5KGUA

Crystal structure of staphylococcal nuclease variant delta+phs n118d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGDNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N118D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kguA00
1A2UA 5IOCA 2EY1A 4YIJA 3V2TA 5KIXA 2EYPA 4ID6A 4NKLA 3U9OA 4K5XA 2F3VA 3TP8A 5C3WA 5CV5A 5J39A 3QOLA 4HTHA 5IGDA 5IGFA 1EY8A 4LAAA 3T16A 2F0LA 1SNDA 2EYHA 5C3XA 2EYFA 2QDBA 1SYCA 4K8IA 2F0UA 3SK6A 1EY5A 2EYLA 5DEHA 3E5SA 5JAVA 1SYFA 3EJIA 4DU9A 1EQVA 2F0VA 4KTAA 1JOKA 2OEOA 1SNMA 3ITPA 1STGA 2SNSA 1STHA 5I9PA 3DHQA 3OWFA 1EYDA 5HGTA 2RKSA 2PQEA 3D6CA 4ODGA 1ENCA 5DAUA 3TP6A 5C6AA 3NXWA 1NUCA 5I6WA 1EY0A 2EY5A 2OXPA 3C1FA 2HQEA 5EKKA 3SK4A 1STNA 2OF1A 2PZWA 3HEJA 3P75A 5CV4A 3OMCA 4RKBA 2F0KA 2M00A 4F7XA 5C4ZA 3R3OA 4DGZA 3TP5A 5J22A 1JORA 5IGCA 1A3UA 1F2ZA 3QOJA 4WORA 3EROA 3P1HA 3MXPA 3NUCA 4G57A 4NMZA 1SYDA 5CGKA 1KDBA 5EKLA 1A3TA 3PMFA 4PNYA 2EY2A 4K2LA 5CV9A 3NHHA 2WACA 4K5VA 2ENBA 5E1FA 1A3VA 5C5MA 4K5WA 1SNOA 2F0OA 4KY7A 5CR3A 3OMGA 5I9OA 5KYIA 3MHBA 2NUCA 5J1ZA 2EXZA 2F0HA 4K8JA 2KHSA 5E3FA 5I6YA 3S9WA 1EY6A 1EY9A 3D4DA 1SYEA 3T13A 2F0NA 2RDFA 2EYOA 3HZXA 2F0EA 5C5LA 1F2YA 5CV8A 5KRUA 3QB3A 4J1MA 2EYJA 5IGGA 1F2MA 4IALA 5KYLA 1KDAA 3TP7A 5IIFA 3RUZA 4RKLA 4QB4A 2F0GA 1KAAA 3MVVA 5CC4A 3TMEA 5HURA 1TQOA 1SYBA 3D4WA 1EY7A 1EZ8A 1SNPA 3NK9A 4QF4A 3SR1A 5M9OA 2F0WA 5IGBA 4H7BA 4KD3A 1ENAA 1SNCA 2F0SA 3SXHA 3NQTA 5K5PA 1STYA 4I65A 5IODA 5CV7A 2SNMA 2F0IA 2LKVA 2F3WA 2PYKA 3MZ5A 4N9PA 4N9TA 4B9XA 1SYGA 3H6MA 1TT2A 1EYAA 5NUCA 4KY6A 4ZQ3A 3SHLA 2F0QA 3LX0A 4S3SA 4ZUIA 2PZTA 2F0MA 4EVOA 2EY6A 3BDCA 5EGTA 1NSNS 2F0JA 3SK8A 4E6IA 4K14A 4TRDA 4KHVA 1TR5A 4F8MA 1JOQA 2SOBA 4IUNA 2KQ3A 4EQPA 4ME5A 2PW5A 4R8NA 1KABA 5KGUA 1EYCA 1II3A 1EY4A 4MIUA 5F2DA 3MEHA 2F0FA 1IHZA 3C1EA 4DFAA 1STAA 4EQOA 4DF7A 5JOBA 4OL7A 2PW7A 3ERQA 5KEEA 3NP8A 2F0PA 4KV6A 5CV6A 4KD4A 3VA5A 3BDLA 4K6DA 3D8GA 4J6HA 4NP5A 2RBMA 3OSOA 2F0TA 2PZUA 4IZ8A 4ZUJA 5IGEA 4PMCA 2O4XA 2F0DA 3EVQA 1SNQA 4KJNA 1STBA 1RKNA 1JOOA 2EYMA 4HMJA 4KJOA 1A2TA 4NDXA 5C4HA 4EQNA 4K2KA 4B9WA 4KY5A 3SK5A 1EZ6A 1U9RA 4QMGA 3DMUA 4HMIA 1AEXA 1KDCA 5ISRA 4PMBA 4WRDA
chains in the Genus database with same CATH superfamily
2KCTA 1B3AA 3M85A 2EY1A 4YIJA 1WTRA 3HOYH 1HQMC 5EPKA 2E2JH 3IRBA 1XWEA 2RA4A 4DR6L 4A93B 2K32A 2ALYB 3MWYW 3OW7A 2K33A 2R93B 1ZEQX 1SYCA 3PUXA 3AFQA 3E5SA 5JAVA 2Z8LA 1G6PA 3DXJC 1XMOQ 3Q24A 3RMHA 4J15A 1HUNA 1SEBD 1S3OA 5G3LF 2K7VA 1NUCA 1XNQL 3D31A 3GTOH 5E4WC 1WOCA 3K5NA 3SVMA 3J81L 3OOCA 4RGNA 3GTPH 4FDBA 1ASZA 2ICEC 1RF2D 5E4XA 5IY0A 4MZ9A 4BBRH 3RZOH 1MGSA 3MXPA 4FF3A 3HOUG 4PNYA 1IZ6A 1Y1VB 1FL0A 3DWQA 3V96A 1E24A 3J80c 1I4RA 3CPFA 3D4DA 4HIKA 3KYHC 4IUQA 2RDGA 3DM1A 4Y7NB 2UUBQ 1F2MA 3GD7A 1B9NA 1WCMB 1DXMA 3U50C 2NB0A 1KAAA 5CC4A 1D5ZC 3SR1A 4AYBB 2NYZD 3T4AC 4GN5A 4X65L 4RFBA 1G6ZA 2VUMH 2UXCL 5C4JB 1VMPA 2XWJB 2O2LD 3GTGB 3BS1A 2PMZB 2A68D 1NSNS 4DR2L 5T1IA 1EQRA 3J81c 4CHTB 1HR0Q 1YZ6A 2CW0D 1K0SA 5FLXE 4GNXB 4OO1I 4JI4L 2BA0A 2MJ8A 5CORA 1X65A 4IPHA 4EQOA 2JA8G 5A2QL 3S2HB 5FOBB 1HNXQ 1Y8OB 4FYDA 2F3IA 3CCEA 1H9SA 1RIPA 1Z47A 1XJVA 1J5EQ 4R9WA 2PZUA 2GA4B 3CPWA 1I4XA 1ESRA 2EPBA 1SFOH 1IKMA 2ID0A 3DUZA 4A3BH 2NVTB 4DK1A 4HMIA 2Q2HA 4JI0Q 3PV0A 4WRDA 2VQEQ 4PQXA 4JOIA 3U4VA 5IP9H 5KIXA 4LMQD 2VY3A 4JC0A 4NB3A 1OTCA 1EY8A 3GTLH 1SNDA 2CFMA 2KJXA 1EY5A 1DCZA 4EQ5A 1SMYD 3A56A 2N49A 1PH5A 2F0VA 2L55A 1JOKA 1TWFH 2SNSA 1LTID 1HR0W 3F2UA 2NVXH 1K8GA 1PTOB 1EQTA 3CAMA 4JI8L 4KN4C 4L5TA 4KKSA 3HEJA 2PZWA 1MD2D 1V1QA 5C4ZA 2F0KA 1TVXA 2XGTA 1BOSA 3QOJA 3WOEA 3CMAA 1SYDA 3HGBA 3KF6B 5EKLA 3P7JA 2YTXA 5FJ8G 1JE4A 4LFBL 3PO2B 1G91A 3S16H 1GUGA 2JE6I 1TWAH 2A6HC 5FLXL 3K6OA 5E3FA 3T1YQ 2RCFA 1EY6A 1SYEA 3AEVA 3I90A 5IGGA 1BQQT 4AQYQ 3FDTA 1QJOA 2MFIA 2KVMA 1P16A 2F0GA 2K5QA 3VA7A 2JA5G 2EJFC 4M1UB 1AP0A 1AZQA 3N52A 1X3GA 1U4PA 3NK9A 4B3TQ 3H0GB 5CBEE 1STYA 3DWPA 1E0BA 1I4HA 2B29A 3MZ5A 1SYGA 2XN9C 2L11A 4E6IA 1A62A 2B2WC 4F8MA 1NE3A 2JA9A 1LUZA 4ME5A 4R8NA 4EQPA 3CMEA 1XMOL 4IFDH 3D4RA 1QVCA 1EY4A 1UNSA 1PV4A 3HOYB 3E6ZX 1V8QA 1VQLA 1LTGD 4NXML 3Q0AA 1YBYA 3T51B 5GADC 4IJHA 1Y1WH 3G4SA 2VS1A 1BCPF 2CQOA 3S2DH 4RMFA 4JVZA 2BE5D 2ZM6Q 1E2WA 5C4HA 1VQBA 3CXCA 3IAYA 4ZAIA 2YU9H 3KUPA 1KNEA 4A3KH 4DR3Q 4KK7A 3STBC 5C4XH 3CCVA 1QZHA 1CT1D 3FKIH 5IOCA 3CC2A 3NTKA 3GTOB 1D8LA 5C44G 1BBWA 4FF1A 2XIWA 4UY8C 3HOXG 3GTPB 3NWTA 4YWMA 2UUBL 4GZYC 3RZOB 1WTPA 4XT1B 4DUZQ 2R3ZA 5GAEC 3ICEA 5TSSA 1EWIA 1HA6A 3GDEA 1CKNB 4Q5VA 5C6AA 2MPMA 4IQZA 1JJ2A 2PNRC 3I8ZA 3PSIA 4JYAQ 1I6VC 1HR0L 2Q2UA 3OMCA 3NQIA 3R3OA 3HKZB 1F2ZA 3AYHB 4JBJA 3ZJYC 3KF8B 3CP0A 3WWVA 1HNXL 2VUMB 1FNWA 3VR5A 1J5EL 5EBDA 2AKWB 4C3JG 2JA7H 5CR3A 4K8JA 2O5JC 1F77A 3HOVH 4GN3B 2E2DC 2XNAC 4WJ4A 2VQEL 1QNKA 4QL5A 3JAMi 1SNCA 1HZCA 1PH7A 2VXWA 1FD7D 4FXGC 1YNNC 1OXSC 4XYQA 1SFOB 5IE8A 3R8BA 4ZQ3A 1N34Q 4A3BB 1I4PA 2F0JA 1WTXA 1ONLA 4A3DH 1TR5A 1JOQA 1ML0D 4RGMA 1A0IA 1K73C 1GJXA 1JWMD 1II3A 3PIPA 1FGUA 1MKHA 2XVSA 3S1NB 2WIIB 2E2HH 2F0PA 5DM73 4RWSC 2B39A 3CCUA 2B2TC 3PCOB 2HCCA 1VQ5A 1EWCA 4IUUA 3GV6A 5CMDA 3H91A 3W1BA 1PRTC 4EQNA 1TWFB 5IYCH 4TQUS 3E9IA 1DONA 2NVXB 1H95A 4A3IG 4BA1I 2F03A 1VQDA 2A5HA 3TP7A 1D7QA 3LNNA 3HKZE 2UUAQ 2ES2A 4P74A 3AU7A 1AZPA 1GOZA 3TP8A 3A0JA 3T1YL 3DEPA 3E0EA 4A93G 5JVH3 3BZKA 4HJ7A 2JA6H 5IGDA 5IGFA 2R93G 2A74C 4NW2A 4AQYL 4K6LA 1EU4A 4B3TL 1E2VA 3D3RA 3S16B 4I7ZC 1QB5D 1TWAB 1PYSB 1QZGA 2FMCA 5I6WA 4GNXA 1E1OA 2BOSA 1TY0A 1B2TA 2JQOA 4KN7C 2P5ZX 4FVMA 4RKBA 2BA1A 1JORA 1X6OA 2NZOA 3PUZA 2K5DA 2TSSA 1Y1VG 4NMZA 1LTTD 1BXTA 2DN8A 1NY4A 3CQZH 2HD3A 5DLQE 3CCMA 1RL2A 1Q90A 5C5MA 2N3SA 1I50H 4AH6A 4KKUA 2B2UA 1VQ7A 4ULLA 2KUMA 2ZM6L 5JJIA 4BY1H 3C2PA 1TU2B 3H3VC 3HZXA 2LS01 2HUGA 5CV8A 3QB3A 5IYBH 4AYBG 4DR3L 1CUKA 2MNAA 4IUTA 1Y1WB 3N6RA 2CVRA 3BG3A 3STBD 3A5ZB 3S2DB 2HQLA 4N9TA 1UAPA 1VQJA 4KY6A 3SHLA 2F0QA 4O2DA 4DUZL 4DV2L 2VB3X 1EU3A 1PZID 2G9HD 4RA8A 3R93A 3ULLA 1JR0D 3S1MH 4GKJQ 1GD7A 1UWVA 2J0TD 5ELDA 1HCZA 5C4XB 3ULJA 3FKIB 1S72A 4MIUA 5L37A 1GVPA 1CA6A 3J7ZC 3S14H 2K03A 5KEEA 4JYAL 1V1PB 4K6DA 2KCMA 1VQMA 3KF6A 3J7AV 1SNQA 2K5VA 3I72A 2LMCB 4NDXA 3DMUA 2E5LQ 4FXKC 3VDYA 2R7DA 2K52A 2JYOA 1EIFA 3L0OA 1GUSA 2YTVA 1DOLA 1AE3A 1S5BD 2IY5B 5CV5A 2QEXA 2WV6D 1SAPA 3SK6A 3CCJA 5DEHA 1FJGQ 1SSOA 3M3YH 1V9PA 4PG3A 1VQOA 3AFPA 5LL6X 2AQ2B 2JA7B 2CWPA 1ZYRD 3CC7A 4DUYQ 3NE5B 2RF4A 1HZ9A 4GS3A 1K0RA 2OF1A 3HOVB 3I3CA 4A3LH 5C44B 2ZXPA 1ZXTA 1BVSA 4P73A 1A3UA 3QG1A 2ZJQA 4Z9CB 3NUCA 2CW0C 4G57A 4G7HC 2WAQG 2B3GA 3K0YA 3M7GA 3GO5A 2EY2A 1JICA 2WACA 3PO2G 1VQ6A 1KXLA 4JCVE 1Q46A 1TS5A 5D3DA 2F0OA 5ELOA 5KNCA 5J1ZA 1BBXC 4A3DB 3UE1A 4OWWB 2YYZA 1PH3A 1SR3A 1CKMA 2BH2A 3HOWH 5C5LA 3WDNA 3G6EA 1KDAA 1OXTA 1O7IA 4OWXB 5IIFA 2MO0A 4IUVA 4QB4A 2E2HB 2L5TA 2Z9HA 2IX3A 3C46A 2UUAL 1KHIA 3H0GG 3FHWA 2IL8A 5FO7B 4H02A 3RZDH 1N9WA 3FPPA 4BY7H 2WB1B 1PH6A 2RSOA 4DK6C 2LKVA 3J7A5 2L0CA 2VZAA 4B9XA 2XWBB 3H6MA 5IT9L 1CTMA 4DR7Q 4EVOA 2EY6A 3SK8A 1CKNA 1H9KA 1X3FA 1SE8A 1XPUA 4OX9L 1X56A 2NN6I 3HOYG 5J3BA 4R4IA 2EOTA 1O78A 2KHJA 1MIUA 2A69D 1SXTA 4HIOA 3MXUA 3I91A 3F8TA 4OL7A 5M5WH 3H3VH 1VQ8A 2AUJD 5GQOA 2ZXOA 3BDLA 3KF8A 4JG2A 1VQHA 2F0TA 1HUMA 1ET6A 4IZ8A 2RVLA 2Q2TA 2JN4A 1UEBA 4LF8Q 1JJGA 4JBKA 3MA2B 4JI2L 4R4CA 3RLFA 4OO1H 1S5FD 3X3NA 1EZ6A 5C3EB 4POFA 3J80i 5ISRA 4A3MH 3U9SA 4BS9A 5A35A 4YCVA 1Q7YC 2EYPA 2CCZA 1CZGA 2BH8A 1PVOA 4LFCQ 5IT9c 4A3GH 5I2XA 5G3LD 1HNZQ 4K8IA 2D0OA 5EKIA 1DYQA 1TIID 3GQBA 4HN7A 4WJWA 2HIXA 3CRKC 1LV9A 3GTJH 4GOPC 1VQNA 3KFUA 3QIAA 4JK1C 4DKAC 1X54A 1I50B 4KHPQ 1SBBB 2PQEA 2SDFA 2QA4A 2VL6A 3J81i 4DAPA 3HOZH 3OTOQ 5LMNQ 3SE0A 4ZKBB 3TZDA 4JI6Q 2WB1E 2Y0SB 3O13A 4ZYSA 4LF4Q 4L6TB 4X3KA 3HKZG 4EGVA 1DM0B 1K83H 1YHAA 2VUMG 2R7ZH 5CV9A 3A8KE 4L8JA 1XTDA 4MTNA 3BZCA 4XYOA 4C2MH 1TY2A 1L1OC 1HTPA 4YWLA 1EY9A 4JI3Q 4UP8A 1F2YA 2E5LL 2BE5C 4DV6Q 4OELB 3S14B 3D4WA 2E74C 5EPJA 1FNUA 3L7ZC 1YNXA 2PYKA 1PTOF 1HPCA 4A3BG 3QR8A 2Z4IA 4BXXH 3M7NA 1L0XB 2MGSA 5LMNW 5IP9G 3Q23A 1OXVA 2LY7A 3MAQA 1ESFA 2RHSB 3PIO3 3MEHA 2F4VQ 2EQSA 3I4OA 4XIGS 3W2DA 4DF7A 3PUYA 3ERQA 3NBHB 1DOMA 1JE5A 5DNFA 5IWAQ 3EFXD 4KD4A 5BR8Q 5M3MH 4R4OA 4QUFA 2J7ZA 3M3YB 1BF4A 1I94Q 2Y0SE 1TWHB 1YHQA 1WTWA 1PRTB 4CDEC 1PHJA 3URYA 2SEBD 2D62A 3H09A 4K5XA 2NBFA 5J39A 3S17H 4XT3B 4OIKA 4OGQC 4DAMA 1WVLA 1VQEA 4U673 4AIMA 4DV1Q 1S5DD 1PLFA 4DU9A 4BBSH 1U4RA 1VCIA 1SNMA 3EBEA 3ITPA 1STGA 3M4OH 1PH8A 1GXDC 1KRTA 3BVZA 2F4IA 5EAYA 1EYDA 2RHQB 5DAUA 3NXWA 1KLGD 2OQKA 2AQ3B 4DR7L 2B2YC 2EY5A 3HOWB 4HSPA 4XQJA 1Q3LA 4BWGB 1VQPA 3S24A 1V1PA 2KCNA 4ZRZA 1MHWC 3I73A 3RZDB 1IXRA 2A6ED 4RHSA 4BY7B 1KDBA 1R4PB 2NZ1D 1CZWA 1XPRA 1Q8KA 4JV5Q 2KEEA 4K5WA 4CGYB 3MEFA 1XX8A 3OMGA 4H44C 4IFDG 4LF8L 3KDFB 3CKIB 1MSHA 4AYBE 1WYDA 2E8GA 4B3MQ 4J1MA 5HURA 5M5WB 1T5XD 1TQOA 1HNWQ 1Y1WG 1QVGA 5ELNA 1EL0A 1LT6D 5JPNC 2UU9Q 2PMZE 1B1ZA 1Y8NB 3NQTA 2K01A 3KOJA 1UE7A 4LFCL 2F0IA 2F3WA 2OTJA 2MHVA 2WAQB 1B3QA 1NAPA 1KTKA 2QW7A 3K58A 4DNTB 1Q1BA 4A4IA 4A3KG 3LGJA 1CK1A 2I5LX 2SOBA 4IUNA 3FKIG 3K57A 4A3MB 5C4XG 1BCPD 5AFWA 4X3SA 4B3RQ 2F0FA 4KHPL 2AUKA 2KCCA 3BDOA 5LMNL 3OWEB 3T53B 3SEBA 3BJUA 4A3GB 4M8AA 4JI6L 4J6HA 2G5DA 4QIWB 4LF4L 5C0XI 3EVQA 1STBA 1EEID 1A2TA 3GTJB 1D2BA 4K2KA 5FKAC 4IN3A 3I2ZA 3TBIB 3KJOA 1WTVA 3A5UA 5JVG3 1W2BA 4DAYB 2F3VA 2VQFQ 2ZTDA 2E2JB 4JI3L 1XMQQ 2EYFA 1S5CD 4LUVA 4HIMA 3I56A 1FVIA 2CHBD 4DV6L 3F1ZA 2R7ZB 5FLXc 1M1KC 4A3FH 1UEAB 2JA7G 4C2MB 1NNXA 4ODGA 1E22A 1RODA 1N32Q 4RCOA 3DM3A 3GTMH 3FVQA 3I70A 3HOVG 2B2WA 4IPCA 5FO8B 4PZ8A 5D65A 4LF6Q 4HAEA 3Q6SA 4F7XA 4A76A 4DGZA 2WAQE 4DV7Q 2KBNA 4DV5Q 2F4VL 1SMXA 4LFAQ 4BBRB 2DY8A 1QG7A 3EQLC 2NZHA 1B44D 4LJZC 5BR8L 2GN5A 4A3DG 4MN3A 1JC7A 1I94L 1UE6A 1VQGA 2I46A 4UP7A 1EWHA 1KAWA 3GTQH 2F0EA 5IYDH 1E2ZA 5KYLA 1QILA 1B4OA 1JT8A 3PIOA 4HJ8A 2K5NA 1LT5D 1IYJB 3KLRA 2WB1G 1U4MA 2F0WA 2NVYH 4KD3A 3U4ZA 3PUWA 5M3MB 2F0SA 3SXHA 5IODA 4FO2A 4FF4A 4HSVA 2AWNA 5IYCG 3JAME 3RLOA 1X32A 3K5LA 4JW0A 4S3SA 4POGA 1UUPA 2K1BA 1N36Q 4DNIA 3NTHA 1PH4A 1WJJA 5JEAJ 2EXDA 1F9RA 1IHZA 4DFAA 2JA6G 2PW7A 1Q81C 4JI0L 2CKZB 1QNUA 1Q1EA 3S17B 1EEFD 1ZYRC 3C3LA 3NWSA 1C7YA 2OCEA 3OSOA 2H1EA 1YNJD 1CKOA 2IJ0A 1PYWD 3CCLA 3GP7A 3ONAB 3M4OB 1SLJA 2B2VA 5C3EG 1SJED 1U9RA 4LNQA 4X6AH 2K14A 1YJNA 4GKKQ 4JV5L 3V2TA 1J9OA 1SDFA 4NKLA 4CKEA 2MUYA 4JI1Q 1PFMA 3QOLA 4HTHA 1D5XC 5GAGC 2F0LA 3GTLB 4B3ML 1Z6HA 5C0XJ 3VYSA 5CBAE 1G51A 2J4XA 1O7YA 1HNWL 2GVAA 2QCPX 2UU9L 1A6XA 1VS0A 1BUVT 2Z4HA 3CF5A 4GOPB 1PH2A 1NJIC 2Y0SG 4UPAA 5IYBG 4B08A 4CBVA 1P8LA 1V43A 1UE5A 4LF7Q 1NTGA 3NBHA 4QUCA 3I4NH 1KL9A 4ZCKA 4IUPA 3RR5A 4B3RL 4MHEA 3A55A 4LW1A 2R6GA 4A3JH 1Q8IA 1F9SA 1U5KA 1ZKOA 2I07B 1IYUA 1A3TA 3IL8A 4HR7B 1JB3A 3K0XA 5E1FA 2B2TA 2A69C 4DNRB 2JJQA 3A7AB 3MHBA 3AQQA 3ULPA 3BYYB 1JMCA 2IHFA 1L1OB 1S5ED 1K8OA 1L0YB 1EUJA 2K4KA 1S4ZA 5FO9B 2O5IC 1SNPA 4DV3Q 5BN3A 1JJCB 3CHBD 3MFYA 2VQFL 5K5PA 5KNBA 1C8CA 4XQQA 4JI7Q 3PO3H 2B8FA 3F2DA 3BU2A 1D1KA 1EFWA 5BN5A 1EYAA 1G291 3LX0A 5I9PA 4X66Q 4DK0A 4N8X1 5K36H 2NTSA 3IFDA 2KQ3A 3G71A 1KABA 1EYCA 2EIFA 3HKSA 5F2DA 2D0PA 4B3SQ 1XPOA 2ASBA 1U4LA 1LTBD 1N32L 5CV6A 4YWKA 2ZTCA 4XXEA 2F0DA 2V4DA 1LM0A 1PTOC 4HEDA 4DV7L 2OTLA 3TQYA 4DV5L 4A3FB 4LFAL 2NN6H 1DZ1A 2QF7A 1T9HA 2YU9B 3KDFA 4A3IH 3K5MA 4A3KB 2IHEA 2ZJRA 3GTMB 3NPPA 1HA5A 2V1CC 1LO5D 4A3LG 3CRLC 4DR5Q 4FXDA 1F2LA 4LAAA 4OEMB 3T16A 2FFKB 1M90C 2F0UA 1HFNA 4KI0A 5DM63 3KK7A 2N88A 2KHIA 1U0LA 1BO0A 3J7YW 4Y52H 4RGOS 4CDDC 3HG9A 1VQKA 3L3OC 2RKSA 1A63A 2A1AA 2CQAA 3HOWG 1LTAD 2IT1A 1RCVD 3GTQB 4EX5A 1N36L 1STNA 2B63H 1SE4A 4C3HH 4BY7G 3EN2A 2IX0A 2NVYB 4DPGA 5EJWA 3FMCA 4WJ3M 1EQQA 1F9QA 2PO4A 2PCFB 2YTYA 2ENBA 4LF5Q 3X3MA 4C3IH 2EE1A 5LHY1 1HHVA 2KHSA 1IKLA 2EYOA 4DAYA 1N34L 1WCMH 1B70B 1V1OA 4RKLA 2R7FA 4GKKL 2JXMB 2N55A 2I5HA 1HFGA 3UDGA 1ICFB 3VYTA 5I4DA 2R92H 4JI1L 1WI5A 4XDXA 5T1GA 2SNMA 2Z6KC 3E9HA 2TMPA 4TSSA 5C4JH 5FLMH 1Z7TA 5NUCA 1CQVA 1A8VA 1QE6A 3BDCA 3D0FA 4JBMA 4TRDA 3DLLA 4A3MG 2BDNA 4R4QA 1G2SA 5E7NA 3V05A 1SE2A 2IW3A 3P20A 1UE1A 5LL6S 3S2HH 4GN4B 2IX1A 4A3GG 2UXCQ 4I7AA 4KV6A 1WD0A 1TS3A 2Z1CA 4LF7L 1W6JA 1MBYA 1K28A 2HDMA 2NVTH 4A3CH 5H1SE 4JI4Q 1H9MA 1M8AA 5HY6A 4ABNA 2F1MA 2DNEA 3HOZG 2BCOA 2A6EC 5M5YH 2K75A 2EZVA 2L9HA 2R61A 4IJLA 3J80E 1WFQA 1IBLQ 2NVQH 1K3BC 1CSQA 3K59A 2JA6B 2R7ZG 1YHBA 4A3JB 1VQ9A 1Z9FA 4G4KA 2C35B 1HZAA 2PPBC 1EQVA 4DV3L 4KTAA 1EIHA 2FJ2A 3CD6A 2X6LA 5M3FH 1PTOH 4JI7L 4JI5Q 1R4QB 3D6CA 2FXQA 1ENCA 1KRSA 1H9JA 2NTTA 1XYIA 4RHRA 2Q8TA 3I7FA 2Q2IA 4X66L 3I55A 2OXPA 2X69A 3I4MH 2UUCQ 2L12A 2ICIA 4ILWA 3J81E 2AQ1B 1GKHA 4DR1Q 3PQIA 2LXJA 4BBRG 4WORA 4B3SL 2K5HA 1BCPC 3PMFA 3PO3B 4YHHQ 4K2LA 1PRTF 3CQZB 4WFN3 4A3EH 4BXXG 2DNCA 1SNOA 1SRUA 4KY7A 3UDFA 5LMUQ 1F9PA 4BY1B 2VW9A 1SJHD 2E2IH 1I6HH 1PTOD 5KRUA 1AW7A 4MNOA 4DR4Q 4C1NK 4GKJL 4DXFA 4L5RC 1S40A 5M3MG 1EY7A 1EZ8A 4QF4A 4LFBQ 1PMRA 1ENAA 1LABA 1YJ9A 2AWOA 5CV7A 1YITA 4UDUC 3BYTB 1PXUA 4R4TA 4ZUIA 5D14A 5IP7H 5JEAH 4GOPA 2XRSD 3S1MB 1QWYA 1I4QA 2HCIA 1STEA 4IOCA 4O1NA 3J80L 1BNZA 1JCKB 1STAA 4TKOB 3CCQA 1FYCA 4QY7A 1ET9A 3S1QH 1EOTA 1PYBA 2QKIC 5A2QE 4HJ9A 3D8GA 2RBMA 1CQFA 3I4LA 3KBXA 4BBSG 2L15A 3PGZA 4NPSA 4X64Q 1TKWB 3T56B 1FJGL 3SK5A 2DUDA 1QCBD 1K9MC 5KGUA 4NXMQ 4LF5L 1BKBA 5JOBA 4QQBX 2IWHA 1L1OA 5HGQA 1CM9A 2B63B 4DUYL 4OXPA 5C0XH 2D5DA 4C3HB 4PMWA 3J81j 2QDBA 2Z0SA 3K5OA 3T1HQ 1X3PA 2QEJC 3J7AF 1M4VA 4JBWA 3MXNB 3VR4A 1TWGH 1VQAA 3IKJA 4C3IB 3TDQA 3MTSA 2HDLA 3D6WA 2K04A 5ELBA 3SDZA 2ATWA 5ELFA 1MSGA 4IURA 5CYUA 1DGSA 3EIVA 5M5XH 3TEHB 3UDXA 5CV4A 1I3QH 1LTSD 5JJLA 3UI2A 4O42A 4OHJA 4KMUC 2K28A 4HIDA 3P1HA 2R92B 3H3VI 2BDOA 3M4QA 1TS2A 4K5VA 1O7ZA 4V0BA 1ENFA 4OIJA 1A3VA 4JOIC 2NUCA 3F2BA 1VF7A 4H0LC 1VDZA 2A73B 2K05A 1GHKA 1YNJC 4LWCA 3GTKH 4DA2A 1GO3E 4DXGA 4XQNA 4BA2I 5BN4A 3CCSA 3MVVA 1PDQA 5M9OA 4GLVB 1IBLL 4QCLA 4JPBW 4I65A 1PA6A 5JPMC 1BDOA 2IPKD 4LUOA 3HOUH 2XTIA 4DAVA 1RTOA 5COYA 4R8IA 4TVAB 3PIP3 5M5YB 2E75C 4U68A 3S1NH 4JI5L 1PZJD 1VQFA 2NVQB 3A8IE 4UAIA 2B2YA 1YJWA 3BZDB 4HCSA 2UUCL 2PQAB 3L9AX 4LUZA 4NP5A 3TREA 1X9NA 4PMCA 2O4XA 4YCWA 3R2IA 1RDPD 4A3FG 2FINB 4HMJA 4DR1L 1HNZL 1ILQA 5M3FB 1PFBA 1JB7A 4KHZA 4H13C 4YHHL 4UP9A 1AEXA 4K0KQ 4ZLTF 1A2UA 3NENA 4P72A 4C1NI 1DOKA 3ERSX 1LTLA 2AMCB 3I4MB 4GLXA 1KLUD 5LMUL 3MXGA 1ASYA 4ME3A 2JA8H 4F87A 5C3XA 3OTOL 1IBKQ 2EJMA 5D3IB 3RN5A 2HT1A 4DR4L 1CI3M 4A3EB 1IW7C 2JEAI 1MJCA 5HGTA 2YV5A 1K8AC 2PI2E 1E7ZA 5IYDG 4FP5D 1I6HB 3HOZB 2E2IB 1OO9B 1G2TA 3K7AH 1LTRD 3TP5A 1B9MA 2CH4W 4HJAA 2RSNA 2XRQD 1K83B 3TS2A 2Q8RE 3NHHA 1TWCH 1VMCA 3KBGA 4HJ5A 1PH9A 4LF9Q 4CDCC 4YCUA 1X3QA 4X64L 3QJYA 2OWOA 4J8QA 1HRJA 3VR3A 3RUZA 1H9RA 3TZUA 4QGUA 3S1QB 1NBWA 2WKCA 3KLSX 2VNUD 4R1JA 1PZKD 2QDLA 2XSCA 4N9PA 3ZYYX 5IWAL 2D9UA 2PZTA 5FJ8H 3B6YA 1WTHA 3T1HL 3NEMA 2JEBI 1MI2A 1JWSD 1LT3D 2QILA 4QIWE 1GM5A 2AHOB 2UXDQ 3OIPA 3AB9A 3NP8A 4X3UA 2JA5H 3CCRA 3VA5A 1QUQB 1W6KA 1EFID 2JK8A 3BVMA 1Q86C 4DV2Q 5IGEA 4L63B 4FF2A 1EIYB 1T5EA 2K6AA 3HFZB 4C56C 3FPUB 5FK9C 1TWGB 3E0JA 4DV1L 2C9OA 1OXXK 2JP1A 1XNRQ 3NELA 4PMBA 1B8AA 2E76C 3M9BA 4ID6A 5ELEA 3VR6A 5M5XB 3I4NG 4IOAA 1I3QB 4LK1C 4L5QA 4CJ0B 4A3JG 2L1BA 1L2FA 1HZBA 2B2VC 3S1RH 3HRZC 3S15H 5ELCA 2OEOA 4BBSB 4MTKA 4CKCA 4G7ZC 3TSSA 2ZXRA 1K8MA 1LACA 1IYVA 1N8RC 5EKKA 3GTKB 1KD1C 3P75A 3K7UC 4HCEA 5J22A 5C44H 3KJPA 2DGYA 3HOXH 3CW2C 1C9OA 1IL2A 1MJEA 3LWEA 2EDGA 2FHTA 4CJ1B 3U58A 3FRPB 3PO3G 2Q8IB 4X62Q 3K8AA 1KQSA 1VF5C 1YVCA 3WOFA 3HOUB 4G7OC 3CU7A 5K36G 1BCPB 5I9OA 4NXNQ 4BY1G 1Y14B 3DWAA 3T13A 5JJZA 3BVGA 1J6QA 2OT2A 3K80C 1NCVA 2FMMA 2KA7A 4IO9A 1VQCA 1HTLD 4DK3C 4K0KL 4IFDI 1NR4A 3TMEA 2ZT9C 3G48A 1Y69U 1R9TH 1IBMQ 5IGBA 4H7BA 2RCNA 3A74A 3OYYA 1DD2A 2C5CA 4PZ7A 4APVA 2KENA 1Q82C 3JAML 1IBKL 1GUOA 1Q12A 2NN6G 3MXNA 4RG1A 4DV4Q 3IFTA 2KECA 1GHJA 1PFNA 1B53A 5EGTA 4DN4M 4GNXC 4C3JH 4KHVA 2M2LA 1GUNA 4RH6A 2N8NA 2G9DA 3C1EA 2HHHQ 4N8FA 4PV1C 4P75A 4DV0Q 1IW7D 4RCNA 2N78A 1RJTA 3SGIA 3OPOA 2JA8B 2A6HD 2MO1A 1I4GA 4OONA 1KNAA 1YI2A 1DJRD 4P71A 4UHVA 1RKNA 1JOOA 2B2UC 3W3AA 1XMQL 4OX9Q 1GUWA 2DJFC 4B9WA 1BR9A 1D6EC 4ZK9B 5KNDA 5C3EH 1LT4D 3A7LA 1HXYD 3RLNA 4QMGA 2ZTEA 1YIJA 1RHPA 4LF9L 2B63G 2I5MX 1TS4A 2UXBQ 3K7AB 4KLKA 4X3TA 3JAMc 2WKDA 3UE0A 2PI2A 5EBCA 3W5OA 4C3HG 4YY3Q 2EJGC 2GVBA 4JI2Q 1WD1A 2LFNA 1C4QA 4LF6L 1X3EA 1J8IA 1CHQD 3DEOA 1K3RA 1TWCB 4Q0FA 4C3IG 2H5XA 1RD9D 3TP6A 2I0QA 1N33Q 5EPLA 1PFSA 1WCMG 3R2TA 1E3PA 3C1FA 2HQEA 4IPDA 3SK4A 1C0AA 4GLAC 4A93H 5AJ3Q 2HIVA 2R92G 3VR2A 5IGCA 2PQAA 2R93H 1H9SB 2Z6BA 1OXUA 2CWAA 5CGKA 2UXDL 4CJ2C 4QJFA 5FLMG 3NTIA 1C48A 2OQ0A 3S9WA 1CHPD 1HJPA 1E1TA 4DR6Q 2F0NA 2RDFA 2CH4A 2EYJA 4IALA 3E3XA 1XNRL 3HP3A 3MFGA 3G7LA 1IL8A 1SYBA 1EOVA 2JA5B 2KEDA 3G6JB 3W1GA 1SROA 5GROA 1NMGA 1Y1VH 4A3CG 1W3SA 1TT2A 5IT9E 1Y8PB 1BBUA 1D5MC 1XNQQ 3UDIA 3FEWX 4CDFC 2X6GA 1KC8C 3GV3A 2EVBA 4Y7NH 3TS0A 3TRZA 4IFDJ 2NWGA 2WINB 3PF5A 3RN2A 3PF4A 1KIXA 3H94A 3FP9A 1AFPA 3A8JE 2H4OA 3CC4A 4KJNA 3S1RB 3S15B 2EYMA 5M3FG 1L0WA 5GAHC 1VQIA 3GTGH 1TWHH 4X62L 4OO1G 1EYGA 1AN8A 2F52A 2B8GA 1O7LA 4OWTB 1KDCA 1B7YB 3AMUA 2VB2X 3RNUA 3I4MG 1HH2P 2A19A 1YNND 3M4PA 4X65Q 3U9OA 5I2YA 4NXNL 5C3WA 4A75A 1G8ZD 1SN8A 2A68C 1VQ4A 3HOXB 1O80A 2EYHA 1WTOA 2LXKA 4CKBA 3Q22A 1A15A 4RAUC 2EYLA 1LYLA 3JC66 2DJGC 1SYFA 4DR2Q 4P2CB 3EJIA 1NR2A 4A3EG 1IBML 1GUTA 1SE3A 2LSSA 2QGQA 1CFMA 1STHA 2Z6KA 3L2PA 3DHQA 3OWFA 3KLWA 4IPGA 4DV4L 2M9VA 1EY0A 2DY7A 1FGBD 1HQRD 1PRTD 5EQ0A 3VYRA 2M00A 2MQHA 3I4NB 4ZKCB 1QUQA 1R9TB 4V190 3NBIA 2HHHL 3EROA 4DV0L 3F2CA 1PH1A 3HS0C 1QOHA 3QWNA 1FNVA 4KKTA 3ND8A 3TN2A 1YEZA 4RGTA 5IP7G 5JEAG 4PZ6A 3QO2A 1X55A 4ALPA 4C3JB 1JWUD 1JQYD 2EXZA 2F0HA 5I6YA 1I5FA 3PUVA 1SMYC 2WP8J 1QVFA 3A54A 5JJKA 1CA5A 1AE2A 3VYUA 1B50A 1ICWA 3OHXC 2ZJPA 1XXGA 3H15A 3LWUA 2UXBL 1NMFA 4YY3L 1CSPA 1TXYA 2KOLA 4JI8Q 3PO2H 2F0MA 2RQXA 1ILPA 2K50A 4K14A 3Q8DA 4L5SA 2PW5A 2RDHA 3OIQA 1WTQA 2K5WA 3M4YA 2MP1A 2JSOA 3KLSA 1EIGA 5C0XG 1XTCD 2A8VA 1N33L 2L4NA 3ND9A 3EA6A 1LLRD 3RD4A 1RTNA 4F88A 3H0GH 2PNHA 4ZUJA 3K81C 1AH9A 2WFWA 5AJ3L 4DR5L 2D2CC 4KJOA 1FR3A 3NSWA 4O0AA 4KY5A 3MC0B 3OW2A 1D1IA 3ER0A 4FNFA 4XTCS 5KYIA 4A3IB
chains in the Genus database with same CATH topology
1B3AA 3M85A 2EY1A 4YIJA 1WTRA 1HQMC 5EPKA 1XWEA 2RA4A 4A93B 2K32A 3MWYW 3OW7A 2K33A 2R93B 1ZEQX 1SYCA 3PUXA 3E5SA 5JAVA 2Z8LA 3DXJC 3Q24A 3RMHA 1HUNA 1SEBD 5G3LF 2K7VA 1NUCA 3D31A 5E4WC 3K5NA 3SVMA 3J81L 3OOCA 4RGNA 2ICEC 1RF2D 5E4XA 1MGSA 3MXPA 4FF3A 4PNYA 1Y1VB 3DWQA 3V96A 1I4RA 3D4DA 4IUQA 2RDGA 3DM1A 4Y7NB 1F2MA 3GD7A 1B9NA 1WCMB 1DXMA 2NB0A 1KAAA 5CC4A 1D5ZC 3SR1A 4AYBB 2NYZD 3T4AC 4RFBA 1G6ZA 5C4JB 1VMPA 2XWJB 2O2LD 3GTGB 3BS1A 2PMZB 2A68D 1NSNS 5T1IA 4CHTB 2CW0D 5FLXE 4OO1I 2BA0A 2MJ8A 5CORA 4EQOA 5A2QL 3S2HB 5FOBB 1Y8OB 4FYDA 1H9SA 1Z47A 4R9WA 2PZUA 2GA4B 1I4XA 1ESRA 2EPBA 1IKMA 2ID0A 3DUZA 2NVTB 4DK1A 4HMIA 3PV0A 4WRDA 4PQXA 5KIXA 4LMQD 1EY8A 1SNDA 2KJXA 1EY5A 1DCZA 1SMYD 3A56A 2F0VA 2L55A 1JOKA 2SNSA 1LTID 3F2UA 1PTOB 1EQTA 4KN4C 4KKSA 3HEJA 2PZWA 1MD2D 5C4ZA 2F0KA 1TVXA 1BOSA 3QOJA 3WOEA 1SYDA 3HGBA 5EKLA 3P7JA 1JE4A 3PO2B 1G91A 1GUGA 2JE6I 2A6HC 5FLXL 3K6OA 5E3FA 1EY6A 1SYEA 3I90A 5IGGA 1BQQT 3FDTA 1QJOA 2KVMA 2F0GA 2K5QA 3VA7A 2EJFC 4M1UB 1AP0A 1AZQA 3N52A 3NK9A 1U4PA 3H0GB 5CBEE 1STYA 3DWPA 1E0BA 1I4HA 3MZ5A 1SYGA 2XN9C 2L11A 4E6IA 2B2WC 4F8MA 4EQPA 4ME5A 4IFDH 4R8NA 3D4RA 1EY4A 1UNSA 3HOYB 3E6ZX 1V8QA 1LTGD 3Q0AA 3T51B 1BCPF 2BE5D 1E2WA 5C4HA 3IAYA 4ZAIA 3KUPA 1KNEA 4KK7A 1CT1D 5IOCA 3NTKA 3GTOB 4FF1A 2XIWA 3GTPB 3NWTA 4GZYC 3RZOB 1WTPA 4XT1B 2R3ZA 5TSSA 1HA6A 4Q5VA 5C6AA 2MPMA 4IQZA 2PNRC 3I8ZA 1I6VC 3OMCA 3NQIA 3R3OA 3HKZB 1F2ZA 2VUMB 1FNWA 3VR5A 5EBDA 4C3JG 5CR3A 4K8JA 2O5JC 1F77A 2E2DC 2XNAC 1QNKA 1SNCA 2VXWA 1FD7D 4FXGC 1YNNC 1OXSC 4XYQA 1SFOB 3R8BA 4ZQ3A 4A3BB 1I4PA 2F0JA 1WTXA 1ONLA 1TR5A 1JOQA 1ML0D 4RGMA 1GJXA 1JWMD 1II3A 2XVSA 3S1NB 2WIIB 2F0PA 5DM73 4RWSC 2B39A 2B2TC 2HCCA 1EWCA 4IUUA 3GV6A 5CMDA 3H91A 1PRTC 4EQNA 1TWFB 4TQUS 1DONA 2NVXB 4BA1I 2F03A 2A5HA 3TP7A 3LNNA 3AU7A 1AZPA 1GOZA 3TP8A 3DEPA 5JVH3 5IGDA 5IGFA 2A74C 4NW2A 4K6LA 1EU4A 1E2VA 3D3RA 3S16B 4I7ZC 1QB5D 1TWAB 2FMCA 5I6WA 2BOSA 1TY0A 1B2TA 4KN7C 4FVMA 4RKBA 2BA1A 1JORA 3PUZA 2K5DA 2TSSA 4NMZA 1LTTD 1BXTA 2DN8A 1Q90A 5C5MA 4KKUA 2B2UA 4ULLA 2KUMA 3C2PA 1TU2B 3H3VC 3HZXA 2LS01 2HUGA 5CV8A 3QB3A 4IUTA 1Y1WB 3N6RA 2CVRA 3BG3A 3S2DB 4N9TA 1UAPA 4KY6A 3SHLA 2F0QA 2VB3X 1EU3A 1PZID 2G9HD 4RA8A 3R93A 1JR0D 5ELDA 2J0TD 1HCZA 5C4XB 3FKIB 4MIUA 1CA6A 2K03A 5KEEA 1V1PB 4K6DA 3J7AV 1SNQA 3I72A 2LMCB 4NDXA 3DMUA 4FXKC 2JYOA 1GUSA 1DOLA 1S5BD 5CV5A 2WV6D 1SAPA 3SK6A 5DEHA 1SSOA 5LL6X 2AQ2B 2JA7B 1ZYRD 3NE5B 2OF1A 3HOVB 3I3CA 5C44B 2ZXPA 1ZXTA 1A3UA 3QG1A 4Z9CB 3NUCA 2CW0C 4G57A 4G7HC 3K0YA 3M7GA 3GO5A 2EY2A 1JICA 2WACA 1TS5A 5D3DA 2F0OA 5KNCA 5J1ZA 1BBXC 4A3DB 2YYZA 5C5LA 3WDNA 1KDAA 1OXTA 5IIFA 4QB4A 4IUVA 2E2HB 2L5TA 2IX3A 3C46A 2IL8A 5FO7B 3FPPA 2WB1B 2RSOA 2LKVA 2L0CA 4B9XA 2XWBB 3H6MA 5IT9L 1CTMA 4EVOA 2EY6A 3SK8A 1H9KA 2NN6I 2EOTA 1O78A 2A69D 1SXTA 3MXUA 3I91A 4OL7A 2AUJD 2ZXOA 3BDLA 3KF8A 2F0TA 4IZ8A 1HUMA 1ET6A 2RVLA 3MA2B 3RLFA 4OO1H 1S5FD 3X3NA 1EZ6A 5C3EB 5ISRA 3U9SA 4BS9A 5A35A 2EYPA 1CZGA 5I2XA 5G3LD 4K8IA 5EKIA 1DYQA 1TIID 3GQBA 4HN7A 4WJWA 3CRKC 1LV9A 3QIAA 4JK1C 1I50B 1SBBB 2PQEA 2SDFA 4DAPA 3SE0A 4ZKBB 3TZDA 2Y0SB 3O13A 4ZYSA 4L6TB 4X3KA 4EGVA 1DM0B 5CV9A 3A8KE 4L8JA 4XYOA 1TY2A 1HTPA 1EY9A 1F2YA 2BE5C 3S14B 3D4WA 2E74C 5EPJA 1FNUA 3L7ZC 2PYKA 1PTOF 1HPCA 2Z4IA 3M7NA 1L0XB 2MGSA 3Q23A 1OXVA 2LY7A 3MAQA 1ESFA 3PIO3 3MEHA 4XIGS 3W2DA 4DF7A 3PUYA 3ERQA 1DOMA 5DNFA 3EFXD 4KD4A 4QUFA 2J7ZA 3M3YB 1BF4A 1TWHB 1WTWA 1PRTB 3URYA 2SEBD 2D62A 3H09A 4K5XA 2NBFA 5J39A 4XT3B 4OIKA 4OGQC 1WVLA 4U673 1S5DD 1PLFA 4DU9A 1U4RA 1VCIA 1SNMA 3ITPA 1STGA 1GXDC 3BVZA 2F4IA 1EYDA 5DAUA 3NXWA 1KLGD 2AQ3B 2B2YC 2EY5A 3HOWB 4HSPA 4XQJA 1Q3LA 4BWGB 1V1PA 2KCNA 4ZRZA 3I73A 3RZDB 2A6ED 4RHSA 4BY7B 1KDBA 1R4PB 2NZ1D 1CZWA 2KEEA 4K5WA 4CGYB 1XX8A 3OMGA 4H44C 4IFDG 3CKIB 1MSHA 4J1MA 5HURA 5M5WB 1T5XD 1TQOA 1EL0A 1LT6D 5JPNC 1B1ZA 1Y8NB 3NQTA 2K01A 2F0IA 2F3WA 2MHVA 2WAQB 1NAPA 1KTKA 3K58A 4DNTB 1Q1BA 1CK1A 2SOBA 4IUNA 3K57A 4A3MB 1BCPD 5AFWA 4X3SA 2F0FA 2AUKA 2KCCA 3BDOA 3OWEB 3T53B 3SEBA 4A3GB 4M8AA 4J6HA 4QIWB 5C0XI 3EVQA 1STBA 1EEID 1A2TA 3GTJB 1D2BA 4K2KA 5FKAC 4IN3A 3TBIB 1WTVA 5JVG3 2F3VA 2E2JB 2EYFA 1S5CD 2CHBD 2R7ZB 1UEAB 4C2MB 4ODGA 1RODA 4RCOA 3FVQA 3I70A 2B2WA 5FO8B 5D65A 4HAEA 3Q6SA 4F7XA 4DGZA 4BBRB 2DY8A 1QG7A 3EQLC 1B44D 4LJZC 4MN3A 1JC7A 2I46A 1EWHA 2F0EA 1E2ZA 5KYLA 1QILA 1B4OA 1LT5D 3KLRA 1U4MA 2F0WA 5M3MB 4KD3A 3PUWA 2F0SA 3SXHA 5IODA 4FO2A 4FF4A 4HSVA 2AWNA 3JAME 1X32A 3K5LA 4S3SA 1UUPA 2K1BA 3NTHA 5JEAJ 1F9RA 1IHZA 4DFAA 2PW7A 1QNUA 1Q1EA 3S17B 1EEFD 1ZYRC 3C3LA 3NWSA 3OSOA 2H1EA 1YNJD 2IJ0A 1PYWD 3GP7A 3ONAB 3M4OB 2B2VA 1SJED 1U9RA 3V2TA 1J9OA 1SDFA 4NKLA 4CKEA 2MUYA 1PFMA 3QOLA 4HTHA 1D5XC 2F0LA 3GTLB 1Z6HA 5C0XJ 3VYSA 5CBAE 2J4XA 1O7YA 2QCPX 1A6XA 2Z4HA 1BUVT 4B08A 4CBVA 1V43A 4QUCA 3NBHA 4IUPA 4MHEA 3A55A 2R6GA 1Q8IA 1F9SA 1ZKOA 2I07B 1IYUA 1A3TA 3IL8A 4HR7B 1JB3A 5E1FA 2B2TA 2A69C 4DNRB 3A7AB 3MHBA 3BYYB 1S5ED 1K8OA 1L0YB 1S4ZA 5FO9B 2O5IC 1SNPA 5BN3A 3CHBD 3MFYA 5K5PA 5KNBA 1C8CA 4XQQA 2B8FA 1D1KA 5BN5A 1EYAA 1G291 3LX0A 5I9PA 4DK0A 5K36H 2NTSA 3IFDA 2KQ3A 1KABA 1EYCA 5F2DA 1U4LA 1LTBD 5CV6A 4XXEA 2F0DA 2V4DA 1PTOC 4HEDA 4A3FB 2NN6H 1DZ1A 2QF7A 2YU9B 3K5MA 4A3KB 3GTMB 3NPPA 1HA5A 1LO5D 3CRLC 4FXDA 1F2LA 4LAAA 3T16A 2FFKB 2F0UA 1HFNA 4KI0A 5DM63 3KK7A 2N88A 1BO0A 3J7YW 4RGOS 3HG9A 3L3OC 2RKSA 2CQAA 1LTAD 2IT1A 1RCVD 3GTQB 1STNA 1SE4A 2IX0A 2NVYB 5EJWA 3FMCA 1F9QA 2PO4A 2PCFB 2ENBA 3X3MA 2EE1A 5LHY1 1HHVA 2KHSA 1IKLA 2EYOA 4DAYA 1V1OA 4RKLA 2JXMB 2N55A 1HFGA 3VYTA 5I4DA 4XDXA 5T1GA 2SNMA 2TMPA 4TSSA 1Z7TA 5NUCA 1CQVA 1QE6A 3BDCA 4TRDA 2BDNA 1G2SA 3V05A 1SE2A 2IW3A 3P20A 5LL6S 2IX1A 4KV6A 1WD0A 1TS3A 2Z1CA 1W6JA 1MBYA 2HDMA 4ABNA 1H9MA 1M8AA 2F1MA 2DNEA 2BCOA 2A6EC 2EZVA 2L9HA 2R61A 3J80E 3K59A 2JA6B 4A3JB 4G4KA 2PPBC 1EQVA 4KTAA 1EIHA 2FJ2A 2X6LA 1PTOH 1R4QB 3D6CA 1ENCA 1H9JA 2NTTA 1XYIA 4RHRA 2Q8TA 2OXPA 2X69A 2L12A 2ICIA 4ILWA 3J81E 2AQ1B 4WORA 1BCPC 3PMFA 3PO3B 4K2LA 1PRTF 3CQZB 4WFN3 2DNCA 1SNOA 4KY7A 1F9PA 4BY1B 1SJHD 1PTOD 5KRUA 1AW7A 4C1NK 4DXFA 1EY7A 1EZ8A 4QF4A 1PMRA 1ENAA 1LABA 2AWOA 5CV7A 4UDUC 3BYTB 1PXUA 4ZUIA 5D14A 5JEAH 2XRSD 3S1MB 1QWYA 1I4QA 2HCIA 1STEA 1BNZA 4O1NA 3J80L 1JCKB 1STAA 4TKOB 1FYCA 1ET9A 1EOTA 2QKIC 5A2QE 3D8GA 2RBMA 1CQFA 3I4LA 3KBXA 1TKWB 3T56B 3SK5A 1QCBD 5KGUA 5JOBA 2IWHA 1CM9A 2B63B 5C0XH 2D5DA 4C3HB 4PMWA 2QDBA 3K5OA 1X3PA 2QEJC 3J7AF 1M4VA 4JBWA 3VR4A 3IKJA 4C3IB 3TDQA 3MTSA 2HDLA 3D6WA 2K04A 5ELBA 3SDZA 5ELFA 1MSGA 4IURA 5CYUA 5CV4A 1LTSD 3UI2A 4O42A 4OHJA 4KMUC 2K28A 3P1HA 2R92B 2BDOA 1TS2A 4K5VA 1O7ZA 4V0BA 1ENFA 4OIJA 1A3VA 2NUCA 1VF7A 4H0LC 1VDZA 2A73B 2K05A 1GHKA 1YNJC 4BA2I 4DA2A 4DXGA 4XQNA 5BN4A 3MVVA 1PDQA 5M9OA 4QCLA 4I65A 5JPMC 1BDOA 2IPKD 4DAVA 1RTOA 5COYA 4R8IA 3PIP3 5M5YB 2E75C 4U68A 1PZJD 2NVQB 3A8IE 4UAIA 2B2YA 3BZDB 4HCSA 3L9AX 4NP5A 4PMCA 2O4XA 3R2IA 1RDPD 2FINB 4HMJA 1ILQA 5M3FB 1PFBA 4KHZA 4H13C 1AEXA 4ZLTF 1A2UA 4C1NI 1DOKA 3I4MB 1KLUD 3MXGA 4F87A 5C3XA 2EJMA 5D3IB 1CI3M 4A3EB 1IW7C 2JEAI 5HGTA 4FP5D 1I6HB 3HOZB 2E2IB 1OO9B 1G2TA 1LTRD 3TP5A 1B9MA 2RSNA 2XRQD 1K83B 2Q8RE 3NHHA 1VMCA 3KBGA 1X3QA 3QJYA 4J8QA 1HRJA 3VR3A 3RUZA 1H9RA 3TZUA 3S1QB 2WKCA 3KLSX 2VNUD 1PZKD 2XSCA 4N9PA 3ZYYX 2D9UA 2PZTA 2JEBI 1MI2A 1JWSD 1LT3D 2QILA 3OIPA 3AB9A 3NP8A 4X3UA 3VA5A 1W6KA 1EFID 3BVMA 5IGEA 4L63B 4FF2A 1T5EA 2K6AA 4C56C 3FPUB 5FK9C 1TWGB 3E0JA 2C9OA 1OXXK 2JP1A 4PMBA 2E76C 4ID6A 5ELEA 3VR6A 5M5XB 1I3QB 4LK1C 4CJ0B 2L1BA 2B2VC 3HRZC 5ELCA 2OEOA 4BBSB 4CKCA 4G7ZC 3TSSA 2ZXRA 1K8MA 1LACA 1IYVA 5EKKA 3GTKB 3P75A 4HCEA 5J22A 3LWEA 2EDGA 2FHTA 4CJ1B 3FRPB 2Q8IB 1VF5C 3WOFA 3HOUB 4G7OC 3CU7A 5K36G 1BCPB 5I9OA 3DWAA 3T13A 5JJZA 3BVGA 2OT2A 1NCVA 2FMMA 2KA7A 1HTLD 4IFDI 1NR4A 3TMEA 2ZT9C 1Y69U 5IGBA 4H7BA 1DD2A 2C5CA 3JAML 1GUOA 1Q12A 2NN6G 3MXNA 3IFTA 2KECA 1GHJA 1PFNA 1B53A 5EGTA 4DN4M 4KHVA 2M2LA 1GUNA 4RH6A 2G9DA 3C1EA 4PV1C 1IW7D 4RCNA 1RJTA 2JA8B 3OPOA 2A6HD 1I4GA 1KNAA 1DJRD 1RKNA 1JOOA 2B2UC 3W3AA 1GUWA 4B9WA 1BR9A 1D6EC 4ZK9B 5KNDA 1LT4D 3A7LA 1HXYD 4QMGA 1RHPA 1TS4A 3K7AB 4X3TA 2WKDA 4C3HG 5EBCA 2EJGC 1WD1A 2LFNA 1C4QA 1J8IA 1CHQD 3DEOA 1TWCB 4Q0FA 4C3IG 1RD9D 3TP6A 5EPLA 3R2TA 3C1FA 2HQEA 3SK4A 3VR2A 5IGCA 1H9SB 1OXUA 5CGKA 4CJ2C 3NTIA 1C48A 3S9WA 1CHPD 2F0NA 2RDFA 2EYJA 4IALA 3HP3A 3MFGA 3G7LA 1IL8A 1SYBA 2JA5B 2KEDA 3G6JB 1TT2A 5IT9E 1Y8PB 1D5MC 3FEWX 2X6GA 3GV3A 2EVBA 4IFDJ 2NWGA 2WINB 3H94A 1AFPA 3A8JE 2H4OA 4KJNA 3S1RB 3S15B 2EYMA 4OO1G 1AN8A 2B8GA 1O7LA 1KDCA 3AMUA 2VB2X 1YNND 3U9OA 5I2YA 5C3WA 1G8ZD 2A68C 3HOXB 1O80A 2EYHA 1WTOA 4CKBA 3Q22A 1A15A 4RAUC 2EYLA 1SYFA 4P2CB 3EJIA 1NR2A 1GUTA 1SE3A 1CFMA 1STHA 3DHQA 3OWFA 2M9VA 1EY0A 2DY7A 1FGBD 1HQRD 1PRTD 5EQ0A 3VYRA 2M00A 3I4NB 4ZKCB 1R9TB 4V190 3NBIA 3EROA 3HS0C 1QOHA 3QWNA 1FNVA 4KKTA 3ND8A 3TN2A 4RGTA 5JEAG 3QO2A 4C3JB 1JWUD 1JQYD 2EXZA 2F0HA 5I6YA 3PUVA 1SMYC 2WP8J 3A54A 1CA5A 3VYUA 1B50A 1ICWA 3OHXC 1XXGA 3LWUA 2KOLA 2F0MA 2RQXA 1ILPA 4K14A 2PW5A 2RDHA 3OIQA 1WTQA 2K5WA 3M4YA 2MP1A 2JSOA 3KLSA 1EIGA 5C0XG 1XTCD 2L4NA 3ND9A 3EA6A 1LLRD 3RD4A 1RTNA 4F88A 4ZUJA 2D2CC 4KJOA 1FR3A 3NSWA 4KY5A 3MC0B 1D1IA 4FNFA 4XTCS 5KYIA 4A3IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2U A;  5IOC A;  2EY1 A;  4YIJ A;  3V2T A;  5KIX A;  2EYP A;  4ID6 A;  4NKL A;  3U9O A;  4K5X A;  2F3V A;  3TP8 A;  5C3W A;  5CV5 A;  5J39 A;  3QOL A;  4HTH A;  5IGD A;  5IGF A;  1EY8 A;  4LAA A;  3T16 A;  2F0L A;  1SND A;  2EYH A;  5C3X A;  2EYF A;  2QDB A;  1SYC A;  4K8I A;  2F0U A;  3SK6 A;  1EY5 A;  2EYL A;  5DEH A;  3E5S A;  5JAV A;  1SYF A;  3EJI A;  4DU9 A;  1EQV A;  2F0V A;  4KTA A;  1JOK A;  2OEO A;  1SNM A;  3ITP A;  1STG A;  2SNS A;  1STH A;  5I9P A;  3DHQ A;  3OWF A;  1EYD A;  5HGT A;  2RKS A;  2PQE A;  3D6C A;  4ODG A;  1ENC A;  5DAU A;  3TP6 A;  5C6A A;  3NXW A;  1NUC A;  5I6W A;  1EY0 A;  2EY5 A;  2OXP A;  3C1F A;  2HQE A;  5EKK A;  3SK4 A;  1STN A;  2OF1 A;  2PZW A;  3HEJ A;  3P75 A;  5CV4 A;  3OMC A;  4RKB A;  2F0K A;  2M00 A;  4F7X A;  5C4Z A;  3R3O A;  4DGZ A;  3TP5 A;  5J22 A;  1JOR A;  5IGC A;  1A3U A;  1F2Z A;  3QOJ A;  4WOR A;  3ERO A;  3P1H A;  3MXP A;  3NUC A;  4G57 A;  4NMZ A;  1SYD A;  5CGK A;  1KDB A;  5EKL A;  1A3T A;  3PMF A;  4PNY A;  2EY2 A;  4K2L A;  5CV9 A;  3NHH A;  2WAC A;  4K5V A;  2ENB A;  5E1F A;  1A3V A;  5C5M A;  4K5W A;  1SNO A;  2F0O A;  4KY7 A;  5CR3 A;  3OMG A;  5I9O A;  5KYI A;  3MHB A;  2NUC A;  5J1Z A;  2EXZ A;  2F0H A;  4K8J A;  2KHS A;  5E3F A;  5I6Y A;  3S9W A;  1EY6 A;  1EY9 A;  3D4D A;  1SYE A;  3T13 A;  2F0N A;  2RDF A;  2EYO A;  3HZX A;  2F0E A;  5C5L A;  1F2Y A;  5CV8 A;  5KRU A;  3QB3 A;  4J1M A;  2EYJ A;  5IGG A;  1F2M A;  4IAL A;  5KYL A;  1KDA A;  3TP7 A;  5IIF A;  3RUZ A;  4RKL A;  4QB4 A;  2F0G A;  1KAA A;  3MVV A;  5CC4 A;  3TME A;  5HUR A;  1TQO A;  1SYB A;  3D4W A;  1EY7 A;  1EZ8 A;  1SNP A;  3NK9 A;  4QF4 A;  3SR1 A;  5M9O A;  2F0W A;  5IGB A;  4H7B A;  4KD3 A;  1ENA A;  1SNC A;  2F0S A;  3SXH A;  3NQT A;  5K5P A;  1STY A;  4I65 A;  5IOD A;  5CV7 A;  2SNM A;  2F0I A;  2LKV A;  2F3W A;  2PYK A;  3MZ5 A;  4N9P A;  4N9T A;  4B9X A;  1SYG A;  3H6M A;  1TT2 A;  1EYA A;  5NUC A;  4KY6 A;  4ZQ3 A;  3SHL A;  2F0Q A;  3LX0 A;  4S3S A;  4ZUI A;  2PZT A;  2F0M A;  4EVO A;  2EY6 A;  3BDC A;  5EGT A;  1NSN S;  2F0J A;  3SK8 A;  4E6I A;  4K14 A;  4TRD A;  4KHV A;  1TR5 A;  4F8M A;  1JOQ A;  2SOB A;  4IUN A;  2KQ3 A;  4EQP A;  4ME5 A;  2PW5 A;  4R8N A;  1KAB A;  5KGU A;  1EYC A;  1II3 A;  1EY4 A;  4MIU A;  5F2D A;  3MEH A;  2F0F A;  1IHZ A;  3C1E A;  4DFA A;  1STA A;  4EQO A;  4DF7 A;  5JOB A;  4OL7 A;  2PW7 A;  3ERQ A;  5KEE A;  3NP8 A;  2F0P A;  4KV6 A;  5CV6 A;  4KD4 A;  3VA5 A;  3BDL A;  4K6D A;  3D8G A;  4J6H A;  4NP5 A;  2RBM A;  3OSO A;  2F0T A;  2PZU A;  4IZ8 A;  4ZUJ A;  5IGE A;  4PMC A;  2O4X A;  2F0D A;  3EVQ A;  1SNQ A;  4KJN A;  1STB A;  1RKN A;  1JOO A;  2EYM A;  4HMJ A;  4KJO A;  1A2T A;  4NDX A;  5C4H A;  4EQN A;  4K2K A;  4B9W A;  4KY5 A;  3SK5 A;  1EZ6 A;  1U9R A;  4QMG A;  3DMU A;  4HMI A;  1AEX A;  1KDC A;  5ISR A;  4PMB A;  4WRD A; 
#chains in the Genus database with same CATH topology
 2KCT A;  1B3A A;  3M85 A;  2EY1 A;  4YIJ A;  1WTR A;  3HOY H;  1HQM C;  5EPK A;  2E2J H;  3IRB A;  1XWE A;  2RA4 A;  4DR6 L;  4A93 B;  2K32 A;  2ALY B;  3MWY W;  3OW7 A;  2K33 A;  2R93 B;  1ZEQ X;  1SYC A;  3PUX A;  3AFQ A;  3E5S A;  5JAV A;  2Z8L A;  1G6P A;  3DXJ C;  1XMO Q;  3Q24 A;  3RMH A;  4J15 A;  1HUN A;  1SEB D;  1S3O A;  5G3L F;  2K7V A;  1NUC A;  1XNQ L;  3D31 A;  3GTO H;  5E4W C;  1WOC A;  3K5N A;  3SVM A;  3J81 L;  3OOC A;  4RGN A;  3GTP H;  4FDB A;  1ASZ A;  2ICE C;  1RF2 D;  5E4X A;  5IY0 A;  4MZ9 A;  4BBR H;  3RZO H;  1MGS A;  3MXP A;  4FF3 A;  3HOU G;  4PNY A;  1IZ6 A;  1Y1V B;  1FL0 A;  3DWQ A;  3V96 A;  1E24 A;  3J80 c;  1I4R A;  3CPF A;  3D4D A;  4HIK A;  3KYH C;  4IUQ A;  2RDG A;  3DM1 A;  4Y7N B;  2UUB Q;  1F2M A;  3GD7 A;  1B9N A;  1WCM B;  1DXM A;  3U50 C;  2NB0 A;  1KAA A;  5CC4 A;  1D5Z C;  3SR1 A;  4AYB B;  2NYZ D;  3T4A C;  4GN5 A;  4X65 L;  4RFB A;  1G6Z A;  2VUM H;  2UXC L;  5C4J B;  1VMP A;  2XWJ B;  2O2L D;  3GTG B;  3BS1 A;  2PMZ B;  2A68 D;  1NSN S;  4DR2 L;  5T1I A;  1EQR A;  3J81 c;  4CHT B;  1HR0 Q;  1YZ6 A;  2CW0 D;  1K0S A;  5FLX E;  4GNX B;  4OO1 I;  4JI4 L;  2BA0 A;  2MJ8 A;  5COR A;  1X65 A;  4IPH A;  4EQO A;  2JA8 G;  5A2Q L;  3S2H B;  5FOB B;  1HNX Q;  1Y8O B;  4FYD A;  2F3I A;  3CCE A;  1H9S A;  1RIP A;  1Z47 A;  1XJV A;  1J5E Q;  4R9W A;  2PZU A;  2GA4 B;  3CPW A;  1I4X A;  1ESR A;  2EPB A;  1SFO H;  1IKM A;  2ID0 A;  3DUZ A;  4A3B H;  2NVT B;  4DK1 A;  4HMI A;  2Q2H A;  4JI0 Q;  3PV0 A;  4WRD A;  2VQE Q;  4PQX A;  4JOI A;  3U4V A;  5IP9 H;  5KIX A;  4LMQ D;  2VY3 A;  4JC0 A;  4NB3 A;  1OTC A;  1EY8 A;  3GTL H;  1SND A;  2CFM A;  2KJX A;  1EY5 A;  1DCZ A;  4EQ5 A;  1SMY D;  3A56 A;  2N49 A;  1PH5 A;  2F0V A;  2L55 A;  1JOK A;  1TWF H;  2SNS A;  1LTI D;  1HR0 W;  3F2U A;  2NVX H;  1K8G A;  1PTO B;  1EQT A;  3CAM A;  4JI8 L;  4KN4 C;  4L5T A;  4KKS A;  3HEJ A;  2PZW A;  1MD2 D;  1V1Q A;  5C4Z A;  2F0K A;  1TVX A;  2XGT A;  1BOS A;  3QOJ A;  3WOE A;  3CMA A;  1SYD A;  3HGB A;  3KF6 B;  5EKL A;  3P7J A;  2YTX A;  5FJ8 G;  1JE4 A;  4LFB L;  3PO2 B;  1G91 A;  3S16 H;  1GUG A;  2JE6 I;  1TWA H;  2A6H C;  5FLX L;  3K6O A;  5E3F A;  3T1Y Q;  2RCF A;  1EY6 A;  1SYE A;  3AEV A;  3I90 A;  5IGG A;  1BQQ T;  4AQY Q;  3FDT A;  1QJO A;  2MFI A;  2KVM A;  1P16 A;  2F0G A;  2K5Q A;  3VA7 A;  2JA5 G;  2EJF C;  4M1U B;  1AP0 A;  1AZQ A;  3N52 A;  1X3G A;  1U4P A;  3NK9 A;  4B3T Q;  3H0G B;  5CBE E;  1STY A;  3DWP A;  1E0B A;  1I4H A;  2B29 A;  3MZ5 A;  1SYG A;  2XN9 C;  2L11 A;  4E6I A;  1A62 A;  2B2W C;  4F8M A;  1NE3 A;  2JA9 A;  1LUZ A;  4ME5 A;  4R8N A;  4EQP A;  3CME A;  1XMO L;  4IFD H;  3D4R A;  1QVC A;  1EY4 A;  1UNS A;  1PV4 A;  3HOY B;  3E6Z X;  1V8Q A;  1VQL A;  1LTG D;  4NXM L;  3Q0A A;  1YBY A;  3T51 B;  5GAD C;  4IJH A;  1Y1W H;  3G4S A;  2VS1 A;  1BCP F;  2CQO A;  3S2D H;  4RMF A;  4JVZ A;  2BE5 D;  2ZM6 Q;  1E2W A;  5C4H A;  1VQB A;  3CXC A;  3IAY A;  4ZAI A;  2YU9 H;  3KUP A;  1KNE A;  4A3K H;  4DR3 Q;  4KK7 A;  3STB C;  5C4X H;  3CCV A;  1QZH A;  1CT1 D;  3FKI H;  5IOC A;  3CC2 A;  3NTK A;  3GTO B;  1D8L A;  5C44 G;  1BBW A;  4FF1 A;  2XIW A;  4UY8 C;  3HOX G;  3GTP B;  3NWT A;  4YWM A;  2UUB L;  4GZY C;  3RZO B;  1WTP A;  4XT1 B;  4DUZ Q;  2R3Z A;  5GAE C;  3ICE A;  5TSS A;  1EWI A;  1HA6 A;  3GDE A;  1CKN B;  4Q5V A;  5C6A A;  2MPM A;  4IQZ A;  1JJ2 A;  2PNR C;  3I8Z A;  3PSI A;  4JYA Q;  1I6V C;  1HR0 L;  2Q2U A;  3OMC A;  3NQI A;  3R3O A;  3HKZ B;  1F2Z A;  3AYH B;  4JBJ A;  3ZJY C;  3KF8 B;  3CP0 A;  3WWV A;  1HNX L;  2VUM B;  1FNW A;  3VR5 A;  1J5E L;  5EBD A;  2AKW B;  4C3J G;  2JA7 H;  5CR3 A;  4K8J A;  2O5J C;  1F77 A;  3HOV H;  4GN3 B;  2E2D C;  2XNA C;  4WJ4 A;  2VQE L;  1QNK A;  4QL5 A;  3JAM i;  1SNC A;  1HZC A;  1PH7 A;  2VXW A;  1FD7 D;  4FXG C;  1YNN C;  1OXS C;  4XYQ A;  1SFO B;  5IE8 A;  3R8B A;  4ZQ3 A;  1N34 Q;  4A3B B;  1I4P A;  2F0J A;  1WTX A;  1ONL A;  4A3D H;  1TR5 A;  1JOQ A;  1ML0 D;  4RGM A;  1A0I A;  1K73 C;  1GJX A;  1JWM D;  1II3 A;  3PIP A;  1FGU A;  1MKH A;  2XVS A;  3S1N B;  2WII B;  2E2H H;  2F0P A;  5DM7 3;  4RWS C;  2B39 A;  3CCU A;  2B2T C;  3PCO B;  2HCC A;  1VQ5 A;  1EWC A;  4IUU A;  3GV6 A;  5CMD A;  3H91 A;  3W1B A;  1PRT C;  4EQN A;  1TWF B;  5IYC H;  4TQU S;  3E9I A;  1DON A;  2NVX B;  1H95 A;  4A3I G;  4BA1 I;  2F03 A;  1VQD A;  2A5H A;  3TP7 A;  1D7Q A;  3LNN A;  3HKZ E;  2UUA Q;  2ES2 A;  4P74 A;  3AU7 A;  1AZP A;  1GOZ A;  3TP8 A;  3A0J A;  3T1Y L;  3DEP A;  3E0E A;  4A93 G;  5JVH 3;  3BZK A;  4HJ7 A;  2JA6 H;  5IGD A;  5IGF A;  2R93 G;  2A74 C;  4NW2 A;  4AQY L;  4K6L A;  1EU4 A;  4B3T L;  1E2V A;  3D3R A;  3S16 B;  4I7Z C;  1QB5 D;  1TWA B;  1PYS B;  1QZG A;  2FMC A;  5I6W A;  4GNX A;  1E1O A;  2BOS A;  1TY0 A;  1B2T A;  2JQO A;  4KN7 C;  2P5Z X;  4FVM A;  4RKB A;  2BA1 A;  1JOR A;  1X6O A;  2NZO A;  3PUZ A;  2K5D A;  2TSS A;  1Y1V G;  4NMZ A;  1LTT D;  1BXT A;  2DN8 A;  1NY4 A;  3CQZ H;  2HD3 A;  5DLQ E;  3CCM A;  1RL2 A;  1Q90 A;  5C5M A;  2N3S A;  1I50 H;  4AH6 A;  4KKU A;  2B2U A;  1VQ7 A;  4ULL A;  2KUM A;  2ZM6 L;  5JJI A;  4BY1 H;  3C2P A;  1TU2 B;  3H3V C;  3HZX A;  2LS0 1;  2HUG A;  5CV8 A;  3QB3 A;  5IYB H;  4AYB G;  4DR3 L;  1CUK A;  2MNA A;  4IUT A;  1Y1W B;  3N6R A;  2CVR A;  3BG3 A;  3STB D;  3A5Z B;  3S2D B;  2HQL A;  4N9T A;  1UAP A;  1VQJ A;  4KY6 A;  3SHL A;  2F0Q A;  4O2D A;  4DUZ L;  4DV2 L;  2VB3 X;  1EU3 A;  1PZI D;  2G9H D;  4RA8 A;  3R93 A;  3ULL A;  1JR0 D;  3S1M H;  4GKJ Q;  1GD7 A;  1UWV A;  2J0T D;  5ELD A;  1HCZ A;  5C4X B;  3ULJ A;  3FKI B;  1S72 A;  4MIU A;  5L37 A;  1GVP A;  1CA6 A;  3J7Z C;  3S14 H;  2K03 A;  5KEE A;  4JYA L;  1V1P B;  4K6D A;  2KCM A;  1VQM A;  3KF6 A;  3J7A V;  1SNQ A;  2K5V A;  3I72 A;  2LMC B;  4NDX A;  3DMU A;  2E5L Q;  4FXK C;  3VDY A;  2R7D A;  2K52 A;  2JYO A;  1EIF A;  3L0O A;  1GUS A;  2YTV A;  1DOL A;  1AE3 A;  1S5B D;  2IY5 B;  5CV5 A;  2QEX A;  2WV6 D;  1SAP A;  3SK6 A;  3CCJ A;  5DEH A;  1FJG Q;  1SSO A;  3M3Y H;  1V9P A;  4PG3 A;  1VQO A;  3AFP A;  5LL6 X;  2AQ2 B;  2JA7 B;  2CWP A;  1ZYR D;  3CC7 A;  4DUY Q;  3NE5 B;  2RF4 A;  1HZ9 A;  4GS3 A;  1K0R A;  2OF1 A;  3HOV B;  3I3C A;  4A3L H;  5C44 B;  2ZXP A;  1ZXT A;  1BVS A;  4P73 A;  1A3U A;  3QG1 A;  2ZJQ A;  4Z9C B;  3NUC A;  2CW0 C;  4G57 A;  4G7H C;  2WAQ G;  2B3G A;  3K0Y A;  3M7G A;  3GO5 A;  2EY2 A;  1JIC A;  2WAC A;  3PO2 G;  1VQ6 A;  1KXL A;  4JCV E;  1Q46 A;  1TS5 A;  5D3D A;  2F0O A;  5ELO A;  5KNC A;  5J1Z A;  1BBX C;  4A3D B;  3UE1 A;  4OWW B;  2YYZ A;  1PH3 A;  1SR3 A;  1CKM A;  2BH2 A;  3HOW H;  5C5L A;  3WDN A;  3G6E A;  1KDA A;  1OXT A;  1O7I A;  4OWX B;  5IIF A;  2MO0 A;  4IUV A;  4QB4 A;  2E2H B;  2L5T A;  2Z9H A;  2IX3 A;  3C46 A;  2UUA L;  1KHI A;  3H0G G;  3FHW A;  2IL8 A;  5FO7 B;  4H02 A;  3RZD H;  1N9W A;  3FPP A;  4BY7 H;  2WB1 B;  1PH6 A;  2RSO A;  4DK6 C;  2LKV A;  3J7A 5;  2L0C A;  2VZA A;  4B9X A;  2XWB B;  3H6M A;  5IT9 L;  1CTM A;  4DR7 Q;  4EVO A;  2EY6 A;  3SK8 A;  1CKN A;  1H9K A;  1X3F A;  1SE8 A;  1XPU A;  4OX9 L;  1X56 A;  2NN6 I;  3HOY G;  5J3B A;  4R4I A;  2EOT A;  1O78 A;  2KHJ A;  1MIU A;  2A69 D;  1SXT A;  4HIO A;  3MXU A;  3I91 A;  3F8T A;  4OL7 A;  5M5W H;  3H3V H;  1VQ8 A;  2AUJ D;  5GQO A;  2ZXO A;  3BDL A;  3KF8 A;  4JG2 A;  1VQH A;  2F0T A;  1HUM A;  1ET6 A;  4IZ8 A;  2RVL A;  2Q2T A;  2JN4 A;  1UEB A;  4LF8 Q;  1JJG A;  4JBK A;  3MA2 B;  4JI2 L;  4R4C A;  3RLF A;  4OO1 H;  1S5F D;  3X3N A;  1EZ6 A;  5C3E B;  4POF A;  3J80 i;  5ISR A;  4A3M H;  3U9S A;  4BS9 A;  5A35 A;  4YCV A;  1Q7Y C;  2EYP A;  2CCZ A;  1CZG A;  2BH8 A;  1PVO A;  4LFC Q;  5IT9 c;  4A3G H;  5I2X A;  5G3L D;  1HNZ Q;  4K8I A;  2D0O A;  5EKI A;  1DYQ A;  1TII D;  3GQB A;  4HN7 A;  4WJW A;  2HIX A;  3CRK C;  1LV9 A;  3GTJ H;  4GOP C;  1VQN A;  3KFU A;  3QIA A;  4JK1 C;  4DKA C;  1X54 A;  1I50 B;  4KHP Q;  1SBB B;  2PQE A;  2SDF A;  2QA4 A;  2VL6 A;  3J81 i;  4DAP A;  3HOZ H;  3OTO Q;  5LMN Q;  3SE0 A;  4ZKB B;  3TZD A;  4JI6 Q;  2WB1 E;  2Y0S B;  3O13 A;  4ZYS A;  4LF4 Q;  4L6T B;  4X3K A;  3HKZ G;  4EGV A;  1DM0 B;  1K83 H;  1YHA A;  2VUM G;  2R7Z H;  5CV9 A;  3A8K E;  4L8J A;  1XTD A;  4MTN A;  3BZC A;  4XYO A;  4C2M H;  1TY2 A;  1L1O C;  1HTP A;  4YWL A;  1EY9 A;  4JI3 Q;  4UP8 A;  1F2Y A;  2E5L L;  2BE5 C;  4DV6 Q;  4OEL B;  3S14 B;  3D4W A;  2E74 C;  5EPJ A;  1FNU A;  3L7Z C;  1YNX A;  2PYK A;  1PTO F;  1HPC A;  4A3B G;  3QR8 A;  2Z4I A;  4BXX H;  3M7N A;  1L0X B;  2MGS A;  5LMN W;  5IP9 G;  3Q23 A;  1OXV A;  2LY7 A;  3MAQ A;  1ESF A;  2RHS B;  3PIO 3;  3MEH A;  2F4V Q;  2EQS A;  3I4O A;  4XIG S;  3W2D A;  4DF7 A;  3PUY A;  3ERQ A;  3NBH B;  1DOM A;  1JE5 A;  5DNF A;  5IWA Q;  3EFX D;  4KD4 A;  5BR8 Q;  5M3M H;  4R4O A;  4QUF A;  2J7Z A;  3M3Y B;  1BF4 A;  1I94 Q;  2Y0S E;  1TWH B;  1YHQ A;  1WTW A;  1PRT B;  4CDE C;  1PHJ A;  3URY A;  2SEB D;  2D62 A;  3H09 A;  4K5X A;  2NBF A;  5J39 A;  3S17 H;  4XT3 B;  4OIK A;  4OGQ C;  4DAM A;  1WVL A;  1VQE A;  4U67 3;  4AIM A;  4DV1 Q;  1S5D D;  1PLF A;  4DU9 A;  4BBS H;  1U4R A;  1VCI A;  1SNM A;  3EBE A;  3ITP A;  1STG A;  3M4O H;  1PH8 A;  1GXD C;  1KRT A;  3BVZ A;  2F4I A;  5EAY A;  1EYD A;  2RHQ B;  5DAU A;  3NXW A;  1KLG D;  2OQK A;  2AQ3 B;  4DR7 L;  2B2Y C;  2EY5 A;  3HOW B;  4HSP A;  4XQJ A;  1Q3L A;  4BWG B;  1VQP A;  3S24 A;  1V1P A;  2KCN A;  4ZRZ A;  1MHW C;  3I73 A;  3RZD B;  1IXR A;  2A6E D;  4RHS A;  4BY7 B;  1KDB A;  1R4P B;  2NZ1 D;  1CZW A;  1XPR A;  1Q8K A;  4JV5 Q;  2KEE A;  4K5W A;  4CGY B;  3MEF A;  1XX8 A;  3OMG A;  4H44 C;  4IFD G;  4LF8 L;  3KDF B;  3CKI B;  1MSH A;  4AYB E;  1WYD A;  2E8G A;  4B3M Q;  4J1M A;  5HUR A;  5M5W B;  1T5X D;  1TQO A;  1HNW Q;  1Y1W G;  1QVG A;  5ELN A;  1EL0 A;  1LT6 D;  5JPN C;  2UU9 Q;  2PMZ E;  1B1Z A;  1Y8N B;  3NQT A;  2K01 A;  3KOJ A;  1UE7 A;  4LFC L;  2F0I A;  2F3W A;  2OTJ A;  2MHV A;  2WAQ B;  1B3Q A;  1NAP A;  1KTK A;  2QW7 A;  3K58 A;  4DNT B;  1Q1B A;  4A4I A;  4A3K G;  3LGJ A;  1CK1 A;  2I5L X;  2SOB A;  4IUN A;  3FKI G;  3K57 A;  4A3M B;  5C4X G;  1BCP D;  5AFW A;  4X3S A;  4B3R Q;  2F0F A;  4KHP L;  2AUK A;  2KCC A;  3BDO A;  5LMN L;  3OWE B;  3T53 B;  3SEB A;  3BJU A;  4A3G B;  4M8A A;  4JI6 L;  4J6H A;  2G5D A;  4QIW B;  4LF4 L;  5C0X I;  3EVQ A;  1STB A;  1EEI D;  1A2T A;  3GTJ B;  1D2B A;  4K2K A;  5FKA C;  4IN3 A;  3I2Z A;  3TBI B;  3KJO A;  1WTV A;  3A5U A;  5JVG 3;  1W2B A;  4DAY B;  2F3V A;  2VQF Q;  2ZTD A;  2E2J B;  4JI3 L;  1XMQ Q;  2EYF A;  1S5C D;  4LUV A;  4HIM A;  3I56 A;  1FVI A;  2CHB D;  4DV6 L;  3F1Z A;  2R7Z B;  5FLX c;  1M1K C;  4A3F H;  1UEA B;  2JA7 G;  4C2M B;  1NNX A;  4ODG A;  1E22 A;  1ROD A;  1N32 Q;  4RCO A;  3DM3 A;  3GTM H;  3FVQ A;  3I70 A;  3HOV G;  2B2W A;  4IPC A;  5FO8 B;  4PZ8 A;  5D65 A;  4LF6 Q;  4HAE A;  3Q6S A;  4F7X A;  4A76 A;  4DGZ A;  2WAQ E;  4DV7 Q;  2KBN A;  4DV5 Q;  2F4V L;  1SMX A;  4LFA Q;  4BBR B;  2DY8 A;  1QG7 A;  3EQL C;  2NZH A;  1B44 D;  4LJZ C;  5BR8 L;  2GN5 A;  4A3D G;  4MN3 A;  1JC7 A;  1I94 L;  1UE6 A;  1VQG A;  2I46 A;  4UP7 A;  1EWH A;  1KAW A;  3GTQ H;  2F0E A;  5IYD H;  1E2Z A;  5KYL A;  1QIL A;  1B4O A;  1JT8 A;  3PIO A;  4HJ8 A;  2K5N A;  1LT5 D;  1IYJ B;  3KLR A;  2WB1 G;  1U4M A;  2F0W A;  2NVY H;  4KD3 A;  3U4Z A;  3PUW A;  5M3M B;  2F0S A;  3SXH A;  5IOD A;  4FO2 A;  4FF4 A;  4HSV A;  2AWN A;  5IYC G;  3JAM E;  3RLO A;  1X32 A;  3K5L A;  4JW0 A;  4S3S A;  4POG A;  1UUP A;  2K1B A;  1N36 Q;  4DNI A;  3NTH A;  1PH4 A;  1WJJ A;  5JEA J;  2EXD A;  1F9R A;  1IHZ A;  4DFA A;  2JA6 G;  2PW7 A;  1Q81 C;  4JI0 L;  2CKZ B;  1QNU A;  1Q1E A;  3S17 B;  1EEF D;  1ZYR C;  3C3L A;  3NWS A;  1C7Y A;  2OCE A;  3OSO A;  2H1E A;  1YNJ D;  1CKO A;  2IJ0 A;  1PYW D;  3CCL A;  3GP7 A;  3ONA B;  3M4O B;  1SLJ A;  2B2V A;  5C3E G;  1SJE D;  1U9R A;  4LNQ A;  4X6A H;  2K14 A;  1YJN A;  4GKK Q;  4JV5 L;  3V2T A;  1J9O A;  1SDF A;  4NKL A;  4CKE A;  2MUY A;  4JI1 Q;  1PFM A;  3QOL A;  4HTH A;  1D5X C;  5GAG C;  2F0L A;  3GTL B;  4B3M L;  1Z6H A;  5C0X J;  3VYS A;  5CBA E;  1G51 A;  2J4X A;  1O7Y A;  1HNW L;  2GVA A;  2QCP X;  2UU9 L;  1A6X A;  1VS0 A;  1BUV T;  2Z4H A;  3CF5 A;  4GOP B;  1PH2 A;  1NJI C;  2Y0S G;  4UPA A;  5IYB G;  4B08 A;  4CBV A;  1P8L A;  1V43 A;  1UE5 A;  4LF7 Q;  1NTG A;  3NBH A;  4QUC A;  3I4N H;  1KL9 A;  4ZCK A;  4IUP A;  3RR5 A;  4B3R L;  4MHE A;  3A55 A;  4LW1 A;  2R6G A;  4A3J H;  1Q8I A;  1F9S A;  1U5K A;  1ZKO A;  2I07 B;  1IYU A;  1A3T A;  3IL8 A;  4HR7 B;  1JB3 A;  3K0X A;  5E1F A;  2B2T A;  2A69 C;  4DNR B;  2JJQ A;  3A7A B;  3MHB A;  3AQQ A;  3ULP A;  3BYY B;  1JMC A;  2IHF A;  1L1O B;  1S5E D;  1K8O A;  1L0Y B;  1EUJ A;  2K4K A;  1S4Z A;  5FO9 B;  2O5I C;  1SNP A;  4DV3 Q;  5BN3 A;  1JJC B;  3CHB D;  3MFY A;  2VQF L;  5K5P A;  5KNB A;  1C8C A;  4XQQ A;  4JI7 Q;  3PO3 H;  2B8F A;  3F2D A;  3BU2 A;  1D1K A;  1EFW A;  5BN5 A;  1EYA A;  1G29 1;  3LX0 A;  5I9P A;  4X66 Q;  4DK0 A;  4N8X 1;  5K36 H;  2NTS A;  3IFD A;  2KQ3 A;  3G71 A;  1KAB A;  1EYC A;  2EIF A;  3HKS A;  5F2D A;  2D0P A;  4B3S Q;  1XPO A;  2ASB A;  1U4L A;  1LTB D;  1N32 L;  5CV6 A;  4YWK A;  2ZTC A;  4XXE A;  2F0D A;  2V4D A;  1LM0 A;  1PTO C;  4HED A;  4DV7 L;  2OTL A;  3TQY A;  4DV5 L;  4A3F B;  4LFA L;  2NN6 H;  1DZ1 A;  2QF7 A;  1T9H A;  2YU9 B;  3KDF A;  4A3I H;  3K5M A;  4A3K B;  2IHE A;  2ZJR A;  3GTM B;  3NPP A;  1HA5 A;  2V1C C;  1LO5 D;  4A3L G;  3CRL C;  4DR5 Q;  4FXD A;  1F2L A;  4LAA A;  4OEM B;  3T16 A;  2FFK B;  1M90 C;  2F0U A;  1HFN A;  4KI0 A;  5DM6 3;  3KK7 A;  2N88 A;  2KHI A;  1U0L A;  1BO0 A;  3J7Y W;  4Y52 H;  4RGO S;  4CDD C;  3HG9 A;  1VQK A;  3L3O C;  2RKS A;  1A63 A;  2A1A A;  2CQA A;  3HOW G;  1LTA D;  2IT1 A;  1RCV D;  3GTQ B;  4EX5 A;  1N36 L;  1STN A;  2B63 H;  1SE4 A;  4C3H H;  4BY7 G;  3EN2 A;  2IX0 A;  2NVY B;  4DPG A;  5EJW A;  3FMC A;  4WJ3 M;  1EQQ A;  1F9Q A;  2PO4 A;  2PCF B;  2YTY A;  2ENB A;  4LF5 Q;  3X3M A;  4C3I H;  2EE1 A;  5LHY 1;  1HHV A;  2KHS A;  1IKL A;  2EYO A;  4DAY A;  1N34 L;  1WCM H;  1B70 B;  1V1O A;  4RKL A;  2R7F A;  4GKK L;  2JXM B;  2N55 A;  2I5H A;  1HFG A;  3UDG A;  1ICF B;  3VYT A;  5I4D A;  2R92 H;  4JI1 L;  1WI5 A;  4XDX A;  5T1G A;  2SNM A;  2Z6K C;  3E9H A;  2TMP A;  4TSS A;  5C4J H;  5FLM H;  1Z7T A;  5NUC A;  1CQV A;  1A8V A;  1QE6 A;  3BDC A;  3D0F A;  4JBM A;  4TRD A;  3DLL A;  4A3M G;  2BDN A;  4R4Q A;  1G2S A;  5E7N A;  3V05 A;  1SE2 A;  2IW3 A;  3P20 A;  1UE1 A;  5LL6 S;  3S2H H;  4GN4 B;  2IX1 A;  4A3G G;  2UXC Q;  4I7A A;  4KV6 A;  1WD0 A;  1TS3 A;  2Z1C A;  4LF7 L;  1W6J A;  1MBY A;  1K28 A;  2HDM A;  2NVT H;  4A3C H;  5H1S E;  4JI4 Q;  1H9M A;  1M8A A;  5HY6 A;  4ABN A;  2F1M A;  2DNE A;  3HOZ G;  2BCO A;  2A6E C;  5M5Y H;  2K75 A;  2EZV A;  2L9H A;  2R61 A;  4IJL A;  3J80 E;  1WFQ A;  1IBL Q;  2NVQ H;  1K3B C;  1CSQ A;  3K59 A;  2JA6 B;  2R7Z G;  1YHB A;  4A3J B;  1VQ9 A;  1Z9F A;  4G4K A;  2C35 B;  1HZA A;  2PPB C;  1EQV A;  4DV3 L;  4KTA A;  1EIH A;  2FJ2 A;  3CD6 A;  2X6L A;  5M3F H;  1PTO H;  4JI7 L;  4JI5 Q;  1R4Q B;  3D6C A;  2FXQ A;  1ENC A;  1KRS A;  1H9J A;  2NTT A;  1XYI A;  4RHR A;  2Q8T A;  3I7F A;  2Q2I A;  4X66 L;  3I55 A;  2OXP A;  2X69 A;  3I4M H;  2UUC Q;  2L12 A;  2ICI A;  4ILW A;  3J81 E;  2AQ1 B;  1GKH A;  4DR1 Q;  3PQI A;  2LXJ A;  4BBR G;  4WOR A;  4B3S L;  2K5H A;  1BCP C;  3PMF A;  3PO3 B;  4YHH Q;  4K2L A;  1PRT F;  3CQZ B;  4WFN 3;  4A3E H;  4BXX G;  2DNC A;  1SNO A;  1SRU A;  4KY7 A;  3UDF A;  5LMU Q;  1F9P A;  4BY1 B;  2VW9 A;  1SJH D;  2E2I H;  1I6H H;  1PTO D;  5KRU A;  1AW7 A;  4MNO A;  4DR4 Q;  4C1N K;  4GKJ L;  4DXF A;  4L5R C;  1S40 A;  5M3M G;  1EY7 A;  1EZ8 A;  4QF4 A;  4LFB Q;  1PMR A;  1ENA A;  1LAB A;  1YJ9 A;  2AWO A;  5CV7 A;  1YIT A;  4UDU C;  3BYT B;  1PXU A;  4R4T A;  4ZUI A;  5D14 A;  5IP7 H;  5JEA H;  4GOP A;  2XRS D;  3S1M B;  1QWY A;  1I4Q A;  2HCI A;  1STE A;  4IOC A;  4O1N A;  3J80 L;  1BNZ A;  1JCK B;  1STA A;  4TKO B;  3CCQ A;  1FYC A;  4QY7 A;  1ET9 A;  3S1Q H;  1EOT A;  1PYB A;  2QKI C;  5A2Q E;  4HJ9 A;  3D8G A;  2RBM A;  1CQF A;  3I4L A;  3KBX A;  4BBS G;  2L15 A;  3PGZ A;  4NPS A;  4X64 Q;  1TKW B;  3T56 B;  1FJG L;  3SK5 A;  2DUD A;  1QCB D;  1K9M C;  5KGU A;  4NXM Q;  4LF5 L;  1BKB A;  5JOB A;  4QQB X;  2IWH A;  1L1O A;  5HGQ A;  1CM9 A;  2B63 B;  4DUY L;  4OXP A;  5C0X H;  2D5D A;  4C3H B;  4PMW A;  3J81 j;  2QDB A;  2Z0S A;  3K5O A;  3T1H Q;  1X3P A;  2QEJ C;  3J7A F;  1M4V A;  4JBW A;  3MXN B;  3VR4 A;  1TWG H;  1VQA A;  3IKJ A;  4C3I B;  3TDQ A;  3MTS A;  2HDL A;  3D6W A;  2K04 A;  5ELB A;  3SDZ A;  2ATW A;  5ELF A;  1MSG A;  4IUR A;  5CYU A;  1DGS A;  3EIV A;  5M5X H;  3TEH B;  3UDX A;  5CV4 A;  1I3Q H;  1LTS D;  5JJL A;  3UI2 A;  4O42 A;  4OHJ A;  4KMU C;  2K28 A;  4HID A;  3P1H A;  2R92 B;  3H3V I;  2BDO A;  3M4Q A;  1TS2 A;  4K5V A;  1O7Z A;  4V0B A;  1ENF A;  4OIJ A;  1A3V A;  4JOI C;  2NUC A;  3F2B A;  1VF7 A;  4H0L C;  1VDZ A;  2A73 B;  2K05 A;  1GHK A;  1YNJ C;  4LWC A;  3GTK H;  4DA2 A;  1GO3 E;  4DXG A;  4XQN A;  4BA2 I;  5BN4 A;  3CCS A;  3MVV A;  1PDQ A;  5M9O A;  4GLV B;  1IBL L;  4QCL A;  4JPB W;  4I65 A;  1PA6 A;  5JPM C;  1BDO A;  2IPK D;  4LUO A;  3HOU H;  2XTI A;  4DAV A;  1RTO A;  5COY A;  4R8I A;  4TVA B;  3PIP 3;  5M5Y B;  2E75 C;  4U68 A;  3S1N H;  4JI5 L;  1PZJ D;  1VQF A;  2NVQ B;  3A8I E;  4UAI A;  2B2Y A;  1YJW A;  3BZD B;  4HCS A;  2UUC L;  2PQA B;  3L9A X;  4LUZ A;  4NP5 A;  3TRE A;  1X9N A;  4PMC A;  2O4X A;  4YCW A;  3R2I A;  1RDP D;  4A3F G;  2FIN B;  4HMJ A;  4DR1 L;  1HNZ L;  1ILQ A;  5M3F B;  1PFB A;  1JB7 A;  4KHZ A;  4H13 C;  4YHH L;  4UP9 A;  1AEX A;  4K0K Q;  4ZLT F;  1A2U A;  3NEN A;  4P72 A;  4C1N I;  1DOK A;  3ERS X;  1LTL A;  2AMC B;  3I4M B;  4GLX A;  1KLU D;  5LMU L;  3MXG A;  1ASY A;  4ME3 A;  2JA8 H;  4F87 A;  5C3X A;  3OTO L;  1IBK Q;  2EJM A;  5D3I B;  3RN5 A;  2HT1 A;  4DR4 L;  1CI3 M;  4A3E B;  1IW7 C;  2JEA I;  1MJC A;  5HGT A;  2YV5 A;  1K8A C;  2PI2 E;  1E7Z A;  5IYD G;  4FP5 D;  1I6H B;  3HOZ B;  2E2I B;  1OO9 B;  1G2T A;  3K7A H;  1LTR D;  3TP5 A;  1B9M A;  2CH4 W;  4HJA A;  2RSN A;  2XRQ D;  1K83 B;  3TS2 A;  2Q8R E;  3NHH A;  1TWC H;  1VMC A;  3KBG A;  4HJ5 A;  1PH9 A;  4LF9 Q;  4CDC C;  4YCU A;  1X3Q A;  4X64 L;  3QJY A;  2OWO A;  4J8Q A;  1HRJ A;  3VR3 A;  3RUZ A;  1H9R A;  3TZU A;  4QGU A;  3S1Q B;  1NBW A;  2WKC A;  3KLS X;  2VNU D;  4R1J A;  1PZK D;  2QDL A;  2XSC A;  4N9P A;  3ZYY X;  5IWA L;  2D9U A;  2PZT A;  5FJ8 H;  3B6Y A;  1WTH A;  3T1H L;  3NEM A;  2JEB I;  1MI2 A;  1JWS D;  1LT3 D;  2QIL A;  4QIW E;  1GM5 A;  2AHO B;  2UXD Q;  3OIP A;  3AB9 A;  3NP8 A;  4X3U A;  2JA5 H;  3CCR A;  3VA5 A;  1QUQ B;  1W6K A;  1EFI D;  2JK8 A;  3BVM A;  1Q86 C;  4DV2 Q;  5IGE A;  4L63 B;  4FF2 A;  1EIY B;  1T5E A;  2K6A A;  3HFZ B;  4C56 C;  3FPU B;  5FK9 C;  1TWG B;  3E0J A;  4DV1 L;  2C9O A;  1OXX K;  2JP1 A;  1XNR Q;  3NEL A;  4PMB A;  1B8A A;  2E76 C;  3M9B A;  4ID6 A;  5ELE A;  3VR6 A;  5M5X B;  3I4N G;  4IOA A;  1I3Q B;  4LK1 C;  4L5Q A;  4CJ0 B;  4A3J G;  2L1B A;  1L2F A;  1HZB A;  2B2V C;  3S1R H;  3HRZ C;  3S15 H;  5ELC A;  2OEO A;  4BBS B;  4MTK A;  4CKC A;  4G7Z C;  3TSS A;  2ZXR A;  1K8M A;  1LAC A;  1IYV A;  1N8R C;  5EKK A;  3GTK B;  1KD1 C;  3P75 A;  3K7U C;  4HCE A;  5J22 A;  5C44 H;  3KJP A;  2DGY A;  3HOX H;  3CW2 C;  1C9O A;  1IL2 A;  1MJE A;  3LWE A;  2EDG A;  2FHT A;  4CJ1 B;  3U58 A;  3FRP B;  3PO3 G;  2Q8I B;  4X62 Q;  3K8A A;  1KQS A;  1VF5 C;  1YVC A;  3WOF A;  3HOU B;  4G7O C;  3CU7 A;  5K36 G;  1BCP B;  5I9O A;  4NXN Q;  4BY1 G;  1Y14 B;  3DWA A;  3T13 A;  5JJZ A;  3BVG A;  1J6Q A;  2OT2 A;  3K80 C;  1NCV A;  2FMM A;  2KA7 A;  4IO9 A;  1VQC A;  1HTL D;  4DK3 C;  4K0K L;  4IFD I;  1NR4 A;  3TME A;  2ZT9 C;  3G48 A;  1Y69 U;  1R9T H;  1IBM Q;  5IGB A;  4H7B A;  2RCN A;  3A74 A;  3OYY A;  1DD2 A;  2C5C A;  4PZ7 A;  4APV A;  2KEN A;  1Q82 C;  3JAM L;  1IBK L;  1GUO A;  1Q12 A;  2NN6 G;  3MXN A;  4RG1 A;  4DV4 Q;  3IFT A;  2KEC A;  1GHJ A;  1PFN A;  1B53 A;  5EGT A;  4DN4 M;  4GNX C;  4C3J H;  4KHV A;  2M2L A;  1GUN A;  4RH6 A;  2N8N A;  2G9D A;  3C1E A;  2HHH Q;  4N8F A;  4PV1 C;  4P75 A;  4DV0 Q;  1IW7 D;  4RCN A;  2N78 A;  1RJT A;  3SGI A;  3OPO A;  2JA8 B;  2A6H D;  2MO1 A;  1I4G A;  4OON A;  1KNA A;  1YI2 A;  1DJR D;  4P71 A;  4UHV A;  1RKN A;  1JOO A;  2B2U C;  3W3A A;  1XMQ L;  4OX9 Q;  1GUW A;  2DJF C;  4B9W A;  1BR9 A;  1D6E C;  4ZK9 B;  5KND A;  5C3E H;  1LT4 D;  3A7L A;  1HXY D;  3RLN A;  4QMG A;  2ZTE A;  1YIJ A;  1RHP A;  4LF9 L;  2B63 G;  2I5M X;  1TS4 A;  2UXB Q;  3K7A B;  4KLK A;  4X3T A;  3JAM c;  2WKD A;  3UE0 A;  2PI2 A;  5EBC A;  3W5O A;  4C3H G;  4YY3 Q;  2EJG C;  2GVB A;  4JI2 Q;  1WD1 A;  2LFN A;  1C4Q A;  4LF6 L;  1X3E A;  1J8I A;  1CHQ D;  3DEO A;  1K3R A;  1TWC B;  4Q0F A;  4C3I G;  2H5X A;  1RD9 D;  3TP6 A;  2I0Q A;  1N33 Q;  5EPL A;  1PFS A;  1WCM G;  3R2T A;  1E3P A;  3C1F A;  2HQE A;  4IPD A;  3SK4 A;  1C0A A;  4GLA C;  4A93 H;  5AJ3 Q;  2HIV A;  2R92 G;  3VR2 A;  5IGC A;  2PQA A;  2R93 H;  1H9S B;  2Z6B A;  1OXU A;  2CWA A;  5CGK A;  2UXD L;  4CJ2 C;  4QJF A;  5FLM G;  3NTI A;  1C48 A;  2OQ0 A;  3S9W A;  1CHP D;  1HJP A;  1E1T A;  4DR6 Q;  2F0N A;  2RDF A;  2CH4 A;  2EYJ A;  4IAL A;  3E3X A;  1XNR L;  3HP3 A;  3MFG A;  3G7L A;  1IL8 A;  1SYB A;  1EOV A;  2JA5 B;  2KED A;  3G6J B;  3W1G A;  1SRO A;  5GRO A;  1NMG A;  1Y1V H;  4A3C G;  1W3S A;  1TT2 A;  5IT9 E;  1Y8P B;  1BBU A;  1D5M C;  1XNQ Q;  3UDI A;  3FEW X;  4CDF C;  2X6G A;  1KC8 C;  3GV3 A;  2EVB A;  4Y7N H;  3TS0 A;  3TRZ A;  4IFD J;  2NWG A;  2WIN B;  3PF5 A;  3RN2 A;  3PF4 A;  1KIX A;  3H94 A;  3FP9 A;  1AFP A;  3A8J E;  2H4O A;  3CC4 A;  4KJN A;  3S1R B;  3S15 B;  2EYM A;  5M3F G;  1L0W A;  5GAH C;  1VQI A;  3GTG H;  1TWH H;  4X62 L;  4OO1 G;  1EYG A;  1AN8 A;  2F52 A;  2B8G A;  1O7L A;  4OWT B;  1KDC A;  1B7Y B;  3AMU A;  2VB2 X;  3RNU A;  3I4M G;  1HH2 P;  2A19 A;  1YNN D;  3M4P A;  4X65 Q;  3U9O A;  5I2Y A;  4NXN L;  5C3W A;  4A75 A;  1G8Z D;  1SN8 A;  2A68 C;  1VQ4 A;  3HOX B;  1O80 A;  2EYH A;  1WTO A;  2LXK A;  4CKB A;  3Q22 A;  1A15 A;  4RAU C;  2EYL A;  1LYL A;  3JC6 6;  2DJG C;  1SYF A;  4DR2 Q;  4P2C B;  3EJI A;  1NR2 A;  4A3E G;  1IBM L;  1GUT A;  1SE3 A;  2LSS A;  2QGQ A;  1CFM A;  1STH A;  2Z6K A;  3L2P A;  3DHQ A;  3OWF A;  3KLW A;  4IPG A;  4DV4 L;  2M9V A;  1EY0 A;  2DY7 A;  1FGB D;  1HQR D;  1PRT D;  5EQ0 A;  3VYR A;  2M00 A;  2MQH A;  3I4N B;  4ZKC B;  1QUQ A;  1R9T B;  4V19 0;  3NBI A;  2HHH L;  3ERO A;  4DV0 L;  3F2C A;  1PH1 A;  3HS0 C;  1QOH A;  3QWN A;  1FNV A;  4KKT A;  3ND8 A;  3TN2 A;  1YEZ A;  4RGT A;  5IP7 G;  5JEA G;  4PZ6 A;  3QO2 A;  1X55 A;  4ALP A;  4C3J B;  1JWU D;  1JQY D;  2EXZ A;  2F0H A;  5I6Y A;  1I5F A;  3PUV A;  1SMY C;  2WP8 J;  1QVF A;  3A54 A;  5JJK A;  1CA5 A;  1AE2 A;  3VYU A;  1B50 A;  1ICW A;  3OHX C;  2ZJP A;  1XXG A;  3H15 A;  3LWU A;  2UXB L;  1NMF A;  4YY3 L;  1CSP A;  1TXY A;  2KOL A;  4JI8 Q;  3PO2 H;  2F0M A;  2RQX A;  1ILP A;  2K50 A;  4K14 A;  3Q8D A;  4L5S A;  2PW5 A;  2RDH A;  3OIQ A;  1WTQ A;  2K5W A;  3M4Y A;  2MP1 A;  2JSO A;  3KLS A;  1EIG A;  5C0X G;  1XTC D;  2A8V A;  1N33 L;  2L4N A;  3ND9 A;  3EA6 A;  1LLR D;  3RD4 A;  1RTN A;  4F88 A;  3H0G H;  2PNH A;  4ZUJ A;  3K81 C;  1AH9 A;  2WFW A;  5AJ3 L;  4DR5 L;  2D2C C;  4KJO A;  1FR3 A;  3NSW A;  4O0A A;  4KY5 A;  3MC0 B;  3OW2 A;  1D1I A;  3ER0 A;  4FNF A;  4XTC S;  5KYI A;  4A3I B; 
#chains in the Genus database with same CATH homology
 1B3A A;  3M85 A;  2EY1 A;  4YIJ A;  1WTR A;  1HQM C;  5EPK A;  1XWE A;  2RA4 A;  4A93 B;  2K32 A;  3MWY W;  3OW7 A;  2K33 A;  2R93 B;  1ZEQ X;  1SYC A;  3PUX A;  3E5S A;  5JAV A;  2Z8L A;  3DXJ C;  3Q24 A;  3RMH A;  1HUN A;  1SEB D;  5G3L F;  2K7V A;  1NUC A;  3D31 A;  5E4W C;  3K5N A;  3SVM A;  3J81 L;  3OOC A;  4RGN A;  2ICE C;  1RF2 D;  5E4X A;  1MGS A;  3MXP A;  4FF3 A;  4PNY A;  1Y1V B;  3DWQ A;  3V96 A;  1I4R A;  3D4D A;  4IUQ A;  2RDG A;  3DM1 A;  4Y7N B;  1F2M A;  3GD7 A;  1B9N A;  1WCM B;  1DXM A;  2NB0 A;  1KAA A;  5CC4 A;  1D5Z C;  3SR1 A;  4AYB B;  2NYZ D;  3T4A C;  4RFB A;  1G6Z A;  5C4J B;  1VMP A;  2XWJ B;  2O2L D;  3GTG B;  3BS1 A;  2PMZ B;  2A68 D;  1NSN S;  5T1I A;  4CHT B;  2CW0 D;  5FLX E;  4OO1 I;  2BA0 A;  2MJ8 A;  5COR A;  4EQO A;  5A2Q L;  3S2H B;  5FOB B;  1Y8O B;  4FYD A;  1H9S A;  1Z47 A;  4R9W A;  2PZU A;  2GA4 B;  1I4X A;  1ESR A;  2EPB A;  1IKM A;  2ID0 A;  3DUZ A;  2NVT B;  4DK1 A;  4HMI A;  3PV0 A;  4WRD A;  4PQX A;  5KIX A;  4LMQ D;  1EY8 A;  1SND A;  2KJX A;  1EY5 A;  1DCZ A;  1SMY D;  3A56 A;  2F0V A;  2L55 A;  1JOK A;  2SNS A;  1LTI D;  3F2U A;  1PTO B;  1EQT A;  4KN4 C;  4KKS A;  3HEJ A;  2PZW A;  1MD2 D;  5C4Z A;  2F0K A;  1TVX A;  1BOS A;  3QOJ A;  3WOE A;  1SYD A;  3HGB A;  5EKL A;  3P7J A;  1JE4 A;  3PO2 B;  1G91 A;  1GUG A;  2JE6 I;  2A6H C;  5FLX L;  3K6O A;  5E3F A;  1EY6 A;  1SYE A;  3I90 A;  5IGG A;  1BQQ T;  3FDT A;  1QJO A;  2KVM A;  2F0G A;  2K5Q A;  3VA7 A;  2EJF C;  4M1U B;  1AP0 A;  1AZQ A;  3N52 A;  3NK9 A;  1U4P A;  3H0G B;  5CBE E;  1STY A;  3DWP A;  1E0B A;  1I4H A;  3MZ5 A;  1SYG A;  2XN9 C;  2L11 A;  4E6I A;  2B2W C;  4F8M A;  4EQP A;  4ME5 A;  4IFD H;  4R8N A;  3D4R A;  1EY4 A;  1UNS A;  3HOY B;  3E6Z X;  1V8Q A;  1LTG D;  3Q0A A;  3T51 B;  1BCP F;  2BE5 D;  1E2W A;  5C4H A;  3IAY A;  4ZAI A;  3KUP A;  1KNE A;  4KK7 A;  1CT1 D;  5IOC A;  3NTK A;  3GTO B;  4FF1 A;  2XIW A;  3GTP B;  3NWT A;  4GZY C;  3RZO B;  1WTP A;  4XT1 B;  2R3Z A;  5TSS A;  1HA6 A;  4Q5V A;  5C6A A;  2MPM A;  4IQZ A;  2PNR C;  3I8Z A;  1I6V C;  3OMC A;  3NQI A;  3R3O A;  3HKZ B;  1F2Z A;  2VUM B;  1FNW A;  3VR5 A;  5EBD A;  4C3J G;  5CR3 A;  4K8J A;  2O5J C;  1F77 A;  2E2D C;  2XNA C;  1QNK A;  1SNC A;  2VXW A;  1FD7 D;  4FXG C;  1YNN C;  1OXS C;  4XYQ A;  1SFO B;  3R8B A;  4ZQ3 A;  4A3B B;  1I4P A;  2F0J A;  1WTX A;  1ONL A;  1TR5 A;  1JOQ A;  1ML0 D;  4RGM A;  1GJX A;  1JWM D;  1II3 A;  2XVS A;  3S1N B;  2WII B;  2F0P A;  5DM7 3;  4RWS C;  2B39 A;  2B2T C;  2HCC A;  1EWC A;  4IUU A;  3GV6 A;  5CMD A;  3H91 A;  1PRT C;  4EQN A;  1TWF B;  4TQU S;  1DON A;  2NVX B;  4BA1 I;  2F03 A;  2A5H A;  3TP7 A;  3LNN A;  3AU7 A;  1AZP A;  1GOZ A;  3TP8 A;  3DEP A;  5JVH 3;  5IGD A;  5IGF A;  2A74 C;  4NW2 A;  4K6L A;  1EU4 A;  1E2V A;  3D3R A;  3S16 B;  4I7Z C;  1QB5 D;  1TWA B;  2FMC A;  5I6W A;  2BOS A;  1TY0 A;  1B2T A;  4KN7 C;  4FVM A;  4RKB A;  2BA1 A;  1JOR A;  3PUZ A;  2K5D A;  2TSS A;  4NMZ A;  1LTT D;  1BXT A;  2DN8 A;  1Q90 A;  5C5M A;  4KKU A;  2B2U A;  4ULL A;  2KUM A;  3C2P A;  1TU2 B;  3H3V C;  3HZX A;  2LS0 1;  2HUG A;  5CV8 A;  3QB3 A;  4IUT A;  1Y1W B;  3N6R A;  2CVR A;  3BG3 A;  3S2D B;  4N9T A;  1UAP A;  4KY6 A;  3SHL A;  2F0Q A;  2VB3 X;  1EU3 A;  1PZI D;  2G9H D;  4RA8 A;  3R93 A;  1JR0 D;  5ELD A;  2J0T D;  1HCZ A;  5C4X B;  3FKI B;  4MIU A;  1CA6 A;  2K03 A;  5KEE A;  1V1P B;  4K6D A;  3J7A V;  1SNQ A;  3I72 A;  2LMC B;  4NDX A;  3DMU A;  4FXK C;  2JYO A;  1GUS A;  1DOL A;  1S5B D;  5CV5 A;  2WV6 D;  1SAP A;  3SK6 A;  5DEH A;  1SSO A;  5LL6 X;  2AQ2 B;  2JA7 B;  1ZYR D;  3NE5 B;  2OF1 A;  3HOV B;  3I3C A;  5C44 B;  2ZXP A;  1ZXT A;  1A3U A;  3QG1 A;  4Z9C B;  3NUC A;  2CW0 C;  4G57 A;  4G7H C;  3K0Y A;  3M7G A;  3GO5 A;  2EY2 A;  1JIC A;  2WAC A;  1TS5 A;  5D3D A;  2F0O A;  5KNC A;  5J1Z A;  1BBX C;  4A3D B;  2YYZ A;  5C5L A;  3WDN A;  1KDA A;  1OXT A;  5IIF A;  4QB4 A;  4IUV A;  2E2H B;  2L5T A;  2IX3 A;  3C46 A;  2IL8 A;  5FO7 B;  3FPP A;  2WB1 B;  2RSO A;  2LKV A;  2L0C A;  4B9X A;  2XWB B;  3H6M A;  5IT9 L;  1CTM A;  4EVO A;  2EY6 A;  3SK8 A;  1H9K A;  2NN6 I;  2EOT A;  1O78 A;  2A69 D;  1SXT A;  3MXU A;  3I91 A;  4OL7 A;  2AUJ D;  2ZXO A;  3BDL A;  3KF8 A;  2F0T A;  4IZ8 A;  1HUM A;  1ET6 A;  2RVL A;  3MA2 B;  3RLF A;  4OO1 H;  1S5F D;  3X3N A;  1EZ6 A;  5C3E B;  5ISR A;  3U9S A;  4BS9 A;  5A35 A;  2EYP A;  1CZG A;  5I2X A;  5G3L D;  4K8I A;  5EKI A;  1DYQ A;  1TII D;  3GQB A;  4HN7 A;  4WJW A;  3CRK C;  1LV9 A;  3QIA A;  4JK1 C;  1I50 B;  1SBB B;  2PQE A;  2SDF A;  4DAP A;  3SE0 A;  4ZKB B;  3TZD A;  2Y0S B;  3O13 A;  4ZYS A;  4L6T B;  4X3K A;  4EGV A;  1DM0 B;  5CV9 A;  3A8K E;  4L8J A;  4XYO A;  1TY2 A;  1HTP A;  1EY9 A;  1F2Y A;  2BE5 C;  3S14 B;  3D4W A;  2E74 C;  5EPJ A;  1FNU A;  3L7Z C;  2PYK A;  1PTO F;  1HPC A;  2Z4I A;  3M7N A;  1L0X B;  2MGS A;  3Q23 A;  1OXV A;  2LY7 A;  3MAQ A;  1ESF A;  3PIO 3;  3MEH A;  4XIG S;  3W2D A;  4DF7 A;  3PUY A;  3ERQ A;  1DOM A;  5DNF A;  3EFX D;  4KD4 A;  4QUF A;  2J7Z A;  3M3Y B;  1BF4 A;  1TWH B;  1WTW A;  1PRT B;  3URY A;  2SEB D;  2D62 A;  3H09 A;  4K5X A;  2NBF A;  5J39 A;  4XT3 B;  4OIK A;  4OGQ C;  1WVL A;  4U67 3;  1S5D D;  1PLF A;  4DU9 A;  1U4R A;  1VCI A;  1SNM A;  3ITP A;  1STG A;  1GXD C;  3BVZ A;  2F4I A;  1EYD A;  5DAU A;  3NXW A;  1KLG D;  2AQ3 B;  2B2Y C;  2EY5 A;  3HOW B;  4HSP A;  4XQJ A;  1Q3L A;  4BWG B;  1V1P A;  2KCN A;  4ZRZ A;  3I73 A;  3RZD B;  2A6E D;  4RHS A;  4BY7 B;  1KDB A;  1R4P B;  2NZ1 D;  1CZW A;  2KEE A;  4K5W A;  4CGY B;  1XX8 A;  3OMG A;  4H44 C;  4IFD G;  3CKI B;  1MSH A;  4J1M A;  5HUR A;  5M5W B;  1T5X D;  1TQO A;  1EL0 A;  1LT6 D;  5JPN C;  1B1Z A;  1Y8N B;  3NQT A;  2K01 A;  2F0I A;  2F3W A;  2MHV A;  2WAQ B;  1NAP A;  1KTK A;  3K58 A;  4DNT B;  1Q1B A;  1CK1 A;  2SOB A;  4IUN A;  3K57 A;  4A3M B;  1BCP D;  5AFW A;  4X3S A;  2F0F A;  2AUK A;  2KCC A;  3BDO A;  3OWE B;  3T53 B;  3SEB A;  4A3G B;  4M8A A;  4J6H A;  4QIW B;  5C0X I;  3EVQ A;  1STB A;  1EEI D;  1A2T A;  3GTJ B;  1D2B A;  4K2K A;  5FKA C;  4IN3 A;  3TBI B;  1WTV A;  5JVG 3;  2F3V A;  2E2J B;  2EYF A;  1S5C D;  2CHB D;  2R7Z B;  1UEA B;  4C2M B;  4ODG A;  1ROD A;  4RCO A;  3FVQ A;  3I70 A;  2B2W A;  5FO8 B;  5D65 A;  4HAE A;  3Q6S A;  4F7X A;  4DGZ A;  4BBR B;  2DY8 A;  1QG7 A;  3EQL C;  1B44 D;  4LJZ C;  4MN3 A;  1JC7 A;  2I46 A;  1EWH A;  2F0E A;  1E2Z A;  5KYL A;  1QIL A;  1B4O A;  1LT5 D;  3KLR A;  1U4M A;  2F0W A;  5M3M B;  4KD3 A;  3PUW A;  2F0S A;  3SXH A;  5IOD A;  4FO2 A;  4FF4 A;  4HSV A;  2AWN A;  3JAM E;  1X32 A;  3K5L A;  4S3S A;  1UUP A;  2K1B A;  3NTH A;  5JEA J;  1F9R A;  1IHZ A;  4DFA A;  2PW7 A;  1QNU A;  1Q1E A;  3S17 B;  1EEF D;  1ZYR C;  3C3L A;  3NWS A;  3OSO A;  2H1E A;  1YNJ D;  2IJ0 A;  1PYW D;  3GP7 A;  3ONA B;  3M4O B;  2B2V A;  1SJE D;  1U9R A;  3V2T A;  1J9O A;  1SDF A;  4NKL A;  4CKE A;  2MUY A;  1PFM A;  3QOL A;  4HTH A;  1D5X C;  2F0L A;  3GTL B;  1Z6H A;  5C0X J;  3VYS A;  5CBA E;  2J4X A;  1O7Y A;  2QCP X;  1A6X A;  2Z4H A;  1BUV T;  4B08 A;  4CBV A;  1V43 A;  4QUC A;  3NBH A;  4IUP A;  4MHE A;  3A55 A;  2R6G A;  1Q8I A;  1F9S A;  1ZKO A;  2I07 B;  1IYU A;  1A3T A;  3IL8 A;  4HR7 B;  1JB3 A;  5E1F A;  2B2T A;  2A69 C;  4DNR B;  3A7A B;  3MHB A;  3BYY B;  1S5E D;  1K8O A;  1L0Y B;  1S4Z A;  5FO9 B;  2O5I C;  1SNP A;  5BN3 A;  3CHB D;  3MFY A;  5K5P A;  5KNB A;  1C8C A;  4XQQ A;  2B8F A;  1D1K A;  5BN5 A;  1EYA A;  1G29 1;  3LX0 A;  5I9P A;  4DK0 A;  5K36 H;  2NTS A;  3IFD A;  2KQ3 A;  1KAB A;  1EYC A;  5F2D A;  1U4L A;  1LTB D;  5CV6 A;  4XXE A;  2F0D A;  2V4D A;  1PTO C;  4HED A;  4A3F B;  2NN6 H;  1DZ1 A;  2QF7 A;  2YU9 B;  3K5M A;  4A3K B;  3GTM B;  3NPP A;  1HA5 A;  1LO5 D;  3CRL C;  4FXD A;  1F2L A;  4LAA A;  3T16 A;  2FFK B;  2F0U A;  1HFN A;  4KI0 A;  5DM6 3;  3KK7 A;  2N88 A;  1BO0 A;  3J7Y W;  4RGO S;  3HG9 A;  3L3O C;  2RKS A;  2CQA A;  1LTA D;  2IT1 A;  1RCV D;  3GTQ B;  1STN A;  1SE4 A;  2IX0 A;  2NVY B;  5EJW A;  3FMC A;  1F9Q A;  2PO4 A;  2PCF B;  2ENB A;  3X3M A;  2EE1 A;  5LHY 1;  1HHV A;  2KHS A;  1IKL A;  2EYO A;  4DAY A;  1V1O A;  4RKL A;  2JXM B;  2N55 A;  1HFG A;  3VYT A;  5I4D A;  4XDX A;  5T1G A;  2SNM A;  2TMP A;  4TSS A;  1Z7T A;  5NUC A;  1CQV A;  1QE6 A;  3BDC A;  4TRD A;  2BDN A;  1G2S A;  3V05 A;  1SE2 A;  2IW3 A;  3P20 A;  5LL6 S;  2IX1 A;  4KV6 A;  1WD0 A;  1TS3 A;  2Z1C A;  1W6J A;  1MBY A;  2HDM A;  4ABN A;  1H9M A;  1M8A A;  2F1M A;  2DNE A;  2BCO A;  2A6E C;  2EZV A;  2L9H A;  2R61 A;  3J80 E;  3K59 A;  2JA6 B;  4A3J B;  4G4K A;  2PPB C;  1EQV A;  4KTA A;  1EIH A;  2FJ2 A;  2X6L A;  1PTO H;  1R4Q B;  3D6C A;  1ENC A;  1H9J A;  2NTT A;  1XYI A;  4RHR A;  2Q8T A;  2OXP A;  2X69 A;  2L12 A;  2ICI A;  4ILW A;  3J81 E;  2AQ1 B;  4WOR A;  1BCP C;  3PMF A;  3PO3 B;  4K2L A;  1PRT F;  3CQZ B;  4WFN 3;  2DNC A;  1SNO A;  4KY7 A;  1F9P A;  4BY1 B;  1SJH D;  1PTO D;  5KRU A;  1AW7 A;  4C1N K;  4DXF A;  1EY7 A;  1EZ8 A;  4QF4 A;  1PMR A;  1ENA A;  1LAB A;  2AWO A;  5CV7 A;  4UDU C;  3BYT B;  1PXU A;  4ZUI A;  5D14 A;  5JEA H;  2XRS D;  3S1M B;  1QWY A;  1I4Q A;  2HCI A;  1STE A;  1BNZ A;  4O1N A;  3J80 L;  1JCK B;  1STA A;  4TKO B;  1FYC A;  1ET9 A;  1EOT A;  2QKI C;  5A2Q E;  3D8G A;  2RBM A;  1CQF A;  3I4L A;  3KBX A;  1TKW B;  3T56 B;  3SK5 A;  1QCB D;  5KGU A;  5JOB A;  2IWH A;  1CM9 A;  2B63 B;  5C0X H;  2D5D A;  4C3H B;  4PMW A;  2QDB A;  3K5O A;  1X3P A;  2QEJ C;  3J7A F;  1M4V A;  4JBW A;  3VR4 A;  3IKJ A;  4C3I B;  3TDQ A;  3MTS A;  2HDL A;  3D6W A;  2K04 A;  5ELB A;  3SDZ A;  5ELF A;  1MSG A;  4IUR A;  5CYU A;  5CV4 A;  1LTS D;  3UI2 A;  4O42 A;  4OHJ A;  4KMU C;  2K28 A;  3P1H A;  2R92 B;  2BDO A;  1TS2 A;  4K5V A;  1O7Z A;  4V0B A;  1ENF A;  4OIJ A;  1A3V A;  2NUC A;  1VF7 A;  4H0L C;  1VDZ A;  2A73 B;  2K05 A;  1GHK A;  1YNJ C;  4BA2 I;  4DA2 A;  4DXG A;  4XQN A;  5BN4 A;  3MVV A;  1PDQ A;  5M9O A;  4QCL A;  4I65 A;  5JPM C;  1BDO A;  2IPK D;  4DAV A;  1RTO A;  5COY A;  4R8I A;  3PIP 3;  5M5Y B;  2E75 C;  4U68 A;  1PZJ D;  2NVQ B;  3A8I E;  4UAI A;  2B2Y A;  3BZD B;  4HCS A;  3L9A X;  4NP5 A;  4PMC A;  2O4X A;  3R2I A;  1RDP D;  2FIN B;  4HMJ A;  1ILQ A;  5M3F B;  1PFB A;  4KHZ A;  4H13 C;  1AEX A;  4ZLT F;  1A2U A;  4C1N I;  1DOK A;  3I4M B;  1KLU D;  3MXG A;  4F87 A;  5C3X A;  2EJM A;  5D3I B;  1CI3 M;  4A3E B;  1IW7 C;  2JEA I;  5HGT A;  4FP5 D;  1I6H B;  3HOZ B;  2E2I B;  1OO9 B;  1G2T A;  1LTR D;  3TP5 A;  1B9M A;  2RSN A;  2XRQ D;  1K83 B;  2Q8R E;  3NHH A;  1VMC A;  3KBG A;  1X3Q A;  3QJY A;  4J8Q A;  1HRJ A;  3VR3 A;  3RUZ A;  1H9R A;  3TZU A;  3S1Q B;  2WKC A;  3KLS X;  2VNU D;  1PZK D;  2XSC A;  4N9P A;  3ZYY X;  2D9U A;  2PZT A;  2JEB I;  1MI2 A;  1JWS D;  1LT3 D;  2QIL A;  3OIP A;  3AB9 A;  3NP8 A;  4X3U A;  3VA5 A;  1W6K A;  1EFI D;  3BVM A;  5IGE A;  4L63 B;  4FF2 A;  1T5E A;  2K6A A;  4C56 C;  3FPU B;  5FK9 C;  1TWG B;  3E0J A;  2C9O A;  1OXX K;  2JP1 A;  4PMB A;  2E76 C;  4ID6 A;  5ELE A;  3VR6 A;  5M5X B;  1I3Q B;  4LK1 C;  4CJ0 B;  2L1B A;  2B2V C;  3HRZ C;  5ELC A;  2OEO A;  4BBS B;  4CKC A;  4G7Z C;  3TSS A;  2ZXR A;  1K8M A;  1LAC A;  1IYV A;  5EKK A;  3GTK B;  3P75 A;  4HCE A;  5J22 A;  3LWE A;  2EDG A;  2FHT A;  4CJ1 B;  3FRP B;  2Q8I B;  1VF5 C;  3WOF A;  3HOU B;  4G7O C;  3CU7 A;  5K36 G;  1BCP B;  5I9O A;  3DWA A;  3T13 A;  5JJZ A;  3BVG A;  2OT2 A;  1NCV A;  2FMM A;  2KA7 A;  1HTL D;  4IFD I;  1NR4 A;  3TME A;  2ZT9 C;  1Y69 U;  5IGB A;  4H7B A;  1DD2 A;  2C5C A;  3JAM L;  1GUO A;  1Q12 A;  2NN6 G;  3MXN A;  3IFT A;  2KEC A;  1GHJ A;  1PFN A;  1B53 A;  5EGT A;  4DN4 M;  4KHV A;  2M2L A;  1GUN A;  4RH6 A;  2G9D A;  3C1E A;  4PV1 C;  1IW7 D;  4RCN A;  1RJT A;  2JA8 B;  3OPO A;  2A6H D;  1I4G A;  1KNA A;  1DJR D;  1RKN A;  1JOO A;  2B2U C;  3W3A A;  1GUW A;  4B9W A;  1BR9 A;  1D6E C;  4ZK9 B;  5KND A;  1LT4 D;  3A7L A;  1HXY D;  4QMG A;  1RHP A;  1TS4 A;  3K7A B;  4X3T A;  2WKD A;  4C3H G;  5EBC A;  2EJG C;  1WD1 A;  2LFN A;  1C4Q A;  1J8I A;  1CHQ D;  3DEO A;  1TWC B;  4Q0F A;  4C3I G;  1RD9 D;  3TP6 A;  5EPL A;  3R2T A;  3C1F A;  2HQE A;  3SK4 A;  3VR2 A;  5IGC A;  1H9S B;  1OXU A;  5CGK A;  4CJ2 C;  3NTI A;  1C48 A;  3S9W A;  1CHP D;  2F0N A;  2RDF A;  2EYJ A;  4IAL A;  3HP3 A;  3MFG A;  3G7L A;  1IL8 A;  1SYB A;  2JA5 B;  2KED A;  3G6J B;  1TT2 A;  5IT9 E;  1Y8P B;  1D5M C;  3FEW X;  2X6G A;  3GV3 A;  2EVB A;  4IFD J;  2NWG A;  2WIN B;  3H94 A;  1AFP A;  3A8J E;  2H4O A;  4KJN A;  3S1R B;  3S15 B;  2EYM A;  4OO1 G;  1AN8 A;  2B8G A;  1O7L A;  1KDC A;  3AMU A;  2VB2 X;  1YNN D;  3U9O A;  5I2Y A;  5C3W A;  1G8Z D;  2A68 C;  3HOX B;  1O80 A;  2EYH A;  1WTO A;  4CKB A;  3Q22 A;  1A15 A;  4RAU C;  2EYL A;  1SYF A;  4P2C B;  3EJI A;  1NR2 A;  1GUT A;  1SE3 A;  1CFM A;  1STH A;  3DHQ A;  3OWF A;  2M9V A;  1EY0 A;  2DY7 A;  1FGB D;  1HQR D;  1PRT D;  5EQ0 A;  3VYR A;  2M00 A;  3I4N B;  4ZKC B;  1R9T B;  4V19 0;  3NBI A;  3ERO A;  3HS0 C;  1QOH A;  3QWN A;  1FNV A;  4KKT A;  3ND8 A;  3TN2 A;  4RGT A;  5JEA G;  3QO2 A;  4C3J B;  1JWU D;  1JQY D;  2EXZ A;  2F0H A;  5I6Y A;  3PUV A;  1SMY C;  2WP8 J;  3A54 A;  1CA5 A;  3VYU A;  1B50 A;  1ICW A;  3OHX C;  1XXG A;  3LWU A;  2KOL A;  2F0M A;  2RQX A;  1ILP A;  4K14 A;  2PW5 A;  2RDH A;  3OIQ A;  1WTQ A;  2K5W A;  3M4Y A;  2MP1 A;  2JSO A;  3KLS A;  1EIG A;  5C0X G;  1XTC D;  2L4N A;  3ND9 A;  3EA6 A;  1LLR D;  3RD4 A;  1RTN A;  4F88 A;  4ZUJ A;  2D2C C;  4KJO A;  1FR3 A;  3NSW A;  4KY5 A;  3MC0 B;  1D1I A;  4FNF A;  4XTC S;  5KYI A;  4A3I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...