4B3MQ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mQ00
3NEMA 1N34L 4X64L 3F8TA 3D0FA 3K81C 3PO2H 1R9TH 2JA5G 1Y14B 2F3IA 2AHOB 2CKZB 3MXNB 2HIXA 4JBJA 5AJ3L 1QZGA 4UY8C 3S1MH 3CPWA 4P72A 3IRBA 4PMWA 3GDEA 1OXUA 4JI3L 4LNQA 3KYHC 1EIFA 3CF5A 4DPGA 3KDFA 4OWTB 2BA1A 3PO3H 4UPAA 3J81c 5IYCG 1YITA 5IWAL 1NTGA 4IOCA 2ATWA 1JE5A 1X65A 4R1JA 3PIPA 4GKJQ 2ZJQA 1X55A 4A3LG 4BA1I 5IP7H 4DV7Q 4KLKA 1K73C 4KHZA 5GROA 2QEXA 1X3EA 3K7AH 2RHSB 4JI6Q 3CMAA 5C0XG 2R93G 2H5XA 3KF6A 1VCIA 3CCJA 4DV3L 4Y52H 1HZAA 2VNUD 2XGTA 2AKWB 3E9HA 4R4OA 2UU9Q 3BJUA 5IYBG 1YI2A 4ME3A 4GNXB 3H15A 1MKHA 2MO0A 2ZTCA 2E2IH 4HIDA 1HZCA 5M5XH 4LF9L 2K75A 4DV0L 3GTLH 3S15H 1A62A 3L2PA 3W1BA 2R7ZG 3J80c 4DR6Q 4LFBL 3L7ZC 3T1YL 3UDIA 1L2FA 1N34Q 1NMFA 4C3JH 1VQAA 2GN5A 1KAWA 3G71A 4DV6L 1SMXA 3GTGH 2I5LX 1KD1C 1SLJA 4PG3A 3ULLA 4L5TA 1OXTA 4MNOA 4UP7A 3CC4A 1C9OA 1QUQB 3HOYG 1KRSA 2JEAI 4X66L 4JI3Q 5GADC 1E1OA 5IYDH 3AQQA 5M5YH 2A8VA 3FKIG 1W2BA 4JC0A 2JA8H 5LMNW 1VQ4A 1XJVA 1IZ6A 5IT9c 5ELNA 4A3JH 4K0KQ 2UUBL 4JI7L 3HKSA 1P16A 1K8AC 1TWCH 1WYDA 1PHJA 1V9PA 4LF4Q 2E5LL 2CQOA 1EIYB 4POFA 5JJLA 2PNHA 4DV5Q 1I94Q 3PIOA 1FL0A 1JT8A 1SROA 1Q7YC 3HOWG 1XMQQ 2XTIA 3STBD 2Q2HA 2F52A 1A0IA 2JK8A 4DV0Q 4GKKL 1QVGA 2UXBL 4A93H 4LFBQ 3K80C 1LUZA 3W1GA 4A3GH 2ZJPA 1JJCB 3S16H 4OO1G 4DV6Q 2WAQG 1X56A 2R7DA 3CCRA 4DUZL 1M1KC 3S1NH 4WJ3M 2R92G 1T9HA 1H95A 4X66Q 1NY4A 2VY3A 4YY3L 3EBEA 4AYBG 4DUYL 4BXXG 3ZJYC 2K5HA 1VQFA 2LXJA 4DK6C 4PZ8A 1PH5A 4XIGS 1VQPA 1VQBA 5J3BA 1D8LA 3J81j 2JA7G 4JI4L 3MEFA 1KIXA 1VQEA 2UUBQ 4HJ5A 1I3QH 2IT1A 1KHIA 3TREA 3B6YA 2PI2A 3KLWA 2QGQA 1AE2A 2B63G 1U5KA 3HOZH 4IJLA 3BZCA 4LF7L 2QA4A 3I4NG 2K5NA 1HNWL 5IP9G 4A3MH 1N33L 3S2DH 1UEBA 3PUWA 3F2BA 3CCEA 4GKKQ 4LUZA 4GNXC 2IHFA 4IOAA 2UXBQ 2BA0A 5FLMG 2VQFL 1K8GA 3E0EA 3S2HH 1Y1WG 2NZHA 4AH6A 1X6OA 2WAQE 2K4KA 4L5SA 1L0WA 3HOVH 4DUZQ 1HZ9A 3GTMH 1TWHH 1Y1VG 2GVBA 2Z6KC 4IJHA 3CCQA 2IHEA 3I7FA 2Q2UA 1JJGA 4YY3Q 1VQOA 4B3TL 2DGYA 2OCEA 4PZ6A 4DUYQ 2VZAA 4JOIC 3M4OH 2NN6I 1M90C 4R4IA 5FJ8G 1N32L 4DV7L 4MZ9A 1FVIA 4JI4Q 1SN8A 2AWNA 4HJ8A 1FGUA 3U58A 5JEAJ 4BY7G 4A3CH 4KHPL 2JE6I 3HOXH 1X3GA 5BR8L 4GNXA 2EQSA 5M3MH 1Q81C 1VQJA 1Q86C 4YCUA 4DV4L 2NZOA 4LF7Q 1VQNA 1NMGA 3RLOA 2B29A 3TEHB 1B7YB 1WI5A 4RMFA 1N33Q 2JA6G 4IPDA 2JA5H 2Z6KA 3PUZA 4C3HH 4DAMA 1B8AA 2VQFQ 3L0OA 1QUQA 4A3IG 3VDYA 4DR7Q 2ID0A 3A0JA 3RZOH 4JOIA 4A4IA 2I5MX 5M5WH 3STBC 3H0GG 1XNQL 1WCMG 2LSSA 3EIVA 1LM0A 1G51A 2Z0SA 1IBML 3RLFA 1LYLA 5IYCH 1O7IA 1WFQA 3U4ZA 1IBKL 4B3TQ 3ER0A 1MJEA 2MNAA 3DM3A 3I4MH 4K0KL 4A3LH 3PUYA 4H02A 1OXVA 1XTDA 1N32Q 3OTOL 4A3EG 4Y7NH 3A74A 2R93H 1N8RC 4P74A 4LF4L 4DV1L 1PH6A 4KHPQ 2OQKA 3NBHB 3U50C 5BR8Q 4DV5L 3HKZG 4NPSA 3RN5A 1I94L 5IYBH 2F4VL 2KHJA 3K0XA 3PSIA 3I56A 4BBSG 1XMQL 4DV4Q 2K14A 1KQSA 3UDGA 1PYSB 3PUVA 1I6HH 3OW2A 3M9BA 3ULJA 2CWPA 1QZHA 4IFDJ 4BA2I 3A5ZB 5JEAG 4R4QA 1N36L 1UE1A 1VQ7A 2LXKA 1A63A 3HOYH 3TQYA 3D31A 4LF5Q 3CQZH 4TQUS 3JAMi 4DR5L 1XNQQ 1Q12A 1J6QA 2K52A 4IPGA 4UP8A 4EQ5A 1IBMQ 1IYJB 3FKIH 2B3GA 1YBYA 3CXCA 1Z9FA 1IBKQ 4HJ7A 2R6GA 4JYAL 4DV2Q 1C7YA 5LMNL 1VQ5A 4YCWA 3HFZB 1YHAA 3CCVA 3OTOQ 5C44G 3TS2A 1TXYA 2YTYA 2Y0SG 3UE0A 3G6EA 3HKZE 4DV1Q 2CWAA 3HOUG 4EX5A 2F4VQ 1SRUA 2HT1A 3HOWH 3KJPA 1YVCA 1SR3A 1OTCA 2KCTA 1UE7A 1KRTA 5C3EG 5DLQE 2KENA 5FLXc 4DK3C 3CPFA 1N36Q 1DGSA 2JA8G 4LUVA 1L1OC 1EUJA 2MQHA 4QL5A 2R92H 4O2DA 4YWMA 4IPCA 2EXDA 3M7NA 4GN5A 4DR5Q 3ERSX 4OONA 4A3KG 3RNUA 2ZTEA 4A3BG 2JA9A 4BXXH 4UP9A 3CCMA 4BY1H 1PH1A 4JYAQ 1K9MC 2JA7H 3AEVA 4IFDG 2BH2A 4JBWA 5LMNQ 4GOPB 4B3RL 2L15A 5C0XI 2VQEL 3S24A 2Y0SE 4GN3B 2NVQH 1VQ6A 3S14H 1UWVA 2YTVA 1S3OA 1VQ8A 2I5HA 2PQAB 4J15A 2I0QA 2ASBA 2Q2IA 2B63H 1JJ2A 1E1TA 4L5RC 3I4NH 1ASYA 3T1HL 1MIUA 1KL9A 4A3FG 3GTPH 2OQ0A 2RF4A 3GD7A 4NXML 1EQQA 1HJPA 1QVCA 4QJFA 1KC8C 5FLMH 2KCMA 4X65Q 4JI5L 1Q1EA 1YNXA 3J80i 1Y1WH 3JC66 5LMUL 2A1AA 4LFAL 4DR7L 4JI2L 5JJKA 3GO5A 4DR3L 1YHQA 3PGZA 5GAEC 1Y1VH 1PH8A 2UXCL 2NVYH 1BVSA 2KBNA 2RCNA 4A76A 4OX9L 3Q8DA 2E8GA 4TVAB 4AYBE 4PZ7A 5IE8A 4A75A 2VUMG 4X62Q 1CKNB 3I2ZA 4JI8Q 4BBRG 3BZKA 4NB3A 1TWAH 5FJ8H 2IX1A 2YV5A 4R4CA 5C4JH 4C2MH 1XNRQ 2VQEQ 3GTKH 1GO3E 4BY7H 4B3RQ 4LFCL 3I55A 1VQHA 1YZ6A 4JCVE 2VL6A 4YWLA 1IBLL 1Q8KA 2ZM6Q 4QY7A 3KF8B 3T1HQ 3EN2A 4LF6L 3HOVG 4FDBA 1VQGA 2MO1A 2YYZA 2IX0A 4LW1A 4NXMQ 2JA6H 1PH9A 1XPUA 5EAYA 1HNZL 3CCUA 1IL2A 1OXXK 4OO1I 1L1OB 1P8LA 2WFWA 4JI5Q 4A3IH 3M4PA 3TS0A 1EFWA 4LFAQ 5LMUQ 5GQOA 2D0PA 4JI2Q 3U4VA 1HR0W 4DR3Q 1HR0L 3UDFA 1TWFH 4LF8L 2HHHL 4LF5L 3H0GH 4DAYB 1Z47A 1WCMH 3TRZA 2UXCQ 2ALYB 4OX9Q 4A3CG 4QQBX 3HOXG 5M3FG 1S72A 3OYYA 4DV2L 2OTJA 1LTLA 1OXSC 1X54A 5GAHC 1K83H 3CP0A 4A3DG 4O0AA 4A3EH 1YJNA 5C4XG 1AE3A 2EIFA 4DKAC 3FP9A 2UUCL 4LFCQ 4P75A 4GOPC 3H3VH 3PO2G 1IBLQ 2PMZE 1GD7A 3NENA 1GKHA 1Q46A 3AYHB 4BBSH 1NBWA 5E7NA 1VQIA 2UUAQ 4JV5L 2D0OA 1Q1BA 4DR1L 1I50H 3NELA 4LF6Q 2R7ZH 4XTCS 1MJCA 1PH3A 1HNZQ 3PO3G 3CCSA 1YHBA 1PVOA 1BBWA 4NXNL 2WB1G 3I4MG 4JBKA 2WP8J 3A5UA 4LF8Q 1HR0Q 5IP7G 2HHHQ 3GTOH 1B70B 1X3FA 1EWIA 4IPHA 3RN2A 1FJGQ 2YTXA 2HQLA 2OTLA 4GLAC 4HJAA 4JI1Q 1HZBA 1UE5A 1RIPA 4GS3A 3SGIA 3CMEA 4JI0L 3F2DA 1PFSA 4AIMA 4GOPA 1YJWA 4GLVB 3RR5A 1RL2A 5C44H 4YHHQ 1XMOQ 2PQAA 2N3SA 1WJJA 4IO9A 2K5VA 2N49A 4P73A 4X64Q 3ULPA 2UUCQ 1ASZA 1CKMA 3HOUH 4LUOA 1J5EL 5IY0A 3CW2C 5JJIA 2D62A 2VW9A 1Q82C 5AJ3Q 5GAGC 4OWXB 4JBMA 4WJ4A 4JV5Q 5K36G 4DR1Q 1VQKA 4B3SL 1UE6A 1N9WA 5ELOA 5C3EH 1G291 4X65L 4HIMA 5IYDG 3J7ZC 4GLXA 1XPOA 2E2JH 4OWWB 2WB1E 1EOVA 1W3SA 3KDFB 5IWAQ 3F2CA 1HNXL 3M3YH 1V1QA 4NXNQ 2NN6G 4B3ML 1SE8A 4A3JG 2FXQA 3M85A 1SFOH 1VQLA 3KJOA 1KXLA 1PH7A 4A3KH 1CKNA 1XPRA 4A3BH 1BKBA 3G48A 1C0AA 2N78A 3GTQH 4X62L 1PYBA 3E9IA 2ZJRA 4DV3Q 4JI0Q 4JI8L 3KF6B 3J81i 1K3RA 3BU2A 1E7ZA 1VQDA 2OWOA 4LF9Q 1XNRL 3CC7A 2VS1A 4P71A 3H3VI 2CFMA 3T1YQ 1YJ9A 4A93G 4DR4L 3G4SA 4A3GG 2ZM6L 1J5EQ 3KFUA 2ZTDA 3FHWA 3ICEA 3F1ZA 3PV0A 1I5FA 2JQOA 4QIWE 1PV4A 2NVTH 4A3FH 3S17H 2KHIA 4X6AH 2MFIA 4YCVA 5IP9H 1A8VA 1PH2A 3GTJH 1L1OA 1CUKA 3CC2A 2N8NA 4B3SQ 1AH9A 2JJQA 3WWVA 5H1SE 3AFPA 3M4QA 4GN4B 2ES2A 2E2HH 4MTNA 1YEZA 1JB7A 1E22A 4BY1G 3DLLA 1X9NA 4HJ9A 1HNXQ 3RZDH 2UXDL 4DR2L 1HH2P 2AMCB 3PF5A 1PA6A 4B3MQ 1QVFA 2CCZA 4JI7Q 1K0RA 1NE3A 5HGQA 3CCLA 4OXPA 2JEBI 2VUMH 4HIOA 4KI0A 3J7A5 2E5LQ 1D7QA 2K50A 4BBRH 3KOJA 3K8AA 1TWGH 3HOZG 4AQYL 2R7FA 4RG1A 3UE1A 3S1RH 3S1QH 4R4TA 2YU9H 1S40A 1E24A 3PCOB 1GM5A 2C35B 4A3MG 1V43A 1CSQA 3K7UC 1NJIC 1G6PA 4DNIA 4DR4Q 3CAMA 1VQMA 5C0XJ 2BH8A 2NVXH 2PI2E 2UUAL 4ALPA 4APVA 3JAMc 2RHQB 2IY5B 2AWOA 3CD6A 4LWCA 4C3IH 2A19A 1EQRA 3PUXA 1E3PA 1VQ9A 2HIVA 1U0LA 3UDXA 3PF4A 1BBUA 4POGA 4GKJL 2DUDA 1CKOA 1IXRA 3LGJA 3RLNA 2UXDQ 1CSPA 1WOCA 4DR2Q 4JG2A 4YWKA 4JI6L 1FJGL 2V1CC 3W5OA 3I4OA 4L5QA 4JI1L 1JMCA 1VQCA 5M3FH 4HIKA 1PH4A 1YIJA 3AFQA 1EYGA 2UU9L 1VS0A 1GVPA 5HY6A 4IFDI 2GVAA 5M3MG 5C4XH 4A3DH 4QGUA 4AQYQ 4YHHL 1XMOL 1HNWQ 4DR6L 2Q2TA
chains in the Genus database with same CATH superfamily
4FF2A 1N34L 4DXGA 1DOLA 3C1EA 1CA6A 2F0JA 4BY1B 2CKZB 3MXNB 4UY8C 2M9VA 4P72A 3IRBA 4PMWA 3GDEA 3I90A 4LNQA 2L0CA 4TKOB 3CF5A 2BA1A 2CW0C 4UPAA 1YITA 1TT2A 2ATWA 1EEFD 1JE5A 1X65A 1TIID 4BA1I 5IP7H 3S2DB 5GROA 2K5QA 3K58A 2QEXA 4ZRZA 4JI6Q 5C0XG 2H5XA 3WOEA 1TR5A 2XGTA 3E9HA 4ME3A 4R9WA 1MKHA 2MO0A 1IYUA 2ZTCA 1TWHB 4LF9L 3W1BA 3J80c 3EFXD 3UDIA 4C3JH 5C4HA 2EPBA 4DV6L 1SMXA 3GTGH 2AUKA 2F0EA 3HOYG 4X66L 3VYTA 4JI3Q 4FF1A 5IYDH 4S3SA 5IGFA 2E2DC 2JA8H 1VQ4A 1XJVA 1M8AA 3C46A 4LF4Q 1V9PA 5D3IB 2CQOA 1EIYB 4POFA 2LS01 4DV5Q 3PIOA 5M5WB 1XMQQ 3STBD 2F52A 2JK8A 3K80C 1LUZA 4A3GH 1QB5D 1RKNA 4HMIA 4C1NI 1STBA 1CQVA 1K83B 1PFMA 2KVMA 2RDFA 4DUZL 2R93B 4HR7B 1F2ZA 4WJ3M 2R92G 1H95A 1AFPA 4CDFC 2B2WA 3O13A 1IW7C 4DK6C 4BBSB 4PZ8A 4KV6A 4XIGS 1BCPF 2NTSA 1R4QB 1AEXA 1EY9A 1DM0B 3B6YA 5C4ZA 3KLWA 3EROA 1X3QA 3KBGA 1YNJD 1STNA 4LF7L 2QA4A 1HNWL 2K5NA 5IP9G 2B2VC 3PUWA 4GKKQ 4IOAA 1DJRD 3FKIB 1E2ZA 3GV6A 4AH6A 1X6OA 1A2TA 2NB0A 4MN3A 1L0WA 3HOVH 2KECA 1O7ZA 1CA5A 1PRTD 1V1PB 3GTMH 1Y1VG 2N55A 3MEHA 4IJHA 3MAQA 2EZVA 4KY6A 3WDNA 1VQOA 4B3TL 2DGYA 1XX8A 2OCEA 4JOIC 1PRTB 4R4IA 5FJ8G 4MZ9A 2B2UA 2AWNA 3QIAA 3K5MA 1W6JA 4QMGA 1X3GA 2WAQB 1Q81C 1Q86C 1BDOA 5I4DA 1RJTA 1KLGD 1WI5A 4AYBB 2FFKB 3PUZA 1VF7A 1B8AA 1PLFA 5KYLA 2VQFQ 1XTCD 4YIJA 1Y8NB 3VDYA 1FR3A 4JOIA 1K8OA 1XNQL 3EIVA 5LL6X 1LYLA 3U4ZA 3I4NB 3ER0A 4XYQA 3PUYA 1SXTA 1XTDA 5C0XH 3T13A 2A6EC 4LF4L 4DV1L 2A74C 3NBHB 3OPOA 4DV5L 3QOLA 3LNNA 4IQZA 1STAA 2F3VA 4BBSG 1XMQL 1JOOA 1I6HH 4OEMB 3OW2A 4K8IA 1ZXTA 3M9BA 5KGUA 3ULJA 2CWPA 3IKJA 1TWGB 3A5ZB 3RMHA 5JAVA 1N36L 1UE1A 4C2MB 1A63A 3HOYH 4L8JA 3CQZH 1ONLA 3JAME 5L37A 2SDFA 2JXMB 1J6QA 2R3ZA 2B3GA 1IBKQ 1Z9FA 2R6GA 4IURA 1VQ5A 1TS5A 3W2DA 1FGBD 3I72A 5CV4A 1SRUA 3BVGA 3KJPA 1YVCA 2RQXA 2Z8LA 1KRTA 5C3EG 3OSOA 1HTLD 3UI2A 4CJ1B 4WFN3 1B50A 5DLQE 1LTGD 4DK3C 5C4XB 3ONAB 2X69A 4NP5A 3A55A 1JWUD 2R92H 2RVLA 3T4AC 4YWMA 4IPCA 3TBIB 2NWGA 4DR5Q 4OONA 3R2IA 2JA9A 3BYYB 4UP9A 3IFDA 4BY1H 4JYAQ 3ERQA 3AEVA 2BH2A 5LMNQ 4GOPB 2VQEL 3PIO3 1VQ6A 1UWVA 2YTVA 3LWUA 4ZLTF 2E76C 2I5HA 2A68C 5FOBB 1PFBA 4MHEA 3CKIB 4QCLA 5A2QL 3T1HL 4ZCKA 1B3QA 2RF4A 1CK1A 1EQQA 1HJPA 1QVCA 2J4XA 3QG1A 1GUGA 1MD2D 3OW7A 5I9OA 5FKAC 1Q1EA 1YNXA 5LMUL 4LFAL 3GO5A 2AQ3B 1S5CD 3PGZA 1H9MA 1J9OA 4KD4A 1Y1VH 1PH8A 2UXCL 3J7AF 4A76A 4OX9L 3Q8DA 5T1GA 4AYBE 4PZ7A 1AZQA 5IE8A 3DM1A 3P7JA 4JI8Q 4R8NA 5FJ8H 4ZKBB 2IW3A 2L9HA 3D6WA 2WKDA 3NQTA 4CDCC 1GXDC 2B2YC 1GO3E 3SE0A 1U4MA 5C4JH 4B3RQ 1VQHA 5M5YB 2E2JB 1YZ6A 3NWSA 1S4ZA 2TSSA 2HDMA 1Q8KA 1PDQA 2ZM6Q 2ZXRA 1IL8A 4A3JB 1MI2A 1XWEA 4LF6L 4FDBA 2BOSA 4LW1A 1VDZA 2L5TA 1XPUA 2BE5D 4OO1I 2WFWA 4JI5Q 3BS1A 3TS0A 1AP0A 3U4VA 5C6AA 1RD9D 1CI3M 4DR3Q 5C3WA 4H0LC 4RGMA 1HA5A 4B08A 3OYYA 4FXKC 2OTJA 1TS4A 1X54A 4K2KA 5C4XG 1K83H 1Z7TA 4O0AA 3SK8A 1YJNA 3K5OA 1WVLA 1UEAB 3H3VH 3PO2G 1BCPC 1IBLQ 3I4LA 1GKHA 4BBSH 1ICFB 4JV5L 4DR1L 2XRQD 4L63B 1ENAA 2QW7A 4XTCS 4IUUA 2QKIC 1PVOA 3BDOA 5CMDA 3FMCA 4LF8Q 1B70B 1EIGA 5EPKA 4XYOA 1FJGQ 2YTXA 4M8AA 4GLAC 4HJAA 1A3VA 1HZBA 4JI1Q 3CMEA 5E1FA 4MTKA 3F2UA 4GZYC 1I4QA 3TDQA 2MPMA 3TZUA 2N49A 3TP7A 2UUCQ 3CW2C 3ND8A 5JJIA 2A5HA 3WOFA 3NTIA 3IL8A 5K36G 3A56A 4B3SL 3HOXB 5C3EH 3K57A 4HIMA 4GLXA 4JW0A 4NDXA 1W3SA 1XYIA 1HNXL 3M3YH 2NN6G 4B3ML 4A3JG 2FXQA 5CGKA 1VQLA 4WJWA 1LTRD 3G48A 2DJFC 1G8ZD 3GTQH 4JI0Q 5JPMC 2A6HC 4JI8L 3RZOB 1SNPA 3NPPA 3CC7A 1UUPA 4P71A 4XDXA 2CW0D 3M7GA 2ZM6L 2WB1B 1J5EQ 1RODA 2ZTDA 3FHWA 3ICEA 2NVTH 1B2TA 2JQOA 4HSPA 2B39A 2IJ0A 4YCVA 1A8VA 2VB2X 3CC2A 2K6AA 5I2XA 1HQMC 1R4PB 2ES2A 2E2HH 1YEZA 1X9NA 2AMCB 1QVFA 1S5FD 2CCZA 1NE3A 4C3JB 4OXPA 4HIOA 3NHHA 3J7A5 3GTGB 4CKBA 4QIWB 3BG3A 1TWGH 5DM63 3S1QH 1Q90A 3CHBD 4KY5A 2C35B 4C1NK 1TU2B 1NJIC 2PI2E 1AZPA 2IY5B 2B8FA 4KKUA 3CD6A 1W6KA 1STEA 4CKEA 4DA2A 2A19A 3HOWB 3PUXA 1E3PA 1NUCA 3UDXA 4XT3B 2O2LD 2DUDA 1TVXA 3LGJA 3KBXA 1RDPD 2IWHA 1FJGL 2V1CC 1JMCA 4A3GB 4JI1L 1PH4A 3Q0AA 1EYGA 1SBBB 5C4XH 4AQYQ 4ZKCB 4DN4M 4EGVA 3PO2H 3F8TA 4KTAA 1FNVA 3KLSA 1IW7D 2F0MA 1SMYD 1JORA 2F3IA 1FNUA 1LACA 3LX0A 2I07B 1M4VA 1SNQA 1SYGA 4FF3A 1EY7A 2NVQB 4DPGA 2HDLA 4CHTB 4ME5A 3OIQA 1ZYRD 2CH4A 4KLKA 1K73C 2X6LA 1WTXA 3K7AH 4KJNA 3KF6A 2CVRA 1Y1WB 1VCIA 4B9XA 3CCJA 4Y52H 1HZAA 2F0NA 2RDHA 3QJYA 2VNUD 5IYBG 2E2IH 1EY0A 5FO7B 2NVYB 1KDCA 1A62A 1H9JA 3L7ZC 1N34Q 1WTRA 2GN5A 1BF4A 3BDCA 1SNDA 4FXGC 1D2BA 3H91A 2RSOA 4MNOA 1C9OA 5K36H 1KRSA 1MBYA 1SYEA 3AQQA 5M5YH 3CU7A 1W2BA 2F0OA 4B9WA 5LMNW 5D3DA 2NN6H 4K0KQ 4A3JH 3X3NA 4O42A 4JK1C 1K8AC 1E2WA 1PHJA 4A3IB 5JJLA 2X6GA 1FL0A 3HOWG 2L1BA 2XTIA 1BOSA 3E5SA 2UXBL 1CZGA 4DV6Q 4WRDA 2K28A 2R7DA 4IN3A 3I73A 1ICWA 2A6ED 4X66Q 4YY3L 3EBEA 3ZJYC 1PH5A 2LXJA 2I46A 1VQBA 5J3BA 1D8LA 1PXUA 1SE2A 3J81j 4P2CB 4JI4L 1I6HB 3MC0B 2HUGA 1KHIA 1NR4A 1EY4A 2PI2A 1U5KA 1YNNC 4IJLA 3HOYB 2F0HA 1N33L 1KLUD 2IHFA 3PQIA 4K5WA 2BA0A 3R93A 1OO9B 5J22A 1Y1WG 2NZHA 4N9TA 1SYFA 2K4KA 1Y8OB 4L5SA 5E4WC 3QR8A 3T56B 3J81L 4DUZQ 3CCQA 2IHEA 2Q2UA 1JJGA 1TY2A 2WIIB 4ZQ3A 5HGTA 3M4YA 3U58A 4BY7G 5JEAJ 1VMCA 4A3CH 3HOXH 1K0SA 1HFGA 5CV9A 2F0KA 5IIFA 5COYA 3AU7A 4DV4L 2NZOA 2R92B 3G6JB 4LF7Q 4ODGA 1BNZA 3RLOA 2B29A 1B7YB 2ZT9C 3AMUA 4RMFA 4MIUA 4RHRA 4DAMA 1XXGA 1GUSA 2C9OA 2H4OA 2ID0A 4A3IG 3RZOH 2PNRC 3H0GG 1WCMG 2SNSA 1LM0A 1IBML 1TS2A 4B3TQ 3S17B 4K0KL 1LTSD 3A54A 3HG9A 4A3EG 3NWTA 3A74A 4I7AA 5CV7A 1PH6A 1F2MA 4K5VA 2F4VL 3HKZG 4NPSA 1HHVA 5IYBH 1STYA 3I56A 5I2YA 2E75C 1Y1VB 3DXJC 3UDGA 1PYSB 2PO4A 2K03A 4IFDJ 1NAPA 1DYQA 4K5XA 3QOJA 2L12A 5C4JB 2LXKA 3TQYA 3D31A 3JAMi 1XNQQ 3D8GA 1Q12A 1I4RA 4UP8A 1ILQA 4IUVA 4KJOA 3CXCA 4YCWA 3HFZB 5C44G 1LABA 1NSNS 2Y0SG 1U4LA 3UE0A 3HKZE 4DV1Q 2CWAA 3K0YA 4DAVA 2HQEA 4K14A 3HOWH 3FPPA 5DM73 4K6LA 3BVMA 3SR1A 2KCTA 1TY0A 1Q8IA 1SYDA 2RCFA 2KENA 5CYUA 5A2QE 5KNDA 1N36Q 2AUJD 1GUNA 3CRKC 1L1OC 1EUJA 1F77A 4O2DA 2EXDA 2B8GA 3RD4A 2CH4W 4A3BG 3T53B 1PFNA 1A6XA 3D6CA 1BCPB 2NYZD 3S24A 2Y0SE 5A35A 2EJGC 4GN3B 2NVQH 1RTOA 5EKIA 1VQ8A 2Q2IA 1DOMA 1E1TA 4A3FG 3DHQA 1GUOA 4EQOA 4NXML 3GTPH 1KC8C 2F0TA 1D5MC 1Y1WH 2QILA 3J80i 3JC66 4JI2L 4Q5VA 3EA6A 5GAEC 5I9PA 2NVYH 2KBNA 2RCNA 4TVAB 3H09A 2F03A 1QILA 4A75A 4TRDA 4DGZA 3HZXA 4G7HC 4BBRG 1C8CA 4LJZC 2YV5A 5EBCA 3SEBA 3NTHA 3NK9A 4R4CA 3GTKH 4BY7H 4ZUIA 5C3EB 2VQEQ 2RA4A 1O80A 2BDOA 3MZ5A 2B2VA 5ELEA 4YWLA 4RGNA 3M3YB 2FMMA 2MJ8A 1WTQA 3T1HQ 3EN2A 1DXMA 2XRSD 5KRUA 2JN4A 1PH9A 1STHA 3GTQB 1HNZL 5AFWA 1LTAD 5ELBA 2LMCB 5D65A 4C3IG 4A3IH 4RHSA 4LFAQ 5LMUQ 1ML0D 1HR0W 1LO5D 1TWFH 3U9SA 2HHHL 3H0GH 1WCMH 4A93B 2UXCQ 2ALYB 5IT9L 4OX9Q 1QE6A 5M3FG 3S16B 2NVTB 3L3OC 1OXSC 3S1NB 4A3DG 4A3EH 1AE3A 2O4XA 2ICIA 4P75A 2EYOA 2E2HB 3NENA 1BO0A 3I3CA 1Q46A 1VQIA 2D0OA 5FLXL 4LF6Q 1MHWC 1PH3A 1MJCA 5ELDA 3K6OA 3CCSA 1BBWA 1QG7A 4NXNL 3S1QB 3I4MG 1G2TA 1EYDA 1I4PA 4JBKA 2ICEC 2WP8J 4A3MB 1X3FA 1EWIA 3S2HB 1HA6A 1PFSA 4AIMA 3Q24A 3V96A 3DWQA 5IGGA 3RR5A 5C44H 2NBFA 4YHHQ 2PQAA 4FP5D 4IO9A 3MVVA 4P73A 1D1IA 4X64Q 3ULPA 1CKMA 4LUOA 3M4OB 5IODA 5IY0A 1ENFA 4LK1C 4IALA 2RBMA 1WTVA 5GAGC 4JBMA 2R61A 4JV5Q 4DR1Q 1ZKOA 3NQIA 2H1EA 3F2CA 1EOVA 3NSWA 5LL6S 3PO2B 1DD2A 4C3HB 2JSOA 1XPRA 1CKNA 1U4RA 4A3BH 1C0AA 2K05A 4RH6A 2ZJRA 1QCBD 2DNEA 3KF6B 3J81i 1K3RA 4EVOA 2PQEA 1VQDA 2VS1A 3T1YQ 4A93G 1YJ9A 4DR4L 3QB3A 3KFUA 1SE3A 3VR3A 2O5IC 3F1ZA 4X6AH 3S17H 4A3FH 4H7BA 1SNMA 3K7AB 5IP9H 2ZXOA 1CUKA 2A69D 4B3SQ 5CC4A 2JJQA 3OMGA 4GN4B 4DAYA 2E2IB 3DLLA 1HNXQ 2EY5A 4HJ9A 1X32A 2KHSA 3RZDH 2F0WA 2K04A 3TSSA 4B3MQ 2Q8TA 5M9OA 1D7QA 4BBRH 3KOJA 1LT3D 3HOZG 2R7FA 5I6WA 1PTOF 3S1RH 4R4TA 1E24A 3BDLA 3PCOB 4A3MG 3K7UC 3I70A 3OHXC 1CQFA 1VQMA 5EKKA 5C0XJ 4UAIA 4ALPA 4G7ZC 2LY7A 2RHQB 1LT4D 4HEDA 4LWCA 4C3IH 3MA2B 1EQRA 3FDTA 2HIVA 4GKJL 3H6MA 1BBUA 1SE4A 5CBAE 5EQ0A 5BN3A 4X3KA 1WOCA 1EYAA 5FO9B 3VYRA 3W5OA 1VQCA 2B2YA 5M3FH 4HSVA 4ILWA 3AFQA 2UU9L 1GVPA 2Q8IB 4IFDI 2GVAA 5M3MG 4A3DH 4PNYA 4QGUA 4YHHL 4OHJA 2M2LA 1O7YA 4DR6L 1G91A 4X64L 3OOCA 3TP5A 1ESRA 1TKWB 4C3HG 1Y14B 2FHTA 3RUZA 3SK4A 4JBJA 3OMCA 3S1MH 3CPWA 3VR5A 1OXUA 3KYHC 1EIFA 3Q23A 5IGEA 4OWTB 1L0XB 4HTHA 5IYCG 2DN8A 1NTGA 4IOCA 1VF5C 1YNND 4U673 4R1JA 1I4XA 3DUZA 2ZJQA 1X55A 4A3LG 1CM9A 3MXGA 4KHZA 4KHVA 1X3EA 2KEEA 1KAAA 4R4OA 3BJUA 2WINB 1JOKA 3H15A 4HIDA 1HZCA 4ID6A 2K75A 4DV0L 3GTLH 3L2PA 4RWSC 2R7ZG 4LFBL 3T1YL 1ENCA 1KAWA 1H9SA 2J0TD 2I5LX 1YNJC 1SLJA 4PG3A 4L5TA 2IPKD 1LTBD 1C4QA 4FNFA 5JPNC 4RKLA 4N8X1 3L9AX 4BWGB 5GADC 2EOTA 1PZJD 1X3PA 4JC0A 4Q0FA 1IZ6A 5IT9c 5ELNA 2UUBL 2JA6B 3HKSA 4RGTA 1P16A 3E3XA 1I94Q 2VB3X 2JP1A 1JT8A 1Q7YC 5JVH3 1U4PA 1RCVD 3QWNA 4M1UB 3V05A 4A93H 3JAML 2KUMA 3S16H 3TMEA 2SEBD 4OO1G 1X56A 4KD3A 2BCOA 3DEPA 2XWJB 3S1NH 1T9HA 3NP8A 5EPLA 1EYCA 2VY3A 1SNCA 4DUYL 2F1MA 4BXXG 1VQFA 1VQPA 2F4IA 2MHVA 2A73B 1KIXA 2KCCA 1I3QH 2KQ3A 3TREA 2QGQA 2B63G 3HOZH 3TP8A 3BZCA 4KN4C 3GTOB 2D5DA 4J6HA 4A3MH 2GA4B 1UEBA 4LUZA 4GNXC 2UXBQ 1G2SA 3S2HH 4L6TB 2FINB 2WV6D 1JICA 1EU4A 2GVBA 3HOUB 3I7FA 2WACA 4YY3Q 1RF2D 3M4OH 1EY6A 5J39A 1N32L 1HUNA 1FVIA 4JI4Q 1HPCA 4HJ8A 1A3TA 2KJXA 5D14A 3VYSA 4KHPL 2OF1A 5KEEA 5BR8L 5E3FA 4GNXA 1PMRA 3P20A 5M3MH 3J80L 1BBXC 4YCUA 4K6DA 4HMJA 2XN9C 1VQNA 1N33Q 2JA6G 4JPBW 3A8JE 4C3HH 1F2LA 3EVQA 1IYVA 1LT5D 1QUQA 3L0OA 3P75A 4A4IA 1AW7A 1JQYD 4F8MA 1G51A 2Z0SA 3RLFA 5IYCH 1O7IA 3TN2A 5HURA 2EVBA 2MNAA 1WTPA 3DM3A 4A3LH 3HS0C 4H02A 1OXVA 3GTPB 3T51B 3OTOL 5CV8A 4P74A 1NCVA 4ULLA 2KA7A 3U50C 2OT2A 3RN5A 1I94L 4U68A 2KHJA 3K0XA 4DV4Q 1GUWA 1BR9A 4RCNA 2QF7A 1QZHA 1PTOC 1A2UA 1V8QA 4R4QA 2YU9B 1D5XC 3GTKB 4BY7B 1Q3LA 3OWEB 2O5JC 2K52A 1EZ8A 1IBMQ 2PMZB 4FXDA 1IYJB 1YBYA 2D2CC 1QNUA 4DV2Q 2Q8RE 1F2YA 4ZAIA 1FYCA 3TS2A 2YTYA 3G6EA 3HOUG 4EX5A 2F4VQ 2HT1A 1TWFB 4DNRB 2QCPX 3H0GB 1WCMB 2F0UA 4CJ2C 4CBVA 1OTCA 4HCSA 3BZDB 2B2TC 1F9SA 4TSSA 4OO1H 3CPFA 1EEID 4A3EB 4NKLA 1DGSA 2JA8G 4LUVA 1QWYA 2MQHA 1JWMD 4J8QA 1WD1A 3HKZB 4QB4A 3ERSX 4BXXH 3RNUA 3Q22A 5G3LF 1K8MA 1PH1A 2WKCA 1B9NA 1K9MC 3FRPB 1GHJA 4X3TA 4JBWA 2K33A 2L15A 5C0XI 3H94A 3GQBA 3S14H 1S3OA 1LTID 2PQAB 2I0QA 4BS9A 2ASBA 2B63H 4PMBA 2B2TA 1ASYA 3HP3A 1MIUA 1KL9A 5CORA 3MHBA 2QDBA 3GD7A 4IUPA 1J8IA 1C48A 1S5BD 4X65Q 1GHKA 5IGDA 3Q6SA 5JJKA 2Z4HA 3I91A 5C44B 1YHQA 4ABNA 2Y0SB 1BVSA 1T5XD 2E8GA 2VUMG 3NBIA 4OL7A 2MGSA 1CKNB 1BXTA 3I2ZA 3BZKA 4NB3A 1TWAH 1GOZA 2K7VA 2IX1A 2F0GA 3AB9A 5IT9E 4LFCL 4JCVE 2VL6A 4DFAA 4K2LA 2KOLA 2RDGA 4UHVA 1CHPD 2IX3A 1F9PA 3HOVG 1TWCB 1VQGA 5E4XA 2G9DA 2IX0A 2YYZA 4NXMQ 2JA6H 4A3BB 1OXXK 1ZEQX 5JVG3 4N9PA 1EFWA 4NW2A 5GQOA 1EWHA 2D0PA 4JI2Q 5DNFA 5FLXE 5T1IA 1HR0L 1BUVT 4DAYB 1Z47A 2OEOA 2BDNA 1PZKD 2LKVA 4QQBX 4I65A 2A68D 1S72A 2EYJA 1D1KA 1AN8A 4DV2L 1LTLA 4A3FB 3KK7A 2OXPA 1K28A 5GAHC 4R8IA 3C1FA 2HCCA 4DKAC 4E6IA 4XXEA 2PMZE 1GD7A 1EY5A 3RZDB 4QUFA 3AYHB 5C3XA 1NBWA 1EQVA 4QUCA 2G5DA 2UUAQ 1I50H 3NELA 2ZXPA 4ZUJA 4KMUC 3IAYA 1HNZQ 4BBRB 2QDLA 3PO3G 1CHQD 3E6ZX 3S1RB 5J1ZA 2F0LA 2SOBA 1HFNA 2HHHQ 3GTOH 4IPHA 2F3WA 2HQLA 4GS3A 3W3AA 3F2DA 4PQXA 4KN7C 1RL2A 4I7ZC 1XMOQ 1SEBD 3K5NA 4EQPA 1WJJA 2K5VA 3A7AB 4C3IB 5C5MA 3HOUH 1Y69U 5CV5A 4IUQA 4H44C 4OELB 5AJ3Q 3ND9A 4WJ4A 2RSNA 1VQKA 2V4DA 1N9WA 5M3FB 2KCNA 5ELOA 1G291 4X65L 4RCOA 1XPOA 3J7ZC 2PW5A 4OWWB 1II3A 5IWAQ 4OIJA 4A3DB 3VR4A 4NXNQ 1SE8A 2B2WC 1SJED 3M85A 1KXLA 3S9WA 2JA5B 1LLRD 1WD0A 1JOQA 1BKBA 2C5CA 1BCPD 2N78A 3TZDA 1PYBA 3E9IA 4DV3Q 2K5DA 2IL8A 3S1MB 1JE4A 2FJ2A 1KDAA 3HGBA 1H9RA 1E7ZA 3H3VI 1ET6A 2CFMA 1VMPA 1EU3A 2EJMA 3G4SA 3KF8A 3I4MB 3PV0A 1PV4A 1H9SB 2KHIA 4Y7NB 2MFIA 3GTJH 1L1OA 2PZTA 1AH9A 3WWVA 3G7LA 3HRZC 3FPUB 3N52A 5H1SE 1SMYC 3SHLA 4MTNA 4BY1G 3DWPA 3C3LA 2Z1CA 3GTLB 2UXDL 4DR2L 4JI7Q 1ET9A 3TP6A 5HGQA 3CCLA 2JEBI 4CGYB 5KYIA 2VUMH 2HCIA 3U9OA 4KI0A 1GJXA 2E5LQ 3K8AA 3MXPA 3DWAA 2B2UC 2TMPA 4HCEA 2AQ1B 3MXUA 1ZYRC 2YU9H 1GM5A 1V43A 1LV9A 4LAAA 1HUMA 4K8JA 1WTHA 2F0FA 4DR4Q 3CAMA 5F2DA 4ZYSA 1EFID 2BH8A 3LWEA 2NVXH 2UUAL 2NUCA 1MSGA 4APVA 1HXYD 2AWOA 3VR6A 4DU9A 1B9MA 3DEOA 1CFMA 1I4GA 1PRTF 2A6HD 2L11A 1U0LA 4DK0A 4POGA 1DZ1A 2F0IA 3RLNA 1CSPA 4JI6L 4JG2A 4RGOS 1HCZA 1QNKA 1YIJA 4EQNA 1IHZA 2Z4IA 1VS0A 3VYUA 3GV3A 4PV1C 3EQLC 1XMOL 1G6ZA 4CDEC 2Q2TA 2JYOA 3NEMA 3K81C 3D0FA 1R9TH 2JA5G 4RKBA 5TSSA 1KNEA 2EJFC 2JA7B 1A3UA 2AHOB 4F87A 5AJ3L 1KDBA 2HIXA 1QZGA 3ZYYX 1I3QB 1F9QA 4JI3L 3KDFA 3VA5A 3PO3H 2PPBC 3J81c 3HOZB 5KNCA 5IWAL 3PIPA 4GKJQ 3BYTB 4DV7Q 2RHSB 3CMAA 2R93G 4V190 4DV3L 2AKWB 2UU9Q 1HTPA 5DAUA 5NUCA 1YI2A 4GNXB 2EYMA 3ITPA 5M5XH 3IFTA 3S15H 2EY1A 5I6YA 4DR6Q 2XWBB 1L2FA 1NMFA 3EJIA 1VQAA 3G71A 1O7LA 1KD1C 3ULLA 1OXTA 4UP7A 3CC4A 1QUQB 1IKMA 2JEAI 1E1OA 2A8VA 5M3MB 3OIPA 1DCZA 3FKIG 1MGSA 4JI7L 1TWCH 2DY7A 1WYDA 4FVMA 2E5LL 2PNHA 1MSHA 4NMZA 1SROA 2D9UA 4HN7A 1EQTA 2Q2HA 1A0IA 3VR2A 4DV0Q 4GKKL 1EZ6A 1QVGA 4LFBQ 3W1GA 2P5ZX 2ZJPA 2EY6A 1JJCB 2K1BA 5EJWA 2WAQG 4Z9CB 3CCRA 1M1KC 2CQAA 1JCKB 2PZUA 1NY4A 4AYBG 2KEDA 3URYA 2K5HA 1EWCA 3D4DA 5IGCA 4CKCA 5CV6A 4IUTA 2JA7G 2J7ZA 1FNWA 2PW7A 3MEFA 2R7ZB 1VQEA 3OWFA 2UUBQ 4HJ5A 2DJGC 2IT1A 2Z6BA 2M00A 1SAPA 2CHBD 1PTOD 4HAEA 1AE2A 4DXFA 3I4NG 4XQJA 1PTOB 3S2DH 3F2BA 2EYFA 2F0QA 4C56C 3CCEA 5FLMG 3MXNA 2SNMA 3J80E 2VQFL 3E0EA 1K8GA 1B44D 4XT1B 2MUYA 2WAQE 4XQQA 2F0SA 5JJZA 1B53A 1JR0D 1HZ9A 4G57A 1TWHH 2Z6KC 5EPJA 4PZ6A 4DUYQ 2VZAA 2NN6I 1M90C 1U9RA 2XIWA 4DV7L 4WORA 1SN8A 3D3RA 5EKLA 1FGUA 1O78A 2JE6I 3R3OA 5KIXA 5K5PA 2EQSA 1ESFA 1VQJA 1SFOB 1QJOA 1KTKA 3VA7A 1NMGA 2K01A 5ISRA 4X3SA 3TEHB 1E0BA 4A3KB 5BN4A 4OGQC 4IPDA 2JA5H 2Z6KA 5LHY1 2Z9HA 1S5ED 1H9KA 4DR7Q 3A0JA 4O1NA 2I5MX 5M5WH 3BVZA 3STBC 3S14B 2LSSA 2EYPA 2B63B 1WFQA 1IBKL 1MJEA 3H3VC 3I4MH 4OIKA 5KNBA 1N32Q 3MFGA 3MTSA 4DK1A 4Y7NH 3FEWX 2R93H 1N8RC 4RAUC 4KHPQ 2OQKA 5BR8Q 4JVZA 1CT1D 1FD7D 1SYCA 3PSIA 4KY7A 3V2TA 2K14A 1KQSA 3PUVA 5EGTA 1L0YB 3A7LA 5ELFA 1KABA 1D5ZC 1CTMA 1I4HA 4FO2A 4BA2I 1TWAB 4RA8A 4X3UA 5JEAG 4KKSA 4G4KA 1VQ7A 1A15A 3PMFA 4LF5Q 4TQUS 4DR5L 3PIP3 4PMCA 4IPGA 4EQ5A 2K5WA 3FKIH 1QOHA 4HJ7A 4JYAL 3CRLC 1C7YA 5LMNL 2EE1A 1YHAA 3CCVA 3OTOQ 2RKSA 1PRTC 1TXYA 1S5DD 1DOKA 1GUTA 2ENBA 1EL0A 1SR3A 3T16A 1F9RA 1RTNA 2DNCA 2NTTA 4XQNA 1UE7A 1D6EC 5CR3A 4FYDA 5FLXc 1V1PA 1TS3A 3KLSX 3K59A 4QL5A 3SK6A 3NTKA 2PYKA 3M7NA 4GN5A 4A3KG 2ZTEA 5BN5A 3CCMA 3J81E 2JA7H 4IFDG 1I50B 4B3RL 1TQOA 3GP7A 5EBDA 1LTTD 4J15A 1JJ2A 1LT6D 4L5RC 3I4NH 1WTOA 3I8ZA 3NUCA 2LFNA 2FMCA 1NR2A 1STGA 2OQ0A 3QO2A 4QJFA 5FLMH 1KNAA 1NNXA 2KCMA 4JI5L 4DR7L 2A1AA 1Y8PB 4DR3L 4KKTA 1PYWD 2DY8A 4DAPA 4X62Q 3NXWA 1I6VC 1SNOA 4C2MH 1XNRQ 3NBHA 3I55A 1PZID 2XVSA 4IUNA 4FF4A 2F0VA 1IBLL 3DMUA 1JC7A 2JA8B 4QY7A 1UAPA 1UNSA 3KF8B 2E74C 4G7OC 2MO1A 4UDUC 4LMQD 5EAYA 1IL2A 3CCUA 1L1OB 1P8LA 2NZ1D 3KLRA 3M4PA 4LF8L 1JB3A 3UDFA 4LF5L 4IZ8A 3TRZA 4F88A 3D4WA 4A3CG 3HOXG 4DF7A 3CP0A 3GTJB 1HRJA 2G9HD 3HEJA 2EIFA 2UUCL 3FP9A 4LFCQ 3SK5A 4GOPC 4F7XA 1B4OA 2PCFB 1EY8A 1K3BC 1T5EA 5E7NA 1Q1BA 2R7ZH 1SDFA 2VUMB 3KUPA 1DONA 1YHBA 3P1HA 5JEAH 1SSOA 2F0PA 2WB1G 1EOTA 1E2VA 3A5UA 3A8KE 1HR0Q 5IP7G 3RN2A 1JWSD 2MP1A 2A69C 2K32A 3X3MA 1PTOH 1SYBA 2OTLA 2AQ2B 1UE5A 3SGIA 1RIPA 3A8IE 4JI0L 4GOPA 1YJWA 2NVXB 3HOVB 3FVQA 4GLVB 3GTMB 2L55A 2N3SA 5CBEE 1ASZA 4C3JG 1J5EL 3J7AV 2D62A 2VW9A 1Q82C 4OWXB 4H13C 4N8FA 1UE6A 5IYDG 2E2JH 2L4NA 3SXHA 3R2TA 2WB1E 3KDFB 3MFYA 4J1MA 1V1QA 4CDDC 1SFOH 4DNTB 4CJ0B 3KJOA 3J7YW 5G3LD 1R9TB 1PH7A 4A3KH 2BE5C 1B3AA 5FO8B 2EYLA 4X62L 2EYHA 2EXZA 4IFDH 3BU2A 1XNRL 2OWOA 4LF9Q 3N6RA 2F0DA 3PO3B 2EDGA 4ZK9B 4A3GG 3MWYW 4RFBA 4QIWE 1I5FA 1ILPA 1PH2A 2QEJC 2N88A 1Z6HA 2N8NA 1WTWA 3AFPA 3M4QA 1JB7A 1E22A 5M5XB 2PZWA 3S15B 3PF5A 1HH2P 1PA6A 5JOBA 1K0RA 3R8BA 2K50A 5FK9C 4AQYL 4RG1A 2XSCA 3UE1A 3CQZB 5ELCA 1S40A 5IOCA 5DEHA 1V1OA 3D4RA 1CSQA 1G6PA 1CZWA 4DNIA 3E0JA 4QF4A 1RHPA 3JAMc 1HQRD 2EY2A 3SVMA 2XNAC 3SDZA 1BQQT 1EIHA 2HD3A 5C5LA 1VQ9A 3PF4A 3K5LA 3C2PA 1CKOA 1IXRA 2UXDQ 4DR2Q 4YWKA 3I4OA 4L5QA 2VXWA 5IGBA 4HIKA 1SJHD 4V0BA 5HY6A 4KK7A 1B1ZA 3NE5B 1HNWQ 1IKLA
chains in the Genus database with same CATH topology
3NEMA 1N34L 4X64L 3F8TA 3D0FA 3K81C 3PO2H 1R9TH 2JA5G 1Y14B 2F3IA 2AHOB 2CKZB 3MXNB 2HIXA 4JBJA 5AJ3L 1QZGA 4UY8C 3S1MH 3CPWA 4P72A 3IRBA 4PMWA 3GDEA 1OXUA 4JI3L 4LNQA 3KYHC 1EIFA 3CF5A 4DPGA 3KDFA 4OWTB 2BA1A 3PO3H 4UPAA 3J81c 5IYCG 1YITA 5IWAL 1NTGA 4IOCA 2ATWA 1JE5A 1X65A 4R1JA 3PIPA 4GKJQ 2ZJQA 1X55A 4A3LG 4BA1I 5IP7H 4DV7Q 4KLKA 1K73C 4KHZA 5GROA 2QEXA 1X3EA 3K7AH 2RHSB 4JI6Q 3CMAA 5C0XG 2R93G 2H5XA 3KF6A 1VCIA 3CCJA 4DV3L 4Y52H 1HZAA 2VNUD 2XGTA 2AKWB 3E9HA 4R4OA 2UU9Q 3BJUA 5IYBG 1YI2A 4ME3A 4GNXB 3H15A 1MKHA 2MO0A 2ZTCA 2E2IH 4HIDA 1HZCA 5M5XH 4LF9L 2K75A 4DV0L 3GTLH 3S15H 1A62A 3L2PA 3W1BA 2R7ZG 3J80c 4DR6Q 4LFBL 3L7ZC 3T1YL 3UDIA 1L2FA 1N34Q 1NMFA 4C3JH 1VQAA 2GN5A 1KAWA 3G71A 4DV6L 1SMXA 3GTGH 2I5LX 1KD1C 1SLJA 4PG3A 3ULLA 4L5TA 1OXTA 4MNOA 4UP7A 3CC4A 1C9OA 1QUQB 3HOYG 1KRSA 2JEAI 4X66L 4JI3Q 5GADC 1E1OA 5IYDH 3AQQA 5M5YH 2A8VA 3FKIG 1W2BA 4JC0A 2JA8H 5LMNW 1VQ4A 1XJVA 1IZ6A 5IT9c 5ELNA 4A3JH 4K0KQ 2UUBL 4JI7L 3HKSA 1P16A 1K8AC 1TWCH 1WYDA 1PHJA 1V9PA 4LF4Q 2E5LL 2CQOA 1EIYB 4POFA 5JJLA 2PNHA 4DV5Q 1I94Q 3PIOA 1FL0A 1JT8A 1SROA 1Q7YC 3HOWG 1XMQQ 2XTIA 3STBD 2Q2HA 2F52A 1A0IA 2JK8A 4DV0Q 4GKKL 1QVGA 2UXBL 4A93H 4LFBQ 3K80C 1LUZA 3W1GA 4A3GH 2ZJPA 1JJCB 3S16H 4OO1G 4DV6Q 2WAQG 1X56A 2R7DA 3CCRA 4DUZL 1M1KC 3S1NH 4WJ3M 2R92G 1T9HA 1H95A 4X66Q 1NY4A 2VY3A 4YY3L 3EBEA 4AYBG 4DUYL 4BXXG 3ZJYC 2K5HA 1VQFA 2LXJA 4DK6C 4PZ8A 1PH5A 4XIGS 1VQPA 1VQBA 5J3BA 1D8LA 3J81j 2JA7G 4JI4L 3MEFA 1KIXA 1VQEA 2UUBQ 4HJ5A 1I3QH 2IT1A 1KHIA 3TREA 3B6YA 2PI2A 3KLWA 2QGQA 1AE2A 2B63G 1U5KA 3HOZH 4IJLA 3BZCA 4LF7L 2QA4A 3I4NG 2K5NA 1HNWL 5IP9G 4A3MH 1N33L 3S2DH 1UEBA 3PUWA 3F2BA 3CCEA 4GKKQ 4LUZA 4GNXC 2IHFA 4IOAA 2UXBQ 2BA0A 5FLMG 2VQFL 1K8GA 3E0EA 3S2HH 1Y1WG 2NZHA 4AH6A 1X6OA 2WAQE 2K4KA 4L5SA 1L0WA 3HOVH 4DUZQ 1HZ9A 3GTMH 1TWHH 1Y1VG 2GVBA 2Z6KC 4IJHA 3CCQA 2IHEA 3I7FA 2Q2UA 1JJGA 4YY3Q 1VQOA 4B3TL 2DGYA 2OCEA 4PZ6A 4DUYQ 2VZAA 4JOIC 3M4OH 2NN6I 1M90C 4R4IA 5FJ8G 1N32L 4DV7L 4MZ9A 1FVIA 4JI4Q 1SN8A 2AWNA 4HJ8A 1FGUA 3U58A 5JEAJ 4BY7G 4A3CH 4KHPL 2JE6I 3HOXH 1X3GA 5BR8L 4GNXA 2EQSA 5M3MH 1Q81C 1VQJA 1Q86C 4YCUA 4DV4L 2NZOA 4LF7Q 1VQNA 1NMGA 3RLOA 2B29A 3TEHB 1B7YB 1WI5A 4RMFA 1N33Q 2JA6G 4IPDA 2JA5H 2Z6KA 3PUZA 4C3HH 4DAMA 1B8AA 2VQFQ 3L0OA 1QUQA 4A3IG 3VDYA 4DR7Q 2ID0A 3A0JA 3RZOH 4JOIA 4A4IA 2I5MX 5M5WH 3STBC 3H0GG 1XNQL 1WCMG 2LSSA 3EIVA 1LM0A 1G51A 2Z0SA 1IBML 3RLFA 1LYLA 5IYCH 1O7IA 1WFQA 3U4ZA 1IBKL 4B3TQ 3ER0A 1MJEA 2MNAA 3DM3A 3I4MH 4K0KL 4A3LH 3PUYA 4H02A 1OXVA 1XTDA 1N32Q 3OTOL 4A3EG 4Y7NH 3A74A 2R93H 1N8RC 4P74A 4LF4L 4DV1L 1PH6A 4KHPQ 2OQKA 3NBHB 3U50C 5BR8Q 4DV5L 3HKZG 4NPSA 3RN5A 1I94L 5IYBH 2F4VL 2KHJA 3K0XA 3PSIA 3I56A 4BBSG 1XMQL 4DV4Q 2K14A 1KQSA 3UDGA 1PYSB 3PUVA 1I6HH 3OW2A 3M9BA 3ULJA 2CWPA 1QZHA 4IFDJ 4BA2I 3A5ZB 5JEAG 4R4QA 1N36L 1UE1A 1VQ7A 2LXKA 1A63A 3HOYH 3TQYA 3D31A 4LF5Q 3CQZH 4TQUS 3JAMi 4DR5L 1XNQQ 1Q12A 1J6QA 2K52A 4IPGA 4UP8A 4EQ5A 1IBMQ 1IYJB 3FKIH 2B3GA 1YBYA 3CXCA 1Z9FA 1IBKQ 4HJ7A 2R6GA 4JYAL 4DV2Q 1C7YA 5LMNL 1VQ5A 4YCWA 3HFZB 1YHAA 3CCVA 3OTOQ 5C44G 3TS2A 1TXYA 2YTYA 2Y0SG 3UE0A 3G6EA 3HKZE 4DV1Q 2CWAA 3HOUG 4EX5A 2F4VQ 1SRUA 2HT1A 3HOWH 3KJPA 1YVCA 1SR3A 1OTCA 2KCTA 1UE7A 1KRTA 5C3EG 5DLQE 2KENA 5FLXc 4DK3C 3CPFA 1N36Q 1DGSA 2JA8G 4LUVA 1L1OC 1EUJA 2MQHA 4QL5A 2R92H 4O2DA 4YWMA 4IPCA 2EXDA 3M7NA 4GN5A 4DR5Q 3ERSX 4OONA 4A3KG 3RNUA 2ZTEA 4A3BG 2JA9A 4BXXH 4UP9A 3CCMA 4BY1H 1PH1A 4JYAQ 1K9MC 2JA7H 3AEVA 4IFDG 2BH2A 4JBWA 5LMNQ 4GOPB 4B3RL 2L15A 5C0XI 2VQEL 3S24A 2Y0SE 4GN3B 2NVQH 1VQ6A 3S14H 1UWVA 2YTVA 1S3OA 1VQ8A 2I5HA 2PQAB 4J15A 2I0QA 2ASBA 2Q2IA 2B63H 1JJ2A 1E1TA 4L5RC 3I4NH 1ASYA 3T1HL 1MIUA 1KL9A 4A3FG 3GTPH 2OQ0A 2RF4A 3GD7A 4NXML 1EQQA 1HJPA 1QVCA 4QJFA 1KC8C 5FLMH 2KCMA 4X65Q 4JI5L 1Q1EA 1YNXA 3J80i 1Y1WH 3JC66 5LMUL 2A1AA 4LFAL 4DR7L 4JI2L 5JJKA 3GO5A 4DR3L 1YHQA 3PGZA 5GAEC 1Y1VH 1PH8A 2UXCL 2NVYH 1BVSA 2KBNA 2RCNA 4A76A 4OX9L 3Q8DA 2E8GA 4TVAB 4AYBE 4PZ7A 5IE8A 4A75A 2VUMG 4X62Q 1CKNB 3I2ZA 4JI8Q 4BBRG 3BZKA 4NB3A 1TWAH 5FJ8H 2IX1A 2YV5A 4R4CA 5C4JH 4C2MH 1XNRQ 2VQEQ 3GTKH 1GO3E 4BY7H 4B3RQ 4LFCL 3I55A 1VQHA 1YZ6A 4JCVE 2VL6A 4YWLA 1IBLL 1Q8KA 2ZM6Q 4QY7A 3KF8B 3T1HQ 3EN2A 4LF6L 3HOVG 4FDBA 1VQGA 2MO1A 2YYZA 2IX0A 4LW1A 4NXMQ 2JA6H 1PH9A 1XPUA 5EAYA 1HNZL 3CCUA 1IL2A 1OXXK 4OO1I 1L1OB 1P8LA 2WFWA 4JI5Q 4A3IH 3M4PA 3TS0A 1EFWA 4LFAQ 5LMUQ 5GQOA 2D0PA 4JI2Q 3U4VA 1HR0W 4DR3Q 1HR0L 3UDFA 1TWFH 4LF8L 2HHHL 4LF5L 3H0GH 4DAYB 1Z47A 1WCMH 3TRZA 2UXCQ 2ALYB 4OX9Q 4A3CG 4QQBX 3HOXG 5M3FG 1S72A 3OYYA 4DV2L 2OTJA 1LTLA 1OXSC 1X54A 5GAHC 1K83H 3CP0A 4A3DG 4O0AA 4A3EH 1YJNA 5C4XG 1AE3A 2EIFA 4DKAC 3FP9A 2UUCL 4LFCQ 4P75A 4GOPC 3H3VH 3PO2G 1IBLQ 2PMZE 1GD7A 3NENA 1GKHA 1Q46A 3AYHB 4BBSH 1NBWA 5E7NA 1VQIA 2UUAQ 4JV5L 2D0OA 1Q1BA 4DR1L 1I50H 3NELA 4LF6Q 2R7ZH 4XTCS 1MJCA 1PH3A 1HNZQ 3PO3G 3CCSA 1YHBA 1PVOA 1BBWA 4NXNL 2WB1G 3I4MG 4JBKA 2WP8J 3A5UA 4LF8Q 1HR0Q 5IP7G 2HHHQ 3GTOH 1B70B 1X3FA 1EWIA 4IPHA 3RN2A 1FJGQ 2YTXA 2HQLA 2OTLA 4GLAC 4HJAA 4JI1Q 1HZBA 1UE5A 1RIPA 4GS3A 3SGIA 3CMEA 4JI0L 3F2DA 1PFSA 4AIMA 4GOPA 1YJWA 4GLVB 3RR5A 1RL2A 5C44H 4YHHQ 1XMOQ 2PQAA 2N3SA 1WJJA 4IO9A 2K5VA 2N49A 4P73A 4X64Q 3ULPA 2UUCQ 1ASZA 1CKMA 3HOUH 4LUOA 1J5EL 5IY0A 3CW2C 5JJIA 2D62A 2VW9A 1Q82C 5AJ3Q 5GAGC 4OWXB 4JBMA 4WJ4A 4JV5Q 5K36G 4DR1Q 1VQKA 4B3SL 1UE6A 1N9WA 5ELOA 5C3EH 1G291 4X65L 4HIMA 5IYDG 3J7ZC 4GLXA 1XPOA 2E2JH 4OWWB 2WB1E 1EOVA 1W3SA 3KDFB 5IWAQ 3F2CA 1HNXL 3M3YH 1V1QA 4NXNQ 2NN6G 4B3ML 1SE8A 4A3JG 2FXQA 3M85A 1SFOH 1VQLA 3KJOA 1KXLA 1PH7A 4A3KH 1CKNA 1XPRA 4A3BH 1BKBA 3G48A 1C0AA 2N78A 3GTQH 4X62L 1PYBA 3E9IA 2ZJRA 4DV3Q 4JI0Q 4JI8L 3KF6B 3J81i 1K3RA 3BU2A 1E7ZA 1VQDA 2OWOA 4LF9Q 1XNRL 3CC7A 2VS1A 4P71A 3H3VI 2CFMA 3T1YQ 1YJ9A 4A93G 4DR4L 3G4SA 4A3GG 2ZM6L 1J5EQ 3KFUA 2ZTDA 3FHWA 3ICEA 3F1ZA 3PV0A 1I5FA 2JQOA 4QIWE 1PV4A 2NVTH 4A3FH 3S17H 2KHIA 4X6AH 2MFIA 4YCVA 5IP9H 1A8VA 1PH2A 3GTJH 1L1OA 1CUKA 3CC2A 2N8NA 4B3SQ 1AH9A 2JJQA 3WWVA 5H1SE 3AFPA 3M4QA 4GN4B 2ES2A 2E2HH 4MTNA 1YEZA 1JB7A 1E22A 4BY1G 3DLLA 1X9NA 4HJ9A 1HNXQ 3RZDH 2UXDL 4DR2L 1HH2P 2AMCB 3PF5A 1PA6A 4B3MQ 1QVFA 2CCZA 4JI7Q 1K0RA 1NE3A 5HGQA 3CCLA 4OXPA 2JEBI 2VUMH 4HIOA 4KI0A 3J7A5 2E5LQ 1D7QA 2K50A 4BBRH 3KOJA 3K8AA 1TWGH 3HOZG 4AQYL 2R7FA 4RG1A 3UE1A 3S1RH 3S1QH 4R4TA 2YU9H 1S40A 1E24A 3PCOB 1GM5A 2C35B 4A3MG 1V43A 1CSQA 3K7UC 1NJIC 1G6PA 4DNIA 4DR4Q 3CAMA 1VQMA 5C0XJ 2BH8A 2NVXH 2PI2E 2UUAL 4ALPA 4APVA 3JAMc 2RHQB 2IY5B 2AWOA 3CD6A 4LWCA 4C3IH 2A19A 1EQRA 3PUXA 1E3PA 1VQ9A 2HIVA 1U0LA 3UDXA 3PF4A 1BBUA 4POGA 4GKJL 2DUDA 1CKOA 1IXRA 3LGJA 3RLNA 2UXDQ 1CSPA 1WOCA 4DR2Q 4JG2A 4YWKA 4JI6L 1FJGL 2V1CC 3W5OA 3I4OA 4L5QA 4JI1L 1JMCA 1VQCA 5M3FH 4HIKA 1PH4A 1YIJA 3AFQA 1EYGA 2UU9L 1VS0A 1GVPA 5HY6A 4IFDI 2GVAA 5M3MG 5C4XH 4A3DH 4QGUA 4AQYQ 4YHHL 1XMOL 1HNWQ 4DR6L 2Q2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEM A;  1N34 L;  4X64 L;  3F8T A;  3D0F A;  3K81 C;  3PO2 H;  1R9T H;  2JA5 G;  1Y14 B;  2F3I A;  2AHO B;  2CKZ B;  3MXN B;  2HIX A;  4JBJ A;  5AJ3 L;  1QZG A;  4UY8 C;  3S1M H;  3CPW A;  4P72 A;  3IRB A;  4PMW A;  3GDE A;  1OXU A;  4JI3 L;  4LNQ A;  3KYH C;  1EIF A;  3CF5 A;  4DPG A;  3KDF A;  4OWT B;  2BA1 A;  3PO3 H;  4UPA A;  3J81 c;  5IYC G;  1YIT A;  5IWA L;  1NTG A;  4IOC A;  2ATW A;  1JE5 A;  1X65 A;  4R1J A;  3PIP A;  4GKJ Q;  2ZJQ A;  1X55 A;  4A3L G;  4BA1 I;  5IP7 H;  4DV7 Q;  4KLK A;  1K73 C;  4KHZ A;  5GRO A;  2QEX A;  1X3E A;  3K7A H;  2RHS B;  4JI6 Q;  3CMA A;  5C0X G;  2R93 G;  2H5X A;  3KF6 A;  1VCI A;  3CCJ A;  4DV3 L;  4Y52 H;  1HZA A;  2VNU D;  2XGT A;  2AKW B;  3E9H A;  4R4O A;  2UU9 Q;  3BJU A;  5IYB G;  1YI2 A;  4ME3 A;  4GNX B;  3H15 A;  1MKH A;  2MO0 A;  2ZTC A;  2E2I H;  4HID A;  1HZC A;  5M5X H;  4LF9 L;  2K75 A;  4DV0 L;  3GTL H;  3S15 H;  1A62 A;  3L2P A;  3W1B A;  2R7Z G;  3J80 c;  4DR6 Q;  4LFB L;  3L7Z C;  3T1Y L;  3UDI A;  1L2F A;  1N34 Q;  1NMF A;  4C3J H;  1VQA A;  2GN5 A;  1KAW A;  3G71 A;  4DV6 L;  1SMX A;  3GTG H;  2I5L X;  1KD1 C;  1SLJ A;  4PG3 A;  3ULL A;  4L5T A;  1OXT A;  4MNO A;  4UP7 A;  3CC4 A;  1C9O A;  1QUQ B;  3HOY G;  1KRS A;  2JEA I;  4X66 L;  4JI3 Q;  5GAD C;  1E1O A;  5IYD H;  3AQQ A;  5M5Y H;  2A8V A;  3FKI G;  1W2B A;  4JC0 A;  2JA8 H;  5LMN W;  1VQ4 A;  1XJV A;  1IZ6 A;  5IT9 c;  5ELN A;  4A3J H;  4K0K Q;  2UUB L;  4JI7 L;  3HKS A;  1P16 A;  1K8A C;  1TWC H;  1WYD A;  1PHJ A;  1V9P A;  4LF4 Q;  2E5L L;  2CQO A;  1EIY B;  4POF A;  5JJL A;  2PNH A;  4DV5 Q;  1I94 Q;  3PIO A;  1FL0 A;  1JT8 A;  1SRO A;  1Q7Y C;  3HOW G;  1XMQ Q;  2XTI A;  3STB D;  2Q2H A;  2F52 A;  1A0I A;  2JK8 A;  4DV0 Q;  4GKK L;  1QVG A;  2UXB L;  4A93 H;  4LFB Q;  3K80 C;  1LUZ A;  3W1G A;  4A3G H;  2ZJP A;  1JJC B;  3S16 H;  4OO1 G;  4DV6 Q;  2WAQ G;  1X56 A;  2R7D A;  3CCR A;  4DUZ L;  1M1K C;  3S1N H;  4WJ3 M;  2R92 G;  1T9H A;  1H95 A;  4X66 Q;  1NY4 A;  2VY3 A;  4YY3 L;  3EBE A;  4AYB G;  4DUY L;  4BXX G;  3ZJY C;  2K5H A;  1VQF A;  2LXJ A;  4DK6 C;  4PZ8 A;  1PH5 A;  4XIG S;  1VQP A;  1VQB A;  5J3B A;  1D8L A;  3J81 j;  2JA7 G;  4JI4 L;  3MEF A;  1KIX A;  1VQE A;  2UUB Q;  4HJ5 A;  1I3Q H;  2IT1 A;  1KHI A;  3TRE A;  3B6Y A;  2PI2 A;  3KLW A;  2QGQ A;  1AE2 A;  2B63 G;  1U5K A;  3HOZ H;  4IJL A;  3BZC A;  4LF7 L;  2QA4 A;  3I4N G;  2K5N A;  1HNW L;  5IP9 G;  4A3M H;  1N33 L;  3S2D H;  1UEB A;  3PUW A;  3F2B A;  3CCE A;  4GKK Q;  4LUZ A;  4GNX C;  2IHF A;  4IOA A;  2UXB Q;  2BA0 A;  5FLM G;  2VQF L;  1K8G A;  3E0E A;  3S2H H;  1Y1W G;  2NZH A;  4AH6 A;  1X6O A;  2WAQ E;  2K4K A;  4L5S A;  1L0W A;  3HOV H;  4DUZ Q;  1HZ9 A;  3GTM H;  1TWH H;  1Y1V G;  2GVB A;  2Z6K C;  4IJH A;  3CCQ A;  2IHE A;  3I7F A;  2Q2U A;  1JJG A;  4YY3 Q;  1VQO A;  4B3T L;  2DGY A;  2OCE A;  4PZ6 A;  4DUY Q;  2VZA A;  4JOI C;  3M4O H;  2NN6 I;  1M90 C;  4R4I A;  5FJ8 G;  1N32 L;  4DV7 L;  4MZ9 A;  1FVI A;  4JI4 Q;  1SN8 A;  2AWN A;  4HJ8 A;  1FGU A;  3U58 A;  5JEA J;  4BY7 G;  4A3C H;  4KHP L;  2JE6 I;  3HOX H;  1X3G A;  5BR8 L;  4GNX A;  2EQS A;  5M3M H;  1Q81 C;  1VQJ A;  1Q86 C;  4YCU A;  4DV4 L;  2NZO A;  4LF7 Q;  1VQN A;  1NMG A;  3RLO A;  2B29 A;  3TEH B;  1B7Y B;  1WI5 A;  4RMF A;  1N33 Q;  2JA6 G;  4IPD A;  2JA5 H;  2Z6K A;  3PUZ A;  4C3H H;  4DAM A;  1B8A A;  2VQF Q;  3L0O A;  1QUQ A;  4A3I G;  3VDY A;  4DR7 Q;  2ID0 A;  3A0J A;  3RZO H;  4JOI A;  4A4I A;  2I5M X;  5M5W H;  3STB C;  3H0G G;  1XNQ L;  1WCM G;  2LSS A;  3EIV A;  1LM0 A;  1G51 A;  2Z0S A;  1IBM L;  3RLF A;  1LYL A;  5IYC H;  1O7I A;  1WFQ A;  3U4Z A;  1IBK L;  4B3T Q;  3ER0 A;  1MJE A;  2MNA A;  3DM3 A;  3I4M H;  4K0K L;  4A3L H;  3PUY A;  4H02 A;  1OXV A;  1XTD A;  1N32 Q;  3OTO L;  4A3E G;  4Y7N H;  3A74 A;  2R93 H;  1N8R C;  4P74 A;  4LF4 L;  4DV1 L;  1PH6 A;  4KHP Q;  2OQK A;  3NBH B;  3U50 C;  5BR8 Q;  4DV5 L;  3HKZ G;  4NPS A;  3RN5 A;  1I94 L;  5IYB H;  2F4V L;  2KHJ A;  3K0X A;  3PSI A;  3I56 A;  4BBS G;  1XMQ L;  4DV4 Q;  2K14 A;  1KQS A;  3UDG A;  1PYS B;  3PUV A;  1I6H H;  3OW2 A;  3M9B A;  3ULJ A;  2CWP A;  1QZH A;  4IFD J;  4BA2 I;  3A5Z B;  5JEA G;  4R4Q A;  1N36 L;  1UE1 A;  1VQ7 A;  2LXK A;  1A63 A;  3HOY H;  3TQY A;  3D31 A;  4LF5 Q;  3CQZ H;  4TQU S;  3JAM i;  4DR5 L;  1XNQ Q;  1Q12 A;  1J6Q A;  2K52 A;  4IPG A;  4UP8 A;  4EQ5 A;  1IBM Q;  1IYJ B;  3FKI H;  2B3G A;  1YBY A;  3CXC A;  1Z9F A;  1IBK Q;  4HJ7 A;  2R6G A;  4JYA L;  4DV2 Q;  1C7Y A;  5LMN L;  1VQ5 A;  4YCW A;  3HFZ B;  1YHA A;  3CCV A;  3OTO Q;  5C44 G;  3TS2 A;  1TXY A;  2YTY A;  2Y0S G;  3UE0 A;  3G6E A;  3HKZ E;  4DV1 Q;  2CWA A;  3HOU G;  4EX5 A;  2F4V Q;  1SRU A;  2HT1 A;  3HOW H;  3KJP A;  1YVC A;  1SR3 A;  1OTC A;  2KCT A;  1UE7 A;  1KRT A;  5C3E G;  5DLQ E;  2KEN A;  5FLX c;  4DK3 C;  3CPF A;  1N36 Q;  1DGS A;  2JA8 G;  4LUV A;  1L1O C;  1EUJ A;  2MQH A;  4QL5 A;  2R92 H;  4O2D A;  4YWM A;  4IPC A;  2EXD A;  3M7N A;  4GN5 A;  4DR5 Q;  3ERS X;  4OON A;  4A3K G;  3RNU A;  2ZTE A;  4A3B G;  2JA9 A;  4BXX H;  4UP9 A;  3CCM A;  4BY1 H;  1PH1 A;  4JYA Q;  1K9M C;  2JA7 H;  3AEV A;  4IFD G;  2BH2 A;  4JBW A;  5LMN Q;  4GOP B;  4B3R L;  2L15 A;  5C0X I;  2VQE L;  3S24 A;  2Y0S E;  4GN3 B;  2NVQ H;  1VQ6 A;  3S14 H;  1UWV A;  2YTV A;  1S3O A;  1VQ8 A;  2I5H A;  2PQA B;  4J15 A;  2I0Q A;  2ASB A;  2Q2I A;  2B63 H;  1JJ2 A;  1E1T A;  4L5R C;  3I4N H;  1ASY A;  3T1H L;  1MIU A;  1KL9 A;  4A3F G;  3GTP H;  2OQ0 A;  2RF4 A;  3GD7 A;  4NXM L;  1EQQ A;  1HJP A;  1QVC A;  4QJF A;  1KC8 C;  5FLM H;  2KCM A;  4X65 Q;  4JI5 L;  1Q1E A;  1YNX A;  3J80 i;  1Y1W H;  3JC6 6;  5LMU L;  2A1A A;  4LFA L;  4DR7 L;  4JI2 L;  5JJK A;  3GO5 A;  4DR3 L;  1YHQ A;  3PGZ A;  5GAE C;  1Y1V H;  1PH8 A;  2UXC L;  2NVY H;  1BVS A;  2KBN A;  2RCN A;  4A76 A;  4OX9 L;  3Q8D A;  2E8G A;  4TVA B;  4AYB E;  4PZ7 A;  5IE8 A;  4A75 A;  2VUM G;  4X62 Q;  1CKN B;  3I2Z A;  4JI8 Q;  4BBR G;  3BZK A;  4NB3 A;  1TWA H;  5FJ8 H;  2IX1 A;  2YV5 A;  4R4C A;  5C4J H;  4C2M H;  1XNR Q;  2VQE Q;  3GTK H;  1GO3 E;  4BY7 H;  4B3R Q;  4LFC L;  3I55 A;  1VQH A;  1YZ6 A;  4JCV E;  2VL6 A;  4YWL A;  1IBL L;  1Q8K A;  2ZM6 Q;  4QY7 A;  3KF8 B;  3T1H Q;  3EN2 A;  4LF6 L;  3HOV G;  4FDB A;  1VQG A;  2MO1 A;  2YYZ A;  2IX0 A;  4LW1 A;  4NXM Q;  2JA6 H;  1PH9 A;  1XPU A;  5EAY A;  1HNZ L;  3CCU A;  1IL2 A;  1OXX K;  4OO1 I;  1L1O B;  1P8L A;  2WFW A;  4JI5 Q;  4A3I H;  3M4P A;  3TS0 A;  1EFW A;  4LFA Q;  5LMU Q;  5GQO A;  2D0P A;  4JI2 Q;  3U4V A;  1HR0 W;  4DR3 Q;  1HR0 L;  3UDF A;  1TWF H;  4LF8 L;  2HHH L;  4LF5 L;  3H0G H;  4DAY B;  1Z47 A;  1WCM H;  3TRZ A;  2UXC Q;  2ALY B;  4OX9 Q;  4A3C G;  4QQB X;  3HOX G;  5M3F G;  1S72 A;  3OYY A;  4DV2 L;  2OTJ A;  1LTL A;  1OXS C;  1X54 A;  5GAH C;  1K83 H;  3CP0 A;  4A3D G;  4O0A A;  4A3E H;  1YJN A;  5C4X G;  1AE3 A;  2EIF A;  4DKA C;  3FP9 A;  2UUC L;  4LFC Q;  4P75 A;  4GOP C;  3H3V H;  3PO2 G;  1IBL Q;  2PMZ E;  1GD7 A;  3NEN A;  1GKH A;  1Q46 A;  3AYH B;  4BBS H;  1NBW A;  5E7N A;  1VQI A;  2UUA Q;  4JV5 L;  2D0O A;  1Q1B A;  4DR1 L;  1I50 H;  3NEL A;  4LF6 Q;  2R7Z H;  4XTC S;  1MJC A;  1PH3 A;  1HNZ Q;  3PO3 G;  3CCS A;  1YHB A;  1PVO A;  1BBW A;  4NXN L;  2WB1 G;  3I4M G;  4JBK A;  2WP8 J;  3A5U A;  4LF8 Q;  1HR0 Q;  5IP7 G;  2HHH Q;  3GTO H;  1B70 B;  1X3F A;  1EWI A;  4IPH A;  3RN2 A;  1FJG Q;  2YTX A;  2HQL A;  2OTL A;  4GLA C;  4HJA A;  4JI1 Q;  1HZB A;  1UE5 A;  1RIP A;  4GS3 A;  3SGI A;  3CME A;  4JI0 L;  3F2D A;  1PFS A;  4AIM A;  4GOP A;  1YJW A;  4GLV B;  3RR5 A;  1RL2 A;  5C44 H;  4YHH Q;  1XMO Q;  2PQA A;  2N3S A;  1WJJ A;  4IO9 A;  2K5V A;  2N49 A;  4P73 A;  4X64 Q;  3ULP A;  2UUC Q;  1ASZ A;  1CKM A;  3HOU H;  4LUO A;  1J5E L;  5IY0 A;  3CW2 C;  5JJI A;  2D62 A;  2VW9 A;  1Q82 C;  5AJ3 Q;  5GAG C;  4OWX B;  4JBM A;  4WJ4 A;  4JV5 Q;  5K36 G;  4DR1 Q;  1VQK A;  4B3S L;  1UE6 A;  1N9W A;  5ELO A;  5C3E H;  1G29 1;  4X65 L;  4HIM A;  5IYD G;  3J7Z C;  4GLX A;  1XPO A;  2E2J H;  4OWW B;  2WB1 E;  1EOV A;  1W3S A;  3KDF B;  5IWA Q;  3F2C A;  1HNX L;  3M3Y H;  1V1Q A;  4NXN Q;  2NN6 G;  4B3M L;  1SE8 A;  4A3J G;  2FXQ A;  3M85 A;  1SFO H;  1VQL A;  3KJO A;  1KXL A;  1PH7 A;  4A3K H;  1CKN A;  1XPR A;  4A3B H;  1BKB A;  3G48 A;  1C0A A;  2N78 A;  3GTQ H;  4X62 L;  1PYB A;  3E9I A;  2ZJR A;  4DV3 Q;  4JI0 Q;  4JI8 L;  3KF6 B;  3J81 i;  1K3R A;  3BU2 A;  1E7Z A;  1VQD A;  2OWO A;  4LF9 Q;  1XNR L;  3CC7 A;  2VS1 A;  4P71 A;  3H3V I;  2CFM A;  3T1Y Q;  1YJ9 A;  4A93 G;  4DR4 L;  3G4S A;  4A3G G;  2ZM6 L;  1J5E Q;  3KFU A;  2ZTD A;  3FHW A;  3ICE A;  3F1Z A;  3PV0 A;  1I5F A;  2JQO A;  4QIW E;  1PV4 A;  2NVT H;  4A3F H;  3S17 H;  2KHI A;  4X6A H;  2MFI A;  4YCV A;  5IP9 H;  1A8V A;  1PH2 A;  3GTJ H;  1L1O A;  1CUK A;  3CC2 A;  2N8N A;  4B3S Q;  1AH9 A;  2JJQ A;  3WWV A;  5H1S E;  3AFP A;  3M4Q A;  4GN4 B;  2ES2 A;  2E2H H;  4MTN A;  1YEZ A;  1JB7 A;  1E22 A;  4BY1 G;  3DLL A;  1X9N A;  4HJ9 A;  1HNX Q;  3RZD H;  2UXD L;  4DR2 L;  1HH2 P;  2AMC B;  3PF5 A;  1PA6 A;  4B3M Q;  1QVF A;  2CCZ A;  4JI7 Q;  1K0R A;  1NE3 A;  5HGQ A;  3CCL A;  4OXP A;  2JEB I;  2VUM H;  4HIO A;  4KI0 A;  3J7A 5;  2E5L Q;  1D7Q A;  2K50 A;  4BBR H;  3KOJ A;  3K8A A;  1TWG H;  3HOZ G;  4AQY L;  2R7F A;  4RG1 A;  3UE1 A;  3S1R H;  3S1Q H;  4R4T A;  2YU9 H;  1S40 A;  1E24 A;  3PCO B;  1GM5 A;  2C35 B;  4A3M G;  1V43 A;  1CSQ A;  3K7U C;  1NJI C;  1G6P A;  4DNI A;  4DR4 Q;  3CAM A;  1VQM A;  5C0X J;  2BH8 A;  2NVX H;  2PI2 E;  2UUA L;  4ALP A;  4APV A;  3JAM c;  2RHQ B;  2IY5 B;  2AWO A;  3CD6 A;  4LWC A;  4C3I H;  2A19 A;  1EQR A;  3PUX A;  1E3P A;  1VQ9 A;  2HIV A;  1U0L A;  3UDX A;  3PF4 A;  1BBU A;  4POG A;  4GKJ L;  2DUD A;  1CKO A;  1IXR A;  3LGJ A;  3RLN A;  2UXD Q;  1CSP A;  1WOC A;  4DR2 Q;  4JG2 A;  4YWK A;  4JI6 L;  1FJG L;  2V1C C;  3W5O A;  3I4O A;  4L5Q A;  4JI1 L;  1JMC A;  1VQC A;  5M3F H;  4HIK A;  1PH4 A;  1YIJ A;  3AFQ A;  1EYG A;  2UU9 L;  1VS0 A;  1GVP A;  5HY6 A;  4IFD I;  2GVA A;  5M3M G;  5C4X H;  4A3D H;  4QGU A;  4AQY Q;  4YHH L;  1XMO L;  1HNW Q;  4DR6 L;  2Q2T A; 
#chains in the Genus database with same CATH topology
 4FF2 A;  1N34 L;  4DXG A;  1DOL A;  3C1E A;  1CA6 A;  2F0J A;  4BY1 B;  2CKZ B;  3MXN B;  4UY8 C;  2M9V A;  4P72 A;  3IRB A;  4PMW A;  3GDE A;  3I90 A;  4LNQ A;  2L0C A;  4TKO B;  3CF5 A;  2BA1 A;  2CW0 C;  4UPA A;  1YIT A;  1TT2 A;  2ATW A;  1EEF D;  1JE5 A;  1X65 A;  1TII D;  4BA1 I;  5IP7 H;  3S2D B;  5GRO A;  2K5Q A;  3K58 A;  2QEX A;  4ZRZ A;  4JI6 Q;  5C0X G;  2H5X A;  3WOE A;  1TR5 A;  2XGT A;  3E9H A;  4ME3 A;  4R9W A;  1MKH A;  2MO0 A;  1IYU A;  2ZTC A;  1TWH B;  4LF9 L;  3W1B A;  3J80 c;  3EFX D;  3UDI A;  4C3J H;  5C4H A;  2EPB A;  4DV6 L;  1SMX A;  3GTG H;  2AUK A;  2F0E A;  3HOY G;  4X66 L;  3VYT A;  4JI3 Q;  4FF1 A;  5IYD H;  4S3S A;  5IGF A;  2E2D C;  2JA8 H;  1VQ4 A;  1XJV A;  1M8A A;  3C46 A;  4LF4 Q;  1V9P A;  5D3I B;  2CQO A;  1EIY B;  4POF A;  2LS0 1;  4DV5 Q;  3PIO A;  5M5W B;  1XMQ Q;  3STB D;  2F52 A;  2JK8 A;  3K80 C;  1LUZ A;  4A3G H;  1QB5 D;  1RKN A;  4HMI A;  4C1N I;  1STB A;  1CQV A;  1K83 B;  1PFM A;  2KVM A;  2RDF A;  4DUZ L;  2R93 B;  4HR7 B;  1F2Z A;  4WJ3 M;  2R92 G;  1H95 A;  1AFP A;  4CDF C;  2B2W A;  3O13 A;  1IW7 C;  4DK6 C;  4BBS B;  4PZ8 A;  4KV6 A;  4XIG S;  1BCP F;  2NTS A;  1R4Q B;  1AEX A;  1EY9 A;  1DM0 B;  3B6Y A;  5C4Z A;  3KLW A;  3ERO A;  1X3Q A;  3KBG A;  1YNJ D;  1STN A;  4LF7 L;  2QA4 A;  1HNW L;  2K5N A;  5IP9 G;  2B2V C;  3PUW A;  4GKK Q;  4IOA A;  1DJR D;  3FKI B;  1E2Z A;  3GV6 A;  4AH6 A;  1X6O A;  1A2T A;  2NB0 A;  4MN3 A;  1L0W A;  3HOV H;  2KEC A;  1O7Z A;  1CA5 A;  1PRT D;  1V1P B;  3GTM H;  1Y1V G;  2N55 A;  3MEH A;  4IJH A;  3MAQ A;  2EZV A;  4KY6 A;  3WDN A;  1VQO A;  4B3T L;  2DGY A;  1XX8 A;  2OCE A;  4JOI C;  1PRT B;  4R4I A;  5FJ8 G;  4MZ9 A;  2B2U A;  2AWN A;  3QIA A;  3K5M A;  1W6J A;  4QMG A;  1X3G A;  2WAQ B;  1Q81 C;  1Q86 C;  1BDO A;  5I4D A;  1RJT A;  1KLG D;  1WI5 A;  4AYB B;  2FFK B;  3PUZ A;  1VF7 A;  1B8A A;  1PLF A;  5KYL A;  2VQF Q;  1XTC D;  4YIJ A;  1Y8N B;  3VDY A;  1FR3 A;  4JOI A;  1K8O A;  1XNQ L;  3EIV A;  5LL6 X;  1LYL A;  3U4Z A;  3I4N B;  3ER0 A;  4XYQ A;  3PUY A;  1SXT A;  1XTD A;  5C0X H;  3T13 A;  2A6E C;  4LF4 L;  4DV1 L;  2A74 C;  3NBH B;  3OPO A;  4DV5 L;  3QOL A;  3LNN A;  4IQZ A;  1STA A;  2F3V A;  4BBS G;  1XMQ L;  1JOO A;  1I6H H;  4OEM B;  3OW2 A;  4K8I A;  1ZXT A;  3M9B A;  5KGU A;  3ULJ A;  2CWP A;  3IKJ A;  1TWG B;  3A5Z B;  3RMH A;  5JAV A;  1N36 L;  1UE1 A;  4C2M B;  1A63 A;  3HOY H;  4L8J A;  3CQZ H;  1ONL A;  3JAM E;  5L37 A;  2SDF A;  2JXM B;  1J6Q A;  2R3Z A;  2B3G A;  1IBK Q;  1Z9F A;  2R6G A;  4IUR A;  1VQ5 A;  1TS5 A;  3W2D A;  1FGB D;  3I72 A;  5CV4 A;  1SRU A;  3BVG A;  3KJP A;  1YVC A;  2RQX A;  2Z8L A;  1KRT A;  5C3E G;  3OSO A;  1HTL D;  3UI2 A;  4CJ1 B;  4WFN 3;  1B50 A;  5DLQ E;  1LTG D;  4DK3 C;  5C4X B;  3ONA B;  2X69 A;  4NP5 A;  3A55 A;  1JWU D;  2R92 H;  2RVL A;  3T4A C;  4YWM A;  4IPC A;  3TBI B;  2NWG A;  4DR5 Q;  4OON A;  3R2I A;  2JA9 A;  3BYY B;  4UP9 A;  3IFD A;  4BY1 H;  4JYA Q;  3ERQ A;  3AEV A;  2BH2 A;  5LMN Q;  4GOP B;  2VQE L;  3PIO 3;  1VQ6 A;  1UWV A;  2YTV A;  3LWU A;  4ZLT F;  2E76 C;  2I5H A;  2A68 C;  5FOB B;  1PFB A;  4MHE A;  3CKI B;  4QCL A;  5A2Q L;  3T1H L;  4ZCK A;  1B3Q A;  2RF4 A;  1CK1 A;  1EQQ A;  1HJP A;  1QVC A;  2J4X A;  3QG1 A;  1GUG A;  1MD2 D;  3OW7 A;  5I9O A;  5FKA C;  1Q1E A;  1YNX A;  5LMU L;  4LFA L;  3GO5 A;  2AQ3 B;  1S5C D;  3PGZ A;  1H9M A;  1J9O A;  4KD4 A;  1Y1V H;  1PH8 A;  2UXC L;  3J7A F;  4A76 A;  4OX9 L;  3Q8D A;  5T1G A;  4AYB E;  4PZ7 A;  1AZQ A;  5IE8 A;  3DM1 A;  3P7J A;  4JI8 Q;  4R8N A;  5FJ8 H;  4ZKB B;  2IW3 A;  2L9H A;  3D6W A;  2WKD A;  3NQT A;  4CDC C;  1GXD C;  2B2Y C;  1GO3 E;  3SE0 A;  1U4M A;  5C4J H;  4B3R Q;  1VQH A;  5M5Y B;  2E2J B;  1YZ6 A;  3NWS A;  1S4Z A;  2TSS A;  2HDM A;  1Q8K A;  1PDQ A;  2ZM6 Q;  2ZXR A;  1IL8 A;  4A3J B;  1MI2 A;  1XWE A;  4LF6 L;  4FDB A;  2BOS A;  4LW1 A;  1VDZ A;  2L5T A;  1XPU A;  2BE5 D;  4OO1 I;  2WFW A;  4JI5 Q;  3BS1 A;  3TS0 A;  1AP0 A;  3U4V A;  5C6A A;  1RD9 D;  1CI3 M;  4DR3 Q;  5C3W A;  4H0L C;  4RGM A;  1HA5 A;  4B08 A;  3OYY A;  4FXK C;  2OTJ A;  1TS4 A;  1X54 A;  4K2K A;  5C4X G;  1K83 H;  1Z7T A;  4O0A A;  3SK8 A;  1YJN A;  3K5O A;  1WVL A;  1UEA B;  3H3V H;  3PO2 G;  1BCP C;  1IBL Q;  3I4L A;  1GKH A;  4BBS H;  1ICF B;  4JV5 L;  4DR1 L;  2XRQ D;  4L63 B;  1ENA A;  2QW7 A;  4XTC S;  4IUU A;  2QKI C;  1PVO A;  3BDO A;  5CMD A;  3FMC A;  4LF8 Q;  1B70 B;  1EIG A;  5EPK A;  4XYO A;  1FJG Q;  2YTX A;  4M8A A;  4GLA C;  4HJA A;  1A3V A;  1HZB A;  4JI1 Q;  3CME A;  5E1F A;  4MTK A;  3F2U A;  4GZY C;  1I4Q A;  3TDQ A;  2MPM A;  3TZU A;  2N49 A;  3TP7 A;  2UUC Q;  3CW2 C;  3ND8 A;  5JJI A;  2A5H A;  3WOF A;  3NTI A;  3IL8 A;  5K36 G;  3A56 A;  4B3S L;  3HOX B;  5C3E H;  3K57 A;  4HIM A;  4GLX A;  4JW0 A;  4NDX A;  1W3S A;  1XYI A;  1HNX L;  3M3Y H;  2NN6 G;  4B3M L;  4A3J G;  2FXQ A;  5CGK A;  1VQL A;  4WJW A;  1LTR D;  3G48 A;  2DJF C;  1G8Z D;  3GTQ H;  4JI0 Q;  5JPM C;  2A6H C;  4JI8 L;  3RZO B;  1SNP A;  3NPP A;  3CC7 A;  1UUP A;  4P71 A;  4XDX A;  2CW0 D;  3M7G A;  2ZM6 L;  2WB1 B;  1J5E Q;  1ROD A;  2ZTD A;  3FHW A;  3ICE A;  2NVT H;  1B2T A;  2JQO A;  4HSP A;  2B39 A;  2IJ0 A;  4YCV A;  1A8V A;  2VB2 X;  3CC2 A;  2K6A A;  5I2X A;  1HQM C;  1R4P B;  2ES2 A;  2E2H H;  1YEZ A;  1X9N A;  2AMC B;  1QVF A;  1S5F D;  2CCZ A;  1NE3 A;  4C3J B;  4OXP A;  4HIO A;  3NHH A;  3J7A 5;  3GTG B;  4CKB A;  4QIW B;  3BG3 A;  1TWG H;  5DM6 3;  3S1Q H;  1Q90 A;  3CHB D;  4KY5 A;  2C35 B;  4C1N K;  1TU2 B;  1NJI C;  2PI2 E;  1AZP A;  2IY5 B;  2B8F A;  4KKU A;  3CD6 A;  1W6K A;  1STE A;  4CKE A;  4DA2 A;  2A19 A;  3HOW B;  3PUX A;  1E3P A;  1NUC A;  3UDX A;  4XT3 B;  2O2L D;  2DUD A;  1TVX A;  3LGJ A;  3KBX A;  1RDP D;  2IWH A;  1FJG L;  2V1C C;  1JMC A;  4A3G B;  4JI1 L;  1PH4 A;  3Q0A A;  1EYG A;  1SBB B;  5C4X H;  4AQY Q;  4ZKC B;  4DN4 M;  4EGV A;  3PO2 H;  3F8T A;  4KTA A;  1FNV A;  3KLS A;  1IW7 D;  2F0M A;  1SMY D;  1JOR A;  2F3I A;  1FNU A;  1LAC A;  3LX0 A;  2I07 B;  1M4V A;  1SNQ A;  1SYG A;  4FF3 A;  1EY7 A;  2NVQ B;  4DPG A;  2HDL A;  4CHT B;  4ME5 A;  3OIQ A;  1ZYR D;  2CH4 A;  4KLK A;  1K73 C;  2X6L A;  1WTX A;  3K7A H;  4KJN A;  3KF6 A;  2CVR A;  1Y1W B;  1VCI A;  4B9X A;  3CCJ A;  4Y52 H;  1HZA A;  2F0N A;  2RDH A;  3QJY A;  2VNU D;  5IYB G;  2E2I H;  1EY0 A;  5FO7 B;  2NVY B;  1KDC A;  1A62 A;  1H9J A;  3L7Z C;  1N34 Q;  1WTR A;  2GN5 A;  1BF4 A;  3BDC A;  1SND A;  4FXG C;  1D2B A;  3H91 A;  2RSO A;  4MNO A;  1C9O A;  5K36 H;  1KRS A;  1MBY A;  1SYE A;  3AQQ A;  5M5Y H;  3CU7 A;  1W2B A;  2F0O A;  4B9W A;  5LMN W;  5D3D A;  2NN6 H;  4K0K Q;  4A3J H;  3X3N A;  4O42 A;  4JK1 C;  1K8A C;  1E2W A;  1PHJ A;  4A3I B;  5JJL A;  2X6G A;  1FL0 A;  3HOW G;  2L1B A;  2XTI A;  1BOS A;  3E5S A;  2UXB L;  1CZG A;  4DV6 Q;  4WRD A;  2K28 A;  2R7D A;  4IN3 A;  3I73 A;  1ICW A;  2A6E D;  4X66 Q;  4YY3 L;  3EBE A;  3ZJY C;  1PH5 A;  2LXJ A;  2I46 A;  1VQB A;  5J3B A;  1D8L A;  1PXU A;  1SE2 A;  3J81 j;  4P2C B;  4JI4 L;  1I6H B;  3MC0 B;  2HUG A;  1KHI A;  1NR4 A;  1EY4 A;  2PI2 A;  1U5K A;  1YNN C;  4IJL A;  3HOY B;  2F0H A;  1N33 L;  1KLU D;  2IHF A;  3PQI A;  4K5W A;  2BA0 A;  3R93 A;  1OO9 B;  5J22 A;  1Y1W G;  2NZH A;  4N9T A;  1SYF A;  2K4K A;  1Y8O B;  4L5S A;  5E4W C;  3QR8 A;  3T56 B;  3J81 L;  4DUZ Q;  3CCQ A;  2IHE A;  2Q2U A;  1JJG A;  1TY2 A;  2WII B;  4ZQ3 A;  5HGT A;  3M4Y A;  3U58 A;  4BY7 G;  5JEA J;  1VMC A;  4A3C H;  3HOX H;  1K0S A;  1HFG A;  5CV9 A;  2F0K A;  5IIF A;  5COY A;  3AU7 A;  4DV4 L;  2NZO A;  2R92 B;  3G6J B;  4LF7 Q;  4ODG A;  1BNZ A;  3RLO A;  2B29 A;  1B7Y B;  2ZT9 C;  3AMU A;  4RMF A;  4MIU A;  4RHR A;  4DAM A;  1XXG A;  1GUS A;  2C9O A;  2H4O A;  2ID0 A;  4A3I G;  3RZO H;  2PNR C;  3H0G G;  1WCM G;  2SNS A;  1LM0 A;  1IBM L;  1TS2 A;  4B3T Q;  3S17 B;  4K0K L;  1LTS D;  3A54 A;  3HG9 A;  4A3E G;  3NWT A;  3A74 A;  4I7A A;  5CV7 A;  1PH6 A;  1F2M A;  4K5V A;  2F4V L;  3HKZ G;  4NPS A;  1HHV A;  5IYB H;  1STY A;  3I56 A;  5I2Y A;  2E75 C;  1Y1V B;  3DXJ C;  3UDG A;  1PYS B;  2PO4 A;  2K03 A;  4IFD J;  1NAP A;  1DYQ A;  4K5X A;  3QOJ A;  2L12 A;  5C4J B;  2LXK A;  3TQY A;  3D31 A;  3JAM i;  1XNQ Q;  3D8G A;  1Q12 A;  1I4R A;  4UP8 A;  1ILQ A;  4IUV A;  4KJO A;  3CXC A;  4YCW A;  3HFZ B;  5C44 G;  1LAB A;  1NSN S;  2Y0S G;  1U4L A;  3UE0 A;  3HKZ E;  4DV1 Q;  2CWA A;  3K0Y A;  4DAV A;  2HQE A;  4K14 A;  3HOW H;  3FPP A;  5DM7 3;  4K6L A;  3BVM A;  3SR1 A;  2KCT A;  1TY0 A;  1Q8I A;  1SYD A;  2RCF A;  2KEN A;  5CYU A;  5A2Q E;  5KND A;  1N36 Q;  2AUJ D;  1GUN A;  3CRK C;  1L1O C;  1EUJ A;  1F77 A;  4O2D A;  2EXD A;  2B8G A;  3RD4 A;  2CH4 W;  4A3B G;  3T53 B;  1PFN A;  1A6X A;  3D6C A;  1BCP B;  2NYZ D;  3S24 A;  2Y0S E;  5A35 A;  2EJG C;  4GN3 B;  2NVQ H;  1RTO A;  5EKI A;  1VQ8 A;  2Q2I A;  1DOM A;  1E1T A;  4A3F G;  3DHQ A;  1GUO A;  4EQO A;  4NXM L;  3GTP H;  1KC8 C;  2F0T A;  1D5M C;  1Y1W H;  2QIL A;  3J80 i;  3JC6 6;  4JI2 L;  4Q5V A;  3EA6 A;  5GAE C;  5I9P A;  2NVY H;  2KBN A;  2RCN A;  4TVA B;  3H09 A;  2F03 A;  1QIL A;  4A75 A;  4TRD A;  4DGZ A;  3HZX A;  4G7H C;  4BBR G;  1C8C A;  4LJZ C;  2YV5 A;  5EBC A;  3SEB A;  3NTH A;  3NK9 A;  4R4C A;  3GTK H;  4BY7 H;  4ZUI A;  5C3E B;  2VQE Q;  2RA4 A;  1O80 A;  2BDO A;  3MZ5 A;  2B2V A;  5ELE A;  4YWL A;  4RGN A;  3M3Y B;  2FMM A;  2MJ8 A;  1WTQ A;  3T1H Q;  3EN2 A;  1DXM A;  2XRS D;  5KRU A;  2JN4 A;  1PH9 A;  1STH A;  3GTQ B;  1HNZ L;  5AFW A;  1LTA D;  5ELB A;  2LMC B;  5D65 A;  4C3I G;  4A3I H;  4RHS A;  4LFA Q;  5LMU Q;  1ML0 D;  1HR0 W;  1LO5 D;  1TWF H;  3U9S A;  2HHH L;  3H0G H;  1WCM H;  4A93 B;  2UXC Q;  2ALY B;  5IT9 L;  4OX9 Q;  1QE6 A;  5M3F G;  3S16 B;  2NVT B;  3L3O C;  1OXS C;  3S1N B;  4A3D G;  4A3E H;  1AE3 A;  2O4X A;  2ICI A;  4P75 A;  2EYO A;  2E2H B;  3NEN A;  1BO0 A;  3I3C A;  1Q46 A;  1VQI A;  2D0O A;  5FLX L;  4LF6 Q;  1MHW C;  1PH3 A;  1MJC A;  5ELD A;  3K6O A;  3CCS A;  1BBW A;  1QG7 A;  4NXN L;  3S1Q B;  3I4M G;  1G2T A;  1EYD A;  1I4P A;  4JBK A;  2ICE C;  2WP8 J;  4A3M B;  1X3F A;  1EWI A;  3S2H B;  1HA6 A;  1PFS A;  4AIM A;  3Q24 A;  3V96 A;  3DWQ A;  5IGG A;  3RR5 A;  5C44 H;  2NBF A;  4YHH Q;  2PQA A;  4FP5 D;  4IO9 A;  3MVV A;  4P73 A;  1D1I A;  4X64 Q;  3ULP A;  1CKM A;  4LUO A;  3M4O B;  5IOD A;  5IY0 A;  1ENF A;  4LK1 C;  4IAL A;  2RBM A;  1WTV A;  5GAG C;  4JBM A;  2R61 A;  4JV5 Q;  4DR1 Q;  1ZKO A;  3NQI A;  2H1E A;  3F2C A;  1EOV A;  3NSW A;  5LL6 S;  3PO2 B;  1DD2 A;  4C3H B;  2JSO A;  1XPR A;  1CKN A;  1U4R A;  4A3B H;  1C0A A;  2K05 A;  4RH6 A;  2ZJR A;  1QCB D;  2DNE A;  3KF6 B;  3J81 i;  1K3R A;  4EVO A;  2PQE A;  1VQD A;  2VS1 A;  3T1Y Q;  4A93 G;  1YJ9 A;  4DR4 L;  3QB3 A;  3KFU A;  1SE3 A;  3VR3 A;  2O5I C;  3F1Z A;  4X6A H;  3S17 H;  4A3F H;  4H7B A;  1SNM A;  3K7A B;  5IP9 H;  2ZXO A;  1CUK A;  2A69 D;  4B3S Q;  5CC4 A;  2JJQ A;  3OMG A;  4GN4 B;  4DAY A;  2E2I B;  3DLL A;  1HNX Q;  2EY5 A;  4HJ9 A;  1X32 A;  2KHS A;  3RZD H;  2F0W A;  2K04 A;  3TSS A;  4B3M Q;  2Q8T A;  5M9O A;  1D7Q A;  4BBR H;  3KOJ A;  1LT3 D;  3HOZ G;  2R7F A;  5I6W A;  1PTO F;  3S1R H;  4R4T A;  1E24 A;  3BDL A;  3PCO B;  4A3M G;  3K7U C;  3I70 A;  3OHX C;  1CQF A;  1VQM A;  5EKK A;  5C0X J;  4UAI A;  4ALP A;  4G7Z C;  2LY7 A;  2RHQ B;  1LT4 D;  4HED A;  4LWC A;  4C3I H;  3MA2 B;  1EQR A;  3FDT A;  2HIV A;  4GKJ L;  3H6M A;  1BBU A;  1SE4 A;  5CBA E;  5EQ0 A;  5BN3 A;  4X3K A;  1WOC A;  1EYA A;  5FO9 B;  3VYR A;  3W5O A;  1VQC A;  2B2Y A;  5M3F H;  4HSV A;  4ILW A;  3AFQ A;  2UU9 L;  1GVP A;  2Q8I B;  4IFD I;  2GVA A;  5M3M G;  4A3D H;  4PNY A;  4QGU A;  4YHH L;  4OHJ A;  2M2L A;  1O7Y A;  4DR6 L;  1G91 A;  4X64 L;  3OOC A;  3TP5 A;  1ESR A;  1TKW B;  4C3H G;  1Y14 B;  2FHT A;  3RUZ A;  3SK4 A;  4JBJ A;  3OMC A;  3S1M H;  3CPW A;  3VR5 A;  1OXU A;  3KYH C;  1EIF A;  3Q23 A;  5IGE A;  4OWT B;  1L0X B;  4HTH A;  5IYC G;  2DN8 A;  1NTG A;  4IOC A;  1VF5 C;  1YNN D;  4U67 3;  4R1J A;  1I4X A;  3DUZ A;  2ZJQ A;  1X55 A;  4A3L G;  1CM9 A;  3MXG A;  4KHZ A;  4KHV A;  1X3E A;  2KEE A;  1KAA A;  4R4O A;  3BJU A;  2WIN B;  1JOK A;  3H15 A;  4HID A;  1HZC A;  4ID6 A;  2K75 A;  4DV0 L;  3GTL H;  3L2P A;  4RWS C;  2R7Z G;  4LFB L;  3T1Y L;  1ENC A;  1KAW A;  1H9S A;  2J0T D;  2I5L X;  1YNJ C;  1SLJ A;  4PG3 A;  4L5T A;  2IPK D;  1LTB D;  1C4Q A;  4FNF A;  5JPN C;  4RKL A;  4N8X 1;  3L9A X;  4BWG B;  5GAD C;  2EOT A;  1PZJ D;  1X3P A;  4JC0 A;  4Q0F A;  1IZ6 A;  5IT9 c;  5ELN A;  2UUB L;  2JA6 B;  3HKS A;  4RGT A;  1P16 A;  3E3X A;  1I94 Q;  2VB3 X;  2JP1 A;  1JT8 A;  1Q7Y C;  5JVH 3;  1U4P A;  1RCV D;  3QWN A;  4M1U B;  3V05 A;  4A93 H;  3JAM L;  2KUM A;  3S16 H;  3TME A;  2SEB D;  4OO1 G;  1X56 A;  4KD3 A;  2BCO A;  3DEP A;  2XWJ B;  3S1N H;  1T9H A;  3NP8 A;  5EPL A;  1EYC A;  2VY3 A;  1SNC A;  4DUY L;  2F1M A;  4BXX G;  1VQF A;  1VQP A;  2F4I A;  2MHV A;  2A73 B;  1KIX A;  2KCC A;  1I3Q H;  2KQ3 A;  3TRE A;  2QGQ A;  2B63 G;  3HOZ H;  3TP8 A;  3BZC A;  4KN4 C;  3GTO B;  2D5D A;  4J6H A;  4A3M H;  2GA4 B;  1UEB A;  4LUZ A;  4GNX C;  2UXB Q;  1G2S A;  3S2H H;  4L6T B;  2FIN B;  2WV6 D;  1JIC A;  1EU4 A;  2GVB A;  3HOU B;  3I7F A;  2WAC A;  4YY3 Q;  1RF2 D;  3M4O H;  1EY6 A;  5J39 A;  1N32 L;  1HUN A;  1FVI A;  4JI4 Q;  1HPC A;  4HJ8 A;  1A3T A;  2KJX A;  5D14 A;  3VYS A;  4KHP L;  2OF1 A;  5KEE A;  5BR8 L;  5E3F A;  4GNX A;  1PMR A;  3P20 A;  5M3M H;  3J80 L;  1BBX C;  4YCU A;  4K6D A;  4HMJ A;  2XN9 C;  1VQN A;  1N33 Q;  2JA6 G;  4JPB W;  3A8J E;  4C3H H;  1F2L A;  3EVQ A;  1IYV A;  1LT5 D;  1QUQ A;  3L0O A;  3P75 A;  4A4I A;  1AW7 A;  1JQY D;  4F8M A;  1G51 A;  2Z0S A;  3RLF A;  5IYC H;  1O7I A;  3TN2 A;  5HUR A;  2EVB A;  2MNA A;  1WTP A;  3DM3 A;  4A3L H;  3HS0 C;  4H02 A;  1OXV A;  3GTP B;  3T51 B;  3OTO L;  5CV8 A;  4P74 A;  1NCV A;  4ULL A;  2KA7 A;  3U50 C;  2OT2 A;  3RN5 A;  1I94 L;  4U68 A;  2KHJ A;  3K0X A;  4DV4 Q;  1GUW A;  1BR9 A;  4RCN A;  2QF7 A;  1QZH A;  1PTO C;  1A2U A;  1V8Q A;  4R4Q A;  2YU9 B;  1D5X C;  3GTK B;  4BY7 B;  1Q3L A;  3OWE B;  2O5J C;  2K52 A;  1EZ8 A;  1IBM Q;  2PMZ B;  4FXD A;  1IYJ B;  1YBY A;  2D2C C;  1QNU A;  4DV2 Q;  2Q8R E;  1F2Y A;  4ZAI A;  1FYC A;  3TS2 A;  2YTY A;  3G6E A;  3HOU G;  4EX5 A;  2F4V Q;  2HT1 A;  1TWF B;  4DNR B;  2QCP X;  3H0G B;  1WCM B;  2F0U A;  4CJ2 C;  4CBV A;  1OTC A;  4HCS A;  3BZD B;  2B2T C;  1F9S A;  4TSS A;  4OO1 H;  3CPF A;  1EEI D;  4A3E B;  4NKL A;  1DGS A;  2JA8 G;  4LUV A;  1QWY A;  2MQH A;  1JWM D;  4J8Q A;  1WD1 A;  3HKZ B;  4QB4 A;  3ERS X;  4BXX H;  3RNU A;  3Q22 A;  5G3L F;  1K8M A;  1PH1 A;  2WKC A;  1B9N A;  1K9M C;  3FRP B;  1GHJ A;  4X3T A;  4JBW A;  2K33 A;  2L15 A;  5C0X I;  3H94 A;  3GQB A;  3S14 H;  1S3O A;  1LTI D;  2PQA B;  2I0Q A;  4BS9 A;  2ASB A;  2B63 H;  4PMB A;  2B2T A;  1ASY A;  3HP3 A;  1MIU A;  1KL9 A;  5COR A;  3MHB A;  2QDB A;  3GD7 A;  4IUP A;  1J8I A;  1C48 A;  1S5B D;  4X65 Q;  1GHK A;  5IGD A;  3Q6S A;  5JJK A;  2Z4H A;  3I91 A;  5C44 B;  1YHQ A;  4ABN A;  2Y0S B;  1BVS A;  1T5X D;  2E8G A;  2VUM G;  3NBI A;  4OL7 A;  2MGS A;  1CKN B;  1BXT A;  3I2Z A;  3BZK A;  4NB3 A;  1TWA H;  1GOZ A;  2K7V A;  2IX1 A;  2F0G A;  3AB9 A;  5IT9 E;  4LFC L;  4JCV E;  2VL6 A;  4DFA A;  4K2L A;  2KOL A;  2RDG A;  4UHV A;  1CHP D;  2IX3 A;  1F9P A;  3HOV G;  1TWC B;  1VQG A;  5E4X A;  2G9D A;  2IX0 A;  2YYZ A;  4NXM Q;  2JA6 H;  4A3B B;  1OXX K;  1ZEQ X;  5JVG 3;  4N9P A;  1EFW A;  4NW2 A;  5GQO A;  1EWH A;  2D0P A;  4JI2 Q;  5DNF A;  5FLX E;  5T1I A;  1HR0 L;  1BUV T;  4DAY B;  1Z47 A;  2OEO A;  2BDN A;  1PZK D;  2LKV A;  4QQB X;  4I65 A;  2A68 D;  1S72 A;  2EYJ A;  1D1K A;  1AN8 A;  4DV2 L;  1LTL A;  4A3F B;  3KK7 A;  2OXP A;  1K28 A;  5GAH C;  4R8I A;  3C1F A;  2HCC A;  4DKA C;  4E6I A;  4XXE A;  2PMZ E;  1GD7 A;  1EY5 A;  3RZD B;  4QUF A;  3AYH B;  5C3X A;  1NBW A;  1EQV A;  4QUC A;  2G5D A;  2UUA Q;  1I50 H;  3NEL A;  2ZXP A;  4ZUJ A;  4KMU C;  3IAY A;  1HNZ Q;  4BBR B;  2QDL A;  3PO3 G;  1CHQ D;  3E6Z X;  3S1R B;  5J1Z A;  2F0L A;  2SOB A;  1HFN A;  2HHH Q;  3GTO H;  4IPH A;  2F3W A;  2HQL A;  4GS3 A;  3W3A A;  3F2D A;  4PQX A;  4KN7 C;  1RL2 A;  4I7Z C;  1XMO Q;  1SEB D;  3K5N A;  4EQP A;  1WJJ A;  2K5V A;  3A7A B;  4C3I B;  5C5M A;  3HOU H;  1Y69 U;  5CV5 A;  4IUQ A;  4H44 C;  4OEL B;  5AJ3 Q;  3ND9 A;  4WJ4 A;  2RSN A;  1VQK A;  2V4D A;  1N9W A;  5M3F B;  2KCN A;  5ELO A;  1G29 1;  4X65 L;  4RCO A;  1XPO A;  3J7Z C;  2PW5 A;  4OWW B;  1II3 A;  5IWA Q;  4OIJ A;  4A3D B;  3VR4 A;  4NXN Q;  1SE8 A;  2B2W C;  1SJE D;  3M85 A;  1KXL A;  3S9W A;  2JA5 B;  1LLR D;  1WD0 A;  1JOQ A;  1BKB A;  2C5C A;  1BCP D;  2N78 A;  3TZD A;  1PYB A;  3E9I A;  4DV3 Q;  2K5D A;  2IL8 A;  3S1M B;  1JE4 A;  2FJ2 A;  1KDA A;  3HGB A;  1H9R A;  1E7Z A;  3H3V I;  1ET6 A;  2CFM A;  1VMP A;  1EU3 A;  2EJM A;  3G4S A;  3KF8 A;  3I4M B;  3PV0 A;  1PV4 A;  1H9S B;  2KHI A;  4Y7N B;  2MFI A;  3GTJ H;  1L1O A;  2PZT A;  1AH9 A;  3WWV A;  3G7L A;  3HRZ C;  3FPU B;  3N52 A;  5H1S E;  1SMY C;  3SHL A;  4MTN A;  4BY1 G;  3DWP A;  3C3L A;  2Z1C A;  3GTL B;  2UXD L;  4DR2 L;  4JI7 Q;  1ET9 A;  3TP6 A;  5HGQ A;  3CCL A;  2JEB I;  4CGY B;  5KYI A;  2VUM H;  2HCI A;  3U9O A;  4KI0 A;  1GJX A;  2E5L Q;  3K8A A;  3MXP A;  3DWA A;  2B2U C;  2TMP A;  4HCE A;  2AQ1 B;  3MXU A;  1ZYR C;  2YU9 H;  1GM5 A;  1V43 A;  1LV9 A;  4LAA A;  1HUM A;  4K8J A;  1WTH A;  2F0F A;  4DR4 Q;  3CAM A;  5F2D A;  4ZYS A;  1EFI D;  2BH8 A;  3LWE A;  2NVX H;  2UUA L;  2NUC A;  1MSG A;  4APV A;  1HXY D;  2AWO A;  3VR6 A;  4DU9 A;  1B9M A;  3DEO A;  1CFM A;  1I4G A;  1PRT F;  2A6H D;  2L11 A;  1U0L A;  4DK0 A;  4POG A;  1DZ1 A;  2F0I A;  3RLN A;  1CSP A;  4JI6 L;  4JG2 A;  4RGO S;  1HCZ A;  1QNK A;  1YIJ A;  4EQN A;  1IHZ A;  2Z4I A;  1VS0 A;  3VYU A;  3GV3 A;  4PV1 C;  3EQL C;  1XMO L;  1G6Z A;  4CDE C;  2Q2T A;  2JYO A;  3NEM A;  3K81 C;  3D0F A;  1R9T H;  2JA5 G;  4RKB A;  5TSS A;  1KNE A;  2EJF C;  2JA7 B;  1A3U A;  2AHO B;  4F87 A;  5AJ3 L;  1KDB A;  2HIX A;  1QZG A;  3ZYY X;  1I3Q B;  1F9Q A;  4JI3 L;  3KDF A;  3VA5 A;  3PO3 H;  2PPB C;  3J81 c;  3HOZ B;  5KNC A;  5IWA L;  3PIP A;  4GKJ Q;  3BYT B;  4DV7 Q;  2RHS B;  3CMA A;  2R93 G;  4V19 0;  4DV3 L;  2AKW B;  2UU9 Q;  1HTP A;  5DAU A;  5NUC A;  1YI2 A;  4GNX B;  2EYM A;  3ITP A;  5M5X H;  3IFT A;  3S15 H;  2EY1 A;  5I6Y A;  4DR6 Q;  2XWB B;  1L2F A;  1NMF A;  3EJI A;  1VQA A;  3G71 A;  1O7L A;  1KD1 C;  3ULL A;  1OXT A;  4UP7 A;  3CC4 A;  1QUQ B;  1IKM A;  2JEA I;  1E1O A;  2A8V A;  5M3M B;  3OIP A;  1DCZ A;  3FKI G;  1MGS A;  4JI7 L;  1TWC H;  2DY7 A;  1WYD A;  4FVM A;  2E5L L;  2PNH A;  1MSH A;  4NMZ A;  1SRO A;  2D9U A;  4HN7 A;  1EQT A;  2Q2H A;  1A0I A;  3VR2 A;  4DV0 Q;  4GKK L;  1EZ6 A;  1QVG A;  4LFB Q;  3W1G A;  2P5Z X;  2ZJP A;  2EY6 A;  1JJC B;  2K1B A;  5EJW A;  2WAQ G;  4Z9C B;  3CCR A;  1M1K C;  2CQA A;  1JCK B;  2PZU A;  1NY4 A;  4AYB G;  2KED A;  3URY A;  2K5H A;  1EWC A;  3D4D A;  5IGC A;  4CKC A;  5CV6 A;  4IUT A;  2JA7 G;  2J7Z A;  1FNW A;  2PW7 A;  3MEF A;  2R7Z B;  1VQE A;  3OWF A;  2UUB Q;  4HJ5 A;  2DJG C;  2IT1 A;  2Z6B A;  2M00 A;  1SAP A;  2CHB D;  1PTO D;  4HAE A;  1AE2 A;  4DXF A;  3I4N G;  4XQJ A;  1PTO B;  3S2D H;  3F2B A;  2EYF A;  2F0Q A;  4C56 C;  3CCE A;  5FLM G;  3MXN A;  2SNM A;  3J80 E;  2VQF L;  3E0E A;  1K8G A;  1B44 D;  4XT1 B;  2MUY A;  2WAQ E;  4XQQ A;  2F0S A;  5JJZ A;  1B53 A;  1JR0 D;  1HZ9 A;  4G57 A;  1TWH H;  2Z6K C;  5EPJ A;  4PZ6 A;  4DUY Q;  2VZA A;  2NN6 I;  1M90 C;  1U9R A;  2XIW A;  4DV7 L;  4WOR A;  1SN8 A;  3D3R A;  5EKL A;  1FGU A;  1O78 A;  2JE6 I;  3R3O A;  5KIX A;  5K5P A;  2EQS A;  1ESF A;  1VQJ A;  1SFO B;  1QJO A;  1KTK A;  3VA7 A;  1NMG A;  2K01 A;  5ISR A;  4X3S A;  3TEH B;  1E0B A;  4A3K B;  5BN4 A;  4OGQ C;  4IPD A;  2JA5 H;  2Z6K A;  5LHY 1;  2Z9H A;  1S5E D;  1H9K A;  4DR7 Q;  3A0J A;  4O1N A;  2I5M X;  5M5W H;  3BVZ A;  3STB C;  3S14 B;  2LSS A;  2EYP A;  2B63 B;  1WFQ A;  1IBK L;  1MJE A;  3H3V C;  3I4M H;  4OIK A;  5KNB A;  1N32 Q;  3MFG A;  3MTS A;  4DK1 A;  4Y7N H;  3FEW X;  2R93 H;  1N8R C;  4RAU C;  4KHP Q;  2OQK A;  5BR8 Q;  4JVZ A;  1CT1 D;  1FD7 D;  1SYC A;  3PSI A;  4KY7 A;  3V2T A;  2K14 A;  1KQS A;  3PUV A;  5EGT A;  1L0Y B;  3A7L A;  5ELF A;  1KAB A;  1D5Z C;  1CTM A;  1I4H A;  4FO2 A;  4BA2 I;  1TWA B;  4RA8 A;  4X3U A;  5JEA G;  4KKS A;  4G4K A;  1VQ7 A;  1A15 A;  3PMF A;  4LF5 Q;  4TQU S;  4DR5 L;  3PIP 3;  4PMC A;  4IPG A;  4EQ5 A;  2K5W A;  3FKI H;  1QOH A;  4HJ7 A;  4JYA L;  3CRL C;  1C7Y A;  5LMN L;  2EE1 A;  1YHA A;  3CCV A;  3OTO Q;  2RKS A;  1PRT C;  1TXY A;  1S5D D;  1DOK A;  1GUT A;  2ENB A;  1EL0 A;  1SR3 A;  3T16 A;  1F9R A;  1RTN A;  2DNC A;  2NTT A;  4XQN A;  1UE7 A;  1D6E C;  5CR3 A;  4FYD A;  5FLX c;  1V1P A;  1TS3 A;  3KLS X;  3K59 A;  4QL5 A;  3SK6 A;  3NTK A;  2PYK A;  3M7N A;  4GN5 A;  4A3K G;  2ZTE A;  5BN5 A;  3CCM A;  3J81 E;  2JA7 H;  4IFD G;  1I50 B;  4B3R L;  1TQO A;  3GP7 A;  5EBD A;  1LTT D;  4J15 A;  1JJ2 A;  1LT6 D;  4L5R C;  3I4N H;  1WTO A;  3I8Z A;  3NUC A;  2LFN A;  2FMC A;  1NR2 A;  1STG A;  2OQ0 A;  3QO2 A;  4QJF A;  5FLM H;  1KNA A;  1NNX A;  2KCM A;  4JI5 L;  4DR7 L;  2A1A A;  1Y8P B;  4DR3 L;  4KKT A;  1PYW D;  2DY8 A;  4DAP A;  4X62 Q;  3NXW A;  1I6V C;  1SNO A;  4C2M H;  1XNR Q;  3NBH A;  3I55 A;  1PZI D;  2XVS A;  4IUN A;  4FF4 A;  2F0V A;  1IBL L;  3DMU A;  1JC7 A;  2JA8 B;  4QY7 A;  1UAP A;  1UNS A;  3KF8 B;  2E74 C;  4G7O C;  2MO1 A;  4UDU C;  4LMQ D;  5EAY A;  1IL2 A;  3CCU A;  1L1O B;  1P8L A;  2NZ1 D;  3KLR A;  3M4P A;  4LF8 L;  1JB3 A;  3UDF A;  4LF5 L;  4IZ8 A;  3TRZ A;  4F88 A;  3D4W A;  4A3C G;  3HOX G;  4DF7 A;  3CP0 A;  3GTJ B;  1HRJ A;  2G9H D;  3HEJ A;  2EIF A;  2UUC L;  3FP9 A;  4LFC Q;  3SK5 A;  4GOP C;  4F7X A;  1B4O A;  2PCF B;  1EY8 A;  1K3B C;  1T5E A;  5E7N A;  1Q1B A;  2R7Z H;  1SDF A;  2VUM B;  3KUP A;  1DON A;  1YHB A;  3P1H A;  5JEA H;  1SSO A;  2F0P A;  2WB1 G;  1EOT A;  1E2V A;  3A5U A;  3A8K E;  1HR0 Q;  5IP7 G;  3RN2 A;  1JWS D;  2MP1 A;  2A69 C;  2K32 A;  3X3M A;  1PTO H;  1SYB A;  2OTL A;  2AQ2 B;  1UE5 A;  3SGI A;  1RIP A;  3A8I E;  4JI0 L;  4GOP A;  1YJW A;  2NVX B;  3HOV B;  3FVQ A;  4GLV B;  3GTM B;  2L55 A;  2N3S A;  5CBE E;  1ASZ A;  4C3J G;  1J5E L;  3J7A V;  2D62 A;  2VW9 A;  1Q82 C;  4OWX B;  4H13 C;  4N8F A;  1UE6 A;  5IYD G;  2E2J H;  2L4N A;  3SXH A;  3R2T A;  2WB1 E;  3KDF B;  3MFY A;  4J1M A;  1V1Q A;  4CDD C;  1SFO H;  4DNT B;  4CJ0 B;  3KJO A;  3J7Y W;  5G3L D;  1R9T B;  1PH7 A;  4A3K H;  2BE5 C;  1B3A A;  5FO8 B;  2EYL A;  4X62 L;  2EYH A;  2EXZ A;  4IFD H;  3BU2 A;  1XNR L;  2OWO A;  4LF9 Q;  3N6R A;  2F0D A;  3PO3 B;  2EDG A;  4ZK9 B;  4A3G G;  3MWY W;  4RFB A;  4QIW E;  1I5F A;  1ILP A;  1PH2 A;  2QEJ C;  2N88 A;  1Z6H A;  2N8N A;  1WTW A;  3AFP A;  3M4Q A;  1JB7 A;  1E22 A;  5M5X B;  2PZW A;  3S15 B;  3PF5 A;  1HH2 P;  1PA6 A;  5JOB A;  1K0R A;  3R8B A;  2K50 A;  5FK9 C;  4AQY L;  4RG1 A;  2XSC A;  3UE1 A;  3CQZ B;  5ELC A;  1S40 A;  5IOC A;  5DEH A;  1V1O A;  3D4R A;  1CSQ A;  1G6P A;  1CZW A;  4DNI A;  3E0J A;  4QF4 A;  1RHP A;  3JAM c;  1HQR D;  2EY2 A;  3SVM A;  2XNA C;  3SDZ A;  1BQQ T;  1EIH A;  2HD3 A;  5C5L A;  1VQ9 A;  3PF4 A;  3K5L A;  3C2P A;  1CKO A;  1IXR A;  2UXD Q;  4DR2 Q;  4YWK A;  3I4O A;  4L5Q A;  2VXW A;  5IGB A;  4HIK A;  1SJH D;  4V0B A;  5HY6 A;  4KK7 A;  1B1Z A;  3NE5 B;  1HNW Q;  1IKL A; 
#chains in the Genus database with same CATH homology
 3NEM A;  1N34 L;  4X64 L;  3F8T A;  3D0F A;  3K81 C;  3PO2 H;  1R9T H;  2JA5 G;  1Y14 B;  2F3I A;  2AHO B;  2CKZ B;  3MXN B;  2HIX A;  4JBJ A;  5AJ3 L;  1QZG A;  4UY8 C;  3S1M H;  3CPW A;  4P72 A;  3IRB A;  4PMW A;  3GDE A;  1OXU A;  4JI3 L;  4LNQ A;  3KYH C;  1EIF A;  3CF5 A;  4DPG A;  3KDF A;  4OWT B;  2BA1 A;  3PO3 H;  4UPA A;  3J81 c;  5IYC G;  1YIT A;  5IWA L;  1NTG A;  4IOC A;  2ATW A;  1JE5 A;  1X65 A;  4R1J A;  3PIP A;  4GKJ Q;  2ZJQ A;  1X55 A;  4A3L G;  4BA1 I;  5IP7 H;  4DV7 Q;  4KLK A;  1K73 C;  4KHZ A;  5GRO A;  2QEX A;  1X3E A;  3K7A H;  2RHS B;  4JI6 Q;  3CMA A;  5C0X G;  2R93 G;  2H5X A;  3KF6 A;  1VCI A;  3CCJ A;  4DV3 L;  4Y52 H;  1HZA A;  2VNU D;  2XGT A;  2AKW B;  3E9H A;  4R4O A;  2UU9 Q;  3BJU A;  5IYB G;  1YI2 A;  4ME3 A;  4GNX B;  3H15 A;  1MKH A;  2MO0 A;  2ZTC A;  2E2I H;  4HID A;  1HZC A;  5M5X H;  4LF9 L;  2K75 A;  4DV0 L;  3GTL H;  3S15 H;  1A62 A;  3L2P A;  3W1B A;  2R7Z G;  3J80 c;  4DR6 Q;  4LFB L;  3L7Z C;  3T1Y L;  3UDI A;  1L2F A;  1N34 Q;  1NMF A;  4C3J H;  1VQA A;  2GN5 A;  1KAW A;  3G71 A;  4DV6 L;  1SMX A;  3GTG H;  2I5L X;  1KD1 C;  1SLJ A;  4PG3 A;  3ULL A;  4L5T A;  1OXT A;  4MNO A;  4UP7 A;  3CC4 A;  1C9O A;  1QUQ B;  3HOY G;  1KRS A;  2JEA I;  4X66 L;  4JI3 Q;  5GAD C;  1E1O A;  5IYD H;  3AQQ A;  5M5Y H;  2A8V A;  3FKI G;  1W2B A;  4JC0 A;  2JA8 H;  5LMN W;  1VQ4 A;  1XJV A;  1IZ6 A;  5IT9 c;  5ELN A;  4A3J H;  4K0K Q;  2UUB L;  4JI7 L;  3HKS A;  1P16 A;  1K8A C;  1TWC H;  1WYD A;  1PHJ A;  1V9P A;  4LF4 Q;  2E5L L;  2CQO A;  1EIY B;  4POF A;  5JJL A;  2PNH A;  4DV5 Q;  1I94 Q;  3PIO A;  1FL0 A;  1JT8 A;  1SRO A;  1Q7Y C;  3HOW G;  1XMQ Q;  2XTI A;  3STB D;  2Q2H A;  2F52 A;  1A0I A;  2JK8 A;  4DV0 Q;  4GKK L;  1QVG A;  2UXB L;  4A93 H;  4LFB Q;  3K80 C;  1LUZ A;  3W1G A;  4A3G H;  2ZJP A;  1JJC B;  3S16 H;  4OO1 G;  4DV6 Q;  2WAQ G;  1X56 A;  2R7D A;  3CCR A;  4DUZ L;  1M1K C;  3S1N H;  4WJ3 M;  2R92 G;  1T9H A;  1H95 A;  4X66 Q;  1NY4 A;  2VY3 A;  4YY3 L;  3EBE A;  4AYB G;  4DUY L;  4BXX G;  3ZJY C;  2K5H A;  1VQF A;  2LXJ A;  4DK6 C;  4PZ8 A;  1PH5 A;  4XIG S;  1VQP A;  1VQB A;  5J3B A;  1D8L A;  3J81 j;  2JA7 G;  4JI4 L;  3MEF A;  1KIX A;  1VQE A;  2UUB Q;  4HJ5 A;  1I3Q H;  2IT1 A;  1KHI A;  3TRE A;  3B6Y A;  2PI2 A;  3KLW A;  2QGQ A;  1AE2 A;  2B63 G;  1U5K A;  3HOZ H;  4IJL A;  3BZC A;  4LF7 L;  2QA4 A;  3I4N G;  2K5N A;  1HNW L;  5IP9 G;  4A3M H;  1N33 L;  3S2D H;  1UEB A;  3PUW A;  3F2B A;  3CCE A;  4GKK Q;  4LUZ A;  4GNX C;  2IHF A;  4IOA A;  2UXB Q;  2BA0 A;  5FLM G;  2VQF L;  1K8G A;  3E0E A;  3S2H H;  1Y1W G;  2NZH A;  4AH6 A;  1X6O A;  2WAQ E;  2K4K A;  4L5S A;  1L0W A;  3HOV H;  4DUZ Q;  1HZ9 A;  3GTM H;  1TWH H;  1Y1V G;  2GVB A;  2Z6K C;  4IJH A;  3CCQ A;  2IHE A;  3I7F A;  2Q2U A;  1JJG A;  4YY3 Q;  1VQO A;  4B3T L;  2DGY A;  2OCE A;  4PZ6 A;  4DUY Q;  2VZA A;  4JOI C;  3M4O H;  2NN6 I;  1M90 C;  4R4I A;  5FJ8 G;  1N32 L;  4DV7 L;  4MZ9 A;  1FVI A;  4JI4 Q;  1SN8 A;  2AWN A;  4HJ8 A;  1FGU A;  3U58 A;  5JEA J;  4BY7 G;  4A3C H;  4KHP L;  2JE6 I;  3HOX H;  1X3G A;  5BR8 L;  4GNX A;  2EQS A;  5M3M H;  1Q81 C;  1VQJ A;  1Q86 C;  4YCU A;  4DV4 L;  2NZO A;  4LF7 Q;  1VQN A;  1NMG A;  3RLO A;  2B29 A;  3TEH B;  1B7Y B;  1WI5 A;  4RMF A;  1N33 Q;  2JA6 G;  4IPD A;  2JA5 H;  2Z6K A;  3PUZ A;  4C3H H;  4DAM A;  1B8A A;  2VQF Q;  3L0O A;  1QUQ A;  4A3I G;  3VDY A;  4DR7 Q;  2ID0 A;  3A0J A;  3RZO H;  4JOI A;  4A4I A;  2I5M X;  5M5W H;  3STB C;  3H0G G;  1XNQ L;  1WCM G;  2LSS A;  3EIV A;  1LM0 A;  1G51 A;  2Z0S A;  1IBM L;  3RLF A;  1LYL A;  5IYC H;  1O7I A;  1WFQ A;  3U4Z A;  1IBK L;  4B3T Q;  3ER0 A;  1MJE A;  2MNA A;  3DM3 A;  3I4M H;  4K0K L;  4A3L H;  3PUY A;  4H02 A;  1OXV A;  1XTD A;  1N32 Q;  3OTO L;  4A3E G;  4Y7N H;  3A74 A;  2R93 H;  1N8R C;  4P74 A;  4LF4 L;  4DV1 L;  1PH6 A;  4KHP Q;  2OQK A;  3NBH B;  3U50 C;  5BR8 Q;  4DV5 L;  3HKZ G;  4NPS A;  3RN5 A;  1I94 L;  5IYB H;  2F4V L;  2KHJ A;  3K0X A;  3PSI A;  3I56 A;  4BBS G;  1XMQ L;  4DV4 Q;  2K14 A;  1KQS A;  3UDG A;  1PYS B;  3PUV A;  1I6H H;  3OW2 A;  3M9B A;  3ULJ A;  2CWP A;  1QZH A;  4IFD J;  4BA2 I;  3A5Z B;  5JEA G;  4R4Q A;  1N36 L;  1UE1 A;  1VQ7 A;  2LXK A;  1A63 A;  3HOY H;  3TQY A;  3D31 A;  4LF5 Q;  3CQZ H;  4TQU S;  3JAM i;  4DR5 L;  1XNQ Q;  1Q12 A;  1J6Q A;  2K52 A;  4IPG A;  4UP8 A;  4EQ5 A;  1IBM Q;  1IYJ B;  3FKI H;  2B3G A;  1YBY A;  3CXC A;  1Z9F A;  1IBK Q;  4HJ7 A;  2R6G A;  4JYA L;  4DV2 Q;  1C7Y A;  5LMN L;  1VQ5 A;  4YCW A;  3HFZ B;  1YHA A;  3CCV A;  3OTO Q;  5C44 G;  3TS2 A;  1TXY A;  2YTY A;  2Y0S G;  3UE0 A;  3G6E A;  3HKZ E;  4DV1 Q;  2CWA A;  3HOU G;  4EX5 A;  2F4V Q;  1SRU A;  2HT1 A;  3HOW H;  3KJP A;  1YVC A;  1SR3 A;  1OTC A;  2KCT A;  1UE7 A;  1KRT A;  5C3E G;  5DLQ E;  2KEN A;  5FLX c;  4DK3 C;  3CPF A;  1N36 Q;  1DGS A;  2JA8 G;  4LUV A;  1L1O C;  1EUJ A;  2MQH A;  4QL5 A;  2R92 H;  4O2D A;  4YWM A;  4IPC A;  2EXD A;  3M7N A;  4GN5 A;  4DR5 Q;  3ERS X;  4OON A;  4A3K G;  3RNU A;  2ZTE A;  4A3B G;  2JA9 A;  4BXX H;  4UP9 A;  3CCM A;  4BY1 H;  1PH1 A;  4JYA Q;  1K9M C;  2JA7 H;  3AEV A;  4IFD G;  2BH2 A;  4JBW A;  5LMN Q;  4GOP B;  4B3R L;  2L15 A;  5C0X I;  2VQE L;  3S24 A;  2Y0S E;  4GN3 B;  2NVQ H;  1VQ6 A;  3S14 H;  1UWV A;  2YTV A;  1S3O A;  1VQ8 A;  2I5H A;  2PQA B;  4J15 A;  2I0Q A;  2ASB A;  2Q2I A;  2B63 H;  1JJ2 A;  1E1T A;  4L5R C;  3I4N H;  1ASY A;  3T1H L;  1MIU A;  1KL9 A;  4A3F G;  3GTP H;  2OQ0 A;  2RF4 A;  3GD7 A;  4NXM L;  1EQQ A;  1HJP A;  1QVC A;  4QJF A;  1KC8 C;  5FLM H;  2KCM A;  4X65 Q;  4JI5 L;  1Q1E A;  1YNX A;  3J80 i;  1Y1W H;  3JC6 6;  5LMU L;  2A1A A;  4LFA L;  4DR7 L;  4JI2 L;  5JJK A;  3GO5 A;  4DR3 L;  1YHQ A;  3PGZ A;  5GAE C;  1Y1V H;  1PH8 A;  2UXC L;  2NVY H;  1BVS A;  2KBN A;  2RCN A;  4A76 A;  4OX9 L;  3Q8D A;  2E8G A;  4TVA B;  4AYB E;  4PZ7 A;  5IE8 A;  4A75 A;  2VUM G;  4X62 Q;  1CKN B;  3I2Z A;  4JI8 Q;  4BBR G;  3BZK A;  4NB3 A;  1TWA H;  5FJ8 H;  2IX1 A;  2YV5 A;  4R4C A;  5C4J H;  4C2M H;  1XNR Q;  2VQE Q;  3GTK H;  1GO3 E;  4BY7 H;  4B3R Q;  4LFC L;  3I55 A;  1VQH A;  1YZ6 A;  4JCV E;  2VL6 A;  4YWL A;  1IBL L;  1Q8K A;  2ZM6 Q;  4QY7 A;  3KF8 B;  3T1H Q;  3EN2 A;  4LF6 L;  3HOV G;  4FDB A;  1VQG A;  2MO1 A;  2YYZ A;  2IX0 A;  4LW1 A;  4NXM Q;  2JA6 H;  1PH9 A;  1XPU A;  5EAY A;  1HNZ L;  3CCU A;  1IL2 A;  1OXX K;  4OO1 I;  1L1O B;  1P8L A;  2WFW A;  4JI5 Q;  4A3I H;  3M4P A;  3TS0 A;  1EFW A;  4LFA Q;  5LMU Q;  5GQO A;  2D0P A;  4JI2 Q;  3U4V A;  1HR0 W;  4DR3 Q;  1HR0 L;  3UDF A;  1TWF H;  4LF8 L;  2HHH L;  4LF5 L;  3H0G H;  4DAY B;  1Z47 A;  1WCM H;  3TRZ A;  2UXC Q;  2ALY B;  4OX9 Q;  4A3C G;  4QQB X;  3HOX G;  5M3F G;  1S72 A;  3OYY A;  4DV2 L;  2OTJ A;  1LTL A;  1OXS C;  1X54 A;  5GAH C;  1K83 H;  3CP0 A;  4A3D G;  4O0A A;  4A3E H;  1YJN A;  5C4X G;  1AE3 A;  2EIF A;  4DKA C;  3FP9 A;  2UUC L;  4LFC Q;  4P75 A;  4GOP C;  3H3V H;  3PO2 G;  1IBL Q;  2PMZ E;  1GD7 A;  3NEN A;  1GKH A;  1Q46 A;  3AYH B;  4BBS H;  1NBW A;  5E7N A;  1VQI A;  2UUA Q;  4JV5 L;  2D0O A;  1Q1B A;  4DR1 L;  1I50 H;  3NEL A;  4LF6 Q;  2R7Z H;  4XTC S;  1MJC A;  1PH3 A;  1HNZ Q;  3PO3 G;  3CCS A;  1YHB A;  1PVO A;  1BBW A;  4NXN L;  2WB1 G;  3I4M G;  4JBK A;  2WP8 J;  3A5U A;  4LF8 Q;  1HR0 Q;  5IP7 G;  2HHH Q;  3GTO H;  1B70 B;  1X3F A;  1EWI A;  4IPH A;  3RN2 A;  1FJG Q;  2YTX A;  2HQL A;  2OTL A;  4GLA C;  4HJA A;  4JI1 Q;  1HZB A;  1UE5 A;  1RIP A;  4GS3 A;  3SGI A;  3CME A;  4JI0 L;  3F2D A;  1PFS A;  4AIM A;  4GOP A;  1YJW A;  4GLV B;  3RR5 A;  1RL2 A;  5C44 H;  4YHH Q;  1XMO Q;  2PQA A;  2N3S A;  1WJJ A;  4IO9 A;  2K5V A;  2N49 A;  4P73 A;  4X64 Q;  3ULP A;  2UUC Q;  1ASZ A;  1CKM A;  3HOU H;  4LUO A;  1J5E L;  5IY0 A;  3CW2 C;  5JJI A;  2D62 A;  2VW9 A;  1Q82 C;  5AJ3 Q;  5GAG C;  4OWX B;  4JBM A;  4WJ4 A;  4JV5 Q;  5K36 G;  4DR1 Q;  1VQK A;  4B3S L;  1UE6 A;  1N9W A;  5ELO A;  5C3E H;  1G29 1;  4X65 L;  4HIM A;  5IYD G;  3J7Z C;  4GLX A;  1XPO A;  2E2J H;  4OWW B;  2WB1 E;  1EOV A;  1W3S A;  3KDF B;  5IWA Q;  3F2C A;  1HNX L;  3M3Y H;  1V1Q A;  4NXN Q;  2NN6 G;  4B3M L;  1SE8 A;  4A3J G;  2FXQ A;  3M85 A;  1SFO H;  1VQL A;  3KJO A;  1KXL A;  1PH7 A;  4A3K H;  1CKN A;  1XPR A;  4A3B H;  1BKB A;  3G48 A;  1C0A A;  2N78 A;  3GTQ H;  4X62 L;  1PYB A;  3E9I A;  2ZJR A;  4DV3 Q;  4JI0 Q;  4JI8 L;  3KF6 B;  3J81 i;  1K3R A;  3BU2 A;  1E7Z A;  1VQD A;  2OWO A;  4LF9 Q;  1XNR L;  3CC7 A;  2VS1 A;  4P71 A;  3H3V I;  2CFM A;  3T1Y Q;  1YJ9 A;  4A93 G;  4DR4 L;  3G4S A;  4A3G G;  2ZM6 L;  1J5E Q;  3KFU A;  2ZTD A;  3FHW A;  3ICE A;  3F1Z A;  3PV0 A;  1I5F A;  2JQO A;  4QIW E;  1PV4 A;  2NVT H;  4A3F H;  3S17 H;  2KHI A;  4X6A H;  2MFI A;  4YCV A;  5IP9 H;  1A8V A;  1PH2 A;  3GTJ H;  1L1O A;  1CUK A;  3CC2 A;  2N8N A;  4B3S Q;  1AH9 A;  2JJQ A;  3WWV A;  5H1S E;  3AFP A;  3M4Q A;  4GN4 B;  2ES2 A;  2E2H H;  4MTN A;  1YEZ A;  1JB7 A;  1E22 A;  4BY1 G;  3DLL A;  1X9N A;  4HJ9 A;  1HNX Q;  3RZD H;  2UXD L;  4DR2 L;  1HH2 P;  2AMC B;  3PF5 A;  1PA6 A;  4B3M Q;  1QVF A;  2CCZ A;  4JI7 Q;  1K0R A;  1NE3 A;  5HGQ A;  3CCL A;  4OXP A;  2JEB I;  2VUM H;  4HIO A;  4KI0 A;  3J7A 5;  2E5L Q;  1D7Q A;  2K50 A;  4BBR H;  3KOJ A;  3K8A A;  1TWG H;  3HOZ G;  4AQY L;  2R7F A;  4RG1 A;  3UE1 A;  3S1R H;  3S1Q H;  4R4T A;  2YU9 H;  1S40 A;  1E24 A;  3PCO B;  1GM5 A;  2C35 B;  4A3M G;  1V43 A;  1CSQ A;  3K7U C;  1NJI C;  1G6P A;  4DNI A;  4DR4 Q;  3CAM A;  1VQM A;  5C0X J;  2BH8 A;  2NVX H;  2PI2 E;  2UUA L;  4ALP A;  4APV A;  3JAM c;  2RHQ B;  2IY5 B;  2AWO A;  3CD6 A;  4LWC A;  4C3I H;  2A19 A;  1EQR A;  3PUX A;  1E3P A;  1VQ9 A;  2HIV A;  1U0L A;  3UDX A;  3PF4 A;  1BBU A;  4POG A;  4GKJ L;  2DUD A;  1CKO A;  1IXR A;  3LGJ A;  3RLN A;  2UXD Q;  1CSP A;  1WOC A;  4DR2 Q;  4JG2 A;  4YWK A;  4JI6 L;  1FJG L;  2V1C C;  3W5O A;  3I4O A;  4L5Q A;  4JI1 L;  1JMC A;  1VQC A;  5M3F H;  4HIK A;  1PH4 A;  1YIJ A;  3AFQ A;  1EYG A;  2UU9 L;  1VS0 A;  1GVP A;  5HY6 A;  4IFD I;  2GVA A;  5M3M G;  5C4X H;  4A3D H;  4QGU A;  4AQY Q;  4YHH L;  1XMO L;  1HNW Q;  4DR6 L;  2Q2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...