5LHY1

Pb3 domain of human plk4 (apo)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
b'SVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title A key centriole assembly interaction interface between human PLK4 and STIL appears to not be conserved in flies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 77
sequence length 77
chains with identical sequence 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.930 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5lhy100
5LHY1 1MBYA
chains in the Genus database with same CATH superfamily
2GVBA 2RSOA 1TVXA 1KTKA 4A3EB 3TREA 1MGSA 2CH4A 5C0XJ 4GLAC 2LFNA 4ID6A 4C56C 1VQ5A 1KQSA 4DV0L 3BVMA 2XTIA 2CKZB 1X6OA 1K8AC 5H1SE 4JI6L 4RGMA 3I8ZA 1VQEA 1PYSB 2J0TD 2ZJQA 4IFDG 3HOVG 1VQ7A 1AN8A 3I4MG 3M3YB 5ISRA 4PV1C 1E7ZA 3RMHA 1GUGA 2F3IA 2VL6A 4M8AA 2ZXPA 1VQ9A 3CHBD 2EY2A 2NZHA 4OHJA 1EFID 2L11A 4KN7C 3SK4A 2BDNA 3R2IA 2QDBA 1AW7A 4GNXB 2FJ2A 2R6GA 1QG7A 1S3OA 3TP8A 1I4PA 5C4XG 4HJ5A 3I4NB 4JOIA 1J5EL 3PO3H 2WFWA 1BF4A 4JI1L 1M8AA 1STGA 3M4OH 5KGUA 4LF9Q 2RQXA 3K59A 3CCQA 3KBXA 4BY7B 5AFWA 4A3JB 1XNRQ 2ZJRA 4FF2A 1QVGA 2EYLA 1NBWA 1N33L 2E2IB 3MXPA 2VUMH 4X6AH 1JCKB 4C3HH 2B2YC 3CCVA 4RA8A 1RJTA 2H4OA 2DNCA 3LGJA 3D8GA 3HOWH 1UEAB 1IXRA 4OIKA 1JC7A 1X56A 2OXPA 2SNSA 2L0CA 2VQFQ 4A3DH 1IBKL 1HQMC 4KI0A 3X3NA 4DR3L 1K83H 4KD4A 5FLXc 3FKIH 2Z1CA 1GUNA 3TEHB 3UE0A 1GHKA 1B3AA 3MFGA 1EY7A 3KLSA 3GD7A 3Q6SA 5JJZA 1E2ZA 5KIXA 4P71A 4HR7B 4A93G 1I6HH 2JQOA 1WVLA 1TT2A 2KENA 3E0EA 4K0KL 4YY3Q 1IZ6A 2R93H 2D5DA 3MVVA 1MJEA 2PW7A 5J22A 2QKIC 1HFNA 2ATWA 1G51A 3V2TA 1UE7A 4AH6A 1RIPA 3T56B 4I65A 2QILA 3BG3A 5JPMC 4BBSH 4GOPB 3TP7A 4F88A 3KF8B 2O2LD 1EIGA 3HOZH 1VQ8A 4H44C 3KK7A 5FO8B 1HXYD 2FINB 2K03A 3CW2C 2DN8A 3I3CA 4CJ1B 1E22A 1YI2A 4DXFA 4A3LH 1BQQT 4YHHL 2K5WA 3K5MA 1EY0A 4CGYB 4BA2I 3CP0A 1UNSA 2WIIB 2B29A 2IHEA 2F0IA 1LT4D 3D31A 5A2QL 4Z9CB 4F8MA 3IFTA 2NVXB 1I3QH 2H1EA 3VYSA 1KL9A 2EJGC 1RF2D 4R8IA 5AJ3L 3PSIA 3J7A5 3QOLA 2KCCA 3F2BA 5EKIA 5A2QE 5COYA 1XMOL 4LF8L 3TZUA 3HS0C 3ZJYC 5T1IA 2ZXRA 1Y1WH 4HIKA 2F4VQ 4LUVA 5IODA 2KHSA 2PI2E 4ZRZA 2HCCA 4ME3A 3TDQA 2ZT9C 4X3KA 5JJLA 2LSSA 5CORA 1XNQL 2F0PA 1V1OA 4KKSA 1TY0A 2DJGC 3C46A 1YEZA 2WB1E 1L0YB 3W1BA 2UU9L 4BXXH 1VQ4A 1CHQD 3KJPA 2RBMA 2NN6I 1ICWA 4K14A 5LHY1 5M5YB 2Q2IA 4OX9Q 1NY4A 4DN4M 3CXCA 3WWVA 3DLLA 1X54A 2A5HA 1X65A 2AQ2B 3MEHA 1HFGA 5M3FG 1NUCA 4DNTB 1SMYC 1S5ED 1STYA 3UI2A 2LS01 1HR0Q 1MSHA 1H9SA 1GKHA 1F77A 3FDTA 1MI2A 1IW7C 2P5ZX 5GAEC 1KIXA 2O4XA 2JA6G 2K6AA 3K5NA 1PFNA 1M90C 5G3LD 1VQ6A 3H0GH 1Q86C 5JJKA 2ES2A 3GTQB 3RZOB 1TS3A 1CQFA 2F0TA 4PQXA 3W2DA 2F0WA 4DR2L 4BY1H 1CKNB 5IYDH 3KDFA 5IT9L 3TS0A 3EA6A 2F0GA 2QEXA 1LV9A 1PH2A 1EU3A 3OPOA 4LF9L 2WB1B 4A76A 2JA9A 2GN5A 1BNZA 1DXMA 2D0PA 5M3MG 4J15A 1XNRL 3UDXA 1HZ9A 2YU9B 2SDFA 4NKLA 4DKAC 4L5RC 1PYWD 5CV5A 2NYZD 3PIOA 2NVTB 3K58A 2K28A 3GTMB 1LT6D 1EWCA 1U4MA 3F2DA 5CBAE 1YHBA 2AQ1B 4APVA 1K3BC 2CVRA 1A8VA 5FOBB 2VQFL 2L1BA 4L5SA 3HOVB 3I4MB 1CQVA 3S14B 3U50C 1G2TA 1I50H 1W2BA 5J3BA 4K2LA 4TKOB 4FXDA 3RUZA 4X3UA 5LL6S 2M9VA 1ZYRC 1XTDA 1D1IA 1UUPA 3PV0A 3TP6A 1C0AA 3RN5A 2EZVA 1PFBA 4A3GG 4FDBA 1JMCA 4B3RQ 5C4XB 5CV6A 5NUCA 4YY3L 5IYCG 1YVCA 1PTOH 3D0FA 3IAYA 3DEOA 3EBEA 4HCEA 1J6QA 1HNZQ 2B2UA 4C2MB 2F0SA 1R4PB 1W6JA 1LTGD 2F0UA 5I4DA 4EQPA 3IFDA 3HOUH 2K50A 4A3EH 4UP7A 1NAPA 1CI3M 2K52A 3W3AA 2G9HD 5I6WA 4P74A 2B2TA 1XX8A 4A3FB 2IX3A 3OHXC 2Z6KA 1TR5A 2ZTCA 3JAMc 2A6ED 2I5HA 1L1OC 4XTCS 2A73B 2EYJA 1KABA 2F4IA 4QL5A 4JI4Q 1GUWA 1I4XA 1C48A 4L63B 1HQRD 5E1FA 2A19A 4LFAQ 3M3YH 1DZ1A 1TY2A 2EQSA 3H15A 2L5TA 3TBIB 5ELBA 2R92H 4A93B 3GQBA 3U9OA 1KLGD 4V190 3ICEA 1NCVA 1DD2A 3KLRA 1BKBA 2WKDA 2LXJA 5C6AA 1FJGL 3I4NH 2RKSA 1SNMA 3GTLB 3QB3A 3CPWA 3CQZB 1KAWA 1RHPA 3CPFA 3Q23A 2WAQG 5M5XH 4RHSA 1DOMA 1EY9A 4R4TA 5JEAH 2NN6G 2F4VL 1EIFA 2CWPA 4BY7H 5DNFA 4A3JH 1TS2A 1D6EC 2BE5D 1DONA 3VR5A 1YNXA 4IPGA 2WINB 2A8VA 2CW0D 2AQ3B 1YHAA 4JBMA 3EJIA 1SYCA 2TMPA 1TIID 3TN2A 2EE1A 2SEBD 5ELEA 4HCSA 1F9PA 1PRTF 5GQOA 3J80L 4QF4A 4OX9L 1FL0A 1Q12A 3QR8A 1S5DD 4JI2Q 4O1NA 1BXTA 2F0KA 5IYBG 5D65A 3EN2A 4HN7A 3A0JA 3N6RA 3DEPA 2I0QA 3ULPA 3VYTA 4IOAA 1AFPA 1U4LA 1HR0L 4EGVA 4O0AA 3J80E 2NVYH 4K5XA 5IP9H 1YJWA 3J7ZC 4YWMA 1Y14B 2MP1A 1HZAA 3KF6A 4TSSA 1Z6HA 3SR1A 2GVAA 4YIJA 2NUCA 1WTVA 1GXDC 2L12A 3MXGA 5CMDA 4LMQD 2B8FA 4QY7A 2KQ3A 4X65Q 1MBYA 1O7YA 2K5VA 3H3VH 2Q2HA 5BR8L 3BZKA 1XXGA 5EAYA 4KJNA 2MNAA 2JYOA 1K9MC 4JI7Q 1VQOA 1N33Q 1AEXA 2HQEA 4A75A 1C7YA 4EQ5A 1PDQA 2WV6D 1HH2P 1E2WA 3J81L 1RD9D 4G7ZC 5C3EG 2AMCB 2Z0SA 2JA5G 2HDLA 3CCEA 3X3MA 5LL6X 1IBLQ 1B8AA 4IO9A 5E7NA 3GTPH 1M1KC 1KHIA 1A3VA 3J81E 1HR0W 4XYQA 4PMCA 4R9WA 3OOCA 1U5KA 4LF6Q 1ET6A 1PZID 2QF7A 2R7FA 2A69C 2JA6B 2MO0A 5C44H 1BCPC 4GNXC 1L0WA 5CV4A 1HA6A 3AB9A 5I9OA 2KVMA 3HKZG 1EY8A 2A1AA 1SLJA 2PCFB 2NTSA 4HSVA 2MQHA 2R3ZA 1ASZA 2NB0A 1UE6A 2IX0A 1U4PA 4HJAA 3CKIB 1HNZL 5I9PA 2Z4IA 1B4OA 2K75A 3KBGA 2CFMA 2K01A 3QO2A 1J8IA 1A0IA 1S5BD 1H9RA 1B3QA 4DNRB 2Q2TA 5M3MB 4CDEC 1TS5A 3P7JA 2JEBI 3HOXH 4A3IH 1MKHA 1LYLA 2M2LA 2L55A 2NTTA 1JOOA 4UHVA 2DUDA 2A6HC 3CF5A 4MTKA 3GTJB 5HURA 1H9MA 1VQAA 4JVZA 2DY7A 2NVQB 5LMNQ 2F0NA 4A3KH 3PO2H 1KXLA 1QVFA 4F87A 4XDXA 4JI4L 3ERQA 4B9XA 4EVOA 3L7ZC 3OWFA 4LFAL 4LUOA 1VCIA 2XVSA 2KEDA 3D3RA 3D4DA 1PZKD 4IUTA 3BJUA 2KCTA 4ODGA 2DGYA 1SDFA 4LNQA 2A74C 4LFCQ 4NP5A 5GAHC 4A3GB 4BBRH 3ITPA 4ZKCB 3HOYG 1FNVA 3S16H 3NTKA 1ASYA 3Q0AA 4GKJQ 1HA5A 1N32Q 1L0XB 3MWYW 4GOPC 3AMUA 2EY5A 1O7ZA 1YNJC 2E76C 3R2TA 3FMCA 1JORA 3BZDB 2K1BA 2KBNA 4KY7A 1BBXC 3STBD 2YU9H 1UAPA 3NEMA 2QDLA 2VW9A 1KRSA 3UDIA 1BR9A 2E2JB 1KD1C 3RZDH 3O13A 1PHJA 1RTOA 3SHLA 1D2BA 1KDBA 5IP7H 2UU9Q 5K36G 3NBHA 2AWNA 1JB3A 3M7GA 1S5CD 1OXUA 3MTSA 3W5OA 1Z47A 3S14H 5M5WB 2OWOA 2FXQA 2EIFA 3H09A 1OXXK 4A3BH 4DV5L 4JI2L 4DV4Q 5IGCA 2R7ZG 2JA8H 4G57A 2MO1A 4CDCC 2YTYA 1EWHA 2OT2A 5L37A 3RN2A 2K5NA 1EQQA 5C0XH 4H0LC 1X3EA 3NPPA 1ONLA 1KAAA 2XN9C 1E1OA 4LK1C 3PGZA 1FVIA 1FR3A 2LMCB 1EIHA 3HZXA 3CCJA 4DR2Q 1OO9B 1TWHH 1G6ZA 2EOTA 1P16A 1UE1A 1BDOA 1SJED 2XWJB 4X65L 3WOEA 4A3FH 4FF4A 4YWKA 3ND9A 4HSPA 1WTPA 2QCPX 2X6LA 4X62Q 4GKKQ 4A3MH 4OO1H 3R8BA 4JI7L 2MUYA 4HMJA 1G91A 1PTOF 3NQIA 2AHOB 1STAA 2DNEA 1H95A 1EY6A 4JI5Q 5C3XA 4GZYC 2QGQA 4B3TQ 1IBLL 1R9TB 3PO3G 1VQLA 3DWQA 4OWTB 3NK9A 4K5VA 3BZCA 3M4YA 4LF6L 3I73A 4CKBA 3GTLH 4IPCA 4PZ6A 1X32A 3J80i 3OYYA 3KJOA 3S1RH 3S1MH 2N78A 3HKZE 4TQUS 2WKCA 2VUMG 4C3HG 3K6OA 1D5XC 3HOWG 3Q22A 4QUCA 4DR5Q 3MHBA 3ONAB 1YJNA 1B1ZA 4KKUA 2KA7A 1C8CA 3SK5A 3NHHA 3CAMA 4A3DG 4B08A 3VA5A 1EUJA 1Q1EA 4GLXA 3FKIG 4PMBA 2PW5A 2J7ZA 1BCPF 1WTXA 1JWUD 5CV7A 4IPDA 4H02A 4DNIA 2JSOA 4NB3A 1O7IA 4KD3A 5EKKA 5C3EB 1U0LA 1W6KA 5KRUA 4RG1A 1JWMD 1UWVA 4JI8Q 5HGTA 4DV1Q 1GJXA 1B70B 2R93G 2OTJA 5LMNL 1SXTA 4C3JH 2MPMA 2BA1A 1LUZA 4P2CB 4JBKA 3S17B 4KHVA 3BU2A 5JAVA 3M4QA 1S40A 4BBSG 1RTNA 3J81i 4R4CA 3HKZB 4Y52H 3P20A 2VS1A 1SNPA 1Y1VB 4HEDA 3HOZG 4LFCL 3NP8A 1G291 3GV3A 2N49A 2QW7A 4KMUC 1FJGQ 3TSSA 1H9SB 2A68D 4M1UB 1O80A 4RWSC 2FMCA 2NBFA 3OIPA 3M4PA 1WYDA 1K28A 4GKJL 1N32L 1EYCA 1AZQA 2N55A 5EGTA 5GADC 4A3LG 1EQTA 3GTKB 3PF5A 1VQCA 3M9BA 1K0SA 3OSOA 1YBYA 1STEA 4EQOA 1HTLD 3A7LA 3NTIA 2PQAA 3BVGA 2B63H 4PMWA 3S15B 5IGFA 1XWEA 3KDFB 3DM1A 1QUQA 3CC4A 3PF4A 3T1HQ 1EYAA 4MZ9A 4X3TA 2HUGA 3G7LA 2CHBD 5ELOA 1JE4A 1BBWA 5CR3A 1B2TA 1BVSA 2EVBA 4L5TA 4NXNL 5LMNW 4B3MQ 1A2UA 2IX1A 1FYCA 2B2WA 3VR6A 3NBIA 2KJXA 3HRZC 1TWFB 3M85A 2MFIA 3J7YW 1Y1WG 4QIWE 1MSGA 4LF7Q 2F0FA 4DV4L 1U4RA 4RKLA 1CA5A 4DAPA 4QGUA 1F2ZA 1NR2A 3FPUB 2BE5C 2HIVA 3RLFA 2WP8J 3G48A 5JVG3 2K14A 1QOHA 3D6WA 4FF1A 1FGBD 3T4AC 1LT3D 2CW0C 1YNND 4UP8A 3RNUA 3UE1A 2PYKA 1TWAH 1Y8NB 2DJFC 4BXXG 2JN4A 1CHPD 2JK8A 2Q8TA 1WFQA 2AKWB 3NELA 4C3IB 2Q8IB 2E2DC 2RVLA 4DAMA 1N34Q 1PH6A 3HP3A 4BWGB 3T51B 2EYFA 1V1PA 3SGIA 4DV7Q 4RGNA 3U58A 4WRDA 5BR8Q 3S9WA 3TMEA 3D4RA 2EYOA 4GN4B 4QB4A 5EPLA 3S1NB 5FLMH 4RGOS 1TWGB 2L4NA 5I2XA 3JAME 1E2VA 4GKKL 4X62L 4PZ7A 2KECA 2PNHA 1VQBA 4QIWB 4RCNA 4K6LA 1PFSA 5KYIA 4IJLA 4JI5L 1EIYB 2KEEA 3H0GG 1A15A 1DM0B 3RD4A 3I4LA 5E4XA 1LTID 3I90A 2XNAC 5KYLA 4B3TL 1LTRD 4BY1G 5IYDG 2JA7H 1PH8A 2ASBA 1XPRA 3GTOH 4X66L 2PO4A 5ELCA 5IGBA 2B2YA 5C4JB 1WCMH 3H91A 1ZEQX 1HZBA 5IE8A 3CD6A 3S2DH 4A3CH 2ICIA 4K5WA 4DPGA 4HIMA 2OQKA 3Q8DA 4V0BA 4RAUC 4DR5L 3S2HH 1ZXTA 3LWEA 1IKLA 4OEMB 2LKVA 3AFQA 2ZXOA 1OTCA 4KHZA 3H3VI 1YIJA 2Z4HA 1OXTA 4NPSA 3EFXD 1SN8A 4KN4C 1SYBA 4CDFC 3GDEA 3MC0B 2IL8A 4OWXB 4IUQA 3KOJA 1NSNS 1CM9A 1KNEA 1SRUA 4WORA 4DU9A 5M5WH 1XTCD 1BOSA 5C5LA 1SR3A 4JI8L 3JC66 4DV1L 3PO3B 1LTBD 1ILPA 1N36Q 4XT3B 4DR4L 1PRTB 3I56A 3AEVA 3M4OB 3GTGB 3URYA 1VS0A 4POFA 1EZ8A 5FK9C 4WJ4A 1KLUD 4GLVB 1DCZA 2KUMA 3MAQA 5IT9c 3E5SA 1VQMA 3HOUG 1CKMA 2BA0A 1PRTD 4A3EG 2XIWA 1G8ZD 2YYZA 4JBJA 1AE3A 4L6TB 5D14A 4C3HB 4WFN3 4FVMA 3HOWB 1B7YB 3TQYA 1XMQQ 3FP9A 4IZ8A 1NMGA 2OTLA 1QVCA 5JEAJ 1AZPA 1KDAA 2EYHA 3KF6B 2B2VC 2JE6I 4ZQ3A 3ULJA 4PNYA 4DGZA 1TKWB 5IGDA 2E2IH 1A3UA 1E24A 1WTWA 5KNBA 2R92G 2K33A 5ELFA 1I6HB 1LTSD 2PQEA 3T1HL 3S24A 3PUZA 2R93B 1SMYD 4GS3A 3SK6A 4JV5L 3M7NA 1VF7A 3I4NG 4QJFA 4B3ML 2MGSA 3MXNA 5K5PA 1IW7D 3A5UA 3DHQA 4N8FA 5HY6A 1JQYD 1D8LA 4RMFA 4XXEA 1GVPA 1R4QB 1PV4A 4DV5Q 4HJ8A 2JXMB 3E9IA 4BBSB 4ME5A 4LF7L 5JEAG 4QCLA 4BY7G 4DR6Q 2BOSA 3CCMA 4A3JG 3FPPA 3HOZB 1NE3A 4B3SL 4CKEA 4GN5A 3STBC 1E3PA 1T5EA 1VQKA 4C1NK 1Y69U 1ENFA 1VQPA 4JCVE 1LACA 1WTOA 1A6XA 1CZGA 4UP9A 5EPJA 4E6IA 2VZAA 5TSSA 4B9WA 4JOIC 1S5FD 3F8TA 1QNKA 4UAIA 2NZ1D 1N34L 1B9NA 2RDFA 4IALA 1D7QA 1V8QA 4Q0FA 4CJ2C 2UXDQ 4DV7L 2BH2A 1EWIA 4O2DA 1EZ6A 1DOLA 4DK0A 3D6CA 1SE8A 3MFYA 4KTAA 5IP9G 2SOBA 2EDGA 2RCFA 4J8QA 2B3GA 1SAPA 1Q3LA 3V05A 3VA7A 1X3QA 3J81j 2UXCL 4MTNA 2ID0A 1Y1WB 4FO2A 3AYHB 1ZYRD 2F3WA 5M3FB 1B50A 1QB5D 2KCMA 3VR2A 3TP5A 2ZM6Q 3HKSA 2NVXH 2G5DA 2ZJPA 4JI3Q 2HD3A 5HGQA 3A5ZB 1Y1VH 4OGQC 4BS9A 2C35B 2E5LQ 1AE2A 5C0XI 1PH1A 3ZYYX 2RHSB 4CKCA 3R3OA 4DR1Q 4H13C 1LTAD 4HTHA 4FXKC 1VMCA 3BDLA 1D5ZC 5IGGA 3BVZA 3NQTA 1F9RA 1S72A 3W1GA 1QE6A 4OXPA 1T9HA 2HDMA 2EPBA 4ALPA 1K8OA 5C4ZA 2VB2X 3VYUA 4RH6A 4DV3Q 1I4QA 1HUMA 5EBCA 3C3LA 2O5JC 1Z7TA 1QCBD 4DA2A 1OXVA 2L9HA 3J80c 1HTPA 3NXWA 4DFAA 5GROA 2C9OA 1DJRD 4CHTB 4OO1I 1DGSA 5C44G 1F2MA 5DEHA 1WTQA 4X3SA 2FHTA 1W3SA 1Q1BA 3KYHC 2TSSA 4XT1B 3IKJA 3OTOL 1HRJA 5M5YH 1CSPA 4CBVA 2F52A 2YTVA 3H0GB 4MN3A 2CH4W 1UE5A 2F0HA 3EQLC 5IY0A 3C1EA 4LFBQ 1N36L 3NBHB 4YCUA 5FJ8H 4IN3A 3GV6A 4UPAA 1EQVA 1KDCA 3DM3A 4DK1A 3CC2A 3NENA 4DV6Q 3SEBA 3HFZB 1L1OA 3HOXG 1E1TA 1TWCB 5CV8A 3E3XA 1GO3E 4A3IG 1K73C 3I72A 3F1ZA 4BA1I 4IJHA 3GTQH 3RZOH 2AUJD 5DM73 4C3IH 3I4OA 4IURA 3DUZA 4HJ7A 1XMQL 1NR4A 2YTXA 4XQQA 4A3KG 3J81c 4G7HC 3PO2G 2WAQE 3K5OA 4AYBG 1LTLA 3CCSA 2EY1A 1EEFD 1EY5A 1SE2A 2D62A 4FXGC 2HQLA 3PUWA 2CQAA 1G2SA 1WTHA 4DK6C 2NVTH 5FLXL 3GTMH 3PIP3 1VQIA 2IT1A 3SK8A 1PLFA 1VMPA 4AQYQ 4A4IA 3F2CA 1ESFA 5FKAC 3TS2A 4NXNQ 4BBRG 3OW7A 4L5QA 3L9AX 1LABA 5C4HA 2L15A 5ELNA 1PTOB 4IFDH 2Z6BA 3HOVH 1SJHD 3U4VA 1EFWA 2X6GA 3I4MH 1SE3A 2XSCA 1I4GA 5FLXE 3BYTB 5EKLA 3OWEB 3S1QB 5T1GA 1RCVD 1ET9A 4ZCKA 3C2PA 3RLOA 1T5XD 2HIXA 1PTOD 1PVOA 3KUPA 2IWHA 4FF3A 3HOUB 1LTTD 1CFMA 1I94L 4DR6L 1O78A 1HZCA 3K5LA 2MJ8A 3UDFA 5C4XH 2F0JA 1JR0D 1B9MA 1U9RA 1QJOA 1Q46A 2UXBQ 2WAQB 5E3FA 2EY6A 1CZWA 5IP7G 4DF7A 3K7UC 4C2MH 5IIFA 1Z9FA 3DMUA 1AP0A 4CDDC 1ENAA 2BCOA 4KHPQ 1CTMA 3E6ZX 2F1MA 4XYOA 4Y7NB 2F0QA 3IL8A 3VYRA 4A3BG 2R92B 2UXDL 1GD7A 1GHJA 4XIGS 5M9OA 2CQOA 2UUCQ 4X64Q 4IUVA 1SFOB 2JA8G 2EYPA 3KLWA 1BCPB 1HPCA 4L8JA 5C0XG 4ULLA 1EYGA 1F2YA 4POGA 1VQHA 2RHQB 1LO5D 1EY4A 2A69D 1CSQA 1STNA 1BCPD 3GTGH 1YNNC 3ND8A 5M5XB 1EL0A 1VQNA 5IWAQ 3OW2A 1K8MA 2QEJC 1G6PA 4A93H 2F0DA 1HNXQ 2ZM6L 4H7BA 4JI3L 5ELDA 4X66Q 2AUKA 1GM5A 3T53B 4DR7Q 4UY8C 4DAYB 2E5LL 1EOVA 4G4KA 5BN3A 4DAVA 4A3FG 4RGTA 5JOBA 4DR1L 1QILA 3MZ5A 3CQZH 2M00A 2RDHA 1SNDA 1YZ6A 4OO1G 4A3MG 4FNFA 3IRBA 1GUOA 3J7AF 1PH9A 2IHFA 1ENCA 2XRQD 4DUYQ 1YJ9A 2B2UC 1TQOA 2A6HD 4DV3L 2MHVA 5F2DA 4GNXA 4LAAA 4P73A 3ULLA 4NXMQ 1I4HA 4LF5Q 2HHHQ 1IYUA 2NVYB 4KY6A 1A3TA 1V9PA 2VNUD 4TVAB 3PUVA 2B2TC 3A8IE 1L2FA 3L3OC 2KCNA 2Z6KC 5D3IB 3Q24A 2JA5B 2I5MX 4YCVA 2PQAB 4K8IA 5DLQE 5IOCA 2VQEQ 3E9HA 3OMGA 2G9DA 2I07B 1SNQA 5KNCA 1A2TA 1QUQB 3L2PA 1Q81C 4MHEA 3WDNA 4LWCA 3LX0A 4DAYA 4DR4Q 1BUVT 2KHJA 4LFBL 1Q90A 2NWGA 1QZGA 3HGBA 1HCZA 3T13A 5BN4A 1IHZA 4I7ZC 2AWOA 5CGKA 3K57A 3H94A 1YNJD 4JI0L 2DY8A 2J4XA 1IYVA 4ZKBB 2Z8LA 4DV6L 3G6JB 3FHWA 3H6MA 1X3FA 4U68A 2IPKD 2BDOA 5J39A 2C5CA 3GO5A 2A6EC 2VY3A 4LJZC 1CK1A 3QOJA 2ENBA 4QQBX 5DM63 1SE4A 1QZHA 3GTPB 4I7AA 2E75C 3VR3A 2F0VA 4C3JG 2PZWA 2K05A 3EIVA 1M4VA 2WACA 4RFBA 1O7LA 4AYBE 3K7AB 5C44B 4FP5D 1K8GA 4QMGA 2K7VA 1SYDA 1YITA 2YV5A 1CKOA 1TXYA 1V1PB 1QNUA 4GOPA 3KF8A 4AQYL 3PUYA 1CA6A 3K80C 4F7XA 1PRTC 5M3FH 4DV2Q 1FD7D 1F2LA 2B8GA 4WJWA 1X55A 4JV5Q 1TS4A 1XJVA 5CYUA 1X3GA 1EOTA 5A35A 1EEID 2JJQA 4JG2A 1H9JA 4U673 2JA6H 1VQGA 3DXJC 5EJWA 5C3WA 1MJCA 3HOXB 4FYDA 4B3SQ 3B6YA 3HOYB 1K3RA 5CC4A 4A3IB 5I2YA 1I6VC 1MHWC 1GUSA 4GN3B 2B63G 4NW2A 5J1ZA 4KLKA 3CCLA 1JT8A 1PYBA 3CRKC 2E2HB 2UXBL 3NTHA 4A3KB 1HJPA 5LMUQ 3PO2B 1ZKOA 3G4SA 1F9SA 4AYBB 2GA4B 1V43A 4K2KA 5M3MH 3JAML 2V4DA 4O42A 2CWAA 4KHPL 4PG3A 2EJMA 3SDZA 3ERSX 2N8NA 2XWBB 3AFPA 2UUCL 2UUAQ 4X64L 3GTJH 4R1JA 3F2UA 4BBRB 2NVQH 3S16B 4ABNA 2EXDA 5CBEE 3EVQA 1IL8A 1SEBD 3FRPB 2UUBQ 4DXGA 1GOZA 2FMMA 2UXCQ 3E0JA 1HHVA 4N9TA 4G7OC 4OIJA 4XQJA 3PUXA 5IWAL 2HT1A 3T1YQ 2R7ZB 5DAUA 4OL7A 3A74A 3CU7A 3A55A 5KEEA 1KRTA 1Q8KA 1HNXL 1PH5A 3BYYB 2OQ0A 5IT9E 4A3GH 1TWCH 1CUKA 3AQQA 3AU7A 5IYCH 3NSWA 3BDCA 1ML0D 1STBA 3RZDB 1WTRA 4DR7L 5FLMG 2RSNA 5I6YA 2Y0SG 5EQ0A 2B39A 4IPHA 1YHQA 3I91A 4LF4Q 1SBBB 1JOQA 2V1CC 3QG1A 1NNXA 2BH8A 4UDUC 5G3LF 3OMCA 4N9PA 4A3BB 4DUYL 4R4OA 2RCNA 4P72A 2PI2A 1A62A 3PQIA 4R4IA 4QUFA 3P75A 2E2JH 1DYQA 2JA8B 4NXML 2D0OA 2IY5B 2D2CC 4LF5L 2HHHL 2JA7G 1V1QA 4EX5A 1CKNA 5D3DA 1IBMQ 2RF4A 4NDXA 3OTOQ 4C1NI 1IL2A 1WCMG 2E8GA 5E4WC 4CJ0B 2XGTA 3S1QH 2N3SA 2VQEL 4A3CG 3I70A 4ZLTF 2F03A 2ALYB 1TWHB 1VQDA 2I46A 1SNCA 3C1FA 2PZTA 4JBWA 1WOCA 2ICEC 1RKNA 5C5MA 1F9QA 1VQJA 4KY5A 2LY7A 3MXNB 2SNMA 4IUUA 4XQNA 1XPUA 5FO9B 2JEAI 2EYMA 1JE5A 4A3MB 2I5LX 3G6EA 2VUMB 1OXSC 2D9UA 2NN6H 2ZTDA 1FNWA 3D4WA 1N9WA 3CC7A 1I5FA 4JYAQ 1GUTA 4JK1C 4A3DB 4Y7NH 3PIPA 2VB3X 1II3A 1K83B 3FKIB 3KFUA 1JWSD 2F0LA 2K5HA 1SFOH 1VQFA 4N8X1 1VDZA 1Y8OB 2EXZA 3NWTA 2OF1A 4MIUA 3A8JE 3I55A 1HNWQ 4R8NA 1IYJB 1H9KA 1PH7A 1JJGA 3K0YA 4ZUJA 4WJ3M 3HEJA 2CCZA 3S1RB 3S1MB 4OONA 5IYBH 1PH4A 4DV2L 1Y8PB 3A54A 4IUPA 3VDYA 4MNOA 4OELB 1R9TH 3CCUA 3I2ZA 2QA4A 4ZK9B 1AH9A 3NWSA 1SYFA 5EBDA 1UEBA 1PH3A 4DUZQ 1NTGA 4ILWA 1N8RC 1I94Q 1WD1A 1XPOA 2VXWA 2O5IC 1IKMA 1EU4A 4HIDA 3ER0A 4HJ9A 2IJ0A 2R61A 3TZDA 1JJ2A 2KHIA 3A56A 3QJYA 4DV0Q 1SROA 1SSOA 3SVMA 2NZOA 3V96A 2KOLA 1ILQA 4JI6Q 1HUNA 1RDPD 3OIQA 4IOCA 1C4QA 2XRSD 2PMZE 4J6HA 5LMUL 3U4ZA 3FVQA 4C3JB 3K8AA 2X69A 2Q2UA 3CRLC 1PA6A 3N52A 4HMIA 4S3SA 5C3EH 2OCEA 3A8KE 4JW0A 1I3QB 2JA5H 1PTOC 4KJOA 1SYEA 2UUAL 5IGEA 4TRDA 3FEWX 3QWNA 1KC8C 1BBUA 2E74C 2K5DA 1J5EQ 1JJCB 4IFDI 3MXUA 1K0RA 1PZJD 4JI1Q 1PFMA 5BN5A 4Q5VA 2UUBL 3S17H 2K4KA 3A7AB 4ZYSA 5JJIA 1PXUA 1QWYA 3P1HA 1LLRD 5JVH3 3T1YL 4YWLA 3U9SA 2F0OA 1EQRA 3K0XA 3HG9A 2B63B 3TRZA 4RCOA 1EYDA 2FFKB 1LM0A 1NJIC 2Z9HA 2R7DA 1SYGA 2PMZB 2RA4A 3DWPA 3BS1A 4LW1A 3LNNA 1IBKQ 2K32A 3CMEA 4DR3Q 4LF4L 2Y0SE 3GTKH 2K04A 4HIOA 3L0OA 1L1OB 1ESRA 1X3PA 3G71A 3PIO3 3BDOA 3CCRA 4P75A 1SNOA 3K7AH 1VF5C 3R93A 3EROA 2F0MA 1RODA 3S15H 1WJJA 3SE0A 5JPNC 3PCOB 3KLSX 1ICFB 3NE5B 4K0KQ 1XYIA 1LT5D 1Y1VG 3NUCA 3UDGA 4B3RL 3RLNA 3CMAA 1IBML 4RKBA 5EPKA 3RR5A 4YCWA 3SXHA 3JAMi 3T16A 1TWFH 1C9OA 1TWAB 4ZUIA 4KK7A 5KNDA 3WOFA 1DOKA 2OEOA 1Q8IA 4JPBW 3MEFA 4BY1B 3GP7A 1RL2A 2H5XA 3LWUA 1Q7YC 1SMXA 3HOYH 2EJFC 1J9OA 1WI5A 1B53A 2PNRC 1STHA 2Y0SB 3PMFA 2ZTEA 4JI0Q 2E2HH 1PMRA 2Q8RE 1JICA 4YHHQ 2IW3A 2RDGA 4R4QA 1Q82C 4KKTA 1KNAA 4K6DA 5FO7B 1D1KA 1S4ZA 4DK3C 4JC0A 1JB7A 4J1MA 4JYAL 1FNUA 5GAGC 2F0EA 1X9NA 3I7FA 2N88A 3S1NH 1D5MC 1FGUA 1TU2B 1TWGH 4AIMA 5AJ3Q 2JA7B 1I50B 3QIAA 1CT1D 4LUZA 1B44D 4NMZA 3GTOB 5K36H 1MD2D 4HAEA 5FJ8G 2PZUA 1A63A 1HNWL 3K81C 1XMOQ 4LF8Q 2K5QA 1WCMB 2HCIA 1MIUA 2F3VA 4OWWB 4PZ8A 1P8LA 3DWAA 5CV9A 4ZAIA 4IUNA 3S2DB 4RHRA 4IQZA 1E0BA 4IFDJ 2LXKA 2B2VA 2R7ZH 3MA2B 3H3VC 4KV6A 4C3IG 2PPBC 2A68C 2B2WC 1I4RA 4K8JA 1NMFA 4EQNA 1XNQQ 3S2HB 1BO0A 1JOKA 1WD0A 3VR4A 5C4JH 3J7AV 2WB1G 4DUZL 2JP1A
chains in the Genus database with same CATH topology
2RSOA 1TVXA 1KTKA 4A3EB 1MGSA 5C0XJ 2LFNA 4ID6A 4C56C 3BVMA 4RGMA 3I8ZA 2J0TD 4IFDG 3M3YB 1AN8A 5ISRA 4PV1C 3RMHA 1GUGA 4M8AA 2ZXPA 3CHBD 2EY2A 4OHJA 1EFID 2L11A 4KN7C 3SK4A 2BDNA 3R2IA 2QDBA 1AW7A 2FJ2A 2R6GA 1QG7A 3TP8A 1I4PA 3I4NB 1BF4A 1M8AA 1STGA 5KGUA 2RQXA 3K59A 3KBXA 4BY7B 5AFWA 4A3JB 4FF2A 2EYLA 2E2IB 3MXPA 1JCKB 2B2YC 4RA8A 1RJTA 2H4OA 2DNCA 3D8GA 1UEAB 4OIKA 1JC7A 2SNSA 2OXPA 2L0CA 1HQMC 4KI0A 3X3NA 4KD4A 2Z1CA 1GUNA 1GHKA 1B3AA 3MFGA 1EY7A 3KLSA 3GD7A 3Q6SA 5JJZA 1E2ZA 5KIXA 4HR7B 1WVLA 1TT2A 2D5DA 3MVVA 2PW7A 5J22A 2QKIC 1HFNA 3V2TA 3T56B 4I65A 2QILA 3BG3A 5JPMC 3TP7A 4F88A 2O2LD 1EIGA 4H44C 3KK7A 5FO8B 1HXYD 2FINB 2K03A 2DN8A 3I3CA 4CJ1B 4DXFA 1BQQT 2K5WA 3K5MA 1EY0A 4CGYB 4BA2I 1UNSA 2WIIB 2F0IA 1LT4D 3D31A 5A2QL 4Z9CB 4F8MA 3IFTA 2NVXB 2H1EA 3VYSA 2EJGC 1RF2D 4R8IA 3QOLA 2KCCA 5EKIA 5A2QE 5COYA 3TZUA 3HS0C 5T1IA 2ZXRA 5IODA 2KHSA 4ZRZA 2HCCA 3TDQA 2ZT9C 4X3KA 5CORA 2F0PA 1V1OA 4KKSA 1TY0A 3C46A 1L0YB 1CHQD 2RBMA 2NN6I 1ICWA 4K14A 5LHY1 5M5YB 4DN4M 2A5HA 3MEHA 2AQ2B 1HFGA 1NUCA 4DNTB 1SMYC 1S5ED 1STYA 3UI2A 2LS01 1MSHA 1H9SA 1F77A 3FDTA 1MI2A 1IW7C 2O4XA 2K6AA 3K5NA 1PFNA 5G3LD 3GTQB 3RZOB 1TS3A 1CQFA 2F0TA 4PQXA 3W2DA 2F0WA 5IT9L 3EA6A 2F0GA 1LV9A 1EU3A 3OPOA 2WB1B 1BNZA 1DXMA 2YU9B 2SDFA 4NKLA 1PYWD 5CV5A 2NYZD 2NVTB 3K58A 2K28A 3GTMB 1LT6D 1EWCA 1U4MA 5CBAE 2AQ1B 2CVRA 5FOBB 2L1BA 3HOVB 3I4MB 1CQVA 3S14B 1G2TA 4K2LA 4TKOB 4FXDA 3RUZA 4X3UA 5LL6S 2M9VA 1ZYRC 1D1IA 1UUPA 3PV0A 3TP6A 2EZVA 1PFBA 5C4XB 5CV6A 5NUCA 1PTOH 3IAYA 3DEOA 4HCEA 2B2UA 4C2MB 2F0SA 1R4PB 1W6JA 1LTGD 2F0UA 5I4DA 4EQPA 3IFDA 1NAPA 1CI3M 3W3AA 2G9HD 5I6WA 2B2TA 1XX8A 4A3FB 2IX3A 3OHXC 1TR5A 2A6ED 4XTCS 2A73B 2EYJA 1KABA 2F4IA 1GUWA 1I4XA 1C48A 4L63B 1HQRD 5E1FA 1DZ1A 1TY2A 2L5TA 3TBIB 5ELBA 4A93B 3GQBA 3U9OA 1KLGD 4V190 1NCVA 1DD2A 3KLRA 2WKDA 5C6AA 2RKSA 1SNMA 3GTLB 3QB3A 3CQZB 1RHPA 3Q23A 4RHSA 1DOMA 1EY9A 5JEAH 2NN6G 5DNFA 1TS2A 1D6EC 2BE5D 1DONA 3VR5A 2WINB 2CW0D 2AQ3B 3EJIA 1SYCA 2TMPA 1TIID 3TN2A 2EE1A 2SEBD 5ELEA 4HCSA 1F9PA 1PRTF 3J80L 4QF4A 1Q12A 1S5DD 4O1NA 1BXTA 2F0KA 5D65A 4HN7A 1AFPA 3N6RA 3DEPA 3VYTA 1U4LA 4EGVA 3J80E 4K5XA 2MP1A 4TSSA 1Z6HA 3SR1A 4YIJA 2NUCA 1WTVA 1GXDC 2L12A 3MXGA 5CMDA 4LMQD 2B8FA 2KQ3A 1MBYA 1O7YA 1XXGA 4KJNA 2JYOA 1AEXA 2HQEA 1PDQA 2WV6D 1E2WA 3J81L 1RD9D 4G7ZC 2HDLA 3X3MA 5LL6X 1A3VA 3J81E 4XYQA 4PMCA 4R9WA 3OOCA 1ET6A 1PZID 2QF7A 2A69C 2JA6B 1BCPC 5CV4A 1HA6A 3AB9A 5I9OA 2KVMA 1EY8A 2PCFB 2NTSA 4HSVA 2R3ZA 2NB0A 2IX0A 1U4PA 3CKIB 5I9PA 2Z4IA 1B4OA 3KBGA 2K01A 3QO2A 1J8IA 1S5BD 1H9RA 4DNRB 5M3MB 1TS5A 3P7JA 2JEBI 2M2LA 2L55A 2NTTA 1JOOA 2A6HC 3GTJB 5HURA 1H9MA 2DY7A 2NVQB 2F0NA 4F87A 4XDXA 3ERQA 4B9XA 4EVOA 3L7ZC 3OWFA 1VCIA 2XVSA 2KEDA 3D3RA 3D4DA 1PZKD 4IUTA 4ODGA 1SDFA 2A74C 4NP5A 4A3GB 3ITPA 4ZKCB 1FNVA 3NTKA 3Q0AA 1HA5A 1L0XB 3MWYW 3AMUA 2EY5A 1O7ZA 1YNJC 2E76C 3R2TA 3FMCA 1JORA 3BZDB 2K1BA 4KY7A 1BBXC 1UAPA 1BR9A 2E2JB 3O13A 1RTOA 3SHLA 1D2BA 1KDBA 5K36G 3NBHA 2AWNA 1JB3A 3M7GA 1S5CD 1OXUA 3MTSA 1Z47A 5M5WB 3H09A 1OXXK 5IGCA 4G57A 1EWHA 2OT2A 5C0XH 4H0LC 3NPPA 1ONLA 1KAAA 2XN9C 4LK1C 1FR3A 2LMCB 1EIHA 3HZXA 1OO9B 1G6ZA 2EOTA 1BDOA 1SJED 2XWJB 3WOEA 4FF4A 3ND9A 4HSPA 1WTPA 2QCPX 2X6LA 4OO1H 3R8BA 1G91A 2MUYA 4HMJA 1PTOF 3NQIA 1STAA 2DNEA 1EY6A 5C3XA 4GZYC 1R9TB 3DWQA 3NK9A 4K5VA 3M4YA 3I73A 4CKBA 1X32A 4TQUS 2WKCA 4C3HG 3K6OA 1D5XC 3Q22A 4QUCA 3MHBA 3ONAB 1B1ZA 4KKUA 2KA7A 1C8CA 3SK5A 3NHHA 4B08A 3VA5A 1Q1EA 4PMBA 2PW5A 2J7ZA 1BCPF 1WTXA 1JWUD 5CV7A 2JSOA 5EKKA 4KD3A 5C3EB 1W6KA 5KRUA 1JWMD 5HGTA 1GJXA 1SXTA 2MPMA 2BA1A 4P2CB 3S17B 4KHVA 5JAVA 1RTNA 3HKZB 3P20A 1SNPA 1Y1VB 4HEDA 3NP8A 1G291 3GV3A 4KMUC 3TSSA 1H9SB 2A68D 4M1UB 1O80A 4RWSC 2FMCA 2NBFA 3OIPA 1EYCA 1AZQA 2N55A 5EGTA 1EQTA 3GTKB 3OSOA 1STEA 4EQOA 1HTLD 3A7LA 3NTIA 3BVGA 4PMWA 3S15B 5IGFA 1XWEA 3DM1A 1EYAA 4X3TA 2HUGA 3G7LA 2CHBD 1JE4A 5CR3A 1B2TA 2EVBA 1A2UA 2IX1A 1FYCA 2B2WA 3VR6A 3NBIA 2KJXA 3HRZC 1TWFB 3M85A 3J7YW 1MSGA 2F0FA 1U4RA 4RKLA 1CA5A 4DAPA 1F2ZA 1NR2A 3FPUB 2BE5C 3RLFA 2WP8J 5JVG3 3D6WA 1QOHA 4FF1A 1FGBD 3T4AC 1LT3D 2CW0C 1YNND 2PYKA 1Y8NB 1CHPD 2Q8TA 4C3IB 2Q8IB 2E2DC 2RVLA 3HP3A 4BWGB 3T51B 2EYFA 1V1PA 4RGNA 4WRDA 3S9WA 3TMEA 3D4RA 2EYOA 4QB4A 5EPLA 3S1NB 4RGOS 1TWGB 2L4NA 5I2XA 3JAME 1E2VA 2KECA 4QIWB 4RCNA 4K6LA 5KYIA 2KEEA 1A15A 1DM0B 3RD4A 3I4LA 5E4XA 1LTID 3I90A 2XNAC 5KYLA 1LTRD 2PO4A 5ELCA 5IGBA 2B2YA 5C4JB 3H91A 1ZEQX 2ICIA 4K5WA 4V0BA 4RAUC 1ZXTA 3LWEA 1IKLA 2LKVA 2ZXOA 4KHZA 2Z4HA 1OXTA 3EFXD 4KN4C 1SYBA 3MC0B 2IL8A 4IUQA 1NSNS 1CM9A 1KNEA 4WORA 4DU9A 1XTCD 1BOSA 5C5LA 3PO3B 1LTBD 1ILPA 4XT3B 1PRTB 3M4OB 3GTGB 3URYA 1EZ8A 5FK9C 1KLUD 1DCZA 2KUMA 3MAQA 3E5SA 2BA0A 1PRTD 2XIWA 1G8ZD 2YYZA 4L6TB 5D14A 4C3HB 4WFN3 4FVMA 3HOWB 4IZ8A 5JEAJ 1AZPA 1KDAA 2EYHA 2B2VC 2JE6I 4ZQ3A 4PNYA 4DGZA 1TKWB 5IGDA 1A3UA 1WTWA 5KNBA 2K33A 5ELFA 1I6HB 1LTSD 2PQEA 3PUZA 2R93B 1SMYD 3SK6A 3M7NA 1VF7A 2MGSA 3MXNA 5K5PA 1IW7D 3DHQA 1JQYD 4XXEA 1R4QB 2JXMB 4BBSB 4ME5A 5JEAG 4QCLA 2BOSA 3FPPA 3HOZB 4CKEA 1T5EA 4C1NK 1Y69U 1ENFA 1LACA 1WTOA 1A6XA 1CZGA 5EPJA 4E6IA 5TSSA 4B9WA 1S5FD 1QNKA 4UAIA 2NZ1D 1B9NA 2RDFA 4IALA 1V8QA 4Q0FA 4CJ2C 1EZ6A 1DOLA 4DK0A 3D6CA 3MFYA 4KTAA 2SOBA 2EDGA 4J8QA 1SAPA 1Q3LA 3V05A 3VA7A 1X3QA 2ID0A 1Y1WB 4FO2A 1ZYRD 2F3WA 5M3FB 1B50A 1QB5D 3VR2A 3TP5A 4OGQC 4BS9A 5C0XI 3ZYYX 4CKCA 3R3OA 4H13C 1LTAD 4HTHA 4FXKC 1VMCA 3BDLA 1D5ZC 5IGGA 3BVZA 3NQTA 1F9RA 1QE6A 2HDMA 2EPBA 1K8OA 5C4ZA 2VB2X 3VYUA 4RH6A 3C3LA 1I4QA 1HUMA 5EBCA 2O5JC 1Z7TA 1QCBD 4DA2A 1OXVA 2L9HA 1HTPA 3NXWA 4DFAA 2C9OA 1DJRD 4CHTB 4OO1I 1F2MA 5DEHA 1WTQA 4X3SA 2FHTA 1Q1BA 2TSSA 4XT1B 3IKJA 1HRJA 4CBVA 3H0GB 4MN3A 2F0HA 3EQLC 3C1EA 4IN3A 3GV6A 1EQVA 1KDCA 4DK1A 3SEBA 1TWCB 5CV8A 3I72A 4BA1I 2AUJD 5DM73 4IURA 3DUZA 1NR4A 4XQQA 4G7HC 3K5OA 2EY1A 1EEFD 1EY5A 1SE2A 2D62A 4FXGC 3PUWA 2CQAA 1G2SA 5FLXL 3PIP3 2IT1A 3SK8A 1PLFA 1VMPA 1ESFA 5FKAC 3OW7A 3L9AX 1LABA 5C4HA 1PTOB 4IFDH 1SJHD 2X6GA 1SE3A 2XSCA 1I4GA 5FLXE 3BYTB 5EKLA 3OWEB 3S1QB 5T1GA 1RCVD 1ET9A 3C2PA 1T5XD 1PTOD 3KUPA 2IWHA 4FF3A 3HOUB 1LTTD 1CFMA 1O78A 3K5LA 2MJ8A 2F0JA 1JR0D 1B9MA 1U9RA 1QJOA 2WAQB 5E3FA 2EY6A 1CZWA 4DF7A 5IIFA 3DMUA 1AP0A 1ENAA 2BCOA 1CTMA 3E6ZX 2F1MA 4XYOA 4Y7NB 2F0QA 3IL8A 3VYRA 2R92B 1GHJA 4XIGS 5M9OA 4IUVA 1SFOB 2EYPA 1BCPB 1HPCA 4L8JA 5C0XG 4ULLA 1F2YA 1LO5D 1EY4A 2A69D 1STNA 1BCPD 1YNNC 3ND8A 5M5XB 1EL0A 1K8MA 2QEJC 2F0DA 4H7BA 5ELDA 2AUKA 3T53B 4G4KA 5BN3A 4DAVA 4RGTA 5JOBA 1QILA 3MZ5A 2M00A 2RDHA 1SNDA 4OO1G 4FNFA 1GUOA 3J7AF 1ENCA 2XRQD 2B2UC 1TQOA 2A6HD 2MHVA 5F2DA 4LAAA 1I4HA 1IYUA 2NVYB 4KY6A 1A3TA 2VNUD 3PUVA 2B2TC 3A8IE 3L3OC 2KCNA 5D3IB 3Q24A 2JA5B 4K8IA 5IOCA 3OMGA 2G9DA 2I07B 1SNQA 5KNCA 1A2TA 4MHEA 3WDNA 3LX0A 4DAYA 1BUVT 1Q90A 2NWGA 3HGBA 1HCZA 3T13A 5BN4A 1IHZA 4I7ZC 2AWOA 5CGKA 3K57A 3H94A 1YNJD 2DY8A 2J4XA 1IYVA 4ZKBB 2Z8LA 3G6JB 3H6MA 4U68A 2IPKD 2BDOA 5J39A 2C5CA 3GO5A 2A6EC 4LJZC 1CK1A 3QOJA 2ENBA 5DM63 1SE4A 3GTPB 2E75C 3VR3A 2F0VA 4C3JG 2PZWA 2K05A 1M4VA 2WACA 4RFBA 1O7LA 3K7AB 5C44B 4FP5D 4QMGA 2K7VA 1SYDA 1V1PB 1QNUA 3KF8A 1CA6A 3PUYA 4F7XA 1PRTC 1FD7D 1F2LA 2B8GA 4WJWA 1TS4A 5CYUA 1EOTA 5A35A 1EEID 1H9JA 4U673 3DXJC 5EJWA 5C3WA 3HOXB 4FYDA 3HOYB 5CC4A 4A3IB 5I2YA 1I6VC 1GUSA 4NW2A 5J1ZA 3CRKC 2E2HB 3NTHA 4A3KB 3PO2B 1ZKOA 1F9SA 4AYBB 2GA4B 1V43A 4K2KA 3JAML 2V4DA 4O42A 2EJMA 3SDZA 2XWBB 3F2UA 4BBRB 3S16B 4ABNA 5CBEE 3EVQA 1IL8A 1SEBD 3FRPB 4DXGA 1GOZA 2FMMA 3E0JA 1HHVA 4N9TA 4G7OC 4OIJA 4XQJA 3PUXA 2R7ZB 5DAUA 4OL7A 3CU7A 3A55A 5KEEA 3BYYB 5IT9E 3AU7A 3NSWA 3BDCA 1ML0D 1STBA 3RZDB 1WTRA 2RSNA 5I6YA 5EQ0A 2B39A 3I91A 1SBBB 1JOQA 3QG1A 4UDUC 5G3LF 3OMCA 4N9PA 4A3BB 4QUFA 3P75A 1DYQA 2JA8B 2D2CC 5D3DA 4NDXA 4C1NI 5E4WC 4CJ0B 3I70A 4ZLTF 2F03A 1TWHB 2I46A 1SNCA 3C1FA 2PZTA 4JBWA 2ICEC 1RKNA 5C5MA 1F9QA 4KY5A 2LY7A 2SNMA 4IUUA 4XQNA 5FO9B 2JEAI 2EYMA 4A3MB 2VUMB 1OXSC 2D9UA 2NN6H 1FNWA 3D4WA 1GUTA 4JK1C 4A3DB 2VB3X 1II3A 1K83B 3FKIB 1JWSD 2F0LA 1VDZA 1Y8OB 2EXZA 3NWTA 2OF1A 4MIUA 3A8JE 4R8NA 1H9KA 3K0YA 4ZUJA 3HEJA 3S1RB 3S1MB 1Y8PB 3A54A 4IUPA 4ZK9B 3NWSA 1SYFA 5EBDA 4ILWA 1WD1A 2VXWA 2O5IC 1IKMA 1EU4A 2IJ0A 2R61A 3TZDA 3QJYA 3A56A 1SSOA 3SVMA 3V96A 2KOLA 1ILQA 1HUNA 1RDPD 3OIQA 1C4QA 2XRSD 4J6HA 3FVQA 4C3JB 2X69A 3CRLC 3N52A 4HMIA 4S3SA 3A8KE 1I3QB 1PTOC 4KJOA 1SYEA 5IGEA 4TRDA 3FEWX 3QWNA 2E74C 2K5DA 4IFDI 3MXUA 1PZJD 1PFMA 5BN5A 4Q5VA 3A7AB 4ZYSA 1PXUA 1QWYA 3P1HA 1LLRD 5JVH3 3U9SA 2F0OA 3HG9A 2B63B 4RCOA 1EYDA 2FFKB 1SYGA 2PMZB 2RA4A 3DWPA 3BS1A 3LNNA 2K32A 2K04A 1ESRA 1X3PA 3PIO3 3BDOA 1SNOA 1VF5C 3R93A 3EROA 2F0MA 1RODA 3SE0A 5JPNC 3KLSX 3NE5B 1XYIA 1LT5D 3NUCA 4RKBA 5EPKA 3SXHA 3T16A 1TWAB 4ZUIA 4KK7A 5KNDA 3WOFA 1DOKA 2OEOA 1Q8IA 4BY1B 3GP7A 3LWUA 2EJFC 1J9OA 1B53A 2PNRC 1STHA 2Y0SB 3PMFA 1PMRA 2Q8RE 1JICA 2IW3A 2RDGA 4KKTA 1KNAA 4K6DA 5FO7B 1D1KA 1S4ZA 4J1MA 1FNUA 2F0EA 2N88A 1D5MC 1TU2B 2JA7B 1I50B 3QIAA 1CT1D 4NMZA 1B44D 3GTOB 5K36H 1MD2D 4HAEA 2PZUA 2K5QA 1WCMB 2HCIA 2F3VA 3DWAA 5CV9A 4ZAIA 4IUNA 3S2DB 4RHRA 4IQZA 1E0BA 4IFDJ 2B2VA 3MA2B 3H3VC 4KV6A 4C3IG 2PPBC 2A68C 2B2WC 1I4RA 4K8JA 4EQNA 3S2HB 1BO0A 1JOKA 1WD0A 3VR4A 3J7AV 2JP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHY 1;  1MBY A; 
#chains in the Genus database with same CATH topology
 2GVB A;  2RSO A;  1TVX A;  1KTK A;  4A3E B;  3TRE A;  1MGS A;  2CH4 A;  5C0X J;  4GLA C;  2LFN A;  4ID6 A;  4C56 C;  1VQ5 A;  1KQS A;  4DV0 L;  3BVM A;  2XTI A;  2CKZ B;  1X6O A;  1K8A C;  5H1S E;  4JI6 L;  4RGM A;  3I8Z A;  1VQE A;  1PYS B;  2J0T D;  2ZJQ A;  4IFD G;  3HOV G;  1VQ7 A;  1AN8 A;  3I4M G;  3M3Y B;  5ISR A;  4PV1 C;  1E7Z A;  3RMH A;  1GUG A;  2F3I A;  2VL6 A;  4M8A A;  2ZXP A;  1VQ9 A;  3CHB D;  2EY2 A;  2NZH A;  4OHJ A;  1EFI D;  2L11 A;  4KN7 C;  3SK4 A;  2BDN A;  3R2I A;  2QDB A;  1AW7 A;  4GNX B;  2FJ2 A;  2R6G A;  1QG7 A;  1S3O A;  3TP8 A;  1I4P A;  5C4X G;  4HJ5 A;  3I4N B;  4JOI A;  1J5E L;  3PO3 H;  2WFW A;  1BF4 A;  4JI1 L;  1M8A A;  1STG A;  3M4O H;  5KGU A;  4LF9 Q;  2RQX A;  3K59 A;  3CCQ A;  3KBX A;  4BY7 B;  5AFW A;  4A3J B;  1XNR Q;  2ZJR A;  4FF2 A;  1QVG A;  2EYL A;  1NBW A;  1N33 L;  2E2I B;  3MXP A;  2VUM H;  4X6A H;  1JCK B;  4C3H H;  2B2Y C;  3CCV A;  4RA8 A;  1RJT A;  2H4O A;  2DNC A;  3LGJ A;  3D8G A;  3HOW H;  1UEA B;  1IXR A;  4OIK A;  1JC7 A;  1X56 A;  2OXP A;  2SNS A;  2L0C A;  2VQF Q;  4A3D H;  1IBK L;  1HQM C;  4KI0 A;  3X3N A;  4DR3 L;  1K83 H;  4KD4 A;  5FLX c;  3FKI H;  2Z1C A;  1GUN A;  3TEH B;  3UE0 A;  1GHK A;  1B3A A;  3MFG A;  1EY7 A;  3KLS A;  3GD7 A;  3Q6S A;  5JJZ A;  1E2Z A;  5KIX A;  4P71 A;  4HR7 B;  4A93 G;  1I6H H;  2JQO A;  1WVL A;  1TT2 A;  2KEN A;  3E0E A;  4K0K L;  4YY3 Q;  1IZ6 A;  2R93 H;  2D5D A;  3MVV A;  1MJE A;  2PW7 A;  5J22 A;  2QKI C;  1HFN A;  2ATW A;  1G51 A;  3V2T A;  1UE7 A;  4AH6 A;  1RIP A;  3T56 B;  4I65 A;  2QIL A;  3BG3 A;  5JPM C;  4BBS H;  4GOP B;  3TP7 A;  4F88 A;  3KF8 B;  2O2L D;  1EIG A;  3HOZ H;  1VQ8 A;  4H44 C;  3KK7 A;  5FO8 B;  1HXY D;  2FIN B;  2K03 A;  3CW2 C;  2DN8 A;  3I3C A;  4CJ1 B;  1E22 A;  1YI2 A;  4DXF A;  4A3L H;  1BQQ T;  4YHH L;  2K5W A;  3K5M A;  1EY0 A;  4CGY B;  4BA2 I;  3CP0 A;  1UNS A;  2WII B;  2B29 A;  2IHE A;  2F0I A;  1LT4 D;  3D31 A;  5A2Q L;  4Z9C B;  4F8M A;  3IFT A;  2NVX B;  1I3Q H;  2H1E A;  3VYS A;  1KL9 A;  2EJG C;  1RF2 D;  4R8I A;  5AJ3 L;  3PSI A;  3J7A 5;  3QOL A;  2KCC A;  3F2B A;  5EKI A;  5A2Q E;  5COY A;  1XMO L;  4LF8 L;  3TZU A;  3HS0 C;  3ZJY C;  5T1I A;  2ZXR A;  1Y1W H;  4HIK A;  2F4V Q;  4LUV A;  5IOD A;  2KHS A;  2PI2 E;  4ZRZ A;  2HCC A;  4ME3 A;  3TDQ A;  2ZT9 C;  4X3K A;  5JJL A;  2LSS A;  5COR A;  1XNQ L;  2F0P A;  1V1O A;  4KKS A;  1TY0 A;  2DJG C;  3C46 A;  1YEZ A;  2WB1 E;  1L0Y B;  3W1B A;  2UU9 L;  4BXX H;  1VQ4 A;  1CHQ D;  3KJP A;  2RBM A;  2NN6 I;  1ICW A;  4K14 A;  5LHY 1;  5M5Y B;  2Q2I A;  4OX9 Q;  1NY4 A;  4DN4 M;  3CXC A;  3WWV A;  3DLL A;  1X54 A;  2A5H A;  1X65 A;  2AQ2 B;  3MEH A;  1HFG A;  5M3F G;  1NUC A;  4DNT B;  1SMY C;  1S5E D;  1STY A;  3UI2 A;  2LS0 1;  1HR0 Q;  1MSH A;  1H9S A;  1GKH A;  1F77 A;  3FDT A;  1MI2 A;  1IW7 C;  2P5Z X;  5GAE C;  1KIX A;  2O4X A;  2JA6 G;  2K6A A;  3K5N A;  1PFN A;  1M90 C;  5G3L D;  1VQ6 A;  3H0G H;  1Q86 C;  5JJK A;  2ES2 A;  3GTQ B;  3RZO B;  1TS3 A;  1CQF A;  2F0T A;  4PQX A;  3W2D A;  2F0W A;  4DR2 L;  4BY1 H;  1CKN B;  5IYD H;  3KDF A;  5IT9 L;  3TS0 A;  3EA6 A;  2F0G A;  2QEX A;  1LV9 A;  1PH2 A;  1EU3 A;  3OPO A;  4LF9 L;  2WB1 B;  4A76 A;  2JA9 A;  2GN5 A;  1BNZ A;  1DXM A;  2D0P A;  5M3M G;  4J15 A;  1XNR L;  3UDX A;  1HZ9 A;  2YU9 B;  2SDF A;  4NKL A;  4DKA C;  4L5R C;  1PYW D;  5CV5 A;  2NYZ D;  3PIO A;  2NVT B;  3K58 A;  2K28 A;  3GTM B;  1LT6 D;  1EWC A;  1U4M A;  3F2D A;  5CBA E;  1YHB A;  2AQ1 B;  4APV A;  1K3B C;  2CVR A;  1A8V A;  5FOB B;  2VQF L;  2L1B A;  4L5S A;  3HOV B;  3I4M B;  1CQV A;  3S14 B;  3U50 C;  1G2T A;  1I50 H;  1W2B A;  5J3B A;  4K2L A;  4TKO B;  4FXD A;  3RUZ A;  4X3U A;  5LL6 S;  2M9V A;  1ZYR C;  1XTD A;  1D1I A;  1UUP A;  3PV0 A;  3TP6 A;  1C0A A;  3RN5 A;  2EZV A;  1PFB A;  4A3G G;  4FDB A;  1JMC A;  4B3R Q;  5C4X B;  5CV6 A;  5NUC A;  4YY3 L;  5IYC G;  1YVC A;  1PTO H;  3D0F A;  3IAY A;  3DEO A;  3EBE A;  4HCE A;  1J6Q A;  1HNZ Q;  2B2U A;  4C2M B;  2F0S A;  1R4P B;  1W6J A;  1LTG D;  2F0U A;  5I4D A;  4EQP A;  3IFD A;  3HOU H;  2K50 A;  4A3E H;  4UP7 A;  1NAP A;  1CI3 M;  2K52 A;  3W3A A;  2G9H D;  5I6W A;  4P74 A;  2B2T A;  1XX8 A;  4A3F B;  2IX3 A;  3OHX C;  2Z6K A;  1TR5 A;  2ZTC A;  3JAM c;  2A6E D;  2I5H A;  1L1O C;  4XTC S;  2A73 B;  2EYJ A;  1KAB A;  2F4I A;  4QL5 A;  4JI4 Q;  1GUW A;  1I4X A;  1C48 A;  4L63 B;  1HQR D;  5E1F A;  2A19 A;  4LFA Q;  3M3Y H;  1DZ1 A;  1TY2 A;  2EQS A;  3H15 A;  2L5T A;  3TBI B;  5ELB A;  2R92 H;  4A93 B;  3GQB A;  3U9O A;  1KLG D;  4V19 0;  3ICE A;  1NCV A;  1DD2 A;  3KLR A;  1BKB A;  2WKD A;  2LXJ A;  5C6A A;  1FJG L;  3I4N H;  2RKS A;  1SNM A;  3GTL B;  3QB3 A;  3CPW A;  3CQZ B;  1KAW A;  1RHP A;  3CPF A;  3Q23 A;  2WAQ G;  5M5X H;  4RHS A;  1DOM A;  1EY9 A;  4R4T A;  5JEA H;  2NN6 G;  2F4V L;  1EIF A;  2CWP A;  4BY7 H;  5DNF A;  4A3J H;  1TS2 A;  1D6E C;  2BE5 D;  1DON A;  3VR5 A;  1YNX A;  4IPG A;  2WIN B;  2A8V A;  2CW0 D;  2AQ3 B;  1YHA A;  4JBM A;  3EJI A;  1SYC A;  2TMP A;  1TII D;  3TN2 A;  2EE1 A;  2SEB D;  5ELE A;  4HCS A;  1F9P A;  1PRT F;  5GQO A;  3J80 L;  4QF4 A;  4OX9 L;  1FL0 A;  1Q12 A;  3QR8 A;  1S5D D;  4JI2 Q;  4O1N A;  1BXT A;  2F0K A;  5IYB G;  5D65 A;  3EN2 A;  4HN7 A;  3A0J A;  3N6R A;  3DEP A;  2I0Q A;  3ULP A;  3VYT A;  4IOA A;  1AFP A;  1U4L A;  1HR0 L;  4EGV A;  4O0A A;  3J80 E;  2NVY H;  4K5X A;  5IP9 H;  1YJW A;  3J7Z C;  4YWM A;  1Y14 B;  2MP1 A;  1HZA A;  3KF6 A;  4TSS A;  1Z6H A;  3SR1 A;  2GVA A;  4YIJ A;  2NUC A;  1WTV A;  1GXD C;  2L12 A;  3MXG A;  5CMD A;  4LMQ D;  2B8F A;  4QY7 A;  2KQ3 A;  4X65 Q;  1MBY A;  1O7Y A;  2K5V A;  3H3V H;  2Q2H A;  5BR8 L;  3BZK A;  1XXG A;  5EAY A;  4KJN A;  2MNA A;  2JYO A;  1K9M C;  4JI7 Q;  1VQO A;  1N33 Q;  1AEX A;  2HQE A;  4A75 A;  1C7Y A;  4EQ5 A;  1PDQ A;  2WV6 D;  1HH2 P;  1E2W A;  3J81 L;  1RD9 D;  4G7Z C;  5C3E G;  2AMC B;  2Z0S A;  2JA5 G;  2HDL A;  3CCE A;  3X3M A;  5LL6 X;  1IBL Q;  1B8A A;  4IO9 A;  5E7N A;  3GTP H;  1M1K C;  1KHI A;  1A3V A;  3J81 E;  1HR0 W;  4XYQ A;  4PMC A;  4R9W A;  3OOC A;  1U5K A;  4LF6 Q;  1ET6 A;  1PZI D;  2QF7 A;  2R7F A;  2A69 C;  2JA6 B;  2MO0 A;  5C44 H;  1BCP C;  4GNX C;  1L0W A;  5CV4 A;  1HA6 A;  3AB9 A;  5I9O A;  2KVM A;  3HKZ G;  1EY8 A;  2A1A A;  1SLJ A;  2PCF B;  2NTS A;  4HSV A;  2MQH A;  2R3Z A;  1ASZ A;  2NB0 A;  1UE6 A;  2IX0 A;  1U4P A;  4HJA A;  3CKI B;  1HNZ L;  5I9P A;  2Z4I A;  1B4O A;  2K75 A;  3KBG A;  2CFM A;  2K01 A;  3QO2 A;  1J8I A;  1A0I A;  1S5B D;  1H9R A;  1B3Q A;  4DNR B;  2Q2T A;  5M3M B;  4CDE C;  1TS5 A;  3P7J A;  2JEB I;  3HOX H;  4A3I H;  1MKH A;  1LYL A;  2M2L A;  2L55 A;  2NTT A;  1JOO A;  4UHV A;  2DUD A;  2A6H C;  3CF5 A;  4MTK A;  3GTJ B;  5HUR A;  1H9M A;  1VQA A;  4JVZ A;  2DY7 A;  2NVQ B;  5LMN Q;  2F0N A;  4A3K H;  3PO2 H;  1KXL A;  1QVF A;  4F87 A;  4XDX A;  4JI4 L;  3ERQ A;  4B9X A;  4EVO A;  3L7Z C;  3OWF A;  4LFA L;  4LUO A;  1VCI A;  2XVS A;  2KED A;  3D3R A;  3D4D A;  1PZK D;  4IUT A;  3BJU A;  2KCT A;  4ODG A;  2DGY A;  1SDF A;  4LNQ A;  2A74 C;  4LFC Q;  4NP5 A;  5GAH C;  4A3G B;  4BBR H;  3ITP A;  4ZKC B;  3HOY G;  1FNV A;  3S16 H;  3NTK A;  1ASY A;  3Q0A A;  4GKJ Q;  1HA5 A;  1N32 Q;  1L0X B;  3MWY W;  4GOP C;  3AMU A;  2EY5 A;  1O7Z A;  1YNJ C;  2E76 C;  3R2T A;  3FMC A;  1JOR A;  3BZD B;  2K1B A;  2KBN A;  4KY7 A;  1BBX C;  3STB D;  2YU9 H;  1UAP A;  3NEM A;  2QDL A;  2VW9 A;  1KRS A;  3UDI A;  1BR9 A;  2E2J B;  1KD1 C;  3RZD H;  3O13 A;  1PHJ A;  1RTO A;  3SHL A;  1D2B A;  1KDB A;  5IP7 H;  2UU9 Q;  5K36 G;  3NBH A;  2AWN A;  1JB3 A;  3M7G A;  1S5C D;  1OXU A;  3MTS A;  3W5O A;  1Z47 A;  3S14 H;  5M5W B;  2OWO A;  2FXQ A;  2EIF A;  3H09 A;  1OXX K;  4A3B H;  4DV5 L;  4JI2 L;  4DV4 Q;  5IGC A;  2R7Z G;  2JA8 H;  4G57 A;  2MO1 A;  4CDC C;  2YTY A;  1EWH A;  2OT2 A;  5L37 A;  3RN2 A;  2K5N A;  1EQQ A;  5C0X H;  4H0L C;  1X3E A;  3NPP A;  1ONL A;  1KAA A;  2XN9 C;  1E1O A;  4LK1 C;  3PGZ A;  1FVI A;  1FR3 A;  2LMC B;  1EIH A;  3HZX A;  3CCJ A;  4DR2 Q;  1OO9 B;  1TWH H;  1G6Z A;  2EOT A;  1P16 A;  1UE1 A;  1BDO A;  1SJE D;  2XWJ B;  4X65 L;  3WOE A;  4A3F H;  4FF4 A;  4YWK A;  3ND9 A;  4HSP A;  1WTP A;  2QCP X;  2X6L A;  4X62 Q;  4GKK Q;  4A3M H;  4OO1 H;  3R8B A;  4JI7 L;  2MUY A;  4HMJ A;  1G91 A;  1PTO F;  3NQI A;  2AHO B;  1STA A;  2DNE A;  1H95 A;  1EY6 A;  4JI5 Q;  5C3X A;  4GZY C;  2QGQ A;  4B3T Q;  1IBL L;  1R9T B;  3PO3 G;  1VQL A;  3DWQ A;  4OWT B;  3NK9 A;  4K5V A;  3BZC A;  3M4Y A;  4LF6 L;  3I73 A;  4CKB A;  3GTL H;  4IPC A;  4PZ6 A;  1X32 A;  3J80 i;  3OYY A;  3KJO A;  3S1R H;  3S1M H;  2N78 A;  3HKZ E;  4TQU S;  2WKC A;  2VUM G;  4C3H G;  3K6O A;  1D5X C;  3HOW G;  3Q22 A;  4QUC A;  4DR5 Q;  3MHB A;  3ONA B;  1YJN A;  1B1Z A;  4KKU A;  2KA7 A;  1C8C A;  3SK5 A;  3NHH A;  3CAM A;  4A3D G;  4B08 A;  3VA5 A;  1EUJ A;  1Q1E A;  4GLX A;  3FKI G;  4PMB A;  2PW5 A;  2J7Z A;  1BCP F;  1WTX A;  1JWU D;  5CV7 A;  4IPD A;  4H02 A;  4DNI A;  2JSO A;  4NB3 A;  1O7I A;  4KD3 A;  5EKK A;  5C3E B;  1U0L A;  1W6K A;  5KRU A;  4RG1 A;  1JWM D;  1UWV A;  4JI8 Q;  5HGT A;  4DV1 Q;  1GJX A;  1B70 B;  2R93 G;  2OTJ A;  5LMN L;  1SXT A;  4C3J H;  2MPM A;  2BA1 A;  1LUZ A;  4P2C B;  4JBK A;  3S17 B;  4KHV A;  3BU2 A;  5JAV A;  3M4Q A;  1S40 A;  4BBS G;  1RTN A;  3J81 i;  4R4C A;  3HKZ B;  4Y52 H;  3P20 A;  2VS1 A;  1SNP A;  1Y1V B;  4HED A;  3HOZ G;  4LFC L;  3NP8 A;  1G29 1;  3GV3 A;  2N49 A;  2QW7 A;  4KMU C;  1FJG Q;  3TSS A;  1H9S B;  2A68 D;  4M1U B;  1O80 A;  4RWS C;  2FMC A;  2NBF A;  3OIP A;  3M4P A;  1WYD A;  1K28 A;  4GKJ L;  1N32 L;  1EYC A;  1AZQ A;  2N55 A;  5EGT A;  5GAD C;  4A3L G;  1EQT A;  3GTK B;  3PF5 A;  1VQC A;  3M9B A;  1K0S A;  3OSO A;  1YBY A;  1STE A;  4EQO A;  1HTL D;  3A7L A;  3NTI A;  2PQA A;  3BVG A;  2B63 H;  4PMW A;  3S15 B;  5IGF A;  1XWE A;  3KDF B;  3DM1 A;  1QUQ A;  3CC4 A;  3PF4 A;  3T1H Q;  1EYA A;  4MZ9 A;  4X3T A;  2HUG A;  3G7L A;  2CHB D;  5ELO A;  1JE4 A;  1BBW A;  5CR3 A;  1B2T A;  1BVS A;  2EVB A;  4L5T A;  4NXN L;  5LMN W;  4B3M Q;  1A2U A;  2IX1 A;  1FYC A;  2B2W A;  3VR6 A;  3NBI A;  2KJX A;  3HRZ C;  1TWF B;  3M85 A;  2MFI A;  3J7Y W;  1Y1W G;  4QIW E;  1MSG A;  4LF7 Q;  2F0F A;  4DV4 L;  1U4R A;  4RKL A;  1CA5 A;  4DAP A;  4QGU A;  1F2Z A;  1NR2 A;  3FPU B;  2BE5 C;  2HIV A;  3RLF A;  2WP8 J;  3G48 A;  5JVG 3;  2K14 A;  1QOH A;  3D6W A;  4FF1 A;  1FGB D;  3T4A C;  1LT3 D;  2CW0 C;  1YNN D;  4UP8 A;  3RNU A;  3UE1 A;  2PYK A;  1TWA H;  1Y8N B;  2DJF C;  4BXX G;  2JN4 A;  1CHP D;  2JK8 A;  2Q8T A;  1WFQ A;  2AKW B;  3NEL A;  4C3I B;  2Q8I B;  2E2D C;  2RVL A;  4DAM A;  1N34 Q;  1PH6 A;  3HP3 A;  4BWG B;  3T51 B;  2EYF A;  1V1P A;  3SGI A;  4DV7 Q;  4RGN A;  3U58 A;  4WRD A;  5BR8 Q;  3S9W A;  3TME A;  3D4R A;  2EYO A;  4GN4 B;  4QB4 A;  5EPL A;  3S1N B;  5FLM H;  4RGO S;  1TWG B;  2L4N A;  5I2X A;  3JAM E;  1E2V A;  4GKK L;  4X62 L;  4PZ7 A;  2KEC A;  2PNH A;  1VQB A;  4QIW B;  4RCN A;  4K6L A;  1PFS A;  5KYI A;  4IJL A;  4JI5 L;  1EIY B;  2KEE A;  3H0G G;  1A15 A;  1DM0 B;  3RD4 A;  3I4L A;  5E4X A;  1LTI D;  3I90 A;  2XNA C;  5KYL A;  4B3T L;  1LTR D;  4BY1 G;  5IYD G;  2JA7 H;  1PH8 A;  2ASB A;  1XPR A;  3GTO H;  4X66 L;  2PO4 A;  5ELC A;  5IGB A;  2B2Y A;  5C4J B;  1WCM H;  3H91 A;  1ZEQ X;  1HZB A;  5IE8 A;  3CD6 A;  3S2D H;  4A3C H;  2ICI A;  4K5W A;  4DPG A;  4HIM A;  2OQK A;  3Q8D A;  4V0B A;  4RAU C;  4DR5 L;  3S2H H;  1ZXT A;  3LWE A;  1IKL A;  4OEM B;  2LKV A;  3AFQ A;  2ZXO A;  1OTC A;  4KHZ A;  3H3V I;  1YIJ A;  2Z4H A;  1OXT A;  4NPS A;  3EFX D;  1SN8 A;  4KN4 C;  1SYB A;  4CDF C;  3GDE A;  3MC0 B;  2IL8 A;  4OWX B;  4IUQ A;  3KOJ A;  1NSN S;  1CM9 A;  1KNE A;  1SRU A;  4WOR A;  4DU9 A;  5M5W H;  1XTC D;  1BOS A;  5C5L A;  1SR3 A;  4JI8 L;  3JC6 6;  4DV1 L;  3PO3 B;  1LTB D;  1ILP A;  1N36 Q;  4XT3 B;  4DR4 L;  1PRT B;  3I56 A;  3AEV A;  3M4O B;  3GTG B;  3URY A;  1VS0 A;  4POF A;  1EZ8 A;  5FK9 C;  4WJ4 A;  1KLU D;  4GLV B;  1DCZ A;  2KUM A;  3MAQ A;  5IT9 c;  3E5S A;  1VQM A;  3HOU G;  1CKM A;  2BA0 A;  1PRT D;  4A3E G;  2XIW A;  1G8Z D;  2YYZ A;  4JBJ A;  1AE3 A;  4L6T B;  5D14 A;  4C3H B;  4WFN 3;  4FVM A;  3HOW B;  1B7Y B;  3TQY A;  1XMQ Q;  3FP9 A;  4IZ8 A;  1NMG A;  2OTL A;  1QVC A;  5JEA J;  1AZP A;  1KDA A;  2EYH A;  3KF6 B;  2B2V C;  2JE6 I;  4ZQ3 A;  3ULJ A;  4PNY A;  4DGZ A;  1TKW B;  5IGD A;  2E2I H;  1A3U A;  1E24 A;  1WTW A;  5KNB A;  2R92 G;  2K33 A;  5ELF A;  1I6H B;  1LTS D;  2PQE A;  3T1H L;  3S24 A;  3PUZ A;  2R93 B;  1SMY D;  4GS3 A;  3SK6 A;  4JV5 L;  3M7N A;  1VF7 A;  3I4N G;  4QJF A;  4B3M L;  2MGS A;  3MXN A;  5K5P A;  1IW7 D;  3A5U A;  3DHQ A;  4N8F A;  5HY6 A;  1JQY D;  1D8L A;  4RMF A;  4XXE A;  1GVP A;  1R4Q B;  1PV4 A;  4DV5 Q;  4HJ8 A;  2JXM B;  3E9I A;  4BBS B;  4ME5 A;  4LF7 L;  5JEA G;  4QCL A;  4BY7 G;  4DR6 Q;  2BOS A;  3CCM A;  4A3J G;  3FPP A;  3HOZ B;  1NE3 A;  4B3S L;  4CKE A;  4GN5 A;  3STB C;  1E3P A;  1T5E A;  1VQK A;  4C1N K;  1Y69 U;  1ENF A;  1VQP A;  4JCV E;  1LAC A;  1WTO A;  1A6X A;  1CZG A;  4UP9 A;  5EPJ A;  4E6I A;  2VZA A;  5TSS A;  4B9W A;  4JOI C;  1S5F D;  3F8T A;  1QNK A;  4UAI A;  2NZ1 D;  1N34 L;  1B9N A;  2RDF A;  4IAL A;  1D7Q A;  1V8Q A;  4Q0F A;  4CJ2 C;  2UXD Q;  4DV7 L;  2BH2 A;  1EWI A;  4O2D A;  1EZ6 A;  1DOL A;  4DK0 A;  3D6C A;  1SE8 A;  3MFY A;  4KTA A;  5IP9 G;  2SOB A;  2EDG A;  2RCF A;  4J8Q A;  2B3G A;  1SAP A;  1Q3L A;  3V05 A;  3VA7 A;  1X3Q A;  3J81 j;  2UXC L;  4MTN A;  2ID0 A;  1Y1W B;  4FO2 A;  3AYH B;  1ZYR D;  2F3W A;  5M3F B;  1B50 A;  1QB5 D;  2KCM A;  3VR2 A;  3TP5 A;  2ZM6 Q;  3HKS A;  2NVX H;  2G5D A;  2ZJP A;  4JI3 Q;  2HD3 A;  5HGQ A;  3A5Z B;  1Y1V H;  4OGQ C;  4BS9 A;  2C35 B;  2E5L Q;  1AE2 A;  5C0X I;  1PH1 A;  3ZYY X;  2RHS B;  4CKC A;  3R3O A;  4DR1 Q;  4H13 C;  1LTA D;  4HTH A;  4FXK C;  1VMC A;  3BDL A;  1D5Z C;  5IGG A;  3BVZ A;  3NQT A;  1F9R A;  1S72 A;  3W1G A;  1QE6 A;  4OXP A;  1T9H A;  2HDM A;  2EPB A;  4ALP A;  1K8O A;  5C4Z A;  2VB2 X;  3VYU A;  4RH6 A;  4DV3 Q;  1I4Q A;  1HUM A;  5EBC A;  3C3L A;  2O5J C;  1Z7T A;  1QCB D;  4DA2 A;  1OXV A;  2L9H A;  3J80 c;  1HTP A;  3NXW A;  4DFA A;  5GRO A;  2C9O A;  1DJR D;  4CHT B;  4OO1 I;  1DGS A;  5C44 G;  1F2M A;  5DEH A;  1WTQ A;  4X3S A;  2FHT A;  1W3S A;  1Q1B A;  3KYH C;  2TSS A;  4XT1 B;  3IKJ A;  3OTO L;  1HRJ A;  5M5Y H;  1CSP A;  4CBV A;  2F52 A;  2YTV A;  3H0G B;  4MN3 A;  2CH4 W;  1UE5 A;  2F0H A;  3EQL C;  5IY0 A;  3C1E A;  4LFB Q;  1N36 L;  3NBH B;  4YCU A;  5FJ8 H;  4IN3 A;  3GV6 A;  4UPA A;  1EQV A;  1KDC A;  3DM3 A;  4DK1 A;  3CC2 A;  3NEN A;  4DV6 Q;  3SEB A;  3HFZ B;  1L1O A;  3HOX G;  1E1T A;  1TWC B;  5CV8 A;  3E3X A;  1GO3 E;  4A3I G;  1K73 C;  3I72 A;  3F1Z A;  4BA1 I;  4IJH A;  3GTQ H;  3RZO H;  2AUJ D;  5DM7 3;  4C3I H;  3I4O A;  4IUR A;  3DUZ A;  4HJ7 A;  1XMQ L;  1NR4 A;  2YTX A;  4XQQ A;  4A3K G;  3J81 c;  4G7H C;  3PO2 G;  2WAQ E;  3K5O A;  4AYB G;  1LTL A;  3CCS A;  2EY1 A;  1EEF D;  1EY5 A;  1SE2 A;  2D62 A;  4FXG C;  2HQL A;  3PUW A;  2CQA A;  1G2S A;  1WTH A;  4DK6 C;  2NVT H;  5FLX L;  3GTM H;  3PIP 3;  1VQI A;  2IT1 A;  3SK8 A;  1PLF A;  1VMP A;  4AQY Q;  4A4I A;  3F2C A;  1ESF A;  5FKA C;  3TS2 A;  4NXN Q;  4BBR G;  3OW7 A;  4L5Q A;  3L9A X;  1LAB A;  5C4H A;  2L15 A;  5ELN A;  1PTO B;  4IFD H;  2Z6B A;  3HOV H;  1SJH D;  3U4V A;  1EFW A;  2X6G A;  3I4M H;  1SE3 A;  2XSC A;  1I4G A;  5FLX E;  3BYT B;  5EKL A;  3OWE B;  3S1Q B;  5T1G A;  1RCV D;  1ET9 A;  4ZCK A;  3C2P A;  3RLO A;  1T5X D;  2HIX A;  1PTO D;  1PVO A;  3KUP A;  2IWH A;  4FF3 A;  3HOU B;  1LTT D;  1CFM A;  1I94 L;  4DR6 L;  1O78 A;  1HZC A;  3K5L A;  2MJ8 A;  3UDF A;  5C4X H;  2F0J A;  1JR0 D;  1B9M A;  1U9R A;  1QJO A;  1Q46 A;  2UXB Q;  2WAQ B;  5E3F A;  2EY6 A;  1CZW A;  5IP7 G;  4DF7 A;  3K7U C;  4C2M H;  5IIF A;  1Z9F A;  3DMU A;  1AP0 A;  4CDD C;  1ENA A;  2BCO A;  4KHP Q;  1CTM A;  3E6Z X;  2F1M A;  4XYO A;  4Y7N B;  2F0Q A;  3IL8 A;  3VYR A;  4A3B G;  2R92 B;  2UXD L;  1GD7 A;  1GHJ A;  4XIG S;  5M9O A;  2CQO A;  2UUC Q;  4X64 Q;  4IUV A;  1SFO B;  2JA8 G;  2EYP A;  3KLW A;  1BCP B;  1HPC A;  4L8J A;  5C0X G;  4ULL A;  1EYG A;  1F2Y A;  4POG A;  1VQH A;  2RHQ B;  1LO5 D;  1EY4 A;  2A69 D;  1CSQ A;  1STN A;  1BCP D;  3GTG H;  1YNN C;  3ND8 A;  5M5X B;  1EL0 A;  1VQN A;  5IWA Q;  3OW2 A;  1K8M A;  2QEJ C;  1G6P A;  4A93 H;  2F0D A;  1HNX Q;  2ZM6 L;  4H7B A;  4JI3 L;  5ELD A;  4X66 Q;  2AUK A;  1GM5 A;  3T53 B;  4DR7 Q;  4UY8 C;  4DAY B;  2E5L L;  1EOV A;  4G4K A;  5BN3 A;  4DAV A;  4A3F G;  4RGT A;  5JOB A;  4DR1 L;  1QIL A;  3MZ5 A;  3CQZ H;  2M00 A;  2RDH A;  1SND A;  1YZ6 A;  4OO1 G;  4A3M G;  4FNF A;  3IRB A;  1GUO A;  3J7A F;  1PH9 A;  2IHF A;  1ENC A;  2XRQ D;  4DUY Q;  1YJ9 A;  2B2U C;  1TQO A;  2A6H D;  4DV3 L;  2MHV A;  5F2D A;  4GNX A;  4LAA A;  4P73 A;  3ULL A;  4NXM Q;  1I4H A;  4LF5 Q;  2HHH Q;  1IYU A;  2NVY B;  4KY6 A;  1A3T A;  1V9P A;  2VNU D;  4TVA B;  3PUV A;  2B2T C;  3A8I E;  1L2F A;  3L3O C;  2KCN A;  2Z6K C;  5D3I B;  3Q24 A;  2JA5 B;  2I5M X;  4YCV A;  2PQA B;  4K8I A;  5DLQ E;  5IOC A;  2VQE Q;  3E9H A;  3OMG A;  2G9D A;  2I07 B;  1SNQ A;  5KNC A;  1A2T A;  1QUQ B;  3L2P A;  1Q81 C;  4MHE A;  3WDN A;  4LWC A;  3LX0 A;  4DAY A;  4DR4 Q;  1BUV T;  2KHJ A;  4LFB L;  1Q90 A;  2NWG A;  1QZG A;  3HGB A;  1HCZ A;  3T13 A;  5BN4 A;  1IHZ A;  4I7Z C;  2AWO A;  5CGK A;  3K57 A;  3H94 A;  1YNJ D;  4JI0 L;  2DY8 A;  2J4X A;  1IYV A;  4ZKB B;  2Z8L A;  4DV6 L;  3G6J B;  3FHW A;  3H6M A;  1X3F A;  4U68 A;  2IPK D;  2BDO A;  5J39 A;  2C5C A;  3GO5 A;  2A6E C;  2VY3 A;  4LJZ C;  1CK1 A;  3QOJ A;  2ENB A;  4QQB X;  5DM6 3;  1SE4 A;  1QZH A;  3GTP B;  4I7A A;  2E75 C;  3VR3 A;  2F0V A;  4C3J G;  2PZW A;  2K05 A;  3EIV A;  1M4V A;  2WAC A;  4RFB A;  1O7L A;  4AYB E;  3K7A B;  5C44 B;  4FP5 D;  1K8G A;  4QMG A;  2K7V A;  1SYD A;  1YIT A;  2YV5 A;  1CKO A;  1TXY A;  1V1P B;  1QNU A;  4GOP A;  3KF8 A;  4AQY L;  3PUY A;  1CA6 A;  3K80 C;  4F7X A;  1PRT C;  5M3F H;  4DV2 Q;  1FD7 D;  1F2L A;  2B8G A;  4WJW A;  1X55 A;  4JV5 Q;  1TS4 A;  1XJV A;  5CYU A;  1X3G A;  1EOT A;  5A35 A;  1EEI D;  2JJQ A;  4JG2 A;  1H9J A;  4U67 3;  2JA6 H;  1VQG A;  3DXJ C;  5EJW A;  5C3W A;  1MJC A;  3HOX B;  4FYD A;  4B3S Q;  3B6Y A;  3HOY B;  1K3R A;  5CC4 A;  4A3I B;  5I2Y A;  1I6V C;  1MHW C;  1GUS A;  4GN3 B;  2B63 G;  4NW2 A;  5J1Z A;  4KLK A;  3CCL A;  1JT8 A;  1PYB A;  3CRK C;  2E2H B;  2UXB L;  3NTH A;  4A3K B;  1HJP A;  5LMU Q;  3PO2 B;  1ZKO A;  3G4S A;  1F9S A;  4AYB B;  2GA4 B;  1V43 A;  4K2K A;  5M3M H;  3JAM L;  2V4D A;  4O42 A;  2CWA A;  4KHP L;  4PG3 A;  2EJM A;  3SDZ A;  3ERS X;  2N8N A;  2XWB B;  3AFP A;  2UUC L;  2UUA Q;  4X64 L;  3GTJ H;  4R1J A;  3F2U A;  4BBR B;  2NVQ H;  3S16 B;  4ABN A;  2EXD A;  5CBE E;  3EVQ A;  1IL8 A;  1SEB D;  3FRP B;  2UUB Q;  4DXG A;  1GOZ A;  2FMM A;  2UXC Q;  3E0J A;  1HHV A;  4N9T A;  4G7O C;  4OIJ A;  4XQJ A;  3PUX A;  5IWA L;  2HT1 A;  3T1Y Q;  2R7Z B;  5DAU A;  4OL7 A;  3A74 A;  3CU7 A;  3A55 A;  5KEE A;  1KRT A;  1Q8K A;  1HNX L;  1PH5 A;  3BYY B;  2OQ0 A;  5IT9 E;  4A3G H;  1TWC H;  1CUK A;  3AQQ A;  3AU7 A;  5IYC H;  3NSW A;  3BDC A;  1ML0 D;  1STB A;  3RZD B;  1WTR A;  4DR7 L;  5FLM G;  2RSN A;  5I6Y A;  2Y0S G;  5EQ0 A;  2B39 A;  4IPH A;  1YHQ A;  3I91 A;  4LF4 Q;  1SBB B;  1JOQ A;  2V1C C;  3QG1 A;  1NNX A;  2BH8 A;  4UDU C;  5G3L F;  3OMC A;  4N9P A;  4A3B B;  4DUY L;  4R4O A;  2RCN A;  4P72 A;  2PI2 A;  1A62 A;  3PQI A;  4R4I A;  4QUF A;  3P75 A;  2E2J H;  1DYQ A;  2JA8 B;  4NXM L;  2D0O A;  2IY5 B;  2D2C C;  4LF5 L;  2HHH L;  2JA7 G;  1V1Q A;  4EX5 A;  1CKN A;  5D3D A;  1IBM Q;  2RF4 A;  4NDX A;  3OTO Q;  4C1N I;  1IL2 A;  1WCM G;  2E8G A;  5E4W C;  4CJ0 B;  2XGT A;  3S1Q H;  2N3S A;  2VQE L;  4A3C G;  3I70 A;  4ZLT F;  2F03 A;  2ALY B;  1TWH B;  1VQD A;  2I46 A;  1SNC A;  3C1F A;  2PZT A;  4JBW A;  1WOC A;  2ICE C;  1RKN A;  5C5M A;  1F9Q A;  1VQJ A;  4KY5 A;  2LY7 A;  3MXN B;  2SNM A;  4IUU A;  4XQN A;  1XPU A;  5FO9 B;  2JEA I;  2EYM A;  1JE5 A;  4A3M B;  2I5L X;  3G6E A;  2VUM B;  1OXS C;  2D9U A;  2NN6 H;  2ZTD A;  1FNW A;  3D4W A;  1N9W A;  3CC7 A;  1I5F A;  4JYA Q;  1GUT A;  4JK1 C;  4A3D B;  4Y7N H;  3PIP A;  2VB3 X;  1II3 A;  1K83 B;  3FKI B;  3KFU A;  1JWS D;  2F0L A;  2K5H A;  1SFO H;  1VQF A;  4N8X 1;  1VDZ A;  1Y8O B;  2EXZ A;  3NWT A;  2OF1 A;  4MIU A;  3A8J E;  3I55 A;  1HNW Q;  4R8N A;  1IYJ B;  1H9K A;  1PH7 A;  1JJG A;  3K0Y A;  4ZUJ A;  4WJ3 M;  3HEJ A;  2CCZ A;  3S1R B;  3S1M B;  4OON A;  5IYB H;  1PH4 A;  4DV2 L;  1Y8P B;  3A54 A;  4IUP A;  3VDY A;  4MNO A;  4OEL B;  1R9T H;  3CCU A;  3I2Z A;  2QA4 A;  4ZK9 B;  1AH9 A;  3NWS A;  1SYF A;  5EBD A;  1UEB A;  1PH3 A;  4DUZ Q;  1NTG A;  4ILW A;  1N8R C;  1I94 Q;  1WD1 A;  1XPO A;  2VXW A;  2O5I C;  1IKM A;  1EU4 A;  4HID A;  3ER0 A;  4HJ9 A;  2IJ0 A;  2R61 A;  3TZD A;  1JJ2 A;  2KHI A;  3A56 A;  3QJY A;  4DV0 Q;  1SRO A;  1SSO A;  3SVM A;  2NZO A;  3V96 A;  2KOL A;  1ILQ A;  4JI6 Q;  1HUN A;  1RDP D;  3OIQ A;  4IOC A;  1C4Q A;  2XRS D;  2PMZ E;  4J6H A;  5LMU L;  3U4Z A;  3FVQ A;  4C3J B;  3K8A A;  2X69 A;  2Q2U A;  3CRL C;  1PA6 A;  3N52 A;  4HMI A;  4S3S A;  5C3E H;  2OCE A;  3A8K E;  4JW0 A;  1I3Q B;  2JA5 H;  1PTO C;  4KJO A;  1SYE A;  2UUA L;  5IGE A;  4TRD A;  3FEW X;  3QWN A;  1KC8 C;  1BBU A;  2E74 C;  2K5D A;  1J5E Q;  1JJC B;  4IFD I;  3MXU A;  1K0R A;  1PZJ D;  4JI1 Q;  1PFM A;  5BN5 A;  4Q5V A;  2UUB L;  3S17 H;  2K4K A;  3A7A B;  4ZYS A;  5JJI A;  1PXU A;  1QWY A;  3P1H A;  1LLR D;  5JVH 3;  3T1Y L;  4YWL A;  3U9S A;  2F0O A;  1EQR A;  3K0X A;  3HG9 A;  2B63 B;  3TRZ A;  4RCO A;  1EYD A;  2FFK B;  1LM0 A;  1NJI C;  2Z9H A;  2R7D A;  1SYG A;  2PMZ B;  2RA4 A;  3DWP A;  3BS1 A;  4LW1 A;  3LNN A;  1IBK Q;  2K32 A;  3CME A;  4DR3 Q;  4LF4 L;  2Y0S E;  3GTK H;  2K04 A;  4HIO A;  3L0O A;  1L1O B;  1ESR A;  1X3P A;  3G71 A;  3PIO 3;  3BDO A;  3CCR A;  4P75 A;  1SNO A;  3K7A H;  1VF5 C;  3R93 A;  3ERO A;  2F0M A;  1ROD A;  3S15 H;  1WJJ A;  3SE0 A;  5JPN C;  3PCO B;  3KLS X;  1ICF B;  3NE5 B;  4K0K Q;  1XYI A;  1LT5 D;  1Y1V G;  3NUC A;  3UDG A;  4B3R L;  3RLN A;  3CMA A;  1IBM L;  4RKB A;  5EPK A;  3RR5 A;  4YCW A;  3SXH A;  3JAM i;  3T16 A;  1TWF H;  1C9O A;  1TWA B;  4ZUI A;  4KK7 A;  5KND A;  3WOF A;  1DOK A;  2OEO A;  1Q8I A;  4JPB W;  3MEF A;  4BY1 B;  3GP7 A;  1RL2 A;  2H5X A;  3LWU A;  1Q7Y C;  1SMX A;  3HOY H;  2EJF C;  1J9O A;  1WI5 A;  1B53 A;  2PNR C;  1STH A;  2Y0S B;  3PMF A;  2ZTE A;  4JI0 Q;  2E2H H;  1PMR A;  2Q8R E;  1JIC A;  4YHH Q;  2IW3 A;  2RDG A;  4R4Q A;  1Q82 C;  4KKT A;  1KNA A;  4K6D A;  5FO7 B;  1D1K A;  1S4Z A;  4DK3 C;  4JC0 A;  1JB7 A;  4J1M A;  4JYA L;  1FNU A;  5GAG C;  2F0E A;  1X9N A;  3I7F A;  2N88 A;  3S1N H;  1D5M C;  1FGU A;  1TU2 B;  1TWG H;  4AIM A;  5AJ3 Q;  2JA7 B;  1I50 B;  3QIA A;  1CT1 D;  4LUZ A;  1B44 D;  4NMZ A;  3GTO B;  5K36 H;  1MD2 D;  4HAE A;  5FJ8 G;  2PZU A;  1A63 A;  1HNW L;  3K81 C;  1XMO Q;  4LF8 Q;  2K5Q A;  1WCM B;  2HCI A;  1MIU A;  2F3V A;  4OWW B;  4PZ8 A;  1P8L A;  3DWA A;  5CV9 A;  4ZAI A;  4IUN A;  3S2D B;  4RHR A;  4IQZ A;  1E0B A;  4IFD J;  2LXK A;  2B2V A;  2R7Z H;  3MA2 B;  3H3V C;  4KV6 A;  4C3I G;  2PPB C;  2A68 C;  2B2W C;  1I4R A;  4K8J A;  1NMF A;  4EQN A;  1XNQ Q;  3S2H B;  1BO0 A;  1JOK A;  1WD0 A;  3VR4 A;  5C4J H;  3J7A V;  2WB1 G;  4DUZ L;  2JP1 A; 
#chains in the Genus database with same CATH homology
 2RSO A;  1TVX A;  1KTK A;  4A3E B;  1MGS A;  5C0X J;  2LFN A;  4ID6 A;  4C56 C;  3BVM A;  4RGM A;  3I8Z A;  2J0T D;  4IFD G;  3M3Y B;  1AN8 A;  5ISR A;  4PV1 C;  3RMH A;  1GUG A;  4M8A A;  2ZXP A;  3CHB D;  2EY2 A;  4OHJ A;  1EFI D;  2L11 A;  4KN7 C;  3SK4 A;  2BDN A;  3R2I A;  2QDB A;  1AW7 A;  2FJ2 A;  2R6G A;  1QG7 A;  3TP8 A;  1I4P A;  3I4N B;  1BF4 A;  1M8A A;  1STG A;  5KGU A;  2RQX A;  3K59 A;  3KBX A;  4BY7 B;  5AFW A;  4A3J B;  4FF2 A;  2EYL A;  2E2I B;  3MXP A;  1JCK B;  2B2Y C;  4RA8 A;  1RJT A;  2H4O A;  2DNC A;  3D8G A;  1UEA B;  4OIK A;  1JC7 A;  2SNS A;  2OXP A;  2L0C A;  1HQM C;  4KI0 A;  3X3N A;  4KD4 A;  2Z1C A;  1GUN A;  1GHK A;  1B3A A;  3MFG A;  1EY7 A;  3KLS A;  3GD7 A;  3Q6S A;  5JJZ A;  1E2Z A;  5KIX A;  4HR7 B;  1WVL A;  1TT2 A;  2D5D A;  3MVV A;  2PW7 A;  5J22 A;  2QKI C;  1HFN A;  3V2T A;  3T56 B;  4I65 A;  2QIL A;  3BG3 A;  5JPM C;  3TP7 A;  4F88 A;  2O2L D;  1EIG A;  4H44 C;  3KK7 A;  5FO8 B;  1HXY D;  2FIN B;  2K03 A;  2DN8 A;  3I3C A;  4CJ1 B;  4DXF A;  1BQQ T;  2K5W A;  3K5M A;  1EY0 A;  4CGY B;  4BA2 I;  1UNS A;  2WII B;  2F0I A;  1LT4 D;  3D31 A;  5A2Q L;  4Z9C B;  4F8M A;  3IFT A;  2NVX B;  2H1E A;  3VYS A;  2EJG C;  1RF2 D;  4R8I A;  3QOL A;  2KCC A;  5EKI A;  5A2Q E;  5COY A;  3TZU A;  3HS0 C;  5T1I A;  2ZXR A;  5IOD A;  2KHS A;  4ZRZ A;  2HCC A;  3TDQ A;  2ZT9 C;  4X3K A;  5COR A;  2F0P A;  1V1O A;  4KKS A;  1TY0 A;  3C46 A;  1L0Y B;  1CHQ D;  2RBM A;  2NN6 I;  1ICW A;  4K14 A;  5LHY 1;  5M5Y B;  4DN4 M;  2A5H A;  3MEH A;  2AQ2 B;  1HFG A;  1NUC A;  4DNT B;  1SMY C;  1S5E D;  1STY A;  3UI2 A;  2LS0 1;  1MSH A;  1H9S A;  1F77 A;  3FDT A;  1MI2 A;  1IW7 C;  2O4X A;  2K6A A;  3K5N A;  1PFN A;  5G3L D;  3GTQ B;  3RZO B;  1TS3 A;  1CQF A;  2F0T A;  4PQX A;  3W2D A;  2F0W A;  5IT9 L;  3EA6 A;  2F0G A;  1LV9 A;  1EU3 A;  3OPO A;  2WB1 B;  1BNZ A;  1DXM A;  2YU9 B;  2SDF A;  4NKL A;  1PYW D;  5CV5 A;  2NYZ D;  2NVT B;  3K58 A;  2K28 A;  3GTM B;  1LT6 D;  1EWC A;  1U4M A;  5CBA E;  2AQ1 B;  2CVR A;  5FOB B;  2L1B A;  3HOV B;  3I4M B;  1CQV A;  3S14 B;  1G2T A;  4K2L A;  4TKO B;  4FXD A;  3RUZ A;  4X3U A;  5LL6 S;  2M9V A;  1ZYR C;  1D1I A;  1UUP A;  3PV0 A;  3TP6 A;  2EZV A;  1PFB A;  5C4X B;  5CV6 A;  5NUC A;  1PTO H;  3IAY A;  3DEO A;  4HCE A;  2B2U A;  4C2M B;  2F0S A;  1R4P B;  1W6J A;  1LTG D;  2F0U A;  5I4D A;  4EQP A;  3IFD A;  1NAP A;  1CI3 M;  3W3A A;  2G9H D;  5I6W A;  2B2T A;  1XX8 A;  4A3F B;  2IX3 A;  3OHX C;  1TR5 A;  2A6E D;  4XTC S;  2A73 B;  2EYJ A;  1KAB A;  2F4I A;  1GUW A;  1I4X A;  1C48 A;  4L63 B;  1HQR D;  5E1F A;  1DZ1 A;  1TY2 A;  2L5T A;  3TBI B;  5ELB A;  4A93 B;  3GQB A;  3U9O A;  1KLG D;  4V19 0;  1NCV A;  1DD2 A;  3KLR A;  2WKD A;  5C6A A;  2RKS A;  1SNM A;  3GTL B;  3QB3 A;  3CQZ B;  1RHP A;  3Q23 A;  4RHS A;  1DOM A;  1EY9 A;  5JEA H;  2NN6 G;  5DNF A;  1TS2 A;  1D6E C;  2BE5 D;  1DON A;  3VR5 A;  2WIN B;  2CW0 D;  2AQ3 B;  3EJI A;  1SYC A;  2TMP A;  1TII D;  3TN2 A;  2EE1 A;  2SEB D;  5ELE A;  4HCS A;  1F9P A;  1PRT F;  3J80 L;  4QF4 A;  1Q12 A;  1S5D D;  4O1N A;  1BXT A;  2F0K A;  5D65 A;  4HN7 A;  1AFP A;  3N6R A;  3DEP A;  3VYT A;  1U4L A;  4EGV A;  3J80 E;  4K5X A;  2MP1 A;  4TSS A;  1Z6H A;  3SR1 A;  4YIJ A;  2NUC A;  1WTV A;  1GXD C;  2L12 A;  3MXG A;  5CMD A;  4LMQ D;  2B8F A;  2KQ3 A;  1MBY A;  1O7Y A;  1XXG A;  4KJN A;  2JYO A;  1AEX A;  2HQE A;  1PDQ A;  2WV6 D;  1E2W A;  3J81 L;  1RD9 D;  4G7Z C;  2HDL A;  3X3M A;  5LL6 X;  1A3V A;  3J81 E;  4XYQ A;  4PMC A;  4R9W A;  3OOC A;  1ET6 A;  1PZI D;  2QF7 A;  2A69 C;  2JA6 B;  1BCP C;  5CV4 A;  1HA6 A;  3AB9 A;  5I9O A;  2KVM A;  1EY8 A;  2PCF B;  2NTS A;  4HSV A;  2R3Z A;  2NB0 A;  2IX0 A;  1U4P A;  3CKI B;  5I9P A;  2Z4I A;  1B4O A;  3KBG A;  2K01 A;  3QO2 A;  1J8I A;  1S5B D;  1H9R A;  4DNR B;  5M3M B;  1TS5 A;  3P7J A;  2JEB I;  2M2L A;  2L55 A;  2NTT A;  1JOO A;  2A6H C;  3GTJ B;  5HUR A;  1H9M A;  2DY7 A;  2NVQ B;  2F0N A;  4F87 A;  4XDX A;  3ERQ A;  4B9X A;  4EVO A;  3L7Z C;  3OWF A;  1VCI A;  2XVS A;  2KED A;  3D3R A;  3D4D A;  1PZK D;  4IUT A;  4ODG A;  1SDF A;  2A74 C;  4NP5 A;  4A3G B;  3ITP A;  4ZKC B;  1FNV A;  3NTK A;  3Q0A A;  1HA5 A;  1L0X B;  3MWY W;  3AMU A;  2EY5 A;  1O7Z A;  1YNJ C;  2E76 C;  3R2T A;  3FMC A;  1JOR A;  3BZD B;  2K1B A;  4KY7 A;  1BBX C;  1UAP A;  1BR9 A;  2E2J B;  3O13 A;  1RTO A;  3SHL A;  1D2B A;  1KDB A;  5K36 G;  3NBH A;  2AWN A;  1JB3 A;  3M7G A;  1S5C D;  1OXU A;  3MTS A;  1Z47 A;  5M5W B;  3H09 A;  1OXX K;  5IGC A;  4G57 A;  1EWH A;  2OT2 A;  5C0X H;  4H0L C;  3NPP A;  1ONL A;  1KAA A;  2XN9 C;  4LK1 C;  1FR3 A;  2LMC B;  1EIH A;  3HZX A;  1OO9 B;  1G6Z A;  2EOT A;  1BDO A;  1SJE D;  2XWJ B;  3WOE A;  4FF4 A;  3ND9 A;  4HSP A;  1WTP A;  2QCP X;  2X6L A;  4OO1 H;  3R8B A;  1G91 A;  2MUY A;  4HMJ A;  1PTO F;  3NQI A;  1STA A;  2DNE A;  1EY6 A;  5C3X A;  4GZY C;  1R9T B;  3DWQ A;  3NK9 A;  4K5V A;  3M4Y A;  3I73 A;  4CKB A;  1X32 A;  4TQU S;  2WKC A;  4C3H G;  3K6O A;  1D5X C;  3Q22 A;  4QUC A;  3MHB A;  3ONA B;  1B1Z A;  4KKU A;  2KA7 A;  1C8C A;  3SK5 A;  3NHH A;  4B08 A;  3VA5 A;  1Q1E A;  4PMB A;  2PW5 A;  2J7Z A;  1BCP F;  1WTX A;  1JWU D;  5CV7 A;  2JSO A;  5EKK A;  4KD3 A;  5C3E B;  1W6K A;  5KRU A;  1JWM D;  5HGT A;  1GJX A;  1SXT A;  2MPM A;  2BA1 A;  4P2C B;  3S17 B;  4KHV A;  5JAV A;  1RTN A;  3HKZ B;  3P20 A;  1SNP A;  1Y1V B;  4HED A;  3NP8 A;  1G29 1;  3GV3 A;  4KMU C;  3TSS A;  1H9S B;  2A68 D;  4M1U B;  1O80 A;  4RWS C;  2FMC A;  2NBF A;  3OIP A;  1EYC A;  1AZQ A;  2N55 A;  5EGT A;  1EQT A;  3GTK B;  3OSO A;  1STE A;  4EQO A;  1HTL D;  3A7L A;  3NTI A;  3BVG A;  4PMW A;  3S15 B;  5IGF A;  1XWE A;  3DM1 A;  1EYA A;  4X3T A;  2HUG A;  3G7L A;  2CHB D;  1JE4 A;  5CR3 A;  1B2T A;  2EVB A;  1A2U A;  2IX1 A;  1FYC A;  2B2W A;  3VR6 A;  3NBI A;  2KJX A;  3HRZ C;  1TWF B;  3M85 A;  3J7Y W;  1MSG A;  2F0F A;  1U4R A;  4RKL A;  1CA5 A;  4DAP A;  1F2Z A;  1NR2 A;  3FPU B;  2BE5 C;  3RLF A;  2WP8 J;  5JVG 3;  3D6W A;  1QOH A;  4FF1 A;  1FGB D;  3T4A C;  1LT3 D;  2CW0 C;  1YNN D;  2PYK A;  1Y8N B;  1CHP D;  2Q8T A;  4C3I B;  2Q8I B;  2E2D C;  2RVL A;  3HP3 A;  4BWG B;  3T51 B;  2EYF A;  1V1P A;  4RGN A;  4WRD A;  3S9W A;  3TME A;  3D4R A;  2EYO A;  4QB4 A;  5EPL A;  3S1N B;  4RGO S;  1TWG B;  2L4N A;  5I2X A;  3JAM E;  1E2V A;  2KEC A;  4QIW B;  4RCN A;  4K6L A;  5KYI A;  2KEE A;  1A15 A;  1DM0 B;  3RD4 A;  3I4L A;  5E4X A;  1LTI D;  3I90 A;  2XNA C;  5KYL A;  1LTR D;  2PO4 A;  5ELC A;  5IGB A;  2B2Y A;  5C4J B;  3H91 A;  1ZEQ X;  2ICI A;  4K5W A;  4V0B A;  4RAU C;  1ZXT A;  3LWE A;  1IKL A;  2LKV A;  2ZXO A;  4KHZ A;  2Z4H A;  1OXT A;  3EFX D;  4KN4 C;  1SYB A;  3MC0 B;  2IL8 A;  4IUQ A;  1NSN S;  1CM9 A;  1KNE A;  4WOR A;  4DU9 A;  1XTC D;  1BOS A;  5C5L A;  3PO3 B;  1LTB D;  1ILP A;  4XT3 B;  1PRT B;  3M4O B;  3GTG B;  3URY A;  1EZ8 A;  5FK9 C;  1KLU D;  1DCZ A;  2KUM A;  3MAQ A;  3E5S A;  2BA0 A;  1PRT D;  2XIW A;  1G8Z D;  2YYZ A;  4L6T B;  5D14 A;  4C3H B;  4WFN 3;  4FVM A;  3HOW B;  4IZ8 A;  5JEA J;  1AZP A;  1KDA A;  2EYH A;  2B2V C;  2JE6 I;  4ZQ3 A;  4PNY A;  4DGZ A;  1TKW B;  5IGD A;  1A3U A;  1WTW A;  5KNB A;  2K33 A;  5ELF A;  1I6H B;  1LTS D;  2PQE A;  3PUZ A;  2R93 B;  1SMY D;  3SK6 A;  3M7N A;  1VF7 A;  2MGS A;  3MXN A;  5K5P A;  1IW7 D;  3DHQ A;  1JQY D;  4XXE A;  1R4Q B;  2JXM B;  4BBS B;  4ME5 A;  5JEA G;  4QCL A;  2BOS A;  3FPP A;  3HOZ B;  4CKE A;  1T5E A;  4C1N K;  1Y69 U;  1ENF A;  1LAC A;  1WTO A;  1A6X A;  1CZG A;  5EPJ A;  4E6I A;  5TSS A;  4B9W A;  1S5F D;  1QNK A;  4UAI A;  2NZ1 D;  1B9N A;  2RDF A;  4IAL A;  1V8Q A;  4Q0F A;  4CJ2 C;  1EZ6 A;  1DOL A;  4DK0 A;  3D6C A;  3MFY A;  4KTA A;  2SOB A;  2EDG A;  4J8Q A;  1SAP A;  1Q3L A;  3V05 A;  3VA7 A;  1X3Q A;  2ID0 A;  1Y1W B;  4FO2 A;  1ZYR D;  2F3W A;  5M3F B;  1B50 A;  1QB5 D;  3VR2 A;  3TP5 A;  4OGQ C;  4BS9 A;  5C0X I;  3ZYY X;  4CKC A;  3R3O A;  4H13 C;  1LTA D;  4HTH A;  4FXK C;  1VMC A;  3BDL A;  1D5Z C;  5IGG A;  3BVZ A;  3NQT A;  1F9R A;  1QE6 A;  2HDM A;  2EPB A;  1K8O A;  5C4Z A;  2VB2 X;  3VYU A;  4RH6 A;  3C3L A;  1I4Q A;  1HUM A;  5EBC A;  2O5J C;  1Z7T A;  1QCB D;  4DA2 A;  1OXV A;  2L9H A;  1HTP A;  3NXW A;  4DFA A;  2C9O A;  1DJR D;  4CHT B;  4OO1 I;  1F2M A;  5DEH A;  1WTQ A;  4X3S A;  2FHT A;  1Q1B A;  2TSS A;  4XT1 B;  3IKJ A;  1HRJ A;  4CBV A;  3H0G B;  4MN3 A;  2F0H A;  3EQL C;  3C1E A;  4IN3 A;  3GV6 A;  1EQV A;  1KDC A;  4DK1 A;  3SEB A;  1TWC B;  5CV8 A;  3I72 A;  4BA1 I;  2AUJ D;  5DM7 3;  4IUR A;  3DUZ A;  1NR4 A;  4XQQ A;  4G7H C;  3K5O A;  2EY1 A;  1EEF D;  1EY5 A;  1SE2 A;  2D62 A;  4FXG C;  3PUW A;  2CQA A;  1G2S A;  5FLX L;  3PIP 3;  2IT1 A;  3SK8 A;  1PLF A;  1VMP A;  1ESF A;  5FKA C;  3OW7 A;  3L9A X;  1LAB A;  5C4H A;  1PTO B;  4IFD H;  1SJH D;  2X6G A;  1SE3 A;  2XSC A;  1I4G A;  5FLX E;  3BYT B;  5EKL A;  3OWE B;  3S1Q B;  5T1G A;  1RCV D;  1ET9 A;  3C2P A;  1T5X D;  1PTO D;  3KUP A;  2IWH A;  4FF3 A;  3HOU B;  1LTT D;  1CFM A;  1O78 A;  3K5L A;  2MJ8 A;  2F0J A;  1JR0 D;  1B9M A;  1U9R A;  1QJO A;  2WAQ B;  5E3F A;  2EY6 A;  1CZW A;  4DF7 A;  5IIF A;  3DMU A;  1AP0 A;  1ENA A;  2BCO A;  1CTM A;  3E6Z X;  2F1M A;  4XYO A;  4Y7N B;  2F0Q A;  3IL8 A;  3VYR A;  2R92 B;  1GHJ A;  4XIG S;  5M9O A;  4IUV A;  1SFO B;  2EYP A;  1BCP B;  1HPC A;  4L8J A;  5C0X G;  4ULL A;  1F2Y A;  1LO5 D;  1EY4 A;  2A69 D;  1STN A;  1BCP D;  1YNN C;  3ND8 A;  5M5X B;  1EL0 A;  1K8M A;  2QEJ C;  2F0D A;  4H7B A;  5ELD A;  2AUK A;  3T53 B;  4G4K A;  5BN3 A;  4DAV A;  4RGT A;  5JOB A;  1QIL A;  3MZ5 A;  2M00 A;  2RDH A;  1SND A;  4OO1 G;  4FNF A;  1GUO A;  3J7A F;  1ENC A;  2XRQ D;  2B2U C;  1TQO A;  2A6H D;  2MHV A;  5F2D A;  4LAA A;  1I4H A;  1IYU A;  2NVY B;  4KY6 A;  1A3T A;  2VNU D;  3PUV A;  2B2T C;  3A8I E;  3L3O C;  2KCN A;  5D3I B;  3Q24 A;  2JA5 B;  4K8I A;  5IOC A;  3OMG A;  2G9D A;  2I07 B;  1SNQ A;  5KNC A;  1A2T A;  4MHE A;  3WDN A;  3LX0 A;  4DAY A;  1BUV T;  1Q90 A;  2NWG A;  3HGB A;  1HCZ A;  3T13 A;  5BN4 A;  1IHZ A;  4I7Z C;  2AWO A;  5CGK A;  3K57 A;  3H94 A;  1YNJ D;  2DY8 A;  2J4X A;  1IYV A;  4ZKB B;  2Z8L A;  3G6J B;  3H6M A;  4U68 A;  2IPK D;  2BDO A;  5J39 A;  2C5C A;  3GO5 A;  2A6E C;  4LJZ C;  1CK1 A;  3QOJ A;  2ENB A;  5DM6 3;  1SE4 A;  3GTP B;  2E75 C;  3VR3 A;  2F0V A;  4C3J G;  2PZW A;  2K05 A;  1M4V A;  2WAC A;  4RFB A;  1O7L A;  3K7A B;  5C44 B;  4FP5 D;  4QMG A;  2K7V A;  1SYD A;  1V1P B;  1QNU A;  3KF8 A;  1CA6 A;  3PUY A;  4F7X A;  1PRT C;  1FD7 D;  1F2L A;  2B8G A;  4WJW A;  1TS4 A;  5CYU A;  1EOT A;  5A35 A;  1EEI D;  1H9J A;  4U67 3;  3DXJ C;  5EJW A;  5C3W A;  3HOX B;  4FYD A;  3HOY B;  5CC4 A;  4A3I B;  5I2Y A;  1I6V C;  1GUS A;  4NW2 A;  5J1Z A;  3CRK C;  2E2H B;  3NTH A;  4A3K B;  3PO2 B;  1ZKO A;  1F9S A;  4AYB B;  2GA4 B;  1V43 A;  4K2K A;  3JAM L;  2V4D A;  4O42 A;  2EJM A;  3SDZ A;  2XWB B;  3F2U A;  4BBR B;  3S16 B;  4ABN A;  5CBE E;  3EVQ A;  1IL8 A;  1SEB D;  3FRP B;  4DXG A;  1GOZ A;  2FMM A;  3E0J A;  1HHV A;  4N9T A;  4G7O C;  4OIJ A;  4XQJ A;  3PUX A;  2R7Z B;  5DAU A;  4OL7 A;  3CU7 A;  3A55 A;  5KEE A;  3BYY B;  5IT9 E;  3AU7 A;  3NSW A;  3BDC A;  1ML0 D;  1STB A;  3RZD B;  1WTR A;  2RSN A;  5I6Y A;  5EQ0 A;  2B39 A;  3I91 A;  1SBB B;  1JOQ A;  3QG1 A;  4UDU C;  5G3L F;  3OMC A;  4N9P A;  4A3B B;  4QUF A;  3P75 A;  1DYQ A;  2JA8 B;  2D2C C;  5D3D A;  4NDX A;  4C1N I;  5E4W C;  4CJ0 B;  3I70 A;  4ZLT F;  2F03 A;  1TWH B;  2I46 A;  1SNC A;  3C1F A;  2PZT A;  4JBW A;  2ICE C;  1RKN A;  5C5M A;  1F9Q A;  4KY5 A;  2LY7 A;  2SNM A;  4IUU A;  4XQN A;  5FO9 B;  2JEA I;  2EYM A;  4A3M B;  2VUM B;  1OXS C;  2D9U A;  2NN6 H;  1FNW A;  3D4W A;  1GUT A;  4JK1 C;  4A3D B;  2VB3 X;  1II3 A;  1K83 B;  3FKI B;  1JWS D;  2F0L A;  1VDZ A;  1Y8O B;  2EXZ A;  3NWT A;  2OF1 A;  4MIU A;  3A8J E;  4R8N A;  1H9K A;  3K0Y A;  4ZUJ A;  3HEJ A;  3S1R B;  3S1M B;  1Y8P B;  3A54 A;  4IUP A;  4ZK9 B;  3NWS A;  1SYF A;  5EBD A;  4ILW A;  1WD1 A;  2VXW A;  2O5I C;  1IKM A;  1EU4 A;  2IJ0 A;  2R61 A;  3TZD A;  3QJY A;  3A56 A;  1SSO A;  3SVM A;  3V96 A;  2KOL A;  1ILQ A;  1HUN A;  1RDP D;  3OIQ A;  1C4Q A;  2XRS D;  4J6H A;  3FVQ A;  4C3J B;  2X69 A;  3CRL C;  3N52 A;  4HMI A;  4S3S A;  3A8K E;  1I3Q B;  1PTO C;  4KJO A;  1SYE A;  5IGE A;  4TRD A;  3FEW X;  3QWN A;  2E74 C;  2K5D A;  4IFD I;  3MXU A;  1PZJ D;  1PFM A;  5BN5 A;  4Q5V A;  3A7A B;  4ZYS A;  1PXU A;  1QWY A;  3P1H A;  1LLR D;  5JVH 3;  3U9S A;  2F0O A;  3HG9 A;  2B63 B;  4RCO A;  1EYD A;  2FFK B;  1SYG A;  2PMZ B;  2RA4 A;  3DWP A;  3BS1 A;  3LNN A;  2K32 A;  2K04 A;  1ESR A;  1X3P A;  3PIO 3;  3BDO A;  1SNO A;  1VF5 C;  3R93 A;  3ERO A;  2F0M A;  1ROD A;  3SE0 A;  5JPN C;  3KLS X;  3NE5 B;  1XYI A;  1LT5 D;  3NUC A;  4RKB A;  5EPK A;  3SXH A;  3T16 A;  1TWA B;  4ZUI A;  4KK7 A;  5KND A;  3WOF A;  1DOK A;  2OEO A;  1Q8I A;  4BY1 B;  3GP7 A;  3LWU A;  2EJF C;  1J9O A;  1B53 A;  2PNR C;  1STH A;  2Y0S B;  3PMF A;  1PMR A;  2Q8R E;  1JIC A;  2IW3 A;  2RDG A;  4KKT A;  1KNA A;  4K6D A;  5FO7 B;  1D1K A;  1S4Z A;  4J1M A;  1FNU A;  2F0E A;  2N88 A;  1D5M C;  1TU2 B;  2JA7 B;  1I50 B;  3QIA A;  1CT1 D;  4NMZ A;  1B44 D;  3GTO B;  5K36 H;  1MD2 D;  4HAE A;  2PZU A;  2K5Q A;  1WCM B;  2HCI A;  2F3V A;  3DWA A;  5CV9 A;  4ZAI A;  4IUN A;  3S2D B;  4RHR A;  4IQZ A;  1E0B A;  4IFD J;  2B2V A;  3MA2 B;  3H3V C;  4KV6 A;  4C3I G;  2PPB C;  2A68 C;  2B2W C;  1I4R A;  4K8J A;  4EQN A;  3S2H B;  1BO0 A;  1JOK A;  1WD0 A;  3VR4 A;  3J7A V;  2JP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...