5KGUA

Crystal structure of staphylococcal nuclease variant delta+phs n118d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGDNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N118D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kguA00
5CV5A 4K5VA 4G57A 3C1EA 2WACA 3MEHA 5K5PA 2RKSA 4DGZA 4J1MA 1SYGA 3MXPA 1A3TA 4NDXA 4QF4A 3SK6A 2EYPA 3SK4A 3QOLA 4F7XA 5KEEA 5C5LA 1KABA 4K5XA 1A3UA 3NHHA 1F2ZA 3NUCA 4K6DA 4KD3A 4QB4A 5NUCA 1II3A 2F0UA 2OF1A 5J1ZA 2SNSA 5JAVA 3D6CA 3PMFA 1EYDA 3OMGA 5CR3A 5CV6A 2F0TA 3MVVA 2PYKA 5C4HA 4ID6A 2F0MA 3RUZA 4RKLA 1EY4A 1EY8A 4K2KA 4PNYA 4YIJA 1ENCA 3QOJA 4KY7A 4ZUJA 5M9OA 5J22A 3D4WA 2PW7A 2EYHA 2F0HA 3MZ5A 4KY6A 1JOKA 1EYCA 5CC4A 5KRUA 4K14A 3HZXA 1KAAA 3TP7A 1A2UA 1A2TA 2KQ3A 4PMBA 5CV9A 4KTAA 5CV8A 4ME5A 1EQVA 1STNA 2EY2A 3HEJA 4HTHA 4IALA 1STYA 2EXZA 3SR1A 1NSNS 3T16A 1EY5A 5CGKA 1SNMA 1TT2A 3EVQA 5I9PA 2F0OA 3C1FA 2F0KA 1JOQA 5IODA 3U9OA 2HQEA 1EY6A 1JOOA 2QDBA 1U9RA 2EYFA 5EGTA 4WORA 5C6AA 5I6WA 5IOCA 1EY0A 3OWFA 3R3OA 4K8IA 2F0JA 4ZQ3A 5KYLA 4KJNA 4S3SA 2F0FA 2EYJA 2F3WA 2O4XA 1NUCA 3D4DA 3EROA 4R8NA 3NP8A 1SNDA 3NK9A 5I9OA 4ODGA 3P1HA 5IGCA 5IGEA 3ERQA 1ENAA 4K8JA 2F0VA 2ENBA 3DHQA 3TP6A 4E6IA 5IGGA 2PZWA 1SYCA 5IGDA 5DAUA 3E5SA 1STGA 4K5WA 4B9WA 4DF7A 5I6YA 5EKKA 4OL7A 2OXPA 2OEOA 1F2MA 3DMUA 5CV4A 5JOBA 2F0IA 2EYMA 1RKNA 5KIXA 4TRDA 2PZTA 4H7BA 1SNQA 2RDFA 5C3XA 3TMEA 1SNOA 3QB3A 2EY5A 2F0WA 1F2YA 2F0GA 3NXWA 2EYOA 2F0EA 1EZ6A 3VA5A 5EKLA 2F0QA 3SHLA 2F0SA 5J39A 4F8MA 2EY1A 4RKBA 2EY6A 2PQEA 4EQPA 2F0NA 3OMCA 1EY7A 3TP5A 5C3WA 5KGUA 5IIFA 4PMCA 2M00A 5HGTA 2F0DA 1SNCA 3MHBA 3BDLA 5E1FA 5F2DA 4MIUA 4EVOA 1KDCA 4KD4A 3S9WA 4I65A 1JORA 1STBA 4KHVA 4KJOA 5C5MA 1IHZA 3T13A 5ISRA 2F3VA 2PW5A 5HURA 3SK5A 4LAAA 4HMIA 1EYAA 2RBMA 2SNMA 4NP5A 1STHA 1SYBA 1KDBA 3OSOA 4WRDA 3V2TA 5KYIA 5DEHA 4KY5A 1AEXA 4N9PA 4QMGA 4EQOA 5C4ZA 4KV6A 4DFAA 4NKLA 3BDCA 3TP8A 5CV7A 4B9XA 2F0PA 4ZUIA 2EYLA 2F0LA 1TR5A 4HMJA 3SXHA 1EY9A 3H6MA 3P75A 1SNPA 1TQOA 4EQNA 1A3VA 4J6HA 3NQTA 4IZ8A 2LKVA 4N9TA 2SOBA 1KDAA 4K2LA 3LX0A 5E3FA 3SK8A 4IUNA 1SYFA 2KHSA 3EJIA 2NUCA 1EZ8A 2PZUA 3D8GA 4DU9A 4NMZA 5IGFA 3ITPA 1STAA 1SYDA 1SYEA 5IGBA
chains in the Genus database with same CATH superfamily
3W5OA 1ET6A 3MEHA 4RHSA 3RZOH 2L4NA 3J81E 1CKMA 5M3FG 4OONA 4BY7H 2LY7A 4X62Q 5JAVA 2JA5B 1TS3A 1EYDA 5CV6A 5C4HA 4X65Q 4ID6A 2F0MA 3HKZB 5EAYA 3NEMA 4PNYA 1HA5A 1Y8PB 3QOJA 1HQMC 3J81i 1L0YB 4KY6A 5JJLA 3GV3A 3HZXA 1S5CD 2R61A 3CRLC 2RDGA 1XMQQ 1KNAA 4V190 2R93H 2KQ3A 4J8QA 1KRSA 4GOPB 4NXMQ 1EQVA 3AU7A 1D7QA 3KDFB 2JJQA 1FJGQ 3S17H 1IZ6A 3F2BA 4DR4Q 4JG2A 1ICWA 4JBKA 3G6EA 1U9RA 2XSCA 4X64L 2OTJA 3RLFA 1IBLL 2WAQB 2JXMB 4UY8C 1WVLA 4C3IH 3P1HA 3M3YB 4DV1L 1PTOD 5DAUA 4GNXB 2LXKA 4RFBA 5EKKA 4OL7A 5M3MB 1F2MA 5CORA 1GKHA 5D3DA 4KN4C 1K9MC 1IBMQ 5LMNW 3S14B 5AJ3L 2JEAI 3ONAB 5C4JB 4QJFA 2LS01 1KIXA 1PZID 4YY3L 3TREA 2XGTA 3NXWA 1H9RA 1JR0D 4B3SL 5EKLA 3SHLA 3R8BA 1Q90A 4F8MA 2UXBL 2JK8A 4L8JA 3DWAA 4YWLA 3I4NB 3HOYG 4JI2L 4EVOA 1M8AA 3KF6B 1R4PB 2H1EA 3MA2B 4L6TB 1LUZA 1IHZA 3OHXC 5DM63 2NVQH 2GVBA 1RL2A 3C3LA 4BBSG 1NTGA 3HOUB 4ALPA 2A74C 3DEOA 3NTIA 1E2WA 3CQZH 2JA8H 1SN8A 3Q8DA 1SEBD 3PUYA 2FJ2A 1PA6A 4HJ9A 4ZUIA 2SDFA 3OIPA 2ALYB 2Z9HA 3J80L 1DXMA 3SK8A 1SMXA 4DR1L 1KLGD 3QIAA 3D8GA 2PZUA 1MGSA 3S1QH 3DWQA 4JI6L 4BA2I 1TKWB 3TSSA 5DNFA 1N36Q 1Z47A 4G57A 4TKOB 1K8MA 1B53A 1Q1EA 3CCQA 1BKBA 4WFN3 3D4RA 1KABA 2H5XA 1K0RA 3HKZE 3K7AB 3W1BA 1J5EL 2F0UA 2KHJA 2MUYA 2D9UA 3QO2A 3U58A 1I3QB 1TXYA 2ICEC 3GD7A 3S1RB 3CCSA 1D2BA 1TWCB 4PZ6A 5M9OA 2KCTA 3GTOH 1V1OA 2WKDA 3JAME 4DV4L 4MTNA 5BR8L 5KRUA 3FKIH 3MC0B 3TP7A 1HZBA 2WB1G 2B39A 2ZJRA 4DR6L 3CPWA 1WJJA 4A3LH 4GLXA 4JI7L 1O78A 4HTHA 4IFDI 1VF5C 4C1NI 1YHBA 4X6AH 1CT1D 1OXUA 4Z9CB 1EY6A 3JAMi 1Q7YC 5FLMH 4CKEA 1GD7A 4QQBX 1L2FA 1AE2A 5TSSA 5EBDA 4A4IA 1BO0A 1O7LA 1PYBA 3GTQH 4JI3L 3RZOB 3PUWA 1WTPA 2PZWA 3S1MH 2A73B 5KNBA 5EBCA 4A75A 4BY7B 4OGQC 2KEDA 3BVGA 4DV3Q 2FMCA 5I4DA 5KIXA 2K6AA 4H13C 5E4WC 4XQJA 2UXDQ 3A5UA 4FP5D 3OOCA 4AQYL 1WYDA 3P20A 4A3CH 5IT9c 1AH9A 1PRTD 2R93B 5ELNA 2M00A 5HGTA 1ESRA 4KJOA 3EFXD 2JN4A 2NZOA 4WRDA 4X62L 3I4MG 1MSGA 2E2IH 1O7YA 4LWCA 3MFGA 4QMGA 5I2YA 3I56A 2Z6KC 2BOSA 4C3IB 1YEZA 3CC4A 3QWNA 4DV5Q 1RJTA 3MWYW 4C3JH 5LMUQ 2D0PA 1XMQL 1VQCA 1BXTA 4DU9A 1T5XD 4NXML 1GHKA 3VR2A 1CM9A 3BG3A 1J8IA 1Y14B 2UUAQ 4A3DG 1H9SB 2K01A 3KYHC 4CKBA 4DGZA 4HJ5A 1SYGA 4JYAQ 1HRJA 5K36H 2RQXA 2ZM6Q 3CMEA 3CC7A 1PMRA 3MVVA 3HRZC 2DNCA 1S5ED 2NVQB 1SXTA 2YTXA 2JA7H 1VQOA 3GTKH 4LK1C 4IPDA 1EYCA 1IBML 1SSOA 3CQZB 2JA8B 1YHQA 5IYDG 1FVIA 4RAUC 1PH3A 5C3EG 2Q8IB 5FJ8G 1XYIA 3T16A 3VYUA 2DY8A 3H94A 3ULJA 2KHIA 2F0OA 1H9MA 4GOPC 4XXEA 1CA6A 5EGTA 4C56C 3S1QB 2IX3A 3HOVG 4A3FG 3HP3A 1FNUA 4ODGA 1K83H 2Z6KA 3WOFA 4DV2Q 1C7YA 1SYCA 1BNZA 3E5SA 2ICIA 1VQ8A 3P7JA 1LTLA 5C44H 1RKNA 4GNXC 4A76A 2PZTA 2RDFA 4O42A 1BR9A 1SNOA 2KOLA 2VUMG 1F2YA 1I6HH 4UDUC 4AYBE 3GTOB 4DAVA 1Q82C 2UUBQ 5C0XH 3CCJA 3FKIB 4RG1A 4K6LA 3HOWG 5KGUA 3E0JA 1N36L 2F4VQ 4LF5L 5F2DA 4A3KH 3GTPH 4NXNQ 4N8X1 5KNDA 2F3VA 2I0QA 5HURA 2AQ1B 2UUCQ 4OWWB 4BXXG 1LT6D 2HIVA 4YWMA 1YJWA 1CFMA 4KMUC 5BN3A 5M5XH 4CHTB 3K7UC 3GTQB 2FINB 5LMNL 2LKVA 2L1BA 4JCVE 3S1MB 1N8RC 4L5SA 3ND8A 3S15B 4GOPA 4IFDG 3I70A 2EIFA 3UDFA 3PSIA 3KDFA 3RLNA 1BOSA 2RKSA 2PPBC 1ET9A 1K28A 2IHEA 1XXGA 3RZDH 1PYWD 4HN7A 2E74C 4KD3A 2NBFA 2R92H 4GNXA 1QE6A 2SEBD 2OQKA 3MZ5A 1CHQD 5ELBA 1H9KA 3RMHA 1JOKA 5IWAQ 1GUWA 3K5LA 2NZHA 4KTAA 1CZGA 1GO3E 1K3BC 3HEJA 1SFOH 1V43A 2HDMA 4G7OC 2BDNA 3E9IA 2QF7A 3H0GB 4C3HG 4OWTB 1JWUD 3AYHB 3KF6A 4P75A 1WCMG 2F0FA 3HOZG 2O4XA 3EROA 4GLAC 1OXSC 3NK9A 4IPGA 3ERQA 1QCBD 1IKLA 1LACA 4K8JA 4E6IA 4R1JA 4F88A 3BZKA 4QIWE 1HCZA 1VMPA 4BY1H 4M1UB 2EYMA 4H7BA 1JWMD 1K8GA 1IXRA 4JV5Q 4DV5L 1LM0A 4BWGB 3FDTA 4JI8L 1RCVD 1Y1VG 5LMUL 1F77A 2JA7B 3GTKB 3NWSA 3DEPA 4R4IA 5C3WA 2F0NA 5LHY1 1VQMA 2IJ0A 5E1FA 1VQHA 3PUXA 4OELB 2VQEQ 2UUAL 1LTAD 1CK1A 1D6EC 4LF7Q 3CCRA 1Z6HA 3SK5A 1QWYA 1S5FD 4IQZA 3SEBA 2ZM6L 1SYBA 1PH4A 1K8AC 4JK1C 4DK1A 1VQ6A 3K81C 4EQOA 3D3RA 2IL8A 1E2VA 1K83B 2JP1A 3H6MA 2VXWA 1L0WA 2EZVA 4DPGA 4K2LA 2JA6G 4DV0L 4IUNA 3G48A 4NPSA 3CF5A 5C44B 1AZPA 4LF8Q 3U4ZA 3I4MH 1TU2B 3ITPA 5BN5A 3CCMA 1I6HB 2Z4HA 1FNWA 3M4QA 2ES2A 3PQIA 3PIP3 4GLVB 1OTCA 4OX9Q 4A3KB 2GVAA 5JEAJ 3GTPB 5JJIA 4MN3A 3RUZA 2NTSA 4DV2L 3E6ZX 3PUZA 4H02A 5J22A 4KY7A 4ZUJA 5AFWA 4DV7Q 3PIO3 2E75C 1E22A 2L55A 4GN4B 5JEAH 1X6OA 1PDQA 1WTXA 5CV9A 2VQFQ 3J7ZC 4DR7L 1ZYRC 5M5XB 3S2HH 1PH2A 1TWFH 4B3MQ 2B3GA 2F03A 4DUZQ 3EVQA 4GKKQ 5KNCA 1JOQA 1ENFA 3U9OA 1I4QA 4CBVA 2F4VL 3NELA 4IURA 3MAQA 3DM1A 2E2HH 5IYDH 2EYJA 1XX8A 4XQNA 5GAHC 2X6GA 3PO2G 2NZ1D 1ENAA 2UUCL 2UXCL 2F0VA 1LTRD 1U4PA 3KUPA 4K5WA 2ZJPA 4L5RC 1DZ1A 1CHPD 1HFGA 1SE8A 4DV6Q 5EKIA 4LF4Q 3HGBA 1B9MA 3H3VI 3DUZA 2R92B 3QG1A 4R9WA 2A6HC 2D62A 1N34L 3GV6A 2EJMA 3I3CA 1SJED 1D8LA 3PO3H 1H9SA 4OWXB 2VNUD 1SFOB 4PZ7A 4KHVA 3NBHB 3T13A 1U4RA 4QL5A 4HMIA 4PMWA 2RBMA 2CH4A 2DGYA 3PGZA 4DK6C 5KYIA 4B3TL 2B2VC 1DCZA 4P73A 1N33Q 1CKNB 1DOKA 3TP8A 2V4DA 2DY7A 4HMJA 1TR5A 1GHJA 1B9NA 1TS5A 5FKAC 4DR2Q 4N9TA 3S16B 4A3BB 1I94Q 5DLQE 1X55A 4CJ0B 1AE3A 1XPOA 2E2DC 4BY1B 3C46A 1G2TA 2R7DA 4OHJA 4NMZA 4ZK9B 2XN9C 1R4QB 1ML0D 3LWEA 3AFQA 2ATWA 4U68A 5KEEA 4BBRG 2C9OA 1NR4A 3BZCA 1EOVA 1II3A 4WJ4A 2KECA 3L3OC 3A8JE 1GUSA 2Q2TA 4JC0A 3T51B 3HOXH 3RN5A 3EIVA 1PV4A 1YZ6A 4CDEC 4LNQA 4CKCA 4IUVA 4LFCL 2XRSD 1A2UA 1QILA 2NN6H 4DNIA 3KJPA 1KTKA 1NCVA 4PMBA 5L37A 1DONA 3NSWA 4ME3A 3SR1A 3M85A 3HFZB 1WD0A 1I4XA 5I9PA 5IODA 4P71A 2HQEA 2KEEA 2EVBA 2Q2HA 4HIKA 4KHPL 1PTOH 1MI2A 2WV6D 4K8IA 4DUYQ 2B2VA 4TSSA 4LF7L 4QUCA 5IGEA 2XNAC 1NR2A 1X56A 3LWUA 1STGA 5I6YA 3I91A 2E76C 2OEOA 2JQOA 1VQKA 2QDLA 1K0SA 4XT3B 4G4KA 2LFNA 3TN2A 4TRDA 2OWOA 4X3KA 1WCMH 1QB5D 1W6KA 1EOTA 4C1NK 3OWEB 3QB3A 2EY5A 1I4HA 2QA4A 2F0EA 1X3PA 1JJ2A 1EU3A 4LF8L 3CP0A 1SLJA 1WTHA 5GROA 1QNKA 1XPUA 1K8OA 3MHBA 1EU4A 1ZKOA 3S2HB 4B08A 3VR6A 1KRTA 1WFQA 4RHRA 1YJ9A 4X66L 2DN8A 2TMPA 2RF4A 4G7HC 4KV6A 4OX9L 4DFAA 3U4VA 2E2HB 1XJVA 3IAYA 2C5CA 4A3GH 5JJKA 1HA6A 4RH6A 4DV7L 3K80C 4J6HA 2MO0A 4IZ8A 1HNXQ 3Q6SA 1ILQA 3U9SA 2VQFL 3PIPA 2RCNA 4DKAC 1EWHA 3OTOQ 1XTCD 4DUZL 4GKKL 2O5IC 5C4XG 3K8AA 3SK4A 2N8NA 4NB3A 3PIOA 2J0TD 1GM5A 1A3UA 2Y0SB 1RTOA 4KKTA 4K6DA 2B63G 3DWPA 1L0XB 3K5OA 3PO3B 2XWJB 3AMUA 1BCPB 3RLOA 1CA5A 2F0TA 2R7ZH 1I4GA 3M7NA 1CSQA 1OXTA 3F2DA 2Z1CA 1LTGD 1ENCA 5J39A 3MTSA 1QZHA 1N32Q 1JJGA 3BS1A 2PW7A 1G6ZA 4A93H 5FLXL 4DV6L 1Y1WH 1SROA 3ND9A 2MFIA 4LF4L 2QKIC 2F4IA 5JVH3 1UE1A 1ASZA 2JYOA 1G6PA 3O13A 2D5DA 2EY2A 3FPUB 1X3QA 2ZXPA 3I8ZA 3UE1A 4A3EH 4PG3A 1PYSB 4OO1H 1HQRD 1YIJA 4R8IA 3QR8A 2F0JA 3H3VC 4A3MG 4S3SA 2DNEA 2ZTEA 2PI2A 3D4DA 3BDOA 4LFAL 1IBKQ 1SNDA 2OTLA 1GJXA 1QUQB 4O0AA 2EXDA 5E7NA 3AFPA 5H1SE 1HHVA 4P72A 4Y7NH 1RTNA 2F0IA 2HCIA 4A3JG 2RSNA 3N52A 1UWVA 4L5TA 4IOAA 3RNUA 3HOXB 2HHHQ 3PO2H 4A3IG 1EZ6A 1VQDA 2R6GA 3MXNB 1ZYRD 2PQEA 1PFBA 3WDNA 4JI1Q 1X3EA 4UP9A 3CPFA 2CVRA 2OQ0A 4JI0L 2WFWA 5EPLA 4RGTA 5FOBB 3K59A 1PTOB 3J81L 2L15A 1W2BA 5IP7G 3BDCA 4CDFC 2NB0A 3V96A 4IJHA 2EYLA 1OXVA 1EY9A 4HJ8A 1TQOA 2CQAA 3IL8A 3FVQA 1TWHH 1SYFA 2BDOA 4AYBB 5JJZA 1UE5A 3UDGA 2A6HD 2Q2UA 1DD2A 5FO7B 2XRQD 1FYCA 2Q2IA 5A35A 1TIID 2Y0SE 3R2IA 4DXGA 3S17B 3F2CA 5DM73 1EQQA 3FP9A 4CDCC 1YI2A 4QB4A 2IPKD 4X65L 3A54A 1CI3M 5M5YH 5CR3A 2PYKA 2K05A 2QEXA 3HG9A 4RMFA 4K2KA 1S40A 4CGYB 3K0YA 4DNRB 1TVXA 4RCOA 5IYCH 4JI5Q 1Z7TA 1JQYD 1FL0A 4LJZC 2K04A 1HR0W 2JA5G 1MJEA 1FJGL 1ICFB 4DR4L 4A3GB 5JVG3 4AH6A 1HZCA 3HKZG 4ILWA 3HKSA 4UP8A 1X65A 3NE5B 2L9HA 3RD4A 3R3OA 3NBHA 1Y8OB 4R8NA 3T1HQ 4RCNA 4H44C 1BCPF 2A69C 5IGDA 1CKNA 1WTWA 5M3FH 3UE0A 1EEID 4JOIC 2WAQG 2E8GA 2L5TA 2H4OA 2R7ZB 3TMEA 1KC8C 4DAPA 3ZJYC 1CQFA 2EYOA 4G7ZC 4C2MH 2FFKB 1EIHA 4A93B 3T4AC 5M3MG 1Y1WB 2HUGA 3I4OA 4DA2A 1QZGA 2F0DA 2K52A 3EN2A 4GKJQ 3OTOL 1EWCA 1V9PA 1UUPA 2N55A 5M5WH 2NVXH 1NMFA 2B2TC 4IOCA 2NVYH 1B44D 4A3EB 5C0XJ 4Q5VA 3I4NG 1QG7A 3NTKA 4QIWB 1NJIC 2A5HA 3D0FA 3J7A5 1GUGA 2K33A 2RDHA 1IYJB 5J3BA 1SNPA 4Y52H 1HJPA 4ZKCB 3NQTA 1XNRQ 1HR0Q 3TS2A 3X3MA 4LMQD 3HOUG 3I4LA 4HR7B 3JAML 1S5DD 2NUCA 2ZXRA 5IE8A 1HZ9A 1VQEA 4Y7NB 1B7YB 3S2DH 5JPMC 1O80A 1KAWA 2AWOA 1G2SA 2CWPA 2CCZA 3OW7A 4AIMA 2MPMA 1IW7C 2KJXA 5ELOA 1BBUA 3UDIA 1A0IA 3C2PA 3J80c 2F52A 4X3SA 1PTOF 1IBKL 3HOYH 5IP9G 1UE6A 4ZYSA 1HFNA 4JOIA 2R3ZA 2JA9A 4YIJA 1BCPC 4JBJA 4MHEA 4BBSH 1ESFA 4WJWA 2BCOA 4DK3C 3R2TA 1CSPA 3RR5A 4LUOA 5CV8A 2Z8LA 3S24A 1EQRA 3D31A 1C48A 3L2PA 3Q0AA 2K50A 1TWHB 2B2TA 4KKSA 4EGVA 3TZDA 4IUUA 2IWHA 1F2LA 3OWFA 4EX5A 4GN3B 1JMCA 1A6XA 1RHPA 1NNXA 4OIKA 2KCMA 5IGGA 1AFPA 4DV3L 1VS0A 1JT8A 2E2IB 1EWIA 5COYA 2A68C 2UXDL 1B2TA 4HEDA 5T1IA 1A15A 1MD2D 2QILA 3T53B 1NAPA 2EQSA 1SE2A 4KN7C 4C3JB 1PHJA 1BBWA 2EDGA 3BYYB 2D2CC 3KLRA 2RCFA 4DAYB 4BY7G 4LF9Q 2DUDA 1SNCA 3BDLA 3ULLA 3A56A 3BVZA 1HUMA 2L0CA 1A63A 2EPBA 1DJRD 2VL6A 1VQGA 1HNWQ 4HCEA 1J6QA 4XDXA 1AEXA 2R93G 1SE3A 1G51A 1YITA 4DXFA 2I07B 1HZAA 4KHZA 2XTIA 3TS0A 3R93A 1STEA 3GO5A 3K5MA 3P75A 2MGSA 3KBGA 2K14A 2G5DA 3GQBA 4ULLA 3A74A 3CXCA 5M3FB 4B3RQ 3EJIA 3IFTA 4QUFA 1MJCA 5IT9E 1A62A 5IP7H 5ELCA 2HD3A 1SMYC 4TVAB 4C3IG 4JYAL 3EQLC 1W3SA 3L7ZC 4C2MB 4QF4A 3SK6A 1TY0A 2MJ8A 1ONLA 2OCEA 1AP0A 3I90A 3MXGA 1QUQA 4N8FA 5NUCA 5LL6S 3T1HL 3D6CA 1EEFD 1WTQA 1QOHA 3AB9A 5CBAE 5M5WB 1F9SA 2NVXB 1C4QA 1MIUA 2N49A 2NVYB 3CAMA 3X3NA 3J7AF 4DK0A 1KAAA 4XIGS 2EJGC 1JB7A 2NTTA 3IFDA 1VCIA 3A8IE 4XT1B 1UEBA 3MXNA 2IT1A 1WTOA 4DN4M 4CJ1B 3AEVA 5C6AA 1CTMA 4NW2A 2JA8G 5KYLA 1XNQQ 3CRKC 2F3WA 2JA5H 3S2DB 1NUCA 1XMOQ 1P16A 4BS9A 4A3DH 1JE4A 3TQYA 3FPPA 1X9NA 3M9BA 2G9DA 2B8FA 1YJNA 4POFA 3KOJA 2DJGC 3B6YA 5C0XI 3HOYB 2GA4B 1WD1A 1P8LA 2UUBL 4U673 1XNRL 5D14A 1EUJA 5D3IB 4EQ5A 2ID0A 2IX0A 2HT1A 4BBSB 2L12A 4YY3Q 1V1PB 2EY6A 4EQPA 1DYQA 4NXNL 3M4PA 3K5NA 3G7LA 3CCUA 5C3EH 5FJ8H 3I2ZA 4I65A 4JW0A 1STBA 1JORA 1GXDC 4DR5Q 3DXJC 2PW5A 4JI2Q 3RZDB 3F2UA 1B3QA 4PQXA 2FMMA 1JE5A 1VQNA 3FKIG 2KBNA 1XPRA 5M3MH 3HOVH 2A69D 4A3FH 4ZKBB 1SJHD 4A3LG 3JAMc 1LT3D 2D0OA 3NBIA 4FF1A 1U4MA 2KENA 3PCOB 5C4JH 1KXLA 2DJFC 3U50C 1YNJC 2ZXOA 4OIJA 2E5LQ 1IYUA 4M8AA 4FF3A 4FO2A 2KHSA 2A1AA 5FLMG 5IGFA 4DAMA 4DR3Q 1CKOA 1SYEA 1Q86C 1D5ZC 3VR5A 5IGBA 2M2LA 4UP7A 2B8GA 2BH8A 4J15A 4JI6Q 2VUMH 3TDQA 3MXPA 1LV9A 4V0BA 1J9OA 1PLFA 2EYPA 3NTHA 3QOLA 1HH2P 5EQ0A 5C5LA 2UU9Q 2NYZD 3FHWA 3HOWH 3NENA 4IO9A 2WB1B 1RD9D 1GUNA 4R4TA 1EL0A 4LFBQ 4FYDA 1C0AA 1F9QA 5IWAL 4HAEA 4A3CG 1RF2D 3D4WA 4F87A 1Z9FA 3T56B 3NPPA 4K14A 4BXXH 4IUPA 3DLLA 3I55A 4DR6Q 1B4OA 1E3PA 3J80i 1U5KA 2CWAA 2BH2A 5T1GA 1S3OA 1JOOA 4LF9L 4IFDH 5CMDA 4L5QA 4KKUA 1VQ4A 1IW7D 2YTVA 1I3QH 1HNWL 3H0GG 2EJFC 1C8CA 2KCCA 1LTTD 4IPHA 3K0XA 4JV5L 2KCNA 1PH8A 3KFUA 1BCPD 1Q8IA 2RVLA 1Q3LA 5BN4A 3I4MB 4H0LC 5K36G 2VQEL 2AQ3B 2P5ZX 2QGQA 1Q46A 3IKJA 3OW2A 3KBXA 2JE6I 5ISRA 1TWAH 5G3LF 1C9OA 1E24A 2JA7G 4C3HH 2VS1A 3OSOA 4ZCKA 5DEHA 4KY5A 1T5EA 2RHQB 4FXGC 3W3AA 3HOZH 4X3UA 4QCLA 3J81j 4A3DB 1MKHA 2FXQA 1VQ9A 2Z4IA 2A68D 2N78A 3V05A 1WTRA 3KF8B 2HQLA 2BA0A 5EPKA 2VB2X 3OPOA 2JEBI 2BE5C 3TBIB 3UDXA 1I4PA 1Q12A 1YHAA 3CW2C 1SYDA 4POGA 1SE4A 1S72A 4KK7A 5E4XA 1OO9B 1BVSA 1TWFB 1S4ZA 1Y8NB 2CKZB 2PNRC 1Y1VH 2BA1A 2WB1E 2ZTCA 3ERSX 2Q8TA 1B70B 3PV0A 2N88A 5C44G 1XNQL 2SNSA 1XMOL 3KLWA 5C3EB 2VB3X 4OEMB 1WTVA 1E2ZA 1EY4A 2B2WC 2EYHA 2F0HA 4RGNA 5C0XG 4HIDA 1FGUA 1V1QA 3SGIA 2B2UC 1U4LA 3HOVB 4A3FB 1HTPA 4B3ML 1HUNA 2L11A 4IJLA 4A3KG 3A7AB 1STNA 2ZT9C 1STYA 2EXZA 3AQQA 4DAYA 3BYTB 2I5LX 1SNMA 1TT2A 5JPNC 1X54A 2JA6H 2MP1A 1SMYD 1EY0A 2MO1A 4KJNA 2HIXA 5I9OA 4DR5L 2VUMB 2AUKA 4OXPA 3J7YW 2LMCB 3GP7A 4HSVA 4B9WA 4DF7A 1UNSA 1B8AA 2OXPA 4RGMA 3HOWB 4HIMA 2YYZA 2K03A 3T1YQ 1ILPA 4MNOA 3GTLH 2F0WA 2QW7A 1JJCB 2E5LL 2A6EC 3CHBD 1NY4A 1U0LA 4DR3L 1I5FA 3OMCA 3STBC 4ZRZA 1D5XC 1GVPA 4MIUA 1KDCA 2R92G 1KD1C 4LF5Q 4JBWA 2OT2A 5ELFA 2B2WA 2UU9L 1N33L 1IL2A 1SBBB 3V2TA 4ZLTF 2GN5A 1PFMA 3NWTA 2PCFB 3KLSX 3PUVA 4TQUS 5HY6A 4FF2A 1HPCA 2B2UA 2CHBD 4B9XA 4BA1I 4LFBL 4DR2L 3K58A 2F0LA 1GUOA 3SXHA 1I94L 1YNNC 1IKMA 2SOBA 5E3FA 3IRBA 2F3IA 4IUTA 5LMNQ 4RWSC 1PFSA 3DM3A 5FO9B 3BVMA 5CV5A 1VQPA 4FVMA 4F7XA 3JC66 4A3BG 2WAQE 1LO5D 1H9JA 3NUCA 4BY1G 5GAEC 2OF1A 5J1ZA 2C35B 1E0BA 3HS0C 1EY8A 1QVCA 2PQAB 2NN6I 1TWAB 4XQQA 1NE3A 2K32A 4LW1A 5ELDA 2Q8RE 2K5DA 4C3HB 3VYTA 2RA4A 2NVTH 2K7VA 1PFNA 3S15H 1G291 1WCMB 4UHVA 2AMCB 1VQLA 4CJ2C 3HOZB 1LABA 1I6VC 1YNJD 4R4QA 2CW0C 1EY5A 1V1PA 5CGKA 1QVGA 1G91A 1DOMA 3C1FA 2EE1A 3CU7A 3CD6A 4DUYL 2E2JH 3GTMH 2QDBA 3E0EA 4GZYC 1FR3A 1W6JA 3ICEA 1TY2A 3VYRA 1EQTA 3W1GA 3M7GA 1Y1VB 2ENBA 3CCEA 4BBRH 3DMUA 1XTDA 3SE0A 4GN5A 3A7LA 3MFYA 3CKIB 1SNQA 3CCLA 4JI4Q 3PF4A 3ULPA 5GQOA 4HJ7A 2R7FA 4UPAA 2M9VA 3VA5A 1TWGH 3G6JB 3WWVA 3SVMA 4JI8Q 3A5ZB 2XWBB 3H0GH 1MSHA 3KJOA 2RSOA 3PF5A 4O1NA 2YU9H 3TZUA 1EIGA 2A8VA 4FXDA 4YHHQ 5C5MA 1PZKD 3GTGH 2CFMA 4APVA 1GUTA 1NBWA 4KI0A 4NP5A 2JA6B 2ZJQA 1TS4A 1KDBA 1IYVA 1V8QA 1HTLD 5JEAG 3WOEA 3K6OA 1KQSA 1YNXA 5CYUA 1HNXL 4HCSA 1PH5A 1A3VA 1KHIA 2CH4W 2VZAA 1KDAA 2LSSA 3VYSA 4R4CA 2HDLA 4P74A 4O2DA 5GAGC 4DV0Q 1JCKB 3GTLB 2YTYA 1D5MC 4J1MA 1F9PA 2AKWB 1QJOA 1VQBA 2IW3A 4NDXA 1A3TA 3E9HA 1RIPA 4MZ9A 4UAIA 2IY5B 2TSSA 3PMFA 1N32L 1GOZA 2I46A 2K5HA 3H91A 2X6LA 1PRTB 2Y0SG 2QCPX 4PZ8A 3T1YL 1A2TA 4YCWA 3PO3G 4OO1I 2BE5D 1L1OB 3PO2B 1NSNS 2YV5A 4DR7Q 1HXYD 1K73C 2V1CC 5IY0A 2F1MA 1WI5A 2QEJC 5IOCA 4WORA 4YCVA 5I6WA 4ZQ3A 4I7AA 4WJ3M 5FLXc 2VY3A 3GDEA 1SRUA 1EFWA 4LUVA 4CDDC 1PVOA 1VQFA 2PO4A 3LNNA 5C4XH 3TP6A 5IYBG 2EOTA 1LT4D 2WINB 3S1NH 3BJUA 1SDFA 2B2YC 2UXCQ 3QJYA 2B63H 1HNZQ 3MEFA 3G71A 4DNTB 3F1ZA 1SR3A 3KF8A 3TRZA 2HHHL 1G8ZD 2IHFA 1DM0B 1CZWA 3N6RA 5EPJA 4JI1L 4QY7A 3H3VH 2JSOA 3F8TA 1EY7A 3TP5A 1N34Q 3OIQA 1BBXC 2NVTB 1H95A 1QNUA 1MHWC 4P2CB 2K5QA 4K0KQ 1M4VA 2K5NA 2ZTDA 1LLRD 4IN3A 3HOXG 3VR4A 1XWEA 2FHTA 3GTMB 2E2JB 2WP8J 2K75A 4ABNA 4X3TA 1BQQT 3OYYA 4FDBA 1FNVA 2NN6G 4A3MH 4FF4A 3GTJH 2O5JC 2AWNA 5M5YB 4B3TQ 5G3LD 1EIYB 1R9TH 1NMGA 1LTBD 1X3GA 4JVZA 1VQIA 3BU2A 4LF6Q 4BBRB 4A3JH 3J81c 3MXUA 1PH7A 1UAPA 2A6ED 4YCUA 3C1EA 2WACA 4LUZA 5K5PA 1PH1A 1D1IA 4A3IH 3STBD 1B3AA 1DOLA 1TWGB 2KVMA 4K5XA 5FK9C 3NHHA 4AYBG 1F2ZA 2B2YA 1I50H 2PMZB 3UI2A 3CMAA 2YU9B 1PTOC 1Y69U 3H09A 2J7ZA 4FXKC 3I7FA 3OMGA 2N3SA 4Q0FA 4L63B 1KLUD 3GTGB 1UEAB 2K5WA 4JPBW 1AN8A 4JI5L 1IL8A 2J4XA 1PXUA 5GADC 5LL6X 5CC4A 3S16H 4A3BH 3CCVA 4JI4L 4KLKA 1YNND 4HJAA 1EFID 4LFCQ 4ME5A 1D1KA 3FMCA 1MBYA 5HGQA 2LXJA 3BZDB 2KA7A 3VA7A 1X32A 4KHPQ 4YHHL 1M1KC 4JBMA 3RN2A 3NP8A 2K5VA 5A2QE 4A3GG 1K3RA 4MTKA 3DHQA 3M4OH 1O7ZA 1Q1BA 4ZAIA 1PRTF 4GS3A 3URYA 5C3XA 1WOCA 2F0GA 2AUJD 2AQ2B 4YWKA 1JB3A 1JC7A 1SAPA 2K28A 2F0QA 3Q22A 1RDPD 4GKJL 3Q24A 4QGUA 2CW0D 4PMCA 3E3XA 4X64Q 4R4OA 2B29A 3S9WA 1IBLQ 4KD4A 2R7ZG 3A0JA 4XYQA 1EYGA 5FO8B 2MQHA 4DV1Q 3D6WA 2SNMA 4A93G 1STHA 1LTSD 4X66Q 2WIIB 2VW9A 1Y1WG 2ASBA 1UE7A 2K4KA 3FRPB 4NKLA 1S5BD 2PQAA 5AJ3Q 3I73A 1HR0L 1AZQA 3L0OA 5I2XA 3H15A 1F9RA 1M90C 4EQNA 5C4XB 2I5MX 2HCCA 3S1NB 3M4YA 4A3EG 4B3SQ 1VMCA 3FEWX 2B63B 4OO1G 2UXBQ 1EZ8A 2I5HA 4IPCA 3W2DA 2A19A 4K5VA 2PNHA 3ZYYX 3M3YH 1X3FA 2PMZE 1BF4A 1BUVT 5D65A 3SDZA 2G9HD 1JICA 1N9WA 3S14H 2RHSB 3NQIA 4HSPA 3VDYA 1T9HA 1TS2A 1PZJD 1PH6A 4RKLA 3CC2A 3EA6A 1LYLA 1DGSA 2CQOA 1FD7D 4I7ZC 1HNZL 1VDZA 4DR1Q 1KNEA 3I4NH 4A3MB 4PV1C 3GTJB 1O7IA 1I4RA 1PRTC 4IUQA 1E1TA 1R9TB 4IALA 2KUMA 1PH9A 2O2LD 2F0KA 1QVFA 1FGBD 3HOUH 3KLSA 1AW7A 1L1OC 2EYFA 2XVSA 4A3JB 1ZXTA 1VQ7A 4RGOS 4K0KL 1YBYA 2WKCA 1J5EQ 3G4SA 2PI2E 1LT5D 3J80E 1VF7A 1VQ5A 5IGCA 1LTID 3A55A 1CQVA 4LFAQ 4A3IB 1EIFA 5FLXE 3K57A 4XTCS 1VQJA 4DV4Q 5CV4A 5JOBA 1Q8KA 5BR8Q 1I50B 3Q23A 1RODA 4IFDJ 5IP9H 2AHOB 1E7ZA 1VQAA 2MHVA 4JI7Q 1E1OA 4LF6L 2Z0SA 2K1BA 2F0SA 1B1ZA 2MNAA 5IYBH 2EY1A 4RKBA 1BDOA 4FNFA 2XIWA 5IIFA 3K7AH 3A8KE 2X69A 2Z6BA 3TEHB 1YVCA 5IT9L 3J7AV 1JWSD 3S1RH 1OXXK 2NWGA 4C3JG 1TWCH 4LAAA 4JI3Q 4HIOA 1EYAA 4JI0Q 3I72A 1CUKA 1ZEQX 5C4ZA 5IYCG 4N9PA 5EJWA 5CV7A 1ASYA 1B50A 2F0PA 1KL9A 4XYOA 3LGJA 5CBEE 4B3RL 1A8VA 3KK7A 4AQYQ 5A2QL 3M4OB 4RA8A 3ER0A 3L9AX 3VR3A 5ELEA 2IX1A 3LX0A 1Q81C 1L1OA 1STAA 3EBEA
chains in the Genus database with same CATH topology
1ET6A 3MEHA 4RHSA 2L4NA 3J81E 2LY7A 5JAVA 2JA5B 1TS3A 1EYDA 5CV6A 5C4HA 4ID6A 2F0MA 3HKZB 4PNYA 1HA5A 1Y8PB 3QOJA 1HQMC 1L0YB 4KY6A 3GV3A 3HZXA 1S5CD 2R61A 2RDGA 3CRLC 4V190 1KNAA 2KQ3A 4J8QA 1EQVA 3AU7A 1ICWA 1U9RA 2XSCA 3RLFA 2WAQB 2JXMB 1WVLA 3P1HA 3M3YB 1PTOD 5DAUA 4RFBA 5EKKA 4OL7A 5M3MB 1F2MA 5CORA 5D3DA 4KN4C 3S14B 2JEAI 3ONAB 5C4JB 2LS01 1PZID 3NXWA 1H9RA 1JR0D 5EKLA 3SHLA 3R8BA 1Q90A 4F8MA 4L8JA 3DWAA 3I4NB 4EVOA 1M8AA 1R4PB 2H1EA 3MA2B 4L6TB 1IHZA 3OHXC 5DM63 3C3LA 3HOUB 2A74C 3DEOA 1E2WA 3NTIA 1SEBD 3PUYA 2FJ2A 4ZUIA 2SDFA 3OIPA 3J80L 1DXMA 3SK8A 1KLGD 3QIAA 3D8GA 2PZUA 1MGSA 3DWQA 4BA2I 1TKWB 3TSSA 5DNFA 1Z47A 4G57A 4TKOB 1K8MA 1B53A 1Q1EA 4WFN3 3D4RA 1KABA 3K7AB 2F0UA 2MUYA 2D9UA 3QO2A 1I3QB 2ICEC 3GD7A 3S1RB 1D2BA 1TWCB 5M9OA 1V1OA 2WKDA 3JAME 5KRUA 3MC0B 3TP7A 2B39A 1O78A 4HTHA 4IFDI 1VF5C 4C1NI 1CT1D 1OXUA 4Z9CB 1EY6A 4CKEA 5TSSA 5EBDA 1BO0A 1O7LA 3RZOB 3PUWA 1WTPA 2PZWA 2A73B 5KNBA 5EBCA 4BY7B 4OGQC 2KEDA 3BVGA 2FMCA 5I4DA 5KIXA 2K6AA 4H13C 5E4WC 4XQJA 4FP5D 3OOCA 3P20A 1PRTD 2R93B 2M00A 5HGTA 1ESRA 4KJOA 3EFXD 4WRDA 1MSGA 1O7YA 4QMGA 3MFGA 5I2YA 2BOSA 4C3IB 3QWNA 1RJTA 3MWYW 1BXTA 4DU9A 1T5XD 1GHKA 3VR2A 1CM9A 3BG3A 1J8IA 1H9SB 2K01A 4CKBA 4DGZA 1SYGA 1HRJA 5K36H 2RQXA 1PMRA 3MVVA 3HRZC 2DNCA 1S5ED 2NVQB 1SXTA 4LK1C 1EYCA 1SSOA 3CQZB 2JA8B 4RAUC 1XYIA 2Q8IB 3T16A 3VYUA 2DY8A 3H94A 2F0OA 1H9MA 4XXEA 1CA6A 5EGTA 4C56C 3S1QB 2IX3A 3HP3A 1FNUA 4ODGA 3WOFA 1SYCA 1BNZA 3E5SA 2ICIA 3P7JA 1RKNA 2PZTA 2RDFA 4O42A 1BR9A 1SNOA 2KOLA 1F2YA 4UDUC 3GTOB 4DAVA 5C0XH 3FKIB 4K6LA 5KGUA 3E0JA 5F2DA 5KNDA 2F3VA 5HURA 2AQ1B 1LT6D 1CFMA 4KMUC 5BN3A 4CHTB 3GTQB 2FINB 2LKVA 2L1BA 3S1MB 3ND8A 3S15B 4IFDG 3I70A 1BOSA 2RKSA 2PPBC 1ET9A 1XXGA 1PYWD 4HN7A 2E74C 4KD3A 2NBFA 1QE6A 2SEBD 3MZ5A 1CHQD 5ELBA 1H9KA 3RMHA 1JOKA 1GUWA 3K5LA 4KTAA 1CZGA 3HEJA 1V43A 2HDMA 4G7OC 2BDNA 2QF7A 3H0GB 4C3HG 1JWUD 2F0FA 2O4XA 3EROA 1OXSC 3NK9A 3ERQA 1QCBD 1IKLA 1LACA 4K8JA 4E6IA 4F88A 1HCZA 1VMPA 4M1UB 2EYMA 4H7BA 1JWMD 4BWGB 3FDTA 1RCVD 1F77A 2JA7B 3GTKB 3NWSA 3DEPA 5C3WA 2F0NA 5LHY1 2IJ0A 5E1FA 3PUXA 1LTAD 1CK1A 1D6EC 1Z6HA 3SK5A 1QWYA 1S5FD 4IQZA 3SEBA 1SYBA 4JK1C 4DK1A 4EQOA 3D3RA 2IL8A 1E2VA 1K83B 2JP1A 3H6MA 2VXWA 2EZVA 4K2LA 4IUNA 5C44B 1AZPA 1TU2B 3ITPA 5BN5A 1I6HB 2Z4HA 1FNWA 3PIP3 4A3KB 5JEAJ 3GTPB 4MN3A 3RUZA 2NTSA 3E6ZX 3PUZA 5J22A 4KY7A 4ZUJA 5AFWA 3PIO3 2E75C 2L55A 5JEAH 1PDQA 1WTXA 5CV9A 1ZYRC 5M5XB 2F03A 3EVQA 5KNCA 1JOQA 1ENFA 3U9OA 1I4QA 4CBVA 4IURA 3MAQA 3DM1A 2EYJA 1XX8A 4XQNA 2X6GA 2NZ1D 1ENAA 2F0VA 1LTRD 1U4PA 3KUPA 4K5WA 1DZ1A 1CHPD 1HFGA 5EKIA 3HGBA 1B9MA 3DUZA 2R92B 3QG1A 4R9WA 2A6HC 2D62A 3GV6A 2EJMA 3I3CA 1SJED 1H9SA 2VNUD 1SFOB 4KHVA 3T13A 1U4RA 4HMIA 4PMWA 2RBMA 5KYIA 2B2VC 1DCZA 1DOKA 3TP8A 2V4DA 2DY7A 4HMJA 1TR5A 1GHJA 1B9NA 1TS5A 5FKAC 4N9TA 3S16B 4A3BB 4CJ0B 2E2DC 4BY1B 3C46A 1G2TA 4OHJA 4NMZA 4ZK9B 2XN9C 1R4QB 1ML0D 3LWEA 4U68A 5KEEA 2C9OA 1NR4A 1II3A 2KECA 3L3OC 3A8JE 1GUSA 3T51B 4CKCA 4IUVA 2XRSD 1A2UA 1QILA 2NN6H 1DONA 1KTKA 1NCVA 4PMBA 3NSWA 3SR1A 3M85A 1WD0A 1I4XA 5I9PA 5IODA 2HQEA 2KEEA 2EVBA 1PTOH 1MI2A 2WV6D 4K8IA 2B2VA 4TSSA 4QUCA 5IGEA 2XNAC 1NR2A 3LWUA 1STGA 5I6YA 3I91A 2E76C 2OEOA 4XT3B 4G4KA 2LFNA 3TN2A 4TRDA 4X3KA 1QB5D 1W6KA 1EOTA 4C1NK 3OWEB 3QB3A 2EY5A 1I4HA 2F0EA 1X3PA 1EU3A 1QNKA 1K8OA 3MHBA 1EU4A 1ZKOA 3S2HB 4B08A 3VR6A 4RHRA 2DN8A 2TMPA 4G7HC 4KV6A 4DFAA 2E2HB 3IAYA 2C5CA 1HA6A 4RH6A 4J6HA 4IZ8A 3Q6SA 1ILQA 3U9SA 1EWHA 1XTCD 2O5IC 3SK4A 2J0TD 1A3UA 2Y0SB 1RTOA 4KKTA 4K6DA 3DWPA 1L0XB 3K5OA 3PO3B 2XWJB 3AMUA 1BCPB 1CA5A 2F0TA 1I4GA 3M7NA 1OXTA 2Z1CA 1LTGD 1ENCA 5J39A 3MTSA 3BS1A 2PW7A 1G6ZA 5FLXL 3ND9A 2QKIC 2F4IA 5JVH3 2JYOA 3O13A 2D5DA 2EY2A 3FPUB 1X3QA 2ZXPA 3I8ZA 4OO1H 1HQRD 4R8IA 2F0JA 3H3VC 4S3SA 2DNEA 3D4DA 3BDOA 1SNDA 1GJXA 1HHVA 1RTNA 2F0IA 2HCIA 2RSNA 3N52A 3HOXB 1EZ6A 2R6GA 1ZYRD 2PQEA 1PFBA 3WDNA 2CVRA 5EPLA 4RGTA 5FOBB 3K59A 1PTOB 3J81L 3BDCA 2NB0A 3V96A 2EYLA 1OXVA 1EY9A 1TQOA 2CQAA 3IL8A 3FVQA 1SYFA 2BDOA 4AYBB 5JJZA 2A6HD 1DD2A 5FO7B 2XRQD 1FYCA 5A35A 1TIID 3R2IA 4DXGA 3S17B 5DM73 4QB4A 2IPKD 3A54A 1CI3M 5CR3A 2PYKA 2K05A 3HG9A 4K2KA 4CGYB 3K0YA 4DNRB 1TVXA 4RCOA 1Z7TA 1JQYD 4LJZC 2K04A 4A3GB 5JVG3 4ILWA 3NE5B 2L9HA 3RD4A 3R3OA 3NBHA 1Y8OB 4R8NA 4RCNA 4H44C 1BCPF 2A69C 5IGDA 1WTWA 1EEID 2L5TA 2H4OA 2R7ZB 3TMEA 4DAPA 1CQFA 2EYOA 4G7ZC 2FFKB 1EIHA 4A93B 3T4AC 1Y1WB 2HUGA 4DA2A 2F0DA 1EWCA 1UUPA 2N55A 2B2TC 1B44D 4A3EB 5C0XJ 4Q5VA 1QG7A 3NTKA 4QIWB 2A5HA 1GUGA 2K33A 2RDHA 1SNPA 4ZKCB 3NQTA 3X3MA 4LMQD 3I4LA 4HR7B 3JAML 1S5DD 2NUCA 2ZXRA 4Y7NB 5JPMC 1O80A 2AWOA 1G2SA 3OW7A 2MPMA 1IW7C 2KJXA 3C2PA 4X3SA 1PTOF 4ZYSA 1HFNA 2R3ZA 4YIJA 1BCPC 4MHEA 1ESFA 4WJWA 2BCOA 3R2TA 5CV8A 2Z8LA 3D31A 1C48A 3Q0AA 1TWHB 2B2TA 4KKSA 4EGVA 3TZDA 4IUUA 2IWHA 1F2LA 3OWFA 1A6XA 1RHPA 4OIKA 5IGGA 1AFPA 2E2IB 5COYA 2A68C 1B2TA 4HEDA 5T1IA 1A15A 1MD2D 2QILA 3T53B 1NAPA 1SE2A 4KN7C 4C3JB 2EDGA 3BYYB 2D2CC 3KLRA 1SNCA 3BDLA 3A56A 3BVZA 1HUMA 2L0CA 2EPBA 1DJRD 4HCEA 4XDXA 1AEXA 1SE3A 4DXFA 2I07B 4KHZA 3R93A 1STEA 3GO5A 3K5MA 3P75A 2MGSA 3KBGA 3GQBA 4ULLA 5M3FB 3EJIA 3IFTA 4QUFA 5IT9E 5ELCA 1SMYC 4C3IG 3EQLC 3L7ZC 4C2MB 4QF4A 3SK6A 1TY0A 2MJ8A 1ONLA 1AP0A 3I90A 3MXGA 5NUCA 5LL6S 3D6CA 1EEFD 1WTQA 1QOHA 3AB9A 5CBAE 5M5WB 1F9SA 2NVXB 1C4QA 2NVYB 3X3NA 3J7AF 4DK0A 1KAAA 4XIGS 2EJGC 2NTTA 3IFDA 1VCIA 3A8IE 4XT1B 3MXNA 2IT1A 1WTOA 4DN4M 4CJ1B 5C6AA 1CTMA 4NW2A 5KYLA 3CRKC 2F3WA 3S2DB 1NUCA 4BS9A 1JE4A 3FPPA 2G9DA 2B8FA 5C0XI 3HOYB 2GA4B 1WD1A 4U673 5D14A 5D3IB 2ID0A 2IX0A 4BBSB 2L12A 1V1PB 2EY6A 4EQPA 1DYQA 3K5NA 3G7LA 4I65A 1JORA 1STBA 1GXDC 3DXJC 2PW5A 3RZDB 3F2UA 4PQXA 2FMMA 2A69D 4ZKBB 1SJHD 1LT3D 3NBIA 4FF1A 1U4MA 1YNJC 2ZXOA 4OIJA 1IYUA 4M8AA 4FF3A 4FO2A 2KHSA 5IGFA 1SYEA 1D5ZC 3VR5A 5IGBA 2M2LA 2B8GA 3TDQA 3MXPA 4V0BA 1LV9A 1J9OA 1PLFA 2EYPA 3NTHA 3QOLA 5EQ0A 5C5LA 2NYZD 2WB1B 1RD9D 1GUNA 1EL0A 4FYDA 1F9QA 4HAEA 1RF2D 3D4WA 4F87A 3T56B 3NPPA 4K14A 4IUPA 1B4OA 5T1GA 1JOOA 4IFDH 5CMDA 4KKUA 1IW7D 2EJFC 1C8CA 2KCCA 1LTTD 2KCNA 1BCPD 1Q8IA 2RVLA 1Q3LA 5BN4A 3I4MB 4H0LC 5K36G 2AQ3B 3IKJA 3KBXA 2JE6I 5ISRA 5G3LF 3OSOA 5DEHA 4KY5A 1T5EA 4FXGC 3W3AA 4X3UA 4QCLA 4A3DB 2Z4IA 2A68D 3V05A 1WTRA 2BA0A 5EPKA 2VB2X 3OPOA 2JEBI 2BE5C 3TBIB 1I4PA 1Q12A 1SYDA 1SE4A 4KK7A 5E4XA 1OO9B 1TWFB 1S4ZA 1Y8NB 2PNRC 2BA1A 2Q8TA 3PV0A 2N88A 2SNSA 5C3EB 2VB3X 1WTVA 1E2ZA 1EY4A 2B2WC 2EYHA 2F0HA 4RGNA 5C0XG 2B2UC 1U4LA 3HOVB 4A3FB 1HTPA 1HUNA 2L11A 3A7AB 1STNA 2ZT9C 1STYA 2EXZA 4DAYA 3BYTB 1SNMA 1TT2A 5JPNC 2MP1A 1SMYD 1EY0A 4KJNA 5I9OA 2VUMB 2AUKA 3J7YW 2LMCB 3GP7A 4HSVA 4B9WA 4DF7A 1UNSA 4RGMA 2OXPA 3HOWB 2YYZA 2K03A 1ILPA 2F0WA 2A6EC 3CHBD 3OMCA 4ZRZA 1D5XC 4MIUA 1KDCA 4JBWA 2OT2A 5ELFA 2B2WA 1SBBB 3V2TA 4ZLTF 1PFMA 3NWTA 2PCFB 3KLSX 3PUVA 4TQUS 4FF2A 1HPCA 2B2UA 2CHBD 4B9XA 4BA1I 3K58A 2F0LA 1GUOA 3SXHA 1YNNC 1IKMA 2SOBA 5E3FA 4IUTA 4RWSC 5FO9B 3BVMA 5CV5A 4FVMA 4F7XA 1LO5D 1H9JA 3NUCA 2OF1A 5J1ZA 1E0BA 3HS0C 1EY8A 4XQQA 2NN6I 1TWAB 2K32A 5ELDA 2Q8RE 2K5DA 4C3HB 3VYTA 2RA4A 2K7VA 1PFNA 1G291 1WCMB 4CJ2C 3HOZB 1LABA 1I6VC 1YNJD 2CW0C 1EY5A 1V1PA 5CGKA 1G91A 1DOMA 3C1FA 2EE1A 3CU7A 2QDBA 4GZYC 1FR3A 1W6JA 1TY2A 3VYRA 1EQTA 3M7GA 1Y1VB 2ENBA 3DMUA 3SE0A 3A7LA 3MFYA 3CKIB 1SNQA 2M9VA 3VA5A 3G6JB 3SVMA 2XWBB 1MSHA 2RSOA 4O1NA 3TZUA 1EIGA 4FXDA 5C5MA 1PZKD 1GUTA 4KI0A 2JA6B 4NP5A 1IYVA 1TS4A 1KDBA 1V8QA 1HTLD 5JEAG 3WOEA 3K6OA 5CYUA 4HCSA 1A3VA 1KDAA 3VYSA 2HDLA 1JCKB 3GTLB 1D5MC 4J1MA 1F9PA 1QJOA 2IW3A 4NDXA 1A3TA 4UAIA 2TSSA 3PMFA 1GOZA 2I46A 3H91A 2X6LA 1PRTB 2QCPX 1A2TA 4OO1I 2BE5D 3PO2B 1NSNS 1HXYD 2F1MA 2QEJC 5IOCA 4WORA 5I6WA 4ZQ3A 2PO4A 3LNNA 3TP6A 2EOTA 1LT4D 2WINB 1SDFA 2B2YC 3QJYA 4DNTB 3KF8A 1G8ZD 1DM0B 1CZWA 3N6RA 5EPJA 2JSOA 1EY7A 3TP5A 2NVTB 3OIQA 1BBXC 1QNUA 4P2CB 2K5QA 1M4VA 1LLRD 4IN3A 3VR4A 1XWEA 2FHTA 3GTMB 2E2JB 2WP8J 4ABNA 4X3TA 1BQQT 1FNVA 2NN6G 5M5YB 4FF4A 2O5JC 2AWNA 5G3LD 1LTBD 4BBRB 3MXUA 1UAPA 2A6ED 3C1EA 2WACA 5K5PA 1D1IA 1B3AA 1DOLA 1TWGB 2KVMA 4K5XA 5FK9C 3NHHA 1F2ZA 2B2YA 2PMZB 3UI2A 2YU9B 1PTOC 1Y69U 3H09A 2J7ZA 4FXKC 3OMGA 4Q0FA 4L63B 1KLUD 3GTGB 1UEAB 2K5WA 1AN8A 1IL8A 2J4XA 1PXUA 5LL6X 5CC4A 1YNND 1EFID 4ME5A 1D1KA 3FMCA 1MBYA 3BZDB 2KA7A 3VA7A 1X32A 3NP8A 5A2QE 3DHQA 1O7ZA 1Q1BA 4ZAIA 1PRTF 3URYA 5C3XA 2F0GA 2AUJD 2AQ2B 1JB3A 1JC7A 1SAPA 2K28A 2F0QA 3Q22A 1RDPD 3Q24A 2CW0D 4PMCA 3S9WA 4KD4A 4XYQA 5FO8B 3D6WA 2SNMA 1STHA 1LTSD 2WIIB 3FRPB 4NKLA 1S5BD 3I73A 1AZQA 5I2XA 1F9RA 4EQNA 5C4XB 2HCCA 3S1NB 3M4YA 1VMCA 3FEWX 2B63B 4OO1G 1EZ8A 3W2DA 4K5VA 3ZYYX 1BF4A 1BUVT 5D65A 3SDZA 2G9HD 1JICA 3NQIA 4HSPA 1TS2A 1PZJD 4RKLA 3EA6A 1FD7D 4I7ZC 1VDZA 1KNEA 4A3MB 4PV1C 3GTJB 1I4RA 1PRTC 4IUQA 1R9TB 4IALA 2KUMA 2O2LD 2F0KA 1FGBD 3KLSA 1AW7A 2EYFA 2XVSA 4A3JB 1ZXTA 4RGOS 2WKCA 1LT5D 3J80E 1VF7A 5IGCA 1LTID 3A55A 1CQVA 4A3IB 5FLXE 3K57A 4XTCS 5CV4A 5JOBA 1I50B 3Q23A 1RODA 4IFDJ 2MHVA 2K1BA 2F0SA 1B1ZA 2EY1A 4RKBA 1BDOA 4FNFA 2XIWA 5IIFA 3A8KE 2X69A 5IT9L 3J7AV 1JWSD 1OXXK 2NWGA 4C3JG 4LAAA 1EYAA 3I72A 1ZEQX 5C4ZA 4N9PA 5EJWA 5CV7A 1B50A 2F0PA 4XYOA 5CBEE 3KK7A 5A2QL 3M4OB 4RA8A 3L9AX 3VR3A 5ELEA 2IX1A 3LX0A 1STAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV5 A;  4K5V A;  4G57 A;  3C1E A;  2WAC A;  3MEH A;  5K5P A;  2RKS A;  4DGZ A;  4J1M A;  1SYG A;  3MXP A;  1A3T A;  4NDX A;  4QF4 A;  3SK6 A;  2EYP A;  3SK4 A;  3QOL A;  4F7X A;  5KEE A;  5C5L A;  1KAB A;  4K5X A;  1A3U A;  3NHH A;  1F2Z A;  3NUC A;  4K6D A;  4KD3 A;  4QB4 A;  5NUC A;  1II3 A;  2F0U A;  2OF1 A;  5J1Z A;  2SNS A;  5JAV A;  3D6C A;  3PMF A;  1EYD A;  3OMG A;  5CR3 A;  5CV6 A;  2F0T A;  3MVV A;  2PYK A;  5C4H A;  4ID6 A;  2F0M A;  3RUZ A;  4RKL A;  1EY4 A;  1EY8 A;  4K2K A;  4PNY A;  4YIJ A;  1ENC A;  3QOJ A;  4KY7 A;  4ZUJ A;  5M9O A;  5J22 A;  3D4W A;  2PW7 A;  2EYH A;  2F0H A;  3MZ5 A;  4KY6 A;  1JOK A;  1EYC A;  5CC4 A;  5KRU A;  4K14 A;  3HZX A;  1KAA A;  3TP7 A;  1A2U A;  1A2T A;  2KQ3 A;  4PMB A;  5CV9 A;  4KTA A;  5CV8 A;  4ME5 A;  1EQV A;  1STN A;  2EY2 A;  3HEJ A;  4HTH A;  4IAL A;  1STY A;  2EXZ A;  3SR1 A;  1NSN S;  3T16 A;  1EY5 A;  5CGK A;  1SNM A;  1TT2 A;  3EVQ A;  5I9P A;  2F0O A;  3C1F A;  2F0K A;  1JOQ A;  5IOD A;  3U9O A;  2HQE A;  1EY6 A;  1JOO A;  2QDB A;  1U9R A;  2EYF A;  5EGT A;  4WOR A;  5C6A A;  5I6W A;  5IOC A;  1EY0 A;  3OWF A;  3R3O A;  4K8I A;  2F0J A;  4ZQ3 A;  5KYL A;  4KJN A;  4S3S A;  2F0F A;  2EYJ A;  2F3W A;  2O4X A;  1NUC A;  3D4D A;  3ERO A;  4R8N A;  3NP8 A;  1SND A;  3NK9 A;  5I9O A;  4ODG A;  3P1H A;  5IGC A;  5IGE A;  3ERQ A;  1ENA A;  4K8J A;  2F0V A;  2ENB A;  3DHQ A;  3TP6 A;  4E6I A;  5IGG A;  2PZW A;  1SYC A;  5IGD A;  5DAU A;  3E5S A;  1STG A;  4K5W A;  4B9W A;  4DF7 A;  5I6Y A;  5EKK A;  4OL7 A;  2OXP A;  2OEO A;  1F2M A;  3DMU A;  5CV4 A;  5JOB A;  2F0I A;  2EYM A;  1RKN A;  5KIX A;  4TRD A;  2PZT A;  4H7B A;  1SNQ A;  2RDF A;  5C3X A;  3TME A;  1SNO A;  3QB3 A;  2EY5 A;  2F0W A;  1F2Y A;  2F0G A;  3NXW A;  2EYO A;  2F0E A;  1EZ6 A;  3VA5 A;  5EKL A;  2F0Q A;  3SHL A;  2F0S A;  5J39 A;  4F8M A;  2EY1 A;  4RKB A;  2EY6 A;  2PQE A;  4EQP A;  2F0N A;  3OMC A;  1EY7 A;  3TP5 A;  5C3W A;  5KGU A;  5IIF A;  4PMC A;  2M00 A;  5HGT A;  2F0D A;  1SNC A;  3MHB A;  3BDL A;  5E1F A;  5F2D A;  4MIU A;  4EVO A;  1KDC A;  4KD4 A;  3S9W A;  4I65 A;  1JOR A;  1STB A;  4KHV A;  4KJO A;  5C5M A;  1IHZ A;  3T13 A;  5ISR A;  2F3V A;  2PW5 A;  5HUR A;  3SK5 A;  4LAA A;  4HMI A;  1EYA A;  2RBM A;  2SNM A;  4NP5 A;  1STH A;  1SYB A;  1KDB A;  3OSO A;  4WRD A;  3V2T A;  5KYI A;  5DEH A;  4KY5 A;  1AEX A;  4N9P A;  4QMG A;  4EQO A;  5C4Z A;  4KV6 A;  4DFA A;  4NKL A;  3BDC A;  3TP8 A;  5CV7 A;  4B9X A;  2F0P A;  4ZUI A;  2EYL A;  2F0L A;  1TR5 A;  4HMJ A;  3SXH A;  1EY9 A;  3H6M A;  3P75 A;  1SNP A;  1TQO A;  4EQN A;  1A3V A;  4J6H A;  3NQT A;  4IZ8 A;  2LKV A;  4N9T A;  2SOB A;  1KDA A;  4K2L A;  3LX0 A;  5E3F A;  3SK8 A;  4IUN A;  1SYF A;  2KHS A;  3EJI A;  2NUC A;  1EZ8 A;  2PZU A;  3D8G A;  4DU9 A;  4NMZ A;  5IGF A;  3ITP A;  1STA A;  1SYD A;  1SYE A;  5IGB A; 
#chains in the Genus database with same CATH topology
 3W5O A;  1ET6 A;  3MEH A;  4RHS A;  3RZO H;  2L4N A;  3J81 E;  1CKM A;  5M3F G;  4OON A;  4BY7 H;  2LY7 A;  4X62 Q;  5JAV A;  2JA5 B;  1TS3 A;  1EYD A;  5CV6 A;  5C4H A;  4X65 Q;  4ID6 A;  2F0M A;  3HKZ B;  5EAY A;  3NEM A;  4PNY A;  1HA5 A;  1Y8P B;  3QOJ A;  1HQM C;  3J81 i;  1L0Y B;  4KY6 A;  5JJL A;  3GV3 A;  3HZX A;  1S5C D;  2R61 A;  3CRL C;  2RDG A;  1XMQ Q;  1KNA A;  4V19 0;  2R93 H;  2KQ3 A;  4J8Q A;  1KRS A;  4GOP B;  4NXM Q;  1EQV A;  3AU7 A;  1D7Q A;  3KDF B;  2JJQ A;  1FJG Q;  3S17 H;  1IZ6 A;  3F2B A;  4DR4 Q;  4JG2 A;  1ICW A;  4JBK A;  3G6E A;  1U9R A;  2XSC A;  4X64 L;  2OTJ A;  3RLF A;  1IBL L;  2WAQ B;  2JXM B;  4UY8 C;  1WVL A;  4C3I H;  3P1H A;  3M3Y B;  4DV1 L;  1PTO D;  5DAU A;  4GNX B;  2LXK A;  4RFB A;  5EKK A;  4OL7 A;  5M3M B;  1F2M A;  5COR A;  1GKH A;  5D3D A;  4KN4 C;  1K9M C;  1IBM Q;  5LMN W;  3S14 B;  5AJ3 L;  2JEA I;  3ONA B;  5C4J B;  4QJF A;  2LS0 1;  1KIX A;  1PZI D;  4YY3 L;  3TRE A;  2XGT A;  3NXW A;  1H9R A;  1JR0 D;  4B3S L;  5EKL A;  3SHL A;  3R8B A;  1Q90 A;  4F8M A;  2UXB L;  2JK8 A;  4L8J A;  3DWA A;  4YWL A;  3I4N B;  3HOY G;  4JI2 L;  4EVO A;  1M8A A;  3KF6 B;  1R4P B;  2H1E A;  3MA2 B;  4L6T B;  1LUZ A;  1IHZ A;  3OHX C;  5DM6 3;  2NVQ H;  2GVB A;  1RL2 A;  3C3L A;  4BBS G;  1NTG A;  3HOU B;  4ALP A;  2A74 C;  3DEO A;  3NTI A;  1E2W A;  3CQZ H;  2JA8 H;  1SN8 A;  3Q8D A;  1SEB D;  3PUY A;  2FJ2 A;  1PA6 A;  4HJ9 A;  4ZUI A;  2SDF A;  3OIP A;  2ALY B;  2Z9H A;  3J80 L;  1DXM A;  3SK8 A;  1SMX A;  4DR1 L;  1KLG D;  3QIA A;  3D8G A;  2PZU A;  1MGS A;  3S1Q H;  3DWQ A;  4JI6 L;  4BA2 I;  1TKW B;  3TSS A;  5DNF A;  1N36 Q;  1Z47 A;  4G57 A;  4TKO B;  1K8M A;  1B53 A;  1Q1E A;  3CCQ A;  1BKB A;  4WFN 3;  3D4R A;  1KAB A;  2H5X A;  1K0R A;  3HKZ E;  3K7A B;  3W1B A;  1J5E L;  2F0U A;  2KHJ A;  2MUY A;  2D9U A;  3QO2 A;  3U58 A;  1I3Q B;  1TXY A;  2ICE C;  3GD7 A;  3S1R B;  3CCS A;  1D2B A;  1TWC B;  4PZ6 A;  5M9O A;  2KCT A;  3GTO H;  1V1O A;  2WKD A;  3JAM E;  4DV4 L;  4MTN A;  5BR8 L;  5KRU A;  3FKI H;  3MC0 B;  3TP7 A;  1HZB A;  2WB1 G;  2B39 A;  2ZJR A;  4DR6 L;  3CPW A;  1WJJ A;  4A3L H;  4GLX A;  4JI7 L;  1O78 A;  4HTH A;  4IFD I;  1VF5 C;  4C1N I;  1YHB A;  4X6A H;  1CT1 D;  1OXU A;  4Z9C B;  1EY6 A;  3JAM i;  1Q7Y C;  5FLM H;  4CKE A;  1GD7 A;  4QQB X;  1L2F A;  1AE2 A;  5TSS A;  5EBD A;  4A4I A;  1BO0 A;  1O7L A;  1PYB A;  3GTQ H;  4JI3 L;  3RZO B;  3PUW A;  1WTP A;  2PZW A;  3S1M H;  2A73 B;  5KNB A;  5EBC A;  4A75 A;  4BY7 B;  4OGQ C;  2KED A;  3BVG A;  4DV3 Q;  2FMC A;  5I4D A;  5KIX A;  2K6A A;  4H13 C;  5E4W C;  4XQJ A;  2UXD Q;  3A5U A;  4FP5 D;  3OOC A;  4AQY L;  1WYD A;  3P20 A;  4A3C H;  5IT9 c;  1AH9 A;  1PRT D;  2R93 B;  5ELN A;  2M00 A;  5HGT A;  1ESR A;  4KJO A;  3EFX D;  2JN4 A;  2NZO A;  4WRD A;  4X62 L;  3I4M G;  1MSG A;  2E2I H;  1O7Y A;  4LWC A;  3MFG A;  4QMG A;  5I2Y A;  3I56 A;  2Z6K C;  2BOS A;  4C3I B;  1YEZ A;  3CC4 A;  3QWN A;  4DV5 Q;  1RJT A;  3MWY W;  4C3J H;  5LMU Q;  2D0P A;  1XMQ L;  1VQC A;  1BXT A;  4DU9 A;  1T5X D;  4NXM L;  1GHK A;  3VR2 A;  1CM9 A;  3BG3 A;  1J8I A;  1Y14 B;  2UUA Q;  4A3D G;  1H9S B;  2K01 A;  3KYH C;  4CKB A;  4DGZ A;  4HJ5 A;  1SYG A;  4JYA Q;  1HRJ A;  5K36 H;  2RQX A;  2ZM6 Q;  3CME A;  3CC7 A;  1PMR A;  3MVV A;  3HRZ C;  2DNC A;  1S5E D;  2NVQ B;  1SXT A;  2YTX A;  2JA7 H;  1VQO A;  3GTK H;  4LK1 C;  4IPD A;  1EYC A;  1IBM L;  1SSO A;  3CQZ B;  2JA8 B;  1YHQ A;  5IYD G;  1FVI A;  4RAU C;  1PH3 A;  5C3E G;  2Q8I B;  5FJ8 G;  1XYI A;  3T16 A;  3VYU A;  2DY8 A;  3H94 A;  3ULJ A;  2KHI A;  2F0O A;  1H9M A;  4GOP C;  4XXE A;  1CA6 A;  5EGT A;  4C56 C;  3S1Q B;  2IX3 A;  3HOV G;  4A3F G;  3HP3 A;  1FNU A;  4ODG A;  1K83 H;  2Z6K A;  3WOF A;  4DV2 Q;  1C7Y A;  1SYC A;  1BNZ A;  3E5S A;  2ICI A;  1VQ8 A;  3P7J A;  1LTL A;  5C44 H;  1RKN A;  4GNX C;  4A76 A;  2PZT A;  2RDF A;  4O42 A;  1BR9 A;  1SNO A;  2KOL A;  2VUM G;  1F2Y A;  1I6H H;  4UDU C;  4AYB E;  3GTO B;  4DAV A;  1Q82 C;  2UUB Q;  5C0X H;  3CCJ A;  3FKI B;  4RG1 A;  4K6L A;  3HOW G;  5KGU A;  3E0J A;  1N36 L;  2F4V Q;  4LF5 L;  5F2D A;  4A3K H;  3GTP H;  4NXN Q;  4N8X 1;  5KND A;  2F3V A;  2I0Q A;  5HUR A;  2AQ1 B;  2UUC Q;  4OWW B;  4BXX G;  1LT6 D;  2HIV A;  4YWM A;  1YJW A;  1CFM A;  4KMU C;  5BN3 A;  5M5X H;  4CHT B;  3K7U C;  3GTQ B;  2FIN B;  5LMN L;  2LKV A;  2L1B A;  4JCV E;  3S1M B;  1N8R C;  4L5S A;  3ND8 A;  3S15 B;  4GOP A;  4IFD G;  3I70 A;  2EIF A;  3UDF A;  3PSI A;  3KDF A;  3RLN A;  1BOS A;  2RKS A;  2PPB C;  1ET9 A;  1K28 A;  2IHE A;  1XXG A;  3RZD H;  1PYW D;  4HN7 A;  2E74 C;  4KD3 A;  2NBF A;  2R92 H;  4GNX A;  1QE6 A;  2SEB D;  2OQK A;  3MZ5 A;  1CHQ D;  5ELB A;  1H9K A;  3RMH A;  1JOK A;  5IWA Q;  1GUW A;  3K5L A;  2NZH A;  4KTA A;  1CZG A;  1GO3 E;  1K3B C;  3HEJ A;  1SFO H;  1V43 A;  2HDM A;  4G7O C;  2BDN A;  3E9I A;  2QF7 A;  3H0G B;  4C3H G;  4OWT B;  1JWU D;  3AYH B;  3KF6 A;  4P75 A;  1WCM G;  2F0F A;  3HOZ G;  2O4X A;  3ERO A;  4GLA C;  1OXS C;  3NK9 A;  4IPG A;  3ERQ A;  1QCB D;  1IKL A;  1LAC A;  4K8J A;  4E6I A;  4R1J A;  4F88 A;  3BZK A;  4QIW E;  1HCZ A;  1VMP A;  4BY1 H;  4M1U B;  2EYM A;  4H7B A;  1JWM D;  1K8G A;  1IXR A;  4JV5 Q;  4DV5 L;  1LM0 A;  4BWG B;  3FDT A;  4JI8 L;  1RCV D;  1Y1V G;  5LMU L;  1F77 A;  2JA7 B;  3GTK B;  3NWS A;  3DEP A;  4R4I A;  5C3W A;  2F0N A;  5LHY 1;  1VQM A;  2IJ0 A;  5E1F A;  1VQH A;  3PUX A;  4OEL B;  2VQE Q;  2UUA L;  1LTA D;  1CK1 A;  1D6E C;  4LF7 Q;  3CCR A;  1Z6H A;  3SK5 A;  1QWY A;  1S5F D;  4IQZ A;  3SEB A;  2ZM6 L;  1SYB A;  1PH4 A;  1K8A C;  4JK1 C;  4DK1 A;  1VQ6 A;  3K81 C;  4EQO A;  3D3R A;  2IL8 A;  1E2V A;  1K83 B;  2JP1 A;  3H6M A;  2VXW A;  1L0W A;  2EZV A;  4DPG A;  4K2L A;  2JA6 G;  4DV0 L;  4IUN A;  3G48 A;  4NPS A;  3CF5 A;  5C44 B;  1AZP A;  4LF8 Q;  3U4Z A;  3I4M H;  1TU2 B;  3ITP A;  5BN5 A;  3CCM A;  1I6H B;  2Z4H A;  1FNW A;  3M4Q A;  2ES2 A;  3PQI A;  3PIP 3;  4GLV B;  1OTC A;  4OX9 Q;  4A3K B;  2GVA A;  5JEA J;  3GTP B;  5JJI A;  4MN3 A;  3RUZ A;  2NTS A;  4DV2 L;  3E6Z X;  3PUZ A;  4H02 A;  5J22 A;  4KY7 A;  4ZUJ A;  5AFW A;  4DV7 Q;  3PIO 3;  2E75 C;  1E22 A;  2L55 A;  4GN4 B;  5JEA H;  1X6O A;  1PDQ A;  1WTX A;  5CV9 A;  2VQF Q;  3J7Z C;  4DR7 L;  1ZYR C;  5M5X B;  3S2H H;  1PH2 A;  1TWF H;  4B3M Q;  2B3G A;  2F03 A;  4DUZ Q;  3EVQ A;  4GKK Q;  5KNC A;  1JOQ A;  1ENF A;  3U9O A;  1I4Q A;  4CBV A;  2F4V L;  3NEL A;  4IUR A;  3MAQ A;  3DM1 A;  2E2H H;  5IYD H;  2EYJ A;  1XX8 A;  4XQN A;  5GAH C;  2X6G A;  3PO2 G;  2NZ1 D;  1ENA A;  2UUC L;  2UXC L;  2F0V A;  1LTR D;  1U4P A;  3KUP A;  4K5W A;  2ZJP A;  4L5R C;  1DZ1 A;  1CHP D;  1HFG A;  1SE8 A;  4DV6 Q;  5EKI A;  4LF4 Q;  3HGB A;  1B9M A;  3H3V I;  3DUZ A;  2R92 B;  3QG1 A;  4R9W A;  2A6H C;  2D62 A;  1N34 L;  3GV6 A;  2EJM A;  3I3C A;  1SJE D;  1D8L A;  3PO3 H;  1H9S A;  4OWX B;  2VNU D;  1SFO B;  4PZ7 A;  4KHV A;  3NBH B;  3T13 A;  1U4R A;  4QL5 A;  4HMI A;  4PMW A;  2RBM A;  2CH4 A;  2DGY A;  3PGZ A;  4DK6 C;  5KYI A;  4B3T L;  2B2V C;  1DCZ A;  4P73 A;  1N33 Q;  1CKN B;  1DOK A;  3TP8 A;  2V4D A;  2DY7 A;  4HMJ A;  1TR5 A;  1GHJ A;  1B9N A;  1TS5 A;  5FKA C;  4DR2 Q;  4N9T A;  3S16 B;  4A3B B;  1I94 Q;  5DLQ E;  1X55 A;  4CJ0 B;  1AE3 A;  1XPO A;  2E2D C;  4BY1 B;  3C46 A;  1G2T A;  2R7D A;  4OHJ A;  4NMZ A;  4ZK9 B;  2XN9 C;  1R4Q B;  1ML0 D;  3LWE A;  3AFQ A;  2ATW A;  4U68 A;  5KEE A;  4BBR G;  2C9O A;  1NR4 A;  3BZC A;  1EOV A;  1II3 A;  4WJ4 A;  2KEC A;  3L3O C;  3A8J E;  1GUS A;  2Q2T A;  4JC0 A;  3T51 B;  3HOX H;  3RN5 A;  3EIV A;  1PV4 A;  1YZ6 A;  4CDE C;  4LNQ A;  4CKC A;  4IUV A;  4LFC L;  2XRS D;  1A2U A;  1QIL A;  2NN6 H;  4DNI A;  3KJP A;  1KTK A;  1NCV A;  4PMB A;  5L37 A;  1DON A;  3NSW A;  4ME3 A;  3SR1 A;  3M85 A;  3HFZ B;  1WD0 A;  1I4X A;  5I9P A;  5IOD A;  4P71 A;  2HQE A;  2KEE A;  2EVB A;  2Q2H A;  4HIK A;  4KHP L;  1PTO H;  1MI2 A;  2WV6 D;  4K8I A;  4DUY Q;  2B2V A;  4TSS A;  4LF7 L;  4QUC A;  5IGE A;  2XNA C;  1NR2 A;  1X56 A;  3LWU A;  1STG A;  5I6Y A;  3I91 A;  2E76 C;  2OEO A;  2JQO A;  1VQK A;  2QDL A;  1K0S A;  4XT3 B;  4G4K A;  2LFN A;  3TN2 A;  4TRD A;  2OWO A;  4X3K A;  1WCM H;  1QB5 D;  1W6K A;  1EOT A;  4C1N K;  3OWE B;  3QB3 A;  2EY5 A;  1I4H A;  2QA4 A;  2F0E A;  1X3P A;  1JJ2 A;  1EU3 A;  4LF8 L;  3CP0 A;  1SLJ A;  1WTH A;  5GRO A;  1QNK A;  1XPU A;  1K8O A;  3MHB A;  1EU4 A;  1ZKO A;  3S2H B;  4B08 A;  3VR6 A;  1KRT A;  1WFQ A;  4RHR A;  1YJ9 A;  4X66 L;  2DN8 A;  2TMP A;  2RF4 A;  4G7H C;  4KV6 A;  4OX9 L;  4DFA A;  3U4V A;  2E2H B;  1XJV A;  3IAY A;  2C5C A;  4A3G H;  5JJK A;  1HA6 A;  4RH6 A;  4DV7 L;  3K80 C;  4J6H A;  2MO0 A;  4IZ8 A;  1HNX Q;  3Q6S A;  1ILQ A;  3U9S A;  2VQF L;  3PIP A;  2RCN A;  4DKA C;  1EWH A;  3OTO Q;  1XTC D;  4DUZ L;  4GKK L;  2O5I C;  5C4X G;  3K8A A;  3SK4 A;  2N8N A;  4NB3 A;  3PIO A;  2J0T D;  1GM5 A;  1A3U A;  2Y0S B;  1RTO A;  4KKT A;  4K6D A;  2B63 G;  3DWP A;  1L0X B;  3K5O A;  3PO3 B;  2XWJ B;  3AMU A;  1BCP B;  3RLO A;  1CA5 A;  2F0T A;  2R7Z H;  1I4G A;  3M7N A;  1CSQ A;  1OXT A;  3F2D A;  2Z1C A;  1LTG D;  1ENC A;  5J39 A;  3MTS A;  1QZH A;  1N32 Q;  1JJG A;  3BS1 A;  2PW7 A;  1G6Z A;  4A93 H;  5FLX L;  4DV6 L;  1Y1W H;  1SRO A;  3ND9 A;  2MFI A;  4LF4 L;  2QKI C;  2F4I A;  5JVH 3;  1UE1 A;  1ASZ A;  2JYO A;  1G6P A;  3O13 A;  2D5D A;  2EY2 A;  3FPU B;  1X3Q A;  2ZXP A;  3I8Z A;  3UE1 A;  4A3E H;  4PG3 A;  1PYS B;  4OO1 H;  1HQR D;  1YIJ A;  4R8I A;  3QR8 A;  2F0J A;  3H3V C;  4A3M G;  4S3S A;  2DNE A;  2ZTE A;  2PI2 A;  3D4D A;  3BDO A;  4LFA L;  1IBK Q;  1SND A;  2OTL A;  1GJX A;  1QUQ B;  4O0A A;  2EXD A;  5E7N A;  3AFP A;  5H1S E;  1HHV A;  4P72 A;  4Y7N H;  1RTN A;  2F0I A;  2HCI A;  4A3J G;  2RSN A;  3N52 A;  1UWV A;  4L5T A;  4IOA A;  3RNU A;  3HOX B;  2HHH Q;  3PO2 H;  4A3I G;  1EZ6 A;  1VQD A;  2R6G A;  3MXN B;  1ZYR D;  2PQE A;  1PFB A;  3WDN A;  4JI1 Q;  1X3E A;  4UP9 A;  3CPF A;  2CVR A;  2OQ0 A;  4JI0 L;  2WFW A;  5EPL A;  4RGT A;  5FOB B;  3K59 A;  1PTO B;  3J81 L;  2L15 A;  1W2B A;  5IP7 G;  3BDC A;  4CDF C;  2NB0 A;  3V96 A;  4IJH A;  2EYL A;  1OXV A;  1EY9 A;  4HJ8 A;  1TQO A;  2CQA A;  3IL8 A;  3FVQ A;  1TWH H;  1SYF A;  2BDO A;  4AYB B;  5JJZ A;  1UE5 A;  3UDG A;  2A6H D;  2Q2U A;  1DD2 A;  5FO7 B;  2XRQ D;  1FYC A;  2Q2I A;  5A35 A;  1TII D;  2Y0S E;  3R2I A;  4DXG A;  3S17 B;  3F2C A;  5DM7 3;  1EQQ A;  3FP9 A;  4CDC C;  1YI2 A;  4QB4 A;  2IPK D;  4X65 L;  3A54 A;  1CI3 M;  5M5Y H;  5CR3 A;  2PYK A;  2K05 A;  2QEX A;  3HG9 A;  4RMF A;  4K2K A;  1S40 A;  4CGY B;  3K0Y A;  4DNR B;  1TVX A;  4RCO A;  5IYC H;  4JI5 Q;  1Z7T A;  1JQY D;  1FL0 A;  4LJZ C;  2K04 A;  1HR0 W;  2JA5 G;  1MJE A;  1FJG L;  1ICF B;  4DR4 L;  4A3G B;  5JVG 3;  4AH6 A;  1HZC A;  3HKZ G;  4ILW A;  3HKS A;  4UP8 A;  1X65 A;  3NE5 B;  2L9H A;  3RD4 A;  3R3O A;  3NBH A;  1Y8O B;  4R8N A;  3T1H Q;  4RCN A;  4H44 C;  1BCP F;  2A69 C;  5IGD A;  1CKN A;  1WTW A;  5M3F H;  3UE0 A;  1EEI D;  4JOI C;  2WAQ G;  2E8G A;  2L5T A;  2H4O A;  2R7Z B;  3TME A;  1KC8 C;  4DAP A;  3ZJY C;  1CQF A;  2EYO A;  4G7Z C;  4C2M H;  2FFK B;  1EIH A;  4A93 B;  3T4A C;  5M3M G;  1Y1W B;  2HUG A;  3I4O A;  4DA2 A;  1QZG A;  2F0D A;  2K52 A;  3EN2 A;  4GKJ Q;  3OTO L;  1EWC A;  1V9P A;  1UUP A;  2N55 A;  5M5W H;  2NVX H;  1NMF A;  2B2T C;  4IOC A;  2NVY H;  1B44 D;  4A3E B;  5C0X J;  4Q5V A;  3I4N G;  1QG7 A;  3NTK A;  4QIW B;  1NJI C;  2A5H A;  3D0F A;  3J7A 5;  1GUG A;  2K33 A;  2RDH A;  1IYJ B;  5J3B A;  1SNP A;  4Y52 H;  1HJP A;  4ZKC B;  3NQT A;  1XNR Q;  1HR0 Q;  3TS2 A;  3X3M A;  4LMQ D;  3HOU G;  3I4L A;  4HR7 B;  3JAM L;  1S5D D;  2NUC A;  2ZXR A;  5IE8 A;  1HZ9 A;  1VQE A;  4Y7N B;  1B7Y B;  3S2D H;  5JPM C;  1O80 A;  1KAW A;  2AWO A;  1G2S A;  2CWP A;  2CCZ A;  3OW7 A;  4AIM A;  2MPM A;  1IW7 C;  2KJX A;  5ELO A;  1BBU A;  3UDI A;  1A0I A;  3C2P A;  3J80 c;  2F52 A;  4X3S A;  1PTO F;  1IBK L;  3HOY H;  5IP9 G;  1UE6 A;  4ZYS A;  1HFN A;  4JOI A;  2R3Z A;  2JA9 A;  4YIJ A;  1BCP C;  4JBJ A;  4MHE A;  4BBS H;  1ESF A;  4WJW A;  2BCO A;  4DK3 C;  3R2T A;  1CSP A;  3RR5 A;  4LUO A;  5CV8 A;  2Z8L A;  3S24 A;  1EQR A;  3D31 A;  1C48 A;  3L2P A;  3Q0A A;  2K50 A;  1TWH B;  2B2T A;  4KKS A;  4EGV A;  3TZD A;  4IUU A;  2IWH A;  1F2L A;  3OWF A;  4EX5 A;  4GN3 B;  1JMC A;  1A6X A;  1RHP A;  1NNX A;  4OIK A;  2KCM A;  5IGG A;  1AFP A;  4DV3 L;  1VS0 A;  1JT8 A;  2E2I B;  1EWI A;  5COY A;  2A68 C;  2UXD L;  1B2T A;  4HED A;  5T1I A;  1A15 A;  1MD2 D;  2QIL A;  3T53 B;  1NAP A;  2EQS A;  1SE2 A;  4KN7 C;  4C3J B;  1PHJ A;  1BBW A;  2EDG A;  3BYY B;  2D2C C;  3KLR A;  2RCF A;  4DAY B;  4BY7 G;  4LF9 Q;  2DUD A;  1SNC A;  3BDL A;  3ULL A;  3A56 A;  3BVZ A;  1HUM A;  2L0C A;  1A63 A;  2EPB A;  1DJR D;  2VL6 A;  1VQG A;  1HNW Q;  4HCE A;  1J6Q A;  4XDX A;  1AEX A;  2R93 G;  1SE3 A;  1G51 A;  1YIT A;  4DXF A;  2I07 B;  1HZA A;  4KHZ A;  2XTI A;  3TS0 A;  3R93 A;  1STE A;  3GO5 A;  3K5M A;  3P75 A;  2MGS A;  3KBG A;  2K14 A;  2G5D A;  3GQB A;  4ULL A;  3A74 A;  3CXC A;  5M3F B;  4B3R Q;  3EJI A;  3IFT A;  4QUF A;  1MJC A;  5IT9 E;  1A62 A;  5IP7 H;  5ELC A;  2HD3 A;  1SMY C;  4TVA B;  4C3I G;  4JYA L;  3EQL C;  1W3S A;  3L7Z C;  4C2M B;  4QF4 A;  3SK6 A;  1TY0 A;  2MJ8 A;  1ONL A;  2OCE A;  1AP0 A;  3I90 A;  3MXG A;  1QUQ A;  4N8F A;  5NUC A;  5LL6 S;  3T1H L;  3D6C A;  1EEF D;  1WTQ A;  1QOH A;  3AB9 A;  5CBA E;  5M5W B;  1F9S A;  2NVX B;  1C4Q A;  1MIU A;  2N49 A;  2NVY B;  3CAM A;  3X3N A;  3J7A F;  4DK0 A;  1KAA A;  4XIG S;  2EJG C;  1JB7 A;  2NTT A;  3IFD A;  1VCI A;  3A8I E;  4XT1 B;  1UEB A;  3MXN A;  2IT1 A;  1WTO A;  4DN4 M;  4CJ1 B;  3AEV A;  5C6A A;  1CTM A;  4NW2 A;  2JA8 G;  5KYL A;  1XNQ Q;  3CRK C;  2F3W A;  2JA5 H;  3S2D B;  1NUC A;  1XMO Q;  1P16 A;  4BS9 A;  4A3D H;  1JE4 A;  3TQY A;  3FPP A;  1X9N A;  3M9B A;  2G9D A;  2B8F A;  1YJN A;  4POF A;  3KOJ A;  2DJG C;  3B6Y A;  5C0X I;  3HOY B;  2GA4 B;  1WD1 A;  1P8L A;  2UUB L;  4U67 3;  1XNR L;  5D14 A;  1EUJ A;  5D3I B;  4EQ5 A;  2ID0 A;  2IX0 A;  2HT1 A;  4BBS B;  2L12 A;  4YY3 Q;  1V1P B;  2EY6 A;  4EQP A;  1DYQ A;  4NXN L;  3M4P A;  3K5N A;  3G7L A;  3CCU A;  5C3E H;  5FJ8 H;  3I2Z A;  4I65 A;  4JW0 A;  1STB A;  1JOR A;  1GXD C;  4DR5 Q;  3DXJ C;  2PW5 A;  4JI2 Q;  3RZD B;  3F2U A;  1B3Q A;  4PQX A;  2FMM A;  1JE5 A;  1VQN A;  3FKI G;  2KBN A;  1XPR A;  5M3M H;  3HOV H;  2A69 D;  4A3F H;  4ZKB B;  1SJH D;  4A3L G;  3JAM c;  1LT3 D;  2D0O A;  3NBI A;  4FF1 A;  1U4M A;  2KEN A;  3PCO B;  5C4J H;  1KXL A;  2DJF C;  3U50 C;  1YNJ C;  2ZXO A;  4OIJ A;  2E5L Q;  1IYU A;  4M8A A;  4FF3 A;  4FO2 A;  2KHS A;  2A1A A;  5FLM G;  5IGF A;  4DAM A;  4DR3 Q;  1CKO A;  1SYE A;  1Q86 C;  1D5Z C;  3VR5 A;  5IGB A;  2M2L A;  4UP7 A;  2B8G A;  2BH8 A;  4J15 A;  4JI6 Q;  2VUM H;  3TDQ A;  3MXP A;  1LV9 A;  4V0B A;  1J9O A;  1PLF A;  2EYP A;  3NTH A;  3QOL A;  1HH2 P;  5EQ0 A;  5C5L A;  2UU9 Q;  2NYZ D;  3FHW A;  3HOW H;  3NEN A;  4IO9 A;  2WB1 B;  1RD9 D;  1GUN A;  4R4T A;  1EL0 A;  4LFB Q;  4FYD A;  1C0A A;  1F9Q A;  5IWA L;  4HAE A;  4A3C G;  1RF2 D;  3D4W A;  4F87 A;  1Z9F A;  3T56 B;  3NPP A;  4K14 A;  4BXX H;  4IUP A;  3DLL A;  3I55 A;  4DR6 Q;  1B4O A;  1E3P A;  3J80 i;  1U5K A;  2CWA A;  2BH2 A;  5T1G A;  1S3O A;  1JOO A;  4LF9 L;  4IFD H;  5CMD A;  4L5Q A;  4KKU A;  1VQ4 A;  1IW7 D;  2YTV A;  1I3Q H;  1HNW L;  3H0G G;  2EJF C;  1C8C A;  2KCC A;  1LTT D;  4IPH A;  3K0X A;  4JV5 L;  2KCN A;  1PH8 A;  3KFU A;  1BCP D;  1Q8I A;  2RVL A;  1Q3L A;  5BN4 A;  3I4M B;  4H0L C;  5K36 G;  2VQE L;  2AQ3 B;  2P5Z X;  2QGQ A;  1Q46 A;  3IKJ A;  3OW2 A;  3KBX A;  2JE6 I;  5ISR A;  1TWA H;  5G3L F;  1C9O A;  1E24 A;  2JA7 G;  4C3H H;  2VS1 A;  3OSO A;  4ZCK A;  5DEH A;  4KY5 A;  1T5E A;  2RHQ B;  4FXG C;  3W3A A;  3HOZ H;  4X3U A;  4QCL A;  3J81 j;  4A3D B;  1MKH A;  2FXQ A;  1VQ9 A;  2Z4I A;  2A68 D;  2N78 A;  3V05 A;  1WTR A;  3KF8 B;  2HQL A;  2BA0 A;  5EPK A;  2VB2 X;  3OPO A;  2JEB I;  2BE5 C;  3TBI B;  3UDX A;  1I4P A;  1Q12 A;  1YHA A;  3CW2 C;  1SYD A;  4POG A;  1SE4 A;  1S72 A;  4KK7 A;  5E4X A;  1OO9 B;  1BVS A;  1TWF B;  1S4Z A;  1Y8N B;  2CKZ B;  2PNR C;  1Y1V H;  2BA1 A;  2WB1 E;  2ZTC A;  3ERS X;  2Q8T A;  1B70 B;  3PV0 A;  2N88 A;  5C44 G;  1XNQ L;  2SNS A;  1XMO L;  3KLW A;  5C3E B;  2VB3 X;  4OEM B;  1WTV A;  1E2Z A;  1EY4 A;  2B2W C;  2EYH A;  2F0H A;  4RGN A;  5C0X G;  4HID A;  1FGU A;  1V1Q A;  3SGI A;  2B2U C;  1U4L A;  3HOV B;  4A3F B;  1HTP A;  4B3M L;  1HUN A;  2L11 A;  4IJL A;  4A3K G;  3A7A B;  1STN A;  2ZT9 C;  1STY A;  2EXZ A;  3AQQ A;  4DAY A;  3BYT B;  2I5L X;  1SNM A;  1TT2 A;  5JPN C;  1X54 A;  2JA6 H;  2MP1 A;  1SMY D;  1EY0 A;  2MO1 A;  4KJN A;  2HIX A;  5I9O A;  4DR5 L;  2VUM B;  2AUK A;  4OXP A;  3J7Y W;  2LMC B;  3GP7 A;  4HSV A;  4B9W A;  4DF7 A;  1UNS A;  1B8A A;  2OXP A;  4RGM A;  3HOW B;  4HIM A;  2YYZ A;  2K03 A;  3T1Y Q;  1ILP A;  4MNO A;  3GTL H;  2F0W A;  2QW7 A;  1JJC B;  2E5L L;  2A6E C;  3CHB D;  1NY4 A;  1U0L A;  4DR3 L;  1I5F A;  3OMC A;  3STB C;  4ZRZ A;  1D5X C;  1GVP A;  4MIU A;  1KDC A;  2R92 G;  1KD1 C;  4LF5 Q;  4JBW A;  2OT2 A;  5ELF A;  2B2W A;  2UU9 L;  1N33 L;  1IL2 A;  1SBB B;  3V2T A;  4ZLT F;  2GN5 A;  1PFM A;  3NWT A;  2PCF B;  3KLS X;  3PUV A;  4TQU S;  5HY6 A;  4FF2 A;  1HPC A;  2B2U A;  2CHB D;  4B9X A;  4BA1 I;  4LFB L;  4DR2 L;  3K58 A;  2F0L A;  1GUO A;  3SXH A;  1I94 L;  1YNN C;  1IKM A;  2SOB A;  5E3F A;  3IRB A;  2F3I A;  4IUT A;  5LMN Q;  4RWS C;  1PFS A;  3DM3 A;  5FO9 B;  3BVM A;  5CV5 A;  1VQP A;  4FVM A;  4F7X A;  3JC6 6;  4A3B G;  2WAQ E;  1LO5 D;  1H9J A;  3NUC A;  4BY1 G;  5GAE C;  2OF1 A;  5J1Z A;  2C35 B;  1E0B A;  3HS0 C;  1EY8 A;  1QVC A;  2PQA B;  2NN6 I;  1TWA B;  4XQQ A;  1NE3 A;  2K32 A;  4LW1 A;  5ELD A;  2Q8R E;  2K5D A;  4C3H B;  3VYT A;  2RA4 A;  2NVT H;  2K7V A;  1PFN A;  3S15 H;  1G29 1;  1WCM B;  4UHV A;  2AMC B;  1VQL A;  4CJ2 C;  3HOZ B;  1LAB A;  1I6V C;  1YNJ D;  4R4Q A;  2CW0 C;  1EY5 A;  1V1P A;  5CGK A;  1QVG A;  1G91 A;  1DOM A;  3C1F A;  2EE1 A;  3CU7 A;  3CD6 A;  4DUY L;  2E2J H;  3GTM H;  2QDB A;  3E0E A;  4GZY C;  1FR3 A;  1W6J A;  3ICE A;  1TY2 A;  3VYR A;  1EQT A;  3W1G A;  3M7G A;  1Y1V B;  2ENB A;  3CCE A;  4BBR H;  3DMU A;  1XTD A;  3SE0 A;  4GN5 A;  3A7L A;  3MFY A;  3CKI B;  1SNQ A;  3CCL A;  4JI4 Q;  3PF4 A;  3ULP A;  5GQO A;  4HJ7 A;  2R7F A;  4UPA A;  2M9V A;  3VA5 A;  1TWG H;  3G6J B;  3WWV A;  3SVM A;  4JI8 Q;  3A5Z B;  2XWB B;  3H0G H;  1MSH A;  3KJO A;  2RSO A;  3PF5 A;  4O1N A;  2YU9 H;  3TZU A;  1EIG A;  2A8V A;  4FXD A;  4YHH Q;  5C5M A;  1PZK D;  3GTG H;  2CFM A;  4APV A;  1GUT A;  1NBW A;  4KI0 A;  4NP5 A;  2JA6 B;  2ZJQ A;  1TS4 A;  1KDB A;  1IYV A;  1V8Q A;  1HTL D;  5JEA G;  3WOE A;  3K6O A;  1KQS A;  1YNX A;  5CYU A;  1HNX L;  4HCS A;  1PH5 A;  1A3V A;  1KHI A;  2CH4 W;  2VZA A;  1KDA A;  2LSS A;  3VYS A;  4R4C A;  2HDL A;  4P74 A;  4O2D A;  5GAG C;  4DV0 Q;  1JCK B;  3GTL B;  2YTY A;  1D5M C;  4J1M A;  1F9P A;  2AKW B;  1QJO A;  1VQB A;  2IW3 A;  4NDX A;  1A3T A;  3E9H A;  1RIP A;  4MZ9 A;  4UAI A;  2IY5 B;  2TSS A;  3PMF A;  1N32 L;  1GOZ A;  2I46 A;  2K5H A;  3H91 A;  2X6L A;  1PRT B;  2Y0S G;  2QCP X;  4PZ8 A;  3T1Y L;  1A2T A;  4YCW A;  3PO3 G;  4OO1 I;  2BE5 D;  1L1O B;  3PO2 B;  1NSN S;  2YV5 A;  4DR7 Q;  1HXY D;  1K73 C;  2V1C C;  5IY0 A;  2F1M A;  1WI5 A;  2QEJ C;  5IOC A;  4WOR A;  4YCV A;  5I6W A;  4ZQ3 A;  4I7A A;  4WJ3 M;  5FLX c;  2VY3 A;  3GDE A;  1SRU A;  1EFW A;  4LUV A;  4CDD C;  1PVO A;  1VQF A;  2PO4 A;  3LNN A;  5C4X H;  3TP6 A;  5IYB G;  2EOT A;  1LT4 D;  2WIN B;  3S1N H;  3BJU A;  1SDF A;  2B2Y C;  2UXC Q;  3QJY A;  2B63 H;  1HNZ Q;  3MEF A;  3G71 A;  4DNT B;  3F1Z A;  1SR3 A;  3KF8 A;  3TRZ A;  2HHH L;  1G8Z D;  2IHF A;  1DM0 B;  1CZW A;  3N6R A;  5EPJ A;  4JI1 L;  4QY7 A;  3H3V H;  2JSO A;  3F8T A;  1EY7 A;  3TP5 A;  1N34 Q;  3OIQ A;  1BBX C;  2NVT B;  1H95 A;  1QNU A;  1MHW C;  4P2C B;  2K5Q A;  4K0K Q;  1M4V A;  2K5N A;  2ZTD A;  1LLR D;  4IN3 A;  3HOX G;  3VR4 A;  1XWE A;  2FHT A;  3GTM B;  2E2J B;  2WP8 J;  2K75 A;  4ABN A;  4X3T A;  1BQQ T;  3OYY A;  4FDB A;  1FNV A;  2NN6 G;  4A3M H;  4FF4 A;  3GTJ H;  2O5J C;  2AWN A;  5M5Y B;  4B3T Q;  5G3L D;  1EIY B;  1R9T H;  1NMG A;  1LTB D;  1X3G A;  4JVZ A;  1VQI A;  3BU2 A;  4LF6 Q;  4BBR B;  4A3J H;  3J81 c;  3MXU A;  1PH7 A;  1UAP A;  2A6E D;  4YCU A;  3C1E A;  2WAC A;  4LUZ A;  5K5P A;  1PH1 A;  1D1I A;  4A3I H;  3STB D;  1B3A A;  1DOL A;  1TWG B;  2KVM A;  4K5X A;  5FK9 C;  3NHH A;  4AYB G;  1F2Z A;  2B2Y A;  1I50 H;  2PMZ B;  3UI2 A;  3CMA A;  2YU9 B;  1PTO C;  1Y69 U;  3H09 A;  2J7Z A;  4FXK C;  3I7F A;  3OMG A;  2N3S A;  4Q0F A;  4L63 B;  1KLU D;  3GTG B;  1UEA B;  2K5W A;  4JPB W;  1AN8 A;  4JI5 L;  1IL8 A;  2J4X A;  1PXU A;  5GAD C;  5LL6 X;  5CC4 A;  3S16 H;  4A3B H;  3CCV A;  4JI4 L;  4KLK A;  1YNN D;  4HJA A;  1EFI D;  4LFC Q;  4ME5 A;  1D1K A;  3FMC A;  1MBY A;  5HGQ A;  2LXJ A;  3BZD B;  2KA7 A;  3VA7 A;  1X32 A;  4KHP Q;  4YHH L;  1M1K C;  4JBM A;  3RN2 A;  3NP8 A;  2K5V A;  5A2Q E;  4A3G G;  1K3R A;  4MTK A;  3DHQ A;  3M4O H;  1O7Z A;  1Q1B A;  4ZAI A;  1PRT F;  4GS3 A;  3URY A;  5C3X A;  1WOC A;  2F0G A;  2AUJ D;  2AQ2 B;  4YWK A;  1JB3 A;  1JC7 A;  1SAP A;  2K28 A;  2F0Q A;  3Q22 A;  1RDP D;  4GKJ L;  3Q24 A;  4QGU A;  2CW0 D;  4PMC A;  3E3X A;  4X64 Q;  4R4O A;  2B29 A;  3S9W A;  1IBL Q;  4KD4 A;  2R7Z G;  3A0J A;  4XYQ A;  1EYG A;  5FO8 B;  2MQH A;  4DV1 Q;  3D6W A;  2SNM A;  4A93 G;  1STH A;  1LTS D;  4X66 Q;  2WII B;  2VW9 A;  1Y1W G;  2ASB A;  1UE7 A;  2K4K A;  3FRP B;  4NKL A;  1S5B D;  2PQA A;  5AJ3 Q;  3I73 A;  1HR0 L;  1AZQ A;  3L0O A;  5I2X A;  3H15 A;  1F9R A;  1M90 C;  4EQN A;  5C4X B;  2I5M X;  2HCC A;  3S1N B;  3M4Y A;  4A3E G;  4B3S Q;  1VMC A;  3FEW X;  2B63 B;  4OO1 G;  2UXB Q;  1EZ8 A;  2I5H A;  4IPC A;  3W2D A;  2A19 A;  4K5V A;  2PNH A;  3ZYY X;  3M3Y H;  1X3F A;  2PMZ E;  1BF4 A;  1BUV T;  5D65 A;  3SDZ A;  2G9H D;  1JIC A;  1N9W A;  3S14 H;  2RHS B;  3NQI A;  4HSP A;  3VDY A;  1T9H A;  1TS2 A;  1PZJ D;  1PH6 A;  4RKL A;  3CC2 A;  3EA6 A;  1LYL A;  1DGS A;  2CQO A;  1FD7 D;  4I7Z C;  1HNZ L;  1VDZ A;  4DR1 Q;  1KNE A;  3I4N H;  4A3M B;  4PV1 C;  3GTJ B;  1O7I A;  1I4R A;  1PRT C;  4IUQ A;  1E1T A;  1R9T B;  4IAL A;  2KUM A;  1PH9 A;  2O2L D;  2F0K A;  1QVF A;  1FGB D;  3HOU H;  3KLS A;  1AW7 A;  1L1O C;  2EYF A;  2XVS A;  4A3J B;  1ZXT A;  1VQ7 A;  4RGO S;  4K0K L;  1YBY A;  2WKC A;  1J5E Q;  3G4S A;  2PI2 E;  1LT5 D;  3J80 E;  1VF7 A;  1VQ5 A;  5IGC A;  1LTI D;  3A55 A;  1CQV A;  4LFA Q;  4A3I B;  1EIF A;  5FLX E;  3K57 A;  4XTC S;  1VQJ A;  4DV4 Q;  5CV4 A;  5JOB A;  1Q8K A;  5BR8 Q;  1I50 B;  3Q23 A;  1ROD A;  4IFD J;  5IP9 H;  2AHO B;  1E7Z A;  1VQA A;  2MHV A;  4JI7 Q;  1E1O A;  4LF6 L;  2Z0S A;  2K1B A;  2F0S A;  1B1Z A;  2MNA A;  5IYB H;  2EY1 A;  4RKB A;  1BDO A;  4FNF A;  2XIW A;  5IIF A;  3K7A H;  3A8K E;  2X69 A;  2Z6B A;  3TEH B;  1YVC A;  5IT9 L;  3J7A V;  1JWS D;  3S1R H;  1OXX K;  2NWG A;  4C3J G;  1TWC H;  4LAA A;  4JI3 Q;  4HIO A;  1EYA A;  4JI0 Q;  3I72 A;  1CUK A;  1ZEQ X;  5C4Z A;  5IYC G;  4N9P A;  5EJW A;  5CV7 A;  1ASY A;  1B50 A;  2F0P A;  1KL9 A;  4XYO A;  3LGJ A;  5CBE E;  4B3R L;  1A8V A;  3KK7 A;  4AQY Q;  5A2Q L;  3M4O B;  4RA8 A;  3ER0 A;  3L9A X;  3VR3 A;  5ELE A;  2IX1 A;  3LX0 A;  1Q81 C;  1L1O A;  1STA A;  3EBE A; 
#chains in the Genus database with same CATH homology
 1ET6 A;  3MEH A;  4RHS A;  2L4N A;  3J81 E;  2LY7 A;  5JAV A;  2JA5 B;  1TS3 A;  1EYD A;  5CV6 A;  5C4H A;  4ID6 A;  2F0M A;  3HKZ B;  4PNY A;  1HA5 A;  1Y8P B;  3QOJ A;  1HQM C;  1L0Y B;  4KY6 A;  3GV3 A;  3HZX A;  1S5C D;  2R61 A;  2RDG A;  3CRL C;  4V19 0;  1KNA A;  2KQ3 A;  4J8Q A;  1EQV A;  3AU7 A;  1ICW A;  1U9R A;  2XSC A;  3RLF A;  2WAQ B;  2JXM B;  1WVL A;  3P1H A;  3M3Y B;  1PTO D;  5DAU A;  4RFB A;  5EKK A;  4OL7 A;  5M3M B;  1F2M A;  5COR A;  5D3D A;  4KN4 C;  3S14 B;  2JEA I;  3ONA B;  5C4J B;  2LS0 1;  1PZI D;  3NXW A;  1H9R A;  1JR0 D;  5EKL A;  3SHL A;  3R8B A;  1Q90 A;  4F8M A;  4L8J A;  3DWA A;  3I4N B;  4EVO A;  1M8A A;  1R4P B;  2H1E A;  3MA2 B;  4L6T B;  1IHZ A;  3OHX C;  5DM6 3;  3C3L A;  3HOU B;  2A74 C;  3DEO A;  1E2W A;  3NTI A;  1SEB D;  3PUY A;  2FJ2 A;  4ZUI A;  2SDF A;  3OIP A;  3J80 L;  1DXM A;  3SK8 A;  1KLG D;  3QIA A;  3D8G A;  2PZU A;  1MGS A;  3DWQ A;  4BA2 I;  1TKW B;  3TSS A;  5DNF A;  1Z47 A;  4G57 A;  4TKO B;  1K8M A;  1B53 A;  1Q1E A;  4WFN 3;  3D4R A;  1KAB A;  3K7A B;  2F0U A;  2MUY A;  2D9U A;  3QO2 A;  1I3Q B;  2ICE C;  3GD7 A;  3S1R B;  1D2B A;  1TWC B;  5M9O A;  1V1O A;  2WKD A;  3JAM E;  5KRU A;  3MC0 B;  3TP7 A;  2B39 A;  1O78 A;  4HTH A;  4IFD I;  1VF5 C;  4C1N I;  1CT1 D;  1OXU A;  4Z9C B;  1EY6 A;  4CKE A;  5TSS A;  5EBD A;  1BO0 A;  1O7L A;  3RZO B;  3PUW A;  1WTP A;  2PZW A;  2A73 B;  5KNB A;  5EBC A;  4BY7 B;  4OGQ C;  2KED A;  3BVG A;  2FMC A;  5I4D A;  5KIX A;  2K6A A;  4H13 C;  5E4W C;  4XQJ A;  4FP5 D;  3OOC A;  3P20 A;  1PRT D;  2R93 B;  2M00 A;  5HGT A;  1ESR A;  4KJO A;  3EFX D;  4WRD A;  1MSG A;  1O7Y A;  4QMG A;  3MFG A;  5I2Y A;  2BOS A;  4C3I B;  3QWN A;  1RJT A;  3MWY W;  1BXT A;  4DU9 A;  1T5X D;  1GHK A;  3VR2 A;  1CM9 A;  3BG3 A;  1J8I A;  1H9S B;  2K01 A;  4CKB A;  4DGZ A;  1SYG A;  1HRJ A;  5K36 H;  2RQX A;  1PMR A;  3MVV A;  3HRZ C;  2DNC A;  1S5E D;  2NVQ B;  1SXT A;  4LK1 C;  1EYC A;  1SSO A;  3CQZ B;  2JA8 B;  4RAU C;  1XYI A;  2Q8I B;  3T16 A;  3VYU A;  2DY8 A;  3H94 A;  2F0O A;  1H9M A;  4XXE A;  1CA6 A;  5EGT A;  4C56 C;  3S1Q B;  2IX3 A;  3HP3 A;  1FNU A;  4ODG A;  3WOF A;  1SYC A;  1BNZ A;  3E5S A;  2ICI A;  3P7J A;  1RKN A;  2PZT A;  2RDF A;  4O42 A;  1BR9 A;  1SNO A;  2KOL A;  1F2Y A;  4UDU C;  3GTO B;  4DAV A;  5C0X H;  3FKI B;  4K6L A;  5KGU A;  3E0J A;  5F2D A;  5KND A;  2F3V A;  5HUR A;  2AQ1 B;  1LT6 D;  1CFM A;  4KMU C;  5BN3 A;  4CHT B;  3GTQ B;  2FIN B;  2LKV A;  2L1B A;  3S1M B;  3ND8 A;  3S15 B;  4IFD G;  3I70 A;  1BOS A;  2RKS A;  2PPB C;  1ET9 A;  1XXG A;  1PYW D;  4HN7 A;  2E74 C;  4KD3 A;  2NBF A;  1QE6 A;  2SEB D;  3MZ5 A;  1CHQ D;  5ELB A;  1H9K A;  3RMH A;  1JOK A;  1GUW A;  3K5L A;  4KTA A;  1CZG A;  3HEJ A;  1V43 A;  2HDM A;  4G7O C;  2BDN A;  2QF7 A;  3H0G B;  4C3H G;  1JWU D;  2F0F A;  2O4X A;  3ERO A;  1OXS C;  3NK9 A;  3ERQ A;  1QCB D;  1IKL A;  1LAC A;  4K8J A;  4E6I A;  4F88 A;  1HCZ A;  1VMP A;  4M1U B;  2EYM A;  4H7B A;  1JWM D;  4BWG B;  3FDT A;  1RCV D;  1F77 A;  2JA7 B;  3GTK B;  3NWS A;  3DEP A;  5C3W A;  2F0N A;  5LHY 1;  2IJ0 A;  5E1F A;  3PUX A;  1LTA D;  1CK1 A;  1D6E C;  1Z6H A;  3SK5 A;  1QWY A;  1S5F D;  4IQZ A;  3SEB A;  1SYB A;  4JK1 C;  4DK1 A;  4EQO A;  3D3R A;  2IL8 A;  1E2V A;  1K83 B;  2JP1 A;  3H6M A;  2VXW A;  2EZV A;  4K2L A;  4IUN A;  5C44 B;  1AZP A;  1TU2 B;  3ITP A;  5BN5 A;  1I6H B;  2Z4H A;  1FNW A;  3PIP 3;  4A3K B;  5JEA J;  3GTP B;  4MN3 A;  3RUZ A;  2NTS A;  3E6Z X;  3PUZ A;  5J22 A;  4KY7 A;  4ZUJ A;  5AFW A;  3PIO 3;  2E75 C;  2L55 A;  5JEA H;  1PDQ A;  1WTX A;  5CV9 A;  1ZYR C;  5M5X B;  2F03 A;  3EVQ A;  5KNC A;  1JOQ A;  1ENF A;  3U9O A;  1I4Q A;  4CBV A;  4IUR A;  3MAQ A;  3DM1 A;  2EYJ A;  1XX8 A;  4XQN A;  2X6G A;  2NZ1 D;  1ENA A;  2F0V A;  1LTR D;  1U4P A;  3KUP A;  4K5W A;  1DZ1 A;  1CHP D;  1HFG A;  5EKI A;  3HGB A;  1B9M A;  3DUZ A;  2R92 B;  3QG1 A;  4R9W A;  2A6H C;  2D62 A;  3GV6 A;  2EJM A;  3I3C A;  1SJE D;  1H9S A;  2VNU D;  1SFO B;  4KHV A;  3T13 A;  1U4R A;  4HMI A;  4PMW A;  2RBM A;  5KYI A;  2B2V C;  1DCZ A;  1DOK A;  3TP8 A;  2V4D A;  2DY7 A;  4HMJ A;  1TR5 A;  1GHJ A;  1B9N A;  1TS5 A;  5FKA C;  4N9T A;  3S16 B;  4A3B B;  4CJ0 B;  2E2D C;  4BY1 B;  3C46 A;  1G2T A;  4OHJ A;  4NMZ A;  4ZK9 B;  2XN9 C;  1R4Q B;  1ML0 D;  3LWE A;  4U68 A;  5KEE A;  2C9O A;  1NR4 A;  1II3 A;  2KEC A;  3L3O C;  3A8J E;  1GUS A;  3T51 B;  4CKC A;  4IUV A;  2XRS D;  1A2U A;  1QIL A;  2NN6 H;  1DON A;  1KTK A;  1NCV A;  4PMB A;  3NSW A;  3SR1 A;  3M85 A;  1WD0 A;  1I4X A;  5I9P A;  5IOD A;  2HQE A;  2KEE A;  2EVB A;  1PTO H;  1MI2 A;  2WV6 D;  4K8I A;  2B2V A;  4TSS A;  4QUC A;  5IGE A;  2XNA C;  1NR2 A;  3LWU A;  1STG A;  5I6Y A;  3I91 A;  2E76 C;  2OEO A;  4XT3 B;  4G4K A;  2LFN A;  3TN2 A;  4TRD A;  4X3K A;  1QB5 D;  1W6K A;  1EOT A;  4C1N K;  3OWE B;  3QB3 A;  2EY5 A;  1I4H A;  2F0E A;  1X3P A;  1EU3 A;  1QNK A;  1K8O A;  3MHB A;  1EU4 A;  1ZKO A;  3S2H B;  4B08 A;  3VR6 A;  4RHR A;  2DN8 A;  2TMP A;  4G7H C;  4KV6 A;  4DFA A;  2E2H B;  3IAY A;  2C5C A;  1HA6 A;  4RH6 A;  4J6H A;  4IZ8 A;  3Q6S A;  1ILQ A;  3U9S A;  1EWH A;  1XTC D;  2O5I C;  3SK4 A;  2J0T D;  1A3U A;  2Y0S B;  1RTO A;  4KKT A;  4K6D A;  3DWP A;  1L0X B;  3K5O A;  3PO3 B;  2XWJ B;  3AMU A;  1BCP B;  1CA5 A;  2F0T A;  1I4G A;  3M7N A;  1OXT A;  2Z1C A;  1LTG D;  1ENC A;  5J39 A;  3MTS A;  3BS1 A;  2PW7 A;  1G6Z A;  5FLX L;  3ND9 A;  2QKI C;  2F4I A;  5JVH 3;  2JYO A;  3O13 A;  2D5D A;  2EY2 A;  3FPU B;  1X3Q A;  2ZXP A;  3I8Z A;  4OO1 H;  1HQR D;  4R8I A;  2F0J A;  3H3V C;  4S3S A;  2DNE A;  3D4D A;  3BDO A;  1SND A;  1GJX A;  1HHV A;  1RTN A;  2F0I A;  2HCI A;  2RSN A;  3N52 A;  3HOX B;  1EZ6 A;  2R6G A;  1ZYR D;  2PQE A;  1PFB A;  3WDN A;  2CVR A;  5EPL A;  4RGT A;  5FOB B;  3K59 A;  1PTO B;  3J81 L;  3BDC A;  2NB0 A;  3V96 A;  2EYL A;  1OXV A;  1EY9 A;  1TQO A;  2CQA A;  3IL8 A;  3FVQ A;  1SYF A;  2BDO A;  4AYB B;  5JJZ A;  2A6H D;  1DD2 A;  5FO7 B;  2XRQ D;  1FYC A;  5A35 A;  1TII D;  3R2I A;  4DXG A;  3S17 B;  5DM7 3;  4QB4 A;  2IPK D;  3A54 A;  1CI3 M;  5CR3 A;  2PYK A;  2K05 A;  3HG9 A;  4K2K A;  4CGY B;  3K0Y A;  4DNR B;  1TVX A;  4RCO A;  1Z7T A;  1JQY D;  4LJZ C;  2K04 A;  4A3G B;  5JVG 3;  4ILW A;  3NE5 B;  2L9H A;  3RD4 A;  3R3O A;  3NBH A;  1Y8O B;  4R8N A;  4RCN A;  4H44 C;  1BCP F;  2A69 C;  5IGD A;  1WTW A;  1EEI D;  2L5T A;  2H4O A;  2R7Z B;  3TME A;  4DAP A;  1CQF A;  2EYO A;  4G7Z C;  2FFK B;  1EIH A;  4A93 B;  3T4A C;  1Y1W B;  2HUG A;  4DA2 A;  2F0D A;  1EWC A;  1UUP A;  2N55 A;  2B2T C;  1B44 D;  4A3E B;  5C0X J;  4Q5V A;  1QG7 A;  3NTK A;  4QIW B;  2A5H A;  1GUG A;  2K33 A;  2RDH A;  1SNP A;  4ZKC B;  3NQT A;  3X3M A;  4LMQ D;  3I4L A;  4HR7 B;  3JAM L;  1S5D D;  2NUC A;  2ZXR A;  4Y7N B;  5JPM C;  1O80 A;  2AWO A;  1G2S A;  3OW7 A;  2MPM A;  1IW7 C;  2KJX A;  3C2P A;  4X3S A;  1PTO F;  4ZYS A;  1HFN A;  2R3Z A;  4YIJ A;  1BCP C;  4MHE A;  1ESF A;  4WJW A;  2BCO A;  3R2T A;  5CV8 A;  2Z8L A;  3D31 A;  1C48 A;  3Q0A A;  1TWH B;  2B2T A;  4KKS A;  4EGV A;  3TZD A;  4IUU A;  2IWH A;  1F2L A;  3OWF A;  1A6X A;  1RHP A;  4OIK A;  5IGG A;  1AFP A;  2E2I B;  5COY A;  2A68 C;  1B2T A;  4HED A;  5T1I A;  1A15 A;  1MD2 D;  2QIL A;  3T53 B;  1NAP A;  1SE2 A;  4KN7 C;  4C3J B;  2EDG A;  3BYY B;  2D2C C;  3KLR A;  1SNC A;  3BDL A;  3A56 A;  3BVZ A;  1HUM A;  2L0C A;  2EPB A;  1DJR D;  4HCE A;  4XDX A;  1AEX A;  1SE3 A;  4DXF A;  2I07 B;  4KHZ A;  3R93 A;  1STE A;  3GO5 A;  3K5M A;  3P75 A;  2MGS A;  3KBG A;  3GQB A;  4ULL A;  5M3F B;  3EJI A;  3IFT A;  4QUF A;  5IT9 E;  5ELC A;  1SMY C;  4C3I G;  3EQL C;  3L7Z C;  4C2M B;  4QF4 A;  3SK6 A;  1TY0 A;  2MJ8 A;  1ONL A;  1AP0 A;  3I90 A;  3MXG A;  5NUC A;  5LL6 S;  3D6C A;  1EEF D;  1WTQ A;  1QOH A;  3AB9 A;  5CBA E;  5M5W B;  1F9S A;  2NVX B;  1C4Q A;  2NVY B;  3X3N A;  3J7A F;  4DK0 A;  1KAA A;  4XIG S;  2EJG C;  2NTT A;  3IFD A;  1VCI A;  3A8I E;  4XT1 B;  3MXN A;  2IT1 A;  1WTO A;  4DN4 M;  4CJ1 B;  5C6A A;  1CTM A;  4NW2 A;  5KYL A;  3CRK C;  2F3W A;  3S2D B;  1NUC A;  4BS9 A;  1JE4 A;  3FPP A;  2G9D A;  2B8F A;  5C0X I;  3HOY B;  2GA4 B;  1WD1 A;  4U67 3;  5D14 A;  5D3I B;  2ID0 A;  2IX0 A;  4BBS B;  2L12 A;  1V1P B;  2EY6 A;  4EQP A;  1DYQ A;  3K5N A;  3G7L A;  4I65 A;  1JOR A;  1STB A;  1GXD C;  3DXJ C;  2PW5 A;  3RZD B;  3F2U A;  4PQX A;  2FMM A;  2A69 D;  4ZKB B;  1SJH D;  1LT3 D;  3NBI A;  4FF1 A;  1U4M A;  1YNJ C;  2ZXO A;  4OIJ A;  1IYU A;  4M8A A;  4FF3 A;  4FO2 A;  2KHS A;  5IGF A;  1SYE A;  1D5Z C;  3VR5 A;  5IGB A;  2M2L A;  2B8G A;  3TDQ A;  3MXP A;  4V0B A;  1LV9 A;  1J9O A;  1PLF A;  2EYP A;  3NTH A;  3QOL A;  5EQ0 A;  5C5L A;  2NYZ D;  2WB1 B;  1RD9 D;  1GUN A;  1EL0 A;  4FYD A;  1F9Q A;  4HAE A;  1RF2 D;  3D4W A;  4F87 A;  3T56 B;  3NPP A;  4K14 A;  4IUP A;  1B4O A;  5T1G A;  1JOO A;  4IFD H;  5CMD A;  4KKU A;  1IW7 D;  2EJF C;  1C8C A;  2KCC A;  1LTT D;  2KCN A;  1BCP D;  1Q8I A;  2RVL A;  1Q3L A;  5BN4 A;  3I4M B;  4H0L C;  5K36 G;  2AQ3 B;  3IKJ A;  3KBX A;  2JE6 I;  5ISR A;  5G3L F;  3OSO A;  5DEH A;  4KY5 A;  1T5E A;  4FXG C;  3W3A A;  4X3U A;  4QCL A;  4A3D B;  2Z4I A;  2A68 D;  3V05 A;  1WTR A;  2BA0 A;  5EPK A;  2VB2 X;  3OPO A;  2JEB I;  2BE5 C;  3TBI B;  1I4P A;  1Q12 A;  1SYD A;  1SE4 A;  4KK7 A;  5E4X A;  1OO9 B;  1TWF B;  1S4Z A;  1Y8N B;  2PNR C;  2BA1 A;  2Q8T A;  3PV0 A;  2N88 A;  2SNS A;  5C3E B;  2VB3 X;  1WTV A;  1E2Z A;  1EY4 A;  2B2W C;  2EYH A;  2F0H A;  4RGN A;  5C0X G;  2B2U C;  1U4L A;  3HOV B;  4A3F B;  1HTP A;  1HUN A;  2L11 A;  3A7A B;  1STN A;  2ZT9 C;  1STY A;  2EXZ A;  4DAY A;  3BYT B;  1SNM A;  1TT2 A;  5JPN C;  2MP1 A;  1SMY D;  1EY0 A;  4KJN A;  5I9O A;  2VUM B;  2AUK A;  3J7Y W;  2LMC B;  3GP7 A;  4HSV A;  4B9W A;  4DF7 A;  1UNS A;  4RGM A;  2OXP A;  3HOW B;  2YYZ A;  2K03 A;  1ILP A;  2F0W A;  2A6E C;  3CHB D;  3OMC A;  4ZRZ A;  1D5X C;  4MIU A;  1KDC A;  4JBW A;  2OT2 A;  5ELF A;  2B2W A;  1SBB B;  3V2T A;  4ZLT F;  1PFM A;  3NWT A;  2PCF B;  3KLS X;  3PUV A;  4TQU S;  4FF2 A;  1HPC A;  2B2U A;  2CHB D;  4B9X A;  4BA1 I;  3K58 A;  2F0L A;  1GUO A;  3SXH A;  1YNN C;  1IKM A;  2SOB A;  5E3F A;  4IUT A;  4RWS C;  5FO9 B;  3BVM A;  5CV5 A;  4FVM A;  4F7X A;  1LO5 D;  1H9J A;  3NUC A;  2OF1 A;  5J1Z A;  1E0B A;  3HS0 C;  1EY8 A;  4XQQ A;  2NN6 I;  1TWA B;  2K32 A;  5ELD A;  2Q8R E;  2K5D A;  4C3H B;  3VYT A;  2RA4 A;  2K7V A;  1PFN A;  1G29 1;  1WCM B;  4CJ2 C;  3HOZ B;  1LAB A;  1I6V C;  1YNJ D;  2CW0 C;  1EY5 A;  1V1P A;  5CGK A;  1G91 A;  1DOM A;  3C1F A;  2EE1 A;  3CU7 A;  2QDB A;  4GZY C;  1FR3 A;  1W6J A;  1TY2 A;  3VYR A;  1EQT A;  3M7G A;  1Y1V B;  2ENB A;  3DMU A;  3SE0 A;  3A7L A;  3MFY A;  3CKI B;  1SNQ A;  2M9V A;  3VA5 A;  3G6J B;  3SVM A;  2XWB B;  1MSH A;  2RSO A;  4O1N A;  3TZU A;  1EIG A;  4FXD A;  5C5M A;  1PZK D;  1GUT A;  4KI0 A;  2JA6 B;  4NP5 A;  1IYV A;  1TS4 A;  1KDB A;  1V8Q A;  1HTL D;  5JEA G;  3WOE A;  3K6O A;  5CYU A;  4HCS A;  1A3V A;  1KDA A;  3VYS A;  2HDL A;  1JCK B;  3GTL B;  1D5M C;  4J1M A;  1F9P A;  1QJO A;  2IW3 A;  4NDX A;  1A3T A;  4UAI A;  2TSS A;  3PMF A;  1GOZ A;  2I46 A;  3H91 A;  2X6L A;  1PRT B;  2QCP X;  1A2T A;  4OO1 I;  2BE5 D;  3PO2 B;  1NSN S;  1HXY D;  2F1M A;  2QEJ C;  5IOC A;  4WOR A;  5I6W A;  4ZQ3 A;  2PO4 A;  3LNN A;  3TP6 A;  2EOT A;  1LT4 D;  2WIN B;  1SDF A;  2B2Y C;  3QJY A;  4DNT B;  3KF8 A;  1G8Z D;  1DM0 B;  1CZW A;  3N6R A;  5EPJ A;  2JSO A;  1EY7 A;  3TP5 A;  2NVT B;  3OIQ A;  1BBX C;  1QNU A;  4P2C B;  2K5Q A;  1M4V A;  1LLR D;  4IN3 A;  3VR4 A;  1XWE A;  2FHT A;  3GTM B;  2E2J B;  2WP8 J;  4ABN A;  4X3T A;  1BQQ T;  1FNV A;  2NN6 G;  5M5Y B;  4FF4 A;  2O5J C;  2AWN A;  5G3L D;  1LTB D;  4BBR B;  3MXU A;  1UAP A;  2A6E D;  3C1E A;  2WAC A;  5K5P A;  1D1I A;  1B3A A;  1DOL A;  1TWG B;  2KVM A;  4K5X A;  5FK9 C;  3NHH A;  1F2Z A;  2B2Y A;  2PMZ B;  3UI2 A;  2YU9 B;  1PTO C;  1Y69 U;  3H09 A;  2J7Z A;  4FXK C;  3OMG A;  4Q0F A;  4L63 B;  1KLU D;  3GTG B;  1UEA B;  2K5W A;  1AN8 A;  1IL8 A;  2J4X A;  1PXU A;  5LL6 X;  5CC4 A;  1YNN D;  1EFI D;  4ME5 A;  1D1K A;  3FMC A;  1MBY A;  3BZD B;  2KA7 A;  3VA7 A;  1X32 A;  3NP8 A;  5A2Q E;  3DHQ A;  1O7Z A;  1Q1B A;  4ZAI A;  1PRT F;  3URY A;  5C3X A;  2F0G A;  2AUJ D;  2AQ2 B;  1JB3 A;  1JC7 A;  1SAP A;  2K28 A;  2F0Q A;  3Q22 A;  1RDP D;  3Q24 A;  2CW0 D;  4PMC A;  3S9W A;  4KD4 A;  4XYQ A;  5FO8 B;  3D6W A;  2SNM A;  1STH A;  1LTS D;  2WII B;  3FRP B;  4NKL A;  1S5B D;  3I73 A;  1AZQ A;  5I2X A;  1F9R A;  4EQN A;  5C4X B;  2HCC A;  3S1N B;  3M4Y A;  1VMC A;  3FEW X;  2B63 B;  4OO1 G;  1EZ8 A;  3W2D A;  4K5V A;  3ZYY X;  1BF4 A;  1BUV T;  5D65 A;  3SDZ A;  2G9H D;  1JIC A;  3NQI A;  4HSP A;  1TS2 A;  1PZJ D;  4RKL A;  3EA6 A;  1FD7 D;  4I7Z C;  1VDZ A;  1KNE A;  4A3M B;  4PV1 C;  3GTJ B;  1I4R A;  1PRT C;  4IUQ A;  1R9T B;  4IAL A;  2KUM A;  2O2L D;  2F0K A;  1FGB D;  3KLS A;  1AW7 A;  2EYF A;  2XVS A;  4A3J B;  1ZXT A;  4RGO S;  2WKC A;  1LT5 D;  3J80 E;  1VF7 A;  5IGC A;  1LTI D;  3A55 A;  1CQV A;  4A3I B;  5FLX E;  3K57 A;  4XTC S;  5CV4 A;  5JOB A;  1I50 B;  3Q23 A;  1ROD A;  4IFD J;  2MHV A;  2K1B A;  2F0S A;  1B1Z A;  2EY1 A;  4RKB A;  1BDO A;  4FNF A;  2XIW A;  5IIF A;  3A8K E;  2X69 A;  5IT9 L;  3J7A V;  1JWS D;  1OXX K;  2NWG A;  4C3J G;  4LAA A;  1EYA A;  3I72 A;  1ZEQ X;  5C4Z A;  4N9P A;  5EJW A;  5CV7 A;  1B50 A;  2F0P A;  4XYO A;  5CBE E;  3KK7 A;  5A2Q L;  3M4O B;  4RA8 A;  3L9A X;  3VR3 A;  5ELE A;  2IX1 A;  3LX0 A;  1STA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...