3S15H

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s15H00
1T9HA 4XIGS 3TS0A 1QZGA 2WB1G 2IHFA 3CPWA 4NPSA 4OXPA 1XPRA 1C9OA 3GTGH 1YIJA 3OTOQ 5M3MH 3K7UC 1WOCA 3S1QH 1VQ7A 3HOWG 3ER0A 2K50A 4H02A 2ZTCA 4IPCA 5IYCH 1VQGA 3EN2A 4ALPA 2B63G 5C0XG 5C3EH 1KAWA 4P74A 2MO1A 1IBLQ 2E5LQ 1VQJA 1P16A 1A62A 2K75A 4C3IH 2A1AA 2F52A 1FJGQ 1IL2A 4JYAQ 3CCEA 4YCUA 4JOIC 4DNIA 1L0WA 1SRUA 4X6AH 1IZ6A 1KXLA 1UWVA 2VW9A 1NMFA 2L15A 1GD7A 3AFPA 4QY7A 4LFAQ 4YWMA 3F2BA 1HNWQ 3HOVG 2DUDA 4GLXA 3CCRA 4LF7Q 5FLMG 1XNQQ 1WCMG 2D0PA 4UP8A 1FJGL 2MFIA 4JYAL 4JBMA 4L5QA 4DAYB 4A3KH 2NN6I 1GM5A 1KC8C 3K0XA 5FLXc 4LFAL 2R7ZG 4OO1G 2PNHA 3STBD 5FLMH 4JI8Q 3J81j 1HNWL 3PUXA 4X66Q 4DR5Q 4LF7L 1S3OA 1N8RC 1XNQL 2N78A 1N34Q 1H95A 3GTMH 4A3MG 4POFA 3M85A 5C0XJ 4A3EH 4A3LH 2WP8J 2UUAQ 5LMUQ 2HHHQ 4X62Q 1XMOL 1HH2P 4A3FG 2VQEQ 3J80i 3HOZH 1VQEA 5JJKA 4JI8L 3PV0A 1W3SA 1U5KA 4OWTB 4DR5L 3LGJA 2PQAB 1K8GA 1UE7A 1E1OA 1WFQA 3FKIH 1Q1BA 2WB1E 3PUYA 3HOYG 1TWHH 4UP9A 1N34L 2BA1A 3UE0A 1YJWA 3HOUH 1LM0A 4A3FH 1YEZA 2UUAL 2HHHL 4X62L 1X6OA 3KYHC 4IJLA 4HIDA 3K81C 4IOAA 3PO2H 2VQEL 1CKMA 4JI2L 1XTDA 3MXNB 3JAMi 3J81c 3NELA 4AH6A 4GN5A 4MNOA 1KL9A 1AE3A 1PFSA 3GO5A 2A8VA 4R1JA 1RL2A 1GO3E 2PQAA 4R4TA 3RLNA 4QQBX 4KLKA 4JI0Q 3JC66 1QVCA 1PH3A 1X65A 2JA7H 2IX1A 4GNXC 1YJNA 3K7AH 5HGQA 1W2BA 1HR0Q 2JEBI 1E3PA 1A8VA 1MJCA 1N33Q 1A63A 1VQCA 4GOPC 1HZBA 1B7YB 1MKHA 2VY3A 2YTXA 1QVGA 1UE1A 1NE3A 1S72A 5LMNQ 1WJJA 2BH2A 1OTCA 4JI0L 2K5VA 3TQYA 2UXCQ 4P71A 3E9HA 3H3VH 3AYHB 5C44H 3A5UA 4KHZA 5BR8Q 1HR0L 1B70B 1SROA 2ZTEA 1VQPA 3HKSA 1N33L 3PF4A 1YHAA 1M1KC 2E2JH 4BBRH 4BY7G 2JJQA 1EIFA 1NY4A 1X3EA 1O7IA 2OCEA 4B3MQ 3W1BA 5IWAQ 5LMNL 4JI4Q 4A3DH 3STBC 4YHHQ 4LFBL 3KF6B 2B29A 5EAYA 1Q1EA 5ELNA 4DUZQ 1PH6A 2UXCL 1IYJB 3I7FA 5BR8L 1C0AA 2D0OA 4ME3A 2N3SA 3GTKH 5C4XH 4DV0L 2ALYB 4DAMA 2BA0A 2Q2UA 5J3BA 4JI7Q 4B3RQ 3S17H 4DK6C 2NVTH 2NZOA 2E8GA 2EIFA 1CUKA 3H0GG 3UE1A 2CQOA 5AJ3Q 5IWAL 2K4KA 3G6EA 1Q81C 1TXYA 1I3QH 1VQHA 4YHHL 4JI4L 4DUZL 3KDFB 4B3ML 4EX5A 4WJ3M 3OW2A 4JC0A 4PMWA 2AWOA 2R92G 5JJIA 2HQLA 1PH2A 4Y7NH 2K52A 4A3BG 4JI3Q 5IE8A 4JI7L 5IT9c 4B3RL 3W1GA 1HZ9A 1IBKL 4LF4Q 5GADC 5AJ3L 1I6HH 3RR5A 3G48A 4DV7Q 4LW1A 1PA6A 1K9MC 4IOCA 5M5YH 1VQMA 1OXSC 2ZM6Q 1UE6A 2I5LX 3AFQA 2V1CC 4A3IH 4JI3L 1Q82C 3GDEA 2JA6G 4QL5A 4C3HH 1SN8A 1EFWA 5IP7H 4B3TQ 1L2FA 2Z0SA 1OXVA 4JOIA 4DV7L 3CCJA 4APVA 3M4QA 2CWPA 4HIKA 3PF5A 4NXNQ 2HT1A 2LSSA 3M9BA 2ZM6L 2HIVA 2QEXA 1PH8A 1PV4A 1YI2A 4DR2Q 1PH5A 5IP7G 3HOWH 2ZJRA 4GLAC 1C7YA 4RG1A 1N9WA 1E24A 4YCWA 1CKNB 2B63H 3OYYA 1GKHA 1FL0A 3PIOA 4B3TL 4NXNL 4X65L 2WAQG 2XGTA 3S15H 1VQFA 2JA8G 3CCVA 4KHPQ 1PYSB 3RLOA 1EQQA 1K8AC 4UY8C 4DR2L 1PVOA 1L1OB 2VUMG 1XNRQ 1U0LA 2GVBA 3BZKA 4JI5Q 1XMOQ 4KI0A 3E9IA 3KJPA 1CKOA 4DV1Q 2R93G 1V9PA 3HOVH 3TEHB 4BY1G 1VQBA 4KHPL 1X54A 3GTLH 5JEAG 1WCMH 2JK8A 2VQFQ 1M90C 4IFDG 2VUMH 1HZCA 2OQ0A 1K83H 1WYDA 3D31A 4PZ8A 3T1HQ 4NXMQ 2ES2A 2E2IH 3RN2A 1XNRL 3L0OA 1MIUA 4JBWA 4PZ6A 3L7ZC 2YYZA 1X56A 4JI5L 5M5XH 4GNXB 1JB7A 2R7ZH 4A3LG 1KHIA 4DV1L 3J7A5 3HKZG 4JI2Q 2QGQA 2KCMA 3FP9A 3RLFA 2JE6I 4BA1I 4GOPB 4A3CG 2IX0A 2VQFL 3T1HL 2AMCB 2Q2IA 4NXML 5C0XI 4A3MH 3ULJA 4UPAA 4DR4Q 1L1OC 2KHJA 2ZTDA 2IHEA 2CKZB 1OXUA 5ELOA 2KCTA 3UDIA 2UUBQ 3KLWA 2YU9H 3GTPH 1E1TA 4LF5Q 3PO3G 1NMGA 3I4OA 5GAEC 2ATWA 5H1SE 4BA2I 4GKKQ 3TS2A 4GNXA 1X3FA 1K73C 1QUQB 4AQYQ 1BKBA 1SE8A 4HJ9A 3A74A 3S1RH 3HOYH 3CPFA 4IJHA 1IBMQ 4GOPA 4DR4L 3K8AA 4A75A 4BXXG 5GAGC 3KOJA 3U4VA 2UUCL 2UUBL 1QVFA 3HOXG 5JEAJ 4LF5L 4IFDJ 3I4MG 4HIMA 4GKJQ 5GQOA 4GKKL 4WJ4A 4DV6L 1G291 4AQYL 2PI2A 2WAQE 5E7NA 1IBML 4LF6Q 2RHQB 4O2DA 4OO1I 1VQKA 2QA4A 1B8AA 2K5NA 1JJCB 4A3JG 1VQLA 3RZOH 4TVAB 1VQ4A 3S14H 1AE2A 1J5EQ 4LFBQ 4AYBG 2F4VQ 2OWOA 2WFWA 5IYBG 2GVAA 4GKJL 1X55A 5FJ8G 1V43A 3HFZB 2NZHA 4DV0Q 5GAHC 1VS0A 2BH8A 2KHIA 4GN4B 3PCOB 5M5WH 2JQOA 1EUJA 4B3SL 5DLQE 3CXCA 2GN5A 4JI1Q 4LF6L 2F3IA 2CWAA 2MO0A 5IP9G 1J5EL 2I0QA 1NJIC 2F4VL 3AQQA 4R4IA 4A76A 3J80c 2K5HA 4DR7Q 2Z6KC 1V1QA 4PZ7A 1YBYA 4BY7H 3CCUA 2N8NA 3I56A 3RN5A 1VQIA 4JV5Q 4A4IA 3HKZE 1IBKQ 2LXKA 1K0RA 2AHOB 3GD7A 4QIWE 4JI1L 4DKAC 4HIOA 1VCIA 4P73A 4A93G 2RCNA 1YVCA 3UDFA 2A19A 4DR7L 5IYDG 4L5TA 3KF6A 3JAMc 4C2MH 3H15A 3F1ZA 1VQ5A 4OWWB 2PI2E 1Y1WG 4JV5L 1NBWA 1E22A 5M3FG 3H0GH 3H3VI 4C3JH 1HJPA 1VQDA 1N36L 4HJ7A 4Y52H 2R7DA 1YHQA 4L5RC 2IY5B 1SR3A 2OTLA 4A3GG 4HJAA 4JBJA 1I94Q 1HNZL 2R92H 2YV5A 2VS1A 4JG2A 2KBNA 4A3BH 5JJLA 1VQ9A 1Q12A 3KDFA 3EIVA 4DV5Q 3PGZA 4BBSG 1XPUA 3KFUA 1Y1VG 3SGIA 1K3RA 4O0AA 4MTNA 4JBKA 1JJGA 4A3GH 1OXXK 3U4ZA 2R7FA 4R4QA 1AH9A 4TQUS 2NN6G 4X65Q 3S16H 2CCZA 2Q2HA 3U50C 1I94L 5M3MG 4AYBE 4JI6Q 4BBSH 1I5FA 3CC7A 4LF9Q 2JA6H 5HY6A 3TRZA 1Q8KA 4DV5L 4LUVA 5IYCG 2Q2TA 1GVPA 2VNUD 3CC4A 3ZJYC 4DR3Q 1VQ6A 5C3EG 3ULPA 3T1YL 1D7QA 4UP7A 1EWIA 1BBWA 3MEFA 1QZHA 1BBUA 1A0IA 3WWVA 1SMXA 1YITA 3S1NH 2AKWB 2UU9L 4JI6L 4IO9A 1EQRA 4LF9L 3AEVA 1HR0W 3UDGA 3ERSX 2XTIA 4LNQA 4DR3L 2N49A 1ASZA 3PUWA 3RNUA 3J81i 1ASYA 2JA8H 3S1MH 1CKNA 3CCSA 3IRBA 4OWXB 4YY3Q 4AIMA 3OTOL 1PH9A 1HZAA 5LMNW 1RIPA 2DGYA 4DUYQ 1UEBA 3M3YH 2UXBQ 3A5ZB 2R6GA 1R9TH 1PH1A 1KRTA 1JE5A 4A3KG 4DV2Q 4YWLA 1L1OA 2R93H 1IBLL 1HNXQ 3A0JA 2E5LL 1NTGA 4BY1H 3S2HH 2E2HH 4HJ8A 1LTLA 3U58A 1XJVA 4YY3L 3M4OH 3K80C 3GTJH 4DUYL 2PMZE 3CMAA 4LF8Q 2UXBL 3F2DA 4XTCS 2I5MX 4DV4Q 4P72A 4GLVB 2YTYA 1LUZA 4A3EG 1BVSA 1KRSA 3UDXA 1KIXA 2UUCQ 4DV2L 2VZAA 1Z9FA 1FGUA 1TWFH 4YWKA 1HNXL 3HOZG 1G51A 4IPHA 3BU2A 3S2DH 4A3CH 4EQ5A 4DV6Q 3CD6A 1IXRA 4POGA 3CW2C 4K0KQ 3FKIG 4GN3B 4MZ9A 1Q46A 4LF8L 3PSIA 4DV4L 4DV3Q 3HOUG 2I5HA 2ASBA 3PO3H 3ULLA 3NBHB 3I55A 3G71A 1PH7A 1OXTA 1CSQA 3PO2G 1YNXA 4X66L 1UE5A 3PUVA 4DPGA 3VDYA 1E7ZA 2RHSB 4JCVE 3PUZA 5C4JH 1KQSA 1N32Q 2B3GA 3CCQA 3I2ZA 3PIPA 4K0KL 3F8TA 2Y0SG 4BXXH 5IY0A 1EIYB 5LMUL 4DV3L 1QUQA 4B3SQ 3S24A 3HOXH 1PH4A 2JA7G 4IFDI 3CCLA 1Q86C 1PHJA 3I4MH 1XPOA 3W5OA 1PYBA 2D62A 2K14A 2OTJA 1WI5A 2JA5G 1N32L 3KJOA 2JEAI 2KENA 4FDBA 2NVXH 2CFMA 4X64Q 2Z6KA 3NENA 2ZJPA 4A3JH 1MJEA 3CAMA 4LWCA 3EBEA 3J7ZC 2HIXA 5IYBH 5GROA 5C44G 5K36G 2JA5H 4LFCQ 5FJ8H 4OX9Q 1YZ6A 4PG3A 4LF4L 3CF5A 3DM3A 3B6YA 4BBRG 4DR6Q 4X64L 2NVQH 1DGSA 4A3DG 4LUOA 1VQOA 5IP9H 2RF4A 3CMEA 4QJFA 2JA9A 4GS3A 4J15A 2C35B 2FXQA 1TWCH 3CQZH 4LFCL 1YHBA 1TWAH 3KF8B 4R4CA 1HNZQ 5C4XG 1Y14B 4P75A 1YJ9A 3BZCA 1KD1C 4IPGA 2IT1A 4OX9L 1JT8A 1P8LA 4DR6L 4DK3C 4HJ5A 3DLLA 1D8LA 2MQHA 1JJ2A 1X9NA 3GTOH 2OQKA 3I4NG 3FHWA 3L2PA 2AWNA 3D0FA 1JMCA 4A93H 3BJUA 4QGUA 3RZDH 3GTQH 2H5XA 3CC2A 2ZJQA 1LYLA 4IPDA 2LXJA 5IYDH 4OONA 3CP0A 1VQNA 4RMFA 2VL6A 4DR1Q 3M7NA 2EQSA 1Y1WH 3F2CA 1EYGA 5M3FH 3E0EA 1XMQQ 3I4NH 1I50H 1VQ8A 2UXDQ 4R4OA 4NB3A 1EOVA 1VQAA 1N36Q 1J6QA 2Y0SE 3T1YQ 1SFOH 4L5SA 1G6PA 3TREA 3G4SA 1SLJA 1FVIA 1S40A 3M4PA 1CSPA 1X3GA 2MNAA 2NVYH 2UU9Q 4DR1L 2EXDA 1Z47A 3ICEA 2YTVA 3NEMA 4A3IG 1TWGH 4LUZA 1XMQL 1Q7YC 2UXDL 1Y1VH 3Q8DA 2ID0A 4YCVA 3CCMA
chains in the Genus database with same CATH superfamily
2IHFA 3CPWA 4OXPA 4DU9A 4DF7A 4KY6A 3GTGH 1EQTA 5M3MH 1IKMA 1LTRD 1WOCA 1ZKOA 1BR9A 4H02A 1VQ7A 1SMYD 2ZTCA 3LWUA 1VQGA 3BVMA 2FMMA 1OO9B 4IZ8A 1KAWA 2MO1A 1B3QA 2E5LQ 4RGTA 2K75A 1MD2D 2RA4A 1IL2A 2Q8IB 3CCEA 2K03A 4YCUA 3TN2A 1IZ6A 1NMFA 4LFAQ 1QB5D 3AFPA 4R8IA 4ODGA 1FYCA 2JA8B 3CCRA 1WCMG 2D0PA 5EGTA 4L5QA 3MZ5A 2E2IB 1KC8C 2HCCA 4LFAL 1ENFA 5M5XB 3STBD 3S2HB 5FLMH 4DR5Q 2PCFB 2PZTA 1N34Q 3C2PA 4ZRZA 4POFA 2HDMA 2HHHQ 1XMOL 1HH2P 3VA7A 3DUZA 1VQEA 4DXFA 3PV0A 4DR5L 4OWTB 2IPKD 4DNRB 1K8GA 3S2DB 3S1RB 4OELB 2WB1E 4DGZA 1N34L 3TZDA 1YJWA 3HOUH 3A8IE 4IUNA 1YEZA 2HHHL 1X6OA 4IJLA 1T5XD 3K81C 1PRTC 5DEHA 1JQYD 1CKMA 1NSNS 1XTDA 3JAMi 2F0FA 4GN5A 1PFSA 2IL8A 4R1JA 4WRDA 1JCKB 1RL2A 2TSSA 4JI0Q 2GA4B 3JC66 3MXGA 3RZOB 3K7AH 1E3PA 1A8VA 3TP6A 2E75C 1N33Q 3C3LA 3I3CA 1VQCA 5HGTA 2Z8LA 1B7YB 4S3SA 2VY3A 4FYDA 3D6WA 2BH2A 4JI0L 1C8CA 3EVQA 2UXCQ 1GJXA 5K36H 5C4ZA 2Z4HA 1SROA 2ZTEA 1ML0D 3HKSA 1BCPF 2HDLA 3CRKC 5C6AA 1N33L 2PPBC 4G4KA 1I4GA 5D65A 1ENAA 1F9PA 3EQLC 2B29A 2UXCL 4RCOA 3I7FA 1TWCB 2A69C 4ME3A 4LAAA 1TWAB 5C4XH 4QMGA 3BDOA 2XVSA 2Q2UA 3OIQA 2A73B 5J3BA 4C2MB 4MTKA 1XWEA 3G6EA 2K4KA 1TXYA 1VQHA 3P75A 4A93B 4CBVA 4EX5A 4WJ3M 4JC0A 2F0SA 4KKSA 1B4OA 5M3FB 1U4LA 3W1GA 1IBKL 1KLGD 1I6HH 3G48A 4DV7Q 2PYKA 2PMZB 5TSSA 1S5FD 4BBSB 3GDEA 4I7AA 2B2TA 3Q23A 1SN8A 4JOIA 1LABA 4DV7L 4HIKA 4APVA 3M4QA 3M9BA 3IL8A 3GTGB 4DR2Q 5EPKA 3HOWH 4GLAC 1D5MC 4YCWA 2NBFA 5I2YA 3I72A 1FL0A 2XGTA 2IW3A 3M7GA 1VQFA 2JA8G 4KN7C 4E6IA 1K8AC 4UY8C 4DR2L 3U9OA 3VR2A 4X3KA 2GVBA 3BZKA 4JI5Q 2B2WA 4I7ZC 3MEHA 1X54A 2JK8A 1SJED 2VUMH 1WYDA 1V1OA 1SE2A 3RN2A 1MIUA 4JI5L 1A2TA 1AZQA 4DAYA 3K0YA 2KJXA 2Z4IA 4PNYA 2EOTA 2QGQA 2IX0A 1QNUA 1JB3A 1QE6A 2A6HD 5FO8B 2IHEA 2CKZB 2VXWA 2KCTA 4LF5Q 1HTPA 2ATWA 1PTOH 3ERQA 2XWJB 1BKBA 3HOYH 2PNRC 3A74A 4K6DA 3CPFA 1XTCD 1RF2D 5DNFA 4BXXG 3HOUB 3C1EA 1II3A 1QVFA 4LF5L 2K7VA 4DA2A 3T53B 3I4MB 5NUCA 4DV6L 4Q5VA 5DM63 3MFGA 2QA4A 1VQLA 2RDFA 4LFBQ 1PFMA 1J5EQ 3K7AB 2OWOA 2GVAA 5AFWA 5FJ8G 2NZHA 1VS0A 2BH8A 1QWYA 2JQOA 3K59A 5DLQE 1HPCA 1K0SA 2CWAA 3D4WA 5IP9G 1J5EL 1TU2B 1CQFA 1M8AA 5I4DA 2K5HA 2F3WA 4K5VA 2G9HD 4PZ7A 2N8NA 3I56A 3RN5A 1VQIA 1G91A 3I90A 1UUPA 2AHOB 2AQ2B 2LXKA 4F8MA 4HIOA 1VCIA 4A93G 2RCNA 3KBXA 5KNDA 5IGCA 2DY7A 2LFNA 3I91A 5C4XB 2F0WA 4EQNA 4F7XA 3H15A 5M3FG 3H0GH 3I4NB 4C3JH 4G57A 3K58A 4HJ7A 5LL6X 2EY6A 4L5RC 2IY5B 3MC0B 1DONA 1DM0B 1A3TA 1VF7A 4M1UB 2PW5A 1TY0A 2R61A 4DV5Q 3PGZA 4BBSG 1ESFA 4DAVA 1TWGB 1MI2A 1Y1VB 2D9UA 4O0AA 2L1BA 4A3GH 4R4QA 4X65Q 2CCZA 2Q2HA 1STEA 3V2TA 5M3MG 2EZVA 4JI6Q 3TRZA 3CC7A 1Q8KA 4DV5L 3S1QB 2Q8RE 3EJIA 3CC4A 3NQTA 4DR3Q 2ICEC 1EYCA 4ULLA 3TP5A 3MEFA 5IGGA 1BBUA 1HA5A 3FRPB 1U4RA 4JI6L 3HOWB 1ILQA 4C1NI 1HR0W 3QIAA 4QUFA 3UDGA 3ERSX 1IW7D 4DR3L 1SE4A 1CKNA 2LY7A 1WTOA 3OTOL 1PH9A 4AIMA 5CC4A 1AP0A 1UEBA 2UXBQ 1R9TH 4FVMA 1KRTA 4DV2Q 1L1OA 2R93H 1IBLL 1HNXQ 3A0JA 3D3RA 4JK1C 4R9WA 4XDXA 3R3OA 5CV4A 3GTJH 4LF8Q 2UXBL 2YTYA 1KRSA 2DJGC 3UDXA 4DV2L 4M8AA 2VZAA 1HNXL 3HOZB 1JICA 2FHTA 4ZUIA 5ISRA 2L55A 1U4PA 4K0KQ 1SYGA 4WJWA 2B2WC 4LF8L 1Q46A 2Q8TA 4DV3Q 3HOUG 3D6CA 2ASBA 4A3FB 1M4VA 1OXTA 1YNXA 1Y69U 4H44C 1E7ZA 3VR3A 1WTWA 1KQSA 3HOYB 3PIPA 4K0KL 1G6ZA 1EQVA 5IY0A 5LMUL 4DV3L 1QUQA 2H1EA 4B3SQ 5I2XA 2AUJD 1PH4A 3CCLA 3ND9A 2ZXOA 2MUYA 3W5OA 4Z9CB 1ET6A 2EYPA 2ZJPA 3CAMA 1F2YA 4U673 1NUCA 1L0YB 1HHVA 5K36G 4OX9Q 4PG3A 3CF5A 3B6YA 3A8KE 5IT9L 1Q8IA 3CMEA 2FXQA 2EYFA 1H9JA 4N9PA 5C4XG 1YJ9A 4OX9L 4IPGA 3C46A 2MQHA 1X9NA 3GTOH 3I4NG 2B2UA 5IIFA 2BCOA 4ABNA 2MPMA 4RA8A 4QGUA 3RZDH 3CC2A 1LYLA 5EKIA 2LXJA 1UNSA 3CP0A 1Y1WH 4Y7NB 3E0EA 1S5CD 3H0GB 4R4OA 4C3JB 3T16A 1CA5A 1CQVA 1FGBD 2Y0SE 1LTTD 1SFOH 4L5SA 3FVQA 1SLJA 1S40A 1CSPA 2HCIA 2MNAA 2NVYH 1Z47A 2YTVA 4RAUC 1SEBD 3NEMA 3DWPA 2DJFC 3Q8DA 4C3HB 4YCVA 1T9HA 1QZGA 3TS0A 5LL6S 4NP5A 1PRTD 3T13A 1EWHA 4O1NA 3HOWG 3D8GA 2K50A 2RSNA 4IPCA 5IYCH 3TP7A 3EN2A 1EOTA 3VYRA 5I9OA 1AZPA 1BQQT 1P16A 1A62A 4C3IH 2A1AA 1U9RA 2F52A 1FJGQ 4JYAQ 1GUNA 1ZXTA 5KYIA 4IURA 1KXLA 3A55A 1UWVA 4X3SA 2L15A 1GD7A 1SYCA 3F2BA 2DUDA 2F0IA 3EA6A 4KD3A 2CHBD 3GTLB 1WCMB 1FJGL 4LMQD 1WD0A 4JYAL 4JBMA 2L5TA 3KUPA 4DAYB 1GXDC 4IUUA 4HMJA 4A3KH 3V96A 5FLXc 3I73A 2R93B 2NB0A 5EKKA 3J81j 4X66Q 3KK7A 2F1MA 3MVVA 2A69D 3GTJB 2B39A 5FLXE 5FO9B 3GTMH 4A3EH 1C4QA 2F3VA 3L9AX 2NTSA 4NDXA 1D1IA 2G5DA 5C5MA 4KMUC 4G7HC 4X62Q 4A3FG 2PQEA 3ND8A 1W3SA 1X32A 2EPBA 3AMUA 2PQAB 1UE7A 3HOYG 1TWHH 4UP9A 1HFNA 1LM0A 1SE3A 2KA7A 3NBIA 4X62L 1CZWA 3KYHC 1E0BA 3PO2H 1SNMA 1G8ZD 4JI2L 3MXNB 1JR0D 3J81c 4BWGB 3MHBA 1KL9A 3GO5A 1EY8A 3RLNA 4CJ2C 1SNDA 1FD7D 5M9OA 3J81E 2JA7H 2K04A 2IX1A 1YJNA 5HGQA 1LTAD 1W2BA 4IN3A 3E0JA 5IGBA 2KOLA 5KIXA 1NE3A 1Z6HA 1S72A 5LMNQ 3OPOA 3PIP3 3KLSX 2K5VA 2ZXPA 1VF5C 4P71A 3E9HA 3AYHB 5T1GA 1RHPA 1B70B 1YNNC 1DD2A 3PF4A 3IKJA 3Q0AA 1YHAA 3GQBA 1M1KC 4BBRH 2E2JH 2JJQA 3GV6A 1X3EA 1O7IA 4O42A 1WTXA 4B3MQ 4HCSA 5LMNL 4A3DH 1WTPA 4JI4Q 4NMZA 1SBBB 1IYJB 3I4LA 3LNNA 3GTKH 4HN7A 3A54A 5JAVA 4DV0L 2CQAA 4DAMA 1K8MA 4B3RQ 2NVTH 3K5OA 2E8GA 2EIFA 3H0GG 4B3ML 2CQOA 3GTOB 4C3JG 4JI4L 1VDZA 4ZKCB 3QG1A 3RZDB 1NR4A 4RCNA 2K5DA 2CVRA 3C1FA 2BDNA 1NNXA 1Y1WB 4B3RL 2EYMA 1QOHA 4LW1A 1K9MC 5E4WC 1OXSC 2ZXRA 1HFGA 2ZM6Q 1UE6A 3VYTA 2FMCA 4RWSC 2B2YC 3S16B 2Z6BA 5JPMC 4CKBA 4A3IH 1Q82C 4QL5A 1EFWA 1L2FA 2Z0SA 4NXNQ 1KABA 2LSSA 2ZM6L 2HIVA 1YI2A 5FK9C 3X3NA 2F0HA 1BUVT 1PH5A 2ZJRA 1N9WA 4L63B 1PFNA 1CKNB 1O7ZA 2B63H 1ICWA 2CH4A 5ELBA 4NXNL 1I4RA 3S15H 2XNAC 1DZ1A 1PYSB 3RLOA 4FXKC 4C3IB 4ZQ3A 3HZXA 1EQQA 1L1OB 1CFMA 1BCPC 2H4OA 4RHRA 1XMOQ 4KI0A 1CKOA 4DV1Q 1AW7A 1V9PA 4HAEA 3HOVH 5ELFA 2R93G 3TEHB 3SXHA 3Q22A 2E2HB 1SDFA 1K83H 3D31A 2JSOA 4A3KB 5G3LD 1TIID 1LO5D 4PZ6A 1VMPA 2R7ZH 3MWYW 2EYLA 4DV1L 1WTQA 2KCMA 1ET9A 3EROA 1B1ZA 1RTOA 4A3MH 3GTMB 4A3EB 5C4HA 1OXUA 3UDIA 4A3LH 4GNXA 1A6XA 1QUQB 4HJ9A 1FNUA 5COYA 1D5XC 4IJHA 1TWHB 4GOPA 3K8AA 3NP8A 5GAGC 3KOJA 2B2VA 2C9OA 2PO4A 3PO2B 4C1NK 1J9OA 4UHVA 4WJ4A 4MIUA 1D2BA 1G291 2NWGA 4LF6Q 1JJCB 2JA7B 1AE2A 2EDGA 3H6MA 4XYQA 4L6TB 1ONLA 5GAHC 2L9HA 1AN8A 3PCOB 4LF6L 3OW7A 3CXCA 2NVQB 1NJIC 4R4IA 4A76A 3J80c 3L3OC 2Z6KC 1V1QA 3WOFA 3CCUA 4BBRB 1H9MA 3K5MA 3A7LA 1D1KA 1IBKQ 3E3XA 1K0RA 3J80E 3GD7A 3UDFA 2O2LD 3GTKB 2FFKB 3KF6A 4OWWB 2K5WA 2PI2E 1Y1WG 1NBWA 2NVTB 2LKVA 5CORA 4Y52H 2R7DA 4CHTB 1SR3A 1XX8A 2OTLA 5K5PA 1K3BC 4HJAA 1FNVA 1Z7TA 1HNZL 2R92H 1SAPA 2YV5A 3LX0A 1K28A 4A3BH 5JJLA 1MHWC 1Q12A 3EIVA 3T56B 2JP1A 4XXEA 2A68C 3KFUA 1BCPB 3DXJC 1TS5A 2K5QA 3A7AB 3U50C 1PRTF 5M3MB 4LF9Q 1EY5A 2QKIC 5IYCG 4KJNA 2VNUD 1K8OA 3ULPA 1QZHA 1BBWA 5EBCA 2LS01 1A0IA 1RJTA 2KEEA 3WWVA 1YITA 3S1NH 3SDZA 2AKWB 4C3IG 2UU9L 1HA6A 2DN8A 4LF9L 2B8GA 2B63B 4N9TA 4LNQA 2O4XA 1CI3M 2N49A 3NK9A 3RNUA 3S1MH 3P1HA 2MGSA 2OF1A 1RODA 1RIPA 2EXZA 4XQQA 3M3YH 3A5ZB 3FPUB 2F0DA 1PH1A 5A35A 2IWHA 4A3KG 4YWLA 4CKCA 4TSSA 4KJOA 2WV6D 1SYDA 4BY1H 3J7AF 3M4OH 3K80C 1LT6D 2PMZE 3DMUA 4DV4Q 1BNZA 5IGFA 4A3EG 2E74C 2R7ZB 1TWFH 3NUCA 4UDUC 1G51A 2ZT9C 3BU2A 3NQIA 2QDLA 5ELCA 4DK1A 1I6VC 4DV6Q 4A3MB 2QDBA 4DV4L 4JPBW 2NYZD 3MAQA 2OXPA 1PH7A 1CSQA 3PO2G 5C4JH 3K57A 3A56A 1B3AA 3F8TA 2JYOA 1EIYB 1V1PA 4OGQC 3NPPA 3S24A 3HOXH 2JA7G 3DHQA 2OTJA 3BVGA 1WI5A 4TRDA 4FDBA 2NVXH 2CFMA 4X64Q 1LT5D 3NENA 3OMCA 5EBDA 3EBEA 5IYBH 2JA5H 3DEOA 3SVMA 1PTOC 5CYUA 5I6WA 1YZ6A 1YNJC 5I9PA 4DR6Q 4BBRG 4X64L 2D5DA 4A3DG 1O78A 4LUOA 2RF4A 1MBYA 3OHXC 4QB4A 1AEXA 2JA9A 3CQZH 4RFBA 4P75A 3Q24A 4J8QA 1X3QA 2IT1A 1MGSA 1P8LA 4DR6L 4P2CB 1D8LA 4CKEA 4NKLA 1STYA 2OQKA 3MFYA 3FHWA 3L2PA 1RDPD 1BBXC 1NR2A 1WTHA 5EKLA 2PW7A 1LACA 3GTQH 4OONA 3NTKA 4RMFA 2CW0C 2EQSA 2QF7A 1EYGA 5L37A 3KF8A 3TMEA 1I50H 2RDHA 4NB3A 1EOVA 1WD1A 1VQAA 1I6HB 3N6RA 3K5NA 1B9MA 3URYA 4FF3A 4HEDA 3HGBA 4A3BB 1STNA 4IUTA 4A3IG 4LK1C 3SK8A 3CCMA 3D4DA 1QJOA 2P5ZX 4XIGS 2NN6H 1STGA 4NPSA 2E76C 3QOJA 5C3XA 1YIJA 3OTOQ 1DCZA 4FF4A 5CV9A 3NHHA 3K7UC 3ER0A 5EPLA 1O80A 1GUWA 2B63G 1F9SA 5C3EH 1IBLQ 1EZ8A 2JN4A 2B2TC 4JOIC 4K2LA 1L0WA 1SYBA 4X6AH 2XSCA 4QY7A 4YWMA 1HNWQ 3HOVG 4LF7Q 5FLMG 1Q90A 3M3YB 2MFIA 2VUMB 4EVOA 2F0JA 2NN6I 4EQOA 1GM5A 3K0XA 5G3LF 2PZWA 5IGEA 2R7ZG 3RMHA 4B08A 1FNWA 3GP7A 4KKUA 1HNWL 3PUXA 4LF7L 3M4OB 1N8RC 4PMBA 1DYQA 1H9SA 1H95A 4A3MG 3M85A 1L0XB 5C0XJ 2WP8J 5LMUQ 1B44D 2L12A 1HXYD 2RSOA 2O5JC 1PTOB 1U5KA 4QIWB 3LGJA 2M9VA 3FKIH 1MSHA 1Q1BA 1S5BD 1JOOA 3UE0A 1S4ZA 3BVZA 1PDQA 3NELA 4AH6A 3NBHA 4MNOA 3FPPA 1AE3A 1HQMC 3IAYA 2QW7A 1GO3E 1HQRD 5LHY1 1G2TA 4QQBX 4KLKA 1X65A 2ICIA 3HOXB 1QG7A 1IYVA 2JEBI 1A63A 1GHKA 1MKHA 4I65A 2OEOA 2YTXA 3VR5A 1WJJA 1QCBD 1STBA 3TQYA 1CK1A 4AYBB 3H3VH 5C44H 4XT1B 5BR8Q 1VQPA 1ILPA 3KLRA 3TBIB 3BDCA 1SNCA 1UAPA 2BE5C 2FINB 4Q0FA 5IWAQ 3V05A 4FP5D 4YHHQ 3KF6B 2X6LA 1PH6A 1C0AA 5BR8L 1ZYRC 2D0OA 3IFTA 2N3SA 3WOEA 3CQZB 2ALYB 4DK6C 2NZOA 4KTAA 1CUKA 1TS2A 2TMPA 5AJ3Q 5IWAL 1WVLA 3VR4A 4YHHL 4IQZA 3BDLA 5CMDA 2F4IA 2M2LA 2KUMA 4X3TA 2R92G 2F0MA 2K52A 4A3BG 3D4RA 4JI3Q 5IE8A 1EY7A 5IT9c 1I50B 1HZ9A 4LF4Q 5GADC 5AJ3L 5ELDA 4FXGC 3RR5A 3NTIA 1VQMA 1SNOA 4A3GB 2F0UA 1LTGD 3AFQA 4G7OC 4JI3L 3CHBD 2PZUA 4LF4L 1Y8NB 2KCNA 4U68A 1OXVA 3PF5A 1T5EA 4HSVA 2RCFA 2QEXA 1PV4A 2K28A 4CDFC 2EJFC 1BO0A 5C0XH 3OYYA 1GUGA 5C3EB 5FLXL 2WAQG 4KHPQ 1B9NA 3NWTA 1HTLD 2RQXA 2VUMG 1XNRQ 2XN9C 1E2VA 3ONAB 1SNPA 1R9TB 1QILA 3KJPA 1Y8PB 3S9WA 4BY1G 1VQBA 4KHPL 4FNFA 2VQFQ 1M90C 5A2QE 2Z1CA 1EEID 1HZCA 4NXMQ 4PZ8A 1CHQD 2E2IH 3HEJA 1XNRL 3L0OA 4G7ZC 2KEDA 5M5XH 1X56A 4OO1H 2X6GA 2G9DA 1A3VA 1PMRA 3HKZG 4JI2Q 3FP9A 4BA1I 3J81L 2VQFL 4RHSA 1HUNA 3MA2B 3BYYB 2Q2IA 4NXML 5C0XI 3ULJA 4UPAA 4DR4Q 1L1OC 5D3IB 2K33A 5ELOA 1EIGA 3KLWA 1I4PA 2MHVA 3NWSA 1NMGA 3I4OA 4YIJA 5DM73 2WACA 4AQYQ 3S1RH 1SXTA 3FKIB 5KNCA 1IBMQ 4DR4L 2Z9HA 4NW2A 1WTVA 4ZLTF 3U4VA 2D2CC 2A68D 2UUCL 3E6ZX 3HOXG 5JEAJ 2J4XA 4IFDJ 3R93A 4HIMA 5GQOA 1JE4A 4XT3B 3BS1A 4ILWA 3TP8A 4AQYL 3X3MA 1U4MA 5E7NA 1IBML 4OO1I 2RHQB 1VQKA 1B8AA 1PYWD 3RZOH 4HCEA 1O7YA 1RKNA 4AYBG 1LT3D 2WFWA 5IYBG 2EVBA 3F2UA 4PV1C 1X55A 2MP1A 3HFZB 4DV0Q 1LTSD 3KBGA 5M5WH 1F2MA 2X69A 4KHVA 3RD4A 1S5ED 2F0EA 2F3IA 3DEPA 2MO0A 2I0QA 3TZUA 4DR7Q 5D14A 1TS4A 4K8IA 3H91A 1YBYA 4BY7H 1B2TA 2EE1A 1RTNA 3I70A 1DXMA 1EEFD 1BF4A 2RDGA 1NCVA 3MXPA 2A19A 4DR7L 3JAMc 2F0QA 4C2MH 1VQ5A 1EU4A 4J1MA 1E22A 4V190 1F9QA 5JVG3 1VQDA 2O5IC 1QNKA 3QB3A 3JAME 1YHQA 4A3GG 3OWEB 2BDOA 4OHJA 1SFOB 1I94Q 3KDFA 2KQ3A 2NVYB 2B2UC 4XQJA 3P7JA 2C5CA 3SGIA 1K3RA 4MTNA 1OXXK 4KY5A 5FO7B 2EYHA 2SOBA 2NN6G 5JPNC 1I94L 4K2KA 3DWAA 2F0PA 4BBSH 3SEBA 2JA6H 5HY6A 1GVPA 4TKOB 5DAUA 2WB1B 1I4XA 4MHEA 5C3EG 3ZYYX 3T1YL 2F0NA 2L4NA 4KN4C 3GV3A 4K14A 2A6EC 2HUGA 4IO9A 1CT1D 2NUCA 2HQEA 2XTIA 1F2LA 3J81i 1ASYA 3IRBA 4YY3Q 4MN3A 1HZAA 5LMNW 2DGYA 4QF4A 4DUYQ 1PTOD 1YNJD 2R6GA 1JE5A 1AFPA 4CDCC 1KDBA 1H9SB 1IKLA 2F0LA 2E5LL 3R8BA 2WINB 5JEAH 4IFDH 4HJ8A 1LTLA 3U58A 1XJVA 4YY3L 4DUYL 4GLVB 1LUZA 1Q3LA 1KIXA 4ZCKA 4FXDA 4RGOS 2WKDA 4YWKA 1MSGA 4IPHA 4A3CH 3EFXD 1IXRA 2NZ1D 3CW2C 4POGA 3FKIG 3KLSA 4MZ9A 2CW0D 3NTHA 2I5HA 2XRQD 3PO3H 3ULLA 3NBHB 1EZ6A 3SK5A 1UE5A 3PUVA 3VDYA 4JCVE 4R8NA 3H94A 3I2ZA 3ITPA 2RVLA 4J6HA 5KRUA 5D3DA 1EYAA 4QCLA 4IFDI 1TS3A 5CBAE 1Q86C 1PHJA 3I4MH 3SK6A 2M00A 1XPOA 2K14A 3J80L 4HSPA 5BN5A 2KENA 3KJOA 2JEAI 3E5SA 4H7BA 4A3JH 4LWCA 3N52A 5E3FA 4ZUJA 5C44G 5GROA 1F77A 5IGDA 3MTSA 4LFCQ 4K6LA 1O7LA 1A3UA 5BN4A 1BXTA 1EY4A 5M5WB 2E2JB 4CGYB 1DGSA 2JXMB 2V4DA 1IHZA 1VQOA 4A3DB 4LJZC 1CZGA 4QJFA 3QOLA 4GS3A 4J15A 1BDOA 1TY2A 3CRLC 4LFCL 1YHBA 1HNZQ 1KD1C 4BY7B 1JWMD 1JT8A 4HJ5A 3DLLA 1JJ2A 4ZKBB 2IX3A 1W6JA 2DNEA 3D0FA 1JMCA 5CGKA 3BJUA 1B53A 4RH6A 1J8IA 4WFN3 5IYDH 3BYTB 1VQNA 3VR6A 2VL6A 4DR1Q 1Y8OB 1ZEQX 2EYOA 1G2SA 5I6YA 3I4NH 1VQ8A 3BG3A 1HRJA 4DN4M 4H0LC 1KTKA 1G6PA 4FO2A 3TREA 3M4PA 2UU9Q 4DR1L 2EXDA 3ICEA 3PQIA 1TWGH 4A3IB 1Y1VH 5IODA 1CTMA 4V0BA 2ID0A 2DY8A 2WB1G 1XPRA 1I4HA 1C9OA 1TVXA 5FKAC 2JA6B 3S1QH 4L8JA 4FF1A 4CJ1B 4ALPA 5C0XG 5CV6A 2HD3A 4P74A 1VQJA 3S15B 1W6KA 4IUVA 4DNIA 1SRUA 2VW9A 3A8JE 2XWBB 4ID6A 5CV7A 4GLXA 3HOVB 5JJZA 2SNMA 1XNQQ 4UP8A 2K01A 4K5XA 1K83B 2BE5D 5EPJA 5F2DA 1PRTB 4ME5A 4KKTA 1CHPD 1EYDA 1DJRD 2PNHA 4OO1G 4JI8Q 3OIPA 1PZKD 1HUMA 1XXGA 1S3OA 1ZYRD 1XYIA 1XNQL 2N78A 1B50A 5EQ0A 2DNCA 3WDNA 5CV5A 1V8QA 2F03A 2UUAQ 2N88A 2ENBA 2VQEQ 3PMFA 3J80i 2KVMA 3HOZH 5JJKA 4JI8L 1E1OA 1LT4D 1WFQA 3PUYA 5JOBA 1KNEA 2BA1A 1EY0A 4A3FH 2UUAL 3PO3B 4IOAA 3R2TA 4HIDA 1DOKA 2AQ1B 2VQEL 3OWFA 2OT2A 3TSSA 3W2DA 2VB2X 1SMYC 2A8VA 4OL7A 1R4QB 1SJHD 1DOLA 2PQAA 3M4YA 4R4TA 5KGUA 1TQOA 1QVCA 1PH3A 4GNXC 1HR0Q 1I4QA 3O13A 1MJCA 4GOPC 1HZBA 1JORA 2MJ8A 3MXNA 1QVGA 1UE1A 2B2VC 3VA5A 3QO2A 3DWQA 1H9RA 1SYEA 4A3JB 1OTCA 2WKCA 3G7LA 2N55A 4KHZA 3A5UA 1HR0L 3G6JB 2SDFA 1JWUD 2F0OA 5KNBA 4BY7G 1EIFA 1NY4A 4DK0A 2OCEA 3W1BA 3STBC 4LFBL 5CV8A 5EAYA 5ELNA 1Q1EA 5BN3A 5J39A 4DUZQ 3SR1A 5KEEA 4DFAA 2QEJC 2BA0A 4JI7Q 2A74C 3S17H 4RGNA 1PZID 2KECA 2AQ3B 2F0KA 2F0TA 3UE1A 1Q81C 4B9XA 1I3QH 4H13C 1ENCA 4DUZL 3KDFB 3U9SA 3OW2A 4PMWA 5JJIA 2AWOA 1JC7A 2R92B 2HQLA 2KCCA 4N8FA 1PH2A 4Y7NH 1STAA 4JI7L 1EIHA 3QR8A 1PA6A 2RKSA 4IOCA 5M5YH 4IALA 2I5LX 1SYFA 2V1CC 1CA6A 4JW0A 1WTRA 1JWSD 5E4XA 2JA6G 4C3HH 3T51B 4EQPA 2SEBD 5IP7H 4B3TQ 3Q6SA 3CCJA 2HT1A 1BOSA 2CWPA 3QJYA 3SK4A 3HS0C 1D5ZC 1PH8A 4BS9A 3J7YW 3S1NB 4OEMB 1LTBD 1C7YA 4RG1A 3HRZC 1E24A 2AUKA 4CDDC 4B3TL 1GKHA 2XRSD 3PIOA 4X65L 4PMCA 2WAQB 3CCVA 3S1MB 3I8ZA 1YNND 5HURA 1PVOA 2IJ0A 1LLRD 2EJMA 1PTOF 1U0LA 1TKWB 3K5LA 3NXWA 3E9IA 2I07B 2A5HA 2SNSA 4IUPA 4BY1B 5JEAG 1D6EC 1WCMH 3GTLH 3J7AV 4IFDG 2OQ0A 3T1HQ 1E2ZA 4CJ0B 2ES2A 3SHLA 4F88A 4JBWA 3L7ZC 2YYZA 4GNXB 1JB7A 4A3LG 5EJWA 1KHIA 3J7A5 1SNQA 1GOZA 1TWFB 4DXGA 3HKZB 4ZYSA 3RLFA 2JE6I 1X3PA 4GOPB 4A3CG 3T1HL 2AMCB 2KHJA 5CBEE 2ZTDA 1HCZA 2YU9H 2UUBQ 3GTPH 3PO3G 1E1TA 5GAEC 2FJ2A 4BA2I 4EGVA 5H1SE 4GKKQ 3TS2A 2F0GA 1X3FA 1K73C 1SE8A 2L11A 5C4JB 1H9KA 3RUZA 4K5WA 4A75A 5C5LA 1PLFA 2R3ZA 4ZAIA 4HR7B 2UUBL 3OOCA 3I4MG 4GKJQ 4GKKL 1PZJD 4OIKA 4B9WA 1CM9A 2PI2A 2Y0SB 2WAQE 2NVXB 3P20A 4O2DA 3FDTA 2K5NA 4A3JG 3S14H 2KHSA 3OMGA 4TVAB 1VQ4A 2F4VQ 2CH4W 1ICFB 4GKJL 1LTID 2JA5B 2QCPX 1V43A 5ELEA 2KHIA 4GN4B 1EUJA 4B3SL 2A6ED 2GN5A 4JI1Q 4N8X1 4QUCA 1EFID 2F4VL 1BCPD 3AQQA 4FF2A 2J0TD 4OIJA 3CU7A 4JV5Q 1NAPA 1FR3A 4A4IA 3HKZE 4K8JA 1EY9A 4QIWE 4JI1L 5J1ZA 4DKAC 4P73A 1YVCA 2B8FA 3GTQB 5IYDG 4L5TA 3K6OA 1RCVD 2A6HC 3F1ZA 3VYSA 1GUTA 2B2YA 5CR3A 4JV5L 3S17B 3H3VI 1HJPA 1STHA 1I3QB 2LMCB 1GUOA 3H3VC 4JBJA 2VS1A 2XIWA 3HG9A 4KY7A 5IT9E 4JG2A 2KBNA 5FOBB 1VQ9A 1KNAA 1XPUA 4HTHA 1Y1VG 3FMCA 4JBKA 1JJGA 5M5YB 3FEWX 4X3UA 3U4ZA 2R7FA 3TDQA 1AH9A 4RGMA 4TQUS 3S16H 3AB9A 3QWNA 2K32A 4AYBE 1ESRA 1I5FA 3IFDA 2L0CA 4LUVA 2Q2TA 5A2QL 1C48A 3ZJYC 1VQ6A 1SSOA 1D7QA 4UP7A 3NE5B 1EWIA 1S5DD 2NTTA 4F87A 1SMXA 3LWEA 1GUSA 1EQRA 3AEVA 3W3AA 4IUQA 1EY6A 4WORA 1R4PB 1ASZA 2E2DC 3PUWA 5J22A 3AU7A 2JA8H 3NSWA 3CCSA 4OWXB 3DM1A 2WIIB 4GZYC 2RBMA 1A15A 1KDCA 4KK7A 3VYUA 5C3WA 3SE0A 1IL8A 1JOKA 3S2HH 1NTGA 2E2HH 2K6AA 3MXUA 3PIO3 1IYUA 3OSOA 3CMAA 3F2DA 4XTCS 2I5MX 4P72A 1PFBA 2EY5A 1EL0A 1BVSA 2UUCQ 1Z9FA 1FGUA 3HOZG 1E2WA 4DNTB 3S2DH 4EQ5A 1V1PB 3CD6A 5T1IA 4GN3B 5E1FA 3PSIA 1F9RA 1UEAB 4RKBA 5JVH3 2YU9B 3GTPB 3BZDB 3I55A 3G71A 4XQNA 4X66L 4DPGA 1KLUD 2RHSB 3PUZA 1N32Q 1GHJA 2B3GA 3CKIB 3CCQA 4BXXH 2Y0SG 4CDEC 4ZK9B 1VMCA 1EWCA 3UI2A 2VB3X 1EU3A 1PYBA 2D62A 4C56C 2JA5G 1N32L 2Z6KA 3H09A 4HMIA 1IW7C 1MJEA 1RD9D 4PQXA 3S14B 5IOCA 2I46A 4JVZA 3J7ZC 2K05A 2HIXA 2K1BA 5C44B 5FJ8H 2J7ZA 1KDAA 3JAML 5KYLA 3DM3A 3R2IA 1PXUA 4DAPA 1A2UA 2NVQH 1LV9A 4RKLA 5IP9H 1F2ZA 2EYJA 2C35B 1TWCH 4XYOA 4R4CA 1TWAH 3KF8B 2EY1A 1Y14B 3HP3A 3BZCA 4DK3C 2F0VA 1JOQA 2EY2A 2AWNA 4A93H 2H5XA 2ZJQA 4IPDA 1DOMA 1TR5A 3T4AC 3M7NA 3F2CA 4UAIA 5M3FH 1XMQQ 2UXDQ 2BOSA 2EJGC 1N36Q 1J6QA 2QILA 3T1YQ 3G4SA 1FVIA 1X3GA 1TT2A 1KAAA 4KD4A 4LUZA 1XMQL 1Q7YC 2UXDL 4KV6A 4C3HG 5IP7G 1N36L
chains in the Genus database with same CATH topology
1T9HA 4XIGS 3TS0A 1QZGA 2WB1G 2IHFA 3CPWA 4NPSA 4OXPA 1XPRA 1C9OA 3GTGH 1YIJA 3OTOQ 5M3MH 3K7UC 1WOCA 3S1QH 1VQ7A 3HOWG 3ER0A 2K50A 4H02A 2ZTCA 4IPCA 5IYCH 1VQGA 3EN2A 4ALPA 2B63G 5C0XG 5C3EH 1KAWA 4P74A 2MO1A 1IBLQ 2E5LQ 1VQJA 1P16A 1A62A 2K75A 4C3IH 2A1AA 2F52A 1FJGQ 1IL2A 4JYAQ 3CCEA 4YCUA 4JOIC 4DNIA 1L0WA 1SRUA 4X6AH 1IZ6A 1KXLA 1UWVA 2VW9A 1NMFA 2L15A 1GD7A 3AFPA 4QY7A 4LFAQ 4YWMA 3F2BA 1HNWQ 3HOVG 2DUDA 4GLXA 3CCRA 4LF7Q 5FLMG 1XNQQ 1WCMG 2D0PA 4UP8A 1FJGL 2MFIA 4JYAL 4JBMA 4L5QA 4DAYB 4A3KH 2NN6I 1GM5A 1KC8C 3K0XA 5FLXc 4LFAL 2R7ZG 4OO1G 2PNHA 3STBD 5FLMH 4JI8Q 3J81j 1HNWL 3PUXA 4X66Q 4DR5Q 4LF7L 1S3OA 1N8RC 1XNQL 2N78A 1N34Q 1H95A 3GTMH 4A3MG 4POFA 3M85A 5C0XJ 4A3EH 4A3LH 2WP8J 2UUAQ 5LMUQ 2HHHQ 4X62Q 1XMOL 1HH2P 4A3FG 2VQEQ 3J80i 3HOZH 1VQEA 5JJKA 4JI8L 3PV0A 1W3SA 1U5KA 4OWTB 4DR5L 3LGJA 2PQAB 1K8GA 1UE7A 1E1OA 1WFQA 3FKIH 1Q1BA 2WB1E 3PUYA 3HOYG 1TWHH 4UP9A 1N34L 2BA1A 3UE0A 1YJWA 3HOUH 1LM0A 4A3FH 1YEZA 2UUAL 2HHHL 4X62L 1X6OA 3KYHC 4IJLA 4HIDA 3K81C 4IOAA 3PO2H 2VQEL 1CKMA 4JI2L 1XTDA 3MXNB 3JAMi 3J81c 3NELA 4AH6A 4GN5A 4MNOA 1KL9A 1AE3A 1PFSA 3GO5A 2A8VA 4R1JA 1RL2A 1GO3E 2PQAA 4R4TA 3RLNA 4QQBX 4KLKA 4JI0Q 3JC66 1QVCA 1PH3A 1X65A 2JA7H 2IX1A 4GNXC 1YJNA 3K7AH 5HGQA 1W2BA 1HR0Q 2JEBI 1E3PA 1A8VA 1MJCA 1N33Q 1A63A 1VQCA 4GOPC 1HZBA 1B7YB 1MKHA 2VY3A 2YTXA 1QVGA 1UE1A 1NE3A 1S72A 5LMNQ 1WJJA 2BH2A 1OTCA 4JI0L 2K5VA 3TQYA 2UXCQ 4P71A 3E9HA 3H3VH 3AYHB 5C44H 3A5UA 4KHZA 5BR8Q 1HR0L 1B70B 1SROA 2ZTEA 1VQPA 3HKSA 1N33L 3PF4A 1YHAA 1M1KC 2E2JH 4BBRH 4BY7G 2JJQA 1EIFA 1NY4A 1X3EA 1O7IA 2OCEA 4B3MQ 3W1BA 5IWAQ 5LMNL 4JI4Q 4A3DH 3STBC 4YHHQ 4LFBL 3KF6B 2B29A 5EAYA 1Q1EA 5ELNA 4DUZQ 1PH6A 2UXCL 1IYJB 3I7FA 5BR8L 1C0AA 2D0OA 4ME3A 2N3SA 3GTKH 5C4XH 4DV0L 2ALYB 4DAMA 2BA0A 2Q2UA 5J3BA 4JI7Q 4B3RQ 3S17H 4DK6C 2NVTH 2NZOA 2E8GA 2EIFA 1CUKA 3H0GG 3UE1A 2CQOA 5AJ3Q 5IWAL 2K4KA 3G6EA 1Q81C 1TXYA 1I3QH 1VQHA 4YHHL 4JI4L 4DUZL 3KDFB 4B3ML 4EX5A 4WJ3M 3OW2A 4JC0A 4PMWA 2AWOA 2R92G 5JJIA 2HQLA 1PH2A 4Y7NH 2K52A 4A3BG 4JI3Q 5IE8A 4JI7L 5IT9c 4B3RL 3W1GA 1HZ9A 1IBKL 4LF4Q 5GADC 5AJ3L 1I6HH 3RR5A 3G48A 4DV7Q 4LW1A 1PA6A 1K9MC 4IOCA 5M5YH 1VQMA 1OXSC 2ZM6Q 1UE6A 2I5LX 3AFQA 2V1CC 4A3IH 4JI3L 1Q82C 3GDEA 2JA6G 4QL5A 4C3HH 1SN8A 1EFWA 5IP7H 4B3TQ 1L2FA 2Z0SA 1OXVA 4JOIA 4DV7L 3CCJA 4APVA 3M4QA 2CWPA 4HIKA 3PF5A 4NXNQ 2HT1A 2LSSA 3M9BA 2ZM6L 2HIVA 2QEXA 1PH8A 1PV4A 1YI2A 4DR2Q 1PH5A 5IP7G 3HOWH 2ZJRA 4GLAC 1C7YA 4RG1A 1N9WA 1E24A 4YCWA 1CKNB 2B63H 3OYYA 1GKHA 1FL0A 3PIOA 4B3TL 4NXNL 4X65L 2WAQG 2XGTA 3S15H 1VQFA 2JA8G 3CCVA 4KHPQ 1PYSB 3RLOA 1EQQA 1K8AC 4UY8C 4DR2L 1PVOA 1L1OB 2VUMG 1XNRQ 1U0LA 2GVBA 3BZKA 4JI5Q 1XMOQ 4KI0A 3E9IA 3KJPA 1CKOA 4DV1Q 2R93G 1V9PA 3HOVH 3TEHB 4BY1G 1VQBA 4KHPL 1X54A 3GTLH 5JEAG 1WCMH 2JK8A 2VQFQ 1M90C 4IFDG 2VUMH 1HZCA 2OQ0A 1K83H 1WYDA 3D31A 4PZ8A 3T1HQ 4NXMQ 2ES2A 2E2IH 3RN2A 1XNRL 3L0OA 1MIUA 4JBWA 4PZ6A 3L7ZC 2YYZA 1X56A 4JI5L 5M5XH 4GNXB 1JB7A 2R7ZH 4A3LG 1KHIA 4DV1L 3J7A5 3HKZG 4JI2Q 2QGQA 2KCMA 3FP9A 3RLFA 2JE6I 4BA1I 4GOPB 4A3CG 2IX0A 2VQFL 3T1HL 2AMCB 2Q2IA 4NXML 5C0XI 4A3MH 3ULJA 4UPAA 4DR4Q 1L1OC 2KHJA 2ZTDA 2IHEA 2CKZB 1OXUA 5ELOA 2KCTA 3UDIA 2UUBQ 3KLWA 2YU9H 3GTPH 1E1TA 4LF5Q 3PO3G 1NMGA 3I4OA 5GAEC 2ATWA 5H1SE 4BA2I 4GKKQ 3TS2A 4GNXA 1X3FA 1K73C 1QUQB 4AQYQ 1BKBA 1SE8A 4HJ9A 3A74A 3S1RH 3HOYH 3CPFA 4IJHA 1IBMQ 4GOPA 4DR4L 3K8AA 4A75A 4BXXG 5GAGC 3KOJA 3U4VA 2UUCL 2UUBL 1QVFA 3HOXG 5JEAJ 4LF5L 4IFDJ 3I4MG 4HIMA 4GKJQ 5GQOA 4GKKL 4WJ4A 4DV6L 1G291 4AQYL 2PI2A 2WAQE 5E7NA 1IBML 4LF6Q 2RHQB 4O2DA 4OO1I 1VQKA 2QA4A 1B8AA 2K5NA 1JJCB 4A3JG 1VQLA 3RZOH 4TVAB 1VQ4A 3S14H 1AE2A 1J5EQ 4LFBQ 4AYBG 2F4VQ 2OWOA 2WFWA 5IYBG 2GVAA 4GKJL 1X55A 5FJ8G 1V43A 3HFZB 2NZHA 4DV0Q 5GAHC 1VS0A 2BH8A 2KHIA 4GN4B 3PCOB 5M5WH 2JQOA 1EUJA 4B3SL 5DLQE 3CXCA 2GN5A 4JI1Q 4LF6L 2F3IA 2CWAA 2MO0A 5IP9G 1J5EL 2I0QA 1NJIC 2F4VL 3AQQA 4R4IA 4A76A 3J80c 2K5HA 4DR7Q 2Z6KC 1V1QA 4PZ7A 1YBYA 4BY7H 3CCUA 2N8NA 3I56A 3RN5A 1VQIA 4JV5Q 4A4IA 3HKZE 1IBKQ 2LXKA 1K0RA 2AHOB 3GD7A 4QIWE 4JI1L 4DKAC 4HIOA 1VCIA 4P73A 4A93G 2RCNA 1YVCA 3UDFA 2A19A 4DR7L 5IYDG 4L5TA 3KF6A 3JAMc 4C2MH 3H15A 3F1ZA 1VQ5A 4OWWB 2PI2E 1Y1WG 4JV5L 1NBWA 1E22A 5M3FG 3H0GH 3H3VI 4C3JH 1HJPA 1VQDA 1N36L 4HJ7A 4Y52H 2R7DA 1YHQA 4L5RC 2IY5B 1SR3A 2OTLA 4A3GG 4HJAA 4JBJA 1I94Q 1HNZL 2R92H 2YV5A 2VS1A 4JG2A 2KBNA 4A3BH 5JJLA 1VQ9A 1Q12A 3KDFA 3EIVA 4DV5Q 3PGZA 4BBSG 1XPUA 3KFUA 1Y1VG 3SGIA 1K3RA 4O0AA 4MTNA 4JBKA 1JJGA 4A3GH 1OXXK 3U4ZA 2R7FA 4R4QA 1AH9A 4TQUS 2NN6G 4X65Q 3S16H 2CCZA 2Q2HA 3U50C 1I94L 5M3MG 4AYBE 4JI6Q 4BBSH 1I5FA 3CC7A 4LF9Q 2JA6H 5HY6A 3TRZA 1Q8KA 4DV5L 4LUVA 5IYCG 2Q2TA 1GVPA 2VNUD 3CC4A 3ZJYC 4DR3Q 1VQ6A 5C3EG 3ULPA 3T1YL 1D7QA 4UP7A 1EWIA 1BBWA 3MEFA 1QZHA 1BBUA 1A0IA 3WWVA 1SMXA 1YITA 3S1NH 2AKWB 2UU9L 4JI6L 4IO9A 1EQRA 4LF9L 3AEVA 1HR0W 3UDGA 3ERSX 2XTIA 4LNQA 4DR3L 2N49A 1ASZA 3PUWA 3RNUA 3J81i 1ASYA 2JA8H 3S1MH 1CKNA 3CCSA 3IRBA 4OWXB 4YY3Q 4AIMA 3OTOL 1PH9A 1HZAA 5LMNW 1RIPA 2DGYA 4DUYQ 1UEBA 3M3YH 2UXBQ 3A5ZB 2R6GA 1R9TH 1PH1A 1KRTA 1JE5A 4A3KG 4DV2Q 4YWLA 1L1OA 2R93H 1IBLL 1HNXQ 3A0JA 2E5LL 1NTGA 4BY1H 3S2HH 2E2HH 4HJ8A 1LTLA 3U58A 1XJVA 4YY3L 3M4OH 3K80C 3GTJH 4DUYL 2PMZE 3CMAA 4LF8Q 2UXBL 3F2DA 4XTCS 2I5MX 4DV4Q 4P72A 4GLVB 2YTYA 1LUZA 4A3EG 1BVSA 1KRSA 3UDXA 1KIXA 2UUCQ 4DV2L 2VZAA 1Z9FA 1FGUA 1TWFH 4YWKA 1HNXL 3HOZG 1G51A 4IPHA 3BU2A 3S2DH 4A3CH 4EQ5A 4DV6Q 3CD6A 1IXRA 4POGA 3CW2C 4K0KQ 3FKIG 4GN3B 4MZ9A 1Q46A 4LF8L 3PSIA 4DV4L 4DV3Q 3HOUG 2I5HA 2ASBA 3PO3H 3ULLA 3NBHB 3I55A 3G71A 1PH7A 1OXTA 1CSQA 3PO2G 1YNXA 4X66L 1UE5A 3PUVA 4DPGA 3VDYA 1E7ZA 2RHSB 4JCVE 3PUZA 5C4JH 1KQSA 1N32Q 2B3GA 3CCQA 3I2ZA 3PIPA 4K0KL 3F8TA 2Y0SG 4BXXH 5IY0A 1EIYB 5LMUL 4DV3L 1QUQA 4B3SQ 3S24A 3HOXH 1PH4A 2JA7G 4IFDI 3CCLA 1Q86C 1PHJA 3I4MH 1XPOA 3W5OA 1PYBA 2D62A 2K14A 2OTJA 1WI5A 2JA5G 1N32L 3KJOA 2JEAI 2KENA 4FDBA 2NVXH 2CFMA 4X64Q 2Z6KA 3NENA 2ZJPA 4A3JH 1MJEA 3CAMA 4LWCA 3EBEA 3J7ZC 2HIXA 5IYBH 5GROA 5C44G 5K36G 2JA5H 4LFCQ 5FJ8H 4OX9Q 1YZ6A 4PG3A 4LF4L 3CF5A 3DM3A 3B6YA 4BBRG 4DR6Q 4X64L 2NVQH 1DGSA 4A3DG 4LUOA 1VQOA 5IP9H 2RF4A 3CMEA 4QJFA 2JA9A 4GS3A 4J15A 2C35B 2FXQA 1TWCH 3CQZH 4LFCL 1YHBA 1TWAH 3KF8B 4R4CA 1HNZQ 5C4XG 1Y14B 4P75A 1YJ9A 3BZCA 1KD1C 4IPGA 2IT1A 4OX9L 1JT8A 1P8LA 4DR6L 4DK3C 4HJ5A 3DLLA 1D8LA 2MQHA 1JJ2A 1X9NA 3GTOH 2OQKA 3I4NG 3FHWA 3L2PA 2AWNA 3D0FA 1JMCA 4A93H 3BJUA 4QGUA 3RZDH 3GTQH 2H5XA 3CC2A 2ZJQA 1LYLA 4IPDA 2LXJA 5IYDH 4OONA 3CP0A 1VQNA 4RMFA 2VL6A 4DR1Q 3M7NA 2EQSA 1Y1WH 3F2CA 1EYGA 5M3FH 3E0EA 1XMQQ 3I4NH 1I50H 1VQ8A 2UXDQ 4R4OA 4NB3A 1EOVA 1VQAA 1N36Q 1J6QA 2Y0SE 3T1YQ 1SFOH 4L5SA 1G6PA 3TREA 3G4SA 1SLJA 1FVIA 1S40A 3M4PA 1CSPA 1X3GA 2MNAA 2NVYH 2UU9Q 4DR1L 2EXDA 1Z47A 3ICEA 2YTVA 3NEMA 4A3IG 1TWGH 4LUZA 1XMQL 1Q7YC 2UXDL 1Y1VH 3Q8DA 2ID0A 4YCVA 3CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T9H A;  4XIG S;  3TS0 A;  1QZG A;  2WB1 G;  2IHF A;  3CPW A;  4NPS A;  4OXP A;  1XPR A;  1C9O A;  3GTG H;  1YIJ A;  3OTO Q;  5M3M H;  3K7U C;  1WOC A;  3S1Q H;  1VQ7 A;  3HOW G;  3ER0 A;  2K50 A;  4H02 A;  2ZTC A;  4IPC A;  5IYC H;  1VQG A;  3EN2 A;  4ALP A;  2B63 G;  5C0X G;  5C3E H;  1KAW A;  4P74 A;  2MO1 A;  1IBL Q;  2E5L Q;  1VQJ A;  1P16 A;  1A62 A;  2K75 A;  4C3I H;  2A1A A;  2F52 A;  1FJG Q;  1IL2 A;  4JYA Q;  3CCE A;  4YCU A;  4JOI C;  4DNI A;  1L0W A;  1SRU A;  4X6A H;  1IZ6 A;  1KXL A;  1UWV A;  2VW9 A;  1NMF A;  2L15 A;  1GD7 A;  3AFP A;  4QY7 A;  4LFA Q;  4YWM A;  3F2B A;  1HNW Q;  3HOV G;  2DUD A;  4GLX A;  3CCR A;  4LF7 Q;  5FLM G;  1XNQ Q;  1WCM G;  2D0P A;  4UP8 A;  1FJG L;  2MFI A;  4JYA L;  4JBM A;  4L5Q A;  4DAY B;  4A3K H;  2NN6 I;  1GM5 A;  1KC8 C;  3K0X A;  5FLX c;  4LFA L;  2R7Z G;  4OO1 G;  2PNH A;  3STB D;  5FLM H;  4JI8 Q;  3J81 j;  1HNW L;  3PUX A;  4X66 Q;  4DR5 Q;  4LF7 L;  1S3O A;  1N8R C;  1XNQ L;  2N78 A;  1N34 Q;  1H95 A;  3GTM H;  4A3M G;  4POF A;  3M85 A;  5C0X J;  4A3E H;  4A3L H;  2WP8 J;  2UUA Q;  5LMU Q;  2HHH Q;  4X62 Q;  1XMO L;  1HH2 P;  4A3F G;  2VQE Q;  3J80 i;  3HOZ H;  1VQE A;  5JJK A;  4JI8 L;  3PV0 A;  1W3S A;  1U5K A;  4OWT B;  4DR5 L;  3LGJ A;  2PQA B;  1K8G A;  1UE7 A;  1E1O A;  1WFQ A;  3FKI H;  1Q1B A;  2WB1 E;  3PUY A;  3HOY G;  1TWH H;  4UP9 A;  1N34 L;  2BA1 A;  3UE0 A;  1YJW A;  3HOU H;  1LM0 A;  4A3F H;  1YEZ A;  2UUA L;  2HHH L;  4X62 L;  1X6O A;  3KYH C;  4IJL A;  4HID A;  3K81 C;  4IOA A;  3PO2 H;  2VQE L;  1CKM A;  4JI2 L;  1XTD A;  3MXN B;  3JAM i;  3J81 c;  3NEL A;  4AH6 A;  4GN5 A;  4MNO A;  1KL9 A;  1AE3 A;  1PFS A;  3GO5 A;  2A8V A;  4R1J A;  1RL2 A;  1GO3 E;  2PQA A;  4R4T A;  3RLN A;  4QQB X;  4KLK A;  4JI0 Q;  3JC6 6;  1QVC A;  1PH3 A;  1X65 A;  2JA7 H;  2IX1 A;  4GNX C;  1YJN A;  3K7A H;  5HGQ A;  1W2B A;  1HR0 Q;  2JEB I;  1E3P A;  1A8V A;  1MJC A;  1N33 Q;  1A63 A;  1VQC A;  4GOP C;  1HZB A;  1B7Y B;  1MKH A;  2VY3 A;  2YTX A;  1QVG A;  1UE1 A;  1NE3 A;  1S72 A;  5LMN Q;  1WJJ A;  2BH2 A;  1OTC A;  4JI0 L;  2K5V A;  3TQY A;  2UXC Q;  4P71 A;  3E9H A;  3H3V H;  3AYH B;  5C44 H;  3A5U A;  4KHZ A;  5BR8 Q;  1HR0 L;  1B70 B;  1SRO A;  2ZTE A;  1VQP A;  3HKS A;  1N33 L;  3PF4 A;  1YHA A;  1M1K C;  2E2J H;  4BBR H;  4BY7 G;  2JJQ A;  1EIF A;  1NY4 A;  1X3E A;  1O7I A;  2OCE A;  4B3M Q;  3W1B A;  5IWA Q;  5LMN L;  4JI4 Q;  4A3D H;  3STB C;  4YHH Q;  4LFB L;  3KF6 B;  2B29 A;  5EAY A;  1Q1E A;  5ELN A;  4DUZ Q;  1PH6 A;  2UXC L;  1IYJ B;  3I7F A;  5BR8 L;  1C0A A;  2D0O A;  4ME3 A;  2N3S A;  3GTK H;  5C4X H;  4DV0 L;  2ALY B;  4DAM A;  2BA0 A;  2Q2U A;  5J3B A;  4JI7 Q;  4B3R Q;  3S17 H;  4DK6 C;  2NVT H;  2NZO A;  2E8G A;  2EIF A;  1CUK A;  3H0G G;  3UE1 A;  2CQO A;  5AJ3 Q;  5IWA L;  2K4K A;  3G6E A;  1Q81 C;  1TXY A;  1I3Q H;  1VQH A;  4YHH L;  4JI4 L;  4DUZ L;  3KDF B;  4B3M L;  4EX5 A;  4WJ3 M;  3OW2 A;  4JC0 A;  4PMW A;  2AWO A;  2R92 G;  5JJI A;  2HQL A;  1PH2 A;  4Y7N H;  2K52 A;  4A3B G;  4JI3 Q;  5IE8 A;  4JI7 L;  5IT9 c;  4B3R L;  3W1G A;  1HZ9 A;  1IBK L;  4LF4 Q;  5GAD C;  5AJ3 L;  1I6H H;  3RR5 A;  3G48 A;  4DV7 Q;  4LW1 A;  1PA6 A;  1K9M C;  4IOC A;  5M5Y H;  1VQM A;  1OXS C;  2ZM6 Q;  1UE6 A;  2I5L X;  3AFQ A;  2V1C C;  4A3I H;  4JI3 L;  1Q82 C;  3GDE A;  2JA6 G;  4QL5 A;  4C3H H;  1SN8 A;  1EFW A;  5IP7 H;  4B3T Q;  1L2F A;  2Z0S A;  1OXV A;  4JOI A;  4DV7 L;  3CCJ A;  4APV A;  3M4Q A;  2CWP A;  4HIK A;  3PF5 A;  4NXN Q;  2HT1 A;  2LSS A;  3M9B A;  2ZM6 L;  2HIV A;  2QEX A;  1PH8 A;  1PV4 A;  1YI2 A;  4DR2 Q;  1PH5 A;  5IP7 G;  3HOW H;  2ZJR A;  4GLA C;  1C7Y A;  4RG1 A;  1N9W A;  1E24 A;  4YCW A;  1CKN B;  2B63 H;  3OYY A;  1GKH A;  1FL0 A;  3PIO A;  4B3T L;  4NXN L;  4X65 L;  2WAQ G;  2XGT A;  3S15 H;  1VQF A;  2JA8 G;  3CCV A;  4KHP Q;  1PYS B;  3RLO A;  1EQQ A;  1K8A C;  4UY8 C;  4DR2 L;  1PVO A;  1L1O B;  2VUM G;  1XNR Q;  1U0L A;  2GVB A;  3BZK A;  4JI5 Q;  1XMO Q;  4KI0 A;  3E9I A;  3KJP A;  1CKO A;  4DV1 Q;  2R93 G;  1V9P A;  3HOV H;  3TEH B;  4BY1 G;  1VQB A;  4KHP L;  1X54 A;  3GTL H;  5JEA G;  1WCM H;  2JK8 A;  2VQF Q;  1M90 C;  4IFD G;  2VUM H;  1HZC A;  2OQ0 A;  1K83 H;  1WYD A;  3D31 A;  4PZ8 A;  3T1H Q;  4NXM Q;  2ES2 A;  2E2I H;  3RN2 A;  1XNR L;  3L0O A;  1MIU A;  4JBW A;  4PZ6 A;  3L7Z C;  2YYZ A;  1X56 A;  4JI5 L;  5M5X H;  4GNX B;  1JB7 A;  2R7Z H;  4A3L G;  1KHI A;  4DV1 L;  3J7A 5;  3HKZ G;  4JI2 Q;  2QGQ A;  2KCM A;  3FP9 A;  3RLF A;  2JE6 I;  4BA1 I;  4GOP B;  4A3C G;  2IX0 A;  2VQF L;  3T1H L;  2AMC B;  2Q2I A;  4NXM L;  5C0X I;  4A3M H;  3ULJ A;  4UPA A;  4DR4 Q;  1L1O C;  2KHJ A;  2ZTD A;  2IHE A;  2CKZ B;  1OXU A;  5ELO A;  2KCT A;  3UDI A;  2UUB Q;  3KLW A;  2YU9 H;  3GTP H;  1E1T A;  4LF5 Q;  3PO3 G;  1NMG A;  3I4O A;  5GAE C;  2ATW A;  5H1S E;  4BA2 I;  4GKK Q;  3TS2 A;  4GNX A;  1X3F A;  1K73 C;  1QUQ B;  4AQY Q;  1BKB A;  1SE8 A;  4HJ9 A;  3A74 A;  3S1R H;  3HOY H;  3CPF A;  4IJH A;  1IBM Q;  4GOP A;  4DR4 L;  3K8A A;  4A75 A;  4BXX G;  5GAG C;  3KOJ A;  3U4V A;  2UUC L;  2UUB L;  1QVF A;  3HOX G;  5JEA J;  4LF5 L;  4IFD J;  3I4M G;  4HIM A;  4GKJ Q;  5GQO A;  4GKK L;  4WJ4 A;  4DV6 L;  1G29 1;  4AQY L;  2PI2 A;  2WAQ E;  5E7N A;  1IBM L;  4LF6 Q;  2RHQ B;  4O2D A;  4OO1 I;  1VQK A;  2QA4 A;  1B8A A;  2K5N A;  1JJC B;  4A3J G;  1VQL A;  3RZO H;  4TVA B;  1VQ4 A;  3S14 H;  1AE2 A;  1J5E Q;  4LFB Q;  4AYB G;  2F4V Q;  2OWO A;  2WFW A;  5IYB G;  2GVA A;  4GKJ L;  1X55 A;  5FJ8 G;  1V43 A;  3HFZ B;  2NZH A;  4DV0 Q;  5GAH C;  1VS0 A;  2BH8 A;  2KHI A;  4GN4 B;  3PCO B;  5M5W H;  2JQO A;  1EUJ A;  4B3S L;  5DLQ E;  3CXC A;  2GN5 A;  4JI1 Q;  4LF6 L;  2F3I A;  2CWA A;  2MO0 A;  5IP9 G;  1J5E L;  2I0Q A;  1NJI C;  2F4V L;  3AQQ A;  4R4I A;  4A76 A;  3J80 c;  2K5H A;  4DR7 Q;  2Z6K C;  1V1Q A;  4PZ7 A;  1YBY A;  4BY7 H;  3CCU A;  2N8N A;  3I56 A;  3RN5 A;  1VQI A;  4JV5 Q;  4A4I A;  3HKZ E;  1IBK Q;  2LXK A;  1K0R A;  2AHO B;  3GD7 A;  4QIW E;  4JI1 L;  4DKA C;  4HIO A;  1VCI A;  4P73 A;  4A93 G;  2RCN A;  1YVC A;  3UDF A;  2A19 A;  4DR7 L;  5IYD G;  4L5T A;  3KF6 A;  3JAM c;  4C2M H;  3H15 A;  3F1Z A;  1VQ5 A;  4OWW B;  2PI2 E;  1Y1W G;  4JV5 L;  1NBW A;  1E22 A;  5M3F G;  3H0G H;  3H3V I;  4C3J H;  1HJP A;  1VQD A;  1N36 L;  4HJ7 A;  4Y52 H;  2R7D A;  1YHQ A;  4L5R C;  2IY5 B;  1SR3 A;  2OTL A;  4A3G G;  4HJA A;  4JBJ A;  1I94 Q;  1HNZ L;  2R92 H;  2YV5 A;  2VS1 A;  4JG2 A;  2KBN A;  4A3B H;  5JJL A;  1VQ9 A;  1Q12 A;  3KDF A;  3EIV A;  4DV5 Q;  3PGZ A;  4BBS G;  1XPU A;  3KFU A;  1Y1V G;  3SGI A;  1K3R A;  4O0A A;  4MTN A;  4JBK A;  1JJG A;  4A3G H;  1OXX K;  3U4Z A;  2R7F A;  4R4Q A;  1AH9 A;  4TQU S;  2NN6 G;  4X65 Q;  3S16 H;  2CCZ A;  2Q2H A;  3U50 C;  1I94 L;  5M3M G;  4AYB E;  4JI6 Q;  4BBS H;  1I5F A;  3CC7 A;  4LF9 Q;  2JA6 H;  5HY6 A;  3TRZ A;  1Q8K A;  4DV5 L;  4LUV A;  5IYC G;  2Q2T A;  1GVP A;  2VNU D;  3CC4 A;  3ZJY C;  4DR3 Q;  1VQ6 A;  5C3E G;  3ULP A;  3T1Y L;  1D7Q A;  4UP7 A;  1EWI A;  1BBW A;  3MEF A;  1QZH A;  1BBU A;  1A0I A;  3WWV A;  1SMX A;  1YIT A;  3S1N H;  2AKW B;  2UU9 L;  4JI6 L;  4IO9 A;  1EQR A;  4LF9 L;  3AEV A;  1HR0 W;  3UDG A;  3ERS X;  2XTI A;  4LNQ A;  4DR3 L;  2N49 A;  1ASZ A;  3PUW A;  3RNU A;  3J81 i;  1ASY A;  2JA8 H;  3S1M H;  1CKN A;  3CCS A;  3IRB A;  4OWX B;  4YY3 Q;  4AIM A;  3OTO L;  1PH9 A;  1HZA A;  5LMN W;  1RIP A;  2DGY A;  4DUY Q;  1UEB A;  3M3Y H;  2UXB Q;  3A5Z B;  2R6G A;  1R9T H;  1PH1 A;  1KRT A;  1JE5 A;  4A3K G;  4DV2 Q;  4YWL A;  1L1O A;  2R93 H;  1IBL L;  1HNX Q;  3A0J A;  2E5L L;  1NTG A;  4BY1 H;  3S2H H;  2E2H H;  4HJ8 A;  1LTL A;  3U58 A;  1XJV A;  4YY3 L;  3M4O H;  3K80 C;  3GTJ H;  4DUY L;  2PMZ E;  3CMA A;  4LF8 Q;  2UXB L;  3F2D A;  4XTC S;  2I5M X;  4DV4 Q;  4P72 A;  4GLV B;  2YTY A;  1LUZ A;  4A3E G;  1BVS A;  1KRS A;  3UDX A;  1KIX A;  2UUC Q;  4DV2 L;  2VZA A;  1Z9F A;  1FGU A;  1TWF H;  4YWK A;  1HNX L;  3HOZ G;  1G51 A;  4IPH A;  3BU2 A;  3S2D H;  4A3C H;  4EQ5 A;  4DV6 Q;  3CD6 A;  1IXR A;  4POG A;  3CW2 C;  4K0K Q;  3FKI G;  4GN3 B;  4MZ9 A;  1Q46 A;  4LF8 L;  3PSI A;  4DV4 L;  4DV3 Q;  3HOU G;  2I5H A;  2ASB A;  3PO3 H;  3ULL A;  3NBH B;  3I55 A;  3G71 A;  1PH7 A;  1OXT A;  1CSQ A;  3PO2 G;  1YNX A;  4X66 L;  1UE5 A;  3PUV A;  4DPG A;  3VDY A;  1E7Z A;  2RHS B;  4JCV E;  3PUZ A;  5C4J H;  1KQS A;  1N32 Q;  2B3G A;  3CCQ A;  3I2Z A;  3PIP A;  4K0K L;  3F8T A;  2Y0S G;  4BXX H;  5IY0 A;  1EIY B;  5LMU L;  4DV3 L;  1QUQ A;  4B3S Q;  3S24 A;  3HOX H;  1PH4 A;  2JA7 G;  4IFD I;  3CCL A;  1Q86 C;  1PHJ A;  3I4M H;  1XPO A;  3W5O A;  1PYB A;  2D62 A;  2K14 A;  2OTJ A;  1WI5 A;  2JA5 G;  1N32 L;  3KJO A;  2JEA I;  2KEN A;  4FDB A;  2NVX H;  2CFM A;  4X64 Q;  2Z6K A;  3NEN A;  2ZJP A;  4A3J H;  1MJE A;  3CAM A;  4LWC A;  3EBE A;  3J7Z C;  2HIX A;  5IYB H;  5GRO A;  5C44 G;  5K36 G;  2JA5 H;  4LFC Q;  5FJ8 H;  4OX9 Q;  1YZ6 A;  4PG3 A;  4LF4 L;  3CF5 A;  3DM3 A;  3B6Y A;  4BBR G;  4DR6 Q;  4X64 L;  2NVQ H;  1DGS A;  4A3D G;  4LUO A;  1VQO A;  5IP9 H;  2RF4 A;  3CME A;  4QJF A;  2JA9 A;  4GS3 A;  4J15 A;  2C35 B;  2FXQ A;  1TWC H;  3CQZ H;  4LFC L;  1YHB A;  1TWA H;  3KF8 B;  4R4C A;  1HNZ Q;  5C4X G;  1Y14 B;  4P75 A;  1YJ9 A;  3BZC A;  1KD1 C;  4IPG A;  2IT1 A;  4OX9 L;  1JT8 A;  1P8L A;  4DR6 L;  4DK3 C;  4HJ5 A;  3DLL A;  1D8L A;  2MQH A;  1JJ2 A;  1X9N A;  3GTO H;  2OQK A;  3I4N G;  3FHW A;  3L2P A;  2AWN A;  3D0F A;  1JMC A;  4A93 H;  3BJU A;  4QGU A;  3RZD H;  3GTQ H;  2H5X A;  3CC2 A;  2ZJQ A;  1LYL A;  4IPD A;  2LXJ A;  5IYD H;  4OON A;  3CP0 A;  1VQN A;  4RMF A;  2VL6 A;  4DR1 Q;  3M7N A;  2EQS A;  1Y1W H;  3F2C A;  1EYG A;  5M3F H;  3E0E A;  1XMQ Q;  3I4N H;  1I50 H;  1VQ8 A;  2UXD Q;  4R4O A;  4NB3 A;  1EOV A;  1VQA A;  1N36 Q;  1J6Q A;  2Y0S E;  3T1Y Q;  1SFO H;  4L5S A;  1G6P A;  3TRE A;  3G4S A;  1SLJ A;  1FVI A;  1S40 A;  3M4P A;  1CSP A;  1X3G A;  2MNA A;  2NVY H;  2UU9 Q;  4DR1 L;  2EXD A;  1Z47 A;  3ICE A;  2YTV A;  3NEM A;  4A3I G;  1TWG H;  4LUZ A;  1XMQ L;  1Q7Y C;  2UXD L;  1Y1V H;  3Q8D A;  2ID0 A;  4YCV A;  3CCM A; 
#chains in the Genus database with same CATH topology
 2IHF A;  3CPW A;  4OXP A;  4DU9 A;  4DF7 A;  4KY6 A;  3GTG H;  1EQT A;  5M3M H;  1IKM A;  1LTR D;  1WOC A;  1ZKO A;  1BR9 A;  4H02 A;  1VQ7 A;  1SMY D;  2ZTC A;  3LWU A;  1VQG A;  3BVM A;  2FMM A;  1OO9 B;  4IZ8 A;  1KAW A;  2MO1 A;  1B3Q A;  2E5L Q;  4RGT A;  2K75 A;  1MD2 D;  2RA4 A;  1IL2 A;  2Q8I B;  3CCE A;  2K03 A;  4YCU A;  3TN2 A;  1IZ6 A;  1NMF A;  4LFA Q;  1QB5 D;  3AFP A;  4R8I A;  4ODG A;  1FYC A;  2JA8 B;  3CCR A;  1WCM G;  2D0P A;  5EGT A;  4L5Q A;  3MZ5 A;  2E2I B;  1KC8 C;  2HCC A;  4LFA L;  1ENF A;  5M5X B;  3STB D;  3S2H B;  5FLM H;  4DR5 Q;  2PCF B;  2PZT A;  1N34 Q;  3C2P A;  4ZRZ A;  4POF A;  2HDM A;  2HHH Q;  1XMO L;  1HH2 P;  3VA7 A;  3DUZ A;  1VQE A;  4DXF A;  3PV0 A;  4DR5 L;  4OWT B;  2IPK D;  4DNR B;  1K8G A;  3S2D B;  3S1R B;  4OEL B;  2WB1 E;  4DGZ A;  1N34 L;  3TZD A;  1YJW A;  3HOU H;  3A8I E;  4IUN A;  1YEZ A;  2HHH L;  1X6O A;  4IJL A;  1T5X D;  3K81 C;  1PRT C;  5DEH A;  1JQY D;  1CKM A;  1NSN S;  1XTD A;  3JAM i;  2F0F A;  4GN5 A;  1PFS A;  2IL8 A;  4R1J A;  4WRD A;  1JCK B;  1RL2 A;  2TSS A;  4JI0 Q;  2GA4 B;  3JC6 6;  3MXG A;  3RZO B;  3K7A H;  1E3P A;  1A8V A;  3TP6 A;  2E75 C;  1N33 Q;  3C3L A;  3I3C A;  1VQC A;  5HGT A;  2Z8L A;  1B7Y B;  4S3S A;  2VY3 A;  4FYD A;  3D6W A;  2BH2 A;  4JI0 L;  1C8C A;  3EVQ A;  2UXC Q;  1GJX A;  5K36 H;  5C4Z A;  2Z4H A;  1SRO A;  2ZTE A;  1ML0 D;  3HKS A;  1BCP F;  2HDL A;  3CRK C;  5C6A A;  1N33 L;  2PPB C;  4G4K A;  1I4G A;  5D65 A;  1ENA A;  1F9P A;  3EQL C;  2B29 A;  2UXC L;  4RCO A;  3I7F A;  1TWC B;  2A69 C;  4ME3 A;  4LAA A;  1TWA B;  5C4X H;  4QMG A;  3BDO A;  2XVS A;  2Q2U A;  3OIQ A;  2A73 B;  5J3B A;  4C2M B;  4MTK A;  1XWE A;  3G6E A;  2K4K A;  1TXY A;  1VQH A;  3P75 A;  4A93 B;  4CBV A;  4EX5 A;  4WJ3 M;  4JC0 A;  2F0S A;  4KKS A;  1B4O A;  5M3F B;  1U4L A;  3W1G A;  1IBK L;  1KLG D;  1I6H H;  3G48 A;  4DV7 Q;  2PYK A;  2PMZ B;  5TSS A;  1S5F D;  4BBS B;  3GDE A;  4I7A A;  2B2T A;  3Q23 A;  1SN8 A;  4JOI A;  1LAB A;  4DV7 L;  4HIK A;  4APV A;  3M4Q A;  3M9B A;  3IL8 A;  3GTG B;  4DR2 Q;  5EPK A;  3HOW H;  4GLA C;  1D5M C;  4YCW A;  2NBF A;  5I2Y A;  3I72 A;  1FL0 A;  2XGT A;  2IW3 A;  3M7G A;  1VQF A;  2JA8 G;  4KN7 C;  4E6I A;  1K8A C;  4UY8 C;  4DR2 L;  3U9O A;  3VR2 A;  4X3K A;  2GVB A;  3BZK A;  4JI5 Q;  2B2W A;  4I7Z C;  3MEH A;  1X54 A;  2JK8 A;  1SJE D;  2VUM H;  1WYD A;  1V1O A;  1SE2 A;  3RN2 A;  1MIU A;  4JI5 L;  1A2T A;  1AZQ A;  4DAY A;  3K0Y A;  2KJX A;  2Z4I A;  4PNY A;  2EOT A;  2QGQ A;  2IX0 A;  1QNU A;  1JB3 A;  1QE6 A;  2A6H D;  5FO8 B;  2IHE A;  2CKZ B;  2VXW A;  2KCT A;  4LF5 Q;  1HTP A;  2ATW A;  1PTO H;  3ERQ A;  2XWJ B;  1BKB A;  3HOY H;  2PNR C;  3A74 A;  4K6D A;  3CPF A;  1XTC D;  1RF2 D;  5DNF A;  4BXX G;  3HOU B;  3C1E A;  1II3 A;  1QVF A;  4LF5 L;  2K7V A;  4DA2 A;  3T53 B;  3I4M B;  5NUC A;  4DV6 L;  4Q5V A;  5DM6 3;  3MFG A;  2QA4 A;  1VQL A;  2RDF A;  4LFB Q;  1PFM A;  1J5E Q;  3K7A B;  2OWO A;  2GVA A;  5AFW A;  5FJ8 G;  2NZH A;  1VS0 A;  2BH8 A;  1QWY A;  2JQO A;  3K59 A;  5DLQ E;  1HPC A;  1K0S A;  2CWA A;  3D4W A;  5IP9 G;  1J5E L;  1TU2 B;  1CQF A;  1M8A A;  5I4D A;  2K5H A;  2F3W A;  4K5V A;  2G9H D;  4PZ7 A;  2N8N A;  3I56 A;  3RN5 A;  1VQI A;  1G91 A;  3I90 A;  1UUP A;  2AHO B;  2AQ2 B;  2LXK A;  4F8M A;  4HIO A;  1VCI A;  4A93 G;  2RCN A;  3KBX A;  5KND A;  5IGC A;  2DY7 A;  2LFN A;  3I91 A;  5C4X B;  2F0W A;  4EQN A;  4F7X A;  3H15 A;  5M3F G;  3H0G H;  3I4N B;  4C3J H;  4G57 A;  3K58 A;  4HJ7 A;  5LL6 X;  2EY6 A;  4L5R C;  2IY5 B;  3MC0 B;  1DON A;  1DM0 B;  1A3T A;  1VF7 A;  4M1U B;  2PW5 A;  1TY0 A;  2R61 A;  4DV5 Q;  3PGZ A;  4BBS G;  1ESF A;  4DAV A;  1TWG B;  1MI2 A;  1Y1V B;  2D9U A;  4O0A A;  2L1B A;  4A3G H;  4R4Q A;  4X65 Q;  2CCZ A;  2Q2H A;  1STE A;  3V2T A;  5M3M G;  2EZV A;  4JI6 Q;  3TRZ A;  3CC7 A;  1Q8K A;  4DV5 L;  3S1Q B;  2Q8R E;  3EJI A;  3CC4 A;  3NQT A;  4DR3 Q;  2ICE C;  1EYC A;  4ULL A;  3TP5 A;  3MEF A;  5IGG A;  1BBU A;  1HA5 A;  3FRP B;  1U4R A;  4JI6 L;  3HOW B;  1ILQ A;  4C1N I;  1HR0 W;  3QIA A;  4QUF A;  3UDG A;  3ERS X;  1IW7 D;  4DR3 L;  1SE4 A;  1CKN A;  2LY7 A;  1WTO A;  3OTO L;  1PH9 A;  4AIM A;  5CC4 A;  1AP0 A;  1UEB A;  2UXB Q;  1R9T H;  4FVM A;  1KRT A;  4DV2 Q;  1L1O A;  2R93 H;  1IBL L;  1HNX Q;  3A0J A;  3D3R A;  4JK1 C;  4R9W A;  4XDX A;  3R3O A;  5CV4 A;  3GTJ H;  4LF8 Q;  2UXB L;  2YTY A;  1KRS A;  2DJG C;  3UDX A;  4DV2 L;  4M8A A;  2VZA A;  1HNX L;  3HOZ B;  1JIC A;  2FHT A;  4ZUI A;  5ISR A;  2L55 A;  1U4P A;  4K0K Q;  1SYG A;  4WJW A;  2B2W C;  4LF8 L;  1Q46 A;  2Q8T A;  4DV3 Q;  3HOU G;  3D6C A;  2ASB A;  4A3F B;  1M4V A;  1OXT A;  1YNX A;  1Y69 U;  4H44 C;  1E7Z A;  3VR3 A;  1WTW A;  1KQS A;  3HOY B;  3PIP A;  4K0K L;  1G6Z A;  1EQV A;  5IY0 A;  5LMU L;  4DV3 L;  1QUQ A;  2H1E A;  4B3S Q;  5I2X A;  2AUJ D;  1PH4 A;  3CCL A;  3ND9 A;  2ZXO A;  2MUY A;  3W5O A;  4Z9C B;  1ET6 A;  2EYP A;  2ZJP A;  3CAM A;  1F2Y A;  4U67 3;  1NUC A;  1L0Y B;  1HHV A;  5K36 G;  4OX9 Q;  4PG3 A;  3CF5 A;  3B6Y A;  3A8K E;  5IT9 L;  1Q8I A;  3CME A;  2FXQ A;  2EYF A;  1H9J A;  4N9P A;  5C4X G;  1YJ9 A;  4OX9 L;  4IPG A;  3C46 A;  2MQH A;  1X9N A;  3GTO H;  3I4N G;  2B2U A;  5IIF A;  2BCO A;  4ABN A;  2MPM A;  4RA8 A;  4QGU A;  3RZD H;  3CC2 A;  1LYL A;  5EKI A;  2LXJ A;  1UNS A;  3CP0 A;  1Y1W H;  4Y7N B;  3E0E A;  1S5C D;  3H0G B;  4R4O A;  4C3J B;  3T16 A;  1CA5 A;  1CQV A;  1FGB D;  2Y0S E;  1LTT D;  1SFO H;  4L5S A;  3FVQ A;  1SLJ A;  1S40 A;  1CSP A;  2HCI A;  2MNA A;  2NVY H;  1Z47 A;  2YTV A;  4RAU C;  1SEB D;  3NEM A;  3DWP A;  2DJF C;  3Q8D A;  4C3H B;  4YCV A;  1T9H A;  1QZG A;  3TS0 A;  5LL6 S;  4NP5 A;  1PRT D;  3T13 A;  1EWH A;  4O1N A;  3HOW G;  3D8G A;  2K50 A;  2RSN A;  4IPC A;  5IYC H;  3TP7 A;  3EN2 A;  1EOT A;  3VYR A;  5I9O A;  1AZP A;  1BQQ T;  1P16 A;  1A62 A;  4C3I H;  2A1A A;  1U9R A;  2F52 A;  1FJG Q;  4JYA Q;  1GUN A;  1ZXT A;  5KYI A;  4IUR A;  1KXL A;  3A55 A;  1UWV A;  4X3S A;  2L15 A;  1GD7 A;  1SYC A;  3F2B A;  2DUD A;  2F0I A;  3EA6 A;  4KD3 A;  2CHB D;  3GTL B;  1WCM B;  1FJG L;  4LMQ D;  1WD0 A;  4JYA L;  4JBM A;  2L5T A;  3KUP A;  4DAY B;  1GXD C;  4IUU A;  4HMJ A;  4A3K H;  3V96 A;  5FLX c;  3I73 A;  2R93 B;  2NB0 A;  5EKK A;  3J81 j;  4X66 Q;  3KK7 A;  2F1M A;  3MVV A;  2A69 D;  3GTJ B;  2B39 A;  5FLX E;  5FO9 B;  3GTM H;  4A3E H;  1C4Q A;  2F3V A;  3L9A X;  2NTS A;  4NDX A;  1D1I A;  2G5D A;  5C5M A;  4KMU C;  4G7H C;  4X62 Q;  4A3F G;  2PQE A;  3ND8 A;  1W3S A;  1X32 A;  2EPB A;  3AMU A;  2PQA B;  1UE7 A;  3HOY G;  1TWH H;  4UP9 A;  1HFN A;  1LM0 A;  1SE3 A;  2KA7 A;  3NBI A;  4X62 L;  1CZW A;  3KYH C;  1E0B A;  3PO2 H;  1SNM A;  1G8Z D;  4JI2 L;  3MXN B;  1JR0 D;  3J81 c;  4BWG B;  3MHB A;  1KL9 A;  3GO5 A;  1EY8 A;  3RLN A;  4CJ2 C;  1SND A;  1FD7 D;  5M9O A;  3J81 E;  2JA7 H;  2K04 A;  2IX1 A;  1YJN A;  5HGQ A;  1LTA D;  1W2B A;  4IN3 A;  3E0J A;  5IGB A;  2KOL A;  5KIX A;  1NE3 A;  1Z6H A;  1S72 A;  5LMN Q;  3OPO A;  3PIP 3;  3KLS X;  2K5V A;  2ZXP A;  1VF5 C;  4P71 A;  3E9H A;  3AYH B;  5T1G A;  1RHP A;  1B70 B;  1YNN C;  1DD2 A;  3PF4 A;  3IKJ A;  3Q0A A;  1YHA A;  3GQB A;  1M1K C;  4BBR H;  2E2J H;  2JJQ A;  3GV6 A;  1X3E A;  1O7I A;  4O42 A;  1WTX A;  4B3M Q;  4HCS A;  5LMN L;  4A3D H;  1WTP A;  4JI4 Q;  4NMZ A;  1SBB B;  1IYJ B;  3I4L A;  3LNN A;  3GTK H;  4HN7 A;  3A54 A;  5JAV A;  4DV0 L;  2CQA A;  4DAM A;  1K8M A;  4B3R Q;  2NVT H;  3K5O A;  2E8G A;  2EIF A;  3H0G G;  4B3M L;  2CQO A;  3GTO B;  4C3J G;  4JI4 L;  1VDZ A;  4ZKC B;  3QG1 A;  3RZD B;  1NR4 A;  4RCN A;  2K5D A;  2CVR A;  3C1F A;  2BDN A;  1NNX A;  1Y1W B;  4B3R L;  2EYM A;  1QOH A;  4LW1 A;  1K9M C;  5E4W C;  1OXS C;  2ZXR A;  1HFG A;  2ZM6 Q;  1UE6 A;  3VYT A;  2FMC A;  4RWS C;  2B2Y C;  3S16 B;  2Z6B A;  5JPM C;  4CKB A;  4A3I H;  1Q82 C;  4QL5 A;  1EFW A;  1L2F A;  2Z0S A;  4NXN Q;  1KAB A;  2LSS A;  2ZM6 L;  2HIV A;  1YI2 A;  5FK9 C;  3X3N A;  2F0H A;  1BUV T;  1PH5 A;  2ZJR A;  1N9W A;  4L63 B;  1PFN A;  1CKN B;  1O7Z A;  2B63 H;  1ICW A;  2CH4 A;  5ELB A;  4NXN L;  1I4R A;  3S15 H;  2XNA C;  1DZ1 A;  1PYS B;  3RLO A;  4FXK C;  4C3I B;  4ZQ3 A;  3HZX A;  1EQQ A;  1L1O B;  1CFM A;  1BCP C;  2H4O A;  4RHR A;  1XMO Q;  4KI0 A;  1CKO A;  4DV1 Q;  1AW7 A;  1V9P A;  4HAE A;  3HOV H;  5ELF A;  2R93 G;  3TEH B;  3SXH A;  3Q22 A;  2E2H B;  1SDF A;  1K83 H;  3D31 A;  2JSO A;  4A3K B;  5G3L D;  1TII D;  1LO5 D;  4PZ6 A;  1VMP A;  2R7Z H;  3MWY W;  2EYL A;  4DV1 L;  1WTQ A;  2KCM A;  1ET9 A;  3ERO A;  1B1Z A;  1RTO A;  4A3M H;  3GTM B;  4A3E B;  5C4H A;  1OXU A;  3UDI A;  4A3L H;  4GNX A;  1A6X A;  1QUQ B;  4HJ9 A;  1FNU A;  5COY A;  1D5X C;  4IJH A;  1TWH B;  4GOP A;  3K8A A;  3NP8 A;  5GAG C;  3KOJ A;  2B2V A;  2C9O A;  2PO4 A;  3PO2 B;  4C1N K;  1J9O A;  4UHV A;  4WJ4 A;  4MIU A;  1D2B A;  1G29 1;  2NWG A;  4LF6 Q;  1JJC B;  2JA7 B;  1AE2 A;  2EDG A;  3H6M A;  4XYQ A;  4L6T B;  1ONL A;  5GAH C;  2L9H A;  1AN8 A;  3PCO B;  4LF6 L;  3OW7 A;  3CXC A;  2NVQ B;  1NJI C;  4R4I A;  4A76 A;  3J80 c;  3L3O C;  2Z6K C;  1V1Q A;  3WOF A;  3CCU A;  4BBR B;  1H9M A;  3K5M A;  3A7L A;  1D1K A;  1IBK Q;  3E3X A;  1K0R A;  3J80 E;  3GD7 A;  3UDF A;  2O2L D;  3GTK B;  2FFK B;  3KF6 A;  4OWW B;  2K5W A;  2PI2 E;  1Y1W G;  1NBW A;  2NVT B;  2LKV A;  5COR A;  4Y52 H;  2R7D A;  4CHT B;  1SR3 A;  1XX8 A;  2OTL A;  5K5P A;  1K3B C;  4HJA A;  1FNV A;  1Z7T A;  1HNZ L;  2R92 H;  1SAP A;  2YV5 A;  3LX0 A;  1K28 A;  4A3B H;  5JJL A;  1MHW C;  1Q12 A;  3EIV A;  3T56 B;  2JP1 A;  4XXE A;  2A68 C;  3KFU A;  1BCP B;  3DXJ C;  1TS5 A;  2K5Q A;  3A7A B;  3U50 C;  1PRT F;  5M3M B;  4LF9 Q;  1EY5 A;  2QKI C;  5IYC G;  4KJN A;  2VNU D;  1K8O A;  3ULP A;  1QZH A;  1BBW A;  5EBC A;  2LS0 1;  1A0I A;  1RJT A;  2KEE A;  3WWV A;  1YIT A;  3S1N H;  3SDZ A;  2AKW B;  4C3I G;  2UU9 L;  1HA6 A;  2DN8 A;  4LF9 L;  2B8G A;  2B63 B;  4N9T A;  4LNQ A;  2O4X A;  1CI3 M;  2N49 A;  3NK9 A;  3RNU A;  3S1M H;  3P1H A;  2MGS A;  2OF1 A;  1ROD A;  1RIP A;  2EXZ A;  4XQQ A;  3M3Y H;  3A5Z B;  3FPU B;  2F0D A;  1PH1 A;  5A35 A;  2IWH A;  4A3K G;  4YWL A;  4CKC A;  4TSS A;  4KJO A;  2WV6 D;  1SYD A;  4BY1 H;  3J7A F;  3M4O H;  3K80 C;  1LT6 D;  2PMZ E;  3DMU A;  4DV4 Q;  1BNZ A;  5IGF A;  4A3E G;  2E74 C;  2R7Z B;  1TWF H;  3NUC A;  4UDU C;  1G51 A;  2ZT9 C;  3BU2 A;  3NQI A;  2QDL A;  5ELC A;  4DK1 A;  1I6V C;  4DV6 Q;  4A3M B;  2QDB A;  4DV4 L;  4JPB W;  2NYZ D;  3MAQ A;  2OXP A;  1PH7 A;  1CSQ A;  3PO2 G;  5C4J H;  3K57 A;  3A56 A;  1B3A A;  3F8T A;  2JYO A;  1EIY B;  1V1P A;  4OGQ C;  3NPP A;  3S24 A;  3HOX H;  2JA7 G;  3DHQ A;  2OTJ A;  3BVG A;  1WI5 A;  4TRD A;  4FDB A;  2NVX H;  2CFM A;  4X64 Q;  1LT5 D;  3NEN A;  3OMC A;  5EBD A;  3EBE A;  5IYB H;  2JA5 H;  3DEO A;  3SVM A;  1PTO C;  5CYU A;  5I6W A;  1YZ6 A;  1YNJ C;  5I9P A;  4DR6 Q;  4BBR G;  4X64 L;  2D5D A;  4A3D G;  1O78 A;  4LUO A;  2RF4 A;  1MBY A;  3OHX C;  4QB4 A;  1AEX A;  2JA9 A;  3CQZ H;  4RFB A;  4P75 A;  3Q24 A;  4J8Q A;  1X3Q A;  2IT1 A;  1MGS A;  1P8L A;  4DR6 L;  4P2C B;  1D8L A;  4CKE A;  4NKL A;  1STY A;  2OQK A;  3MFY A;  3FHW A;  3L2P A;  1RDP D;  1BBX C;  1NR2 A;  1WTH A;  5EKL A;  2PW7 A;  1LAC A;  3GTQ H;  4OON A;  3NTK A;  4RMF A;  2CW0 C;  2EQS A;  2QF7 A;  1EYG A;  5L37 A;  3KF8 A;  3TME A;  1I50 H;  2RDH A;  4NB3 A;  1EOV A;  1WD1 A;  1VQA A;  1I6H B;  3N6R A;  3K5N A;  1B9M A;  3URY A;  4FF3 A;  4HED A;  3HGB A;  4A3B B;  1STN A;  4IUT A;  4A3I G;  4LK1 C;  3SK8 A;  3CCM A;  3D4D A;  1QJO A;  2P5Z X;  4XIG S;  2NN6 H;  1STG A;  4NPS A;  2E76 C;  3QOJ A;  5C3X A;  1YIJ A;  3OTO Q;  1DCZ A;  4FF4 A;  5CV9 A;  3NHH A;  3K7U C;  3ER0 A;  5EPL A;  1O80 A;  1GUW A;  2B63 G;  1F9S A;  5C3E H;  1IBL Q;  1EZ8 A;  2JN4 A;  2B2T C;  4JOI C;  4K2L A;  1L0W A;  1SYB A;  4X6A H;  2XSC A;  4QY7 A;  4YWM A;  1HNW Q;  3HOV G;  4LF7 Q;  5FLM G;  1Q90 A;  3M3Y B;  2MFI A;  2VUM B;  4EVO A;  2F0J A;  2NN6 I;  4EQO A;  1GM5 A;  3K0X A;  5G3L F;  2PZW A;  5IGE A;  2R7Z G;  3RMH A;  4B08 A;  1FNW A;  3GP7 A;  4KKU A;  1HNW L;  3PUX A;  4LF7 L;  3M4O B;  1N8R C;  4PMB A;  1DYQ A;  1H9S A;  1H95 A;  4A3M G;  3M85 A;  1L0X B;  5C0X J;  2WP8 J;  5LMU Q;  1B44 D;  2L12 A;  1HXY D;  2RSO A;  2O5J C;  1PTO B;  1U5K A;  4QIW B;  3LGJ A;  2M9V A;  3FKI H;  1MSH A;  1Q1B A;  1S5B D;  1JOO A;  3UE0 A;  1S4Z A;  3BVZ A;  1PDQ A;  3NEL A;  4AH6 A;  3NBH A;  4MNO A;  3FPP A;  1AE3 A;  1HQM C;  3IAY A;  2QW7 A;  1GO3 E;  1HQR D;  5LHY 1;  1G2T A;  4QQB X;  4KLK A;  1X65 A;  2ICI A;  3HOX B;  1QG7 A;  1IYV A;  2JEB I;  1A63 A;  1GHK A;  1MKH A;  4I65 A;  2OEO A;  2YTX A;  3VR5 A;  1WJJ A;  1QCB D;  1STB A;  3TQY A;  1CK1 A;  4AYB B;  3H3V H;  5C44 H;  4XT1 B;  5BR8 Q;  1VQP A;  1ILP A;  3KLR A;  3TBI B;  3BDC A;  1SNC A;  1UAP A;  2BE5 C;  2FIN B;  4Q0F A;  5IWA Q;  3V05 A;  4FP5 D;  4YHH Q;  3KF6 B;  2X6L A;  1PH6 A;  1C0A A;  5BR8 L;  1ZYR C;  2D0O A;  3IFT A;  2N3S A;  3WOE A;  3CQZ B;  2ALY B;  4DK6 C;  2NZO A;  4KTA A;  1CUK A;  1TS2 A;  2TMP A;  5AJ3 Q;  5IWA L;  1WVL A;  3VR4 A;  4YHH L;  4IQZ A;  3BDL A;  5CMD A;  2F4I A;  2M2L A;  2KUM A;  4X3T A;  2R92 G;  2F0M A;  2K52 A;  4A3B G;  3D4R A;  4JI3 Q;  5IE8 A;  1EY7 A;  5IT9 c;  1I50 B;  1HZ9 A;  4LF4 Q;  5GAD C;  5AJ3 L;  5ELD A;  4FXG C;  3RR5 A;  3NTI A;  1VQM A;  1SNO A;  4A3G B;  2F0U A;  1LTG D;  3AFQ A;  4G7O C;  4JI3 L;  3CHB D;  2PZU A;  4LF4 L;  1Y8N B;  2KCN A;  4U68 A;  1OXV A;  3PF5 A;  1T5E A;  4HSV A;  2RCF A;  2QEX A;  1PV4 A;  2K28 A;  4CDF C;  2EJF C;  1BO0 A;  5C0X H;  3OYY A;  1GUG A;  5C3E B;  5FLX L;  2WAQ G;  4KHP Q;  1B9N A;  3NWT A;  1HTL D;  2RQX A;  2VUM G;  1XNR Q;  2XN9 C;  1E2V A;  3ONA B;  1SNP A;  1R9T B;  1QIL A;  3KJP A;  1Y8P B;  3S9W A;  4BY1 G;  1VQB A;  4KHP L;  4FNF A;  2VQF Q;  1M90 C;  5A2Q E;  2Z1C A;  1EEI D;  1HZC A;  4NXM Q;  4PZ8 A;  1CHQ D;  2E2I H;  3HEJ A;  1XNR L;  3L0O A;  4G7Z C;  2KED A;  5M5X H;  1X56 A;  4OO1 H;  2X6G A;  2G9D A;  1A3V A;  1PMR A;  3HKZ G;  4JI2 Q;  3FP9 A;  4BA1 I;  3J81 L;  2VQF L;  4RHS A;  1HUN A;  3MA2 B;  3BYY B;  2Q2I A;  4NXM L;  5C0X I;  3ULJ A;  4UPA A;  4DR4 Q;  1L1O C;  5D3I B;  2K33 A;  5ELO A;  1EIG A;  3KLW A;  1I4P A;  2MHV A;  3NWS A;  1NMG A;  3I4O A;  4YIJ A;  5DM7 3;  2WAC A;  4AQY Q;  3S1R H;  1SXT A;  3FKI B;  5KNC A;  1IBM Q;  4DR4 L;  2Z9H A;  4NW2 A;  1WTV A;  4ZLT F;  3U4V A;  2D2C C;  2A68 D;  2UUC L;  3E6Z X;  3HOX G;  5JEA J;  2J4X A;  4IFD J;  3R93 A;  4HIM A;  5GQO A;  1JE4 A;  4XT3 B;  3BS1 A;  4ILW A;  3TP8 A;  4AQY L;  3X3M A;  1U4M A;  5E7N A;  1IBM L;  4OO1 I;  2RHQ B;  1VQK A;  1B8A A;  1PYW D;  3RZO H;  4HCE A;  1O7Y A;  1RKN A;  4AYB G;  1LT3 D;  2WFW A;  5IYB G;  2EVB A;  3F2U A;  4PV1 C;  1X55 A;  2MP1 A;  3HFZ B;  4DV0 Q;  1LTS D;  3KBG A;  5M5W H;  1F2M A;  2X69 A;  4KHV A;  3RD4 A;  1S5E D;  2F0E A;  2F3I A;  3DEP A;  2MO0 A;  2I0Q A;  3TZU A;  4DR7 Q;  5D14 A;  1TS4 A;  4K8I A;  3H91 A;  1YBY A;  4BY7 H;  1B2T A;  2EE1 A;  1RTN A;  3I70 A;  1DXM A;  1EEF D;  1BF4 A;  2RDG A;  1NCV A;  3MXP A;  2A19 A;  4DR7 L;  3JAM c;  2F0Q A;  4C2M H;  1VQ5 A;  1EU4 A;  4J1M A;  1E22 A;  4V19 0;  1F9Q A;  5JVG 3;  1VQD A;  2O5I C;  1QNK A;  3QB3 A;  3JAM E;  1YHQ A;  4A3G G;  3OWE B;  2BDO A;  4OHJ A;  1SFO B;  1I94 Q;  3KDF A;  2KQ3 A;  2NVY B;  2B2U C;  4XQJ A;  3P7J A;  2C5C A;  3SGI A;  1K3R A;  4MTN A;  1OXX K;  4KY5 A;  5FO7 B;  2EYH A;  2SOB A;  2NN6 G;  5JPN C;  1I94 L;  4K2K A;  3DWA A;  2F0P A;  4BBS H;  3SEB A;  2JA6 H;  5HY6 A;  1GVP A;  4TKO B;  5DAU A;  2WB1 B;  1I4X A;  4MHE A;  5C3E G;  3ZYY X;  3T1Y L;  2F0N A;  2L4N A;  4KN4 C;  3GV3 A;  4K14 A;  2A6E C;  2HUG A;  4IO9 A;  1CT1 D;  2NUC A;  2HQE A;  2XTI A;  1F2L A;  3J81 i;  1ASY A;  3IRB A;  4YY3 Q;  4MN3 A;  1HZA A;  5LMN W;  2DGY A;  4QF4 A;  4DUY Q;  1PTO D;  1YNJ D;  2R6G A;  1JE5 A;  1AFP A;  4CDC C;  1KDB A;  1H9S B;  1IKL A;  2F0L A;  2E5L L;  3R8B A;  2WIN B;  5JEA H;  4IFD H;  4HJ8 A;  1LTL A;  3U58 A;  1XJV A;  4YY3 L;  4DUY L;  4GLV B;  1LUZ A;  1Q3L A;  1KIX A;  4ZCK A;  4FXD A;  4RGO S;  2WKD A;  4YWK A;  1MSG A;  4IPH A;  4A3C H;  3EFX D;  1IXR A;  2NZ1 D;  3CW2 C;  4POG A;  3FKI G;  3KLS A;  4MZ9 A;  2CW0 D;  3NTH A;  2I5H A;  2XRQ D;  3PO3 H;  3ULL A;  3NBH B;  1EZ6 A;  3SK5 A;  1UE5 A;  3PUV A;  3VDY A;  4JCV E;  4R8N A;  3H94 A;  3I2Z A;  3ITP A;  2RVL A;  4J6H A;  5KRU A;  5D3D A;  1EYA A;  4QCL A;  4IFD I;  1TS3 A;  5CBA E;  1Q86 C;  1PHJ A;  3I4M H;  3SK6 A;  2M00 A;  1XPO A;  2K14 A;  3J80 L;  4HSP A;  5BN5 A;  2KEN A;  3KJO A;  2JEA I;  3E5S A;  4H7B A;  4A3J H;  4LWC A;  3N52 A;  5E3F A;  4ZUJ A;  5C44 G;  5GRO A;  1F77 A;  5IGD A;  3MTS A;  4LFC Q;  4K6L A;  1O7L A;  1A3U A;  5BN4 A;  1BXT A;  1EY4 A;  5M5W B;  2E2J B;  4CGY B;  1DGS A;  2JXM B;  2V4D A;  1IHZ A;  1VQO A;  4A3D B;  4LJZ C;  1CZG A;  4QJF A;  3QOL A;  4GS3 A;  4J15 A;  1BDO A;  1TY2 A;  3CRL C;  4LFC L;  1YHB A;  1HNZ Q;  1KD1 C;  4BY7 B;  1JWM D;  1JT8 A;  4HJ5 A;  3DLL A;  1JJ2 A;  4ZKB B;  2IX3 A;  1W6J A;  2DNE A;  3D0F A;  1JMC A;  5CGK A;  3BJU A;  1B53 A;  4RH6 A;  1J8I A;  4WFN 3;  5IYD H;  3BYT B;  1VQN A;  3VR6 A;  2VL6 A;  4DR1 Q;  1Y8O B;  1ZEQ X;  2EYO A;  1G2S A;  5I6Y A;  3I4N H;  1VQ8 A;  3BG3 A;  1HRJ A;  4DN4 M;  4H0L C;  1KTK A;  1G6P A;  4FO2 A;  3TRE A;  3M4P A;  2UU9 Q;  4DR1 L;  2EXD A;  3ICE A;  3PQI A;  1TWG H;  4A3I B;  1Y1V H;  5IOD A;  1CTM A;  4V0B A;  2ID0 A;  2DY8 A;  2WB1 G;  1XPR A;  1I4H A;  1C9O A;  1TVX A;  5FKA C;  2JA6 B;  3S1Q H;  4L8J A;  4FF1 A;  4CJ1 B;  4ALP A;  5C0X G;  5CV6 A;  2HD3 A;  4P74 A;  1VQJ A;  3S15 B;  1W6K A;  4IUV A;  4DNI A;  1SRU A;  2VW9 A;  3A8J E;  2XWB B;  4ID6 A;  5CV7 A;  4GLX A;  3HOV B;  5JJZ A;  2SNM A;  1XNQ Q;  4UP8 A;  2K01 A;  4K5X A;  1K83 B;  2BE5 D;  5EPJ A;  5F2D A;  1PRT B;  4ME5 A;  4KKT A;  1CHP D;  1EYD A;  1DJR D;  2PNH A;  4OO1 G;  4JI8 Q;  3OIP A;  1PZK D;  1HUM A;  1XXG A;  1S3O A;  1ZYR D;  1XYI A;  1XNQ L;  2N78 A;  1B50 A;  5EQ0 A;  2DNC A;  3WDN A;  5CV5 A;  1V8Q A;  2F03 A;  2UUA Q;  2N88 A;  2ENB A;  2VQE Q;  3PMF A;  3J80 i;  2KVM A;  3HOZ H;  5JJK A;  4JI8 L;  1E1O A;  1LT4 D;  1WFQ A;  3PUY A;  5JOB A;  1KNE A;  2BA1 A;  1EY0 A;  4A3F H;  2UUA L;  3PO3 B;  4IOA A;  3R2T A;  4HID A;  1DOK A;  2AQ1 B;  2VQE L;  3OWF A;  2OT2 A;  3TSS A;  3W2D A;  2VB2 X;  1SMY C;  2A8V A;  4OL7 A;  1R4Q B;  1SJH D;  1DOL A;  2PQA A;  3M4Y A;  4R4T A;  5KGU A;  1TQO A;  1QVC A;  1PH3 A;  4GNX C;  1HR0 Q;  1I4Q A;  3O13 A;  1MJC A;  4GOP C;  1HZB A;  1JOR A;  2MJ8 A;  3MXN A;  1QVG A;  1UE1 A;  2B2V C;  3VA5 A;  3QO2 A;  3DWQ A;  1H9R A;  1SYE A;  4A3J B;  1OTC A;  2WKC A;  3G7L A;  2N55 A;  4KHZ A;  3A5U A;  1HR0 L;  3G6J B;  2SDF A;  1JWU D;  2F0O A;  5KNB A;  4BY7 G;  1EIF A;  1NY4 A;  4DK0 A;  2OCE A;  3W1B A;  3STB C;  4LFB L;  5CV8 A;  5EAY A;  5ELN A;  1Q1E A;  5BN3 A;  5J39 A;  4DUZ Q;  3SR1 A;  5KEE A;  4DFA A;  2QEJ C;  2BA0 A;  4JI7 Q;  2A74 C;  3S17 H;  4RGN A;  1PZI D;  2KEC A;  2AQ3 B;  2F0K A;  2F0T A;  3UE1 A;  1Q81 C;  4B9X A;  1I3Q H;  4H13 C;  1ENC A;  4DUZ L;  3KDF B;  3U9S A;  3OW2 A;  4PMW A;  5JJI A;  2AWO A;  1JC7 A;  2R92 B;  2HQL A;  2KCC A;  4N8F A;  1PH2 A;  4Y7N H;  1STA A;  4JI7 L;  1EIH A;  3QR8 A;  1PA6 A;  2RKS A;  4IOC A;  5M5Y H;  4IAL A;  2I5L X;  1SYF A;  2V1C C;  1CA6 A;  4JW0 A;  1WTR A;  1JWS D;  5E4X A;  2JA6 G;  4C3H H;  3T51 B;  4EQP A;  2SEB D;  5IP7 H;  4B3T Q;  3Q6S A;  3CCJ A;  2HT1 A;  1BOS A;  2CWP A;  3QJY A;  3SK4 A;  3HS0 C;  1D5Z C;  1PH8 A;  4BS9 A;  3J7Y W;  3S1N B;  4OEM B;  1LTB D;  1C7Y A;  4RG1 A;  3HRZ C;  1E24 A;  2AUK A;  4CDD C;  4B3T L;  1GKH A;  2XRS D;  3PIO A;  4X65 L;  4PMC A;  2WAQ B;  3CCV A;  3S1M B;  3I8Z A;  1YNN D;  5HUR A;  1PVO A;  2IJ0 A;  1LLR D;  2EJM A;  1PTO F;  1U0L A;  1TKW B;  3K5L A;  3NXW A;  3E9I A;  2I07 B;  2A5H A;  2SNS A;  4IUP A;  4BY1 B;  5JEA G;  1D6E C;  1WCM H;  3GTL H;  3J7A V;  4IFD G;  2OQ0 A;  3T1H Q;  1E2Z A;  4CJ0 B;  2ES2 A;  3SHL A;  4F88 A;  4JBW A;  3L7Z C;  2YYZ A;  4GNX B;  1JB7 A;  4A3L G;  5EJW A;  1KHI A;  3J7A 5;  1SNQ A;  1GOZ A;  1TWF B;  4DXG A;  3HKZ B;  4ZYS A;  3RLF A;  2JE6 I;  1X3P A;  4GOP B;  4A3C G;  3T1H L;  2AMC B;  2KHJ A;  5CBE E;  2ZTD A;  1HCZ A;  2YU9 H;  2UUB Q;  3GTP H;  3PO3 G;  1E1T A;  5GAE C;  2FJ2 A;  4BA2 I;  4EGV A;  5H1S E;  4GKK Q;  3TS2 A;  2F0G A;  1X3F A;  1K73 C;  1SE8 A;  2L11 A;  5C4J B;  1H9K A;  3RUZ A;  4K5W A;  4A75 A;  5C5L A;  1PLF A;  2R3Z A;  4ZAI A;  4HR7 B;  2UUB L;  3OOC A;  3I4M G;  4GKJ Q;  4GKK L;  1PZJ D;  4OIK A;  4B9W A;  1CM9 A;  2PI2 A;  2Y0S B;  2WAQ E;  2NVX B;  3P20 A;  4O2D A;  3FDT A;  2K5N A;  4A3J G;  3S14 H;  2KHS A;  3OMG A;  4TVA B;  1VQ4 A;  2F4V Q;  2CH4 W;  1ICF B;  4GKJ L;  1LTI D;  2JA5 B;  2QCP X;  1V43 A;  5ELE A;  2KHI A;  4GN4 B;  1EUJ A;  4B3S L;  2A6E D;  2GN5 A;  4JI1 Q;  4N8X 1;  4QUC A;  1EFI D;  2F4V L;  1BCP D;  3AQQ A;  4FF2 A;  2J0T D;  4OIJ A;  3CU7 A;  4JV5 Q;  1NAP A;  1FR3 A;  4A4I A;  3HKZ E;  4K8J A;  1EY9 A;  4QIW E;  4JI1 L;  5J1Z A;  4DKA C;  4P73 A;  1YVC A;  2B8F A;  3GTQ B;  5IYD G;  4L5T A;  3K6O A;  1RCV D;  2A6H C;  3F1Z A;  3VYS A;  1GUT A;  2B2Y A;  5CR3 A;  4JV5 L;  3S17 B;  3H3V I;  1HJP A;  1STH A;  1I3Q B;  2LMC B;  1GUO A;  3H3V C;  4JBJ A;  2VS1 A;  2XIW A;  3HG9 A;  4KY7 A;  5IT9 E;  4JG2 A;  2KBN A;  5FOB B;  1VQ9 A;  1KNA A;  1XPU A;  4HTH A;  1Y1V G;  3FMC A;  4JBK A;  1JJG A;  5M5Y B;  3FEW X;  4X3U A;  3U4Z A;  2R7F A;  3TDQ A;  1AH9 A;  4RGM A;  4TQU S;  3S16 H;  3AB9 A;  3QWN A;  2K32 A;  4AYB E;  1ESR A;  1I5F A;  3IFD A;  2L0C A;  4LUV A;  2Q2T A;  5A2Q L;  1C48 A;  3ZJY C;  1VQ6 A;  1SSO A;  1D7Q A;  4UP7 A;  3NE5 B;  1EWI A;  1S5D D;  2NTT A;  4F87 A;  1SMX A;  3LWE A;  1GUS A;  1EQR A;  3AEV A;  3W3A A;  4IUQ A;  1EY6 A;  4WOR A;  1R4P B;  1ASZ A;  2E2D C;  3PUW A;  5J22 A;  3AU7 A;  2JA8 H;  3NSW A;  3CCS A;  4OWX B;  3DM1 A;  2WII B;  4GZY C;  2RBM A;  1A15 A;  1KDC A;  4KK7 A;  3VYU A;  5C3W A;  3SE0 A;  1IL8 A;  1JOK A;  3S2H H;  1NTG A;  2E2H H;  2K6A A;  3MXU A;  3PIO 3;  1IYU A;  3OSO A;  3CMA A;  3F2D A;  4XTC S;  2I5M X;  4P72 A;  1PFB A;  2EY5 A;  1EL0 A;  1BVS A;  2UUC Q;  1Z9F A;  1FGU A;  3HOZ G;  1E2W A;  4DNT B;  3S2D H;  4EQ5 A;  1V1P B;  3CD6 A;  5T1I A;  4GN3 B;  5E1F A;  3PSI A;  1F9R A;  1UEA B;  4RKB A;  5JVH 3;  2YU9 B;  3GTP B;  3BZD B;  3I55 A;  3G71 A;  4XQN A;  4X66 L;  4DPG A;  1KLU D;  2RHS B;  3PUZ A;  1N32 Q;  1GHJ A;  2B3G A;  3CKI B;  3CCQ A;  4BXX H;  2Y0S G;  4CDE C;  4ZK9 B;  1VMC A;  1EWC A;  3UI2 A;  2VB3 X;  1EU3 A;  1PYB A;  2D62 A;  4C56 C;  2JA5 G;  1N32 L;  2Z6K A;  3H09 A;  4HMI A;  1IW7 C;  1MJE A;  1RD9 D;  4PQX A;  3S14 B;  5IOC A;  2I46 A;  4JVZ A;  3J7Z C;  2K05 A;  2HIX A;  2K1B A;  5C44 B;  5FJ8 H;  2J7Z A;  1KDA A;  3JAM L;  5KYL A;  3DM3 A;  3R2I A;  1PXU A;  4DAP A;  1A2U A;  2NVQ H;  1LV9 A;  4RKL A;  5IP9 H;  1F2Z A;  2EYJ A;  2C35 B;  1TWC H;  4XYO A;  4R4C A;  1TWA H;  3KF8 B;  2EY1 A;  1Y14 B;  3HP3 A;  3BZC A;  4DK3 C;  2F0V A;  1JOQ A;  2EY2 A;  2AWN A;  4A93 H;  2H5X A;  2ZJQ A;  4IPD A;  1DOM A;  1TR5 A;  3T4A C;  3M7N A;  3F2C A;  4UAI A;  5M3F H;  1XMQ Q;  2UXD Q;  2BOS A;  2EJG C;  1N36 Q;  1J6Q A;  2QIL A;  3T1Y Q;  3G4S A;  1FVI A;  1X3G A;  1TT2 A;  1KAA A;  4KD4 A;  4LUZ A;  1XMQ L;  1Q7Y C;  2UXD L;  4KV6 A;  4C3H G;  5IP7 G;  1N36 L; 
#chains in the Genus database with same CATH homology
 1T9H A;  4XIG S;  3TS0 A;  1QZG A;  2WB1 G;  2IHF A;  3CPW A;  4NPS A;  4OXP A;  1XPR A;  1C9O A;  3GTG H;  1YIJ A;  3OTO Q;  5M3M H;  3K7U C;  1WOC A;  3S1Q H;  1VQ7 A;  3HOW G;  3ER0 A;  2K50 A;  4H02 A;  2ZTC A;  4IPC A;  5IYC H;  1VQG A;  3EN2 A;  4ALP A;  2B63 G;  5C0X G;  5C3E H;  1KAW A;  4P74 A;  2MO1 A;  1IBL Q;  2E5L Q;  1VQJ A;  1P16 A;  1A62 A;  2K75 A;  4C3I H;  2A1A A;  2F52 A;  1FJG Q;  1IL2 A;  4JYA Q;  3CCE A;  4YCU A;  4JOI C;  4DNI A;  1L0W A;  1SRU A;  4X6A H;  1IZ6 A;  1KXL A;  1UWV A;  2VW9 A;  1NMF A;  2L15 A;  1GD7 A;  3AFP A;  4QY7 A;  4LFA Q;  4YWM A;  3F2B A;  1HNW Q;  3HOV G;  2DUD A;  4GLX A;  3CCR A;  4LF7 Q;  5FLM G;  1XNQ Q;  1WCM G;  2D0P A;  4UP8 A;  1FJG L;  2MFI A;  4JYA L;  4JBM A;  4L5Q A;  4DAY B;  4A3K H;  2NN6 I;  1GM5 A;  1KC8 C;  3K0X A;  5FLX c;  4LFA L;  2R7Z G;  4OO1 G;  2PNH A;  3STB D;  5FLM H;  4JI8 Q;  3J81 j;  1HNW L;  3PUX A;  4X66 Q;  4DR5 Q;  4LF7 L;  1S3O A;  1N8R C;  1XNQ L;  2N78 A;  1N34 Q;  1H95 A;  3GTM H;  4A3M G;  4POF A;  3M85 A;  5C0X J;  4A3E H;  4A3L H;  2WP8 J;  2UUA Q;  5LMU Q;  2HHH Q;  4X62 Q;  1XMO L;  1HH2 P;  4A3F G;  2VQE Q;  3J80 i;  3HOZ H;  1VQE A;  5JJK A;  4JI8 L;  3PV0 A;  1W3S A;  1U5K A;  4OWT B;  4DR5 L;  3LGJ A;  2PQA B;  1K8G A;  1UE7 A;  1E1O A;  1WFQ A;  3FKI H;  1Q1B A;  2WB1 E;  3PUY A;  3HOY G;  1TWH H;  4UP9 A;  1N34 L;  2BA1 A;  3UE0 A;  1YJW A;  3HOU H;  1LM0 A;  4A3F H;  1YEZ A;  2UUA L;  2HHH L;  4X62 L;  1X6O A;  3KYH C;  4IJL A;  4HID A;  3K81 C;  4IOA A;  3PO2 H;  2VQE L;  1CKM A;  4JI2 L;  1XTD A;  3MXN B;  3JAM i;  3J81 c;  3NEL A;  4AH6 A;  4GN5 A;  4MNO A;  1KL9 A;  1AE3 A;  1PFS A;  3GO5 A;  2A8V A;  4R1J A;  1RL2 A;  1GO3 E;  2PQA A;  4R4T A;  3RLN A;  4QQB X;  4KLK A;  4JI0 Q;  3JC6 6;  1QVC A;  1PH3 A;  1X65 A;  2JA7 H;  2IX1 A;  4GNX C;  1YJN A;  3K7A H;  5HGQ A;  1W2B A;  1HR0 Q;  2JEB I;  1E3P A;  1A8V A;  1MJC A;  1N33 Q;  1A63 A;  1VQC A;  4GOP C;  1HZB A;  1B7Y B;  1MKH A;  2VY3 A;  2YTX A;  1QVG A;  1UE1 A;  1NE3 A;  1S72 A;  5LMN Q;  1WJJ A;  2BH2 A;  1OTC A;  4JI0 L;  2K5V A;  3TQY A;  2UXC Q;  4P71 A;  3E9H A;  3H3V H;  3AYH B;  5C44 H;  3A5U A;  4KHZ A;  5BR8 Q;  1HR0 L;  1B70 B;  1SRO A;  2ZTE A;  1VQP A;  3HKS A;  1N33 L;  3PF4 A;  1YHA A;  1M1K C;  2E2J H;  4BBR H;  4BY7 G;  2JJQ A;  1EIF A;  1NY4 A;  1X3E A;  1O7I A;  2OCE A;  4B3M Q;  3W1B A;  5IWA Q;  5LMN L;  4JI4 Q;  4A3D H;  3STB C;  4YHH Q;  4LFB L;  3KF6 B;  2B29 A;  5EAY A;  1Q1E A;  5ELN A;  4DUZ Q;  1PH6 A;  2UXC L;  1IYJ B;  3I7F A;  5BR8 L;  1C0A A;  2D0O A;  4ME3 A;  2N3S A;  3GTK H;  5C4X H;  4DV0 L;  2ALY B;  4DAM A;  2BA0 A;  2Q2U A;  5J3B A;  4JI7 Q;  4B3R Q;  3S17 H;  4DK6 C;  2NVT H;  2NZO A;  2E8G A;  2EIF A;  1CUK A;  3H0G G;  3UE1 A;  2CQO A;  5AJ3 Q;  5IWA L;  2K4K A;  3G6E A;  1Q81 C;  1TXY A;  1I3Q H;  1VQH A;  4YHH L;  4JI4 L;  4DUZ L;  3KDF B;  4B3M L;  4EX5 A;  4WJ3 M;  3OW2 A;  4JC0 A;  4PMW A;  2AWO A;  2R92 G;  5JJI A;  2HQL A;  1PH2 A;  4Y7N H;  2K52 A;  4A3B G;  4JI3 Q;  5IE8 A;  4JI7 L;  5IT9 c;  4B3R L;  3W1G A;  1HZ9 A;  1IBK L;  4LF4 Q;  5GAD C;  5AJ3 L;  1I6H H;  3RR5 A;  3G48 A;  4DV7 Q;  4LW1 A;  1PA6 A;  1K9M C;  4IOC A;  5M5Y H;  1VQM A;  1OXS C;  2ZM6 Q;  1UE6 A;  2I5L X;  3AFQ A;  2V1C C;  4A3I H;  4JI3 L;  1Q82 C;  3GDE A;  2JA6 G;  4QL5 A;  4C3H H;  1SN8 A;  1EFW A;  5IP7 H;  4B3T Q;  1L2F A;  2Z0S A;  1OXV A;  4JOI A;  4DV7 L;  3CCJ A;  4APV A;  3M4Q A;  2CWP A;  4HIK A;  3PF5 A;  4NXN Q;  2HT1 A;  2LSS A;  3M9B A;  2ZM6 L;  2HIV A;  2QEX A;  1PH8 A;  1PV4 A;  1YI2 A;  4DR2 Q;  1PH5 A;  5IP7 G;  3HOW H;  2ZJR A;  4GLA C;  1C7Y A;  4RG1 A;  1N9W A;  1E24 A;  4YCW A;  1CKN B;  2B63 H;  3OYY A;  1GKH A;  1FL0 A;  3PIO A;  4B3T L;  4NXN L;  4X65 L;  2WAQ G;  2XGT A;  3S15 H;  1VQF A;  2JA8 G;  3CCV A;  4KHP Q;  1PYS B;  3RLO A;  1EQQ A;  1K8A C;  4UY8 C;  4DR2 L;  1PVO A;  1L1O B;  2VUM G;  1XNR Q;  1U0L A;  2GVB A;  3BZK A;  4JI5 Q;  1XMO Q;  4KI0 A;  3E9I A;  3KJP A;  1CKO A;  4DV1 Q;  2R93 G;  1V9P A;  3HOV H;  3TEH B;  4BY1 G;  1VQB A;  4KHP L;  1X54 A;  3GTL H;  5JEA G;  1WCM H;  2JK8 A;  2VQF Q;  1M90 C;  4IFD G;  2VUM H;  1HZC A;  2OQ0 A;  1K83 H;  1WYD A;  3D31 A;  4PZ8 A;  3T1H Q;  4NXM Q;  2ES2 A;  2E2I H;  3RN2 A;  1XNR L;  3L0O A;  1MIU A;  4JBW A;  4PZ6 A;  3L7Z C;  2YYZ A;  1X56 A;  4JI5 L;  5M5X H;  4GNX B;  1JB7 A;  2R7Z H;  4A3L G;  1KHI A;  4DV1 L;  3J7A 5;  3HKZ G;  4JI2 Q;  2QGQ A;  2KCM A;  3FP9 A;  3RLF A;  2JE6 I;  4BA1 I;  4GOP B;  4A3C G;  2IX0 A;  2VQF L;  3T1H L;  2AMC B;  2Q2I A;  4NXM L;  5C0X I;  4A3M H;  3ULJ A;  4UPA A;  4DR4 Q;  1L1O C;  2KHJ A;  2ZTD A;  2IHE A;  2CKZ B;  1OXU A;  5ELO A;  2KCT A;  3UDI A;  2UUB Q;  3KLW A;  2YU9 H;  3GTP H;  1E1T A;  4LF5 Q;  3PO3 G;  1NMG A;  3I4O A;  5GAE C;  2ATW A;  5H1S E;  4BA2 I;  4GKK Q;  3TS2 A;  4GNX A;  1X3F A;  1K73 C;  1QUQ B;  4AQY Q;  1BKB A;  1SE8 A;  4HJ9 A;  3A74 A;  3S1R H;  3HOY H;  3CPF A;  4IJH A;  1IBM Q;  4GOP A;  4DR4 L;  3K8A A;  4A75 A;  4BXX G;  5GAG C;  3KOJ A;  3U4V A;  2UUC L;  2UUB L;  1QVF A;  3HOX G;  5JEA J;  4LF5 L;  4IFD J;  3I4M G;  4HIM A;  4GKJ Q;  5GQO A;  4GKK L;  4WJ4 A;  4DV6 L;  1G29 1;  4AQY L;  2PI2 A;  2WAQ E;  5E7N A;  1IBM L;  4LF6 Q;  2RHQ B;  4O2D A;  4OO1 I;  1VQK A;  2QA4 A;  1B8A A;  2K5N A;  1JJC B;  4A3J G;  1VQL A;  3RZO H;  4TVA B;  1VQ4 A;  3S14 H;  1AE2 A;  1J5E Q;  4LFB Q;  4AYB G;  2F4V Q;  2OWO A;  2WFW A;  5IYB G;  2GVA A;  4GKJ L;  1X55 A;  5FJ8 G;  1V43 A;  3HFZ B;  2NZH A;  4DV0 Q;  5GAH C;  1VS0 A;  2BH8 A;  2KHI A;  4GN4 B;  3PCO B;  5M5W H;  2JQO A;  1EUJ A;  4B3S L;  5DLQ E;  3CXC A;  2GN5 A;  4JI1 Q;  4LF6 L;  2F3I A;  2CWA A;  2MO0 A;  5IP9 G;  1J5E L;  2I0Q A;  1NJI C;  2F4V L;  3AQQ A;  4R4I A;  4A76 A;  3J80 c;  2K5H A;  4DR7 Q;  2Z6K C;  1V1Q A;  4PZ7 A;  1YBY A;  4BY7 H;  3CCU A;  2N8N A;  3I56 A;  3RN5 A;  1VQI A;  4JV5 Q;  4A4I A;  3HKZ E;  1IBK Q;  2LXK A;  1K0R A;  2AHO B;  3GD7 A;  4QIW E;  4JI1 L;  4DKA C;  4HIO A;  1VCI A;  4P73 A;  4A93 G;  2RCN A;  1YVC A;  3UDF A;  2A19 A;  4DR7 L;  5IYD G;  4L5T A;  3KF6 A;  3JAM c;  4C2M H;  3H15 A;  3F1Z A;  1VQ5 A;  4OWW B;  2PI2 E;  1Y1W G;  4JV5 L;  1NBW A;  1E22 A;  5M3F G;  3H0G H;  3H3V I;  4C3J H;  1HJP A;  1VQD A;  1N36 L;  4HJ7 A;  4Y52 H;  2R7D A;  1YHQ A;  4L5R C;  2IY5 B;  1SR3 A;  2OTL A;  4A3G G;  4HJA A;  4JBJ A;  1I94 Q;  1HNZ L;  2R92 H;  2YV5 A;  2VS1 A;  4JG2 A;  2KBN A;  4A3B H;  5JJL A;  1VQ9 A;  1Q12 A;  3KDF A;  3EIV A;  4DV5 Q;  3PGZ A;  4BBS G;  1XPU A;  3KFU A;  1Y1V G;  3SGI A;  1K3R A;  4O0A A;  4MTN A;  4JBK A;  1JJG A;  4A3G H;  1OXX K;  3U4Z A;  2R7F A;  4R4Q A;  1AH9 A;  4TQU S;  2NN6 G;  4X65 Q;  3S16 H;  2CCZ A;  2Q2H A;  3U50 C;  1I94 L;  5M3M G;  4AYB E;  4JI6 Q;  4BBS H;  1I5F A;  3CC7 A;  4LF9 Q;  2JA6 H;  5HY6 A;  3TRZ A;  1Q8K A;  4DV5 L;  4LUV A;  5IYC G;  2Q2T A;  1GVP A;  2VNU D;  3CC4 A;  3ZJY C;  4DR3 Q;  1VQ6 A;  5C3E G;  3ULP A;  3T1Y L;  1D7Q A;  4UP7 A;  1EWI A;  1BBW A;  3MEF A;  1QZH A;  1BBU A;  1A0I A;  3WWV A;  1SMX A;  1YIT A;  3S1N H;  2AKW B;  2UU9 L;  4JI6 L;  4IO9 A;  1EQR A;  4LF9 L;  3AEV A;  1HR0 W;  3UDG A;  3ERS X;  2XTI A;  4LNQ A;  4DR3 L;  2N49 A;  1ASZ A;  3PUW A;  3RNU A;  3J81 i;  1ASY A;  2JA8 H;  3S1M H;  1CKN A;  3CCS A;  3IRB A;  4OWX B;  4YY3 Q;  4AIM A;  3OTO L;  1PH9 A;  1HZA A;  5LMN W;  1RIP A;  2DGY A;  4DUY Q;  1UEB A;  3M3Y H;  2UXB Q;  3A5Z B;  2R6G A;  1R9T H;  1PH1 A;  1KRT A;  1JE5 A;  4A3K G;  4DV2 Q;  4YWL A;  1L1O A;  2R93 H;  1IBL L;  1HNX Q;  3A0J A;  2E5L L;  1NTG A;  4BY1 H;  3S2H H;  2E2H H;  4HJ8 A;  1LTL A;  3U58 A;  1XJV A;  4YY3 L;  3M4O H;  3K80 C;  3GTJ H;  4DUY L;  2PMZ E;  3CMA A;  4LF8 Q;  2UXB L;  3F2D A;  4XTC S;  2I5M X;  4DV4 Q;  4P72 A;  4GLV B;  2YTY A;  1LUZ A;  4A3E G;  1BVS A;  1KRS A;  3UDX A;  1KIX A;  2UUC Q;  4DV2 L;  2VZA A;  1Z9F A;  1FGU A;  1TWF H;  4YWK A;  1HNX L;  3HOZ G;  1G51 A;  4IPH A;  3BU2 A;  3S2D H;  4A3C H;  4EQ5 A;  4DV6 Q;  3CD6 A;  1IXR A;  4POG A;  3CW2 C;  4K0K Q;  3FKI G;  4GN3 B;  4MZ9 A;  1Q46 A;  4LF8 L;  3PSI A;  4DV4 L;  4DV3 Q;  3HOU G;  2I5H A;  2ASB A;  3PO3 H;  3ULL A;  3NBH B;  3I55 A;  3G71 A;  1PH7 A;  1OXT A;  1CSQ A;  3PO2 G;  1YNX A;  4X66 L;  1UE5 A;  3PUV A;  4DPG A;  3VDY A;  1E7Z A;  2RHS B;  4JCV E;  3PUZ A;  5C4J H;  1KQS A;  1N32 Q;  2B3G A;  3CCQ A;  3I2Z A;  3PIP A;  4K0K L;  3F8T A;  2Y0S G;  4BXX H;  5IY0 A;  1EIY B;  5LMU L;  4DV3 L;  1QUQ A;  4B3S Q;  3S24 A;  3HOX H;  1PH4 A;  2JA7 G;  4IFD I;  3CCL A;  1Q86 C;  1PHJ A;  3I4M H;  1XPO A;  3W5O A;  1PYB A;  2D62 A;  2K14 A;  2OTJ A;  1WI5 A;  2JA5 G;  1N32 L;  3KJO A;  2JEA I;  2KEN A;  4FDB A;  2NVX H;  2CFM A;  4X64 Q;  2Z6K A;  3NEN A;  2ZJP A;  4A3J H;  1MJE A;  3CAM A;  4LWC A;  3EBE A;  3J7Z C;  2HIX A;  5IYB H;  5GRO A;  5C44 G;  5K36 G;  2JA5 H;  4LFC Q;  5FJ8 H;  4OX9 Q;  1YZ6 A;  4PG3 A;  4LF4 L;  3CF5 A;  3DM3 A;  3B6Y A;  4BBR G;  4DR6 Q;  4X64 L;  2NVQ H;  1DGS A;  4A3D G;  4LUO A;  1VQO A;  5IP9 H;  2RF4 A;  3CME A;  4QJF A;  2JA9 A;  4GS3 A;  4J15 A;  2C35 B;  2FXQ A;  1TWC H;  3CQZ H;  4LFC L;  1YHB A;  1TWA H;  3KF8 B;  4R4C A;  1HNZ Q;  5C4X G;  1Y14 B;  4P75 A;  1YJ9 A;  3BZC A;  1KD1 C;  4IPG A;  2IT1 A;  4OX9 L;  1JT8 A;  1P8L A;  4DR6 L;  4DK3 C;  4HJ5 A;  3DLL A;  1D8L A;  2MQH A;  1JJ2 A;  1X9N A;  3GTO H;  2OQK A;  3I4N G;  3FHW A;  3L2P A;  2AWN A;  3D0F A;  1JMC A;  4A93 H;  3BJU A;  4QGU A;  3RZD H;  3GTQ H;  2H5X A;  3CC2 A;  2ZJQ A;  1LYL A;  4IPD A;  2LXJ A;  5IYD H;  4OON A;  3CP0 A;  1VQN A;  4RMF A;  2VL6 A;  4DR1 Q;  3M7N A;  2EQS A;  1Y1W H;  3F2C A;  1EYG A;  5M3F H;  3E0E A;  1XMQ Q;  3I4N H;  1I50 H;  1VQ8 A;  2UXD Q;  4R4O A;  4NB3 A;  1EOV A;  1VQA A;  1N36 Q;  1J6Q A;  2Y0S E;  3T1Y Q;  1SFO H;  4L5S A;  1G6P A;  3TRE A;  3G4S A;  1SLJ A;  1FVI A;  1S40 A;  3M4P A;  1CSP A;  1X3G A;  2MNA A;  2NVY H;  2UU9 Q;  4DR1 L;  2EXD A;  1Z47 A;  3ICE A;  2YTV A;  3NEM A;  4A3I G;  1TWG H;  4LUZ A;  1XMQ L;  1Q7Y C;  2UXD L;  1Y1V H;  3Q8D A;  2ID0 A;  4YCV A;  3CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...