5KGUA

Crystal structure of staphylococcal nuclease variant delta+phs n118d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGDNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N118D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kguA00
2F0UA 1STGA 4IALA 1SNOA 4KJOA 3EJIA 2F0EA 3EROA 1A3VA 3P1HA 4N9TA 3SR1A 3S9WA 3MHBA 4KY5A 5DAUA 2F0OA 1A2TA 4EQPA 3NK9A 4WRDA 2SOBA 4KHVA 5I9PA 1EYDA 1KAAA 3D8GA 2EYMA 1EQVA 5E1FA 1EYAA 5E3FA 5J1ZA 3TP7A 4DFAA 3MVVA 1STAA 4H7BA 1STYA 3D4WA 5IGDA 2SNMA 3BDCA 1A2UA 4IZ8A 4J6HA 4K5VA 4B9WA 4KY6A 1JOQA 5CV9A 4YIJA 2F0HA 2PW5A 3PMFA 3MEHA 4QMGA 2EY2A 4NMZA 2F0GA 2F0LA 4QB4A 5I6WA 3OMCA 1STNA 2WACA 5C5MA 1TR5A 4K2LA 2PQEA 5C4ZA 1SNDA 4RKLA 2F0IA 4DU9A 2NUCA 3RUZA 1SNMA 4B9XA 3T13A 3TMEA 5JOBA 5EGTA 2EYHA 4KV6A 1RKNA 2PW7A 1EYCA 4EQNA 5CGKA 2PZUA 3OMGA 3TP8A 3HEJA 4G57A 4F8MA 5CV4A 5HGTA 4OL7A 3SK5A 1JOKA 3QB3A 2F3WA 4ID6A 4LAAA 4WORA 1EZ8A 2F0PA 2RDFA 1IHZA 3TP5A 5KRUA 2LKVA 4K14A 5KGUA 4NDXA 5IGGA 5C6AA 2M00A 4ZUIA 5IGCA 2QDBA 2F0WA 3HZXA 1EY5A 4F7XA 2F0QA 3ITPA 4KD3A 4ZQ3A 1SYGA 4K5WA 1ENAA 3NXWA 4KTAA 5IODA 1NUCA 2PZWA 2RKSA 3QOLA 3MXPA 2EYLA 2EY5A 5IGBA 4K8IA 3D6CA 1JORA 4DGZA 5C3WA 1TT2A 2EYPA 1SNPA 3SHLA 3QOJA 3H6MA 4ODGA 1NSNS 5CC4A 1F2ZA 4DF7A 1F2YA 3NUCA 5C3XA 5KYLA 3EVQA 1KDCA 4K8JA 5C5LA 5K5PA 1A3UA 1STHA 5KYIA 4E6IA 1EY8A 4K5XA 3SXHA 4TRDA 5KIXA 2PYKA 4MIUA 5JAVA 2F0VA 2KHSA 2HQEA 2OF1A 1EY6A 1SYBA 4PMBA 3SK4A 1KDBA 3NP8A 5IGEA 1JOOA 4N9PA 5C4HA 1KDAA 4KJNA 5ISRA 2F3VA 2F0DA 1STBA 4S3SA 2F0KA 3TP6A 5HURA 3C1FA 1ENCA 5I6YA 1TQOA 4HTHA 1EY7A 4PMCA 4IUNA 2O4XA 3U9OA 3V2TA 5M9OA 5EKLA 4KY7A 3D4DA 1SYDA 4NKLA 1EZ6A 1SNQA 2F0TA 2EXZA 2F0MA 3LX0A 1AEXA 5IOCA 1EY0A 2EYFA 2PZTA 1SYEA 2OEOA 2RBMA 2F0NA 1F2MA 2SNSA 5J39A 3MZ5A 3C1EA 4ME5A 4RKBA 4KD4A 5I9OA 1A3TA 3BDLA 2EY1A 2F0SA 3ERQA 4K6DA 5CV6A 2F0FA 3T16A 5CV5A 3DMUA 5DEHA 4QF4A 4EQOA 5J22A 2OXPA 1U9RA 5KEEA 2F0JA 3OWFA 3NQTA 4ZUJA 5CV7A 2EYJA 3SK6A 5IGFA 1SNCA 2KQ3A 4J1MA 4NP5A 4PNYA 4K2KA 4I65A 5CV8A 2EY6A 3P75A 5F2DA 5NUCA 1SYFA 5EKKA 1KABA 4EVOA 3SK8A 2ENBA 3OSOA 3DHQA 3R3OA 5CR3A 4HMJA 3NHHA 5IIFA 4R8NA 1EY4A 3VA5A 1EY9A 2EYOA 4HMIA 3E5SA 1SYCA 1II3A
chains in the Genus database with same CATH superfamily
3SR1A 1SNOA 3L9AX 4P2CB 1BCPD 4GN3B 4OIJA 4CDDC 3A8JE 1YJWA 1N36L 2IHFA 2UUAL 2X6LA 4ZRZA 3WOFA 2ZJQA 4IUTA 3P7JA 3M4OH 2VQFQ 4FF4A 3J81L 4CJ2C 1RODA 2UUCL 1LTBD 3G6JB 4A3BB 3MEHA 1BBUA 1G2SA 4XYOA 2EY2A 1CKMA 3AU7A 4NMZA 5C3EB 3OWEB 4IOAA 1SNDA 1GKHA 2Q8RE 5JOBA 2DY8A 1HA5A 2JN4A 2MGSA 1WD0A 4DR4Q 4LFBQ 4ZKCB 1JOKA 4LAAA 1MJEA 2FMMA 2MPMA 3JC66 2ZTEA 2RSNA 2Y0SG 4A3GG 4DK6C 4BBRG 4ZQ3A 4KTAA 1SFOB 1MSHA 2KA7A 1F9PA 3H0GH 2FINB 2B63H 2MJ8A 3QOJA 1PFBA 1PH5A 2R93B 3D4RA 3HOXB 4FDBA 2MFIA 5KYIA 3AFPA 2L4NA 2PYKA 4C3IH 2VW9A 4UP9A 1W6KA 1SYBA 3WWVA 3QR8A 2OCEA 3PV0A 4KJNA 2IW3A 2F3VA 4X65L 4IPCA 3LGJA 2YU9B 2LY7A 3UDXA 5JPNC 5FLMH 3C1FA 4CDCC 5I6YA 1RIPA 1SEBD 4HTHA 2O4XA 4P71A 4DK1A 2Z4HA 2R7DA 3MXNB 2I46A 2QEXA 4G4KA 5GROA 1W2BA 2SNSA 3GTPH 1GM5A 1VQFA 2JQOA 1MKHA 4DK3C 3K7AB 2H4OA 5CV6A 4MZ9A 4EQOA 5KEEA 1LTGD 3J81E 3BS1A 3UDIA 1C0AA 1SNCA 1HUMA 4PNYA 5F2DA 4DPGA 5EKKA 3H3VC 1O7LA 1FJGQ 1ET6A 2IHEA 3CPFA 4DR5Q 1TWCB 3H94A 2HUGA 4R4IA 2BCOA 5LL6S 1HRJA 3NBHB 4EQPA 2NTSA 2UXDQ 1D6EC 4DV5Q 1P8LA 4H02A 4KI0A 2RVLA 5C0XI 1F9SA 3Q23A 2VUMB 5CV9A 1S72A 2F0LA 3I7FA 1CI3M 1I50B 4RWSC 1PH9A 3PQIA 5BN3A 2R92H 2RHQB 1SNMA 2KEDA 4R1JA 5BN4A 1UUPA 1JWMD 1C4QA 4A3CG 4DR1Q 4G57A 1S5CD 3SK5A 4L5RC 3QB3A 1K83H 4ID6A 1F9QA 3UE0A 1HTPA 2LXJA 1Y1WH 1C7YA 4HIKA 3QJYA 4K5WA 5LMNW 4WJ3M 2K5VA 2A5HA 5A2QL 3PUZA 1EOTA 2YTYA 3I72A 4OWWB 1VQ9A 4K8IA 4IN3A 3S2DB 3FKIH 2R61A 3MWYW 1O7IA 4A3FG 1EL0A 4IPDA 3W5OA 1GUOA 1N8RC 2HQEA 1WJJA 4A3LG 1PVOA 3GV3A 2ZXPA 4CJ1B 3E3XA 4R4QA 4ABNA 2J7ZA 4IUPA 2V1CC 1HHVA 3A8IE 1RTNA 1XPRA 2XRQD 5M9OA 3CC7A 1SLJA 3RNUA 2HHHL 2NZHA 1I6HH 1HNXL 5G3LF 1VQIA 1B50A 1MGSA 1IYJB 3C1EA 1TIID 1R4PB 1TXYA 1NR2A 2I0QA 1Q3LA 3GTQB 2M2LA 3PO2B 2WB1G 1AE2A 1HA6A 2KCNA 4KN4C 1BQQT 1KABA 1WTRA 3KLWA 3SK8A 2TMPA 3NE5B 3PIOA 2UXCQ 4HMJA 1GUWA 1XMOQ 1STEA 3CW2C 1YJ9A 3T4AC 1R4QB 1JC7A 3HOUH 2ALYB 4YCUA 1CA5A 1R9TH 1DOLA 1TU2B 1LTLA 1T5XD 3D4WA 2VQEQ 4O1NA 1A62A 4JI3L 2Z0SA 4B08A 4A3JH 1Q90A 5A2QE 5BN5A 2O2LD 5IP7G 4LF9L 1FGUA 4GLAC 1WFQA 4OO1G 4JI6Q 3VYTA 4CDFC 2Z9HA 4Q5VA 1PDQA 2RDGA 2RF4A 2L1BA 4YY3L 4AYBB 1B3AA 3HG9A 4F8MA 2E76C 2XN9C 4HAEA 3H91A 2NVQB 4O0AA 1NR4A 4C2MB 2DJFC 3X3NA 2GN5A 4OGQC 1XJVA 1L0WA 4OHJA 5C0XJ 5IYDH 2QGQA 1UEBA 1OXTA 4BY1G 5IP9G 3UDFA 3I4MG 1RD9D 1JORA 1E1TA 3HP3A 1VQ8A 3SHLA 4JCVE 2F3IA 4QGUA 1VQ5A 2AQ1B 1V8QA 5CYUA 5KYLA 4FXDA 3MAQA 3RZOB 4HSPA 4RAUC 3L3OC 3SEBA 3H3VI 3HRZC 4XT3B 2R7ZG 1G6PA 4IO9A 1MHWC 2HCCA 3KLSA 4DR2L 5M3MG 4N9PA 4B3SL 1EEFD 1EFID 3RZDB 2WFWA 4I7AA 3I2ZA 2MQHA 4KY7A 1QOHA 3R2IA 3IRBA 2EXZA 4A3IG 3MXNA 2ZXOA 4NW2A 2N78A 3I90A 3BDLA 3J81c 2E2DC 3GD7A 1LT5D 3S1QB 2NVYH 3I4NB 4DV1L 4MHEA 1IKMA 2L0CA 4C56C 1Z9FA 2HDMA 1HJPA 3PUVA 1Q7YC 2F52A 3PIPA 3OSOA 3R93A 1TWGB 1HZ9A 4YHHL 3A5ZB 3EFXD 5EKIA 3GTKB 1T5EA 4A93G 1SYCA 4A3EH 1HFNA 4HR7B 1PFNA 2MUYA 4BBRH 3CF5A 3S9WA 1X65A 4O2DA 2B8FA 4L6TB 4L5QA 4LFCL 4XQNA 4BS9A 2K28A 4X64L 1HNZQ 3GTJH 2PPBC 5C3XA 3VDYA 1EQVA 5E1FA 2K5HA 1D1IA 2ZT9C 2Q8IB 1Y8OB 3F1ZA 4LUVA 3PIO3 3PMFA 1PRTF 3MC0B 3S1RH 3ULJA 3GQBA 4XXEA 4PZ6A 4K2LA 4CDEC 2NBFA 3HKSA 4JBMA 1E2VA 3H15A 3T13A 1ML0D 1HUNA 1HNWL 3JAMi 1EYCA 3KJPA 3TP8A 3OPOA 4RGTA 4OL7A 3J80i 5M5XB 5DM63 3E0EA 2ASBA 2LKVA 5KNCA 1KD1C 5C6AA 1XTDA 4ZUIA 1QB5D 1IBML 2JYOA 1DD2A 4KHPQ 2F0QA 2R3ZA 3TS0A 4BA2I 2XVSA 3NBIA 2OQKA 3CCJA 4DUZL 4DAVA 4LJZC 4WJWA 3K58A 2O5IC 2EYPA 3S17B 5JJIA 3QO2A 4AIMA 1STHA 1BUVT 4HJ9A 2F0VA 1YNJC 2E2JB 1PTOB 1Q86C 2A1AA 3BYYB 3MFYA 4JI4L 1KLGD 3FMCA 4HSVA 2E2HB 2JEBI 1KNAA 2RDHA 1VQGA 1HR0Q 3DUZA 2F4VQ 1G51A 1EYGA 4JBJA 1JE4A 1BCPC 1BCPB 2ZM6L 4NB3A 5DNFA 1VQMA 4B3TL 2OTLA 1PV4A 4ALPA 3GP7A 4JVZA 1Y69U 1U4PA 1SSOA 3ND9A 1AZPA 4IPHA 4A75A 2F1MA 1YHBA 3Q22A 1EFWA 2PCFB 3L0OA 3T1YQ 4A3CH 2R92G 1N32Q 2EY6A 4JW0A 3D0FA 4EVOA 4DV0Q 1KQSA 3R3OA 1TKWB 1BXTA 4XQQA 2UUBQ 2AWOA 1JR0D 2A6ED 4A3DH 4PQXA 3GTGB 1SE2A 1D5MC 3S16H 4DR3Q 2CQAA 1EU3A 1D7QA 1BR9A 1I5FA 4AYBE 4KHVA 1SXTA 1RDPD 3VR6A 3BDCA 3KFUA 1JOQA 2L12A 1EIYB 4A3LH 2CWPA 3DWPA 2PI2A 5M3FG 4GKJL 3QIAA 1TWAB 1VQHA 4KV6A 2JA6H 1SE3A 2NVTH 2A68D 1WCMG 3CAMA 2VY3A 1DONA 3PUXA 5KRUA 2K1BA 4A3GB 5M5WB 2QDBA 5FOBB 2XWJB 1S5BD 1ENAA 3NXWA 4IOCA 4FVMA 4GS3A 5BR8Q 1D8LA 4I7ZC 1WTXA 4J15A 1IXRA 1VMPA 4GOPB 2K5QA 2BA0A 2QILA 4DAYA 1CSPA 1X3GA 5K5PA 3I55A 1KRSA 1BDOA 1RHPA 1UE5A 5KNBA 1OXSC 3CCUA 2A19A 2JA7B 5AJ3Q 2E2IB 1LTAD 4YCVA 5ISRA 3GTOB 4LF8Q 4GLXA 1QUQA 1Q1EA 2QDLA 2XGTA 1VF5C 2N8NA 2UU9L 1G6ZA 3CRLC 5EPKA 3V2TA 2B2VC 3KLSX 3JAML 3HOUG 1L1OC 1TS4A 3S15H 4KK7A 2IX0A 1VQCA 3OIPA 1WOCA 3M4PA 2ES2A 3BU2A 1VQ4A 3AFQA 3KYHC 4IQZA 2EY1A 4X66L 4BXXH 1RF2D 5CV5A 4C3HG 5M5YB 5T1IA 1FVIA 2X6GA 1CM9A 3BVMA 2EXDA 3OTOL 1K9MC 3CCLA 4JV5Q 4DV3L 4I65A 1QG7A 1A15A 2V4DA 4F88A 2NB0A 4FNFA 3J7A5 3TEHB 2UUAQ 3BG3A 3EJIA 3H3VH 3RD4A 3I4MH 2EE1A 5IYDG 5E3FA 4FYDA 1V1PB 5D3DA 3S2HH 4JI7L 3GTMH 4YIJA 3CCVA 5JEAJ 2R7ZH 4JI5L 4JI0L 5I6WA 2B8GA 2WACA 1TR5A 5C4XB 2F0IA 2L5TA 1UAPA 4DAMA 1KTKA 2MO1A 3CD6A 3ER0A 4LF4L 2JA8G 1PH7A 3TP5A 5IE8A 2D62A 4A3IH 3FVQA 1LLRD 1IYUA 3ERSX 1O80A 3JAME 3W2DA 1NBWA 3HOVH 2KEEA 1UWVA 1SNPA 2PNHA 4FO2A 3H6MA 3DWAA 4ODGA 4A3FB 1X9NA 3K7UC 3VR4A 2QKIC 2YTVA 4N8FA 4IFDI 1SMYD 1V1OA 3HOYG 4GZYC 3W1GA 2Z6KA 1TWFB 4FP5D 3T1HQ 3SK4A 4LFAL 3L7ZC 2G9DA 1VQKA 4X65Q 1PH3A 4A93H 3OIQA 4JI1L 4HJ7A 3CMAA 3CP0A 4A3EG 2IWHA 1PYBA 5IWAQ 1LV9A 3TZUA 4PMCA 4RG1A 4HEDA 1AN8A 3H09A 1PA6A 4GNXB 5JJZA 4DR7L 2HD3A 4DV7Q 3PF5A 1VQ7A 1PFMA 1D2BA 3ICEA 1LO5D 2KENA 4R9WA 3EQLC 1MD2D 3M3YH 3M7GA 2FHTA 4APVA 2F03A 1BVSA 4AH6A 1PZID 2CW0D 2K33A 2WB1B 2VL6A 1PH6A 1Z6HA 5CV8A 3I3CA 2VQFL 4TQUS 1ESRA 3DHQA 4XQJA 1STYA 1T9HA 1STGA 3ONAB 1V9PA 1A2TA 3TSSA 3K5MA 3ZJYC 1GXDC 5JJLA 1JJ2A 4LF7Q 4DR4L 3VA7A 4A3MG 4QQBX 2K05A 5CBEE 3IL8A 1WTHA 1LACA 2PW5A 3CQZH 5A35A 3CC4A 3AB9A 3KBXA 4L5TA 2A69D 4QB4A 3KUPA 4WFN3 4HIMA 1Y1VB 2HT1A 4L8JA 4P74A 4DU9A 2ID0A 3PO3H 4BBSB 5C0XG 4B3ML 5CBAE 3HOWB 4Y7NB 4IJHA 5I2YA 1HZBA 3QG1A 4JI2L 1A63A 1K3BC 2KJXA 4KKUA 1O7YA 3M85A 3D31A 4K14A 1SN8A 4C3JH 4R4OA 3TBIB 4GLVB 4UP8A 5FO8B 1I4XA 3URYA 3X3MA 5ELNA 1X3QA 4BY1B 1YNNC 2K14A 4X3SA 2I5MX 5CMDA 4IPGA 1TT2A 3O13A 4GOPA 4DF7A 1VQJA 1S5FD 3T56B 1X3PA 3SXHA 1B44D 4MIUA 1HH2P 4YWLA 1I94Q 1CSQA 4DR6Q 1EY6A 2KVMA 2RQXA 5M3MB 3A7LA 5IGEA 3EN2A 1DM0B 1GD7A 2JA5H 4A3DG 1A6XA 1XMQQ 4S3SA 2GA4B 5HURA 4HJAA 3FRPB 2DNEA 1B8AA 1QE6A 1FJGL 1N33Q 2D2CC 1CQFA 3A0JA 3TDQA 4DV4Q 4OWXB 1EWIA 3M4OB 1UE1A 4JYAQ 3LWEA 4KKSA 1F2MA 4ULLA 2SEBD 1KIXA 1NTGA 4DR5L 4IFDJ 1A3TA 1JICA 2CHBD 5M3FH 4LF6Q 5GAHC 1ENFA 1SE4A 2PNRC 3W3AA 2IL8A 4KLKA 1PH2A 2UXDL 3CU7A 2CH4A 4GN5A 4P73A 4QUCA 4J1MA 4NP5A 1WCMH 1SYFA 3J7AV 1JT8A 5CR3A 2JA6G 1EY4A 1EY9A 4LK1C 5IYCG 3HKZG 2NVXH 1CHPD 4GKKQ 3NTKA 3VR2A 1AP0A 3GDEA 2F0OA 1W6JA 1V1QA 5FK9C 3HOZH 1KHIA 2NZOA 3GTLH 4OELB 4CGYB 5COYA 2OTJA 2K5DA 2EYMA 4DR1L 3RN5A 3H0GB 1WI5A 1Z7TA 2B63B 1YITA 1OO9B 3TREA 4B9WA 1V1PA 3FP9A 1G2TA 1ZEQX 4C3IB 3BZKA 1PTOF 3K5LA 1M4VA 1VQAA 1N34Q 3S1NH 2R93G 3Q24A 1SROA 1LTRD 2P5ZX 2PMZB 4U68A 1XNRQ 4EQNA 2VS1A 3U58A 5CV4A 3Q6SA 2A8VA 1M8AA 4JG2A 2F0PA 2RSOA 3FDTA 3BYTB 5IGGA 3JAMc 1BCPF 4OX9L 3I73A 2QF7A 4F7XA 1WD1A 3GTPB 1NUCA 4DUYQ 4C3HH 5EBCA 4ZAIA 4BXXG 1NSNS 1X3EA 4RCNA 1PH8A 2EIFA 3TN2A 1K28A 2OQ0A 1RCVD 4CKBA 2GVBA 3PSIA 1TVXA 3NELA 4NXMQ 1TWHH 2NZ1D 2E5LQ 5I2XA 3F2DA 4B3RL 2WB1E 3E9HA 1SJHD 1VQBA 4L5SA 4P75A 2ICIA 4OWTB 2A6EC 1BBWA 3S1MH 3MXUA 4ME3A 1ASYA 1K8OA 1EZ6A 1X3FA 2F0TA 1E0BA 2L55A 5C44H 2UXCL 4DAYB 1XMOL 1M1KC 5IOCA 1EY0A 2Q2TA 1SYEA 4GNXA 2N88A 1X54A 3DXJC 4LUOA 3Q0AA 2L9HA 3V96A 4XTCS 1YIJA 2K5WA 3DMUA 2OXPA 1IW7D 1YHAA 3SDZA 4IUUA 2R92B 3SK6A 1EWHA 1QUQB 4DK0A 3FEWX 3P75A 2K03A 2VQEL 2JA8H 2KHJA 2IJ0A 4EQ5A 1CZWA 3K5OA 4DXFA 1K83B 1KAWA 4QL5A 1EQQA 1KLUD 2A68C 4N9TA 2FXQA 1FYCA 5HGQA 5IYBG 4X64Q 4LFCQ 1Y1WB 4JI6L 3DM1A 4XIGS 5I4DA 1EYDA 2K50A 3TP7A 3ULLA 1EYAA 4RH6A 4CKCA 4OONA 1C9OA 1VQPA 1STAA 3FKIB 2B2YA 4K5VA 3HOVG 1YBYA 2KECA 3G48A 4A4IA 3HOYH 2F0HA 1H9SA 2NWGA 3OYYA 5GADC 1YVCA 2Z8LA 1STNA 1VCIA 3A54A 3M4QA 4OEMB 5ELCA 1K8GA 3MFGA 1RKNA 5ELFA 2PZUA 3OMGA 5DLQE 1SE8A 1KC8C 2Q2HA 1HZAA 2JP1A 2C5CA 1LTID 5IGCA 2WP8J 4DUZQ 1I6HB 3HS0C 1SYGA 1J5EQ 4UP7A 4C1NI 1H95A 3QOLA 2EYLA 3A8KE 2PQAA 3U9SA 3CHBD 5C3WA 2M9VA 2BE5D 4X3TA 4NXNQ 5JPMC 5HY6A 2JEAI 1F2YA 2CH4W 2B2UA 2CVRA 1KDCA 1AH9A 1HZCA 3NWTA 4FF2A 4L63B 1NY4A 1B9MA 2K01A 4IUVA 3UI2A 2BDOA 1Q12A 1GUTA 2QCPX 3I4LA 5FLXL 2EOTA 2F0DA 4GN4B 3TP6A 1A8VA 1SR3A 2ZM6Q 3HOUB 1BO0A 3UE1A 4A3MH 1I3QH 1R9TB 4POGA 4DV2Q 3LX0A 2JXMB 3L2PA 1PYSB 5KNDA 5E4WC 3MZ5A 5J39A 1HPCA 3OW7A 1PZJD 3CMEA 3LWUA 2EZVA 1DZ1A 2A73B 4A3JB 1B2TA 1I4HA 2JA9A 1AFPA 1PTOC 5C0XH 2NN6I 3RR5A 3OWFA 1HNZL 2G9HD 4K0KQ 2G5DA 4ZUJA 1WVLA 5FJ8H 1IBKL 3PO3G 3DWQA 3ND8A 5C4JH 2PO4A 3NHHA 1J6QA 1C8CA 3D3RA 3K0YA 3F2CA 1CUKA 2CWAA 5JEAG 1CZGA 5LMNQ 3KF6B 4C3JG 3VYSA 5DAUA 2EPBA 2PMZE 3M4YA 2VB3X 3S14H 3NK9A 4R4TA 4WRDA 4DV6Q 4Y52H 1WTVA 2KCTA 4DFAA 4BY7H 4MTNA 4J6HA 1BNZA 1WTPA 5K36G 2B2WA 5JJKA 3RLFA 2R6GA 2A6HD 4FXKC 3PF4A 1W3SA 1MBYA 2WAQB 4A3KH 2PI2E 2NUCA 1SMYC 1WTOA 1HFGA 3ZYYX 2JA5G 3J81j 2N3SA 5ELEA 5AFWA 3C2PA 5LMUL 2E75C 2WV6D 3PUYA 2JSOA 1JE5A 1B4OA 2M00A 5FLXE 2VZAA 3BVZA 1LM0A 3U4VA 1PFSA 2CQOA 4C1NK 3NENA 2EDGA 2PZWA 1JWUD 3MXPA 2EY5A 1HR0L 3D6CA 1PLFA 1CHQD 3PUWA 3F2BA 1L2FA 2NVYB 2F4VL 4K8JA 5EPLA 4A3BH 4TRDA 3I70A 5J3BA 1VQLA 5C3EH 2CW0C 2OF1A 5IYCH 2OT2A 1J9OA 3I4OA 1QILA 2Y0SB 2UU9Q 3I4NG 2ZXRA 3MA2B 4A3EB 1JB3A 5LL6X 4BBRB 1QVFA 2UXBL 4PZ8A 3T1YL 2IY5B 5ELDA 3IFDA 1N32L 3VYUA 1A0IA 1SYDA 4DV0L 5EQ0A 3GTJB 3A7AB 3HOZG 1Q46A 3STBD 2UUBL 4GOPC 1SBBB 1VMCA 2OEOA 4DNRB 5IY0A 1SFOH 4H0LC 1E24A 4DR3L 1RTOA 3A5UA 4HN7A 4OXPA 4DN4M 4X62L 3S1RB 1ICWA 2J0TD 1XYIA 4KKTA 2R93H 1ILPA 3HOXH 1Q8KA 5H1SE 1XX8A 2A69C 3CCSA 1U4LA 1I4RA 4K2KA 5NUCA 3K6OA 1ZYRD 5E7NA 3BVGA 1ASZA 2ENBA 4PG3A 2RCFA 4R8NA 1YI2A 1QJOA 1LT4D 1B3QA 4PMWA 2TSSA 4ZKBB 2Z1CA 2YU9H 1XNQQ 1O7ZA 3J80L 1A3VA 1K8MA 4JI8Q 4U673 3N6RA 4A3MB 4AQYL 1F2LA 3DEPA 1FL0A 3MVVA 4IZ8A 4LF5Q 1Q8IA 1YZ6A 3K7AH 1QNUA 3OMCA 3K57A 2KCMA 5BR8L 4LF4Q 1MI2A 1N36Q 1IBLL 2L11A 2JE6I 4RFBA 3K5NA 1IZ6A 3DEOA 2F3WA 4WORA 1EZ8A 4G7OC 5KGUA 4PV1C 3UDGA 1TWCH 2UUCQ 5AJ3L 5D3IB 5C44G 4KD3A 4JC0A 5G3LD 4LF8L 3KLRA 3A55A 2ZJRA 3AEVA 1U5KA 1IL8A 4DA2A 2QEJC 3U50C 1F77A 2D5DA 5TSSA 2VUMH 5EPJA 1A3UA 4E6IA 1LUZA 2AUJD 3KDFB 4X3KA 5KIXA 3NWSA 1I50H 1CA6A 4A3DB 1VDZA 5IYBH 4WJ4A 3AMUA 2F4IA 4CBVA 1GVPA 1BF4A 1G8ZD 4IFDG 3B6YA 3S16B 4UPAA 3F8TA 1EY7A 4HJ5A 4IUNA 4JV5L 2B39A 3D4DA 2AQ2B 2MHVA 3J80E 2DUDA 2EYFA 2B2TA 5I9OA 2ZTCA 3GV6A 4RMFA 1IKLA 3S2DH 5DEHA 4QF4A 4XYQA 1YJNA 1HQRD 3J7ZC 2F0JA 4EX5A 3EIVA 4M8AA 2XWBB 1H9RA 2EJFC 2RCNA 4POFA 2JA6B 2WKDA 2NVTB 5IIFA 4FF3A 1ESFA 3HKZB 1LTTD 2WAQE 4HMIA 4KJOA 1GOZA 2F0EA 5FKAC 4GNXC 3P1HA 2H1EA 3KF6A 2EVBA 2AQ3B 2CFMA 2X69A 4BWGB 2LFNA 3J7AF 2SOBA 5I9PA 3D8GA 1WTWA 4G7ZC 3A74A 1NAPA 1EQRA 4DXGA 2Q2IA 4DNTB 1ZKOA 3SVMA 1I6VC 1VQNA 4LNQA 4RHSA 1DJRD 1CT1D 2F0GA 1U0LA 4B3MQ 4FF1A 1FNUA 4QJFA 2PQEA 4ZCKA 2N55A 2Q2UA 3GTQH 3PO2H 4JI2Q 3V05A 1B9NA 1B7YB 5EBDA 1FD7D 2NN6H 3HEJA 5FLXc 2BH2A 4IURA 4UAIA 2JA7G 1E22A 1CTMA 3T1HL 4NDXA 4LFBL 3S15B 1CFMA 2Y0SE 2B2YC 3HZXA 3TZDA 2XIWA 2LS01 3CRKC 2HIVA 1GHJA 1H9SB 4H44C 4CJ0B 3M7NA 1K73C 5IWAL 4JOIA 5IT9L 5FO9B 5FO7B 1IW7C 5FJ8G 5EAYA 4DV7L 1X32A 3VR3A 1KDBA 2FFKB 5JEAH 1JOOA 2QA4A 1X6OA 2KOLA 4M1UB 1ENCA 1C48A 4RCOA 3VYRA 4QUFA 2XNAC 4EGVA 2HIXA 2NVQH 2PQAB 1SDFA 3I4MB 4TSSA 1QZHA 1GUNA 1XPOA 4C2MH 2F0MA 4ILWA 4KMUC 5K36H 2B2UC 4BY7G 3S2HB 3GTMB 1FGBD 4HCSA 3ERQA 2R7ZB 1PRTD 1X56A 3NQIA 1K0RA 4JBKA 3IKJA 1H9MA 1QNKA 1K8AC 4LF7L 1PH4A 5CV7A 3NEMA 4A3KG 3RZOH 1MSGA 2D9UA 1VQDA 1VQEA 2NYZD 1YHQA 2HHHQ 1GUSA 1HNXQ 1E2WA 1NJIC 3GO5A 5C4XG 4A3IB 3I8ZA 2F0UA 5GAGC 4N8X1 3R8BA 5JVG3 4KY5A 5EJWA 3RZDH 2OWOA 4Z9CB 1J8IA 1XWEA 3A56A 3QWNA 1HR0W 4O42A 1NMGA 1KAAA 4KHZA 4LW1A 1FNWA 4DAPA 3HOVB 2BH8A 1A2UA 3E6ZX 4DV5L 3D6WA 4A3BG 2B2VA 2BE5C 1L1OA 3KBGA 3S1QH 2IX3A 2H5XA 3I4NH 1KNEA 2DY7A 5C3EG 4A93B 4RKLA 4X3UA 3MEFA 3RUZA 5IT9E 2DNCA 4XT1B 4QIWB 1G291 3F2UA 5EGTA 3TMEA 4KN7C 3N52A 1TWGH 1XTCD 4OX9Q 3GTKH 3WOEA 3P20A 2LMCB 3G4SA 1G91A 3KJOA 1SJED 1H9JA 1I94L 4DR6L 4JI3Q 3U4ZA 2EJGC 5ELBA 3TRZA 2B2WC 3KOJA 3OW2A 4LF9Q 2EQSA 3FHWA 1XMQL 2RKSA 1EQTA 1PMRA 3IAYA 3CC2A 3M3YB 4YY3Q 1WTQA 3G6EA 1FNVA 1N33L 3EVQA 3MTSA 4DV4L 2L15A 1IYVA 1EY8A 1WYDA 3HOXG 4JYAL 2KHSA 3KDFA 3R2TA 4B3RQ 2CKZB 4LF6L 3OOCA 3I56A 1B1ZA 3ULPA 4OIKA 1TY2A 3J80c 1JJCB 3U9OA 5M5XH 5EKLA 3HGBA 1ILQA 3HKZE 2ATWA 1AEXA 3NTIA 1E3PA 2E74C 3MXGA 4MNOA 2Q8TA 1DCZA 4GKKL 4HJ8A 5JVH3 3CQZB 4DR2Q 4G7HC 2F0FA 4B3SQ 3NPPA 3S17H 4V190 1MIUA 1U9RA 3AQQA 2D0OA 4HIDA 3PO3B 2DN8A 2EYJA 5IGFA 2A6HC 2JK8A 4IUQA 3KF8B 2E2JH 4JPBW 1Q82C 1PTOH 1D5ZC 2K7VA 3BJUA 4X6AH 1CKNB 1RJTA 1Y1VG 2IPKD 1D1KA 3DM3A 3E5SA 2E2HH 4BBSG 1X55A 1L0YB 1S5ED 1I4QA 4C3JB 5IODA 1SRUA 1PH1A 1DOKA 3HOWG 1JCKB 1EIGA 3MHBA 1N34L 4P72A 2I5LX 1UE6A 1JWSD 1XNRL 1ZXTA 4DV1Q 2AWNA 1H9KA 2RHSB 1D5XC 3CXCA 3BZCA 1HQMC 5IGDA 4OO1I 1I4PA 2C35B 3AYHB 2VUMG 4YHHQ 1EU4A 1ONLA 1YEZA 1NNXA 1U4MA 1GHKA 3FPUB 2LXKA 5C5MA 4DUYL 2YYZA 1XXGA 4IFDH 4MN3A 2ICEC 1QVGA 4B9XA 1EUJA 2KCCA 2JA5B 4K6LA 4A76A 2CCZA 2PW7A 1TY0A 4NPSA 5HGTA 1DOMA 3C3LA 3PGZA 2RDFA 3GTGH 1IHZA 1PXUA 4NXML 1EY5A 2WINB 3K0XA 1VF7A 2E5LL 3ITPA 2Z4IA 1S4ZA 4YCWA 1OXUA 2DJGC 3STBC 5IGBA 4RA8A 1PZKD 1YNND 2AKWB 4DGZA 5M3FB 3CCRA 1HNWQ 2JJQA 1KL9A 5CC4A 2K75A 4RHRA 1B70B 4K5XA 1WCMB 5JAVA 2HDLA 2NTTA 1IBMQ 1QVCA 1N9WA 1SMXA 4RGOS 2O5JC 4HCEA 1KDAA 1TWAH 1ZYRC 1OXVA 3EBEA 2NVXB 1STBA 3VR5A 3DLLA 1JB7A 3SE0A 1QZGA 3IFTA 2IT1A 3TQYA 3CPWA 3HOZB 5LHY1 3GTLB 1EWCA 4JBWA 4A3GH 5T1GA 5M5WH 2PZTA 2F0NA 4RKBA 4FXGC 4ME5A 4QCLA 2E8GA 3NBHA 2HQLA 3RLOA 2QW7A 3G71A 2LSSA 2I07B 1S3OA 4JI4Q 1JQYD 2BDNA 1IBKQ 2K04A 1F9RA 1BOSA 1NMFA 3H0GG 2HCIA 2D0PA 1BKBA 1NCVA 2BOSA 3PCOB 4LUZA 2B63G 2B29A 2I5HA 3PO2G 2R7FA 3S1NB 3NTHA 2AHOB 4RGMA 1DXMA 2JA7H 4B3TQ 1SAPA 4C3IG 2E2IH 2NN6G 3VA5A 2XSCA 3GTOH 3J7YW 4YWMA 4J8QA 4QIWE 2B2TC 1RL2A 5L37A 2Z6KC 5FLMG 2YV5A 1EIHA 4C3HB 3I91A 1DGSA 1CQVA 4H7BA 2SNMA 5E4XA 2GVAA 1DYQA 2BA1A 5D14A 5IT9c 2ZJPA 1S5DD 1Y14B 1GJXA 4TVAB 5M5YH 1HTLD 1J5EL 2MP1A 1Q1BA 1TWHB 1JMCA 2MO0A 4Q0FA 1P16A 5LMUQ 2IX1A 3CCEA 2YTXA 4NXNL 3NSWA 4AYBG 3S1MB 1K3RA 5C44B 2F0WA 1L0XB 4IJLA 3E0JA 4YWKA 1VQ6A 3RLNA 4KHPL 4GKJQ 1K0SA 1OTCA 1EOVA 2AMCB 2RA4A 1LABA 1AE3A 2VXWA 2WIIB 3T51B 1LT6D 5C5LA 4DV2L 3CCQA 2JA8B 5C4XH 2UXBQ 4UDUC 3K59A 2F0KA 1VQOA 4K0KL 2K32A 3LNNA 5GQOA 3FPPA 2WKCA 1LYLA 1PYWD 1SNQA 1UE7A 4NKLA 1ET9A 3J81i 2VNUD 4JOIC 4X62Q 1Y1WG 1Y8PB 4UY8C 1KXLA 1HXYD 1OXXK 4KD4A 5LMNL 4HIOA 3HOYB 4K6DA 2EJMA 3BDOA 2N49A 4A3FH 4LWCA 4DV6L 3FKIG 1QCBD 2KBNA 4CKEA 3M9BA 3PIP3 1Q81C 2A74C 1TWFH 3C46A 1V43A 1LTSD 3KF8A 3K80C 3Q8DA 1FR3A 2C9OA 5ELOA 1CKNA 3TS2A 4IALA 3EROA 4ZLTF 2K52A 3W1BA 4AQYQ 4X66Q 4MTKA 3T53B 3OTOQ 5J1ZA 1BBXC 3EA6A 3KK7A 4DV3Q 1AZQA 1PHJA 4KY6A 2XTIA 2K5NA 4ZYSA 4QMGA 4F87A 1MJCA 1IBLQ 5C4ZA 4TKOB 2EYHA 1KRTA 2DGYA 2J4XA 5CGKA 2KUMA 1ICFB 4XDXA 3G7LA 1Z47A 1NE3A 4ZK9B 3OHXC 1I3QB 3CKIB 3BZDB 4JI7Q 1TS2A 4UHVA 4JI5Q 3RMHA 2MNAA 1XPUA 4QY7A 4JI0Q 3HFZB 1L1OB 3K81C 4RGNA 4LMQD 5D65A 1UEAB 1E7ZA 2K6AA 3WDNA 1EEID 1I4GA 1F2ZA 1CKOA 3NUCA 3S24A 3E9IA 4DKAC 1PRTC 1PRTB 1GO3E 5IP7H 1AW7A 1HCZA 4R8IA 2KHIA 2Z6BA 4CHTB 2B3GA 4DNIA 4BA1I 1B53A 1Y1VH 5C4JB 4A3JG 2FJ2A 4PMBA 5CORA 4OO1H 3K8AA 4BBSH 3NP8A 2ZTDA 2XRSD 1M90C 1QWYA 5C4HA 3HOWH 2K4KA 4Y7NH 1CK1A 1TS5A 5DM73 1GUGA 2VB2X 1TQOA 1EIFA 1JJGA 3S14B 3SGIA 4H13C 4R4CA 2FMCA 4BY7B 1VS0A 2RBMA 1UNSA 4BY1H 4V0BA 1TS3A 2SDFA 4LFAQ 5IP9H 1XNQL 4JI1Q 5GAEC 2F0SA 3T16A 4JK1C 4JI8L 4PZ7A 5J22A 1E2ZA 1YNJD 1Y8NB 2AUKA 1PTOD 3NQTA 4A3KB 1S40A 3CCMA 2KQ3A 1LT3D 1O78A 1U4RA 1E1OA 3RN2A 4LF5L 5M3MH 1YNXA 2EYOA 2WAQG 4DR7Q 1IL2A 1II3A
chains in the Genus database with same CATH topology
3SR1A 1SNOA 3L9AX 4P2CB 1BCPD 4OIJA 3A8JE 2X6LA 4ZRZA 3WOFA 4IUTA 3P7JA 4FF4A 3J81L 4CJ2C 1RODA 1LTBD 3G6JB 4A3BB 3MEHA 1G2SA 4XYOA 2EY2A 4NMZA 3AU7A 5C3EB 3OWEB 1SNDA 2Q8RE 5JOBA 2DY8A 1HA5A 2MGSA 1WD0A 4ZKCB 1JOKA 4LAAA 2FMMA 2MPMA 2RSNA 4ZQ3A 4KTAA 1SFOB 1MSHA 2KA7A 1F9PA 2FINB 2MJ8A 3QOJA 1PFBA 2R93B 3D4RA 3HOXB 5KYIA 2L4NA 2PYKA 1W6KA 1SYBA 3PV0A 4KJNA 2IW3A 2F3VA 2YU9B 2LY7A 5JPNC 3C1FA 5I6YA 1SEBD 4HTHA 2O4XA 4DK1A 2Z4HA 2I46A 4G4KA 2SNSA 3K7AB 2H4OA 5CV6A 4EQOA 5KEEA 1LTGD 3J81E 3BS1A 1SNCA 1HUMA 4PNYA 5F2DA 5EKKA 3H3VC 1O7LA 1ET6A 1TWCB 3H94A 2HUGA 2BCOA 5LL6S 1HRJA 4EQPA 2NTSA 1D6EC 4KI0A 2RVLA 5C0XI 1F9SA 3Q23A 2VUMB 5CV9A 2F0LA 1CI3M 1I50B 4RWSC 5BN3A 1SNMA 2KEDA 5BN4A 1UUPA 1JWMD 1C4QA 4G57A 1S5CD 3SK5A 3QB3A 4ID6A 1F9QA 1HTPA 3QJYA 4K5WA 2A5HA 5A2QL 3PUZA 1EOTA 3I72A 4K8IA 4IN3A 3S2DB 2R61A 3MWYW 1EL0A 1GUOA 2HQEA 3GV3A 2ZXPA 4CJ1B 4ABNA 2J7ZA 4IUPA 1HHVA 3A8IE 1RTNA 2XRQD 5M9OA 5G3LF 1B50A 1MGSA 3C1EA 1TIID 1R4PB 1NR2A 1Q3LA 3GTQB 2M2LA 3PO2B 1HA6A 2KCNA 4KN4C 1BQQT 1KABA 1WTRA 3SK8A 2TMPA 3NE5B 4HMJA 1GUWA 1STEA 3T4AC 1R4QB 1JC7A 1CA5A 1DOLA 1TU2B 1T5XD 3D4WA 4O1NA 4B08A 1Q90A 5A2QE 5BN5A 2O2LD 4OO1G 3VYTA 4Q5VA 1PDQA 2RDGA 2L1BA 4AYBB 1B3AA 3HG9A 4F8MA 2E76C 2XN9C 4HAEA 3H91A 2NVQB 1NR4A 4C2MB 3X3NA 4OGQC 4OHJA 5C0XJ 1OXTA 1JORA 1RD9D 3HP3A 3SHLA 2AQ1B 1V8QA 5CYUA 5KYLA 4FXDA 3MAQA 3RZOB 4HSPA 4RAUC 3L3OC 3SEBA 3HRZC 4XT3B 2HCCA 3KLSA 4N9PA 1EEFD 1EFID 3RZDB 4KY7A 1QOHA 3R2IA 2EXZA 3MXNA 2ZXOA 4NW2A 3I90A 3BDLA 2E2DC 3GD7A 1LT5D 3S1QB 3I4NB 4MHEA 1IKMA 2L0CA 4C56C 2HDMA 3PUVA 3OSOA 3R93A 1TWGB 3EFXD 5EKIA 3GTKB 1T5EA 1SYCA 1HFNA 4HR7B 1PFNA 2MUYA 3S9WA 2B8FA 4L6TB 4XQNA 4BS9A 2K28A 2PPBC 5C3XA 1EQVA 5E1FA 1D1IA 2ZT9C 2Q8IB 1Y8OB 3PIO3 3PMFA 1PRTF 3MC0B 3GQBA 4XXEA 4K2LA 2NBFA 1E2VA 3T13A 1ML0D 1HUNA 1EYCA 3TP8A 3OPOA 4RGTA 4OL7A 5M5XB 5DM63 2LKVA 5KNCA 5C6AA 4ZUIA 1QB5D 2JYOA 1DD2A 2F0QA 2R3ZA 4BA2I 2XVSA 3NBIA 4DAVA 4LJZC 4WJWA 3K58A 2O5IC 2EYPA 3S17B 3QO2A 1STHA 1BUVT 2F0VA 1YNJC 2E2JB 1PTOB 3BYYB 3MFYA 1KLGD 3FMCA 4HSVA 2E2HB 2JEBI 1KNAA 2RDHA 3DUZA 1D2BA 1JE4A 1BCPC 1BCPB 5DNFA 3GP7A 1Y69U 1U4PA 1SSOA 3ND9A 1AZPA 2F1MA 3Q22A 2PCFB 2EY6A 4EVOA 3R3OA 1TKWB 1BXTA 4XQQA 2AWOA 1JR0D 2A6ED 4PQXA 3GTGB 1SE2A 1D5MC 2CQAA 1EU3A 1BR9A 4KHVA 1SXTA 1RDPD 3VR6A 3BDCA 1JOQA 2L12A 3DWPA 3QIAA 1TWAB 4KV6A 1SE3A 2A68D 1DONA 3PUXA 5KRUA 2K1BA 4A3GB 5M5WB 2QDBA 5FOBB 2XWJB 1S5BD 1ENAA 3NXWA 4FVMA 4I7ZC 1WTXA 1VMPA 2K5QA 2BA0A 2QILA 4DAYA 5K5PA 1BDOA 1RHPA 5KNBA 1OXSC 2JA7B 2E2IB 1LTAD 3GTOB 5ISRA 1Q1EA 1VF5C 1G6ZA 3CRLC 5EPKA 3V2TA 2B2VC 3KLSX 3JAML 1TS4A 4KK7A 2IX0A 3OIPA 4IQZA 2EY1A 1RF2D 5CV5A 4C3HG 5M5YB 5T1IA 2X6GA 1CM9A 3BVMA 4I65A 1QG7A 1A15A 2V4DA 4F88A 2NB0A 4FNFA 3BG3A 3EJIA 3RD4A 2EE1A 5E3FA 4FYDA 1V1PB 5D3DA 4YIJA 5JEAJ 5I6WA 2B8GA 2WACA 1TR5A 5C4XB 2F0IA 2L5TA 1UAPA 1KTKA 3TP5A 2D62A 3FVQA 1LLRD 1IYUA 1O80A 3JAME 3W2DA 2KEEA 1SNPA 4FO2A 3H6MA 3DWAA 4ODGA 4A3FB 3VR4A 2QKIC 4IFDI 1SMYD 1V1OA 4GZYC 1TWFB 4FP5D 3SK4A 3L7ZC 2G9DA 3OIQA 2IWHA 1LV9A 3TZUA 4PMCA 4HEDA 1AN8A 3H09A 5JJZA 1PFMA 1LO5D 4R9WA 3EQLC 1MD2D 3M7GA 2FHTA 2F03A 1PZID 2CW0D 2K33A 2WB1B 1Z6HA 5CV8A 3I3CA 4TQUS 1ESRA 3DHQA 4XQJA 1STYA 1STGA 3ONAB 3TSSA 1A2TA 3K5MA 1GXDC 3VA7A 2K05A 5CBEE 3IL8A 1LACA 2PW5A 5A35A 3AB9A 3KBXA 2A69D 4QB4A 3KUPA 4WFN3 1Y1VB 4L8JA 4DU9A 2ID0A 4BBSB 5C0XG 5CBAE 3HOWB 4Y7NB 5I2YA 3QG1A 2KJXA 4KKUA 1O7YA 3M85A 3D31A 4K14A 3TBIB 5FO8B 1I4XA 3URYA 3X3MA 4BY1B 1X3QA 1YNNC 4X3SA 5CMDA 1TT2A 3O13A 4DF7A 1S5FD 3T56B 1X3PA 3SXHA 1B44D 4MIUA 1EY6A 2KVMA 2RQXA 5M3MB 3A7LA 5IGEA 1DM0B 1A6XA 4S3SA 2GA4B 5HURA 3FRPB 2DNEA 1QE6A 2D2CC 1CQFA 3TDQA 3M4OB 3LWEA 4KKSA 1F2MA 4ULLA 2SEBD 4IFDJ 1A3TA 1JICA 2CHBD 1ENFA 1SE4A 2PNRC 3W3AA 2IL8A 3CU7A 4QUCA 4J1MA 4NP5A 1SYFA 3J7AV 5CR3A 1EY4A 1EY9A 4LK1C 1CHPD 3NTKA 3VR2A 1AP0A 2F0OA 1W6JA 5FK9C 4CGYB 5COYA 2K5DA 2EYMA 3H0GB 1Z7TA 2B63B 1OO9B 4B9WA 1V1PA 1G2TA 1ZEQX 4C3IB 1PTOF 3K5LA 1M4VA 3Q24A 2PMZB 1LTRD 4U68A 4EQNA 5CV4A 3Q6SA 1M8AA 2F0PA 2RSOA 3FDTA 3BYTB 5IGGA 1BCPF 3I73A 2QF7A 4F7XA 1WD1A 3GTPB 1NUCA 5EBCA 4ZAIA 1NSNS 4RCNA 3TN2A 1RCVD 4CKBA 1TVXA 2NZ1D 5I2XA 1SJHD 2ICIA 2A6EC 3MXUA 1K8OA 1EZ6A 2F0TA 1E0BA 2L55A 5IOCA 1EY0A 1SYEA 2N88A 3DXJC 3Q0AA 2L9HA 3V96A 4XTCS 2K5WA 3DMUA 3SDZA 1IW7D 2OXPA 4IUUA 2R92B 3SK6A 1EWHA 4DK0A 3FEWX 3P75A 2K03A 2IJ0A 1CZWA 3K5OA 4DXFA 1K83B 1KLUD 2A68C 4N9TA 1FYCA 1Y1WB 3DM1A 4XIGS 5I4DA 1EYDA 3TP7A 1EYAA 4RH6A 4CKCA 1STAA 3FKIB 2B2YA 4K5VA 2KECA 2F0HA 1H9SA 2NWGA 2Z8LA 1STNA 1VCIA 3A54A 5ELCA 3MFGA 1RKNA 5ELFA 2PZUA 3OMGA 2JP1A 2C5CA 1LTID 5IGCA 2WP8J 1I6HB 3HS0C 1SYGA 4C1NI 3QOLA 2EYLA 3A8KE 3U9SA 3CHBD 5C3WA 2M9VA 2BE5D 4X3TA 5JPMC 2JEAI 1F2YA 2B2UA 2CVRA 1KDCA 3NWTA 4FF2A 4L63B 2K01A 1B9MA 3UI2A 4IUVA 2BDOA 1Q12A 1GUTA 2QCPX 3I4LA 5FLXL 2EOTA 2F0DA 3TP6A 3HOUB 1BO0A 1R9TB 3LX0A 2JXMB 5KNDA 5E4WC 3MZ5A 5J39A 1HPCA 3OW7A 1PZJD 3LWUA 2EZVA 1DZ1A 2A73B 4A3JB 1B2TA 1I4HA 1AFPA 1PTOC 5C0XH 2NN6I 3OWFA 2G9HD 4ZUJA 1WVLA 3DWQA 3ND8A 2PO4A 3NHHA 1C8CA 3D3RA 3K0YA 5JEAG 1CZGA 4C3JG 3VYSA 5DAUA 2EPBA 3M4YA 2VB3X 3NK9A 4WRDA 1WTVA 4DFAA 4J6HA 1BNZA 1WTPA 5K36G 2B2WA 3RLFA 2R6GA 2A6HD 4FXKC 1MBYA 2WAQB 2NUCA 1SMYC 1WTOA 1HFGA 3ZYYX 5ELEA 5AFWA 3C2PA 2E75C 2WV6D 3PUYA 2JSOA 1B4OA 2M00A 5FLXE 3BVZA 4C1NK 2EDGA 2PZWA 1JWUD 3MXPA 2EY5A 3D6CA 1PLFA 1CHQD 3PUWA 2NVYB 4K8JA 5EPLA 4TRDA 3I70A 2CW0C 2OF1A 2OT2A 1J9OA 1QILA 2Y0SB 2ZXRA 3MA2B 4A3EB 1JB3A 5LL6X 4BBRB 5ELDA 3IFDA 3VYUA 1SYDA 3GTJB 5EQ0A 3A7AB 1SBBB 1VMCA 2OEOA 4DNRB 4H0LC 1RTOA 4HN7A 4DN4M 3S1RB 1ICWA 2J0TD 1XYIA 4KKTA 1ILPA 1XX8A 2A69C 1U4LA 1I4RA 4K2KA 5NUCA 3K6OA 1ZYRD 3BVGA 2ENBA 4R8NA 1QJOA 1LT4D 4PMWA 2TSSA 4ZKBB 2Z1CA 1O7ZA 3J80L 1A3VA 1K8MA 4U673 3N6RA 4A3MB 1F2LA 3DEPA 3MVVA 4IZ8A 1Q8IA 1QNUA 3OMCA 3K57A 1MI2A 2L11A 2JE6I 4RFBA 3K5NA 3DEOA 2F3WA 4WORA 1EZ8A 4G7OC 5KGUA 4PV1C 5D3IB 4KD3A 5G3LD 3KLRA 3A55A 1IL8A 4DA2A 2QEJC 1F77A 2D5DA 5TSSA 5EPJA 1A3UA 4E6IA 4X3KA 2AUJD 5KIXA 3NWSA 1CA6A 4A3DB 1VDZA 3AMUA 2F4IA 4CBVA 1BF4A 1G8ZD 4IFDG 3S16B 1EY7A 4IUNA 2B39A 3D4DA 2AQ2B 2MHVA 3J80E 2EYFA 2B2TA 5I9OA 3GV6A 1IKLA 5DEHA 4QF4A 4XYQA 1HQRD 2F0JA 4M8AA 2XWBB 1H9RA 2EJFC 2JA6B 2WKDA 2NVTB 5IIFA 4FF3A 1ESFA 3HKZB 1LTTD 4HMIA 4KJOA 1GOZA 2F0EA 5FKAC 3P1HA 2H1EA 2EVBA 2AQ3B 2X69A 4BWGB 2LFNA 3J7AF 2SOBA 5I9PA 3D8GA 1WTWA 4G7ZC 1NAPA 4DXGA 4DNTB 1ZKOA 3SVMA 1I6VC 4RHSA 1DJRD 1CT1D 2F0GA 4FF1A 1FNUA 2PQEA 2N55A 3V05A 1B9NA 5EBDA 1FD7D 2NN6H 3HEJA 4IURA 4UAIA 1CTMA 4NDXA 3S15B 1CFMA 2B2YC 3HZXA 3TZDA 2XIWA 2LS01 3CRKC 1GHJA 1H9SB 4H44C 4CJ0B 3M7NA 5FO9B 5IT9L 5FO7B 1IW7C 1X32A 3VR3A 1KDBA 2FFKB 5JEAH 1JOOA 2KOLA 4M1UB 1ENCA 1C48A 4RCOA 3VYRA 4QUFA 2XNAC 4EGVA 1SDFA 3I4MB 4TSSA 1GUNA 2F0MA 4ILWA 4KMUC 5K36H 2B2UC 3S2HB 3GTMB 1FGBD 4HCSA 3ERQA 2R7ZB 1PRTD 3NQIA 3IKJA 1H9MA 1QNKA 5CV7A 1MSGA 2D9UA 2NYZD 1GUSA 1E2WA 3GO5A 4A3IB 3I8ZA 2F0UA 5JVG3 3R8BA 4KY5A 5EJWA 4Z9CB 1J8IA 1XWEA 3A56A 3QWNA 4O42A 1KAAA 4KHZA 1FNWA 4DAPA 3HOVB 1A2UA 3E6ZX 3D6WA 2B2VA 2BE5C 3KBGA 2IX3A 1KNEA 2DY7A 4A93B 4RKLA 4X3UA 3RUZA 5IT9E 3TMEA 2DNCA 4XT1B 1G291 3F2UA 4QIWB 5EGTA 4KN7C 3N52A 1XTCD 3WOEA 3P20A 2LMCB 1G91A 1SJED 1H9JA 2EJGC 5ELBA 2B2WC 2RKSA 1EQTA 1PMRA 3IAYA 3M3YB 1WTQA 1FNVA 3EVQA 3MTSA 1IYVA 1EY8A 2KHSA 3R2TA 3OOCA 1B1ZA 4OIKA 1TY2A 3U9OA 5EKLA 3HGBA 1ILQA 1AEXA 3NTIA 2E74C 3MXGA 2Q8TA 1DCZA 5JVH3 3CQZB 4G7HC 2F0FA 3NPPA 4V190 1U9RA 3PO3B 2DN8A 2EYJA 5IGFA 2A6HC 4IUQA 1PTOH 1D5ZC 2K7VA 1RJTA 2IPKD 1D1KA 3E5SA 1L0YB 1S5ED 1I4QA 4C3JB 5IODA 1DOKA 1JCKB 1EIGA 3MHBA 1JWSD 1ZXTA 2AWNA 1H9KA 1D5XC 1HQMC 5IGDA 4OO1I 1I4PA 1EU4A 1ONLA 1U4MA 1GHKA 3FPUB 5C5MA 2YYZA 1XXGA 4IFDH 4MN3A 2ICEC 4B9XA 2KCCA 2JA5B 4K6LA 2PW7A 1TY0A 5HGTA 1DOMA 3C3LA 2RDFA 1IHZA 1PXUA 1EY5A 2WINB 1VF7A 3ITPA 2Z4IA 1S4ZA 1OXUA 5IGBA 4RA8A 1PZKD 1YNND 4DGZA 5M3FB 5CC4A 4RHRA 4K5XA 1WCMB 5JAVA 2HDLA 2NTTA 2O5JC 4RGOS 4HCEA 1KDAA 1ZYRC 1OXVA 2NVXB 1STBA 3VR5A 3SE0A 3IFTA 2IT1A 3HOZB 5LHY1 3GTLB 1EWCA 4JBWA 5T1GA 2PZTA 2F0NA 4RKBA 4FXGC 4ME5A 4QCLA 3NBHA 2I07B 1JQYD 2BDNA 2K04A 1F9RA 1BOSA 2HCIA 1NCVA 2BOSA 3S1NB 3NTHA 4RGMA 1DXMA 1SAPA 4C3IG 2NN6G 3VA5A 2XSCA 3J7YW 4J8QA 2B2TC 1EIHA 4C3HB 3I91A 1CQVA 4H7BA 2SNMA 5E4XA 1DYQA 2BA1A 5D14A 1S5DD 1GJXA 1HTLD 2MP1A 1Q1BA 1TWHB 4Q0FA 2IX1A 3NSWA 3S1MB 5C44B 2F0WA 1L0XB 3E0JA 2RA4A 1LABA 2VXWA 2WIIB 3T51B 1LT6D 5C5LA 2JA8B 4UDUC 3K59A 2F0KA 2K32A 3LNNA 3FPPA 2WKCA 4NKLA 1PYWD 1SNQA 1ET9A 2VNUD 1Y8PB 1HXYD 1OXXK 4KD4A 3HOYB 4K6DA 2EJMA 3BDOA 1QCBD 3PIP3 4CKEA 2A74C 3C46A 1V43A 1LTSD 3KF8A 1FR3A 2C9OA 4IALA 3EROA 4ZLTF 3T53B 1BBXC 5J1ZA 3EA6A 3KK7A 1AZQA 4KY6A 4ZYSA 4QMGA 4F87A 5C4ZA 4TKOB 2EYHA 2J4XA 5CGKA 2KUMA 4XDXA 3G7LA 1Z47A 4ZK9B 3OHXC 1I3QB 3CKIB 3BZDB 1TS2A 3RMHA 4RGNA 4LMQD 5D65A 1UEAB 2K6AA 3WDNA 1EEID 1I4GA 1F2ZA 3NUCA 1PRTC 1PRTB 1AW7A 1HCZA 4R8IA 4CHTB 4BA1I 1B53A 5C4JB 4OO1H 2FJ2A 4PMBA 5CORA 3NP8A 2XRSD 1QWYA 5C4HA 1CK1A 1TS5A 5DM73 1GUGA 2VB2X 1TQOA 3S14B 4H13C 2FMCA 4BY7B 2RBMA 1UNSA 4V0BA 1TS3A 2SDFA 2F0SA 3T16A 4JK1C 5J22A 1E2ZA 1YNJD 1Y8NB 2AUKA 1PTOD 3NQTA 4A3KB 2KQ3A 1LT3D 1O78A 1U4RA 2EYOA 1II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0U A;  1STG A;  4IAL A;  1SNO A;  4KJO A;  3EJI A;  2F0E A;  3ERO A;  1A3V A;  3P1H A;  4N9T A;  3SR1 A;  3S9W A;  3MHB A;  4KY5 A;  5DAU A;  2F0O A;  1A2T A;  4EQP A;  3NK9 A;  4WRD A;  2SOB A;  4KHV A;  5I9P A;  1EYD A;  1KAA A;  3D8G A;  2EYM A;  1EQV A;  5E1F A;  1EYA A;  5E3F A;  5J1Z A;  3TP7 A;  4DFA A;  3MVV A;  1STA A;  4H7B A;  1STY A;  3D4W A;  5IGD A;  2SNM A;  3BDC A;  1A2U A;  4IZ8 A;  4J6H A;  4K5V A;  4B9W A;  4KY6 A;  1JOQ A;  5CV9 A;  4YIJ A;  2F0H A;  2PW5 A;  3PMF A;  3MEH A;  4QMG A;  2EY2 A;  4NMZ A;  2F0G A;  2F0L A;  4QB4 A;  5I6W A;  3OMC A;  1STN A;  2WAC A;  5C5M A;  1TR5 A;  4K2L A;  2PQE A;  5C4Z A;  1SND A;  4RKL A;  2F0I A;  4DU9 A;  2NUC A;  3RUZ A;  1SNM A;  4B9X A;  3T13 A;  3TME A;  5JOB A;  5EGT A;  2EYH A;  4KV6 A;  1RKN A;  2PW7 A;  1EYC A;  4EQN A;  5CGK A;  2PZU A;  3OMG A;  3TP8 A;  3HEJ A;  4G57 A;  4F8M A;  5CV4 A;  5HGT A;  4OL7 A;  3SK5 A;  1JOK A;  3QB3 A;  2F3W A;  4ID6 A;  4LAA A;  4WOR A;  1EZ8 A;  2F0P A;  2RDF A;  1IHZ A;  3TP5 A;  5KRU A;  2LKV A;  4K14 A;  5KGU A;  4NDX A;  5IGG A;  5C6A A;  2M00 A;  4ZUI A;  5IGC A;  2QDB A;  2F0W A;  3HZX A;  1EY5 A;  4F7X A;  2F0Q A;  3ITP A;  4KD3 A;  4ZQ3 A;  1SYG A;  4K5W A;  1ENA A;  3NXW A;  4KTA A;  5IOD A;  1NUC A;  2PZW A;  2RKS A;  3QOL A;  3MXP A;  2EYL A;  2EY5 A;  5IGB A;  4K8I A;  3D6C A;  1JOR A;  4DGZ A;  5C3W A;  1TT2 A;  2EYP A;  1SNP A;  3SHL A;  3QOJ A;  3H6M A;  4ODG A;  1NSN S;  5CC4 A;  1F2Z A;  4DF7 A;  1F2Y A;  3NUC A;  5C3X A;  5KYL A;  3EVQ A;  1KDC A;  4K8J A;  5C5L A;  5K5P A;  1A3U A;  1STH A;  5KYI A;  4E6I A;  1EY8 A;  4K5X A;  3SXH A;  4TRD A;  5KIX A;  2PYK A;  4MIU A;  5JAV A;  2F0V A;  2KHS A;  2HQE A;  2OF1 A;  1EY6 A;  1SYB A;  4PMB A;  3SK4 A;  1KDB A;  3NP8 A;  5IGE A;  1JOO A;  4N9P A;  5C4H A;  1KDA A;  4KJN A;  5ISR A;  2F3V A;  2F0D A;  1STB A;  4S3S A;  2F0K A;  3TP6 A;  5HUR A;  3C1F A;  1ENC A;  5I6Y A;  1TQO A;  4HTH A;  1EY7 A;  4PMC A;  4IUN A;  2O4X A;  3U9O A;  3V2T A;  5M9O A;  5EKL A;  4KY7 A;  3D4D A;  1SYD A;  4NKL A;  1EZ6 A;  1SNQ A;  2F0T A;  2EXZ A;  2F0M A;  3LX0 A;  1AEX A;  5IOC A;  1EY0 A;  2EYF A;  2PZT A;  1SYE A;  2OEO A;  2RBM A;  2F0N A;  1F2M A;  2SNS A;  5J39 A;  3MZ5 A;  3C1E A;  4ME5 A;  4RKB A;  4KD4 A;  5I9O A;  1A3T A;  3BDL A;  2EY1 A;  2F0S A;  3ERQ A;  4K6D A;  5CV6 A;  2F0F A;  3T16 A;  5CV5 A;  3DMU A;  5DEH A;  4QF4 A;  4EQO A;  5J22 A;  2OXP A;  1U9R A;  5KEE A;  2F0J A;  3OWF A;  3NQT A;  4ZUJ A;  5CV7 A;  2EYJ A;  3SK6 A;  5IGF A;  1SNC A;  2KQ3 A;  4J1M A;  4NP5 A;  4PNY A;  4K2K A;  4I65 A;  5CV8 A;  2EY6 A;  3P75 A;  5F2D A;  5NUC A;  1SYF A;  5EKK A;  1KAB A;  4EVO A;  3SK8 A;  2ENB A;  3OSO A;  3DHQ A;  3R3O A;  5CR3 A;  4HMJ A;  3NHH A;  5IIF A;  4R8N A;  1EY4 A;  3VA5 A;  1EY9 A;  2EYO A;  4HMI A;  3E5S A;  1SYC A;  1II3 A; 
#chains in the Genus database with same CATH topology
 3SR1 A;  1SNO A;  3L9A X;  4P2C B;  1BCP D;  4GN3 B;  4OIJ A;  4CDD C;  3A8J E;  1YJW A;  1N36 L;  2IHF A;  2UUA L;  2X6L A;  4ZRZ A;  3WOF A;  2ZJQ A;  4IUT A;  3P7J A;  3M4O H;  2VQF Q;  4FF4 A;  3J81 L;  4CJ2 C;  1ROD A;  2UUC L;  1LTB D;  3G6J B;  4A3B B;  3MEH A;  1BBU A;  1G2S A;  4XYO A;  2EY2 A;  1CKM A;  3AU7 A;  4NMZ A;  5C3E B;  3OWE B;  4IOA A;  1SND A;  1GKH A;  2Q8R E;  5JOB A;  2DY8 A;  1HA5 A;  2JN4 A;  2MGS A;  1WD0 A;  4DR4 Q;  4LFB Q;  4ZKC B;  1JOK A;  4LAA A;  1MJE A;  2FMM A;  2MPM A;  3JC6 6;  2ZTE A;  2RSN A;  2Y0S G;  4A3G G;  4DK6 C;  4BBR G;  4ZQ3 A;  4KTA A;  1SFO B;  1MSH A;  2KA7 A;  1F9P A;  3H0G H;  2FIN B;  2B63 H;  2MJ8 A;  3QOJ A;  1PFB A;  1PH5 A;  2R93 B;  3D4R A;  3HOX B;  4FDB A;  2MFI A;  5KYI A;  3AFP A;  2L4N A;  2PYK A;  4C3I H;  2VW9 A;  4UP9 A;  1W6K A;  1SYB A;  3WWV A;  3QR8 A;  2OCE A;  3PV0 A;  4KJN A;  2IW3 A;  2F3V A;  4X65 L;  4IPC A;  3LGJ A;  2YU9 B;  2LY7 A;  3UDX A;  5JPN C;  5FLM H;  3C1F A;  4CDC C;  5I6Y A;  1RIP A;  1SEB D;  4HTH A;  2O4X A;  4P71 A;  4DK1 A;  2Z4H A;  2R7D A;  3MXN B;  2I46 A;  2QEX A;  4G4K A;  5GRO A;  1W2B A;  2SNS A;  3GTP H;  1GM5 A;  1VQF A;  2JQO A;  1MKH A;  4DK3 C;  3K7A B;  2H4O A;  5CV6 A;  4MZ9 A;  4EQO A;  5KEE A;  1LTG D;  3J81 E;  3BS1 A;  3UDI A;  1C0A A;  1SNC A;  1HUM A;  4PNY A;  5F2D A;  4DPG A;  5EKK A;  3H3V C;  1O7L A;  1FJG Q;  1ET6 A;  2IHE A;  3CPF A;  4DR5 Q;  1TWC B;  3H94 A;  2HUG A;  4R4I A;  2BCO A;  5LL6 S;  1HRJ A;  3NBH B;  4EQP A;  2NTS A;  2UXD Q;  1D6E C;  4DV5 Q;  1P8L A;  4H02 A;  4KI0 A;  2RVL A;  5C0X I;  1F9S A;  3Q23 A;  2VUM B;  5CV9 A;  1S72 A;  2F0L A;  3I7F A;  1CI3 M;  1I50 B;  4RWS C;  1PH9 A;  3PQI A;  5BN3 A;  2R92 H;  2RHQ B;  1SNM A;  2KED A;  4R1J A;  5BN4 A;  1UUP A;  1JWM D;  1C4Q A;  4A3C G;  4DR1 Q;  4G57 A;  1S5C D;  3SK5 A;  4L5R C;  3QB3 A;  1K83 H;  4ID6 A;  1F9Q A;  3UE0 A;  1HTP A;  2LXJ A;  1Y1W H;  1C7Y A;  4HIK A;  3QJY A;  4K5W A;  5LMN W;  4WJ3 M;  2K5V A;  2A5H A;  5A2Q L;  3PUZ A;  1EOT A;  2YTY A;  3I72 A;  4OWW B;  1VQ9 A;  4K8I A;  4IN3 A;  3S2D B;  3FKI H;  2R61 A;  3MWY W;  1O7I A;  4A3F G;  1EL0 A;  4IPD A;  3W5O A;  1GUO A;  1N8R C;  2HQE A;  1WJJ A;  4A3L G;  1PVO A;  3GV3 A;  2ZXP A;  4CJ1 B;  3E3X A;  4R4Q A;  4ABN A;  2J7Z A;  4IUP A;  2V1C C;  1HHV A;  3A8I E;  1RTN A;  1XPR A;  2XRQ D;  5M9O A;  3CC7 A;  1SLJ A;  3RNU A;  2HHH L;  2NZH A;  1I6H H;  1HNX L;  5G3L F;  1VQI A;  1B50 A;  1MGS A;  1IYJ B;  3C1E A;  1TII D;  1R4P B;  1TXY A;  1NR2 A;  2I0Q A;  1Q3L A;  3GTQ B;  2M2L A;  3PO2 B;  2WB1 G;  1AE2 A;  1HA6 A;  2KCN A;  4KN4 C;  1BQQ T;  1KAB A;  1WTR A;  3KLW A;  3SK8 A;  2TMP A;  3NE5 B;  3PIO A;  2UXC Q;  4HMJ A;  1GUW A;  1XMO Q;  1STE A;  3CW2 C;  1YJ9 A;  3T4A C;  1R4Q B;  1JC7 A;  3HOU H;  2ALY B;  4YCU A;  1CA5 A;  1R9T H;  1DOL A;  1TU2 B;  1LTL A;  1T5X D;  3D4W A;  2VQE Q;  4O1N A;  1A62 A;  4JI3 L;  2Z0S A;  4B08 A;  4A3J H;  1Q90 A;  5A2Q E;  5BN5 A;  2O2L D;  5IP7 G;  4LF9 L;  1FGU A;  4GLA C;  1WFQ A;  4OO1 G;  4JI6 Q;  3VYT A;  4CDF C;  2Z9H A;  4Q5V A;  1PDQ A;  2RDG A;  2RF4 A;  2L1B A;  4YY3 L;  4AYB B;  1B3A A;  3HG9 A;  4F8M A;  2E76 C;  2XN9 C;  4HAE A;  3H91 A;  2NVQ B;  4O0A A;  1NR4 A;  4C2M B;  2DJF C;  3X3N A;  2GN5 A;  4OGQ C;  1XJV A;  1L0W A;  4OHJ A;  5C0X J;  5IYD H;  2QGQ A;  1UEB A;  1OXT A;  4BY1 G;  5IP9 G;  3UDF A;  3I4M G;  1RD9 D;  1JOR A;  1E1T A;  3HP3 A;  1VQ8 A;  3SHL A;  4JCV E;  2F3I A;  4QGU A;  1VQ5 A;  2AQ1 B;  1V8Q A;  5CYU A;  5KYL A;  4FXD A;  3MAQ A;  3RZO B;  4HSP A;  4RAU C;  3L3O C;  3SEB A;  3H3V I;  3HRZ C;  4XT3 B;  2R7Z G;  1G6P A;  4IO9 A;  1MHW C;  2HCC A;  3KLS A;  4DR2 L;  5M3M G;  4N9P A;  4B3S L;  1EEF D;  1EFI D;  3RZD B;  2WFW A;  4I7A A;  3I2Z A;  2MQH A;  4KY7 A;  1QOH A;  3R2I A;  3IRB A;  2EXZ A;  4A3I G;  3MXN A;  2ZXO A;  4NW2 A;  2N78 A;  3I90 A;  3BDL A;  3J81 c;  2E2D C;  3GD7 A;  1LT5 D;  3S1Q B;  2NVY H;  3I4N B;  4DV1 L;  4MHE A;  1IKM A;  2L0C A;  4C56 C;  1Z9F A;  2HDM A;  1HJP A;  3PUV A;  1Q7Y C;  2F52 A;  3PIP A;  3OSO A;  3R93 A;  1TWG B;  1HZ9 A;  4YHH L;  3A5Z B;  3EFX D;  5EKI A;  3GTK B;  1T5E A;  4A93 G;  1SYC A;  4A3E H;  1HFN A;  4HR7 B;  1PFN A;  2MUY A;  4BBR H;  3CF5 A;  3S9W A;  1X65 A;  4O2D A;  2B8F A;  4L6T B;  4L5Q A;  4LFC L;  4XQN A;  4BS9 A;  2K28 A;  4X64 L;  1HNZ Q;  3GTJ H;  2PPB C;  5C3X A;  3VDY A;  1EQV A;  5E1F A;  2K5H A;  1D1I A;  2ZT9 C;  2Q8I B;  1Y8O B;  3F1Z A;  4LUV A;  3PIO 3;  3PMF A;  1PRT F;  3MC0 B;  3S1R H;  3ULJ A;  3GQB A;  4XXE A;  4PZ6 A;  4K2L A;  4CDE C;  2NBF A;  3HKS A;  4JBM A;  1E2V A;  3H15 A;  3T13 A;  1ML0 D;  1HUN A;  1HNW L;  3JAM i;  1EYC A;  3KJP A;  3TP8 A;  3OPO A;  4RGT A;  4OL7 A;  3J80 i;  5M5X B;  5DM6 3;  3E0E A;  2ASB A;  2LKV A;  5KNC A;  1KD1 C;  5C6A A;  1XTD A;  4ZUI A;  1QB5 D;  1IBM L;  2JYO A;  1DD2 A;  4KHP Q;  2F0Q A;  2R3Z A;  3TS0 A;  4BA2 I;  2XVS A;  3NBI A;  2OQK A;  3CCJ A;  4DUZ L;  4DAV A;  4LJZ C;  4WJW A;  3K58 A;  2O5I C;  2EYP A;  3S17 B;  5JJI A;  3QO2 A;  4AIM A;  1STH A;  1BUV T;  4HJ9 A;  2F0V A;  1YNJ C;  2E2J B;  1PTO B;  1Q86 C;  2A1A A;  3BYY B;  3MFY A;  4JI4 L;  1KLG D;  3FMC A;  4HSV A;  2E2H B;  2JEB I;  1KNA A;  2RDH A;  1VQG A;  1HR0 Q;  3DUZ A;  2F4V Q;  1G51 A;  1EYG A;  4JBJ A;  1JE4 A;  1BCP C;  1BCP B;  2ZM6 L;  4NB3 A;  5DNF A;  1VQM A;  4B3T L;  2OTL A;  1PV4 A;  4ALP A;  3GP7 A;  4JVZ A;  1Y69 U;  1U4P A;  1SSO A;  3ND9 A;  1AZP A;  4IPH A;  4A75 A;  2F1M A;  1YHB A;  3Q22 A;  1EFW A;  2PCF B;  3L0O A;  3T1Y Q;  4A3C H;  2R92 G;  1N32 Q;  2EY6 A;  4JW0 A;  3D0F A;  4EVO A;  4DV0 Q;  1KQS A;  3R3O A;  1TKW B;  1BXT A;  4XQQ A;  2UUB Q;  2AWO A;  1JR0 D;  2A6E D;  4A3D H;  4PQX A;  3GTG B;  1SE2 A;  1D5M C;  3S16 H;  4DR3 Q;  2CQA A;  1EU3 A;  1D7Q A;  1BR9 A;  1I5F A;  4AYB E;  4KHV A;  1SXT A;  1RDP D;  3VR6 A;  3BDC A;  3KFU A;  1JOQ A;  2L12 A;  1EIY B;  4A3L H;  2CWP A;  3DWP A;  2PI2 A;  5M3F G;  4GKJ L;  3QIA A;  1TWA B;  1VQH A;  4KV6 A;  2JA6 H;  1SE3 A;  2NVT H;  2A68 D;  1WCM G;  3CAM A;  2VY3 A;  1DON A;  3PUX A;  5KRU A;  2K1B A;  4A3G B;  5M5W B;  2QDB A;  5FOB B;  2XWJ B;  1S5B D;  1ENA A;  3NXW A;  4IOC A;  4FVM A;  4GS3 A;  5BR8 Q;  1D8L A;  4I7Z C;  1WTX A;  4J15 A;  1IXR A;  1VMP A;  4GOP B;  2K5Q A;  2BA0 A;  2QIL A;  4DAY A;  1CSP A;  1X3G A;  5K5P A;  3I55 A;  1KRS A;  1BDO A;  1RHP A;  1UE5 A;  5KNB A;  1OXS C;  3CCU A;  2A19 A;  2JA7 B;  5AJ3 Q;  2E2I B;  1LTA D;  4YCV A;  5ISR A;  3GTO B;  4LF8 Q;  4GLX A;  1QUQ A;  1Q1E A;  2QDL A;  2XGT A;  1VF5 C;  2N8N A;  2UU9 L;  1G6Z A;  3CRL C;  5EPK A;  3V2T A;  2B2V C;  3KLS X;  3JAM L;  3HOU G;  1L1O C;  1TS4 A;  3S15 H;  4KK7 A;  2IX0 A;  1VQC A;  3OIP A;  1WOC A;  3M4P A;  2ES2 A;  3BU2 A;  1VQ4 A;  3AFQ A;  3KYH C;  4IQZ A;  2EY1 A;  4X66 L;  4BXX H;  1RF2 D;  5CV5 A;  4C3H G;  5M5Y B;  5T1I A;  1FVI A;  2X6G A;  1CM9 A;  3BVM A;  2EXD A;  3OTO L;  1K9M C;  3CCL A;  4JV5 Q;  4DV3 L;  4I65 A;  1QG7 A;  1A15 A;  2V4D A;  4F88 A;  2NB0 A;  4FNF A;  3J7A 5;  3TEH B;  2UUA Q;  3BG3 A;  3EJI A;  3H3V H;  3RD4 A;  3I4M H;  2EE1 A;  5IYD G;  5E3F A;  4FYD A;  1V1P B;  5D3D A;  3S2H H;  4JI7 L;  3GTM H;  4YIJ A;  3CCV A;  5JEA J;  2R7Z H;  4JI5 L;  4JI0 L;  5I6W A;  2B8G A;  2WAC A;  1TR5 A;  5C4X B;  2F0I A;  2L5T A;  1UAP A;  4DAM A;  1KTK A;  2MO1 A;  3CD6 A;  3ER0 A;  4LF4 L;  2JA8 G;  1PH7 A;  3TP5 A;  5IE8 A;  2D62 A;  4A3I H;  3FVQ A;  1LLR D;  1IYU A;  3ERS X;  1O80 A;  3JAM E;  3W2D A;  1NBW A;  3HOV H;  2KEE A;  1UWV A;  1SNP A;  2PNH A;  4FO2 A;  3H6M A;  3DWA A;  4ODG A;  4A3F B;  1X9N A;  3K7U C;  3VR4 A;  2QKI C;  2YTV A;  4N8F A;  4IFD I;  1SMY D;  1V1O A;  3HOY G;  4GZY C;  3W1G A;  2Z6K A;  1TWF B;  4FP5 D;  3T1H Q;  3SK4 A;  4LFA L;  3L7Z C;  2G9D A;  1VQK A;  4X65 Q;  1PH3 A;  4A93 H;  3OIQ A;  4JI1 L;  4HJ7 A;  3CMA A;  3CP0 A;  4A3E G;  2IWH A;  1PYB A;  5IWA Q;  1LV9 A;  3TZU A;  4PMC A;  4RG1 A;  4HED A;  1AN8 A;  3H09 A;  1PA6 A;  4GNX B;  5JJZ A;  4DR7 L;  2HD3 A;  4DV7 Q;  3PF5 A;  1VQ7 A;  1PFM A;  1D2B A;  3ICE A;  1LO5 D;  2KEN A;  4R9W A;  3EQL C;  1MD2 D;  3M3Y H;  3M7G A;  2FHT A;  4APV A;  2F03 A;  1BVS A;  4AH6 A;  1PZI D;  2CW0 D;  2K33 A;  2WB1 B;  2VL6 A;  1PH6 A;  1Z6H A;  5CV8 A;  3I3C A;  2VQF L;  4TQU S;  1ESR A;  3DHQ A;  4XQJ A;  1STY A;  1T9H A;  1STG A;  3ONA B;  1V9P A;  1A2T A;  3TSS A;  3K5M A;  3ZJY C;  1GXD C;  5JJL A;  1JJ2 A;  4LF7 Q;  4DR4 L;  3VA7 A;  4A3M G;  4QQB X;  2K05 A;  5CBE E;  3IL8 A;  1WTH A;  1LAC A;  2PW5 A;  3CQZ H;  5A35 A;  3CC4 A;  3AB9 A;  3KBX A;  4L5T A;  2A69 D;  4QB4 A;  3KUP A;  4WFN 3;  4HIM A;  1Y1V B;  2HT1 A;  4L8J A;  4P74 A;  4DU9 A;  2ID0 A;  3PO3 H;  4BBS B;  5C0X G;  4B3M L;  5CBA E;  3HOW B;  4Y7N B;  4IJH A;  5I2Y A;  1HZB A;  3QG1 A;  4JI2 L;  1A63 A;  1K3B C;  2KJX A;  4KKU A;  1O7Y A;  3M85 A;  3D31 A;  4K14 A;  1SN8 A;  4C3J H;  4R4O A;  3TBI B;  4GLV B;  4UP8 A;  5FO8 B;  1I4X A;  3URY A;  3X3M A;  5ELN A;  1X3Q A;  4BY1 B;  1YNN C;  2K14 A;  4X3S A;  2I5M X;  5CMD A;  4IPG A;  1TT2 A;  3O13 A;  4GOP A;  4DF7 A;  1VQJ A;  1S5F D;  3T56 B;  1X3P A;  3SXH A;  1B44 D;  4MIU A;  1HH2 P;  4YWL A;  1I94 Q;  1CSQ A;  4DR6 Q;  1EY6 A;  2KVM A;  2RQX A;  5M3M B;  3A7L A;  5IGE A;  3EN2 A;  1DM0 B;  1GD7 A;  2JA5 H;  4A3D G;  1A6X A;  1XMQ Q;  4S3S A;  2GA4 B;  5HUR A;  4HJA A;  3FRP B;  2DNE A;  1B8A A;  1QE6 A;  1FJG L;  1N33 Q;  2D2C C;  1CQF A;  3A0J A;  3TDQ A;  4DV4 Q;  4OWX B;  1EWI A;  3M4O B;  1UE1 A;  4JYA Q;  3LWE A;  4KKS A;  1F2M A;  4ULL A;  2SEB D;  1KIX A;  1NTG A;  4DR5 L;  4IFD J;  1A3T A;  1JIC A;  2CHB D;  5M3F H;  4LF6 Q;  5GAH C;  1ENF A;  1SE4 A;  2PNR C;  3W3A A;  2IL8 A;  4KLK A;  1PH2 A;  2UXD L;  3CU7 A;  2CH4 A;  4GN5 A;  4P73 A;  4QUC A;  4J1M A;  4NP5 A;  1WCM H;  1SYF A;  3J7A V;  1JT8 A;  5CR3 A;  2JA6 G;  1EY4 A;  1EY9 A;  4LK1 C;  5IYC G;  3HKZ G;  2NVX H;  1CHP D;  4GKK Q;  3NTK A;  3VR2 A;  1AP0 A;  3GDE A;  2F0O A;  1W6J A;  1V1Q A;  5FK9 C;  3HOZ H;  1KHI A;  2NZO A;  3GTL H;  4OEL B;  4CGY B;  5COY A;  2OTJ A;  2K5D A;  2EYM A;  4DR1 L;  3RN5 A;  3H0G B;  1WI5 A;  1Z7T A;  2B63 B;  1YIT A;  1OO9 B;  3TRE A;  4B9W A;  1V1P A;  3FP9 A;  1G2T A;  1ZEQ X;  4C3I B;  3BZK A;  1PTO F;  3K5L A;  1M4V A;  1VQA A;  1N34 Q;  3S1N H;  2R93 G;  3Q24 A;  1SRO A;  1LTR D;  2P5Z X;  2PMZ B;  4U68 A;  1XNR Q;  4EQN A;  2VS1 A;  3U58 A;  5CV4 A;  3Q6S A;  2A8V A;  1M8A A;  4JG2 A;  2F0P A;  2RSO A;  3FDT A;  3BYT B;  5IGG A;  3JAM c;  1BCP F;  4OX9 L;  3I73 A;  2QF7 A;  4F7X A;  1WD1 A;  3GTP B;  1NUC A;  4DUY Q;  4C3H H;  5EBC A;  4ZAI A;  4BXX G;  1NSN S;  1X3E A;  4RCN A;  1PH8 A;  2EIF A;  3TN2 A;  1K28 A;  2OQ0 A;  1RCV D;  4CKB A;  2GVB A;  3PSI A;  1TVX A;  3NEL A;  4NXM Q;  1TWH H;  2NZ1 D;  2E5L Q;  5I2X A;  3F2D A;  4B3R L;  2WB1 E;  3E9H A;  1SJH D;  1VQB A;  4L5S A;  4P75 A;  2ICI A;  4OWT B;  2A6E C;  1BBW A;  3S1M H;  3MXU A;  4ME3 A;  1ASY A;  1K8O A;  1EZ6 A;  1X3F A;  2F0T A;  1E0B A;  2L55 A;  5C44 H;  2UXC L;  4DAY B;  1XMO L;  1M1K C;  5IOC A;  1EY0 A;  2Q2T A;  1SYE A;  4GNX A;  2N88 A;  1X54 A;  3DXJ C;  4LUO A;  3Q0A A;  2L9H A;  3V96 A;  4XTC S;  1YIJ A;  2K5W A;  3DMU A;  2OXP A;  1IW7 D;  1YHA A;  3SDZ A;  4IUU A;  2R92 B;  3SK6 A;  1EWH A;  1QUQ B;  4DK0 A;  3FEW X;  3P75 A;  2K03 A;  2VQE L;  2JA8 H;  2KHJ A;  2IJ0 A;  4EQ5 A;  1CZW A;  3K5O A;  4DXF A;  1K83 B;  1KAW A;  4QL5 A;  1EQQ A;  1KLU D;  2A68 C;  4N9T A;  2FXQ A;  1FYC A;  5HGQ A;  5IYB G;  4X64 Q;  4LFC Q;  1Y1W B;  4JI6 L;  3DM1 A;  4XIG S;  5I4D A;  1EYD A;  2K50 A;  3TP7 A;  3ULL A;  1EYA A;  4RH6 A;  4CKC A;  4OON A;  1C9O A;  1VQP A;  1STA A;  3FKI B;  2B2Y A;  4K5V A;  3HOV G;  1YBY A;  2KEC A;  3G48 A;  4A4I A;  3HOY H;  2F0H A;  1H9S A;  2NWG A;  3OYY A;  5GAD C;  1YVC A;  2Z8L A;  1STN A;  1VCI A;  3A54 A;  3M4Q A;  4OEM B;  5ELC A;  1K8G A;  3MFG A;  1RKN A;  5ELF A;  2PZU A;  3OMG A;  5DLQ E;  1SE8 A;  1KC8 C;  2Q2H A;  1HZA A;  2JP1 A;  2C5C A;  1LTI D;  5IGC A;  2WP8 J;  4DUZ Q;  1I6H B;  3HS0 C;  1SYG A;  1J5E Q;  4UP7 A;  4C1N I;  1H95 A;  3QOL A;  2EYL A;  3A8K E;  2PQA A;  3U9S A;  3CHB D;  5C3W A;  2M9V A;  2BE5 D;  4X3T A;  4NXN Q;  5JPM C;  5HY6 A;  2JEA I;  1F2Y A;  2CH4 W;  2B2U A;  2CVR A;  1KDC A;  1AH9 A;  1HZC A;  3NWT A;  4FF2 A;  4L63 B;  1NY4 A;  1B9M A;  2K01 A;  4IUV A;  3UI2 A;  2BDO A;  1Q12 A;  1GUT A;  2QCP X;  3I4L A;  5FLX L;  2EOT A;  2F0D A;  4GN4 B;  3TP6 A;  1A8V A;  1SR3 A;  2ZM6 Q;  3HOU B;  1BO0 A;  3UE1 A;  4A3M H;  1I3Q H;  1R9T B;  4POG A;  4DV2 Q;  3LX0 A;  2JXM B;  3L2P A;  1PYS B;  5KND A;  5E4W C;  3MZ5 A;  5J39 A;  1HPC A;  3OW7 A;  1PZJ D;  3CME A;  3LWU A;  2EZV A;  1DZ1 A;  2A73 B;  4A3J B;  1B2T A;  1I4H A;  2JA9 A;  1AFP A;  1PTO C;  5C0X H;  2NN6 I;  3RR5 A;  3OWF A;  1HNZ L;  2G9H D;  4K0K Q;  2G5D A;  4ZUJ A;  1WVL A;  5FJ8 H;  1IBK L;  3PO3 G;  3DWQ A;  3ND8 A;  5C4J H;  2PO4 A;  3NHH A;  1J6Q A;  1C8C A;  3D3R A;  3K0Y A;  3F2C A;  1CUK A;  2CWA A;  5JEA G;  1CZG A;  5LMN Q;  3KF6 B;  4C3J G;  3VYS A;  5DAU A;  2EPB A;  2PMZ E;  3M4Y A;  2VB3 X;  3S14 H;  3NK9 A;  4R4T A;  4WRD A;  4DV6 Q;  4Y52 H;  1WTV A;  2KCT A;  4DFA A;  4BY7 H;  4MTN A;  4J6H A;  1BNZ A;  1WTP A;  5K36 G;  2B2W A;  5JJK A;  3RLF A;  2R6G A;  2A6H D;  4FXK C;  3PF4 A;  1W3S A;  1MBY A;  2WAQ B;  4A3K H;  2PI2 E;  2NUC A;  1SMY C;  1WTO A;  1HFG A;  3ZYY X;  2JA5 G;  3J81 j;  2N3S A;  5ELE A;  5AFW A;  3C2P A;  5LMU L;  2E75 C;  2WV6 D;  3PUY A;  2JSO A;  1JE5 A;  1B4O A;  2M00 A;  5FLX E;  2VZA A;  3BVZ A;  1LM0 A;  3U4V A;  1PFS A;  2CQO A;  4C1N K;  3NEN A;  2EDG A;  2PZW A;  1JWU D;  3MXP A;  2EY5 A;  1HR0 L;  3D6C A;  1PLF A;  1CHQ D;  3PUW A;  3F2B A;  1L2F A;  2NVY B;  2F4V L;  4K8J A;  5EPL A;  4A3B H;  4TRD A;  3I70 A;  5J3B A;  1VQL A;  5C3E H;  2CW0 C;  2OF1 A;  5IYC H;  2OT2 A;  1J9O A;  3I4O A;  1QIL A;  2Y0S B;  2UU9 Q;  3I4N G;  2ZXR A;  3MA2 B;  4A3E B;  1JB3 A;  5LL6 X;  4BBR B;  1QVF A;  2UXB L;  4PZ8 A;  3T1Y L;  2IY5 B;  5ELD A;  3IFD A;  1N32 L;  3VYU A;  1A0I A;  1SYD A;  4DV0 L;  5EQ0 A;  3GTJ B;  3A7A B;  3HOZ G;  1Q46 A;  3STB D;  2UUB L;  4GOP C;  1SBB B;  1VMC A;  2OEO A;  4DNR B;  5IY0 A;  1SFO H;  4H0L C;  1E24 A;  4DR3 L;  1RTO A;  3A5U A;  4HN7 A;  4OXP A;  4DN4 M;  4X62 L;  3S1R B;  1ICW A;  2J0T D;  1XYI A;  4KKT A;  2R93 H;  1ILP A;  3HOX H;  1Q8K A;  5H1S E;  1XX8 A;  2A69 C;  3CCS A;  1U4L A;  1I4R A;  4K2K A;  5NUC A;  3K6O A;  1ZYR D;  5E7N A;  3BVG A;  1ASZ A;  2ENB A;  4PG3 A;  2RCF A;  4R8N A;  1YI2 A;  1QJO A;  1LT4 D;  1B3Q A;  4PMW A;  2TSS A;  4ZKB B;  2Z1C A;  2YU9 H;  1XNQ Q;  1O7Z A;  3J80 L;  1A3V A;  1K8M A;  4JI8 Q;  4U67 3;  3N6R A;  4A3M B;  4AQY L;  1F2L A;  3DEP A;  1FL0 A;  3MVV A;  4IZ8 A;  4LF5 Q;  1Q8I A;  1YZ6 A;  3K7A H;  1QNU A;  3OMC A;  3K57 A;  2KCM A;  5BR8 L;  4LF4 Q;  1MI2 A;  1N36 Q;  1IBL L;  2L11 A;  2JE6 I;  4RFB A;  3K5N A;  1IZ6 A;  3DEO A;  2F3W A;  4WOR A;  1EZ8 A;  4G7O C;  5KGU A;  4PV1 C;  3UDG A;  1TWC H;  2UUC Q;  5AJ3 L;  5D3I B;  5C44 G;  4KD3 A;  4JC0 A;  5G3L D;  4LF8 L;  3KLR A;  3A55 A;  2ZJR A;  3AEV A;  1U5K A;  1IL8 A;  4DA2 A;  2QEJ C;  3U50 C;  1F77 A;  2D5D A;  5TSS A;  2VUM H;  5EPJ A;  1A3U A;  4E6I A;  1LUZ A;  2AUJ D;  3KDF B;  4X3K A;  5KIX A;  3NWS A;  1I50 H;  1CA6 A;  4A3D B;  1VDZ A;  5IYB H;  4WJ4 A;  3AMU A;  2F4I A;  4CBV A;  1GVP A;  1BF4 A;  1G8Z D;  4IFD G;  3B6Y A;  3S16 B;  4UPA A;  3F8T A;  1EY7 A;  4HJ5 A;  4IUN A;  4JV5 L;  2B39 A;  3D4D A;  2AQ2 B;  2MHV A;  3J80 E;  2DUD A;  2EYF A;  2B2T A;  5I9O A;  2ZTC A;  3GV6 A;  4RMF A;  1IKL A;  3S2D H;  5DEH A;  4QF4 A;  4XYQ A;  1YJN A;  1HQR D;  3J7Z C;  2F0J A;  4EX5 A;  3EIV A;  4M8A A;  2XWB B;  1H9R A;  2EJF C;  2RCN A;  4POF A;  2JA6 B;  2WKD A;  2NVT B;  5IIF A;  4FF3 A;  1ESF A;  3HKZ B;  1LTT D;  2WAQ E;  4HMI A;  4KJO A;  1GOZ A;  2F0E A;  5FKA C;  4GNX C;  3P1H A;  2H1E A;  3KF6 A;  2EVB A;  2AQ3 B;  2CFM A;  2X69 A;  4BWG B;  2LFN A;  3J7A F;  2SOB A;  5I9P A;  3D8G A;  1WTW A;  4G7Z C;  3A74 A;  1NAP A;  1EQR A;  4DXG A;  2Q2I A;  4DNT B;  1ZKO A;  3SVM A;  1I6V C;  1VQN A;  4LNQ A;  4RHS A;  1DJR D;  1CT1 D;  2F0G A;  1U0L A;  4B3M Q;  4FF1 A;  1FNU A;  4QJF A;  2PQE A;  4ZCK A;  2N55 A;  2Q2U A;  3GTQ H;  3PO2 H;  4JI2 Q;  3V05 A;  1B9N A;  1B7Y B;  5EBD A;  1FD7 D;  2NN6 H;  3HEJ A;  5FLX c;  2BH2 A;  4IUR A;  4UAI A;  2JA7 G;  1E22 A;  1CTM A;  3T1H L;  4NDX A;  4LFB L;  3S15 B;  1CFM A;  2Y0S E;  2B2Y C;  3HZX A;  3TZD A;  2XIW A;  2LS0 1;  3CRK C;  2HIV A;  1GHJ A;  1H9S B;  4H44 C;  4CJ0 B;  3M7N A;  1K73 C;  5IWA L;  4JOI A;  5IT9 L;  5FO9 B;  5FO7 B;  1IW7 C;  5FJ8 G;  5EAY A;  4DV7 L;  1X32 A;  3VR3 A;  1KDB A;  2FFK B;  5JEA H;  1JOO A;  2QA4 A;  1X6O A;  2KOL A;  4M1U B;  1ENC A;  1C48 A;  4RCO A;  3VYR A;  4QUF A;  2XNA C;  4EGV A;  2HIX A;  2NVQ H;  2PQA B;  1SDF A;  3I4M B;  4TSS A;  1QZH A;  1GUN A;  1XPO A;  4C2M H;  2F0M A;  4ILW A;  4KMU C;  5K36 H;  2B2U C;  4BY7 G;  3S2H B;  3GTM B;  1FGB D;  4HCS A;  3ERQ A;  2R7Z B;  1PRT D;  1X56 A;  3NQI A;  1K0R A;  4JBK A;  3IKJ A;  1H9M A;  1QNK A;  1K8A C;  4LF7 L;  1PH4 A;  5CV7 A;  3NEM A;  4A3K G;  3RZO H;  1MSG A;  2D9U A;  1VQD A;  1VQE A;  2NYZ D;  1YHQ A;  2HHH Q;  1GUS A;  1HNX Q;  1E2W A;  1NJI C;  3GO5 A;  5C4X G;  4A3I B;  3I8Z A;  2F0U A;  5GAG C;  4N8X 1;  3R8B A;  5JVG 3;  4KY5 A;  5EJW A;  3RZD H;  2OWO A;  4Z9C B;  1J8I A;  1XWE A;  3A56 A;  3QWN A;  1HR0 W;  4O42 A;  1NMG A;  1KAA A;  4KHZ A;  4LW1 A;  1FNW A;  4DAP A;  3HOV B;  2BH8 A;  1A2U A;  3E6Z X;  4DV5 L;  3D6W A;  4A3B G;  2B2V A;  2BE5 C;  1L1O A;  3KBG A;  3S1Q H;  2IX3 A;  2H5X A;  3I4N H;  1KNE A;  2DY7 A;  5C3E G;  4A93 B;  4RKL A;  4X3U A;  3MEF A;  3RUZ A;  5IT9 E;  2DNC A;  4XT1 B;  4QIW B;  1G29 1;  3F2U A;  5EGT A;  3TME A;  4KN7 C;  3N52 A;  1TWG H;  1XTC D;  4OX9 Q;  3GTK H;  3WOE A;  3P20 A;  2LMC B;  3G4S A;  1G91 A;  3KJO A;  1SJE D;  1H9J A;  1I94 L;  4DR6 L;  4JI3 Q;  3U4Z A;  2EJG C;  5ELB A;  3TRZ A;  2B2W C;  3KOJ A;  3OW2 A;  4LF9 Q;  2EQS A;  3FHW A;  1XMQ L;  2RKS A;  1EQT A;  1PMR A;  3IAY A;  3CC2 A;  3M3Y B;  4YY3 Q;  1WTQ A;  3G6E A;  1FNV A;  1N33 L;  3EVQ A;  3MTS A;  4DV4 L;  2L15 A;  1IYV A;  1EY8 A;  1WYD A;  3HOX G;  4JYA L;  2KHS A;  3KDF A;  3R2T A;  4B3R Q;  2CKZ B;  4LF6 L;  3OOC A;  3I56 A;  1B1Z A;  3ULP A;  4OIK A;  1TY2 A;  3J80 c;  1JJC B;  3U9O A;  5M5X H;  5EKL A;  3HGB A;  1ILQ A;  3HKZ E;  2ATW A;  1AEX A;  3NTI A;  1E3P A;  2E74 C;  3MXG A;  4MNO A;  2Q8T A;  1DCZ A;  4GKK L;  4HJ8 A;  5JVH 3;  3CQZ B;  4DR2 Q;  4G7H C;  2F0F A;  4B3S Q;  3NPP A;  3S17 H;  4V19 0;  1MIU A;  1U9R A;  3AQQ A;  2D0O A;  4HID A;  3PO3 B;  2DN8 A;  2EYJ A;  5IGF A;  2A6H C;  2JK8 A;  4IUQ A;  3KF8 B;  2E2J H;  4JPB W;  1Q82 C;  1PTO H;  1D5Z C;  2K7V A;  3BJU A;  4X6A H;  1CKN B;  1RJT A;  1Y1V G;  2IPK D;  1D1K A;  3DM3 A;  3E5S A;  2E2H H;  4BBS G;  1X55 A;  1L0Y B;  1S5E D;  1I4Q A;  4C3J B;  5IOD A;  1SRU A;  1PH1 A;  1DOK A;  3HOW G;  1JCK B;  1EIG A;  3MHB A;  1N34 L;  4P72 A;  2I5L X;  1UE6 A;  1JWS D;  1XNR L;  1ZXT A;  4DV1 Q;  2AWN A;  1H9K A;  2RHS B;  1D5X C;  3CXC A;  3BZC A;  1HQM C;  5IGD A;  4OO1 I;  1I4P A;  2C35 B;  3AYH B;  2VUM G;  4YHH Q;  1EU4 A;  1ONL A;  1YEZ A;  1NNX A;  1U4M A;  1GHK A;  3FPU B;  2LXK A;  5C5M A;  4DUY L;  2YYZ A;  1XXG A;  4IFD H;  4MN3 A;  2ICE C;  1QVG A;  4B9X A;  1EUJ A;  2KCC A;  2JA5 B;  4K6L A;  4A76 A;  2CCZ A;  2PW7 A;  1TY0 A;  4NPS A;  5HGT A;  1DOM A;  3C3L A;  3PGZ A;  2RDF A;  3GTG H;  1IHZ A;  1PXU A;  4NXM L;  1EY5 A;  2WIN B;  3K0X A;  1VF7 A;  2E5L L;  3ITP A;  2Z4I A;  1S4Z A;  4YCW A;  1OXU A;  2DJG C;  3STB C;  5IGB A;  4RA8 A;  1PZK D;  1YNN D;  2AKW B;  4DGZ A;  5M3F B;  3CCR A;  1HNW Q;  2JJQ A;  1KL9 A;  5CC4 A;  2K75 A;  4RHR A;  1B70 B;  4K5X A;  1WCM B;  5JAV A;  2HDL A;  2NTT A;  1IBM Q;  1QVC A;  1N9W A;  1SMX A;  4RGO S;  2O5J C;  4HCE A;  1KDA A;  1TWA H;  1ZYR C;  1OXV A;  3EBE A;  2NVX B;  1STB A;  3VR5 A;  3DLL A;  1JB7 A;  3SE0 A;  1QZG A;  3IFT A;  2IT1 A;  3TQY A;  3CPW A;  3HOZ B;  5LHY 1;  3GTL B;  1EWC A;  4JBW A;  4A3G H;  5T1G A;  5M5W H;  2PZT A;  2F0N A;  4RKB A;  4FXG C;  4ME5 A;  4QCL A;  2E8G A;  3NBH A;  2HQL A;  3RLO A;  2QW7 A;  3G71 A;  2LSS A;  2I07 B;  1S3O A;  4JI4 Q;  1JQY D;  2BDN A;  1IBK Q;  2K04 A;  1F9R A;  1BOS A;  1NMF A;  3H0G G;  2HCI A;  2D0P A;  1BKB A;  1NCV A;  2BOS A;  3PCO B;  4LUZ A;  2B63 G;  2B29 A;  2I5H A;  3PO2 G;  2R7F A;  3S1N B;  3NTH A;  2AHO B;  4RGM A;  1DXM A;  2JA7 H;  4B3T Q;  1SAP A;  4C3I G;  2E2I H;  2NN6 G;  3VA5 A;  2XSC A;  3GTO H;  3J7Y W;  4YWM A;  4J8Q A;  4QIW E;  2B2T C;  1RL2 A;  5L37 A;  2Z6K C;  5FLM G;  2YV5 A;  1EIH A;  4C3H B;  3I91 A;  1DGS A;  1CQV A;  4H7B A;  2SNM A;  5E4X A;  2GVA A;  1DYQ A;  2BA1 A;  5D14 A;  5IT9 c;  2ZJP A;  1S5D D;  1Y14 B;  1GJX A;  4TVA B;  5M5Y H;  1HTL D;  1J5E L;  2MP1 A;  1Q1B A;  1TWH B;  1JMC A;  2MO0 A;  4Q0F A;  1P16 A;  5LMU Q;  2IX1 A;  3CCE A;  2YTX A;  4NXN L;  3NSW A;  4AYB G;  3S1M B;  1K3R A;  5C44 B;  2F0W A;  1L0X B;  4IJL A;  3E0J A;  4YWK A;  1VQ6 A;  3RLN A;  4KHP L;  4GKJ Q;  1K0S A;  1OTC A;  1EOV A;  2AMC B;  2RA4 A;  1LAB A;  1AE3 A;  2VXW A;  2WII B;  3T51 B;  1LT6 D;  5C5L A;  4DV2 L;  3CCQ A;  2JA8 B;  5C4X H;  2UXB Q;  4UDU C;  3K59 A;  2F0K A;  1VQO A;  4K0K L;  2K32 A;  3LNN A;  5GQO A;  3FPP A;  2WKC A;  1LYL A;  1PYW D;  1SNQ A;  1UE7 A;  4NKL A;  1ET9 A;  3J81 i;  2VNU D;  4JOI C;  4X62 Q;  1Y1W G;  1Y8P B;  4UY8 C;  1KXL A;  1HXY D;  1OXX K;  4KD4 A;  5LMN L;  4HIO A;  3HOY B;  4K6D A;  2EJM A;  3BDO A;  2N49 A;  4A3F H;  4LWC A;  4DV6 L;  3FKI G;  1QCB D;  2KBN A;  4CKE A;  3M9B A;  3PIP 3;  1Q81 C;  2A74 C;  1TWF H;  3C46 A;  1V43 A;  1LTS D;  3KF8 A;  3K80 C;  3Q8D A;  1FR3 A;  2C9O A;  5ELO A;  1CKN A;  3TS2 A;  4IAL A;  3ERO A;  4ZLT F;  2K52 A;  3W1B A;  4AQY Q;  4X66 Q;  4MTK A;  3T53 B;  3OTO Q;  5J1Z A;  1BBX C;  3EA6 A;  3KK7 A;  4DV3 Q;  1AZQ A;  1PHJ A;  4KY6 A;  2XTI A;  2K5N A;  4ZYS A;  4QMG A;  4F87 A;  1MJC A;  1IBL Q;  5C4Z A;  4TKO B;  2EYH A;  1KRT A;  2DGY A;  2J4X A;  5CGK A;  2KUM A;  1ICF B;  4XDX A;  3G7L A;  1Z47 A;  1NE3 A;  4ZK9 B;  3OHX C;  1I3Q B;  3CKI B;  3BZD B;  4JI7 Q;  1TS2 A;  4UHV A;  4JI5 Q;  3RMH A;  2MNA A;  1XPU A;  4QY7 A;  4JI0 Q;  3HFZ B;  1L1O B;  3K81 C;  4RGN A;  4LMQ D;  5D65 A;  1UEA B;  1E7Z A;  2K6A A;  3WDN A;  1EEI D;  1I4G A;  1F2Z A;  1CKO A;  3NUC A;  3S24 A;  3E9I A;  4DKA C;  1PRT C;  1PRT B;  1GO3 E;  5IP7 H;  1AW7 A;  1HCZ A;  4R8I A;  2KHI A;  2Z6B A;  4CHT B;  2B3G A;  4DNI A;  4BA1 I;  1B53 A;  1Y1V H;  5C4J B;  4A3J G;  2FJ2 A;  4PMB A;  5COR A;  4OO1 H;  3K8A A;  4BBS H;  3NP8 A;  2ZTD A;  2XRS D;  1M90 C;  1QWY A;  5C4H A;  3HOW H;  2K4K A;  4Y7N H;  1CK1 A;  1TS5 A;  5DM7 3;  1GUG A;  2VB2 X;  1TQO A;  1EIF A;  1JJG A;  3S14 B;  3SGI A;  4H13 C;  4R4C A;  2FMC A;  4BY7 B;  1VS0 A;  2RBM A;  1UNS A;  4BY1 H;  4V0B A;  1TS3 A;  2SDF A;  4LFA Q;  5IP9 H;  1XNQ L;  4JI1 Q;  5GAE C;  2F0S A;  3T16 A;  4JK1 C;  4JI8 L;  4PZ7 A;  5J22 A;  1E2Z A;  1YNJ D;  1Y8N B;  2AUK A;  1PTO D;  3NQT A;  4A3K B;  1S40 A;  3CCM A;  2KQ3 A;  1LT3 D;  1O78 A;  1U4R A;  1E1O A;  3RN2 A;  4LF5 L;  5M3M H;  1YNX A;  2EYO A;  2WAQ G;  4DR7 Q;  1IL2 A;  1II3 A; 
#chains in the Genus database with same CATH homology
 3SR1 A;  1SNO A;  3L9A X;  4P2C B;  1BCP D;  4OIJ A;  3A8J E;  2X6L A;  4ZRZ A;  3WOF A;  4IUT A;  3P7J A;  4FF4 A;  3J81 L;  4CJ2 C;  1ROD A;  1LTB D;  3G6J B;  4A3B B;  3MEH A;  1G2S A;  4XYO A;  2EY2 A;  4NMZ A;  3AU7 A;  5C3E B;  3OWE B;  1SND A;  2Q8R E;  5JOB A;  2DY8 A;  1HA5 A;  2MGS A;  1WD0 A;  4ZKC B;  1JOK A;  4LAA A;  2FMM A;  2MPM A;  2RSN A;  4ZQ3 A;  4KTA A;  1SFO B;  1MSH A;  2KA7 A;  1F9P A;  2FIN B;  2MJ8 A;  3QOJ A;  1PFB A;  2R93 B;  3D4R A;  3HOX B;  5KYI A;  2L4N A;  2PYK A;  1W6K A;  1SYB A;  3PV0 A;  4KJN A;  2IW3 A;  2F3V A;  2YU9 B;  2LY7 A;  5JPN C;  3C1F A;  5I6Y A;  1SEB D;  4HTH A;  2O4X A;  4DK1 A;  2Z4H A;  2I46 A;  4G4K A;  2SNS A;  3K7A B;  2H4O A;  5CV6 A;  4EQO A;  5KEE A;  1LTG D;  3J81 E;  3BS1 A;  1SNC A;  1HUM A;  4PNY A;  5F2D A;  5EKK A;  3H3V C;  1O7L A;  1ET6 A;  1TWC B;  3H94 A;  2HUG A;  2BCO A;  5LL6 S;  1HRJ A;  4EQP A;  2NTS A;  1D6E C;  4KI0 A;  2RVL A;  5C0X I;  1F9S A;  3Q23 A;  2VUM B;  5CV9 A;  2F0L A;  1CI3 M;  1I50 B;  4RWS C;  5BN3 A;  1SNM A;  2KED A;  5BN4 A;  1UUP A;  1JWM D;  1C4Q A;  4G57 A;  1S5C D;  3SK5 A;  3QB3 A;  4ID6 A;  1F9Q A;  1HTP A;  3QJY A;  4K5W A;  2A5H A;  5A2Q L;  3PUZ A;  1EOT A;  3I72 A;  4K8I A;  4IN3 A;  3S2D B;  2R61 A;  3MWY W;  1EL0 A;  1GUO A;  2HQE A;  3GV3 A;  2ZXP A;  4CJ1 B;  4ABN A;  2J7Z A;  4IUP A;  1HHV A;  3A8I E;  1RTN A;  2XRQ D;  5M9O A;  5G3L F;  1B50 A;  1MGS A;  3C1E A;  1TII D;  1R4P B;  1NR2 A;  1Q3L A;  3GTQ B;  2M2L A;  3PO2 B;  1HA6 A;  2KCN A;  4KN4 C;  1BQQ T;  1KAB A;  1WTR A;  3SK8 A;  2TMP A;  3NE5 B;  4HMJ A;  1GUW A;  1STE A;  3T4A C;  1R4Q B;  1JC7 A;  1CA5 A;  1DOL A;  1TU2 B;  1T5X D;  3D4W A;  4O1N A;  4B08 A;  1Q90 A;  5A2Q E;  5BN5 A;  2O2L D;  4OO1 G;  3VYT A;  4Q5V A;  1PDQ A;  2RDG A;  2L1B A;  4AYB B;  1B3A A;  3HG9 A;  4F8M A;  2E76 C;  2XN9 C;  4HAE A;  3H91 A;  2NVQ B;  1NR4 A;  4C2M B;  3X3N A;  4OGQ C;  4OHJ A;  5C0X J;  1OXT A;  1JOR A;  1RD9 D;  3HP3 A;  3SHL A;  2AQ1 B;  1V8Q A;  5CYU A;  5KYL A;  4FXD A;  3MAQ A;  3RZO B;  4HSP A;  4RAU C;  3L3O C;  3SEB A;  3HRZ C;  4XT3 B;  2HCC A;  3KLS A;  4N9P A;  1EEF D;  1EFI D;  3RZD B;  4KY7 A;  1QOH A;  3R2I A;  2EXZ A;  3MXN A;  2ZXO A;  4NW2 A;  3I90 A;  3BDL A;  2E2D C;  3GD7 A;  1LT5 D;  3S1Q B;  3I4N B;  4MHE A;  1IKM A;  2L0C A;  4C56 C;  2HDM A;  3PUV A;  3OSO A;  3R93 A;  1TWG B;  3EFX D;  5EKI A;  3GTK B;  1T5E A;  1SYC A;  1HFN A;  4HR7 B;  1PFN A;  2MUY A;  3S9W A;  2B8F A;  4L6T B;  4XQN A;  4BS9 A;  2K28 A;  2PPB C;  5C3X A;  1EQV A;  5E1F A;  1D1I A;  2ZT9 C;  2Q8I B;  1Y8O B;  3PIO 3;  3PMF A;  1PRT F;  3MC0 B;  3GQB A;  4XXE A;  4K2L A;  2NBF A;  1E2V A;  3T13 A;  1ML0 D;  1HUN A;  1EYC A;  3TP8 A;  3OPO A;  4RGT A;  4OL7 A;  5M5X B;  5DM6 3;  2LKV A;  5KNC A;  5C6A A;  4ZUI A;  1QB5 D;  2JYO A;  1DD2 A;  2F0Q A;  2R3Z A;  4BA2 I;  2XVS A;  3NBI A;  4DAV A;  4LJZ C;  4WJW A;  3K58 A;  2O5I C;  2EYP A;  3S17 B;  3QO2 A;  1STH A;  1BUV T;  2F0V A;  1YNJ C;  2E2J B;  1PTO B;  3BYY B;  3MFY A;  1KLG D;  3FMC A;  4HSV A;  2E2H B;  2JEB I;  1KNA A;  2RDH A;  3DUZ A;  1D2B A;  1JE4 A;  1BCP C;  1BCP B;  5DNF A;  3GP7 A;  1Y69 U;  1U4P A;  1SSO A;  3ND9 A;  1AZP A;  2F1M A;  3Q22 A;  2PCF B;  2EY6 A;  4EVO A;  3R3O A;  1TKW B;  1BXT A;  4XQQ A;  2AWO A;  1JR0 D;  2A6E D;  4PQX A;  3GTG B;  1SE2 A;  1D5M C;  2CQA A;  1EU3 A;  1BR9 A;  4KHV A;  1SXT A;  1RDP D;  3VR6 A;  3BDC A;  1JOQ A;  2L12 A;  3DWP A;  3QIA A;  1TWA B;  4KV6 A;  1SE3 A;  2A68 D;  1DON A;  3PUX A;  5KRU A;  2K1B A;  4A3G B;  5M5W B;  2QDB A;  5FOB B;  2XWJ B;  1S5B D;  1ENA A;  3NXW A;  4FVM A;  4I7Z C;  1WTX A;  1VMP A;  2K5Q A;  2BA0 A;  2QIL A;  4DAY A;  5K5P A;  1BDO A;  1RHP A;  5KNB A;  1OXS C;  2JA7 B;  2E2I B;  1LTA D;  3GTO B;  5ISR A;  1Q1E A;  1VF5 C;  1G6Z A;  3CRL C;  5EPK A;  3V2T A;  2B2V C;  3KLS X;  3JAM L;  1TS4 A;  4KK7 A;  2IX0 A;  3OIP A;  4IQZ A;  2EY1 A;  1RF2 D;  5CV5 A;  4C3H G;  5M5Y B;  5T1I A;  2X6G A;  1CM9 A;  3BVM A;  4I65 A;  1QG7 A;  1A15 A;  2V4D A;  4F88 A;  2NB0 A;  4FNF A;  3BG3 A;  3EJI A;  3RD4 A;  2EE1 A;  5E3F A;  4FYD A;  1V1P B;  5D3D A;  4YIJ A;  5JEA J;  5I6W A;  2B8G A;  2WAC A;  1TR5 A;  5C4X B;  2F0I A;  2L5T A;  1UAP A;  1KTK A;  3TP5 A;  2D62 A;  3FVQ A;  1LLR D;  1IYU A;  1O80 A;  3JAM E;  3W2D A;  2KEE A;  1SNP A;  4FO2 A;  3H6M A;  3DWA A;  4ODG A;  4A3F B;  3VR4 A;  2QKI C;  4IFD I;  1SMY D;  1V1O A;  4GZY C;  1TWF B;  4FP5 D;  3SK4 A;  3L7Z C;  2G9D A;  3OIQ A;  2IWH A;  1LV9 A;  3TZU A;  4PMC A;  4HED A;  1AN8 A;  3H09 A;  5JJZ A;  1PFM A;  1LO5 D;  4R9W A;  3EQL C;  1MD2 D;  3M7G A;  2FHT A;  2F03 A;  1PZI D;  2CW0 D;  2K33 A;  2WB1 B;  1Z6H A;  5CV8 A;  3I3C A;  4TQU S;  1ESR A;  3DHQ A;  4XQJ A;  1STY A;  1STG A;  3ONA B;  3TSS A;  1A2T A;  3K5M A;  1GXD C;  3VA7 A;  2K05 A;  5CBE E;  3IL8 A;  1LAC A;  2PW5 A;  5A35 A;  3AB9 A;  3KBX A;  2A69 D;  4QB4 A;  3KUP A;  4WFN 3;  1Y1V B;  4L8J A;  4DU9 A;  2ID0 A;  4BBS B;  5C0X G;  5CBA E;  3HOW B;  4Y7N B;  5I2Y A;  3QG1 A;  2KJX A;  4KKU A;  1O7Y A;  3M85 A;  3D31 A;  4K14 A;  3TBI B;  5FO8 B;  1I4X A;  3URY A;  3X3M A;  4BY1 B;  1X3Q A;  1YNN C;  4X3S A;  5CMD A;  1TT2 A;  3O13 A;  4DF7 A;  1S5F D;  3T56 B;  1X3P A;  3SXH A;  1B44 D;  4MIU A;  1EY6 A;  2KVM A;  2RQX A;  5M3M B;  3A7L A;  5IGE A;  1DM0 B;  1A6X A;  4S3S A;  2GA4 B;  5HUR A;  3FRP B;  2DNE A;  1QE6 A;  2D2C C;  1CQF A;  3TDQ A;  3M4O B;  3LWE A;  4KKS A;  1F2M A;  4ULL A;  2SEB D;  4IFD J;  1A3T A;  1JIC A;  2CHB D;  1ENF A;  1SE4 A;  2PNR C;  3W3A A;  2IL8 A;  3CU7 A;  4QUC A;  4J1M A;  4NP5 A;  1SYF A;  3J7A V;  5CR3 A;  1EY4 A;  1EY9 A;  4LK1 C;  1CHP D;  3NTK A;  3VR2 A;  1AP0 A;  2F0O A;  1W6J A;  5FK9 C;  4CGY B;  5COY A;  2K5D A;  2EYM A;  3H0G B;  1Z7T A;  2B63 B;  1OO9 B;  4B9W A;  1V1P A;  1G2T A;  1ZEQ X;  4C3I B;  1PTO F;  3K5L A;  1M4V A;  3Q24 A;  2PMZ B;  1LTR D;  4U68 A;  4EQN A;  5CV4 A;  3Q6S A;  1M8A A;  2F0P A;  2RSO A;  3FDT A;  3BYT B;  5IGG A;  1BCP F;  3I73 A;  2QF7 A;  4F7X A;  1WD1 A;  3GTP B;  1NUC A;  5EBC A;  4ZAI A;  1NSN S;  4RCN A;  3TN2 A;  1RCV D;  4CKB A;  1TVX A;  2NZ1 D;  5I2X A;  1SJH D;  2ICI A;  2A6E C;  3MXU A;  1K8O A;  1EZ6 A;  2F0T A;  1E0B A;  2L55 A;  5IOC A;  1EY0 A;  1SYE A;  2N88 A;  3DXJ C;  3Q0A A;  2L9H A;  3V96 A;  4XTC S;  2K5W A;  3DMU A;  3SDZ A;  1IW7 D;  2OXP A;  4IUU A;  2R92 B;  3SK6 A;  1EWH A;  4DK0 A;  3FEW X;  3P75 A;  2K03 A;  2IJ0 A;  1CZW A;  3K5O A;  4DXF A;  1K83 B;  1KLU D;  2A68 C;  4N9T A;  1FYC A;  1Y1W B;  3DM1 A;  4XIG S;  5I4D A;  1EYD A;  3TP7 A;  1EYA A;  4RH6 A;  4CKC A;  1STA A;  3FKI B;  2B2Y A;  4K5V A;  2KEC A;  2F0H A;  1H9S A;  2NWG A;  2Z8L A;  1STN A;  1VCI A;  3A54 A;  5ELC A;  3MFG A;  1RKN A;  5ELF A;  2PZU A;  3OMG A;  2JP1 A;  2C5C A;  1LTI D;  5IGC A;  2WP8 J;  1I6H B;  3HS0 C;  1SYG A;  4C1N I;  3QOL A;  2EYL A;  3A8K E;  3U9S A;  3CHB D;  5C3W A;  2M9V A;  2BE5 D;  4X3T A;  5JPM C;  2JEA I;  1F2Y A;  2B2U A;  2CVR A;  1KDC A;  3NWT A;  4FF2 A;  4L63 B;  2K01 A;  1B9M A;  3UI2 A;  4IUV A;  2BDO A;  1Q12 A;  1GUT A;  2QCP X;  3I4L A;  5FLX L;  2EOT A;  2F0D A;  3TP6 A;  3HOU B;  1BO0 A;  1R9T B;  3LX0 A;  2JXM B;  5KND A;  5E4W C;  3MZ5 A;  5J39 A;  1HPC A;  3OW7 A;  1PZJ D;  3LWU A;  2EZV A;  1DZ1 A;  2A73 B;  4A3J B;  1B2T A;  1I4H A;  1AFP A;  1PTO C;  5C0X H;  2NN6 I;  3OWF A;  2G9H D;  4ZUJ A;  1WVL A;  3DWQ A;  3ND8 A;  2PO4 A;  3NHH A;  1C8C A;  3D3R A;  3K0Y A;  5JEA G;  1CZG A;  4C3J G;  3VYS A;  5DAU A;  2EPB A;  3M4Y A;  2VB3 X;  3NK9 A;  4WRD A;  1WTV A;  4DFA A;  4J6H A;  1BNZ A;  1WTP A;  5K36 G;  2B2W A;  3RLF A;  2R6G A;  2A6H D;  4FXK C;  1MBY A;  2WAQ B;  2NUC A;  1SMY C;  1WTO A;  1HFG A;  3ZYY X;  5ELE A;  5AFW A;  3C2P A;  2E75 C;  2WV6 D;  3PUY A;  2JSO A;  1B4O A;  2M00 A;  5FLX E;  3BVZ A;  4C1N K;  2EDG A;  2PZW A;  1JWU D;  3MXP A;  2EY5 A;  3D6C A;  1PLF A;  1CHQ D;  3PUW A;  2NVY B;  4K8J A;  5EPL A;  4TRD A;  3I70 A;  2CW0 C;  2OF1 A;  2OT2 A;  1J9O A;  1QIL A;  2Y0S B;  2ZXR A;  3MA2 B;  4A3E B;  1JB3 A;  5LL6 X;  4BBR B;  5ELD A;  3IFD A;  3VYU A;  1SYD A;  3GTJ B;  5EQ0 A;  3A7A B;  1SBB B;  1VMC A;  2OEO A;  4DNR B;  4H0L C;  1RTO A;  4HN7 A;  4DN4 M;  3S1R B;  1ICW A;  2J0T D;  1XYI A;  4KKT A;  1ILP A;  1XX8 A;  2A69 C;  1U4L A;  1I4R A;  4K2K A;  5NUC A;  3K6O A;  1ZYR D;  3BVG A;  2ENB A;  4R8N A;  1QJO A;  1LT4 D;  4PMW A;  2TSS A;  4ZKB B;  2Z1C A;  1O7Z A;  3J80 L;  1A3V A;  1K8M A;  4U67 3;  3N6R A;  4A3M B;  1F2L A;  3DEP A;  3MVV A;  4IZ8 A;  1Q8I A;  1QNU A;  3OMC A;  3K57 A;  1MI2 A;  2L11 A;  2JE6 I;  4RFB A;  3K5N A;  3DEO A;  2F3W A;  4WOR A;  1EZ8 A;  4G7O C;  5KGU A;  4PV1 C;  5D3I B;  4KD3 A;  5G3L D;  3KLR A;  3A55 A;  1IL8 A;  4DA2 A;  2QEJ C;  1F77 A;  2D5D A;  5TSS A;  5EPJ A;  1A3U A;  4E6I A;  4X3K A;  2AUJ D;  5KIX A;  3NWS A;  1CA6 A;  4A3D B;  1VDZ A;  3AMU A;  2F4I A;  4CBV A;  1BF4 A;  1G8Z D;  4IFD G;  3S16 B;  1EY7 A;  4IUN A;  2B39 A;  3D4D A;  2AQ2 B;  2MHV A;  3J80 E;  2EYF A;  2B2T A;  5I9O A;  3GV6 A;  1IKL A;  5DEH A;  4QF4 A;  4XYQ A;  1HQR D;  2F0J A;  4M8A A;  2XWB B;  1H9R A;  2EJF C;  2JA6 B;  2WKD A;  2NVT B;  5IIF A;  4FF3 A;  1ESF A;  3HKZ B;  1LTT D;  4HMI A;  4KJO A;  1GOZ A;  2F0E A;  5FKA C;  3P1H A;  2H1E A;  2EVB A;  2AQ3 B;  2X69 A;  4BWG B;  2LFN A;  3J7A F;  2SOB A;  5I9P A;  3D8G A;  1WTW A;  4G7Z C;  1NAP A;  4DXG A;  4DNT B;  1ZKO A;  3SVM A;  1I6V C;  4RHS A;  1DJR D;  1CT1 D;  2F0G A;  4FF1 A;  1FNU A;  2PQE A;  2N55 A;  3V05 A;  1B9N A;  5EBD A;  1FD7 D;  2NN6 H;  3HEJ A;  4IUR A;  4UAI A;  1CTM A;  4NDX A;  3S15 B;  1CFM A;  2B2Y C;  3HZX A;  3TZD A;  2XIW A;  2LS0 1;  3CRK C;  1GHJ A;  1H9S B;  4H44 C;  4CJ0 B;  3M7N A;  5FO9 B;  5IT9 L;  5FO7 B;  1IW7 C;  1X32 A;  3VR3 A;  1KDB A;  2FFK B;  5JEA H;  1JOO A;  2KOL A;  4M1U B;  1ENC A;  1C48 A;  4RCO A;  3VYR A;  4QUF A;  2XNA C;  4EGV A;  1SDF A;  3I4M B;  4TSS A;  1GUN A;  2F0M A;  4ILW A;  4KMU C;  5K36 H;  2B2U C;  3S2H B;  3GTM B;  1FGB D;  4HCS A;  3ERQ A;  2R7Z B;  1PRT D;  3NQI A;  3IKJ A;  1H9M A;  1QNK A;  5CV7 A;  1MSG A;  2D9U A;  2NYZ D;  1GUS A;  1E2W A;  3GO5 A;  4A3I B;  3I8Z A;  2F0U A;  5JVG 3;  3R8B A;  4KY5 A;  5EJW A;  4Z9C B;  1J8I A;  1XWE A;  3A56 A;  3QWN A;  4O42 A;  1KAA A;  4KHZ A;  1FNW A;  4DAP A;  3HOV B;  1A2U A;  3E6Z X;  3D6W A;  2B2V A;  2BE5 C;  3KBG A;  2IX3 A;  1KNE A;  2DY7 A;  4A93 B;  4RKL A;  4X3U A;  3RUZ A;  5IT9 E;  3TME A;  2DNC A;  4XT1 B;  1G29 1;  3F2U A;  4QIW B;  5EGT A;  4KN7 C;  3N52 A;  1XTC D;  3WOE A;  3P20 A;  2LMC B;  1G91 A;  1SJE D;  1H9J A;  2EJG C;  5ELB A;  2B2W C;  2RKS A;  1EQT A;  1PMR A;  3IAY A;  3M3Y B;  1WTQ A;  1FNV A;  3EVQ A;  3MTS A;  1IYV A;  1EY8 A;  2KHS A;  3R2T A;  3OOC A;  1B1Z A;  4OIK A;  1TY2 A;  3U9O A;  5EKL A;  3HGB A;  1ILQ A;  1AEX A;  3NTI A;  2E74 C;  3MXG A;  2Q8T A;  1DCZ A;  5JVH 3;  3CQZ B;  4G7H C;  2F0F A;  3NPP A;  4V19 0;  1U9R A;  3PO3 B;  2DN8 A;  2EYJ A;  5IGF A;  2A6H C;  4IUQ A;  1PTO H;  1D5Z C;  2K7V A;  1RJT A;  2IPK D;  1D1K A;  3E5S A;  1L0Y B;  1S5E D;  1I4Q A;  4C3J B;  5IOD A;  1DOK A;  1JCK B;  1EIG A;  3MHB A;  1JWS D;  1ZXT A;  2AWN A;  1H9K A;  1D5X C;  1HQM C;  5IGD A;  4OO1 I;  1I4P A;  1EU4 A;  1ONL A;  1U4M A;  1GHK A;  3FPU B;  5C5M A;  2YYZ A;  1XXG A;  4IFD H;  4MN3 A;  2ICE C;  4B9X A;  2KCC A;  2JA5 B;  4K6L A;  2PW7 A;  1TY0 A;  5HGT A;  1DOM A;  3C3L A;  2RDF A;  1IHZ A;  1PXU A;  1EY5 A;  2WIN B;  1VF7 A;  3ITP A;  2Z4I A;  1S4Z A;  1OXU A;  5IGB A;  4RA8 A;  1PZK D;  1YNN D;  4DGZ A;  5M3F B;  5CC4 A;  4RHR A;  4K5X A;  1WCM B;  5JAV A;  2HDL A;  2NTT A;  2O5J C;  4RGO S;  4HCE A;  1KDA A;  1ZYR C;  1OXV A;  2NVX B;  1STB A;  3VR5 A;  3SE0 A;  3IFT A;  2IT1 A;  3HOZ B;  5LHY 1;  3GTL B;  1EWC A;  4JBW A;  5T1G A;  2PZT A;  2F0N A;  4RKB A;  4FXG C;  4ME5 A;  4QCL A;  3NBH A;  2I07 B;  1JQY D;  2BDN A;  2K04 A;  1F9R A;  1BOS A;  2HCI A;  1NCV A;  2BOS A;  3S1N B;  3NTH A;  4RGM A;  1DXM A;  1SAP A;  4C3I G;  2NN6 G;  3VA5 A;  2XSC A;  3J7Y W;  4J8Q A;  2B2T C;  1EIH A;  4C3H B;  3I91 A;  1CQV A;  4H7B A;  2SNM A;  5E4X A;  1DYQ A;  2BA1 A;  5D14 A;  1S5D D;  1GJX A;  1HTL D;  2MP1 A;  1Q1B A;  1TWH B;  4Q0F A;  2IX1 A;  3NSW A;  3S1M B;  5C44 B;  2F0W A;  1L0X B;  3E0J A;  2RA4 A;  1LAB A;  2VXW A;  2WII B;  3T51 B;  1LT6 D;  5C5L A;  2JA8 B;  4UDU C;  3K59 A;  2F0K A;  2K32 A;  3LNN A;  3FPP A;  2WKC A;  4NKL A;  1PYW D;  1SNQ A;  1ET9 A;  2VNU D;  1Y8P B;  1HXY D;  1OXX K;  4KD4 A;  3HOY B;  4K6D A;  2EJM A;  3BDO A;  1QCB D;  3PIP 3;  4CKE A;  2A74 C;  3C46 A;  1V43 A;  1LTS D;  3KF8 A;  1FR3 A;  2C9O A;  4IAL A;  3ERO A;  4ZLT F;  3T53 B;  1BBX C;  5J1Z A;  3EA6 A;  3KK7 A;  1AZQ A;  4KY6 A;  4ZYS A;  4QMG A;  4F87 A;  5C4Z A;  4TKO B;  2EYH A;  2J4X A;  5CGK A;  2KUM A;  4XDX A;  3G7L A;  1Z47 A;  4ZK9 B;  3OHX C;  1I3Q B;  3CKI B;  3BZD B;  1TS2 A;  3RMH A;  4RGN A;  4LMQ D;  5D65 A;  1UEA B;  2K6A A;  3WDN A;  1EEI D;  1I4G A;  1F2Z A;  3NUC A;  1PRT C;  1PRT B;  1AW7 A;  1HCZ A;  4R8I A;  4CHT B;  4BA1 I;  1B53 A;  5C4J B;  4OO1 H;  2FJ2 A;  4PMB A;  5COR A;  3NP8 A;  2XRS D;  1QWY A;  5C4H A;  1CK1 A;  1TS5 A;  5DM7 3;  1GUG A;  2VB2 X;  1TQO A;  3S14 B;  4H13 C;  2FMC A;  4BY7 B;  2RBM A;  1UNS A;  4V0B A;  1TS3 A;  2SDF A;  2F0S A;  3T16 A;  4JK1 C;  5J22 A;  1E2Z A;  1YNJ D;  1Y8N B;  2AUK A;  1PTO D;  3NQT A;  4A3K B;  2KQ3 A;  1LT3 D;  1O78 A;  1U4R A;  2EYO A;  1II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...