4LUZA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luzA00
1VQHA 5EAYA 4OX9L 1YIJA 2IY5B 5AJ3L 1WJJA 1MJCA 4LF5L 3KLWA 4GNXA 3U50C 1X3EA 1Q81C 2LXJA 3Q8DA 1X55A 3D31A 4IPCA 1HR0W 3UE0A 1HH2P 3G4SA 2OTJA 4BA1I 4JI4Q 4JC0A 4JI8Q 2QGQA 3CMEA 1HZAA 4IFDG 2R6GA 2VS1A 2JA5G 2NZHA 3MEFA 2JA8H 5C4XG 2Z6KA 2ALYB 3S1RH 4LF6Q 2IT1A 3HOUH 3ZJYC 3UDIA 2ZTCA 4A3IH 3K0XA 3OYYA 1GD7A 1Z9FA 4PG3A 1PH2A 4ME3A 1IL2A 4A3LG 4YHHL 4LF8Q 5HY6A 1TWHH 2A8VA 3ER0A 2B63H 1VQ9A 3E9HA 2UUBQ 1BBWA 4IJHA 4TVAB 2H5XA 3T1HL 1CKMA 1L1OA 3JC66 4JI1L 5IYBG 3PO2G 3TS2A 5FLMG 3UE1A 2NN6I 5GAGC 3M9BA 4DK6C 2GVBA 4A3KG 3M4QA 3I56A 4X64Q 4TQUS 4DV0Q 5C4XH 2UUCL 3CD6A 3UDFA 3F2BA 4NXNQ 2F4VL 1M1KC 4POGA 4DUZL 1FJGL 1Q1EA 1RIPA 3BJUA 1K73C 2Q2UA 4PMWA 3PUXA 1LYLA 1IBLL 4C2MH 1X54A 1UE5A 4JBJA 4MTNA 1QVGA 3PO2H 5IYBH 3SGIA 2K52A 5FLMH 3RNUA 1CSQA 2VW9A 4DV3Q 4A3JG 3HFZB 1VQ5A 1YHQA 3HOYG 4A3KH 4A3BG 1XMOL 1FL0A 2AHOB 3I4OA 5C0XI 2ZJPA 4BY1H 4JBWA 5J3BA 1K3RA 3F2CA 1NBWA 2MNAA 1Q82C 4HJAA 3HOVH 3U58A 3PGZA 5IYDH 4LFAQ 1WFQA 1X65A 2HHHQ 3STBC 3LGJA 4A4IA 1EFWA 1X56A 2LXKA 2PQAA 3CAMA 3H3VI 1UE6A 4A3JH 2K5NA 4JOIA 1HNXQ 2OWOA 4DR2Q 1J5EQ 1EQQA 1E1TA 4DV7Q 1VQGA 1UE7A 4JI8L 4JI4L 3U4VA 4R4TA 1YNXA 1YVCA 4C3HH 1PH4A 4QIWE 1VQAA 4LF6L 3GTLH 1XMQQ 2WAQE 4AIMA 2IHEA 2KCMA 1L0WA 5C44G 4QGUA 4DV4Q 3CCUA 1VQFA 4A3EH 1VQDA 4LFCQ 3HOWH 1Z47A 4DR5Q 1I3QH 4MZ9A 3AFPA 2YTVA 3CCQA 2RCNA 3KDFB 4DKAC 4O0AA 5IP9H 2UUBL 3I4MG 1KRSA 1GKHA 1UE1A 4QJFA 4RMFA 1C7YA 4LF8L 1IXRA 1K9MC 1HJPA 4BBRH 1LTLA 4X64L 1CKNA 4DV0L 4IOCA 4B3TQ 2Y0SE 5ELOA 4BBSG 4IOAA 4A93G 4NXNL 1Y1WG 2E5LQ 4WJ3M 5M5YH 4DV1Q 2ZTEA 3MXNB 4OO1I 4JBKA 3CF5A 2WAQG 4P75A 1E22A 1QUQB 5E7NA 2NVTH 2VUMG 3HOZH 4DAYB 1B8AA 1PFSA 1NJIC 1VQ6A 2RF4A 2AKWB 3EIVA 4ALPA 4IFDJ 3M85A 3TREA 3S2DH 2RHSB 2ZJRA 1PA6A 4DV3L 4B3RQ 4QQBX 5HGQA 1DGSA 1IBKQ 3NBHB 3W1GA 4YCWA 4JYAQ 1OXUA 3BZCA 4YY3Q 1Y1WH 3H3VH 2Y0SG 4IJLA 1U0LA 5LMNQ 1I50H 5LMNW 1PH1A 2BA0A 4LFAL 5GADC 4DV5Q 2IHFA 2CKZB 1KQSA 1VQLA 3J7ZC 4OWXB 1W2BA 2R7ZG 3F8TA 3STBD 2E2HH 1KRTA 4HIDA 3GTPH 4IFDI 4DR2L 2D62A 1U5KA 3KOJA 1E24A 4A3CH 3CP0A 4DV7L 2MO0A 2NVQH 2CCZA 4APVA 4A3MG 1C0AA 4GNXC 1XTDA 3TQYA 4QL5A 1L2FA 1YBYA 4C3IH 3OTOQ 3TRZA 1XMQL 4IPGA 5IY0A 2VQFQ 1Y1VG 1V1QA 3CCMA 1JJ2A 1SN8A 2MFIA 4DV4L 2UU9Q 2F52A 1PH3A 4LFCL 5IYCG 4NB3A 4DR5L 2HHHL 4DR4Q 1KIXA 2FXQA 3GTKH 3S2HH 3CCLA 3RLFA 2HQLA 5M3FG 3RZDH 1P16A 1SMXA 1VQKA 2OCEA 1TWGH 1G291 3CPFA 4JI5Q 4B3TL 3RR5A 3CCJA 2KCTA 1PHJA 1L1OB 3G6EA 2E5LL 4DV1L 4X6AH 1EIFA 4L5RC 5IP7G 4JI2Q 1TWAH 2YYZA 3HKSA 3PIPA 2A1AA 3CCEA 4B3MQ 1EOVA 3F1ZA 5H1SE 3PSIA 2KBNA 3NENA 2WP8J 3S15H 2VQEQ 1Q12A 1KHIA 1S3OA 1XNQQ 4B3RL 1IBKL 1P8LA 1KC8C 5IWAQ 4JBMA 4JYAL 4A3GG 1D8LA 4YY3L 1Q1BA 1X3FA 2ZM6Q 4L5QA 2YU9H 2JA6G 5LMNL 3PV0A 4C3JH 5C0XJ 1M90C 3PUYA 3GO5A 1XPOA 1YITA 2JE6I 2JA5H 4R4OA 2CQOA 4DV5L 3KF6A 4XTCS 1I6HH 4GLXA 2XTIA 1JMCA 3EN2A 4A3LH 5K36G 2IX0A 2VL6A 2RHQB 4KLKA 4UY8C 4YWKA 1V43A 2PQAB 1EUJA 3K7UC 2PI2A 3M4OH 2NZOA 3W5OA 3D0FA 1N33Q 3OTOL 3DLLA 2R93G 4OWTB 2VQFL 2JA7G 1QZGA 1QVFA 3PUWA 2UU9L 1VS0A 1K83H 1OXVA 5C4JH 3CCSA 4H02A 3S14H 4DR4L 3H15A 2GN5A 1SRUA 1YHBA 3K7AH 1XPRA 4AYBE 2NVYH 2D0PA 1V9PA 2B3GA 3U4ZA 1WCMG 2JEBI 4JI5L 2EQSA 1VQ8A 4L5SA 3HOYH 1B70B 1VQJA 4YWMA 4A3BH 5BR8Q 2ZTDA 1CKOA 4AH6A 4JI2L 2JA7H 1HNZQ 2MO1A 1VQOA 1CKNB 1A62A 4DR7Q 4MNOA 3K8AA 1VCIA 5JEAG 4B3ML 1VQNA 2HIXA 3ULLA 3GD7A 2ID0A 2QEXA 4BA2I 3BZKA 2VQEL 2UUAQ 1XNQL 4AYBG 4HIMA 3PO3G 4PZ7A 4DV2Q 3CPWA 2R92G 3FP9A 2ZM6L 2KENA 1JB7A 4GS3A 1YZ6A 4JV5Q 1PH5A 5GQOA 5C3EG 4R4IA 4HIOA 4A3FG 2BA1A 2UXDQ 2AWNA 2ATWA 3GTQH 2MQHA 3UDXA 4DK3C 3RN5A 3J81j 4YCVA 1FVIA 4JCVE 1TWCH 5C44H 4BY7G 4P72A 4GLVB 1N8RC 2UXCQ 1K8AC 4AQYQ 1BVSA 1HZCA 3I4MH 4A75A 2UXBQ 1PH6A 2K5VA 1PV4A 4JI7Q 2R92H 4OX9Q 4HJ9A 4PZ8A 5GAEC 4P74A 1N33L 3FKIG 3NELA 1S40A 2I5LX 4UP8A 4BBSH 4GKJQ 1E7ZA 4A93H 1VQ7A 1GO3E 2ES2A 4NXMQ 2JJQA 3B6YA 1PYBA 3M7NA 4YCUA 1CUKA 2HIVA 2VUMH 1WOCA 3GDEA 3WWVA 3L2PA 3K81C 2HT1A 3CC2A 4LF9Q 1NTGA 4DR6Q 1NMGA 1VQEA 2R7DA 2VNUD 1HNXL 1X3GA 3KFUA 1PVOA 3FKIH 3A5ZB 1J5EL 3M4PA 5BR8L 1CSPA 1G51A 4K0KQ 3AFQA 3KJOA 4DNIA 3PCOB 1HNZL 2VZAA 3RZOH 4DR7L 3AYHB 4X66Q 3J80c 4OXPA 4JI6Q 3CC7A 4JI1Q 1I94Q 5M3MG 5M5XH 4DPGA 1W3SA 2L15A 3RLOA 4DR1Q 4GOPA 2UUAL 3HOXG 2R7ZH 4DR3Q 3PUZA 1E3PA 2K4KA 4DV2L 2ZJQA 1EIYB 3H0GG 2Z6KC 1KD1C 5IT9c 4LFBQ 1JJCB 2KHJA 2K50A 2E8GA 2WFWA 3FHWA 2NVXH 2OTLA 3S1NH 4JV5L 5JJKA 4DUZQ 2IX1A 3GTOH 4A3MH 1PH9A 2UXDL 1YEZA 3E0EA 5GROA 4PZ6A 3RN2A 3CW2C 3J81c 4EX5A 2DGYA 1L1OC 1C9OA 1Y1VH 1QVCA 1X6OA 3A74A 2UXCL 4LF4Q 1H95A 1E1OA 5IYCH 1J6QA 4AQYL 3KF6B 2JQOA 1YJWA 2UXBL 3H0GH 1O7IA 2Z0SA 1R9TH 1YHAA 3RLNA 4JI7L 5M3FH 2JEAI 4KHPQ 1OXSC 1N32Q 2JA8G 5JEAJ 3HOUG 4GN3B 4GKJL 4DV6Q 3BU2A 1SLJA 2GVAA 4A3IG 4HIKA 3UDGA 1HNWQ 4GN4B 4NXML 1JJGA 1VQBA 1K0RA 2B63G 5IP7H 2V1CC 4LWCA 5LMUQ 2VY3A 1HR0Q 3CMAA 2B29A 4O2DA 3ULJA 2I5HA 1ASYA 4HJ7A 2DUDA 5GAHC 1MIUA 2QA4A 2CWAA 4LF9L 1PH8A 4JI3Q 2I0QA 4JI0Q 3K80C 3HKZE 3AQQA 3ICEA 4DR6L 1Q86C 3T1YQ 1EWIA 4FDBA 4IPHA 4A3GH 1BBUA 4GKKQ 1T9HA 4K0KL 1WYDA 2AWOA 2JA6H 5ELNA 1MKHA 5DLQE 4X66L 3M3YH 4JOIC 4JI6L 3I7FA 4Y7NH 1I94L 1TXYA 2N78A 3CXCA 3I55A 4DR1L 4DR3L 2N49A 3KYHC 2BH2A 3KJPA 3E9IA 3S17H 3VDYA 2R7FA 1YJ9A 4B3SQ 4BY1G 4LF7Q 4LFBL 3HKZG 1XNRQ 1Q46A 4QY7A 1Q7YC 5IYDG 2PMZE 3CCVA 2E2JH 3HOVG 1WI5A 4X62Q 3S16H 4P71A 3EBEA 2N8NA 4J15A 4GLAC 3CC4A 2R93H 1IBMQ 4X65Q 1KAWA 1A0IA 3I4NG 3JAMi 2E2IH 2EIFA 4DUYQ 4LF4L 1A8VA 1VQMA 3PIOA 4Y52H 4IO9A 2I5MX 3S1MH 1KL9A 4IPDA 3GTGH 4KHPL 1S72A 4OONA 3KF8B 1AH9A 1N32L 3OW2A 1LM0A 2A19A 4NPSA 1LUZA 2K75A 1WCMH 4A3DG 2CWPA 3JAMc 1OXXK 1YI2A 4P73A 4UPAA 1IZ6A 5IWAL 2NN6G 4XIGS 4DV6L 1HNWL 4POFA 4BXXG 4A3EG 4UP7A 3A0JA 1N34Q 3HOWG 3I4NH 5LMUL 1YJNA 5IP9G 1HR0L 2K14A 3J7A5 3CQZH 1XJVA 1N36Q 2CFMA 4LW1A 4LUVA 4JG2A 4BBRG 1SE8A 2YV5A 4JI3L 4JI0L 2BH8A 3CCRA 2Q2HA 4YWLA 3T1YL 3TS0A 2PNHA 3GTJH 2PI2E 1SFOH 1XPUA 3PO3H 1QZHA 4A3DH 1G6PA 4BXXH 3GTMH 4GKKL 1JE5A 3S1QH 3HOZG 1NMFA 5C0XG 5JJLA 2OQKA 1UEBA 5AJ3Q 5C3EH 1SROA 5IE8A 1ASZA 4A3FH 2F3IA 3ULPA 1EYGA 4LF5Q 3PUVA 2EXDA 1OXTA 4L5TA 4BY7H 5JJIA 4B3SL 4LUZA 4LF7L 1MJEA 2K5HA 1AE2A 1XNRL 1K8GA 1Q8KA 3G48A 3L7ZC 2N3SA 3G71A 4GOPB 2Q2TA 3L0OA 3J80i 2WB1E 3F2DA 4GOPC 1A63A 4R4QA 2Q2IA 4X62L 2LSSA 3KDFA 4GN5A 4HJ8A 1FGUA 4OWWB 1EQRA 4KHZA 1D7QA 3ERSX 1IBML 4X65L 3S24A 4LNQA 4A76A 4UP9A 5FJ8G 3TEHB 1X9NA 1NY4A 4DUYL 4YHHQ 1VQ4A 1PYSB 1GVPA 1KXLA 4DAMA 4WJ4A 3T1HQ 3NEMA 1Y14B 4A3CG 1I5FA 2AMCB 4HJ5A 1OTCA 3PF4A 1JT8A 4R1JA 2ASBA 1GM5A 1QUQA 1PH7A 3DM3A 3IRBA 2XGTA 3J81i 2UUCQ 2WB1G 4R4CA 5FLXc 4LUOA 4EQ5A 1NE3A 1SR3A 2F4VQ 2YTYA 1N34L 5M5WH 1B7YB 1N9WA 1RL2A 5FJ8H 3A5UA 1FJGQ 1HZ9A 1N36L 1IBLQ 4OO1G 3PF5A 1AE3A 4KI0A 5M3MH 4GNXB 2C35B 3I2ZA 1VQIA 4RG1A 1HZBA 1VQPA 3HOXH 2JA9A 1UWVA 1XMOQ 2D0OA 3AEVA 1IYJB 1VQCA 2JK8A 3W1BA 2KHIA 1TWFH 2OQ0A 1BKBA 2YTXA
chains in the Genus database with same CATH superfamily
2DJFC 1VQHA 1HRJA 1YIJA 1MJCA 1UAPA 1Y1WB 1BNZA 4LF5L 2F0UA 3U50C 3H3VC 3W2DA 3Q8DA 3D31A 3UE0A 2OTJA 4IUQA 3J80L 5C4XG 4LF6Q 3SDZA 2C5CA 1QNUA 2FHTA 4A3IH 3OYYA 1FNWA 1VQ9A 1PZKD 3PO2G 5IYBG 3UE1A 3VYTA 1AFPA 1TR5A 4HTHA 3I56A 2DY7A 5BN5A 3F2BA 1NR4A 2NVXB 1BOSA 4A3MB 1RIPA 5ELFA 1PTOB 3PUXA 4C2MH 5FLMH 2F0QA 3HFZB 4A3BG 4K8JA 3E6ZX 4O42A 1BBXC 3I4OA 1HPCA 5C0XI 3TSSA 4BY1H 5J3BA 3X3NA 4RKLA 3C2PA 3PGZA 2F0SA 2WACA 1X65A 1EFWA 1X56A 2PQAA 2O4XA 3CAMA 2PZWA 4A3JH 4JOIA 3IKJA 1EQQA 4JI4L 1VQGA 4JI8L 3SR1A 4R4TA 1VQAA 2CHBD 4AIMA 1CA5A 4A3GB 3CCUA 3TS2A 1Z47A 2J4XA 4LF8L 2RCNA 3KDFB 4RMFA 1UE1A 3DEPA 4QF4A 4BBRH 4BBSG 4FYDA 4NXNL 1C48A 2ZTEA 4B9WA 2B2VC 3MXNB 4O1NA 4OO1I 1QUQB 4DAYB 2RDFA 1B8AA 5C0XH 1PFSA 1EYDA 1RDPD 3R8BA 3TREA 4B3RQ 4J6HA 5JPNC 4DV3L 1DOKA 3SHLA 3W1GA 4YCWA 3VR3A 2CQAA 3A8IE 2Y0SG 1PH1A 1DONA 3D4WA 4LFAL 4DV5Q 2IHFA 4UAIA 3R2IA 1ESRA 1W2BA 2XRQD 3BDOA 3F8TA 3MXUA 2E2HH 2BDOA 3SEBA 1KRTA 4DR2L 1HXYD 2H1EA 3M4YA 1U5KA 3C1FA 4A3CH 2A69C 3CP0A 1SNPA 3J7YW 4GNXC 3TQYA 4IALA 3PO3B 3OTOQ 1YBYA 1MD2D 3TP5A 2QDBA 4IPGA 2R92B 4NKLA 1RD9D 2FXQA 4A3FB 1FNVA 3S2HH 2HQLA 1TIID 4OO1H 1SMXA 1VQKA 1DZ1A 1G291 4JI5Q 4HMJA 4B3TL 4ZYSA 3J7AV 5C5LA 1I4PA 1EIFA 1GUGA 2A1AA 1PZID 1V1PA 1BDOA 3H09A 1MBYA 3FKIB 1HA6A 2KBNA 3ONAB 5KGUA 1SNCA 4QCLA 5CV6A 1P8LA 1KC8C 2KEEA 4JYAL 1DM0B 3OW7A 1X3FA 2ZM6Q 2JA6G 3GO5A 4HCEA 3WOEA 4R4OA 4XTCS 2A68C 1TY0A 1GUTA 2XTIA 4CBVA 2JXMB 1JICA 1SE2A 4KLKA 3P75A 1PTOC 2B2TC 3K7UC 4FXDA 3FPUB 1EYCA 2AUJD 4K5VA 1N33Q 3M7GA 2R93G 3VA7A 2D9UA 4C1NI 2JA7G 2UU9L 1JWSD 1W6JA 4QB4A 3DHQA 1SRUA 2F0LA 2DN8A 2NVYH 1KLUD 1O7LA 4MN3A 1IYVA 1U4RA 2JEBI 2NTTA 2NYZD 4L5SA 4A3BH 1B70B 1VQJA 4M8AA 4YWMA 1F9SA 2MUYA 1EFID 3OWEB 1CKNB 1A62A 4DR7Q 2HIXA 3ULLA 2ID0A 4A3IB 1WTOA 5I4DA 5IGEA 2Q8TA 4G57A 3FP9A 1JB7A 4OEMB 5J39A 1BCPD 1PH5A 4R4IA 5FLXE 2UXDQ 2ATWA 2WINB 4YCVA 3MEHA 4JCVE 4BY7G 1G6ZA 1N8RC 2UXCQ 1BVSA 1HZCA 4C2MB 1J8IA 2UXBQ 1PH6A 1WTPA 4JI7Q 1PV4A 1JQYD 1HTPA 5C4ZA 2J0TD 4OX9Q 1AEXA 3OOCA 4BBSH 1VQ7A 4BY1B 5KNBA 2EYHA 4YIJA 2QKIC 1PYBA 5A2QE 1SYBA 3D3RA 4N9PA 1WOCA 3R2TA 1NMGA 3HGBA 1K8MA 3VYRA 3MVVA 3A5ZB 4KJNA 3M4PA 1LT4D 3TZDA 1G51A 2PW7A 5BR8L 2N88A 1R4QB 3R93A 4DNIA 2L11A 2FFKB 4Q0FA 3AYHB 4OXPA 1CK1A 2JN4A 5CBEE 3K5MA 2K04A 5M3MG 5M5XH 1I94Q 3S1QB 1IHZA 3RLOA 2LS01 1FNUA 3OWFA 3PUZA 4PMBA 1PRTB 2AQ3B 2KECA 4DV2L 2Z6KC 1KD1C 4LFBQ 1HHVA 1VDZA 4BBRB 4JV5L 5BN3A 3A7AB 1PDQA 3TZUA 1PH9A 5GROA 1SMYD 3E0EA 2XSCA 3J81c 1C9OA 5JAVA 4RA8A 4RGOS 1H95A 4MTKA 3H0GH 4OHJA 1JORA 1SNMA 4KHVA 1UEAB 5D14A 5CV8A 4KJOA 3HOUG 4RKBA 4EQPA 4GN3B 1STHA 4DV6Q 1SLJA 3UDGA 1Q8IA 1S5FD 1WD1A 4X3TA 3DWQA 4LWCA 5LMUQ 3CMAA 2I5HA 3BG3A 1XX8A 5GAHC 1GUOA 4LF9L 2E2HB 2ZXPA 1PH8A 1K8OA 2I0QA 1SYFA 3O13A 3GP7A 4G7OC 4FNFA 2EYJA 2JA6H 2VB3X 2F3WA 3P20A 3RUZA 4KKUA 4TKOB 4IUTA 1IKLA 2WKCA 3N6RA 2O5JC 3KJPA 2F0NA 4B3SQ 4RWSC 3S2HB 3HKZG 1XNRQ 4ILWA 1Q46A 2AQ2B 1F9RA 1CTMA 4EVOA 5IYDG 2CVRA 2E2JH 4IUNA 3HOVG 4X62Q 3BS1A 1F2ZA 1EU4A 4J15A 2R93H 1IBMQ 4X65Q 1KAWA 1F9QA 1HFNA 4LF4L 1VQMA 2HCCA 4IO9A 2I5MX 5FO8B 4KHPL 1GUSA 1AH9A 3Q22A 3OW2A 1LM0A 2A19A 3JAMc 4UPAA 1IZ6A 1HNWL 2CH4W 3SVMA 4UP7A 4IQZA 2L55A 4OELB 5J1ZA 5IP9G 1SYCA 2R61A 3CQZH 1N36Q 2ZXRA 3ERQA 5EBDA 4XYQA 1QG7A 3CCRA 2Q2HA 1XPUA 4A3DH 2PI2E 1QZHA 3PO2B 1LLRD 2G9DA 4ODGA 4BXXH 1A3UA 3GTMH 1NMFA 3TBIB 1EQTA 5IE8A 3SE0A 1ASZA 4C1NK 3ULPA 3H94A 3PUVA 2EXDA 3SK5A 1OXTA 4LF5Q 4BY7H 5JJIA 2B2YC 4LF7L 2F0IA 2F0OA 3OIQA 1TU2B 5EGTA 1MJEA 2NVYB 3FEWX 4KKTA 1M8AA 3L7ZC 4DF7A 2N3SA 4ZUJA 4DXGA 4GOPB 3L0OA 2K32A 3F2DA 1A63A 2O5IC 1L0XB 4HJ8A 2LSSA 4GN5A 4A3BB 1FGUA 4KHZA 3BYYB 4LNQA 3QIAA 4WRDA 4A76A 1ESFA 3SXHA 3TEHB 1NY4A 1VQ4A 1G8ZD 1EU3A 4CDDC 1PYSB 2F0MA 4EQOA 4WJ4A 1H9KA 4ABNA 1I5FA 2RVLA 1LV9A 2AMCB 2EXZA 4HSVA 3PIO3 1OTCA 1D6EC 3I8ZA 3J81i 4KY6A 2WB1G 1PRTC 3EFXD 1N9WA 2HDMA 1EZ8A 5EPJA 3PF5A 1IW7D 4KI0A 5M3MH 2JSOA 3I2ZA 1VQIA 1C4QA 2F0EA 2NVTB 1UWVA 3HRZC 1TVXA 3AEVA 1IYJB 4H13C 3PV0A 1BKBA 2AUKA 5EAYA 1LTAD 4OX9L 1KNEA 4DNTB 4BBSB 5DM63 4S3SA 2F0TA 3OMCA 3HS0C 1X3EA 1TS2A 4IPCA 1HR0W 4TSSA 3G4SA 4C3JG 3GV3A 4JI4Q 4JI8Q 2QGQA 1SNOA 5ELEA 1NAPA 3MEFA 3HOUH 2MP1A 3MXPA 4A3LG 1Z9FA 1PH2A 4ME3A 2A6HD 4LF8Q 1STAA 3ER0A 4KD4A 3E9HA 1H9JA 4CJ1B 3T1HL 1L1OA 5M5XB 2F03A 1B53A 2IPKD 2XIWA 5T1GA 5FLMG 5GAGC 2B39A 1DD2A 2GVBA 1XWEA 4TQUS 3GTKB 3CD6A 4NXNQ 4FF1A 2F4VL 1M1KC 5EKLA 1Q1EA 5T1IA 2Q2UA 2RBMA 1IBLL 3IFDA 1EEFD 4JBJA 4ZUIA 5K5PA 3SGIA 2K52A 3RNUA 1CSQA 2VW9A 4IN3A 4DV3Q 4A3JG 1VQ5A 1U4LA 3VYSA 4A3KH 1FL0A 2XN9C 5D65A 1UNSA 2EOTA 4FO2A 3F2CA 1NBWA 1Q82C 4HJAA 3HOVH 3U58A 5IYDH 4LFAQ 3STBC 1D1KA 2EDGA 2R3ZA 3KLSA 2K5NA 4PV1C 1V1OA 2OWOA 4DR2Q 3NTHA 2EYOA 1DOMA 1E1TA 2E2DC 3EJIA 1GHKA 1DYQA 2KCMA 1L0WA 2JA6B 2PO4A 1VQFA 3J80E 2EYPA 4MZ9A 5LL6X 2YTVA 2UUBL 5D3IB 5IP9H 1GKHA 1F2LA 1A6XA 1JC7A 1JOOA 4X64L 4DV0L 4IOCA 2C9OA 4B3TQ 2Y0SE 4A93G 1SNDA 3NPPA 3T51B 5KYLA 1EY7A 5KEEA 3CF5A 2WAQG 4KD3A 2VUMG 1CHPD 3PMFA 4PNYA 1NJIC 2R93B 4LAAA 1I4HA 2RF4A 1EWCA 4QQBX 2JA7B 1LACA 1PA6A 4JYAQ 3BZCA 3PQIA 1YNNC 1VF7A 2Z1CA 1U0LA 1MSHA 1U4PA 1KQSA 4DK1A 3J7ZC 1TT2A 2R7ZG 1PYWD 3QWNA 2B2WA 3MFYA 2ZT9C 3CQZB 1GOZA 2D62A 2D2CC 2FINB 3CHBD 1E24A 4DV7L 2NVQH 4KN4C 4QL5A 4CJ0B 1F2YA 1PFBA 2E76C 3GTMB 3CCMA 1JJ2A 1SN8A 2KA7A 4LK1C 2UU9Q 1PH3A 4FXKC 3AU7A 4LFCL 2HHHL 3L9AX 1KIXA 3HEJA 1ZYRC 3RZDH 4EGVA 4IUUA 3V05A 4BY7B 4KK7A 2OCEA 5FKAC 1II3A 4DA2A 3EA6A 3NQTA 1PHJA 4X6AH 3G6EA 2EJFC 4DV1L 4L5RC 1TWAH 2CH4A 3HKSA 3PIPA 3V2TA 4ZAIA 1TKWB 2IL8A 3CCEA 5H1SE 1RF2D 2WP8J 4CKEA 1YNJC 4IURA 1EYAA 3AMUA 2QDLA 2EPBA 4YY3L 5J22A 2YU9H 4L5QA 5LMNL 2F0WA 4C3JH 3E5SA 5C0XJ 5IIFA 1LT5D 3KF6A 4RCNA 5G3LF 4GLXA 1C8CA 2V4DA 4NMZA 3EN2A 1F77A 4A3LH 2IX0A 5M3MB 4EQNA 2A69D 1WTVA 3W5OA 1EY0A 1T5XD 4Z9CB 3F2UA 1JWMD 3A8JE 4C56C 5FO7B 1K83H 1STEA 5C4JH 3CCSA 4DR4L 3TP7A 3H15A 2GN5A 1J9OA 1YHBA 2BOSA 1V9PA 1LTSD 4HAEA 3SK6A 4DXFA 1WCMG 2EQSA 5BR8Q 2ZTDA 4AH6A 4JI2L 3OPOA 3MZ5A 1LO5D 1VQOA 2I07B 1WTWA 3HOUB 4MNOA 2HD3A 3K8AA 5JEAG 1VQNA 3HG9A 3NWSA 4N9TA 5KNDA 2RDGA 1XNQL 3K5OA 4BS9A 4AYBG 4HIMA 1RKNA 4PZ7A 1I4QA 4DV2Q 5I2XA 1X3QA 2RSOA 4JK1C 4JV5Q 5GQOA 5C3EG 4KMUC 5JPMC 1CT1D 4HIOA 2AWNA 1HFGA 4KV6A 1FVIA 4DGZA 4UHVA 2A68D 4P72A 2B2UC 3T16A 3SK4A 1SYDA 4A75A 1CZGA 1L0YB 1MHWC 2K5VA 5ISRA 1A3VA 1PTOD 4HJ9A 3NELA 3MXGA 2I5LX 4A93H 4FP5D 3HKZB 3NP8A 2EYMA 3HOVB 4XQJA 2VUMH 2FJ2A 3WWVA 2HT1A 3CC2A 4LF9Q 3NTKA 1VQEA 2R7DA 2VNUD 3KFUA 2F1MA 3QB3A 5ELCA 2Z6BA 3PCOB 1HNZL 2VZAA 3RZOH 2XWBB 3CC7A 2B2VA 4JI1Q 1SJED 1W3SA 2L15A 2PMZB 1E2VA 2UUAL 3HOXG 2R7ZH 3IAYA 3T53B 5HGTA 2ZJQA 1EIGA 2IX3A 3H0GG 5IT9c 1JJCB 2K50A 4DUZQ 2IX1A 4PZ6A 4KY5A 4HCSA 1I4RA 1B9NA 1QVCA 1HQRD 1RTOA 3A74A 4LF4Q 4I7ZC 3FRPB 4DN4M 4AQYL 4U68A 1KDBA 4KHPQ 1R9TH 5JEAJ 2DNCA 2KVMA 1ET9A 1ZXTA 2GVAA 1HNWQ 4CGYB 5E4WC 4NXML 3E3XA 1VQBA 1K0RA 5CV4A 3DXJC 1S5DD 2CW0C 1H9SA 2QA4A 5M5WB 2CWAA 3HKZE 1KAAA 4V190 4OIKA 4K0KL 1T9HA 2NVQB 5ELNA 1ENCA 5I6YA 5IT9L 4JI6L 4Y7NH 2PPBC 3K57A 2WB1B 1DCZA 1TXYA 5I9OA 1LTID 2J7ZA 3S9WA 4DR3L 3KYHC 1GJXA 1SE4A 2R7FA 1YJ9A 4LF7Q 3RZDB 2K01A 3CCVA 2PMZE 3S16H 4P71A 3EBEA 2B8GA 2N8NA 3BYTB 2PZUA 1EY8A 4B9XA 1TWAB 1Y8NB 4V0BA 2E2IH 1A8VA 5FO9B 2LFNA 4Y52H 5LHY1 3GTGH 1EIHA 3KF8B 3QR8A 1N32L 1LTGD 2PQEA 4ID6A 1WCMH 2PNRC 5E1FA 4RCOA 3I90A 5JVH3 1YI2A 4A3DG 4XIGS 2B2TA 4BXXG 2YU9B 3A0JA 4C3JB 4FF4A 3I4NH 2F0GA 2D5DA 4X3KA 2RKSA 5HURA 5JEAH 4K2LA 4LUVA 4JG2A 2YV5A 3CKIB 4JI3L 2BH8A 3MWYW 2Q8IB 1SFOH 3EQLC 3TS0A 3GTJH 2L1BA 5AFWA 3DMUA 3LWUA 3DM1A 3HOZG 2E75C 5JJLA 1UEBA 3LNNA 5C3EH 4F87A 2F3IA 1EYGA 1K83B 4L5TA 5C4JB 2L9HA 3FPPA 4L63B 3OIPA 2FMCA 1I6VC 1Q8KA 3G71A 2HUGA 2WB1E 4A3JB 1TS5A 2Q2IA 1HCZA 3KDFA 1D7QA 3S24A 1PMRA 4DUYL 1JE4A 3NXWA 3T1HQ 4P2CB 2KCCA 1DOLA 3MXNA 3PF4A 3D6WA 5EPLA 1GM5A 1QUQA 1PH7A 4MHEA 2XGTA 3D4RA 4DAYA 4R4CA 5FLXc 3MA2B 1NE3A 4RGTA 1SR3A 4XDXA 2F4VQ 5FJ8H 3A5UA 1BCPF 4QMGA 2RSNA 4ZQ3A 1IBLQ 4RG1A 1B9MA 3HOXH 2JA9A 1VQCA 1MSGA 2KHIA 1TWFH 1J6QA 2EY2A 2YTXA 4A93B 5I2YA 3NTIA 2WIIB 5E3FA 4QIWB 2OXPA 2WAQB 1Q81C 2VUMB 4XT3B 1Z6HA 1SAPA 3VA5A 4BA1I 1HZAA 2R6GA 2VS1A 2Z6KA 2ALYB 4M1UB 3ZJYC 3UDIA 1XTCD 2ZTCA 4DAPA 3K6OA 4YHHL 3RZOB 2A8VA 5HY6A 1STNA 2UUBQ 5FLXL 1BBWA 4IJHA 2H5XA 3JC66 4JI1L 2R7ZB 1O78A 4A3KG 3M4QA 4X64Q 4DV0Q 3J81L 1BUVT 1GUWA 1PRTD 3C3LA 4DUZL 4PMWA 1LYLA 1QVGA 4MTNA 5FK9C 3ND9A 3QO2A 3HOYG 3K59A 2AHOB 2ZJPA 5BN4A 4JBWA 1JWUD 4WORA 1SSOA 2MNAA 3K5NA 1WFQA 4A4IA 2KCNA 2EYLA 1G2SA 4OL7A 1UE6A 4K6LA 1H9MA 2Z8LA 1EY9A 1B1ZA 4ZLTF 4I7AA 1HUNA 4DV7Q 1UE7A 3U4VA 4C3HH 1YVCA 1PH4A 4QIWE 3GTLH 5CV5A 2WAQE 2A6EC 4JPBW 2K05A 2SOBA 4LFCQ 4X3SA 1I3QH 3KBXA 3CCQA 2HHHQ 3I4MG 4DKAC 2VXWA 4O0AA 4Y7NB 3Q23A 4FF3A 1KRSA 4QJFA 1C7YA 1IXRA 1HJPA 1CKNA 1WVLA 3DWPA 4WJ3M 5M5YH 4DV1Q 2X6LA 3AB9A 4P75A 3FMCA 3HOZH 1KDCA 5E7NA 2B8FA 3HP3A 3S16B 5DEHA 1HQMC 1CHQD 3EIVA 3S2DH 3JAML 4R9WA 3EVQA 1QWYA 1FR3A 3GTGB 1KDAA 4YY3Q 1Y1WH 1BF4A 4IJLA 2KHSA 1STBA 5LMNQ 3KK7A 3CRLC 5LMNW 1WCMB 3QJYA 3OHXC 1KABA 2CKZB 1VQLA 4OWXB 1JB3A 5CMDA 1GUNA 3STBD 5EKKA 1EY6A 3GTPH 3NBHA 3N52A 2GA4B 1VMCA 4XT1B 4OGQC 2CCZA 2B2YA 4AYBB 1XTDA 3FDTA 1SFOB 3GTJB 1L2FA 3TRZA 4QUFA 5IY0A 1XMQL 1Y1VG 1K28A 4ZCKA 2MFIA 4DV4L 4XQQA 4DR5L 4DR4Q 2XNAC 5C3EB 2EY5A 3CCLA 2G5DA 3KBGA 3RLFA 5M3FG 1P16A 1PFNA 4J1MA 3CPFA 2TSSA 4G4KA 3CCJA 5C4HA 2E5LL 1G2TA 4TRDA 5IP7G 4JI2Q 1AP0A 3K0YA 1T5EA 2QEJC 4IZ8A 3U9SA 3F1ZA 3PSIA 3NENA 1ML0D 1Q12A 3BVGA 1S3OA 1XNQQ 3T56B 3UI2A 3KLRA 4LJZC 1VF5C 5ELBA 1WD0A 1IBKL 5IWAQ 1Q1BA 1EOTA 2MGSA 5M9OA 4HMIA 1YNND 1XPOA 3D8GA 1YITA 2CQOA 1ILPA 2OT2A 1CA6A 4UY8C 3D6CA 5CR3A 2L12A 1GXDC 1JOKA 2PQAB 1EUJA 1AZPA 3HOXB 1NSNS 2PI2A 3M4OH 3D0FA 3DLLA 2VQFL 3H0GB 1TWFB 3PUWA 2KJXA 1VS0A 4U673 2ICIA 4H02A 3S14H 1HA5A 1QJOA 5EJWA 1QB5D 1XPRA 4AYBE 1DXMA 5L37A 1ZYRD 3C1EA 2K5WA 5CBAE 3HOYH 1B50A 1D5MC 1CKOA 1HNZQ 1TQOA 1VCIA 4B3ML 2QEXA 1JOQA 4BA2I 3BZKA 2VQEL 2UUAQ 1SJHD 5IGGA 5KRUA 4H7BA 5EBCA 3U9OA 1U4MA 1YNJD 3CPWA 2PCFB 4GS3A 1YZ6A 2NUCA 1ZEQX 2F0DA 2MQHA 3UDXA 3QOJA 2L0CA 4DK3C 5IGFA 3J81j 1TWCH 1IL8A 4G7ZC 2E2JB 2F0HA 5JVG3 4AQYQ 3I4MH 1RODA 1PLFA 2DNEA 1K0SA 2R92H 2K28A 1A2UA 5GAEC 1TY2A 4UP8A 1E7ZA 3ITPA 1B3AA 1RTNA 2ES2A 1LT3D 4NXMQ 1ZKOA 3X3MA 2HIVA 3EROA 3NHHA 4LMQD 1G91A 3K81C 3FKIH 1SE3A 2A6HC 4K0KQ 3AFQA 3VR4A 3G6JB 4C3HB 3E0JA 3GTLB 3J80c 4FF2A 4A3DB 4JI6Q 1Q3LA 2LMCB 1VMPA 1H9RA 4GOPA 1I3QB 4E6IA 4DR3Q 1V1PB 2K4KA 1EIYB 3P7JA 2FMMA 3FHWA 2WFWA 3S1NH 3OMGA 5JJKA 3GTOH 1GHJA 3MAQA 4DK0A 1YEZA 4RH6A 5M5YB 3RN2A 3CW2C 4EX5A 1Y1VH 2L4NA 3HOZB 1E1OA 2Z9HA 1OO9B 2JQOA 1YJWA 3S2DB 5M3FH 1OXSC 1N32Q 2JA8G 2KEDA 1FD7D 1RHPA 3NSWA 4GKJL 4HIKA 4KY7A 1JJGA 4H44C 1ENAA 5I9PA 2B63G 5IP7H 4O2DA 1XXGA 4RGMA 5CORA 2H4OA 1WTQA 1MGSA 2DUDA 4PQXA 4DR6L 4JI3Q 3K80C 3GTPB 1Q86C 4F88A 3GV6A 4FDBA 3P1HA 1HUMA 2K03A 3I73A 4IPHA 1BBUA 1PZJD 2BE5C 1HTLD 1MKHA 2EYFA 5DLQE 5EPKA 4X66L 3M3YH 4JOIC 2KQ3A 4L6TB 4DR1L 1B2TA 2DJGC 2OF1A 3E9IA 5CYUA 4CDCC 3VDYA 3S17H 2Z4HA 1CQVA 4QY7A 1WI5A 2SDFA 4KKSA 3I3CA 1ICWA 1LT6D 3CC4A 4GLAC 1A0IA 2BDNA 3I4NG 4RFBA 2AQ1B 1QOHA 4I65A 2EIFA 4DUYQ 1TS3A 3RD4A 3PIOA 3S1MH 1KL9A 4JW0A 1PXUA 2DY8A 1S72A 4NPSA 2K75A 2CWPA 5D3DA 1OXXK 5IWAL 2NN6G 1CI3M 4POFA 1BO0A 4XYOA 4KTAA 4A3EG 3HOWG 1SNQA 1DJRD 1YJNA 1HR0L 2RDHA 2K14A 1XJVA 2CFMA 4LW1A 1NCVA 3V96A 3NQIA 4JI0L 2QILA 2CW0D 4CJ2C 4YWLA 1A2TA 3T1YL 2PNHA 1G6PA 2ICEC 4GKKL 1JE5A 3S1QH 4NW2A 3M4OB 1SYGA 4A3KB 2WKDA 2OQKA 4J8QA 2IW3A 1AZQA 3S14B 2F0FA 5IT9E 4LUZA 2N55A 5CC4A 2K5HA 1AE2A 2EZVA 1O7ZA 3VR6A 3J80i 4R4QA 3HOYB 4OWWB 1E0BA 2PZTA 1RCVD 5FJ8G 1X9NA 4YHHQ 3A56A 1Y14B 3TP6A 4HJ5A 2B2UA 2M9VA 4R1JA 2ASBA 5DNFA 1S5BD 4C3IG 1QE6A 3DM3A 3IRBA 3LWEA 2JYOA 4LUOA 5CV9A 4RAUC 2YTYA 1N34L 1B7YB 1HZ9A 3G7LA 4F7XA 5I6WA 4XXEA 1AE3A 1TWCB 4N8FA 1I4XA 5C5MA 1HZBA 2RA4A 1VQPA 2D0OA 3I4MB 2JK8A 3J7AF 4ZK9B 1B3QA 4K5XA 1PTOF 2X69A 4HEDA 2IY5B 5AJ3L 3WDNA 1WJJA 2A74C 3KLWA 4GNXA 1A3TA 2LXJA 1Q90A 1X55A 1STYA 1HH2P 1X3PA 2HCIA 4Q5VA 5C3WA 4JC0A 3CMEA 4IFDG 3NUCA 2JA5G 2NZHA 2JA8H 3DUZA 3S1RH 1SXTA 2IT1A 4RGNA 3K0XA 1KTKA 1IKMA 1GD7A 4PG3A 1IL2A 1R4PB 2B63H 3IL8A 1TWHH 4JVZA 3TDQA 1BCPB 4TVAB 1CKMA 3K5LA 5JJZA 1JR0D 1S4ZA 2NN6I 3M9BA 4DK6C 2QW7A 5C4XH 2UUCL 3UDFA 1B4OA 3S1NB 1ONLA 5CV7A 3GTOB 4POGA 1FJGL 1ENFA 1ET6A 3NWTA 3BJUA 4DAVA 1K73C 2JP1A 2VB2X 1X54A 1UE5A 2NBFA 3PO2H 1Y1VB 5IYBH 1YHQA 4NDXA 1XMOL 1E2ZA 2NWGA 4BWGB 5M3FB 1K3RA 4C3HG 5A35A 5KNCA 3L3OC 2G9HD 3LGJA 2LXKA 1RJTA 2HQEA 3H3VI 2EJGC 1HNXQ 3TMEA 1EY5A 1J5EQ 1MI2A 2SNSA 2F0KA 1YNXA 4LF6L 3Q6SA 1XMQQ 5C44G 2IHEA 2K6AA 2NN6H 4G7HC 4QGUA 4DV4Q 5E4XA 4A3EH 1VQDA 3HOWH 1LABA 4DR5Q 3AFPA 4HSPA 1QILA 3M3YB 4WFN3 5C6AA 1K9MC 3NK9A 1EQVA 1LTLA 3S17B 4IOAA 2NTSA 5ELOA 2MHVA 1Y1WG 2E5LQ 5FOBB 4JBKA 1CM9A 1E22A 2NVTH 3J81E 1V8QA 1VQ6A 1Y8OB 2AKWB 4ALPA 4IFDJ 3M85A 2RHSB 2ZJRA 2K1BA 5HGQA 1DGSA 1IBKQ 3NBHB 3S1MB 1OXUA 3H3VH 3NBIA 1I50H 1D5XC 2BA0A 1STGA 2HDLA 4GZYC 5GADC 4HN7A 4CKBA 4XQNA 4HIDA 5NUCA 4IFDI 1B44D 3TP8A 3KOJA 5EQ0A 1M4VA 5COYA 1C0AA 2MO0A 3QOLA 4APVA 4A3MG 4OIJA 5TSSA 2XWJB 4KN7C 4C3IH 5LL6S 2BCOA 2VQFQ 3C46A 1V1QA 2QCPX 3I91A 2F52A 4RHSA 2A6ED 5IYCG 4NB3A 1LTBD 1LTRD 2IJ0A 1ICFB 3GTKH 1IYUA 1TWGH 1CFMA 3RR5A 2KCTA 1SDFA 1L1OB 1EZ6A 2YYZA 1BQQT 2MJ8A 4B3MQ 3MTSA 1EOVA 4N8X1 2TMPA 3DEOA 3S15H 4MIUA 2VQEQ 1KHIA 4B3RL 4IUPA 3T13A 4JBMA 1I4GA 3BDCA 1WTRA 4A3GG 2UXBL 1D8LA 1BCPC 2PW5A 3A55A 2SEBD 4CKCA 1M90C 3JAME 4IFDH 3PUYA 4HR7B 1O80A 2JA5H 2JE6I 4DV5L 2LKVA 1I6HH 1JMCA 5K36G 1AW7A 3D4DA 2VL6A 2RHQB 2EY6A 3BVMA 4YWKA 1V43A 1S5ED 3R3OA 2K5DA 2NZOA 1KLGD 5A2QL 3OTOL 4OWTB 1R9TB 1AN8A 1QZGA 1QVFA 1OXVA 1Z7TA 4K6DA 2F0PA 3K7AH 4QUCA 2D0PA 2B3GA 3U4ZA 4JI5L 1D1IA 1VQ8A 4UDUC 4R8NA 1QNKA 2JA7H 2MPMA 1Y69U 2MO1A 2JA8B 3S1RB 2OEOA 3DWAA 3T4AC 3GD7A 3PIP3 3IFTA 3CRKC 4DNRB 2B63B 1TWHB 3PO3G 1F9PA 4PMCA 4L8JA 1D2BA 1EL0A 2R92G 2ZM6L 2KENA 4K2KA 1SMYC 5C4XB 4A3FG 2BA1A 4X3UA 3GTQH 3RN5A 5C44H 3KF8A 1QCBD 4GLVB 1PRTF 1K8AC 2SNMA 3ND8A 1XYIA 2I46A 1NUCA 1EY4A 3KUPA 3BZDB 2E2IB 3WOFA 3A8KE 3MHBA 4PZ8A 4P74A 1N33L 3FKIG 1S40A 4GKJQ 2IWHA 1SEBD 3I72A 2M2LA 1U9RA 1GO3E 3VR5A 1E2WA 5JOBA 4DU9A 2ENBA 2JJQA 3B6YA 4ZKBB 3M7NA 4YCUA 1CUKA 2NZ1D 3H91A 3GDEA 3L2PA 3W3AA 1KNAA 1NTGA 3I4NB 4DR6Q 1WTXA 1UUPA 3I4LA 1HNXL 1X3GA 2ZXOA 1PVOA 1J5EL 1CSPA 2WV6D 3KJOA 2K33A 4DR7L 4X66Q 1Y8PB 4DPGA 1SYEA 4DR1Q 4A3EB 2KUMA 3HOWB 4DFAA 1E3PA 2P5ZX 2RQXA 2KHJA 2LY7A 2E8GA 2NVXH 2OTLA 4A3MH 4K5WA 2A5HA 2UXDL 1PTOH 1W6KA 2DGYA 1L1OC 3I70A 2EE1A 1X6OA 2UXCL 2K7VA 4NP5A 5IYCH 2F0JA 3K58A 1NNXA 2RCFA 3KF6B 2XRSD 3A54A 2X6GA 1O7IA 2Z0SA 3LX0A 1YHAA 3MC0B 4K14A 3RLNA 5CGKA 4JI7L 2JEAI 4B08A 3BU2A 1O7YA 2E74C 4ZRZA 1D5ZC 4A3IG 4GN4B 1X32A 1I50B 2V1CC 2VY3A 2EJMA 3VR2A 5KIXA 1HR0Q 2B29A 3ULJA 1ASYA 4HJ7A 1MIUA 3ICEA 4JI0Q 3URYA 3AQQA 3T1YQ 1EWIA 4A3GH 4GKKQ 1WYDA 2Y0SB 2AWOA 4H0LC 4C3IB 3I7FA 4ULLA 1I94L 1BXTA 2N78A 3CXCA 3I55A 2EY1A 4F8MA 4WJWA 2N49A 2BH2A 5K36H 4BY1G 4LFBL 1Q7YC 1TWGB 1LTTD 2NB0A 5IOCA 3JAMi 1BR9A 1EWHA 2Z4IA 5ELDA 4IPDA 3NE5B 2F4IA 3S15B 4OONA 5DAUA 3MFGA 1LUZA 3Q0AA 4P73A 4DV6L 1JCKB 1N34Q 5LMUL 3BVZA 3OSOA 3KLSX 2JA5B 3H6MA 3J7A5 1IW7C 4ZKCB 1I6HB 2F0VA 5IGDA 1CQFA 5IODA 4BBRG 1SE8A 2QF7A 1CZWA 5DM73 3PO3H 3TN2A 4CHTB 4FXGC 4IUVA 4K8IA 2L5TA 5C0XG 4CDEC 4CDFC 2B2WC 5AJ3Q 2BE5D 1SROA 3HZXA 4A3FH 1PFMA 3FVQA 5C3XA 1FYCA 5EKIA 1S5CD 1TS4A 4FVMA 4B3SL 3K7AB 1XNRL 1K8GA 1NR2A 3G48A 2Q2TA 2KOLA 1EEID 2EVBA 4GOPC 4X62L 3CU7A 1EQRA 2Q8RE 3ERSX 1IBML 4X65L 4UP9A 3SK8A 1GVPA 1KXLA 4DAMA 3NEMA 4A3CG 4RHRA 1SBBB 1JT8A 5KYIA 3RMHA 4R8IA 1ILQA 2UUCQ 5G3LD 2PYKA 1A15A 1K3BC 4EQ5A 2M00A 5M5WH 1RL2A 1FJGQ 2XVSA 4ME5A 3GTQB 2F3VA 3A7LA 1N36L 4OO1G 5C44B 1F2MA 1FGBD 2A73B 3VYUA 2C35B 4GNXB 2O2LD 1WTHA 3GQBA 3Q24A 3BDLA 5F2DA 1XMOQ 3QG1A 3ZYYX 5IGBA 3W1BA 1H9SB 2K5QA 2OQ0A 5IGCA
chains in the Genus database with same CATH topology
1VQHA 5EAYA 4OX9L 1YIJA 2IY5B 5AJ3L 1WJJA 1MJCA 4LF5L 3KLWA 4GNXA 3U50C 1X3EA 1Q81C 2LXJA 3Q8DA 1X55A 3D31A 4IPCA 1HR0W 3UE0A 1HH2P 3G4SA 2OTJA 4BA1I 4JI4Q 4JC0A 4JI8Q 2QGQA 3CMEA 1HZAA 4IFDG 2R6GA 2VS1A 2JA5G 2NZHA 3MEFA 2JA8H 5C4XG 2Z6KA 2ALYB 3S1RH 4LF6Q 2IT1A 3HOUH 3ZJYC 3UDIA 2ZTCA 4A3IH 3K0XA 3OYYA 1GD7A 1Z9FA 4PG3A 1PH2A 4ME3A 1IL2A 4A3LG 4YHHL 4LF8Q 5HY6A 1TWHH 2A8VA 3ER0A 2B63H 1VQ9A 3E9HA 2UUBQ 1BBWA 4IJHA 4TVAB 2H5XA 3T1HL 1CKMA 1L1OA 3JC66 4JI1L 5IYBG 3PO2G 3TS2A 5FLMG 3UE1A 2NN6I 5GAGC 3M9BA 4DK6C 2GVBA 4A3KG 3M4QA 3I56A 4X64Q 4TQUS 4DV0Q 5C4XH 2UUCL 3CD6A 3UDFA 3F2BA 4NXNQ 2F4VL 1M1KC 4POGA 4DUZL 1FJGL 1Q1EA 1RIPA 3BJUA 1K73C 2Q2UA 4PMWA 3PUXA 1LYLA 1IBLL 4C2MH 1X54A 1UE5A 4JBJA 4MTNA 1QVGA 3PO2H 5IYBH 3SGIA 2K52A 5FLMH 3RNUA 1CSQA 2VW9A 4DV3Q 4A3JG 3HFZB 1VQ5A 1YHQA 3HOYG 4A3KH 4A3BG 1XMOL 1FL0A 2AHOB 3I4OA 5C0XI 2ZJPA 4BY1H 4JBWA 5J3BA 1K3RA 3F2CA 1NBWA 2MNAA 1Q82C 4HJAA 3HOVH 3U58A 3PGZA 5IYDH 4LFAQ 1WFQA 1X65A 2HHHQ 3STBC 3LGJA 4A4IA 1EFWA 1X56A 2LXKA 2PQAA 3CAMA 3H3VI 1UE6A 4A3JH 2K5NA 4JOIA 1HNXQ 2OWOA 4DR2Q 1J5EQ 1EQQA 1E1TA 4DV7Q 1VQGA 1UE7A 4JI8L 4JI4L 3U4VA 4R4TA 1YNXA 1YVCA 4C3HH 1PH4A 4QIWE 1VQAA 4LF6L 3GTLH 1XMQQ 2WAQE 4AIMA 2IHEA 2KCMA 1L0WA 5C44G 4QGUA 4DV4Q 3CCUA 1VQFA 4A3EH 1VQDA 4LFCQ 3HOWH 1Z47A 4DR5Q 1I3QH 4MZ9A 3AFPA 2YTVA 3CCQA 2RCNA 3KDFB 4DKAC 4O0AA 5IP9H 2UUBL 3I4MG 1KRSA 1GKHA 1UE1A 4QJFA 4RMFA 1C7YA 4LF8L 1IXRA 1K9MC 1HJPA 4BBRH 1LTLA 4X64L 1CKNA 4DV0L 4IOCA 4B3TQ 2Y0SE 5ELOA 4BBSG 4IOAA 4A93G 4NXNL 1Y1WG 2E5LQ 4WJ3M 5M5YH 4DV1Q 2ZTEA 3MXNB 4OO1I 4JBKA 3CF5A 2WAQG 4P75A 1E22A 1QUQB 5E7NA 2NVTH 2VUMG 3HOZH 4DAYB 1B8AA 1PFSA 1NJIC 1VQ6A 2RF4A 2AKWB 3EIVA 4ALPA 4IFDJ 3M85A 3TREA 3S2DH 2RHSB 2ZJRA 1PA6A 4DV3L 4B3RQ 4QQBX 5HGQA 1DGSA 1IBKQ 3NBHB 3W1GA 4YCWA 4JYAQ 1OXUA 3BZCA 4YY3Q 1Y1WH 3H3VH 2Y0SG 4IJLA 1U0LA 5LMNQ 1I50H 5LMNW 1PH1A 2BA0A 4LFAL 5GADC 4DV5Q 2IHFA 2CKZB 1KQSA 1VQLA 3J7ZC 4OWXB 1W2BA 2R7ZG 3F8TA 3STBD 2E2HH 1KRTA 4HIDA 3GTPH 4IFDI 4DR2L 2D62A 1U5KA 3KOJA 1E24A 4A3CH 3CP0A 4DV7L 2MO0A 2NVQH 2CCZA 4APVA 4A3MG 1C0AA 4GNXC 1XTDA 3TQYA 4QL5A 1L2FA 1YBYA 4C3IH 3OTOQ 3TRZA 1XMQL 4IPGA 5IY0A 2VQFQ 1Y1VG 1V1QA 3CCMA 1JJ2A 1SN8A 2MFIA 4DV4L 2UU9Q 2F52A 1PH3A 4LFCL 5IYCG 4NB3A 4DR5L 2HHHL 4DR4Q 1KIXA 2FXQA 3GTKH 3S2HH 3CCLA 3RLFA 2HQLA 5M3FG 3RZDH 1P16A 1SMXA 1VQKA 2OCEA 1TWGH 1G291 3CPFA 4JI5Q 4B3TL 3RR5A 3CCJA 2KCTA 1PHJA 1L1OB 3G6EA 2E5LL 4DV1L 4X6AH 1EIFA 4L5RC 5IP7G 4JI2Q 1TWAH 2YYZA 3HKSA 3PIPA 2A1AA 3CCEA 4B3MQ 1EOVA 3F1ZA 5H1SE 3PSIA 2KBNA 3NENA 2WP8J 3S15H 2VQEQ 1Q12A 1KHIA 1S3OA 1XNQQ 4B3RL 1IBKL 1P8LA 1KC8C 5IWAQ 4JBMA 4JYAL 4A3GG 1D8LA 4YY3L 1Q1BA 1X3FA 2ZM6Q 4L5QA 2YU9H 2JA6G 5LMNL 3PV0A 4C3JH 5C0XJ 1M90C 3PUYA 3GO5A 1XPOA 1YITA 2JE6I 2JA5H 4R4OA 2CQOA 4DV5L 3KF6A 4XTCS 1I6HH 4GLXA 2XTIA 1JMCA 3EN2A 4A3LH 5K36G 2IX0A 2VL6A 2RHQB 4KLKA 4UY8C 4YWKA 1V43A 2PQAB 1EUJA 3K7UC 2PI2A 3M4OH 2NZOA 3W5OA 3D0FA 1N33Q 3OTOL 3DLLA 2R93G 4OWTB 2VQFL 2JA7G 1QZGA 1QVFA 3PUWA 2UU9L 1VS0A 1K83H 1OXVA 5C4JH 3CCSA 4H02A 3S14H 4DR4L 3H15A 2GN5A 1SRUA 1YHBA 3K7AH 1XPRA 4AYBE 2NVYH 2D0PA 1V9PA 2B3GA 3U4ZA 1WCMG 2JEBI 4JI5L 2EQSA 1VQ8A 4L5SA 3HOYH 1B70B 1VQJA 4YWMA 4A3BH 5BR8Q 2ZTDA 1CKOA 4AH6A 4JI2L 2JA7H 1HNZQ 2MO1A 1VQOA 1CKNB 1A62A 4DR7Q 4MNOA 3K8AA 1VCIA 5JEAG 4B3ML 1VQNA 2HIXA 3ULLA 3GD7A 2ID0A 2QEXA 4BA2I 3BZKA 2VQEL 2UUAQ 1XNQL 4AYBG 4HIMA 3PO3G 4PZ7A 4DV2Q 3CPWA 2R92G 3FP9A 2ZM6L 2KENA 1JB7A 4GS3A 1YZ6A 4JV5Q 1PH5A 5GQOA 5C3EG 4R4IA 4HIOA 4A3FG 2BA1A 2UXDQ 2AWNA 2ATWA 3GTQH 2MQHA 3UDXA 4DK3C 3RN5A 3J81j 4YCVA 1FVIA 4JCVE 1TWCH 5C44H 4BY7G 4P72A 4GLVB 1N8RC 2UXCQ 1K8AC 4AQYQ 1BVSA 1HZCA 3I4MH 4A75A 2UXBQ 1PH6A 2K5VA 1PV4A 4JI7Q 2R92H 4OX9Q 4HJ9A 4PZ8A 5GAEC 4P74A 1N33L 3FKIG 3NELA 1S40A 2I5LX 4UP8A 4BBSH 4GKJQ 1E7ZA 4A93H 1VQ7A 1GO3E 2ES2A 4NXMQ 2JJQA 3B6YA 1PYBA 3M7NA 4YCUA 1CUKA 2HIVA 2VUMH 1WOCA 3GDEA 3WWVA 3L2PA 3K81C 2HT1A 3CC2A 4LF9Q 1NTGA 4DR6Q 1NMGA 1VQEA 2R7DA 2VNUD 1HNXL 1X3GA 3KFUA 1PVOA 3FKIH 3A5ZB 1J5EL 3M4PA 5BR8L 1CSPA 1G51A 4K0KQ 3AFQA 3KJOA 4DNIA 3PCOB 1HNZL 2VZAA 3RZOH 4DR7L 3AYHB 4X66Q 3J80c 4OXPA 4JI6Q 3CC7A 4JI1Q 1I94Q 5M3MG 5M5XH 4DPGA 1W3SA 2L15A 3RLOA 4DR1Q 4GOPA 2UUAL 3HOXG 2R7ZH 4DR3Q 3PUZA 1E3PA 2K4KA 4DV2L 2ZJQA 1EIYB 3H0GG 2Z6KC 1KD1C 5IT9c 4LFBQ 1JJCB 2KHJA 2K50A 2E8GA 2WFWA 3FHWA 2NVXH 2OTLA 3S1NH 4JV5L 5JJKA 4DUZQ 2IX1A 3GTOH 4A3MH 1PH9A 2UXDL 1YEZA 3E0EA 5GROA 4PZ6A 3RN2A 3CW2C 3J81c 4EX5A 2DGYA 1L1OC 1C9OA 1Y1VH 1QVCA 1X6OA 3A74A 2UXCL 4LF4Q 1H95A 1E1OA 5IYCH 1J6QA 4AQYL 3KF6B 2JQOA 1YJWA 2UXBL 3H0GH 1O7IA 2Z0SA 1R9TH 1YHAA 3RLNA 4JI7L 5M3FH 2JEAI 4KHPQ 1OXSC 1N32Q 2JA8G 5JEAJ 3HOUG 4GN3B 4GKJL 4DV6Q 3BU2A 1SLJA 2GVAA 4A3IG 4HIKA 3UDGA 1HNWQ 4GN4B 4NXML 1JJGA 1VQBA 1K0RA 2B63G 5IP7H 2V1CC 4LWCA 5LMUQ 2VY3A 1HR0Q 3CMAA 2B29A 4O2DA 3ULJA 2I5HA 1ASYA 4HJ7A 2DUDA 5GAHC 1MIUA 2QA4A 2CWAA 4LF9L 1PH8A 4JI3Q 2I0QA 4JI0Q 3K80C 3HKZE 3AQQA 3ICEA 4DR6L 1Q86C 3T1YQ 1EWIA 4FDBA 4IPHA 4A3GH 1BBUA 4GKKQ 1T9HA 4K0KL 1WYDA 2AWOA 2JA6H 5ELNA 1MKHA 5DLQE 4X66L 3M3YH 4JOIC 4JI6L 3I7FA 4Y7NH 1I94L 1TXYA 2N78A 3CXCA 3I55A 4DR1L 4DR3L 2N49A 3KYHC 2BH2A 3KJPA 3E9IA 3S17H 3VDYA 2R7FA 1YJ9A 4B3SQ 4BY1G 4LF7Q 4LFBL 3HKZG 1XNRQ 1Q46A 4QY7A 1Q7YC 5IYDG 2PMZE 3CCVA 2E2JH 3HOVG 1WI5A 4X62Q 3S16H 4P71A 3EBEA 2N8NA 4J15A 4GLAC 3CC4A 2R93H 1IBMQ 4X65Q 1KAWA 1A0IA 3I4NG 3JAMi 2E2IH 2EIFA 4DUYQ 4LF4L 1A8VA 1VQMA 3PIOA 4Y52H 4IO9A 2I5MX 3S1MH 1KL9A 4IPDA 3GTGH 4KHPL 1S72A 4OONA 3KF8B 1AH9A 1N32L 3OW2A 1LM0A 2A19A 4NPSA 1LUZA 2K75A 1WCMH 4A3DG 2CWPA 3JAMc 1OXXK 1YI2A 4P73A 4UPAA 1IZ6A 5IWAL 2NN6G 4XIGS 4DV6L 1HNWL 4POFA 4BXXG 4A3EG 4UP7A 3A0JA 1N34Q 3HOWG 3I4NH 5LMUL 1YJNA 5IP9G 1HR0L 2K14A 3J7A5 3CQZH 1XJVA 1N36Q 2CFMA 4LW1A 4LUVA 4JG2A 4BBRG 1SE8A 2YV5A 4JI3L 4JI0L 2BH8A 3CCRA 2Q2HA 4YWLA 3T1YL 3TS0A 2PNHA 3GTJH 2PI2E 1SFOH 1XPUA 3PO3H 1QZHA 4A3DH 1G6PA 4BXXH 3GTMH 4GKKL 1JE5A 3S1QH 3HOZG 1NMFA 5C0XG 5JJLA 2OQKA 1UEBA 5AJ3Q 5C3EH 1SROA 5IE8A 1ASZA 4A3FH 2F3IA 3ULPA 1EYGA 4LF5Q 3PUVA 2EXDA 1OXTA 4L5TA 4BY7H 5JJIA 4B3SL 4LUZA 4LF7L 1MJEA 2K5HA 1AE2A 1XNRL 1K8GA 1Q8KA 3G48A 3L7ZC 2N3SA 3G71A 4GOPB 2Q2TA 3L0OA 3J80i 2WB1E 3F2DA 4GOPC 1A63A 4R4QA 2Q2IA 4X62L 2LSSA 3KDFA 4GN5A 4HJ8A 1FGUA 4OWWB 1EQRA 4KHZA 1D7QA 3ERSX 1IBML 4X65L 3S24A 4LNQA 4A76A 4UP9A 5FJ8G 3TEHB 1X9NA 1NY4A 4DUYL 4YHHQ 1VQ4A 1PYSB 1GVPA 1KXLA 4DAMA 4WJ4A 3T1HQ 3NEMA 1Y14B 4A3CG 1I5FA 2AMCB 4HJ5A 1OTCA 3PF4A 1JT8A 4R1JA 2ASBA 1GM5A 1QUQA 1PH7A 3DM3A 3IRBA 2XGTA 3J81i 2UUCQ 2WB1G 4R4CA 5FLXc 4LUOA 4EQ5A 1NE3A 1SR3A 2F4VQ 2YTYA 1N34L 5M5WH 1B7YB 1N9WA 1RL2A 5FJ8H 3A5UA 1FJGQ 1HZ9A 1N36L 1IBLQ 4OO1G 3PF5A 1AE3A 4KI0A 5M3MH 4GNXB 2C35B 3I2ZA 1VQIA 4RG1A 1HZBA 1VQPA 3HOXH 2JA9A 1UWVA 1XMOQ 2D0OA 3AEVA 1IYJB 1VQCA 2JK8A 3W1BA 2KHIA 1TWFH 2OQ0A 1BKBA 2YTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQH A;  5EAY A;  4OX9 L;  1YIJ A;  2IY5 B;  5AJ3 L;  1WJJ A;  1MJC A;  4LF5 L;  3KLW A;  4GNX A;  3U50 C;  1X3E A;  1Q81 C;  2LXJ A;  3Q8D A;  1X55 A;  3D31 A;  4IPC A;  1HR0 W;  3UE0 A;  1HH2 P;  3G4S A;  2OTJ A;  4BA1 I;  4JI4 Q;  4JC0 A;  4JI8 Q;  2QGQ A;  3CME A;  1HZA A;  4IFD G;  2R6G A;  2VS1 A;  2JA5 G;  2NZH A;  3MEF A;  2JA8 H;  5C4X G;  2Z6K A;  2ALY B;  3S1R H;  4LF6 Q;  2IT1 A;  3HOU H;  3ZJY C;  3UDI A;  2ZTC A;  4A3I H;  3K0X A;  3OYY A;  1GD7 A;  1Z9F A;  4PG3 A;  1PH2 A;  4ME3 A;  1IL2 A;  4A3L G;  4YHH L;  4LF8 Q;  5HY6 A;  1TWH H;  2A8V A;  3ER0 A;  2B63 H;  1VQ9 A;  3E9H A;  2UUB Q;  1BBW A;  4IJH A;  4TVA B;  2H5X A;  3T1H L;  1CKM A;  1L1O A;  3JC6 6;  4JI1 L;  5IYB G;  3PO2 G;  3TS2 A;  5FLM G;  3UE1 A;  2NN6 I;  5GAG C;  3M9B A;  4DK6 C;  2GVB A;  4A3K G;  3M4Q A;  3I56 A;  4X64 Q;  4TQU S;  4DV0 Q;  5C4X H;  2UUC L;  3CD6 A;  3UDF A;  3F2B A;  4NXN Q;  2F4V L;  1M1K C;  4POG A;  4DUZ L;  1FJG L;  1Q1E A;  1RIP A;  3BJU A;  1K73 C;  2Q2U A;  4PMW A;  3PUX A;  1LYL A;  1IBL L;  4C2M H;  1X54 A;  1UE5 A;  4JBJ A;  4MTN A;  1QVG A;  3PO2 H;  5IYB H;  3SGI A;  2K52 A;  5FLM H;  3RNU A;  1CSQ A;  2VW9 A;  4DV3 Q;  4A3J G;  3HFZ B;  1VQ5 A;  1YHQ A;  3HOY G;  4A3K H;  4A3B G;  1XMO L;  1FL0 A;  2AHO B;  3I4O A;  5C0X I;  2ZJP A;  4BY1 H;  4JBW A;  5J3B A;  1K3R A;  3F2C A;  1NBW A;  2MNA A;  1Q82 C;  4HJA A;  3HOV H;  3U58 A;  3PGZ A;  5IYD H;  4LFA Q;  1WFQ A;  1X65 A;  2HHH Q;  3STB C;  3LGJ A;  4A4I A;  1EFW A;  1X56 A;  2LXK A;  2PQA A;  3CAM A;  3H3V I;  1UE6 A;  4A3J H;  2K5N A;  4JOI A;  1HNX Q;  2OWO A;  4DR2 Q;  1J5E Q;  1EQQ A;  1E1T A;  4DV7 Q;  1VQG A;  1UE7 A;  4JI8 L;  4JI4 L;  3U4V A;  4R4T A;  1YNX A;  1YVC A;  4C3H H;  1PH4 A;  4QIW E;  1VQA A;  4LF6 L;  3GTL H;  1XMQ Q;  2WAQ E;  4AIM A;  2IHE A;  2KCM A;  1L0W A;  5C44 G;  4QGU A;  4DV4 Q;  3CCU A;  1VQF A;  4A3E H;  1VQD A;  4LFC Q;  3HOW H;  1Z47 A;  4DR5 Q;  1I3Q H;  4MZ9 A;  3AFP A;  2YTV A;  3CCQ A;  2RCN A;  3KDF B;  4DKA C;  4O0A A;  5IP9 H;  2UUB L;  3I4M G;  1KRS A;  1GKH A;  1UE1 A;  4QJF A;  4RMF A;  1C7Y A;  4LF8 L;  1IXR A;  1K9M C;  1HJP A;  4BBR H;  1LTL A;  4X64 L;  1CKN A;  4DV0 L;  4IOC A;  4B3T Q;  2Y0S E;  5ELO A;  4BBS G;  4IOA A;  4A93 G;  4NXN L;  1Y1W G;  2E5L Q;  4WJ3 M;  5M5Y H;  4DV1 Q;  2ZTE A;  3MXN B;  4OO1 I;  4JBK A;  3CF5 A;  2WAQ G;  4P75 A;  1E22 A;  1QUQ B;  5E7N A;  2NVT H;  2VUM G;  3HOZ H;  4DAY B;  1B8A A;  1PFS A;  1NJI C;  1VQ6 A;  2RF4 A;  2AKW B;  3EIV A;  4ALP A;  4IFD J;  3M85 A;  3TRE A;  3S2D H;  2RHS B;  2ZJR A;  1PA6 A;  4DV3 L;  4B3R Q;  4QQB X;  5HGQ A;  1DGS A;  1IBK Q;  3NBH B;  3W1G A;  4YCW A;  4JYA Q;  1OXU A;  3BZC A;  4YY3 Q;  1Y1W H;  3H3V H;  2Y0S G;  4IJL A;  1U0L A;  5LMN Q;  1I50 H;  5LMN W;  1PH1 A;  2BA0 A;  4LFA L;  5GAD C;  4DV5 Q;  2IHF A;  2CKZ B;  1KQS A;  1VQL A;  3J7Z C;  4OWX B;  1W2B A;  2R7Z G;  3F8T A;  3STB D;  2E2H H;  1KRT A;  4HID A;  3GTP H;  4IFD I;  4DR2 L;  2D62 A;  1U5K A;  3KOJ A;  1E24 A;  4A3C H;  3CP0 A;  4DV7 L;  2MO0 A;  2NVQ H;  2CCZ A;  4APV A;  4A3M G;  1C0A A;  4GNX C;  1XTD A;  3TQY A;  4QL5 A;  1L2F A;  1YBY A;  4C3I H;  3OTO Q;  3TRZ A;  1XMQ L;  4IPG A;  5IY0 A;  2VQF Q;  1Y1V G;  1V1Q A;  3CCM A;  1JJ2 A;  1SN8 A;  2MFI A;  4DV4 L;  2UU9 Q;  2F52 A;  1PH3 A;  4LFC L;  5IYC G;  4NB3 A;  4DR5 L;  2HHH L;  4DR4 Q;  1KIX A;  2FXQ A;  3GTK H;  3S2H H;  3CCL A;  3RLF A;  2HQL A;  5M3F G;  3RZD H;  1P16 A;  1SMX A;  1VQK A;  2OCE A;  1TWG H;  1G29 1;  3CPF A;  4JI5 Q;  4B3T L;  3RR5 A;  3CCJ A;  2KCT A;  1PHJ A;  1L1O B;  3G6E A;  2E5L L;  4DV1 L;  4X6A H;  1EIF A;  4L5R C;  5IP7 G;  4JI2 Q;  1TWA H;  2YYZ A;  3HKS A;  3PIP A;  2A1A A;  3CCE A;  4B3M Q;  1EOV A;  3F1Z A;  5H1S E;  3PSI A;  2KBN A;  3NEN A;  2WP8 J;  3S15 H;  2VQE Q;  1Q12 A;  1KHI A;  1S3O A;  1XNQ Q;  4B3R L;  1IBK L;  1P8L A;  1KC8 C;  5IWA Q;  4JBM A;  4JYA L;  4A3G G;  1D8L A;  4YY3 L;  1Q1B A;  1X3F A;  2ZM6 Q;  4L5Q A;  2YU9 H;  2JA6 G;  5LMN L;  3PV0 A;  4C3J H;  5C0X J;  1M90 C;  3PUY A;  3GO5 A;  1XPO A;  1YIT A;  2JE6 I;  2JA5 H;  4R4O A;  2CQO A;  4DV5 L;  3KF6 A;  4XTC S;  1I6H H;  4GLX A;  2XTI A;  1JMC A;  3EN2 A;  4A3L H;  5K36 G;  2IX0 A;  2VL6 A;  2RHQ B;  4KLK A;  4UY8 C;  4YWK A;  1V43 A;  2PQA B;  1EUJ A;  3K7U C;  2PI2 A;  3M4O H;  2NZO A;  3W5O A;  3D0F A;  1N33 Q;  3OTO L;  3DLL A;  2R93 G;  4OWT B;  2VQF L;  2JA7 G;  1QZG A;  1QVF A;  3PUW A;  2UU9 L;  1VS0 A;  1K83 H;  1OXV A;  5C4J H;  3CCS A;  4H02 A;  3S14 H;  4DR4 L;  3H15 A;  2GN5 A;  1SRU A;  1YHB A;  3K7A H;  1XPR A;  4AYB E;  2NVY H;  2D0P A;  1V9P A;  2B3G A;  3U4Z A;  1WCM G;  2JEB I;  4JI5 L;  2EQS A;  1VQ8 A;  4L5S A;  3HOY H;  1B70 B;  1VQJ A;  4YWM A;  4A3B H;  5BR8 Q;  2ZTD A;  1CKO A;  4AH6 A;  4JI2 L;  2JA7 H;  1HNZ Q;  2MO1 A;  1VQO A;  1CKN B;  1A62 A;  4DR7 Q;  4MNO A;  3K8A A;  1VCI A;  5JEA G;  4B3M L;  1VQN A;  2HIX A;  3ULL A;  3GD7 A;  2ID0 A;  2QEX A;  4BA2 I;  3BZK A;  2VQE L;  2UUA Q;  1XNQ L;  4AYB G;  4HIM A;  3PO3 G;  4PZ7 A;  4DV2 Q;  3CPW A;  2R92 G;  3FP9 A;  2ZM6 L;  2KEN A;  1JB7 A;  4GS3 A;  1YZ6 A;  4JV5 Q;  1PH5 A;  5GQO A;  5C3E G;  4R4I A;  4HIO A;  4A3F G;  2BA1 A;  2UXD Q;  2AWN A;  2ATW A;  3GTQ H;  2MQH A;  3UDX A;  4DK3 C;  3RN5 A;  3J81 j;  4YCV A;  1FVI A;  4JCV E;  1TWC H;  5C44 H;  4BY7 G;  4P72 A;  4GLV B;  1N8R C;  2UXC Q;  1K8A C;  4AQY Q;  1BVS A;  1HZC A;  3I4M H;  4A75 A;  2UXB Q;  1PH6 A;  2K5V A;  1PV4 A;  4JI7 Q;  2R92 H;  4OX9 Q;  4HJ9 A;  4PZ8 A;  5GAE C;  4P74 A;  1N33 L;  3FKI G;  3NEL A;  1S40 A;  2I5L X;  4UP8 A;  4BBS H;  4GKJ Q;  1E7Z A;  4A93 H;  1VQ7 A;  1GO3 E;  2ES2 A;  4NXM Q;  2JJQ A;  3B6Y A;  1PYB A;  3M7N A;  4YCU A;  1CUK A;  2HIV A;  2VUM H;  1WOC A;  3GDE A;  3WWV A;  3L2P A;  3K81 C;  2HT1 A;  3CC2 A;  4LF9 Q;  1NTG A;  4DR6 Q;  1NMG A;  1VQE A;  2R7D A;  2VNU D;  1HNX L;  1X3G A;  3KFU A;  1PVO A;  3FKI H;  3A5Z B;  1J5E L;  3M4P A;  5BR8 L;  1CSP A;  1G51 A;  4K0K Q;  3AFQ A;  3KJO A;  4DNI A;  3PCO B;  1HNZ L;  2VZA A;  3RZO H;  4DR7 L;  3AYH B;  4X66 Q;  3J80 c;  4OXP A;  4JI6 Q;  3CC7 A;  4JI1 Q;  1I94 Q;  5M3M G;  5M5X H;  4DPG A;  1W3S A;  2L15 A;  3RLO A;  4DR1 Q;  4GOP A;  2UUA L;  3HOX G;  2R7Z H;  4DR3 Q;  3PUZ A;  1E3P A;  2K4K A;  4DV2 L;  2ZJQ A;  1EIY B;  3H0G G;  2Z6K C;  1KD1 C;  5IT9 c;  4LFB Q;  1JJC B;  2KHJ A;  2K50 A;  2E8G A;  2WFW A;  3FHW A;  2NVX H;  2OTL A;  3S1N H;  4JV5 L;  5JJK A;  4DUZ Q;  2IX1 A;  3GTO H;  4A3M H;  1PH9 A;  2UXD L;  1YEZ A;  3E0E A;  5GRO A;  4PZ6 A;  3RN2 A;  3CW2 C;  3J81 c;  4EX5 A;  2DGY A;  1L1O C;  1C9O A;  1Y1V H;  1QVC A;  1X6O A;  3A74 A;  2UXC L;  4LF4 Q;  1H95 A;  1E1O A;  5IYC H;  1J6Q A;  4AQY L;  3KF6 B;  2JQO A;  1YJW A;  2UXB L;  3H0G H;  1O7I A;  2Z0S A;  1R9T H;  1YHA A;  3RLN A;  4JI7 L;  5M3F H;  2JEA I;  4KHP Q;  1OXS C;  1N32 Q;  2JA8 G;  5JEA J;  3HOU G;  4GN3 B;  4GKJ L;  4DV6 Q;  3BU2 A;  1SLJ A;  2GVA A;  4A3I G;  4HIK A;  3UDG A;  1HNW Q;  4GN4 B;  4NXM L;  1JJG A;  1VQB A;  1K0R A;  2B63 G;  5IP7 H;  2V1C C;  4LWC A;  5LMU Q;  2VY3 A;  1HR0 Q;  3CMA A;  2B29 A;  4O2D A;  3ULJ A;  2I5H A;  1ASY A;  4HJ7 A;  2DUD A;  5GAH C;  1MIU A;  2QA4 A;  2CWA A;  4LF9 L;  1PH8 A;  4JI3 Q;  2I0Q A;  4JI0 Q;  3K80 C;  3HKZ E;  3AQQ A;  3ICE A;  4DR6 L;  1Q86 C;  3T1Y Q;  1EWI A;  4FDB A;  4IPH A;  4A3G H;  1BBU A;  4GKK Q;  1T9H A;  4K0K L;  1WYD A;  2AWO A;  2JA6 H;  5ELN A;  1MKH A;  5DLQ E;  4X66 L;  3M3Y H;  4JOI C;  4JI6 L;  3I7F A;  4Y7N H;  1I94 L;  1TXY A;  2N78 A;  3CXC A;  3I55 A;  4DR1 L;  4DR3 L;  2N49 A;  3KYH C;  2BH2 A;  3KJP A;  3E9I A;  3S17 H;  3VDY A;  2R7F A;  1YJ9 A;  4B3S Q;  4BY1 G;  4LF7 Q;  4LFB L;  3HKZ G;  1XNR Q;  1Q46 A;  4QY7 A;  1Q7Y C;  5IYD G;  2PMZ E;  3CCV A;  2E2J H;  3HOV G;  1WI5 A;  4X62 Q;  3S16 H;  4P71 A;  3EBE A;  2N8N A;  4J15 A;  4GLA C;  3CC4 A;  2R93 H;  1IBM Q;  4X65 Q;  1KAW A;  1A0I A;  3I4N G;  3JAM i;  2E2I H;  2EIF A;  4DUY Q;  4LF4 L;  1A8V A;  1VQM A;  3PIO A;  4Y52 H;  4IO9 A;  2I5M X;  3S1M H;  1KL9 A;  4IPD A;  3GTG H;  4KHP L;  1S72 A;  4OON A;  3KF8 B;  1AH9 A;  1N32 L;  3OW2 A;  1LM0 A;  2A19 A;  4NPS A;  1LUZ A;  2K75 A;  1WCM H;  4A3D G;  2CWP A;  3JAM c;  1OXX K;  1YI2 A;  4P73 A;  4UPA A;  1IZ6 A;  5IWA L;  2NN6 G;  4XIG S;  4DV6 L;  1HNW L;  4POF A;  4BXX G;  4A3E G;  4UP7 A;  3A0J A;  1N34 Q;  3HOW G;  3I4N H;  5LMU L;  1YJN A;  5IP9 G;  1HR0 L;  2K14 A;  3J7A 5;  3CQZ H;  1XJV A;  1N36 Q;  2CFM A;  4LW1 A;  4LUV A;  4JG2 A;  4BBR G;  1SE8 A;  2YV5 A;  4JI3 L;  4JI0 L;  2BH8 A;  3CCR A;  2Q2H A;  4YWL A;  3T1Y L;  3TS0 A;  2PNH A;  3GTJ H;  2PI2 E;  1SFO H;  1XPU A;  3PO3 H;  1QZH A;  4A3D H;  1G6P A;  4BXX H;  3GTM H;  4GKK L;  1JE5 A;  3S1Q H;  3HOZ G;  1NMF A;  5C0X G;  5JJL A;  2OQK A;  1UEB A;  5AJ3 Q;  5C3E H;  1SRO A;  5IE8 A;  1ASZ A;  4A3F H;  2F3I A;  3ULP A;  1EYG A;  4LF5 Q;  3PUV A;  2EXD A;  1OXT A;  4L5T A;  4BY7 H;  5JJI A;  4B3S L;  4LUZ A;  4LF7 L;  1MJE A;  2K5H A;  1AE2 A;  1XNR L;  1K8G A;  1Q8K A;  3G48 A;  3L7Z C;  2N3S A;  3G71 A;  4GOP B;  2Q2T A;  3L0O A;  3J80 i;  2WB1 E;  3F2D A;  4GOP C;  1A63 A;  4R4Q A;  2Q2I A;  4X62 L;  2LSS A;  3KDF A;  4GN5 A;  4HJ8 A;  1FGU A;  4OWW B;  1EQR A;  4KHZ A;  1D7Q A;  3ERS X;  1IBM L;  4X65 L;  3S24 A;  4LNQ A;  4A76 A;  4UP9 A;  5FJ8 G;  3TEH B;  1X9N A;  1NY4 A;  4DUY L;  4YHH Q;  1VQ4 A;  1PYS B;  1GVP A;  1KXL A;  4DAM A;  4WJ4 A;  3T1H Q;  3NEM A;  1Y14 B;  4A3C G;  1I5F A;  2AMC B;  4HJ5 A;  1OTC A;  3PF4 A;  1JT8 A;  4R1J A;  2ASB A;  1GM5 A;  1QUQ A;  1PH7 A;  3DM3 A;  3IRB A;  2XGT A;  3J81 i;  2UUC Q;  2WB1 G;  4R4C A;  5FLX c;  4LUO A;  4EQ5 A;  1NE3 A;  1SR3 A;  2F4V Q;  2YTY A;  1N34 L;  5M5W H;  1B7Y B;  1N9W A;  1RL2 A;  5FJ8 H;  3A5U A;  1FJG Q;  1HZ9 A;  1N36 L;  1IBL Q;  4OO1 G;  3PF5 A;  1AE3 A;  4KI0 A;  5M3M H;  4GNX B;  2C35 B;  3I2Z A;  1VQI A;  4RG1 A;  1HZB A;  1VQP A;  3HOX H;  2JA9 A;  1UWV A;  1XMO Q;  2D0O A;  3AEV A;  1IYJ B;  1VQC A;  2JK8 A;  3W1B A;  2KHI A;  1TWF H;  2OQ0 A;  1BKB A;  2YTX A; 
#chains in the Genus database with same CATH topology
 2DJF C;  1VQH A;  1HRJ A;  1YIJ A;  1MJC A;  1UAP A;  1Y1W B;  1BNZ A;  4LF5 L;  2F0U A;  3U50 C;  3H3V C;  3W2D A;  3Q8D A;  3D31 A;  3UE0 A;  2OTJ A;  4IUQ A;  3J80 L;  5C4X G;  4LF6 Q;  3SDZ A;  2C5C A;  1QNU A;  2FHT A;  4A3I H;  3OYY A;  1FNW A;  1VQ9 A;  1PZK D;  3PO2 G;  5IYB G;  3UE1 A;  3VYT A;  1AFP A;  1TR5 A;  4HTH A;  3I56 A;  2DY7 A;  5BN5 A;  3F2B A;  1NR4 A;  2NVX B;  1BOS A;  4A3M B;  1RIP A;  5ELF A;  1PTO B;  3PUX A;  4C2M H;  5FLM H;  2F0Q A;  3HFZ B;  4A3B G;  4K8J A;  3E6Z X;  4O42 A;  1BBX C;  3I4O A;  1HPC A;  5C0X I;  3TSS A;  4BY1 H;  5J3B A;  3X3N A;  4RKL A;  3C2P A;  3PGZ A;  2F0S A;  2WAC A;  1X65 A;  1EFW A;  1X56 A;  2PQA A;  2O4X A;  3CAM A;  2PZW A;  4A3J H;  4JOI A;  3IKJ A;  1EQQ A;  4JI4 L;  1VQG A;  4JI8 L;  3SR1 A;  4R4T A;  1VQA A;  2CHB D;  4AIM A;  1CA5 A;  4A3G B;  3CCU A;  3TS2 A;  1Z47 A;  2J4X A;  4LF8 L;  2RCN A;  3KDF B;  4RMF A;  1UE1 A;  3DEP A;  4QF4 A;  4BBR H;  4BBS G;  4FYD A;  4NXN L;  1C48 A;  2ZTE A;  4B9W A;  2B2V C;  3MXN B;  4O1N A;  4OO1 I;  1QUQ B;  4DAY B;  2RDF A;  1B8A A;  5C0X H;  1PFS A;  1EYD A;  1RDP D;  3R8B A;  3TRE A;  4B3R Q;  4J6H A;  5JPN C;  4DV3 L;  1DOK A;  3SHL A;  3W1G A;  4YCW A;  3VR3 A;  2CQA A;  3A8I E;  2Y0S G;  1PH1 A;  1DON A;  3D4W A;  4LFA L;  4DV5 Q;  2IHF A;  4UAI A;  3R2I A;  1ESR A;  1W2B A;  2XRQ D;  3BDO A;  3F8T A;  3MXU A;  2E2H H;  2BDO A;  3SEB A;  1KRT A;  4DR2 L;  1HXY D;  2H1E A;  3M4Y A;  1U5K A;  3C1F A;  4A3C H;  2A69 C;  3CP0 A;  1SNP A;  3J7Y W;  4GNX C;  3TQY A;  4IAL A;  3PO3 B;  3OTO Q;  1YBY A;  1MD2 D;  3TP5 A;  2QDB A;  4IPG A;  2R92 B;  4NKL A;  1RD9 D;  2FXQ A;  4A3F B;  1FNV A;  3S2H H;  2HQL A;  1TII D;  4OO1 H;  1SMX A;  1VQK A;  1DZ1 A;  1G29 1;  4JI5 Q;  4HMJ A;  4B3T L;  4ZYS A;  3J7A V;  5C5L A;  1I4P A;  1EIF A;  1GUG A;  2A1A A;  1PZI D;  1V1P A;  1BDO A;  3H09 A;  1MBY A;  3FKI B;  1HA6 A;  2KBN A;  3ONA B;  5KGU A;  1SNC A;  4QCL A;  5CV6 A;  1P8L A;  1KC8 C;  2KEE A;  4JYA L;  1DM0 B;  3OW7 A;  1X3F A;  2ZM6 Q;  2JA6 G;  3GO5 A;  4HCE A;  3WOE A;  4R4O A;  4XTC S;  2A68 C;  1TY0 A;  1GUT A;  2XTI A;  4CBV A;  2JXM B;  1JIC A;  1SE2 A;  4KLK A;  3P75 A;  1PTO C;  2B2T C;  3K7U C;  4FXD A;  3FPU B;  1EYC A;  2AUJ D;  4K5V A;  1N33 Q;  3M7G A;  2R93 G;  3VA7 A;  2D9U A;  4C1N I;  2JA7 G;  2UU9 L;  1JWS D;  1W6J A;  4QB4 A;  3DHQ A;  1SRU A;  2F0L A;  2DN8 A;  2NVY H;  1KLU D;  1O7L A;  4MN3 A;  1IYV A;  1U4R A;  2JEB I;  2NTT A;  2NYZ D;  4L5S A;  4A3B H;  1B70 B;  1VQJ A;  4M8A A;  4YWM A;  1F9S A;  2MUY A;  1EFI D;  3OWE B;  1CKN B;  1A62 A;  4DR7 Q;  2HIX A;  3ULL A;  2ID0 A;  4A3I B;  1WTO A;  5I4D A;  5IGE A;  2Q8T A;  4G57 A;  3FP9 A;  1JB7 A;  4OEM B;  5J39 A;  1BCP D;  1PH5 A;  4R4I A;  5FLX E;  2UXD Q;  2ATW A;  2WIN B;  4YCV A;  3MEH A;  4JCV E;  4BY7 G;  1G6Z A;  1N8R C;  2UXC Q;  1BVS A;  1HZC A;  4C2M B;  1J8I A;  2UXB Q;  1PH6 A;  1WTP A;  4JI7 Q;  1PV4 A;  1JQY D;  1HTP A;  5C4Z A;  2J0T D;  4OX9 Q;  1AEX A;  3OOC A;  4BBS H;  1VQ7 A;  4BY1 B;  5KNB A;  2EYH A;  4YIJ A;  2QKI C;  1PYB A;  5A2Q E;  1SYB A;  3D3R A;  4N9P A;  1WOC A;  3R2T A;  1NMG A;  3HGB A;  1K8M A;  3VYR A;  3MVV A;  3A5Z B;  4KJN A;  3M4P A;  1LT4 D;  3TZD A;  1G51 A;  2PW7 A;  5BR8 L;  2N88 A;  1R4Q B;  3R93 A;  4DNI A;  2L11 A;  2FFK B;  4Q0F A;  3AYH B;  4OXP A;  1CK1 A;  2JN4 A;  5CBE E;  3K5M A;  2K04 A;  5M3M G;  5M5X H;  1I94 Q;  3S1Q B;  1IHZ A;  3RLO A;  2LS0 1;  1FNU A;  3OWF A;  3PUZ A;  4PMB A;  1PRT B;  2AQ3 B;  2KEC A;  4DV2 L;  2Z6K C;  1KD1 C;  4LFB Q;  1HHV A;  1VDZ A;  4BBR B;  4JV5 L;  5BN3 A;  3A7A B;  1PDQ A;  3TZU A;  1PH9 A;  5GRO A;  1SMY D;  3E0E A;  2XSC A;  3J81 c;  1C9O A;  5JAV A;  4RA8 A;  4RGO S;  1H95 A;  4MTK A;  3H0G H;  4OHJ A;  1JOR A;  1SNM A;  4KHV A;  1UEA B;  5D14 A;  5CV8 A;  4KJO A;  3HOU G;  4RKB A;  4EQP A;  4GN3 B;  1STH A;  4DV6 Q;  1SLJ A;  3UDG A;  1Q8I A;  1S5F D;  1WD1 A;  4X3T A;  3DWQ A;  4LWC A;  5LMU Q;  3CMA A;  2I5H A;  3BG3 A;  1XX8 A;  5GAH C;  1GUO A;  4LF9 L;  2E2H B;  2ZXP A;  1PH8 A;  1K8O A;  2I0Q A;  1SYF A;  3O13 A;  3GP7 A;  4G7O C;  4FNF A;  2EYJ A;  2JA6 H;  2VB3 X;  2F3W A;  3P20 A;  3RUZ A;  4KKU A;  4TKO B;  4IUT A;  1IKL A;  2WKC A;  3N6R A;  2O5J C;  3KJP A;  2F0N A;  4B3S Q;  4RWS C;  3S2H B;  3HKZ G;  1XNR Q;  4ILW A;  1Q46 A;  2AQ2 B;  1F9R A;  1CTM A;  4EVO A;  5IYD G;  2CVR A;  2E2J H;  4IUN A;  3HOV G;  4X62 Q;  3BS1 A;  1F2Z A;  1EU4 A;  4J15 A;  2R93 H;  1IBM Q;  4X65 Q;  1KAW A;  1F9Q A;  1HFN A;  4LF4 L;  1VQM A;  2HCC A;  4IO9 A;  2I5M X;  5FO8 B;  4KHP L;  1GUS A;  1AH9 A;  3Q22 A;  3OW2 A;  1LM0 A;  2A19 A;  3JAM c;  4UPA A;  1IZ6 A;  1HNW L;  2CH4 W;  3SVM A;  4UP7 A;  4IQZ A;  2L55 A;  4OEL B;  5J1Z A;  5IP9 G;  1SYC A;  2R61 A;  3CQZ H;  1N36 Q;  2ZXR A;  3ERQ A;  5EBD A;  4XYQ A;  1QG7 A;  3CCR A;  2Q2H A;  1XPU A;  4A3D H;  2PI2 E;  1QZH A;  3PO2 B;  1LLR D;  2G9D A;  4ODG A;  4BXX H;  1A3U A;  3GTM H;  1NMF A;  3TBI B;  1EQT A;  5IE8 A;  3SE0 A;  1ASZ A;  4C1N K;  3ULP A;  3H94 A;  3PUV A;  2EXD A;  3SK5 A;  1OXT A;  4LF5 Q;  4BY7 H;  5JJI A;  2B2Y C;  4LF7 L;  2F0I A;  2F0O A;  3OIQ A;  1TU2 B;  5EGT A;  1MJE A;  2NVY B;  3FEW X;  4KKT A;  1M8A A;  3L7Z C;  4DF7 A;  2N3S A;  4ZUJ A;  4DXG A;  4GOP B;  3L0O A;  2K32 A;  3F2D A;  1A63 A;  2O5I C;  1L0X B;  4HJ8 A;  2LSS A;  4GN5 A;  4A3B B;  1FGU A;  4KHZ A;  3BYY B;  4LNQ A;  3QIA A;  4WRD A;  4A76 A;  1ESF A;  3SXH A;  3TEH B;  1NY4 A;  1VQ4 A;  1G8Z D;  1EU3 A;  4CDD C;  1PYS B;  2F0M A;  4EQO A;  4WJ4 A;  1H9K A;  4ABN A;  1I5F A;  2RVL A;  1LV9 A;  2AMC B;  2EXZ A;  4HSV A;  3PIO 3;  1OTC A;  1D6E C;  3I8Z A;  3J81 i;  4KY6 A;  2WB1 G;  1PRT C;  3EFX D;  1N9W A;  2HDM A;  1EZ8 A;  5EPJ A;  3PF5 A;  1IW7 D;  4KI0 A;  5M3M H;  2JSO A;  3I2Z A;  1VQI A;  1C4Q A;  2F0E A;  2NVT B;  1UWV A;  3HRZ C;  1TVX A;  3AEV A;  1IYJ B;  4H13 C;  3PV0 A;  1BKB A;  2AUK A;  5EAY A;  1LTA D;  4OX9 L;  1KNE A;  4DNT B;  4BBS B;  5DM6 3;  4S3S A;  2F0T A;  3OMC A;  3HS0 C;  1X3E A;  1TS2 A;  4IPC A;  1HR0 W;  4TSS A;  3G4S A;  4C3J G;  3GV3 A;  4JI4 Q;  4JI8 Q;  2QGQ A;  1SNO A;  5ELE A;  1NAP A;  3MEF A;  3HOU H;  2MP1 A;  3MXP A;  4A3L G;  1Z9F A;  1PH2 A;  4ME3 A;  2A6H D;  4LF8 Q;  1STA A;  3ER0 A;  4KD4 A;  3E9H A;  1H9J A;  4CJ1 B;  3T1H L;  1L1O A;  5M5X B;  2F03 A;  1B53 A;  2IPK D;  2XIW A;  5T1G A;  5FLM G;  5GAG C;  2B39 A;  1DD2 A;  2GVB A;  1XWE A;  4TQU S;  3GTK B;  3CD6 A;  4NXN Q;  4FF1 A;  2F4V L;  1M1K C;  5EKL A;  1Q1E A;  5T1I A;  2Q2U A;  2RBM A;  1IBL L;  3IFD A;  1EEF D;  4JBJ A;  4ZUI A;  5K5P A;  3SGI A;  2K52 A;  3RNU A;  1CSQ A;  2VW9 A;  4IN3 A;  4DV3 Q;  4A3J G;  1VQ5 A;  1U4L A;  3VYS A;  4A3K H;  1FL0 A;  2XN9 C;  5D65 A;  1UNS A;  2EOT A;  4FO2 A;  3F2C A;  1NBW A;  1Q82 C;  4HJA A;  3HOV H;  3U58 A;  5IYD H;  4LFA Q;  3STB C;  1D1K A;  2EDG A;  2R3Z A;  3KLS A;  2K5N A;  4PV1 C;  1V1O A;  2OWO A;  4DR2 Q;  3NTH A;  2EYO A;  1DOM A;  1E1T A;  2E2D C;  3EJI A;  1GHK A;  1DYQ A;  2KCM A;  1L0W A;  2JA6 B;  2PO4 A;  1VQF A;  3J80 E;  2EYP A;  4MZ9 A;  5LL6 X;  2YTV A;  2UUB L;  5D3I B;  5IP9 H;  1GKH A;  1F2L A;  1A6X A;  1JC7 A;  1JOO A;  4X64 L;  4DV0 L;  4IOC A;  2C9O A;  4B3T Q;  2Y0S E;  4A93 G;  1SND A;  3NPP A;  3T51 B;  5KYL A;  1EY7 A;  5KEE A;  3CF5 A;  2WAQ G;  4KD3 A;  2VUM G;  1CHP D;  3PMF A;  4PNY A;  1NJI C;  2R93 B;  4LAA A;  1I4H A;  2RF4 A;  1EWC A;  4QQB X;  2JA7 B;  1LAC A;  1PA6 A;  4JYA Q;  3BZC A;  3PQI A;  1YNN C;  1VF7 A;  2Z1C A;  1U0L A;  1MSH A;  1U4P A;  1KQS A;  4DK1 A;  3J7Z C;  1TT2 A;  2R7Z G;  1PYW D;  3QWN A;  2B2W A;  3MFY A;  2ZT9 C;  3CQZ B;  1GOZ A;  2D62 A;  2D2C C;  2FIN B;  3CHB D;  1E24 A;  4DV7 L;  2NVQ H;  4KN4 C;  4QL5 A;  4CJ0 B;  1F2Y A;  1PFB A;  2E76 C;  3GTM B;  3CCM A;  1JJ2 A;  1SN8 A;  2KA7 A;  4LK1 C;  2UU9 Q;  1PH3 A;  4FXK C;  3AU7 A;  4LFC L;  2HHH L;  3L9A X;  1KIX A;  3HEJ A;  1ZYR C;  3RZD H;  4EGV A;  4IUU A;  3V05 A;  4BY7 B;  4KK7 A;  2OCE A;  5FKA C;  1II3 A;  4DA2 A;  3EA6 A;  3NQT A;  1PHJ A;  4X6A H;  3G6E A;  2EJF C;  4DV1 L;  4L5R C;  1TWA H;  2CH4 A;  3HKS A;  3PIP A;  3V2T A;  4ZAI A;  1TKW B;  2IL8 A;  3CCE A;  5H1S E;  1RF2 D;  2WP8 J;  4CKE A;  1YNJ C;  4IUR A;  1EYA A;  3AMU A;  2QDL A;  2EPB A;  4YY3 L;  5J22 A;  2YU9 H;  4L5Q A;  5LMN L;  2F0W A;  4C3J H;  3E5S A;  5C0X J;  5IIF A;  1LT5 D;  3KF6 A;  4RCN A;  5G3L F;  4GLX A;  1C8C A;  2V4D A;  4NMZ A;  3EN2 A;  1F77 A;  4A3L H;  2IX0 A;  5M3M B;  4EQN A;  2A69 D;  1WTV A;  3W5O A;  1EY0 A;  1T5X D;  4Z9C B;  3F2U A;  1JWM D;  3A8J E;  4C56 C;  5FO7 B;  1K83 H;  1STE A;  5C4J H;  3CCS A;  4DR4 L;  3TP7 A;  3H15 A;  2GN5 A;  1J9O A;  1YHB A;  2BOS A;  1V9P A;  1LTS D;  4HAE A;  3SK6 A;  4DXF A;  1WCM G;  2EQS A;  5BR8 Q;  2ZTD A;  4AH6 A;  4JI2 L;  3OPO A;  3MZ5 A;  1LO5 D;  1VQO A;  2I07 B;  1WTW A;  3HOU B;  4MNO A;  2HD3 A;  3K8A A;  5JEA G;  1VQN A;  3HG9 A;  3NWS A;  4N9T A;  5KND A;  2RDG A;  1XNQ L;  3K5O A;  4BS9 A;  4AYB G;  4HIM A;  1RKN A;  4PZ7 A;  1I4Q A;  4DV2 Q;  5I2X A;  1X3Q A;  2RSO A;  4JK1 C;  4JV5 Q;  5GQO A;  5C3E G;  4KMU C;  5JPM C;  1CT1 D;  4HIO A;  2AWN A;  1HFG A;  4KV6 A;  1FVI A;  4DGZ A;  4UHV A;  2A68 D;  4P72 A;  2B2U C;  3T16 A;  3SK4 A;  1SYD A;  4A75 A;  1CZG A;  1L0Y B;  1MHW C;  2K5V A;  5ISR A;  1A3V A;  1PTO D;  4HJ9 A;  3NEL A;  3MXG A;  2I5L X;  4A93 H;  4FP5 D;  3HKZ B;  3NP8 A;  2EYM A;  3HOV B;  4XQJ A;  2VUM H;  2FJ2 A;  3WWV A;  2HT1 A;  3CC2 A;  4LF9 Q;  3NTK A;  1VQE A;  2R7D A;  2VNU D;  3KFU A;  2F1M A;  3QB3 A;  5ELC A;  2Z6B A;  3PCO B;  1HNZ L;  2VZA A;  3RZO H;  2XWB B;  3CC7 A;  2B2V A;  4JI1 Q;  1SJE D;  1W3S A;  2L15 A;  2PMZ B;  1E2V A;  2UUA L;  3HOX G;  2R7Z H;  3IAY A;  3T53 B;  5HGT A;  2ZJQ A;  1EIG A;  2IX3 A;  3H0G G;  5IT9 c;  1JJC B;  2K50 A;  4DUZ Q;  2IX1 A;  4PZ6 A;  4KY5 A;  4HCS A;  1I4R A;  1B9N A;  1QVC A;  1HQR D;  1RTO A;  3A74 A;  4LF4 Q;  4I7Z C;  3FRP B;  4DN4 M;  4AQY L;  4U68 A;  1KDB A;  4KHP Q;  1R9T H;  5JEA J;  2DNC A;  2KVM A;  1ET9 A;  1ZXT A;  2GVA A;  1HNW Q;  4CGY B;  5E4W C;  4NXM L;  3E3X A;  1VQB A;  1K0R A;  5CV4 A;  3DXJ C;  1S5D D;  2CW0 C;  1H9S A;  2QA4 A;  5M5W B;  2CWA A;  3HKZ E;  1KAA A;  4V19 0;  4OIK A;  4K0K L;  1T9H A;  2NVQ B;  5ELN A;  1ENC A;  5I6Y A;  5IT9 L;  4JI6 L;  4Y7N H;  2PPB C;  3K57 A;  2WB1 B;  1DCZ A;  1TXY A;  5I9O A;  1LTI D;  2J7Z A;  3S9W A;  4DR3 L;  3KYH C;  1GJX A;  1SE4 A;  2R7F A;  1YJ9 A;  4LF7 Q;  3RZD B;  2K01 A;  3CCV A;  2PMZ E;  3S16 H;  4P71 A;  3EBE A;  2B8G A;  2N8N A;  3BYT B;  2PZU A;  1EY8 A;  4B9X A;  1TWA B;  1Y8N B;  4V0B A;  2E2I H;  1A8V A;  5FO9 B;  2LFN A;  4Y52 H;  5LHY 1;  3GTG H;  1EIH A;  3KF8 B;  3QR8 A;  1N32 L;  1LTG D;  2PQE A;  4ID6 A;  1WCM H;  2PNR C;  5E1F A;  4RCO A;  3I90 A;  5JVH 3;  1YI2 A;  4A3D G;  4XIG S;  2B2T A;  4BXX G;  2YU9 B;  3A0J A;  4C3J B;  4FF4 A;  3I4N H;  2F0G A;  2D5D A;  4X3K A;  2RKS A;  5HUR A;  5JEA H;  4K2L A;  4LUV A;  4JG2 A;  2YV5 A;  3CKI B;  4JI3 L;  2BH8 A;  3MWY W;  2Q8I B;  1SFO H;  3EQL C;  3TS0 A;  3GTJ H;  2L1B A;  5AFW A;  3DMU A;  3LWU A;  3DM1 A;  3HOZ G;  2E75 C;  5JJL A;  1UEB A;  3LNN A;  5C3E H;  4F87 A;  2F3I A;  1EYG A;  1K83 B;  4L5T A;  5C4J B;  2L9H A;  3FPP A;  4L63 B;  3OIP A;  2FMC A;  1I6V C;  1Q8K A;  3G71 A;  2HUG A;  2WB1 E;  4A3J B;  1TS5 A;  2Q2I A;  1HCZ A;  3KDF A;  1D7Q A;  3S24 A;  1PMR A;  4DUY L;  1JE4 A;  3NXW A;  3T1H Q;  4P2C B;  2KCC A;  1DOL A;  3MXN A;  3PF4 A;  3D6W A;  5EPL A;  1GM5 A;  1QUQ A;  1PH7 A;  4MHE A;  2XGT A;  3D4R A;  4DAY A;  4R4C A;  5FLX c;  3MA2 B;  1NE3 A;  4RGT A;  1SR3 A;  4XDX A;  2F4V Q;  5FJ8 H;  3A5U A;  1BCP F;  4QMG A;  2RSN A;  4ZQ3 A;  1IBL Q;  4RG1 A;  1B9M A;  3HOX H;  2JA9 A;  1VQC A;  1MSG A;  2KHI A;  1TWF H;  1J6Q A;  2EY2 A;  2YTX A;  4A93 B;  5I2Y A;  3NTI A;  2WII B;  5E3F A;  4QIW B;  2OXP A;  2WAQ B;  1Q81 C;  2VUM B;  4XT3 B;  1Z6H A;  1SAP A;  3VA5 A;  4BA1 I;  1HZA A;  2R6G A;  2VS1 A;  2Z6K A;  2ALY B;  4M1U B;  3ZJY C;  3UDI A;  1XTC D;  2ZTC A;  4DAP A;  3K6O A;  4YHH L;  3RZO B;  2A8V A;  5HY6 A;  1STN A;  2UUB Q;  5FLX L;  1BBW A;  4IJH A;  2H5X A;  3JC6 6;  4JI1 L;  2R7Z B;  1O78 A;  4A3K G;  3M4Q A;  4X64 Q;  4DV0 Q;  3J81 L;  1BUV T;  1GUW A;  1PRT D;  3C3L A;  4DUZ L;  4PMW A;  1LYL A;  1QVG A;  4MTN A;  5FK9 C;  3ND9 A;  3QO2 A;  3HOY G;  3K59 A;  2AHO B;  2ZJP A;  5BN4 A;  4JBW A;  1JWU D;  4WOR A;  1SSO A;  2MNA A;  3K5N A;  1WFQ A;  4A4I A;  2KCN A;  2EYL A;  1G2S A;  4OL7 A;  1UE6 A;  4K6L A;  1H9M A;  2Z8L A;  1EY9 A;  1B1Z A;  4ZLT F;  4I7A A;  1HUN A;  4DV7 Q;  1UE7 A;  3U4V A;  4C3H H;  1YVC A;  1PH4 A;  4QIW E;  3GTL H;  5CV5 A;  2WAQ E;  2A6E C;  4JPB W;  2K05 A;  2SOB A;  4LFC Q;  4X3S A;  1I3Q H;  3KBX A;  3CCQ A;  2HHH Q;  3I4M G;  4DKA C;  2VXW A;  4O0A A;  4Y7N B;  3Q23 A;  4FF3 A;  1KRS A;  4QJF A;  1C7Y A;  1IXR A;  1HJP A;  1CKN A;  1WVL A;  3DWP A;  4WJ3 M;  5M5Y H;  4DV1 Q;  2X6L A;  3AB9 A;  4P75 A;  3FMC A;  3HOZ H;  1KDC A;  5E7N A;  2B8F A;  3HP3 A;  3S16 B;  5DEH A;  1HQM C;  1CHQ D;  3EIV A;  3S2D H;  3JAM L;  4R9W A;  3EVQ A;  1QWY A;  1FR3 A;  3GTG B;  1KDA A;  4YY3 Q;  1Y1W H;  1BF4 A;  4IJL A;  2KHS A;  1STB A;  5LMN Q;  3KK7 A;  3CRL C;  5LMN W;  1WCM B;  3QJY A;  3OHX C;  1KAB A;  2CKZ B;  1VQL A;  4OWX B;  1JB3 A;  5CMD A;  1GUN A;  3STB D;  5EKK A;  1EY6 A;  3GTP H;  3NBH A;  3N52 A;  2GA4 B;  1VMC A;  4XT1 B;  4OGQ C;  2CCZ A;  2B2Y A;  4AYB B;  1XTD A;  3FDT A;  1SFO B;  3GTJ B;  1L2F A;  3TRZ A;  4QUF A;  5IY0 A;  1XMQ L;  1Y1V G;  1K28 A;  4ZCK A;  2MFI A;  4DV4 L;  4XQQ A;  4DR5 L;  4DR4 Q;  2XNA C;  5C3E B;  2EY5 A;  3CCL A;  2G5D A;  3KBG A;  3RLF A;  5M3F G;  1P16 A;  1PFN A;  4J1M A;  3CPF A;  2TSS A;  4G4K A;  3CCJ A;  5C4H A;  2E5L L;  1G2T A;  4TRD A;  5IP7 G;  4JI2 Q;  1AP0 A;  3K0Y A;  1T5E A;  2QEJ C;  4IZ8 A;  3U9S A;  3F1Z A;  3PSI A;  3NEN A;  1ML0 D;  1Q12 A;  3BVG A;  1S3O A;  1XNQ Q;  3T56 B;  3UI2 A;  3KLR A;  4LJZ C;  1VF5 C;  5ELB A;  1WD0 A;  1IBK L;  5IWA Q;  1Q1B A;  1EOT A;  2MGS A;  5M9O A;  4HMI A;  1YNN D;  1XPO A;  3D8G A;  1YIT A;  2CQO A;  1ILP A;  2OT2 A;  1CA6 A;  4UY8 C;  3D6C A;  5CR3 A;  2L12 A;  1GXD C;  1JOK A;  2PQA B;  1EUJ A;  1AZP A;  3HOX B;  1NSN S;  2PI2 A;  3M4O H;  3D0F A;  3DLL A;  2VQF L;  3H0G B;  1TWF B;  3PUW A;  2KJX A;  1VS0 A;  4U67 3;  2ICI A;  4H02 A;  3S14 H;  1HA5 A;  1QJO A;  5EJW A;  1QB5 D;  1XPR A;  4AYB E;  1DXM A;  5L37 A;  1ZYR D;  3C1E A;  2K5W A;  5CBA E;  3HOY H;  1B50 A;  1D5M C;  1CKO A;  1HNZ Q;  1TQO A;  1VCI A;  4B3M L;  2QEX A;  1JOQ A;  4BA2 I;  3BZK A;  2VQE L;  2UUA Q;  1SJH D;  5IGG A;  5KRU A;  4H7B A;  5EBC A;  3U9O A;  1U4M A;  1YNJ D;  3CPW A;  2PCF B;  4GS3 A;  1YZ6 A;  2NUC A;  1ZEQ X;  2F0D A;  2MQH A;  3UDX A;  3QOJ A;  2L0C A;  4DK3 C;  5IGF A;  3J81 j;  1TWC H;  1IL8 A;  4G7Z C;  2E2J B;  2F0H A;  5JVG 3;  4AQY Q;  3I4M H;  1ROD A;  1PLF A;  2DNE A;  1K0S A;  2R92 H;  2K28 A;  1A2U A;  5GAE C;  1TY2 A;  4UP8 A;  1E7Z A;  3ITP A;  1B3A A;  1RTN A;  2ES2 A;  1LT3 D;  4NXM Q;  1ZKO A;  3X3M A;  2HIV A;  3ERO A;  3NHH A;  4LMQ D;  1G91 A;  3K81 C;  3FKI H;  1SE3 A;  2A6H C;  4K0K Q;  3AFQ A;  3VR4 A;  3G6J B;  4C3H B;  3E0J A;  3GTL B;  3J80 c;  4FF2 A;  4A3D B;  4JI6 Q;  1Q3L A;  2LMC B;  1VMP A;  1H9R A;  4GOP A;  1I3Q B;  4E6I A;  4DR3 Q;  1V1P B;  2K4K A;  1EIY B;  3P7J A;  2FMM A;  3FHW A;  2WFW A;  3S1N H;  3OMG A;  5JJK A;  3GTO H;  1GHJ A;  3MAQ A;  4DK0 A;  1YEZ A;  4RH6 A;  5M5Y B;  3RN2 A;  3CW2 C;  4EX5 A;  1Y1V H;  2L4N A;  3HOZ B;  1E1O A;  2Z9H A;  1OO9 B;  2JQO A;  1YJW A;  3S2D B;  5M3F H;  1OXS C;  1N32 Q;  2JA8 G;  2KED A;  1FD7 D;  1RHP A;  3NSW A;  4GKJ L;  4HIK A;  4KY7 A;  1JJG A;  4H44 C;  1ENA A;  5I9P A;  2B63 G;  5IP7 H;  4O2D A;  1XXG A;  4RGM A;  5COR A;  2H4O A;  1WTQ A;  1MGS A;  2DUD A;  4PQX A;  4DR6 L;  4JI3 Q;  3K80 C;  3GTP B;  1Q86 C;  4F88 A;  3GV6 A;  4FDB A;  3P1H A;  1HUM A;  2K03 A;  3I73 A;  4IPH A;  1BBU A;  1PZJ D;  2BE5 C;  1HTL D;  1MKH A;  2EYF A;  5DLQ E;  5EPK A;  4X66 L;  3M3Y H;  4JOI C;  2KQ3 A;  4L6T B;  4DR1 L;  1B2T A;  2DJG C;  2OF1 A;  3E9I A;  5CYU A;  4CDC C;  3VDY A;  3S17 H;  2Z4H A;  1CQV A;  4QY7 A;  1WI5 A;  2SDF A;  4KKS A;  3I3C A;  1ICW A;  1LT6 D;  3CC4 A;  4GLA C;  1A0I A;  2BDN A;  3I4N G;  4RFB A;  2AQ1 B;  1QOH A;  4I65 A;  2EIF A;  4DUY Q;  1TS3 A;  3RD4 A;  3PIO A;  3S1M H;  1KL9 A;  4JW0 A;  1PXU A;  2DY8 A;  1S72 A;  4NPS A;  2K75 A;  2CWP A;  5D3D A;  1OXX K;  5IWA L;  2NN6 G;  1CI3 M;  4POF A;  1BO0 A;  4XYO A;  4KTA A;  4A3E G;  3HOW G;  1SNQ A;  1DJR D;  1YJN A;  1HR0 L;  2RDH A;  2K14 A;  1XJV A;  2CFM A;  4LW1 A;  1NCV A;  3V96 A;  3NQI A;  4JI0 L;  2QIL A;  2CW0 D;  4CJ2 C;  4YWL A;  1A2T A;  3T1Y L;  2PNH A;  1G6P A;  2ICE C;  4GKK L;  1JE5 A;  3S1Q H;  4NW2 A;  3M4O B;  1SYG A;  4A3K B;  2WKD A;  2OQK A;  4J8Q A;  2IW3 A;  1AZQ A;  3S14 B;  2F0F A;  5IT9 E;  4LUZ A;  2N55 A;  5CC4 A;  2K5H A;  1AE2 A;  2EZV A;  1O7Z A;  3VR6 A;  3J80 i;  4R4Q A;  3HOY B;  4OWW B;  1E0B A;  2PZT A;  1RCV D;  5FJ8 G;  1X9N A;  4YHH Q;  3A56 A;  1Y14 B;  3TP6 A;  4HJ5 A;  2B2U A;  2M9V A;  4R1J A;  2ASB A;  5DNF A;  1S5B D;  4C3I G;  1QE6 A;  3DM3 A;  3IRB A;  3LWE A;  2JYO A;  4LUO A;  5CV9 A;  4RAU C;  2YTY A;  1N34 L;  1B7Y B;  1HZ9 A;  3G7L A;  4F7X A;  5I6W A;  4XXE A;  1AE3 A;  1TWC B;  4N8F A;  1I4X A;  5C5M A;  1HZB A;  2RA4 A;  1VQP A;  2D0O A;  3I4M B;  2JK8 A;  3J7A F;  4ZK9 B;  1B3Q A;  4K5X A;  1PTO F;  2X69 A;  4HED A;  2IY5 B;  5AJ3 L;  3WDN A;  1WJJ A;  2A74 C;  3KLW A;  4GNX A;  1A3T A;  2LXJ A;  1Q90 A;  1X55 A;  1STY A;  1HH2 P;  1X3P A;  2HCI A;  4Q5V A;  5C3W A;  4JC0 A;  3CME A;  4IFD G;  3NUC A;  2JA5 G;  2NZH A;  2JA8 H;  3DUZ A;  3S1R H;  1SXT A;  2IT1 A;  4RGN A;  3K0X A;  1KTK A;  1IKM A;  1GD7 A;  4PG3 A;  1IL2 A;  1R4P B;  2B63 H;  3IL8 A;  1TWH H;  4JVZ A;  3TDQ A;  1BCP B;  4TVA B;  1CKM A;  3K5L A;  5JJZ A;  1JR0 D;  1S4Z A;  2NN6 I;  3M9B A;  4DK6 C;  2QW7 A;  5C4X H;  2UUC L;  3UDF A;  1B4O A;  3S1N B;  1ONL A;  5CV7 A;  3GTO B;  4POG A;  1FJG L;  1ENF A;  1ET6 A;  3NWT A;  3BJU A;  4DAV A;  1K73 C;  2JP1 A;  2VB2 X;  1X54 A;  1UE5 A;  2NBF A;  3PO2 H;  1Y1V B;  5IYB H;  1YHQ A;  4NDX A;  1XMO L;  1E2Z A;  2NWG A;  4BWG B;  5M3F B;  1K3R A;  4C3H G;  5A35 A;  5KNC A;  3L3O C;  2G9H D;  3LGJ A;  2LXK A;  1RJT A;  2HQE A;  3H3V I;  2EJG C;  1HNX Q;  3TME A;  1EY5 A;  1J5E Q;  1MI2 A;  2SNS A;  2F0K A;  1YNX A;  4LF6 L;  3Q6S A;  1XMQ Q;  5C44 G;  2IHE A;  2K6A A;  2NN6 H;  4G7H C;  4QGU A;  4DV4 Q;  5E4X A;  4A3E H;  1VQD A;  3HOW H;  1LAB A;  4DR5 Q;  3AFP A;  4HSP A;  1QIL A;  3M3Y B;  4WFN 3;  5C6A A;  1K9M C;  3NK9 A;  1EQV A;  1LTL A;  3S17 B;  4IOA A;  2NTS A;  5ELO A;  2MHV A;  1Y1W G;  2E5L Q;  5FOB B;  4JBK A;  1CM9 A;  1E22 A;  2NVT H;  3J81 E;  1V8Q A;  1VQ6 A;  1Y8O B;  2AKW B;  4ALP A;  4IFD J;  3M85 A;  2RHS B;  2ZJR A;  2K1B A;  5HGQ A;  1DGS A;  1IBK Q;  3NBH B;  3S1M B;  1OXU A;  3H3V H;  3NBI A;  1I50 H;  1D5X C;  2BA0 A;  1STG A;  2HDL A;  4GZY C;  5GAD C;  4HN7 A;  4CKB A;  4XQN A;  4HID A;  5NUC A;  4IFD I;  1B44 D;  3TP8 A;  3KOJ A;  5EQ0 A;  1M4V A;  5COY A;  1C0A A;  2MO0 A;  3QOL A;  4APV A;  4A3M G;  4OIJ A;  5TSS A;  2XWJ B;  4KN7 C;  4C3I H;  5LL6 S;  2BCO A;  2VQF Q;  3C46 A;  1V1Q A;  2QCP X;  3I91 A;  2F52 A;  4RHS A;  2A6E D;  5IYC G;  4NB3 A;  1LTB D;  1LTR D;  2IJ0 A;  1ICF B;  3GTK H;  1IYU A;  1TWG H;  1CFM A;  3RR5 A;  2KCT A;  1SDF A;  1L1O B;  1EZ6 A;  2YYZ A;  1BQQ T;  2MJ8 A;  4B3M Q;  3MTS A;  1EOV A;  4N8X 1;  2TMP A;  3DEO A;  3S15 H;  4MIU A;  2VQE Q;  1KHI A;  4B3R L;  4IUP A;  3T13 A;  4JBM A;  1I4G A;  3BDC A;  1WTR A;  4A3G G;  2UXB L;  1D8L A;  1BCP C;  2PW5 A;  3A55 A;  2SEB D;  4CKC A;  1M90 C;  3JAM E;  4IFD H;  3PUY A;  4HR7 B;  1O80 A;  2JA5 H;  2JE6 I;  4DV5 L;  2LKV A;  1I6H H;  1JMC A;  5K36 G;  1AW7 A;  3D4D A;  2VL6 A;  2RHQ B;  2EY6 A;  3BVM A;  4YWK A;  1V43 A;  1S5E D;  3R3O A;  2K5D A;  2NZO A;  1KLG D;  5A2Q L;  3OTO L;  4OWT B;  1R9T B;  1AN8 A;  1QZG A;  1QVF A;  1OXV A;  1Z7T A;  4K6D A;  2F0P A;  3K7A H;  4QUC A;  2D0P A;  2B3G A;  3U4Z A;  4JI5 L;  1D1I A;  1VQ8 A;  4UDU C;  4R8N A;  1QNK A;  2JA7 H;  2MPM A;  1Y69 U;  2MO1 A;  2JA8 B;  3S1R B;  2OEO A;  3DWA A;  3T4A C;  3GD7 A;  3PIP 3;  3IFT A;  3CRK C;  4DNR B;  2B63 B;  1TWH B;  3PO3 G;  1F9P A;  4PMC A;  4L8J A;  1D2B A;  1EL0 A;  2R92 G;  2ZM6 L;  2KEN A;  4K2K A;  1SMY C;  5C4X B;  4A3F G;  2BA1 A;  4X3U A;  3GTQ H;  3RN5 A;  5C44 H;  3KF8 A;  1QCB D;  4GLV B;  1PRT F;  1K8A C;  2SNM A;  3ND8 A;  1XYI A;  2I46 A;  1NUC A;  1EY4 A;  3KUP A;  3BZD B;  2E2I B;  3WOF A;  3A8K E;  3MHB A;  4PZ8 A;  4P74 A;  1N33 L;  3FKI G;  1S40 A;  4GKJ Q;  2IWH A;  1SEB D;  3I72 A;  2M2L A;  1U9R A;  1GO3 E;  3VR5 A;  1E2W A;  5JOB A;  4DU9 A;  2ENB A;  2JJQ A;  3B6Y A;  4ZKB B;  3M7N A;  4YCU A;  1CUK A;  2NZ1 D;  3H91 A;  3GDE A;  3L2P A;  3W3A A;  1KNA A;  1NTG A;  3I4N B;  4DR6 Q;  1WTX A;  1UUP A;  3I4L A;  1HNX L;  1X3G A;  2ZXO A;  1PVO A;  1J5E L;  1CSP A;  2WV6 D;  3KJO A;  2K33 A;  4DR7 L;  4X66 Q;  1Y8P B;  4DPG A;  1SYE A;  4DR1 Q;  4A3E B;  2KUM A;  3HOW B;  4DFA A;  1E3P A;  2P5Z X;  2RQX A;  2KHJ A;  2LY7 A;  2E8G A;  2NVX H;  2OTL A;  4A3M H;  4K5W A;  2A5H A;  2UXD L;  1PTO H;  1W6K A;  2DGY A;  1L1O C;  3I70 A;  2EE1 A;  1X6O A;  2UXC L;  2K7V A;  4NP5 A;  5IYC H;  2F0J A;  3K58 A;  1NNX A;  2RCF A;  3KF6 B;  2XRS D;  3A54 A;  2X6G A;  1O7I A;  2Z0S A;  3LX0 A;  1YHA A;  3MC0 B;  4K14 A;  3RLN A;  5CGK A;  4JI7 L;  2JEA I;  4B08 A;  3BU2 A;  1O7Y A;  2E74 C;  4ZRZ A;  1D5Z C;  4A3I G;  4GN4 B;  1X32 A;  1I50 B;  2V1C C;  2VY3 A;  2EJM A;  3VR2 A;  5KIX A;  1HR0 Q;  2B29 A;  3ULJ A;  1ASY A;  4HJ7 A;  1MIU A;  3ICE A;  4JI0 Q;  3URY A;  3AQQ A;  3T1Y Q;  1EWI A;  4A3G H;  4GKK Q;  1WYD A;  2Y0S B;  2AWO A;  4H0L C;  4C3I B;  3I7F A;  4ULL A;  1I94 L;  1BXT A;  2N78 A;  3CXC A;  3I55 A;  2EY1 A;  4F8M A;  4WJW A;  2N49 A;  2BH2 A;  5K36 H;  4BY1 G;  4LFB L;  1Q7Y C;  1TWG B;  1LTT D;  2NB0 A;  5IOC A;  3JAM i;  1BR9 A;  1EWH A;  2Z4I A;  5ELD A;  4IPD A;  3NE5 B;  2F4I A;  3S15 B;  4OON A;  5DAU A;  3MFG A;  1LUZ A;  3Q0A A;  4P73 A;  4DV6 L;  1JCK B;  1N34 Q;  5LMU L;  3BVZ A;  3OSO A;  3KLS X;  2JA5 B;  3H6M A;  3J7A 5;  1IW7 C;  4ZKC B;  1I6H B;  2F0V A;  5IGD A;  1CQF A;  5IOD A;  4BBR G;  1SE8 A;  2QF7 A;  1CZW A;  5DM7 3;  3PO3 H;  3TN2 A;  4CHT B;  4FXG C;  4IUV A;  4K8I A;  2L5T A;  5C0X G;  4CDE C;  4CDF C;  2B2W C;  5AJ3 Q;  2BE5 D;  1SRO A;  3HZX A;  4A3F H;  1PFM A;  3FVQ A;  5C3X A;  1FYC A;  5EKI A;  1S5C D;  1TS4 A;  4FVM A;  4B3S L;  3K7A B;  1XNR L;  1K8G A;  1NR2 A;  3G48 A;  2Q2T A;  2KOL A;  1EEI D;  2EVB A;  4GOP C;  4X62 L;  3CU7 A;  1EQR A;  2Q8R E;  3ERS X;  1IBM L;  4X65 L;  4UP9 A;  3SK8 A;  1GVP A;  1KXL A;  4DAM A;  3NEM A;  4A3C G;  4RHR A;  1SBB B;  1JT8 A;  5KYI A;  3RMH A;  4R8I A;  1ILQ A;  2UUC Q;  5G3L D;  2PYK A;  1A15 A;  1K3B C;  4EQ5 A;  2M00 A;  5M5W H;  1RL2 A;  1FJG Q;  2XVS A;  4ME5 A;  3GTQ B;  2F3V A;  3A7L A;  1N36 L;  4OO1 G;  5C44 B;  1F2M A;  1FGB D;  2A73 B;  3VYU A;  2C35 B;  4GNX B;  2O2L D;  1WTH A;  3GQB A;  3Q24 A;  3BDL A;  5F2D A;  1XMO Q;  3QG1 A;  3ZYY X;  5IGB A;  3W1B A;  1H9S B;  2K5Q A;  2OQ0 A;  5IGC A; 
#chains in the Genus database with same CATH homology
 1VQH A;  5EAY A;  4OX9 L;  1YIJ A;  2IY5 B;  5AJ3 L;  1WJJ A;  1MJC A;  4LF5 L;  3KLW A;  4GNX A;  3U50 C;  1X3E A;  1Q81 C;  2LXJ A;  3Q8D A;  1X55 A;  3D31 A;  4IPC A;  1HR0 W;  3UE0 A;  1HH2 P;  3G4S A;  2OTJ A;  4BA1 I;  4JI4 Q;  4JC0 A;  4JI8 Q;  2QGQ A;  3CME A;  1HZA A;  4IFD G;  2R6G A;  2VS1 A;  2JA5 G;  2NZH A;  3MEF A;  2JA8 H;  5C4X G;  2Z6K A;  2ALY B;  3S1R H;  4LF6 Q;  2IT1 A;  3HOU H;  3ZJY C;  3UDI A;  2ZTC A;  4A3I H;  3K0X A;  3OYY A;  1GD7 A;  1Z9F A;  4PG3 A;  1PH2 A;  4ME3 A;  1IL2 A;  4A3L G;  4YHH L;  4LF8 Q;  5HY6 A;  1TWH H;  2A8V A;  3ER0 A;  2B63 H;  1VQ9 A;  3E9H A;  2UUB Q;  1BBW A;  4IJH A;  4TVA B;  2H5X A;  3T1H L;  1CKM A;  1L1O A;  3JC6 6;  4JI1 L;  5IYB G;  3PO2 G;  3TS2 A;  5FLM G;  3UE1 A;  2NN6 I;  5GAG C;  3M9B A;  4DK6 C;  2GVB A;  4A3K G;  3M4Q A;  3I56 A;  4X64 Q;  4TQU S;  4DV0 Q;  5C4X H;  2UUC L;  3CD6 A;  3UDF A;  3F2B A;  4NXN Q;  2F4V L;  1M1K C;  4POG A;  4DUZ L;  1FJG L;  1Q1E A;  1RIP A;  3BJU A;  1K73 C;  2Q2U A;  4PMW A;  3PUX A;  1LYL A;  1IBL L;  4C2M H;  1X54 A;  1UE5 A;  4JBJ A;  4MTN A;  1QVG A;  3PO2 H;  5IYB H;  3SGI A;  2K52 A;  5FLM H;  3RNU A;  1CSQ A;  2VW9 A;  4DV3 Q;  4A3J G;  3HFZ B;  1VQ5 A;  1YHQ A;  3HOY G;  4A3K H;  4A3B G;  1XMO L;  1FL0 A;  2AHO B;  3I4O A;  5C0X I;  2ZJP A;  4BY1 H;  4JBW A;  5J3B A;  1K3R A;  3F2C A;  1NBW A;  2MNA A;  1Q82 C;  4HJA A;  3HOV H;  3U58 A;  3PGZ A;  5IYD H;  4LFA Q;  1WFQ A;  1X65 A;  2HHH Q;  3STB C;  3LGJ A;  4A4I A;  1EFW A;  1X56 A;  2LXK A;  2PQA A;  3CAM A;  3H3V I;  1UE6 A;  4A3J H;  2K5N A;  4JOI A;  1HNX Q;  2OWO A;  4DR2 Q;  1J5E Q;  1EQQ A;  1E1T A;  4DV7 Q;  1VQG A;  1UE7 A;  4JI8 L;  4JI4 L;  3U4V A;  4R4T A;  1YNX A;  1YVC A;  4C3H H;  1PH4 A;  4QIW E;  1VQA A;  4LF6 L;  3GTL H;  1XMQ Q;  2WAQ E;  4AIM A;  2IHE A;  2KCM A;  1L0W A;  5C44 G;  4QGU A;  4DV4 Q;  3CCU A;  1VQF A;  4A3E H;  1VQD A;  4LFC Q;  3HOW H;  1Z47 A;  4DR5 Q;  1I3Q H;  4MZ9 A;  3AFP A;  2YTV A;  3CCQ A;  2RCN A;  3KDF B;  4DKA C;  4O0A A;  5IP9 H;  2UUB L;  3I4M G;  1KRS A;  1GKH A;  1UE1 A;  4QJF A;  4RMF A;  1C7Y A;  4LF8 L;  1IXR A;  1K9M C;  1HJP A;  4BBR H;  1LTL A;  4X64 L;  1CKN A;  4DV0 L;  4IOC A;  4B3T Q;  2Y0S E;  5ELO A;  4BBS G;  4IOA A;  4A93 G;  4NXN L;  1Y1W G;  2E5L Q;  4WJ3 M;  5M5Y H;  4DV1 Q;  2ZTE A;  3MXN B;  4OO1 I;  4JBK A;  3CF5 A;  2WAQ G;  4P75 A;  1E22 A;  1QUQ B;  5E7N A;  2NVT H;  2VUM G;  3HOZ H;  4DAY B;  1B8A A;  1PFS A;  1NJI C;  1VQ6 A;  2RF4 A;  2AKW B;  3EIV A;  4ALP A;  4IFD J;  3M85 A;  3TRE A;  3S2D H;  2RHS B;  2ZJR A;  1PA6 A;  4DV3 L;  4B3R Q;  4QQB X;  5HGQ A;  1DGS A;  1IBK Q;  3NBH B;  3W1G A;  4YCW A;  4JYA Q;  1OXU A;  3BZC A;  4YY3 Q;  1Y1W H;  3H3V H;  2Y0S G;  4IJL A;  1U0L A;  5LMN Q;  1I50 H;  5LMN W;  1PH1 A;  2BA0 A;  4LFA L;  5GAD C;  4DV5 Q;  2IHF A;  2CKZ B;  1KQS A;  1VQL A;  3J7Z C;  4OWX B;  1W2B A;  2R7Z G;  3F8T A;  3STB D;  2E2H H;  1KRT A;  4HID A;  3GTP H;  4IFD I;  4DR2 L;  2D62 A;  1U5K A;  3KOJ A;  1E24 A;  4A3C H;  3CP0 A;  4DV7 L;  2MO0 A;  2NVQ H;  2CCZ A;  4APV A;  4A3M G;  1C0A A;  4GNX C;  1XTD A;  3TQY A;  4QL5 A;  1L2F A;  1YBY A;  4C3I H;  3OTO Q;  3TRZ A;  1XMQ L;  4IPG A;  5IY0 A;  2VQF Q;  1Y1V G;  1V1Q A;  3CCM A;  1JJ2 A;  1SN8 A;  2MFI A;  4DV4 L;  2UU9 Q;  2F52 A;  1PH3 A;  4LFC L;  5IYC G;  4NB3 A;  4DR5 L;  2HHH L;  4DR4 Q;  1KIX A;  2FXQ A;  3GTK H;  3S2H H;  3CCL A;  3RLF A;  2HQL A;  5M3F G;  3RZD H;  1P16 A;  1SMX A;  1VQK A;  2OCE A;  1TWG H;  1G29 1;  3CPF A;  4JI5 Q;  4B3T L;  3RR5 A;  3CCJ A;  2KCT A;  1PHJ A;  1L1O B;  3G6E A;  2E5L L;  4DV1 L;  4X6A H;  1EIF A;  4L5R C;  5IP7 G;  4JI2 Q;  1TWA H;  2YYZ A;  3HKS A;  3PIP A;  2A1A A;  3CCE A;  4B3M Q;  1EOV A;  3F1Z A;  5H1S E;  3PSI A;  2KBN A;  3NEN A;  2WP8 J;  3S15 H;  2VQE Q;  1Q12 A;  1KHI A;  1S3O A;  1XNQ Q;  4B3R L;  1IBK L;  1P8L A;  1KC8 C;  5IWA Q;  4JBM A;  4JYA L;  4A3G G;  1D8L A;  4YY3 L;  1Q1B A;  1X3F A;  2ZM6 Q;  4L5Q A;  2YU9 H;  2JA6 G;  5LMN L;  3PV0 A;  4C3J H;  5C0X J;  1M90 C;  3PUY A;  3GO5 A;  1XPO A;  1YIT A;  2JE6 I;  2JA5 H;  4R4O A;  2CQO A;  4DV5 L;  3KF6 A;  4XTC S;  1I6H H;  4GLX A;  2XTI A;  1JMC A;  3EN2 A;  4A3L H;  5K36 G;  2IX0 A;  2VL6 A;  2RHQ B;  4KLK A;  4UY8 C;  4YWK A;  1V43 A;  2PQA B;  1EUJ A;  3K7U C;  2PI2 A;  3M4O H;  2NZO A;  3W5O A;  3D0F A;  1N33 Q;  3OTO L;  3DLL A;  2R93 G;  4OWT B;  2VQF L;  2JA7 G;  1QZG A;  1QVF A;  3PUW A;  2UU9 L;  1VS0 A;  1K83 H;  1OXV A;  5C4J H;  3CCS A;  4H02 A;  3S14 H;  4DR4 L;  3H15 A;  2GN5 A;  1SRU A;  1YHB A;  3K7A H;  1XPR A;  4AYB E;  2NVY H;  2D0P A;  1V9P A;  2B3G A;  3U4Z A;  1WCM G;  2JEB I;  4JI5 L;  2EQS A;  1VQ8 A;  4L5S A;  3HOY H;  1B70 B;  1VQJ A;  4YWM A;  4A3B H;  5BR8 Q;  2ZTD A;  1CKO A;  4AH6 A;  4JI2 L;  2JA7 H;  1HNZ Q;  2MO1 A;  1VQO A;  1CKN B;  1A62 A;  4DR7 Q;  4MNO A;  3K8A A;  1VCI A;  5JEA G;  4B3M L;  1VQN A;  2HIX A;  3ULL A;  3GD7 A;  2ID0 A;  2QEX A;  4BA2 I;  3BZK A;  2VQE L;  2UUA Q;  1XNQ L;  4AYB G;  4HIM A;  3PO3 G;  4PZ7 A;  4DV2 Q;  3CPW A;  2R92 G;  3FP9 A;  2ZM6 L;  2KEN A;  1JB7 A;  4GS3 A;  1YZ6 A;  4JV5 Q;  1PH5 A;  5GQO A;  5C3E G;  4R4I A;  4HIO A;  4A3F G;  2BA1 A;  2UXD Q;  2AWN A;  2ATW A;  3GTQ H;  2MQH A;  3UDX A;  4DK3 C;  3RN5 A;  3J81 j;  4YCV A;  1FVI A;  4JCV E;  1TWC H;  5C44 H;  4BY7 G;  4P72 A;  4GLV B;  1N8R C;  2UXC Q;  1K8A C;  4AQY Q;  1BVS A;  1HZC A;  3I4M H;  4A75 A;  2UXB Q;  1PH6 A;  2K5V A;  1PV4 A;  4JI7 Q;  2R92 H;  4OX9 Q;  4HJ9 A;  4PZ8 A;  5GAE C;  4P74 A;  1N33 L;  3FKI G;  3NEL A;  1S40 A;  2I5L X;  4UP8 A;  4BBS H;  4GKJ Q;  1E7Z A;  4A93 H;  1VQ7 A;  1GO3 E;  2ES2 A;  4NXM Q;  2JJQ A;  3B6Y A;  1PYB A;  3M7N A;  4YCU A;  1CUK A;  2HIV A;  2VUM H;  1WOC A;  3GDE A;  3WWV A;  3L2P A;  3K81 C;  2HT1 A;  3CC2 A;  4LF9 Q;  1NTG A;  4DR6 Q;  1NMG A;  1VQE A;  2R7D A;  2VNU D;  1HNX L;  1X3G A;  3KFU A;  1PVO A;  3FKI H;  3A5Z B;  1J5E L;  3M4P A;  5BR8 L;  1CSP A;  1G51 A;  4K0K Q;  3AFQ A;  3KJO A;  4DNI A;  3PCO B;  1HNZ L;  2VZA A;  3RZO H;  4DR7 L;  3AYH B;  4X66 Q;  3J80 c;  4OXP A;  4JI6 Q;  3CC7 A;  4JI1 Q;  1I94 Q;  5M3M G;  5M5X H;  4DPG A;  1W3S A;  2L15 A;  3RLO A;  4DR1 Q;  4GOP A;  2UUA L;  3HOX G;  2R7Z H;  4DR3 Q;  3PUZ A;  1E3P A;  2K4K A;  4DV2 L;  2ZJQ A;  1EIY B;  3H0G G;  2Z6K C;  1KD1 C;  5IT9 c;  4LFB Q;  1JJC B;  2KHJ A;  2K50 A;  2E8G A;  2WFW A;  3FHW A;  2NVX H;  2OTL A;  3S1N H;  4JV5 L;  5JJK A;  4DUZ Q;  2IX1 A;  3GTO H;  4A3M H;  1PH9 A;  2UXD L;  1YEZ A;  3E0E A;  5GRO A;  4PZ6 A;  3RN2 A;  3CW2 C;  3J81 c;  4EX5 A;  2DGY A;  1L1O C;  1C9O A;  1Y1V H;  1QVC A;  1X6O A;  3A74 A;  2UXC L;  4LF4 Q;  1H95 A;  1E1O A;  5IYC H;  1J6Q A;  4AQY L;  3KF6 B;  2JQO A;  1YJW A;  2UXB L;  3H0G H;  1O7I A;  2Z0S A;  1R9T H;  1YHA A;  3RLN A;  4JI7 L;  5M3F H;  2JEA I;  4KHP Q;  1OXS C;  1N32 Q;  2JA8 G;  5JEA J;  3HOU G;  4GN3 B;  4GKJ L;  4DV6 Q;  3BU2 A;  1SLJ A;  2GVA A;  4A3I G;  4HIK A;  3UDG A;  1HNW Q;  4GN4 B;  4NXM L;  1JJG A;  1VQB A;  1K0R A;  2B63 G;  5IP7 H;  2V1C C;  4LWC A;  5LMU Q;  2VY3 A;  1HR0 Q;  3CMA A;  2B29 A;  4O2D A;  3ULJ A;  2I5H A;  1ASY A;  4HJ7 A;  2DUD A;  5GAH C;  1MIU A;  2QA4 A;  2CWA A;  4LF9 L;  1PH8 A;  4JI3 Q;  2I0Q A;  4JI0 Q;  3K80 C;  3HKZ E;  3AQQ A;  3ICE A;  4DR6 L;  1Q86 C;  3T1Y Q;  1EWI A;  4FDB A;  4IPH A;  4A3G H;  1BBU A;  4GKK Q;  1T9H A;  4K0K L;  1WYD A;  2AWO A;  2JA6 H;  5ELN A;  1MKH A;  5DLQ E;  4X66 L;  3M3Y H;  4JOI C;  4JI6 L;  3I7F A;  4Y7N H;  1I94 L;  1TXY A;  2N78 A;  3CXC A;  3I55 A;  4DR1 L;  4DR3 L;  2N49 A;  3KYH C;  2BH2 A;  3KJP A;  3E9I A;  3S17 H;  3VDY A;  2R7F A;  1YJ9 A;  4B3S Q;  4BY1 G;  4LF7 Q;  4LFB L;  3HKZ G;  1XNR Q;  1Q46 A;  4QY7 A;  1Q7Y C;  5IYD G;  2PMZ E;  3CCV A;  2E2J H;  3HOV G;  1WI5 A;  4X62 Q;  3S16 H;  4P71 A;  3EBE A;  2N8N A;  4J15 A;  4GLA C;  3CC4 A;  2R93 H;  1IBM Q;  4X65 Q;  1KAW A;  1A0I A;  3I4N G;  3JAM i;  2E2I H;  2EIF A;  4DUY Q;  4LF4 L;  1A8V A;  1VQM A;  3PIO A;  4Y52 H;  4IO9 A;  2I5M X;  3S1M H;  1KL9 A;  4IPD A;  3GTG H;  4KHP L;  1S72 A;  4OON A;  3KF8 B;  1AH9 A;  1N32 L;  3OW2 A;  1LM0 A;  2A19 A;  4NPS A;  1LUZ A;  2K75 A;  1WCM H;  4A3D G;  2CWP A;  3JAM c;  1OXX K;  1YI2 A;  4P73 A;  4UPA A;  1IZ6 A;  5IWA L;  2NN6 G;  4XIG S;  4DV6 L;  1HNW L;  4POF A;  4BXX G;  4A3E G;  4UP7 A;  3A0J A;  1N34 Q;  3HOW G;  3I4N H;  5LMU L;  1YJN A;  5IP9 G;  1HR0 L;  2K14 A;  3J7A 5;  3CQZ H;  1XJV A;  1N36 Q;  2CFM A;  4LW1 A;  4LUV A;  4JG2 A;  4BBR G;  1SE8 A;  2YV5 A;  4JI3 L;  4JI0 L;  2BH8 A;  3CCR A;  2Q2H A;  4YWL A;  3T1Y L;  3TS0 A;  2PNH A;  3GTJ H;  2PI2 E;  1SFO H;  1XPU A;  3PO3 H;  1QZH A;  4A3D H;  1G6P A;  4BXX H;  3GTM H;  4GKK L;  1JE5 A;  3S1Q H;  3HOZ G;  1NMF A;  5C0X G;  5JJL A;  2OQK A;  1UEB A;  5AJ3 Q;  5C3E H;  1SRO A;  5IE8 A;  1ASZ A;  4A3F H;  2F3I A;  3ULP A;  1EYG A;  4LF5 Q;  3PUV A;  2EXD A;  1OXT A;  4L5T A;  4BY7 H;  5JJI A;  4B3S L;  4LUZ A;  4LF7 L;  1MJE A;  2K5H A;  1AE2 A;  1XNR L;  1K8G A;  1Q8K A;  3G48 A;  3L7Z C;  2N3S A;  3G71 A;  4GOP B;  2Q2T A;  3L0O A;  3J80 i;  2WB1 E;  3F2D A;  4GOP C;  1A63 A;  4R4Q A;  2Q2I A;  4X62 L;  2LSS A;  3KDF A;  4GN5 A;  4HJ8 A;  1FGU A;  4OWW B;  1EQR A;  4KHZ A;  1D7Q A;  3ERS X;  1IBM L;  4X65 L;  3S24 A;  4LNQ A;  4A76 A;  4UP9 A;  5FJ8 G;  3TEH B;  1X9N A;  1NY4 A;  4DUY L;  4YHH Q;  1VQ4 A;  1PYS B;  1GVP A;  1KXL A;  4DAM A;  4WJ4 A;  3T1H Q;  3NEM A;  1Y14 B;  4A3C G;  1I5F A;  2AMC B;  4HJ5 A;  1OTC A;  3PF4 A;  1JT8 A;  4R1J A;  2ASB A;  1GM5 A;  1QUQ A;  1PH7 A;  3DM3 A;  3IRB A;  2XGT A;  3J81 i;  2UUC Q;  2WB1 G;  4R4C A;  5FLX c;  4LUO A;  4EQ5 A;  1NE3 A;  1SR3 A;  2F4V Q;  2YTY A;  1N34 L;  5M5W H;  1B7Y B;  1N9W A;  1RL2 A;  5FJ8 H;  3A5U A;  1FJG Q;  1HZ9 A;  1N36 L;  1IBL Q;  4OO1 G;  3PF5 A;  1AE3 A;  4KI0 A;  5M3M H;  4GNX B;  2C35 B;  3I2Z A;  1VQI A;  4RG1 A;  1HZB A;  1VQP A;  3HOX H;  2JA9 A;  1UWV A;  1XMO Q;  2D0O A;  3AEV A;  1IYJ B;  1VQC A;  2JK8 A;  3W1B A;  2KHI A;  1TWF H;  2OQ0 A;  1BKB A;  2YTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...