3RZDH

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rzdH00
3HOVH 1GO3E 2Q2TA 2WB1E 1EQQA 1KL9A 4GNXB 4HJ8A 1UE5A 1SRUA 4LUZA 4LF9Q 5IP9H 2UXCQ 4HJ5A 4JYAL 5C0XJ 1NMFA 3HOWH 1HNZL 4P71A 2NZOA 2HIXA 4L5TA 1VQDA 4JI2Q 3GTKH 4JI6Q 1HZAA 1OTCA 3A0JA 2OQ0A 1FL0A 3FHWA 1CSQA 5GQOA 4B3RL 2QGQA 4YHHL 3KF6A 4DV4L 1B70B 4JC0A 1IBLQ 2BA0A 2GVBA 4LFAQ 1E7ZA 1I94Q 1EFWA 1VQJA 5IP9G 3J7ZC 3Q8DA 5AJ3Q 4DV1Q 3GTLH 1Z9FA 2IHFA 4DPGA 2AWOA 4JI8Q 5FLXc 1VQNA 1VQOA 4DR1L 3ZJYC 4A75A 4QQBX 4NPSA 1VQGA 3H0GG 4YY3L 2R93G 4HIOA 1X3GA 1W3SA 3S2DH 1YNXA 1I6HH 1IBMQ 4BXXH 1KRSA 1PH5A 2YYZA 2YU9H 2HHHL 2ZM6L 3PO3H 1YHAA 4A3MH 2F4VQ 1S3OA 1VQPA 4DUZQ 1JB7A 4LF5Q 4GLVB 2MFIA 4C2MH 4HIKA 1PH6A 2HIVA 4AH6A 2ZTEA 1Q86C 2K5VA 1VS0A 3HFZB 3PV0A 3KF6B 5M3MH 3HOWG 2UUAQ 3K7AH 1XMOL 2YV5A 5FLMG 1R9TH 2VUMG 1JT8A 1N8RC 4JOIC 3S1MH 3FP9A 4RG1A 1B8AA 3CCJA 4NXML 2ASBA 1VQ6A 3M4QA 1Z47A 4BBRG 2LSSA 3F8TA 1IXRA 4IPCA 1LYLA 4LUVA 4OWTB 4AQYQ 4KHPL 4B3MQ 1ASZA 3KDFB 4IPDA 3CW2C 3MXNB 3GD7A 4JBWA 4L5QA 1N34Q 3TREA 1FGUA 2K4KA 3W5OA 4QGUA 4OWXB 1E3PA 5AJ3L 2QEXA 2UU9Q 4PMWA 4DV5L 4LF7Q 2JJQA 4DR5L 1MJEA 4JI0L 3EN2A 3GTPH 2BH2A 3K0XA 2V1CC 3W1BA 2R7DA 4IOAA 4JI1Q 5IYBH 2LXKA 3PCOB 2K14A 4GN5A 2JA9A 4O0AA 3D31A 4YCUA 5FJ8G 5C0XG 3F2BA 1S72A 1QZHA 2E5LQ 1FJGQ 3PO2H 3TS2A 4YCWA 3CP0A 1EYGA 4BY7H 1E24A 1C0AA 4LF9L 2R93H 3CPWA 4NB3A 4DR6Q 2JA5H 4PZ6A 3S1QH 4DK3C 2E2IH 1X3EA 3CPFA 2PQAA 3S1RH 1HNZQ 4QL5A 3M7NA 4JI7Q 4YWMA 5ELNA 4X6AH 4LF6Q 5IYDG 4X65Q 3CCEA 2IX0A 5IE8A 4GNXC 1AE3A 2PMZE 3E9IA 4APVA 5C44G 3PUXA 2XTIA 3F2CA 4JI2L 2RCNA 5BR8Q 3J7A5 1O7IA 4LFCL 3E0EA 1V1QA 1WYDA 3EIVA 3JAMc 2Z6KC 3M4OH 3NELA 4B3RQ 4TQUS 1CKNB 2ZTDA 3GTGH 4C3HH 4A3FG 4DV6L 1AH9A 5FLMH 3EBEA 2VUMH 4WJ3M 1KXLA 1K3RA 3OTOL 2K5HA 5M3MG 3UE0A 4X66L 1X3FA 4DV7L 4POFA 3CMAA 3CMEA 2CQOA 2IT1A 4B3TL 1IL2A 2ES2A 1XNQQ 5C4XH 1MIUA 3S15H 3HKSA 4X65L 1PV4A 1PH9A 4JBMA 5GAGC 5M5XH 5IWAQ 3HOUG 1I50H 4DAYB 3CCQA 2QA4A 1C7YA 2NZHA 2LXJA 3I7FA 1HNXQ 2ZTCA 4LF5L 4DUZL 4Y7NH 3HKZE 4UPAA 4UP9A 4IPHA 2JA5G 2JEAI 2EQSA 5C4XG 4GKKQ 4QJFA 2IY5B 4EQ5A 3ERSX 2VY3A 3T1YQ 1XTDA 2E2JH 2VQFL 2VQEL 1WJJA 2B63G 3RZOH 5IYBG 1N33L 4IFDG 5GADC 1CKNA 1GVPA 3RLOA 1PYSB 4LUOA 4GOPC 1XMOQ 1IZ6A 1WI5A 3KDFA 4A3BH 3HKZG 2JA6G 4BBRH 1WCMH 1EIYB 1A63A 3PF4A 1CSPA 1VQKA 3CAMA 4X64Q 5HY6A 1Q46A 5IWAL 1PH1A 3RLFA 3CXCA 4DR2Q 4IPGA 4KHPQ 1CUKA 3L7ZC 4KI0A 1GM5A 4P72A 1GKHA 3W1GA 4DR3Q 4BY1G 1HR0L 2MO0A 3BZKA 5M5YH 1Y1WG 1QVGA 1WOCA 3CCMA 3KJOA 1EWIA 2VQFQ 1VQMA 4X66Q 4IOCA 1Y1VG 1K73C 5H1SE 1HZCA 3HOXG 1K0RA 1RIPA 4GKJQ 4JG2A 4R4IA 1X54A 1IBKQ 2E2HH 4L5SA 4LF4L 2ZJQA 1VQAA 1Q1BA 2JK8A 4JI3L 3RNUA 2NVTH 4GS3A 3I4MG 3KOJA 1KIXA 2GVAA 4TVAB 1FVIA 4AYBE 3MEFA 3H0GH 3J81j 2VL6A 4UP8A 4X64L 5GAHC 2K75A 3RLNA 1Y1VH 1MJCA 2Q2IA 1CKOA 3PO3G 4LF6L 1SFOH 1A8VA 4DV0L 1YJWA 1VQ9A 2EIFA 1X65A 2Y0SE 4DK6C 4A3KH 3TRZA 4P73A 4GOPB 4A3GH 2WB1G 3L2PA 5HGQA 3K8AA 4OONA 1X6OA 3G71A 1HJPA 4A76A 4A3JH 1KD1C 2E8GA 3K80C 3PSIA 3NBHB 3A5UA 1QZGA 5C3EG 2PI2A 1L1OB 1S40A 4X62Q 3I56A 1HNWL 5IYDH 4R4QA 4DV6Q 1K8AC 2AHOB 1Q82C 1DGSA 3M9BA 1VQ4A 3ULLA 1PH8A 1D7QA 1RL2A 3PUVA 4JI3Q 3HOZG 2B29A 2B63H 3PIPA 3STBD 4A3BG 1OXUA 3I4MH 4OWWB 4A3JG 4ALPA 1Q12A 1I5FA 4IFDI 4LWCA 3CCLA 3M3YH 1PH3A 2K5NA 4OO1G 4B3SQ 1L2FA 1XPUA 4DV0Q 1OXTA 1YJ9A 4YWLA 3IRBA 1B7YB 3T1HL 4A93G 1J6QA 4YWKA 4JI5Q 2I0QA 3CQZH 4MTNA 4GKKL 3B6YA 5ELOA 4ME3A 4BY1H 1I3QH 1X55A 1BVSA 1PYBA 4Y52H 2YTXA 1XMQL 4IJHA 2OTJA 1TWCH 2PI2E 2AWNA 1N33Q 4A93H 2I5LX 3A5ZB 3HOXH 5C4JH 5FJ8H 3AEVA 2UUBQ 3JAMi 4A3EH 4JI4Q 3S1NH 2ZJRA 3AFQA 5JJKA 4A3IH 1XNRL 2BA1A 1PA6A 1JMCA 4R4TA 2NVQH 2AKWB 1Y1WH 2JA6H 4IFDJ 1UWVA 3UDGA 3H3VI 1PVOA 3KYHC 1K9MC 3S24A 1KAWA 1W2BA 2VS1A 1JJ2A 4RMFA 3PUZA 3I4NG 2L15A 4A3CG 2NVYH 4IJLA 1L1OC 1N32L 4C3IH 3GTOH 4BA1I 1JE5A 5J3BA 4JI5L 1D8LA 3BZCA 2WP8J 3KLWA 3ULJA 1I94L 2UUCQ 1Y14B 4LFAL 3M85A 1X56A 3ER0A 2B3GA 4JI0Q 1G6PA 4A3DG 1LM0A 1VQFA 4LF8L 2RF4A 3UDFA 5IY0A 5C44H 3D0FA 3LGJA 4XTCS 5LMUQ 3KFUA 1G51A 4JBJA 4O2DA 2I5HA 2YTYA 3GO5A 1KQSA 5GAEC 2CWPA 3G4SA 1VCIA 1G291 5M3FH 1Q81C 2D0PA 2PQAB 3PGZA 2Q2UA 1HZ9A 4PG3A 5E7NA 2OCEA 2RHSB 4DR4L 5EAYA 4JI7L 1E22A 2A1AA 1TWFH 1OXSC 3OW2A 1J5EL 2JEBI 2YTVA 4OX9L 4BBSH 4LFBQ 1M1KC 1N34L 1Q7YC 4HIMA 2VZAA 2I5MX 2Z0SA 3TEHB 1YIJA 4A3DH 4OO1I 3CF5A 3GDEA 4R1JA 4OXPA 2UUAL 4P74A 3KF8B 4PZ8A 4DR3L 1EUJA 3OYYA 3I55A 4JI4L 4DV7Q 4GNXA 1KC8C 2A8VA 1YBYA 2HT1A 2VNUD 3J80i 4YCVA 1U5KA 1VQIA 2R6GA 3AQQA 1XNQL 3AYHB 4UP7A 2DGYA 5GROA 4A3IG 2NN6I 1SROA 4DR7L 4LNQA 2N49A 4YY3Q 1MKHA 1UEBA 1BBWA 3GTQH 2VW9A 4EX5A 3T1HQ 1SMXA 1NJIC 2JA7H 4B3SL 5LMNL 3RR5A 4B3ML 1V9PA 2ZM6Q 1E1OA 4DV2Q 5LMUL 3CD6A 1UE6A 3JC66 4L5RC 1SE8A 1TWHH 2MO1A 3F2DA 2PNHA 1Q1EA 3PUYA 2ZJPA 2XGTA 3WWVA 1PH2A 1NTGA 1VQLA 5JEAJ 2BH8A 3UE1A 1VQCA 1BKBA 3TQYA 4R4CA 3E9HA 1P16A 4FDBA 5DLQE 4DV3L 2Q2HA 1P8LA 5IT9c 1XJVA 3S17H 3ULPA 2UXBL 4OX9Q 4LFBL 3I2ZA 3RZDH 2R7ZH 4AIMA 1YHQA 1N32Q 3I4OA 1XPRA 4JCVE 4DNIA 2OWOA 3HOUH 1TWGH 5BR8L 1YEZA 2KHIA 2R7FA 3UDXA 4DAMA 2OQKA 1JJCB 2CKZB 4JOIA 1VQ8A 3KJPA 1LUZA 4DKAC 3ICEA 4DV5Q 4LF7L 3CCRA 1EOVA 2KHJA 2ALYB 4KHZA 2F3IA 3OTOQ 5C0XI 4LF8Q 4JV5L 3J80c 4GKJL 1YJNA 3U58A 3UDIA 1UE1A 5JJLA 3SGIA 1VQ5A 1HR0W 4POGA 4HJ7A 4NXNQ 3CC4A 4BXXG 4DR4Q 2UXCL 4A3FH 1YZ6A 1V43A 3HOYH 5IYCH 1JJGA 1J5EQ 4A3EG 2FXQA 4NXMQ 4DR6L 3HOVG 2ID0A 2JQOA 3PO2G 3S16H 2WAQG 2NVXH 4JI6L 4A3GG 2D0OA 4DV2L 1T9HA 2NN6G 2JA8H 2UXDQ 1YVCA 2IHEA 2WFWA 1KRTA 3T1YL 3BU2A 1QVCA 2A19A 5K36G 4GLXA 1SLJA 2DUDA 2UU9L 3VDYA 2D62A 3CCVA 1X9NA 1U0LA 1XMQQ 4K0KL 1WFQA 1OXXK 1YHBA 2N3SA 2CFMA 3GTJH 4PZ7A 1IBKL 1L1OA 3GTMH 4JI1L 4DR7Q 5LMNW 5JEAG 1N9WA 2CWAA 4GN3B 1L0WA 1LTLA 2OTLA 1NY4A 2H5XA 3L0OA 4GOPA 2F4VL 2UXDL 1YI2A 2JA7G 5C3EH 1TXYA 2IX1A 3STBC 4A4IA 1N36L 4XIGS 1VQBA 2ATWA 1EQRA 2K50A 1NMGA 5LMNQ 4A3CH 2Y0SG 3H15A 3NENA 4DR2L 3M4PA 5IP7G 3PF5A 3TS0A 1ASYA 4DV4Q 1A62A 4C3JH 3G6EA 3CC7A 4MNOA 1GD7A 4NXNL 2R92G 4BY7G 4QY7A 1PH7A 4DR1Q 3S2HH 2C35B 3FKIH 4H02A 3J81c 2HQLA 1QVFA 2RHQB 4J15A 5M5WH 5IYCG 1OXVA 4AQYL 3PIOA 4DV3Q 3DM3A 3HOYG 1QUQB 2JE6I 4LF4Q 3A74A 1VQHA 2CCZA 5M3FG 2Z6KA 2HHHQ 2UUCL 4JBKA 3H3VH 1NE3A 2AMCB 2GN5A 3U50C 2R92H 4A3LH 3S14H 1TWAH 4BA2I 3U4ZA 1XPOA 4DUYQ 2JA8G 4DR5Q 5JJIA 1AE2A 3NEMA 1K8GA 1A0IA 3AFPA 2MNAA 1HNWQ 4WJ4A 4JV5Q 4QIWE 4B3TQ 1K83H 1C9OA 1HR0Q 4K0KQ 1HNXL 3G48A 4A3KG 3BJUA 4GLAC 4HJ9A 1HH2P 4HJAA 1E1TA 1EIFA 2E5LL 1FJGL 3HOZH 3F1ZA 2F52A 2UUBL 3U4VA 2KCMA 4DV1L 1CKMA 2N78A 1IYJB 4LW1A 4X62L 1WCMG 2R7ZG 4A3LG 3DLLA 3I4NH 2KBNA 1PHJA 1BBUA 2VQEQ 4JI8L 1SN8A 1KHIA 3RN5A 1YITA 2KENA 4AYBG 2MQHA 4KLKA 4R4OA 1PH4A 4UY8C 4MZ9A 1N36Q 2UXBQ 1HZBA 2N8NA 4GN4B 3K7UC 3CC2A 4HIDA 4JYAQ 4DUYL 4LFCQ 1QUQA 4A3MG 1VQEA 1IBML 1PFSA 1VQ7A 1UE7A 1NBWA 1H95A 4BBSG 1SR3A 2K52A 5IP7H 3PUWA 3CCUA 4YHHQ 3RN2A 2EXDA 2KCTA 1IBLL 3K81C 2WAQE 1Q8KA 4P75A 1M90C 3CCSA 3FKIG 3J81i 1XNRQ 4IO9A
chains in the Genus database with same CATH superfamily
2B2WA 1GO3E 2Q2TA 3SHLA 4LF9Q 3OW7A 5CR3A 3A56A 4HJ5A 4KY7A 4JYAL 3QIAA 4P71A 2NZOA 2N55A 4L5TA 2QF7A 4JI6Q 3A0JA 3GTJB 2OQ0A 1CSQA 2QGQA 4YHHL 4X3SA 2A6HD 5C4XB 4LFAQ 1VQJA 5BN5A 3Q8DA 5EGTA 5AJ3Q 4XT3B 2K03A 3FPPA 3J81L 1W6KA 4KKUA 3K57A 1W3SA 2EY6A 3AU7A 1YNXA 1HTLD 1IBMQ 4LAAA 4BXXH 1EOTA 1AN8A 3PO3H 1ZYRD 4DUZQ 3BDCA 3PMFA 3G7LA 4GLVB 4LF5Q 1PH6A 1PRTD 4AH6A 1STNA 2ZTEA 1Q86C 5M3MH 1GUGA 3U9SA 3S14B 3VR6A 4JOIC 3S1MH 4F8MA 1IL8A 4TSSA 2ASBA 3M4QA 1Z47A 4N8X1 1K28A 1ENAA 4KKTA 1IXRA 4LUVA 1AEXA 5E1FA 3GD7A 1U9RA 1RCVD 2A74C 2NVTB 2UU9Q 2X6GA 4ZRZA 1SJHD 4IFDH 3PCOB 4GN5A 2K14A 4O0AA 2JA9A 2B63H 3D31A 5C0XG 3TS2A 1D5MC 5CV6A 4A3GB 4YCWA 1C0AA 2J0TD 1UUPA 1E24A 4BY7H 4LF9L 2R93H 4DXGA 4DR6Q 3S1QH 4NP5A 3GTGB 2F0IA 3QO2A 1EL0A 2K7VA 2IX0A 2VUMB 1HA6A 3HOXB 4APVA 2RCNA 5BR8Q 3E0EA 1WYDA 2F0PA 3JAMc 1B50A 4TQUS 1CKNB 4CBVA 4DNTB 5LHY1 1AH9A 5FLMH 5M3MG 3URYA 2JSOA 4X66L 1X3FA 4ME5A 3CMAA 4B3TL 1IL2A 4ZQ3A 2ES2A 5D3DA 1XNQQ 1RHPA 3S15H 1G8ZD 1PV4A 4A93B 3K0YA 5IWAQ 3HOUG 4DAYB 1C7YA 4LF5L 1TY0A 4DUZL 4UP9A 4IPHA 5KIXA 2KEEA 2HD3A 4KK7A 2IY5B 4EQPA 3ERSX 2VQFL 2VQEL 2M9VA 5IYBG 1JOOA 5IGEA 4IFDG 5GADC 4L63B 1CKNA 1HRJA 1DCZA 4GOPC 1WTPA 1IZ6A 4IZ8A 3KDFA 4A3BH 3HKZG 2EY5A 3QG1A 5LL6S 1JE4A 1CSPA 1VQKA 1Q46A 2F0WA 3GTMB 3L7ZC 1ML0D 4XQQA 2XIWA 3CU7A 1DM0B 4CKBA 1VDZA 3KJOA 4IOCA 1EU4A 1K73C 5KYIA 1WTVA 5D3IB 4L5SA 4LF4L 1F2MA 1VQAA 1Q1BA 4GS3A 1A3VA 2EE1A 4C1NI 1KIXA 2BOSA 3I4MG 1DONA 2VL6A 4KMUC 5GAHC 3K5LA 4XYQA 3GTPB 2Q2IA 3KUPA 4IURA 4QF4A 1YJWA 2QW7A 1X65A 4GOPB 2NTSA 3K8AA 1X6OA 3G71A 1HJPA 3HS0C 4A76A 4A3JH 2E8GA 5C3EG 2PI2A 1S40A 3FRPB 4MN3A 1HNWL 5IYDH 1EEFD 2NZ1D 1K8AC 1Q82C 2A68C 1U4MA 3M9BA 1VQ4A 4RCOA 1D7QA 2O5IC 3PUVA 1SNOA 4JI3Q 2EYPA 3HOZG 3M4OB 4IFDI 1VMPA 1PLFA 3CCLA 4C3HB 3M3YH 1WTXA 2CH4W 3JAML 4YWLA 1B7YB 3I4NB 1CT1D 4JI5Q 4BY7B 3R2TA 4CDEC 5C3XA 1PTOC 3B6YA 1F77A 1XMQL 4KKSA 4IJHA 2Y0SB 1C48A 3ERQA 2NVXB 3HOXH 5C4JH 5FJ8H 4K6DA 2F1MA 1ET6A 2ZT9C 1QNKA 3MWYW 1S4ZA 4A3IH 2NVQH 4DAVA 4ZK9B 3UDGA 4RMFA 5CV9A 3RD4A 4C3IH 1PZKD 1D8LA 3KLWA 4S3SA 3ULJA 3WDNA 4DAPA 1X56A 4A3DG 2HDLA 3D0FA 3LGJA 4XTCS 1TS3A 5LMUQ 5CC4A 3C3LA 5BN4A 2I5HA 2MP1A 2CWPA 2QDLA 4PQXA 1VCIA 5JPNC 1AZQA 3PGZA 3TBIB 1IKMA 3H3VC 2R3ZA 5M5YB 4C3JB 2X69A 4BWGB 4OX9L 3K5OA 1N34L 3TEHB 1QCBD 2RSOA 1JORA 2A69C 1ZXTA 2UUAL 4P74A 1DZ1A 3T13A 5I9OA 3OYYA 4JI4L 1SSOA 4DV7Q 2A8VA 1MD2D 1TWAB 3AYHB 1ENCA 3X3NA 3SVMA 4A3IG 3AMUA 3BYTB 1JOQA 4EX5A 1SMXA 5FO8B 1FNUA 1RKNA 2B2VC 2CQAA 1F9QA 2NBFA 3J7AF 3RR5A 4B3ML 5IGFA 1LTGD 4L5RC 2R93B 3MHBA 2MO1A 3F2DA 2PNHA 3PUYA 2ZJPA 1JWMD 4GZYC 5CV7A 4OL7A 3TP5A 1B3AA 1UNSA 4DGZA 5JEAJ 1VMCA 3VYRA 3TQYA 1LTTD 5DLQE 3ULPA 1F2YA 1MSGA 3E6ZX 3SR1A 3D3RA 3RZDH 3I72A 4AIMA 1YHQA 4G57A 2DJFC 3KK7A 2FFKB 1O80A 3FDTA 1JJCB 5IT9E 2F4IA 3KJPA 1LUZA 4DKAC 3ICEA 3EFXD 1EOVA 3S1RB 2L55A 5CBEE 3DMUA 2VB3X 4POGA 4DXFA 4BXXG 2OF1A 1H9JA 1S5CD 1KAAA 1EY4A 3I8ZA 4NXMQ 4DR6L 2JQOA 2WAQG 4EQNA 2NVXH 4A3GG 3HG9A 2VXWA 2MUYA 2ZXOA 4HSVA 1WTOA 1D6EC 1K3BC 1D1IA 4IUUA 2WFWA 1KRTA 2A19A 2L0CA 3CCVA 1U0LA 4J1MA 2N3SA 4NMZA 3GTMH 2NYZD 1L1OA 2MGSA 4JI1L 1N9WA 4KJNA 1LTLA 3W3AA 2OTLA 5COYA 5EJWA 4QMGA 3L0OA 2KQ3A 1LTBD 3OPOA 2UXDL 2K6AA 2JA7G 3NQTA 1TXYA 3STBC 1PVOA 1YNND 1EQRA 3H15A 5IP7G 3PF5A 1KNEA 4HEDA 3K5MA 5LL6X 1A62A 1B53A 1QILA 4C3JH 4MNOA 3TP8A 2FMCA 1PH7A 3KLSA 3S2HH 2R92B 3SEBA 1EY0A 3J81c 2DY7A 2EOTA 3PIOA 5L37A 3FPUB 3W2DA 1LT5D 4A3JB 3J7YW 1KLGD 1Y69U 3OIPA 2VB2X 3R3OA 5M3FG 2UUCL 2M00A 1R9TB 1TWAH 1XPOA 2K32A 1I4QA 5M5WB 3NEMA 2J4XA 4YIJA 3SK6A 4ZKBB 1SNCA 2SNSA 2F52A 1SFOB 4DV1L 4PMBA 4A3LG 2R7ZG 3OOCA 3DLLA 3I4NH 2KBNA 1BBUA 5CV4A 3LWUA 5DNFA 3RN5A 1STYA 1L0XB 2UXBQ 1GHJA 4HIDA 4JYAQ 2FINB 1VQEA 3PO2B 3ND8A 4BBSG 1SBBB 2CW0C 2QKIC 2K52A 5IP7H 3PUWA 3IAYA 4YHHQ 3RZDB 4Q0FA 1X3PA 1Q8KA 3S16B 3DWQA 4N9TA 1XNRQ 2PNRC 1HFGA 3CRKC 1EQQA 1KL9A 2F0DA 1UE5A 1I3QB 4LUZA 1LV9A 5IP9H 2UXCQ 3GTLB 1NMFA 5JJZA 2HIXA 4JI2Q 3N52A 5C5LA 2G9HD 3V96A 3HKZB 2GVBA 1I94Q 1EFWA 1E7ZA 2SEBD 5JEAH 1WCMB 4HMIA 2IHFA 2F0FA 4JI8Q 2LMCB 1DXMA 3ZJYC 3LNNA 1AZPA 1VQGA 3H0GG 1EFID 4YY3L 1A2UA 2R93G 1X3GA 3S2DH 2WACA 1KRSA 1JWSD 4CKCA 1BCPD 5FOBB 4C2MH 4HIKA 2HIVA 5G3LF 3U9OA 1WD1A 3HOWG 3KF6B 2RDGA 5FLMG 1JT8A 3NBHA 3FP9A 3EVQA 3CCJA 2PZTA 3QOJA 1H9RA 1CQVA 3K58A 1F9PA 4F7XA 3S2HB 3KDFB 2JP1A 1F9RA 5JOBA 3CW2C 3MXNB 1N34Q 1FGUA 4OWXB 1E3PA 1PZJD 2QEXA 4DV5L 2HQEA 2JJQA 1PZID 1MJEA 4C56C 5AFWA 3EN2A 4ZLTF 2HUGA 3H09A 1CM9A 2R7DA 5C4ZA 3D4DA 4G7HC 4OIKA 2HCCA 3F2BA 1S72A 3CP0A 5E4XA 4X3KA 2PZWA 1HQMC 2E2IH 1I4RA 1X3EA 1XWEA 2PQAA 3S1RH 3M7NA 4JI7Q 2K05A 5ELNA 2F3VA 2K28A 3E9IA 2XTIA 4JI2L 2K33A 1V1QA 3IFDA 3DEOA 3NELA 3ZYYX 5ELCA 4A3FG 1KABA 1BO0A 1KXLA 3EBEA 2F0TA 1K3RA 1IKLA 1V1OA 4KN4C 4PMCA 3OTOL 3NBIA 5DM73 1RJTA 3EQLC 2IT1A 3S9WA 3CKIB 1BBXC 2ZXPA 4AYBB 2EY1A 5C4XH 1MIUA 1DJRD 4UAIA 3D4WA 2D2CC 4O42A 5D65A 2QA4A 2F0LA 1LTAD 1HNXQ 2LXJA 3KLRA 4Y7NH 2PW5A 4UPAA 2JA5G 2JEAI 1ENFA 4QJFA 1D5ZC 4EQ5A 1MSHA 4N8FA 2VY3A 3T1YQ 1XTDA 4RWSC 2RDFA 2JA8B 2KCNA 4XXEA 1SMYD 4LUOA 1ILQA 1MBYA 1TY2A 5I6YA 4CDCC 2A6ED 4BBRH 1K8MA 3M4YA 1WCMH 4FF4A 3DEPA 3VA7A 5M3MB 1CUKA 4KI0A 1GKHA 5C5MA 4DR3Q 1WTWA 3BZKA 3S2DB 1EWIA 3LX0A 5NUCA 4GKJQ 4R4IA 2EVBA 2ZJQA 4JI3L 1J9OA 2NVTH 1RDPD 3MZ5A 3J81j 2Z4HA 4UP8A 4DK1A 1Y1VH 3D6WA 3PO3G 1CKOA 2WKCA 4RGOS 1SFOH 1VQ9A 4FNFA 4P73A 4A3GH 4OONA 3K80C 3A5UA 3NBHB 4IN3A 1L1OB 1EWCA 3I56A 1A3TA 1GXDC 1H9MA 1DGSA 1AFPA 1YNJC 3PIPA 3HGBA 4A3BG 1GOZA 3I4MH 4ALPA 1Q12A 3NWTA 1EYDA 4LWCA 2A69D 4IALA 1PH3A 5G3LD 4DV0Q 1OXTA 1TS2A 4A93G 1U4LA 1O7YA 1EY5A 1HUMA 2I0QA 3HOYB 1LTRD 1I3QH 1X55A 4E6IA 1BVSA 1PYBA 2YTXA 3S15B 4DAYA 2RSNA 2PI2E 5HGTA 4A93H 3A5ZB 3AEVA 2IPKD 4A3EH 2AQ2B 2EYHA 1G91A 1HUNA 1JMCA 3HEJA 3KLSX 2AKWB 2JA6H 1RTOA 1H9SA 3H3VI 1W2BA 1B9MA 5C44B 3PUZA 4A3CG 2L15A 5CYUA 5FLXE 1KTKA 3BZCA 1E0BA 2WP8J 5KEEA 2B3GA 3A7LA 1V1PB 1TIID 4JBJA 3CRLC 5K5PA 2C9OA 2DNCA 1G291 5C3EB 5M3FH 2EYLA 4TKOB 2OCEA 1SNQA 4FVMA 5EAYA 5FLXL 1Q90A 1TWFH 5C0XH 5IGCA 1J5EL 2JEBI 2YTVA 4LFBQ 3VYUA 3FMCA 5JVG3 1Q7YC 5IOCA 2VZAA 2I5MX 2XRQD 3NPPA 1MGSA 1OO9B 4A3DH 4BBRB 3TSSA 4OO1I 4R1JA 4OXPA 5I6WA 5ELEA 1AW7A 1EUJA 3I55A 4GNXA 3NQIA 2VNUD 1M4VA 1QJOA 4YCVA 1VQIA 2R6GA 3AQQA 1XNQL 5EPKA 2DGYA 1F9SA 5CV8A 2IW3A 5GROA 1JWUD 2NN6I 4YY3Q 1GHKA 1UEBA 4F88A 1PFNA 5C4HA 2VW9A 1R4QB 1GUWA 2QDBA 1V9PA 1E1OA 4PNYA 3UI2A 4DV2Q 1UE6A 2E2DC 1NSNS 2Z1CA 2XGTA 2E2IB 4ODGA 3UE1A 1TS4A 1GUTA 1P16A 4FDBA 3P7JA 4L6TB 1GUOA 3MXNA 3SXHA 1JOKA 2R7ZH 1AP0A 2OWOA 4JCVE 2L5TA 1TKWB 4OHJA 4DAMA 2OQKA 2O4XA 1ZKOA 3I4MB 1VQ8A 1S5DD 4A3IB 1I6VC 2L1BA 4DV5Q 1QWYA 4N9PA 1QE6A 2HDMA 4K6LA 3J80c 4RAUC 3HOYH 1V43A 1LT6D 3JAME 3VR2A 3OHXC 1J5EQ 1MHWC 4A3EG 2FXQA 3PO2G 4JI6L 2JA8H 2UXDQ 1YVCA 4CJ1B 5D14A 1TR5A 4ZUIA 2JA6B 3KBGA 4NW2A 4RHRA 1QVCA 1STHA 1F2ZA 5K36G 1SLJA 5IIFA 1CZWA 1X9NA 4K0KL 1HPCA 3MXPA 1IW7D 1IBKL 1X32A 3I70A 3MAQA 2SOBA 2H1EA 1DYQA 5JEAG 2CWAA 1D2BA 2FMMA 1M8AA 2CW0D 1KDBA 1PDQA 4RGMA 5C3EH 5M3FB 1FNVA 5J1ZA 4LK1C 1N36L 1PTOF 2K50A 2Y0SG 1QG7A 2PCFB 1TWFB 1ASYA 3G6EA 2EJFC 4UDUC 4NXNL 2DN8A 2R92G 4DR1Q 5IGBA 2KHSA 4NKLA 4O1NA 3D8GA 3C1EA 1MI2A 2HQLA 1EIGA 1OXVA 5KNDA 3K5NA 3HOYG 2JE6I 1H9KA 5EPLA 5HURA 4LF4Q 3A74A 2HHHQ 3H3VH 4JBKA 3U50C 3HOZB 3PIO3 4K8JA 2JA8G 1JCKB 1A0IA 1NUCA 4LMQD 1KLUD 5ELBA 1K83H 1C9OA 2JA5B 3BJUA 4ID6A 5DAUA 1HH2P 1EIFA 3F1ZA 2UUBL 1ILPA 3U4VA 2N78A 1IYJB 4RHSA 1YITA 2XRSD 4R8IA 1BCPC 4MZ9A 3TDQA 4DUYL 1IBML 1PFSA 1XX8A 2F0HA 2L9HA 4A3EB 1UE7A 5I2YA 1SYGA 1O7ZA 2ICIA 1J8IA 2KCTA 1F2LA 1NCVA 3LWEA 1S5FD 2KOLA 1M90C 5FK9C 4B3TQ 1I4HA 1XMQQ 3HOVH 1T5EA 4HCEA 1LO5D 3CQZB 2Q8RE 3WOFA 1E2ZA 4GNXB 1S5ED 4HJ8A 1SRUA 1O78A 2MJ8A 2EJMA 5C0XJ 2CVRA 3HOWH 1HNZL 2F0GA 3MEHA 4B9WA 1V8QA 4FF2A 3GTKH 2LS01 1HZAA 1OTCA 1FL0A 3FHWA 2HCIA 1IBLQ 3KF6A 1Y8OB 2BA0A 3P75A 4I7AA 3J7ZC 3EA6A 4DPGA 1Q3LA 2AWOA 2OEOA 4CGYB 1VQNA 1VQOA 4DR1L 3DWPA 4A75A 4NPSA 3NP8A 4WRDA 4C1NK 5I2XA 4IUVA 3CHBD 1I6HH 1PH5A 2HHHL 3MTSA 2EDGA 4DFAA 3KF8A 4CJ0B 2F4VQ 3RUZA 1JB7A 3QOLA 2MFIA 4MTKA 1WTQA 1G2SA 4R8NA 2XVSA 3HFZB 5I4DA 3A7AB 2UUAQ 2YV5A 1R9TH 2RBMA 2KCCA 3DWAA 4RG1A 4NXML 1O7LA 1EYAA 3F8TA 4IPCA 1LYLA 4AQYQ 4KHPL 3ONAB 1ASZA 4IQZA 4EGVA 4IPDA 4EVOA 2G9DA 4JBWA 4L5QA 3TREA 2K4KA 3W5OA 5AJ3L 4PMWA 4LF7Q 4DR5L 4RCNA 4JI0L 3S1QB 2A6EC 1SJED 2BH2A 2R7ZB 4OO1H 4K2LA 4JI1Q 4B08A 4YCUA 4EQOA 1FJGQ 2E5LQ 4A3KB 3PO2H 1EYGA 3SK4A 3CPWA 4NB3A 3BS1A 1K83B 2JA5H 1ONLA 4V0BA 4FXGC 2A5HA 1HNZQ 2F0UA 4X6AH 4YWMA 4LF6Q 5IYDG 5IE8A 4GNXC 2PMZE 5C44G 1NNXA 3F2CA 1FNWA 4LFCL 2Z6KC 2DJGC 2WKDA 1G2TA 2EZVA 2QEJC 3GTGH 1PTOB 4DV6L 2VUMH 1TS5A 2K5HA 4POFA 1CQFA 5J39A 3OWEB 4BS9A 4X65L 3BZDB 5EBCA 5GAGC 3HZXA 5JPMC 2Q8IB 3I7FA 2F03A 4KTAA 4A3BB 1YNJD 2EQSA 2AUJD 1GUNA 1LACA 2E2JH 2EYFA 3DM1A 3RZOH 1WJJA 4WORA 1GVPA 2ICEC 1S5BD 1KNAA 4ZKCB 5IGGA 2PPBC 4C2MB 2WINB 5CGKA 1EIYB 3PF4A 3CAMA 4KHPQ 1PH1A 3RLFA 4DR2Q 4QCLA 3NK9A 1GM5A 2MO0A 4R9WA 3SDZA 1B9NA 4BBSB 3NTKA 4X66Q 4I65A 5H1SE 1HZCA 4PV1C 1XYIA 2JA7B 1K0RA 1RIPA 1SE4A 4JG2A 4XQJA 2E2HH 1IBKQ 3RNUA 3TN2A 4JK1C 2GVAA 4TVAB 4AYBE 1SXTA 2AUKA 2AQ1B 5FKAC 4X64L 5IGDA 1BDOA 3RLNA 4IUTA 1EEID 4LF6L 1A8VA 4DV0L 2EIFA 4DK6C 4IUQA 5CBAE 1RD9D 3PSIA 4L8JA 3Q24A 3GQBA 1TVXA 3BVZA 4X62Q 4DV6Q 2AHOB 3IFTA 1PH8A 2A6HC 4K5XA 2EYMA 2EXZA 3STBD 4A3JG 4OGQC 1CHPD 1I5FA 4QUFA 2K5NA 1HHVA 2FHTA 1L2FA 4B3SQ 1XTCD 3V2TA 5KRUA 1YJ9A 3IRBA 1XPUA 3T1HL 1PYWD 1J6QA 2I07B 3E5SA 1SYDA 3CQZH 1SE3A 3HP3A 2NVQB 4Y52H 2KEDA 5ELDA 1LABA 2I5LX 2UUBQ 4C3IB 4FO2A 4JI4Q 3GTKB 5JJKA 3AFQA 2XWBB 1XNRL 1PA6A 4R4TA 2K1BA 4IFDJ 1UWVA 3KYHC 1JR0D 1KAWA 3S24A 1JJ2A 5A2QE 1DOLA 1HQRD 1N32L 2L4NA 1JE5A 1BR9A 3Q0AA 1V1PA 4LFAL 2SNMA 1Y14B 3M85A 2L12A 1G6PA 4QUCA 2K01A 4IUNA 2KVMA 5IY0A 4KD4A 3PIP3 1KQSA 5GAEC 3FVQA 2E74C 1T5XD 1Q81C 2PQAB 1HZ9A 2IL8A 4PG3A 2WAQB 2RHSB 4DR4L 2RKSA 4JI7L 1E22A 2A1AA 3OW2A 2E2JB 3A54A 4HIMA 5ISRA 4CDFC 1K0SA 4HR7B 4F87A 1QOHA 2IJ0A 2EPBA 4UHVA 1YIJA 3CF5A 3VR5A 2K5WA 2B2YA 1I4XA 4DF7A 3KF8B 4PZ8A 1YBYA 2HT1A 1Y1VB 3AB9A 4G4KA 1SNMA 4UP7A 4XT1B 4U68A 1HTPA 4DR7L 4LNQA 1MKHA 2IWHA 1BBWA 2NB0A 1BCPB 3T1HQ 1NJIC 2JA7H 1H9SB 4B3SL 5LMNL 3J80L 2E2HB 2D9UA 5LMUL 3JC66 3TZDA 1TWHH 3A8IE 2ENBA 3Q22A 2LFNA 1Q1EA 5ELFA 1TQOA 2GA4B 5EKIA 1RF2D 1VQLA 1EQVA 2BH8A 1VQCA 1BKBA 3E9HA 4DV3L 4IOAA 1XJVA 2F3WA 2Q2HA 4OX9Q 4NDXA 2JN4A 1PTOH 1N32Q 1XPRA 3HOUH 1GJXA 1TWGH 5BR8L 1YEZA 1B1ZA 2KHIA 2R7FA 1WTRA 4JOIA 4LF7L 3MFGA 3NHHA 2KHJA 5JVH3 3TP7A 4JV5L 5C0XI 4IUPA 4GKJL 1YJNA 3U58A 1RODA 2BE5C 4CDDC 2RQXA 1HR0W 4KY6A 1VQ5A 5M9OA 4DR4Q 4J6HA 2UXCL 4A3FH 3BG3A 3SK5A 4K5VA 1JJGA 2KECA 2KUMA 3HOVG 2ID0A 5T1IA 2PMZB 1T9HA 3RZOB 4C3JG 3J81E 3OMCA 3DUZA 2IHEA 4OIJA 1STBA 1CK1A 1FR3A 3BU2A 4H44C 4RGNA 2DUDA 2KJXA 2UU9L 3VDYA 2OT2A 5M5XB 1DD2A 1E2VA 4RA8A 1NR2A 1YHBA 3GTJH 3KBXA 2B2VA 4PZ7A 1CFMA 4DR7Q 2B2YC 2CHBD 5LMNW 1L0WA 4ABNA 2A68D 4GOPA 1A3UA 1EWHA 1A6XA 5DEHA 2LKVA 4Z9CB 2IX1A 4ZCKA 4A4IA 4XIGS 1VQBA 2OXPA 4DN4M 5LMNQ 1NMGA 4A3CH 2UXBL 1EY8A 3M4PA 4H13C 1FYCA 1II3A 4DV4Q 1D5XC 4ZYSA 2PO4A 3CC7A 2F0OA 4BY7G 4MHEA 2N88A 2JXMB 2C35B 4H02A 5EKLA 3T51B 3MXUA 1PTOD 1QVFA 2RHQB 4KD3A 5M5WH 1SNPA 5IYCG 4DV3Q 3DM3A 3H94A 1EY6A 2F0QA 4KJOA 1EZ6A 1D1KA 1VQHA 3ND9A 2CCZA 2Z6KA 3K59A 1NE3A 4RKBA 2R92H 3S14H 1BOSA 4BA2I 4DUYQ 3S1MB 5JJIA 1K8GA 3I4LA 4KV6A 2MNAA 3IKJA 1HNWQ 1LLRD 4WJ4A 4JV5Q 4QIWE 3H0GB 4QIWB 3G48A 4GLAC 4B9XA 4HJAA 5BN3A 3M7GA 2KCMA 1BNZA 1CKMA 1B2TA 2ZXRA 2VQEQ 2O2LD 2F0KA 4JI8L 1SN8A 1KHIA 1IYUA 1PH4A 4DK0A 4UY8C 2K04A 2N8NA 3K7UC 3CC2A 3IL8A 1QUQA 4A3MG 1CA5A 5K36H 2R61A 2E76C 1SYFA 5FO9B 1VQ7A 1NBWA 1H95A 1KDCA 2Z6BA 3C1FA 3T4AC 2M2LA 2E75C 2X6LA 3RN2A 3CCUA 1IBLL 3K81C 4U673 2WAQE 4P75A 1PFMA 3FKIG 3J81i 1PFBA 3G6JB 2D5DA 1GUSA 1STEA 2WB1E 1UAPA 4M1UB 4CJ2C 1WVLA 2V4DA 3HRZC 1ET9A 1TU2B 3I90A 1VQDA 1XXGA 4OEMB 4DA2A 2K5QA 5GQOA 4B3RL 3VA5A 4DV4L 1B70B 4JC0A 5IP9G 3GTLH 4DV1Q 4DNRB 1Z9FA 3GV6A 2FJ2A 2A73B 5FLXc 1HA5A 1Y8NB 1K8OA 4QQBX 3C46A 1JICA 1SYEA 4HIOA 2C5CA 3TMEA 4TRDA 3OWFA 1UEAB 2PQEA 2YYZA 2YU9H 1PRTF 1CHQD 3A8JE 1HCZA 2ZM6L 1YHAA 4A3MH 1SE2A 1S3OA 1VQPA 5TSSA 5CMDA 4HCSA 2G5DA 3DXJC 2RVLA 4OELB 3GV3A 4QB4A 2K5VA 1KDAA 1VS0A 3BVGA 3PV0A 3K7AH 1XMOL 2VUMG 4K2KA 1Z7TA 1Q8IA 3H6MA 1N8RC 3J7AV 1B8AA 1VQ6A 4BBRG 2LSSA 3NUCA 1A15A 4OWTB 5T1GA 1JQYD 4B3MQ 3D4RA 3R8BA 1NR4A 4ILWA 1PRTB 3Q6SA 4QGUA 2NWGA 4Q5VA 3BYYB 4J8QA 3GTQB 2PW7A 3GTPH 3K0XA 2V1CC 3W1BA 1L0YB 3I3CA 2EYOA 2LXKA 5IYBH 3GTOH 3E0JA 1QZHA 5FJ8G 2JYOA 4K8IA 4FXKC 2B2UA 4PZ6A 3A8KE 4KN7C 4DK3C 3CPFA 3GP7A 4QL5A 1ICWA 2P5ZX 4X65Q 3CCEA 1AE3A 5FO7B 3PUXA 3HOVB 4HAEA 2B8FA 3J7A5 1O7IA 3S1NB 3EIVA 3M4OH 4B3RQ 2PYKA 1BF4A 2ZTDA 3L3OC 4C3HH 3M3YB 3PQIA 1SYCA 1ZYRC 2NVYB 1YNNC 1TT2A 3HOWB 4WJ3M 3UE0A 4DV7L 3CMEA 1EIHA 1PRTC 2BDOA 2CQOA 4FF3A 4Y7NB 4V190 3HKSA 4WJWA 1PH9A 5C4JB 4JBMA 5M5XH 5JAVA 2KA7A 1I50H 4H7BA 3CCQA 2NZHA 2ZTCA 3HKZE 5C4XG 4GKKQ 1I6HB 2B63G 1WTHA 3OMGA 4K14A 4FP5D 1N33L 3RLOA 1PYSB 2RDHA 1E2WA 4RFBA 4XDXA 1XMOQ 1WI5A 3S17B 4FYDA 1G6ZA 4CHTB 2JA6G 1C4QA 1HXYD 5CORA 2XWJB 1A63A 1I4PA 4X64Q 5HY6A 5IWAL 3NWSA 3CXCA 4IPGA 4M8AA 2TSSA 4P72A 3SK8A 3W1GA 5DM63 1QB5D 3I73A 4BY1G 1HR0L 5M5YH 1Y1WG 1QVGA 1WOCA 1JC7A 1STAA 3CCMA 2VQFQ 1VQMA 2YU9B 1Y1VG 3NTIA 3HOXG 4A3MB 4RKLA 1ESRA 1X3QA 1X54A 3QB3A 2Z9HA 5A35A 2JK8A 3VR4A 1IHZA 3KOJA 1EU3A 1FVIA 3MEFA 3H0GH 1EQTA 1ICFB 2K75A 1MJCA 1Y8PB 4JVZA 2Y0SE 2B2UC 4A3KH 3TRZA 1IW7C 1CZGA 2WB1G 4LJZC 5HGQA 2F0JA 3L2PA 1RTNA 4MIUA 2AQ3B 1KD1C 3NE5B 2CH4A 4KY5A 1QZGA 3R2IA 2B2TC 4R4QA 5EQ0A 5KNCA 3R93A 3ULLA 1RL2A 2B29A 4HTHA 1OXUA 5CV5A 3OIQA 4OWWB 4P2CB 1ESFA 3K6OA 4X3UA 4OO1G 3BDLA 2PZUA 3VYTA 4C3IG 1BXTA 5C6AA 4YWKA 4XQNA 3MC0B 4MTNA 2SDFA 3C2PA 1HFNA 4GKKL 5ELOA 4ME3A 4BY1H 3ITPA 2OTJA 1DOMA 1TWCH 2AWNA 5F2DA 1N33Q 1BQQT 3MVVA 3JAMi 3QR8A 3S1NH 1PMRA 2ZJRA 1SAPA 4FXDA 2BA1A 3A55A 3SE0A 1Y1WH 1K9MC 2VS1A 4HN7A 3I4NG 1SYBA 2NVYH 4IJLA 1L1OC 5KGUA 2WIIB 1DOKA 4BA1I 1W6JA 5J3BA 4JI5L 2UUCQ 2NUCA 4HMJA 1I94L 4RGTA 3ER0A 4JI0Q 1LM0A 1VQFA 3H91A 4LF8L 2RF4A 2DY8A 3UDFA 5C44H 3KFUA 1Z6HA 1G51A 4O2DA 2EYJA 2YTYA 1CTMA 3GO5A 3G4SA 1I50B 2D0PA 2Q2UA 1FD7D 5E7NA 3QWNA 4A3DB 2WB1B 2TMPA 1I4GA 1OXSC 2NTTA 4K5WA 4BBSH 1A2TA 1M1KC 2F0VA 3K7AB 2Z0SA 3FKIB 2BE5D 4X3TA 2I46A 3GDEA 1B44D 1FGBD 4DR3L 2RCFA 5I9PA 3TP6A 1KC8C 3P20A 3J80i 3V05A 1U5KA 1LTSD 2F0SA 5EPJA 1SROA 2N49A 2Q8TA 4ULLA 2K5DA 3RMHA 3GTQH 1EY7A 1QNUA 3P1HA 1SEBD 3BDOA 3FEWX 3GTOB 2ZM6Q 4JW0A 2B39A 2XSCA 3CD6A 2F0MA 1SE8A 2Z8LA 5E3FA 3WWVA 5E4WC 1PH2A 1NTGA 1B4OA 3VYSA 4FF1A 1STGA 4R4CA 3S17H 4RH6A 1P8LA 1PXUA 5IT9c 3VR3A 4LFBL 3I2ZA 3I4OA 5KNBA 4DNIA 1SMYC 4G7OC 3UDXA 2Z4IA 2B2TA 3EJIA 2CKZB 2RA4A 1JB3A 3L9AX 3I91A 2J7ZA 2QCPX 3CCRA 2EY2A 4LF8Q 2ALYB 4KHZA 2F3IA 3MA2B 3OTOQ 1CA6A 2EJGC 2BDNA 5J22A 3N6RA 4JPBW 3UDIA 1UE1A 4CKEA 5JJLA 3NXWA 3SGIA 4HJ7A 4NXNQ 3CC4A 1YZ6A 3DHQA 5IYCH 4BY1B 1C8CA 2MHVA 4ZAIA 3S16H 1TWCB 2D0OA 2DNEA 4DV2L 1U4PA 2NN6G 1WD0A 1ZEQX 4DU9A 4KHVA 3T1YL 4GLXA 2D62A 2F0NA 1EZ8A 1LT3D 1OXXK 1WFQA 2CFMA 3PO3B 1SDFA 3O13A 3QJYA 4I7ZC 4GN3B 1LT4D 1U4RA 1B3QA 3MFYA 1CI3M 1EYCA 1NY4A 2H5XA 3J80E 2F4VL 2B2WC 1YI2A 2L11A 3E3XA 2O5JC 2ATWA 3T16A 3BVMA 3NENA 4DR2L 5EBDA 3TS0A 1GD7A 4H0LC 3F2UA 4QY7A 1EY9A 2XN9C 2H4OA 3FKIH 1BUVT 4J15A 4AQYL 1SNDA 4XYOA 3X3MA 1QUQB 1TWHB 2QILA 2B8GA 1VF7A 2LY7A 4G7ZC 1VF5C 1LTID 2AMCB 2GN5A 4HSPA 4A3LH 3U4ZA 4C3HG 3NTHA 2NN6H 2B63B 4DR5Q 1AE2A 3AFPA 2WV6D 3MXGA 1HR0Q 4K0KQ 1HNXL 4A3KG 2MPMA 4HJ9A 1E1TA 5IODA 2E5LL 3WOEA 1FJGL 3HOZH 3HOUB 3Q23A 1TWGB 4LW1A 3NSWA 4X62L 1WCMG 2IX3A 1PHJA 5C3WA 3D6CA 1IYVA 2KENA 1R4PB 4AYBG 2MQHA 5IT9L 4KLKA 4R4OA 1N36Q 1HZBA 4GN4B 3EROA 2F0EA 4LFCQ 4ZUJA 5KYLA 3T53B 5A2QL 1BCPF 5EKKA 3TZUA 4A3FB 1SR3A 2BCOA 2EXDA 1Y1WB 3T56B 4WFN3 1NAPA 3CCSA 2XNAC 3OSOA 4IO9A
chains in the Genus database with same CATH topology
3HOVH 1GO3E 2Q2TA 2WB1E 1EQQA 1KL9A 4GNXB 4HJ8A 1UE5A 1SRUA 4LUZA 4LF9Q 5IP9H 2UXCQ 4HJ5A 4JYAL 5C0XJ 1NMFA 3HOWH 1HNZL 4P71A 2NZOA 2HIXA 4L5TA 1VQDA 4JI2Q 3GTKH 4JI6Q 1HZAA 1OTCA 3A0JA 2OQ0A 1FL0A 3FHWA 1CSQA 5GQOA 4B3RL 2QGQA 4YHHL 3KF6A 4DV4L 1B70B 4JC0A 1IBLQ 2BA0A 2GVBA 4LFAQ 1E7ZA 1I94Q 1EFWA 1VQJA 5IP9G 3J7ZC 3Q8DA 5AJ3Q 4DV1Q 3GTLH 1Z9FA 2IHFA 4DPGA 2AWOA 4JI8Q 5FLXc 1VQNA 1VQOA 4DR1L 3ZJYC 4A75A 4QQBX 4NPSA 1VQGA 3H0GG 4YY3L 2R93G 4HIOA 1X3GA 1W3SA 3S2DH 1YNXA 1I6HH 1IBMQ 4BXXH 1KRSA 1PH5A 2YYZA 2YU9H 2HHHL 2ZM6L 3PO3H 1YHAA 4A3MH 2F4VQ 1S3OA 1VQPA 4DUZQ 1JB7A 4LF5Q 4GLVB 2MFIA 4C2MH 4HIKA 1PH6A 2HIVA 4AH6A 2ZTEA 1Q86C 2K5VA 1VS0A 3HFZB 3PV0A 3KF6B 5M3MH 3HOWG 2UUAQ 3K7AH 1XMOL 2YV5A 5FLMG 1R9TH 2VUMG 1JT8A 1N8RC 4JOIC 3S1MH 3FP9A 4RG1A 1B8AA 3CCJA 4NXML 2ASBA 1VQ6A 3M4QA 1Z47A 4BBRG 2LSSA 3F8TA 1IXRA 4IPCA 1LYLA 4LUVA 4OWTB 4AQYQ 4KHPL 4B3MQ 1ASZA 3KDFB 4IPDA 3CW2C 3MXNB 3GD7A 4JBWA 4L5QA 1N34Q 3TREA 1FGUA 2K4KA 3W5OA 4QGUA 4OWXB 1E3PA 5AJ3L 2QEXA 2UU9Q 4PMWA 4DV5L 4LF7Q 2JJQA 4DR5L 1MJEA 4JI0L 3EN2A 3GTPH 2BH2A 3K0XA 2V1CC 3W1BA 2R7DA 4IOAA 4JI1Q 5IYBH 2LXKA 3PCOB 2K14A 4GN5A 2JA9A 4O0AA 3D31A 4YCUA 5FJ8G 5C0XG 3F2BA 1S72A 1QZHA 2E5LQ 1FJGQ 3PO2H 3TS2A 4YCWA 3CP0A 1EYGA 4BY7H 1E24A 1C0AA 4LF9L 2R93H 3CPWA 4NB3A 4DR6Q 2JA5H 4PZ6A 3S1QH 4DK3C 2E2IH 1X3EA 3CPFA 2PQAA 3S1RH 1HNZQ 4QL5A 3M7NA 4JI7Q 4YWMA 5ELNA 4X6AH 4LF6Q 5IYDG 4X65Q 3CCEA 2IX0A 5IE8A 4GNXC 1AE3A 2PMZE 3E9IA 4APVA 5C44G 3PUXA 2XTIA 3F2CA 4JI2L 2RCNA 5BR8Q 3J7A5 1O7IA 4LFCL 3E0EA 1V1QA 1WYDA 3EIVA 3JAMc 2Z6KC 3M4OH 3NELA 4B3RQ 4TQUS 1CKNB 2ZTDA 3GTGH 4C3HH 4A3FG 4DV6L 1AH9A 5FLMH 3EBEA 2VUMH 4WJ3M 1KXLA 1K3RA 3OTOL 2K5HA 5M3MG 3UE0A 4X66L 1X3FA 4DV7L 4POFA 3CMAA 3CMEA 2CQOA 2IT1A 4B3TL 1IL2A 2ES2A 1XNQQ 5C4XH 1MIUA 3S15H 3HKSA 4X65L 1PV4A 1PH9A 4JBMA 5GAGC 5M5XH 5IWAQ 3HOUG 1I50H 4DAYB 3CCQA 2QA4A 1C7YA 2NZHA 2LXJA 3I7FA 1HNXQ 2ZTCA 4LF5L 4DUZL 4Y7NH 3HKZE 4UPAA 4UP9A 4IPHA 2JA5G 2JEAI 2EQSA 5C4XG 4GKKQ 4QJFA 2IY5B 4EQ5A 3ERSX 2VY3A 3T1YQ 1XTDA 2E2JH 2VQFL 2VQEL 1WJJA 2B63G 3RZOH 5IYBG 1N33L 4IFDG 5GADC 1CKNA 1GVPA 3RLOA 1PYSB 4LUOA 4GOPC 1XMOQ 1IZ6A 1WI5A 3KDFA 4A3BH 3HKZG 2JA6G 4BBRH 1WCMH 1EIYB 1A63A 3PF4A 1CSPA 1VQKA 3CAMA 4X64Q 5HY6A 1Q46A 5IWAL 1PH1A 3RLFA 3CXCA 4DR2Q 4IPGA 4KHPQ 1CUKA 3L7ZC 4KI0A 1GM5A 4P72A 1GKHA 3W1GA 4DR3Q 4BY1G 1HR0L 2MO0A 3BZKA 5M5YH 1Y1WG 1QVGA 1WOCA 3CCMA 3KJOA 1EWIA 2VQFQ 1VQMA 4X66Q 4IOCA 1Y1VG 1K73C 5H1SE 1HZCA 3HOXG 1K0RA 1RIPA 4GKJQ 4JG2A 4R4IA 1X54A 1IBKQ 2E2HH 4L5SA 4LF4L 2ZJQA 1VQAA 1Q1BA 2JK8A 4JI3L 3RNUA 2NVTH 4GS3A 3I4MG 3KOJA 1KIXA 2GVAA 4TVAB 1FVIA 4AYBE 3MEFA 3H0GH 3J81j 2VL6A 4UP8A 4X64L 5GAHC 2K75A 3RLNA 1Y1VH 1MJCA 2Q2IA 1CKOA 3PO3G 4LF6L 1SFOH 1A8VA 4DV0L 1YJWA 1VQ9A 2EIFA 1X65A 2Y0SE 4DK6C 4A3KH 3TRZA 4P73A 4GOPB 4A3GH 2WB1G 3L2PA 5HGQA 3K8AA 4OONA 1X6OA 3G71A 1HJPA 4A76A 4A3JH 1KD1C 2E8GA 3K80C 3PSIA 3NBHB 3A5UA 1QZGA 5C3EG 2PI2A 1L1OB 1S40A 4X62Q 3I56A 1HNWL 5IYDH 4R4QA 4DV6Q 1K8AC 2AHOB 1Q82C 1DGSA 3M9BA 1VQ4A 3ULLA 1PH8A 1D7QA 1RL2A 3PUVA 4JI3Q 3HOZG 2B29A 2B63H 3PIPA 3STBD 4A3BG 1OXUA 3I4MH 4OWWB 4A3JG 4ALPA 1Q12A 1I5FA 4IFDI 4LWCA 3CCLA 3M3YH 1PH3A 2K5NA 4OO1G 4B3SQ 1L2FA 1XPUA 4DV0Q 1OXTA 1YJ9A 4YWLA 3IRBA 1B7YB 3T1HL 4A93G 1J6QA 4YWKA 4JI5Q 2I0QA 3CQZH 4MTNA 4GKKL 3B6YA 5ELOA 4ME3A 4BY1H 1I3QH 1X55A 1BVSA 1PYBA 4Y52H 2YTXA 1XMQL 4IJHA 2OTJA 1TWCH 2PI2E 2AWNA 1N33Q 4A93H 2I5LX 3A5ZB 3HOXH 5C4JH 5FJ8H 3AEVA 2UUBQ 3JAMi 4A3EH 4JI4Q 3S1NH 2ZJRA 3AFQA 5JJKA 4A3IH 1XNRL 2BA1A 1PA6A 1JMCA 4R4TA 2NVQH 2AKWB 1Y1WH 2JA6H 4IFDJ 1UWVA 3UDGA 3H3VI 1PVOA 3KYHC 1K9MC 3S24A 1KAWA 1W2BA 2VS1A 1JJ2A 4RMFA 3PUZA 3I4NG 2L15A 4A3CG 2NVYH 4IJLA 1L1OC 1N32L 4C3IH 3GTOH 4BA1I 1JE5A 5J3BA 4JI5L 1D8LA 3BZCA 2WP8J 3KLWA 3ULJA 1I94L 2UUCQ 1Y14B 4LFAL 3M85A 1X56A 3ER0A 2B3GA 4JI0Q 1G6PA 4A3DG 1LM0A 1VQFA 4LF8L 2RF4A 3UDFA 5IY0A 5C44H 3D0FA 3LGJA 4XTCS 5LMUQ 3KFUA 1G51A 4JBJA 4O2DA 2I5HA 2YTYA 3GO5A 1KQSA 5GAEC 2CWPA 3G4SA 1VCIA 1G291 5M3FH 1Q81C 2D0PA 2PQAB 3PGZA 2Q2UA 1HZ9A 4PG3A 5E7NA 2OCEA 2RHSB 4DR4L 5EAYA 4JI7L 1E22A 2A1AA 1TWFH 1OXSC 3OW2A 1J5EL 2JEBI 2YTVA 4OX9L 4BBSH 4LFBQ 1M1KC 1N34L 1Q7YC 4HIMA 2VZAA 2I5MX 2Z0SA 3TEHB 1YIJA 4A3DH 4OO1I 3CF5A 3GDEA 4R1JA 4OXPA 2UUAL 4P74A 3KF8B 4PZ8A 4DR3L 1EUJA 3OYYA 3I55A 4JI4L 4DV7Q 4GNXA 1KC8C 2A8VA 1YBYA 2HT1A 2VNUD 3J80i 4YCVA 1U5KA 1VQIA 2R6GA 3AQQA 1XNQL 3AYHB 4UP7A 2DGYA 5GROA 4A3IG 2NN6I 1SROA 4DR7L 4LNQA 2N49A 4YY3Q 1MKHA 1UEBA 1BBWA 3GTQH 2VW9A 4EX5A 3T1HQ 1SMXA 1NJIC 2JA7H 4B3SL 5LMNL 3RR5A 4B3ML 1V9PA 2ZM6Q 1E1OA 4DV2Q 5LMUL 3CD6A 1UE6A 3JC66 4L5RC 1SE8A 1TWHH 2MO1A 3F2DA 2PNHA 1Q1EA 3PUYA 2ZJPA 2XGTA 3WWVA 1PH2A 1NTGA 1VQLA 5JEAJ 2BH8A 3UE1A 1VQCA 1BKBA 3TQYA 4R4CA 3E9HA 1P16A 4FDBA 5DLQE 4DV3L 2Q2HA 1P8LA 5IT9c 1XJVA 3S17H 3ULPA 2UXBL 4OX9Q 4LFBL 3I2ZA 3RZDH 2R7ZH 4AIMA 1YHQA 1N32Q 3I4OA 1XPRA 4JCVE 4DNIA 2OWOA 3HOUH 1TWGH 5BR8L 1YEZA 2KHIA 2R7FA 3UDXA 4DAMA 2OQKA 1JJCB 2CKZB 4JOIA 1VQ8A 3KJPA 1LUZA 4DKAC 3ICEA 4DV5Q 4LF7L 3CCRA 1EOVA 2KHJA 2ALYB 4KHZA 2F3IA 3OTOQ 5C0XI 4LF8Q 4JV5L 3J80c 4GKJL 1YJNA 3U58A 3UDIA 1UE1A 5JJLA 3SGIA 1VQ5A 1HR0W 4POGA 4HJ7A 4NXNQ 3CC4A 4BXXG 4DR4Q 2UXCL 4A3FH 1YZ6A 1V43A 3HOYH 5IYCH 1JJGA 1J5EQ 4A3EG 2FXQA 4NXMQ 4DR6L 3HOVG 2ID0A 2JQOA 3PO2G 3S16H 2WAQG 2NVXH 4JI6L 4A3GG 2D0OA 4DV2L 1T9HA 2NN6G 2JA8H 2UXDQ 1YVCA 2IHEA 2WFWA 1KRTA 3T1YL 3BU2A 1QVCA 2A19A 5K36G 4GLXA 1SLJA 2DUDA 2UU9L 3VDYA 2D62A 3CCVA 1X9NA 1U0LA 1XMQQ 4K0KL 1WFQA 1OXXK 1YHBA 2N3SA 2CFMA 3GTJH 4PZ7A 1IBKL 1L1OA 3GTMH 4JI1L 4DR7Q 5LMNW 5JEAG 1N9WA 2CWAA 4GN3B 1L0WA 1LTLA 2OTLA 1NY4A 2H5XA 3L0OA 4GOPA 2F4VL 2UXDL 1YI2A 2JA7G 5C3EH 1TXYA 2IX1A 3STBC 4A4IA 1N36L 4XIGS 1VQBA 2ATWA 1EQRA 2K50A 1NMGA 5LMNQ 4A3CH 2Y0SG 3H15A 3NENA 4DR2L 3M4PA 5IP7G 3PF5A 3TS0A 1ASYA 4DV4Q 1A62A 4C3JH 3G6EA 3CC7A 4MNOA 1GD7A 4NXNL 2R92G 4BY7G 4QY7A 1PH7A 4DR1Q 3S2HH 2C35B 3FKIH 4H02A 3J81c 2HQLA 1QVFA 2RHQB 4J15A 5M5WH 5IYCG 1OXVA 4AQYL 3PIOA 4DV3Q 3DM3A 3HOYG 1QUQB 2JE6I 4LF4Q 3A74A 1VQHA 2CCZA 5M3FG 2Z6KA 2HHHQ 2UUCL 4JBKA 3H3VH 1NE3A 2AMCB 2GN5A 3U50C 2R92H 4A3LH 3S14H 1TWAH 4BA2I 3U4ZA 1XPOA 4DUYQ 2JA8G 4DR5Q 5JJIA 1AE2A 3NEMA 1K8GA 1A0IA 3AFPA 2MNAA 1HNWQ 4WJ4A 4JV5Q 4QIWE 4B3TQ 1K83H 1C9OA 1HR0Q 4K0KQ 1HNXL 3G48A 4A3KG 3BJUA 4GLAC 4HJ9A 1HH2P 4HJAA 1E1TA 1EIFA 2E5LL 1FJGL 3HOZH 3F1ZA 2F52A 2UUBL 3U4VA 2KCMA 4DV1L 1CKMA 2N78A 1IYJB 4LW1A 4X62L 1WCMG 2R7ZG 4A3LG 3DLLA 3I4NH 2KBNA 1PHJA 1BBUA 2VQEQ 4JI8L 1SN8A 1KHIA 3RN5A 1YITA 2KENA 4AYBG 2MQHA 4KLKA 4R4OA 1PH4A 4UY8C 4MZ9A 1N36Q 2UXBQ 1HZBA 2N8NA 4GN4B 3K7UC 3CC2A 4HIDA 4JYAQ 4DUYL 4LFCQ 1QUQA 4A3MG 1VQEA 1IBML 1PFSA 1VQ7A 1UE7A 1NBWA 1H95A 4BBSG 1SR3A 2K52A 5IP7H 3PUWA 3CCUA 4YHHQ 3RN2A 2EXDA 2KCTA 1IBLL 3K81C 2WAQE 1Q8KA 4P75A 1M90C 3CCSA 3FKIG 3J81i 1XNRQ 4IO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV H;  1GO3 E;  2Q2T A;  2WB1 E;  1EQQ A;  1KL9 A;  4GNX B;  4HJ8 A;  1UE5 A;  1SRU A;  4LUZ A;  4LF9 Q;  5IP9 H;  2UXC Q;  4HJ5 A;  4JYA L;  5C0X J;  1NMF A;  3HOW H;  1HNZ L;  4P71 A;  2NZO A;  2HIX A;  4L5T A;  1VQD A;  4JI2 Q;  3GTK H;  4JI6 Q;  1HZA A;  1OTC A;  3A0J A;  2OQ0 A;  1FL0 A;  3FHW A;  1CSQ A;  5GQO A;  4B3R L;  2QGQ A;  4YHH L;  3KF6 A;  4DV4 L;  1B70 B;  4JC0 A;  1IBL Q;  2BA0 A;  2GVB A;  4LFA Q;  1E7Z A;  1I94 Q;  1EFW A;  1VQJ A;  5IP9 G;  3J7Z C;  3Q8D A;  5AJ3 Q;  4DV1 Q;  3GTL H;  1Z9F A;  2IHF A;  4DPG A;  2AWO A;  4JI8 Q;  5FLX c;  1VQN A;  1VQO A;  4DR1 L;  3ZJY C;  4A75 A;  4QQB X;  4NPS A;  1VQG A;  3H0G G;  4YY3 L;  2R93 G;  4HIO A;  1X3G A;  1W3S A;  3S2D H;  1YNX A;  1I6H H;  1IBM Q;  4BXX H;  1KRS A;  1PH5 A;  2YYZ A;  2YU9 H;  2HHH L;  2ZM6 L;  3PO3 H;  1YHA A;  4A3M H;  2F4V Q;  1S3O A;  1VQP A;  4DUZ Q;  1JB7 A;  4LF5 Q;  4GLV B;  2MFI A;  4C2M H;  4HIK A;  1PH6 A;  2HIV A;  4AH6 A;  2ZTE A;  1Q86 C;  2K5V A;  1VS0 A;  3HFZ B;  3PV0 A;  3KF6 B;  5M3M H;  3HOW G;  2UUA Q;  3K7A H;  1XMO L;  2YV5 A;  5FLM G;  1R9T H;  2VUM G;  1JT8 A;  1N8R C;  4JOI C;  3S1M H;  3FP9 A;  4RG1 A;  1B8A A;  3CCJ A;  4NXM L;  2ASB A;  1VQ6 A;  3M4Q A;  1Z47 A;  4BBR G;  2LSS A;  3F8T A;  1IXR A;  4IPC A;  1LYL A;  4LUV A;  4OWT B;  4AQY Q;  4KHP L;  4B3M Q;  1ASZ A;  3KDF B;  4IPD A;  3CW2 C;  3MXN B;  3GD7 A;  4JBW A;  4L5Q A;  1N34 Q;  3TRE A;  1FGU A;  2K4K A;  3W5O A;  4QGU A;  4OWX B;  1E3P A;  5AJ3 L;  2QEX A;  2UU9 Q;  4PMW A;  4DV5 L;  4LF7 Q;  2JJQ A;  4DR5 L;  1MJE A;  4JI0 L;  3EN2 A;  3GTP H;  2BH2 A;  3K0X A;  2V1C C;  3W1B A;  2R7D A;  4IOA A;  4JI1 Q;  5IYB H;  2LXK A;  3PCO B;  2K14 A;  4GN5 A;  2JA9 A;  4O0A A;  3D31 A;  4YCU A;  5FJ8 G;  5C0X G;  3F2B A;  1S72 A;  1QZH A;  2E5L Q;  1FJG Q;  3PO2 H;  3TS2 A;  4YCW A;  3CP0 A;  1EYG A;  4BY7 H;  1E24 A;  1C0A A;  4LF9 L;  2R93 H;  3CPW A;  4NB3 A;  4DR6 Q;  2JA5 H;  4PZ6 A;  3S1Q H;  4DK3 C;  2E2I H;  1X3E A;  3CPF A;  2PQA A;  3S1R H;  1HNZ Q;  4QL5 A;  3M7N A;  4JI7 Q;  4YWM A;  5ELN A;  4X6A H;  4LF6 Q;  5IYD G;  4X65 Q;  3CCE A;  2IX0 A;  5IE8 A;  4GNX C;  1AE3 A;  2PMZ E;  3E9I A;  4APV A;  5C44 G;  3PUX A;  2XTI A;  3F2C A;  4JI2 L;  2RCN A;  5BR8 Q;  3J7A 5;  1O7I A;  4LFC L;  3E0E A;  1V1Q A;  1WYD A;  3EIV A;  3JAM c;  2Z6K C;  3M4O H;  3NEL A;  4B3R Q;  4TQU S;  1CKN B;  2ZTD A;  3GTG H;  4C3H H;  4A3F G;  4DV6 L;  1AH9 A;  5FLM H;  3EBE A;  2VUM H;  4WJ3 M;  1KXL A;  1K3R A;  3OTO L;  2K5H A;  5M3M G;  3UE0 A;  4X66 L;  1X3F A;  4DV7 L;  4POF A;  3CMA A;  3CME A;  2CQO A;  2IT1 A;  4B3T L;  1IL2 A;  2ES2 A;  1XNQ Q;  5C4X H;  1MIU A;  3S15 H;  3HKS A;  4X65 L;  1PV4 A;  1PH9 A;  4JBM A;  5GAG C;  5M5X H;  5IWA Q;  3HOU G;  1I50 H;  4DAY B;  3CCQ A;  2QA4 A;  1C7Y A;  2NZH A;  2LXJ A;  3I7F A;  1HNX Q;  2ZTC A;  4LF5 L;  4DUZ L;  4Y7N H;  3HKZ E;  4UPA A;  4UP9 A;  4IPH A;  2JA5 G;  2JEA I;  2EQS A;  5C4X G;  4GKK Q;  4QJF A;  2IY5 B;  4EQ5 A;  3ERS X;  2VY3 A;  3T1Y Q;  1XTD A;  2E2J H;  2VQF L;  2VQE L;  1WJJ A;  2B63 G;  3RZO H;  5IYB G;  1N33 L;  4IFD G;  5GAD C;  1CKN A;  1GVP A;  3RLO A;  1PYS B;  4LUO A;  4GOP C;  1XMO Q;  1IZ6 A;  1WI5 A;  3KDF A;  4A3B H;  3HKZ G;  2JA6 G;  4BBR H;  1WCM H;  1EIY B;  1A63 A;  3PF4 A;  1CSP A;  1VQK A;  3CAM A;  4X64 Q;  5HY6 A;  1Q46 A;  5IWA L;  1PH1 A;  3RLF A;  3CXC A;  4DR2 Q;  4IPG A;  4KHP Q;  1CUK A;  3L7Z C;  4KI0 A;  1GM5 A;  4P72 A;  1GKH A;  3W1G A;  4DR3 Q;  4BY1 G;  1HR0 L;  2MO0 A;  3BZK A;  5M5Y H;  1Y1W G;  1QVG A;  1WOC A;  3CCM A;  3KJO A;  1EWI A;  2VQF Q;  1VQM A;  4X66 Q;  4IOC A;  1Y1V G;  1K73 C;  5H1S E;  1HZC A;  3HOX G;  1K0R A;  1RIP A;  4GKJ Q;  4JG2 A;  4R4I A;  1X54 A;  1IBK Q;  2E2H H;  4L5S A;  4LF4 L;  2ZJQ A;  1VQA A;  1Q1B A;  2JK8 A;  4JI3 L;  3RNU A;  2NVT H;  4GS3 A;  3I4M G;  3KOJ A;  1KIX A;  2GVA A;  4TVA B;  1FVI A;  4AYB E;  3MEF A;  3H0G H;  3J81 j;  2VL6 A;  4UP8 A;  4X64 L;  5GAH C;  2K75 A;  3RLN A;  1Y1V H;  1MJC A;  2Q2I A;  1CKO A;  3PO3 G;  4LF6 L;  1SFO H;  1A8V A;  4DV0 L;  1YJW A;  1VQ9 A;  2EIF A;  1X65 A;  2Y0S E;  4DK6 C;  4A3K H;  3TRZ A;  4P73 A;  4GOP B;  4A3G H;  2WB1 G;  3L2P A;  5HGQ A;  3K8A A;  4OON A;  1X6O A;  3G71 A;  1HJP A;  4A76 A;  4A3J H;  1KD1 C;  2E8G A;  3K80 C;  3PSI A;  3NBH B;  3A5U A;  1QZG A;  5C3E G;  2PI2 A;  1L1O B;  1S40 A;  4X62 Q;  3I56 A;  1HNW L;  5IYD H;  4R4Q A;  4DV6 Q;  1K8A C;  2AHO B;  1Q82 C;  1DGS A;  3M9B A;  1VQ4 A;  3ULL A;  1PH8 A;  1D7Q A;  1RL2 A;  3PUV A;  4JI3 Q;  3HOZ G;  2B29 A;  2B63 H;  3PIP A;  3STB D;  4A3B G;  1OXU A;  3I4M H;  4OWW B;  4A3J G;  4ALP A;  1Q12 A;  1I5F A;  4IFD I;  4LWC A;  3CCL A;  3M3Y H;  1PH3 A;  2K5N A;  4OO1 G;  4B3S Q;  1L2F A;  1XPU A;  4DV0 Q;  1OXT A;  1YJ9 A;  4YWL A;  3IRB A;  1B7Y B;  3T1H L;  4A93 G;  1J6Q A;  4YWK A;  4JI5 Q;  2I0Q A;  3CQZ H;  4MTN A;  4GKK L;  3B6Y A;  5ELO A;  4ME3 A;  4BY1 H;  1I3Q H;  1X55 A;  1BVS A;  1PYB A;  4Y52 H;  2YTX A;  1XMQ L;  4IJH A;  2OTJ A;  1TWC H;  2PI2 E;  2AWN A;  1N33 Q;  4A93 H;  2I5L X;  3A5Z B;  3HOX H;  5C4J H;  5FJ8 H;  3AEV A;  2UUB Q;  3JAM i;  4A3E H;  4JI4 Q;  3S1N H;  2ZJR A;  3AFQ A;  5JJK A;  4A3I H;  1XNR L;  2BA1 A;  1PA6 A;  1JMC A;  4R4T A;  2NVQ H;  2AKW B;  1Y1W H;  2JA6 H;  4IFD J;  1UWV A;  3UDG A;  3H3V I;  1PVO A;  3KYH C;  1K9M C;  3S24 A;  1KAW A;  1W2B A;  2VS1 A;  1JJ2 A;  4RMF A;  3PUZ A;  3I4N G;  2L15 A;  4A3C G;  2NVY H;  4IJL A;  1L1O C;  1N32 L;  4C3I H;  3GTO H;  4BA1 I;  1JE5 A;  5J3B A;  4JI5 L;  1D8L A;  3BZC A;  2WP8 J;  3KLW A;  3ULJ A;  1I94 L;  2UUC Q;  1Y14 B;  4LFA L;  3M85 A;  1X56 A;  3ER0 A;  2B3G A;  4JI0 Q;  1G6P A;  4A3D G;  1LM0 A;  1VQF A;  4LF8 L;  2RF4 A;  3UDF A;  5IY0 A;  5C44 H;  3D0F A;  3LGJ A;  4XTC S;  5LMU Q;  3KFU A;  1G51 A;  4JBJ A;  4O2D A;  2I5H A;  2YTY A;  3GO5 A;  1KQS A;  5GAE C;  2CWP A;  3G4S A;  1VCI A;  1G29 1;  5M3F H;  1Q81 C;  2D0P A;  2PQA B;  3PGZ A;  2Q2U A;  1HZ9 A;  4PG3 A;  5E7N A;  2OCE A;  2RHS B;  4DR4 L;  5EAY A;  4JI7 L;  1E22 A;  2A1A A;  1TWF H;  1OXS C;  3OW2 A;  1J5E L;  2JEB I;  2YTV A;  4OX9 L;  4BBS H;  4LFB Q;  1M1K C;  1N34 L;  1Q7Y C;  4HIM A;  2VZA A;  2I5M X;  2Z0S A;  3TEH B;  1YIJ A;  4A3D H;  4OO1 I;  3CF5 A;  3GDE A;  4R1J A;  4OXP A;  2UUA L;  4P74 A;  3KF8 B;  4PZ8 A;  4DR3 L;  1EUJ A;  3OYY A;  3I55 A;  4JI4 L;  4DV7 Q;  4GNX A;  1KC8 C;  2A8V A;  1YBY A;  2HT1 A;  2VNU D;  3J80 i;  4YCV A;  1U5K A;  1VQI A;  2R6G A;  3AQQ A;  1XNQ L;  3AYH B;  4UP7 A;  2DGY A;  5GRO A;  4A3I G;  2NN6 I;  1SRO A;  4DR7 L;  4LNQ A;  2N49 A;  4YY3 Q;  1MKH A;  1UEB A;  1BBW A;  3GTQ H;  2VW9 A;  4EX5 A;  3T1H Q;  1SMX A;  1NJI C;  2JA7 H;  4B3S L;  5LMN L;  3RR5 A;  4B3M L;  1V9P A;  2ZM6 Q;  1E1O A;  4DV2 Q;  5LMU L;  3CD6 A;  1UE6 A;  3JC6 6;  4L5R C;  1SE8 A;  1TWH H;  2MO1 A;  3F2D A;  2PNH A;  1Q1E A;  3PUY A;  2ZJP A;  2XGT A;  3WWV A;  1PH2 A;  1NTG A;  1VQL A;  5JEA J;  2BH8 A;  3UE1 A;  1VQC A;  1BKB A;  3TQY A;  4R4C A;  3E9H A;  1P16 A;  4FDB A;  5DLQ E;  4DV3 L;  2Q2H A;  1P8L A;  5IT9 c;  1XJV A;  3S17 H;  3ULP A;  2UXB L;  4OX9 Q;  4LFB L;  3I2Z A;  3RZD H;  2R7Z H;  4AIM A;  1YHQ A;  1N32 Q;  3I4O A;  1XPR A;  4JCV E;  4DNI A;  2OWO A;  3HOU H;  1TWG H;  5BR8 L;  1YEZ A;  2KHI A;  2R7F A;  3UDX A;  4DAM A;  2OQK A;  1JJC B;  2CKZ B;  4JOI A;  1VQ8 A;  3KJP A;  1LUZ A;  4DKA C;  3ICE A;  4DV5 Q;  4LF7 L;  3CCR A;  1EOV A;  2KHJ A;  2ALY B;  4KHZ A;  2F3I A;  3OTO Q;  5C0X I;  4LF8 Q;  4JV5 L;  3J80 c;  4GKJ L;  1YJN A;  3U58 A;  3UDI A;  1UE1 A;  5JJL A;  3SGI A;  1VQ5 A;  1HR0 W;  4POG A;  4HJ7 A;  4NXN Q;  3CC4 A;  4BXX G;  4DR4 Q;  2UXC L;  4A3F H;  1YZ6 A;  1V43 A;  3HOY H;  5IYC H;  1JJG A;  1J5E Q;  4A3E G;  2FXQ A;  4NXM Q;  4DR6 L;  3HOV G;  2ID0 A;  2JQO A;  3PO2 G;  3S16 H;  2WAQ G;  2NVX H;  4JI6 L;  4A3G G;  2D0O A;  4DV2 L;  1T9H A;  2NN6 G;  2JA8 H;  2UXD Q;  1YVC A;  2IHE A;  2WFW A;  1KRT A;  3T1Y L;  3BU2 A;  1QVC A;  2A19 A;  5K36 G;  4GLX A;  1SLJ A;  2DUD A;  2UU9 L;  3VDY A;  2D62 A;  3CCV A;  1X9N A;  1U0L A;  1XMQ Q;  4K0K L;  1WFQ A;  1OXX K;  1YHB A;  2N3S A;  2CFM A;  3GTJ H;  4PZ7 A;  1IBK L;  1L1O A;  3GTM H;  4JI1 L;  4DR7 Q;  5LMN W;  5JEA G;  1N9W A;  2CWA A;  4GN3 B;  1L0W A;  1LTL A;  2OTL A;  1NY4 A;  2H5X A;  3L0O A;  4GOP A;  2F4V L;  2UXD L;  1YI2 A;  2JA7 G;  5C3E H;  1TXY A;  2IX1 A;  3STB C;  4A4I A;  1N36 L;  4XIG S;  1VQB A;  2ATW A;  1EQR A;  2K50 A;  1NMG A;  5LMN Q;  4A3C H;  2Y0S G;  3H15 A;  3NEN A;  4DR2 L;  3M4P A;  5IP7 G;  3PF5 A;  3TS0 A;  1ASY A;  4DV4 Q;  1A62 A;  4C3J H;  3G6E A;  3CC7 A;  4MNO A;  1GD7 A;  4NXN L;  2R92 G;  4BY7 G;  4QY7 A;  1PH7 A;  4DR1 Q;  3S2H H;  2C35 B;  3FKI H;  4H02 A;  3J81 c;  2HQL A;  1QVF A;  2RHQ B;  4J15 A;  5M5W H;  5IYC G;  1OXV A;  4AQY L;  3PIO A;  4DV3 Q;  3DM3 A;  3HOY G;  1QUQ B;  2JE6 I;  4LF4 Q;  3A74 A;  1VQH A;  2CCZ A;  5M3F G;  2Z6K A;  2HHH Q;  2UUC L;  4JBK A;  3H3V H;  1NE3 A;  2AMC B;  2GN5 A;  3U50 C;  2R92 H;  4A3L H;  3S14 H;  1TWA H;  4BA2 I;  3U4Z A;  1XPO A;  4DUY Q;  2JA8 G;  4DR5 Q;  5JJI A;  1AE2 A;  3NEM A;  1K8G A;  1A0I A;  3AFP A;  2MNA A;  1HNW Q;  4WJ4 A;  4JV5 Q;  4QIW E;  4B3T Q;  1K83 H;  1C9O A;  1HR0 Q;  4K0K Q;  1HNX L;  3G48 A;  4A3K G;  3BJU A;  4GLA C;  4HJ9 A;  1HH2 P;  4HJA A;  1E1T A;  1EIF A;  2E5L L;  1FJG L;  3HOZ H;  3F1Z A;  2F52 A;  2UUB L;  3U4V A;  2KCM A;  4DV1 L;  1CKM A;  2N78 A;  1IYJ B;  4LW1 A;  4X62 L;  1WCM G;  2R7Z G;  4A3L G;  3DLL A;  3I4N H;  2KBN A;  1PHJ A;  1BBU A;  2VQE Q;  4JI8 L;  1SN8 A;  1KHI A;  3RN5 A;  1YIT A;  2KEN A;  4AYB G;  2MQH A;  4KLK A;  4R4O A;  1PH4 A;  4UY8 C;  4MZ9 A;  1N36 Q;  2UXB Q;  1HZB A;  2N8N A;  4GN4 B;  3K7U C;  3CC2 A;  4HID A;  4JYA Q;  4DUY L;  4LFC Q;  1QUQ A;  4A3M G;  1VQE A;  1IBM L;  1PFS A;  1VQ7 A;  1UE7 A;  1NBW A;  1H95 A;  4BBS G;  1SR3 A;  2K52 A;  5IP7 H;  3PUW A;  3CCU A;  4YHH Q;  3RN2 A;  2EXD A;  2KCT A;  1IBL L;  3K81 C;  2WAQ E;  1Q8K A;  4P75 A;  1M90 C;  3CCS A;  3FKI G;  3J81 i;  1XNR Q;  4IO9 A; 
#chains in the Genus database with same CATH topology
 2B2W A;  1GO3 E;  2Q2T A;  3SHL A;  4LF9 Q;  3OW7 A;  5CR3 A;  3A56 A;  4HJ5 A;  4KY7 A;  4JYA L;  3QIA A;  4P71 A;  2NZO A;  2N55 A;  4L5T A;  2QF7 A;  4JI6 Q;  3A0J A;  3GTJ B;  2OQ0 A;  1CSQ A;  2QGQ A;  4YHH L;  4X3S A;  2A6H D;  5C4X B;  4LFA Q;  1VQJ A;  5BN5 A;  3Q8D A;  5EGT A;  5AJ3 Q;  4XT3 B;  2K03 A;  3FPP A;  3J81 L;  1W6K A;  4KKU A;  3K57 A;  1W3S A;  2EY6 A;  3AU7 A;  1YNX A;  1HTL D;  1IBM Q;  4LAA A;  4BXX H;  1EOT A;  1AN8 A;  3PO3 H;  1ZYR D;  4DUZ Q;  3BDC A;  3PMF A;  3G7L A;  4GLV B;  4LF5 Q;  1PH6 A;  1PRT D;  4AH6 A;  1STN A;  2ZTE A;  1Q86 C;  5M3M H;  1GUG A;  3U9S A;  3S14 B;  3VR6 A;  4JOI C;  3S1M H;  4F8M A;  1IL8 A;  4TSS A;  2ASB A;  3M4Q A;  1Z47 A;  4N8X 1;  1K28 A;  1ENA A;  4KKT A;  1IXR A;  4LUV A;  1AEX A;  5E1F A;  3GD7 A;  1U9R A;  1RCV D;  2A74 C;  2NVT B;  2UU9 Q;  2X6G A;  4ZRZ A;  1SJH D;  4IFD H;  3PCO B;  4GN5 A;  2K14 A;  4O0A A;  2JA9 A;  2B63 H;  3D31 A;  5C0X G;  3TS2 A;  1D5M C;  5CV6 A;  4A3G B;  4YCW A;  1C0A A;  2J0T D;  1UUP A;  1E24 A;  4BY7 H;  4LF9 L;  2R93 H;  4DXG A;  4DR6 Q;  3S1Q H;  4NP5 A;  3GTG B;  2F0I A;  3QO2 A;  1EL0 A;  2K7V A;  2IX0 A;  2VUM B;  1HA6 A;  3HOX B;  4APV A;  2RCN A;  5BR8 Q;  3E0E A;  1WYD A;  2F0P A;  3JAM c;  1B50 A;  4TQU S;  1CKN B;  4CBV A;  4DNT B;  5LHY 1;  1AH9 A;  5FLM H;  5M3M G;  3URY A;  2JSO A;  4X66 L;  1X3F A;  4ME5 A;  3CMA A;  4B3T L;  1IL2 A;  4ZQ3 A;  2ES2 A;  5D3D A;  1XNQ Q;  1RHP A;  3S15 H;  1G8Z D;  1PV4 A;  4A93 B;  3K0Y A;  5IWA Q;  3HOU G;  4DAY B;  1C7Y A;  4LF5 L;  1TY0 A;  4DUZ L;  4UP9 A;  4IPH A;  5KIX A;  2KEE A;  2HD3 A;  4KK7 A;  2IY5 B;  4EQP A;  3ERS X;  2VQF L;  2VQE L;  2M9V A;  5IYB G;  1JOO A;  5IGE A;  4IFD G;  5GAD C;  4L63 B;  1CKN A;  1HRJ A;  1DCZ A;  4GOP C;  1WTP A;  1IZ6 A;  4IZ8 A;  3KDF A;  4A3B H;  3HKZ G;  2EY5 A;  3QG1 A;  5LL6 S;  1JE4 A;  1CSP A;  1VQK A;  1Q46 A;  2F0W A;  3GTM B;  3L7Z C;  1ML0 D;  4XQQ A;  2XIW A;  3CU7 A;  1DM0 B;  4CKB A;  1VDZ A;  3KJO A;  4IOC A;  1EU4 A;  1K73 C;  5KYI A;  1WTV A;  5D3I B;  4L5S A;  4LF4 L;  1F2M A;  1VQA A;  1Q1B A;  4GS3 A;  1A3V A;  2EE1 A;  4C1N I;  1KIX A;  2BOS A;  3I4M G;  1DON A;  2VL6 A;  4KMU C;  5GAH C;  3K5L A;  4XYQ A;  3GTP B;  2Q2I A;  3KUP A;  4IUR A;  4QF4 A;  1YJW A;  2QW7 A;  1X65 A;  4GOP B;  2NTS A;  3K8A A;  1X6O A;  3G71 A;  1HJP A;  3HS0 C;  4A76 A;  4A3J H;  2E8G A;  5C3E G;  2PI2 A;  1S40 A;  3FRP B;  4MN3 A;  1HNW L;  5IYD H;  1EEF D;  2NZ1 D;  1K8A C;  1Q82 C;  2A68 C;  1U4M A;  3M9B A;  1VQ4 A;  4RCO A;  1D7Q A;  2O5I C;  3PUV A;  1SNO A;  4JI3 Q;  2EYP A;  3HOZ G;  3M4O B;  4IFD I;  1VMP A;  1PLF A;  3CCL A;  4C3H B;  3M3Y H;  1WTX A;  2CH4 W;  3JAM L;  4YWL A;  1B7Y B;  3I4N B;  1CT1 D;  4JI5 Q;  4BY7 B;  3R2T A;  4CDE C;  5C3X A;  1PTO C;  3B6Y A;  1F77 A;  1XMQ L;  4KKS A;  4IJH A;  2Y0S B;  1C48 A;  3ERQ A;  2NVX B;  3HOX H;  5C4J H;  5FJ8 H;  4K6D A;  2F1M A;  1ET6 A;  2ZT9 C;  1QNK A;  3MWY W;  1S4Z A;  4A3I H;  2NVQ H;  4DAV A;  4ZK9 B;  3UDG A;  4RMF A;  5CV9 A;  3RD4 A;  4C3I H;  1PZK D;  1D8L A;  3KLW A;  4S3S A;  3ULJ A;  3WDN A;  4DAP A;  1X56 A;  4A3D G;  2HDL A;  3D0F A;  3LGJ A;  4XTC S;  1TS3 A;  5LMU Q;  5CC4 A;  3C3L A;  5BN4 A;  2I5H A;  2MP1 A;  2CWP A;  2QDL A;  4PQX A;  1VCI A;  5JPN C;  1AZQ A;  3PGZ A;  3TBI B;  1IKM A;  3H3V C;  2R3Z A;  5M5Y B;  4C3J B;  2X69 A;  4BWG B;  4OX9 L;  3K5O A;  1N34 L;  3TEH B;  1QCB D;  2RSO A;  1JOR A;  2A69 C;  1ZXT A;  2UUA L;  4P74 A;  1DZ1 A;  3T13 A;  5I9O A;  3OYY A;  4JI4 L;  1SSO A;  4DV7 Q;  2A8V A;  1MD2 D;  1TWA B;  3AYH B;  1ENC A;  3X3N A;  3SVM A;  4A3I G;  3AMU A;  3BYT B;  1JOQ A;  4EX5 A;  1SMX A;  5FO8 B;  1FNU A;  1RKN A;  2B2V C;  2CQA A;  1F9Q A;  2NBF A;  3J7A F;  3RR5 A;  4B3M L;  5IGF A;  1LTG D;  4L5R C;  2R93 B;  3MHB A;  2MO1 A;  3F2D A;  2PNH A;  3PUY A;  2ZJP A;  1JWM D;  4GZY C;  5CV7 A;  4OL7 A;  3TP5 A;  1B3A A;  1UNS A;  4DGZ A;  5JEA J;  1VMC A;  3VYR A;  3TQY A;  1LTT D;  5DLQ E;  3ULP A;  1F2Y A;  1MSG A;  3E6Z X;  3SR1 A;  3D3R A;  3RZD H;  3I72 A;  4AIM A;  1YHQ A;  4G57 A;  2DJF C;  3KK7 A;  2FFK B;  1O80 A;  3FDT A;  1JJC B;  5IT9 E;  2F4I A;  3KJP A;  1LUZ A;  4DKA C;  3ICE A;  3EFX D;  1EOV A;  3S1R B;  2L55 A;  5CBE E;  3DMU A;  2VB3 X;  4POG A;  4DXF A;  4BXX G;  2OF1 A;  1H9J A;  1S5C D;  1KAA A;  1EY4 A;  3I8Z A;  4NXM Q;  4DR6 L;  2JQO A;  2WAQ G;  4EQN A;  2NVX H;  4A3G G;  3HG9 A;  2VXW A;  2MUY A;  2ZXO A;  4HSV A;  1WTO A;  1D6E C;  1K3B C;  1D1I A;  4IUU A;  2WFW A;  1KRT A;  2A19 A;  2L0C A;  3CCV A;  1U0L A;  4J1M A;  2N3S A;  4NMZ A;  3GTM H;  2NYZ D;  1L1O A;  2MGS A;  4JI1 L;  1N9W A;  4KJN A;  1LTL A;  3W3A A;  2OTL A;  5COY A;  5EJW A;  4QMG A;  3L0O A;  2KQ3 A;  1LTB D;  3OPO A;  2UXD L;  2K6A A;  2JA7 G;  3NQT A;  1TXY A;  3STB C;  1PVO A;  1YNN D;  1EQR A;  3H15 A;  5IP7 G;  3PF5 A;  1KNE A;  4HED A;  3K5M A;  5LL6 X;  1A62 A;  1B53 A;  1QIL A;  4C3J H;  4MNO A;  3TP8 A;  2FMC A;  1PH7 A;  3KLS A;  3S2H H;  2R92 B;  3SEB A;  1EY0 A;  3J81 c;  2DY7 A;  2EOT A;  3PIO A;  5L37 A;  3FPU B;  3W2D A;  1LT5 D;  4A3J B;  3J7Y W;  1KLG D;  1Y69 U;  3OIP A;  2VB2 X;  3R3O A;  5M3F G;  2UUC L;  2M00 A;  1R9T B;  1TWA H;  1XPO A;  2K32 A;  1I4Q A;  5M5W B;  3NEM A;  2J4X A;  4YIJ A;  3SK6 A;  4ZKB B;  1SNC A;  2SNS A;  2F52 A;  1SFO B;  4DV1 L;  4PMB A;  4A3L G;  2R7Z G;  3OOC A;  3DLL A;  3I4N H;  2KBN A;  1BBU A;  5CV4 A;  3LWU A;  5DNF A;  3RN5 A;  1STY A;  1L0X B;  2UXB Q;  1GHJ A;  4HID A;  4JYA Q;  2FIN B;  1VQE A;  3PO2 B;  3ND8 A;  4BBS G;  1SBB B;  2CW0 C;  2QKI C;  2K52 A;  5IP7 H;  3PUW A;  3IAY A;  4YHH Q;  3RZD B;  4Q0F A;  1X3P A;  1Q8K A;  3S16 B;  3DWQ A;  4N9T A;  1XNR Q;  2PNR C;  1HFG A;  3CRK C;  1EQQ A;  1KL9 A;  2F0D A;  1UE5 A;  1I3Q B;  4LUZ A;  1LV9 A;  5IP9 H;  2UXC Q;  3GTL B;  1NMF A;  5JJZ A;  2HIX A;  4JI2 Q;  3N52 A;  5C5L A;  2G9H D;  3V96 A;  3HKZ B;  2GVB A;  1I94 Q;  1EFW A;  1E7Z A;  2SEB D;  5JEA H;  1WCM B;  4HMI A;  2IHF A;  2F0F A;  4JI8 Q;  2LMC B;  1DXM A;  3ZJY C;  3LNN A;  1AZP A;  1VQG A;  3H0G G;  1EFI D;  4YY3 L;  1A2U A;  2R93 G;  1X3G A;  3S2D H;  2WAC A;  1KRS A;  1JWS D;  4CKC A;  1BCP D;  5FOB B;  4C2M H;  4HIK A;  2HIV A;  5G3L F;  3U9O A;  1WD1 A;  3HOW G;  3KF6 B;  2RDG A;  5FLM G;  1JT8 A;  3NBH A;  3FP9 A;  3EVQ A;  3CCJ A;  2PZT A;  3QOJ A;  1H9R A;  1CQV A;  3K58 A;  1F9P A;  4F7X A;  3S2H B;  3KDF B;  2JP1 A;  1F9R A;  5JOB A;  3CW2 C;  3MXN B;  1N34 Q;  1FGU A;  4OWX B;  1E3P A;  1PZJ D;  2QEX A;  4DV5 L;  2HQE A;  2JJQ A;  1PZI D;  1MJE A;  4C56 C;  5AFW A;  3EN2 A;  4ZLT F;  2HUG A;  3H09 A;  1CM9 A;  2R7D A;  5C4Z A;  3D4D A;  4G7H C;  4OIK A;  2HCC A;  3F2B A;  1S72 A;  3CP0 A;  5E4X A;  4X3K A;  2PZW A;  1HQM C;  2E2I H;  1I4R A;  1X3E A;  1XWE A;  2PQA A;  3S1R H;  3M7N A;  4JI7 Q;  2K05 A;  5ELN A;  2F3V A;  2K28 A;  3E9I A;  2XTI A;  4JI2 L;  2K33 A;  1V1Q A;  3IFD A;  3DEO A;  3NEL A;  3ZYY X;  5ELC A;  4A3F G;  1KAB A;  1BO0 A;  1KXL A;  3EBE A;  2F0T A;  1K3R A;  1IKL A;  1V1O A;  4KN4 C;  4PMC A;  3OTO L;  3NBI A;  5DM7 3;  1RJT A;  3EQL C;  2IT1 A;  3S9W A;  3CKI B;  1BBX C;  2ZXP A;  4AYB B;  2EY1 A;  5C4X H;  1MIU A;  1DJR D;  4UAI A;  3D4W A;  2D2C C;  4O42 A;  5D65 A;  2QA4 A;  2F0L A;  1LTA D;  1HNX Q;  2LXJ A;  3KLR A;  4Y7N H;  2PW5 A;  4UPA A;  2JA5 G;  2JEA I;  1ENF A;  4QJF A;  1D5Z C;  4EQ5 A;  1MSH A;  4N8F A;  2VY3 A;  3T1Y Q;  1XTD A;  4RWS C;  2RDF A;  2JA8 B;  2KCN A;  4XXE A;  1SMY D;  4LUO A;  1ILQ A;  1MBY A;  1TY2 A;  5I6Y A;  4CDC C;  2A6E D;  4BBR H;  1K8M A;  3M4Y A;  1WCM H;  4FF4 A;  3DEP A;  3VA7 A;  5M3M B;  1CUK A;  4KI0 A;  1GKH A;  5C5M A;  4DR3 Q;  1WTW A;  3BZK A;  3S2D B;  1EWI A;  3LX0 A;  5NUC A;  4GKJ Q;  4R4I A;  2EVB A;  2ZJQ A;  4JI3 L;  1J9O A;  2NVT H;  1RDP D;  3MZ5 A;  3J81 j;  2Z4H A;  4UP8 A;  4DK1 A;  1Y1V H;  3D6W A;  3PO3 G;  1CKO A;  2WKC A;  4RGO S;  1SFO H;  1VQ9 A;  4FNF A;  4P73 A;  4A3G H;  4OON A;  3K80 C;  3A5U A;  3NBH B;  4IN3 A;  1L1O B;  1EWC A;  3I56 A;  1A3T A;  1GXD C;  1H9M A;  1DGS A;  1AFP A;  1YNJ C;  3PIP A;  3HGB A;  4A3B G;  1GOZ A;  3I4M H;  4ALP A;  1Q12 A;  3NWT A;  1EYD A;  4LWC A;  2A69 D;  4IAL A;  1PH3 A;  5G3L D;  4DV0 Q;  1OXT A;  1TS2 A;  4A93 G;  1U4L A;  1O7Y A;  1EY5 A;  1HUM A;  2I0Q A;  3HOY B;  1LTR D;  1I3Q H;  1X55 A;  4E6I A;  1BVS A;  1PYB A;  2YTX A;  3S15 B;  4DAY A;  2RSN A;  2PI2 E;  5HGT A;  4A93 H;  3A5Z B;  3AEV A;  2IPK D;  4A3E H;  2AQ2 B;  2EYH A;  1G91 A;  1HUN A;  1JMC A;  3HEJ A;  3KLS X;  2AKW B;  2JA6 H;  1RTO A;  1H9S A;  3H3V I;  1W2B A;  1B9M A;  5C44 B;  3PUZ A;  4A3C G;  2L15 A;  5CYU A;  5FLX E;  1KTK A;  3BZC A;  1E0B A;  2WP8 J;  5KEE A;  2B3G A;  3A7L A;  1V1P B;  1TII D;  4JBJ A;  3CRL C;  5K5P A;  2C9O A;  2DNC A;  1G29 1;  5C3E B;  5M3F H;  2EYL A;  4TKO B;  2OCE A;  1SNQ A;  4FVM A;  5EAY A;  5FLX L;  1Q90 A;  1TWF H;  5C0X H;  5IGC A;  1J5E L;  2JEB I;  2YTV A;  4LFB Q;  3VYU A;  3FMC A;  5JVG 3;  1Q7Y C;  5IOC A;  2VZA A;  2I5M X;  2XRQ D;  3NPP A;  1MGS A;  1OO9 B;  4A3D H;  4BBR B;  3TSS A;  4OO1 I;  4R1J A;  4OXP A;  5I6W A;  5ELE A;  1AW7 A;  1EUJ A;  3I55 A;  4GNX A;  3NQI A;  2VNU D;  1M4V A;  1QJO A;  4YCV A;  1VQI A;  2R6G A;  3AQQ A;  1XNQ L;  5EPK A;  2DGY A;  1F9S A;  5CV8 A;  2IW3 A;  5GRO A;  1JWU D;  2NN6 I;  4YY3 Q;  1GHK A;  1UEB A;  4F88 A;  1PFN A;  5C4H A;  2VW9 A;  1R4Q B;  1GUW A;  2QDB A;  1V9P A;  1E1O A;  4PNY A;  3UI2 A;  4DV2 Q;  1UE6 A;  2E2D C;  1NSN S;  2Z1C A;  2XGT A;  2E2I B;  4ODG A;  3UE1 A;  1TS4 A;  1GUT A;  1P16 A;  4FDB A;  3P7J A;  4L6T B;  1GUO A;  3MXN A;  3SXH A;  1JOK A;  2R7Z H;  1AP0 A;  2OWO A;  4JCV E;  2L5T A;  1TKW B;  4OHJ A;  4DAM A;  2OQK A;  2O4X A;  1ZKO A;  3I4M B;  1VQ8 A;  1S5D D;  4A3I B;  1I6V C;  2L1B A;  4DV5 Q;  1QWY A;  4N9P A;  1QE6 A;  2HDM A;  4K6L A;  3J80 c;  4RAU C;  3HOY H;  1V43 A;  1LT6 D;  3JAM E;  3VR2 A;  3OHX C;  1J5E Q;  1MHW C;  4A3E G;  2FXQ A;  3PO2 G;  4JI6 L;  2JA8 H;  2UXD Q;  1YVC A;  4CJ1 B;  5D14 A;  1TR5 A;  4ZUI A;  2JA6 B;  3KBG A;  4NW2 A;  4RHR A;  1QVC A;  1STH A;  1F2Z A;  5K36 G;  1SLJ A;  5IIF A;  1CZW A;  1X9N A;  4K0K L;  1HPC A;  3MXP A;  1IW7 D;  1IBK L;  1X32 A;  3I70 A;  3MAQ A;  2SOB A;  2H1E A;  1DYQ A;  5JEA G;  2CWA A;  1D2B A;  2FMM A;  1M8A A;  2CW0 D;  1KDB A;  1PDQ A;  4RGM A;  5C3E H;  5M3F B;  1FNV A;  5J1Z A;  4LK1 C;  1N36 L;  1PTO F;  2K50 A;  2Y0S G;  1QG7 A;  2PCF B;  1TWF B;  1ASY A;  3G6E A;  2EJF C;  4UDU C;  4NXN L;  2DN8 A;  2R92 G;  4DR1 Q;  5IGB A;  2KHS A;  4NKL A;  4O1N A;  3D8G A;  3C1E A;  1MI2 A;  2HQL A;  1EIG A;  1OXV A;  5KND A;  3K5N A;  3HOY G;  2JE6 I;  1H9K A;  5EPL A;  5HUR A;  4LF4 Q;  3A74 A;  2HHH Q;  3H3V H;  4JBK A;  3U50 C;  3HOZ B;  3PIO 3;  4K8J A;  2JA8 G;  1JCK B;  1A0I A;  1NUC A;  4LMQ D;  1KLU D;  5ELB A;  1K83 H;  1C9O A;  2JA5 B;  3BJU A;  4ID6 A;  5DAU A;  1HH2 P;  1EIF A;  3F1Z A;  2UUB L;  1ILP A;  3U4V A;  2N78 A;  1IYJ B;  4RHS A;  1YIT A;  2XRS D;  4R8I A;  1BCP C;  4MZ9 A;  3TDQ A;  4DUY L;  1IBM L;  1PFS A;  1XX8 A;  2F0H A;  2L9H A;  4A3E B;  1UE7 A;  5I2Y A;  1SYG A;  1O7Z A;  2ICI A;  1J8I A;  2KCT A;  1F2L A;  1NCV A;  3LWE A;  1S5F D;  2KOL A;  1M90 C;  5FK9 C;  4B3T Q;  1I4H A;  1XMQ Q;  3HOV H;  1T5E A;  4HCE A;  1LO5 D;  3CQZ B;  2Q8R E;  3WOF A;  1E2Z A;  4GNX B;  1S5E D;  4HJ8 A;  1SRU A;  1O78 A;  2MJ8 A;  2EJM A;  5C0X J;  2CVR A;  3HOW H;  1HNZ L;  2F0G A;  3MEH A;  4B9W A;  1V8Q A;  4FF2 A;  3GTK H;  2LS0 1;  1HZA A;  1OTC A;  1FL0 A;  3FHW A;  2HCI A;  1IBL Q;  3KF6 A;  1Y8O B;  2BA0 A;  3P75 A;  4I7A A;  3J7Z C;  3EA6 A;  4DPG A;  1Q3L A;  2AWO A;  2OEO A;  4CGY B;  1VQN A;  1VQO A;  4DR1 L;  3DWP A;  4A75 A;  4NPS A;  3NP8 A;  4WRD A;  4C1N K;  5I2X A;  4IUV A;  3CHB D;  1I6H H;  1PH5 A;  2HHH L;  3MTS A;  2EDG A;  4DFA A;  3KF8 A;  4CJ0 B;  2F4V Q;  3RUZ A;  1JB7 A;  3QOL A;  2MFI A;  4MTK A;  1WTQ A;  1G2S A;  4R8N A;  2XVS A;  3HFZ B;  5I4D A;  3A7A B;  2UUA Q;  2YV5 A;  1R9T H;  2RBM A;  2KCC A;  3DWA A;  4RG1 A;  4NXM L;  1O7L A;  1EYA A;  3F8T A;  4IPC A;  1LYL A;  4AQY Q;  4KHP L;  3ONA B;  1ASZ A;  4IQZ A;  4EGV A;  4IPD A;  4EVO A;  2G9D A;  4JBW A;  4L5Q A;  3TRE A;  2K4K A;  3W5O A;  5AJ3 L;  4PMW A;  4LF7 Q;  4DR5 L;  4RCN A;  4JI0 L;  3S1Q B;  2A6E C;  1SJE D;  2BH2 A;  2R7Z B;  4OO1 H;  4K2L A;  4JI1 Q;  4B08 A;  4YCU A;  4EQO A;  1FJG Q;  2E5L Q;  4A3K B;  3PO2 H;  1EYG A;  3SK4 A;  3CPW A;  4NB3 A;  3BS1 A;  1K83 B;  2JA5 H;  1ONL A;  4V0B A;  4FXG C;  2A5H A;  1HNZ Q;  2F0U A;  4X6A H;  4YWM A;  4LF6 Q;  5IYD G;  5IE8 A;  4GNX C;  2PMZ E;  5C44 G;  1NNX A;  3F2C A;  1FNW A;  4LFC L;  2Z6K C;  2DJG C;  2WKD A;  1G2T A;  2EZV A;  2QEJ C;  3GTG H;  1PTO B;  4DV6 L;  2VUM H;  1TS5 A;  2K5H A;  4POF A;  1CQF A;  5J39 A;  3OWE B;  4BS9 A;  4X65 L;  3BZD B;  5EBC A;  5GAG C;  3HZX A;  5JPM C;  2Q8I B;  3I7F A;  2F03 A;  4KTA A;  4A3B B;  1YNJ D;  2EQS A;  2AUJ D;  1GUN A;  1LAC A;  2E2J H;  2EYF A;  3DM1 A;  3RZO H;  1WJJ A;  4WOR A;  1GVP A;  2ICE C;  1S5B D;  1KNA A;  4ZKC B;  5IGG A;  2PPB C;  4C2M B;  2WIN B;  5CGK A;  1EIY B;  3PF4 A;  3CAM A;  4KHP Q;  1PH1 A;  3RLF A;  4DR2 Q;  4QCL A;  3NK9 A;  1GM5 A;  2MO0 A;  4R9W A;  3SDZ A;  1B9N A;  4BBS B;  3NTK A;  4X66 Q;  4I65 A;  5H1S E;  1HZC A;  4PV1 C;  1XYI A;  2JA7 B;  1K0R A;  1RIP A;  1SE4 A;  4JG2 A;  4XQJ A;  2E2H H;  1IBK Q;  3RNU A;  3TN2 A;  4JK1 C;  2GVA A;  4TVA B;  4AYB E;  1SXT A;  2AUK A;  2AQ1 B;  5FKA C;  4X64 L;  5IGD A;  1BDO A;  3RLN A;  4IUT A;  1EEI D;  4LF6 L;  1A8V A;  4DV0 L;  2EIF A;  4DK6 C;  4IUQ A;  5CBA E;  1RD9 D;  3PSI A;  4L8J A;  3Q24 A;  3GQB A;  1TVX A;  3BVZ A;  4X62 Q;  4DV6 Q;  2AHO B;  3IFT A;  1PH8 A;  2A6H C;  4K5X A;  2EYM A;  2EXZ A;  3STB D;  4A3J G;  4OGQ C;  1CHP D;  1I5F A;  4QUF A;  2K5N A;  1HHV A;  2FHT A;  1L2F A;  4B3S Q;  1XTC D;  3V2T A;  5KRU A;  1YJ9 A;  3IRB A;  1XPU A;  3T1H L;  1PYW D;  1J6Q A;  2I07 B;  3E5S A;  1SYD A;  3CQZ H;  1SE3 A;  3HP3 A;  2NVQ B;  4Y52 H;  2KED A;  5ELD A;  1LAB A;  2I5L X;  2UUB Q;  4C3I B;  4FO2 A;  4JI4 Q;  3GTK B;  5JJK A;  3AFQ A;  2XWB B;  1XNR L;  1PA6 A;  4R4T A;  2K1B A;  4IFD J;  1UWV A;  3KYH C;  1JR0 D;  1KAW A;  3S24 A;  1JJ2 A;  5A2Q E;  1DOL A;  1HQR D;  1N32 L;  2L4N A;  1JE5 A;  1BR9 A;  3Q0A A;  1V1P A;  4LFA L;  2SNM A;  1Y14 B;  3M85 A;  2L12 A;  1G6P A;  4QUC A;  2K01 A;  4IUN A;  2KVM A;  5IY0 A;  4KD4 A;  3PIP 3;  1KQS A;  5GAE C;  3FVQ A;  2E74 C;  1T5X D;  1Q81 C;  2PQA B;  1HZ9 A;  2IL8 A;  4PG3 A;  2WAQ B;  2RHS B;  4DR4 L;  2RKS A;  4JI7 L;  1E22 A;  2A1A A;  3OW2 A;  2E2J B;  3A54 A;  4HIM A;  5ISR A;  4CDF C;  1K0S A;  4HR7 B;  4F87 A;  1QOH A;  2IJ0 A;  2EPB A;  4UHV A;  1YIJ A;  3CF5 A;  3VR5 A;  2K5W A;  2B2Y A;  1I4X A;  4DF7 A;  3KF8 B;  4PZ8 A;  1YBY A;  2HT1 A;  1Y1V B;  3AB9 A;  4G4K A;  1SNM A;  4UP7 A;  4XT1 B;  4U68 A;  1HTP A;  4DR7 L;  4LNQ A;  1MKH A;  2IWH A;  1BBW A;  2NB0 A;  1BCP B;  3T1H Q;  1NJI C;  2JA7 H;  1H9S B;  4B3S L;  5LMN L;  3J80 L;  2E2H B;  2D9U A;  5LMU L;  3JC6 6;  3TZD A;  1TWH H;  3A8I E;  2ENB A;  3Q22 A;  2LFN A;  1Q1E A;  5ELF A;  1TQO A;  2GA4 B;  5EKI A;  1RF2 D;  1VQL A;  1EQV A;  2BH8 A;  1VQC A;  1BKB A;  3E9H A;  4DV3 L;  4IOA A;  1XJV A;  2F3W A;  2Q2H A;  4OX9 Q;  4NDX A;  2JN4 A;  1PTO H;  1N32 Q;  1XPR A;  3HOU H;  1GJX A;  1TWG H;  5BR8 L;  1YEZ A;  1B1Z A;  2KHI A;  2R7F A;  1WTR A;  4JOI A;  4LF7 L;  3MFG A;  3NHH A;  2KHJ A;  5JVH 3;  3TP7 A;  4JV5 L;  5C0X I;  4IUP A;  4GKJ L;  1YJN A;  3U58 A;  1ROD A;  2BE5 C;  4CDD C;  2RQX A;  1HR0 W;  4KY6 A;  1VQ5 A;  5M9O A;  4DR4 Q;  4J6H A;  2UXC L;  4A3F H;  3BG3 A;  3SK5 A;  4K5V A;  1JJG A;  2KEC A;  2KUM A;  3HOV G;  2ID0 A;  5T1I A;  2PMZ B;  1T9H A;  3RZO B;  4C3J G;  3J81 E;  3OMC A;  3DUZ A;  2IHE A;  4OIJ A;  1STB A;  1CK1 A;  1FR3 A;  3BU2 A;  4H44 C;  4RGN A;  2DUD A;  2KJX A;  2UU9 L;  3VDY A;  2OT2 A;  5M5X B;  1DD2 A;  1E2V A;  4RA8 A;  1NR2 A;  1YHB A;  3GTJ H;  3KBX A;  2B2V A;  4PZ7 A;  1CFM A;  4DR7 Q;  2B2Y C;  2CHB D;  5LMN W;  1L0W A;  4ABN A;  2A68 D;  4GOP A;  1A3U A;  1EWH A;  1A6X A;  5DEH A;  2LKV A;  4Z9C B;  2IX1 A;  4ZCK A;  4A4I A;  4XIG S;  1VQB A;  2OXP A;  4DN4 M;  5LMN Q;  1NMG A;  4A3C H;  2UXB L;  1EY8 A;  3M4P A;  4H13 C;  1FYC A;  1II3 A;  4DV4 Q;  1D5X C;  4ZYS A;  2PO4 A;  3CC7 A;  2F0O A;  4BY7 G;  4MHE A;  2N88 A;  2JXM B;  2C35 B;  4H02 A;  5EKL A;  3T51 B;  3MXU A;  1PTO D;  1QVF A;  2RHQ B;  4KD3 A;  5M5W H;  1SNP A;  5IYC G;  4DV3 Q;  3DM3 A;  3H94 A;  1EY6 A;  2F0Q A;  4KJO A;  1EZ6 A;  1D1K A;  1VQH A;  3ND9 A;  2CCZ A;  2Z6K A;  3K59 A;  1NE3 A;  4RKB A;  2R92 H;  3S14 H;  1BOS A;  4BA2 I;  4DUY Q;  3S1M B;  5JJI A;  1K8G A;  3I4L A;  4KV6 A;  2MNA A;  3IKJ A;  1HNW Q;  1LLR D;  4WJ4 A;  4JV5 Q;  4QIW E;  3H0G B;  4QIW B;  3G48 A;  4GLA C;  4B9X A;  4HJA A;  5BN3 A;  3M7G A;  2KCM A;  1BNZ A;  1CKM A;  1B2T A;  2ZXR A;  2VQE Q;  2O2L D;  2F0K A;  4JI8 L;  1SN8 A;  1KHI A;  1IYU A;  1PH4 A;  4DK0 A;  4UY8 C;  2K04 A;  2N8N A;  3K7U C;  3CC2 A;  3IL8 A;  1QUQ A;  4A3M G;  1CA5 A;  5K36 H;  2R61 A;  2E76 C;  1SYF A;  5FO9 B;  1VQ7 A;  1NBW A;  1H95 A;  1KDC A;  2Z6B A;  3C1F A;  3T4A C;  2M2L A;  2E75 C;  2X6L A;  3RN2 A;  3CCU A;  1IBL L;  3K81 C;  4U67 3;  2WAQ E;  4P75 A;  1PFM A;  3FKI G;  3J81 i;  1PFB A;  3G6J B;  2D5D A;  1GUS A;  1STE A;  2WB1 E;  1UAP A;  4M1U B;  4CJ2 C;  1WVL A;  2V4D A;  3HRZ C;  1ET9 A;  1TU2 B;  3I90 A;  1VQD A;  1XXG A;  4OEM B;  4DA2 A;  2K5Q A;  5GQO A;  4B3R L;  3VA5 A;  4DV4 L;  1B70 B;  4JC0 A;  5IP9 G;  3GTL H;  4DV1 Q;  4DNR B;  1Z9F A;  3GV6 A;  2FJ2 A;  2A73 B;  5FLX c;  1HA5 A;  1Y8N B;  1K8O A;  4QQB X;  3C46 A;  1JIC A;  1SYE A;  4HIO A;  2C5C A;  3TME A;  4TRD A;  3OWF A;  1UEA B;  2PQE A;  2YYZ A;  2YU9 H;  1PRT F;  1CHQ D;  3A8J E;  1HCZ A;  2ZM6 L;  1YHA A;  4A3M H;  1SE2 A;  1S3O A;  1VQP A;  5TSS A;  5CMD A;  4HCS A;  2G5D A;  3DXJ C;  2RVL A;  4OEL B;  3GV3 A;  4QB4 A;  2K5V A;  1KDA A;  1VS0 A;  3BVG A;  3PV0 A;  3K7A H;  1XMO L;  2VUM G;  4K2K A;  1Z7T A;  1Q8I A;  3H6M A;  1N8R C;  3J7A V;  1B8A A;  1VQ6 A;  4BBR G;  2LSS A;  3NUC A;  1A15 A;  4OWT B;  5T1G A;  1JQY D;  4B3M Q;  3D4R A;  3R8B A;  1NR4 A;  4ILW A;  1PRT B;  3Q6S A;  4QGU A;  2NWG A;  4Q5V A;  3BYY B;  4J8Q A;  3GTQ B;  2PW7 A;  3GTP H;  3K0X A;  2V1C C;  3W1B A;  1L0Y B;  3I3C A;  2EYO A;  2LXK A;  5IYB H;  3GTO H;  3E0J A;  1QZH A;  5FJ8 G;  2JYO A;  4K8I A;  4FXK C;  2B2U A;  4PZ6 A;  3A8K E;  4KN7 C;  4DK3 C;  3CPF A;  3GP7 A;  4QL5 A;  1ICW A;  2P5Z X;  4X65 Q;  3CCE A;  1AE3 A;  5FO7 B;  3PUX A;  3HOV B;  4HAE A;  2B8F A;  3J7A 5;  1O7I A;  3S1N B;  3EIV A;  3M4O H;  4B3R Q;  2PYK A;  1BF4 A;  2ZTD A;  3L3O C;  4C3H H;  3M3Y B;  3PQI A;  1SYC A;  1ZYR C;  2NVY B;  1YNN C;  1TT2 A;  3HOW B;  4WJ3 M;  3UE0 A;  4DV7 L;  3CME A;  1EIH A;  1PRT C;  2BDO A;  2CQO A;  4FF3 A;  4Y7N B;  4V19 0;  3HKS A;  4WJW A;  1PH9 A;  5C4J B;  4JBM A;  5M5X H;  5JAV A;  2KA7 A;  1I50 H;  4H7B A;  3CCQ A;  2NZH A;  2ZTC A;  3HKZ E;  5C4X G;  4GKK Q;  1I6H B;  2B63 G;  1WTH A;  3OMG A;  4K14 A;  4FP5 D;  1N33 L;  3RLO A;  1PYS B;  2RDH A;  1E2W A;  4RFB A;  4XDX A;  1XMO Q;  1WI5 A;  3S17 B;  4FYD A;  1G6Z A;  4CHT B;  2JA6 G;  1C4Q A;  1HXY D;  5COR A;  2XWJ B;  1A63 A;  1I4P A;  4X64 Q;  5HY6 A;  5IWA L;  3NWS A;  3CXC A;  4IPG A;  4M8A A;  2TSS A;  4P72 A;  3SK8 A;  3W1G A;  5DM6 3;  1QB5 D;  3I73 A;  4BY1 G;  1HR0 L;  5M5Y H;  1Y1W G;  1QVG A;  1WOC A;  1JC7 A;  1STA A;  3CCM A;  2VQF Q;  1VQM A;  2YU9 B;  1Y1V G;  3NTI A;  3HOX G;  4A3M B;  4RKL A;  1ESR A;  1X3Q A;  1X54 A;  3QB3 A;  2Z9H A;  5A35 A;  2JK8 A;  3VR4 A;  1IHZ A;  3KOJ A;  1EU3 A;  1FVI A;  3MEF A;  3H0G H;  1EQT A;  1ICF B;  2K75 A;  1MJC A;  1Y8P B;  4JVZ A;  2Y0S E;  2B2U C;  4A3K H;  3TRZ A;  1IW7 C;  1CZG A;  2WB1 G;  4LJZ C;  5HGQ A;  2F0J A;  3L2P A;  1RTN A;  4MIU A;  2AQ3 B;  1KD1 C;  3NE5 B;  2CH4 A;  4KY5 A;  1QZG A;  3R2I A;  2B2T C;  4R4Q A;  5EQ0 A;  5KNC A;  3R93 A;  3ULL A;  1RL2 A;  2B29 A;  4HTH A;  1OXU A;  5CV5 A;  3OIQ A;  4OWW B;  4P2C B;  1ESF A;  3K6O A;  4X3U A;  4OO1 G;  3BDL A;  2PZU A;  3VYT A;  4C3I G;  1BXT A;  5C6A A;  4YWK A;  4XQN A;  3MC0 B;  4MTN A;  2SDF A;  3C2P A;  1HFN A;  4GKK L;  5ELO A;  4ME3 A;  4BY1 H;  3ITP A;  2OTJ A;  1DOM A;  1TWC H;  2AWN A;  5F2D A;  1N33 Q;  1BQQ T;  3MVV A;  3JAM i;  3QR8 A;  3S1N H;  1PMR A;  2ZJR A;  1SAP A;  4FXD A;  2BA1 A;  3A55 A;  3SE0 A;  1Y1W H;  1K9M C;  2VS1 A;  4HN7 A;  3I4N G;  1SYB A;  2NVY H;  4IJL A;  1L1O C;  5KGU A;  2WII B;  1DOK A;  4BA1 I;  1W6J A;  5J3B A;  4JI5 L;  2UUC Q;  2NUC A;  4HMJ A;  1I94 L;  4RGT A;  3ER0 A;  4JI0 Q;  1LM0 A;  1VQF A;  3H91 A;  4LF8 L;  2RF4 A;  2DY8 A;  3UDF A;  5C44 H;  3KFU A;  1Z6H A;  1G51 A;  4O2D A;  2EYJ A;  2YTY A;  1CTM A;  3GO5 A;  3G4S A;  1I50 B;  2D0P A;  2Q2U A;  1FD7 D;  5E7N A;  3QWN A;  4A3D B;  2WB1 B;  2TMP A;  1I4G A;  1OXS C;  2NTT A;  4K5W A;  4BBS H;  1A2T A;  1M1K C;  2F0V A;  3K7A B;  2Z0S A;  3FKI B;  2BE5 D;  4X3T A;  2I46 A;  3GDE A;  1B44 D;  1FGB D;  4DR3 L;  2RCF A;  5I9P A;  3TP6 A;  1KC8 C;  3P20 A;  3J80 i;  3V05 A;  1U5K A;  1LTS D;  2F0S A;  5EPJ A;  1SRO A;  2N49 A;  2Q8T A;  4ULL A;  2K5D A;  3RMH A;  3GTQ H;  1EY7 A;  1QNU A;  3P1H A;  1SEB D;  3BDO A;  3FEW X;  3GTO B;  2ZM6 Q;  4JW0 A;  2B39 A;  2XSC A;  3CD6 A;  2F0M A;  1SE8 A;  2Z8L A;  5E3F A;  3WWV A;  5E4W C;  1PH2 A;  1NTG A;  1B4O A;  3VYS A;  4FF1 A;  1STG A;  4R4C A;  3S17 H;  4RH6 A;  1P8L A;  1PXU A;  5IT9 c;  3VR3 A;  4LFB L;  3I2Z A;  3I4O A;  5KNB A;  4DNI A;  1SMY C;  4G7O C;  3UDX A;  2Z4I A;  2B2T A;  3EJI A;  2CKZ B;  2RA4 A;  1JB3 A;  3L9A X;  3I91 A;  2J7Z A;  2QCP X;  3CCR A;  2EY2 A;  4LF8 Q;  2ALY B;  4KHZ A;  2F3I A;  3MA2 B;  3OTO Q;  1CA6 A;  2EJG C;  2BDN A;  5J22 A;  3N6R A;  4JPB W;  3UDI A;  1UE1 A;  4CKE A;  5JJL A;  3NXW A;  3SGI A;  4HJ7 A;  4NXN Q;  3CC4 A;  1YZ6 A;  3DHQ A;  5IYC H;  4BY1 B;  1C8C A;  2MHV A;  4ZAI A;  3S16 H;  1TWC B;  2D0O A;  2DNE A;  4DV2 L;  1U4P A;  2NN6 G;  1WD0 A;  1ZEQ X;  4DU9 A;  4KHV A;  3T1Y L;  4GLX A;  2D62 A;  2F0N A;  1EZ8 A;  1LT3 D;  1OXX K;  1WFQ A;  2CFM A;  3PO3 B;  1SDF A;  3O13 A;  3QJY A;  4I7Z C;  4GN3 B;  1LT4 D;  1U4R A;  1B3Q A;  3MFY A;  1CI3 M;  1EYC A;  1NY4 A;  2H5X A;  3J80 E;  2F4V L;  2B2W C;  1YI2 A;  2L11 A;  3E3X A;  2O5J C;  2ATW A;  3T16 A;  3BVM A;  3NEN A;  4DR2 L;  5EBD A;  3TS0 A;  1GD7 A;  4H0L C;  3F2U A;  4QY7 A;  1EY9 A;  2XN9 C;  2H4O A;  3FKI H;  1BUV T;  4J15 A;  4AQY L;  1SND A;  4XYO A;  3X3M A;  1QUQ B;  1TWH B;  2QIL A;  2B8G A;  1VF7 A;  2LY7 A;  4G7Z C;  1VF5 C;  1LTI D;  2AMC B;  2GN5 A;  4HSP A;  4A3L H;  3U4Z A;  4C3H G;  3NTH A;  2NN6 H;  2B63 B;  4DR5 Q;  1AE2 A;  3AFP A;  2WV6 D;  3MXG A;  1HR0 Q;  4K0K Q;  1HNX L;  4A3K G;  2MPM A;  4HJ9 A;  1E1T A;  5IOD A;  2E5L L;  3WOE A;  1FJG L;  3HOZ H;  3HOU B;  3Q23 A;  1TWG B;  4LW1 A;  3NSW A;  4X62 L;  1WCM G;  2IX3 A;  1PHJ A;  5C3W A;  3D6C A;  1IYV A;  2KEN A;  1R4P B;  4AYB G;  2MQH A;  5IT9 L;  4KLK A;  4R4O A;  1N36 Q;  1HZB A;  4GN4 B;  3ERO A;  2F0E A;  4LFC Q;  4ZUJ A;  5KYL A;  3T53 B;  5A2Q L;  1BCP F;  5EKK A;  3TZU A;  4A3F B;  1SR3 A;  2BCO A;  2EXD A;  1Y1W B;  3T56 B;  4WFN 3;  1NAP A;  3CCS A;  2XNA C;  3OSO A;  4IO9 A; 
#chains in the Genus database with same CATH homology
 3HOV H;  1GO3 E;  2Q2T A;  2WB1 E;  1EQQ A;  1KL9 A;  4GNX B;  4HJ8 A;  1UE5 A;  1SRU A;  4LUZ A;  4LF9 Q;  5IP9 H;  2UXC Q;  4HJ5 A;  4JYA L;  5C0X J;  1NMF A;  3HOW H;  1HNZ L;  4P71 A;  2NZO A;  2HIX A;  4L5T A;  1VQD A;  4JI2 Q;  3GTK H;  4JI6 Q;  1HZA A;  1OTC A;  3A0J A;  2OQ0 A;  1FL0 A;  3FHW A;  1CSQ A;  5GQO A;  4B3R L;  2QGQ A;  4YHH L;  3KF6 A;  4DV4 L;  1B70 B;  4JC0 A;  1IBL Q;  2BA0 A;  2GVB A;  4LFA Q;  1E7Z A;  1I94 Q;  1EFW A;  1VQJ A;  5IP9 G;  3J7Z C;  3Q8D A;  5AJ3 Q;  4DV1 Q;  3GTL H;  1Z9F A;  2IHF A;  4DPG A;  2AWO A;  4JI8 Q;  5FLX c;  1VQN A;  1VQO A;  4DR1 L;  3ZJY C;  4A75 A;  4QQB X;  4NPS A;  1VQG A;  3H0G G;  4YY3 L;  2R93 G;  4HIO A;  1X3G A;  1W3S A;  3S2D H;  1YNX A;  1I6H H;  1IBM Q;  4BXX H;  1KRS A;  1PH5 A;  2YYZ A;  2YU9 H;  2HHH L;  2ZM6 L;  3PO3 H;  1YHA A;  4A3M H;  2F4V Q;  1S3O A;  1VQP A;  4DUZ Q;  1JB7 A;  4LF5 Q;  4GLV B;  2MFI A;  4C2M H;  4HIK A;  1PH6 A;  2HIV A;  4AH6 A;  2ZTE A;  1Q86 C;  2K5V A;  1VS0 A;  3HFZ B;  3PV0 A;  3KF6 B;  5M3M H;  3HOW G;  2UUA Q;  3K7A H;  1XMO L;  2YV5 A;  5FLM G;  1R9T H;  2VUM G;  1JT8 A;  1N8R C;  4JOI C;  3S1M H;  3FP9 A;  4RG1 A;  1B8A A;  3CCJ A;  4NXM L;  2ASB A;  1VQ6 A;  3M4Q A;  1Z47 A;  4BBR G;  2LSS A;  3F8T A;  1IXR A;  4IPC A;  1LYL A;  4LUV A;  4OWT B;  4AQY Q;  4KHP L;  4B3M Q;  1ASZ A;  3KDF B;  4IPD A;  3CW2 C;  3MXN B;  3GD7 A;  4JBW A;  4L5Q A;  1N34 Q;  3TRE A;  1FGU A;  2K4K A;  3W5O A;  4QGU A;  4OWX B;  1E3P A;  5AJ3 L;  2QEX A;  2UU9 Q;  4PMW A;  4DV5 L;  4LF7 Q;  2JJQ A;  4DR5 L;  1MJE A;  4JI0 L;  3EN2 A;  3GTP H;  2BH2 A;  3K0X A;  2V1C C;  3W1B A;  2R7D A;  4IOA A;  4JI1 Q;  5IYB H;  2LXK A;  3PCO B;  2K14 A;  4GN5 A;  2JA9 A;  4O0A A;  3D31 A;  4YCU A;  5FJ8 G;  5C0X G;  3F2B A;  1S72 A;  1QZH A;  2E5L Q;  1FJG Q;  3PO2 H;  3TS2 A;  4YCW A;  3CP0 A;  1EYG A;  4BY7 H;  1E24 A;  1C0A A;  4LF9 L;  2R93 H;  3CPW A;  4NB3 A;  4DR6 Q;  2JA5 H;  4PZ6 A;  3S1Q H;  4DK3 C;  2E2I H;  1X3E A;  3CPF A;  2PQA A;  3S1R H;  1HNZ Q;  4QL5 A;  3M7N A;  4JI7 Q;  4YWM A;  5ELN A;  4X6A H;  4LF6 Q;  5IYD G;  4X65 Q;  3CCE A;  2IX0 A;  5IE8 A;  4GNX C;  1AE3 A;  2PMZ E;  3E9I A;  4APV A;  5C44 G;  3PUX A;  2XTI A;  3F2C A;  4JI2 L;  2RCN A;  5BR8 Q;  3J7A 5;  1O7I A;  4LFC L;  3E0E A;  1V1Q A;  1WYD A;  3EIV A;  3JAM c;  2Z6K C;  3M4O H;  3NEL A;  4B3R Q;  4TQU S;  1CKN B;  2ZTD A;  3GTG H;  4C3H H;  4A3F G;  4DV6 L;  1AH9 A;  5FLM H;  3EBE A;  2VUM H;  4WJ3 M;  1KXL A;  1K3R A;  3OTO L;  2K5H A;  5M3M G;  3UE0 A;  4X66 L;  1X3F A;  4DV7 L;  4POF A;  3CMA A;  3CME A;  2CQO A;  2IT1 A;  4B3T L;  1IL2 A;  2ES2 A;  1XNQ Q;  5C4X H;  1MIU A;  3S15 H;  3HKS A;  4X65 L;  1PV4 A;  1PH9 A;  4JBM A;  5GAG C;  5M5X H;  5IWA Q;  3HOU G;  1I50 H;  4DAY B;  3CCQ A;  2QA4 A;  1C7Y A;  2NZH A;  2LXJ A;  3I7F A;  1HNX Q;  2ZTC A;  4LF5 L;  4DUZ L;  4Y7N H;  3HKZ E;  4UPA A;  4UP9 A;  4IPH A;  2JA5 G;  2JEA I;  2EQS A;  5C4X G;  4GKK Q;  4QJF A;  2IY5 B;  4EQ5 A;  3ERS X;  2VY3 A;  3T1Y Q;  1XTD A;  2E2J H;  2VQF L;  2VQE L;  1WJJ A;  2B63 G;  3RZO H;  5IYB G;  1N33 L;  4IFD G;  5GAD C;  1CKN A;  1GVP A;  3RLO A;  1PYS B;  4LUO A;  4GOP C;  1XMO Q;  1IZ6 A;  1WI5 A;  3KDF A;  4A3B H;  3HKZ G;  2JA6 G;  4BBR H;  1WCM H;  1EIY B;  1A63 A;  3PF4 A;  1CSP A;  1VQK A;  3CAM A;  4X64 Q;  5HY6 A;  1Q46 A;  5IWA L;  1PH1 A;  3RLF A;  3CXC A;  4DR2 Q;  4IPG A;  4KHP Q;  1CUK A;  3L7Z C;  4KI0 A;  1GM5 A;  4P72 A;  1GKH A;  3W1G A;  4DR3 Q;  4BY1 G;  1HR0 L;  2MO0 A;  3BZK A;  5M5Y H;  1Y1W G;  1QVG A;  1WOC A;  3CCM A;  3KJO A;  1EWI A;  2VQF Q;  1VQM A;  4X66 Q;  4IOC A;  1Y1V G;  1K73 C;  5H1S E;  1HZC A;  3HOX G;  1K0R A;  1RIP A;  4GKJ Q;  4JG2 A;  4R4I A;  1X54 A;  1IBK Q;  2E2H H;  4L5S A;  4LF4 L;  2ZJQ A;  1VQA A;  1Q1B A;  2JK8 A;  4JI3 L;  3RNU A;  2NVT H;  4GS3 A;  3I4M G;  3KOJ A;  1KIX A;  2GVA A;  4TVA B;  1FVI A;  4AYB E;  3MEF A;  3H0G H;  3J81 j;  2VL6 A;  4UP8 A;  4X64 L;  5GAH C;  2K75 A;  3RLN A;  1Y1V H;  1MJC A;  2Q2I A;  1CKO A;  3PO3 G;  4LF6 L;  1SFO H;  1A8V A;  4DV0 L;  1YJW A;  1VQ9 A;  2EIF A;  1X65 A;  2Y0S E;  4DK6 C;  4A3K H;  3TRZ A;  4P73 A;  4GOP B;  4A3G H;  2WB1 G;  3L2P A;  5HGQ A;  3K8A A;  4OON A;  1X6O A;  3G71 A;  1HJP A;  4A76 A;  4A3J H;  1KD1 C;  2E8G A;  3K80 C;  3PSI A;  3NBH B;  3A5U A;  1QZG A;  5C3E G;  2PI2 A;  1L1O B;  1S40 A;  4X62 Q;  3I56 A;  1HNW L;  5IYD H;  4R4Q A;  4DV6 Q;  1K8A C;  2AHO B;  1Q82 C;  1DGS A;  3M9B A;  1VQ4 A;  3ULL A;  1PH8 A;  1D7Q A;  1RL2 A;  3PUV A;  4JI3 Q;  3HOZ G;  2B29 A;  2B63 H;  3PIP A;  3STB D;  4A3B G;  1OXU A;  3I4M H;  4OWW B;  4A3J G;  4ALP A;  1Q12 A;  1I5F A;  4IFD I;  4LWC A;  3CCL A;  3M3Y H;  1PH3 A;  2K5N A;  4OO1 G;  4B3S Q;  1L2F A;  1XPU A;  4DV0 Q;  1OXT A;  1YJ9 A;  4YWL A;  3IRB A;  1B7Y B;  3T1H L;  4A93 G;  1J6Q A;  4YWK A;  4JI5 Q;  2I0Q A;  3CQZ H;  4MTN A;  4GKK L;  3B6Y A;  5ELO A;  4ME3 A;  4BY1 H;  1I3Q H;  1X55 A;  1BVS A;  1PYB A;  4Y52 H;  2YTX A;  1XMQ L;  4IJH A;  2OTJ A;  1TWC H;  2PI2 E;  2AWN A;  1N33 Q;  4A93 H;  2I5L X;  3A5Z B;  3HOX H;  5C4J H;  5FJ8 H;  3AEV A;  2UUB Q;  3JAM i;  4A3E H;  4JI4 Q;  3S1N H;  2ZJR A;  3AFQ A;  5JJK A;  4A3I H;  1XNR L;  2BA1 A;  1PA6 A;  1JMC A;  4R4T A;  2NVQ H;  2AKW B;  1Y1W H;  2JA6 H;  4IFD J;  1UWV A;  3UDG A;  3H3V I;  1PVO A;  3KYH C;  1K9M C;  3S24 A;  1KAW A;  1W2B A;  2VS1 A;  1JJ2 A;  4RMF A;  3PUZ A;  3I4N G;  2L15 A;  4A3C G;  2NVY H;  4IJL A;  1L1O C;  1N32 L;  4C3I H;  3GTO H;  4BA1 I;  1JE5 A;  5J3B A;  4JI5 L;  1D8L A;  3BZC A;  2WP8 J;  3KLW A;  3ULJ A;  1I94 L;  2UUC Q;  1Y14 B;  4LFA L;  3M85 A;  1X56 A;  3ER0 A;  2B3G A;  4JI0 Q;  1G6P A;  4A3D G;  1LM0 A;  1VQF A;  4LF8 L;  2RF4 A;  3UDF A;  5IY0 A;  5C44 H;  3D0F A;  3LGJ A;  4XTC S;  5LMU Q;  3KFU A;  1G51 A;  4JBJ A;  4O2D A;  2I5H A;  2YTY A;  3GO5 A;  1KQS A;  5GAE C;  2CWP A;  3G4S A;  1VCI A;  1G29 1;  5M3F H;  1Q81 C;  2D0P A;  2PQA B;  3PGZ A;  2Q2U A;  1HZ9 A;  4PG3 A;  5E7N A;  2OCE A;  2RHS B;  4DR4 L;  5EAY A;  4JI7 L;  1E22 A;  2A1A A;  1TWF H;  1OXS C;  3OW2 A;  1J5E L;  2JEB I;  2YTV A;  4OX9 L;  4BBS H;  4LFB Q;  1M1K C;  1N34 L;  1Q7Y C;  4HIM A;  2VZA A;  2I5M X;  2Z0S A;  3TEH B;  1YIJ A;  4A3D H;  4OO1 I;  3CF5 A;  3GDE A;  4R1J A;  4OXP A;  2UUA L;  4P74 A;  3KF8 B;  4PZ8 A;  4DR3 L;  1EUJ A;  3OYY A;  3I55 A;  4JI4 L;  4DV7 Q;  4GNX A;  1KC8 C;  2A8V A;  1YBY A;  2HT1 A;  2VNU D;  3J80 i;  4YCV A;  1U5K A;  1VQI A;  2R6G A;  3AQQ A;  1XNQ L;  3AYH B;  4UP7 A;  2DGY A;  5GRO A;  4A3I G;  2NN6 I;  1SRO A;  4DR7 L;  4LNQ A;  2N49 A;  4YY3 Q;  1MKH A;  1UEB A;  1BBW A;  3GTQ H;  2VW9 A;  4EX5 A;  3T1H Q;  1SMX A;  1NJI C;  2JA7 H;  4B3S L;  5LMN L;  3RR5 A;  4B3M L;  1V9P A;  2ZM6 Q;  1E1O A;  4DV2 Q;  5LMU L;  3CD6 A;  1UE6 A;  3JC6 6;  4L5R C;  1SE8 A;  1TWH H;  2MO1 A;  3F2D A;  2PNH A;  1Q1E A;  3PUY A;  2ZJP A;  2XGT A;  3WWV A;  1PH2 A;  1NTG A;  1VQL A;  5JEA J;  2BH8 A;  3UE1 A;  1VQC A;  1BKB A;  3TQY A;  4R4C A;  3E9H A;  1P16 A;  4FDB A;  5DLQ E;  4DV3 L;  2Q2H A;  1P8L A;  5IT9 c;  1XJV A;  3S17 H;  3ULP A;  2UXB L;  4OX9 Q;  4LFB L;  3I2Z A;  3RZD H;  2R7Z H;  4AIM A;  1YHQ A;  1N32 Q;  3I4O A;  1XPR A;  4JCV E;  4DNI A;  2OWO A;  3HOU H;  1TWG H;  5BR8 L;  1YEZ A;  2KHI A;  2R7F A;  3UDX A;  4DAM A;  2OQK A;  1JJC B;  2CKZ B;  4JOI A;  1VQ8 A;  3KJP A;  1LUZ A;  4DKA C;  3ICE A;  4DV5 Q;  4LF7 L;  3CCR A;  1EOV A;  2KHJ A;  2ALY B;  4KHZ A;  2F3I A;  3OTO Q;  5C0X I;  4LF8 Q;  4JV5 L;  3J80 c;  4GKJ L;  1YJN A;  3U58 A;  3UDI A;  1UE1 A;  5JJL A;  3SGI A;  1VQ5 A;  1HR0 W;  4POG A;  4HJ7 A;  4NXN Q;  3CC4 A;  4BXX G;  4DR4 Q;  2UXC L;  4A3F H;  1YZ6 A;  1V43 A;  3HOY H;  5IYC H;  1JJG A;  1J5E Q;  4A3E G;  2FXQ A;  4NXM Q;  4DR6 L;  3HOV G;  2ID0 A;  2JQO A;  3PO2 G;  3S16 H;  2WAQ G;  2NVX H;  4JI6 L;  4A3G G;  2D0O A;  4DV2 L;  1T9H A;  2NN6 G;  2JA8 H;  2UXD Q;  1YVC A;  2IHE A;  2WFW A;  1KRT A;  3T1Y L;  3BU2 A;  1QVC A;  2A19 A;  5K36 G;  4GLX A;  1SLJ A;  2DUD A;  2UU9 L;  3VDY A;  2D62 A;  3CCV A;  1X9N A;  1U0L A;  1XMQ Q;  4K0K L;  1WFQ A;  1OXX K;  1YHB A;  2N3S A;  2CFM A;  3GTJ H;  4PZ7 A;  1IBK L;  1L1O A;  3GTM H;  4JI1 L;  4DR7 Q;  5LMN W;  5JEA G;  1N9W A;  2CWA A;  4GN3 B;  1L0W A;  1LTL A;  2OTL A;  1NY4 A;  2H5X A;  3L0O A;  4GOP A;  2F4V L;  2UXD L;  1YI2 A;  2JA7 G;  5C3E H;  1TXY A;  2IX1 A;  3STB C;  4A4I A;  1N36 L;  4XIG S;  1VQB A;  2ATW A;  1EQR A;  2K50 A;  1NMG A;  5LMN Q;  4A3C H;  2Y0S G;  3H15 A;  3NEN A;  4DR2 L;  3M4P A;  5IP7 G;  3PF5 A;  3TS0 A;  1ASY A;  4DV4 Q;  1A62 A;  4C3J H;  3G6E A;  3CC7 A;  4MNO A;  1GD7 A;  4NXN L;  2R92 G;  4BY7 G;  4QY7 A;  1PH7 A;  4DR1 Q;  3S2H H;  2C35 B;  3FKI H;  4H02 A;  3J81 c;  2HQL A;  1QVF A;  2RHQ B;  4J15 A;  5M5W H;  5IYC G;  1OXV A;  4AQY L;  3PIO A;  4DV3 Q;  3DM3 A;  3HOY G;  1QUQ B;  2JE6 I;  4LF4 Q;  3A74 A;  1VQH A;  2CCZ A;  5M3F G;  2Z6K A;  2HHH Q;  2UUC L;  4JBK A;  3H3V H;  1NE3 A;  2AMC B;  2GN5 A;  3U50 C;  2R92 H;  4A3L H;  3S14 H;  1TWA H;  4BA2 I;  3U4Z A;  1XPO A;  4DUY Q;  2JA8 G;  4DR5 Q;  5JJI A;  1AE2 A;  3NEM A;  1K8G A;  1A0I A;  3AFP A;  2MNA A;  1HNW Q;  4WJ4 A;  4JV5 Q;  4QIW E;  4B3T Q;  1K83 H;  1C9O A;  1HR0 Q;  4K0K Q;  1HNX L;  3G48 A;  4A3K G;  3BJU A;  4GLA C;  4HJ9 A;  1HH2 P;  4HJA A;  1E1T A;  1EIF A;  2E5L L;  1FJG L;  3HOZ H;  3F1Z A;  2F52 A;  2UUB L;  3U4V A;  2KCM A;  4DV1 L;  1CKM A;  2N78 A;  1IYJ B;  4LW1 A;  4X62 L;  1WCM G;  2R7Z G;  4A3L G;  3DLL A;  3I4N H;  2KBN A;  1PHJ A;  1BBU A;  2VQE Q;  4JI8 L;  1SN8 A;  1KHI A;  3RN5 A;  1YIT A;  2KEN A;  4AYB G;  2MQH A;  4KLK A;  4R4O A;  1PH4 A;  4UY8 C;  4MZ9 A;  1N36 Q;  2UXB Q;  1HZB A;  2N8N A;  4GN4 B;  3K7U C;  3CC2 A;  4HID A;  4JYA Q;  4DUY L;  4LFC Q;  1QUQ A;  4A3M G;  1VQE A;  1IBM L;  1PFS A;  1VQ7 A;  1UE7 A;  1NBW A;  1H95 A;  4BBS G;  1SR3 A;  2K52 A;  5IP7 H;  3PUW A;  3CCU A;  4YHH Q;  3RN2 A;  2EXD A;  2KCT A;  1IBL L;  3K81 C;  2WAQ E;  1Q8K A;  4P75 A;  1M90 C;  3CCS A;  3FKI G;  3J81 i;  1XNR Q;  4IO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...