4LUZA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luzA00
3FHWA 1OXTA 2E5LL 1N33L 3A0JA 5BR8L 1N36Q 3HOXG 1KL9A 3CPWA 1SLJA 1IBKQ 1HNWL 4BXXH 5GROA 3UDGA 1L1OC 3J81i 1NE3A 3I56A 3T1HQ 1VQNA 5LMNL 1CSPA 1FGUA 3D0FA 4A3FG 3M85A 4DV0Q 1PH4A 1KRSA 1CSQA 1GVPA 2BH2A 1T9HA 3K8AA 4A3GH 1I6HH 1IBLQ 1VQIA 4LUOA 3I4NG 1E22A 2UXDL 5JJLA 4AYBE 2JA9A 5C0XI 4FDBA 1KXLA 3L0OA 1B7YB 5IYDG 4UY8C 4BXXG 2Z6KC 1UE6A 4A76A 4AIMA 2NVXH 4GLVB 1KAWA 3HOUG 1A63A 3PO2G 2CCZA 4IO9A 2B63G 4DV7Q 2JE6I 4JI2Q 1WOCA 2NVYH 4DV5L 1XMOQ 2PI2E 1VQ9A 4LF9L 2NVTH 3GTPH 1RIPA 2UXDQ 4B3TL 3GO5A 3PCOB 1LYLA 2UUAL 1HNXL 4LF5L 3KOJA 4GS3A 5LMUL 2K5VA 4GOPB 1Z47A 2VS1A 4DV4Q 4NXNL 1PH3A 5M5WH 1PV4A 3GTJH 1HNZQ 3NEMA 5J3BA 4DV6L 4C3IH 4DR4L 4Y52H 4GNXB 1D7QA 3EN2A 1QVGA 3HFZB 1UEBA 2IT1A 4QY7A 2HIXA 2ATWA 1UE5A 2NZOA 2Q2IA 2YYZA 1U5KA 2JA6G 2B29A 4R4IA 3ULLA 1E1TA 3HKZG 1O7IA 4A4IA 4IOAA 1GO3E 4LF8L 1L0WA 4PZ7A 5M5XH 3HOUH 2LSSA 2WB1E 5C4JH 5C3EG 1VQOA 4LUZA 1EWIA 2F4VL 1NJIC 1C0AA 1L1OA 4GKKL 1VQCA 1TXYA 5IYDH 4A3KH 4OX9L 1VS0A 4DUZQ 4LNQA 4DK3C 1K3RA 3CC4A 4GN3B 2NN6I 3GD7A 3I4NH 4IJLA 5ELOA 1N9WA 4AH6A 5LMUQ 2NN6G 4OWWB 4UP7A 3HOXH 4A3JH 4HIOA 2YV5A 1M90C 3CC7A 4DV3Q 1OXVA 3KLWA 2ZM6Q 4WJ3M 3AQQA 1PHJA 3KDFB 1Y1WG 2K50A 4JI2L 4BA2I 4JI4L 1K83H 1K0RA 1W3SA 1E24A 3RR5A 1J6QA 1VQ6A 3CMAA 4OWTB 3U4ZA 1S72A 1JMCA 1VQ5A 3E0EA 4KI0A 4DR3Q 1OTCA 4JV5L 2IY5B 4A75A 3PIPA 4LF6L 3S1MH 2K52A 4LF5Q 4LFAQ 1HH2P 3A74A 4APVA 2F52A 3RN2A 4KLKA 1UE1A 4EQ5A 1M1KC 3IRBA 4PMWA 5IT9c 4DV1Q 4JI6L 1GD7A 2WFWA 5LMNQ 2R92G 2D62A 2R6GA 2VQEL 3HOVG 2V1CC 3K80C 3CMEA 3E9HA 2I5LX 3CCSA 1X3FA 1X55A 1YHAA 1HNZL 2QEXA 3CCEA 4H02A 4O2DA 3CPFA 1VQKA 2MO0A 1VQ7A 1ASZA 4A3LG 1X9NA 3CW2C 2BA0A 4YCWA 3F2BA 2R7ZG 1WYDA 1QVFA 4DR7L 3MXNB 4A3GG 3GTGH 4JI8L 4B3ML 1BBWA 4WJ4A 2BH8A 3LGJA 5IWAL 4DUZL 2ZTEA 4IPCA 1A8VA 3K7UC 4GKJL 1OXUA 4GKKQ 3CQZH 2DGYA 1IBML 4LUVA 1N36L 4X64L 3K7AH 1OXSC 4JG2A 1JJ2A 1IL2A 3K81C 4IPHA 1WJJA 3G6EA 5K36G 1I50H 2Y0SG 2UU9Q 1UWVA 3J81j 3PF5A 2JA8G 1PA6A 3B6YA 3GTOH 5GQOA 1XNRQ 3OTOQ 1PH9A 3RZDH 4A93H 2XGTA 1IBMQ 2ID0A 4JBMA 5IYCH 1XPOA 1AH9A 2RHSB 2VW9A 4HIKA 4BY7H 4HJ7A 3S1NH 4LF7L 3TS2A 2K75A 2NZHA 4DNIA 5C4XH 4GOPC 2UUCQ 2OQKA 2VL6A 3PUXA 2H5XA 3F2CA 4BY1H 1PYBA 4DKAC 3PO2H 1N8RC 1EIYB 3RZOH 5JEAG 2N8NA 3STBD 1PH6A 3TS0A 4A3JG 1W2BA 5IY0A 1N34Q 2YU9H 1FJGQ 1KQSA 1HR0Q 3PIOA 2ES2A 2VNUD 4X65L 1Q7YC 1CKOA 4DR6L 1A0IA 2AMCB 4IOCA 2GVAA 1TWHH 2DUDA 1YITA 4DUYQ 4POGA 1J5EQ 4A3IH 1KHIA 1B8AA 2QGQA 4B3SL 1LM0A 1HZBA 1HZ9A 2R93H 1Q46A 1SFOH 1K9MC 1QUQB 2I0QA 1LUZA 1Q12A 3I2ZA 4LF6Q 1CKNA 1VQBA 4JOIA 1V9PA 1X56A 2K4KA 5GADC 4ALPA 4JV5Q 4R4OA 1NMGA 1MIUA 5IWAQ 4MZ9A 2VQEQ 2IX1A 3GTMH 1LTLA 1GM5A 3A5ZB 4BBRH 1HJPA 3RLNA 5BR8Q 3CXCA 2K5NA 3UE1A 2Z0SA 5IP7G 2CWPA 1E1OA 4YHHQ 3S2HH 5ELNA 3W5OA 1CKNB 4ME3A 1JE5A 4KHPL 1QUQA 5FJ8H 4HJAA 4JYAQ 2JJQA 3UDFA 3S1QH 4OX9Q 3KJOA 2CFMA 4GNXA 1IZ6A 4DR6Q 4JI6Q 4X66Q 1EUJA 1YJWA 2HQLA 4DAMA 4HIDA 2F4VQ 2LXJA 2VZAA 5M3FG 1SRUA 1C7YA 1R9TH 2XTIA 3F8TA 2WP8J 1TWGH 3PV0A 4RMFA 4L5TA 1NBWA 3AFQA 5FLMG 3WWVA 1WCMG 3CCQA 3HOZH 1QVCA 2EQSA 4IPDA 1MKHA 4OONA 1PH2A 2YTXA 5EAYA 3KDFA 5IP9H 1I94L 2IHFA 2JA5H 3AYHB 2A8VA 1Y14B 2PNHA 4A3BH 1YHBA 4HIMA 3RNUA 1WFQA 2HT1A 4DPGA 2OWOA 4A3CG 4R4CA 4K0KL 1V43A 2UXBL 4QGUA 1EOVA 2WB1G 1UE7A 1EQRA 1IBKL 4QQBX 1HNWQ 5C44H 1XNRL 4TVAB 4IPGA 1QZGA 2FXQA 2E5LQ 1XJVA 2N78A 3S24A 2PI2A 4JBWA 5M3FH 2WAQE 1PH8A 2EXDA 4JI3Q 1L2FA 1PFSA 3W1GA 1YIJA 3UDXA 1BVSA 1KD1C 1EFWA 1P8LA 1SROA 3RLOA 3PO3H 1BKBA 3M4OH 4X65Q 3ER0A 2MNAA 4DR4Q 4JI7L 4XIGS 3JAMi 3CCVA 2ASBA 2WAQG 4IJHA 4A3EG 4BBSG 3H3VI 3GTKH 4PG3A 2HHHQ 5GAGC 1HZCA 4P72A 4HJ8A 3T1YQ 3A5UA 1TWCH 3BJUA 4HJ9A 4DR2Q 4KHZA 4C2MH 1XMQL 5C0XG 2JK8A 4A3DH 1I5FA 4GOPA 4DV5Q 1XMOL 4L5QA 4LF9Q 1AE3A 2UUBQ 1JJGA 4YCUA 4MNOA 3M4QA 4LWCA 2YTYA 3J80c 1FL0A 3BZCA 2KCMA 1CUKA 2OQ0A 2RCNA 3FKIG 3OYYA 4QJFA 3UDIA 3H0GH 4DV2Q 4JCVE 1I94Q 2JA7G 3GTQH 4DR7Q 4A3CH 1AE2A 3PUYA 2UUAQ 2N49A 4A3BG 2B3GA 4GN4B 1MJEA 2R7FA 5IYBH 3EIVA 4JBKA 1X3GA 4UP8A 3G71A 2ZJRA 3I4OA 2OCEA 3M7NA 5JEAJ 1B70B 3VDYA 4EX5A 2UXCQ 1YZ6A 1MJCA 5FLXc 1IXRA 2Z6KA 3ERSX 4Y7NH 3S15H 3NBHB 3F1ZA 3I4MH 4X6AH 2CQOA 1OXXK 2VUMH 3I55A 2JEAI 1YEZA 2ALYB 4NPSA 1VQMA 4QL5A 3UE0A 2KENA 3L2PA 3S17H 3T1YL 4IFDG 4DV0L 3ULPA 1HR0W 2K14A 1VQEA 2IHEA 1VQ4A 5IP7H 5IYCG 4C3JH 2I5MX 3DLLA 4IFDJ 4JI5L 3SGIA 3ICEA 1XNQQ 4B3RQ 2GVBA 2ZM6L 4LF4Q 4DV3L 1VQLA 4QIWE 5C44G 3KFUA 1VQJA 2AHOB 2QA4A 5IYBG 1L1OB 1J5EL 2AKWB 1G291 4DUYL 4O0AA 1U0LA 3F2DA 4LF4L 2NVQH 4YWMA 2L15A 2A19A 3CCLA 3AFPA 5M5YH 4MTNA 2IX0A 4YCVA 3CF5A 1Q8KA 2E8GA 4HJ5A 3KYHC 4K0KQ 3J80i 5M3MG 1SN8A 2UXBQ 2D0OA 1FJGL 1XPUA 2R7DA 1Y1VH 2KHJA 4A3LH 2GN5A 5AJ3L 2JEBI 4YHHL 5AJ3Q 1VQAA 2E2IH 4POFA 4DAYB 2MFIA 3E9IA 4A3EH 5E7NA 4BBSH 4DR1L 1C9OA 3H3VH 3HOVH 5C0XJ 3HOWH 4X66L 4X62L 4JOIC 3U4VA 2UXCL 1VQ8A 2C35B 5DLQE 1I3QH 3TQYA 2Y0SE 4A93G 1N32Q 3PUVA 2ZJPA 1SR3A 3M4PA 1IBLL 2JA8H 1EYGA 1XTDA 4B3RL 3HOYH 3J7A5 4OO1I 4NB3A 4P71A 3CCMA 3CC2A 1PVOA 5HGQA 3HOWG 1XPRA 1YNXA 2RF4A 4R4QA 1SE8A 3NELA 1HZAA 1K8AC 3S2DH 4DV4L 2KHIA 1JT8A 3PF4A 1S3OA 1YBYA 2RHQB 4OXPA 1K73C 3K0XA 2PQAA 3Q8DA 4UPAA 1Y1VG 5GAEC 2JQOA 4C3HH 4AYBG 4A3IG 1VQPA 1N33Q 3AEVA 1PH1A 3TRZA 3DM3A 1VQHA 1TWAH 1EQQA 1KC8C 1A62A 4XTCS 2ZJQA 4LF7Q 4LW1A 4A3KG 1VCIA 4GNXC 2ZTDA 1PH5A 3EBEA 3STBC 1Q1EA 1H95A 1HR0L 1BBUA 1DGSA 4BY1G 3CP0A 5FLMH 4JI3L 3RN5A 2R92H 5C4XG 2BA1A 3HOYG 3U58A 1N34L 1X54A 2AWOA 3G48A 1N32L 4JI0L 4BY7G 4GLAC 4X64Q 2N3SA 2VQFQ 3PSIA 3M9BA 3CAMA 4L5RC 3CCJA 3J81c 4YWLA 5FJ8G 1PH7A 3I7FA 1GKHA 1X65A 4DR1Q 4DK6C 2UUBL 3PUWA 4P74A 4LFCL 4NXNQ 3BU2A 4OWXB 3KF6A 3J7ZC 3CD6A 2VUMG 1YVCA 1YHQA 2UU9L 4BBRG 1VQFA 3JAMc 1S40A 2A1AA 2R93G 4JI7Q 4YY3Q 4UP9A 4DR5Q 2EIFA 2OTJA 3OTOL 5M3MH 3H15A 4DV1L 2MQHA 4JI1L 1VQGA 3S1RH 2E2HH 1Q82C 4JYAL 4TQUS 3KJPA 4P73A 2ZTCA 5HY6A 3HKZE 4LFBL 2Q2UA 2JA5G 5C3EH 1G6PA 3FKIH 2JA7H 1Q86C 1YJNA 4A3FH 1WCMH 4NXML 1P16A 4GN5A 3S14H 4GLXA 4DV2L 3G4SA 4GKJQ 3T1HL 2HIVA 3PGZA 3D31A 2PMZE 4B3MQ 2PQAB 1K8GA 1Z9FA 2CWAA 1Q81C 3S16H 3RLFA 4B3TQ 1KIXA 2HHHL 2AWNA 4B3SQ 1WI5A 2E2JH 4A3MH 4BA1I 1X6OA 3PO3G 3U50C 4PZ8A 4JI1Q 3I4MG 4DR3L 2YTVA 2Q2TA 3L7ZC 1Y1WH 2B63H 1V1QA 4R1JA 5H1SE 1YJ9A 4JC0A 1JB7A 1TWFH 3MEFA 3GTLH 3KF8B 4JI4Q 2KCTA 4KHPQ 5JJIA 1NMFA 5GAHC 2CKZB 4LF8Q 2I5HA 4LFAL 2MO1A 2Q2HA 2UUCL 1E7ZA 1VQDA 4R4TA 1PYSB 3CCUA 4PZ6A 4X62Q 3H0GG 1RL2A 3TEHB 5IP9G 4P75A 1IYJB 1YI2A 4JI5Q 1G51A 4L5SA 4YY3L 5LMNW 4OO1G 3W1BA 3HOZG 3GDEA 2R7ZH 1ASYA 4NXMQ 3HKSA 3KF6B 1KRTA 2VQFL 2OTLA 2JA6H 4DR2L 1XMQQ 4A3DG 4YWKA 4JI0Q 2KBNA 2K5HA 1JJCB 4JBJA 1D8LA 4LFBQ 1NTGA 3PUZA 1QZHA 1FVIA 1NY4A 4LFCQ 3TREA 4DV7L 4IFDI 3CCRA 2D0PA 1XNQL 4AQYQ 3BZKA 3JC66 3ULJA 4AQYL 4DR5L 1CKMA 4DV6Q 1EIFA 3ZJYC 2VY3A 2LXKA 3NENA 1E3PA 3FP9A 4A3MG 4JI8Q 3M3YH 5JJKA 4RG1A 1Q1BA 2F3IA 1X3EA 1SMXA 4J15A 5IE8A 3OW2A 1HNXQ
chains in the Genus database with same CATH superfamily
2EY5A 5BR8L 1KL9A 1V1OA 1IBKQ 5EBDA 4ZUIA 3TZUA 2YU9B 1NE3A 1VQNA 2K5QA 1CSPA 4IUPA 3LWUA 2F0UA 4ID6A 1CSQA 1GVPA 2K7VA 1A6XA 2JA9A 5C0XI 3L0OA 5IYDG 2A5HA 1B53A 1HTPA 2CQAA 5CV4A 4AIMA 5DAUA 2EY2A 1KAWA 4GLVB 4HMJA 3HOUG 2B63G 2M9VA 4JI2Q 1WOCA 3SK8A 4DV5L 1VQ9A 1RIPA 1B44D 4B3TL 3E0JA 2G9HD 3OWFA 2JSOA 3VYRA 3AU7A 4DV4Q 1DCZA 1HNZQ 3GTJH 4G4KA 4I65A 4C3IH 3TP6A 5KYIA 1D7QA 3EN2A 5K36H 3HFZB 3PIO3 2HIXA 3SK6A 2B29A 2HCCA 4IOAA 1U4RA 3QOJA 1L0WA 1H9MA 4V0BA 2KA7A 1BCPB 3ND8A 4RFBA 3GTJB 1VS0A 4LNQA 3G7LA 1K3RA 3CC4A 4GN3B 3GD7A 3I4NH 4WFN3 1N9WA 3DUZA 4AH6A 5LMUQ 3IKJA 2WKDA 4A3JH 4Q0FA 4DXFA 4HIOA 1TY2A 1EYCA 1PHJA 1SMYD 1CZGA 4CDEC 1F9PA 4JI2L 1K0RA 2J7ZA 3PIP3 3RR5A 1J6QA 1QE6A 1G2SA 1VQ6A 3D6WA 3CMAA 4OWTB 1VQ5A 1SYDA 2K33A 3E0EA 4KI0A 5FK9C 4LF6L 4FF3A 3P7JA 2QW7A 1TWCB 1GD7A 2X6GA 2XSCA 3QWNA 4RGOS 1H9SA 1SSOA 2V1CC 3K80C 1HNZL 1X55A 3OSOA 4IUTA 2QEXA 1UUPA 3NQTA 1K3BC 2X69A 3GTMB 1FD7D 1ASZA 3CW2C 5IGCA 3H3VC 5LHY1 5IWAL 4NDXA 4EQNA 4QUFA 4HN7A 1WD0A 3DWPA 4GKJL 5C3WA 3MEHA 5C4XB 4X64L 4KV6A 3K81C 1WJJA 5I2XA 2UU9Q 3T53B 5KNDA 2JA8G 3B6YA 3J7AV 1XNRQ 1XWEA 1B9NA 1PH9A 1IBMQ 4C3JG 2ID0A 1JWMD 4MHEA 5IYCH 1XPOA 2VW9A 3TSSA 1LT4D 4MIUA 2NZHA 4DNIA 5C4XH 4BY1H 1TQOA 2H5XA 5C5MA 1N8RC 3BZDB 4A3JG 1HR0Q 3K5NA 1GHJA 4DR6L 4R9WA 4IOCA 1TWHH 1YITA 4J1MA 2WINB 3NXWA 2E2DC 1B8AA 2R93H 5FO9B 1SFOH 1HA5A 2I0QA 1LT5D 1VQBA 2K4KA 1X56A 4ALPA 4ZLTF 4NW2A 3MFYA 1MIUA 5IWAQ 2VQEQ 2CW0C 4A3EB 4BBSB 3T51B 3RLNA 3HOZB 2Z0SA 2CWPA 4YHHQ 1G6ZA 5ELNA 3SEBA 1EU4A 1T5EA 2R3ZA 3S1QH 1LABA 4GNXA 3NWTA 4JI6Q 1YJWA 2F4VQ 2LXJA 2VZAA 5M3FG 2O4XA 2TMPA 1R9TH 3F8TA 2WP8J 1TWGH 3PV0A 3AFQA 3HOZH 1YNND 2EQSA 4IPDA 1PH2A 1RHPA 5EAYA 5IP9H 4C3HG 5KIXA 3AYHB 2PNHA 2HT1A 2VB2X 3C1EA 1AFPA 1EOVA 2WB1G 1HNWQ 1FGBD 5C44H 4TSSA 1QZGA 2E5LQ 3SR1A 1DM0B 3S24A 1R9TB 4QIWB 3E6ZX 2PI2A 4JBWA 2MP1A 5M3FH 5C4HA 1IW7D 3EROA 1BVSA 1DYQA 3A56A 1P8LA 3KK7A 5ELCA 3RLOA 1BKBA 1S5ED 1ZEQX 2WV6D 5CV5A 3RMHA 3ER0A 2MNAA 1JE4A 4XIGS 3CCVA 4IJHA 3H3VI 3NTIA 3T1YQ 3BJUA 4FXGC 1L0YB 4CKCA 4KHVA 1AE3A 2PZWA 2UUBQ 3MTSA 3J80c 2R61A 2SEBD 1PTOH 3BZCA 4XDXA 3OYYA 1I94Q 1PZJD 3H0GH 3GTQH 4A3BG 4K2KA 2B3GA 2L5TA 1EZ6A 2HCIA 1ICFB 5D3DA 2ZJRA 1QNUA 2LY7A 3NHHA 3M7NA 3MXUA 1YZ6A 1MJCA 1IXRA 3S15H 1AP0A 3W3AA 4BWGB 2JEAI 1YEZA 4NPSA 1VQMA 1LTSD 2KENA 1CQFA 1HR0W 5IYCG 1MGSA 3CHBD 4C3JH 3DLLA 2B2WC 2SDFA 2E2JB 1Y1VB 3D8GA 5A35A 1EWCA 2LMCB 3NUCA 3HP3A 4DV3L 1TT2A 3KFUA 2AHOB 5IYBG 1U0LA 2NVQH 4G57A 3CCLA 5F2DA 1QOHA 4HJ5A 3FRPB 5M3MG 1CZWA 3OIQA 4KKUA 2AQ3B 1FJGL 1XPUA 4ODGA 1Y1VH 5E4XA 2F0WA 5AJ3Q 3OHXC 4DNTB 4POFA 4FF1A 2MFIA 3E9IA 3H3VH 3UI2A 1IHZA 5CV9A 4RKBA 2B39A 4WJWA 5DLQE 1KDAA 3TQYA 1TS5A 4FF2A 1EQTA 1SR3A 2K05A 3M4PA 1IKMA 1XTDA 4CDDC 3J7A5 4OO1I 3DWQA 4NB3A 2IL8A 3CCMA 1XPRA 1YNXA 2RF4A 5EPKA 3OPOA 4DV4L 2DJFC 4UPAA 1Y1VG 1N33Q 4AYBG 1RD9D 2KVMA 4B9WA 2A6HC 1A62A 5C3EB 4LW1A 3STBC 1WTWA 5JEAH 1FNUA 4OIKA 4EQPA 3NPPA 3RN5A 1PRTC 2BA1A 3HOYG 3U58A 1N34L 2AWOA 4DK0A 3FDTA 4GLAC 5EQ0A 4X64Q 2N3SA 3PSIA 3M9BA 4HSVA 3NE5B 4KJOA 4L5RC 2KQ3A 3CCJA 3R2IA 5A2QL 5CV8A 4OWXB 1O80A 1HXYD 1XX8A 4BBRG 5IGBA 4RA8A 3I8ZA 1D6EC 1WVLA 2G5DA 3K0YA 4WORA 4YY3Q 1MSHA 4DR5Q 3WDNA 4NP5A 3OTOL 3H15A 4JI1L 1VQGA 4JYAL 5CMDA 1B4OA 4TQUS 4P73A 2ZTCA 5HY6A 4G7ZC 4LFBL 2XVSA 2F1MA 2SNSA 3TP8A 1Q86C 2EJFC 1Z6HA 4GLXA 1B3QA 3G4SA 1Y1WB 5JAVA 2EYPA 2HIVA 4H7BA 5ELDA 3J80L 1NR4A 4NKLA 2QF7A 2BDNA 1TWAB 1Q81C 4PNYA 5A2QE 4B3TQ 1MBYA 1SAPA 4FXKC 4L63B 4C1NK 1O7ZA 5EKLA 1Y1WH 2EPBA 5H1SE 3MEFA 3GTLH 2IWHA 2B2TC 1ZKOA 4JI4Q 5JJIA 1AZPA 1ENFA 4LF8Q 4ILWA 2WAQB 1IL8A 5KNBA 2ZT9C 4B08A 3TEHB 5IP9G 3H91A 3BVGA 3HEJA 4JI5Q 3U9OA 4YY3L 2F4IA 3W1BA 3HOZG 4KKSA 4IQZA 2OTLA 3KF6B 1E0BA 1XMQQ 2FMCA 2RKSA 2A68C 3J80E 2KBNA 2K5HA 4JBJA 3KBGA 4LFBQ 1FVIA 3TREA 4DV7L 4IFDI 2F0IA 3CCRA 2D0PA 3S1RB 4AQYQ 1LTGD 5M5XB 1S4ZA 2SNMA 1EIFA 4A3MG 5FO8B 4JI8Q 1ENCA 3FHWA 3ITPA 1N33L 3CPWA 2PO4A 3HOXB 4BXXH 2B2UA 4FO2A 5LMNL 4N8FA 3E3XA 2A6ED 1KRSA 1X3PA 1T9HA 3K8AA 1I6HH 1IBLQ 1VQIA 2DY7A 1EWHA 4AYBE 1JICA 4QF4A 1SJED 1LTRD 4ZUJA 4XXEA 4OL7A 2Z6KC 2FHTA 4TKOB 4HAEA 4IO9A 4DV7Q 1KTKA 1XMOQ 2PW7A 5JVG3 3GO5A 4EGVA 3DHQA 4DAYA 3IFTA 3AEVA 5M5WH 3NEMA 5J3BA 1B3AA 4GNXB 4RAUC 2IT1A 1DD2A 2Q2IA 1R4PB 2F3VA 2XIWA 4KD3A 4R4IA 4A4IA 1O7IA 1GO3E 2DJGC 2H1EA 4PZ7A 2LSSA 1VQOA 4LUZA 1NJIC 4GKKL 4ZYSA 1TXYA 3V96A 5M5WB 4ZQ3A 2PNRC 4HCSA 3CQZB 1PRTD 4A3FB 1RCVD 4BY7B 2D9UA 1M90C 4DV3Q 1WTHA 4RH6A 2BOSA 3MFGA 2ZM6Q 2K50A 1STBA 4JI4L 3HZXA 1W3SA 2L4NA 1JORA 1JCKB 3V2TA 3QOLA 1S72A 4JV5L 2PW5A 2IY5B 4RGNA 4A75A 2ENBA 4LFAQ 2Q8IB 4CJ2C 3RZOB 4K2LA 2L1BA 1M1KC 1CTMA 4DV1Q 2WFWA 3Q0AA 2Y0SB 2R92G 4M1UB 3HOVG 1A3UA 3CCSA 2EZVA 1X3FA 4O2DA 1KLUD 3CPFA 1CFMA 4RWSC 3GTQB 5CGKA 4DR7L 1GUTA 3MXNB 3GTGH 4JI8L 4B3ML 1BBWA 2KJXA 4JPBW 1A8VA 1OXUA 4GKKQ 4XYOA 4Z9CB 4JG2A 1JJ2A 2Z9HA 4IPHA 1JOOA 1ZYRD 4BBRB 3G6EA 5K36G 2Y0SG 2Q8RE 1PA6A 1QJOA 5GQOA 3K58A 3RZDH 4A93H 2WIIB 2XGTA 4F7XA 1AH9A 1H9SB 3J7AF 1KAAA 2KEEA 4HJ7A 5T1GA 4F8MA 4LF7L 1SXTA 1YNJD 4GOPC 2UUCQ 2OQKA 3PUXA 1JOQA 5ELBA 1PYBA 2N8NA 2F0GA 1N34Q 3PF4A 1KQSA 2ES2A 2VNUD 4X65L 1CHPD 1CKOA 3FVQA 2GVAA 1BDOA 1EZ8A 1Y8NB 4A3IH 2QGQA 2WKCA 2BE5D 4DU9A 1EOTA 1HZ9A 4AYBB 1K9MC 1QUQB 4K6LA 1LUZA 1CK1A 3MA2B 5IT9L 2IX1A 4MZ9A 1QWYA 5C0XH 2ICIA 3QIAA 1LTLA 1Z7TA 1JR0D 3A5ZB 2CH4A 1SEBD 4CKEA 1E1OA 3S2HH 5CC4A 2A69C 1O7YA 4ME3A 5CYUA 5FJ8H 1SE4A 3GP7A 4OX9Q 1D5MC 1DJRD 2HQLA 4BY1B 1SRUA 5G3LD 1C4QA 1EEFD 2F0SA 2O2LD 4RMFA 1LTBD 4HR7B 3TP5A 1NR2A 5FLMG 1QVCA 4N9PA 1JWSD 1MKHA 2A74C 2DNCA 3KDFA 2A8VA 3S17B 1LACA 1YHBA 4RGMA 1WFQA 2IX3A 4A3CG 1V43A 1EY5A 4QGUA 1B1ZA 4TVAB 2E76C 3J7YW 5DEHA 1GUOA 1PH8A 1XTCD 4I7ZC 1L2FA 3W1GA 1YIJA 3UDXA 1EFWA 3M4OH 1BUVT 4UDUC 2RSNA 3A7LA 4JI7L 2F0DA 1PRTB 4I7AA 1EY4A 3EVQA 4PG3A 4K5VA 4HJ8A 1XMQL 2JK8A 1I5FA 4GOPA 4LF9Q 2OEOA 4YCUA 3CU7A 4MNOA 4LWCA 4Y7NB 2A6EC 1ZYRC 4PV1C 1CUKA 2NB0A 4QJFA 2PZTA 2JA7G 3HOWB 1HRJA 4DV2Q 5IGFA 1AE2A 2UUAQ 4GN4B 1WTOA 5IYBH 1EL0A 4JBKA 1KDBA 1S5CD 1X3GA 4BS9A 1CI3M 4UP8A 3Q23A 3I4OA 4K5XA 2OCEA 4QCLA 2QEJC 2UXCQ 1STHA 5HURA 1ESRA 4Y7NH 1QCBD 4ZRZA 3VYSA 4X6AH 1OXXK 2VUMH 1T5XD 2ALYB 2J0TD 3UE0A 3L3OC 2F0QA 5CORA 4DV0L 5D14A 2IHEA 3LNNA 4L8JA 3KUPA 5IP7H 1TS4A 2I5MX 4IFDJ 4JI5L 5JPNC 1CA5A 1QB5D 5I6YA 1I4PA 4B3RQ 2GVBA 1DXMA 2QDLA 4G7HC 3TMEA 1L1OB 2AKWB 1G291 4DUYL 4O0AA 1TIID 5M5YH 3KLSA 2RDGA 1Q8KA 4K0KQ 2UXBQ 3H0GB 3URYA 2D2CC 3T4AC 2NBFA 2R7DA 5EJWA 1CA6A 4LK1C 4YHHL 4CKBA 1SNCA 1LT3D 1PTOF 2XN9C 5E7NA 1SE2A 1HCZA 1HFGA 5C0XJ 1SNOA 4EQOA 2UXCL 1TKWB 4X3KA 2C35B 2EJMA 4ZK9B 1HTLD 2Y0SE 4V190 2KOLA 5FKAC 1IBLL 4X3UA 1UNSA 3HOWG 4PQXA 2XRSD 4R4QA 1SE8A 4KY6A 3NELA 2CVRA 2Z1CA 1HZAA 4KN7C 2KHIA 1S3OA 1YBYA 2RHQB 4DN4M 1K73C 3R3OA 4A3IG 2JQOA 4C3HH 3TRZA 1VQPA 1PH1A 3IAYA 2JA5B 2NVQB 1BCPC 4DGZA 1HHVA 3ERQA 1EQQA 5BN3A 4XTCS 3I90A 4A3KG 1ONLA 4GNXC 2KECA 5I6WA 3MVVA 2PMZB 1Q1EA 1BBUA 3OWEB 1DGSA 5FLMH 5E3FA 1N32L 1WTVA 2VQFQ 1KABA 3BYTB 3CAMA 3A54A 1PH7A 4YWLA 5FJ8G 4CJ1B 2QILA 4NXNQ 4LFCL 3VA7A 3CD6A 2NTSA 1MD2D 1YVCA 3SK5A 4CBVA 1H9KA 1TWFB 1F9QA 2UU9L 2JA6B 1DOKA 1S40A 2A1AA 2R93G 5I9OA 2KCNA 4DV1L 2E2HH 5EPLA 1Q82C 2ZXOA 5I2YA 2E75C 3HKZE 4LMQD 2Q2UA 3J81E 5C3EH 1H9RA 1UEAB 3K5OA 4A3FH 3S14H 3S2DB 2L55A 3T1HL 3PGZA 4B3MQ 2PQAB 2L9HA 1NSNS 2EY1A 2K32A 3RLFA 4K8IA 3SDZA 2B2UC 2NWGA 2KUMA 3PO3G 4RCOA 4PZ8A 3I4MG 4DR3L 4IALA 3L7ZC 1S5BD 1V1QA 1YJ9A 3KF8B 2KCTA 3NTHA 5IGGA 5GAHC 1I4GA 2CKZB 2E74C 1V1PA 5E4WC 2Q2HA 3QR8A 3AMUA 2UUCL 4A3GB 3VYTA 2NYZD 4P75A 1YI2A 5LMNW 4OO1G 4WRDA 3FEWX 3JAML 1ASYA 3HKSA 1ENAA 1KRTA 4KN4C 1AZQA 1Q90A 2NTTA 4A3DG 4YWKA 2K5DA 2NVTB 1QZHA 1NY4A 1U4PA 2AQ2B 1BCPD 1XNQL 1D1KA 3BZKA 4AQYL 3ULJA 4DR5L 2LXKA 5JJKA 3M3YH 1A2TA 1Q1BA 1SMXA 3DEOA 1N36Q 1TY0A 1HNWL 4A3JB 1EY0A 5GROA 3HOUB 2EE1A 3UDGA 3J81i 1EEID 2N88A 1PDQA 3T13A 1FGUA 2B2YA 2KEDA 2B2VC 3NBHA 4OO1H 4IZ8A 3M85A 2FMMA 4IURA 5JJLA 2UXDL 2F0MA 4A3IB 3VR3A 4BXXG 1UE6A 2R92B 1EIGA 3KLSX 2NVXH 3PO2G 2CCZA 1PFNA 2JE6I 3GTPH 1X3QA 3PCOB 1LYLA 2UUAL 3KOJA 5JVH3 4IUUA 5LMUL 1IW7C 2F0JA 5C4ZA 2VS1A 1PV4A 4XT3B 1PH3A 3HS0C 1ET9A 2L11A 4XQJA 5CV7A 2K1BA 2B2WA 1QVGA 2B8FA 1UEBA 4QY7A 1UE5A 2YYZA 1U5KA 3HKZG 1TS2A 5C3EG 1EWIA 2F4VL 1C0AA 3D4RA 1VQCA 4OX9L 4DK3C 2NN6I 4IJLA 4DAPA 3EQLC 2MJ8A 2PPBC 2NN6G 4OWWB 4UP7A 3IL8A 2YV5A 1OXVA 4WJ3M 3AQQA 1LLRD 1Y1WG 4BA2I 1SNQA 4JK1C 5G3LF 2PQEA 4CHTB 3U4ZA 2LKVA 2IW3A 4DR3Q 3M4OB 4C3IG 1CM9A 2K52A 4LF5Q 1HH2P 1GUNA 2EYMA 2F52A 3M7GA 4KLKA 1UE1A 2A73B 1BBXC 2R93B 3IRBA 4PMBA 4PMWA 5IT9c 4JI6L 1PRTF 5LMNQ 2D62A 1RKNA 1YHAA 1VQKA 2MO0A 1VQ7A 1Y69U 3A8IE 4CDFC 4A3LG 2XRQD 5IIFA 1EIHA 1HUMA 4WJ4A 2EYOA 5CR3A 3LGJA 4DUZL 1ML0D 3P20A 3K7UC 4KK7A 3CQZH 2DGYA 1N36L 4QMGA 1OXSC 1IL2A 3VR4A 3J81j 3PF5A 5IT9E 1TWGB 3GTOH 1RF2D 4N8X1 3OTOQ 2I07B 1I4RA 1Q3LA 3N6RA 3T56B 5FO7B 4JBMA 1H9JA 2RHSB 3EA6A 3DXJC 2QCPX 4IFDH 2K75A 1VMPA 4CGYB 2VL6A 3F2CA 3RZOH 5FLXE 3T16A 1EIYB 5JEAG 5C44B 3STBD 1PH6A 3TS0A 3BDCA 1W2BA 1FJGQ 2NN6H 5EGTA 1Y8PB 2OF1A 3PIOA 4H0LC 3GTOB 1Q7YC 1TR5A 3C2PA 2Z8LA 1RTOA 1A0IA 3QJYA 3DEPA 3WOEA 4POGA 1B9MA 3A7AB 1GJXA 2OT2A 1LM0A 3E5SA 2RA4A 1SNPA 1GUWA 4LF6Q 3I2ZA 1CKNA 1FNVA 1V9PA 4JV5Q 1YNNC 3ONAB 3GTMH 3GV6A 4BBRH 2EJGC 1Y8OB 1PTOB 1GUSA 2K5NA 4QB4A 5NUCA 5IP7G 3HRZC 3W5OA 1CKNB 4FNFA 4HJAA 4JYAQ 1U9RA 3PQIA 2JJQA 3UDFA 3KJOA 2CFMA 1IZ6A 1EUJA 1FYCA 1SBBB 4DAMA 1II3A 3VR2A 4IUQA 1C7YA 2XTIA 1BXTA 3MWYW 4L5TA 1NBWA 1LTID 3H09A 3R93A 2CW0D 3WWVA 3S15B 1QNKA 1WCMG 4KMUC 1IYVA 2IJ0A 4OONA 2YTXA 4A3KB 1I94L 2JA5H 2IHFA 2AUJD 4KJNA 2OWOA 4K0KL 4R4CA 2UXBL 5I4DA 2N55A 1IBKL 1UE7A 1EQRA 1FNWA 2XWJB 1XNRL 2FXQA 1F2ZA 2N78A 1C8CA 2QDBA 4A3DB 4IUNA 1U4LA 2MHVA 4NMZA 4JI3Q 1K8MA 1WTXA 1TWHB 4XYQA 4Q5VA 3S1MB 1KNEA 4X65Q 2JP1A 1NCVA 5L37A 3JAMi 3C46A 1HQMC 2ASBA 4A3EG 4BBSG 3GTKH 2B2YC 4DNRB 1HZCA 4HJ9A 4KHZA 4C2MH 4A3DH 4DV5Q 4L5QA 1UAPA 2D5DA 2O5IC 3KBXA 3M4QA 2YTYA 4HCEA 5KEEA 1FL0A 2KCMA 4M8AA 3FKIG 1A2UA 4A3CH 4JCVE 4DR7Q 5KRUA 3PUYA 5IGDA 2E2HB 2R7FA 3GTKB 1F77A 3S1QB 3I3CA 3EJIA 3OW7A 2E2IB 5JEAJ 1B70B 5DM73 5C6AA 4EX5A 3VDYA 5FLXc 1EYAA 3D4DA 3BDLA 3HOVB 2Z6KA 3SXHA 3BYYB 1R4QB 1JB3A 3NBHB 3I4MH 2LFNA 3F2UA 2CQOA 3P1HA 1SDFA 4QL5A 3L2PA 4IFDG 1VQEA 1A3VA 1VQ4A 5IOCA 5FLXL 3TBIB 3VR5A 3S1NB 1EQVA 2MGSA 3ICEA 1XNQQ 4K8JA 2ZM6L 4LF4Q 4N9TA 1VQLA 5C44G 2DN8A 2F0VA 3F2DA 4LF4L 4YWMA 2L15A 3AFPA 3BS1A 3CF5A 5IGEA 5IODA 5J22A 4GZYC 3KYHC 1W6KA 3J80i 2ZXRA 5ELEA 4G7OC 2KHJA 4A3LH 1ILPA 2GN5A 3MHBA 2JEBI 3BG3A 1EY7A 1JWUD 4DR1L 1C9OA 1X32A 4X66L 3SK4A 4JOIC 3SE0A 2VUMB 1VQ8A 3KF8A 4ULLA 4S3SA 4A93G 1N32Q 2ZJPA 3M3YB 3CC2A 4P71A 1PVOA 2AUKA 5HGQA 4XT1B 4FYDA 2L0CA 1K8AC 2LS01 1AN8A 1JT8A 5JOBA 5J39A 3K0XA 1PTOD 2PQAA 5GAEC 4MN3A 2HDLA 2EY6A 3DM3A 1VQHA 2B8GA 4C3JB 1TWAH 2DNEA 1VCIA 2ZTDA 3EBEA 4E6IA 1RODA 5ISRA 2PYKA 4J8QA 1HR0L 4BY1G 3EFXD 2R92H 5C4XG 2NVXB 3G48A 2RCFA 3HG9A 3GTPB 2B2VA 4XQNA 2HDMA 3D4WA 1GXDC 1SE3A 5JPMC 2IPKD 1GKHA 1X65A 3TP7A 4DR1Q 2UUBL 1EYDA 3BU2A 3J7ZC 2P5ZX 2EOTA 3FKIB 1HPCA 1YHQA 5D3IB 4LJZC 5J1ZA 4MTKA 3I70A 3V05A 2GA4B 1G91A 3FPPA 3GQBA 1LTAD 3D6CA 1D5XC 2OTJA 4OELB 2HUGA 3S1RH 2Q8TA 4R8IA 1ESFA 1G6PA 3FKIH 1STNA 5LL6S 1YJNA 1K8OA 4NXML 1P16A 1E2ZA 4KY5A 3N52A 4DA2A 4OHJA 5HGTA 3K5LA 3LX0A 3X3NA 2Z4HA 3IFDA 4U68A 4JVZA 1B2TA 1EY8A 1JC7A 3S16H 3U9SA 1CT1D 1X6OA 2CHBD 2KCCA 4JI1Q 1STGA 3C1FA 1K0SA 4R1JA 2EXZA 5C3XA 1PFMA 4JC0A 1TWFH 4UHVA 5K5PA 4F88A 1I4XA 2I5HA 3DMUA 1VQDA 4R4TA 3CCUA 4PZ6A 4X62Q 2I46A 1RL2A 4UAIA 1HUNA 3TDQA 1G51A 1GOZA 3R2TA 3GDEA 1PLFA 2A69D 3ZYYX 4NXMQ 4KY7A 4OIJA 3SHLA 4O1NA 1GUGA 4DR2L 2F0NA 4JI0Q 1JJCB 1D8LA 1M4VA 5D65A 3K57A 3PUZA 1F9RA 4IUVA 1BF4A 2BCOA 3OMGA 3X3MA 5TSSA 1SMYC 4HTHA 1I3QB 4O42A 2SOBA 1CHQD 1CKMA 1G2TA 4C3IB 1J9OA 3NENA 1E3PA 1YNJC 5COYA 1X3EA 4J15A 5BN5A 1I6VC 1OXTA 2E5LL 3A0JA 3HOXG 1SLJA 2JYOA 2K01A 3I91A 2EDGA 1L1OC 3OIPA 1CQVA 3I56A 1SNDA 3T1HQ 4RCNA 2FJ2A 2X6LA 2FINB 3D0FA 3TN2A 2F0TA 4A3FG 4DV0Q 1PH4A 3K5MA 4HEDA 2BH2A 3I4NB 4A3GH 4LUOA 3I4NG 1E22A 2A6HD 3M4YA 4ZAIA 1BNZA 4FDBA 1KXLA 1B7YB 4RKLA 3RD4A 4UY8C 3HKZB 1I4HA 5FOBB 4A76A 1A63A 1ILQA 3G6JB 1KLGD 1NUCA 2NVYH 4LF9L 2PI2E 2UXDQ 3LWEA 2NVTH 3KLRA 1HQRD 4LF5L 1HNXL 4GS3A 2K5VA 4GOPB 1Z47A 2Z4IA 1VMCA 2F0FA 4NXNL 4DV6L 4DR4L 4Y52H 1D2BA 3GTGB 3MZ5A 1LO5D 2F0OA 1LTTD 2ATWA 2NZOA 4B9XA 3I72A 2JA6G 3QO2A 3ULLA 3D3RA 5DM63 1E1TA 4LF8L 3VYUA 3HOUH 5M5XH 2WB1E 5C4JH 2EYJA 1L1OA 3HGBA 5IYDH 3PMFA 4A3KH 3BDOA 4DUZQ 3TZDA 3RZDB 1KDCA 2F0KA 2JN4A 5ELOA 3ND9A 3K59A 1WCMB 3HOXH 3Q6SA 4KD4A 1F2LA 3CC7A 4EVOA 3KLWA 1GHKA 3KDFB 1K83H 1E24A 1D1IA 1V8QA 1QILA 2F03A 1JMCA 1OTCA 1I6HB 3BVZA 3PIPA 4C1NI 3S1MH 1B50A 3MXGA 4QUCA 4KKTA 3AB9A 3A74A 4APVA 2DY8A 1PZKD 4KTAA 1IKLA 3RN2A 3OOCA 4EQ5A 2G9DA 4IN3A 4K14A 2C5CA 2R6GA 2VQEL 3CMEA 3E9HA 2I5LX 1PXUA 1LT6D 3CCEA 4H02A 2F0PA 3H6MA 1X9NA 5BN4A 3F2BA 2BA0A 4YCWA 2R7ZG 1WYDA 1QVFA 4A3GG 3S2HB 1SFOB 2BH8A 2R7ZB 1EU3A 2ZTEA 4IPCA 5CBAE 1IBML 4LUVA 1F9SA 3NP8A 1STEA 1PFBA 1XXGA 2OXPA 3K7AH 3NSWA 3PO2B 1OO9B 1VF5C 5JJZA 1I50H 1UWVA 1XYIA 4HSPA 2EYLA 4J6HA 4HIKA 4BY7H 3H94A 3S1NH 3TS2A 5AFWA 3DWAA 3K7AB 4DKAC 1MI2A 3PO2H 4OGQC 3SVMA 2YU9H 5IY0A 2PZUA 2NUCA 4K6DA 1SYFA 3W2DA 4P2CB 1LV9A 2M00A 2AMCB 1STAA 2MUYA 4RGTA 2DUDA 4DUYQ 1J5EQ 2BE5C 1KHIA 4B3SL 1HZBA 2RDFA 3S9WA 2K03A 1Q46A 4ABNA 3Q22A 5KGUA 1Q12A 1SJHD 4JOIA 4DF7A 5I9PA 5GADC 4H13C 4R4OA 2F0HA 1NMGA 5KYLA 2EVBA 3QB3A 1GM5A 3CXCA 1HJPA 4R8NA 5BR8Q 3UE1A 1MHWC 1WTRA 3GV3A 1JE5A 4KHPL 1QUQA 3CRKC 1PMRA 1WTPA 4DR6Q 4X66Q 2B2TA 4HIDA 1BCPF 5ELFA 2H4OA 4A93B 3CCQA 3VR6A 1U4MA 2MPMA 4PMCA 2V4DA 5EKIA 3PO3B 1Y14B 4A3BH 3RNUA 4HIMA 1SYCA 2L12A 4DPGA 3C3LA 4QQBX 2A68D 4IPGA 1XJVA 4F87A 4K5WA 2BDOA 5DNFA 2WAQE 4H44C 2EXDA 1PFSA 1KD1C 1SROA 4FP5D 3PO3H 2CH4W 1PYWD 2JXMB 2RQXA 5T1IA 1PTOC 2NZ1D 4CDCC 4X3TA 4DR4Q 4A3BB 5M5YB 2O5JC 2WAQG 1TS3A 1RJTA 4OEMB 1K28A 1ET6A 2ZXPA 5GAGC 2HHHQ 4P72A 3MC0B 4DK1A 3A5UA 1TWCH 4DR2Q 5C0XG 1XMOL 1WD1A 3MXNA 1JJGA 4CJ0B 2OQ0A 2RCNA 3UDIA 2RVLA 4YIJA 4RHRA 3CRLC 2N49A 4JW0A 1SYBA 5M9OA 1MJEA 1AW7A 5EPJA 1STYA 3EIVA 3G71A 1M8AA 2EYHA 4L6TB 3I73A 3L9AX 3ERSX 5KNCA 3F1ZA 3I55A 1NNXA 1V1PB 3S17H 3T1YL 2AQ1B 3ULPA 3I4LA 4C3HB 2K14A 1Q8IA 3S16B 1BO0A 4ZCKA 3SGIA 3CKIB 3A8KE 3JAME 2F3WA 4C2MB 3Q24A 4QIWE 1VQJA 3VA5A 1G8ZD 2QA4A 2HQEA 1J5EL 2A19A 4FF4A 4MTNA 2IX0A 4YCVA 3A8JE 2E8GA 1SN8A 4U673 2D0OA 2FFKB 1EFID 2TSSA 5E1FA 5AJ3L 3NK9A 3FPUB 1BQQT 2C9OA 1VQAA 4ZKCB 3HOYB 2E2IH 2WACA 4DAYB 4DXGA 4A3EH 4BBSH 1PZID 3HOVH 3HOWH 3BVMA 1WTQA 1DONA 4X62L 3I4MB 3U4VA 3QG1A 1I3QH 4ZKBB 1VDZA 2ICEC 1JOKA 4ME5A 1DZ1A 3PUVA 2JA8H 1EYGA 5EBCA 4B3RL 1EY9A 3HOYH 4C56C 2QKIC 2VXWA 3S2DH 5C5LA 3S14B 1MSGA 3R8BA 1ICWA 3WOFA 3MXPA 4OXPA 2K6AA 3MAQA 1DOLA 3P75A 3Q8DA 2WB1B 5CBEE 4FXDA 5LL6X 2RSOA 1KC8C 1RDPD 2RDHA 2ZJQA 1SNMA 4LF7Q 2JA8B 1EY6A 2F0LA 1PH5A 3O13A 1H95A 5M3FB 3CP0A 4JI3L 1TU2B 1W6JA 5EKKA 1X54A 2EYFA 4JI0L 4BY7G 1A3TA 2NVYB 4DAVA 1L0XB 3J81L 5M3MB 1BOSA 1FR3A 3J81c 1HFNA 2VB3X 3I7FA 3NTKA 4DK6C 3PUWA 4P74A 3KF6A 3FMCA 2JA7B 2VUMG 1E2WA 3GTLB 1VQFA 3JAMc 1JQYD 1SYEA 4JI7Q 1O7LA 4DFAA 4UP9A 1A15A 1O78A 1AEXA 2EIFA 5C4JB 5M3MH 1QG7A 2MQHA 1F2MA 3KJPA 2JA5G 2JA7H 1S5FD 3NQIA 1WCMH 1C48A 4GN5A 2K5WA 4DV2L 4X3SA 4GKJQ 1NAPA 2HD3A 3D31A 2K04A 1J8IA 2PMZE 1K83B 1ZXTA 1K8GA 2Z6BA 1D5ZC 1E2VA 2J4XA 4LAAA 1Z9FA 2CWAA 3DM1A 1KIXA 2KHSA 2HHHL 2AWNA 3A55A 4B3SQ 1WI5A 2E2JH 4A3MH 4BA1I 3U50C 3NBIA 3RUZA 1VF7A 2YTVA 3K6OA 2Q2TA 4RHSA 2B63H 2XNAC 1JB7A 4KHPQ 2M2LA 1S5DD 1NMFA 2F0EA 3NWSA 1KNAA 1F2YA 4LFAL 1I4QA 2MO1A 3OMCA 1E7ZA 1PYSB 4A3MB 3H0GG 1IYJB 2K28A 4L5SA 2R7ZH 1HA6A 2B63B 2JA6H 2VQFL 1BR9A 4HMIA 1IYUA 1NTGA 4LFCQ 5CV6A 1I50B 4FVMA 3JC66 4XQQA 2XWBB 4DV6Q 1SYGA 3ZJYC 2VY3A 3FP9A 1TVXA 1DOMA 4RG1A 2F3IA 1RTNA 2PCFB 3OW2A 5IE8A 4TRDA 1HNXQ 2RBMA
chains in the Genus database with same CATH topology
3FHWA 1OXTA 2E5LL 1N33L 3A0JA 5BR8L 1N36Q 3HOXG 1KL9A 3CPWA 1SLJA 1IBKQ 1HNWL 4BXXH 5GROA 3UDGA 1L1OC 3J81i 1NE3A 3I56A 3T1HQ 1VQNA 5LMNL 1CSPA 1FGUA 3D0FA 4A3FG 3M85A 4DV0Q 1PH4A 1KRSA 1CSQA 1GVPA 2BH2A 1T9HA 3K8AA 4A3GH 1I6HH 1IBLQ 1VQIA 4LUOA 3I4NG 1E22A 2UXDL 5JJLA 4AYBE 2JA9A 5C0XI 4FDBA 1KXLA 3L0OA 1B7YB 5IYDG 4UY8C 4BXXG 2Z6KC 1UE6A 4A76A 4AIMA 2NVXH 4GLVB 1KAWA 3HOUG 1A63A 3PO2G 2CCZA 4IO9A 2B63G 4DV7Q 2JE6I 4JI2Q 1WOCA 2NVYH 4DV5L 1XMOQ 2PI2E 1VQ9A 4LF9L 2NVTH 3GTPH 1RIPA 2UXDQ 4B3TL 3GO5A 3PCOB 1LYLA 2UUAL 1HNXL 4LF5L 3KOJA 4GS3A 5LMUL 2K5VA 4GOPB 1Z47A 2VS1A 4DV4Q 4NXNL 1PH3A 5M5WH 1PV4A 3GTJH 1HNZQ 3NEMA 5J3BA 4DV6L 4C3IH 4DR4L 4Y52H 4GNXB 1D7QA 3EN2A 1QVGA 3HFZB 1UEBA 2IT1A 4QY7A 2HIXA 2ATWA 1UE5A 2NZOA 2Q2IA 2YYZA 1U5KA 2JA6G 2B29A 4R4IA 3ULLA 1E1TA 3HKZG 1O7IA 4A4IA 4IOAA 1GO3E 4LF8L 1L0WA 4PZ7A 5M5XH 3HOUH 2LSSA 2WB1E 5C4JH 5C3EG 1VQOA 4LUZA 1EWIA 2F4VL 1NJIC 1C0AA 1L1OA 4GKKL 1VQCA 1TXYA 5IYDH 4A3KH 4OX9L 1VS0A 4DUZQ 4LNQA 4DK3C 1K3RA 3CC4A 4GN3B 2NN6I 3GD7A 3I4NH 4IJLA 5ELOA 1N9WA 4AH6A 5LMUQ 2NN6G 4OWWB 4UP7A 3HOXH 4A3JH 4HIOA 2YV5A 1M90C 3CC7A 4DV3Q 1OXVA 3KLWA 2ZM6Q 4WJ3M 3AQQA 1PHJA 3KDFB 1Y1WG 2K50A 4JI2L 4BA2I 4JI4L 1K83H 1K0RA 1W3SA 1E24A 3RR5A 1J6QA 1VQ6A 3CMAA 4OWTB 3U4ZA 1S72A 1JMCA 1VQ5A 3E0EA 4KI0A 4DR3Q 1OTCA 4JV5L 2IY5B 4A75A 3PIPA 4LF6L 3S1MH 2K52A 4LF5Q 4LFAQ 1HH2P 3A74A 4APVA 2F52A 3RN2A 4KLKA 1UE1A 4EQ5A 1M1KC 3IRBA 4PMWA 5IT9c 4DV1Q 4JI6L 1GD7A 2WFWA 5LMNQ 2R92G 2D62A 2R6GA 2VQEL 3HOVG 2V1CC 3K80C 3CMEA 3E9HA 2I5LX 3CCSA 1X3FA 1X55A 1YHAA 1HNZL 2QEXA 3CCEA 4H02A 4O2DA 3CPFA 1VQKA 2MO0A 1VQ7A 1ASZA 4A3LG 1X9NA 3CW2C 2BA0A 4YCWA 3F2BA 2R7ZG 1WYDA 1QVFA 4DR7L 3MXNB 4A3GG 3GTGH 4JI8L 4B3ML 1BBWA 4WJ4A 2BH8A 3LGJA 5IWAL 4DUZL 2ZTEA 4IPCA 1A8VA 3K7UC 4GKJL 1OXUA 4GKKQ 3CQZH 2DGYA 1IBML 4LUVA 1N36L 4X64L 3K7AH 1OXSC 4JG2A 1JJ2A 1IL2A 3K81C 4IPHA 1WJJA 3G6EA 5K36G 1I50H 2Y0SG 2UU9Q 1UWVA 3J81j 3PF5A 2JA8G 1PA6A 3B6YA 3GTOH 5GQOA 1XNRQ 3OTOQ 1PH9A 3RZDH 4A93H 2XGTA 1IBMQ 2ID0A 4JBMA 5IYCH 1XPOA 1AH9A 2RHSB 2VW9A 4HIKA 4BY7H 4HJ7A 3S1NH 4LF7L 3TS2A 2K75A 2NZHA 4DNIA 5C4XH 4GOPC 2UUCQ 2OQKA 2VL6A 3PUXA 2H5XA 3F2CA 4BY1H 1PYBA 4DKAC 3PO2H 1N8RC 1EIYB 3RZOH 5JEAG 2N8NA 3STBD 1PH6A 3TS0A 4A3JG 1W2BA 5IY0A 1N34Q 2YU9H 1FJGQ 1KQSA 1HR0Q 3PIOA 2ES2A 2VNUD 4X65L 1Q7YC 1CKOA 4DR6L 1A0IA 2AMCB 4IOCA 2GVAA 1TWHH 2DUDA 1YITA 4DUYQ 4POGA 1J5EQ 4A3IH 1KHIA 1B8AA 2QGQA 4B3SL 1LM0A 1HZBA 1HZ9A 2R93H 1Q46A 1SFOH 1K9MC 1QUQB 2I0QA 1LUZA 1Q12A 3I2ZA 4LF6Q 1CKNA 1VQBA 4JOIA 1V9PA 1X56A 2K4KA 5GADC 4ALPA 4JV5Q 4R4OA 1NMGA 1MIUA 5IWAQ 4MZ9A 2VQEQ 2IX1A 3GTMH 1LTLA 1GM5A 3A5ZB 4BBRH 1HJPA 3RLNA 5BR8Q 3CXCA 2K5NA 3UE1A 2Z0SA 5IP7G 2CWPA 1E1OA 4YHHQ 3S2HH 5ELNA 3W5OA 1CKNB 4ME3A 1JE5A 4KHPL 1QUQA 5FJ8H 4HJAA 4JYAQ 2JJQA 3UDFA 3S1QH 4OX9Q 3KJOA 2CFMA 4GNXA 1IZ6A 4DR6Q 4JI6Q 4X66Q 1EUJA 1YJWA 2HQLA 4DAMA 4HIDA 2F4VQ 2LXJA 2VZAA 5M3FG 1SRUA 1C7YA 1R9TH 2XTIA 3F8TA 2WP8J 1TWGH 3PV0A 4RMFA 4L5TA 1NBWA 3AFQA 5FLMG 3WWVA 1WCMG 3CCQA 3HOZH 1QVCA 2EQSA 4IPDA 1MKHA 4OONA 1PH2A 2YTXA 5EAYA 3KDFA 5IP9H 1I94L 2IHFA 2JA5H 3AYHB 2A8VA 1Y14B 2PNHA 4A3BH 1YHBA 4HIMA 3RNUA 1WFQA 2HT1A 4DPGA 2OWOA 4A3CG 4R4CA 4K0KL 1V43A 2UXBL 4QGUA 1EOVA 2WB1G 1UE7A 1EQRA 1IBKL 4QQBX 1HNWQ 5C44H 1XNRL 4TVAB 4IPGA 1QZGA 2FXQA 2E5LQ 1XJVA 2N78A 3S24A 2PI2A 4JBWA 5M3FH 2WAQE 1PH8A 2EXDA 4JI3Q 1L2FA 1PFSA 3W1GA 1YIJA 3UDXA 1BVSA 1KD1C 1EFWA 1P8LA 1SROA 3RLOA 3PO3H 1BKBA 3M4OH 4X65Q 3ER0A 2MNAA 4DR4Q 4JI7L 4XIGS 3JAMi 3CCVA 2ASBA 2WAQG 4IJHA 4A3EG 4BBSG 3H3VI 3GTKH 4PG3A 2HHHQ 5GAGC 1HZCA 4P72A 4HJ8A 3T1YQ 3A5UA 1TWCH 3BJUA 4HJ9A 4DR2Q 4KHZA 4C2MH 1XMQL 5C0XG 2JK8A 4A3DH 1I5FA 4GOPA 4DV5Q 1XMOL 4L5QA 4LF9Q 1AE3A 2UUBQ 1JJGA 4YCUA 4MNOA 3M4QA 4LWCA 2YTYA 3J80c 1FL0A 3BZCA 2KCMA 1CUKA 2OQ0A 2RCNA 3FKIG 3OYYA 4QJFA 3UDIA 3H0GH 4DV2Q 4JCVE 1I94Q 2JA7G 3GTQH 4DR7Q 4A3CH 1AE2A 3PUYA 2UUAQ 2N49A 4A3BG 2B3GA 4GN4B 1MJEA 2R7FA 5IYBH 3EIVA 4JBKA 1X3GA 4UP8A 3G71A 2ZJRA 3I4OA 2OCEA 3M7NA 5JEAJ 1B70B 3VDYA 4EX5A 2UXCQ 1YZ6A 1MJCA 5FLXc 1IXRA 2Z6KA 3ERSX 4Y7NH 3S15H 3NBHB 3F1ZA 3I4MH 4X6AH 2CQOA 1OXXK 2VUMH 3I55A 2JEAI 1YEZA 2ALYB 4NPSA 1VQMA 4QL5A 3UE0A 2KENA 3L2PA 3S17H 3T1YL 4IFDG 4DV0L 3ULPA 1HR0W 2K14A 1VQEA 2IHEA 1VQ4A 5IP7H 5IYCG 4C3JH 2I5MX 3DLLA 4IFDJ 4JI5L 3SGIA 3ICEA 1XNQQ 4B3RQ 2GVBA 2ZM6L 4LF4Q 4DV3L 1VQLA 4QIWE 5C44G 3KFUA 1VQJA 2AHOB 2QA4A 5IYBG 1L1OB 1J5EL 2AKWB 1G291 4DUYL 4O0AA 1U0LA 3F2DA 4LF4L 2NVQH 4YWMA 2L15A 2A19A 3CCLA 3AFPA 5M5YH 4MTNA 2IX0A 4YCVA 3CF5A 1Q8KA 2E8GA 4HJ5A 3KYHC 4K0KQ 3J80i 5M3MG 1SN8A 2UXBQ 2D0OA 1FJGL 1XPUA 2R7DA 1Y1VH 2KHJA 4A3LH 2GN5A 5AJ3L 2JEBI 4YHHL 5AJ3Q 1VQAA 2E2IH 4POFA 4DAYB 2MFIA 3E9IA 4A3EH 5E7NA 4BBSH 4DR1L 1C9OA 3H3VH 3HOVH 5C0XJ 3HOWH 4X66L 4X62L 4JOIC 3U4VA 2UXCL 1VQ8A 2C35B 5DLQE 1I3QH 3TQYA 2Y0SE 4A93G 1N32Q 3PUVA 2ZJPA 1SR3A 3M4PA 1IBLL 2JA8H 1EYGA 1XTDA 4B3RL 3HOYH 3J7A5 4OO1I 4NB3A 4P71A 3CCMA 3CC2A 1PVOA 5HGQA 3HOWG 1XPRA 1YNXA 2RF4A 4R4QA 1SE8A 3NELA 1HZAA 1K8AC 3S2DH 4DV4L 2KHIA 1JT8A 3PF4A 1S3OA 1YBYA 2RHQB 4OXPA 1K73C 3K0XA 2PQAA 3Q8DA 4UPAA 1Y1VG 5GAEC 2JQOA 4C3HH 4AYBG 4A3IG 1VQPA 1N33Q 3AEVA 1PH1A 3TRZA 3DM3A 1VQHA 1TWAH 1EQQA 1KC8C 1A62A 4XTCS 2ZJQA 4LF7Q 4LW1A 4A3KG 1VCIA 4GNXC 2ZTDA 1PH5A 3EBEA 3STBC 1Q1EA 1H95A 1HR0L 1BBUA 1DGSA 4BY1G 3CP0A 5FLMH 4JI3L 3RN5A 2R92H 5C4XG 2BA1A 3HOYG 3U58A 1N34L 1X54A 2AWOA 3G48A 1N32L 4JI0L 4BY7G 4GLAC 4X64Q 2N3SA 2VQFQ 3PSIA 3M9BA 3CAMA 4L5RC 3CCJA 3J81c 4YWLA 5FJ8G 1PH7A 3I7FA 1GKHA 1X65A 4DR1Q 4DK6C 2UUBL 3PUWA 4P74A 4LFCL 4NXNQ 3BU2A 4OWXB 3KF6A 3J7ZC 3CD6A 2VUMG 1YVCA 1YHQA 2UU9L 4BBRG 1VQFA 3JAMc 1S40A 2A1AA 2R93G 4JI7Q 4YY3Q 4UP9A 4DR5Q 2EIFA 2OTJA 3OTOL 5M3MH 3H15A 4DV1L 2MQHA 4JI1L 1VQGA 3S1RH 2E2HH 1Q82C 4JYAL 4TQUS 3KJPA 4P73A 2ZTCA 5HY6A 3HKZE 4LFBL 2Q2UA 2JA5G 5C3EH 1G6PA 3FKIH 2JA7H 1Q86C 1YJNA 4A3FH 1WCMH 4NXML 1P16A 4GN5A 3S14H 4GLXA 4DV2L 3G4SA 4GKJQ 3T1HL 2HIVA 3PGZA 3D31A 2PMZE 4B3MQ 2PQAB 1K8GA 1Z9FA 2CWAA 1Q81C 3S16H 3RLFA 4B3TQ 1KIXA 2HHHL 2AWNA 4B3SQ 1WI5A 2E2JH 4A3MH 4BA1I 1X6OA 3PO3G 3U50C 4PZ8A 4JI1Q 3I4MG 4DR3L 2YTVA 2Q2TA 3L7ZC 1Y1WH 2B63H 1V1QA 4R1JA 5H1SE 1YJ9A 4JC0A 1JB7A 1TWFH 3MEFA 3GTLH 3KF8B 4JI4Q 2KCTA 4KHPQ 5JJIA 1NMFA 5GAHC 2CKZB 4LF8Q 2I5HA 4LFAL 2MO1A 2Q2HA 2UUCL 1E7ZA 1VQDA 4R4TA 1PYSB 3CCUA 4PZ6A 4X62Q 3H0GG 1RL2A 3TEHB 5IP9G 4P75A 1IYJB 1YI2A 4JI5Q 1G51A 4L5SA 4YY3L 5LMNW 4OO1G 3W1BA 3HOZG 3GDEA 2R7ZH 1ASYA 4NXMQ 3HKSA 3KF6B 1KRTA 2VQFL 2OTLA 2JA6H 4DR2L 1XMQQ 4A3DG 4YWKA 4JI0Q 2KBNA 2K5HA 1JJCB 4JBJA 1D8LA 4LFBQ 1NTGA 3PUZA 1QZHA 1FVIA 1NY4A 4LFCQ 3TREA 4DV7L 4IFDI 3CCRA 2D0PA 1XNQL 4AQYQ 3BZKA 3JC66 3ULJA 4AQYL 4DR5L 1CKMA 4DV6Q 1EIFA 3ZJYC 2VY3A 2LXKA 3NENA 1E3PA 3FP9A 4A3MG 4JI8Q 3M3YH 5JJKA 4RG1A 1Q1BA 2F3IA 1X3EA 1SMXA 4J15A 5IE8A 3OW2A 1HNXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHW A;  1OXT A;  2E5L L;  1N33 L;  3A0J A;  5BR8 L;  1N36 Q;  3HOX G;  1KL9 A;  3CPW A;  1SLJ A;  1IBK Q;  1HNW L;  4BXX H;  5GRO A;  3UDG A;  1L1O C;  3J81 i;  1NE3 A;  3I56 A;  3T1H Q;  1VQN A;  5LMN L;  1CSP A;  1FGU A;  3D0F A;  4A3F G;  3M85 A;  4DV0 Q;  1PH4 A;  1KRS A;  1CSQ A;  1GVP A;  2BH2 A;  1T9H A;  3K8A A;  4A3G H;  1I6H H;  1IBL Q;  1VQI A;  4LUO A;  3I4N G;  1E22 A;  2UXD L;  5JJL A;  4AYB E;  2JA9 A;  5C0X I;  4FDB A;  1KXL A;  3L0O A;  1B7Y B;  5IYD G;  4UY8 C;  4BXX G;  2Z6K C;  1UE6 A;  4A76 A;  4AIM A;  2NVX H;  4GLV B;  1KAW A;  3HOU G;  1A63 A;  3PO2 G;  2CCZ A;  4IO9 A;  2B63 G;  4DV7 Q;  2JE6 I;  4JI2 Q;  1WOC A;  2NVY H;  4DV5 L;  1XMO Q;  2PI2 E;  1VQ9 A;  4LF9 L;  2NVT H;  3GTP H;  1RIP A;  2UXD Q;  4B3T L;  3GO5 A;  3PCO B;  1LYL A;  2UUA L;  1HNX L;  4LF5 L;  3KOJ A;  4GS3 A;  5LMU L;  2K5V A;  4GOP B;  1Z47 A;  2VS1 A;  4DV4 Q;  4NXN L;  1PH3 A;  5M5W H;  1PV4 A;  3GTJ H;  1HNZ Q;  3NEM A;  5J3B A;  4DV6 L;  4C3I H;  4DR4 L;  4Y52 H;  4GNX B;  1D7Q A;  3EN2 A;  1QVG A;  3HFZ B;  1UEB A;  2IT1 A;  4QY7 A;  2HIX A;  2ATW A;  1UE5 A;  2NZO A;  2Q2I A;  2YYZ A;  1U5K A;  2JA6 G;  2B29 A;  4R4I A;  3ULL A;  1E1T A;  3HKZ G;  1O7I A;  4A4I A;  4IOA A;  1GO3 E;  4LF8 L;  1L0W A;  4PZ7 A;  5M5X H;  3HOU H;  2LSS A;  2WB1 E;  5C4J H;  5C3E G;  1VQO A;  4LUZ A;  1EWI A;  2F4V L;  1NJI C;  1C0A A;  1L1O A;  4GKK L;  1VQC A;  1TXY A;  5IYD H;  4A3K H;  4OX9 L;  1VS0 A;  4DUZ Q;  4LNQ A;  4DK3 C;  1K3R A;  3CC4 A;  4GN3 B;  2NN6 I;  3GD7 A;  3I4N H;  4IJL A;  5ELO A;  1N9W A;  4AH6 A;  5LMU Q;  2NN6 G;  4OWW B;  4UP7 A;  3HOX H;  4A3J H;  4HIO A;  2YV5 A;  1M90 C;  3CC7 A;  4DV3 Q;  1OXV A;  3KLW A;  2ZM6 Q;  4WJ3 M;  3AQQ A;  1PHJ A;  3KDF B;  1Y1W G;  2K50 A;  4JI2 L;  4BA2 I;  4JI4 L;  1K83 H;  1K0R A;  1W3S A;  1E24 A;  3RR5 A;  1J6Q A;  1VQ6 A;  3CMA A;  4OWT B;  3U4Z A;  1S72 A;  1JMC A;  1VQ5 A;  3E0E A;  4KI0 A;  4DR3 Q;  1OTC A;  4JV5 L;  2IY5 B;  4A75 A;  3PIP A;  4LF6 L;  3S1M H;  2K52 A;  4LF5 Q;  4LFA Q;  1HH2 P;  3A74 A;  4APV A;  2F52 A;  3RN2 A;  4KLK A;  1UE1 A;  4EQ5 A;  1M1K C;  3IRB A;  4PMW A;  5IT9 c;  4DV1 Q;  4JI6 L;  1GD7 A;  2WFW A;  5LMN Q;  2R92 G;  2D62 A;  2R6G A;  2VQE L;  3HOV G;  2V1C C;  3K80 C;  3CME A;  3E9H A;  2I5L X;  3CCS A;  1X3F A;  1X55 A;  1YHA A;  1HNZ L;  2QEX A;  3CCE A;  4H02 A;  4O2D A;  3CPF A;  1VQK A;  2MO0 A;  1VQ7 A;  1ASZ A;  4A3L G;  1X9N A;  3CW2 C;  2BA0 A;  4YCW A;  3F2B A;  2R7Z G;  1WYD A;  1QVF A;  4DR7 L;  3MXN B;  4A3G G;  3GTG H;  4JI8 L;  4B3M L;  1BBW A;  4WJ4 A;  2BH8 A;  3LGJ A;  5IWA L;  4DUZ L;  2ZTE A;  4IPC A;  1A8V A;  3K7U C;  4GKJ L;  1OXU A;  4GKK Q;  3CQZ H;  2DGY A;  1IBM L;  4LUV A;  1N36 L;  4X64 L;  3K7A H;  1OXS C;  4JG2 A;  1JJ2 A;  1IL2 A;  3K81 C;  4IPH A;  1WJJ A;  3G6E A;  5K36 G;  1I50 H;  2Y0S G;  2UU9 Q;  1UWV A;  3J81 j;  3PF5 A;  2JA8 G;  1PA6 A;  3B6Y A;  3GTO H;  5GQO A;  1XNR Q;  3OTO Q;  1PH9 A;  3RZD H;  4A93 H;  2XGT A;  1IBM Q;  2ID0 A;  4JBM A;  5IYC H;  1XPO A;  1AH9 A;  2RHS B;  2VW9 A;  4HIK A;  4BY7 H;  4HJ7 A;  3S1N H;  4LF7 L;  3TS2 A;  2K75 A;  2NZH A;  4DNI A;  5C4X H;  4GOP C;  2UUC Q;  2OQK A;  2VL6 A;  3PUX A;  2H5X A;  3F2C A;  4BY1 H;  1PYB A;  4DKA C;  3PO2 H;  1N8R C;  1EIY B;  3RZO H;  5JEA G;  2N8N A;  3STB D;  1PH6 A;  3TS0 A;  4A3J G;  1W2B A;  5IY0 A;  1N34 Q;  2YU9 H;  1FJG Q;  1KQS A;  1HR0 Q;  3PIO A;  2ES2 A;  2VNU D;  4X65 L;  1Q7Y C;  1CKO A;  4DR6 L;  1A0I A;  2AMC B;  4IOC A;  2GVA A;  1TWH H;  2DUD A;  1YIT A;  4DUY Q;  4POG A;  1J5E Q;  4A3I H;  1KHI A;  1B8A A;  2QGQ A;  4B3S L;  1LM0 A;  1HZB A;  1HZ9 A;  2R93 H;  1Q46 A;  1SFO H;  1K9M C;  1QUQ B;  2I0Q A;  1LUZ A;  1Q12 A;  3I2Z A;  4LF6 Q;  1CKN A;  1VQB A;  4JOI A;  1V9P A;  1X56 A;  2K4K A;  5GAD C;  4ALP A;  4JV5 Q;  4R4O A;  1NMG A;  1MIU A;  5IWA Q;  4MZ9 A;  2VQE Q;  2IX1 A;  3GTM H;  1LTL A;  1GM5 A;  3A5Z B;  4BBR H;  1HJP A;  3RLN A;  5BR8 Q;  3CXC A;  2K5N A;  3UE1 A;  2Z0S A;  5IP7 G;  2CWP A;  1E1O A;  4YHH Q;  3S2H H;  5ELN A;  3W5O A;  1CKN B;  4ME3 A;  1JE5 A;  4KHP L;  1QUQ A;  5FJ8 H;  4HJA A;  4JYA Q;  2JJQ A;  3UDF A;  3S1Q H;  4OX9 Q;  3KJO A;  2CFM A;  4GNX A;  1IZ6 A;  4DR6 Q;  4JI6 Q;  4X66 Q;  1EUJ A;  1YJW A;  2HQL A;  4DAM A;  4HID A;  2F4V Q;  2LXJ A;  2VZA A;  5M3F G;  1SRU A;  1C7Y A;  1R9T H;  2XTI A;  3F8T A;  2WP8 J;  1TWG H;  3PV0 A;  4RMF A;  4L5T A;  1NBW A;  3AFQ A;  5FLM G;  3WWV A;  1WCM G;  3CCQ A;  3HOZ H;  1QVC A;  2EQS A;  4IPD A;  1MKH A;  4OON A;  1PH2 A;  2YTX A;  5EAY A;  3KDF A;  5IP9 H;  1I94 L;  2IHF A;  2JA5 H;  3AYH B;  2A8V A;  1Y14 B;  2PNH A;  4A3B H;  1YHB A;  4HIM A;  3RNU A;  1WFQ A;  2HT1 A;  4DPG A;  2OWO A;  4A3C G;  4R4C A;  4K0K L;  1V43 A;  2UXB L;  4QGU A;  1EOV A;  2WB1 G;  1UE7 A;  1EQR A;  1IBK L;  4QQB X;  1HNW Q;  5C44 H;  1XNR L;  4TVA B;  4IPG A;  1QZG A;  2FXQ A;  2E5L Q;  1XJV A;  2N78 A;  3S24 A;  2PI2 A;  4JBW A;  5M3F H;  2WAQ E;  1PH8 A;  2EXD A;  4JI3 Q;  1L2F A;  1PFS A;  3W1G A;  1YIJ A;  3UDX A;  1BVS A;  1KD1 C;  1EFW A;  1P8L A;  1SRO A;  3RLO A;  3PO3 H;  1BKB A;  3M4O H;  4X65 Q;  3ER0 A;  2MNA A;  4DR4 Q;  4JI7 L;  4XIG S;  3JAM i;  3CCV A;  2ASB A;  2WAQ G;  4IJH A;  4A3E G;  4BBS G;  3H3V I;  3GTK H;  4PG3 A;  2HHH Q;  5GAG C;  1HZC A;  4P72 A;  4HJ8 A;  3T1Y Q;  3A5U A;  1TWC H;  3BJU A;  4HJ9 A;  4DR2 Q;  4KHZ A;  4C2M H;  1XMQ L;  5C0X G;  2JK8 A;  4A3D H;  1I5F A;  4GOP A;  4DV5 Q;  1XMO L;  4L5Q A;  4LF9 Q;  1AE3 A;  2UUB Q;  1JJG A;  4YCU A;  4MNO A;  3M4Q A;  4LWC A;  2YTY A;  3J80 c;  1FL0 A;  3BZC A;  2KCM A;  1CUK A;  2OQ0 A;  2RCN A;  3FKI G;  3OYY A;  4QJF A;  3UDI A;  3H0G H;  4DV2 Q;  4JCV E;  1I94 Q;  2JA7 G;  3GTQ H;  4DR7 Q;  4A3C H;  1AE2 A;  3PUY A;  2UUA Q;  2N49 A;  4A3B G;  2B3G A;  4GN4 B;  1MJE A;  2R7F A;  5IYB H;  3EIV A;  4JBK A;  1X3G A;  4UP8 A;  3G71 A;  2ZJR A;  3I4O A;  2OCE A;  3M7N A;  5JEA J;  1B70 B;  3VDY A;  4EX5 A;  2UXC Q;  1YZ6 A;  1MJC A;  5FLX c;  1IXR A;  2Z6K A;  3ERS X;  4Y7N H;  3S15 H;  3NBH B;  3F1Z A;  3I4M H;  4X6A H;  2CQO A;  1OXX K;  2VUM H;  3I55 A;  2JEA I;  1YEZ A;  2ALY B;  4NPS A;  1VQM A;  4QL5 A;  3UE0 A;  2KEN A;  3L2P A;  3S17 H;  3T1Y L;  4IFD G;  4DV0 L;  3ULP A;  1HR0 W;  2K14 A;  1VQE A;  2IHE A;  1VQ4 A;  5IP7 H;  5IYC G;  4C3J H;  2I5M X;  3DLL A;  4IFD J;  4JI5 L;  3SGI A;  3ICE A;  1XNQ Q;  4B3R Q;  2GVB A;  2ZM6 L;  4LF4 Q;  4DV3 L;  1VQL A;  4QIW E;  5C44 G;  3KFU A;  1VQJ A;  2AHO B;  2QA4 A;  5IYB G;  1L1O B;  1J5E L;  2AKW B;  1G29 1;  4DUY L;  4O0A A;  1U0L A;  3F2D A;  4LF4 L;  2NVQ H;  4YWM A;  2L15 A;  2A19 A;  3CCL A;  3AFP A;  5M5Y H;  4MTN A;  2IX0 A;  4YCV A;  3CF5 A;  1Q8K A;  2E8G A;  4HJ5 A;  3KYH C;  4K0K Q;  3J80 i;  5M3M G;  1SN8 A;  2UXB Q;  2D0O A;  1FJG L;  1XPU A;  2R7D A;  1Y1V H;  2KHJ A;  4A3L H;  2GN5 A;  5AJ3 L;  2JEB I;  4YHH L;  5AJ3 Q;  1VQA A;  2E2I H;  4POF A;  4DAY B;  2MFI A;  3E9I A;  4A3E H;  5E7N A;  4BBS H;  4DR1 L;  1C9O A;  3H3V H;  3HOV H;  5C0X J;  3HOW H;  4X66 L;  4X62 L;  4JOI C;  3U4V A;  2UXC L;  1VQ8 A;  2C35 B;  5DLQ E;  1I3Q H;  3TQY A;  2Y0S E;  4A93 G;  1N32 Q;  3PUV A;  2ZJP A;  1SR3 A;  3M4P A;  1IBL L;  2JA8 H;  1EYG A;  1XTD A;  4B3R L;  3HOY H;  3J7A 5;  4OO1 I;  4NB3 A;  4P71 A;  3CCM A;  3CC2 A;  1PVO A;  5HGQ A;  3HOW G;  1XPR A;  1YNX A;  2RF4 A;  4R4Q A;  1SE8 A;  3NEL A;  1HZA A;  1K8A C;  3S2D H;  4DV4 L;  2KHI A;  1JT8 A;  3PF4 A;  1S3O A;  1YBY A;  2RHQ B;  4OXP A;  1K73 C;  3K0X A;  2PQA A;  3Q8D A;  4UPA A;  1Y1V G;  5GAE C;  2JQO A;  4C3H H;  4AYB G;  4A3I G;  1VQP A;  1N33 Q;  3AEV A;  1PH1 A;  3TRZ A;  3DM3 A;  1VQH A;  1TWA H;  1EQQ A;  1KC8 C;  1A62 A;  4XTC S;  2ZJQ A;  4LF7 Q;  4LW1 A;  4A3K G;  1VCI A;  4GNX C;  2ZTD A;  1PH5 A;  3EBE A;  3STB C;  1Q1E A;  1H95 A;  1HR0 L;  1BBU A;  1DGS A;  4BY1 G;  3CP0 A;  5FLM H;  4JI3 L;  3RN5 A;  2R92 H;  5C4X G;  2BA1 A;  3HOY G;  3U58 A;  1N34 L;  1X54 A;  2AWO A;  3G48 A;  1N32 L;  4JI0 L;  4BY7 G;  4GLA C;  4X64 Q;  2N3S A;  2VQF Q;  3PSI A;  3M9B A;  3CAM A;  4L5R C;  3CCJ A;  3J81 c;  4YWL A;  5FJ8 G;  1PH7 A;  3I7F A;  1GKH A;  1X65 A;  4DR1 Q;  4DK6 C;  2UUB L;  3PUW A;  4P74 A;  4LFC L;  4NXN Q;  3BU2 A;  4OWX B;  3KF6 A;  3J7Z C;  3CD6 A;  2VUM G;  1YVC A;  1YHQ A;  2UU9 L;  4BBR G;  1VQF A;  3JAM c;  1S40 A;  2A1A A;  2R93 G;  4JI7 Q;  4YY3 Q;  4UP9 A;  4DR5 Q;  2EIF A;  2OTJ A;  3OTO L;  5M3M H;  3H15 A;  4DV1 L;  2MQH A;  4JI1 L;  1VQG A;  3S1R H;  2E2H H;  1Q82 C;  4JYA L;  4TQU S;  3KJP A;  4P73 A;  2ZTC A;  5HY6 A;  3HKZ E;  4LFB L;  2Q2U A;  2JA5 G;  5C3E H;  1G6P A;  3FKI H;  2JA7 H;  1Q86 C;  1YJN A;  4A3F H;  1WCM H;  4NXM L;  1P16 A;  4GN5 A;  3S14 H;  4GLX A;  4DV2 L;  3G4S A;  4GKJ Q;  3T1H L;  2HIV A;  3PGZ A;  3D31 A;  2PMZ E;  4B3M Q;  2PQA B;  1K8G A;  1Z9F A;  2CWA A;  1Q81 C;  3S16 H;  3RLF A;  4B3T Q;  1KIX A;  2HHH L;  2AWN A;  4B3S Q;  1WI5 A;  2E2J H;  4A3M H;  4BA1 I;  1X6O A;  3PO3 G;  3U50 C;  4PZ8 A;  4JI1 Q;  3I4M G;  4DR3 L;  2YTV A;  2Q2T A;  3L7Z C;  1Y1W H;  2B63 H;  1V1Q A;  4R1J A;  5H1S E;  1YJ9 A;  4JC0 A;  1JB7 A;  1TWF H;  3MEF A;  3GTL H;  3KF8 B;  4JI4 Q;  2KCT A;  4KHP Q;  5JJI A;  1NMF A;  5GAH C;  2CKZ B;  4LF8 Q;  2I5H A;  4LFA L;  2MO1 A;  2Q2H A;  2UUC L;  1E7Z A;  1VQD A;  4R4T A;  1PYS B;  3CCU A;  4PZ6 A;  4X62 Q;  3H0G G;  1RL2 A;  3TEH B;  5IP9 G;  4P75 A;  1IYJ B;  1YI2 A;  4JI5 Q;  1G51 A;  4L5S A;  4YY3 L;  5LMN W;  4OO1 G;  3W1B A;  3HOZ G;  3GDE A;  2R7Z H;  1ASY A;  4NXM Q;  3HKS A;  3KF6 B;  1KRT A;  2VQF L;  2OTL A;  2JA6 H;  4DR2 L;  1XMQ Q;  4A3D G;  4YWK A;  4JI0 Q;  2KBN A;  2K5H A;  1JJC B;  4JBJ A;  1D8L A;  4LFB Q;  1NTG A;  3PUZ A;  1QZH A;  1FVI A;  1NY4 A;  4LFC Q;  3TRE A;  4DV7 L;  4IFD I;  3CCR A;  2D0P A;  1XNQ L;  4AQY Q;  3BZK A;  3JC6 6;  3ULJ A;  4AQY L;  4DR5 L;  1CKM A;  4DV6 Q;  1EIF A;  3ZJY C;  2VY3 A;  2LXK A;  3NEN A;  1E3P A;  3FP9 A;  4A3M G;  4JI8 Q;  3M3Y H;  5JJK A;  4RG1 A;  1Q1B A;  2F3I A;  1X3E A;  1SMX A;  4J15 A;  5IE8 A;  3OW2 A;  1HNX Q; 
#chains in the Genus database with same CATH topology
 2EY5 A;  5BR8 L;  1KL9 A;  1V1O A;  1IBK Q;  5EBD A;  4ZUI A;  3TZU A;  2YU9 B;  1NE3 A;  1VQN A;  2K5Q A;  1CSP A;  4IUP A;  3LWU A;  2F0U A;  4ID6 A;  1CSQ A;  1GVP A;  2K7V A;  1A6X A;  2JA9 A;  5C0X I;  3L0O A;  5IYD G;  2A5H A;  1B53 A;  1HTP A;  2CQA A;  5CV4 A;  4AIM A;  5DAU A;  2EY2 A;  1KAW A;  4GLV B;  4HMJ A;  3HOU G;  2B63 G;  2M9V A;  4JI2 Q;  1WOC A;  3SK8 A;  4DV5 L;  1VQ9 A;  1RIP A;  1B44 D;  4B3T L;  3E0J A;  2G9H D;  3OWF A;  2JSO A;  3VYR A;  3AU7 A;  4DV4 Q;  1DCZ A;  1HNZ Q;  3GTJ H;  4G4K A;  4I65 A;  4C3I H;  3TP6 A;  5KYI A;  1D7Q A;  3EN2 A;  5K36 H;  3HFZ B;  3PIO 3;  2HIX A;  3SK6 A;  2B29 A;  2HCC A;  4IOA A;  1U4R A;  3QOJ A;  1L0W A;  1H9M A;  4V0B A;  2KA7 A;  1BCP B;  3ND8 A;  4RFB A;  3GTJ B;  1VS0 A;  4LNQ A;  3G7L A;  1K3R A;  3CC4 A;  4GN3 B;  3GD7 A;  3I4N H;  4WFN 3;  1N9W A;  3DUZ A;  4AH6 A;  5LMU Q;  3IKJ A;  2WKD A;  4A3J H;  4Q0F A;  4DXF A;  4HIO A;  1TY2 A;  1EYC A;  1PHJ A;  1SMY D;  1CZG A;  4CDE C;  1F9P A;  4JI2 L;  1K0R A;  2J7Z A;  3PIP 3;  3RR5 A;  1J6Q A;  1QE6 A;  1G2S A;  1VQ6 A;  3D6W A;  3CMA A;  4OWT B;  1VQ5 A;  1SYD A;  2K33 A;  3E0E A;  4KI0 A;  5FK9 C;  4LF6 L;  4FF3 A;  3P7J A;  2QW7 A;  1TWC B;  1GD7 A;  2X6G A;  2XSC A;  3QWN A;  4RGO S;  1H9S A;  1SSO A;  2V1C C;  3K80 C;  1HNZ L;  1X55 A;  3OSO A;  4IUT A;  2QEX A;  1UUP A;  3NQT A;  1K3B C;  2X69 A;  3GTM B;  1FD7 D;  1ASZ A;  3CW2 C;  5IGC A;  3H3V C;  5LHY 1;  5IWA L;  4NDX A;  4EQN A;  4QUF A;  4HN7 A;  1WD0 A;  3DWP A;  4GKJ L;  5C3W A;  3MEH A;  5C4X B;  4X64 L;  4KV6 A;  3K81 C;  1WJJ A;  5I2X A;  2UU9 Q;  3T53 B;  5KND A;  2JA8 G;  3B6Y A;  3J7A V;  1XNR Q;  1XWE A;  1B9N A;  1PH9 A;  1IBM Q;  4C3J G;  2ID0 A;  1JWM D;  4MHE A;  5IYC H;  1XPO A;  2VW9 A;  3TSS A;  1LT4 D;  4MIU A;  2NZH A;  4DNI A;  5C4X H;  4BY1 H;  1TQO A;  2H5X A;  5C5M A;  1N8R C;  3BZD B;  4A3J G;  1HR0 Q;  3K5N A;  1GHJ A;  4DR6 L;  4R9W A;  4IOC A;  1TWH H;  1YIT A;  4J1M A;  2WIN B;  3NXW A;  2E2D C;  1B8A A;  2R93 H;  5FO9 B;  1SFO H;  1HA5 A;  2I0Q A;  1LT5 D;  1VQB A;  2K4K A;  1X56 A;  4ALP A;  4ZLT F;  4NW2 A;  3MFY A;  1MIU A;  5IWA Q;  2VQE Q;  2CW0 C;  4A3E B;  4BBS B;  3T51 B;  3RLN A;  3HOZ B;  2Z0S A;  2CWP A;  4YHH Q;  1G6Z A;  5ELN A;  3SEB A;  1EU4 A;  1T5E A;  2R3Z A;  3S1Q H;  1LAB A;  4GNX A;  3NWT A;  4JI6 Q;  1YJW A;  2F4V Q;  2LXJ A;  2VZA A;  5M3F G;  2O4X A;  2TMP A;  1R9T H;  3F8T A;  2WP8 J;  1TWG H;  3PV0 A;  3AFQ A;  3HOZ H;  1YNN D;  2EQS A;  4IPD A;  1PH2 A;  1RHP A;  5EAY A;  5IP9 H;  4C3H G;  5KIX A;  3AYH B;  2PNH A;  2HT1 A;  2VB2 X;  3C1E A;  1AFP A;  1EOV A;  2WB1 G;  1HNW Q;  1FGB D;  5C44 H;  4TSS A;  1QZG A;  2E5L Q;  3SR1 A;  1DM0 B;  3S24 A;  1R9T B;  4QIW B;  3E6Z X;  2PI2 A;  4JBW A;  2MP1 A;  5M3F H;  5C4H A;  1IW7 D;  3ERO A;  1BVS A;  1DYQ A;  3A56 A;  1P8L A;  3KK7 A;  5ELC A;  3RLO A;  1BKB A;  1S5E D;  1ZEQ X;  2WV6 D;  5CV5 A;  3RMH A;  3ER0 A;  2MNA A;  1JE4 A;  4XIG S;  3CCV A;  4IJH A;  3H3V I;  3NTI A;  3T1Y Q;  3BJU A;  4FXG C;  1L0Y B;  4CKC A;  4KHV A;  1AE3 A;  2PZW A;  2UUB Q;  3MTS A;  3J80 c;  2R61 A;  2SEB D;  1PTO H;  3BZC A;  4XDX A;  3OYY A;  1I94 Q;  1PZJ D;  3H0G H;  3GTQ H;  4A3B G;  4K2K A;  2B3G A;  2L5T A;  1EZ6 A;  2HCI A;  1ICF B;  5D3D A;  2ZJR A;  1QNU A;  2LY7 A;  3NHH A;  3M7N A;  3MXU A;  1YZ6 A;  1MJC A;  1IXR A;  3S15 H;  1AP0 A;  3W3A A;  4BWG B;  2JEA I;  1YEZ A;  4NPS A;  1VQM A;  1LTS D;  2KEN A;  1CQF A;  1HR0 W;  5IYC G;  1MGS A;  3CHB D;  4C3J H;  3DLL A;  2B2W C;  2SDF A;  2E2J B;  1Y1V B;  3D8G A;  5A35 A;  1EWC A;  2LMC B;  3NUC A;  3HP3 A;  4DV3 L;  1TT2 A;  3KFU A;  2AHO B;  5IYB G;  1U0L A;  2NVQ H;  4G57 A;  3CCL A;  5F2D A;  1QOH A;  4HJ5 A;  3FRP B;  5M3M G;  1CZW A;  3OIQ A;  4KKU A;  2AQ3 B;  1FJG L;  1XPU A;  4ODG A;  1Y1V H;  5E4X A;  2F0W A;  5AJ3 Q;  3OHX C;  4DNT B;  4POF A;  4FF1 A;  2MFI A;  3E9I A;  3H3V H;  3UI2 A;  1IHZ A;  5CV9 A;  4RKB A;  2B39 A;  4WJW A;  5DLQ E;  1KDA A;  3TQY A;  1TS5 A;  4FF2 A;  1EQT A;  1SR3 A;  2K05 A;  3M4P A;  1IKM A;  1XTD A;  4CDD C;  3J7A 5;  4OO1 I;  3DWQ A;  4NB3 A;  2IL8 A;  3CCM A;  1XPR A;  1YNX A;  2RF4 A;  5EPK A;  3OPO A;  4DV4 L;  2DJF C;  4UPA A;  1Y1V G;  1N33 Q;  4AYB G;  1RD9 D;  2KVM A;  4B9W A;  2A6H C;  1A62 A;  5C3E B;  4LW1 A;  3STB C;  1WTW A;  5JEA H;  1FNU A;  4OIK A;  4EQP A;  3NPP A;  3RN5 A;  1PRT C;  2BA1 A;  3HOY G;  3U58 A;  1N34 L;  2AWO A;  4DK0 A;  3FDT A;  4GLA C;  5EQ0 A;  4X64 Q;  2N3S A;  3PSI A;  3M9B A;  4HSV A;  3NE5 B;  4KJO A;  4L5R C;  2KQ3 A;  3CCJ A;  3R2I A;  5A2Q L;  5CV8 A;  4OWX B;  1O80 A;  1HXY D;  1XX8 A;  4BBR G;  5IGB A;  4RA8 A;  3I8Z A;  1D6E C;  1WVL A;  2G5D A;  3K0Y A;  4WOR A;  4YY3 Q;  1MSH A;  4DR5 Q;  3WDN A;  4NP5 A;  3OTO L;  3H15 A;  4JI1 L;  1VQG A;  4JYA L;  5CMD A;  1B4O A;  4TQU S;  4P73 A;  2ZTC A;  5HY6 A;  4G7Z C;  4LFB L;  2XVS A;  2F1M A;  2SNS A;  3TP8 A;  1Q86 C;  2EJF C;  1Z6H A;  4GLX A;  1B3Q A;  3G4S A;  1Y1W B;  5JAV A;  2EYP A;  2HIV A;  4H7B A;  5ELD A;  3J80 L;  1NR4 A;  4NKL A;  2QF7 A;  2BDN A;  1TWA B;  1Q81 C;  4PNY A;  5A2Q E;  4B3T Q;  1MBY A;  1SAP A;  4FXK C;  4L63 B;  4C1N K;  1O7Z A;  5EKL A;  1Y1W H;  2EPB A;  5H1S E;  3MEF A;  3GTL H;  2IWH A;  2B2T C;  1ZKO A;  4JI4 Q;  5JJI A;  1AZP A;  1ENF A;  4LF8 Q;  4ILW A;  2WAQ B;  1IL8 A;  5KNB A;  2ZT9 C;  4B08 A;  3TEH B;  5IP9 G;  3H91 A;  3BVG A;  3HEJ A;  4JI5 Q;  3U9O A;  4YY3 L;  2F4I A;  3W1B A;  3HOZ G;  4KKS A;  4IQZ A;  2OTL A;  3KF6 B;  1E0B A;  1XMQ Q;  2FMC A;  2RKS A;  2A68 C;  3J80 E;  2KBN A;  2K5H A;  4JBJ A;  3KBG A;  4LFB Q;  1FVI A;  3TRE A;  4DV7 L;  4IFD I;  2F0I A;  3CCR A;  2D0P A;  3S1R B;  4AQY Q;  1LTG D;  5M5X B;  1S4Z A;  2SNM A;  1EIF A;  4A3M G;  5FO8 B;  4JI8 Q;  1ENC A;  3FHW A;  3ITP A;  1N33 L;  3CPW A;  2PO4 A;  3HOX B;  4BXX H;  2B2U A;  4FO2 A;  5LMN L;  4N8F A;  3E3X A;  2A6E D;  1KRS A;  1X3P A;  1T9H A;  3K8A A;  1I6H H;  1IBL Q;  1VQI A;  2DY7 A;  1EWH A;  4AYB E;  1JIC A;  4QF4 A;  1SJE D;  1LTR D;  4ZUJ A;  4XXE A;  4OL7 A;  2Z6K C;  2FHT A;  4TKO B;  4HAE A;  4IO9 A;  4DV7 Q;  1KTK A;  1XMO Q;  2PW7 A;  5JVG 3;  3GO5 A;  4EGV A;  3DHQ A;  4DAY A;  3IFT A;  3AEV A;  5M5W H;  3NEM A;  5J3B A;  1B3A A;  4GNX B;  4RAU C;  2IT1 A;  1DD2 A;  2Q2I A;  1R4P B;  2F3V A;  2XIW A;  4KD3 A;  4R4I A;  4A4I A;  1O7I A;  1GO3 E;  2DJG C;  2H1E A;  4PZ7 A;  2LSS A;  1VQO A;  4LUZ A;  1NJI C;  4GKK L;  4ZYS A;  1TXY A;  3V96 A;  5M5W B;  4ZQ3 A;  2PNR C;  4HCS A;  3CQZ B;  1PRT D;  4A3F B;  1RCV D;  4BY7 B;  2D9U A;  1M90 C;  4DV3 Q;  1WTH A;  4RH6 A;  2BOS A;  3MFG A;  2ZM6 Q;  2K50 A;  1STB A;  4JI4 L;  3HZX A;  1W3S A;  2L4N A;  1JOR A;  1JCK B;  3V2T A;  3QOL A;  1S72 A;  4JV5 L;  2PW5 A;  2IY5 B;  4RGN A;  4A75 A;  2ENB A;  4LFA Q;  2Q8I B;  4CJ2 C;  3RZO B;  4K2L A;  2L1B A;  1M1K C;  1CTM A;  4DV1 Q;  2WFW A;  3Q0A A;  2Y0S B;  2R92 G;  4M1U B;  3HOV G;  1A3U A;  3CCS A;  2EZV A;  1X3F A;  4O2D A;  1KLU D;  3CPF A;  1CFM A;  4RWS C;  3GTQ B;  5CGK A;  4DR7 L;  1GUT A;  3MXN B;  3GTG H;  4JI8 L;  4B3M L;  1BBW A;  2KJX A;  4JPB W;  1A8V A;  1OXU A;  4GKK Q;  4XYO A;  4Z9C B;  4JG2 A;  1JJ2 A;  2Z9H A;  4IPH A;  1JOO A;  1ZYR D;  4BBR B;  3G6E A;  5K36 G;  2Y0S G;  2Q8R E;  1PA6 A;  1QJO A;  5GQO A;  3K58 A;  3RZD H;  4A93 H;  2WII B;  2XGT A;  4F7X A;  1AH9 A;  1H9S B;  3J7A F;  1KAA A;  2KEE A;  4HJ7 A;  5T1G A;  4F8M A;  4LF7 L;  1SXT A;  1YNJ D;  4GOP C;  2UUC Q;  2OQK A;  3PUX A;  1JOQ A;  5ELB A;  1PYB A;  2N8N A;  2F0G A;  1N34 Q;  3PF4 A;  1KQS A;  2ES2 A;  2VNU D;  4X65 L;  1CHP D;  1CKO A;  3FVQ A;  2GVA A;  1BDO A;  1EZ8 A;  1Y8N B;  4A3I H;  2QGQ A;  2WKC A;  2BE5 D;  4DU9 A;  1EOT A;  1HZ9 A;  4AYB B;  1K9M C;  1QUQ B;  4K6L A;  1LUZ A;  1CK1 A;  3MA2 B;  5IT9 L;  2IX1 A;  4MZ9 A;  1QWY A;  5C0X H;  2ICI A;  3QIA A;  1LTL A;  1Z7T A;  1JR0 D;  3A5Z B;  2CH4 A;  1SEB D;  4CKE A;  1E1O A;  3S2H H;  5CC4 A;  2A69 C;  1O7Y A;  4ME3 A;  5CYU A;  5FJ8 H;  1SE4 A;  3GP7 A;  4OX9 Q;  1D5M C;  1DJR D;  2HQL A;  4BY1 B;  1SRU A;  5G3L D;  1C4Q A;  1EEF D;  2F0S A;  2O2L D;  4RMF A;  1LTB D;  4HR7 B;  3TP5 A;  1NR2 A;  5FLM G;  1QVC A;  4N9P A;  1JWS D;  1MKH A;  2A74 C;  2DNC A;  3KDF A;  2A8V A;  3S17 B;  1LAC A;  1YHB A;  4RGM A;  1WFQ A;  2IX3 A;  4A3C G;  1V43 A;  1EY5 A;  4QGU A;  1B1Z A;  4TVA B;  2E76 C;  3J7Y W;  5DEH A;  1GUO A;  1PH8 A;  1XTC D;  4I7Z C;  1L2F A;  3W1G A;  1YIJ A;  3UDX A;  1EFW A;  3M4O H;  1BUV T;  4UDU C;  2RSN A;  3A7L A;  4JI7 L;  2F0D A;  1PRT B;  4I7A A;  1EY4 A;  3EVQ A;  4PG3 A;  4K5V A;  4HJ8 A;  1XMQ L;  2JK8 A;  1I5F A;  4GOP A;  4LF9 Q;  2OEO A;  4YCU A;  3CU7 A;  4MNO A;  4LWC A;  4Y7N B;  2A6E C;  1ZYR C;  4PV1 C;  1CUK A;  2NB0 A;  4QJF A;  2PZT A;  2JA7 G;  3HOW B;  1HRJ A;  4DV2 Q;  5IGF A;  1AE2 A;  2UUA Q;  4GN4 B;  1WTO A;  5IYB H;  1EL0 A;  4JBK A;  1KDB A;  1S5C D;  1X3G A;  4BS9 A;  1CI3 M;  4UP8 A;  3Q23 A;  3I4O A;  4K5X A;  2OCE A;  4QCL A;  2QEJ C;  2UXC Q;  1STH A;  5HUR A;  1ESR A;  4Y7N H;  1QCB D;  4ZRZ A;  3VYS A;  4X6A H;  1OXX K;  2VUM H;  1T5X D;  2ALY B;  2J0T D;  3UE0 A;  3L3O C;  2F0Q A;  5COR A;  4DV0 L;  5D14 A;  2IHE A;  3LNN A;  4L8J A;  3KUP A;  5IP7 H;  1TS4 A;  2I5M X;  4IFD J;  4JI5 L;  5JPN C;  1CA5 A;  1QB5 D;  5I6Y A;  1I4P A;  4B3R Q;  2GVB A;  1DXM A;  2QDL A;  4G7H C;  3TME A;  1L1O B;  2AKW B;  1G29 1;  4DUY L;  4O0A A;  1TII D;  5M5Y H;  3KLS A;  2RDG A;  1Q8K A;  4K0K Q;  2UXB Q;  3H0G B;  3URY A;  2D2C C;  3T4A C;  2NBF A;  2R7D A;  5EJW A;  1CA6 A;  4LK1 C;  4YHH L;  4CKB A;  1SNC A;  1LT3 D;  1PTO F;  2XN9 C;  5E7N A;  1SE2 A;  1HCZ A;  1HFG A;  5C0X J;  1SNO A;  4EQO A;  2UXC L;  1TKW B;  4X3K A;  2C35 B;  2EJM A;  4ZK9 B;  1HTL D;  2Y0S E;  4V19 0;  2KOL A;  5FKA C;  1IBL L;  4X3U A;  1UNS A;  3HOW G;  4PQX A;  2XRS D;  4R4Q A;  1SE8 A;  4KY6 A;  3NEL A;  2CVR A;  2Z1C A;  1HZA A;  4KN7 C;  2KHI A;  1S3O A;  1YBY A;  2RHQ B;  4DN4 M;  1K73 C;  3R3O A;  4A3I G;  2JQO A;  4C3H H;  3TRZ A;  1VQP A;  1PH1 A;  3IAY A;  2JA5 B;  2NVQ B;  1BCP C;  4DGZ A;  1HHV A;  3ERQ A;  1EQQ A;  5BN3 A;  4XTC S;  3I90 A;  4A3K G;  1ONL A;  4GNX C;  2KEC A;  5I6W A;  3MVV A;  2PMZ B;  1Q1E A;  1BBU A;  3OWE B;  1DGS A;  5FLM H;  5E3F A;  1N32 L;  1WTV A;  2VQF Q;  1KAB A;  3BYT B;  3CAM A;  3A54 A;  1PH7 A;  4YWL A;  5FJ8 G;  4CJ1 B;  2QIL A;  4NXN Q;  4LFC L;  3VA7 A;  3CD6 A;  2NTS A;  1MD2 D;  1YVC A;  3SK5 A;  4CBV A;  1H9K A;  1TWF B;  1F9Q A;  2UU9 L;  2JA6 B;  1DOK A;  1S40 A;  2A1A A;  2R93 G;  5I9O A;  2KCN A;  4DV1 L;  2E2H H;  5EPL A;  1Q82 C;  2ZXO A;  5I2Y A;  2E75 C;  3HKZ E;  4LMQ D;  2Q2U A;  3J81 E;  5C3E H;  1H9R A;  1UEA B;  3K5O A;  4A3F H;  3S14 H;  3S2D B;  2L55 A;  3T1H L;  3PGZ A;  4B3M Q;  2PQA B;  2L9H A;  1NSN S;  2EY1 A;  2K32 A;  3RLF A;  4K8I A;  3SDZ A;  2B2U C;  2NWG A;  2KUM A;  3PO3 G;  4RCO A;  4PZ8 A;  3I4M G;  4DR3 L;  4IAL A;  3L7Z C;  1S5B D;  1V1Q A;  1YJ9 A;  3KF8 B;  2KCT A;  3NTH A;  5IGG A;  5GAH C;  1I4G A;  2CKZ B;  2E74 C;  1V1P A;  5E4W C;  2Q2H A;  3QR8 A;  3AMU A;  2UUC L;  4A3G B;  3VYT A;  2NYZ D;  4P75 A;  1YI2 A;  5LMN W;  4OO1 G;  4WRD A;  3FEW X;  3JAM L;  1ASY A;  3HKS A;  1ENA A;  1KRT A;  4KN4 C;  1AZQ A;  1Q90 A;  2NTT A;  4A3D G;  4YWK A;  2K5D A;  2NVT B;  1QZH A;  1NY4 A;  1U4P A;  2AQ2 B;  1BCP D;  1XNQ L;  1D1K A;  3BZK A;  4AQY L;  3ULJ A;  4DR5 L;  2LXK A;  5JJK A;  3M3Y H;  1A2T A;  1Q1B A;  1SMX A;  3DEO A;  1N36 Q;  1TY0 A;  1HNW L;  4A3J B;  1EY0 A;  5GRO A;  3HOU B;  2EE1 A;  3UDG A;  3J81 i;  1EEI D;  2N88 A;  1PDQ A;  3T13 A;  1FGU A;  2B2Y A;  2KED A;  2B2V C;  3NBH A;  4OO1 H;  4IZ8 A;  3M85 A;  2FMM A;  4IUR A;  5JJL A;  2UXD L;  2F0M A;  4A3I B;  3VR3 A;  4BXX G;  1UE6 A;  2R92 B;  1EIG A;  3KLS X;  2NVX H;  3PO2 G;  2CCZ A;  1PFN A;  2JE6 I;  3GTP H;  1X3Q A;  3PCO B;  1LYL A;  2UUA L;  3KOJ A;  5JVH 3;  4IUU A;  5LMU L;  1IW7 C;  2F0J A;  5C4Z A;  2VS1 A;  1PV4 A;  4XT3 B;  1PH3 A;  3HS0 C;  1ET9 A;  2L11 A;  4XQJ A;  5CV7 A;  2K1B A;  2B2W A;  1QVG A;  2B8F A;  1UEB A;  4QY7 A;  1UE5 A;  2YYZ A;  1U5K A;  3HKZ G;  1TS2 A;  5C3E G;  1EWI A;  2F4V L;  1C0A A;  3D4R A;  1VQC A;  4OX9 L;  4DK3 C;  2NN6 I;  4IJL A;  4DAP A;  3EQL C;  2MJ8 A;  2PPB C;  2NN6 G;  4OWW B;  4UP7 A;  3IL8 A;  2YV5 A;  1OXV A;  4WJ3 M;  3AQQ A;  1LLR D;  1Y1W G;  4BA2 I;  1SNQ A;  4JK1 C;  5G3L F;  2PQE A;  4CHT B;  3U4Z A;  2LKV A;  2IW3 A;  4DR3 Q;  3M4O B;  4C3I G;  1CM9 A;  2K52 A;  4LF5 Q;  1HH2 P;  1GUN A;  2EYM A;  2F52 A;  3M7G A;  4KLK A;  1UE1 A;  2A73 B;  1BBX C;  2R93 B;  3IRB A;  4PMB A;  4PMW A;  5IT9 c;  4JI6 L;  1PRT F;  5LMN Q;  2D62 A;  1RKN A;  1YHA A;  1VQK A;  2MO0 A;  1VQ7 A;  1Y69 U;  3A8I E;  4CDF C;  4A3L G;  2XRQ D;  5IIF A;  1EIH A;  1HUM A;  4WJ4 A;  2EYO A;  5CR3 A;  3LGJ A;  4DUZ L;  1ML0 D;  3P20 A;  3K7U C;  4KK7 A;  3CQZ H;  2DGY A;  1N36 L;  4QMG A;  1OXS C;  1IL2 A;  3VR4 A;  3J81 j;  3PF5 A;  5IT9 E;  1TWG B;  3GTO H;  1RF2 D;  4N8X 1;  3OTO Q;  2I07 B;  1I4R A;  1Q3L A;  3N6R A;  3T56 B;  5FO7 B;  4JBM A;  1H9J A;  2RHS B;  3EA6 A;  3DXJ C;  2QCP X;  4IFD H;  2K75 A;  1VMP A;  4CGY B;  2VL6 A;  3F2C A;  3RZO H;  5FLX E;  3T16 A;  1EIY B;  5JEA G;  5C44 B;  3STB D;  1PH6 A;  3TS0 A;  3BDC A;  1W2B A;  1FJG Q;  2NN6 H;  5EGT A;  1Y8P B;  2OF1 A;  3PIO A;  4H0L C;  3GTO B;  1Q7Y C;  1TR5 A;  3C2P A;  2Z8L A;  1RTO A;  1A0I A;  3QJY A;  3DEP A;  3WOE A;  4POG A;  1B9M A;  3A7A B;  1GJX A;  2OT2 A;  1LM0 A;  3E5S A;  2RA4 A;  1SNP A;  1GUW A;  4LF6 Q;  3I2Z A;  1CKN A;  1FNV A;  1V9P A;  4JV5 Q;  1YNN C;  3ONA B;  3GTM H;  3GV6 A;  4BBR H;  2EJG C;  1Y8O B;  1PTO B;  1GUS A;  2K5N A;  4QB4 A;  5NUC A;  5IP7 G;  3HRZ C;  3W5O A;  1CKN B;  4FNF A;  4HJA A;  4JYA Q;  1U9R A;  3PQI A;  2JJQ A;  3UDF A;  3KJO A;  2CFM A;  1IZ6 A;  1EUJ A;  1FYC A;  1SBB B;  4DAM A;  1II3 A;  3VR2 A;  4IUQ A;  1C7Y A;  2XTI A;  1BXT A;  3MWY W;  4L5T A;  1NBW A;  1LTI D;  3H09 A;  3R93 A;  2CW0 D;  3WWV A;  3S15 B;  1QNK A;  1WCM G;  4KMU C;  1IYV A;  2IJ0 A;  4OON A;  2YTX A;  4A3K B;  1I94 L;  2JA5 H;  2IHF A;  2AUJ D;  4KJN A;  2OWO A;  4K0K L;  4R4C A;  2UXB L;  5I4D A;  2N55 A;  1IBK L;  1UE7 A;  1EQR A;  1FNW A;  2XWJ B;  1XNR L;  2FXQ A;  1F2Z A;  2N78 A;  1C8C A;  2QDB A;  4A3D B;  4IUN A;  1U4L A;  2MHV A;  4NMZ A;  4JI3 Q;  1K8M A;  1WTX A;  1TWH B;  4XYQ A;  4Q5V A;  3S1M B;  1KNE A;  4X65 Q;  2JP1 A;  1NCV A;  5L37 A;  3JAM i;  3C46 A;  1HQM C;  2ASB A;  4A3E G;  4BBS G;  3GTK H;  2B2Y C;  4DNR B;  1HZC A;  4HJ9 A;  4KHZ A;  4C2M H;  4A3D H;  4DV5 Q;  4L5Q A;  1UAP A;  2D5D A;  2O5I C;  3KBX A;  3M4Q A;  2YTY A;  4HCE A;  5KEE A;  1FL0 A;  2KCM A;  4M8A A;  3FKI G;  1A2U A;  4A3C H;  4JCV E;  4DR7 Q;  5KRU A;  3PUY A;  5IGD A;  2E2H B;  2R7F A;  3GTK B;  1F77 A;  3S1Q B;  3I3C A;  3EJI A;  3OW7 A;  2E2I B;  5JEA J;  1B70 B;  5DM7 3;  5C6A A;  4EX5 A;  3VDY A;  5FLX c;  1EYA A;  3D4D A;  3BDL A;  3HOV B;  2Z6K A;  3SXH A;  3BYY B;  1R4Q B;  1JB3 A;  3NBH B;  3I4M H;  2LFN A;  3F2U A;  2CQO A;  3P1H A;  1SDF A;  4QL5 A;  3L2P A;  4IFD G;  1VQE A;  1A3V A;  1VQ4 A;  5IOC A;  5FLX L;  3TBI B;  3VR5 A;  3S1N B;  1EQV A;  2MGS A;  3ICE A;  1XNQ Q;  4K8J A;  2ZM6 L;  4LF4 Q;  4N9T A;  1VQL A;  5C44 G;  2DN8 A;  2F0V A;  3F2D A;  4LF4 L;  4YWM A;  2L15 A;  3AFP A;  3BS1 A;  3CF5 A;  5IGE A;  5IOD A;  5J22 A;  4GZY C;  3KYH C;  1W6K A;  3J80 i;  2ZXR A;  5ELE A;  4G7O C;  2KHJ A;  4A3L H;  1ILP A;  2GN5 A;  3MHB A;  2JEB I;  3BG3 A;  1EY7 A;  1JWU D;  4DR1 L;  1C9O A;  1X32 A;  4X66 L;  3SK4 A;  4JOI C;  3SE0 A;  2VUM B;  1VQ8 A;  3KF8 A;  4ULL A;  4S3S A;  4A93 G;  1N32 Q;  2ZJP A;  3M3Y B;  3CC2 A;  4P71 A;  1PVO A;  2AUK A;  5HGQ A;  4XT1 B;  4FYD A;  2L0C A;  1K8A C;  2LS0 1;  1AN8 A;  1JT8 A;  5JOB A;  5J39 A;  3K0X A;  1PTO D;  2PQA A;  5GAE C;  4MN3 A;  2HDL A;  2EY6 A;  3DM3 A;  1VQH A;  2B8G A;  4C3J B;  1TWA H;  2DNE A;  1VCI A;  2ZTD A;  3EBE A;  4E6I A;  1ROD A;  5ISR A;  2PYK A;  4J8Q A;  1HR0 L;  4BY1 G;  3EFX D;  2R92 H;  5C4X G;  2NVX B;  3G48 A;  2RCF A;  3HG9 A;  3GTP B;  2B2V A;  4XQN A;  2HDM A;  3D4W A;  1GXD C;  1SE3 A;  5JPM C;  2IPK D;  1GKH A;  1X65 A;  3TP7 A;  4DR1 Q;  2UUB L;  1EYD A;  3BU2 A;  3J7Z C;  2P5Z X;  2EOT A;  3FKI B;  1HPC A;  1YHQ A;  5D3I B;  4LJZ C;  5J1Z A;  4MTK A;  3I70 A;  3V05 A;  2GA4 B;  1G91 A;  3FPP A;  3GQB A;  1LTA D;  3D6C A;  1D5X C;  2OTJ A;  4OEL B;  2HUG A;  3S1R H;  2Q8T A;  4R8I A;  1ESF A;  1G6P A;  3FKI H;  1STN A;  5LL6 S;  1YJN A;  1K8O A;  4NXM L;  1P16 A;  1E2Z A;  4KY5 A;  3N52 A;  4DA2 A;  4OHJ A;  5HGT A;  3K5L A;  3LX0 A;  3X3N A;  2Z4H A;  3IFD A;  4U68 A;  4JVZ A;  1B2T A;  1EY8 A;  1JC7 A;  3S16 H;  3U9S A;  1CT1 D;  1X6O A;  2CHB D;  2KCC A;  4JI1 Q;  1STG A;  3C1F A;  1K0S A;  4R1J A;  2EXZ A;  5C3X A;  1PFM A;  4JC0 A;  1TWF H;  4UHV A;  5K5P A;  4F88 A;  1I4X A;  2I5H A;  3DMU A;  1VQD A;  4R4T A;  3CCU A;  4PZ6 A;  4X62 Q;  2I46 A;  1RL2 A;  4UAI A;  1HUN A;  3TDQ A;  1G51 A;  1GOZ A;  3R2T A;  3GDE A;  1PLF A;  2A69 D;  3ZYY X;  4NXM Q;  4KY7 A;  4OIJ A;  3SHL A;  4O1N A;  1GUG A;  4DR2 L;  2F0N A;  4JI0 Q;  1JJC B;  1D8L A;  1M4V A;  5D65 A;  3K57 A;  3PUZ A;  1F9R A;  4IUV A;  1BF4 A;  2BCO A;  3OMG A;  3X3M A;  5TSS A;  1SMY C;  4HTH A;  1I3Q B;  4O42 A;  2SOB A;  1CHQ D;  1CKM A;  1G2T A;  4C3I B;  1J9O A;  3NEN A;  1E3P A;  1YNJ C;  5COY A;  1X3E A;  4J15 A;  5BN5 A;  1I6V C;  1OXT A;  2E5L L;  3A0J A;  3HOX G;  1SLJ A;  2JYO A;  2K01 A;  3I91 A;  2EDG A;  1L1O C;  3OIP A;  1CQV A;  3I56 A;  1SND A;  3T1H Q;  4RCN A;  2FJ2 A;  2X6L A;  2FIN B;  3D0F A;  3TN2 A;  2F0T A;  4A3F G;  4DV0 Q;  1PH4 A;  3K5M A;  4HED A;  2BH2 A;  3I4N B;  4A3G H;  4LUO A;  3I4N G;  1E22 A;  2A6H D;  3M4Y A;  4ZAI A;  1BNZ A;  4FDB A;  1KXL A;  1B7Y B;  4RKL A;  3RD4 A;  4UY8 C;  3HKZ B;  1I4H A;  5FOB B;  4A76 A;  1A63 A;  1ILQ A;  3G6J B;  1KLG D;  1NUC A;  2NVY H;  4LF9 L;  2PI2 E;  2UXD Q;  3LWE A;  2NVT H;  3KLR A;  1HQR D;  4LF5 L;  1HNX L;  4GS3 A;  2K5V A;  4GOP B;  1Z47 A;  2Z4I A;  1VMC A;  2F0F A;  4NXN L;  4DV6 L;  4DR4 L;  4Y52 H;  1D2B A;  3GTG B;  3MZ5 A;  1LO5 D;  2F0O A;  1LTT D;  2ATW A;  2NZO A;  4B9X A;  3I72 A;  2JA6 G;  3QO2 A;  3ULL A;  3D3R A;  5DM6 3;  1E1T A;  4LF8 L;  3VYU A;  3HOU H;  5M5X H;  2WB1 E;  5C4J H;  2EYJ A;  1L1O A;  3HGB A;  5IYD H;  3PMF A;  4A3K H;  3BDO A;  4DUZ Q;  3TZD A;  3RZD B;  1KDC A;  2F0K A;  2JN4 A;  5ELO A;  3ND9 A;  3K59 A;  1WCM B;  3HOX H;  3Q6S A;  4KD4 A;  1F2L A;  3CC7 A;  4EVO A;  3KLW A;  1GHK A;  3KDF B;  1K83 H;  1E24 A;  1D1I A;  1V8Q A;  1QIL A;  2F03 A;  1JMC A;  1OTC A;  1I6H B;  3BVZ A;  3PIP A;  4C1N I;  3S1M H;  1B50 A;  3MXG A;  4QUC A;  4KKT A;  3AB9 A;  3A74 A;  4APV A;  2DY8 A;  1PZK D;  4KTA A;  1IKL A;  3RN2 A;  3OOC A;  4EQ5 A;  2G9D A;  4IN3 A;  4K14 A;  2C5C A;  2R6G A;  2VQE L;  3CME A;  3E9H A;  2I5L X;  1PXU A;  1LT6 D;  3CCE A;  4H02 A;  2F0P A;  3H6M A;  1X9N A;  5BN4 A;  3F2B A;  2BA0 A;  4YCW A;  2R7Z G;  1WYD A;  1QVF A;  4A3G G;  3S2H B;  1SFO B;  2BH8 A;  2R7Z B;  1EU3 A;  2ZTE A;  4IPC A;  5CBA E;  1IBM L;  4LUV A;  1F9S A;  3NP8 A;  1STE A;  1PFB A;  1XXG A;  2OXP A;  3K7A H;  3NSW A;  3PO2 B;  1OO9 B;  1VF5 C;  5JJZ A;  1I50 H;  1UWV A;  1XYI A;  4HSP A;  2EYL A;  4J6H A;  4HIK A;  4BY7 H;  3H94 A;  3S1N H;  3TS2 A;  5AFW A;  3DWA A;  3K7A B;  4DKA C;  1MI2 A;  3PO2 H;  4OGQ C;  3SVM A;  2YU9 H;  5IY0 A;  2PZU A;  2NUC A;  4K6D A;  1SYF A;  3W2D A;  4P2C B;  1LV9 A;  2M00 A;  2AMC B;  1STA A;  2MUY A;  4RGT A;  2DUD A;  4DUY Q;  1J5E Q;  2BE5 C;  1KHI A;  4B3S L;  1HZB A;  2RDF A;  3S9W A;  2K03 A;  1Q46 A;  4ABN A;  3Q22 A;  5KGU A;  1Q12 A;  1SJH D;  4JOI A;  4DF7 A;  5I9P A;  5GAD C;  4H13 C;  4R4O A;  2F0H A;  1NMG A;  5KYL A;  2EVB A;  3QB3 A;  1GM5 A;  3CXC A;  1HJP A;  4R8N A;  5BR8 Q;  3UE1 A;  1MHW C;  1WTR A;  3GV3 A;  1JE5 A;  4KHP L;  1QUQ A;  3CRK C;  1PMR A;  1WTP A;  4DR6 Q;  4X66 Q;  2B2T A;  4HID A;  1BCP F;  5ELF A;  2H4O A;  4A93 B;  3CCQ A;  3VR6 A;  1U4M A;  2MPM A;  4PMC A;  2V4D A;  5EKI A;  3PO3 B;  1Y14 B;  4A3B H;  3RNU A;  4HIM A;  1SYC A;  2L12 A;  4DPG A;  3C3L A;  4QQB X;  2A68 D;  4IPG A;  1XJV A;  4F87 A;  4K5W A;  2BDO A;  5DNF A;  2WAQ E;  4H44 C;  2EXD A;  1PFS A;  1KD1 C;  1SRO A;  4FP5 D;  3PO3 H;  2CH4 W;  1PYW D;  2JXM B;  2RQX A;  5T1I A;  1PTO C;  2NZ1 D;  4CDC C;  4X3T A;  4DR4 Q;  4A3B B;  5M5Y B;  2O5J C;  2WAQ G;  1TS3 A;  1RJT A;  4OEM B;  1K28 A;  1ET6 A;  2ZXP A;  5GAG C;  2HHH Q;  4P72 A;  3MC0 B;  4DK1 A;  3A5U A;  1TWC H;  4DR2 Q;  5C0X G;  1XMO L;  1WD1 A;  3MXN A;  1JJG A;  4CJ0 B;  2OQ0 A;  2RCN A;  3UDI A;  2RVL A;  4YIJ A;  4RHR A;  3CRL C;  2N49 A;  4JW0 A;  1SYB A;  5M9O A;  1MJE A;  1AW7 A;  5EPJ A;  1STY A;  3EIV A;  3G71 A;  1M8A A;  2EYH A;  4L6T B;  3I73 A;  3L9A X;  3ERS X;  5KNC A;  3F1Z A;  3I55 A;  1NNX A;  1V1P B;  3S17 H;  3T1Y L;  2AQ1 B;  3ULP A;  3I4L A;  4C3H B;  2K14 A;  1Q8I A;  3S16 B;  1BO0 A;  4ZCK A;  3SGI A;  3CKI B;  3A8K E;  3JAM E;  2F3W A;  4C2M B;  3Q24 A;  4QIW E;  1VQJ A;  3VA5 A;  1G8Z D;  2QA4 A;  2HQE A;  1J5E L;  2A19 A;  4FF4 A;  4MTN A;  2IX0 A;  4YCV A;  3A8J E;  2E8G A;  1SN8 A;  4U67 3;  2D0O A;  2FFK B;  1EFI D;  2TSS A;  5E1F A;  5AJ3 L;  3NK9 A;  3FPU B;  1BQQ T;  2C9O A;  1VQA A;  4ZKC B;  3HOY B;  2E2I H;  2WAC A;  4DAY B;  4DXG A;  4A3E H;  4BBS H;  1PZI D;  3HOV H;  3HOW H;  3BVM A;  1WTQ A;  1DON A;  4X62 L;  3I4M B;  3U4V A;  3QG1 A;  1I3Q H;  4ZKB B;  1VDZ A;  2ICE C;  1JOK A;  4ME5 A;  1DZ1 A;  3PUV A;  2JA8 H;  1EYG A;  5EBC A;  4B3R L;  1EY9 A;  3HOY H;  4C56 C;  2QKI C;  2VXW A;  3S2D H;  5C5L A;  3S14 B;  1MSG A;  3R8B A;  1ICW A;  3WOF A;  3MXP A;  4OXP A;  2K6A A;  3MAQ A;  1DOL A;  3P75 A;  3Q8D A;  2WB1 B;  5CBE E;  4FXD A;  5LL6 X;  2RSO A;  1KC8 C;  1RDP D;  2RDH A;  2ZJQ A;  1SNM A;  4LF7 Q;  2JA8 B;  1EY6 A;  2F0L A;  1PH5 A;  3O13 A;  1H95 A;  5M3F B;  3CP0 A;  4JI3 L;  1TU2 B;  1W6J A;  5EKK A;  1X54 A;  2EYF A;  4JI0 L;  4BY7 G;  1A3T A;  2NVY B;  4DAV A;  1L0X B;  3J81 L;  5M3M B;  1BOS A;  1FR3 A;  3J81 c;  1HFN A;  2VB3 X;  3I7F A;  3NTK A;  4DK6 C;  3PUW A;  4P74 A;  3KF6 A;  3FMC A;  2JA7 B;  2VUM G;  1E2W A;  3GTL B;  1VQF A;  3JAM c;  1JQY D;  1SYE A;  4JI7 Q;  1O7L A;  4DFA A;  4UP9 A;  1A15 A;  1O78 A;  1AEX A;  2EIF A;  5C4J B;  5M3M H;  1QG7 A;  2MQH A;  1F2M A;  3KJP A;  2JA5 G;  2JA7 H;  1S5F D;  3NQI A;  1WCM H;  1C48 A;  4GN5 A;  2K5W A;  4DV2 L;  4X3S A;  4GKJ Q;  1NAP A;  2HD3 A;  3D31 A;  2K04 A;  1J8I A;  2PMZ E;  1K83 B;  1ZXT A;  1K8G A;  2Z6B A;  1D5Z C;  1E2V A;  2J4X A;  4LAA A;  1Z9F A;  2CWA A;  3DM1 A;  1KIX A;  2KHS A;  2HHH L;  2AWN A;  3A55 A;  4B3S Q;  1WI5 A;  2E2J H;  4A3M H;  4BA1 I;  3U50 C;  3NBI A;  3RUZ A;  1VF7 A;  2YTV A;  3K6O A;  2Q2T A;  4RHS A;  2B63 H;  2XNA C;  1JB7 A;  4KHP Q;  2M2L A;  1S5D D;  1NMF A;  2F0E A;  3NWS A;  1KNA A;  1F2Y A;  4LFA L;  1I4Q A;  2MO1 A;  3OMC A;  1E7Z A;  1PYS B;  4A3M B;  3H0G G;  1IYJ B;  2K28 A;  4L5S A;  2R7Z H;  1HA6 A;  2B63 B;  2JA6 H;  2VQF L;  1BR9 A;  4HMI A;  1IYU A;  1NTG A;  4LFC Q;  5CV6 A;  1I50 B;  4FVM A;  3JC6 6;  4XQQ A;  2XWB B;  4DV6 Q;  1SYG A;  3ZJY C;  2VY3 A;  3FP9 A;  1TVX A;  1DOM A;  4RG1 A;  2F3I A;  1RTN A;  2PCF B;  3OW2 A;  5IE8 A;  4TRD A;  1HNX Q;  2RBM A; 
#chains in the Genus database with same CATH homology
 3FHW A;  1OXT A;  2E5L L;  1N33 L;  3A0J A;  5BR8 L;  1N36 Q;  3HOX G;  1KL9 A;  3CPW A;  1SLJ A;  1IBK Q;  1HNW L;  4BXX H;  5GRO A;  3UDG A;  1L1O C;  3J81 i;  1NE3 A;  3I56 A;  3T1H Q;  1VQN A;  5LMN L;  1CSP A;  1FGU A;  3D0F A;  4A3F G;  3M85 A;  4DV0 Q;  1PH4 A;  1KRS A;  1CSQ A;  1GVP A;  2BH2 A;  1T9H A;  3K8A A;  4A3G H;  1I6H H;  1IBL Q;  1VQI A;  4LUO A;  3I4N G;  1E22 A;  2UXD L;  5JJL A;  4AYB E;  2JA9 A;  5C0X I;  4FDB A;  1KXL A;  3L0O A;  1B7Y B;  5IYD G;  4UY8 C;  4BXX G;  2Z6K C;  1UE6 A;  4A76 A;  4AIM A;  2NVX H;  4GLV B;  1KAW A;  3HOU G;  1A63 A;  3PO2 G;  2CCZ A;  4IO9 A;  2B63 G;  4DV7 Q;  2JE6 I;  4JI2 Q;  1WOC A;  2NVY H;  4DV5 L;  1XMO Q;  2PI2 E;  1VQ9 A;  4LF9 L;  2NVT H;  3GTP H;  1RIP A;  2UXD Q;  4B3T L;  3GO5 A;  3PCO B;  1LYL A;  2UUA L;  1HNX L;  4LF5 L;  3KOJ A;  4GS3 A;  5LMU L;  2K5V A;  4GOP B;  1Z47 A;  2VS1 A;  4DV4 Q;  4NXN L;  1PH3 A;  5M5W H;  1PV4 A;  3GTJ H;  1HNZ Q;  3NEM A;  5J3B A;  4DV6 L;  4C3I H;  4DR4 L;  4Y52 H;  4GNX B;  1D7Q A;  3EN2 A;  1QVG A;  3HFZ B;  1UEB A;  2IT1 A;  4QY7 A;  2HIX A;  2ATW A;  1UE5 A;  2NZO A;  2Q2I A;  2YYZ A;  1U5K A;  2JA6 G;  2B29 A;  4R4I A;  3ULL A;  1E1T A;  3HKZ G;  1O7I A;  4A4I A;  4IOA A;  1GO3 E;  4LF8 L;  1L0W A;  4PZ7 A;  5M5X H;  3HOU H;  2LSS A;  2WB1 E;  5C4J H;  5C3E G;  1VQO A;  4LUZ A;  1EWI A;  2F4V L;  1NJI C;  1C0A A;  1L1O A;  4GKK L;  1VQC A;  1TXY A;  5IYD H;  4A3K H;  4OX9 L;  1VS0 A;  4DUZ Q;  4LNQ A;  4DK3 C;  1K3R A;  3CC4 A;  4GN3 B;  2NN6 I;  3GD7 A;  3I4N H;  4IJL A;  5ELO A;  1N9W A;  4AH6 A;  5LMU Q;  2NN6 G;  4OWW B;  4UP7 A;  3HOX H;  4A3J H;  4HIO A;  2YV5 A;  1M90 C;  3CC7 A;  4DV3 Q;  1OXV A;  3KLW A;  2ZM6 Q;  4WJ3 M;  3AQQ A;  1PHJ A;  3KDF B;  1Y1W G;  2K50 A;  4JI2 L;  4BA2 I;  4JI4 L;  1K83 H;  1K0R A;  1W3S A;  1E24 A;  3RR5 A;  1J6Q A;  1VQ6 A;  3CMA A;  4OWT B;  3U4Z A;  1S72 A;  1JMC A;  1VQ5 A;  3E0E A;  4KI0 A;  4DR3 Q;  1OTC A;  4JV5 L;  2IY5 B;  4A75 A;  3PIP A;  4LF6 L;  3S1M H;  2K52 A;  4LF5 Q;  4LFA Q;  1HH2 P;  3A74 A;  4APV A;  2F52 A;  3RN2 A;  4KLK A;  1UE1 A;  4EQ5 A;  1M1K C;  3IRB A;  4PMW A;  5IT9 c;  4DV1 Q;  4JI6 L;  1GD7 A;  2WFW A;  5LMN Q;  2R92 G;  2D62 A;  2R6G A;  2VQE L;  3HOV G;  2V1C C;  3K80 C;  3CME A;  3E9H A;  2I5L X;  3CCS A;  1X3F A;  1X55 A;  1YHA A;  1HNZ L;  2QEX A;  3CCE A;  4H02 A;  4O2D A;  3CPF A;  1VQK A;  2MO0 A;  1VQ7 A;  1ASZ A;  4A3L G;  1X9N A;  3CW2 C;  2BA0 A;  4YCW A;  3F2B A;  2R7Z G;  1WYD A;  1QVF A;  4DR7 L;  3MXN B;  4A3G G;  3GTG H;  4JI8 L;  4B3M L;  1BBW A;  4WJ4 A;  2BH8 A;  3LGJ A;  5IWA L;  4DUZ L;  2ZTE A;  4IPC A;  1A8V A;  3K7U C;  4GKJ L;  1OXU A;  4GKK Q;  3CQZ H;  2DGY A;  1IBM L;  4LUV A;  1N36 L;  4X64 L;  3K7A H;  1OXS C;  4JG2 A;  1JJ2 A;  1IL2 A;  3K81 C;  4IPH A;  1WJJ A;  3G6E A;  5K36 G;  1I50 H;  2Y0S G;  2UU9 Q;  1UWV A;  3J81 j;  3PF5 A;  2JA8 G;  1PA6 A;  3B6Y A;  3GTO H;  5GQO A;  1XNR Q;  3OTO Q;  1PH9 A;  3RZD H;  4A93 H;  2XGT A;  1IBM Q;  2ID0 A;  4JBM A;  5IYC H;  1XPO A;  1AH9 A;  2RHS B;  2VW9 A;  4HIK A;  4BY7 H;  4HJ7 A;  3S1N H;  4LF7 L;  3TS2 A;  2K75 A;  2NZH A;  4DNI A;  5C4X H;  4GOP C;  2UUC Q;  2OQK A;  2VL6 A;  3PUX A;  2H5X A;  3F2C A;  4BY1 H;  1PYB A;  4DKA C;  3PO2 H;  1N8R C;  1EIY B;  3RZO H;  5JEA G;  2N8N A;  3STB D;  1PH6 A;  3TS0 A;  4A3J G;  1W2B A;  5IY0 A;  1N34 Q;  2YU9 H;  1FJG Q;  1KQS A;  1HR0 Q;  3PIO A;  2ES2 A;  2VNU D;  4X65 L;  1Q7Y C;  1CKO A;  4DR6 L;  1A0I A;  2AMC B;  4IOC A;  2GVA A;  1TWH H;  2DUD A;  1YIT A;  4DUY Q;  4POG A;  1J5E Q;  4A3I H;  1KHI A;  1B8A A;  2QGQ A;  4B3S L;  1LM0 A;  1HZB A;  1HZ9 A;  2R93 H;  1Q46 A;  1SFO H;  1K9M C;  1QUQ B;  2I0Q A;  1LUZ A;  1Q12 A;  3I2Z A;  4LF6 Q;  1CKN A;  1VQB A;  4JOI A;  1V9P A;  1X56 A;  2K4K A;  5GAD C;  4ALP A;  4JV5 Q;  4R4O A;  1NMG A;  1MIU A;  5IWA Q;  4MZ9 A;  2VQE Q;  2IX1 A;  3GTM H;  1LTL A;  1GM5 A;  3A5Z B;  4BBR H;  1HJP A;  3RLN A;  5BR8 Q;  3CXC A;  2K5N A;  3UE1 A;  2Z0S A;  5IP7 G;  2CWP A;  1E1O A;  4YHH Q;  3S2H H;  5ELN A;  3W5O A;  1CKN B;  4ME3 A;  1JE5 A;  4KHP L;  1QUQ A;  5FJ8 H;  4HJA A;  4JYA Q;  2JJQ A;  3UDF A;  3S1Q H;  4OX9 Q;  3KJO A;  2CFM A;  4GNX A;  1IZ6 A;  4DR6 Q;  4JI6 Q;  4X66 Q;  1EUJ A;  1YJW A;  2HQL A;  4DAM A;  4HID A;  2F4V Q;  2LXJ A;  2VZA A;  5M3F G;  1SRU A;  1C7Y A;  1R9T H;  2XTI A;  3F8T A;  2WP8 J;  1TWG H;  3PV0 A;  4RMF A;  4L5T A;  1NBW A;  3AFQ A;  5FLM G;  3WWV A;  1WCM G;  3CCQ A;  3HOZ H;  1QVC A;  2EQS A;  4IPD A;  1MKH A;  4OON A;  1PH2 A;  2YTX A;  5EAY A;  3KDF A;  5IP9 H;  1I94 L;  2IHF A;  2JA5 H;  3AYH B;  2A8V A;  1Y14 B;  2PNH A;  4A3B H;  1YHB A;  4HIM A;  3RNU A;  1WFQ A;  2HT1 A;  4DPG A;  2OWO A;  4A3C G;  4R4C A;  4K0K L;  1V43 A;  2UXB L;  4QGU A;  1EOV A;  2WB1 G;  1UE7 A;  1EQR A;  1IBK L;  4QQB X;  1HNW Q;  5C44 H;  1XNR L;  4TVA B;  4IPG A;  1QZG A;  2FXQ A;  2E5L Q;  1XJV A;  2N78 A;  3S24 A;  2PI2 A;  4JBW A;  5M3F H;  2WAQ E;  1PH8 A;  2EXD A;  4JI3 Q;  1L2F A;  1PFS A;  3W1G A;  1YIJ A;  3UDX A;  1BVS A;  1KD1 C;  1EFW A;  1P8L A;  1SRO A;  3RLO A;  3PO3 H;  1BKB A;  3M4O H;  4X65 Q;  3ER0 A;  2MNA A;  4DR4 Q;  4JI7 L;  4XIG S;  3JAM i;  3CCV A;  2ASB A;  2WAQ G;  4IJH A;  4A3E G;  4BBS G;  3H3V I;  3GTK H;  4PG3 A;  2HHH Q;  5GAG C;  1HZC A;  4P72 A;  4HJ8 A;  3T1Y Q;  3A5U A;  1TWC H;  3BJU A;  4HJ9 A;  4DR2 Q;  4KHZ A;  4C2M H;  1XMQ L;  5C0X G;  2JK8 A;  4A3D H;  1I5F A;  4GOP A;  4DV5 Q;  1XMO L;  4L5Q A;  4LF9 Q;  1AE3 A;  2UUB Q;  1JJG A;  4YCU A;  4MNO A;  3M4Q A;  4LWC A;  2YTY A;  3J80 c;  1FL0 A;  3BZC A;  2KCM A;  1CUK A;  2OQ0 A;  2RCN A;  3FKI G;  3OYY A;  4QJF A;  3UDI A;  3H0G H;  4DV2 Q;  4JCV E;  1I94 Q;  2JA7 G;  3GTQ H;  4DR7 Q;  4A3C H;  1AE2 A;  3PUY A;  2UUA Q;  2N49 A;  4A3B G;  2B3G A;  4GN4 B;  1MJE A;  2R7F A;  5IYB H;  3EIV A;  4JBK A;  1X3G A;  4UP8 A;  3G71 A;  2ZJR A;  3I4O A;  2OCE A;  3M7N A;  5JEA J;  1B70 B;  3VDY A;  4EX5 A;  2UXC Q;  1YZ6 A;  1MJC A;  5FLX c;  1IXR A;  2Z6K A;  3ERS X;  4Y7N H;  3S15 H;  3NBH B;  3F1Z A;  3I4M H;  4X6A H;  2CQO A;  1OXX K;  2VUM H;  3I55 A;  2JEA I;  1YEZ A;  2ALY B;  4NPS A;  1VQM A;  4QL5 A;  3UE0 A;  2KEN A;  3L2P A;  3S17 H;  3T1Y L;  4IFD G;  4DV0 L;  3ULP A;  1HR0 W;  2K14 A;  1VQE A;  2IHE A;  1VQ4 A;  5IP7 H;  5IYC G;  4C3J H;  2I5M X;  3DLL A;  4IFD J;  4JI5 L;  3SGI A;  3ICE A;  1XNQ Q;  4B3R Q;  2GVB A;  2ZM6 L;  4LF4 Q;  4DV3 L;  1VQL A;  4QIW E;  5C44 G;  3KFU A;  1VQJ A;  2AHO B;  2QA4 A;  5IYB G;  1L1O B;  1J5E L;  2AKW B;  1G29 1;  4DUY L;  4O0A A;  1U0L A;  3F2D A;  4LF4 L;  2NVQ H;  4YWM A;  2L15 A;  2A19 A;  3CCL A;  3AFP A;  5M5Y H;  4MTN A;  2IX0 A;  4YCV A;  3CF5 A;  1Q8K A;  2E8G A;  4HJ5 A;  3KYH C;  4K0K Q;  3J80 i;  5M3M G;  1SN8 A;  2UXB Q;  2D0O A;  1FJG L;  1XPU A;  2R7D A;  1Y1V H;  2KHJ A;  4A3L H;  2GN5 A;  5AJ3 L;  2JEB I;  4YHH L;  5AJ3 Q;  1VQA A;  2E2I H;  4POF A;  4DAY B;  2MFI A;  3E9I A;  4A3E H;  5E7N A;  4BBS H;  4DR1 L;  1C9O A;  3H3V H;  3HOV H;  5C0X J;  3HOW H;  4X66 L;  4X62 L;  4JOI C;  3U4V A;  2UXC L;  1VQ8 A;  2C35 B;  5DLQ E;  1I3Q H;  3TQY A;  2Y0S E;  4A93 G;  1N32 Q;  3PUV A;  2ZJP A;  1SR3 A;  3M4P A;  1IBL L;  2JA8 H;  1EYG A;  1XTD A;  4B3R L;  3HOY H;  3J7A 5;  4OO1 I;  4NB3 A;  4P71 A;  3CCM A;  3CC2 A;  1PVO A;  5HGQ A;  3HOW G;  1XPR A;  1YNX A;  2RF4 A;  4R4Q A;  1SE8 A;  3NEL A;  1HZA A;  1K8A C;  3S2D H;  4DV4 L;  2KHI A;  1JT8 A;  3PF4 A;  1S3O A;  1YBY A;  2RHQ B;  4OXP A;  1K73 C;  3K0X A;  2PQA A;  3Q8D A;  4UPA A;  1Y1V G;  5GAE C;  2JQO A;  4C3H H;  4AYB G;  4A3I G;  1VQP A;  1N33 Q;  3AEV A;  1PH1 A;  3TRZ A;  3DM3 A;  1VQH A;  1TWA H;  1EQQ A;  1KC8 C;  1A62 A;  4XTC S;  2ZJQ A;  4LF7 Q;  4LW1 A;  4A3K G;  1VCI A;  4GNX C;  2ZTD A;  1PH5 A;  3EBE A;  3STB C;  1Q1E A;  1H95 A;  1HR0 L;  1BBU A;  1DGS A;  4BY1 G;  3CP0 A;  5FLM H;  4JI3 L;  3RN5 A;  2R92 H;  5C4X G;  2BA1 A;  3HOY G;  3U58 A;  1N34 L;  1X54 A;  2AWO A;  3G48 A;  1N32 L;  4JI0 L;  4BY7 G;  4GLA C;  4X64 Q;  2N3S A;  2VQF Q;  3PSI A;  3M9B A;  3CAM A;  4L5R C;  3CCJ A;  3J81 c;  4YWL A;  5FJ8 G;  1PH7 A;  3I7F A;  1GKH A;  1X65 A;  4DR1 Q;  4DK6 C;  2UUB L;  3PUW A;  4P74 A;  4LFC L;  4NXN Q;  3BU2 A;  4OWX B;  3KF6 A;  3J7Z C;  3CD6 A;  2VUM G;  1YVC A;  1YHQ A;  2UU9 L;  4BBR G;  1VQF A;  3JAM c;  1S40 A;  2A1A A;  2R93 G;  4JI7 Q;  4YY3 Q;  4UP9 A;  4DR5 Q;  2EIF A;  2OTJ A;  3OTO L;  5M3M H;  3H15 A;  4DV1 L;  2MQH A;  4JI1 L;  1VQG A;  3S1R H;  2E2H H;  1Q82 C;  4JYA L;  4TQU S;  3KJP A;  4P73 A;  2ZTC A;  5HY6 A;  3HKZ E;  4LFB L;  2Q2U A;  2JA5 G;  5C3E H;  1G6P A;  3FKI H;  2JA7 H;  1Q86 C;  1YJN A;  4A3F H;  1WCM H;  4NXM L;  1P16 A;  4GN5 A;  3S14 H;  4GLX A;  4DV2 L;  3G4S A;  4GKJ Q;  3T1H L;  2HIV A;  3PGZ A;  3D31 A;  2PMZ E;  4B3M Q;  2PQA B;  1K8G A;  1Z9F A;  2CWA A;  1Q81 C;  3S16 H;  3RLF A;  4B3T Q;  1KIX A;  2HHH L;  2AWN A;  4B3S Q;  1WI5 A;  2E2J H;  4A3M H;  4BA1 I;  1X6O A;  3PO3 G;  3U50 C;  4PZ8 A;  4JI1 Q;  3I4M G;  4DR3 L;  2YTV A;  2Q2T A;  3L7Z C;  1Y1W H;  2B63 H;  1V1Q A;  4R1J A;  5H1S E;  1YJ9 A;  4JC0 A;  1JB7 A;  1TWF H;  3MEF A;  3GTL H;  3KF8 B;  4JI4 Q;  2KCT A;  4KHP Q;  5JJI A;  1NMF A;  5GAH C;  2CKZ B;  4LF8 Q;  2I5H A;  4LFA L;  2MO1 A;  2Q2H A;  2UUC L;  1E7Z A;  1VQD A;  4R4T A;  1PYS B;  3CCU A;  4PZ6 A;  4X62 Q;  3H0G G;  1RL2 A;  3TEH B;  5IP9 G;  4P75 A;  1IYJ B;  1YI2 A;  4JI5 Q;  1G51 A;  4L5S A;  4YY3 L;  5LMN W;  4OO1 G;  3W1B A;  3HOZ G;  3GDE A;  2R7Z H;  1ASY A;  4NXM Q;  3HKS A;  3KF6 B;  1KRT A;  2VQF L;  2OTL A;  2JA6 H;  4DR2 L;  1XMQ Q;  4A3D G;  4YWK A;  4JI0 Q;  2KBN A;  2K5H A;  1JJC B;  4JBJ A;  1D8L A;  4LFB Q;  1NTG A;  3PUZ A;  1QZH A;  1FVI A;  1NY4 A;  4LFC Q;  3TRE A;  4DV7 L;  4IFD I;  3CCR A;  2D0P A;  1XNQ L;  4AQY Q;  3BZK A;  3JC6 6;  3ULJ A;  4AQY L;  4DR5 L;  1CKM A;  4DV6 Q;  1EIF A;  3ZJY C;  2VY3 A;  2LXK A;  3NEN A;  1E3P A;  3FP9 A;  4A3M G;  4JI8 Q;  3M3Y H;  5JJK A;  4RG1 A;  1Q1B A;  2F3I A;  1X3E A;  1SMX A;  4J15 A;  5IE8 A;  3OW2 A;  1HNX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...