4B3MQ

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3mQ00
4B3MQ 3L7ZC 4LF4L 4GLAC 4GKKL 4DKAC 3ERSX 3ICEA 2FXQA 4YCVA 4A3BG 2I5LX 4AQYL 1IYJB 2VZAA 3H0GG 1NJIC 4LFCL 1K8AC 4JI0Q 4K0KQ 3A0JA 3D31A 1XNRL 2QA4A 1A0IA 1HNZL 1YEZA 1QUQB 1PH7A 3U50C 2KCMA 3TS0A 1HNWQ 3BZCA 1S3OA 4QQBX 2VNUD 4DV5L 1IBMQ 3CMEA 2MFIA 1PH5A 4BA1I 2BH2A 4UP9A 1OXTA 2BA0A 3F2DA 3CCMA 3HOUG 3PIOA 2PQAB 5C4XH 3STBC 2E2HH 1SLJA 5IT9c 1UE5A 3CCSA 5IP9G 3GTJH 3SGIA 1JT8A 1SMXA 4X66L 1UE1A 4HIDA 3PV0A 1Y14B 4A3KH 3K8AA 1YJ9A 3GTLH 4DV0L 5C3EG 2A1AA 3HKZE 4JYAQ 1NTGA 3KF8B 3ZJYC 4HJ7A 4DR5L 1Q82C 3KYHC 5H1SE 4X65L 1VQMA 2OTLA 1Y1WH 4DR3Q 2RHSB 3ULJA 5IE8A 1DGSA 2R7ZG 2B3GA 2HQLA 1PH2A 3J81i 1JB7A 3L2PA 1XNQQ 4X6AH 2JA6H 4YHHL 2NN6G 4IOCA 4LF5L 1XPUA 3AFPA 5IYBH 4FDBA 2A19A 5M5WH 3KJOA 2K5HA 1VQ9A 1JE5A 2F52A 5AJ3L 1ASYA 3CMAA 2UXBQ 1IBLQ 4C3JH 3VDYA 3AEVA 3UDIA 1HR0Q 5FLMH 1CSQA 5C0XG 4BA2I 4WJ4A 2MO0A 4LNQA 2B29A 4Y7NH 3CF5A 3T1HQ 2F4VL 4AH6A 2OTJA 3HKZG 2ZTDA 4UPAA 3CC7A 4DV2L 3J7A5 3PF4A 4KHPL 1C0AA 1A8VA 4XTCS 1XJVA 4GKJL 4O2DA 1VQJA 4LF7Q 5M5YH 2F3IA 1PH3A 4DR6Q 2JEBI 2YTYA 4OWTB 1QUQA 4P73A 1PHJA 2VUMG 1NMFA 4OO1G 4YWLA 2VS1A 1PH1A 4DV6L 2JA5H 2R93H 4R4QA 1KD1C 3M85A 2UUCL 2R92H 1PVOA 5GADC 5J3BA 4NXNL 2E2JH 3K81C 2BH8A 1U0LA 4BBSG 4IPDA 2CKZB 2ZJPA 4B3TQ 2LSSA 4LFAL 3PO2H 1AH9A 3J81c 4A3GG 4IJHA 1KHIA 4MNOA 3HOWH 3HOYG 4PZ8A 1GVPA 3W5OA 1Y1VH 5FJ8H 1M90C 3Q8DA 1Q12A 3PF5A 3RLOA 5IYDG 1A63A 3LGJA 4AYBE 5JJIA 2ASBA 4JI2Q 2VQEL 4LF8L 4DR7Q 4JBMA 4JI3Q 3HKSA 3PUXA 4RG1A 1I5FA 2RCNA 4QL5A 3M4PA 2K14A 4L5TA 4YY3Q 1Q46A 1I50H 1NY4A 1V43A 2YTXA 1PFSA 3PO2G 1YI2A 1WJJA 1VQPA 5IWAL 2ZJQA 4GLVB 1SR3A 1NMGA 1D8LA 3UDGA 3CCLA 1FJGQ 2VY3A 4A3FG 3MEFA 3J80i 4B3RQ 3E9IA 1LYLA 1XTDA 1VQHA 2L15A 2N8NA 1VQLA 1XMQL 2EXDA 5GAHC 2OCEA 1SFOH 1J5EQ 3CPWA 1X6OA 2GN5A 2NVYH 4DV7Q 4A3IH 1XPOA 1I94L 3UDXA 2GVBA 4KI0A 2KCTA 4C3HH 2XGTA 1N32L 1YHAA 2HIVA 2UXCQ 3PO3G 4NXMQ 1QVFA 3EN2A 1EWIA 4AYBG 1SROA 3PUYA 2H5XA 1AE3A 1X3EA 4BXXH 4GLXA 2K50A 1Q7YC 5GROA 4GOPC 1CKNA 2E5LL 2YYZA 4B3SQ 2EQSA 1GM5A 2RHQB 3A74A 3F2CA 5GAGC 3CCJA 4GKKQ 1XPRA 4DV4Q 3G4SA 1HZ9A 4AQYQ 4GS3A 4LFCQ 3NELA 4IPGA 4LW1A 5C4JH 3G71A 2OQ0A 4DV3L 3PUVA 4A3JG 1I3QH 1HNZQ 4P75A 2K52A 1X65A 1E1OA 3EBEA 1HZBA 5K36G 3ULPA 4QJFA 1EYGA 1PH6A 2D0PA 3GD7A 3E9HA 3GTOH 1CKOA 2NZHA 4R4CA 3PUWA 4HIOA 3OTOL 2Q2TA 1X54A 4X62L 1YIJA 4A76A 4A3DH 2YTVA 1K9MC 3L0OA 1BVSA 4L5QA 3I2ZA 2EIFA 1VQDA 3J80c 3HOXG 1J6QA 1HH2P 1Q1EA 4LF6L 4R1JA 4GOPB 3CD6A 2NVQH 1VQKA 3H3VI 3H3VH 4BY7G 4X66Q 4POGA 3S1RH 4DR1L 3U58A 1Q1BA 4DV0Q 1EIFA 3HOVH 1Z9FA 4J15A 2JK8A 4JC0A 2WP8J 3CC2A 4DR5Q 1HNXQ 4X65Q 3GTKH 2B63H 5DLQE 3CP0A 1VQ8A 5ELOA 4OX9L 3JAMc 3KDFB 1EFWA 3UE0A 3I7FA 1N34Q 5BR8L 3I4NH 4JI5Q 3W1GA 3PCOB 1TXYA 4YHHQ 4DUYQ 2IT1A 4JI7L 4LF5Q 3FKIH 3S2DH 2MQHA 4BY1H 1VQ6A 4L5SA 4GNXC 4HJAA 2CFMA 3M9BA 3BU2A 4JV5L 4KHZA 2AKWB 4A3EH 3TEHB 4JI8L 4R4TA 3KJPA 4ALPA 4HJ5A 1TWHH 5JEAG 3BZKA 4EX5A 2JA7H 4MZ9A 3FHWA 1FVIA 4IFDG 1QZGA 1S72A 3I4MH 3TREA 1X3FA 4DV2Q 4HIKA 4KHPQ 1B7YB 3CCQA 4JI1L 5JJKA 2ZTCA 3TQYA 2VL6A 2YV5A 1KC8C 5C4XG 1KL9A 4A3LH 2ID0A 4YCWA 5JEAJ 2NN6I 1KRSA 3J81j 1PH4A 4OWWB 3STBD 4DV6Q 2HHHQ 4IFDJ 1MIUA 1HZCA 1WCMH 2MO1A 4A3KG 2UUCQ 4GNXB 4DR4Q 4K0KL 1HR0W 1K83H 4NXNQ 4XIGS 3KF6B 2GVAA 3EIVA 4APVA 4HJ9A 1Y1WG 1PA6A 3HOZH 4LUZA 3NEMA 4LFAQ 3IRBA 1YHQA 4TVAB 2Q2HA 4JI4L 4GOPA 3KLWA 1PH9A 1HJPA 4LFBQ 4UP8A 5IYCH 2JA6G 3A5ZB 4A93H 1A62A 5IYBG 2K5NA 2XTIA 5M3MH 4A75A 2HT1A 2JEAI 1CSPA 3K7AH 5C0XJ 1CKNB 1JMCA 3GO5A 3RN5A 5FLMG 4OO1I 1YBYA 2QGQA 4LF8Q 3KDFA 1K73C 1UE6A 4QY7A 1TWFH 1VQBA 4DNIA 2UUBQ 3S14H 4IOAA 1VQOA 4JG2A 3K80C 1OXVA 1PV4A 5HY6A 1BBWA 3K7UC 4TQUS 1NE3A 2CWAA 5FLXc 3GTMH 2HIXA 5IYCG 2BA1A 3U4ZA 3U4VA 3ER0A 2CWPA 3NENA 3FP9A 4P71A 5M3MG 4NPSA 1OTCA 1EUJA 3PGZA 3RR5A 3CXCA 1N33L 3S1QH 5C44H 4A3CH 2JA5G 2R93G 1X9NA 1P8LA 1I94Q 2R92G 2OQKA 3E0EA 4PMWA 2UXDQ 1BBUA 5LMNQ 1N32Q 3CAMA 4P74A 5LMNW 1Q81C 2UUAQ 1WI5A 1VCIA 4R4OA 4JI6L 3HOWG 4UP7A 4L5RC 2ZM6Q 1QVGA 2JA8H 1NBWA 5IP7H 1MJCA 1X56A 3KOJA 1Y1VG 5FJ8G 4DUZL 1TWAH 4GNXA 1E7ZA 3JC66 4LF7L 2IX1A 3J7ZC 1E3PA 1X3GA 4DV1Q 4A3CG 3KF6A 2KHIA 1N8RC 4AIMA 2UU9Q 4DV3Q 2AMCB 1JJCB 4LUVA 3TRZA 1SN8A 4JCVE 2E2IH 2Z6KA 3NBHB 4X64L 3PSIA 2VQFL 3I56A 1IBKL 1G51A 2R7FA 3OTOQ 4IPCA 4X62Q 1N36Q 1ASZA 4BBRH 3S2HH 1LM0A 5M3FH 2AWOA 1W2BA 1EQQA 2Z0SA 4LF4Q 4GN5A 1OXXK 4LF6Q 1MJEA 4JOIC 4DR1Q 3GDEA 1XNRQ 1Z47A 2K4KA 4A3IG 2K5VA 2AWNA 3MXNB 2OWOA 2N3SA 2DUDA 1LUZA 1EOVA 3A5UA 2R6GA 4DV5Q 1FL0A 3G6EA 1YITA 4JBJA 4YCUA 5IY0A 4OX9Q 4BXXG 3CCRA 1W3SA 4WJ3M 5BR8Q 4BBRG 4YY3L 3PUZA 4JI7Q 2JE6I 1HZAA 1FJGL 2WFWA 1VS0A 1KIXA 4JI8Q 4ME3A 4A3BH 3H0GH 1Q86C 1V1QA 1CUKA 4POFA 1XMOL 2IHFA 3WWVA 1S40A 1KXLA 2UXCL 1VQ7A 1IZ6A 2LXKA 4NXML 4A3DG 2IHEA 2ALYB 5GAEC 3HOUH 4KLKA 4GN4B 3CQZH 2PMZE 4RMFA 5AJ3Q 1TWCH 2KHJA 3T1YL 2VW9A 1RL2A 2A8VA 1VQFA 3UDFA 1GO3E 5IP9H 1CKMA 4H02A 4DV4L 2AHOB 3HOVG 4LF9L 2PI2A 1L1OA 1IXRA 1YHBA 2Z6KC 2B63G 5C3EH 2F4VQ 2CCZA 5LMUL 2JA9A 4A4IA 4JI4Q 4IFDI 3RN2A 1VQ4A 3I4NG 3S1MH 4DR2L 1JJ2A 2R7ZH 4PZ6A 4C2MH 4GKJQ 3CCUA 3FKIG 4BY1G 2QEXA 3CCVA 4QGUA 1M1KC 4B3ML 1JJGA 4A3EG 4UY8C 4OWXB 3RLFA 1RIPA 4PG3A 4JI0L 2JA7G 2N78A 2IY5B 3F2BA 3AQQA 2DGYA 3B6YA 1BKBA 3I4OA 1LTLA 5C0XI 3H15A 3I4MG 1HNWL 1HNXL 1C9OA 2WB1E 3CPFA 3M7NA 4HIMA 4GN3B 1KAWA 1IBML 4JBWA 3S17H 1VQGA 1QZHA 2KENA 1K0RA 4JBKA 4Y52H 1K8GA 1N34L 4A3LG 4JI5L 1N33Q 4DUYL 1G6PA 2KBNA 4PZ7A 3K0XA 4JOIA 3DM3A 3AFQA 1WCMG 4QIWE 5M5XH 1SE8A 1R9TH 1KRTA 1E24A 2NVTH 4NB3A 2VUMH 2VQEQ 3BJUA 1N9WA 4OONA 1GKHA 3HOZG 4JYAL 3G48A 1MKHA 3CCEA 1TWGH 4BBSH 4DR3L 4JI6Q 2RF4A 5IWAQ 3F1ZA 1VQNA 4LWCA 1VQIA 4A93G 1GD7A 1E22A 4P72A 2Q2UA 4DUZQ 4A3GH 1U5KA 3HOYH 2IX0A 2WB1G 3S15H 1UE7A 1XNQL 3GTPH 1K3RA 1XMQQ 1IL2A 2ATWA 3S16H 2LXJA 5E7NA 4DAYB 1IBLL 2UXBL 1B70B 5IYDH 2HHHL 1HR0L 1PH8A 4DR4L 1L1OC 1QVCA 4X64Q 5JJLA 3S24A 3S1NH 2I5HA 2VQFQ 1VQAA 3RZDH 1IBKQ 4YWMA 1EIYB 3I55A 1SRUA 3T1HL 2E5LQ 3KFUA 2PQAA 1L2FA 4DPGA 1FGUA 2WAQE 4OXPA 4LFBL 1PYSB 1WYDA 2V1CC 1AE2A 3D0FA 1B8AA 3OYYA 5C44G 1KQSA 2K75A 4A3FH 1I6HH 4DR6L 3RNUA 1E1TA 1VQ5A 1VQEA 2ZJRA 2D62A 2ZTEA 3F8TA 2MNAA 1EQRA 5ELNA 1PYBA 2ES2A 1WFQA 4MTNA 5HGQA 1H95A 4DAMA 2N49A 2UUBL 3CC4A 1O7IA 3CW2C 2C35B 1L1OB 2E8GA 5GQOA 3PO3H 1Q8KA 2JA8G 5IP7G 2I0QA 4B3TL 3PIPA 1OXSC 2R7DA 1T9HA 1YZ6A 1X55A 1C7YA 2JQOA 1UEBA 3GTGH 2Y0SE 1YJWA 2WAQG 3DLLA 1D7QA 4IO9A 5EAYA 3OW2A 2D0OA 4IJLA 3ULLA 2PI2E 4YWKA 4A3JH 4A3MH 4C3IH 1XMOQ 4JI2L 4DR7L 2UXDL 5LMNL 4JI3L 4LUOA 1YJNA 1P16A 2UUAL 5M3FG 1L0WA 4DK6C 4R4IA 3UE1A 3JAMi 3M4OH 2ZM6L 1UWVA 3T1YQ 2NVXH 2CQOA 4O0AA 3TS2A 1OXUA 2NZOA 3HOXH 4JV5Q 4DK3C 4B3RL 2Q2IA 3RLNA 4DV1L 4BY7H 1YVCA 3M3YH 4LF9Q 1YNXA 2UU9L 1J5EL 2Y0SG 4A3MG 4DV7L 3AYHB 2I5MX 3RZOH 5LMUQ 1G291 3M4QA 1V9PA 1WOCA 4JI1Q 1VQCA 4EQ5A 2PNHA 4DR2Q 3HFZB 2YU9H 4IPHA 3W1BA 4HJ8A 1N36L 3GTQH 2JJQA 4B3SL
chains in the Genus database with same CATH superfamily
4B3MQ 4LF4L 2L1BA 4FXKC 5I9OA 4YCVA 2QKIC 3EFXD 4A3KB 3GTLB 1HFNA 3D31A 2QA4A 5DAUA 3U50C 1HNWQ 4OGQC 1S3OA 4QQBX 2BCOA 5CBAE 2VNUD 1DOMA 3SK8A 2MFIA 4BA1I 1OXTA 3KBXA 3PIOA 2IPKD 1X3PA 2EYLA 2LMCB 1HTLD 1Y14B 4A3KH 3K8AA 3GTLH 3E0JA 1RTNA 2WKDA 2B2UA 1JOKA 1O7YA 1VF5C 3HKZE 4JYAQ 4HJ7A 4L8JA 3HOZB 1V8QA 1A15A 1VQMA 1LTBD 2G9HD 1DGSA 3T4AC 1HQMC 3J81i 4X6AH 2F0LA 4IOCA 4LF5L 1PFBA 3ND8A 2K5HA 1WTXA 5AJ3L 4P2CB 3VDYA 1GHJA 1Q3LA 4QF4A 1CSQA 2QDLA 3D6WA 2PQEA 2ENBA 1TS3A 3HOWB 3CC7A 4DV2L 5JPNC 4N8FA 1C0AA 3KLRA 3WDNA 4LF7Q 1WD0A 3S1QB 2L4NA 4OWTB 1O7ZA 1WTVA 2RQXA 2R93H 2NBFA 1GJXA 1NR2A 1A2TA 3K81C 2BH8A 1I50B 3EROA 4B3TQ 2LSSA 1WVLA 3HOWH 4MNOA 2NTSA 1E2VA 1F2ZA 3KLSA 1YNNC 1JQYD 1SNOA 5JVH3 2EE1A 3NXWA 3LGJA 4FP5D 5E1FA 4RFBA 4JI3Q 3HKSA 1I5FA 1SYFA 2F0HA 4YY3Q 2EYHA 1I50H 5E3FA 1V43A 4BBRB 5ELFA 1YI2A 1WJJA 1XX8A 1VQPA 5IWAL 2ZJQA 3UDGA 1SR3A 3IAYA 3MEFA 1MI2A 2Z6BA 2OCEA 3CPWA 4UAIA 3O13A 3FMCA 1PFNA 1PDQA 2F4IA 1D5MC 3E5SA 3PO3G 1QVFA 3NTHA 1EWIA 1QILA 3Q24A 1UEAB 1X3EA 2EOTA 4B3SQ 5GAGC 5IGDA 2RDGA 4DV4Q 1A3UA 1HZ9A 3NELA 4IPGA 4LW1A 3GTKB 1I3QH 2EVBA 1X65A 5A2QE 1HZBA 4QJFA 1EYGA 3GD7A 5IODA 3GTOH 4R4CA 3I4NB 3BYTB 4G57A 1K9MC 3C1EA 2ZT9C 3HOXG 1T5EA 1ZKOA 4A3EB 4FNFA 1B3QA 1VQKA 1WTQA 3KLSX 4X66Q 3D4RA 4QMGA 3GTKH 2WP8J 5C3EB 4NW2A 5CYUA 3VR5A 3QB3A 3JAMc 3PQIA 2JXMB 3UE0A 2B2VA 3I4NH 1TXYA 4YHHQ 4ZUJA 1FYCA 5BN5A 2RDHA 2MQHA 1K8MA 2CFMA 4JV5L 4A3EH 2BOSA 4LK1C 3SDZA 4MZ9A 3VA7A 3T13A 1U4RA 3TREA 1S5DD 1HXYD 1X3FA 1X3QA 5EKKA 4DAPA 4OELB 5JJKA 1H9KA 1JICA 2HDLA 2NN6I 3J81j 4BS9A 1HZCA 2MO1A 4JPBW 4A3KG 2UUCQ 4K0KL 2R61A 3SVMA 3TP5A 4XIGS 3NEMA 4LFAQ 3GTMB 4JI4L 1DYQA 1VMPA 4GOPA 1CHQD 4A75A 2HT1A 5C44B 5C0XJ 4LAAA 1JMCA 3SHLA 4OO1I 1YNJC 3V96A 4QY7A 2N88A 2EXZA 3DMUA 5HY6A 2XRQD 3CRKC 4TQUS 3GTMH 2HIXA 5IYCG 2A6HD 4K2LA 2BA1A 5KIXA 2CWPA 3NENA 1QB5D 1OTCA 1CK1A 3RR5A 5FK9C 5C44H 4A3CH 2MJ8A 3RUZA 2R93G 2E2IB 2OQKA 3JAML 3E0EA 4PMWA 1BBUA 5CV7A 5LMNW 4R4OA 5M3FB 4FF3A 3HOWG 2ZM6Q 1NBWA 1B44D 3Q23A 3KOJA 4X3KA 2D5DA 1AN8A 4GNXA 1SEBD 3J7ZC 3K5LA 4KY7A 2JP1A 1JJCB 4LUVA 3TRZA 1SN8A 1PTOF 2E2IH 3NE5B 4IUNA 1PZJD 1LTGD 4X62Q 2F03A 1ASZA 3D8GA 5M3FH 1R4PB 2AWOA 1LO5D 2Z0SA 3K5OA 4GN5A 4ZQ3A 1EU4A 5C4ZA 4CHTB 4A3BB 3H0GB 1XNRQ 3Q6SA 1ENFA 2AWNA 2OWOA 2N3SA 2JYOA 1PRTC 3NQIA 3PIP3 2TSSA 4ME5A 4WJ3M 3SE0A 4BBRG 1U4LA 1BNZA 4JI7Q 3HOUB 3K57A 4DAYA 2IL8A 3D4DA 1QCBD 1XYIA 1EFID 5KNCA 1SNPA 4ME3A 4A3BH 4I65A 3H0GH 1SBBB 1CT1D 4FO2A 1JOOA 2EYJA 1F9PA 4POFA 1CUKA 1TIID 3E3XA 3KUPA 3S1MB 2UXCL 3HOUH 4KLKA 1U9RA 4GN4B 2PMZE 2VW9A 1RL2A 3OIQA 1GO3E 5IP9H 3IKJA 5DM63 3OIPA 1SDFA 2PI2A 3URYA 2F4VQ 1JC7A 1STNA 3HKZB 1VQ4A 4K5XA 3I4NG 3S1MH 1JJ2A 4GKJQ 2QEXA 1CA6A 4A3EG 1R4QB 3RLFA 1RIPA 4JI0L 3F2BA 3AQQA 2E76C 1C9OA 3CPFA 1B9NA 3FVQA 4JBWA 2KENA 4R9WA 1ML0D 4Y52H 5M5YB 1N34L 1N33Q 1LTSD 4PZ7A 5A2QL 2MP1A 3S16B 4QIWE 2VUMH 1SE8A 2NVTH 2VQEQ 1CI3M 2CVRA 1GKHA 4EQOA 1MKHA 3CCEA 1WTWA 3PO2B 2JN4A 1NUCA 3F1ZA 4LWCA 1VQIA 5BN4A 3NP8A 1GD7A 2Q2UA 2KECA 2KCNA 1UE7A 4IZ8A 3MTSA 2EY2A 4F8MA 1IL2A 3D3RA 1QE6A 3S16H 5KNDA 3GQBA 5IYDH 1RJTA 3BVMA 1JWSD 4X64Q 3S24A 1TS4A 2VQFQ 2WV6D 1DD2A 1LT6D 4YWMA 1HRJA 3T1HL 1BOSA 1L2FA 4DPGA 2WAQE 4OXPA 4LFBL 1PYSB 3VYUA 2AUJD 5I2YA 5C44G 4HSVA 4DR6L 1YNND 2DNCA 1VQ5A 1SFOB 2ZJRA 1G91A 3NUCA 4EQPA 4A3JB 4C3IB 2KEEA 2ES2A 4L6TB 1XWEA 4TSSA 5HGQA 1H95A 2UUBL 3BDOA 3Q22A 2C35B 1L1OB 1Q8KA 1D1KA 3M4OB 2R7DA 5JPMC 1YZ6A 1LV9A 4ABNA 3C46A 3GTGH 2Y0SE 1YJWA 4IUUA 2SDFA 3ZYYX 5C3XA 3ULLA 2PI2E 4A3JH 3QO2A 4ZUIA 3MA2B 4C3IH 4A3MH 1DM0B 1LLRD 3WOEA 1I4GA 4N9PA 2UUAL 3K5MA 5M3FG 3QWNA 4HEDA 1L0WA 4MTKA 5AFWA 3GV6A 4DK6C 5C3WA 3UE1A 3JAMi 3HG9A 3M4OH 1HUMA 5DEHA 1UWVA 3VR4A 1SYBA 4O0AA 3TS2A 2K05A 2Q8RE 3QG1A 2Q2IA 2G5DA 2SNMA 2Z4IA 4OIJA 4CDEC 1J5EL 3MAQA 4K14A 1MBYA 1ZEQX 1B4OA 4JI1Q 4DR2Q 2A74C 3MZ5A 3J80E 1I6VC 1G6ZA 3L7ZC 4K6DA 4DKAC 3ERSX 3QIAA 4A3BG 2I5LX 1NJIC 1IYJB 2VZAA 3H0GG 3BDCA 4LFCL 1K8AC 1KNAA 4JW0A 4QCLA 1ET6A 1A0IA 1HNZL 2B2TC 1EY6A 2KCMA 1BO0A 3BZCA 5EKIA 1TVXA 4IFDH 1FNVA 1L0YB 4FXDA 4UP9A 4RCOA 3HOUG 2PQAB 3TDQA 1ENCA 2HCCA 1H9SA 1S5FD 1BBXC 1JCKB 5IP9G 1U4MA 1JT8A 1SMXA 1HFGA 2J7ZA 4HIDA 3PV0A 3P75A 1YJ9A 4DV0L 1G2SA 2A1AA 3OSOA 3VYSA 5FOBB 3ZJYC 3MFGA 4DR5L 5H1SE 4X65L 4XXEA 5IGCA 3ULJA 2B3GA 2HQLA 4KHVA 2I46A 1XNQQ 3AFPA 5IYBH 4FDBA 4C56C 1VQ9A 4MN3A 2F52A 5D14A 3CMAA 2UXBQ 4B9WA 2K1BA 4KY5A 2A68D 3K59A 4CBVA 4Q0FA 3H94A 3TP7A 4AH6A 3HKZG 2ZTDA 1TS5A 4G7OC 1XJVA 2JEBI 1QUQA 4P73A 2VUMG 4KK7A 4DV6L 5HURA 2ICIA 4XT3B 1PVOA 3TZUA 5GADC 4NXNL 1NCVA 4ZKBB 2F0KA 5IOCA 4IPDA 4HTHA 2ZJPA 1KHIA 3M4YA 4PZ8A 4DXFA 1ILPA 2C5CA 1B1ZA 3W5OA 5FJ8H 4K5VA 1M90C 5IYDG 4C3HB 4JI2Q 4LF8L 2PO4A 4JBMA 4DA2A 4RG1A 1JWUD 2ZXPA 3PO2G 4S3SA 3I90A 2O5JC 1NAPA 3VYTA 4GLVB 1FJGQ 1D8LA 2LFNA 4FF4A 3P7JA 1Y8PB 4ZAIA 4U68A 4DU9A 2MUYA 5IGGA 1XTDA 4B3RQ 1XMQL 4H7BA 5HGTA 1GUOA 2AQ3B 1ET9A 2GN5A 5IGEA 4DV7Q 1I94L 2FMMA 2GVBA 5CV9A 4E6IA 2KCTA 4O1NA 4C3HH 1N32L 4XT1B 2CHBD 2H5XA 1AE3A 4GLXA 2KVMA 2E5LL 1ZYRD 2HDMA 2RKSA 3A74A 3F2CA 3OPOA 2PNRC 1KDAA 1HTPA 4DV3L 4A3JG 1RHPA 4C3IG 1O7LA 2K52A 3P1HA 2B63B 5NUCA 2IX3A 1FR3A 1KDCA 5IGBA 1D6EC 2E75C 3E9HA 5J1ZA 3OTOL 4G7ZC 1X54A 1YIJA 4A76A 3MEHA 3L0OA 4BY1B 2ZXRA 1PZKD 3J80c 4RKLA 5C5MA 4GOPB 3CD6A 1GUGA 3H3VI 1EWCA 3S1RH 2FMCA 2PMZB 3X3MA 2JA7B 1EIFA 1XTCD 4J15A 3H91A 2EDGA 1HNXQ 2B63H 3I4MB 1JWMD 5DLQE 2FHTA 3CP0A 1LACA 5ELOA 4OX9L 2R7ZB 2NWGA 2EYPA 4C2MB 1EFWA 5BR8L 3V05A 4JI5Q 5C6AA 4LF5Q 2DY7A 4BY1H 1EU3A 1VQ6A 1ESRA 3KK7A 3M9BA 4R4TA 1GUNA 4HJ5A 1CQVA 2JA7H 3BZKA 4EX5A 2K6AA 2AQ2B 4IFDG 1S72A 3N52A 3I4MH 4DV2Q 4HIKA 3CCQA 1KLUD 2IJ0A 2J0TD 4OL7A 4IN3A 1FGBD 2LKVA 1KC8C 4A3LH 1PFMA 3STBD 2HHHQ 4IFDJ 1MIUA 4DR4Q 4GNXB 4TKOB 3S14B 1M8AA 2GVAA 4QIWB 4HJ9A 1F2YA 1PA6A 3HOZH 3PIO3 1TY2A 3IRBA 5IYCH 3ERQA 4H0LC 1KAAA 4I7AA 3IL8A 5IYBG 3MXGA 1CSPA 1M4VA 2JEAI 3DEPA 2O5IC 1CKNB 1F9SA 4ZCKA 1VDZA 3GO5A 1AZQA 1TQOA 3J7AF 1CHPD 3VR2A 1VQBA 5DM73 3S14H 3J80L 4L63B 1OXVA 1PV4A 2Z8LA 4BWGB 3K7UC 1NE3A 2CWAA 5I9PA 4KJOA 3U4VA 4P71A 3PGZA 1I6HB 2KUMA 3S1QH 2WAQB 3G6JB 2BDNA 3OOCA 3DXJC 1X9NA 1K28A 5LMNQ 3CAMA 3WOFA 3MC0B 3S2HB 2D2CC 4JI6L 4UP7A 3W3AA 1QVGA 5IP7H 3A8IE 1MJCA 4KKSA 2L0CA 1STAA 5FJ8G 4DUZL 5FO9B 3JC66 4LF7L 1E3PA 1G2TA 3KF6A 1N8RC 4DNTB 2UU9Q 2Y0SB 1QWYA 3NBHB 4NDXA 5LHY1 3T16A 3I56A 1G51A 2R7FA 3SK6A 1N36Q 4BBRH 3S2HH 1EQQA 4XYOA 5G3LF 4V0BA 4ILWA 1D5ZC 4HMIA 4JK1C 4JOIC 1CZGA 1BUVT 3H6MA 4JVZA 2K5VA 3MXNB 1LTAD 5EJWA 4UDUC 3UI2A 2DUDA 2XWJB 1EOVA 4C3HG 2OEOA 2BE5D 2R6GA 3A5UA 4DV5Q 1YITA 2VB3X 4JBJA 1AEXA 2B2WC 3CCRA 2EZVA 4YY3L 3QJYA 4LJZC 2WACA 1TWCB 2B2YA 4PMBA 1MSGA 1LTID 2WFWA 1CM9A 1F2MA 1VS0A 1D2BA 2M2LA 2EY6A 3LX0A 1B3AA 1Q86C 1V1QA 3S9WA 1S40A 3J7YW 4PNYA 2K03A 1VQ7A 1IZ6A 3HS0C 2ALYB 5GAEC 2K04A 3I70A 3OMCA 2E2HB 2OF1A 1ESFA 1TWCH 3IFTA 4YIJA 2A8VA 3I91A 2R3ZA 1ONLA 4DV4L 2H1EA 2AHOB 4LF9L 3EQLC 3V2TA 1EZ6A 1S5BD 2Z6KC 2B63G 2CQAA 1IKMA 5C3EH 5LMUL 1E0BA 4A4IA 3A8JE 4JI4Q 4NKLA 4TRDA 1PZID 4BY1G 1B9MA 3TP6A 1R9TB 4UY8C 2EPBA 2A69D 2A68C 2JA7G 1BCPB 2HUGA 2DGYA 2F0FA 1BKBA 3B6YA 5C0XI 3H15A 3I4MG 4BBSB 1GUTA 1PRTF 2WINB 3M7NA 4GN3B 3A8KE 1IBML 4A3GB 1VQGA 3HOYB 1K0RA 4JBKA 1K8GA 3PMFA 4A3LG 5CV6A 1J9OA 3DM3A 4IUVA 2EJGC 1R9TH 1H9MA 2TMPA 1KRTA 5EPJA 1EWHA 3S1NB 4RGTA 4OONA 3HOZG 2QILA 2PZTA 2G9DA 4BBSH 4DR3L 4K8JA 4A3GH 1DJRD 3HOYH 4A3FB 1H9JA 1K3RA 1SE3A 2ATWA 3L9AX 1S5CD 2QF7A 1IBLL 1B70B 1HR0L 1L1OC 1QVCA 5JJLA 2F3VA 2F0GA 3MVVA 3S1NH 2EY5A 1EIYB 3J81E 3W2DA 1FGUA 3I4LA 4MHEA 1BXTA 5KYLA 3DM1A 1STGA 1B8AA 2AUKA 1KQSA 4A3FH 1IYUA 1E1TA 2QDBA 2ZTEA 3F8TA 2MNAA 2B2TA 4MTNA 2B2UC 3L3OC 4DAMA 2N49A 5JAVA 1PXUA 5GQOA 1ZYRC 5IP7G 2I0QA 3PIPA 4IUQA 3H3VC 5I4DA 1X55A 3NHHA 2XWBB 1A3TA 2XN9C 1EL0A 4HCEA 2WAQG 4BY7B 3DLLA 1D7QA 5TSSA 1EIHA 5M9OA 4IJLA 3RZOB 1RTOA 4YWKA 3LWEA 1EZ8A 2PPBC 1DCZA 1TS2A 1JB3A 4DR7L 3NQTA 5K36H 2YU9B 3GTQB 1SNQA 1S4ZA 2ZM6L 4R8IA 2NZOA 2F0VA 3RLNA 4BY7H 2EYMA 1B2TA 1EEID 4WORA 2Y0SG 3AYHB 1LT4D 2I5MX 3RZOH 1G291 1RCVD 3M4QA 2HCIA 1V9PA 2QEJC 1A2UA 1VQCA 2PNHA 1K3BC 2YU9H 4IPHA 1EYAA 3GTQH 4GLAC 2KOLA 5LL6S 3GTJB 4GKKL 3ICEA 4DN4M 4J6HA 1HCZA 4AQYL 4JI0Q 4LMQD 1XNRL 1QUQB 1PH7A 5JEAH 3U9OA 1V1PB 1Z6HA 1Y1WB 3CMEA 2BH2A 3F2DA 2JA6B 1F2LA 3BS1A 1PYWD 3STBC 1SLJA 1UE5A 3GTJH 3SGIA 3MXPA 2F0DA 4DXGA 1BCPD 2SOBA 2A73B 5C3EG 4V190 4XYQA 4Y7NB 2OTLA 1Y1WH 2RHSB 4KJNA 5IE8A 1PH2A 2L12A 4DF7A 1JB7A 5M3MB 2JA6H 4FVMA 4RCNA 4RGNA 1XPUA 5EBDA 2A19A 2M00A 2R92B 3AEVA 3UDIA 5FLMH 2F0UA 3K0YA 4RAUC 4KKTA 4WJ4A 4Y7NH 1CZWA 3CF5A 3T1HQ 3KBGA 2F4VL 4UPAA 3BG3A 3J7A5 4KHPL 4XTCS 4F87A 1O78A 4GKJL 4O2DA 1VQJA 5M5YH 1PH3A 4DR6Q 5KGUA 2YTYA 1PHJA 2VS1A 4R4QA 1KD1C 3M85A 2R92H 1SE2A 4BBSG 3MHBA 1EY9A 5FLXE 4KKUA 5KYIA 3PO2H 3J81c 4A3GG 4IJHA 3HOYG 4RA8A 1GVPA 1TWAB 1WTHA 2Z9HA 5KNBA 3PF5A 3KF8A 3RLOA 2NVYB 4CKBA 2VB2X 2Z4HA 1IYVA 1SAPA 4AYBE 5JJIA 1SYEA 2ASBA 2VQEL 3HP3A 3AMUA 1GXDC 2RCFA 3PUXA 3TMEA 3M4PA 2K14A 4L5TA 1Q46A 2YTXA 1PFSA 3CU7A 5E4WC 2OXPA 1SJHD 4DFAA 3CCLA 4KN7C 3MWYW 2VY3A 4A3FG 3C3LA 5ELDA 3E9IA 1VQHA 2L15A 4HCSA 2EXDA 5GAHC 2L55A 1SFOH 1J5EQ 1X6OA 1SNMA 2NVYH 1F9QA 1XPOA 2BE5C 3UDXA 5EGTA 4KI0A 1GUSA 5CMDA 2XGTA 1YHAA 4NXMQ 3EN2A 5E4XA 3R93A 4M8AA 2K50A 4GOPC 4ODGA 2EQSA 4DK1A 3BZDB 2RHQB 3OHXC 2WIIB 3RD4A 3QOJA 4R8NA 3G4SA 3P20A 4GS3A 1B53A 4LFCQ 3HOVB 2MHVA 3PUVA 1W6JA 1HNZQ 4P75A 2BDOA 3EBEA 5K36G 5LL6X 4HIOA 3PUWA 1WTRA 3FKIB 3TSSA 1BVSA 4L5QA 3I2ZA 1IW7C 1VQDA 2EIFA 1B50A 1RD9D 1HH2P 1Q1EA 4LF6L 4R1JA 3H3VH 4BY7G 3M7GA 5CV8A 3R2TA 4DR1L 3U58A 1TWHB 1Q1BA 5CV5A 3J81L 4DV0Q 3BVGA 3HOVH 3A55A 2JK8A 2F0NA 3CC2A 1AZPA 4DR5Q 4X65Q 4PMCA 1SNCA 3VA5A 1VQ8A 5CORA 3W1GA 1ZXTA 4DUYQ 3FKIH 3AB9A 3BDLA 3LNNA 2A69C 2B8FA 4GNXC 4KV6A 3BU2A 1WCMB 3TEHB 4JI8L 3KJPA 4ALPA 2RSOA 2DN8A 1TWHH 5JEAG 5ELBA 3FHWA 1QZGA 1B7YB 3H09A 4JI1L 1LTRD 1TT2A 2ZTCA 1G8ZD 2FJ2A 3TQYA 2VL6A 1KL9A 2ID0A 4IQZA 5DNFA 5JEAJ 5CBEE 4OWWB 4KY6A 4DV6Q 1F77A 3FPPA 1WCMH 1TWFB 4NXNQ 3KF6B 3EA6A 1Y1WG 1YHQA 2Q2HA 3KLWA 1PH9A 1HJPA 1BR9A 4UP8A 4HAEA 2JA6G 2CH4W 2K5NA 2XTIA 3GTPB 4X3UA 1QNUA 4GZYC 5EPKA 1K0SA 3RN5A 5FLMG 3E6ZX 1PTOB 4LF8Q 3KDFA 1CFMA 1D5XC 4M1UB 1TWFH 4J8QA 4DNIA 1S5ED 4B9XA 1K73C 4N8X1 3K80C 4EGVA 2B2WA 5FLXc 4QUCA 3ONAB 2K7VA 1X32A 5M3MG 4NPSA 1SJED 1P8LA 1I94Q 2R92G 1STYA 1VMCA 2NZ1D 1T5XD 2NYZD 1SYCA 5JOBA 2UXDQ 1PTOH 1N32Q 4F88A 4P74A 3OWEB 1Q81C 4WFN3 1WI5A 3C1FA 2EJFC 1DZ1A 4NMZA 1UNSA 1X56A 1E7ZA 2IX1A 1X3GA 4DV1Q 2KHIA 2NUCA 4AIMA 5D3IB 4DV3Q 2AMCB 4HR7B 4JCVE 2Z6KA 3GV3A 3DHQA 3VR6A 3PSIA 4FYDA 2PZWA 5J22A 3OTOQ 1IBKL 1QNKA 3SEBA 3DUZA 2F0IA 4LF4Q 1OXXK 4RWSC 1MJEA 1FNWA 3GDEA 3ITPA 1LUZA 2XVSA 3HZXA 2P5ZX 2K5WA 2F0SA 4CJ2C 2PZUA 4UHVA 4YCUA 5IY0A 2EYOA 2H4OA 2KHSA 4OX9Q 5BR8Q 3PUZA 5BN3A 1KLGD 3CQZB 2RBMA 1FJGL 2A6ED 1EY0A 3D4WA 1LT5D 5J39A 5FLXL 1SSOA 1XMOL 4ID6A 1UAPA 1HPCA 3NBIA 1I4XA 3SXHA 4C1NI 2IHEA 3CQZH 3T1YL 5AJ3Q 2E2DC 1BCPC 1CKMA 4H02A 1DONA 3HOVG 2KJXA 1L1OA 1KNEA 1YHBA 4MIUA 4IFDI 2X6GA 4O42A 3RN2A 3JAME 1HHVA 2R7ZH 4C2MH 3FKIG 1M1KC 3MXUA 1KABA 1Y8OB 2NN6H 1ENAA 4DK0A 5IT9E 4B3ML 1OO9B 1ILQA 4PG3A 2MPMA 2N78A 3I4OA 1SYDA 4HN7A 5C0XH 1Y8NB 1TWGB 2X69A 2QCPX 5ELEA 1HNXL 1HNWL 2WB1E 3OWFA 2F0EA 1KAWA 1JORA 1QZHA 1GUWA 1O80A 1STBA 2PCFB 4JI5L 2PW7A 1G6PA 2KBNA 1EIGA 2KEDA 5D3DA 1WCMG 2R93B 1PTOD 4OO1H 1E24A 4NB3A 4WRDA 3RZDB 3BJUA 5I2XA 5EBCA 1N9WA 4JYAL 3G48A 4IUTA 4K5WA 3A7AB 1TWGH 4JI6Q 2RF4A 4C1NK 5IWAQ 5ELCA 4P72A 4DUZQ 1U5KA 1SE4A 5F2DA 2LXJA 5E7NA 4DAYB 2CH4A 2HHHL 1PLFA 1PH8A 4DR4L 3I72A 3T51B 3RZDH 5CC4A 4AYBB 1SRUA 5KEEA 3NPPA 3EVQA 2PQAA 4QUFA 3J7AV 1EQVA 2DJGC 1EY7A 1HQRD 3D0FA 3OYYA 3NWTA 2K75A 1I6HH 1MD2D 2K5DA 2D62A 5K5PA 2CW0D 1EQRA 5ELNA 3C2PA 2AQ1B 3EJIA 3TN2A 1GOZA 2DJFC 1O7IA 3CW2C 1TKWB 3VR3A 2DNEA 4B3TL 1QG7A 4B08A 1UEBA 5T1GA 4ZLTF 2Q8TA 3DWAA 3M3YB 5C5LA 3QR8A 1I4QA 5EAYA 1I3QB 2D0OA 1DOKA 4NP5A 5LMNL 1AFPA 3GTOB 4CDCC 4JI3L 4LUOA 3GP7A 4FF2A 4JV5Q 4DK3C 1YVCA 3M3YH 3ND9A 4LF9Q 2UU9L 4RHSA 2D9UA 2LY7A 5IGFA 5LMUQ 5D65A 5L37A 1J8IA 4EQ5A 2K33A 1N36L 2F0OA 2K32A 2JJQA 1Q90A 4B3SL 5C4XB 1CQFA 4WJWA 1IW7D 4CDDC 2FXQA 3X3NA 4K0KQ 3A0JA 3NSWA 1YEZA 1A6XA 3TS0A 4DV5L 1IBMQ 1PH5A 4HSPA 2BA0A 3CCMA 3K6OA 5M5WB 2X6LA 5C4XH 2FINB 2E2HH 5IT9c 3CCSA 4C3JB 4CJ0B 4X66L 1UE1A 1EEFD 1SMYD 2L11A 4PV1C 2F0WA 4Z9CB 1NTGA 2F0TA 3KF8B 1Q82C 3KYHC 1F9RA 1GHKA 4DR3Q 5EPLA 2R7ZG 3K5NA 2E74C 3TZDA 4RKBA 3L2PA 4YHHL 2NN6G 3KJOA 3IFDA 1II3A 2SEBD 5M5WH 1JE5A 4HMJA 1ASYA 2JA5B 1IBLQ 4C3JH 5COYA 1HR0Q 4Q5VA 1MSHA 2E2JB 2XSCA 5C0XG 4BA2I 2MO0A 4LNQA 2B29A 2OTJA 1UUPA 2F0JA 3PF4A 1A8VA 1Y1VB 2F3IA 3HGBA 1MHWC 1NMFA 3OW7A 4OO1G 4YWLA 2HQEA 1PH1A 2JA5H 5A35A 2N55A 2UUCL 1JOQA 2M9VA 5J3BA 2E2JH 3A54A 1U0LA 1RDPD 2CKZB 1ICFB 4LFAL 1AH9A 1FD7D 3FRPB 3BYYB 1Y1VH 4K8IA 2KCCA 3Q8DA 1E2ZA 1Q12A 4KTAA 5C4HA 1A63A 2RVLA 4A3IB 4U673 3R3OA 1C8CA 3I3CA 4DR7Q 4ULLA 1PMRA 2RCNA 4QL5A 5IT9L 1NY4A 4EQNA 1NMGA 2Z1CA 5FO8B 3LWUA 4IALA 4KMUC 2FFKB 2ICEC 1Q8IA 3J80i 1LYLA 5C4JB 2N8NA 1VQLA 4G7HC 1IKLA 4K6LA 1H9SB 4A3IH 4CDFC 5ISRA 1VF7A 2HIVA 2UXCQ 2WKCA 4AYBG 1SROA 3PUYA 2HD3A 4A3DB 4BXXH 3OMGA 5GROA 1Q7YC 1CKNA 2PW5A 2YYZA 1L0XB 1LT3D 4PQXA 2A6EC 2QW7A 3G7LA 1GM5A 2NVQB 4GKKQ 3CCJA 1WTOA 1XPRA 4AQYQ 2I07B 5C4JH 3G71A 2OQ0A 4XQJA 1E1OA 3ULPA 1CA5A 3Q0AA 1PH6A 2D0PA 1CKOA 2NZHA 1EYDA 2Q2TA 4X62L 1RKNA 4A3DH 2YTVA 2IWHA 3S2DB 1J6QA 2RDFA 4OHJA 5FKAC 2NVQH 2RSNA 4POGA 4IUPA 1RF2D 1I4PA 1Z9FA 4ZKCB 4JC0A 4ZYSA 2XRSD 1Y69U 1TR5A 3KDFB 3I7FA 1WD1A 1N34Q 4J1MA 3PCOB 4JI7L 2IT1A 3S2DH 1JR0D 1DXMA 4L5SA 4HJAA 4KD4A 3NBHA 4KHZA 2AKWB 2GA4B 1K83B 1ICWA 4KN4C 1FVIA 4KHPQ 2EJMA 4A93B 4EVOA 1JE4A 3DWQA 2DY8A 2WB1B 3CHBD 2YV5A 3K7AB 1EOTA 3R8BA 3T53B 5C4XG 4YCWA 3MXNA 5KRUA 1KRSA 1PH4A 1PTOC 2VUMB 2NVTB 1HR0W 1K83H 4IURA 3EIVA 4APVA 4LUZA 3HEJA 4TVAB 2SNSA 4LFBQ 3QOLA 3A5ZB 4A93H 1A62A 1LTTD 2J4XA 5M3MH 3DEOA 3FEWX 2B2YC 3CRLC 3K7AH 2F3WA 4C3JG 2IW3A 1YBYA 1D1IA 2QGQA 1UE6A 2UUBQ 4IOAA 1VQOA 4JG2A 1BBWA 2JA8B 5CR3A 2B2VC 3U4ZA 3FDTA 3ER0A 4XDXA 3FP9A 3K58A 1EUJA 1N33L 3CXCA 2CW0C 5JVG3 2JA5G 3TP8A 1A3VA 1SYGA 2Q8IB 1BDOA 2F0QA 4FXGC 2ZXOA 2L9HA 2NB0A 2UUAQ 2NTTA 1VCIA 2A5HA 4L5RC 2JA8H 5JJZA 3SK4A 1QJOA 1Y1VG 3GTGB 1TWAH 4A3CG 3TBIB 1Z7TA 2C9OA 1XXGA 1STHA 4A3MB 2K01A 1TY0A 5I6YA 4X64L 3AU7A 1NSNS 2VQFL 4IPCA 1FNUA 1LM0A 4H44C 1W2BA 4LF6Q 1SXTA 2K5QA 3I73A 4DR1Q 1HA6A 1Z47A 2K4KA 4A3IG 3VYRA 1FL0A 3G6EA 1HUNA 1IL8A 3CKIB 1H9RA 4BXXG 2L5TA 3HRZC 1W3SA 4X3SA 4XQQA 3N6RA 1EQTA 2JE6I 3DWPA 1MGSA 1HZAA 1EY8A 4G4KA 1KTKA 1RODA 1KIXA 4JI8Q 4RGMA 4ZK9B 2IHFA 3WWVA 2RA4A 4CKEA 3R2IA 1KXLA 1PRTB 5IIFA 2LXKA 4NXML 4A3DG 4K2KA 2EYFA 1I4RA 4RMFA 2KHJA 3A7LA 1VQFA 3UDFA 5CV4A 2XNAC 1SMYC 4I7ZC 4RHRA 1C4QA 1IXRA 2VXWA 2CCZA 2JA9A 3A56A 4DAVA 3I8ZA 3S17B 4DR2L 3MFYA 4PZ6A 3CCUA 3CCVA 4RGOS 1TU2B 4QGUA 4OEMB 2K28A 2EY1A 5I6WA 1JJGA 1WTPA 5M5XB 1DOLA 4OWXB 4F7XA 5EKLA 2IY5B 3T56B 2B39A 1LTLA 1AW7A 3SR1A 3U9SA 4HIMA 3S17H 3S15B 4H13C 4DUYL 3K0XA 4JOIA 4QB4A 4CGYB 3AFQA 5M5XH 2V4DA 1V1OA 3RMHA 4KD3A 2A6HC 1VQNA 1U4PA 4A93G 5G3LD 1E22A 4DNRB 3S15H 2IX0A 2WB1G 1XNQL 3GTPH 1IHZA 1XMQQ 5EQ0A 1V1PA 2F1MA 2UXBL 1BQQT 1BCPF 1CTMA 3BVZA 5CGKA 1YNJD 2I5HA 1VQAA 3PO3B 1IBKQ 3I55A 2E5LQ 3KFUA 1E2WA 4XQNA 3NTKA 2O2LD 2F0PA 1WYDA 2V1CC 1AE2A 5FO7B 2XIWA 3RNUA 1QOHA 1EYCA 1VQEA 1STEA 1PYBA 2LS01 1EY5A 1WFQA 2KA7A 2OT2A 3CC4A 1BF4A 2E8GA 2JSOA 3PO3H 1LABA 1I4HA 2B8GA 2JA8G 1OXSC 1HA5A 1T9HA 1W6KA 4FF1A 2NVXB 1AP0A 3NWSA 2KQ3A 1C7YA 4RH6A 2JQOA 3HOXB 4IO9A 3OW2A 2O4XA 1XMOQ 4JI2L 2UXDL 4N9TA 1NNXA 2MGSA 2PYKA 1EY4A 2F0MA 3NTIA 4CKCA 1KDBA 1P16A 1YJNA 4R4IA 3NK9A 4DGZA 1K8OA 3T1YQ 2NVXH 2CQOA 4X3TA 1OXUA 3HOXH 4B3RL 3S1RB 4DV1L 5T1IA 1YNXA 4ZRZA 4CJ1B 4OIKA 4A3MG 1C48A 3D6CA 4DV7L 1NR4A 1PRTD 1WOCA 3HFZB 3SK5A 3W1BA 4HJ8A 3FPUB 3F2UA 1SNDA
chains in the Genus database with same CATH topology
4B3MQ 3L7ZC 4LF4L 4GLAC 4GKKL 4DKAC 3ERSX 3ICEA 2FXQA 4YCVA 4A3BG 2I5LX 4AQYL 1IYJB 2VZAA 3H0GG 1NJIC 4LFCL 1K8AC 4JI0Q 4K0KQ 3A0JA 3D31A 1XNRL 2QA4A 1A0IA 1HNZL 1YEZA 1QUQB 1PH7A 3U50C 2KCMA 3TS0A 1HNWQ 3BZCA 1S3OA 4QQBX 2VNUD 4DV5L 1IBMQ 3CMEA 2MFIA 1PH5A 4BA1I 2BH2A 4UP9A 1OXTA 2BA0A 3F2DA 3CCMA 3HOUG 3PIOA 2PQAB 5C4XH 3STBC 2E2HH 1SLJA 5IT9c 1UE5A 3CCSA 5IP9G 3GTJH 3SGIA 1JT8A 1SMXA 4X66L 1UE1A 4HIDA 3PV0A 1Y14B 4A3KH 3K8AA 1YJ9A 3GTLH 4DV0L 5C3EG 2A1AA 3HKZE 4JYAQ 1NTGA 3KF8B 3ZJYC 4HJ7A 4DR5L 1Q82C 3KYHC 5H1SE 4X65L 1VQMA 2OTLA 1Y1WH 4DR3Q 2RHSB 3ULJA 5IE8A 1DGSA 2R7ZG 2B3GA 2HQLA 1PH2A 3J81i 1JB7A 3L2PA 1XNQQ 4X6AH 2JA6H 4YHHL 2NN6G 4IOCA 4LF5L 1XPUA 3AFPA 5IYBH 4FDBA 2A19A 5M5WH 3KJOA 2K5HA 1VQ9A 1JE5A 2F52A 5AJ3L 1ASYA 3CMAA 2UXBQ 1IBLQ 4C3JH 3VDYA 3AEVA 3UDIA 1HR0Q 5FLMH 1CSQA 5C0XG 4BA2I 4WJ4A 2MO0A 4LNQA 2B29A 4Y7NH 3CF5A 3T1HQ 2F4VL 4AH6A 2OTJA 3HKZG 2ZTDA 4UPAA 3CC7A 4DV2L 3J7A5 3PF4A 4KHPL 1C0AA 1A8VA 4XTCS 1XJVA 4GKJL 4O2DA 1VQJA 4LF7Q 5M5YH 2F3IA 1PH3A 4DR6Q 2JEBI 2YTYA 4OWTB 1QUQA 4P73A 1PHJA 2VUMG 1NMFA 4OO1G 4YWLA 2VS1A 1PH1A 4DV6L 2JA5H 2R93H 4R4QA 1KD1C 3M85A 2UUCL 2R92H 1PVOA 5GADC 5J3BA 4NXNL 2E2JH 3K81C 2BH8A 1U0LA 4BBSG 4IPDA 2CKZB 2ZJPA 4B3TQ 2LSSA 4LFAL 3PO2H 1AH9A 3J81c 4A3GG 4IJHA 1KHIA 4MNOA 3HOWH 3HOYG 4PZ8A 1GVPA 3W5OA 1Y1VH 5FJ8H 1M90C 3Q8DA 1Q12A 3PF5A 3RLOA 5IYDG 1A63A 3LGJA 4AYBE 5JJIA 2ASBA 4JI2Q 2VQEL 4LF8L 4DR7Q 4JBMA 4JI3Q 3HKSA 3PUXA 4RG1A 1I5FA 2RCNA 4QL5A 3M4PA 2K14A 4L5TA 4YY3Q 1Q46A 1I50H 1NY4A 1V43A 2YTXA 1PFSA 3PO2G 1YI2A 1WJJA 1VQPA 5IWAL 2ZJQA 4GLVB 1SR3A 1NMGA 1D8LA 3UDGA 3CCLA 1FJGQ 2VY3A 4A3FG 3MEFA 3J80i 4B3RQ 3E9IA 1LYLA 1XTDA 1VQHA 2L15A 2N8NA 1VQLA 1XMQL 2EXDA 5GAHC 2OCEA 1SFOH 1J5EQ 3CPWA 1X6OA 2GN5A 2NVYH 4DV7Q 4A3IH 1XPOA 1I94L 3UDXA 2GVBA 4KI0A 2KCTA 4C3HH 2XGTA 1N32L 1YHAA 2HIVA 2UXCQ 3PO3G 4NXMQ 1QVFA 3EN2A 1EWIA 4AYBG 1SROA 3PUYA 2H5XA 1AE3A 1X3EA 4BXXH 4GLXA 2K50A 1Q7YC 5GROA 4GOPC 1CKNA 2E5LL 2YYZA 4B3SQ 2EQSA 1GM5A 2RHQB 3A74A 3F2CA 5GAGC 3CCJA 4GKKQ 1XPRA 4DV4Q 3G4SA 1HZ9A 4AQYQ 4GS3A 4LFCQ 3NELA 4IPGA 4LW1A 5C4JH 3G71A 2OQ0A 4DV3L 3PUVA 4A3JG 1I3QH 1HNZQ 4P75A 2K52A 1X65A 1E1OA 3EBEA 1HZBA 5K36G 3ULPA 4QJFA 1EYGA 1PH6A 2D0PA 3GD7A 3E9HA 3GTOH 1CKOA 2NZHA 4R4CA 3PUWA 4HIOA 3OTOL 2Q2TA 1X54A 4X62L 1YIJA 4A76A 4A3DH 2YTVA 1K9MC 3L0OA 1BVSA 4L5QA 3I2ZA 2EIFA 1VQDA 3J80c 3HOXG 1J6QA 1HH2P 1Q1EA 4LF6L 4R1JA 4GOPB 3CD6A 2NVQH 1VQKA 3H3VI 3H3VH 4BY7G 4X66Q 4POGA 3S1RH 4DR1L 3U58A 1Q1BA 4DV0Q 1EIFA 3HOVH 1Z9FA 4J15A 2JK8A 4JC0A 2WP8J 3CC2A 4DR5Q 1HNXQ 4X65Q 3GTKH 2B63H 5DLQE 3CP0A 1VQ8A 5ELOA 4OX9L 3JAMc 3KDFB 1EFWA 3UE0A 3I7FA 1N34Q 5BR8L 3I4NH 4JI5Q 3W1GA 3PCOB 1TXYA 4YHHQ 4DUYQ 2IT1A 4JI7L 4LF5Q 3FKIH 3S2DH 2MQHA 4BY1H 1VQ6A 4L5SA 4GNXC 4HJAA 2CFMA 3M9BA 3BU2A 4JV5L 4KHZA 2AKWB 4A3EH 3TEHB 4JI8L 4R4TA 3KJPA 4ALPA 4HJ5A 1TWHH 5JEAG 3BZKA 4EX5A 2JA7H 4MZ9A 3FHWA 1FVIA 4IFDG 1QZGA 1S72A 3I4MH 3TREA 1X3FA 4DV2Q 4HIKA 4KHPQ 1B7YB 3CCQA 4JI1L 5JJKA 2ZTCA 3TQYA 2VL6A 2YV5A 1KC8C 5C4XG 1KL9A 4A3LH 2ID0A 4YCWA 5JEAJ 2NN6I 1KRSA 3J81j 1PH4A 4OWWB 3STBD 4DV6Q 2HHHQ 4IFDJ 1MIUA 1HZCA 1WCMH 2MO1A 4A3KG 2UUCQ 4GNXB 4DR4Q 4K0KL 1HR0W 1K83H 4NXNQ 4XIGS 3KF6B 2GVAA 3EIVA 4APVA 4HJ9A 1Y1WG 1PA6A 3HOZH 4LUZA 3NEMA 4LFAQ 3IRBA 1YHQA 4TVAB 2Q2HA 4JI4L 4GOPA 3KLWA 1PH9A 1HJPA 4LFBQ 4UP8A 5IYCH 2JA6G 3A5ZB 4A93H 1A62A 5IYBG 2K5NA 2XTIA 5M3MH 4A75A 2HT1A 2JEAI 1CSPA 3K7AH 5C0XJ 1CKNB 1JMCA 3GO5A 3RN5A 5FLMG 4OO1I 1YBYA 2QGQA 4LF8Q 3KDFA 1K73C 1UE6A 4QY7A 1TWFH 1VQBA 4DNIA 2UUBQ 3S14H 4IOAA 1VQOA 4JG2A 3K80C 1OXVA 1PV4A 5HY6A 1BBWA 3K7UC 4TQUS 1NE3A 2CWAA 5FLXc 3GTMH 2HIXA 5IYCG 2BA1A 3U4ZA 3U4VA 3ER0A 2CWPA 3NENA 3FP9A 4P71A 5M3MG 4NPSA 1OTCA 1EUJA 3PGZA 3RR5A 3CXCA 1N33L 3S1QH 5C44H 4A3CH 2JA5G 2R93G 1X9NA 1P8LA 1I94Q 2R92G 2OQKA 3E0EA 4PMWA 2UXDQ 1BBUA 5LMNQ 1N32Q 3CAMA 4P74A 5LMNW 1Q81C 2UUAQ 1WI5A 1VCIA 4R4OA 4JI6L 3HOWG 4UP7A 4L5RC 2ZM6Q 1QVGA 2JA8H 1NBWA 5IP7H 1MJCA 1X56A 3KOJA 1Y1VG 5FJ8G 4DUZL 1TWAH 4GNXA 1E7ZA 3JC66 4LF7L 2IX1A 3J7ZC 1E3PA 1X3GA 4DV1Q 4A3CG 3KF6A 2KHIA 1N8RC 4AIMA 2UU9Q 4DV3Q 2AMCB 1JJCB 4LUVA 3TRZA 1SN8A 4JCVE 2E2IH 2Z6KA 3NBHB 4X64L 3PSIA 2VQFL 3I56A 1IBKL 1G51A 2R7FA 3OTOQ 4IPCA 4X62Q 1N36Q 1ASZA 4BBRH 3S2HH 1LM0A 5M3FH 2AWOA 1W2BA 1EQQA 2Z0SA 4LF4Q 4GN5A 1OXXK 4LF6Q 1MJEA 4JOIC 4DR1Q 3GDEA 1XNRQ 1Z47A 2K4KA 4A3IG 2K5VA 2AWNA 3MXNB 2OWOA 2N3SA 2DUDA 1LUZA 1EOVA 3A5UA 2R6GA 4DV5Q 1FL0A 3G6EA 1YITA 4JBJA 4YCUA 5IY0A 4OX9Q 4BXXG 3CCRA 1W3SA 4WJ3M 5BR8Q 4BBRG 4YY3L 3PUZA 4JI7Q 2JE6I 1HZAA 1FJGL 2WFWA 1VS0A 1KIXA 4JI8Q 4ME3A 4A3BH 3H0GH 1Q86C 1V1QA 1CUKA 4POFA 1XMOL 2IHFA 3WWVA 1S40A 1KXLA 2UXCL 1VQ7A 1IZ6A 2LXKA 4NXML 4A3DG 2IHEA 2ALYB 5GAEC 3HOUH 4KLKA 4GN4B 3CQZH 2PMZE 4RMFA 5AJ3Q 1TWCH 2KHJA 3T1YL 2VW9A 1RL2A 2A8VA 1VQFA 3UDFA 1GO3E 5IP9H 1CKMA 4H02A 4DV4L 2AHOB 3HOVG 4LF9L 2PI2A 1L1OA 1IXRA 1YHBA 2Z6KC 2B63G 5C3EH 2F4VQ 2CCZA 5LMUL 2JA9A 4A4IA 4JI4Q 4IFDI 3RN2A 1VQ4A 3I4NG 3S1MH 4DR2L 1JJ2A 2R7ZH 4PZ6A 4C2MH 4GKJQ 3CCUA 3FKIG 4BY1G 2QEXA 3CCVA 4QGUA 1M1KC 4B3ML 1JJGA 4A3EG 4UY8C 4OWXB 3RLFA 1RIPA 4PG3A 4JI0L 2JA7G 2N78A 2IY5B 3F2BA 3AQQA 2DGYA 3B6YA 1BKBA 3I4OA 1LTLA 5C0XI 3H15A 3I4MG 1HNWL 1HNXL 1C9OA 2WB1E 3CPFA 3M7NA 4HIMA 4GN3B 1KAWA 1IBML 4JBWA 3S17H 1VQGA 1QZHA 2KENA 1K0RA 4JBKA 4Y52H 1K8GA 1N34L 4A3LG 4JI5L 1N33Q 4DUYL 1G6PA 2KBNA 4PZ7A 3K0XA 4JOIA 3DM3A 3AFQA 1WCMG 4QIWE 5M5XH 1SE8A 1R9TH 1KRTA 1E24A 2NVTH 4NB3A 2VUMH 2VQEQ 3BJUA 1N9WA 4OONA 1GKHA 3HOZG 4JYAL 3G48A 1MKHA 3CCEA 1TWGH 4BBSH 4DR3L 4JI6Q 2RF4A 5IWAQ 3F1ZA 1VQNA 4LWCA 1VQIA 4A93G 1GD7A 1E22A 4P72A 2Q2UA 4DUZQ 4A3GH 1U5KA 3HOYH 2IX0A 2WB1G 3S15H 1UE7A 1XNQL 3GTPH 1K3RA 1XMQQ 1IL2A 2ATWA 3S16H 2LXJA 5E7NA 4DAYB 1IBLL 2UXBL 1B70B 5IYDH 2HHHL 1HR0L 1PH8A 4DR4L 1L1OC 1QVCA 4X64Q 5JJLA 3S24A 3S1NH 2I5HA 2VQFQ 1VQAA 3RZDH 1IBKQ 4YWMA 1EIYB 3I55A 1SRUA 3T1HL 2E5LQ 3KFUA 2PQAA 1L2FA 4DPGA 1FGUA 2WAQE 4OXPA 4LFBL 1PYSB 1WYDA 2V1CC 1AE2A 3D0FA 1B8AA 3OYYA 5C44G 1KQSA 2K75A 4A3FH 1I6HH 4DR6L 3RNUA 1E1TA 1VQ5A 1VQEA 2ZJRA 2D62A 2ZTEA 3F8TA 2MNAA 1EQRA 5ELNA 1PYBA 2ES2A 1WFQA 4MTNA 5HGQA 1H95A 4DAMA 2N49A 2UUBL 3CC4A 1O7IA 3CW2C 2C35B 1L1OB 2E8GA 5GQOA 3PO3H 1Q8KA 2JA8G 5IP7G 2I0QA 4B3TL 3PIPA 1OXSC 2R7DA 1T9HA 1YZ6A 1X55A 1C7YA 2JQOA 1UEBA 3GTGH 2Y0SE 1YJWA 2WAQG 3DLLA 1D7QA 4IO9A 5EAYA 3OW2A 2D0OA 4IJLA 3ULLA 2PI2E 4YWKA 4A3JH 4A3MH 4C3IH 1XMOQ 4JI2L 4DR7L 2UXDL 5LMNL 4JI3L 4LUOA 1YJNA 1P16A 2UUAL 5M3FG 1L0WA 4DK6C 4R4IA 3UE1A 3JAMi 3M4OH 2ZM6L 1UWVA 3T1YQ 2NVXH 2CQOA 4O0AA 3TS2A 1OXUA 2NZOA 3HOXH 4JV5Q 4DK3C 4B3RL 2Q2IA 3RLNA 4DV1L 4BY7H 1YVCA 3M3YH 4LF9Q 1YNXA 2UU9L 1J5EL 2Y0SG 4A3MG 4DV7L 3AYHB 2I5MX 3RZOH 5LMUQ 1G291 3M4QA 1V9PA 1WOCA 4JI1Q 1VQCA 4EQ5A 2PNHA 4DR2Q 3HFZB 2YU9H 4IPHA 3W1BA 4HJ8A 1N36L 3GTQH 2JJQA 4B3SL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M Q;  3L7Z C;  4LF4 L;  4GLA C;  4GKK L;  4DKA C;  3ERS X;  3ICE A;  2FXQ A;  4YCV A;  4A3B G;  2I5L X;  4AQY L;  1IYJ B;  2VZA A;  3H0G G;  1NJI C;  4LFC L;  1K8A C;  4JI0 Q;  4K0K Q;  3A0J A;  3D31 A;  1XNR L;  2QA4 A;  1A0I A;  1HNZ L;  1YEZ A;  1QUQ B;  1PH7 A;  3U50 C;  2KCM A;  3TS0 A;  1HNW Q;  3BZC A;  1S3O A;  4QQB X;  2VNU D;  4DV5 L;  1IBM Q;  3CME A;  2MFI A;  1PH5 A;  4BA1 I;  2BH2 A;  4UP9 A;  1OXT A;  2BA0 A;  3F2D A;  3CCM A;  3HOU G;  3PIO A;  2PQA B;  5C4X H;  3STB C;  2E2H H;  1SLJ A;  5IT9 c;  1UE5 A;  3CCS A;  5IP9 G;  3GTJ H;  3SGI A;  1JT8 A;  1SMX A;  4X66 L;  1UE1 A;  4HID A;  3PV0 A;  1Y14 B;  4A3K H;  3K8A A;  1YJ9 A;  3GTL H;  4DV0 L;  5C3E G;  2A1A A;  3HKZ E;  4JYA Q;  1NTG A;  3KF8 B;  3ZJY C;  4HJ7 A;  4DR5 L;  1Q82 C;  3KYH C;  5H1S E;  4X65 L;  1VQM A;  2OTL A;  1Y1W H;  4DR3 Q;  2RHS B;  3ULJ A;  5IE8 A;  1DGS A;  2R7Z G;  2B3G A;  2HQL A;  1PH2 A;  3J81 i;  1JB7 A;  3L2P A;  1XNQ Q;  4X6A H;  2JA6 H;  4YHH L;  2NN6 G;  4IOC A;  4LF5 L;  1XPU A;  3AFP A;  5IYB H;  4FDB A;  2A19 A;  5M5W H;  3KJO A;  2K5H A;  1VQ9 A;  1JE5 A;  2F52 A;  5AJ3 L;  1ASY A;  3CMA A;  2UXB Q;  1IBL Q;  4C3J H;  3VDY A;  3AEV A;  3UDI A;  1HR0 Q;  5FLM H;  1CSQ A;  5C0X G;  4BA2 I;  4WJ4 A;  2MO0 A;  4LNQ A;  2B29 A;  4Y7N H;  3CF5 A;  3T1H Q;  2F4V L;  4AH6 A;  2OTJ A;  3HKZ G;  2ZTD A;  4UPA A;  3CC7 A;  4DV2 L;  3J7A 5;  3PF4 A;  4KHP L;  1C0A A;  1A8V A;  4XTC S;  1XJV A;  4GKJ L;  4O2D A;  1VQJ A;  4LF7 Q;  5M5Y H;  2F3I A;  1PH3 A;  4DR6 Q;  2JEB I;  2YTY A;  4OWT B;  1QUQ A;  4P73 A;  1PHJ A;  2VUM G;  1NMF A;  4OO1 G;  4YWL A;  2VS1 A;  1PH1 A;  4DV6 L;  2JA5 H;  2R93 H;  4R4Q A;  1KD1 C;  3M85 A;  2UUC L;  2R92 H;  1PVO A;  5GAD C;  5J3B A;  4NXN L;  2E2J H;  3K81 C;  2BH8 A;  1U0L A;  4BBS G;  4IPD A;  2CKZ B;  2ZJP A;  4B3T Q;  2LSS A;  4LFA L;  3PO2 H;  1AH9 A;  3J81 c;  4A3G G;  4IJH A;  1KHI A;  4MNO A;  3HOW H;  3HOY G;  4PZ8 A;  1GVP A;  3W5O A;  1Y1V H;  5FJ8 H;  1M90 C;  3Q8D A;  1Q12 A;  3PF5 A;  3RLO A;  5IYD G;  1A63 A;  3LGJ A;  4AYB E;  5JJI A;  2ASB A;  4JI2 Q;  2VQE L;  4LF8 L;  4DR7 Q;  4JBM A;  4JI3 Q;  3HKS A;  3PUX A;  4RG1 A;  1I5F A;  2RCN A;  4QL5 A;  3M4P A;  2K14 A;  4L5T A;  4YY3 Q;  1Q46 A;  1I50 H;  1NY4 A;  1V43 A;  2YTX A;  1PFS A;  3PO2 G;  1YI2 A;  1WJJ A;  1VQP A;  5IWA L;  2ZJQ A;  4GLV B;  1SR3 A;  1NMG A;  1D8L A;  3UDG A;  3CCL A;  1FJG Q;  2VY3 A;  4A3F G;  3MEF A;  3J80 i;  4B3R Q;  3E9I A;  1LYL A;  1XTD A;  1VQH A;  2L15 A;  2N8N A;  1VQL A;  1XMQ L;  2EXD A;  5GAH C;  2OCE A;  1SFO H;  1J5E Q;  3CPW A;  1X6O A;  2GN5 A;  2NVY H;  4DV7 Q;  4A3I H;  1XPO A;  1I94 L;  3UDX A;  2GVB A;  4KI0 A;  2KCT A;  4C3H H;  2XGT A;  1N32 L;  1YHA A;  2HIV A;  2UXC Q;  3PO3 G;  4NXM Q;  1QVF A;  3EN2 A;  1EWI A;  4AYB G;  1SRO A;  3PUY A;  2H5X A;  1AE3 A;  1X3E A;  4BXX H;  4GLX A;  2K50 A;  1Q7Y C;  5GRO A;  4GOP C;  1CKN A;  2E5L L;  2YYZ A;  4B3S Q;  2EQS A;  1GM5 A;  2RHQ B;  3A74 A;  3F2C A;  5GAG C;  3CCJ A;  4GKK Q;  1XPR A;  4DV4 Q;  3G4S A;  1HZ9 A;  4AQY Q;  4GS3 A;  4LFC Q;  3NEL A;  4IPG A;  4LW1 A;  5C4J H;  3G71 A;  2OQ0 A;  4DV3 L;  3PUV A;  4A3J G;  1I3Q H;  1HNZ Q;  4P75 A;  2K52 A;  1X65 A;  1E1O A;  3EBE A;  1HZB A;  5K36 G;  3ULP A;  4QJF A;  1EYG A;  1PH6 A;  2D0P A;  3GD7 A;  3E9H A;  3GTO H;  1CKO A;  2NZH A;  4R4C A;  3PUW A;  4HIO A;  3OTO L;  2Q2T A;  1X54 A;  4X62 L;  1YIJ A;  4A76 A;  4A3D H;  2YTV A;  1K9M C;  3L0O A;  1BVS A;  4L5Q A;  3I2Z A;  2EIF A;  1VQD A;  3J80 c;  3HOX G;  1J6Q A;  1HH2 P;  1Q1E A;  4LF6 L;  4R1J A;  4GOP B;  3CD6 A;  2NVQ H;  1VQK A;  3H3V I;  3H3V H;  4BY7 G;  4X66 Q;  4POG A;  3S1R H;  4DR1 L;  3U58 A;  1Q1B A;  4DV0 Q;  1EIF A;  3HOV H;  1Z9F A;  4J15 A;  2JK8 A;  4JC0 A;  2WP8 J;  3CC2 A;  4DR5 Q;  1HNX Q;  4X65 Q;  3GTK H;  2B63 H;  5DLQ E;  3CP0 A;  1VQ8 A;  5ELO A;  4OX9 L;  3JAM c;  3KDF B;  1EFW A;  3UE0 A;  3I7F A;  1N34 Q;  5BR8 L;  3I4N H;  4JI5 Q;  3W1G A;  3PCO B;  1TXY A;  4YHH Q;  4DUY Q;  2IT1 A;  4JI7 L;  4LF5 Q;  3FKI H;  3S2D H;  2MQH A;  4BY1 H;  1VQ6 A;  4L5S A;  4GNX C;  4HJA A;  2CFM A;  3M9B A;  3BU2 A;  4JV5 L;  4KHZ A;  2AKW B;  4A3E H;  3TEH B;  4JI8 L;  4R4T A;  3KJP A;  4ALP A;  4HJ5 A;  1TWH H;  5JEA G;  3BZK A;  4EX5 A;  2JA7 H;  4MZ9 A;  3FHW A;  1FVI A;  4IFD G;  1QZG A;  1S72 A;  3I4M H;  3TRE A;  1X3F A;  4DV2 Q;  4HIK A;  4KHP Q;  1B7Y B;  3CCQ A;  4JI1 L;  5JJK A;  2ZTC A;  3TQY A;  2VL6 A;  2YV5 A;  1KC8 C;  5C4X G;  1KL9 A;  4A3L H;  2ID0 A;  4YCW A;  5JEA J;  2NN6 I;  1KRS A;  3J81 j;  1PH4 A;  4OWW B;  3STB D;  4DV6 Q;  2HHH Q;  4IFD J;  1MIU A;  1HZC A;  1WCM H;  2MO1 A;  4A3K G;  2UUC Q;  4GNX B;  4DR4 Q;  4K0K L;  1HR0 W;  1K83 H;  4NXN Q;  4XIG S;  3KF6 B;  2GVA A;  3EIV A;  4APV A;  4HJ9 A;  1Y1W G;  1PA6 A;  3HOZ H;  4LUZ A;  3NEM A;  4LFA Q;  3IRB A;  1YHQ A;  4TVA B;  2Q2H A;  4JI4 L;  4GOP A;  3KLW A;  1PH9 A;  1HJP A;  4LFB Q;  4UP8 A;  5IYC H;  2JA6 G;  3A5Z B;  4A93 H;  1A62 A;  5IYB G;  2K5N A;  2XTI A;  5M3M H;  4A75 A;  2HT1 A;  2JEA I;  1CSP A;  3K7A H;  5C0X J;  1CKN B;  1JMC A;  3GO5 A;  3RN5 A;  5FLM G;  4OO1 I;  1YBY A;  2QGQ A;  4LF8 Q;  3KDF A;  1K73 C;  1UE6 A;  4QY7 A;  1TWF H;  1VQB A;  4DNI A;  2UUB Q;  3S14 H;  4IOA A;  1VQO A;  4JG2 A;  3K80 C;  1OXV A;  1PV4 A;  5HY6 A;  1BBW A;  3K7U C;  4TQU S;  1NE3 A;  2CWA A;  5FLX c;  3GTM H;  2HIX A;  5IYC G;  2BA1 A;  3U4Z A;  3U4V A;  3ER0 A;  2CWP A;  3NEN A;  3FP9 A;  4P71 A;  5M3M G;  4NPS A;  1OTC A;  1EUJ A;  3PGZ A;  3RR5 A;  3CXC A;  1N33 L;  3S1Q H;  5C44 H;  4A3C H;  2JA5 G;  2R93 G;  1X9N A;  1P8L A;  1I94 Q;  2R92 G;  2OQK A;  3E0E A;  4PMW A;  2UXD Q;  1BBU A;  5LMN Q;  1N32 Q;  3CAM A;  4P74 A;  5LMN W;  1Q81 C;  2UUA Q;  1WI5 A;  1VCI A;  4R4O A;  4JI6 L;  3HOW G;  4UP7 A;  4L5R C;  2ZM6 Q;  1QVG A;  2JA8 H;  1NBW A;  5IP7 H;  1MJC A;  1X56 A;  3KOJ A;  1Y1V G;  5FJ8 G;  4DUZ L;  1TWA H;  4GNX A;  1E7Z A;  3JC6 6;  4LF7 L;  2IX1 A;  3J7Z C;  1E3P A;  1X3G A;  4DV1 Q;  4A3C G;  3KF6 A;  2KHI A;  1N8R C;  4AIM A;  2UU9 Q;  4DV3 Q;  2AMC B;  1JJC B;  4LUV A;  3TRZ A;  1SN8 A;  4JCV E;  2E2I H;  2Z6K A;  3NBH B;  4X64 L;  3PSI A;  2VQF L;  3I56 A;  1IBK L;  1G51 A;  2R7F A;  3OTO Q;  4IPC A;  4X62 Q;  1N36 Q;  1ASZ A;  4BBR H;  3S2H H;  1LM0 A;  5M3F H;  2AWO A;  1W2B A;  1EQQ A;  2Z0S A;  4LF4 Q;  4GN5 A;  1OXX K;  4LF6 Q;  1MJE A;  4JOI C;  4DR1 Q;  3GDE A;  1XNR Q;  1Z47 A;  2K4K A;  4A3I G;  2K5V A;  2AWN A;  3MXN B;  2OWO A;  2N3S A;  2DUD A;  1LUZ A;  1EOV A;  3A5U A;  2R6G A;  4DV5 Q;  1FL0 A;  3G6E A;  1YIT A;  4JBJ A;  4YCU A;  5IY0 A;  4OX9 Q;  4BXX G;  3CCR A;  1W3S A;  4WJ3 M;  5BR8 Q;  4BBR G;  4YY3 L;  3PUZ A;  4JI7 Q;  2JE6 I;  1HZA A;  1FJG L;  2WFW A;  1VS0 A;  1KIX A;  4JI8 Q;  4ME3 A;  4A3B H;  3H0G H;  1Q86 C;  1V1Q A;  1CUK A;  4POF A;  1XMO L;  2IHF A;  3WWV A;  1S40 A;  1KXL A;  2UXC L;  1VQ7 A;  1IZ6 A;  2LXK A;  4NXM L;  4A3D G;  2IHE A;  2ALY B;  5GAE C;  3HOU H;  4KLK A;  4GN4 B;  3CQZ H;  2PMZ E;  4RMF A;  5AJ3 Q;  1TWC H;  2KHJ A;  3T1Y L;  2VW9 A;  1RL2 A;  2A8V A;  1VQF A;  3UDF A;  1GO3 E;  5IP9 H;  1CKM A;  4H02 A;  4DV4 L;  2AHO B;  3HOV G;  4LF9 L;  2PI2 A;  1L1O A;  1IXR A;  1YHB A;  2Z6K C;  2B63 G;  5C3E H;  2F4V Q;  2CCZ A;  5LMU L;  2JA9 A;  4A4I A;  4JI4 Q;  4IFD I;  3RN2 A;  1VQ4 A;  3I4N G;  3S1M H;  4DR2 L;  1JJ2 A;  2R7Z H;  4PZ6 A;  4C2M H;  4GKJ Q;  3CCU A;  3FKI G;  4BY1 G;  2QEX A;  3CCV A;  4QGU A;  1M1K C;  4B3M L;  1JJG A;  4A3E G;  4UY8 C;  4OWX B;  3RLF A;  1RIP A;  4PG3 A;  4JI0 L;  2JA7 G;  2N78 A;  2IY5 B;  3F2B A;  3AQQ A;  2DGY A;  3B6Y A;  1BKB A;  3I4O A;  1LTL A;  5C0X I;  3H15 A;  3I4M G;  1HNW L;  1HNX L;  1C9O A;  2WB1 E;  3CPF A;  3M7N A;  4HIM A;  4GN3 B;  1KAW A;  1IBM L;  4JBW A;  3S17 H;  1VQG A;  1QZH A;  2KEN A;  1K0R A;  4JBK A;  4Y52 H;  1K8G A;  1N34 L;  4A3L G;  4JI5 L;  1N33 Q;  4DUY L;  1G6P A;  2KBN A;  4PZ7 A;  3K0X A;  4JOI A;  3DM3 A;  3AFQ A;  1WCM G;  4QIW E;  5M5X H;  1SE8 A;  1R9T H;  1KRT A;  1E24 A;  2NVT H;  4NB3 A;  2VUM H;  2VQE Q;  3BJU A;  1N9W A;  4OON A;  1GKH A;  3HOZ G;  4JYA L;  3G48 A;  1MKH A;  3CCE A;  1TWG H;  4BBS H;  4DR3 L;  4JI6 Q;  2RF4 A;  5IWA Q;  3F1Z A;  1VQN A;  4LWC A;  1VQI A;  4A93 G;  1GD7 A;  1E22 A;  4P72 A;  2Q2U A;  4DUZ Q;  4A3G H;  1U5K A;  3HOY H;  2IX0 A;  2WB1 G;  3S15 H;  1UE7 A;  1XNQ L;  3GTP H;  1K3R A;  1XMQ Q;  1IL2 A;  2ATW A;  3S16 H;  2LXJ A;  5E7N A;  4DAY B;  1IBL L;  2UXB L;  1B70 B;  5IYD H;  2HHH L;  1HR0 L;  1PH8 A;  4DR4 L;  1L1O C;  1QVC A;  4X64 Q;  5JJL A;  3S24 A;  3S1N H;  2I5H A;  2VQF Q;  1VQA A;  3RZD H;  1IBK Q;  4YWM A;  1EIY B;  3I55 A;  1SRU A;  3T1H L;  2E5L Q;  3KFU A;  2PQA A;  1L2F A;  4DPG A;  1FGU A;  2WAQ E;  4OXP A;  4LFB L;  1PYS B;  1WYD A;  2V1C C;  1AE2 A;  3D0F A;  1B8A A;  3OYY A;  5C44 G;  1KQS A;  2K75 A;  4A3F H;  1I6H H;  4DR6 L;  3RNU A;  1E1T A;  1VQ5 A;  1VQE A;  2ZJR A;  2D62 A;  2ZTE A;  3F8T A;  2MNA A;  1EQR A;  5ELN A;  1PYB A;  2ES2 A;  1WFQ A;  4MTN A;  5HGQ A;  1H95 A;  4DAM A;  2N49 A;  2UUB L;  3CC4 A;  1O7I A;  3CW2 C;  2C35 B;  1L1O B;  2E8G A;  5GQO A;  3PO3 H;  1Q8K A;  2JA8 G;  5IP7 G;  2I0Q A;  4B3T L;  3PIP A;  1OXS C;  2R7D A;  1T9H A;  1YZ6 A;  1X55 A;  1C7Y A;  2JQO A;  1UEB A;  3GTG H;  2Y0S E;  1YJW A;  2WAQ G;  3DLL A;  1D7Q A;  4IO9 A;  5EAY A;  3OW2 A;  2D0O A;  4IJL A;  3ULL A;  2PI2 E;  4YWK A;  4A3J H;  4A3M H;  4C3I H;  1XMO Q;  4JI2 L;  4DR7 L;  2UXD L;  5LMN L;  4JI3 L;  4LUO A;  1YJN A;  1P16 A;  2UUA L;  5M3F G;  1L0W A;  4DK6 C;  4R4I A;  3UE1 A;  3JAM i;  3M4O H;  2ZM6 L;  1UWV A;  3T1Y Q;  2NVX H;  2CQO A;  4O0A A;  3TS2 A;  1OXU A;  2NZO A;  3HOX H;  4JV5 Q;  4DK3 C;  4B3R L;  2Q2I A;  3RLN A;  4DV1 L;  4BY7 H;  1YVC A;  3M3Y H;  4LF9 Q;  1YNX A;  2UU9 L;  1J5E L;  2Y0S G;  4A3M G;  4DV7 L;  3AYH B;  2I5M X;  3RZO H;  5LMU Q;  1G29 1;  3M4Q A;  1V9P A;  1WOC A;  4JI1 Q;  1VQC A;  4EQ5 A;  2PNH A;  4DR2 Q;  3HFZ B;  2YU9 H;  4IPH A;  3W1B A;  4HJ8 A;  1N36 L;  3GTQ H;  2JJQ A;  4B3S L; 
#chains in the Genus database with same CATH topology
 4B3M Q;  4LF4 L;  2L1B A;  4FXK C;  5I9O A;  4YCV A;  2QKI C;  3EFX D;  4A3K B;  3GTL B;  1HFN A;  3D31 A;  2QA4 A;  5DAU A;  3U50 C;  1HNW Q;  4OGQ C;  1S3O A;  4QQB X;  2BCO A;  5CBA E;  2VNU D;  1DOM A;  3SK8 A;  2MFI A;  4BA1 I;  1OXT A;  3KBX A;  3PIO A;  2IPK D;  1X3P A;  2EYL A;  2LMC B;  1HTL D;  1Y14 B;  4A3K H;  3K8A A;  3GTL H;  3E0J A;  1RTN A;  2WKD A;  2B2U A;  1JOK A;  1O7Y A;  1VF5 C;  3HKZ E;  4JYA Q;  4HJ7 A;  4L8J A;  3HOZ B;  1V8Q A;  1A15 A;  1VQM A;  1LTB D;  2G9H D;  1DGS A;  3T4A C;  1HQM C;  3J81 i;  4X6A H;  2F0L A;  4IOC A;  4LF5 L;  1PFB A;  3ND8 A;  2K5H A;  1WTX A;  5AJ3 L;  4P2C B;  3VDY A;  1GHJ A;  1Q3L A;  4QF4 A;  1CSQ A;  2QDL A;  3D6W A;  2PQE A;  2ENB A;  1TS3 A;  3HOW B;  3CC7 A;  4DV2 L;  5JPN C;  4N8F A;  1C0A A;  3KLR A;  3WDN A;  4LF7 Q;  1WD0 A;  3S1Q B;  2L4N A;  4OWT B;  1O7Z A;  1WTV A;  2RQX A;  2R93 H;  2NBF A;  1GJX A;  1NR2 A;  1A2T A;  3K81 C;  2BH8 A;  1I50 B;  3ERO A;  4B3T Q;  2LSS A;  1WVL A;  3HOW H;  4MNO A;  2NTS A;  1E2V A;  1F2Z A;  3KLS A;  1YNN C;  1JQY D;  1SNO A;  5JVH 3;  2EE1 A;  3NXW A;  3LGJ A;  4FP5 D;  5E1F A;  4RFB A;  4JI3 Q;  3HKS A;  1I5F A;  1SYF A;  2F0H A;  4YY3 Q;  2EYH A;  1I50 H;  5E3F A;  1V43 A;  4BBR B;  5ELF A;  1YI2 A;  1WJJ A;  1XX8 A;  1VQP A;  5IWA L;  2ZJQ A;  3UDG A;  1SR3 A;  3IAY A;  3MEF A;  1MI2 A;  2Z6B A;  2OCE A;  3CPW A;  4UAI A;  3O13 A;  3FMC A;  1PFN A;  1PDQ A;  2F4I A;  1D5M C;  3E5S A;  3PO3 G;  1QVF A;  3NTH A;  1EWI A;  1QIL A;  3Q24 A;  1UEA B;  1X3E A;  2EOT A;  4B3S Q;  5GAG C;  5IGD A;  2RDG A;  4DV4 Q;  1A3U A;  1HZ9 A;  3NEL A;  4IPG A;  4LW1 A;  3GTK B;  1I3Q H;  2EVB A;  1X65 A;  5A2Q E;  1HZB A;  4QJF A;  1EYG A;  3GD7 A;  5IOD A;  3GTO H;  4R4C A;  3I4N B;  3BYT B;  4G57 A;  1K9M C;  3C1E A;  2ZT9 C;  3HOX G;  1T5E A;  1ZKO A;  4A3E B;  4FNF A;  1B3Q A;  1VQK A;  1WTQ A;  3KLS X;  4X66 Q;  3D4R A;  4QMG A;  3GTK H;  2WP8 J;  5C3E B;  4NW2 A;  5CYU A;  3VR5 A;  3QB3 A;  3JAM c;  3PQI A;  2JXM B;  3UE0 A;  2B2V A;  3I4N H;  1TXY A;  4YHH Q;  4ZUJ A;  1FYC A;  5BN5 A;  2RDH A;  2MQH A;  1K8M A;  2CFM A;  4JV5 L;  4A3E H;  2BOS A;  4LK1 C;  3SDZ A;  4MZ9 A;  3VA7 A;  3T13 A;  1U4R A;  3TRE A;  1S5D D;  1HXY D;  1X3F A;  1X3Q A;  5EKK A;  4DAP A;  4OEL B;  5JJK A;  1H9K A;  1JIC A;  2HDL A;  2NN6 I;  3J81 j;  4BS9 A;  1HZC A;  2MO1 A;  4JPB W;  4A3K G;  2UUC Q;  4K0K L;  2R61 A;  3SVM A;  3TP5 A;  4XIG S;  3NEM A;  4LFA Q;  3GTM B;  4JI4 L;  1DYQ A;  1VMP A;  4GOP A;  1CHQ D;  4A75 A;  2HT1 A;  5C44 B;  5C0X J;  4LAA A;  1JMC A;  3SHL A;  4OO1 I;  1YNJ C;  3V96 A;  4QY7 A;  2N88 A;  2EXZ A;  3DMU A;  5HY6 A;  2XRQ D;  3CRK C;  4TQU S;  3GTM H;  2HIX A;  5IYC G;  2A6H D;  4K2L A;  2BA1 A;  5KIX A;  2CWP A;  3NEN A;  1QB5 D;  1OTC A;  1CK1 A;  3RR5 A;  5FK9 C;  5C44 H;  4A3C H;  2MJ8 A;  3RUZ A;  2R93 G;  2E2I B;  2OQK A;  3JAM L;  3E0E A;  4PMW A;  1BBU A;  5CV7 A;  5LMN W;  4R4O A;  5M3F B;  4FF3 A;  3HOW G;  2ZM6 Q;  1NBW A;  1B44 D;  3Q23 A;  3KOJ A;  4X3K A;  2D5D A;  1AN8 A;  4GNX A;  1SEB D;  3J7Z C;  3K5L A;  4KY7 A;  2JP1 A;  1JJC B;  4LUV A;  3TRZ A;  1SN8 A;  1PTO F;  2E2I H;  3NE5 B;  4IUN A;  1PZJ D;  1LTG D;  4X62 Q;  2F03 A;  1ASZ A;  3D8G A;  5M3F H;  1R4P B;  2AWO A;  1LO5 D;  2Z0S A;  3K5O A;  4GN5 A;  4ZQ3 A;  1EU4 A;  5C4Z A;  4CHT B;  4A3B B;  3H0G B;  1XNR Q;  3Q6S A;  1ENF A;  2AWN A;  2OWO A;  2N3S A;  2JYO A;  1PRT C;  3NQI A;  3PIP 3;  2TSS A;  4ME5 A;  4WJ3 M;  3SE0 A;  4BBR G;  1U4L A;  1BNZ A;  4JI7 Q;  3HOU B;  3K57 A;  4DAY A;  2IL8 A;  3D4D A;  1QCB D;  1XYI A;  1EFI D;  5KNC A;  1SNP A;  4ME3 A;  4A3B H;  4I65 A;  3H0G H;  1SBB B;  1CT1 D;  4FO2 A;  1JOO A;  2EYJ A;  1F9P A;  4POF A;  1CUK A;  1TII D;  3E3X A;  3KUP A;  3S1M B;  2UXC L;  3HOU H;  4KLK A;  1U9R A;  4GN4 B;  2PMZ E;  2VW9 A;  1RL2 A;  3OIQ A;  1GO3 E;  5IP9 H;  3IKJ A;  5DM6 3;  3OIP A;  1SDF A;  2PI2 A;  3URY A;  2F4V Q;  1JC7 A;  1STN A;  3HKZ B;  1VQ4 A;  4K5X A;  3I4N G;  3S1M H;  1JJ2 A;  4GKJ Q;  2QEX A;  1CA6 A;  4A3E G;  1R4Q B;  3RLF A;  1RIP A;  4JI0 L;  3F2B A;  3AQQ A;  2E76 C;  1C9O A;  3CPF A;  1B9N A;  3FVQ A;  4JBW A;  2KEN A;  4R9W A;  1ML0 D;  4Y52 H;  5M5Y B;  1N34 L;  1N33 Q;  1LTS D;  4PZ7 A;  5A2Q L;  2MP1 A;  3S16 B;  4QIW E;  2VUM H;  1SE8 A;  2NVT H;  2VQE Q;  1CI3 M;  2CVR A;  1GKH A;  4EQO A;  1MKH A;  3CCE A;  1WTW A;  3PO2 B;  2JN4 A;  1NUC A;  3F1Z A;  4LWC A;  1VQI A;  5BN4 A;  3NP8 A;  1GD7 A;  2Q2U A;  2KEC A;  2KCN A;  1UE7 A;  4IZ8 A;  3MTS A;  2EY2 A;  4F8M A;  1IL2 A;  3D3R A;  1QE6 A;  3S16 H;  5KND A;  3GQB A;  5IYD H;  1RJT A;  3BVM A;  1JWS D;  4X64 Q;  3S24 A;  1TS4 A;  2VQF Q;  2WV6 D;  1DD2 A;  1LT6 D;  4YWM A;  1HRJ A;  3T1H L;  1BOS A;  1L2F A;  4DPG A;  2WAQ E;  4OXP A;  4LFB L;  1PYS B;  3VYU A;  2AUJ D;  5I2Y A;  5C44 G;  4HSV A;  4DR6 L;  1YNN D;  2DNC A;  1VQ5 A;  1SFO B;  2ZJR A;  1G91 A;  3NUC A;  4EQP A;  4A3J B;  4C3I B;  2KEE A;  2ES2 A;  4L6T B;  1XWE A;  4TSS A;  5HGQ A;  1H95 A;  2UUB L;  3BDO A;  3Q22 A;  2C35 B;  1L1O B;  1Q8K A;  1D1K A;  3M4O B;  2R7D A;  5JPM C;  1YZ6 A;  1LV9 A;  4ABN A;  3C46 A;  3GTG H;  2Y0S E;  1YJW A;  4IUU A;  2SDF A;  3ZYY X;  5C3X A;  3ULL A;  2PI2 E;  4A3J H;  3QO2 A;  4ZUI A;  3MA2 B;  4C3I H;  4A3M H;  1DM0 B;  1LLR D;  3WOE A;  1I4G A;  4N9P A;  2UUA L;  3K5M A;  5M3F G;  3QWN A;  4HED A;  1L0W A;  4MTK A;  5AFW A;  3GV6 A;  4DK6 C;  5C3W A;  3UE1 A;  3JAM i;  3HG9 A;  3M4O H;  1HUM A;  5DEH A;  1UWV A;  3VR4 A;  1SYB A;  4O0A A;  3TS2 A;  2K05 A;  2Q8R E;  3QG1 A;  2Q2I A;  2G5D A;  2SNM A;  2Z4I A;  4OIJ A;  4CDE C;  1J5E L;  3MAQ A;  4K14 A;  1MBY A;  1ZEQ X;  1B4O A;  4JI1 Q;  4DR2 Q;  2A74 C;  3MZ5 A;  3J80 E;  1I6V C;  1G6Z A;  3L7Z C;  4K6D A;  4DKA C;  3ERS X;  3QIA A;  4A3B G;  2I5L X;  1NJI C;  1IYJ B;  2VZA A;  3H0G G;  3BDC A;  4LFC L;  1K8A C;  1KNA A;  4JW0 A;  4QCL A;  1ET6 A;  1A0I A;  1HNZ L;  2B2T C;  1EY6 A;  2KCM A;  1BO0 A;  3BZC A;  5EKI A;  1TVX A;  4IFD H;  1FNV A;  1L0Y B;  4FXD A;  4UP9 A;  4RCO A;  3HOU G;  2PQA B;  3TDQ A;  1ENC A;  2HCC A;  1H9S A;  1S5F D;  1BBX C;  1JCK B;  5IP9 G;  1U4M A;  1JT8 A;  1SMX A;  1HFG A;  2J7Z A;  4HID A;  3PV0 A;  3P75 A;  1YJ9 A;  4DV0 L;  1G2S A;  2A1A A;  3OSO A;  3VYS A;  5FOB B;  3ZJY C;  3MFG A;  4DR5 L;  5H1S E;  4X65 L;  4XXE A;  5IGC A;  3ULJ A;  2B3G A;  2HQL A;  4KHV A;  2I46 A;  1XNQ Q;  3AFP A;  5IYB H;  4FDB A;  4C56 C;  1VQ9 A;  4MN3 A;  2F52 A;  5D14 A;  3CMA A;  2UXB Q;  4B9W A;  2K1B A;  4KY5 A;  2A68 D;  3K59 A;  4CBV A;  4Q0F A;  3H94 A;  3TP7 A;  4AH6 A;  3HKZ G;  2ZTD A;  1TS5 A;  4G7O C;  1XJV A;  2JEB I;  1QUQ A;  4P73 A;  2VUM G;  4KK7 A;  4DV6 L;  5HUR A;  2ICI A;  4XT3 B;  1PVO A;  3TZU A;  5GAD C;  4NXN L;  1NCV A;  4ZKB B;  2F0K A;  5IOC A;  4IPD A;  4HTH A;  2ZJP A;  1KHI A;  3M4Y A;  4PZ8 A;  4DXF A;  1ILP A;  2C5C A;  1B1Z A;  3W5O A;  5FJ8 H;  4K5V A;  1M90 C;  5IYD G;  4C3H B;  4JI2 Q;  4LF8 L;  2PO4 A;  4JBM A;  4DA2 A;  4RG1 A;  1JWU D;  2ZXP A;  3PO2 G;  4S3S A;  3I90 A;  2O5J C;  1NAP A;  3VYT A;  4GLV B;  1FJG Q;  1D8L A;  2LFN A;  4FF4 A;  3P7J A;  1Y8P B;  4ZAI A;  4U68 A;  4DU9 A;  2MUY A;  5IGG A;  1XTD A;  4B3R Q;  1XMQ L;  4H7B A;  5HGT A;  1GUO A;  2AQ3 B;  1ET9 A;  2GN5 A;  5IGE A;  4DV7 Q;  1I94 L;  2FMM A;  2GVB A;  5CV9 A;  4E6I A;  2KCT A;  4O1N A;  4C3H H;  1N32 L;  4XT1 B;  2CHB D;  2H5X A;  1AE3 A;  4GLX A;  2KVM A;  2E5L L;  1ZYR D;  2HDM A;  2RKS A;  3A74 A;  3F2C A;  3OPO A;  2PNR C;  1KDA A;  1HTP A;  4DV3 L;  4A3J G;  1RHP A;  4C3I G;  1O7L A;  2K52 A;  3P1H A;  2B63 B;  5NUC A;  2IX3 A;  1FR3 A;  1KDC A;  5IGB A;  1D6E C;  2E75 C;  3E9H A;  5J1Z A;  3OTO L;  4G7Z C;  1X54 A;  1YIJ A;  4A76 A;  3MEH A;  3L0O A;  4BY1 B;  2ZXR A;  1PZK D;  3J80 c;  4RKL A;  5C5M A;  4GOP B;  3CD6 A;  1GUG A;  3H3V I;  1EWC A;  3S1R H;  2FMC A;  2PMZ B;  3X3M A;  2JA7 B;  1EIF A;  1XTC D;  4J15 A;  3H91 A;  2EDG A;  1HNX Q;  2B63 H;  3I4M B;  1JWM D;  5DLQ E;  2FHT A;  3CP0 A;  1LAC A;  5ELO A;  4OX9 L;  2R7Z B;  2NWG A;  2EYP A;  4C2M B;  1EFW A;  5BR8 L;  3V05 A;  4JI5 Q;  5C6A A;  4LF5 Q;  2DY7 A;  4BY1 H;  1EU3 A;  1VQ6 A;  1ESR A;  3KK7 A;  3M9B A;  4R4T A;  1GUN A;  4HJ5 A;  1CQV A;  2JA7 H;  3BZK A;  4EX5 A;  2K6A A;  2AQ2 B;  4IFD G;  1S72 A;  3N52 A;  3I4M H;  4DV2 Q;  4HIK A;  3CCQ A;  1KLU D;  2IJ0 A;  2J0T D;  4OL7 A;  4IN3 A;  1FGB D;  2LKV A;  1KC8 C;  4A3L H;  1PFM A;  3STB D;  2HHH Q;  4IFD J;  1MIU A;  4DR4 Q;  4GNX B;  4TKO B;  3S14 B;  1M8A A;  2GVA A;  4QIW B;  4HJ9 A;  1F2Y A;  1PA6 A;  3HOZ H;  3PIO 3;  1TY2 A;  3IRB A;  5IYC H;  3ERQ A;  4H0L C;  1KAA A;  4I7A A;  3IL8 A;  5IYB G;  3MXG A;  1CSP A;  1M4V A;  2JEA I;  3DEP A;  2O5I C;  1CKN B;  1F9S A;  4ZCK A;  1VDZ A;  3GO5 A;  1AZQ A;  1TQO A;  3J7A F;  1CHP D;  3VR2 A;  1VQB A;  5DM7 3;  3S14 H;  3J80 L;  4L63 B;  1OXV A;  1PV4 A;  2Z8L A;  4BWG B;  3K7U C;  1NE3 A;  2CWA A;  5I9P A;  4KJO A;  3U4V A;  4P71 A;  3PGZ A;  1I6H B;  2KUM A;  3S1Q H;  2WAQ B;  3G6J B;  2BDN A;  3OOC A;  3DXJ C;  1X9N A;  1K28 A;  5LMN Q;  3CAM A;  3WOF A;  3MC0 B;  3S2H B;  2D2C C;  4JI6 L;  4UP7 A;  3W3A A;  1QVG A;  5IP7 H;  3A8I E;  1MJC A;  4KKS A;  2L0C A;  1STA A;  5FJ8 G;  4DUZ L;  5FO9 B;  3JC6 6;  4LF7 L;  1E3P A;  1G2T A;  3KF6 A;  1N8R C;  4DNT B;  2UU9 Q;  2Y0S B;  1QWY A;  3NBH B;  4NDX A;  5LHY 1;  3T16 A;  3I56 A;  1G51 A;  2R7F A;  3SK6 A;  1N36 Q;  4BBR H;  3S2H H;  1EQQ A;  4XYO A;  5G3L F;  4V0B A;  4ILW A;  1D5Z C;  4HMI A;  4JK1 C;  4JOI C;  1CZG A;  1BUV T;  3H6M A;  4JVZ A;  2K5V A;  3MXN B;  1LTA D;  5EJW A;  4UDU C;  3UI2 A;  2DUD A;  2XWJ B;  1EOV A;  4C3H G;  2OEO A;  2BE5 D;  2R6G A;  3A5U A;  4DV5 Q;  1YIT A;  2VB3 X;  4JBJ A;  1AEX A;  2B2W C;  3CCR A;  2EZV A;  4YY3 L;  3QJY A;  4LJZ C;  2WAC A;  1TWC B;  2B2Y A;  4PMB A;  1MSG A;  1LTI D;  2WFW A;  1CM9 A;  1F2M A;  1VS0 A;  1D2B A;  2M2L A;  2EY6 A;  3LX0 A;  1B3A A;  1Q86 C;  1V1Q A;  3S9W A;  1S40 A;  3J7Y W;  4PNY A;  2K03 A;  1VQ7 A;  1IZ6 A;  3HS0 C;  2ALY B;  5GAE C;  2K04 A;  3I70 A;  3OMC A;  2E2H B;  2OF1 A;  1ESF A;  1TWC H;  3IFT A;  4YIJ A;  2A8V A;  3I91 A;  2R3Z A;  1ONL A;  4DV4 L;  2H1E A;  2AHO B;  4LF9 L;  3EQL C;  3V2T A;  1EZ6 A;  1S5B D;  2Z6K C;  2B63 G;  2CQA A;  1IKM A;  5C3E H;  5LMU L;  1E0B A;  4A4I A;  3A8J E;  4JI4 Q;  4NKL A;  4TRD A;  1PZI D;  4BY1 G;  1B9M A;  3TP6 A;  1R9T B;  4UY8 C;  2EPB A;  2A69 D;  2A68 C;  2JA7 G;  1BCP B;  2HUG A;  2DGY A;  2F0F A;  1BKB A;  3B6Y A;  5C0X I;  3H15 A;  3I4M G;  4BBS B;  1GUT A;  1PRT F;  2WIN B;  3M7N A;  4GN3 B;  3A8K E;  1IBM L;  4A3G B;  1VQG A;  3HOY B;  1K0R A;  4JBK A;  1K8G A;  3PMF A;  4A3L G;  5CV6 A;  1J9O A;  3DM3 A;  4IUV A;  2EJG C;  1R9T H;  1H9M A;  2TMP A;  1KRT A;  5EPJ A;  1EWH A;  3S1N B;  4RGT A;  4OON A;  3HOZ G;  2QIL A;  2PZT A;  2G9D A;  4BBS H;  4DR3 L;  4K8J A;  4A3G H;  1DJR D;  3HOY H;  4A3F B;  1H9J A;  1K3R A;  1SE3 A;  2ATW A;  3L9A X;  1S5C D;  2QF7 A;  1IBL L;  1B70 B;  1HR0 L;  1L1O C;  1QVC A;  5JJL A;  2F3V A;  2F0G A;  3MVV A;  3S1N H;  2EY5 A;  1EIY B;  3J81 E;  3W2D A;  1FGU A;  3I4L A;  4MHE A;  1BXT A;  5KYL A;  3DM1 A;  1STG A;  1B8A A;  2AUK A;  1KQS A;  4A3F H;  1IYU A;  1E1T A;  2QDB A;  2ZTE A;  3F8T A;  2MNA A;  2B2T A;  4MTN A;  2B2U C;  3L3O C;  4DAM A;  2N49 A;  5JAV A;  1PXU A;  5GQO A;  1ZYR C;  5IP7 G;  2I0Q A;  3PIP A;  4IUQ A;  3H3V C;  5I4D A;  1X55 A;  3NHH A;  2XWB B;  1A3T A;  2XN9 C;  1EL0 A;  4HCE A;  2WAQ G;  4BY7 B;  3DLL A;  1D7Q A;  5TSS A;  1EIH A;  5M9O A;  4IJL A;  3RZO B;  1RTO A;  4YWK A;  3LWE A;  1EZ8 A;  2PPB C;  1DCZ A;  1TS2 A;  1JB3 A;  4DR7 L;  3NQT A;  5K36 H;  2YU9 B;  3GTQ B;  1SNQ A;  1S4Z A;  2ZM6 L;  4R8I A;  2NZO A;  2F0V A;  3RLN A;  4BY7 H;  2EYM A;  1B2T A;  1EEI D;  4WOR A;  2Y0S G;  3AYH B;  1LT4 D;  2I5M X;  3RZO H;  1G29 1;  1RCV D;  3M4Q A;  2HCI A;  1V9P A;  2QEJ C;  1A2U A;  1VQC A;  2PNH A;  1K3B C;  2YU9 H;  4IPH A;  1EYA A;  3GTQ H;  4GLA C;  2KOL A;  5LL6 S;  3GTJ B;  4GKK L;  3ICE A;  4DN4 M;  4J6H A;  1HCZ A;  4AQY L;  4JI0 Q;  4LMQ D;  1XNR L;  1QUQ B;  1PH7 A;  5JEA H;  3U9O A;  1V1P B;  1Z6H A;  1Y1W B;  3CME A;  2BH2 A;  3F2D A;  2JA6 B;  1F2L A;  3BS1 A;  1PYW D;  3STB C;  1SLJ A;  1UE5 A;  3GTJ H;  3SGI A;  3MXP A;  2F0D A;  4DXG A;  1BCP D;  2SOB A;  2A73 B;  5C3E G;  4V19 0;  4XYQ A;  4Y7N B;  2OTL A;  1Y1W H;  2RHS B;  4KJN A;  5IE8 A;  1PH2 A;  2L12 A;  4DF7 A;  1JB7 A;  5M3M B;  2JA6 H;  4FVM A;  4RCN A;  4RGN A;  1XPU A;  5EBD A;  2A19 A;  2M00 A;  2R92 B;  3AEV A;  3UDI A;  5FLM H;  2F0U A;  3K0Y A;  4RAU C;  4KKT A;  4WJ4 A;  4Y7N H;  1CZW A;  3CF5 A;  3T1H Q;  3KBG A;  2F4V L;  4UPA A;  3BG3 A;  3J7A 5;  4KHP L;  4XTC S;  4F87 A;  1O78 A;  4GKJ L;  4O2D A;  1VQJ A;  5M5Y H;  1PH3 A;  4DR6 Q;  5KGU A;  2YTY A;  1PHJ A;  2VS1 A;  4R4Q A;  1KD1 C;  3M85 A;  2R92 H;  1SE2 A;  4BBS G;  3MHB A;  1EY9 A;  5FLX E;  4KKU A;  5KYI A;  3PO2 H;  3J81 c;  4A3G G;  4IJH A;  3HOY G;  4RA8 A;  1GVP A;  1TWA B;  1WTH A;  2Z9H A;  5KNB A;  3PF5 A;  3KF8 A;  3RLO A;  2NVY B;  4CKB A;  2VB2 X;  2Z4H A;  1IYV A;  1SAP A;  4AYB E;  5JJI A;  1SYE A;  2ASB A;  2VQE L;  3HP3 A;  3AMU A;  1GXD C;  2RCF A;  3PUX A;  3TME A;  3M4P A;  2K14 A;  4L5T A;  1Q46 A;  2YTX A;  1PFS A;  3CU7 A;  5E4W C;  2OXP A;  1SJH D;  4DFA A;  3CCL A;  4KN7 C;  3MWY W;  2VY3 A;  4A3F G;  3C3L A;  5ELD A;  3E9I A;  1VQH A;  2L15 A;  4HCS A;  2EXD A;  5GAH C;  2L55 A;  1SFO H;  1J5E Q;  1X6O A;  1SNM A;  2NVY H;  1F9Q A;  1XPO A;  2BE5 C;  3UDX A;  5EGT A;  4KI0 A;  1GUS A;  5CMD A;  2XGT A;  1YHA A;  4NXM Q;  3EN2 A;  5E4X A;  3R93 A;  4M8A A;  2K50 A;  4GOP C;  4ODG A;  2EQS A;  4DK1 A;  3BZD B;  2RHQ B;  3OHX C;  2WII B;  3RD4 A;  3QOJ A;  4R8N A;  3G4S A;  3P20 A;  4GS3 A;  1B53 A;  4LFC Q;  3HOV B;  2MHV A;  3PUV A;  1W6J A;  1HNZ Q;  4P75 A;  2BDO A;  3EBE A;  5K36 G;  5LL6 X;  4HIO A;  3PUW A;  1WTR A;  3FKI B;  3TSS A;  1BVS A;  4L5Q A;  3I2Z A;  1IW7 C;  1VQD A;  2EIF A;  1B50 A;  1RD9 D;  1HH2 P;  1Q1E A;  4LF6 L;  4R1J A;  3H3V H;  4BY7 G;  3M7G A;  5CV8 A;  3R2T A;  4DR1 L;  3U58 A;  1TWH B;  1Q1B A;  5CV5 A;  3J81 L;  4DV0 Q;  3BVG A;  3HOV H;  3A55 A;  2JK8 A;  2F0N A;  3CC2 A;  1AZP A;  4DR5 Q;  4X65 Q;  4PMC A;  1SNC A;  3VA5 A;  1VQ8 A;  5COR A;  3W1G A;  1ZXT A;  4DUY Q;  3FKI H;  3AB9 A;  3BDL A;  3LNN A;  2A69 C;  2B8F A;  4GNX C;  4KV6 A;  3BU2 A;  1WCM B;  3TEH B;  4JI8 L;  3KJP A;  4ALP A;  2RSO A;  2DN8 A;  1TWH H;  5JEA G;  5ELB A;  3FHW A;  1QZG A;  1B7Y B;  3H09 A;  4JI1 L;  1LTR D;  1TT2 A;  2ZTC A;  1G8Z D;  2FJ2 A;  3TQY A;  2VL6 A;  1KL9 A;  2ID0 A;  4IQZ A;  5DNF A;  5JEA J;  5CBE E;  4OWW B;  4KY6 A;  4DV6 Q;  1F77 A;  3FPP A;  1WCM H;  1TWF B;  4NXN Q;  3KF6 B;  3EA6 A;  1Y1W G;  1YHQ A;  2Q2H A;  3KLW A;  1PH9 A;  1HJP A;  1BR9 A;  4UP8 A;  4HAE A;  2JA6 G;  2CH4 W;  2K5N A;  2XTI A;  3GTP B;  4X3U A;  1QNU A;  4GZY C;  5EPK A;  1K0S A;  3RN5 A;  5FLM G;  3E6Z X;  1PTO B;  4LF8 Q;  3KDF A;  1CFM A;  1D5X C;  4M1U B;  1TWF H;  4J8Q A;  4DNI A;  1S5E D;  4B9X A;  1K73 C;  4N8X 1;  3K80 C;  4EGV A;  2B2W A;  5FLX c;  4QUC A;  3ONA B;  2K7V A;  1X32 A;  5M3M G;  4NPS A;  1SJE D;  1P8L A;  1I94 Q;  2R92 G;  1STY A;  1VMC A;  2NZ1 D;  1T5X D;  2NYZ D;  1SYC A;  5JOB A;  2UXD Q;  1PTO H;  1N32 Q;  4F88 A;  4P74 A;  3OWE B;  1Q81 C;  4WFN 3;  1WI5 A;  3C1F A;  2EJF C;  1DZ1 A;  4NMZ A;  1UNS A;  1X56 A;  1E7Z A;  2IX1 A;  1X3G A;  4DV1 Q;  2KHI A;  2NUC A;  4AIM A;  5D3I B;  4DV3 Q;  2AMC B;  4HR7 B;  4JCV E;  2Z6K A;  3GV3 A;  3DHQ A;  3VR6 A;  3PSI A;  4FYD A;  2PZW A;  5J22 A;  3OTO Q;  1IBK L;  1QNK A;  3SEB A;  3DUZ A;  2F0I A;  4LF4 Q;  1OXX K;  4RWS C;  1MJE A;  1FNW A;  3GDE A;  3ITP A;  1LUZ A;  2XVS A;  3HZX A;  2P5Z X;  2K5W A;  2F0S A;  4CJ2 C;  2PZU A;  4UHV A;  4YCU A;  5IY0 A;  2EYO A;  2H4O A;  2KHS A;  4OX9 Q;  5BR8 Q;  3PUZ A;  5BN3 A;  1KLG D;  3CQZ B;  2RBM A;  1FJG L;  2A6E D;  1EY0 A;  3D4W A;  1LT5 D;  5J39 A;  5FLX L;  1SSO A;  1XMO L;  4ID6 A;  1UAP A;  1HPC A;  3NBI A;  1I4X A;  3SXH A;  4C1N I;  2IHE A;  3CQZ H;  3T1Y L;  5AJ3 Q;  2E2D C;  1BCP C;  1CKM A;  4H02 A;  1DON A;  3HOV G;  2KJX A;  1L1O A;  1KNE A;  1YHB A;  4MIU A;  4IFD I;  2X6G A;  4O42 A;  3RN2 A;  3JAM E;  1HHV A;  2R7Z H;  4C2M H;  3FKI G;  1M1K C;  3MXU A;  1KAB A;  1Y8O B;  2NN6 H;  1ENA A;  4DK0 A;  5IT9 E;  4B3M L;  1OO9 B;  1ILQ A;  4PG3 A;  2MPM A;  2N78 A;  3I4O A;  1SYD A;  4HN7 A;  5C0X H;  1Y8N B;  1TWG B;  2X69 A;  2QCP X;  5ELE A;  1HNX L;  1HNW L;  2WB1 E;  3OWF A;  2F0E A;  1KAW A;  1JOR A;  1QZH A;  1GUW A;  1O80 A;  1STB A;  2PCF B;  4JI5 L;  2PW7 A;  1G6P A;  2KBN A;  1EIG A;  2KED A;  5D3D A;  1WCM G;  2R93 B;  1PTO D;  4OO1 H;  1E24 A;  4NB3 A;  4WRD A;  3RZD B;  3BJU A;  5I2X A;  5EBC A;  1N9W A;  4JYA L;  3G48 A;  4IUT A;  4K5W A;  3A7A B;  1TWG H;  4JI6 Q;  2RF4 A;  4C1N K;  5IWA Q;  5ELC A;  4P72 A;  4DUZ Q;  1U5K A;  1SE4 A;  5F2D A;  2LXJ A;  5E7N A;  4DAY B;  2CH4 A;  2HHH L;  1PLF A;  1PH8 A;  4DR4 L;  3I72 A;  3T51 B;  3RZD H;  5CC4 A;  4AYB B;  1SRU A;  5KEE A;  3NPP A;  3EVQ A;  2PQA A;  4QUF A;  3J7A V;  1EQV A;  2DJG C;  1EY7 A;  1HQR D;  3D0F A;  3OYY A;  3NWT A;  2K75 A;  1I6H H;  1MD2 D;  2K5D A;  2D62 A;  5K5P A;  2CW0 D;  1EQR A;  5ELN A;  3C2P A;  2AQ1 B;  3EJI A;  3TN2 A;  1GOZ A;  2DJF C;  1O7I A;  3CW2 C;  1TKW B;  3VR3 A;  2DNE A;  4B3T L;  1QG7 A;  4B08 A;  1UEB A;  5T1G A;  4ZLT F;  2Q8T A;  3DWA A;  3M3Y B;  5C5L A;  3QR8 A;  1I4Q A;  5EAY A;  1I3Q B;  2D0O A;  1DOK A;  4NP5 A;  5LMN L;  1AFP A;  3GTO B;  4CDC C;  4JI3 L;  4LUO A;  3GP7 A;  4FF2 A;  4JV5 Q;  4DK3 C;  1YVC A;  3M3Y H;  3ND9 A;  4LF9 Q;  2UU9 L;  4RHS A;  2D9U A;  2LY7 A;  5IGF A;  5LMU Q;  5D65 A;  5L37 A;  1J8I A;  4EQ5 A;  2K33 A;  1N36 L;  2F0O A;  2K32 A;  2JJQ A;  1Q90 A;  4B3S L;  5C4X B;  1CQF A;  4WJW A;  1IW7 D;  4CDD C;  2FXQ A;  3X3N A;  4K0K Q;  3A0J A;  3NSW A;  1YEZ A;  1A6X A;  3TS0 A;  4DV5 L;  1IBM Q;  1PH5 A;  4HSP A;  2BA0 A;  3CCM A;  3K6O A;  5M5W B;  2X6L A;  5C4X H;  2FIN B;  2E2H H;  5IT9 c;  3CCS A;  4C3J B;  4CJ0 B;  4X66 L;  1UE1 A;  1EEF D;  1SMY D;  2L11 A;  4PV1 C;  2F0W A;  4Z9C B;  1NTG A;  2F0T A;  3KF8 B;  1Q82 C;  3KYH C;  1F9R A;  1GHK A;  4DR3 Q;  5EPL A;  2R7Z G;  3K5N A;  2E74 C;  3TZD A;  4RKB A;  3L2P A;  4YHH L;  2NN6 G;  3KJO A;  3IFD A;  1II3 A;  2SEB D;  5M5W H;  1JE5 A;  4HMJ A;  1ASY A;  2JA5 B;  1IBL Q;  4C3J H;  5COY A;  1HR0 Q;  4Q5V A;  1MSH A;  2E2J B;  2XSC A;  5C0X G;  4BA2 I;  2MO0 A;  4LNQ A;  2B29 A;  2OTJ A;  1UUP A;  2F0J A;  3PF4 A;  1A8V A;  1Y1V B;  2F3I A;  3HGB A;  1MHW C;  1NMF A;  3OW7 A;  4OO1 G;  4YWL A;  2HQE A;  1PH1 A;  2JA5 H;  5A35 A;  2N55 A;  2UUC L;  1JOQ A;  2M9V A;  5J3B A;  2E2J H;  3A54 A;  1U0L A;  1RDP D;  2CKZ B;  1ICF B;  4LFA L;  1AH9 A;  1FD7 D;  3FRP B;  3BYY B;  1Y1V H;  4K8I A;  2KCC A;  3Q8D A;  1E2Z A;  1Q12 A;  4KTA A;  5C4H A;  1A63 A;  2RVL A;  4A3I B;  4U67 3;  3R3O A;  1C8C A;  3I3C A;  4DR7 Q;  4ULL A;  1PMR A;  2RCN A;  4QL5 A;  5IT9 L;  1NY4 A;  4EQN A;  1NMG A;  2Z1C A;  5FO8 B;  3LWU A;  4IAL A;  4KMU C;  2FFK B;  2ICE C;  1Q8I A;  3J80 i;  1LYL A;  5C4J B;  2N8N A;  1VQL A;  4G7H C;  1IKL A;  4K6L A;  1H9S B;  4A3I H;  4CDF C;  5ISR A;  1VF7 A;  2HIV A;  2UXC Q;  2WKC A;  4AYB G;  1SRO A;  3PUY A;  2HD3 A;  4A3D B;  4BXX H;  3OMG A;  5GRO A;  1Q7Y C;  1CKN A;  2PW5 A;  2YYZ A;  1L0X B;  1LT3 D;  4PQX A;  2A6E C;  2QW7 A;  3G7L A;  1GM5 A;  2NVQ B;  4GKK Q;  3CCJ A;  1WTO A;  1XPR A;  4AQY Q;  2I07 B;  5C4J H;  3G71 A;  2OQ0 A;  4XQJ A;  1E1O A;  3ULP A;  1CA5 A;  3Q0A A;  1PH6 A;  2D0P A;  1CKO A;  2NZH A;  1EYD A;  2Q2T A;  4X62 L;  1RKN A;  4A3D H;  2YTV A;  2IWH A;  3S2D B;  1J6Q A;  2RDF A;  4OHJ A;  5FKA C;  2NVQ H;  2RSN A;  4POG A;  4IUP A;  1RF2 D;  1I4P A;  1Z9F A;  4ZKC B;  4JC0 A;  4ZYS A;  2XRS D;  1Y69 U;  1TR5 A;  3KDF B;  3I7F A;  1WD1 A;  1N34 Q;  4J1M A;  3PCO B;  4JI7 L;  2IT1 A;  3S2D H;  1JR0 D;  1DXM A;  4L5S A;  4HJA A;  4KD4 A;  3NBH A;  4KHZ A;  2AKW B;  2GA4 B;  1K83 B;  1ICW A;  4KN4 C;  1FVI A;  4KHP Q;  2EJM A;  4A93 B;  4EVO A;  1JE4 A;  3DWQ A;  2DY8 A;  2WB1 B;  3CHB D;  2YV5 A;  3K7A B;  1EOT A;  3R8B A;  3T53 B;  5C4X G;  4YCW A;  3MXN A;  5KRU A;  1KRS A;  1PH4 A;  1PTO C;  2VUM B;  2NVT B;  1HR0 W;  1K83 H;  4IUR A;  3EIV A;  4APV A;  4LUZ A;  3HEJ A;  4TVA B;  2SNS A;  4LFB Q;  3QOL A;  3A5Z B;  4A93 H;  1A62 A;  1LTT D;  2J4X A;  5M3M H;  3DEO A;  3FEW X;  2B2Y C;  3CRL C;  3K7A H;  2F3W A;  4C3J G;  2IW3 A;  1YBY A;  1D1I A;  2QGQ A;  1UE6 A;  2UUB Q;  4IOA A;  1VQO A;  4JG2 A;  1BBW A;  2JA8 B;  5CR3 A;  2B2V C;  3U4Z A;  3FDT A;  3ER0 A;  4XDX A;  3FP9 A;  3K58 A;  1EUJ A;  1N33 L;  3CXC A;  2CW0 C;  5JVG 3;  2JA5 G;  3TP8 A;  1A3V A;  1SYG A;  2Q8I B;  1BDO A;  2F0Q A;  4FXG C;  2ZXO A;  2L9H A;  2NB0 A;  2UUA Q;  2NTT A;  1VCI A;  2A5H A;  4L5R C;  2JA8 H;  5JJZ A;  3SK4 A;  1QJO A;  1Y1V G;  3GTG B;  1TWA H;  4A3C G;  3TBI B;  1Z7T A;  2C9O A;  1XXG A;  1STH A;  4A3M B;  2K01 A;  1TY0 A;  5I6Y A;  4X64 L;  3AU7 A;  1NSN S;  2VQF L;  4IPC A;  1FNU A;  1LM0 A;  4H44 C;  1W2B A;  4LF6 Q;  1SXT A;  2K5Q A;  3I73 A;  4DR1 Q;  1HA6 A;  1Z47 A;  2K4K A;  4A3I G;  3VYR A;  1FL0 A;  3G6E A;  1HUN A;  1IL8 A;  3CKI B;  1H9R A;  4BXX G;  2L5T A;  3HRZ C;  1W3S A;  4X3S A;  4XQQ A;  3N6R A;  1EQT A;  2JE6 I;  3DWP A;  1MGS A;  1HZA A;  1EY8 A;  4G4K A;  1KTK A;  1ROD A;  1KIX A;  4JI8 Q;  4RGM A;  4ZK9 B;  2IHF A;  3WWV A;  2RA4 A;  4CKE A;  3R2I A;  1KXL A;  1PRT B;  5IIF A;  2LXK A;  4NXM L;  4A3D G;  4K2K A;  2EYF A;  1I4R A;  4RMF A;  2KHJ A;  3A7L A;  1VQF A;  3UDF A;  5CV4 A;  2XNA C;  1SMY C;  4I7Z C;  4RHR A;  1C4Q A;  1IXR A;  2VXW A;  2CCZ A;  2JA9 A;  3A56 A;  4DAV A;  3I8Z A;  3S17 B;  4DR2 L;  3MFY A;  4PZ6 A;  3CCU A;  3CCV A;  4RGO S;  1TU2 B;  4QGU A;  4OEM B;  2K28 A;  2EY1 A;  5I6W A;  1JJG A;  1WTP A;  5M5X B;  1DOL A;  4OWX B;  4F7X A;  5EKL A;  2IY5 B;  3T56 B;  2B39 A;  1LTL A;  1AW7 A;  3SR1 A;  3U9S A;  4HIM A;  3S17 H;  3S15 B;  4H13 C;  4DUY L;  3K0X A;  4JOI A;  4QB4 A;  4CGY B;  3AFQ A;  5M5X H;  2V4D A;  1V1O A;  3RMH A;  4KD3 A;  2A6H C;  1VQN A;  1U4P A;  4A93 G;  5G3L D;  1E22 A;  4DNR B;  3S15 H;  2IX0 A;  2WB1 G;  1XNQ L;  3GTP H;  1IHZ A;  1XMQ Q;  5EQ0 A;  1V1P A;  2F1M A;  2UXB L;  1BQQ T;  1BCP F;  1CTM A;  3BVZ A;  5CGK A;  1YNJ D;  2I5H A;  1VQA A;  3PO3 B;  1IBK Q;  3I55 A;  2E5L Q;  3KFU A;  1E2W A;  4XQN A;  3NTK A;  2O2L D;  2F0P A;  1WYD A;  2V1C C;  1AE2 A;  5FO7 B;  2XIW A;  3RNU A;  1QOH A;  1EYC A;  1VQE A;  1STE A;  1PYB A;  2LS0 1;  1EY5 A;  1WFQ A;  2KA7 A;  2OT2 A;  3CC4 A;  1BF4 A;  2E8G A;  2JSO A;  3PO3 H;  1LAB A;  1I4H A;  2B8G A;  2JA8 G;  1OXS C;  1HA5 A;  1T9H A;  1W6K A;  4FF1 A;  2NVX B;  1AP0 A;  3NWS A;  2KQ3 A;  1C7Y A;  4RH6 A;  2JQO A;  3HOX B;  4IO9 A;  3OW2 A;  2O4X A;  1XMO Q;  4JI2 L;  2UXD L;  4N9T A;  1NNX A;  2MGS A;  2PYK A;  1EY4 A;  2F0M A;  3NTI A;  4CKC A;  1KDB A;  1P16 A;  1YJN A;  4R4I A;  3NK9 A;  4DGZ A;  1K8O A;  3T1Y Q;  2NVX H;  2CQO A;  4X3T A;  1OXU A;  3HOX H;  4B3R L;  3S1R B;  4DV1 L;  5T1I A;  1YNX A;  4ZRZ A;  4CJ1 B;  4OIK A;  4A3M G;  1C48 A;  3D6C A;  4DV7 L;  1NR4 A;  1PRT D;  1WOC A;  3HFZ B;  3SK5 A;  3W1B A;  4HJ8 A;  3FPU B;  3F2U A;  1SND A; 
#chains in the Genus database with same CATH homology
 4B3M Q;  3L7Z C;  4LF4 L;  4GLA C;  4GKK L;  4DKA C;  3ERS X;  3ICE A;  2FXQ A;  4YCV A;  4A3B G;  2I5L X;  4AQY L;  1IYJ B;  2VZA A;  3H0G G;  1NJI C;  4LFC L;  1K8A C;  4JI0 Q;  4K0K Q;  3A0J A;  3D31 A;  1XNR L;  2QA4 A;  1A0I A;  1HNZ L;  1YEZ A;  1QUQ B;  1PH7 A;  3U50 C;  2KCM A;  3TS0 A;  1HNW Q;  3BZC A;  1S3O A;  4QQB X;  2VNU D;  4DV5 L;  1IBM Q;  3CME A;  2MFI A;  1PH5 A;  4BA1 I;  2BH2 A;  4UP9 A;  1OXT A;  2BA0 A;  3F2D A;  3CCM A;  3HOU G;  3PIO A;  2PQA B;  5C4X H;  3STB C;  2E2H H;  1SLJ A;  5IT9 c;  1UE5 A;  3CCS A;  5IP9 G;  3GTJ H;  3SGI A;  1JT8 A;  1SMX A;  4X66 L;  1UE1 A;  4HID A;  3PV0 A;  1Y14 B;  4A3K H;  3K8A A;  1YJ9 A;  3GTL H;  4DV0 L;  5C3E G;  2A1A A;  3HKZ E;  4JYA Q;  1NTG A;  3KF8 B;  3ZJY C;  4HJ7 A;  4DR5 L;  1Q82 C;  3KYH C;  5H1S E;  4X65 L;  1VQM A;  2OTL A;  1Y1W H;  4DR3 Q;  2RHS B;  3ULJ A;  5IE8 A;  1DGS A;  2R7Z G;  2B3G A;  2HQL A;  1PH2 A;  3J81 i;  1JB7 A;  3L2P A;  1XNQ Q;  4X6A H;  2JA6 H;  4YHH L;  2NN6 G;  4IOC A;  4LF5 L;  1XPU A;  3AFP A;  5IYB H;  4FDB A;  2A19 A;  5M5W H;  3KJO A;  2K5H A;  1VQ9 A;  1JE5 A;  2F52 A;  5AJ3 L;  1ASY A;  3CMA A;  2UXB Q;  1IBL Q;  4C3J H;  3VDY A;  3AEV A;  3UDI A;  1HR0 Q;  5FLM H;  1CSQ A;  5C0X G;  4BA2 I;  4WJ4 A;  2MO0 A;  4LNQ A;  2B29 A;  4Y7N H;  3CF5 A;  3T1H Q;  2F4V L;  4AH6 A;  2OTJ A;  3HKZ G;  2ZTD A;  4UPA A;  3CC7 A;  4DV2 L;  3J7A 5;  3PF4 A;  4KHP L;  1C0A A;  1A8V A;  4XTC S;  1XJV A;  4GKJ L;  4O2D A;  1VQJ A;  4LF7 Q;  5M5Y H;  2F3I A;  1PH3 A;  4DR6 Q;  2JEB I;  2YTY A;  4OWT B;  1QUQ A;  4P73 A;  1PHJ A;  2VUM G;  1NMF A;  4OO1 G;  4YWL A;  2VS1 A;  1PH1 A;  4DV6 L;  2JA5 H;  2R93 H;  4R4Q A;  1KD1 C;  3M85 A;  2UUC L;  2R92 H;  1PVO A;  5GAD C;  5J3B A;  4NXN L;  2E2J H;  3K81 C;  2BH8 A;  1U0L A;  4BBS G;  4IPD A;  2CKZ B;  2ZJP A;  4B3T Q;  2LSS A;  4LFA L;  3PO2 H;  1AH9 A;  3J81 c;  4A3G G;  4IJH A;  1KHI A;  4MNO A;  3HOW H;  3HOY G;  4PZ8 A;  1GVP A;  3W5O A;  1Y1V H;  5FJ8 H;  1M90 C;  3Q8D A;  1Q12 A;  3PF5 A;  3RLO A;  5IYD G;  1A63 A;  3LGJ A;  4AYB E;  5JJI A;  2ASB A;  4JI2 Q;  2VQE L;  4LF8 L;  4DR7 Q;  4JBM A;  4JI3 Q;  3HKS A;  3PUX A;  4RG1 A;  1I5F A;  2RCN A;  4QL5 A;  3M4P A;  2K14 A;  4L5T A;  4YY3 Q;  1Q46 A;  1I50 H;  1NY4 A;  1V43 A;  2YTX A;  1PFS A;  3PO2 G;  1YI2 A;  1WJJ A;  1VQP A;  5IWA L;  2ZJQ A;  4GLV B;  1SR3 A;  1NMG A;  1D8L A;  3UDG A;  3CCL A;  1FJG Q;  2VY3 A;  4A3F G;  3MEF A;  3J80 i;  4B3R Q;  3E9I A;  1LYL A;  1XTD A;  1VQH A;  2L15 A;  2N8N A;  1VQL A;  1XMQ L;  2EXD A;  5GAH C;  2OCE A;  1SFO H;  1J5E Q;  3CPW A;  1X6O A;  2GN5 A;  2NVY H;  4DV7 Q;  4A3I H;  1XPO A;  1I94 L;  3UDX A;  2GVB A;  4KI0 A;  2KCT A;  4C3H H;  2XGT A;  1N32 L;  1YHA A;  2HIV A;  2UXC Q;  3PO3 G;  4NXM Q;  1QVF A;  3EN2 A;  1EWI A;  4AYB G;  1SRO A;  3PUY A;  2H5X A;  1AE3 A;  1X3E A;  4BXX H;  4GLX A;  2K50 A;  1Q7Y C;  5GRO A;  4GOP C;  1CKN A;  2E5L L;  2YYZ A;  4B3S Q;  2EQS A;  1GM5 A;  2RHQ B;  3A74 A;  3F2C A;  5GAG C;  3CCJ A;  4GKK Q;  1XPR A;  4DV4 Q;  3G4S A;  1HZ9 A;  4AQY Q;  4GS3 A;  4LFC Q;  3NEL A;  4IPG A;  4LW1 A;  5C4J H;  3G71 A;  2OQ0 A;  4DV3 L;  3PUV A;  4A3J G;  1I3Q H;  1HNZ Q;  4P75 A;  2K52 A;  1X65 A;  1E1O A;  3EBE A;  1HZB A;  5K36 G;  3ULP A;  4QJF A;  1EYG A;  1PH6 A;  2D0P A;  3GD7 A;  3E9H A;  3GTO H;  1CKO A;  2NZH A;  4R4C A;  3PUW A;  4HIO A;  3OTO L;  2Q2T A;  1X54 A;  4X62 L;  1YIJ A;  4A76 A;  4A3D H;  2YTV A;  1K9M C;  3L0O A;  1BVS A;  4L5Q A;  3I2Z A;  2EIF A;  1VQD A;  3J80 c;  3HOX G;  1J6Q A;  1HH2 P;  1Q1E A;  4LF6 L;  4R1J A;  4GOP B;  3CD6 A;  2NVQ H;  1VQK A;  3H3V I;  3H3V H;  4BY7 G;  4X66 Q;  4POG A;  3S1R H;  4DR1 L;  3U58 A;  1Q1B A;  4DV0 Q;  1EIF A;  3HOV H;  1Z9F A;  4J15 A;  2JK8 A;  4JC0 A;  2WP8 J;  3CC2 A;  4DR5 Q;  1HNX Q;  4X65 Q;  3GTK H;  2B63 H;  5DLQ E;  3CP0 A;  1VQ8 A;  5ELO A;  4OX9 L;  3JAM c;  3KDF B;  1EFW A;  3UE0 A;  3I7F A;  1N34 Q;  5BR8 L;  3I4N H;  4JI5 Q;  3W1G A;  3PCO B;  1TXY A;  4YHH Q;  4DUY Q;  2IT1 A;  4JI7 L;  4LF5 Q;  3FKI H;  3S2D H;  2MQH A;  4BY1 H;  1VQ6 A;  4L5S A;  4GNX C;  4HJA A;  2CFM A;  3M9B A;  3BU2 A;  4JV5 L;  4KHZ A;  2AKW B;  4A3E H;  3TEH B;  4JI8 L;  4R4T A;  3KJP A;  4ALP A;  4HJ5 A;  1TWH H;  5JEA G;  3BZK A;  4EX5 A;  2JA7 H;  4MZ9 A;  3FHW A;  1FVI A;  4IFD G;  1QZG A;  1S72 A;  3I4M H;  3TRE A;  1X3F A;  4DV2 Q;  4HIK A;  4KHP Q;  1B7Y B;  3CCQ A;  4JI1 L;  5JJK A;  2ZTC A;  3TQY A;  2VL6 A;  2YV5 A;  1KC8 C;  5C4X G;  1KL9 A;  4A3L H;  2ID0 A;  4YCW A;  5JEA J;  2NN6 I;  1KRS A;  3J81 j;  1PH4 A;  4OWW B;  3STB D;  4DV6 Q;  2HHH Q;  4IFD J;  1MIU A;  1HZC A;  1WCM H;  2MO1 A;  4A3K G;  2UUC Q;  4GNX B;  4DR4 Q;  4K0K L;  1HR0 W;  1K83 H;  4NXN Q;  4XIG S;  3KF6 B;  2GVA A;  3EIV A;  4APV A;  4HJ9 A;  1Y1W G;  1PA6 A;  3HOZ H;  4LUZ A;  3NEM A;  4LFA Q;  3IRB A;  1YHQ A;  4TVA B;  2Q2H A;  4JI4 L;  4GOP A;  3KLW A;  1PH9 A;  1HJP A;  4LFB Q;  4UP8 A;  5IYC H;  2JA6 G;  3A5Z B;  4A93 H;  1A62 A;  5IYB G;  2K5N A;  2XTI A;  5M3M H;  4A75 A;  2HT1 A;  2JEA I;  1CSP A;  3K7A H;  5C0X J;  1CKN B;  1JMC A;  3GO5 A;  3RN5 A;  5FLM G;  4OO1 I;  1YBY A;  2QGQ A;  4LF8 Q;  3KDF A;  1K73 C;  1UE6 A;  4QY7 A;  1TWF H;  1VQB A;  4DNI A;  2UUB Q;  3S14 H;  4IOA A;  1VQO A;  4JG2 A;  3K80 C;  1OXV A;  1PV4 A;  5HY6 A;  1BBW A;  3K7U C;  4TQU S;  1NE3 A;  2CWA A;  5FLX c;  3GTM H;  2HIX A;  5IYC G;  2BA1 A;  3U4Z A;  3U4V A;  3ER0 A;  2CWP A;  3NEN A;  3FP9 A;  4P71 A;  5M3M G;  4NPS A;  1OTC A;  1EUJ A;  3PGZ A;  3RR5 A;  3CXC A;  1N33 L;  3S1Q H;  5C44 H;  4A3C H;  2JA5 G;  2R93 G;  1X9N A;  1P8L A;  1I94 Q;  2R92 G;  2OQK A;  3E0E A;  4PMW A;  2UXD Q;  1BBU A;  5LMN Q;  1N32 Q;  3CAM A;  4P74 A;  5LMN W;  1Q81 C;  2UUA Q;  1WI5 A;  1VCI A;  4R4O A;  4JI6 L;  3HOW G;  4UP7 A;  4L5R C;  2ZM6 Q;  1QVG A;  2JA8 H;  1NBW A;  5IP7 H;  1MJC A;  1X56 A;  3KOJ A;  1Y1V G;  5FJ8 G;  4DUZ L;  1TWA H;  4GNX A;  1E7Z A;  3JC6 6;  4LF7 L;  2IX1 A;  3J7Z C;  1E3P A;  1X3G A;  4DV1 Q;  4A3C G;  3KF6 A;  2KHI A;  1N8R C;  4AIM A;  2UU9 Q;  4DV3 Q;  2AMC B;  1JJC B;  4LUV A;  3TRZ A;  1SN8 A;  4JCV E;  2E2I H;  2Z6K A;  3NBH B;  4X64 L;  3PSI A;  2VQF L;  3I56 A;  1IBK L;  1G51 A;  2R7F A;  3OTO Q;  4IPC A;  4X62 Q;  1N36 Q;  1ASZ A;  4BBR H;  3S2H H;  1LM0 A;  5M3F H;  2AWO A;  1W2B A;  1EQQ A;  2Z0S A;  4LF4 Q;  4GN5 A;  1OXX K;  4LF6 Q;  1MJE A;  4JOI C;  4DR1 Q;  3GDE A;  1XNR Q;  1Z47 A;  2K4K A;  4A3I G;  2K5V A;  2AWN A;  3MXN B;  2OWO A;  2N3S A;  2DUD A;  1LUZ A;  1EOV A;  3A5U A;  2R6G A;  4DV5 Q;  1FL0 A;  3G6E A;  1YIT A;  4JBJ A;  4YCU A;  5IY0 A;  4OX9 Q;  4BXX G;  3CCR A;  1W3S A;  4WJ3 M;  5BR8 Q;  4BBR G;  4YY3 L;  3PUZ A;  4JI7 Q;  2JE6 I;  1HZA A;  1FJG L;  2WFW A;  1VS0 A;  1KIX A;  4JI8 Q;  4ME3 A;  4A3B H;  3H0G H;  1Q86 C;  1V1Q A;  1CUK A;  4POF A;  1XMO L;  2IHF A;  3WWV A;  1S40 A;  1KXL A;  2UXC L;  1VQ7 A;  1IZ6 A;  2LXK A;  4NXM L;  4A3D G;  2IHE A;  2ALY B;  5GAE C;  3HOU H;  4KLK A;  4GN4 B;  3CQZ H;  2PMZ E;  4RMF A;  5AJ3 Q;  1TWC H;  2KHJ A;  3T1Y L;  2VW9 A;  1RL2 A;  2A8V A;  1VQF A;  3UDF A;  1GO3 E;  5IP9 H;  1CKM A;  4H02 A;  4DV4 L;  2AHO B;  3HOV G;  4LF9 L;  2PI2 A;  1L1O A;  1IXR A;  1YHB A;  2Z6K C;  2B63 G;  5C3E H;  2F4V Q;  2CCZ A;  5LMU L;  2JA9 A;  4A4I A;  4JI4 Q;  4IFD I;  3RN2 A;  1VQ4 A;  3I4N G;  3S1M H;  4DR2 L;  1JJ2 A;  2R7Z H;  4PZ6 A;  4C2M H;  4GKJ Q;  3CCU A;  3FKI G;  4BY1 G;  2QEX A;  3CCV A;  4QGU A;  1M1K C;  4B3M L;  1JJG A;  4A3E G;  4UY8 C;  4OWX B;  3RLF A;  1RIP A;  4PG3 A;  4JI0 L;  2JA7 G;  2N78 A;  2IY5 B;  3F2B A;  3AQQ A;  2DGY A;  3B6Y A;  1BKB A;  3I4O A;  1LTL A;  5C0X I;  3H15 A;  3I4M G;  1HNW L;  1HNX L;  1C9O A;  2WB1 E;  3CPF A;  3M7N A;  4HIM A;  4GN3 B;  1KAW A;  1IBM L;  4JBW A;  3S17 H;  1VQG A;  1QZH A;  2KEN A;  1K0R A;  4JBK A;  4Y52 H;  1K8G A;  1N34 L;  4A3L G;  4JI5 L;  1N33 Q;  4DUY L;  1G6P A;  2KBN A;  4PZ7 A;  3K0X A;  4JOI A;  3DM3 A;  3AFQ A;  1WCM G;  4QIW E;  5M5X H;  1SE8 A;  1R9T H;  1KRT A;  1E24 A;  2NVT H;  4NB3 A;  2VUM H;  2VQE Q;  3BJU A;  1N9W A;  4OON A;  1GKH A;  3HOZ G;  4JYA L;  3G48 A;  1MKH A;  3CCE A;  1TWG H;  4BBS H;  4DR3 L;  4JI6 Q;  2RF4 A;  5IWA Q;  3F1Z A;  1VQN A;  4LWC A;  1VQI A;  4A93 G;  1GD7 A;  1E22 A;  4P72 A;  2Q2U A;  4DUZ Q;  4A3G H;  1U5K A;  3HOY H;  2IX0 A;  2WB1 G;  3S15 H;  1UE7 A;  1XNQ L;  3GTP H;  1K3R A;  1XMQ Q;  1IL2 A;  2ATW A;  3S16 H;  2LXJ A;  5E7N A;  4DAY B;  1IBL L;  2UXB L;  1B70 B;  5IYD H;  2HHH L;  1HR0 L;  1PH8 A;  4DR4 L;  1L1O C;  1QVC A;  4X64 Q;  5JJL A;  3S24 A;  3S1N H;  2I5H A;  2VQF Q;  1VQA A;  3RZD H;  1IBK Q;  4YWM A;  1EIY B;  3I55 A;  1SRU A;  3T1H L;  2E5L Q;  3KFU A;  2PQA A;  1L2F A;  4DPG A;  1FGU A;  2WAQ E;  4OXP A;  4LFB L;  1PYS B;  1WYD A;  2V1C C;  1AE2 A;  3D0F A;  1B8A A;  3OYY A;  5C44 G;  1KQS A;  2K75 A;  4A3F H;  1I6H H;  4DR6 L;  3RNU A;  1E1T A;  1VQ5 A;  1VQE A;  2ZJR A;  2D62 A;  2ZTE A;  3F8T A;  2MNA A;  1EQR A;  5ELN A;  1PYB A;  2ES2 A;  1WFQ A;  4MTN A;  5HGQ A;  1H95 A;  4DAM A;  2N49 A;  2UUB L;  3CC4 A;  1O7I A;  3CW2 C;  2C35 B;  1L1O B;  2E8G A;  5GQO A;  3PO3 H;  1Q8K A;  2JA8 G;  5IP7 G;  2I0Q A;  4B3T L;  3PIP A;  1OXS C;  2R7D A;  1T9H A;  1YZ6 A;  1X55 A;  1C7Y A;  2JQO A;  1UEB A;  3GTG H;  2Y0S E;  1YJW A;  2WAQ G;  3DLL A;  1D7Q A;  4IO9 A;  5EAY A;  3OW2 A;  2D0O A;  4IJL A;  3ULL A;  2PI2 E;  4YWK A;  4A3J H;  4A3M H;  4C3I H;  1XMO Q;  4JI2 L;  4DR7 L;  2UXD L;  5LMN L;  4JI3 L;  4LUO A;  1YJN A;  1P16 A;  2UUA L;  5M3F G;  1L0W A;  4DK6 C;  4R4I A;  3UE1 A;  3JAM i;  3M4O H;  2ZM6 L;  1UWV A;  3T1Y Q;  2NVX H;  2CQO A;  4O0A A;  3TS2 A;  1OXU A;  2NZO A;  3HOX H;  4JV5 Q;  4DK3 C;  4B3R L;  2Q2I A;  3RLN A;  4DV1 L;  4BY7 H;  1YVC A;  3M3Y H;  4LF9 Q;  1YNX A;  2UU9 L;  1J5E L;  2Y0S G;  4A3M G;  4DV7 L;  3AYH B;  2I5M X;  3RZO H;  5LMU Q;  1G29 1;  3M4Q A;  1V9P A;  1WOC A;  4JI1 Q;  1VQC A;  4EQ5 A;  2PNH A;  4DR2 Q;  3HFZ B;  2YU9 H;  4IPH A;  3W1B A;  4HJ8 A;  1N36 L;  3GTQ H;  2JJQ A;  4B3S L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...