3D4WA

Crystal structure of staphylococcal nuclease variant delta+phs a109r at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLRKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4wA00
3OMGA 3SK8A 2F0NA 3EVQA 2F0OA 4NP5A 5CV6A 3C1EA 1TQOA 4S3SA 4ODGA 2EYOA 1EZ8A 2F0KA 3QOJA 5C3WA 5J39A 1EY7A 2F0SA 4PNYA 1F2ZA 2WACA 4I65A 1STAA 2F0GA 2LKVA 4WORA 3DHQA 3SK6A 4K5XA 5CC4A 5C5MA 5IGGA 2PW5A 1ENCA 2F0TA 1TT2A 4IUNA 5IGEA 3SR1A 5NUCA 1A3VA 5KEEA 3C1FA 3MVVA 5CV4A 5EGTA 4R8NA 2RDFA 1STHA 5IGFA 2EYJA 2F0PA 5JOBA 2OXPA 5I9PA 1F2YA 3TP5A 4ZUJA 3SHLA 4F8MA 5J1ZA 1EY0A 1IHZA 2EY6A 1KDAA 1SNPA 3S9WA 4QMGA 4NDXA 4QB4A 4PMBA 2RKSA 2OF1A 4N9PA 1STYA 1NUCA 1KDBA 4KJOA 5IODA 5KYLA 3H6MA 2OEOA 4K6DA 1F2MA 5I9OA 1TR5A 2PQEA 1STGA 2PZWA 1EYAA 2SOBA 3EJIA 1EYDA 1RKNA 3SK5A 3NXWA 3V2TA 1EY9A 3DMUA 5CV7A 4HMJA 2EY5A 5M9OA 5J22A 2F0LA 5E1FA 1SNQA 4ID6A 1ENAA 5C4ZA 5JAVA 1A2TA 1EY4A 2EYMA 2KHSA 4QF4A 2PZTA 2F0FA 1EQVA 5CV5A 2F3VA 4WRDA 1SYGA 1SYEA 2F0WA 2SNMA 4H7BA 4MIUA 1A2UA 4F7XA 5C6AA 3TP6A 1U9RA 2EYLA 2PW7A 2RBMA 4ME5A 4ZQ3A 1SYDA 3OWFA 3QOLA 4NKLA 3NHHA 5HURA 5K5PA 5KYIA 1A3UA 3NUCA 4KY5A 4B9XA 3BDLA 1KABA 3D6CA 3TMEA 4IALA 1KAAA 2F0DA 5C5LA 4KD4A 1NSNS 1STNA 5KRUA 2F0EA 4N9TA 1AEXA 1SYFA 1SNDA 3MEHA 4KJNA 4B9WA 1JOQA 4K14A 1EY6A 2EYFA 4HMIA 5HGTA 2F0MA 5IGDA 1II3A 1SYCA 2F0VA 4LAAA 1SNCA 3R3OA 2F0IA 4IZ8A 3T13A 2PZUA 4K5WA 3VA5A 5EKLA 1EY8A 3NP8A 4J6HA 3TP8A 3NQTA 4HTHA 3P75A 5I6WA 4RKBA 4KY7A 3HEJA 4J1MA 5CV8A 4TRDA 5CV9A 4DF7A 4DU9A 5DEHA 5IOCA 5CGKA 2F0HA 5KIXA 4K5VA 3ITPA 1JOKA 3EROA 4PMCA 4KV6A 1SNMA 3P1HA 2SNSA 1A3TA 5DAUA 2ENBA 2PYKA 1KDCA 3QB3A 2EY2A 4NMZA 5C3XA 1JORA 3BDCA 4KD3A 3NK9A 4G57A 5CR3A 3SK4A 4EQPA 5C4HA 4KTAA 4K8JA 5I6YA 5IGCA 4ZUIA 3U9OA 4K8IA 1EYCA 2O4XA 3HZXA 2EXZA 2KQ3A 2F0QA 3MXPA 4OL7A 5E3FA 2F0UA 3OMCA 4K2KA 3D4DA 4EQOA 3RUZA 4DGZA 4DFAA 3OSOA 3E5SA 2NUCA 4RKLA 2HQEA 4KHVA 1STBA 2F3WA 3D8GA 5F2DA 1JOOA 3MZ5A 3TP7A 4EQNA 4EVOA 3D4WA 3ERQA 5EKKA 4YIJA 4E6IA 3LX0A 1SNOA 5IGBA 5ISRA 2QDBA 2EYPA 3MHBA 3SXHA 1EY5A 5KGUA 5IIFA 3T16A 2EY1A 2M00A 1SYBA 2F0JA 4K2LA 3PMFA 1EZ6A 2EYHA 4KY6A
chains in the Genus database with same CATH superfamily
1C48A 2UXBL 2O5JC 5IYCG 1TQOA 1RF2D 4DV1L 3IKJA 5DNFA 1NBWA 3DHQA 2RA4A 3OWEB 4NPSA 1XX8A 5BR8Q 4MTKA 1IL8A 3TDQA 1O78A 1SROA 3W5OA 4JI7L 4UY8C 3IFTA 3AFQA 3CPFA 5BR8L 2QEXA 3GTOH 3FKIB 1LTGD 4BY7G 4QB4A 2B39A 4AIMA 1STYA 3FDTA 3G71A 2Q2TA 3H0GB 4JI8Q 2C9OA 4IPDA 2L15A 3ULPA 1XXGA 5FJ8G 2SOBA 1TVXA 3PSIA 4A3KH 3AQQA 5M9OA 2CFMA 4QJFA 1S5DD 3CP0A 4JI4L 1EU4A 4Y7NB 4JK1C 2A19A 5K36G 4KI0A 4MIUA 1U4LA 1JE5A 3M4OH 4C3JB 2RBMA 4IUVA 3NHHA 2ZXOA 3UE1A 4B9XA 5CYUA 1N36L 4OO1H 4V190 1KAAA 5EKIA 1OXUA 4FVMA 2A8VA 3MTSA 3KLRA 2WB1G 4JBKA 3NENA 1EIGA 2VQEL 4KK7A 4JI1Q 1DOKA 5FKAC 1A62A 1TKWB 2Z6KC 1IBLQ 5D65A 4JI0L 1VQBA 3VA5A 3NBHB 3JAME 1C0AA 3QWNA 4RG1A 2E2HH 3NWSA 4RKBA 4KY7A 1NY4A 3J80i 4JG2A 2B2UA 4TRDA 1TWCB 1CZGA 1S5ED 1K3RA 4K5VA 4L8JA 2K5HA 1TWAB 3EROA 1KNEA 4ZKBB 4RH6A 5I4DA 3TBIB 1S5FD 3I4NB 3NSWA 3TSSA 1XNRL 1BBXC 4LF8L 3I91A 4JI5L 1QVCA 1WI5A 4UPAA 5C4HA 3CC4A 3HS0C 4HSPA 2ES2A 2QKIC 2HHHL 1IBKL 2CVRA 2D2CC 4A3FG 4GNXC 4LFBQ 2RSNA 2MUYA 4DV5L 3RUZA 5D14A 1QOHA 3GTMB 3FPPA 5C3EG 2B8GA 2K6AA 1TWFH 1R9TH 1VQKA 1PFNA 1ZYRC 2VUMB 2VY3A 2EY1A 2DUDA 2YYZA 2QILA 2HIVA 1K0SA 1HQRD 2I46A 3GTJB 3OMGA 2X6GA 2KA7A 1P16A 3PIOA 1SE4A 1XMOL 5C3WA 4U68A 1D7QA 2CW0C 1Y1VH 4LFCQ 2F0SA 4I65A 3K5MA 3LNNA 4O42A 1Q81C 2JA6G 4IUNA 1DJRD 1PYBA 2KCCA 2G9HD 5CV4A 4A3JH 1LV9A 2RDFA 2NZOA 2JSOA 3FRPB 1EQTA 3ND9A 2UU9L 2OF1A 1SDFA 5LL6X 4X3KA 5AFWA 3FHWA 2ALYB 1SXTA 3A74A 1RTOA 5C4JB 1WTRA 4DKAC 3V2TA 4YY3L 4P2CB 2A74C 3M3YH 1ET9A 1CSQA 2KEDA 4A3IB 2JXMB 1ILQA 5CMDA 3TP6A 4J15A 1JCKB 4N8X1 1KRSA 3TMEA 1PVOA 2NTTA 4A3LG 2NVTB 1RCVD 4B9WA 1DM0B 1T5XD 2EYFA 4GOPA 1X6OA 2EOTA 2K5WA 4KHPQ 3R3OA 2BA1A 4Q0FA 5M5XH 1HHVA 2OT2A 5I6WA 2J7ZA 4DU9A 1HCZA 2K01A 2E2JB 5KIXA 1I6VC 3ITPA 1JOKA 1JWUD 4MHEA 4PMCA 4A3BH 5DAUA 4IUUA 2EDGA 2RHQB 1JORA 5C44B 5CR3A 5M3MH 3J81E 1B1ZA 4ZRZA 1IYVA 1ICFB 4DR7Q 1K0RA 1GUGA 1LT6D 2O4XA 3HZXA 1O7ZA 2LXKA 3VR5A 3E5SA 4GKKL 3V96A 1JOOA 1ONLA 1NNXA 2MP1A 4MTNA 4YCWA 2UXCL 1I6HB 1TS3A 1LM0A 4CDCC 5A2QL 1YHBA 4A3GH 1NR4A 2R92G 1QUQB 1H9RA 1I5FA 4H0LC 4GS3A 3S2HB 3S1NB 4JPBW 4S3SA 2IWHA 4PV1C 2KHIA 2B63H 5CC4A 2L4NA 4NXNQ 1V1PB 5IWAL 4BA1I 5JPNC 1Y8OB 3T1HQ 1S40A 3E9HA 4R8NA 3W1GA 3CF5A 1I4RA 2E8GA 3IAYA 5J1ZA 1G2TA 4C1NI 2AQ2B 2JP1A 3BZCA 5IYBG 3HGBA 4N9PA 4HR7B 5KYLA 1K28A 2R93G 2PQEA 1ZXTA 2F4IA 1RKNA 5LMNQ 3FKIH 2VB3X 4NXMQ 2XIWA 1WOCA 2LS01 2KCNA 3H0GH 1B53A 1PDQA 4RGOS 5EBCA 3I4OA 1ASYA 1XMQQ 5LMNL 4RAUC 5G3LF 1CKNA 1NR2A 3QJYA 4DUYL 1CZWA 4C3IB 3PO3B 4BY1G 4Y7NH 2LSSA 1BXTA 3BDLA 3HOWG 4RWSC 3ULLA 2E76C 3WWVA 3I4MG 1XTCD 1VQOA 4B3TL 2KCTA 2K52A 4M8AA 4KJNA 2VXWA 1AE3A 4C3JH 4DAYA 4DV4L 2ATWA 1JOQA 5E7NA 3DEPA 4P73A 3I55A 2BDNA 2OQKA 2IY5B 1F9PA 1EY8A 2F1MA 4HTHA 3AB9A 3I3CA 2R7ZG 3CAMA 1UAPA 3JAMc 3KF6B 3P1HA 1LTRD 1Y1WG 4IFDH 1VQHA 4A3CG 3OOCA 1GVPA 5C3XA 1AP0A 3NK9A 1TWCH 1BCPF 3M7NA 1TWAH 2B2YA 3R2TA 2H5XA 3MXPA 1CUKA 1Q8IA 3I4NH 3P7JA 1W2BA 1PMRA 3D8GA 4A3EG 4LUZA 5EKKA 5ISRA 1X3EA 1JJCB 3K6OA 4XT3B 2EYPA 4L5RC 2AKWB 1SYBA 1V1OA 3GTMH 2Z4HA 1Y8NB 1EZ6A 3NTHA 4NP5A 1WJJA 4CKBA 1J6QA 1YHQA 3HKZE 2F0GA 2VUMH 4C56C 1HUMA 1VQDA 3GTJH 1BOSA 4DV2Q 2BH2A 4IJLA 4DR2L 3NTKA 1YIJA 2D9UA 1MJCA 4B3SL 5ELOA 5IGFA 5I9PA 2OXPA 2K75A 2HDLA 3FVQA 1JWMD 5CBEE 4JBWA 1LLRD 4HAEA 3PUWA 1QE6A 3S9WA 5IP7G 3ZYYX 2FMMA 1FR3A 2B3GA 2JJQA 3H6MA 2ZTDA 2OEOA 4B3MQ 4L63B 1SSOA 2NZHA 1UUPA 2JEBI 3ONAB 1CHQD 1A2TA 2KOLA 1MIUA 2NN6I 3CHBD 1PH2A 4R4TA 4DR6Q 3D3RA 3P20A 5C4JH 4A3FB 1CQVA 2DGYA 2PW7A 3OHXC 3OWFA 3QOLA 5HURA 1SLJA 3KBGA 3CD6A 3I2ZA 2JA8G 4Z9CB 1NE3A 4DR6L 2R7FA 4A3IH 2BE5D 2FFKB 5C3EB 1EQRA 2V4DA 1FYCA 4DR3L 2KECA 5EQ0A 3S17B 1KHIA 1BVSA 4LMQD 1N32Q 4ME3A 1OTCA 2RDGA 1MD2D 2NN6G 1B70B 3PUXA 1V43A 2NVTH 4X3UA 2K04A 2GN5A 5CORA 1K83B 3QR8A 1AE2A 4XQNA 1E22A 2CKZB 3OPOA 4Y52H 5COYA 5E4XA 4LK1C 1EYGA 2JA6B 1SNMA 3GQBA 1FD7D 4YHHL 2B8FA 1JWSD 1IL2A 1QZHA 1VDZA 4JVZA 2E2JH 3CMEA 4OWXB 4DA2A 4A3MB 1G291 2PCFB 3BYTB 2E2DC 1VQGA 1RDPD 5C44H 3J81c 5GQOA 4YCUA 1SMYC 3GTPB 3CCEA 1WVLA 1G91A 3GTKB 3J80E 4KKTA 3PO2G 4RGTA 2NZ1D 1QVFA 1K8GA 2M00A 4FO2A 4J8QA 3PMFA 2CWAA 4KY6A 3SR1A 1PHJA 3HKSA 2F0OA 4H02A 5FLXc 1I6HH 1TS2A 2L55A 1NMGA 1B44D 1XYIA 3ZJYC 1I94Q 5KEEA 3S2HH 3S1NH 1TXYA 3H91A 3UDGA 4IOCA 1N34Q 1STHA 4L5SA 3K7UC 3H3VC 1YVCA 2ZT9C 4DV6L 1JJ2A 1QILA 1I94L 5TSSA 4X66Q 1Y8PB 4NDXA 3PGZA 2F4VQ 2JA5G 3WOEA 3J7AF 1VQJA 1JICA 1MBYA 4JW0A 1VCIA 1EYDA 1F2LA 4IUTA 5T1GA 3H09A 1T9HA 1XNQL 3K81C 1ENAA 1EY4A 2DJFC 4R4OA 5BN4A 1GHKA 3VYTA 1B50A 4R4QA 2B2TC 3RLOA 1SE2A 2NYZD 1Q12A 4U673 5GAEC 4DUZQ 2IW3A 4P74A 1D5ZC 2FINB 1GUSA 1SEBD 2IX3A 1SNDA 2WAQE 4C3IH 2PMZB 1FVIA 3PO3H 2F0VA 1RHPA 2WFWA 3TZUA 2R92B 2ZTCA 3RLFA 3J7ZC 1TU2B 3HEJA 1CSPA 2IT1A 4BBSG 4HCSA 1A15A 2K03A 5IYDH 2Z9HA 1A63A 1BCPC 3STBD 2ENBA 1MJEA 2PYKA 2DY8A 4KD3A 5LHY1 3G48A 3EA6A 1GUWA 1CI3M 4HJ9A 2JQOA 1DYQA 3Q6SA 2Q8RE 2MNAA 1UWVA 3KLWA 3VR2A 1FJGL 3V05A 2XGTA 1I4GA 3CC2A 2R93B 4L5TA 1A0IA 4DR4L 2K50A 2D0PA 5C0XI 1VQPA 1E2ZA 1EOVA 4QIWE 3NELA 1SNOA 3WOFA 2K5QA 4WJ3M 2D62A 3AYHB 3BZDB 3VDYA 5FJ8H 1GD7A 5CV8A 3SK8A 4LF9L 3BVZA 1BF4A 1S5BD 1I3QB 1JB3A 2QF7A 4BY1B 5LMNW 1PH3A 3HOWB 4X3SA 1RD9D 3I72A 3PV0A 1YNND 3I4MB 2K4KA 3HKZG 1ESRA 1D5XC 5IT9E 3J7YW 3GO5A 4DK1A 3SHLA 2RVLA 1PA6A 2UXBQ 2EPBA 1FGBD 4CDDC 4DV1Q 3F1ZA 3G7LA 1KL9A 2R7ZB 1F2MA 4CKCA 2I07B 2GVAA 2YU9B 3TS2A 1Y1WB 4HMJA 4RHSA 5E1FA 4JI7Q 5D3DA 2P5ZX 3BG3A 4AQYL 4FDBA 4FXKC 4R8IA 4O0AA 4H7BA 1A2UA 3FPUB 2Q8IB 1JR0D 4ZQ3A 5K5PA 5ELNA 3HOUG 4A3EB 2AHOB 5JJIA 1QNUA 4A3FH 1MHWC 2F0EA 4FXGC 3B6YA 2NB0A 3LGJA 4JI4Q 2SDFA 1D1IA 4QQBX 1LTLA 5M3FG 5C3EH 3ER0A 4AYBE 3PUVA 4BWGB 1N36Q 1YEZA 2Z4IA 3IL8A 3S17H 3L7ZC 5ELDA 3TZDA 2Y0SE 1SAPA 2KEEA 3W2DA 2VQEQ 1DZ1A 3GTQB 1K83H 2Q2IA 4JI0Q 4BA2I 3KJPA 2L5TA 2JA6H 1GJXA 3KDFB 4QUFA 2RF4A 5E3FA 2F0UA 2F03A 2A5HA 4DNIA 4DK6C 4HIDA 3EIVA 3U50C 4DR1L 1CKNB 4A3MH 2E5LL 1O7YA 1D5MC 1Q90A 4YIJA 1XNRQ 4LF8Q 4JYAL 1OXVA 5ELFA 4JI5Q 1X56A 1EY5A 2HHHQ 1IBKQ 1E7ZA 3GTPH 4DV5Q 4DAYB 3GTKH 1AZQA 2JEAI 1HNWL 3HOZG 2JA8B 2B2VA 3PCOB 2A68D 2MJ8A 2MO0A 1HUNA 2TSSA 1R4PB 4JI2L 1VQ5A 1F9RA 1LO5D 5LMUL 1LACA 3E3XA 3F2DA 1GKHA 3KOJA 5E4WC 2CHBD 4IUQA 4A3LH 4BXXG 4DN4M 1XMOQ 4YWMA 1LTID 1WTQA 2K32A 3GP7A 2D0OA 2VQFL 5JVG3 2YTVA 3CCSA 3UDXA 4PZ8A 5CV7A 5EAYA 1N33Q 3T4AC 1EL0A 2N8NA 4DXGA 1Q1BA 1UEAB 1EOTA 3KF8A 5C0XJ 1NCVA 2UU9Q 2ZXPA 5JJKA 3A8IE 2EZVA 1N33L 2C35B 2QDLA 1SYDA 1HNXL 5HGQA 1PTOB 3LWUA 2PNRC 4KMUC 3D6CA 3DM1A 2F0DA 1HTLD 2B2TA 4YY3Q 3MXNA 1PH8A 1Z6HA 4KD4A 5BN5A 1JQYD 3AEVA 4OO1G 1KXLA 1H9KA 3PO2B 1DONA 4K14A 4HMIA 2RHSB 3PIP3 4X64L 4UP7A 3CCMA 3T13A 2WAQG 3NP8A 1NAPA 4DNTB 5IOCA 5CGKA 1X3PA 1E3PA 3DXJC 2R92H 1EEFD 4KV6A 1J5EL 3HOVG 3CW2C 1VQEA 1L1OC 1LTTD 2WIIB 3A8JE 4IPCA 4QY7A 5I2YA 4XIGS 4KTAA 1EFID 2JA5B 5ELCA 1KC8C 3CRKC 3D4DA 3DEOA 3HP3A 2A6ED 1LT4D 4EQNA 3VA7A 1B3AA 5IYBH 1Q7YC 2KJXA 3H3VI 3RR5A 1UE7A 2JYOA 2N78A 3T16A 2R93H 3J81j 1EWCA 3S1MB 2GVBA 3GTLB 4L5QA 5CV6A 3DM3A 4GKKQ 1RJTA 4UP9A 4G7OC 5C4XG 2B2WA 2K5DA 3PQIA 2UXCQ 3I4LA 4N8FA 2I5MX 5AJ3L 1VF5C 4I7ZC 1I3QH 4R4IA 4DR5L 4XQJA 4BY1H 4R9WA 3HOWH 1F2YA 3NQIA 4NB3A 3I4MH 2BDOA 3UDIA 2OQ0A 3FEWX 3MEFA 1G6PA 1NUCA 2JA9A 4DXFA 3A5UA 1HFGA 5IT9c 3RLNA 1TR5A 5IWAQ 4BBSB 1DGSA 4C1NK 1EFWA 3ULJA 3BU2A 3DMUA 4OX9L 2UXDL 2IX1A 1HNZL 5M5WB 2EYMA 2KHSA 4IO9A 2R3ZA 4RMFA 1XWEA 2R7ZH 2NVYB 2F0WA 3OTOQ 1Y1WH 2XRSD 4WJ4A 4CHTB 3D6WA 3F2UA 4G4KA 3CCUA 2IJ0A 1PYSB 4JBJA 1V9PA 1PZJD 5KNDA 4LNQA 5J3BA 3OTOL 1PRTD 1AEXA 3MEHA 2RCNA 1U4PA 4GKJL 1WFQA 3SDZA 1EQQA 2HDMA 3KDFA 3OIPA 3N52A 1B7YB 4A3EH 1VMPA 2AUJD 4DUYQ 1XPOA 4K5WA 1PH7A 1UE5A 3TP8A 3EQLC 2IHEA 3I8ZA 3AFPA 4AYBG 4B3TQ 3KLSX 1EWIA 4DV4Q 1AH9A 3HKZB 1K3BC 1P8LA 2DNEA 3QB3A 2EY2A 2Y0SG 3SK4A 2DJGC 4DAMA 1IBMQ 3S16B 4KLKA 1GM5A 3AMUA 4ZUIA 3A54A 4OL7A 4XYQA 2A1AA 4K2KA 4LFAL 3GTQH 1UEBA 1PH6A 1MKHA 3TREA 1IBML 2F3WA 2CQAA 1XJVA 2JA7G 1DOMA 4UAIA 2RCFA 5IP7H 5IGBA 2A73B 4X62L 2Z6KA 1TY0A 1WTXA 1LTBD 1VQFA 4RCOA 2NTSA 5KGUA 4OHJA 1EWHA 2I0QA 2HQLA 2HCCA 3S14B 3GV3A 4HSVA 2WV6D 1HZBA 2D5DA 3SK6A 3HOUB 3J7AV 1PH9A 3CCQA 4BY7B 4ZCKA 2F0TA 2B63G 1TT2A 4LF5Q 1EEID 2JA8H 3H94A 4GNXA 2NBFA 1V1QA 1IYUA 4A75A 3S1RB 2M9VA 4LF5L 1KDAA 2Q2HA 4HJ7A 3M4PA 3VR3A 5I9OA 4A3DG 2PZWA 3EJIA 2NN6H 4DR2Q 2K14A 5J22A 1AN8A 4TKOB 4B3SQ 2EXDA 1PZID 2OTLA 4QF4A 1FGUA 2WB1B 4LUOA 4X65L 2BOSA 4WRDA 1IKLA 1SYGA 3IFDA 4JI3L 1D6EC 4EGVA 5I2XA 1X9NA 4FF3A 1N9WA 1HZ9A 5ELBA 4KY5A 1EIHA 3W3AA 1S5CD 2N55A 3TS0A 1VF7A 1NSNS 1DOLA 5IGDA 1PTOH 1SYCA 1U4RA 4C3JG 2F0IA 4GN5A 1GHJA 1C7YA 1B9MA 5EKLA 3PO2H 3HOZB 2AQ3B 5CV9A 2Q8TA 4DAVA 2WKCA 3EFXD 4XDXA 3K5OA 3UDFA 3NWTA 4OWWB 1GXDC 1E24A 4DR3Q 1H9MA 4L6TB 3BDCA 1WTVA 4IN3A 3EN2A 1KLGD 5I6YA 2XN9C 1CA5A 3K59A 1X55A 4FF1A 2A6EC 2QEJC 1L1OA 1MSGA 3X3NA 4OXPA 4EQ5A 2EQSA 4RKLA 4GZYC 5F2DA 1E1OA 4YHHQ 2HCIA 2JA5H 2Z0SA 2XNAC 4HJ8A 3VYSA 3MHBA 1WTOA 3PUZA 3G4SA 3JAML 1JE4A 1KRTA 1E0BA 1VQ6A 2HUGA 4B3RL 3HOXG 3U4ZA 2FJ2A 5ELEA 4QCLA 3SE0A 2XVSA 1U0LA 4HIOA 4UDUC 4PNYA 3S1MH 5JJLA 3GTLH 3A8KE 2PW5A 3VR4A 1CM9A 2BA0A 3DUZA 5IGEA 3K0YA 4KN7C 4RCNA 2UUBQ 4MN3A 2K28A 3PIO3 4F8MA 1C4QA 2EY6A 5EPLA 4FF2A 3WDNA 2E2IB 2UUBL 2H1EA 3C3LA 2VL6A 3DWQA 3VR6A 2ICIA 2O5IC 2QGQA 1YJ9A 3HOVB 3A56A 2RSOA 1S4ZA 2Z6BA 1HR0Q 3UI2A 2F0LA 4RHRA 4K0KL 1SNQA 3OW7A 1S72A 3GDEA 4DV6Q 4BBSH 4KN4C 3CCJA 2H4OA 3K7AB 1F9QA 2SNMA 1TWHB 3A5ZB 4GLVB 2GA4B 1CA6A 5HY6A 1HR0L 4B08A 1PRTC 2HIXA 3BS1A 5M5WH 1YI2A 3E9IA 2NVYH 4IALA 3D0FA 5GAGC 3Q24A 1XNQQ 1PXUA 2OCEA 1STNA 1GUOA 4N9TA 1LABA 1SYFA 3NTIA 1ASZA 5A2QE 4IJHA 1SNCA 5DM73 3I90A 2MGSA 4I7AA 4GN4B 4TSSA 1WTPA 3G6EA 2L0CA 2N88A 4LF7L 3J7A5 4FNFA 1PTOD 5C4XB 4GLXA 2ZXRA 1YNXA 3ERSX 2QW7A 4IPHA 4KHZA 3RZOB 4DV3L 4HEDA 2SNSA 3ICEA 1A3TA 1VQCA 1L0YB 1BKBA 1DCZA 1WCMG 1KTKA 4EQPA 2MHVA 2VB2X 1MSHA 4K8JA 3VYUA 3ND8A 2JK8A 4K8IA 3HOYG 5C0XH 2EXZA 1K8MA 1C9OA 4A93G 2CW0D 2N49A 3KF8B 2RDHA 1CKMA 3OSOA 2HQEA 4KHVA 1SJED 3S16H 2M2LA 2AUKA 3BVMA 1KLUD 5C44G 1PV4A 5FK9C 3H15A 2DY7A 5IIFA 1FNWA 1HPCA 2F0JA 3MXNB 2EJFC 5IYCH 1FJGQ 3C1EA 5FO7B 1HA5A 2FMCA 2WKDA 3A55A 4DR4Q 3I70A 1BUVT 1D8LA 1KQSA 2IHFA 2EJMA 2LMCB 5A35A 4JC0A 3RN5A 2TMPA 4OIKA 5NUCA 3S14H 1A3VA 3MVVA 1SN8A 2KENA 3BYYB 5EGTA 3CCLA 3J81L 2NVXB 2EYJA 3HOUH 1ZEQX 4BY7H 1HA6A 3MFYA 4LF9Q 1C8CA 4LJZC 4GOPC 1IHZA 5JJZA 1H95A 2XRQD 1LTAD 4JI6L 4X3TA 5IP9G 2ZJRA 1IXRA 4AYBB 1BCPB 4DAPA 3HG9A 2PNHA 3AU7A 3SK5A 3S1RH 4IQZA 1SRUA 1HH2P 2AWOA 1LYLA 2EY5A 4C2MB 5FLXL 5KNBA 5JAVA 2Y0SB 5K36H 4OEMB 2VW9A 1K8AC 5CV5A 1JC7A 2F3VA 4C3HG 1SYEA 3CCRA 1T5EA 2EYLA 4NKLA 2I5HA 3S15B 5KYIA 4F88A 3NUCA 1WYDA 4ALPA 4WJWA 4LF6L 1QB5D 2JA7B 5KRUA 1N8RC 4AQYQ 2AQ1B 1G8ZD 4P75A 3L2PA 1QZGA 1W6KA 2Z8LA 2MFIA 2L12A 4YCVA 1OXXK 5FLMG 2CQOA 1LT3D 4GLAC 3NPPA 1M90C 2ZJPA 1VQ8A 3UE0A 2F0HA 2HT1A 2BE5C 3KYHC 3DWAA 3QIAA 1D2BA 1IKMA 3HOZH 4DV7L 4DK0A 3MXUA 2F52A 1PH1A 1J8IA 4DV0L 4UHVA 3NBIA 4BBRG 1KIXA 3PUYA 4A3DB 2NUCA 1PFSA 2F3IA 1STBA 4BXXH 3URYA 4DNRB 2N3SA 3LWEA 3SXHA 5JEAG 1EIYB 4LF4Q 3S2DB 5JPMC 3DWPA 3EVQA 3OYYA 3RZDB 3QOJA 2F0KA 4DR1Q 4JI8L 4LF4L 2E5LQ 5C5MA 1FL0A 3T56B 1VQ4A 4JYAQ 4KKSA 4YWLA 1TIID 4KKUA 4CKEA 5EPKA 1NMFA 1VQLA 3SEBA 2XTIA 1QVGA 3TP5A 1EY0A 3CMAA 1HNWQ 2HD3A 2CCZA 3F2CA 2CWPA 3RN2A 2ASBA 3J80c 2CH4A 2Z1CA 4HIKA 1GO3E 3K5NA 1G6ZA 4OELB 4JI2Q 3MWYW 5LMUQ 1OO9B 2E2IH 5C4ZA 3E0EA 1TWGB 2PZTA 3D4RA 1MGSA 3M4QA 4JI1L 1ET6A 1HFNA 1VQ9A 1PFBA 2K33A 3HOVH 4F7XA 2R61A 1IBLL 4ME5A 3T51B 2VQFQ 4HJAA 1Q82C 4FYDA 2B2YC 1GUNA 1YNJD 1SJHD 3K7AH 4ZLTF 1TWHH 3KBXA 4RA8A 2EE1A 3NEMA 2IPKD 1F77A 1ESFA 4XXEA 4HJ5A 1CQFA 3L3OC 4OO1I 1YHAA 2XWJB 2J4XA 4LAAA 4IZ8A 2K1BA 4A3KG 1H9SA 3HOXB 1HNXQ 1PTOC 2NVQB 4UP8A 4Q5VA 4LFBL 4RGNA 4O1NA 4GNXB 1MI2A 1ENFA 3CU7A 3Q23A 1M8AA 1X32A 2PQAB 3F8TA 4DK3C 2VS1A 1JT8A 5T1IA 1KDCA 2Q2UA 5GROA 2RQXA 4QUCA 2IX0A 3CKIB 3MFGA 3PF5A 4X64Q 5C4XH 1Z9FA 3HRZC 3RZOH 2X69A 4IUPA 3H3VH 1RIPA 1J5EQ 4LFCL 2B29A 3W1BA 1D1KA 3STBC 1VMCA 3LX0A 4A3MG 1TS5A 5IY0A 3KLSA 2AMCB 4PQXA 4F87A 2E74C 1OXTA 3OW2A 3S24A 3HFZB 1A8VA 1Q3LA 1JJGA 1EZ8A 5DM63 5J39A 1Z7TA 2LKVA 4X6AH 1SR3A 3IRBA 4JCVE 3E0JA 1HR0W 1CK1A 3BJUA 3I73A 1CT1D 3C1FA 4P72A 4HIMA 4CJ2C 4H44C 2JN4A 1Y14B 5JEAJ 3KJOA 1HJPA 2RKSA 1E2WA 1I50B 1KDBA 2A69D 2NVXH 3A0JA 4P71A 1O7IA 3J80L 1YNNC 1OXSC 5AJ3Q 1L1OB 1F9SA 1M1KC 4DR5Q 1B4OA 3FMCA 1WCMB 1Y1VG 2L1BA 3C2PA 1Q46A 3M4YA 3L0OA 2F0FA 1SFOB 2ZTEA 4APVA 3SGIA 5C6AA 3HOYB 4KHPL 1PH4A 4C2MH 4A93B 4A3JG 2OTJA 4TVAB 3JC66 2JE6I 2QCPX 1HZAA 3MAQA 4OX9Q 1CTMA 2O2LD 1WD0A 5IE8A 2UXDQ 1EUJA 2ZJQA 1HNZQ 1QJOA 1SE3A 1FNUA 3S15H 2F0MA 1II3A 4FP5D 3CRLC 4CDFC 2ID0A 4JOIC 2JA7H 4DR7L 1A6XA 1UNSA 2VZAA 1ML0D 3P75A 4IPGA 4J1MA 2YU9H 4DF7A 3KK7A 4ULLA 2EVBA 1SMYD 5FLXE 3RNUA 4A3CH 1VQAA 1BBWA 4GKJQ 3T53B 1WD1A 1PFMA 1PRTF 3R93A 4PG3A 4DPGA 3O13A 1K73C 3OMCA 2MO1A 5EJWA 2DNCA 1AFPA 2PO4A 3U58A 3GTGB 4TQUS 4ZK9B 5JVH3 1SMXA 3D4WA 3CQZB 4NXNL 2A6HD 3E6ZX 1ILPA 3T1HL 4A3DH 1QCBD 5L37A 3PF4A 4C3HB 4A3BG 4LFAQ 4PZ6A 1EY7A 5M3MG 4K5XA 5IGGA 3CPWA 3S2DH 1ENCA 4ZKCB 4XYOA 4X62Q 3NBHA 1XPRA 1X65A 1HZCA 2G5DA 3QO2A 5G3LD 2DN8A 3RZDH 4NXML 2I5LX 5JOBA 4PMWA 4MZ9A 3KFUA 3QG1A 4YWKA 1XMQL 1SNPA 1QNKA 4QMGA 5M5YB 1U4MA 1AZPA 1CFMA 5IODA 1B3QA 1WTWA 1STGA 1EYAA 4A3GG 2A68C 2ICEC 3N6RA 4H13C 4ID6A 3JAMi 2FHTA 5FO9B 1EQVA 1BNZA 2K5VA 1IW7D 5EPJA 1YNJC 4HN7A 1BQQT 1HQMC 4BBRB 1E2VA 1R4QB 1U9RA 1L2FA 2WP8J 5M3FB 5H1SE 4EX5A 1TWGH 2VNUD 4O2DA 2PQAA 1EU3A 3BZKA 3I56A 1BCPD 2G9DA 1HRJA 4ABNA 3CCVA 1JB7A 5IT9L 5HGTA 3S1QB 4X65Q 2NWGA 4JI3Q 5GADC 3FKIG 5BN3A 1YJNA 1XTDA 2PI2E 1O80A 3H0GG 3RMHA 4V0BA 3M85A 2BH8A 3HOXH 2R7DA 2NVQH 1L0XB 1V8QA 3D31A 2C5CA 2KBNA 4G57A 1SE8A 3A7LA 4CGYB 4OIJA 4ZYSA 1EYCA 4IFDI 1ZKOA 2F0QA 2KQ3A 1GUTA 2PPBC 4EQOA 1G51A 1X3FA 3K5LA 4EVOA 3EBEA 3MZ5A 3ERQA 3G6JB 4E6IA 4DV2L 1SBBB 2MQHA 1H9JA 4ZAIA 2F0NA 2L9HA 4IFDG 4ODGA 1Z47A 4A4IA 3CXCA 3I7FA 2WACA 3GTOB 4OWTB 4FXDA 4QGUA 4B3ML 1W3SA 2YTYA 1Q1EA 4BS9A 3K58A 3U4VA 1TS4A 2K7VA 4WFN3 3I4NG 1ICWA 2LY7A 1O7LA 4ZUJA 4B3RQ 2A69C 4A3KB 1IYJB 4PMBA 1X3GA 2KHJA 4R4CA 4CJ0B 4K6DA 1Q8KA 2K05A 4IURA 4FF4A 3M4OB 1VQMA 1XPUA 1I50H 1W6JA 1LUZA 1STEA 3CC7A 3FP9A 2VUMG 1N32L 3DLLA 5CBAE 3PIPA 1I4QA 1HTPA 2X6LA 2V1CC 1WCMH 2WB1E 2WAQB 1S3OA 1SFOH 1CHPD 5C5LA 3SVMA 3HOYH 1QUQA 4K0KQ 3J81i 2E2HB 3TQYA 2MPMA 4A93H 5KNCA 4JV5Q 4G7HC 1KD1C 2B2UC 1DD2A 4G7ZC 3NE5B 2KCMA 3M7GA 3Q0AA 3R8BA 1V1PA 3X3MA 3F2BA 2L11A 4J6HA 1BBUA 2YTXA 2LFNA 3NQTA 5GAHC 1VQ7A 4JV5L 4PZ7A 5DEHA 4JOIA 1BO0A 1JMCA 2B2VC 1LT5D 4ILWA 4POGA 3VYRA 1NTGA 2IL8A 1AW7A 4CBVA 1Q86C 3L9AX 4A3IG 5IGCA 1PYWD 2PI2A 3MA2B 4JBMA 1IZ6A 3OIQA 1X54A 1TWFB 4QIWB 1R9TB 4LF7Q 2A6HC 4DFAA 4DGZA 2KVMA 4K6LA 4DV3Q 3TN2A 1I4PA 2EJGC 1HXYD 4R1JA 1PLFA 1PTOF 1Y1VB 5IP9H 1TY2A 3K57A 2FXQA 1N34L 3GTGH 4K2LA 3TP7A 4LW1A 2EYHA 3C46A 3CQZH 1PRTB 1ZYRD 4POFA 4HCEA 2EYOA 4A3JB 4OONA 4X66L 2F4VL 3T1YQ 1RTNA 4XTCS 1F2ZA 1PH5A 1STAA 4WORA 1H9SB 3K8AA 4C3HH 3TRZA 1K9MC 2XSCA 1RODA 3U9SA 3T1YL 1YJWA 5LL6S 2QA4A 5EBDA 2F0PA 2OWOA 5DLQE 4OGQC 1LTSD 3GV6A 3A7AB 3KF6A 1QWYA 4CDEC 1YBYA 4GN3B 3M3YB 4KJOA 4DUZL 1UE6A 3RD4A 3Q22A 1GOZA 4IFDJ 1VS0A 4A76A 5FLMH 3M9BA 3NXWA 1K8OA 4RFBA 1G2SA 1EY9A 1IW7C 5M5YH 1YITA 1M4VA 1FNVA 1X3QA 5D3IB 1KAWA 4NW2A 4JI6Q 3MXGA 1VQNA 5FO8B 4LUVA 1A3UA 2BCOA 1L0WA 4XQQA 1KABA 1KNAA 3MC0B 1B9NA 4XT1B 5M5XB 4BBRH 1EY6A 2ZM6Q 5M3FH 2YV5A 1VQIA 2LXJA 3K80C 3BDOA 4A3BB 1I4XA 5FOBB 2PZUA 4AH6A 2R6GA 3K0XA 1U5KA 1RL2A 2ZM6L 1DXMA 1NJIC 1BDOA 3TEHB 2UUAQ 4LF6Q 5JEAH 3S1QH 4M1UB 5M3MB 2UUCQ 1EIFA 3BVGA 4LWCA 1PZKD 2UUAL 2B2WC 4NMZA 1E1TA 1YZ6A 2K5NA 2UUCL 1B2TA 4MNOA 2WINB 4GOPB 2J0TD 1B8AA 3U9OA 4QL5A 2KUMA 4CJ1B 4RGMA 5C0XG 4C3IG 3GD7A 3PO3G 2EIFA 1WTHA 3R2IA 3Q8DA 1QG7A 2CH4W 4A3GB 4IOAA 2XWBB 2PMZE 2AWNA 1CKOA 1Y69U 4DV7Q 3KUPA 2E75C 2QDBA 1J9OA 2B63B 1BR9A 1UE1A 4DV0Q 1I4HA 2SEBD 5IYDG
chains in the Genus database with same CATH topology
1C48A 2O5JC 1TQOA 1RF2D 3IKJA 5DNFA 3DHQA 2RA4A 3OWEB 1XX8A 1IL8A 3TDQA 1O78A 3IFTA 3FKIB 1LTGD 4QB4A 2B39A 1STYA 3FDTA 3H0GB 2C9OA 1XXGA 2SOBA 1TVXA 5M9OA 1S5DD 1EU4A 4Y7NB 4JK1C 5K36G 4KI0A 4MIUA 1U4LA 4C3JB 2RBMA 4IUVA 3NHHA 2ZXOA 4B9XA 5CYUA 4OO1H 4V190 1KAAA 5EKIA 1OXUA 4FVMA 3MTSA 3KLRA 1EIGA 4KK7A 1DOKA 5FKAC 1TKWB 5D65A 3JAME 3VA5A 3QWNA 3NWSA 4RKBA 4KY7A 4TRDA 2B2UA 1TWCB 1CZGA 1S5ED 4K5VA 4L8JA 3EROA 1TWAB 1KNEA 4ZKBB 4RH6A 5I4DA 3TBIB 1S5FD 3I4NB 3NSWA 3TSSA 1BBXC 3I91A 5C4HA 3HS0C 4HSPA 2QKIC 2CVRA 2D2CC 2RSNA 2MUYA 3RUZA 5D14A 1QOHA 3GTMB 3FPPA 2B8GA 2K6AA 1PFNA 1ZYRC 2VUMB 2EY1A 2YYZA 2QILA 1HQRD 2I46A 3GTJB 3OMGA 2X6GA 2KA7A 1SE4A 5C3WA 4U68A 2CW0C 2F0SA 4I65A 3K5MA 3LNNA 4O42A 4IUNA 1DJRD 2KCCA 2G9HD 5CV4A 1LV9A 2RDFA 2JSOA 3FRPB 1EQTA 3ND9A 2OF1A 1SDFA 5LL6X 4X3KA 5AFWA 1SXTA 5C4JB 1RTOA 1WTRA 3V2TA 4P2CB 2A74C 1ET9A 4A3IB 2KEDA 2JXMB 1ILQA 5CMDA 3TP6A 1JCKB 3TMEA 2NTTA 2NVTB 1RCVD 4B9WA 1DM0B 1T5XD 2EYFA 2EOTA 2K5WA 3R3OA 2BA1A 4Q0FA 1HHVA 2OT2A 5I6WA 2J7ZA 4DU9A 1HCZA 2K01A 2E2JB 5KIXA 1I6VC 3ITPA 1JOKA 1JWUD 4MHEA 4PMCA 5DAUA 4IUUA 2EDGA 1JORA 5C44B 5CR3A 3J81E 1B1ZA 4ZRZA 1IYVA 1GUGA 1LT6D 2O4XA 3HZXA 1O7ZA 3VR5A 3E5SA 3V96A 1JOOA 1ONLA 2MP1A 1I6HB 1TS3A 5A2QL 1NR4A 1H9RA 4H0LC 3S2HB 3S1NB 4S3SA 2IWHA 4PV1C 5CC4A 2L4NA 1V1PB 4BA1I 5JPNC 1Y8OB 4R8NA 1I4RA 3IAYA 5J1ZA 1G2TA 4C1NI 2AQ2B 2JP1A 3HGBA 4N9PA 4HR7B 5KYLA 2PQEA 1ZXTA 2F4IA 1RKNA 2VB3X 2XIWA 2LS01 2KCNA 1B53A 1PDQA 4RGOS 5EBCA 4RAUC 5G3LF 1NR2A 3QJYA 1CZWA 4C3IB 3PO3B 3BDLA 1BXTA 4RWSC 2E76C 1XTCD 4M8AA 4KJNA 2VXWA 1JOQA 4DAYA 3DEPA 2BDNA 1F9PA 1EY8A 2F1MA 4HTHA 3AB9A 3I3CA 1UAPA 3P1HA 1LTRD 4IFDH 3OOCA 5C3XA 1AP0A 3NK9A 1BCPF 3M7NA 2B2YA 3R2TA 3MXPA 1Q8IA 3P7JA 1PMRA 3D8GA 5EKKA 5ISRA 3K6OA 4XT3B 2EYPA 1SYBA 1V1OA 2Z4HA 1Y8NB 1EZ6A 3NTHA 4NP5A 4CKBA 2F0GA 4C56C 1HUMA 1BOSA 3NTKA 2D9UA 5IGFA 5I9PA 2OXPA 2HDLA 3FVQA 1JWMD 5CBEE 4JBWA 1LLRD 4HAEA 3PUWA 1QE6A 3S9WA 3ZYYX 2FMMA 1FR3A 3H6MA 2OEOA 4L63B 1SSOA 1UUPA 2JEBI 3ONAB 1CHQD 1A2TA 2KOLA 2NN6I 3CHBD 3D3RA 3P20A 4A3FB 1CQVA 3OHXC 2PW7A 3OWFA 3QOLA 5HURA 3KBGA 4Z9CB 2BE5D 2FFKB 5C3EB 2V4DA 1FYCA 2KECA 5EQ0A 3S17B 4LMQD 2RDGA 1MD2D 2NN6G 3PUXA 1V43A 4X3UA 2K04A 5CORA 1K83B 4XQNA 3OPOA 5COYA 5E4XA 4LK1C 2JA6B 1SNMA 3GQBA 1FD7D 2B8FA 1JWSD 1VDZA 4DA2A 4A3MB 1G291 2PCFB 3BYTB 2E2DC 1RDPD 1SMYC 3GTPB 1WVLA 1G91A 3GTKB 3J80E 4KKTA 4RGTA 2NZ1D 2M00A 4FO2A 4J8QA 3PMFA 3SR1A 4KY6A 2F0OA 1TS2A 2L55A 1B44D 1XYIA 5KEEA 3H91A 1STHA 3H3VC 2ZT9C 1QILA 5TSSA 1Y8PB 4NDXA 3WOEA 3J7AF 1JICA 1MBYA 1VCIA 1EYDA 1F2LA 4IUTA 5T1GA 3H09A 1ENAA 1EY4A 5BN4A 1GHKA 3VYTA 1B50A 2B2TC 1SE2A 2NYZD 1Q12A 4U673 2IW3A 1D5ZC 2FINB 1GUSA 1SEBD 2IX3A 1SNDA 2PMZB 2F0VA 1RHPA 3TZUA 2R92B 3RLFA 1TU2B 3HEJA 2IT1A 4HCSA 1A15A 2K03A 1BCPC 2ENBA 2PYKA 2DY8A 4KD3A 5LHY1 3EA6A 1GUWA 1CI3M 1DYQA 3Q6SA 2Q8RE 3VR2A 3V05A 1I4GA 2R93B 5C0XI 1E2ZA 1SNOA 3WOFA 2K5QA 2D62A 3BZDB 5CV8A 3SK8A 3BVZA 1BF4A 1S5BD 1I3QB 1JB3A 2QF7A 4BY1B 3HOWB 4X3SA 1RD9D 3I72A 3PV0A 1YNND 3I4MB 1ESRA 1D5XC 5IT9E 3J7YW 3GO5A 4DK1A 3SHLA 2RVLA 2EPBA 1FGBD 3G7LA 2R7ZB 1F2MA 4CKCA 2I07B 2YU9B 1Y1WB 4HMJA 4RHSA 5E1FA 5D3DA 3BG3A 4FXKC 4R8IA 4H7BA 1A2UA 3FPUB 2Q8IB 1JR0D 4ZQ3A 5K5PA 4A3EB 1QNUA 2F0EA 4FXGC 2NB0A 2SDFA 1D1IA 3PUVA 4BWGB 3IL8A 2Z4IA 3L7ZC 5ELDA 3TZDA 1SAPA 2KEEA 3W2DA 1DZ1A 3GTQB 4BA2I 2L5TA 1GJXA 4QUFA 5E3FA 2F0UA 2F03A 2A5HA 1O7YA 1D5MC 1Q90A 4YIJA 1OXVA 5ELFA 1EY5A 1AZQA 2JEAI 2JA8B 2B2VA 2A68D 2MJ8A 1HUNA 2TSSA 1R4PB 1F9RA 1LO5D 1LACA 5E4WC 2CHBD 4IUQA 4DN4M 1LTID 1WTQA 2K32A 3GP7A 5JVG3 5CV7A 3T4AC 1EL0A 4DXGA 1Q1BA 1UEAB 1EOTA 3KF8A 5C0XJ 1NCVA 2ZXPA 3A8IE 2EZVA 1SYDA 1PTOB 3LWUA 2PNRC 4KMUC 3D6CA 3DM1A 2F0DA 1HTLD 2B2TA 3MXNA 1Z6HA 4KD4A 5BN5A 1JQYD 4OO1G 1H9KA 3PO2B 1DONA 4K14A 4HMIA 3PIP3 3T13A 3NP8A 1NAPA 4DNTB 5IOCA 5CGKA 1X3PA 3DXJC 1EEFD 4KV6A 1LTTD 2WIIB 3A8JE 5I2YA 4XIGS 4KTAA 1EFID 2JA5B 5ELCA 3CRKC 3D4DA 3DEOA 3HP3A 2A6ED 1LT4D 4EQNA 3VA7A 1B3AA 2KJXA 2JYOA 3T16A 3S1MB 1EWCA 3GTLB 5CV6A 1RJTA 4G7OC 2B2WA 2K5DA 3I4LA 1VF5C 4I7ZC 4XQJA 4R9WA 1F2YA 3NQIA 2BDOA 3FEWX 1NUCA 4DXFA 1HFGA 1TR5A 4BBSB 4C1NK 3DMUA 2IX1A 5M5WB 2EYMA 2KHSA 2R3ZA 1XWEA 2NVYB 2F0WA 2XRSD 4CHTB 3D6WA 3F2UA 4G4KA 2IJ0A 1PZJD 5KNDA 1PRTD 1AEXA 3MEHA 1U4PA 3SDZA 2HDMA 3OIPA 3N52A 1VMPA 2AUJD 4K5WA 3TP8A 3EQLC 3I8ZA 3KLSX 3HKZB 2DNEA 3QB3A 2EY2A 3SK4A 3S16B 3AMUA 4ZUIA 3A54A 4OL7A 4XYQA 4K2KA 2F3WA 2CQAA 1DOMA 4UAIA 5IGBA 2A73B 1TY0A 1WTXA 1LTBD 4RCOA 5KGUA 2NTSA 4OHJA 1EWHA 2HCCA 3S14B 3GV3A 4HSVA 2WV6D 2D5DA 3SK6A 3HOUB 3J7AV 4BY7B 2F0TA 1TT2A 1EEID 3H94A 2NBFA 1IYUA 3S1RB 2M9VA 1KDAA 3VR3A 5I9OA 2PZWA 3EJIA 2NN6H 5J22A 1AN8A 4TKOB 1PZID 4QF4A 2WB1B 2BOSA 4WRDA 1IKLA 1SYGA 3IFDA 4FF3A 1D6EC 4EGVA 5I2XA 5ELBA 4KY5A 1EIHA 3W3AA 1S5CD 2N55A 1VF7A 1NSNS 1DOLA 5IGDA 1PTOH 1SYCA 1U4RA 4C3JG 2F0IA 1GHJA 1B9MA 5EKLA 3HOZB 2AQ3B 5CV9A 2Q8TA 4DAVA 2WKCA 3EFXD 4XDXA 3K5OA 3NWTA 1GXDC 1H9MA 4L6TB 3BDCA 1WTVA 4IN3A 1KLGD 5I6YA 2XN9C 1CA5A 3K59A 4FF1A 2A6EC 2QEJC 1MSGA 3X3NA 4RKLA 4GZYC 5F2DA 2HCIA 2XNAC 3VYSA 3MHBA 1WTOA 3PUZA 3JAML 1JE4A 1E0BA 2HUGA 2FJ2A 5ELEA 4QCLA 3SE0A 2XVSA 4UDUC 4PNYA 3A8KE 2PW5A 3VR4A 1CM9A 2BA0A 3DUZA 5IGEA 3K0YA 4KN7C 4RCNA 4MN3A 2K28A 3PIO3 4F8MA 1C4QA 2EY6A 5EPLA 4FF2A 3WDNA 2E2IB 2H1EA 3C3LA 3DWQA 3VR6A 2ICIA 2O5IC 3HOVB 3A56A 2RSOA 1S4ZA 3UI2A 2F0LA 4RHRA 1SNQA 3OW7A 4KN4C 2H4OA 3K7AB 1F9QA 2SNMA 1TWHB 2GA4B 1CA6A 4B08A 1PRTC 3BS1A 4IALA 3Q24A 1PXUA 1STNA 1GUOA 4N9TA 1LABA 1SYFA 3NTIA 5A2QE 1SNCA 5DM73 3I90A 2MGSA 4TSSA 1WTPA 2L0CA 2N88A 4FNFA 1PTOD 5C4XB 2ZXRA 3RZOB 4KHZA 4HEDA 2SNSA 1A3TA 1L0YB 1DCZA 1KTKA 4EQPA 2MHVA 2VB2X 1MSHA 4K8JA 3VYUA 3ND8A 4K8IA 5C0XH 2EXZA 1K8MA 2CW0D 2RDHA 3OSOA 2HQEA 4KHVA 1SJED 2M2LA 2AUKA 3BVMA 1KLUD 5FK9C 2DY7A 5IIFA 1FNWA 1HPCA 2F0JA 2EJFC 3C1EA 5FO7B 1HA5A 2FMCA 2WKDA 3A55A 3I70A 1BUVT 2EJMA 2LMCB 5A35A 2TMPA 4OIKA 5NUCA 1A3VA 3MVVA 3BYYB 5EGTA 3J81L 2NVXB 2EYJA 1ZEQX 1HA6A 3MFYA 1C8CA 4LJZC 1IHZA 5JJZA 2XRQD 1LTAD 4X3TA 4AYBB 1BCPB 4DAPA 3HG9A 3SK5A 3AU7A 4IQZA 2AWOA 2EY5A 4C2MB 5FLXL 5KNBA 5JAVA 2Y0SB 5K36H 5CV5A 1JC7A 2F3VA 4C3HG 1SYEA 1T5EA 2EYLA 4NKLA 3S15B 5KYIA 4F88A 3NUCA 4WJWA 1QB5D 2JA7B 5KRUA 2AQ1B 1G8ZD 1W6KA 2Z8LA 2L12A 1OXXK 1LT3D 3NPPA 2F0HA 2BE5C 1D2BA 3DWAA 3QIAA 1IKMA 4DK0A 3MXUA 1J8IA 3NBIA 3PUYA 4A3DB 2NUCA 1STBA 3URYA 4DNRB 3LWEA 3SXHA 5JEAG 3S2DB 5JPMC 3DWPA 3EVQA 3RZDB 3QOJA 2F0KA 5C5MA 3T56B 4KKSA 1TIID 4KKUA 4CKEA 5EPKA 3SEBA 3TP5A 1EY0A 2Z1CA 3K5NA 1G6ZA 3MWYW 1OO9B 5C4ZA 1TWGB 2PZTA 3D4RA 1MGSA 1ET6A 1HFNA 1PFBA 2K33A 4F7XA 2R61A 4ME5A 3T51B 4FYDA 2B2YC 1GUNA 1YNJD 1SJHD 4ZLTF 3KBXA 4RA8A 2EE1A 2IPKD 1F77A 1ESFA 4XXEA 1CQFA 3L3OC 4OO1I 4LAAA 2J4XA 2XWJB 4IZ8A 2K1BA 1H9SA 3HOXB 1PTOC 2NVQB 4Q5VA 4RGNA 4O1NA 1MI2A 1ENFA 3CU7A 3Q23A 1M8AA 1X32A 5T1IA 1KDCA 2RQXA 4QUCA 2IX0A 3CKIB 3MFGA 3HRZC 2X69A 4IUPA 1D1KA 1VMCA 3LX0A 1TS5A 3KLSA 4PQXA 4F87A 2E74C 1OXTA 1Q3LA 1EZ8A 5DM63 5J39A 1Z7TA 2LKVA 3E0JA 1CK1A 3I73A 1CT1D 3C1FA 4CJ2C 4H44C 5JEAJ 2RKSA 1E2WA 1I50B 1KDBA 2A69D 3J80L 1YNNC 1OXSC 1F9SA 1B4OA 3FMCA 1WCMB 2L1BA 3C2PA 3M4YA 1SFOB 2F0FA 5C6AA 3HOYB 4A93B 2JE6I 2QCPX 3MAQA 1CTMA 2O2LD 1WD0A 1QJOA 1SE3A 1FNUA 2F0MA 1II3A 4FP5D 3CRLC 2ID0A 1A6XA 1UNSA 1ML0D 3P75A 4J1MA 4DF7A 3KK7A 4ULLA 2EVBA 1SMYD 5FLXE 3T53B 1WD1A 1PFMA 1PRTF 3R93A 3O13A 3OMCA 5EJWA 2DNCA 1AFPA 2PO4A 3GTGB 4TQUS 4ZK9B 5JVH3 3D4WA 3CQZB 2A6HD 3E6ZX 1ILPA 1QCBD 4C3HB 1EY7A 4K5XA 5IGGA 1ENCA 4ZKCB 4XYOA 3NBHA 3QO2A 5G3LD 2DN8A 5JOBA 4PMWA 3QG1A 1SNPA 1QNKA 4QMGA 5M5YB 1U4MA 1AZPA 1CFMA 5IODA 1WTWA 1STGA 1EYAA 2A68C 2ICEC 3N6RA 4H13C 4ID6A 2FHTA 5FO9B 1EQVA 1BNZA 1IW7D 5EPJA 1YNJC 4HN7A 4BBRB 1BQQT 1HQMC 1E2VA 1R4QB 1U9RA 2WP8J 5M3FB 2VNUD 1EU3A 1BCPD 2G9DA 1HRJA 4ABNA 5IT9L 5HGTA 3S1QB 2NWGA 5BN3A 1O80A 3RMHA 4V0BA 3M85A 1L0XB 1V8QA 3D31A 2C5CA 4G57A 3A7LA 4CGYB 4OIJA 4ZYSA 1EYCA 4IFDI 1ZKOA 2F0QA 2KQ3A 1GUTA 2PPBC 4EQOA 3K5LA 4EVOA 3MZ5A 3ERQA 3G6JB 4E6IA 1SBBB 1H9JA 4ZAIA 2F0NA 2L9HA 4IFDG 4ODGA 1Z47A 2WACA 3GTOB 4FXDA 1Q1EA 4BS9A 3K58A 1TS4A 2K7VA 4WFN3 1ICWA 2LY7A 1O7LA 4ZUJA 2A69C 4A3KB 4PMBA 4CJ0B 4K6DA 2K05A 4IURA 4FF4A 3M4OB 1W6JA 1STEA 5CBAE 1I4QA 1HTPA 2X6LA 2WAQB 1CHPD 5C5LA 3SVMA 2E2HB 2MPMA 5KNCA 4G7HC 2B2UC 1DD2A 4G7ZC 3NE5B 3M7GA 3Q0AA 3R8BA 1V1PA 3X3MA 2L11A 4J6HA 2LFNA 3NQTA 5DEHA 1BO0A 2B2VC 1LT5D 4ILWA 3VYRA 2IL8A 1AW7A 4CBVA 3L9AX 5IGCA 1PYWD 3MA2B 3OIQA 1TWFB 4QIWB 1R9TB 2A6HC 4DFAA 4DGZA 2KVMA 4K6LA 3TN2A 1I4PA 2EJGC 1HXYD 1PLFA 1PTOF 1Y1VB 1TY2A 3K57A 4K2LA 3TP7A 2EYHA 3C46A 1PRTB 1ZYRD 4HCEA 2EYOA 4A3JB 1RTNA 4XTCS 1F2ZA 1STAA 4WORA 1H9SB 2XSCA 1RODA 3U9SA 5LL6S 5EBDA 2F0PA 4OGQC 1LTSD 3GV6A 3A7AB 1QWYA 3M3YB 4KJOA 3RD4A 3Q22A 1GOZA 4IFDJ 3NXWA 1K8OA 4RFBA 1G2SA 1EY9A 1IW7C 1M4VA 1FNVA 1X3QA 5D3IB 4NW2A 3MXGA 5FO8B 1A3UA 2BCOA 4XQQA 1KABA 1KNAA 3MC0B 1B9NA 4XT1B 5M5XB 1EY6A 4A3BB 3BDOA 5FOBB 1I4XA 2PZUA 2R6GA 1DXMA 1BDOA 5JEAH 4M1UB 5M3MB 3BVGA 1PZKD 2B2WC 4NMZA 1B2TA 2WINB 2J0TD 3U9OA 2KUMA 4CJ1B 4RGMA 5C0XG 4C3IG 3GD7A 3R2IA 1QG7A 4A3GB 2XWBB 2AWNA 1Y69U 3KUPA 2E75C 2QDBA 1J9OA 2B63B 1BR9A 1I4HA 2SEBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  3SK8 A;  2F0N A;  3EVQ A;  2F0O A;  4NP5 A;  5CV6 A;  3C1E A;  1TQO A;  4S3S A;  4ODG A;  2EYO A;  1EZ8 A;  2F0K A;  3QOJ A;  5C3W A;  5J39 A;  1EY7 A;  2F0S A;  4PNY A;  1F2Z A;  2WAC A;  4I65 A;  1STA A;  2F0G A;  2LKV A;  4WOR A;  3DHQ A;  3SK6 A;  4K5X A;  5CC4 A;  5C5M A;  5IGG A;  2PW5 A;  1ENC A;  2F0T A;  1TT2 A;  4IUN A;  5IGE A;  3SR1 A;  5NUC A;  1A3V A;  5KEE A;  3C1F A;  3MVV A;  5CV4 A;  5EGT A;  4R8N A;  2RDF A;  1STH A;  5IGF A;  2EYJ A;  2F0P A;  5JOB A;  2OXP A;  5I9P A;  1F2Y A;  3TP5 A;  4ZUJ A;  3SHL A;  4F8M A;  5J1Z A;  1EY0 A;  1IHZ A;  2EY6 A;  1KDA A;  1SNP A;  3S9W A;  4QMG A;  4NDX A;  4QB4 A;  4PMB A;  2RKS A;  2OF1 A;  4N9P A;  1STY A;  1NUC A;  1KDB A;  4KJO A;  5IOD A;  5KYL A;  3H6M A;  2OEO A;  4K6D A;  1F2M A;  5I9O A;  1TR5 A;  2PQE A;  1STG A;  2PZW A;  1EYA A;  2SOB A;  3EJI A;  1EYD A;  1RKN A;  3SK5 A;  3NXW A;  3V2T A;  1EY9 A;  3DMU A;  5CV7 A;  4HMJ A;  2EY5 A;  5M9O A;  5J22 A;  2F0L A;  5E1F A;  1SNQ A;  4ID6 A;  1ENA A;  5C4Z A;  5JAV A;  1A2T A;  1EY4 A;  2EYM A;  2KHS A;  4QF4 A;  2PZT A;  2F0F A;  1EQV A;  5CV5 A;  2F3V A;  4WRD A;  1SYG A;  1SYE A;  2F0W A;  2SNM A;  4H7B A;  4MIU A;  1A2U A;  4F7X A;  5C6A A;  3TP6 A;  1U9R A;  2EYL A;  2PW7 A;  2RBM A;  4ME5 A;  4ZQ3 A;  1SYD A;  3OWF A;  3QOL A;  4NKL A;  3NHH A;  5HUR A;  5K5P A;  5KYI A;  1A3U A;  3NUC A;  4KY5 A;  4B9X A;  3BDL A;  1KAB A;  3D6C A;  3TME A;  4IAL A;  1KAA A;  2F0D A;  5C5L A;  4KD4 A;  1NSN S;  1STN A;  5KRU A;  2F0E A;  4N9T A;  1AEX A;  1SYF A;  1SND A;  3MEH A;  4KJN A;  4B9W A;  1JOQ A;  4K14 A;  1EY6 A;  2EYF A;  4HMI A;  5HGT A;  2F0M A;  5IGD A;  1II3 A;  1SYC A;  2F0V A;  4LAA A;  1SNC A;  3R3O A;  2F0I A;  4IZ8 A;  3T13 A;  2PZU A;  4K5W A;  3VA5 A;  5EKL A;  1EY8 A;  3NP8 A;  4J6H A;  3TP8 A;  3NQT A;  4HTH A;  3P75 A;  5I6W A;  4RKB A;  4KY7 A;  3HEJ A;  4J1M A;  5CV8 A;  4TRD A;  5CV9 A;  4DF7 A;  4DU9 A;  5DEH A;  5IOC A;  5CGK A;  2F0H A;  5KIX A;  4K5V A;  3ITP A;  1JOK A;  3ERO A;  4PMC A;  4KV6 A;  1SNM A;  3P1H A;  2SNS A;  1A3T A;  5DAU A;  2ENB A;  2PYK A;  1KDC A;  3QB3 A;  2EY2 A;  4NMZ A;  5C3X A;  1JOR A;  3BDC A;  4KD3 A;  3NK9 A;  4G57 A;  5CR3 A;  3SK4 A;  4EQP A;  5C4H A;  4KTA A;  4K8J A;  5I6Y A;  5IGC A;  4ZUI A;  3U9O A;  4K8I A;  1EYC A;  2O4X A;  3HZX A;  2EXZ A;  2KQ3 A;  2F0Q A;  3MXP A;  4OL7 A;  5E3F A;  2F0U A;  3OMC A;  4K2K A;  3D4D A;  4EQO A;  3RUZ A;  4DGZ A;  4DFA A;  3OSO A;  3E5S A;  2NUC A;  4RKL A;  2HQE A;  4KHV A;  1STB A;  2F3W A;  3D8G A;  5F2D A;  1JOO A;  3MZ5 A;  3TP7 A;  4EQN A;  4EVO A;  3D4W A;  3ERQ A;  5EKK A;  4YIJ A;  4E6I A;  3LX0 A;  1SNO A;  5IGB A;  5ISR A;  2QDB A;  2EYP A;  3MHB A;  3SXH A;  1EY5 A;  5KGU A;  5IIF A;  3T16 A;  2EY1 A;  2M00 A;  1SYB A;  2F0J A;  4K2L A;  3PMF A;  1EZ6 A;  2EYH A;  4KY6 A; 
#chains in the Genus database with same CATH topology
 1C48 A;  2UXB L;  2O5J C;  5IYC G;  1TQO A;  1RF2 D;  4DV1 L;  3IKJ A;  5DNF A;  1NBW A;  3DHQ A;  2RA4 A;  3OWE B;  4NPS A;  1XX8 A;  5BR8 Q;  4MTK A;  1IL8 A;  3TDQ A;  1O78 A;  1SRO A;  3W5O A;  4JI7 L;  4UY8 C;  3IFT A;  3AFQ A;  3CPF A;  5BR8 L;  2QEX A;  3GTO H;  3FKI B;  1LTG D;  4BY7 G;  4QB4 A;  2B39 A;  4AIM A;  1STY A;  3FDT A;  3G71 A;  2Q2T A;  3H0G B;  4JI8 Q;  2C9O A;  4IPD A;  2L15 A;  3ULP A;  1XXG A;  5FJ8 G;  2SOB A;  1TVX A;  3PSI A;  4A3K H;  3AQQ A;  5M9O A;  2CFM A;  4QJF A;  1S5D D;  3CP0 A;  4JI4 L;  1EU4 A;  4Y7N B;  4JK1 C;  2A19 A;  5K36 G;  4KI0 A;  4MIU A;  1U4L A;  1JE5 A;  3M4O H;  4C3J B;  2RBM A;  4IUV A;  3NHH A;  2ZXO A;  3UE1 A;  4B9X A;  5CYU A;  1N36 L;  4OO1 H;  4V19 0;  1KAA A;  5EKI A;  1OXU A;  4FVM A;  2A8V A;  3MTS A;  3KLR A;  2WB1 G;  4JBK A;  3NEN A;  1EIG A;  2VQE L;  4KK7 A;  4JI1 Q;  1DOK A;  5FKA C;  1A62 A;  1TKW B;  2Z6K C;  1IBL Q;  5D65 A;  4JI0 L;  1VQB A;  3VA5 A;  3NBH B;  3JAM E;  1C0A A;  3QWN A;  4RG1 A;  2E2H H;  3NWS A;  4RKB A;  4KY7 A;  1NY4 A;  3J80 i;  4JG2 A;  2B2U A;  4TRD A;  1TWC B;  1CZG A;  1S5E D;  1K3R A;  4K5V A;  4L8J A;  2K5H A;  1TWA B;  3ERO A;  1KNE A;  4ZKB B;  4RH6 A;  5I4D A;  3TBI B;  1S5F D;  3I4N B;  3NSW A;  3TSS A;  1XNR L;  1BBX C;  4LF8 L;  3I91 A;  4JI5 L;  1QVC A;  1WI5 A;  4UPA A;  5C4H A;  3CC4 A;  3HS0 C;  4HSP A;  2ES2 A;  2QKI C;  2HHH L;  1IBK L;  2CVR A;  2D2C C;  4A3F G;  4GNX C;  4LFB Q;  2RSN A;  2MUY A;  4DV5 L;  3RUZ A;  5D14 A;  1QOH A;  3GTM B;  3FPP A;  5C3E G;  2B8G A;  2K6A A;  1TWF H;  1R9T H;  1VQK A;  1PFN A;  1ZYR C;  2VUM B;  2VY3 A;  2EY1 A;  2DUD A;  2YYZ A;  2QIL A;  2HIV A;  1K0S A;  1HQR D;  2I46 A;  3GTJ B;  3OMG A;  2X6G A;  2KA7 A;  1P16 A;  3PIO A;  1SE4 A;  1XMO L;  5C3W A;  4U68 A;  1D7Q A;  2CW0 C;  1Y1V H;  4LFC Q;  2F0S A;  4I65 A;  3K5M A;  3LNN A;  4O42 A;  1Q81 C;  2JA6 G;  4IUN A;  1DJR D;  1PYB A;  2KCC A;  2G9H D;  5CV4 A;  4A3J H;  1LV9 A;  2RDF A;  2NZO A;  2JSO A;  3FRP B;  1EQT A;  3ND9 A;  2UU9 L;  2OF1 A;  1SDF A;  5LL6 X;  4X3K A;  5AFW A;  3FHW A;  2ALY B;  1SXT A;  3A74 A;  1RTO A;  5C4J B;  1WTR A;  4DKA C;  3V2T A;  4YY3 L;  4P2C B;  2A74 C;  3M3Y H;  1ET9 A;  1CSQ A;  2KED A;  4A3I B;  2JXM B;  1ILQ A;  5CMD A;  3TP6 A;  4J15 A;  1JCK B;  4N8X 1;  1KRS A;  3TME A;  1PVO A;  2NTT A;  4A3L G;  2NVT B;  1RCV D;  4B9W A;  1DM0 B;  1T5X D;  2EYF A;  4GOP A;  1X6O A;  2EOT A;  2K5W A;  4KHP Q;  3R3O A;  2BA1 A;  4Q0F A;  5M5X H;  1HHV A;  2OT2 A;  5I6W A;  2J7Z A;  4DU9 A;  1HCZ A;  2K01 A;  2E2J B;  5KIX A;  1I6V C;  3ITP A;  1JOK A;  1JWU D;  4MHE A;  4PMC A;  4A3B H;  5DAU A;  4IUU A;  2EDG A;  2RHQ B;  1JOR A;  5C44 B;  5CR3 A;  5M3M H;  3J81 E;  1B1Z A;  4ZRZ A;  1IYV A;  1ICF B;  4DR7 Q;  1K0R A;  1GUG A;  1LT6 D;  2O4X A;  3HZX A;  1O7Z A;  2LXK A;  3VR5 A;  3E5S A;  4GKK L;  3V96 A;  1JOO A;  1ONL A;  1NNX A;  2MP1 A;  4MTN A;  4YCW A;  2UXC L;  1I6H B;  1TS3 A;  1LM0 A;  4CDC C;  5A2Q L;  1YHB A;  4A3G H;  1NR4 A;  2R92 G;  1QUQ B;  1H9R A;  1I5F A;  4H0L C;  4GS3 A;  3S2H B;  3S1N B;  4JPB W;  4S3S A;  2IWH A;  4PV1 C;  2KHI A;  2B63 H;  5CC4 A;  2L4N A;  4NXN Q;  1V1P B;  5IWA L;  4BA1 I;  5JPN C;  1Y8O B;  3T1H Q;  1S40 A;  3E9H A;  4R8N A;  3W1G A;  3CF5 A;  1I4R A;  2E8G A;  3IAY A;  5J1Z A;  1G2T A;  4C1N I;  2AQ2 B;  2JP1 A;  3BZC A;  5IYB G;  3HGB A;  4N9P A;  4HR7 B;  5KYL A;  1K28 A;  2R93 G;  2PQE A;  1ZXT A;  2F4I A;  1RKN A;  5LMN Q;  3FKI H;  2VB3 X;  4NXM Q;  2XIW A;  1WOC A;  2LS0 1;  2KCN A;  3H0G H;  1B53 A;  1PDQ A;  4RGO S;  5EBC A;  3I4O A;  1ASY A;  1XMQ Q;  5LMN L;  4RAU C;  5G3L F;  1CKN A;  1NR2 A;  3QJY A;  4DUY L;  1CZW A;  4C3I B;  3PO3 B;  4BY1 G;  4Y7N H;  2LSS A;  1BXT A;  3BDL A;  3HOW G;  4RWS C;  3ULL A;  2E76 C;  3WWV A;  3I4M G;  1XTC D;  1VQO A;  4B3T L;  2KCT A;  2K52 A;  4M8A A;  4KJN A;  2VXW A;  1AE3 A;  4C3J H;  4DAY A;  4DV4 L;  2ATW A;  1JOQ A;  5E7N A;  3DEP A;  4P73 A;  3I55 A;  2BDN A;  2OQK A;  2IY5 B;  1F9P A;  1EY8 A;  2F1M A;  4HTH A;  3AB9 A;  3I3C A;  2R7Z G;  3CAM A;  1UAP A;  3JAM c;  3KF6 B;  3P1H A;  1LTR D;  1Y1W G;  4IFD H;  1VQH A;  4A3C G;  3OOC A;  1GVP A;  5C3X A;  1AP0 A;  3NK9 A;  1TWC H;  1BCP F;  3M7N A;  1TWA H;  2B2Y A;  3R2T A;  2H5X A;  3MXP A;  1CUK A;  1Q8I A;  3I4N H;  3P7J A;  1W2B A;  1PMR A;  3D8G A;  4A3E G;  4LUZ A;  5EKK A;  5ISR A;  1X3E A;  1JJC B;  3K6O A;  4XT3 B;  2EYP A;  4L5R C;  2AKW B;  1SYB A;  1V1O A;  3GTM H;  2Z4H A;  1Y8N B;  1EZ6 A;  3NTH A;  4NP5 A;  1WJJ A;  4CKB A;  1J6Q A;  1YHQ A;  3HKZ E;  2F0G A;  2VUM H;  4C56 C;  1HUM A;  1VQD A;  3GTJ H;  1BOS A;  4DV2 Q;  2BH2 A;  4IJL A;  4DR2 L;  3NTK A;  1YIJ A;  2D9U A;  1MJC A;  4B3S L;  5ELO A;  5IGF A;  5I9P A;  2OXP A;  2K75 A;  2HDL A;  3FVQ A;  1JWM D;  5CBE E;  4JBW A;  1LLR D;  4HAE A;  3PUW A;  1QE6 A;  3S9W A;  5IP7 G;  3ZYY X;  2FMM A;  1FR3 A;  2B3G A;  2JJQ A;  3H6M A;  2ZTD A;  2OEO A;  4B3M Q;  4L63 B;  1SSO A;  2NZH A;  1UUP A;  2JEB I;  3ONA B;  1CHQ D;  1A2T A;  2KOL A;  1MIU A;  2NN6 I;  3CHB D;  1PH2 A;  4R4T A;  4DR6 Q;  3D3R A;  3P20 A;  5C4J H;  4A3F B;  1CQV A;  2DGY A;  2PW7 A;  3OHX C;  3OWF A;  3QOL A;  5HUR A;  1SLJ A;  3KBG A;  3CD6 A;  3I2Z A;  2JA8 G;  4Z9C B;  1NE3 A;  4DR6 L;  2R7F A;  4A3I H;  2BE5 D;  2FFK B;  5C3E B;  1EQR A;  2V4D A;  1FYC A;  4DR3 L;  2KEC A;  5EQ0 A;  3S17 B;  1KHI A;  1BVS A;  4LMQ D;  1N32 Q;  4ME3 A;  1OTC A;  2RDG A;  1MD2 D;  2NN6 G;  1B70 B;  3PUX A;  1V43 A;  2NVT H;  4X3U A;  2K04 A;  2GN5 A;  5COR A;  1K83 B;  3QR8 A;  1AE2 A;  4XQN A;  1E22 A;  2CKZ B;  3OPO A;  4Y52 H;  5COY A;  5E4X A;  4LK1 C;  1EYG A;  2JA6 B;  1SNM A;  3GQB A;  1FD7 D;  4YHH L;  2B8F A;  1JWS D;  1IL2 A;  1QZH A;  1VDZ A;  4JVZ A;  2E2J H;  3CME A;  4OWX B;  4DA2 A;  4A3M B;  1G29 1;  2PCF B;  3BYT B;  2E2D C;  1VQG A;  1RDP D;  5C44 H;  3J81 c;  5GQO A;  4YCU A;  1SMY C;  3GTP B;  3CCE A;  1WVL A;  1G91 A;  3GTK B;  3J80 E;  4KKT A;  3PO2 G;  4RGT A;  2NZ1 D;  1QVF A;  1K8G A;  2M00 A;  4FO2 A;  4J8Q A;  3PMF A;  2CWA A;  4KY6 A;  3SR1 A;  1PHJ A;  3HKS A;  2F0O A;  4H02 A;  5FLX c;  1I6H H;  1TS2 A;  2L55 A;  1NMG A;  1B44 D;  1XYI A;  3ZJY C;  1I94 Q;  5KEE A;  3S2H H;  3S1N H;  1TXY A;  3H91 A;  3UDG A;  4IOC A;  1N34 Q;  1STH A;  4L5S A;  3K7U C;  3H3V C;  1YVC A;  2ZT9 C;  4DV6 L;  1JJ2 A;  1QIL A;  1I94 L;  5TSS A;  4X66 Q;  1Y8P B;  4NDX A;  3PGZ A;  2F4V Q;  2JA5 G;  3WOE A;  3J7A F;  1VQJ A;  1JIC A;  1MBY A;  4JW0 A;  1VCI A;  1EYD A;  1F2L A;  4IUT A;  5T1G A;  3H09 A;  1T9H A;  1XNQ L;  3K81 C;  1ENA A;  1EY4 A;  2DJF C;  4R4O A;  5BN4 A;  1GHK A;  3VYT A;  1B50 A;  4R4Q A;  2B2T C;  3RLO A;  1SE2 A;  2NYZ D;  1Q12 A;  4U67 3;  5GAE C;  4DUZ Q;  2IW3 A;  4P74 A;  1D5Z C;  2FIN B;  1GUS A;  1SEB D;  2IX3 A;  1SND A;  2WAQ E;  4C3I H;  2PMZ B;  1FVI A;  3PO3 H;  2F0V A;  1RHP A;  2WFW A;  3TZU A;  2R92 B;  2ZTC A;  3RLF A;  3J7Z C;  1TU2 B;  3HEJ A;  1CSP A;  2IT1 A;  4BBS G;  4HCS A;  1A15 A;  2K03 A;  5IYD H;  2Z9H A;  1A63 A;  1BCP C;  3STB D;  2ENB A;  1MJE A;  2PYK A;  2DY8 A;  4KD3 A;  5LHY 1;  3G48 A;  3EA6 A;  1GUW A;  1CI3 M;  4HJ9 A;  2JQO A;  1DYQ A;  3Q6S A;  2Q8R E;  2MNA A;  1UWV A;  3KLW A;  3VR2 A;  1FJG L;  3V05 A;  2XGT A;  1I4G A;  3CC2 A;  2R93 B;  4L5T A;  1A0I A;  4DR4 L;  2K50 A;  2D0P A;  5C0X I;  1VQP A;  1E2Z A;  1EOV A;  4QIW E;  3NEL A;  1SNO A;  3WOF A;  2K5Q A;  4WJ3 M;  2D62 A;  3AYH B;  3BZD B;  3VDY A;  5FJ8 H;  1GD7 A;  5CV8 A;  3SK8 A;  4LF9 L;  3BVZ A;  1BF4 A;  1S5B D;  1I3Q B;  1JB3 A;  2QF7 A;  4BY1 B;  5LMN W;  1PH3 A;  3HOW B;  4X3S A;  1RD9 D;  3I72 A;  3PV0 A;  1YNN D;  3I4M B;  2K4K A;  3HKZ G;  1ESR A;  1D5X C;  5IT9 E;  3J7Y W;  3GO5 A;  4DK1 A;  3SHL A;  2RVL A;  1PA6 A;  2UXB Q;  2EPB A;  1FGB D;  4CDD C;  4DV1 Q;  3F1Z A;  3G7L A;  1KL9 A;  2R7Z B;  1F2M A;  4CKC A;  2I07 B;  2GVA A;  2YU9 B;  3TS2 A;  1Y1W B;  4HMJ A;  4RHS A;  5E1F A;  4JI7 Q;  5D3D A;  2P5Z X;  3BG3 A;  4AQY L;  4FDB A;  4FXK C;  4R8I A;  4O0A A;  4H7B A;  1A2U A;  3FPU B;  2Q8I B;  1JR0 D;  4ZQ3 A;  5K5P A;  5ELN A;  3HOU G;  4A3E B;  2AHO B;  5JJI A;  1QNU A;  4A3F H;  1MHW C;  2F0E A;  4FXG C;  3B6Y A;  2NB0 A;  3LGJ A;  4JI4 Q;  2SDF A;  1D1I A;  4QQB X;  1LTL A;  5M3F G;  5C3E H;  3ER0 A;  4AYB E;  3PUV A;  4BWG B;  1N36 Q;  1YEZ A;  2Z4I A;  3IL8 A;  3S17 H;  3L7Z C;  5ELD A;  3TZD A;  2Y0S E;  1SAP A;  2KEE A;  3W2D A;  2VQE Q;  1DZ1 A;  3GTQ B;  1K83 H;  2Q2I A;  4JI0 Q;  4BA2 I;  3KJP A;  2L5T A;  2JA6 H;  1GJX A;  3KDF B;  4QUF A;  2RF4 A;  5E3F A;  2F0U A;  2F03 A;  2A5H A;  4DNI A;  4DK6 C;  4HID A;  3EIV A;  3U50 C;  4DR1 L;  1CKN B;  4A3M H;  2E5L L;  1O7Y A;  1D5M C;  1Q90 A;  4YIJ A;  1XNR Q;  4LF8 Q;  4JYA L;  1OXV A;  5ELF A;  4JI5 Q;  1X56 A;  1EY5 A;  2HHH Q;  1IBK Q;  1E7Z A;  3GTP H;  4DV5 Q;  4DAY B;  3GTK H;  1AZQ A;  2JEA I;  1HNW L;  3HOZ G;  2JA8 B;  2B2V A;  3PCO B;  2A68 D;  2MJ8 A;  2MO0 A;  1HUN A;  2TSS A;  1R4P B;  4JI2 L;  1VQ5 A;  1F9R A;  1LO5 D;  5LMU L;  1LAC A;  3E3X A;  3F2D A;  1GKH A;  3KOJ A;  5E4W C;  2CHB D;  4IUQ A;  4A3L H;  4BXX G;  4DN4 M;  1XMO Q;  4YWM A;  1LTI D;  1WTQ A;  2K32 A;  3GP7 A;  2D0O A;  2VQF L;  5JVG 3;  2YTV A;  3CCS A;  3UDX A;  4PZ8 A;  5CV7 A;  5EAY A;  1N33 Q;  3T4A C;  1EL0 A;  2N8N A;  4DXG A;  1Q1B A;  1UEA B;  1EOT A;  3KF8 A;  5C0X J;  1NCV A;  2UU9 Q;  2ZXP A;  5JJK A;  3A8I E;  2EZV A;  1N33 L;  2C35 B;  2QDL A;  1SYD A;  1HNX L;  5HGQ A;  1PTO B;  3LWU A;  2PNR C;  4KMU C;  3D6C A;  3DM1 A;  2F0D A;  1HTL D;  2B2T A;  4YY3 Q;  3MXN A;  1PH8 A;  1Z6H A;  4KD4 A;  5BN5 A;  1JQY D;  3AEV A;  4OO1 G;  1KXL A;  1H9K A;  3PO2 B;  1DON A;  4K14 A;  4HMI A;  2RHS B;  3PIP 3;  4X64 L;  4UP7 A;  3CCM A;  3T13 A;  2WAQ G;  3NP8 A;  1NAP A;  4DNT B;  5IOC A;  5CGK A;  1X3P A;  1E3P A;  3DXJ C;  2R92 H;  1EEF D;  4KV6 A;  1J5E L;  3HOV G;  3CW2 C;  1VQE A;  1L1O C;  1LTT D;  2WII B;  3A8J E;  4IPC A;  4QY7 A;  5I2Y A;  4XIG S;  4KTA A;  1EFI D;  2JA5 B;  5ELC A;  1KC8 C;  3CRK C;  3D4D A;  3DEO A;  3HP3 A;  2A6E D;  1LT4 D;  4EQN A;  3VA7 A;  1B3A A;  5IYB H;  1Q7Y C;  2KJX A;  3H3V I;  3RR5 A;  1UE7 A;  2JYO A;  2N78 A;  3T16 A;  2R93 H;  3J81 j;  1EWC A;  3S1M B;  2GVB A;  3GTL B;  4L5Q A;  5CV6 A;  3DM3 A;  4GKK Q;  1RJT A;  4UP9 A;  4G7O C;  5C4X G;  2B2W A;  2K5D A;  3PQI A;  2UXC Q;  3I4L A;  4N8F A;  2I5M X;  5AJ3 L;  1VF5 C;  4I7Z C;  1I3Q H;  4R4I A;  4DR5 L;  4XQJ A;  4BY1 H;  4R9W A;  3HOW H;  1F2Y A;  3NQI A;  4NB3 A;  3I4M H;  2BDO A;  3UDI A;  2OQ0 A;  3FEW X;  3MEF A;  1G6P A;  1NUC A;  2JA9 A;  4DXF A;  3A5U A;  1HFG A;  5IT9 c;  3RLN A;  1TR5 A;  5IWA Q;  4BBS B;  1DGS A;  4C1N K;  1EFW A;  3ULJ A;  3BU2 A;  3DMU A;  4OX9 L;  2UXD L;  2IX1 A;  1HNZ L;  5M5W B;  2EYM A;  2KHS A;  4IO9 A;  2R3Z A;  4RMF A;  1XWE A;  2R7Z H;  2NVY B;  2F0W A;  3OTO Q;  1Y1W H;  2XRS D;  4WJ4 A;  4CHT B;  3D6W A;  3F2U A;  4G4K A;  3CCU A;  2IJ0 A;  1PYS B;  4JBJ A;  1V9P A;  1PZJ D;  5KND A;  4LNQ A;  5J3B A;  3OTO L;  1PRT D;  1AEX A;  3MEH A;  2RCN A;  1U4P A;  4GKJ L;  1WFQ A;  3SDZ A;  1EQQ A;  2HDM A;  3KDF A;  3OIP A;  3N52 A;  1B7Y B;  4A3E H;  1VMP A;  2AUJ D;  4DUY Q;  1XPO A;  4K5W A;  1PH7 A;  1UE5 A;  3TP8 A;  3EQL C;  2IHE A;  3I8Z A;  3AFP A;  4AYB G;  4B3T Q;  3KLS X;  1EWI A;  4DV4 Q;  1AH9 A;  3HKZ B;  1K3B C;  1P8L A;  2DNE A;  3QB3 A;  2EY2 A;  2Y0S G;  3SK4 A;  2DJG C;  4DAM A;  1IBM Q;  3S16 B;  4KLK A;  1GM5 A;  3AMU A;  4ZUI A;  3A54 A;  4OL7 A;  4XYQ A;  2A1A A;  4K2K A;  4LFA L;  3GTQ H;  1UEB A;  1PH6 A;  1MKH A;  3TRE A;  1IBM L;  2F3W A;  2CQA A;  1XJV A;  2JA7 G;  1DOM A;  4UAI A;  2RCF A;  5IP7 H;  5IGB A;  2A73 B;  4X62 L;  2Z6K A;  1TY0 A;  1WTX A;  1LTB D;  1VQF A;  4RCO A;  2NTS A;  5KGU A;  4OHJ A;  1EWH A;  2I0Q A;  2HQL A;  2HCC A;  3S14 B;  3GV3 A;  4HSV A;  2WV6 D;  1HZB A;  2D5D A;  3SK6 A;  3HOU B;  3J7A V;  1PH9 A;  3CCQ A;  4BY7 B;  4ZCK A;  2F0T A;  2B63 G;  1TT2 A;  4LF5 Q;  1EEI D;  2JA8 H;  3H94 A;  4GNX A;  2NBF A;  1V1Q A;  1IYU A;  4A75 A;  3S1R B;  2M9V A;  4LF5 L;  1KDA A;  2Q2H A;  4HJ7 A;  3M4P A;  3VR3 A;  5I9O A;  4A3D G;  2PZW A;  3EJI A;  2NN6 H;  4DR2 Q;  2K14 A;  5J22 A;  1AN8 A;  4TKO B;  4B3S Q;  2EXD A;  1PZI D;  2OTL A;  4QF4 A;  1FGU A;  2WB1 B;  4LUO A;  4X65 L;  2BOS A;  4WRD A;  1IKL A;  1SYG A;  3IFD A;  4JI3 L;  1D6E C;  4EGV A;  5I2X A;  1X9N A;  4FF3 A;  1N9W A;  1HZ9 A;  5ELB A;  4KY5 A;  1EIH A;  3W3A A;  1S5C D;  2N55 A;  3TS0 A;  1VF7 A;  1NSN S;  1DOL A;  5IGD A;  1PTO H;  1SYC A;  1U4R A;  4C3J G;  2F0I A;  4GN5 A;  1GHJ A;  1C7Y A;  1B9M A;  5EKL A;  3PO2 H;  3HOZ B;  2AQ3 B;  5CV9 A;  2Q8T A;  4DAV A;  2WKC A;  3EFX D;  4XDX A;  3K5O A;  3UDF A;  3NWT A;  4OWW B;  1GXD C;  1E24 A;  4DR3 Q;  1H9M A;  4L6T B;  3BDC A;  1WTV A;  4IN3 A;  3EN2 A;  1KLG D;  5I6Y A;  2XN9 C;  1CA5 A;  3K59 A;  1X55 A;  4FF1 A;  2A6E C;  2QEJ C;  1L1O A;  1MSG A;  3X3N A;  4OXP A;  4EQ5 A;  2EQS A;  4RKL A;  4GZY C;  5F2D A;  1E1O A;  4YHH Q;  2HCI A;  2JA5 H;  2Z0S A;  2XNA C;  4HJ8 A;  3VYS A;  3MHB A;  1WTO A;  3PUZ A;  3G4S A;  3JAM L;  1JE4 A;  1KRT A;  1E0B A;  1VQ6 A;  2HUG A;  4B3R L;  3HOX G;  3U4Z A;  2FJ2 A;  5ELE A;  4QCL A;  3SE0 A;  2XVS A;  1U0L A;  4HIO A;  4UDU C;  4PNY A;  3S1M H;  5JJL A;  3GTL H;  3A8K E;  2PW5 A;  3VR4 A;  1CM9 A;  2BA0 A;  3DUZ A;  5IGE A;  3K0Y A;  4KN7 C;  4RCN A;  2UUB Q;  4MN3 A;  2K28 A;  3PIO 3;  4F8M A;  1C4Q A;  2EY6 A;  5EPL A;  4FF2 A;  3WDN A;  2E2I B;  2UUB L;  2H1E A;  3C3L A;  2VL6 A;  3DWQ A;  3VR6 A;  2ICI A;  2O5I C;  2QGQ A;  1YJ9 A;  3HOV B;  3A56 A;  2RSO A;  1S4Z A;  2Z6B A;  1HR0 Q;  3UI2 A;  2F0L A;  4RHR A;  4K0K L;  1SNQ A;  3OW7 A;  1S72 A;  3GDE A;  4DV6 Q;  4BBS H;  4KN4 C;  3CCJ A;  2H4O A;  3K7A B;  1F9Q A;  2SNM A;  1TWH B;  3A5Z B;  4GLV B;  2GA4 B;  1CA6 A;  5HY6 A;  1HR0 L;  4B08 A;  1PRT C;  2HIX A;  3BS1 A;  5M5W H;  1YI2 A;  3E9I A;  2NVY H;  4IAL A;  3D0F A;  5GAG C;  3Q24 A;  1XNQ Q;  1PXU A;  2OCE A;  1STN A;  1GUO A;  4N9T A;  1LAB A;  1SYF A;  3NTI A;  1ASZ A;  5A2Q E;  4IJH A;  1SNC A;  5DM7 3;  3I90 A;  2MGS A;  4I7A A;  4GN4 B;  4TSS A;  1WTP A;  3G6E A;  2L0C A;  2N88 A;  4LF7 L;  3J7A 5;  4FNF A;  1PTO D;  5C4X B;  4GLX A;  2ZXR A;  1YNX A;  3ERS X;  2QW7 A;  4IPH A;  4KHZ A;  3RZO B;  4DV3 L;  4HED A;  2SNS A;  3ICE A;  1A3T A;  1VQC A;  1L0Y B;  1BKB A;  1DCZ A;  1WCM G;  1KTK A;  4EQP A;  2MHV A;  2VB2 X;  1MSH A;  4K8J A;  3VYU A;  3ND8 A;  2JK8 A;  4K8I A;  3HOY G;  5C0X H;  2EXZ A;  1K8M A;  1C9O A;  4A93 G;  2CW0 D;  2N49 A;  3KF8 B;  2RDH A;  1CKM A;  3OSO A;  2HQE A;  4KHV A;  1SJE D;  3S16 H;  2M2L A;  2AUK A;  3BVM A;  1KLU D;  5C44 G;  1PV4 A;  5FK9 C;  3H15 A;  2DY7 A;  5IIF A;  1FNW A;  1HPC A;  2F0J A;  3MXN B;  2EJF C;  5IYC H;  1FJG Q;  3C1E A;  5FO7 B;  1HA5 A;  2FMC A;  2WKD A;  3A55 A;  4DR4 Q;  3I70 A;  1BUV T;  1D8L A;  1KQS A;  2IHF A;  2EJM A;  2LMC B;  5A35 A;  4JC0 A;  3RN5 A;  2TMP A;  4OIK A;  5NUC A;  3S14 H;  1A3V A;  3MVV A;  1SN8 A;  2KEN A;  3BYY B;  5EGT A;  3CCL A;  3J81 L;  2NVX B;  2EYJ A;  3HOU H;  1ZEQ X;  4BY7 H;  1HA6 A;  3MFY A;  4LF9 Q;  1C8C A;  4LJZ C;  4GOP C;  1IHZ A;  5JJZ A;  1H95 A;  2XRQ D;  1LTA D;  4JI6 L;  4X3T A;  5IP9 G;  2ZJR A;  1IXR A;  4AYB B;  1BCP B;  4DAP A;  3HG9 A;  2PNH A;  3AU7 A;  3SK5 A;  3S1R H;  4IQZ A;  1SRU A;  1HH2 P;  2AWO A;  1LYL A;  2EY5 A;  4C2M B;  5FLX L;  5KNB A;  5JAV A;  2Y0S B;  5K36 H;  4OEM B;  2VW9 A;  1K8A C;  5CV5 A;  1JC7 A;  2F3V A;  4C3H G;  1SYE A;  3CCR A;  1T5E A;  2EYL A;  4NKL A;  2I5H A;  3S15 B;  5KYI A;  4F88 A;  3NUC A;  1WYD A;  4ALP A;  4WJW A;  4LF6 L;  1QB5 D;  2JA7 B;  5KRU A;  1N8R C;  4AQY Q;  2AQ1 B;  1G8Z D;  4P75 A;  3L2P A;  1QZG A;  1W6K A;  2Z8L A;  2MFI A;  2L12 A;  4YCV A;  1OXX K;  5FLM G;  2CQO A;  1LT3 D;  4GLA C;  3NPP A;  1M90 C;  2ZJP A;  1VQ8 A;  3UE0 A;  2F0H A;  2HT1 A;  2BE5 C;  3KYH C;  3DWA A;  3QIA A;  1D2B A;  1IKM A;  3HOZ H;  4DV7 L;  4DK0 A;  3MXU A;  2F52 A;  1PH1 A;  1J8I A;  4DV0 L;  4UHV A;  3NBI A;  4BBR G;  1KIX A;  3PUY A;  4A3D B;  2NUC A;  1PFS A;  2F3I A;  1STB A;  4BXX H;  3URY A;  4DNR B;  2N3S A;  3LWE A;  3SXH A;  5JEA G;  1EIY B;  4LF4 Q;  3S2D B;  5JPM C;  3DWP A;  3EVQ A;  3OYY A;  3RZD B;  3QOJ A;  2F0K A;  4DR1 Q;  4JI8 L;  4LF4 L;  2E5L Q;  5C5M A;  1FL0 A;  3T56 B;  1VQ4 A;  4JYA Q;  4KKS A;  4YWL A;  1TII D;  4KKU A;  4CKE A;  5EPK A;  1NMF A;  1VQL A;  3SEB A;  2XTI A;  1QVG A;  3TP5 A;  1EY0 A;  3CMA A;  1HNW Q;  2HD3 A;  2CCZ A;  3F2C A;  2CWP A;  3RN2 A;  2ASB A;  3J80 c;  2CH4 A;  2Z1C A;  4HIK A;  1GO3 E;  3K5N A;  1G6Z A;  4OEL B;  4JI2 Q;  3MWY W;  5LMU Q;  1OO9 B;  2E2I H;  5C4Z A;  3E0E A;  1TWG B;  2PZT A;  3D4R A;  1MGS A;  3M4Q A;  4JI1 L;  1ET6 A;  1HFN A;  1VQ9 A;  1PFB A;  2K33 A;  3HOV H;  4F7X A;  2R61 A;  1IBL L;  4ME5 A;  3T51 B;  2VQF Q;  4HJA A;  1Q82 C;  4FYD A;  2B2Y C;  1GUN A;  1YNJ D;  1SJH D;  3K7A H;  4ZLT F;  1TWH H;  3KBX A;  4RA8 A;  2EE1 A;  3NEM A;  2IPK D;  1F77 A;  1ESF A;  4XXE A;  4HJ5 A;  1CQF A;  3L3O C;  4OO1 I;  1YHA A;  2XWJ B;  2J4X A;  4LAA A;  4IZ8 A;  2K1B A;  4A3K G;  1H9S A;  3HOX B;  1HNX Q;  1PTO C;  2NVQ B;  4UP8 A;  4Q5V A;  4LFB L;  4RGN A;  4O1N A;  4GNX B;  1MI2 A;  1ENF A;  3CU7 A;  3Q23 A;  1M8A A;  1X32 A;  2PQA B;  3F8T A;  4DK3 C;  2VS1 A;  1JT8 A;  5T1I A;  1KDC A;  2Q2U A;  5GRO A;  2RQX A;  4QUC A;  2IX0 A;  3CKI B;  3MFG A;  3PF5 A;  4X64 Q;  5C4X H;  1Z9F A;  3HRZ C;  3RZO H;  2X69 A;  4IUP A;  3H3V H;  1RIP A;  1J5E Q;  4LFC L;  2B29 A;  3W1B A;  1D1K A;  3STB C;  1VMC A;  3LX0 A;  4A3M G;  1TS5 A;  5IY0 A;  3KLS A;  2AMC B;  4PQX A;  4F87 A;  2E74 C;  1OXT A;  3OW2 A;  3S24 A;  3HFZ B;  1A8V A;  1Q3L A;  1JJG A;  1EZ8 A;  5DM6 3;  5J39 A;  1Z7T A;  2LKV A;  4X6A H;  1SR3 A;  3IRB A;  4JCV E;  3E0J A;  1HR0 W;  1CK1 A;  3BJU A;  3I73 A;  1CT1 D;  3C1F A;  4P72 A;  4HIM A;  4CJ2 C;  4H44 C;  2JN4 A;  1Y14 B;  5JEA J;  3KJO A;  1HJP A;  2RKS A;  1E2W A;  1I50 B;  1KDB A;  2A69 D;  2NVX H;  3A0J A;  4P71 A;  1O7I A;  3J80 L;  1YNN C;  1OXS C;  5AJ3 Q;  1L1O B;  1F9S A;  1M1K C;  4DR5 Q;  1B4O A;  3FMC A;  1WCM B;  1Y1V G;  2L1B A;  3C2P A;  1Q46 A;  3M4Y A;  3L0O A;  2F0F A;  1SFO B;  2ZTE A;  4APV A;  3SGI A;  5C6A A;  3HOY B;  4KHP L;  1PH4 A;  4C2M H;  4A93 B;  4A3J G;  2OTJ A;  4TVA B;  3JC6 6;  2JE6 I;  2QCP X;  1HZA A;  3MAQ A;  4OX9 Q;  1CTM A;  2O2L D;  1WD0 A;  5IE8 A;  2UXD Q;  1EUJ A;  2ZJQ A;  1HNZ Q;  1QJO A;  1SE3 A;  1FNU A;  3S15 H;  2F0M A;  1II3 A;  4FP5 D;  3CRL C;  4CDF C;  2ID0 A;  4JOI C;  2JA7 H;  4DR7 L;  1A6X A;  1UNS A;  2VZA A;  1ML0 D;  3P75 A;  4IPG A;  4J1M A;  2YU9 H;  4DF7 A;  3KK7 A;  4ULL A;  2EVB A;  1SMY D;  5FLX E;  3RNU A;  4A3C H;  1VQA A;  1BBW A;  4GKJ Q;  3T53 B;  1WD1 A;  1PFM A;  1PRT F;  3R93 A;  4PG3 A;  4DPG A;  3O13 A;  1K73 C;  3OMC A;  2MO1 A;  5EJW A;  2DNC A;  1AFP A;  2PO4 A;  3U58 A;  3GTG B;  4TQU S;  4ZK9 B;  5JVH 3;  1SMX A;  3D4W A;  3CQZ B;  4NXN L;  2A6H D;  3E6Z X;  1ILP A;  3T1H L;  4A3D H;  1QCB D;  5L37 A;  3PF4 A;  4C3H B;  4A3B G;  4LFA Q;  4PZ6 A;  1EY7 A;  5M3M G;  4K5X A;  5IGG A;  3CPW A;  3S2D H;  1ENC A;  4ZKC B;  4XYO A;  4X62 Q;  3NBH A;  1XPR A;  1X65 A;  1HZC A;  2G5D A;  3QO2 A;  5G3L D;  2DN8 A;  3RZD H;  4NXM L;  2I5L X;  5JOB A;  4PMW A;  4MZ9 A;  3KFU A;  3QG1 A;  4YWK A;  1XMQ L;  1SNP A;  1QNK A;  4QMG A;  5M5Y B;  1U4M A;  1AZP A;  1CFM A;  5IOD A;  1B3Q A;  1WTW A;  1STG A;  1EYA A;  4A3G G;  2A68 C;  2ICE C;  3N6R A;  4H13 C;  4ID6 A;  3JAM i;  2FHT A;  5FO9 B;  1EQV A;  1BNZ A;  2K5V A;  1IW7 D;  5EPJ A;  1YNJ C;  4HN7 A;  1BQQ T;  1HQM C;  4BBR B;  1E2V A;  1R4Q B;  1U9R A;  1L2F A;  2WP8 J;  5M3F B;  5H1S E;  4EX5 A;  1TWG H;  2VNU D;  4O2D A;  2PQA A;  1EU3 A;  3BZK A;  3I56 A;  1BCP D;  2G9D A;  1HRJ A;  4ABN A;  3CCV A;  1JB7 A;  5IT9 L;  5HGT A;  3S1Q B;  4X65 Q;  2NWG A;  4JI3 Q;  5GAD C;  3FKI G;  5BN3 A;  1YJN A;  1XTD A;  2PI2 E;  1O80 A;  3H0G G;  3RMH A;  4V0B A;  3M85 A;  2BH8 A;  3HOX H;  2R7D A;  2NVQ H;  1L0X B;  1V8Q A;  3D31 A;  2C5C A;  2KBN A;  4G57 A;  1SE8 A;  3A7L A;  4CGY B;  4OIJ A;  4ZYS A;  1EYC A;  4IFD I;  1ZKO A;  2F0Q A;  2KQ3 A;  1GUT A;  2PPB C;  4EQO A;  1G51 A;  1X3F A;  3K5L A;  4EVO A;  3EBE A;  3MZ5 A;  3ERQ A;  3G6J B;  4E6I A;  4DV2 L;  1SBB B;  2MQH A;  1H9J A;  4ZAI A;  2F0N A;  2L9H A;  4IFD G;  4ODG A;  1Z47 A;  4A4I A;  3CXC A;  3I7F A;  2WAC A;  3GTO B;  4OWT B;  4FXD A;  4QGU A;  4B3M L;  1W3S A;  2YTY A;  1Q1E A;  4BS9 A;  3K58 A;  3U4V A;  1TS4 A;  2K7V A;  4WFN 3;  3I4N G;  1ICW A;  2LY7 A;  1O7L A;  4ZUJ A;  4B3R Q;  2A69 C;  4A3K B;  1IYJ B;  4PMB A;  1X3G A;  2KHJ A;  4R4C A;  4CJ0 B;  4K6D A;  1Q8K A;  2K05 A;  4IUR A;  4FF4 A;  3M4O B;  1VQM A;  1XPU A;  1I50 H;  1W6J A;  1LUZ A;  1STE A;  3CC7 A;  3FP9 A;  2VUM G;  1N32 L;  3DLL A;  5CBA E;  3PIP A;  1I4Q A;  1HTP A;  2X6L A;  2V1C C;  1WCM H;  2WB1 E;  2WAQ B;  1S3O A;  1SFO H;  1CHP D;  5C5L A;  3SVM A;  3HOY H;  1QUQ A;  4K0K Q;  3J81 i;  2E2H B;  3TQY A;  2MPM A;  4A93 H;  5KNC A;  4JV5 Q;  4G7H C;  1KD1 C;  2B2U C;  1DD2 A;  4G7Z C;  3NE5 B;  2KCM A;  3M7G A;  3Q0A A;  3R8B A;  1V1P A;  3X3M A;  3F2B A;  2L11 A;  4J6H A;  1BBU A;  2YTX A;  2LFN A;  3NQT A;  5GAH C;  1VQ7 A;  4JV5 L;  4PZ7 A;  5DEH A;  4JOI A;  1BO0 A;  1JMC A;  2B2V C;  1LT5 D;  4ILW A;  4POG A;  3VYR A;  1NTG A;  2IL8 A;  1AW7 A;  4CBV A;  1Q86 C;  3L9A X;  4A3I G;  5IGC A;  1PYW D;  2PI2 A;  3MA2 B;  4JBM A;  1IZ6 A;  3OIQ A;  1X54 A;  1TWF B;  4QIW B;  1R9T B;  4LF7 Q;  2A6H C;  4DFA A;  4DGZ A;  2KVM A;  4K6L A;  4DV3 Q;  3TN2 A;  1I4P A;  2EJG C;  1HXY D;  4R1J A;  1PLF A;  1PTO F;  1Y1V B;  5IP9 H;  1TY2 A;  3K57 A;  2FXQ A;  1N34 L;  3GTG H;  4K2L A;  3TP7 A;  4LW1 A;  2EYH A;  3C46 A;  3CQZ H;  1PRT B;  1ZYR D;  4POF A;  4HCE A;  2EYO A;  4A3J B;  4OON A;  4X66 L;  2F4V L;  3T1Y Q;  1RTN A;  4XTC S;  1F2Z A;  1PH5 A;  1STA A;  4WOR A;  1H9S B;  3K8A A;  4C3H H;  3TRZ A;  1K9M C;  2XSC A;  1ROD A;  3U9S A;  3T1Y L;  1YJW A;  5LL6 S;  2QA4 A;  5EBD A;  2F0P A;  2OWO A;  5DLQ E;  4OGQ C;  1LTS D;  3GV6 A;  3A7A B;  3KF6 A;  1QWY A;  4CDE C;  1YBY A;  4GN3 B;  3M3Y B;  4KJO A;  4DUZ L;  1UE6 A;  3RD4 A;  3Q22 A;  1GOZ A;  4IFD J;  1VS0 A;  4A76 A;  5FLM H;  3M9B A;  3NXW A;  1K8O A;  4RFB A;  1G2S A;  1EY9 A;  1IW7 C;  5M5Y H;  1YIT A;  1M4V A;  1FNV A;  1X3Q A;  5D3I B;  1KAW A;  4NW2 A;  4JI6 Q;  3MXG A;  1VQN A;  5FO8 B;  4LUV A;  1A3U A;  2BCO A;  1L0W A;  4XQQ A;  1KAB A;  1KNA A;  3MC0 B;  1B9N A;  4XT1 B;  5M5X B;  4BBR H;  1EY6 A;  2ZM6 Q;  5M3F H;  2YV5 A;  1VQI A;  2LXJ A;  3K80 C;  3BDO A;  4A3B B;  1I4X A;  5FOB B;  2PZU A;  4AH6 A;  2R6G A;  3K0X A;  1U5K A;  1RL2 A;  2ZM6 L;  1DXM A;  1NJI C;  1BDO A;  3TEH B;  2UUA Q;  4LF6 Q;  5JEA H;  3S1Q H;  4M1U B;  5M3M B;  2UUC Q;  1EIF A;  3BVG A;  4LWC A;  1PZK D;  2UUA L;  2B2W C;  4NMZ A;  1E1T A;  1YZ6 A;  2K5N A;  2UUC L;  1B2T A;  4MNO A;  2WIN B;  4GOP B;  2J0T D;  1B8A A;  3U9O A;  4QL5 A;  2KUM A;  4CJ1 B;  4RGM A;  5C0X G;  4C3I G;  3GD7 A;  3PO3 G;  2EIF A;  1WTH A;  3R2I A;  3Q8D A;  1QG7 A;  2CH4 W;  4A3G B;  4IOA A;  2XWB B;  2PMZ E;  2AWN A;  1CKO A;  1Y69 U;  4DV7 Q;  3KUP A;  2E75 C;  2QDB A;  1J9O A;  2B63 B;  1BR9 A;  1UE1 A;  4DV0 Q;  1I4H A;  2SEB D;  5IYD G; 
#chains in the Genus database with same CATH homology
 1C48 A;  2O5J C;  1TQO A;  1RF2 D;  3IKJ A;  5DNF A;  3DHQ A;  2RA4 A;  3OWE B;  1XX8 A;  1IL8 A;  3TDQ A;  1O78 A;  3IFT A;  3FKI B;  1LTG D;  4QB4 A;  2B39 A;  1STY A;  3FDT A;  3H0G B;  2C9O A;  1XXG A;  2SOB A;  1TVX A;  5M9O A;  1S5D D;  1EU4 A;  4Y7N B;  4JK1 C;  5K36 G;  4KI0 A;  4MIU A;  1U4L A;  4C3J B;  2RBM A;  4IUV A;  3NHH A;  2ZXO A;  4B9X A;  5CYU A;  4OO1 H;  4V19 0;  1KAA A;  5EKI A;  1OXU A;  4FVM A;  3MTS A;  3KLR A;  1EIG A;  4KK7 A;  1DOK A;  5FKA C;  1TKW B;  5D65 A;  3JAM E;  3VA5 A;  3QWN A;  3NWS A;  4RKB A;  4KY7 A;  4TRD A;  2B2U A;  1TWC B;  1CZG A;  1S5E D;  4K5V A;  4L8J A;  3ERO A;  1TWA B;  1KNE A;  4ZKB B;  4RH6 A;  5I4D A;  3TBI B;  1S5F D;  3I4N B;  3NSW A;  3TSS A;  1BBX C;  3I91 A;  5C4H A;  3HS0 C;  4HSP A;  2QKI C;  2CVR A;  2D2C C;  2RSN A;  2MUY A;  3RUZ A;  5D14 A;  1QOH A;  3GTM B;  3FPP A;  2B8G A;  2K6A A;  1PFN A;  1ZYR C;  2VUM B;  2EY1 A;  2YYZ A;  2QIL A;  1HQR D;  2I46 A;  3GTJ B;  3OMG A;  2X6G A;  2KA7 A;  1SE4 A;  5C3W A;  4U68 A;  2CW0 C;  2F0S A;  4I65 A;  3K5M A;  3LNN A;  4O42 A;  4IUN A;  1DJR D;  2KCC A;  2G9H D;  5CV4 A;  1LV9 A;  2RDF A;  2JSO A;  3FRP B;  1EQT A;  3ND9 A;  2OF1 A;  1SDF A;  5LL6 X;  4X3K A;  5AFW A;  1SXT A;  5C4J B;  1RTO A;  1WTR A;  3V2T A;  4P2C B;  2A74 C;  1ET9 A;  4A3I B;  2KED A;  2JXM B;  1ILQ A;  5CMD A;  3TP6 A;  1JCK B;  3TME A;  2NTT A;  2NVT B;  1RCV D;  4B9W A;  1DM0 B;  1T5X D;  2EYF A;  2EOT A;  2K5W A;  3R3O A;  2BA1 A;  4Q0F A;  1HHV A;  2OT2 A;  5I6W A;  2J7Z A;  4DU9 A;  1HCZ A;  2K01 A;  2E2J B;  5KIX A;  1I6V C;  3ITP A;  1JOK A;  1JWU D;  4MHE A;  4PMC A;  5DAU A;  4IUU A;  2EDG A;  1JOR A;  5C44 B;  5CR3 A;  3J81 E;  1B1Z A;  4ZRZ A;  1IYV A;  1GUG A;  1LT6 D;  2O4X A;  3HZX A;  1O7Z A;  3VR5 A;  3E5S A;  3V96 A;  1JOO A;  1ONL A;  2MP1 A;  1I6H B;  1TS3 A;  5A2Q L;  1NR4 A;  1H9R A;  4H0L C;  3S2H B;  3S1N B;  4S3S A;  2IWH A;  4PV1 C;  5CC4 A;  2L4N A;  1V1P B;  4BA1 I;  5JPN C;  1Y8O B;  4R8N A;  1I4R A;  3IAY A;  5J1Z A;  1G2T A;  4C1N I;  2AQ2 B;  2JP1 A;  3HGB A;  4N9P A;  4HR7 B;  5KYL A;  2PQE A;  1ZXT A;  2F4I A;  1RKN A;  2VB3 X;  2XIW A;  2LS0 1;  2KCN A;  1B53 A;  1PDQ A;  4RGO S;  5EBC A;  4RAU C;  5G3L F;  1NR2 A;  3QJY A;  1CZW A;  4C3I B;  3PO3 B;  3BDL A;  1BXT A;  4RWS C;  2E76 C;  1XTC D;  4M8A A;  4KJN A;  2VXW A;  1JOQ A;  4DAY A;  3DEP A;  2BDN A;  1F9P A;  1EY8 A;  2F1M A;  4HTH A;  3AB9 A;  3I3C A;  1UAP A;  3P1H A;  1LTR D;  4IFD H;  3OOC A;  5C3X A;  1AP0 A;  3NK9 A;  1BCP F;  3M7N A;  2B2Y A;  3R2T A;  3MXP A;  1Q8I A;  3P7J A;  1PMR A;  3D8G A;  5EKK A;  5ISR A;  3K6O A;  4XT3 B;  2EYP A;  1SYB A;  1V1O A;  2Z4H A;  1Y8N B;  1EZ6 A;  3NTH A;  4NP5 A;  4CKB A;  2F0G A;  4C56 C;  1HUM A;  1BOS A;  3NTK A;  2D9U A;  5IGF A;  5I9P A;  2OXP A;  2HDL A;  3FVQ A;  1JWM D;  5CBE E;  4JBW A;  1LLR D;  4HAE A;  3PUW A;  1QE6 A;  3S9W A;  3ZYY X;  2FMM A;  1FR3 A;  3H6M A;  2OEO A;  4L63 B;  1SSO A;  1UUP A;  2JEB I;  3ONA B;  1CHQ D;  1A2T A;  2KOL A;  2NN6 I;  3CHB D;  3D3R A;  3P20 A;  4A3F B;  1CQV A;  3OHX C;  2PW7 A;  3OWF A;  3QOL A;  5HUR A;  3KBG A;  4Z9C B;  2BE5 D;  2FFK B;  5C3E B;  2V4D A;  1FYC A;  2KEC A;  5EQ0 A;  3S17 B;  4LMQ D;  2RDG A;  1MD2 D;  2NN6 G;  3PUX A;  1V43 A;  4X3U A;  2K04 A;  5COR A;  1K83 B;  4XQN A;  3OPO A;  5COY A;  5E4X A;  4LK1 C;  2JA6 B;  1SNM A;  3GQB A;  1FD7 D;  2B8F A;  1JWS D;  1VDZ A;  4DA2 A;  4A3M B;  1G29 1;  2PCF B;  3BYT B;  2E2D C;  1RDP D;  1SMY C;  3GTP B;  1WVL A;  1G91 A;  3GTK B;  3J80 E;  4KKT A;  4RGT A;  2NZ1 D;  2M00 A;  4FO2 A;  4J8Q A;  3PMF A;  3SR1 A;  4KY6 A;  2F0O A;  1TS2 A;  2L55 A;  1B44 D;  1XYI A;  5KEE A;  3H91 A;  1STH A;  3H3V C;  2ZT9 C;  1QIL A;  5TSS A;  1Y8P B;  4NDX A;  3WOE A;  3J7A F;  1JIC A;  1MBY A;  1VCI A;  1EYD A;  1F2L A;  4IUT A;  5T1G A;  3H09 A;  1ENA A;  1EY4 A;  5BN4 A;  1GHK A;  3VYT A;  1B50 A;  2B2T C;  1SE2 A;  2NYZ D;  1Q12 A;  4U67 3;  2IW3 A;  1D5Z C;  2FIN B;  1GUS A;  1SEB D;  2IX3 A;  1SND A;  2PMZ B;  2F0V A;  1RHP A;  3TZU A;  2R92 B;  3RLF A;  1TU2 B;  3HEJ A;  2IT1 A;  4HCS A;  1A15 A;  2K03 A;  1BCP C;  2ENB A;  2PYK A;  2DY8 A;  4KD3 A;  5LHY 1;  3EA6 A;  1GUW A;  1CI3 M;  1DYQ A;  3Q6S A;  2Q8R E;  3VR2 A;  3V05 A;  1I4G A;  2R93 B;  5C0X I;  1E2Z A;  1SNO A;  3WOF A;  2K5Q A;  2D62 A;  3BZD B;  5CV8 A;  3SK8 A;  3BVZ A;  1BF4 A;  1S5B D;  1I3Q B;  1JB3 A;  2QF7 A;  4BY1 B;  3HOW B;  4X3S A;  1RD9 D;  3I72 A;  3PV0 A;  1YNN D;  3I4M B;  1ESR A;  1D5X C;  5IT9 E;  3J7Y W;  3GO5 A;  4DK1 A;  3SHL A;  2RVL A;  2EPB A;  1FGB D;  3G7L A;  2R7Z B;  1F2M A;  4CKC A;  2I07 B;  2YU9 B;  1Y1W B;  4HMJ A;  4RHS A;  5E1F A;  5D3D A;  3BG3 A;  4FXK C;  4R8I A;  4H7B A;  1A2U A;  3FPU B;  2Q8I B;  1JR0 D;  4ZQ3 A;  5K5P A;  4A3E B;  1QNU A;  2F0E A;  4FXG C;  2NB0 A;  2SDF A;  1D1I A;  3PUV A;  4BWG B;  3IL8 A;  2Z4I A;  3L7Z C;  5ELD A;  3TZD A;  1SAP A;  2KEE A;  3W2D A;  1DZ1 A;  3GTQ B;  4BA2 I;  2L5T A;  1GJX A;  4QUF A;  5E3F A;  2F0U A;  2F03 A;  2A5H A;  1O7Y A;  1D5M C;  1Q90 A;  4YIJ A;  1OXV A;  5ELF A;  1EY5 A;  1AZQ A;  2JEA I;  2JA8 B;  2B2V A;  2A68 D;  2MJ8 A;  1HUN A;  2TSS A;  1R4P B;  1F9R A;  1LO5 D;  1LAC A;  5E4W C;  2CHB D;  4IUQ A;  4DN4 M;  1LTI D;  1WTQ A;  2K32 A;  3GP7 A;  5JVG 3;  5CV7 A;  3T4A C;  1EL0 A;  4DXG A;  1Q1B A;  1UEA B;  1EOT A;  3KF8 A;  5C0X J;  1NCV A;  2ZXP A;  3A8I E;  2EZV A;  1SYD A;  1PTO B;  3LWU A;  2PNR C;  4KMU C;  3D6C A;  3DM1 A;  2F0D A;  1HTL D;  2B2T A;  3MXN A;  1Z6H A;  4KD4 A;  5BN5 A;  1JQY D;  4OO1 G;  1H9K A;  3PO2 B;  1DON A;  4K14 A;  4HMI A;  3PIP 3;  3T13 A;  3NP8 A;  1NAP A;  4DNT B;  5IOC A;  5CGK A;  1X3P A;  3DXJ C;  1EEF D;  4KV6 A;  1LTT D;  2WII B;  3A8J E;  5I2Y A;  4XIG S;  4KTA A;  1EFI D;  2JA5 B;  5ELC A;  3CRK C;  3D4D A;  3DEO A;  3HP3 A;  2A6E D;  1LT4 D;  4EQN A;  3VA7 A;  1B3A A;  2KJX A;  2JYO A;  3T16 A;  3S1M B;  1EWC A;  3GTL B;  5CV6 A;  1RJT A;  4G7O C;  2B2W A;  2K5D A;  3I4L A;  1VF5 C;  4I7Z C;  4XQJ A;  4R9W A;  1F2Y A;  3NQI A;  2BDO A;  3FEW X;  1NUC A;  4DXF A;  1HFG A;  1TR5 A;  4BBS B;  4C1N K;  3DMU A;  2IX1 A;  5M5W B;  2EYM A;  2KHS A;  2R3Z A;  1XWE A;  2NVY B;  2F0W A;  2XRS D;  4CHT B;  3D6W A;  3F2U A;  4G4K A;  2IJ0 A;  1PZJ D;  5KND A;  1PRT D;  1AEX A;  3MEH A;  1U4P A;  3SDZ A;  2HDM A;  3OIP A;  3N52 A;  1VMP A;  2AUJ D;  4K5W A;  3TP8 A;  3EQL C;  3I8Z A;  3KLS X;  3HKZ B;  2DNE A;  3QB3 A;  2EY2 A;  3SK4 A;  3S16 B;  3AMU A;  4ZUI A;  3A54 A;  4OL7 A;  4XYQ A;  4K2K A;  2F3W A;  2CQA A;  1DOM A;  4UAI A;  5IGB A;  2A73 B;  1TY0 A;  1WTX A;  1LTB D;  4RCO A;  5KGU A;  2NTS A;  4OHJ A;  1EWH A;  2HCC A;  3S14 B;  3GV3 A;  4HSV A;  2WV6 D;  2D5D A;  3SK6 A;  3HOU B;  3J7A V;  4BY7 B;  2F0T A;  1TT2 A;  1EEI D;  3H94 A;  2NBF A;  1IYU A;  3S1R B;  2M9V A;  1KDA A;  3VR3 A;  5I9O A;  2PZW A;  3EJI A;  2NN6 H;  5J22 A;  1AN8 A;  4TKO B;  1PZI D;  4QF4 A;  2WB1 B;  2BOS A;  4WRD A;  1IKL A;  1SYG A;  3IFD A;  4FF3 A;  1D6E C;  4EGV A;  5I2X A;  5ELB A;  4KY5 A;  1EIH A;  3W3A A;  1S5C D;  2N55 A;  1VF7 A;  1NSN S;  1DOL A;  5IGD A;  1PTO H;  1SYC A;  1U4R A;  4C3J G;  2F0I A;  1GHJ A;  1B9M A;  5EKL A;  3HOZ B;  2AQ3 B;  5CV9 A;  2Q8T A;  4DAV A;  2WKC A;  3EFX D;  4XDX A;  3K5O A;  3NWT A;  1GXD C;  1H9M A;  4L6T B;  3BDC A;  1WTV A;  4IN3 A;  1KLG D;  5I6Y A;  2XN9 C;  1CA5 A;  3K59 A;  4FF1 A;  2A6E C;  2QEJ C;  1MSG A;  3X3N A;  4RKL A;  4GZY C;  5F2D A;  2HCI A;  2XNA C;  3VYS A;  3MHB A;  1WTO A;  3PUZ A;  3JAM L;  1JE4 A;  1E0B A;  2HUG A;  2FJ2 A;  5ELE A;  4QCL A;  3SE0 A;  2XVS A;  4UDU C;  4PNY A;  3A8K E;  2PW5 A;  3VR4 A;  1CM9 A;  2BA0 A;  3DUZ A;  5IGE A;  3K0Y A;  4KN7 C;  4RCN A;  4MN3 A;  2K28 A;  3PIO 3;  4F8M A;  1C4Q A;  2EY6 A;  5EPL A;  4FF2 A;  3WDN A;  2E2I B;  2H1E A;  3C3L A;  3DWQ A;  3VR6 A;  2ICI A;  2O5I C;  3HOV B;  3A56 A;  2RSO A;  1S4Z A;  3UI2 A;  2F0L A;  4RHR A;  1SNQ A;  3OW7 A;  4KN4 C;  2H4O A;  3K7A B;  1F9Q A;  2SNM A;  1TWH B;  2GA4 B;  1CA6 A;  4B08 A;  1PRT C;  3BS1 A;  4IAL A;  3Q24 A;  1PXU A;  1STN A;  1GUO A;  4N9T A;  1LAB A;  1SYF A;  3NTI A;  5A2Q E;  1SNC A;  5DM7 3;  3I90 A;  2MGS A;  4TSS A;  1WTP A;  2L0C A;  2N88 A;  4FNF A;  1PTO D;  5C4X B;  2ZXR A;  3RZO B;  4KHZ A;  4HED A;  2SNS A;  1A3T A;  1L0Y B;  1DCZ A;  1KTK A;  4EQP A;  2MHV A;  2VB2 X;  1MSH A;  4K8J A;  3VYU A;  3ND8 A;  4K8I A;  5C0X H;  2EXZ A;  1K8M A;  2CW0 D;  2RDH A;  3OSO A;  2HQE A;  4KHV A;  1SJE D;  2M2L A;  2AUK A;  3BVM A;  1KLU D;  5FK9 C;  2DY7 A;  5IIF A;  1FNW A;  1HPC A;  2F0J A;  2EJF C;  3C1E A;  5FO7 B;  1HA5 A;  2FMC A;  2WKD A;  3A55 A;  3I70 A;  1BUV T;  2EJM A;  2LMC B;  5A35 A;  2TMP A;  4OIK A;  5NUC A;  1A3V A;  3MVV A;  3BYY B;  5EGT A;  3J81 L;  2NVX B;  2EYJ A;  1ZEQ X;  1HA6 A;  3MFY A;  1C8C A;  4LJZ C;  1IHZ A;  5JJZ A;  2XRQ D;  1LTA D;  4X3T A;  4AYB B;  1BCP B;  4DAP A;  3HG9 A;  3SK5 A;  3AU7 A;  4IQZ A;  2AWO A;  2EY5 A;  4C2M B;  5FLX L;  5KNB A;  5JAV A;  2Y0S B;  5K36 H;  5CV5 A;  1JC7 A;  2F3V A;  4C3H G;  1SYE A;  1T5E A;  2EYL A;  4NKL A;  3S15 B;  5KYI A;  4F88 A;  3NUC A;  4WJW A;  1QB5 D;  2JA7 B;  5KRU A;  2AQ1 B;  1G8Z D;  1W6K A;  2Z8L A;  2L12 A;  1OXX K;  1LT3 D;  3NPP A;  2F0H A;  2BE5 C;  1D2B A;  3DWA A;  3QIA A;  1IKM A;  4DK0 A;  3MXU A;  1J8I A;  3NBI A;  3PUY A;  4A3D B;  2NUC A;  1STB A;  3URY A;  4DNR B;  3LWE A;  3SXH A;  5JEA G;  3S2D B;  5JPM C;  3DWP A;  3EVQ A;  3RZD B;  3QOJ A;  2F0K A;  5C5M A;  3T56 B;  4KKS A;  1TII D;  4KKU A;  4CKE A;  5EPK A;  3SEB A;  3TP5 A;  1EY0 A;  2Z1C A;  3K5N A;  1G6Z A;  3MWY W;  1OO9 B;  5C4Z A;  1TWG B;  2PZT A;  3D4R A;  1MGS A;  1ET6 A;  1HFN A;  1PFB A;  2K33 A;  4F7X A;  2R61 A;  4ME5 A;  3T51 B;  4FYD A;  2B2Y C;  1GUN A;  1YNJ D;  1SJH D;  4ZLT F;  3KBX A;  4RA8 A;  2EE1 A;  2IPK D;  1F77 A;  1ESF A;  4XXE A;  1CQF A;  3L3O C;  4OO1 I;  4LAA A;  2J4X A;  2XWJ B;  4IZ8 A;  2K1B A;  1H9S A;  3HOX B;  1PTO C;  2NVQ B;  4Q5V A;  4RGN A;  4O1N A;  1MI2 A;  1ENF A;  3CU7 A;  3Q23 A;  1M8A A;  1X32 A;  5T1I A;  1KDC A;  2RQX A;  4QUC A;  2IX0 A;  3CKI B;  3MFG A;  3HRZ C;  2X69 A;  4IUP A;  1D1K A;  1VMC A;  3LX0 A;  1TS5 A;  3KLS A;  4PQX A;  4F87 A;  2E74 C;  1OXT A;  1Q3L A;  1EZ8 A;  5DM6 3;  5J39 A;  1Z7T A;  2LKV A;  3E0J A;  1CK1 A;  3I73 A;  1CT1 D;  3C1F A;  4CJ2 C;  4H44 C;  5JEA J;  2RKS A;  1E2W A;  1I50 B;  1KDB A;  2A69 D;  3J80 L;  1YNN C;  1OXS C;  1F9S A;  1B4O A;  3FMC A;  1WCM B;  2L1B A;  3C2P A;  3M4Y A;  1SFO B;  2F0F A;  5C6A A;  3HOY B;  4A93 B;  2JE6 I;  2QCP X;  3MAQ A;  1CTM A;  2O2L D;  1WD0 A;  1QJO A;  1SE3 A;  1FNU A;  2F0M A;  1II3 A;  4FP5 D;  3CRL C;  2ID0 A;  1A6X A;  1UNS A;  1ML0 D;  3P75 A;  4J1M A;  4DF7 A;  3KK7 A;  4ULL A;  2EVB A;  1SMY D;  5FLX E;  3T53 B;  1WD1 A;  1PFM A;  1PRT F;  3R93 A;  3O13 A;  3OMC A;  5EJW A;  2DNC A;  1AFP A;  2PO4 A;  3GTG B;  4TQU S;  4ZK9 B;  5JVH 3;  3D4W A;  3CQZ B;  2A6H D;  3E6Z X;  1ILP A;  1QCB D;  4C3H B;  1EY7 A;  4K5X A;  5IGG A;  1ENC A;  4ZKC B;  4XYO A;  3NBH A;  3QO2 A;  5G3L D;  2DN8 A;  5JOB A;  4PMW A;  3QG1 A;  1SNP A;  1QNK A;  4QMG A;  5M5Y B;  1U4M A;  1AZP A;  1CFM A;  5IOD A;  1WTW A;  1STG A;  1EYA A;  2A68 C;  2ICE C;  3N6R A;  4H13 C;  4ID6 A;  2FHT A;  5FO9 B;  1EQV A;  1BNZ A;  1IW7 D;  5EPJ A;  1YNJ C;  4HN7 A;  4BBR B;  1BQQ T;  1HQM C;  1E2V A;  1R4Q B;  1U9R A;  2WP8 J;  5M3F B;  2VNU D;  1EU3 A;  1BCP D;  2G9D A;  1HRJ A;  4ABN A;  5IT9 L;  5HGT A;  3S1Q B;  2NWG A;  5BN3 A;  1O80 A;  3RMH A;  4V0B A;  3M85 A;  1L0X B;  1V8Q A;  3D31 A;  2C5C A;  4G57 A;  3A7L A;  4CGY B;  4OIJ A;  4ZYS A;  1EYC A;  4IFD I;  1ZKO A;  2F0Q A;  2KQ3 A;  1GUT A;  2PPB C;  4EQO A;  3K5L A;  4EVO A;  3MZ5 A;  3ERQ A;  3G6J B;  4E6I A;  1SBB B;  1H9J A;  4ZAI A;  2F0N A;  2L9H A;  4IFD G;  4ODG A;  1Z47 A;  2WAC A;  3GTO B;  4FXD A;  1Q1E A;  4BS9 A;  3K58 A;  1TS4 A;  2K7V A;  4WFN 3;  1ICW A;  2LY7 A;  1O7L A;  4ZUJ A;  2A69 C;  4A3K B;  4PMB A;  4CJ0 B;  4K6D A;  2K05 A;  4IUR A;  4FF4 A;  3M4O B;  1W6J A;  1STE A;  5CBA E;  1I4Q A;  1HTP A;  2X6L A;  2WAQ B;  1CHP D;  5C5L A;  3SVM A;  2E2H B;  2MPM A;  5KNC A;  4G7H C;  2B2U C;  1DD2 A;  4G7Z C;  3NE5 B;  3M7G A;  3Q0A A;  3R8B A;  1V1P A;  3X3M A;  2L11 A;  4J6H A;  2LFN A;  3NQT A;  5DEH A;  1BO0 A;  2B2V C;  1LT5 D;  4ILW A;  3VYR A;  2IL8 A;  1AW7 A;  4CBV A;  3L9A X;  5IGC A;  1PYW D;  3MA2 B;  3OIQ A;  1TWF B;  4QIW B;  1R9T B;  2A6H C;  4DFA A;  4DGZ A;  2KVM A;  4K6L A;  3TN2 A;  1I4P A;  2EJG C;  1HXY D;  1PLF A;  1PTO F;  1Y1V B;  1TY2 A;  3K57 A;  4K2L A;  3TP7 A;  2EYH A;  3C46 A;  1PRT B;  1ZYR D;  4HCE A;  2EYO A;  4A3J B;  1RTN A;  4XTC S;  1F2Z A;  1STA A;  4WOR A;  1H9S B;  2XSC A;  1ROD A;  3U9S A;  5LL6 S;  5EBD A;  2F0P A;  4OGQ C;  1LTS D;  3GV6 A;  3A7A B;  1QWY A;  3M3Y B;  4KJO A;  3RD4 A;  3Q22 A;  1GOZ A;  4IFD J;  3NXW A;  1K8O A;  4RFB A;  1G2S A;  1EY9 A;  1IW7 C;  1M4V A;  1FNV A;  1X3Q A;  5D3I B;  4NW2 A;  3MXG A;  5FO8 B;  1A3U A;  2BCO A;  4XQQ A;  1KAB A;  1KNA A;  3MC0 B;  1B9N A;  4XT1 B;  5M5X B;  1EY6 A;  4A3B B;  3BDO A;  5FOB B;  1I4X A;  2PZU A;  2R6G A;  1DXM A;  1BDO A;  5JEA H;  4M1U B;  5M3M B;  3BVG A;  1PZK D;  2B2W C;  4NMZ A;  1B2T A;  2WIN B;  2J0T D;  3U9O A;  2KUM A;  4CJ1 B;  4RGM A;  5C0X G;  4C3I G;  3GD7 A;  3R2I A;  1QG7 A;  4A3G B;  2XWB B;  2AWN A;  1Y69 U;  3KUP A;  2E75 C;  2QDB A;  1J9O A;  2B63 B;  1BR9 A;  1I4H A;  2SEB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...