3D4WA

Crystal structure of staphylococcal nuclease variant delta+phs a109r at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLRKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4wA00
5K5PA 3BDLA 4QMGA 3V2TA 2F0FA 2EYHA 2PZWA 5CV8A 1EY0A 4ZUIA 3U9OA 2M00A 4MIUA 3SR1A 4I65A 2F0IA 5C4ZA 5CV6A 3NQTA 5C5MA 1AEXA 1SYDA 5CV7A 2HQEA 5EGTA 4DFAA 4N9PA 2F0TA 3EJIA 4ID6A 4F8MA 3E5SA 4EQOA 1SYEA 4PNYA 3SK8A 3OMCA 2F0QA 2ENBA 3SK4A 4S3SA 4EVOA 2EYPA 4LAAA 1TQOA 5F2DA 4KY5A 1KDAA 1EY7A 1IHZA 1SYFA 2F0EA 2F0GA 2RBMA 3TP5A 2SNSA 2WACA 4F7XA 4KY7A 5IGGA 3ERQA 2PYKA 3D4WA 4K8IA 1U9RA 4DF7A 2QDBA 2EYJA 2OF1A 2F0DA 1STYA 1EYCA 1STBA 1ENAA 3C1EA 3PMFA 1A2TA 4NP5A 4K2KA 4YIJA 1SNPA 1A3VA 2NUCA 5IGCA 3LX0A 4QB4A 4KHVA 2LKVA 1A3TA 5I9OA 1STHA 1JORA 4DGZA 4B9WA 5C4HA 5ISRA 3BDCA 5JAVA 3SK5A 1EY6A 1F2YA 3D6CA 5DEHA 3VA5A 2OXPA 2F0PA 4ODGA 5I6YA 1SYGA 5IODA 3NK9A 5I9PA 4WRDA 4EQPA 5J1ZA 1JOQA 3QB3A 3MHBA 1A2UA 3MEHA 5CC4A 3TP6A 1NUCA 1KABA 2F3WA 5I6WA 3EVQA 2EYOA 1A3UA 4KY6A 5HURA 1TR5A 4H7BA 5J39A 3NHHA 3NXWA 5CV5A 5E1FA 2EYMA 5EKKA 3NP8A 1EZ6A 3TP8A 4K5WA 1SYBA 5J22A 5C3XA 3HZXA 3QOLA 3D4DA 2EY1A 4IZ8A 3MXPA 4PMCA 2SOBA 3T16A 3P1HA 3QOJA 4NMZA 3TP7A 2EY6A 5CR3A 1EQVA 3C1FA 4HMIA 4RKBA 5CV4A 4KTAA 3TMEA 3HEJA 4IUNA 5IOCA 5KYLA 4K5VA 4J1MA 1NSNS 5IGDA 1SNMA 2F3VA 4NKLA 4QF4A 3SXHA 1SYCA 1SNQA 1STNA 2F0LA 5KEEA 5KIXA 5M9OA 1JOKA 1F2MA 3DHQA 3MVVA 3SK6A 4DU9A 5IGFA 1F2ZA 2F0JA 2F0VA 1JOOA 1STAA 1EY5A 4ZUJA 1EYDA 5EKLA 3D8GA 1II3A 2PZTA 2F0HA 1SNCA 5JOBA 5E3FA 5C6AA 2F0WA 2EYFA 1EYAA 3T13A 1RKNA 1EZ8A 1STGA 2F0SA 3OWFA 3R3OA 4K5XA 4KD3A 2EYLA 4KD4A 4RKLA 3DMUA 4K6DA 3ITPA 5C3WA 2F0UA 1ENCA 3P75A 2EY2A 1KAAA 4J6HA 1EY9A 2PQEA 4HMJA 4KV6A 4OL7A 4R8NA 4KJNA 3EROA 5CV9A 5CGKA 2KHSA 5HGTA 3SHLA 1EY8A 5DAUA 2PW5A 4KJOA 1EY4A 3OMGA 4K8JA 2EXZA 2F0KA 5KYIA 4EQNA 2EY5A 2O4XA 4K14A 5KRUA 4N9TA 3S9WA 3RUZA 3NUCA 1SNDA 4ME5A 1TT2A 4E6IA 5KGUA 2RKSA 5C5LA 4PMBA 4HTHA 5IIFA 2F0MA 4ZQ3A 1KDCA 3MZ5A 4IALA 1KDBA 3OSOA 5NUCA 4B9XA 2PZUA 2RDFA 2SNMA 3H6MA 4NDXA 4TRDA 2F0NA 4WORA 2PW7A 2KQ3A 5IGBA 1SNOA 5IGEA 2F0OA 4K2LA 2OEOA 4G57A
chains in the Genus database with same CATH superfamily
3BDLA 4HIOA 1PH2A 1X6OA 3H0GB 1VCIA 3K6OA 2BH2A 1B4OA 1AW7A 2F0IA 1I4XA 2Z0SA 1TWFB 1EU4A 4JVZA 3VA7A 2LXJA 3NENA 1GKHA 3PIP3 1Q86C 2K75A 4DR3L 1Y8OB 4FF3A 3BZCA 2SEBD 1B3AA 3PUVA 2IX3A 1YNJC 2KVMA 2K7VA 1AZPA 1RTOA 2LMCB 5LL6X 4DV0Q 3LX0A 1MJEA 1QVFA 3J7AF 5AFWA 5ISRA 1RODA 3TS0A 1JJGA 3HOYB 4G7OC 3CPFA 5DEHA 3T56B 4ODGA 5IODA 4JI3Q 3D31A 3OPOA 4PZ7A 1VQ7A 1YJ9A 2JA8G 3K80C 3KUPA 1S5DD 2YYZA 5LMUL 4X6AH 1T9HA 1MSGA 3HKSA 4K5WA 2CW0D 1TS4A 4HJ9A 1A8VA 4LMQD 1EL0A 1F9QA 3SE0A 3LNNA 3C1FA 2JA6H 1CSQA 4KTAA 2RHQB 2XTIA 3FPUB 3OW7A 2NZHA 1D5MC 2VQFQ 1DM0B 1V9PA 1PV4A 2L15A 3NTKA 1YIJA 1JOKA 1BVSA 4DNTB 4FF1A 1SNCA 1BDOA 2F0WA 1V1OA 1RKNA 5ELDA 1BF4A 3R3OA 1O7YA 5C0XG 2OQKA 3OIPA 4J6HA 3H3VH 4KJNA 2YU9H 4DR4Q 2KHSA 4IOCA 3J7ZC 3CXCA 4C56C 2AKWB 1PH4A 1Z9FA 2Y0SE 4ME3A 2B2WA 3NUCA 1NE3A 1CM9A 2VQEL 2JA5B 1SE8A 4F87A 4A3CH 1AFPA 2RDFA 4XXEA 4MIUA 2JXMB 2XN9C 2AWNA 2UXCQ 4C3IB 1P8LA 5CV7A 5ELFA 2PCFB 5EGTA 1HZCA 4DFAA 5JEAJ 2MJ8A 4JBKA 3NBIA 2F0QA 4EVOA 3PSIA 4R4IA 2E2IH 3OHXC 1JMCA 2R92H 3GTKH 1BCPC 1C48A 3ERQA 4Q0FA 2K05A 4U673 4TSSA 5IYDG 2ICIA 1BQQT 2GVAA 3RMHA 2F0DA 5LHY1 1UE6A 4NP5A 1D1KA 3M4YA 1QJOA 3K5LA 4RG1A 1A3TA 1X55A 5C4XG 1X54A 1X3PA 4FXKC 3EFXD 3D6CA 5BN4A 4JV5Q 5I9PA 2AUJD 4GS3A 1YJNA 3MHBA 1H9KA 2FFKB 5KNCA 3SVMA 4PV1C 3K7AH 1E2ZA 3K0XA 1K0SA 5EBCA 3S15B 4FVMA 1RHPA 3HZXA 3I90A 2K52A 1X3EA 1IBLQ 3AFPA 3KJPA 1FJGL 1XXGA 2UXBQ 2I5LX 1WYDA 4DR7L 1Y8PB 3I73A 1NMFA 2PNRC 1Y69U 3E0JA 4A3IH 5IOCA 4GKKL 2E8GA 4DR6Q 2FJ2A 4K0KQ 3AMUA 2K1BA 3TSSA 3PO3H 3RN5A 3CW2C 3PCOB 4C3JH 3OYYA 1JQYD 1C4QA 3I72A 2NVXB 3JC66 1EFWA 5JOBA 4C3HG 4DUYL 1PHJA 3F8TA 4UPAA 3PUYA 2A8VA 4Y7NB 4KD3A 2XGTA 1C9OA 3PUWA 4IPCA 4NW2A 3IL8A 1ASZA 4KHPL 2JJQA 5CV9A 4BBSH 1GJXA 2BA0A 1KD1C 3SHLA 2PW5A 3GV3A 4JI0L 3VR4A 3MXGA 3PF5A 2R7ZG 2KHJA 3HOZH 1TWAB 1WTWA 4FYDA 4YWLA 2B63H 2Q8RE 4L63B 4DV6L 1I4PA 5T1GA 2F0MA 3GTMH 4ULLA 1HTPA 2PO4A 5IGEA 2KQ3A 3S24A 3NWSA 4POGA 1K9MC 2O5IC 2EE1A 1OO9B 2CQOA 3SR1A 1OXSC 3E6ZX 4RH6A 3S14H 3S16B 2OCEA 4CDFC 4YCUA 4C2MB 3BZKA 3EJIA 3SK8A 4OIKA 5IYCG 4DK6C 1TWHB 2KCCA 2ZT9C 3D4WA 5ELNA 4BBRH 3MWYW 1MBYA 2XSCA 1PZID 2NN6I 4HEDA 1H9MA 3M4PA 1PZKD 1RF2D 3UDIA 3CCMA 1NTGA 1ICWA 1E1OA 2B2WC 2P5ZX 5KNDA 1Y14B 1LTSD 1UAPA 2A1AA 2AHOB 1F2YA 3VA5A 1TWGB 4OO1G 1SYGA 4JG2A 1XMQL 3MXNA 4WRDA 4EQPA 3MEHA 1BCPF 2Y0SG 1NUCA 1I6HB 1Q82C 5J39A 3PO2G 3S1NH 1TS3A 2E2DC 3NP8A 1MHWC 1B50A 3MXPA 1G6PA 1GVPA 4R4CA 1W6KA 3CC4A 1S40A 2K04A 2NTSA 2WKCA 1N36L 1CTMA 2QGQA 4NXML 2I5MX 3HEJA 2UUAQ 4MTKA 1L1OA 4QF4A 1P16A 1F9PA 1GUNA 4DV4L 1QZHA 1HUMA 2RA4A 5IYBH 1SE3A 2KECA 1SMXA 5M3FH 4QUCA 3A0JA 3RLOA 1VQ8A 1NNXA 4DV1Q 2WAQB 5HGTA 1EYGA 4RKLA 3H94A 4A3GB 3BYYB 5CMDA 1XMOQ 2UXDQ 1E7ZA 1EY9A 2HCCA 2QILA 3NTIA 2DNCA 3CF5A 1GHJA 3OMGA 5M3MH 2FMCA 2F0KA 3J81i 5JJKA 1DYQA 2PNHA 1AP0A 3I8ZA 1X3QA 1SMYD 1J8IA 1XTCD 2HIXA 4EQ5A 4CJ1B 2BH8A 3DWQA 4R8IA 2RSNA 2L55A 4LF4L 4YCVA 4AYBE 1KXLA 4DXGA 2CKZB 4HJ7A 2I0QA 4HJ8A 4RGTA 3OOCA 3LWUA 3U9OA 3GTLH 3CRLC 4POFA 1SYDA 1ZYRD 2F0TA 4YY3Q 2ZJRA 3SK4A 2ENBA 2MNAA 1IKLA 1WTXA 3DM3A 4RWSC 1WCMH 2PQAA 2R61A 2R93H 3TP5A 3BYTB 2NB0A 2EYJA 1B44D 2CW0C 4XQNA 4A3FB 3NE5B 3HOXH 4C1NI 3I4NH 3PIO3 3ULLA 4JPBW 1VQFA 1XNRL 3GTOB 1WOCA 3I56A 4LF5Q 2R7FA 1JR0D 4HIMA 3FVQA 3TRZA 2F0PA 1CK1A 1IYVA 5IP7G 1D5XC 2IHEA 4HIDA 4CKCA 1GXDC 4OHJA 1G6ZA 1ET9A 3BVMA 4R1JA 4A3JG 2VXWA 4IOAA 2B8FA 2OWOA 5E1FA 2IX0A 3GTGB 4XIGS 1UE1A 2LSSA 5C3XA 1DOMA 2QEXA 4GNXA 1N34Q 3I4OA 1NY4A 3GTJB 4DXFA 1TIID 4UP8A 1LUZA 3TP7A 2QDLA 1EQVA 1JT8A 1B8AA 1HZBA 1B2TA 3V96A 4J1MA 3CCJA 3RD4A 3MFYA 2F0LA 4QIWE 1BNZA 1VQKA 2F03A 4L8JA 4LF6L 1MGSA 1B7YB 3CU7A 1Q90A 1I3QB 1L2FA 1FD7D 1IXRA 4BS9A 1EYAA 4A3DB 3I70A 4KKTA 4KD4A 2YTYA 3DEOA 3FKIB 4LF8L 3ITPA 5C3WA 1CKNA 3J7A5 3HOUB 2JE6I 1BXTA 3KYHC 4RMFA 4OL7A 4LF9Q 2K14A 3EROA 1MI2A 2B8GA 4LFCQ 3S17B 4KJOA 5JEAG 1SJHD 1QZGA 4K8JA 4QY7A 5KYIA 4A3BG 3RUZA 4DR5Q 4BY1H 4ME5A 4QJFA 4HTHA 1ML0D 3ER0A 2ZXRA 2EZVA 3AEVA 2F0NA 3S1MB 1H9SA 4A3KH 1LT3D 3I55A 3I2ZA 5CV8A 1MIUA 5CV6A 3NWTA 4HJAA 3HOWB 1EFID 5EAYA 1VQCA 2QF7A 1LO5D 3A8IE 3K5NA 1EY7A 4R9WA 2F0EA 3GDEA 4GN3B 1PRTB 2SNSA 1MKHA 2WACA 4OX9Q 3BVGA 3J80i 4BA1I 2ZJQA 1J5EL 2OF1A 5FLXL 3C1EA 3HOWG 4A3LG 1PTOB 4JYAL 1HZ9A 4YIJA 2UUCQ 1GUOA 1IL2A 1A3VA 4QB4A 1B53A 4LF7Q 3I4MB 4AYBB 2PI2A 3I3CA 3RZOB 3AQQA 3VR5A 3QB3A 1H9JA 1PYBA 4IFDI 1KHIA 2E74C 2MUYA 1SFOB 4FNFA 4DR2Q 1D7QA 3I4LA 1WI5A 5I2YA 1HJPA 3I4MG 4AYBG 1Z6HA 3ONAB 3M4OB 4TVAB 5DM73 3GTQB 1AE2A 3K7UC 2H4OA 3FPPA 2DN8A 3GTPH 1EIFA 2KEEA 5C3EH 1VF5C 5I2XA 2NVQH 2F3VA 1R9TB 1CA5A 3F1ZA 2VQFL 2A68D 2HQLA 4YWMA 1JJ2A 2RSOA 3FHWA 3JAMi 1EQRA 3JAML 1HR0L 2OQ0A 1VQMA 4NXNQ 2Q2UA 4JI7Q 4X3SA 4A3EH 2WV6D 3T13A 2EIFA 1EZ8A 4XYOA 1QNKA 1GOZA 4P2CB 3F2DA 1TWCH 1M1KC 1JC7A 1G51A 4X64L 4JI1L 5JPMC 1PMRA 3A7LA 4H02A 1QE6A 2WB1E 5FJ8H 4GNXC 4DR4L 5BN5A 1D8LA 3A55A 3NPPA 4ZCKA 4NPSA 3HOVG 4JOIC 4UDUC 2ZM6L 1JB3A 5M5XB 3UDGA 4HIKA 1Y1VB 4B9XA 3Q24A 2PZUA 1CKMA 4M1UB 1PH1A 4P71A 4LFBQ 1J6QA 5M5YB 3TREA 5GAGC 3S2HH 2UXCL 2A69D 4A93B 4LUOA 2VUMG 1RTNA 4KY5A 4DF7A 1HNWQ 2HD3A 4JBWA 2HHHQ 3K8AA 4X62Q 4DV2L 1PA6A 4K2KA 4IO9A 4HAEA 1PLFA 2DJGC 5IE8A 3BDCA 1EIYB 3SK5A 4DPGA 2R3ZA 2OXPA 2QA4A 4HCSA 1FVIA 2WINB 3QIAA 4B3RL 2EJMA 4DAYB 2UUBL 4WJWA 1QG7A 2N8NA 3CCVA 1R4QB 3NHHA 1HFGA 2KBNA 1HNXQ 5EPKA 3AU7A 1CHPD 3AFQA 4IJLA 3P1HA 2DY7A 1HR0W 1PRTF 4GOPB 3S1RH 1VQ5A 1VQHA 2F4IA 3NSWA 2JA8B 1SEBD 1HNZQ 2N49A 4IUNA 1EIHA 2E76C 5M5WH 1N9WA 1PTOF 1SYCA 4HCEA 1KL9A 1D5ZC 4A3MH 3A54A 1S5ED 1SMYC 1N33L 4GN5A 1V1PB 3H0GH 5JVH3 2RVLA 3MXUA 5LMNL 1UE5A 1XNQL 1QOHA 2JA6G 3TN2A 4EX5A 4MNOA 5JJIA 1TWFH 2PQEA 4PMWA 4CDCC 5FLMH 1ZYRC 5D14A 4P74A 2YU9B 1G8ZD 1LLRD 2PMZB 3DWPA 3UDXA 2Z4IA 4XTCS 1ET6A 2J0TD 3RZDB 4B3MQ 3A56A 4DV3Q 2XVSA 4Y52H 5HGQA 1N8RC 3H6MA 3S1QH 1XPOA 2PW7A 4JI4L 4G57A 1FL0A 1CZWA 3HOYH 2RCNA 5GADC 3HG9A 4ZUIA 1LTGD 2B39A 2IW3A 5FK9C 3L0OA 1SDFA 3T4AC 1HXYD 1A62A 1FNUA 4KHZA 4LK1C 3N52A 1SYEA 3VR3A 2IPKD 1NR2A 2EYPA 4A3CG 3CCEA 1PFMA 1IHZA 1DGSA 2AQ3B 2D2CC 4K8IA 3TDQA 4CBVA 4X65Q 5H1SE 3CMAA 3KLWA 4UAIA 5IP9H 4NB3A 4R4TA 3CCLA 1SNPA 1HQMC 2LKVA 4DV5Q 1IZ6A 4FF2A 3ICEA 1S72A 1PFNA 1E24A 2WB1G 3BDOA 3CD6A 4DV7L 2R92G 1W3SA 2N3SA 3R8BA 2BDNA 2F3WA 1A3UA 5C4XB 1TS2A 2JK8A 3OTOL 1CQFA 4X3TA 3MEFA 5EKKA 3M9BA 4CKEA 4DA2A 1SAPA 3PIPA 2NVTH 3NBHB 1TU2B 3PUXA 5LMNW 3Q0AA 1EQQA 1JJCB 2L12A 2VL6A 1PH8A 4K5VA 4O0AA 3CCUA 3RNUA 1AN8A 1U0LA 4AIMA 2JA5H 2CQAA 3MVVA 2FMMA 1E0BA 2E5LQ 1EYDA 3PF4A 3ND9A 4JI2Q 1CA6A 2LY7A 1NBWA 3J81c 1A0IA 1VQOA 4C3IH 2EXDA 2YTXA 4A3IG 1LTLA 4IPDA 2ALYB 1DD2A 1ENCA 2DY8A 4CHTB 3H3VI 1F9SA 4C3HB 2UXDL 1O7LA 2B2VC 2A5HA 1ZKOA 4FXGC 1PRTD 3W1BA 4MZ9A 2CWPA 5C0XI 3PO3G 4DR3Q 4C3JG 5EPJA 2NVYB 2E2HB 1TT2A 1PTOD 2FXQA 4FO2A 2ICEC 5NUCA 1ZEQX 2VNUD 2NN6H 5C44H 5FO7B 2AMCB 1JWMD 1V1QA 2R7ZB 1U4PA 4BBSG 2D9UA 3D3RA 2Q8IB 3E0EA 3VYSA 1F2LA 2FHTA 1SR3A 1FGBD 4I65A 2VY3A 3KDFB 3HOZG 3IFDA 2B63G 3C46A 4DNRB 4IUTA 2KEDA 1UUPA 5C4JB 3S14B 2MP1A 4YHHL 2HDLA 5LMUQ 3VDYA 2KCNA 2XWJB 3S15H 4DAPA 2N88A 1O7IA 1TKWB 3CPWA 3O13A 3ND8A 4L5QA 1YHAA 1K3RA 1HQRD 1S5FD 2QKIC 1EU3A 2AUKA 4OONA 1Y8NB 4DN4M 5I9OA 1ENFA 1EY6A 3SGIA 3VR6A 5I6YA 4LF5L 4LFAL 4X3UA 4ABNA 1Q1BA 4KI0A 2NVXH 2A68C 2EVBA 4JI8L 2BDOA 4BBRG 2MO0A 4CGYB 2WP8J 2RCFA 1TVXA 2HUGA 1IBML 5IT9c 1VDZA 3QOLA 4B3SL 2Y0SB 3T53B 2EY6A 3TS2A 1Q1EA 1YZ6A 2CVRA 3PO2B 1TWAH 3QR8A 1NSNS 5IT9E 3NQIA 1AE3A 4DU9A 3VR2A 2VQEQ 2B2TA 3QG1A 4L5RC 1JOOA 1STAA 3R2TA 1LTID 2KUMA 3CC7A 1KNAA 5IYCH 3HGBA 4IURA 2D62A 3PV0A 1GO3E 1K8OA 1D6EC 2F0SA 2XIWA 4RFBA 1QVGA 3S16H 1QCBD 2ZXOA 2V1CC 3M3YH 4C2MH 1VQIA 3T1HL 3P75A 4CJ0B 1M90C 2A69C 5AJ3L 5IYBG 5M3FG 2K03A 3VYTA 1TWHH 1K73C 3MA2B 2QW7A 3DXJC 2RHSB 2J4XA 4N9TA 1PH5A 1HRJA 4DR5L 2JYOA 2NZOA 1S4ZA 4U68A 5JJLA 2CH4W 3CCQA 1CZGA 2OTLA 1FGUA 4LNQA 4LWCA 1TWGH 4XQQA 1JICA 4GKJQ 1KTKA 5M3MG 3J80c 1S5BD 5E4WC 2YTVA 1KRTA 4B3TL 1I6HH 2Z6KA 4EQOA 4CKBA 3L9AX 1BBWA 1TQOA 5A2QE 1WD0A 1WTQA 2EQSA 3D6WA 2QDBA 3BJUA 1FJGQ 1STEA 5D3IB 3IRBA 2UU9L 4C1NK 1N32L 4DR7Q 1CHQD 4JK1C 1E22A 4DGZA 3G7LA 3MFGA 1XTDA 5IY0A 5HY6A 3KBGA 1HCZA 1WCMG 4LF7L 3QO2A 2R93G 4O1NA 4GN4B 2F4VL 1NAPA 1A2UA 1LM0A 1RJTA 4PG3A 4DUZQ 4DUYQ 4OO1I 3EVQA 5HURA 4HSVA 2N55A 4GLXA 3HOXG 1G2TA 3I4NG 1UNSA 4A3GH 3LWEA 3GD7A 3T16A 4KHPQ 3JAMc 4NMZA 1PZJD 2ZJPA 4A3JB 1I94L 4IQZA 5CV4A 4DK1A 1HUNA 4JI0Q 4QGUA 3HKZE 1PYWD 3G6JB 2MPMA 4NKLA 1SNQA 2ASBA 5KEEA 4DV6Q 5EKLA 1L0XB 1VQNA 4LJZC 3S2DB 1LTRD 2X6GA 3KF8B 1VQJA 1VMPA 2L0CA 3GO5A 4AQYL 3MAQA 2Z4HA 1KAAA 3GP7A 4JOIA 4KV6A 4OEMB 3U4VA 4XYQA 2EDGA 4A3FH 4E6IA 2NWGA 4BXXH 1KDBA 2A73B 1OTCA 4ZKBB 1IW7D 1VQDA 3ZYYX 3GTOH 2D0OA 2F0OA 3K81C 5K5PA 4A3BB 3V2TA 4OIJA 1RIPA 2B2TC 3RLNA 2VW9A 2ES2A 1CT1D 5FO9B 4LFBL 3A8JE 5J3BA 2OT2A 3SEBA 2M00A 5CBAE 1YVCA 1M8AA 1XMQQ 2HCIA 1V8QA 2E2JH 2K28A 2HQEA 4BY1G 4XQJA 1Y1WH 1FNVA 3T1YL 3CQZB 2C9OA 1PFBA 4IFDH 3RLFA 2L9HA 4DR1L 3GTGH 1LYLA 2CCZA 2L11A 3GTJH 1KC8C 4A3KG 1QUQB 4RGMA 1HNWL 3P7JA 1HA6A 5GROA 5T1IA 1A2TA 5GAEC 3ULPA 2A19A 2NUCA 4NXMQ 1UEBA 1L1OB 3R2IA 4L5TA 4IPGA 1DOKA 4FXDA 2A6HD 4DV4Q 2CWAA 5DM63 5DNFA 2JEBI 4BY7B 3STBD 1AH9A 5JPNC 1RDPD 5JEAH 1S3OA 1U5KA 5CC4A 1I3QH 4A3DH 4DK3C 4KY6A 4KKUA 3PUZA 2H5XA 3EIVA 4DAYA 3M7NA 3FKIH 3I91A 3HOUH 2Z6KC 2EPBA 4BY7G 2SOBA 4WJ4A 3S17H 2DUDA 4RKBA 3KOJA 4DV0L 2CHBD 1ICFB 4GOPA 1K83B 1U4MA 1IYJB 1PRTC 4MTNA 3PIOA 3A5UA 1I50B 2NYZD 5KIXA 3KJOA 1QB5D 3NELA 1F2MA 4JI3L 5A2QL 3SK6A 2F0JA 3CC2A 3S1MH 1PTOC 1TY2A 2HIVA 1LTAD 2PI2E 1BBXC 4LF4Q 3X3NA 2SDFA 3A8KE 2GA4B 1V1PA 4K5XA 3DMUA 1XJVA 1PVOA 2M2LA 1BKBA 5C3EG 1KLUD 2F0UA 3HOWH 1H95A 2N78A 4AH6A 1QNUA 2K5VA 1RCVD 5DAUA 3L3OC 4V0BA 2EJGC 3OWEB 1WD1A 1O80A 1TY0A 2O4XA 1FR3A 5KRUA 4DNIA 1X3FA 1SNDA 5BN3A 4A3EG 2D0PA 2ZTCA 3FDTA 1ILQA 1PTOH 3A74A 1NJIC 4IALA 3U4ZA 2K5HA 1HFNA 2X69A 1XNRQ 3CKIB 3I4MH 4XDXA 3HOVB 2PZWA 1KNEA 3DLLA 3RZOH 1IYUA 5FJ8G 3GQBA 4G7HC 1AZQA 3HKZG 3Q8DA 4KMUC 1EIGA 1SFOH 1IBKQ 4N9PA 4F8MA 4M8AA 3E5SA 1GD7A 1F9RA 5F2DA 2F0GA 4X3KA 2ZXPA 3WDNA 5BR8Q 1DZ1A 2ATWA 3TZUA 1K8AC 3M4OH 1YHBA 2J7ZA 1S5CD 1LT5D 3GTQH 4EGVA 3PMFA 1EYCA 1STBA 1EUJA 4QIWB 4X65L 1WJJA 2VUMB 1GUWA 5IGCA 1B3QA 5ELEA 3CCRA 2GVBA 3VYUA 1EEID 2HT1A 2WFWA 1VQBA 2MO1A 5I6WA 3F2CA 1B9MA 5CV5A 5GAHC 2AQ1B 1PFSA 5J22A 2EJFC 1YNND 4LF8Q 4ILWA 2JP1A 1GUTA 1EOVA 5GQOA 2O5JC 2JA7H 5CR3A 3D0FA 3UE0A 1JE5A 1LTTD 3NBHA 5TSSA 2XNAC 3Q22A 4P75A 5JJZA 1BOSA 2AQ2B 1ESRA 5M5XH 1Y1VH 1UWVA 5K36H 4JV5L 3QJYA 2KA7A 1SE2A 5M5YH 2EYFA 2B2VA 1WFQA 2G9DA 1QWYA 1JWUD 4K6DA 1DJRD 1I6VC 4A93H 5ELBA 1IBLL 2UXBL 4A3MG 2JA6B 4DR6L 4K14A 3H0GG 2HDMA 3BG3A 4JW0A 2Q2TA 1ILPA 4K0KL 2RKSA 1J5EQ 2BOSA 4GOPC 2B2UA 3M4QA 3MZ5A 4A76A 4ALPA 4JYAQ 1ZXTA 4NDXA 4WORA 2BE5D 2B3GA 2OEOA 1BUVT 1BO0A 5CORA 3S1QB 1ONLA 5FLMG 4OGQC 3SDZA 2CH4A 5C4ZA 2A6ED 1AEXA 2MGSA 1W6JA 2BCOA 3H09A 3KDFA 5D65A 4QCLA 4V190 1CSPA 1KDAA 1WTPA 2OTJA 3L7ZC 5IGGA 3CHBD 2PYKA 5IWAQ 3KF6B 3HOYG 4ZAIA 5E7NA 2JA8H 4UY8C 2F52A 1GUSA 3H3VC 3Q6SA 1Q8IA 2RDHA 1R4PB 2JA9A 3BVZA 2K01A 3NK9A 1HTLD 4I7AA 2K33A 4IN3A 1HR0Q 2K5WA 2Z9HA 4JI5Q 3TEHB 2KENA 5IP9G 1WVLA 1G91A 1SE4A 2WB1B 1SYBA 1VMCA 1G2SA 1SROA 3M7GA 3EQLC 4H13C 3K57A 2E2IB 2R92B 3GTKB 3K58A 3ULJA 4X64Q 4JI1Q 3URYA 1Q81C 1SN8A 2M9VA 2C35B 2Q2IA 2XRSD 2NVTB 3E3XA 5KYLA 5IGDA 5C0XH 3RZDH 3KK7A 1PH3A 2Z1CA 4IFDJ 3DHQA 2ZM6Q 3KLSA 1F2ZA 4WFN3 3CMEA 1II3A 5G3LD 4DKAC 1Q46A 3VYRA 2R6GA 3C3LA 3FEWX 5E3FA 3HRZC 1IW7C 4RA8A 4H44C 3K7AB 3OWFA 4X66Q 4RAUC 1EWCA 1BCPB 5LL6S 1DONA 1JOQA 1K8MA 2JA5G 4IUVA 1L0YB 4RGNA 4UHVA 3EBEA 1EY8A 4JI6Q 1EY4A 1O78A 2ZTDA 4QL5A 3RR5A 2UUAL 1EWIA 1XPUA 4GLAC 3IKJA 3S9WA 4A3IB 2MHVA 1SXTA 4UP9A 4PMBA 5IIFA 3U58A 3P20A 1LV9A 1VF7A 4KN7C 4C3IG 4DV2Q 3PO3B 4C3JB 2RQXA 1YJWA 5C44B 4DV1L 4G7ZC 5IYDH 3WOEA 1W2BA 3K59A 4RHSA 2A6HC 3AB9A 1MJCA 3G48A 5EPLA 1XMOL 4B3RQ 4GKJL 3STBC 5C4XH 4JCVE 2UUBQ 4ID6A 2G9HD 2WAQE 1HHVA 4BBSB 2MQHA 4PNYA 3OMCA 3J81E 4LAAA 4PZ8A 1I4RA 2NN6G 5C44G 1V43A 1QVCA 2RBMA 1UEAB 3F2BA 1X3GA 4ZRZA 3H15A 3HOZB 2H1EA 1SJED 2B63B 3DEPA 1GUGA 1X32A 3GTMB 4GLVB 4HJ5A 4CDEC 1RL2A 3AYHB 1TS5A 2B2UC 4B9WA 4OELB 2F1MA 5JAVA 4K6LA 3CRKC 1B1ZA 1N33Q 1KQSA 1EEFD 3DWAA 4ZKCB 4YY3L 4UP7A 2EYOA 1VQ6A 5LMNQ 4P72A 1XNQQ 3U50C 4DUZL 3R93A 2F3IA 2EY1A 3KBXA 4HSPA 4C3HH 1YITA 3RN2A 4BBRB 4IUQA 4R4OA 5EKIA 2NVYH 3HFZB 1WTHA 2Q2HA 2IY5B 1K3BC 2E2HH 3EN2A 4RHRA 4RCOA 1VS0A 2BA1A 2NBFA 3KLRA 3E9IA 4O2DA 4ZUJA 2R7ZH 1G291 1KAWA 1SSOA 4Y7NH 4JI4Q 3CP0A 1YI2A 1H9RA 1YNXA 5DLQE 2I46A 2JEAI 3S1NB 3MC0B 3KF8A 1N34L 2RF4A 2JSOA 5FOBB 5C4JH 2GN5A 2I5HA 1B70B 3M3YB 1ESFA 1PH7A 4OXPA 1OXXK 4CJ2C 2CFMA 5C5LA 2EOTA 2L5TA 2XWBB 3FP9A 4QQBX 3LGJA 3NTHA 4TRDA 1CFMA 5M3FB 2WKDA 1XWEA 3IAYA 4K2LA 1I5FA 3IFTA 1E2WA 2EYHA 1FYCA 3ZJYC 4GZYC 1VQ4A 4DV7Q 1JCKB 3N6RA 5JVG3 4LF9L 3D4RA 3H91A 4KN4C 5FKAC 4LFCL 2ZTEA 3OTOQ 3C2PA 4OO1H 5EJWA 1C8CA 1SYFA 4WJ3M 5M3MB 1YBYA 3A5ZB 1U9RA 2PPBC 3I7FA 1YNNC 3KFUA 3Q23A 3PO2H 1A15A 3CCSA 2IJ0A 1OXVA 3BS1A 1I4GA 4J15A 1QUQA 4MN3A 1LTBD 3OIQA 3TBIB 2WIIB 1STHA 4RGOS 1I4HA 3BU2A 2B29A 5FLXc 3NEMA 1Q3LA 3GTLB 5D3DA 3GV6A 3TP6A 2D5DA 1IL8A 4IJHA 4H7BA 3NXWA 2EYMA 4OWXB 1MD2D 1EZ6A 3EA6A 3TP8A 1YNJD 1WCMB 4OX9L 3J80E 2R93B 1WTVA 5FLXE 3WOFA 2ID0A 3K0YA 4HMIA 1K8GA 4GKKQ 1T5XD 2UUCL 4DAVA 4I7ZC 3HOXB 3I4NB 4BA2I 3G71A 1WTOA 1SNMA 3MTSA 3SXHA 4XT3B 1STNA 4IPHA 2WAQG 3J81L 2VB2X 1L0WA 3BZDB 2IHFA 4A3GG 2IT1A 4CDDC 1VQAA 1U4RA 3D8GA 3PGZA 3F2UA 3K5MA 4APVA 2BE5C 1J9OA 1Q12A 3J7YW 4DR2L 3WWVA 1E3PA 2EYLA 1X56A 3G6EA 2EY2A 4R8NA 1TXYA 3U9SA 2A6EC 2V4DA 4J8QA 1OXUA 1OXTA 4YHHQ 1I4QA 2L1BA 4IUUA 3X3MA 1PDQA 1U4LA 2XRQD 4ZYSA 5E4XA 1CKOA 4FP5D 4G4KA 1A6XA 5L37A 2JQOA 3J7AV 3JAME 4B08A 4HN7A 4ZQ3A 1KDCA 1Q7YC 1HH2P 3OSOA 2QCPX 4F88A 1RD9D 1DCZA 2DJFC 4N8X1 3UE1A 1SNOA 3E9HA 4NXNL 4QMGA 1K28A 4JI7L 2F0FA 1EY0A 1ASYA 4LFAQ 5C0XJ 4KKSA 2Q8TA 1KIXA 3HS0C 3NQTA 4KK7A 4JI8Q 4A3FG 4YCWA 2FINB 4TKOB 2KOLA 4BXXG 1IBKL 3J81j 2E2JB 4KLKA 1IBMQ 1SBBB 1NR4A 5IP7H 4OWWB 5ELOA 1PH6A 1Y1WB 1Z47A 1FNWA 5BR8L 4B3SQ 4A3JH 4Z9CB 4BY1B 2K5DA 3DUZA 3T51B 1KRSA 1HPCA 5FO8B 1UE7A 4A75A 4A3KB 3MXNB 1Y1WG 1D1IA 3TQYA 4R4QA 1D2BA 4IFDG 1C0AA 2VB3X 5IT9L 4FF4A 3S2DH 1A63A 5I4DA 1BBUA 2NTTA 1PH9A 5EBDA 1BCPD 2VS1A 1EWHA 1XYIA 1E2VA 3D4DA 1N36Q 1HA5A 3T1HQ 2X6LA 3QOJA 4XT1B 1M4VA 2HHHL 5AJ3Q 4X62L 2JN4A 3TMEA 1KLGD 2L4NA 2B2YA 5KNBA 4L6TB 2K50A 2K4KA 4ZK9B 4A3DG 1DOLA 4JBMA 1CQVA 2Z8LA 5M9OA 1XPRA 1VQGA 4ZLTF 3FKIG 3HOUG 2F0VA 4A3BH 3W5OA 2E75C 1L1OC 2F0HA 4PZ6A 2A74C 2K5NA 3G4SA 5CYUA 1STGA 1EOTA 1HNXL 3L2PA 2O2LD 1IKMA 1XX8A 1CI3M 4BWGB 4B3TQ 4HMJA 3CQZH 3DM1A 2LS01 1JE4A 1HNZL 2EXZA 3PQIA 4EQNA 2EY5A 1NCVA 3GTPB 5C3EB 2NVQB 5KGUA 5CBEE 1Q8KA 2UU9Q 1N32Q 1Z7TA 2R7DA 3ERSX 3J80L 1X9NA 1NMGA 4LUZA 1E1TA 1PXUA 5EQ0A 1VQPA 3UI2A 1YEZA 2QEJC 1QILA 1LT4D 4BY7H 4A3EB 3V05A 1DXMA 1JWSD 2NZ1D 4A3LH 2LFNA 2F4VQ 5C5MA 1BR9A 1TWCB 2YV5A 2KJXA 2PQAB 3HP3A 4H0LC 1JB7A 3B6YA 2DGYA 2DNEA 4S3SA 1X65A 2TMPA 1K0RA 1C7YA 4F7XA 3HKZB 4KY7A 1YHQA 4B3ML 1LACA 4DV3L 1SRUA 5IWAL 1I94Q 4MHEA 3TZDA 1STYA 2K5QA 1ENAA 2K6AA 3KF6A 1K83H 1VQ9A 2MFIA 2PMZE 2TSSA 4KHVA 1I50H 1JORA 5C4HA 1GM5A 4N8FA 3K5OA 3OW2A 2LXKA 3M85A 3UDFA 2IL8A 3S2HB 5J1ZA 4DAMA 4FDBA 1KABA 1HZAA 5COYA 1MSHA 1TR5A 1CUKA 2AWOA 2C5CA 3W2DA 4GNXB 4PQXA 4JI5L 1SLJA 2KCMA 3QWNA 4JBJA 2Z6BA 4AQYQ 4LUVA 4IZ8A 4PMCA 2K32A 1O7ZA 4YWKA 4OWTB 1R9TH 3FRPB 4LW1A 2JA7B 4Q5VA 2I07B 1PYSB 4DV5L 4A4IA 4QUFA 3CAMA 1B9NA 3W1GA 2G5DA 5G3LF 4L5SA 1VQLA 4LF6Q 5IGFA 2RDGA 1EY5A 1F77A 2PZTA 4P73A 4RCNA 3HOVH 2KCTA 3W3AA 5C6AA 1GHKA 2JA7G 4O42A 1CKNB 4JC0A 2IX1A 4HR7B 5ELCA 4X66L 5A35A 5CGKA 1Y1VG 3T1YQ 1T5EA 4TQUS 5K36G 2VZAA 3S1RB 1EQTA 3A7AB 3KLSX 4DR1Q 4DK0A 1WTRA 4JI6L 5M5WB 4IUPA 3FMCA 1H9SB 2VUMH 2B2YC 2KHIA 4A3MB 2E5LL 2SNMA 4A93G 5IGBA 1LT6D 1VQEA 4JI2L 1LABA 2IWHA
chains in the Genus database with same CATH topology
3BDLA 3H0GB 1VCIA 3K6OA 1B4OA 1AW7A 2F0IA 1I4XA 1TWFB 1EU4A 3VA7A 3PIP3 1Y8OB 4FF3A 2SEBD 1B3AA 3PUVA 2IX3A 1YNJC 2KVMA 2K7VA 1AZPA 1RTOA 2LMCB 5LL6X 3LX0A 3J7AF 5AFWA 5ISRA 1RODA 3HOYB 4G7OC 5DEHA 3T56B 4ODGA 5IODA 3D31A 3OPOA 3KUPA 1S5DD 2YYZA 1MSGA 4K5WA 2CW0D 1TS4A 4LMQD 1EL0A 1F9QA 3SE0A 3LNNA 3C1FA 4KTAA 3FPUB 3OW7A 1D5MC 1DM0B 3NTKA 1JOKA 4DNTB 4FF1A 1SNCA 1BDOA 2F0WA 1V1OA 1RKNA 5ELDA 1BF4A 3R3OA 1O7YA 5C0XG 3OIPA 4J6HA 4KJNA 2KHSA 4C56C 2B2WA 3NUCA 1CM9A 2JA5B 4F87A 1AFPA 2RDFA 4XXEA 4MIUA 2JXMB 2XN9C 2AWNA 4C3IB 5CV7A 5ELFA 2PCFB 5EGTA 4DFAA 5JEAJ 2MJ8A 3NBIA 2F0QA 4EVOA 3OHXC 1BCPC 1C48A 3ERQA 4Q0FA 2K05A 4U673 4TSSA 2ICIA 1BQQT 3RMHA 2F0DA 5LHY1 4NP5A 1D1KA 3M4YA 1QJOA 3K5LA 1A3TA 1X3PA 4FXKC 3EFXD 3D6CA 5BN4A 5I9PA 2AUJD 3MHBA 1H9KA 2FFKB 5KNCA 3SVMA 4PV1C 1E2ZA 5EBCA 3S15B 4FVMA 1RHPA 3HZXA 3I90A 1XXGA 1Y8PB 3I73A 2PNRC 1Y69U 3E0JA 5IOCA 2FJ2A 3AMUA 2K1BA 3TSSA 1JQYD 1C4QA 3I72A 2NVXB 5JOBA 4C3HG 3PUYA 4Y7NB 4KD3A 3PUWA 4NW2A 3IL8A 5CV9A 1GJXA 2BA0A 3SHLA 2PW5A 3GV3A 3VR4A 3MXGA 1TWAB 1WTWA 4FYDA 2Q8RE 4L63B 1I4PA 5T1GA 2F0MA 4ULLA 1HTPA 2PO4A 5IGEA 2KQ3A 3NWSA 2O5IC 2EE1A 1OO9B 3SR1A 1OXSC 3E6ZX 4RH6A 3S16B 4C2MB 3EJIA 3SK8A 4OIKA 1TWHB 2KCCA 2ZT9C 3D4WA 3MWYW 1MBYA 2XSCA 1PZID 2NN6I 4HEDA 1H9MA 1PZKD 1RF2D 1ICWA 2B2WC 5KNDA 1LTSD 1UAPA 1F2YA 3VA5A 1TWGB 4OO1G 1SYGA 3MXNA 4WRDA 4EQPA 3MEHA 1BCPF 1NUCA 1I6HB 5J39A 1TS3A 2E2DC 3NP8A 1B50A 3MXPA 1W6KA 2K04A 2NTSA 2WKCA 1CTMA 3HEJA 4QF4A 1F9PA 1GUNA 1HUMA 2RA4A 1SE3A 2KECA 4QUCA 2WAQB 5HGTA 4RKLA 3H94A 4A3GB 3BYYB 5CMDA 1EY9A 2HCCA 2QILA 3NTIA 2DNCA 1GHJA 3OMGA 2FMCA 2F0KA 1AP0A 1DYQA 3I8ZA 1X3QA 1SMYD 1J8IA 1XTCD 4CJ1B 3DWQA 4R8IA 2RSNA 2L55A 4DXGA 4RGTA 3OOCA 3LWUA 3U9OA 3CRLC 1SYDA 1ZYRD 2F0TA 3SK4A 2ENBA 1WTXA 1IKLA 4RWSC 2R61A 3TP5A 3BYTB 2NB0A 2EYJA 1B44D 2CW0C 4XQNA 4A3FB 3NE5B 4C1NI 3PIO3 3GTOB 1JR0D 3FVQA 2F0PA 1CK1A 1IYVA 1D5XC 4CKCA 1GXDC 4OHJA 1G6ZA 1ET9A 3BVMA 2VXWA 2B8FA 5E1FA 2IX0A 3GTGB 4XIGS 5C3XA 1DOMA 3GTJB 4DXFA 1TIID 3TP7A 1EQVA 1B2TA 3V96A 4J1MA 3RD4A 3MFYA 2F0LA 1BNZA 2F03A 4L8JA 1MGSA 1Q90A 1I3QB 3CU7A 4BS9A 1FD7D 4A3DB 1EYAA 3I70A 4KKTA 4KD4A 3DEOA 3FKIB 3ITPA 5C3WA 3HOUB 2JE6I 1BXTA 4OL7A 3EROA 1MI2A 2B8GA 3S17B 4KJOA 5JEAG 1SJHD 4K8JA 5KYIA 3RUZA 4ME5A 4HTHA 1ML0D 2ZXRA 2EZVA 2F0NA 3S1MB 1H9SA 1LT3D 5CV8A 5CV6A 3NWTA 3HOWB 1EFID 2QF7A 1LO5D 3A8IE 3K5NA 1EY7A 4R9WA 2F0EA 1PRTB 2SNSA 2WACA 3BVGA 4BA1I 2OF1A 5FLXL 3C1EA 1PTOB 4YIJA 1GUOA 1A3VA 4QB4A 1B53A 3I4MB 4AYBB 3I3CA 3RZOB 3VR5A 3QB3A 1H9JA 4IFDI 2E74C 2MUYA 1SFOB 4FNFA 3I4LA 5I2YA 1Z6HA 3ONAB 3M4OB 5DM73 3GTQB 2H4OA 3FPPA 2DN8A 2KEEA 1VF5C 5I2XA 2F3VA 1R9TB 1CA5A 2A68D 2RSOA 3JAML 4X3SA 2WV6D 3T13A 4XYOA 1EZ8A 1QNKA 1GOZA 4P2CB 1JC7A 5JPMC 1PMRA 3A7LA 1QE6A 5BN5A 3A55A 3NPPA 4UDUC 1JB3A 5M5XB 1Y1VB 4B9XA 3Q24A 2PZUA 4M1UB 5M5YB 2A69D 4A93B 1RTNA 4KY5A 4DF7A 4JBWA 4K2KA 4HAEA 1PLFA 3BDCA 3SK5A 2R3ZA 2OXPA 4HCSA 2WINB 3QIAA 2EJMA 4WJWA 1QG7A 1R4QB 3NHHA 1HFGA 5EPKA 3AU7A 1CHPD 3P1HA 2DY7A 1PRTF 2F4IA 3NSWA 2JA8B 1SEBD 4IUNA 1EIHA 2E76C 1PTOF 4HCEA 1SYCA 1D5ZC 3A54A 1S5ED 1SMYC 1V1PB 5JVH3 2RVLA 3MXUA 1QOHA 3TN2A 2PQEA 4PMWA 1ZYRC 5D14A 2YU9B 1G8ZD 1LLRD 2PMZB 3DWPA 2Z4IA 4XTCS 1ET6A 2J0TD 3RZDB 3A56A 2XVSA 3H6MA 2PW7A 4G57A 1CZWA 3HG9A 4ZUIA 1LTGD 2B39A 2IW3A 5FK9C 1SDFA 3T4AC 1HXYD 1FNUA 4KHZA 4LK1C 3N52A 1SYEA 3VR3A 2IPKD 1NR2A 2EYPA 1PFMA 1IHZA 2AQ3B 2D2CC 4K8IA 3TDQA 4CBVA 4UAIA 1SNPA 1HQMC 2LKVA 4FF2A 1PFNA 3BDOA 3R8BA 2BDNA 2F3WA 1A3UA 5C4XB 1TS2A 1CQFA 4X3TA 5EKKA 4CKEA 4DA2A 1SAPA 1TU2B 3PUXA 3Q0AA 2L12A 4K5VA 1AN8A 2CQAA 3MVVA 2FMMA 1E0BA 1EYDA 3ND9A 1CA6A 2LY7A 1DD2A 1ENCA 2DY8A 4CHTB 1F9SA 4C3HB 1O7LA 2B2VC 2A5HA 1ZKOA 4FXGC 1PRTD 5C0XI 4C3JG 5EPJA 2NVYB 2E2HB 1TT2A 1PTOD 4FO2A 2ICEC 5NUCA 1ZEQX 2VNUD 2NN6H 5FO7B 1JWMD 2R7ZB 1U4PA 2D9UA 3D3RA 2Q8IB 3VYSA 1F2LA 2FHTA 1FGBD 4I65A 3IFDA 3C46A 4DNRB 4IUTA 2KEDA 1UUPA 5C4JB 3S14B 2MP1A 2HDLA 2KCNA 2XWJB 4DAPA 2N88A 1TKWB 3O13A 3ND8A 1HQRD 1S5FD 2QKIC 1EU3A 2AUKA 4DN4M 1Y8NB 5I9OA 1ENFA 1EY6A 3VR6A 5I6YA 4X3UA 4ABNA 1Q1BA 4KI0A 2A68C 2EVBA 2BDOA 4CGYB 2WP8J 1TVXA 2HUGA 1VDZA 3QOLA 2Y0SB 3T53B 2EY6A 1Q1EA 2CVRA 3PO2B 1NSNS 5IT9E 3NQIA 4DU9A 3VR2A 2B2TA 3QG1A 1JOOA 1STAA 3R2TA 1LTID 2KUMA 1KNAA 4IURA 3HGBA 2D62A 3PV0A 1K8OA 1D6EC 2F0SA 2XIWA 4RFBA 1QCBD 2ZXOA 3P75A 4CJ0B 2A69C 2K03A 3VYTA 3MA2B 3DXJC 2J4XA 4N9TA 1HRJA 2JYOA 1S4ZA 4U68A 1CZGA 4XQQA 1JICA 1KTKA 1S5BD 5E4WC 4EQOA 4CKBA 3L9AX 5A2QE 1TQOA 1WD0A 1WTQA 3D6WA 2QDBA 1STEA 5D3IB 4C1NK 1CHQD 4JK1C 4DGZA 3G7LA 3MFGA 3KBGA 1HCZA 3QO2A 4O1NA 1NAPA 1A2UA 1RJTA 4OO1I 3EVQA 5HURA 4HSVA 2N55A 1G2TA 1UNSA 3LWEA 3GD7A 3T16A 4NMZA 1PZJD 4A3JB 4IQZA 5CV4A 4DK1A 1HUNA 1PYWD 3G6JB 2MPMA 4NKLA 1SNQA 5KEEA 5EKLA 1L0XB 4LJZC 3S2DB 1LTRD 2X6GA 1VMPA 2L0CA 3GO5A 3MAQA 2Z4HA 1KAAA 3GP7A 4KV6A 4XYQA 2EDGA 4E6IA 2NWGA 1KDBA 2A73B 4ZKBB 1IW7D 3ZYYX 2F0OA 5K5PA 4A3BB 3V2TA 4OIJA 2B2TC 1CT1D 5FO9B 3A8JE 2OT2A 3SEBA 2M00A 5CBAE 1M8AA 2HCIA 1V8QA 2K28A 2HQEA 4XQJA 1FNVA 3CQZB 2C9OA 1PFBA 4IFDH 3RLFA 2L9HA 2L11A 4RGMA 3P7JA 1HA6A 5T1IA 1A2TA 2NUCA 3R2IA 4FXDA 1DOKA 2A6HD 5DM63 5DNFA 2JEBI 4BY7B 5JPNC 1RDPD 5JEAH 5CC4A 4KY6A 4KKUA 3PUZA 4DAYA 3M7NA 3I91A 2EPBA 2SOBA 4RKBA 2CHBD 1K83B 1U4MA 1PRTC 1I50B 2NYZD 5KIXA 1QB5D 1F2MA 5A2QL 3SK6A 2F0JA 1PTOC 1TY2A 1BBXC 1LTAD 3X3NA 2SDFA 3A8KE 2GA4B 1V1PA 4K5XA 3DMUA 2M2LA 1KLUD 2F0UA 1QNUA 1RCVD 5DAUA 3L3OC 4V0BA 2EJGC 3OWEB 1WD1A 1O80A 1TY0A 2O4XA 1FR3A 5KRUA 1SNDA 5BN3A 3FDTA 1ILQA 1PTOH 4IALA 1HFNA 2X69A 3CKIB 4XDXA 3HOVB 2PZWA 1KNEA 1IYUA 3GQBA 4G7HC 1AZQA 4KMUC 1EIGA 4N9PA 4F8MA 4M8AA 3E5SA 1F9RA 5F2DA 2F0GA 4X3KA 2ZXPA 3WDNA 1DZ1A 3TZUA 2J7ZA 1S5CD 1LT5D 4EGVA 3PMFA 1EYCA 1STBA 4QIWB 2VUMB 1GUWA 5IGCA 5ELEA 3VYUA 1EEID 5I6WA 1B9MA 5CV5A 2AQ1B 5J22A 2EJFC 1YNND 4ILWA 2JP1A 1GUTA 2O5JC 5CR3A 1LTTD 3NBHA 5TSSA 2XNAC 3Q22A 5JJZA 1BOSA 2AQ2B 1ESRA 5K36H 3QJYA 2KA7A 1SE2A 2EYFA 2B2VA 2G9DA 1QWYA 1JWUD 4K6DA 1DJRD 1I6VC 5ELBA 2JA6B 4K14A 2HDMA 3BG3A 1ILPA 2RKSA 2BOSA 2B2UA 3MZ5A 1ZXTA 4NDXA 4WORA 2BE5D 2OEOA 1BUVT 1BO0A 5CORA 3S1QB 1ONLA 4OGQC 3SDZA 5C4ZA 2A6ED 1AEXA 2MGSA 1W6JA 2BCOA 3H09A 5D65A 4QCLA 4V190 1KDAA 1WTPA 3L7ZC 5IGGA 3CHBD 2PYKA 4ZAIA 1GUSA 3H3VC 3Q6SA 1Q8IA 2RDHA 1R4PB 3BVZA 2K01A 3NK9A 1HTLD 2K33A 4IN3A 2K5WA 1WVLA 1G91A 1SE4A 2WB1B 1SYBA 1VMCA 1G2SA 3M7GA 2E2IB 3EQLC 4H13C 3K57A 2R92B 3GTKB 3K58A 3URYA 2M9VA 2XRSD 2NVTB 5KYLA 5IGDA 5C0XH 3KK7A 2Z1CA 4IFDJ 3DHQA 3KLSA 1F2ZA 4WFN3 1II3A 5G3LD 3VYRA 2R6GA 3C3LA 3FEWX 5E3FA 3HRZC 1IW7C 4RA8A 4H44C 3K7AB 3OWFA 4RAUC 1EWCA 1BCPB 5LL6S 1DONA 1JOQA 1K8MA 4IUVA 1L0YB 4RGNA 1EY8A 1EY4A 1O78A 4A3IB 3IKJA 3S9WA 2MHVA 1SXTA 4PMBA 5IIFA 3P20A 1LV9A 1VF7A 4KN7C 4C3IG 3PO3B 4C3JB 2RQXA 5C44B 4G7ZC 3WOEA 3K59A 4RHSA 2A6HC 3AB9A 5EPLA 4ID6A 2G9HD 1HHVA 4BBSB 4PNYA 3OMCA 3J81E 4LAAA 1I4RA 2NN6G 1V43A 2RBMA 1UEAB 4ZRZA 3HOZB 2H1EA 1SJED 2B63B 3DEPA 1GUGA 1X32A 3GTMB 1TS5A 2B2UC 4B9WA 2F1MA 5JAVA 4K6LA 3CRKC 1B1ZA 1EEFD 3DWAA 4ZKCB 2EYOA 3R93A 2EY1A 3KBXA 4HSPA 4BBRB 4IUQA 5EKIA 4RHRA 4RCOA 2BA1A 2NBFA 3KLRA 4ZUJA 1G291 1SSOA 1H9RA 2I46A 2JEAI 3S1NB 3MC0B 3KF8A 2JSOA 5FOBB 3M3YB 1ESFA 1OXXK 4CJ2C 5C5LA 2EOTA 2L5TA 2XWBB 3NTHA 4TRDA 1CFMA 5M3FB 2WKDA 1XWEA 3IAYA 4K2LA 3IFTA 1E2WA 2EYHA 1FYCA 4GZYC 1JCKB 3N6RA 5JVG3 3D4RA 3H91A 4KN4C 5FKAC 3C2PA 4OO1H 5EJWA 1C8CA 1SYFA 5M3MB 1U9RA 2PPBC 1YNNC 3Q23A 1A15A 2IJ0A 1OXVA 3BS1A 1I4GA 4MN3A 1LTBD 3OIQA 3TBIB 2WIIB 1STHA 4RGOS 1I4HA 1Q3LA 3GTLB 5D3DA 3GV6A 3TP6A 2D5DA 1IL8A 4H7BA 3NXWA 2EYMA 1MD2D 1EZ6A 3EA6A 3TP8A 1YNJD 1WCMB 3J80E 2R93B 1WTVA 5FLXE 3WOFA 2ID0A 3K0YA 4HMIA 1T5XD 4DAVA 4I7ZC 3HOXB 3I4NB 4BA2I 1WTOA 1SNMA 3MTSA 3SXHA 4XT3B 1STNA 3J81L 2VB2X 3BZDB 2IT1A 1U4RA 3D8GA 3F2UA 3K5MA 2BE5C 1J9OA 1Q12A 3J7YW 2EYLA 2EY2A 4R8NA 3U9SA 2A6EC 2V4DA 4J8QA 1OXUA 1OXTA 1I4QA 3X3MA 2L1BA 4IUUA 1PDQA 1U4LA 2XRQD 4ZYSA 5E4XA 4FP5D 4G4KA 1A6XA 3J7AV 3JAME 4B08A 4HN7A 4ZQ3A 1KDCA 3OSOA 2QCPX 4F88A 1RD9D 1DCZA 1SNOA 4QMGA 2F0FA 1EY0A 5C0XJ 4KKSA 2Q8TA 3HS0C 3NQTA 4KK7A 2FINB 4TKOB 2KOLA 2E2JB 1SBBB 1NR4A 1Y1WB 1Z47A 1FNWA 4Z9CB 4BY1B 2K5DA 3DUZA 3T51B 1HPCA 5FO8B 4A3KB 1D1IA 1D2BA 4IFDG 2VB3X 5IT9L 4FF4A 5I4DA 2NTTA 5EBDA 1BCPD 1EWHA 1XYIA 1E2VA 3D4DA 1HA5A 2X6LA 3QOJA 4XT1B 1M4VA 3TMEA 1KLGD 2L4NA 2B2YA 5KNBA 4L6TB 4ZK9B 1DOLA 1CQVA 2Z8LA 5M9OA 4ZLTF 2F0VA 2E75C 2F0HA 2A74C 5CYUA 1STGA 1EOTA 2O2LD 1IKMA 1XX8A 1CI3M 4BWGB 4HMJA 3DM1A 2LS01 1JE4A 2EXZA 4EQNA 2EY5A 1NCVA 3GTPB 5C3EB 2NVQB 5KGUA 5CBEE 1Z7TA 3J80L 1PXUA 5EQ0A 3UI2A 2QEJC 1QILA 1LT4D 4A3EB 3V05A 1DXMA 1JWSD 2NZ1D 2LFNA 5C5MA 1BR9A 1TWCB 2KJXA 3HP3A 4H0LC 4S3SA 2DNEA 2TMPA 4F7XA 3HKZB 4KY7A 1LACA 4MHEA 3TZDA 1STYA 2K5QA 1ENAA 2K6AA 2TSSA 4KHVA 1JORA 5C4HA 3K5OA 3M85A 2IL8A 3S2HB 5J1ZA 1KABA 5COYA 1MSHA 1TR5A 2AWOA 2C5CA 3W2DA 4PQXA 3QWNA 4IZ8A 4PMCA 2K32A 1O7ZA 3FRPB 2JA7B 4Q5VA 2I07B 4QUFA 1B9NA 5G3LF 5IGFA 2RDGA 1EY5A 1F77A 2PZTA 4RCNA 5C6AA 3W3AA 1GHKA 4O42A 2IX1A 4HR7B 5ELCA 5A35A 5CGKA 1T5EA 4TQUS 5K36G 3S1RB 1EQTA 3A7AB 3KLSX 4DK0A 1WTRA 5M5WB 4IUPA 3FMCA 1H9SB 2B2YC 4A3MB 2SNMA 5IGBA 1LT6D 1LABA 2IWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K5P A;  3BDL A;  4QMG A;  3V2T A;  2F0F A;  2EYH A;  2PZW A;  5CV8 A;  1EY0 A;  4ZUI A;  3U9O A;  2M00 A;  4MIU A;  3SR1 A;  4I65 A;  2F0I A;  5C4Z A;  5CV6 A;  3NQT A;  5C5M A;  1AEX A;  1SYD A;  5CV7 A;  2HQE A;  5EGT A;  4DFA A;  4N9P A;  2F0T A;  3EJI A;  4ID6 A;  4F8M A;  3E5S A;  4EQO A;  1SYE A;  4PNY A;  3SK8 A;  3OMC A;  2F0Q A;  2ENB A;  3SK4 A;  4S3S A;  4EVO A;  2EYP A;  4LAA A;  1TQO A;  5F2D A;  4KY5 A;  1KDA A;  1EY7 A;  1IHZ A;  1SYF A;  2F0E A;  2F0G A;  2RBM A;  3TP5 A;  2SNS A;  2WAC A;  4F7X A;  4KY7 A;  5IGG A;  3ERQ A;  2PYK A;  3D4W A;  4K8I A;  1U9R A;  4DF7 A;  2QDB A;  2EYJ A;  2OF1 A;  2F0D A;  1STY A;  1EYC A;  1STB A;  1ENA A;  3C1E A;  3PMF A;  1A2T A;  4NP5 A;  4K2K A;  4YIJ A;  1SNP A;  1A3V A;  2NUC A;  5IGC A;  3LX0 A;  4QB4 A;  4KHV A;  2LKV A;  1A3T A;  5I9O A;  1STH A;  1JOR A;  4DGZ A;  4B9W A;  5C4H A;  5ISR A;  3BDC A;  5JAV A;  3SK5 A;  1EY6 A;  1F2Y A;  3D6C A;  5DEH A;  3VA5 A;  2OXP A;  2F0P A;  4ODG A;  5I6Y A;  1SYG A;  5IOD A;  3NK9 A;  5I9P A;  4WRD A;  4EQP A;  5J1Z A;  1JOQ A;  3QB3 A;  3MHB A;  1A2U A;  3MEH A;  5CC4 A;  3TP6 A;  1NUC A;  1KAB A;  2F3W A;  5I6W A;  3EVQ A;  2EYO A;  1A3U A;  4KY6 A;  5HUR A;  1TR5 A;  4H7B A;  5J39 A;  3NHH A;  3NXW A;  5CV5 A;  5E1F A;  2EYM A;  5EKK A;  3NP8 A;  1EZ6 A;  3TP8 A;  4K5W A;  1SYB A;  5J22 A;  5C3X A;  3HZX A;  3QOL A;  3D4D A;  2EY1 A;  4IZ8 A;  3MXP A;  4PMC A;  2SOB A;  3T16 A;  3P1H A;  3QOJ A;  4NMZ A;  3TP7 A;  2EY6 A;  5CR3 A;  1EQV A;  3C1F A;  4HMI A;  4RKB A;  5CV4 A;  4KTA A;  3TME A;  3HEJ A;  4IUN A;  5IOC A;  5KYL A;  4K5V A;  4J1M A;  1NSN S;  5IGD A;  1SNM A;  2F3V A;  4NKL A;  4QF4 A;  3SXH A;  1SYC A;  1SNQ A;  1STN A;  2F0L A;  5KEE A;  5KIX A;  5M9O A;  1JOK A;  1F2M A;  3DHQ A;  3MVV A;  3SK6 A;  4DU9 A;  5IGF A;  1F2Z A;  2F0J A;  2F0V A;  1JOO A;  1STA A;  1EY5 A;  4ZUJ A;  1EYD A;  5EKL A;  3D8G A;  1II3 A;  2PZT A;  2F0H A;  1SNC A;  5JOB A;  5E3F A;  5C6A A;  2F0W A;  2EYF A;  1EYA A;  3T13 A;  1RKN A;  1EZ8 A;  1STG A;  2F0S A;  3OWF A;  3R3O A;  4K5X A;  4KD3 A;  2EYL A;  4KD4 A;  4RKL A;  3DMU A;  4K6D A;  3ITP A;  5C3W A;  2F0U A;  1ENC A;  3P75 A;  2EY2 A;  1KAA A;  4J6H A;  1EY9 A;  2PQE A;  4HMJ A;  4KV6 A;  4OL7 A;  4R8N A;  4KJN A;  3ERO A;  5CV9 A;  5CGK A;  2KHS A;  5HGT A;  3SHL A;  1EY8 A;  5DAU A;  2PW5 A;  4KJO A;  1EY4 A;  3OMG A;  4K8J A;  2EXZ A;  2F0K A;  5KYI A;  4EQN A;  2EY5 A;  2O4X A;  4K14 A;  5KRU A;  4N9T A;  3S9W A;  3RUZ A;  3NUC A;  1SND A;  4ME5 A;  1TT2 A;  4E6I A;  5KGU A;  2RKS A;  5C5L A;  4PMB A;  4HTH A;  5IIF A;  2F0M A;  4ZQ3 A;  1KDC A;  3MZ5 A;  4IAL A;  1KDB A;  3OSO A;  5NUC A;  4B9X A;  2PZU A;  2RDF A;  2SNM A;  3H6M A;  4NDX A;  4TRD A;  2F0N A;  4WOR A;  2PW7 A;  2KQ3 A;  5IGB A;  1SNO A;  5IGE A;  2F0O A;  4K2L A;  2OEO A;  4G57 A; 
#chains in the Genus database with same CATH topology
 3BDL A;  4HIO A;  1PH2 A;  1X6O A;  3H0G B;  1VCI A;  3K6O A;  2BH2 A;  1B4O A;  1AW7 A;  2F0I A;  1I4X A;  2Z0S A;  1TWF B;  1EU4 A;  4JVZ A;  3VA7 A;  2LXJ A;  3NEN A;  1GKH A;  3PIP 3;  1Q86 C;  2K75 A;  4DR3 L;  1Y8O B;  4FF3 A;  3BZC A;  2SEB D;  1B3A A;  3PUV A;  2IX3 A;  1YNJ C;  2KVM A;  2K7V A;  1AZP A;  1RTO A;  2LMC B;  5LL6 X;  4DV0 Q;  3LX0 A;  1MJE A;  1QVF A;  3J7A F;  5AFW A;  5ISR A;  1ROD A;  3TS0 A;  1JJG A;  3HOY B;  4G7O C;  3CPF A;  5DEH A;  3T56 B;  4ODG A;  5IOD A;  4JI3 Q;  3D31 A;  3OPO A;  4PZ7 A;  1VQ7 A;  1YJ9 A;  2JA8 G;  3K80 C;  3KUP A;  1S5D D;  2YYZ A;  5LMU L;  4X6A H;  1T9H A;  1MSG A;  3HKS A;  4K5W A;  2CW0 D;  1TS4 A;  4HJ9 A;  1A8V A;  4LMQ D;  1EL0 A;  1F9Q A;  3SE0 A;  3LNN A;  3C1F A;  2JA6 H;  1CSQ A;  4KTA A;  2RHQ B;  2XTI A;  3FPU B;  3OW7 A;  2NZH A;  1D5M C;  2VQF Q;  1DM0 B;  1V9P A;  1PV4 A;  2L15 A;  3NTK A;  1YIJ A;  1JOK A;  1BVS A;  4DNT B;  4FF1 A;  1SNC A;  1BDO A;  2F0W A;  1V1O A;  1RKN A;  5ELD A;  1BF4 A;  3R3O A;  1O7Y A;  5C0X G;  2OQK A;  3OIP A;  4J6H A;  3H3V H;  4KJN A;  2YU9 H;  4DR4 Q;  2KHS A;  4IOC A;  3J7Z C;  3CXC A;  4C56 C;  2AKW B;  1PH4 A;  1Z9F A;  2Y0S E;  4ME3 A;  2B2W A;  3NUC A;  1NE3 A;  1CM9 A;  2VQE L;  2JA5 B;  1SE8 A;  4F87 A;  4A3C H;  1AFP A;  2RDF A;  4XXE A;  4MIU A;  2JXM B;  2XN9 C;  2AWN A;  2UXC Q;  4C3I B;  1P8L A;  5CV7 A;  5ELF A;  2PCF B;  5EGT A;  1HZC A;  4DFA A;  5JEA J;  2MJ8 A;  4JBK A;  3NBI A;  2F0Q A;  4EVO A;  3PSI A;  4R4I A;  2E2I H;  3OHX C;  1JMC A;  2R92 H;  3GTK H;  1BCP C;  1C48 A;  3ERQ A;  4Q0F A;  2K05 A;  4U67 3;  4TSS A;  5IYD G;  2ICI A;  1BQQ T;  2GVA A;  3RMH A;  2F0D A;  5LHY 1;  1UE6 A;  4NP5 A;  1D1K A;  3M4Y A;  1QJO A;  3K5L A;  4RG1 A;  1A3T A;  1X55 A;  5C4X G;  1X54 A;  1X3P A;  4FXK C;  3EFX D;  3D6C A;  5BN4 A;  4JV5 Q;  5I9P A;  2AUJ D;  4GS3 A;  1YJN A;  3MHB A;  1H9K A;  2FFK B;  5KNC A;  3SVM A;  4PV1 C;  3K7A H;  1E2Z A;  3K0X A;  1K0S A;  5EBC A;  3S15 B;  4FVM A;  1RHP A;  3HZX A;  3I90 A;  2K52 A;  1X3E A;  1IBL Q;  3AFP A;  3KJP A;  1FJG L;  1XXG A;  2UXB Q;  2I5L X;  1WYD A;  4DR7 L;  1Y8P B;  3I73 A;  1NMF A;  2PNR C;  1Y69 U;  3E0J A;  4A3I H;  5IOC A;  4GKK L;  2E8G A;  4DR6 Q;  2FJ2 A;  4K0K Q;  3AMU A;  2K1B A;  3TSS A;  3PO3 H;  3RN5 A;  3CW2 C;  3PCO B;  4C3J H;  3OYY A;  1JQY D;  1C4Q A;  3I72 A;  2NVX B;  3JC6 6;  1EFW A;  5JOB A;  4C3H G;  4DUY L;  1PHJ A;  3F8T A;  4UPA A;  3PUY A;  2A8V A;  4Y7N B;  4KD3 A;  2XGT A;  1C9O A;  3PUW A;  4IPC A;  4NW2 A;  3IL8 A;  1ASZ A;  4KHP L;  2JJQ A;  5CV9 A;  4BBS H;  1GJX A;  2BA0 A;  1KD1 C;  3SHL A;  2PW5 A;  3GV3 A;  4JI0 L;  3VR4 A;  3MXG A;  3PF5 A;  2R7Z G;  2KHJ A;  3HOZ H;  1TWA B;  1WTW A;  4FYD A;  4YWL A;  2B63 H;  2Q8R E;  4L63 B;  4DV6 L;  1I4P A;  5T1G A;  2F0M A;  3GTM H;  4ULL A;  1HTP A;  2PO4 A;  5IGE A;  2KQ3 A;  3S24 A;  3NWS A;  4POG A;  1K9M C;  2O5I C;  2EE1 A;  1OO9 B;  2CQO A;  3SR1 A;  1OXS C;  3E6Z X;  4RH6 A;  3S14 H;  3S16 B;  2OCE A;  4CDF C;  4YCU A;  4C2M B;  3BZK A;  3EJI A;  3SK8 A;  4OIK A;  5IYC G;  4DK6 C;  1TWH B;  2KCC A;  2ZT9 C;  3D4W A;  5ELN A;  4BBR H;  3MWY W;  1MBY A;  2XSC A;  1PZI D;  2NN6 I;  4HED A;  1H9M A;  3M4P A;  1PZK D;  1RF2 D;  3UDI A;  3CCM A;  1NTG A;  1ICW A;  1E1O A;  2B2W C;  2P5Z X;  5KND A;  1Y14 B;  1LTS D;  1UAP A;  2A1A A;  2AHO B;  1F2Y A;  3VA5 A;  1TWG B;  4OO1 G;  1SYG A;  4JG2 A;  1XMQ L;  3MXN A;  4WRD A;  4EQP A;  3MEH A;  1BCP F;  2Y0S G;  1NUC A;  1I6H B;  1Q82 C;  5J39 A;  3PO2 G;  3S1N H;  1TS3 A;  2E2D C;  3NP8 A;  1MHW C;  1B50 A;  3MXP A;  1G6P A;  1GVP A;  4R4C A;  1W6K A;  3CC4 A;  1S40 A;  2K04 A;  2NTS A;  2WKC A;  1N36 L;  1CTM A;  2QGQ A;  4NXM L;  2I5M X;  3HEJ A;  2UUA Q;  4MTK A;  1L1O A;  4QF4 A;  1P16 A;  1F9P A;  1GUN A;  4DV4 L;  1QZH A;  1HUM A;  2RA4 A;  5IYB H;  1SE3 A;  2KEC A;  1SMX A;  5M3F H;  4QUC A;  3A0J A;  3RLO A;  1VQ8 A;  1NNX A;  4DV1 Q;  2WAQ B;  5HGT A;  1EYG A;  4RKL A;  3H94 A;  4A3G B;  3BYY B;  5CMD A;  1XMO Q;  2UXD Q;  1E7Z A;  1EY9 A;  2HCC A;  2QIL A;  3NTI A;  2DNC A;  3CF5 A;  1GHJ A;  3OMG A;  5M3M H;  2FMC A;  2F0K A;  3J81 i;  5JJK A;  1DYQ A;  2PNH A;  1AP0 A;  3I8Z A;  1X3Q A;  1SMY D;  1J8I A;  1XTC D;  2HIX A;  4EQ5 A;  4CJ1 B;  2BH8 A;  3DWQ A;  4R8I A;  2RSN A;  2L55 A;  4LF4 L;  4YCV A;  4AYB E;  1KXL A;  4DXG A;  2CKZ B;  4HJ7 A;  2I0Q A;  4HJ8 A;  4RGT A;  3OOC A;  3LWU A;  3U9O A;  3GTL H;  3CRL C;  4POF A;  1SYD A;  1ZYR D;  2F0T A;  4YY3 Q;  2ZJR A;  3SK4 A;  2ENB A;  2MNA A;  1IKL A;  1WTX A;  3DM3 A;  4RWS C;  1WCM H;  2PQA A;  2R61 A;  2R93 H;  3TP5 A;  3BYT B;  2NB0 A;  2EYJ A;  1B44 D;  2CW0 C;  4XQN A;  4A3F B;  3NE5 B;  3HOX H;  4C1N I;  3I4N H;  3PIO 3;  3ULL A;  4JPB W;  1VQF A;  1XNR L;  3GTO B;  1WOC A;  3I56 A;  4LF5 Q;  2R7F A;  1JR0 D;  4HIM A;  3FVQ A;  3TRZ A;  2F0P A;  1CK1 A;  1IYV A;  5IP7 G;  1D5X C;  2IHE A;  4HID A;  4CKC A;  1GXD C;  4OHJ A;  1G6Z A;  1ET9 A;  3BVM A;  4R1J A;  4A3J G;  2VXW A;  4IOA A;  2B8F A;  2OWO A;  5E1F A;  2IX0 A;  3GTG B;  4XIG S;  1UE1 A;  2LSS A;  5C3X A;  1DOM A;  2QEX A;  4GNX A;  1N34 Q;  3I4O A;  1NY4 A;  3GTJ B;  4DXF A;  1TII D;  4UP8 A;  1LUZ A;  3TP7 A;  2QDL A;  1EQV A;  1JT8 A;  1B8A A;  1HZB A;  1B2T A;  3V96 A;  4J1M A;  3CCJ A;  3RD4 A;  3MFY A;  2F0L A;  4QIW E;  1BNZ A;  1VQK A;  2F03 A;  4L8J A;  4LF6 L;  1MGS A;  1B7Y B;  3CU7 A;  1Q90 A;  1I3Q B;  1L2F A;  1FD7 D;  1IXR A;  4BS9 A;  1EYA A;  4A3D B;  3I70 A;  4KKT A;  4KD4 A;  2YTY A;  3DEO A;  3FKI B;  4LF8 L;  3ITP A;  5C3W A;  1CKN A;  3J7A 5;  3HOU B;  2JE6 I;  1BXT A;  3KYH C;  4RMF A;  4OL7 A;  4LF9 Q;  2K14 A;  3ERO A;  1MI2 A;  2B8G A;  4LFC Q;  3S17 B;  4KJO A;  5JEA G;  1SJH D;  1QZG A;  4K8J A;  4QY7 A;  5KYI A;  4A3B G;  3RUZ A;  4DR5 Q;  4BY1 H;  4ME5 A;  4QJF A;  4HTH A;  1ML0 D;  3ER0 A;  2ZXR A;  2EZV A;  3AEV A;  2F0N A;  3S1M B;  1H9S A;  4A3K H;  1LT3 D;  3I55 A;  3I2Z A;  5CV8 A;  1MIU A;  5CV6 A;  3NWT A;  4HJA A;  3HOW B;  1EFI D;  5EAY A;  1VQC A;  2QF7 A;  1LO5 D;  3A8I E;  3K5N A;  1EY7 A;  4R9W A;  2F0E A;  3GDE A;  4GN3 B;  1PRT B;  2SNS A;  1MKH A;  2WAC A;  4OX9 Q;  3BVG A;  3J80 i;  4BA1 I;  2ZJQ A;  1J5E L;  2OF1 A;  5FLX L;  3C1E A;  3HOW G;  4A3L G;  1PTO B;  4JYA L;  1HZ9 A;  4YIJ A;  2UUC Q;  1GUO A;  1IL2 A;  1A3V A;  4QB4 A;  1B53 A;  4LF7 Q;  3I4M B;  4AYB B;  2PI2 A;  3I3C A;  3RZO B;  3AQQ A;  3VR5 A;  3QB3 A;  1H9J A;  1PYB A;  4IFD I;  1KHI A;  2E74 C;  2MUY A;  1SFO B;  4FNF A;  4DR2 Q;  1D7Q A;  3I4L A;  1WI5 A;  5I2Y A;  1HJP A;  3I4M G;  4AYB G;  1Z6H A;  3ONA B;  3M4O B;  4TVA B;  5DM7 3;  3GTQ B;  1AE2 A;  3K7U C;  2H4O A;  3FPP A;  2DN8 A;  3GTP H;  1EIF A;  2KEE A;  5C3E H;  1VF5 C;  5I2X A;  2NVQ H;  2F3V A;  1R9T B;  1CA5 A;  3F1Z A;  2VQF L;  2A68 D;  2HQL A;  4YWM A;  1JJ2 A;  2RSO A;  3FHW A;  3JAM i;  1EQR A;  3JAM L;  1HR0 L;  2OQ0 A;  1VQM A;  4NXN Q;  2Q2U A;  4JI7 Q;  4X3S A;  4A3E H;  2WV6 D;  3T13 A;  2EIF A;  1EZ8 A;  4XYO A;  1QNK A;  1GOZ A;  4P2C B;  3F2D A;  1TWC H;  1M1K C;  1JC7 A;  1G51 A;  4X64 L;  4JI1 L;  5JPM C;  1PMR A;  3A7L A;  4H02 A;  1QE6 A;  2WB1 E;  5FJ8 H;  4GNX C;  4DR4 L;  5BN5 A;  1D8L A;  3A55 A;  3NPP A;  4ZCK A;  4NPS A;  3HOV G;  4JOI C;  4UDU C;  2ZM6 L;  1JB3 A;  5M5X B;  3UDG A;  4HIK A;  1Y1V B;  4B9X A;  3Q24 A;  2PZU A;  1CKM A;  4M1U B;  1PH1 A;  4P71 A;  4LFB Q;  1J6Q A;  5M5Y B;  3TRE A;  5GAG C;  3S2H H;  2UXC L;  2A69 D;  4A93 B;  4LUO A;  2VUM G;  1RTN A;  4KY5 A;  4DF7 A;  1HNW Q;  2HD3 A;  4JBW A;  2HHH Q;  3K8A A;  4X62 Q;  4DV2 L;  1PA6 A;  4K2K A;  4IO9 A;  4HAE A;  1PLF A;  2DJG C;  5IE8 A;  3BDC A;  1EIY B;  3SK5 A;  4DPG A;  2R3Z A;  2OXP A;  2QA4 A;  4HCS A;  1FVI A;  2WIN B;  3QIA A;  4B3R L;  2EJM A;  4DAY B;  2UUB L;  4WJW A;  1QG7 A;  2N8N A;  3CCV A;  1R4Q B;  3NHH A;  1HFG A;  2KBN A;  1HNX Q;  5EPK A;  3AU7 A;  1CHP D;  3AFQ A;  4IJL A;  3P1H A;  2DY7 A;  1HR0 W;  1PRT F;  4GOP B;  3S1R H;  1VQ5 A;  1VQH A;  2F4I A;  3NSW A;  2JA8 B;  1SEB D;  1HNZ Q;  2N49 A;  4IUN A;  1EIH A;  2E76 C;  5M5W H;  1N9W A;  1PTO F;  1SYC A;  4HCE A;  1KL9 A;  1D5Z C;  4A3M H;  3A54 A;  1S5E D;  1SMY C;  1N33 L;  4GN5 A;  1V1P B;  3H0G H;  5JVH 3;  2RVL A;  3MXU A;  5LMN L;  1UE5 A;  1XNQ L;  1QOH A;  2JA6 G;  3TN2 A;  4EX5 A;  4MNO A;  5JJI A;  1TWF H;  2PQE A;  4PMW A;  4CDC C;  5FLM H;  1ZYR C;  5D14 A;  4P74 A;  2YU9 B;  1G8Z D;  1LLR D;  2PMZ B;  3DWP A;  3UDX A;  2Z4I A;  4XTC S;  1ET6 A;  2J0T D;  3RZD B;  4B3M Q;  3A56 A;  4DV3 Q;  2XVS A;  4Y52 H;  5HGQ A;  1N8R C;  3H6M A;  3S1Q H;  1XPO A;  2PW7 A;  4JI4 L;  4G57 A;  1FL0 A;  1CZW A;  3HOY H;  2RCN A;  5GAD C;  3HG9 A;  4ZUI A;  1LTG D;  2B39 A;  2IW3 A;  5FK9 C;  3L0O A;  1SDF A;  3T4A C;  1HXY D;  1A62 A;  1FNU A;  4KHZ A;  4LK1 C;  3N52 A;  1SYE A;  3VR3 A;  2IPK D;  1NR2 A;  2EYP A;  4A3C G;  3CCE A;  1PFM A;  1IHZ A;  1DGS A;  2AQ3 B;  2D2C C;  4K8I A;  3TDQ A;  4CBV A;  4X65 Q;  5H1S E;  3CMA A;  3KLW A;  4UAI A;  5IP9 H;  4NB3 A;  4R4T A;  3CCL A;  1SNP A;  1HQM C;  2LKV A;  4DV5 Q;  1IZ6 A;  4FF2 A;  3ICE A;  1S72 A;  1PFN A;  1E24 A;  2WB1 G;  3BDO A;  3CD6 A;  4DV7 L;  2R92 G;  1W3S A;  2N3S A;  3R8B A;  2BDN A;  2F3W A;  1A3U A;  5C4X B;  1TS2 A;  2JK8 A;  3OTO L;  1CQF A;  4X3T A;  3MEF A;  5EKK A;  3M9B A;  4CKE A;  4DA2 A;  1SAP A;  3PIP A;  2NVT H;  3NBH B;  1TU2 B;  3PUX A;  5LMN W;  3Q0A A;  1EQQ A;  1JJC B;  2L12 A;  2VL6 A;  1PH8 A;  4K5V A;  4O0A A;  3CCU A;  3RNU A;  1AN8 A;  1U0L A;  4AIM A;  2JA5 H;  2CQA A;  3MVV A;  2FMM A;  1E0B A;  2E5L Q;  1EYD A;  3PF4 A;  3ND9 A;  4JI2 Q;  1CA6 A;  2LY7 A;  1NBW A;  3J81 c;  1A0I A;  1VQO A;  4C3I H;  2EXD A;  2YTX A;  4A3I G;  1LTL A;  4IPD A;  2ALY B;  1DD2 A;  1ENC A;  2DY8 A;  4CHT B;  3H3V I;  1F9S A;  4C3H B;  2UXD L;  1O7L A;  2B2V C;  2A5H A;  1ZKO A;  4FXG C;  1PRT D;  3W1B A;  4MZ9 A;  2CWP A;  5C0X I;  3PO3 G;  4DR3 Q;  4C3J G;  5EPJ A;  2NVY B;  2E2H B;  1TT2 A;  1PTO D;  2FXQ A;  4FO2 A;  2ICE C;  5NUC A;  1ZEQ X;  2VNU D;  2NN6 H;  5C44 H;  5FO7 B;  2AMC B;  1JWM D;  1V1Q A;  2R7Z B;  1U4P A;  4BBS G;  2D9U A;  3D3R A;  2Q8I B;  3E0E A;  3VYS A;  1F2L A;  2FHT A;  1SR3 A;  1FGB D;  4I65 A;  2VY3 A;  3KDF B;  3HOZ G;  3IFD A;  2B63 G;  3C46 A;  4DNR B;  4IUT A;  2KED A;  1UUP A;  5C4J B;  3S14 B;  2MP1 A;  4YHH L;  2HDL A;  5LMU Q;  3VDY A;  2KCN A;  2XWJ B;  3S15 H;  4DAP A;  2N88 A;  1O7I A;  1TKW B;  3CPW A;  3O13 A;  3ND8 A;  4L5Q A;  1YHA A;  1K3R A;  1HQR D;  1S5F D;  2QKI C;  1EU3 A;  2AUK A;  4OON A;  1Y8N B;  4DN4 M;  5I9O A;  1ENF A;  1EY6 A;  3SGI A;  3VR6 A;  5I6Y A;  4LF5 L;  4LFA L;  4X3U A;  4ABN A;  1Q1B A;  4KI0 A;  2NVX H;  2A68 C;  2EVB A;  4JI8 L;  2BDO A;  4BBR G;  2MO0 A;  4CGY B;  2WP8 J;  2RCF A;  1TVX A;  2HUG A;  1IBM L;  5IT9 c;  1VDZ A;  3QOL A;  4B3S L;  2Y0S B;  3T53 B;  2EY6 A;  3TS2 A;  1Q1E A;  1YZ6 A;  2CVR A;  3PO2 B;  1TWA H;  3QR8 A;  1NSN S;  5IT9 E;  3NQI A;  1AE3 A;  4DU9 A;  3VR2 A;  2VQE Q;  2B2T A;  3QG1 A;  4L5R C;  1JOO A;  1STA A;  3R2T A;  1LTI D;  2KUM A;  3CC7 A;  1KNA A;  5IYC H;  3HGB A;  4IUR A;  2D62 A;  3PV0 A;  1GO3 E;  1K8O A;  1D6E C;  2F0S A;  2XIW A;  4RFB A;  1QVG A;  3S16 H;  1QCB D;  2ZXO A;  2V1C C;  3M3Y H;  4C2M H;  1VQI A;  3T1H L;  3P75 A;  4CJ0 B;  1M90 C;  2A69 C;  5AJ3 L;  5IYB G;  5M3F G;  2K03 A;  3VYT A;  1TWH H;  1K73 C;  3MA2 B;  2QW7 A;  3DXJ C;  2RHS B;  2J4X A;  4N9T A;  1PH5 A;  1HRJ A;  4DR5 L;  2JYO A;  2NZO A;  1S4Z A;  4U68 A;  5JJL A;  2CH4 W;  3CCQ A;  1CZG A;  2OTL A;  1FGU A;  4LNQ A;  4LWC A;  1TWG H;  4XQQ A;  1JIC A;  4GKJ Q;  1KTK A;  5M3M G;  3J80 c;  1S5B D;  5E4W C;  2YTV A;  1KRT A;  4B3T L;  1I6H H;  2Z6K A;  4EQO A;  4CKB A;  3L9A X;  1BBW A;  1TQO A;  5A2Q E;  1WD0 A;  1WTQ A;  2EQS A;  3D6W A;  2QDB A;  3BJU A;  1FJG Q;  1STE A;  5D3I B;  3IRB A;  2UU9 L;  4C1N K;  1N32 L;  4DR7 Q;  1CHQ D;  4JK1 C;  1E22 A;  4DGZ A;  3G7L A;  3MFG A;  1XTD A;  5IY0 A;  5HY6 A;  3KBG A;  1HCZ A;  1WCM G;  4LF7 L;  3QO2 A;  2R93 G;  4O1N A;  4GN4 B;  2F4V L;  1NAP A;  1A2U A;  1LM0 A;  1RJT A;  4PG3 A;  4DUZ Q;  4DUY Q;  4OO1 I;  3EVQ A;  5HUR A;  4HSV A;  2N55 A;  4GLX A;  3HOX G;  1G2T A;  3I4N G;  1UNS A;  4A3G H;  3LWE A;  3GD7 A;  3T16 A;  4KHP Q;  3JAM c;  4NMZ A;  1PZJ D;  2ZJP A;  4A3J B;  1I94 L;  4IQZ A;  5CV4 A;  4DK1 A;  1HUN A;  4JI0 Q;  4QGU A;  3HKZ E;  1PYW D;  3G6J B;  2MPM A;  4NKL A;  1SNQ A;  2ASB A;  5KEE A;  4DV6 Q;  5EKL A;  1L0X B;  1VQN A;  4LJZ C;  3S2D B;  1LTR D;  2X6G A;  3KF8 B;  1VQJ A;  1VMP A;  2L0C A;  3GO5 A;  4AQY L;  3MAQ A;  2Z4H A;  1KAA A;  3GP7 A;  4JOI A;  4KV6 A;  4OEM B;  3U4V A;  4XYQ A;  2EDG A;  4A3F H;  4E6I A;  2NWG A;  4BXX H;  1KDB A;  2A73 B;  1OTC A;  4ZKB B;  1IW7 D;  1VQD A;  3ZYY X;  3GTO H;  2D0O A;  2F0O A;  3K81 C;  5K5P A;  4A3B B;  3V2T A;  4OIJ A;  1RIP A;  2B2T C;  3RLN A;  2VW9 A;  2ES2 A;  1CT1 D;  5FO9 B;  4LFB L;  3A8J E;  5J3B A;  2OT2 A;  3SEB A;  2M00 A;  5CBA E;  1YVC A;  1M8A A;  1XMQ Q;  2HCI A;  1V8Q A;  2E2J H;  2K28 A;  2HQE A;  4BY1 G;  4XQJ A;  1Y1W H;  1FNV A;  3T1Y L;  3CQZ B;  2C9O A;  1PFB A;  4IFD H;  3RLF A;  2L9H A;  4DR1 L;  3GTG H;  1LYL A;  2CCZ A;  2L11 A;  3GTJ H;  1KC8 C;  4A3K G;  1QUQ B;  4RGM A;  1HNW L;  3P7J A;  1HA6 A;  5GRO A;  5T1I A;  1A2T A;  5GAE C;  3ULP A;  2A19 A;  2NUC A;  4NXM Q;  1UEB A;  1L1O B;  3R2I A;  4L5T A;  4IPG A;  1DOK A;  4FXD A;  2A6H D;  4DV4 Q;  2CWA A;  5DM6 3;  5DNF A;  2JEB I;  4BY7 B;  3STB D;  1AH9 A;  5JPN C;  1RDP D;  5JEA H;  1S3O A;  1U5K A;  5CC4 A;  1I3Q H;  4A3D H;  4DK3 C;  4KY6 A;  4KKU A;  3PUZ A;  2H5X A;  3EIV A;  4DAY A;  3M7N A;  3FKI H;  3I91 A;  3HOU H;  2Z6K C;  2EPB A;  4BY7 G;  2SOB A;  4WJ4 A;  3S17 H;  2DUD A;  4RKB A;  3KOJ A;  4DV0 L;  2CHB D;  1ICF B;  4GOP A;  1K83 B;  1U4M A;  1IYJ B;  1PRT C;  4MTN A;  3PIO A;  3A5U A;  1I50 B;  2NYZ D;  5KIX A;  3KJO A;  1QB5 D;  3NEL A;  1F2M A;  4JI3 L;  5A2Q L;  3SK6 A;  2F0J A;  3CC2 A;  3S1M H;  1PTO C;  1TY2 A;  2HIV A;  1LTA D;  2PI2 E;  1BBX C;  4LF4 Q;  3X3N A;  2SDF A;  3A8K E;  2GA4 B;  1V1P A;  4K5X A;  3DMU A;  1XJV A;  1PVO A;  2M2L A;  1BKB A;  5C3E G;  1KLU D;  2F0U A;  3HOW H;  1H95 A;  2N78 A;  4AH6 A;  1QNU A;  2K5V A;  1RCV D;  5DAU A;  3L3O C;  4V0B A;  2EJG C;  3OWE B;  1WD1 A;  1O80 A;  1TY0 A;  2O4X A;  1FR3 A;  5KRU A;  4DNI A;  1X3F A;  1SND A;  5BN3 A;  4A3E G;  2D0P A;  2ZTC A;  3FDT A;  1ILQ A;  1PTO H;  3A74 A;  1NJI C;  4IAL A;  3U4Z A;  2K5H A;  1HFN A;  2X69 A;  1XNR Q;  3CKI B;  3I4M H;  4XDX A;  3HOV B;  2PZW A;  1KNE A;  3DLL A;  3RZO H;  1IYU A;  5FJ8 G;  3GQB A;  4G7H C;  1AZQ A;  3HKZ G;  3Q8D A;  4KMU C;  1EIG A;  1SFO H;  1IBK Q;  4N9P A;  4F8M A;  4M8A A;  3E5S A;  1GD7 A;  1F9R A;  5F2D A;  2F0G A;  4X3K A;  2ZXP A;  3WDN A;  5BR8 Q;  1DZ1 A;  2ATW A;  3TZU A;  1K8A C;  3M4O H;  1YHB A;  2J7Z A;  1S5C D;  1LT5 D;  3GTQ H;  4EGV A;  3PMF A;  1EYC A;  1STB A;  1EUJ A;  4QIW B;  4X65 L;  1WJJ A;  2VUM B;  1GUW A;  5IGC A;  1B3Q A;  5ELE A;  3CCR A;  2GVB A;  3VYU A;  1EEI D;  2HT1 A;  2WFW A;  1VQB A;  2MO1 A;  5I6W A;  3F2C A;  1B9M A;  5CV5 A;  5GAH C;  2AQ1 B;  1PFS A;  5J22 A;  2EJF C;  1YNN D;  4LF8 Q;  4ILW A;  2JP1 A;  1GUT A;  1EOV A;  5GQO A;  2O5J C;  2JA7 H;  5CR3 A;  3D0F A;  3UE0 A;  1JE5 A;  1LTT D;  3NBH A;  5TSS A;  2XNA C;  3Q22 A;  4P75 A;  5JJZ A;  1BOS A;  2AQ2 B;  1ESR A;  5M5X H;  1Y1V H;  1UWV A;  5K36 H;  4JV5 L;  3QJY A;  2KA7 A;  1SE2 A;  5M5Y H;  2EYF A;  2B2V A;  1WFQ A;  2G9D A;  1QWY A;  1JWU D;  4K6D A;  1DJR D;  1I6V C;  4A93 H;  5ELB A;  1IBL L;  2UXB L;  4A3M G;  2JA6 B;  4DR6 L;  4K14 A;  3H0G G;  2HDM A;  3BG3 A;  4JW0 A;  2Q2T A;  1ILP A;  4K0K L;  2RKS A;  1J5E Q;  2BOS A;  4GOP C;  2B2U A;  3M4Q A;  3MZ5 A;  4A76 A;  4ALP A;  4JYA Q;  1ZXT A;  4NDX A;  4WOR A;  2BE5 D;  2B3G A;  2OEO A;  1BUV T;  1BO0 A;  5COR A;  3S1Q B;  1ONL A;  5FLM G;  4OGQ C;  3SDZ A;  2CH4 A;  5C4Z A;  2A6E D;  1AEX A;  2MGS A;  1W6J A;  2BCO A;  3H09 A;  3KDF A;  5D65 A;  4QCL A;  4V19 0;  1CSP A;  1KDA A;  1WTP A;  2OTJ A;  3L7Z C;  5IGG A;  3CHB D;  2PYK A;  5IWA Q;  3KF6 B;  3HOY G;  4ZAI A;  5E7N A;  2JA8 H;  4UY8 C;  2F52 A;  1GUS A;  3H3V C;  3Q6S A;  1Q8I A;  2RDH A;  1R4P B;  2JA9 A;  3BVZ A;  2K01 A;  3NK9 A;  1HTL D;  4I7A A;  2K33 A;  4IN3 A;  1HR0 Q;  2K5W A;  2Z9H A;  4JI5 Q;  3TEH B;  2KEN A;  5IP9 G;  1WVL A;  1G91 A;  1SE4 A;  2WB1 B;  1SYB A;  1VMC A;  1G2S A;  1SRO A;  3M7G A;  3EQL C;  4H13 C;  3K57 A;  2E2I B;  2R92 B;  3GTK B;  3K58 A;  3ULJ A;  4X64 Q;  4JI1 Q;  3URY A;  1Q81 C;  1SN8 A;  2M9V A;  2C35 B;  2Q2I A;  2XRS D;  2NVT B;  3E3X A;  5KYL A;  5IGD A;  5C0X H;  3RZD H;  3KK7 A;  1PH3 A;  2Z1C A;  4IFD J;  3DHQ A;  2ZM6 Q;  3KLS A;  1F2Z A;  4WFN 3;  3CME A;  1II3 A;  5G3L D;  4DKA C;  1Q46 A;  3VYR A;  2R6G A;  3C3L A;  3FEW X;  5E3F A;  3HRZ C;  1IW7 C;  4RA8 A;  4H44 C;  3K7A B;  3OWF A;  4X66 Q;  4RAU C;  1EWC A;  1BCP B;  5LL6 S;  1DON A;  1JOQ A;  1K8M A;  2JA5 G;  4IUV A;  1L0Y B;  4RGN A;  4UHV A;  3EBE A;  1EY8 A;  4JI6 Q;  1EY4 A;  1O78 A;  2ZTD A;  4QL5 A;  3RR5 A;  2UUA L;  1EWI A;  1XPU A;  4GLA C;  3IKJ A;  3S9W A;  4A3I B;  2MHV A;  1SXT A;  4UP9 A;  4PMB A;  5IIF A;  3U58 A;  3P20 A;  1LV9 A;  1VF7 A;  4KN7 C;  4C3I G;  4DV2 Q;  3PO3 B;  4C3J B;  2RQX A;  1YJW A;  5C44 B;  4DV1 L;  4G7Z C;  5IYD H;  3WOE A;  1W2B A;  3K59 A;  4RHS A;  2A6H C;  3AB9 A;  1MJC A;  3G48 A;  5EPL A;  1XMO L;  4B3R Q;  4GKJ L;  3STB C;  5C4X H;  4JCV E;  2UUB Q;  4ID6 A;  2G9H D;  2WAQ E;  1HHV A;  4BBS B;  2MQH A;  4PNY A;  3OMC A;  3J81 E;  4LAA A;  4PZ8 A;  1I4R A;  2NN6 G;  5C44 G;  1V43 A;  1QVC A;  2RBM A;  1UEA B;  3F2B A;  1X3G A;  4ZRZ A;  3H15 A;  3HOZ B;  2H1E A;  1SJE D;  2B63 B;  3DEP A;  1GUG A;  1X32 A;  3GTM B;  4GLV B;  4HJ5 A;  4CDE C;  1RL2 A;  3AYH B;  1TS5 A;  2B2U C;  4B9W A;  4OEL B;  2F1M A;  5JAV A;  4K6L A;  3CRK C;  1B1Z A;  1N33 Q;  1KQS A;  1EEF D;  3DWA A;  4ZKC B;  4YY3 L;  4UP7 A;  2EYO A;  1VQ6 A;  5LMN Q;  4P72 A;  1XNQ Q;  3U50 C;  4DUZ L;  3R93 A;  2F3I A;  2EY1 A;  3KBX A;  4HSP A;  4C3H H;  1YIT A;  3RN2 A;  4BBR B;  4IUQ A;  4R4O A;  5EKI A;  2NVY H;  3HFZ B;  1WTH A;  2Q2H A;  2IY5 B;  1K3B C;  2E2H H;  3EN2 A;  4RHR A;  4RCO A;  1VS0 A;  2BA1 A;  2NBF A;  3KLR A;  3E9I A;  4O2D A;  4ZUJ A;  2R7Z H;  1G29 1;  1KAW A;  1SSO A;  4Y7N H;  4JI4 Q;  3CP0 A;  1YI2 A;  1H9R A;  1YNX A;  5DLQ E;  2I46 A;  2JEA I;  3S1N B;  3MC0 B;  3KF8 A;  1N34 L;  2RF4 A;  2JSO A;  5FOB B;  5C4J H;  2GN5 A;  2I5H A;  1B70 B;  3M3Y B;  1ESF A;  1PH7 A;  4OXP A;  1OXX K;  4CJ2 C;  2CFM A;  5C5L A;  2EOT A;  2L5T A;  2XWB B;  3FP9 A;  4QQB X;  3LGJ A;  3NTH A;  4TRD A;  1CFM A;  5M3F B;  2WKD A;  1XWE A;  3IAY A;  4K2L A;  1I5F A;  3IFT A;  1E2W A;  2EYH A;  1FYC A;  3ZJY C;  4GZY C;  1VQ4 A;  4DV7 Q;  1JCK B;  3N6R A;  5JVG 3;  4LF9 L;  3D4R A;  3H91 A;  4KN4 C;  5FKA C;  4LFC L;  2ZTE A;  3OTO Q;  3C2P A;  4OO1 H;  5EJW A;  1C8C A;  1SYF A;  4WJ3 M;  5M3M B;  1YBY A;  3A5Z B;  1U9R A;  2PPB C;  3I7F A;  1YNN C;  3KFU A;  3Q23 A;  3PO2 H;  1A15 A;  3CCS A;  2IJ0 A;  1OXV A;  3BS1 A;  1I4G A;  4J15 A;  1QUQ A;  4MN3 A;  1LTB D;  3OIQ A;  3TBI B;  2WII B;  1STH A;  4RGO S;  1I4H A;  3BU2 A;  2B29 A;  5FLX c;  3NEM A;  1Q3L A;  3GTL B;  5D3D A;  3GV6 A;  3TP6 A;  2D5D A;  1IL8 A;  4IJH A;  4H7B A;  3NXW A;  2EYM A;  4OWX B;  1MD2 D;  1EZ6 A;  3EA6 A;  3TP8 A;  1YNJ D;  1WCM B;  4OX9 L;  3J80 E;  2R93 B;  1WTV A;  5FLX E;  3WOF A;  2ID0 A;  3K0Y A;  4HMI A;  1K8G A;  4GKK Q;  1T5X D;  2UUC L;  4DAV A;  4I7Z C;  3HOX B;  3I4N B;  4BA2 I;  3G71 A;  1WTO A;  1SNM A;  3MTS A;  3SXH A;  4XT3 B;  1STN A;  4IPH A;  2WAQ G;  3J81 L;  2VB2 X;  1L0W A;  3BZD B;  2IHF A;  4A3G G;  2IT1 A;  4CDD C;  1VQA A;  1U4R A;  3D8G A;  3PGZ A;  3F2U A;  3K5M A;  4APV A;  2BE5 C;  1J9O A;  1Q12 A;  3J7Y W;  4DR2 L;  3WWV A;  1E3P A;  2EYL A;  1X56 A;  3G6E A;  2EY2 A;  4R8N A;  1TXY A;  3U9S A;  2A6E C;  2V4D A;  4J8Q A;  1OXU A;  1OXT A;  4YHH Q;  1I4Q A;  2L1B A;  4IUU A;  3X3M A;  1PDQ A;  1U4L A;  2XRQ D;  4ZYS A;  5E4X A;  1CKO A;  4FP5 D;  4G4K A;  1A6X A;  5L37 A;  2JQO A;  3J7A V;  3JAM E;  4B08 A;  4HN7 A;  4ZQ3 A;  1KDC A;  1Q7Y C;  1HH2 P;  3OSO A;  2QCP X;  4F88 A;  1RD9 D;  1DCZ A;  2DJF C;  4N8X 1;  3UE1 A;  1SNO A;  3E9H A;  4NXN L;  4QMG A;  1K28 A;  4JI7 L;  2F0F A;  1EY0 A;  1ASY A;  4LFA Q;  5C0X J;  4KKS A;  2Q8T A;  1KIX A;  3HS0 C;  3NQT A;  4KK7 A;  4JI8 Q;  4A3F G;  4YCW A;  2FIN B;  4TKO B;  2KOL A;  4BXX G;  1IBK L;  3J81 j;  2E2J B;  4KLK A;  1IBM Q;  1SBB B;  1NR4 A;  5IP7 H;  4OWW B;  5ELO A;  1PH6 A;  1Y1W B;  1Z47 A;  1FNW A;  5BR8 L;  4B3S Q;  4A3J H;  4Z9C B;  4BY1 B;  2K5D A;  3DUZ A;  3T51 B;  1KRS A;  1HPC A;  5FO8 B;  1UE7 A;  4A75 A;  4A3K B;  3MXN B;  1Y1W G;  1D1I A;  3TQY A;  4R4Q A;  1D2B A;  4IFD G;  1C0A A;  2VB3 X;  5IT9 L;  4FF4 A;  3S2D H;  1A63 A;  5I4D A;  1BBU A;  2NTT A;  1PH9 A;  5EBD A;  1BCP D;  2VS1 A;  1EWH A;  1XYI A;  1E2V A;  3D4D A;  1N36 Q;  1HA5 A;  3T1H Q;  2X6L A;  3QOJ A;  4XT1 B;  1M4V A;  2HHH L;  5AJ3 Q;  4X62 L;  2JN4 A;  3TME A;  1KLG D;  2L4N A;  2B2Y A;  5KNB A;  4L6T B;  2K50 A;  2K4K A;  4ZK9 B;  4A3D G;  1DOL A;  4JBM A;  1CQV A;  2Z8L A;  5M9O A;  1XPR A;  1VQG A;  4ZLT F;  3FKI G;  3HOU G;  2F0V A;  4A3B H;  3W5O A;  2E75 C;  1L1O C;  2F0H A;  4PZ6 A;  2A74 C;  2K5N A;  3G4S A;  5CYU A;  1STG A;  1EOT A;  1HNX L;  3L2P A;  2O2L D;  1IKM A;  1XX8 A;  1CI3 M;  4BWG B;  4B3T Q;  4HMJ A;  3CQZ H;  3DM1 A;  2LS0 1;  1JE4 A;  1HNZ L;  2EXZ A;  3PQI A;  4EQN A;  2EY5 A;  1NCV A;  3GTP B;  5C3E B;  2NVQ B;  5KGU A;  5CBE E;  1Q8K A;  2UU9 Q;  1N32 Q;  1Z7T A;  2R7D A;  3ERS X;  3J80 L;  1X9N A;  1NMG A;  4LUZ A;  1E1T A;  1PXU A;  5EQ0 A;  1VQP A;  3UI2 A;  1YEZ A;  2QEJ C;  1QIL A;  1LT4 D;  4BY7 H;  4A3E B;  3V05 A;  1DXM A;  1JWS D;  2NZ1 D;  4A3L H;  2LFN A;  2F4V Q;  5C5M A;  1BR9 A;  1TWC B;  2YV5 A;  2KJX A;  2PQA B;  3HP3 A;  4H0L C;  1JB7 A;  3B6Y A;  2DGY A;  2DNE A;  4S3S A;  1X65 A;  2TMP A;  1K0R A;  1C7Y A;  4F7X A;  3HKZ B;  4KY7 A;  1YHQ A;  4B3M L;  1LAC A;  4DV3 L;  1SRU A;  5IWA L;  1I94 Q;  4MHE A;  3TZD A;  1STY A;  2K5Q A;  1ENA A;  2K6A A;  3KF6 A;  1K83 H;  1VQ9 A;  2MFI A;  2PMZ E;  2TSS A;  4KHV A;  1I50 H;  1JOR A;  5C4H A;  1GM5 A;  4N8F A;  3K5O A;  3OW2 A;  2LXK A;  3M85 A;  3UDF A;  2IL8 A;  3S2H B;  5J1Z A;  4DAM A;  4FDB A;  1KAB A;  1HZA A;  5COY A;  1MSH A;  1TR5 A;  1CUK A;  2AWO A;  2C5C A;  3W2D A;  4GNX B;  4PQX A;  4JI5 L;  1SLJ A;  2KCM A;  3QWN A;  4JBJ A;  2Z6B A;  4AQY Q;  4LUV A;  4IZ8 A;  4PMC A;  2K32 A;  1O7Z A;  4YWK A;  4OWT B;  1R9T H;  3FRP B;  4LW1 A;  2JA7 B;  4Q5V A;  2I07 B;  1PYS B;  4DV5 L;  4A4I A;  4QUF A;  3CAM A;  1B9N A;  3W1G A;  2G5D A;  5G3L F;  4L5S A;  1VQL A;  4LF6 Q;  5IGF A;  2RDG A;  1EY5 A;  1F77 A;  2PZT A;  4P73 A;  4RCN A;  3HOV H;  2KCT A;  3W3A A;  5C6A A;  1GHK A;  2JA7 G;  4O42 A;  1CKN B;  4JC0 A;  2IX1 A;  4HR7 B;  5ELC A;  4X66 L;  5A35 A;  5CGK A;  1Y1V G;  3T1Y Q;  1T5E A;  4TQU S;  5K36 G;  2VZA A;  3S1R B;  1EQT A;  3A7A B;  3KLS X;  4DR1 Q;  4DK0 A;  1WTR A;  4JI6 L;  5M5W B;  4IUP A;  3FMC A;  1H9S B;  2VUM H;  2B2Y C;  2KHI A;  4A3M B;  2E5L L;  2SNM A;  4A93 G;  5IGB A;  1LT6 D;  1VQE A;  4JI2 L;  1LAB A;  2IWH A; 
#chains in the Genus database with same CATH homology
 3BDL A;  3H0G B;  1VCI A;  3K6O A;  1B4O A;  1AW7 A;  2F0I A;  1I4X A;  1TWF B;  1EU4 A;  3VA7 A;  3PIP 3;  1Y8O B;  4FF3 A;  2SEB D;  1B3A A;  3PUV A;  2IX3 A;  1YNJ C;  2KVM A;  2K7V A;  1AZP A;  1RTO A;  2LMC B;  5LL6 X;  3LX0 A;  3J7A F;  5AFW A;  5ISR A;  1ROD A;  3HOY B;  4G7O C;  5DEH A;  3T56 B;  4ODG A;  5IOD A;  3D31 A;  3OPO A;  3KUP A;  1S5D D;  2YYZ A;  1MSG A;  4K5W A;  2CW0 D;  1TS4 A;  4LMQ D;  1EL0 A;  1F9Q A;  3SE0 A;  3LNN A;  3C1F A;  4KTA A;  3FPU B;  3OW7 A;  1D5M C;  1DM0 B;  3NTK A;  1JOK A;  4DNT B;  4FF1 A;  1SNC A;  1BDO A;  2F0W A;  1V1O A;  1RKN A;  5ELD A;  1BF4 A;  3R3O A;  1O7Y A;  5C0X G;  3OIP A;  4J6H A;  4KJN A;  2KHS A;  4C56 C;  2B2W A;  3NUC A;  1CM9 A;  2JA5 B;  4F87 A;  1AFP A;  2RDF A;  4XXE A;  4MIU A;  2JXM B;  2XN9 C;  2AWN A;  4C3I B;  5CV7 A;  5ELF A;  2PCF B;  5EGT A;  4DFA A;  5JEA J;  2MJ8 A;  3NBI A;  2F0Q A;  4EVO A;  3OHX C;  1BCP C;  1C48 A;  3ERQ A;  4Q0F A;  2K05 A;  4U67 3;  4TSS A;  2ICI A;  1BQQ T;  3RMH A;  2F0D A;  5LHY 1;  4NP5 A;  1D1K A;  3M4Y A;  1QJO A;  3K5L A;  1A3T A;  1X3P A;  4FXK C;  3EFX D;  3D6C A;  5BN4 A;  5I9P A;  2AUJ D;  3MHB A;  1H9K A;  2FFK B;  5KNC A;  3SVM A;  4PV1 C;  1E2Z A;  5EBC A;  3S15 B;  4FVM A;  1RHP A;  3HZX A;  3I90 A;  1XXG A;  1Y8P B;  3I73 A;  2PNR C;  1Y69 U;  3E0J A;  5IOC A;  2FJ2 A;  3AMU A;  2K1B A;  3TSS A;  1JQY D;  1C4Q A;  3I72 A;  2NVX B;  5JOB A;  4C3H G;  3PUY A;  4Y7N B;  4KD3 A;  3PUW A;  4NW2 A;  3IL8 A;  5CV9 A;  1GJX A;  2BA0 A;  3SHL A;  2PW5 A;  3GV3 A;  3VR4 A;  3MXG A;  1TWA B;  1WTW A;  4FYD A;  2Q8R E;  4L63 B;  1I4P A;  5T1G A;  2F0M A;  4ULL A;  1HTP A;  2PO4 A;  5IGE A;  2KQ3 A;  3NWS A;  2O5I C;  2EE1 A;  1OO9 B;  3SR1 A;  1OXS C;  3E6Z X;  4RH6 A;  3S16 B;  4C2M B;  3EJI A;  3SK8 A;  4OIK A;  1TWH B;  2KCC A;  2ZT9 C;  3D4W A;  3MWY W;  1MBY A;  2XSC A;  1PZI D;  2NN6 I;  4HED A;  1H9M A;  1PZK D;  1RF2 D;  1ICW A;  2B2W C;  5KND A;  1LTS D;  1UAP A;  1F2Y A;  3VA5 A;  1TWG B;  4OO1 G;  1SYG A;  3MXN A;  4WRD A;  4EQP A;  3MEH A;  1BCP F;  1NUC A;  1I6H B;  5J39 A;  1TS3 A;  2E2D C;  3NP8 A;  1B50 A;  3MXP A;  1W6K A;  2K04 A;  2NTS A;  2WKC A;  1CTM A;  3HEJ A;  4QF4 A;  1F9P A;  1GUN A;  1HUM A;  2RA4 A;  1SE3 A;  2KEC A;  4QUC A;  2WAQ B;  5HGT A;  4RKL A;  3H94 A;  4A3G B;  3BYY B;  5CMD A;  1EY9 A;  2HCC A;  2QIL A;  3NTI A;  2DNC A;  1GHJ A;  3OMG A;  2FMC A;  2F0K A;  1AP0 A;  1DYQ A;  3I8Z A;  1X3Q A;  1SMY D;  1J8I A;  1XTC D;  4CJ1 B;  3DWQ A;  4R8I A;  2RSN A;  2L55 A;  4DXG A;  4RGT A;  3OOC A;  3LWU A;  3U9O A;  3CRL C;  1SYD A;  1ZYR D;  2F0T A;  3SK4 A;  2ENB A;  1WTX A;  1IKL A;  4RWS C;  2R61 A;  3TP5 A;  3BYT B;  2NB0 A;  2EYJ A;  1B44 D;  2CW0 C;  4XQN A;  4A3F B;  3NE5 B;  4C1N I;  3PIO 3;  3GTO B;  1JR0 D;  3FVQ A;  2F0P A;  1CK1 A;  1IYV A;  1D5X C;  4CKC A;  1GXD C;  4OHJ A;  1G6Z A;  1ET9 A;  3BVM A;  2VXW A;  2B8F A;  5E1F A;  2IX0 A;  3GTG B;  4XIG S;  5C3X A;  1DOM A;  3GTJ B;  4DXF A;  1TII D;  3TP7 A;  1EQV A;  1B2T A;  3V96 A;  4J1M A;  3RD4 A;  3MFY A;  2F0L A;  1BNZ A;  2F03 A;  4L8J A;  1MGS A;  1Q90 A;  1I3Q B;  3CU7 A;  4BS9 A;  1FD7 D;  4A3D B;  1EYA A;  3I70 A;  4KKT A;  4KD4 A;  3DEO A;  3FKI B;  3ITP A;  5C3W A;  3HOU B;  2JE6 I;  1BXT A;  4OL7 A;  3ERO A;  1MI2 A;  2B8G A;  3S17 B;  4KJO A;  5JEA G;  1SJH D;  4K8J A;  5KYI A;  3RUZ A;  4ME5 A;  4HTH A;  1ML0 D;  2ZXR A;  2EZV A;  2F0N A;  3S1M B;  1H9S A;  1LT3 D;  5CV8 A;  5CV6 A;  3NWT A;  3HOW B;  1EFI D;  2QF7 A;  1LO5 D;  3A8I E;  3K5N A;  1EY7 A;  4R9W A;  2F0E A;  1PRT B;  2SNS A;  2WAC A;  3BVG A;  4BA1 I;  2OF1 A;  5FLX L;  3C1E A;  1PTO B;  4YIJ A;  1GUO A;  1A3V A;  4QB4 A;  1B53 A;  3I4M B;  4AYB B;  3I3C A;  3RZO B;  3VR5 A;  3QB3 A;  1H9J A;  4IFD I;  2E74 C;  2MUY A;  1SFO B;  4FNF A;  3I4L A;  5I2Y A;  1Z6H A;  3ONA B;  3M4O B;  5DM7 3;  3GTQ B;  2H4O A;  3FPP A;  2DN8 A;  2KEE A;  1VF5 C;  5I2X A;  2F3V A;  1R9T B;  1CA5 A;  2A68 D;  2RSO A;  3JAM L;  4X3S A;  2WV6 D;  3T13 A;  4XYO A;  1EZ8 A;  1QNK A;  1GOZ A;  4P2C B;  1JC7 A;  5JPM C;  1PMR A;  3A7L A;  1QE6 A;  5BN5 A;  3A55 A;  3NPP A;  4UDU C;  1JB3 A;  5M5X B;  1Y1V B;  4B9X A;  3Q24 A;  2PZU A;  4M1U B;  5M5Y B;  2A69 D;  4A93 B;  1RTN A;  4KY5 A;  4DF7 A;  4JBW A;  4K2K A;  4HAE A;  1PLF A;  3BDC A;  3SK5 A;  2R3Z A;  2OXP A;  4HCS A;  2WIN B;  3QIA A;  2EJM A;  4WJW A;  1QG7 A;  1R4Q B;  3NHH A;  1HFG A;  5EPK A;  3AU7 A;  1CHP D;  3P1H A;  2DY7 A;  1PRT F;  2F4I A;  3NSW A;  2JA8 B;  1SEB D;  4IUN A;  1EIH A;  2E76 C;  1PTO F;  4HCE A;  1SYC A;  1D5Z C;  3A54 A;  1S5E D;  1SMY C;  1V1P B;  5JVH 3;  2RVL A;  3MXU A;  1QOH A;  3TN2 A;  2PQE A;  4PMW A;  1ZYR C;  5D14 A;  2YU9 B;  1G8Z D;  1LLR D;  2PMZ B;  3DWP A;  2Z4I A;  4XTC S;  1ET6 A;  2J0T D;  3RZD B;  3A56 A;  2XVS A;  3H6M A;  2PW7 A;  4G57 A;  1CZW A;  3HG9 A;  4ZUI A;  1LTG D;  2B39 A;  2IW3 A;  5FK9 C;  1SDF A;  3T4A C;  1HXY D;  1FNU A;  4KHZ A;  4LK1 C;  3N52 A;  1SYE A;  3VR3 A;  2IPK D;  1NR2 A;  2EYP A;  1PFM A;  1IHZ A;  2AQ3 B;  2D2C C;  4K8I A;  3TDQ A;  4CBV A;  4UAI A;  1SNP A;  1HQM C;  2LKV A;  4FF2 A;  1PFN A;  3BDO A;  3R8B A;  2BDN A;  2F3W A;  1A3U A;  5C4X B;  1TS2 A;  1CQF A;  4X3T A;  5EKK A;  4CKE A;  4DA2 A;  1SAP A;  1TU2 B;  3PUX A;  3Q0A A;  2L12 A;  4K5V A;  1AN8 A;  2CQA A;  3MVV A;  2FMM A;  1E0B A;  1EYD A;  3ND9 A;  1CA6 A;  2LY7 A;  1DD2 A;  1ENC A;  2DY8 A;  4CHT B;  1F9S A;  4C3H B;  1O7L A;  2B2V C;  2A5H A;  1ZKO A;  4FXG C;  1PRT D;  5C0X I;  4C3J G;  5EPJ A;  2NVY B;  2E2H B;  1TT2 A;  1PTO D;  4FO2 A;  2ICE C;  5NUC A;  1ZEQ X;  2VNU D;  2NN6 H;  5FO7 B;  1JWM D;  2R7Z B;  1U4P A;  2D9U A;  3D3R A;  2Q8I B;  3VYS A;  1F2L A;  2FHT A;  1FGB D;  4I65 A;  3IFD A;  3C46 A;  4DNR B;  4IUT A;  2KED A;  1UUP A;  5C4J B;  3S14 B;  2MP1 A;  2HDL A;  2KCN A;  2XWJ B;  4DAP A;  2N88 A;  1TKW B;  3O13 A;  3ND8 A;  1HQR D;  1S5F D;  2QKI C;  1EU3 A;  2AUK A;  4DN4 M;  1Y8N B;  5I9O A;  1ENF A;  1EY6 A;  3VR6 A;  5I6Y A;  4X3U A;  4ABN A;  1Q1B A;  4KI0 A;  2A68 C;  2EVB A;  2BDO A;  4CGY B;  2WP8 J;  1TVX A;  2HUG A;  1VDZ A;  3QOL A;  2Y0S B;  3T53 B;  2EY6 A;  1Q1E A;  2CVR A;  3PO2 B;  1NSN S;  5IT9 E;  3NQI A;  4DU9 A;  3VR2 A;  2B2T A;  3QG1 A;  1JOO A;  1STA A;  3R2T A;  1LTI D;  2KUM A;  1KNA A;  4IUR A;  3HGB A;  2D62 A;  3PV0 A;  1K8O A;  1D6E C;  2F0S A;  2XIW A;  4RFB A;  1QCB D;  2ZXO A;  3P75 A;  4CJ0 B;  2A69 C;  2K03 A;  3VYT A;  3MA2 B;  3DXJ C;  2J4X A;  4N9T A;  1HRJ A;  2JYO A;  1S4Z A;  4U68 A;  1CZG A;  4XQQ A;  1JIC A;  1KTK A;  1S5B D;  5E4W C;  4EQO A;  4CKB A;  3L9A X;  5A2Q E;  1TQO A;  1WD0 A;  1WTQ A;  3D6W A;  2QDB A;  1STE A;  5D3I B;  4C1N K;  1CHQ D;  4JK1 C;  4DGZ A;  3G7L A;  3MFG A;  3KBG A;  1HCZ A;  3QO2 A;  4O1N A;  1NAP A;  1A2U A;  1RJT A;  4OO1 I;  3EVQ A;  5HUR A;  4HSV A;  2N55 A;  1G2T A;  1UNS A;  3LWE A;  3GD7 A;  3T16 A;  4NMZ A;  1PZJ D;  4A3J B;  4IQZ A;  5CV4 A;  4DK1 A;  1HUN A;  1PYW D;  3G6J B;  2MPM A;  4NKL A;  1SNQ A;  5KEE A;  5EKL A;  1L0X B;  4LJZ C;  3S2D B;  1LTR D;  2X6G A;  1VMP A;  2L0C A;  3GO5 A;  3MAQ A;  2Z4H A;  1KAA A;  3GP7 A;  4KV6 A;  4XYQ A;  2EDG A;  4E6I A;  2NWG A;  1KDB A;  2A73 B;  4ZKB B;  1IW7 D;  3ZYY X;  2F0O A;  5K5P A;  4A3B B;  3V2T A;  4OIJ A;  2B2T C;  1CT1 D;  5FO9 B;  3A8J E;  2OT2 A;  3SEB A;  2M00 A;  5CBA E;  1M8A A;  2HCI A;  1V8Q A;  2K28 A;  2HQE A;  4XQJ A;  1FNV A;  3CQZ B;  2C9O A;  1PFB A;  4IFD H;  3RLF A;  2L9H A;  2L11 A;  4RGM A;  3P7J A;  1HA6 A;  5T1I A;  1A2T A;  2NUC A;  3R2I A;  4FXD A;  1DOK A;  2A6H D;  5DM6 3;  5DNF A;  2JEB I;  4BY7 B;  5JPN C;  1RDP D;  5JEA H;  5CC4 A;  4KY6 A;  4KKU A;  3PUZ A;  4DAY A;  3M7N A;  3I91 A;  2EPB A;  2SOB A;  4RKB A;  2CHB D;  1K83 B;  1U4M A;  1PRT C;  1I50 B;  2NYZ D;  5KIX A;  1QB5 D;  1F2M A;  5A2Q L;  3SK6 A;  2F0J A;  1PTO C;  1TY2 A;  1BBX C;  1LTA D;  3X3N A;  2SDF A;  3A8K E;  2GA4 B;  1V1P A;  4K5X A;  3DMU A;  2M2L A;  1KLU D;  2F0U A;  1QNU A;  1RCV D;  5DAU A;  3L3O C;  4V0B A;  2EJG C;  3OWE B;  1WD1 A;  1O80 A;  1TY0 A;  2O4X A;  1FR3 A;  5KRU A;  1SND A;  5BN3 A;  3FDT A;  1ILQ A;  1PTO H;  4IAL A;  1HFN A;  2X69 A;  3CKI B;  4XDX A;  3HOV B;  2PZW A;  1KNE A;  1IYU A;  3GQB A;  4G7H C;  1AZQ A;  4KMU C;  1EIG A;  4N9P A;  4F8M A;  4M8A A;  3E5S A;  1F9R A;  5F2D A;  2F0G A;  4X3K A;  2ZXP A;  3WDN A;  1DZ1 A;  3TZU A;  2J7Z A;  1S5C D;  1LT5 D;  4EGV A;  3PMF A;  1EYC A;  1STB A;  4QIW B;  2VUM B;  1GUW A;  5IGC A;  5ELE A;  3VYU A;  1EEI D;  5I6W A;  1B9M A;  5CV5 A;  2AQ1 B;  5J22 A;  2EJF C;  1YNN D;  4ILW A;  2JP1 A;  1GUT A;  2O5J C;  5CR3 A;  1LTT D;  3NBH A;  5TSS A;  2XNA C;  3Q22 A;  5JJZ A;  1BOS A;  2AQ2 B;  1ESR A;  5K36 H;  3QJY A;  2KA7 A;  1SE2 A;  2EYF A;  2B2V A;  2G9D A;  1QWY A;  1JWU D;  4K6D A;  1DJR D;  1I6V C;  5ELB A;  2JA6 B;  4K14 A;  2HDM A;  3BG3 A;  1ILP A;  2RKS A;  2BOS A;  2B2U A;  3MZ5 A;  1ZXT A;  4NDX A;  4WOR A;  2BE5 D;  2OEO A;  1BUV T;  1BO0 A;  5COR A;  3S1Q B;  1ONL A;  4OGQ C;  3SDZ A;  5C4Z A;  2A6E D;  1AEX A;  2MGS A;  1W6J A;  2BCO A;  3H09 A;  5D65 A;  4QCL A;  4V19 0;  1KDA A;  1WTP A;  3L7Z C;  5IGG A;  3CHB D;  2PYK A;  4ZAI A;  1GUS A;  3H3V C;  3Q6S A;  1Q8I A;  2RDH A;  1R4P B;  3BVZ A;  2K01 A;  3NK9 A;  1HTL D;  2K33 A;  4IN3 A;  2K5W A;  1WVL A;  1G91 A;  1SE4 A;  2WB1 B;  1SYB A;  1VMC A;  1G2S A;  3M7G A;  2E2I B;  3EQL C;  4H13 C;  3K57 A;  2R92 B;  3GTK B;  3K58 A;  3URY A;  2M9V A;  2XRS D;  2NVT B;  5KYL A;  5IGD A;  5C0X H;  3KK7 A;  2Z1C A;  4IFD J;  3DHQ A;  3KLS A;  1F2Z A;  4WFN 3;  1II3 A;  5G3L D;  3VYR A;  2R6G A;  3C3L A;  3FEW X;  5E3F A;  3HRZ C;  1IW7 C;  4RA8 A;  4H44 C;  3K7A B;  3OWF A;  4RAU C;  1EWC A;  1BCP B;  5LL6 S;  1DON A;  1JOQ A;  1K8M A;  4IUV A;  1L0Y B;  4RGN A;  1EY8 A;  1EY4 A;  1O78 A;  4A3I B;  3IKJ A;  3S9W A;  2MHV A;  1SXT A;  4PMB A;  5IIF A;  3P20 A;  1LV9 A;  1VF7 A;  4KN7 C;  4C3I G;  3PO3 B;  4C3J B;  2RQX A;  5C44 B;  4G7Z C;  3WOE A;  3K59 A;  4RHS A;  2A6H C;  3AB9 A;  5EPL A;  4ID6 A;  2G9H D;  1HHV A;  4BBS B;  4PNY A;  3OMC A;  3J81 E;  4LAA A;  1I4R A;  2NN6 G;  1V43 A;  2RBM A;  1UEA B;  4ZRZ A;  3HOZ B;  2H1E A;  1SJE D;  2B63 B;  3DEP A;  1GUG A;  1X32 A;  3GTM B;  1TS5 A;  2B2U C;  4B9W A;  2F1M A;  5JAV A;  4K6L A;  3CRK C;  1B1Z A;  1EEF D;  3DWA A;  4ZKC B;  2EYO A;  3R93 A;  2EY1 A;  3KBX A;  4HSP A;  4BBR B;  4IUQ A;  5EKI A;  4RHR A;  4RCO A;  2BA1 A;  2NBF A;  3KLR A;  4ZUJ A;  1G29 1;  1SSO A;  1H9R A;  2I46 A;  2JEA I;  3S1N B;  3MC0 B;  3KF8 A;  2JSO A;  5FOB B;  3M3Y B;  1ESF A;  1OXX K;  4CJ2 C;  5C5L A;  2EOT A;  2L5T A;  2XWB B;  3NTH A;  4TRD A;  1CFM A;  5M3F B;  2WKD A;  1XWE A;  3IAY A;  4K2L A;  3IFT A;  1E2W A;  2EYH A;  1FYC A;  4GZY C;  1JCK B;  3N6R A;  5JVG 3;  3D4R A;  3H91 A;  4KN4 C;  5FKA C;  3C2P A;  4OO1 H;  5EJW A;  1C8C A;  1SYF A;  5M3M B;  1U9R A;  2PPB C;  1YNN C;  3Q23 A;  1A15 A;  2IJ0 A;  1OXV A;  3BS1 A;  1I4G A;  4MN3 A;  1LTB D;  3OIQ A;  3TBI B;  2WII B;  1STH A;  4RGO S;  1I4H A;  1Q3L A;  3GTL B;  5D3D A;  3GV6 A;  3TP6 A;  2D5D A;  1IL8 A;  4H7B A;  3NXW A;  2EYM A;  1MD2 D;  1EZ6 A;  3EA6 A;  3TP8 A;  1YNJ D;  1WCM B;  3J80 E;  2R93 B;  1WTV A;  5FLX E;  3WOF A;  2ID0 A;  3K0Y A;  4HMI A;  1T5X D;  4DAV A;  4I7Z C;  3HOX B;  3I4N B;  4BA2 I;  1WTO A;  1SNM A;  3MTS A;  3SXH A;  4XT3 B;  1STN A;  3J81 L;  2VB2 X;  3BZD B;  2IT1 A;  1U4R A;  3D8G A;  3F2U A;  3K5M A;  2BE5 C;  1J9O A;  1Q12 A;  3J7Y W;  2EYL A;  2EY2 A;  4R8N A;  3U9S A;  2A6E C;  2V4D A;  4J8Q A;  1OXU A;  1OXT A;  1I4Q A;  3X3M A;  2L1B A;  4IUU A;  1PDQ A;  1U4L A;  2XRQ D;  4ZYS A;  5E4X A;  4FP5 D;  4G4K A;  1A6X A;  3J7A V;  3JAM E;  4B08 A;  4HN7 A;  4ZQ3 A;  1KDC A;  3OSO A;  2QCP X;  4F88 A;  1RD9 D;  1DCZ A;  1SNO A;  4QMG A;  2F0F A;  1EY0 A;  5C0X J;  4KKS A;  2Q8T A;  3HS0 C;  3NQT A;  4KK7 A;  2FIN B;  4TKO B;  2KOL A;  2E2J B;  1SBB B;  1NR4 A;  1Y1W B;  1Z47 A;  1FNW A;  4Z9C B;  4BY1 B;  2K5D A;  3DUZ A;  3T51 B;  1HPC A;  5FO8 B;  4A3K B;  1D1I A;  1D2B A;  4IFD G;  2VB3 X;  5IT9 L;  4FF4 A;  5I4D A;  2NTT A;  5EBD A;  1BCP D;  1EWH A;  1XYI A;  1E2V A;  3D4D A;  1HA5 A;  2X6L A;  3QOJ A;  4XT1 B;  1M4V A;  3TME A;  1KLG D;  2L4N A;  2B2Y A;  5KNB A;  4L6T B;  4ZK9 B;  1DOL A;  1CQV A;  2Z8L A;  5M9O A;  4ZLT F;  2F0V A;  2E75 C;  2F0H A;  2A74 C;  5CYU A;  1STG A;  1EOT A;  2O2L D;  1IKM A;  1XX8 A;  1CI3 M;  4BWG B;  4HMJ A;  3DM1 A;  2LS0 1;  1JE4 A;  2EXZ A;  4EQN A;  2EY5 A;  1NCV A;  3GTP B;  5C3E B;  2NVQ B;  5KGU A;  5CBE E;  1Z7T A;  3J80 L;  1PXU A;  5EQ0 A;  3UI2 A;  2QEJ C;  1QIL A;  1LT4 D;  4A3E B;  3V05 A;  1DXM A;  1JWS D;  2NZ1 D;  2LFN A;  5C5M A;  1BR9 A;  1TWC B;  2KJX A;  3HP3 A;  4H0L C;  4S3S A;  2DNE A;  2TMP A;  4F7X A;  3HKZ B;  4KY7 A;  1LAC A;  4MHE A;  3TZD A;  1STY A;  2K5Q A;  1ENA A;  2K6A A;  2TSS A;  4KHV A;  1JOR A;  5C4H A;  3K5O A;  3M85 A;  2IL8 A;  3S2H B;  5J1Z A;  1KAB A;  5COY A;  1MSH A;  1TR5 A;  2AWO A;  2C5C A;  3W2D A;  4PQX A;  3QWN A;  4IZ8 A;  4PMC A;  2K32 A;  1O7Z A;  3FRP B;  2JA7 B;  4Q5V A;  2I07 B;  4QUF A;  1B9N A;  5G3L F;  5IGF A;  2RDG A;  1EY5 A;  1F77 A;  2PZT A;  4RCN A;  5C6A A;  3W3A A;  1GHK A;  4O42 A;  2IX1 A;  4HR7 B;  5ELC A;  5A35 A;  5CGK A;  1T5E A;  4TQU S;  5K36 G;  3S1R B;  1EQT A;  3A7A B;  3KLS X;  4DK0 A;  1WTR A;  5M5W B;  4IUP A;  3FMC A;  1H9S B;  2B2Y C;  4A3M B;  2SNM A;  5IGB A;  1LT6 D;  1LAB A;  2IWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...