3U4ZA

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
TLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDDQRKVITYNQEQGVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
total genus 17
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u4zA00
1I3QH 4JI2Q 1L1OB 1NMFA 1TWAH 5EAYA 3W5OA 2ZM6L 3S14H 1JMCA 4DR7L 1HR0W 2KHJA 2F52A 3UE1A 4R4TA 1VS0A 1B8AA 1UEBA 2UXDL 2WB1E 4X66L 4L5TA 4BA1I 3HOXH 4MNOA 4QIWE 4A4IA 1Y1VG 1VQIA 2A19A 4DV0Q 5GAGC 5M3FG 5H1SE 1HNWL 3T1HL 1W2BA 2GVBA 1XPUA 2ID0A 2UXDQ 1C0AA 5LMNQ 4YCUA 3CC7A 1HNXL 4B3SL 3S17H 5FJ8H 4JI6L 4LFAL 1CKOA 3CW2C 1HNWQ 3JC66 3PUXA 3T1HQ 1Q12A 1PH6A 4BXXH 5HY6A 4A3CH 4HIKA 1AE2A 5IY0A 4BY7H 3CCUA 1HNXQ 3CP0A 4UP9A 2B63G 2CQOA 2LSSA 1EQRA 4LFAQ 3RN2A 4JI6Q 2R93H 1TWFH 1SN8A 2YV5A 4A3EH 4B3MQ 1VQ6A 1TWCH 3G71A 4OWXB 2NVXH 2CWPA 4P71A 1NY4A 3WWVA 4DKAC 1IL2A 3ULPA 2BH8A 4JBKA 4A3GH 1Q82C 3KF6B 4GNXB 2C35B 2LXKA 4A93H 2D62A 5M5XH 4KI0A 1PH5A 2YTYA 1UE6A 2VS1A 3CCSA 1QZHA 1K9MC 2B63H 3NEMA 4MZ9A 1KAWA 2EIFA 4DUZQ 1KIXA 4A3LH 1KHIA 2K52A 1S40A 1M1KC 4JI0L 1NE3A 1NMGA 4H02A 3IRBA 3GDEA 1X6OA 4LW1A 4OONA 5M5WH 3CCMA 4HIDA 1VQPA 3BU2A 4AYBE 3CF5A 1YHBA 1N34Q 1PH1A 2BA0A 1VCIA 1I94L 1Y14B 4JI0Q 4A3DG 4JBWA 1RIPA 2NZHA 1UE7A 3S2HH 1B70B 3K8AA 3A74A 3H0GH 4A3KG 4BY1G 3CCLA 2ATWA 4KHPL 1BKBA 1IBKL 2UXCL 2QGQA 2LXJA 4LF4L 4NB3A 4AH6A 1M90C 1I94Q 3KF8B 1K8GA 2VUMH 2JK8A 1GKHA 3A5UA 1KC8C 4DR1L 1SLJA 2K75A 2ALYB 1J5EL 3JAMc 4L5SA 4PMWA 3GTMH 3F2BA 1Z47A 4NPSA 1IBKQ 4KHPQ 1ASYA 2KCMA 3GO5A 1HNZL 1KL9A 4YHHL 5IYDG 3TREA 3PO2G 4P72A 2AWNA 4LF8L 2D0PA 1CKNA 2ZTCA 3MEFA 3I4NH 2UXBL 4DUYL 2MO0A 1XJVA 1XPOA 2AWOA 2IX0A 1SROA 3D0FA 1Q7YC 1NBWA 3KJOA 4LF8Q 2I0QA 1VQDA 2R7ZG 1N32L 2UXBQ 3RR5A 4Y7NH 4DV2Q 1XMOQ 3PIOA 4JI8L 2RF4A 2WFWA 4A3BH 1WYDA 2R7FA 2UUBQ 1JB7A 1N32Q 2PI2A 1CSQA 5IYBG 4X6AH 3TS2A 3K80C 2L15A 2JQOA 3CCEA 4DV5L 4JI8Q 3G48A 5GADC 1A8VA 3CPFA 4BBRG 4GOPA 3HOUG 3PO3G 1KRSA 4GN5A 1XTDA 2JJQA 1OXTA 1WI5A 4JYAL 2PQAA 2R7DA 2ZJRA 2K5NA 2ZJQA 4A3MG 1XNRL 2R7ZH 1SRUA 1T9HA 3JAMi 4LFBQ 2ES2A 4P73A 4X64L 2BA1A 2VQEL 5ELNA 4JYAQ 2RCNA 3KDFB 3HOUH 4JI5L 2Q2TA 5GQOA 4X65Q 2ASBA 1XNRQ 1D7QA 5BR8L 1XPRA 4WJ4A 3L7ZC 3D31A 1N33L 4X64Q 1V1QA 4X62Q 3OW2A 3I4MG 3PUVA 3RLFA 5IWAL 1X3FA 1TWGH 1I5FA 2I5MX 3U50C 1KQSA 5BR8Q 1C7YA 2NZOA 5GAEC 4A3MH 1X9NA 1JE5A 4R1JA 2UU9L 3HKSA 2GN5A 1YJNA 2XTIA 1Z9FA 5IT9c 4IO9A 2PMZE 5IWAQ 4B3RL 4PZ8A 1KRTA 3ULLA 4RG1A 5LMNW 1YITA 1MIUA 1WCMG 1GM5A 1VQ7A 4IFDJ 4LUVA 3CD6A 3T1YL 3M4PA 2N8NA 2B29A 4GOPC 2HIVA 1HZBA 3DM3A 3I4MH 1VQFA 3K7UC 2R92H 5JJLA 4R4QA 3L2PA 2ZM6Q 4DR7Q 5M5YH 5IYCH 2ZJPA 1CKMA 1VQEA 4R4IA 5K36G 2I5HA 3PUYA 4X66Q 4A3JG 1PVOA 3CAMA 2JEAI 4ME3A 1EIFA 1QVFA 4LF9L 4LF5L 3NENA 1PYSB 3B6YA 4B3SQ 2EQSA 1HZCA 2PI2E 3ER0A 2VW9A 4A3IG 4LF9Q 1YI2A 4GS3A 2VNUD 2Z0SA 2Q2HA 1IBML 4LWCA 2F4VL 1Y1VH 1TXYA 1SE8A 1GO3E 4YCVA 4QGUA 5M3FH 2I5LX 3PF4A 3S1QH 4JG2A 4O0AA 1HR0L 1I6HH 1K0RA 1UE1A 2VL6A 4DK6C 4A3JH 1WJJA 3KYHC 3PUZA 4AIMA 2QEXA 2YU9H 1YBYA 1HZAA 1IBMQ 2F4VQ 2A8VA 1A63A 1EWIA 1JJCB 3UDGA 1VQKA 3KLWA 1HR0Q 3CCVA 3M4OH 2QA4A 1D8LA 1PH9A 1VQ8A 4GKKL 1EIYB 3GTOH 3KJPA 1PFSA 4DV7L 1K3RA 3BJUA 4GLAC 3TQYA 4B3TL 1EYGA 2IY5B 4BA2I 3K7AH 2OWOA 1YVCA 4IFDI 3HKZG 4GOPB 1QUQA 1OXVA 4JBJA 1YHQA 2NVQH 1LUZA 3H3VI 4GKKQ 5JJKA 4JV5L 2PQAB 4PG3A 1E1TA 3RZOH 1BVSA 1NTGA 4B3TQ 3GTKH 2CKZB 2N78A 2JA5G 1YIJA 1N9WA 3M9BA 4RMFA 4LUZA 4GN4B 2ZTEA 4JI7L 4UP8A 3CC2A 1OXSC 3ICEA 1X65A 3RN5A 1VQLA 1Q1BA 4GLXA 1PHJA 4YCWA 2WAQG 2UXCQ 5FLMG 1AH9A 4JI7Q 4LF4Q 1ASZA 1JT8A 4LFCL 4MTNA 1K73C 3CCQA 5C4XG 2Q2UA 4LNQA 3BZKA 4DR1Q 4HJ7A 4A3DH 1E24A 1J5EQ 2E2IH 5AJ3L 1HH2P 4A3FG 4QQBX 4EQ5A 4P74A 4DR5L 3HOYG 1VQHA 2MO1A 4IPCA 4AQYL 3CMEA 4A3KH 1HNZQ 4BY1H 4LFCQ 4YHHQ 3AYHB 3M85A 4DV6L 1QVGA 2JA8G 3ERSX 3G4SA 4EX5A 2AKWB 4DUYQ 1X54A 3RZDH 4DV4L 2Y0SG 4DR5Q 3A0JA 3CPWA 4HJ8A 1RL2A 3S1MH 1FGUA 2R6GA 3I56A 3OTOL 4DR2L 1JJ2A 4DV6Q 3AQQA 1OTCA 1FJGL 1X56A 4FDBA 5C4XH 3J80i 1K8AC 3HOZG 2JE6I 4BBSG 3PO2H 4WJ3M 5IYDH 4DPGA 4HJAA 1TWHH 2N49A 4GKJL 3CMAA 4K0KL 4LF7L 4UPAA 5JEAJ 2KCTA 3GTQH 3EBEA 5C44G 1XNQL 3GTLH 1I50H 3DLLA 2JA7G 4DV5Q 1N8RC 2JA6G 5C3EG 4KLKA 3U58A 1R9TH 3F8TA 2ZTDA 1V9PA 4K0KQ 2NN6I 5IP9G 4LF7Q 4GNXA 3AFPA 2N3SA 1G6PA 4TQUS 3RLOA 3PGZA 1H95A 2GVAA 1KXLA 1YJ9A 3HOVG 1EQQA 5IYBH 4DNIA 2KENA 4OX9L 1BBWA 4JI1L 4QL5A 2E5LL 2VQEQ 4DV1L 1NJIC 4DV3L 1WFQA 4NXNL 2MNAA 1FVIA 1V43A 2AHOB 4L5QA 4OXPA 2K5HA 1CUKA 4BBRH 4ALPA 1EFWA 2E2JH 4JI5Q 1VQNA 3KFUA 3MXNB 3I7FA 1Q81C 2E2HH 4JCVE 4OX9Q 2DUDA 4JC0A 3U4VA 1N33Q 5IP7G 1LYLA 4DV1Q 4NXNQ 3S15H 3ZJYC 3J7ZC 3FKIG 3J81i 3F2CA 1IZ6A 3H15A 2CWAA 3CCJA 1E3PA 1WOCA 5JEAG 1PH2A 4LF6L 3M3YH 2KHIA 4KHZA 3CXCA 3HOVH 4C3HH 2E8GA 3Q8DA 1E7ZA 5DLQE 1EUJA 4DAYB 1PH4A 2UU9Q 4OWWB 1J6QA 1QVCA 2JA9A 4YWKA 5M3MG 3M7NA 2EXDA 3EN2A 4LF6Q 3STBD 2E5LQ 4DR6L 4B3RQ 1QUQB 4DAMA 1U5KA 2NN6G 3T1YQ 1G51A 3E0EA 1UWVA 2K4KA 4GNXC 2YTXA 3HOXG 3S16H 5IP7H 2YYZA 2RHQB 1UE5A 1VQCA 1MKHA 3SGIA 2Z6KA 1MJCA 1LM0A 1VQOA 2NVTH 1WCMH 5FJ8G 1X3GA 5ELOA 3K0XA 3J81j 3I2ZA 4A75A 1IYJB 4JI4L 3UDIA 4OO1I 4IJLA 3AEVA 3GD7A 1OXUA 5M3MH 4BXXG 4IJHA 4A3CG 4DV0L 1E22A 4BY7G 3TEHB 4DR3L 1VQ4A 3FP9A 1Q46A 3FHWA 4GLVB 4QJFA 2RHSB 1DGSA 4JI4Q 5LMNL 4IFDG 1CKNB 4LF5Q 2R93G 1Q1EA 1Y1WG 4A3EG 4DR3Q 1XMQL 5C0XI 4NXML 4UP7A 5IE8A 1P16A 3STBC 4XTCS 3OYYA 5C0XJ 3VDYA 3NELA 2PNHA 1A62A 1IBLL 3HKZE 2WB1G 1YNXA 2HT1A 4A3GG 3NBHB 3TS0A 3S2DH 3RLNA 4A93G 1XMQQ 4JI3L 4NXMQ 5LMUL 4HJ9A 1E1OA 1L0WA 3KDFA 3RNUA 2HQLA 4IPDA 2A1AA 4A3IH 4B3ML 1GVPA 1IBLQ 3PIPA 4A3LG 1VQGA 1X55A 2Z6KC 1Y1WH 2WP8J 3PF5A 4JI3Q 3S1NH 3AFQA 4C2MH 5LMUQ 4OO1G 5C4JH 4JOIA 2VY3A 4DV7Q 4P75A 4YY3L 2UUAL 2OTJA 3J80c 3M4QA 2WAQE 4IPGA 3E9IA 5E7NA 4DUZL 5GAHC 1PH3A 2OQKA 4POGA 3LGJA 3HOWG 2UUAQ 3H0GG 4YY3Q 1EOVA 1GD7A 1PH8A 4JV5Q 1YHAA 1G291 2OCEA 3CCRA 3PCOB 1N34L 2VUMG 3PSIA 5JJIA 5C0XG 1L1OA 1Q8KA 1N36L 1S3OA 3F2DA 3CQZH 2AMCB 3UDFA 2MFIA 2Y0SE 1S72A 3HFZB 1CSPA 4APVA 4OWTB 1N36Q 3I4NG 1IXRA 2VQFL 2JA5H 3GTGH 3J7A5 3A5ZB 3HOWH 2DGYA 1HJPA 1VQAA 2V1CC 3F1ZA 4JBMA 3E9HA 3BZCA 3ULJA 5AJ3Q 4R4CA 4AYBG 2KBNA 1W3SA 4QY7A 3GTJH 4JOIC 2VQFQ 4AQYQ 1SFOH 1B7YB 1VQ5A 1PV4A 5FLMH 3I55A 3J81c 4A3BG 1YEZA 4DV4Q 1VQ9A 2YTVA 1L2FA 1BBUA 1OXXK 2B3GA 1SR3A 3OTOQ 4DR2Q 4A3FH 1YJWA 4YWLA 3HOYH 1FJGQ 2BH2A 4DV2L 1XMOL 4TVAB 4L5RC 2JA8H 3UE0A 1PH7A 1L1OC 2IHFA 3KOJA 2UUBL 4GKJQ 1AE3A 2K5VA 3H3VH 3KF6A 4UY8C 4YWMA 2UUCL 2Q2IA 4LUOA 5J3BA 1XNQQ 4O2DA 3GTPH 1JJGA 1U0LA 2CFMA 3HOZH 4PZ6A 4BBSH 3U4ZA 2CCZA 4DR4L 2K50A 2VZAA 4J15A 4HIOA 3K81C 1A0IA 2H5XA 2UUCQ 2K14A 4HJ5A 1VQBA 1LTLA 1X3EA 2IHEA 2NVYH 2HIXA 2HHHL 3CC4A 4LFBL 5C44H 4DR4Q 4Y52H 1QZGA 1MJEA 4A76A 2JA7H 4JI1Q 2JA6H 3W1BA 5C3EH 4XIGS 4HIMA 4DV3Q 1HZ9A 4X65L 1K83H 2F3IA 3EIVA 3S24A 2D0OA 1PA6A 3PV0A 5IP9H 1Q86C 2IX1A 2HHHQ 2OTLA 2JEBI 4X62L 4GN3B 4IPHA 4C3JH 4PZ7A 3S1RH 4DK3C 4IOAA 3L0OA 1KD1C 1P8LA 3G6EA 2FXQA 4IOCA 1O7IA 2R92G 1FL0A 1YZ6A 4C3IH 3TRZA 5IYCG 2IT1A 3W1GA 3I4OA 3PUWA 3UDXA 1C9OA 5HGQA 4JI2L 3FKIH 1VQJA 4DR6Q 2MQHA 1PYBA 2XGTA 5GROA 2OQ0A 4POFA 1SMXA 1VQMA 5FLXc 3PO3H 4R4OA
chains in the Genus database with same CATH superfamily
1TWAH 5EAYA 3W5OA 4DR7L 2OF1A 5IGEA 1R4QB 4BWGB 2F52A 1PZID 4XQJA 3UE1A 3VR3A 1NSNS 2NN6H 1RD9D 4X66L 4L5TA 1SYFA 4BA1I 4RAUC 1KNAA 3S2DB 2F0SA 4TKOB 4QIWE 2IW3A 1Y1VG 5IT9L 4DV0Q 3T1HL 4A3IB 1W2BA 2UXDQ 1ET9A 5LMNQ 1CKOA 2O2LD 3JC66 2PZWA 3EJIA 4KV6A 1Q12A 5IY0A 3J81E 1HNXQ 1EWHA 2B63G 3RN2A 2LSSA 2PCFB 5CV7A 5E4WC 2F0HA 2R93H 1SN8A 1J9OA 4J1MA 2YV5A 3CU7A 1NY4A 4DKAC 1SXTA 5G3LD 1LO5D 2BH8A 2QW7A 3HKZB 3CQZB 3MTSA 4EGVA 2NB0A 2LXKA 4KI0A 2CH4W 5ELCA 2Z9HA 2F0GA 4PMBA 5CV6A 5I2YA 3GTGB 2HCCA 1NMGA 4LW1A 1X6OA 4HIDA 4AYBE 2E75C 1YHBA 3DHQA 2ENBA 2BA0A 4KTAA 1RIPA 1UE7A 3S2HH 2B39A 3CCLA 1GUTA 4HTHA 4BY1G 4DK0A 1IYVA 2DJFC 1K8GA 2VUMH 2JK8A 1GKHA 1IKLA 1J5EL 1S4ZA 2PPBC 3GTMH 4NPSA 1ASYA 3GO5A 4H0LC 2A73B 4P72A 1ONLA 2AWOA 3DWQA 1IKMA 1NAPA 2R7ZG 1ILQA 4IN3A 2NVYB 1KLGD 1PZJD 5C44B 4JI8L 5A35A 3K6OA 2RF4A 3PIP3 1JB7A 1O7ZA 5EKLA 1K83B 2PZUA 1CA6A 1H9MA 2J0TD 4BBRG 4GOPA 3HOUG 5HURA 4GN5A 5IODA 2JJQA 2C5CA 2ZJRA 4A3MG 3FDTA 1XNRL 1SRUA 1T9HA 3JAMi 4J6HA 3SK5A 2ES2A 4P73A 4X64L 2BA1A 2F3WA 1WTPA 5L37A 1GUSA 3KLSX 2L5TA 2Z1CA 4JW0A 3TP6A 2ASBA 2HDMA 1VMCA 1BBXC 2FINB 5FK9C 2VB3X 3T16A 3SR1A 5IWAL 4K6LA 2I5MX 2BDNA 1TWAB 3A8KE 3HKSA 2EDGA 5C4ZA 2XTIA 1NNXA 2PMZE 4PZ8A 3OPOA 5LMNW 1WCMG 2HD3A 1VQ7A 4IFDJ 2EYPA 1G91A 1HZBA 4RGMA 4CDCC 1CHQD 1FNVA 2K6AA 1SYGA 4R4QA 1X3PA 4JK1C 5M5YH 1PFBA 2ZJPA 1CKMA 1DONA 1VQEA 4R4IA 2B2VC 2F0TA 2I5HA 5CV5A 4UHVA 4B08A 4I7ZC 4A3JG 2JEAI 2R93B 3VYUA 1EIFA 3BS1A 1PYSB 3B6YA 2EQSA 2F0UA 5TSSA 4GS3A 2VNUD 4QIWB 1Y1VH 2WIIB 4WRDA 2F4VL 4QGUA 4CDDC 1I6HH 2EJGC 4KKTA 2VL6A 4DK6C 1WJJA 4AIMA 1PRTF 3MFGA 1ESFA 3T53B 1FYCA 5JPNC 2NTTA 4CHTB 1D8LA 1STEA 1PH9A 4GKKL 1EIYB 3GTOH 3IAYA 4DV7L 1QE6A 4RWSC 4DAYA 5NUCA 5D65A 1EYGA 1HTLD 3G6JB 5CYUA 1LTSD 2NVQH 2VUMB 1LUZA 4JV5L 3BDOA 4Q0FA 2CKZB 3GTMB 1YIJA 4PNYA 4RMFA 3U9SA 2ZTEA 3I72A 3CC2A 3EQLC 1U4MA 3D4WA 1X65A 2BE5C 1Q1BA 4FF1A 1PFNA 1PHJA 4JI7Q 3V96A 2L0CA 4AYBB 1SYEA 3MZ5A 1V8QA 1RDPD 1I4QA 4DR1Q 4A3FG 3VR4A 3EFXD 2MO1A 1YNJD 4BY1H 2PW5A 4XQQA 4YHHQ 3G4SA 4DUYQ 4B9XA 2QDBA 2EJFC 3S1MH 3QIAA 2F0KA 4DR2L 1JJ2A 1OTCA 2TSSA 4ULLA 5LL6X 4K2KA 4IUVA 3J80i 3HOZG 2JE6I 1I6VC 3KLSA 3C3LA 4HJAA 4RCOA 1TWHH 1IW7C 4LF7L 4UPAA 5JEAJ 4C56C 1C48A 3GTLH 3E3XA 2FHTA 2JA7G 4DV5Q 4X3UA 5C3EG 3F8TA 2F0IA 4K0KQ 1D2BA 2NN6I 1PRTC 5IP9G 3AFPA 1LT3D 2N3SA 2LFNA 1MGSA 3L3OC 4TQUS 4FO2A 2KENA 3DUZA 4JI1L 4QL5A 5M9OA 2VQEQ 2HDLA 2E5LL 2EE1A 1IYUA 2MNAA 1EFWA 4BBRH 1WD0A 2E2JH 3HOUH 4JI5Q 1H9KA 3KFUA 1Z7TA 4OX9Q 1KDCA 1O80A 2IX3A 4GZYC 3J7ZC 3FKIG 1STYA 3J81i 3CCJA 1IZ6A 4DN4M 3NPPA 2F0JA 4J8QA 3URYA 5JEAG 1PH2A 5M5YB 3D6CA 3S16B 3KF8A 4MTKA 2JA9A 1SAPA 2EXDA 3EN2A 4B3RQ 1QUQB 2AUJD 4DAMA 3E0EA 1UWVA 3DXJC 1B53A 2PMZB 1VMPA 1WCMH 4QCLA 5FJ8G 1Y1VB 3K0XA 4MIUA 5G3LF 2SOBA 3UDIA 1I6HB 2RDGA 4IJLA 4XDXA 5M3MH 1OXUA 2X69A 2K01A 4IJHA 4DV0L 1SNQA 5C3XA 4DR3L 1VQ4A 3NQIA 1PRTB 4QJFA 4JI4Q 5LMNL 3TMEA 2JN4A 1CT1D 2BOSA 3GTOB 4KKUA 2E76C 4ZQ3A 5FLXL 5C0XJ 3VDYA 3NELA 2PNHA 2EVBA 3NBHB 2NVQB 3TS0A 5LL6S 1EU4A 1ICWA 3RLNA 1XMQQ 4A93G 4PMCA 4NXMQ 3RNUA 3PIPA 1X55A 2Z6KC 1Y1WH 4JI3Q 3S1NH 4C2MH 5LMUQ 4OO1G 5T1IA 2OTJA 1S5BD 1DOLA 3J80c 3M4QA 4IPGA 2KOLA 1RODA 1PH3A 2UUAQ 3H0GG 5A2QL 1GD7A 1PH8A 4ZAIA 2EPBA 2OCEA 3PCOB 1C4QA 2OEOA 5JJIA 5C0XG 1Q8KA 3AB9A 2DNEA 2RKSA 4YIJA 2MFIA 1S72A 3HFZB 3S1MB 3A56A 2WAQB 3C46A 4HSPA 3F1ZA 4ZCKA 3Q6SA 3BZCA 1TWHB 4QMGA 4R4CA 1E0BA 4JOIC 4K5VA 2WV6D 3I73A 3GTJH 2VQFQ 2F0VA 4AQYQ 1CA5A 3GTLB 1EY8A 3I4LA 1PV4A 5CBAE 3NWTA 3J81c 4HMIA 5CORA 4A3FH 2EZVA 2RCFA 1FJGQ 4L5RC 1WTHA 3TBIB 1PH7A 4K2LA 1L1OC 4OELB 2IHFA 3ZYYX 2K5QA 5IGDA 4GKJQ 1AE3A 1TT2A 4BBRB 3HOUB 2E2JB 3H09A 4YWMA 2UUCL 2Q2IA 1XNQQ 4FXKC 1TY2A 2CFMA 3LNNA 1UEAB 3HOZH 2CCZA 4DR4L 3H91A 4ZYSA 1LT5D 4HJ5A 1LTLA 1BOSA 2HIXA 3S1RB 1QZGA 1MJEA 4A76A 2JA7H 5C3EH 3EIVA 3S24A 3PV0A 5IP9H 1SE4A 3K59A 2MPMA 1F9SA 1X3QA 1SDFA 3QOJA 3SHLA 3R2IA 4HAEA 3IKJA 2RBMA 1EL0A 4PZ7A 3VYSA 1KD1C 1P8LA 3G6EA 4S3SA 4OHJA 1KNEA 2Z8LA 4RKLA 1A2TA 5K5PA 5M3MB 3I4OA 3GV3A 3FKIH 1BNZA 5JEAH 1ESRA 2XVSA 3QR8A 5EBCA 1RF2D 3R2TA 1XYIA 4I7AA 1ZYRD 4JI2Q 1L1OB 5EPJA 1LTRD 3OWFA 1HR0W 2N55A 4KY5A 2KHJA 4R4TA 1UEBA 1TQOA 2Q8IB 4MNOA 3A7LA 1HNWL 2A19A 5M3FG 5H1SE 1C0AA 3CC7A 1HUNA 3T56B 5FJ8H 4KMUC 1Y1WB 3EROA 3HG9A 4JI6L 4LFAL 3S1NB 4C2MB 3K5MA 1C8CA 3PUXA 4IUTA 1GUGA 1TU2B 1AE2A 4TSSA 2L4NA 1EQRA 1GJXA 2WB1B 3AU7A 1HCZA 3K5OA 3P75A 4B3MQ 4O1NA 1TWCH 3G71A 1CI3M 4OWXB 5CV8A 2A6HD 5CMDA 1HQRD 1TR5A 1HFGA 2J7ZA 1IL2A 4JBKA 2K5DA 3KF6B 1EEFD 4GNXB 2C35B 4A93H 2D62A 3DWPA 2VS1A 1T5EA 1FGBD 1QZHA 4ZUJA 2EIFA 3BG3A 2K52A 1S40A 1NE3A 4H02A 3GDEA 2A5HA 5AFWA 4OO1H 3CF5A 1KLUD 1PH1A 2FMMA 3GTJB 2MUYA 1I94L 1Y14B 2HUGA 4JI0Q 4R8NA 4A3DG 1B70B 3A74A 3H0GH 2B2YA 2LXJA 4AH6A 4A3FB 3A5UA 1PTOD 1STHA 5C0XH 1DM0B 4DR1L 1CFMA 1SLJA 3MC0B 4KHPQ 2KUMA 1IBKQ 1DD2A 3KBGA 2KCMA 2F0DA 1ZEQX 1KL9A 4YHHL 4ODGA 5ELFA 3TREA 5EQ0A 1V1PA 2D0PA 2UXBL 2ZTCA 4DUYL 1F2ZA 1XJVA 1IL8A 2X6LA 1XPOA 3HOZB 3D0FA 2SDFA 1NBWA 4LF8Q 1JWUD 4Y7NH 2F0FA 3DEPA 3K5LA 2JA7B 5C3EB 1N32Q 5IYBG 4X6AH 3DM1A 2I07B 4X3TA 4DV5L 1LTGD 3G48A 5JVG3 4CGYB 1XTDA 2NBFA 1TS3A 2K5NA 1F2MA 2VQEL 4JYAQ 2RCNA 5D3IB 4JI5L 3FKIB 1YNJC 1XPRA 3D31A 1LACA 4IUNA 1TWGH 1I5FA 5BR8Q 4ID6A 3OMCA 2NZOA 5GAEC 1JE5A 2GN5A 1F2LA 4IO9A 4B3RL 1YITA 2EYOA 2B29A 4GOPC 2XN9C 1LTTD 5C6AA 2KCCA 1VQFA 4RKBA 4DNTB 1TS2A 2RVLA 4KY6A 2ZXOA 3IFDA 1S5ED 2BDOA 2L1BA 1PVOA 3CAMA 4NKLA 4LF9L 1A6XA 1TWCB 2FMCA 1EWCA 5KGUA 2HQEA 2PI2E 2EYLA 3VA7A 4K8JA 1YI2A 3RMHA 1JOOA 2Z0SA 1IBML 4A93B 1TXYA 1SE8A 1GO3E 4G57A 4YCVA 5M3FH 1HFNA 1HR0L 4O0AA 2KECA 5KNBA 2A6ED 5E4XA 2QEXA 5CBEE 1YBYA 1HZAA 1MD2D 3TZUA 1A63A 1EWIA 4ABNA 3UDGA 1VQKA 3KLWA 3BDCA 1LABA 1T5XD 4FVMA 4U68A 3TQYA 4B3TL 2CQAA 4RGOS 3H0GB 1RTOA 1Y8OB 4BA2I 4KN4C 4GOPB 1OXVA 4I65A 2M9VA 1E1TA 3D4RA 1BVSA 3RZOH 1JQYD 2JA5G 3M9BA 4H13C 4LUZA 2I46A 1QJOA 2EOTA 5CR3A 1VQLA 4GLXA 1VF5C 2WAQG 2UXCQ 4F8MA 1AH9A 2ZT9C 4LF4Q 1BCPD 4LFCL 3CCQA 2L9HA 2QF7A 3GQBA 1B3QA 5C3WA 4LNQA 4Y7NB 3BZKA 3HEJA 2JSOA 1E24A 3LWUA 1BF4A 4A3DH 4IQZA 4DR5L 2VB2X 1VQHA 4AQYL 5IT9E 1SNDA 5KRUA 1HNZQ 3M85A 3KUPA 4DV6L 2XWBB 1Q90A 4EX5A 2AKWB 1X54A 3BVMA 2Y0SG 2KQ3A 1FGUA 2F0NA 1MSGA 1WTVA 5I9PA 3AQQA 1FJGL 2EYHA 3I90A 2EY6A 4GKJL 4KHVA 1GHKA 3GTQH 1HRJA 1XNQL 3BVGA 3DLLA 4KLKA 2E2DC 1R9TH 2ZTDA 2E74C 1TWGB 3EA6A 2DNCA 3PGZA 3RLOA 2GVAA 2B2UA 4C3JG 4DNIA 5IYBH 1BBWA 3NE5B 1TS4A 4DV1L 1V43A 2AHOB 2GA4B 4ALPA 2K5HA 3E5SA 4LJZC 1VQNA 4DAPA 3MXNB 2XSCA 2F0QA 4JCVE 2EYJA 3SK6A 4NXNQ 3F2CA 4LF6L 3A55A 3QJYA 4G4KA 2UU9Q 1E7ZA 4DAYB 2B2WA 3A7AB 3TN2A 5M3MG 4CJ0B 1U5KA 3ONAB 2K4KA 3S16H 1W6KA 1ZKOA 1VQCA 1G6ZA 1H9JA 4X3SA 1AEXA 1MJCA 1VQOA 3PIO3 1X3GA 5IIFA 3J81j 5M3FB 4A75A 1IYJB 4OO1I 3AEVA 4A3CG 3SEBA 4ZKBB 2F0MA 4GLVB 1Q46A 3SXHA 1FD7D 2XRQD 2RHSB 2KEDA 4IFDG 1CKNB 4LF5Q 1Q1EA 3WOEA 1Y1WG 3Q23A 3G7LA 2K7VA 2D2CC 5C0XI 4N8X1 5IGBA 1BQQT 3STBC 4XTCS 3OYYA 1IBLL 1A62A 4HSVA 2WB1G 1YNXA 2HT1A 1SJHD 3MHBA 3RZOB 4HJ9A 1E1OA 1H9SA 1WTQA 1LLRD 2XNAC 2ICEC 2A1AA 4IPDA 4B3ML 1GVPA 2KJXA 1PTOF 3MFYA 3SDZA 5FKAC 1PTOH 3NWSA 3PF5A 2AQ3B 3AFQA 5C5MA 1U4RA 3QG1A 2VY3A 1ZYRC 2NYZD 4P75A 1GUNA 4YY3L 5JAVA 2WAQE 5E7NA 5GAHC 4POGA 1LV9A 2K32A 4FF3A 1YHAA 4A3DB 4MHEA 3PSIA 2AMCB 4LK1C 5I6WA 2Y0SE 1JOQA 1N36Q 1KABA 2IJ0A 2PW7A 1IXRA 3MAQA 5IGFA 2JA5H 3J7A5 1XTCD 3A5ZB 3HOWH 5HGTA 1HJPA 1VQAA 3PMFA 5FO7B 5DEHA 5AJ3Q 1Y8NB 1W3SA 1I4XA 3GTQB 4WORA 2A6HC 1QCBD 4DV4Q 3UI2A 1R9TB 4PQXA 2YTVA 5DAUA 3OTOQ 3WDNA 4G7OC 3R3OA 4KD4A 3T51B 1CM9A 1F2YA 4N9PA 2L11A 1ET6A 4TRDA 2K5VA 2MP1A 3H3VH 2KHSA 2G9DA 4LUOA 3GTPH 4O2DA 4F87A 1HTPA 1U0LA 2EJMA 3U4ZA 4NW2A 1QNUA 2K50A 2VZAA 4XYOA 4ZRZA 1A0IA 3OHXC 1VQBA 1X3EA 2IHEA 1PTOC 4Y52H 1EIHA 4DV3Q 4NMZA 4RGTA 2HHHQ 2NTSA 4DGZA 4IPHA 4C3JH 3Q22A 5EJWA 2B2VA 3S1RH 4EVOA 4WJWA 2DN8A 3E6ZX 2R92G 5BN3A 1FL0A 4DFAA 4ME5A 1TIID 3TRZA 1SMYD 2MHVA 4N9TA 1KAAA 4DR6Q 1UUPA 4KD3A 2MQHA 3IFTA 1PYBA 5GROA 2OQ0A 3J7YW 1TKWB 3S14H 3VYRA 1JMCA 1JWSD 1GHJA 2UXDL 2FJ2A 2WB1E 4K6DA 5CV9A 4KN7C 5CGKA 2CHBD 1AZPA 5E1FA 4A4IA 3M4YA 4UDUC 5GAGC 1DJRD 1VF7A 2GVBA 4LAAA 1XPUA 1FNWA 1HNXL 2PO4A 2F1MA 5EKKA 1PTOB 3Q0AA 3T1HQ 4A3CH 3H3VC 4HIKA 2M2LA 3CCUA 3W2DA 2CQOA 4IFDH 1PMRA 2A74C 1TWFH 4FXGC 2NVXH 2CWPA 3WWVA 2KA7A 3DEOA 5FO8B 2WACA 4M8AA 1PH5A 1LTID 3CCSA 4U673 1B4OA 4CDEC 3DWAA 1KIXA 2JA5B 3TSSA 3J7AF 4RHRA 3U9OA 3HOWB 1MI2A 2G5DA 4OONA 3RUZA 5M5WH 3BU2A 1N34Q 1ICFB 4JBWA 2NZHA 1EQVA 3K8AA 2ATWA 2UXCL 1EYDA 5I4DA 2LMCB 2QGQA 4LF4L 1II3A 2F0WA 3FEWX 1SJED 2A6EC 2K75A 4XXEA 5I2XA 4PMWA 2G9HD 1Z47A 2RSNA 1NR2A 3VR6A 1BR9A 1HNZL 2Y0SB 2WKDA 2AWNA 3MEFA 2O5IC 1QILA 3GTPB 2MO0A 2H1EA 3SVMA 4WFN3 4G7HC 3VA5A 3SE0A 4M1UB 4FP5D 2XRSD 4DF7A 1K28A 5FLXE 4ZKCB 2X6GA 3KJOA 2I0QA 3VR5A 3BDLA 3JAML 4DV2Q 1XMOQ 3NBHA 3PIOA 2R7FA 4IALA 1K0SA 4O42A 5BN5A 2IWHA 3P7JA 1STBA 3NSWA 3CCEA 2B2YC 4JI8Q 3KLRA 1EOTA 3CPFA 4NP5A 4C3JB 4MN3A 1O7YA 2A68D 4RA8A 2PQAA 2ZJQA 2LS01 3A8JE 4LFBQ 1SEBD 4HEDA 1K8MA 5ELNA 5A2QE 3KDFB 2BCOA 1TY0A 2Q2TA 5GQOA 4C3HG 3CKIB 4X65Q 1XNRQ 4WJ4A 3L7ZC 4X64Q 2WINB 3D8GA 1B1ZA 3PUVA 3RLFA 5I6YA 1X3FA 4K5XA 4OGQC 3S14B 1C7YA 1W6JA 1X9NA 2UU9L 1DOKA 3T4AC 1PYWD 1ZXTA 5IT9c 1SNMA 5IWAQ 1KRTA 4RG1A 1GM5A 1B50A 5KNDA 4LUVA 3M4PA 4K5WA 2F0PA 2K05A 1A2UA 4CKCA 3I4MH 3K7UC 2R92H 1WTWA 4KY7A 2ZM6Q 1O7LA 4CJ1B 3N6RA 1L0XB 2F0EA 1HUMA 4L6TB 1TWFB 1QVFA 4RH6A 4LF5L 1XX8A 4OEMB 3JAME 4QB4A 2NVXB 2RDFA 4B3SQ 3MA2B 3VYTA 4R8IA 1EY5A 1V1PB 1M8AA 4LWCA 3PF4A 2I5LX 3S1QH 1ILPA 1RKNA 4JG2A 1K0RA 5J1ZA 3PUZA 3K58A 2YU9H 1A15A 5M5WB 1YNND 3H6MA 2F4VQ 5JJZA 1JJCB 1SYDA 2F3VA 3MEHA 3PQIA 3CCVA 3M4OH 3E0JA 1EFID 1PFSA 1K3RA 3BJUA 2B2TA 1PZKD 3K7AH 2OWOA 3TP7A 4EQNA 4GKKQ 1YHQA 5JJKA 3QB3A 3H3VI 3GTKH 1U9RA 2N78A 1N9WA 4JI7L 1LT4D 1OXSC 3ICEA 1IW7D 2QCPX 4KJNA 1DYQA 5FLMG 2IPKD 1HQMC 2L55A 1PRTD 3J80L 5D3DA 1UNSA 3X3NA 2Q2UA 4HJ7A 2V4DA 2E2IH 5AJ3L 1HH2P 4EQ5A 4P74A 3AYHB 2JA8G 3ERSX 1DCZA 3RZDH 4DV4L 1F77A 3A0JA 3CPWA 1RL2A 2R6GA 5ELDA 3OTOL 3I56A 3R8BA 3O13A 1X56A 5C4XH 1K8AC 2HCIA 4BBSG 1RTNA 1EIGA 3CMAA 3NUCA 1QOHA 4K0KL 1HPCA 5I9OA 4P2CB 1I50H 1R4PB 1N8RC 2JA6G 3U58A 4LF7Q 4IUQA 4GNXA 3J81L 1H95A 3TZDA 2F0OA 1YJ9A 1EQQA 4OX9L 4RFBA 1VQ6A 1NJIC 1AN8A 4DV3L 4FF2A 4OXPA 2QKIC 1CUKA 3I7FA 4JC0A 2RA4A 2XWJB 1N33Q 1WTRA 1LYLA 1VDZA 4CDFC 3I4MB 2R92B 4IFDI 2CWAA 2KHIA 3CXCA 5DM73 4C3HH 3HOVH 4N8FA 1PH4A 3HRZC 1TVXA 2D5DA 1CZWA 4YWKA 4F88A 4Q5VA 4DR6L 2Q8RE 1SE3A 2WKCA 3T1YQ 1G51A 4UAIA 3HOXG 5IP7H 2YYZA 1Y8PB 3OSOA 2RHQB 1CTMA 1MKHA 3SGIA 1A3TA 4JI4L 3S1QB 3GD7A 4BXXG 1D1IA 1E22A 2YU9B 4BY7G 3FP9A 1U4LA 1D6EC 4HN7A 3M4OB 1PDQA 4A3EG 3ND8A 1B44D 4DR3Q 3V2TA 3P20A 1XMQL 2B2WC 2ICIA 4NXML 5IE8A 1F9PA 1K8OA 2Q8TA 3K7AB 1SYCA 4A3GG 3D4DA 1BXTA 1SMYC 4JI3L 5LMUL 1L0WA 3GTKB 4EQOA 4A3LG 1VQGA 2R61A 5EPKA 3TDQA 5C4JH 2UUAL 1S5DD 3K57A 1F9RA 1QG7A 1ML0D 1CQVA 1KDAA 1RCVD 4IURA 3LGJA 3HOWG 2E2IB 1N34L 4X3KA 2R3ZA 4ZUIA 1HXYD 1XXGA 3RZDB 4IZ8A 4OWTB 4K8IA 2O4XA 3I4NG 2VQFL 5C4XB 2DGYA 2V1CC 4JBMA 1SSOA 3ULJA 1AFPA 1D1KA 4E6IA 3GP7A 1SFOH 3HOYB 2NWGA 1B7YB 1STNA 5FLMH 3I55A 1G2TA 4H44C 1I50B 4KJOA 1KTKA 4A3BG 3CRKC 3V05A 1VQ9A 5LHY1 4DK1A 1L2FA 2K33A 1YJWA 4YWLA 3SK8A 2BH2A 1GXDC 4DV2L 4TVAB 1XMOL 3BYTB 5COYA 2JA8H 3UE0A 3W3AA 4UY8C 5J3BA 4BBSH 2JYOA 1E2WA 4HIOA 3C1EA 4IUUA 3K81C 2H5XA 2UUCQ 2K14A 1JWMD 3CC4A 4LFBL 4HR7B 4C3HB 3HOVB 4DR4Q 1B9NA 1Q8IA 4C1NK 2JA6H 1HZ9A 4X65L 1PA6A 2Z6BA 2PZTA 1E2ZA 4GN3B 1H9SB 4C3IB 3MVVA 3K0YA 1RJTA 1EY6A 1O7IA 2SEBD 1YZ6A 1QB5D 5JPMC 5IYCG 3W1GA 2EXZA 4DXFA 3PUWA 3NXWA 1C9OA 3UDXA 5HGQA 4JI2L 1VQJA 1D5ZC 1EZ8A 2KVMA 3OWEB 4POFA 1SMXA 5FLXc 3NTHA 1I4RA 1I3QH 2ZM6L 1B2TA 1CZGA 1NMFA 2K28A 3FRPB 2A68C 5JVH3 1UAPA 1VS0A 1B8AA 2F4IA 1AZQA 4KK7A 3WOFA 3HOXH 3R93A 1ENAA 1VQIA 2ID0A 2FFKB 4YCUA 1SNPA 4B3SL 3S17H 3LWEA 4ZK9B 2AUKA 3CW2C 4H7BA 1HNWQ 5C4JB 1PH6A 4BXXH 3NHHA 5HY6A 2F0LA 4BY7H 1DOMA 3CP0A 4UP9A 2NZ1D 4JI6Q 4LFAQ 1Y69U 2ZXRA 1EY0A 2CW0D 2EY1A 4A3EH 1HHVA 5ELBA 2MGSA 3MXNA 3HGBA 4P71A 4ZLTF 3ULPA 2M00A 4A3GH 1Q82C 5M5XH 2DY8A 2YTYA 1UE6A 2K03A 2B63H 1K9MC 3NEMA 4MZ9A 1KAWA 1STGA 4DUZQ 4A3LH 3S2HB 1KHIA 4JI0L 1M1KC 3IRBA 4JPBW 4DU9A 3CCMA 1VQPA 4RCNA 2MJ8A 1SFOB 3NTIA 1VCIA 3HZXA 4A3KG 5KYLA 4KHPL 1BKBA 1IBKL 1D5XC 3Q24A 4NB3A 1M90C 4QF4A 1I94Q 3KF8B 2F03A 5IGCA 1Z6HA 1KC8C 5EBDA 1SYBA 2ALYB 3JAMc 4L5SA 2JA8B 3F2BA 1QNKA 1YNNC 4RGNA 2PQEA 5IYDG 3PO2G 1WVLA 4LF8L 4DA2A 1CKNA 3I4NH 4DNRB 4BBSB 2IX0A 1SROA 1Q7YC 1TS5A 1N32L 1PLFA 1VQDA 2UXBQ 1SBBB 5CC4A 2JP1A 3RR5A 1EY7A 3ITPA 2WFWA 4C1NI 4A3BH 1WYDA 2UUBQ 2JA6B 1MBYA 2A69D 1JCKB 1CSQA 2PI2A 3C2PA 3TS2A 3K80C 2L15A 2JQOA 1EQTA 2AQ2B 5GADC 1A8VA 3PO3G 1KRSA 2TMPA 4JYAL 1OXTA 1WI5A 2P5ZX 2R7DA 1X32A 3VR2A 2R7ZH 3A8IE 2KCNA 1LT6D 4OIJA 1I4HA 5ELEA 1I4GA 5C5LA 1D7QA 3D6WA 5BR8L 1EYAA 1N33L 1V1QA 4X62Q 3OW2A 3I4MG 3U50C 1I3QB 3K5NA 3F2UA 1KQSA 2OXPA 4A3MH 4R1JA 1YJNA 1Z9FA 1SE2A 3OW7A 3ULLA 1E2VA 3HOXB 1MIUA 3CD6A 5D14A 3T1YL 2N8NA 1WTXA 4QUCA 2HIVA 4XYQA 3S17B 1DZ1A 3DM3A 3NQTA 5JJLA 3I3CA 1JORA 3L2PA 4DR7Q 2LY7A 5IYCH 4BY7B 5J39A 5K36G 3PUYA 4X66Q 4FYDA 4ME3A 2B8GA 4A3EB 3NENA 1HZCA 3ER0A 2VW9A 4A3IG 4LF9Q 1EY4A 4A3GB 5EGTA 3MXGA 2Q2HA 5KIXA 5M5XB 1H9RA 3D3RA 1BCPF 2B63B 1J8IA 1UE1A 1STAA 2RQXA 4A3JH 3KYHC 1WD1A 1RHPA 4CJ2C 2OT2A 1IBMQ 2A8VA 5FO9B 3J7AV 2N88A 3AMUA 1HR0Q 2QA4A 2NUCA 5T1GA 1EYCA 2JXMB 1VQ8A 3KJPA 4GLAC 2IY5B 1NCVA 1YVCA 3MWYW 3HKZG 1QUQA 4JBJA 2PQAB 4PG3A 1NTGA 4B3TQ 4V0BA 1MHWC 3CHBD 1V1OA 2CVRA 2PYKA 4GN4B 1EY9A 2RSOA 4UP8A 1HA5A 3I4NB 3RN5A 4YCWA 4BY1B 5KNCA 1JT8A 1ASZA 1S5FD 1NR4A 4MTNA 4NDXA 1K73C 3ND9A 5C4XG 1XWEA 5EPLA 1LTAD 3H94A 3N52A 5KEEA 1J5EQ 4QQBX 4L63B 3HOYG 2H4OA 4A3BB 4IPCA 3CMEA 3NP8A 4A3KH 1LTBD 4LFCQ 1QVGA 2B2TC 2K1BA 2AQ1B 2IL8A 4DR5Q 4XT1B 4HJ8A 4DV6Q 4XQNA 1BUVT 3P1HA 4FDBA 2R7ZB 1BDOA 4WJ3M 5IYDH 3PO2H 4DPGA 2VXWA 2N49A 3CRLC 4L8JA 2KCTA 1A3VA 3EBEA 5C44G 1CK1A 3ERQA 5E3FA 1BCPC 4K14A 3OIPA 1V9PA 3C1FA 3HS0C 1GUWA 1G6PA 1MSHA 2J4XA 1KXLA 4A3MB 3HOVG 2LKVA 1JB3A 3OIQA 3DMUA 1SNCA 1D5MC 5DNFA 3BVZA 1WFQA 4NXNL 1FVIA 4Z9CB 4L5QA 4OL7A 5C4HA 3PO3H 3MXPA 2EYFA 4PV1C 2E2HH 1Q81C 1EZ6A 2DJGC 2DUDA 4C3IG 3U4VA 4XT3B 5IP7G 4DV1Q 3S15H 3ZJYC 1O78A 3H15A 1CHPD 3M3YH 1E3PA 1OO9B 1WOCA 1SNOA 4KHZA 5EKIA 1KDBA 2E8GA 3Q8DA 5DLQE 1AW7A 1EUJA 4KKSA 5IOCA 5DM63 4OWWB 1NUCA 4OIKA 1J6QA 1QVCA 3M7NA 3TP8A 4LF6Q 3STBD 2D9UA 1Q3LA 1WCMB 2NN6G 1GOZA 4CKEA 4GNXC 4F7XA 2YTXA 3MXUA 1UE5A 4CKBA 2Z6KA 1F9QA 2PNRC 1LM0A 2L12A 2NVTH 2DY7A 3OMGA 2Z4IA 5ELOA 3I2ZA 3OOCA 1GUOA 3I91A 3TP5A 4IUPA 1BCPB 4A3JB 3KBXA 3TEHB 2O5JC 5F2DA 1G2SA 3FHWA 1DGSA 2R93G 2BE5D 4HMJA 5K36H 2K04A 3X3MA 3T13A 1G8ZD 4UP7A 1JE4A 1P16A 5KYIA 3HKZE 2EYMA 1PFMA 4JVZA 3S2DH 3NTKA 3FMCA 2QILA 3KDFA 2HQLA 4A3IH 1IBLQ 1A3UA 1ENFA 4DAVA 5CV4A 2WP8J 1S5CD 1QWYA 4JOIA 4EQPA 4DV7Q 3GV6A 5BN4A 1CQFA 3E9IA 2B8FA 1B9MA 5FOBB 4DUZL 2OQKA 5J22A 4YY3Q 1EOVA 4JV5Q 1G291 3CCRA 4G7ZC 2VUMG 4A3KB 1L1OA 1N36L 4LMQD 2K5WA 1S3OA 3F2DA 1B3AA 2SNSA 2QEJC 3CQZH 1PXUA 1U4PA 1EEID 2RDHA 3UDFA 3SK4A 3A54A 1CSPA 3QOLA 1WTOA 1DXMA 3LX0A 4APVA 2CH4A 1IHZA 3GTGH 3PO2B 2C9OA 3E9HA 2CW0C 2Z4HA 4AYBG 2KBNA 4QY7A 3M7GA 4FNFA 2QDLA 1VQ5A 2EY2A 3I8ZA 1YEZA 4DXGA 3S9WA 2XIWA 2EY5A 1BBUA 1OXXK 2B3GA 1SR3A 4R9WA 4DR2Q 3HOYH 1K3BC 1HA6A 3NK9A 5JOBA 3KOJA 2UUBL 3BYYB 3QO2A 1JICA 3FVQA 3KF6A 3PO3B 4V190 3KK7A 2E2HB 1JJGA 3L9AX 4CBVA 3BZDB 2KEEA 4PZ6A 1JR0D 3S15B 1FR3A 1L0YB 4J15A 3M3YB 1JC7A 2NVYH 2HHHL 5C44H 5ISRA 1I4PA 4ILWA 4B9WA 4HCEA 3I70A 4JI1Q 3W1BA 2E5LQ 4XIGS 4HIMA 1ENCA 1K83H 2F3IA 2IX1A 3NBIA 2D0OA 4FF4A 1EU3A 1Q86C 3IL8A 2OTLA 2JEBI 4X62L 3EVQA 2SNMA 3RD4A 4DK3C 1JOKA 4HCSA 4IOAA 1BO0A 3L0OA 3FPPA 3HP3A 2NVTB 2FXQA 4IOCA 5IGGA 3QWNA 4BS9A 4C3IH 3J80E 2IT1A 3FPUB 2B2UC 2A69C 4QUFA 2XGTA 2ZXPA 1VQMA 1M4VA 1AP0A 1FNUA 4R4OA 4FXDA 4RHSA
chains in the Genus database with same CATH topology
1I3QH 4JI2Q 1L1OB 1NMFA 1TWAH 5EAYA 3W5OA 2ZM6L 3S14H 1JMCA 4DR7L 1HR0W 2KHJA 2F52A 3UE1A 4R4TA 1VS0A 1B8AA 1UEBA 2UXDL 2WB1E 4X66L 4L5TA 4BA1I 3HOXH 4MNOA 4QIWE 4A4IA 1Y1VG 1VQIA 2A19A 4DV0Q 5GAGC 5M3FG 5H1SE 1HNWL 3T1HL 1W2BA 2GVBA 1XPUA 2ID0A 2UXDQ 1C0AA 5LMNQ 4YCUA 3CC7A 1HNXL 4B3SL 3S17H 5FJ8H 4JI6L 4LFAL 1CKOA 3CW2C 1HNWQ 3JC66 3PUXA 3T1HQ 1Q12A 1PH6A 4BXXH 5HY6A 4A3CH 4HIKA 1AE2A 5IY0A 4BY7H 3CCUA 1HNXQ 3CP0A 4UP9A 2B63G 2CQOA 2LSSA 1EQRA 4LFAQ 3RN2A 4JI6Q 2R93H 1TWFH 1SN8A 2YV5A 4A3EH 4B3MQ 1VQ6A 1TWCH 3G71A 4OWXB 2NVXH 2CWPA 4P71A 1NY4A 3WWVA 4DKAC 1IL2A 3ULPA 2BH8A 4JBKA 4A3GH 1Q82C 3KF6B 4GNXB 2C35B 2LXKA 4A93H 2D62A 5M5XH 4KI0A 1PH5A 2YTYA 1UE6A 2VS1A 3CCSA 1QZHA 1K9MC 2B63H 3NEMA 4MZ9A 1KAWA 2EIFA 4DUZQ 1KIXA 4A3LH 1KHIA 2K52A 1S40A 1M1KC 4JI0L 1NE3A 1NMGA 4H02A 3IRBA 3GDEA 1X6OA 4LW1A 4OONA 5M5WH 3CCMA 4HIDA 1VQPA 3BU2A 4AYBE 3CF5A 1YHBA 1N34Q 1PH1A 2BA0A 1VCIA 1I94L 1Y14B 4JI0Q 4A3DG 4JBWA 1RIPA 2NZHA 1UE7A 3S2HH 1B70B 3K8AA 3A74A 3H0GH 4A3KG 4BY1G 3CCLA 2ATWA 4KHPL 1BKBA 1IBKL 2UXCL 2QGQA 2LXJA 4LF4L 4NB3A 4AH6A 1M90C 1I94Q 3KF8B 1K8GA 2VUMH 2JK8A 1GKHA 3A5UA 1KC8C 4DR1L 1SLJA 2K75A 2ALYB 1J5EL 3JAMc 4L5SA 4PMWA 3GTMH 3F2BA 1Z47A 4NPSA 1IBKQ 4KHPQ 1ASYA 2KCMA 3GO5A 1HNZL 1KL9A 4YHHL 5IYDG 3TREA 3PO2G 4P72A 2AWNA 4LF8L 2D0PA 1CKNA 2ZTCA 3MEFA 3I4NH 2UXBL 4DUYL 2MO0A 1XJVA 1XPOA 2AWOA 2IX0A 1SROA 3D0FA 1Q7YC 1NBWA 3KJOA 4LF8Q 2I0QA 1VQDA 2R7ZG 1N32L 2UXBQ 3RR5A 4Y7NH 4DV2Q 1XMOQ 3PIOA 4JI8L 2RF4A 2WFWA 4A3BH 1WYDA 2R7FA 2UUBQ 1JB7A 1N32Q 2PI2A 1CSQA 5IYBG 4X6AH 3TS2A 3K80C 2L15A 2JQOA 3CCEA 4DV5L 4JI8Q 3G48A 5GADC 1A8VA 3CPFA 4BBRG 4GOPA 3HOUG 3PO3G 1KRSA 4GN5A 1XTDA 2JJQA 1OXTA 1WI5A 4JYAL 2PQAA 2R7DA 2ZJRA 2K5NA 2ZJQA 4A3MG 1XNRL 2R7ZH 1SRUA 1T9HA 3JAMi 4LFBQ 2ES2A 4P73A 4X64L 2BA1A 2VQEL 5ELNA 4JYAQ 2RCNA 3KDFB 3HOUH 4JI5L 2Q2TA 5GQOA 4X65Q 2ASBA 1XNRQ 1D7QA 5BR8L 1XPRA 4WJ4A 3L7ZC 3D31A 1N33L 4X64Q 1V1QA 4X62Q 3OW2A 3I4MG 3PUVA 3RLFA 5IWAL 1X3FA 1TWGH 1I5FA 2I5MX 3U50C 1KQSA 5BR8Q 1C7YA 2NZOA 5GAEC 4A3MH 1X9NA 1JE5A 4R1JA 2UU9L 3HKSA 2GN5A 1YJNA 2XTIA 1Z9FA 5IT9c 4IO9A 2PMZE 5IWAQ 4B3RL 4PZ8A 1KRTA 3ULLA 4RG1A 5LMNW 1YITA 1MIUA 1WCMG 1GM5A 1VQ7A 4IFDJ 4LUVA 3CD6A 3T1YL 3M4PA 2N8NA 2B29A 4GOPC 2HIVA 1HZBA 3DM3A 3I4MH 1VQFA 3K7UC 2R92H 5JJLA 4R4QA 3L2PA 2ZM6Q 4DR7Q 5M5YH 5IYCH 2ZJPA 1CKMA 1VQEA 4R4IA 5K36G 2I5HA 3PUYA 4X66Q 4A3JG 1PVOA 3CAMA 2JEAI 4ME3A 1EIFA 1QVFA 4LF9L 4LF5L 3NENA 1PYSB 3B6YA 4B3SQ 2EQSA 1HZCA 2PI2E 3ER0A 2VW9A 4A3IG 4LF9Q 1YI2A 4GS3A 2VNUD 2Z0SA 2Q2HA 1IBML 4LWCA 2F4VL 1Y1VH 1TXYA 1SE8A 1GO3E 4YCVA 4QGUA 5M3FH 2I5LX 3PF4A 3S1QH 4JG2A 4O0AA 1HR0L 1I6HH 1K0RA 1UE1A 2VL6A 4DK6C 4A3JH 1WJJA 3KYHC 3PUZA 4AIMA 2QEXA 2YU9H 1YBYA 1HZAA 1IBMQ 2F4VQ 2A8VA 1A63A 1EWIA 1JJCB 3UDGA 1VQKA 3KLWA 1HR0Q 3CCVA 3M4OH 2QA4A 1D8LA 1PH9A 1VQ8A 4GKKL 1EIYB 3GTOH 3KJPA 1PFSA 4DV7L 1K3RA 3BJUA 4GLAC 3TQYA 4B3TL 1EYGA 2IY5B 4BA2I 3K7AH 2OWOA 1YVCA 4IFDI 3HKZG 4GOPB 1QUQA 1OXVA 4JBJA 1YHQA 2NVQH 1LUZA 3H3VI 4GKKQ 5JJKA 4JV5L 2PQAB 4PG3A 1E1TA 3RZOH 1BVSA 1NTGA 4B3TQ 3GTKH 2CKZB 2N78A 2JA5G 1YIJA 1N9WA 3M9BA 4RMFA 4LUZA 4GN4B 2ZTEA 4JI7L 4UP8A 3CC2A 1OXSC 3ICEA 1X65A 3RN5A 1VQLA 1Q1BA 4GLXA 1PHJA 4YCWA 2WAQG 2UXCQ 5FLMG 1AH9A 4JI7Q 4LF4Q 1ASZA 1JT8A 4LFCL 4MTNA 1K73C 3CCQA 5C4XG 2Q2UA 4LNQA 3BZKA 4DR1Q 4HJ7A 4A3DH 1E24A 1J5EQ 2E2IH 5AJ3L 1HH2P 4A3FG 4QQBX 4EQ5A 4P74A 4DR5L 3HOYG 1VQHA 2MO1A 4IPCA 4AQYL 3CMEA 4A3KH 1HNZQ 4BY1H 4LFCQ 4YHHQ 3AYHB 3M85A 4DV6L 1QVGA 2JA8G 3ERSX 3G4SA 4EX5A 2AKWB 4DUYQ 1X54A 3RZDH 4DV4L 2Y0SG 4DR5Q 3A0JA 3CPWA 4HJ8A 1RL2A 3S1MH 1FGUA 2R6GA 3I56A 3OTOL 4DR2L 1JJ2A 4DV6Q 3AQQA 1OTCA 1FJGL 1X56A 4FDBA 5C4XH 3J80i 1K8AC 3HOZG 2JE6I 4BBSG 3PO2H 4WJ3M 5IYDH 4DPGA 4HJAA 1TWHH 2N49A 4GKJL 3CMAA 4K0KL 4LF7L 4UPAA 5JEAJ 2KCTA 3GTQH 3EBEA 5C44G 1XNQL 3GTLH 1I50H 3DLLA 2JA7G 4DV5Q 1N8RC 2JA6G 5C3EG 4KLKA 3U58A 1R9TH 3F8TA 2ZTDA 1V9PA 4K0KQ 2NN6I 5IP9G 4LF7Q 4GNXA 3AFPA 2N3SA 1G6PA 4TQUS 3RLOA 3PGZA 1H95A 2GVAA 1KXLA 1YJ9A 3HOVG 1EQQA 5IYBH 4DNIA 2KENA 4OX9L 1BBWA 4JI1L 4QL5A 2E5LL 2VQEQ 4DV1L 1NJIC 4DV3L 1WFQA 4NXNL 2MNAA 1FVIA 1V43A 2AHOB 4L5QA 4OXPA 2K5HA 1CUKA 4BBRH 4ALPA 1EFWA 2E2JH 4JI5Q 1VQNA 3KFUA 3MXNB 3I7FA 1Q81C 2E2HH 4JCVE 4OX9Q 2DUDA 4JC0A 3U4VA 1N33Q 5IP7G 1LYLA 4DV1Q 4NXNQ 3S15H 3ZJYC 3J7ZC 3FKIG 3J81i 3F2CA 1IZ6A 3H15A 2CWAA 3CCJA 1E3PA 1WOCA 5JEAG 1PH2A 4LF6L 3M3YH 2KHIA 4KHZA 3CXCA 3HOVH 4C3HH 2E8GA 3Q8DA 1E7ZA 5DLQE 1EUJA 4DAYB 1PH4A 2UU9Q 4OWWB 1J6QA 1QVCA 2JA9A 4YWKA 5M3MG 3M7NA 2EXDA 3EN2A 4LF6Q 3STBD 2E5LQ 4DR6L 4B3RQ 1QUQB 4DAMA 1U5KA 2NN6G 3T1YQ 1G51A 3E0EA 1UWVA 2K4KA 4GNXC 2YTXA 3HOXG 3S16H 5IP7H 2YYZA 2RHQB 1UE5A 1VQCA 1MKHA 3SGIA 2Z6KA 1MJCA 1LM0A 1VQOA 2NVTH 1WCMH 5FJ8G 1X3GA 5ELOA 3K0XA 3J81j 3I2ZA 4A75A 1IYJB 4JI4L 3UDIA 4OO1I 4IJLA 3AEVA 3GD7A 1OXUA 5M3MH 4BXXG 4IJHA 4A3CG 4DV0L 1E22A 4BY7G 3TEHB 4DR3L 1VQ4A 3FP9A 1Q46A 3FHWA 4GLVB 4QJFA 2RHSB 1DGSA 4JI4Q 5LMNL 4IFDG 1CKNB 4LF5Q 2R93G 1Q1EA 1Y1WG 4A3EG 4DR3Q 1XMQL 5C0XI 4NXML 4UP7A 5IE8A 1P16A 3STBC 4XTCS 3OYYA 5C0XJ 3VDYA 3NELA 2PNHA 1A62A 1IBLL 3HKZE 2WB1G 1YNXA 2HT1A 4A3GG 3NBHB 3TS0A 3S2DH 3RLNA 4A93G 1XMQQ 4JI3L 4NXMQ 5LMUL 4HJ9A 1E1OA 1L0WA 3KDFA 3RNUA 2HQLA 4IPDA 2A1AA 4A3IH 4B3ML 1GVPA 1IBLQ 3PIPA 4A3LG 1VQGA 1X55A 2Z6KC 1Y1WH 2WP8J 3PF5A 4JI3Q 3S1NH 3AFQA 4C2MH 5LMUQ 4OO1G 5C4JH 4JOIA 2VY3A 4DV7Q 4P75A 4YY3L 2UUAL 2OTJA 3J80c 3M4QA 2WAQE 4IPGA 3E9IA 5E7NA 4DUZL 5GAHC 1PH3A 2OQKA 4POGA 3LGJA 3HOWG 2UUAQ 3H0GG 4YY3Q 1EOVA 1GD7A 1PH8A 4JV5Q 1YHAA 1G291 2OCEA 3CCRA 3PCOB 1N34L 2VUMG 3PSIA 5JJIA 5C0XG 1L1OA 1Q8KA 1N36L 1S3OA 3F2DA 3CQZH 2AMCB 3UDFA 2MFIA 2Y0SE 1S72A 3HFZB 1CSPA 4APVA 4OWTB 1N36Q 3I4NG 1IXRA 2VQFL 2JA5H 3GTGH 3J7A5 3A5ZB 3HOWH 2DGYA 1HJPA 1VQAA 2V1CC 3F1ZA 4JBMA 3E9HA 3BZCA 3ULJA 5AJ3Q 4R4CA 4AYBG 2KBNA 1W3SA 4QY7A 3GTJH 4JOIC 2VQFQ 4AQYQ 1SFOH 1B7YB 1VQ5A 1PV4A 5FLMH 3I55A 3J81c 4A3BG 1YEZA 4DV4Q 1VQ9A 2YTVA 1L2FA 1BBUA 1OXXK 2B3GA 1SR3A 3OTOQ 4DR2Q 4A3FH 1YJWA 4YWLA 3HOYH 1FJGQ 2BH2A 4DV2L 1XMOL 4TVAB 4L5RC 2JA8H 3UE0A 1PH7A 1L1OC 2IHFA 3KOJA 2UUBL 4GKJQ 1AE3A 2K5VA 3H3VH 3KF6A 4UY8C 4YWMA 2UUCL 2Q2IA 4LUOA 5J3BA 1XNQQ 4O2DA 3GTPH 1JJGA 1U0LA 2CFMA 3HOZH 4PZ6A 4BBSH 3U4ZA 2CCZA 4DR4L 2K50A 2VZAA 4J15A 4HIOA 3K81C 1A0IA 2H5XA 2UUCQ 2K14A 4HJ5A 1VQBA 1LTLA 1X3EA 2IHEA 2NVYH 2HIXA 2HHHL 3CC4A 4LFBL 5C44H 4DR4Q 4Y52H 1QZGA 1MJEA 4A76A 2JA7H 4JI1Q 2JA6H 3W1BA 5C3EH 4XIGS 4HIMA 4DV3Q 1HZ9A 4X65L 1K83H 2F3IA 3EIVA 3S24A 2D0OA 1PA6A 3PV0A 5IP9H 1Q86C 2IX1A 2HHHQ 2OTLA 2JEBI 4X62L 4GN3B 4IPHA 4C3JH 4PZ7A 3S1RH 4DK3C 4IOAA 3L0OA 1KD1C 1P8LA 3G6EA 2FXQA 4IOCA 1O7IA 2R92G 1FL0A 1YZ6A 4C3IH 3TRZA 5IYCG 2IT1A 3W1GA 3I4OA 3PUWA 3UDXA 1C9OA 5HGQA 4JI2L 3FKIH 1VQJA 4DR6Q 2MQHA 1PYBA 2XGTA 5GROA 2OQ0A 4POFA 1SMXA 1VQMA 5FLXc 3PO3H 4R4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q H;  4JI2 Q;  1L1O B;  1NMF A;  1TWA H;  5EAY A;  3W5O A;  2ZM6 L;  3S14 H;  1JMC A;  4DR7 L;  1HR0 W;  2KHJ A;  2F52 A;  3UE1 A;  4R4T A;  1VS0 A;  1B8A A;  1UEB A;  2UXD L;  2WB1 E;  4X66 L;  4L5T A;  4BA1 I;  3HOX H;  4MNO A;  4QIW E;  4A4I A;  1Y1V G;  1VQI A;  2A19 A;  4DV0 Q;  5GAG C;  5M3F G;  5H1S E;  1HNW L;  3T1H L;  1W2B A;  2GVB A;  1XPU A;  2ID0 A;  2UXD Q;  1C0A A;  5LMN Q;  4YCU A;  3CC7 A;  1HNX L;  4B3S L;  3S17 H;  5FJ8 H;  4JI6 L;  4LFA L;  1CKO A;  3CW2 C;  1HNW Q;  3JC6 6;  3PUX A;  3T1H Q;  1Q12 A;  1PH6 A;  4BXX H;  5HY6 A;  4A3C H;  4HIK A;  1AE2 A;  5IY0 A;  4BY7 H;  3CCU A;  1HNX Q;  3CP0 A;  4UP9 A;  2B63 G;  2CQO A;  2LSS A;  1EQR A;  4LFA Q;  3RN2 A;  4JI6 Q;  2R93 H;  1TWF H;  1SN8 A;  2YV5 A;  4A3E H;  4B3M Q;  1VQ6 A;  1TWC H;  3G71 A;  4OWX B;  2NVX H;  2CWP A;  4P71 A;  1NY4 A;  3WWV A;  4DKA C;  1IL2 A;  3ULP A;  2BH8 A;  4JBK A;  4A3G H;  1Q82 C;  3KF6 B;  4GNX B;  2C35 B;  2LXK A;  4A93 H;  2D62 A;  5M5X H;  4KI0 A;  1PH5 A;  2YTY A;  1UE6 A;  2VS1 A;  3CCS A;  1QZH A;  1K9M C;  2B63 H;  3NEM A;  4MZ9 A;  1KAW A;  2EIF A;  4DUZ Q;  1KIX A;  4A3L H;  1KHI A;  2K52 A;  1S40 A;  1M1K C;  4JI0 L;  1NE3 A;  1NMG A;  4H02 A;  3IRB A;  3GDE A;  1X6O A;  4LW1 A;  4OON A;  5M5W H;  3CCM A;  4HID A;  1VQP A;  3BU2 A;  4AYB E;  3CF5 A;  1YHB A;  1N34 Q;  1PH1 A;  2BA0 A;  1VCI A;  1I94 L;  1Y14 B;  4JI0 Q;  4A3D G;  4JBW A;  1RIP A;  2NZH A;  1UE7 A;  3S2H H;  1B70 B;  3K8A A;  3A74 A;  3H0G H;  4A3K G;  4BY1 G;  3CCL A;  2ATW A;  4KHP L;  1BKB A;  1IBK L;  2UXC L;  2QGQ A;  2LXJ A;  4LF4 L;  4NB3 A;  4AH6 A;  1M90 C;  1I94 Q;  3KF8 B;  1K8G A;  2VUM H;  2JK8 A;  1GKH A;  3A5U A;  1KC8 C;  4DR1 L;  1SLJ A;  2K75 A;  2ALY B;  1J5E L;  3JAM c;  4L5S A;  4PMW A;  3GTM H;  3F2B A;  1Z47 A;  4NPS A;  1IBK Q;  4KHP Q;  1ASY A;  2KCM A;  3GO5 A;  1HNZ L;  1KL9 A;  4YHH L;  5IYD G;  3TRE A;  3PO2 G;  4P72 A;  2AWN A;  4LF8 L;  2D0P A;  1CKN A;  2ZTC A;  3MEF A;  3I4N H;  2UXB L;  4DUY L;  2MO0 A;  1XJV A;  1XPO A;  2AWO A;  2IX0 A;  1SRO A;  3D0F A;  1Q7Y C;  1NBW A;  3KJO A;  4LF8 Q;  2I0Q A;  1VQD A;  2R7Z G;  1N32 L;  2UXB Q;  3RR5 A;  4Y7N H;  4DV2 Q;  1XMO Q;  3PIO A;  4JI8 L;  2RF4 A;  2WFW A;  4A3B H;  1WYD A;  2R7F A;  2UUB Q;  1JB7 A;  1N32 Q;  2PI2 A;  1CSQ A;  5IYB G;  4X6A H;  3TS2 A;  3K80 C;  2L15 A;  2JQO A;  3CCE A;  4DV5 L;  4JI8 Q;  3G48 A;  5GAD C;  1A8V A;  3CPF A;  4BBR G;  4GOP A;  3HOU G;  3PO3 G;  1KRS A;  4GN5 A;  1XTD A;  2JJQ A;  1OXT A;  1WI5 A;  4JYA L;  2PQA A;  2R7D A;  2ZJR A;  2K5N A;  2ZJQ A;  4A3M G;  1XNR L;  2R7Z H;  1SRU A;  1T9H A;  3JAM i;  4LFB Q;  2ES2 A;  4P73 A;  4X64 L;  2BA1 A;  2VQE L;  5ELN A;  4JYA Q;  2RCN A;  3KDF B;  3HOU H;  4JI5 L;  2Q2T A;  5GQO A;  4X65 Q;  2ASB A;  1XNR Q;  1D7Q A;  5BR8 L;  1XPR A;  4WJ4 A;  3L7Z C;  3D31 A;  1N33 L;  4X64 Q;  1V1Q A;  4X62 Q;  3OW2 A;  3I4M G;  3PUV A;  3RLF A;  5IWA L;  1X3F A;  1TWG H;  1I5F A;  2I5M X;  3U50 C;  1KQS A;  5BR8 Q;  1C7Y A;  2NZO A;  5GAE C;  4A3M H;  1X9N A;  1JE5 A;  4R1J A;  2UU9 L;  3HKS A;  2GN5 A;  1YJN A;  2XTI A;  1Z9F A;  5IT9 c;  4IO9 A;  2PMZ E;  5IWA Q;  4B3R L;  4PZ8 A;  1KRT A;  3ULL A;  4RG1 A;  5LMN W;  1YIT A;  1MIU A;  1WCM G;  1GM5 A;  1VQ7 A;  4IFD J;  4LUV A;  3CD6 A;  3T1Y L;  3M4P A;  2N8N A;  2B29 A;  4GOP C;  2HIV A;  1HZB A;  3DM3 A;  3I4M H;  1VQF A;  3K7U C;  2R92 H;  5JJL A;  4R4Q A;  3L2P A;  2ZM6 Q;  4DR7 Q;  5M5Y H;  5IYC H;  2ZJP A;  1CKM A;  1VQE A;  4R4I A;  5K36 G;  2I5H A;  3PUY A;  4X66 Q;  4A3J G;  1PVO A;  3CAM A;  2JEA I;  4ME3 A;  1EIF A;  1QVF A;  4LF9 L;  4LF5 L;  3NEN A;  1PYS B;  3B6Y A;  4B3S Q;  2EQS A;  1HZC A;  2PI2 E;  3ER0 A;  2VW9 A;  4A3I G;  4LF9 Q;  1YI2 A;  4GS3 A;  2VNU D;  2Z0S A;  2Q2H A;  1IBM L;  4LWC A;  2F4V L;  1Y1V H;  1TXY A;  1SE8 A;  1GO3 E;  4YCV A;  4QGU A;  5M3F H;  2I5L X;  3PF4 A;  3S1Q H;  4JG2 A;  4O0A A;  1HR0 L;  1I6H H;  1K0R A;  1UE1 A;  2VL6 A;  4DK6 C;  4A3J H;  1WJJ A;  3KYH C;  3PUZ A;  4AIM A;  2QEX A;  2YU9 H;  1YBY A;  1HZA A;  1IBM Q;  2F4V Q;  2A8V A;  1A63 A;  1EWI A;  1JJC B;  3UDG A;  1VQK A;  3KLW A;  1HR0 Q;  3CCV A;  3M4O H;  2QA4 A;  1D8L A;  1PH9 A;  1VQ8 A;  4GKK L;  1EIY B;  3GTO H;  3KJP A;  1PFS A;  4DV7 L;  1K3R A;  3BJU A;  4GLA C;  3TQY A;  4B3T L;  1EYG A;  2IY5 B;  4BA2 I;  3K7A H;  2OWO A;  1YVC A;  4IFD I;  3HKZ G;  4GOP B;  1QUQ A;  1OXV A;  4JBJ A;  1YHQ A;  2NVQ H;  1LUZ A;  3H3V I;  4GKK Q;  5JJK A;  4JV5 L;  2PQA B;  4PG3 A;  1E1T A;  3RZO H;  1BVS A;  1NTG A;  4B3T Q;  3GTK H;  2CKZ B;  2N78 A;  2JA5 G;  1YIJ A;  1N9W A;  3M9B A;  4RMF A;  4LUZ A;  4GN4 B;  2ZTE A;  4JI7 L;  4UP8 A;  3CC2 A;  1OXS C;  3ICE A;  1X65 A;  3RN5 A;  1VQL A;  1Q1B A;  4GLX A;  1PHJ A;  4YCW A;  2WAQ G;  2UXC Q;  5FLM G;  1AH9 A;  4JI7 Q;  4LF4 Q;  1ASZ A;  1JT8 A;  4LFC L;  4MTN A;  1K73 C;  3CCQ A;  5C4X G;  2Q2U A;  4LNQ A;  3BZK A;  4DR1 Q;  4HJ7 A;  4A3D H;  1E24 A;  1J5E Q;  2E2I H;  5AJ3 L;  1HH2 P;  4A3F G;  4QQB X;  4EQ5 A;  4P74 A;  4DR5 L;  3HOY G;  1VQH A;  2MO1 A;  4IPC A;  4AQY L;  3CME A;  4A3K H;  1HNZ Q;  4BY1 H;  4LFC Q;  4YHH Q;  3AYH B;  3M85 A;  4DV6 L;  1QVG A;  2JA8 G;  3ERS X;  3G4S A;  4EX5 A;  2AKW B;  4DUY Q;  1X54 A;  3RZD H;  4DV4 L;  2Y0S G;  4DR5 Q;  3A0J A;  3CPW A;  4HJ8 A;  1RL2 A;  3S1M H;  1FGU A;  2R6G A;  3I56 A;  3OTO L;  4DR2 L;  1JJ2 A;  4DV6 Q;  3AQQ A;  1OTC A;  1FJG L;  1X56 A;  4FDB A;  5C4X H;  3J80 i;  1K8A C;  3HOZ G;  2JE6 I;  4BBS G;  3PO2 H;  4WJ3 M;  5IYD H;  4DPG A;  4HJA A;  1TWH H;  2N49 A;  4GKJ L;  3CMA A;  4K0K L;  4LF7 L;  4UPA A;  5JEA J;  2KCT A;  3GTQ H;  3EBE A;  5C44 G;  1XNQ L;  3GTL H;  1I50 H;  3DLL A;  2JA7 G;  4DV5 Q;  1N8R C;  2JA6 G;  5C3E G;  4KLK A;  3U58 A;  1R9T H;  3F8T A;  2ZTD A;  1V9P A;  4K0K Q;  2NN6 I;  5IP9 G;  4LF7 Q;  4GNX A;  3AFP A;  2N3S A;  1G6P A;  4TQU S;  3RLO A;  3PGZ A;  1H95 A;  2GVA A;  1KXL A;  1YJ9 A;  3HOV G;  1EQQ A;  5IYB H;  4DNI A;  2KEN A;  4OX9 L;  1BBW A;  4JI1 L;  4QL5 A;  2E5L L;  2VQE Q;  4DV1 L;  1NJI C;  4DV3 L;  1WFQ A;  4NXN L;  2MNA A;  1FVI A;  1V43 A;  2AHO B;  4L5Q A;  4OXP A;  2K5H A;  1CUK A;  4BBR H;  4ALP A;  1EFW A;  2E2J H;  4JI5 Q;  1VQN A;  3KFU A;  3MXN B;  3I7F A;  1Q81 C;  2E2H H;  4JCV E;  4OX9 Q;  2DUD A;  4JC0 A;  3U4V A;  1N33 Q;  5IP7 G;  1LYL A;  4DV1 Q;  4NXN Q;  3S15 H;  3ZJY C;  3J7Z C;  3FKI G;  3J81 i;  3F2C A;  1IZ6 A;  3H15 A;  2CWA A;  3CCJ A;  1E3P A;  1WOC A;  5JEA G;  1PH2 A;  4LF6 L;  3M3Y H;  2KHI A;  4KHZ A;  3CXC A;  3HOV H;  4C3H H;  2E8G A;  3Q8D A;  1E7Z A;  5DLQ E;  1EUJ A;  4DAY B;  1PH4 A;  2UU9 Q;  4OWW B;  1J6Q A;  1QVC A;  2JA9 A;  4YWK A;  5M3M G;  3M7N A;  2EXD A;  3EN2 A;  4LF6 Q;  3STB D;  2E5L Q;  4DR6 L;  4B3R Q;  1QUQ B;  4DAM A;  1U5K A;  2NN6 G;  3T1Y Q;  1G51 A;  3E0E A;  1UWV A;  2K4K A;  4GNX C;  2YTX A;  3HOX G;  3S16 H;  5IP7 H;  2YYZ A;  2RHQ B;  1UE5 A;  1VQC A;  1MKH A;  3SGI A;  2Z6K A;  1MJC A;  1LM0 A;  1VQO A;  2NVT H;  1WCM H;  5FJ8 G;  1X3G A;  5ELO A;  3K0X A;  3J81 j;  3I2Z A;  4A75 A;  1IYJ B;  4JI4 L;  3UDI A;  4OO1 I;  4IJL A;  3AEV A;  3GD7 A;  1OXU A;  5M3M H;  4BXX G;  4IJH A;  4A3C G;  4DV0 L;  1E22 A;  4BY7 G;  3TEH B;  4DR3 L;  1VQ4 A;  3FP9 A;  1Q46 A;  3FHW A;  4GLV B;  4QJF A;  2RHS B;  1DGS A;  4JI4 Q;  5LMN L;  4IFD G;  1CKN B;  4LF5 Q;  2R93 G;  1Q1E A;  1Y1W G;  4A3E G;  4DR3 Q;  1XMQ L;  5C0X I;  4NXM L;  4UP7 A;  5IE8 A;  1P16 A;  3STB C;  4XTC S;  3OYY A;  5C0X J;  3VDY A;  3NEL A;  2PNH A;  1A62 A;  1IBL L;  3HKZ E;  2WB1 G;  1YNX A;  2HT1 A;  4A3G G;  3NBH B;  3TS0 A;  3S2D H;  3RLN A;  4A93 G;  1XMQ Q;  4JI3 L;  4NXM Q;  5LMU L;  4HJ9 A;  1E1O A;  1L0W A;  3KDF A;  3RNU A;  2HQL A;  4IPD A;  2A1A A;  4A3I H;  4B3M L;  1GVP A;  1IBL Q;  3PIP A;  4A3L G;  1VQG A;  1X55 A;  2Z6K C;  1Y1W H;  2WP8 J;  3PF5 A;  4JI3 Q;  3S1N H;  3AFQ A;  4C2M H;  5LMU Q;  4OO1 G;  5C4J H;  4JOI A;  2VY3 A;  4DV7 Q;  4P75 A;  4YY3 L;  2UUA L;  2OTJ A;  3J80 c;  3M4Q A;  2WAQ E;  4IPG A;  3E9I A;  5E7N A;  4DUZ L;  5GAH C;  1PH3 A;  2OQK A;  4POG A;  3LGJ A;  3HOW G;  2UUA Q;  3H0G G;  4YY3 Q;  1EOV A;  1GD7 A;  1PH8 A;  4JV5 Q;  1YHA A;  1G29 1;  2OCE A;  3CCR A;  3PCO B;  1N34 L;  2VUM G;  3PSI A;  5JJI A;  5C0X G;  1L1O A;  1Q8K A;  1N36 L;  1S3O A;  3F2D A;  3CQZ H;  2AMC B;  3UDF A;  2MFI A;  2Y0S E;  1S72 A;  3HFZ B;  1CSP A;  4APV A;  4OWT B;  1N36 Q;  3I4N G;  1IXR A;  2VQF L;  2JA5 H;  3GTG H;  3J7A 5;  3A5Z B;  3HOW H;  2DGY A;  1HJP A;  1VQA A;  2V1C C;  3F1Z A;  4JBM A;  3E9H A;  3BZC A;  3ULJ A;  5AJ3 Q;  4R4C A;  4AYB G;  2KBN A;  1W3S A;  4QY7 A;  3GTJ H;  4JOI C;  2VQF Q;  4AQY Q;  1SFO H;  1B7Y B;  1VQ5 A;  1PV4 A;  5FLM H;  3I55 A;  3J81 c;  4A3B G;  1YEZ A;  4DV4 Q;  1VQ9 A;  2YTV A;  1L2F A;  1BBU A;  1OXX K;  2B3G A;  1SR3 A;  3OTO Q;  4DR2 Q;  4A3F H;  1YJW A;  4YWL A;  3HOY H;  1FJG Q;  2BH2 A;  4DV2 L;  1XMO L;  4TVA B;  4L5R C;  2JA8 H;  3UE0 A;  1PH7 A;  1L1O C;  2IHF A;  3KOJ A;  2UUB L;  4GKJ Q;  1AE3 A;  2K5V A;  3H3V H;  3KF6 A;  4UY8 C;  4YWM A;  2UUC L;  2Q2I A;  4LUO A;  5J3B A;  1XNQ Q;  4O2D A;  3GTP H;  1JJG A;  1U0L A;  2CFM A;  3HOZ H;  4PZ6 A;  4BBS H;  3U4Z A;  2CCZ A;  4DR4 L;  2K50 A;  2VZA A;  4J15 A;  4HIO A;  3K81 C;  1A0I A;  2H5X A;  2UUC Q;  2K14 A;  4HJ5 A;  1VQB A;  1LTL A;  1X3E A;  2IHE A;  2NVY H;  2HIX A;  2HHH L;  3CC4 A;  4LFB L;  5C44 H;  4DR4 Q;  4Y52 H;  1QZG A;  1MJE A;  4A76 A;  2JA7 H;  4JI1 Q;  2JA6 H;  3W1B A;  5C3E H;  4XIG S;  4HIM A;  4DV3 Q;  1HZ9 A;  4X65 L;  1K83 H;  2F3I A;  3EIV A;  3S24 A;  2D0O A;  1PA6 A;  3PV0 A;  5IP9 H;  1Q86 C;  2IX1 A;  2HHH Q;  2OTL A;  2JEB I;  4X62 L;  4GN3 B;  4IPH A;  4C3J H;  4PZ7 A;  3S1R H;  4DK3 C;  4IOA A;  3L0O A;  1KD1 C;  1P8L A;  3G6E A;  2FXQ A;  4IOC A;  1O7I A;  2R92 G;  1FL0 A;  1YZ6 A;  4C3I H;  3TRZ A;  5IYC G;  2IT1 A;  3W1G A;  3I4O A;  3PUW A;  3UDX A;  1C9O A;  5HGQ A;  4JI2 L;  3FKI H;  1VQJ A;  4DR6 Q;  2MQH A;  1PYB A;  2XGT A;  5GRO A;  2OQ0 A;  4POF A;  1SMX A;  1VQM A;  5FLX c;  3PO3 H;  4R4O A; 
#chains in the Genus database with same CATH topology
 1TWA H;  5EAY A;  3W5O A;  4DR7 L;  2OF1 A;  5IGE A;  1R4Q B;  4BWG B;  2F52 A;  1PZI D;  4XQJ A;  3UE1 A;  3VR3 A;  1NSN S;  2NN6 H;  1RD9 D;  4X66 L;  4L5T A;  1SYF A;  4BA1 I;  4RAU C;  1KNA A;  3S2D B;  2F0S A;  4TKO B;  4QIW E;  2IW3 A;  1Y1V G;  5IT9 L;  4DV0 Q;  3T1H L;  4A3I B;  1W2B A;  2UXD Q;  1ET9 A;  5LMN Q;  1CKO A;  2O2L D;  3JC6 6;  2PZW A;  3EJI A;  4KV6 A;  1Q12 A;  5IY0 A;  3J81 E;  1HNX Q;  1EWH A;  2B63 G;  3RN2 A;  2LSS A;  2PCF B;  5CV7 A;  5E4W C;  2F0H A;  2R93 H;  1SN8 A;  1J9O A;  4J1M A;  2YV5 A;  3CU7 A;  1NY4 A;  4DKA C;  1SXT A;  5G3L D;  1LO5 D;  2BH8 A;  2QW7 A;  3HKZ B;  3CQZ B;  3MTS A;  4EGV A;  2NB0 A;  2LXK A;  4KI0 A;  2CH4 W;  5ELC A;  2Z9H A;  2F0G A;  4PMB A;  5CV6 A;  5I2Y A;  3GTG B;  2HCC A;  1NMG A;  4LW1 A;  1X6O A;  4HID A;  4AYB E;  2E75 C;  1YHB A;  3DHQ A;  2ENB A;  2BA0 A;  4KTA A;  1RIP A;  1UE7 A;  3S2H H;  2B39 A;  3CCL A;  1GUT A;  4HTH A;  4BY1 G;  4DK0 A;  1IYV A;  2DJF C;  1K8G A;  2VUM H;  2JK8 A;  1GKH A;  1IKL A;  1J5E L;  1S4Z A;  2PPB C;  3GTM H;  4NPS A;  1ASY A;  3GO5 A;  4H0L C;  2A73 B;  4P72 A;  1ONL A;  2AWO A;  3DWQ A;  1IKM A;  1NAP A;  2R7Z G;  1ILQ A;  4IN3 A;  2NVY B;  1KLG D;  1PZJ D;  5C44 B;  4JI8 L;  5A35 A;  3K6O A;  2RF4 A;  3PIP 3;  1JB7 A;  1O7Z A;  5EKL A;  1K83 B;  2PZU A;  1CA6 A;  1H9M A;  2J0T D;  4BBR G;  4GOP A;  3HOU G;  5HUR A;  4GN5 A;  5IOD A;  2JJQ A;  2C5C A;  2ZJR A;  4A3M G;  3FDT A;  1XNR L;  1SRU A;  1T9H A;  3JAM i;  4J6H A;  3SK5 A;  2ES2 A;  4P73 A;  4X64 L;  2BA1 A;  2F3W A;  1WTP A;  5L37 A;  1GUS A;  3KLS X;  2L5T A;  2Z1C A;  4JW0 A;  3TP6 A;  2ASB A;  2HDM A;  1VMC A;  1BBX C;  2FIN B;  5FK9 C;  2VB3 X;  3T16 A;  3SR1 A;  5IWA L;  4K6L A;  2I5M X;  2BDN A;  1TWA B;  3A8K E;  3HKS A;  2EDG A;  5C4Z A;  2XTI A;  1NNX A;  2PMZ E;  4PZ8 A;  3OPO A;  5LMN W;  1WCM G;  2HD3 A;  1VQ7 A;  4IFD J;  2EYP A;  1G91 A;  1HZB A;  4RGM A;  4CDC C;  1CHQ D;  1FNV A;  2K6A A;  1SYG A;  4R4Q A;  1X3P A;  4JK1 C;  5M5Y H;  1PFB A;  2ZJP A;  1CKM A;  1DON A;  1VQE A;  4R4I A;  2B2V C;  2F0T A;  2I5H A;  5CV5 A;  4UHV A;  4B08 A;  4I7Z C;  4A3J G;  2JEA I;  2R93 B;  3VYU A;  1EIF A;  3BS1 A;  1PYS B;  3B6Y A;  2EQS A;  2F0U A;  5TSS A;  4GS3 A;  2VNU D;  4QIW B;  1Y1V H;  2WII B;  4WRD A;  2F4V L;  4QGU A;  4CDD C;  1I6H H;  2EJG C;  4KKT A;  2VL6 A;  4DK6 C;  1WJJ A;  4AIM A;  1PRT F;  3MFG A;  1ESF A;  3T53 B;  1FYC A;  5JPN C;  2NTT A;  4CHT B;  1D8L A;  1STE A;  1PH9 A;  4GKK L;  1EIY B;  3GTO H;  3IAY A;  4DV7 L;  1QE6 A;  4RWS C;  4DAY A;  5NUC A;  5D65 A;  1EYG A;  1HTL D;  3G6J B;  5CYU A;  1LTS D;  2NVQ H;  2VUM B;  1LUZ A;  4JV5 L;  3BDO A;  4Q0F A;  2CKZ B;  3GTM B;  1YIJ A;  4PNY A;  4RMF A;  3U9S A;  2ZTE A;  3I72 A;  3CC2 A;  3EQL C;  1U4M A;  3D4W A;  1X65 A;  2BE5 C;  1Q1B A;  4FF1 A;  1PFN A;  1PHJ A;  4JI7 Q;  3V96 A;  2L0C A;  4AYB B;  1SYE A;  3MZ5 A;  1V8Q A;  1RDP D;  1I4Q A;  4DR1 Q;  4A3F G;  3VR4 A;  3EFX D;  2MO1 A;  1YNJ D;  4BY1 H;  2PW5 A;  4XQQ A;  4YHH Q;  3G4S A;  4DUY Q;  4B9X A;  2QDB A;  2EJF C;  3S1M H;  3QIA A;  2F0K A;  4DR2 L;  1JJ2 A;  1OTC A;  2TSS A;  4ULL A;  5LL6 X;  4K2K A;  4IUV A;  3J80 i;  3HOZ G;  2JE6 I;  1I6V C;  3KLS A;  3C3L A;  4HJA A;  4RCO A;  1TWH H;  1IW7 C;  4LF7 L;  4UPA A;  5JEA J;  4C56 C;  1C48 A;  3GTL H;  3E3X A;  2FHT A;  2JA7 G;  4DV5 Q;  4X3U A;  5C3E G;  3F8T A;  2F0I A;  4K0K Q;  1D2B A;  2NN6 I;  1PRT C;  5IP9 G;  3AFP A;  1LT3 D;  2N3S A;  2LFN A;  1MGS A;  3L3O C;  4TQU S;  4FO2 A;  2KEN A;  3DUZ A;  4JI1 L;  4QL5 A;  5M9O A;  2VQE Q;  2HDL A;  2E5L L;  2EE1 A;  1IYU A;  2MNA A;  1EFW A;  4BBR H;  1WD0 A;  2E2J H;  3HOU H;  4JI5 Q;  1H9K A;  3KFU A;  1Z7T A;  4OX9 Q;  1KDC A;  1O80 A;  2IX3 A;  4GZY C;  3J7Z C;  3FKI G;  1STY A;  3J81 i;  3CCJ A;  1IZ6 A;  4DN4 M;  3NPP A;  2F0J A;  4J8Q A;  3URY A;  5JEA G;  1PH2 A;  5M5Y B;  3D6C A;  3S16 B;  3KF8 A;  4MTK A;  2JA9 A;  1SAP A;  2EXD A;  3EN2 A;  4B3R Q;  1QUQ B;  2AUJ D;  4DAM A;  3E0E A;  1UWV A;  3DXJ C;  1B53 A;  2PMZ B;  1VMP A;  1WCM H;  4QCL A;  5FJ8 G;  1Y1V B;  3K0X A;  4MIU A;  5G3L F;  2SOB A;  3UDI A;  1I6H B;  2RDG A;  4IJL A;  4XDX A;  5M3M H;  1OXU A;  2X69 A;  2K01 A;  4IJH A;  4DV0 L;  1SNQ A;  5C3X A;  4DR3 L;  1VQ4 A;  3NQI A;  1PRT B;  4QJF A;  4JI4 Q;  5LMN L;  3TME A;  2JN4 A;  1CT1 D;  2BOS A;  3GTO B;  4KKU A;  2E76 C;  4ZQ3 A;  5FLX L;  5C0X J;  3VDY A;  3NEL A;  2PNH A;  2EVB A;  3NBH B;  2NVQ B;  3TS0 A;  5LL6 S;  1EU4 A;  1ICW A;  3RLN A;  1XMQ Q;  4A93 G;  4PMC A;  4NXM Q;  3RNU A;  3PIP A;  1X55 A;  2Z6K C;  1Y1W H;  4JI3 Q;  3S1N H;  4C2M H;  5LMU Q;  4OO1 G;  5T1I A;  2OTJ A;  1S5B D;  1DOL A;  3J80 c;  3M4Q A;  4IPG A;  2KOL A;  1ROD A;  1PH3 A;  2UUA Q;  3H0G G;  5A2Q L;  1GD7 A;  1PH8 A;  4ZAI A;  2EPB A;  2OCE A;  3PCO B;  1C4Q A;  2OEO A;  5JJI A;  5C0X G;  1Q8K A;  3AB9 A;  2DNE A;  2RKS A;  4YIJ A;  2MFI A;  1S72 A;  3HFZ B;  3S1M B;  3A56 A;  2WAQ B;  3C46 A;  4HSP A;  3F1Z A;  4ZCK A;  3Q6S A;  3BZC A;  1TWH B;  4QMG A;  4R4C A;  1E0B A;  4JOI C;  4K5V A;  2WV6 D;  3I73 A;  3GTJ H;  2VQF Q;  2F0V A;  4AQY Q;  1CA5 A;  3GTL B;  1EY8 A;  3I4L A;  1PV4 A;  5CBA E;  3NWT A;  3J81 c;  4HMI A;  5COR A;  4A3F H;  2EZV A;  2RCF A;  1FJG Q;  4L5R C;  1WTH A;  3TBI B;  1PH7 A;  4K2L A;  1L1O C;  4OEL B;  2IHF A;  3ZYY X;  2K5Q A;  5IGD A;  4GKJ Q;  1AE3 A;  1TT2 A;  4BBR B;  3HOU B;  2E2J B;  3H09 A;  4YWM A;  2UUC L;  2Q2I A;  1XNQ Q;  4FXK C;  1TY2 A;  2CFM A;  3LNN A;  1UEA B;  3HOZ H;  2CCZ A;  4DR4 L;  3H91 A;  4ZYS A;  1LT5 D;  4HJ5 A;  1LTL A;  1BOS A;  2HIX A;  3S1R B;  1QZG A;  1MJE A;  4A76 A;  2JA7 H;  5C3E H;  3EIV A;  3S24 A;  3PV0 A;  5IP9 H;  1SE4 A;  3K59 A;  2MPM A;  1F9S A;  1X3Q A;  1SDF A;  3QOJ A;  3SHL A;  3R2I A;  4HAE A;  3IKJ A;  2RBM A;  1EL0 A;  4PZ7 A;  3VYS A;  1KD1 C;  1P8L A;  3G6E A;  4S3S A;  4OHJ A;  1KNE A;  2Z8L A;  4RKL A;  1A2T A;  5K5P A;  5M3M B;  3I4O A;  3GV3 A;  3FKI H;  1BNZ A;  5JEA H;  1ESR A;  2XVS A;  3QR8 A;  5EBC A;  1RF2 D;  3R2T A;  1XYI A;  4I7A A;  1ZYR D;  4JI2 Q;  1L1O B;  5EPJ A;  1LTR D;  3OWF A;  1HR0 W;  2N55 A;  4KY5 A;  2KHJ A;  4R4T A;  1UEB A;  1TQO A;  2Q8I B;  4MNO A;  3A7L A;  1HNW L;  2A19 A;  5M3F G;  5H1S E;  1C0A A;  3CC7 A;  1HUN A;  3T56 B;  5FJ8 H;  4KMU C;  1Y1W B;  3ERO A;  3HG9 A;  4JI6 L;  4LFA L;  3S1N B;  4C2M B;  3K5M A;  1C8C A;  3PUX A;  4IUT A;  1GUG A;  1TU2 B;  1AE2 A;  4TSS A;  2L4N A;  1EQR A;  1GJX A;  2WB1 B;  3AU7 A;  1HCZ A;  3K5O A;  3P75 A;  4B3M Q;  4O1N A;  1TWC H;  3G71 A;  1CI3 M;  4OWX B;  5CV8 A;  2A6H D;  5CMD A;  1HQR D;  1TR5 A;  1HFG A;  2J7Z A;  1IL2 A;  4JBK A;  2K5D A;  3KF6 B;  1EEF D;  4GNX B;  2C35 B;  4A93 H;  2D62 A;  3DWP A;  2VS1 A;  1T5E A;  1FGB D;  1QZH A;  4ZUJ A;  2EIF A;  3BG3 A;  2K52 A;  1S40 A;  1NE3 A;  4H02 A;  3GDE A;  2A5H A;  5AFW A;  4OO1 H;  3CF5 A;  1KLU D;  1PH1 A;  2FMM A;  3GTJ B;  2MUY A;  1I94 L;  1Y14 B;  2HUG A;  4JI0 Q;  4R8N A;  4A3D G;  1B70 B;  3A74 A;  3H0G H;  2B2Y A;  2LXJ A;  4AH6 A;  4A3F B;  3A5U A;  1PTO D;  1STH A;  5C0X H;  1DM0 B;  4DR1 L;  1CFM A;  1SLJ A;  3MC0 B;  4KHP Q;  2KUM A;  1IBK Q;  1DD2 A;  3KBG A;  2KCM A;  2F0D A;  1ZEQ X;  1KL9 A;  4YHH L;  4ODG A;  5ELF A;  3TRE A;  5EQ0 A;  1V1P A;  2D0P A;  2UXB L;  2ZTC A;  4DUY L;  1F2Z A;  1XJV A;  1IL8 A;  2X6L A;  1XPO A;  3HOZ B;  3D0F A;  2SDF A;  1NBW A;  4LF8 Q;  1JWU D;  4Y7N H;  2F0F A;  3DEP A;  3K5L A;  2JA7 B;  5C3E B;  1N32 Q;  5IYB G;  4X6A H;  3DM1 A;  2I07 B;  4X3T A;  4DV5 L;  1LTG D;  3G48 A;  5JVG 3;  4CGY B;  1XTD A;  2NBF A;  1TS3 A;  2K5N A;  1F2M A;  2VQE L;  4JYA Q;  2RCN A;  5D3I B;  4JI5 L;  3FKI B;  1YNJ C;  1XPR A;  3D31 A;  1LAC A;  4IUN A;  1TWG H;  1I5F A;  5BR8 Q;  4ID6 A;  3OMC A;  2NZO A;  5GAE C;  1JE5 A;  2GN5 A;  1F2L A;  4IO9 A;  4B3R L;  1YIT A;  2EYO A;  2B29 A;  4GOP C;  2XN9 C;  1LTT D;  5C6A A;  2KCC A;  1VQF A;  4RKB A;  4DNT B;  1TS2 A;  2RVL A;  4KY6 A;  2ZXO A;  3IFD A;  1S5E D;  2BDO A;  2L1B A;  1PVO A;  3CAM A;  4NKL A;  4LF9 L;  1A6X A;  1TWC B;  2FMC A;  1EWC A;  5KGU A;  2HQE A;  2PI2 E;  2EYL A;  3VA7 A;  4K8J A;  1YI2 A;  3RMH A;  1JOO A;  2Z0S A;  1IBM L;  4A93 B;  1TXY A;  1SE8 A;  1GO3 E;  4G57 A;  4YCV A;  5M3F H;  1HFN A;  1HR0 L;  4O0A A;  2KEC A;  5KNB A;  2A6E D;  5E4X A;  2QEX A;  5CBE E;  1YBY A;  1HZA A;  1MD2 D;  3TZU A;  1A63 A;  1EWI A;  4ABN A;  3UDG A;  1VQK A;  3KLW A;  3BDC A;  1LAB A;  1T5X D;  4FVM A;  4U68 A;  3TQY A;  4B3T L;  2CQA A;  4RGO S;  3H0G B;  1RTO A;  1Y8O B;  4BA2 I;  4KN4 C;  4GOP B;  1OXV A;  4I65 A;  2M9V A;  1E1T A;  3D4R A;  1BVS A;  3RZO H;  1JQY D;  2JA5 G;  3M9B A;  4H13 C;  4LUZ A;  2I46 A;  1QJO A;  2EOT A;  5CR3 A;  1VQL A;  4GLX A;  1VF5 C;  2WAQ G;  2UXC Q;  4F8M A;  1AH9 A;  2ZT9 C;  4LF4 Q;  1BCP D;  4LFC L;  3CCQ A;  2L9H A;  2QF7 A;  3GQB A;  1B3Q A;  5C3W A;  4LNQ A;  4Y7N B;  3BZK A;  3HEJ A;  2JSO A;  1E24 A;  3LWU A;  1BF4 A;  4A3D H;  4IQZ A;  4DR5 L;  2VB2 X;  1VQH A;  4AQY L;  5IT9 E;  1SND A;  5KRU A;  1HNZ Q;  3M85 A;  3KUP A;  4DV6 L;  2XWB B;  1Q90 A;  4EX5 A;  2AKW B;  1X54 A;  3BVM A;  2Y0S G;  2KQ3 A;  1FGU A;  2F0N A;  1MSG A;  1WTV A;  5I9P A;  3AQQ A;  1FJG L;  2EYH A;  3I90 A;  2EY6 A;  4GKJ L;  4KHV A;  1GHK A;  3GTQ H;  1HRJ A;  1XNQ L;  3BVG A;  3DLL A;  4KLK A;  2E2D C;  1R9T H;  2ZTD A;  2E74 C;  1TWG B;  3EA6 A;  2DNC A;  3PGZ A;  3RLO A;  2GVA A;  2B2U A;  4C3J G;  4DNI A;  5IYB H;  1BBW A;  3NE5 B;  1TS4 A;  4DV1 L;  1V43 A;  2AHO B;  2GA4 B;  4ALP A;  2K5H A;  3E5S A;  4LJZ C;  1VQN A;  4DAP A;  3MXN B;  2XSC A;  2F0Q A;  4JCV E;  2EYJ A;  3SK6 A;  4NXN Q;  3F2C A;  4LF6 L;  3A55 A;  3QJY A;  4G4K A;  2UU9 Q;  1E7Z A;  4DAY B;  2B2W A;  3A7A B;  3TN2 A;  5M3M G;  4CJ0 B;  1U5K A;  3ONA B;  2K4K A;  3S16 H;  1W6K A;  1ZKO A;  1VQC A;  1G6Z A;  1H9J A;  4X3S A;  1AEX A;  1MJC A;  1VQO A;  3PIO 3;  1X3G A;  5IIF A;  3J81 j;  5M3F B;  4A75 A;  1IYJ B;  4OO1 I;  3AEV A;  4A3C G;  3SEB A;  4ZKB B;  2F0M A;  4GLV B;  1Q46 A;  3SXH A;  1FD7 D;  2XRQ D;  2RHS B;  2KED A;  4IFD G;  1CKN B;  4LF5 Q;  1Q1E A;  3WOE A;  1Y1W G;  3Q23 A;  3G7L A;  2K7V A;  2D2C C;  5C0X I;  4N8X 1;  5IGB A;  1BQQ T;  3STB C;  4XTC S;  3OYY A;  1IBL L;  1A62 A;  4HSV A;  2WB1 G;  1YNX A;  2HT1 A;  1SJH D;  3MHB A;  3RZO B;  4HJ9 A;  1E1O A;  1H9S A;  1WTQ A;  1LLR D;  2XNA C;  2ICE C;  2A1A A;  4IPD A;  4B3M L;  1GVP A;  2KJX A;  1PTO F;  3MFY A;  3SDZ A;  5FKA C;  1PTO H;  3NWS A;  3PF5 A;  2AQ3 B;  3AFQ A;  5C5M A;  1U4R A;  3QG1 A;  2VY3 A;  1ZYR C;  2NYZ D;  4P75 A;  1GUN A;  4YY3 L;  5JAV A;  2WAQ E;  5E7N A;  5GAH C;  4POG A;  1LV9 A;  2K32 A;  4FF3 A;  1YHA A;  4A3D B;  4MHE A;  3PSI A;  2AMC B;  4LK1 C;  5I6W A;  2Y0S E;  1JOQ A;  1N36 Q;  1KAB A;  2IJ0 A;  2PW7 A;  1IXR A;  3MAQ A;  5IGF A;  2JA5 H;  3J7A 5;  1XTC D;  3A5Z B;  3HOW H;  5HGT A;  1HJP A;  1VQA A;  3PMF A;  5FO7 B;  5DEH A;  5AJ3 Q;  1Y8N B;  1W3S A;  1I4X A;  3GTQ B;  4WOR A;  2A6H C;  1QCB D;  4DV4 Q;  3UI2 A;  1R9T B;  4PQX A;  2YTV A;  5DAU A;  3OTO Q;  3WDN A;  4G7O C;  3R3O A;  4KD4 A;  3T51 B;  1CM9 A;  1F2Y A;  4N9P A;  2L11 A;  1ET6 A;  4TRD A;  2K5V A;  2MP1 A;  3H3V H;  2KHS A;  2G9D A;  4LUO A;  3GTP H;  4O2D A;  4F87 A;  1HTP A;  1U0L A;  2EJM A;  3U4Z A;  4NW2 A;  1QNU A;  2K50 A;  2VZA A;  4XYO A;  4ZRZ A;  1A0I A;  3OHX C;  1VQB A;  1X3E A;  2IHE A;  1PTO C;  4Y52 H;  1EIH A;  4DV3 Q;  4NMZ A;  4RGT A;  2HHH Q;  2NTS A;  4DGZ A;  4IPH A;  4C3J H;  3Q22 A;  5EJW A;  2B2V A;  3S1R H;  4EVO A;  4WJW A;  2DN8 A;  3E6Z X;  2R92 G;  5BN3 A;  1FL0 A;  4DFA A;  4ME5 A;  1TII D;  3TRZ A;  1SMY D;  2MHV A;  4N9T A;  1KAA A;  4DR6 Q;  1UUP A;  4KD3 A;  2MQH A;  3IFT A;  1PYB A;  5GRO A;  2OQ0 A;  3J7Y W;  1TKW B;  3S14 H;  3VYR A;  1JMC A;  1JWS D;  1GHJ A;  2UXD L;  2FJ2 A;  2WB1 E;  4K6D A;  5CV9 A;  4KN7 C;  5CGK A;  2CHB D;  1AZP A;  5E1F A;  4A4I A;  3M4Y A;  4UDU C;  5GAG C;  1DJR D;  1VF7 A;  2GVB A;  4LAA A;  1XPU A;  1FNW A;  1HNX L;  2PO4 A;  2F1M A;  5EKK A;  1PTO B;  3Q0A A;  3T1H Q;  4A3C H;  3H3V C;  4HIK A;  2M2L A;  3CCU A;  3W2D A;  2CQO A;  4IFD H;  1PMR A;  2A74 C;  1TWF H;  4FXG C;  2NVX H;  2CWP A;  3WWV A;  2KA7 A;  3DEO A;  5FO8 B;  2WAC A;  4M8A A;  1PH5 A;  1LTI D;  3CCS A;  4U67 3;  1B4O A;  4CDE C;  3DWA A;  1KIX A;  2JA5 B;  3TSS A;  3J7A F;  4RHR A;  3U9O A;  3HOW B;  1MI2 A;  2G5D A;  4OON A;  3RUZ A;  5M5W H;  3BU2 A;  1N34 Q;  1ICF B;  4JBW A;  2NZH A;  1EQV A;  3K8A A;  2ATW A;  2UXC L;  1EYD A;  5I4D A;  2LMC B;  2QGQ A;  4LF4 L;  1II3 A;  2F0W A;  3FEW X;  1SJE D;  2A6E C;  2K75 A;  4XXE A;  5I2X A;  4PMW A;  2G9H D;  1Z47 A;  2RSN A;  1NR2 A;  3VR6 A;  1BR9 A;  1HNZ L;  2Y0S B;  2WKD A;  2AWN A;  3MEF A;  2O5I C;  1QIL A;  3GTP B;  2MO0 A;  2H1E A;  3SVM A;  4WFN 3;  4G7H C;  3VA5 A;  3SE0 A;  4M1U B;  4FP5 D;  2XRS D;  4DF7 A;  1K28 A;  5FLX E;  4ZKC B;  2X6G A;  3KJO A;  2I0Q A;  3VR5 A;  3BDL A;  3JAM L;  4DV2 Q;  1XMO Q;  3NBH A;  3PIO A;  2R7F A;  4IAL A;  1K0S A;  4O42 A;  5BN5 A;  2IWH A;  3P7J A;  1STB A;  3NSW A;  3CCE A;  2B2Y C;  4JI8 Q;  3KLR A;  1EOT A;  3CPF A;  4NP5 A;  4C3J B;  4MN3 A;  1O7Y A;  2A68 D;  4RA8 A;  2PQA A;  2ZJQ A;  2LS0 1;  3A8J E;  4LFB Q;  1SEB D;  4HED A;  1K8M A;  5ELN A;  5A2Q E;  3KDF B;  2BCO A;  1TY0 A;  2Q2T A;  5GQO A;  4C3H G;  3CKI B;  4X65 Q;  1XNR Q;  4WJ4 A;  3L7Z C;  4X64 Q;  2WIN B;  3D8G A;  1B1Z A;  3PUV A;  3RLF A;  5I6Y A;  1X3F A;  4K5X A;  4OGQ C;  3S14 B;  1C7Y A;  1W6J A;  1X9N A;  2UU9 L;  1DOK A;  3T4A C;  1PYW D;  1ZXT A;  5IT9 c;  1SNM A;  5IWA Q;  1KRT A;  4RG1 A;  1GM5 A;  1B50 A;  5KND A;  4LUV A;  3M4P A;  4K5W A;  2F0P A;  2K05 A;  1A2U A;  4CKC A;  3I4M H;  3K7U C;  2R92 H;  1WTW A;  4KY7 A;  2ZM6 Q;  1O7L A;  4CJ1 B;  3N6R A;  1L0X B;  2F0E A;  1HUM A;  4L6T B;  1TWF B;  1QVF A;  4RH6 A;  4LF5 L;  1XX8 A;  4OEM B;  3JAM E;  4QB4 A;  2NVX B;  2RDF A;  4B3S Q;  3MA2 B;  3VYT A;  4R8I A;  1EY5 A;  1V1P B;  1M8A A;  4LWC A;  3PF4 A;  2I5L X;  3S1Q H;  1ILP A;  1RKN A;  4JG2 A;  1K0R A;  5J1Z A;  3PUZ A;  3K58 A;  2YU9 H;  1A15 A;  5M5W B;  1YNN D;  3H6M A;  2F4V Q;  5JJZ A;  1JJC B;  1SYD A;  2F3V A;  3MEH A;  3PQI A;  3CCV A;  3M4O H;  3E0J A;  1EFI D;  1PFS A;  1K3R A;  3BJU A;  2B2T A;  1PZK D;  3K7A H;  2OWO A;  3TP7 A;  4EQN A;  4GKK Q;  1YHQ A;  5JJK A;  3QB3 A;  3H3V I;  3GTK H;  1U9R A;  2N78 A;  1N9W A;  4JI7 L;  1LT4 D;  1OXS C;  3ICE A;  1IW7 D;  2QCP X;  4KJN A;  1DYQ A;  5FLM G;  2IPK D;  1HQM C;  2L55 A;  1PRT D;  3J80 L;  5D3D A;  1UNS A;  3X3N A;  2Q2U A;  4HJ7 A;  2V4D A;  2E2I H;  5AJ3 L;  1HH2 P;  4EQ5 A;  4P74 A;  3AYH B;  2JA8 G;  3ERS X;  1DCZ A;  3RZD H;  4DV4 L;  1F77 A;  3A0J A;  3CPW A;  1RL2 A;  2R6G A;  5ELD A;  3OTO L;  3I56 A;  3R8B A;  3O13 A;  1X56 A;  5C4X H;  1K8A C;  2HCI A;  4BBS G;  1RTN A;  1EIG A;  3CMA A;  3NUC A;  1QOH A;  4K0K L;  1HPC A;  5I9O A;  4P2C B;  1I50 H;  1R4P B;  1N8R C;  2JA6 G;  3U58 A;  4LF7 Q;  4IUQ A;  4GNX A;  3J81 L;  1H95 A;  3TZD A;  2F0O A;  1YJ9 A;  1EQQ A;  4OX9 L;  4RFB A;  1VQ6 A;  1NJI C;  1AN8 A;  4DV3 L;  4FF2 A;  4OXP A;  2QKI C;  1CUK A;  3I7F A;  4JC0 A;  2RA4 A;  2XWJ B;  1N33 Q;  1WTR A;  1LYL A;  1VDZ A;  4CDF C;  3I4M B;  2R92 B;  4IFD I;  2CWA A;  2KHI A;  3CXC A;  5DM7 3;  4C3H H;  3HOV H;  4N8F A;  1PH4 A;  3HRZ C;  1TVX A;  2D5D A;  1CZW A;  4YWK A;  4F88 A;  4Q5V A;  4DR6 L;  2Q8R E;  1SE3 A;  2WKC A;  3T1Y Q;  1G51 A;  4UAI A;  3HOX G;  5IP7 H;  2YYZ A;  1Y8P B;  3OSO A;  2RHQ B;  1CTM A;  1MKH A;  3SGI A;  1A3T A;  4JI4 L;  3S1Q B;  3GD7 A;  4BXX G;  1D1I A;  1E22 A;  2YU9 B;  4BY7 G;  3FP9 A;  1U4L A;  1D6E C;  4HN7 A;  3M4O B;  1PDQ A;  4A3E G;  3ND8 A;  1B44 D;  4DR3 Q;  3V2T A;  3P20 A;  1XMQ L;  2B2W C;  2ICI A;  4NXM L;  5IE8 A;  1F9P A;  1K8O A;  2Q8T A;  3K7A B;  1SYC A;  4A3G G;  3D4D A;  1BXT A;  1SMY C;  4JI3 L;  5LMU L;  1L0W A;  3GTK B;  4EQO A;  4A3L G;  1VQG A;  2R61 A;  5EPK A;  3TDQ A;  5C4J H;  2UUA L;  1S5D D;  3K57 A;  1F9R A;  1QG7 A;  1ML0 D;  1CQV A;  1KDA A;  1RCV D;  4IUR A;  3LGJ A;  3HOW G;  2E2I B;  1N34 L;  4X3K A;  2R3Z A;  4ZUI A;  1HXY D;  1XXG A;  3RZD B;  4IZ8 A;  4OWT B;  4K8I A;  2O4X A;  3I4N G;  2VQF L;  5C4X B;  2DGY A;  2V1C C;  4JBM A;  1SSO A;  3ULJ A;  1AFP A;  1D1K A;  4E6I A;  3GP7 A;  1SFO H;  3HOY B;  2NWG A;  1B7Y B;  1STN A;  5FLM H;  3I55 A;  1G2T A;  4H44 C;  1I50 B;  4KJO A;  1KTK A;  4A3B G;  3CRK C;  3V05 A;  1VQ9 A;  5LHY 1;  4DK1 A;  1L2F A;  2K33 A;  1YJW A;  4YWL A;  3SK8 A;  2BH2 A;  1GXD C;  4DV2 L;  4TVA B;  1XMO L;  3BYT B;  5COY A;  2JA8 H;  3UE0 A;  3W3A A;  4UY8 C;  5J3B A;  4BBS H;  2JYO A;  1E2W A;  4HIO A;  3C1E A;  4IUU A;  3K81 C;  2H5X A;  2UUC Q;  2K14 A;  1JWM D;  3CC4 A;  4LFB L;  4HR7 B;  4C3H B;  3HOV B;  4DR4 Q;  1B9N A;  1Q8I A;  4C1N K;  2JA6 H;  1HZ9 A;  4X65 L;  1PA6 A;  2Z6B A;  2PZT A;  1E2Z A;  4GN3 B;  1H9S B;  4C3I B;  3MVV A;  3K0Y A;  1RJT A;  1EY6 A;  1O7I A;  2SEB D;  1YZ6 A;  1QB5 D;  5JPM C;  5IYC G;  3W1G A;  2EXZ A;  4DXF A;  3PUW A;  3NXW A;  1C9O A;  3UDX A;  5HGQ A;  4JI2 L;  1VQJ A;  1D5Z C;  1EZ8 A;  2KVM A;  3OWE B;  4POF A;  1SMX A;  5FLX c;  3NTH A;  1I4R A;  1I3Q H;  2ZM6 L;  1B2T A;  1CZG A;  1NMF A;  2K28 A;  3FRP B;  2A68 C;  5JVH 3;  1UAP A;  1VS0 A;  1B8A A;  2F4I A;  1AZQ A;  4KK7 A;  3WOF A;  3HOX H;  3R93 A;  1ENA A;  1VQI A;  2ID0 A;  2FFK B;  4YCU A;  1SNP A;  4B3S L;  3S17 H;  3LWE A;  4ZK9 B;  2AUK A;  3CW2 C;  4H7B A;  1HNW Q;  5C4J B;  1PH6 A;  4BXX H;  3NHH A;  5HY6 A;  2F0L A;  4BY7 H;  1DOM A;  3CP0 A;  4UP9 A;  2NZ1 D;  4JI6 Q;  4LFA Q;  1Y69 U;  2ZXR A;  1EY0 A;  2CW0 D;  2EY1 A;  4A3E H;  1HHV A;  5ELB A;  2MGS A;  3MXN A;  3HGB A;  4P71 A;  4ZLT F;  3ULP A;  2M00 A;  4A3G H;  1Q82 C;  5M5X H;  2DY8 A;  2YTY A;  1UE6 A;  2K03 A;  2B63 H;  1K9M C;  3NEM A;  4MZ9 A;  1KAW A;  1STG A;  4DUZ Q;  4A3L H;  3S2H B;  1KHI A;  4JI0 L;  1M1K C;  3IRB A;  4JPB W;  4DU9 A;  3CCM A;  1VQP A;  4RCN A;  2MJ8 A;  1SFO B;  3NTI A;  1VCI A;  3HZX A;  4A3K G;  5KYL A;  4KHP L;  1BKB A;  1IBK L;  1D5X C;  3Q24 A;  4NB3 A;  1M90 C;  4QF4 A;  1I94 Q;  3KF8 B;  2F03 A;  5IGC A;  1Z6H A;  1KC8 C;  5EBD A;  1SYB A;  2ALY B;  3JAM c;  4L5S A;  2JA8 B;  3F2B A;  1QNK A;  1YNN C;  4RGN A;  2PQE A;  5IYD G;  3PO2 G;  1WVL A;  4LF8 L;  4DA2 A;  1CKN A;  3I4N H;  4DNR B;  4BBS B;  2IX0 A;  1SRO A;  1Q7Y C;  1TS5 A;  1N32 L;  1PLF A;  1VQD A;  2UXB Q;  1SBB B;  5CC4 A;  2JP1 A;  3RR5 A;  1EY7 A;  3ITP A;  2WFW A;  4C1N I;  4A3B H;  1WYD A;  2UUB Q;  2JA6 B;  1MBY A;  2A69 D;  1JCK B;  1CSQ A;  2PI2 A;  3C2P A;  3TS2 A;  3K80 C;  2L15 A;  2JQO A;  1EQT A;  2AQ2 B;  5GAD C;  1A8V A;  3PO3 G;  1KRS A;  2TMP A;  4JYA L;  1OXT A;  1WI5 A;  2P5Z X;  2R7D A;  1X32 A;  3VR2 A;  2R7Z H;  3A8I E;  2KCN A;  1LT6 D;  4OIJ A;  1I4H A;  5ELE A;  1I4G A;  5C5L A;  1D7Q A;  3D6W A;  5BR8 L;  1EYA A;  1N33 L;  1V1Q A;  4X62 Q;  3OW2 A;  3I4M G;  3U50 C;  1I3Q B;  3K5N A;  3F2U A;  1KQS A;  2OXP A;  4A3M H;  4R1J A;  1YJN A;  1Z9F A;  1SE2 A;  3OW7 A;  3ULL A;  1E2V A;  3HOX B;  1MIU A;  3CD6 A;  5D14 A;  3T1Y L;  2N8N A;  1WTX A;  4QUC A;  2HIV A;  4XYQ A;  3S17 B;  1DZ1 A;  3DM3 A;  3NQT A;  5JJL A;  3I3C A;  1JOR A;  3L2P A;  4DR7 Q;  2LY7 A;  5IYC H;  4BY7 B;  5J39 A;  5K36 G;  3PUY A;  4X66 Q;  4FYD A;  4ME3 A;  2B8G A;  4A3E B;  3NEN A;  1HZC A;  3ER0 A;  2VW9 A;  4A3I G;  4LF9 Q;  1EY4 A;  4A3G B;  5EGT A;  3MXG A;  2Q2H A;  5KIX A;  5M5X B;  1H9R A;  3D3R A;  1BCP F;  2B63 B;  1J8I A;  1UE1 A;  1STA A;  2RQX A;  4A3J H;  3KYH C;  1WD1 A;  1RHP A;  4CJ2 C;  2OT2 A;  1IBM Q;  2A8V A;  5FO9 B;  3J7A V;  2N88 A;  3AMU A;  1HR0 Q;  2QA4 A;  2NUC A;  5T1G A;  1EYC A;  2JXM B;  1VQ8 A;  3KJP A;  4GLA C;  2IY5 B;  1NCV A;  1YVC A;  3MWY W;  3HKZ G;  1QUQ A;  4JBJ A;  2PQA B;  4PG3 A;  1NTG A;  4B3T Q;  4V0B A;  1MHW C;  3CHB D;  1V1O A;  2CVR A;  2PYK A;  4GN4 B;  1EY9 A;  2RSO A;  4UP8 A;  1HA5 A;  3I4N B;  3RN5 A;  4YCW A;  4BY1 B;  5KNC A;  1JT8 A;  1ASZ A;  1S5F D;  1NR4 A;  4MTN A;  4NDX A;  1K73 C;  3ND9 A;  5C4X G;  1XWE A;  5EPL A;  1LTA D;  3H94 A;  3N52 A;  5KEE A;  1J5E Q;  4QQB X;  4L63 B;  3HOY G;  2H4O A;  4A3B B;  4IPC A;  3CME A;  3NP8 A;  4A3K H;  1LTB D;  4LFC Q;  1QVG A;  2B2T C;  2K1B A;  2AQ1 B;  2IL8 A;  4DR5 Q;  4XT1 B;  4HJ8 A;  4DV6 Q;  4XQN A;  1BUV T;  3P1H A;  4FDB A;  2R7Z B;  1BDO A;  4WJ3 M;  5IYD H;  3PO2 H;  4DPG A;  2VXW A;  2N49 A;  3CRL C;  4L8J A;  2KCT A;  1A3V A;  3EBE A;  5C44 G;  1CK1 A;  3ERQ A;  5E3F A;  1BCP C;  4K14 A;  3OIP A;  1V9P A;  3C1F A;  3HS0 C;  1GUW A;  1G6P A;  1MSH A;  2J4X A;  1KXL A;  4A3M B;  3HOV G;  2LKV A;  1JB3 A;  3OIQ A;  3DMU A;  1SNC A;  1D5M C;  5DNF A;  3BVZ A;  1WFQ A;  4NXN L;  1FVI A;  4Z9C B;  4L5Q A;  4OL7 A;  5C4H A;  3PO3 H;  3MXP A;  2EYF A;  4PV1 C;  2E2H H;  1Q81 C;  1EZ6 A;  2DJG C;  2DUD A;  4C3I G;  3U4V A;  4XT3 B;  5IP7 G;  4DV1 Q;  3S15 H;  3ZJY C;  1O78 A;  3H15 A;  1CHP D;  3M3Y H;  1E3P A;  1OO9 B;  1WOC A;  1SNO A;  4KHZ A;  5EKI A;  1KDB A;  2E8G A;  3Q8D A;  5DLQ E;  1AW7 A;  1EUJ A;  4KKS A;  5IOC A;  5DM6 3;  4OWW B;  1NUC A;  4OIK A;  1J6Q A;  1QVC A;  3M7N A;  3TP8 A;  4LF6 Q;  3STB D;  2D9U A;  1Q3L A;  1WCM B;  2NN6 G;  1GOZ A;  4CKE A;  4GNX C;  4F7X A;  2YTX A;  3MXU A;  1UE5 A;  4CKB A;  2Z6K A;  1F9Q A;  2PNR C;  1LM0 A;  2L12 A;  2NVT H;  2DY7 A;  3OMG A;  2Z4I A;  5ELO A;  3I2Z A;  3OOC A;  1GUO A;  3I91 A;  3TP5 A;  4IUP A;  1BCP B;  4A3J B;  3KBX A;  3TEH B;  2O5J C;  5F2D A;  1G2S A;  3FHW A;  1DGS A;  2R93 G;  2BE5 D;  4HMJ A;  5K36 H;  2K04 A;  3X3M A;  3T13 A;  1G8Z D;  4UP7 A;  1JE4 A;  1P16 A;  5KYI A;  3HKZ E;  2EYM A;  1PFM A;  4JVZ A;  3S2D H;  3NTK A;  3FMC A;  2QIL A;  3KDF A;  2HQL A;  4A3I H;  1IBL Q;  1A3U A;  1ENF A;  4DAV A;  5CV4 A;  2WP8 J;  1S5C D;  1QWY A;  4JOI A;  4EQP A;  4DV7 Q;  3GV6 A;  5BN4 A;  1CQF A;  3E9I A;  2B8F A;  1B9M A;  5FOB B;  4DUZ L;  2OQK A;  5J22 A;  4YY3 Q;  1EOV A;  4JV5 Q;  1G29 1;  3CCR A;  4G7Z C;  2VUM G;  4A3K B;  1L1O A;  1N36 L;  4LMQ D;  2K5W A;  1S3O A;  3F2D A;  1B3A A;  2SNS A;  2QEJ C;  3CQZ H;  1PXU A;  1U4P A;  1EEI D;  2RDH A;  3UDF A;  3SK4 A;  3A54 A;  1CSP A;  3QOL A;  1WTO A;  1DXM A;  3LX0 A;  4APV A;  2CH4 A;  1IHZ A;  3GTG H;  3PO2 B;  2C9O A;  3E9H A;  2CW0 C;  2Z4H A;  4AYB G;  2KBN A;  4QY7 A;  3M7G A;  4FNF A;  2QDL A;  1VQ5 A;  2EY2 A;  3I8Z A;  1YEZ A;  4DXG A;  3S9W A;  2XIW A;  2EY5 A;  1BBU A;  1OXX K;  2B3G A;  1SR3 A;  4R9W A;  4DR2 Q;  3HOY H;  1K3B C;  1HA6 A;  3NK9 A;  5JOB A;  3KOJ A;  2UUB L;  3BYY B;  3QO2 A;  1JIC A;  3FVQ A;  3KF6 A;  3PO3 B;  4V19 0;  3KK7 A;  2E2H B;  1JJG A;  3L9A X;  4CBV A;  3BZD B;  2KEE A;  4PZ6 A;  1JR0 D;  3S15 B;  1FR3 A;  1L0Y B;  4J15 A;  3M3Y B;  1JC7 A;  2NVY H;  2HHH L;  5C44 H;  5ISR A;  1I4P A;  4ILW A;  4B9W A;  4HCE A;  3I70 A;  4JI1 Q;  3W1B A;  2E5L Q;  4XIG S;  4HIM A;  1ENC A;  1K83 H;  2F3I A;  2IX1 A;  3NBI A;  2D0O A;  4FF4 A;  1EU3 A;  1Q86 C;  3IL8 A;  2OTL A;  2JEB I;  4X62 L;  3EVQ A;  2SNM A;  3RD4 A;  4DK3 C;  1JOK A;  4HCS A;  4IOA A;  1BO0 A;  3L0O A;  3FPP A;  3HP3 A;  2NVT B;  2FXQ A;  4IOC A;  5IGG A;  3QWN A;  4BS9 A;  4C3I H;  3J80 E;  2IT1 A;  3FPU B;  2B2U C;  2A69 C;  4QUF A;  2XGT A;  2ZXP A;  1VQM A;  1M4V A;  1AP0 A;  1FNU A;  4R4O A;  4FXD A;  4RHS A; 
#chains in the Genus database with same CATH homology
 1I3Q H;  4JI2 Q;  1L1O B;  1NMF A;  1TWA H;  5EAY A;  3W5O A;  2ZM6 L;  3S14 H;  1JMC A;  4DR7 L;  1HR0 W;  2KHJ A;  2F52 A;  3UE1 A;  4R4T A;  1VS0 A;  1B8A A;  1UEB A;  2UXD L;  2WB1 E;  4X66 L;  4L5T A;  4BA1 I;  3HOX H;  4MNO A;  4QIW E;  4A4I A;  1Y1V G;  1VQI A;  2A19 A;  4DV0 Q;  5GAG C;  5M3F G;  5H1S E;  1HNW L;  3T1H L;  1W2B A;  2GVB A;  1XPU A;  2ID0 A;  2UXD Q;  1C0A A;  5LMN Q;  4YCU A;  3CC7 A;  1HNX L;  4B3S L;  3S17 H;  5FJ8 H;  4JI6 L;  4LFA L;  1CKO A;  3CW2 C;  1HNW Q;  3JC6 6;  3PUX A;  3T1H Q;  1Q12 A;  1PH6 A;  4BXX H;  5HY6 A;  4A3C H;  4HIK A;  1AE2 A;  5IY0 A;  4BY7 H;  3CCU A;  1HNX Q;  3CP0 A;  4UP9 A;  2B63 G;  2CQO A;  2LSS A;  1EQR A;  4LFA Q;  3RN2 A;  4JI6 Q;  2R93 H;  1TWF H;  1SN8 A;  2YV5 A;  4A3E H;  4B3M Q;  1VQ6 A;  1TWC H;  3G71 A;  4OWX B;  2NVX H;  2CWP A;  4P71 A;  1NY4 A;  3WWV A;  4DKA C;  1IL2 A;  3ULP A;  2BH8 A;  4JBK A;  4A3G H;  1Q82 C;  3KF6 B;  4GNX B;  2C35 B;  2LXK A;  4A93 H;  2D62 A;  5M5X H;  4KI0 A;  1PH5 A;  2YTY A;  1UE6 A;  2VS1 A;  3CCS A;  1QZH A;  1K9M C;  2B63 H;  3NEM A;  4MZ9 A;  1KAW A;  2EIF A;  4DUZ Q;  1KIX A;  4A3L H;  1KHI A;  2K52 A;  1S40 A;  1M1K C;  4JI0 L;  1NE3 A;  1NMG A;  4H02 A;  3IRB A;  3GDE A;  1X6O A;  4LW1 A;  4OON A;  5M5W H;  3CCM A;  4HID A;  1VQP A;  3BU2 A;  4AYB E;  3CF5 A;  1YHB A;  1N34 Q;  1PH1 A;  2BA0 A;  1VCI A;  1I94 L;  1Y14 B;  4JI0 Q;  4A3D G;  4JBW A;  1RIP A;  2NZH A;  1UE7 A;  3S2H H;  1B70 B;  3K8A A;  3A74 A;  3H0G H;  4A3K G;  4BY1 G;  3CCL A;  2ATW A;  4KHP L;  1BKB A;  1IBK L;  2UXC L;  2QGQ A;  2LXJ A;  4LF4 L;  4NB3 A;  4AH6 A;  1M90 C;  1I94 Q;  3KF8 B;  1K8G A;  2VUM H;  2JK8 A;  1GKH A;  3A5U A;  1KC8 C;  4DR1 L;  1SLJ A;  2K75 A;  2ALY B;  1J5E L;  3JAM c;  4L5S A;  4PMW A;  3GTM H;  3F2B A;  1Z47 A;  4NPS A;  1IBK Q;  4KHP Q;  1ASY A;  2KCM A;  3GO5 A;  1HNZ L;  1KL9 A;  4YHH L;  5IYD G;  3TRE A;  3PO2 G;  4P72 A;  2AWN A;  4LF8 L;  2D0P A;  1CKN A;  2ZTC A;  3MEF A;  3I4N H;  2UXB L;  4DUY L;  2MO0 A;  1XJV A;  1XPO A;  2AWO A;  2IX0 A;  1SRO A;  3D0F A;  1Q7Y C;  1NBW A;  3KJO A;  4LF8 Q;  2I0Q A;  1VQD A;  2R7Z G;  1N32 L;  2UXB Q;  3RR5 A;  4Y7N H;  4DV2 Q;  1XMO Q;  3PIO A;  4JI8 L;  2RF4 A;  2WFW A;  4A3B H;  1WYD A;  2R7F A;  2UUB Q;  1JB7 A;  1N32 Q;  2PI2 A;  1CSQ A;  5IYB G;  4X6A H;  3TS2 A;  3K80 C;  2L15 A;  2JQO A;  3CCE A;  4DV5 L;  4JI8 Q;  3G48 A;  5GAD C;  1A8V A;  3CPF A;  4BBR G;  4GOP A;  3HOU G;  3PO3 G;  1KRS A;  4GN5 A;  1XTD A;  2JJQ A;  1OXT A;  1WI5 A;  4JYA L;  2PQA A;  2R7D A;  2ZJR A;  2K5N A;  2ZJQ A;  4A3M G;  1XNR L;  2R7Z H;  1SRU A;  1T9H A;  3JAM i;  4LFB Q;  2ES2 A;  4P73 A;  4X64 L;  2BA1 A;  2VQE L;  5ELN A;  4JYA Q;  2RCN A;  3KDF B;  3HOU H;  4JI5 L;  2Q2T A;  5GQO A;  4X65 Q;  2ASB A;  1XNR Q;  1D7Q A;  5BR8 L;  1XPR A;  4WJ4 A;  3L7Z C;  3D31 A;  1N33 L;  4X64 Q;  1V1Q A;  4X62 Q;  3OW2 A;  3I4M G;  3PUV A;  3RLF A;  5IWA L;  1X3F A;  1TWG H;  1I5F A;  2I5M X;  3U50 C;  1KQS A;  5BR8 Q;  1C7Y A;  2NZO A;  5GAE C;  4A3M H;  1X9N A;  1JE5 A;  4R1J A;  2UU9 L;  3HKS A;  2GN5 A;  1YJN A;  2XTI A;  1Z9F A;  5IT9 c;  4IO9 A;  2PMZ E;  5IWA Q;  4B3R L;  4PZ8 A;  1KRT A;  3ULL A;  4RG1 A;  5LMN W;  1YIT A;  1MIU A;  1WCM G;  1GM5 A;  1VQ7 A;  4IFD J;  4LUV A;  3CD6 A;  3T1Y L;  3M4P A;  2N8N A;  2B29 A;  4GOP C;  2HIV A;  1HZB A;  3DM3 A;  3I4M H;  1VQF A;  3K7U C;  2R92 H;  5JJL A;  4R4Q A;  3L2P A;  2ZM6 Q;  4DR7 Q;  5M5Y H;  5IYC H;  2ZJP A;  1CKM A;  1VQE A;  4R4I A;  5K36 G;  2I5H A;  3PUY A;  4X66 Q;  4A3J G;  1PVO A;  3CAM A;  2JEA I;  4ME3 A;  1EIF A;  1QVF A;  4LF9 L;  4LF5 L;  3NEN A;  1PYS B;  3B6Y A;  4B3S Q;  2EQS A;  1HZC A;  2PI2 E;  3ER0 A;  2VW9 A;  4A3I G;  4LF9 Q;  1YI2 A;  4GS3 A;  2VNU D;  2Z0S A;  2Q2H A;  1IBM L;  4LWC A;  2F4V L;  1Y1V H;  1TXY A;  1SE8 A;  1GO3 E;  4YCV A;  4QGU A;  5M3F H;  2I5L X;  3PF4 A;  3S1Q H;  4JG2 A;  4O0A A;  1HR0 L;  1I6H H;  1K0R A;  1UE1 A;  2VL6 A;  4DK6 C;  4A3J H;  1WJJ A;  3KYH C;  3PUZ A;  4AIM A;  2QEX A;  2YU9 H;  1YBY A;  1HZA A;  1IBM Q;  2F4V Q;  2A8V A;  1A63 A;  1EWI A;  1JJC B;  3UDG A;  1VQK A;  3KLW A;  1HR0 Q;  3CCV A;  3M4O H;  2QA4 A;  1D8L A;  1PH9 A;  1VQ8 A;  4GKK L;  1EIY B;  3GTO H;  3KJP A;  1PFS A;  4DV7 L;  1K3R A;  3BJU A;  4GLA C;  3TQY A;  4B3T L;  1EYG A;  2IY5 B;  4BA2 I;  3K7A H;  2OWO A;  1YVC A;  4IFD I;  3HKZ G;  4GOP B;  1QUQ A;  1OXV A;  4JBJ A;  1YHQ A;  2NVQ H;  1LUZ A;  3H3V I;  4GKK Q;  5JJK A;  4JV5 L;  2PQA B;  4PG3 A;  1E1T A;  3RZO H;  1BVS A;  1NTG A;  4B3T Q;  3GTK H;  2CKZ B;  2N78 A;  2JA5 G;  1YIJ A;  1N9W A;  3M9B A;  4RMF A;  4LUZ A;  4GN4 B;  2ZTE A;  4JI7 L;  4UP8 A;  3CC2 A;  1OXS C;  3ICE A;  1X65 A;  3RN5 A;  1VQL A;  1Q1B A;  4GLX A;  1PHJ A;  4YCW A;  2WAQ G;  2UXC Q;  5FLM G;  1AH9 A;  4JI7 Q;  4LF4 Q;  1ASZ A;  1JT8 A;  4LFC L;  4MTN A;  1K73 C;  3CCQ A;  5C4X G;  2Q2U A;  4LNQ A;  3BZK A;  4DR1 Q;  4HJ7 A;  4A3D H;  1E24 A;  1J5E Q;  2E2I H;  5AJ3 L;  1HH2 P;  4A3F G;  4QQB X;  4EQ5 A;  4P74 A;  4DR5 L;  3HOY G;  1VQH A;  2MO1 A;  4IPC A;  4AQY L;  3CME A;  4A3K H;  1HNZ Q;  4BY1 H;  4LFC Q;  4YHH Q;  3AYH B;  3M85 A;  4DV6 L;  1QVG A;  2JA8 G;  3ERS X;  3G4S A;  4EX5 A;  2AKW B;  4DUY Q;  1X54 A;  3RZD H;  4DV4 L;  2Y0S G;  4DR5 Q;  3A0J A;  3CPW A;  4HJ8 A;  1RL2 A;  3S1M H;  1FGU A;  2R6G A;  3I56 A;  3OTO L;  4DR2 L;  1JJ2 A;  4DV6 Q;  3AQQ A;  1OTC A;  1FJG L;  1X56 A;  4FDB A;  5C4X H;  3J80 i;  1K8A C;  3HOZ G;  2JE6 I;  4BBS G;  3PO2 H;  4WJ3 M;  5IYD H;  4DPG A;  4HJA A;  1TWH H;  2N49 A;  4GKJ L;  3CMA A;  4K0K L;  4LF7 L;  4UPA A;  5JEA J;  2KCT A;  3GTQ H;  3EBE A;  5C44 G;  1XNQ L;  3GTL H;  1I50 H;  3DLL A;  2JA7 G;  4DV5 Q;  1N8R C;  2JA6 G;  5C3E G;  4KLK A;  3U58 A;  1R9T H;  3F8T A;  2ZTD A;  1V9P A;  4K0K Q;  2NN6 I;  5IP9 G;  4LF7 Q;  4GNX A;  3AFP A;  2N3S A;  1G6P A;  4TQU S;  3RLO A;  3PGZ A;  1H95 A;  2GVA A;  1KXL A;  1YJ9 A;  3HOV G;  1EQQ A;  5IYB H;  4DNI A;  2KEN A;  4OX9 L;  1BBW A;  4JI1 L;  4QL5 A;  2E5L L;  2VQE Q;  4DV1 L;  1NJI C;  4DV3 L;  1WFQ A;  4NXN L;  2MNA A;  1FVI A;  1V43 A;  2AHO B;  4L5Q A;  4OXP A;  2K5H A;  1CUK A;  4BBR H;  4ALP A;  1EFW A;  2E2J H;  4JI5 Q;  1VQN A;  3KFU A;  3MXN B;  3I7F A;  1Q81 C;  2E2H H;  4JCV E;  4OX9 Q;  2DUD A;  4JC0 A;  3U4V A;  1N33 Q;  5IP7 G;  1LYL A;  4DV1 Q;  4NXN Q;  3S15 H;  3ZJY C;  3J7Z C;  3FKI G;  3J81 i;  3F2C A;  1IZ6 A;  3H15 A;  2CWA A;  3CCJ A;  1E3P A;  1WOC A;  5JEA G;  1PH2 A;  4LF6 L;  3M3Y H;  2KHI A;  4KHZ A;  3CXC A;  3HOV H;  4C3H H;  2E8G A;  3Q8D A;  1E7Z A;  5DLQ E;  1EUJ A;  4DAY B;  1PH4 A;  2UU9 Q;  4OWW B;  1J6Q A;  1QVC A;  2JA9 A;  4YWK A;  5M3M G;  3M7N A;  2EXD A;  3EN2 A;  4LF6 Q;  3STB D;  2E5L Q;  4DR6 L;  4B3R Q;  1QUQ B;  4DAM A;  1U5K A;  2NN6 G;  3T1Y Q;  1G51 A;  3E0E A;  1UWV A;  2K4K A;  4GNX C;  2YTX A;  3HOX G;  3S16 H;  5IP7 H;  2YYZ A;  2RHQ B;  1UE5 A;  1VQC A;  1MKH A;  3SGI A;  2Z6K A;  1MJC A;  1LM0 A;  1VQO A;  2NVT H;  1WCM H;  5FJ8 G;  1X3G A;  5ELO A;  3K0X A;  3J81 j;  3I2Z A;  4A75 A;  1IYJ B;  4JI4 L;  3UDI A;  4OO1 I;  4IJL A;  3AEV A;  3GD7 A;  1OXU A;  5M3M H;  4BXX G;  4IJH A;  4A3C G;  4DV0 L;  1E22 A;  4BY7 G;  3TEH B;  4DR3 L;  1VQ4 A;  3FP9 A;  1Q46 A;  3FHW A;  4GLV B;  4QJF A;  2RHS B;  1DGS A;  4JI4 Q;  5LMN L;  4IFD G;  1CKN B;  4LF5 Q;  2R93 G;  1Q1E A;  1Y1W G;  4A3E G;  4DR3 Q;  1XMQ L;  5C0X I;  4NXM L;  4UP7 A;  5IE8 A;  1P16 A;  3STB C;  4XTC S;  3OYY A;  5C0X J;  3VDY A;  3NEL A;  2PNH A;  1A62 A;  1IBL L;  3HKZ E;  2WB1 G;  1YNX A;  2HT1 A;  4A3G G;  3NBH B;  3TS0 A;  3S2D H;  3RLN A;  4A93 G;  1XMQ Q;  4JI3 L;  4NXM Q;  5LMU L;  4HJ9 A;  1E1O A;  1L0W A;  3KDF A;  3RNU A;  2HQL A;  4IPD A;  2A1A A;  4A3I H;  4B3M L;  1GVP A;  1IBL Q;  3PIP A;  4A3L G;  1VQG A;  1X55 A;  2Z6K C;  1Y1W H;  2WP8 J;  3PF5 A;  4JI3 Q;  3S1N H;  3AFQ A;  4C2M H;  5LMU Q;  4OO1 G;  5C4J H;  4JOI A;  2VY3 A;  4DV7 Q;  4P75 A;  4YY3 L;  2UUA L;  2OTJ A;  3J80 c;  3M4Q A;  2WAQ E;  4IPG A;  3E9I A;  5E7N A;  4DUZ L;  5GAH C;  1PH3 A;  2OQK A;  4POG A;  3LGJ A;  3HOW G;  2UUA Q;  3H0G G;  4YY3 Q;  1EOV A;  1GD7 A;  1PH8 A;  4JV5 Q;  1YHA A;  1G29 1;  2OCE A;  3CCR A;  3PCO B;  1N34 L;  2VUM G;  3PSI A;  5JJI A;  5C0X G;  1L1O A;  1Q8K A;  1N36 L;  1S3O A;  3F2D A;  3CQZ H;  2AMC B;  3UDF A;  2MFI A;  2Y0S E;  1S72 A;  3HFZ B;  1CSP A;  4APV A;  4OWT B;  1N36 Q;  3I4N G;  1IXR A;  2VQF L;  2JA5 H;  3GTG H;  3J7A 5;  3A5Z B;  3HOW H;  2DGY A;  1HJP A;  1VQA A;  2V1C C;  3F1Z A;  4JBM A;  3E9H A;  3BZC A;  3ULJ A;  5AJ3 Q;  4R4C A;  4AYB G;  2KBN A;  1W3S A;  4QY7 A;  3GTJ H;  4JOI C;  2VQF Q;  4AQY Q;  1SFO H;  1B7Y B;  1VQ5 A;  1PV4 A;  5FLM H;  3I55 A;  3J81 c;  4A3B G;  1YEZ A;  4DV4 Q;  1VQ9 A;  2YTV A;  1L2F A;  1BBU A;  1OXX K;  2B3G A;  1SR3 A;  3OTO Q;  4DR2 Q;  4A3F H;  1YJW A;  4YWL A;  3HOY H;  1FJG Q;  2BH2 A;  4DV2 L;  1XMO L;  4TVA B;  4L5R C;  2JA8 H;  3UE0 A;  1PH7 A;  1L1O C;  2IHF A;  3KOJ A;  2UUB L;  4GKJ Q;  1AE3 A;  2K5V A;  3H3V H;  3KF6 A;  4UY8 C;  4YWM A;  2UUC L;  2Q2I A;  4LUO A;  5J3B A;  1XNQ Q;  4O2D A;  3GTP H;  1JJG A;  1U0L A;  2CFM A;  3HOZ H;  4PZ6 A;  4BBS H;  3U4Z A;  2CCZ A;  4DR4 L;  2K50 A;  2VZA A;  4J15 A;  4HIO A;  3K81 C;  1A0I A;  2H5X A;  2UUC Q;  2K14 A;  4HJ5 A;  1VQB A;  1LTL A;  1X3E A;  2IHE A;  2NVY H;  2HIX A;  2HHH L;  3CC4 A;  4LFB L;  5C44 H;  4DR4 Q;  4Y52 H;  1QZG A;  1MJE A;  4A76 A;  2JA7 H;  4JI1 Q;  2JA6 H;  3W1B A;  5C3E H;  4XIG S;  4HIM A;  4DV3 Q;  1HZ9 A;  4X65 L;  1K83 H;  2F3I A;  3EIV A;  3S24 A;  2D0O A;  1PA6 A;  3PV0 A;  5IP9 H;  1Q86 C;  2IX1 A;  2HHH Q;  2OTL A;  2JEB I;  4X62 L;  4GN3 B;  4IPH A;  4C3J H;  4PZ7 A;  3S1R H;  4DK3 C;  4IOA A;  3L0O A;  1KD1 C;  1P8L A;  3G6E A;  2FXQ A;  4IOC A;  1O7I A;  2R92 G;  1FL0 A;  1YZ6 A;  4C3I H;  3TRZ A;  5IYC G;  2IT1 A;  3W1G A;  3I4O A;  3PUW A;  3UDX A;  1C9O A;  5HGQ A;  4JI2 L;  3FKI H;  1VQJ A;  4DR6 Q;  2MQH A;  1PYB A;  2XGT A;  5GRO A;  2OQ0 A;  4POF A;  1SMX A;  1VQM A;  5FLX c;  3PO3 H;  4R4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...