4B3MQ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mQ00
2BH2A 5C3EH 3M85A 1PH5A 4LNQA 1OTCA 4LF6Q 1TXYA 1N9WA 1X3FA 3CCSA 4JOIA 1J5EQ 3J81j 1YNXA 1IBLL 5IYBG 2JK8A 2NVYH 3UDXA 4DAMA 2ZJRA 2FXQA 3AYHB 1VQNA 4B3RQ 3RLOA 1I50H 1IXRA 4A3KH 4A3GG 3TQYA 2JEBI 4QJFA 1I3QH 5M5YH 3VDYA 1YITA 3A0JA 3M4OH 3CMEA 4HIMA 1Y1WH 2H5XA 2ALYB 4L5SA 3I55A 3HOYG 2QGQA 1CSPA 1I5FA 1VQFA 1PA6A 2UXCL 4DV2L 5IYBH 2RHQB 3PF5A 2XTIA 4QGUA 4L5TA 1XPRA 4A3CH 2R6GA 4DV5Q 4YWMA 4A3DG 3J80c 2UXCQ 1G6PA 2AWNA 2ES2A 4IFDI 1Q7YC 2IHEA 1VQEA 2KHIA 2CQOA 3NENA 2R7DA 3CQZH 4OWTB 4LFCL 3U50C 1PYBA 1UE1A 3RR5A 5DLQE 1I94L 2BA0A 2JA7H 1XTDA 2R92H 3CAMA 1EIFA 3G71A 2Q2TA 2WB1G 3BJUA 4BY1G 4GN4B 3K81C 4X66Q 4JV5Q 3FHWA 1UE6A 2CFMA 2ZTEA 4DV6Q 1EWIA 4JBJA 3T1HL 4IJHA 4C2MH 3GTKH 3ZJYC 4A3IG 1FGUA 1GM5A 2K5HA 4OWWB 2JQOA 3CW2C 2ID0A 1N34L 4A3CG 5C0XI 1DGSA 1Q86C 2R93H 3H0GG 5IP7G 2E8GA 2KCTA 1NE3A 3S2HH 3T1HQ 1X9NA 4GKKL 4A3MH 1XNQL 1PH7A 2BH8A 2HT1A 1W3SA 2I5HA 3EIVA 1HR0L 5IYDG 3GD7A 2KENA 4LFCQ 1NBWA 4POFA 1HNXL 2CWPA 4P71A 3K0XA 1KRSA 2AMCB 4KHPQ 2I5LX 1HR0Q 3S1RH 1PFSA 4UP8A 5JJIA 3HOUG 2WFWA 4DV1L 4GNXC 4KLKA 5IY0A 5GAEC 4A75A 4LF9L 4DK6C 3CCJA 2HHHQ 3GDEA 3ICEA 4C3HH 1PYSB 1PH6A 1PH8A 3A74A 3GTLH 4GKKQ 2K5VA 1Z47A 1K9MC 1N33L 1X6OA 2OTLA 4MNOA 4UPAA 1WCMH 1KRTA 4BBRH 1K0RA 1EUJA 1XPUA 3I56A 4BBSG 1HZCA 3CMAA 5GADC 5C4JH 3W1BA 4B3ML 1MKHA 1JB7A 4YWLA 1EYGA 3CC2A 1IBLQ 3CPFA 2PNHA 1OXUA 1X54A 5FLXc 1B70B 1J5EL 4JG2A 4YWKA 5IYCH 5LMNW 4DR6Q 2Q2IA 3PO3H 3CCQA 1BVSA 1SRUA 1VQBA 4Y52H 2NN6I 5FJ8H 3GTPH 4X65L 4PZ7A 2R7ZG 4QY7A 1N32L 1PH1A 1PV4A 3I4MG 3HKZE 4NXNQ 4DV4L 3HOZG 2N3SA 2IY5B 1E22A 2LXKA 4IO9A 3OYYA 1NMFA 1CUKA 1S40A 4HJ8A 4DUZL 1TWHH 4DUZQ 4O0AA 3D0FA 3HOXG 4LUZA 5BR8L 4Y7NH 1TWGH 2KBNA 1E1TA 4OONA 4AYBE 4GOPA 1XNRQ 2K14A 2YTXA 4NXNL 1EOVA 3STBC 3CCEA 2CCZA 2YU9H 4GLVB 1JT8A 1M90C 3L0OA 2K4KA 2UUBQ 4YCUA 1CKOA 2I0QA 4KHZA 1X55A 5AJ3L 5C0XJ 2JE6I 2UU9L 2VUMG 4BXXH 2LXJA 1UWVA 3CCRA 4LF5L 4LF8Q 4HJ9A 1VQJA 2Q2UA 3IRBA 5K36G 3AFQA 3HOUH 1T9HA 3S15H 1L1OB 4J15A 1FVIA 5GAGC 1Q46A 5C44G 4OXPA 1JJCB 1QVGA 2A19A 1P16A 4JI1L 4GLXA 1VQ6A 1WJJA 4B3MQ 3AEVA 1AH9A 1Y14B 4DR4L 1G51A 3M4PA 1VQ5A 2DUDA 3FKIG 4UY8C 3BZCA 1HZBA 1C7YA 1S3OA 1WOCA 2HIXA 3F8TA 4NB3A 1FJGL 3KLWA 2RCNA 2VS1A 1K8GA 2VL6A 3DM3A 5J3BA 4DV1Q 4LF9Q 4EQ5A 3F2BA 3PIOA 1TWCH 3KDFA 2IT1A 2IX1A 2OTJA 3PF4A 1PH2A 4LF7Q 1SMXA 4PMWA 4JI2L 3UDGA 1HNWQ 4A3LG 1OXSC 3I4NG 1FL0A 2E2JH 5EAYA 1A8VA 2Z0SA 4TQUS 3I4MH 1EIYB 4IFDG 1LYLA 3I4OA 4YY3L 1FJGQ 4JBKA 4OO1I 2ZJQA 4DR2Q 2E5LQ 5M5XH 1YIJA 2OCEA 1P8LA 2MO0A 1SROA 2UXDQ 3HOWG 2JA6H 1Q1BA 3H0GH 4GOPC 3NELA 1JJ2A 4DR3L 2JA8H 1IYJB 2JA5G 3KOJA 4AYBG 2UU9Q 4LUVA 1Y1VG 4R4OA 1YHAA 1XMQL 5E7NA 4JCVE 3I4NH 4LF4Q 4MTNA 3T1YQ 3W5OA 1PH4A 3HKZG 4YHHL 2NVQH 1VQ4A 4DV0Q 3J81c 2HQLA 1N36L 4LFAL 1V1QA 3TREA 2ZM6L 3F2CA 3ULLA 5JJLA 2I5MX 4DR1L 4A93G 4TVAB 3GTQH 4RG1A 2BA1A 1LM0A 4DV4Q 4HJ5A 2D0OA 4A3JH 4POGA 3S1QH 1X56A 4A4IA 1HR0W 4X6AH 3E0EA 1XMOL 3HOZH 4PZ6A 4H02A 4X65Q 2MFIA 4DV2Q 4HIOA 5HGQA 1UEBA 1U5KA 5C3EG 4YHHQ 4YCVA 2WAQG 4DR6L 4DR5L 1OXVA 4JI0L 5HY6A 2UUCQ 2AKWB 2VW9A 2ATWA 2RHSB 3PUWA 1GO3E 4JOIC 3TEHB 3G4SA 2N8NA 3MEFA 4GN3B 4A3LH 3RNUA 1U0LA 3BZKA 3U58A 1S72A 3K7AH 3CD6A 4R4CA 5FLMH 4HJ7A 2N49A 5C44H 1Q81C 4JBWA 3KFUA 3UDIA 2MQHA 1SN8A 4A3MG 1D8LA 4WJ3M 4IJLA 3F1ZA 4O2DA 4WJ4A 4JI4L 4JI6Q 2PQAB 3J80i 2ZTDA 5M3FH 3D31A 1A0IA 3I7FA 4HIDA 5IWAL 4ALPA 2UXBQ 2ZTCA 4KI0A 4DUYL 3ER0A 1MJEA 4AH6A 2YTYA 1HNWL 4RMFA 4JI8Q 3S2DH 4DV3L 3RZOH 4KHPL 4AIMA 4X64Q 3CP0A 1L2FA 2GVAA 4DR7L 4DUYQ 1X3EA 3FP9A 2YV5A 3J81i 1A63A 1YVCA 4JC0A 4R4IA 1ASZA 4GN5A 4BA2I 1WI5A 3W1GA 4PG3A 4A3BG 2L15A 3GTOH 3M7NA 1VCIA 1CKMA 3U4VA 4JI6L 2PI2E 2VUMH 4GS3A 5IP7H 3PUZA 2MNAA 3HOVH 1KC8C 3CCLA 2NZOA 4JI1Q 1IBKQ 4JI5L 1GVPA 1N34Q 4A3BH 2B29A 2MO1A 4BA1I 4X62L 4JI7L 1NJIC 2A8VA 3GO5A 3KDFB 5IE8A 4DV6L 1HJPA 4IPCA 2C35B 4JI3L 2GN5A 5GAHC 1KHIA 3EN2A 3RZDH 1XPOA 2E2IH 2UUCL 1WYDA 4DR5Q 2R92G 3HKSA 1H95A 1LUZA 2NVTH 5H1SE 1K83H 4X64L 2B63G 4DV3Q 2DGYA 5M3MH 2VNUD 1E7ZA 2K5NA 1I94Q 4NPSA 1HZAA 2OWOA 1NMGA 4UP7A 5FLMG 1C9OA 1HZ9A 3PUXA 3HOXH 4BBSH 1KXLA 1WCMG 4B3TQ 1TWFH 1VQ8A 1GKHA 3AFPA 4MZ9A 3CPWA 1B7YB 2R93G 5JJKA 1I6HH 3HFZB 3HOYH 2ZM6Q 1KD1C 5M5WH 1Q12A 1Y1WG 2F52A 1C0AA 2KHJA 4DV7Q 1TWAH 1E3PA 2NN6G 3PSIA 1YJNA 3TRZA 4A3EG 4R4TA 3STBD 4A3FG 3KF8B 3A5UA 3PO3G 2HIVA 1RL2A 2R7FA 3KF6A 4LF4L 4NXMQ 2JEAI 1L1OA 2Y0SE 5IYDH 1CKNB 4JI7Q 1X3GA 3RLNA 3BU2A 2NVXH 4XTCS 4OWXB 2CKZB 4JI5Q 1IBKL 3H3VH 1BKBA 3KJOA 3S16H 4DR3Q 4L5QA 1K73C 1SLJA 3J7ZC 1KQSA 4LF6L 3NBHB 1MJCA 4LFBQ 5IP9H 4IPDA 5M3FG 4DV7L 2UXDL 4P72A 4BY7H 2VQFL 1VQAA 4DR2L 2E5LL 4A3JG 1XMOQ 4IOAA 4GKJQ 1Z9FA 4B3SL 2V1CC 1YEZA 2A1AA 1Q1EA 1QUQA 2RF4A 2WAQE 5JEAJ 4A3IH 3AQQA 4B3TL 4JBMA 3GTGH 4P75A 3KYHC 1NY4A 4DK3C 2VY3A 4L5RC 4DR7Q 3CXCA 4OO1G 4LFAQ 4A3DH 4DAYB 4OX9Q 4GNXB 4EX5A 4C3JH 5ELNA 2PI2A 4BXXG 3E9HA 4LWCA 3H15A 1O7IA 3ULPA 2ZJPA 1YZ6A 2UUAQ 2AWOA 2K50A 1QUQB 3M9BA 4UP9A 4AQYQ 3S17H 3S1NH 2LSSA 2OQ0A 3EBEA 1BBUA 4FDBA 1SE8A 1K8AC 1VQMA 4JYAQ 3I2ZA 5LMNL 2N78A 4R1JA 1J6QA 4QQBX 2F4VL 3S1MH 1NTGA 2JA7G 2WP8J 3CCVA 3PO2G 1QVFA 1HNZQ 2KCMA 5LMUQ 2NZHA 5LMNQ 2Z6KA 3RN5A 4XIGS 2ASBA 1CKNA 3DLLA 1EFWA 1AE3A 1CSQA 5ELOA 4BBRG 3M4QA 2EIFA 1YHQA 3KF6B 1W2BA 1YI2A 1N8RC 5IYCG 2QA4A 4JI0Q 3S14H 2B3GA 1QZHA 3K80C 3A5ZB 3E9IA 4JI2Q 3UDFA 3MXNB 4QIWE 3TS0A 4OX9L 4JI8L 2D62A 2F3IA 3Q8DA 1QVCA 4YCWA 5BR8Q 3L2PA 1EQRA 4DV5L 2JA5H 2R7ZH 4IFDJ 1OXXK 2B63H 1IBML 2OQKA 5IWAQ 3RLFA 1VQ7A 2UXBL 1YJWA 1HH2P 4DKAC 1PVOA 1G291 1YBYA 3HOWH 4DR1Q 3FKIH 1N32Q 1VS0A 1K3RA 1BBWA 3NEMA 4LW1A 1Y1VH 4JI4Q 2YTVA 4DR4Q 3H3VI 3L7ZC 4P74A 3CF5A 3PGZA 3U4ZA 1RIPA 2K52A 1X65A 4B3RL 4LFBL 5IT9c 5JEAG 2GVBA 3JAMi 3JC66 3OTOQ 1VQ9A 3TS2A 2JA9A 1XMQQ 3HOVG 3S24A 1YJ9A 3PIPA 2PMZE 4NXML 1UE7A 4A93H 1M1KC 5IP9G 1A62A 3K8AA 2WB1E 3OTOL 1YHBA 1R9TH 3CC4A 1JE5A 1IL2A 5C4XH 1XJVA 5M3MG 3PV0A 4K0KQ 1N33Q 2VZAA 3OW2A 1UE5A 1SR3A 2Q2HA 2JA6G 1XNRL 1JJGA 3UE1A 1IBMQ 2XGTA 2CWAA 2K75A 4C3IH 4IPHA 1GD7A 1JMCA 3GTMH 3SGIA 1D7QA 2D0PA 3KJPA 3RN2A 5C4XG 1V43A 2VQEL 5GROA 4A76A 1PH9A 1HNXQ 2Z6KC 5GQOA 4LF7L 1N36Q 1VQGA 2Y0SG 4BY1H 4IPGA 1L0WA 2JJQA 4DV0L 4QL5A 1VQPA 3PUVA 2EQSA 4DNIA 1PH3A 1PHJA 3T1YL 1WFQA 3LGJA 5LMUL 4GOPB 4JI3Q 3CCMA 3G6EA 4A3KG 2EXDA 4X62Q 3PO2H 1E1OA 5C0XG 3ERSX 1HNZL 1QZGA 4GLAC 4JYAL 4DPGA 2IHFA 3UE0A 4APVA 4BY7G 1OXTA 1LTLA 1KL9A 3J7A5 2YYZA 2F4VQ 4ME3A 3PUYA 1VQKA 4X66L 2HHHL 4JV5L 2IX0A 4K0KL 1KAWA 5FJ8G 1EQQA 2UUAL 4LF8L 3M3YH 3JAMc 3PCOB 4LF5Q 2JA8G 4YY3Q 2QEXA 5AJ3Q 1KIXA 2E2HH 3GTJH 1Q82C 1AE2A 4AQYL 4HJAA 4GNXA 2UUBL 3WWVA 1B8AA 1MIUA 3G48A 1Q8KA 1VQLA 4R4QA 1VQDA 3ULJA 3F2DA 2VQEQ 1VQCA 4LUOA 1VQIA 1V9PA 4A3EH 4A3FH 1SFOH 4IOCA 4B3SQ 2PQAA 4GKJL 4A3GH 1IZ6A 3B6YA 3K7UC 1E24A 1VQOA 1ASYA 1XNQQ 2AHOB 1L1OC 4PZ8A 3CCUA 3CC7A 1VQHA 4HIKA 4P73A 2VQFQ
chains in the Genus database with same CATH superfamily
1HUNA 2C9OA 5C3EH 4HMJA 1H9JA 1II3A 5E4WC 4LNQA 4G7OC 5T1GA 2F0QA 3K58A 1YNXA 4M1UB 5IYBG 3UDXA 2BCOA 4A3GG 4A3KH 3GTMB 4UDUC 4HIMA 2NTTA 5LHY1 2H5XA 1LTID 3P75A 3HOYG 5IGDA 1B53A 1I5FA 2XVSA 5CGKA 4OELB 4DV5Q 2F0IA 4EQPA 4K8JA 4XDXA 2AWNA 4CJ0B 2FMMA 1BXTA 2R7DA 4OWTB 3U50C 1PYBA 2SEBD 3I8ZA 3IFTA 1H9MA 2D5DA 3QOLA 2PPBC 1NUCA 2I07B 3OHXC 3K81C 4X66Q 4JV5Q 5C4HA 4CDEC 5ELBA 4DV6Q 1RCVD 4JBJA 3T1HL 3VR2A 3TP6A 2K5HA 2NZ1D 4KTAA 4OWWB 2JQOA 4DU9A 1N34L 4A3CG 3M3YB 1WTHA 2R93H 1EQTA 5FO9B 3S15B 4J8QA 3TZDA 1PH7A 3S2DB 2HT1A 3EIVA 3ND9A 3E5SA 4HAEA 5KYIA 2IWHA 1HNXL 5DEHA 2CWPA 1CFMA 5LL6X 2I5LX 4UP8A 5JJIA 5C3EB 2RBMA 1O80A 4OIKA 4KLKA 5IY0A 3TDQA 4DK6C 3EJIA 3GDEA 4C3HH 1PYSB 1PH6A 1PH8A 2LMCB 4DNRB 3GTLH 2LKVA 1N33L 4UPAA 1F2YA 1EL0A 4BBSG 3URYA 4A3KB 1GXDC 5I6YA 1IBLQ 4V190 2ENBA 3IL8A 2F0FA 1J5EL 5LMNW 2Q2IA 1SRUA 5FJ8H 1TIID 2TMPA 3K0YA 4NXNQ 3HOZG 1RTOA 2N3SA 5EKKA 2IY5B 5M5WB 1QNUA 2B39A 2J0TD 4HJ8A 4R9WA 2KBNA 5JEAH 4AYBE 1XNRQ 5IGBA 1SYBA 2JSOA 1M90C 4FXDA 3LWUA 2PW5A 4RGOS 1VQJA 1CM9A 4U673 1K8MA 3BDOA 5K36G 3S15H 1T5EA 1Q46A 4GLXA 4G7HC 4RAUC 3M4PA 3NWTA 2DUDA 3VR3A 3BZCA 2HIXA 4NB3A 4RCNA 2VS1A 5C44B 4ZRZA 1K28A 3K57A 3QO2A 1A15A 2IX1A 4P2CB 3PF4A 1TQOA 2RVLA 2V4DA 4LF7Q 3I4NG 1STBA 2E2JH 3BZDB 1GHJA 3I4MH 4IFDG 1FJGQ 2ZJQA 4DR2Q 2E5LQ 4A3EB 2A69C 1YIJA 1KLUD 1S5DD 1B44D 1SROA 2UXDQ 3OIQA 4GOPC 1MSHA 1JJ2A 3NTKA 1SEBD 5T1IA 4LF4Q 2LS01 5EPKA 5C5LA 3W5OA 2EY5A 3HKZG 4PV1C 5KNBA 3J81c 2HQLA 1B4OA 1EZ6A 4LFAL 3F2CA 2JYOA 1LM0A 4K6DA 4DV4Q 1QE6A 1NNXA 4X6AH 4X65Q 3VYTA 4DN4M 4DV2Q 4DFAA 2OXPA 4DR6L 4DR5L 1LV9A 1VF7A 3PUWA 1GO3E 1G8ZD 4GN3B 2F3VA 1R9TB 3DUZA 3ZYYX 3K7AH 2JA7B 4R4CA 1BF4A 4HJ7A 4WFN3 5C44H 1L0YB 2EJMA 3HS0C 4JI6Q 3J80i 1A2UA 4R8NA 4X3UA 2XN9C 5IWAL 3I4MB 3ER0A 4TSSA 2K1BA 4A3MB 3NXWA 4BY7B 4G57A 2FINB 2RKSA 4QB4A 3ITPA 4HTHA 4I7AA 4DUYQ 4DR7L 2F0WA 2F0OA 4JC0A 1WI5A 2DJFC 3W1GA 3Q22A 3GTOH 3A8KE 3U4VA 3DWQA 2PI2E 2ICIA 2K01A 3VYSA 4QMGA 3HOVH 3H94A 4JI5L 3J80L 5ELCA 1S5ED 4A3BH 1G2TA 2CHBD 3GO5A 5IE8A 1HJPA 1VMCA 4IPCA 2GN5A 1PZID 1WYDA 3O13A 3MXNA 1VMPA 2DNEA 5I4DA 1PTOH 1I94Q 5IGEA 1HZ9A 1WCMG 2EOTA 3S14B 4RGTA 3HFZB 2BDNA 1KD1C 5EGTA 1EYAA 1Q12A 1C0AA 2KHJA 1AZPA 3X3MA 2NVYB 3KF8B 2HIVA 1GJXA 3HOWB 4G7ZC 3KLSX 5D14A 1CKNB 4XQQA 4OWXB 2CKZB 3S16H 3KJOA 4AYBB 1SMYC 4DV7L 2P5ZX 4BY7H 1IKMA 3OSOA 3VA7A 4A3JG 1Y8NB 1BCPB 1YEZA 3I72A 1QUQA 2RF4A 4A3IH 4B3TL 4P75A 4DK3C 5BN4A 4DR7Q 2VY3A 4UAIA 4L5RC 2O2LD 4A3DH 4CJ1B 3IAYA 4TRDA 4C3IB 3E9HA 3R2TA 1J8IA 3M9BA 2E74C 4JVZA 3S1NH 4KY7A 4FDBA 4ULLA 4ODGA 3S2HB 1RDPD 5LMNL 2N78A 3C46A 2BOSA 4C3IG 4QQBX 3GV6A 2F4VL 1DCZA 1HNZQ 1EY0A 2NZHA 1PTOB 2Z6KA 3RN5A 3DLLA 2B2TC 5KEEA 1QILA 3NBHA 3TP8A 1W2BA 1Q90A 4OIJA 2J7ZA 1N8RC 4OGQC 1RTNA 3S14H 2MHVA 1QZHA 1JOKA 1UAPA 4B08A 1DONA 2K5QA 3MXNB 4QIWE 4JI8L 5BR8Q 2F3IA 2EY2A 3L2PA 1ICWA 2B63H 3D8GA 2OQKA 2UXBL 1PVOA 4DKAC 1G291 3HOWH 4DR1Q 1N32Q 3QWNA 1VS0A 1K3RA 1BBWA 2YTVA 1ML0D 4CDFC 2IL8A 4LMQD 3HOZB 2K52A 1X65A 2EY6A 5JEAG 3JAMi 1BO0A 3OTOQ 2JA9A 4XQNA 1B3AA 1YJ9A 3PIPA 3EQLC 1M1KC 2Z8LA 4RH6A 3K8AA 5IP9G 3CC4A 1ONLA 1IL2A 5C4XH 2XNAC 5M3MG 4K0KQ 2VZAA 3OW2A 1UE5A 1F2ZA 3KUPA 1I4GA 3BVMA 4N8FA 4Y7NB 1XNRL 1JJGA 4NMZA 1K8OA 3W2DA 2K75A 4C3IH 1JMCA 3KLRA 5F2DA 3SGIA 1JORA 1ILPA 1D7QA 3RN2A 2B2TA 2VQEL 3S1NB 1IYVA 5GQOA 4LF7L 5IGCA 2PCFB 4BY1H 2JJQA 2PW7A 3D3RA 1YNJD 3PQIA 5A2QE 1HCZA 3T1YL 2Z9HA 1QB5D 3QOJA 3G6EA 2EPBA 4A3KG 2MUYA 5EBCA 2RDFA 1S4ZA 1E1OA 3V2TA 4DPGA 2IHFA 3MHBA 3SK8A 4BY7G 1LTLA 2VUMB 2WV6D 4C2MB 4KHVA 5FJ8G 1TVXA 4YY3Q 5AJ3Q 1KIXA 3GTJH 1Q82C 4QCLA 4QUFA 1EU3A 1B8AA 4KD3A 1MIUA 4DA2A 5JVG3 4C3JG 3SK5A 1Q8KA 3T51B 5CBEE 1PXUA 4LUOA 1V9PA 5A35A 5M5XB 1DOMA 3CU7A 4RKLA 4XT3B 1CA5A 1NR2A 4RCOA 1E24A 4MN3A 2AHOB 1CZGA 1L1OC 1EYDA 3TMEA 5JPMC 1X3PA 4P73A 2VQFQ 3OMGA 2K5WA 2F1MA 5IT9E 3HP3A 3J80E 4FYDA 1EQVA 1BCPD 3DMUA 4ZLTF 1N9WA 2N55A 5I2XA 4JOIA 2HCCA 1J5EQ 1TWAB 3J81j 1IBLL 3DM1A 4DAMA 2CVRA 2FXQA 3OMCA 4B3RQ 1AP0A 1IXRA 3GTQB 2MPMA 4QJFA 1I3QH 2F03A 1YITA 1LT6D 3K5OA 4IZ8A 1Y1WH 4F8MA 3I55A 2QGQA 1PA6A 2UXCL 1VQFA 3E6ZX 3VA5A 5IYBH 2RHQB 4DV2L 1XPRA 3QJYA 4A3CH 2CW0C 3G6JB 4IFDI 1Q7YC 4ZKBB 1CHPD 3NENA 4LFCL 1UE1A 5DLQE 2BA0A 2AQ1B 1XTDA 1R4PB 1TWHB 3CAMA 3G71A 4BY1G 1ZYRC 4YIJA 3D6WA 1TR5A 1EWIA 1ZYRD 2EVBA 3BDCA 4C2MH 3ZJYC 3CW2C 2ID0A 1Q86C 3GTJB 1EWCA 3MVVA 3T1HQ 1LT4D 1X9NA 4GKKL 1G91A 1IYUA 2BH8A 1J9OA 1HR0L 3FRPB 5JAVA 5IYDG 2KENA 1NBWA 5EKIA 1KDBA 3K0XA 1SNDA 3S1RH 5EJWA 2WFWA 4H44C 5FO8B 2NTSA 4ILWA 3A74A 1Z47A 4FF1A 2Z1CA 3I56A 3V05A 5C4JH 4B3ML 3K5NA 1JB7A 1B9MA 1SYDA 3CPFA 1TS3A 1OXUA 4YWKA 4DAVA 3MXUA 5JOBA 3CCQA 1RF2D 1VQBA 3J7AV 4X65L 3BS1A 1LACA 1N32L 1PV4A 4Q5VA 4DV4L 1JOOA 1UEAB 3WOEA 2O5JC 1CUKA 1ET9A 4IQZA 1PRTD 1TWHH 5ELFA 1STNA 1E1TA 2ZXPA 4NXNL 2CCZA 3CCEA 1HFNA 1B2TA 5FLXE 1BR9A 1JC7A 2JE6I 2UU9L 2LXJA 1UWVA 4LF5L 3BG3A 1E0BA 2F0MA 1L1OB 5GAGC 1FVIA 4HSVA 4J6HA 4OXPA 1P16A 1GHKA 3AEVA 4K5VA 4CJ2C 4N9TA 1AEXA 1Y14B 2WKCA 3FPPA 1U4PA 4UY8C 1C7YA 4IUTA 2R3ZA 1FJGL 2RCNA 1XYIA 1DD2A 5J3BA 1Q3LA 1UNSA 3PIOA 3F2BA 1JQYD 2OTJA 2DN8A 1FNVA 1PH2A 1SMXA 1ZEQX 1HNWQ 3UDGA 2E2HB 1EYCA 1STAA 1FL0A 1A8VA 1R4QB 1SJHD 1LYLA 5I2YA 4JBKA 1FNWA 2F0HA 5C4JB 4OO1I 2QDBA 2A6HC 4L63B 1GUTA 2OCEA 2MO0A 4A3GB 3H0GH 5JPNC 2B8GA 1M4VA 2UU9Q 1YHAA 1XMQL 5E7NA 3EROA 1STGA 2EXZA 1PH4A 3PMFA 4KJOA 2JA5B 1HPCA 2NVQH 1FR3A 2O4XA 3T56B 1N36L 2B2UC 1JWMD 1V1QA 3D4RA 3TREA 4E6IA 5FKAC 1BNZA 3SK6A 2H4OA 4RG1A 2BA1A 1SNMA 3AU7A 1T5XD 3Q0AA 1JB3A 1IW7D 1XMOL 5HURA 5M3MB 1ILQA 1SMYD 1X3QA 5IODA 3BVZA 5J1ZA 2FFKB 4ZYSA 5JJLA 4JI0L 2UUCQ 4IOAA 4JOIC 3G4SA 2B2VA 4C1NI 4A3LH 3RNUA 1WD0A 2KCNA 1S72A 2VB2X 5FLMH 3N52A 2FHTA 3P20A 1Q81C 1SE3A 3KFUA 2AUKA 3UDIA 1PZKD 1SN8A 5LL6S 4IJLA 4BWGB 1EY9A 2PQAB 1HQRD 4F87A 3I7FA 2F0TA 2ZTCA 3IFDA 4KI0A 4DUYL 1MJEA 4AH6A 3FEWX 3S2DH 5NUCA 4DV3L 4KHPL 2LFNA 2I46A 1L2FA 1PTOC 1F2MA 3H0GB 1PTOD 2SOBA 1W6KA 2F0PA 4BA2I 1JE4A 2PO4A 1TT2A 3OIPA 1I4QA 1D1IA 1HHVA 1D1KA 1ENAA 4GS3A 1KC8C 3CCLA 1A6XA 4C3HB 1IBKQ 4NKLA 3S17B 3GTLB 2NVQB 1ENFA 2EJGC 3WOFA 1V1OA 3VYUA 2A8VA 3KDFB 2ZXRA 4QF4A 3Q23A 2HDLA 4JI3L 3H91A 2UUCL 4DR5Q 1LABA 1H95A 2AQ2B 2NVTH 3QIAA 5CYUA 1V1PB 4X64L 5M3MH 4OEMB 3QG1A 3SK4A 1HZAA 2OWOA 1YNND 4UP7A 3ERQA 1W6JA 1LTTD 1TWFH 2FMCA 1VQ8A 3AFPA 4B3TQ 1B7YB 5M5WH 2HDMA 1PFMA 4FP5D 1HUMA 4FXKC 4DV7Q 2NN6G 3PSIA 1BUVT 3STBD 1KABA 2XIWA 2Q8IB 3KF6A 3VR6A 1NCVA 4NXMQ 2AQ3B 2Y0SE 4JI7Q 1X3GA 2KJXA 3F2UA 5EKLA 1SE4A 1AW7A 4V0BA 1BKBA 3J7ZC 4LF6L 2EZVA 3MC0B 5IP9H 5ELEA 1GUWA 2EYFA 1E2ZA 2AUJD 2Z4IA 2OF1A 4DXGA 3CQZB 2WAQE 5JEAJ 1CQFA 3CXCA 4OX9Q 3U9OA 5FLXL 3J7AF 2PI2A 4KY6A 5E3FA 4LWCA 2L0CA 4K5WA 3H15A 3ULPA 3AMUA 2AWOA 2K50A 4AQYQ 3R8BA 3S17H 2LSSA 2J4XA 5TSSA 2WAQB 2E2JB 2E76C 4JYAQ 3I2ZA 5KRUA 2A6HD 1NTGA 2WP8J 3PO2G 4WORA 4KN4C 2A69D 2KCMA 4CBVA 2G9DA 4XIGS 1CKNA 3JAML 1EFWA 1F9PA 1AE3A 5ELOA 4BBRG 2EIFA 4CDCC 3Q6SA 1YI2A 1TS2A 3ONAB 2B3GA 1BCPC 3E9IA 3FDTA 4JI2Q 4FF3A 3TS0A 3A7AB 4KN7C 2R7ZH 3Q8DA 4IFDJ 2SNMA 1OXXK 1XX8A 2X69A 1U4MA 3E3XA 2IJ0A 1IKLA 3IKJA 4FF2A 4LW1A 5G3LD 4DR4Q 3H3VI 4P74A 3MTSA 3U4ZA 4LFBL 1RIPA 3GP7A 3VYRA 3QR8A 4DGZA 1F9RA 4TKOB 4EVOA 4A93H 2O5IC 1A62A 5CV4A 1TS5A 2WB1E 1R9TH 2A74C 2Z6BA 1F9SA 1JWSD 3UE1A 1IBMQ 2CWAA 4DK0A 1V8QA 2G5DA 2RSNA 2OT2A 2L12A 2QEJC 3E0JA 2NUCA 1PH9A 3I90A 4JK1C 1N36Q 4Q0FA 4IPGA 1L0WA 2EQSA 1B1ZA 1PH3A 1PHJA 1WFQA 1NAPA 1WVLA 1CA6A 1SNCA 2BE5D 4GOPB 1JICA 4O42A 3CCMA 4HMIA 4MHEA 3D4DA 1STYA 1QNKA 2EXDA 4X62Q 3PO2H 1K0SA 5C0XG 3BYTB 5DM73 2EDGA 3UE0A 2F0JA 2Q8TA 2L4NA 3M4YA 2HHHL 1KAWA 1EQQA 1SNQA 4LF8L 2R7ZB 2QEXA 1EY5A 1AE2A 4AQYL 4PMCA 4HJAA 4GNXA 3CRKC 4A3BB 2UUBL 3QB3A 2F0KA 1VQLA 2MJ8A 3ULJA 3F2DA 1VQCA 1S5CD 4PNYA 4A3FH 1SFOH 1B9NA 3A56A 2PQAA 4GKJL 4KKTA 3SVMA 1VQOA 1CK1A 3MXGA 5C4ZA 4KJNA 3SDZA 1KTKA 4A93B 1ZXTA 2BH2A 3I4NB 2QW7A 4OL7A 1PH5A 4K6LA 1OTCA 4LF6Q 1TXYA 2K03A 1X3FA 2JK8A 2NVYH 2ZJRA 1E2VA 3P1HA 3RLOA 1EIHA 1I50H 3TQYA 2JEBI 4K8IA 1QJOA 3OWFA 4L5SA 3S16B 3PF5A 4QGUA 4HEDA 4L5TA 2R6GA 4A3DG 2XRSD 1G6PA 2ES2A 2IHEA 1VQEA 2CQOA 4A3IB 3MZ5A 3T53B 3KBXA 3PO2B 4JPBW 1I6VC 1WTVA 2Q2TA 4A3DB 2TSSA 3I70A 2N88A 1GOZA 1U9RA 1O7ZA 1UE6A 2CFMA 2L5TA 3NSWA 4K2LA 1XTCD 1QCBD 1I4XA 1PFBA 5C0XI 1DGSA 3H0GG 1QG7A 1EZ8A 2E8GA 2JP1A 2KCTA 1NE3A 3S2HH 2EYHA 2NB0A 3I73A 4H13C 1XNQL 3UI2A 3FMCA 3NTHA 1SFOB 1YNJC 2RDHA 1AN8A 5C3XA 3TZUA 3GD7A 2X6GA 4POFA 4S3SA 2CH4A 3K59A 4P71A 1LTBD 1KRSA 4KHPQ 4LK1C 4HCSA 1HR0Q 1PFSA 4GNXC 4LF9L 2B2WC 3A54A 3CCJA 2HHHQ 3BVGA 1HQMC 4GKKQ 2K5VA 2B63B 4QIWB 2OTLA 1KRTA 4FNFA 2L55A 1XPUA 1HZCA 5GADC 3W1BA 4XYOA 4YWLA 3L9AX 2PNHA 1X54A 5BN5A 4JG2A 5IYCH 2H1EA 4DR6Q 4BBSB 3I91A 1BVSA 3HOXB 1SSOA 2Y0SB 3DHQA 4QY7A 4IUVA 2R7ZG 3I4MG 1LT3D 5K36H 1I6HB 4RHRA 2LXKA 5CORA 4MIUA 1NMFA 4DUZL 4DUZQ 1ESFA 1CT1D 3D0FA 4J1MA 4O0AA 4LUZA 5BR8L 4Y7NH 3HOXG 1TWGH 4OONA 1MI2A 3RUZA 2YTXA 1EOVA 1U4RA 2K4KA 2UUBQ 4A3JB 4OHJA 4YCUA 1SE2A 2NVXB 1STHA 2I0QA 4LF8Q 4HJ9A 5KIXA 2Q2UA 3IRBA 3AFQA 1T9HA 4NDXA 3U9SA 5I6WA 5C44G 3NWSA 2BE5C 1I4HA 2A19A 1CTMA 3MA2B 4JI1L 4CKCA 4M8AA 1WJJA 3NBIA 1VQ6A 1AH9A 4KY5A 1PRTF 1DM0B 4DR4L 4RGMA 3EFXD 5CV9A 1HZBA 2KEDA 1K8GA 2KQ3A 4CKEA 4DV1Q 1KLGD 3HZXA 3SXHA 4JI2L 4CKBA 5M3FB 3LNNA 4A3LG 1OXSC 5EAYA 1EIYB 4YY3L 3RD4A 1JCKB 5M5XH 1P8LA 1LTAD 1Q1BA 5ISRA 3NELA 5CV7A 2JA8H 1IYJB 2JA5G 3KOJA 4AYBG 3H6MA 4K5XA 1SAPA 1HA6A 4NP5A 4MTNA 3TP7A 4MTKA 2DJGC 3T1YQ 1MBYA 4YHHL 1VQ4A 1TWGB 1DXMA 3SHLA 3ULLA 4IUUA 3NE5B 4A93G 3GTQH 2WB1B 1I3QB 2R61A 1IL8A 4HJ5A 2D0OA 2QKIC 4A3JH 3S1QH 1X56A 4A4IA 4H0LC 4H02A 5IGFA 1CI3M 2KUMA 3MEHA 5C3EG 4YHHQ 2WAQG 4K0KL 1OXVA 5HY6A 2AKWB 2ATWA 2RHSB 1GUSA 2N8NA 3MEFA 1SNPA 5COYA 4RKBA 3CD6A 1SNOA 4HSPA 3K5LA 1FGBD 2F0UA 1Y8OB 2MQHA 2MP1A 4A3MG 1D8LA 1S5BD 3X3NA 2ZTDA 2BDOA 5M3FH 4H7BA 3D6CA 4ALPA 2UXBQ 2YTYA 1HNWL 4RMFA 4JI8Q 1LT5D 3RZOH 1H9RA 1NSNS 4RHSA 3CP0A 1X3EA 5CBAE 2PZUA 2YV5A 4F7XA 3J81i 1YVCA 2JA8B 4R4IA 4GN5A 4A3BG 2L15A 3M7NA 4C3JB 3S1RB 2A68D 4JI6L 2JXMB 2IW3A 5IP7H 3PUZA 2MNAA 2NZOA 4JI1Q 4ID6A 3T13A 3T4AC 3ND8A 4BS9A 2X6LA 1Y8PB 2B29A 2MO1A 4BA1I 4JI7L 1NJIC 4DV6L 1HXYD 5GAHC 3RZDH 3EN2A 2E2IH 2R92G 3HKSA 3S1QB 1PZJD 4B9WA 1K83H 1SBBB 5L37A 4DV3Q 2KCCA 2K5NA 2QF7A 4NPSA 3VR4A 1FNUA 1C9OA 1UUPA 1PRTB 1ET6A 2DY8A 3FPUB 4WRDA 1Y1WG 2B2YC 5ELDA 2L9HA 1RODA 4RA8A 1E3PA 3GV3A 3TRZA 4A3EG 4R4TA 3A5UA 3PO3G 4LF4L 2R7FA 1L1OA 5IYDH 1HA5A 4ZQ3A 2F0VA 3RLNA 3C3LA 4XTCS 5CV6A 3H3VH 4L5QA 1IW7C 1K73C 1KQSA 1FYCA 4LFBQ 2UXDL 5M3FG 1O7YA 1IHZA 2VQFL 3RZOB 1VQAA 4DR2L 2E5LL 4HN7A 4B3SL 2V1CC 1Q1EA 3GTGH 3EVQA 4OO1G 2PZWA 2XWBB 4DAYB 4EX5A 4C3JH 4BXXG 5DNFA 3LWEA 3L3OC 1YZ6A 2F0GA 2ZJPA 4UP9A 4X3KA 1LTRD 1WTQA 2OQ0A 3EBEA 4L8JA 3NTIA 2F4IA 3OWEB 4RGNA 2RA4A 3MAQA 2E2IB 4X3TA 3CCVA 1K83B 3KBGA 2ASBA 5I9OA 1CSQA 3KF6B 1ENCA 1C4QA 2QA4A 1DOKA 4JI0Q 4N9PA 5JVH3 3A5ZB 3UDFA 4FF4A 4OX9L 2D62A 1QVCA 4YCWA 2JA5H 5C6AA 3VR5A 5E1FA 5IWAQ 1STEA 4C56C 1VQ7A 3NQTA 5FOBB 4CDDC 4PMBA 1Y1VH 4JI4Q 5CV8A 3DEOA 2KECA 1EY8A 1TKWB 3EA6A 4B3RL 4PQXA 2EYOA 4KKSA 5IT9c 2GVBA 4QUCA 3A7LA 3JC66 1DJRD 4LAAA 1VQ9A 3S24A 2K6AA 3D4WA 1ZKOA 1MD2D 5DM63 4ZAIA 2EYJA 3OTOL 1YHBA 2K05A 1XJVA 4FXGC 3GTGB 1N33Q 1EY4A 2Q2HA 2JA6G 1HTLD 5G3LF 3G7LA 4IPHA 1E2WA 2SNSA 3KJPA 3M4OB 1XXGA 5M5YB 5C4XG 2K5DA 4A76A 1HNXQ 4ZUJA 2Z6KC 2Y0SG 4N8X1 4DV0L 2EY1A 1PFNA 2CQAA 5LMUL 4JI3Q 1SYFA 1CZWA 1RHPA 2R92B 3ERSX 1HNZL 1QZGA 4GLAC 4JW0A 1KL9A 2YYZA 2F4VQ 1TS4A 4ME3A 3PUYA 2EJFC 1VQKA 2A68C 4X66L 4JV5L 1A3TA 2IX0A 3GTKB 1TU2B 2UUAL 3NUCA 3PCOB 2JA8G 3K6OA 3K5MA 3DWPA 3G48A 3OW7A 4R4QA 1VQDA 3J81E 5A2QL 4HR7B 5IIFA 1VQIA 4A3EH 1Y1VB 5I9PA 2NVTB 4CGYB 3K7UC 1ASYA 3C2PA 1XNQQ 5J39A 1SDFA 2D9UA 3CCUA 5D3IB 3CC7A 4HIKA 1YNNC 2VW9A 5KNDA 1TWFB 2OEOA 1KNAA 3V96A 2WIIB 3M85A 3JAME 3CCSA 4O1NA 2DY7A 3MFGA 4IUQA 1WCMB 1VQNA 2ICEC 3AYHB 3OOCA 3WDNA 4DXFA 4XXEA 1F2LA 1VDZA 3AB9A 2ZT9C 5M5YH 4ZKCB 3A0JA 3VDYA 3M4OH 3CMEA 1M8AA 2ALYB 1WTOA 3A55A 1CSPA 4EQNA 3H3VC 5KYLA 1EWHA 1RJTA 2XTIA 3PO3B 4B9XA 3PIO3 4YWMA 3J80c 2UXCQ 2WINB 5CV5A 2KHIA 1S5FD 2B2WA 3CQZH 4K2KA 2VNUD 1PTOF 1I94L 3RR5A 3K7AB 2JA7H 4GZYC 2R92H 1EIFA 2WB1G 3BJUA 4GN4B 5FK9C 3HEJA 2F0EA 3FHWA 2D2CC 2ZTEA 4IJHA 5AFWA 3GTKH 4A3IG 1SYGA 1FGUA 1GM5A 1Q8IA 4CHTB 3TN2A 5IP7G 4U68A 4A3MH 5IOCA 5JJZA 1W3SA 2I5HA 3BYYB 1B50A 1BCPF 1KDAA 4LFCQ 1ESRA 3GTOB 2AMCB 2SDFA 3R3OA 3HOUG 1TWCB 2VB3X 4DV1L 2A73B 5GAEC 1O7LA 4A75A 3HOVB 2KHSA 3ICEA 5HGTA 1K9MC 1X6OA 4MNOA 1WCMH 4BBRH 1K0RA 1EUJA 1H9SA 3CMAA 3A8JE 1MKHA 1EYGA 2EYPA 3CC2A 3SEBA 5FLXc 3TP5A 1B70B 4HCEA 4DF7A 3PO3H 3J81L 4KMUC 4Y52H 2NN6I 3DXJC 3GTPH 2XSCA 4PZ7A 2F0SA 1LLRD 2A6ED 1PH1A 3HKZE 3SE0A 1I4PA 3R2IA 2RQXA 1E22A 4IO9A 3OPOA 3OYYA 1S40A 4FO2A 1TY2A 2DNCA 3SR1A 4GOPA 5CMDA 2K14A 5KGUA 3STBC 4IN3A 2YU9H 4GLVB 3J7YW 1EOTA 3PIP3 1JT8A 3L0OA 1D5MC 4I65A 1GUNA 4ZK9B 1CKOA 2KVMA 4KHZA 1X55A 5AJ3L 3N6RA 5C0XJ 2VUMG 4BXXH 3CCRA 1BOSA 1QWYA 1Y69U 3HOUH 4J15A 1QVGA 1JJCB 4WJWA 5K5PA 3TBIB 2MGSA 4B3MQ 2GA4B 1G51A 1VQ5A 3FKIG 1DOLA 1Z7TA 1S3OA 1WOCA 3F8TA 1OO9B 3KLWA 2VL6A 3DM3A 1V1PA 1SJED 3NK9A 3I4LA 4LF9Q 3GQBA 4EQ5A 2B2VC 1TWCH 2M9VA 3KDFA 2IT1A 1C8CA 2M2LA 4KKUA 4G4KA 4PMWA 1D2BA 2Z4HA 2Z0SA 4EGVA 1LTSD 4TQUS 4BBRB 3I4OA 1AFPA 3Q24A 2K7VA 4A3FB 2EYLA 5EQ0A 3A8IE 3HOWG 2JA6H 1TY0A 1AZQA 4K14A 1DYQA 4DNTB 4KV6A 4DR3L 5C5MA 1X32A 1PMRA 2WKDA 2XWJB 3GTPB 5J22A 4LUVA 1Y1VG 3BDLA 4R4OA 3I4NH 4JCVE 2PNRC 1NR4A 4Z9CB 2QDLA 2L1BA 1LO5D 3CKIB 4DV0Q 2ZM6L 5DAUA 2I5MX 1HFGA 4DR1L 2YU9B 1KDCA 1I50B 4TVAB 1KNEA 4ZCKA 4POGA 2PMZB 2M00A 1I4RA 1HR0W 3HKZB 3E0EA 3HOZH 4PZ6A 2MFIA 3TSSA 3RMHA 4HIOA 5HGQA 1FD7D 1D5XC 1U5KA 1UEBA 3DWAA 2NN6H 2RDGA 4IURA 4YCVA 3HOUB 4KD4A 4WJ3M 5E4XA 2E2DC 3TEHB 2K04A 2E75C 2A6EC 1D5ZC 3HOYB 1U0LA 1A2TA 3BZKA 4X3SA 4XYQA 3U58A 1WTWA 5C4XB 1BBXC 2N49A 4JBWA 4RFBA 1G2SA 2PQEA 5D65A 4F88A 3F1ZA 4O2DA 4WJ4A 4JI4L 3I3CA 1SYCA 2B2YA 2PYKA 3D31A 1A0IA 5CC4A 4HIDA 4BY1B 1EIGA 1SYEA 3KF8A 1JOQA 4DAPA 4AIMA 4X64Q 1HRJA 2GVAA 4LJZC 2JA6B 3FP9A 4XT1B 3LX0A 2QCPX 1A63A 1ASZA 4DK1A 4IALA 1GUGA 3M7GA 4PG3A 1VCIA 2F0DA 1CKMA 2VUMH 2RSOA 1MSGA 2RCFA 2IPKD 5BN3A 3H09A 5FO7B 5M9OA 1GVPA 2KOLA 1N34Q 4X62L 3MXPA 2C35B 3S1MB 1KHIA 1XPOA 3P7JA 1LUZA 5H1SE 2B63G 2DGYA 2ZXOA 1E7ZA 2B8FA 1NMGA 4EQOA 5FLMG 4BBSH 3PUXA 3HOXH 1KXLA 1GKHA 4MZ9A 4NW2A 3CPWA 3HRZC 2R93G 5JJKA 1I6HH 1BDOA 3HOYH 2ZM6Q 1RD9D 2F52A 1TWAH 5IT9L 1YJNA 1JWUD 2HUGA 3C1FA 4A3FG 2LY7A 1RL2A 2JEAI 2EYMA 3BU2A 1Y1WB 2NVXH 4JI5Q 1IBKL 5D3DA 4DR3Q 1SLJA 5IGGA 3NBHB 1MJCA 5EPLA 3C1EA 4IPDA 4IUNA 2CW0D 4P72A 2K32A 3R93A 1O78A 1G6ZA 1XMOQ 4GKJQ 4ABNA 1Z9FA 1PDQA 3HG9A 4RWSC 2A1AA 1RKNA 2NBFA 1A3VA 2CH4W 1GUOA 3AQQA 4JBMA 4IUPA 3KYHC 1NY4A 1PYWD 4LFAQ 3MFYA 4GNXB 2JN4A 1QOHA 4L6TB 5ELNA 1O7IA 5C3WA 2UUAQ 1D6EC 1QUQB 3T16A 1F77A 2HCIA 1BBUA 1SE8A 1K8AC 1VQMA 4C1NK 1C48A 1EY7A 1JR0D 2XRQD 4R1JA 1J6QA 1LTGD 1EY6A 2F3WA 3DEPA 3S1MH 2JA7G 5C0XH 1QVFA 5LMUQ 5LMNQ 1B3QA 4ZUIA 2B2UA 1PLFA 1L0XB 1MHWC 3M4QA 2L11A 1YHQA 5EBDA 1EFID 5IYCG 1EEID 3K80C 3NHHA 2Q8RE 2K28A 5EPJA 1H9KA 1BQQT 4DV5L 1EQRA 1IBML 1Z6HA 3RLFA 3HGBA 2F0NA 1YJWA 1HH2P 1XWEA 1YBYA 2A5HA 2C5CA 2NYZD 3FKIH 2KEEA 3NEMA 2NWGA 3W3AA 1A3UA 4OO1H 1CHQD 3L7ZC 3CF5A 3PGZA 1K3BC 1U4LA 1WTRA 3NPPA 3TS2A 1XMQQ 3HOVG 1EEFD 4C3HG 2PMZE 3MWYW 1SXTA 1UE7A 4NXML 1JE5A 1WTXA 1PRTC 3PV0A 4XQJA 2K33A 1SR3A 3KK7A 1VF5C 2XGTA 3KLSA 4I7ZC 1GD7A 1WTPA 3GTMH 2D0PA 5CR3A 1V43A 5GROA 1WD1A 3NQIA 2WACA 3FVQA 1VQGA 2IX3A 4FVMA 4DAYA 4QL5A 1KAAA 5KNCA 1VQPA 3PUVA 4DNIA 3LGJA 1F9QA 2HQEA 4IFDH 1CQVA 1HTPA 2EE1A 1DZ1A 1EU4A 4JYAL 4APVA 1OXTA 3J7A5 3M3YH 3JAMc 1MGSA 4LF5Q 4UHVA 2E2HH 2QILA 2R93B 2F0LA 2PZTA 3WWVA 2KA7A 4ME5A 4KK7A 2VXWA 2VQEQ 3FKIB 4R8IA 3RZDB 1ICFB 4IOCA 4B3SQ 2FJ2A 3CHBD 3CRLC 4A3GH 2HD3A 3S9WA 1IZ6A 3B6YA 3NP8A 2G9HD 1H9SB 4PZ8A 1VQHA
chains in the Genus database with same CATH topology
2BH2A 5C3EH 3M85A 1PH5A 4LNQA 1OTCA 4LF6Q 1TXYA 1N9WA 1X3FA 3CCSA 4JOIA 1J5EQ 3J81j 1YNXA 1IBLL 5IYBG 2JK8A 2NVYH 3UDXA 4DAMA 2ZJRA 2FXQA 3AYHB 1VQNA 4B3RQ 3RLOA 1I50H 1IXRA 4A3KH 4A3GG 3TQYA 2JEBI 4QJFA 1I3QH 5M5YH 3VDYA 1YITA 3A0JA 3M4OH 3CMEA 4HIMA 1Y1WH 2H5XA 2ALYB 4L5SA 3I55A 3HOYG 2QGQA 1CSPA 1I5FA 1VQFA 1PA6A 2UXCL 4DV2L 5IYBH 2RHQB 3PF5A 2XTIA 4QGUA 4L5TA 1XPRA 4A3CH 2R6GA 4DV5Q 4YWMA 4A3DG 3J80c 2UXCQ 1G6PA 2AWNA 2ES2A 4IFDI 1Q7YC 2IHEA 1VQEA 2KHIA 2CQOA 3NENA 2R7DA 3CQZH 4OWTB 4LFCL 3U50C 1PYBA 1UE1A 3RR5A 5DLQE 1I94L 2BA0A 2JA7H 1XTDA 2R92H 3CAMA 1EIFA 3G71A 2Q2TA 2WB1G 3BJUA 4BY1G 4GN4B 3K81C 4X66Q 4JV5Q 3FHWA 1UE6A 2CFMA 2ZTEA 4DV6Q 1EWIA 4JBJA 3T1HL 4IJHA 4C2MH 3GTKH 3ZJYC 4A3IG 1FGUA 1GM5A 2K5HA 4OWWB 2JQOA 3CW2C 2ID0A 1N34L 4A3CG 5C0XI 1DGSA 1Q86C 2R93H 3H0GG 5IP7G 2E8GA 2KCTA 1NE3A 3S2HH 3T1HQ 1X9NA 4GKKL 4A3MH 1XNQL 1PH7A 2BH8A 2HT1A 1W3SA 2I5HA 3EIVA 1HR0L 5IYDG 3GD7A 2KENA 4LFCQ 1NBWA 4POFA 1HNXL 2CWPA 4P71A 3K0XA 1KRSA 2AMCB 4KHPQ 2I5LX 1HR0Q 3S1RH 1PFSA 4UP8A 5JJIA 3HOUG 2WFWA 4DV1L 4GNXC 4KLKA 5IY0A 5GAEC 4A75A 4LF9L 4DK6C 3CCJA 2HHHQ 3GDEA 3ICEA 4C3HH 1PYSB 1PH6A 1PH8A 3A74A 3GTLH 4GKKQ 2K5VA 1Z47A 1K9MC 1N33L 1X6OA 2OTLA 4MNOA 4UPAA 1WCMH 1KRTA 4BBRH 1K0RA 1EUJA 1XPUA 3I56A 4BBSG 1HZCA 3CMAA 5GADC 5C4JH 3W1BA 4B3ML 1MKHA 1JB7A 4YWLA 1EYGA 3CC2A 1IBLQ 3CPFA 2PNHA 1OXUA 1X54A 5FLXc 1B70B 1J5EL 4JG2A 4YWKA 5IYCH 5LMNW 4DR6Q 2Q2IA 3PO3H 3CCQA 1BVSA 1SRUA 1VQBA 4Y52H 2NN6I 5FJ8H 3GTPH 4X65L 4PZ7A 2R7ZG 4QY7A 1N32L 1PH1A 1PV4A 3I4MG 3HKZE 4NXNQ 4DV4L 3HOZG 2N3SA 2IY5B 1E22A 2LXKA 4IO9A 3OYYA 1NMFA 1CUKA 1S40A 4HJ8A 4DUZL 1TWHH 4DUZQ 4O0AA 3D0FA 3HOXG 4LUZA 5BR8L 4Y7NH 1TWGH 2KBNA 1E1TA 4OONA 4AYBE 4GOPA 1XNRQ 2K14A 2YTXA 4NXNL 1EOVA 3STBC 3CCEA 2CCZA 2YU9H 4GLVB 1JT8A 1M90C 3L0OA 2K4KA 2UUBQ 4YCUA 1CKOA 2I0QA 4KHZA 1X55A 5AJ3L 5C0XJ 2JE6I 2UU9L 2VUMG 4BXXH 2LXJA 1UWVA 3CCRA 4LF5L 4LF8Q 4HJ9A 1VQJA 2Q2UA 3IRBA 5K36G 3AFQA 3HOUH 1T9HA 3S15H 1L1OB 4J15A 1FVIA 5GAGC 1Q46A 5C44G 4OXPA 1JJCB 1QVGA 2A19A 1P16A 4JI1L 4GLXA 1VQ6A 1WJJA 4B3MQ 3AEVA 1AH9A 1Y14B 4DR4L 1G51A 3M4PA 1VQ5A 2DUDA 3FKIG 4UY8C 3BZCA 1HZBA 1C7YA 1S3OA 1WOCA 2HIXA 3F8TA 4NB3A 1FJGL 3KLWA 2RCNA 2VS1A 1K8GA 2VL6A 3DM3A 5J3BA 4DV1Q 4LF9Q 4EQ5A 3F2BA 3PIOA 1TWCH 3KDFA 2IT1A 2IX1A 2OTJA 3PF4A 1PH2A 4LF7Q 1SMXA 4PMWA 4JI2L 3UDGA 1HNWQ 4A3LG 1OXSC 3I4NG 1FL0A 2E2JH 5EAYA 1A8VA 2Z0SA 4TQUS 3I4MH 1EIYB 4IFDG 1LYLA 3I4OA 4YY3L 1FJGQ 4JBKA 4OO1I 2ZJQA 4DR2Q 2E5LQ 5M5XH 1YIJA 2OCEA 1P8LA 2MO0A 1SROA 2UXDQ 3HOWG 2JA6H 1Q1BA 3H0GH 4GOPC 3NELA 1JJ2A 4DR3L 2JA8H 1IYJB 2JA5G 3KOJA 4AYBG 2UU9Q 4LUVA 1Y1VG 4R4OA 1YHAA 1XMQL 5E7NA 4JCVE 3I4NH 4LF4Q 4MTNA 3T1YQ 3W5OA 1PH4A 3HKZG 4YHHL 2NVQH 1VQ4A 4DV0Q 3J81c 2HQLA 1N36L 4LFAL 1V1QA 3TREA 2ZM6L 3F2CA 3ULLA 5JJLA 2I5MX 4DR1L 4A93G 4TVAB 3GTQH 4RG1A 2BA1A 1LM0A 4DV4Q 4HJ5A 2D0OA 4A3JH 4POGA 3S1QH 1X56A 4A4IA 1HR0W 4X6AH 3E0EA 1XMOL 3HOZH 4PZ6A 4H02A 4X65Q 2MFIA 4DV2Q 4HIOA 5HGQA 1UEBA 1U5KA 5C3EG 4YHHQ 4YCVA 2WAQG 4DR6L 4DR5L 1OXVA 4JI0L 5HY6A 2UUCQ 2AKWB 2VW9A 2ATWA 2RHSB 3PUWA 1GO3E 4JOIC 3TEHB 3G4SA 2N8NA 3MEFA 4GN3B 4A3LH 3RNUA 1U0LA 3BZKA 3U58A 1S72A 3K7AH 3CD6A 4R4CA 5FLMH 4HJ7A 2N49A 5C44H 1Q81C 4JBWA 3KFUA 3UDIA 2MQHA 1SN8A 4A3MG 1D8LA 4WJ3M 4IJLA 3F1ZA 4O2DA 4WJ4A 4JI4L 4JI6Q 2PQAB 3J80i 2ZTDA 5M3FH 3D31A 1A0IA 3I7FA 4HIDA 5IWAL 4ALPA 2UXBQ 2ZTCA 4KI0A 4DUYL 3ER0A 1MJEA 4AH6A 2YTYA 1HNWL 4RMFA 4JI8Q 3S2DH 4DV3L 3RZOH 4KHPL 4AIMA 4X64Q 3CP0A 1L2FA 2GVAA 4DR7L 4DUYQ 1X3EA 3FP9A 2YV5A 3J81i 1A63A 1YVCA 4JC0A 4R4IA 1ASZA 4GN5A 4BA2I 1WI5A 3W1GA 4PG3A 4A3BG 2L15A 3GTOH 3M7NA 1VCIA 1CKMA 3U4VA 4JI6L 2PI2E 2VUMH 4GS3A 5IP7H 3PUZA 2MNAA 3HOVH 1KC8C 3CCLA 2NZOA 4JI1Q 1IBKQ 4JI5L 1GVPA 1N34Q 4A3BH 2B29A 2MO1A 4BA1I 4X62L 4JI7L 1NJIC 2A8VA 3GO5A 3KDFB 5IE8A 4DV6L 1HJPA 4IPCA 2C35B 4JI3L 2GN5A 5GAHC 1KHIA 3EN2A 3RZDH 1XPOA 2E2IH 2UUCL 1WYDA 4DR5Q 2R92G 3HKSA 1H95A 1LUZA 2NVTH 5H1SE 1K83H 4X64L 2B63G 4DV3Q 2DGYA 5M3MH 2VNUD 1E7ZA 2K5NA 1I94Q 4NPSA 1HZAA 2OWOA 1NMGA 4UP7A 5FLMG 1C9OA 1HZ9A 3PUXA 3HOXH 4BBSH 1KXLA 1WCMG 4B3TQ 1TWFH 1VQ8A 1GKHA 3AFPA 4MZ9A 3CPWA 1B7YB 2R93G 5JJKA 1I6HH 3HFZB 3HOYH 2ZM6Q 1KD1C 5M5WH 1Q12A 1Y1WG 2F52A 1C0AA 2KHJA 4DV7Q 1TWAH 1E3PA 2NN6G 3PSIA 1YJNA 3TRZA 4A3EG 4R4TA 3STBD 4A3FG 3KF8B 3A5UA 3PO3G 2HIVA 1RL2A 2R7FA 3KF6A 4LF4L 4NXMQ 2JEAI 1L1OA 2Y0SE 5IYDH 1CKNB 4JI7Q 1X3GA 3RLNA 3BU2A 2NVXH 4XTCS 4OWXB 2CKZB 4JI5Q 1IBKL 3H3VH 1BKBA 3KJOA 3S16H 4DR3Q 4L5QA 1K73C 1SLJA 3J7ZC 1KQSA 4LF6L 3NBHB 1MJCA 4LFBQ 5IP9H 4IPDA 5M3FG 4DV7L 2UXDL 4P72A 4BY7H 2VQFL 1VQAA 4DR2L 2E5LL 4A3JG 1XMOQ 4IOAA 4GKJQ 1Z9FA 4B3SL 2V1CC 1YEZA 2A1AA 1Q1EA 1QUQA 2RF4A 2WAQE 5JEAJ 4A3IH 3AQQA 4B3TL 4JBMA 3GTGH 4P75A 3KYHC 1NY4A 4DK3C 2VY3A 4L5RC 4DR7Q 3CXCA 4OO1G 4LFAQ 4A3DH 4DAYB 4OX9Q 4GNXB 4EX5A 4C3JH 5ELNA 2PI2A 4BXXG 3E9HA 4LWCA 3H15A 1O7IA 3ULPA 2ZJPA 1YZ6A 2UUAQ 2AWOA 2K50A 1QUQB 3M9BA 4UP9A 4AQYQ 3S17H 3S1NH 2LSSA 2OQ0A 3EBEA 1BBUA 4FDBA 1SE8A 1K8AC 1VQMA 4JYAQ 3I2ZA 5LMNL 2N78A 4R1JA 1J6QA 4QQBX 2F4VL 3S1MH 1NTGA 2JA7G 2WP8J 3CCVA 3PO2G 1QVFA 1HNZQ 2KCMA 5LMUQ 2NZHA 5LMNQ 2Z6KA 3RN5A 4XIGS 2ASBA 1CKNA 3DLLA 1EFWA 1AE3A 1CSQA 5ELOA 4BBRG 3M4QA 2EIFA 1YHQA 3KF6B 1W2BA 1YI2A 1N8RC 5IYCG 2QA4A 4JI0Q 3S14H 2B3GA 1QZHA 3K80C 3A5ZB 3E9IA 4JI2Q 3UDFA 3MXNB 4QIWE 3TS0A 4OX9L 4JI8L 2D62A 2F3IA 3Q8DA 1QVCA 4YCWA 5BR8Q 3L2PA 1EQRA 4DV5L 2JA5H 2R7ZH 4IFDJ 1OXXK 2B63H 1IBML 2OQKA 5IWAQ 3RLFA 1VQ7A 2UXBL 1YJWA 1HH2P 4DKAC 1PVOA 1G291 1YBYA 3HOWH 4DR1Q 3FKIH 1N32Q 1VS0A 1K3RA 1BBWA 3NEMA 4LW1A 1Y1VH 4JI4Q 2YTVA 4DR4Q 3H3VI 3L7ZC 4P74A 3CF5A 3PGZA 3U4ZA 1RIPA 2K52A 1X65A 4B3RL 4LFBL 5IT9c 5JEAG 2GVBA 3JAMi 3JC66 3OTOQ 1VQ9A 3TS2A 2JA9A 1XMQQ 3HOVG 3S24A 1YJ9A 3PIPA 2PMZE 4NXML 1UE7A 4A93H 1M1KC 5IP9G 1A62A 3K8AA 2WB1E 3OTOL 1YHBA 1R9TH 3CC4A 1JE5A 1IL2A 5C4XH 1XJVA 5M3MG 3PV0A 4K0KQ 1N33Q 2VZAA 3OW2A 1UE5A 1SR3A 2Q2HA 2JA6G 1XNRL 1JJGA 3UE1A 1IBMQ 2XGTA 2CWAA 2K75A 4C3IH 4IPHA 1GD7A 1JMCA 3GTMH 3SGIA 1D7QA 2D0PA 3KJPA 3RN2A 5C4XG 1V43A 2VQEL 5GROA 4A76A 1PH9A 1HNXQ 2Z6KC 5GQOA 4LF7L 1N36Q 1VQGA 2Y0SG 4BY1H 4IPGA 1L0WA 2JJQA 4DV0L 4QL5A 1VQPA 3PUVA 2EQSA 4DNIA 1PH3A 1PHJA 3T1YL 1WFQA 3LGJA 5LMUL 4GOPB 4JI3Q 3CCMA 3G6EA 4A3KG 2EXDA 4X62Q 3PO2H 1E1OA 5C0XG 3ERSX 1HNZL 1QZGA 4GLAC 4JYAL 4DPGA 2IHFA 3UE0A 4APVA 4BY7G 1OXTA 1LTLA 1KL9A 3J7A5 2YYZA 2F4VQ 4ME3A 3PUYA 1VQKA 4X66L 2HHHL 4JV5L 2IX0A 4K0KL 1KAWA 5FJ8G 1EQQA 2UUAL 4LF8L 3M3YH 3JAMc 3PCOB 4LF5Q 2JA8G 4YY3Q 2QEXA 5AJ3Q 1KIXA 2E2HH 3GTJH 1Q82C 1AE2A 4AQYL 4HJAA 4GNXA 2UUBL 3WWVA 1B8AA 1MIUA 3G48A 1Q8KA 1VQLA 4R4QA 1VQDA 3ULJA 3F2DA 2VQEQ 1VQCA 4LUOA 1VQIA 1V9PA 4A3EH 4A3FH 1SFOH 4IOCA 4B3SQ 2PQAA 4GKJL 4A3GH 1IZ6A 3B6YA 3K7UC 1E24A 1VQOA 1ASYA 1XNQQ 2AHOB 1L1OC 4PZ8A 3CCUA 3CC7A 1VQHA 4HIKA 4P73A 2VQFQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH2 A;  5C3E H;  3M85 A;  1PH5 A;  4LNQ A;  1OTC A;  4LF6 Q;  1TXY A;  1N9W A;  1X3F A;  3CCS A;  4JOI A;  1J5E Q;  3J81 j;  1YNX A;  1IBL L;  5IYB G;  2JK8 A;  2NVY H;  3UDX A;  4DAM A;  2ZJR A;  2FXQ A;  3AYH B;  1VQN A;  4B3R Q;  3RLO A;  1I50 H;  1IXR A;  4A3K H;  4A3G G;  3TQY A;  2JEB I;  4QJF A;  1I3Q H;  5M5Y H;  3VDY A;  1YIT A;  3A0J A;  3M4O H;  3CME A;  4HIM A;  1Y1W H;  2H5X A;  2ALY B;  4L5S A;  3I55 A;  3HOY G;  2QGQ A;  1CSP A;  1I5F A;  1VQF A;  1PA6 A;  2UXC L;  4DV2 L;  5IYB H;  2RHQ B;  3PF5 A;  2XTI A;  4QGU A;  4L5T A;  1XPR A;  4A3C H;  2R6G A;  4DV5 Q;  4YWM A;  4A3D G;  3J80 c;  2UXC Q;  1G6P A;  2AWN A;  2ES2 A;  4IFD I;  1Q7Y C;  2IHE A;  1VQE A;  2KHI A;  2CQO A;  3NEN A;  2R7D A;  3CQZ H;  4OWT B;  4LFC L;  3U50 C;  1PYB A;  1UE1 A;  3RR5 A;  5DLQ E;  1I94 L;  2BA0 A;  2JA7 H;  1XTD A;  2R92 H;  3CAM A;  1EIF A;  3G71 A;  2Q2T A;  2WB1 G;  3BJU A;  4BY1 G;  4GN4 B;  3K81 C;  4X66 Q;  4JV5 Q;  3FHW A;  1UE6 A;  2CFM A;  2ZTE A;  4DV6 Q;  1EWI A;  4JBJ A;  3T1H L;  4IJH A;  4C2M H;  3GTK H;  3ZJY C;  4A3I G;  1FGU A;  1GM5 A;  2K5H A;  4OWW B;  2JQO A;  3CW2 C;  2ID0 A;  1N34 L;  4A3C G;  5C0X I;  1DGS A;  1Q86 C;  2R93 H;  3H0G G;  5IP7 G;  2E8G A;  2KCT A;  1NE3 A;  3S2H H;  3T1H Q;  1X9N A;  4GKK L;  4A3M H;  1XNQ L;  1PH7 A;  2BH8 A;  2HT1 A;  1W3S A;  2I5H A;  3EIV A;  1HR0 L;  5IYD G;  3GD7 A;  2KEN A;  4LFC Q;  1NBW A;  4POF A;  1HNX L;  2CWP A;  4P71 A;  3K0X A;  1KRS A;  2AMC B;  4KHP Q;  2I5L X;  1HR0 Q;  3S1R H;  1PFS A;  4UP8 A;  5JJI A;  3HOU G;  2WFW A;  4DV1 L;  4GNX C;  4KLK A;  5IY0 A;  5GAE C;  4A75 A;  4LF9 L;  4DK6 C;  3CCJ A;  2HHH Q;  3GDE A;  3ICE A;  4C3H H;  1PYS B;  1PH6 A;  1PH8 A;  3A74 A;  3GTL H;  4GKK Q;  2K5V A;  1Z47 A;  1K9M C;  1N33 L;  1X6O A;  2OTL A;  4MNO A;  4UPA A;  1WCM H;  1KRT A;  4BBR H;  1K0R A;  1EUJ A;  1XPU A;  3I56 A;  4BBS G;  1HZC A;  3CMA A;  5GAD C;  5C4J H;  3W1B A;  4B3M L;  1MKH A;  1JB7 A;  4YWL A;  1EYG A;  3CC2 A;  1IBL Q;  3CPF A;  2PNH A;  1OXU A;  1X54 A;  5FLX c;  1B70 B;  1J5E L;  4JG2 A;  4YWK A;  5IYC H;  5LMN W;  4DR6 Q;  2Q2I A;  3PO3 H;  3CCQ A;  1BVS A;  1SRU A;  1VQB A;  4Y52 H;  2NN6 I;  5FJ8 H;  3GTP H;  4X65 L;  4PZ7 A;  2R7Z G;  4QY7 A;  1N32 L;  1PH1 A;  1PV4 A;  3I4M G;  3HKZ E;  4NXN Q;  4DV4 L;  3HOZ G;  2N3S A;  2IY5 B;  1E22 A;  2LXK A;  4IO9 A;  3OYY A;  1NMF A;  1CUK A;  1S40 A;  4HJ8 A;  4DUZ L;  1TWH H;  4DUZ Q;  4O0A A;  3D0F A;  3HOX G;  4LUZ A;  5BR8 L;  4Y7N H;  1TWG H;  2KBN A;  1E1T A;  4OON A;  4AYB E;  4GOP A;  1XNR Q;  2K14 A;  2YTX A;  4NXN L;  1EOV A;  3STB C;  3CCE A;  2CCZ A;  2YU9 H;  4GLV B;  1JT8 A;  1M90 C;  3L0O A;  2K4K A;  2UUB Q;  4YCU A;  1CKO A;  2I0Q A;  4KHZ A;  1X55 A;  5AJ3 L;  5C0X J;  2JE6 I;  2UU9 L;  2VUM G;  4BXX H;  2LXJ A;  1UWV A;  3CCR A;  4LF5 L;  4LF8 Q;  4HJ9 A;  1VQJ A;  2Q2U A;  3IRB A;  5K36 G;  3AFQ A;  3HOU H;  1T9H A;  3S15 H;  1L1O B;  4J15 A;  1FVI A;  5GAG C;  1Q46 A;  5C44 G;  4OXP A;  1JJC B;  1QVG A;  2A19 A;  1P16 A;  4JI1 L;  4GLX A;  1VQ6 A;  1WJJ A;  4B3M Q;  3AEV A;  1AH9 A;  1Y14 B;  4DR4 L;  1G51 A;  3M4P A;  1VQ5 A;  2DUD A;  3FKI G;  4UY8 C;  3BZC A;  1HZB A;  1C7Y A;  1S3O A;  1WOC A;  2HIX A;  3F8T A;  4NB3 A;  1FJG L;  3KLW A;  2RCN A;  2VS1 A;  1K8G A;  2VL6 A;  3DM3 A;  5J3B A;  4DV1 Q;  4LF9 Q;  4EQ5 A;  3F2B A;  3PIO A;  1TWC H;  3KDF A;  2IT1 A;  2IX1 A;  2OTJ A;  3PF4 A;  1PH2 A;  4LF7 Q;  1SMX A;  4PMW A;  4JI2 L;  3UDG A;  1HNW Q;  4A3L G;  1OXS C;  3I4N G;  1FL0 A;  2E2J H;  5EAY A;  1A8V A;  2Z0S A;  4TQU S;  3I4M H;  1EIY B;  4IFD G;  1LYL A;  3I4O A;  4YY3 L;  1FJG Q;  4JBK A;  4OO1 I;  2ZJQ A;  4DR2 Q;  2E5L Q;  5M5X H;  1YIJ A;  2OCE A;  1P8L A;  2MO0 A;  1SRO A;  2UXD Q;  3HOW G;  2JA6 H;  1Q1B A;  3H0G H;  4GOP C;  3NEL A;  1JJ2 A;  4DR3 L;  2JA8 H;  1IYJ B;  2JA5 G;  3KOJ A;  4AYB G;  2UU9 Q;  4LUV A;  1Y1V G;  4R4O A;  1YHA A;  1XMQ L;  5E7N A;  4JCV E;  3I4N H;  4LF4 Q;  4MTN A;  3T1Y Q;  3W5O A;  1PH4 A;  3HKZ G;  4YHH L;  2NVQ H;  1VQ4 A;  4DV0 Q;  3J81 c;  2HQL A;  1N36 L;  4LFA L;  1V1Q A;  3TRE A;  2ZM6 L;  3F2C A;  3ULL A;  5JJL A;  2I5M X;  4DR1 L;  4A93 G;  4TVA B;  3GTQ H;  4RG1 A;  2BA1 A;  1LM0 A;  4DV4 Q;  4HJ5 A;  2D0O A;  4A3J H;  4POG A;  3S1Q H;  1X56 A;  4A4I A;  1HR0 W;  4X6A H;  3E0E A;  1XMO L;  3HOZ H;  4PZ6 A;  4H02 A;  4X65 Q;  2MFI A;  4DV2 Q;  4HIO A;  5HGQ A;  1UEB A;  1U5K A;  5C3E G;  4YHH Q;  4YCV A;  2WAQ G;  4DR6 L;  4DR5 L;  1OXV A;  4JI0 L;  5HY6 A;  2UUC Q;  2AKW B;  2VW9 A;  2ATW A;  2RHS B;  3PUW A;  1GO3 E;  4JOI C;  3TEH B;  3G4S A;  2N8N A;  3MEF A;  4GN3 B;  4A3L H;  3RNU A;  1U0L A;  3BZK A;  3U58 A;  1S72 A;  3K7A H;  3CD6 A;  4R4C A;  5FLM H;  4HJ7 A;  2N49 A;  5C44 H;  1Q81 C;  4JBW A;  3KFU A;  3UDI A;  2MQH A;  1SN8 A;  4A3M G;  1D8L A;  4WJ3 M;  4IJL A;  3F1Z A;  4O2D A;  4WJ4 A;  4JI4 L;  4JI6 Q;  2PQA B;  3J80 i;  2ZTD A;  5M3F H;  3D31 A;  1A0I A;  3I7F A;  4HID A;  5IWA L;  4ALP A;  2UXB Q;  2ZTC A;  4KI0 A;  4DUY L;  3ER0 A;  1MJE A;  4AH6 A;  2YTY A;  1HNW L;  4RMF A;  4JI8 Q;  3S2D H;  4DV3 L;  3RZO H;  4KHP L;  4AIM A;  4X64 Q;  3CP0 A;  1L2F A;  2GVA A;  4DR7 L;  4DUY Q;  1X3E A;  3FP9 A;  2YV5 A;  3J81 i;  1A63 A;  1YVC A;  4JC0 A;  4R4I A;  1ASZ A;  4GN5 A;  4BA2 I;  1WI5 A;  3W1G A;  4PG3 A;  4A3B G;  2L15 A;  3GTO H;  3M7N A;  1VCI A;  1CKM A;  3U4V A;  4JI6 L;  2PI2 E;  2VUM H;  4GS3 A;  5IP7 H;  3PUZ A;  2MNA A;  3HOV H;  1KC8 C;  3CCL A;  2NZO A;  4JI1 Q;  1IBK Q;  4JI5 L;  1GVP A;  1N34 Q;  4A3B H;  2B29 A;  2MO1 A;  4BA1 I;  4X62 L;  4JI7 L;  1NJI C;  2A8V A;  3GO5 A;  3KDF B;  5IE8 A;  4DV6 L;  1HJP A;  4IPC A;  2C35 B;  4JI3 L;  2GN5 A;  5GAH C;  1KHI A;  3EN2 A;  3RZD H;  1XPO A;  2E2I H;  2UUC L;  1WYD A;  4DR5 Q;  2R92 G;  3HKS A;  1H95 A;  1LUZ A;  2NVT H;  5H1S E;  1K83 H;  4X64 L;  2B63 G;  4DV3 Q;  2DGY A;  5M3M H;  2VNU D;  1E7Z A;  2K5N A;  1I94 Q;  4NPS A;  1HZA A;  2OWO A;  1NMG A;  4UP7 A;  5FLM G;  1C9O A;  1HZ9 A;  3PUX A;  3HOX H;  4BBS H;  1KXL A;  1WCM G;  4B3T Q;  1TWF H;  1VQ8 A;  1GKH A;  3AFP A;  4MZ9 A;  3CPW A;  1B7Y B;  2R93 G;  5JJK A;  1I6H H;  3HFZ B;  3HOY H;  2ZM6 Q;  1KD1 C;  5M5W H;  1Q12 A;  1Y1W G;  2F52 A;  1C0A A;  2KHJ A;  4DV7 Q;  1TWA H;  1E3P A;  2NN6 G;  3PSI A;  1YJN A;  3TRZ A;  4A3E G;  4R4T A;  3STB D;  4A3F G;  3KF8 B;  3A5U A;  3PO3 G;  2HIV A;  1RL2 A;  2R7F A;  3KF6 A;  4LF4 L;  4NXM Q;  2JEA I;  1L1O A;  2Y0S E;  5IYD H;  1CKN B;  4JI7 Q;  1X3G A;  3RLN A;  3BU2 A;  2NVX H;  4XTC S;  4OWX B;  2CKZ B;  4JI5 Q;  1IBK L;  3H3V H;  1BKB A;  3KJO A;  3S16 H;  4DR3 Q;  4L5Q A;  1K73 C;  1SLJ A;  3J7Z C;  1KQS A;  4LF6 L;  3NBH B;  1MJC A;  4LFB Q;  5IP9 H;  4IPD A;  5M3F G;  4DV7 L;  2UXD L;  4P72 A;  4BY7 H;  2VQF L;  1VQA A;  4DR2 L;  2E5L L;  4A3J G;  1XMO Q;  4IOA A;  4GKJ Q;  1Z9F A;  4B3S L;  2V1C C;  1YEZ A;  2A1A A;  1Q1E A;  1QUQ A;  2RF4 A;  2WAQ E;  5JEA J;  4A3I H;  3AQQ A;  4B3T L;  4JBM A;  3GTG H;  4P75 A;  3KYH C;  1NY4 A;  4DK3 C;  2VY3 A;  4L5R C;  4DR7 Q;  3CXC A;  4OO1 G;  4LFA Q;  4A3D H;  4DAY B;  4OX9 Q;  4GNX B;  4EX5 A;  4C3J H;  5ELN A;  2PI2 A;  4BXX G;  3E9H A;  4LWC A;  3H15 A;  1O7I A;  3ULP A;  2ZJP A;  1YZ6 A;  2UUA Q;  2AWO A;  2K50 A;  1QUQ B;  3M9B A;  4UP9 A;  4AQY Q;  3S17 H;  3S1N H;  2LSS A;  2OQ0 A;  3EBE A;  1BBU A;  4FDB A;  1SE8 A;  1K8A C;  1VQM A;  4JYA Q;  3I2Z A;  5LMN L;  2N78 A;  4R1J A;  1J6Q A;  4QQB X;  2F4V L;  3S1M H;  1NTG A;  2JA7 G;  2WP8 J;  3CCV A;  3PO2 G;  1QVF A;  1HNZ Q;  2KCM A;  5LMU Q;  2NZH A;  5LMN Q;  2Z6K A;  3RN5 A;  4XIG S;  2ASB A;  1CKN A;  3DLL A;  1EFW A;  1AE3 A;  1CSQ A;  5ELO A;  4BBR G;  3M4Q A;  2EIF A;  1YHQ A;  3KF6 B;  1W2B A;  1YI2 A;  1N8R C;  5IYC G;  2QA4 A;  4JI0 Q;  3S14 H;  2B3G A;  1QZH A;  3K80 C;  3A5Z B;  3E9I A;  4JI2 Q;  3UDF A;  3MXN B;  4QIW E;  3TS0 A;  4OX9 L;  4JI8 L;  2D62 A;  2F3I A;  3Q8D A;  1QVC A;  4YCW A;  5BR8 Q;  3L2P A;  1EQR A;  4DV5 L;  2JA5 H;  2R7Z H;  4IFD J;  1OXX K;  2B63 H;  1IBM L;  2OQK A;  5IWA Q;  3RLF A;  1VQ7 A;  2UXB L;  1YJW A;  1HH2 P;  4DKA C;  1PVO A;  1G29 1;  1YBY A;  3HOW H;  4DR1 Q;  3FKI H;  1N32 Q;  1VS0 A;  1K3R A;  1BBW A;  3NEM A;  4LW1 A;  1Y1V H;  4JI4 Q;  2YTV A;  4DR4 Q;  3H3V I;  3L7Z C;  4P74 A;  3CF5 A;  3PGZ A;  3U4Z A;  1RIP A;  2K52 A;  1X65 A;  4B3R L;  4LFB L;  5IT9 c;  5JEA G;  2GVB A;  3JAM i;  3JC6 6;  3OTO Q;  1VQ9 A;  3TS2 A;  2JA9 A;  1XMQ Q;  3HOV G;  3S24 A;  1YJ9 A;  3PIP A;  2PMZ E;  4NXM L;  1UE7 A;  4A93 H;  1M1K C;  5IP9 G;  1A62 A;  3K8A A;  2WB1 E;  3OTO L;  1YHB A;  1R9T H;  3CC4 A;  1JE5 A;  1IL2 A;  5C4X H;  1XJV A;  5M3M G;  3PV0 A;  4K0K Q;  1N33 Q;  2VZA A;  3OW2 A;  1UE5 A;  1SR3 A;  2Q2H A;  2JA6 G;  1XNR L;  1JJG A;  3UE1 A;  1IBM Q;  2XGT A;  2CWA A;  2K75 A;  4C3I H;  4IPH A;  1GD7 A;  1JMC A;  3GTM H;  3SGI A;  1D7Q A;  2D0P A;  3KJP A;  3RN2 A;  5C4X G;  1V43 A;  2VQE L;  5GRO A;  4A76 A;  1PH9 A;  1HNX Q;  2Z6K C;  5GQO A;  4LF7 L;  1N36 Q;  1VQG A;  2Y0S G;  4BY1 H;  4IPG A;  1L0W A;  2JJQ A;  4DV0 L;  4QL5 A;  1VQP A;  3PUV A;  2EQS A;  4DNI A;  1PH3 A;  1PHJ A;  3T1Y L;  1WFQ A;  3LGJ A;  5LMU L;  4GOP B;  4JI3 Q;  3CCM A;  3G6E A;  4A3K G;  2EXD A;  4X62 Q;  3PO2 H;  1E1O A;  5C0X G;  3ERS X;  1HNZ L;  1QZG A;  4GLA C;  4JYA L;  4DPG A;  2IHF A;  3UE0 A;  4APV A;  4BY7 G;  1OXT A;  1LTL A;  1KL9 A;  3J7A 5;  2YYZ A;  2F4V Q;  4ME3 A;  3PUY A;  1VQK A;  4X66 L;  2HHH L;  4JV5 L;  2IX0 A;  4K0K L;  1KAW A;  5FJ8 G;  1EQQ A;  2UUA L;  4LF8 L;  3M3Y H;  3JAM c;  3PCO B;  4LF5 Q;  2JA8 G;  4YY3 Q;  2QEX A;  5AJ3 Q;  1KIX A;  2E2H H;  3GTJ H;  1Q82 C;  1AE2 A;  4AQY L;  4HJA A;  4GNX A;  2UUB L;  3WWV A;  1B8A A;  1MIU A;  3G48 A;  1Q8K A;  1VQL A;  4R4Q A;  1VQD A;  3ULJ A;  3F2D A;  2VQE Q;  1VQC A;  4LUO A;  1VQI A;  1V9P A;  4A3E H;  4A3F H;  1SFO H;  4IOC A;  4B3S Q;  2PQA A;  4GKJ L;  4A3G H;  1IZ6 A;  3B6Y A;  3K7U C;  1E24 A;  1VQO A;  1ASY A;  1XNQ Q;  2AHO B;  1L1O C;  4PZ8 A;  3CCU A;  3CC7 A;  1VQH A;  4HIK A;  4P73 A;  2VQF Q; 
#chains in the Genus database with same CATH topology
 1HUN A;  2C9O A;  5C3E H;  4HMJ A;  1H9J A;  1II3 A;  5E4W C;  4LNQ A;  4G7O C;  5T1G A;  2F0Q A;  3K58 A;  1YNX A;  4M1U B;  5IYB G;  3UDX A;  2BCO A;  4A3G G;  4A3K H;  3GTM B;  4UDU C;  4HIM A;  2NTT A;  5LHY 1;  2H5X A;  1LTI D;  3P75 A;  3HOY G;  5IGD A;  1B53 A;  1I5F A;  2XVS A;  5CGK A;  4OEL B;  4DV5 Q;  2F0I A;  4EQP A;  4K8J A;  4XDX A;  2AWN A;  4CJ0 B;  2FMM A;  1BXT A;  2R7D A;  4OWT B;  3U50 C;  1PYB A;  2SEB D;  3I8Z A;  3IFT A;  1H9M A;  2D5D A;  3QOL A;  2PPB C;  1NUC A;  2I07 B;  3OHX C;  3K81 C;  4X66 Q;  4JV5 Q;  5C4H A;  4CDE C;  5ELB A;  4DV6 Q;  1RCV D;  4JBJ A;  3T1H L;  3VR2 A;  3TP6 A;  2K5H A;  2NZ1 D;  4KTA A;  4OWW B;  2JQO A;  4DU9 A;  1N34 L;  4A3C G;  3M3Y B;  1WTH A;  2R93 H;  1EQT A;  5FO9 B;  3S15 B;  4J8Q A;  3TZD A;  1PH7 A;  3S2D B;  2HT1 A;  3EIV A;  3ND9 A;  3E5S A;  4HAE A;  5KYI A;  2IWH A;  1HNX L;  5DEH A;  2CWP A;  1CFM A;  5LL6 X;  2I5L X;  4UP8 A;  5JJI A;  5C3E B;  2RBM A;  1O80 A;  4OIK A;  4KLK A;  5IY0 A;  3TDQ A;  4DK6 C;  3EJI A;  3GDE A;  4C3H H;  1PYS B;  1PH6 A;  1PH8 A;  2LMC B;  4DNR B;  3GTL H;  2LKV A;  1N33 L;  4UPA A;  1F2Y A;  1EL0 A;  4BBS G;  3URY A;  4A3K B;  1GXD C;  5I6Y A;  1IBL Q;  4V19 0;  2ENB A;  3IL8 A;  2F0F A;  1J5E L;  5LMN W;  2Q2I A;  1SRU A;  5FJ8 H;  1TII D;  2TMP A;  3K0Y A;  4NXN Q;  3HOZ G;  1RTO A;  2N3S A;  5EKK A;  2IY5 B;  5M5W B;  1QNU A;  2B39 A;  2J0T D;  4HJ8 A;  4R9W A;  2KBN A;  5JEA H;  4AYB E;  1XNR Q;  5IGB A;  1SYB A;  2JSO A;  1M90 C;  4FXD A;  3LWU A;  2PW5 A;  4RGO S;  1VQJ A;  1CM9 A;  4U67 3;  1K8M A;  3BDO A;  5K36 G;  3S15 H;  1T5E A;  1Q46 A;  4GLX A;  4G7H C;  4RAU C;  3M4P A;  3NWT A;  2DUD A;  3VR3 A;  3BZC A;  2HIX A;  4NB3 A;  4RCN A;  2VS1 A;  5C44 B;  4ZRZ A;  1K28 A;  3K57 A;  3QO2 A;  1A15 A;  2IX1 A;  4P2C B;  3PF4 A;  1TQO A;  2RVL A;  2V4D A;  4LF7 Q;  3I4N G;  1STB A;  2E2J H;  3BZD B;  1GHJ A;  3I4M H;  4IFD G;  1FJG Q;  2ZJQ A;  4DR2 Q;  2E5L Q;  4A3E B;  2A69 C;  1YIJ A;  1KLU D;  1S5D D;  1B44 D;  1SRO A;  2UXD Q;  3OIQ A;  4GOP C;  1MSH A;  1JJ2 A;  3NTK A;  1SEB D;  5T1I A;  4LF4 Q;  2LS0 1;  5EPK A;  5C5L A;  3W5O A;  2EY5 A;  3HKZ G;  4PV1 C;  5KNB A;  3J81 c;  2HQL A;  1B4O A;  1EZ6 A;  4LFA L;  3F2C A;  2JYO A;  1LM0 A;  4K6D A;  4DV4 Q;  1QE6 A;  1NNX A;  4X6A H;  4X65 Q;  3VYT A;  4DN4 M;  4DV2 Q;  4DFA A;  2OXP A;  4DR6 L;  4DR5 L;  1LV9 A;  1VF7 A;  3PUW A;  1GO3 E;  1G8Z D;  4GN3 B;  2F3V A;  1R9T B;  3DUZ A;  3ZYY X;  3K7A H;  2JA7 B;  4R4C A;  1BF4 A;  4HJ7 A;  4WFN 3;  5C44 H;  1L0Y B;  2EJM A;  3HS0 C;  4JI6 Q;  3J80 i;  1A2U A;  4R8N A;  4X3U A;  2XN9 C;  5IWA L;  3I4M B;  3ER0 A;  4TSS A;  2K1B A;  4A3M B;  3NXW A;  4BY7 B;  4G57 A;  2FIN B;  2RKS A;  4QB4 A;  3ITP A;  4HTH A;  4I7A A;  4DUY Q;  4DR7 L;  2F0W A;  2F0O A;  4JC0 A;  1WI5 A;  2DJF C;  3W1G A;  3Q22 A;  3GTO H;  3A8K E;  3U4V A;  3DWQ A;  2PI2 E;  2ICI A;  2K01 A;  3VYS A;  4QMG A;  3HOV H;  3H94 A;  4JI5 L;  3J80 L;  5ELC A;  1S5E D;  4A3B H;  1G2T A;  2CHB D;  3GO5 A;  5IE8 A;  1HJP A;  1VMC A;  4IPC A;  2GN5 A;  1PZI D;  1WYD A;  3O13 A;  3MXN A;  1VMP A;  2DNE A;  5I4D A;  1PTO H;  1I94 Q;  5IGE A;  1HZ9 A;  1WCM G;  2EOT A;  3S14 B;  4RGT A;  3HFZ B;  2BDN A;  1KD1 C;  5EGT A;  1EYA A;  1Q12 A;  1C0A A;  2KHJ A;  1AZP A;  3X3M A;  2NVY B;  3KF8 B;  2HIV A;  1GJX A;  3HOW B;  4G7Z C;  3KLS X;  5D14 A;  1CKN B;  4XQQ A;  4OWX B;  2CKZ B;  3S16 H;  3KJO A;  4AYB B;  1SMY C;  4DV7 L;  2P5Z X;  4BY7 H;  1IKM A;  3OSO A;  3VA7 A;  4A3J G;  1Y8N B;  1BCP B;  1YEZ A;  3I72 A;  1QUQ A;  2RF4 A;  4A3I H;  4B3T L;  4P75 A;  4DK3 C;  5BN4 A;  4DR7 Q;  2VY3 A;  4UAI A;  4L5R C;  2O2L D;  4A3D H;  4CJ1 B;  3IAY A;  4TRD A;  4C3I B;  3E9H A;  3R2T A;  1J8I A;  3M9B A;  2E74 C;  4JVZ A;  3S1N H;  4KY7 A;  4FDB A;  4ULL A;  4ODG A;  3S2H B;  1RDP D;  5LMN L;  2N78 A;  3C46 A;  2BOS A;  4C3I G;  4QQB X;  3GV6 A;  2F4V L;  1DCZ A;  1HNZ Q;  1EY0 A;  2NZH A;  1PTO B;  2Z6K A;  3RN5 A;  3DLL A;  2B2T C;  5KEE A;  1QIL A;  3NBH A;  3TP8 A;  1W2B A;  1Q90 A;  4OIJ A;  2J7Z A;  1N8R C;  4OGQ C;  1RTN A;  3S14 H;  2MHV A;  1QZH A;  1JOK A;  1UAP A;  4B08 A;  1DON A;  2K5Q A;  3MXN B;  4QIW E;  4JI8 L;  5BR8 Q;  2F3I A;  2EY2 A;  3L2P A;  1ICW A;  2B63 H;  3D8G A;  2OQK A;  2UXB L;  1PVO A;  4DKA C;  1G29 1;  3HOW H;  4DR1 Q;  1N32 Q;  3QWN A;  1VS0 A;  1K3R A;  1BBW A;  2YTV A;  1ML0 D;  4CDF C;  2IL8 A;  4LMQ D;  3HOZ B;  2K52 A;  1X65 A;  2EY6 A;  5JEA G;  3JAM i;  1BO0 A;  3OTO Q;  2JA9 A;  4XQN A;  1B3A A;  1YJ9 A;  3PIP A;  3EQL C;  1M1K C;  2Z8L A;  4RH6 A;  3K8A A;  5IP9 G;  3CC4 A;  1ONL A;  1IL2 A;  5C4X H;  2XNA C;  5M3M G;  4K0K Q;  2VZA A;  3OW2 A;  1UE5 A;  1F2Z A;  3KUP A;  1I4G A;  3BVM A;  4N8F A;  4Y7N B;  1XNR L;  1JJG A;  4NMZ A;  1K8O A;  3W2D A;  2K75 A;  4C3I H;  1JMC A;  3KLR A;  5F2D A;  3SGI A;  1JOR A;  1ILP A;  1D7Q A;  3RN2 A;  2B2T A;  2VQE L;  3S1N B;  1IYV A;  5GQO A;  4LF7 L;  5IGC A;  2PCF B;  4BY1 H;  2JJQ A;  2PW7 A;  3D3R A;  1YNJ D;  3PQI A;  5A2Q E;  1HCZ A;  3T1Y L;  2Z9H A;  1QB5 D;  3QOJ A;  3G6E A;  2EPB A;  4A3K G;  2MUY A;  5EBC A;  2RDF A;  1S4Z A;  1E1O A;  3V2T A;  4DPG A;  2IHF A;  3MHB A;  3SK8 A;  4BY7 G;  1LTL A;  2VUM B;  2WV6 D;  4C2M B;  4KHV A;  5FJ8 G;  1TVX A;  4YY3 Q;  5AJ3 Q;  1KIX A;  3GTJ H;  1Q82 C;  4QCL A;  4QUF A;  1EU3 A;  1B8A A;  4KD3 A;  1MIU A;  4DA2 A;  5JVG 3;  4C3J G;  3SK5 A;  1Q8K A;  3T51 B;  5CBE E;  1PXU A;  4LUO A;  1V9P A;  5A35 A;  5M5X B;  1DOM A;  3CU7 A;  4RKL A;  4XT3 B;  1CA5 A;  1NR2 A;  4RCO A;  1E24 A;  4MN3 A;  2AHO B;  1CZG A;  1L1O C;  1EYD A;  3TME A;  5JPM C;  1X3P A;  4P73 A;  2VQF Q;  3OMG A;  2K5W A;  2F1M A;  5IT9 E;  3HP3 A;  3J80 E;  4FYD A;  1EQV A;  1BCP D;  3DMU A;  4ZLT F;  1N9W A;  2N55 A;  5I2X A;  4JOI A;  2HCC A;  1J5E Q;  1TWA B;  3J81 j;  1IBL L;  3DM1 A;  4DAM A;  2CVR A;  2FXQ A;  3OMC A;  4B3R Q;  1AP0 A;  1IXR A;  3GTQ B;  2MPM A;  4QJF A;  1I3Q H;  2F03 A;  1YIT A;  1LT6 D;  3K5O A;  4IZ8 A;  1Y1W H;  4F8M A;  3I55 A;  2QGQ A;  1PA6 A;  2UXC L;  1VQF A;  3E6Z X;  3VA5 A;  5IYB H;  2RHQ B;  4DV2 L;  1XPR A;  3QJY A;  4A3C H;  2CW0 C;  3G6J B;  4IFD I;  1Q7Y C;  4ZKB B;  1CHP D;  3NEN A;  4LFC L;  1UE1 A;  5DLQ E;  2BA0 A;  2AQ1 B;  1XTD A;  1R4P B;  1TWH B;  3CAM A;  3G71 A;  4BY1 G;  1ZYR C;  4YIJ A;  3D6W A;  1TR5 A;  1EWI A;  1ZYR D;  2EVB A;  3BDC A;  4C2M H;  3ZJY C;  3CW2 C;  2ID0 A;  1Q86 C;  3GTJ B;  1EWC A;  3MVV A;  3T1H Q;  1LT4 D;  1X9N A;  4GKK L;  1G91 A;  1IYU A;  2BH8 A;  1J9O A;  1HR0 L;  3FRP B;  5JAV A;  5IYD G;  2KEN A;  1NBW A;  5EKI A;  1KDB A;  3K0X A;  1SND A;  3S1R H;  5EJW A;  2WFW A;  4H44 C;  5FO8 B;  2NTS A;  4ILW A;  3A74 A;  1Z47 A;  4FF1 A;  2Z1C A;  3I56 A;  3V05 A;  5C4J H;  4B3M L;  3K5N A;  1JB7 A;  1B9M A;  1SYD A;  3CPF A;  1TS3 A;  1OXU A;  4YWK A;  4DAV A;  3MXU A;  5JOB A;  3CCQ A;  1RF2 D;  1VQB A;  3J7A V;  4X65 L;  3BS1 A;  1LAC A;  1N32 L;  1PV4 A;  4Q5V A;  4DV4 L;  1JOO A;  1UEA B;  3WOE A;  2O5J C;  1CUK A;  1ET9 A;  4IQZ A;  1PRT D;  1TWH H;  5ELF A;  1STN A;  1E1T A;  2ZXP A;  4NXN L;  2CCZ A;  3CCE A;  1HFN A;  1B2T A;  5FLX E;  1BR9 A;  1JC7 A;  2JE6 I;  2UU9 L;  2LXJ A;  1UWV A;  4LF5 L;  3BG3 A;  1E0B A;  2F0M A;  1L1O B;  5GAG C;  1FVI A;  4HSV A;  4J6H A;  4OXP A;  1P16 A;  1GHK A;  3AEV A;  4K5V A;  4CJ2 C;  4N9T A;  1AEX A;  1Y14 B;  2WKC A;  3FPP A;  1U4P A;  4UY8 C;  1C7Y A;  4IUT A;  2R3Z A;  1FJG L;  2RCN A;  1XYI A;  1DD2 A;  5J3B A;  1Q3L A;  1UNS A;  3PIO A;  3F2B A;  1JQY D;  2OTJ A;  2DN8 A;  1FNV A;  1PH2 A;  1SMX A;  1ZEQ X;  1HNW Q;  3UDG A;  2E2H B;  1EYC A;  1STA A;  1FL0 A;  1A8V A;  1R4Q B;  1SJH D;  1LYL A;  5I2Y A;  4JBK A;  1FNW A;  2F0H A;  5C4J B;  4OO1 I;  2QDB A;  2A6H C;  4L63 B;  1GUT A;  2OCE A;  2MO0 A;  4A3G B;  3H0G H;  5JPN C;  2B8G A;  1M4V A;  2UU9 Q;  1YHA A;  1XMQ L;  5E7N A;  3ERO A;  1STG A;  2EXZ A;  1PH4 A;  3PMF A;  4KJO A;  2JA5 B;  1HPC A;  2NVQ H;  1FR3 A;  2O4X A;  3T56 B;  1N36 L;  2B2U C;  1JWM D;  1V1Q A;  3D4R A;  3TRE A;  4E6I A;  5FKA C;  1BNZ A;  3SK6 A;  2H4O A;  4RG1 A;  2BA1 A;  1SNM A;  3AU7 A;  1T5X D;  3Q0A A;  1JB3 A;  1IW7 D;  1XMO L;  5HUR A;  5M3M B;  1ILQ A;  1SMY D;  1X3Q A;  5IOD A;  3BVZ A;  5J1Z A;  2FFK B;  4ZYS A;  5JJL A;  4JI0 L;  2UUC Q;  4IOA A;  4JOI C;  3G4S A;  2B2V A;  4C1N I;  4A3L H;  3RNU A;  1WD0 A;  2KCN A;  1S72 A;  2VB2 X;  5FLM H;  3N52 A;  2FHT A;  3P20 A;  1Q81 C;  1SE3 A;  3KFU A;  2AUK A;  3UDI A;  1PZK D;  1SN8 A;  5LL6 S;  4IJL A;  4BWG B;  1EY9 A;  2PQA B;  1HQR D;  4F87 A;  3I7F A;  2F0T A;  2ZTC A;  3IFD A;  4KI0 A;  4DUY L;  1MJE A;  4AH6 A;  3FEW X;  3S2D H;  5NUC A;  4DV3 L;  4KHP L;  2LFN A;  2I46 A;  1L2F A;  1PTO C;  1F2M A;  3H0G B;  1PTO D;  2SOB A;  1W6K A;  2F0P A;  4BA2 I;  1JE4 A;  2PO4 A;  1TT2 A;  3OIP A;  1I4Q A;  1D1I A;  1HHV A;  1D1K A;  1ENA A;  4GS3 A;  1KC8 C;  3CCL A;  1A6X A;  4C3H B;  1IBK Q;  4NKL A;  3S17 B;  3GTL B;  2NVQ B;  1ENF A;  2EJG C;  3WOF A;  1V1O A;  3VYU A;  2A8V A;  3KDF B;  2ZXR A;  4QF4 A;  3Q23 A;  2HDL A;  4JI3 L;  3H91 A;  2UUC L;  4DR5 Q;  1LAB A;  1H95 A;  2AQ2 B;  2NVT H;  3QIA A;  5CYU A;  1V1P B;  4X64 L;  5M3M H;  4OEM B;  3QG1 A;  3SK4 A;  1HZA A;  2OWO A;  1YNN D;  4UP7 A;  3ERQ A;  1W6J A;  1LTT D;  1TWF H;  2FMC A;  1VQ8 A;  3AFP A;  4B3T Q;  1B7Y B;  5M5W H;  2HDM A;  1PFM A;  4FP5 D;  1HUM A;  4FXK C;  4DV7 Q;  2NN6 G;  3PSI A;  1BUV T;  3STB D;  1KAB A;  2XIW A;  2Q8I B;  3KF6 A;  3VR6 A;  1NCV A;  4NXM Q;  2AQ3 B;  2Y0S E;  4JI7 Q;  1X3G A;  2KJX A;  3F2U A;  5EKL A;  1SE4 A;  1AW7 A;  4V0B A;  1BKB A;  3J7Z C;  4LF6 L;  2EZV A;  3MC0 B;  5IP9 H;  5ELE A;  1GUW A;  2EYF A;  1E2Z A;  2AUJ D;  2Z4I A;  2OF1 A;  4DXG A;  3CQZ B;  2WAQ E;  5JEA J;  1CQF A;  3CXC A;  4OX9 Q;  3U9O A;  5FLX L;  3J7A F;  2PI2 A;  4KY6 A;  5E3F A;  4LWC A;  2L0C A;  4K5W A;  3H15 A;  3ULP A;  3AMU A;  2AWO A;  2K50 A;  4AQY Q;  3R8B A;  3S17 H;  2LSS A;  2J4X A;  5TSS A;  2WAQ B;  2E2J B;  2E76 C;  4JYA Q;  3I2Z A;  5KRU A;  2A6H D;  1NTG A;  2WP8 J;  3PO2 G;  4WOR A;  4KN4 C;  2A69 D;  2KCM A;  4CBV A;  2G9D A;  4XIG S;  1CKN A;  3JAM L;  1EFW A;  1F9P A;  1AE3 A;  5ELO A;  4BBR G;  2EIF A;  4CDC C;  3Q6S A;  1YI2 A;  1TS2 A;  3ONA B;  2B3G A;  1BCP C;  3E9I A;  3FDT A;  4JI2 Q;  4FF3 A;  3TS0 A;  3A7A B;  4KN7 C;  2R7Z H;  3Q8D A;  4IFD J;  2SNM A;  1OXX K;  1XX8 A;  2X69 A;  1U4M A;  3E3X A;  2IJ0 A;  1IKL A;  3IKJ A;  4FF2 A;  4LW1 A;  5G3L D;  4DR4 Q;  3H3V I;  4P74 A;  3MTS A;  3U4Z A;  4LFB L;  1RIP A;  3GP7 A;  3VYR A;  3QR8 A;  4DGZ A;  1F9R A;  4TKO B;  4EVO A;  4A93 H;  2O5I C;  1A62 A;  5CV4 A;  1TS5 A;  2WB1 E;  1R9T H;  2A74 C;  2Z6B A;  1F9S A;  1JWS D;  3UE1 A;  1IBM Q;  2CWA A;  4DK0 A;  1V8Q A;  2G5D A;  2RSN A;  2OT2 A;  2L12 A;  2QEJ C;  3E0J A;  2NUC A;  1PH9 A;  3I90 A;  4JK1 C;  1N36 Q;  4Q0F A;  4IPG A;  1L0W A;  2EQS A;  1B1Z A;  1PH3 A;  1PHJ A;  1WFQ A;  1NAP A;  1WVL A;  1CA6 A;  1SNC A;  2BE5 D;  4GOP B;  1JIC A;  4O42 A;  3CCM A;  4HMI A;  4MHE A;  3D4D A;  1STY A;  1QNK A;  2EXD A;  4X62 Q;  3PO2 H;  1K0S A;  5C0X G;  3BYT B;  5DM7 3;  2EDG A;  3UE0 A;  2F0J A;  2Q8T A;  2L4N A;  3M4Y A;  2HHH L;  1KAW A;  1EQQ A;  1SNQ A;  4LF8 L;  2R7Z B;  2QEX A;  1EY5 A;  1AE2 A;  4AQY L;  4PMC A;  4HJA A;  4GNX A;  3CRK C;  4A3B B;  2UUB L;  3QB3 A;  2F0K A;  1VQL A;  2MJ8 A;  3ULJ A;  3F2D A;  1VQC A;  1S5C D;  4PNY A;  4A3F H;  1SFO H;  1B9N A;  3A56 A;  2PQA A;  4GKJ L;  4KKT A;  3SVM A;  1VQO A;  1CK1 A;  3MXG A;  5C4Z A;  4KJN A;  3SDZ A;  1KTK A;  4A93 B;  1ZXT A;  2BH2 A;  3I4N B;  2QW7 A;  4OL7 A;  1PH5 A;  4K6L A;  1OTC A;  4LF6 Q;  1TXY A;  2K03 A;  1X3F A;  2JK8 A;  2NVY H;  2ZJR A;  1E2V A;  3P1H A;  3RLO A;  1EIH A;  1I50 H;  3TQY A;  2JEB I;  4K8I A;  1QJO A;  3OWF A;  4L5S A;  3S16 B;  3PF5 A;  4QGU A;  4HED A;  4L5T A;  2R6G A;  4A3D G;  2XRS D;  1G6P A;  2ES2 A;  2IHE A;  1VQE A;  2CQO A;  4A3I B;  3MZ5 A;  3T53 B;  3KBX A;  3PO2 B;  4JPB W;  1I6V C;  1WTV A;  2Q2T A;  4A3D B;  2TSS A;  3I70 A;  2N88 A;  1GOZ A;  1U9R A;  1O7Z A;  1UE6 A;  2CFM A;  2L5T A;  3NSW A;  4K2L A;  1XTC D;  1QCB D;  1I4X A;  1PFB A;  5C0X I;  1DGS A;  3H0G G;  1QG7 A;  1EZ8 A;  2E8G A;  2JP1 A;  2KCT A;  1NE3 A;  3S2H H;  2EYH A;  2NB0 A;  3I73 A;  4H13 C;  1XNQ L;  3UI2 A;  3FMC A;  3NTH A;  1SFO B;  1YNJ C;  2RDH A;  1AN8 A;  5C3X A;  3TZU A;  3GD7 A;  2X6G A;  4POF A;  4S3S A;  2CH4 A;  3K59 A;  4P71 A;  1LTB D;  1KRS A;  4KHP Q;  4LK1 C;  4HCS A;  1HR0 Q;  1PFS A;  4GNX C;  4LF9 L;  2B2W C;  3A54 A;  3CCJ A;  2HHH Q;  3BVG A;  1HQM C;  4GKK Q;  2K5V A;  2B63 B;  4QIW B;  2OTL A;  1KRT A;  4FNF A;  2L55 A;  1XPU A;  1HZC A;  5GAD C;  3W1B A;  4XYO A;  4YWL A;  3L9A X;  2PNH A;  1X54 A;  5BN5 A;  4JG2 A;  5IYC H;  2H1E A;  4DR6 Q;  4BBS B;  3I91 A;  1BVS A;  3HOX B;  1SSO A;  2Y0S B;  3DHQ A;  4QY7 A;  4IUV A;  2R7Z G;  3I4M G;  1LT3 D;  5K36 H;  1I6H B;  4RHR A;  2LXK A;  5COR A;  4MIU A;  1NMF A;  4DUZ L;  4DUZ Q;  1ESF A;  1CT1 D;  3D0F A;  4J1M A;  4O0A A;  4LUZ A;  5BR8 L;  4Y7N H;  3HOX G;  1TWG H;  4OON A;  1MI2 A;  3RUZ A;  2YTX A;  1EOV A;  1U4R A;  2K4K A;  2UUB Q;  4A3J B;  4OHJ A;  4YCU A;  1SE2 A;  2NVX B;  1STH A;  2I0Q A;  4LF8 Q;  4HJ9 A;  5KIX A;  2Q2U A;  3IRB A;  3AFQ A;  1T9H A;  4NDX A;  3U9S A;  5I6W A;  5C44 G;  3NWS A;  2BE5 C;  1I4H A;  2A19 A;  1CTM A;  3MA2 B;  4JI1 L;  4CKC A;  4M8A A;  1WJJ A;  3NBI A;  1VQ6 A;  1AH9 A;  4KY5 A;  1PRT F;  1DM0 B;  4DR4 L;  4RGM A;  3EFX D;  5CV9 A;  1HZB A;  2KED A;  1K8G A;  2KQ3 A;  4CKE A;  4DV1 Q;  1KLG D;  3HZX A;  3SXH A;  4JI2 L;  4CKB A;  5M3F B;  3LNN A;  4A3L G;  1OXS C;  5EAY A;  1EIY B;  4YY3 L;  3RD4 A;  1JCK B;  5M5X H;  1P8L A;  1LTA D;  1Q1B A;  5ISR A;  3NEL A;  5CV7 A;  2JA8 H;  1IYJ B;  2JA5 G;  3KOJ A;  4AYB G;  3H6M A;  4K5X A;  1SAP A;  1HA6 A;  4NP5 A;  4MTN A;  3TP7 A;  4MTK A;  2DJG C;  3T1Y Q;  1MBY A;  4YHH L;  1VQ4 A;  1TWG B;  1DXM A;  3SHL A;  3ULL A;  4IUU A;  3NE5 B;  4A93 G;  3GTQ H;  2WB1 B;  1I3Q B;  2R61 A;  1IL8 A;  4HJ5 A;  2D0O A;  2QKI C;  4A3J H;  3S1Q H;  1X56 A;  4A4I A;  4H0L C;  4H02 A;  5IGF A;  1CI3 M;  2KUM A;  3MEH A;  5C3E G;  4YHH Q;  2WAQ G;  4K0K L;  1OXV A;  5HY6 A;  2AKW B;  2ATW A;  2RHS B;  1GUS A;  2N8N A;  3MEF A;  1SNP A;  5COY A;  4RKB A;  3CD6 A;  1SNO A;  4HSP A;  3K5L A;  1FGB D;  2F0U A;  1Y8O B;  2MQH A;  2MP1 A;  4A3M G;  1D8L A;  1S5B D;  3X3N A;  2ZTD A;  2BDO A;  5M3F H;  4H7B A;  3D6C A;  4ALP A;  2UXB Q;  2YTY A;  1HNW L;  4RMF A;  4JI8 Q;  1LT5 D;  3RZO H;  1H9R A;  1NSN S;  4RHS A;  3CP0 A;  1X3E A;  5CBA E;  2PZU A;  2YV5 A;  4F7X A;  3J81 i;  1YVC A;  2JA8 B;  4R4I A;  4GN5 A;  4A3B G;  2L15 A;  3M7N A;  4C3J B;  3S1R B;  2A68 D;  4JI6 L;  2JXM B;  2IW3 A;  5IP7 H;  3PUZ A;  2MNA A;  2NZO A;  4JI1 Q;  4ID6 A;  3T13 A;  3T4A C;  3ND8 A;  4BS9 A;  2X6L A;  1Y8P B;  2B29 A;  2MO1 A;  4BA1 I;  4JI7 L;  1NJI C;  4DV6 L;  1HXY D;  5GAH C;  3RZD H;  3EN2 A;  2E2I H;  2R92 G;  3HKS A;  3S1Q B;  1PZJ D;  4B9W A;  1K83 H;  1SBB B;  5L37 A;  4DV3 Q;  2KCC A;  2K5N A;  2QF7 A;  4NPS A;  3VR4 A;  1FNU A;  1C9O A;  1UUP A;  1PRT B;  1ET6 A;  2DY8 A;  3FPU B;  4WRD A;  1Y1W G;  2B2Y C;  5ELD A;  2L9H A;  1ROD A;  4RA8 A;  1E3P A;  3GV3 A;  3TRZ A;  4A3E G;  4R4T A;  3A5U A;  3PO3 G;  4LF4 L;  2R7F A;  1L1O A;  5IYD H;  1HA5 A;  4ZQ3 A;  2F0V A;  3RLN A;  3C3L A;  4XTC S;  5CV6 A;  3H3V H;  4L5Q A;  1IW7 C;  1K73 C;  1KQS A;  1FYC A;  4LFB Q;  2UXD L;  5M3F G;  1O7Y A;  1IHZ A;  2VQF L;  3RZO B;  1VQA A;  4DR2 L;  2E5L L;  4HN7 A;  4B3S L;  2V1C C;  1Q1E A;  3GTG H;  3EVQ A;  4OO1 G;  2PZW A;  2XWB B;  4DAY B;  4EX5 A;  4C3J H;  4BXX G;  5DNF A;  3LWE A;  3L3O C;  1YZ6 A;  2F0G A;  2ZJP A;  4UP9 A;  4X3K A;  1LTR D;  1WTQ A;  2OQ0 A;  3EBE A;  4L8J A;  3NTI A;  2F4I A;  3OWE B;  4RGN A;  2RA4 A;  3MAQ A;  2E2I B;  4X3T A;  3CCV A;  1K83 B;  3KBG A;  2ASB A;  5I9O A;  1CSQ A;  3KF6 B;  1ENC A;  1C4Q A;  2QA4 A;  1DOK A;  4JI0 Q;  4N9P A;  5JVH 3;  3A5Z B;  3UDF A;  4FF4 A;  4OX9 L;  2D62 A;  1QVC A;  4YCW A;  2JA5 H;  5C6A A;  3VR5 A;  5E1F A;  5IWA Q;  1STE A;  4C56 C;  1VQ7 A;  3NQT A;  5FOB B;  4CDD C;  4PMB A;  1Y1V H;  4JI4 Q;  5CV8 A;  3DEO A;  2KEC A;  1EY8 A;  1TKW B;  3EA6 A;  4B3R L;  4PQX A;  2EYO A;  4KKS A;  5IT9 c;  2GVB A;  4QUC A;  3A7L A;  3JC6 6;  1DJR D;  4LAA A;  1VQ9 A;  3S24 A;  2K6A A;  3D4W A;  1ZKO A;  1MD2 D;  5DM6 3;  4ZAI A;  2EYJ A;  3OTO L;  1YHB A;  2K05 A;  1XJV A;  4FXG C;  3GTG B;  1N33 Q;  1EY4 A;  2Q2H A;  2JA6 G;  1HTL D;  5G3L F;  3G7L A;  4IPH A;  1E2W A;  2SNS A;  3KJP A;  3M4O B;  1XXG A;  5M5Y B;  5C4X G;  2K5D A;  4A76 A;  1HNX Q;  4ZUJ A;  2Z6K C;  2Y0S G;  4N8X 1;  4DV0 L;  2EY1 A;  1PFN A;  2CQA A;  5LMU L;  4JI3 Q;  1SYF A;  1CZW A;  1RHP A;  2R92 B;  3ERS X;  1HNZ L;  1QZG A;  4GLA C;  4JW0 A;  1KL9 A;  2YYZ A;  2F4V Q;  1TS4 A;  4ME3 A;  3PUY A;  2EJF C;  1VQK A;  2A68 C;  4X66 L;  4JV5 L;  1A3T A;  2IX0 A;  3GTK B;  1TU2 B;  2UUA L;  3NUC A;  3PCO B;  2JA8 G;  3K6O A;  3K5M A;  3DWP A;  3G48 A;  3OW7 A;  4R4Q A;  1VQD A;  3J81 E;  5A2Q L;  4HR7 B;  5IIF A;  1VQI A;  4A3E H;  1Y1V B;  5I9P A;  2NVT B;  4CGY B;  3K7U C;  1ASY A;  3C2P A;  1XNQ Q;  5J39 A;  1SDF A;  2D9U A;  3CCU A;  5D3I B;  3CC7 A;  4HIK A;  1YNN C;  2VW9 A;  5KND A;  1TWF B;  2OEO A;  1KNA A;  3V96 A;  2WII B;  3M85 A;  3JAM E;  3CCS A;  4O1N A;  2DY7 A;  3MFG A;  4IUQ A;  1WCM B;  1VQN A;  2ICE C;  3AYH B;  3OOC A;  3WDN A;  4DXF A;  4XXE A;  1F2L A;  1VDZ A;  3AB9 A;  2ZT9 C;  5M5Y H;  4ZKC B;  3A0J A;  3VDY A;  3M4O H;  3CME A;  1M8A A;  2ALY B;  1WTO A;  3A55 A;  1CSP A;  4EQN A;  3H3V C;  5KYL A;  1EWH A;  1RJT A;  2XTI A;  3PO3 B;  4B9X A;  3PIO 3;  4YWM A;  3J80 c;  2UXC Q;  2WIN B;  5CV5 A;  2KHI A;  1S5F D;  2B2W A;  3CQZ H;  4K2K A;  2VNU D;  1PTO F;  1I94 L;  3RR5 A;  3K7A B;  2JA7 H;  4GZY C;  2R92 H;  1EIF A;  2WB1 G;  3BJU A;  4GN4 B;  5FK9 C;  3HEJ A;  2F0E A;  3FHW A;  2D2C C;  2ZTE A;  4IJH A;  5AFW A;  3GTK H;  4A3I G;  1SYG A;  1FGU A;  1GM5 A;  1Q8I A;  4CHT B;  3TN2 A;  5IP7 G;  4U68 A;  4A3M H;  5IOC A;  5JJZ A;  1W3S A;  2I5H A;  3BYY B;  1B50 A;  1BCP F;  1KDA A;  4LFC Q;  1ESR A;  3GTO B;  2AMC B;  2SDF A;  3R3O A;  3HOU G;  1TWC B;  2VB3 X;  4DV1 L;  2A73 B;  5GAE C;  1O7L A;  4A75 A;  3HOV B;  2KHS A;  3ICE A;  5HGT A;  1K9M C;  1X6O A;  4MNO A;  1WCM H;  4BBR H;  1K0R A;  1EUJ A;  1H9S A;  3CMA A;  3A8J E;  1MKH A;  1EYG A;  2EYP A;  3CC2 A;  3SEB A;  5FLX c;  3TP5 A;  1B70 B;  4HCE A;  4DF7 A;  3PO3 H;  3J81 L;  4KMU C;  4Y52 H;  2NN6 I;  3DXJ C;  3GTP H;  2XSC A;  4PZ7 A;  2F0S A;  1LLR D;  2A6E D;  1PH1 A;  3HKZ E;  3SE0 A;  1I4P A;  3R2I A;  2RQX A;  1E22 A;  4IO9 A;  3OPO A;  3OYY A;  1S40 A;  4FO2 A;  1TY2 A;  2DNC A;  3SR1 A;  4GOP A;  5CMD A;  2K14 A;  5KGU A;  3STB C;  4IN3 A;  2YU9 H;  4GLV B;  3J7Y W;  1EOT A;  3PIP 3;  1JT8 A;  3L0O A;  1D5M C;  4I65 A;  1GUN A;  4ZK9 B;  1CKO A;  2KVM A;  4KHZ A;  1X55 A;  5AJ3 L;  3N6R A;  5C0X J;  2VUM G;  4BXX H;  3CCR A;  1BOS A;  1QWY A;  1Y69 U;  3HOU H;  4J15 A;  1QVG A;  1JJC B;  4WJW A;  5K5P A;  3TBI B;  2MGS A;  4B3M Q;  2GA4 B;  1G51 A;  1VQ5 A;  3FKI G;  1DOL A;  1Z7T A;  1S3O A;  1WOC A;  3F8T A;  1OO9 B;  3KLW A;  2VL6 A;  3DM3 A;  1V1P A;  1SJE D;  3NK9 A;  3I4L A;  4LF9 Q;  3GQB A;  4EQ5 A;  2B2V C;  1TWC H;  2M9V A;  3KDF A;  2IT1 A;  1C8C A;  2M2L A;  4KKU A;  4G4K A;  4PMW A;  1D2B A;  2Z4H A;  2Z0S A;  4EGV A;  1LTS D;  4TQU S;  4BBR B;  3I4O A;  1AFP A;  3Q24 A;  2K7V A;  4A3F B;  2EYL A;  5EQ0 A;  3A8I E;  3HOW G;  2JA6 H;  1TY0 A;  1AZQ A;  4K14 A;  1DYQ A;  4DNT B;  4KV6 A;  4DR3 L;  5C5M A;  1X32 A;  1PMR A;  2WKD A;  2XWJ B;  3GTP B;  5J22 A;  4LUV A;  1Y1V G;  3BDL A;  4R4O A;  3I4N H;  4JCV E;  2PNR C;  1NR4 A;  4Z9C B;  2QDL A;  2L1B A;  1LO5 D;  3CKI B;  4DV0 Q;  2ZM6 L;  5DAU A;  2I5M X;  1HFG A;  4DR1 L;  2YU9 B;  1KDC A;  1I50 B;  4TVA B;  1KNE A;  4ZCK A;  4POG A;  2PMZ B;  2M00 A;  1I4R A;  1HR0 W;  3HKZ B;  3E0E A;  3HOZ H;  4PZ6 A;  2MFI A;  3TSS A;  3RMH A;  4HIO A;  5HGQ A;  1FD7 D;  1D5X C;  1U5K A;  1UEB A;  3DWA A;  2NN6 H;  2RDG A;  4IUR A;  4YCV A;  3HOU B;  4KD4 A;  4WJ3 M;  5E4X A;  2E2D C;  3TEH B;  2K04 A;  2E75 C;  2A6E C;  1D5Z C;  3HOY B;  1U0L A;  1A2T A;  3BZK A;  4X3S A;  4XYQ A;  3U58 A;  1WTW A;  5C4X B;  1BBX C;  2N49 A;  4JBW A;  4RFB A;  1G2S A;  2PQE A;  5D65 A;  4F88 A;  3F1Z A;  4O2D A;  4WJ4 A;  4JI4 L;  3I3C A;  1SYC A;  2B2Y A;  2PYK A;  3D31 A;  1A0I A;  5CC4 A;  4HID A;  4BY1 B;  1EIG A;  1SYE A;  3KF8 A;  1JOQ A;  4DAP A;  4AIM A;  4X64 Q;  1HRJ A;  2GVA A;  4LJZ C;  2JA6 B;  3FP9 A;  4XT1 B;  3LX0 A;  2QCP X;  1A63 A;  1ASZ A;  4DK1 A;  4IAL A;  1GUG A;  3M7G A;  4PG3 A;  1VCI A;  2F0D A;  1CKM A;  2VUM H;  2RSO A;  1MSG A;  2RCF A;  2IPK D;  5BN3 A;  3H09 A;  5FO7 B;  5M9O A;  1GVP A;  2KOL A;  1N34 Q;  4X62 L;  3MXP A;  2C35 B;  3S1M B;  1KHI A;  1XPO A;  3P7J A;  1LUZ A;  5H1S E;  2B63 G;  2DGY A;  2ZXO A;  1E7Z A;  2B8F A;  1NMG A;  4EQO A;  5FLM G;  4BBS H;  3PUX A;  3HOX H;  1KXL A;  1GKH A;  4MZ9 A;  4NW2 A;  3CPW A;  3HRZ C;  2R93 G;  5JJK A;  1I6H H;  1BDO A;  3HOY H;  2ZM6 Q;  1RD9 D;  2F52 A;  1TWA H;  5IT9 L;  1YJN A;  1JWU D;  2HUG A;  3C1F A;  4A3F G;  2LY7 A;  1RL2 A;  2JEA I;  2EYM A;  3BU2 A;  1Y1W B;  2NVX H;  4JI5 Q;  1IBK L;  5D3D A;  4DR3 Q;  1SLJ A;  5IGG A;  3NBH B;  1MJC A;  5EPL A;  3C1E A;  4IPD A;  4IUN A;  2CW0 D;  4P72 A;  2K32 A;  3R93 A;  1O78 A;  1G6Z A;  1XMO Q;  4GKJ Q;  4ABN A;  1Z9F A;  1PDQ A;  3HG9 A;  4RWS C;  2A1A A;  1RKN A;  2NBF A;  1A3V A;  2CH4 W;  1GUO A;  3AQQ A;  4JBM A;  4IUP A;  3KYH C;  1NY4 A;  1PYW D;  4LFA Q;  3MFY A;  4GNX B;  2JN4 A;  1QOH A;  4L6T B;  5ELN A;  1O7I A;  5C3W A;  2UUA Q;  1D6E C;  1QUQ B;  3T16 A;  1F77 A;  2HCI A;  1BBU A;  1SE8 A;  1K8A C;  1VQM A;  4C1N K;  1C48 A;  1EY7 A;  1JR0 D;  2XRQ D;  4R1J A;  1J6Q A;  1LTG D;  1EY6 A;  2F3W A;  3DEP A;  3S1M H;  2JA7 G;  5C0X H;  1QVF A;  5LMU Q;  5LMN Q;  1B3Q A;  4ZUI A;  2B2U A;  1PLF A;  1L0X B;  1MHW C;  3M4Q A;  2L11 A;  1YHQ A;  5EBD A;  1EFI D;  5IYC G;  1EEI D;  3K80 C;  3NHH A;  2Q8R E;  2K28 A;  5EPJ A;  1H9K A;  1BQQ T;  4DV5 L;  1EQR A;  1IBM L;  1Z6H A;  3RLF A;  3HGB A;  2F0N A;  1YJW A;  1HH2 P;  1XWE A;  1YBY A;  2A5H A;  2C5C A;  2NYZ D;  3FKI H;  2KEE A;  3NEM A;  2NWG A;  3W3A A;  1A3U A;  4OO1 H;  1CHQ D;  3L7Z C;  3CF5 A;  3PGZ A;  1K3B C;  1U4L A;  1WTR A;  3NPP A;  3TS2 A;  1XMQ Q;  3HOV G;  1EEF D;  4C3H G;  2PMZ E;  3MWY W;  1SXT A;  1UE7 A;  4NXM L;  1JE5 A;  1WTX A;  1PRT C;  3PV0 A;  4XQJ A;  2K33 A;  1SR3 A;  3KK7 A;  1VF5 C;  2XGT A;  3KLS A;  4I7Z C;  1GD7 A;  1WTP A;  3GTM H;  2D0P A;  5CR3 A;  1V43 A;  5GRO A;  1WD1 A;  3NQI A;  2WAC A;  3FVQ A;  1VQG A;  2IX3 A;  4FVM A;  4DAY A;  4QL5 A;  1KAA A;  5KNC A;  1VQP A;  3PUV A;  4DNI A;  3LGJ A;  1F9Q A;  2HQE A;  4IFD H;  1CQV A;  1HTP A;  2EE1 A;  1DZ1 A;  1EU4 A;  4JYA L;  4APV A;  1OXT A;  3J7A 5;  3M3Y H;  3JAM c;  1MGS A;  4LF5 Q;  4UHV A;  2E2H H;  2QIL A;  2R93 B;  2F0L A;  2PZT A;  3WWV A;  2KA7 A;  4ME5 A;  4KK7 A;  2VXW A;  2VQE Q;  3FKI B;  4R8I A;  3RZD B;  1ICF B;  4IOC A;  4B3S Q;  2FJ2 A;  3CHB D;  3CRL C;  4A3G H;  2HD3 A;  3S9W A;  1IZ6 A;  3B6Y A;  3NP8 A;  2G9H D;  1H9S B;  4PZ8 A;  1VQH A; 
#chains in the Genus database with same CATH homology
 2BH2 A;  5C3E H;  3M85 A;  1PH5 A;  4LNQ A;  1OTC A;  4LF6 Q;  1TXY A;  1N9W A;  1X3F A;  3CCS A;  4JOI A;  1J5E Q;  3J81 j;  1YNX A;  1IBL L;  5IYB G;  2JK8 A;  2NVY H;  3UDX A;  4DAM A;  2ZJR A;  2FXQ A;  3AYH B;  1VQN A;  4B3R Q;  3RLO A;  1I50 H;  1IXR A;  4A3K H;  4A3G G;  3TQY A;  2JEB I;  4QJF A;  1I3Q H;  5M5Y H;  3VDY A;  1YIT A;  3A0J A;  3M4O H;  3CME A;  4HIM A;  1Y1W H;  2H5X A;  2ALY B;  4L5S A;  3I55 A;  3HOY G;  2QGQ A;  1CSP A;  1I5F A;  1VQF A;  1PA6 A;  2UXC L;  4DV2 L;  5IYB H;  2RHQ B;  3PF5 A;  2XTI A;  4QGU A;  4L5T A;  1XPR A;  4A3C H;  2R6G A;  4DV5 Q;  4YWM A;  4A3D G;  3J80 c;  2UXC Q;  1G6P A;  2AWN A;  2ES2 A;  4IFD I;  1Q7Y C;  2IHE A;  1VQE A;  2KHI A;  2CQO A;  3NEN A;  2R7D A;  3CQZ H;  4OWT B;  4LFC L;  3U50 C;  1PYB A;  1UE1 A;  3RR5 A;  5DLQ E;  1I94 L;  2BA0 A;  2JA7 H;  1XTD A;  2R92 H;  3CAM A;  1EIF A;  3G71 A;  2Q2T A;  2WB1 G;  3BJU A;  4BY1 G;  4GN4 B;  3K81 C;  4X66 Q;  4JV5 Q;  3FHW A;  1UE6 A;  2CFM A;  2ZTE A;  4DV6 Q;  1EWI A;  4JBJ A;  3T1H L;  4IJH A;  4C2M H;  3GTK H;  3ZJY C;  4A3I G;  1FGU A;  1GM5 A;  2K5H A;  4OWW B;  2JQO A;  3CW2 C;  2ID0 A;  1N34 L;  4A3C G;  5C0X I;  1DGS A;  1Q86 C;  2R93 H;  3H0G G;  5IP7 G;  2E8G A;  2KCT A;  1NE3 A;  3S2H H;  3T1H Q;  1X9N A;  4GKK L;  4A3M H;  1XNQ L;  1PH7 A;  2BH8 A;  2HT1 A;  1W3S A;  2I5H A;  3EIV A;  1HR0 L;  5IYD G;  3GD7 A;  2KEN A;  4LFC Q;  1NBW A;  4POF A;  1HNX L;  2CWP A;  4P71 A;  3K0X A;  1KRS A;  2AMC B;  4KHP Q;  2I5L X;  1HR0 Q;  3S1R H;  1PFS A;  4UP8 A;  5JJI A;  3HOU G;  2WFW A;  4DV1 L;  4GNX C;  4KLK A;  5IY0 A;  5GAE C;  4A75 A;  4LF9 L;  4DK6 C;  3CCJ A;  2HHH Q;  3GDE A;  3ICE A;  4C3H H;  1PYS B;  1PH6 A;  1PH8 A;  3A74 A;  3GTL H;  4GKK Q;  2K5V A;  1Z47 A;  1K9M C;  1N33 L;  1X6O A;  2OTL A;  4MNO A;  4UPA A;  1WCM H;  1KRT A;  4BBR H;  1K0R A;  1EUJ A;  1XPU A;  3I56 A;  4BBS G;  1HZC A;  3CMA A;  5GAD C;  5C4J H;  3W1B A;  4B3M L;  1MKH A;  1JB7 A;  4YWL A;  1EYG A;  3CC2 A;  1IBL Q;  3CPF A;  2PNH A;  1OXU A;  1X54 A;  5FLX c;  1B70 B;  1J5E L;  4JG2 A;  4YWK A;  5IYC H;  5LMN W;  4DR6 Q;  2Q2I A;  3PO3 H;  3CCQ A;  1BVS A;  1SRU A;  1VQB A;  4Y52 H;  2NN6 I;  5FJ8 H;  3GTP H;  4X65 L;  4PZ7 A;  2R7Z G;  4QY7 A;  1N32 L;  1PH1 A;  1PV4 A;  3I4M G;  3HKZ E;  4NXN Q;  4DV4 L;  3HOZ G;  2N3S A;  2IY5 B;  1E22 A;  2LXK A;  4IO9 A;  3OYY A;  1NMF A;  1CUK A;  1S40 A;  4HJ8 A;  4DUZ L;  1TWH H;  4DUZ Q;  4O0A A;  3D0F A;  3HOX G;  4LUZ A;  5BR8 L;  4Y7N H;  1TWG H;  2KBN A;  1E1T A;  4OON A;  4AYB E;  4GOP A;  1XNR Q;  2K14 A;  2YTX A;  4NXN L;  1EOV A;  3STB C;  3CCE A;  2CCZ A;  2YU9 H;  4GLV B;  1JT8 A;  1M90 C;  3L0O A;  2K4K A;  2UUB Q;  4YCU A;  1CKO A;  2I0Q A;  4KHZ A;  1X55 A;  5AJ3 L;  5C0X J;  2JE6 I;  2UU9 L;  2VUM G;  4BXX H;  2LXJ A;  1UWV A;  3CCR A;  4LF5 L;  4LF8 Q;  4HJ9 A;  1VQJ A;  2Q2U A;  3IRB A;  5K36 G;  3AFQ A;  3HOU H;  1T9H A;  3S15 H;  1L1O B;  4J15 A;  1FVI A;  5GAG C;  1Q46 A;  5C44 G;  4OXP A;  1JJC B;  1QVG A;  2A19 A;  1P16 A;  4JI1 L;  4GLX A;  1VQ6 A;  1WJJ A;  4B3M Q;  3AEV A;  1AH9 A;  1Y14 B;  4DR4 L;  1G51 A;  3M4P A;  1VQ5 A;  2DUD A;  3FKI G;  4UY8 C;  3BZC A;  1HZB A;  1C7Y A;  1S3O A;  1WOC A;  2HIX A;  3F8T A;  4NB3 A;  1FJG L;  3KLW A;  2RCN A;  2VS1 A;  1K8G A;  2VL6 A;  3DM3 A;  5J3B A;  4DV1 Q;  4LF9 Q;  4EQ5 A;  3F2B A;  3PIO A;  1TWC H;  3KDF A;  2IT1 A;  2IX1 A;  2OTJ A;  3PF4 A;  1PH2 A;  4LF7 Q;  1SMX A;  4PMW A;  4JI2 L;  3UDG A;  1HNW Q;  4A3L G;  1OXS C;  3I4N G;  1FL0 A;  2E2J H;  5EAY A;  1A8V A;  2Z0S A;  4TQU S;  3I4M H;  1EIY B;  4IFD G;  1LYL A;  3I4O A;  4YY3 L;  1FJG Q;  4JBK A;  4OO1 I;  2ZJQ A;  4DR2 Q;  2E5L Q;  5M5X H;  1YIJ A;  2OCE A;  1P8L A;  2MO0 A;  1SRO A;  2UXD Q;  3HOW G;  2JA6 H;  1Q1B A;  3H0G H;  4GOP C;  3NEL A;  1JJ2 A;  4DR3 L;  2JA8 H;  1IYJ B;  2JA5 G;  3KOJ A;  4AYB G;  2UU9 Q;  4LUV A;  1Y1V G;  4R4O A;  1YHA A;  1XMQ L;  5E7N A;  4JCV E;  3I4N H;  4LF4 Q;  4MTN A;  3T1Y Q;  3W5O A;  1PH4 A;  3HKZ G;  4YHH L;  2NVQ H;  1VQ4 A;  4DV0 Q;  3J81 c;  2HQL A;  1N36 L;  4LFA L;  1V1Q A;  3TRE A;  2ZM6 L;  3F2C A;  3ULL A;  5JJL A;  2I5M X;  4DR1 L;  4A93 G;  4TVA B;  3GTQ H;  4RG1 A;  2BA1 A;  1LM0 A;  4DV4 Q;  4HJ5 A;  2D0O A;  4A3J H;  4POG A;  3S1Q H;  1X56 A;  4A4I A;  1HR0 W;  4X6A H;  3E0E A;  1XMO L;  3HOZ H;  4PZ6 A;  4H02 A;  4X65 Q;  2MFI A;  4DV2 Q;  4HIO A;  5HGQ A;  1UEB A;  1U5K A;  5C3E G;  4YHH Q;  4YCV A;  2WAQ G;  4DR6 L;  4DR5 L;  1OXV A;  4JI0 L;  5HY6 A;  2UUC Q;  2AKW B;  2VW9 A;  2ATW A;  2RHS B;  3PUW A;  1GO3 E;  4JOI C;  3TEH B;  3G4S A;  2N8N A;  3MEF A;  4GN3 B;  4A3L H;  3RNU A;  1U0L A;  3BZK A;  3U58 A;  1S72 A;  3K7A H;  3CD6 A;  4R4C A;  5FLM H;  4HJ7 A;  2N49 A;  5C44 H;  1Q81 C;  4JBW A;  3KFU A;  3UDI A;  2MQH A;  1SN8 A;  4A3M G;  1D8L A;  4WJ3 M;  4IJL A;  3F1Z A;  4O2D A;  4WJ4 A;  4JI4 L;  4JI6 Q;  2PQA B;  3J80 i;  2ZTD A;  5M3F H;  3D31 A;  1A0I A;  3I7F A;  4HID A;  5IWA L;  4ALP A;  2UXB Q;  2ZTC A;  4KI0 A;  4DUY L;  3ER0 A;  1MJE A;  4AH6 A;  2YTY A;  1HNW L;  4RMF A;  4JI8 Q;  3S2D H;  4DV3 L;  3RZO H;  4KHP L;  4AIM A;  4X64 Q;  3CP0 A;  1L2F A;  2GVA A;  4DR7 L;  4DUY Q;  1X3E A;  3FP9 A;  2YV5 A;  3J81 i;  1A63 A;  1YVC A;  4JC0 A;  4R4I A;  1ASZ A;  4GN5 A;  4BA2 I;  1WI5 A;  3W1G A;  4PG3 A;  4A3B G;  2L15 A;  3GTO H;  3M7N A;  1VCI A;  1CKM A;  3U4V A;  4JI6 L;  2PI2 E;  2VUM H;  4GS3 A;  5IP7 H;  3PUZ A;  2MNA A;  3HOV H;  1KC8 C;  3CCL A;  2NZO A;  4JI1 Q;  1IBK Q;  4JI5 L;  1GVP A;  1N34 Q;  4A3B H;  2B29 A;  2MO1 A;  4BA1 I;  4X62 L;  4JI7 L;  1NJI C;  2A8V A;  3GO5 A;  3KDF B;  5IE8 A;  4DV6 L;  1HJP A;  4IPC A;  2C35 B;  4JI3 L;  2GN5 A;  5GAH C;  1KHI A;  3EN2 A;  3RZD H;  1XPO A;  2E2I H;  2UUC L;  1WYD A;  4DR5 Q;  2R92 G;  3HKS A;  1H95 A;  1LUZ A;  2NVT H;  5H1S E;  1K83 H;  4X64 L;  2B63 G;  4DV3 Q;  2DGY A;  5M3M H;  2VNU D;  1E7Z A;  2K5N A;  1I94 Q;  4NPS A;  1HZA A;  2OWO A;  1NMG A;  4UP7 A;  5FLM G;  1C9O A;  1HZ9 A;  3PUX A;  3HOX H;  4BBS H;  1KXL A;  1WCM G;  4B3T Q;  1TWF H;  1VQ8 A;  1GKH A;  3AFP A;  4MZ9 A;  3CPW A;  1B7Y B;  2R93 G;  5JJK A;  1I6H H;  3HFZ B;  3HOY H;  2ZM6 Q;  1KD1 C;  5M5W H;  1Q12 A;  1Y1W G;  2F52 A;  1C0A A;  2KHJ A;  4DV7 Q;  1TWA H;  1E3P A;  2NN6 G;  3PSI A;  1YJN A;  3TRZ A;  4A3E G;  4R4T A;  3STB D;  4A3F G;  3KF8 B;  3A5U A;  3PO3 G;  2HIV A;  1RL2 A;  2R7F A;  3KF6 A;  4LF4 L;  4NXM Q;  2JEA I;  1L1O A;  2Y0S E;  5IYD H;  1CKN B;  4JI7 Q;  1X3G A;  3RLN A;  3BU2 A;  2NVX H;  4XTC S;  4OWX B;  2CKZ B;  4JI5 Q;  1IBK L;  3H3V H;  1BKB A;  3KJO A;  3S16 H;  4DR3 Q;  4L5Q A;  1K73 C;  1SLJ A;  3J7Z C;  1KQS A;  4LF6 L;  3NBH B;  1MJC A;  4LFB Q;  5IP9 H;  4IPD A;  5M3F G;  4DV7 L;  2UXD L;  4P72 A;  4BY7 H;  2VQF L;  1VQA A;  4DR2 L;  2E5L L;  4A3J G;  1XMO Q;  4IOA A;  4GKJ Q;  1Z9F A;  4B3S L;  2V1C C;  1YEZ A;  2A1A A;  1Q1E A;  1QUQ A;  2RF4 A;  2WAQ E;  5JEA J;  4A3I H;  3AQQ A;  4B3T L;  4JBM A;  3GTG H;  4P75 A;  3KYH C;  1NY4 A;  4DK3 C;  2VY3 A;  4L5R C;  4DR7 Q;  3CXC A;  4OO1 G;  4LFA Q;  4A3D H;  4DAY B;  4OX9 Q;  4GNX B;  4EX5 A;  4C3J H;  5ELN A;  2PI2 A;  4BXX G;  3E9H A;  4LWC A;  3H15 A;  1O7I A;  3ULP A;  2ZJP A;  1YZ6 A;  2UUA Q;  2AWO A;  2K50 A;  1QUQ B;  3M9B A;  4UP9 A;  4AQY Q;  3S17 H;  3S1N H;  2LSS A;  2OQ0 A;  3EBE A;  1BBU A;  4FDB A;  1SE8 A;  1K8A C;  1VQM A;  4JYA Q;  3I2Z A;  5LMN L;  2N78 A;  4R1J A;  1J6Q A;  4QQB X;  2F4V L;  3S1M H;  1NTG A;  2JA7 G;  2WP8 J;  3CCV A;  3PO2 G;  1QVF A;  1HNZ Q;  2KCM A;  5LMU Q;  2NZH A;  5LMN Q;  2Z6K A;  3RN5 A;  4XIG S;  2ASB A;  1CKN A;  3DLL A;  1EFW A;  1AE3 A;  1CSQ A;  5ELO A;  4BBR G;  3M4Q A;  2EIF A;  1YHQ A;  3KF6 B;  1W2B A;  1YI2 A;  1N8R C;  5IYC G;  2QA4 A;  4JI0 Q;  3S14 H;  2B3G A;  1QZH A;  3K80 C;  3A5Z B;  3E9I A;  4JI2 Q;  3UDF A;  3MXN B;  4QIW E;  3TS0 A;  4OX9 L;  4JI8 L;  2D62 A;  2F3I A;  3Q8D A;  1QVC A;  4YCW A;  5BR8 Q;  3L2P A;  1EQR A;  4DV5 L;  2JA5 H;  2R7Z H;  4IFD J;  1OXX K;  2B63 H;  1IBM L;  2OQK A;  5IWA Q;  3RLF A;  1VQ7 A;  2UXB L;  1YJW A;  1HH2 P;  4DKA C;  1PVO A;  1G29 1;  1YBY A;  3HOW H;  4DR1 Q;  3FKI H;  1N32 Q;  1VS0 A;  1K3R A;  1BBW A;  3NEM A;  4LW1 A;  1Y1V H;  4JI4 Q;  2YTV A;  4DR4 Q;  3H3V I;  3L7Z C;  4P74 A;  3CF5 A;  3PGZ A;  3U4Z A;  1RIP A;  2K52 A;  1X65 A;  4B3R L;  4LFB L;  5IT9 c;  5JEA G;  2GVB A;  3JAM i;  3JC6 6;  3OTO Q;  1VQ9 A;  3TS2 A;  2JA9 A;  1XMQ Q;  3HOV G;  3S24 A;  1YJ9 A;  3PIP A;  2PMZ E;  4NXM L;  1UE7 A;  4A93 H;  1M1K C;  5IP9 G;  1A62 A;  3K8A A;  2WB1 E;  3OTO L;  1YHB A;  1R9T H;  3CC4 A;  1JE5 A;  1IL2 A;  5C4X H;  1XJV A;  5M3M G;  3PV0 A;  4K0K Q;  1N33 Q;  2VZA A;  3OW2 A;  1UE5 A;  1SR3 A;  2Q2H A;  2JA6 G;  1XNR L;  1JJG A;  3UE1 A;  1IBM Q;  2XGT A;  2CWA A;  2K75 A;  4C3I H;  4IPH A;  1GD7 A;  1JMC A;  3GTM H;  3SGI A;  1D7Q A;  2D0P A;  3KJP A;  3RN2 A;  5C4X G;  1V43 A;  2VQE L;  5GRO A;  4A76 A;  1PH9 A;  1HNX Q;  2Z6K C;  5GQO A;  4LF7 L;  1N36 Q;  1VQG A;  2Y0S G;  4BY1 H;  4IPG A;  1L0W A;  2JJQ A;  4DV0 L;  4QL5 A;  1VQP A;  3PUV A;  2EQS A;  4DNI A;  1PH3 A;  1PHJ A;  3T1Y L;  1WFQ A;  3LGJ A;  5LMU L;  4GOP B;  4JI3 Q;  3CCM A;  3G6E A;  4A3K G;  2EXD A;  4X62 Q;  3PO2 H;  1E1O A;  5C0X G;  3ERS X;  1HNZ L;  1QZG A;  4GLA C;  4JYA L;  4DPG A;  2IHF A;  3UE0 A;  4APV A;  4BY7 G;  1OXT A;  1LTL A;  1KL9 A;  3J7A 5;  2YYZ A;  2F4V Q;  4ME3 A;  3PUY A;  1VQK A;  4X66 L;  2HHH L;  4JV5 L;  2IX0 A;  4K0K L;  1KAW A;  5FJ8 G;  1EQQ A;  2UUA L;  4LF8 L;  3M3Y H;  3JAM c;  3PCO B;  4LF5 Q;  2JA8 G;  4YY3 Q;  2QEX A;  5AJ3 Q;  1KIX A;  2E2H H;  3GTJ H;  1Q82 C;  1AE2 A;  4AQY L;  4HJA A;  4GNX A;  2UUB L;  3WWV A;  1B8A A;  1MIU A;  3G48 A;  1Q8K A;  1VQL A;  4R4Q A;  1VQD A;  3ULJ A;  3F2D A;  2VQE Q;  1VQC A;  4LUO A;  1VQI A;  1V9P A;  4A3E H;  4A3F H;  1SFO H;  4IOC A;  4B3S Q;  2PQA A;  4GKJ L;  4A3G H;  1IZ6 A;  3B6Y A;  3K7U C;  1E24 A;  1VQO A;  1ASY A;  1XNQ Q;  2AHO B;  1L1O C;  4PZ8 A;  3CCU A;  3CC7 A;  1VQH A;  4HIK A;  4P73 A;  2VQF Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...