3D4WA

Crystal structure of staphylococcal nuclease variant delta+phs a109r at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLRKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4wA00
2F0UA 1IHZA 5NUCA 3D4WA 5IGEA 2KQ3A 4ODGA 2EY6A 4I65A 2QDBA 1NUCA 1SYGA 2WACA 3NQTA 2SNMA 3TP8A 5HGTA 4KD4A 4B9XA 4NMZA 4WRDA 4K2LA 4HTHA 4KTAA 1SYCA 2SNSA 1NSNS 4J1MA 4HMIA 4QB4A 4PNYA 3RUZA 2RKSA 2OXPA 5CV8A 1A3UA 2EYFA 4ZUIA 4B9WA 5M9OA 1JORA 3P1HA 5C3XA 5KGUA 2M00A 3EVQA 4KJNA 3MZ5A 1KDBA 3MEHA 4KHVA 2F0NA 4H7BA 1AEXA 4K14A 3SK5A 4DU9A 2F0TA 1STAA 2F0QA 3D4DA 4K5VA 5J1ZA 4K8IA 3NP8A 3HEJA 4G57A 5DEHA 4EQOA 5E3FA 1A2UA 5F2DA 3H6MA 3OSOA 3TP7A 1F2YA 4K2KA 4K5WA 2PYKA 4TRDA 1EY4A 3ITPA 5CV7A 3QB3A 2F3VA 2PQEA 2PZWA 3NHHA 3P75A 1STNA 5EKKA 2NUCA 1TQOA 3C1FA 3BDCA 3E5SA 4IALA 1II3A 1U9RA 4KY6A 4QF4A 5IGBA 5KEEA 1ENAA 1SNOA 1EY8A 5C4ZA 5C3WA 1SNQA 1SNMA 4F7XA 1SNPA 2OEOA 2EXZA 5IGDA 5IGFA 5I9OA 1EY5A 5EGTA 1TR5A 4S3SA 1STYA 3TP5A 2KHSA 2F0SA 3SK8A 3TP6A 3S9WA 1SNDA 2OF1A 4NDXA 5CV4A 4WORA 5KYIA 1EYDA 1A3VA 2F0EA 3SR1A 3DHQA 2PZUA 1JOOA 3R3OA 4MIUA 3VA5A 1ENCA 1EY6A 1KABA 3OWFA 1A2TA 1EQVA 1SYFA 4LAAA 3SK6A 2F0FA 4R8NA 5E1FA 3TMEA 1EY0A 2PW7A 3EJIA 1RKNA 2PZTA 3QOJA 3NK9A 2F0VA 3OMCA 3D6CA 2EY1A 3V2TA 5EKLA 5IGCA 4NKLA 4EVOA 4KV6A 1KDAA 4ID6A 3SK4A 1SNCA 4ZQ3A 3ERQA 4ZUJA 2O4XA 1EZ6A 5JOBA 5IGGA 4K5XA 2EYHA 2F0KA 4K8JA 1TT2A 2F0PA 1STBA 4NP5A 5JAVA 1EY7A 4YIJA 1STHA 4IZ8A 3MXPA 5I9PA 3DMUA 5KIXA 2ENBA 2F0GA 2F0JA 1EYCA 2F0MA 1A3TA 4DF7A 1EY9A 5I6WA 4DGZA 3NXWA 1SYBA 4KY7A 1F2ZA 4RKLA 4EQPA 4K6DA 2EYMA 2F0WA 2HQEA 3MHBA 5C6AA 3QOLA 5J22A 5J39A 5CR3A 3HZXA 3SXHA 5KYLA 2EYOA 4N9PA 4OL7A 2F0IA 3OMGA 3MVVA 2EYLA 3T13A 4HMJA 1STGA 2LKVA 4EQNA 4F8MA 1F2MA 3C1EA 5IOCA 5CV5A 2RBMA 2F0DA 2RDFA 5I6YA 4J6HA 2F0HA 5C5MA 4N9TA 5HURA 2F0LA 5CV9A 4KJOA 5ISRA 1SYEA 1JOKA 5CGKA 4DFAA 1KDCA 2EY2A 4KD3A 2F3WA 2EYPA 3SHLA 3BDLA 4KY5A 5CV6A 3U9OA 2F0OA 3EROA 5IODA 1KAAA 2EY5A 4E6IA 3LX0A 5C4HA 5K5PA 4ME5A 4RKBA 1JOQA 5IIFA 3T16A 2SOBA 4PMBA 5KRUA 1EYAA 3NUCA 1SYDA 5C5LA 3D8GA 5DAUA 4PMCA 4IUNA 4QMGA 1EZ8A 3PMFA 5CC4A 2PW5A 2EYJA
chains in the Genus database with same CATH superfamily
2N88A 1R9TB 3S17H 4B08A 4OO1I 4R9WA 1NSNS 1QJOA 3FKIH 2QDLA 5IGEA 5C3XA 2ASBA 5IYCH 3MZ5A 4XIGS 4XTCS 3GD7A 1VMPA 4GLXA 1KHIA 5F2DA 1S5FD 2RHSB 2PYKA 2K5WA 3I4MH 3H0GB 3OW7A 1EWHA 3L0OA 3E5SA 4A3DH 1ENAA 1EY8A 2VQFL 1S5DD 4JI3Q 3C46A 3D6WA 2MGSA 4P74A 1FJGL 2F1MA 3M4QA 1QWYA 1YHQA 4OIJA 5L37A 5FO7B 1BQQT 1V8QA 2K5NA 1KAWA 4GKKQ 1KABA 2K4KA 4JI7Q 4CDFC 1EQVA 4B3RQ 3HKZG 4A3BH 1WTQA 3JAML 2RVLA 2YYZA 1PRTD 1NNXA 1ASYA 4DR7Q 4R4CA 2K5HA 4LFCQ 1E2ZA 1AFPA 4NXML 2KEDA 2K01A 3PO2B 2OCEA 1HPCA 1V1OA 1IBMQ 4DF7A 4QGUA 2V4DA 1ML0D 3CRLC 4KY7A 3C2PA 2QKIC 4LF6L 3QOLA 5CR3A 3HZXA 1BNZA 2B8GA 2B2TC 1ILPA 1BO0A 2EYOA 1M1KC 1BBWA 3U4ZA 3T13A 1LTSD 1JQYD 2TSSA 4HR7B 1TWAB 1BCPF 1X9NA 2R93H 1S4ZA 4TQUS 4GN5A 3HOXG 4KKSA 2EYPA 1XNRL 3HKZE 4YWLA 3G6EA 3M4OH 4ZKBB 4LMQD 1XMOQ 2HCCA 4A3GB 2WB1B 3PO3H 1BR9A 4IURA 4XT1B 3GTLB 4HJ5A 3ZJYC 5LMNQ 3RZOB 5C0XH 2EJMA 3UDGA 4X3SA 4ZK9B 3PUZA 2QDBA 2UU9Q 2BA0A 4B3TL 3S1QH 4P71A 1FNUA 1N34Q 1SYCA 1U4PA 1G2SA 4RGMA 2NVTB 2RKSA 1VQCA 4OX9Q 1SXTA 2QW7A 4AH6A 2K50A 4RWSC 3MEHA 4KHVA 2Z8LA 3D4DA 2UUAL 1A2UA 3A7LA 3H91A 3NEMA 3M7NA 4K0KQ 1UUPA 3RN2A 2RSNA 4YHHQ 1OO9B 4LW1A 1H9RA 1Q81C 3VYSA 4DR3L 4A3IG 2Q2IA 5JEAH 1SNMA 3A56A 1G91A 2A69D 3T1YQ 3RLFA 4DV2L 4A3KH 2KHSA 2RDHA 3ND8A 3SK8A 2I5HA 5C4XH 1PXUA 2R7ZH 4HAEA 3LNNA 2ICIA 2R92H 4PV1C 5DM73 3QOJA 4LFAL 2NVYH 1A15A 2ID0A 4DUZL 2OT2A 1KDAA 2AQ1B 1A63A 5G3LD 1QVGA 1SMYD 1SE2A 3HOZB 1TT2A 1S3OA 2CW0C 2K1BA 5I9PA 2CCZA 3S2DB 2F0JA 1X6OA 2O5IC 3K5OA 4A3FB 1B9NA 1DOKA 3S1RH 3R2TA 4EQPA 2PQAB 1DZ1A 3HG9A 1X3QA 2VQFQ 1IBLL 4YCWA 1C4QA 5FK9C 4HMJA 3PF5A 4EQNA 3A8KE 1FJGQ 4A93G 2JA6H 2NZOA 3I4NH 1A0IA 2EQSA 1N36L 1SN8A 1SYEA 1TWFB 1K8AC 1LACA 4N8FA 4GN4B 1EFWA 1L2FA 2JK8A 4BXXH 1YJ9A 2PQAA 3OW2A 2B29A 1TVXA 3QWNA 1SLJA 4L5SA 1PH8A 2KENA 3BYTB 1O78A 3W1GA 5JJLA 4C3IB 1X56A 2GVAA 1VF5C 1SYGA 1Y69U 1UEAB 3CPWA 4HSPA 3MXNA 3TN2A 2NVQH 2WACA 2DNEA 4UY8C 2K75A 2JA8G 1BXTA 2B2UC 1X54A 3VYRA 3U4VA 2E2IH 1XX8A 4HMIA 2FMMA 4LF6Q 4MTNA 3K81C 5M3FB 3K7AH 3KBGA 5H1SE 2B63H 3EVQA 1KDBA 4A3MH 2DGYA 4L5QA 1STAA 1VQIA 3NBIA 1X3EA 3UE0A 4X65L 4BBSG 1AH9A 1BCPB 4BA2I 1ZYRD 3MXGA 2B2VA 1XNRQ 2BE5C 1L0WA 1EWCA 1H9JA 1II3A 1SR3A 2R6GA 2MPMA 3S17B 3I8ZA 1D8LA 2L9HA 4A3LH 5IGFA 3A8JE 1E1OA 3FKIB 3TP6A 1VF7A 4AIMA 1WTOA 4NDXA 3QIAA 1JJCB 5JVG3 3NSWA 4QUFA 1EYDA 3S14B 3DM1A 1ENCA 4F87A 4B3TQ 1HUMA 3CRKC 3DWPA 3GTOH 1GHJA 1PTOC 2Z0SA 3PQIA 4C2MH 1V43A 2KECA 2JA5G 4EVOA 3I4MB 1OXXK 4A3DB 1HNZL 5EJWA 1I5FA 2EYHA 3OWEB 4DAPA 1HZ9A 2CH4W 5KNDA 4JI4L 3K7UC 3MXPA 4NW2A 4YCVA 4L5TA 4LUZA 4K6DA 3AMUA 4BY7H 5IT9c 3NELA 4DR3Q 2BDNA 3EBEA 5JJKA 3R8BA 5M3MG 3HGBA 4A3BB 2VXWA 4DV2Q 3BG3A 1HR0L 5EKIA 2XVSA 1NMGA 1CHPD 2ZT9C 1GUGA 4KJOA 4OXPA 4A3JG 1CSQA 3U9OA 2F0OA 5IODA 2AUKA 1HTPA 4ME5A 1PH6A 4RKBA 4LFAQ 3JAME 3HOUB 3BZDB 2SOBA 1KLUD 1VCIA 5C44G 4DUZQ 1LTAD 3GV6A 4GLAC 3KJPA 2AWNA 1HQMC 1EZ8A 1PVOA 1IW7C 4ZRZA 3ERQA 4ILWA 2K7VA 2EY6A 3TP8A 5GAHC 1H9SB 4A3CH 4X62L 2WIIB 4HTHA 2R93B 1ZXTA 3OTOL 2EE1A 4PNYA 3RZDH 5CV8A 1IKMA 3M4OB 4R4IA 3L7ZC 1IBLQ 2CH4A 1JE5A 3PO3B 4GNXC 4CHTB 1TXYA 1S5ED 3NENA 4G57A 1PFNA 3H6MA 1F2YA 3DEPA 4CGYB 4JBKA 1EU4A 1H9SA 5CV7A 4YWMA 5EKKA 2PI2E 1TQOA 1Y14B 2WAQG 1ZEQX 1CQFA 2ZXOA 3S1QB 3GTKH 2G5DA 2KCMA 5I9OA 1STYA 1CA5A 1PHJA 4HIDA 2RA4A 1E2WA 2UUBL 4XT3B 1S40A 1IBKL 1B53A 4ZYSA 2OWOA 2UXBL 3H09A 4DV1L 1NY4A 5IT9L 1PH5A 4OO1G 2EY1A 1HZCA 3E6ZX 3NTHA 4NKLA 1UWVA 1EIFA 2RHQB 1FGBD 3GP7A 1KRSA 3LWEA 3VR2A 1ESRA 3K6OA 1FVIA 1OXUA 1WCMH 2NBFA 4WJWA 4X65Q 2N49A 1EYCA 5C4XB 2R7ZB 2WAQE 2JEAI 3NXWA 2Z6KC 2PMZB 1KD1C 2ALYB 3RN5A 2R92B 1D5MC 3G48A 1Q82C 4C3JG 4P2CB 3WDNA 2L5TA 5IYDG 1STGA 1BVSA 2NVYB 3C1EA 2XRSD 5CV5A 4R4OA 3HOWG 5I6YA 3I91A 2Q8TA 2YTXA 1WJJA 2B2YC 3BVGA 1D1KA 1WFQA 5ELEA 1KAAA 1EQQA 3HOXH 3MFGA 1SYDA 3S1RB 1O7IA 3RLNA 1YNNC 1HNWL 1JWSD 2JEBI 1DONA 4JI4Q 4LF5L 4GKJL 3DM3A 3NQTA 2JA6B 4A3EH 4B9XA 3I4NB 2K33A 1IYVA 1C8CA 1T5EA 1FGUA 3GTGB 4B9WA 3FMCA 3S1MH 1VQMA 3S16H 3SK5A 1AEXA 4DU9A 1Q7YC 1XPUA 2F0TA 1SRUA 2F0QA 4BBRH 4JI5L 4KLKA 3J80c 1QVFA 1QNUA 3OSOA 3AB9A 4DXFA 1EQRA 1VQ8A 4R4TA 1I50H 1T9HA 4WJ3M 4FYDA 4DNTB 3CMAA 2Q2HA 4M1UB 4KY6A 2NVQB 1WTXA 1G8ZD 1FYCA 1RIPA 2VW9A 1C48A 1SNQA 4DA2A 2E2IB 4FXDA 1N32L 3RD4A 1ET9A 3K7AB 1D7QA 3Q24A 3L2PA 1K3BC 3SR1A 4A3MB 1PRTF 2DJFC 3L9AX 4O42A 3CC4A 1SYFA 4X62Q 3TMEA 4V190 1W6KA 2ZXPA 3EJIA 2ZJRA 4M8AA 3OTOQ 3G6JB 5KNCA 1EL0A 3G4SA 3K59A 1MSHA 4XXEA 2WP8J 1B7YB 3AYHB 4FVMA 4RG1A 1STHA 3F2CA 2K5DA 1U5KA 3BVMA 2F0GA 3IL8A 5I6WA 1LTID 2FXQA 4FDBA 1MJEA 4ZAIA 1UNSA 1P8LA 4ZCKA 3MHBA 3ULPA 2FINB 2G9DA 1Y1VB 4C3HG 3GTOB 3JC66 4C2MB 1ONLA 2B39A 1F2MA 2D0OA 4YY3L 2LS01 2UUBQ 1ILQA 1IBKQ 4Z9CB 3KLRA 2Q2TA 1X3GA 4IQZA 3W5OA 3VYUA 1JWMD 4GOPC 4HIKA 5CV6A 1H95A 2UXBQ 1MSGA 3K80C 4E6IA 4DV1Q 3TDQA 1K28A 1RTNA 1VQPA 1RF2D 4RGOS 3JAMc 1YJWA 4KN4C 4BY7B 2E5LL 1DD2A 3PMFA 5CC4A 4I7AA 3FPUB 2PPBC 1HCZA 2VNUD 3CPFA 3J80L 2NN6I 3HKSA 1NUCA 3KFUA 2EZVA 3NQIA 4HJ8A 2MUYA 1LTRD 1AP0A 4KTAA 2SNSA 3F2UA 2XIWA 2NYZD 3W1BA 1BUVT 1JORA 1TIID 4I7ZC 5E4XA 2QEXA 2JA8H 1F9QA 4K14A 4H44C 1EIHA 3X3NA 1XTCD 3VYTA 1GUNA 1DYQA 3BJUA 3VR3A 4LF7Q 3U50C 2PCFB 4IUTA 3FVQA 1STNA 3J81c 1VQ5A 1CSPA 1RHPA 4BBSH 1Z6HA 1SNOA 5GQOA 5C4ZA 3MAQA 2BOSA 1VQDA 4CBVA 4JG2A 3ULLA 2WKDA 5M5XH 3TP5A 3S9WA 2A68D 1VQOA 4JI6L 1UE7A 1B9MA 1SE3A 3T53B 1GUSA 4LF5Q 1IKLA 2J0TD 4GKJQ 4IFDJ 1B70B 3F8TA 3TSSA 4JI0Q 4R8NA 3M85A 3VR5A 1LTGD 1R4PB 3NK9A 1SE4A 3U9SA 4KV6A 1PRTC 5FLMG 3NTKA 1SFOH 3GTKB 4K8JA 4JI5Q 2E2DC 2ZTEA 4EX5A 4IZ8A 1VQ7A 1SJED 1I94L 5M5YH 3BS1A 2BDOA 3K58A 3FEWX 3H94A 5IWAL 2K5QA 2Z4IA 2ZM6L 3MA2B 2C35B 2HDMA 5D3IB 3TREA 2X6LA 5LL6S 4EGVA 1WTVA 2EYLA 5ELBA 5C3EG 3CMEA 1N32Q 2R3ZA 4IPHA 1WVLA 3S2HH 2F0DA 3TS2A 4PG3A 4J6HA 4K6LA 3K0XA 3HKZB 5M3MH 1DOLA 1LT3D 1CQVA 1EU3A 3CU7A 3CW2C 4DV5Q 3EN2A 1WCMB 4JPBW 4J8QA 3I55A 1C0AA 2D0PA 3PUWA 4YCUA 1QZHA 1PDQA 4X66L 5KRUA 4A3JH 5IT9E 4L5RC 1YHAA 3D8GA 3Q22A 2XTIA 2PW5A 2R7FA 5NUCA 3EFXD 1RCVD 4I65A 2BH2A 1O7YA 3PUVA 1LV9A 4WRDA 3TZUA 3KYHC 1TY2A 3J81L 1Q90A 3GTPH 5BN5A 3OIPA 5EPLA 4Y7NH 1DGSA 2QCPX 2M00A 2QILA 2F0NA 3M7GA 4QIWB 4LF8L 1V1PB 4YY3Q 4ZLTF 3F1ZA 3O13A 1GM5A 3HOXB 4MN3A 1JCKB 1PLFA 4R1JA 1KXLA 5DEHA 1PH1A 1BOSA 5K36G 1X32A 2F3VA 4UHVA 2UXCQ 3NHHA 1HRJA 1RDPD 2WB1G 4A3EB 4BWGB 4DXGA 5E7NA 1PA6A 1FL0A 2QGQA 1Z47A 3C3LA 2OEOA 5IGDA 4IJHA 5EGTA 2E5LQ 2R61A 1SNDA 3S1MB 4BY1G 3CCSA 3S16B 2JJQA 2A69C 4L8JA 4BBRB 4HJ7A 3SK6A 4X6AH 2PW7A 3NTIA 1I50B 3OMCA 2HHHL 2E76C 3TZDA 4ID6A 1N33L 3ONAB 2KVMA 1EFID 3BVZA 4DAVA 2F0KA 2HQLA 5LMNW 1Q8KA 1STBA 4CJ2C 1PTOF 1JB7A 4XQNA 3HS0C 2ENBA 3HRZC 4LF4L 1L0YB 1SMYC 2KCNA 2WB1E 2LSSA 5FLXc 4OIKA 2LXKA 3CQZH 3MXUA 1NBWA 5LL6X 4MZ9A 3AQQA 2QEJC 2RDFA 2CVRA 1GXDC 1ENFA 4C3JH 1HH2P 1LT5D 1E0BA 4DFAA 1QCBD 3SHLA 1TY0A 1AN8A 4DV6L 2O5JC 3HOWH 3JAMi 2EY5A 4LFBL 4PMBA 2JE6I 4RH6A 2HIXA 4OWWB 4WFN3 3K8AA 2GVBA 4IUNA 2EXDA 3E3XA 1Y1WB 3HOZG 3LWUA 4IPDA 1B50A 3J7AF 4CJ1B 1SDFA 2SNMA 3MC0B 2A19A 5T1GA 1J9OA 1I94Q 5M5WH 1I4XA 1OXSC 1XWEA 4ZKCB 5IWAQ 1IZ6A 1CA6A 3RUZA 1A3UA 4G7ZC 4PZ8A 4RGTA 4RHSA 1TS4A 2VZAA 4DR6L 3STBD 4DR1L 4JV5L 4OHJA 1JJ2A 3NBHB 4AQYL 2IHEA 1QZGA 1W2BA 5IP9G 2B2VC 3CCVA 3TEHB 4NXMQ 2NB0A 3P75A 2RCFA 2KJXA 1ICFB 5KEEA 1N8RC 5IGBA 3A5ZB 4X66Q 1ZYRC 3AFQA 1T5XD 1XMQL 4Y52H 1WD0A 5A2QL 3D0FA 1CUKA 4XQJA 2D2CC 3PV0A 2L55A 4TSSA 2JA8B 3NBHA 1G291 1XNQL 4IFDG 1VMCA 3J80E 4DV0L 1A8VA 2ZJPA 1C7YA 5FLXL 1KNAA 1HFGA 3HOYH 3CXCA 4BBSB 1H9KA 5CYUA 4LF8Q 1BCPD 4AYBG 4B3ML 5JAVA 5M5XB 5KIXA 4FF4A 3SEBA 1A62A 1B1ZA 3CC2A 3HFZB 1WYDA 2HQEA 2KOLA 3RMHA 2QF7A 1K8MA 1NR2A 4HEDA 3FKIG 1P16A 4IUQA 4OGQC 4ABNA 5GROA 4DV3L 3FDTA 3ZYYX 2LFNA 3QR8A 2F0HA 1M8AA 2B2UA 1F77A 3IFDA 5DNFA 4C3HH 2MP1A 2I0QA 5CGKA 2O2LD 3K5NA 1SFOB 2UUAQ 3H3VI 5J3BA 1VQHA 1VQ4A 3BZCA 1F9PA 1B3AA 1VQGA 2MO0A 5M5YB 4NPSA 2OQ0A 5C5LA 1D5XC 1N33Q 1ESFA 2IHFA 1HZAA 2XRQD 4O1NA 3UE1A 4AYBE 2EYJA 3KK7A 1NR4A 2IT1A 3MTSA 4LF4Q 1D1IA 3S2HB 1TS5A 2V1CC 2E74C 1IXRA 4G4KA 3PIO3 5KGUA 3CCMA 4X3TA 2M2LA 1K9MC 2MJ8A 3E9IA 5FOBB 4A3JB 3KLSX 3MEFA 3HEJA 4ULLA 2DY7A 3TP7A 1QUQB 1QE6A 3F2DA 1SEBD 1JMCA 1EY4A 4DV6Q 2KA7A 2EJGC 3HOUG 2FFKB 1FR3A 3ER0A 4OWTB 4JBJA 3GTPB 5EBDA 1KRTA 4WORA 2VB3X 5FO8B 2XNAC 4NXNL 4KHPL 2A73B 1NCVA 3TQYA 3R3OA 1QUQA 3URYA 3OWFA 3KF8B 4DKAC 1O7ZA 4LAAA 2NN6G 5E1FA 4YWKA 5I2YA 1N36Q 2PZTA 1PH9A 4DR2L 1MGSA 3GTQH 3J81E 4RHRA 4UDUC 4DR6Q 2G9HD 2Z4HA 3PO3G 3NWSA 2JA7G 4JV5Q 3GV3A 4JC0A 1Y8PB 3HOVG 3GTJH 4AQYQ 1MIUA 1X3PA 1PFMA 3UDFA 2WAQB 1EY9A 3CP0A 2D9UA 3KF8A 5FLMH 1GO3E 4ME3A 5J39A 1IYUA 4GNXB 5IYBG 1XMQQ 3F2BA 3UDIA 4IOCA 5ELNA 4DUYL 2F52A 4TVAB 2KCTA 2I46A 1EIGA 1IL2A 1S5BD 1HTLD 1XNQQ 1H9MA 4DV0Q 5IP7G 4KY5A 3VR4A 5C3EH 3K0YA 2AUJD 5EAYA 5AFWA 5C4JH 2DY8A 4A3KB 2YTYA 2IX1A 3DXJC 5BN3A 3U58A 2ZXRA 4GNXA 2Y0SB 3CQZB 4A4IA 1DOMA 4QY7A 1LLRD 3PUYA 5JEAG 5BR8L 4KI0A 3W2DA 4LF9L 1CTMA 4KD4A 2FHTA 1VQ9A 4CJ0B 1CZGA 5BN4A 2K03A 2R92G 1F9RA 1I4HA 1YHBA 5M9OA 1MJCA 5JPNC 4H02A 3HOWB 4KHZA 3DEOA 4KJNA 4DR4L 1Q1EA 4H7BA 4KKTA 4IN3A 2RSOA 1HNZQ 1W3SA 4QJFA 2CKZB 2KHJA 1PZJD 2CQAA 3V05A 3J7AV 3CF5A 2K05A 1ET6A 5C3WA 4U673 3CCRA 5M5WB 3S24A 5FKAC 4F7XA 1YITA 4LJZC 1CKNB 4OWXB 2PNRC 1TR5A 4S3SA 3M9BA 2F0SA 3CCLA 4EQ5A 1UAPA 3E0JA 4JI2L 2XSCA 1JOOA 2RQXA 2JA6G 4L63B 1JB3A 2XN9C 1HR0Q 2PMZE 1DJRD 2MO1A 3OOCA 4F88A 4BY1H 5IE8A 4OELB 3CCUA 2A74C 2F0VA 2DNCA 1YNXA 4DK1A 2X69A 1Q46A 3OIQA 3TRZA 4BXXG 1GUOA 5IGGA 3LGJA 3I7FA 3WOEA 1VDZA 1U4MA 2B2YA 2IJ0A 2L1BA 4A3IH 2HUGA 2WINB 2B63B 2EJFC 4X3UA 1L1OB 1F2LA 5KYLA 1HNXL 2PO4A 3FPPA 2H4OA 5A2QE 3ND9A 2E75C 4JI7L 2BH8A 4LUVA 1LT6D 4LWCA 4NXNQ 4KHPQ 3HOYB 4A3MG 1Q12A 2EPBA 2JQOA 1TWHH 1KDCA 2L4NA 3BYYB 3G71A 2A6HD 2A8VA 1XPOA 2WFWA 1L1OA 5IIFA 5FLXE 4DR2Q 1K0RA 2RF4A 1SJHD 4JOIC 5DM63 4P75A 3R93A 2A1AA 2ICEC 2KQ3A 3NPPA 4ODGA 1UE5A 4LK1C 2SEBD 2TMPA 4C3HB 4OONA 3S1NH 4RAUC 1Y1VG 1AW7A 1DXMA 4A93H 3P1HA 1EEFD 1I3QH 3EQLC 3GTMH 1HQRD 1LTBD 1I4PA 4DV4L 2DJGC 2NVXH 1FNWA 1XMOL 3BDOA 4HIOA 4FP5D 4TRDA 3CD6A 4DAYB 2VUMG 3NE5B 2PZWA 1SMXA 3KDFB 1YNJD 4C56C 4HSVA 4QF4A 1UEBA 3B6YA 5IP9H 4DAMA 1G51A 2CFMA 3WWVA 1O80A 2L12A 2JSOA 1EUJA 3DHQA 4LF9Q 5C0XI 4DAYA 3KLSA 2A68C 4L6TB 3UDXA 2DN8A 5HGQA 1VQKA 1EY0A 3KDFA 1HHVA 1WOCA 3D6CA 5EKLA 4IFDH 1JE4A 2ES2A 4DR4Q 4ZQ3A 3SE0A 4K0KL 4K5XA 2JXMB 4IUUA 1EY7A 2A6ED 4IOAA 2B8FA 3RZDB 1LO5D 1K73C 3T1HL 1TU2B 1A3TA 1HZBA 1HNWQ 3SVMA 3M4PA 1XXGA 4JI8L 1PH2A 2ZTCA 3Q6SA 3W3AA 2OTJA 4DK0A 1F9SA 3SXHA 2I5MX 2VY3A 5G3LF 1I4RA 3GTQB 1UE6A 1EIYB 4TKOB 2F0LA 2EOTA 2JYOA 4JI2Q 1MHWC 2J4XA 1I6HH 1KIXA 2CHBD 1QOHA 4H13C 2GN5A 3GTJB 1YZ6A 2B2WA 2Z1CA 3Q23A 2JA5H 3EROA 1ZKOA 1VQEA 3HP3A 3S14H 1N9WA 1TWCH 4IPGA 1WD1A 3H0GG 3A7AB 1Y8OB 3IRBA 5COYA 5DAUA 4QMGA 3E9HA 5D3DA 3D4WA 3R2IA 2KEEA 2RCNA 1PTOH 1YI2A 2IX3A 3I4OA 5AJ3L 1STEA 2SDFA 4J1MA 3H3VC 3DWAA 2NWGA 1I4QA 5C3EB 1PRTB 4G7HC 5FJ8G 5C4JB 1HNXQ 1YEZA 1HA6A 3CCEA 4XDXA 3M3YH 3PIPA 4K5VA 4K8IA 2HCIA 5E3FA 1E3PA 1OXTA 2AMCB 4LNQA 1CT1D 4FF2A 3PO2G 2VS1A 1WCMG 2EDGA 5C44H 1WTRA 1G6PA 1CZWA 1U9RA 3AEVA 3KF6B 3I70A 2NTTA 1SNPA 3D31A 1JWUD 1QB5D 4RCOA 3HOUH 1GD7A 5KYIA 2R7DA 1C9OA 2F0EA 3PCOB 4GLVB 5D65A 3J80i 4ALPA 3NWTA 1NMFA 2KCCA 4R4QA 4FF3A 4U68A 2F0FA 2JP1A 1RKNA 1RODA 2H5XA 4C1NI 1D5ZC 4V0BA 1O7LA 3KF6A 1AZPA 4A3GG 1Z7TA 5IGCA 3WOFA 1AE3A 2NN6H 1TWGH 1QILA 5LHY1 4B3SL 4JI1L 1SROA 1JC7A 2LY7A 1VQAA 4DNRB 3KJOA 3MFYA 4DV4Q 1VQNA 3DMUA 1V1PA 2CWPA 2KHIA 2JA7H 1RD9D 4UP9A 1PYWD 3HOVH 2CQOA 1BF4A 1Z9FA 3P7JA 2F4VL 1VQJA 1E1TA 4A3EG 2JN4A 4X3KA 3Q0AA 4BY1B 2F0IA 2B2TA 1NJIC 1RTOA 4F8MA 2HD3A 3D4RA 1WI5A 1E24A 1ASZA 4N9TA 1KQSA 1K8OA 2KUMA 5IYBH 1FNVA 4BBRG 4OO1H 3I2ZA 3CCQA 4CDDC 5C0XJ 1OTCA 4PZ7A 1GUWA 3I72A 3V96A 4A3IB 3RNUA 4QIWE 2YTVA 5IP7H 3T4AC 5HY6A 3FP9A 1K8GA 2MNAA 5KNBA 2E8GA 3KBXA 5I2XA 3T1HQ 5HGTA 2YU9H 4RMFA 4NMZA 4P73A 4JI6Q 4K2LA 1BBXC 1SAPA 4JI8Q 4O0AA 1GKHA 4FF1A 2AHOB 1TWHB 4ZUIA 3A5UA 1PMRA 5IYDH 2FJ2A 5IY0A 2CWAA 3FHWA 2N8NA 2K04A 1BKBA 5J1ZA 3I3CA 1K3RA 4RA8A 4HIMA 4KKUA 1Q8IA 3STBC 5JEAJ 3QB3A 2PQEA 3EA6A 3S15H 2ATWA 3C1FA 2FMCA 4DNIA 1EWIA 1E22A 4A3FG 4CKEA 1M90C 3T51B 3ICEA 1K83H 5JJZA 3S1NB 2ZM6Q 1Y1WG 1EOVA 4A93B 2OF1A 2L11A 1I3QB 4QUCA 5CV4A 3GTMB 5CBAE 2WV6D 4C1NK 1PV4A 4MIUA 1WTWA 5TSSA 4DK3C 2NVXB 5AJ3Q 3J81i 5E4WC 4RGNA 3ULJA 4IUPA 2CW0D 3A8IE 5CBEE 2MHVA 3K5LA 3MXNB 4J15A 3I90A 5JOBA 2E2HH 3GTGH 1YIJA 2F0PA 1D2BA 1LTTD 1SSOA 4C3IG 3H15A 1YVCA 1Y8NB 3SGIA 4APVA 1EQTA 1VQLA 1VQ6A 1BCPC 1M4VA 1TS2A 1F2ZA 4RKLA 2E2JH 1CFMA 1CHQD 2D5DA 5D14A 3MVVA 5M3FG 1E2VA 2RDGA 1EEID 4A75A 4JYAL 3CKIB 4GS3A 2XWBB 5ISRA 1JOKA 3PSIA 2Z9HA 4UP8A 3BDLA 1JJGA 1LTLA 4FXKC 4N8X1 3LX0A 1B3QA 3DWQA 1JOQA 4GN3B 1CKMA 3NUCA 4DV7L 1AE2A 4O2DA 4CDCC 4AYBB 1WTPA 4B3SQ 1FD7D 4PMCA 1HUNA 3OYYA 3PUXA 4JI1Q 1PFBA 1X55A 3L3OC 2F0UA 1IHZA 2UXDL 1GJXA 1W6JA 4CKBA 4A76A 3PGZA 3VDYA 3GO5A 5IYCG 3CC7A 1I6HB 5LMUL 1J6QA 2F4VQ 3DUZA 2OXPA 1V9PA 3QO2A 4DPGA 2JA5B 4KK7A 4DR5L 5EPJA 1SE8A 4HCSA 4JVZA 4KMUC 3DLLA 1DM0B 2I5LX 3VA7A 2HT1A 1TWCB 2BE5D 3VR6A 2HHHQ 1D6EC 1Y1VH 3I4MG 1ICWA 4PMWA 4EQOA 4A3DG 4K2KA 2BA1A 2HDLA 4QL5A 1S72A 5FO9B 3BDCA 1PTOB 4CDEC 4IALA 2UUCL 4IJLA 2VUMH 4P72A 1WTHA 5M3MB 1B2TA 3GQBA 1PYSB 1E7ZA 1PTOD 4A3BG 2XWJB 2PZUA 4JBMA 3CHBD 1J5EL 3M3YB 3RR5A 1PH4A 1I4GA 1A2TA 4FO2A 4QCLA 1K0SA 2K32A 3G7LA 4X64L 2B3GA 1U4RA 5C44B 4UP7A 3RLOA 1SNCA 3EIVA 2O4XA 5GAEC 3K5MA 2GA4B 4LFBQ 4WJ4A 3IFTA 3TBIB 1EYGA 3BU2A 2VL6A 2VQEL 4Y7NB 4UPAA 2DUDA 3UI2A 4DGZA 4XYOA 3T56B 2EYMA 2F0WA 3A0JA 2PI2A 2R93G 2L15A 4OL7A 3OMGA 1QVCA 1R9TH 1X65A 2LKVA 2RBMA 4IO9A 4RCNA 5HURA 1TWGB 4DR1Q 4BA1I 1LABA 3SDZA 1VS0A 2F03A 1KNEA 5C0XG 5K5PA 1IW7D 1AZQA 2JA7B 2LMCB 1GHKA 1LT4D 3HOVB 2F3IA 3QG1A 2N3SA 3H0GH 5DLQE 4R8IA 2QA4A 1V1QA 4QB4A 1L0XB 2VB2X 2HIVA 1GOZA 2H1EA 2MQHA 3PF4A 4FXGC 4JCVE 3NP8A 1YJNA 4MHEA 4POFA 1NE3A 4JYAQ 4QQBX 1UE1A 5FJ8H 4K5WA 2ZTDA 1G6ZA 3KUPA 4B3MQ 4A3KG 1QG7A 1KC8C 5C4XG 3D3RA 1PH7A 3FRPB 3ERSX 1VQBA 5I4DA 2YU9B 3P20A 2R7ZG 1RL2A 4XYQA 4DV7Q 3PO2H 1R4QB 2EXZA 4C3JB 4IPCA 2Y0SG 5ELDA 3H3VH 1HFNA 2UXDQ 5ELOA 3MWYW 2K14A 2IL8A 1IYJB 3VA5A 4DV3Q 3AFPA 4HCEA 1G2TA 5LMUQ 1LUZA 4IUVA 2EVBA 3E0EA 4JBWA 3I56A 4KN7C 1KL9A 4POGA 3IKJA 1TWAH 3S15B 2Q8IB 4DR5Q 3CAMA 1DCZA 4LF7L 1JR0D 5CMDA 3A55A 1XPRA 5K36H 3GDEA 1LM0A 4A3GH 1JICA 2AWOA 4YIJA 5JVH3 1K83B 2F0MA 1CK1A 4G7OC 3BZKA 1MBYA 2KBNA 3GTLH 2AQ3B 1J8IA 1BBUA 3RZOH 2UUCQ 2Z6KA 5J22A 3I4NG 1XYIA 3KLWA 4FNFA 1CM9A 4IFDI 2K6AA 4N9PA 2Y0SE 1OXVA 4HJAA 2LXJA 1PYBA 1LYLA 3OPOA 5ELFA 4H0LC 2C5CA 5C5MA 4JI0L 2XGTA 5GADC 1CKNA 1J5EQ 2NVTH 2IY5B 2E2HB 5T1IA 1Q3LA 2NZ1D 4KD3A 4RFBA 3I4LA 3KOJA 5JPMC 2N78A 1L1OC 3I73A 2K5VA 5C4HA 1NAPA 4MNOA 1B8AA 1YNND 3J7ZC 1PZID 3PIP3 1HJPA 1EYAA 2A6HC 2M9VA 4X64Q 4JI3L 2E2JB 1KLGD 1PFSA 2Q8RE 1QNKA 2EIFA 1IL8A 2BCOA 4GKKL 1PZKD 2VQEQ 3K57A 2B63G 4LUOA 5JJIA 4B3RL 3X3MA 1XJVA 3J81j 2D62A 1HR0W 3J7A5 1XTDA 2EYFA 4DR7L 3PIOA 5EPKA 4HJ9A 2YV5A 3Q8DA 4LFCL 3AU7A 1GVPA 3M4YA 2OTLA 4NB3A 5EQ0A 4DV5L 4XQQA 3HOYG 1HA5A 2IWHA 1IBML 4A3LG 3ITPA 1PH3A 2JA9A 2NTSA 1BDOA 1VQFA 2NUCA 4DN4M 5GAGC 1I6VC 3HOZH 2N55A 4GZYC 2IX0A 1EY5A 3S2DH 4Q0FA 1YNJC 2WKCA 2F4IA 1YBYA 4CKCA 4A3FH 2IPKD 3OHXC 1EOTA 1A3VA 5EBCA 2K52A 5A35A 1CI3M 1EY6A 4HN7A 4DUYQ 1Y1WH 2P5ZX 1MD2D 1MKHA 3N6RA 3V2TA 5CORA 4Q5VA 4MTKA 3TS0A 1U0LA 2C9OA 2PNHA 4JW0A 3SK4A 1CKOA 5LMNL 4BS9A 4ZUJA 1EZ6A 2ZJQA 2AQ2B 1TWFH 2IW3A 2VUMB 2UXCL 4NP5A 2X6GA 4BY7G 3A74A 4UAIA 2UU9L 3IAYA 1MI2A 3N52A 4GOPB 1N34L 5BR8Q 2NZHA 1SYBA 2I07B 1A6XA 2Q2UA 2A6EC 5C6AA 4OX9L 4JOIA 4C3IH 1KTKA 1Q86C 1TKWB 1GUTA 2MFIA 1S5CD 5IOCA 5ELCA 1B4OA 5CV9A 1SBBB 3CCJA 1HXYD 1NTGA 2EY2A 1B44D 2B2WC 2F3WA 2A5HA 1TS3A 5M3FH 4YHHL 3QJYA 4GOPA 1JT8A 2Z6BA 2OQKA 2AKWB 2L0CA 3A54A 4PQXA 3J7YW 1U4LA 3T16A 4OEMB 4PZ6A 4DK6C 3T1YL 4JK1C 1Q1BA 2J7ZA 2K28A 4A3CG 1X3FA 1RJTA
chains in the Genus database with same CATH topology
2N88A 1R9TB 4B08A 4OO1I 4R9WA 1NSNS 1QJOA 5IGEA 5C3XA 3MZ5A 4XIGS 4XTCS 3GD7A 1VMPA 5F2DA 1S5FD 2PYKA 2K5WA 3H0GB 3OW7A 1EWHA 3E5SA 1ENAA 1EY8A 1S5DD 3C46A 3D6WA 2MGSA 2F1MA 1QWYA 4OIJA 5FO7B 1BQQT 1V8QA 1KABA 1EQVA 1WTQA 3JAML 2RVLA 2YYZA 1PRTD 1E2ZA 1AFPA 2KEDA 2K01A 3PO2B 1HPCA 1V1OA 4DF7A 2V4DA 1ML0D 3CRLC 4KY7A 3C2PA 2QKIC 3QOLA 5CR3A 3HZXA 1BNZA 2B8GA 2B2TC 1ILPA 1BO0A 2EYOA 3T13A 1LTSD 1JQYD 2TSSA 4HR7B 1TWAB 1BCPF 1S4ZA 4TQUS 4KKSA 2EYPA 4A3GB 4ZKBB 4LMQD 2HCCA 2WB1B 1BR9A 4IURA 4XT1B 3GTLB 3RZOB 5C0XH 2EJMA 4X3SA 4ZK9B 3PUZA 2QDBA 2BA0A 1FNUA 1SYCA 1U4PA 1G2SA 4RGMA 2NVTB 2RKSA 1SXTA 4RWSC 3MEHA 4KHVA 2Z8LA 3D4DA 1A2UA 3A7LA 3H91A 3M7NA 1UUPA 2RSNA 1OO9B 1H9RA 3VYSA 5JEAH 1SNMA 3A56A 1G91A 2A69D 3RLFA 2KHSA 2RDHA 3ND8A 3SK8A 1PXUA 4HAEA 3LNNA 2ICIA 4PV1C 5DM73 3QOJA 1A15A 2ID0A 2OT2A 1KDAA 2AQ1B 5G3LD 1SMYD 1SE2A 3HOZB 1TT2A 2CW0C 2K1BA 5I9PA 3S2DB 2F0JA 2O5IC 3K5OA 4A3FB 1B9NA 1DOKA 3R2TA 4EQPA 1DZ1A 3HG9A 1X3QA 1C4QA 5FK9C 4HMJA 4EQNA 3A8KE 1SYEA 1TWFB 1LACA 1TVXA 3QWNA 3BYTB 1O78A 4C3IB 1VF5C 1SYGA 1Y69U 1UEAB 4HSPA 3MXNA 3TN2A 2WACA 2DNEA 1BXTA 2B2UC 3VYRA 1XX8A 4HMIA 2FMMA 5M3FB 3KBGA 3EVQA 1KDBA 1STAA 3NBIA 1BCPB 4BA2I 1ZYRD 3MXGA 2B2VA 2BE5C 1EWCA 1H9JA 1II3A 2R6GA 2MPMA 3S17B 3I8ZA 2L9HA 5IGFA 3A8JE 3FKIB 3TP6A 1VF7A 1WTOA 4NDXA 3QIAA 5JVG3 3NSWA 4QUFA 1EYDA 3S14B 3DM1A 1ENCA 4F87A 1HUMA 3CRKC 3DWPA 1GHJA 1PTOC 1V43A 2KECA 4EVOA 3I4MB 1OXXK 4A3DB 5EJWA 2EYHA 3OWEB 4DAPA 5KNDA 3MXPA 4NW2A 4K6DA 3AMUA 2BDNA 3R8BA 3HGBA 4A3BB 2VXWA 3BG3A 5EKIA 2XVSA 1CHPD 2ZT9C 1GUGA 4KJOA 3U9OA 2F0OA 5IODA 2AUKA 1HTPA 4ME5A 4RKBA 3JAME 3HOUB 3BZDB 2SOBA 1KLUD 1VCIA 1LTAD 3GV6A 2AWNA 1HQMC 1EZ8A 1IW7C 4ZRZA 3ERQA 4ILWA 2K7VA 2EY6A 3TP8A 1H9SB 2WIIB 4HTHA 2R93B 1ZXTA 2EE1A 4PNYA 5CV8A 1IKMA 3M4OB 3L7ZC 3PO3B 4CHTB 1S5ED 4G57A 1PFNA 3H6MA 1F2YA 3DEPA 4CGYB 1EU4A 1H9SA 5CV7A 5EKKA 1TQOA 1ZEQX 1CQFA 2ZXOA 3S1QB 5I9OA 1STYA 1CA5A 2RA4A 1E2WA 4XT3B 1B53A 4ZYSA 3H09A 5IT9L 4OO1G 2EY1A 3E6ZX 3NTHA 4NKLA 1FGBD 3GP7A 3LWEA 3VR2A 1ESRA 3K6OA 1OXUA 2NBFA 4WJWA 1EYCA 5C4XB 2R7ZB 2JEAI 3NXWA 2PMZB 2R92B 1D5MC 4C3JG 4P2CB 3WDNA 2L5TA 1STGA 2NVYB 3C1EA 2XRSD 5CV5A 5I6YA 3I91A 2Q8TA 2B2YC 3BVGA 1D1KA 5ELEA 1KAAA 3MFGA 1SYDA 3S1RB 1YNNC 1JWSD 2JEBI 1DONA 3NQTA 2JA6B 4B9XA 3I4NB 2K33A 1IYVA 1C8CA 1T5EA 3GTGB 4B9WA 3FMCA 3SK5A 1AEXA 4DU9A 2F0TA 2F0QA 1QNUA 3OSOA 3AB9A 4DXFA 4FYDA 4DNTB 4M1UB 4KY6A 2NVQB 1WTXA 1G8ZD 1FYCA 1C48A 1SNQA 4DA2A 2E2IB 4FXDA 3RD4A 1ET9A 3K7AB 3Q24A 3SR1A 4A3MB 1PRTF 3L9AX 4O42A 1SYFA 3TMEA 4V190 1W6KA 2ZXPA 3EJIA 4M8AA 3G6JB 5KNCA 1EL0A 3K59A 1MSHA 4XXEA 2WP8J 4FVMA 1STHA 2K5DA 3BVMA 2F0GA 3IL8A 5I6WA 1LTID 4ZAIA 1UNSA 3MHBA 2FINB 2G9DA 1Y1VB 4C3HG 3GTOB 4C2MB 1ONLA 2B39A 1F2MA 2LS01 1ILQA 4Z9CB 3KLRA 4IQZA 3VYUA 1JWMD 5CV6A 1MSGA 4E6IA 3TDQA 1RTNA 1RF2D 4RGOS 4KN4C 4BY7B 1DD2A 3PMFA 5CC4A 2PPBC 3FPUB 1HCZA 2VNUD 3J80L 2NN6I 1NUCA 2EZVA 3NQIA 2MUYA 1LTRD 1AP0A 4KTAA 2SNSA 3F2UA 2XIWA 2NYZD 1BUVT 1JORA 1TIID 4I7ZC 5E4XA 1F9QA 4K14A 4H44C 1EIHA 3X3NA 1XTCD 3VYTA 1GUNA 1DYQA 3VR3A 2PCFB 4IUTA 3FVQA 1STNA 1RHPA 1Z6HA 1SNOA 5C4ZA 3MAQA 2BOSA 4CBVA 2WKDA 3TP5A 3S9WA 2A68D 1B9MA 1SE3A 3T53B 1GUSA 1IKLA 2J0TD 4IFDJ 3TSSA 4R8NA 3M85A 3VR5A 1LTGD 1R4PB 3NK9A 1SE4A 3U9SA 4KV6A 1PRTC 3NTKA 3GTKB 4K8JA 2E2DC 4IZ8A 1SJED 3BS1A 2BDOA 3K58A 3FEWX 3H94A 2K5QA 2Z4IA 3MA2B 2HDMA 5D3IB 2X6LA 5LL6S 4EGVA 1WTVA 2EYLA 5ELBA 2R3ZA 1WVLA 2F0DA 4J6HA 4K6LA 3HKZB 1DOLA 1LT3D 1CQVA 1EU3A 3CU7A 1WCMB 4J8QA 3PUWA 1PDQA 5KRUA 5IT9E 3D8GA 3Q22A 2PW5A 5NUCA 3EFXD 1RCVD 4I65A 1O7YA 3PUVA 1LV9A 4WRDA 3TZUA 1TY2A 3J81L 1Q90A 5BN5A 3OIPA 5EPLA 2QCPX 2M00A 2QILA 2F0NA 3M7GA 4QIWB 1V1PB 4ZLTF 3O13A 3HOXB 4MN3A 1JCKB 1PLFA 5DEHA 1BOSA 5K36G 1X32A 2F3VA 3NHHA 1HRJA 1RDPD 4A3EB 4BWGB 4DXGA 3C3LA 1Z47A 2OEOA 5IGDA 5EGTA 2R61A 1SNDA 3S1MB 3S16B 2A69C 4L8JA 4BBRB 3SK6A 2PW7A 3NTIA 1I50B 3OMCA 2E76C 3TZDA 4ID6A 3ONAB 2KVMA 1EFID 3BVZA 4DAVA 2F0KA 4CJ2C 1STBA 1PTOF 4XQNA 3HS0C 2ENBA 3HRZC 1L0YB 1SMYC 2KCNA 4OIKA 3MXUA 5LL6X 2QEJC 2RDFA 2CVRA 1GXDC 1ENFA 1LT5D 1E0BA 4DFAA 1QCBD 3SHLA 1TY0A 1AN8A 2O5JC 2EY5A 4PMBA 2JE6I 4RH6A 4WFN3 4IUNA 1Y1WB 3LWUA 1B50A 3J7AF 4CJ1B 1SDFA 2SNMA 3MC0B 5T1GA 1J9OA 1I4XA 1OXSC 1XWEA 4ZKCB 1CA6A 3RUZA 1A3UA 4G7ZC 4RGTA 4RHSA 1TS4A 4OHJA 2B2VC 2NB0A 3P75A 2KJXA 5KEEA 5IGBA 1ZYRC 1T5XD 1WD0A 5A2QL 4XQJA 2D2CC 3PV0A 2L55A 4TSSA 2JA8B 3NBHA 1G291 4IFDG 1VMCA 3J80E 5FLXL 1KNAA 1HFGA 4BBSB 1H9KA 5CYUA 1BCPD 5JAVA 5M5XB 5KIXA 4FF4A 3SEBA 1B1ZA 2HQEA 2KOLA 3RMHA 2QF7A 1K8MA 1NR2A 4HEDA 4IUQA 4OGQC 4ABNA 3FDTA 3ZYYX 2LFNA 2F0HA 1M8AA 2B2UA 1F77A 3IFDA 5DNFA 2MP1A 5CGKA 2O2LD 3K5NA 1SFOB 1F9PA 1B3AA 5M5YB 5C5LA 1D5XC 1ESFA 2XRQD 4O1NA 2EYJA 3KK7A 1NR4A 2IT1A 3MTSA 1D1IA 3S2HB 1TS5A 2E74C 4G4KA 3PIO3 5KGUA 4X3TA 2M2LA 2MJ8A 5FOBB 4A3JB 3KLSX 3HEJA 4ULLA 2DY7A 3TP7A 1QE6A 1SEBD 1EY4A 2KA7A 2EJGC 2FFKB 1FR3A 3GTPB 5EBDA 4WORA 2VB3X 5FO8B 2XNAC 2A73B 1NCVA 3R3OA 3URYA 3OWFA 1O7ZA 4LAAA 2NN6G 5E1FA 5I2YA 2PZTA 1MGSA 3J81E 4RHRA 4UDUC 2G9HD 2Z4HA 3NWSA 3GV3A 1Y8PB 1X3PA 1PFMA 2WAQB 1EY9A 2D9UA 3KF8A 5J39A 1IYUA 2I46A 1EIGA 1S5BD 1HTLD 1H9MA 4KY5A 3VR4A 3K0YA 2AUJD 5AFWA 2DY8A 4A3KB 2IX1A 3DXJC 5BN3A 2ZXRA 2Y0SB 3CQZB 1DOMA 1LLRD 3PUYA 5JEAG 4KI0A 3W2DA 1CTMA 4KD4A 2FHTA 4CJ0B 1CZGA 5BN4A 2K03A 1F9RA 1I4HA 5M9OA 5JPNC 3HOWB 4KHZA 3DEOA 4KJNA 1Q1EA 4H7BA 4KKTA 4IN3A 2RSOA 1PZJD 2CQAA 3V05A 3J7AV 2K05A 1ET6A 5C3WA 4U673 5M5WB 5FKAC 4F7XA 4LJZC 2PNRC 1TR5A 4S3SA 2F0SA 1UAPA 3E0JA 2XSCA 1JOOA 2RQXA 4L63B 1JB3A 2XN9C 1DJRD 3OOCA 4F88A 2A74C 2F0VA 2DNCA 4DK1A 2X69A 3OIQA 1GUOA 5IGGA 3WOEA 1VDZA 1U4MA 2B2YA 2IJ0A 2L1BA 2HUGA 2WINB 2B63B 2EJFC 4X3UA 1F2LA 5KYLA 2PO4A 3FPPA 2H4OA 5A2QE 3ND9A 2E75C 1LT6D 3HOYB 1Q12A 2EPBA 1KDCA 2L4NA 3BYYB 2A6HD 5IIFA 5FLXE 1SJHD 5DM63 3R93A 2ICEC 2KQ3A 3NPPA 4ODGA 4LK1C 2SEBD 2TMPA 4C3HB 4RAUC 1AW7A 1DXMA 3P1HA 1EEFD 3EQLC 1HQRD 1LTBD 1I4PA 1FNWA 3BDOA 4FP5D 4TRDA 3NE5B 2PZWA 1YNJD 4C56C 4HSVA 4QF4A 1O80A 2L12A 2JSOA 3DHQA 5C0XI 4DAYA 3KLSA 2A68C 4L6TB 2DN8A 1EY0A 1HHVA 3D6CA 5EKLA 4IFDH 1JE4A 4ZQ3A 3SE0A 4K5XA 2JXMB 4IUUA 1EY7A 2A6ED 2B8FA 3RZDB 1LO5D 1TU2B 1A3TA 3SVMA 1XXGA 3Q6SA 3W3AA 4DK0A 1F9SA 3SXHA 5G3LF 1I4RA 3GTQB 4TKOB 2F0LA 2EOTA 2JYOA 2J4XA 2CHBD 1QOHA 4H13C 3GTJB 2B2WA 2Z1CA 3Q23A 3EROA 1ZKOA 3HP3A 1WD1A 3A7AB 1Y8OB 5COYA 5DAUA 4QMGA 5D3DA 3D4WA 3R2IA 2KEEA 1PTOH 2IX3A 1STEA 2SDFA 4J1MA 3H3VC 3DWAA 2NWGA 1I4QA 5C3EB 1PRTB 4G7HC 5C4JB 1HA6A 4XDXA 4K5VA 4K8IA 2HCIA 5E3FA 1OXTA 1CT1D 4FF2A 2EDGA 1WTRA 1CZWA 1U9RA 3I70A 2NTTA 1SNPA 3D31A 1JWUD 1QB5D 4RCOA 5KYIA 2F0EA 5D65A 3NWTA 2KCCA 4FF3A 4U68A 2F0FA 2JP1A 1RKNA 1RODA 4C1NI 1D5ZC 4V0BA 1O7LA 1AZPA 1Z7TA 5IGCA 3WOFA 2NN6H 1QILA 5LHY1 1JC7A 2LY7A 4DNRB 3MFYA 3DMUA 1V1PA 1RD9D 1PYWD 1BF4A 3P7JA 4X3KA 3Q0AA 4BY1B 2F0IA 2B2TA 1RTOA 4F8MA 3D4RA 4N9TA 1K8OA 2KUMA 1FNVA 4OO1H 5C0XJ 1GUWA 3I72A 3V96A 4A3IB 3T4AC 5KNBA 3KBXA 5I2XA 5HGTA 4NMZA 4K2LA 1BBXC 1SAPA 4FF1A 1TWHB 4ZUIA 1PMRA 2FJ2A 2K04A 5J1ZA 3I3CA 4RA8A 4KKUA 1Q8IA 5JEAJ 3QB3A 2PQEA 3EA6A 3C1FA 2FMCA 4CKEA 3T51B 3S1NB 5JJZA 4A93B 2OF1A 2L11A 1I3QB 4QUCA 5CV4A 3GTMB 5CBAE 2WV6D 4C1NK 4MIUA 1WTWA 5TSSA 2NVXB 5E4WC 4RGNA 4IUPA 2CW0D 3A8IE 5CBEE 2MHVA 3K5LA 3I90A 5JOBA 2F0PA 1D2BA 1LTTD 1SSOA 4C3IG 1Y8NB 1EQTA 1BCPC 1M4VA 1TS2A 1F2ZA 4RKLA 1CFMA 1CHQD 2D5DA 5D14A 3MVVA 1E2VA 2RDGA 1EEID 3CKIB 2XWBB 5ISRA 1JOKA 3BDLA 4FXKC 3LX0A 3DWQA 1JOQA 3NUCA 4AYBB 1WTPA 1FD7D 4PMCA 1HUNA 3PUXA 1PFBA 3L3OC 2F0UA 1IHZA 1GJXA 1W6JA 4CKBA 3GO5A 1I6HB 3DUZA 2OXPA 3QO2A 2JA5B 4KK7A 5EPJA 4HCSA 4KMUC 1DM0B 3VA7A 1TWCB 2BE5D 3VR6A 1D6EC 1ICWA 4PMWA 4EQOA 4K2KA 2BA1A 2HDLA 5FO9B 3BDCA 1PTOB 4IALA 5M3MB 1B2TA 3GQBA 1PTOD 2XWJB 2PZUA 3CHBD 3M3YB 1I4GA 1A2TA 4FO2A 4QCLA 2K32A 3G7LA 1U4RA 5C44B 1SNCA 2O4XA 3K5MA 2GA4B 3IFTA 3TBIB 4Y7NB 3UI2A 4DGZA 4XYOA 3T56B 2EYMA 2F0WA 4OL7A 3OMGA 2LKVA 2RBMA 4RCNA 5HURA 1TWGB 4BA1I 1LABA 3SDZA 2F03A 1KNEA 5C0XG 5K5PA 1IW7D 1AZQA 2JA7B 2LMCB 1GHKA 1LT4D 3HOVB 3QG1A 4R8IA 4QB4A 1L0XB 2VB2X 1GOZA 2H1EA 4FXGC 3NP8A 4MHEA 4K5WA 1G6ZA 3KUPA 1QG7A 3D3RA 3FRPB 5I4DA 2YU9B 3P20A 4XYQA 1R4QB 2EXZA 4C3JB 5ELDA 1HFNA 3MWYW 2IL8A 3VA5A 4HCEA 1G2TA 4IUVA 2EVBA 4JBWA 4KN7C 3IKJA 3S15B 2Q8IB 1DCZA 1JR0D 5CMDA 3A55A 5K36H 1JICA 2AWOA 4YIJA 5JVH3 1K83B 2F0MA 1CK1A 4G7OC 1MBYA 2AQ3B 1J8IA 5J22A 1XYIA 4FNFA 1CM9A 4IFDI 2K6AA 4N9PA 1OXVA 3OPOA 5ELFA 4H0LC 2C5CA 5C5MA 2E2HB 5T1IA 1Q3LA 2NZ1D 4KD3A 4RFBA 3I4LA 5JPMC 3I73A 5C4HA 1NAPA 1YNND 3PIP3 1PZID 1EYAA 2A6HC 2M9VA 2E2JB 1KLGD 2Q8RE 1QNKA 1IL8A 2BCOA 1PZKD 3K57A 3X3MA 2D62A 2EYFA 5EPKA 3AU7A 3M4YA 5EQ0A 4XQQA 1HA5A 2IWHA 3ITPA 2NTSA 1BDOA 2NUCA 4DN4M 1I6VC 2N55A 4GZYC 2IX0A 1EY5A 4Q0FA 1YNJC 2WKCA 2F4IA 4CKCA 2IPKD 3OHXC 1EOTA 1A3VA 5EBCA 5A35A 1CI3M 1EY6A 4HN7A 1MD2D 3N6RA 3V2TA 5CORA 4Q5VA 2C9OA 3SK4A 4BS9A 4ZUJA 1EZ6A 2AQ2B 2IW3A 2VUMB 4NP5A 2X6GA 4UAIA 3IAYA 1MI2A 3N52A 1SYBA 2I07B 1A6XA 2A6EC 5C6AA 1KTKA 1TKWB 1GUTA 1S5CD 5IOCA 5ELCA 1B4OA 5CV9A 1SBBB 1HXYD 2EY2A 1B44D 2B2WC 2F3WA 2A5HA 1TS3A 3QJYA 3A54A 2L0CA 4PQXA 3J7YW 1U4LA 3T16A 4JK1C 1Q1BA 2J7ZA 2K28A 1RJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0U A;  1IHZ A;  5NUC A;  3D4W A;  5IGE A;  2KQ3 A;  4ODG A;  2EY6 A;  4I65 A;  2QDB A;  1NUC A;  1SYG A;  2WAC A;  3NQT A;  2SNM A;  3TP8 A;  5HGT A;  4KD4 A;  4B9X A;  4NMZ A;  4WRD A;  4K2L A;  4HTH A;  4KTA A;  1SYC A;  2SNS A;  1NSN S;  4J1M A;  4HMI A;  4QB4 A;  4PNY A;  3RUZ A;  2RKS A;  2OXP A;  5CV8 A;  1A3U A;  2EYF A;  4ZUI A;  4B9W A;  5M9O A;  1JOR A;  3P1H A;  5C3X A;  5KGU A;  2M00 A;  3EVQ A;  4KJN A;  3MZ5 A;  1KDB A;  3MEH A;  4KHV A;  2F0N A;  4H7B A;  1AEX A;  4K14 A;  3SK5 A;  4DU9 A;  2F0T A;  1STA A;  2F0Q A;  3D4D A;  4K5V A;  5J1Z A;  4K8I A;  3NP8 A;  3HEJ A;  4G57 A;  5DEH A;  4EQO A;  5E3F A;  1A2U A;  5F2D A;  3H6M A;  3OSO A;  3TP7 A;  1F2Y A;  4K2K A;  4K5W A;  2PYK A;  4TRD A;  1EY4 A;  3ITP A;  5CV7 A;  3QB3 A;  2F3V A;  2PQE A;  2PZW A;  3NHH A;  3P75 A;  1STN A;  5EKK A;  2NUC A;  1TQO A;  3C1F A;  3BDC A;  3E5S A;  4IAL A;  1II3 A;  1U9R A;  4KY6 A;  4QF4 A;  5IGB A;  5KEE A;  1ENA A;  1SNO A;  1EY8 A;  5C4Z A;  5C3W A;  1SNQ A;  1SNM A;  4F7X A;  1SNP A;  2OEO A;  2EXZ A;  5IGD A;  5IGF A;  5I9O A;  1EY5 A;  5EGT A;  1TR5 A;  4S3S A;  1STY A;  3TP5 A;  2KHS A;  2F0S A;  3SK8 A;  3TP6 A;  3S9W A;  1SND A;  2OF1 A;  4NDX A;  5CV4 A;  4WOR A;  5KYI A;  1EYD A;  1A3V A;  2F0E A;  3SR1 A;  3DHQ A;  2PZU A;  1JOO A;  3R3O A;  4MIU A;  3VA5 A;  1ENC A;  1EY6 A;  1KAB A;  3OWF A;  1A2T A;  1EQV A;  1SYF A;  4LAA A;  3SK6 A;  2F0F A;  4R8N A;  5E1F A;  3TME A;  1EY0 A;  2PW7 A;  3EJI A;  1RKN A;  2PZT A;  3QOJ A;  3NK9 A;  2F0V A;  3OMC A;  3D6C A;  2EY1 A;  3V2T A;  5EKL A;  5IGC A;  4NKL A;  4EVO A;  4KV6 A;  1KDA A;  4ID6 A;  3SK4 A;  1SNC A;  4ZQ3 A;  3ERQ A;  4ZUJ A;  2O4X A;  1EZ6 A;  5JOB A;  5IGG A;  4K5X A;  2EYH A;  2F0K A;  4K8J A;  1TT2 A;  2F0P A;  1STB A;  4NP5 A;  5JAV A;  1EY7 A;  4YIJ A;  1STH A;  4IZ8 A;  3MXP A;  5I9P A;  3DMU A;  5KIX A;  2ENB A;  2F0G A;  2F0J A;  1EYC A;  2F0M A;  1A3T A;  4DF7 A;  1EY9 A;  5I6W A;  4DGZ A;  3NXW A;  1SYB A;  4KY7 A;  1F2Z A;  4RKL A;  4EQP A;  4K6D A;  2EYM A;  2F0W A;  2HQE A;  3MHB A;  5C6A A;  3QOL A;  5J22 A;  5J39 A;  5CR3 A;  3HZX A;  3SXH A;  5KYL A;  2EYO A;  4N9P A;  4OL7 A;  2F0I A;  3OMG A;  3MVV A;  2EYL A;  3T13 A;  4HMJ A;  1STG A;  2LKV A;  4EQN A;  4F8M A;  1F2M A;  3C1E A;  5IOC A;  5CV5 A;  2RBM A;  2F0D A;  2RDF A;  5I6Y A;  4J6H A;  2F0H A;  5C5M A;  4N9T A;  5HUR A;  2F0L A;  5CV9 A;  4KJO A;  5ISR A;  1SYE A;  1JOK A;  5CGK A;  4DFA A;  1KDC A;  2EY2 A;  4KD3 A;  2F3W A;  2EYP A;  3SHL A;  3BDL A;  4KY5 A;  5CV6 A;  3U9O A;  2F0O A;  3ERO A;  5IOD A;  1KAA A;  2EY5 A;  4E6I A;  3LX0 A;  5C4H A;  5K5P A;  4ME5 A;  4RKB A;  1JOQ A;  5IIF A;  3T16 A;  2SOB A;  4PMB A;  5KRU A;  1EYA A;  3NUC A;  1SYD A;  5C5L A;  3D8G A;  5DAU A;  4PMC A;  4IUN A;  4QMG A;  1EZ8 A;  3PMF A;  5CC4 A;  2PW5 A;  2EYJ A; 
#chains in the Genus database with same CATH topology
 2N88 A;  1R9T B;  3S17 H;  4B08 A;  4OO1 I;  4R9W A;  1NSN S;  1QJO A;  3FKI H;  2QDL A;  5IGE A;  5C3X A;  2ASB A;  5IYC H;  3MZ5 A;  4XIG S;  4XTC S;  3GD7 A;  1VMP A;  4GLX A;  1KHI A;  5F2D A;  1S5F D;  2RHS B;  2PYK A;  2K5W A;  3I4M H;  3H0G B;  3OW7 A;  1EWH A;  3L0O A;  3E5S A;  4A3D H;  1ENA A;  1EY8 A;  2VQF L;  1S5D D;  4JI3 Q;  3C46 A;  3D6W A;  2MGS A;  4P74 A;  1FJG L;  2F1M A;  3M4Q A;  1QWY A;  1YHQ A;  4OIJ A;  5L37 A;  5FO7 B;  1BQQ T;  1V8Q A;  2K5N A;  1KAW A;  4GKK Q;  1KAB A;  2K4K A;  4JI7 Q;  4CDF C;  1EQV A;  4B3R Q;  3HKZ G;  4A3B H;  1WTQ A;  3JAM L;  2RVL A;  2YYZ A;  1PRT D;  1NNX A;  1ASY A;  4DR7 Q;  4R4C A;  2K5H A;  4LFC Q;  1E2Z A;  1AFP A;  4NXM L;  2KED A;  2K01 A;  3PO2 B;  2OCE A;  1HPC A;  1V1O A;  1IBM Q;  4DF7 A;  4QGU A;  2V4D A;  1ML0 D;  3CRL C;  4KY7 A;  3C2P A;  2QKI C;  4LF6 L;  3QOL A;  5CR3 A;  3HZX A;  1BNZ A;  2B8G A;  2B2T C;  1ILP A;  1BO0 A;  2EYO A;  1M1K C;  1BBW A;  3U4Z A;  3T13 A;  1LTS D;  1JQY D;  2TSS A;  4HR7 B;  1TWA B;  1BCP F;  1X9N A;  2R93 H;  1S4Z A;  4TQU S;  4GN5 A;  3HOX G;  4KKS A;  2EYP A;  1XNR L;  3HKZ E;  4YWL A;  3G6E A;  3M4O H;  4ZKB B;  4LMQ D;  1XMO Q;  2HCC A;  4A3G B;  2WB1 B;  3PO3 H;  1BR9 A;  4IUR A;  4XT1 B;  3GTL B;  4HJ5 A;  3ZJY C;  5LMN Q;  3RZO B;  5C0X H;  2EJM A;  3UDG A;  4X3S A;  4ZK9 B;  3PUZ A;  2QDB A;  2UU9 Q;  2BA0 A;  4B3T L;  3S1Q H;  4P71 A;  1FNU A;  1N34 Q;  1SYC A;  1U4P A;  1G2S A;  4RGM A;  2NVT B;  2RKS A;  1VQC A;  4OX9 Q;  1SXT A;  2QW7 A;  4AH6 A;  2K50 A;  4RWS C;  3MEH A;  4KHV A;  2Z8L A;  3D4D A;  2UUA L;  1A2U A;  3A7L A;  3H91 A;  3NEM A;  3M7N A;  4K0K Q;  1UUP A;  3RN2 A;  2RSN A;  4YHH Q;  1OO9 B;  4LW1 A;  1H9R A;  1Q81 C;  3VYS A;  4DR3 L;  4A3I G;  2Q2I A;  5JEA H;  1SNM A;  3A56 A;  1G91 A;  2A69 D;  3T1Y Q;  3RLF A;  4DV2 L;  4A3K H;  2KHS A;  2RDH A;  3ND8 A;  3SK8 A;  2I5H A;  5C4X H;  1PXU A;  2R7Z H;  4HAE A;  3LNN A;  2ICI A;  2R92 H;  4PV1 C;  5DM7 3;  3QOJ A;  4LFA L;  2NVY H;  1A15 A;  2ID0 A;  4DUZ L;  2OT2 A;  1KDA A;  2AQ1 B;  1A63 A;  5G3L D;  1QVG A;  1SMY D;  1SE2 A;  3HOZ B;  1TT2 A;  1S3O A;  2CW0 C;  2K1B A;  5I9P A;  2CCZ A;  3S2D B;  2F0J A;  1X6O A;  2O5I C;  3K5O A;  4A3F B;  1B9N A;  1DOK A;  3S1R H;  3R2T A;  4EQP A;  2PQA B;  1DZ1 A;  3HG9 A;  1X3Q A;  2VQF Q;  1IBL L;  4YCW A;  1C4Q A;  5FK9 C;  4HMJ A;  3PF5 A;  4EQN A;  3A8K E;  1FJG Q;  4A93 G;  2JA6 H;  2NZO A;  3I4N H;  1A0I A;  2EQS A;  1N36 L;  1SN8 A;  1SYE A;  1TWF B;  1K8A C;  1LAC A;  4N8F A;  4GN4 B;  1EFW A;  1L2F A;  2JK8 A;  4BXX H;  1YJ9 A;  2PQA A;  3OW2 A;  2B29 A;  1TVX A;  3QWN A;  1SLJ A;  4L5S A;  1PH8 A;  2KEN A;  3BYT B;  1O78 A;  3W1G A;  5JJL A;  4C3I B;  1X56 A;  2GVA A;  1VF5 C;  1SYG A;  1Y69 U;  1UEA B;  3CPW A;  4HSP A;  3MXN A;  3TN2 A;  2NVQ H;  2WAC A;  2DNE A;  4UY8 C;  2K75 A;  2JA8 G;  1BXT A;  2B2U C;  1X54 A;  3VYR A;  3U4V A;  2E2I H;  1XX8 A;  4HMI A;  2FMM A;  4LF6 Q;  4MTN A;  3K81 C;  5M3F B;  3K7A H;  3KBG A;  5H1S E;  2B63 H;  3EVQ A;  1KDB A;  4A3M H;  2DGY A;  4L5Q A;  1STA A;  1VQI A;  3NBI A;  1X3E A;  3UE0 A;  4X65 L;  4BBS G;  1AH9 A;  1BCP B;  4BA2 I;  1ZYR D;  3MXG A;  2B2V A;  1XNR Q;  2BE5 C;  1L0W A;  1EWC A;  1H9J A;  1II3 A;  1SR3 A;  2R6G A;  2MPM A;  3S17 B;  3I8Z A;  1D8L A;  2L9H A;  4A3L H;  5IGF A;  3A8J E;  1E1O A;  3FKI B;  3TP6 A;  1VF7 A;  4AIM A;  1WTO A;  4NDX A;  3QIA A;  1JJC B;  5JVG 3;  3NSW A;  4QUF A;  1EYD A;  3S14 B;  3DM1 A;  1ENC A;  4F87 A;  4B3T Q;  1HUM A;  3CRK C;  3DWP A;  3GTO H;  1GHJ A;  1PTO C;  2Z0S A;  3PQI A;  4C2M H;  1V43 A;  2KEC A;  2JA5 G;  4EVO A;  3I4M B;  1OXX K;  4A3D B;  1HNZ L;  5EJW A;  1I5F A;  2EYH A;  3OWE B;  4DAP A;  1HZ9 A;  2CH4 W;  5KND A;  4JI4 L;  3K7U C;  3MXP A;  4NW2 A;  4YCV A;  4L5T A;  4LUZ A;  4K6D A;  3AMU A;  4BY7 H;  5IT9 c;  3NEL A;  4DR3 Q;  2BDN A;  3EBE A;  5JJK A;  3R8B A;  5M3M G;  3HGB A;  4A3B B;  2VXW A;  4DV2 Q;  3BG3 A;  1HR0 L;  5EKI A;  2XVS A;  1NMG A;  1CHP D;  2ZT9 C;  1GUG A;  4KJO A;  4OXP A;  4A3J G;  1CSQ A;  3U9O A;  2F0O A;  5IOD A;  2AUK A;  1HTP A;  4ME5 A;  1PH6 A;  4RKB A;  4LFA Q;  3JAM E;  3HOU B;  3BZD B;  2SOB A;  1KLU D;  1VCI A;  5C44 G;  4DUZ Q;  1LTA D;  3GV6 A;  4GLA C;  3KJP A;  2AWN A;  1HQM C;  1EZ8 A;  1PVO A;  1IW7 C;  4ZRZ A;  3ERQ A;  4ILW A;  2K7V A;  2EY6 A;  3TP8 A;  5GAH C;  1H9S B;  4A3C H;  4X62 L;  2WII B;  4HTH A;  2R93 B;  1ZXT A;  3OTO L;  2EE1 A;  4PNY A;  3RZD H;  5CV8 A;  1IKM A;  3M4O B;  4R4I A;  3L7Z C;  1IBL Q;  2CH4 A;  1JE5 A;  3PO3 B;  4GNX C;  4CHT B;  1TXY A;  1S5E D;  3NEN A;  4G57 A;  1PFN A;  3H6M A;  1F2Y A;  3DEP A;  4CGY B;  4JBK A;  1EU4 A;  1H9S A;  5CV7 A;  4YWM A;  5EKK A;  2PI2 E;  1TQO A;  1Y14 B;  2WAQ G;  1ZEQ X;  1CQF A;  2ZXO A;  3S1Q B;  3GTK H;  2G5D A;  2KCM A;  5I9O A;  1STY A;  1CA5 A;  1PHJ A;  4HID A;  2RA4 A;  1E2W A;  2UUB L;  4XT3 B;  1S40 A;  1IBK L;  1B53 A;  4ZYS A;  2OWO A;  2UXB L;  3H09 A;  4DV1 L;  1NY4 A;  5IT9 L;  1PH5 A;  4OO1 G;  2EY1 A;  1HZC A;  3E6Z X;  3NTH A;  4NKL A;  1UWV A;  1EIF A;  2RHQ B;  1FGB D;  3GP7 A;  1KRS A;  3LWE A;  3VR2 A;  1ESR A;  3K6O A;  1FVI A;  1OXU A;  1WCM H;  2NBF A;  4WJW A;  4X65 Q;  2N49 A;  1EYC A;  5C4X B;  2R7Z B;  2WAQ E;  2JEA I;  3NXW A;  2Z6K C;  2PMZ B;  1KD1 C;  2ALY B;  3RN5 A;  2R92 B;  1D5M C;  3G48 A;  1Q82 C;  4C3J G;  4P2C B;  3WDN A;  2L5T A;  5IYD G;  1STG A;  1BVS A;  2NVY B;  3C1E A;  2XRS D;  5CV5 A;  4R4O A;  3HOW G;  5I6Y A;  3I91 A;  2Q8T A;  2YTX A;  1WJJ A;  2B2Y C;  3BVG A;  1D1K A;  1WFQ A;  5ELE A;  1KAA A;  1EQQ A;  3HOX H;  3MFG A;  1SYD A;  3S1R B;  1O7I A;  3RLN A;  1YNN C;  1HNW L;  1JWS D;  2JEB I;  1DON A;  4JI4 Q;  4LF5 L;  4GKJ L;  3DM3 A;  3NQT A;  2JA6 B;  4A3E H;  4B9X A;  3I4N B;  2K33 A;  1IYV A;  1C8C A;  1T5E A;  1FGU A;  3GTG B;  4B9W A;  3FMC A;  3S1M H;  1VQM A;  3S16 H;  3SK5 A;  1AEX A;  4DU9 A;  1Q7Y C;  1XPU A;  2F0T A;  1SRU A;  2F0Q A;  4BBR H;  4JI5 L;  4KLK A;  3J80 c;  1QVF A;  1QNU A;  3OSO A;  3AB9 A;  4DXF A;  1EQR A;  1VQ8 A;  4R4T A;  1I50 H;  1T9H A;  4WJ3 M;  4FYD A;  4DNT B;  3CMA A;  2Q2H A;  4M1U B;  4KY6 A;  2NVQ B;  1WTX A;  1G8Z D;  1FYC A;  1RIP A;  2VW9 A;  1C48 A;  1SNQ A;  4DA2 A;  2E2I B;  4FXD A;  1N32 L;  3RD4 A;  1ET9 A;  3K7A B;  1D7Q A;  3Q24 A;  3L2P A;  1K3B C;  3SR1 A;  4A3M B;  1PRT F;  2DJF C;  3L9A X;  4O42 A;  3CC4 A;  1SYF A;  4X62 Q;  3TME A;  4V19 0;  1W6K A;  2ZXP A;  3EJI A;  2ZJR A;  4M8A A;  3OTO Q;  3G6J B;  5KNC A;  1EL0 A;  3G4S A;  3K59 A;  1MSH A;  4XXE A;  2WP8 J;  1B7Y B;  3AYH B;  4FVM A;  4RG1 A;  1STH A;  3F2C A;  2K5D A;  1U5K A;  3BVM A;  2F0G A;  3IL8 A;  5I6W A;  1LTI D;  2FXQ A;  4FDB A;  1MJE A;  4ZAI A;  1UNS A;  1P8L A;  4ZCK A;  3MHB A;  3ULP A;  2FIN B;  2G9D A;  1Y1V B;  4C3H G;  3GTO B;  3JC6 6;  4C2M B;  1ONL A;  2B39 A;  1F2M A;  2D0O A;  4YY3 L;  2LS0 1;  2UUB Q;  1ILQ A;  1IBK Q;  4Z9C B;  3KLR A;  2Q2T A;  1X3G A;  4IQZ A;  3W5O A;  3VYU A;  1JWM D;  4GOP C;  4HIK A;  5CV6 A;  1H95 A;  2UXB Q;  1MSG A;  3K80 C;  4E6I A;  4DV1 Q;  3TDQ A;  1K28 A;  1RTN A;  1VQP A;  1RF2 D;  4RGO S;  3JAM c;  1YJW A;  4KN4 C;  4BY7 B;  2E5L L;  1DD2 A;  3PMF A;  5CC4 A;  4I7A A;  3FPU B;  2PPB C;  1HCZ A;  2VNU D;  3CPF A;  3J80 L;  2NN6 I;  3HKS A;  1NUC A;  3KFU A;  2EZV A;  3NQI A;  4HJ8 A;  2MUY A;  1LTR D;  1AP0 A;  4KTA A;  2SNS A;  3F2U A;  2XIW A;  2NYZ D;  3W1B A;  1BUV T;  1JOR A;  1TII D;  4I7Z C;  5E4X A;  2QEX A;  2JA8 H;  1F9Q A;  4K14 A;  4H44 C;  1EIH A;  3X3N A;  1XTC D;  3VYT A;  1GUN A;  1DYQ A;  3BJU A;  3VR3 A;  4LF7 Q;  3U50 C;  2PCF B;  4IUT A;  3FVQ A;  1STN A;  3J81 c;  1VQ5 A;  1CSP A;  1RHP A;  4BBS H;  1Z6H A;  1SNO A;  5GQO A;  5C4Z A;  3MAQ A;  2BOS A;  1VQD A;  4CBV A;  4JG2 A;  3ULL A;  2WKD A;  5M5X H;  3TP5 A;  3S9W A;  2A68 D;  1VQO A;  4JI6 L;  1UE7 A;  1B9M A;  1SE3 A;  3T53 B;  1GUS A;  4LF5 Q;  1IKL A;  2J0T D;  4GKJ Q;  4IFD J;  1B70 B;  3F8T A;  3TSS A;  4JI0 Q;  4R8N A;  3M85 A;  3VR5 A;  1LTG D;  1R4P B;  3NK9 A;  1SE4 A;  3U9S A;  4KV6 A;  1PRT C;  5FLM G;  3NTK A;  1SFO H;  3GTK B;  4K8J A;  4JI5 Q;  2E2D C;  2ZTE A;  4EX5 A;  4IZ8 A;  1VQ7 A;  1SJE D;  1I94 L;  5M5Y H;  3BS1 A;  2BDO A;  3K58 A;  3FEW X;  3H94 A;  5IWA L;  2K5Q A;  2Z4I A;  2ZM6 L;  3MA2 B;  2C35 B;  2HDM A;  5D3I B;  3TRE A;  2X6L A;  5LL6 S;  4EGV A;  1WTV A;  2EYL A;  5ELB A;  5C3E G;  3CME A;  1N32 Q;  2R3Z A;  4IPH A;  1WVL A;  3S2H H;  2F0D A;  3TS2 A;  4PG3 A;  4J6H A;  4K6L A;  3K0X A;  3HKZ B;  5M3M H;  1DOL A;  1LT3 D;  1CQV A;  1EU3 A;  3CU7 A;  3CW2 C;  4DV5 Q;  3EN2 A;  1WCM B;  4JPB W;  4J8Q A;  3I55 A;  1C0A A;  2D0P A;  3PUW A;  4YCU A;  1QZH A;  1PDQ A;  4X66 L;  5KRU A;  4A3J H;  5IT9 E;  4L5R C;  1YHA A;  3D8G A;  3Q22 A;  2XTI A;  2PW5 A;  2R7F A;  5NUC A;  3EFX D;  1RCV D;  4I65 A;  2BH2 A;  1O7Y A;  3PUV A;  1LV9 A;  4WRD A;  3TZU A;  3KYH C;  1TY2 A;  3J81 L;  1Q90 A;  3GTP H;  5BN5 A;  3OIP A;  5EPL A;  4Y7N H;  1DGS A;  2QCP X;  2M00 A;  2QIL A;  2F0N A;  3M7G A;  4QIW B;  4LF8 L;  1V1P B;  4YY3 Q;  4ZLT F;  3F1Z A;  3O13 A;  1GM5 A;  3HOX B;  4MN3 A;  1JCK B;  1PLF A;  4R1J A;  1KXL A;  5DEH A;  1PH1 A;  1BOS A;  5K36 G;  1X32 A;  2F3V A;  4UHV A;  2UXC Q;  3NHH A;  1HRJ A;  1RDP D;  2WB1 G;  4A3E B;  4BWG B;  4DXG A;  5E7N A;  1PA6 A;  1FL0 A;  2QGQ A;  1Z47 A;  3C3L A;  2OEO A;  5IGD A;  4IJH A;  5EGT A;  2E5L Q;  2R61 A;  1SND A;  3S1M B;  4BY1 G;  3CCS A;  3S16 B;  2JJQ A;  2A69 C;  4L8J A;  4BBR B;  4HJ7 A;  3SK6 A;  4X6A H;  2PW7 A;  3NTI A;  1I50 B;  3OMC A;  2HHH L;  2E76 C;  3TZD A;  4ID6 A;  1N33 L;  3ONA B;  2KVM A;  1EFI D;  3BVZ A;  4DAV A;  2F0K A;  2HQL A;  5LMN W;  1Q8K A;  1STB A;  4CJ2 C;  1PTO F;  1JB7 A;  4XQN A;  3HS0 C;  2ENB A;  3HRZ C;  4LF4 L;  1L0Y B;  1SMY C;  2KCN A;  2WB1 E;  2LSS A;  5FLX c;  4OIK A;  2LXK A;  3CQZ H;  3MXU A;  1NBW A;  5LL6 X;  4MZ9 A;  3AQQ A;  2QEJ C;  2RDF A;  2CVR A;  1GXD C;  1ENF A;  4C3J H;  1HH2 P;  1LT5 D;  1E0B A;  4DFA A;  1QCB D;  3SHL A;  1TY0 A;  1AN8 A;  4DV6 L;  2O5J C;  3HOW H;  3JAM i;  2EY5 A;  4LFB L;  4PMB A;  2JE6 I;  4RH6 A;  2HIX A;  4OWW B;  4WFN 3;  3K8A A;  2GVB A;  4IUN A;  2EXD A;  3E3X A;  1Y1W B;  3HOZ G;  3LWU A;  4IPD A;  1B50 A;  3J7A F;  4CJ1 B;  1SDF A;  2SNM A;  3MC0 B;  2A19 A;  5T1G A;  1J9O A;  1I94 Q;  5M5W H;  1I4X A;  1OXS C;  1XWE A;  4ZKC B;  5IWA Q;  1IZ6 A;  1CA6 A;  3RUZ A;  1A3U A;  4G7Z C;  4PZ8 A;  4RGT A;  4RHS A;  1TS4 A;  2VZA A;  4DR6 L;  3STB D;  4DR1 L;  4JV5 L;  4OHJ A;  1JJ2 A;  3NBH B;  4AQY L;  2IHE A;  1QZG A;  1W2B A;  5IP9 G;  2B2V C;  3CCV A;  3TEH B;  4NXM Q;  2NB0 A;  3P75 A;  2RCF A;  2KJX A;  1ICF B;  5KEE A;  1N8R C;  5IGB A;  3A5Z B;  4X66 Q;  1ZYR C;  3AFQ A;  1T5X D;  1XMQ L;  4Y52 H;  1WD0 A;  5A2Q L;  3D0F A;  1CUK A;  4XQJ A;  2D2C C;  3PV0 A;  2L55 A;  4TSS A;  2JA8 B;  3NBH A;  1G29 1;  1XNQ L;  4IFD G;  1VMC A;  3J80 E;  4DV0 L;  1A8V A;  2ZJP A;  1C7Y A;  5FLX L;  1KNA A;  1HFG A;  3HOY H;  3CXC A;  4BBS B;  1H9K A;  5CYU A;  4LF8 Q;  1BCP D;  4AYB G;  4B3M L;  5JAV A;  5M5X B;  5KIX A;  4FF4 A;  3SEB A;  1A62 A;  1B1Z A;  3CC2 A;  3HFZ B;  1WYD A;  2HQE A;  2KOL A;  3RMH A;  2QF7 A;  1K8M A;  1NR2 A;  4HED A;  3FKI G;  1P16 A;  4IUQ A;  4OGQ C;  4ABN A;  5GRO A;  4DV3 L;  3FDT A;  3ZYY X;  2LFN A;  3QR8 A;  2F0H A;  1M8A A;  2B2U A;  1F77 A;  3IFD A;  5DNF A;  4C3H H;  2MP1 A;  2I0Q A;  5CGK A;  2O2L D;  3K5N A;  1SFO B;  2UUA Q;  3H3V I;  5J3B A;  1VQH A;  1VQ4 A;  3BZC A;  1F9P A;  1B3A A;  1VQG A;  2MO0 A;  5M5Y B;  4NPS A;  2OQ0 A;  5C5L A;  1D5X C;  1N33 Q;  1ESF A;  2IHF A;  1HZA A;  2XRQ D;  4O1N A;  3UE1 A;  4AYB E;  2EYJ A;  3KK7 A;  1NR4 A;  2IT1 A;  3MTS A;  4LF4 Q;  1D1I A;  3S2H B;  1TS5 A;  2V1C C;  2E74 C;  1IXR A;  4G4K A;  3PIO 3;  5KGU A;  3CCM A;  4X3T A;  2M2L A;  1K9M C;  2MJ8 A;  3E9I A;  5FOB B;  4A3J B;  3KLS X;  3MEF A;  3HEJ A;  4ULL A;  2DY7 A;  3TP7 A;  1QUQ B;  1QE6 A;  3F2D A;  1SEB D;  1JMC A;  1EY4 A;  4DV6 Q;  2KA7 A;  2EJG C;  3HOU G;  2FFK B;  1FR3 A;  3ER0 A;  4OWT B;  4JBJ A;  3GTP B;  5EBD A;  1KRT A;  4WOR A;  2VB3 X;  5FO8 B;  2XNA C;  4NXN L;  4KHP L;  2A73 B;  1NCV A;  3TQY A;  3R3O A;  1QUQ A;  3URY A;  3OWF A;  3KF8 B;  4DKA C;  1O7Z A;  4LAA A;  2NN6 G;  5E1F A;  4YWK A;  5I2Y A;  1N36 Q;  2PZT A;  1PH9 A;  4DR2 L;  1MGS A;  3GTQ H;  3J81 E;  4RHR A;  4UDU C;  4DR6 Q;  2G9H D;  2Z4H A;  3PO3 G;  3NWS A;  2JA7 G;  4JV5 Q;  3GV3 A;  4JC0 A;  1Y8P B;  3HOV G;  3GTJ H;  4AQY Q;  1MIU A;  1X3P A;  1PFM A;  3UDF A;  2WAQ B;  1EY9 A;  3CP0 A;  2D9U A;  3KF8 A;  5FLM H;  1GO3 E;  4ME3 A;  5J39 A;  1IYU A;  4GNX B;  5IYB G;  1XMQ Q;  3F2B A;  3UDI A;  4IOC A;  5ELN A;  4DUY L;  2F52 A;  4TVA B;  2KCT A;  2I46 A;  1EIG A;  1IL2 A;  1S5B D;  1HTL D;  1XNQ Q;  1H9M A;  4DV0 Q;  5IP7 G;  4KY5 A;  3VR4 A;  5C3E H;  3K0Y A;  2AUJ D;  5EAY A;  5AFW A;  5C4J H;  2DY8 A;  4A3K B;  2YTY A;  2IX1 A;  3DXJ C;  5BN3 A;  3U58 A;  2ZXR A;  4GNX A;  2Y0S B;  3CQZ B;  4A4I A;  1DOM A;  4QY7 A;  1LLR D;  3PUY A;  5JEA G;  5BR8 L;  4KI0 A;  3W2D A;  4LF9 L;  1CTM A;  4KD4 A;  2FHT A;  1VQ9 A;  4CJ0 B;  1CZG A;  5BN4 A;  2K03 A;  2R92 G;  1F9R A;  1I4H A;  1YHB A;  5M9O A;  1MJC A;  5JPN C;  4H02 A;  3HOW B;  4KHZ A;  3DEO A;  4KJN A;  4DR4 L;  1Q1E A;  4H7B A;  4KKT A;  4IN3 A;  2RSO A;  1HNZ Q;  1W3S A;  4QJF A;  2CKZ B;  2KHJ A;  1PZJ D;  2CQA A;  3V05 A;  3J7A V;  3CF5 A;  2K05 A;  1ET6 A;  5C3W A;  4U67 3;  3CCR A;  5M5W B;  3S24 A;  5FKA C;  4F7X A;  1YIT A;  4LJZ C;  1CKN B;  4OWX B;  2PNR C;  1TR5 A;  4S3S A;  3M9B A;  2F0S A;  3CCL A;  4EQ5 A;  1UAP A;  3E0J A;  4JI2 L;  2XSC A;  1JOO A;  2RQX A;  2JA6 G;  4L63 B;  1JB3 A;  2XN9 C;  1HR0 Q;  2PMZ E;  1DJR D;  2MO1 A;  3OOC A;  4F88 A;  4BY1 H;  5IE8 A;  4OEL B;  3CCU A;  2A74 C;  2F0V A;  2DNC A;  1YNX A;  4DK1 A;  2X69 A;  1Q46 A;  3OIQ A;  3TRZ A;  4BXX G;  1GUO A;  5IGG A;  3LGJ A;  3I7F A;  3WOE A;  1VDZ A;  1U4M A;  2B2Y A;  2IJ0 A;  2L1B A;  4A3I H;  2HUG A;  2WIN B;  2B63 B;  2EJF C;  4X3U A;  1L1O B;  1F2L A;  5KYL A;  1HNX L;  2PO4 A;  3FPP A;  2H4O A;  5A2Q E;  3ND9 A;  2E75 C;  4JI7 L;  2BH8 A;  4LUV A;  1LT6 D;  4LWC A;  4NXN Q;  4KHP Q;  3HOY B;  4A3M G;  1Q12 A;  2EPB A;  2JQO A;  1TWH H;  1KDC A;  2L4N A;  3BYY B;  3G71 A;  2A6H D;  2A8V A;  1XPO A;  2WFW A;  1L1O A;  5IIF A;  5FLX E;  4DR2 Q;  1K0R A;  2RF4 A;  1SJH D;  4JOI C;  5DM6 3;  4P75 A;  3R93 A;  2A1A A;  2ICE C;  2KQ3 A;  3NPP A;  4ODG A;  1UE5 A;  4LK1 C;  2SEB D;  2TMP A;  4C3H B;  4OON A;  3S1N H;  4RAU C;  1Y1V G;  1AW7 A;  1DXM A;  4A93 H;  3P1H A;  1EEF D;  1I3Q H;  3EQL C;  3GTM H;  1HQR D;  1LTB D;  1I4P A;  4DV4 L;  2DJG C;  2NVX H;  1FNW A;  1XMO L;  3BDO A;  4HIO A;  4FP5 D;  4TRD A;  3CD6 A;  4DAY B;  2VUM G;  3NE5 B;  2PZW A;  1SMX A;  3KDF B;  1YNJ D;  4C56 C;  4HSV A;  4QF4 A;  1UEB A;  3B6Y A;  5IP9 H;  4DAM A;  1G51 A;  2CFM A;  3WWV A;  1O80 A;  2L12 A;  2JSO A;  1EUJ A;  3DHQ A;  4LF9 Q;  5C0X I;  4DAY A;  3KLS A;  2A68 C;  4L6T B;  3UDX A;  2DN8 A;  5HGQ A;  1VQK A;  1EY0 A;  3KDF A;  1HHV A;  1WOC A;  3D6C A;  5EKL A;  4IFD H;  1JE4 A;  2ES2 A;  4DR4 Q;  4ZQ3 A;  3SE0 A;  4K0K L;  4K5X A;  2JXM B;  4IUU A;  1EY7 A;  2A6E D;  4IOA A;  2B8F A;  3RZD B;  1LO5 D;  1K73 C;  3T1H L;  1TU2 B;  1A3T A;  1HZB A;  1HNW Q;  3SVM A;  3M4P A;  1XXG A;  4JI8 L;  1PH2 A;  2ZTC A;  3Q6S A;  3W3A A;  2OTJ A;  4DK0 A;  1F9S A;  3SXH A;  2I5M X;  2VY3 A;  5G3L F;  1I4R A;  3GTQ B;  1UE6 A;  1EIY B;  4TKO B;  2F0L A;  2EOT A;  2JYO A;  4JI2 Q;  1MHW C;  2J4X A;  1I6H H;  1KIX A;  2CHB D;  1QOH A;  4H13 C;  2GN5 A;  3GTJ B;  1YZ6 A;  2B2W A;  2Z1C A;  3Q23 A;  2JA5 H;  3ERO A;  1ZKO A;  1VQE A;  3HP3 A;  3S14 H;  1N9W A;  1TWC H;  4IPG A;  1WD1 A;  3H0G G;  3A7A B;  1Y8O B;  3IRB A;  5COY A;  5DAU A;  4QMG A;  3E9H A;  5D3D A;  3D4W A;  3R2I A;  2KEE A;  2RCN A;  1PTO H;  1YI2 A;  2IX3 A;  3I4O A;  5AJ3 L;  1STE A;  2SDF A;  4J1M A;  3H3V C;  3DWA A;  2NWG A;  1I4Q A;  5C3E B;  1PRT B;  4G7H C;  5FJ8 G;  5C4J B;  1HNX Q;  1YEZ A;  1HA6 A;  3CCE A;  4XDX A;  3M3Y H;  3PIP A;  4K5V A;  4K8I A;  2HCI A;  5E3F A;  1E3P A;  1OXT A;  2AMC B;  4LNQ A;  1CT1 D;  4FF2 A;  3PO2 G;  2VS1 A;  1WCM G;  2EDG A;  5C44 H;  1WTR A;  1G6P A;  1CZW A;  1U9R A;  3AEV A;  3KF6 B;  3I70 A;  2NTT A;  1SNP A;  3D31 A;  1JWU D;  1QB5 D;  4RCO A;  3HOU H;  1GD7 A;  5KYI A;  2R7D A;  1C9O A;  2F0E A;  3PCO B;  4GLV B;  5D65 A;  3J80 i;  4ALP A;  3NWT A;  1NMF A;  2KCC A;  4R4Q A;  4FF3 A;  4U68 A;  2F0F A;  2JP1 A;  1RKN A;  1ROD A;  2H5X A;  4C1N I;  1D5Z C;  4V0B A;  1O7L A;  3KF6 A;  1AZP A;  4A3G G;  1Z7T A;  5IGC A;  3WOF A;  1AE3 A;  2NN6 H;  1TWG H;  1QIL A;  5LHY 1;  4B3S L;  4JI1 L;  1SRO A;  1JC7 A;  2LY7 A;  1VQA A;  4DNR B;  3KJO A;  3MFY A;  4DV4 Q;  1VQN A;  3DMU A;  1V1P A;  2CWP A;  2KHI A;  2JA7 H;  1RD9 D;  4UP9 A;  1PYW D;  3HOV H;  2CQO A;  1BF4 A;  1Z9F A;  3P7J A;  2F4V L;  1VQJ A;  1E1T A;  4A3E G;  2JN4 A;  4X3K A;  3Q0A A;  4BY1 B;  2F0I A;  2B2T A;  1NJI C;  1RTO A;  4F8M A;  2HD3 A;  3D4R A;  1WI5 A;  1E24 A;  1ASZ A;  4N9T A;  1KQS A;  1K8O A;  2KUM A;  5IYB H;  1FNV A;  4BBR G;  4OO1 H;  3I2Z A;  3CCQ A;  4CDD C;  5C0X J;  1OTC A;  4PZ7 A;  1GUW A;  3I72 A;  3V96 A;  4A3I B;  3RNU A;  4QIW E;  2YTV A;  5IP7 H;  3T4A C;  5HY6 A;  3FP9 A;  1K8G A;  2MNA A;  5KNB A;  2E8G A;  3KBX A;  5I2X A;  3T1H Q;  5HGT A;  2YU9 H;  4RMF A;  4NMZ A;  4P73 A;  4JI6 Q;  4K2L A;  1BBX C;  1SAP A;  4JI8 Q;  4O0A A;  1GKH A;  4FF1 A;  2AHO B;  1TWH B;  4ZUI A;  3A5U A;  1PMR A;  5IYD H;  2FJ2 A;  5IY0 A;  2CWA A;  3FHW A;  2N8N A;  2K04 A;  1BKB A;  5J1Z A;  3I3C A;  1K3R A;  4RA8 A;  4HIM A;  4KKU A;  1Q8I A;  3STB C;  5JEA J;  3QB3 A;  2PQE A;  3EA6 A;  3S15 H;  2ATW A;  3C1F A;  2FMC A;  4DNI A;  1EWI A;  1E22 A;  4A3F G;  4CKE A;  1M90 C;  3T51 B;  3ICE A;  1K83 H;  5JJZ A;  3S1N B;  2ZM6 Q;  1Y1W G;  1EOV A;  4A93 B;  2OF1 A;  2L11 A;  1I3Q B;  4QUC A;  5CV4 A;  3GTM B;  5CBA E;  2WV6 D;  4C1N K;  1PV4 A;  4MIU A;  1WTW A;  5TSS A;  4DK3 C;  2NVX B;  5AJ3 Q;  3J81 i;  5E4W C;  4RGN A;  3ULJ A;  4IUP A;  2CW0 D;  3A8I E;  5CBE E;  2MHV A;  3K5L A;  3MXN B;  4J15 A;  3I90 A;  5JOB A;  2E2H H;  3GTG H;  1YIJ A;  2F0P A;  1D2B A;  1LTT D;  1SSO A;  4C3I G;  3H15 A;  1YVC A;  1Y8N B;  3SGI A;  4APV A;  1EQT A;  1VQL A;  1VQ6 A;  1BCP C;  1M4V A;  1TS2 A;  1F2Z A;  4RKL A;  2E2J H;  1CFM A;  1CHQ D;  2D5D A;  5D14 A;  3MVV A;  5M3F G;  1E2V A;  2RDG A;  1EEI D;  4A75 A;  4JYA L;  3CKI B;  4GS3 A;  2XWB B;  5ISR A;  1JOK A;  3PSI A;  2Z9H A;  4UP8 A;  3BDL A;  1JJG A;  1LTL A;  4FXK C;  4N8X 1;  3LX0 A;  1B3Q A;  3DWQ A;  1JOQ A;  4GN3 B;  1CKM A;  3NUC A;  4DV7 L;  1AE2 A;  4O2D A;  4CDC C;  4AYB B;  1WTP A;  4B3S Q;  1FD7 D;  4PMC A;  1HUN A;  3OYY A;  3PUX A;  4JI1 Q;  1PFB A;  1X55 A;  3L3O C;  2F0U A;  1IHZ A;  2UXD L;  1GJX A;  1W6J A;  4CKB A;  4A76 A;  3PGZ A;  3VDY A;  3GO5 A;  5IYC G;  3CC7 A;  1I6H B;  5LMU L;  1J6Q A;  2F4V Q;  3DUZ A;  2OXP A;  1V9P A;  3QO2 A;  4DPG A;  2JA5 B;  4KK7 A;  4DR5 L;  5EPJ A;  1SE8 A;  4HCS A;  4JVZ A;  4KMU C;  3DLL A;  1DM0 B;  2I5L X;  3VA7 A;  2HT1 A;  1TWC B;  2BE5 D;  3VR6 A;  2HHH Q;  1D6E C;  1Y1V H;  3I4M G;  1ICW A;  4PMW A;  4EQO A;  4A3D G;  4K2K A;  2BA1 A;  2HDL A;  4QL5 A;  1S72 A;  5FO9 B;  3BDC A;  1PTO B;  4CDE C;  4IAL A;  2UUC L;  4IJL A;  2VUM H;  4P72 A;  1WTH A;  5M3M B;  1B2T A;  3GQB A;  1PYS B;  1E7Z A;  1PTO D;  4A3B G;  2XWJ B;  2PZU A;  4JBM A;  3CHB D;  1J5E L;  3M3Y B;  3RR5 A;  1PH4 A;  1I4G A;  1A2T A;  4FO2 A;  4QCL A;  1K0S A;  2K32 A;  3G7L A;  4X64 L;  2B3G A;  1U4R A;  5C44 B;  4UP7 A;  3RLO A;  1SNC A;  3EIV A;  2O4X A;  5GAE C;  3K5M A;  2GA4 B;  4LFB Q;  4WJ4 A;  3IFT A;  3TBI B;  1EYG A;  3BU2 A;  2VL6 A;  2VQE L;  4Y7N B;  4UPA A;  2DUD A;  3UI2 A;  4DGZ A;  4XYO A;  3T56 B;  2EYM A;  2F0W A;  3A0J A;  2PI2 A;  2R93 G;  2L15 A;  4OL7 A;  3OMG A;  1QVC A;  1R9T H;  1X65 A;  2LKV A;  2RBM A;  4IO9 A;  4RCN A;  5HUR A;  1TWG B;  4DR1 Q;  4BA1 I;  1LAB A;  3SDZ A;  1VS0 A;  2F03 A;  1KNE A;  5C0X G;  5K5P A;  1IW7 D;  1AZQ A;  2JA7 B;  2LMC B;  1GHK A;  1LT4 D;  3HOV B;  2F3I A;  3QG1 A;  2N3S A;  3H0G H;  5DLQ E;  4R8I A;  2QA4 A;  1V1Q A;  4QB4 A;  1L0X B;  2VB2 X;  2HIV A;  1GOZ A;  2H1E A;  2MQH A;  3PF4 A;  4FXG C;  4JCV E;  3NP8 A;  1YJN A;  4MHE A;  4POF A;  1NE3 A;  4JYA Q;  4QQB X;  1UE1 A;  5FJ8 H;  4K5W A;  2ZTD A;  1G6Z A;  3KUP A;  4B3M Q;  4A3K G;  1QG7 A;  1KC8 C;  5C4X G;  3D3R A;  1PH7 A;  3FRP B;  3ERS X;  1VQB A;  5I4D A;  2YU9 B;  3P20 A;  2R7Z G;  1RL2 A;  4XYQ A;  4DV7 Q;  3PO2 H;  1R4Q B;  2EXZ A;  4C3J B;  4IPC A;  2Y0S G;  5ELD A;  3H3V H;  1HFN A;  2UXD Q;  5ELO A;  3MWY W;  2K14 A;  2IL8 A;  1IYJ B;  3VA5 A;  4DV3 Q;  3AFP A;  4HCE A;  1G2T A;  5LMU Q;  1LUZ A;  4IUV A;  2EVB A;  3E0E A;  4JBW A;  3I56 A;  4KN7 C;  1KL9 A;  4POG A;  3IKJ A;  1TWA H;  3S15 B;  2Q8I B;  4DR5 Q;  3CAM A;  1DCZ A;  4LF7 L;  1JR0 D;  5CMD A;  3A55 A;  1XPR A;  5K36 H;  3GDE A;  1LM0 A;  4A3G H;  1JIC A;  2AWO A;  4YIJ A;  5JVH 3;  1K83 B;  2F0M A;  1CK1 A;  4G7O C;  3BZK A;  1MBY A;  2KBN A;  3GTL H;  2AQ3 B;  1J8I A;  1BBU A;  3RZO H;  2UUC Q;  2Z6K A;  5J22 A;  3I4N G;  1XYI A;  3KLW A;  4FNF A;  1CM9 A;  4IFD I;  2K6A A;  4N9P A;  2Y0S E;  1OXV A;  4HJA A;  2LXJ A;  1PYB A;  1LYL A;  3OPO A;  5ELF A;  4H0L C;  2C5C A;  5C5M A;  4JI0 L;  2XGT A;  5GAD C;  1CKN A;  1J5E Q;  2NVT H;  2IY5 B;  2E2H B;  5T1I A;  1Q3L A;  2NZ1 D;  4KD3 A;  4RFB A;  3I4L A;  3KOJ A;  5JPM C;  2N78 A;  1L1O C;  3I73 A;  2K5V A;  5C4H A;  1NAP A;  4MNO A;  1B8A A;  1YNN D;  3J7Z C;  1PZI D;  3PIP 3;  1HJP A;  1EYA A;  2A6H C;  2M9V A;  4X64 Q;  4JI3 L;  2E2J B;  1KLG D;  1PFS A;  2Q8R E;  1QNK A;  2EIF A;  1IL8 A;  2BCO A;  4GKK L;  1PZK D;  2VQE Q;  3K57 A;  2B63 G;  4LUO A;  5JJI A;  4B3R L;  3X3M A;  1XJV A;  3J81 j;  2D62 A;  1HR0 W;  3J7A 5;  1XTD A;  2EYF A;  4DR7 L;  3PIO A;  5EPK A;  4HJ9 A;  2YV5 A;  3Q8D A;  4LFC L;  3AU7 A;  1GVP A;  3M4Y A;  2OTL A;  4NB3 A;  5EQ0 A;  4DV5 L;  4XQQ A;  3HOY G;  1HA5 A;  2IWH A;  1IBM L;  4A3L G;  3ITP A;  1PH3 A;  2JA9 A;  2NTS A;  1BDO A;  1VQF A;  2NUC A;  4DN4 M;  5GAG C;  1I6V C;  3HOZ H;  2N55 A;  4GZY C;  2IX0 A;  1EY5 A;  3S2D H;  4Q0F A;  1YNJ C;  2WKC A;  2F4I A;  1YBY A;  4CKC A;  4A3F H;  2IPK D;  3OHX C;  1EOT A;  1A3V A;  5EBC A;  2K52 A;  5A35 A;  1CI3 M;  1EY6 A;  4HN7 A;  4DUY Q;  1Y1W H;  2P5Z X;  1MD2 D;  1MKH A;  3N6R A;  3V2T A;  5COR A;  4Q5V A;  4MTK A;  3TS0 A;  1U0L A;  2C9O A;  2PNH A;  4JW0 A;  3SK4 A;  1CKO A;  5LMN L;  4BS9 A;  4ZUJ A;  1EZ6 A;  2ZJQ A;  2AQ2 B;  1TWF H;  2IW3 A;  2VUM B;  2UXC L;  4NP5 A;  2X6G A;  4BY7 G;  3A74 A;  4UAI A;  2UU9 L;  3IAY A;  1MI2 A;  3N52 A;  4GOP B;  1N34 L;  5BR8 Q;  2NZH A;  1SYB A;  2I07 B;  1A6X A;  2Q2U A;  2A6E C;  5C6A A;  4OX9 L;  4JOI A;  4C3I H;  1KTK A;  1Q86 C;  1TKW B;  1GUT A;  2MFI A;  1S5C D;  5IOC A;  5ELC A;  1B4O A;  5CV9 A;  1SBB B;  3CCJ A;  1HXY D;  1NTG A;  2EY2 A;  1B44 D;  2B2W C;  2F3W A;  2A5H A;  1TS3 A;  5M3F H;  4YHH L;  3QJY A;  4GOP A;  1JT8 A;  2Z6B A;  2OQK A;  2AKW B;  2L0C A;  3A54 A;  4PQX A;  3J7Y W;  1U4L A;  3T16 A;  4OEM B;  4PZ6 A;  4DK6 C;  3T1Y L;  4JK1 C;  1Q1B A;  2J7Z A;  2K28 A;  4A3C G;  1X3F A;  1RJT A; 
#chains in the Genus database with same CATH homology
 2N88 A;  1R9T B;  4B08 A;  4OO1 I;  4R9W A;  1NSN S;  1QJO A;  5IGE A;  5C3X A;  3MZ5 A;  4XIG S;  4XTC S;  3GD7 A;  1VMP A;  5F2D A;  1S5F D;  2PYK A;  2K5W A;  3H0G B;  3OW7 A;  1EWH A;  3E5S A;  1ENA A;  1EY8 A;  1S5D D;  3C46 A;  3D6W A;  2MGS A;  2F1M A;  1QWY A;  4OIJ A;  5FO7 B;  1BQQ T;  1V8Q A;  1KAB A;  1EQV A;  1WTQ A;  3JAM L;  2RVL A;  2YYZ A;  1PRT D;  1E2Z A;  1AFP A;  2KED A;  2K01 A;  3PO2 B;  1HPC A;  1V1O A;  4DF7 A;  2V4D A;  1ML0 D;  3CRL C;  4KY7 A;  3C2P A;  2QKI C;  3QOL A;  5CR3 A;  3HZX A;  1BNZ A;  2B8G A;  2B2T C;  1ILP A;  1BO0 A;  2EYO A;  3T13 A;  1LTS D;  1JQY D;  2TSS A;  4HR7 B;  1TWA B;  1BCP F;  1S4Z A;  4TQU S;  4KKS A;  2EYP A;  4A3G B;  4ZKB B;  4LMQ D;  2HCC A;  2WB1 B;  1BR9 A;  4IUR A;  4XT1 B;  3GTL B;  3RZO B;  5C0X H;  2EJM A;  4X3S A;  4ZK9 B;  3PUZ A;  2QDB A;  2BA0 A;  1FNU A;  1SYC A;  1U4P A;  1G2S A;  4RGM A;  2NVT B;  2RKS A;  1SXT A;  4RWS C;  3MEH A;  4KHV A;  2Z8L A;  3D4D A;  1A2U A;  3A7L A;  3H91 A;  3M7N A;  1UUP A;  2RSN A;  1OO9 B;  1H9R A;  3VYS A;  5JEA H;  1SNM A;  3A56 A;  1G91 A;  2A69 D;  3RLF A;  2KHS A;  2RDH A;  3ND8 A;  3SK8 A;  1PXU A;  4HAE A;  3LNN A;  2ICI A;  4PV1 C;  5DM7 3;  3QOJ A;  1A15 A;  2ID0 A;  2OT2 A;  1KDA A;  2AQ1 B;  5G3L D;  1SMY D;  1SE2 A;  3HOZ B;  1TT2 A;  2CW0 C;  2K1B A;  5I9P A;  3S2D B;  2F0J A;  2O5I C;  3K5O A;  4A3F B;  1B9N A;  1DOK A;  3R2T A;  4EQP A;  1DZ1 A;  3HG9 A;  1X3Q A;  1C4Q A;  5FK9 C;  4HMJ A;  4EQN A;  3A8K E;  1SYE A;  1TWF B;  1LAC A;  1TVX A;  3QWN A;  3BYT B;  1O78 A;  4C3I B;  1VF5 C;  1SYG A;  1Y69 U;  1UEA B;  4HSP A;  3MXN A;  3TN2 A;  2WAC A;  2DNE A;  1BXT A;  2B2U C;  3VYR A;  1XX8 A;  4HMI A;  2FMM A;  5M3F B;  3KBG A;  3EVQ A;  1KDB A;  1STA A;  3NBI A;  1BCP B;  4BA2 I;  1ZYR D;  3MXG A;  2B2V A;  2BE5 C;  1EWC A;  1H9J A;  1II3 A;  2R6G A;  2MPM A;  3S17 B;  3I8Z A;  2L9H A;  5IGF A;  3A8J E;  3FKI B;  3TP6 A;  1VF7 A;  1WTO A;  4NDX A;  3QIA A;  5JVG 3;  3NSW A;  4QUF A;  1EYD A;  3S14 B;  3DM1 A;  1ENC A;  4F87 A;  1HUM A;  3CRK C;  3DWP A;  1GHJ A;  1PTO C;  1V43 A;  2KEC A;  4EVO A;  3I4M B;  1OXX K;  4A3D B;  5EJW A;  2EYH A;  3OWE B;  4DAP A;  5KND A;  3MXP A;  4NW2 A;  4K6D A;  3AMU A;  2BDN A;  3R8B A;  3HGB A;  4A3B B;  2VXW A;  3BG3 A;  5EKI A;  2XVS A;  1CHP D;  2ZT9 C;  1GUG A;  4KJO A;  3U9O A;  2F0O A;  5IOD A;  2AUK A;  1HTP A;  4ME5 A;  4RKB A;  3JAM E;  3HOU B;  3BZD B;  2SOB A;  1KLU D;  1VCI A;  1LTA D;  3GV6 A;  2AWN A;  1HQM C;  1EZ8 A;  1IW7 C;  4ZRZ A;  3ERQ A;  4ILW A;  2K7V A;  2EY6 A;  3TP8 A;  1H9S B;  2WII B;  4HTH A;  2R93 B;  1ZXT A;  2EE1 A;  4PNY A;  5CV8 A;  1IKM A;  3M4O B;  3L7Z C;  3PO3 B;  4CHT B;  1S5E D;  4G57 A;  1PFN A;  3H6M A;  1F2Y A;  3DEP A;  4CGY B;  1EU4 A;  1H9S A;  5CV7 A;  5EKK A;  1TQO A;  1ZEQ X;  1CQF A;  2ZXO A;  3S1Q B;  5I9O A;  1STY A;  1CA5 A;  2RA4 A;  1E2W A;  4XT3 B;  1B53 A;  4ZYS A;  3H09 A;  5IT9 L;  4OO1 G;  2EY1 A;  3E6Z X;  3NTH A;  4NKL A;  1FGB D;  3GP7 A;  3LWE A;  3VR2 A;  1ESR A;  3K6O A;  1OXU A;  2NBF A;  4WJW A;  1EYC A;  5C4X B;  2R7Z B;  2JEA I;  3NXW A;  2PMZ B;  2R92 B;  1D5M C;  4C3J G;  4P2C B;  3WDN A;  2L5T A;  1STG A;  2NVY B;  3C1E A;  2XRS D;  5CV5 A;  5I6Y A;  3I91 A;  2Q8T A;  2B2Y C;  3BVG A;  1D1K A;  5ELE A;  1KAA A;  3MFG A;  1SYD A;  3S1R B;  1YNN C;  1JWS D;  2JEB I;  1DON A;  3NQT A;  2JA6 B;  4B9X A;  3I4N B;  2K33 A;  1IYV A;  1C8C A;  1T5E A;  3GTG B;  4B9W A;  3FMC A;  3SK5 A;  1AEX A;  4DU9 A;  2F0T A;  2F0Q A;  1QNU A;  3OSO A;  3AB9 A;  4DXF A;  4FYD A;  4DNT B;  4M1U B;  4KY6 A;  2NVQ B;  1WTX A;  1G8Z D;  1FYC A;  1C48 A;  1SNQ A;  4DA2 A;  2E2I B;  4FXD A;  3RD4 A;  1ET9 A;  3K7A B;  3Q24 A;  3SR1 A;  4A3M B;  1PRT F;  3L9A X;  4O42 A;  1SYF A;  3TME A;  4V19 0;  1W6K A;  2ZXP A;  3EJI A;  4M8A A;  3G6J B;  5KNC A;  1EL0 A;  3K59 A;  1MSH A;  4XXE A;  2WP8 J;  4FVM A;  1STH A;  2K5D A;  3BVM A;  2F0G A;  3IL8 A;  5I6W A;  1LTI D;  4ZAI A;  1UNS A;  3MHB A;  2FIN B;  2G9D A;  1Y1V B;  4C3H G;  3GTO B;  4C2M B;  1ONL A;  2B39 A;  1F2M A;  2LS0 1;  1ILQ A;  4Z9C B;  3KLR A;  4IQZ A;  3VYU A;  1JWM D;  5CV6 A;  1MSG A;  4E6I A;  3TDQ A;  1RTN A;  1RF2 D;  4RGO S;  4KN4 C;  4BY7 B;  1DD2 A;  3PMF A;  5CC4 A;  2PPB C;  3FPU B;  1HCZ A;  2VNU D;  3J80 L;  2NN6 I;  1NUC A;  2EZV A;  3NQI A;  2MUY A;  1LTR D;  1AP0 A;  4KTA A;  2SNS A;  3F2U A;  2XIW A;  2NYZ D;  1BUV T;  1JOR A;  1TII D;  4I7Z C;  5E4X A;  1F9Q A;  4K14 A;  4H44 C;  1EIH A;  3X3N A;  1XTC D;  3VYT A;  1GUN A;  1DYQ A;  3VR3 A;  2PCF B;  4IUT A;  3FVQ A;  1STN A;  1RHP A;  1Z6H A;  1SNO A;  5C4Z A;  3MAQ A;  2BOS A;  4CBV A;  2WKD A;  3TP5 A;  3S9W A;  2A68 D;  1B9M A;  1SE3 A;  3T53 B;  1GUS A;  1IKL A;  2J0T D;  4IFD J;  3TSS A;  4R8N A;  3M85 A;  3VR5 A;  1LTG D;  1R4P B;  3NK9 A;  1SE4 A;  3U9S A;  4KV6 A;  1PRT C;  3NTK A;  3GTK B;  4K8J A;  2E2D C;  4IZ8 A;  1SJE D;  3BS1 A;  2BDO A;  3K58 A;  3FEW X;  3H94 A;  2K5Q A;  2Z4I A;  3MA2 B;  2HDM A;  5D3I B;  2X6L A;  5LL6 S;  4EGV A;  1WTV A;  2EYL A;  5ELB A;  2R3Z A;  1WVL A;  2F0D A;  4J6H A;  4K6L A;  3HKZ B;  1DOL A;  1LT3 D;  1CQV A;  1EU3 A;  3CU7 A;  1WCM B;  4J8Q A;  3PUW A;  1PDQ A;  5KRU A;  5IT9 E;  3D8G A;  3Q22 A;  2PW5 A;  5NUC A;  3EFX D;  1RCV D;  4I65 A;  1O7Y A;  3PUV A;  1LV9 A;  4WRD A;  3TZU A;  1TY2 A;  3J81 L;  1Q90 A;  5BN5 A;  3OIP A;  5EPL A;  2QCP X;  2M00 A;  2QIL A;  2F0N A;  3M7G A;  4QIW B;  1V1P B;  4ZLT F;  3O13 A;  3HOX B;  4MN3 A;  1JCK B;  1PLF A;  5DEH A;  1BOS A;  5K36 G;  1X32 A;  2F3V A;  3NHH A;  1HRJ A;  1RDP D;  4A3E B;  4BWG B;  4DXG A;  3C3L A;  1Z47 A;  2OEO A;  5IGD A;  5EGT A;  2R61 A;  1SND A;  3S1M B;  3S16 B;  2A69 C;  4L8J A;  4BBR B;  3SK6 A;  2PW7 A;  3NTI A;  1I50 B;  3OMC A;  2E76 C;  3TZD A;  4ID6 A;  3ONA B;  2KVM A;  1EFI D;  3BVZ A;  4DAV A;  2F0K A;  4CJ2 C;  1STB A;  1PTO F;  4XQN A;  3HS0 C;  2ENB A;  3HRZ C;  1L0Y B;  1SMY C;  2KCN A;  4OIK A;  3MXU A;  5LL6 X;  2QEJ C;  2RDF A;  2CVR A;  1GXD C;  1ENF A;  1LT5 D;  1E0B A;  4DFA A;  1QCB D;  3SHL A;  1TY0 A;  1AN8 A;  2O5J C;  2EY5 A;  4PMB A;  2JE6 I;  4RH6 A;  4WFN 3;  4IUN A;  1Y1W B;  3LWU A;  1B50 A;  3J7A F;  4CJ1 B;  1SDF A;  2SNM A;  3MC0 B;  5T1G A;  1J9O A;  1I4X A;  1OXS C;  1XWE A;  4ZKC B;  1CA6 A;  3RUZ A;  1A3U A;  4G7Z C;  4RGT A;  4RHS A;  1TS4 A;  4OHJ A;  2B2V C;  2NB0 A;  3P75 A;  2KJX A;  5KEE A;  5IGB A;  1ZYR C;  1T5X D;  1WD0 A;  5A2Q L;  4XQJ A;  2D2C C;  3PV0 A;  2L55 A;  4TSS A;  2JA8 B;  3NBH A;  1G29 1;  4IFD G;  1VMC A;  3J80 E;  5FLX L;  1KNA A;  1HFG A;  4BBS B;  1H9K A;  5CYU A;  1BCP D;  5JAV A;  5M5X B;  5KIX A;  4FF4 A;  3SEB A;  1B1Z A;  2HQE A;  2KOL A;  3RMH A;  2QF7 A;  1K8M A;  1NR2 A;  4HED A;  4IUQ A;  4OGQ C;  4ABN A;  3FDT A;  3ZYY X;  2LFN A;  2F0H A;  1M8A A;  2B2U A;  1F77 A;  3IFD A;  5DNF A;  2MP1 A;  5CGK A;  2O2L D;  3K5N A;  1SFO B;  1F9P A;  1B3A A;  5M5Y B;  5C5L A;  1D5X C;  1ESF A;  2XRQ D;  4O1N A;  2EYJ A;  3KK7 A;  1NR4 A;  2IT1 A;  3MTS A;  1D1I A;  3S2H B;  1TS5 A;  2E74 C;  4G4K A;  3PIO 3;  5KGU A;  4X3T A;  2M2L A;  2MJ8 A;  5FOB B;  4A3J B;  3KLS X;  3HEJ A;  4ULL A;  2DY7 A;  3TP7 A;  1QE6 A;  1SEB D;  1EY4 A;  2KA7 A;  2EJG C;  2FFK B;  1FR3 A;  3GTP B;  5EBD A;  4WOR A;  2VB3 X;  5FO8 B;  2XNA C;  2A73 B;  1NCV A;  3R3O A;  3URY A;  3OWF A;  1O7Z A;  4LAA A;  2NN6 G;  5E1F A;  5I2Y A;  2PZT A;  1MGS A;  3J81 E;  4RHR A;  4UDU C;  2G9H D;  2Z4H A;  3NWS A;  3GV3 A;  1Y8P B;  1X3P A;  1PFM A;  2WAQ B;  1EY9 A;  2D9U A;  3KF8 A;  5J39 A;  1IYU A;  2I46 A;  1EIG A;  1S5B D;  1HTL D;  1H9M A;  4KY5 A;  3VR4 A;  3K0Y A;  2AUJ D;  5AFW A;  2DY8 A;  4A3K B;  2IX1 A;  3DXJ C;  5BN3 A;  2ZXR A;  2Y0S B;  3CQZ B;  1DOM A;  1LLR D;  3PUY A;  5JEA G;  4KI0 A;  3W2D A;  1CTM A;  4KD4 A;  2FHT A;  4CJ0 B;  1CZG A;  5BN4 A;  2K03 A;  1F9R A;  1I4H A;  5M9O A;  5JPN C;  3HOW B;  4KHZ A;  3DEO A;  4KJN A;  1Q1E A;  4H7B A;  4KKT A;  4IN3 A;  2RSO A;  1PZJ D;  2CQA A;  3V05 A;  3J7A V;  2K05 A;  1ET6 A;  5C3W A;  4U67 3;  5M5W B;  5FKA C;  4F7X A;  4LJZ C;  2PNR C;  1TR5 A;  4S3S A;  2F0S A;  1UAP A;  3E0J A;  2XSC A;  1JOO A;  2RQX A;  4L63 B;  1JB3 A;  2XN9 C;  1DJR D;  3OOC A;  4F88 A;  2A74 C;  2F0V A;  2DNC A;  4DK1 A;  2X69 A;  3OIQ A;  1GUO A;  5IGG A;  3WOE A;  1VDZ A;  1U4M A;  2B2Y A;  2IJ0 A;  2L1B A;  2HUG A;  2WIN B;  2B63 B;  2EJF C;  4X3U A;  1F2L A;  5KYL A;  2PO4 A;  3FPP A;  2H4O A;  5A2Q E;  3ND9 A;  2E75 C;  1LT6 D;  3HOY B;  1Q12 A;  2EPB A;  1KDC A;  2L4N A;  3BYY B;  2A6H D;  5IIF A;  5FLX E;  1SJH D;  5DM6 3;  3R93 A;  2ICE C;  2KQ3 A;  3NPP A;  4ODG A;  4LK1 C;  2SEB D;  2TMP A;  4C3H B;  4RAU C;  1AW7 A;  1DXM A;  3P1H A;  1EEF D;  3EQL C;  1HQR D;  1LTB D;  1I4P A;  1FNW A;  3BDO A;  4FP5 D;  4TRD A;  3NE5 B;  2PZW A;  1YNJ D;  4C56 C;  4HSV A;  4QF4 A;  1O80 A;  2L12 A;  2JSO A;  3DHQ A;  5C0X I;  4DAY A;  3KLS A;  2A68 C;  4L6T B;  2DN8 A;  1EY0 A;  1HHV A;  3D6C A;  5EKL A;  4IFD H;  1JE4 A;  4ZQ3 A;  3SE0 A;  4K5X A;  2JXM B;  4IUU A;  1EY7 A;  2A6E D;  2B8F A;  3RZD B;  1LO5 D;  1TU2 B;  1A3T A;  3SVM A;  1XXG A;  3Q6S A;  3W3A A;  4DK0 A;  1F9S A;  3SXH A;  5G3L F;  1I4R A;  3GTQ B;  4TKO B;  2F0L A;  2EOT A;  2JYO A;  2J4X A;  2CHB D;  1QOH A;  4H13 C;  3GTJ B;  2B2W A;  2Z1C A;  3Q23 A;  3ERO A;  1ZKO A;  3HP3 A;  1WD1 A;  3A7A B;  1Y8O B;  5COY A;  5DAU A;  4QMG A;  5D3D A;  3D4W A;  3R2I A;  2KEE A;  1PTO H;  2IX3 A;  1STE A;  2SDF A;  4J1M A;  3H3V C;  3DWA A;  2NWG A;  1I4Q A;  5C3E B;  1PRT B;  4G7H C;  5C4J B;  1HA6 A;  4XDX A;  4K5V A;  4K8I A;  2HCI A;  5E3F A;  1OXT A;  1CT1 D;  4FF2 A;  2EDG A;  1WTR A;  1CZW A;  1U9R A;  3I70 A;  2NTT A;  1SNP A;  3D31 A;  1JWU D;  1QB5 D;  4RCO A;  5KYI A;  2F0E A;  5D65 A;  3NWT A;  2KCC A;  4FF3 A;  4U68 A;  2F0F A;  2JP1 A;  1RKN A;  1ROD A;  4C1N I;  1D5Z C;  4V0B A;  1O7L A;  1AZP A;  1Z7T A;  5IGC A;  3WOF A;  2NN6 H;  1QIL A;  5LHY 1;  1JC7 A;  2LY7 A;  4DNR B;  3MFY A;  3DMU A;  1V1P A;  1RD9 D;  1PYW D;  1BF4 A;  3P7J A;  4X3K A;  3Q0A A;  4BY1 B;  2F0I A;  2B2T A;  1RTO A;  4F8M A;  3D4R A;  4N9T A;  1K8O A;  2KUM A;  1FNV A;  4OO1 H;  5C0X J;  1GUW A;  3I72 A;  3V96 A;  4A3I B;  3T4A C;  5KNB A;  3KBX A;  5I2X A;  5HGT A;  4NMZ A;  4K2L A;  1BBX C;  1SAP A;  4FF1 A;  1TWH B;  4ZUI A;  1PMR A;  2FJ2 A;  2K04 A;  5J1Z A;  3I3C A;  4RA8 A;  4KKU A;  1Q8I A;  5JEA J;  3QB3 A;  2PQE A;  3EA6 A;  3C1F A;  2FMC A;  4CKE A;  3T51 B;  3S1N B;  5JJZ A;  4A93 B;  2OF1 A;  2L11 A;  1I3Q B;  4QUC A;  5CV4 A;  3GTM B;  5CBA E;  2WV6 D;  4C1N K;  4MIU A;  1WTW A;  5TSS A;  2NVX B;  5E4W C;  4RGN A;  4IUP A;  2CW0 D;  3A8I E;  5CBE E;  2MHV A;  3K5L A;  3I90 A;  5JOB A;  2F0P A;  1D2B A;  1LTT D;  1SSO A;  4C3I G;  1Y8N B;  1EQT A;  1BCP C;  1M4V A;  1TS2 A;  1F2Z A;  4RKL A;  1CFM A;  1CHQ D;  2D5D A;  5D14 A;  3MVV A;  1E2V A;  2RDG A;  1EEI D;  3CKI B;  2XWB B;  5ISR A;  1JOK A;  3BDL A;  4FXK C;  3LX0 A;  3DWQ A;  1JOQ A;  3NUC A;  4AYB B;  1WTP A;  1FD7 D;  4PMC A;  1HUN A;  3PUX A;  1PFB A;  3L3O C;  2F0U A;  1IHZ A;  1GJX A;  1W6J A;  4CKB A;  3GO5 A;  1I6H B;  3DUZ A;  2OXP A;  3QO2 A;  2JA5 B;  4KK7 A;  5EPJ A;  4HCS A;  4KMU C;  1DM0 B;  3VA7 A;  1TWC B;  2BE5 D;  3VR6 A;  1D6E C;  1ICW A;  4PMW A;  4EQO A;  4K2K A;  2BA1 A;  2HDL A;  5FO9 B;  3BDC A;  1PTO B;  4IAL A;  5M3M B;  1B2T A;  3GQB A;  1PTO D;  2XWJ B;  2PZU A;  3CHB D;  3M3Y B;  1I4G A;  1A2T A;  4FO2 A;  4QCL A;  2K32 A;  3G7L A;  1U4R A;  5C44 B;  1SNC A;  2O4X A;  3K5M A;  2GA4 B;  3IFT A;  3TBI B;  4Y7N B;  3UI2 A;  4DGZ A;  4XYO A;  3T56 B;  2EYM A;  2F0W A;  4OL7 A;  3OMG A;  2LKV A;  2RBM A;  4RCN A;  5HUR A;  1TWG B;  4BA1 I;  1LAB A;  3SDZ A;  2F03 A;  1KNE A;  5C0X G;  5K5P A;  1IW7 D;  1AZQ A;  2JA7 B;  2LMC B;  1GHK A;  1LT4 D;  3HOV B;  3QG1 A;  4R8I A;  4QB4 A;  1L0X B;  2VB2 X;  1GOZ A;  2H1E A;  4FXG C;  3NP8 A;  4MHE A;  4K5W A;  1G6Z A;  3KUP A;  1QG7 A;  3D3R A;  3FRP B;  5I4D A;  2YU9 B;  3P20 A;  4XYQ A;  1R4Q B;  2EXZ A;  4C3J B;  5ELD A;  1HFN A;  3MWY W;  2IL8 A;  3VA5 A;  4HCE A;  1G2T A;  4IUV A;  2EVB A;  4JBW A;  4KN7 C;  3IKJ A;  3S15 B;  2Q8I B;  1DCZ A;  1JR0 D;  5CMD A;  3A55 A;  5K36 H;  1JIC A;  2AWO A;  4YIJ A;  5JVH 3;  1K83 B;  2F0M A;  1CK1 A;  4G7O C;  1MBY A;  2AQ3 B;  1J8I A;  5J22 A;  1XYI A;  4FNF A;  1CM9 A;  4IFD I;  2K6A A;  4N9P A;  1OXV A;  3OPO A;  5ELF A;  4H0L C;  2C5C A;  5C5M A;  2E2H B;  5T1I A;  1Q3L A;  2NZ1 D;  4KD3 A;  4RFB A;  3I4L A;  5JPM C;  3I73 A;  5C4H A;  1NAP A;  1YNN D;  3PIP 3;  1PZI D;  1EYA A;  2A6H C;  2M9V A;  2E2J B;  1KLG D;  2Q8R E;  1QNK A;  1IL8 A;  2BCO A;  1PZK D;  3K57 A;  3X3M A;  2D62 A;  2EYF A;  5EPK A;  3AU7 A;  3M4Y A;  5EQ0 A;  4XQQ A;  1HA5 A;  2IWH A;  3ITP A;  2NTS A;  1BDO A;  2NUC A;  4DN4 M;  1I6V C;  2N55 A;  4GZY C;  2IX0 A;  1EY5 A;  4Q0F A;  1YNJ C;  2WKC A;  2F4I A;  4CKC A;  2IPK D;  3OHX C;  1EOT A;  1A3V A;  5EBC A;  5A35 A;  1CI3 M;  1EY6 A;  4HN7 A;  1MD2 D;  3N6R A;  3V2T A;  5COR A;  4Q5V A;  2C9O A;  3SK4 A;  4BS9 A;  4ZUJ A;  1EZ6 A;  2AQ2 B;  2IW3 A;  2VUM B;  4NP5 A;  2X6G A;  4UAI A;  3IAY A;  1MI2 A;  3N52 A;  1SYB A;  2I07 B;  1A6X A;  2A6E C;  5C6A A;  1KTK A;  1TKW B;  1GUT A;  1S5C D;  5IOC A;  5ELC A;  1B4O A;  5CV9 A;  1SBB B;  1HXY D;  2EY2 A;  1B44 D;  2B2W C;  2F3W A;  2A5H A;  1TS3 A;  3QJY A;  3A54 A;  2L0C A;  4PQX A;  3J7Y W;  1U4L A;  3T16 A;  4JK1 C;  1Q1B A;  2J7Z A;  2K28 A;  1RJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...