3RZDH

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rzdH00
1VCIA 1B7YB 2ZJPA 4JI3Q 3PUWA 4DK3C 2ZJQA 4IFDI 4DR6Q 1SLJA 4J15A 4B3RL 2IY5B 1YJWA 3CCSA 2NVYH 1HR0L 3H15A 4GN4B 5JJLA 4A3MH 4DKAC 3RLOA 4X65L 3BZCA 1PH5A 1VQ6A 1YVCA 1X6OA 3PUYA 1U5KA 2OCEA 1XNRL 1RL2A 2PI2E 2R93H 2E2JH 3T1YL 2I5LX 3A0JA 4EX5A 4DV1L 4DV7Q 3JC66 4LF9L 1EUJA 4A3EH 1N34Q 5GAHC 3CCEA 3GTJH 2B63G 3S1NH 2L15A 4LF8L 4UPAA 4BY1H 3JAMc 4PZ6A 4GOPB 4POFA 5J3BA 1P16A 3HOXH 3UDIA 3S1MH 4JI0L 4A3DG 3EBEA 2R6GA 4JBWA 1YEZA 3J81i 3MEFA 2Y0SG 1KHIA 2V1CC 1KQSA 2R7ZH 1JJGA 4A93H 4BBSH 1VQNA 1YHAA 1P8LA 5HY6A 2NVQH 3GTLH 1X3GA 5LMNQ 2I5MX 5IYCH 1GD7A 5C0XG 1YJNA 2UUCQ 1GKHA 1E24A 1UWVA 1WYDA 4DR4Q 3RLFA 1K83H 5FJ8G 3L2PA 2R7FA 1Q7YC 1EWIA 3S1RH 4DR3L 2UXBL 1L1OB 4JI2Q 4C3JH 2N49A 4DV3L 2JA7H 5JEAG 3CAMA 4LF7Q 3HOYH 1TWGH 2YTXA 3NENA 4DV6Q 3CP0A 2E8GA 3S2DH 1SROA 1VQ9A 4XIGS 2JA5G 3ER0A 1QZGA 4BY7H 4H02A 4X66L 2UU9Q 4A3CG 2EQSA 2NZHA 3RZOH 3B6YA 4GKJQ 1NMGA 3CCJA 2I5HA 1TWHH 4UP8A 4DNIA 4NB3A 3J81j 1IBML 1VQFA 3J80i 2K50A 2AWOA 1IBKQ 2VQFL 1VQ7A 4BA2I 4BBRG 4JI2L 3I7FA 4JI6L 4X64Q 1J6QA 2VY3A 1SFOH 1A63A 4KHPQ 2JEBI 3A74A 3PIPA 4IPGA 2BH2A 5JJKA 2B63H 1EQRA 3KDFA 1X3FA 4DK6C 3J81c 1PH7A 1KRSA 2RHSB 3K81C 1XPRA 1MKHA 2JK8A 3L0OA 1N33L 5IT9c 2WAQG 3U50C 4P75A 4JV5Q 1SRUA 3I4NG 2HQLA 3H0GH 4A3DH 4DV0Q 3M7NA 1PV4A 4A3GG 3PUZA 1Z47A 2VQEL 4RG1A 1QZHA 4APVA 1OXTA 3NBHB 3RLNA 2VNUD 2IT1A 3ZJYC 2Q2IA 4DAMA 4OO1I 1V9PA 2VS1A 4JI1Q 2A8VA 1JB7A 1E1TA 1QUQA 2RF4A 1T9HA 1VQCA 2ZTDA 3AEVA 2UXCL 1K3RA 2Y0SE 4A4IA 3HOUG 2OTJA 4Y52H 4YWLA 3J7ZC 2OQ0A 1VQLA 4KHPL 3GO5A 1XMQQ 2IX0A 5M3FH 4A3KG 5ELNA 1CKMA 3I4MG 4R4TA 3M85A 3AFPA 1PH3A 1XMOQ 1L0WA 3CD6A 2KBNA 1PYSB 1E1OA 3CF5A 1XTDA 4DUZQ 1DGSA 2JA5H 2UUAQ 3H3VH 4LWCA 1HNXQ 3KFUA 3L7ZC 1KRTA 3RNUA 1VQ8A 1CKNA 4DR1Q 2ASBA 2JA8G 4A3CH 3J80c 2KCMA 2YU9H 4R1JA 2R7DA 1J5EQ 2UUBL 1CSQA 3GTKH 3CXCA 4JI7L 3CMAA 2KENA 4NXML 1RIPA 2N78A 3I55A 1YITA 1VQMA 1HZBA 3HKSA 1G6PA 5BR8Q 1FJGL 2ID0A 2UXDQ 1I94Q 1HH2P 1A8VA 1TWCH 2PQAA 1N36Q 2E2IH 2B29A 1FL0A 2IHEA 3E9IA 5GROA 3ULJA 4X62L 5GADC 2OWOA 1XPOA 1E3PA 1HZ9A 2AHOB 1VQ5A 1M1KC 3CQZH 1N9WA 2NVXH 3ULPA 4P73A 1HNXL 4L5RC 2Q2UA 1JT8A 2EIFA 4DR5Q 1LM0A 3KJOA 1EFWA 3ICEA 2E5LQ 3I4NH 4GN3B 1TXYA 3Q8DA 2XTIA 3I56A 1VQ4A 1L1OC 4A3GH 4IOCA 2DUDA 2YTYA 3OYYA 1W2BA 4C2MH 2OQKA 4DR2Q 1VQHA 4LF5Q 2JA6G 2I0QA 1PFSA 2WAQE 4DV2L 1NTGA 3RN5A 2K5HA 3DM3A 2WB1E 3K8AA 1L2FA 1O7IA 2PNHA 1N32Q 3HKZG 3G48A 4IPHA 4NPSA 5HGQA 5M5WH 1K0RA 3HOUH 4LUOA 4A76A 4LFBL 1SN8A 3KLWA 3EN2A 4OXPA 1IBLQ 4A3KH 3G4SA 1HR0W 1PYBA 2NN6I 1EIFA 2VZAA 4KLKA 4GLVB 3UE1A 5LMUQ 4DUYQ 4AQYL 2ZJRA 4A3IG 3OTOQ 3CPWA 4GKKQ 1NE3A 1HZCA 2AMCB 4JI3L 2E5LL 4DR6L 3S24A 2KHIA 2IHFA 4R4OA 4HJ5A 1HNZQ 4DR2L 4AH6A 1IYJB 2CQOA 2E2HH 3ULLA 2MFIA 1S40A 3BZKA 3I4OA 3KOJA 1K9MC 3A5UA 1I50H 3G6EA 3VDYA 2OTLA 4IPCA 1QUQB 3PO2G 2ZM6Q 1VQKA 5FLXc 4LW1A 4YHHQ 4YWMA 3KYHC 4DV7L 1V1QA 1N34L 1SMXA 3PUXA 1PH1A 4QQBX 3GD7A 4MTNA 5IWAQ 4IOAA 4DAYB 1EYGA 2Z6KA 1AE3A 3T1HL 3PIOA 3F1ZA 4IJHA 5IYDG 3TQYA 2H5XA 2F4VQ 3F2CA 1CKOA 2BA1A 3F2BA 4NXNQ 2K52A 2Q2HA 3F8TA 1UEBA 1QVGA 4HJ8A 4GNXC 1CKNB 1Y1VG 3G71A 1EOVA 5IP9G 1VQJA 2A19A 1PHJA 4TQUS 1JJCB 3TREA 2Q2TA 2JEAI 4JOIC 2Z6KC 5LMNL 2JA6H 5JJIA 1YNXA 1B8AA 2RHQB 4IPDA 4MZ9A 4GLXA 2UUCL 3A5ZB 1OXSC 1HJPA 3NELA 3TS2A 4DR4L 2JJQA 2R92G 3CCMA 4JC0A 2ALYB 2PQAB 3S17H 2K5NA 4AYBG 1Y1WG 5GAEC 4X6AH 2F52A 4LF7L 1X65A 4DV6L 3DLLA 2QA4A 2F4VL 3CCQA 4A3IH 2VW9A 5IE8A 2JQOA 2A1AA 3HKZE 5AJ3Q 2GVBA 4LUZA 3UE0A 2WP8J 2UU9L 1PA6A 2HHHQ 3J7A5 4HJ7A 3CCLA 5M5YH 2C35B 1YHQA 3ERSX 5C4JH 1VQEA 4GKJL 1BBWA 3GTPH 2QGQA 3PCOB 1YJ9A 4A3BG 1XPUA 4DV4Q 1WCMG 3D31A 1UE1A 1IBKL 4FDBA 4B3SQ 4JI5Q 2D0OA 3PV0A 1VQBA 4LF6Q 1SE8A 4IFDJ 4B3TQ 4JI8Q 4K0KQ 5FJ8H 4X64L 4C3IH 3W1GA 4JCVE 4L5QA 5C3EG 3AYHB 1YIJA 2EXDA 1EQQA 3U4VA 3PUVA 1R9TH 4DR7Q 4JV5L 5IYDH 4P74A 4BXXG 1NY4A 4A3LG 2HHHL 1TWAH 3BJUA 4OWTB 4DV0L 1M90C 3S16H 1I6HH 1I3QH 4JI4Q 1Y1VH 3S1QH 3FP9A 3GTOH 4BA1I 5E7NA 1KXLA 5IP7G 4PZ7A 5IP9H 3PF5A 1Q8KA 1HNWQ 1VQGA 4JI1L 4B3SL 4GOPC 3K7AH 1Q81C 2IX1A 3PGZA 4OO1G 2K4KA 4GS3A 4MNOA 4YCVA 1D8LA 3LGJA 4JYAQ 3PO3G 1L1OA 4DPGA 2R92H 1IZ6A 3CCRA 4BBRH 1Q86C 5DLQE 1XMQL 3OW2A 1D7QA 4QJFA 1KL9A 2WFWA 4TVAB 4B3MQ 1XMOL 4DR7L 4YY3Q 2D62A 4IO9A 4DUZL 1EIYB 2F3IA 3MXNB 2UUAL 1LTLA 1QVCA 3PSIA 4AYBE 4DR1L 2CFMA 3K0XA 3M4OH 3CC2A 4L5SA 1OXVA 1J5EL 1LYLA 3FKIG 1HR0Q 1V43A 2LXKA 1YI2A 1WJJA 3WWVA 3S2HH 4A3BH 1UE6A 4X65Q 4A75A 4QIWE 3NEMA 2N3SA 1WCMH 1BBUA 2CCZA 5BR8L 2UXDL 1XJVA 1GO3E 2KHJA 2JE6I 1I94L 4HIMA 1CSPA 4DV5Q 1N36L 1MJCA 1B70B 4HJAA 3S14H 4WJ4A 4P72A 2BA0A 4R4IA 5C3EH 4LF8Q 1PVOA 3KDFB 3I4MH 1PH6A 1PH9A 1Q1EA 2KCTA 1GM5A 4BY7G 3PF4A 1GVPA 2XGTA 1BVSA 2QEXA 4JI0Q 2R7ZG 4DR5L 1AH9A 4BXXH 4A3LH 4QL5A 2MQHA 2K75A 4UP7A 2ZTEA 2JA8H 3CCVA 4IFDG 3D0FA 3TEHB 4LF5L 5IP7H 3E0EA 3E9HA 3STBD 5C0XI 1K8GA 2BH8A 5ELOA 5M3MG 4PZ8A 1WOCA 5C44G 3TS0A 1N32L 4GNXA 4DV5L 1MIUA 3T1HQ 3M4PA 3KF8B 1YBYA 3PO3H 4DR3Q 2UXBQ 1KC8C 3UDXA 1N8RC 4DV3Q 2VUMG 4JOIA 1IBLL 2K14A 4LF4Q 4DUYL 5LMUL 3H3VI 1HZAA 5IYBG 1X3EA 1VS0A 3RR5A 2NN6G 1K73C 2ES2A 4LNQA 1VQIA 3H0GG 3OTOL 3CC4A 3M3YH 4GKKL 2JA9A 1VQAA 1E22A 4X66Q 1ASYA 1VQDA 3UDGA 2NZOA 2D0PA 1G291 2Z0SA 1HNZL 3HOWG 3KF6A 1A0IA 4OWXB 4HIKA 3FKIH 5FLMG 1IBMQ 3M4QA 4L5TA 3AFQA 3RN2A 1MJEA 3HOZG 4R4QA 3AQQA 1S72A 2ZM6L 2VQFQ 4O2DA 1WFQA 4YHHL 4HIOA 4JBKA 4KHZA 4JI6Q 1AE2A 5M3FG 4LFCQ 4QGUA 2N8NA 5IWAL 4A3JG 4LF4L 2ZTCA 3CW2C 4LUVA 1X9NA 3GDEA 4ALPA 4AIMA 1N33Q 4POGA 3K7UC 4PMWA 5LMNW 1VQPA 1IXRA 1JJ2A 1JE5A 4A3FG 4NXNL 5H1SE 5EAYA 4Y7NH 5C4XG 4YWKA 2GVAA 3UDFA 5GAGC 2VQEQ 4OX9Q 4QY7A 5K36G 4IJLA 4P71A 3S15H 4HJ9A 3IRBA 3GTMH 4JBJA 5M3MH 2YYZA 4YCUA 4LFAQ 5C44H 2UXCQ 4KI0A 4LFCL 3KJPA 1SR3A 3PO2H 2CKZB 1WI5A 1NJIC 1JMCA 2CWAA 1KD1C 2VUMH 2AKWB 1Z9FA 3HOVG 2YV5A 4GOPA 4UY8C 5IYBH 1K8AC 5AJ3L 2WB1G 1XNQQ 2LXJA 1PH8A 3RZDH 5GQOA 2DGYA 3K80C 1VQOA 4OX9L 1UE5A 1FVIA 1C7YA 3HOWH 1YHBA 1S3OA 1X55A 2UUBQ 1Q46A 3TRZA 3M9BA 4XTCS 4EQ5A 4A3MG 4GN5A 4JI7Q 5FLMH 4NXMQ 5M5XH 4DV4L 1H95A 1KIXA 1UE7A 5IY0A 3CC7A 2R93G 4LFAL 2B3GA 4JI5L 3GTQH 3BU2A 1FJGQ 1X54A 3HOZH 4GNXB 4LF6L 4B3TL 4A3EG 4JI8L 4K0KL 3U58A 3W1BA 2GN5A 1PH2A 1KAWA 4X62Q 2NVTH 5C0XJ 1NBWA 4A3JH 4JBMA 1LUZA 4BY1G 1C0AA 2HIXA 2K5VA 1Y1WH 4C3HH 3HOXG 4HIDA 1C9OA 1OXXK 1X56A 3EIVA 3STBC 3CCUA 1XNQL 2HT1A 1A62A 1NMFA 1W3SA 2FXQA 2PMZE 2MNAA 4UP9A 4A3FH 5JEAJ 1Q82C 2VL6A 4GLAC 4OWWB 2PI2A 3JAMi 1FGUA 1YZ6A 2MO0A 5C4XH 3FHWA 4JI4L 4A93G 3KF6B 4BBSG 4WJ3M 3GTGH 3I2ZA 4B3RQ 1OTCA 3F2DA 2AWNA 2LSSA 1PH4A 1I5FA 2CWPA 4YCWA 5IYCG 4DV2Q 3SGIA 1BKBA 3W5OA 1Q12A 1IL2A 2YTVA 1HNWL 3CPFA 1OXUA 4RMFA 1E7ZA 1Y14B 1XNRQ 4JYAL 3HFZB 1Q1BA 3T1YQ 4PG3A 2MO1A 4DV1Q 1TWFH 1CUKA 1ASZA 2RCNA 3CMEA 4AQYQ 3U4ZA 4LF9Q 2JA7G 4OONA 3HOYG 1QVFA 4LFBQ 4O0AA 1U0LA 4B3ML 2ATWA 4ME3A 1G51A 3HOVH 4YY3L 4JG2A 4R4CA 2HIVA
chains in the Genus database with same CATH superfamily
1DOLA 2G9HD 5I9PA 4MIUA 4IFDI 3NE5B 3T13A 1JOQA 4J15A 1I3QB 1HR0L 4RHRA 2F0IA 1VQ6A 1FNVA 3BZCA 1BOSA 1EZ8A 5CYUA 3HRZC 2OCEA 1XNRL 1TY2A 3VR2A 2L0CA 3GTQB 1B9MA 1RTOA 3JC66 1N34Q 3K5OA 5A35A 2R92B 1B9NA 3S1NH 2K01A 2L15A 1Y1WB 1FNWA 4BY1H 4C3HB 1QCBD 5J3BA 2EYLA 3UDIA 4A3DG 3J81i 1KHIA 3GTGB 3DM1A 3GTLH 1QNKA 5LMNQ 3S2HB 5FO8B 1E24A 1WYDA 4DR4Q 2R7FA 1Q7YC 3X3NA 2N49A 4DV3L 2D9UA 4LF7Q 4DV6Q 3S14B 3CP0A 2WIIB 2E8GA 3S2DH 1SEBD 1SNMA 1SROA 3IL8A 1XWEA 1QZGA 4H02A 2M2LA 1H9MA 1MHWC 3MC0B 3P1HA 1BQQT 5ISRA 1TWHH 1IHZA 4NB3A 3J81j 2EE1A 1IKMA 2K50A 2AWOA 3DEPA 1VQ7A 1JR0D 1PYWD 4JI2L 4IURA 1A63A 4KHPQ 1AZQA 2B63H 3KDFA 1X3FA 1UUPA 1TS5A 1PH7A 2RHSB 1XPRA 1MKHA 3L0OA 3NTIA 4KN4C 3HOXB 5KYLA 1BUVT 4DV0Q 5T1GA 1LTAD 2VQEL 2HDMA 2VNUD 3ZJYC 4DAMA 5LL6X 3FKIB 1KLGD 3VA5A 1JB7A 1Z6HA 1U9RA 2UXCL 1K3RA 2FMCA 2Y0SE 4A4IA 4DNRB 4Y52H 3W2DA 3GO5A 1XMQQ 4C3JB 2IX0A 4K2LA 1TWGB 3M85A 1XMOQ 1L0WA 3CD6A 2KBNA 1E1OA 1CQFA 1XTDA 3DEOA 2UUAQ 4BY7B 4QB4A 3KFUA 1VQ8A 4DR1Q 2JA8G 2ASBA 4A3CH 2YU9H 4R1JA 1QE6A 3MA2B 1EU3A 3L3OC 5BR8Q 4ULLA 4O1NA 3V05A 3D4RA 1ZYRD 1FL0A 3E9IA 4IUVA 1E3PA 2AHOB 2V4DA 5EQ0A 1SNCA 4P73A 5LHY1 3I4NH 1DXMA 4GN3B 1TXYA 3Q8DA 4OGQC 2F0QA 2XTIA 5K5PA 1W2BA 4C2MH 5KGUA 1L0YB 1JE4A 1NUCA 1S4ZA 3RN5A 1D1IA 2K5HA 4FXDA 3HKZG 3HOUH 3LNNA 4LMQD 1A15A 1TT2A 5M3FB 3TP5A 1IBLQ 2NVTB 3T16A 4A3JB 4DUYQ 3T1HQ 4A3IG 2EZVA 4GLVB 3Q0AA 4S3SA 3CPWA 2VB3X 2JA5B 4JI3L 3D6CA 5L37A 4HCEA 2KHIA 4NW2A 4R4OA 4HJ5A 3HP3A 5C4XB 1VMPA 2CQOA 3BZKA 3A5UA 5D65A 4HAEA 5C4ZA 4XXEA 3G6EA 1QUQB 4V0BA 1QILA 4LW1A 4XQJA 4DV7L 5D14A 1VF7A 4QQBX 3FMCA 2F0MA 1ESFA 3PIOA 1TU2B 3I70A 1ENAA 2NTTA 4HCSA 1CKOA 2Q2HA 3F8TA 1UEBA 1TKWB 1QVGA 3AU7A 4XQNA 2WB1B 4F87A 4C1NI 3GQBA 1VQJA 2NZ1D 4TQUS 4KN7C 3TREA 2JEAI 2Z6KC 1YNXA 2UUCL 3E5SA 5JVH3 2NWGA 3A5ZB 3NELA 2JJQA 2K03A 2QF7A 2B39A 2R92G 2A6ED 1JWSD 2IW3A 1Y1WG 5IGDA 1WD0A 1SJED 5TSSA 2VW9A 2JQOA 5D3DA 2FJ2A 5KNBA 3J7A5 2EJFC 5M5YH 2C35B 1WTQA 1TS2A 4ID6A 1YHQA 3ERSX 1HCZA 2KUMA 3TDQA 4DV4Q 3GTLB 4GZYC 1UE1A 4PNYA 1IBKL 3OWEB 1QG7A 4JI5Q 2D0OA 1FR3A 1VQBA 2OF1A 3GV3A 1SE8A 4CJ2C 1HQMC 4H7BA 2QDLA 1HHVA 4RKBA 3NWTA 3AYHB 2XN9C 3BYYB 3EJIA 4HSPA 3U4VA 4DR7Q 1CQVA 4HN7A 3S2DB 1A6XA 1XX8A 1TWAH 3S16H 1I6HH 3D3RA 3FP9A 1C48A 3GTOH 1Q8KA 1VQGA 4JI1L 4GOPC 4OO1G 3WOEA 4YCVA 3MFYA 4JYAQ 1B2TA 1L0XB 2O2LD 1L1OA 3CCRA 5EKIA 4DUZL 3MXNB 4WRDA 1LTLA 4HMIA 1MSHA 4EGVA 5EKKA 1Y69U 1OXVA 2XVSA 2Y0SB 3FKIG 1O7LA 1SE2A 2DNCA 2LXKA 1MGSA 1WJJA 2MPMA 5IIFA 2N3SA 1WCMH 5I2YA 2KHJA 1I94L 5JAVA 4DV5Q 4C3JG 4J6HA 4C3IB 1QWYA 1AW7A 3FPPA 5C3EH 2H4OA 2K05A 2NTSA 3KDFB 4BY7G 2BE5D 1WTRA 2MQHA 4DNTB 1AFPA 4K6DA 3S1QB 1BR9A 2ZTEA 2JA8H 3JAME 3EQLC 2YU9B 1W6JA 5IP7H 1HFGA 3E0EA 1HUMA 5C0XI 5BN3A 5ELOA 1K8OA 1M4VA 4DR3Q 1S5CD 1KC8C 5FOBB 3UDXA 4AYBB 1GUWA 2RA4A 3R2IA 4LF4Q 5IYBG 1GUNA 4RGMA 3RR5A 2ES2A 2B2TC 2JA9A 4R9WA 4ILWA 3I4NB 2D0PA 1G291 3KF6A 1PLFA 1Q90A 1SE4A 3AFQA 3RN2A 2PYKA 2XNAC 4R4QA 3AQQA 1EYAA 1S72A 2ZM6L 4O2DA 4L6TB 4M1UB 4KHZA 4LFCQ 5M3FG 5IWAL 4A3JG 3HOUB 2EYPA 2ZTCA 3CW2C 1F9QA 2CH4W 3K0YA 1IXRA 2WV6D 4NXNL 1PTOH 3I90A 4Y7NH 5C4XG 4YWKA 3UDFA 2PW7A 1S5FD 2KJXA 5IGGA 3Q24A 5BN5A 4P71A 1VDZA 1ZYRC 4IUUA 1DOKA 1ENFA 2CVRA 4JBJA 3KLSA 1ZEQX 2Q8IB 2O4XA 1HA6A 1M8AA 1NJIC 1V1PB 2HUGA 2JP1A 2DN8A 4DK0A 2AKWB 4X3SA 1AN8A 4EQNA 4B9WA 4UY8C 3IFDA 3M3YB 2WB1G 3SK4A 1K0SA 4OX9L 4H0LC 1UE5A 3HGBA 2IJ0A 4MTKA 1C7YA 3HOWH 1S3OA 1S5DD 1X55A 2UUBQ 1Q46A 3TRZA 4JI7Q 2E74C 5FLMH 1G2SA 1SYFA 3GTQH 1FJGQ 1GHKA 4GNXB 1PZKD 4B3TL 1KNEA 4K0KL 5HURA 3U58A 3W1BA 3P7JA 5C0XJ 1NBWA 3CHBD 1C0AA 1LUZA 4BY1G 1Y1WH 1BF4A 4C3HH 2QCPX 4TRDA 3EIVA 1XNQL 3BVMA 2PMZE 3NK9A 2FXQA 2F0WA 2HD3A 1SNOA 5JEAJ 2A68D 4GLAC 3QR8A 4JK1C 1G8ZD 5M5YB 3GTGH 2Z4IA 4U673 1OTCA 2Q8RE 5K36H 3F2DA 1I5FA 1KLUD 4F88A 4DV2Q 1SNDA 1IL2A 3CPFA 1OXUA 4RMFA 1E7ZA 1Y14B 5IGBA 1RHPA 2LKVA 5KYIA 1CUKA 2RCNA 4LF9Q 3U4ZA 4DF7A 3N6RA 4OONA 4XYOA 2L55A 3VYTA 1QVFA 4LFBQ 5EPLA 3C46A 4ME3A 2BOSA 4R4CA 4XT3B 4DXFA 4DK3C 5CV4A 2EYHA 4DN4M 1TWAB 5FO7B 4DR6Q 2IY5B 1I6HB 1YJWA 2NVYH 2A6EC 4ZK9B 1IW7D 3LWUA 3T4AC 2JYOA 4A3MH 5M5XB 1YVCA 3PUYA 1U4MA 1RL2A 3HOZB 3T1YL 3SXHA 3BYTB 4OO1H 1PFNA 5GAHC 1ONLA 2R61A 3GTJH 2B63G 1KDBA 1WTOA 4LF8L 4UPAA 5G3LF 1B4OA 3HOXH 1P16A 4X3TA 3S1MH 2R6GA 2Y0SG 3J7YW 1JJGA 2XSCA 3OOCA 2B2WC 2Z1CA 1CHQD 1YHAA 5HY6A 1Y8PB 2NVQH 3NTHA 3E3XA 2PPBC 2L4NA 4IUPA 1GKHA 1WCMB 5FJ8G 3DXJC 1EWIA 4C3IG 3TP8A 5ELDA 1L1OB 2SEBD 3MTSA 2XWJB 4C3JH 4FF2A 1UAPA 1TWGH 2YTXA 4PMBA 3IAYA 1BXTA 5C3EB 1VQ9A 2FMMA 4FXKC 4FP5D 4RCNA 4BY7H 4HMJA 2F0JA 4A3CG 5DNFA 2KHSA 3SK8A 2TMPA 2G9DA 1NMGA 2B8FA 3CCJA 2AQ2B 1VQFA 2KVMA 2VQFL 4KKTA 1IKLA 1LLRD 2F0OA 3I7FA 4A3EB 1J6QA 5CMDA 3A74A 1AP0A 4Z9CB 5JJKA 4DK6C 3J81c 1KRSA 3K81C 1N33L 5IT9c 1SRUA 1EY9A 3I4NG 2HQLA 4LK1C 4OHJA 4RGOS 2SOBA 3M7NA 2R7ZB 4APVA 1OXTA 3NBHB 2IT1A 2VS1A 1QUQA 5C0XH 1PRTD 1T9HA 2ZTDA 4RHSA 3HOUG 4YWLA 2BE5C 3J7ZC 4KHPL 1JORA 5M3FH 5ELNA 1CKMA 5JEAH 3AFPA 2HIVA 5E4WC 4C56C 4QUCA 3ONAB 2JA5H 1DGSA 3MVVA 5T1IA 1PTOB 4Y7NB 3FPUB 2C9OA 1J5EQ 1LTBD 2L1BA 4ABNA 3H94A 4NXML 2N78A 1YITA 1IL8A 3MFGA 3KUPA 3HKSA 1G6PA 2UXDQ 1EY4A 1G6ZA 2B29A 5GADC 1HQRD 4X62L 1STHA 3CQZH 5CV7A 5CV6A 3ULPA 4L5RC 4K5VA 2Q2UA 1JT8A 3KJOA 1EFWA 3H0GB 2E5LQ 1VQ4A 4A3GH 2DUDA 2YTYA 3HOWB 5I4DA 5AFWA 5JJZA 4LF5Q 1PFSA 2WAQE 3OIQA 2K5WA 3DM3A 2WB1E 1PXUA 3K8AA 1O7IA 1N32Q 2ZXOA 3G48A 1AZPA 5HGQA 1K0RA 3P75A 1B1ZA 4A76A 2PMZB 4N9TA 3KLWA 4HR7B 4A3KH 1HR0W 1EY7A 2NN6I 1EIFA 3RMHA 2QEJC 4OIJA 3OTOQ 1NE3A 3K5LA 3MEHA 4HTHA 1CTMA 3S24A 1HNZQ 2IHFA 1LTSD 1IYJB 3GTKB 3KOJA 4CJ1B 2KQ3A 1SXTA 4IUTA 3VDYA 2KOLA 4DU9A 1VQKA 5FLXc 4YHHQ 3KYHC 1SMXA 4HEDA 2F0PA 4CDEC 4H44C 1EYGA 1CT1D 2Z6KA 3T1HL 1FNUA 3F1ZA 2F0TA 4F7XA 3C3LA 3MXNA 4HJ8A 5ELFA 2NBFA 4ZYSA 2F0KA 1GXDC 3F2UA 4K6LA 1JCKB 1KDCA 2NVYB 3NHHA 4JW0A 2Q2TA 1WTWA 4RKLA 2JA6H 4A3MB 5JJIA 2RHQB 1OXSC 3D6WA 2PQAB 3S17H 4RGTA 2KCCA 1TY0A 2B2YC 1LABA 2A68C 3GTJB 3NPPA 2VXWA 2QA4A 4L63B 3NP8A 1HUNA 5AJ3Q 1STNA 3S1MB 2WP8J 1JQYD 2UU9L 4UDUC 3CCLA 3NWSA 4GKJL 1VQEA 1LACA 2QGQA 3PCOB 1XPUA 2NVQB 1WCMG 4CDDC 5C5LA 1BCPB 4IFDJ 3VYUA 1I4PA 2XIWA 5FJ8H 4X64L 2PZWA 4C3IH 4L5QA 5C3EG 5DM63 4ZUIA 1DONA 2Q8TA 1QJOA 2EXDA 3BVGA 1EQQA 3PUVA 4JV5L 5IYDH 3I4LA 1IW7C 3Q6SA 1NY4A 3BJUA 2F0GA 1WTHA 1JC7A 3S1QH 2F3WA 4BA1I 1UNSA 3D8GA 5IP7G 3K58A 3OSOA 2QKIC 5IP9H 4FF3A 1H9SA 3W3AA 1SE3A 2EY1A 3K7AH 3PGZA 1TS3A 4GS3A 3LGJA 1D5ZC 4DPGA 1Q86C 1D7QA 1QNUA 4Q5VA 2BCOA 1KL9A 3O13A 3TSSA 4K2KA 1F2LA 2SNSA 4DR7L 2F3IA 2EY6A 1JOOA 3PSIA 1ILPA 1ET6A 4AYBE 2PNRC 3TMEA 2CFMA 3M4OH 4L5SA 5C4JB 5KNCA 1HR0Q 3GTPB 1V43A 3MHBA 1UEAB 5F2DA 4A75A 3J7AF 1BBUA 3VA7A 2CCZA 1GO3E 2JE6I 1F2ZA 1N36L 4HJAA 3RD4A 1V1PA 1U4LA 1HPCA 1HA5A 5IGCA 1LT5D 1EYCA 1PH9A 2X6GA 1GVPA 1BVSA 2QEXA 2RSOA 4DR5L 2B2VA 1Y8NB 1RF2D 1PZJD 2K75A 3P20A 4X3UA 4FYDA 3A55A 2OT2A 1RTNA 3KK7A 2B2TA 1K8GA 2BH8A 3UI2A 5EGTA 3CRKC 2WKCA 5C3XA 3TBIB 4GNXA 4DV5L 1TIID 3KF8B 3PO3H 4LAAA 4BBRB 2ENBA 3BZDB 5C4HA 4DV3Q 2F4IA 4JOIA 3ITPA 5LMUL 1JICA 1QB5D 5FLXE 3H3VI 4NKLA 1X3EA 1K73C 3CQZB 3NXWA 1VQIA 3H0GG 3M3YH 4GKKL 1ASYA 1E22A 2WAQB 4QIWB 3E6ZX 5HGTA 3UDGA 4PQXA 1PRTC 3HOWG 4BS9A 1Z7TA 1A0IA 4A3GB 5FLMG 4L5TA 4A3BB 4TKOB 2EJMA 4LF4L 4LUVA 1TS4A 1X32A 4KD3A 4CJ0B 4C3HG 4A3KB 2J4XA 4PMWA 1VQPA 1KNAA 3NBIA 5H1SE 2RDFA 5CR3A 3LX0A 5GAGC 5ELBA 2VQEQ 5K36G 4IJLA 4OEMB 1O80A 4IFDH 4HJ9A 1EYDA 5E1FA 2C5CA 2Z8LA 4LFAQ 2UXCQ 4LFCL 5NUCA 4TSSA 1WI5A 3OW7A 1C4QA 3K6OA 1KD1C 2VUMH 1F9SA 1SJHD 1K8AC 1FGBD 2NN6H 1PH8A 2DGYA 3TN2A 1VQOA 1RJTA 4FO2A 2F03A 3M9BA 4XTCS 4F8MA 4A3MG 2L9HA 1RDPD 2EDGA 5M5XH 1E2VA 3BDCA 1UE7A 4KD4A 5IY0A 3CC7A 2JA6B 2B3GA 3HOZH 5FLXL 4LF6L 1PTOF 4JI8L 3FVQA 4K5WA 3S17B 4KKUA 1LO5D 2K5VA 4EQOA 3HOXG 4HIDA 3DWPA 3STBC 1OXXK 1X56A 1A62A 1B44D 4OWWB 4UP9A 4XT1B 3JAMi 4JI4L 2HDLA 4WJ3M 1KAAA 3I2ZA 4B3RQ 2LSSA 4KY7A 1NSNS 3S15B 4YCWA 3W5OA 1HNWL 1F2MA 1Q1BA 3PO2B 4DV1Q 1ASZA 1ENCA 1LT4D 3CMEA 1SNQA 4CGYB 3FDTA 4B3ML 1U0LA 4YY3L 1NCVA 1EZ6A 1M1KC 3QB3A 4K8JA 2ZJPA 4JI3Q 3A8KE 1V8QA 3PUWA 1KABA 2LY7A 1SLJA 4IALA 3NBHA 1DD2A 4C1NK 3H15A 5JJLA 1X3QA 4DKAC 4M8AA 3RLOA 4X65L 1PH5A 1X6OA 2E2JH 3K7AB 2K1BA 4DV7Q 4LF9L 4A3EH 1T5EA 3CCEA 4FF1A 5FKAC 5J1ZA 4FNFA 3H6MA 2VB2X 4PZ6A 4GOPB 4POFA 4JI0L 4FVMA 4IUQA 4JBWA 1YEZA 2EXZA 3MEFA 2R7ZH 1GUGA 2V1CC 1EEID 3OMGA 3M4OB 5IOCA 1VQNA 4RGNA 5COYA 1EIHA 3V96A 5EJWA 5IYCH 4UAIA 1H9SB 4XYQA 5C0XG 2UUCQ 3RLFA 1Y8OB 3L2PA 1WTVA 2EYMA 3S1RH 2UXBL 2KEEA 3GV6A 4WORA 2JA7H 5JEAG 3CAMA 3HOYH 2EY5A 3AMUA 2F0HA 3IFTA 2JA5G 2RQXA 1DJRD 4X66L 1NNXA 2EQSA 2B2UA 2NZHA 1H9KA 3B6YA 1SSOA 1STAA 4DNIA 4UP8A 1IBML 3NQTA 3J80i 3DUZA 1IBKQ 1EY0A 1S5BD 4DFAA 3K57A 4BBRG 4PMCA 3QIAA 2DY7A 1JB3A 4JI6L 1SFOH 1HTLD 3Q22A 2EYJA 3PO3B 3PIPA 4IPGA 2BH2A 2WINB 1B53A 1ML0D 3VR5A 1SAPA 3NUCA 2WAQG 1BCPF 4P75A 5CBAE 1G2TA 3H0GH 1O78A 4A3GG 3PUZA 1QZHA 4RG1A 4PV1C 4BBSB 3MAQA 3KBGA 5J39A 1BCPD 4JI1Q 1E1TA 2MJ8A 2RF4A 1VQCA 3AEVA 2OTJA 1VQLA 2A69D 1KTKA 1AEXA 4A3KG 1EY8A 4R4TA 4P2CB 3DWAA 4QCLA 4DUZQ 3CF5A 3H3VH 2K33A 4LWCA 1HNXQ 1KRTA 1B3QA 3RZOB 2KCMA 2R7DA 2F0FA 1CSQA 3GTKH 2Z6BA 3CMAA 2KENA 3I55A 1HZBA 3CU7A 3K5NA 2ID0A 4FXGC 1I94Q 1HH2P 2PQAA 1XYIA 5GROA 2IHEA 3ULJA 2OWOA 2K5DA 3BVZA 1YNJD 3I72A 1VQ5A 3BG3A 3D4WA 2VUMB 1N9WA 3TZDA 4DAPA 3PIP3 2EIFA 1LM0A 3ICEA 4HSVA 4OIKA 5IODA 3MXPA 1L1OC 4IOCA 1CM9A 2OQKA 4DR2Q 4KV6A 2JA6G 2Z4HA 2I0QA 1GUSA 3IKJA 3S9WA 2F0UA 1BBXC 3EROA 2N88A 4RWSC 4IPHA 4LUOA 5C3WA 1J8IA 2F1MA 2AUKA 5EKLA 3EN2A 1YNND 4OXPA 2CHBD 3G4SA 1VF5C 3UE1A 4AQYL 5CBEE 1HZCA 2E5LL 4DA2A 2GA4B 1PMRA 3MZ5A 1T5XD 3VYSA 2KEDA 4AH6A 3L9AX 5G3LD 3ULLA 1E2WA 4EVOA 4IPCA 3PO2G 2ZM6Q 4ZKCB 1N34L 3PUXA 1PH1A 2E2IB 1GHJA 5IWAQ 4IOAA 4DAYB 4N8FA 5FK9C 4MHEA 5IYDG 3TQYA 4KTAA 2F4VQ 2NVXB 1CZWA 3F2BA 4NXNQ 3V2TA 1CKNB 2BDOA 3G71A 5IP9G 2A19A 1PHJA 3E0JA 1JJCB 3BS1A 5LMNL 2CW0D 1QOHA 1S5ED 3OWFA 4IPDA 4MZ9A 3R8BA 4DR4L 2JXMB 5ELCA 3QOJA 3CCMA 2PQEA 2ALYB 2M00A 4G4KA 4JC0A 2E2JB 4AYBG 2DJFC 1IYUA 4ZQ3A 5GAEC 4X6AH 4LF7L 1MD2D 1X65A 2I07B 4DV6L 5IGFA 3DLLA 4IZ8A 2M9VA 1CA6A 5IE8A 2GVBA 3UE0A 1PA6A 2HHHQ 3OHXC 4G7HC 5C4JH 2IL8A 3GTPH 1YJ9A 3D31A 1I4QA 4FDBA 4B3SQ 3PV0A 1Q3LA 3KF8A 4B3TQ 1MSGA 3R93A 4K0KQ 4CDFC 4WJWA 4CKEA 4DGZA 3S1RB 4JCVE 3NTKA 2JA7B 2EVBA 1EY6A 5KIXA 3HOYB 2EJGC 4N8X1 1R9TH 4P74A 2L12A 1U4RA 4OWTB 4YIJA 4DV0L 1Y1VH 1VMCA 3PMFA 1KXLA 1A3VA 3TP6A 1SYEA 2WACA 5EBDA 3K5MA 1Q81C 2IX1A 4MNOA 1D8LA 3PO3G 1HTPA 2QW7A 1IZ6A 2J7ZA 1DYQA 4CDCC 4BBRH 1XMQL 3OW2A 1SFOB 4QJFA 2WFWA 2RDHA 5I9OA 1XMOL 3I73A 2D62A 2XWBB 1EIYB 2UUAL 4DR1L 1A3TA 4LJZC 2LFNA 3CC2A 1X3PA 1LT6D 2N55A 1F9RA 1YI2A 4A3BH 1UE6A 4BWGB 4QIWE 3NEMA 3SEBA 5BR8L 2MUYA 3A7AB 1CSPA 4HIMA 2NUCA 3DHQA 3H91A 5D3IB 1XXGA 2BA0A 4NDXA 2KECA 4LF8Q 4MN3A 1PVOA 1PH6A 1GM5A 2KCTA 1PFMA 2XGTA 1AH9A 1D2BA 2K6AA 4BXXH 4A3LH 4QL5A 4UP7A 2F0EA 2K04A 4KMUC 2O5IC 3CCVA 4IFDG 3D0FA 3TEHB 3Q23A 3E9HA 3STBD 4PZ8A 1WOCA 5I6WA 4L8JA 1MIUA 3M4PA 2PZTA 4KJNA 3WOFA 1N8RC 2VUMG 2JSOA 4CKCA 1IBLL 2K14A 1R4PB 4DUYL 2KCNA 2BDNA 1VS0A 2MGSA 2NN6G 4E6IA 4LNQA 3CC4A 3J7AV 3CRLC 1BCPC 1VQAA 2FFKB 3A54A 2Z0SA 1GOZA 2DNEA 4OWXB 4HIKA 4DAVA 2A69C 3HOZG 2VQFQ 1WFQA 4HIOA 4FF4A 3PQIA 4QGUA 2N8NA 5EPJA 2G5DA 5IGEA 1X9NA 1N33Q 3I4MB 3K7UC 4QF4A 2K5QA 2HCCA 1JJ2A 1OO9B 5EAYA 5E4XA 2GVAA 1D5MC 3J81E 3T51B 5IT9E 3QOLA 3S15H 5J22A 3KLRA 1Q8IA 3IRBA 3GTMH 5M3MH 1YNJC 2PW5A 2YYZA 4ODGA 5C44H 2I46A 5JVG3 3PO2H 4DXGA 2CKZB 3MXGA 3VR3A 4DK1A 4CBVA 3G7LA 2CWAA 1CI3M 4H13C 3C2PA 4O42A 4GOPA 1HRJA 2LXJA 5GQOA 2F3VA 5I2XA 1RCVD 2F0NA 4K8IA 1YHBA 1CA5A 3N52A 2AUJD 1LTGD 4GN5A 5CORA 4NXMQ 5JPNC 4DV4L 1LV9A 1YNNC 4LFAL 4JI5L 3A8JE 3BU2A 1X54A 2SNMA 4OL7A 4A3EG 2GN5A 1LTRD 4X62Q 2CQAA 2HIXA 3SE0A 5DEHA 1WTPA 3CCUA 1NMFA 4IUNA 2IX3A 2MNAA 3VYRA 4A3FH 2R7ZG 2PI2A 2MO0A 1YZ6A 4KKSA 4CHTB 3LWEA 5C5MA 3QJYA 2AWNA 2CWPA 1WVLA 5IYCG 2L11A 3SGIA 2YTVA 2P5ZX 3ZYYX 1XNRQ 4JYAL 3HFZB 2A73B 4PG3A 5KNDA 2MO1A 1TWFH 2E75C 3VR4A 4AQYQ 2JA7G 4ZAIA 3HOYG 4O0AA 1EFID 3TP7A 3J81L 1G51A 3HOVH 5IT9L 1VCIA 1B7YB 1R9TB 2CW0C 1NR4A 2ICEC 4XQQA 3RZDB 2ZJQA 1SMYC 4K14A 1EWCA 1DOMA 4I65A 4B3RL 1SYCA 1Y1VB 3CCSA 2EY2A 4GN4B 4QUFA 3DWQA 1GUTA 1U5KA 4IN3A 2PI2E 2R93H 4G7ZC 3C1FA 2I5LX 3A0JA 4EX5A 4DV1L 2NYZD 1EUJA 3JAMc 2ICIA 3R2TA 1G91A 2LS01 1C8CA 3EBEA 3NQIA 3ERQA 1EQVA 3KBXA 1KQSA 1H9RA 1EWHA 5EBCA 4A93H 1A2TA 1ZXTA 4BBSH 1P8LA 1X3GA 2I5MX 1GD7A 1YJNA 2E2DC 1SBBB 3U9SA 3HZXA 1UWVA 1K83H 1TQOA 4DR3L 1D6EC 1STBA 4I7AA 4JI2Q 1H95A 3NENA 2K7VA 1D5XC 1JWMD 4XIGS 3ER0A 2EYOA 4KY5A 2UU9Q 3RZOH 4GKJQ 2I5HA 2IPKD 1SYGA 3WDNA 4BA2I 3I91A 4X64Q 5KRUA 2VY3A 1SYBA 2JEBI 3S1NB 1EQRA 2EPBA 2DJGC 4BY1B 2JK8A 3U50C 4JV5Q 3X3MA 1D1KA 4A3DH 1EEFD 1SNPA 1PV4A 1Z47A 2CH4A 1HXYD 1B50A 3RLNA 1FYCA 4UHVA 5CV9A 2Q2IA 1STEA 4OO1I 1V9PA 2A6HD 2A8VA 3NSWA 4R8NA 2IWHA 2B8GA 1PRTB 3DMUA 2OQ0A 4DAYA 3I4MG 3EA6A 1K28A 3OMCA 1PH3A 1KDAA 4RFBA 1PYSB 3PIO3 2E76C 1PTOD 5KEEA 3L7ZC 3RNUA 1CKNA 3J80c 1PFBA 2UUBL 3CXCA 1NR2A 1TWHB 4JI7L 3FRPB 1ILQA 1RIPA 1BNZA 1VQMA 1F9PA 3I8ZA 3GTMB 1FJGL 5CGKA 1JWUD 5M3MB 1TWCH 1A8VA 1K3BC 1N36Q 5C44B 2E2IH 4RCOA 2AQ1B 4V190 1U4PA 4RAUC 3RUZA 1CFMA 1XPOA 1HZ9A 1W6KA 2B63B 2J0TD 2NVXH 1F77A 3CKIB 1HNXL 4DR5Q 1ESRA 1V1OA 3I56A 3OYYA 1VQHA 1CZGA 4NMZA 4DV2L 1NTGA 3K59A 2H1EA 2K28A 1L2FA 2PNHA 2EYFA 2RCFA 5M5WH 4NPSA 1SYDA 1HFNA 4X3KA 2B2WA 3ND9A 4Q0FA 4ME5A 4LFBL 1SN8A 1EU4A 1PYBA 1E2ZA 2VZAA 5LMUQ 4KLKA 2ZJRA 2O5JC 3OPOA 4GKKQ 2AMCB 3QG1A 4OELB 4A3FB 4DR6L 4DR2L 1SDFA 2RDGA 2E2HH 2MFIA 1WTXA 1S40A 3I4OA 1K9MC 3KLSX 3QWNA 1I50H 1ICWA 1BO0A 1RD9D 3R3OA 3M4YA 2OTLA 2JN4A 4U68A 4YWMA 1V1QA 5FO9B 2B2VC 2D5DA 5CC4A 3GD7A 4MTNA 1TWFB 1AE3A 4CKBA 1J9OA 3A8IE 4IJHA 5LL6S 2H5XA 3F2CA 3HOVB 1I4RA 2BA1A 4ZLTF 1EOTA 2K52A 1B3AA 5DM73 4GNXC 1Y1VG 3C1EA 1EOVA 4ZCKA 4B9XA 4C2MB 4JOIC 1STYA 1B8AA 1EY5A 4GLXA 2RSNA 1HJPA 3TS2A 2R93B 4EQPA 1I4HA 1F2YA 2K5NA 2AQ3B 2F52A 5I6YA 4ZKBB 4QMGA 2F4VL 3CCQA 4A3IH 2Z9HA 1GJXA 2RVLA 2A1AA 3HKZE 4LUZA 5DAUA 1ET9A 4HJ7A 3AB9A 2D2CC 1GUOA 2HCIA 3M7GA 1BBWA 4A93B 5JOBA 4A3BG 1EQTA 1NAPA 3G6JB 4LF6Q 4KHVA 4JI8Q 1K83B 3W1GA 2F0LA 4RH6A 3JAML 1YIJA 2A5HA 2F0DA 4BXXG 4A3LG 2HHHL 1O7YA 1M90C 1I3QH 5CV8A 4JI4Q 2K32A 3SK6A 5E7NA 3SHLA 2X69A 3EFXD 4PZ7A 3PF5A 1I4XA 3BDOA 1HNWQ 4B3SL 4KY6A 5BN4A 3J80E 2K4KA 1I4GA 2MP1A 2R92H 5DLQE 1EL0A 2XRSD 4TVAB 4B3MQ 1E0BA 4YY3Q 5C6AA 4IO9A 1QVCA 2ZXPA 2OEOA 2L5TA 3OIPA 3BDLA 4A3DB 3K0XA 3A7LA 4NP5A 1J5EL 1LYLA 1A3UA 1MBYA 3WWVA 3S2HH 4X65Q 3GP7A 2QDBA 5CV5A 2LMCB 3ND8A 2UXDL 1XJVA 1DCZA 4ZUJA 3SR1A 1MJCA 1B70B 3S14H 4WJ4A 3I3CA 5EPKA 4P72A 4R4IA 3I4MH 3T53B 1Q1EA 4N9PA 3PF4A 1TVXA 2SDFA 4JI0Q 2FINB 1MI2A 2PCFB 2XRQD 4KK7A 3S16B 2PZUA 3GTOB 2HQEA 4LF5L 1TR5A 3TZUA 5M3MG 2MHVA 5C44G 3TS0A 1N32L 2KA7A 5A2QE 1ICFB 1YBYA 1TWCB 2UXBQ 2A74C 4K5XA 3A56A 3HEJA 1HZAA 2PO4A 3U9OA 3OTOL 4B08A 1CHPD 4X66Q 4R8IA 2A6HC 1VQDA 1BDOA 2B2YA 2NZOA 3J80L 1HNZL 1LT3D 3SDZA 2QILA 3FKIH 1IBMQ 3M4QA 5JPMC 1MJEA 1O7ZA 1SMYD 4YHHL 1PZID 3SVMA 1FD7D 5M5WB 4JI6Q 1AE2A 4JBKA 1PTOC 3D4DA 1JOKA 3VR6A 1LTID 3GDEA 1A2UA 3HS0C 4J1MA 5ELEA 4AIMA 4WFN3 4ALPA 4POGA 5LMNW 4G7OC 1JE5A 4A3FG 4KJOA 5M9OA 4OX9Q 4I7ZC 2JA8B 4QY7A 2E2HB 3HG9A 1I50B 1WD1A 4YCUA 2ZT9C 4KI0A 3KJPA 4J8QA 1SR3A 1DZ1A 1XTCD 2B2UC 1RKNA 1JMCA 1Z9FA 3HOVG 2YV5A 1LTTD 5IYBH 2DY8A 2FHTA 1DM0B 4ZRZA 5AJ3L 1PRTF 2F0VA 1XNQQ 3RZDH 3K80C 1IYVA 1FVIA 5A2QL 1CK1A 2TSSA 4EQ5A 1R4QB 3MWYW 1ZKOA 3URYA 1KIXA 3SK5A 2R93G 4JPBW 1II3A 3H3VC 2RBMA 1STGA 2WKDA 3MXUA 1RODA 3HKZB 1I6VC 1PH2A 1KAWA 2NVTH 4A3JH 4JBMA 1K8MA 4RA8A 4G57A 4IQZA 1C9OA 4A3IB 4JVZA 2HT1A 1W3SA 3QO2A 2X6LA 1Q82C 2VL6A 3H09A 1FGUA 5C4XH 2ZXRA 3FHWA 4A93G 3KF6B 4BBSG 3T56B 1PH4A 2RKSA 2NB0A 1BKBA 1Q12A 5E3FA 1EIGA 2EOTA 4XDXA 3T1YQ 2F0SA 3FEWX 1H9JA 2R3ZA 1PDQA 2ATWA 4JG2A 2OXPA 3EVQA
chains in the Genus database with same CATH topology
1VCIA 1B7YB 2ZJPA 4JI3Q 3PUWA 4DK3C 2ZJQA 4IFDI 4DR6Q 1SLJA 4J15A 4B3RL 2IY5B 1YJWA 3CCSA 2NVYH 1HR0L 3H15A 4GN4B 5JJLA 4A3MH 4DKAC 3RLOA 4X65L 3BZCA 1PH5A 1VQ6A 1YVCA 1X6OA 3PUYA 1U5KA 2OCEA 1XNRL 1RL2A 2PI2E 2R93H 2E2JH 3T1YL 2I5LX 3A0JA 4EX5A 4DV1L 4DV7Q 3JC66 4LF9L 1EUJA 4A3EH 1N34Q 5GAHC 3CCEA 3GTJH 2B63G 3S1NH 2L15A 4LF8L 4UPAA 4BY1H 3JAMc 4PZ6A 4GOPB 4POFA 5J3BA 1P16A 3HOXH 3UDIA 3S1MH 4JI0L 4A3DG 3EBEA 2R6GA 4JBWA 1YEZA 3J81i 3MEFA 2Y0SG 1KHIA 2V1CC 1KQSA 2R7ZH 1JJGA 4A93H 4BBSH 1VQNA 1YHAA 1P8LA 5HY6A 2NVQH 3GTLH 1X3GA 5LMNQ 2I5MX 5IYCH 1GD7A 5C0XG 1YJNA 2UUCQ 1GKHA 1E24A 1UWVA 1WYDA 4DR4Q 3RLFA 1K83H 5FJ8G 3L2PA 2R7FA 1Q7YC 1EWIA 3S1RH 4DR3L 2UXBL 1L1OB 4JI2Q 4C3JH 2N49A 4DV3L 2JA7H 5JEAG 3CAMA 4LF7Q 3HOYH 1TWGH 2YTXA 3NENA 4DV6Q 3CP0A 2E8GA 3S2DH 1SROA 1VQ9A 4XIGS 2JA5G 3ER0A 1QZGA 4BY7H 4H02A 4X66L 2UU9Q 4A3CG 2EQSA 2NZHA 3RZOH 3B6YA 4GKJQ 1NMGA 3CCJA 2I5HA 1TWHH 4UP8A 4DNIA 4NB3A 3J81j 1IBML 1VQFA 3J80i 2K50A 2AWOA 1IBKQ 2VQFL 1VQ7A 4BA2I 4BBRG 4JI2L 3I7FA 4JI6L 4X64Q 1J6QA 2VY3A 1SFOH 1A63A 4KHPQ 2JEBI 3A74A 3PIPA 4IPGA 2BH2A 5JJKA 2B63H 1EQRA 3KDFA 1X3FA 4DK6C 3J81c 1PH7A 1KRSA 2RHSB 3K81C 1XPRA 1MKHA 2JK8A 3L0OA 1N33L 5IT9c 2WAQG 3U50C 4P75A 4JV5Q 1SRUA 3I4NG 2HQLA 3H0GH 4A3DH 4DV0Q 3M7NA 1PV4A 4A3GG 3PUZA 1Z47A 2VQEL 4RG1A 1QZHA 4APVA 1OXTA 3NBHB 3RLNA 2VNUD 2IT1A 3ZJYC 2Q2IA 4DAMA 4OO1I 1V9PA 2VS1A 4JI1Q 2A8VA 1JB7A 1E1TA 1QUQA 2RF4A 1T9HA 1VQCA 2ZTDA 3AEVA 2UXCL 1K3RA 2Y0SE 4A4IA 3HOUG 2OTJA 4Y52H 4YWLA 3J7ZC 2OQ0A 1VQLA 4KHPL 3GO5A 1XMQQ 2IX0A 5M3FH 4A3KG 5ELNA 1CKMA 3I4MG 4R4TA 3M85A 3AFPA 1PH3A 1XMOQ 1L0WA 3CD6A 2KBNA 1PYSB 1E1OA 3CF5A 1XTDA 4DUZQ 1DGSA 2JA5H 2UUAQ 3H3VH 4LWCA 1HNXQ 3KFUA 3L7ZC 1KRTA 3RNUA 1VQ8A 1CKNA 4DR1Q 2ASBA 2JA8G 4A3CH 3J80c 2KCMA 2YU9H 4R1JA 2R7DA 1J5EQ 2UUBL 1CSQA 3GTKH 3CXCA 4JI7L 3CMAA 2KENA 4NXML 1RIPA 2N78A 3I55A 1YITA 1VQMA 1HZBA 3HKSA 1G6PA 5BR8Q 1FJGL 2ID0A 2UXDQ 1I94Q 1HH2P 1A8VA 1TWCH 2PQAA 1N36Q 2E2IH 2B29A 1FL0A 2IHEA 3E9IA 5GROA 3ULJA 4X62L 5GADC 2OWOA 1XPOA 1E3PA 1HZ9A 2AHOB 1VQ5A 1M1KC 3CQZH 1N9WA 2NVXH 3ULPA 4P73A 1HNXL 4L5RC 2Q2UA 1JT8A 2EIFA 4DR5Q 1LM0A 3KJOA 1EFWA 3ICEA 2E5LQ 3I4NH 4GN3B 1TXYA 3Q8DA 2XTIA 3I56A 1VQ4A 1L1OC 4A3GH 4IOCA 2DUDA 2YTYA 3OYYA 1W2BA 4C2MH 2OQKA 4DR2Q 1VQHA 4LF5Q 2JA6G 2I0QA 1PFSA 2WAQE 4DV2L 1NTGA 3RN5A 2K5HA 3DM3A 2WB1E 3K8AA 1L2FA 1O7IA 2PNHA 1N32Q 3HKZG 3G48A 4IPHA 4NPSA 5HGQA 5M5WH 1K0RA 3HOUH 4LUOA 4A76A 4LFBL 1SN8A 3KLWA 3EN2A 4OXPA 1IBLQ 4A3KH 3G4SA 1HR0W 1PYBA 2NN6I 1EIFA 2VZAA 4KLKA 4GLVB 3UE1A 5LMUQ 4DUYQ 4AQYL 2ZJRA 4A3IG 3OTOQ 3CPWA 4GKKQ 1NE3A 1HZCA 2AMCB 4JI3L 2E5LL 4DR6L 3S24A 2KHIA 2IHFA 4R4OA 4HJ5A 1HNZQ 4DR2L 4AH6A 1IYJB 2CQOA 2E2HH 3ULLA 2MFIA 1S40A 3BZKA 3I4OA 3KOJA 1K9MC 3A5UA 1I50H 3G6EA 3VDYA 2OTLA 4IPCA 1QUQB 3PO2G 2ZM6Q 1VQKA 5FLXc 4LW1A 4YHHQ 4YWMA 3KYHC 4DV7L 1V1QA 1N34L 1SMXA 3PUXA 1PH1A 4QQBX 3GD7A 4MTNA 5IWAQ 4IOAA 4DAYB 1EYGA 2Z6KA 1AE3A 3T1HL 3PIOA 3F1ZA 4IJHA 5IYDG 3TQYA 2H5XA 2F4VQ 3F2CA 1CKOA 2BA1A 3F2BA 4NXNQ 2K52A 2Q2HA 3F8TA 1UEBA 1QVGA 4HJ8A 4GNXC 1CKNB 1Y1VG 3G71A 1EOVA 5IP9G 1VQJA 2A19A 1PHJA 4TQUS 1JJCB 3TREA 2Q2TA 2JEAI 4JOIC 2Z6KC 5LMNL 2JA6H 5JJIA 1YNXA 1B8AA 2RHQB 4IPDA 4MZ9A 4GLXA 2UUCL 3A5ZB 1OXSC 1HJPA 3NELA 3TS2A 4DR4L 2JJQA 2R92G 3CCMA 4JC0A 2ALYB 2PQAB 3S17H 2K5NA 4AYBG 1Y1WG 5GAEC 4X6AH 2F52A 4LF7L 1X65A 4DV6L 3DLLA 2QA4A 2F4VL 3CCQA 4A3IH 2VW9A 5IE8A 2JQOA 2A1AA 3HKZE 5AJ3Q 2GVBA 4LUZA 3UE0A 2WP8J 2UU9L 1PA6A 2HHHQ 3J7A5 4HJ7A 3CCLA 5M5YH 2C35B 1YHQA 3ERSX 5C4JH 1VQEA 4GKJL 1BBWA 3GTPH 2QGQA 3PCOB 1YJ9A 4A3BG 1XPUA 4DV4Q 1WCMG 3D31A 1UE1A 1IBKL 4FDBA 4B3SQ 4JI5Q 2D0OA 3PV0A 1VQBA 4LF6Q 1SE8A 4IFDJ 4B3TQ 4JI8Q 4K0KQ 5FJ8H 4X64L 4C3IH 3W1GA 4JCVE 4L5QA 5C3EG 3AYHB 1YIJA 2EXDA 1EQQA 3U4VA 3PUVA 1R9TH 4DR7Q 4JV5L 5IYDH 4P74A 4BXXG 1NY4A 4A3LG 2HHHL 1TWAH 3BJUA 4OWTB 4DV0L 1M90C 3S16H 1I6HH 1I3QH 4JI4Q 1Y1VH 3S1QH 3FP9A 3GTOH 4BA1I 5E7NA 1KXLA 5IP7G 4PZ7A 5IP9H 3PF5A 1Q8KA 1HNWQ 1VQGA 4JI1L 4B3SL 4GOPC 3K7AH 1Q81C 2IX1A 3PGZA 4OO1G 2K4KA 4GS3A 4MNOA 4YCVA 1D8LA 3LGJA 4JYAQ 3PO3G 1L1OA 4DPGA 2R92H 1IZ6A 3CCRA 4BBRH 1Q86C 5DLQE 1XMQL 3OW2A 1D7QA 4QJFA 1KL9A 2WFWA 4TVAB 4B3MQ 1XMOL 4DR7L 4YY3Q 2D62A 4IO9A 4DUZL 1EIYB 2F3IA 3MXNB 2UUAL 1LTLA 1QVCA 3PSIA 4AYBE 4DR1L 2CFMA 3K0XA 3M4OH 3CC2A 4L5SA 1OXVA 1J5EL 1LYLA 3FKIG 1HR0Q 1V43A 2LXKA 1YI2A 1WJJA 3WWVA 3S2HH 4A3BH 1UE6A 4X65Q 4A75A 4QIWE 3NEMA 2N3SA 1WCMH 1BBUA 2CCZA 5BR8L 2UXDL 1XJVA 1GO3E 2KHJA 2JE6I 1I94L 4HIMA 1CSPA 4DV5Q 1N36L 1MJCA 1B70B 4HJAA 3S14H 4WJ4A 4P72A 2BA0A 4R4IA 5C3EH 4LF8Q 1PVOA 3KDFB 3I4MH 1PH6A 1PH9A 1Q1EA 2KCTA 1GM5A 4BY7G 3PF4A 1GVPA 2XGTA 1BVSA 2QEXA 4JI0Q 2R7ZG 4DR5L 1AH9A 4BXXH 4A3LH 4QL5A 2MQHA 2K75A 4UP7A 2ZTEA 2JA8H 3CCVA 4IFDG 3D0FA 3TEHB 4LF5L 5IP7H 3E0EA 3E9HA 3STBD 5C0XI 1K8GA 2BH8A 5ELOA 5M3MG 4PZ8A 1WOCA 5C44G 3TS0A 1N32L 4GNXA 4DV5L 1MIUA 3T1HQ 3M4PA 3KF8B 1YBYA 3PO3H 4DR3Q 2UXBQ 1KC8C 3UDXA 1N8RC 4DV3Q 2VUMG 4JOIA 1IBLL 2K14A 4LF4Q 4DUYL 5LMUL 3H3VI 1HZAA 5IYBG 1X3EA 1VS0A 3RR5A 2NN6G 1K73C 2ES2A 4LNQA 1VQIA 3H0GG 3OTOL 3CC4A 3M3YH 4GKKL 2JA9A 1VQAA 1E22A 4X66Q 1ASYA 1VQDA 3UDGA 2NZOA 2D0PA 1G291 2Z0SA 1HNZL 3HOWG 3KF6A 1A0IA 4OWXB 4HIKA 3FKIH 5FLMG 1IBMQ 3M4QA 4L5TA 3AFQA 3RN2A 1MJEA 3HOZG 4R4QA 3AQQA 1S72A 2ZM6L 2VQFQ 4O2DA 1WFQA 4YHHL 4HIOA 4JBKA 4KHZA 4JI6Q 1AE2A 5M3FG 4LFCQ 4QGUA 2N8NA 5IWAL 4A3JG 4LF4L 2ZTCA 3CW2C 4LUVA 1X9NA 3GDEA 4ALPA 4AIMA 1N33Q 4POGA 3K7UC 4PMWA 5LMNW 1VQPA 1IXRA 1JJ2A 1JE5A 4A3FG 4NXNL 5H1SE 5EAYA 4Y7NH 5C4XG 4YWKA 2GVAA 3UDFA 5GAGC 2VQEQ 4OX9Q 4QY7A 5K36G 4IJLA 4P71A 3S15H 4HJ9A 3IRBA 3GTMH 4JBJA 5M3MH 2YYZA 4YCUA 4LFAQ 5C44H 2UXCQ 4KI0A 4LFCL 3KJPA 1SR3A 3PO2H 2CKZB 1WI5A 1NJIC 1JMCA 2CWAA 1KD1C 2VUMH 2AKWB 1Z9FA 3HOVG 2YV5A 4GOPA 4UY8C 5IYBH 1K8AC 5AJ3L 2WB1G 1XNQQ 2LXJA 1PH8A 3RZDH 5GQOA 2DGYA 3K80C 1VQOA 4OX9L 1UE5A 1FVIA 1C7YA 3HOWH 1YHBA 1S3OA 1X55A 2UUBQ 1Q46A 3TRZA 3M9BA 4XTCS 4EQ5A 4A3MG 4GN5A 4JI7Q 5FLMH 4NXMQ 5M5XH 4DV4L 1H95A 1KIXA 1UE7A 5IY0A 3CC7A 2R93G 4LFAL 2B3GA 4JI5L 3GTQH 3BU2A 1FJGQ 1X54A 3HOZH 4GNXB 4LF6L 4B3TL 4A3EG 4JI8L 4K0KL 3U58A 3W1BA 2GN5A 1PH2A 1KAWA 4X62Q 2NVTH 5C0XJ 1NBWA 4A3JH 4JBMA 1LUZA 4BY1G 1C0AA 2HIXA 2K5VA 1Y1WH 4C3HH 3HOXG 4HIDA 1C9OA 1OXXK 1X56A 3EIVA 3STBC 3CCUA 1XNQL 2HT1A 1A62A 1NMFA 1W3SA 2FXQA 2PMZE 2MNAA 4UP9A 4A3FH 5JEAJ 1Q82C 2VL6A 4GLAC 4OWWB 2PI2A 3JAMi 1FGUA 1YZ6A 2MO0A 5C4XH 3FHWA 4JI4L 4A93G 3KF6B 4BBSG 4WJ3M 3GTGH 3I2ZA 4B3RQ 1OTCA 3F2DA 2AWNA 2LSSA 1PH4A 1I5FA 2CWPA 4YCWA 5IYCG 4DV2Q 3SGIA 1BKBA 3W5OA 1Q12A 1IL2A 2YTVA 1HNWL 3CPFA 1OXUA 4RMFA 1E7ZA 1Y14B 1XNRQ 4JYAL 3HFZB 1Q1BA 3T1YQ 4PG3A 2MO1A 4DV1Q 1TWFH 1CUKA 1ASZA 2RCNA 3CMEA 4AQYQ 3U4ZA 4LF9Q 2JA7G 4OONA 3HOYG 1QVFA 4LFBQ 4O0AA 1U0LA 4B3ML 2ATWA 4ME3A 1G51A 3HOVH 4YY3L 4JG2A 4R4CA 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCI A;  1B7Y B;  2ZJP A;  4JI3 Q;  3PUW A;  4DK3 C;  2ZJQ A;  4IFD I;  4DR6 Q;  1SLJ A;  4J15 A;  4B3R L;  2IY5 B;  1YJW A;  3CCS A;  2NVY H;  1HR0 L;  3H15 A;  4GN4 B;  5JJL A;  4A3M H;  4DKA C;  3RLO A;  4X65 L;  3BZC A;  1PH5 A;  1VQ6 A;  1YVC A;  1X6O A;  3PUY A;  1U5K A;  2OCE A;  1XNR L;  1RL2 A;  2PI2 E;  2R93 H;  2E2J H;  3T1Y L;  2I5L X;  3A0J A;  4EX5 A;  4DV1 L;  4DV7 Q;  3JC6 6;  4LF9 L;  1EUJ A;  4A3E H;  1N34 Q;  5GAH C;  3CCE A;  3GTJ H;  2B63 G;  3S1N H;  2L15 A;  4LF8 L;  4UPA A;  4BY1 H;  3JAM c;  4PZ6 A;  4GOP B;  4POF A;  5J3B A;  1P16 A;  3HOX H;  3UDI A;  3S1M H;  4JI0 L;  4A3D G;  3EBE A;  2R6G A;  4JBW A;  1YEZ A;  3J81 i;  3MEF A;  2Y0S G;  1KHI A;  2V1C C;  1KQS A;  2R7Z H;  1JJG A;  4A93 H;  4BBS H;  1VQN A;  1YHA A;  1P8L A;  5HY6 A;  2NVQ H;  3GTL H;  1X3G A;  5LMN Q;  2I5M X;  5IYC H;  1GD7 A;  5C0X G;  1YJN A;  2UUC Q;  1GKH A;  1E24 A;  1UWV A;  1WYD A;  4DR4 Q;  3RLF A;  1K83 H;  5FJ8 G;  3L2P A;  2R7F A;  1Q7Y C;  1EWI A;  3S1R H;  4DR3 L;  2UXB L;  1L1O B;  4JI2 Q;  4C3J H;  2N49 A;  4DV3 L;  2JA7 H;  5JEA G;  3CAM A;  4LF7 Q;  3HOY H;  1TWG H;  2YTX A;  3NEN A;  4DV6 Q;  3CP0 A;  2E8G A;  3S2D H;  1SRO A;  1VQ9 A;  4XIG S;  2JA5 G;  3ER0 A;  1QZG A;  4BY7 H;  4H02 A;  4X66 L;  2UU9 Q;  4A3C G;  2EQS A;  2NZH A;  3RZO H;  3B6Y A;  4GKJ Q;  1NMG A;  3CCJ A;  2I5H A;  1TWH H;  4UP8 A;  4DNI A;  4NB3 A;  3J81 j;  1IBM L;  1VQF A;  3J80 i;  2K50 A;  2AWO A;  1IBK Q;  2VQF L;  1VQ7 A;  4BA2 I;  4BBR G;  4JI2 L;  3I7F A;  4JI6 L;  4X64 Q;  1J6Q A;  2VY3 A;  1SFO H;  1A63 A;  4KHP Q;  2JEB I;  3A74 A;  3PIP A;  4IPG A;  2BH2 A;  5JJK A;  2B63 H;  1EQR A;  3KDF A;  1X3F A;  4DK6 C;  3J81 c;  1PH7 A;  1KRS A;  2RHS B;  3K81 C;  1XPR A;  1MKH A;  2JK8 A;  3L0O A;  1N33 L;  5IT9 c;  2WAQ G;  3U50 C;  4P75 A;  4JV5 Q;  1SRU A;  3I4N G;  2HQL A;  3H0G H;  4A3D H;  4DV0 Q;  3M7N A;  1PV4 A;  4A3G G;  3PUZ A;  1Z47 A;  2VQE L;  4RG1 A;  1QZH A;  4APV A;  1OXT A;  3NBH B;  3RLN A;  2VNU D;  2IT1 A;  3ZJY C;  2Q2I A;  4DAM A;  4OO1 I;  1V9P A;  2VS1 A;  4JI1 Q;  2A8V A;  1JB7 A;  1E1T A;  1QUQ A;  2RF4 A;  1T9H A;  1VQC A;  2ZTD A;  3AEV A;  2UXC L;  1K3R A;  2Y0S E;  4A4I A;  3HOU G;  2OTJ A;  4Y52 H;  4YWL A;  3J7Z C;  2OQ0 A;  1VQL A;  4KHP L;  3GO5 A;  1XMQ Q;  2IX0 A;  5M3F H;  4A3K G;  5ELN A;  1CKM A;  3I4M G;  4R4T A;  3M85 A;  3AFP A;  1PH3 A;  1XMO Q;  1L0W A;  3CD6 A;  2KBN A;  1PYS B;  1E1O A;  3CF5 A;  1XTD A;  4DUZ Q;  1DGS A;  2JA5 H;  2UUA Q;  3H3V H;  4LWC A;  1HNX Q;  3KFU A;  3L7Z C;  1KRT A;  3RNU A;  1VQ8 A;  1CKN A;  4DR1 Q;  2ASB A;  2JA8 G;  4A3C H;  3J80 c;  2KCM A;  2YU9 H;  4R1J A;  2R7D A;  1J5E Q;  2UUB L;  1CSQ A;  3GTK H;  3CXC A;  4JI7 L;  3CMA A;  2KEN A;  4NXM L;  1RIP A;  2N78 A;  3I55 A;  1YIT A;  1VQM A;  1HZB A;  3HKS A;  1G6P A;  5BR8 Q;  1FJG L;  2ID0 A;  2UXD Q;  1I94 Q;  1HH2 P;  1A8V A;  1TWC H;  2PQA A;  1N36 Q;  2E2I H;  2B29 A;  1FL0 A;  2IHE A;  3E9I A;  5GRO A;  3ULJ A;  4X62 L;  5GAD C;  2OWO A;  1XPO A;  1E3P A;  1HZ9 A;  2AHO B;  1VQ5 A;  1M1K C;  3CQZ H;  1N9W A;  2NVX H;  3ULP A;  4P73 A;  1HNX L;  4L5R C;  2Q2U A;  1JT8 A;  2EIF A;  4DR5 Q;  1LM0 A;  3KJO A;  1EFW A;  3ICE A;  2E5L Q;  3I4N H;  4GN3 B;  1TXY A;  3Q8D A;  2XTI A;  3I56 A;  1VQ4 A;  1L1O C;  4A3G H;  4IOC A;  2DUD A;  2YTY A;  3OYY A;  1W2B A;  4C2M H;  2OQK A;  4DR2 Q;  1VQH A;  4LF5 Q;  2JA6 G;  2I0Q A;  1PFS A;  2WAQ E;  4DV2 L;  1NTG A;  3RN5 A;  2K5H A;  3DM3 A;  2WB1 E;  3K8A A;  1L2F A;  1O7I A;  2PNH A;  1N32 Q;  3HKZ G;  3G48 A;  4IPH A;  4NPS A;  5HGQ A;  5M5W H;  1K0R A;  3HOU H;  4LUO A;  4A76 A;  4LFB L;  1SN8 A;  3KLW A;  3EN2 A;  4OXP A;  1IBL Q;  4A3K H;  3G4S A;  1HR0 W;  1PYB A;  2NN6 I;  1EIF A;  2VZA A;  4KLK A;  4GLV B;  3UE1 A;  5LMU Q;  4DUY Q;  4AQY L;  2ZJR A;  4A3I G;  3OTO Q;  3CPW A;  4GKK Q;  1NE3 A;  1HZC A;  2AMC B;  4JI3 L;  2E5L L;  4DR6 L;  3S24 A;  2KHI A;  2IHF A;  4R4O A;  4HJ5 A;  1HNZ Q;  4DR2 L;  4AH6 A;  1IYJ B;  2CQO A;  2E2H H;  3ULL A;  2MFI A;  1S40 A;  3BZK A;  3I4O A;  3KOJ A;  1K9M C;  3A5U A;  1I50 H;  3G6E A;  3VDY A;  2OTL A;  4IPC A;  1QUQ B;  3PO2 G;  2ZM6 Q;  1VQK A;  5FLX c;  4LW1 A;  4YHH Q;  4YWM A;  3KYH C;  4DV7 L;  1V1Q A;  1N34 L;  1SMX A;  3PUX A;  1PH1 A;  4QQB X;  3GD7 A;  4MTN A;  5IWA Q;  4IOA A;  4DAY B;  1EYG A;  2Z6K A;  1AE3 A;  3T1H L;  3PIO A;  3F1Z A;  4IJH A;  5IYD G;  3TQY A;  2H5X A;  2F4V Q;  3F2C A;  1CKO A;  2BA1 A;  3F2B A;  4NXN Q;  2K52 A;  2Q2H A;  3F8T A;  1UEB A;  1QVG A;  4HJ8 A;  4GNX C;  1CKN B;  1Y1V G;  3G71 A;  1EOV A;  5IP9 G;  1VQJ A;  2A19 A;  1PHJ A;  4TQU S;  1JJC B;  3TRE A;  2Q2T A;  2JEA I;  4JOI C;  2Z6K C;  5LMN L;  2JA6 H;  5JJI A;  1YNX A;  1B8A A;  2RHQ B;  4IPD A;  4MZ9 A;  4GLX A;  2UUC L;  3A5Z B;  1OXS C;  1HJP A;  3NEL A;  3TS2 A;  4DR4 L;  2JJQ A;  2R92 G;  3CCM A;  4JC0 A;  2ALY B;  2PQA B;  3S17 H;  2K5N A;  4AYB G;  1Y1W G;  5GAE C;  4X6A H;  2F52 A;  4LF7 L;  1X65 A;  4DV6 L;  3DLL A;  2QA4 A;  2F4V L;  3CCQ A;  4A3I H;  2VW9 A;  5IE8 A;  2JQO A;  2A1A A;  3HKZ E;  5AJ3 Q;  2GVB A;  4LUZ A;  3UE0 A;  2WP8 J;  2UU9 L;  1PA6 A;  2HHH Q;  3J7A 5;  4HJ7 A;  3CCL A;  5M5Y H;  2C35 B;  1YHQ A;  3ERS X;  5C4J H;  1VQE A;  4GKJ L;  1BBW A;  3GTP H;  2QGQ A;  3PCO B;  1YJ9 A;  4A3B G;  1XPU A;  4DV4 Q;  1WCM G;  3D31 A;  1UE1 A;  1IBK L;  4FDB A;  4B3S Q;  4JI5 Q;  2D0O A;  3PV0 A;  1VQB A;  4LF6 Q;  1SE8 A;  4IFD J;  4B3T Q;  4JI8 Q;  4K0K Q;  5FJ8 H;  4X64 L;  4C3I H;  3W1G A;  4JCV E;  4L5Q A;  5C3E G;  3AYH B;  1YIJ A;  2EXD A;  1EQQ A;  3U4V A;  3PUV A;  1R9T H;  4DR7 Q;  4JV5 L;  5IYD H;  4P74 A;  4BXX G;  1NY4 A;  4A3L G;  2HHH L;  1TWA H;  3BJU A;  4OWT B;  4DV0 L;  1M90 C;  3S16 H;  1I6H H;  1I3Q H;  4JI4 Q;  1Y1V H;  3S1Q H;  3FP9 A;  3GTO H;  4BA1 I;  5E7N A;  1KXL A;  5IP7 G;  4PZ7 A;  5IP9 H;  3PF5 A;  1Q8K A;  1HNW Q;  1VQG A;  4JI1 L;  4B3S L;  4GOP C;  3K7A H;  1Q81 C;  2IX1 A;  3PGZ A;  4OO1 G;  2K4K A;  4GS3 A;  4MNO A;  4YCV A;  1D8L A;  3LGJ A;  4JYA Q;  3PO3 G;  1L1O A;  4DPG A;  2R92 H;  1IZ6 A;  3CCR A;  4BBR H;  1Q86 C;  5DLQ E;  1XMQ L;  3OW2 A;  1D7Q A;  4QJF A;  1KL9 A;  2WFW A;  4TVA B;  4B3M Q;  1XMO L;  4DR7 L;  4YY3 Q;  2D62 A;  4IO9 A;  4DUZ L;  1EIY B;  2F3I A;  3MXN B;  2UUA L;  1LTL A;  1QVC A;  3PSI A;  4AYB E;  4DR1 L;  2CFM A;  3K0X A;  3M4O H;  3CC2 A;  4L5S A;  1OXV A;  1J5E L;  1LYL A;  3FKI G;  1HR0 Q;  1V43 A;  2LXK A;  1YI2 A;  1WJJ A;  3WWV A;  3S2H H;  4A3B H;  1UE6 A;  4X65 Q;  4A75 A;  4QIW E;  3NEM A;  2N3S A;  1WCM H;  1BBU A;  2CCZ A;  5BR8 L;  2UXD L;  1XJV A;  1GO3 E;  2KHJ A;  2JE6 I;  1I94 L;  4HIM A;  1CSP A;  4DV5 Q;  1N36 L;  1MJC A;  1B70 B;  4HJA A;  3S14 H;  4WJ4 A;  4P72 A;  2BA0 A;  4R4I A;  5C3E H;  4LF8 Q;  1PVO A;  3KDF B;  3I4M H;  1PH6 A;  1PH9 A;  1Q1E A;  2KCT A;  1GM5 A;  4BY7 G;  3PF4 A;  1GVP A;  2XGT A;  1BVS A;  2QEX A;  4JI0 Q;  2R7Z G;  4DR5 L;  1AH9 A;  4BXX H;  4A3L H;  4QL5 A;  2MQH A;  2K75 A;  4UP7 A;  2ZTE A;  2JA8 H;  3CCV A;  4IFD G;  3D0F A;  3TEH B;  4LF5 L;  5IP7 H;  3E0E A;  3E9H A;  3STB D;  5C0X I;  1K8G A;  2BH8 A;  5ELO A;  5M3M G;  4PZ8 A;  1WOC A;  5C44 G;  3TS0 A;  1N32 L;  4GNX A;  4DV5 L;  1MIU A;  3T1H Q;  3M4P A;  3KF8 B;  1YBY A;  3PO3 H;  4DR3 Q;  2UXB Q;  1KC8 C;  3UDX A;  1N8R C;  4DV3 Q;  2VUM G;  4JOI A;  1IBL L;  2K14 A;  4LF4 Q;  4DUY L;  5LMU L;  3H3V I;  1HZA A;  5IYB G;  1X3E A;  1VS0 A;  3RR5 A;  2NN6 G;  1K73 C;  2ES2 A;  4LNQ A;  1VQI A;  3H0G G;  3OTO L;  3CC4 A;  3M3Y H;  4GKK L;  2JA9 A;  1VQA A;  1E22 A;  4X66 Q;  1ASY A;  1VQD A;  3UDG A;  2NZO A;  2D0P A;  1G29 1;  2Z0S A;  1HNZ L;  3HOW G;  3KF6 A;  1A0I A;  4OWX B;  4HIK A;  3FKI H;  5FLM G;  1IBM Q;  3M4Q A;  4L5T A;  3AFQ A;  3RN2 A;  1MJE A;  3HOZ G;  4R4Q A;  3AQQ A;  1S72 A;  2ZM6 L;  2VQF Q;  4O2D A;  1WFQ A;  4YHH L;  4HIO A;  4JBK A;  4KHZ A;  4JI6 Q;  1AE2 A;  5M3F G;  4LFC Q;  4QGU A;  2N8N A;  5IWA L;  4A3J G;  4LF4 L;  2ZTC A;  3CW2 C;  4LUV A;  1X9N A;  3GDE A;  4ALP A;  4AIM A;  1N33 Q;  4POG A;  3K7U C;  4PMW A;  5LMN W;  1VQP A;  1IXR A;  1JJ2 A;  1JE5 A;  4A3F G;  4NXN L;  5H1S E;  5EAY A;  4Y7N H;  5C4X G;  4YWK A;  2GVA A;  3UDF A;  5GAG C;  2VQE Q;  4OX9 Q;  4QY7 A;  5K36 G;  4IJL A;  4P71 A;  3S15 H;  4HJ9 A;  3IRB A;  3GTM H;  4JBJ A;  5M3M H;  2YYZ A;  4YCU A;  4LFA Q;  5C44 H;  2UXC Q;  4KI0 A;  4LFC L;  3KJP A;  1SR3 A;  3PO2 H;  2CKZ B;  1WI5 A;  1NJI C;  1JMC A;  2CWA A;  1KD1 C;  2VUM H;  2AKW B;  1Z9F A;  3HOV G;  2YV5 A;  4GOP A;  4UY8 C;  5IYB H;  1K8A C;  5AJ3 L;  2WB1 G;  1XNQ Q;  2LXJ A;  1PH8 A;  3RZD H;  5GQO A;  2DGY A;  3K80 C;  1VQO A;  4OX9 L;  1UE5 A;  1FVI A;  1C7Y A;  3HOW H;  1YHB A;  1S3O A;  1X55 A;  2UUB Q;  1Q46 A;  3TRZ A;  3M9B A;  4XTC S;  4EQ5 A;  4A3M G;  4GN5 A;  4JI7 Q;  5FLM H;  4NXM Q;  5M5X H;  4DV4 L;  1H95 A;  1KIX A;  1UE7 A;  5IY0 A;  3CC7 A;  2R93 G;  4LFA L;  2B3G A;  4JI5 L;  3GTQ H;  3BU2 A;  1FJG Q;  1X54 A;  3HOZ H;  4GNX B;  4LF6 L;  4B3T L;  4A3E G;  4JI8 L;  4K0K L;  3U58 A;  3W1B A;  2GN5 A;  1PH2 A;  1KAW A;  4X62 Q;  2NVT H;  5C0X J;  1NBW A;  4A3J H;  4JBM A;  1LUZ A;  4BY1 G;  1C0A A;  2HIX A;  2K5V A;  1Y1W H;  4C3H H;  3HOX G;  4HID A;  1C9O A;  1OXX K;  1X56 A;  3EIV A;  3STB C;  3CCU A;  1XNQ L;  2HT1 A;  1A62 A;  1NMF A;  1W3S A;  2FXQ A;  2PMZ E;  2MNA A;  4UP9 A;  4A3F H;  5JEA J;  1Q82 C;  2VL6 A;  4GLA C;  4OWW B;  2PI2 A;  3JAM i;  1FGU A;  1YZ6 A;  2MO0 A;  5C4X H;  3FHW A;  4JI4 L;  4A93 G;  3KF6 B;  4BBS G;  4WJ3 M;  3GTG H;  3I2Z A;  4B3R Q;  1OTC A;  3F2D A;  2AWN A;  2LSS A;  1PH4 A;  1I5F A;  2CWP A;  4YCW A;  5IYC G;  4DV2 Q;  3SGI A;  1BKB A;  3W5O A;  1Q12 A;  1IL2 A;  2YTV A;  1HNW L;  3CPF A;  1OXU A;  4RMF A;  1E7Z A;  1Y14 B;  1XNR Q;  4JYA L;  3HFZ B;  1Q1B A;  3T1Y Q;  4PG3 A;  2MO1 A;  4DV1 Q;  1TWF H;  1CUK A;  1ASZ A;  2RCN A;  3CME A;  4AQY Q;  3U4Z A;  4LF9 Q;  2JA7 G;  4OON A;  3HOY G;  1QVF A;  4LFB Q;  4O0A A;  1U0L A;  4B3M L;  2ATW A;  4ME3 A;  1G51 A;  3HOV H;  4YY3 L;  4JG2 A;  4R4C A;  2HIV A; 
#chains in the Genus database with same CATH topology
 1DOL A;  2G9H D;  5I9P A;  4MIU A;  4IFD I;  3NE5 B;  3T13 A;  1JOQ A;  4J15 A;  1I3Q B;  1HR0 L;  4RHR A;  2F0I A;  1VQ6 A;  1FNV A;  3BZC A;  1BOS A;  1EZ8 A;  5CYU A;  3HRZ C;  2OCE A;  1XNR L;  1TY2 A;  3VR2 A;  2L0C A;  3GTQ B;  1B9M A;  1RTO A;  3JC6 6;  1N34 Q;  3K5O A;  5A35 A;  2R92 B;  1B9N A;  3S1N H;  2K01 A;  2L15 A;  1Y1W B;  1FNW A;  4BY1 H;  4C3H B;  1QCB D;  5J3B A;  2EYL A;  3UDI A;  4A3D G;  3J81 i;  1KHI A;  3GTG B;  3DM1 A;  3GTL H;  1QNK A;  5LMN Q;  3S2H B;  5FO8 B;  1E24 A;  1WYD A;  4DR4 Q;  2R7F A;  1Q7Y C;  3X3N A;  2N49 A;  4DV3 L;  2D9U A;  4LF7 Q;  4DV6 Q;  3S14 B;  3CP0 A;  2WII B;  2E8G A;  3S2D H;  1SEB D;  1SNM A;  1SRO A;  3IL8 A;  1XWE A;  1QZG A;  4H02 A;  2M2L A;  1H9M A;  1MHW C;  3MC0 B;  3P1H A;  1BQQ T;  5ISR A;  1TWH H;  1IHZ A;  4NB3 A;  3J81 j;  2EE1 A;  1IKM A;  2K50 A;  2AWO A;  3DEP A;  1VQ7 A;  1JR0 D;  1PYW D;  4JI2 L;  4IUR A;  1A63 A;  4KHP Q;  1AZQ A;  2B63 H;  3KDF A;  1X3F A;  1UUP A;  1TS5 A;  1PH7 A;  2RHS B;  1XPR A;  1MKH A;  3L0O A;  3NTI A;  4KN4 C;  3HOX B;  5KYL A;  1BUV T;  4DV0 Q;  5T1G A;  1LTA D;  2VQE L;  2HDM A;  2VNU D;  3ZJY C;  4DAM A;  5LL6 X;  3FKI B;  1KLG D;  3VA5 A;  1JB7 A;  1Z6H A;  1U9R A;  2UXC L;  1K3R A;  2FMC A;  2Y0S E;  4A4I A;  4DNR B;  4Y52 H;  3W2D A;  3GO5 A;  1XMQ Q;  4C3J B;  2IX0 A;  4K2L A;  1TWG B;  3M85 A;  1XMO Q;  1L0W A;  3CD6 A;  2KBN A;  1E1O A;  1CQF A;  1XTD A;  3DEO A;  2UUA Q;  4BY7 B;  4QB4 A;  3KFU A;  1VQ8 A;  4DR1 Q;  2JA8 G;  2ASB A;  4A3C H;  2YU9 H;  4R1J A;  1QE6 A;  3MA2 B;  1EU3 A;  3L3O C;  5BR8 Q;  4ULL A;  4O1N A;  3V05 A;  3D4R A;  1ZYR D;  1FL0 A;  3E9I A;  4IUV A;  1E3P A;  2AHO B;  2V4D A;  5EQ0 A;  1SNC A;  4P73 A;  5LHY 1;  3I4N H;  1DXM A;  4GN3 B;  1TXY A;  3Q8D A;  4OGQ C;  2F0Q A;  2XTI A;  5K5P A;  1W2B A;  4C2M H;  5KGU A;  1L0Y B;  1JE4 A;  1NUC A;  1S4Z A;  3RN5 A;  1D1I A;  2K5H A;  4FXD A;  3HKZ G;  3HOU H;  3LNN A;  4LMQ D;  1A15 A;  1TT2 A;  5M3F B;  3TP5 A;  1IBL Q;  2NVT B;  3T16 A;  4A3J B;  4DUY Q;  3T1H Q;  4A3I G;  2EZV A;  4GLV B;  3Q0A A;  4S3S A;  3CPW A;  2VB3 X;  2JA5 B;  4JI3 L;  3D6C A;  5L37 A;  4HCE A;  2KHI A;  4NW2 A;  4R4O A;  4HJ5 A;  3HP3 A;  5C4X B;  1VMP A;  2CQO A;  3BZK A;  3A5U A;  5D65 A;  4HAE A;  5C4Z A;  4XXE A;  3G6E A;  1QUQ B;  4V0B A;  1QIL A;  4LW1 A;  4XQJ A;  4DV7 L;  5D14 A;  1VF7 A;  4QQB X;  3FMC A;  2F0M A;  1ESF A;  3PIO A;  1TU2 B;  3I70 A;  1ENA A;  2NTT A;  4HCS A;  1CKO A;  2Q2H A;  3F8T A;  1UEB A;  1TKW B;  1QVG A;  3AU7 A;  4XQN A;  2WB1 B;  4F87 A;  4C1N I;  3GQB A;  1VQJ A;  2NZ1 D;  4TQU S;  4KN7 C;  3TRE A;  2JEA I;  2Z6K C;  1YNX A;  2UUC L;  3E5S A;  5JVH 3;  2NWG A;  3A5Z B;  3NEL A;  2JJQ A;  2K03 A;  2QF7 A;  2B39 A;  2R92 G;  2A6E D;  1JWS D;  2IW3 A;  1Y1W G;  5IGD A;  1WD0 A;  1SJE D;  5TSS A;  2VW9 A;  2JQO A;  5D3D A;  2FJ2 A;  5KNB A;  3J7A 5;  2EJF C;  5M5Y H;  2C35 B;  1WTQ A;  1TS2 A;  4ID6 A;  1YHQ A;  3ERS X;  1HCZ A;  2KUM A;  3TDQ A;  4DV4 Q;  3GTL B;  4GZY C;  1UE1 A;  4PNY A;  1IBK L;  3OWE B;  1QG7 A;  4JI5 Q;  2D0O A;  1FR3 A;  1VQB A;  2OF1 A;  3GV3 A;  1SE8 A;  4CJ2 C;  1HQM C;  4H7B A;  2QDL A;  1HHV A;  4RKB A;  3NWT A;  3AYH B;  2XN9 C;  3BYY B;  3EJI A;  4HSP A;  3U4V A;  4DR7 Q;  1CQV A;  4HN7 A;  3S2D B;  1A6X A;  1XX8 A;  1TWA H;  3S16 H;  1I6H H;  3D3R A;  3FP9 A;  1C48 A;  3GTO H;  1Q8K A;  1VQG A;  4JI1 L;  4GOP C;  4OO1 G;  3WOE A;  4YCV A;  3MFY A;  4JYA Q;  1B2T A;  1L0X B;  2O2L D;  1L1O A;  3CCR A;  5EKI A;  4DUZ L;  3MXN B;  4WRD A;  1LTL A;  4HMI A;  1MSH A;  4EGV A;  5EKK A;  1Y69 U;  1OXV A;  2XVS A;  2Y0S B;  3FKI G;  1O7L A;  1SE2 A;  2DNC A;  2LXK A;  1MGS A;  1WJJ A;  2MPM A;  5IIF A;  2N3S A;  1WCM H;  5I2Y A;  2KHJ A;  1I94 L;  5JAV A;  4DV5 Q;  4C3J G;  4J6H A;  4C3I B;  1QWY A;  1AW7 A;  3FPP A;  5C3E H;  2H4O A;  2K05 A;  2NTS A;  3KDF B;  4BY7 G;  2BE5 D;  1WTR A;  2MQH A;  4DNT B;  1AFP A;  4K6D A;  3S1Q B;  1BR9 A;  2ZTE A;  2JA8 H;  3JAM E;  3EQL C;  2YU9 B;  1W6J A;  5IP7 H;  1HFG A;  3E0E A;  1HUM A;  5C0X I;  5BN3 A;  5ELO A;  1K8O A;  1M4V A;  4DR3 Q;  1S5C D;  1KC8 C;  5FOB B;  3UDX A;  4AYB B;  1GUW A;  2RA4 A;  3R2I A;  4LF4 Q;  5IYB G;  1GUN A;  4RGM A;  3RR5 A;  2ES2 A;  2B2T C;  2JA9 A;  4R9W A;  4ILW A;  3I4N B;  2D0P A;  1G29 1;  3KF6 A;  1PLF A;  1Q90 A;  1SE4 A;  3AFQ A;  3RN2 A;  2PYK A;  2XNA C;  4R4Q A;  3AQQ A;  1EYA A;  1S72 A;  2ZM6 L;  4O2D A;  4L6T B;  4M1U B;  4KHZ A;  4LFC Q;  5M3F G;  5IWA L;  4A3J G;  3HOU B;  2EYP A;  2ZTC A;  3CW2 C;  1F9Q A;  2CH4 W;  3K0Y A;  1IXR A;  2WV6 D;  4NXN L;  1PTO H;  3I90 A;  4Y7N H;  5C4X G;  4YWK A;  3UDF A;  2PW7 A;  1S5F D;  2KJX A;  5IGG A;  3Q24 A;  5BN5 A;  4P71 A;  1VDZ A;  1ZYR C;  4IUU A;  1DOK A;  1ENF A;  2CVR A;  4JBJ A;  3KLS A;  1ZEQ X;  2Q8I B;  2O4X A;  1HA6 A;  1M8A A;  1NJI C;  1V1P B;  2HUG A;  2JP1 A;  2DN8 A;  4DK0 A;  2AKW B;  4X3S A;  1AN8 A;  4EQN A;  4B9W A;  4UY8 C;  3IFD A;  3M3Y B;  2WB1 G;  3SK4 A;  1K0S A;  4OX9 L;  4H0L C;  1UE5 A;  3HGB A;  2IJ0 A;  4MTK A;  1C7Y A;  3HOW H;  1S3O A;  1S5D D;  1X55 A;  2UUB Q;  1Q46 A;  3TRZ A;  4JI7 Q;  2E74 C;  5FLM H;  1G2S A;  1SYF A;  3GTQ H;  1FJG Q;  1GHK A;  4GNX B;  1PZK D;  4B3T L;  1KNE A;  4K0K L;  5HUR A;  3U58 A;  3W1B A;  3P7J A;  5C0X J;  1NBW A;  3CHB D;  1C0A A;  1LUZ A;  4BY1 G;  1Y1W H;  1BF4 A;  4C3H H;  2QCP X;  4TRD A;  3EIV A;  1XNQ L;  3BVM A;  2PMZ E;  3NK9 A;  2FXQ A;  2F0W A;  2HD3 A;  1SNO A;  5JEA J;  2A68 D;  4GLA C;  3QR8 A;  4JK1 C;  1G8Z D;  5M5Y B;  3GTG H;  2Z4I A;  4U67 3;  1OTC A;  2Q8R E;  5K36 H;  3F2D A;  1I5F A;  1KLU D;  4F88 A;  4DV2 Q;  1SND A;  1IL2 A;  3CPF A;  1OXU A;  4RMF A;  1E7Z A;  1Y14 B;  5IGB A;  1RHP A;  2LKV A;  5KYI A;  1CUK A;  2RCN A;  4LF9 Q;  3U4Z A;  4DF7 A;  3N6R A;  4OON A;  4XYO A;  2L55 A;  3VYT A;  1QVF A;  4LFB Q;  5EPL A;  3C46 A;  4ME3 A;  2BOS A;  4R4C A;  4XT3 B;  4DXF A;  4DK3 C;  5CV4 A;  2EYH A;  4DN4 M;  1TWA B;  5FO7 B;  4DR6 Q;  2IY5 B;  1I6H B;  1YJW A;  2NVY H;  2A6E C;  4ZK9 B;  1IW7 D;  3LWU A;  3T4A C;  2JYO A;  4A3M H;  5M5X B;  1YVC A;  3PUY A;  1U4M A;  1RL2 A;  3HOZ B;  3T1Y L;  3SXH A;  3BYT B;  4OO1 H;  1PFN A;  5GAH C;  1ONL A;  2R61 A;  3GTJ H;  2B63 G;  1KDB A;  1WTO A;  4LF8 L;  4UPA A;  5G3L F;  1B4O A;  3HOX H;  1P16 A;  4X3T A;  3S1M H;  2R6G A;  2Y0S G;  3J7Y W;  1JJG A;  2XSC A;  3OOC A;  2B2W C;  2Z1C A;  1CHQ D;  1YHA A;  5HY6 A;  1Y8P B;  2NVQ H;  3NTH A;  3E3X A;  2PPB C;  2L4N A;  4IUP A;  1GKH A;  1WCM B;  5FJ8 G;  3DXJ C;  1EWI A;  4C3I G;  3TP8 A;  5ELD A;  1L1O B;  2SEB D;  3MTS A;  2XWJ B;  4C3J H;  4FF2 A;  1UAP A;  1TWG H;  2YTX A;  4PMB A;  3IAY A;  1BXT A;  5C3E B;  1VQ9 A;  2FMM A;  4FXK C;  4FP5 D;  4RCN A;  4BY7 H;  4HMJ A;  2F0J A;  4A3C G;  5DNF A;  2KHS A;  3SK8 A;  2TMP A;  2G9D A;  1NMG A;  2B8F A;  3CCJ A;  2AQ2 B;  1VQF A;  2KVM A;  2VQF L;  4KKT A;  1IKL A;  1LLR D;  2F0O A;  3I7F A;  4A3E B;  1J6Q A;  5CMD A;  3A74 A;  1AP0 A;  4Z9C B;  5JJK A;  4DK6 C;  3J81 c;  1KRS A;  3K81 C;  1N33 L;  5IT9 c;  1SRU A;  1EY9 A;  3I4N G;  2HQL A;  4LK1 C;  4OHJ A;  4RGO S;  2SOB A;  3M7N A;  2R7Z B;  4APV A;  1OXT A;  3NBH B;  2IT1 A;  2VS1 A;  1QUQ A;  5C0X H;  1PRT D;  1T9H A;  2ZTD A;  4RHS A;  3HOU G;  4YWL A;  2BE5 C;  3J7Z C;  4KHP L;  1JOR A;  5M3F H;  5ELN A;  1CKM A;  5JEA H;  3AFP A;  2HIV A;  5E4W C;  4C56 C;  4QUC A;  3ONA B;  2JA5 H;  1DGS A;  3MVV A;  5T1I A;  1PTO B;  4Y7N B;  3FPU B;  2C9O A;  1J5E Q;  1LTB D;  2L1B A;  4ABN A;  3H94 A;  4NXM L;  2N78 A;  1YIT A;  1IL8 A;  3MFG A;  3KUP A;  3HKS A;  1G6P A;  2UXD Q;  1EY4 A;  1G6Z A;  2B29 A;  5GAD C;  1HQR D;  4X62 L;  1STH A;  3CQZ H;  5CV7 A;  5CV6 A;  3ULP A;  4L5R C;  4K5V A;  2Q2U A;  1JT8 A;  3KJO A;  1EFW A;  3H0G B;  2E5L Q;  1VQ4 A;  4A3G H;  2DUD A;  2YTY A;  3HOW B;  5I4D A;  5AFW A;  5JJZ A;  4LF5 Q;  1PFS A;  2WAQ E;  3OIQ A;  2K5W A;  3DM3 A;  2WB1 E;  1PXU A;  3K8A A;  1O7I A;  1N32 Q;  2ZXO A;  3G48 A;  1AZP A;  5HGQ A;  1K0R A;  3P75 A;  1B1Z A;  4A76 A;  2PMZ B;  4N9T A;  3KLW A;  4HR7 B;  4A3K H;  1HR0 W;  1EY7 A;  2NN6 I;  1EIF A;  3RMH A;  2QEJ C;  4OIJ A;  3OTO Q;  1NE3 A;  3K5L A;  3MEH A;  4HTH A;  1CTM A;  3S24 A;  1HNZ Q;  2IHF A;  1LTS D;  1IYJ B;  3GTK B;  3KOJ A;  4CJ1 B;  2KQ3 A;  1SXT A;  4IUT A;  3VDY A;  2KOL A;  4DU9 A;  1VQK A;  5FLX c;  4YHH Q;  3KYH C;  1SMX A;  4HED A;  2F0P A;  4CDE C;  4H44 C;  1EYG A;  1CT1 D;  2Z6K A;  3T1H L;  1FNU A;  3F1Z A;  2F0T A;  4F7X A;  3C3L A;  3MXN A;  4HJ8 A;  5ELF A;  2NBF A;  4ZYS A;  2F0K A;  1GXD C;  3F2U A;  4K6L A;  1JCK B;  1KDC A;  2NVY B;  3NHH A;  4JW0 A;  2Q2T A;  1WTW A;  4RKL A;  2JA6 H;  4A3M B;  5JJI A;  2RHQ B;  1OXS C;  3D6W A;  2PQA B;  3S17 H;  4RGT A;  2KCC A;  1TY0 A;  2B2Y C;  1LAB A;  2A68 C;  3GTJ B;  3NPP A;  2VXW A;  2QA4 A;  4L63 B;  3NP8 A;  1HUN A;  5AJ3 Q;  1STN A;  3S1M B;  2WP8 J;  1JQY D;  2UU9 L;  4UDU C;  3CCL A;  3NWS A;  4GKJ L;  1VQE A;  1LAC A;  2QGQ A;  3PCO B;  1XPU A;  2NVQ B;  1WCM G;  4CDD C;  5C5L A;  1BCP B;  4IFD J;  3VYU A;  1I4P A;  2XIW A;  5FJ8 H;  4X64 L;  2PZW A;  4C3I H;  4L5Q A;  5C3E G;  5DM6 3;  4ZUI A;  1DON A;  2Q8T A;  1QJO A;  2EXD A;  3BVG A;  1EQQ A;  3PUV A;  4JV5 L;  5IYD H;  3I4L A;  1IW7 C;  3Q6S A;  1NY4 A;  3BJU A;  2F0G A;  1WTH A;  1JC7 A;  3S1Q H;  2F3W A;  4BA1 I;  1UNS A;  3D8G A;  5IP7 G;  3K58 A;  3OSO A;  2QKI C;  5IP9 H;  4FF3 A;  1H9S A;  3W3A A;  1SE3 A;  2EY1 A;  3K7A H;  3PGZ A;  1TS3 A;  4GS3 A;  3LGJ A;  1D5Z C;  4DPG A;  1Q86 C;  1D7Q A;  1QNU A;  4Q5V A;  2BCO A;  1KL9 A;  3O13 A;  3TSS A;  4K2K A;  1F2L A;  2SNS A;  4DR7 L;  2F3I A;  2EY6 A;  1JOO A;  3PSI A;  1ILP A;  1ET6 A;  4AYB E;  2PNR C;  3TME A;  2CFM A;  3M4O H;  4L5S A;  5C4J B;  5KNC A;  1HR0 Q;  3GTP B;  1V43 A;  3MHB A;  1UEA B;  5F2D A;  4A75 A;  3J7A F;  1BBU A;  3VA7 A;  2CCZ A;  1GO3 E;  2JE6 I;  1F2Z A;  1N36 L;  4HJA A;  3RD4 A;  1V1P A;  1U4L A;  1HPC A;  1HA5 A;  5IGC A;  1LT5 D;  1EYC A;  1PH9 A;  2X6G A;  1GVP A;  1BVS A;  2QEX A;  2RSO A;  4DR5 L;  2B2V A;  1Y8N B;  1RF2 D;  1PZJ D;  2K75 A;  3P20 A;  4X3U A;  4FYD A;  3A55 A;  2OT2 A;  1RTN A;  3KK7 A;  2B2T A;  1K8G A;  2BH8 A;  3UI2 A;  5EGT A;  3CRK C;  2WKC A;  5C3X A;  3TBI B;  4GNX A;  4DV5 L;  1TII D;  3KF8 B;  3PO3 H;  4LAA A;  4BBR B;  2ENB A;  3BZD B;  5C4H A;  4DV3 Q;  2F4I A;  4JOI A;  3ITP A;  5LMU L;  1JIC A;  1QB5 D;  5FLX E;  3H3V I;  4NKL A;  1X3E A;  1K73 C;  3CQZ B;  3NXW A;  1VQI A;  3H0G G;  3M3Y H;  4GKK L;  1ASY A;  1E22 A;  2WAQ B;  4QIW B;  3E6Z X;  5HGT A;  3UDG A;  4PQX A;  1PRT C;  3HOW G;  4BS9 A;  1Z7T A;  1A0I A;  4A3G B;  5FLM G;  4L5T A;  4A3B B;  4TKO B;  2EJM A;  4LF4 L;  4LUV A;  1TS4 A;  1X32 A;  4KD3 A;  4CJ0 B;  4C3H G;  4A3K B;  2J4X A;  4PMW A;  1VQP A;  1KNA A;  3NBI A;  5H1S E;  2RDF A;  5CR3 A;  3LX0 A;  5GAG C;  5ELB A;  2VQE Q;  5K36 G;  4IJL A;  4OEM B;  1O80 A;  4IFD H;  4HJ9 A;  1EYD A;  5E1F A;  2C5C A;  2Z8L A;  4LFA Q;  2UXC Q;  4LFC L;  5NUC A;  4TSS A;  1WI5 A;  3OW7 A;  1C4Q A;  3K6O A;  1KD1 C;  2VUM H;  1F9S A;  1SJH D;  1K8A C;  1FGB D;  2NN6 H;  1PH8 A;  2DGY A;  3TN2 A;  1VQO A;  1RJT A;  4FO2 A;  2F03 A;  3M9B A;  4XTC S;  4F8M A;  4A3M G;  2L9H A;  1RDP D;  2EDG A;  5M5X H;  1E2V A;  3BDC A;  1UE7 A;  4KD4 A;  5IY0 A;  3CC7 A;  2JA6 B;  2B3G A;  3HOZ H;  5FLX L;  4LF6 L;  1PTO F;  4JI8 L;  3FVQ A;  4K5W A;  3S17 B;  4KKU A;  1LO5 D;  2K5V A;  4EQO A;  3HOX G;  4HID A;  3DWP A;  3STB C;  1OXX K;  1X56 A;  1A62 A;  1B44 D;  4OWW B;  4UP9 A;  4XT1 B;  3JAM i;  4JI4 L;  2HDL A;  4WJ3 M;  1KAA A;  3I2Z A;  4B3R Q;  2LSS A;  4KY7 A;  1NSN S;  3S15 B;  4YCW A;  3W5O A;  1HNW L;  1F2M A;  1Q1B A;  3PO2 B;  4DV1 Q;  1ASZ A;  1ENC A;  1LT4 D;  3CME A;  1SNQ A;  4CGY B;  3FDT A;  4B3M L;  1U0L A;  4YY3 L;  1NCV A;  1EZ6 A;  1M1K C;  3QB3 A;  4K8J A;  2ZJP A;  4JI3 Q;  3A8K E;  1V8Q A;  3PUW A;  1KAB A;  2LY7 A;  1SLJ A;  4IAL A;  3NBH A;  1DD2 A;  4C1N K;  3H15 A;  5JJL A;  1X3Q A;  4DKA C;  4M8A A;  3RLO A;  4X65 L;  1PH5 A;  1X6O A;  2E2J H;  3K7A B;  2K1B A;  4DV7 Q;  4LF9 L;  4A3E H;  1T5E A;  3CCE A;  4FF1 A;  5FKA C;  5J1Z A;  4FNF A;  3H6M A;  2VB2 X;  4PZ6 A;  4GOP B;  4POF A;  4JI0 L;  4FVM A;  4IUQ A;  4JBW A;  1YEZ A;  2EXZ A;  3MEF A;  2R7Z H;  1GUG A;  2V1C C;  1EEI D;  3OMG A;  3M4O B;  5IOC A;  1VQN A;  4RGN A;  5COY A;  1EIH A;  3V96 A;  5EJW A;  5IYC H;  4UAI A;  1H9S B;  4XYQ A;  5C0X G;  2UUC Q;  3RLF A;  1Y8O B;  3L2P A;  1WTV A;  2EYM A;  3S1R H;  2UXB L;  2KEE A;  3GV6 A;  4WOR A;  2JA7 H;  5JEA G;  3CAM A;  3HOY H;  2EY5 A;  3AMU A;  2F0H A;  3IFT A;  2JA5 G;  2RQX A;  1DJR D;  4X66 L;  1NNX A;  2EQS A;  2B2U A;  2NZH A;  1H9K A;  3B6Y A;  1SSO A;  1STA A;  4DNI A;  4UP8 A;  1IBM L;  3NQT A;  3J80 i;  3DUZ A;  1IBK Q;  1EY0 A;  1S5B D;  4DFA A;  3K57 A;  4BBR G;  4PMC A;  3QIA A;  2DY7 A;  1JB3 A;  4JI6 L;  1SFO H;  1HTL D;  3Q22 A;  2EYJ A;  3PO3 B;  3PIP A;  4IPG A;  2BH2 A;  2WIN B;  1B53 A;  1ML0 D;  3VR5 A;  1SAP A;  3NUC A;  2WAQ G;  1BCP F;  4P75 A;  5CBA E;  1G2T A;  3H0G H;  1O78 A;  4A3G G;  3PUZ A;  1QZH A;  4RG1 A;  4PV1 C;  4BBS B;  3MAQ A;  3KBG A;  5J39 A;  1BCP D;  4JI1 Q;  1E1T A;  2MJ8 A;  2RF4 A;  1VQC A;  3AEV A;  2OTJ A;  1VQL A;  2A69 D;  1KTK A;  1AEX A;  4A3K G;  1EY8 A;  4R4T A;  4P2C B;  3DWA A;  4QCL A;  4DUZ Q;  3CF5 A;  3H3V H;  2K33 A;  4LWC A;  1HNX Q;  1KRT A;  1B3Q A;  3RZO B;  2KCM A;  2R7D A;  2F0F A;  1CSQ A;  3GTK H;  2Z6B A;  3CMA A;  2KEN A;  3I55 A;  1HZB A;  3CU7 A;  3K5N A;  2ID0 A;  4FXG C;  1I94 Q;  1HH2 P;  2PQA A;  1XYI A;  5GRO A;  2IHE A;  3ULJ A;  2OWO A;  2K5D A;  3BVZ A;  1YNJ D;  3I72 A;  1VQ5 A;  3BG3 A;  3D4W A;  2VUM B;  1N9W A;  3TZD A;  4DAP A;  3PIP 3;  2EIF A;  1LM0 A;  3ICE A;  4HSV A;  4OIK A;  5IOD A;  3MXP A;  1L1O C;  4IOC A;  1CM9 A;  2OQK A;  4DR2 Q;  4KV6 A;  2JA6 G;  2Z4H A;  2I0Q A;  1GUS A;  3IKJ A;  3S9W A;  2F0U A;  1BBX C;  3ERO A;  2N88 A;  4RWS C;  4IPH A;  4LUO A;  5C3W A;  1J8I A;  2F1M A;  2AUK A;  5EKL A;  3EN2 A;  1YNN D;  4OXP A;  2CHB D;  3G4S A;  1VF5 C;  3UE1 A;  4AQY L;  5CBE E;  1HZC A;  2E5L L;  4DA2 A;  2GA4 B;  1PMR A;  3MZ5 A;  1T5X D;  3VYS A;  2KED A;  4AH6 A;  3L9A X;  5G3L D;  3ULL A;  1E2W A;  4EVO A;  4IPC A;  3PO2 G;  2ZM6 Q;  4ZKC B;  1N34 L;  3PUX A;  1PH1 A;  2E2I B;  1GHJ A;  5IWA Q;  4IOA A;  4DAY B;  4N8F A;  5FK9 C;  4MHE A;  5IYD G;  3TQY A;  4KTA A;  2F4V Q;  2NVX B;  1CZW A;  3F2B A;  4NXN Q;  3V2T A;  1CKN B;  2BDO A;  3G71 A;  5IP9 G;  2A19 A;  1PHJ A;  3E0J A;  1JJC B;  3BS1 A;  5LMN L;  2CW0 D;  1QOH A;  1S5E D;  3OWF A;  4IPD A;  4MZ9 A;  3R8B A;  4DR4 L;  2JXM B;  5ELC A;  3QOJ A;  3CCM A;  2PQE A;  2ALY B;  2M00 A;  4G4K A;  4JC0 A;  2E2J B;  4AYB G;  2DJF C;  1IYU A;  4ZQ3 A;  5GAE C;  4X6A H;  4LF7 L;  1MD2 D;  1X65 A;  2I07 B;  4DV6 L;  5IGF A;  3DLL A;  4IZ8 A;  2M9V A;  1CA6 A;  5IE8 A;  2GVB A;  3UE0 A;  1PA6 A;  2HHH Q;  3OHX C;  4G7H C;  5C4J H;  2IL8 A;  3GTP H;  1YJ9 A;  3D31 A;  1I4Q A;  4FDB A;  4B3S Q;  3PV0 A;  1Q3L A;  3KF8 A;  4B3T Q;  1MSG A;  3R93 A;  4K0K Q;  4CDF C;  4WJW A;  4CKE A;  4DGZ A;  3S1R B;  4JCV E;  3NTK A;  2JA7 B;  2EVB A;  1EY6 A;  5KIX A;  3HOY B;  2EJG C;  4N8X 1;  1R9T H;  4P74 A;  2L12 A;  1U4R A;  4OWT B;  4YIJ A;  4DV0 L;  1Y1V H;  1VMC A;  3PMF A;  1KXL A;  1A3V A;  3TP6 A;  1SYE A;  2WAC A;  5EBD A;  3K5M A;  1Q81 C;  2IX1 A;  4MNO A;  1D8L A;  3PO3 G;  1HTP A;  2QW7 A;  1IZ6 A;  2J7Z A;  1DYQ A;  4CDC C;  4BBR H;  1XMQ L;  3OW2 A;  1SFO B;  4QJF A;  2WFW A;  2RDH A;  5I9O A;  1XMO L;  3I73 A;  2D62 A;  2XWB B;  1EIY B;  2UUA L;  4DR1 L;  1A3T A;  4LJZ C;  2LFN A;  3CC2 A;  1X3P A;  1LT6 D;  2N55 A;  1F9R A;  1YI2 A;  4A3B H;  1UE6 A;  4BWG B;  4QIW E;  3NEM A;  3SEB A;  5BR8 L;  2MUY A;  3A7A B;  1CSP A;  4HIM A;  2NUC A;  3DHQ A;  3H91 A;  5D3I B;  1XXG A;  2BA0 A;  4NDX A;  2KEC A;  4LF8 Q;  4MN3 A;  1PVO A;  1PH6 A;  1GM5 A;  2KCT A;  1PFM A;  2XGT A;  1AH9 A;  1D2B A;  2K6A A;  4BXX H;  4A3L H;  4QL5 A;  4UP7 A;  2F0E A;  2K04 A;  4KMU C;  2O5I C;  3CCV A;  4IFD G;  3D0F A;  3TEH B;  3Q23 A;  3E9H A;  3STB D;  4PZ8 A;  1WOC A;  5I6W A;  4L8J A;  1MIU A;  3M4P A;  2PZT A;  4KJN A;  3WOF A;  1N8R C;  2VUM G;  2JSO A;  4CKC A;  1IBL L;  2K14 A;  1R4P B;  4DUY L;  2KCN A;  2BDN A;  1VS0 A;  2MGS A;  2NN6 G;  4E6I A;  4LNQ A;  3CC4 A;  3J7A V;  3CRL C;  1BCP C;  1VQA A;  2FFK B;  3A54 A;  2Z0S A;  1GOZ A;  2DNE A;  4OWX B;  4HIK A;  4DAV A;  2A69 C;  3HOZ G;  2VQF Q;  1WFQ A;  4HIO A;  4FF4 A;  3PQI A;  4QGU A;  2N8N A;  5EPJ A;  2G5D A;  5IGE A;  1X9N A;  1N33 Q;  3I4M B;  3K7U C;  4QF4 A;  2K5Q A;  2HCC A;  1JJ2 A;  1OO9 B;  5EAY A;  5E4X A;  2GVA A;  1D5M C;  3J81 E;  3T51 B;  5IT9 E;  3QOL A;  3S15 H;  5J22 A;  3KLR A;  1Q8I A;  3IRB A;  3GTM H;  5M3M H;  1YNJ C;  2PW5 A;  2YYZ A;  4ODG A;  5C44 H;  2I46 A;  5JVG 3;  3PO2 H;  4DXG A;  2CKZ B;  3MXG A;  3VR3 A;  4DK1 A;  4CBV A;  3G7L A;  2CWA A;  1CI3 M;  4H13 C;  3C2P A;  4O42 A;  4GOP A;  1HRJ A;  2LXJ A;  5GQO A;  2F3V A;  5I2X A;  1RCV D;  2F0N A;  4K8I A;  1YHB A;  1CA5 A;  3N52 A;  2AUJ D;  1LTG D;  4GN5 A;  5COR A;  4NXM Q;  5JPN C;  4DV4 L;  1LV9 A;  1YNN C;  4LFA L;  4JI5 L;  3A8J E;  3BU2 A;  1X54 A;  2SNM A;  4OL7 A;  4A3E G;  2GN5 A;  1LTR D;  4X62 Q;  2CQA A;  2HIX A;  3SE0 A;  5DEH A;  1WTP A;  3CCU A;  1NMF A;  4IUN A;  2IX3 A;  2MNA A;  3VYR A;  4A3F H;  2R7Z G;  2PI2 A;  2MO0 A;  1YZ6 A;  4KKS A;  4CHT B;  3LWE A;  5C5M A;  3QJY A;  2AWN A;  2CWP A;  1WVL A;  5IYC G;  2L11 A;  3SGI A;  2YTV A;  2P5Z X;  3ZYY X;  1XNR Q;  4JYA L;  3HFZ B;  2A73 B;  4PG3 A;  5KND A;  2MO1 A;  1TWF H;  2E75 C;  3VR4 A;  4AQY Q;  2JA7 G;  4ZAI A;  3HOY G;  4O0A A;  1EFI D;  3TP7 A;  3J81 L;  1G51 A;  3HOV H;  5IT9 L;  1VCI A;  1B7Y B;  1R9T B;  2CW0 C;  1NR4 A;  2ICE C;  4XQQ A;  3RZD B;  2ZJQ A;  1SMY C;  4K14 A;  1EWC A;  1DOM A;  4I65 A;  4B3R L;  1SYC A;  1Y1V B;  3CCS A;  2EY2 A;  4GN4 B;  4QUF A;  3DWQ A;  1GUT A;  1U5K A;  4IN3 A;  2PI2 E;  2R93 H;  4G7Z C;  3C1F A;  2I5L X;  3A0J A;  4EX5 A;  4DV1 L;  2NYZ D;  1EUJ A;  3JAM c;  2ICI A;  3R2T A;  1G91 A;  2LS0 1;  1C8C A;  3EBE A;  3NQI A;  3ERQ A;  1EQV A;  3KBX A;  1KQS A;  1H9R A;  1EWH A;  5EBC A;  4A93 H;  1A2T A;  1ZXT A;  4BBS H;  1P8L A;  1X3G A;  2I5M X;  1GD7 A;  1YJN A;  2E2D C;  1SBB B;  3U9S A;  3HZX A;  1UWV A;  1K83 H;  1TQO A;  4DR3 L;  1D6E C;  1STB A;  4I7A A;  4JI2 Q;  1H95 A;  3NEN A;  2K7V A;  1D5X C;  1JWM D;  4XIG S;  3ER0 A;  2EYO A;  4KY5 A;  2UU9 Q;  3RZO H;  4GKJ Q;  2I5H A;  2IPK D;  1SYG A;  3WDN A;  4BA2 I;  3I91 A;  4X64 Q;  5KRU A;  2VY3 A;  1SYB A;  2JEB I;  3S1N B;  1EQR A;  2EPB A;  2DJG C;  4BY1 B;  2JK8 A;  3U50 C;  4JV5 Q;  3X3M A;  1D1K A;  4A3D H;  1EEF D;  1SNP A;  1PV4 A;  1Z47 A;  2CH4 A;  1HXY D;  1B50 A;  3RLN A;  1FYC A;  4UHV A;  5CV9 A;  2Q2I A;  1STE A;  4OO1 I;  1V9P A;  2A6H D;  2A8V A;  3NSW A;  4R8N A;  2IWH A;  2B8G A;  1PRT B;  3DMU A;  2OQ0 A;  4DAY A;  3I4M G;  3EA6 A;  1K28 A;  3OMC A;  1PH3 A;  1KDA A;  4RFB A;  1PYS B;  3PIO 3;  2E76 C;  1PTO D;  5KEE A;  3L7Z C;  3RNU A;  1CKN A;  3J80 c;  1PFB A;  2UUB L;  3CXC A;  1NR2 A;  1TWH B;  4JI7 L;  3FRP B;  1ILQ A;  1RIP A;  1BNZ A;  1VQM A;  1F9P A;  3I8Z A;  3GTM B;  1FJG L;  5CGK A;  1JWU D;  5M3M B;  1TWC H;  1A8V A;  1K3B C;  1N36 Q;  5C44 B;  2E2I H;  4RCO A;  2AQ1 B;  4V19 0;  1U4P A;  4RAU C;  3RUZ A;  1CFM A;  1XPO A;  1HZ9 A;  1W6K A;  2B63 B;  2J0T D;  2NVX H;  1F77 A;  3CKI B;  1HNX L;  4DR5 Q;  1ESR A;  1V1O A;  3I56 A;  3OYY A;  1VQH A;  1CZG A;  4NMZ A;  4DV2 L;  1NTG A;  3K59 A;  2H1E A;  2K28 A;  1L2F A;  2PNH A;  2EYF A;  2RCF A;  5M5W H;  4NPS A;  1SYD A;  1HFN A;  4X3K A;  2B2W A;  3ND9 A;  4Q0F A;  4ME5 A;  4LFB L;  1SN8 A;  1EU4 A;  1PYB A;  1E2Z A;  2VZA A;  5LMU Q;  4KLK A;  2ZJR A;  2O5J C;  3OPO A;  4GKK Q;  2AMC B;  3QG1 A;  4OEL B;  4A3F B;  4DR6 L;  4DR2 L;  1SDF A;  2RDG A;  2E2H H;  2MFI A;  1WTX A;  1S40 A;  3I4O A;  1K9M C;  3KLS X;  3QWN A;  1I50 H;  1ICW A;  1BO0 A;  1RD9 D;  3R3O A;  3M4Y A;  2OTL A;  2JN4 A;  4U68 A;  4YWM A;  1V1Q A;  5FO9 B;  2B2V C;  2D5D A;  5CC4 A;  3GD7 A;  4MTN A;  1TWF B;  1AE3 A;  4CKB A;  1J9O A;  3A8I E;  4IJH A;  5LL6 S;  2H5X A;  3F2C A;  3HOV B;  1I4R A;  2BA1 A;  4ZLT F;  1EOT A;  2K52 A;  1B3A A;  5DM7 3;  4GNX C;  1Y1V G;  3C1E A;  1EOV A;  4ZCK A;  4B9X A;  4C2M B;  4JOI C;  1STY A;  1B8A A;  1EY5 A;  4GLX A;  2RSN A;  1HJP A;  3TS2 A;  2R93 B;  4EQP A;  1I4H A;  1F2Y A;  2K5N A;  2AQ3 B;  2F52 A;  5I6Y A;  4ZKB B;  4QMG A;  2F4V L;  3CCQ A;  4A3I H;  2Z9H A;  1GJX A;  2RVL A;  2A1A A;  3HKZ E;  4LUZ A;  5DAU A;  1ET9 A;  4HJ7 A;  3AB9 A;  2D2C C;  1GUO A;  2HCI A;  3M7G A;  1BBW A;  4A93 B;  5JOB A;  4A3B G;  1EQT A;  1NAP A;  3G6J B;  4LF6 Q;  4KHV A;  4JI8 Q;  1K83 B;  3W1G A;  2F0L A;  4RH6 A;  3JAM L;  1YIJ A;  2A5H A;  2F0D A;  4BXX G;  4A3L G;  2HHH L;  1O7Y A;  1M90 C;  1I3Q H;  5CV8 A;  4JI4 Q;  2K32 A;  3SK6 A;  5E7N A;  3SHL A;  2X69 A;  3EFX D;  4PZ7 A;  3PF5 A;  1I4X A;  3BDO A;  1HNW Q;  4B3S L;  4KY6 A;  5BN4 A;  3J80 E;  2K4K A;  1I4G A;  2MP1 A;  2R92 H;  5DLQ E;  1EL0 A;  2XRS D;  4TVA B;  4B3M Q;  1E0B A;  4YY3 Q;  5C6A A;  4IO9 A;  1QVC A;  2ZXP A;  2OEO A;  2L5T A;  3OIP A;  3BDL A;  4A3D B;  3K0X A;  3A7L A;  4NP5 A;  1J5E L;  1LYL A;  1A3U A;  1MBY A;  3WWV A;  3S2H H;  4X65 Q;  3GP7 A;  2QDB A;  5CV5 A;  2LMC B;  3ND8 A;  2UXD L;  1XJV A;  1DCZ A;  4ZUJ A;  3SR1 A;  1MJC A;  1B70 B;  3S14 H;  4WJ4 A;  3I3C A;  5EPK A;  4P72 A;  4R4I A;  3I4M H;  3T53 B;  1Q1E A;  4N9P A;  3PF4 A;  1TVX A;  2SDF A;  4JI0 Q;  2FIN B;  1MI2 A;  2PCF B;  2XRQ D;  4KK7 A;  3S16 B;  2PZU A;  3GTO B;  2HQE A;  4LF5 L;  1TR5 A;  3TZU A;  5M3M G;  2MHV A;  5C44 G;  3TS0 A;  1N32 L;  2KA7 A;  5A2Q E;  1ICF B;  1YBY A;  1TWC B;  2UXB Q;  2A74 C;  4K5X A;  3A56 A;  3HEJ A;  1HZA A;  2PO4 A;  3U9O A;  3OTO L;  4B08 A;  1CHP D;  4X66 Q;  4R8I A;  2A6H C;  1VQD A;  1BDO A;  2B2Y A;  2NZO A;  3J80 L;  1HNZ L;  1LT3 D;  3SDZ A;  2QIL A;  3FKI H;  1IBM Q;  3M4Q A;  5JPM C;  1MJE A;  1O7Z A;  1SMY D;  4YHH L;  1PZI D;  3SVM A;  1FD7 D;  5M5W B;  4JI6 Q;  1AE2 A;  4JBK A;  1PTO C;  3D4D A;  1JOK A;  3VR6 A;  1LTI D;  3GDE A;  1A2U A;  3HS0 C;  4J1M A;  5ELE A;  4AIM A;  4WFN 3;  4ALP A;  4POG A;  5LMN W;  4G7O C;  1JE5 A;  4A3F G;  4KJO A;  5M9O A;  4OX9 Q;  4I7Z C;  2JA8 B;  4QY7 A;  2E2H B;  3HG9 A;  1I50 B;  1WD1 A;  4YCU A;  2ZT9 C;  4KI0 A;  3KJP A;  4J8Q A;  1SR3 A;  1DZ1 A;  1XTC D;  2B2U C;  1RKN A;  1JMC A;  1Z9F A;  3HOV G;  2YV5 A;  1LTT D;  5IYB H;  2DY8 A;  2FHT A;  1DM0 B;  4ZRZ A;  5AJ3 L;  1PRT F;  2F0V A;  1XNQ Q;  3RZD H;  3K80 C;  1IYV A;  1FVI A;  5A2Q L;  1CK1 A;  2TSS A;  4EQ5 A;  1R4Q B;  3MWY W;  1ZKO A;  3URY A;  1KIX A;  3SK5 A;  2R93 G;  4JPB W;  1II3 A;  3H3V C;  2RBM A;  1STG A;  2WKD A;  3MXU A;  1ROD A;  3HKZ B;  1I6V C;  1PH2 A;  1KAW A;  2NVT H;  4A3J H;  4JBM A;  1K8M A;  4RA8 A;  4G57 A;  4IQZ A;  1C9O A;  4A3I B;  4JVZ A;  2HT1 A;  1W3S A;  3QO2 A;  2X6L A;  1Q82 C;  2VL6 A;  3H09 A;  1FGU A;  5C4X H;  2ZXR A;  3FHW A;  4A93 G;  3KF6 B;  4BBS G;  3T56 B;  1PH4 A;  2RKS A;  2NB0 A;  1BKB A;  1Q12 A;  5E3F A;  1EIG A;  2EOT A;  4XDX A;  3T1Y Q;  2F0S A;  3FEW X;  1H9J A;  2R3Z A;  1PDQ A;  2ATW A;  4JG2 A;  2OXP A;  3EVQ A; 
#chains in the Genus database with same CATH homology
 1VCI A;  1B7Y B;  2ZJP A;  4JI3 Q;  3PUW A;  4DK3 C;  2ZJQ A;  4IFD I;  4DR6 Q;  1SLJ A;  4J15 A;  4B3R L;  2IY5 B;  1YJW A;  3CCS A;  2NVY H;  1HR0 L;  3H15 A;  4GN4 B;  5JJL A;  4A3M H;  4DKA C;  3RLO A;  4X65 L;  3BZC A;  1PH5 A;  1VQ6 A;  1YVC A;  1X6O A;  3PUY A;  1U5K A;  2OCE A;  1XNR L;  1RL2 A;  2PI2 E;  2R93 H;  2E2J H;  3T1Y L;  2I5L X;  3A0J A;  4EX5 A;  4DV1 L;  4DV7 Q;  3JC6 6;  4LF9 L;  1EUJ A;  4A3E H;  1N34 Q;  5GAH C;  3CCE A;  3GTJ H;  2B63 G;  3S1N H;  2L15 A;  4LF8 L;  4UPA A;  4BY1 H;  3JAM c;  4PZ6 A;  4GOP B;  4POF A;  5J3B A;  1P16 A;  3HOX H;  3UDI A;  3S1M H;  4JI0 L;  4A3D G;  3EBE A;  2R6G A;  4JBW A;  1YEZ A;  3J81 i;  3MEF A;  2Y0S G;  1KHI A;  2V1C C;  1KQS A;  2R7Z H;  1JJG A;  4A93 H;  4BBS H;  1VQN A;  1YHA A;  1P8L A;  5HY6 A;  2NVQ H;  3GTL H;  1X3G A;  5LMN Q;  2I5M X;  5IYC H;  1GD7 A;  5C0X G;  1YJN A;  2UUC Q;  1GKH A;  1E24 A;  1UWV A;  1WYD A;  4DR4 Q;  3RLF A;  1K83 H;  5FJ8 G;  3L2P A;  2R7F A;  1Q7Y C;  1EWI A;  3S1R H;  4DR3 L;  2UXB L;  1L1O B;  4JI2 Q;  4C3J H;  2N49 A;  4DV3 L;  2JA7 H;  5JEA G;  3CAM A;  4LF7 Q;  3HOY H;  1TWG H;  2YTX A;  3NEN A;  4DV6 Q;  3CP0 A;  2E8G A;  3S2D H;  1SRO A;  1VQ9 A;  4XIG S;  2JA5 G;  3ER0 A;  1QZG A;  4BY7 H;  4H02 A;  4X66 L;  2UU9 Q;  4A3C G;  2EQS A;  2NZH A;  3RZO H;  3B6Y A;  4GKJ Q;  1NMG A;  3CCJ A;  2I5H A;  1TWH H;  4UP8 A;  4DNI A;  4NB3 A;  3J81 j;  1IBM L;  1VQF A;  3J80 i;  2K50 A;  2AWO A;  1IBK Q;  2VQF L;  1VQ7 A;  4BA2 I;  4BBR G;  4JI2 L;  3I7F A;  4JI6 L;  4X64 Q;  1J6Q A;  2VY3 A;  1SFO H;  1A63 A;  4KHP Q;  2JEB I;  3A74 A;  3PIP A;  4IPG A;  2BH2 A;  5JJK A;  2B63 H;  1EQR A;  3KDF A;  1X3F A;  4DK6 C;  3J81 c;  1PH7 A;  1KRS A;  2RHS B;  3K81 C;  1XPR A;  1MKH A;  2JK8 A;  3L0O A;  1N33 L;  5IT9 c;  2WAQ G;  3U50 C;  4P75 A;  4JV5 Q;  1SRU A;  3I4N G;  2HQL A;  3H0G H;  4A3D H;  4DV0 Q;  3M7N A;  1PV4 A;  4A3G G;  3PUZ A;  1Z47 A;  2VQE L;  4RG1 A;  1QZH A;  4APV A;  1OXT A;  3NBH B;  3RLN A;  2VNU D;  2IT1 A;  3ZJY C;  2Q2I A;  4DAM A;  4OO1 I;  1V9P A;  2VS1 A;  4JI1 Q;  2A8V A;  1JB7 A;  1E1T A;  1QUQ A;  2RF4 A;  1T9H A;  1VQC A;  2ZTD A;  3AEV A;  2UXC L;  1K3R A;  2Y0S E;  4A4I A;  3HOU G;  2OTJ A;  4Y52 H;  4YWL A;  3J7Z C;  2OQ0 A;  1VQL A;  4KHP L;  3GO5 A;  1XMQ Q;  2IX0 A;  5M3F H;  4A3K G;  5ELN A;  1CKM A;  3I4M G;  4R4T A;  3M85 A;  3AFP A;  1PH3 A;  1XMO Q;  1L0W A;  3CD6 A;  2KBN A;  1PYS B;  1E1O A;  3CF5 A;  1XTD A;  4DUZ Q;  1DGS A;  2JA5 H;  2UUA Q;  3H3V H;  4LWC A;  1HNX Q;  3KFU A;  3L7Z C;  1KRT A;  3RNU A;  1VQ8 A;  1CKN A;  4DR1 Q;  2ASB A;  2JA8 G;  4A3C H;  3J80 c;  2KCM A;  2YU9 H;  4R1J A;  2R7D A;  1J5E Q;  2UUB L;  1CSQ A;  3GTK H;  3CXC A;  4JI7 L;  3CMA A;  2KEN A;  4NXM L;  1RIP A;  2N78 A;  3I55 A;  1YIT A;  1VQM A;  1HZB A;  3HKS A;  1G6P A;  5BR8 Q;  1FJG L;  2ID0 A;  2UXD Q;  1I94 Q;  1HH2 P;  1A8V A;  1TWC H;  2PQA A;  1N36 Q;  2E2I H;  2B29 A;  1FL0 A;  2IHE A;  3E9I A;  5GRO A;  3ULJ A;  4X62 L;  5GAD C;  2OWO A;  1XPO A;  1E3P A;  1HZ9 A;  2AHO B;  1VQ5 A;  1M1K C;  3CQZ H;  1N9W A;  2NVX H;  3ULP A;  4P73 A;  1HNX L;  4L5R C;  2Q2U A;  1JT8 A;  2EIF A;  4DR5 Q;  1LM0 A;  3KJO A;  1EFW A;  3ICE A;  2E5L Q;  3I4N H;  4GN3 B;  1TXY A;  3Q8D A;  2XTI A;  3I56 A;  1VQ4 A;  1L1O C;  4A3G H;  4IOC A;  2DUD A;  2YTY A;  3OYY A;  1W2B A;  4C2M H;  2OQK A;  4DR2 Q;  1VQH A;  4LF5 Q;  2JA6 G;  2I0Q A;  1PFS A;  2WAQ E;  4DV2 L;  1NTG A;  3RN5 A;  2K5H A;  3DM3 A;  2WB1 E;  3K8A A;  1L2F A;  1O7I A;  2PNH A;  1N32 Q;  3HKZ G;  3G48 A;  4IPH A;  4NPS A;  5HGQ A;  5M5W H;  1K0R A;  3HOU H;  4LUO A;  4A76 A;  4LFB L;  1SN8 A;  3KLW A;  3EN2 A;  4OXP A;  1IBL Q;  4A3K H;  3G4S A;  1HR0 W;  1PYB A;  2NN6 I;  1EIF A;  2VZA A;  4KLK A;  4GLV B;  3UE1 A;  5LMU Q;  4DUY Q;  4AQY L;  2ZJR A;  4A3I G;  3OTO Q;  3CPW A;  4GKK Q;  1NE3 A;  1HZC A;  2AMC B;  4JI3 L;  2E5L L;  4DR6 L;  3S24 A;  2KHI A;  2IHF A;  4R4O A;  4HJ5 A;  1HNZ Q;  4DR2 L;  4AH6 A;  1IYJ B;  2CQO A;  2E2H H;  3ULL A;  2MFI A;  1S40 A;  3BZK A;  3I4O A;  3KOJ A;  1K9M C;  3A5U A;  1I50 H;  3G6E A;  3VDY A;  2OTL A;  4IPC A;  1QUQ B;  3PO2 G;  2ZM6 Q;  1VQK A;  5FLX c;  4LW1 A;  4YHH Q;  4YWM A;  3KYH C;  4DV7 L;  1V1Q A;  1N34 L;  1SMX A;  3PUX A;  1PH1 A;  4QQB X;  3GD7 A;  4MTN A;  5IWA Q;  4IOA A;  4DAY B;  1EYG A;  2Z6K A;  1AE3 A;  3T1H L;  3PIO A;  3F1Z A;  4IJH A;  5IYD G;  3TQY A;  2H5X A;  2F4V Q;  3F2C A;  1CKO A;  2BA1 A;  3F2B A;  4NXN Q;  2K52 A;  2Q2H A;  3F8T A;  1UEB A;  1QVG A;  4HJ8 A;  4GNX C;  1CKN B;  1Y1V G;  3G71 A;  1EOV A;  5IP9 G;  1VQJ A;  2A19 A;  1PHJ A;  4TQU S;  1JJC B;  3TRE A;  2Q2T A;  2JEA I;  4JOI C;  2Z6K C;  5LMN L;  2JA6 H;  5JJI A;  1YNX A;  1B8A A;  2RHQ B;  4IPD A;  4MZ9 A;  4GLX A;  2UUC L;  3A5Z B;  1OXS C;  1HJP A;  3NEL A;  3TS2 A;  4DR4 L;  2JJQ A;  2R92 G;  3CCM A;  4JC0 A;  2ALY B;  2PQA B;  3S17 H;  2K5N A;  4AYB G;  1Y1W G;  5GAE C;  4X6A H;  2F52 A;  4LF7 L;  1X65 A;  4DV6 L;  3DLL A;  2QA4 A;  2F4V L;  3CCQ A;  4A3I H;  2VW9 A;  5IE8 A;  2JQO A;  2A1A A;  3HKZ E;  5AJ3 Q;  2GVB A;  4LUZ A;  3UE0 A;  2WP8 J;  2UU9 L;  1PA6 A;  2HHH Q;  3J7A 5;  4HJ7 A;  3CCL A;  5M5Y H;  2C35 B;  1YHQ A;  3ERS X;  5C4J H;  1VQE A;  4GKJ L;  1BBW A;  3GTP H;  2QGQ A;  3PCO B;  1YJ9 A;  4A3B G;  1XPU A;  4DV4 Q;  1WCM G;  3D31 A;  1UE1 A;  1IBK L;  4FDB A;  4B3S Q;  4JI5 Q;  2D0O A;  3PV0 A;  1VQB A;  4LF6 Q;  1SE8 A;  4IFD J;  4B3T Q;  4JI8 Q;  4K0K Q;  5FJ8 H;  4X64 L;  4C3I H;  3W1G A;  4JCV E;  4L5Q A;  5C3E G;  3AYH B;  1YIJ A;  2EXD A;  1EQQ A;  3U4V A;  3PUV A;  1R9T H;  4DR7 Q;  4JV5 L;  5IYD H;  4P74 A;  4BXX G;  1NY4 A;  4A3L G;  2HHH L;  1TWA H;  3BJU A;  4OWT B;  4DV0 L;  1M90 C;  3S16 H;  1I6H H;  1I3Q H;  4JI4 Q;  1Y1V H;  3S1Q H;  3FP9 A;  3GTO H;  4BA1 I;  5E7N A;  1KXL A;  5IP7 G;  4PZ7 A;  5IP9 H;  3PF5 A;  1Q8K A;  1HNW Q;  1VQG A;  4JI1 L;  4B3S L;  4GOP C;  3K7A H;  1Q81 C;  2IX1 A;  3PGZ A;  4OO1 G;  2K4K A;  4GS3 A;  4MNO A;  4YCV A;  1D8L A;  3LGJ A;  4JYA Q;  3PO3 G;  1L1O A;  4DPG A;  2R92 H;  1IZ6 A;  3CCR A;  4BBR H;  1Q86 C;  5DLQ E;  1XMQ L;  3OW2 A;  1D7Q A;  4QJF A;  1KL9 A;  2WFW A;  4TVA B;  4B3M Q;  1XMO L;  4DR7 L;  4YY3 Q;  2D62 A;  4IO9 A;  4DUZ L;  1EIY B;  2F3I A;  3MXN B;  2UUA L;  1LTL A;  1QVC A;  3PSI A;  4AYB E;  4DR1 L;  2CFM A;  3K0X A;  3M4O H;  3CC2 A;  4L5S A;  1OXV A;  1J5E L;  1LYL A;  3FKI G;  1HR0 Q;  1V43 A;  2LXK A;  1YI2 A;  1WJJ A;  3WWV A;  3S2H H;  4A3B H;  1UE6 A;  4X65 Q;  4A75 A;  4QIW E;  3NEM A;  2N3S A;  1WCM H;  1BBU A;  2CCZ A;  5BR8 L;  2UXD L;  1XJV A;  1GO3 E;  2KHJ A;  2JE6 I;  1I94 L;  4HIM A;  1CSP A;  4DV5 Q;  1N36 L;  1MJC A;  1B70 B;  4HJA A;  3S14 H;  4WJ4 A;  4P72 A;  2BA0 A;  4R4I A;  5C3E H;  4LF8 Q;  1PVO A;  3KDF B;  3I4M H;  1PH6 A;  1PH9 A;  1Q1E A;  2KCT A;  1GM5 A;  4BY7 G;  3PF4 A;  1GVP A;  2XGT A;  1BVS A;  2QEX A;  4JI0 Q;  2R7Z G;  4DR5 L;  1AH9 A;  4BXX H;  4A3L H;  4QL5 A;  2MQH A;  2K75 A;  4UP7 A;  2ZTE A;  2JA8 H;  3CCV A;  4IFD G;  3D0F A;  3TEH B;  4LF5 L;  5IP7 H;  3E0E A;  3E9H A;  3STB D;  5C0X I;  1K8G A;  2BH8 A;  5ELO A;  5M3M G;  4PZ8 A;  1WOC A;  5C44 G;  3TS0 A;  1N32 L;  4GNX A;  4DV5 L;  1MIU A;  3T1H Q;  3M4P A;  3KF8 B;  1YBY A;  3PO3 H;  4DR3 Q;  2UXB Q;  1KC8 C;  3UDX A;  1N8R C;  4DV3 Q;  2VUM G;  4JOI A;  1IBL L;  2K14 A;  4LF4 Q;  4DUY L;  5LMU L;  3H3V I;  1HZA A;  5IYB G;  1X3E A;  1VS0 A;  3RR5 A;  2NN6 G;  1K73 C;  2ES2 A;  4LNQ A;  1VQI A;  3H0G G;  3OTO L;  3CC4 A;  3M3Y H;  4GKK L;  2JA9 A;  1VQA A;  1E22 A;  4X66 Q;  1ASY A;  1VQD A;  3UDG A;  2NZO A;  2D0P A;  1G29 1;  2Z0S A;  1HNZ L;  3HOW G;  3KF6 A;  1A0I A;  4OWX B;  4HIK A;  3FKI H;  5FLM G;  1IBM Q;  3M4Q A;  4L5T A;  3AFQ A;  3RN2 A;  1MJE A;  3HOZ G;  4R4Q A;  3AQQ A;  1S72 A;  2ZM6 L;  2VQF Q;  4O2D A;  1WFQ A;  4YHH L;  4HIO A;  4JBK A;  4KHZ A;  4JI6 Q;  1AE2 A;  5M3F G;  4LFC Q;  4QGU A;  2N8N A;  5IWA L;  4A3J G;  4LF4 L;  2ZTC A;  3CW2 C;  4LUV A;  1X9N A;  3GDE A;  4ALP A;  4AIM A;  1N33 Q;  4POG A;  3K7U C;  4PMW A;  5LMN W;  1VQP A;  1IXR A;  1JJ2 A;  1JE5 A;  4A3F G;  4NXN L;  5H1S E;  5EAY A;  4Y7N H;  5C4X G;  4YWK A;  2GVA A;  3UDF A;  5GAG C;  2VQE Q;  4OX9 Q;  4QY7 A;  5K36 G;  4IJL A;  4P71 A;  3S15 H;  4HJ9 A;  3IRB A;  3GTM H;  4JBJ A;  5M3M H;  2YYZ A;  4YCU A;  4LFA Q;  5C44 H;  2UXC Q;  4KI0 A;  4LFC L;  3KJP A;  1SR3 A;  3PO2 H;  2CKZ B;  1WI5 A;  1NJI C;  1JMC A;  2CWA A;  1KD1 C;  2VUM H;  2AKW B;  1Z9F A;  3HOV G;  2YV5 A;  4GOP A;  4UY8 C;  5IYB H;  1K8A C;  5AJ3 L;  2WB1 G;  1XNQ Q;  2LXJ A;  1PH8 A;  3RZD H;  5GQO A;  2DGY A;  3K80 C;  1VQO A;  4OX9 L;  1UE5 A;  1FVI A;  1C7Y A;  3HOW H;  1YHB A;  1S3O A;  1X55 A;  2UUB Q;  1Q46 A;  3TRZ A;  3M9B A;  4XTC S;  4EQ5 A;  4A3M G;  4GN5 A;  4JI7 Q;  5FLM H;  4NXM Q;  5M5X H;  4DV4 L;  1H95 A;  1KIX A;  1UE7 A;  5IY0 A;  3CC7 A;  2R93 G;  4LFA L;  2B3G A;  4JI5 L;  3GTQ H;  3BU2 A;  1FJG Q;  1X54 A;  3HOZ H;  4GNX B;  4LF6 L;  4B3T L;  4A3E G;  4JI8 L;  4K0K L;  3U58 A;  3W1B A;  2GN5 A;  1PH2 A;  1KAW A;  4X62 Q;  2NVT H;  5C0X J;  1NBW A;  4A3J H;  4JBM A;  1LUZ A;  4BY1 G;  1C0A A;  2HIX A;  2K5V A;  1Y1W H;  4C3H H;  3HOX G;  4HID A;  1C9O A;  1OXX K;  1X56 A;  3EIV A;  3STB C;  3CCU A;  1XNQ L;  2HT1 A;  1A62 A;  1NMF A;  1W3S A;  2FXQ A;  2PMZ E;  2MNA A;  4UP9 A;  4A3F H;  5JEA J;  1Q82 C;  2VL6 A;  4GLA C;  4OWW B;  2PI2 A;  3JAM i;  1FGU A;  1YZ6 A;  2MO0 A;  5C4X H;  3FHW A;  4JI4 L;  4A93 G;  3KF6 B;  4BBS G;  4WJ3 M;  3GTG H;  3I2Z A;  4B3R Q;  1OTC A;  3F2D A;  2AWN A;  2LSS A;  1PH4 A;  1I5F A;  2CWP A;  4YCW A;  5IYC G;  4DV2 Q;  3SGI A;  1BKB A;  3W5O A;  1Q12 A;  1IL2 A;  2YTV A;  1HNW L;  3CPF A;  1OXU A;  4RMF A;  1E7Z A;  1Y14 B;  1XNR Q;  4JYA L;  3HFZ B;  1Q1B A;  3T1Y Q;  4PG3 A;  2MO1 A;  4DV1 Q;  1TWF H;  1CUK A;  1ASZ A;  2RCN A;  3CME A;  4AQY Q;  3U4Z A;  4LF9 Q;  2JA7 G;  4OON A;  3HOY G;  1QVF A;  4LFB Q;  4O0A A;  1U0L A;  4B3M L;  2ATW A;  4ME3 A;  1G51 A;  3HOV H;  4YY3 L;  4JG2 A;  4R4C A;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...