5KGUA

Crystal structure of staphylococcal nuclease variant delta+phs n118d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGDNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N118D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kguA00
1SYBA 1KAAA 5KGUA 1KDBA 1NUCA 4S3SA 5HGTA 1SNQA 3V2TA 3EROA 1STHA 4NMZA 4EQNA 5CGKA 5IGCA 4ID6A 3P75A 4PMBA 2F0SA 1SNPA 3OMCA 1U9RA 4LAAA 3NUCA 4IZ8A 4ME5A 5J22A 1TT2A 2EYPA 5IGDA 2PZTA 5E1FA 5JOBA 1SYFA 5IGBA 1JOQA 1STBA 3P1HA 5K5PA 4KD4A 5C5LA 2EYOA 4J1MA 3SK4A 4KJNA 4PMCA 5I6WA 1JOKA 4NDXA 1EZ6A 1F2YA 1II3A 1SNMA 5C5MA 1ENAA 5JAVA 3D4WA 4K8JA 1RKNA 2EXZA 4HMIA 4EQOA 5KEEA 4G57A 2F0MA 2F3VA 4IALA 3SHLA 5I9OA 3T16A 4RKLA 5C3XA 2EYJA 1A3UA 5IOCA 4N9TA 5CV7A 4J6HA 2PZUA 4TRDA 2OF1A 1EY0A 3MZ5A 2PQEA 2F0GA 2SNMA 1EY4A 4PNYA 2OEOA 5KRUA 3S9WA 2EY1A 2KHSA 2RBMA 3QOJA 4KY6A 1EYAA 5C4HA 3EJIA 5C6AA 4I65A 2F0KA 4KY7A 2F3WA 4K14A 5IGGA 3MXPA 4DF7A 4WRDA 3D6CA 1EY8A 2F0UA 3C1EA 2F0DA 3MHBA 1JORA 2F0PA 5CV6A 5EGTA 4ZUIA 4KTAA 3BDLA 4HTHA 5C3WA 3TP5A 2F0VA 2SNSA 2F0TA 1A2TA 4DU9A 4ZUJA 1EY7A 4EVOA 2ENBA 5EKKA 4K5XA 1SNDA 2F0WA 4F8MA 2EY2A 2F0QA 4KJOA 1KDAA 5IGFA 5E3FA 5J1ZA 5IIFA 3NP8A 3PMFA 4B9XA 2EYHA 2F0OA 3BDCA 3TP8A 1NSNS 5HURA 4ODGA 4YIJA 3NK9A 3C1FA 1SYDA 1F2MA 1EYDA 4OL7A 4QMGA 3EVQA 3SK5A 1STAA 5I9PA 3SR1A 4K8IA 3TMEA 3OWFA 4B9WA 5CV4A 2PYKA 2EYLA 5CV8A 2LKVA 4HMJA 2F0LA 5KYLA 4RKBA 5IGEA 3D4DA 3HZXA 1EY9A 4MIUA 1KDCA 1STNA 3MEHA 1EZ8A 3VA5A 1EQVA 1EYCA 1EY6A 1A3VA 4QF4A 2OXPA 1SYCA 4EQPA 5KYIA 3NXWA 2F0IA 3H6MA 3NQTA 4H7BA 4E6IA 3SXHA 2EY6A 3SK6A 5IODA 2F0HA 1A3TA 3OMGA 3R3OA 5I6YA 4K6DA 1A2UA 2EY5A 3E5SA 2M00A 5DEHA 1TR5A 4F7XA 5KIXA 4NP5A 2SOBA 3DMUA 3HEJA 2PW5A 3D8GA 4N9PA 5CR3A 3U9OA 4K2KA 1EY5A 3MVVA 3QOLA 3TP6A 3DHQA 4DGZA 5CV5A 2F0FA 4KHVA 4K2LA 2F0JA 2F0NA 4IUNA 1JOOA 4KV6A 1ENCA 1F2ZA 2NUCA 5F2DA 5NUCA 3SK8A 3TP7A 4WORA 2RKSA 5EKLA 1AEXA 3T13A 4NKLA 2F0EA 2HQEA 2WACA 3LX0A 4K5VA 4R8NA 1SYEA 1KABA 2PZWA 4QB4A 3ERQA 1STGA 1SYGA 3RUZA 3ITPA 5CC4A 2EYFA 4KY5A 5ISRA 5J39A 3NHHA 4ZQ3A 5DAUA 2KQ3A 4K5WA 1SNCA 1TQOA 5M9OA 2RDFA 1STYA 2QDBA 1SNOA 2PW7A 4KD3A 4DFAA 2EYMA 3QB3A 3OSOA 1IHZA 2O4XA 5CV9A 5C4ZA
chains in the Genus database with same CATH superfamily
2B8GA 1CKMA 3DEOA 3FDTA 4WJWA 3S1QB 4C3IG 5E7NA 4CBVA 5JEAH 3PQIA 1ASZA 2ASBA 1K3BC 1STBA 1CQFA 2HT1A 1QVCA 1RTOA 5I6WA 1RHPA 1WFQA 4TVAB 4L5SA 3HKZB 1E22A 1V1PA 2EVBA 2E2JB 1NY4A 3TEHB 2BDOA 4DV0L 5FLXE 5M5XH 1E1TA 5IOCA 5M3FH 2PZUA 2OF1A 1W6KA 3DWPA 5C4HA 3T1HL 4I65A 3HOZG 1LTAD 1EU4A 4K14A 3BVZA 1DXMA 4X65L 1PTOB 5IYDG 3C1EA 4FXDA 1VQIA 1VQJA 1I4PA 2QKIC 4DAMA 4AQYQ 2NN6G 1YNNC 4A75A 1PRTB 4QJFA 3RR5A 4JBKA 1SROA 4ZUJA 1YVCA 2ENBA 4GN5A 4PG3A 2Q8TA 2KHJA 1YJNA 4JI6L 3HP3A 4B3ML 3B6YA 4YCWA 2JA6B 4LF4L 2ZJRA 2Q8IB 2KENA 5EKIA 4ZLTF 4LFBL 3UDFA 2N55A 3G4SA 4GOPA 5D3IB 1EY9A 5GROA 1F9QA 2F1MA 3VA5A 4IOAA 4DR4Q 1IKMA 4Z9CB 3UDXA 3ICEA 4QF4A 3RNUA 1D2BA 3GQBA 1HCZA 3VR4A 3SK6A 4HIKA 1TWCB 3U50C 3R3OA 3CCRA 1K8OA 3E5SA 1CA5A 2D5DA 1C7YA 3J81c 4OX9Q 1B1ZA 4C3HG 1BCPD 4JV5L 5M3MG 3U9OA 5AJ3L 2UU9Q 3T1YL 1GHKA 4OGQC 3GTKH 3RD4A 3RMHA 2E76C 4K2LA 4IUNA 1LT6D 1TVXA 4BY1G 2HQEA 4DV4L 4U68A 4OEMB 1IBLQ 1ET9A 2KVMA 2VQEQ 1FNVA 2EYFA 5DM63 1T5EA 4IPGA 2F4VL 2OWOA 2GVAA 1SNCA 1PFMA 2NVXH 1H95A 2JP1A 1STHA 4EQNA 4JI1Q 1U9RA 3L3OC 5IP7G 4HJ8A 1SE4A 1DONA 1FGBD 3JAML 4UDUC 1YJ9A 3I4MH 3UI2A 3S14B 1D1KA 3CQZH 3L7ZC 1VQPA 4N8FA 2FMCA 1HUNA 5JEAG 2P5ZX 2K1BA 3MAQA 1H9RA 4FXKC 1S4ZA 2FINB 2MJ8A 1EY4A 2ICIA 5IYCH 1BCPC 3HKZG 3K57A 2KECA 1XMQL 4JYAQ 2CQOA 4WRDA 1U4RA 2F3IA 2LFNA 1LTGD 3KF6B 2AQ1B 1VQGA 2K01A 5M3FG 4HTHA 4QUCA 1TS2A 4A3KB 1CUKA 2NVTB 2YTXA 1B9MA 2Q2TA 2DNCA 3JAMi 1HUMA 1JWUD 2Z6KA 1CKNB 1HZAA 1H9KA 2UUAL 1VMPA 5HURA 4ODGA 2E74C 2HCIA 5E4XA 4A76A 3E3XA 3EVQA 3HG9A 2BE5D 4ULLA 2MP1A 3M85A 5FLMH 1SN8A 3KDFB 5IWAL 1TWFH 3CCQA 1YHQA 1V9PA 5AFWA 4IUUA 1BQQT 2EYLA 1K8AC 1PH3A 2WAQG 4XIGS 2B2WA 3KJPA 1AE3A 3QG1A 2B2TA 4E6IA 2XWJB 2D9UA 4XYOA 1XTCD 1ICFB 3SGIA 2AWNA 2PMZB 3HEJA 2I46A 3FKIB 3A56A 3D8GA 4K2KA 1EY5A 3S1NH 2ZJQA 4JBMA 4H44C 5BN3A 3S16H 1BF4A 4JW0A 2NWGA 4DV6Q 4A3BB 4V190 5LL6X 3WOEA 4B3TQ 3U58A 4A3BH 2K50A 3LX0A 3DM3A 3PGZA 4DN4M 3VYTA 4GLXA 1Z7TA 4LFCL 4UP9A 3NWSA 4EGVA 2PCFB 1B8AA 4DV3Q 5CORA 4DFAA 2K6AA 1HR0L 3FEWX 1K9MC 1YITA 2Q2UA 3UE0A 1G6ZA 4IPCA 2C35B 3CW2C 2K52A 5M5WH 3OMCA 2PO4A 3NUCA 4ME5A 4FXGC 2BE5C 2PZTA 1PH2A 1K0SA 3QIAA 5ELCA 1XJVA 3TREA 1H9SB 2ZXRA 3J80E 1NE3A 3D4WA 5FJ8H 4DPGA 1KC8C 1N9WA 3Q23A 3R2IA 5EQ0A 3Q0AA 1GM5A 5EJWA 1XNRQ 3I4MG 1R4PB 3H15A 3NBIA 1PFBA 3A74A 3OW7A 4LUZA 4X3UA 2K7VA 5LHY1 3ZYYX 5LMUQ 5I4DA 2F0DA 2F0PA 4ZUIA 2OQKA 1HTLD 4DV1Q 3J7AF 1SFOB 1ZYRD 1BOSA 1QE6A 4M1UB 5IYCG 2HDMA 2JA8H 1N33L 5BN5A 3TP8A 3J7YW 3C1FA 4MNOA 1Y69U 1D5ZC 5IY0A 3PUXA 1PH1A 2JA7B 3OWFA 1V43A 2PYKA 2NBFA 4ZYSA 1ESRA 1Q8IA 2AQ2B 2HQLA 1EQVA 3KF6A 4EQPA 1EQTA 4LFAQ 2H5XA 2PNHA 5FLMG 1UWVA 2BA0A 1LT5D 3W3AA 1U4LA 3H09A 2E2IH 3VYRA 4GKKL 4YY3L 2HIXA 3W1BA 5CR3A 2L1BA 1YHBA 3T53B 2D0OA 3CC2A 3TP7A 1CA6A 4XQJA 1FNWA 5GQOA 1PH8A 2EJMA 3S1MB 1SYEA 2WKDA 4BBRH 3FKIG 4KY5A 3K6OA 4PZ8A 1C0AA 3OHXC 1I3QB 1AH9A 2J7ZA 3JAME 1OXUA 1VQKA 2JQOA 1FL0A 4FO2A 1ZYRC 4RGNA 4A3BG 1WYDA 2OTJA 3PO2H 4HCEA 4TQUS 5IGCA 2B8FA 1PRTF 1X6OA 4NMZA 4DK0A 4RHRA 1JR0D 3AQQA 1GO3E 1A8VA 4LAAA 4L8JA 2HDLA 4JI2L 1WJJA 2MO1A 1PHJA 1BNZA 5IGDA 1I50B 4FF3A 3H3VI 1HRJA 5HGQA 3HOXH 1CFMA 3ERSX 3G6JB 2ZTDA 3E9HA 1ET6A 2WV6D 4NDXA 4I7AA 3GTOH 2IT1A 4HR7B 4DV7Q 5T1GA 4A3LH 1O78A 2D62A 4C2MB 3S2DB 3GTPH 3GTJH 3U9SA 3V96A 1OXXK 5C3XA 5C44B 2QILA 3H3VH 1K83B 2EJFC 4DR3Q 3S2HB 2I5MX 4TKOB 3PF5A 4B3SQ 4BWGB 5FJ8G 4KLKA 1HNXQ 2E5LL 2VUMH 3FP9A 5GADC 3VA7A 1RTNA 3H0GB 1Z9FA 3TBIB 2C9OA 1VQDA 2OCEA 1I6HB 3CC4A 3VDYA 2O5IC 4K5XA 2L4NA 3C3LA 5ELNA 2IY5B 4DXGA 5LL6S 4A3IH 1EIFA 4CDEC 2IX1A 2SEBD 2E8GA 1LTLA 3J81E 3HGBA 3A8JE 4HJ9A 2RDGA 1YEZA 2R7ZH 3OIQA 2JA8G 1EUJA 5D65A 1TWHH 4A3GH 2NZHA 1PMRA 5GAHC 1Y1WB 1I94L 5DNFA 4DR5L 4A3FH 2F0HA 1DCZA 2RVLA 5FLXL 4F7XA 3PIOA 2D0PA 3DHQA 5A2QL 2PNRC 3TSSA 1VQMA 2I07B 3PCOB 3URYA 1F2ZA 4IFDI 3TZDA 1AN8A 4GNXA 1X32A 1AW7A 3LWEA 1SYGA 1T5XD 2PI2E 2N3SA 4RGTA 1GUTA 3T1HQ 2XN9C 3CU7A 1BBWA 1M8AA 2H1EA 4JC0A 3CCLA 3Q8DA 4IJHA 4ME3A 4G7HC 5EBDA 4IFDH 1WD0A 5KGUA 4BBRG 1W6JA 3OOCA 4C56C 5JJZA 3CD6A 1TY0A 4JI6Q 4B3MQ 3PO2G 2XSCA 4PMCA 4LF4Q 5EPLA 4X64L 4IJLA 4C3IB 5JJKA 2AQ3B 5IE8A 4FF1A 5KNDA 2AUKA 4LFBQ 2GA4B 2KCNA 1JWMD 4RKLA 4CGYB 3BG3A 3HOXG 1FJGL 4RH6A 1GUOA 3KK7A 4X3TA 5C0XJ 4PNYA 1SBBB 1MIUA 4A3LG 3D6WA 2VQFL 4N8X1 3MXPA 2K5WA 3E0EA 4IUTA 4CKBA 2JA5H 5C3WA 4HJ7A 4JV5Q 3M3YB 3AFQA 3T1YQ 4GOPC 1XMOL 1HZ9A 1SE8A 1K0RA 4RCOA 3HOZB 1QNKA 1MD2D 2FJ2A 2F0QA 3FMCA 2VUMG 1XNQL 1TY2A 4DUZL 5G3LF 1IZ6A 4DV4Q 1SE2A 1SLJA 3VYSA 2LY7A 1SMXA 2F4VQ 3MXUA 1XPRA 1IL8A 1LO5D 5IGEA 4A3IG 4A3EB 1E3PA 3TS2A 4CJ1B 4KKTA 2A1AA 4HSPA 1EYCA 1F9SA 1HTPA 3H6MA 3K58A 3SXHA 4GZYC 3AU7A 2YU9B 4NW2A 1QWYA 3F2DA 2PPBC 3S1RB 3NENA 4NP5A 3VR2A 4A3GG 1X65A 4IUPA 1GKHA 1BUVT 1LTRD 3S1RH 2B2VC 1I4RA 3MVVA 3UDIA 1X54A 1WTPA 1IL2A 4A3FG 1RIPA 5F2DA 4WORA 1IYJB 2WB1E 4IQZA 4C3HB 3O13A 2JYOA 5M3MB 1PTOD 4WJ3M 2PZWA 2ES2A 2R92H 1NNXA 1PRTD 2B2UA 1R9TB 3D4RA 3NWTA 4K0KL 5FO8B 4R9WA 2K03A 1XMQQ 3V05A 4L5RC 1STYA 4BY1B 3M7NA 4DR6L 3TZUA 4RHSA 5CV9A 5EAYA 1W3SA 4HEDA 3Q24A 2K32A 2WB1B 3J81j 2UUAQ 2RSOA 4L5QA 5E1FA 3KLRA 5IGBA 4IFDG 1B9NA 3SK4A 1N8RC 2GN5A 1VQEA 5IWAQ 3SE0A 2R93H 2EIFA 3RLFA 2DJFC 1EY0A 1BKBA 1NMFA 2Z6KC 4M8AA 3Q6SA 4JI8L 3CRKC 2C5CA 2V1CC 2N49A 1X3GA 3BZCA 1JICA 4JI3L 1JORA 1JE5A 3BDLA 3TP5A 2OT2A 2PI2A 2SNSA 2XGTA 1IBML 2B2WC 1TS3A 1PTOC 5IGFA 2JJQA 1D5MC 1Q82C 1TWAH 1PRTC 5M5XB 1JJCB 1A62A 2JA5G 2WAQE 5M3FB 1B3QA 4PV1C 1Y1VB 3SK5A 1AZPA 4X3SA 1Y1VH 1RD9D 4C1NI 4LFCQ 4NXNL 3EA6A 1JWSD 1AP0A 5A2QE 2M2LA 2B2YA 3K8AA 1FVIA 3D4DA 4MIUA 1HR0Q 3J80L 1JE4A 1ML0D 3Q22A 3OMGA 4HIOA 3HOVH 2B63H 4NB3A 2WAQB 1TR5A 2LS01 3ULJA 4X3KA 5D3DA 2UXCL 4A3EG 2FMMA 2X69A 3FRPB 1WD1A 4DAYA 3ZJYC 3NBHA 5IT9c 4KHVA 4F87A 4GN4B 1EOVA 2NUCA 1EQRA 4JK1C 4Y7NH 2WP8J 1AEXA 4AIMA 3CPWA 1KABA 1TWGH 2Q8RE 5J39A 3ITPA 4P71A 5CC4A 3RZOH 2EOTA 2N78A 2L5TA 1VQLA 2DN8A 4HAEA 3J80i 1C9OA 1IBKQ 1PVOA 3OSOA 1AFPA 5C4ZA 1KAAA 2BOSA 2Z8LA 3TN2A 2R92G 4DUYL 3GTKB 3VR3A 4OO1I 1KNAA 3MTSA 2UUCQ 2NB0A 1Q90A 3MA2B 1N33Q 4FNFA 1VQBA 5D14A 3NTKA 1II3A 4X62L 4OO1H 2DNEA 2NVXB 4BBSH 2WB1G 3L2PA 3M4QA 2Y0SG 4IALA 4GKJL 2NTTA 4PZ6A 1M1KC 1LTID 3QOJA 5C3EH 4DKAC 2QW7A 2R93G 3K81C 4GKKQ 2FHTA 3I4MB 5G3LD 3CQZB 4KHZA 1D6EC 4R1JA 1GUSA 1XX8A 3CP0A 1UE6A 4KJOA 1EL0A 3DLLA 1VQOA 3PMFA 2E2HH 5ELDA 1X3PA 1CZWA 2L0CA 1J8IA 1E0BA 1EYDA 2JXMB 1O7YA 2A19A 4LW1A 4DK6C 1ILQA 1KDCA 2R7DA 4OHJA 3I72A 1A3VA 4RAUC 1Y1VG 5IODA 1OO9B 3I55A 1VQ4A 4JI2Q 3FVQA 5JPMC 3TS0A 3G48A 3DMUA 3D0FA 3VYUA 1UEAB 1QZGA 2IJ0A 4N9PA 1MJCA 2NTSA 5CV5A 1B3AA 1TWFB 2OQ0A 2SDFA 3AB9A 3HOVG 4XT3B 1B44D 4A3DH 1VMCA 2RKSA 4B3RL 1G291 1I6VC 4MZ9A 4YWKA 4JI5L 1VQ6A 3G7LA 5J22A 4O42A 3RUZA 4WJ4A 2LXJA 5DAUA 2KQ3A 2IHFA 3I4NH 2E5LQ 3OIPA 2VB2X 2CQAA 4LF5Q 1D1IA 1L1OB 2PW7A 4KD3A 2JEBI 5C5LA 3J81L 2CVRA 3S1NB 3UDGA 1R4QB 1RODA 3S16B 3CMEA 4JI4L 5GAGC 4JBWA 2BDNA 2KCCA 2RHSB 1K8GA 2IX3A 2EYPA 3BDOA 4P74A 1JOQA 1EIHA 3OTOL 2ZJPA 4KD4A 1NCVA 5FK9C 3P20A 2A8VA 5ELFA 1HR0W 3HOUH 3GTLH 4K8JA 3CRLC 1W2BA 3MXNB 4KK7A 5KEEA 2ZTEA 2EXDA 2YTYA 3M4OH 2Z9HA 1RDPD 1WTXA 4RMFA 1Q1BA 4N9TA 4J6HA 2EZVA 4HIDA 1BBXC 4YWMA 5M5WB 4DR5Q 1HFGA 4OO1G 1EYAA 1K8MA 3I73A 3K5OA 3J81i 4DF7A 4RGMA 3KBXA 4KKUA 1LTBD 1E7ZA 4LF8L 5EGTA 5ELEA 3IAYA 3JC66 2K14A 2Z0SA 5KNCA 5C3EG 3CC7A 3ND8A 1CQVA 3EN2A 1N34L 2DJGC 3NK9A 5E4WC 3I90A 3BU2A 1AZQA 1STAA 3K0YA 4K8IA 1MSGA 3TMEA 3CMAA 3K7AH 4LUOA 3KUPA 2XRSD 4LNQA 1F9PA 3A5ZB 1RL2A 3PO3B 4IN3A 2OXPA 1S72A 3NXWA 3PO3H 3AYHB 1TIID 4OWWB 2JA8B 4K6DA 1YIJA 2KCMA 3KF8A 5L37A 1KTKA 1U0LA 3H94A 4DGZA 4X64Q 2E75C 4YCUA 3GTGH 5IP9H 1SE3A 4J8QA 2Q2HA 1JC7A 1Q1EA 4GNXB 2A5HA 2A6HD 3PIPA 5LMNL 2CHBD 2K33A 1FJGQ 4MTNA 1VQCA 3J7ZC 1F77A 4C1NK 2E2IB 2VQFQ 4A3DG 2ALYB 1UNSA 4CKCA 4ILWA 1IW7D 1SR3A 1SYBA 3DWQA 1PZKD 3T4AC 3L9AX 4R8IA 3I4NG 1HZCA 1KAWA 3F2UA 4O2DA 1EU3A 2EPBA 4A93H 1XNQQ 4OWXB 3MC0B 2RDHA 4BBRB 4GLVB 5C4JH 2RHQB 5CYUA 4AYBE 1J5EQ 3R2TA 4G57A 1Q81C 1A0IA 2X6GA 3PO2B 1L1OA 5CV7A 1N36L 2XWBB 5K36H 4G4KA 1LLRD 2EY1A 3HOUG 2RQXA 3BZKA 4CHTB 2CWPA 1N32L 3D6CA 2QCPX 3HOXB 3NTHA 4P72A 1Y8NB 4YCVA 4G7ZC 3M7GA 3ER0A 4AYBB 3GTOB 3X3NA 4DAPA 4JYAL 2A6HC 4DAVA 1SSOA 3GTPB 3MXNA 1HQMC 3M4PA 2EYHA 3GTJB 2DY8A 3K59A 1ESFA 4YHHL 2XVSA 3EBEA 4YIJA 4LF9L 1SAPA 1EWIA 5A35A 4A4IA 4U673 4HSVA 1HA6A 4K0KQ 2UUBL 1EQQA 1IW7C 2EQSA 2VUMB 4RA8A 2X6LA 4DR6Q 4XXEA 5IT9E 1XWEA 3FPPA 1EZ8A 1KIXA 3IKJA 1ZKOA 1CSQA 1I4HA 3A5UA 3PSIA 1A3TA 1YZ6A 3HOYH 1HXYD 4A3IB 2B2UC 2ZT9C 2CH4A 2SOBA 1JMCA 5T1IA 3TP6A 3PO3G 4RFBA 2JK8A 4XQQA 2R7ZB 2HHHL 1TWHB 4A3GB 4QL5A 1O7IA 5I2YA 3ERQA 1STGA 4OIKA 4JI7L 4DK1A 1NMGA 4JI8Q 4A3FB 3AMUA 4K5WA 5IP9G 2K4KA 4DV6L 4DV5L 1QNUA 4XT1B 4FVMA 4MHEA 4B3TL 2EJGC 3W5OA 4JI3Q 1LV9A 2EYMA 4C3JH 2UXDL 3EFXD 2IX0A 1KDBA 1PFSA 3HKSA 4PMWA 1IBMQ 4EQ5A 2MUYA 4A3JH 1FR3A 1JCKB 2F0SA 4DR1L 2VZAA 1CK1A 4DV3L 1JQYD 1A6XA 3VR6A 2VXWA 1OXVA 1VQNA 1Q12A 3P1HA 4DV0Q 2FXQA 1EZ6A 1F2YA 2BA1A 2K05A 4OELB 4QUFA 3NEMA 1B7YB 5JEAJ 4NXNQ 3STBD 1LT3D 4A93G 1O80A 3SHLA 1OTCA 5I9OA 4X65Q 1KLGD 4FF4A 3CPFA 2VL6A 1BR9A 3MXGA 3KLSA 3OYYA 2KHSA 1UE7A 4LK1C 3K0XA 1U5KA 1J6QA 1HNWL 4KHPL 2NVYH 1ICWA 4A3MH 4LF6L 2F0UA 1XNRL 3IL8A 2UXCQ 5M5YH 1E24A 1Y8PB 5K36G 2B2YC 2RA4A 1GJXA 1E2ZA 5EKKA 5C4XH 1CZGA 1SNDA 2F0WA 2ZXPA 5LMUL 3K5LA 1DOKA 2QEJC 3QWNA 3LGJA 4CJ2C 3IFDA 4B9WA 4AYBG 1DYQA 4A3CH 2KOLA 3CCUA 4Y52H 1IXRA 2F0LA 1J9OA 1BCPF 3D31A 2JA5B 2XNAC 4ZAIA 4ZKBB 4IPDA 4F88A 5AJ3Q 4DUYQ 4P75A 3OPOA 4WFN3 1CI3M 2Z4HA 1V8QA 2VB3X 5DEHA 2M00A 4G7OC 2JN4A 3STBC 3QOLA 4DAYB 3NBHB 2B3GA 2H4OA 1B53A 1Z47A 3U4ZA 5FO9B 4X62Q 2NVQH 3HOWB 4KV6A 1ENCA 1KRTA 3HOWH 5NUCA 4X66L 2QGQA 4GKJQ 3KJOA 1MHWC 2J0TD 2JEAI 2DGYA 2QF7A 2I5HA 1HNZL 3S17H 1Q46A 1FNUA 2R7ZG 1WCMH 2QDBA 3CXCA 1DD2A 3K5NA 4NXML 1PH4A 2EDGA 2ZTCA 5HGTA 3EROA 2K5QA 4PMBA 1VF5C 1YBYA 3GDEA 3S15H 3I91A 4V0BA 5EPJA 1SYFA 3CCEA 2Y0SE 1S5BD 4OWTB 2R92B 5DLQE 4GS3A 4MTKA 5C5MA 4R4CA 1QILA 4A3JG 1IYVA 5JJLA 4FYDA 2EXZA 4HMIA 2K5HA 2PQAB 1UE5A 1E2WA 3RLOA 1FGUA 1QVFA 1PXUA 1YJWA 2KEDA 1MSHA 4XYQA 1KHIA 4HN7A 4DV7L 4KY6A 4BXXH 3CHBD 2BH8A 2N8NA 1XYIA 2Y0SB 3CCMA 2UXBL 1LYLA 1VCIA 4BY7H 4JI0L 1M90C 3GTQH 4DR3L 4P2CB 4UAIA 1EFID 1PYSB 5DM73 1JB3A 3A7LA 2R93B 1DJRD 4A3MG 4B3RQ 3CCJA 1QVGA 1G6PA 2KJXA 1STEA 2ZXOA 1YHAA 1PH9A 4DNRB 5C4XG 3PV0A 4R4OA 5JVH3 3NQIA 4RKBA 1KQSA 1B70B 5GAEC 3MEHA 1STNA 2RCFA 4LMQD 2F03A 3S24A 5FKAC 1Q86C 3GTMH 1C4QA 4JI4Q 4A3CG 2G9HD 3ULPA 1TWAB 2KHIA 1WTRA 5KIXA 5EPKA 1EFWA 1DOLA 2B2TC 3PUWA 3OTOQ 1WTVA 2MGSA 1S40A 3S1QH 1B4OA 1WOCA 3UE1A 4XDXA 3JAMc 4NKLA 4ZKCB 3P7JA 3BJUA 3E0JA 3HOVB 4B08A 2B63B 5M9OA 3HOWG 3A0JA 3KFUA 1XTDA 1GUWA 1I4QA 1SNOA 2E2JH 4LF8Q 2SNMA 1F9RA 3NELA 4CDDC 2Z4IA 1EIGA 4S3SA 4H02A 5C0XI 2IW3A 1EWCA 1HJPA 4JOIA 1GUNA 4DNTB 1SNPA 2A73B 5IYBH 4Y7NB 3DWAA 4DA2A 1WCMG 3R93A 1TXYA 2N88A 5JOBA 1PTOH 1N34Q 1TWGB 3CF5A 3A54A 3RLNA 3BZDB 5C0XH 1JOKA 3RZOB 1ENAA 1ILPA 2E2DC 4HCSA 3H91A 4BS9A 2ATWA 1B50A 2YV5A 4BA1I 5ELOA 3ND9A 1FYCA 3BVGA 1DM0B 4L63B 2F3VA 1VQ5A 3T16A 3CCSA 2EYJA 3A8IE 2HCCA 3A8KE 4DR2L 2TSSA 3MWYW 2JA6H 2G9DA 1XPUA 3R8BA 5C6AA 4XQNA 5IGGA 1VF7A 4DXFA 1S5ED 1CM9A 1EY8A 1QUQA 4KTAA 2K5VA 1C8CA 1D5XC 4OXPA 1F2LA 3PIO3 3QR8A 4DV2L 2JSOA 4BXXG 4LF7L 4BBSB 2BCOA 2EY2A 1TWCH 4LUVA 2K5NA 2F0OA 2PQAA 4BY7G 2RF4A 1X9NA 1E1OA 5LMNQ 2VY3A 3DXJC 4ZRZA 2ZM6L 5C3EB 1BVSA 3F1ZA 3NTIA 1LACA 4UHVA 2KCTA 1G51A 1VQAA 2YYZA 5EBCA 1WTOA 1D8LA 4YY3Q 5KYIA 1SYCA 4H7BA 3WOFA 4POFA 2B2VA 2HD3A 1I5FA 1A2UA 4O0AA 1PH5A 4HJAA 4J15A 2E2HB 3KF8B 3DM1A 3I4LA 5JPNC 1UE1A 4ALPA 5BR8L 3WDNA 1VQ8A 1JOOA 1ONLA 1KRSA 3T13A 1L0YB 3I4OA 1EOTA 2Q2IA 2TMPA 4KMUC 1N36Q 3S14H 3NHHA 4CKEA 3QO2A 1Y14B 1PZID 1TQOA 2K04A 4H13C 1N32Q 1Y8OB 3QB3A 4ABNA 4ZK9B 1HZBA 2IWHA 3V2TA 2ICEC 5IT9L 1L1OC 4A3DB 4IZ8A 4QY7A 2B63G 3BVMA 1TT2A 2IHEA 1QB5D 2KUMA 4APVA 1ASYA 2HUGA 4YHHQ 3K7UC 1H9JA 4J1MA 4LF9Q 4A3KH 2NVTH 3U4VA 2UUBQ 3I4NB 1RKNA 2Z1CA 4OIJA 5IYBG 3CAMA 1BCPB 2F0MA 3IRBA 4DR7L 5FO7B 1HH2P 3I2ZA 3G71A 3MZ5A 3HRZC 2PMZE 2F0GA 5C0XG 2G5DA 2OEOA 2L9HA 5ELBA 4EX5A 2F3WA 3AFPA 1NJIC 3OW2A 1Q3LA 4GN3B 2GVBA 2JA6G 2F0TA 1LTSD 2MHVA 3HOUB 1UUPA 3GTLB 5CBEE 5HY6A 4F8MA 4CDFC 5J1ZA 3M4OB 2HHHQ 3LNNA 4KI0A 1HHVA 1PV4A 1VQ9A 1U4PA 3FKIH 5I9PA 1EYGA 4JI7Q 1I94Q 1QCBD 4DV5Q 3GV3A 4BBSG 1LABA 3ULLA 1O7ZA 3KBGA 1YI2A 2CCZA 2UXDQ 1EIYB 1I4XA 3QJYA 3AEVA 4KN4C 1SXTA 4QCLA 2AWOA 3GV6A 1ENFA 2F4IA 4I7ZC 4DR1Q 1V1OA 1HA5A 3F8TA 3KOJA 5TSSA 4AQYL 5JJIA 4UP8A 1BBUA 4CDCC 3HFZB 1PLFA 3C2PA 4DK3C 2L15A 3M4YA 2F0FA 2K5DA 1S5CD 3K7AB 3LWUA 2D2CC 5EKLA 3MFGA 4R4IA 2WACA 4R8NA 1JB7A 2LSSA 1RF2D 3I7FA 1XXGA 3RN5A 3I56A 4GNXC 2CFMA 1HNWQ 4KHPQ 4LF6Q 3J7A5 2QDLA 4JCVE 4JBJA 1PYBA 4DR4L 1G2SA 3N6RA 1NUCA 3P75A 2WFWA 2B29A 2M9VA 5LMNW 3GTGB 1MGSA 4JPBW 1IBKL 1BDOA 2L55A 2MNAA 2VNUD 2R6GA 4OX9L 1KLUD 2NZOA 4IFDJ 2LXKA 4RWSC 2EYOA 2VW9A 2UU9L 4KJNA 1UAPA 2O5JC 1SNMA 1SFOH 2O2LD 2UUCL 2QA4A 3HS0C 4EQOA 3KYHC 3KLWA 4FDBA 3DEPA 1CKOA 1LT4D 1A3UA 1IBLL 5FOBB 2I5LX 1FD7D 2VQEL 4A3KG 1QZHA 4RGOS 1XMOQ 1V1QA 2K28A 1RJTA 2JA7H 3SDZA 4A93B 3T51B 4BA2I 1TKWB 3WWVA 2ID0A 1NR4A 3MHBA 5CV6A 4DUZQ 1M4VA 5C4JB 2F0VA 1A2TA 3PF4A 1B2TA 1I4GA 2EE1A 4JI1L 1KL9A 5FLXc 2L12A 4KN7C 1CTMA 1C48A 5CBAE 4X66Q 1O7LA 1K28A 3VR5A 1CKNA 4R4QA 4HIMA 1X3QA 1AE2A 1SYDA 1F2MA 1JT8A 3K80C 1VQHA 1G91A 1HNZQ 3KDFA 5CV4A 2BH2A 3H3VC 5CV8A 4IUVA 3A7AB 5KYLA 3FHWA 2MQHA 1JJGA 1EWHA 4NXMQ 4QIWE 5H1SE 2A69D 4GLAC 3S1MH 2F0IA 2K75A 2RSNA 1I3QH 1VQ7A 1BO0A 1G8ZD 1ZEQX 1SMYD 1PTOF 3RZDB 2OTLA 3SEBA 1HQRD 1WTHA 1NAPA 3RZDH 4TSSA 1SEBD 3PUZA 2F0NA 1TS4A 4FP5D 1KXLA 4QIWB 3GD7A 4UPAA 1DGSA 1X3EA 2VS1A 4IPHA 1I50H 2CKZB 2A6ED 2WKCA 4K5VA 2XTIA 1EEID 3IFTA 1S5FD 3HOYB 1NTGA 3EIVA 1RCVD 3I8ZA 4C2MH 2UXBQ 5JVG3 3S2DH 4OONA 4JI0Q 5C44H 1K83H 3M9BA 1SNQA 1VS0A 5CGKA 4ID6A 1L0WA 4JG2A 2KBNA 1GXDC 3S2HH 2A68D 4Q0FA 4LF5L 3H0GH 5K5PA 3CKIB 5I2XA 3X3MA 4FF2A 1H9SA 1I6HH 4X6AH 3T56B 2A69C 3J7AV 2R61A 1X3FA 2DUDA 4C3JB 2IL8A 2JE6I 2NYZD 4Q5VA 1MKHA 1TU2B 2PQEA 3DUZA 3TRZA 2HIVA 3SVMA 1SMYC 4A3JB 2XRQD 4LWCA 2RBMA 4QQBX 1YNJD 3EJIA 3N52A 3C46A 1LTTD 1Y1WH 1SRUA 4DU9A 1EY7A 1Q8KA 2JA7G 1JJ2A 2A6EC 2NZ1D 4NPSA 3E9IA 3BYYB 5IIFA 1IKLA 4B9XA 1PH6A 3TQYA 3BDCA 1NSNS 2DY7A 4IO9A 2CW0D 1L0XB 2QEXA 4PZ7A 4YWLA 2R7FA 2NVYB 4HMJA 2Z6BA 4A3MB 5KNBA 5M5YB 2A68C 1PYWD 3CCVA 4LJZC 1EY6A 4O1NA 5C4XB 3NQTA 1PH7A 1WVLA 2JA9A 4HJ5A 1CT1D 3NSWA 2AKWB 1GOZA 2RCNA 4DNIA 1CSPA 1PA6A 4KKSA 1ZXTA 2MPMA 4DV1L 2FFKB 5J3BA 4JVZA 1P8LA 2F0JA 3BS1A 1HPCA 4JOIC 3NE5B 2KEEA 4L5TA 2F0EA 1GVPA 1YNJC 4QB4A 4DR2Q 1V1PB 4C3IH 1Q7YC 2F52A 1LM0A 1NR2A 2RDFA 4RCNA 1QJOA 1A63A 4IUQA 3F2BA 1IHZA 3I3CA 4CJ0B 4LFAL 3TDQA 2NVQB 2YTVA 3W2DA 4DV2Q 1A15A 2V4DA 3MEFA 4LF7Q 1K73C 2CW0C 3HOYG 2J4XA 1SJED 1E2VA 1MBYA 1OXSC 2NN6I 5C44G 2A74C 1T9HA 1EEFD 2MFIA 3GP7A 4K6LA 1WTWA 3M3YH 3S17B 1HFNA 1NBWA 1LUZA 2ZM6Q 5JAVA 1CHPD 1PDQA 1SJHD 2CWAA 3HOZH 1WCMB 3EQLC 1OXTA 4UY8C 5IYDH 3H0GG 1U4MA 2NN6H 1GUGA 4MN3A 4TRDA 1S3OA 3NPPA 5KRUA 3S9WA 4RG1A 3S15B 4IURA 1J5EL 4GOPB 2F0KA 4KY7A 1QUQB 1S5DD 1D7QA 5COYA 1XPOA 3E6ZX 3J80c 4C3JG 3KLSX 4A3EH 1G2TA 1Z6HA 3GO5A 4XTCS 5BR8Q 3PUVA 4PQXA 2AUJD 3BYTB 4EVOA 2I0QA 1KD1C 1BXTA 4ZCKA 3L0OA 1KDAA 4R4TA 5E3FA 1K3RA 2YU9H 2AHOB 3K5MA 3NP8A 1UEBA 1GHJA 3FPUB 2L11A 3D3RA 1VQFA 1Y1WG 4OL7A 4QMGA 1MJEA 1P16A 3SR1A 3ONAB 2KA7A 1SDFA 3PIP3 3W1GA 2LKVA 2R3ZA 1CHQD 4BY7B 3A55A 3HZXA 3GTQB 2B39A 4AH6A 4C3HH 2WIIB 1QG7A 1DZ1A 5CMDA 1H9MA 5M3MH 4L6TB 1R9TH 4B3SL 4POGA 2EY6A 1HNXL 5I6YA 1QOHA 2EY5A 4BY1H 1VDZA 4UP7A 1TS5A 2XIWA 3PUYA 1KNEA 2LMCB 4IOCA 2PW5A 4JI5Q 1GD7A 3F2CA 3OWEB 3RN2A 1YNND 3I70A 3SK8A 1X56A 4QGUA 2MO0A 2WINB 1PFNA 4DR7Q 1YNXA 1WTQA 1PZJD 1IYUA 2CH4W 5ISRA 1WI5A 5BN4A 3GTMB 4P73A 4ZQ3A 1X55A 3G6EA 3MFYA 1L2FA 3HKZE 5IP7H 1DOMA 2AMCB 1MI2A 4H0LC 2O4XA 2IPKD
chains in the Genus database with same CATH topology
2B8GA 3DEOA 3FDTA 4WJWA 3S1QB 4C3IG 4CBVA 5JEAH 1STBA 1CQFA 1RTOA 5I6WA 1RHPA 3HKZB 1V1PA 2EVBA 2E2JB 2BDOA 5FLXE 5IOCA 2PZUA 2OF1A 1W6KA 3DWPA 5C4HA 4I65A 1LTAD 1EU4A 4K14A 3BVZA 1DXMA 1PTOB 3C1EA 4FXDA 1I4PA 2QKIC 2NN6G 1YNNC 1PRTB 4ZUJA 2ENBA 2Q8TA 3HP3A 2JA6B 2Q8IB 5EKIA 4ZLTF 2N55A 5D3IB 1EY9A 1F9QA 2F1MA 3VA5A 1IKMA 4Z9CB 4QF4A 1D2BA 3GQBA 1HCZA 3VR4A 3SK6A 1TWCB 3R3OA 1K8OA 3E5SA 1CA5A 2D5DA 1B1ZA 4C3HG 1BCPD 3U9OA 1GHKA 4OGQC 3RD4A 3RMHA 2E76C 4K2LA 4IUNA 1LT6D 1TVXA 2HQEA 4U68A 1ET9A 2KVMA 1FNVA 2EYFA 5DM63 1T5EA 1SNCA 1PFMA 2JP1A 1STHA 4EQNA 1U9RA 3L3OC 1SE4A 1DONA 1FGBD 3JAML 4UDUC 3S14B 3UI2A 1D1KA 3L7ZC 2FMCA 1HUNA 5JEAG 2K1BA 3MAQA 1H9RA 4FXKC 1S4ZA 2FINB 2MJ8A 1EY4A 2ICIA 1BCPC 3K57A 2KECA 4WRDA 1U4RA 2LFNA 1LTGD 2AQ1B 2K01A 4HTHA 4QUCA 1TS2A 4A3KB 2NVTB 1B9MA 2DNCA 1HUMA 1JWUD 1H9KA 1VMPA 5HURA 4ODGA 2E74C 2HCIA 5E4XA 3EVQA 3HG9A 2BE5D 4ULLA 2MP1A 3M85A 5AFWA 4IUUA 1BQQT 2EYLA 4XIGS 2B2WA 3QG1A 2B2TA 4E6IA 2XWJB 2D9UA 4XYOA 1XTCD 2AWNA 2PMZB 3HEJA 2I46A 3FKIB 3A56A 3D8GA 4K2KA 1EY5A 4H44C 5BN3A 1BF4A 2NWGA 4A3BB 4V190 5LL6X 3WOEA 3LX0A 4DN4M 3VYTA 1Z7TA 3NWSA 4EGVA 2PCFB 5CORA 4DFAA 2K6AA 3FEWX 1G6ZA 3OMCA 2PO4A 3NUCA 4ME5A 4FXGC 2BE5C 2PZTA 3QIAA 5ELCA 1H9SB 2ZXRA 3J80E 3D4WA 3Q23A 3R2IA 5EQ0A 3Q0AA 5EJWA 1R4PB 3NBIA 1PFBA 3OW7A 4X3UA 2K7VA 5LHY1 3ZYYX 5I4DA 2F0DA 2F0PA 4ZUIA 1HTLD 3J7AF 1SFOB 1ZYRD 1BOSA 1QE6A 4M1UB 2HDMA 5BN5A 3TP8A 3J7YW 3C1FA 1Y69U 1D5ZC 3PUXA 2JA7B 3OWFA 1V43A 2PYKA 2NBFA 4ZYSA 1ESRA 1Q8IA 2AQ2B 1EQVA 4EQPA 1EQTA 2BA0A 1LT5D 3W3AA 1U4LA 3H09A 3VYRA 5CR3A 2L1BA 3T53B 3TP7A 1CA6A 4XQJA 1FNWA 2EJMA 3S1MB 1SYEA 2WKDA 4KY5A 3K6OA 3OHXC 1I3QB 2J7ZA 3JAME 1OXUA 4RGNA 4FO2A 1ZYRC 4HCEA 4TQUS 5IGCA 2B8FA 1PRTF 4NMZA 4DK0A 4RHRA 1JR0D 4LAAA 4L8JA 2HDLA 1BNZA 5IGDA 1I50B 4FF3A 1HRJA 1CFMA 3G6JB 1ET6A 2WV6D 4NDXA 2IT1A 4HR7B 5T1GA 1O78A 2D62A 4C2MB 3S2DB 3U9SA 3V96A 1OXXK 5C3XA 5C44B 2QILA 1K83B 2EJFC 3S2HB 4TKOB 4BWGB 3VA7A 1RTNA 3H0GB 3TBIB 2C9OA 1I6HB 2O5IC 4K5XA 2L4NA 3C3LA 4DXGA 5LL6S 2IX1A 2SEBD 3J81E 3HGBA 3A8JE 2RDGA 3OIQA 5D65A 1PMRA 1Y1WB 5DNFA 2F0HA 1DCZA 2RVLA 5FLXL 4F7XA 3DHQA 5A2QL 2PNRC 3TSSA 2I07B 3URYA 1F2ZA 4IFDI 3TZDA 1AN8A 1X32A 1AW7A 3LWEA 1SYGA 1T5XD 4RGTA 1GUTA 2XN9C 3CU7A 1M8AA 2H1EA 4G7HC 5EBDA 4IFDH 1WD0A 5KGUA 1W6JA 3OOCA 4C56C 5JJZA 1TY0A 2XSCA 4PMCA 5EPLA 4C3IB 2AQ3B 4FF1A 5KNDA 2AUKA 2GA4B 2KCNA 1JWMD 4RKLA 4CGYB 3BG3A 4RH6A 1GUOA 3KK7A 4X3TA 5C0XJ 4PNYA 1SBBB 3D6WA 3MXPA 2K5WA 4IUTA 4CKBA 5C3WA 3M3YB 4RCOA 3HOZB 1QNKA 1MD2D 2FJ2A 2F0QA 3FMCA 1TY2A 5G3LF 1SE2A 3VYSA 2LY7A 3MXUA 1IL8A 1LO5D 5IGEA 4A3EB 4CJ1B 4KKTA 4HSPA 1EYCA 1F9SA 1HTPA 3H6MA 3K58A 3SXHA 4GZYC 3AU7A 2YU9B 4NW2A 1QWYA 2PPBC 3S1RB 4NP5A 3VR2A 4IUPA 1BUVT 1LTRD 2B2VC 1I4RA 3MVVA 1WTPA 5F2DA 4WORA 4C3HB 4IQZA 3O13A 2JYOA 5M3MB 1PTOD 2PZWA 2B2UA 1PRTD 1R9TB 3D4RA 3NWTA 5FO8B 4R9WA 2K03A 3V05A 1STYA 4BY1B 3M7NA 3TZUA 4RHSA 5CV9A 4HEDA 3Q24A 2K32A 2WB1B 2RSOA 5E1FA 3KLRA 5IGBA 4IFDG 1B9NA 3SK4A 3SE0A 3RLFA 1EY0A 4M8AA 3Q6SA 3CRKC 2C5CA 1JICA 1JORA 3BDLA 3TP5A 2OT2A 2SNSA 2B2WC 1TS3A 1PTOC 5IGFA 1D5MC 1PRTC 5M5XB 5M3FB 4PV1C 1Y1VB 3SK5A 1AZPA 4X3SA 1RD9D 4C1NI 3EA6A 1JWSD 1AP0A 5A2QE 2M2LA 2B2YA 3D4DA 4MIUA 3J80L 1JE4A 1ML0D 3Q22A 3OMGA 2WAQB 1TR5A 2LS01 4X3KA 5D3DA 2FMMA 2X69A 3FRPB 1WD1A 4DAYA 3NBHA 4KHVA 4F87A 2NUCA 4JK1C 2WP8J 1AEXA 1KABA 2Q8RE 5J39A 3ITPA 5CC4A 2EOTA 2L5TA 2DN8A 4HAEA 1AFPA 3OSOA 5C4ZA 1KAAA 2BOSA 2Z8LA 3TN2A 3GTKB 3VR3A 4OO1I 1KNAA 3MTSA 2NB0A 1Q90A 3MA2B 4FNFA 5D14A 3NTKA 1II3A 4OO1H 2DNEA 2NVXB 4IALA 2NTTA 1LTID 3QOJA 2FHTA 3I4MB 5G3LD 3CQZB 4KHZA 1D6EC 1GUSA 1XX8A 4KJOA 1EL0A 3PMFA 5ELDA 1X3PA 1CZWA 2L0CA 1J8IA 1E0BA 1EYDA 2JXMB 1O7YA 1ILQA 1KDCA 4OHJA 3I72A 1A3VA 4RAUC 5IODA 1OO9B 3FVQA 5JPMC 3DMUA 3VYUA 1UEAB 2IJ0A 4N9PA 2NTSA 5CV5A 1B3AA 1TWFB 2SDFA 3AB9A 4XT3B 1B44D 1VMCA 2RKSA 1G291 1I6VC 3G7LA 5J22A 4O42A 3RUZA 5DAUA 2KQ3A 3OIPA 2VB2X 2CQAA 1D1IA 2PW7A 4KD3A 2JEBI 5C5LA 3J81L 2CVRA 3S1NB 1R4QB 1RODA 3S16B 4JBWA 2BDNA 2KCCA 2IX3A 2EYPA 3BDOA 1JOQA 1EIHA 4KD4A 1NCVA 5FK9C 3P20A 5ELFA 4K8JA 3CRLC 4KK7A 5KEEA 1RDPD 1WTXA 1Q1BA 4N9TA 4J6HA 2EZVA 1BBXC 5M5WB 1HFGA 4OO1G 1EYAA 1K8MA 3I73A 3K5OA 4DF7A 4RGMA 3KBXA 4KKUA 1LTBD 5EGTA 5ELEA 3IAYA 5KNCA 3ND8A 1CQVA 3NK9A 5E4WC 3I90A 1AZQA 1STAA 3K0YA 4K8IA 1MSGA 3TMEA 3KUPA 2XRSD 1F9PA 3PO3B 4IN3A 2OXPA 3NXWA 1TIID 2JA8B 4K6DA 3KF8A 1KTKA 3H94A 4DGZA 2E75C 1SE3A 4J8QA 1JC7A 1Q1EA 2A5HA 2A6HD 2CHBD 2K33A 1F77A 4C1NK 2E2IB 1UNSA 4CKCA 4ILWA 1IW7D 1SYBA 3DWQA 1PZKD 3T4AC 3L9AX 4R8IA 3F2UA 1EU3A 2EPBA 3MC0B 2RDHA 4BBRB 5CYUA 3R2TA 4G57A 2X6GA 3PO2B 5CV7A 2XWBB 5K36H 4G4KA 1LLRD 2EY1A 2RQXA 4CHTB 3D6CA 2QCPX 3HOXB 3NTHA 1Y8NB 4G7ZC 3M7GA 4AYBB 3GTOB 3X3NA 4DAPA 2A6HC 4DAVA 1SSOA 3GTPB 3MXNA 1HQMC 3GTJB 2EYHA 2DY8A 3K59A 1ESFA 2XVSA 4YIJA 1SAPA 5A35A 4U673 4HSVA 1HA6A 1IW7C 2VUMB 4RA8A 2X6LA 4XXEA 5IT9E 1XWEA 3FPPA 1EZ8A 3IKJA 1ZKOA 1I4HA 1A3TA 1HXYD 4A3IB 2B2UC 2ZT9C 2SOBA 5T1IA 3TP6A 4RFBA 4XQQA 2R7ZB 1TWHB 4A3GB 5I2YA 4OIKA 1STGA 3ERQA 4DK1A 4A3FB 3AMUA 4K5WA 1QNUA 4XT1B 4FVMA 4MHEA 2EJGC 1LV9A 2EYMA 3EFXD 2IX0A 1KDBA 4PMWA 2MUYA 1FR3A 1JCKB 2F0SA 1CK1A 1JQYD 1A6XA 3VR6A 2VXWA 1OXVA 1Q12A 3P1HA 1EZ6A 1F2YA 2BA1A 2K05A 4QUFA 5JEAJ 1LT3D 1O80A 3SHLA 5I9OA 1KLGD 4FF4A 1BR9A 3MXGA 3KLSA 2KHSA 4LK1C 1ICWA 2F0UA 3IL8A 5K36G 1Y8PB 2B2YC 2RA4A 1GJXA 1E2ZA 5EKKA 1CZGA 1SNDA 2F0WA 2ZXPA 3K5LA 1DOKA 2QEJC 3QWNA 4CJ2C 3IFDA 4B9WA 1DYQA 2KOLA 2F0LA 1J9OA 1BCPF 3D31A 2JA5B 2XNAC 4ZAIA 4ZKBB 4F88A 3OPOA 4WFN3 1CI3M 2Z4HA 1V8QA 2VB3X 5DEHA 2M00A 4G7OC 3QOLA 2H4OA 1B53A 1Z47A 3HOWB 5FO9B 4KV6A 1ENCA 5NUCA 2J0TD 2JEAI 2QF7A 1FNUA 2QDBA 1DD2A 3K5NA 2EDGA 5HGTA 3EROA 2K5QA 4PMBA 1VF5C 3I91A 4V0BA 5EPJA 1SYFA 1S5BD 2R92B 5C5MA 1QILA 1IYVA 4FYDA 2EXZA 4HMIA 1E2WA 1PXUA 2KEDA 1MSHA 4XYQA 4HN7A 4KY6A 3CHBD 1XYIA 2Y0SB 1VCIA 4P2CB 4UAIA 1EFID 5DM73 1JB3A 3A7LA 2R93B 1DJRD 2KJXA 1STEA 2ZXOA 4DNRB 3PV0A 5JVH3 3NQIA 4RKBA 3MEHA 1STNA 4LMQD 2F03A 5FKAC 1C4QA 2G9HD 1TWAB 1WTRA 5KIXA 5EPKA 1DOLA 2B2TC 3PUWA 1WTVA 2MGSA 1B4OA 4XDXA 4NKLA 4ZKCB 3P7JA 3E0JA 3HOVB 4B08A 2B63B 5M9OA 1GUWA 1I4QA 1SNOA 2SNMA 1F9RA 2Z4IA 1EIGA 4S3SA 5C0XI 2IW3A 1EWCA 1GUNA 4DNTB 1SNPA 2A73B 4Y7NB 3DWAA 4DA2A 3R93A 2N88A 5JOBA 1PTOH 1TWGB 3A54A 3BZDB 5C0XH 1JOKA 3RZOB 1ENAA 1ILPA 2E2DC 4HCSA 3H91A 4BS9A 1B50A 4BA1I 3ND9A 1FYCA 3BVGA 1DM0B 4L63B 2F3VA 3T16A 2EYJA 3A8IE 2HCCA 3A8KE 2TSSA 3MWYW 2G9DA 3R8BA 5C6AA 4XQNA 5IGGA 1VF7A 4DXFA 1S5ED 1CM9A 1EY8A 4KTAA 1C8CA 1D5XC 1F2LA 3PIO3 2JSOA 4BBSB 2BCOA 2EY2A 2F0OA 3DXJC 4ZRZA 5C3EB 3NTIA 1LACA 2YYZA 5EBCA 1WTOA 5KYIA 1SYCA 4H7BA 3WOFA 2B2VA 1A2UA 2E2HB 3DM1A 3I4LA 5JPNC 3WDNA 1JOOA 1ONLA 3T13A 1L0YB 1EOTA 2TMPA 4KMUC 3NHHA 4CKEA 3QO2A 1PZID 1TQOA 2K04A 4H13C 1Y8OB 3QB3A 4ABNA 4ZK9B 2IWHA 3V2TA 2ICEC 5IT9L 4A3DB 4IZ8A 3BVMA 1TT2A 1QB5D 2KUMA 2HUGA 1H9JA 4J1MA 3I4NB 1RKNA 2Z1CA 4OIJA 1BCPB 2F0MA 5FO7B 3MZ5A 3HRZC 2F0GA 5C0XG 2OEOA 2L9HA 5ELBA 2F3WA 1Q3LA 2F0TA 1LTSD 2MHVA 3HOUB 1UUPA 3GTLB 5CBEE 4F8MA 5J1ZA 3M4OB 3LNNA 4KI0A 1HHVA 1U4PA 5I9PA 1QCBD 3GV3A 1LABA 1O7ZA 3KBGA 1I4XA 3QJYA 4KN4C 1SXTA 4QCLA 2AWOA 3GV6A 1ENFA 2F4IA 4I7ZC 1V1OA 1HA5A 5TSSA 1PLFA 3C2PA 3M4YA 2F0FA 2K5DA 1S5CD 3K7AB 3LWUA 2D2CC 5EKLA 3MFGA 2WACA 4R8NA 1RF2D 1XXGA 1G2SA 3N6RA 1NUCA 3P75A 2M9VA 3GTGB 1MGSA 1BDOA 2L55A 2VNUD 2R6GA 1KLUD 4IFDJ 4RWSC 2EYOA 4KJNA 1UAPA 2O5JC 1SNMA 2O2LD 3HS0C 4EQOA 3DEPA 1LT4D 1A3UA 5FOBB 1FD7D 4RGOS 2K28A 1RJTA 3SDZA 4A93B 3T51B 4BA2I 1TKWB 2ID0A 1NR4A 3MHBA 5CV6A 1M4VA 5C4JB 2F0VA 1A2TA 1B2TA 1I4GA 2EE1A 2L12A 4KN7C 1CTMA 1C48A 5CBAE 1O7LA 3VR5A 1X3QA 1SYDA 1F2MA 1G91A 5CV4A 3H3VC 5CV8A 4IUVA 3A7AB 5KYLA 1EWHA 2A69D 2F0IA 2RSNA 1BO0A 1G8ZD 1ZEQX 1SMYD 1PTOF 3RZDB 3SEBA 1HQRD 1NAPA 4TSSA 1SEBD 3PUZA 2F0NA 1TS4A 4FP5D 4QIWB 3GD7A 2A6ED 2WKCA 4K5VA 1EEID 3IFTA 1S5FD 3HOYB 1RCVD 3I8ZA 5JVG3 1SNQA 5CGKA 4ID6A 1GXDC 2A68D 4Q0FA 5K5PA 3CKIB 5I2XA 3X3MA 4FF2A 1H9SA 3T56B 2A69C 3J7AV 2R61A 4C3JB 2IL8A 2JE6I 2NYZD 4Q5VA 1TU2B 2PQEA 3DUZA 3SVMA 4A3JB 1SMYC 2XRQD 2RBMA 1YNJD 3EJIA 3N52A 3C46A 1LTTD 4DU9A 1EY7A 2A6EC 2NZ1D 3BYYB 5IIFA 1IKLA 4B9XA 3BDCA 1NSNS 2DY7A 2CW0D 1L0XB 2NVYB 4HMJA 4A3MB 5KNBA 5M5YB 2A68C 1PYWD 4LJZC 1EY6A 4O1NA 5C4XB 3NQTA 1WVLA 1CT1D 3NSWA 1GOZA 4KKSA 1ZXTA 2MPMA 2FFKB 2F0JA 3BS1A 1HPCA 3NE5B 2KEEA 2F0EA 1YNJC 4QB4A 1V1PB 1NR2A 2RDFA 4RCNA 1QJOA 4IUQA 1IHZA 3I3CA 4CJ0B 3TDQA 2NVQB 3W2DA 1A15A 2V4DA 2CW0C 2J4XA 1SJED 1E2VA 1MBYA 1OXSC 2NN6I 2A74C 1EEFD 3GP7A 4K6LA 1WTWA 3S17B 1HFNA 5JAVA 1CHPD 1PDQA 1SJHD 1WCMB 3EQLC 1OXTA 1U4MA 2NN6H 1GUGA 4MN3A 4TRDA 3NPPA 5KRUA 3S9WA 3S15B 4IURA 2F0KA 4KY7A 1S5DD 5COYA 3E6ZX 4C3JG 3KLSX 1G2TA 1Z6HA 3GO5A 4XTCS 3PUVA 4PQXA 2AUJD 3BYTB 4EVOA 1BXTA 1KDAA 5E3FA 3K5MA 3NP8A 1GHJA 3FPUB 2L11A 3D3RA 4OL7A 4QMGA 3SR1A 3ONAB 2KA7A 1SDFA 3PIP3 2LKVA 2R3ZA 1CHQD 4BY7B 3A55A 3HZXA 3GTQB 2B39A 2WIIB 1QG7A 1DZ1A 5CMDA 1H9MA 4L6TB 2EY6A 5I6YA 1QOHA 2EY5A 1VDZA 1TS5A 2XIWA 3PUYA 1KNEA 2LMCB 2PW5A 3OWEB 1YNND 3I70A 3SK8A 2WINB 1PFNA 1WTQA 1PZJD 1IYUA 5ISRA 5BN4A 3GTMB 4ZQ3A 3MFYA 1DOMA 4H0LC 1MI2A 2O4XA 2IPKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYB A;  1KAA A;  5KGU A;  1KDB A;  1NUC A;  4S3S A;  5HGT A;  1SNQ A;  3V2T A;  3ERO A;  1STH A;  4NMZ A;  4EQN A;  5CGK A;  5IGC A;  4ID6 A;  3P75 A;  4PMB A;  2F0S A;  1SNP A;  3OMC A;  1U9R A;  4LAA A;  3NUC A;  4IZ8 A;  4ME5 A;  5J22 A;  1TT2 A;  2EYP A;  5IGD A;  2PZT A;  5E1F A;  5JOB A;  1SYF A;  5IGB A;  1JOQ A;  1STB A;  3P1H A;  5K5P A;  4KD4 A;  5C5L A;  2EYO A;  4J1M A;  3SK4 A;  4KJN A;  4PMC A;  5I6W A;  1JOK A;  4NDX A;  1EZ6 A;  1F2Y A;  1II3 A;  1SNM A;  5C5M A;  1ENA A;  5JAV A;  3D4W A;  4K8J A;  1RKN A;  2EXZ A;  4HMI A;  4EQO A;  5KEE A;  4G57 A;  2F0M A;  2F3V A;  4IAL A;  3SHL A;  5I9O A;  3T16 A;  4RKL A;  5C3X A;  2EYJ A;  1A3U A;  5IOC A;  4N9T A;  5CV7 A;  4J6H A;  2PZU A;  4TRD A;  2OF1 A;  1EY0 A;  3MZ5 A;  2PQE A;  2F0G A;  2SNM A;  1EY4 A;  4PNY A;  2OEO A;  5KRU A;  3S9W A;  2EY1 A;  2KHS A;  2RBM A;  3QOJ A;  4KY6 A;  1EYA A;  5C4H A;  3EJI A;  5C6A A;  4I65 A;  2F0K A;  4KY7 A;  2F3W A;  4K14 A;  5IGG A;  3MXP A;  4DF7 A;  4WRD A;  3D6C A;  1EY8 A;  2F0U A;  3C1E A;  2F0D A;  3MHB A;  1JOR A;  2F0P A;  5CV6 A;  5EGT A;  4ZUI A;  4KTA A;  3BDL A;  4HTH A;  5C3W A;  3TP5 A;  2F0V A;  2SNS A;  2F0T A;  1A2T A;  4DU9 A;  4ZUJ A;  1EY7 A;  4EVO A;  2ENB A;  5EKK A;  4K5X A;  1SND A;  2F0W A;  4F8M A;  2EY2 A;  2F0Q A;  4KJO A;  1KDA A;  5IGF A;  5E3F A;  5J1Z A;  5IIF A;  3NP8 A;  3PMF A;  4B9X A;  2EYH A;  2F0O A;  3BDC A;  3TP8 A;  1NSN S;  5HUR A;  4ODG A;  4YIJ A;  3NK9 A;  3C1F A;  1SYD A;  1F2M A;  1EYD A;  4OL7 A;  4QMG A;  3EVQ A;  3SK5 A;  1STA A;  5I9P A;  3SR1 A;  4K8I A;  3TME A;  3OWF A;  4B9W A;  5CV4 A;  2PYK A;  2EYL A;  5CV8 A;  2LKV A;  4HMJ A;  2F0L A;  5KYL A;  4RKB A;  5IGE A;  3D4D A;  3HZX A;  1EY9 A;  4MIU A;  1KDC A;  1STN A;  3MEH A;  1EZ8 A;  3VA5 A;  1EQV A;  1EYC A;  1EY6 A;  1A3V A;  4QF4 A;  2OXP A;  1SYC A;  4EQP A;  5KYI A;  3NXW A;  2F0I A;  3H6M A;  3NQT A;  4H7B A;  4E6I A;  3SXH A;  2EY6 A;  3SK6 A;  5IOD A;  2F0H A;  1A3T A;  3OMG A;  3R3O A;  5I6Y A;  4K6D A;  1A2U A;  2EY5 A;  3E5S A;  2M00 A;  5DEH A;  1TR5 A;  4F7X A;  5KIX A;  4NP5 A;  2SOB A;  3DMU A;  3HEJ A;  2PW5 A;  3D8G A;  4N9P A;  5CR3 A;  3U9O A;  4K2K A;  1EY5 A;  3MVV A;  3QOL A;  3TP6 A;  3DHQ A;  4DGZ A;  5CV5 A;  2F0F A;  4KHV A;  4K2L A;  2F0J A;  2F0N A;  4IUN A;  1JOO A;  4KV6 A;  1ENC A;  1F2Z A;  2NUC A;  5F2D A;  5NUC A;  3SK8 A;  3TP7 A;  4WOR A;  2RKS A;  5EKL A;  1AEX A;  3T13 A;  4NKL A;  2F0E A;  2HQE A;  2WAC A;  3LX0 A;  4K5V A;  4R8N A;  1SYE A;  1KAB A;  2PZW A;  4QB4 A;  3ERQ A;  1STG A;  1SYG A;  3RUZ A;  3ITP A;  5CC4 A;  2EYF A;  4KY5 A;  5ISR A;  5J39 A;  3NHH A;  4ZQ3 A;  5DAU A;  2KQ3 A;  4K5W A;  1SNC A;  1TQO A;  5M9O A;  2RDF A;  1STY A;  2QDB A;  1SNO A;  2PW7 A;  4KD3 A;  4DFA A;  2EYM A;  3QB3 A;  3OSO A;  1IHZ A;  2O4X A;  5CV9 A;  5C4Z A; 
#chains in the Genus database with same CATH topology
 2B8G A;  1CKM A;  3DEO A;  3FDT A;  4WJW A;  3S1Q B;  4C3I G;  5E7N A;  4CBV A;  5JEA H;  3PQI A;  1ASZ A;  2ASB A;  1K3B C;  1STB A;  1CQF A;  2HT1 A;  1QVC A;  1RTO A;  5I6W A;  1RHP A;  1WFQ A;  4TVA B;  4L5S A;  3HKZ B;  1E22 A;  1V1P A;  2EVB A;  2E2J B;  1NY4 A;  3TEH B;  2BDO A;  4DV0 L;  5FLX E;  5M5X H;  1E1T A;  5IOC A;  5M3F H;  2PZU A;  2OF1 A;  1W6K A;  3DWP A;  5C4H A;  3T1H L;  4I65 A;  3HOZ G;  1LTA D;  1EU4 A;  4K14 A;  3BVZ A;  1DXM A;  4X65 L;  1PTO B;  5IYD G;  3C1E A;  4FXD A;  1VQI A;  1VQJ A;  1I4P A;  2QKI C;  4DAM A;  4AQY Q;  2NN6 G;  1YNN C;  4A75 A;  1PRT B;  4QJF A;  3RR5 A;  4JBK A;  1SRO A;  4ZUJ A;  1YVC A;  2ENB A;  4GN5 A;  4PG3 A;  2Q8T A;  2KHJ A;  1YJN A;  4JI6 L;  3HP3 A;  4B3M L;  3B6Y A;  4YCW A;  2JA6 B;  4LF4 L;  2ZJR A;  2Q8I B;  2KEN A;  5EKI A;  4ZLT F;  4LFB L;  3UDF A;  2N55 A;  3G4S A;  4GOP A;  5D3I B;  1EY9 A;  5GRO A;  1F9Q A;  2F1M A;  3VA5 A;  4IOA A;  4DR4 Q;  1IKM A;  4Z9C B;  3UDX A;  3ICE A;  4QF4 A;  3RNU A;  1D2B A;  3GQB A;  1HCZ A;  3VR4 A;  3SK6 A;  4HIK A;  1TWC B;  3U50 C;  3R3O A;  3CCR A;  1K8O A;  3E5S A;  1CA5 A;  2D5D A;  1C7Y A;  3J81 c;  4OX9 Q;  1B1Z A;  4C3H G;  1BCP D;  4JV5 L;  5M3M G;  3U9O A;  5AJ3 L;  2UU9 Q;  3T1Y L;  1GHK A;  4OGQ C;  3GTK H;  3RD4 A;  3RMH A;  2E76 C;  4K2L A;  4IUN A;  1LT6 D;  1TVX A;  4BY1 G;  2HQE A;  4DV4 L;  4U68 A;  4OEM B;  1IBL Q;  1ET9 A;  2KVM A;  2VQE Q;  1FNV A;  2EYF A;  5DM6 3;  1T5E A;  4IPG A;  2F4V L;  2OWO A;  2GVA A;  1SNC A;  1PFM A;  2NVX H;  1H95 A;  2JP1 A;  1STH A;  4EQN A;  4JI1 Q;  1U9R A;  3L3O C;  5IP7 G;  4HJ8 A;  1SE4 A;  1DON A;  1FGB D;  3JAM L;  4UDU C;  1YJ9 A;  3I4M H;  3UI2 A;  3S14 B;  1D1K A;  3CQZ H;  3L7Z C;  1VQP A;  4N8F A;  2FMC A;  1HUN A;  5JEA G;  2P5Z X;  2K1B A;  3MAQ A;  1H9R A;  4FXK C;  1S4Z A;  2FIN B;  2MJ8 A;  1EY4 A;  2ICI A;  5IYC H;  1BCP C;  3HKZ G;  3K57 A;  2KEC A;  1XMQ L;  4JYA Q;  2CQO A;  4WRD A;  1U4R A;  2F3I A;  2LFN A;  1LTG D;  3KF6 B;  2AQ1 B;  1VQG A;  2K01 A;  5M3F G;  4HTH A;  4QUC A;  1TS2 A;  4A3K B;  1CUK A;  2NVT B;  2YTX A;  1B9M A;  2Q2T A;  2DNC A;  3JAM i;  1HUM A;  1JWU D;  2Z6K A;  1CKN B;  1HZA A;  1H9K A;  2UUA L;  1VMP A;  5HUR A;  4ODG A;  2E74 C;  2HCI A;  5E4X A;  4A76 A;  3E3X A;  3EVQ A;  3HG9 A;  2BE5 D;  4ULL A;  2MP1 A;  3M85 A;  5FLM H;  1SN8 A;  3KDF B;  5IWA L;  1TWF H;  3CCQ A;  1YHQ A;  1V9P A;  5AFW A;  4IUU A;  1BQQ T;  2EYL A;  1K8A C;  1PH3 A;  2WAQ G;  4XIG S;  2B2W A;  3KJP A;  1AE3 A;  3QG1 A;  2B2T A;  4E6I A;  2XWJ B;  2D9U A;  4XYO A;  1XTC D;  1ICF B;  3SGI A;  2AWN A;  2PMZ B;  3HEJ A;  2I46 A;  3FKI B;  3A56 A;  3D8G A;  4K2K A;  1EY5 A;  3S1N H;  2ZJQ A;  4JBM A;  4H44 C;  5BN3 A;  3S16 H;  1BF4 A;  4JW0 A;  2NWG A;  4DV6 Q;  4A3B B;  4V19 0;  5LL6 X;  3WOE A;  4B3T Q;  3U58 A;  4A3B H;  2K50 A;  3LX0 A;  3DM3 A;  3PGZ A;  4DN4 M;  3VYT A;  4GLX A;  1Z7T A;  4LFC L;  4UP9 A;  3NWS A;  4EGV A;  2PCF B;  1B8A A;  4DV3 Q;  5COR A;  4DFA A;  2K6A A;  1HR0 L;  3FEW X;  1K9M C;  1YIT A;  2Q2U A;  3UE0 A;  1G6Z A;  4IPC A;  2C35 B;  3CW2 C;  2K52 A;  5M5W H;  3OMC A;  2PO4 A;  3NUC A;  4ME5 A;  4FXG C;  2BE5 C;  2PZT A;  1PH2 A;  1K0S A;  3QIA A;  5ELC A;  1XJV A;  3TRE A;  1H9S B;  2ZXR A;  3J80 E;  1NE3 A;  3D4W A;  5FJ8 H;  4DPG A;  1KC8 C;  1N9W A;  3Q23 A;  3R2I A;  5EQ0 A;  3Q0A A;  1GM5 A;  5EJW A;  1XNR Q;  3I4M G;  1R4P B;  3H15 A;  3NBI A;  1PFB A;  3A74 A;  3OW7 A;  4LUZ A;  4X3U A;  2K7V A;  5LHY 1;  3ZYY X;  5LMU Q;  5I4D A;  2F0D A;  2F0P A;  4ZUI A;  2OQK A;  1HTL D;  4DV1 Q;  3J7A F;  1SFO B;  1ZYR D;  1BOS A;  1QE6 A;  4M1U B;  5IYC G;  2HDM A;  2JA8 H;  1N33 L;  5BN5 A;  3TP8 A;  3J7Y W;  3C1F A;  4MNO A;  1Y69 U;  1D5Z C;  5IY0 A;  3PUX A;  1PH1 A;  2JA7 B;  3OWF A;  1V43 A;  2PYK A;  2NBF A;  4ZYS A;  1ESR A;  1Q8I A;  2AQ2 B;  2HQL A;  1EQV A;  3KF6 A;  4EQP A;  1EQT A;  4LFA Q;  2H5X A;  2PNH A;  5FLM G;  1UWV A;  2BA0 A;  1LT5 D;  3W3A A;  1U4L A;  3H09 A;  2E2I H;  3VYR A;  4GKK L;  4YY3 L;  2HIX A;  3W1B A;  5CR3 A;  2L1B A;  1YHB A;  3T53 B;  2D0O A;  3CC2 A;  3TP7 A;  1CA6 A;  4XQJ A;  1FNW A;  5GQO A;  1PH8 A;  2EJM A;  3S1M B;  1SYE A;  2WKD A;  4BBR H;  3FKI G;  4KY5 A;  3K6O A;  4PZ8 A;  1C0A A;  3OHX C;  1I3Q B;  1AH9 A;  2J7Z A;  3JAM E;  1OXU A;  1VQK A;  2JQO A;  1FL0 A;  4FO2 A;  1ZYR C;  4RGN A;  4A3B G;  1WYD A;  2OTJ A;  3PO2 H;  4HCE A;  4TQU S;  5IGC A;  2B8F A;  1PRT F;  1X6O A;  4NMZ A;  4DK0 A;  4RHR A;  1JR0 D;  3AQQ A;  1GO3 E;  1A8V A;  4LAA A;  4L8J A;  2HDL A;  4JI2 L;  1WJJ A;  2MO1 A;  1PHJ A;  1BNZ A;  5IGD A;  1I50 B;  4FF3 A;  3H3V I;  1HRJ A;  5HGQ A;  3HOX H;  1CFM A;  3ERS X;  3G6J B;  2ZTD A;  3E9H A;  1ET6 A;  2WV6 D;  4NDX A;  4I7A A;  3GTO H;  2IT1 A;  4HR7 B;  4DV7 Q;  5T1G A;  4A3L H;  1O78 A;  2D62 A;  4C2M B;  3S2D B;  3GTP H;  3GTJ H;  3U9S A;  3V96 A;  1OXX K;  5C3X A;  5C44 B;  2QIL A;  3H3V H;  1K83 B;  2EJF C;  4DR3 Q;  3S2H B;  2I5M X;  4TKO B;  3PF5 A;  4B3S Q;  4BWG B;  5FJ8 G;  4KLK A;  1HNX Q;  2E5L L;  2VUM H;  3FP9 A;  5GAD C;  3VA7 A;  1RTN A;  3H0G B;  1Z9F A;  3TBI B;  2C9O A;  1VQD A;  2OCE A;  1I6H B;  3CC4 A;  3VDY A;  2O5I C;  4K5X A;  2L4N A;  3C3L A;  5ELN A;  2IY5 B;  4DXG A;  5LL6 S;  4A3I H;  1EIF A;  4CDE C;  2IX1 A;  2SEB D;  2E8G A;  1LTL A;  3J81 E;  3HGB A;  3A8J E;  4HJ9 A;  2RDG A;  1YEZ A;  2R7Z H;  3OIQ A;  2JA8 G;  1EUJ A;  5D65 A;  1TWH H;  4A3G H;  2NZH A;  1PMR A;  5GAH C;  1Y1W B;  1I94 L;  5DNF A;  4DR5 L;  4A3F H;  2F0H A;  1DCZ A;  2RVL A;  5FLX L;  4F7X A;  3PIO A;  2D0P A;  3DHQ A;  5A2Q L;  2PNR C;  3TSS A;  1VQM A;  2I07 B;  3PCO B;  3URY A;  1F2Z A;  4IFD I;  3TZD A;  1AN8 A;  4GNX A;  1X32 A;  1AW7 A;  3LWE A;  1SYG A;  1T5X D;  2PI2 E;  2N3S A;  4RGT A;  1GUT A;  3T1H Q;  2XN9 C;  3CU7 A;  1BBW A;  1M8A A;  2H1E A;  4JC0 A;  3CCL A;  3Q8D A;  4IJH A;  4ME3 A;  4G7H C;  5EBD A;  4IFD H;  1WD0 A;  5KGU A;  4BBR G;  1W6J A;  3OOC A;  4C56 C;  5JJZ A;  3CD6 A;  1TY0 A;  4JI6 Q;  4B3M Q;  3PO2 G;  2XSC A;  4PMC A;  4LF4 Q;  5EPL A;  4X64 L;  4IJL A;  4C3I B;  5JJK A;  2AQ3 B;  5IE8 A;  4FF1 A;  5KND A;  2AUK A;  4LFB Q;  2GA4 B;  2KCN A;  1JWM D;  4RKL A;  4CGY B;  3BG3 A;  3HOX G;  1FJG L;  4RH6 A;  1GUO A;  3KK7 A;  4X3T A;  5C0X J;  4PNY A;  1SBB B;  1MIU A;  4A3L G;  3D6W A;  2VQF L;  4N8X 1;  3MXP A;  2K5W A;  3E0E A;  4IUT A;  4CKB A;  2JA5 H;  5C3W A;  4HJ7 A;  4JV5 Q;  3M3Y B;  3AFQ A;  3T1Y Q;  4GOP C;  1XMO L;  1HZ9 A;  1SE8 A;  1K0R A;  4RCO A;  3HOZ B;  1QNK A;  1MD2 D;  2FJ2 A;  2F0Q A;  3FMC A;  2VUM G;  1XNQ L;  1TY2 A;  4DUZ L;  5G3L F;  1IZ6 A;  4DV4 Q;  1SE2 A;  1SLJ A;  3VYS A;  2LY7 A;  1SMX A;  2F4V Q;  3MXU A;  1XPR A;  1IL8 A;  1LO5 D;  5IGE A;  4A3I G;  4A3E B;  1E3P A;  3TS2 A;  4CJ1 B;  4KKT A;  2A1A A;  4HSP A;  1EYC A;  1F9S A;  1HTP A;  3H6M A;  3K58 A;  3SXH A;  4GZY C;  3AU7 A;  2YU9 B;  4NW2 A;  1QWY A;  3F2D A;  2PPB C;  3S1R B;  3NEN A;  4NP5 A;  3VR2 A;  4A3G G;  1X65 A;  4IUP A;  1GKH A;  1BUV T;  1LTR D;  3S1R H;  2B2V C;  1I4R A;  3MVV A;  3UDI A;  1X54 A;  1WTP A;  1IL2 A;  4A3F G;  1RIP A;  5F2D A;  4WOR A;  1IYJ B;  2WB1 E;  4IQZ A;  4C3H B;  3O13 A;  2JYO A;  5M3M B;  1PTO D;  4WJ3 M;  2PZW A;  2ES2 A;  2R92 H;  1NNX A;  1PRT D;  2B2U A;  1R9T B;  3D4R A;  3NWT A;  4K0K L;  5FO8 B;  4R9W A;  2K03 A;  1XMQ Q;  3V05 A;  4L5R C;  1STY A;  4BY1 B;  3M7N A;  4DR6 L;  3TZU A;  4RHS A;  5CV9 A;  5EAY A;  1W3S A;  4HED A;  3Q24 A;  2K32 A;  2WB1 B;  3J81 j;  2UUA Q;  2RSO A;  4L5Q A;  5E1F A;  3KLR A;  5IGB A;  4IFD G;  1B9N A;  3SK4 A;  1N8R C;  2GN5 A;  1VQE A;  5IWA Q;  3SE0 A;  2R93 H;  2EIF A;  3RLF A;  2DJF C;  1EY0 A;  1BKB A;  1NMF A;  2Z6K C;  4M8A A;  3Q6S A;  4JI8 L;  3CRK C;  2C5C A;  2V1C C;  2N49 A;  1X3G A;  3BZC A;  1JIC A;  4JI3 L;  1JOR A;  1JE5 A;  3BDL A;  3TP5 A;  2OT2 A;  2PI2 A;  2SNS A;  2XGT A;  1IBM L;  2B2W C;  1TS3 A;  1PTO C;  5IGF A;  2JJQ A;  1D5M C;  1Q82 C;  1TWA H;  1PRT C;  5M5X B;  1JJC B;  1A62 A;  2JA5 G;  2WAQ E;  5M3F B;  1B3Q A;  4PV1 C;  1Y1V B;  3SK5 A;  1AZP A;  4X3S A;  1Y1V H;  1RD9 D;  4C1N I;  4LFC Q;  4NXN L;  3EA6 A;  1JWS D;  1AP0 A;  5A2Q E;  2M2L A;  2B2Y A;  3K8A A;  1FVI A;  3D4D A;  4MIU A;  1HR0 Q;  3J80 L;  1JE4 A;  1ML0 D;  3Q22 A;  3OMG A;  4HIO A;  3HOV H;  2B63 H;  4NB3 A;  2WAQ B;  1TR5 A;  2LS0 1;  3ULJ A;  4X3K A;  5D3D A;  2UXC L;  4A3E G;  2FMM A;  2X69 A;  3FRP B;  1WD1 A;  4DAY A;  3ZJY C;  3NBH A;  5IT9 c;  4KHV A;  4F87 A;  4GN4 B;  1EOV A;  2NUC A;  1EQR A;  4JK1 C;  4Y7N H;  2WP8 J;  1AEX A;  4AIM A;  3CPW A;  1KAB A;  1TWG H;  2Q8R E;  5J39 A;  3ITP A;  4P71 A;  5CC4 A;  3RZO H;  2EOT A;  2N78 A;  2L5T A;  1VQL A;  2DN8 A;  4HAE A;  3J80 i;  1C9O A;  1IBK Q;  1PVO A;  3OSO A;  1AFP A;  5C4Z A;  1KAA A;  2BOS A;  2Z8L A;  3TN2 A;  2R92 G;  4DUY L;  3GTK B;  3VR3 A;  4OO1 I;  1KNA A;  3MTS A;  2UUC Q;  2NB0 A;  1Q90 A;  3MA2 B;  1N33 Q;  4FNF A;  1VQB A;  5D14 A;  3NTK A;  1II3 A;  4X62 L;  4OO1 H;  2DNE A;  2NVX B;  4BBS H;  2WB1 G;  3L2P A;  3M4Q A;  2Y0S G;  4IAL A;  4GKJ L;  2NTT A;  4PZ6 A;  1M1K C;  1LTI D;  3QOJ A;  5C3E H;  4DKA C;  2QW7 A;  2R93 G;  3K81 C;  4GKK Q;  2FHT A;  3I4M B;  5G3L D;  3CQZ B;  4KHZ A;  1D6E C;  4R1J A;  1GUS A;  1XX8 A;  3CP0 A;  1UE6 A;  4KJO A;  1EL0 A;  3DLL A;  1VQO A;  3PMF A;  2E2H H;  5ELD A;  1X3P A;  1CZW A;  2L0C A;  1J8I A;  1E0B A;  1EYD A;  2JXM B;  1O7Y A;  2A19 A;  4LW1 A;  4DK6 C;  1ILQ A;  1KDC A;  2R7D A;  4OHJ A;  3I72 A;  1A3V A;  4RAU C;  1Y1V G;  5IOD A;  1OO9 B;  3I55 A;  1VQ4 A;  4JI2 Q;  3FVQ A;  5JPM C;  3TS0 A;  3G48 A;  3DMU A;  3D0F A;  3VYU A;  1UEA B;  1QZG A;  2IJ0 A;  4N9P A;  1MJC A;  2NTS A;  5CV5 A;  1B3A A;  1TWF B;  2OQ0 A;  2SDF A;  3AB9 A;  3HOV G;  4XT3 B;  1B44 D;  4A3D H;  1VMC A;  2RKS A;  4B3R L;  1G29 1;  1I6V C;  4MZ9 A;  4YWK A;  4JI5 L;  1VQ6 A;  3G7L A;  5J22 A;  4O42 A;  3RUZ A;  4WJ4 A;  2LXJ A;  5DAU A;  2KQ3 A;  2IHF A;  3I4N H;  2E5L Q;  3OIP A;  2VB2 X;  2CQA A;  4LF5 Q;  1D1I A;  1L1O B;  2PW7 A;  4KD3 A;  2JEB I;  5C5L A;  3J81 L;  2CVR A;  3S1N B;  3UDG A;  1R4Q B;  1ROD A;  3S16 B;  3CME A;  4JI4 L;  5GAG C;  4JBW A;  2BDN A;  2KCC A;  2RHS B;  1K8G A;  2IX3 A;  2EYP A;  3BDO A;  4P74 A;  1JOQ A;  1EIH A;  3OTO L;  2ZJP A;  4KD4 A;  1NCV A;  5FK9 C;  3P20 A;  2A8V A;  5ELF A;  1HR0 W;  3HOU H;  3GTL H;  4K8J A;  3CRL C;  1W2B A;  3MXN B;  4KK7 A;  5KEE A;  2ZTE A;  2EXD A;  2YTY A;  3M4O H;  2Z9H A;  1RDP D;  1WTX A;  4RMF A;  1Q1B A;  4N9T A;  4J6H A;  2EZV A;  4HID A;  1BBX C;  4YWM A;  5M5W B;  4DR5 Q;  1HFG A;  4OO1 G;  1EYA A;  1K8M A;  3I73 A;  3K5O A;  3J81 i;  4DF7 A;  4RGM A;  3KBX A;  4KKU A;  1LTB D;  1E7Z A;  4LF8 L;  5EGT A;  5ELE A;  3IAY A;  3JC6 6;  2K14 A;  2Z0S A;  5KNC A;  5C3E G;  3CC7 A;  3ND8 A;  1CQV A;  3EN2 A;  1N34 L;  2DJG C;  3NK9 A;  5E4W C;  3I90 A;  3BU2 A;  1AZQ A;  1STA A;  3K0Y A;  4K8I A;  1MSG A;  3TME A;  3CMA A;  3K7A H;  4LUO A;  3KUP A;  2XRS D;  4LNQ A;  1F9P A;  3A5Z B;  1RL2 A;  3PO3 B;  4IN3 A;  2OXP A;  1S72 A;  3NXW A;  3PO3 H;  3AYH B;  1TII D;  4OWW B;  2JA8 B;  4K6D A;  1YIJ A;  2KCM A;  3KF8 A;  5L37 A;  1KTK A;  1U0L A;  3H94 A;  4DGZ A;  4X64 Q;  2E75 C;  4YCU A;  3GTG H;  5IP9 H;  1SE3 A;  4J8Q A;  2Q2H A;  1JC7 A;  1Q1E A;  4GNX B;  2A5H A;  2A6H D;  3PIP A;  5LMN L;  2CHB D;  2K33 A;  1FJG Q;  4MTN A;  1VQC A;  3J7Z C;  1F77 A;  4C1N K;  2E2I B;  2VQF Q;  4A3D G;  2ALY B;  1UNS A;  4CKC A;  4ILW A;  1IW7 D;  1SR3 A;  1SYB A;  3DWQ A;  1PZK D;  3T4A C;  3L9A X;  4R8I A;  3I4N G;  1HZC A;  1KAW A;  3F2U A;  4O2D A;  1EU3 A;  2EPB A;  4A93 H;  1XNQ Q;  4OWX B;  3MC0 B;  2RDH A;  4BBR B;  4GLV B;  5C4J H;  2RHQ B;  5CYU A;  4AYB E;  1J5E Q;  3R2T A;  4G57 A;  1Q81 C;  1A0I A;  2X6G A;  3PO2 B;  1L1O A;  5CV7 A;  1N36 L;  2XWB B;  5K36 H;  4G4K A;  1LLR D;  2EY1 A;  3HOU G;  2RQX A;  3BZK A;  4CHT B;  2CWP A;  1N32 L;  3D6C A;  2QCP X;  3HOX B;  3NTH A;  4P72 A;  1Y8N B;  4YCV A;  4G7Z C;  3M7G A;  3ER0 A;  4AYB B;  3GTO B;  3X3N A;  4DAP A;  4JYA L;  2A6H C;  4DAV A;  1SSO A;  3GTP B;  3MXN A;  1HQM C;  3M4P A;  2EYH A;  3GTJ B;  2DY8 A;  3K59 A;  1ESF A;  4YHH L;  2XVS A;  3EBE A;  4YIJ A;  4LF9 L;  1SAP A;  1EWI A;  5A35 A;  4A4I A;  4U67 3;  4HSV A;  1HA6 A;  4K0K Q;  2UUB L;  1EQQ A;  1IW7 C;  2EQS A;  2VUM B;  4RA8 A;  2X6L A;  4DR6 Q;  4XXE A;  5IT9 E;  1XWE A;  3FPP A;  1EZ8 A;  1KIX A;  3IKJ A;  1ZKO A;  1CSQ A;  1I4H A;  3A5U A;  3PSI A;  1A3T A;  1YZ6 A;  3HOY H;  1HXY D;  4A3I B;  2B2U C;  2ZT9 C;  2CH4 A;  2SOB A;  1JMC A;  5T1I A;  3TP6 A;  3PO3 G;  4RFB A;  2JK8 A;  4XQQ A;  2R7Z B;  2HHH L;  1TWH B;  4A3G B;  4QL5 A;  1O7I A;  5I2Y A;  3ERQ A;  1STG A;  4OIK A;  4JI7 L;  4DK1 A;  1NMG A;  4JI8 Q;  4A3F B;  3AMU A;  4K5W A;  5IP9 G;  2K4K A;  4DV6 L;  4DV5 L;  1QNU A;  4XT1 B;  4FVM A;  4MHE A;  4B3T L;  2EJG C;  3W5O A;  4JI3 Q;  1LV9 A;  2EYM A;  4C3J H;  2UXD L;  3EFX D;  2IX0 A;  1KDB A;  1PFS A;  3HKS A;  4PMW A;  1IBM Q;  4EQ5 A;  2MUY A;  4A3J H;  1FR3 A;  1JCK B;  2F0S A;  4DR1 L;  2VZA A;  1CK1 A;  4DV3 L;  1JQY D;  1A6X A;  3VR6 A;  2VXW A;  1OXV A;  1VQN A;  1Q12 A;  3P1H A;  4DV0 Q;  2FXQ A;  1EZ6 A;  1F2Y A;  2BA1 A;  2K05 A;  4OEL B;  4QUF A;  3NEM A;  1B7Y B;  5JEA J;  4NXN Q;  3STB D;  1LT3 D;  4A93 G;  1O80 A;  3SHL A;  1OTC A;  5I9O A;  4X65 Q;  1KLG D;  4FF4 A;  3CPF A;  2VL6 A;  1BR9 A;  3MXG A;  3KLS A;  3OYY A;  2KHS A;  1UE7 A;  4LK1 C;  3K0X A;  1U5K A;  1J6Q A;  1HNW L;  4KHP L;  2NVY H;  1ICW A;  4A3M H;  4LF6 L;  2F0U A;  1XNR L;  3IL8 A;  2UXC Q;  5M5Y H;  1E24 A;  1Y8P B;  5K36 G;  2B2Y C;  2RA4 A;  1GJX A;  1E2Z A;  5EKK A;  5C4X H;  1CZG A;  1SND A;  2F0W A;  2ZXP A;  5LMU L;  3K5L A;  1DOK A;  2QEJ C;  3QWN A;  3LGJ A;  4CJ2 C;  3IFD A;  4B9W A;  4AYB G;  1DYQ A;  4A3C H;  2KOL A;  3CCU A;  4Y52 H;  1IXR A;  2F0L A;  1J9O A;  1BCP F;  3D31 A;  2JA5 B;  2XNA C;  4ZAI A;  4ZKB B;  4IPD A;  4F88 A;  5AJ3 Q;  4DUY Q;  4P75 A;  3OPO A;  4WFN 3;  1CI3 M;  2Z4H A;  1V8Q A;  2VB3 X;  5DEH A;  2M00 A;  4G7O C;  2JN4 A;  3STB C;  3QOL A;  4DAY B;  3NBH B;  2B3G A;  2H4O A;  1B53 A;  1Z47 A;  3U4Z A;  5FO9 B;  4X62 Q;  2NVQ H;  3HOW B;  4KV6 A;  1ENC A;  1KRT A;  3HOW H;  5NUC A;  4X66 L;  2QGQ A;  4GKJ Q;  3KJO A;  1MHW C;  2J0T D;  2JEA I;  2DGY A;  2QF7 A;  2I5H A;  1HNZ L;  3S17 H;  1Q46 A;  1FNU A;  2R7Z G;  1WCM H;  2QDB A;  3CXC A;  1DD2 A;  3K5N A;  4NXM L;  1PH4 A;  2EDG A;  2ZTC A;  5HGT A;  3ERO A;  2K5Q A;  4PMB A;  1VF5 C;  1YBY A;  3GDE A;  3S15 H;  3I91 A;  4V0B A;  5EPJ A;  1SYF A;  3CCE A;  2Y0S E;  1S5B D;  4OWT B;  2R92 B;  5DLQ E;  4GS3 A;  4MTK A;  5C5M A;  4R4C A;  1QIL A;  4A3J G;  1IYV A;  5JJL A;  4FYD A;  2EXZ A;  4HMI A;  2K5H A;  2PQA B;  1UE5 A;  1E2W A;  3RLO A;  1FGU A;  1QVF A;  1PXU A;  1YJW A;  2KED A;  1MSH A;  4XYQ A;  1KHI A;  4HN7 A;  4DV7 L;  4KY6 A;  4BXX H;  3CHB D;  2BH8 A;  2N8N A;  1XYI A;  2Y0S B;  3CCM A;  2UXB L;  1LYL A;  1VCI A;  4BY7 H;  4JI0 L;  1M90 C;  3GTQ H;  4DR3 L;  4P2C B;  4UAI A;  1EFI D;  1PYS B;  5DM7 3;  1JB3 A;  3A7L A;  2R93 B;  1DJR D;  4A3M G;  4B3R Q;  3CCJ A;  1QVG A;  1G6P A;  2KJX A;  1STE A;  2ZXO A;  1YHA A;  1PH9 A;  4DNR B;  5C4X G;  3PV0 A;  4R4O A;  5JVH 3;  3NQI A;  4RKB A;  1KQS A;  1B70 B;  5GAE C;  3MEH A;  1STN A;  2RCF A;  4LMQ D;  2F03 A;  3S24 A;  5FKA C;  1Q86 C;  3GTM H;  1C4Q A;  4JI4 Q;  4A3C G;  2G9H D;  3ULP A;  1TWA B;  2KHI A;  1WTR A;  5KIX A;  5EPK A;  1EFW A;  1DOL A;  2B2T C;  3PUW A;  3OTO Q;  1WTV A;  2MGS A;  1S40 A;  3S1Q H;  1B4O A;  1WOC A;  3UE1 A;  4XDX A;  3JAM c;  4NKL A;  4ZKC B;  3P7J A;  3BJU A;  3E0J A;  3HOV B;  4B08 A;  2B63 B;  5M9O A;  3HOW G;  3A0J A;  3KFU A;  1XTD A;  1GUW A;  1I4Q A;  1SNO A;  2E2J H;  4LF8 Q;  2SNM A;  1F9R A;  3NEL A;  4CDD C;  2Z4I A;  1EIG A;  4S3S A;  4H02 A;  5C0X I;  2IW3 A;  1EWC A;  1HJP A;  4JOI A;  1GUN A;  4DNT B;  1SNP A;  2A73 B;  5IYB H;  4Y7N B;  3DWA A;  4DA2 A;  1WCM G;  3R93 A;  1TXY A;  2N88 A;  5JOB A;  1PTO H;  1N34 Q;  1TWG B;  3CF5 A;  3A54 A;  3RLN A;  3BZD B;  5C0X H;  1JOK A;  3RZO B;  1ENA A;  1ILP A;  2E2D C;  4HCS A;  3H91 A;  4BS9 A;  2ATW A;  1B50 A;  2YV5 A;  4BA1 I;  5ELO A;  3ND9 A;  1FYC A;  3BVG A;  1DM0 B;  4L63 B;  2F3V A;  1VQ5 A;  3T16 A;  3CCS A;  2EYJ A;  3A8I E;  2HCC A;  3A8K E;  4DR2 L;  2TSS A;  3MWY W;  2JA6 H;  2G9D A;  1XPU A;  3R8B A;  5C6A A;  4XQN A;  5IGG A;  1VF7 A;  4DXF A;  1S5E D;  1CM9 A;  1EY8 A;  1QUQ A;  4KTA A;  2K5V A;  1C8C A;  1D5X C;  4OXP A;  1F2L A;  3PIO 3;  3QR8 A;  4DV2 L;  2JSO A;  4BXX G;  4LF7 L;  4BBS B;  2BCO A;  2EY2 A;  1TWC H;  4LUV A;  2K5N A;  2F0O A;  2PQA A;  4BY7 G;  2RF4 A;  1X9N A;  1E1O A;  5LMN Q;  2VY3 A;  3DXJ C;  4ZRZ A;  2ZM6 L;  5C3E B;  1BVS A;  3F1Z A;  3NTI A;  1LAC A;  4UHV A;  2KCT A;  1G51 A;  1VQA A;  2YYZ A;  5EBC A;  1WTO A;  1D8L A;  4YY3 Q;  5KYI A;  1SYC A;  4H7B A;  3WOF A;  4POF A;  2B2V A;  2HD3 A;  1I5F A;  1A2U A;  4O0A A;  1PH5 A;  4HJA A;  4J15 A;  2E2H B;  3KF8 B;  3DM1 A;  3I4L A;  5JPN C;  1UE1 A;  4ALP A;  5BR8 L;  3WDN A;  1VQ8 A;  1JOO A;  1ONL A;  1KRS A;  3T13 A;  1L0Y B;  3I4O A;  1EOT A;  2Q2I A;  2TMP A;  4KMU C;  1N36 Q;  3S14 H;  3NHH A;  4CKE A;  3QO2 A;  1Y14 B;  1PZI D;  1TQO A;  2K04 A;  4H13 C;  1N32 Q;  1Y8O B;  3QB3 A;  4ABN A;  4ZK9 B;  1HZB A;  2IWH A;  3V2T A;  2ICE C;  5IT9 L;  1L1O C;  4A3D B;  4IZ8 A;  4QY7 A;  2B63 G;  3BVM A;  1TT2 A;  2IHE A;  1QB5 D;  2KUM A;  4APV A;  1ASY A;  2HUG A;  4YHH Q;  3K7U C;  1H9J A;  4J1M A;  4LF9 Q;  4A3K H;  2NVT H;  3U4V A;  2UUB Q;  3I4N B;  1RKN A;  2Z1C A;  4OIJ A;  5IYB G;  3CAM A;  1BCP B;  2F0M A;  3IRB A;  4DR7 L;  5FO7 B;  1HH2 P;  3I2Z A;  3G71 A;  3MZ5 A;  3HRZ C;  2PMZ E;  2F0G A;  5C0X G;  2G5D A;  2OEO A;  2L9H A;  5ELB A;  4EX5 A;  2F3W A;  3AFP A;  1NJI C;  3OW2 A;  1Q3L A;  4GN3 B;  2GVB A;  2JA6 G;  2F0T A;  1LTS D;  2MHV A;  3HOU B;  1UUP A;  3GTL B;  5CBE E;  5HY6 A;  4F8M A;  4CDF C;  5J1Z A;  3M4O B;  2HHH Q;  3LNN A;  4KI0 A;  1HHV A;  1PV4 A;  1VQ9 A;  1U4P A;  3FKI H;  5I9P A;  1EYG A;  4JI7 Q;  1I94 Q;  1QCB D;  4DV5 Q;  3GV3 A;  4BBS G;  1LAB A;  3ULL A;  1O7Z A;  3KBG A;  1YI2 A;  2CCZ A;  2UXD Q;  1EIY B;  1I4X A;  3QJY A;  3AEV A;  4KN4 C;  1SXT A;  4QCL A;  2AWO A;  3GV6 A;  1ENF A;  2F4I A;  4I7Z C;  4DR1 Q;  1V1O A;  1HA5 A;  3F8T A;  3KOJ A;  5TSS A;  4AQY L;  5JJI A;  4UP8 A;  1BBU A;  4CDC C;  3HFZ B;  1PLF A;  3C2P A;  4DK3 C;  2L15 A;  3M4Y A;  2F0F A;  2K5D A;  1S5C D;  3K7A B;  3LWU A;  2D2C C;  5EKL A;  3MFG A;  4R4I A;  2WAC A;  4R8N A;  1JB7 A;  2LSS A;  1RF2 D;  3I7F A;  1XXG A;  3RN5 A;  3I56 A;  4GNX C;  2CFM A;  1HNW Q;  4KHP Q;  4LF6 Q;  3J7A 5;  2QDL A;  4JCV E;  4JBJ A;  1PYB A;  4DR4 L;  1G2S A;  3N6R A;  1NUC A;  3P75 A;  2WFW A;  2B29 A;  2M9V A;  5LMN W;  3GTG B;  1MGS A;  4JPB W;  1IBK L;  1BDO A;  2L55 A;  2MNA A;  2VNU D;  2R6G A;  4OX9 L;  1KLU D;  2NZO A;  4IFD J;  2LXK A;  4RWS C;  2EYO A;  2VW9 A;  2UU9 L;  4KJN A;  1UAP A;  2O5J C;  1SNM A;  1SFO H;  2O2L D;  2UUC L;  2QA4 A;  3HS0 C;  4EQO A;  3KYH C;  3KLW A;  4FDB A;  3DEP A;  1CKO A;  1LT4 D;  1A3U A;  1IBL L;  5FOB B;  2I5L X;  1FD7 D;  2VQE L;  4A3K G;  1QZH A;  4RGO S;  1XMO Q;  1V1Q A;  2K28 A;  1RJT A;  2JA7 H;  3SDZ A;  4A93 B;  3T51 B;  4BA2 I;  1TKW B;  3WWV A;  2ID0 A;  1NR4 A;  3MHB A;  5CV6 A;  4DUZ Q;  1M4V A;  5C4J B;  2F0V A;  1A2T A;  3PF4 A;  1B2T A;  1I4G A;  2EE1 A;  4JI1 L;  1KL9 A;  5FLX c;  2L12 A;  4KN7 C;  1CTM A;  1C48 A;  5CBA E;  4X66 Q;  1O7L A;  1K28 A;  3VR5 A;  1CKN A;  4R4Q A;  4HIM A;  1X3Q A;  1AE2 A;  1SYD A;  1F2M A;  1JT8 A;  3K80 C;  1VQH A;  1G91 A;  1HNZ Q;  3KDF A;  5CV4 A;  2BH2 A;  3H3V C;  5CV8 A;  4IUV A;  3A7A B;  5KYL A;  3FHW A;  2MQH A;  1JJG A;  1EWH A;  4NXM Q;  4QIW E;  5H1S E;  2A69 D;  4GLA C;  3S1M H;  2F0I A;  2K75 A;  2RSN A;  1I3Q H;  1VQ7 A;  1BO0 A;  1G8Z D;  1ZEQ X;  1SMY D;  1PTO F;  3RZD B;  2OTL A;  3SEB A;  1HQR D;  1WTH A;  1NAP A;  3RZD H;  4TSS A;  1SEB D;  3PUZ A;  2F0N A;  1TS4 A;  4FP5 D;  1KXL A;  4QIW B;  3GD7 A;  4UPA A;  1DGS A;  1X3E A;  2VS1 A;  4IPH A;  1I50 H;  2CKZ B;  2A6E D;  2WKC A;  4K5V A;  2XTI A;  1EEI D;  3IFT A;  1S5F D;  3HOY B;  1NTG A;  3EIV A;  1RCV D;  3I8Z A;  4C2M H;  2UXB Q;  5JVG 3;  3S2D H;  4OON A;  4JI0 Q;  5C44 H;  1K83 H;  3M9B A;  1SNQ A;  1VS0 A;  5CGK A;  4ID6 A;  1L0W A;  4JG2 A;  2KBN A;  1GXD C;  3S2H H;  2A68 D;  4Q0F A;  4LF5 L;  3H0G H;  5K5P A;  3CKI B;  5I2X A;  3X3M A;  4FF2 A;  1H9S A;  1I6H H;  4X6A H;  3T56 B;  2A69 C;  3J7A V;  2R61 A;  1X3F A;  2DUD A;  4C3J B;  2IL8 A;  2JE6 I;  2NYZ D;  4Q5V A;  1MKH A;  1TU2 B;  2PQE A;  3DUZ A;  3TRZ A;  2HIV A;  3SVM A;  1SMY C;  4A3J B;  2XRQ D;  4LWC A;  2RBM A;  4QQB X;  1YNJ D;  3EJI A;  3N52 A;  3C46 A;  1LTT D;  1Y1W H;  1SRU A;  4DU9 A;  1EY7 A;  1Q8K A;  2JA7 G;  1JJ2 A;  2A6E C;  2NZ1 D;  4NPS A;  3E9I A;  3BYY B;  5IIF A;  1IKL A;  4B9X A;  1PH6 A;  3TQY A;  3BDC A;  1NSN S;  2DY7 A;  4IO9 A;  2CW0 D;  1L0X B;  2QEX A;  4PZ7 A;  4YWL A;  2R7F A;  2NVY B;  4HMJ A;  2Z6B A;  4A3M B;  5KNB A;  5M5Y B;  2A68 C;  1PYW D;  3CCV A;  4LJZ C;  1EY6 A;  4O1N A;  5C4X B;  3NQT A;  1PH7 A;  1WVL A;  2JA9 A;  4HJ5 A;  1CT1 D;  3NSW A;  2AKW B;  1GOZ A;  2RCN A;  4DNI A;  1CSP A;  1PA6 A;  4KKS A;  1ZXT A;  2MPM A;  4DV1 L;  2FFK B;  5J3B A;  4JVZ A;  1P8L A;  2F0J A;  3BS1 A;  1HPC A;  4JOI C;  3NE5 B;  2KEE A;  4L5T A;  2F0E A;  1GVP A;  1YNJ C;  4QB4 A;  4DR2 Q;  1V1P B;  4C3I H;  1Q7Y C;  2F52 A;  1LM0 A;  1NR2 A;  2RDF A;  4RCN A;  1QJO A;  1A63 A;  4IUQ A;  3F2B A;  1IHZ A;  3I3C A;  4CJ0 B;  4LFA L;  3TDQ A;  2NVQ B;  2YTV A;  3W2D A;  4DV2 Q;  1A15 A;  2V4D A;  3MEF A;  4LF7 Q;  1K73 C;  2CW0 C;  3HOY G;  2J4X A;  1SJE D;  1E2V A;  1MBY A;  1OXS C;  2NN6 I;  5C44 G;  2A74 C;  1T9H A;  1EEF D;  2MFI A;  3GP7 A;  4K6L A;  1WTW A;  3M3Y H;  3S17 B;  1HFN A;  1NBW A;  1LUZ A;  2ZM6 Q;  5JAV A;  1CHP D;  1PDQ A;  1SJH D;  2CWA A;  3HOZ H;  1WCM B;  3EQL C;  1OXT A;  4UY8 C;  5IYD H;  3H0G G;  1U4M A;  2NN6 H;  1GUG A;  4MN3 A;  4TRD A;  1S3O A;  3NPP A;  5KRU A;  3S9W A;  4RG1 A;  3S15 B;  4IUR A;  1J5E L;  4GOP B;  2F0K A;  4KY7 A;  1QUQ B;  1S5D D;  1D7Q A;  5COY A;  1XPO A;  3E6Z X;  3J80 c;  4C3J G;  3KLS X;  4A3E H;  1G2T A;  1Z6H A;  3GO5 A;  4XTC S;  5BR8 Q;  3PUV A;  4PQX A;  2AUJ D;  3BYT B;  4EVO A;  2I0Q A;  1KD1 C;  1BXT A;  4ZCK A;  3L0O A;  1KDA A;  4R4T A;  5E3F A;  1K3R A;  2YU9 H;  2AHO B;  3K5M A;  3NP8 A;  1UEB A;  1GHJ A;  3FPU B;  2L11 A;  3D3R A;  1VQF A;  1Y1W G;  4OL7 A;  4QMG A;  1MJE A;  1P16 A;  3SR1 A;  3ONA B;  2KA7 A;  1SDF A;  3PIP 3;  3W1G A;  2LKV A;  2R3Z A;  1CHQ D;  4BY7 B;  3A55 A;  3HZX A;  3GTQ B;  2B39 A;  4AH6 A;  4C3H H;  2WII B;  1QG7 A;  1DZ1 A;  5CMD A;  1H9M A;  5M3M H;  4L6T B;  1R9T H;  4B3S L;  4POG A;  2EY6 A;  1HNX L;  5I6Y A;  1QOH A;  2EY5 A;  4BY1 H;  1VDZ A;  4UP7 A;  1TS5 A;  2XIW A;  3PUY A;  1KNE A;  2LMC B;  4IOC A;  2PW5 A;  4JI5 Q;  1GD7 A;  3F2C A;  3OWE B;  3RN2 A;  1YNN D;  3I70 A;  3SK8 A;  1X56 A;  4QGU A;  2MO0 A;  2WIN B;  1PFN A;  4DR7 Q;  1YNX A;  1WTQ A;  1PZJ D;  1IYU A;  2CH4 W;  5ISR A;  1WI5 A;  5BN4 A;  3GTM B;  4P73 A;  4ZQ3 A;  1X55 A;  3G6E A;  3MFY A;  1L2F A;  3HKZ E;  5IP7 H;  1DOM A;  2AMC B;  1MI2 A;  4H0L C;  2O4X A;  2IPK D; 
#chains in the Genus database with same CATH homology
 2B8G A;  3DEO A;  3FDT A;  4WJW A;  3S1Q B;  4C3I G;  4CBV A;  5JEA H;  1STB A;  1CQF A;  1RTO A;  5I6W A;  1RHP A;  3HKZ B;  1V1P A;  2EVB A;  2E2J B;  2BDO A;  5FLX E;  5IOC A;  2PZU A;  2OF1 A;  1W6K A;  3DWP A;  5C4H A;  4I65 A;  1LTA D;  1EU4 A;  4K14 A;  3BVZ A;  1DXM A;  1PTO B;  3C1E A;  4FXD A;  1I4P A;  2QKI C;  2NN6 G;  1YNN C;  1PRT B;  4ZUJ A;  2ENB A;  2Q8T A;  3HP3 A;  2JA6 B;  2Q8I B;  5EKI A;  4ZLT F;  2N55 A;  5D3I B;  1EY9 A;  1F9Q A;  2F1M A;  3VA5 A;  1IKM A;  4Z9C B;  4QF4 A;  1D2B A;  3GQB A;  1HCZ A;  3VR4 A;  3SK6 A;  1TWC B;  3R3O A;  1K8O A;  3E5S A;  1CA5 A;  2D5D A;  1B1Z A;  4C3H G;  1BCP D;  3U9O A;  1GHK A;  4OGQ C;  3RD4 A;  3RMH A;  2E76 C;  4K2L A;  4IUN A;  1LT6 D;  1TVX A;  2HQE A;  4U68 A;  1ET9 A;  2KVM A;  1FNV A;  2EYF A;  5DM6 3;  1T5E A;  1SNC A;  1PFM A;  2JP1 A;  1STH A;  4EQN A;  1U9R A;  3L3O C;  1SE4 A;  1DON A;  1FGB D;  3JAM L;  4UDU C;  3S14 B;  3UI2 A;  1D1K A;  3L7Z C;  2FMC A;  1HUN A;  5JEA G;  2K1B A;  3MAQ A;  1H9R A;  4FXK C;  1S4Z A;  2FIN B;  2MJ8 A;  1EY4 A;  2ICI A;  1BCP C;  3K57 A;  2KEC A;  4WRD A;  1U4R A;  2LFN A;  1LTG D;  2AQ1 B;  2K01 A;  4HTH A;  4QUC A;  1TS2 A;  4A3K B;  2NVT B;  1B9M A;  2DNC A;  1HUM A;  1JWU D;  1H9K A;  1VMP A;  5HUR A;  4ODG A;  2E74 C;  2HCI A;  5E4X A;  3EVQ A;  3HG9 A;  2BE5 D;  4ULL A;  2MP1 A;  3M85 A;  5AFW A;  4IUU A;  1BQQ T;  2EYL A;  4XIG S;  2B2W A;  3QG1 A;  2B2T A;  4E6I A;  2XWJ B;  2D9U A;  4XYO A;  1XTC D;  2AWN A;  2PMZ B;  3HEJ A;  2I46 A;  3FKI B;  3A56 A;  3D8G A;  4K2K A;  1EY5 A;  4H44 C;  5BN3 A;  1BF4 A;  2NWG A;  4A3B B;  4V19 0;  5LL6 X;  3WOE A;  3LX0 A;  4DN4 M;  3VYT A;  1Z7T A;  3NWS A;  4EGV A;  2PCF B;  5COR A;  4DFA A;  2K6A A;  3FEW X;  1G6Z A;  3OMC A;  2PO4 A;  3NUC A;  4ME5 A;  4FXG C;  2BE5 C;  2PZT A;  3QIA A;  5ELC A;  1H9S B;  2ZXR A;  3J80 E;  3D4W A;  3Q23 A;  3R2I A;  5EQ0 A;  3Q0A A;  5EJW A;  1R4P B;  3NBI A;  1PFB A;  3OW7 A;  4X3U A;  2K7V A;  5LHY 1;  3ZYY X;  5I4D A;  2F0D A;  2F0P A;  4ZUI A;  1HTL D;  3J7A F;  1SFO B;  1ZYR D;  1BOS A;  1QE6 A;  4M1U B;  2HDM A;  5BN5 A;  3TP8 A;  3J7Y W;  3C1F A;  1Y69 U;  1D5Z C;  3PUX A;  2JA7 B;  3OWF A;  1V43 A;  2PYK A;  2NBF A;  4ZYS A;  1ESR A;  1Q8I A;  2AQ2 B;  1EQV A;  4EQP A;  1EQT A;  2BA0 A;  1LT5 D;  3W3A A;  1U4L A;  3H09 A;  3VYR A;  5CR3 A;  2L1B A;  3T53 B;  3TP7 A;  1CA6 A;  4XQJ A;  1FNW A;  2EJM A;  3S1M B;  1SYE A;  2WKD A;  4KY5 A;  3K6O A;  3OHX C;  1I3Q B;  2J7Z A;  3JAM E;  1OXU A;  4RGN A;  4FO2 A;  1ZYR C;  4HCE A;  4TQU S;  5IGC A;  2B8F A;  1PRT F;  4NMZ A;  4DK0 A;  4RHR A;  1JR0 D;  4LAA A;  4L8J A;  2HDL A;  1BNZ A;  5IGD A;  1I50 B;  4FF3 A;  1HRJ A;  1CFM A;  3G6J B;  1ET6 A;  2WV6 D;  4NDX A;  2IT1 A;  4HR7 B;  5T1G A;  1O78 A;  2D62 A;  4C2M B;  3S2D B;  3U9S A;  3V96 A;  1OXX K;  5C3X A;  5C44 B;  2QIL A;  1K83 B;  2EJF C;  3S2H B;  4TKO B;  4BWG B;  3VA7 A;  1RTN A;  3H0G B;  3TBI B;  2C9O A;  1I6H B;  2O5I C;  4K5X A;  2L4N A;  3C3L A;  4DXG A;  5LL6 S;  2IX1 A;  2SEB D;  3J81 E;  3HGB A;  3A8J E;  2RDG A;  3OIQ A;  5D65 A;  1PMR A;  1Y1W B;  5DNF A;  2F0H A;  1DCZ A;  2RVL A;  5FLX L;  4F7X A;  3DHQ A;  5A2Q L;  2PNR C;  3TSS A;  2I07 B;  3URY A;  1F2Z A;  4IFD I;  3TZD A;  1AN8 A;  1X32 A;  1AW7 A;  3LWE A;  1SYG A;  1T5X D;  4RGT A;  1GUT A;  2XN9 C;  3CU7 A;  1M8A A;  2H1E A;  4G7H C;  5EBD A;  4IFD H;  1WD0 A;  5KGU A;  1W6J A;  3OOC A;  4C56 C;  5JJZ A;  1TY0 A;  2XSC A;  4PMC A;  5EPL A;  4C3I B;  2AQ3 B;  4FF1 A;  5KND A;  2AUK A;  2GA4 B;  2KCN A;  1JWM D;  4RKL A;  4CGY B;  3BG3 A;  4RH6 A;  1GUO A;  3KK7 A;  4X3T A;  5C0X J;  4PNY A;  1SBB B;  3D6W A;  3MXP A;  2K5W A;  4IUT A;  4CKB A;  5C3W A;  3M3Y B;  4RCO A;  3HOZ B;  1QNK A;  1MD2 D;  2FJ2 A;  2F0Q A;  3FMC A;  1TY2 A;  5G3L F;  1SE2 A;  3VYS A;  2LY7 A;  3MXU A;  1IL8 A;  1LO5 D;  5IGE A;  4A3E B;  4CJ1 B;  4KKT A;  4HSP A;  1EYC A;  1F9S A;  1HTP A;  3H6M A;  3K58 A;  3SXH A;  4GZY C;  3AU7 A;  2YU9 B;  4NW2 A;  1QWY A;  2PPB C;  3S1R B;  4NP5 A;  3VR2 A;  4IUP A;  1BUV T;  1LTR D;  2B2V C;  1I4R A;  3MVV A;  1WTP A;  5F2D A;  4WOR A;  4C3H B;  4IQZ A;  3O13 A;  2JYO A;  5M3M B;  1PTO D;  2PZW A;  2B2U A;  1PRT D;  1R9T B;  3D4R A;  3NWT A;  5FO8 B;  4R9W A;  2K03 A;  3V05 A;  1STY A;  4BY1 B;  3M7N A;  3TZU A;  4RHS A;  5CV9 A;  4HED A;  3Q24 A;  2K32 A;  2WB1 B;  2RSO A;  5E1F A;  3KLR A;  5IGB A;  4IFD G;  1B9N A;  3SK4 A;  3SE0 A;  3RLF A;  1EY0 A;  4M8A A;  3Q6S A;  3CRK C;  2C5C A;  1JIC A;  1JOR A;  3BDL A;  3TP5 A;  2OT2 A;  2SNS A;  2B2W C;  1TS3 A;  1PTO C;  5IGF A;  1D5M C;  1PRT C;  5M5X B;  5M3F B;  4PV1 C;  1Y1V B;  3SK5 A;  1AZP A;  4X3S A;  1RD9 D;  4C1N I;  3EA6 A;  1JWS D;  1AP0 A;  5A2Q E;  2M2L A;  2B2Y A;  3D4D A;  4MIU A;  3J80 L;  1JE4 A;  1ML0 D;  3Q22 A;  3OMG A;  2WAQ B;  1TR5 A;  2LS0 1;  4X3K A;  5D3D A;  2FMM A;  2X69 A;  3FRP B;  1WD1 A;  4DAY A;  3NBH A;  4KHV A;  4F87 A;  2NUC A;  4JK1 C;  2WP8 J;  1AEX A;  1KAB A;  2Q8R E;  5J39 A;  3ITP A;  5CC4 A;  2EOT A;  2L5T A;  2DN8 A;  4HAE A;  1AFP A;  3OSO A;  5C4Z A;  1KAA A;  2BOS A;  2Z8L A;  3TN2 A;  3GTK B;  3VR3 A;  4OO1 I;  1KNA A;  3MTS A;  2NB0 A;  1Q90 A;  3MA2 B;  4FNF A;  5D14 A;  3NTK A;  1II3 A;  4OO1 H;  2DNE A;  2NVX B;  4IAL A;  2NTT A;  1LTI D;  3QOJ A;  2FHT A;  3I4M B;  5G3L D;  3CQZ B;  4KHZ A;  1D6E C;  1GUS A;  1XX8 A;  4KJO A;  1EL0 A;  3PMF A;  5ELD A;  1X3P A;  1CZW A;  2L0C A;  1J8I A;  1E0B A;  1EYD A;  2JXM B;  1O7Y A;  1ILQ A;  1KDC A;  4OHJ A;  3I72 A;  1A3V A;  4RAU C;  5IOD A;  1OO9 B;  3FVQ A;  5JPM C;  3DMU A;  3VYU A;  1UEA B;  2IJ0 A;  4N9P A;  2NTS A;  5CV5 A;  1B3A A;  1TWF B;  2SDF A;  3AB9 A;  4XT3 B;  1B44 D;  1VMC A;  2RKS A;  1G29 1;  1I6V C;  3G7L A;  5J22 A;  4O42 A;  3RUZ A;  5DAU A;  2KQ3 A;  3OIP A;  2VB2 X;  2CQA A;  1D1I A;  2PW7 A;  4KD3 A;  2JEB I;  5C5L A;  3J81 L;  2CVR A;  3S1N B;  1R4Q B;  1ROD A;  3S16 B;  4JBW A;  2BDN A;  2KCC A;  2IX3 A;  2EYP A;  3BDO A;  1JOQ A;  1EIH A;  4KD4 A;  1NCV A;  5FK9 C;  3P20 A;  5ELF A;  4K8J A;  3CRL C;  4KK7 A;  5KEE A;  1RDP D;  1WTX A;  1Q1B A;  4N9T A;  4J6H A;  2EZV A;  1BBX C;  5M5W B;  1HFG A;  4OO1 G;  1EYA A;  1K8M A;  3I73 A;  3K5O A;  4DF7 A;  4RGM A;  3KBX A;  4KKU A;  1LTB D;  5EGT A;  5ELE A;  3IAY A;  5KNC A;  3ND8 A;  1CQV A;  3NK9 A;  5E4W C;  3I90 A;  1AZQ A;  1STA A;  3K0Y A;  4K8I A;  1MSG A;  3TME A;  3KUP A;  2XRS D;  1F9P A;  3PO3 B;  4IN3 A;  2OXP A;  3NXW A;  1TII D;  2JA8 B;  4K6D A;  3KF8 A;  1KTK A;  3H94 A;  4DGZ A;  2E75 C;  1SE3 A;  4J8Q A;  1JC7 A;  1Q1E A;  2A5H A;  2A6H D;  2CHB D;  2K33 A;  1F77 A;  4C1N K;  2E2I B;  1UNS A;  4CKC A;  4ILW A;  1IW7 D;  1SYB A;  3DWQ A;  1PZK D;  3T4A C;  3L9A X;  4R8I A;  3F2U A;  1EU3 A;  2EPB A;  3MC0 B;  2RDH A;  4BBR B;  5CYU A;  3R2T A;  4G57 A;  2X6G A;  3PO2 B;  5CV7 A;  2XWB B;  5K36 H;  4G4K A;  1LLR D;  2EY1 A;  2RQX A;  4CHT B;  3D6C A;  2QCP X;  3HOX B;  3NTH A;  1Y8N B;  4G7Z C;  3M7G A;  4AYB B;  3GTO B;  3X3N A;  4DAP A;  2A6H C;  4DAV A;  1SSO A;  3GTP B;  3MXN A;  1HQM C;  3GTJ B;  2EYH A;  2DY8 A;  3K59 A;  1ESF A;  2XVS A;  4YIJ A;  1SAP A;  5A35 A;  4U67 3;  4HSV A;  1HA6 A;  1IW7 C;  2VUM B;  4RA8 A;  2X6L A;  4XXE A;  5IT9 E;  1XWE A;  3FPP A;  1EZ8 A;  3IKJ A;  1ZKO A;  1I4H A;  1A3T A;  1HXY D;  4A3I B;  2B2U C;  2ZT9 C;  2SOB A;  5T1I A;  3TP6 A;  4RFB A;  4XQQ A;  2R7Z B;  1TWH B;  4A3G B;  5I2Y A;  4OIK A;  1STG A;  3ERQ A;  4DK1 A;  4A3F B;  3AMU A;  4K5W A;  1QNU A;  4XT1 B;  4FVM A;  4MHE A;  2EJG C;  1LV9 A;  2EYM A;  3EFX D;  2IX0 A;  1KDB A;  4PMW A;  2MUY A;  1FR3 A;  1JCK B;  2F0S A;  1CK1 A;  1JQY D;  1A6X A;  3VR6 A;  2VXW A;  1OXV A;  1Q12 A;  3P1H A;  1EZ6 A;  1F2Y A;  2BA1 A;  2K05 A;  4QUF A;  5JEA J;  1LT3 D;  1O80 A;  3SHL A;  5I9O A;  1KLG D;  4FF4 A;  1BR9 A;  3MXG A;  3KLS A;  2KHS A;  4LK1 C;  1ICW A;  2F0U A;  3IL8 A;  5K36 G;  1Y8P B;  2B2Y C;  2RA4 A;  1GJX A;  1E2Z A;  5EKK A;  1CZG A;  1SND A;  2F0W A;  2ZXP A;  3K5L A;  1DOK A;  2QEJ C;  3QWN A;  4CJ2 C;  3IFD A;  4B9W A;  1DYQ A;  2KOL A;  2F0L A;  1J9O A;  1BCP F;  3D31 A;  2JA5 B;  2XNA C;  4ZAI A;  4ZKB B;  4F88 A;  3OPO A;  4WFN 3;  1CI3 M;  2Z4H A;  1V8Q A;  2VB3 X;  5DEH A;  2M00 A;  4G7O C;  3QOL A;  2H4O A;  1B53 A;  1Z47 A;  3HOW B;  5FO9 B;  4KV6 A;  1ENC A;  5NUC A;  2J0T D;  2JEA I;  2QF7 A;  1FNU A;  2QDB A;  1DD2 A;  3K5N A;  2EDG A;  5HGT A;  3ERO A;  2K5Q A;  4PMB A;  1VF5 C;  3I91 A;  4V0B A;  5EPJ A;  1SYF A;  1S5B D;  2R92 B;  5C5M A;  1QIL A;  1IYV A;  4FYD A;  2EXZ A;  4HMI A;  1E2W A;  1PXU A;  2KED A;  1MSH A;  4XYQ A;  4HN7 A;  4KY6 A;  3CHB D;  1XYI A;  2Y0S B;  1VCI A;  4P2C B;  4UAI A;  1EFI D;  5DM7 3;  1JB3 A;  3A7L A;  2R93 B;  1DJR D;  2KJX A;  1STE A;  2ZXO A;  4DNR B;  3PV0 A;  5JVH 3;  3NQI A;  4RKB A;  3MEH A;  1STN A;  4LMQ D;  2F03 A;  5FKA C;  1C4Q A;  2G9H D;  1TWA B;  1WTR A;  5KIX A;  5EPK A;  1DOL A;  2B2T C;  3PUW A;  1WTV A;  2MGS A;  1B4O A;  4XDX A;  4NKL A;  4ZKC B;  3P7J A;  3E0J A;  3HOV B;  4B08 A;  2B63 B;  5M9O A;  1GUW A;  1I4Q A;  1SNO A;  2SNM A;  1F9R A;  2Z4I A;  1EIG A;  4S3S A;  5C0X I;  2IW3 A;  1EWC A;  1GUN A;  4DNT B;  1SNP A;  2A73 B;  4Y7N B;  3DWA A;  4DA2 A;  3R93 A;  2N88 A;  5JOB A;  1PTO H;  1TWG B;  3A54 A;  3BZD B;  5C0X H;  1JOK A;  3RZO B;  1ENA A;  1ILP A;  2E2D C;  4HCS A;  3H91 A;  4BS9 A;  1B50 A;  4BA1 I;  3ND9 A;  1FYC A;  3BVG A;  1DM0 B;  4L63 B;  2F3V A;  3T16 A;  2EYJ A;  3A8I E;  2HCC A;  3A8K E;  2TSS A;  3MWY W;  2G9D A;  3R8B A;  5C6A A;  4XQN A;  5IGG A;  1VF7 A;  4DXF A;  1S5E D;  1CM9 A;  1EY8 A;  4KTA A;  1C8C A;  1D5X C;  1F2L A;  3PIO 3;  2JSO A;  4BBS B;  2BCO A;  2EY2 A;  2F0O A;  3DXJ C;  4ZRZ A;  5C3E B;  3NTI A;  1LAC A;  2YYZ A;  5EBC A;  1WTO A;  5KYI A;  1SYC A;  4H7B A;  3WOF A;  2B2V A;  1A2U A;  2E2H B;  3DM1 A;  3I4L A;  5JPN C;  3WDN A;  1JOO A;  1ONL A;  3T13 A;  1L0Y B;  1EOT A;  2TMP A;  4KMU C;  3NHH A;  4CKE A;  3QO2 A;  1PZI D;  1TQO A;  2K04 A;  4H13 C;  1Y8O B;  3QB3 A;  4ABN A;  4ZK9 B;  2IWH A;  3V2T A;  2ICE C;  5IT9 L;  4A3D B;  4IZ8 A;  3BVM A;  1TT2 A;  1QB5 D;  2KUM A;  2HUG A;  1H9J A;  4J1M A;  3I4N B;  1RKN A;  2Z1C A;  4OIJ A;  1BCP B;  2F0M A;  5FO7 B;  3MZ5 A;  3HRZ C;  2F0G A;  5C0X G;  2OEO A;  2L9H A;  5ELB A;  2F3W A;  1Q3L A;  2F0T A;  1LTS D;  2MHV A;  3HOU B;  1UUP A;  3GTL B;  5CBE E;  4F8M A;  5J1Z A;  3M4O B;  3LNN A;  4KI0 A;  1HHV A;  1U4P A;  5I9P A;  1QCB D;  3GV3 A;  1LAB A;  1O7Z A;  3KBG A;  1I4X A;  3QJY A;  4KN4 C;  1SXT A;  4QCL A;  2AWO A;  3GV6 A;  1ENF A;  2F4I A;  4I7Z C;  1V1O A;  1HA5 A;  5TSS A;  1PLF A;  3C2P A;  3M4Y A;  2F0F A;  2K5D A;  1S5C D;  3K7A B;  3LWU A;  2D2C C;  5EKL A;  3MFG A;  2WAC A;  4R8N A;  1RF2 D;  1XXG A;  1G2S A;  3N6R A;  1NUC A;  3P75 A;  2M9V A;  3GTG B;  1MGS A;  1BDO A;  2L55 A;  2VNU D;  2R6G A;  1KLU D;  4IFD J;  4RWS C;  2EYO A;  4KJN A;  1UAP A;  2O5J C;  1SNM A;  2O2L D;  3HS0 C;  4EQO A;  3DEP A;  1LT4 D;  1A3U A;  5FOB B;  1FD7 D;  4RGO S;  2K28 A;  1RJT A;  3SDZ A;  4A93 B;  3T51 B;  4BA2 I;  1TKW B;  2ID0 A;  1NR4 A;  3MHB A;  5CV6 A;  1M4V A;  5C4J B;  2F0V A;  1A2T A;  1B2T A;  1I4G A;  2EE1 A;  2L12 A;  4KN7 C;  1CTM A;  1C48 A;  5CBA E;  1O7L A;  3VR5 A;  1X3Q A;  1SYD A;  1F2M A;  1G91 A;  5CV4 A;  3H3V C;  5CV8 A;  4IUV A;  3A7A B;  5KYL A;  1EWH A;  2A69 D;  2F0I A;  2RSN A;  1BO0 A;  1G8Z D;  1ZEQ X;  1SMY D;  1PTO F;  3RZD B;  3SEB A;  1HQR D;  1NAP A;  4TSS A;  1SEB D;  3PUZ A;  2F0N A;  1TS4 A;  4FP5 D;  4QIW B;  3GD7 A;  2A6E D;  2WKC A;  4K5V A;  1EEI D;  3IFT A;  1S5F D;  3HOY B;  1RCV D;  3I8Z A;  5JVG 3;  1SNQ A;  5CGK A;  4ID6 A;  1GXD C;  2A68 D;  4Q0F A;  5K5P A;  3CKI B;  5I2X A;  3X3M A;  4FF2 A;  1H9S A;  3T56 B;  2A69 C;  3J7A V;  2R61 A;  4C3J B;  2IL8 A;  2JE6 I;  2NYZ D;  4Q5V A;  1TU2 B;  2PQE A;  3DUZ A;  3SVM A;  4A3J B;  1SMY C;  2XRQ D;  2RBM A;  1YNJ D;  3EJI A;  3N52 A;  3C46 A;  1LTT D;  4DU9 A;  1EY7 A;  2A6E C;  2NZ1 D;  3BYY B;  5IIF A;  1IKL A;  4B9X A;  3BDC A;  1NSN S;  2DY7 A;  2CW0 D;  1L0X B;  2NVY B;  4HMJ A;  4A3M B;  5KNB A;  5M5Y B;  2A68 C;  1PYW D;  4LJZ C;  1EY6 A;  4O1N A;  5C4X B;  3NQT A;  1WVL A;  1CT1 D;  3NSW A;  1GOZ A;  4KKS A;  1ZXT A;  2MPM A;  2FFK B;  2F0J A;  3BS1 A;  1HPC A;  3NE5 B;  2KEE A;  2F0E A;  1YNJ C;  4QB4 A;  1V1P B;  1NR2 A;  2RDF A;  4RCN A;  1QJO A;  4IUQ A;  1IHZ A;  3I3C A;  4CJ0 B;  3TDQ A;  2NVQ B;  3W2D A;  1A15 A;  2V4D A;  2CW0 C;  2J4X A;  1SJE D;  1E2V A;  1MBY A;  1OXS C;  2NN6 I;  2A74 C;  1EEF D;  3GP7 A;  4K6L A;  1WTW A;  3S17 B;  1HFN A;  5JAV A;  1CHP D;  1PDQ A;  1SJH D;  1WCM B;  3EQL C;  1OXT A;  1U4M A;  2NN6 H;  1GUG A;  4MN3 A;  4TRD A;  3NPP A;  5KRU A;  3S9W A;  3S15 B;  4IUR A;  2F0K A;  4KY7 A;  1S5D D;  5COY A;  3E6Z X;  4C3J G;  3KLS X;  1G2T A;  1Z6H A;  3GO5 A;  4XTC S;  3PUV A;  4PQX A;  2AUJ D;  3BYT B;  4EVO A;  1BXT A;  1KDA A;  5E3F A;  3K5M A;  3NP8 A;  1GHJ A;  3FPU B;  2L11 A;  3D3R A;  4OL7 A;  4QMG A;  3SR1 A;  3ONA B;  2KA7 A;  1SDF A;  3PIP 3;  2LKV A;  2R3Z A;  1CHQ D;  4BY7 B;  3A55 A;  3HZX A;  3GTQ B;  2B39 A;  2WII B;  1QG7 A;  1DZ1 A;  5CMD A;  1H9M A;  4L6T B;  2EY6 A;  5I6Y A;  1QOH A;  2EY5 A;  1VDZ A;  1TS5 A;  2XIW A;  3PUY A;  1KNE A;  2LMC B;  2PW5 A;  3OWE B;  1YNN D;  3I70 A;  3SK8 A;  2WIN B;  1PFN A;  1WTQ A;  1PZJ D;  1IYU A;  5ISR A;  5BN4 A;  3GTM B;  4ZQ3 A;  3MFY A;  1DOM A;  4H0L C;  1MI2 A;  2O4X A;  2IPK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...