Q;  5FJ8 G;  4OXP A;  2PZT A;  4C2M H;  2HHH Q;  3J7A F;  1S40 A;  4DV6 Q;  1TS2 A;  4IFD H;  2EY5 A;  1UWV A;  1VQA A;  5IGD A;  4A3E G;  2GA4 B;  2UXB Q;  4BXX H;  4K2L A;  1FNU A;  4CJ0 B;  1C7Y A;  1B70 B;  4KTA A;  4PV1 C;  3ITP A;  4A3E B;  4LF9 Q;  1CZG A;  4C3I G;  2NVQ H;  4ID6 A;  3GTM B;  2JA9 A;  1W6J A;  1Y14 B;  4JYA Q;  1VQI A;  1CKN B;  1WTP A;  4C3I B;  5I4D A;  2JA8 H;  4LF5 Q;  2X6G A;  4DV2 L;  3JAM c;  4DR7 L;  2F4V L;  4QIW B;  2SNS A;  3BDO A;  3HG9 A;  2R92 H;  1LTS D;  3MFY A;  4ZKC B;  1KAB A;  3OIP A;  1AP0 A;  1CUK A;  1ENC A;  1B9M A;  1EFI D;  2BE5 C;  1A3U A;  3V96 A;  4OWT B;  5CV4 A;  3E9I A;  2WKD A;  3TEH B;  5F2D A;  2NVY B;  2FFK B;  2EYF A;  2UU9 L;  1SE4 A;  1H9S B;  4KK7 A;  4HJ7 A;  4QY7 A;  1H9M A;  3CC4 A;  1RL2 A;  2EJF C;  4IPH A;  4FXK C;  2JE6 I;  3CAM A;  3WDN A;  2HDM A;  2B2U C;  4A76 A;  2D5D A;  3CP0 A;  5M5W B;  4IZ8 A;  2JK8 A;  1SE8 A;  5IGE A;  4GLX A;  2QIL A;  1RJT A;  4NDX A;  4B3S L;  3S15 H;  1HZ9 A;  5IIF A;  4A3C H;  1CKO A;  2BA1 A;  2E2J B;  3QJY A;  4KV6 A;  3CXC A;  2B2W C;  2N55 A;  3RLO A;  5IOC A;  4LF6 L;  5T1I A;  2KHS A;  5ELN A;  4DR4 Q;  3D3R A;  1WCM G;  3S16 B;  2XWJ B;  2H5X A;  2Y0S E;  4WJ4 A;  3HGB A;  5ELD A;  4DV4 L;  1WCM B;  5GAH C;  4KD4 A;  4B3T Q;  1ILP A;  3A54 A;  1UE5 A;  3N52 A;  5CV5 A;  1WTO A;  4HIM A;  1EZ8 A;  5FO7 B;  1V43 A;  2RSN A;  4IPG A;  4LAA A;  1WD1 A;  4UY8 C;  1J8I A;  1EQT A;  4R8N A;  1EYG A;  3PO2 H;  3HOY H;  5M5X B;  1SJE D;  4O1N A;  4S3S A;  1II3 A;  3I4O A;  3Q0A A;  1VQ5 A;  2BDN A;  3RLN A;  3U4Z A;  5DAU A;  4DV7 Q;  4APV A;  1YEZ A;  2CWP A;  3A7L A;  4JPB W;  4ZUI A;  1BDO A;  1LTL A;  1K73 C;  3CF5 A;  3NQT A;  2E2H H;  3A7A B;  3K0X A;  1WTH A;  3RR5 A;  3BYY B;  4BWG B;  5C4H A;  3GTQ H;  3NPP A;  2QCP X;  3W2D A;  1V8Q A;  1BVS A;  1TWA H;  4BY1 H;  4V19 0;  1CKN A;  2A69 C;  2DJG C;  1KHI A;  1G91 A;  2D2C C;  3GTK B;  1HRJ A;  3V05 A;  1T5E A;  4XYQ A;  1XMQ L;  1MJC A;  2L11 A;  3FHW A;  5C0X J;  1Y1V G;  3AFP A;  3SGI A;  1PZI D;  3OPO A;  2IL8 A;  1Q7Y C;  1EIY B;  1Y1V B;  3TRZ A;  1ONL A;  1LAB A;  1DOL A;  2Q8I B;  3B6Y A;  1EEI D;  1YNJ C;  5K36 G;  4RGN A;  1B7Y B;  2Q8R E;  4P71 A;  4LFA L;  1TWG H;  2AUJ D;  3STB C;  2ZJQ A;  2Q2U A;  5IP9 G;  1QZH A;  3TP8 A;  5FK9 C;  2ZM6 Q;  1I5F A;  3TME A;  5BN4 A;  5M5Y B;  3F2B A;  4HIK A;  1X9N A;  4XQQ A;  2JP1 A;  2DUD A;  1LUZ A;  1DM0 B;  5I9O A;  4F87 A;  3NTK A;  3RD4 A;  3PO3 H;  3NSW A;  4WJ3 M;  3A0J A;  3ER0 A;  4X66 L;  5G3L D;  2MP1 A;  1IL8 A;  2KEC A;  5IGF A;  2QEJ C;  2YYZ A;  2VQF L;  5IT9 E;  2EY2 A;  2K75 A;  2MO1 A;  3EQL C;  3UE1 A;  5JVH 3;  1SMY D;  2Z6K C;  1PTO D;  5C0X I;  1F2M A;  1JWU D;  4NXM Q;  1SAP A;  2JSO A;  3ULL A;  1D6E C;  3H0G H;  1XX8 A;  2N8N A;  4KLK A;  4DAP A;  4JI6 Q;  1N9W A;  1QUQ B;  1VS0 A;  2NBF A;  3HOU H;  2HIX A;  3DHQ A;  4YHH L;  1NTG A;  4CDC C;  3S9W A;  2WII B;  1GUN A;  5EPK A;  3PIP 3;  4RG1 A;  3NBH B;  3FMC A;  5I6W A;  5LMU Q;  1V1P B;  3S1N H;  3S24 A;  3IL8 A;  4LMQ D;  2ZJP A;  1SE2 A;  4ZQ3 A;  3J7Y W;  1BUV T;  3ZJY C;  3CCS A;  1PTO C;  3Q8D A;  1S5F D;  3T1Y Q;  4HTH A;  1W2B A;  4NMZ A;  3CME A;  2IX3 A;  3NQI A;  3TZD A;  3IRB A;  1SNO A;  1BR9 A;  4R8I A;  5M3F B;  5CYU A;  3PIO 3;  2HQE A;  4HMI A;  4DV5 Q;  5E4W C;  1K8O A;  1VQ7 A;  2WIN B;  4FF1 A;  2B2Y A;  2EPB A;  2M9V A;  3CPF A;  4KY6 A;  2D9U A;  2L5T A;  4IUT A;  4DR6 Q;  2E74 C;  1DJR D;  2MUY A;  3FPP A;  3TN2 A;  4HSP A;  2SEB D;  5CBE E;  1K83 B;  5CC4 A;  1QJO A;  4IUU A;  4NW2 A;  3VDY A;  4LFC Q;  2YTV A;  3CRL C;  3HOX G;  4PQX A;  2XGT A;  5DLQ E;  4DFA A;  2YTX A;  2EYL A;  2NWG A;  2DGY A;  3L9A X;  3HFZ B;  1STY A;  4IFD J;  3K5O A;  3M3Y B;  5IGC A;  3HOX B;  1BNZ A;  3UI2 A;  2F0J A;  3FPU B;  3I72 A;  2K01 A;  4YY3 Q;  3MAQ A;  1TY2 A;  1PYB A;  1DCZ A;  3W1G A;  1DD2 A;  3MEH A;  1K8G A;  3A55 A;  4Z9C B;  2RHQ B;  3CHB D;  2F0O A;  5KRU A;  1VQ4 A;  1MSH A;  1Q12 A;  1Z9F A;  1HPC A;  5HY6 A;  5BR8 L;  1IKM A;  3L7Z C;  1UUP A;  4I7Z C;  5COY A;  5CGK A;  5JVG 3;  1J5E Q;  4R4T A;  3CMA A;  1FL0 A;  3KF8 B;  3BZC A;  2X69 A;  1XWE A;  1PHJ A;  1HNZ L;  1G8Z D;  1X3Q A;  1PRT B;  1QUQ A;  1K3B C;  2B29 A;  3F2D A;  1XPO A;  4JI3 L;  2NVX B;  1BCP D;  1UNS A;  1TU2 B;  4LF8 Q;  5C4X H;  3S2D H;  4FXG C;  1G6P A;  1HQM C;  1Y8O B;  3A8K E;  1D5M C;  3PSI A;  4LUO A;  2GVA A;  1VCI A;  3K5N A;  2EXZ A;  4GNX C;  1YI2 A;  5IE8 A;  3VA7 A;  3PUW A;  4CDF C;  3KF6 A;  3TRE A;  4IFD I;  4F8M A;  4AQY Q;  3H94 A;  2K52 A;  3NHH A;  4EQ5 A;  3GP7 A;  1YHQ A;  1Z47 A;  4PZ7 A;  2NN6 H;  4HN7 A;  4QCL A;  1JWM D;  3QG1 A;  4XQJ A;  1WYD A;  3CQZ B;  2AMC B;  3NTH A;  3VYS A;  1GUW A;  3G4S A;  2HD3 A;  4OO1 G;  1EQV A;  4K2K A;  2VUM H;  1VQH A;  1U4R A;  3BVZ A;  1DXM A;  5LL6 X;  1HQR D;  1YHA A;  1STH A;  1PRT F;  2JA7 G;  1VQO A;  4C1N K;  3TP5 A;  1TWC B;  1HA5 A;  1ZYR D;  2Z1C A;  1HNW L;  2C9O A;  5EGT A;  1NBW A;  2RCN A;  3GTP B;  5FO9 B;  2WAC A;  2JA7 B;  4GZY C;  1IBM Q;  2KQ3 A;  4DV0 Q;  3RZD H;  2L12 A;  1JMC A;  5AFW A;  3I4N G;  2CVR A;  2KEE A;  2JEA I;  3BG3 A;  2NZ1 D;  2O5J C;  1SNP A;  3S17 H;  1I4X A;  3I4N B;  3AU7 A;  1VDZ A;  1EY7 A;  2IHF A;  1O7L A;  2RVL A;  2E2I H;  3IFD A;  3H91 A;  1VQP A;  3J80 L;  3I8Z A;  1FNW A;  1EWI A;  3SXH A;  2I46 A;  4DR5 Q;  4A3F G;  4K14 A;  1KQS A;  2JA6 G;  3KLR A;  1PH9 A;  4BA2 I;  2K14 A;  3CU7 A;  4UPA A;  3GTG B;  1N33 Q;  3HOV G;  4UP9 A;  4A3F B;  1N32 L;  5IYB H;  1PH7 A;  3KF8 A;  2JA6 B;  1EEF D;  2WAQ G;  2EY6 A;  3HOZ G;  1GVP A;  4LNQ A;  1TII D;  3SHL A;  3HOV B;  3LWU A;  3CCR A;  4B9W A;  3DLL A;  4A3K G;  1VQF A;  2OQ0 A;  3DEP A;  2E5L L;  2WAQ B;  5FKA C;  3HOZ B;  5EKI A;  3BDC A;  1XJV A;  4A3K B;  2PI2 A;  3JAM L;  3SVM A;  4KY5 A;  2KOL A;  4JI7 Q;  3VR3 A;  4O42 A;  1LV9 A;  3S1R H;  3JAM E;  1NUC A;  2L1B A;  5LHY 1;  4Y7N H;  1Q86 C;  1EYC A;  5GAE C;  1VQC A;  2JJQ A;  1ASZ A;  1ENA A;  4CBV A;  3W1B A;  4B3R Q;  4CDE C;  3I56 A;  1ZKO A;  2JA5 G;  4DR1 Q;  4KN4 C;  2TMP A;  1YNN C;  2JA5 B;  3M4O H;  3FRP B;  3QIA A;  2B2V C;  1LTR D;  1IW7 D;  5JJL A;  4GN3 B;  2K05 A;  3GV6 A;  1CKM A;  3E3X A;  1BKB A;  4GKJ L;  1E2Z A;  4DU9 A;  1VQD A;  1RTO A;  1ASY A;  4B3M Q;  3DXJ C;  1IYU A;  5FLX L;  1EIF A;  4BY7 H;  4BBS G;  4HED A;  1PYW D;  2PMZ B;  4G57 A;  2F3W A;  1WTV A;  1VQG A;  5FLX E;  2GN5 A;  5A2Q L;  4DV6 L;  4P73 A;  1JCK B;  4WOR A;  5IP7 H;  4BBS B;  1LAC A;  5JEA H;  5A2Q E;  4KN7 C;  2SDF A;  3HKZ E;  3UDF A;  4NKL A;  4IUN A;  1IW7 C;  1ET9 A;  2WV6 D;  4YIJ A;  5LMN Q;  4LUZ A;  3J7A V;  4UP8 A;  5E7N A;  5KIX A;  1GUO A;  5CBA E;  1PFM A;  3HOW G;  2HQL A;  3CCE A;  3OMC A;  4L5Q A;  1L0W A;  3J7Z C;  3SK4 A;  2EYM A;  3ND8 A;  4DV3 Q;  1WTX A;  3HOW B;  4HID A;  2K5V A;  4FVM A;  1BQQ T;  3S14 B;  1I3Q B;  1R4Q B;  1HFN A;  4DUZ L;  5KYL A;  3KBX A;  1SFO H;  1SSO A;  3BZD B;  1N8R C;  1PZK D;  1G2T A;  2VB2 X;  3U9O A;  3NBI A;  3I2Z A;  1H9J A;  3FKI G;  4L8J A;  2UXD Q;  3K7A B;  4ODG A;  4FXD A;  2FMC A;  4MNO A;  2LS0 1;  3FKI B;  3TS2 A;  5C3E H;  1JJ2 A;  4KD3 A;  1XYI A;  2L9H A;  4JV5 L;  2HCI A;  4UDU C;  4R9W A;  5KGU A;  1LTT D;  3KYH C;  3F8T A;  2BA0 A;  2HCC A;  3MEF A;  2Z8L A;  1PH6 A;  1R4P B;  5EJW A;  5FLM G;  1A3T A;  2EE1 A;  1I50 B;  3R2I A;  2YU9 H;  3EFX D;  4K5X A;  4CJ2 C;  1UE6 A;  2A5H A;  2BDO A;  1PVO A;  4OIK A;  5DEH A;  1KIX A;  3LX0 A;  2QKI C;  2DN8 A;  1EOT A;  1KL9 A;  1YJN A;  1QG7 A;  5D3I B;  4HIO A;  2VS1 A;  3C1F A;  4IUP A;  1AFP A;  1HUM A;  1MSG A;  3H3V H;  4KHP Q;  1JWS D;  3K5L A;  4DPG A;  4WFN 3;  4MN3 A;  3SE0 A;  4JI4 Q;  4J15 A;  3ND9 A;  2A68 C;  1T9H A;  1X3G A;  4A3D H;  2G5D A;  3RN5 A;  2UUB L;  1SEB D;  4HJ5 A;  1IYJ B;  1TWH H;  1NE3 A;  3K0Y A;  2MFI A;  3MC0 B;  2B63 G;  5ISR A;  4ILW A;  1S3O A;  4QUF A;  3I4L A;  1IBK Q;  3GTJ H;  2B63 B;  2VZA A;  2AWO A;  4F88 A;  4LW1 A;  3URY A;  1NMF A;  4OX9 Q;  1L1O C;  2YV5 A;  2CHB D;  4FP5 D;  3M4P A;  3Q6S A;  4MIU A;  2EYP A;  2F0M A;  5FJ8 H;  2EQS A;  2ENB A;  3GTL B;  4DN4 M;  3MVV A;  1B50 A;  1SJH D;  3AQQ A;  3SDZ A;  4XIG S;  1LYL A;  4ZRZ A;  1VQK A;  5EBC A;  4A3E H;  1VQM A;  1H9K A;  4JI8 Q;  2JN4 A;  4DNR B;  3GTM H;  2HDL A;  1BF4 A;  2CH4 A;  1K8A C;  2PQE A;  2ES2 A;  4A3B G;  1CI3 M;  2L4N A;  4X64 L;  2PZU A;  4A75 A;  4C3I H;  1DYQ A;  5CV7 A;  4A3B B;  1I4H A;  4PNY A;  1K0S A;  5M3M G;  1LTI D;  1I94 L;  2UUA L;  5KYI A;  2F0L A;  2PCF B;  5A35 A;  1EY4 A;  2OF1 A;  2ZXP A;  2K50 A;  1HR0 Q;  4GKK L;  2FIN B;  2A73 B;  3BS1 A;  5M3M B;  2KHI A;  1SNQ A;  2SOB A;  4B9X A;  3JC6 6;  1JQY D;  4HJ8 A;  1BBW A;  5ELB A;  2NVY H;  5EPJ A;  2PW5 A;  1ESR A;  3K7U C;  5EKK A;  2NZH A;  1B8A A;  4X65 Q;  2WFW A;  3Q24 A;  4ZAI A;  3CKI B;  1EL0 A;  1XXG A;  1CHP D;  4RA8 A;  2O4X A;  3G6J B;  4RAU C;  1LT3 D;  1RF2 D;  4EQO A;  5M5W H;  4JK1 C;  5ELC A;  2B3G A;  4QB4 A;  1X3F A;  2DNC A;  1MIU A;  2F4I A;  3OOC A;  2E2J H;  4PMB A;  1FNV A;  1Y8P B;  3W5O A;  2NN6 I;  3J7A 5;  4XXE A;  1H95 A;  4CGY B;  3GO5 A;  2WB1 G;  4JI1 Q;  3S16 H;  4NXM L;  1TS3 A;  4JOI C;  3C1E A;  4LK1 C;  1G6Z A;  2ZTC A;  2L0C A;  1IYV A;  1WCM H;  2WB1 B;  3NWT A;  2C5C A;  2MQH A;  2XRS D;  4BBR G;  1VQ8 A;  3MXN B;  1F9Q A;  3AMU A;  5AJ3 Q;  3EBE A;  4LF7 Q;  4YWL A;  1YJ9 A;  1A0I A;  4BBR B;  3WOE A;  4Y52 H;  5FOB B;  2K5W A;  4DAV A;  1OXU A;  1PRT D;  1I6H B;  2L15 A;  1UE1 A;  1XMO L;  3T1Y L;  4JG2 A;  3TP6 A;  3K8A A;  4GOP B;  1LTG D;  3L3O C;  4A3L G;  4YWM A;  3QOL A;  4DF7 A;  2EVB A;  3ULP A;  3RN2 A;  2FMM A;  3IFT A;  1WOC A;  2UXC Q;  2VQE L;  2Q8T A;  2SNM A;  3EVQ A;  3QWN A;  3DUZ A;  4G7H C;  4DR3 L;  3GTK H;  5IYC G;  2R93 G;  4DV2 Q;  4DR7 Q;  4A93 G;  4WRD A;  2VB3 X;  2F4V Q;  3H15 A;  5JPN C;  1C8C A;  3KLW A;  1FJG L;  4G7Z C;  1PRT C;  1NY4 A;  3I4M G;  2R93 B;  4A93 B;  1LTB D;  3KBG A;  4OHJ A;  1DGS A;  5I9P A;  1Y1V H;  1JOR A;  1P8L A;  4HSV A;  3I4M B;  4KJO A;  2KA7 A;  4JW0 A;  1QVG A;  4HCE A;  1O7I A;  2UU9 Q;  2F3V A;  1E24 A;  4XQN A;  4J1M A;  1JE4 A;  4DK3 C;  1FR3 A;  5JEA J;  5IT9 L;  3RZO B;  5K36 H;  4L5R C;  2OEO A;  1EY5 A;  3PO3 B;  2F0H A;  2F0D A;  4I65 A;  1NSN S;  2H1E A;  5M5Y H;  4CKC A;  1EY9 A;  5IP9 H;  1AZQ A;  4B3S Q;  4LFB L;  1AEX A;  3OIQ A;  3EN2 A;  3U50 C;  4QMG A;  2IX1 A;  4LF6 Q;  2R3Z A;  4ABN A;  4P72 A;  1I4P A;  1Y1W G;  3CW2 C;  1HZC A;  1SLJ A;  2A74 C;  3NE5 B;  1ZXT A;  4DV4 Q;  1K28 A;  2XSC A;  2P5Z X;  1Y1W B;  3KDF A;  2KED A;  1LT5 D;  2KVM A;  4A3G G;  1F2Y A;  2VNU D;  3F2U A;  3MXN A;  1RCV D;  2D62 A;  1BOS A;  3OSO A;  4A3G B;  5C44 G;  3KF6 B;  5HGT A;  3H6M A;  4RWS C;  5E4X A;  1SMY C;  5C5L A;  3HP3 A;  4JI2 L;  1YHB A;  5C44 B;  1Q8I A;  1WI5 A;  5M3F G;  2R7D A;  5EKL A;  5EPL A;  3T53 B;  4CKB A;  4DR2 L;  1U0L A;  1CA6 A;  4AYB E;  4GOP A;  3S1M B;  2I5H A;  1N36 L;  3K59 A;  1D5Z C;  2F0V A;  1GOZ A;  4NXN L;  1EIG A;  1UEB A;  3NXW A;  4A3M G;  1JB3 A;  3HS0 C;  1X56 A;  2OT2 A;  4RFB A;  3CC7 A;  4FDB A;  4PMW A;  2K1B A;  1CK1 A;  1JT8 A;  4IPD A;  4HMJ A;  5J1Z A;  1O78 A;  2I07 B;  4A3M B;  5JAV A;  2DJF C;  1S5B D;  1O7Y A;  2ID0 A;  3RLF A;  1E3P A;  1NCV A;  1XMQ Q;  1TVX A;  3KJO A;  3TZU A;  4YCV A;  4J8Q A;  3GDE A;  4C3H G;  3E0E A;  4EGV A;  2KHJ A;  2JQO A;  3D4W A;  1LM0 A;  4ZUJ A;  4C3H B;  4BA1 I;  2VL6 A;  4C3J G;  2ZTE A;  3CCU A;  2CCZ A;  1K83 H;  1GJX A;  1NR4 A;  1DOK A;  1AE2 A;  2K03 A;  4C3J B;  2D0P A;  1PMR A;  4GN4 B;  2BCO A;  2PNR C;  1PDQ A;  4UAI A;  1B9N A;  3M3Y H;  5BN5 A;  3HOX H;  1FVI A;  3I70 A;  4WJW A;  3C3L A;  4POG A;  2CWA A;  2K5Q A;  1GKH A;  1SNC A;  5H1S E;  3GV3 A;  2J4X A;  1D1I A;  1K0R A;  1SRO A;  4X66 Q;  2RKS A;  2RHS B;  3AFQ A;  1A62 A;  1L0Y B;  1VF7 A;  2ZTD A;  2VQF Q;  2N88 A;  3OWF A;  5CV9 A;  3I7F A;  3LNN A;  4O2D A;  3U4V A;  1DZ1 A;  2ICE C;  4TSS A;  1EY6 A;  2K04 A;  4PZ6 A;  3MA2 B;  4TRD A;  1KD1 C;  2B2T C;  1SYE A;  1VQJ A;  3H3V I;  1TKW B;  3A8J E;  1QNU A;  1KDC A;  1Q1B A;  1D1K A;  1HFG A;  2N3S A;  3J81 i;  2XIW A;  2Y0S G;  4FO2 A;  1Q90 A;  1AE3 A;  5KNB A;  4YHH Q;  1W6K A;  3EA6 A;  4EQN A;  2K5N A;  2PQA B;  1PH1 A;  3FVQ A;  4K5W A;  2F0S A;  3G48 A;  4PZ8 A;  4AIM A;  2Y0S B;  1TS5 A;  4LF4 L;  2B2U A;  3GTO H;  4TKO B;  4KI0 A;  4B3R L;  3TP7 A;  1EWH A;  3AB9 A;  2Q2T A;  3NUC A;  3RUZ A;  3S1Q H;  1IKL A;  1BCP C;  3D0F A;  2B2W A;  4U67 3;  3C2P A;  3QO2 A;  1F2L A;  1IBL L;  2KEN A;  2BOS A;  5E3F A;  1NR2 A;  1UEA B;  2OWO A;  4N9T A;  1LT4 D;  1J6Q A;  3D4R A;  5K5P A;  3ERO A;  3BZK A;  1V1O A;  1MI2 A;  3BVM A;  2TSS A;  2F0I A;  1EY0 A;  5KEE A;  3K58 A;  1U4L A;  4RKB A;  4UHV A;  4OO1 H;  1TWC H;  3PUY A;  4QIW E;  4L5T A;  1A8V A;  4JBW A;  3GTP H;  3T4A C;  2JA7 H;  4QUC A;  3L2P A;  4ZK9 B;  3G6E A;  2AQ1 B;  3U58 A;  1D5X C;  1QNK A;  2KBN A;  2UUC L;  4UP7 A;  5IY0 A;  1MBY A;  1QB5 D;  1ZYR C;  3OYY A;  4KKU A;  3UDG A;  1HTL D;  3I4N H;  1PTO B;  3BJU A;  3H3V C;  1A15 A;  2EYJ A;  4JBJ A;  1TT2 A;  4I7A A;  3CCM A;  1HCZ A;  2LSS A;  1WVL A;  3MTS A;  1EIH A;  4DV3 L;  2VXW A;  4XT3 B;  1FYC A;  1PFS A;  1EOV A;  1RTN A;  4RCO A;  5BR8 Q;  3OTO L;  2KCC A;  4FF2 A;  3GTG H;  2F0Q A;  3L0O A;  5I2Y A;  2JXM B;  5I6Y A;  2A8V A;  4A3F H;  2FXQ A;  4DUY L;  3MHB A;  1JOQ A;  5EAY A;  3A8I E;  1HNZ Q;  1OXT A;  1EU4 A;  2EDG A;  3HOV H;  3PIP A;  1PFB A;  3ULJ A;  4A3I G;  1EYA A;  4OON A;  1STA A;  1UAP A;  3BDL A;  2PQA A;  3HOZ H;  4JI0 L;  5JJK A;  5M9O A;  5C0X G;  4A3K H;  4A3J G;  1GUS A;  1MHW C;  4AH6 A;  4A3I B;  4KHZ A;  3VA5 A;  3LGJ A;  5IWA L;  1Y69 U;  5GQO A;  4DA2 A;  1HNX L;  2E8G A;  4A3J B;  4GN5 A;  3P75 A;  3F2C A;  5FO8 B;  5JJI A;  3MXG A;  4R4Q A;  4JI5 L;  1ROD A;  3M4Y A;  4NPS A;  1KLU D;  1LO5 D;  4E6I A;  2OTJ A;  2IT1 A;  1K9M C;  4DV1 L;  3BYT B;  1PH5 A;  1HA6 A;  2Z6K A;  2JA5 H;  1XNR L;  2QEX A;  1TXY A;  5E1F A;  1PA6 A;  1UE7 A;  4X62 L;  2HHH L;  3V2T A;  3S2H B;  1B44 D;  1HNW Q;  1AW7 A;  1VQL A;  5C4J B;  2UXB L;  1C4Q A;  1F2Z A;  1SN8 A;  3PMF A;  1J9O A;  3KUP A;  4KKT A;  4HJA A;  2DNE A;  1WTQ A;  4K0K Q;  4LF9 L;  1JOK A;  4JC0 A;  4Q0F A;  1D2B A;  4GNX B;  4Q5V A;  1X3E A;  4ZCK A;  2AWN A;  2KJX A;  4JYA L;  1X6O A;  1ICF B;  4BBS H;  1X65 A;  1V9P A;  3T1H Q;  1MKH A;  3HZX A;  4KMU C;  4LF5 L;  2A6H D;  2V1C C;  2KUM A;  4OEL B;  3ZYY X;  4MTN A;  1WD0 A;  2NVT B;  1GUT A;  1OXS C;  1S72 A;  5KND A;  5TSS A;  4ALP A;  1JIC A;  4IUV A;  1VMP A;  1NAP A;  2EXD A;  4R4I A;  5EQ0 A;  1JJC B;  1TWF B;  1CQV A;  3HOW H;  4XTC S;  1PXU A;  1TY0 A;  1I3Q H;  2A19 A;  2RQX A;  5HGQ A;  4EQP A;  3OMG A;  1SE3 A;  1E1T A;  4J6H A;  4FYD A;  1RKN A;  3DWA A;  3A5Z B;  2E5L Q;  3FEW X;  3PUZ A;  5C3E B;  1K3R A;  5IYD G;  1RDP D;  2YTY A;  3K7A H;  1BXT A;  1A3V A;  3X3M A;  1N34 Q;  2R7Z G;  4DR4 L;  3FKI H;  1PLF A;  1OTC A;  1T5X D;  1YIT A;  4HCS A;  4QJF A;  4TQU S;  2IPK D;  2R7Z B;  3DM3 A;  2C35 B;  2E76 C;  2PZW A;  3P20 A;  4R4C A;  2QF7 A;  1JOO A;  2HT1 A;  1YNX A;  3SR1 A;  4H44 C;  5CV8 A;  1GD7 A;  4B3T L;  1SYG A;  2IY5 B;  2B2Y C;  1PZJ D;  1I50 H;  3FDT A;  2PYK A;  2QDB A;  4M8A A;  2O5I C;  4JI1 L;  4IFD G;  1JJG A;  1NJI C;  1FGU A;  4OWX B;  1Y8N B;  2MHV A;  2KCT A;  3WWV A;  4FNF A;  4C2M B;  4BXX G;  3PV0 A;  4K8J A;  2K6A A;  4GKJ Q;  4DV7 L;  1KAA A;  3W3A A;  1EQQ A;  2RDH A;  5ELO A;  1G51 A;  1R9T H;  4R4O A;  3K5M A;  5AJ3 L;  1EY8 A;  1PH4 A;  1HTP A;  4QL5 A;  1ENF A;  1QIL A;  1SYC A;  4KY7 A;  3J80 c;  2PPB C;  2NVQ B;  1U9R A;  5LMN W;  4G7O C;  1ESF A;  3QB3 A;  4GNX A;  1ET6 A;  2IHE A;  4U68 A;  2JA8 G;  3KK7 A;  2G9D A;  1C48 A;  3CCJ A;  2IX0 A;  1KLG D;  2BE5 D;  1STB A;  1QOH A;  2B63 H;  2F0U A;  2XTI A;  1Q8K A;  2JA8 B;  4DK6 C;  2R92 G;  1HJP A;  5JPM C;  1DOM A;  2A6E D;  4BS9 A;  2LKV A;  2Z6B A;  4K5V A;  4X3S A;  1E7Z A;  4P2C B;  3GTL H;  2R92 B;  2M2L A;  2UXC L;  1B53 A;  4IUQ A;  3BVG A;  1PFN A;  3N6R A;  1XNQ Q;  3ICE A;  3KLS X;  4IUR A;  2NUC A;  1ZEQ X;  2WKC A;  4IN3 A;  4RKL A;  5COR A;  3PQI A;  1F9R A;  3VYT A;  4MHE A;  4RH6 A;  1SYB A;  4DUZ Q;  3VR4 A;  1I4R A;  4A3B H;  2AQ2 B;  4IAL A;  1F9P A;  4A3C G;  2ZM6 L;  4GS3 A;  3DWP A;  3X3N A;  4JBK A;  3J81 c;  3S15 B;  3CCV A;  2A6E C;  3P1H A;  4P74 A;  4QQB X;  3A56 A;  4N9P A;  1C9O A;  5M3M H;  1D7Q A;  4RMF A;  4TVA B;  3MWY W;  1M4V A;  1HHV A;  2F0N A;  4XDX A;  3TDQ A;  1K8M A;  4LJZ C;  4XT1 B;  3KOJ A;  1SRU A;  2PI2 E;  4JV5 Q;  4RHR A;  2RA4 A;  3K81 C;  1KTK A;  4DNT B;  2ZXO A;  2K4K A;  1OXV A;  1CA5 A;  1U5K A;  1B3A A;  4YCU A;  3P7J A;  2F0W A;  3PO2 G;  3DM1 A;  1STN A;  5FLX c;  3HOY G;  2O2L D;  4JI6 L;  3KDF B;  3NTI A;  4K8I A;  5C3X A;  2X6L A;  1Q46 A;  1HXY D;  3PO2 B;  1XPU A;  3HOY B;  5GRO A;  3PF5 A;  5GAD C;  2EJM A;  2JYO A;  1MD2 D;  1S5E D;  4NP5 A;  3FP9 A;  5LMU L;  2A69 D;  1M1K C;  1L0X B;  5KNC A;  2Z9H A;  1CZW A;  4G4K A;  5M5X H;  2A1A A;  1JB7 A;  3PGZ A;  2UUB Q;  3HEJ A;  2LFN A;  4BY1 G;  2E2H B;  2MNA A;  1A2T A;  4OO1 I;  2L55 A;  1MGS A;  1GXD C;  3GTQ B;  3U9S A;  2R6G A;  2EYO A;  1TWA B;  2EZV A;  4BY1 B;  1KDB A;  3AYH B;  5IOD A;  1ILQ A;  4BBR H;  5HUR A;  4ZYS A;  3ONA B;  1HZA A;  1S5D D;  1G29 1;  1QE6 A;  4IJH A;  1YNJ D;  3I73 A;  1I6H H;  2K33 A;  4DV5 L;  1MJE A;  3RNU A;  3KJP A;  2K5D A;  3STB D;  1QCB D;  4IQZ A;  4IO9 A;  2MJ8 A;  3PUX A;  1A6X A;  3EIV A;  4OIJ A;  2J0T D;  4LWC A;  4JBM A;  4DR6 L;  1SND A;  1F77 A;  2B2V A;  3HKZ G;  4A3L H;  1HR0 W;  5CMD A;  1TWG B;  3CC2 A;  4PG3 A;  4X64 Q;  1SBB B;  4LFC L;  3HKZ B;  1RHP A;  4RGM A;  2MPM A;  5D3D A;  1KRT A;  3SK6 A;  3O13 A;  1ICW A;  2Q2H A;  3VYR A;  3PO3 G;  2XN9 C;  1I94 Q;  2UUA Q;  4O0A A;  5IYC H;  2R93 H;  1STG A;  2ZJR A;  4A93 H;  5GAG C;  1Q3L A;  4YY3 L;  1H9S A;  4GKK Q;  3NEL A;  1Q82 C;  1FD7 D;  4RGT A;  3E0J A;  3I4M H;  3KFU A;  2R61 A;  4NB3 A;  2CW0 D;  2WAQ E;  1D8L A;  1KNE A;  2K32 A;  1EWC A;  2RSO A;  4POF A;  1L1O B;  2F3I A;  1XTC D;  3E9H A;  2F0F A;  3H0G G;  3RZO H;  5CR3 A;  3HOU G;  3TS0 A;  1GO3 E;  2H4O A;  1J5E L;  3I90 A;  5L37 A;  3HKS A;  1QZG A;  3TSS A;  3H0G B;  3CCL A;  1YIJ A;  3M9B A;  5DM6 3;  3HOU B;  1BBU A;  5ELE A;  2EY1 A;  1WJJ A;  3NWS A;  4LF8 L;  2D0O A;  3NEN A;  2MO0 A;  3NK9 A;  2N49 A;  4H7B A;  4KHV A;  1GHK A;  5DM7 3;  2CW0 C;  1DON A;  4OL7 A;  2WP8 J;  4QF4 A;  4CHT B;  3S1N B;  1Y1W H;  1V1Q A;  3VYU A;  2OQK A;  3K57 A;  1LTA D;  2JEB I;  1E22 A;  3MZ5 A;  4AQY L;  1XTD A;  4DKA C;  1CSQ A;  1SYF A;  1KNA A;  2Q2I A;  4FF3 A;  4YWK A;  3PUV A;  1SDF A;  4A3G H;  3Q23 A;  5DNF A;  2BH8 A;  2VY3 A;  2EIF A;  2PMZ E;  1I4G A;  1A63 A;  1AZP A;  5BN3 A;  5C44 H;  2GVB A;  3LWE A;  1XMO Q;  4DK0 A;  2CQO A;  3CRK C;  1M8A A;  2DY7 A;  3S1M H;  3UDX A;  5M3F H;  1F9S A;  2MGS A;  1WFQ A;  1PH2 A;  1B4O A;  1SNM A;  1IXR A;  2AQ3 B;  3K80 C;  1I4Q A;  1STE A;  5JOB A;  1EFW A;  3CD6 A;  3I55 A;  1KC8 C;  3VR5 A;  2VQE Q;  4CDD C;  1YJW A;  1IBM L;  4KKS A;  3T51 B;  2V4D A;  4DR3 Q;  4DV0 L;  1B1Z A;  2PW7 A;  4A3M H;  1SR3 A;  3J80 i;  2I5L X;  3IKJ A;  2NZO A; 
#chains in the Genus database with same CATH homology
 1I6V C;  3SK5 A;  3DWQ A;  4C1N I;  4PMC A;  1TS4 A;  3Q22 A;  1HUN A;  1LT6 D;  3D6W A;  5D65 A;  3R8B A;  1BBX C;  4DXF A;  5C3W A;  2HUG A;  3MXP A;  1TQO A;  2B8F A;  4DGZ A;  3WOF A;  1WTW A;  1E2W A;  1CTM A;  2RDG A;  4X3U A;  5C4X B;  5C4Z A;  3S2D B;  3HRZ C;  4OGQ C;  2B8G A;  2XRQ D;  2NN6 G;  3SK8 A;  3M7G A;  4C56 C;  3D6C A;  3D31 A;  3OWE B;  1OXX K;  3NBH A;  3GTO B;  2M00 A;  1V1P A;  2XVS A;  3S1Q B;  1KDA A;  1E0B A;  2AUK A;  1G2S A;  1VF5 C;  4DK1 A;  2DY8 A;  2VUM B;  3E5S A;  2CQA A;  2KCN A;  4RGO S;  3D8G A;  3G7L A;  1GHJ A;  5CV6 A;  3RZD B;  1LLR D;  2LMC B;  4DXG A;  1O80 A;  3S17 B;  1Z6H A;  5C6A A;  2E2I B;  2K7V A;  2EJG C;  5IGG A;  4ME5 A;  2OXP A;  4X3K A;  1S4Z A;  4FF4 A;  1X32 A;  1SYD A;  3EJI A;  3DMU A;  4CJ1 B;  5J22 A;  4ZLT F;  3DEO A;  1JC7 A;  3NP8 A;  1PTO H;  3OHX C;  2NYZ D;  5J39 A;  3M7N A;  3J80 E;  3MXU A;  1TR5 A;  2G9H D;  3S1R B;  2F0E A;  2FJ2 A;  5G3L F;  5NUC A;  4Y7N B;  1YNN D;  1U4M A;  1CQF A;  1PTO F;  4ULL A;  2XWB B;  4K6L A;  4EVO A;  2F1M A;  3ERQ A;  4ZKB B;  3M4O B;  1QWY A;  2PO4 A;  5IGB A;  3J81 L;  5C0X H;  1IHZ A;  1WTR A;  3J81 E;  4X3T A;  1E2V A;  2B39 A;  2ZXR A;  3GQB A;  1RD9 D;  4BY7 B;  5JEA G;  1EU3 A;  1FGB D;  1BO0 A;  1CT1 D;  2RDF A;  5JJZ A;  1S5C D;  2F0P A;  2E75 C;  4AYB B;  1U4P A;  1Z7T A;  4H0L C;  2XNA C;  1AN8 A;  1O7Z A;  3I3C A;  4CKE A;  5I2X A;  2J7Z A;  4F7X A;  1H9R A;  1CHQ D;  1SXT A;  5C5M A;  2F0T A;  3E6Z X;  4RHS A;  3VR6 A;  4RCN A;  2F0K A;  2F0G A;  3H09 A;  5ELF A;  4L6T B;  3C46 A;  3T16 A;  1BCP B;  2K28 A;  1CM9 A;  4HAE A;  1SFO B;  2LY7 A;  4B08 A;  1A2U A;  1JR0 D;  4HR7 B;  3R93 A;  1X3P A;  4XYO A;  1Q1E A;  2F03 A;  5D14 A;  2IWH A;  1EZ6 A;  4V0B A;  2A6H C;  2EYH A;  3R2T A;  1GUG A;  2NTT A;  4DAY A;  4H13 C;  3I91 A;  2NB0 A;  3D4D A;  3IAY A;  1B2T A;  2IW3 A;  1VMC A;  3R3O A;  2YU9 B;  1OO9 B;  3OW7 A;  5EBD A;  2Z4I A;  3TBI B;  2IJ0 A;  5LL6 S;  4KJN A;  3T13 A;  3MFG A;  3K6O A;  3KLS A;  2A68 D;  1ML0 D;  3T56 B;  1BCP F;  2Z4H A;  3RMH A;  3GD7 A;  3SEB A;  2ZT9 C;  2E2D C;  1CFM A;  2NTS A;  4L63 B;  1EYD A;  4K6D A;  5T1G A;  4A3D B;  1TWH B;  2FHT A;  2ICI A;  3VR2 A;  2EOT A;  3M85 A;  2RBM A;  3QOJ A;  1R9T B;  3GTJ B;  4M1U B;  2B2T A;  2PZT A;  3J7A F;  4IFD H;  1TS2 A;  2EY5 A;  5IGD A;  2GA4 B;  4K2L A;  1FNU A;  4CJ0 B;  4KTA A;  4PV1 C;  3ITP A;  4A3E B;  1CZG A;  4C3I G;  4ID6 A;  3GTM B;  1W6J A;  1WTP A;  4C3I B;  5I4D A;  2X6G A;  4QIW B;  2SNS A;  3BDO A;  3HG9 A;  1LTS D;  3MFY A;  4ZKC B;  1KAB A;  3OIP A;  1AP0 A;  1ENC A;  1B9M A;  1EFI D;  2BE5 C;  1A3U A;  3V96 A;  5CV4 A;  2WKD A;  5F2D A;  2NVY B;  2FFK B;  2EYF A;  1SE4 A;  1H9S B;  4KK7 A;  1H9M A;  2EJF C;  4FXK C;  2JE6 I;  3WDN A;  2HDM A;  2B2U C;  2D5D A;  5M5W B;  4IZ8 A;  5IGE A;  2QIL A;  1RJT A;  4NDX A;  5IIF A;  2BA1 A;  2E2J B;  3QJY A;  4KV6 A;  2B2W C;  2N55 A;  5IOC A;  5T1I A;  2KHS A;  3D3R A;  3S16 B;  2XWJ B;  3HGB A;  5ELD A;  1WCM B;  4KD4 A;  1ILP A;  3A54 A;  3N52 A;  5CV5 A;  1WTO A;  1EZ8 A;  5FO7 B;  1V43 A;  2RSN A;  4LAA A;  1WD1 A;  1J8I A;  1EQT A;  4R8N A;  5M5X B;  1SJE D;  4O1N A;  4S3S A;  1II3 A;  3Q0A A;  2BDN A;  5DAU A;  3A7L A;  4ZUI A;  1BDO A;  3NQT A;  3A7A B;  3BYY B;  4BWG B;  5C4H A;  3NPP A;  2QCP X;  3W2D A;  1V8Q A;  4V19 0;  2A69 C;  1G91 A;  2D2C C;  3GTK B;  1HRJ A;  3V05 A;  1T5E A;  4XYQ A;  2L11 A;  5C0X J;  1PZI D;  3OPO A;  2IL8 A;  1Y1V B;  1ONL A;  1LAB A;  1DOL A;  2Q8I B;  1EEI D;  1YNJ C;  5K36 G;  4RGN A;  2Q8R E;  2AUJ D;  3TP8 A;  5FK9 C;  3TME A;  5BN4 A;  5M5Y B;  4XQQ A;  2JP1 A;  1DM0 B;  5I9O A;  4F87 A;  3NTK A;  3RD4 A;  3NSW A;  5G3L D;  2MP1 A;  1IL8 A;  2KEC A;  5IGF A;  2QEJ C;  2YYZ A;  5IT9 E;  2EY2 A;  3EQL C;  5JVH 3;  1SMY D;  1PTO D;  5C0X I;  1F2M A;  1JWU D;  1SAP A;  2JSO A;  1D6E C;  1XX8 A;  4DAP A;  2NBF A;  3DHQ A;  3S9W A;  2WII B;  1GUN A;  5EPK A;  3PIP 3;  3FMC A;  5I6W A;  1V1P B;  3IL8 A;  4LMQ D;  1SE2 A;  4ZQ3 A;  3J7Y W;  1BUV T;  1PTO C;  1S5F D;  4HTH A;  4NMZ A;  2IX3 A;  3NQI A;  3TZD A;  1SNO A;  1BR9 A;  4R8I A;  5M3F B;  5CYU A;  3PIO 3;  2HQE A;  4HMI A;  5E4W C;  1K8O A;  2WIN B;  4FF1 A;  2B2Y A;  2EPB A;  2M9V A;  4KY6 A;  2D9U A;  2L5T A;  4IUT A;  2E74 C;  1DJR D;  2MUY A;  3FPP A;  3TN2 A;  4HSP A;  2SEB D;  5CBE E;  1K83 B;  5CC4 A;  1QJO A;  4IUU A;  4NW2 A;  3CRL C;  4PQX A;  4DFA A;  2EYL A;  2NWG A;  3L9A X;  1STY A;  4IFD J;  3K5O A;  3M3Y B;  5IGC A;  3HOX B;  1BNZ A;  3UI2 A;  2F0J A;  3FPU B;  3I72 A;  2K01 A;  3MAQ A;  1TY2 A;  1DCZ A;  1DD2 A;  3MEH A;  3A55 A;  4Z9C B;  3CHB D;  2F0O A;  5KRU A;  1MSH A;  1Q12 A;  1HPC A;  1IKM A;  3L7Z C;  1UUP A;  4I7Z C;  5COY A;  5CGK A;  5JVG 3;  2X69 A;  1XWE A;  1G8Z D;  1X3Q A;  1PRT B;  2NVX B;  1BCP D;  1UNS A;  1TU2 B;  4FXG C;  1HQM C;  1Y8O B;  3A8K E;  1D5M C;  1VCI A;  3K5N A;  2EXZ A;  3VA7 A;  3PUW A;  4IFD I;  4F8M A;  3H94 A;  3NHH A;  3GP7 A;  1Z47 A;  2NN6 H;  4HN7 A;  4QCL A;  1JWM D;  3QG1 A;  4XQJ A;  3CQZ B;  3NTH A;  3VYS A;  1GUW A;  4OO1 G;  1EQV A;  4K2K A;  1U4R A;  3BVZ A;  1DXM A;  5LL6 X;  1HQR D;  1STH A;  1PRT F;  4C1N K;  3TP5 A;  1TWC B;  1HA5 A;  1ZYR D;  2Z1C A;  2C9O A;  5EGT A;  3GTP B;  5FO9 B;  2WAC A;  2JA7 B;  4GZY C;  2KQ3 A;  2L12 A;  5AFW A;  2CVR A;  2KEE A;  2JEA I;  3BG3 A;  2NZ1 D;  2O5J C;  1SNP A;  1I4X A;  3I4N B;  3AU7 A;  1VDZ A;  1EY7 A;  1O7L A;  2RVL A;  3IFD A;  3H91 A;  3J80 L;  3I8Z A;  1FNW A;  3SXH A;  2I46 A;  4K14 A;  3KLR A;  4BA2 I;  3CU7 A;  3GTG B;  4A3F B;  3KF8 A;  2JA6 B;  1EEF D;  2EY6 A;  1TII D;  3SHL A;  3HOV B;  3LWU A;  4B9W A;  3DEP A;  2WAQ B;  5FKA C;  3HOZ B;  5EKI A;  3BDC A;  4A3K B;  3JAM L;  3SVM A;  4KY5 A;  2KOL A;  3VR3 A;  4O42 A;  1LV9 A;  3JAM E;  1NUC A;  2L1B A;  5LHY 1;  1EYC A;  1ENA A;  4CBV A;  1ZKO A;  4KN4 C;  2TMP A;  1YNN C;  2JA5 B;  3FRP B;  3QIA A;  2B2V C;  1LTR D;  1IW7 D;  2K05 A;  3GV6 A;  1E2Z A;  4DU9 A;  1RTO A;  3DXJ C;  1IYU A;  5FLX L;  4HED A;  1PYW D;  2PMZ B;  4G57 A;  2F3W A;  1WTV A;  5FLX E;  5A2Q L;  1JCK B;  4WOR A;  4BBS B;  1LAC A;  5JEA H;  5A2Q E;  4KN7 C;  2SDF A;  4NKL A;  4IUN A;  1IW7 C;  1ET9 A;  2WV6 D;  4YIJ A;  3J7A V;  5KIX A;  1GUO A;  5CBA E;  1PFM A;  3OMC A;  3SK4 A;  2EYM A;  3ND8 A;  1WTX A;  3HOW B;  3S14 B;  4FVM A;  1BQQ T;  1I3Q B;  1R4Q B;  1HFN A;  5KYL A;  3KBX A;  1SSO A;  3BZD B;  1PZK D;  1G2T A;  2VB2 X;  3U9O A;  3NBI A;  1H9J A;  4L8J A;  3K7A B;  4ODG A;  4FXD A;  2FMC A;  2LS0 1;  3FKI B;  4KD3 A;  1XYI A;  2L9H A;  2HCI A;  4UDU C;  4R9W A;  5KGU A;  1LTT D;  2BA0 A;  2HCC A;  2Z8L A;  1R4P B;  5EJW A;  1A3T A;  2EE1 A;  1I50 B;  3R2I A;  3EFX D;  4K5X A;  4CJ2 C;  2A5H A;  2BDO A;  4OIK A;  5DEH A;  3LX0 A;  2QKI C;  2DN8 A;  1EOT A;  1QG7 A;  5D3I B;  3C1F A;  4IUP A;  1AFP A;  1HUM A;  1MSG A;  1JWS D;  3K5L A;  4WFN 3;  4MN3 A;  3SE0 A;  3ND9 A;  2A68 C;  1SEB D;  3K0Y A;  3MC0 B;  5ISR A;  4ILW A;  4QUF A;  3I4L A;  2B63 B;  2AWO A;  4F88 A;  3URY A;  2CHB D;  4FP5 D;  3Q6S A;  4MIU A;  2EYP A;  2F0M A;  2ENB A;  3GTL B;  4DN4 M;  3MVV A;  1B50 A;  1SJH D;  3SDZ A;  4XIG S;  4ZRZ A;  5EBC A;  1H9K A;  4DNR B;  2HDL A;  1BF4 A;  2PQE A;  1CI3 M;  2L4N A;  2PZU A;  1DYQ A;  5CV7 A;  4A3B B;  1I4H A;  4PNY A;  1LTI D;  5KYI A;  2F0L A;  2PCF B;  5A35 A;  1EY4 A;  2OF1 A;  2ZXP A;  2FIN B;  2A73 B;  3BS1 A;  5M3M B;  2SOB A;  1SNQ A;  4B9X A;  1JQY D;  5ELB A;  5EPJ A;  2PW5 A;  1ESR A;  5EKK A;  3Q24 A;  4ZAI A;  3CKI B;  1EL0 A;  1XXG A;  1CHP D;  4RA8 A;  2O4X A;  3G6J B;  4RAU C;  1LT3 D;  1RF2 D;  4EQO A;  4JK1 C;  5ELC A;  4QB4 A;  2DNC A;  2F4I A;  3OOC A;  4PMB A;  1FNV A;  1Y8P B;  2NN6 I;  4XXE A;  4CGY B;  3GO5 A;  1TS3 A;  4LK1 C;  3C1E A;  1G6Z A;  2L0C A;  1IYV A;  2WB1 B;  3NWT A;  2C5C A;  2XRS D;  1F9Q A;  3AMU A;  4BBR B;  3WOE A;  5FOB B;  2K5W A;  4DAV A;  1OXU A;  1PRT D;  1I6H B;  3TP6 A;  1LTG D;  3L3O C;  3QOL A;  4DF7 A;  2EVB A;  2FMM A;  3IFT A;  2Q8T A;  2SNM A;  3EVQ A;  3QWN A;  3DUZ A;  4G7H C;  4WRD A;  2VB3 X;  5JPN C;  1C8C A;  4G7Z C;  1PRT C;  2R93 B;  4A93 B;  1LTB D;  3KBG A;  4OHJ A;  5I9P A;  1JOR A;  3I4M B;  4HSV A;  4KJO A;  2KA7 A;  4HCE A;  2F3V A;  4XQN A;  4J1M A;  1JE4 A;  1FR3 A;  5JEA J;  5IT9 L;  3RZO B;  5K36 H;  2OEO A;  1EY5 A;  3PO3 B;  2F0H A;  2F0D A;  4I65 A;  1NSN S;  2H1E A;  4CKC A;  1EY9 A;  1AZQ A;  1AEX A;  3OIQ A;  4QMG A;  2IX1 A;  2R3Z A;  4ABN A;  1I4P A;  2A74 C;  3NE5 B;  1ZXT A;  2XSC A;  1Y1W B;  2KED A;  1LT5 D;  2KVM A;  1F2Y A;  2VNU D;  3F2U A;  3MXN A;  1RCV D;  2D62 A;  1BOS A;  3OSO A;  4A3G B;  5HGT A;  3H6M A;  4RWS C;  5E4X A;  1SMY C;  5C5L A;  3HP3 A;  5C44 B;  1Q8I A;  5EKL A;  5EPL A;  3T53 B;  4CKB A;  1CA6 A;  3S1M B;  3K59 A;  1D5Z C;  2F0V A;  1GOZ A;  1EIG A;  3NXW A;  1JB3 A;  3HS0 C;  2OT2 A;  4RFB A;  4PMW A;  2K1B A;  1CK1 A;  4HMJ A;  5J1Z A;  1O78 A;  2I07 B;  4A3M B;  5JAV A;  1S5B D;  1O7Y A;  2ID0 A;  3RLF A;  1NCV A;  1TVX A;  3TZU A;  4J8Q A;  4C3H G;  4EGV A;  3D4W A;  4ZUJ A;  4C3H B;  4BA1 I;  4C3J G;  1GJX A;  1NR4 A;  1DOK A;  2K03 A;  4C3J B;  1PMR A;  2BCO A;  2PNR C;  1PDQ A;  4UAI A;  1B9N A;  5BN5 A;  3I70 A;  4WJW A;  3C3L A;  2K5Q A;  1SNC A;  3GV3 A;  2J4X A;  1D1I A;  2RKS A;  1L0Y B;  1VF7 A;  2N88 A;  3OWF A;  5CV9 A;  3LNN A;  1DZ1 A;  2ICE C;  4TSS A;  1EY6 A;  2K04 A;  3MA2 B;  4TRD A;  2B2T C;  1SYE A;  1TKW B;  3A8J E;  1QNU A;  1KDC A;  1Q1B A;  1D1K A;  1HFG A;  2XIW A;  4FO2 A;  1Q90 A;  5KNB A;  1W6K A;  3EA6 A;  4EQN A;  3FVQ A;  4K5W A;  2F0S A;  2Y0S B;  1TS5 A;  2B2U A;  4TKO B;  4KI0 A;  3TP7 A;  1EWH A;  3AB9 A;  3NUC A;  3RUZ A;  1IKL A;  1BCP C;  2B2W A;  4U67 3;  3C2P A;  3QO2 A;  1F2L A;  2BOS A;  5E3F A;  1NR2 A;  1UEA B;  4N9T A;  1LT4 D;  3D4R A;  5K5P A;  3ERO A;  1V1O A;  1MI2 A;  3BVM A;  2TSS A;  2F0I A;  1EY0 A;  5KEE A;  3K58 A;  1U4L A;  4RKB A;  4OO1 H;  3PUY A;  4JBW A;  3T4A C;  4QUC A;  4ZK9 B;  2AQ1 B;  1D5X C;  1QNK A;  1MBY A;  1QB5 D;  1ZYR C;  4KKU A;  1HTL D;  1PTO B;  3H3V C;  1A15 A;  2EYJ A;  1TT2 A;  1HCZ A;  1WVL A;  3MTS A;  1EIH A;  2VXW A;  4XT3 B;  1FYC A;  1RTN A;  4RCO A;  2KCC A;  4FF2 A;  2F0Q A;  5I2Y A;  5I6Y A;  2JXM B;  3MHB A;  1JOQ A;  3A8I E;  1OXT A;  1EU4 A;  2EDG A;  1PFB A;  1EYA A;  1STA A;  1UAP A;  3BDL A;  5M9O A;  5C0X G;  1GUS A;  4A3I B;  4KHZ A;  3VA5 A;  1Y69 U;  4DA2 A;  4A3J B;  3P75 A;  5FO8 B;  3MXG A;  1ROD A;  3M4Y A;  1KLU D;  1LO5 D;  4E6I A;  2IT1 A;  3BYT B;  1HA6 A;  5E1F A;  3V2T A;  3S2H B;  1B44 D;  1AW7 A;  5C4J B;  1C4Q A;  1F2Z A;  3PMF A;  1J9O A;  3KUP A;  4KKT A;  1WTQ A;  2DNE A;  1JOK A;  4Q0F A;  1D2B A;  4Q5V A;  2AWN A;  2KJX A;  3HZX A;  4KMU C;  2A6H D;  2KUM A;  3ZYY X;  1WD0 A;  2NVT B;  1GUT A;  1OXS C;  5KND A;  5TSS A;  1JIC A;  4IUV A;  1VMP A;  1NAP A;  5EQ0 A;  1TWF B;  1CQV A;  4XTC S;  1PXU A;  1TY0 A;  2RQX A;  4EQP A;  3OMG A;  1SE3 A;  4J6H A;  4FYD A;  1RKN A;  3DWA A;  3FEW X;  3PUZ A;  5C3E B;  1RDP D;  1BXT A;  1A3V A;  3X3M A;  1PLF A;  1T5X D;  4HCS A;  4TQU S;  2IPK D;  2R7Z B;  2E76 C;  2PZW A;  3P20 A;  2QF7 A;  1JOO A;  3SR1 A;  4H44 C;  5CV8 A;  1SYG A;  2B2Y C;  1PZJ D;  3FDT A;  2PYK A;  2QDB A;  4M8A A;  2O5I C;  4IFD G;  1Y8N B;  2MHV A;  4FNF A;  4C2M B;  3PV0 A;  4K8J A;  2K6A A;  1KAA A;  3W3A A;  2RDH A;  3K5M A;  1EY8 A;  1HTP A;  1ENF A;  1QIL A;  1SYC A;  4KY7 A;  2PPB C;  2NVQ B;  1U9R A;  4G7O C;  1ESF A;  3QB3 A;  1ET6 A;  4U68 A;  3KK7 A;  2G9D A;  1C48 A;  2IX0 A;  1KLG D;  2BE5 D;  1STB A;  1QOH A;  2F0U A;  2JA8 B;  5JPM C;  1DOM A;  2A6E D;  4BS9 A;  2LKV A;  4K5V A;  4X3S A;  4P2C B;  2R92 B;  2M2L A;  1B53 A;  4IUQ A;  3BVG A;  1PFN A;  3N6R A;  3KLS X;  4IUR A;  2NUC A;  1ZEQ X;  2WKC A;  4IN3 A;  4RKL A;  5COR A;  1F9R A;  3VYT A;  4MHE A;  4RH6 A;  1SYB A;  3VR4 A;  1I4R A;  2AQ2 B;  4IAL A;  1F9P A;  3DWP A;  3X3N A;  3S15 B;  2A6E C;  3P1H A;  3A56 A;  4N9P A;  3MWY W;  1M4V A;  1HHV A;  2F0N A;  4XDX A;  3TDQ A;  1K8M A;  4LJZ C;  4XT1 B;  4RHR A;  2RA4 A;  1KTK A;  4DNT B;  2ZXO A;  1OXV A;  1CA5 A;  1B3A A;  3P7J A;  2F0W A;  3DM1 A;  1STN A;  2O2L D;  3NTI A;  4K8I A;  5C3X A;  2X6L A;  1HXY D;  3PO2 B;  3HOY B;  2EJM A;  2JYO A;  1MD2 D;  1S5E D;  4NP5 A;  2A69 D;  1L0X B;  5KNC A;  1CZW A;  4G4K A;  3HEJ A;  2LFN A;  2E2H B;  1A2T A;  4OO1 I;  2L55 A;  1MGS A;  1GXD C;  3GTQ B;  3U9S A;  2R6G A;  2EYO A;  1TWA B;  2EZV A;  4BY1 B;  1KDB A;  5IOD A;  1ILQ A;  5HUR A;  4ZYS A;  3ONA B;  1S5D D;  1G29 1;  1QE6 A;  1YNJ D;  3I73 A;  2K33 A;  2K5D A;  1QCB D;  4IQZ A;  2MJ8 A;  3PUX A;  1A6X A;  4OIJ A;  2J0T D;  1SND A;  1F77 A;  2B2V A;  5CMD A;  1TWG B;  1SBB B;  3HKZ B;  1RHP A;  4RGM A;  2MPM A;  5D3D A;  3SK6 A;  3O13 A;  1ICW A;  3VYR A;  2XN9 C;  1STG A;  1Q3L A;  1H9S A;  1FD7 D;  4RGT A;  3E0J A;  2R61 A;  2CW0 D;  1KNE A;  2K32 A;  1EWC A;  2RSO A;  1XTC D;  2F0F A;  5CR3 A;  2H4O A;  3I90 A;  3TSS A;  3H0G B;  5DM6 3;  3HOU B;  5ELE A;  2EY1 A;  3NWS A;  3NK9 A;  4H7B A;  4KHV A;  1GHK A;  5DM7 3;  2CW0 C;  1DON A;  4OL7 A;  2WP8 J;  4QF4 A;  4CHT B;  3S1N B;  3VYU A;  3K57 A;  1LTA D;  2JEB I;  3MZ5 A;  1SYF A;  1KNA A;  4FF3 A;  3PUV A;  1SDF A;  3Q23 A;  5DNF A;  1I4G A;  1AZP A;  5BN3 A;  3LWE A;  4DK0 A;  3CRK C;  1M8A A;  2DY7 A;  1F9S A;  2MGS A;  1B4O A;  1SNM A;  2AQ3 B;  1I4Q A;  1STE A;  5JOB A;  3VR5 A;  4KKS A;  3T51 B;  2V4D A;  1B1Z A;  2PW7 A;  3IKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...