3RZDH

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rzdH00
1EOVA 1SFOH 1I50H 1VQBA 3FP9A 4LUVA 4NPSA 2Y0SE 4JC0A 4OXPA 4YY3L 5IT9c 1KC8C 1IL2A 3CD6A 4A3DH 4AIMA 3KFUA 3M9BA 3PUZA 4DAMA 5C0XJ 1PHJA 1PYBA 3S1MH 2LXKA 2Z6KC 1LYLA 1X54A 2EIFA 4C3JH 1NBWA 1UWVA 3PUVA 4A4IA 4YHHQ 4QGUA 1KQSA 2OTLA 4JI6L 1XNRL 1UE6A 2UXCQ 1B8AA 2ZTCA 1PVOA 2OQKA 1BBUA 4PZ8A 1MIUA 2E5LQ 2JA7G 1FJGL 4DKAC 3CXCA 4DUZQ 3AFPA 2IT1A 1YJNA 3G71A 1IBLQ 4JI1L 2E2HH 1XPOA 2LSSA 1ASZA 3HOXG 4A3BG 1PA6A 3KF8B 1J5EQ 2K52A 2ZTEA 2Z6KA 4LFAQ 1E7ZA 1Y1WG 2F52A 4YWMA 1XMQQ 1EIYB 2KENA 2JA6H 1KHIA 4QJFA 2ZM6Q 2VQFQ 1HNZQ 2E8GA 5IP9G 4YWKA 5ELOA 4PMWA 3FHWA 3TQYA 3E9HA 4A3IG 1XNQQ 3M85A 3GTOH 1VQEA 2UUCL 4TQUS 1PH2A 2JJQA 2ALYB 1WCMG 1Y14B 4HIMA 3EN2A 4YCWA 1YJ9A 1L1OB 3KLWA 3PGZA 1GD7A 1OXTA 2LXJA 3D0FA 4YHHL 5FJ8G 3UDFA 2JA5G 4BXXH 4R4OA 3G4SA 2UXCL 4FDBA 5GAEC 4BBRH 4LF4Q 3I7FA 2E5LL 1X3FA 4X66Q 3M4QA 3OW2A 4DUZL 1VQFA 1IBLL 1OXVA 4JBJA 1JB7A 1JJCB 2GVAA 2NZHA 4A3CH 2CWPA 3T1HQ 2VS1A 3HKZG 1J5EL 5JJKA 1BVSA 5IWAQ 1SR3A 1XMQL 1CSPA 4LFAL 1O7IA 3HKZE 3ULLA 2MFIA 4JOIA 2ZM6L 3BU2A 2VQFL 1HNZL 2JEAI 4LF5Q 2HT1A 1XPUA 5DLQE 3JAMc 2E2IH 1XNQL 1PYSB 3HOYH 4DR4Q 1WFQA 1CUKA 5J3BA 5LMNL 1CKNB 3M4PA 5FLXc 1SROA 3HOWH 3GTLH 1N9WA 3JAMi 3S1QH 2AWNA 1HNXQ 1Z9FA 2YV5A 3PUYA 4JBWA 4DR6Q 3J81j 2VNUD 4B3MQ 4EX5A 3K80C 1HR0W 4DV5Q 4JI3Q 3W1GA 1VQLA 1B70B 4JYAQ 2C35B 3UDIA 3PF5A 1VQ7A 3J81i 2YU9H 4HIDA 1DGSA 1YJWA 3G6EA 4A3LG 2CCZA 2IHFA 2VQEQ 2YTVA 1BBWA 3T1HL 4MTNA 5C44H 5IWAL 3CCEA 1EQRA 4BY7H 1YNXA 2YTXA 1HZ9A 3TS0A 4GKJQ 3ERSX 4HJAA 1VQDA 4QIWE 1KRSA 4HJ8A 1YHQA 4A3FH 1E24A 3E0EA 4LF5L 1N33Q 1JJGA 4BA1I 3CCMA 2RCNA 1QVGA 4LNQA 1HH2P 2PI2E 2NN6G 2PQAB 2D62A 2R92G 1X3GA 2Q2IA 4JI0Q 3AFQA 2JQOA 3K8AA 1Q46A 1GVPA 2RHSB 3K0XA 5M3MG 1VCIA 1HNXL 4DR6L 4B3ML 4DV0Q 3ICEA 4JI3L 4Y7NH 3CP0A 2ZJRA 1U0LA 4DV5L 1XTDA 4LF8Q 5IYDH 2BA0A 1SMXA 2JA8G 4JYAL 1NTGA 2K14A 2HHHQ 4MNOA 3KF6A 5BR8Q 4AYBE 3T1YQ 4A3GG 4A3EH 3UE1A 1D7QA 4DR1Q 1K83H 1JE5A 1X65A 4TVAB 5M3FG 3MEFA 3PO2G 4GKJL 2WB1E 1FGUA 3K7AH 3KOJA 1KAWA 2D0OA 2CKZB 2UU9Q 4GLXA 2K75A 1K3RA 3RLOA 3UDGA 1PH3A 2YTYA 5GQOA 4JI0L 3H0GG 1HNWQ 1UEBA 5JJLA 1AE3A 1PFSA 1VQIA 5HY6A 3RZDH 1NMGA 4DV0L 4B3RQ 3HOVG 3HOXH 3GTGH 4A3BH 4LF8L 4ALPA 1Y1WH 2PNHA 4KLKA 2MQHA 3EBEA 1HZAA 2CQOA 3LGJA 4YCUA 1A8VA 4DV1Q 2N78A 1IXRA 2HHHL 2UUCQ 3S16H 5BR8L 3T1YL 3KDFB 3CCVA 4DR1L 1CSQA 1VQ8A 2OWOA 4L5QA 3TEHB 4LF7Q 2A8VA 2OTJA 3PV0A 4R4IA 2Q2HA 3MXNB 3K81C 3VDYA 1WCMH 5IYCH 3F2BA 1YIJA 1Q1EA 2UU9L 3M3YH 4P73A 2UXBQ 1VS0A 2K5NA 3E9IA 3HOZG 5FJ8H 1YHAA 4C3IH 4LFBQ 4Y52H 3Q8DA 3GTQH 4L5SA 4GOPB 3PUWA 1EWIA 1MJCA 1I3QH 3KJOA 1HNWL 1VQCA 3B6YA 1G6PA 1I94Q 5HGQA 2YYZA 2HQLA 4APVA 1PH9A 5M5WH 1P8LA 4JBKA 4JBMA 4DNIA 4B3RL 1V9PA 1W3SA 3F8TA 2I5HA 4A3MG 3HKSA 1J6QA 2B29A 3GD7A 3RN5A 4POFA 1X6OA 3RLFA 4DV1L 1VQ9A 5LMNQ 1IBMQ 1X3EA 4BY1G 1K0RA 3CCUA 2QA4A 1Y1VG 4DR5Q 2D0PA 4OX9Q 4O2DA 1TWFH 3CQZH 3RNUA 4LF7L 2NZOA 2NVTH 4LFCQ 3M4OH 4BBSG 3NELA 1RIPA 4WJ4A 3AYHB 2UXBL 4AQYQ 2F3IA 4A3JH 2MO1A 3PO3H 1VQKA 4PG3A 4IFDI 1Q7YC 4HIKA 1NE3A 4LFBL 2K50A 1HR0Q 4A3DG 2JE6I 1X56A 3CAMA 2R93G 1I94L 1WI5A 2I0QA 4OONA 1K8AC 3K7UC 4GOPC 3GTJH 1HZCA 2NVYH 2MO0A 3PIOA 2CWAA 5GADC 1XMOQ 1E1TA 3U4ZA 2R6GA 1CKOA 2OQ0A 4H02A 4C3HH 3H3VI 1VQGA 2GVBA 1A0IA 1YHBA 1IBML 2AKWB 4QQBX 1V1QA 3I4MH 4DR5L 4IOAA 2NVQH 4OX9L 2QGQA 1Z47A 2R92H 5IP7H 2L15A 2IX1A 4IPCA 1RL2A 4LFCL 1PH8A 2XTIA 3CMEA 3J81c 1YBYA 4GOPA 2JA6G 2OCEA 1L1OC 4AQYL 2N49A 1Q81C 2HIVA 5M3MH 4QY7A 3I4NH 4GLVB 3CMAA 1HJPA 3J80i 4NB3A 1PH6A 3PUXA 1HR0L 1N32Q 1QVFA 5EAYA 4O0AA 4A3KG 1NMFA 2A1AA 4KHPL 4GKKQ 1B7YB 3KYHC 3S14H 3GDEA 4MZ9A 4GLAC 3CCJA 1XMOL 4JI4Q 2K4KA 1M90C 4BXXG 1N36Q 5FLMG 1SN8A 4OO1I 3CF5A 1L1OA 4LW1A 4BBRG 5C4XH 5ELNA 4POGA 3L7ZC 2B63H 4OO1G 2AHOB 1NJIC 4A3CG 4BA2I 1H95A 4DPGA 4R4TA 4XIGS 2WP8J 2VW9A 1TWHH 1EQQA 4OWTB 4DV7Q 3H0GH 3NENA 4DK3C 5C3EH 2I5LX 1UE7A 2KCMA 4YWLA 5IE8A 3PIPA 2HIXA 2R7ZH 3HOYG 3CCRA 4GNXB 3HOVH 1X9NA 1KD1C 1N32L 1VQHA 3GTMH 3H15A 3PF4A 3HOWG 4IPGA 1VQ5A 4GKKL 2N8NA 5H1SE 3S1RH 4JI4L 1CKNA 2K5VA 4DR3Q 4GN3B 2PMZE 3F2DA 1S40A 1N36L 3I4OA 1M1KC 4JV5Q 2IX0A 1C9OA 1V43A 2MNAA 5C4JH 4HJ9A 4UP8A 3STBC 3A0JA 3UDXA 1L0WA 2VUMG 1W2BA 1VQ6A 2JA7H 2FXQA 4UPAA 4KI0A 5C44G 5JEAG 1Q82C 1A62A 3G48A 2UUBQ 3A74A 4UY8C 1XPRA 4L5RC 3RR5A 2E2JH 3TREA 3CPFA 4DV7L 5K36G 3CCLA 4B3SQ 4A3FG 4IOCA 1K9MC 4OWXB 4LF9Q 1OXXK 1D8LA 3GO5A 2EXDA 3A5ZB 2XGTA 2H5XA 1VQJA 5IP9H 2EQSA 4X64Q 3OYYA 3L2PA 4HJ5A 4A3IH 3S2HH 3A5UA 2PQAA 4GNXC 5C0XI 1YI2A 1TWGH 4JI8Q 4BY1H 1SLJA 2V1CC 4DR3L 1I6HH 5IYDG 3IRBA 1CKMA 4JV5L 1C0AA 4JI7Q 3HOUG 1G51A 3F1ZA 1FVIA 4PZ6A 2N3SA 2ZTDA 2ES2A 2JA5H 4BBSH 4RMFA 4P72A 4XTCS 2KCTA 3I2ZA 1Q86C 4A93G 4JG2A 3ULJA 1QZHA 4A3EG 2NVXH 1G291 3CW2C 1GO3E 1Q8KA 2UUBL 3AEVA 1AH9A 3UE0A 4GN5A 5IYBG 1JT8A 2VZAA 4GNXA 4X65Q 4QL5A 3DM3A 3PSIA 1YITA 1EFWA 4EQ5A 1IBKQ 3RZOH 4C2MH 2JEBI 3ER0A 4B3SL 3W1BA 4PZ7A 4LF9L 1AE2A 4A76A 3S15H 3NEMA 2GN5A 1QUQB 1E3PA 1YZ6A 4R1JA 2BH8A 3U4VA 4OWWB 4X64L 3RLNA 4ME3A 3L0OA 4IPHA 3OTOQ 3FKIG 4JI8L 3CCQA 1VQ4A 1EYGA 5M5YH 5LMUL 3H3VH 4DV4Q 2JA9A 2PI2A 3DLLA 2AMCB 4B3TQ 4L5TA 1P16A 4RG1A 4DAYB 4JI7L 1YVCA 2ZJQA 1TWAH 3S1NH 2AWOA 5GAGC 2K5HA 1S72A 2Q2UA 1WOCA 3TRZA 2WAQG 4HIOA 2DGYA 4IFDG 2ZJPA 3U58A 4KHPQ 1SE8A 2WAQE 1GM5A 2F4VQ 1K73C 1FL0A 4A3LH 4X65L 5GAHC 3KJPA 4DV6Q 1KL9A 1IBKL 5IYCG 4A3KH 3ULPA 1KXLA 3KDFA 4DUYQ 2VL6A 3CC7A 1PH7A 4AH6A 4JOIC 2UUAQ 1JMCA 4IFDJ 5AJ3Q 1EIFA 5FLMH 4K0KQ 1LM0A 1NY4A 2KHIA 4JCVE 1PV4A 1MJEA 2R7FA 3OTOL 1A63A 1Q1BA 1MKHA 1IYJB 1N8RC 1VQOA 3J80c 1OXSC 1S3OA 4DV4L 3WWVA 3SGIA 1VQNA 4B3TL 1YEZA 3S2DH 2BA1A 3BZCA 4LF6Q 1PH5A 1HZBA 2Z0SA 3GTPH 5LMNW 4P71A 3KF6B 2IY5B 4KHZA 3CCSA 1ASYA 4IPDA 2JA8H 2R93H 1E1OA 2UXDQ 4HJ7A 4IJLA 1VQAA 1UE5A 2CFMA 3BZKA 3I55A 4JI5Q 4DV6L 1QUQA 2F4VL 3CC2A 5IY0A 4A3GH 4A3JG 1LUZA 2JK8A 3PO3G 3JC66 5M3FH 4DUYL 2VY3A 1PH4A 1X55A 4NXNQ 3PO2H 1N34Q 2IHEA 4A75A 2UUAL 1TXYA 5AJ3L 1UE1A 2A19A 3HFZB 4K0KL 1Q12A 4LF4L 4X66L 3CC4A 1IZ6A 3GTKH 2RF4A 4J15A 1R9TH 3EIVA 2VUMH 2WFWA 4DV2Q 2B3GA 1SRUA 4R4QA 1L2FA 4JI2Q 4R4CA 3AQQA 4X62Q 4LF6L 2NN6I 3TS2A 1VQMA 3S17H 3I4MG 4P74A 5GROA 3J7ZC 2KHJA 1XJVA 1PH1A 4DR7Q 5JJIA 2UXDL 5IP7G 4NXMQ 4DR4L 4JI5L 4X6AH 4DR2Q 1WYDA 4GS3A 1VQPA 3M7NA 1QVCA 4YCVA 3S24A 5M5XH 1KIXA 1LTLA 4LWCA 4NXNL 1EUJA 3CPWA 3F2CA 1N34L 3I4NG 4DV3Q 2KBNA 2DUDA 3RN2A 2ID0A 1JJ2A 1U5KA 3HOZH 3D31A 3HOUH 4AYBG 2Q2TA 4BY7G 1TWCH 3NBHB 4LUZA 4YY3Q 5E7NA 4GN4B 1KRTA 2VQEL 4UP7A 1OXUA 4LUOA 4A93H 1WJJA 2WB1G 4DV2L 2BH2A 3J7A5 1T9HA 2RHQB 4JI2L 3U50C 1XNRQ 4JI6Q 4P75A 5IYBH 4X62L 1QZGA 5C4XG 2B63G 1E22A 5JEAJ 2I5MX 3W5OA 4A3MH 4IO9A 1K8GA 2ASBA 1N33L 4IJHA 3STBD 1FJGQ 1C7YA 4DR7L 2QEXA 4NXML 4JI1Q 4DK6C 3PCOB 3ZJYC 1BKBA 1GKHA 5LMUQ 1Y1VH 3BJUA 4DR2L 1OTCA 5C3EG 5C0XG 2R7DA 1I5FA 3FKIH 3I56A 2R7ZG 4UP9A 4DV3L 2ATWA 2Y0SG 4WJ3M
chains in the Genus database with same CATH superfamily
2EDGA 1VQBA 3FP9A 2NTTA 1EY5A 4AIMA 1L0XB 3PUZA 5C0XJ 1PYBA 3S1MH 5IGCA 5IIFA 1NBWA 2L0CA 2OTLA 4FO2A 2F0QA 3J80E 1PVOA 2OQKA 2NBFA 4JW0A 3CXCA 3AFPA 5IGDA 5CC4A 2E2HH 1HUNA 1NR4A 3H6MA 1S4ZA 3HOXG 4A3BG 5DNFA 5CORA 3SK8A 2K52A 1J5EQ 2ZTEA 2Z6KA 1E7ZA 2F52A 1LT3D 1KHIA 2E8GA 1ENFA 5IP9G 4YWKA 1ONLA 1D5ZC 2NYZD 1XNQQ 2AUKA 5IGFA 3HOUB 1VF5C 2KCNA 1PH2A 2JJQA 1Y14B 1YJ9A 2LXJA 3NUCA 3JAML 5EPKA 5FJ8G 2JA5G 5ELEA 2UXCL 5EKLA 3K7AB 3R2TA 1JR0D 4X66Q 3M4QA 1VQFA 4FNFA 1M8AA 4JBJA 2WACA 1JB7A 4A3CH 1BVSA 2OT2A 4LFAL 3HKZE 2ZM6L 2VQFL 3ERQA 3URYA 5DLQE 3HZXA 1B4OA 2E2DC 1JOQA 4DR4Q 2B2UA 2L9HA 1ML0D 3M4PA 3HOWH 1N9WA 4JBWA 3R8BA 4EX5A 3VYTA 1TT2A 1B70B 3UDIA 3PF5A 3J81i 5ISRA 4HIDA 1U4LA 2CCZA 2VQEQ 1BBWA 2D5DA 3T1HL 1ET6A 5JEAH 4FF4A 2YTXA 1HZ9A 4GKJQ 2MJ8A 1EYDA 1A3VA 3E3XA 1KRSA 4A3FH 4LF5L 4HCEA 1JJGA 1BR9A 4BA1I 2EY6A 3FEWX 1QJOA 4FXDA 3R3OA 2BCOA 1O7ZA 2RHSB 1HNXL 1C8CA 4IURA 4J1MA 4JI3L 4Y7NH 3CP0A 4DV5L 5LHY1 2BA0A 4RFBA 4JYAL 4A3JB 2QW7A 1ET9A 1QOHA 2HHHQ 1SSOA 4MNOA 3Q0AA 4RHRA 1D7QA 4BS9A 1K83H 2QCPX 1JE5A 1SEBD 1KNAA 1X65A 1FGUA 3NQTA 1KAWA 2XRSD 4FF3A 2WKCA 2CKZB 2UU9Q 1Y8OB 2O5JC 1PH3A 1W6KA 2EYPA 1PZJD 5KYIA 1BCPC 5JJLA 1HNWQ 2J4XA 2X69A 3TP6A 5HY6A 3X3MA 2E74C 3RZDH 1LTBD 2O2LD 3GTGH 1J8IA 5EPJA 2CQOA 4YCUA 1A8VA 4DK0A 3S16H 2SDFA 3OMCA 1G2SA 5IGEA 3TDQA 4DR1L 3PV0A 4R4IA 2Q2HA 3K81C 2PW7A 3M3YH 3F2BA 4P73A 3S14B 1VS0A 2WB1B 2O4XA 4L5SA 1EWIA 1ICFB 2FHTA 4OIJA 5C4XB 1VQCA 2B63B 1G6PA 2LFNA 1L0YB 1V8QA 3WDNA 1ENAA 3P7JA 1J6QA 2B29A 1ZYRD 3RUZA 1FNVA 1X6OA 3RLFA 1VQ9A 1X3EA 4BY1G 1Y1VG 3RNUA 1B53A 3CQZH 3A7LA 4LF7L 5ELFA 1G8ZD 5BN3A 1C48A 1PXUA 5FLXL 4AQYQ 3MXGA 4RGMA 4PG3A 2F0MA 5JPMC 2K50A 4RGTA 5I4DA 2XWJB 5KGUA 5EPLA 1I94L 3VR4A 4OONA 3GTJH 1LACA 2NVYH 1WTQA 2MO0A 4H7BA 2KEEA 3U4ZA 3GV3A 2KJXA 4H02A 4C3HH 1VQGA 4DN4M 4IUTA 3KLSA 1Y1WB 4QQBX 1V1QA 4ZCKA 3I4MH 4DR5L 4IOAA 2NVQH 1EU4A 4IN3A 3IAYA 1RJTA 2NN6H 5IP7H 2L15A 3HRZC 5LL6S 1RL2A 4LFCL 2XTIA 4IUNA 4GOPA 5CBEE 1Q81C 4I7AA 2HIVA 1WCMB 3CMAA 1DOKA 1HJPA 3P20A 1HR0L 3PUXA 1O7YA 1QVFA 5EAYA 3PQIA 1NMFA 2RCFA 1LLRD 4GKKQ 1B7YB 1EY0A 2F0VA 1TU2B 1M90C 4OO1I 1L1OA 2EE1A 3RZOB 1SYDA 1B9MA 1PFBA 3HKZB 1F9PA 1F9QA 3VA5A 4HSVA 2KQ3A 4A3CG 3S15B 1JB3A 3TP8A 4DXFA 1ENCA 3BS1A 1TWHH 1EQQA 1R4PB 4DV7Q 2B2VC 2R3ZA 2A6ED 3H0GH 2NVTB 3H09A 4YWLA 2KCMA 2DNCA 2R7ZH 4PV1C 1N32L 2L55A 4V190 3H15A 3SDZA 3HOWG 4HMJA 5JAVA 3R93A 2H1EA 4JI4L 4ZRZA 4DR3Q 1LT6D 5M9OA 4RGNA 3T51B 5BN4A 4ULLA 1O80A 1I4XA 2JA7H 5JEAG 2UUBQ 1XPRA 2E2JH 3Q22A 2R92B 3CCLA 1I4PA 4B3SQ 4A3FG 4G7OC 3NTHA 1D8LA 1RTNA 1STAA 2CW0D 1QWYA 1HA6A 3A5ZB 3S2DB 3AB9A 2H5XA 2EQSA 4X64Q 3S2HH 3A5UA 1TWGH 2QF7A 4G4KA 3IRBA 4JI7Q 4A3GB 2ES2A 1MD2D 4BBSH 5M3FB 4RMFA 4K2KA 1E2ZA 1IKMA 1G291 3CW2C 3JAME 2BOSA 1AH9A 4GNXA 4HCSA 1B9NA 4QL5A 1YITA 4EQ5A 2AQ1B 5KIXA 3NE5B 3E5SA 4KKUA 3NEMA 1D6EC 1EQTA 4PMCA 1DXMA 1HCZA 3RLNA 3WOEA 1KLUD 5FKAC 2F0UA 5LMUL 3H3VH 2PI2A 1MBYA 1JCKB 4B3TQ 4L5TA 1ICWA 1YVCA 3S1NH 1C4QA 2AWOA 2K5HA 1A3UA 3J80L 5C4JB 1AEXA 5L37A 2DGYA 3U58A 5A35A 1SE8A 2WAQE 1SJED 1K73C 1FL0A 1TWCB 4A3KH 1KXLA 3EROA 2VL6A 3CC7A 1PH7A 5C4ZA 4JOIC 2IX3A 2MPMA 3I4LA 1TS4A 4A3MB 2RSOA 2LMCB 4F7XA 3OTOL 1Q1BA 1N8RC 2K5QA 2BDNA 1S3OA 3WWVA 2BA1A 4LF6Q 3EQLC 1HZBA 5AFWA 3I73A 1EEID 2CHBD 1BOSA 2IY5B 1SNOA 1PFNA 3HG9A 3WOFA 1EL0A 1I50B 1CFMA 3LWUA 3GV6A 1QUQA 3C1EA 2E75C 3JC66 2E76C 2VY3A 3PO2H 1X55A 2MP1A 1IKLA 2UUAL 3AU7A 4C3JB 1GHJA 1UE1A 1B2TA 4K0KL 1XXGA 1BBXC 1E2WA 4DFAA 3FRPB 4J15A 1DYQA 3BZDB 3QR8A 2I46A 4QUCA 4IUVA 1SRUA 4R4QA 4JI2Q 4C3HG 2K6AA 4X62Q 1WTHA 4XDXA 5EKIA 1LT5D 3X3NA 3S17H 2JA6B 3I4MG 2KHJA 1Q8IA 5IP7G 1UAPA 5D65A 2DY7A 3PIP3 4CKEA 3OOCA 1WYDA 4GS3A 2B2TC 3M7NA 4YCVA 4KJOA 1PRTB 1A6XA 4NXNL 1FR3A 2ID0A 1JJ2A 1U5KA 3K0YA 3HOUH 2Z4HA 4BBRB 4LUZA 3GQBA 2Z9HA 1KRTA 3J7YW 1OXUA 4H0LC 5EBDA 1CT1D 1F2MA 4K6DA 1XNRQ 4P75A 2Q8IB 1CZGA 1QZGA 1E22A 1N33L 4NXML 1EEFD 2EPBA 4X3UA 2KEDA 5LMUQ 4DR2L 1OTCA 1PFMA 3HOYB 2QEJC 1I5FA 3GTLB 2R7ZG 4DV3L 2BE5D 3I72A 1EOVA 4DNTB 4OXPA 2Y0SE 4YY3L 1PZKD 2F0LA 1IL2A 4A3DH 2R93H 3M9BA 3DMUA 1PHJA 3D3RA 2LXKA 2Z6KC 2DJGC 1LYLA 1X54A 2EIFA 3PUVA 4JI6L 5C44B 1KABA 2ZTCA 4ZKBB 1AZPA 2JA7G 1FJGL 4DKAC 1QNUA 3G71A 1IBLQ 1F2YA 1WTRA 2LSSA 3KF8B 2B39A 1XMQQ 4YWMA 2KENA 2EY5A 3D4WA 4NMZA 5M5XB 2IL8A 2OF1A 1HNZQ 1U4RA 2F0DA 5ELOA 4PMWA 3FHWA 5KNDA 3E9HA 1CQFA 5E4WC 1ILPA 3M85A 2UUCL 4DNRB 4HIMA 1F2ZA 4M1UB 2RVLA 5C3WA 1HHVA 2K33A 4A93B 3D0FA 3UDFA 4R4OA 1FNUA 2Z8LA 4FDBA 1JWMD 2B2UC 1OXVA 4OO1H 3HS0C 4CJ2C 2N88A 1J5EL 5JJKA 5IWAQ 4O1NA 3T13A 2F0IA 4JOIA 4R8IA 3FKIB 1CI3M 1X3PA 1XNQL 1SFOB 5J3BA 3A54A 2WAQB 2J0TD 5FOBB 1K8OA 2F0PA 1IYUA 3W1GA 3QB3A 1EQVA 3D6WA 1YJWA 3BYYB 3G6EA 2YTVA 2F3WA 4C3IB 2A6EC 1EQRA 3BVGA 1ZEQX 1CHPD 1VQDA 4QIWE 3K5LA 2CH4A 4HJ8A 2PYKA 1E24A 1N33Q 1SBBB 4RKBA 3CCMA 1KTKA 3ND8A 3V05A 2D62A 4JI0Q 2C5CA 1I6VC 3AFQA 4I7ZC 1Q46A 3DEOA 3K0XA 5M3MG 2XIWA 4PQXA 1TWFB 2PO4A 4LF8Q 5IYDH 2ZJRA 2KOLA 4ZLTF 3M4OB 1EIHA 1SMXA 3EJIA 4K2LA 3PO3B 2K14A 1YNND 5BR8Q 3T1YQ 2JXMB 2F0FA 4A3EH 3UE1A 4G57A 2B2TA 3PO2G 1DM0B 4GKJL 2WB1E 2F0NA 3L9AX 3O13A 5CV6A 2CW0C 1K3RA 3RLOA 3KBXA 5GQOA 2E2IB 1PFSA 1VQIA 1QE6A 4XT1B 4ZK9B 4B3RQ 3HOVG 4DXGA 1BXTA 1G6ZA 1SNCA 4ALPA 1Y1WH 2MQHA 3EBEA 3LGJA 5DEHA 4DV1Q 2ZXOA 2N78A 2HHHL 2UUCQ 3TZUA 3KDFB 4L5QA 4AYBB 3MXNB 5DM63 1KDAA 4BY7B 1WCMH 1V1PB 5CBAE 1Q1EA 2UU9L 2HDMA 1SE2A 4ZUIA 4LFBQ 4NP5A 1PTOH 3NHHA 3GTQH 1MJCA 1HNWL 3B6YA 5IGBA 4DA2A 5HGQA 2OEOA 4APVA 1PH9A 5M5WH 1P8LA 1S5ED 3QO2A 1HQRD 1W3SA 4EQNA 2I5HA 3V2TA 1A2TA 1IBMQ 1FNWA 1DZ1A 2RSNA 2Y0SB 2NVTH 2BDOA 2QDBA 3C46A 4WJ4A 2MO1A 3DUZA 1VQKA 4IFDI 2IJ0A 1NE3A 2R93G 4A3DG 2JE6I 1X56A 3CAMA 5KNCA 2I0QA 1HUMA 3A8KE 4GOPC 1TR5A 3R2IA 5COYA 1Y69U 4JK1C 5GADC 3PIOA 1EYCA 1B44D 1CKOA 3HOXB 3H3VI 4RH6A 4A3BB 4UAIA 1A0IA 3A55A 4ILWA 3QJYA 1TS5A 5J22A 3MA2B 2R92H 3HP3A 2IX1A 1L1OC 2A5HA 4AQYL 5D14A 3I4NH 4ABNA 3J80i 4NB3A 2JA5B 4KY6A 1R4QB 3NPPA 1I3QB 4MZ9A 2WKDA 5J39A 4I65A 1MSHA 4F8MA 1N36Q 5FLMG 3CF5A 5I6YA 2K03A 1H9SA 1EZ6A 1NUCA 5ELNA 1NCVA 4OO1G 1LTSD 2AHOB 1I4GA 1NJIC 4CKBA 4DPGA 3MFGA 5JVG3 4TKOB 2HCIA 4FYDA 3NTKA 1DONA 3D4DA 2KECA 3NENA 5C3EH 2I5LX 1VMCA 3KUPA 2DJFC 5IE8A 2RKSA 4HR7B 1KD1C 3TMEA 4IUUA 4CGYB 3K59A 3FPPA 4IALA 2G5DA 4IPGA 1VQ5A 4GKKL 2N8NA 4G7HC 3MFYA 1CKNA 1FYCA 4GN3B 2PMZE 3F2DA 1S40A 1GUTA 4JV5Q 2IX0A 2B2WA 1C9OA 2HUGA 1V43A 5C4JH 4QIWB 2M2LA 1WVLA 3OHXC 3VYUA 2VUMG 2X6GA 4UY8C 2A73B 4KI0A 3G48A 5I6WA 3A74A 1G91A 2RBMA 3TREA 3CPFA 4QMGA 4BWGB 4LJZC 4DV7L 3TN2A 3OSOA 2BE5C 4OWXB 1OXXK 1GUGA 1VQJA 1GUNA 3OYYA 3L2PA 4A3IH 2PQAA 4GNXC 5C0XI 5ELDA 2F0JA 2F0OA 2V1CC 4DR3L 1I6HH 3J7AF 5IYDG 3S9WA 3F1ZA 1HTLD 4PZ6A 3VR2A 5HGTA 2ZXRA 2KCTA 1Q86C 4A3EG 2UUBL 3AEVA 3UE0A 4GN5A 2MGSA 3A56A 5I9PA 1JT8A 2FINB 1EFWA 3GTKB 1IBKQ 4IZ8A 1EIGA 2JYOA 4B3SL 3M7GA 3W1BA 1AE2A 2B8GA 1CA6A 1H9JA 4R1JA 4OWWB 3U4VA 2L4NA 4DK1A 3KK7A 1DOLA 4X64L 2F0EA 3GTMB 4CJ1B 4IPHA 4DV4Q 3S1RB 2AMCB 1STBA 4JI7L 2F3VA 3TRZA 3Q23A 4E6IA 2CH4W 3I8ZA 4RWSC 1UNSA 2PCFB 5JPNC 1KL9A 2H4OA 5GAHC 2QKIC 3KJPA 3V96A 1STNA 2KUMA 5LL6X 1EYAA 3DWPA 3J7AV 5AJ3Q 4KY5A 4JCVE 1NY4A 2AQ3B 4RA8A 1MJEA 4CDFC 1W6JA 1MKHA 2L5TA 3ZYYX 1VQNA 3SGIA 4BY1B 4B3TL 5I2YA 1Y1VB 1XYIA 4Q5VA 1TKWB 4CDCC 5LMNW 4P71A 1BQQT 1DD2A 2JA8H 4IPDA 1G2TA 1E1OA 2UXDQ 1EZ8A 2TMPA 5IY0A 2G9DA 1D1IA 4C2MB 3S1MB 2IHEA 5IODA 4A75A 1TXYA 3QG1A 4L8JA 2K32A 3HFZB 1WD1A 5A2QL 4LF4L 4OIKA 3CC4A 2K01A 3K5OA 2K7VA 1CZWA 1R9TH 2EJFC 2WFWA 2E2HB 1SE3A 4OHJA 2SOBA 5ELBA 5JJZA 1SNQA 3AQQA 2TSSA 1CA5A 4LF6L 1AN8A 1VQMA 2RQXA 4FXGC 1PH1A 1YNNC 1UUPA 2IWHA 1ZKOA 4X6AH 5M5XH 4N8X1 3AMUA 3CPWA 2V4DA 3I4NG 3BG3A 4LMQD 1SYGA 2KBNA 3RN2A 2F0HA 2K04A 4G7ZC 3HOZH 1LTGD 5E7NA 4A93H 2LY7A 3J7A5 3I90A 4JI2L 3U50C 1PTOD 3HGBA 3I91A 5IYBH 4EVOA 4X62L 2IPKD 4CKCA 5JEAJ 4KV6A 4PNYA 3H3VC 2PZUA 3STBD 2RA4A 2VB3X 4JI1Q 3PCOB 3SEBA 1AW7A 3BJUA 5C3EG 1O7LA 2WIIB 3QWNA 3U9SA 2A6HD 3FKIH 4X3TA 3HOWB 2PMZB 2K05A 1SFOH 4KY7A 4LUVA 4NPSA 2XRQD 4JC0A 5IT9c 1KC8C 1EWHA 4RCNA 4DAMA 4IFDH 2EY1A 1Q3LA 1XNRL 3NTIA 4YHHQ 4QGUA 5J1ZA 2JSOA 2F1MA 2XWBB 1BBUA 1MIUA 2E5LQ 4DUZQ 2IT1A 3LWEA 4A3FB 1XPOA 2XVSA 1STHA 2L11A 1PA6A 4K8IA 5EKKA 1EIYB 4QJFA 1BO0A 3QIAA 2K28A 4A3IG 4EGVA 1EWCA 3GTOH 1VQEA 1HFGA 2DN8A 4TQUS 2ALYB 3E6ZX 2L1BA 3EN2A 4YCWA 1L1OB 3KLWA 3PGZA 3VR3A 1GD7A 1OXTA 3KBGA 4BXXH 5D3IB 1K83B 5FO7B 3D4RA 5GAEC 4LF4Q 3I7FA 1X3FA 1IBLL 4RAUC 1JJCB 2GVAA 2NZHA 3KLSX 1ESRA 2CWPA 4GZYC 1SR3A 1XMQL 1QG7A 1O7IA 2MFIA 4DV6Q 3BU2A 1HNZL 1ILQA 3GTGB 5T1IA 2E2IH 1PYSB 3DHQA 4OEMB 4Q0FA 5FLXc 1SROA 3TP7A 2KHSA 1SNDA 3JAMi 3S1QH 3S16B 3PUYA 2YV5A 4DR6Q 4B3MQ 5FO8B 3K80C 1VQLA 1T5XD 3VYRA 4DAYA 3FMCA 2C35B 1VQ7A 2IHFA 1TIID 3T16A 1BNZA 4MTNA 5IWAL 1EFID 4BY7H 4OGQC 1YNXA 3TS0A 1SMYD 1ESFA 4HJAA 1F77A 2Z4IA 4F87A 1BCPB 3E0EA 1S5CD 2JP1A 3SK4A 2RCNA 1HH2P 2NN6G 2Q2IA 3UI2A 2B2YA 3K8AA 3BDCA 3CHBD 4DV0Q 3ICEA 1SNMA 1XTDA 5C0XH 2JA8G 1NTGA 3A8IE 4EQOA 3KF6A 4AYBE 2D9UA 4FF1A 2K1BA 1X32A 3G7LA 4TVAB 3MEFA 5KYLA 3K7AH 1PTOF 3OWEB 3KOJA 3I70A 3GTJB 4WORA 4GLXA 2FFKB 3UDGA 4H44C 2YTYA 4C3HB 4JI0L 2OXPA 3H0GG 2P5ZX 1AE3A 3I4MB 2NVQB 5E3FA 1TVXA 3HOXH 4A3BH 4LF8L 3HEJA 5C6AA 2EJMA 4KN7C 2PNHA 5K5PA 2HDLA 1HZAA 3NK9A 3NSWA 4DGZA 5BR8L 3T1YL 2YU9B 2RDHA 3BDLA 1CSQA 3TEHB 2OTJA 1ZYRC 3K58A 4MHEA 1BDOA 2UXBQ 5CV9A 3HOZG 3N6RA 4MN3A 5FJ8H 1PRTD 1GJXA 1YHAA 3Q8DA 3PUWA 1I3QH 3IFDA 2EYLA 2YYZA 1EU3A 1I4QA 2M9VA 3NBHA 3DM1A 4JBKA 4B3RL 1V9PA 1TWHB 3HKSA 2ZT9C 2QDLA 3RN5A 2EYJA 4DV1L 1UEAB 1K0RA 3CCUA 1VF7A 4QF4A 2R7ZB 2D0PA 1B3AA 4OX9Q 4O2DA 3BYTB 2NZOA 4KKTA 5ELCA 1AZQA 1DJRD 5E4XA 4BBSG 4U68A 3NELA 2CQAA 3AYHB 4A3JH 2PPBC 2PZWA 1Q7YC 4LFBL 4H13C 2EYOA 4KHVA 1V1OA 1D5XC 2F0SA 4RCOA 1WTXA 5EJWA 3SK6A 3K7UC 3VR5A 1K8AC 2JA7B 3Q24A 1CK1A 4V0BA 2CWAA 1XMOQ 2FJ2A 1VDZA 4J6HA 1EY8A 5A2QE 3MXNA 1YHBA 1IBML 2AKWB 1V1PA 3I3CA 5C3XA 4N9PA 4U673 5TSSA 3ITPA 1Z47A 4IPCA 1PH8A 3CMEA 3J81c 1YBYA 3A8JE 4CDEC 4B9XA 4L63B 1FD7D 1TWGB 2N49A 2EOTA 4QY7A 4GLVB 1PH6A 1I4RA 1JOKA 4O0AA 4HTHA 4A3KG 2A1AA 4K6LA 4J8QA 3KYHC 3S14H 3GDEA 4BXXG 4B08A 2K4KA 1SN8A 1F9RA 3MHBA 5HURA 5C4XH 3L7ZC 2B63H 1B1ZA 4KTAA 1WTPA 4BA2I 1RTOA 3H94A 4R4TA 4XIGS 2WP8J 2VW9A 1PYWD 4OWTB 4DK3C 2B2WC 1UE7A 1IYVA 2HIXA 5EBCA 4KK7A 1CTMA 1RHPA 1VQHA 3S1NB 3N52A 3GTMH 1SDFA 3PF4A 2FMCA 1JE4A 3S1RH 3IFTA 2K5VA 5C4HA 1PTOC 1SYBA 1N36L 3I4OA 1EOTA 4XQNA 3LNNA 2MNAA 4HJ9A 3STBC 3A0JA 1L0WA 1W2BA 4K5WA 1JWUD 1VQ6A 5KEEA 1Q82C 4OL7A 4L5RC 3RR5A 2A6HC 1A3TA 1K9MC 4LF9Q 3GO5A 2EXDA 1QNKA 5M3MB 3DXJC 2XGTA 4QUFA 1RD9D 1X3QA 1XWEA 4HJ5A 3CKIB 3SK5A 4JI8Q 4BY1H 1SLJA 2G9HD 3TZDA 4CDDC 4JV5L 1CKMA 1JOOA 3W2DA 3HOUG 1G51A 1FVIA 2ZTDA 1NNXA 3PO2B 1PRTF 4P72A 3EA6A 4XTCS 3BVZA 4JG2A 1PDQA 1QZHA 1LTID 4IUPA 3IKJA 5F2DA 2VZAA 4X65Q 1MSGA 1JQYD 3DM3A 4NW2A 4YIJA 3RZOH 4C2MH 2JEBI 4PZ7A 2A69D 2F0TA 4A76A 2F03A 3S15H 2FMMA 3J81E 2GN5A 1E3PA 1DCZA 4CHTB 4XT3B 3HOVB 4ME3A 3S17B 3Q6SA 3K5NA 2EYMA 1EYGA 2NZ1D 4RG1A 1PMRA 2D2CC 4OELB 4C56C 2Q2UA 1S72A 1WOCA 2EXZA 1QILA 3FDTA 2ZJPA 5CMDA 4C1NK 4ZAIA 2F4VQ 4A3LH 3FPUB 4QB4A 1IBKL 3ULPA 1EY9A 4DUYQ 1U4MA 3SE0A 2WV6D 1JMCA 1EIFA 3EVQA 4HAEA 3PIO3 1PV4A 2R7FA 1GXDC 1A63A 1B50A 5CV4A 1IYJB 4DV4L 1AFPA 5IOCA 3S2DH 2MUYA 1PH5A 1BUVT 4ME5A 3T53B 1Q90A 3EFXD 3CCSA 1VQAA 1UE5A 2PQEA 2CFMA 4K5XA 4JI5Q 4DV6L 2NVXB 4A3GH 2M00A 2R93B 1SJHD 4A3JG 4A3DB 2F0GA 1LUZA 1SMYC 1PH4A 5M3FH 1SXTA 1N34Q 3C1FA 5AJ3L 3NWTA 1Q12A 3ND9A 4PMBA 1LT4D 3W3AA 3C2PA 3EIVA 4DV2Q 2B3GA 3FVQA 1L2FA 4R4CA 5M5YB 1U9RA 3TS2A 2HCCA 2XNAC 1TWAB 4XXEA 5JJIA 4DR7Q 3T56B 2UXDL 1WTWA 5T1GA 1E0BA 4FXKC 4KMUC 1VQPA 1STEA 4L6TB 3S24A 3CRLC 4XQJA 1LTLA 4LWCA 3F2CA 3G6JB 4DU9A 1F2LA 1XTCD 2DUDA 3D31A 2VXWA 1TWCH 4F88A 4GN4B 3MTSA 4UP7A 2WB1G 1CQVA 1T9HA 2Z6BA 3T4AC 5G3LD 2KA7A 1YNJD 5IT9L 5C4XG 2QILA 4DAVA 2B63G 2DNEA 2XN9C 3W5OA 4A3MH 2NB0A 3NXWA 1K8GA 4IJHA 3OIPA 1C7YA 3GTPB 3H91A 4DK6C 1LO5D 1BKBA 1GKHA 1HTPA 1STGA 1TS3A 2RDGA 3MWYW 2SNSA 4RKLA 2A68D 3NBIA 2R7DA 1RODA 1TY2A 3I56A 2Q8TA 1PRTC 4WJ3M 2EYHA 1I50H 1HFNA 3CD6A 4WFN3 5I2XA 3KFUA 4JPBW 1OO9B 2VUMB 4C3JH 1UWVA 4A4IA 1KQSA 1UE6A 2UXCQ 3BDOA 1B8AA 4PZ8A 3OMGA 2HQEA 2KCCA 1YJNA 4JI1L 1ASZA 4KD4A 4LFAQ 1Y1WG 1SYCA 2JA6H 2ZM6Q 2VQFQ 3CRKC 3TQYA 3NWSA 1WCMG 1STYA 1H9SB 4YHHL 3DWAA 4A3EB 2AUJD 3G4SA 1JORA 4BBRH 2ICEC 2O5IC 1LABA 2E5LL 2K5DA 3OW2A 4DUZL 5CGKA 1K8MA 1IW7D 4HMIA 3T1HQ 2VS1A 3HKZG 1HPCA 1CSPA 1D5MC 5FO9B 3ONAB 3ULLA 1U4PA 2JEAI 4LF5Q 2HT1A 1XPUA 1K0SA 3JAMc 3HOYH 1WFQA 1CUKA 5LMNL 1PLFA 1CKNB 3GTLH 1MHWC 4JVZA 4NKLA 2AWNA 1HNXQ 1Z9FA 5FK9C 3TP5A 3J81j 2VNUD 1EY4A 4IQZA 1KDBA 4HEDA 1HR0W 4ID6A 4DV5Q 4JI3Q 1BF4A 4JYAQ 3RD4A 3MAQA 2YU9H 1DGSA 4A3LG 2B2YC 1PTOB 3IL8A 4WRDA 5C44H 1KNEA 3CCEA 3GTQB 1NSNS 5JVH3 5D3DA 3VYSA 3ERSX 1DOMA 5K36H 2WINB 3L3OC 5M5WB 1YHQA 1QVGA 4LNQA 2PI2E 2PQAB 2R92G 1X3GA 1WD0A 1ZXTA 2JQOA 1GVPA 4LK1C 1VCIA 4DR6L 2R61A 1GUOA 3BVMA 4B3ML 3P75A 1KDCA 2LS01 1U0LA 2ICIA 1GHKA 2PZTA 2A74C 4A3GG 4DR1Q 5M3FG 1A15A 2D0OA 1TS2A 5G3LF 1WTVA 2JN4A 1T5EA 4NDXA 1TY0A 2K75A 1D1KA 5CV7A 2I07B 2KVMA 1JWSD 1UEBA 1I4HA 3CU7A 1K3BC 1NMGA 1SNPA 2EZVA 4DV0L 4KLKA 3QOJA 1IXRA 2K5WA 1LTRD 3I4NB 4KN4C 1SYEA 1JC7A 3CCVA 1VQ8A 4LF7Q 2OWOA 2A8VA 4TSSA 1D2BA 3LX0A 3VDYA 5IYCH 2A69C 1YIJA 2VB2X 2K5NA 3E9IA 4C3IH 4Y52H 3SXHA 4GOPB 3DEPA 2RDFA 3KJOA 4K14A 1I94Q 1RCVD 2Z1CA 2HQLA 4JBMA 4DNIA 4S3SA 3F8TA 4A3MG 3QOLA 2Q8RE 3GD7A 2PNRC 4Y7NB 4POFA 5C3EB 4MTKA 1E2VA 4FF2A 4KD3A 3E0JA 3P1HA 5LMNQ 4HSPA 2QA4A 4DR5Q 4FVMA 1TWFH 4WJWA 3TSSA 2ZXPA 4LFCQ 3M4OH 3MZ5A 1RIPA 4CJ0B 2UXBL 2F3IA 1CHQD 3PO3H 4DAPA 4HIKA 5CYUA 3J81L 1HR0Q 5BN5A 1WI5A 4TRDA 3K6OA 4C3JG 1H9RA 1HZCA 2CVRA 2IW3A 2NWGA 3RZDB 2EYFA 1E1TA 1Z6HA 2R6GA 4R8NA 1K28A 4XYOA 2OQ0A 5C5MA 3OW7A 2GVBA 5DAUA 3RMHA 2EVBA 4OX9L 2QGQA 4C1NI 2JA6G 4A3IB 2B8FA 2OCEA 3KF8A 1WTOA 1S5DD 4M8AA 4B9WA 5M3MH 4RHSA 3M3YB 1I6HB 1RDPD 2ENBA 1EY6A 4K5VA 3U9OA 3NQIA 4DF7A 1N32Q 1TQOA 4KHPL 4MIUA 3CCJA 4JI4Q 4GLAC 1XMOL 4LW1A 4BBRG 5I9OA 4POGA 1GUSA 1H95A 3MVVA 5IT9E 2SEBD 3CQZB 4QCLA 3TBIB 5CR3A 2MHVA 3PIPA 3SVMA 1HA5A 3HOYG 1KLGD 3CCRA 4GNXB 1X9NA 3HOVH 1EY7A 4ZQ3A 1CM9A 1VMPA 5H1SE 3VR6A 1YNJC 2B2VA 2NVYB 1M1KC 4X3SA 3KLRA 3MXPA 3F2UA 4UP8A 4XQQA 3UDXA 2FXQA 4UPAA 5C44G 3GP7A 1A62A 1SE4A 2GA4B 2L12A 2A68C 5K36G 5CV5A 4IOCA 5NUCA 3D8GA 3MXUA 5IGGA 2NUCA 5IP9H 1II3A 4CBVA 1BCPD 5EQ0A 1YI2A 2JA8B 1HRJA 4K8JA 4FP5D 5CV8A 2XSCA 1C0AA 4ZUJA 2JA5H 2N3SA 3I2ZA 4A93G 1PZID 3ULJA 2NVXH 1GO3E 1Q8KA 5IYBG 3D6CA 3PSIA 2N55A 1JICA 5FLXE 4UDUC 1Y8PB 3ER0A 3OWFA 3H0GB 1R9TB 4LF9L 4O42A 1QUQB 1GOZA 1H9KA 1YZ6A 2BH8A 2HD3A 4X3KA 3L0OA 3OTOQ 3FKIG 4N9TA 4JI8L 3CCQA 1VQ4A 5M5YH 2JA9A 2PW5A 4KJNA 3DLLA 1IHZA 1P16A 4DAYB 2ZJQA 1TWAH 5GAGC 1H9MA 2WAQG 4HIOA 1HQMC 2C9OA 4IFDG 1QB5D 3MEHA 4HN7A 1IW7C 4KHPQ 1A2UA 3PMFA 1GM5A 3HOZB 4X65L 5IYCG 2E2JB 3SHLA 3KDFA 2F4IA 4AH6A 4C3IG 2UUAQ 1SYFA 4IFDJ 5FLMH 4K0KQ 1LM0A 2KHIA 4EQPA 2EY2A 1LV9A 2SNMA 3S2HB 1VQOA 3J80c 1OXSC 1QCBD 3C3LA 1YEZA 1MGSA 4XYQA 2F0KA 1HXYD 3BZCA 5EGTA 5KRUA 2Z0SA 3GTPH 1XX8A 1FGBD 3A7AB 3KF6B 3MC0B 4RGOS 4BBSB 4KHZA 1Y8NB 1ASYA 1KAAA 4UHVA 4HJ7A 4IJLA 3BZKA 3I55A 2F4VL 4KKSA 3DWQA 3CC2A 3OPOA 2DY8A 2JK8A 3PO3G 4DUYL 4NXNQ 1B3QA 2A19A 5JOBA 3NP8A 4X66L 1IL8A 1IZ6A 3GTKH 4ZYSA 2RF4A 1S5BD 2F0WA 4LAAA 2VUMH 1NR2A 5KNBA 4R9WA 2NN6I 3OIQA 1Z7TA 1LTAD 5DM73 3K5MA 2AQ2B 4P74A 5GROA 3J7ZC 1XJVA 3SR1A 4NXMQ 2NTSA 4DR4L 4JI5L 1S5FD 1J9OA 4DR2Q 3GTOB 2X6LA 4P2CB 1QVCA 1KIXA 1NAPA 1AP0A 1EUJA 4Z9CB 4A3KB 1N34L 4N8FA 4DV3Q 3K57A 1O78A 1MI2A 4AYBG 2Q2TA 4BY7G 3NBHB 4YY3Q 2VQEL 4LUOA 2EJGC 1WJJA 4DV2L 2BH2A 4ZKCB 1RF2D 2RHQB 3M4YA 4JI6Q 1GUWA 1LTTD 2I5MX 4ODGA 4IO9A 2J7ZA 2ASBA 1FJGQ 2LKVA 4DR7L 2QEXA 5E1FA 3ZJYC 1BCPF 1Y1VH 4IUQA 1SAPA 3VA7A 5C0XG 1M4VA 1F9SA 3S1QB 4UP9A 2ATWA 5C5LA 2Y0SG 1RKNA
chains in the Genus database with same CATH topology
1EOVA 1SFOH 1I50H 1VQBA 3FP9A 4LUVA 4NPSA 2Y0SE 4JC0A 4OXPA 4YY3L 5IT9c 1KC8C 1IL2A 3CD6A 4A3DH 4AIMA 3KFUA 3M9BA 3PUZA 4DAMA 5C0XJ 1PHJA 1PYBA 3S1MH 2LXKA 2Z6KC 1LYLA 1X54A 2EIFA 4C3JH 1NBWA 1UWVA 3PUVA 4A4IA 4YHHQ 4QGUA 1KQSA 2OTLA 4JI6L 1XNRL 1UE6A 2UXCQ 1B8AA 2ZTCA 1PVOA 2OQKA 1BBUA 4PZ8A 1MIUA 2E5LQ 2JA7G 1FJGL 4DKAC 3CXCA 4DUZQ 3AFPA 2IT1A 1YJNA 3G71A 1IBLQ 4JI1L 2E2HH 1XPOA 2LSSA 1ASZA 3HOXG 4A3BG 1PA6A 3KF8B 1J5EQ 2K52A 2ZTEA 2Z6KA 4LFAQ 1E7ZA 1Y1WG 2F52A 4YWMA 1XMQQ 1EIYB 2KENA 2JA6H 1KHIA 4QJFA 2ZM6Q 2VQFQ 1HNZQ 2E8GA 5IP9G 4YWKA 5ELOA 4PMWA 3FHWA 3TQYA 3E9HA 4A3IG 1XNQQ 3M85A 3GTOH 1VQEA 2UUCL 4TQUS 1PH2A 2JJQA 2ALYB 1WCMG 1Y14B 4HIMA 3EN2A 4YCWA 1YJ9A 1L1OB 3KLWA 3PGZA 1GD7A 1OXTA 2LXJA 3D0FA 4YHHL 5FJ8G 3UDFA 2JA5G 4BXXH 4R4OA 3G4SA 2UXCL 4FDBA 5GAEC 4BBRH 4LF4Q 3I7FA 2E5LL 1X3FA 4X66Q 3M4QA 3OW2A 4DUZL 1VQFA 1IBLL 1OXVA 4JBJA 1JB7A 1JJCB 2GVAA 2NZHA 4A3CH 2CWPA 3T1HQ 2VS1A 3HKZG 1J5EL 5JJKA 1BVSA 5IWAQ 1SR3A 1XMQL 1CSPA 4LFAL 1O7IA 3HKZE 3ULLA 2MFIA 4JOIA 2ZM6L 3BU2A 2VQFL 1HNZL 2JEAI 4LF5Q 2HT1A 1XPUA 5DLQE 3JAMc 2E2IH 1XNQL 1PYSB 3HOYH 4DR4Q 1WFQA 1CUKA 5J3BA 5LMNL 1CKNB 3M4PA 5FLXc 1SROA 3HOWH 3GTLH 1N9WA 3JAMi 3S1QH 2AWNA 1HNXQ 1Z9FA 2YV5A 3PUYA 4JBWA 4DR6Q 3J81j 2VNUD 4B3MQ 4EX5A 3K80C 1HR0W 4DV5Q 4JI3Q 3W1GA 1VQLA 1B70B 4JYAQ 2C35B 3UDIA 3PF5A 1VQ7A 3J81i 2YU9H 4HIDA 1DGSA 1YJWA 3G6EA 4A3LG 2CCZA 2IHFA 2VQEQ 2YTVA 1BBWA 3T1HL 4MTNA 5C44H 5IWAL 3CCEA 1EQRA 4BY7H 1YNXA 2YTXA 1HZ9A 3TS0A 4GKJQ 3ERSX 4HJAA 1VQDA 4QIWE 1KRSA 4HJ8A 1YHQA 4A3FH 1E24A 3E0EA 4LF5L 1N33Q 1JJGA 4BA1I 3CCMA 2RCNA 1QVGA 4LNQA 1HH2P 2PI2E 2NN6G 2PQAB 2D62A 2R92G 1X3GA 2Q2IA 4JI0Q 3AFQA 2JQOA 3K8AA 1Q46A 1GVPA 2RHSB 3K0XA 5M3MG 1VCIA 1HNXL 4DR6L 4B3ML 4DV0Q 3ICEA 4JI3L 4Y7NH 3CP0A 2ZJRA 1U0LA 4DV5L 1XTDA 4LF8Q 5IYDH 2BA0A 1SMXA 2JA8G 4JYAL 1NTGA 2K14A 2HHHQ 4MNOA 3KF6A 5BR8Q 4AYBE 3T1YQ 4A3GG 4A3EH 3UE1A 1D7QA 4DR1Q 1K83H 1JE5A 1X65A 4TVAB 5M3FG 3MEFA 3PO2G 4GKJL 2WB1E 1FGUA 3K7AH 3KOJA 1KAWA 2D0OA 2CKZB 2UU9Q 4GLXA 2K75A 1K3RA 3RLOA 3UDGA 1PH3A 2YTYA 5GQOA 4JI0L 3H0GG 1HNWQ 1UEBA 5JJLA 1AE3A 1PFSA 1VQIA 5HY6A 3RZDH 1NMGA 4DV0L 4B3RQ 3HOVG 3HOXH 3GTGH 4A3BH 4LF8L 4ALPA 1Y1WH 2PNHA 4KLKA 2MQHA 3EBEA 1HZAA 2CQOA 3LGJA 4YCUA 1A8VA 4DV1Q 2N78A 1IXRA 2HHHL 2UUCQ 3S16H 5BR8L 3T1YL 3KDFB 3CCVA 4DR1L 1CSQA 1VQ8A 2OWOA 4L5QA 3TEHB 4LF7Q 2A8VA 2OTJA 3PV0A 4R4IA 2Q2HA 3MXNB 3K81C 3VDYA 1WCMH 5IYCH 3F2BA 1YIJA 1Q1EA 2UU9L 3M3YH 4P73A 2UXBQ 1VS0A 2K5NA 3E9IA 3HOZG 5FJ8H 1YHAA 4C3IH 4LFBQ 4Y52H 3Q8DA 3GTQH 4L5SA 4GOPB 3PUWA 1EWIA 1MJCA 1I3QH 3KJOA 1HNWL 1VQCA 3B6YA 1G6PA 1I94Q 5HGQA 2YYZA 2HQLA 4APVA 1PH9A 5M5WH 1P8LA 4JBKA 4JBMA 4DNIA 4B3RL 1V9PA 1W3SA 3F8TA 2I5HA 4A3MG 3HKSA 1J6QA 2B29A 3GD7A 3RN5A 4POFA 1X6OA 3RLFA 4DV1L 1VQ9A 5LMNQ 1IBMQ 1X3EA 4BY1G 1K0RA 3CCUA 2QA4A 1Y1VG 4DR5Q 2D0PA 4OX9Q 4O2DA 1TWFH 3CQZH 3RNUA 4LF7L 2NZOA 2NVTH 4LFCQ 3M4OH 4BBSG 3NELA 1RIPA 4WJ4A 3AYHB 2UXBL 4AQYQ 2F3IA 4A3JH 2MO1A 3PO3H 1VQKA 4PG3A 4IFDI 1Q7YC 4HIKA 1NE3A 4LFBL 2K50A 1HR0Q 4A3DG 2JE6I 1X56A 3CAMA 2R93G 1I94L 1WI5A 2I0QA 4OONA 1K8AC 3K7UC 4GOPC 3GTJH 1HZCA 2NVYH 2MO0A 3PIOA 2CWAA 5GADC 1XMOQ 1E1TA 3U4ZA 2R6GA 1CKOA 2OQ0A 4H02A 4C3HH 3H3VI 1VQGA 2GVBA 1A0IA 1YHBA 1IBML 2AKWB 4QQBX 1V1QA 3I4MH 4DR5L 4IOAA 2NVQH 4OX9L 2QGQA 1Z47A 2R92H 5IP7H 2L15A 2IX1A 4IPCA 1RL2A 4LFCL 1PH8A 2XTIA 3CMEA 3J81c 1YBYA 4GOPA 2JA6G 2OCEA 1L1OC 4AQYL 2N49A 1Q81C 2HIVA 5M3MH 4QY7A 3I4NH 4GLVB 3CMAA 1HJPA 3J80i 4NB3A 1PH6A 3PUXA 1HR0L 1N32Q 1QVFA 5EAYA 4O0AA 4A3KG 1NMFA 2A1AA 4KHPL 4GKKQ 1B7YB 3KYHC 3S14H 3GDEA 4MZ9A 4GLAC 3CCJA 1XMOL 4JI4Q 2K4KA 1M90C 4BXXG 1N36Q 5FLMG 1SN8A 4OO1I 3CF5A 1L1OA 4LW1A 4BBRG 5C4XH 5ELNA 4POGA 3L7ZC 2B63H 4OO1G 2AHOB 1NJIC 4A3CG 4BA2I 1H95A 4DPGA 4R4TA 4XIGS 2WP8J 2VW9A 1TWHH 1EQQA 4OWTB 4DV7Q 3H0GH 3NENA 4DK3C 5C3EH 2I5LX 1UE7A 2KCMA 4YWLA 5IE8A 3PIPA 2HIXA 2R7ZH 3HOYG 3CCRA 4GNXB 3HOVH 1X9NA 1KD1C 1N32L 1VQHA 3GTMH 3H15A 3PF4A 3HOWG 4IPGA 1VQ5A 4GKKL 2N8NA 5H1SE 3S1RH 4JI4L 1CKNA 2K5VA 4DR3Q 4GN3B 2PMZE 3F2DA 1S40A 1N36L 3I4OA 1M1KC 4JV5Q 2IX0A 1C9OA 1V43A 2MNAA 5C4JH 4HJ9A 4UP8A 3STBC 3A0JA 3UDXA 1L0WA 2VUMG 1W2BA 1VQ6A 2JA7H 2FXQA 4UPAA 4KI0A 5C44G 5JEAG 1Q82C 1A62A 3G48A 2UUBQ 3A74A 4UY8C 1XPRA 4L5RC 3RR5A 2E2JH 3TREA 3CPFA 4DV7L 5K36G 3CCLA 4B3SQ 4A3FG 4IOCA 1K9MC 4OWXB 4LF9Q 1OXXK 1D8LA 3GO5A 2EXDA 3A5ZB 2XGTA 2H5XA 1VQJA 5IP9H 2EQSA 4X64Q 3OYYA 3L2PA 4HJ5A 4A3IH 3S2HH 3A5UA 2PQAA 4GNXC 5C0XI 1YI2A 1TWGH 4JI8Q 4BY1H 1SLJA 2V1CC 4DR3L 1I6HH 5IYDG 3IRBA 1CKMA 4JV5L 1C0AA 4JI7Q 3HOUG 1G51A 3F1ZA 1FVIA 4PZ6A 2N3SA 2ZTDA 2ES2A 2JA5H 4BBSH 4RMFA 4P72A 4XTCS 2KCTA 3I2ZA 1Q86C 4A93G 4JG2A 3ULJA 1QZHA 4A3EG 2NVXH 1G291 3CW2C 1GO3E 1Q8KA 2UUBL 3AEVA 1AH9A 3UE0A 4GN5A 5IYBG 1JT8A 2VZAA 4GNXA 4X65Q 4QL5A 3DM3A 3PSIA 1YITA 1EFWA 4EQ5A 1IBKQ 3RZOH 4C2MH 2JEBI 3ER0A 4B3SL 3W1BA 4PZ7A 4LF9L 1AE2A 4A76A 3S15H 3NEMA 2GN5A 1QUQB 1E3PA 1YZ6A 4R1JA 2BH8A 3U4VA 4OWWB 4X64L 3RLNA 4ME3A 3L0OA 4IPHA 3OTOQ 3FKIG 4JI8L 3CCQA 1VQ4A 1EYGA 5M5YH 5LMUL 3H3VH 4DV4Q 2JA9A 2PI2A 3DLLA 2AMCB 4B3TQ 4L5TA 1P16A 4RG1A 4DAYB 4JI7L 1YVCA 2ZJQA 1TWAH 3S1NH 2AWOA 5GAGC 2K5HA 1S72A 2Q2UA 1WOCA 3TRZA 2WAQG 4HIOA 2DGYA 4IFDG 2ZJPA 3U58A 4KHPQ 1SE8A 2WAQE 1GM5A 2F4VQ 1K73C 1FL0A 4A3LH 4X65L 5GAHC 3KJPA 4DV6Q 1KL9A 1IBKL 5IYCG 4A3KH 3ULPA 1KXLA 3KDFA 4DUYQ 2VL6A 3CC7A 1PH7A 4AH6A 4JOIC 2UUAQ 1JMCA 4IFDJ 5AJ3Q 1EIFA 5FLMH 4K0KQ 1LM0A 1NY4A 2KHIA 4JCVE 1PV4A 1MJEA 2R7FA 3OTOL 1A63A 1Q1BA 1MKHA 1IYJB 1N8RC 1VQOA 3J80c 1OXSC 1S3OA 4DV4L 3WWVA 3SGIA 1VQNA 4B3TL 1YEZA 3S2DH 2BA1A 3BZCA 4LF6Q 1PH5A 1HZBA 2Z0SA 3GTPH 5LMNW 4P71A 3KF6B 2IY5B 4KHZA 3CCSA 1ASYA 4IPDA 2JA8H 2R93H 1E1OA 2UXDQ 4HJ7A 4IJLA 1VQAA 1UE5A 2CFMA 3BZKA 3I55A 4JI5Q 4DV6L 1QUQA 2F4VL 3CC2A 5IY0A 4A3GH 4A3JG 1LUZA 2JK8A 3PO3G 3JC66 5M3FH 4DUYL 2VY3A 1PH4A 1X55A 4NXNQ 3PO2H 1N34Q 2IHEA 4A75A 2UUAL 1TXYA 5AJ3L 1UE1A 2A19A 3HFZB 4K0KL 1Q12A 4LF4L 4X66L 3CC4A 1IZ6A 3GTKH 2RF4A 4J15A 1R9TH 3EIVA 2VUMH 2WFWA 4DV2Q 2B3GA 1SRUA 4R4QA 1L2FA 4JI2Q 4R4CA 3AQQA 4X62Q 4LF6L 2NN6I 3TS2A 1VQMA 3S17H 3I4MG 4P74A 5GROA 3J7ZC 2KHJA 1XJVA 1PH1A 4DR7Q 5JJIA 2UXDL 5IP7G 4NXMQ 4DR4L 4JI5L 4X6AH 4DR2Q 1WYDA 4GS3A 1VQPA 3M7NA 1QVCA 4YCVA 3S24A 5M5XH 1KIXA 1LTLA 4LWCA 4NXNL 1EUJA 3CPWA 3F2CA 1N34L 3I4NG 4DV3Q 2KBNA 2DUDA 3RN2A 2ID0A 1JJ2A 1U5KA 3HOZH 3D31A 3HOUH 4AYBG 2Q2TA 4BY7G 1TWCH 3NBHB 4LUZA 4YY3Q 5E7NA 4GN4B 1KRTA 2VQEL 4UP7A 1OXUA 4LUOA 4A93H 1WJJA 2WB1G 4DV2L 2BH2A 3J7A5 1T9HA 2RHQB 4JI2L 3U50C 1XNRQ 4JI6Q 4P75A 5IYBH 4X62L 1QZGA 5C4XG 2B63G 1E22A 5JEAJ 2I5MX 3W5OA 4A3MH 4IO9A 1K8GA 2ASBA 1N33L 4IJHA 3STBD 1FJGQ 1C7YA 4DR7L 2QEXA 4NXML 4JI1Q 4DK6C 3PCOB 3ZJYC 1BKBA 1GKHA 5LMUQ 1Y1VH 3BJUA 4DR2L 1OTCA 5C3EG 5C0XG 2R7DA 1I5FA 3FKIH 3I56A 2R7ZG 4UP9A 4DV3L 2ATWA 2Y0SG 4WJ3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOV A;  1SFO H;  1I50 H;  1VQB A;  3FP9 A;  4LUV A;  4NPS A;  2Y0S E;  4JC0 A;  4OXP A;  4YY3 L;  5IT9 c;  1KC8 C;  1IL2 A;  3CD6 A;  4A3D H;  4AIM A;  3KFU A;  3M9B A;  3PUZ A;  4DAM A;  5C0X J;  1PHJ A;  1PYB A;  3S1M H;  2LXK A;  2Z6K C;  1LYL A;  1X54 A;  2EIF A;  4C3J H;  1NBW A;  1UWV A;  3PUV A;  4A4I A;  4YHH Q;  4QGU A;  1KQS A;  2OTL A;  4JI6 L;  1XNR L;  1UE6 A;  2UXC Q;  1B8A A;  2ZTC A;  1PVO A;  2OQK A;  1BBU A;  4PZ8 A;  1MIU A;  2E5L Q;  2JA7 G;  1FJG L;  4DKA C;  3CXC A;  4DUZ Q;  3AFP A;  2IT1 A;  1YJN A;  3G71 A;  1IBL Q;  4JI1 L;  2E2H H;  1XPO A;  2LSS A;  1ASZ A;  3HOX G;  4A3B G;  1PA6 A;  3KF8 B;  1J5E Q;  2K52 A;  2ZTE A;  2Z6K A;  4LFA Q;  1E7Z A;  1Y1W G;  2F52 A;  4YWM A;  1XMQ Q;  1EIY B;  2KEN A;  2JA6 H;  1KHI A;  4QJF A;  2ZM6 Q;  2VQF Q;  1HNZ Q;  2E8G A;  5IP9 G;  4YWK A;  5ELO A;  4PMW A;  3FHW A;  3TQY A;  3E9H A;  4A3I G;  1XNQ Q;  3M85 A;  3GTO H;  1VQE A;  2UUC L;  4TQU S;  1PH2 A;  2JJQ A;  2ALY B;  1WCM G;  1Y14 B;  4HIM A;  3EN2 A;  4YCW A;  1YJ9 A;  1L1O B;  3KLW A;  3PGZ A;  1GD7 A;  1OXT A;  2LXJ A;  3D0F A;  4YHH L;  5FJ8 G;  3UDF A;  2JA5 G;  4BXX H;  4R4O A;  3G4S A;  2UXC L;  4FDB A;  5GAE C;  4BBR H;  4LF4 Q;  3I7F A;  2E5L L;  1X3F A;  4X66 Q;  3M4Q A;  3OW2 A;  4DUZ L;  1VQF A;  1IBL L;  1OXV A;  4JBJ A;  1JB7 A;  1JJC B;  2GVA A;  2NZH A;  4A3C H;  2CWP A;  3T1H Q;  2VS1 A;  3HKZ G;  1J5E L;  5JJK A;  1BVS A;  5IWA Q;  1SR3 A;  1XMQ L;  1CSP A;  4LFA L;  1O7I A;  3HKZ E;  3ULL A;  2MFI A;  4JOI A;  2ZM6 L;  3BU2 A;  2VQF L;  1HNZ L;  2JEA I;  4LF5 Q;  2HT1 A;  1XPU A;  5DLQ E;  3JAM c;  2E2I H;  1XNQ L;  1PYS B;  3HOY H;  4DR4 Q;  1WFQ A;  1CUK A;  5J3B A;  5LMN L;  1CKN B;  3M4P A;  5FLX c;  1SRO A;  3HOW H;  3GTL H;  1N9W A;  3JAM i;  3S1Q H;  2AWN A;  1HNX Q;  1Z9F A;  2YV5 A;  3PUY A;  4JBW A;  4DR6 Q;  3J81 j;  2VNU D;  4B3M Q;  4EX5 A;  3K80 C;  1HR0 W;  4DV5 Q;  4JI3 Q;  3W1G A;  1VQL A;  1B70 B;  4JYA Q;  2C35 B;  3UDI A;  3PF5 A;  1VQ7 A;  3J81 i;  2YU9 H;  4HID A;  1DGS A;  1YJW A;  3G6E A;  4A3L G;  2CCZ A;  2IHF A;  2VQE Q;  2YTV A;  1BBW A;  3T1H L;  4MTN A;  5C44 H;  5IWA L;  3CCE A;  1EQR A;  4BY7 H;  1YNX A;  2YTX A;  1HZ9 A;  3TS0 A;  4GKJ Q;  3ERS X;  4HJA A;  1VQD A;  4QIW E;  1KRS A;  4HJ8 A;  1YHQ A;  4A3F H;  1E24 A;  3E0E A;  4LF5 L;  1N33 Q;  1JJG A;  4BA1 I;  3CCM A;  2RCN A;  1QVG A;  4LNQ A;  1HH2 P;  2PI2 E;  2NN6 G;  2PQA B;  2D62 A;  2R92 G;  1X3G A;  2Q2I A;  4JI0 Q;  3AFQ A;  2JQO A;  3K8A A;  1Q46 A;  1GVP A;  2RHS B;  3K0X A;  5M3M G;  1VCI A;  1HNX L;  4DR6 L;  4B3M L;  4DV0 Q;  3ICE A;  4JI3 L;  4Y7N H;  3CP0 A;  2ZJR A;  1U0L A;  4DV5 L;  1XTD A;  4LF8 Q;  5IYD H;  2BA0 A;  1SMX A;  2JA8 G;  4JYA L;  1NTG A;  2K14 A;  2HHH Q;  4MNO A;  3KF6 A;  5BR8 Q;  4AYB E;  3T1Y Q;  4A3G G;  4A3E H;  3UE1 A;  1D7Q A;  4DR1 Q;  1K83 H;  1JE5 A;  1X65 A;  4TVA B;  5M3F G;  3MEF A;  3PO2 G;  4GKJ L;  2WB1 E;  1FGU A;  3K7A H;  3KOJ A;  1KAW A;  2D0O A;  2CKZ B;  2UU9 Q;  4GLX A;  2K75 A;  1K3R A;  3RLO A;  3UDG A;  1PH3 A;  2YTY A;  5GQO A;  4JI0 L;  3H0G G;  1HNW Q;  1UEB A;  5JJL A;  1AE3 A;  1PFS A;  1VQI A;  5HY6 A;  3RZD H;  1NMG A;  4DV0 L;  4B3R Q;  3HOV G;  3HOX H;  3GTG H;  4A3B H;  4LF8 L;  4ALP A;  1Y1W H;  2PNH A;  4KLK A;  2MQH A;  3EBE A;  1HZA A;  2CQO A;  3LGJ A;  4YCU A;  1A8V A;  4DV1 Q;  2N78 A;  1IXR A;  2HHH L;  2UUC Q;  3S16 H;  5BR8 L;  3T1Y L;  3KDF B;  3CCV A;  4DR1 L;  1CSQ A;  1VQ8 A;  2OWO A;  4L5Q A;  3TEH B;  4LF7 Q;  2A8V A;  2OTJ A;  3PV0 A;  4R4I A;  2Q2H A;  3MXN B;  3K81 C;  3VDY A;  1WCM H;  5IYC H;  3F2B A;  1YIJ A;  1Q1E A;  2UU9 L;  3M3Y H;  4P73 A;  2UXB Q;  1VS0 A;  2K5N A;  3E9I A;  3HOZ G;  5FJ8 H;  1YHA A;  4C3I H;  4LFB Q;  4Y52 H;  3Q8D A;  3GTQ H;  4L5S A;  4GOP B;  3PUW A;  1EWI A;  1MJC A;  1I3Q H;  3KJO A;  1HNW L;  1VQC A;  3B6Y A;  1G6P A;  1I94 Q;  5HGQ A;  2YYZ A;  2HQL A;  4APV A;  1PH9 A;  5M5W H;  1P8L A;  4JBK A;  4JBM A;  4DNI A;  4B3R L;  1V9P A;  1W3S A;  3F8T A;  2I5H A;  4A3M G;  3HKS A;  1J6Q A;  2B29 A;  3GD7 A;  3RN5 A;  4POF A;  1X6O A;  3RLF A;  4DV1 L;  1VQ9 A;  5LMN Q;  1IBM Q;  1X3E A;  4BY1 G;  1K0R A;  3CCU A;  2QA4 A;  1Y1V G;  4DR5 Q;  2D0P A;  4OX9 Q;  4O2D A;  1TWF H;  3CQZ H;  3RNU A;  4LF7 L;  2NZO A;  2NVT H;  4LFC Q;  3M4O H;  4BBS G;  3NEL A;  1RIP A;  4WJ4 A;  3AYH B;  2UXB L;  4AQY Q;  2F3I A;  4A3J H;  2MO1 A;  3PO3 H;  1VQK A;  4PG3 A;  4IFD I;  1Q7Y C;  4HIK A;  1NE3 A;  4LFB L;  2K50 A;  1HR0 Q;  4A3D G;  2JE6 I;  1X56 A;  3CAM A;  2R93 G;  1I94 L;  1WI5 A;  2I0Q A;  4OON A;  1K8A C;  3K7U C;  4GOP C;  3GTJ H;  1HZC A;  2NVY H;  2MO0 A;  3PIO A;  2CWA A;  5GAD C;  1XMO Q;  1E1T A;  3U4Z A;  2R6G A;  1CKO A;  2OQ0 A;  4H02 A;  4C3H H;  3H3V I;  1VQG A;  2GVB A;  1A0I A;  1YHB A;  1IBM L;  2AKW B;  4QQB X;  1V1Q A;  3I4M H;  4DR5 L;  4IOA A;  2NVQ H;  4OX9 L;  2QGQ A;  1Z47 A;  2R92 H;  5IP7 H;  2L15 A;  2IX1 A;  4IPC A;  1RL2 A;  4LFC L;  1PH8 A;  2XTI A;  3CME A;  3J81 c;  1YBY A;  4GOP A;  2JA6 G;  2OCE A;  1L1O C;  4AQY L;  2N49 A;  1Q81 C;  2HIV A;  5M3M H;  4QY7 A;  3I4N H;  4GLV B;  3CMA A;  1HJP A;  3J80 i;  4NB3 A;  1PH6 A;  3PUX A;  1HR0 L;  1N32 Q;  1QVF A;  5EAY A;  4O0A A;  4A3K G;  1NMF A;  2A1A A;  4KHP L;  4GKK Q;  1B7Y B;  3KYH C;  3S14 H;  3GDE A;  4MZ9 A;  4GLA C;  3CCJ A;  1XMO L;  4JI4 Q;  2K4K A;  1M90 C;  4BXX G;  1N36 Q;  5FLM G;  1SN8 A;  4OO1 I;  3CF5 A;  1L1O A;  4LW1 A;  4BBR G;  5C4X H;  5ELN A;  4POG A;  3L7Z C;  2B63 H;  4OO1 G;  2AHO B;  1NJI C;  4A3C G;  4BA2 I;  1H95 A;  4DPG A;  4R4T A;  4XIG S;  2WP8 J;  2VW9 A;  1TWH H;  1EQQ A;  4OWT B;  4DV7 Q;  3H0G H;  3NEN A;  4DK3 C;  5C3E H;  2I5L X;  1UE7 A;  2KCM A;  4YWL A;  5IE8 A;  3PIP A;  2HIX A;  2R7Z H;  3HOY G;  3CCR A;  4GNX B;  3HOV H;  1X9N A;  1KD1 C;  1N32 L;  1VQH A;  3GTM H;  3H15 A;  3PF4 A;  3HOW G;  4IPG A;  1VQ5 A;  4GKK L;  2N8N A;  5H1S E;  3S1R H;  4JI4 L;  1CKN A;  2K5V A;  4DR3 Q;  4GN3 B;  2PMZ E;  3F2D A;  1S40 A;  1N36 L;  3I4O A;  1M1K C;  4JV5 Q;  2IX0 A;  1C9O A;  1V43 A;  2MNA A;  5C4J H;  4HJ9 A;  4UP8 A;  3STB C;  3A0J A;  3UDX A;  1L0W A;  2VUM G;  1W2B A;  1VQ6 A;  2JA7 H;  2FXQ A;  4UPA A;  4KI0 A;  5C44 G;  5JEA G;  1Q82 C;  1A62 A;  3G48 A;  2UUB Q;  3A74 A;  4UY8 C;  1XPR A;  4L5R C;  3RR5 A;  2E2J H;  3TRE A;  3CPF A;  4DV7 L;  5K36 G;  3CCL A;  4B3S Q;  4A3F G;  4IOC A;  1K9M C;  4OWX B;  4LF9 Q;  1OXX K;  1D8L A;  3GO5 A;  2EXD A;  3A5Z B;  2XGT A;  2H5X A;  1VQJ A;  5IP9 H;  2EQS A;  4X64 Q;  3OYY A;  3L2P A;  4HJ5 A;  4A3I H;  3S2H H;  3A5U A;  2PQA A;  4GNX C;  5C0X I;  1YI2 A;  1TWG H;  4JI8 Q;  4BY1 H;  1SLJ A;  2V1C C;  4DR3 L;  1I6H H;  5IYD G;  3IRB A;  1CKM A;  4JV5 L;  1C0A A;  4JI7 Q;  3HOU G;  1G51 A;  3F1Z A;  1FVI A;  4PZ6 A;  2N3S A;  2ZTD A;  2ES2 A;  2JA5 H;  4BBS H;  4RMF A;  4P72 A;  4XTC S;  2KCT A;  3I2Z A;  1Q86 C;  4A93 G;  4JG2 A;  3ULJ A;  1QZH A;  4A3E G;  2NVX H;  1G29 1;  3CW2 C;  1GO3 E;  1Q8K A;  2UUB L;  3AEV A;  1AH9 A;  3UE0 A;  4GN5 A;  5IYB G;  1JT8 A;  2VZA A;  4GNX A;  4X65 Q;  4QL5 A;  3DM3 A;  3PSI A;  1YIT A;  1EFW A;  4EQ5 A;  1IBK Q;  3RZO H;  4C2M H;  2JEB I;  3ER0 A;  4B3S L;  3W1B A;  4PZ7 A;  4LF9 L;  1AE2 A;  4A76 A;  3S15 H;  3NEM A;  2GN5 A;  1QUQ B;  1E3P A;  1YZ6 A;  4R1J A;  2BH8 A;  3U4V A;  4OWW B;  4X64 L;  3RLN A;  4ME3 A;  3L0O A;  4IPH A;  3OTO Q;  3FKI G;  4JI8 L;  3CCQ A;  1VQ4 A;  1EYG A;  5M5Y H;  5LMU L;  3H3V H;  4DV4 Q;  2JA9 A;  2PI2 A;  3DLL A;  2AMC B;  4B3T Q;  4L5T A;  1P16 A;  4RG1 A;  4DAY B;  4JI7 L;  1YVC A;  2ZJQ A;  1TWA H;  3S1N H;  2AWO A;  5GAG C;  2K5H A;  1S72 A;  2Q2U A;  1WOC A;  3TRZ A;  2WAQ G;  4HIO A;  2DGY A;  4IFD G;  2ZJP A;  3U58 A;  4KHP Q;  1SE8 A;  2WAQ E;  1GM5 A;  2F4V Q;  1K73 C;  1FL0 A;  4A3L H;  4X65 L;  5GAH C;  3KJP A;  4DV6 Q;  1KL9 A;  1IBK L;  5IYC G;  4A3K H;  3ULP A;  1KXL A;  3KDF A;  4DUY Q;  2VL6 A;  3CC7 A;  1PH7 A;  4AH6 A;  4JOI C;  2UUA Q;  1JMC A;  4IFD J;  5AJ3 Q;  1EIF A;  5FLM H;  4K0K Q;  1LM0 A;  1NY4 A;  2KHI A;  4JCV E;  1PV4 A;  1MJE A;  2R7F A;  3OTO L;  1A63 A;  1Q1B A;  1MKH A;  1IYJ B;  1N8R C;  1VQO A;  3J80 c;  1OXS C;  1S3O A;  4DV4 L;  3WWV A;  3SGI A;  1VQN A;  4B3T L;  1YEZ A;  3S2D H;  2BA1 A;  3BZC A;  4LF6 Q;  1PH5 A;  1HZB A;  2Z0S A;  3GTP H;  5LMN W;  4P71 A;  3KF6 B;  2IY5 B;  4KHZ A;  3CCS A;  1ASY A;  4IPD A;  2JA8 H;  2R93 H;  1E1O A;  2UXD Q;  4HJ7 A;  4IJL A;  1VQA A;  1UE5 A;  2CFM A;  3BZK A;  3I55 A;  4JI5 Q;  4DV6 L;  1QUQ A;  2F4V L;  3CC2 A;  5IY0 A;  4A3G H;  4A3J G;  1LUZ A;  2JK8 A;  3PO3 G;  3JC6 6;  5M3F H;  4DUY L;  2VY3 A;  1PH4 A;  1X55 A;  4NXN Q;  3PO2 H;  1N34 Q;  2IHE A;  4A75 A;  2UUA L;  1TXY A;  5AJ3 L;  1UE1 A;  2A19 A;  3HFZ B;  4K0K L;  1Q12 A;  4LF4 L;  4X66 L;  3CC4 A;  1IZ6 A;  3GTK H;  2RF4 A;  4J15 A;  1R9T H;  3EIV A;  2VUM H;  2WFW A;  4DV2 Q;  2B3G A;  1SRU A;  4R4Q A;  1L2F A;  4JI2 Q;  4R4C A;  3AQQ A;  4X62 Q;  4LF6 L;  2NN6 I;  3TS2 A;  1VQM A;  3S17 H;  3I4M G;  4P74 A;  5GRO A;  3J7Z C;  2KHJ A;  1XJV A;  1PH1 A;  4DR7 Q;  5JJI A;  2UXD L;  5IP7 G;  4NXM Q;  4DR4 L;  4JI5 L;  4X6A H;  4DR2 Q;  1WYD A;  4GS3 A;  1VQP A;  3M7N A;  1QVC A;  4YCV A;  3S24 A;  5M5X H;  1KIX A;  1LTL A;  4LWC A;  4NXN L;  1EUJ A;  3CPW A;  3F2C A;  1N34 L;  3I4N G;  4DV3 Q;  2KBN A;  2DUD A;  3RN2 A;  2ID0 A;  1JJ2 A;  1U5K A;  3HOZ H;  3D31 A;  3HOU H;  4AYB G;  2Q2T A;  4BY7 G;  1TWC H;  3NBH B;  4LUZ A;  4YY3 Q;  5E7N A;  4GN4 B;  1KRT A;  2VQE L;  4UP7 A;  1OXU A;  4LUO A;  4A93 H;  1WJJ A;  2WB1 G;  4DV2 L;  2BH2 A;  3J7A 5;  1T9H A;  2RHQ B;  4JI2 L;  3U50 C;  1XNR Q;  4JI6 Q;  4P75 A;  5IYB H;  4X62 L;  1QZG A;  5C4X G;  2B63 G;  1E22 A;  5JEA J;  2I5M X;  3W5O A;  4A3M H;  4IO9 A;  1K8G A;  2ASB A;  1N33 L;  4IJH A;  3STB D;  1FJG Q;  1C7Y A;  4DR7 L;  2QEX A;  4NXM L;  4JI1 Q;  4DK6 C;  3PCO B;  3ZJY C;  1BKB A;  1GKH A;  5LMU Q;  1Y1V H;  3BJU A;  4DR2 L;  1OTC A;  5C3E G;  5C0X G;  2R7D A;  1I5F A;  3FKI H;  3I56 A;  2R7Z G;  4UP9 A;  4DV3 L;  2ATW A;  2Y0S G;  4WJ3 M; 
#chains in the Genus database with same CATH topology
 2EDG A;  1VQB A;  3FP9 A;  2NTT A;  1EY5 A;  4AIM A;  1L0X B;  3PUZ A;  5C0X J;  1PYB A;  3S1M H;  5IGC A;  5IIF A;  1NBW A;  2L0C A;  2OTL A;  4FO2 A;  2F0Q A;  3J80 E;  1PVO A;  2OQK A;  2NBF A;  4JW0 A;  3CXC A;  3AFP A;  5IGD A;  5CC4 A;  2E2H H;  1HUN A;  1NR4 A;  3H6M A;  1S4Z A;  3HOX G;  4A3B G;  5DNF A;  5COR A;  3SK8 A;  2K52 A;  1J5E Q;  2ZTE A;  2Z6K A;  1E7Z A;  2F52 A;  1LT3 D;  1KHI A;  2E8G A;  1ENF A;  5IP9 G;  4YWK A;  1ONL A;  1D5Z C;  2NYZ D;  1XNQ Q;  2AUK A;  5IGF A;  3HOU B;  1VF5 C;  2KCN A;  1PH2 A;  2JJQ A;  1Y14 B;  1YJ9 A;  2LXJ A;  3NUC A;  3JAM L;  5EPK A;  5FJ8 G;  2JA5 G;  5ELE A;  2UXC L;  5EKL A;  3K7A B;  3R2T A;  1JR0 D;  4X66 Q;  3M4Q A;  1VQF A;  4FNF A;  1M8A A;  4JBJ A;  2WAC A;  1JB7 A;  4A3C H;  1BVS A;  2OT2 A;  4LFA L;  3HKZ E;  2ZM6 L;  2VQF L;  3ERQ A;  3URY A;  5DLQ E;  3HZX A;  1B4O A;  2E2D C;  1JOQ A;  4DR4 Q;  2B2U A;  2L9H A;  1ML0 D;  3M4P A;  3HOW H;  1N9W A;  4JBW A;  3R8B A;  4EX5 A;  3VYT A;  1TT2 A;  1B70 B;  3UDI A;  3PF5 A;  3J81 i;  5ISR A;  4HID A;  1U4L A;  2CCZ A;  2VQE Q;  1BBW A;  2D5D A;  3T1H L;  1ET6 A;  5JEA H;  4FF4 A;  2YTX A;  1HZ9 A;  4GKJ Q;  2MJ8 A;  1EYD A;  1A3V A;  3E3X A;  1KRS A;  4A3F H;  4LF5 L;  4HCE A;  1JJG A;  1BR9 A;  4BA1 I;  2EY6 A;  3FEW X;  1QJO A;  4FXD A;  3R3O A;  2BCO A;  1O7Z A;  2RHS B;  1HNX L;  1C8C A;  4IUR A;  4J1M A;  4JI3 L;  4Y7N H;  3CP0 A;  4DV5 L;  5LHY 1;  2BA0 A;  4RFB A;  4JYA L;  4A3J B;  2QW7 A;  1ET9 A;  1QOH A;  2HHH Q;  1SSO A;  4MNO A;  3Q0A A;  4RHR A;  1D7Q A;  4BS9 A;  1K83 H;  2QCP X;  1JE5 A;  1SEB D;  1KNA A;  1X65 A;  1FGU A;  3NQT A;  1KAW A;  2XRS D;  4FF3 A;  2WKC A;  2CKZ B;  2UU9 Q;  1Y8O B;  2O5J C;  1PH3 A;  1W6K A;  2EYP A;  1PZJ D;  5KYI A;  1BCP C;  5JJL A;  1HNW Q;  2J4X A;  2X69 A;  3TP6 A;  5HY6 A;  3X3M A;  2E74 C;  3RZD H;  1LTB D;  2O2L D;  3GTG H;  1J8I A;  5EPJ A;  2CQO A;  4YCU A;  1A8V A;  4DK0 A;  3S16 H;  2SDF A;  3OMC A;  1G2S A;  5IGE A;  3TDQ A;  4DR1 L;  3PV0 A;  4R4I A;  2Q2H A;  3K81 C;  2PW7 A;  3M3Y H;  3F2B A;  4P73 A;  3S14 B;  1VS0 A;  2WB1 B;  2O4X A;  4L5S A;  1EWI A;  1ICF B;  2FHT A;  4OIJ A;  5C4X B;  1VQC A;  2B63 B;  1G6P A;  2LFN A;  1L0Y B;  1V8Q A;  3WDN A;  1ENA A;  3P7J A;  1J6Q A;  2B29 A;  1ZYR D;  3RUZ A;  1FNV A;  1X6O A;  3RLF A;  1VQ9 A;  1X3E A;  4BY1 G;  1Y1V G;  3RNU A;  1B53 A;  3CQZ H;  3A7L A;  4LF7 L;  5ELF A;  1G8Z D;  5BN3 A;  1C48 A;  1PXU A;  5FLX L;  4AQY Q;  3MXG A;  4RGM A;  4PG3 A;  2F0M A;  5JPM C;  2K50 A;  4RGT A;  5I4D A;  2XWJ B;  5KGU A;  5EPL A;  1I94 L;  3VR4 A;  4OON A;  3GTJ H;  1LAC A;  2NVY H;  1WTQ A;  2MO0 A;  4H7B A;  2KEE A;  3U4Z A;  3GV3 A;  2KJX A;  4H02 A;  4C3H H;  1VQG A;  4DN4 M;  4IUT A;  3KLS A;  1Y1W B;  4QQB X;  1V1Q A;  4ZCK A;  3I4M H;  4DR5 L;  4IOA A;  2NVQ H;  1EU4 A;  4IN3 A;  3IAY A;  1RJT A;  2NN6 H;  5IP7 H;  2L15 A;  3HRZ C;  5LL6 S;  1RL2 A;  4LFC L;  2XTI A;  4IUN A;  4GOP A;  5CBE E;  1Q81 C;  4I7A A;  2HIV A;  1WCM B;  3CMA A;  1DOK A;  1HJP A;  3P20 A;  1HR0 L;  3PUX A;  1O7Y A;  1QVF A;  5EAY A;  3PQI A;  1NMF A;  2RCF A;  1LLR D;  4GKK Q;  1B7Y B;  1EY0 A;  2F0V A;  1TU2 B;  1M90 C;  4OO1 I;  1L1O A;  2EE1 A;  3RZO B;  1SYD A;  1B9M A;  1PFB A;  3HKZ B;  1F9P A;  1F9Q A;  3VA5 A;  4HSV A;  2KQ3 A;  4A3C G;  3S15 B;  1JB3 A;  3TP8 A;  4DXF A;  1ENC A;  3BS1 A;  1TWH H;  1EQQ A;  1R4P B;  4DV7 Q;  2B2V C;  2R3Z A;  2A6E D;  3H0G H;  2NVT B;  3H09 A;  4YWL A;  2KCM A;  2DNC A;  2R7Z H;  4PV1 C;  1N32 L;  2L55 A;  4V19 0;  3H15 A;  3SDZ A;  3HOW G;  4HMJ A;  5JAV A;  3R93 A;  2H1E A;  4JI4 L;  4ZRZ A;  4DR3 Q;  1LT6 D;  5M9O A;  4RGN A;  3T51 B;  5BN4 A;  4ULL A;  1O80 A;  1I4X A;  2JA7 H;  5JEA G;  2UUB Q;  1XPR A;  2E2J H;  3Q22 A;  2R92 B;  3CCL A;  1I4P A;  4B3S Q;  4A3F G;  4G7O C;  3NTH A;  1D8L A;  1RTN A;  1STA A;  2CW0 D;  1QWY A;  1HA6 A;  3A5Z B;  3S2D B;  3AB9 A;  2H5X A;  2EQS A;  4X64 Q;  3S2H H;  3A5U A;  1TWG H;  2QF7 A;  4G4K A;  3IRB A;  4JI7 Q;  4A3G B;  2ES2 A;  1MD2 D;  4BBS H;  5M3F B;  4RMF A;  4K2K A;  1E2Z A;  1IKM A;  1G29 1;  3CW2 C;  3JAM E;  2BOS A;  1AH9 A;  4GNX A;  4HCS A;  1B9N A;  4QL5 A;  1YIT A;  4EQ5 A;  2AQ1 B;  5KIX A;  3NE5 B;  3E5S A;  4KKU A;  3NEM A;  1D6E C;  1EQT A;  4PMC A;  1DXM A;  1HCZ A;  3RLN A;  3WOE A;  1KLU D;  5FKA C;  2F0U A;  5LMU L;  3H3V H;  2PI2 A;  1MBY A;  1JCK B;  4B3T Q;  4L5T A;  1ICW A;  1YVC A;  3S1N H;  1C4Q A;  2AWO A;  2K5H A;  1A3U A;  3J80 L;  5C4J B;  1AEX A;  5L37 A;  2DGY A;  3U58 A;  5A35 A;  1SE8 A;  2WAQ E;  1SJE D;  1K73 C;  1FL0 A;  1TWC B;  4A3K H;  1KXL A;  3ERO A;  2VL6 A;  3CC7 A;  1PH7 A;  5C4Z A;  4JOI C;  2IX3 A;  2MPM A;  3I4L A;  1TS4 A;  4A3M B;  2RSO A;  2LMC B;  4F7X A;  3OTO L;  1Q1B A;  1N8R C;  2K5Q A;  2BDN A;  1S3O A;  3WWV A;  2BA1 A;  4LF6 Q;  3EQL C;  1HZB A;  5AFW A;  3I73 A;  1EEI D;  2CHB D;  1BOS A;  2IY5 B;  1SNO A;  1PFN A;  3HG9 A;  3WOF A;  1EL0 A;  1I50 B;  1CFM A;  3LWU A;  3GV6 A;  1QUQ A;  3C1E A;  2E75 C;  3JC6 6;  2E76 C;  2VY3 A;  3PO2 H;  1X55 A;  2MP1 A;  1IKL A;  2UUA L;  3AU7 A;  4C3J B;  1GHJ A;  1UE1 A;  1B2T A;  4K0K L;  1XXG A;  1BBX C;  1E2W A;  4DFA A;  3FRP B;  4J15 A;  1DYQ A;  3BZD B;  3QR8 A;  2I46 A;  4QUC A;  4IUV A;  1SRU A;  4R4Q A;  4JI2 Q;  4C3H G;  2K6A A;  4X62 Q;  1WTH A;  4XDX A;  5EKI A;  1LT5 D;  3X3N A;  3S17 H;  2JA6 B;  3I4M G;  2KHJ A;  1Q8I A;  5IP7 G;  1UAP A;  5D65 A;  2DY7 A;  3PIP 3;  4CKE A;  3OOC A;  1WYD A;  4GS3 A;  2B2T C;  3M7N A;  4YCV A;  4KJO A;  1PRT B;  1A6X A;  4NXN L;  1FR3 A;  2ID0 A;  1JJ2 A;  1U5K A;  3K0Y A;  3HOU H;  2Z4H A;  4BBR B;  4LUZ A;  3GQB A;  2Z9H A;  1KRT A;  3J7Y W;  1OXU A;  4H0L C;  5EBD A;  1CT1 D;  1F2M A;  4K6D A;  1XNR Q;  4P75 A;  2Q8I B;  1CZG A;  1QZG A;  1E22 A;  1N33 L;  4NXM L;  1EEF D;  2EPB A;  4X3U A;  2KED A;  5LMU Q;  4DR2 L;  1OTC A;  1PFM A;  3HOY B;  2QEJ C;  1I5F A;  3GTL B;  2R7Z G;  4DV3 L;  2BE5 D;  3I72 A;  1EOV A;  4DNT B;  4OXP A;  2Y0S E;  4YY3 L;  1PZK D;  2F0L A;  1IL2 A;  4A3D H;  2R93 H;  3M9B A;  3DMU A;  1PHJ A;  3D3R A;  2LXK A;  2Z6K C;  2DJG C;  1LYL A;  1X54 A;  2EIF A;  3PUV A;  4JI6 L;  5C44 B;  1KAB A;  2ZTC A;  4ZKB B;  1AZP A;  2JA7 G;  1FJG L;  4DKA C;  1QNU A;  3G71 A;  1IBL Q;  1F2Y A;  1WTR A;  2LSS A;  3KF8 B;  2B39 A;  1XMQ Q;  4YWM A;  2KEN A;  2EY5 A;  3D4W A;  4NMZ A;  5M5X B;  2IL8 A;  2OF1 A;  1HNZ Q;  1U4R A;  2F0D A;  5ELO A;  4PMW A;  3FHW A;  5KND A;  3E9H A;  1CQF A;  5E4W C;  1ILP A;  3M85 A;  2UUC L;  4DNR B;  4HIM A;  1F2Z A;  4M1U B;  2RVL A;  5C3W A;  1HHV A;  2K33 A;  4A93 B;  3D0F A;  3UDF A;  4R4O A;  1FNU A;  2Z8L A;  4FDB A;  1JWM D;  2B2U C;  1OXV A;  4OO1 H;  3HS0 C;  4CJ2 C;  2N88 A;  1J5E L;  5JJK A;  5IWA Q;  4O1N A;  3T13 A;  2F0I A;  4JOI A;  4R8I A;  3FKI B;  1CI3 M;  1X3P A;  1XNQ L;  1SFO B;  5J3B A;  3A54 A;  2WAQ B;  2J0T D;  5FOB B;  1K8O A;  2F0P A;  1IYU A;  3W1G A;  3QB3 A;  1EQV A;  3D6W A;  1YJW A;  3BYY B;  3G6E A;  2YTV A;  2F3W A;  4C3I B;  2A6E C;  1EQR A;  3BVG A;  1ZEQ X;  1CHP D;  1VQD A;  4QIW E;  3K5L A;  2CH4 A;  4HJ8 A;  2PYK A;  1E24 A;  1N33 Q;  1SBB B;  4RKB A;  3CCM A;  1KTK A;  3ND8 A;  3V05 A;  2D62 A;  4JI0 Q;  2C5C A;  1I6V C;  3AFQ A;  4I7Z C;  1Q46 A;  3DEO A;  3K0X A;  5M3M G;  2XIW A;  4PQX A;  1TWF B;  2PO4 A;  4LF8 Q;  5IYD H;  2ZJR A;  2KOL A;  4ZLT F;  3M4O B;  1EIH A;  1SMX A;  3EJI A;  4K2L A;  3PO3 B;  2K14 A;  1YNN D;  5BR8 Q;  3T1Y Q;  2JXM B;  2F0F A;  4A3E H;  3UE1 A;  4G57 A;  2B2T A;  3PO2 G;  1DM0 B;  4GKJ L;  2WB1 E;  2F0N A;  3L9A X;  3O13 A;  5CV6 A;  2CW0 C;  1K3R A;  3RLO A;  3KBX A;  5GQO A;  2E2I B;  1PFS A;  1VQI A;  1QE6 A;  4XT1 B;  4ZK9 B;  4B3R Q;  3HOV G;  4DXG A;  1BXT A;  1G6Z A;  1SNC A;  4ALP A;  1Y1W H;  2MQH A;  3EBE A;  3LGJ A;  5DEH A;  4DV1 Q;  2ZXO A;  2N78 A;  2HHH L;  2UUC Q;  3TZU A;  3KDF B;  4L5Q A;  4AYB B;  3MXN B;  5DM6 3;  1KDA A;  4BY7 B;  1WCM H;  1V1P B;  5CBA E;  1Q1E A;  2UU9 L;  2HDM A;  1SE2 A;  4ZUI A;  4LFB Q;  4NP5 A;  1PTO H;  3NHH A;  3GTQ H;  1MJC A;  1HNW L;  3B6Y A;  5IGB A;  4DA2 A;  5HGQ A;  2OEO A;  4APV A;  1PH9 A;  5M5W H;  1P8L A;  1S5E D;  3QO2 A;  1HQR D;  1W3S A;  4EQN A;  2I5H A;  3V2T A;  1A2T A;  1IBM Q;  1FNW A;  1DZ1 A;  2RSN A;  2Y0S B;  2NVT H;  2BDO A;  2QDB A;  3C46 A;  4WJ4 A;  2MO1 A;  3DUZ A;  1VQK A;  4IFD I;  2IJ0 A;  1NE3 A;  2R93 G;  4A3D G;  2JE6 I;  1X56 A;  3CAM A;  5KNC A;  2I0Q A;  1HUM A;  3A8K E;  4GOP C;  1TR5 A;  3R2I A;  5COY A;  1Y69 U;  4JK1 C;  5GAD C;  3PIO A;  1EYC A;  1B44 D;  1CKO A;  3HOX B;  3H3V I;  4RH6 A;  4A3B B;  4UAI A;  1A0I A;  3A55 A;  4ILW A;  3QJY A;  1TS5 A;  5J22 A;  3MA2 B;  2R92 H;  3HP3 A;  2IX1 A;  1L1O C;  2A5H A;  4AQY L;  5D14 A;  3I4N H;  4ABN A;  3J80 i;  4NB3 A;  2JA5 B;  4KY6 A;  1R4Q B;  3NPP A;  1I3Q B;  4MZ9 A;  2WKD A;  5J39 A;  4I65 A;  1MSH A;  4F8M A;  1N36 Q;  5FLM G;  3CF5 A;  5I6Y A;  2K03 A;  1H9S A;  1EZ6 A;  1NUC A;  5ELN A;  1NCV A;  4OO1 G;  1LTS D;  2AHO B;  1I4G A;  1NJI C;  4CKB A;  4DPG A;  3MFG A;  5JVG 3;  4TKO B;  2HCI A;  4FYD A;  3NTK A;  1DON A;  3D4D A;  2KEC A;  3NEN A;  5C3E H;  2I5L X;  1VMC A;  3KUP A;  2DJF C;  5IE8 A;  2RKS A;  4HR7 B;  1KD1 C;  3TME A;  4IUU A;  4CGY B;  3K59 A;  3FPP A;  4IAL A;  2G5D A;  4IPG A;  1VQ5 A;  4GKK L;  2N8N A;  4G7H C;  3MFY A;  1CKN A;  1FYC A;  4GN3 B;  2PMZ E;  3F2D A;  1S40 A;  1GUT A;  4JV5 Q;  2IX0 A;  2B2W A;  1C9O A;  2HUG A;  1V43 A;  5C4J H;  4QIW B;  2M2L A;  1WVL A;  3OHX C;  3VYU A;  2VUM G;  2X6G A;  4UY8 C;  2A73 B;  4KI0 A;  3G48 A;  5I6W A;  3A74 A;  1G91 A;  2RBM A;  3TRE A;  3CPF A;  4QMG A;  4BWG B;  4LJZ C;  4DV7 L;  3TN2 A;  3OSO A;  2BE5 C;  4OWX B;  1OXX K;  1GUG A;  1VQJ A;  1GUN A;  3OYY A;  3L2P A;  4A3I H;  2PQA A;  4GNX C;  5C0X I;  5ELD A;  2F0J A;  2F0O A;  2V1C C;  4DR3 L;  1I6H H;  3J7A F;  5IYD G;  3S9W A;  3F1Z A;  1HTL D;  4PZ6 A;  3VR2 A;  5HGT A;  2ZXR A;  2KCT A;  1Q86 C;  4A3E G;  2UUB L;  3AEV A;  3UE0 A;  4GN5 A;  2MGS A;  3A56 A;  5I9P A;  1JT8 A;  2FIN B;  1EFW A;  3GTK B;  1IBK Q;  4IZ8 A;  1EIG A;  2JYO A;  4B3S L;  3M7G A;  3W1B A;  1AE2 A;  2B8G A;  1CA6 A;  1H9J A;  4R1J A;  4OWW B;  3U4V A;  2L4N A;  4DK1 A;  3KK7 A;  1DOL A;  4X64 L;  2F0E A;  3GTM B;  4CJ1 B;  4IPH A;  4DV4 Q;  3S1R B;  2AMC B;  1STB A;  4JI7 L;  2F3V A;  3TRZ A;  3Q23 A;  4E6I A;  2CH4 W;  3I8Z A;  4RWS C;  1UNS A;  2PCF B;  5JPN C;  1KL9 A;  2H4O A;  5GAH C;  2QKI C;  3KJP A;  3V96 A;  1STN A;  2KUM A;  5LL6 X;  1EYA A;  3DWP A;  3J7A V;  5AJ3 Q;  4KY5 A;  4JCV E;  1NY4 A;  2AQ3 B;  4RA8 A;  1MJE A;  4CDF C;  1W6J A;  1MKH A;  2L5T A;  3ZYY X;  1VQN A;  3SGI A;  4BY1 B;  4B3T L;  5I2Y A;  1Y1V B;  1XYI A;  4Q5V A;  1TKW B;  4CDC C;  5LMN W;  4P71 A;  1BQQ T;  1DD2 A;  2JA8 H;  4IPD A;  1G2T A;  1E1O A;  2UXD Q;  1EZ8 A;  2TMP A;  5IY0 A;  2G9D A;  1D1I A;  4C2M B;  3S1M B;  2IHE A;  5IOD A;  4A75 A;  1TXY A;  3QG1 A;  4L8J A;  2K32 A;  3HFZ B;  1WD1 A;  5A2Q L;  4LF4 L;  4OIK A;  3CC4 A;  2K01 A;  3K5O A;  2K7V A;  1CZW A;  1R9T H;  2EJF C;  2WFW A;  2E2H B;  1SE3 A;  4OHJ A;  2SOB A;  5ELB A;  5JJZ A;  1SNQ A;  3AQQ A;  2TSS A;  1CA5 A;  4LF6 L;  1AN8 A;  1VQM A;  2RQX A;  4FXG C;  1PH1 A;  1YNN C;  1UUP A;  2IWH A;  1ZKO A;  4X6A H;  5M5X H;  4N8X 1;  3AMU A;  3CPW A;  2V4D A;  3I4N G;  3BG3 A;  4LMQ D;  1SYG A;  2KBN A;  3RN2 A;  2F0H A;  2K04 A;  4G7Z C;  3HOZ H;  1LTG D;  5E7N A;  4A93 H;  2LY7 A;  3J7A 5;  3I90 A;  4JI2 L;  3U50 C;  1PTO D;  3HGB A;  3I91 A;  5IYB H;  4EVO A;  4X62 L;  2IPK D;  4CKC A;  5JEA J;  4KV6 A;  4PNY A;  3H3V C;  2PZU A;  3STB D;  2RA4 A;  2VB3 X;  4JI1 Q;  3PCO B;  3SEB A;  1AW7 A;  3BJU A;  5C3E G;  1O7L A;  2WII B;  3QWN A;  3U9S A;  2A6H D;  3FKI H;  4X3T A;  3HOW B;  2PMZ B;  2K05 A;  1SFO H;  4KY7 A;  4LUV A;  4NPS A;  2XRQ D;  4JC0 A;  5IT9 c;  1KC8 C;  1EWH A;  4RCN A;  4DAM A;  4IFD H;  2EY1 A;  1Q3L A;  1XNR L;  3NTI A;  4YHH Q;  4QGU A;  5J1Z A;  2JSO A;  2F1M A;  2XWB B;  1BBU A;  1MIU A;  2E5L Q;  4DUZ Q;  2IT1 A;  3LWE A;  4A3F B;  1XPO A;  2XVS A;  1STH A;  2L11 A;  1PA6 A;  4K8I A;  5EKK A;  1EIY B;  4QJF A;  1BO0 A;  3QIA A;  2K28 A;  4A3I G;  4EGV A;  1EWC A;  3GTO H;  1VQE A;  1HFG A;  2DN8 A;  4TQU S;  2ALY B;  3E6Z X;  2L1B A;  3EN2 A;  4YCW A;  1L1O B;  3KLW A;  3PGZ A;  3VR3 A;  1GD7 A;  1OXT A;  3KBG A;  4BXX H;  5D3I B;  1K83 B;  5FO7 B;  3D4R A;  5GAE C;  4LF4 Q;  3I7F A;  1X3F A;  1IBL L;  4RAU C;  1JJC B;  2GVA A;  2NZH A;  3KLS X;  1ESR A;  2CWP A;  4GZY C;  1SR3 A;  1XMQ L;  1QG7 A;  1O7I A;  2MFI A;  4DV6 Q;  3BU2 A;  1HNZ L;  1ILQ A;  3GTG B;  5T1I A;  2E2I H;  1PYS B;  3DHQ A;  4OEM B;  4Q0F A;  5FLX c;  1SRO A;  3TP7 A;  2KHS A;  1SND A;  3JAM i;  3S1Q H;  3S16 B;  3PUY A;  2YV5 A;  4DR6 Q;  4B3M Q;  5FO8 B;  3K80 C;  1VQL A;  1T5X D;  3VYR A;  4DAY A;  3FMC A;  2C35 B;  1VQ7 A;  2IHF A;  1TII D;  3T16 A;  1BNZ A;  4MTN A;  5IWA L;  1EFI D;  4BY7 H;  4OGQ C;  1YNX A;  3TS0 A;  1SMY D;  1ESF A;  4HJA A;  1F77 A;  2Z4I A;  4F87 A;  1BCP B;  3E0E A;  1S5C D;  2JP1 A;  3SK4 A;  2RCN A;  1HH2 P;  2NN6 G;  2Q2I A;  3UI2 A;  2B2Y A;  3K8A A;  3BDC A;  3CHB D;  4DV0 Q;  3ICE A;  1SNM A;  1XTD A;  5C0X H;  2JA8 G;  1NTG A;  3A8I E;  4EQO A;  3KF6 A;  4AYB E;  2D9U A;  4FF1 A;  2K1B A;  1X32 A;  3G7L A;  4TVA B;  3MEF A;  5KYL A;  3K7A H;  1PTO F;  3OWE B;  3KOJ A;  3I70 A;  3GTJ B;  4WOR A;  4GLX A;  2FFK B;  3UDG A;  4H44 C;  2YTY A;  4C3H B;  4JI0 L;  2OXP A;  3H0G G;  2P5Z X;  1AE3 A;  3I4M B;  2NVQ B;  5E3F A;  1TVX A;  3HOX H;  4A3B H;  4LF8 L;  3HEJ A;  5C6A A;  2EJM A;  4KN7 C;  2PNH A;  5K5P A;  2HDL A;  1HZA A;  3NK9 A;  3NSW A;  4DGZ A;  5BR8 L;  3T1Y L;  2YU9 B;  2RDH A;  3BDL A;  1CSQ A;  3TEH B;  2OTJ A;  1ZYR C;  3K58 A;  4MHE A;  1BDO A;  2UXB Q;  5CV9 A;  3HOZ G;  3N6R A;  4MN3 A;  5FJ8 H;  1PRT D;  1GJX A;  1YHA A;  3Q8D A;  3PUW A;  1I3Q H;  3IFD A;  2EYL A;  2YYZ A;  1EU3 A;  1I4Q A;  2M9V A;  3NBH A;  3DM1 A;  4JBK A;  4B3R L;  1V9P A;  1TWH B;  3HKS A;  2ZT9 C;  2QDL A;  3RN5 A;  2EYJ A;  4DV1 L;  1UEA B;  1K0R A;  3CCU A;  1VF7 A;  4QF4 A;  2R7Z B;  2D0P A;  1B3A A;  4OX9 Q;  4O2D A;  3BYT B;  2NZO A;  4KKT A;  5ELC A;  1AZQ A;  1DJR D;  5E4X A;  4BBS G;  4U68 A;  3NEL A;  2CQA A;  3AYH B;  4A3J H;  2PPB C;  2PZW A;  1Q7Y C;  4LFB L;  4H13 C;  2EYO A;  4KHV A;  1V1O A;  1D5X C;  2F0S A;  4RCO A;  1WTX A;  5EJW A;  3SK6 A;  3K7U C;  3VR5 A;  1K8A C;  2JA7 B;  3Q24 A;  1CK1 A;  4V0B A;  2CWA A;  1XMO Q;  2FJ2 A;  1VDZ A;  4J6H A;  1EY8 A;  5A2Q E;  3MXN A;  1YHB A;  1IBM L;  2AKW B;  1V1P A;  3I3C A;  5C3X A;  4N9P A;  4U67 3;  5TSS A;  3ITP A;  1Z47 A;  4IPC A;  1PH8 A;  3CME A;  3J81 c;  1YBY A;  3A8J E;  4CDE C;  4B9X A;  4L63 B;  1FD7 D;  1TWG B;  2N49 A;  2EOT A;  4QY7 A;  4GLV B;  1PH6 A;  1I4R A;  1JOK A;  4O0A A;  4HTH A;  4A3K G;  2A1A A;  4K6L A;  4J8Q A;  3KYH C;  3S14 H;  3GDE A;  4BXX G;  4B08 A;  2K4K A;  1SN8 A;  1F9R A;  3MHB A;  5HUR A;  5C4X H;  3L7Z C;  2B63 H;  1B1Z A;  4KTA A;  1WTP A;  4BA2 I;  1RTO A;  3H94 A;  4R4T A;  4XIG S;  2WP8 J;  2VW9 A;  1PYW D;  4OWT B;  4DK3 C;  2B2W C;  1UE7 A;  1IYV A;  2HIX A;  5EBC A;  4KK7 A;  1CTM A;  1RHP A;  1VQH A;  3S1N B;  3N52 A;  3GTM H;  1SDF A;  3PF4 A;  2FMC A;  1JE4 A;  3S1R H;  3IFT A;  2K5V A;  5C4H A;  1PTO C;  1SYB A;  1N36 L;  3I4O A;  1EOT A;  4XQN A;  3LNN A;  2MNA A;  4HJ9 A;  3STB C;  3A0J A;  1L0W A;  1W2B A;  4K5W A;  1JWU D;  1VQ6 A;  5KEE A;  1Q82 C;  4OL7 A;  4L5R C;  3RR5 A;  2A6H C;  1A3T A;  1K9M C;  4LF9 Q;  3GO5 A;  2EXD A;  1QNK A;  5M3M B;  3DXJ C;  2XGT A;  4QUF A;  1RD9 D;  1X3Q A;  1XWE A;  4HJ5 A;  3CKI B;  3SK5 A;  4JI8 Q;  4BY1 H;  1SLJ A;  2G9H D;  3TZD A;  4CDD C;  4JV5 L;  1CKM A;  1JOO A;  3W2D A;  3HOU G;  1G51 A;  1FVI A;  2ZTD A;  1NNX A;  3PO2 B;  1PRT F;  4P72 A;  3EA6 A;  4XTC S;  3BVZ A;  4JG2 A;  1PDQ A;  1QZH A;  1LTI D;  4IUP A;  3IKJ A;  5F2D A;  2VZA A;  4X65 Q;  1MSG A;  1JQY D;  3DM3 A;  4NW2 A;  4YIJ A;  3RZO H;  4C2M H;  2JEB I;  4PZ7 A;  2A69 D;  2F0T A;  4A76 A;  2F03 A;  3S15 H;  2FMM A;  3J81 E;  2GN5 A;  1E3P A;  1DCZ A;  4CHT B;  4XT3 B;  3HOV B;  4ME3 A;  3S17 B;  3Q6S A;  3K5N A;  2EYM A;  1EYG A;  2NZ1 D;  4RG1 A;  1PMR A;  2D2C C;  4OEL B;  4C56 C;  2Q2U A;  1S72 A;  1WOC A;  2EXZ A;  1QIL A;  3FDT A;  2ZJP A;  5CMD A;  4C1N K;  4ZAI A;  2F4V Q;  4A3L H;  3FPU B;  4QB4 A;  1IBK L;  3ULP A;  1EY9 A;  4DUY Q;  1U4M A;  3SE0 A;  2WV6 D;  1JMC A;  1EIF A;  3EVQ A;  4HAE A;  3PIO 3;  1PV4 A;  2R7F A;  1GXD C;  1A63 A;  1B50 A;  5CV4 A;  1IYJ B;  4DV4 L;  1AFP A;  5IOC A;  3S2D H;  2MUY A;  1PH5 A;  1BUV T;  4ME5 A;  3T53 B;  1Q90 A;  3EFX D;  3CCS A;  1VQA A;  1UE5 A;  2PQE A;  2CFM A;  4K5X A;  4JI5 Q;  4DV6 L;  2NVX B;  4A3G H;  2M00 A;  2R93 B;  1SJH D;  4A3J G;  4A3D B;  2F0G A;  1LUZ A;  1SMY C;  1PH4 A;  5M3F H;  1SXT A;  1N34 Q;  3C1F A;  5AJ3 L;  3NWT A;  1Q12 A;  3ND9 A;  4PMB A;  1LT4 D;  3W3A A;  3C2P A;  3EIV A;  4DV2 Q;  2B3G A;  3FVQ A;  1L2F A;  4R4C A;  5M5Y B;  1U9R A;  3TS2 A;  2HCC A;  2XNA C;  1TWA B;  4XXE A;  5JJI A;  4DR7 Q;  3T56 B;  2UXD L;  1WTW A;  5T1G A;  1E0B A;  4FXK C;  4KMU C;  1VQP A;  1STE A;  4L6T B;  3S24 A;  3CRL C;  4XQJ A;  1LTL A;  4LWC A;  3F2C A;  3G6J B;  4DU9 A;  1F2L A;  1XTC D;  2DUD A;  3D31 A;  2VXW A;  1TWC H;  4F88 A;  4GN4 B;  3MTS A;  4UP7 A;  2WB1 G;  1CQV A;  1T9H A;  2Z6B A;  3T4A C;  5G3L D;  2KA7 A;  1YNJ D;  5IT9 L;  5C4X G;  2QIL A;  4DAV A;  2B63 G;  2DNE A;  2XN9 C;  3W5O A;  4A3M H;  2NB0 A;  3NXW A;  1K8G A;  4IJH A;  3OIP A;  1C7Y A;  3GTP B;  3H91 A;  4DK6 C;  1LO5 D;  1BKB A;  1GKH A;  1HTP A;  1STG A;  1TS3 A;  2RDG A;  3MWY W;  2SNS A;  4RKL A;  2A68 D;  3NBI A;  2R7D A;  1ROD A;  1TY2 A;  3I56 A;  2Q8T A;  1PRT C;  4WJ3 M;  2EYH A;  1I50 H;  1HFN A;  3CD6 A;  4WFN 3;  5I2X A;  3KFU A;  4JPB W;  1OO9 B;  2VUM B;  4C3J H;  1UWV A;  4A4I A;  1KQS A;  1UE6 A;  2UXC Q;  3BDO A;  1B8A A;  4PZ8 A;  3OMG A;  2HQE A;  2KCC A;  1YJN A;  4JI1 L;  1ASZ A;  4KD4 A;  4LFA Q;  1Y1W G;  1SYC A;  2JA6 H;  2ZM6 Q;  2VQF Q;  3CRK C;  3TQY A;  3NWS A;  1WCM G;  1STY A;  1H9S B;  4YHH L;  3DWA A;  4A3E B;  2AUJ D;  3G4S A;  1JOR A;  4BBR H;  2ICE C;  2O5I C;  1LAB A;  2E5L L;  2K5D A;  3OW2 A;  4DUZ L;  5CGK A;  1K8M A;  1IW7 D;  4HMI A;  3T1H Q;  2VS1 A;  3HKZ G;  1HPC A;  1CSP A;  1D5M C;  5FO9 B;  3ONA B;  3ULL A;  1U4P A;  2JEA I;  4LF5 Q;  2HT1 A;  1XPU A;  1K0S A;  3JAM c;  3HOY H;  1WFQ A;  1CUK A;  5LMN L;  1PLF A;  1CKN B;  3GTL H;  1MHW C;  4JVZ A;  4NKL A;  2AWN A;  1HNX Q;  1Z9F A;  5FK9 C;  3TP5 A;  3J81 j;  2VNU D;  1EY4 A;  4IQZ A;  1KDB A;  4HED A;  1HR0 W;  4ID6 A;  4DV5 Q;  4JI3 Q;  1BF4 A;  4JYA Q;  3RD4 A;  3MAQ A;  2YU9 H;  1DGS A;  4A3L G;  2B2Y C;  1PTO B;  3IL8 A;  4WRD A;  5C44 H;  1KNE A;  3CCE A;  3GTQ B;  1NSN S;  5JVH 3;  5D3D A;  3VYS A;  3ERS X;  1DOM A;  5K36 H;  2WIN B;  3L3O C;  5M5W B;  1YHQ A;  1QVG A;  4LNQ A;  2PI2 E;  2PQA B;  2R92 G;  1X3G A;  1WD0 A;  1ZXT A;  2JQO A;  1GVP A;  4LK1 C;  1VCI A;  4DR6 L;  2R61 A;  1GUO A;  3BVM A;  4B3M L;  3P75 A;  1KDC A;  2LS0 1;  1U0L A;  2ICI A;  1GHK A;  2PZT A;  2A74 C;  4A3G G;  4DR1 Q;  5M3F G;  1A15 A;  2D0O A;  1TS2 A;  5G3L F;  1WTV A;  2JN4 A;  1T5E A;  4NDX A;  1TY0 A;  2K75 A;  1D1K A;  5CV7 A;  2I07 B;  2KVM A;  1JWS D;  1UEB A;  1I4H A;  3CU7 A;  1K3B C;  1NMG A;  1SNP A;  2EZV A;  4DV0 L;  4KLK A;  3QOJ A;  1IXR A;  2K5W A;  1LTR D;  3I4N B;  4KN4 C;  1SYE A;  1JC7 A;  3CCV A;  1VQ8 A;  4LF7 Q;  2OWO A;  2A8V A;  4TSS A;  1D2B A;  3LX0 A;  3VDY A;  5IYC H;  2A69 C;  1YIJ A;  2VB2 X;  2K5N A;  3E9I A;  4C3I H;  4Y52 H;  3SXH A;  4GOP B;  3DEP A;  2RDF A;  3KJO A;  4K14 A;  1I94 Q;  1RCV D;  2Z1C A;  2HQL A;  4JBM A;  4DNI A;  4S3S A;  3F8T A;  4A3M G;  3QOL A;  2Q8R E;  3GD7 A;  2PNR C;  4Y7N B;  4POF A;  5C3E B;  4MTK A;  1E2V A;  4FF2 A;  4KD3 A;  3E0J A;  3P1H A;  5LMN Q;  4HSP A;  2QA4 A;  4DR5 Q;  4FVM A;  1TWF H;  4WJW A;  3TSS A;  2ZXP A;  4LFC Q;  3M4O H;  3MZ5 A;  1RIP A;  4CJ0 B;  2UXB L;  2F3I A;  1CHQ D;  3PO3 H;  4DAP A;  4HIK A;  5CYU A;  3J81 L;  1HR0 Q;  5BN5 A;  1WI5 A;  4TRD A;  3K6O A;  4C3J G;  1H9R A;  1HZC A;  2CVR A;  2IW3 A;  2NWG A;  3RZD B;  2EYF A;  1E1T A;  1Z6H A;  2R6G A;  4R8N A;  1K28 A;  4XYO A;  2OQ0 A;  5C5M A;  3OW7 A;  2GVB A;  5DAU A;  3RMH A;  2EVB A;  4OX9 L;  2QGQ A;  4C1N I;  2JA6 G;  4A3I B;  2B8F A;  2OCE A;  3KF8 A;  1WTO A;  1S5D D;  4M8A A;  4B9W A;  5M3M H;  4RHS A;  3M3Y B;  1I6H B;  1RDP D;  2ENB A;  1EY6 A;  4K5V A;  3U9O A;  3NQI A;  4DF7 A;  1N32 Q;  1TQO A;  4KHP L;  4MIU A;  3CCJ A;  4JI4 Q;  4GLA C;  1XMO L;  4LW1 A;  4BBR G;  5I9O A;  4POG A;  1GUS A;  1H95 A;  3MVV A;  5IT9 E;  2SEB D;  3CQZ B;  4QCL A;  3TBI B;  5CR3 A;  2MHV A;  3PIP A;  3SVM A;  1HA5 A;  3HOY G;  1KLG D;  3CCR A;  4GNX B;  1X9N A;  3HOV H;  1EY7 A;  4ZQ3 A;  1CM9 A;  1VMP A;  5H1S E;  3VR6 A;  1YNJ C;  2B2V A;  2NVY B;  1M1K C;  4X3S A;  3KLR A;  3MXP A;  3F2U A;  4UP8 A;  4XQQ A;  3UDX A;  2FXQ A;  4UPA A;  5C44 G;  3GP7 A;  1A62 A;  1SE4 A;  2GA4 B;  2L12 A;  2A68 C;  5K36 G;  5CV5 A;  4IOC A;  5NUC A;  3D8G A;  3MXU A;  5IGG A;  2NUC A;  5IP9 H;  1II3 A;  4CBV A;  1BCP D;  5EQ0 A;  1YI2 A;  2JA8 B;  1HRJ A;  4K8J A;  4FP5 D;  5CV8 A;  2XSC A;  1C0A A;  4ZUJ A;  2JA5 H;  2N3S A;  3I2Z A;  4A93 G;  1PZI D;  3ULJ A;  2NVX H;  1GO3 E;  1Q8K A;  5IYB G;  3D6C A;  3PSI A;  2N55 A;  1JIC A;  5FLX E;  4UDU C;  1Y8P B;  3ER0 A;  3OWF A;  3H0G B;  1R9T B;  4LF9 L;  4O42 A;  1QUQ B;  1GOZ A;  1H9K A;  1YZ6 A;  2BH8 A;  2HD3 A;  4X3K A;  3L0O A;  3OTO Q;  3FKI G;  4N9T A;  4JI8 L;  3CCQ A;  1VQ4 A;  5M5Y H;  2JA9 A;  2PW5 A;  4KJN A;  3DLL A;  1IHZ A;  1P16 A;  4DAY B;  2ZJQ A;  1TWA H;  5GAG C;  1H9M A;  2WAQ G;  4HIO A;  1HQM C;  2C9O A;  4IFD G;  1QB5 D;  3MEH A;  4HN7 A;  1IW7 C;  4KHP Q;  1A2U A;  3PMF A;  1GM5 A;  3HOZ B;  4X65 L;  5IYC G;  2E2J B;  3SHL A;  3KDF A;  2F4I A;  4AH6 A;  4C3I G;  2UUA Q;  1SYF A;  4IFD J;  5FLM H;  4K0K Q;  1LM0 A;  2KHI A;  4EQP A;  2EY2 A;  1LV9 A;  2SNM A;  3S2H B;  1VQO A;  3J80 c;  1OXS C;  1QCB D;  3C3L A;  1YEZ A;  1MGS A;  4XYQ A;  2F0K A;  1HXY D;  3BZC A;  5EGT A;  5KRU A;  2Z0S A;  3GTP H;  1XX8 A;  1FGB D;  3A7A B;  3KF6 B;  3MC0 B;  4RGO S;  4BBS B;  4KHZ A;  1Y8N B;  1ASY A;  1KAA A;  4UHV A;  4HJ7 A;  4IJL A;  3BZK A;  3I55 A;  2F4V L;  4KKS A;  3DWQ A;  3CC2 A;  3OPO A;  2DY8 A;  2JK8 A;  3PO3 G;  4DUY L;  4NXN Q;  1B3Q A;  2A19 A;  5JOB A;  3NP8 A;  4X66 L;  1IL8 A;  1IZ6 A;  3GTK H;  4ZYS A;  2RF4 A;  1S5B D;  2F0W A;  4LAA A;  2VUM H;  1NR2 A;  5KNB A;  4R9W A;  2NN6 I;  3OIQ A;  1Z7T A;  1LTA D;  5DM7 3;  3K5M A;  2AQ2 B;  4P74 A;  5GRO A;  3J7Z C;  1XJV A;  3SR1 A;  4NXM Q;  2NTS A;  4DR4 L;  4JI5 L;  1S5F D;  1J9O A;  4DR2 Q;  3GTO B;  2X6L A;  4P2C B;  1QVC A;  1KIX A;  1NAP A;  1AP0 A;  1EUJ A;  4Z9C B;  4A3K B;  1N34 L;  4N8F A;  4DV3 Q;  3K57 A;  1O78 A;  1MI2 A;  4AYB G;  2Q2T A;  4BY7 G;  3NBH B;  4YY3 Q;  2VQE L;  4LUO A;  2EJG C;  1WJJ A;  4DV2 L;  2BH2 A;  4ZKC B;  1RF2 D;  2RHQ B;  3M4Y A;  4JI6 Q;  1GUW A;  1LTT D;  2I5M X;  4ODG A;  4IO9 A;  2J7Z A;  2ASB A;  1FJG Q;  2LKV A;  4DR7 L;  2QEX A;  5E1F A;  3ZJY C;  1BCP F;  1Y1V H;  4IUQ A;  1SAP A;  3VA7 A;  5C0X G;  1M4V A;  1F9S A;  3S1Q B;  4UP9 A;  2ATW A;  5C5L A;  2Y0S G;  1RKN A; 
#chains in the Genus database with same CATH homology
 1EOV A;  1SFO H;  1I50 H;  1VQB A;  3FP9 A;  4LUV A;  4NPS A;  2Y0S E;  4JC0 A;  4OXP A;  4YY3 L;  5IT9 c;  1KC8 C;  1IL2 A;  3CD6 A;  4A3D H;  4AIM A;  3KFU A;  3M9B A;  3PUZ A;  4DAM A;  5C0X J;  1PHJ A;  1PYB A;  3S1M H;  2LXK A;  2Z6K C;  1LYL A;  1X54 A;  2EIF A;  4C3J H;  1NBW A;  1UWV A;  3PUV A;  4A4I A;  4YHH Q;  4QGU A;  1KQS A;  2OTL A;  4JI6 L;  1XNR L;  1UE6 A;  2UXC Q;  1B8A A;  2ZTC A;  1PVO A;  2OQK A;  1BBU A;  4PZ8 A;  1MIU A;  2E5L Q;  2JA7 G;  1FJG L;  4DKA C;  3CXC A;  4DUZ Q;  3AFP A;  2IT1 A;  1YJN A;  3G71 A;  1IBL Q;  4JI1 L;  2E2H H;  1XPO A;  2LSS A;  1ASZ A;  3HOX G;  4A3B G;  1PA6 A;  3KF8 B;  1J5E Q;  2K52 A;  2ZTE A;  2Z6K A;  4LFA Q;  1E7Z A;  1Y1W G;  2F52 A;  4YWM A;  1XMQ Q;  1EIY B;  2KEN A;  2JA6 H;  1KHI A;  4QJF A;  2ZM6 Q;  2VQF Q;  1HNZ Q;  2E8G A;  5IP9 G;  4YWK A;  5ELO A;  4PMW A;  3FHW A;  3TQY A;  3E9H A;  4A3I G;  1XNQ Q;  3M85 A;  3GTO H;  1VQE A;  2UUC L;  4TQU S;  1PH2 A;  2JJQ A;  2ALY B;  1WCM G;  1Y14 B;  4HIM A;  3EN2 A;  4YCW A;  1YJ9 A;  1L1O B;  3KLW A;  3PGZ A;  1GD7 A;  1OXT A;  2LXJ A;  3D0F A;  4YHH L;  5FJ8 G;  3UDF A;  2JA5 G;  4BXX H;  4R4O A;  3G4S A;  2UXC L;  4FDB A;  5GAE C;  4BBR H;  4LF4 Q;  3I7F A;  2E5L L;  1X3F A;  4X66 Q;  3M4Q A;  3OW2 A;  4DUZ L;  1VQF A;  1IBL L;  1OXV A;  4JBJ A;  1JB7 A;  1JJC B;  2GVA A;  2NZH A;  4A3C H;  2CWP A;  3T1H Q;  2VS1 A;  3HKZ G;  1J5E L;  5JJK A;  1BVS A;  5IWA Q;  1SR3 A;  1XMQ L;  1CSP A;  4LFA L;  1O7I A;  3HKZ E;  3ULL A;  2MFI A;  4JOI A;  2ZM6 L;  3BU2 A;  2VQF L;  1HNZ L;  2JEA I;  4LF5 Q;  2HT1 A;  1XPU A;  5DLQ E;  3JAM c;  2E2I H;  1XNQ L;  1PYS B;  3HOY H;  4DR4 Q;  1WFQ A;  1CUK A;  5J3B A;  5LMN L;  1CKN B;  3M4P A;  5FLX c;  1SRO A;  3HOW H;  3GTL H;  1N9W A;  3JAM i;  3S1Q H;  2AWN A;  1HNX Q;  1Z9F A;  2YV5 A;  3PUY A;  4JBW A;  4DR6 Q;  3J81 j;  2VNU D;  4B3M Q;  4EX5 A;  3K80 C;  1HR0 W;  4DV5 Q;  4JI3 Q;  3W1G A;  1VQL A;  1B70 B;  4JYA Q;  2C35 B;  3UDI A;  3PF5 A;  1VQ7 A;  3J81 i;  2YU9 H;  4HID A;  1DGS A;  1YJW A;  3G6E A;  4A3L G;  2CCZ A;  2IHF A;  2VQE Q;  2YTV A;  1BBW A;  3T1H L;  4MTN A;  5C44 H;  5IWA L;  3CCE A;  1EQR A;  4BY7 H;  1YNX A;  2YTX A;  1HZ9 A;  3TS0 A;  4GKJ Q;  3ERS X;  4HJA A;  1VQD A;  4QIW E;  1KRS A;  4HJ8 A;  1YHQ A;  4A3F H;  1E24 A;  3E0E A;  4LF5 L;  1N33 Q;  1JJG A;  4BA1 I;  3CCM A;  2RCN A;  1QVG A;  4LNQ A;  1HH2 P;  2PI2 E;  2NN6 G;  2PQA B;  2D62 A;  2R92 G;  1X3G A;  2Q2I A;  4JI0 Q;  3AFQ A;  2JQO A;  3K8A A;  1Q46 A;  1GVP A;  2RHS B;  3K0X A;  5M3M G;  1VCI A;  1HNX L;  4DR6 L;  4B3M L;  4DV0 Q;  3ICE A;  4JI3 L;  4Y7N H;  3CP0 A;  2ZJR A;  1U0L A;  4DV5 L;  1XTD A;  4LF8 Q;  5IYD H;  2BA0 A;  1SMX A;  2JA8 G;  4JYA L;  1NTG A;  2K14 A;  2HHH Q;  4MNO A;  3KF6 A;  5BR8 Q;  4AYB E;  3T1Y Q;  4A3G G;  4A3E H;  3UE1 A;  1D7Q A;  4DR1 Q;  1K83 H;  1JE5 A;  1X65 A;  4TVA B;  5M3F G;  3MEF A;  3PO2 G;  4GKJ L;  2WB1 E;  1FGU A;  3K7A H;  3KOJ A;  1KAW A;  2D0O A;  2CKZ B;  2UU9 Q;  4GLX A;  2K75 A;  1K3R A;  3RLO A;  3UDG A;  1PH3 A;  2YTY A;  5GQO A;  4JI0 L;  3H0G G;  1HNW Q;  1UEB A;  5JJL A;  1AE3 A;  1PFS A;  1VQI A;  5HY6 A;  3RZD H;  1NMG A;  4DV0 L;  4B3R Q;  3HOV G;  3HOX H;  3GTG H;  4A3B H;  4LF8 L;  4ALP A;  1Y1W H;  2PNH A;  4KLK A;  2MQH A;  3EBE A;  1HZA A;  2CQO A;  3LGJ A;  4YCU A;  1A8V A;  4DV1 Q;  2N78 A;  1IXR A;  2HHH L;  2UUC Q;  3S16 H;  5BR8 L;  3T1Y L;  3KDF B;  3CCV A;  4DR1 L;  1CSQ A;  1VQ8 A;  2OWO A;  4L5Q A;  3TEH B;  4LF7 Q;  2A8V A;  2OTJ A;  3PV0 A;  4R4I A;  2Q2H A;  3MXN B;  3K81 C;  3VDY A;  1WCM H;  5IYC H;  3F2B A;  1YIJ A;  1Q1E A;  2UU9 L;  3M3Y H;  4P73 A;  2UXB Q;  1VS0 A;  2K5N A;  3E9I A;  3HOZ G;  5FJ8 H;  1YHA A;  4C3I H;  4LFB Q;  4Y52 H;  3Q8D A;  3GTQ H;  4L5S A;  4GOP B;  3PUW A;  1EWI A;  1MJC A;  1I3Q H;  3KJO A;  1HNW L;  1VQC A;  3B6Y A;  1G6P A;  1I94 Q;  5HGQ A;  2YYZ A;  2HQL A;  4APV A;  1PH9 A;  5M5W H;  1P8L A;  4JBK A;  4JBM A;  4DNI A;  4B3R L;  1V9P A;  1W3S A;  3F8T A;  2I5H A;  4A3M G;  3HKS A;  1J6Q A;  2B29 A;  3GD7 A;  3RN5 A;  4POF A;  1X6O A;  3RLF A;  4DV1 L;  1VQ9 A;  5LMN Q;  1IBM Q;  1X3E A;  4BY1 G;  1K0R A;  3CCU A;  2QA4 A;  1Y1V G;  4DR5 Q;  2D0P A;  4OX9 Q;  4O2D A;  1TWF H;  3CQZ H;  3RNU A;  4LF7 L;  2NZO A;  2NVT H;  4LFC Q;  3M4O H;  4BBS G;  3NEL A;  1RIP A;  4WJ4 A;  3AYH B;  2UXB L;  4AQY Q;  2F3I A;  4A3J H;  2MO1 A;  3PO3 H;  1VQK A;  4PG3 A;  4IFD I;  1Q7Y C;  4HIK A;  1NE3 A;  4LFB L;  2K50 A;  1HR0 Q;  4A3D G;  2JE6 I;  1X56 A;  3CAM A;  2R93 G;  1I94 L;  1WI5 A;  2I0Q A;  4OON A;  1K8A C;  3K7U C;  4GOP C;  3GTJ H;  1HZC A;  2NVY H;  2MO0 A;  3PIO A;  2CWA A;  5GAD C;  1XMO Q;  1E1T A;  3U4Z A;  2R6G A;  1CKO A;  2OQ0 A;  4H02 A;  4C3H H;  3H3V I;  1VQG A;  2GVB A;  1A0I A;  1YHB A;  1IBM L;  2AKW B;  4QQB X;  1V1Q A;  3I4M H;  4DR5 L;  4IOA A;  2NVQ H;  4OX9 L;  2QGQ A;  1Z47 A;  2R92 H;  5IP7 H;  2L15 A;  2IX1 A;  4IPC A;  1RL2 A;  4LFC L;  1PH8 A;  2XTI A;  3CME A;  3J81 c;  1YBY A;  4GOP A;  2JA6 G;  2OCE A;  1L1O C;  4AQY L;  2N49 A;  1Q81 C;  2HIV A;  5M3M H;  4QY7 A;  3I4N H;  4GLV B;  3CMA A;  1HJP A;  3J80 i;  4NB3 A;  1PH6 A;  3PUX A;  1HR0 L;  1N32 Q;  1QVF A;  5EAY A;  4O0A A;  4A3K G;  1NMF A;  2A1A A;  4KHP L;  4GKK Q;  1B7Y B;  3KYH C;  3S14 H;  3GDE A;  4MZ9 A;  4GLA C;  3CCJ A;  1XMO L;  4JI4 Q;  2K4K A;  1M90 C;  4BXX G;  1N36 Q;  5FLM G;  1SN8 A;  4OO1 I;  3CF5 A;  1L1O A;  4LW1 A;  4BBR G;  5C4X H;  5ELN A;  4POG A;  3L7Z C;  2B63 H;  4OO1 G;  2AHO B;  1NJI C;  4A3C G;  4BA2 I;  1H95 A;  4DPG A;  4R4T A;  4XIG S;  2WP8 J;  2VW9 A;  1TWH H;  1EQQ A;  4OWT B;  4DV7 Q;  3H0G H;  3NEN A;  4DK3 C;  5C3E H;  2I5L X;  1UE7 A;  2KCM A;  4YWL A;  5IE8 A;  3PIP A;  2HIX A;  2R7Z H;  3HOY G;  3CCR A;  4GNX B;  3HOV H;  1X9N A;  1KD1 C;  1N32 L;  1VQH A;  3GTM H;  3H15 A;  3PF4 A;  3HOW G;  4IPG A;  1VQ5 A;  4GKK L;  2N8N A;  5H1S E;  3S1R H;  4JI4 L;  1CKN A;  2K5V A;  4DR3 Q;  4GN3 B;  2PMZ E;  3F2D A;  1S40 A;  1N36 L;  3I4O A;  1M1K C;  4JV5 Q;  2IX0 A;  1C9O A;  1V43 A;  2MNA A;  5C4J H;  4HJ9 A;  4UP8 A;  3STB C;  3A0J A;  3UDX A;  1L0W A;  2VUM G;  1W2B A;  1VQ6 A;  2JA7 H;  2FXQ A;  4UPA A;  4KI0 A;  5C44 G;  5JEA G;  1Q82 C;  1A62 A;  3G48 A;  2UUB Q;  3A74 A;  4UY8 C;  1XPR A;  4L5R C;  3RR5 A;  2E2J H;  3TRE A;  3CPF A;  4DV7 L;  5K36 G;  3CCL A;  4B3S Q;  4A3F G;  4IOC A;  1K9M C;  4OWX B;  4LF9 Q;  1OXX K;  1D8L A;  3GO5 A;  2EXD A;  3A5Z B;  2XGT A;  2H5X A;  1VQJ A;  5IP9 H;  2EQS A;  4X64 Q;  3OYY A;  3L2P A;  4HJ5 A;  4A3I H;  3S2H H;  3A5U A;  2PQA A;  4GNX C;  5C0X I;  1YI2 A;  1TWG H;  4JI8 Q;  4BY1 H;  1SLJ A;  2V1C C;  4DR3 L;  1I6H H;  5IYD G;  3IRB A;  1CKM A;  4JV5 L;  1C0A A;  4JI7 Q;  3HOU G;  1G51 A;  3F1Z A;  1FVI A;  4PZ6 A;  2N3S A;  2ZTD A;  2ES2 A;  2JA5 H;  4BBS H;  4RMF A;  4P72 A;  4XTC S;  2KCT A;  3I2Z A;  1Q86 C;  4A93 G;  4JG2 A;  3ULJ A;  1QZH A;  4A3E G;  2NVX H;  1G29 1;  3CW2 C;  1GO3 E;  1Q8K A;  2UUB L;  3AEV A;  1AH9 A;  3UE0 A;  4GN5 A;  5IYB G;  1JT8 A;  2VZA A;  4GNX A;  4X65 Q;  4QL5 A;  3DM3 A;  3PSI A;  1YIT A;  1EFW A;  4EQ5 A;  1IBK Q;  3RZO H;  4C2M H;  2JEB I;  3ER0 A;  4B3S L;  3W1B A;  4PZ7 A;  4LF9 L;  1AE2 A;  4A76 A;  3S15 H;  3NEM A;  2GN5 A;  1QUQ B;  1E3P A;  1YZ6 A;  4R1J A;  2BH8 A;  3U4V A;  4OWW B;  4X64 L;  3RLN A;  4ME3 A;  3L0O A;  4IPH A;  3OTO Q;  3FKI G;  4JI8 L;  3CCQ A;  1VQ4 A;  1EYG A;  5M5Y H;  5LMU L;  3H3V H;  4DV4 Q;  2JA9 A;  2PI2 A;  3DLL A;  2AMC B;  4B3T Q;  4L5T A;  1P16 A;  4RG1 A;  4DAY B;  4JI7 L;  1YVC A;  2ZJQ A;  1TWA H;  3S1N H;  2AWO A;  5GAG C;  2K5H A;  1S72 A;  2Q2U A;  1WOC A;  3TRZ A;  2WAQ G;  4HIO A;  2DGY A;  4IFD G;  2ZJP A;  3U58 A;  4KHP Q;  1SE8 A;  2WAQ E;  1GM5 A;  2F4V Q;  1K73 C;  1FL0 A;  4A3L H;  4X65 L;  5GAH C;  3KJP A;  4DV6 Q;  1KL9 A;  1IBK L;  5IYC G;  4A3K H;  3ULP A;  1KXL A;  3KDF A;  4DUY Q;  2VL6 A;  3CC7 A;  1PH7 A;  4AH6 A;  4JOI C;  2UUA Q;  1JMC A;  4IFD J;  5AJ3 Q;  1EIF A;  5FLM H;  4K0K Q;  1LM0 A;  1NY4 A;  2KHI A;  4JCV E;  1PV4 A;  1MJE A;  2R7F A;  3OTO L;  1A63 A;  1Q1B A;  1MKH A;  1IYJ B;  1N8R C;  1VQO A;  3J80 c;  1OXS C;  1S3O A;  4DV4 L;  3WWV A;  3SGI A;  1VQN A;  4B3T L;  1YEZ A;  3S2D H;  2BA1 A;  3BZC A;  4LF6 Q;  1PH5 A;  1HZB A;  2Z0S A;  3GTP H;  5LMN W;  4P71 A;  3KF6 B;  2IY5 B;  4KHZ A;  3CCS A;  1ASY A;  4IPD A;  2JA8 H;  2R93 H;  1E1O A;  2UXD Q;  4HJ7 A;  4IJL A;  1VQA A;  1UE5 A;  2CFM A;  3BZK A;  3I55 A;  4JI5 Q;  4DV6 L;  1QUQ A;  2F4V L;  3CC2 A;  5IY0 A;  4A3G H;  4A3J G;  1LUZ A;  2JK8 A;  3PO3 G;  3JC6 6;  5M3F H;  4DUY L;  2VY3 A;  1PH4 A;  1X55 A;  4NXN Q;  3PO2 H;  1N34 Q;  2IHE A;  4A75 A;  2UUA L;  1TXY A;  5AJ3 L;  1UE1 A;  2A19 A;  3HFZ B;  4K0K L;  1Q12 A;  4LF4 L;  4X66 L;  3CC4 A;  1IZ6 A;  3GTK H;  2RF4 A;  4J15 A;  1R9T H;  3EIV A;  2VUM H;  2WFW A;  4DV2 Q;  2B3G A;  1SRU A;  4R4Q A;  1L2F A;  4JI2 Q;  4R4C A;  3AQQ A;  4X62 Q;  4LF6 L;  2NN6 I;  3TS2 A;  1VQM A;  3S17 H;  3I4M G;  4P74 A;  5GRO A;  3J7Z C;  2KHJ A;  1XJV A;  1PH1 A;  4DR7 Q;  5JJI A;  2UXD L;  5IP7 G;  4NXM Q;  4DR4 L;  4JI5 L;  4X6A H;  4DR2 Q;  1WYD A;  4GS3 A;  1VQP A;  3M7N A;  1QVC A;  4YCV A;  3S24 A;  5M5X H;  1KIX A;  1LTL A;  4LWC A;  4NXN L;  1EUJ A;  3CPW A;  3F2C A;  1N34 L;  3I4N G;  4DV3 Q;  2KBN A;  2DUD A;  3RN2 A;  2ID0 A;  1JJ2 A;  1U5K A;  3HOZ H;  3D31 A;  3HOU H;  4AYB G;  2Q2T A;  4BY7 G;  1TWC H;  3NBH B;  4LUZ A;  4YY3 Q;  5E7N A;  4GN4 B;  1KRT A;  2VQE L;  4UP7 A;  1OXU A;  4LUO A;  4A93 H;  1WJJ A;  2WB1 G;  4DV2 L;  2BH2 A;  3J7A 5;  1T9H A;  2RHQ B;  4JI2 L;  3U50 C;  1XNR Q;  4JI6 Q;  4P75 A;  5IYB H;  4X62 L;  1QZG A;  5C4X G;  2B63 G;  1E22 A;  5JEA J;  2I5M X;  3W5O A;  4A3M H;  4IO9 A;  1K8G A;  2ASB A;  1N33 L;  4IJH A;  3STB D;  1FJG Q;  1C7Y A;  4DR7 L;  2QEX A;  4NXM L;  4JI1 Q;  4DK6 C;  3PCO B;  3ZJY C;  1BKB A;  1GKH A;  5LMU Q;  1Y1V H;  3BJU A;  4DR2 L;  1OTC A;  5C3E G;  5C0X G;  2R7D A;  1I5F A;  3FKI H;  3I56 A;  2R7Z G;  4UP9 A;  4DV3 L;  2ATW A;  2Y0S G;  4WJ3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...