4LUZA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luzA00
1KRSA 5GROA 1EYGA 4A3BG 5GAGC 2FXQA 5M5XH 4B3TL 1DGSA 2BH2A 1HZBA 3H3VI 4Y52H 2DUDA 3G48A 1UEBA 1I50H 3T1HQ 1GVPA 4OWXB 1CKOA 3AYHB 4LF7L 4PZ6A 3CAMA 4BA2I 1X56A 1Y1WH 3GTOH 3M4QA 4HJ8A 1JT8A 5M3FG 5GADC 2D62A 4PMWA 1VQBA 4YCUA 4GLVB 2PI2A 4MZ9A 4R4TA 3HOXG 1OXTA 2IY5B 4A3EH 1HR0L 3PUYA 1SMXA 1JE5A 1FL0A 1WYDA 1TWFH 2K52A 2NZHA 3BJUA 4BY1H 1N32Q 3NENA 2D0PA 1KL9A 1PHJA 4DR1Q 3JC66 3CPWA 1YHBA 1PFSA 1VQOA 5C3EH 4OX9L 3GTQH 3CPFA 1IZ6A 4AQYL 1NMGA 4LWCA 1RIPA 3KLWA 4JI1Q 1HNXL 3EBEA 4JI6Q 2KENA 4IPDA 1VQIA 1XNQQ 5JJLA 1E1OA 4GOPB 3HOZH 1AE2A 3K8AA 5C0XJ 4DR2L 3PUZA 1UWVA 3CF5A 4L5SA 1S72A 4LUOA 1VQPA 1N34Q 2BA1A 2K50A 1Y1WG 1XJVA 3I4MG 1PVOA 2IT1A 5FLXc 1GKHA 3RNUA 4RG1A 5GQOA 2R6GA 1N8RC 3JAMc 3TS2A 2UXCQ 3WWVA 1HNWL 4B3MQ 2JK8A 3S15H 2VQEQ 1QVFA 2R7FA 4BY1G 4DV1Q 1YNXA 3G6EA 4HJ9A 1N36Q 1IBLL 4UPAA 2WAQE 3D31A 5IP9H 1M90C 4UY8C 5AJ3Q 1KRTA 3GTJH 4DR6Q 4BBSH 4GLXA 1EFWA 2A8VA 2CQOA 4DV0Q 4DV4L 2PNHA 2WFWA 5C4XH 1K8GA 3M7NA 3RN2A 1W3SA 2OTLA 1H95A 3LGJA 4JI3L 4IFDJ 4APVA 3CCQA 1UE1A 2LXJA 4IO9A 4DV2Q 2Q2IA 2PI2E 4NXNQ 3HOZG 1JB7A 1EQQA 1GM5A 5IP7H 1N33L 5M3MG 1PH1A 1WCMH 1SE8A 1OTCA 4JI0L 1P16A 4P75A 3ULJA 4X64L 4B3SL 4JI4Q 1XNRL 1C0AA 2ID0A 3HOWH 1X3EA 5HY6A 1U0LA 4DUZL 2V1CC 1OXUA 1VQCA 4DPGA 2N3SA 1I94L 1YJWA 1G51A 4NB3A 2VZAA 3F2DA 3NBHB 4JI5Q 2R92H 2NN6G 4OO1I 2ZTDA 2RHQB 5C0XG 2ZM6Q 1X9NA 5IYBH 4LF8L 1VCIA 4B3RQ 1WFQA 3GO5A 2MQHA 1MIUA 1WI5A 3J7ZC 3RZOH 2UU9L 4BBSG 2I5HA 1Y1VH 4IPGA 3STBC 4C3HH 3CP0A 5H1SE 5M5YH 4DV5L 4A93H 4BBRH 1V1QA 2E5LL 3F8TA 3PO3H 4A3FH 1GD7A 3HKZG 3ZJYC 4DV6L 4X62Q 3ULPA 4ALPA 4LF6L 3GTLH 1K3RA 4DR7Q 2I5MX 1XPOA 4R4IA 3CD6A 1XMOL 3CXCA 4BY7H 4QIWE 1K0RA 4GN4B 1FJGL 1KAWA 1CKMA 5IP7G 4XTCS 2E2JH 2F3IA 1VQGA 2K4KA 5IWAQ 1B70B 1PH6A 1EUJA 2GVBA 2WB1E 2MNAA 4DR4L 4YWLA 1S40A 1W2BA 2JA6H 1L1OA 1Q8KA 1SRUA 2QEXA 3U58A 1VQMA 3HOWG 1K83H 4LF4L 1K9MC 2AHOB 5J3BA 4JI2L 2VQFQ 2VW9A 2NVYH 3M85A 5M3FH 3FKIG 4KLKA 2JA7H 4GN3B 3J81j 5IYBG 4KHPL 3AFPA 3J80i 4YY3Q 2K75A 1FVIA 4X66L 5FJ8H 1NBWA 3H0GH 1MJEA 1HNZQ 3J7A5 2UUAQ 4K0KL 4DAMA 1Q1EA 3PCOB 4BBRG 4DV7Q 2ATWA 3PO3G 1AE3A 3KOJA 3E9HA 4A3FG 3S17H 1CSQA 4JYAQ 4DR5L 3J81c 1PYBA 4DV3Q 1NJIC 4RMFA 2NN6I 2WP8J 1TWCH 3STBD 1B8AA 2YV5A 4JOIC 4BY7G 4HIDA 1SLJA 3EIVA 2OWOA 3HOUG 2UXBQ 4GOPC 3PIOA 2F4VQ 2UXDL 3H15A 5IYDG 2HHHL 2JA6G 2IX1A 1YHQA 4LFAL 1E24A 3M9BA 4P74A 3T1HL 2UUBQ 4C3IH 2PMZE 3PSIA 3I4MH 5BR8Q 1NY4A 4X65L 2R7ZG 4GKKL 1P8LA 1XMQL 4MTNA 2JA7G 3I2ZA 3CCJA 5LMNQ 2RF4A 2YTYA 4KI0A 1A62A 5JEAJ 3S1NH 1AH9A 1OXSC 3UE1A 4LF5Q 5FJ8G 1KXLA 1WJJA 3H0GG 5LMUL 4B3TQ 3TRZA 2JQOA 3OYYA 2QA4A 4NXML 1VQAA 2NVTH 3GDEA 4JI7L 4DR1L 2EXDA 4POGA 3CC2A 3KDFA 4YCVA 4LF7Q 2K5HA 4R4OA 4BA1I 1NTGA 2LSSA 4IOCA 3PF5A 1R9TH 1HZCA 2E2HH 4A3MG 4GKJL 1LUZA 1RL2A 3T1YL 4GNXA 1VQJA 2HIVA 4R1JA 5M3MH 3OW2A 1HR0Q 3RR5A 4HJAA 2JA5H 2HIXA 2PQAA 3KF8B 3S1QH 1ASZA 4IJHA 1VQNA 2GN5A 1M1KC 3VDYA 4X6AH 2N8NA 1FGUA 2R7DA 4JI8L 1KIXA 4OX9Q 3KF6A 4AQYQ 2F52A 5IT9c 1PH7A 1YVCA 4JBJA 2H5XA 1HNXQ 4LNQA 1U5KA 2BH8A 1UE5A 2VQEL 3UDGA 4DK6C 4DKAC 1VQDA 3CW2C 2AMCB 4DR2Q 3K7AH 4A3KH 1YEZA 4LF9L 2Q2HA 2AKWB 5ELNA 2KCTA 1CSPA 2RHSB 4IPCA 1I5FA 2HT1A 3ICEA 4GLAC 4IPHA 4C3JH 1HNWQ 1Q12A 4MNOA 3U4VA 1E22A 4AYBE 4QGUA 2JA5G 4DUYL 1IBLQ 4YHHL 1TXYA 1SR3A 1L1OB 1VQEA 2L15A 1HJPA 3BZKA 3TS0A 1QVGA 4HIOA 2C35B 2Z6KA 1X55A 5C4JH 2VNUD 3TREA 1L2FA 5K36G 4DV4Q 1Q1BA 2Z0SA 4EQ5A 3JAMi 5JJKA 3HKZE 3FKIH 5IYCH 4JV5L 4QL5A 4DR3L 4JI3Q 3OTOQ 2YU9H 1YZ6A 1PH3A 1OXXK 2OQKA 3K0XA 4A3KG 1JJGA 4QY7A 4OWWB 4OXPA 5C44H 1Q86C 2VUMG 3CMAA 1N33Q 3GTKH 3S2DH 1A0IA 1VQFA 4LFCL 1KQSA 3K7UC 4X64Q 1KD1C 1Q46A 4B3SQ 1XNRQ 1IXRA 4C2MH 4L5RC 2IHEA 4ME3A 4OWTB 3TQYA 4DUZQ 1B7YB 1NMFA 3A5ZB 2UUCL 2B29A 3HOUH 4O2DA 5LMNW 1I94Q 1J6QA 4LFBL 1PYSB 1LM0A 1J5EL 4R4QA 4JG2A 3CCSA 4LF8Q 3G71A 5IYDH 5DLQE 3KFUA 1C9OA 4GS3A 4A3JG 4LUVA 2UU9Q 4LUZA 4DV5Q 1PA6A 2Y0SG 4IFDG 2D0OA 2B3GA 4P72A 1YI2A 4JCVE 2E5LQ 2R7ZH 1QZHA 4DV6Q 1IBKL 5IYCG 3W5OA 4A75A 3S1RH 4EX5A 4LF6Q 1SROA 2K5VA 1YITA 2JA8H 4GN5A 1XMOQ 3CCRA 2ZJRA 5C44G 2CCZA 1FJGQ 1IBML 2MO1A 1NE3A 3B6YA 4OONA 4QJFA 4UP9A 2YTXA 3DLLA 3ER0A 4DR4Q 2AWNA 2HQLA 2LXKA 3RLFA 3G4SA 3DM3A 1YJ9A 2Q2UA 4JYAL 2XTIA 3KDFB 1PH5A 4DNIA 4Y7NH 2B63H 5C0XI 2MFIA 4LF4Q 3M4OH 3I4OA 4JI2Q 3HOVH 4A3MH 4TQUS 3TEHB 4GNXB 4A3CH 4KHPQ 3S24A 1VQ8A 2R93H 1TWAH 3HOYH 4R4CA 3NEMA 4FDBA 4X66Q 2EIFA 3RLOA 4A3LG 1ASYA 3S16H 2PQAB 3AQQA 1PH9A 4K0KQ 2YTVA 4A3IH 3KJPA 3I4NG 3A74A 3L0OA 3CMEA 4A76A 3KF6B 4H02A 4DR5Q 3Q8DA 3CC4A 2ZJPA 1QUQA 4NPSA 1TWGH 5LMNL 1G6PA 4PG3A 5IY0A 2Q2TA 2JA8G 1CKNA 4LF5L 3PO2H 3PF4A 3CCVA 1YJNA 1JJCB 3PUWA 1N32L 5M5WH 2K14A 2UXDQ 4BXXH 2BA0A 4HIMA 2IHFA 1K73C 1CUKA 1X54A 3D0FA 3BU2A 2HHHQ 2N78A 4LFAQ 3GTGH 4IFDI 3S1MH 2B63G 3M3YH 1XTDA 3K81C 3MXNB 3J81i 1TWHH 2KCMA 4X65Q 4GKKQ 3F2BA 4JI1L 4HJ7A 1XMQQ 3HOVG 4JI6L 5JJIA 1SFOH 1XNQL 4JBMA 3UDXA 4A3CG 1MKHA 3UDIA 3PGZA 1EWIA 3CCUA 1E7ZA 3IRBA 4KHZA 3HOYG 3EN2A 2A19A 5ELOA 2R93G 1QVCA 1L1OC 5LMUQ 3HKSA 1T9HA 1N34L 4JBWA 3FHWA 1OXVA 2ZTEA 4A3IG 2JJQA 4NXMQ 1IL2A 4JI7Q 2VL6A 4IOAA 1UE6A 2UXCL 4A3GH 4P71A 1VQ6A 4IJLA 1VQ5A 4B3ML 3RN5A 2N49A 4WJ3M 1K8AC 3PO2G 3F2CA 1N9WA 4DV1L 1VQ9A 2ALYB 1VQ4A 1N36L 5HGQA 4BXXG 2AWOA 3BZCA 3T1YQ 4GKJQ 1D8LA 5AJ3L 2VUMH 2CFMA 1Z9FA 2EQSA 1JJ2A 4DR6L 4OO1G 1L0WA 1PH2A 3CQZH 1KC8C 1E1TA 4PZ7A 2ES2A 3GD7A 2GVAA 4DV0L 1XPUA 4HJ5A 5JEAG 3CCMA 1KHIA 1BBWA 4JI8Q 4TVAB 4NXNL 4DV2L 1Z47A 2KBNA 1VQKA 1LTLA 2I5LX 2OCEA 3AFQA 3F1ZA 1PH8A 2I0QA 2A1AA 2NZOA 4A3EG 2QGQA 4YCWA 5GAEC 1EQRA 1I6HH 4UP7A 4JI4L 3S14H 5GAHC 4A3JH 4A3DH 1Q7YC 3L2PA 1G291 4LF9Q 1Y14B 4A3GG 5C3EG 1E3PA 3H3VH 3CCLA 4L5TA 4WJ4A 2DGYA 1Q81C 3E9IA 3FP9A 4JI5L 3UDFA 1JMCA 1SN8A 2NVXH 3ULLA 2JE6I 1O7IA 3I55A 2ZM6L 4DAYB 1VQ7A 3OTOL 1GO3E 4JOIA 3CC7A 2WAQG 2IX0A 4GOPA 4B3RL 3A0JA 3MEFA 3PUXA 4JI0Q 2CWAA 4LW1A 1V9PA 2ZJQA 3L7ZC 3S2HH 4DUYQ 4YHHQ 4X62L 3UE0A 1VS0A 1XPRA 2ZTCA 4DR7L 4JC0A 2VY3A 1V43A 1EIFA 1X3FA 3SGIA 2Y0SE 3U50C 4GNXC 1X6OA 2E8GA 4L5QA 4A4IA 1HZAA 1LYLA 3PIPA 2JEBI 3J80c 4JV5Q 4DK3C 4DR3Q 5EAYA 2MO0A 5IWAL 4AYBG 3PV0A 2OQ0A 3A5UA 5IP9G 4JBKA 4A3DG 2CWPA 4A3LH 1IYJB 4PZ8A 4AH6A 4POFA 1PH4A 1D7QA 1VQHA 4P73A 3I7FA 4LFCQ 1HH2P 3I4NH 2OTJA 2VQFL 5C4XG 1QUQB 1BBUA 1BKBA 2JA9A 4UP8A 3E0EA 1X3GA 5FLMH 3I56A 1VQLA 1X65A 2VS1A 1CKNB 4YY3L 2UUCQ 1EIYB 4A3BH 3W1GA 1HNZL 1EOVA 2UUAL 4LFBQ 1I3QH 3GTPH 1YIJA 4HIKA 2YYZA 1WCMG 4DV7L 1HR0W 1BVSA 1J5EQ 1A63A 4J15A 3M4PA 1WOCA 3GTMH 3KYHC 5E7NA 2KHJA 3U4ZA 4DV3L 4XIGS 1MJCA 1UE7A 1C7YA 3ERSX 1A8VA 2UXBL 2K5NA 3KJOA 4AIMA 3RLNA 1IBKQ 2R92G 1YBYA 1S3OA 3K80C 1YHAA 2F4VL 2ASBA 2WB1G 4O0AA 3HOXH 5IE8A 1PV4A 3AEVA 3PUVA 4QQBX 3NELA 3HFZB 1Q82C 4YWKA 1QZGA 3CCEA 1IBMQ 2JEAI 2XGTA 1Y1VG 2KHIA 2UUBL 2RCNA 2E2IH 2Z6KC 5BR8L 4A93G 4YWMA 3W1BA 3RZDH 2CKZB 2NVQH 5FLMG 1HZ9A
chains in the Genus database with same CATH superfamily
5EKIA 1G91A 1DOMA 2EJGC 4A3BG 4L63B 5M5XH 3H3VI 4HMJA 1ET6A 1I50H 1GVPA 2LKVA 4HSPA 4I7AA 3AYHB 4MIUA 2O5IC 4DN4M 5IOCA 5GADC 2D62A 4PMWA 1VQBA 5E4WC 4K2KA 1OXTA 4QIWB 1HR0L 5JOBA 3NENA 1KL9A 2F03A 5C3EH 2Z1CA 1G2TA 3I4NB 3T53B 4AQYL 4JI1Q 1HNXL 3EBEA 4JI6Q 1XNQQ 5JJLA 1VQIA 2AUKA 3K8AA 3DWAA 3SHLA 1RD9D 3CF5A 1LTBD 4LUOA 5FLXL 3A7LA 5FO8B 1I6VC 1TKWB 3JAML 1Y1WG 3I4MG 4ID6A 5FLXc 4DFAA 5GQOA 2R6GA 5IT9L 3JAMc 2F0GA 4JVZA 2UXCQ 3MC0B 1YNJD 2QCPX 2R7FA 3HOXB 1IBLL 2WAQE 5AJ3Q 1KRTA 3GTJH 2QDLA 1LTAD 4ODGA 1VMCA 4J1MA 1IYUA 1CQFA 4KY5A 2A8VA 1SJHD 2CQOA 4DV4L 2B2TA 3K59A 2F0VA 2WFWA 1K8GA 3M7NA 3RN2A 3OW7A 4JI3L 4APVA 2LXJA 4IO9A 3HOZG 1UAPA 2D9UA 1SYCA 1PH1A 1SE8A 5AFWA 1P16A 1RTNA 3ULJA 4ZK9B 4B3SL 4UDUC 2EOTA 1X3EA 5HY6A 2LS01 4IN3A 1OXUA 4DPGA 1F9PA 4JI5Q 3NBHB 4HR7B 2NN6G 2RHQB 2ZM6Q 5IYBH 5I6YA 1SNQA 3GO5A 2MQHA 1MIUA 4C3HH 3PO3H 4X3SA 3VYRA 3F8TA 4A3FH 3H3VC 4K14A 3HKZG 4X62Q 4LF6L 4ALPA 1K3RA 2K1BA 2I5MX 1XPOA 4R4IA 4BY7H 4GN4B 5A35A 1KAWA 1CKMA 5IP7G 4XTCS 2R3ZA 3BVMA 1VQGA 2EYFA 5EPKA 1HFNA 4YWLA 1W2BA 1Q8KA 3D4DA 2QEXA 1CTMA 1SDFA 4CKEA 2NVYH 4H13C 4KLKA 1BCPF 4QF4A 3AFPA 3J80i 3S15B 1NBWA 4G7ZC 2UUAQ 4K0KL 4DAMA 5EQ0A 3S17H 1B1ZA 2ATWA 3E9HA 4JYAQ 4HMIA 1HTLD 4RMFA 2NN6I 2WP8J 1TWCH 4XQJA 4RAUC 4JOIC 4X3KA 4HIDA 1SLJA 3MFGA 2UXBQ 4DU9A 4ZAIA 1I4XA 2F4VQ 1RTOA 1BCPD 4JPBW 1JR0D 4KK7A 2UUBQ 4C3IH 2PMZE 2F3VA 2E75C 5FK9C 5BR8Q 1P8LA 1XMQL 3HOWB 2JSOA 2RF4A 2YTYA 3P20A 1JOQA 1OXSC 5T1GA 5FJ8G 3SK6A 3TP7A 1KXLA 3H0GG 3OIPA 3HP3A 3TRZA 1A3UA 3OYYA 2B39A 3PIP3 1ONLA 4JI7L 4POGA 1Y1VB 1AW7A 4HEDA 5JPMC 2F0DA 5C3XA 5JAVA 4KHVA 1HZCA 2DY7A 2E2HH 4A3MG 4GKJL 1RL2A 1F9SA 5KYLA 2CVRA 3OOCA 4R1JA 3OW2A 1HR0Q 2JA5H 5EGTA 3I90A 1VQNA 4J8QA 2JA6B 3VDYA 4X6AH 2R7DA 2J7ZA 1TY2A 2EY6A 4AQYQ 5M3FB 1KAAA 1PH7A 1YVCA 2F3WA 2XWJB 2JA7B 1H9JA 1HNXQ 2KUMA 4RFBA 2VQEL 5BN5A 4M8AA 5ELBA 1KLUD 1YEZA 4LF9L 2AKWB 3NK9A 3WDNA 1MI2A 3C1FA 4IPHA 4MNOA 4DK0A 4AYBE 4QGUA 4RKBA 1STNA 1IBLQ 3KF8A 1SR3A 4IUQA 3BZKA 1AEXA 3C46A 2M9VA 3NPPA 2Z6KA 1X55A 1CHQD 1AZPA 1G6ZA 5K36G 2F0IA 2DJFC 1LT6D 4YIJA 4DV4Q 2Z0SA 2IWHA 3FKIH 5IYCH 4JV5L 1SYGA 1FNWA 4JI3Q 3OTOQ 4QCLA 2YU9H 1YZ6A 4OGQC 2HQEA 4A3KG 1JJGA 1VQFA 2EYHA 1STAA 4LFCL 2NVTB 3LWUA 1Q46A 4B3SQ 5EKLA 4ME3A 5CR3A 2F0PA 1GUTA 2C5CA 1B7YB 1K28A 3A5ZB 2B29A 4C3JG 4O2DA 3HOUH 1R9TB 3TZDA 1SYEA 2QEJC 2F0MA 2F0LA 2ZXRA 3D8GA 4R4QA 2JN4A 3P75A 5DLQE 5M3MB 1NSNS 2DN8A 5BN4A 2D0OA 4P72A 4S3SA 3W5OA 3HGBA 4LF6Q 1JC7A 3K5MA 3J7AF 4DAPA 2CCZA 4OHJA 4OONA 2YTXA 2KOLA 5DM63 3K7AB 2LXKA 2XTIA 3L3OC 2TMPA 1PH5A 2B63H 3CQZB 2MFIA 3A8KE 1EYCA 3DUZA 4A3CH 2PPBC 4GZYC 3C2PA 1Y8NB 2MPMA 3NEMA 3HRZC 1ASYA 4Q5VA 4K0KQ 3KBXA 2YTVA 2RQXA 4QMGA 3CMEA 4H02A 1G6PA 3K0YA 5C4JB 3ND9A 4PG3A 2Q2TA 4G7HC 1IW7C 3CCVA 1CHPD 3EFXD 3T16A 2IHFA 3S2DB 1NR4A 5C44B 3BU2A 3GTKB 3S1MH 3M3YH 4HN7A 5LL6X 1ZEQX 2QF7A 3K81C 3NWSA 1VMPA 1EWCA 3F2BA 1XMQQ 5JJIA 2O2LD 2SOBA 1EL0A 3PGZA 1EWIA 2R93G 1E7ZA 3HOYG 3EN2A 1ESFA 2FHTA 2VXWA 1PZID 1E2ZA 3QWNA 3HKSA 1L1OC 1B3QA 1OXVA 4JI7Q 1H9MA 2F0JA 3FVQA 3HEJA 2VL6A 4IOAA 1BNZA 4IURA 1CM9A 1FGBD 3PO2G 1T5EA 1BBXC 3F2CA 4FF3A 2EYOA 4GKJQ 2JA8B 4BXXG 3BZCA 3QG1A 3MXGA 3NSWA 2IX3A 1STEA 1LV9A 2CFMA 3BVZA 4DV0L 1EU3A 3TZUA 3CCMA 4PNYA 4TVAB 4NXNL 1VQKA 1PH8A 3F1ZA 4RGNA 2I0QA 1RKNA 1ESRA 1PFMA 3C1EA 1ILQA 4JI4L 5J1ZA 1DCZA 2NBFA 2F0OA 1Z7TA 3K6OA 3I3CA 4A3DH 3S16B 1Q7YC 4LF9Q 4A3GG 3OIQA 5C3EG 4WJ4A 2DGYA 3E9IA 1K8OA 1I4QA 3ULLA 1GO3E 4JOIA 2WAQG 2IX0A 5BN3A 4B3RL 3A0JA 4RGTA 1HUNA 4XXEA 4ILWA 1V9PA 5EBDA 1WTXA 2EXZA 1QJOA 3QOLA 4WRDA 3GTGB 3CRKC 1KNEA 2ZTCA 5CC4A 4JC0A 1GOZA 2X6LA 1TWHB 4RWSC 3U50C 4GNXC 2NZ1D 3LWEA 1SFOB 4JV5Q 3Q6SA 1GHJA 3PV0A 5COYA 2QILA 1CI3M 2NB0A 1DOKA 4A3LH 2CWPA 3DWQA 4PZ8A 4POFA 5IGDA 1VQHA 4LFCQ 2A74C 3I4NH 4RCOA 1BBUA 2XNAC 4UP8A 3I91A 4DGZA 1SNCA 1ENAA 3R3OA 1EIYB 5KYIA 1YIJA 4HIKA 4J15A 3M4PA 5E7NA 2KHJA 1MBYA 1WTVA 1B4OA 4UHVA 2K5NA 1YBYA 2HUGA 2ASBA 3HS0C 3NWTA 4O0AA 3HOXH 1PV4A 3AEVA 2LFNA 1ZYRC 1I6HB 5JVG3 3VR6A 2M2LA 2EJFC 4YWMA 2KECA 2Q8TA 3I70A 1YNXA 4M1UB 2G9DA 1HZ9A 2FMCA 1BCPB 5GROA 1EYGA 4I65A 2E76C 1ZKOA 3MHBA 3T1HQ 5LHY1 1X56A 3H6MA 1JT8A 4IQZA 1SAPA 2PI2A 1B53A 1CT1D 1B9NA 3PUYA 1SE2A 2F4IA 5K5PA 1WTQA 3BJUA 1T5XD 2K5WA 3OSOA 1EEFD 1PHJA 4ULLA 1PFSA 3CPFA 2ZT9C 1S5CD 2BE5D 1C48A 4CDFC 2KENA 5C0XJ 2PZTA 1TT2A 1UWVA 2K5QA 4A3BB 2E2JB 3GTPB 1S72A 1VQPA 4P2CB 4QUFA 2BA1A 2XIWA 1PVOA 1STHA 4RG1A 3BDCA 3CRLC 1HNWL 1GUNA 1SNOA 5J22A 3S15H 1EEID 3KK7A 4BY1G 2NTTA 3D4WA 4UY8C 1F2YA 1F9QA 2E2IB 3MXUA 4DV0Q 4KKSA 1M4VA 2PNHA 5KRUA 1W3SA 3LGJA 2NVQB 1WD1A 3BYYB 4NXNQ 2M00A 1KNAA 3OPOA 1JB7A 2ICIA 5NUCA 1N33L 2ZXPA 2WINB 4JI0L 1WTPA 5CMDA 4X64L 4JI4Q 1XNRL 1C0AA 3UI2A 4FVMA 3AU7A 3HOWH 1U0LA 2V1CC 1Y1WB 1YJWA 4OELB 1G51A 1QOHA 2VZAA 2C9OA 3F2DA 1GJXA 5C0XG 1X9NA 1C4QA 4B3RQ 2H4OA 1WI5A 3J7ZC 4BBSG 2I5HA 1TWFB 1Y1VH 4IPGA 3STBC 3CP0A 5M5YH 1CFMA 2B2YC 2E5LL 1GD7A 3ZJYC 1J9OA 3AB9A 3ULPA 3GTQB 1U4RA 1SXTA 5EPJA 4PMBA 1FJGL 1D1KA 1HFGA 4K5VA 1R4PB 1GUOA 2K4KA 2L11A 1B70B 3HOZB 1MD2D 2WB1E 2MNAA 3DXJC 2JA6H 1L1OA 4HSVA 3U58A 1VQMA 2L0CA 1EQVA 1PDQA 4LF4L 4H0LC 3K5NA 4KD3A 5J3BA 4JI2L 3M85A 5M3FH 3FKIG 5J39A 4GN3B 3J80E 2JA7H 2SDFA 2K7VA 1DONA 2K75A 3BZDB 1MSHA 1FVIA 1IYVA 1MJEA 2F0FA 4G4KA 1LTSD 1Q1EA 4BBRG 2RSOA 1AN8A 3J81c 3FPUB 1LTRD 1NJIC 3J7YW 3STBD 1B8AA 2MUYA 1G8ZD 1F2LA 5FO7B 3HOUG 3HKZB 4KKTA 4KJOA 4GOPC 5KNCA 4OIKA 1L0XB 3H15A 2F0TA 2HHHL 4EVOA 4ZKCB 3SDZA 1E24A 3QOJA 3M9BA 1YNJC 4Z9CB 1JOKA 1PMRA 3T51B 3TSSA 1AP0A 3PSIA 4GKKL 3WOFA 1EWHA 3CCJA 5LMNQ 1A62A 4LAAA 1WJJA 2NVTH 1PRTC 2N55A 1PTOC 4DR1L 1LLRD 4A93B 4YCVA 1PFBA 4R4OA 4IOCA 3PF5A 1R9TH 3GTLB 3NTHA 5D3IB 1WD0A 4GNXA 4R8NA 5M3MH 3RR5A 3TDQA 5I6WA 4O1NA 1GXDC 1PXUA 3S1QH 1PRTF 1PTOF 4JI8L 2DJGC 5IT9c 3PMFA 5D14A 4LNQA 1U5KA 2B8GA 4DKAC 1LTID 4K6LA 2AMCB 3K7AH 3H0GB 1I4GA 2KCTA 2RHSB 1PRTD 4ZYSA 2AQ3B 1PTOD 2J4XA 4N9PA 2L1BA 3C3LA 4GLAC 3VR5A 3NTIA 1HNWQ 1VDZA 2XWBB 4MHEA 4A3MB 2WKCA 4NKLA 4Q0FA 3HG9A 1L1OB 1EZ8A 1VQEA 4TSSA 3TS0A 1QVGA 1VF5C 3QJYA 5C4JH 4IFDH 1L2FA 4C1NK 2K33A 3SK4A 5JJKA 4DR3L 3S1NB 5T1IA 2MHVA 2OQKA 2RVLA 3S2DH 5C44H 3CMAA 1N33Q 3GTKH 1QE6A 3EQLC 1KQSA 4X64Q 1XNRQ 1IXRA 4L5RC 3BDOA 4OWTB 1BCPC 3A55A 1SE3A 1BUVT 1NMFA 3O13A 1PYSB 4HCEA 1J5EL 2OXPA 2WACA 4JG2A 3KFUA 1C9OA 4IZ8A 4GS3A 4QUCA 5FO9B 4FNFA 2E5LQ 2B3GA 4IUPA 4ZUIA 4DK1A 1QZHA 1IBKL 3X3MA 4EX5A 1SROA 5CV7A 1EQTA 4G57A 4DAYA 2JA8H 3CCRA 1FJGQ 1IBML 3B6YA 1LT3D 3DLLA 3ER0A 4A3KB 1PZKD 4DNIA 1EY0A 1JWUD 4LF4Q 4NMZA 1UNSA 3GV3A 3I4OA 4JI2Q 3GQBA 2QKIC 1KLGD 4TQUS 3TEHB 1F77A 5ELCA 4GNXB 4C3JB 1TWAH 2EE1A 3Q22A 2LMCB 1EY5A 3RLOA 4A3LG 3S16H 3AQQA 2NTSA 1PH9A 4EQOA 3I4NG 2EY1A 3MXPA 3CC4A 2SNSA 2ZJPA 1KDBA 2JP1A 2EYPA 1CKNA 4LF5L 2MGSA 4DXFA 1YJNA 3DMUA 2BA0A 3K5OA 1I4RA 1K73C 2HHHQ 3R2TA 3GTGH 3MXNB 1S4ZA 2KVMA 5CV8A 1TWHH 3DEOA 2LY7A 5ELEA 4C2MB 5JEAH 4GKKQ 3HOVG 3SK5A 4XYQA 1SFOH 4RGOS 3UDXA 1MKHA 3PQIA 4KHZA 2A19A 3MWYW 1CK1A 1T9HA 4JBWA 1HRJA 2ZTEA 4A3IG 3TMEA 1UE6A 3FPPA 2B2YA 1VQ6A 3A54A 4IJLA 4B3ML 2R7ZB 4WJ3M 3I8ZA 1K8AC 2BCOA 1U9RA 1TIID 1N9WA 4DV1L 5HGQA 2WIIB 1D8LA 2FMMA 4OO1G 2EQSA 1O7ZA 1E1TA 1XPUA 2GVAA 3VYSA 2OEOA 1KHIA 4JI8Q 1R4QB 4DV2L 2KBNA 3M4OB 2OCEA 5F2DA 4XDXA 1I6HH 2R93B 3HOYB 4XYOA 4A3JH 3U9OA 3VA7A 1G291 1Y14B 1BF4A 1BO0A 1E3PA 2A68C 3IAYA 1EIGA 1TVXA 4L5TA 3H3VH 3L9AX 1V8QA 1Q81C 2JE6I 1O7IA 3I55A 4DAYB 1TWGB 1QILA 3NTKA 3CC7A 1JQYD 4GOPA 4CGYB 3PO2B 3PUXA 5M5WB 1EY6A 1Y69U 2KEDA 3L7ZC 4FF1A 1BXTA 4KY6A 4DR7L 3J80L 2VY3A 2E8GA 1LT5D 1LYLA 2JEBI 1TQOA 3SEBA 3J80c 4DR3Q 5EAYA 5IWAL 3V2TA 1TS3A 2IJ0A 3OWFA 1STYA 2OQ0A 3A5UA 3FEWX 5FOBB 3OWEB 1IYJB 4J6HA 2VQFL 1KTKA 4A3GB 1X65A 3SR1A 1CKNB 2A68D 1EZ6A 3TP5A 4A3BH 3W1GA 1HNZL 1EOVA 2R61A 2B2VC 3GTPH 3IL8A 2EVBA 2YYZA 2WAQB 3D3RA 3RD4A 1J5EQ 1PZJD 2VUMB 2Z6BA 3ERSX 1QWYA 3KJOA 1IBKQ 4AIMA 5KNBA 2Z9HA 4RHSA 1D5MC 3K80C 1HTPA 2WB1G 3PUVA 3NELA 5I4DA 2CW0C 1QZGA 3CCEA 1IBMQ 2XGTA 1Y1VG 2E2IH 1SJED 1LO5D 1HXYD 3W1BA 1DD2A 4B08A 2EDGA 2CKZB 2NVQH 5FLMG 2Y0SB 4KN7C 2SNMA 2NVXB 2FXQA 4B3TL 4RHRA 1V1PA 1HZBA 2Z8LA 2DUDA 2PCFB 4Y52H 3G48A 1UEBA 4UAIA 3S2HB 3NP8A 2EY5A 4LF7L 4PZ6A 3CAMA 2EJMA 1Y1WH 3M4QA 1JB3A 1D1IA 2N88A 4HJ8A 2ZXOA 5M3FG 1LABA 1U4PA 4GLVB 4MZ9A 4DNTB 4ZRZA 2IY5B 4A3EH 1SMXA 3CHBD 2XN9C 1TWFH 2K52A 1WVLA 1B2TA 3M7GA 3JC66 1YHBA 1PYWD 2CW0D 3GTQH 3D6CA 5C6AA 1IZ6A 1TS2A 4XT3B 1NMGA 2KQ3A 2NWGA 5G3LF 2IPKD 4GOPB 1B3AA 3HOZH 3PUZA 4L5SA 2JXMB 1RCVD 5M9OA 2EPBA 1XJVA 2IT1A 1DZ1A 3S9WA 2KA7A 1ILPA 3WWVA 4B3MQ 2NN6H 2VQEQ 4DV1Q 5G3LD 4HJ9A 5IP9H 1M90C 4K5XA 1SSOA 4GLXA 2PMZB 1PRTB 2XVSA 1EFWA 1PTOB 4KJNA 3AMUA 2OTLA 4IFDJ 5C4HA 3CCQA 1NCVA 4DV2Q 2Q2IA 2PI2E 2A69D 1EQQA 1GM5A 5IP7H 5M3MG 4PQXA 2PO4A 1EYDA 2QDBA 4DUZL 1SNMA 3E0JA 2N3SA 3GTOB 1I94L 1LTTD 1A15A 4HAEA 3N6RA 4BY1B 4RGMA 4A93H 2AQ1B 1V1QA 2KEEA 4XT1B 3SK8A 4DV6L 3GTLH 3T4AC 4DR7Q 3CD6A 1XMOL 2Z4IA 5I9PA 4QIWE 1V1OA 1BDOA 1V1PB 5IWAQ 1PH6A 1LTGD 5I2YA 2GVBA 1RJTA 1S40A 2PZWA 1CZWA 4F87A 4WORA 2VQFQ 2VW9A 4RA8A 3DM1A 2E2DC 5IYBG 4CJ2C 4HTHA 4X66L 5FJ8H 4WJWA 4R9WA 3H0GH 3T13A 1HNZQ 3J7A5 4TKOB 2FFKB 4AYBB 4C3HG 1UUPA 2BE5C 3PO3G 3KOJA 4A3FG 5CBAE 4H7BA 4BBSB 2RBMA 2HD3A 4BY7G 5C4XB 3X3NA 5IGFA 2PNRC 3I72A 4MN3A 3PIOA 2OWOA 1IHZA 2UXDL 1GUGA 4CDEC 1WCMB 3NE5B 3FMCA 3D6WA 3I73A 1NY4A 4X65L 4MTNA 1TS5A 3S1NH 4KI0A 2K28A 5JEAJ 1AH9A 1DJRD 3UE1A 2R92B 3FKIB 5LMUL 4B3TQ 1II3A 2JQOA 4NXML 1VQAA 4C56C 3RZOB 4BWGB 4ABNA 4F8MA 3KDFA 2B2UC 2ICEC 4BBRB 4LF7Q 1SYFA 3H91A 2PW5A 2F0KA 3HOUB 1ET9A 2XRQD 4RKLA 2HIVA 3LX0A 1HQMC 4HJAA 4C3IG 4KY7A 1M1KC 2RDGA 1FGUA 1K83B 1KIXA 5A2QE 4ZCKA 3DWPA 1I4PA 2K03A 5C5MA 5IGCA 1C8CA 5K36H 2F52A 4JBJA 2EYLA 1UE5A 5CYUA 3UDGA 2A73B 4B9XA 4CBVA 1VQDA 1HPCA 2NYZD 4A3KH 2B2VA 4NW2A 1O7YA 4K2LA 1CSPA 1SBBB 2RSNA 2D2CC 1I5FA 2HT1A 2EZVA 3ICEA 4C3JH 1Q12A 3E6ZX 1SEBD 3U4VA 4IALA 2JA5G 4YHHL 1TXYA 2K05A 3J7AV 1HJPA 2K01A 4HIOA 1JCKB 3I4MB 2SEBD 3JAMi 1ICFB 3R8BA 3T56B 1MSGA 4QL5A 2HCIA 3Q0AA 2O4XA 1PH3A 3K0XA 5CV6A 5KNDA 4OXPA 1Q86C 3K7UC 1KD1C 4C2MH 2IHEA 3NXWA 1X32A 3TQYA 1Y8PB 3ERQA 4DUZQ 2UUCL 5LMNW 1I94Q 1J6QA 5JVH3 4LFBL 2CHBD 1LM0A 2D5DA 5IYDH 4A3JG 1DXMA 4OEMB 4LUZA 2R7ZH 1F2ZA 1YI2A 4DV6Q 5IGBA 5IYCG 3KBGA 1W6JA 2E74C 3MVVA 1XMOQ 2MO1A 1NE3A 3G7LA 4LK1C 4QJFA 3MTSA 1FNVA 5JJZA 1IL8A 2AWNA 3RLFA 2Q2UA 4JYAL 3QIAA 3KDFB 5C0XI 3M4OH 1SNDA 1STGA 3IKJA 2EYMA 2R93H 1VF7A 3HOYH 3TP8A 4X66Q 3KJPA 1EY4A 1S5ED 3FDTA 3A74A 3GV6A 3NBIA 1EIHA 3Q23A 1QUQA 4NPSA 1TWGH 4XQNA 5IY0A 2WV6D 4E6IA 4F7XA 3PO2H 1HCZA 1N32L 5M5WH 1EFID 2B2WC 2I07B 5C3WA 1UEAB 1YNNC 4BXXH 4HIMA 2UXDQ 3A7AB 3D0FA 3MZ5A 2N78A 2B8FA 1TR5A 2B63G 2CH4A 5EJWA 1S5FD 5HURA 5L37A 2KCMA 4X65Q 2F0UA 1CQVA 4KD4A 4JBMA 3GP7A 4A3CG 3UDIA 3EVQA 5HGTA 3KLSA 3CCUA 3VR4A 5ELOA 5LMUQ 1N34L 2XSCA 1BOSA 2KCNA 4OIJA 2JJQA 5CBEE 4NXMQ 4FF2A 4LJZC 4A3GH 4BS9A 1VQ5A 3OMCA 1QNUA 5CV9A 3S1RB 1RHPA 1EY9A 2ALYB 1VQ4A 1N36L 4IUTA 4EQNA 2AWOA 1VQ9A 3QO2A 2VUMH 1E0BA 1Z9FA 1JJ2A 4DR6L 1H9KA 1QCBD 1L0WA 3CQZH 1PH2A 3MXNA 1YNND 5ELDA 4HJ5A 2NUCA 4Y7NB 5TSSA 1Z47A 2I5LX 2BDNA 3AFQA 3HOVB 4A3EG 4YCWA 1EQRA 5GAHC 3E5SA 3PIO3 1O78A 4A3IB 1ZXTA 1L0YB 5DAUA 3FP9A 3UDFA 3BG3A 2NVXH 5D65A 3EA6A 4KMUC 1SMYC 1VQ7A 3OTOL 3TP6A 2K5DA 4IUVA 3QR8A 3MEFA 1XXGA 1WTHA 4R8IA 4JI0Q 2CWAA 2A6HC 4LW1A 3S2HH 4CJ0B 4YHHQ 1J8IA 5IGGA 1VS0A 1D5XC 1V43A 3SGIA 1X3FA 2Y0SE 4FO2A 2F0QA 1X6OA 4A4IA 3BS1A 2EY2A 4DK3C 2MO0A 2H1EA 1B44D 5IP9G 4JBKA 4A3DG 1A2TA 4NDXA 2PZUA 1PH4A 1MGSA 1QUQB 2B2UA 2KHSA 1VQLA 3I56A 5JPNC 4ZQ3A 2UUCQ 4YY3L 4I7ZC 2PYKA 3CKIB 4LFBQ 1HR0W 1A63A 1Y8OB 4DV7L 1BVSA 1SMYD 3RUZA 2KJXA 1LACA 5LL6S 3TN2A 3KYHC 3ONAB 4DV3L 2IL8A 3QB3A 1MJCA 1C7YA 2A6HD 3A8IE 1HA5A 3A8JE 4JW0A 2RDHA 1S3OA 1Q3LA 2OF1A 3G6JB 4QQBX 1S5BD 3URYA 1DM0B 1U4LA 3HFZB 4DAVA 1KDAA 1Q82C 2L55A 2JEAI 2L12A 2KHIA 2RCFA 3S14B 1PTOH 4A93G 1RDPD 1A6XA 2F0EA 3MFYA 1KRSA 5GAGC 1A3TA 2RKSA 5EPLA 1WTWA 1DGSA 3NQTA 2BH2A 2RA4A 1Q90A 1EY8A 5DNFA 1STBA 2VB2X 5E3FA 4OWXB 1CKOA 5D3DA 5A2QL 4BA2I 4RH6A 4X3UA 3GTOH 4L6TB 1H9RA 1E2VA 3A56A 1O7LA 4YCUA 4PMCA 4R4TA 3HOXG 4IUNA 2AQ2B 4IUUA 1SNPA 1JE5A 1FL0A 1WYDA 3BDLA 1SYDA 2NZHA 4BY1H 2WB1B 1N32Q 2D0PA 1H9SA 4DR1Q 3CPWA 1VQOA 4DNRB 4OX9L 5M5YB 4CDDC 3WOEA 3NHHA 4LWCA 1RIPA 1JWSD 3KLWA 3M4YA 4IPDA 4RCNA 1E1OA 1AE2A 4DR2L 1K3BC 1I3QB 3D4RA 1N34Q 4CHTB 2K50A 1D2BA 3GTMB 4FP5D 1GKHA 3RNUA 4EGVA 1N8RC 3TS2A 1TS4A 4XQQA 2JK8A 2AUJD 1QVFA 1B50A 5C0XH 1IKLA 3G6EA 1N36Q 4UPAA 3D31A 1TU2B 2BOSA 1NR2A 4DR6Q 1CA6A 4BBSH 5CV5A 3V05A 4N8X1 1B9MA 5C4XH 1FNUA 3RZDB 1H95A 5E4XA 1JWMD 1UE1A 3SVMA 4CDCC 5M5XB 1WCMH 1OTCA 3HZXA 1K0SA 4P75A 2ID0A 1I50B 2PQEA 2HDLA 3H09A 5DM73 1VQCA 2F0NA 4NB3A 1MHWC 4ZUJA 2R92H 4OO1I 1EYAA 2CQAA 2ZTDA 4V0BA 4LF8L 4G7OC 1VCIA 1WFQA 5KIXA 4N8FA 4H44C 3RZOH 2B2WA 2UU9L 5H1SE 1GHKA 4DV5L 1M8AA 4BBRH 2DNCA 4FXKC 3VYUA 3RMHA 1W6KA 5C3EB 3ND8A 3CXCA 3NUCA 1K0RA 1KABA 4KV6A 1QG7A 2E2JH 3KUPA 3EJIA 3F2UA 2F3IA 4CKCA 1EUJA 4DR4L 1F9RA 3HOWG 1SRUA 4ME5A 1K83H 1K9MC 2AHOB 2DY8A 3S1QB 5EBCA 1ENFA 3J81j 1TY0A 5CV4A 4KHPL 5C4ZA 3IFDA 4YY3Q 3OHXC 1JE4A 1I4HA 4U673 3PCOB 4DV7Q 1H9SB 1AE3A 3GTJB 1CSQA 2CH4W 5CORA 2G9HD 1HHVA 4DR5L 3FRPB 1PYBA 2L5TA 4DV3Q 2QW7A 2YV5A 3EIVA 1QB5D 1KDCA 3MAQA 1ICWA 1X3QA 2L9HA 5IYDG 4EQPA 1YHQA 4LFAL 2JA6G 2IX1A 4P74A 3T1HL 4OL7A 1JORA 3I4MH 2R7ZG 4L8JA 2JA7G 3I2ZA 3LNNA 1RF2D 4DXGA 4HCSA 4LF5Q 3DEPA 3V96A 1DYQA 2QA4A 3GDEA 2EXDA 3OMGA 2HDMA 3H94A 3P1HA 4C3HB 3CC2A 1DOLA 2A69C 3J81E 3PO3B 2K5HA 4A3FB 4BA1I 1HA6A 1NTGA 2LSSA 1BR9A 1LUZA 3T1YL 1XX8A 2O5JC 4BY7B 1D5ZC 2IW3A 1VQJA 3SE0A 1HUMA 2HCCA 4FXGC 2HIXA 2PQAA 4ZLTF 3KF8B 4FYDA 1ASZA 4IJHA 2GN5A 2N8NA 4X3TA 4OX9Q 3KF6A 2F1MA 1XYIA 2NVYB 1Q8IA 4FF4A 2H5XA 2BH8A 2FJ2A 4DK6C 3CW2C 4DR2Q 1LT4D 4U68A 2Q2HA 3S17B 5ELNA 1IW7D 2KCCA 4NP5A 1X3PA 3ZYYX 4IPCA 1E2WA 1TWCB 1E22A 1RODA 4DUYL 3VR2A 1TWAB 2L15A 4WFN3 2Q8RE 3CU7A 5FLXE 2C35B 1NNXA 4C3IB 3JAME 2VNUD 3TREA 4DF7A 1Q1BA 3BYTB 4EQ5A 3HKZE 1GUSA 5IT9E 3VYTA 1Z6HA 1OXXK 4QY7A 4OWWB 2VUMG 3IFTA 1A0IA 1FYCA 3R2IA 2P5ZX 3SXHA 4PV1C 2Q8IB 2E2HB 3DHQA 3CCSA 4LF8Q 3G71A 1CZGA 4LUVA 2UU9Q 2JA5B 4DV5Q 2FINB 2G5DA 2DNEA 2Y0SG 1PA6A 4IFDG 4JCVE 4A75A 3S1RH 2K5VA 4K8IA 5I9OA 1YITA 4GN5A 2ZJRA 1XTCD 5C44G 5E1FA 4UP9A 5DEHA 1ML0D 4DR4Q 1AZQA 2HQLA 2B2TC 3G4SA 3DM3A 1YJ9A 3W3AA 4Y7NH 3N52A 4K8JA 3VR3A 1O80A 1XWEA 5KEEA 2VB3X 4A3MH 3HOVH 1BQQT 1SE4A 4KHPQ 3S24A 1VQ8A 4R4CA 4FDBA 2EIFA 2F0WA 2F0HA 2PQAB 4A3IH 1JOOA 2K04A 4A3JB 1JICA 3L0OA 4A76A 4DR5Q 3KF6B 2WKDA 3Q8DA 5LMNL 5KGUA 1PLFA 2JA8G 1QNKA 2GA4B 2F0SA 1A3VA 3PF4A 3E3XA 3U9SA 1A2UA 1JJCB 2PW7A 3PUWA 2YU9B 2K14A 2V4DA 3EROA 1CUKA 4OO1H 1X54A 4IFDI 4LFAQ 2JYOA 1XTDA 4CKBA 3J81i 4JI1L 4HJ7A 4JK1C 3VA5A 2K6AA 4JI6L 1XNQL 1FD7D 3IRBA 4MTKA 3W2DA 1QVCA 2I46A 3FHWA 2TSSA 4LMQD 1IL2A 5CGKA 1PFNA 2UXCL 4P71A 1ZYRD 3R93A 3RN5A 2N49A 2XRSD 5EKKA 1NAPA 3T1YQ 5AJ3L 4QB4A 3KLRA 2MJ8A 1KC8C 2ES2A 4PZ7A 3GD7A 1IKMA 1U4MA 5JEAG 3Q24A 2EYJA 2B63B 1BBWA 1HQRD 4DA2A 2A5HA 1LTLA 1F2MA 2A1AA 2NZOA 1FR3A 2QGQA 5GAEC 1EY7A 4UP7A 3S14H 1EU4A 4V190 1NUCA 1OO9B 3L2PA 1G2SA 3CCLA 2RDFA 5ISRA 5I2XA 1JMCA 4JI5L 1SN8A 2ZM6L 1AFPA 1GUWA 4F88A 4K5WA 2X69A 5FKAC 2BDOA 2L4NA 3NQIA 4C1NI 4CJ1B 3P7JA 2ZJQA 3K5LA 4DUYQ 2OT2A 2A6EC 4X62L 4KKUA 3K57A 3UE0A 3S1MB 1XPRA 2ENBA 3M3YB 3MEHA 1EIFA 3PIPA 5ELFA 4L5QA 1HZAA 1ENCA 5IIFA 2J0TD 4AYBG 4A3EB 1D7QA 4K6DA 1EOTA 4AH6A 3KLSX 4P73A 3I7FA 3TBIB 1HH2P 3I4LA 2OTJA 5C4XG 4KTAA 4B9WA 1BKBA 2JA9A 3E0EA 1X3GA 5FLMH 2VS1A 4N9TA 2MP1A 2UUAL 1I3QH 5IODA 1D6EC 1WCMG 5C5LA 3BVGA 2K32A 1WOCA 3GTMH 1S5DD 3U4ZA 4XIGS 1UE7A 1WTOA 1A8VA 2UXBL 3MA2B 3RLNA 4TRDA 4ZKBB 2Z4HA 2R92G 2A6ED 3NBHA 1YHAA 3K58A 2F4VL 4O42A 5IE8A 4YWKA 4KN4C 1WTRA 2UUBL 2RCNA 3J81L 2Z6KC 5BR8L 1CA5A 2X6GA 4FXDA 1K8MA 5IGEA 4A3DB 3ITPA 3RZDH 1SYBA
chains in the Genus database with same CATH topology
1KRSA 5GROA 1EYGA 4A3BG 5GAGC 2FXQA 5M5XH 4B3TL 1DGSA 2BH2A 1HZBA 3H3VI 4Y52H 2DUDA 3G48A 1UEBA 1I50H 3T1HQ 1GVPA 4OWXB 1CKOA 3AYHB 4LF7L 4PZ6A 3CAMA 4BA2I 1X56A 1Y1WH 3GTOH 3M4QA 4HJ8A 1JT8A 5M3FG 5GADC 2D62A 4PMWA 1VQBA 4YCUA 4GLVB 2PI2A 4MZ9A 4R4TA 3HOXG 1OXTA 2IY5B 4A3EH 1HR0L 3PUYA 1SMXA 1JE5A 1FL0A 1WYDA 1TWFH 2K52A 2NZHA 3BJUA 4BY1H 1N32Q 3NENA 2D0PA 1KL9A 1PHJA 4DR1Q 3JC66 3CPWA 1YHBA 1PFSA 1VQOA 5C3EH 4OX9L 3GTQH 3CPFA 1IZ6A 4AQYL 1NMGA 4LWCA 1RIPA 3KLWA 4JI1Q 1HNXL 3EBEA 4JI6Q 2KENA 4IPDA 1VQIA 1XNQQ 5JJLA 1E1OA 4GOPB 3HOZH 1AE2A 3K8AA 5C0XJ 4DR2L 3PUZA 1UWVA 3CF5A 4L5SA 1S72A 4LUOA 1VQPA 1N34Q 2BA1A 2K50A 1Y1WG 1XJVA 3I4MG 1PVOA 2IT1A 5FLXc 1GKHA 3RNUA 4RG1A 5GQOA 2R6GA 1N8RC 3JAMc 3TS2A 2UXCQ 3WWVA 1HNWL 4B3MQ 2JK8A 3S15H 2VQEQ 1QVFA 2R7FA 4BY1G 4DV1Q 1YNXA 3G6EA 4HJ9A 1N36Q 1IBLL 4UPAA 2WAQE 3D31A 5IP9H 1M90C 4UY8C 5AJ3Q 1KRTA 3GTJH 4DR6Q 4BBSH 4GLXA 1EFWA 2A8VA 2CQOA 4DV0Q 4DV4L 2PNHA 2WFWA 5C4XH 1K8GA 3M7NA 3RN2A 1W3SA 2OTLA 1H95A 3LGJA 4JI3L 4IFDJ 4APVA 3CCQA 1UE1A 2LXJA 4IO9A 4DV2Q 2Q2IA 2PI2E 4NXNQ 3HOZG 1JB7A 1EQQA 1GM5A 5IP7H 1N33L 5M3MG 1PH1A 1WCMH 1SE8A 1OTCA 4JI0L 1P16A 4P75A 3ULJA 4X64L 4B3SL 4JI4Q 1XNRL 1C0AA 2ID0A 3HOWH 1X3EA 5HY6A 1U0LA 4DUZL 2V1CC 1OXUA 1VQCA 4DPGA 2N3SA 1I94L 1YJWA 1G51A 4NB3A 2VZAA 3F2DA 3NBHB 4JI5Q 2R92H 2NN6G 4OO1I 2ZTDA 2RHQB 5C0XG 2ZM6Q 1X9NA 5IYBH 4LF8L 1VCIA 4B3RQ 1WFQA 3GO5A 2MQHA 1MIUA 1WI5A 3J7ZC 3RZOH 2UU9L 4BBSG 2I5HA 1Y1VH 4IPGA 3STBC 4C3HH 3CP0A 5H1SE 5M5YH 4DV5L 4A93H 4BBRH 1V1QA 2E5LL 3F8TA 3PO3H 4A3FH 1GD7A 3HKZG 3ZJYC 4DV6L 4X62Q 3ULPA 4ALPA 4LF6L 3GTLH 1K3RA 4DR7Q 2I5MX 1XPOA 4R4IA 3CD6A 1XMOL 3CXCA 4BY7H 4QIWE 1K0RA 4GN4B 1FJGL 1KAWA 1CKMA 5IP7G 4XTCS 2E2JH 2F3IA 1VQGA 2K4KA 5IWAQ 1B70B 1PH6A 1EUJA 2GVBA 2WB1E 2MNAA 4DR4L 4YWLA 1S40A 1W2BA 2JA6H 1L1OA 1Q8KA 1SRUA 2QEXA 3U58A 1VQMA 3HOWG 1K83H 4LF4L 1K9MC 2AHOB 5J3BA 4JI2L 2VQFQ 2VW9A 2NVYH 3M85A 5M3FH 3FKIG 4KLKA 2JA7H 4GN3B 3J81j 5IYBG 4KHPL 3AFPA 3J80i 4YY3Q 2K75A 1FVIA 4X66L 5FJ8H 1NBWA 3H0GH 1MJEA 1HNZQ 3J7A5 2UUAQ 4K0KL 4DAMA 1Q1EA 3PCOB 4BBRG 4DV7Q 2ATWA 3PO3G 1AE3A 3KOJA 3E9HA 4A3FG 3S17H 1CSQA 4JYAQ 4DR5L 3J81c 1PYBA 4DV3Q 1NJIC 4RMFA 2NN6I 2WP8J 1TWCH 3STBD 1B8AA 2YV5A 4JOIC 4BY7G 4HIDA 1SLJA 3EIVA 2OWOA 3HOUG 2UXBQ 4GOPC 3PIOA 2F4VQ 2UXDL 3H15A 5IYDG 2HHHL 2JA6G 2IX1A 1YHQA 4LFAL 1E24A 3M9BA 4P74A 3T1HL 2UUBQ 4C3IH 2PMZE 3PSIA 3I4MH 5BR8Q 1NY4A 4X65L 2R7ZG 4GKKL 1P8LA 1XMQL 4MTNA 2JA7G 3I2ZA 3CCJA 5LMNQ 2RF4A 2YTYA 4KI0A 1A62A 5JEAJ 3S1NH 1AH9A 1OXSC 3UE1A 4LF5Q 5FJ8G 1KXLA 1WJJA 3H0GG 5LMUL 4B3TQ 3TRZA 2JQOA 3OYYA 2QA4A 4NXML 1VQAA 2NVTH 3GDEA 4JI7L 4DR1L 2EXDA 4POGA 3CC2A 3KDFA 4YCVA 4LF7Q 2K5HA 4R4OA 4BA1I 1NTGA 2LSSA 4IOCA 3PF5A 1R9TH 1HZCA 2E2HH 4A3MG 4GKJL 1LUZA 1RL2A 3T1YL 4GNXA 1VQJA 2HIVA 4R1JA 5M3MH 3OW2A 1HR0Q 3RR5A 4HJAA 2JA5H 2HIXA 2PQAA 3KF8B 3S1QH 1ASZA 4IJHA 1VQNA 2GN5A 1M1KC 3VDYA 4X6AH 2N8NA 1FGUA 2R7DA 4JI8L 1KIXA 4OX9Q 3KF6A 4AQYQ 2F52A 5IT9c 1PH7A 1YVCA 4JBJA 2H5XA 1HNXQ 4LNQA 1U5KA 2BH8A 1UE5A 2VQEL 3UDGA 4DK6C 4DKAC 1VQDA 3CW2C 2AMCB 4DR2Q 3K7AH 4A3KH 1YEZA 4LF9L 2Q2HA 2AKWB 5ELNA 2KCTA 1CSPA 2RHSB 4IPCA 1I5FA 2HT1A 3ICEA 4GLAC 4IPHA 4C3JH 1HNWQ 1Q12A 4MNOA 3U4VA 1E22A 4AYBE 4QGUA 2JA5G 4DUYL 1IBLQ 4YHHL 1TXYA 1SR3A 1L1OB 1VQEA 2L15A 1HJPA 3BZKA 3TS0A 1QVGA 4HIOA 2C35B 2Z6KA 1X55A 5C4JH 2VNUD 3TREA 1L2FA 5K36G 4DV4Q 1Q1BA 2Z0SA 4EQ5A 3JAMi 5JJKA 3HKZE 3FKIH 5IYCH 4JV5L 4QL5A 4DR3L 4JI3Q 3OTOQ 2YU9H 1YZ6A 1PH3A 1OXXK 2OQKA 3K0XA 4A3KG 1JJGA 4QY7A 4OWWB 4OXPA 5C44H 1Q86C 2VUMG 3CMAA 1N33Q 3GTKH 3S2DH 1A0IA 1VQFA 4LFCL 1KQSA 3K7UC 4X64Q 1KD1C 1Q46A 4B3SQ 1XNRQ 1IXRA 4C2MH 4L5RC 2IHEA 4ME3A 4OWTB 3TQYA 4DUZQ 1B7YB 1NMFA 3A5ZB 2UUCL 2B29A 3HOUH 4O2DA 5LMNW 1I94Q 1J6QA 4LFBL 1PYSB 1LM0A 1J5EL 4R4QA 4JG2A 3CCSA 4LF8Q 3G71A 5IYDH 5DLQE 3KFUA 1C9OA 4GS3A 4A3JG 4LUVA 2UU9Q 4LUZA 4DV5Q 1PA6A 2Y0SG 4IFDG 2D0OA 2B3GA 4P72A 1YI2A 4JCVE 2E5LQ 2R7ZH 1QZHA 4DV6Q 1IBKL 5IYCG 3W5OA 4A75A 3S1RH 4EX5A 4LF6Q 1SROA 2K5VA 1YITA 2JA8H 4GN5A 1XMOQ 3CCRA 2ZJRA 5C44G 2CCZA 1FJGQ 1IBML 2MO1A 1NE3A 3B6YA 4OONA 4QJFA 4UP9A 2YTXA 3DLLA 3ER0A 4DR4Q 2AWNA 2HQLA 2LXKA 3RLFA 3G4SA 3DM3A 1YJ9A 2Q2UA 4JYAL 2XTIA 3KDFB 1PH5A 4DNIA 4Y7NH 2B63H 5C0XI 2MFIA 4LF4Q 3M4OH 3I4OA 4JI2Q 3HOVH 4A3MH 4TQUS 3TEHB 4GNXB 4A3CH 4KHPQ 3S24A 1VQ8A 2R93H 1TWAH 3HOYH 4R4CA 3NEMA 4FDBA 4X66Q 2EIFA 3RLOA 4A3LG 1ASYA 3S16H 2PQAB 3AQQA 1PH9A 4K0KQ 2YTVA 4A3IH 3KJPA 3I4NG 3A74A 3L0OA 3CMEA 4A76A 3KF6B 4H02A 4DR5Q 3Q8DA 3CC4A 2ZJPA 1QUQA 4NPSA 1TWGH 5LMNL 1G6PA 4PG3A 5IY0A 2Q2TA 2JA8G 1CKNA 4LF5L 3PO2H 3PF4A 3CCVA 1YJNA 1JJCB 3PUWA 1N32L 5M5WH 2K14A 2UXDQ 4BXXH 2BA0A 4HIMA 2IHFA 1K73C 1CUKA 1X54A 3D0FA 3BU2A 2HHHQ 2N78A 4LFAQ 3GTGH 4IFDI 3S1MH 2B63G 3M3YH 1XTDA 3K81C 3MXNB 3J81i 1TWHH 2KCMA 4X65Q 4GKKQ 3F2BA 4JI1L 4HJ7A 1XMQQ 3HOVG 4JI6L 5JJIA 1SFOH 1XNQL 4JBMA 3UDXA 4A3CG 1MKHA 3UDIA 3PGZA 1EWIA 3CCUA 1E7ZA 3IRBA 4KHZA 3HOYG 3EN2A 2A19A 5ELOA 2R93G 1QVCA 1L1OC 5LMUQ 3HKSA 1T9HA 1N34L 4JBWA 3FHWA 1OXVA 2ZTEA 4A3IG 2JJQA 4NXMQ 1IL2A 4JI7Q 2VL6A 4IOAA 1UE6A 2UXCL 4A3GH 4P71A 1VQ6A 4IJLA 1VQ5A 4B3ML 3RN5A 2N49A 4WJ3M 1K8AC 3PO2G 3F2CA 1N9WA 4DV1L 1VQ9A 2ALYB 1VQ4A 1N36L 5HGQA 4BXXG 2AWOA 3BZCA 3T1YQ 4GKJQ 1D8LA 5AJ3L 2VUMH 2CFMA 1Z9FA 2EQSA 1JJ2A 4DR6L 4OO1G 1L0WA 1PH2A 3CQZH 1KC8C 1E1TA 4PZ7A 2ES2A 3GD7A 2GVAA 4DV0L 1XPUA 4HJ5A 5JEAG 3CCMA 1KHIA 1BBWA 4JI8Q 4TVAB 4NXNL 4DV2L 1Z47A 2KBNA 1VQKA 1LTLA 2I5LX 2OCEA 3AFQA 3F1ZA 1PH8A 2I0QA 2A1AA 2NZOA 4A3EG 2QGQA 4YCWA 5GAEC 1EQRA 1I6HH 4UP7A 4JI4L 3S14H 5GAHC 4A3JH 4A3DH 1Q7YC 3L2PA 1G291 4LF9Q 1Y14B 4A3GG 5C3EG 1E3PA 3H3VH 3CCLA 4L5TA 4WJ4A 2DGYA 1Q81C 3E9IA 3FP9A 4JI5L 3UDFA 1JMCA 1SN8A 2NVXH 3ULLA 2JE6I 1O7IA 3I55A 2ZM6L 4DAYB 1VQ7A 3OTOL 1GO3E 4JOIA 3CC7A 2WAQG 2IX0A 4GOPA 4B3RL 3A0JA 3MEFA 3PUXA 4JI0Q 2CWAA 4LW1A 1V9PA 2ZJQA 3L7ZC 3S2HH 4DUYQ 4YHHQ 4X62L 3UE0A 1VS0A 1XPRA 2ZTCA 4DR7L 4JC0A 2VY3A 1V43A 1EIFA 1X3FA 3SGIA 2Y0SE 3U50C 4GNXC 1X6OA 2E8GA 4L5QA 4A4IA 1HZAA 1LYLA 3PIPA 2JEBI 3J80c 4JV5Q 4DK3C 4DR3Q 5EAYA 2MO0A 5IWAL 4AYBG 3PV0A 2OQ0A 3A5UA 5IP9G 4JBKA 4A3DG 2CWPA 4A3LH 1IYJB 4PZ8A 4AH6A 4POFA 1PH4A 1D7QA 1VQHA 4P73A 3I7FA 4LFCQ 1HH2P 3I4NH 2OTJA 2VQFL 5C4XG 1QUQB 1BBUA 1BKBA 2JA9A 4UP8A 3E0EA 1X3GA 5FLMH 3I56A 1VQLA 1X65A 2VS1A 1CKNB 4YY3L 2UUCQ 1EIYB 4A3BH 3W1GA 1HNZL 1EOVA 2UUAL 4LFBQ 1I3QH 3GTPH 1YIJA 4HIKA 2YYZA 1WCMG 4DV7L 1HR0W 1BVSA 1J5EQ 1A63A 4J15A 3M4PA 1WOCA 3GTMH 3KYHC 5E7NA 2KHJA 3U4ZA 4DV3L 4XIGS 1MJCA 1UE7A 1C7YA 3ERSX 1A8VA 2UXBL 2K5NA 3KJOA 4AIMA 3RLNA 1IBKQ 2R92G 1YBYA 1S3OA 3K80C 1YHAA 2F4VL 2ASBA 2WB1G 4O0AA 3HOXH 5IE8A 1PV4A 3AEVA 3PUVA 4QQBX 3NELA 3HFZB 1Q82C 4YWKA 1QZGA 3CCEA 1IBMQ 2JEAI 2XGTA 1Y1VG 2KHIA 2UUBL 2RCNA 2E2IH 2Z6KC 5BR8L 4A93G 4YWMA 3W1BA 3RZDH 2CKZB 2NVQH 5FLMG 1HZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRS A;  5GRO A;  1EYG A;  4A3B G;  5GAG C;  2FXQ A;  5M5X H;  4B3T L;  1DGS A;  2BH2 A;  1HZB A;  3H3V I;  4Y52 H;  2DUD A;  3G48 A;  1UEB A;  1I50 H;  3T1H Q;  1GVP A;  4OWX B;  1CKO A;  3AYH B;  4LF7 L;  4PZ6 A;  3CAM A;  4BA2 I;  1X56 A;  1Y1W H;  3GTO H;  3M4Q A;  4HJ8 A;  1JT8 A;  5M3F G;  5GAD C;  2D62 A;  4PMW A;  1VQB A;  4YCU A;  4GLV B;  2PI2 A;  4MZ9 A;  4R4T A;  3HOX G;  1OXT A;  2IY5 B;  4A3E H;  1HR0 L;  3PUY A;  1SMX A;  1JE5 A;  1FL0 A;  1WYD A;  1TWF H;  2K52 A;  2NZH A;  3BJU A;  4BY1 H;  1N32 Q;  3NEN A;  2D0P A;  1KL9 A;  1PHJ A;  4DR1 Q;  3JC6 6;  3CPW A;  1YHB A;  1PFS A;  1VQO A;  5C3E H;  4OX9 L;  3GTQ H;  3CPF A;  1IZ6 A;  4AQY L;  1NMG A;  4LWC A;  1RIP A;  3KLW A;  4JI1 Q;  1HNX L;  3EBE A;  4JI6 Q;  2KEN A;  4IPD A;  1VQI A;  1XNQ Q;  5JJL A;  1E1O A;  4GOP B;  3HOZ H;  1AE2 A;  3K8A A;  5C0X J;  4DR2 L;  3PUZ A;  1UWV A;  3CF5 A;  4L5S A;  1S72 A;  4LUO A;  1VQP A;  1N34 Q;  2BA1 A;  2K50 A;  1Y1W G;  1XJV A;  3I4M G;  1PVO A;  2IT1 A;  5FLX c;  1GKH A;  3RNU A;  4RG1 A;  5GQO A;  2R6G A;  1N8R C;  3JAM c;  3TS2 A;  2UXC Q;  3WWV A;  1HNW L;  4B3M Q;  2JK8 A;  3S15 H;  2VQE Q;  1QVF A;  2R7F A;  4BY1 G;  4DV1 Q;  1YNX A;  3G6E A;  4HJ9 A;  1N36 Q;  1IBL L;  4UPA A;  2WAQ E;  3D31 A;  5IP9 H;  1M90 C;  4UY8 C;  5AJ3 Q;  1KRT A;  3GTJ H;  4DR6 Q;  4BBS H;  4GLX A;  1EFW A;  2A8V A;  2CQO A;  4DV0 Q;  4DV4 L;  2PNH A;  2WFW A;  5C4X H;  1K8G A;  3M7N A;  3RN2 A;  1W3S A;  2OTL A;  1H95 A;  3LGJ A;  4JI3 L;  4IFD J;  4APV A;  3CCQ A;  1UE1 A;  2LXJ A;  4IO9 A;  4DV2 Q;  2Q2I A;  2PI2 E;  4NXN Q;  3HOZ G;  1JB7 A;  1EQQ A;  1GM5 A;  5IP7 H;  1N33 L;  5M3M G;  1PH1 A;  1WCM H;  1SE8 A;  1OTC A;  4JI0 L;  1P16 A;  4P75 A;  3ULJ A;  4X64 L;  4B3S L;  4JI4 Q;  1XNR L;  1C0A A;  2ID0 A;  3HOW H;  1X3E A;  5HY6 A;  1U0L A;  4DUZ L;  2V1C C;  1OXU A;  1VQC A;  4DPG A;  2N3S A;  1I94 L;  1YJW A;  1G51 A;  4NB3 A;  2VZA A;  3F2D A;  3NBH B;  4JI5 Q;  2R92 H;  2NN6 G;  4OO1 I;  2ZTD A;  2RHQ B;  5C0X G;  2ZM6 Q;  1X9N A;  5IYB H;  4LF8 L;  1VCI A;  4B3R Q;  1WFQ A;  3GO5 A;  2MQH A;  1MIU A;  1WI5 A;  3J7Z C;  3RZO H;  2UU9 L;  4BBS G;  2I5H A;  1Y1V H;  4IPG A;  3STB C;  4C3H H;  3CP0 A;  5H1S E;  5M5Y H;  4DV5 L;  4A93 H;  4BBR H;  1V1Q A;  2E5L L;  3F8T A;  3PO3 H;  4A3F H;  1GD7 A;  3HKZ G;  3ZJY C;  4DV6 L;  4X62 Q;  3ULP A;  4ALP A;  4LF6 L;  3GTL H;  1K3R A;  4DR7 Q;  2I5M X;  1XPO A;  4R4I A;  3CD6 A;  1XMO L;  3CXC A;  4BY7 H;  4QIW E;  1K0R A;  4GN4 B;  1FJG L;  1KAW A;  1CKM A;  5IP7 G;  4XTC S;  2E2J H;  2F3I A;  1VQG A;  2K4K A;  5IWA Q;  1B70 B;  1PH6 A;  1EUJ A;  2GVB A;  2WB1 E;  2MNA A;  4DR4 L;  4YWL A;  1S40 A;  1W2B A;  2JA6 H;  1L1O A;  1Q8K A;  1SRU A;  2QEX A;  3U58 A;  1VQM A;  3HOW G;  1K83 H;  4LF4 L;  1K9M C;  2AHO B;  5J3B A;  4JI2 L;  2VQF Q;  2VW9 A;  2NVY H;  3M85 A;  5M3F H;  3FKI G;  4KLK A;  2JA7 H;  4GN3 B;  3J81 j;  5IYB G;  4KHP L;  3AFP A;  3J80 i;  4YY3 Q;  2K75 A;  1FVI A;  4X66 L;  5FJ8 H;  1NBW A;  3H0G H;  1MJE A;  1HNZ Q;  3J7A 5;  2UUA Q;  4K0K L;  4DAM A;  1Q1E A;  3PCO B;  4BBR G;  4DV7 Q;  2ATW A;  3PO3 G;  1AE3 A;  3KOJ A;  3E9H A;  4A3F G;  3S17 H;  1CSQ A;  4JYA Q;  4DR5 L;  3J81 c;  1PYB A;  4DV3 Q;  1NJI C;  4RMF A;  2NN6 I;  2WP8 J;  1TWC H;  3STB D;  1B8A A;  2YV5 A;  4JOI C;  4BY7 G;  4HID A;  1SLJ A;  3EIV A;  2OWO A;  3HOU G;  2UXB Q;  4GOP C;  3PIO A;  2F4V Q;  2UXD L;  3H15 A;  5IYD G;  2HHH L;  2JA6 G;  2IX1 A;  1YHQ A;  4LFA L;  1E24 A;  3M9B A;  4P74 A;  3T1H L;  2UUB Q;  4C3I H;  2PMZ E;  3PSI A;  3I4M H;  5BR8 Q;  1NY4 A;  4X65 L;  2R7Z G;  4GKK L;  1P8L A;  1XMQ L;  4MTN A;  2JA7 G;  3I2Z A;  3CCJ A;  5LMN Q;  2RF4 A;  2YTY A;  4KI0 A;  1A62 A;  5JEA J;  3S1N H;  1AH9 A;  1OXS C;  3UE1 A;  4LF5 Q;  5FJ8 G;  1KXL A;  1WJJ A;  3H0G G;  5LMU L;  4B3T Q;  3TRZ A;  2JQO A;  3OYY A;  2QA4 A;  4NXM L;  1VQA A;  2NVT H;  3GDE A;  4JI7 L;  4DR1 L;  2EXD A;  4POG A;  3CC2 A;  3KDF A;  4YCV A;  4LF7 Q;  2K5H A;  4R4O A;  4BA1 I;  1NTG A;  2LSS A;  4IOC A;  3PF5 A;  1R9T H;  1HZC A;  2E2H H;  4A3M G;  4GKJ L;  1LUZ A;  1RL2 A;  3T1Y L;  4GNX A;  1VQJ A;  2HIV A;  4R1J A;  5M3M H;  3OW2 A;  1HR0 Q;  3RR5 A;  4HJA A;  2JA5 H;  2HIX A;  2PQA A;  3KF8 B;  3S1Q H;  1ASZ A;  4IJH A;  1VQN A;  2GN5 A;  1M1K C;  3VDY A;  4X6A H;  2N8N A;  1FGU A;  2R7D A;  4JI8 L;  1KIX A;  4OX9 Q;  3KF6 A;  4AQY Q;  2F52 A;  5IT9 c;  1PH7 A;  1YVC A;  4JBJ A;  2H5X A;  1HNX Q;  4LNQ A;  1U5K A;  2BH8 A;  1UE5 A;  2VQE L;  3UDG A;  4DK6 C;  4DKA C;  1VQD A;  3CW2 C;  2AMC B;  4DR2 Q;  3K7A H;  4A3K H;  1YEZ A;  4LF9 L;  2Q2H A;  2AKW B;  5ELN A;  2KCT A;  1CSP A;  2RHS B;  4IPC A;  1I5F A;  2HT1 A;  3ICE A;  4GLA C;  4IPH A;  4C3J H;  1HNW Q;  1Q12 A;  4MNO A;  3U4V A;  1E22 A;  4AYB E;  4QGU A;  2JA5 G;  4DUY L;  1IBL Q;  4YHH L;  1TXY A;  1SR3 A;  1L1O B;  1VQE A;  2L15 A;  1HJP A;  3BZK A;  3TS0 A;  1QVG A;  4HIO A;  2C35 B;  2Z6K A;  1X55 A;  5C4J H;  2VNU D;  3TRE A;  1L2F A;  5K36 G;  4DV4 Q;  1Q1B A;  2Z0S A;  4EQ5 A;  3JAM i;  5JJK A;  3HKZ E;  3FKI H;  5IYC H;  4JV5 L;  4QL5 A;  4DR3 L;  4JI3 Q;  3OTO Q;  2YU9 H;  1YZ6 A;  1PH3 A;  1OXX K;  2OQK A;  3K0X A;  4A3K G;  1JJG A;  4QY7 A;  4OWW B;  4OXP A;  5C44 H;  1Q86 C;  2VUM G;  3CMA A;  1N33 Q;  3GTK H;  3S2D H;  1A0I A;  1VQF A;  4LFC L;  1KQS A;  3K7U C;  4X64 Q;  1KD1 C;  1Q46 A;  4B3S Q;  1XNR Q;  1IXR A;  4C2M H;  4L5R C;  2IHE A;  4ME3 A;  4OWT B;  3TQY A;  4DUZ Q;  1B7Y B;  1NMF A;  3A5Z B;  2UUC L;  2B29 A;  3HOU H;  4O2D A;  5LMN W;  1I94 Q;  1J6Q A;  4LFB L;  1PYS B;  1LM0 A;  1J5E L;  4R4Q A;  4JG2 A;  3CCS A;  4LF8 Q;  3G71 A;  5IYD H;  5DLQ E;  3KFU A;  1C9O A;  4GS3 A;  4A3J G;  4LUV A;  2UU9 Q;  4LUZ A;  4DV5 Q;  1PA6 A;  2Y0S G;  4IFD G;  2D0O A;  2B3G A;  4P72 A;  1YI2 A;  4JCV E;  2E5L Q;  2R7Z H;  1QZH A;  4DV6 Q;  1IBK L;  5IYC G;  3W5O A;  4A75 A;  3S1R H;  4EX5 A;  4LF6 Q;  1SRO A;  2K5V A;  1YIT A;  2JA8 H;  4GN5 A;  1XMO Q;  3CCR A;  2ZJR A;  5C44 G;  2CCZ A;  1FJG Q;  1IBM L;  2MO1 A;  1NE3 A;  3B6Y A;  4OON A;  4QJF A;  4UP9 A;  2YTX A;  3DLL A;  3ER0 A;  4DR4 Q;  2AWN A;  2HQL A;  2LXK A;  3RLF A;  3G4S A;  3DM3 A;  1YJ9 A;  2Q2U A;  4JYA L;  2XTI A;  3KDF B;  1PH5 A;  4DNI A;  4Y7N H;  2B63 H;  5C0X I;  2MFI A;  4LF4 Q;  3M4O H;  3I4O A;  4JI2 Q;  3HOV H;  4A3M H;  4TQU S;  3TEH B;  4GNX B;  4A3C H;  4KHP Q;  3S24 A;  1VQ8 A;  2R93 H;  1TWA H;  3HOY H;  4R4C A;  3NEM A;  4FDB A;  4X66 Q;  2EIF A;  3RLO A;  4A3L G;  1ASY A;  3S16 H;  2PQA B;  3AQQ A;  1PH9 A;  4K0K Q;  2YTV A;  4A3I H;  3KJP A;  3I4N G;  3A74 A;  3L0O A;  3CME A;  4A76 A;  3KF6 B;  4H02 A;  4DR5 Q;  3Q8D A;  3CC4 A;  2ZJP A;  1QUQ A;  4NPS A;  1TWG H;  5LMN L;  1G6P A;  4PG3 A;  5IY0 A;  2Q2T A;  2JA8 G;  1CKN A;  4LF5 L;  3PO2 H;  3PF4 A;  3CCV A;  1YJN A;  1JJC B;  3PUW A;  1N32 L;  5M5W H;  2K14 A;  2UXD Q;  4BXX H;  2BA0 A;  4HIM A;  2IHF A;  1K73 C;  1CUK A;  1X54 A;  3D0F A;  3BU2 A;  2HHH Q;  2N78 A;  4LFA Q;  3GTG H;  4IFD I;  3S1M H;  2B63 G;  3M3Y H;  1XTD A;  3K81 C;  3MXN B;  3J81 i;  1TWH H;  2KCM A;  4X65 Q;  4GKK Q;  3F2B A;  4JI1 L;  4HJ7 A;  1XMQ Q;  3HOV G;  4JI6 L;  5JJI A;  1SFO H;  1XNQ L;  4JBM A;  3UDX A;  4A3C G;  1MKH A;  3UDI A;  3PGZ A;  1EWI A;  3CCU A;  1E7Z A;  3IRB A;  4KHZ A;  3HOY G;  3EN2 A;  2A19 A;  5ELO A;  2R93 G;  1QVC A;  1L1O C;  5LMU Q;  3HKS A;  1T9H A;  1N34 L;  4JBW A;  3FHW A;  1OXV A;  2ZTE A;  4A3I G;  2JJQ A;  4NXM Q;  1IL2 A;  4JI7 Q;  2VL6 A;  4IOA A;  1UE6 A;  2UXC L;  4A3G H;  4P71 A;  1VQ6 A;  4IJL A;  1VQ5 A;  4B3M L;  3RN5 A;  2N49 A;  4WJ3 M;  1K8A C;  3PO2 G;  3F2C A;  1N9W A;  4DV1 L;  1VQ9 A;  2ALY B;  1VQ4 A;  1N36 L;  5HGQ A;  4BXX G;  2AWO A;  3BZC A;  3T1Y Q;  4GKJ Q;  1D8L A;  5AJ3 L;  2VUM H;  2CFM A;  1Z9F A;  2EQS A;  1JJ2 A;  4DR6 L;  4OO1 G;  1L0W A;  1PH2 A;  3CQZ H;  1KC8 C;  1E1T A;  4PZ7 A;  2ES2 A;  3GD7 A;  2GVA A;  4DV0 L;  1XPU A;  4HJ5 A;  5JEA G;  3CCM A;  1KHI A;  1BBW A;  4JI8 Q;  4TVA B;  4NXN L;  4DV2 L;  1Z47 A;  2KBN A;  1VQK A;  1LTL A;  2I5L X;  2OCE A;  3AFQ A;  3F1Z A;  1PH8 A;  2I0Q A;  2A1A A;  2NZO A;  4A3E G;  2QGQ A;  4YCW A;  5GAE C;  1EQR A;  1I6H H;  4UP7 A;  4JI4 L;  3S14 H;  5GAH C;  4A3J H;  4A3D H;  1Q7Y C;  3L2P A;  1G29 1;  4LF9 Q;  1Y14 B;  4A3G G;  5C3E G;  1E3P A;  3H3V H;  3CCL A;  4L5T A;  4WJ4 A;  2DGY A;  1Q81 C;  3E9I A;  3FP9 A;  4JI5 L;  3UDF A;  1JMC A;  1SN8 A;  2NVX H;  3ULL A;  2JE6 I;  1O7I A;  3I55 A;  2ZM6 L;  4DAY B;  1VQ7 A;  3OTO L;  1GO3 E;  4JOI A;  3CC7 A;  2WAQ G;  2IX0 A;  4GOP A;  4B3R L;  3A0J A;  3MEF A;  3PUX A;  4JI0 Q;  2CWA A;  4LW1 A;  1V9P A;  2ZJQ A;  3L7Z C;  3S2H H;  4DUY Q;  4YHH Q;  4X62 L;  3UE0 A;  1VS0 A;  1XPR A;  2ZTC A;  4DR7 L;  4JC0 A;  2VY3 A;  1V43 A;  1EIF A;  1X3F A;  3SGI A;  2Y0S E;  3U50 C;  4GNX C;  1X6O A;  2E8G A;  4L5Q A;  4A4I A;  1HZA A;  1LYL A;  3PIP A;  2JEB I;  3J80 c;  4JV5 Q;  4DK3 C;  4DR3 Q;  5EAY A;  2MO0 A;  5IWA L;  4AYB G;  3PV0 A;  2OQ0 A;  3A5U A;  5IP9 G;  4JBK A;  4A3D G;  2CWP A;  4A3L H;  1IYJ B;  4PZ8 A;  4AH6 A;  4POF A;  1PH4 A;  1D7Q A;  1VQH A;  4P73 A;  3I7F A;  4LFC Q;  1HH2 P;  3I4N H;  2OTJ A;  2VQF L;  5C4X G;  1QUQ B;  1BBU A;  1BKB A;  2JA9 A;  4UP8 A;  3E0E A;  1X3G A;  5FLM H;  3I56 A;  1VQL A;  1X65 A;  2VS1 A;  1CKN B;  4YY3 L;  2UUC Q;  1EIY B;  4A3B H;  3W1G A;  1HNZ L;  1EOV A;  2UUA L;  4LFB Q;  1I3Q H;  3GTP H;  1YIJ A;  4HIK A;  2YYZ A;  1WCM G;  4DV7 L;  1HR0 W;  1BVS A;  1J5E Q;  1A63 A;  4J15 A;  3M4P A;  1WOC A;  3GTM H;  3KYH C;  5E7N A;  2KHJ A;  3U4Z A;  4DV3 L;  4XIG S;  1MJC A;  1UE7 A;  1C7Y A;  3ERS X;  1A8V A;  2UXB L;  2K5N A;  3KJO A;  4AIM A;  3RLN A;  1IBK Q;  2R92 G;  1YBY A;  1S3O A;  3K80 C;  1YHA A;  2F4V L;  2ASB A;  2WB1 G;  4O0A A;  3HOX H;  5IE8 A;  1PV4 A;  3AEV A;  3PUV A;  4QQB X;  3NEL A;  3HFZ B;  1Q82 C;  4YWK A;  1QZG A;  3CCE A;  1IBM Q;  2JEA I;  2XGT A;  1Y1V G;  2KHI A;  2UUB L;  2RCN A;  2E2I H;  2Z6K C;  5BR8 L;  4A93 G;  4YWM A;  3W1B A;  3RZD H;  2CKZ B;  2NVQ H;  5FLM G;  1HZ9 A; 
#chains in the Genus database with same CATH topology
 5EKI A;  1G91 A;  1DOM A;  2EJG C;  4A3B G;  4L63 B;  5M5X H;  3H3V I;  4HMJ A;  1ET6 A;  1I50 H;  1GVP A;  2LKV A;  4HSP A;  4I7A A;  3AYH B;  4MIU A;  2O5I C;  4DN4 M;  5IOC A;  5GAD C;  2D62 A;  4PMW A;  1VQB A;  5E4W C;  4K2K A;  1OXT A;  4QIW B;  1HR0 L;  5JOB A;  3NEN A;  1KL9 A;  2F03 A;  5C3E H;  2Z1C A;  1G2T A;  3I4N B;  3T53 B;  4AQY L;  4JI1 Q;  1HNX L;  3EBE A;  4JI6 Q;  1XNQ Q;  5JJL A;  1VQI A;  2AUK A;  3K8A A;  3DWA A;  3SHL A;  1RD9 D;  3CF5 A;  1LTB D;  4LUO A;  5FLX L;  3A7L A;  5FO8 B;  1I6V C;  1TKW B;  3JAM L;  1Y1W G;  3I4M G;  4ID6 A;  5FLX c;  4DFA A;  5GQO A;  2R6G A;  5IT9 L;  3JAM c;  2F0G A;  4JVZ A;  2UXC Q;  3MC0 B;  1YNJ D;  2QCP X;  2R7F A;  3HOX B;  1IBL L;  2WAQ E;  5AJ3 Q;  1KRT A;  3GTJ H;  2QDL A;  1LTA D;  4ODG A;  1VMC A;  4J1M A;  1IYU A;  1CQF A;  4KY5 A;  2A8V A;  1SJH D;  2CQO A;  4DV4 L;  2B2T A;  3K59 A;  2F0V A;  2WFW A;  1K8G A;  3M7N A;  3RN2 A;  3OW7 A;  4JI3 L;  4APV A;  2LXJ A;  4IO9 A;  3HOZ G;  1UAP A;  2D9U A;  1SYC A;  1PH1 A;  1SE8 A;  5AFW A;  1P16 A;  1RTN A;  3ULJ A;  4ZK9 B;  4B3S L;  4UDU C;  2EOT A;  1X3E A;  5HY6 A;  2LS0 1;  4IN3 A;  1OXU A;  4DPG A;  1F9P A;  4JI5 Q;  3NBH B;  4HR7 B;  2NN6 G;  2RHQ B;  2ZM6 Q;  5IYB H;  5I6Y A;  1SNQ A;  3GO5 A;  2MQH A;  1MIU A;  4C3H H;  3PO3 H;  4X3S A;  3VYR A;  3F8T A;  4A3F H;  3H3V C;  4K14 A;  3HKZ G;  4X62 Q;  4LF6 L;  4ALP A;  1K3R A;  2K1B A;  2I5M X;  1XPO A;  4R4I A;  4BY7 H;  4GN4 B;  5A35 A;  1KAW A;  1CKM A;  5IP7 G;  4XTC S;  2R3Z A;  3BVM A;  1VQG A;  2EYF A;  5EPK A;  1HFN A;  4YWL A;  1W2B A;  1Q8K A;  3D4D A;  2QEX A;  1CTM A;  1SDF A;  4CKE A;  2NVY H;  4H13 C;  4KLK A;  1BCP F;  4QF4 A;  3AFP A;  3J80 i;  3S15 B;  1NBW A;  4G7Z C;  2UUA Q;  4K0K L;  4DAM A;  5EQ0 A;  3S17 H;  1B1Z A;  2ATW A;  3E9H A;  4JYA Q;  4HMI A;  1HTL D;  4RMF A;  2NN6 I;  2WP8 J;  1TWC H;  4XQJ A;  4RAU C;  4JOI C;  4X3K A;  4HID A;  1SLJ A;  3MFG A;  2UXB Q;  4DU9 A;  4ZAI A;  1I4X A;  2F4V Q;  1RTO A;  1BCP D;  4JPB W;  1JR0 D;  4KK7 A;  2UUB Q;  4C3I H;  2PMZ E;  2F3V A;  2E75 C;  5FK9 C;  5BR8 Q;  1P8L A;  1XMQ L;  3HOW B;  2JSO A;  2RF4 A;  2YTY A;  3P20 A;  1JOQ A;  1OXS C;  5T1G A;  5FJ8 G;  3SK6 A;  3TP7 A;  1KXL A;  3H0G G;  3OIP A;  3HP3 A;  3TRZ A;  1A3U A;  3OYY A;  2B39 A;  3PIP 3;  1ONL A;  4JI7 L;  4POG A;  1Y1V B;  1AW7 A;  4HED A;  5JPM C;  2F0D A;  5C3X A;  5JAV A;  4KHV A;  1HZC A;  2DY7 A;  2E2H H;  4A3M G;  4GKJ L;  1RL2 A;  1F9S A;  5KYL A;  2CVR A;  3OOC A;  4R1J A;  3OW2 A;  1HR0 Q;  2JA5 H;  5EGT A;  3I90 A;  1VQN A;  4J8Q A;  2JA6 B;  3VDY A;  4X6A H;  2R7D A;  2J7Z A;  1TY2 A;  2EY6 A;  4AQY Q;  5M3F B;  1KAA A;  1PH7 A;  1YVC A;  2F3W A;  2XWJ B;  2JA7 B;  1H9J A;  1HNX Q;  2KUM A;  4RFB A;  2VQE L;  5BN5 A;  4M8A A;  5ELB A;  1KLU D;  1YEZ A;  4LF9 L;  2AKW B;  3NK9 A;  3WDN A;  1MI2 A;  3C1F A;  4IPH A;  4MNO A;  4DK0 A;  4AYB E;  4QGU A;  4RKB A;  1STN A;  1IBL Q;  3KF8 A;  1SR3 A;  4IUQ A;  3BZK A;  1AEX A;  3C46 A;  2M9V A;  3NPP A;  2Z6K A;  1X55 A;  1CHQ D;  1AZP A;  1G6Z A;  5K36 G;  2F0I A;  2DJF C;  1LT6 D;  4YIJ A;  4DV4 Q;  2Z0S A;  2IWH A;  3FKI H;  5IYC H;  4JV5 L;  1SYG A;  1FNW A;  4JI3 Q;  3OTO Q;  4QCL A;  2YU9 H;  1YZ6 A;  4OGQ C;  2HQE A;  4A3K G;  1JJG A;  1VQF A;  2EYH A;  1STA A;  4LFC L;  2NVT B;  3LWU A;  1Q46 A;  4B3S Q;  5EKL A;  4ME3 A;  5CR3 A;  2F0P A;  1GUT A;  2C5C A;  1B7Y B;  1K28 A;  3A5Z B;  2B29 A;  4C3J G;  4O2D A;  3HOU H;  1R9T B;  3TZD A;  1SYE A;  2QEJ C;  2F0M A;  2F0L A;  2ZXR A;  3D8G A;  4R4Q A;  2JN4 A;  3P75 A;  5DLQ E;  5M3M B;  1NSN S;  2DN8 A;  5BN4 A;  2D0O A;  4P72 A;  4S3S A;  3W5O A;  3HGB A;  4LF6 Q;  1JC7 A;  3K5M A;  3J7A F;  4DAP A;  2CCZ A;  4OHJ A;  4OON A;  2YTX A;  2KOL A;  5DM6 3;  3K7A B;  2LXK A;  2XTI A;  3L3O C;  2TMP A;  1PH5 A;  2B63 H;  3CQZ B;  2MFI A;  3A8K E;  1EYC A;  3DUZ A;  4A3C H;  2PPB C;  4GZY C;  3C2P A;  1Y8N B;  2MPM A;  3NEM A;  3HRZ C;  1ASY A;  4Q5V A;  4K0K Q;  3KBX A;  2YTV A;  2RQX A;  4QMG A;  3CME A;  4H02 A;  1G6P A;  3K0Y A;  5C4J B;  3ND9 A;  4PG3 A;  2Q2T A;  4G7H C;  1IW7 C;  3CCV A;  1CHP D;  3EFX D;  3T16 A;  2IHF A;  3S2D B;  1NR4 A;  5C44 B;  3BU2 A;  3GTK B;  3S1M H;  3M3Y H;  4HN7 A;  5LL6 X;  1ZEQ X;  2QF7 A;  3K81 C;  3NWS A;  1VMP A;  1EWC A;  3F2B A;  1XMQ Q;  5JJI A;  2O2L D;  2SOB A;  1EL0 A;  3PGZ A;  1EWI A;  2R93 G;  1E7Z A;  3HOY G;  3EN2 A;  1ESF A;  2FHT A;  2VXW A;  1PZI D;  1E2Z A;  3QWN A;  3HKS A;  1L1O C;  1B3Q A;  1OXV A;  4JI7 Q;  1H9M A;  2F0J A;  3FVQ A;  3HEJ A;  2VL6 A;  4IOA A;  1BNZ A;  4IUR A;  1CM9 A;  1FGB D;  3PO2 G;  1T5E A;  1BBX C;  3F2C A;  4FF3 A;  2EYO A;  4GKJ Q;  2JA8 B;  4BXX G;  3BZC A;  3QG1 A;  3MXG A;  3NSW A;  2IX3 A;  1STE A;  1LV9 A;  2CFM A;  3BVZ A;  4DV0 L;  1EU3 A;  3TZU A;  3CCM A;  4PNY A;  4TVA B;  4NXN L;  1VQK A;  1PH8 A;  3F1Z A;  4RGN A;  2I0Q A;  1RKN A;  1ESR A;  1PFM A;  3C1E A;  1ILQ A;  4JI4 L;  5J1Z A;  1DCZ A;  2NBF A;  2F0O A;  1Z7T A;  3K6O A;  3I3C A;  4A3D H;  3S16 B;  1Q7Y C;  4LF9 Q;  4A3G G;  3OIQ A;  5C3E G;  4WJ4 A;  2DGY A;  3E9I A;  1K8O A;  1I4Q A;  3ULL A;  1GO3 E;  4JOI A;  2WAQ G;  2IX0 A;  5BN3 A;  4B3R L;  3A0J A;  4RGT A;  1HUN A;  4XXE A;  4ILW A;  1V9P A;  5EBD A;  1WTX A;  2EXZ A;  1QJO A;  3QOL A;  4WRD A;  3GTG B;  3CRK C;  1KNE A;  2ZTC A;  5CC4 A;  4JC0 A;  1GOZ A;  2X6L A;  1TWH B;  4RWS C;  3U50 C;  4GNX C;  2NZ1 D;  3LWE A;  1SFO B;  4JV5 Q;  3Q6S A;  1GHJ A;  3PV0 A;  5COY A;  2QIL A;  1CI3 M;  2NB0 A;  1DOK A;  4A3L H;  2CWP A;  3DWQ A;  4PZ8 A;  4POF A;  5IGD A;  1VQH A;  4LFC Q;  2A74 C;  3I4N H;  4RCO A;  1BBU A;  2XNA C;  4UP8 A;  3I91 A;  4DGZ A;  1SNC A;  1ENA A;  3R3O A;  1EIY B;  5KYI A;  1YIJ A;  4HIK A;  4J15 A;  3M4P A;  5E7N A;  2KHJ A;  1MBY A;  1WTV A;  1B4O A;  4UHV A;  2K5N A;  1YBY A;  2HUG A;  2ASB A;  3HS0 C;  3NWT A;  4O0A A;  3HOX H;  1PV4 A;  3AEV A;  2LFN A;  1ZYR C;  1I6H B;  5JVG 3;  3VR6 A;  2M2L A;  2EJF C;  4YWM A;  2KEC A;  2Q8T A;  3I70 A;  1YNX A;  4M1U B;  2G9D A;  1HZ9 A;  2FMC A;  1BCP B;  5GRO A;  1EYG A;  4I65 A;  2E76 C;  1ZKO A;  3MHB A;  3T1H Q;  5LHY 1;  1X56 A;  3H6M A;  1JT8 A;  4IQZ A;  1SAP A;  2PI2 A;  1B53 A;  1CT1 D;  1B9N A;  3PUY A;  1SE2 A;  2F4I A;  5K5P A;  1WTQ A;  3BJU A;  1T5X D;  2K5W A;  3OSO A;  1EEF D;  1PHJ A;  4ULL A;  1PFS A;  3CPF A;  2ZT9 C;  1S5C D;  2BE5 D;  1C48 A;  4CDF C;  2KEN A;  5C0X J;  2PZT A;  1TT2 A;  1UWV A;  2K5Q A;  4A3B B;  2E2J B;  3GTP B;  1S72 A;  1VQP A;  4P2C B;  4QUF A;  2BA1 A;  2XIW A;  1PVO A;  1STH A;  4RG1 A;  3BDC A;  3CRL C;  1HNW L;  1GUN A;  1SNO A;  5J22 A;  3S15 H;  1EEI D;  3KK7 A;  4BY1 G;  2NTT A;  3D4W A;  4UY8 C;  1F2Y A;  1F9Q A;  2E2I B;  3MXU A;  4DV0 Q;  4KKS A;  1M4V A;  2PNH A;  5KRU A;  1W3S A;  3LGJ A;  2NVQ B;  1WD1 A;  3BYY B;  4NXN Q;  2M00 A;  1KNA A;  3OPO A;  1JB7 A;  2ICI A;  5NUC A;  1N33 L;  2ZXP A;  2WIN B;  4JI0 L;  1WTP A;  5CMD A;  4X64 L;  4JI4 Q;  1XNR L;  1C0A A;  3UI2 A;  4FVM A;  3AU7 A;  3HOW H;  1U0L A;  2V1C C;  1Y1W B;  1YJW A;  4OEL B;  1G51 A;  1QOH A;  2VZA A;  2C9O A;  3F2D A;  1GJX A;  5C0X G;  1X9N A;  1C4Q A;  4B3R Q;  2H4O A;  1WI5 A;  3J7Z C;  4BBS G;  2I5H A;  1TWF B;  1Y1V H;  4IPG A;  3STB C;  3CP0 A;  5M5Y H;  1CFM A;  2B2Y C;  2E5L L;  1GD7 A;  3ZJY C;  1J9O A;  3AB9 A;  3ULP A;  3GTQ B;  1U4R A;  1SXT A;  5EPJ A;  4PMB A;  1FJG L;  1D1K A;  1HFG A;  4K5V A;  1R4P B;  1GUO A;  2K4K A;  2L11 A;  1B70 B;  3HOZ B;  1MD2 D;  2WB1 E;  2MNA A;  3DXJ C;  2JA6 H;  1L1O A;  4HSV A;  3U58 A;  1VQM A;  2L0C A;  1EQV A;  1PDQ A;  4LF4 L;  4H0L C;  3K5N A;  4KD3 A;  5J3B A;  4JI2 L;  3M85 A;  5M3F H;  3FKI G;  5J39 A;  4GN3 B;  3J80 E;  2JA7 H;  2SDF A;  2K7V A;  1DON A;  2K75 A;  3BZD B;  1MSH A;  1FVI A;  1IYV A;  1MJE A;  2F0F A;  4G4K A;  1LTS D;  1Q1E A;  4BBR G;  2RSO A;  1AN8 A;  3J81 c;  3FPU B;  1LTR D;  1NJI C;  3J7Y W;  3STB D;  1B8A A;  2MUY A;  1G8Z D;  1F2L A;  5FO7 B;  3HOU G;  3HKZ B;  4KKT A;  4KJO A;  4GOP C;  5KNC A;  4OIK A;  1L0X B;  3H15 A;  2F0T A;  2HHH L;  4EVO A;  4ZKC B;  3SDZ A;  1E24 A;  3QOJ A;  3M9B A;  1YNJ C;  4Z9C B;  1JOK A;  1PMR A;  3T51 B;  3TSS A;  1AP0 A;  3PSI A;  4GKK L;  3WOF A;  1EWH A;  3CCJ A;  5LMN Q;  1A62 A;  4LAA A;  1WJJ A;  2NVT H;  1PRT C;  2N55 A;  1PTO C;  4DR1 L;  1LLR D;  4A93 B;  4YCV A;  1PFB A;  4R4O A;  4IOC A;  3PF5 A;  1R9T H;  3GTL B;  3NTH A;  5D3I B;  1WD0 A;  4GNX A;  4R8N A;  5M3M H;  3RR5 A;  3TDQ A;  5I6W A;  4O1N A;  1GXD C;  1PXU A;  3S1Q H;  1PRT F;  1PTO F;  4JI8 L;  2DJG C;  5IT9 c;  3PMF A;  5D14 A;  4LNQ A;  1U5K A;  2B8G A;  4DKA C;  1LTI D;  4K6L A;  2AMC B;  3K7A H;  3H0G B;  1I4G A;  2KCT A;  2RHS B;  1PRT D;  4ZYS A;  2AQ3 B;  1PTO D;  2J4X A;  4N9P A;  2L1B A;  3C3L A;  4GLA C;  3VR5 A;  3NTI A;  1HNW Q;  1VDZ A;  2XWB B;  4MHE A;  4A3M B;  2WKC A;  4NKL A;  4Q0F A;  3HG9 A;  1L1O B;  1EZ8 A;  1VQE A;  4TSS A;  3TS0 A;  1QVG A;  1VF5 C;  3QJY A;  5C4J H;  4IFD H;  1L2F A;  4C1N K;  2K33 A;  3SK4 A;  5JJK A;  4DR3 L;  3S1N B;  5T1I A;  2MHV A;  2OQK A;  2RVL A;  3S2D H;  5C44 H;  3CMA A;  1N33 Q;  3GTK H;  1QE6 A;  3EQL C;  1KQS A;  4X64 Q;  1XNR Q;  1IXR A;  4L5R C;  3BDO A;  4OWT B;  1BCP C;  3A55 A;  1SE3 A;  1BUV T;  1NMF A;  3O13 A;  1PYS B;  4HCE A;  1J5E L;  2OXP A;  2WAC A;  4JG2 A;  3KFU A;  1C9O A;  4IZ8 A;  4GS3 A;  4QUC A;  5FO9 B;  4FNF A;  2E5L Q;  2B3G A;  4IUP A;  4ZUI A;  4DK1 A;  1QZH A;  1IBK L;  3X3M A;  4EX5 A;  1SRO A;  5CV7 A;  1EQT A;  4G57 A;  4DAY A;  2JA8 H;  3CCR A;  1FJG Q;  1IBM L;  3B6Y A;  1LT3 D;  3DLL A;  3ER0 A;  4A3K B;  1PZK D;  4DNI A;  1EY0 A;  1JWU D;  4LF4 Q;  4NMZ A;  1UNS A;  3GV3 A;  3I4O A;  4JI2 Q;  3GQB A;  2QKI C;  1KLG D;  4TQU S;  3TEH B;  1F77 A;  5ELC A;  4GNX B;  4C3J B;  1TWA H;  2EE1 A;  3Q22 A;  2LMC B;  1EY5 A;  3RLO A;  4A3L G;  3S16 H;  3AQQ A;  2NTS A;  1PH9 A;  4EQO A;  3I4N G;  2EY1 A;  3MXP A;  3CC4 A;  2SNS A;  2ZJP A;  1KDB A;  2JP1 A;  2EYP A;  1CKN A;  4LF5 L;  2MGS A;  4DXF A;  1YJN A;  3DMU A;  2BA0 A;  3K5O A;  1I4R A;  1K73 C;  2HHH Q;  3R2T A;  3GTG H;  3MXN B;  1S4Z A;  2KVM A;  5CV8 A;  1TWH H;  3DEO A;  2LY7 A;  5ELE A;  4C2M B;  5JEA H;  4GKK Q;  3HOV G;  3SK5 A;  4XYQ A;  1SFO H;  4RGO S;  3UDX A;  1MKH A;  3PQI A;  4KHZ A;  2A19 A;  3MWY W;  1CK1 A;  1T9H A;  4JBW A;  1HRJ A;  2ZTE A;  4A3I G;  3TME A;  1UE6 A;  3FPP A;  2B2Y A;  1VQ6 A;  3A54 A;  4IJL A;  4B3M L;  2R7Z B;  4WJ3 M;  3I8Z A;  1K8A C;  2BCO A;  1U9R A;  1TII D;  1N9W A;  4DV1 L;  5HGQ A;  2WII B;  1D8L A;  2FMM A;  4OO1 G;  2EQS A;  1O7Z A;  1E1T A;  1XPU A;  2GVA A;  3VYS A;  2OEO A;  1KHI A;  4JI8 Q;  1R4Q B;  4DV2 L;  2KBN A;  3M4O B;  2OCE A;  5F2D A;  4XDX A;  1I6H H;  2R93 B;  3HOY B;  4XYO A;  4A3J H;  3U9O A;  3VA7 A;  1G29 1;  1Y14 B;  1BF4 A;  1BO0 A;  1E3P A;  2A68 C;  3IAY A;  1EIG A;  1TVX A;  4L5T A;  3H3V H;  3L9A X;  1V8Q A;  1Q81 C;  2JE6 I;  1O7I A;  3I55 A;  4DAY B;  1TWG B;  1QIL A;  3NTK A;  3CC7 A;  1JQY D;  4GOP A;  4CGY B;  3PO2 B;  3PUX A;  5M5W B;  1EY6 A;  1Y69 U;  2KED A;  3L7Z C;  4FF1 A;  1BXT A;  4KY6 A;  4DR7 L;  3J80 L;  2VY3 A;  2E8G A;  1LT5 D;  1LYL A;  2JEB I;  1TQO A;  3SEB A;  3J80 c;  4DR3 Q;  5EAY A;  5IWA L;  3V2T A;  1TS3 A;  2IJ0 A;  3OWF A;  1STY A;  2OQ0 A;  3A5U A;  3FEW X;  5FOB B;  3OWE B;  1IYJ B;  4J6H A;  2VQF L;  1KTK A;  4A3G B;  1X65 A;  3SR1 A;  1CKN B;  2A68 D;  1EZ6 A;  3TP5 A;  4A3B H;  3W1G A;  1HNZ L;  1EOV A;  2R61 A;  2B2V C;  3GTP H;  3IL8 A;  2EVB A;  2YYZ A;  2WAQ B;  3D3R A;  3RD4 A;  1J5E Q;  1PZJ D;  2VUM B;  2Z6B A;  3ERS X;  1QWY A;  3KJO A;  1IBK Q;  4AIM A;  5KNB A;  2Z9H A;  4RHS A;  1D5M C;  3K80 C;  1HTP A;  2WB1 G;  3PUV A;  3NEL A;  5I4D A;  2CW0 C;  1QZG A;  3CCE A;  1IBM Q;  2XGT A;  1Y1V G;  2E2I H;  1SJE D;  1LO5 D;  1HXY D;  3W1B A;  1DD2 A;  4B08 A;  2EDG A;  2CKZ B;  2NVQ H;  5FLM G;  2Y0S B;  4KN7 C;  2SNM A;  2NVX B;  2FXQ A;  4B3T L;  4RHR A;  1V1P A;  1HZB A;  2Z8L A;  2DUD A;  2PCF B;  4Y52 H;  3G48 A;  1UEB A;  4UAI A;  3S2H B;  3NP8 A;  2EY5 A;  4LF7 L;  4PZ6 A;  3CAM A;  2EJM A;  1Y1W H;  3M4Q A;  1JB3 A;  1D1I A;  2N88 A;  4HJ8 A;  2ZXO A;  5M3F G;  1LAB A;  1U4P A;  4GLV B;  4MZ9 A;  4DNT B;  4ZRZ A;  2IY5 B;  4A3E H;  1SMX A;  3CHB D;  2XN9 C;  1TWF H;  2K52 A;  1WVL A;  1B2T A;  3M7G A;  3JC6 6;  1YHB A;  1PYW D;  2CW0 D;  3GTQ H;  3D6C A;  5C6A A;  1IZ6 A;  1TS2 A;  4XT3 B;  1NMG A;  2KQ3 A;  2NWG A;  5G3L F;  2IPK D;  4GOP B;  1B3A A;  3HOZ H;  3PUZ A;  4L5S A;  2JXM B;  1RCV D;  5M9O A;  2EPB A;  1XJV A;  2IT1 A;  1DZ1 A;  3S9W A;  2KA7 A;  1ILP A;  3WWV A;  4B3M Q;  2NN6 H;  2VQE Q;  4DV1 Q;  5G3L D;  4HJ9 A;  5IP9 H;  1M90 C;  4K5X A;  1SSO A;  4GLX A;  2PMZ B;  1PRT B;  2XVS A;  1EFW A;  1PTO B;  4KJN A;  3AMU A;  2OTL A;  4IFD J;  5C4H A;  3CCQ A;  1NCV A;  4DV2 Q;  2Q2I A;  2PI2 E;  2A69 D;  1EQQ A;  1GM5 A;  5IP7 H;  5M3M G;  4PQX A;  2PO4 A;  1EYD A;  2QDB A;  4DUZ L;  1SNM A;  3E0J A;  2N3S A;  3GTO B;  1I94 L;  1LTT D;  1A15 A;  4HAE A;  3N6R A;  4BY1 B;  4RGM A;  4A93 H;  2AQ1 B;  1V1Q A;  2KEE A;  4XT1 B;  3SK8 A;  4DV6 L;  3GTL H;  3T4A C;  4DR7 Q;  3CD6 A;  1XMO L;  2Z4I A;  5I9P A;  4QIW E;  1V1O A;  1BDO A;  1V1P B;  5IWA Q;  1PH6 A;  1LTG D;  5I2Y A;  2GVB A;  1RJT A;  1S40 A;  2PZW A;  1CZW A;  4F87 A;  4WOR A;  2VQF Q;  2VW9 A;  4RA8 A;  3DM1 A;  2E2D C;  5IYB G;  4CJ2 C;  4HTH A;  4X66 L;  5FJ8 H;  4WJW A;  4R9W A;  3H0G H;  3T13 A;  1HNZ Q;  3J7A 5;  4TKO B;  2FFK B;  4AYB B;  4C3H G;  1UUP A;  2BE5 C;  3PO3 G;  3KOJ A;  4A3F G;  5CBA E;  4H7B A;  4BBS B;  2RBM A;  2HD3 A;  4BY7 G;  5C4X B;  3X3N A;  5IGF A;  2PNR C;  3I72 A;  4MN3 A;  3PIO A;  2OWO A;  1IHZ A;  2UXD L;  1GUG A;  4CDE C;  1WCM B;  3NE5 B;  3FMC A;  3D6W A;  3I73 A;  1NY4 A;  4X65 L;  4MTN A;  1TS5 A;  3S1N H;  4KI0 A;  2K28 A;  5JEA J;  1AH9 A;  1DJR D;  3UE1 A;  2R92 B;  3FKI B;  5LMU L;  4B3T Q;  1II3 A;  2JQO A;  4NXM L;  1VQA A;  4C56 C;  3RZO B;  4BWG B;  4ABN A;  4F8M A;  3KDF A;  2B2U C;  2ICE C;  4BBR B;  4LF7 Q;  1SYF A;  3H91 A;  2PW5 A;  2F0K A;  3HOU B;  1ET9 A;  2XRQ D;  4RKL A;  2HIV A;  3LX0 A;  1HQM C;  4HJA A;  4C3I G;  4KY7 A;  1M1K C;  2RDG A;  1FGU A;  1K83 B;  1KIX A;  5A2Q E;  4ZCK A;  3DWP A;  1I4P A;  2K03 A;  5C5M A;  5IGC A;  1C8C A;  5K36 H;  2F52 A;  4JBJ A;  2EYL A;  1UE5 A;  5CYU A;  3UDG A;  2A73 B;  4B9X A;  4CBV A;  1VQD A;  1HPC A;  2NYZ D;  4A3K H;  2B2V A;  4NW2 A;  1O7Y A;  4K2L A;  1CSP A;  1SBB B;  2RSN A;  2D2C C;  1I5F A;  2HT1 A;  2EZV A;  3ICE A;  4C3J H;  1Q12 A;  3E6Z X;  1SEB D;  3U4V A;  4IAL A;  2JA5 G;  4YHH L;  1TXY A;  2K05 A;  3J7A V;  1HJP A;  2K01 A;  4HIO A;  1JCK B;  3I4M B;  2SEB D;  3JAM i;  1ICF B;  3R8B A;  3T56 B;  1MSG A;  4QL5 A;  2HCI A;  3Q0A A;  2O4X A;  1PH3 A;  3K0X A;  5CV6 A;  5KND A;  4OXP A;  1Q86 C;  3K7U C;  1KD1 C;  4C2M H;  2IHE A;  3NXW A;  1X32 A;  3TQY A;  1Y8P B;  3ERQ A;  4DUZ Q;  2UUC L;  5LMN W;  1I94 Q;  1J6Q A;  5JVH 3;  4LFB L;  2CHB D;  1LM0 A;  2D5D A;  5IYD H;  4A3J G;  1DXM A;  4OEM B;  4LUZ A;  2R7Z H;  1F2Z A;  1YI2 A;  4DV6 Q;  5IGB A;  5IYC G;  3KBG A;  1W6J A;  2E74 C;  3MVV A;  1XMO Q;  2MO1 A;  1NE3 A;  3G7L A;  4LK1 C;  4QJF A;  3MTS A;  1FNV A;  5JJZ A;  1IL8 A;  2AWN A;  3RLF A;  2Q2U A;  4JYA L;  3QIA A;  3KDF B;  5C0X I;  3M4O H;  1SND A;  1STG A;  3IKJ A;  2EYM A;  2R93 H;  1VF7 A;  3HOY H;  3TP8 A;  4X66 Q;  3KJP A;  1EY4 A;  1S5E D;  3FDT A;  3A74 A;  3GV6 A;  3NBI A;  1EIH A;  3Q23 A;  1QUQ A;  4NPS A;  1TWG H;  4XQN A;  5IY0 A;  2WV6 D;  4E6I A;  4F7X A;  3PO2 H;  1HCZ A;  1N32 L;  5M5W H;  1EFI D;  2B2W C;  2I07 B;  5C3W A;  1UEA B;  1YNN C;  4BXX H;  4HIM A;  2UXD Q;  3A7A B;  3D0F A;  3MZ5 A;  2N78 A;  2B8F A;  1TR5 A;  2B63 G;  2CH4 A;  5EJW A;  1S5F D;  5HUR A;  5L37 A;  2KCM A;  4X65 Q;  2F0U A;  1CQV A;  4KD4 A;  4JBM A;  3GP7 A;  4A3C G;  3UDI A;  3EVQ A;  5HGT A;  3KLS A;  3CCU A;  3VR4 A;  5ELO A;  5LMU Q;  1N34 L;  2XSC A;  1BOS A;  2KCN A;  4OIJ A;  2JJQ A;  5CBE E;  4NXM Q;  4FF2 A;  4LJZ C;  4A3G H;  4BS9 A;  1VQ5 A;  3OMC A;  1QNU A;  5CV9 A;  3S1R B;  1RHP A;  1EY9 A;  2ALY B;  1VQ4 A;  1N36 L;  4IUT A;  4EQN A;  2AWO A;  1VQ9 A;  3QO2 A;  2VUM H;  1E0B A;  1Z9F A;  1JJ2 A;  4DR6 L;  1H9K A;  1QCB D;  1L0W A;  3CQZ H;  1PH2 A;  3MXN A;  1YNN D;  5ELD A;  4HJ5 A;  2NUC A;  4Y7N B;  5TSS A;  1Z47 A;  2I5L X;  2BDN A;  3AFQ A;  3HOV B;  4A3E G;  4YCW A;  1EQR A;  5GAH C;  3E5S A;  3PIO 3;  1O78 A;  4A3I B;  1ZXT A;  1L0Y B;  5DAU A;  3FP9 A;  3UDF A;  3BG3 A;  2NVX H;  5D65 A;  3EA6 A;  4KMU C;  1SMY C;  1VQ7 A;  3OTO L;  3TP6 A;  2K5D A;  4IUV A;  3QR8 A;  3MEF A;  1XXG A;  1WTH A;  4R8I A;  4JI0 Q;  2CWA A;  2A6H C;  4LW1 A;  3S2H H;  4CJ0 B;  4YHH Q;  1J8I A;  5IGG A;  1VS0 A;  1D5X C;  1V43 A;  3SGI A;  1X3F A;  2Y0S E;  4FO2 A;  2F0Q A;  1X6O A;  4A4I A;  3BS1 A;  2EY2 A;  4DK3 C;  2MO0 A;  2H1E A;  1B44 D;  5IP9 G;  4JBK A;  4A3D G;  1A2T A;  4NDX A;  2PZU A;  1PH4 A;  1MGS A;  1QUQ B;  2B2U A;  2KHS A;  1VQL A;  3I56 A;  5JPN C;  4ZQ3 A;  2UUC Q;  4YY3 L;  4I7Z C;  2PYK A;  3CKI B;  4LFB Q;  1HR0 W;  1A63 A;  1Y8O B;  4DV7 L;  1BVS A;  1SMY D;  3RUZ A;  2KJX A;  1LAC A;  5LL6 S;  3TN2 A;  3KYH C;  3ONA B;  4DV3 L;  2IL8 A;  3QB3 A;  1MJC A;  1C7Y A;  2A6H D;  3A8I E;  1HA5 A;  3A8J E;  4JW0 A;  2RDH A;  1S3O A;  1Q3L A;  2OF1 A;  3G6J B;  4QQB X;  1S5B D;  3URY A;  1DM0 B;  1U4L A;  3HFZ B;  4DAV A;  1KDA A;  1Q82 C;  2L55 A;  2JEA I;  2L12 A;  2KHI A;  2RCF A;  3S14 B;  1PTO H;  4A93 G;  1RDP D;  1A6X A;  2F0E A;  3MFY A;  1KRS A;  5GAG C;  1A3T A;  2RKS A;  5EPL A;  1WTW A;  1DGS A;  3NQT A;  2BH2 A;  2RA4 A;  1Q90 A;  1EY8 A;  5DNF A;  1STB A;  2VB2 X;  5E3F A;  4OWX B;  1CKO A;  5D3D A;  5A2Q L;  4BA2 I;  4RH6 A;  4X3U A;  3GTO H;  4L6T B;  1H9R A;  1E2V A;  3A56 A;  1O7L A;  4YCU A;  4PMC A;  4R4T A;  3HOX G;  4IUN A;  2AQ2 B;  4IUU A;  1SNP A;  1JE5 A;  1FL0 A;  1WYD A;  3BDL A;  1SYD A;  2NZH A;  4BY1 H;  2WB1 B;  1N32 Q;  2D0P A;  1H9S A;  4DR1 Q;  3CPW A;  1VQO A;  4DNR B;  4OX9 L;  5M5Y B;  4CDD C;  3WOE A;  3NHH A;  4LWC A;  1RIP A;  1JWS D;  3KLW A;  3M4Y A;  4IPD A;  4RCN A;  1E1O A;  1AE2 A;  4DR2 L;  1K3B C;  1I3Q B;  3D4R A;  1N34 Q;  4CHT B;  2K50 A;  1D2B A;  3GTM B;  4FP5 D;  1GKH A;  3RNU A;  4EGV A;  1N8R C;  3TS2 A;  1TS4 A;  4XQQ A;  2JK8 A;  2AUJ D;  1QVF A;  1B50 A;  5C0X H;  1IKL A;  3G6E A;  1N36 Q;  4UPA A;  3D31 A;  1TU2 B;  2BOS A;  1NR2 A;  4DR6 Q;  1CA6 A;  4BBS H;  5CV5 A;  3V05 A;  4N8X 1;  1B9M A;  5C4X H;  1FNU A;  3RZD B;  1H95 A;  5E4X A;  1JWM D;  1UE1 A;  3SVM A;  4CDC C;  5M5X B;  1WCM H;  1OTC A;  3HZX A;  1K0S A;  4P75 A;  2ID0 A;  1I50 B;  2PQE A;  2HDL A;  3H09 A;  5DM7 3;  1VQC A;  2F0N A;  4NB3 A;  1MHW C;  4ZUJ A;  2R92 H;  4OO1 I;  1EYA A;  2CQA A;  2ZTD A;  4V0B A;  4LF8 L;  4G7O C;  1VCI A;  1WFQ A;  5KIX A;  4N8F A;  4H44 C;  3RZO H;  2B2W A;  2UU9 L;  5H1S E;  1GHK A;  4DV5 L;  1M8A A;  4BBR H;  2DNC A;  4FXK C;  3VYU A;  3RMH A;  1W6K A;  5C3E B;  3ND8 A;  3CXC A;  3NUC A;  1K0R A;  1KAB A;  4KV6 A;  1QG7 A;  2E2J H;  3KUP A;  3EJI A;  3F2U A;  2F3I A;  4CKC A;  1EUJ A;  4DR4 L;  1F9R A;  3HOW G;  1SRU A;  4ME5 A;  1K83 H;  1K9M C;  2AHO B;  2DY8 A;  3S1Q B;  5EBC A;  1ENF A;  3J81 j;  1TY0 A;  5CV4 A;  4KHP L;  5C4Z A;  3IFD A;  4YY3 Q;  3OHX C;  1JE4 A;  1I4H A;  4U67 3;  3PCO B;  4DV7 Q;  1H9S B;  1AE3 A;  3GTJ B;  1CSQ A;  2CH4 W;  5COR A;  2G9H D;  1HHV A;  4DR5 L;  3FRP B;  1PYB A;  2L5T A;  4DV3 Q;  2QW7 A;  2YV5 A;  3EIV A;  1QB5 D;  1KDC A;  3MAQ A;  1ICW A;  1X3Q A;  2L9H A;  5IYD G;  4EQP A;  1YHQ A;  4LFA L;  2JA6 G;  2IX1 A;  4P74 A;  3T1H L;  4OL7 A;  1JOR A;  3I4M H;  2R7Z G;  4L8J A;  2JA7 G;  3I2Z A;  3LNN A;  1RF2 D;  4DXG A;  4HCS A;  4LF5 Q;  3DEP A;  3V96 A;  1DYQ A;  2QA4 A;  3GDE A;  2EXD A;  3OMG A;  2HDM A;  3H94 A;  3P1H A;  4C3H B;  3CC2 A;  1DOL A;  2A69 C;  3J81 E;  3PO3 B;  2K5H A;  4A3F B;  4BA1 I;  1HA6 A;  1NTG A;  2LSS A;  1BR9 A;  1LUZ A;  3T1Y L;  1XX8 A;  2O5J C;  4BY7 B;  1D5Z C;  2IW3 A;  1VQJ A;  3SE0 A;  1HUM A;  2HCC A;  4FXG C;  2HIX A;  2PQA A;  4ZLT F;  3KF8 B;  4FYD A;  1ASZ A;  4IJH A;  2GN5 A;  2N8N A;  4X3T A;  4OX9 Q;  3KF6 A;  2F1M A;  1XYI A;  2NVY B;  1Q8I A;  4FF4 A;  2H5X A;  2BH8 A;  2FJ2 A;  4DK6 C;  3CW2 C;  4DR2 Q;  1LT4 D;  4U68 A;  2Q2H A;  3S17 B;  5ELN A;  1IW7 D;  2KCC A;  4NP5 A;  1X3P A;  3ZYY X;  4IPC A;  1E2W A;  1TWC B;  1E22 A;  1ROD A;  4DUY L;  3VR2 A;  1TWA B;  2L15 A;  4WFN 3;  2Q8R E;  3CU7 A;  5FLX E;  2C35 B;  1NNX A;  4C3I B;  3JAM E;  2VNU D;  3TRE A;  4DF7 A;  1Q1B A;  3BYT B;  4EQ5 A;  3HKZ E;  1GUS A;  5IT9 E;  3VYT A;  1Z6H A;  1OXX K;  4QY7 A;  4OWW B;  2VUM G;  3IFT A;  1A0I A;  1FYC A;  3R2I A;  2P5Z X;  3SXH A;  4PV1 C;  2Q8I B;  2E2H B;  3DHQ A;  3CCS A;  4LF8 Q;  3G71 A;  1CZG A;  4LUV A;  2UU9 Q;  2JA5 B;  4DV5 Q;  2FIN B;  2G5D A;  2DNE A;  2Y0S G;  1PA6 A;  4IFD G;  4JCV E;  4A75 A;  3S1R H;  2K5V A;  4K8I A;  5I9O A;  1YIT A;  4GN5 A;  2ZJR A;  1XTC D;  5C44 G;  5E1F A;  4UP9 A;  5DEH A;  1ML0 D;  4DR4 Q;  1AZQ A;  2HQL A;  2B2T C;  3G4S A;  3DM3 A;  1YJ9 A;  3W3A A;  4Y7N H;  3N52 A;  4K8J A;  3VR3 A;  1O80 A;  1XWE A;  5KEE A;  2VB3 X;  4A3M H;  3HOV H;  1BQQ T;  1SE4 A;  4KHP Q;  3S24 A;  1VQ8 A;  4R4C A;  4FDB A;  2EIF A;  2F0W A;  2F0H A;  2PQA B;  4A3I H;  1JOO A;  2K04 A;  4A3J B;  1JIC A;  3L0O A;  4A76 A;  4DR5 Q;  3KF6 B;  2WKD A;  3Q8D A;  5LMN L;  5KGU A;  1PLF A;  2JA8 G;  1QNK A;  2GA4 B;  2F0S A;  1A3V A;  3PF4 A;  3E3X A;  3U9S A;  1A2U A;  1JJC B;  2PW7 A;  3PUW A;  2YU9 B;  2K14 A;  2V4D A;  3ERO A;  1CUK A;  4OO1 H;  1X54 A;  4IFD I;  4LFA Q;  2JYO A;  1XTD A;  4CKB A;  3J81 i;  4JI1 L;  4HJ7 A;  4JK1 C;  3VA5 A;  2K6A A;  4JI6 L;  1XNQ L;  1FD7 D;  3IRB A;  4MTK A;  3W2D A;  1QVC A;  2I46 A;  3FHW A;  2TSS A;  4LMQ D;  1IL2 A;  5CGK A;  1PFN A;  2UXC L;  4P71 A;  1ZYR D;  3R93 A;  3RN5 A;  2N49 A;  2XRS D;  5EKK A;  1NAP A;  3T1Y Q;  5AJ3 L;  4QB4 A;  3KLR A;  2MJ8 A;  1KC8 C;  2ES2 A;  4PZ7 A;  3GD7 A;  1IKM A;  1U4M A;  5JEA G;  3Q24 A;  2EYJ A;  2B63 B;  1BBW A;  1HQR D;  4DA2 A;  2A5H A;  1LTL A;  1F2M A;  2A1A A;  2NZO A;  1FR3 A;  2QGQ A;  5GAE C;  1EY7 A;  4UP7 A;  3S14 H;  1EU4 A;  4V19 0;  1NUC A;  1OO9 B;  3L2P A;  1G2S A;  3CCL A;  2RDF A;  5ISR A;  5I2X A;  1JMC A;  4JI5 L;  1SN8 A;  2ZM6 L;  1AFP A;  1GUW A;  4F88 A;  4K5W A;  2X69 A;  5FKA C;  2BDO A;  2L4N A;  3NQI A;  4C1N I;  4CJ1 B;  3P7J A;  2ZJQ A;  3K5L A;  4DUY Q;  2OT2 A;  2A6E C;  4X62 L;  4KKU A;  3K57 A;  3UE0 A;  3S1M B;  1XPR A;  2ENB A;  3M3Y B;  3MEH A;  1EIF A;  3PIP A;  5ELF A;  4L5Q A;  1HZA A;  1ENC A;  5IIF A;  2J0T D;  4AYB G;  4A3E B;  1D7Q A;  4K6D A;  1EOT A;  4AH6 A;  3KLS X;  4P73 A;  3I7F A;  3TBI B;  1HH2 P;  3I4L A;  2OTJ A;  5C4X G;  4KTA A;  4B9W A;  1BKB A;  2JA9 A;  3E0E A;  1X3G A;  5FLM H;  2VS1 A;  4N9T A;  2MP1 A;  2UUA L;  1I3Q H;  5IOD A;  1D6E C;  1WCM G;  5C5L A;  3BVG A;  2K32 A;  1WOC A;  3GTM H;  1S5D D;  3U4Z A;  4XIG S;  1UE7 A;  1WTO A;  1A8V A;  2UXB L;  3MA2 B;  3RLN A;  4TRD A;  4ZKB B;  2Z4H A;  2R92 G;  2A6E D;  3NBH A;  1YHA A;  3K58 A;  2F4V L;  4O42 A;  5IE8 A;  4YWK A;  4KN4 C;  1WTR A;  2UUB L;  2RCN A;  3J81 L;  2Z6K C;  5BR8 L;  1CA5 A;  2X6G A;  4FXD A;  1K8M A;  5IGE A;  4A3D B;  3ITP A;  3RZD H;  1SYB A; 
#chains in the Genus database with same CATH homology
 1KRS A;  5GRO A;  1EYG A;  4A3B G;  5GAG C;  2FXQ A;  5M5X H;  4B3T L;  1DGS A;  2BH2 A;  1HZB A;  3H3V I;  4Y52 H;  2DUD A;  3G48 A;  1UEB A;  1I50 H;  3T1H Q;  1GVP A;  4OWX B;  1CKO A;  3AYH B;  4LF7 L;  4PZ6 A;  3CAM A;  4BA2 I;  1X56 A;  1Y1W H;  3GTO H;  3M4Q A;  4HJ8 A;  1JT8 A;  5M3F G;  5GAD C;  2D62 A;  4PMW A;  1VQB A;  4YCU A;  4GLV B;  2PI2 A;  4MZ9 A;  4R4T A;  3HOX G;  1OXT A;  2IY5 B;  4A3E H;  1HR0 L;  3PUY A;  1SMX A;  1JE5 A;  1FL0 A;  1WYD A;  1TWF H;  2K52 A;  2NZH A;  3BJU A;  4BY1 H;  1N32 Q;  3NEN A;  2D0P A;  1KL9 A;  1PHJ A;  4DR1 Q;  3JC6 6;  3CPW A;  1YHB A;  1PFS A;  1VQO A;  5C3E H;  4OX9 L;  3GTQ H;  3CPF A;  1IZ6 A;  4AQY L;  1NMG A;  4LWC A;  1RIP A;  3KLW A;  4JI1 Q;  1HNX L;  3EBE A;  4JI6 Q;  2KEN A;  4IPD A;  1VQI A;  1XNQ Q;  5JJL A;  1E1O A;  4GOP B;  3HOZ H;  1AE2 A;  3K8A A;  5C0X J;  4DR2 L;  3PUZ A;  1UWV A;  3CF5 A;  4L5S A;  1S72 A;  4LUO A;  1VQP A;  1N34 Q;  2BA1 A;  2K50 A;  1Y1W G;  1XJV A;  3I4M G;  1PVO A;  2IT1 A;  5FLX c;  1GKH A;  3RNU A;  4RG1 A;  5GQO A;  2R6G A;  1N8R C;  3JAM c;  3TS2 A;  2UXC Q;  3WWV A;  1HNW L;  4B3M Q;  2JK8 A;  3S15 H;  2VQE Q;  1QVF A;  2R7F A;  4BY1 G;  4DV1 Q;  1YNX A;  3G6E A;  4HJ9 A;  1N36 Q;  1IBL L;  4UPA A;  2WAQ E;  3D31 A;  5IP9 H;  1M90 C;  4UY8 C;  5AJ3 Q;  1KRT A;  3GTJ H;  4DR6 Q;  4BBS H;  4GLX A;  1EFW A;  2A8V A;  2CQO A;  4DV0 Q;  4DV4 L;  2PNH A;  2WFW A;  5C4X H;  1K8G A;  3M7N A;  3RN2 A;  1W3S A;  2OTL A;  1H95 A;  3LGJ A;  4JI3 L;  4IFD J;  4APV A;  3CCQ A;  1UE1 A;  2LXJ A;  4IO9 A;  4DV2 Q;  2Q2I A;  2PI2 E;  4NXN Q;  3HOZ G;  1JB7 A;  1EQQ A;  1GM5 A;  5IP7 H;  1N33 L;  5M3M G;  1PH1 A;  1WCM H;  1SE8 A;  1OTC A;  4JI0 L;  1P16 A;  4P75 A;  3ULJ A;  4X64 L;  4B3S L;  4JI4 Q;  1XNR L;  1C0A A;  2ID0 A;  3HOW H;  1X3E A;  5HY6 A;  1U0L A;  4DUZ L;  2V1C C;  1OXU A;  1VQC A;  4DPG A;  2N3S A;  1I94 L;  1YJW A;  1G51 A;  4NB3 A;  2VZA A;  3F2D A;  3NBH B;  4JI5 Q;  2R92 H;  2NN6 G;  4OO1 I;  2ZTD A;  2RHQ B;  5C0X G;  2ZM6 Q;  1X9N A;  5IYB H;  4LF8 L;  1VCI A;  4B3R Q;  1WFQ A;  3GO5 A;  2MQH A;  1MIU A;  1WI5 A;  3J7Z C;  3RZO H;  2UU9 L;  4BBS G;  2I5H A;  1Y1V H;  4IPG A;  3STB C;  4C3H H;  3CP0 A;  5H1S E;  5M5Y H;  4DV5 L;  4A93 H;  4BBR H;  1V1Q A;  2E5L L;  3F8T A;  3PO3 H;  4A3F H;  1GD7 A;  3HKZ G;  3ZJY C;  4DV6 L;  4X62 Q;  3ULP A;  4ALP A;  4LF6 L;  3GTL H;  1K3R A;  4DR7 Q;  2I5M X;  1XPO A;  4R4I A;  3CD6 A;  1XMO L;  3CXC A;  4BY7 H;  4QIW E;  1K0R A;  4GN4 B;  1FJG L;  1KAW A;  1CKM A;  5IP7 G;  4XTC S;  2E2J H;  2F3I A;  1VQG A;  2K4K A;  5IWA Q;  1B70 B;  1PH6 A;  1EUJ A;  2GVB A;  2WB1 E;  2MNA A;  4DR4 L;  4YWL A;  1S40 A;  1W2B A;  2JA6 H;  1L1O A;  1Q8K A;  1SRU A;  2QEX A;  3U58 A;  1VQM A;  3HOW G;  1K83 H;  4LF4 L;  1K9M C;  2AHO B;  5J3B A;  4JI2 L;  2VQF Q;  2VW9 A;  2NVY H;  3M85 A;  5M3F H;  3FKI G;  4KLK A;  2JA7 H;  4GN3 B;  3J81 j;  5IYB G;  4KHP L;  3AFP A;  3J80 i;  4YY3 Q;  2K75 A;  1FVI A;  4X66 L;  5FJ8 H;  1NBW A;  3H0G H;  1MJE A;  1HNZ Q;  3J7A 5;  2UUA Q;  4K0K L;  4DAM A;  1Q1E A;  3PCO B;  4BBR G;  4DV7 Q;  2ATW A;  3PO3 G;  1AE3 A;  3KOJ A;  3E9H A;  4A3F G;  3S17 H;  1CSQ A;  4JYA Q;  4DR5 L;  3J81 c;  1PYB A;  4DV3 Q;  1NJI C;  4RMF A;  2NN6 I;  2WP8 J;  1TWC H;  3STB D;  1B8A A;  2YV5 A;  4JOI C;  4BY7 G;  4HID A;  1SLJ A;  3EIV A;  2OWO A;  3HOU G;  2UXB Q;  4GOP C;  3PIO A;  2F4V Q;  2UXD L;  3H15 A;  5IYD G;  2HHH L;  2JA6 G;  2IX1 A;  1YHQ A;  4LFA L;  1E24 A;  3M9B A;  4P74 A;  3T1H L;  2UUB Q;  4C3I H;  2PMZ E;  3PSI A;  3I4M H;  5BR8 Q;  1NY4 A;  4X65 L;  2R7Z G;  4GKK L;  1P8L A;  1XMQ L;  4MTN A;  2JA7 G;  3I2Z A;  3CCJ A;  5LMN Q;  2RF4 A;  2YTY A;  4KI0 A;  1A62 A;  5JEA J;  3S1N H;  1AH9 A;  1OXS C;  3UE1 A;  4LF5 Q;  5FJ8 G;  1KXL A;  1WJJ A;  3H0G G;  5LMU L;  4B3T Q;  3TRZ A;  2JQO A;  3OYY A;  2QA4 A;  4NXM L;  1VQA A;  2NVT H;  3GDE A;  4JI7 L;  4DR1 L;  2EXD A;  4POG A;  3CC2 A;  3KDF A;  4YCV A;  4LF7 Q;  2K5H A;  4R4O A;  4BA1 I;  1NTG A;  2LSS A;  4IOC A;  3PF5 A;  1R9T H;  1HZC A;  2E2H H;  4A3M G;  4GKJ L;  1LUZ A;  1RL2 A;  3T1Y L;  4GNX A;  1VQJ A;  2HIV A;  4R1J A;  5M3M H;  3OW2 A;  1HR0 Q;  3RR5 A;  4HJA A;  2JA5 H;  2HIX A;  2PQA A;  3KF8 B;  3S1Q H;  1ASZ A;  4IJH A;  1VQN A;  2GN5 A;  1M1K C;  3VDY A;  4X6A H;  2N8N A;  1FGU A;  2R7D A;  4JI8 L;  1KIX A;  4OX9 Q;  3KF6 A;  4AQY Q;  2F52 A;  5IT9 c;  1PH7 A;  1YVC A;  4JBJ A;  2H5X A;  1HNX Q;  4LNQ A;  1U5K A;  2BH8 A;  1UE5 A;  2VQE L;  3UDG A;  4DK6 C;  4DKA C;  1VQD A;  3CW2 C;  2AMC B;  4DR2 Q;  3K7A H;  4A3K H;  1YEZ A;  4LF9 L;  2Q2H A;  2AKW B;  5ELN A;  2KCT A;  1CSP A;  2RHS B;  4IPC A;  1I5F A;  2HT1 A;  3ICE A;  4GLA C;  4IPH A;  4C3J H;  1HNW Q;  1Q12 A;  4MNO A;  3U4V A;  1E22 A;  4AYB E;  4QGU A;  2JA5 G;  4DUY L;  1IBL Q;  4YHH L;  1TXY A;  1SR3 A;  1L1O B;  1VQE A;  2L15 A;  1HJP A;  3BZK A;  3TS0 A;  1QVG A;  4HIO A;  2C35 B;  2Z6K A;  1X55 A;  5C4J H;  2VNU D;  3TRE A;  1L2F A;  5K36 G;  4DV4 Q;  1Q1B A;  2Z0S A;  4EQ5 A;  3JAM i;  5JJK A;  3HKZ E;  3FKI H;  5IYC H;  4JV5 L;  4QL5 A;  4DR3 L;  4JI3 Q;  3OTO Q;  2YU9 H;  1YZ6 A;  1PH3 A;  1OXX K;  2OQK A;  3K0X A;  4A3K G;  1JJG A;  4QY7 A;  4OWW B;  4OXP A;  5C44 H;  1Q86 C;  2VUM G;  3CMA A;  1N33 Q;  3GTK H;  3S2D H;  1A0I A;  1VQF A;  4LFC L;  1KQS A;  3K7U C;  4X64 Q;  1KD1 C;  1Q46 A;  4B3S Q;  1XNR Q;  1IXR A;  4C2M H;  4L5R C;  2IHE A;  4ME3 A;  4OWT B;  3TQY A;  4DUZ Q;  1B7Y B;  1NMF A;  3A5Z B;  2UUC L;  2B29 A;  3HOU H;  4O2D A;  5LMN W;  1I94 Q;  1J6Q A;  4LFB L;  1PYS B;  1LM0 A;  1J5E L;  4R4Q A;  4JG2 A;  3CCS A;  4LF8 Q;  3G71 A;  5IYD H;  5DLQ E;  3KFU A;  1C9O A;  4GS3 A;  4A3J G;  4LUV A;  2UU9 Q;  4LUZ A;  4DV5 Q;  1PA6 A;  2Y0S G;  4IFD G;  2D0O A;  2B3G A;  4P72 A;  1YI2 A;  4JCV E;  2E5L Q;  2R7Z H;  1QZH A;  4DV6 Q;  1IBK L;  5IYC G;  3W5O A;  4A75 A;  3S1R H;  4EX5 A;  4LF6 Q;  1SRO A;  2K5V A;  1YIT A;  2JA8 H;  4GN5 A;  1XMO Q;  3CCR A;  2ZJR A;  5C44 G;  2CCZ A;  1FJG Q;  1IBM L;  2MO1 A;  1NE3 A;  3B6Y A;  4OON A;  4QJF A;  4UP9 A;  2YTX A;  3DLL A;  3ER0 A;  4DR4 Q;  2AWN A;  2HQL A;  2LXK A;  3RLF A;  3G4S A;  3DM3 A;  1YJ9 A;  2Q2U A;  4JYA L;  2XTI A;  3KDF B;  1PH5 A;  4DNI A;  4Y7N H;  2B63 H;  5C0X I;  2MFI A;  4LF4 Q;  3M4O H;  3I4O A;  4JI2 Q;  3HOV H;  4A3M H;  4TQU S;  3TEH B;  4GNX B;  4A3C H;  4KHP Q;  3S24 A;  1VQ8 A;  2R93 H;  1TWA H;  3HOY H;  4R4C A;  3NEM A;  4FDB A;  4X66 Q;  2EIF A;  3RLO A;  4A3L G;  1ASY A;  3S16 H;  2PQA B;  3AQQ A;  1PH9 A;  4K0K Q;  2YTV A;  4A3I H;  3KJP A;  3I4N G;  3A74 A;  3L0O A;  3CME A;  4A76 A;  3KF6 B;  4H02 A;  4DR5 Q;  3Q8D A;  3CC4 A;  2ZJP A;  1QUQ A;  4NPS A;  1TWG H;  5LMN L;  1G6P A;  4PG3 A;  5IY0 A;  2Q2T A;  2JA8 G;  1CKN A;  4LF5 L;  3PO2 H;  3PF4 A;  3CCV A;  1YJN A;  1JJC B;  3PUW A;  1N32 L;  5M5W H;  2K14 A;  2UXD Q;  4BXX H;  2BA0 A;  4HIM A;  2IHF A;  1K73 C;  1CUK A;  1X54 A;  3D0F A;  3BU2 A;  2HHH Q;  2N78 A;  4LFA Q;  3GTG H;  4IFD I;  3S1M H;  2B63 G;  3M3Y H;  1XTD A;  3K81 C;  3MXN B;  3J81 i;  1TWH H;  2KCM A;  4X65 Q;  4GKK Q;  3F2B A;  4JI1 L;  4HJ7 A;  1XMQ Q;  3HOV G;  4JI6 L;  5JJI A;  1SFO H;  1XNQ L;  4JBM A;  3UDX A;  4A3C G;  1MKH A;  3UDI A;  3PGZ A;  1EWI A;  3CCU A;  1E7Z A;  3IRB A;  4KHZ A;  3HOY G;  3EN2 A;  2A19 A;  5ELO A;  2R93 G;  1QVC A;  1L1O C;  5LMU Q;  3HKS A;  1T9H A;  1N34 L;  4JBW A;  3FHW A;  1OXV A;  2ZTE A;  4A3I G;  2JJQ A;  4NXM Q;  1IL2 A;  4JI7 Q;  2VL6 A;  4IOA A;  1UE6 A;  2UXC L;  4A3G H;  4P71 A;  1VQ6 A;  4IJL A;  1VQ5 A;  4B3M L;  3RN5 A;  2N49 A;  4WJ3 M;  1K8A C;  3PO2 G;  3F2C A;  1N9W A;  4DV1 L;  1VQ9 A;  2ALY B;  1VQ4 A;  1N36 L;  5HGQ A;  4BXX G;  2AWO A;  3BZC A;  3T1Y Q;  4GKJ Q;  1D8L A;  5AJ3 L;  2VUM H;  2CFM A;  1Z9F A;  2EQS A;  1JJ2 A;  4DR6 L;  4OO1 G;  1L0W A;  1PH2 A;  3CQZ H;  1KC8 C;  1E1T A;  4PZ7 A;  2ES2 A;  3GD7 A;  2GVA A;  4DV0 L;  1XPU A;  4HJ5 A;  5JEA G;  3CCM A;  1KHI A;  1BBW A;  4JI8 Q;  4TVA B;  4NXN L;  4DV2 L;  1Z47 A;  2KBN A;  1VQK A;  1LTL A;  2I5L X;  2OCE A;  3AFQ A;  3F1Z A;  1PH8 A;  2I0Q A;  2A1A A;  2NZO A;  4A3E G;  2QGQ A;  4YCW A;  5GAE C;  1EQR A;  1I6H H;  4UP7 A;  4JI4 L;  3S14 H;  5GAH C;  4A3J H;  4A3D H;  1Q7Y C;  3L2P A;  1G29 1;  4LF9 Q;  1Y14 B;  4A3G G;  5C3E G;  1E3P A;  3H3V H;  3CCL A;  4L5T A;  4WJ4 A;  2DGY A;  1Q81 C;  3E9I A;  3FP9 A;  4JI5 L;  3UDF A;  1JMC A;  1SN8 A;  2NVX H;  3ULL A;  2JE6 I;  1O7I A;  3I55 A;  2ZM6 L;  4DAY B;  1VQ7 A;  3OTO L;  1GO3 E;  4JOI A;  3CC7 A;  2WAQ G;  2IX0 A;  4GOP A;  4B3R L;  3A0J A;  3MEF A;  3PUX A;  4JI0 Q;  2CWA A;  4LW1 A;  1V9P A;  2ZJQ A;  3L7Z C;  3S2H H;  4DUY Q;  4YHH Q;  4X62 L;  3UE0 A;  1VS0 A;  1XPR A;  2ZTC A;  4DR7 L;  4JC0 A;  2VY3 A;  1V43 A;  1EIF A;  1X3F A;  3SGI A;  2Y0S E;  3U50 C;  4GNX C;  1X6O A;  2E8G A;  4L5Q A;  4A4I A;  1HZA A;  1LYL A;  3PIP A;  2JEB I;  3J80 c;  4JV5 Q;  4DK3 C;  4DR3 Q;  5EAY A;  2MO0 A;  5IWA L;  4AYB G;  3PV0 A;  2OQ0 A;  3A5U A;  5IP9 G;  4JBK A;  4A3D G;  2CWP A;  4A3L H;  1IYJ B;  4PZ8 A;  4AH6 A;  4POF A;  1PH4 A;  1D7Q A;  1VQH A;  4P73 A;  3I7F A;  4LFC Q;  1HH2 P;  3I4N H;  2OTJ A;  2VQF L;  5C4X G;  1QUQ B;  1BBU A;  1BKB A;  2JA9 A;  4UP8 A;  3E0E A;  1X3G A;  5FLM H;  3I56 A;  1VQL A;  1X65 A;  2VS1 A;  1CKN B;  4YY3 L;  2UUC Q;  1EIY B;  4A3B H;  3W1G A;  1HNZ L;  1EOV A;  2UUA L;  4LFB Q;  1I3Q H;  3GTP H;  1YIJ A;  4HIK A;  2YYZ A;  1WCM G;  4DV7 L;  1HR0 W;  1BVS A;  1J5E Q;  1A63 A;  4J15 A;  3M4P A;  1WOC A;  3GTM H;  3KYH C;  5E7N A;  2KHJ A;  3U4Z A;  4DV3 L;  4XIG S;  1MJC A;  1UE7 A;  1C7Y A;  3ERS X;  1A8V A;  2UXB L;  2K5N A;  3KJO A;  4AIM A;  3RLN A;  1IBK Q;  2R92 G;  1YBY A;  1S3O A;  3K80 C;  1YHA A;  2F4V L;  2ASB A;  2WB1 G;  4O0A A;  3HOX H;  5IE8 A;  1PV4 A;  3AEV A;  3PUV A;  4QQB X;  3NEL A;  3HFZ B;  1Q82 C;  4YWK A;  1QZG A;  3CCE A;  1IBM Q;  2JEA I;  2XGT A;  1Y1V G;  2KHI A;  2UUB L;  2RCN A;  2E2I H;  2Z6K C;  5BR8 L;  4A93 G;  4YWM A;  3W1B A;  3RZD H;  2CKZ B;  2NVQ H;  5FLM G;  1HZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...