3U4ZA

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
TLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDDQRKVITYNQEQGVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 17
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u4zA00
2JE6I 3J7ZC 4BA2I 2NN6I 1LUZA 1XNRL 5IE8A 4GOPC 4YHHL 4JYAL 5M3MG 4A3EH 2RF4A 4XTCS 3H15A 2KHIA 3A5ZB 4LUOA 4AQYQ 4GN5A 4DPGA 1EFWA 3J80c 4B3SQ 2IT1A 4X64Q 4HJ9A 1I50H 4GNXC 4JI3L 4DR2Q 5LMNW 5C4XH 1L1OA 4DR5Q 1TWHH 4DV2Q 1HNWQ 1SLJA 2WB1G 4YWLA 3M4OH 4JI4Q 1VQ6A 1FJGL 3DM3A 2N3SA 3D0FA 2K75A 1QUQB 1HZ9A 4A3KH 4UP8A 4R1JA 1UE6A 3W5OA 1D8LA 1VQ8A 3CMAA 5JJKA 1EWIA 4JBWA 2ZJRA 4LF9L 3HKZG 4BBRH 2JK8A 2UXCL 2L15A 1M90C 2D62A 2NN6G 4C3JH 4BBSG 2E8GA 4DR7Q 3M7NA 2UXBQ 2BH8A 3GTKH 3T1HL 1YVCA 4IJLA 4A3BH 1QVGA 1EQRA 3I56A 4NPSA 5LMNL 2VUMH 4GS3A 1JE5A 4P73A 3L7ZC 4DK6C 1X3EA 5IWAQ 1Q81C 4A3CG 3LGJA 4MTNA 1WI5A 3KDFB 4IPGA 4A3FG 2RCNA 4XIGS 3D31A 3CC7A 3U50C 2CWAA 2KHJA 5IYCG 4DV5L 2UUCL 3S2HH 4LFBQ 4AYBE 3GO5A 4OWXB 5GQOA 2HT1A 2Z6KA 3M3YH 4APVA 3TRZA 3M4PA 2YTXA 4RMFA 4DV0Q 1C7YA 1PYSB 1KHIA 1N34L 2B63G 3CXCA 4B3MQ 1TWCH 4AH6A 2K5NA 4QIWE 2JA7G 4A3DG 2PI2E 4JI0Q 2VY3A 2Y0SG 3FKIH 3FP9A 1YI2A 3OW2A 4UY8C 2JQOA 2KCMA 3KJOA 1GVPA 1PHJA 4YWMA 4QQBX 4AIMA 5M3MH 4BY1H 4JBJA 3CCMA 3HOXG 4NB3A 2YYZA 4JI8Q 4DR3Q 2UU9L 1W2BA 3TS2A 2IY5B 1JJ2A 5ELNA 4JV5L 3HOUG 1YHBA 3G6EA 2VQFQ 2KBNA 4EQ5A 3GTGH 2MFIA 4L5RC 1Q12A 4DV3Q 3AFQA 4BA1I 5IYDH 3HKZE 3HKSA 4WJ3M 3EBEA 1YJWA 4ME3A 1B70B 1DGSA 1SN8A 1VQHA 3CCVA 2V1CC 3STBD 2F3IA 1Q82C 2E5LL 1UE7A 3S24A 1OXVA 4GLVB 4A3EG 2JA8H 4P74A 3UDIA 4QL5A 2WAQG 4HIKA 3JAMc 4DR2L 4LF5L 4PZ6A 3T1YQ 2NZHA 4R4OA 4IJHA 3GTPH 5C4XG 5JJIA 5GAGC 3GTOH 1XPOA 2QGQA 3L0OA 1X65A 2R6GA 2B29A 4JBMA 1HJPA 2ZTEA 1I6HH 1X3GA 4UPAA 3IRBA 4A3KG 2AWOA 4JOIA 4DR4Q 3S1MH 2FXQA 3S15H 3G48A 3GD7A 4KHPQ 1V9PA 3BU2A 4BBRG 2PNHA 1K73C 1J5EL 1YNXA 1KRTA 1YIJA 1VQFA 2OCEA 2MNAA 1R9TH 4A3BG 2LSSA 2VUMG 2JA9A 1B7YB 4OX9L 2IX1A 1Y1VH 1OXXK 2A19A 5M5WH 3RN5A 4R4IA 1HR0Q 4IPDA 4BXXH 3BZKA 4DNIA 3K0XA 4JI7L 4GLAC 3F2DA 4DUYQ 3DLLA 1FVIA 4YY3Q 2E2HH 1S72A 2XGTA 3TREA 2I5HA 4YCVA 1TWGH 3NBHB 1IBKQ 4LF8Q 4KI0A 3PUZA 2RHSB 3L2PA 4B3ML 4IPCA 2ID0A 1KQSA 3PF4A 3AQQA 2OQKA 4HIOA 5C0XJ 4H02A 4C3HH 1YEZA 2JJQA 3K7UC 1K0RA 4X66Q 1N32Q 3FKIG 2PQAA 1Q8KA 1IBLQ 1PYBA 4DAMA 4DR6Q 1HNZQ 1S40A 3KOJA 2BA1A 4A3JH 2WAQE 4LFAQ 1VQOA 3S16H 2K14A 5C4JH 4LF7Q 4BY1G 3K80C 2IX0A 5IY0A 2E2JH 5FLMH 1E3PA 2OQ0A 1HH2P 3JC66 1PH9A 5C3EH 2DUDA 4DUZQ 2D0OA 4B3RQ 4K0KQ 2OTJA 4JBKA 1N36Q 1WYDA 5GAHC 1J6QA 1OXUA 5C44H 3E0EA 2R92H 3PUVA 4DV3L 4YCUA 2F4VL 1HZCA 2Q2UA 4GOPA 5IYDG 4MZ9A 1VQNA 4IFDJ 4HJAA 2ZTCA 4B3TL 1QVCA 2QA4A 5M5YH 3CC4A 1N9WA 1Y1WH 2CFMA 4DV7Q 4P72A 4DV4L 1VQMA 3PO3H 1BBUA 3NELA 2AMCB 1EOVA 4GNXA 1YHAA 3PO2H 5ELOA 4HIMA 4HJ8A 3K7AH 2JA8G 1BKBA 3PGZA 1UEBA 1QVFA 3J81j 3CCRA 1XMOQ 4LF4Q 4C3IH 1TWFH 4X6AH 3PV0A 1CKNB 3OTOL 4LW1A 2EXDA 4PZ8A 1UE1A 2BA0A 3F2CA 2N78A 4O2DA 3PUWA 4RG1A 2CQOA 1IBML 4A93H 1XMQL 3MEFA 1IXRA 2AKWB 4LFCQ 1K8AC 4A3GH 1PH2A 4JI2L 1SE8A 3CCJA 3ZJYC 1KC8C 2CCZA 3H0GH 1TWAH 4X62Q 1K8GA 4NXNQ 3G71A 4JI5L 2YU9H 1CSPA 2R7FA 4DKAC 2JA5H 3BZCA 1PH8A 1V43A 3CAMA 5AJ3Q 1VS0A 2R7ZH 4JI1Q 3HOYH 3CMEA 1Y1VG 3A0JA 5M5XH 1WFQA 1X54A 2K50A 5BR8Q 1MKHA 4BXXG 2CKZB 4DV6Q 1E7ZA 2GN5A 4X65Q 4O0AA 1KL9A 2MO0A 1WJJA 5GROA 1E1TA 5C0XI 1YITA 3KF6A 2PMZE 2HHHQ 2Q2TA 2UXDL 4BY7H 2WB1E 1VQLA 1N33Q 3NENA 3HFZB 3TEHB 1VQEA 2I5MX 1YJ9A 1JJGA 2BH2A 4TVAB 1TXYA 4NXMQ 2ZM6L 2UUBQ 1I94L 1E1OA 1G291 3EIVA 4X66L 3U4ZA 1N32L 3CCLA 1IL2A 3CF5A 2QEXA 1PVOA 1AE3A 2ASBA 3KFUA 4J15A 3ULLA 1SFOH 1K9MC 4LFAL 2VQEQ 1PA6A 1OXTA 1P16A 4A3JG 1Q46A 2ZJPA 4LF6Q 1VQJA 2I5LX 5JJLA 1QUQA 2ZJQA 3HOVH 4A3LG 4A3IH 1XNRQ 4AQYL 4P75A 4YHHQ 4B3SL 5FLMG 4X64L 4IFDI 4JYAQ 1VQIA 4B3RL 2WP8J 4QJFA 5C0XG 2JA6H 5C3EG 1JT8A 3F2BA 4DR5L 1X9NA 1NBWA 1HNXQ 3TS0A 4DV2L 1HNWL 5C44G 3KLWA 2WFWA 2HQLA 2PQAB 2GVBA 4JI3Q 2NZOA 4JI4L 3AFPA 2UUAQ 2R92G 2OTLA 1A62A 1BVSA 2YV5A 3RLOA 4HJ5A 4UP9A 1VQKA 1FJGQ 4R4TA 1LTLA 1SROA 1E24A 1Y1WG 1ASYA 2IHEA 1PH6A 1NTGA 3KDFA 4P71A 4DAYB 5IT9c 3PO3G 3S17H 3ERSX 1V1QA 2Y0SE 3G4SA 2N8NA 3PO2G 3B6YA 4LUVA 4DR7L 4LF4L 4A75A 4LF9Q 3HOZH 2UXBL 2UXCQ 1L1OB 4FDBA 5EAYA 1XNQQ 1VQ4A 3CPFA 4UP7A 4IFDG 5IWAL 4GLXA 3T1HQ 3UE0A 3E9HA 5HY6A 1YHQA 3CC2A 5LMNQ 1EQQA 1Y14B 1S3OA 1CKOA 4A93G 2B3GA 2ALYB 4LFCL 1ASZA 3I55A 1G6PA 4LFBL 2Q2HA 1AE2A 4PG3A 4DR1Q 3I4OA 1PH7A 4A3GG 1VQ5A 1KRSA 1CSQA 3CCEA 4OO1G 4KLKA 4DV0L 4DV5Q 2UUCQ 3K81C 3ER0A 5M3FH 4X62L 1Q1BA 1EUJA 3H0GG 1I3QH 4JG2A 3E9IA 1GD7A 1Z9FA 5AJ3L 2VW9A 1N34Q 2JA5G 4JI1L 4JI0L 3S1NH 2KCTA 1AH9A 3I4NG 4R4QA 3HOYG 2R7ZG 1KIXA 1YBYA 1JMCA 1LM0A 4JC0A 3RLFA 1JJCB 3M9BA 3PIPA 4DV6L 3I2ZA 1XPUA 1O7IA 5K36G 4Y52H 1VQDA 4JI8L 4A3LH 4DR3L 1RIPA 1CUKA 4LNQA 4L5TA 4JI6Q 1VQCA 3H3VH 5IYBH 4DV1Q 2UU9Q 4BY7G 2AHOB 5LMUQ 4GKKQ 2OWOA 1K83H 4NXML 2VQFL 4JV5Q 1YJNA 1FGUA 1VCIA 4AYBG 2JEAI 1XTDA 1OTCA 1EIFA 5H1SE 1VQPA 3GTQH 5HGQA 2EIFA 1VQGA 1L1OC 1JB7A 2JEBI 1PV4A 1P8LA 1X3FA 3UE1A 3UDGA 4GKJQ 1Q7YC 2H5XA 2CWPA 2A1AA 1PH1A 5JEAG 3HOWH 4A3IG 3HOVG 3I4MH 2E5LQ 2Z0SA 3NEMA 1NJIC 3A5UA 2JA6G 2LXJA 3MXNB 3T1YL 1FL0A 2VS1A 3PUYA 1HNXL 3AEVA 1X56A 3I7FA 1XPRA 4LF5Q 2UUAL 2HIVA 4A3MH 1Q1EA 1HR0W 1NMGA 3PIOA 5FJ8H 5IP9H 2R93H 4DR4L 3J80i 1VQ7A 2XTIA 4YWKA 4KHZA 3CW2C 2YTYA 3OYYA 2NVTH 2K5VA 4KHPL 3U58A 1VQAA 1GO3E 1K3RA 2K5HA 1X55A 2VL6A 2ZTDA 3CP0A 1XNQL 3HOZG 1J5EQ 1L0WA 2Q2IA 3I4NH 2Z6KC 5IP7H 1IZ6A 1X6OA 3Q8DA 1UE5A 1KAWA 1NMFA 4POGA 4IOCA 1SRUA 2C35B 1HR0L 3S1RH 4OX9Q 1N8RC 1A63A 4DK3C 3SGIA 3UDXA 1D7QA 4OONA 4Y7NH 4DUYL 4L5SA 3CQZH 4YY3L 4DR1L 3H3VI 1PH4A 3EN2A 1PFSA 4JI7Q 1IBKL 1CKMA 4LF8L 1H95A 4TQUS 3W1BA 4A76A 5M3FG 1A0IA 1SMXA 5JEAJ 3A74A 3PSIA 3K8AA 4IPHA 3TQYA 1B8AA 2R7DA 1IBLL 4WJ4A 3GTMH 3KYHC 3PF5A 1HNZL 4DR6L 1WCMH 3RZDH 1PH5A 3CCQA 5E7NA 4HIDA 3FHWA 5GADC 3RNUA 4LF7L 3U4VA 1IYJB 3GDEA 4JI6L 3UDFA 4GKKL 4DV1L 5LMUL 4DUZL 4K0KL 1UWVA 2MO1A 5IYBG 1VQ9A 4YCWA 1N36L 3S14H 2K52A 2YTVA 2KENA 3GTJH 1NY4A 3WWVA 3S2DH 1C9OA 1C0AA 4OXPA 2MQHA 1CKNA 2F52A 5FLXc 2F4VQ 4OO1I 1T9HA 2VZAA 3KF6B 4R4CA 3CCSA 1KXLA 4DV7L 1YZ6A 2E2IH 4ALPA 4GKJL 4B3TQ 5DLQE 3PCOB 4PZ7A 1OXSC 4EX5A 4POFA 3J7A5 3HOWG 4GN3B 4LWCA 4DV4Q 3ULPA 2I0QA 4GN4B 3I4MG 4JOIC 1A8VA 1XMOL 3F1ZA 5J3BA 4BBSH 1E22A 1M1KC 4HJ7A 1QZHA 3RLNA 1PH3A 2EQSA 3ULJA 1HZBA 4GOPB 3S1QH 4A3CH 4OWWB 3OTOQ 1Z47A 2RHQB 4A3MG 3BJUA 2DGYA 5FJ8G 3STBC 4LUZA 5IP9G 1WOCA 4A3FH 1QZGA 1IBMQ 2R93G 2D0PA 1XMQQ 1L2FA 4GNXB 3M4QA 1SR3A 5IYCH 3JAMi 3KF8B 3AYHB 2NVYH 3W1GA 3VDYA 1U5KA 4JI2Q 4NXNL 4A4IA 3GTLH 1HZAA 3M85A 2B63H 3CCUA 1U0LA 2JA7H 3ICEA 4JI5Q 4A3DH 4IOAA 4JCVE 5IP7G 1RL2A 3CPWA 1NE3A 1MIUA 3F8TA 2A8VA 5BR8L 3J81c 3KJPA 4MNOA 4X65L 1KD1C 2HIXA 1GKHA 2HHHL 3PUXA 1Q86C 1W3SA 2LXKA 3HOXH 1N33L 2NVXH 4QGUA 2K4KA 4OWTB 2IHFA 1G51A 1EIYB 2UXDQ 1GM5A 3RR5A 4QY7A 3J81i 3HOUH 2ES2A 2UUBL 3CD6A 4C2MH 2ATWA 2NVQH 1MJCA 1LYLA 5GAEC 1XJVA 1MJEA 2VNUD 4IO9A 2ZM6Q 2GVAA 1I94Q 1I5FA 2AWNA 3RZOH 4L5QA 4PMWA 2PI2A 1WCMG 2VQEL 3RN2A 4LF6L 1BBWA 2N49A 1EYGA 1VQBA
chains in the Genus database with same CATH superfamily
3J7ZC 4BA2I 1RDPD 5IE8A 4YHHL 1IYUA 5M3MG 4A3EH 4MTKA 4FF2A 3A5ZB 2B2YC 2XIWA 4IUVA 1O80A 3DWQA 1I50H 2I46A 5LMNW 4DR5Q 3QOLA 5DNFA 1TWHH 1HNWQ 3TP5A 1SLJA 2WB1G 3M4OH 1VQ6A 1FGBD 5C3EB 2K75A 4R1JA 5BN3A 1EIGA 1VQ8A 3CMAA 5JJKA 1K8OA 5E3FA 4BBRH 1TVXA 1M90C 2D62A 3JAML 1MBYA 5M5YB 2BH8A 1Y1WB 2F0KA 4NPSA 1VF5C 1JE5A 4MIUA 4P73A 1Q81C 2WV6D 3A7AB 3PO2B 4XYQA 2O2LD 1PTOF 1EZ6A 1LTTD 1TWFB 3D31A 3U50C 2CWAA 2KHJA 4DV5L 2Z6KA 1PYSB 4IUQA 4I65A 1N34L 2B63G 5D14A 4B3MQ 5D3IB 2K5NA 4QIWE 2JA7G 4RGOS 5T1IA 2VY3A 3FKIH 1YI2A 1NSNS 2JQOA 3FRPB 4CDEC 1BQQT 1TWAB 2EYHA 1Z6HA 4YWMA 4QQBX 1T5EA 1IKMA 4OHJA 5M3MH 4NB3A 3HOYB 3SXHA 1JJ2A 4FXKC 1MD2D 4Q5VA 2A68D 2KBNA 4EQ5A 3GTGH 3K5NA 1STGA 3EBEA 1L0YB 4ME3A 1B70B 2EYOA 4I7AA 1PRTD 3C1FA 3STBD 2JA8H 4P74A 1HCZA 4DR2L 4RCOA 3T13A 3JAMc 1SFOB 3RMHA 5JJIA 3HOVB 1XPOA 2F4IA 2QGQA 4MN3A 2RQXA 3BDLA 2IWHA 2D2CC 1WTQA 1X3GA 3NSWA 1ZEQX 1IL8A 4A3KG 2K04A 4DR4Q 3C46A 1SAPA 5KIXA 3KK7A 3GD7A 3KLRA 4KHPQ 3BU2A 4RKBA 2FFKB 4C56C 2LSSA 1EYDA 5J22A 3R2TA 2IX1A 1Y1VH 2F0HA 3RN5A 1HR0Q 3T53B 2KVMA 1KDBA 4DUYQ 2E2HH 1GJXA 1FVIA 3OPOA 2R3ZA 1STYA 2E2DC 5IGEA 3NBHB 4K8IA 4HIOA 4X66Q 3K7UC 4K6DA 3C1EA 1Q8KA 4RKLA 4DAMA 2AQ3B 1HNZQ 5A2QL 3SDZA 4A3JH 4KKTA 3E6ZX 1GUOA 2IX0A 5IY0A 4N9PA 5FLMH 2OQ0A 1HH2P 3JC66 1PH9A 2OTJA 5GAHC 1G2TA 1XXGA 5C44H 3E0EA 1S5BD 2LKVA 4IFDJ 4B3TL 4K14A 1K83B 4ZK9B 4ODGA 3OSOA 4DV4L 3SK6A 1BBUA 1PTOD 2A6ED 2AMCB 4GNXA 3OHXC 4HIMA 1BKBA 1QVFA 3OWFA 3GTQB 3J81j 2K6AA 3L3OC 3OTOL 4G7ZC 4LW1A 2EXDA 2BA0A 2F0TA 1B9MA 1KLGD 2F0DA 5KYIA 1MSHA 1LACA 3A8JE 1IBML 4IUTA 5I2XA 1WTVA 4KK7A 3Q24A 1EU4A 2G9HD 4KJOA 4A3GH 4XXEA 4JI2L 3CCJA 1IW7C 4K8JA 2CCZA 4NXNQ 4HCSA 2YU9H 3JAME 1CSPA 1PFNA 2JA5H 4P2CB 2NVTB 3A54A 1VMPA 1YNJC 4PV1C 3A0JA 4KKUA 1CZWA 2CH4A 5BR8Q 3FDTA 1E7ZA 5J1ZA 4X65Q 1YITA 5C0XI 5E1FA 2Q2TA 3D4RA 1UAPA 3DM1A 1CK1A 1VQLA 3S1RB 4FF1A 3E5SA 4HCEA 2I5MX 1JJGA 4Y7NB 4TVAB 1TXYA 1U4MA 3FEWX 2XWBB 5KEEA 2X69A 3EIVA 2Z4IA 3U4ZA 1N32L 2A6HD 3CCLA 1IL2A 2KEDA 1PVOA 1AE3A 3NTIA 5EQ0A 2ASBA 2H1EA 2VQEQ 4LF6Q 1Q46A 1QUQA 2ZJQA 1B2TA 3GTMB 4JYAQ 1VQIA 1JT8A 2WP8J 4QJFA 3TBIB 5C0XG 4DR5L 4QIWB 3TS0A 1HNWL 1BF4A 3KLWA 3D8GA 2AUKA 4JI3Q 2L12A 2R92G 4KD4A 1V1PA 4DXFA 1SYEA 4DFAA 2EY2A 4ZUJA 3QWNA 3KDFA 3PO3G 3ERSX 2WB1B 3KLSX 3B6YA 4A75A 3HOZH 5IGCA 1QE6A 1I4HA 5DM63 1BUVT 4ME5A 3T1HQ 2EXZA 1YHQA 2F0LA 1S3OA 4A93G 2B3GA 1ASZA 1HFGA 1AE2A 3ERQA 3I4OA 1KRSA 3CCEA 4KLKA 5M3FH 3EQLC 5EBDA 4X62L 1I3QH 3ONAB 2VW9A 4IURA 1AH9A 4JI1L 1C8CA 3S1NH 1WTOA 3I4NG 2OT2A 4R4QA 1KIXA 5C3XA 1HUMA 1JMCA 3RLFA 1JJCB 3I2ZA 4M8AA 1KNAA 2RDHA 1WD0A 1WTPA 1HA5A 2B63B 2JA7B 4JW0A 4WORA 4JI6Q 3H3VH 5IYBH 2F0VA 3EA6A 1S5FD 1SYDA 4KD3A 4JV5Q 4DNRB 1FGUA 4MHEA 4QB4A 4AYBG 1BO0A 1EIFA 5H1SE 1VQPA 1L1OC 1JB7A 1P8LA 1X3FA 1MSGA 4C2MB 3UDGA 5KNBA 4GKJQ 1Q7YC 4ZRZA 1EY0A 2E5LQ 2Z0SA 1S4ZA 1B3AA 2JA6G 3TZUA 1JE4A 3GQBA 4A3MH 1TY0A 5IP9H 1TS5A 2R93H 5CV7A 4DR4L 2L0CA 2YTYA 3OYYA 4KHPL 3U58A 4JVZA 2RVLA 3DHQA 1S5CD 2E75C 1GUTA 2ZTDA 3CP0A 4L6TB 4A3KB 1EY4A 1J5EQ 2QDLA 1II3A 5EGTA 3I4NH 1IZ6A 1X6OA 1BBXC 1H9SA 1UE5A 1NMFA 2K32A 1HR0L 3QR8A 1Q8IA 2CW0C 4DUYL 5HURA 3A56A 1EYCA 3GTKB 1JOOA 4KMUC 3P7JA 2QILA 1PRTB 3BVZA 3BS1A 3HRZC 2VB3X 4OGQC 3MXPA 3LWEA 3S2HB 2EY5A 1O78A 1HNZL 1WCMH 3RZDH 2DNEA 4FVMA 1JC7A 5GADC 3RNUA 2A73B 3UDFA 4GKKL 4NP5A 4YCWA 2YTVA 1J8IA 1YNNC 1KLUD 3WWVA 1JB3A 1SDFA 1ET9A 1C0AA 1PFMA 2MQHA 3KBGA 2F52A 4HMIA 3S14B 2VZAA 1ML0D 4ALPA 3OWEB 5DLQE 1ESFA 3J7A5 2I0QA 1GOZA 4GN4B 4BBSH 1RCVD 1E22A 1SEBD 4B9XA 1Z47A 5FJ8G 1WOCA 3U9SA 4GNXB 3T4AC 5IYCH 4F7XA 3GTOB 3I3CA 3ZYYX 1KDCA 1HTLD 4NXNL 4A4IA 3R3OA 2F0IA 1TT2A 4RGMA 3E3XA 1AZPA 3ICEA 4A3DH 1H9JA 4IOAA 4JCVE 2FHTA 1RL2A 3CPWA 2A8VA 5BR8L 1H9KA 4RH6A 3J7AF 4X65L 1KD1C 1TS3A 4K5XA 2HIXA 1X3QA 2IL8A 1W3SA 4WJWA 1IKLA 1Q86C 1R9TB 4QGUA 2HD3A 4R9WA 4OWTB 2IHFA 1I4RA 2D5DA 2SNMA 3FPPA 4QY7A 3H91A 4GZYC 1PTOB 2NVQH 4PQXA 4IO9A 1LLRD 3M4YA 4V190 4DN4M 2VQEL 1LTSD 4LF6L 2N49A 1RIPA 1VQBA 1RTOA 3I70A 2KUMA 2NN6I 1LUZA 2B2WA 5ELCA 4JYAL 5CBAE 2DY7A 1SYGA 3RZOB 1KTKA 2KHIA 5JPNC 1SE2A 4AQYQ 4GN5A 4B3SQ 2LS01 4X64Q 3DXJC 4HJ9A 1ENCA 4JI3L 4DR2Q 4KY5A 3TP8A 4DV2Q 4JI4Q 1ILPA 3DM3A 2EYJA 2N3SA 3D0FA 1QUQB 1HZ9A 4UP8A 4K6LA 3SEBA 1UE6A 1ILQA 2R92B 4LJZC 4JBWA 3TDQA 1QILA 2ZJRA 3HKZG 1KNEA 3K5LA 1SJHD 1CQVA 2BDNA 2NN6G 1R4QB 4DR7Q 3NBHA 3T1HL 1YVCA 4A3BH 4RHSA 1QVGA 2VUMH 2HCCA 1V1PB 3PO3B 4DK6C 3L7ZC 5IGFA 1X3EA 5IWAQ 3K7AB 4X3SA 1STBA 1WI5A 3KDFB 4A3FG 1Y8NB 4OWXB 1XTCD 2LY7A 2HT1A 3M3YH 4APVA 1CFMA 1CT1D 4A93B 4QCLA 3CXCA 1TWCH 4DA2A 5CGKA 3VA7A 1TS4A 1NR4A 4PNYA 4UY8C 1K3BC 3ND8A 2KCMA 2LMCB 1S5ED 1CZGA 4DF7A 4O42A 1PHJA 3NWSA 4G57A 4BY1H 3HOXG 1AEXA 4DR3Q 1CHQD 2IY5B 4JV5L 3NK9A 4HN7A 1DOKA 1TY2A 1ZYRC 2VQFQ 2D9UA 3QB3A 1JICA 5IYDH 3HKZE 3MVVA 1SN8A 1VQHA 1M4VA 2DJGC 1DONA 1Q82C 2E5LL 1JWSD 1UE7A 2Z9HA 1PDQA 3S24A 4XYOA 4GLVB 4A3EG 1O7ZA 4DU9A 2WAQG 3VR3A 4HIKA 3T1YQ 2NZHA 4IJHA 3TSSA 5GAGC 3L0OA 1EOTA 2B29A 2RCFA 3IL8A 2ZTEA 1I6HH 4L63B 2JA6B 1CHPD 2KECA 2AWOA 4JOIA 1SNPA 2EYLA 2FXQA 1O7LA 1LTRD 2C9OA 1A15A 4BBRG 1K73C 4X3KA 1J5EL 4NDXA 1YNXA 4HAEA 1YIJA 4XT3B 2MNAA 2Q8TA 3DEPA 4HTHA 3P1HA 3HS0C 5M5WH 4R4IA 1PLFA 1SJED 4CJ0B 2KCNA 2L5TA 3BZKA 4DNIA 2KHSA 3K0XA 4GLAC 3F2DA 4YY3Q 2MUYA 5FO7B 4YCVA 1TWGH 1JQYD 4KTAA 3W3AA 4KI0A 4K5VA 3PUZA 2RHSB 1TU2B 1SE4A 1H9SB 3PF4A 1KQSA 4H02A 3OIQA 4C3HH 1YEZA 2JJQA 5FOBB 4FP5D 1N32Q 1SYCA 3FKIG 5FKAC 1PYBA 2HUGA 1S40A 3P75A 1Y8OB 2WAQE 1VQOA 3S16H 2K14A 5C4JH 4FF3A 3K80C 2EYPA 2E2JH 1E3PA 4NMZA 4CBVA 4JBKA 1N36Q 4G4KA 2EYFA 1J6QA 4V0BA 3SVMA 2KEEA 2Q2UA 3NBIA 4GOPA 1VQNA 4HJAA 2ZTCA 3BVMA 1N9WA 2B2TC 1VQMA 3NELA 2B2UC 1EOVA 5ELOA 2JA8G 3KF8A 1TKWB 1UEBA 2B2VA 4OIJA 1LTID 2A5HA 3K6OA 3NXWA 4IFDH 2PW7A 4PZ8A 3F2CA 2N78A 4O2DA 5COYA 2CQOA 1TQOA 3RUZA 1FYCA 4C3IB 4KN4C 4H44C 4O1NA 1YNJD 2A69C 2JYOA 1K8AC 1Y69U 3ZJYC 2FMMA 1KC8C 1B44D 3H0GH 1LO5D 4X62Q 4H13C 1V1OA 3G71A 1FR3A 4RAUC 1PH8A 4DK1A 2R7ZH 1VS0A 4UHVA 1CTMA 4JI1Q 1STHA 5KNCA 1Y1VG 5K36H 1WFQA 3GV6A 5EJWA 4H0LC 1WJJA 5GROA 2PMZE 3PMFA 4IUNA 4BY7H 1Z7TA 2WB1E 3NWTA 1X3PA 1N33Q 3HFZB 1LTGD 1BNZA 1E1OA 3H6MA 3ND9A 5FO9B 2O5IC 3MTSA 1KDAA 1SXTA 4J15A 1DOMA 4A3JG 1F9RA 1VQJA 3A8IE 5JEAH 4A3IH 4AQYL 4B3SL 5FLMG 4X64L 1SE3A 2FINB 2MHVA 1UUPA 1X9NA 1PZJD 5C5LA 3A55A 5C44G 4DV2L 4XT1B 2HQLA 2GVBA 4JI4L 1A62A 5EKLA 1VQKA 3H94A 4HR7B 3GTJB 3EROA 1SROA 2J4XA 2Z6BA 3S2DB 1JR0D 3S17H 4P71A 2F0WA 1A2UA 4RGTA 1V1QA 1BXTA 5A35A 4LUVA 4DR7L 4LF9Q 2F0UA 2UXCQ 4FDBA 2SDFA 2E2IB 3CPFA 4UP7A 5IWAL 4GLXA 5HY6A 4M1UB 3HKZB 1Y14B 1CKOA 5EBCA 4LFCL 4RHRA 3I55A 4KY6A 4TKOB 1G6PA 4PG3A 1PH7A 4A3GG 4OO1G 1H9RA 2UUCQ 1JWUD 1EUJA 4JG2A 4A3FB 1Z9FA 5AJ3L 2JA5G 1HUNA 2M2LA 3Q22A 1LM0A 3GTLB 1XPUA 3VYSA 4DV6L 4KN7C 4DR3L 1K0SA 4DGZA 1CUKA 1QOHA 2G9DA 4L5TA 1VQCA 2RSNA 3OOCA 4GKKQ 2AHOB 3BDOA 3QOJA 2BDOA 2ZT9C 4NXML 2VQFL 1YJNA 4K2KA 3HOXB 3MA2B 2AQ2B 3VR2A 1OTCA 2O5JC 1VQGA 3KLSA 1A3TA 2BE5C 3HOWH 1F2MA 1PH1A 1EQTA 3I4MH 1BCPF 3NEMA 5DAUA 3A5UA 1C48A 2LXJA 3T1YL 1RD9D 1HNXL 1ICFB 3AEVA 1X56A 2NWGA 4LF5Q 5I2YA 2RDGA 2UUAL 2KCCA 4TRDA 4A3EB 2ZXPA 1HR0W 1JORA 1EY6A 3PIOA 1RF2D 2WAQB 3J80i 1VQ7A 1I50B 2XTIA 3CU7A 3HEJA 4KHZA 4YWKA 3CW2C 3IFTA 4OO1H 2CW0D 1EEID 1TWHB 1Y8PB 4XQJA 2IX3A 1K3RA 2K5HA 1X55A 1XNQL 3HOZG 2Z6KC 3K5OA 5IP7H 2K33A 3NTKA 1AW7A 2WKDA 1K28A 4BBRB 1HA6A 5LL6X 1N8RC 1D7QA 5ELEA 2F0PA 3SGIA 4DK3C 4OONA 1QJOA 1PZKD 3CQZH 4YY3L 3H3VI 3TP7A 4JI7Q 5C4ZA 1NAPA 4CGYB 3DEOA 2F0SA 1BOSA 5M3FG 2EJMA 5JEAJ 1WD1A 3A74A 4IPHA 4CJ2C 4IQZA 2R7DA 3KYHC 3J81L 3PF5A 1LT6D 2NTTA 4FXDA 4HIDA 1FNUA 5JPMC 3U4VA 1LTAD 1EEFD 5LL6S 4DV1L 3FKIB 5IYBG 1N36L 3MFGA 3S14H 5M3MB 1E2ZA 2L55A 2K5WA 1GHJA 4OXPA 1CKNA 3K0YA 2F4VQ 1YZ6A 1T5XD 2PMZB 4PZ7A 1OXSC 4POFA 2PZWA 2HQEA 3GTGB 1RKNA 1V8QA 4UAIA 1A8VA 3HG9A 5J3BA 1M1KC 1QZHA 1PFBA 2A68C 3HP3A 1DCZA 2CHBD 3ULJA 4GOPB 3S1QH 4A3CH 4A3MG 1TS2A 2EDGA 4F87A 4PMBA 2WIIB 2DY8A 3STBC 3VYRA 2F1MA 5IP9G 2R93G 3RD4A 5D65A 3KF8B 3X3NA 3AYHB 4ZCKA 2RSOA 1U5KA 5BN4A 1VMCA 2IJ0A 5EPJA 1HZAA 1ICWA 1RTNA 2PO4A 3J80E 3CCUA 1LABA 4CDDC 3W2DA 2MJ8A 5HGTA 1EY5A 3OIPA 1F9QA 1NE3A 3J81c 3KJPA 2Z4HA 4CDFC 3PUXA 4LMQD 2EZVA 2B8FA 1N33L 2NVXH 4LK1C 3DUZA 4KJNA 5G3LD 1Y1VB 1GM5A 1C4QA 1F9SA 3I90A 4RCNA 3J81i 3HOUH 3CD6A 3HZXA 1BCPD 2VNUD 1MJEA 1SMYD 3RZOH 4L5QA 2PI2A 1WCMG 2I07B 1BBWA 3L2PA 1B50A 2RF4A 3H15A 4C1NI 4LUOA 3AB9A 1LTBD 4DAYA 1EFWA 1H9MA 5ELDA 2XNAC 1GUSA 4NKLA 4GNXC 4A3JB 5D3DA 5EPKA 3AU7A 1ENAA 4F88A 5C4XH 1F2LA 1D6EC 3NQIA 1ENFA 1HRJA 2L9HA 3W5OA 2PZUA 5C44B 5LHY1 1D8LA 4RGNA 1EWIA 1D5ZC 4ZKCB 4LF9L 2JK8A 2UXCL 2L15A 4C3JH 4BBSG 2E8GA 3M7NA 3R8BA 2LFNA 3T51B 3I56A 1GUNA 4ZAIA 1DOLA 3LGJA 2O4XA 1PTOC 4RA8A 5ELFA 4XIGS 5IYCG 2UUCL 4LFBQ 4AYBE 3QG1A 4RMFA 1C7YA 4FXGC 1KHIA 2PZTA 1U4PA 2M9VA 3R93A 4A3DG 2N88A 4A3GB 2PI2E 4XQQA 2Y0SG 3FP9A 1ZYRD 3KJOA 3TN2A 5C3WA 2KOLA 1HPCA 2YU9B 4AIMA 3V96A 2KQ3A 2JA5B 1E2WA 2YYZA 4R8IA 3MEHA 3TS2A 1CA6A 5ELNA 2JP1A 4DK0A 1YHBA 2IW3A 1QG7A 3G6EA 1B1ZA 1EY8A 1OO9B 3GV3A 3MXNA 4OEMB 4L5RC 3AFQA 5L37A 3HKSA 3J81E 1YJWA 2F0NA 3CCVA 2V1CC 1CM9A 1OXVA 4J6HA 3WDNA 4QL5A 2Z8LA 5EKKA 4LF5L 4PZ6A 4R4OA 3GTPH 1B53A 1QB5D 2B8GA 2WACA 2R6GA 1NR2A 1HJPA 4CKEA 4UPAA 3IRBA 4ILWA 3S1MH 3O13A 1QCBD 3S15H 1E2VA 5J39A 4H7BA 1V9PA 3FVQA 1W6KA 1KRTA 3T16A 2OCEA 4A3BG 3ITPA 2K1BA 4RFBA 2VUMG 1OXXK 3HOZB 4BXXH 2RKSA 4JI7L 1PMRA 1X32A 4DNTB 1S72A 1IBKQ 4LF8Q 4CKCA 5T1GA 1I4QA 1I4PA 5C0XJ 1K0RA 5CV4A 5M3FB 4DR6Q 1TR5A 2EY6A 1I3QB 3I4LA 3FMCA 4LF7Q 4BY1G 1U9RA 3S1NB 1TIID 5C3EH 2DUDA 4K0KQ 4Z9CB 3PQIA 1WYDA 2M00A 4X3UA 4DV3L 4LAAA 4YCUA 3LWUA 2F4VL 3E0JA 4YIJA 5IYDG 4MZ9A 1CQFA 2QA4A 5M5YH 1EYGA 5DM73 2B2YA 3I73A 1Y1WH 2CFMA 4DV7Q 4P72A 4ZKBB 3NTHA 2PNRC 1NCVA 5JOBA 4L8JA 3PO2H 4HJ8A 1SNOA 2MGSA 3PGZA 3CCRA 1XMOQ 2G5DA 4C3IH 1TWFH 4X6AH 3PV0A 1CKNB 2EYMA 3PUWA 4RWSC 2QEJC 1EWHA 2JXMB 3EFXD 4FNFA 4LFCQ 5IT9L 2EOTA 1PH2A 4N8X1 4A3MB 5F2DA 3NE5B 2B39A 1TWAH 4N8FA 4J1MA 1K8GA 2R93B 3BDCA 3BZCA 1V43A 3CAMA 4JPBW 5AJ3Q 3HOYH 1EL0A 1W6JA 3NHHA 3A7LA 3SK5A 1X54A 3S9WA 2K50A 2CKZB 4DV6Q 2XN9C 2GN5A 1KL9A 2MO0A 2HHHQ 1E1TA 3URYA 3I4NB 1IYVA 2PYKA 5FO8B 1FNWA 1GXDC 3D6CA 5M5XB 1VQEA 1EZ8A 2BH2A 1D1IA 1B9NA 3SK4A 4NXMQ 5ELBA 1G291 2CH4W 1VF7A 1LV9A 4C3HG 2QEXA 3ULLA 1SFOH 1K9MC 4LFAL 1P16A 2ZJPA 2PW5A 2I5LX 4AYBB 3HOVH 3P20A 1XNRQ 4P75A 4IFDI 4BS9A 1WCMB 3RZDB 4B3RL 2MPMA 2VXWA 1ET6A 3F2BA 1UNSA 3C3LA 1HNXQ 5JAVA 2K05A 1RJTA 2PQAB 5C5MA 2UUAQ 2YV5A 3RLOA 4B08A 4HJ5A 4UP9A 3K58A 1FJGQ 1SNDA 4R4TA 2K03A 4KHVA 2IHEA 1PH6A 1NTGA 1SNCA 4DAYB 5IT9c 4LF4L 2GA4B 3N52A 1XNQQ 2BOSA 2PQEA 3D4WA 4IFDG 3VYTA 3UE0A 2RA4A 3CC2A 2F0FA 5LMNQ 3EVQA 4BBSB 1BCPB 2VB2X 2AUJD 2ALYB 1GHKA 4LFBL 2Q2HA 1VQ5A 1CSQA 4QUFA 3ER0A 2EVBA 4WRDA 1Q1BA 3H0GG 3E9IA 4UDUC 1GD7A 3A8KE 2KCTA 4U673 5I6YA 2R7ZG 2F0OA 5JVG3 1NNXA 2F03A 5K36G 3M9BA 3NPPA 1JWMD 1VQDA 4A3DB 3MFYA 2Y0SB 4R8NA 4DV1Q 2UU9Q 4BY7G 3BG3A 2OWOA 2B2WC 5CBEE 1K83H 1SYFA 2F3VA 2K28A 5K5PA 3D3RA 1XTDA 2KA7A 3GTQH 2EIFA 4CDCC 1Q3LA 1PV4A 3FPUB 4ABNA 3UE1A 2NVQB 2JSOA 2H5XA 3VR4A 2CWPA 4ZYSA 2EJGC 5JEAG 4A3IG 2TSSA 4DAPA 2FMCA 1XYIA 3MXNB 1FL0A 2VS1A 1IW7D 2HDLA 1XPRA 2HIVA 5E4WC 5FLXL 3EJIA 2AQ1B 2FJ2A 4PMCA 2NVTH 2K5VA 1VQAA 3CRKC 2SNSA 5C6AA 2IPKD 2VL6A 2TMPA 1UEAB 2NBFA 4IALA 3MXGA 3Q8DA 1KAWA 4POGA 2K01A 3S1RH 4OX9Q 1A63A 4Y7NH 4DR1L 4A3BB 2VUMB 1PH4A 3EN2A 1PFSA 4ZQ3A 1I4GA 2XRSD 5IT9E 1BDOA 1IBKL 1CKMA 4LF8L 1H95A 3QO2A 3W1BA 1AP0A 3U9OA 3HGBA 4IUUA 3K8AA 1I6VC 3GTMH 4DR6L 5KRUA 2PPBC 1PH5A 3M3YB 4CJ1B 4TSSA 3FHWA 4LF7L 1TWCB 1IYJB 3GDEA 3C2PA 2XRQD 4KV6A 5LMUL 4K0KL 1UWVA 3AMUA 2MO1A 4DAVA 4EVOA 2KENA 3MZ5A 2ENBA 2E76C 3D6WA 3OMGA 5CV6A 4BY1B 4JK1C 5FLXc 4OO1I 4R4CA 4DV7L 4BWGB 2K7VA 3L9AX 3PCOB 1A6XA 4EX5A 1I4XA 3HOWG 4GN3B 1U4LA 4LWCA 4CHTB 3I4MG 3J80L 4JOIC 1XMOL 2K5DA 4HJ7A 3VR6A 1O7YA 4OWWB 2RHQB 2Q8IB 1G8ZD 4LUZA 2HDMA 2ZXRA 1XMQQ 1DJRD 3M4QA 3JAMi 2L11A 4WFN3 3CKIB 1I6HB 1MHWC 2B63H 1U0LA 2JA7H 5CV9A 2NVYB 4JI5Q 5IP7G 4HSPA 4MNOA 2NUCA 3CHBD 2HHHL 5CR3A 2LXKA 3PIO3 3IAYA 4J8QA 1WTWA 4EGVA 1D1KA 1EIYB 5KYLA 2UXDQ 1G91A 5M5WB 3RR5A 5CMDA 5AFWA 3UI2A 2QDBA 4C2MH 1XWEA 1LYLA 5GAEC 1F2YA 2ZM6Q 2GVAA 1I94Q 2AWNA 4X3TA 4DXGA 1TWGB 1SBBB 5G3LF 2QCPX 2JE6I 4XDXA 1XNRL 1ZKOA 4GOPC 4C3HB 4XTCS 4IZ8A 4DPGA 3OMCA 3J80c 2IT1A 4ULLA 3BYYB 2C5CA 2L4NA 3S16B 1L1OA 5C4JB 2B2VC 2EE1A 1ONLA 2E2JB 4YWLA 1FJGL 2A74C 1STNA 4A3KH 1F9PA 2R61A 4K5WA 1PZID 1AFPA 3M4OB 3DWAA 2UXBQ 1XX8A 1R4PB 4E6IA 5IIFA 3GTKH 1QNKA 4IJLA 2X6GA 1EQRA 5DEHA 5LMNL 5M9OA 4GS3A 2ZXOA 4A3CG 4I7ZC 4MTNA 5FLXE 4IPGA 4OIKA 2RCNA 3CC7A 3R2IA 3S2HH 3GO5A 5GQOA 3OW7A 3TRZA 3M4PA 2YTXA 4DV0Q 3DMUA 4AH6A 1YNND 4JI0Q 3OW2A 3N6RA 3H0GB 1GVPA 4JBJA 2J0TD 3CCMA 4JI8Q 1HQMC 2UU9L 2R7ZB 1W2BA 2XSCA 1G2SA 3HOUG 1JOKA 2MFIA 1Q12A 4DV3Q 1HQRD 4BY7B 4BA1I 4WJ3M 5CV8A 1A3VA 5EKIA 1DGSA 2F3IA 1M8AA 3UDIA 3BYTB 3CRLC 5C4XG 3GTOH 4A3IB 1MI2A 1X65A 2JA8B 4JBMA 5CYUA 1PRTC 3TP6A 2Q8RE 2CVRA 3LX0A 3G48A 3SK8A 2PNHA 2DN8A 4C3JG 2SEBD 1VQFA 1R9TH 1SNQA 3G6JB 3S17B 2JA9A 1B7YB 4OX9L 5E4XA 2A19A 4OL7A 4IPDA 1EFID 1PTOH 5IGGA 3DLLA 5FK9C 1EYAA 2XGTA 3TREA 2F0MA 2KJXA 2I5HA 2XVSA 4B3ML 4QF4A 1F2ZA 4IPCA 2E2HB 2ID0A 1WTXA 3AQQA 2OQKA 1J9OA 4FYDA 4EQNA 4OELB 1IBLQ 2PQAA 2F0GA 3M7GA 2HCIA 4HEDA 4N9TA 1BR9A 3KOJA 2BA1A 4LFAQ 1F77A 2E74C 5KGUA 5C0XH 3VA5A 4B3RQ 4DUZQ 2D0OA 5JVH3 2L1BA 1DD2A 1OXUA 2R92H 3PUVA 1HZCA 3V05A 1QVCA 1SNMA 3CC4A 5A2QE 3PO3H 2V4DA 4EQPA 1YHAA 2X6LA 3IKJA 3K7AH 4LF4Q 3KBXA 4NW2A 1UE1A 3HOWB 5BN5A 3I4MB 1PYWD 4RG1A 3GP7A 4FO2A 4C1NK 1JCKB 4A93H 1EU3A 1DXMA 1EY9A 3MEFA 1XMQL 1IXRA 2A6EC 4ID6A 3MAQA 2AKWB 1RODA 1B3QA 1SE8A 2DNCA 5TSSA 1ESRA 4ZLTF 5ISRA 1KABA 3BVGA 1DZ1A 4JI5L 2R7FA 1AN8A 4DKAC 1LT4D 2P5ZX 5CORA 5IGBA 3CMEA 4S3SA 3K5MA 2N55A 3J7YW 2XWJB 5M5XH 4BXXG 1MKHA 4KKSA 4O0AA 1VDZA 3KF6A 2UXDL 3H3VC 2H4OA 3NENA 2NB0A 3TEHB 1FNVA 1YJ9A 5I9PA 2RDFA 3CQZB 2ZM6L 2UUBQ 1I94L 4X66L 2ICIA 1CI3M 3TMEA 5C4HA 3SR1A 2EY1A 3D4DA 3CF5A 1B4OA 3KFUA 3T56B 1PA6A 1OXTA 1WTRA 5JJLA 1PXUA 4A3LG 4YHHQ 2JA6H 5C3EG 2A6HC 1NBWA 2OEOA 2WFWA 2QF7A 3I91A 2NZOA 3AFPA 2WINB 5JJZA 2OTLA 1BVSA 3SHLA 3G7LA 1LTLA 1ASYA 1E24A 1Y1WG 2J7ZA 3K57A 5EPLA 2Y0SE 3G4SA 2N8NA 3PIP3 3PO2G 2UXBL 4ZUIA 1L1OB 5EAYA 1JOQA 1ZXTA 4C3IG 1VQ4A 3NP8A 3K59A 3E9HA 3MWYW 1EQQA 4F8MA 1CA5A 4U68A 2K5QA 4EQOA 2WKCA 4K2LA 1QNUA 4DR1Q 2CQAA 5IGDA 3S1QB 4DV0L 4DV5Q 3K81C 5CV5A 3WOEA 1Q90A 1AZQA 1N34Q 4JI0L 5CC4A 3HOYG 1YBYA 4JC0A 3SE0A 1GUGA 3PIPA 1O7IA 2NZ1D 4Y52H 4JI8L 4A3LH 1L0XB 4LNQA 5LMUQ 4B9WA 4HMJA 1A3UA 1EWCA 2ICEC 1LT5D 1VCIA 3V2TA 2NVXB 2JEAI 4XQNA 3J7AV 5HGQA 1S5DD 2JEBI 3HOUB 2OXPA 3I8ZA 3NUCA 2A1AA 3HOVG 2A69D 1BCPC 1NJIC 5NUCA 3QIAA 1D2BA 3PUYA 4CKBA 1SMYC 3I7FA 3X3MA 3KUPA 1Q1EA 2DJFC 1NMGA 2B2TA 5I9OA 2BCOA 5FJ8H 1MGSA 3WOFA 1STEA 2B2UA 1D5XC 2QKIC 1KAAA 2SOBA 5C4XB 1LT3D 1HTPA 1GO3E 1HFNA 1FD7D 3NQTA 1L0WA 2Q2IA 3MXUA 2PCFB 4IOCA 1SRUA 2C35B 3LNNA 4C3JB 4G7OC 3UDXA 4L5SA 1DM0B 1A2TA 2Z1CA 4KY7A 4TQUS 4A76A 1HHVA 1A0IA 1SMXA 5IOCA 3PSIA 3MC0B 3TQYA 1B8AA 1IBLL 4WJ4A 1SYBA 3Q23A 2F0QA 3CCQA 5E7NA 2F0EA 5IODA 1STAA 5KNDA 4JI6L 1G6ZA 3VYUA 4DUZL 1U4RA 1VQ9A 2QW7A 2K52A 3GTJH 1NY4A 3S2DH 1C9OA 3H09A 4QMGA 5I4DA 1EIHA 1T9HA 4Q0FA 3CCSA 1KXLA 2E2IH 4GKJL 3Q0AA 4B3TQ 3IFDA 1EQVA 4DV4Q 3ULPA 1HXYD 2NN6H 1DYQA 3F1ZA 3TZDA 2MP1A 1WVLA 3RLNA 1PH3A 4IN3A 2EQSA 4IUPA 3VR5A 2NTSA 1HZBA 2NYZD 3OTOQ 3BJUA 2JN4A 1PRTF 2DGYA 4A3FH 1QZGA 2F0JA 4QUCA 4G7HC 2D0PA 1IBMQ 1L2FA 1QWYA 3QJYA 1SR3A 3DWPA 3GTPB 2NVYH 3W1GA 3VDYA 4JI2Q 3BZDB 3I72A 3GTLH 1D5MC 3M85A 1GUWA 1SSOA 2EPBA 4HSVA 3S1MB 3Q6SA 3S15B 1NUCA 5I6WA 3F8TA 1MIUA 3MHBA 2EJFC 1GKHA 1IHZA 1K8MA 3HOXH 1E0BA 2K4KA 2RBMA 1G51A 2BE5D 2OF1A 2ES2A 2UUBL 2ATWA 1MJCA 1XJVA 1WTHA 1I5FA 4FF4A 4PMWA 3F2UA 1RHPA 3RN2A 2F3WA 3KF6B 1EY7A
chains in the Genus database with same CATH topology
2JE6I 3J7ZC 4BA2I 2NN6I 1LUZA 1XNRL 5IE8A 4GOPC 4YHHL 4JYAL 5M3MG 4A3EH 2RF4A 4XTCS 3H15A 2KHIA 3A5ZB 4LUOA 4AQYQ 4GN5A 4DPGA 1EFWA 3J80c 4B3SQ 2IT1A 4X64Q 4HJ9A 1I50H 4GNXC 4JI3L 4DR2Q 5LMNW 5C4XH 1L1OA 4DR5Q 1TWHH 4DV2Q 1HNWQ 1SLJA 2WB1G 4YWLA 3M4OH 4JI4Q 1VQ6A 1FJGL 3DM3A 2N3SA 3D0FA 2K75A 1QUQB 1HZ9A 4A3KH 4UP8A 4R1JA 1UE6A 3W5OA 1D8LA 1VQ8A 3CMAA 5JJKA 1EWIA 4JBWA 2ZJRA 4LF9L 3HKZG 4BBRH 2JK8A 2UXCL 2L15A 1M90C 2D62A 2NN6G 4C3JH 4BBSG 2E8GA 4DR7Q 3M7NA 2UXBQ 2BH8A 3GTKH 3T1HL 1YVCA 4IJLA 4A3BH 1QVGA 1EQRA 3I56A 4NPSA 5LMNL 2VUMH 4GS3A 1JE5A 4P73A 3L7ZC 4DK6C 1X3EA 5IWAQ 1Q81C 4A3CG 3LGJA 4MTNA 1WI5A 3KDFB 4IPGA 4A3FG 2RCNA 4XIGS 3D31A 3CC7A 3U50C 2CWAA 2KHJA 5IYCG 4DV5L 2UUCL 3S2HH 4LFBQ 4AYBE 3GO5A 4OWXB 5GQOA 2HT1A 2Z6KA 3M3YH 4APVA 3TRZA 3M4PA 2YTXA 4RMFA 4DV0Q 1C7YA 1PYSB 1KHIA 1N34L 2B63G 3CXCA 4B3MQ 1TWCH 4AH6A 2K5NA 4QIWE 2JA7G 4A3DG 2PI2E 4JI0Q 2VY3A 2Y0SG 3FKIH 3FP9A 1YI2A 3OW2A 4UY8C 2JQOA 2KCMA 3KJOA 1GVPA 1PHJA 4YWMA 4QQBX 4AIMA 5M3MH 4BY1H 4JBJA 3CCMA 3HOXG 4NB3A 2YYZA 4JI8Q 4DR3Q 2UU9L 1W2BA 3TS2A 2IY5B 1JJ2A 5ELNA 4JV5L 3HOUG 1YHBA 3G6EA 2VQFQ 2KBNA 4EQ5A 3GTGH 2MFIA 4L5RC 1Q12A 4DV3Q 3AFQA 4BA1I 5IYDH 3HKZE 3HKSA 4WJ3M 3EBEA 1YJWA 4ME3A 1B70B 1DGSA 1SN8A 1VQHA 3CCVA 2V1CC 3STBD 2F3IA 1Q82C 2E5LL 1UE7A 3S24A 1OXVA 4GLVB 4A3EG 2JA8H 4P74A 3UDIA 4QL5A 2WAQG 4HIKA 3JAMc 4DR2L 4LF5L 4PZ6A 3T1YQ 2NZHA 4R4OA 4IJHA 3GTPH 5C4XG 5JJIA 5GAGC 3GTOH 1XPOA 2QGQA 3L0OA 1X65A 2R6GA 2B29A 4JBMA 1HJPA 2ZTEA 1I6HH 1X3GA 4UPAA 3IRBA 4A3KG 2AWOA 4JOIA 4DR4Q 3S1MH 2FXQA 3S15H 3G48A 3GD7A 4KHPQ 1V9PA 3BU2A 4BBRG 2PNHA 1K73C 1J5EL 1YNXA 1KRTA 1YIJA 1VQFA 2OCEA 2MNAA 1R9TH 4A3BG 2LSSA 2VUMG 2JA9A 1B7YB 4OX9L 2IX1A 1Y1VH 1OXXK 2A19A 5M5WH 3RN5A 4R4IA 1HR0Q 4IPDA 4BXXH 3BZKA 4DNIA 3K0XA 4JI7L 4GLAC 3F2DA 4DUYQ 3DLLA 1FVIA 4YY3Q 2E2HH 1S72A 2XGTA 3TREA 2I5HA 4YCVA 1TWGH 3NBHB 1IBKQ 4LF8Q 4KI0A 3PUZA 2RHSB 3L2PA 4B3ML 4IPCA 2ID0A 1KQSA 3PF4A 3AQQA 2OQKA 4HIOA 5C0XJ 4H02A 4C3HH 1YEZA 2JJQA 3K7UC 1K0RA 4X66Q 1N32Q 3FKIG 2PQAA 1Q8KA 1IBLQ 1PYBA 4DAMA 4DR6Q 1HNZQ 1S40A 3KOJA 2BA1A 4A3JH 2WAQE 4LFAQ 1VQOA 3S16H 2K14A 5C4JH 4LF7Q 4BY1G 3K80C 2IX0A 5IY0A 2E2JH 5FLMH 1E3PA 2OQ0A 1HH2P 3JC66 1PH9A 5C3EH 2DUDA 4DUZQ 2D0OA 4B3RQ 4K0KQ 2OTJA 4JBKA 1N36Q 1WYDA 5GAHC 1J6QA 1OXUA 5C44H 3E0EA 2R92H 3PUVA 4DV3L 4YCUA 2F4VL 1HZCA 2Q2UA 4GOPA 5IYDG 4MZ9A 1VQNA 4IFDJ 4HJAA 2ZTCA 4B3TL 1QVCA 2QA4A 5M5YH 3CC4A 1N9WA 1Y1WH 2CFMA 4DV7Q 4P72A 4DV4L 1VQMA 3PO3H 1BBUA 3NELA 2AMCB 1EOVA 4GNXA 1YHAA 3PO2H 5ELOA 4HIMA 4HJ8A 3K7AH 2JA8G 1BKBA 3PGZA 1UEBA 1QVFA 3J81j 3CCRA 1XMOQ 4LF4Q 4C3IH 1TWFH 4X6AH 3PV0A 1CKNB 3OTOL 4LW1A 2EXDA 4PZ8A 1UE1A 2BA0A 3F2CA 2N78A 4O2DA 3PUWA 4RG1A 2CQOA 1IBML 4A93H 1XMQL 3MEFA 1IXRA 2AKWB 4LFCQ 1K8AC 4A3GH 1PH2A 4JI2L 1SE8A 3CCJA 3ZJYC 1KC8C 2CCZA 3H0GH 1TWAH 4X62Q 1K8GA 4NXNQ 3G71A 4JI5L 2YU9H 1CSPA 2R7FA 4DKAC 2JA5H 3BZCA 1PH8A 1V43A 3CAMA 5AJ3Q 1VS0A 2R7ZH 4JI1Q 3HOYH 3CMEA 1Y1VG 3A0JA 5M5XH 1WFQA 1X54A 2K50A 5BR8Q 1MKHA 4BXXG 2CKZB 4DV6Q 1E7ZA 2GN5A 4X65Q 4O0AA 1KL9A 2MO0A 1WJJA 5GROA 1E1TA 5C0XI 1YITA 3KF6A 2PMZE 2HHHQ 2Q2TA 2UXDL 4BY7H 2WB1E 1VQLA 1N33Q 3NENA 3HFZB 3TEHB 1VQEA 2I5MX 1YJ9A 1JJGA 2BH2A 4TVAB 1TXYA 4NXMQ 2ZM6L 2UUBQ 1I94L 1E1OA 1G291 3EIVA 4X66L 3U4ZA 1N32L 3CCLA 1IL2A 3CF5A 2QEXA 1PVOA 1AE3A 2ASBA 3KFUA 4J15A 3ULLA 1SFOH 1K9MC 4LFAL 2VQEQ 1PA6A 1OXTA 1P16A 4A3JG 1Q46A 2ZJPA 4LF6Q 1VQJA 2I5LX 5JJLA 1QUQA 2ZJQA 3HOVH 4A3LG 4A3IH 1XNRQ 4AQYL 4P75A 4YHHQ 4B3SL 5FLMG 4X64L 4IFDI 4JYAQ 1VQIA 4B3RL 2WP8J 4QJFA 5C0XG 2JA6H 5C3EG 1JT8A 3F2BA 4DR5L 1X9NA 1NBWA 1HNXQ 3TS0A 4DV2L 1HNWL 5C44G 3KLWA 2WFWA 2HQLA 2PQAB 2GVBA 4JI3Q 2NZOA 4JI4L 3AFPA 2UUAQ 2R92G 2OTLA 1A62A 1BVSA 2YV5A 3RLOA 4HJ5A 4UP9A 1VQKA 1FJGQ 4R4TA 1LTLA 1SROA 1E24A 1Y1WG 1ASYA 2IHEA 1PH6A 1NTGA 3KDFA 4P71A 4DAYB 5IT9c 3PO3G 3S17H 3ERSX 1V1QA 2Y0SE 3G4SA 2N8NA 3PO2G 3B6YA 4LUVA 4DR7L 4LF4L 4A75A 4LF9Q 3HOZH 2UXBL 2UXCQ 1L1OB 4FDBA 5EAYA 1XNQQ 1VQ4A 3CPFA 4UP7A 4IFDG 5IWAL 4GLXA 3T1HQ 3UE0A 3E9HA 5HY6A 1YHQA 3CC2A 5LMNQ 1EQQA 1Y14B 1S3OA 1CKOA 4A93G 2B3GA 2ALYB 4LFCL 1ASZA 3I55A 1G6PA 4LFBL 2Q2HA 1AE2A 4PG3A 4DR1Q 3I4OA 1PH7A 4A3GG 1VQ5A 1KRSA 1CSQA 3CCEA 4OO1G 4KLKA 4DV0L 4DV5Q 2UUCQ 3K81C 3ER0A 5M3FH 4X62L 1Q1BA 1EUJA 3H0GG 1I3QH 4JG2A 3E9IA 1GD7A 1Z9FA 5AJ3L 2VW9A 1N34Q 2JA5G 4JI1L 4JI0L 3S1NH 2KCTA 1AH9A 3I4NG 4R4QA 3HOYG 2R7ZG 1KIXA 1YBYA 1JMCA 1LM0A 4JC0A 3RLFA 1JJCB 3M9BA 3PIPA 4DV6L 3I2ZA 1XPUA 1O7IA 5K36G 4Y52H 1VQDA 4JI8L 4A3LH 4DR3L 1RIPA 1CUKA 4LNQA 4L5TA 4JI6Q 1VQCA 3H3VH 5IYBH 4DV1Q 2UU9Q 4BY7G 2AHOB 5LMUQ 4GKKQ 2OWOA 1K83H 4NXML 2VQFL 4JV5Q 1YJNA 1FGUA 1VCIA 4AYBG 2JEAI 1XTDA 1OTCA 1EIFA 5H1SE 1VQPA 3GTQH 5HGQA 2EIFA 1VQGA 1L1OC 1JB7A 2JEBI 1PV4A 1P8LA 1X3FA 3UE1A 3UDGA 4GKJQ 1Q7YC 2H5XA 2CWPA 2A1AA 1PH1A 5JEAG 3HOWH 4A3IG 3HOVG 3I4MH 2E5LQ 2Z0SA 3NEMA 1NJIC 3A5UA 2JA6G 2LXJA 3MXNB 3T1YL 1FL0A 2VS1A 3PUYA 1HNXL 3AEVA 1X56A 3I7FA 1XPRA 4LF5Q 2UUAL 2HIVA 4A3MH 1Q1EA 1HR0W 1NMGA 3PIOA 5FJ8H 5IP9H 2R93H 4DR4L 3J80i 1VQ7A 2XTIA 4YWKA 4KHZA 3CW2C 2YTYA 3OYYA 2NVTH 2K5VA 4KHPL 3U58A 1VQAA 1GO3E 1K3RA 2K5HA 1X55A 2VL6A 2ZTDA 3CP0A 1XNQL 3HOZG 1J5EQ 1L0WA 2Q2IA 3I4NH 2Z6KC 5IP7H 1IZ6A 1X6OA 3Q8DA 1UE5A 1KAWA 1NMFA 4POGA 4IOCA 1SRUA 2C35B 1HR0L 3S1RH 4OX9Q 1N8RC 1A63A 4DK3C 3SGIA 3UDXA 1D7QA 4OONA 4Y7NH 4DUYL 4L5SA 3CQZH 4YY3L 4DR1L 3H3VI 1PH4A 3EN2A 1PFSA 4JI7Q 1IBKL 1CKMA 4LF8L 1H95A 4TQUS 3W1BA 4A76A 5M3FG 1A0IA 1SMXA 5JEAJ 3A74A 3PSIA 3K8AA 4IPHA 3TQYA 1B8AA 2R7DA 1IBLL 4WJ4A 3GTMH 3KYHC 3PF5A 1HNZL 4DR6L 1WCMH 3RZDH 1PH5A 3CCQA 5E7NA 4HIDA 3FHWA 5GADC 3RNUA 4LF7L 3U4VA 1IYJB 3GDEA 4JI6L 3UDFA 4GKKL 4DV1L 5LMUL 4DUZL 4K0KL 1UWVA 2MO1A 5IYBG 1VQ9A 4YCWA 1N36L 3S14H 2K52A 2YTVA 2KENA 3GTJH 1NY4A 3WWVA 3S2DH 1C9OA 1C0AA 4OXPA 2MQHA 1CKNA 2F52A 5FLXc 2F4VQ 4OO1I 1T9HA 2VZAA 3KF6B 4R4CA 3CCSA 1KXLA 4DV7L 1YZ6A 2E2IH 4ALPA 4GKJL 4B3TQ 5DLQE 3PCOB 4PZ7A 1OXSC 4EX5A 4POFA 3J7A5 3HOWG 4GN3B 4LWCA 4DV4Q 3ULPA 2I0QA 4GN4B 3I4MG 4JOIC 1A8VA 1XMOL 3F1ZA 5J3BA 4BBSH 1E22A 1M1KC 4HJ7A 1QZHA 3RLNA 1PH3A 2EQSA 3ULJA 1HZBA 4GOPB 3S1QH 4A3CH 4OWWB 3OTOQ 1Z47A 2RHQB 4A3MG 3BJUA 2DGYA 5FJ8G 3STBC 4LUZA 5IP9G 1WOCA 4A3FH 1QZGA 1IBMQ 2R93G 2D0PA 1XMQQ 1L2FA 4GNXB 3M4QA 1SR3A 5IYCH 3JAMi 3KF8B 3AYHB 2NVYH 3W1GA 3VDYA 1U5KA 4JI2Q 4NXNL 4A4IA 3GTLH 1HZAA 3M85A 2B63H 3CCUA 1U0LA 2JA7H 3ICEA 4JI5Q 4A3DH 4IOAA 4JCVE 5IP7G 1RL2A 3CPWA 1NE3A 1MIUA 3F8TA 2A8VA 5BR8L 3J81c 3KJPA 4MNOA 4X65L 1KD1C 2HIXA 1GKHA 2HHHL 3PUXA 1Q86C 1W3SA 2LXKA 3HOXH 1N33L 2NVXH 4QGUA 2K4KA 4OWTB 2IHFA 1G51A 1EIYB 2UXDQ 1GM5A 3RR5A 4QY7A 3J81i 3HOUH 2ES2A 2UUBL 3CD6A 4C2MH 2ATWA 2NVQH 1MJCA 1LYLA 5GAEC 1XJVA 1MJEA 2VNUD 4IO9A 2ZM6Q 2GVAA 1I94Q 1I5FA 2AWNA 3RZOH 4L5QA 4PMWA 2PI2A 1WCMG 2VQEL 3RN2A 4LF6L 1BBWA 2N49A 1EYGA 1VQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  3J7Z C;  4BA2 I;  2NN6 I;  1LUZ A;  1XNR L;  5IE8 A;  4GOP C;  4YHH L;  4JYA L;  5M3M G;  4A3E H;  2RF4 A;  4XTC S;  3H15 A;  2KHI A;  3A5Z B;  4LUO A;  4AQY Q;  4GN5 A;  4DPG A;  1EFW A;  3J80 c;  4B3S Q;  2IT1 A;  4X64 Q;  4HJ9 A;  1I50 H;  4GNX C;  4JI3 L;  4DR2 Q;  5LMN W;  5C4X H;  1L1O A;  4DR5 Q;  1TWH H;  4DV2 Q;  1HNW Q;  1SLJ A;  2WB1 G;  4YWL A;  3M4O H;  4JI4 Q;  1VQ6 A;  1FJG L;  3DM3 A;  2N3S A;  3D0F A;  2K75 A;  1QUQ B;  1HZ9 A;  4A3K H;  4UP8 A;  4R1J A;  1UE6 A;  3W5O A;  1D8L A;  1VQ8 A;  3CMA A;  5JJK A;  1EWI A;  4JBW A;  2ZJR A;  4LF9 L;  3HKZ G;  4BBR H;  2JK8 A;  2UXC L;  2L15 A;  1M90 C;  2D62 A;  2NN6 G;  4C3J H;  4BBS G;  2E8G A;  4DR7 Q;  3M7N A;  2UXB Q;  2BH8 A;  3GTK H;  3T1H L;  1YVC A;  4IJL A;  4A3B H;  1QVG A;  1EQR A;  3I56 A;  4NPS A;  5LMN L;  2VUM H;  4GS3 A;  1JE5 A;  4P73 A;  3L7Z C;  4DK6 C;  1X3E A;  5IWA Q;  1Q81 C;  4A3C G;  3LGJ A;  4MTN A;  1WI5 A;  3KDF B;  4IPG A;  4A3F G;  2RCN A;  4XIG S;  3D31 A;  3CC7 A;  3U50 C;  2CWA A;  2KHJ A;  5IYC G;  4DV5 L;  2UUC L;  3S2H H;  4LFB Q;  4AYB E;  3GO5 A;  4OWX B;  5GQO A;  2HT1 A;  2Z6K A;  3M3Y H;  4APV A;  3TRZ A;  3M4P A;  2YTX A;  4RMF A;  4DV0 Q;  1C7Y A;  1PYS B;  1KHI A;  1N34 L;  2B63 G;  3CXC A;  4B3M Q;  1TWC H;  4AH6 A;  2K5N A;  4QIW E;  2JA7 G;  4A3D G;  2PI2 E;  4JI0 Q;  2VY3 A;  2Y0S G;  3FKI H;  3FP9 A;  1YI2 A;  3OW2 A;  4UY8 C;  2JQO A;  2KCM A;  3KJO A;  1GVP A;  1PHJ A;  4YWM A;  4QQB X;  4AIM A;  5M3M H;  4BY1 H;  4JBJ A;  3CCM A;  3HOX G;  4NB3 A;  2YYZ A;  4JI8 Q;  4DR3 Q;  2UU9 L;  1W2B A;  3TS2 A;  2IY5 B;  1JJ2 A;  5ELN A;  4JV5 L;  3HOU G;  1YHB A;  3G6E A;  2VQF Q;  2KBN A;  4EQ5 A;  3GTG H;  2MFI A;  4L5R C;  1Q12 A;  4DV3 Q;  3AFQ A;  4BA1 I;  5IYD H;  3HKZ E;  3HKS A;  4WJ3 M;  3EBE A;  1YJW A;  4ME3 A;  1B70 B;  1DGS A;  1SN8 A;  1VQH A;  3CCV A;  2V1C C;  3STB D;  2F3I A;  1Q82 C;  2E5L L;  1UE7 A;  3S24 A;  1OXV A;  4GLV B;  4A3E G;  2JA8 H;  4P74 A;  3UDI A;  4QL5 A;  2WAQ G;  4HIK A;  3JAM c;  4DR2 L;  4LF5 L;  4PZ6 A;  3T1Y Q;  2NZH A;  4R4O A;  4IJH A;  3GTP H;  5C4X G;  5JJI A;  5GAG C;  3GTO H;  1XPO A;  2QGQ A;  3L0O A;  1X65 A;  2R6G A;  2B29 A;  4JBM A;  1HJP A;  2ZTE A;  1I6H H;  1X3G A;  4UPA A;  3IRB A;  4A3K G;  2AWO A;  4JOI A;  4DR4 Q;  3S1M H;  2FXQ A;  3S15 H;  3G48 A;  3GD7 A;  4KHP Q;  1V9P A;  3BU2 A;  4BBR G;  2PNH A;  1K73 C;  1J5E L;  1YNX A;  1KRT A;  1YIJ A;  1VQF A;  2OCE A;  2MNA A;  1R9T H;  4A3B G;  2LSS A;  2VUM G;  2JA9 A;  1B7Y B;  4OX9 L;  2IX1 A;  1Y1V H;  1OXX K;  2A19 A;  5M5W H;  3RN5 A;  4R4I A;  1HR0 Q;  4IPD A;  4BXX H;  3BZK A;  4DNI A;  3K0X A;  4JI7 L;  4GLA C;  3F2D A;  4DUY Q;  3DLL A;  1FVI A;  4YY3 Q;  2E2H H;  1S72 A;  2XGT A;  3TRE A;  2I5H A;  4YCV A;  1TWG H;  3NBH B;  1IBK Q;  4LF8 Q;  4KI0 A;  3PUZ A;  2RHS B;  3L2P A;  4B3M L;  4IPC A;  2ID0 A;  1KQS A;  3PF4 A;  3AQQ A;  2OQK A;  4HIO A;  5C0X J;  4H02 A;  4C3H H;  1YEZ A;  2JJQ A;  3K7U C;  1K0R A;  4X66 Q;  1N32 Q;  3FKI G;  2PQA A;  1Q8K A;  1IBL Q;  1PYB A;  4DAM A;  4DR6 Q;  1HNZ Q;  1S40 A;  3KOJ A;  2BA1 A;  4A3J H;  2WAQ E;  4LFA Q;  1VQO A;  3S16 H;  2K14 A;  5C4J H;  4LF7 Q;  4BY1 G;  3K80 C;  2IX0 A;  5IY0 A;  2E2J H;  5FLM H;  1E3P A;  2OQ0 A;  1HH2 P;  3JC6 6;  1PH9 A;  5C3E H;  2DUD A;  4DUZ Q;  2D0O A;  4B3R Q;  4K0K Q;  2OTJ A;  4JBK A;  1N36 Q;  1WYD A;  5GAH C;  1J6Q A;  1OXU A;  5C44 H;  3E0E A;  2R92 H;  3PUV A;  4DV3 L;  4YCU A;  2F4V L;  1HZC A;  2Q2U A;  4GOP A;  5IYD G;  4MZ9 A;  1VQN A;  4IFD J;  4HJA A;  2ZTC A;  4B3T L;  1QVC A;  2QA4 A;  5M5Y H;  3CC4 A;  1N9W A;  1Y1W H;  2CFM A;  4DV7 Q;  4P72 A;  4DV4 L;  1VQM A;  3PO3 H;  1BBU A;  3NEL A;  2AMC B;  1EOV A;  4GNX A;  1YHA A;  3PO2 H;  5ELO A;  4HIM A;  4HJ8 A;  3K7A H;  2JA8 G;  1BKB A;  3PGZ A;  1UEB A;  1QVF A;  3J81 j;  3CCR A;  1XMO Q;  4LF4 Q;  4C3I H;  1TWF H;  4X6A H;  3PV0 A;  1CKN B;  3OTO L;  4LW1 A;  2EXD A;  4PZ8 A;  1UE1 A;  2BA0 A;  3F2C A;  2N78 A;  4O2D A;  3PUW A;  4RG1 A;  2CQO A;  1IBM L;  4A93 H;  1XMQ L;  3MEF A;  1IXR A;  2AKW B;  4LFC Q;  1K8A C;  4A3G H;  1PH2 A;  4JI2 L;  1SE8 A;  3CCJ A;  3ZJY C;  1KC8 C;  2CCZ A;  3H0G H;  1TWA H;  4X62 Q;  1K8G A;  4NXN Q;  3G71 A;  4JI5 L;  2YU9 H;  1CSP A;  2R7F A;  4DKA C;  2JA5 H;  3BZC A;  1PH8 A;  1V43 A;  3CAM A;  5AJ3 Q;  1VS0 A;  2R7Z H;  4JI1 Q;  3HOY H;  3CME A;  1Y1V G;  3A0J A;  5M5X H;  1WFQ A;  1X54 A;  2K50 A;  5BR8 Q;  1MKH A;  4BXX G;  2CKZ B;  4DV6 Q;  1E7Z A;  2GN5 A;  4X65 Q;  4O0A A;  1KL9 A;  2MO0 A;  1WJJ A;  5GRO A;  1E1T A;  5C0X I;  1YIT A;  3KF6 A;  2PMZ E;  2HHH Q;  2Q2T A;  2UXD L;  4BY7 H;  2WB1 E;  1VQL A;  1N33 Q;  3NEN A;  3HFZ B;  3TEH B;  1VQE A;  2I5M X;  1YJ9 A;  1JJG A;  2BH2 A;  4TVA B;  1TXY A;  4NXM Q;  2ZM6 L;  2UUB Q;  1I94 L;  1E1O A;  1G29 1;  3EIV A;  4X66 L;  3U4Z A;  1N32 L;  3CCL A;  1IL2 A;  3CF5 A;  2QEX A;  1PVO A;  1AE3 A;  2ASB A;  3KFU A;  4J15 A;  3ULL A;  1SFO H;  1K9M C;  4LFA L;  2VQE Q;  1PA6 A;  1OXT A;  1P16 A;  4A3J G;  1Q46 A;  2ZJP A;  4LF6 Q;  1VQJ A;  2I5L X;  5JJL A;  1QUQ A;  2ZJQ A;  3HOV H;  4A3L G;  4A3I H;  1XNR Q;  4AQY L;  4P75 A;  4YHH Q;  4B3S L;  5FLM G;  4X64 L;  4IFD I;  4JYA Q;  1VQI A;  4B3R L;  2WP8 J;  4QJF A;  5C0X G;  2JA6 H;  5C3E G;  1JT8 A;  3F2B A;  4DR5 L;  1X9N A;  1NBW A;  1HNX Q;  3TS0 A;  4DV2 L;  1HNW L;  5C44 G;  3KLW A;  2WFW A;  2HQL A;  2PQA B;  2GVB A;  4JI3 Q;  2NZO A;  4JI4 L;  3AFP A;  2UUA Q;  2R92 G;  2OTL A;  1A62 A;  1BVS A;  2YV5 A;  3RLO A;  4HJ5 A;  4UP9 A;  1VQK A;  1FJG Q;  4R4T A;  1LTL A;  1SRO A;  1E24 A;  1Y1W G;  1ASY A;  2IHE A;  1PH6 A;  1NTG A;  3KDF A;  4P71 A;  4DAY B;  5IT9 c;  3PO3 G;  3S17 H;  3ERS X;  1V1Q A;  2Y0S E;  3G4S A;  2N8N A;  3PO2 G;  3B6Y A;  4LUV A;  4DR7 L;  4LF4 L;  4A75 A;  4LF9 Q;  3HOZ H;  2UXB L;  2UXC Q;  1L1O B;  4FDB A;  5EAY A;  1XNQ Q;  1VQ4 A;  3CPF A;  4UP7 A;  4IFD G;  5IWA L;  4GLX A;  3T1H Q;  3UE0 A;  3E9H A;  5HY6 A;  1YHQ A;  3CC2 A;  5LMN Q;  1EQQ A;  1Y14 B;  1S3O A;  1CKO A;  4A93 G;  2B3G A;  2ALY B;  4LFC L;  1ASZ A;  3I55 A;  1G6P A;  4LFB L;  2Q2H A;  1AE2 A;  4PG3 A;  4DR1 Q;  3I4O A;  1PH7 A;  4A3G G;  1VQ5 A;  1KRS A;  1CSQ A;  3CCE A;  4OO1 G;  4KLK A;  4DV0 L;  4DV5 Q;  2UUC Q;  3K81 C;  3ER0 A;  5M3F H;  4X62 L;  1Q1B A;  1EUJ A;  3H0G G;  1I3Q H;  4JG2 A;  3E9I A;  1GD7 A;  1Z9F A;  5AJ3 L;  2VW9 A;  1N34 Q;  2JA5 G;  4JI1 L;  4JI0 L;  3S1N H;  2KCT A;  1AH9 A;  3I4N G;  4R4Q A;  3HOY G;  2R7Z G;  1KIX A;  1YBY A;  1JMC A;  1LM0 A;  4JC0 A;  3RLF A;  1JJC B;  3M9B A;  3PIP A;  4DV6 L;  3I2Z A;  1XPU A;  1O7I A;  5K36 G;  4Y52 H;  1VQD A;  4JI8 L;  4A3L H;  4DR3 L;  1RIP A;  1CUK A;  4LNQ A;  4L5T A;  4JI6 Q;  1VQC A;  3H3V H;  5IYB H;  4DV1 Q;  2UU9 Q;  4BY7 G;  2AHO B;  5LMU Q;  4GKK Q;  2OWO A;  1K83 H;  4NXM L;  2VQF L;  4JV5 Q;  1YJN A;  1FGU A;  1VCI A;  4AYB G;  2JEA I;  1XTD A;  1OTC A;  1EIF A;  5H1S E;  1VQP A;  3GTQ H;  5HGQ A;  2EIF A;  1VQG A;  1L1O C;  1JB7 A;  2JEB I;  1PV4 A;  1P8L A;  1X3F A;  3UE1 A;  3UDG A;  4GKJ Q;  1Q7Y C;  2H5X A;  2CWP A;  2A1A A;  1PH1 A;  5JEA G;  3HOW H;  4A3I G;  3HOV G;  3I4M H;  2E5L Q;  2Z0S A;  3NEM A;  1NJI C;  3A5U A;  2JA6 G;  2LXJ A;  3MXN B;  3T1Y L;  1FL0 A;  2VS1 A;  3PUY A;  1HNX L;  3AEV A;  1X56 A;  3I7F A;  1XPR A;  4LF5 Q;  2UUA L;  2HIV A;  4A3M H;  1Q1E A;  1HR0 W;  1NMG A;  3PIO A;  5FJ8 H;  5IP9 H;  2R93 H;  4DR4 L;  3J80 i;  1VQ7 A;  2XTI A;  4YWK A;  4KHZ A;  3CW2 C;  2YTY A;  3OYY A;  2NVT H;  2K5V A;  4KHP L;  3U58 A;  1VQA A;  1GO3 E;  1K3R A;  2K5H A;  1X55 A;  2VL6 A;  2ZTD A;  3CP0 A;  1XNQ L;  3HOZ G;  1J5E Q;  1L0W A;  2Q2I A;  3I4N H;  2Z6K C;  5IP7 H;  1IZ6 A;  1X6O A;  3Q8D A;  1UE5 A;  1KAW A;  1NMF A;  4POG A;  4IOC A;  1SRU A;  2C35 B;  1HR0 L;  3S1R H;  4OX9 Q;  1N8R C;  1A63 A;  4DK3 C;  3SGI A;  3UDX A;  1D7Q A;  4OON A;  4Y7N H;  4DUY L;  4L5S A;  3CQZ H;  4YY3 L;  4DR1 L;  3H3V I;  1PH4 A;  3EN2 A;  1PFS A;  4JI7 Q;  1IBK L;  1CKM A;  4LF8 L;  1H95 A;  4TQU S;  3W1B A;  4A76 A;  5M3F G;  1A0I A;  1SMX A;  5JEA J;  3A74 A;  3PSI A;  3K8A A;  4IPH A;  3TQY A;  1B8A A;  2R7D A;  1IBL L;  4WJ4 A;  3GTM H;  3KYH C;  3PF5 A;  1HNZ L;  4DR6 L;  1WCM H;  3RZD H;  1PH5 A;  3CCQ A;  5E7N A;  4HID A;  3FHW A;  5GAD C;  3RNU A;  4LF7 L;  3U4V A;  1IYJ B;  3GDE A;  4JI6 L;  3UDF A;  4GKK L;  4DV1 L;  5LMU L;  4DUZ L;  4K0K L;  1UWV A;  2MO1 A;  5IYB G;  1VQ9 A;  4YCW A;  1N36 L;  3S14 H;  2K52 A;  2YTV A;  2KEN A;  3GTJ H;  1NY4 A;  3WWV A;  3S2D H;  1C9O A;  1C0A A;  4OXP A;  2MQH A;  1CKN A;  2F52 A;  5FLX c;  2F4V Q;  4OO1 I;  1T9H A;  2VZA A;  3KF6 B;  4R4C A;  3CCS A;  1KXL A;  4DV7 L;  1YZ6 A;  2E2I H;  4ALP A;  4GKJ L;  4B3T Q;  5DLQ E;  3PCO B;  4PZ7 A;  1OXS C;  4EX5 A;  4POF A;  3J7A 5;  3HOW G;  4GN3 B;  4LWC A;  4DV4 Q;  3ULP A;  2I0Q A;  4GN4 B;  3I4M G;  4JOI C;  1A8V A;  1XMO L;  3F1Z A;  5J3B A;  4BBS H;  1E22 A;  1M1K C;  4HJ7 A;  1QZH A;  3RLN A;  1PH3 A;  2EQS A;  3ULJ A;  1HZB A;  4GOP B;  3S1Q H;  4A3C H;  4OWW B;  3OTO Q;  1Z47 A;  2RHQ B;  4A3M G;  3BJU A;  2DGY A;  5FJ8 G;  3STB C;  4LUZ A;  5IP9 G;  1WOC A;  4A3F H;  1QZG A;  1IBM Q;  2R93 G;  2D0P A;  1XMQ Q;  1L2F A;  4GNX B;  3M4Q A;  1SR3 A;  5IYC H;  3JAM i;  3KF8 B;  3AYH B;  2NVY H;  3W1G A;  3VDY A;  1U5K A;  4JI2 Q;  4NXN L;  4A4I A;  3GTL H;  1HZA A;  3M85 A;  2B63 H;  3CCU A;  1U0L A;  2JA7 H;  3ICE A;  4JI5 Q;  4A3D H;  4IOA A;  4JCV E;  5IP7 G;  1RL2 A;  3CPW A;  1NE3 A;  1MIU A;  3F8T A;  2A8V A;  5BR8 L;  3J81 c;  3KJP A;  4MNO A;  4X65 L;  1KD1 C;  2HIX A;  1GKH A;  2HHH L;  3PUX A;  1Q86 C;  1W3S A;  2LXK A;  3HOX H;  1N33 L;  2NVX H;  4QGU A;  2K4K A;  4OWT B;  2IHF A;  1G51 A;  1EIY B;  2UXD Q;  1GM5 A;  3RR5 A;  4QY7 A;  3J81 i;  3HOU H;  2ES2 A;  2UUB L;  3CD6 A;  4C2M H;  2ATW A;  2NVQ H;  1MJC A;  1LYL A;  5GAE C;  1XJV A;  1MJE A;  2VNU D;  4IO9 A;  2ZM6 Q;  2GVA A;  1I94 Q;  1I5F A;  2AWN A;  3RZO H;  4L5Q A;  4PMW A;  2PI2 A;  1WCM G;  2VQE L;  3RN2 A;  4LF6 L;  1BBW A;  2N49 A;  1EYG A;  1VQB A; 
#chains in the Genus database with same CATH topology
 3J7Z C;  4BA2 I;  1RDP D;  5IE8 A;  4YHH L;  1IYU A;  5M3M G;  4A3E H;  4MTK A;  4FF2 A;  3A5Z B;  2B2Y C;  2XIW A;  4IUV A;  1O80 A;  3DWQ A;  1I50 H;  2I46 A;  5LMN W;  4DR5 Q;  3QOL A;  5DNF A;  1TWH H;  1HNW Q;  3TP5 A;  1SLJ A;  2WB1 G;  3M4O H;  1VQ6 A;  1FGB D;  5C3E B;  2K75 A;  4R1J A;  5BN3 A;  1EIG A;  1VQ8 A;  3CMA A;  5JJK A;  1K8O A;  5E3F A;  4BBR H;  1TVX A;  1M90 C;  2D62 A;  3JAM L;  1MBY A;  5M5Y B;  2BH8 A;  1Y1W B;  2F0K A;  4NPS A;  1VF5 C;  1JE5 A;  4MIU A;  4P73 A;  1Q81 C;  2WV6 D;  3A7A B;  3PO2 B;  4XYQ A;  2O2L D;  1PTO F;  1EZ6 A;  1LTT D;  1TWF B;  3D31 A;  3U50 C;  2CWA A;  2KHJ A;  4DV5 L;  2Z6K A;  1PYS B;  4IUQ A;  4I65 A;  1N34 L;  2B63 G;  5D14 A;  4B3M Q;  5D3I B;  2K5N A;  4QIW E;  2JA7 G;  4RGO S;  5T1I A;  2VY3 A;  3FKI H;  1YI2 A;  1NSN S;  2JQO A;  3FRP B;  4CDE C;  1BQQ T;  1TWA B;  2EYH A;  1Z6H A;  4YWM A;  4QQB X;  1T5E A;  1IKM A;  4OHJ A;  5M3M H;  4NB3 A;  3HOY B;  3SXH A;  1JJ2 A;  4FXK C;  1MD2 D;  4Q5V A;  2A68 D;  2KBN A;  4EQ5 A;  3GTG H;  3K5N A;  1STG A;  3EBE A;  1L0Y B;  4ME3 A;  1B70 B;  2EYO A;  4I7A A;  1PRT D;  3C1F A;  3STB D;  2JA8 H;  4P74 A;  1HCZ A;  4DR2 L;  4RCO A;  3T13 A;  3JAM c;  1SFO B;  3RMH A;  5JJI A;  3HOV B;  1XPO A;  2F4I A;  2QGQ A;  4MN3 A;  2RQX A;  3BDL A;  2IWH A;  2D2C C;  1WTQ A;  1X3G A;  3NSW A;  1ZEQ X;  1IL8 A;  4A3K G;  2K04 A;  4DR4 Q;  3C46 A;  1SAP A;  5KIX A;  3KK7 A;  3GD7 A;  3KLR A;  4KHP Q;  3BU2 A;  4RKB A;  2FFK B;  4C56 C;  2LSS A;  1EYD A;  5J22 A;  3R2T A;  2IX1 A;  1Y1V H;  2F0H A;  3RN5 A;  1HR0 Q;  3T53 B;  2KVM A;  1KDB A;  4DUY Q;  2E2H H;  1GJX A;  1FVI A;  3OPO A;  2R3Z A;  1STY A;  2E2D C;  5IGE A;  3NBH B;  4K8I A;  4HIO A;  4X66 Q;  3K7U C;  4K6D A;  3C1E A;  1Q8K A;  4RKL A;  4DAM A;  2AQ3 B;  1HNZ Q;  5A2Q L;  3SDZ A;  4A3J H;  4KKT A;  3E6Z X;  1GUO A;  2IX0 A;  5IY0 A;  4N9P A;  5FLM H;  2OQ0 A;  1HH2 P;  3JC6 6;  1PH9 A;  2OTJ A;  5GAH C;  1G2T A;  1XXG A;  5C44 H;  3E0E A;  1S5B D;  2LKV A;  4IFD J;  4B3T L;  4K14 A;  1K83 B;  4ZK9 B;  4ODG A;  3OSO A;  4DV4 L;  3SK6 A;  1BBU A;  1PTO D;  2A6E D;  2AMC B;  4GNX A;  3OHX C;  4HIM A;  1BKB A;  1QVF A;  3OWF A;  3GTQ B;  3J81 j;  2K6A A;  3L3O C;  3OTO L;  4G7Z C;  4LW1 A;  2EXD A;  2BA0 A;  2F0T A;  1B9M A;  1KLG D;  2F0D A;  5KYI A;  1MSH A;  1LAC A;  3A8J E;  1IBM L;  4IUT A;  5I2X A;  1WTV A;  4KK7 A;  3Q24 A;  1EU4 A;  2G9H D;  4KJO A;  4A3G H;  4XXE A;  4JI2 L;  3CCJ A;  1IW7 C;  4K8J A;  2CCZ A;  4NXN Q;  4HCS A;  2YU9 H;  3JAM E;  1CSP A;  1PFN A;  2JA5 H;  4P2C B;  2NVT B;  3A54 A;  1VMP A;  1YNJ C;  4PV1 C;  3A0J A;  4KKU A;  1CZW A;  2CH4 A;  5BR8 Q;  3FDT A;  1E7Z A;  5J1Z A;  4X65 Q;  1YIT A;  5C0X I;  5E1F A;  2Q2T A;  3D4R A;  1UAP A;  3DM1 A;  1CK1 A;  1VQL A;  3S1R B;  4FF1 A;  3E5S A;  4HCE A;  2I5M X;  1JJG A;  4Y7N B;  4TVA B;  1TXY A;  1U4M A;  3FEW X;  2XWB B;  5KEE A;  2X69 A;  3EIV A;  2Z4I A;  3U4Z A;  1N32 L;  2A6H D;  3CCL A;  1IL2 A;  2KED A;  1PVO A;  1AE3 A;  3NTI A;  5EQ0 A;  2ASB A;  2H1E A;  2VQE Q;  4LF6 Q;  1Q46 A;  1QUQ A;  2ZJQ A;  1B2T A;  3GTM B;  4JYA Q;  1VQI A;  1JT8 A;  2WP8 J;  4QJF A;  3TBI B;  5C0X G;  4DR5 L;  4QIW B;  3TS0 A;  1HNW L;  1BF4 A;  3KLW A;  3D8G A;  2AUK A;  4JI3 Q;  2L12 A;  2R92 G;  4KD4 A;  1V1P A;  4DXF A;  1SYE A;  4DFA A;  2EY2 A;  4ZUJ A;  3QWN A;  3KDF A;  3PO3 G;  3ERS X;  2WB1 B;  3KLS X;  3B6Y A;  4A75 A;  3HOZ H;  5IGC A;  1QE6 A;  1I4H A;  5DM6 3;  1BUV T;  4ME5 A;  3T1H Q;  2EXZ A;  1YHQ A;  2F0L A;  1S3O A;  4A93 G;  2B3G A;  1ASZ A;  1HFG A;  1AE2 A;  3ERQ A;  3I4O A;  1KRS A;  3CCE A;  4KLK A;  5M3F H;  3EQL C;  5EBD A;  4X62 L;  1I3Q H;  3ONA B;  2VW9 A;  4IUR A;  1AH9 A;  4JI1 L;  1C8C A;  3S1N H;  1WTO A;  3I4N G;  2OT2 A;  4R4Q A;  1KIX A;  5C3X A;  1HUM A;  1JMC A;  3RLF A;  1JJC B;  3I2Z A;  4M8A A;  1KNA A;  2RDH A;  1WD0 A;  1WTP A;  1HA5 A;  2B63 B;  2JA7 B;  4JW0 A;  4WOR A;  4JI6 Q;  3H3V H;  5IYB H;  2F0V A;  3EA6 A;  1S5F D;  1SYD A;  4KD3 A;  4JV5 Q;  4DNR B;  1FGU A;  4MHE A;  4QB4 A;  4AYB G;  1BO0 A;  1EIF A;  5H1S E;  1VQP A;  1L1O C;  1JB7 A;  1P8L A;  1X3F A;  1MSG A;  4C2M B;  3UDG A;  5KNB A;  4GKJ Q;  1Q7Y C;  4ZRZ A;  1EY0 A;  2E5L Q;  2Z0S A;  1S4Z A;  1B3A A;  2JA6 G;  3TZU A;  1JE4 A;  3GQB A;  4A3M H;  1TY0 A;  5IP9 H;  1TS5 A;  2R93 H;  5CV7 A;  4DR4 L;  2L0C A;  2YTY A;  3OYY A;  4KHP L;  3U58 A;  4JVZ A;  2RVL A;  3DHQ A;  1S5C D;  2E75 C;  1GUT A;  2ZTD A;  3CP0 A;  4L6T B;  4A3K B;  1EY4 A;  1J5E Q;  2QDL A;  1II3 A;  5EGT A;  3I4N H;  1IZ6 A;  1X6O A;  1BBX C;  1H9S A;  1UE5 A;  1NMF A;  2K32 A;  1HR0 L;  3QR8 A;  1Q8I A;  2CW0 C;  4DUY L;  5HUR A;  3A56 A;  1EYC A;  3GTK B;  1JOO A;  4KMU C;  3P7J A;  2QIL A;  1PRT B;  3BVZ A;  3BS1 A;  3HRZ C;  2VB3 X;  4OGQ C;  3MXP A;  3LWE A;  3S2H B;  2EY5 A;  1O78 A;  1HNZ L;  1WCM H;  3RZD H;  2DNE A;  4FVM A;  1JC7 A;  5GAD C;  3RNU A;  2A73 B;  3UDF A;  4GKK L;  4NP5 A;  4YCW A;  2YTV A;  1J8I A;  1YNN C;  1KLU D;  3WWV A;  1JB3 A;  1SDF A;  1ET9 A;  1C0A A;  1PFM A;  2MQH A;  3KBG A;  2F52 A;  4HMI A;  3S14 B;  2VZA A;  1ML0 D;  4ALP A;  3OWE B;  5DLQ E;  1ESF A;  3J7A 5;  2I0Q A;  1GOZ A;  4GN4 B;  4BBS H;  1RCV D;  1E22 A;  1SEB D;  4B9X A;  1Z47 A;  5FJ8 G;  1WOC A;  3U9S A;  4GNX B;  3T4A C;  5IYC H;  4F7X A;  3GTO B;  3I3C A;  3ZYY X;  1KDC A;  1HTL D;  4NXN L;  4A4I A;  3R3O A;  2F0I A;  1TT2 A;  4RGM A;  3E3X A;  1AZP A;  3ICE A;  4A3D H;  1H9J A;  4IOA A;  4JCV E;  2FHT A;  1RL2 A;  3CPW A;  2A8V A;  5BR8 L;  1H9K A;  4RH6 A;  3J7A F;  4X65 L;  1KD1 C;  1TS3 A;  4K5X A;  2HIX A;  1X3Q A;  2IL8 A;  1W3S A;  4WJW A;  1IKL A;  1Q86 C;  1R9T B;  4QGU A;  2HD3 A;  4R9W A;  4OWT B;  2IHF A;  1I4R A;  2D5D A;  2SNM A;  3FPP A;  4QY7 A;  3H91 A;  4GZY C;  1PTO B;  2NVQ H;  4PQX A;  4IO9 A;  1LLR D;  3M4Y A;  4V19 0;  4DN4 M;  2VQE L;  1LTS D;  4LF6 L;  2N49 A;  1RIP A;  1VQB A;  1RTO A;  3I70 A;  2KUM A;  2NN6 I;  1LUZ A;  2B2W A;  5ELC A;  4JYA L;  5CBA E;  2DY7 A;  1SYG A;  3RZO B;  1KTK A;  2KHI A;  5JPN C;  1SE2 A;  4AQY Q;  4GN5 A;  4B3S Q;  2LS0 1;  4X64 Q;  3DXJ C;  4HJ9 A;  1ENC A;  4JI3 L;  4DR2 Q;  4KY5 A;  3TP8 A;  4DV2 Q;  4JI4 Q;  1ILP A;  3DM3 A;  2EYJ A;  2N3S A;  3D0F A;  1QUQ B;  1HZ9 A;  4UP8 A;  4K6L A;  3SEB A;  1UE6 A;  1ILQ A;  2R92 B;  4LJZ C;  4JBW A;  3TDQ A;  1QIL A;  2ZJR A;  3HKZ G;  1KNE A;  3K5L A;  1SJH D;  1CQV A;  2BDN A;  2NN6 G;  1R4Q B;  4DR7 Q;  3NBH A;  3T1H L;  1YVC A;  4A3B H;  4RHS A;  1QVG A;  2VUM H;  2HCC A;  1V1P B;  3PO3 B;  4DK6 C;  3L7Z C;  5IGF A;  1X3E A;  5IWA Q;  3K7A B;  4X3S A;  1STB A;  1WI5 A;  3KDF B;  4A3F G;  1Y8N B;  4OWX B;  1XTC D;  2LY7 A;  2HT1 A;  3M3Y H;  4APV A;  1CFM A;  1CT1 D;  4A93 B;  4QCL A;  3CXC A;  1TWC H;  4DA2 A;  5CGK A;  3VA7 A;  1TS4 A;  1NR4 A;  4PNY A;  4UY8 C;  1K3B C;  3ND8 A;  2KCM A;  2LMC B;  1S5E D;  1CZG A;  4DF7 A;  4O42 A;  1PHJ A;  3NWS A;  4G57 A;  4BY1 H;  3HOX G;  1AEX A;  4DR3 Q;  1CHQ D;  2IY5 B;  4JV5 L;  3NK9 A;  4HN7 A;  1DOK A;  1TY2 A;  1ZYR C;  2VQF Q;  2D9U A;  3QB3 A;  1JIC A;  5IYD H;  3HKZ E;  3MVV A;  1SN8 A;  1VQH A;  1M4V A;  2DJG C;  1DON A;  1Q82 C;  2E5L L;  1JWS D;  1UE7 A;  2Z9H A;  1PDQ A;  3S24 A;  4XYO A;  4GLV B;  4A3E G;  1O7Z A;  4DU9 A;  2WAQ G;  3VR3 A;  4HIK A;  3T1Y Q;  2NZH A;  4IJH A;  3TSS A;  5GAG C;  3L0O A;  1EOT A;  2B29 A;  2RCF A;  3IL8 A;  2ZTE A;  1I6H H;  4L63 B;  2JA6 B;  1CHP D;  2KEC A;  2AWO A;  4JOI A;  1SNP A;  2EYL A;  2FXQ A;  1O7L A;  1LTR D;  2C9O A;  1A15 A;  4BBR G;  1K73 C;  4X3K A;  1J5E L;  4NDX A;  1YNX A;  4HAE A;  1YIJ A;  4XT3 B;  2MNA A;  2Q8T A;  3DEP A;  4HTH A;  3P1H A;  3HS0 C;  5M5W H;  4R4I A;  1PLF A;  1SJE D;  4CJ0 B;  2KCN A;  2L5T A;  3BZK A;  4DNI A;  2KHS A;  3K0X A;  4GLA C;  3F2D A;  4YY3 Q;  2MUY A;  5FO7 B;  4YCV A;  1TWG H;  1JQY D;  4KTA A;  3W3A A;  4KI0 A;  4K5V A;  3PUZ A;  2RHS B;  1TU2 B;  1SE4 A;  1H9S B;  3PF4 A;  1KQS A;  4H02 A;  3OIQ A;  4C3H H;  1YEZ A;  2JJQ A;  5FOB B;  4FP5 D;  1N32 Q;  1SYC A;  3FKI G;  5FKA C;  1PYB A;  2HUG A;  1S40 A;  3P75 A;  1Y8O B;  2WAQ E;  1VQO A;  3S16 H;  2K14 A;  5C4J H;  4FF3 A;  3K80 C;  2EYP A;  2E2J H;  1E3P A;  4NMZ A;  4CBV A;  4JBK A;  1N36 Q;  4G4K A;  2EYF A;  1J6Q A;  4V0B A;  3SVM A;  2KEE A;  2Q2U A;  3NBI A;  4GOP A;  1VQN A;  4HJA A;  2ZTC A;  3BVM A;  1N9W A;  2B2T C;  1VQM A;  3NEL A;  2B2U C;  1EOV A;  5ELO A;  2JA8 G;  3KF8 A;  1TKW B;  1UEB A;  2B2V A;  4OIJ A;  1LTI D;  2A5H A;  3K6O A;  3NXW A;  4IFD H;  2PW7 A;  4PZ8 A;  3F2C A;  2N78 A;  4O2D A;  5COY A;  2CQO A;  1TQO A;  3RUZ A;  1FYC A;  4C3I B;  4KN4 C;  4H44 C;  4O1N A;  1YNJ D;  2A69 C;  2JYO A;  1K8A C;  1Y69 U;  3ZJY C;  2FMM A;  1KC8 C;  1B44 D;  3H0G H;  1LO5 D;  4X62 Q;  4H13 C;  1V1O A;  3G71 A;  1FR3 A;  4RAU C;  1PH8 A;  4DK1 A;  2R7Z H;  1VS0 A;  4UHV A;  1CTM A;  4JI1 Q;  1STH A;  5KNC A;  1Y1V G;  5K36 H;  1WFQ A;  3GV6 A;  5EJW A;  4H0L C;  1WJJ A;  5GRO A;  2PMZ E;  3PMF A;  4IUN A;  4BY7 H;  1Z7T A;  2WB1 E;  3NWT A;  1X3P A;  1N33 Q;  3HFZ B;  1LTG D;  1BNZ A;  1E1O A;  3H6M A;  3ND9 A;  5FO9 B;  2O5I C;  3MTS A;  1KDA A;  1SXT A;  4J15 A;  1DOM A;  4A3J G;  1F9R A;  1VQJ A;  3A8I E;  5JEA H;  4A3I H;  4AQY L;  4B3S L;  5FLM G;  4X64 L;  1SE3 A;  2FIN B;  2MHV A;  1UUP A;  1X9N A;  1PZJ D;  5C5L A;  3A55 A;  5C44 G;  4DV2 L;  4XT1 B;  2HQL A;  2GVB A;  4JI4 L;  1A62 A;  5EKL A;  1VQK A;  3H94 A;  4HR7 B;  3GTJ B;  3ERO A;  1SRO A;  2J4X A;  2Z6B A;  3S2D B;  1JR0 D;  3S17 H;  4P71 A;  2F0W A;  1A2U A;  4RGT A;  1V1Q A;  1BXT A;  5A35 A;  4LUV A;  4DR7 L;  4LF9 Q;  2F0U A;  2UXC Q;  4FDB A;  2SDF A;  2E2I B;  3CPF A;  4UP7 A;  5IWA L;  4GLX A;  5HY6 A;  4M1U B;  3HKZ B;  1Y14 B;  1CKO A;  5EBC A;  4LFC L;  4RHR A;  3I55 A;  4KY6 A;  4TKO B;  1G6P A;  4PG3 A;  1PH7 A;  4A3G G;  4OO1 G;  1H9R A;  2UUC Q;  1JWU D;  1EUJ A;  4JG2 A;  4A3F B;  1Z9F A;  5AJ3 L;  2JA5 G;  1HUN A;  2M2L A;  3Q22 A;  1LM0 A;  3GTL B;  1XPU A;  3VYS A;  4DV6 L;  4KN7 C;  4DR3 L;  1K0S A;  4DGZ A;  1CUK A;  1QOH A;  2G9D A;  4L5T A;  1VQC A;  2RSN A;  3OOC A;  4GKK Q;  2AHO B;  3BDO A;  3QOJ A;  2BDO A;  2ZT9 C;  4NXM L;  2VQF L;  1YJN A;  4K2K A;  3HOX B;  3MA2 B;  2AQ2 B;  3VR2 A;  1OTC A;  2O5J C;  1VQG A;  3KLS A;  1A3T A;  2BE5 C;  3HOW H;  1F2M A;  1PH1 A;  1EQT A;  3I4M H;  1BCP F;  3NEM A;  5DAU A;  3A5U A;  1C48 A;  2LXJ A;  3T1Y L;  1RD9 D;  1HNX L;  1ICF B;  3AEV A;  1X56 A;  2NWG A;  4LF5 Q;  5I2Y A;  2RDG A;  2UUA L;  2KCC A;  4TRD A;  4A3E B;  2ZXP A;  1HR0 W;  1JOR A;  1EY6 A;  3PIO A;  1RF2 D;  2WAQ B;  3J80 i;  1VQ7 A;  1I50 B;  2XTI A;  3CU7 A;  3HEJ A;  4KHZ A;  4YWK A;  3CW2 C;  3IFT A;  4OO1 H;  2CW0 D;  1EEI D;  1TWH B;  1Y8P B;  4XQJ A;  2IX3 A;  1K3R A;  2K5H A;  1X55 A;  1XNQ L;  3HOZ G;  2Z6K C;  3K5O A;  5IP7 H;  2K33 A;  3NTK A;  1AW7 A;  2WKD A;  1K28 A;  4BBR B;  1HA6 A;  5LL6 X;  1N8R C;  1D7Q A;  5ELE A;  2F0P A;  3SGI A;  4DK3 C;  4OON A;  1QJO A;  1PZK D;  3CQZ H;  4YY3 L;  3H3V I;  3TP7 A;  4JI7 Q;  5C4Z A;  1NAP A;  4CGY B;  3DEO A;  2F0S A;  1BOS A;  5M3F G;  2EJM A;  5JEA J;  1WD1 A;  3A74 A;  4IPH A;  4CJ2 C;  4IQZ A;  2R7D A;  3KYH C;  3J81 L;  3PF5 A;  1LT6 D;  2NTT A;  4FXD A;  4HID A;  1FNU A;  5JPM C;  3U4V A;  1LTA D;  1EEF D;  5LL6 S;  4DV1 L;  3FKI B;  5IYB G;  1N36 L;  3MFG A;  3S14 H;  5M3M B;  1E2Z A;  2L55 A;  2K5W A;  1GHJ A;  4OXP A;  1CKN A;  3K0Y A;  2F4V Q;  1YZ6 A;  1T5X D;  2PMZ B;  4PZ7 A;  1OXS C;  4POF A;  2PZW A;  2HQE A;  3GTG B;  1RKN A;  1V8Q A;  4UAI A;  1A8V A;  3HG9 A;  5J3B A;  1M1K C;  1QZH A;  1PFB A;  2A68 C;  3HP3 A;  1DCZ A;  2CHB D;  3ULJ A;  4GOP B;  3S1Q H;  4A3C H;  4A3M G;  1TS2 A;  2EDG A;  4F87 A;  4PMB A;  2WII B;  2DY8 A;  3STB C;  3VYR A;  2F1M A;  5IP9 G;  2R93 G;  3RD4 A;  5D65 A;  3KF8 B;  3X3N A;  3AYH B;  4ZCK A;  2RSO A;  1U5K A;  5BN4 A;  1VMC A;  2IJ0 A;  5EPJ A;  1HZA A;  1ICW A;  1RTN A;  2PO4 A;  3J80 E;  3CCU A;  1LAB A;  4CDD C;  3W2D A;  2MJ8 A;  5HGT A;  1EY5 A;  3OIP A;  1F9Q A;  1NE3 A;  3J81 c;  3KJP A;  2Z4H A;  4CDF C;  3PUX A;  4LMQ D;  2EZV A;  2B8F A;  1N33 L;  2NVX H;  4LK1 C;  3DUZ A;  4KJN A;  5G3L D;  1Y1V B;  1GM5 A;  1C4Q A;  1F9S A;  3I90 A;  4RCN A;  3J81 i;  3HOU H;  3CD6 A;  3HZX A;  1BCP D;  2VNU D;  1MJE A;  1SMY D;  3RZO H;  4L5Q A;  2PI2 A;  1WCM G;  2I07 B;  1BBW A;  3L2P A;  1B50 A;  2RF4 A;  3H15 A;  4C1N I;  4LUO A;  3AB9 A;  1LTB D;  4DAY A;  1EFW A;  1H9M A;  5ELD A;  2XNA C;  1GUS A;  4NKL A;  4GNX C;  4A3J B;  5D3D A;  5EPK A;  3AU7 A;  1ENA A;  4F88 A;  5C4X H;  1F2L A;  1D6E C;  3NQI A;  1ENF A;  1HRJ A;  2L9H A;  3W5O A;  2PZU A;  5C44 B;  5LHY 1;  1D8L A;  4RGN A;  1EWI A;  1D5Z C;  4ZKC B;  4LF9 L;  2JK8 A;  2UXC L;  2L15 A;  4C3J H;  4BBS G;  2E8G A;  3M7N A;  3R8B A;  2LFN A;  3T51 B;  3I56 A;  1GUN A;  4ZAI A;  1DOL A;  3LGJ A;  2O4X A;  1PTO C;  4RA8 A;  5ELF A;  4XIG S;  5IYC G;  2UUC L;  4LFB Q;  4AYB E;  3QG1 A;  4RMF A;  1C7Y A;  4FXG C;  1KHI A;  2PZT A;  1U4P A;  2M9V A;  3R93 A;  4A3D G;  2N88 A;  4A3G B;  2PI2 E;  4XQQ A;  2Y0S G;  3FP9 A;  1ZYR D;  3KJO A;  3TN2 A;  5C3W A;  2KOL A;  1HPC A;  2YU9 B;  4AIM A;  3V96 A;  2KQ3 A;  2JA5 B;  1E2W A;  2YYZ A;  4R8I A;  3MEH A;  3TS2 A;  1CA6 A;  5ELN A;  2JP1 A;  4DK0 A;  1YHB A;  2IW3 A;  1QG7 A;  3G6E A;  1B1Z A;  1EY8 A;  1OO9 B;  3GV3 A;  3MXN A;  4OEM B;  4L5R C;  3AFQ A;  5L37 A;  3HKS A;  3J81 E;  1YJW A;  2F0N A;  3CCV A;  2V1C C;  1CM9 A;  1OXV A;  4J6H A;  3WDN A;  4QL5 A;  2Z8L A;  5EKK A;  4LF5 L;  4PZ6 A;  4R4O A;  3GTP H;  1B53 A;  1QB5 D;  2B8G A;  2WAC A;  2R6G A;  1NR2 A;  1HJP A;  4CKE A;  4UPA A;  3IRB A;  4ILW A;  3S1M H;  3O13 A;  1QCB D;  3S15 H;  1E2V A;  5J39 A;  4H7B A;  1V9P A;  3FVQ A;  1W6K A;  1KRT A;  3T16 A;  2OCE A;  4A3B G;  3ITP A;  2K1B A;  4RFB A;  2VUM G;  1OXX K;  3HOZ B;  4BXX H;  2RKS A;  4JI7 L;  1PMR A;  1X32 A;  4DNT B;  1S72 A;  1IBK Q;  4LF8 Q;  4CKC A;  5T1G A;  1I4Q A;  1I4P A;  5C0X J;  1K0R A;  5CV4 A;  5M3F B;  4DR6 Q;  1TR5 A;  2EY6 A;  1I3Q B;  3I4L A;  3FMC A;  4LF7 Q;  4BY1 G;  1U9R A;  3S1N B;  1TII D;  5C3E H;  2DUD A;  4K0K Q;  4Z9C B;  3PQI A;  1WYD A;  2M00 A;  4X3U A;  4DV3 L;  4LAA A;  4YCU A;  3LWU A;  2F4V L;  3E0J A;  4YIJ A;  5IYD G;  4MZ9 A;  1CQF A;  2QA4 A;  5M5Y H;  1EYG A;  5DM7 3;  2B2Y A;  3I73 A;  1Y1W H;  2CFM A;  4DV7 Q;  4P72 A;  4ZKB B;  3NTH A;  2PNR C;  1NCV A;  5JOB A;  4L8J A;  3PO2 H;  4HJ8 A;  1SNO A;  2MGS A;  3PGZ A;  3CCR A;  1XMO Q;  2G5D A;  4C3I H;  1TWF H;  4X6A H;  3PV0 A;  1CKN B;  2EYM A;  3PUW A;  4RWS C;  2QEJ C;  1EWH A;  2JXM B;  3EFX D;  4FNF A;  4LFC Q;  5IT9 L;  2EOT A;  1PH2 A;  4N8X 1;  4A3M B;  5F2D A;  3NE5 B;  2B39 A;  1TWA H;  4N8F A;  4J1M A;  1K8G A;  2R93 B;  3BDC A;  3BZC A;  1V43 A;  3CAM A;  4JPB W;  5AJ3 Q;  3HOY H;  1EL0 A;  1W6J A;  3NHH A;  3A7L A;  3SK5 A;  1X54 A;  3S9W A;  2K50 A;  2CKZ B;  4DV6 Q;  2XN9 C;  2GN5 A;  1KL9 A;  2MO0 A;  2HHH Q;  1E1T A;  3URY A;  3I4N B;  1IYV A;  2PYK A;  5FO8 B;  1FNW A;  1GXD C;  3D6C A;  5M5X B;  1VQE A;  1EZ8 A;  2BH2 A;  1D1I A;  1B9N A;  3SK4 A;  4NXM Q;  5ELB A;  1G29 1;  2CH4 W;  1VF7 A;  1LV9 A;  4C3H G;  2QEX A;  3ULL A;  1SFO H;  1K9M C;  4LFA L;  1P16 A;  2ZJP A;  2PW5 A;  2I5L X;  4AYB B;  3HOV H;  3P20 A;  1XNR Q;  4P75 A;  4IFD I;  4BS9 A;  1WCM B;  3RZD B;  4B3R L;  2MPM A;  2VXW A;  1ET6 A;  3F2B A;  1UNS A;  3C3L A;  1HNX Q;  5JAV A;  2K05 A;  1RJT A;  2PQA B;  5C5M A;  2UUA Q;  2YV5 A;  3RLO A;  4B08 A;  4HJ5 A;  4UP9 A;  3K58 A;  1FJG Q;  1SND A;  4R4T A;  2K03 A;  4KHV A;  2IHE A;  1PH6 A;  1NTG A;  1SNC A;  4DAY B;  5IT9 c;  4LF4 L;  2GA4 B;  3N52 A;  1XNQ Q;  2BOS A;  2PQE A;  3D4W A;  4IFD G;  3VYT A;  3UE0 A;  2RA4 A;  3CC2 A;  2F0F A;  5LMN Q;  3EVQ A;  4BBS B;  1BCP B;  2VB2 X;  2AUJ D;  2ALY B;  1GHK A;  4LFB L;  2Q2H A;  1VQ5 A;  1CSQ A;  4QUF A;  3ER0 A;  2EVB A;  4WRD A;  1Q1B A;  3H0G G;  3E9I A;  4UDU C;  1GD7 A;  3A8K E;  2KCT A;  4U67 3;  5I6Y A;  2R7Z G;  2F0O A;  5JVG 3;  1NNX A;  2F03 A;  5K36 G;  3M9B A;  3NPP A;  1JWM D;  1VQD A;  4A3D B;  3MFY A;  2Y0S B;  4R8N A;  4DV1 Q;  2UU9 Q;  4BY7 G;  3BG3 A;  2OWO A;  2B2W C;  5CBE E;  1K83 H;  1SYF A;  2F3V A;  2K28 A;  5K5P A;  3D3R A;  1XTD A;  2KA7 A;  3GTQ H;  2EIF A;  4CDC C;  1Q3L A;  1PV4 A;  3FPU B;  4ABN A;  3UE1 A;  2NVQ B;  2JSO A;  2H5X A;  3VR4 A;  2CWP A;  4ZYS A;  2EJG C;  5JEA G;  4A3I G;  2TSS A;  4DAP A;  2FMC A;  1XYI A;  3MXN B;  1FL0 A;  2VS1 A;  1IW7 D;  2HDL A;  1XPR A;  2HIV A;  5E4W C;  5FLX L;  3EJI A;  2AQ1 B;  2FJ2 A;  4PMC A;  2NVT H;  2K5V A;  1VQA A;  3CRK C;  2SNS A;  5C6A A;  2IPK D;  2VL6 A;  2TMP A;  1UEA B;  2NBF A;  4IAL A;  3MXG A;  3Q8D A;  1KAW A;  4POG A;  2K01 A;  3S1R H;  4OX9 Q;  1A63 A;  4Y7N H;  4DR1 L;  4A3B B;  2VUM B;  1PH4 A;  3EN2 A;  1PFS A;  4ZQ3 A;  1I4G A;  2XRS D;  5IT9 E;  1BDO A;  1IBK L;  1CKM A;  4LF8 L;  1H95 A;  3QO2 A;  3W1B A;  1AP0 A;  3U9O A;  3HGB A;  4IUU A;  3K8A A;  1I6V C;  3GTM H;  4DR6 L;  5KRU A;  2PPB C;  1PH5 A;  3M3Y B;  4CJ1 B;  4TSS A;  3FHW A;  4LF7 L;  1TWC B;  1IYJ B;  3GDE A;  3C2P A;  2XRQ D;  4KV6 A;  5LMU L;  4K0K L;  1UWV A;  3AMU A;  2MO1 A;  4DAV A;  4EVO A;  2KEN A;  3MZ5 A;  2ENB A;  2E76 C;  3D6W A;  3OMG A;  5CV6 A;  4BY1 B;  4JK1 C;  5FLX c;  4OO1 I;  4R4C A;  4DV7 L;  4BWG B;  2K7V A;  3L9A X;  3PCO B;  1A6X A;  4EX5 A;  1I4X A;  3HOW G;  4GN3 B;  1U4L A;  4LWC A;  4CHT B;  3I4M G;  3J80 L;  4JOI C;  1XMO L;  2K5D A;  4HJ7 A;  3VR6 A;  1O7Y A;  4OWW B;  2RHQ B;  2Q8I B;  1G8Z D;  4LUZ A;  2HDM A;  2ZXR A;  1XMQ Q;  1DJR D;  3M4Q A;  3JAM i;  2L11 A;  4WFN 3;  3CKI B;  1I6H B;  1MHW C;  2B63 H;  1U0L A;  2JA7 H;  5CV9 A;  2NVY B;  4JI5 Q;  5IP7 G;  4HSP A;  4MNO A;  2NUC A;  3CHB D;  2HHH L;  5CR3 A;  2LXK A;  3PIO 3;  3IAY A;  4J8Q A;  1WTW A;  4EGV A;  1D1K A;  1EIY B;  5KYL A;  2UXD Q;  1G91 A;  5M5W B;  3RR5 A;  5CMD A;  5AFW A;  3UI2 A;  2QDB A;  4C2M H;  1XWE A;  1LYL A;  5GAE C;  1F2Y A;  2ZM6 Q;  2GVA A;  1I94 Q;  2AWN A;  4X3T A;  4DXG A;  1TWG B;  1SBB B;  5G3L F;  2QCP X;  2JE6 I;  4XDX A;  1XNR L;  1ZKO A;  4GOP C;  4C3H B;  4XTC S;  4IZ8 A;  4DPG A;  3OMC A;  3J80 c;  2IT1 A;  4ULL A;  3BYY B;  2C5C A;  2L4N A;  3S16 B;  1L1O A;  5C4J B;  2B2V C;  2EE1 A;  1ONL A;  2E2J B;  4YWL A;  1FJG L;  2A74 C;  1STN A;  4A3K H;  1F9P A;  2R61 A;  4K5W A;  1PZI D;  1AFP A;  3M4O B;  3DWA A;  2UXB Q;  1XX8 A;  1R4P B;  4E6I A;  5IIF A;  3GTK H;  1QNK A;  4IJL A;  2X6G A;  1EQR A;  5DEH A;  5LMN L;  5M9O A;  4GS3 A;  2ZXO A;  4A3C G;  4I7Z C;  4MTN A;  5FLX E;  4IPG A;  4OIK A;  2RCN A;  3CC7 A;  3R2I A;  3S2H H;  3GO5 A;  5GQO A;  3OW7 A;  3TRZ A;  3M4P A;  2YTX A;  4DV0 Q;  3DMU A;  4AH6 A;  1YNN D;  4JI0 Q;  3OW2 A;  3N6R A;  3H0G B;  1GVP A;  4JBJ A;  2J0T D;  3CCM A;  4JI8 Q;  1HQM C;  2UU9 L;  2R7Z B;  1W2B A;  2XSC A;  1G2S A;  3HOU G;  1JOK A;  2MFI A;  1Q12 A;  4DV3 Q;  1HQR D;  4BY7 B;  4BA1 I;  4WJ3 M;  5CV8 A;  1A3V A;  5EKI A;  1DGS A;  2F3I A;  1M8A A;  3UDI A;  3BYT B;  3CRL C;  5C4X G;  3GTO H;  4A3I B;  1MI2 A;  1X65 A;  2JA8 B;  4JBM A;  5CYU A;  1PRT C;  3TP6 A;  2Q8R E;  2CVR A;  3LX0 A;  3G48 A;  3SK8 A;  2PNH A;  2DN8 A;  4C3J G;  2SEB D;  1VQF A;  1R9T H;  1SNQ A;  3G6J B;  3S17 B;  2JA9 A;  1B7Y B;  4OX9 L;  5E4X A;  2A19 A;  4OL7 A;  4IPD A;  1EFI D;  1PTO H;  5IGG A;  3DLL A;  5FK9 C;  1EYA A;  2XGT A;  3TRE A;  2F0M A;  2KJX A;  2I5H A;  2XVS A;  4B3M L;  4QF4 A;  1F2Z A;  4IPC A;  2E2H B;  2ID0 A;  1WTX A;  3AQQ A;  2OQK A;  1J9O A;  4FYD A;  4EQN A;  4OEL B;  1IBL Q;  2PQA A;  2F0G A;  3M7G A;  2HCI A;  4HED A;  4N9T A;  1BR9 A;  3KOJ A;  2BA1 A;  4LFA Q;  1F77 A;  2E74 C;  5KGU A;  5C0X H;  3VA5 A;  4B3R Q;  4DUZ Q;  2D0O A;  5JVH 3;  2L1B A;  1DD2 A;  1OXU A;  2R92 H;  3PUV A;  1HZC A;  3V05 A;  1QVC A;  1SNM A;  3CC4 A;  5A2Q E;  3PO3 H;  2V4D A;  4EQP A;  1YHA A;  2X6L A;  3IKJ A;  3K7A H;  4LF4 Q;  3KBX A;  4NW2 A;  1UE1 A;  3HOW B;  5BN5 A;  3I4M B;  1PYW D;  4RG1 A;  3GP7 A;  4FO2 A;  4C1N K;  1JCK B;  4A93 H;  1EU3 A;  1DXM A;  1EY9 A;  3MEF A;  1XMQ L;  1IXR A;  2A6E C;  4ID6 A;  3MAQ A;  2AKW B;  1ROD A;  1B3Q A;  1SE8 A;  2DNC A;  5TSS A;  1ESR A;  4ZLT F;  5ISR A;  1KAB A;  3BVG A;  1DZ1 A;  4JI5 L;  2R7F A;  1AN8 A;  4DKA C;  1LT4 D;  2P5Z X;  5COR A;  5IGB A;  3CME A;  4S3S A;  3K5M A;  2N55 A;  3J7Y W;  2XWJ B;  5M5X H;  4BXX G;  1MKH A;  4KKS A;  4O0A A;  1VDZ A;  3KF6 A;  2UXD L;  3H3V C;  2H4O A;  3NEN A;  2NB0 A;  3TEH B;  1FNV A;  1YJ9 A;  5I9P A;  2RDF A;  3CQZ B;  2ZM6 L;  2UUB Q;  1I94 L;  4X66 L;  2ICI A;  1CI3 M;  3TME A;  5C4H A;  3SR1 A;  2EY1 A;  3D4D A;  3CF5 A;  1B4O A;  3KFU A;  3T56 B;  1PA6 A;  1OXT A;  1WTR A;  5JJL A;  1PXU A;  4A3L G;  4YHH Q;  2JA6 H;  5C3E G;  2A6H C;  1NBW A;  2OEO A;  2WFW A;  2QF7 A;  3I91 A;  2NZO A;  3AFP A;  2WIN B;  5JJZ A;  2OTL A;  1BVS A;  3SHL A;  3G7L A;  1LTL A;  1ASY A;  1E24 A;  1Y1W G;  2J7Z A;  3K57 A;  5EPL A;  2Y0S E;  3G4S A;  2N8N A;  3PIP 3;  3PO2 G;  2UXB L;  4ZUI A;  1L1O B;  5EAY A;  1JOQ A;  1ZXT A;  4C3I G;  1VQ4 A;  3NP8 A;  3K59 A;  3E9H A;  3MWY W;  1EQQ A;  4F8M A;  1CA5 A;  4U68 A;  2K5Q A;  4EQO A;  2WKC A;  4K2L A;  1QNU A;  4DR1 Q;  2CQA A;  5IGD A;  3S1Q B;  4DV0 L;  4DV5 Q;  3K81 C;  5CV5 A;  3WOE A;  1Q90 A;  1AZQ A;  1N34 Q;  4JI0 L;  5CC4 A;  3HOY G;  1YBY A;  4JC0 A;  3SE0 A;  1GUG A;  3PIP A;  1O7I A;  2NZ1 D;  4Y52 H;  4JI8 L;  4A3L H;  1L0X B;  4LNQ A;  5LMU Q;  4B9W A;  4HMJ A;  1A3U A;  1EWC A;  2ICE C;  1LT5 D;  1VCI A;  3V2T A;  2NVX B;  2JEA I;  4XQN A;  3J7A V;  5HGQ A;  1S5D D;  2JEB I;  3HOU B;  2OXP A;  3I8Z A;  3NUC A;  2A1A A;  3HOV G;  2A69 D;  1BCP C;  1NJI C;  5NUC A;  3QIA A;  1D2B A;  3PUY A;  4CKB A;  1SMY C;  3I7F A;  3X3M A;  3KUP A;  1Q1E A;  2DJF C;  1NMG A;  2B2T A;  5I9O A;  2BCO A;  5FJ8 H;  1MGS A;  3WOF A;  1STE A;  2B2U A;  1D5X C;  2QKI C;  1KAA A;  2SOB A;  5C4X B;  1LT3 D;  1HTP A;  1GO3 E;  1HFN A;  1FD7 D;  3NQT A;  1L0W A;  2Q2I A;  3MXU A;  2PCF B;  4IOC A;  1SRU A;  2C35 B;  3LNN A;  4C3J B;  4G7O C;  3UDX A;  4L5S A;  1DM0 B;  1A2T A;  2Z1C A;  4KY7 A;  4TQU S;  4A76 A;  1HHV A;  1A0I A;  1SMX A;  5IOC A;  3PSI A;  3MC0 B;  3TQY A;  1B8A A;  1IBL L;  4WJ4 A;  1SYB A;  3Q23 A;  2F0Q A;  3CCQ A;  5E7N A;  2F0E A;  5IOD A;  1STA A;  5KND A;  4JI6 L;  1G6Z A;  3VYU A;  4DUZ L;  1U4R A;  1VQ9 A;  2QW7 A;  2K52 A;  3GTJ H;  1NY4 A;  3S2D H;  1C9O A;  3H09 A;  4QMG A;  5I4D A;  1EIH A;  1T9H A;  4Q0F A;  3CCS A;  1KXL A;  2E2I H;  4GKJ L;  3Q0A A;  4B3T Q;  3IFD A;  1EQV A;  4DV4 Q;  3ULP A;  1HXY D;  2NN6 H;  1DYQ A;  3F1Z A;  3TZD A;  2MP1 A;  1WVL A;  3RLN A;  1PH3 A;  4IN3 A;  2EQS A;  4IUP A;  3VR5 A;  2NTS A;  1HZB A;  2NYZ D;  3OTO Q;  3BJU A;  2JN4 A;  1PRT F;  2DGY A;  4A3F H;  1QZG A;  2F0J A;  4QUC A;  4G7H C;  2D0P A;  1IBM Q;  1L2F A;  1QWY A;  3QJY A;  1SR3 A;  3DWP A;  3GTP B;  2NVY H;  3W1G A;  3VDY A;  4JI2 Q;  3BZD B;  3I72 A;  3GTL H;  1D5M C;  3M85 A;  1GUW A;  1SSO A;  2EPB A;  4HSV A;  3S1M B;  3Q6S A;  3S15 B;  1NUC A;  5I6W A;  3F8T A;  1MIU A;  3MHB A;  2EJF C;  1GKH A;  1IHZ A;  1K8M A;  3HOX H;  1E0B A;  2K4K A;  2RBM A;  1G51 A;  2BE5 D;  2OF1 A;  2ES2 A;  2UUB L;  2ATW A;  1MJC A;  1XJV A;  1WTH A;  1I5F A;  4FF4 A;  4PMW A;  3F2U A;  1RHP A;  3RN2 A;  2F3W A;  3KF6 B;  1EY7 A; 
#chains in the Genus database with same CATH homology
 2JE6 I;  3J7Z C;  4BA2 I;  2NN6 I;  1LUZ A;  1XNR L;  5IE8 A;  4GOP C;  4YHH L;  4JYA L;  5M3M G;  4A3E H;  2RF4 A;  4XTC S;  3H15 A;  2KHI A;  3A5Z B;  4LUO A;  4AQY Q;  4GN5 A;  4DPG A;  1EFW A;  3J80 c;  4B3S Q;  2IT1 A;  4X64 Q;  4HJ9 A;  1I50 H;  4GNX C;  4JI3 L;  4DR2 Q;  5LMN W;  5C4X H;  1L1O A;  4DR5 Q;  1TWH H;  4DV2 Q;  1HNW Q;  1SLJ A;  2WB1 G;  4YWL A;  3M4O H;  4JI4 Q;  1VQ6 A;  1FJG L;  3DM3 A;  2N3S A;  3D0F A;  2K75 A;  1QUQ B;  1HZ9 A;  4A3K H;  4UP8 A;  4R1J A;  1UE6 A;  3W5O A;  1D8L A;  1VQ8 A;  3CMA A;  5JJK A;  1EWI A;  4JBW A;  2ZJR A;  4LF9 L;  3HKZ G;  4BBR H;  2JK8 A;  2UXC L;  2L15 A;  1M90 C;  2D62 A;  2NN6 G;  4C3J H;  4BBS G;  2E8G A;  4DR7 Q;  3M7N A;  2UXB Q;  2BH8 A;  3GTK H;  3T1H L;  1YVC A;  4IJL A;  4A3B H;  1QVG A;  1EQR A;  3I56 A;  4NPS A;  5LMN L;  2VUM H;  4GS3 A;  1JE5 A;  4P73 A;  3L7Z C;  4DK6 C;  1X3E A;  5IWA Q;  1Q81 C;  4A3C G;  3LGJ A;  4MTN A;  1WI5 A;  3KDF B;  4IPG A;  4A3F G;  2RCN A;  4XIG S;  3D31 A;  3CC7 A;  3U50 C;  2CWA A;  2KHJ A;  5IYC G;  4DV5 L;  2UUC L;  3S2H H;  4LFB Q;  4AYB E;  3GO5 A;  4OWX B;  5GQO A;  2HT1 A;  2Z6K A;  3M3Y H;  4APV A;  3TRZ A;  3M4P A;  2YTX A;  4RMF A;  4DV0 Q;  1C7Y A;  1PYS B;  1KHI A;  1N34 L;  2B63 G;  3CXC A;  4B3M Q;  1TWC H;  4AH6 A;  2K5N A;  4QIW E;  2JA7 G;  4A3D G;  2PI2 E;  4JI0 Q;  2VY3 A;  2Y0S G;  3FKI H;  3FP9 A;  1YI2 A;  3OW2 A;  4UY8 C;  2JQO A;  2KCM A;  3KJO A;  1GVP A;  1PHJ A;  4YWM A;  4QQB X;  4AIM A;  5M3M H;  4BY1 H;  4JBJ A;  3CCM A;  3HOX G;  4NB3 A;  2YYZ A;  4JI8 Q;  4DR3 Q;  2UU9 L;  1W2B A;  3TS2 A;  2IY5 B;  1JJ2 A;  5ELN A;  4JV5 L;  3HOU G;  1YHB A;  3G6E A;  2VQF Q;  2KBN A;  4EQ5 A;  3GTG H;  2MFI A;  4L5R C;  1Q12 A;  4DV3 Q;  3AFQ A;  4BA1 I;  5IYD H;  3HKZ E;  3HKS A;  4WJ3 M;  3EBE A;  1YJW A;  4ME3 A;  1B70 B;  1DGS A;  1SN8 A;  1VQH A;  3CCV A;  2V1C C;  3STB D;  2F3I A;  1Q82 C;  2E5L L;  1UE7 A;  3S24 A;  1OXV A;  4GLV B;  4A3E G;  2JA8 H;  4P74 A;  3UDI A;  4QL5 A;  2WAQ G;  4HIK A;  3JAM c;  4DR2 L;  4LF5 L;  4PZ6 A;  3T1Y Q;  2NZH A;  4R4O A;  4IJH A;  3GTP H;  5C4X G;  5JJI A;  5GAG C;  3GTO H;  1XPO A;  2QGQ A;  3L0O A;  1X65 A;  2R6G A;  2B29 A;  4JBM A;  1HJP A;  2ZTE A;  1I6H H;  1X3G A;  4UPA A;  3IRB A;  4A3K G;  2AWO A;  4JOI A;  4DR4 Q;  3S1M H;  2FXQ A;  3S15 H;  3G48 A;  3GD7 A;  4KHP Q;  1V9P A;  3BU2 A;  4BBR G;  2PNH A;  1K73 C;  1J5E L;  1YNX A;  1KRT A;  1YIJ A;  1VQF A;  2OCE A;  2MNA A;  1R9T H;  4A3B G;  2LSS A;  2VUM G;  2JA9 A;  1B7Y B;  4OX9 L;  2IX1 A;  1Y1V H;  1OXX K;  2A19 A;  5M5W H;  3RN5 A;  4R4I A;  1HR0 Q;  4IPD A;  4BXX H;  3BZK A;  4DNI A;  3K0X A;  4JI7 L;  4GLA C;  3F2D A;  4DUY Q;  3DLL A;  1FVI A;  4YY3 Q;  2E2H H;  1S72 A;  2XGT A;  3TRE A;  2I5H A;  4YCV A;  1TWG H;  3NBH B;  1IBK Q;  4LF8 Q;  4KI0 A;  3PUZ A;  2RHS B;  3L2P A;  4B3M L;  4IPC A;  2ID0 A;  1KQS A;  3PF4 A;  3AQQ A;  2OQK A;  4HIO A;  5C0X J;  4H02 A;  4C3H H;  1YEZ A;  2JJQ A;  3K7U C;  1K0R A;  4X66 Q;  1N32 Q;  3FKI G;  2PQA A;  1Q8K A;  1IBL Q;  1PYB A;  4DAM A;  4DR6 Q;  1HNZ Q;  1S40 A;  3KOJ A;  2BA1 A;  4A3J H;  2WAQ E;  4LFA Q;  1VQO A;  3S16 H;  2K14 A;  5C4J H;  4LF7 Q;  4BY1 G;  3K80 C;  2IX0 A;  5IY0 A;  2E2J H;  5FLM H;  1E3P A;  2OQ0 A;  1HH2 P;  3JC6 6;  1PH9 A;  5C3E H;  2DUD A;  4DUZ Q;  2D0O A;  4B3R Q;  4K0K Q;  2OTJ A;  4JBK A;  1N36 Q;  1WYD A;  5GAH C;  1J6Q A;  1OXU A;  5C44 H;  3E0E A;  2R92 H;  3PUV A;  4DV3 L;  4YCU A;  2F4V L;  1HZC A;  2Q2U A;  4GOP A;  5IYD G;  4MZ9 A;  1VQN A;  4IFD J;  4HJA A;  2ZTC A;  4B3T L;  1QVC A;  2QA4 A;  5M5Y H;  3CC4 A;  1N9W A;  1Y1W H;  2CFM A;  4DV7 Q;  4P72 A;  4DV4 L;  1VQM A;  3PO3 H;  1BBU A;  3NEL A;  2AMC B;  1EOV A;  4GNX A;  1YHA A;  3PO2 H;  5ELO A;  4HIM A;  4HJ8 A;  3K7A H;  2JA8 G;  1BKB A;  3PGZ A;  1UEB A;  1QVF A;  3J81 j;  3CCR A;  1XMO Q;  4LF4 Q;  4C3I H;  1TWF H;  4X6A H;  3PV0 A;  1CKN B;  3OTO L;  4LW1 A;  2EXD A;  4PZ8 A;  1UE1 A;  2BA0 A;  3F2C A;  2N78 A;  4O2D A;  3PUW A;  4RG1 A;  2CQO A;  1IBM L;  4A93 H;  1XMQ L;  3MEF A;  1IXR A;  2AKW B;  4LFC Q;  1K8A C;  4A3G H;  1PH2 A;  4JI2 L;  1SE8 A;  3CCJ A;  3ZJY C;  1KC8 C;  2CCZ A;  3H0G H;  1TWA H;  4X62 Q;  1K8G A;  4NXN Q;  3G71 A;  4JI5 L;  2YU9 H;  1CSP A;  2R7F A;  4DKA C;  2JA5 H;  3BZC A;  1PH8 A;  1V43 A;  3CAM A;  5AJ3 Q;  1VS0 A;  2R7Z H;  4JI1 Q;  3HOY H;  3CME A;  1Y1V G;  3A0J A;  5M5X H;  1WFQ A;  1X54 A;  2K50 A;  5BR8 Q;  1MKH A;  4BXX G;  2CKZ B;  4DV6 Q;  1E7Z A;  2GN5 A;  4X65 Q;  4O0A A;  1KL9 A;  2MO0 A;  1WJJ A;  5GRO A;  1E1T A;  5C0X I;  1YIT A;  3KF6 A;  2PMZ E;  2HHH Q;  2Q2T A;  2UXD L;  4BY7 H;  2WB1 E;  1VQL A;  1N33 Q;  3NEN A;  3HFZ B;  3TEH B;  1VQE A;  2I5M X;  1YJ9 A;  1JJG A;  2BH2 A;  4TVA B;  1TXY A;  4NXM Q;  2ZM6 L;  2UUB Q;  1I94 L;  1E1O A;  1G29 1;  3EIV A;  4X66 L;  3U4Z A;  1N32 L;  3CCL A;  1IL2 A;  3CF5 A;  2QEX A;  1PVO A;  1AE3 A;  2ASB A;  3KFU A;  4J15 A;  3ULL A;  1SFO H;  1K9M C;  4LFA L;  2VQE Q;  1PA6 A;  1OXT A;  1P16 A;  4A3J G;  1Q46 A;  2ZJP A;  4LF6 Q;  1VQJ A;  2I5L X;  5JJL A;  1QUQ A;  2ZJQ A;  3HOV H;  4A3L G;  4A3I H;  1XNR Q;  4AQY L;  4P75 A;  4YHH Q;  4B3S L;  5FLM G;  4X64 L;  4IFD I;  4JYA Q;  1VQI A;  4B3R L;  2WP8 J;  4QJF A;  5C0X G;  2JA6 H;  5C3E G;  1JT8 A;  3F2B A;  4DR5 L;  1X9N A;  1NBW A;  1HNX Q;  3TS0 A;  4DV2 L;  1HNW L;  5C44 G;  3KLW A;  2WFW A;  2HQL A;  2PQA B;  2GVB A;  4JI3 Q;  2NZO A;  4JI4 L;  3AFP A;  2UUA Q;  2R92 G;  2OTL A;  1A62 A;  1BVS A;  2YV5 A;  3RLO A;  4HJ5 A;  4UP9 A;  1VQK A;  1FJG Q;  4R4T A;  1LTL A;  1SRO A;  1E24 A;  1Y1W G;  1ASY A;  2IHE A;  1PH6 A;  1NTG A;  3KDF A;  4P71 A;  4DAY B;  5IT9 c;  3PO3 G;  3S17 H;  3ERS X;  1V1Q A;  2Y0S E;  3G4S A;  2N8N A;  3PO2 G;  3B6Y A;  4LUV A;  4DR7 L;  4LF4 L;  4A75 A;  4LF9 Q;  3HOZ H;  2UXB L;  2UXC Q;  1L1O B;  4FDB A;  5EAY A;  1XNQ Q;  1VQ4 A;  3CPF A;  4UP7 A;  4IFD G;  5IWA L;  4GLX A;  3T1H Q;  3UE0 A;  3E9H A;  5HY6 A;  1YHQ A;  3CC2 A;  5LMN Q;  1EQQ A;  1Y14 B;  1S3O A;  1CKO A;  4A93 G;  2B3G A;  2ALY B;  4LFC L;  1ASZ A;  3I55 A;  1G6P A;  4LFB L;  2Q2H A;  1AE2 A;  4PG3 A;  4DR1 Q;  3I4O A;  1PH7 A;  4A3G G;  1VQ5 A;  1KRS A;  1CSQ A;  3CCE A;  4OO1 G;  4KLK A;  4DV0 L;  4DV5 Q;  2UUC Q;  3K81 C;  3ER0 A;  5M3F H;  4X62 L;  1Q1B A;  1EUJ A;  3H0G G;  1I3Q H;  4JG2 A;  3E9I A;  1GD7 A;  1Z9F A;  5AJ3 L;  2VW9 A;  1N34 Q;  2JA5 G;  4JI1 L;  4JI0 L;  3S1N H;  2KCT A;  1AH9 A;  3I4N G;  4R4Q A;  3HOY G;  2R7Z G;  1KIX A;  1YBY A;  1JMC A;  1LM0 A;  4JC0 A;  3RLF A;  1JJC B;  3M9B A;  3PIP A;  4DV6 L;  3I2Z A;  1XPU A;  1O7I A;  5K36 G;  4Y52 H;  1VQD A;  4JI8 L;  4A3L H;  4DR3 L;  1RIP A;  1CUK A;  4LNQ A;  4L5T A;  4JI6 Q;  1VQC A;  3H3V H;  5IYB H;  4DV1 Q;  2UU9 Q;  4BY7 G;  2AHO B;  5LMU Q;  4GKK Q;  2OWO A;  1K83 H;  4NXM L;  2VQF L;  4JV5 Q;  1YJN A;  1FGU A;  1VCI A;  4AYB G;  2JEA I;  1XTD A;  1OTC A;  1EIF A;  5H1S E;  1VQP A;  3GTQ H;  5HGQ A;  2EIF A;  1VQG A;  1L1O C;  1JB7 A;  2JEB I;  1PV4 A;  1P8L A;  1X3F A;  3UE1 A;  3UDG A;  4GKJ Q;  1Q7Y C;  2H5X A;  2CWP A;  2A1A A;  1PH1 A;  5JEA G;  3HOW H;  4A3I G;  3HOV G;  3I4M H;  2E5L Q;  2Z0S A;  3NEM A;  1NJI C;  3A5U A;  2JA6 G;  2LXJ A;  3MXN B;  3T1Y L;  1FL0 A;  2VS1 A;  3PUY A;  1HNX L;  3AEV A;  1X56 A;  3I7F A;  1XPR A;  4LF5 Q;  2UUA L;  2HIV A;  4A3M H;  1Q1E A;  1HR0 W;  1NMG A;  3PIO A;  5FJ8 H;  5IP9 H;  2R93 H;  4DR4 L;  3J80 i;  1VQ7 A;  2XTI A;  4YWK A;  4KHZ A;  3CW2 C;  2YTY A;  3OYY A;  2NVT H;  2K5V A;  4KHP L;  3U58 A;  1VQA A;  1GO3 E;  1K3R A;  2K5H A;  1X55 A;  2VL6 A;  2ZTD A;  3CP0 A;  1XNQ L;  3HOZ G;  1J5E Q;  1L0W A;  2Q2I A;  3I4N H;  2Z6K C;  5IP7 H;  1IZ6 A;  1X6O A;  3Q8D A;  1UE5 A;  1KAW A;  1NMF A;  4POG A;  4IOC A;  1SRU A;  2C35 B;  1HR0 L;  3S1R H;  4OX9 Q;  1N8R C;  1A63 A;  4DK3 C;  3SGI A;  3UDX A;  1D7Q A;  4OON A;  4Y7N H;  4DUY L;  4L5S A;  3CQZ H;  4YY3 L;  4DR1 L;  3H3V I;  1PH4 A;  3EN2 A;  1PFS A;  4JI7 Q;  1IBK L;  1CKM A;  4LF8 L;  1H95 A;  4TQU S;  3W1B A;  4A76 A;  5M3F G;  1A0I A;  1SMX A;  5JEA J;  3A74 A;  3PSI A;  3K8A A;  4IPH A;  3TQY A;  1B8A A;  2R7D A;  1IBL L;  4WJ4 A;  3GTM H;  3KYH C;  3PF5 A;  1HNZ L;  4DR6 L;  1WCM H;  3RZD H;  1PH5 A;  3CCQ A;  5E7N A;  4HID A;  3FHW A;  5GAD C;  3RNU A;  4LF7 L;  3U4V A;  1IYJ B;  3GDE A;  4JI6 L;  3UDF A;  4GKK L;  4DV1 L;  5LMU L;  4DUZ L;  4K0K L;  1UWV A;  2MO1 A;  5IYB G;  1VQ9 A;  4YCW A;  1N36 L;  3S14 H;  2K52 A;  2YTV A;  2KEN A;  3GTJ H;  1NY4 A;  3WWV A;  3S2D H;  1C9O A;  1C0A A;  4OXP A;  2MQH A;  1CKN A;  2F52 A;  5FLX c;  2F4V Q;  4OO1 I;  1T9H A;  2VZA A;  3KF6 B;  4R4C A;  3CCS A;  1KXL A;  4DV7 L;  1YZ6 A;  2E2I H;  4ALP A;  4GKJ L;  4B3T Q;  5DLQ E;  3PCO B;  4PZ7 A;  1OXS C;  4EX5 A;  4POF A;  3J7A 5;  3HOW G;  4GN3 B;  4LWC A;  4DV4 Q;  3ULP A;  2I0Q A;  4GN4 B;  3I4M G;  4JOI C;  1A8V A;  1XMO L;  3F1Z A;  5J3B A;  4BBS H;  1E22 A;  1M1K C;  4HJ7 A;  1QZH A;  3RLN A;  1PH3 A;  2EQS A;  3ULJ A;  1HZB A;  4GOP B;  3S1Q H;  4A3C H;  4OWW B;  3OTO Q;  1Z47 A;  2RHQ B;  4A3M G;  3BJU A;  2DGY A;  5FJ8 G;  3STB C;  4LUZ A;  5IP9 G;  1WOC A;  4A3F H;  1QZG A;  1IBM Q;  2R93 G;  2D0P A;  1XMQ Q;  1L2F A;  4GNX B;  3M4Q A;  1SR3 A;  5IYC H;  3JAM i;  3KF8 B;  3AYH B;  2NVY H;  3W1G A;  3VDY A;  1U5K A;  4JI2 Q;  4NXN L;  4A4I A;  3GTL H;  1HZA A;  3M85 A;  2B63 H;  3CCU A;  1U0L A;  2JA7 H;  3ICE A;  4JI5 Q;  4A3D H;  4IOA A;  4JCV E;  5IP7 G;  1RL2 A;  3CPW A;  1NE3 A;  1MIU A;  3F8T A;  2A8V A;  5BR8 L;  3J81 c;  3KJP A;  4MNO A;  4X65 L;  1KD1 C;  2HIX A;  1GKH A;  2HHH L;  3PUX A;  1Q86 C;  1W3S A;  2LXK A;  3HOX H;  1N33 L;  2NVX H;  4QGU A;  2K4K A;  4OWT B;  2IHF A;  1G51 A;  1EIY B;  2UXD Q;  1GM5 A;  3RR5 A;  4QY7 A;  3J81 i;  3HOU H;  2ES2 A;  2UUB L;  3CD6 A;  4C2M H;  2ATW A;  2NVQ H;  1MJC A;  1LYL A;  5GAE C;  1XJV A;  1MJE A;  2VNU D;  4IO9 A;  2ZM6 Q;  2GVA A;  1I94 Q;  1I5F A;  2AWN A;  3RZO H;  4L5Q A;  4PMW A;  2PI2 A;  1WCM G;  2VQE L;  3RN2 A;  4LF6 L;  1BBW A;  2N49 A;  1EYG A;  1VQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...