3S15H

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s15H00
2CFMA 2HQLA 3SGIA 2AMCB 2EQSA 3K80C 4BY1G 4YCWA 3JAMc 3CCUA 2Q2TA 1KQSA 1BBUA 5C0XG 1EQQA 4B3SL 2E2JH 1XMQL 4JI5Q 3AQQA 4A3LG 4DAYB 1VQJA 2HT1A 1A0IA 3EIVA 4L5SA 1KRTA 1KHIA 4UPAA 3TQYA 5IP9H 1EOVA 4DV2Q 4A3FH 1XMOQ 2BA0A 3M9BA 1KRSA 1YHAA 4HJ7A 2Q2IA 2UXDQ 3PIOA 1NE3A 1AH9A 5LMUQ 2JJQA 4DR6Q 4DR7Q 3ZJYC 1I94Q 1MKHA 1VCIA 2K50A 4EX5A 1ASZA 2E2HH 3J81c 1BVSA 1QVCA 1VQIA 1PH1A 4LF7L 5ELOA 4HIKA 4JI8L 1PH7A 4C3JH 3OW2A 5C44G 2FXQA 1EQRA 2VQEL 1XTDA 1CKOA 1Q82C 4JBMA 4X62Q 5JJKA 5M3MG 1XPRA 3T1YQ 1L1OC 3KYHC 1EIFA 2GVBA 1HH2P 4LF6Q 3HKZG 2R7DA 4YHHL 1VQ6A 2Y0SG 3PUVA 4RG1A 4A3EH 4OWTB 3KJPA 3NEMA 3HOXG 1OTCA 1IL2A 1HNZL 5IP7G 3S15H 2DUDA 4IFDJ 5K36G 4DR1Q 2JA8G 1PYBA 3CC4A 4QGUA 3CCRA 3RZOH 1A62A 2R7ZG 2I5HA 2HHHL 4A3BG 5GQOA 4NXNQ 1N33Q 3CW2C 2R92H 1CUKA 1KL9A 1BBWA 2Z6KC 4A3MH 4LFBL 3DM3A 3G4SA 4DV5Q 4POGA 1JJCB 4LFBQ 5M3FG 3UDGA 3T1HQ 4BBSG 1HNXQ 4DV7Q 1PH9A 2LSSA 2LXKA 5C3EG 2ZM6Q 4LF8Q 3PO3G 1LUZA 1J5EQ 3GTLH 1K83H 4JI1L 4DNIA 1M90C 1QVFA 4LW1A 2UUBQ 1Y1VH 5GADC 4DV4Q 3IRBA 5IYDH 1WCMH 4LF4Q 1PVOA 3MXNB 2HIXA 1NJIC 4AQYQ 3RLOA 4IPDA 1UE1A 2JA6G 4X65Q 3KDFA 2IHFA 2ZJRA 3AEVA 1FVIA 2K52A 3HOVG 4A3GH 4LWCA 4TVAB 4YWKA 2JEAI 3TRZA 3S1NH 5GAGC 4A3JG 2OQ0A 2ZJQA 1HZBA 4AYBE 2L15A 4DV4L 4ME3A 3JC66 3H0GH 1S3OA 2CQOA 2R6GA 4NPSA 4DAMA 1IBMQ 2XTIA 2UUCQ 1QUQB 5HGQA 4DV3Q 4B3TL 1HZ9A 1WOCA 5IP9G 3L2PA 3PGZA 4A3FG 3OTOL 2N49A 2VZAA 4P71A 1XNQQ 4BXXH 2PNHA 1D7QA 4JI6Q 4HIDA 1GO3E 1G51A 4YWMA 2KBNA 4AH6A 4R4IA 4WJ4A 4PG3A 4LFCL 3CC2A 1IBML 1N36Q 1SMXA 1SR3A 1WJJA 2KHIA 1HNWQ 4JOIA 4IPGA 1QZHA 4JI4L 2PMZE 4FDBA 4DUZL 4JI6L 3VDYA 2ID0A 2WB1G 3CCLA 2DGYA 3I4NH 2QGQA 1WI5A 2ZTCA 3W5OA 1VS0A 1OXXK 3A0JA 1N34Q 3CQZH 4APVA 3UDIA 1HR0L 1VQKA 3GTKH 3H3VH 3HKZE 1S72A 4A3BH 3F1ZA 2K14A 2Y0SE 4JBJA 2RF4A 5EAYA 1AE2A 3E9HA 4C3IH 4GNXA 3RNUA 4IJHA 4A3EG 3J7A5 3A74A 1KXLA 3U4VA 4YY3Q 2UUAL 4BBSH 4BY7H 3CF5A 4IO9A 4LNQA 1HZAA 3PO3H 3KJOA 1YI2A 1JMCA 4DR6L 2PQAB 1PYSB 2H5XA 3PIPA 1VQOA 4MTNA 1FJGL 2R92G 4PZ7A 2BH2A 4B3RL 4A3MG 1BKBA 3ER0A 4WJ3M 4X66Q 5IYBH 1K73C 4LF9Q 4IPHA 3HOZG 1X3FA 4GN4B 1OXVA 3GTOH 1SN8A 3RN2A 3S14H 4DPGA 1YITA 1IBKL 3S24A 3UE1A 1Y1VG 2F4VL 4OO1I 4JI2L 5IYDG 1IBLL 1WCMG 4DR2L 3HOYH 3S1MH 3TS2A 2R93H 3TEHB 4JV5Q 3CCSA 2ATWA 1E7ZA 2UXCL 4K0KQ 3TS0A 1YBYA 5AJ3L 2UXBQ 1EUJA 2CWPA 2JEBI 4OXPA 1R9TH 3GO5A 1EYGA 1RL2A 2NVXH 3HOUG 1NMGA 1J6QA 2WP8J 2MFIA 4R1JA 3H0GG 2VQFQ 3F2DA 1GD7A 2KENA 3CCQA 1V9PA 4H02A 4P75A 4JI5L 1WFQA 2B29A 2OCEA 5IE8A 3M4OH 4JI3Q 5JJIA 2PQAA 4LUZA 4DV2L 1XMOL 2ALYB 1VQHA 1X6OA 2IX0A 4BXXG 4UP7A 5GAEC 5IT9c 2UXDL 1K0RA 5C0XI 4JBWA 5BR8Q 5LMUL 1HR0W 4DR7L 3KDFB 1E1OA 1NTGA 1YEZA 1B7YB 4DV0Q 3I2ZA 4GOPA 3RN5A 1I94L 1JB7A 3F2CA 4HIMA 4MZ9A 2PI2A 1PA6A 1KD1C 3G6EA 1IXRA 2QA4A 1T9HA 1VQ7A 2N3SA 1E24A 1TWAH 4OONA 1TWCH 4QL5A 2WB1E 3BJUA 5E7NA 3K7AH 3STBC 3I4NG 4P74A 4GKJQ 4X62L 1VQGA 3FP9A 1OXTA 1LM0A 3T1YL 1XNRQ 4X6AH 3I55A 4LF6L 4A3KH 4B3MQ 2JA5H 4BY7G 2I5MX 1X56A 3F2BA 4NXMQ 2AWOA 1UWVA 2KCMA 3GTPH 2JQOA 1IYJB 1YNXA 4DR4Q 1JE5A 1X9NA 4DR1L 3CCMA 3S2DH 1VQAA 3A5ZB 1VQLA 2Q2UA 4A93H 4IOAA 4NXNL 1N33L 1VQCA 4A3CG 2NVQH 1VQBA 3PSIA 3CCEA 3K7UC 1CSPA 1GKHA 4DV5L 1KAWA 1YZ6A 4LFAQ 5IYBG 1TWFH 3T1HL 4A3IH 1HNXL 4DV7L 3I7FA 4LF8L 3KF6A 2ZM6L 4IOCA 3Q8DA 3PV0A 4EQ5A 3KOJA 1J5EL 4QY7A 4JOIC 3GTGH 3S17H 3ULPA 5M5WH 1JJ2A 2UUBL 4JI0Q 2NVTH 1Z9FA 4UP8A 4GNXB 3HOUH 3HOYG 4LF4L 4C3HH 4GN5A 1VQ8A 1HJPA 2R93G 2VUMH 4GN3B 4AQYL 4O0AA 1X3GA 2I5LX 1W3SA 1RIPA 2LXJA 2HIVA 5H1SE 3W1GA 4X65L 5LMNQ 1YHQA 2E5LQ 1L0WA 1YIJA 5IYCH 2YU9H 1OXUA 1L1OA 1VQDA 4HIOA 4X64Q 4IFDG 1UE6A 4KI0A 3AFQA 1KIXA 2NN6G 4AIMA 4LF5Q 5JJLA 5C4JH 1NMFA 4UY8C 4JYAQ 2K5HA 1AE3A 1YJNA 2UUCL 4DV3L 2D0PA 2B63H 5DLQE 4XTCS 2AHOB 2ASBA 4A3DH 3WWVA 3BZKA 1EWIA 2A19A 4DR5Q 4GLAC 2OWOA 1XNQL 2VNUD 1TWHH 4YCVA 2IHEA 1MJCA 2IX1A 2UU9Q 2YYZA 2BH8A 1XPOA 2K75A 1VQ4A 1N36L 1A63A 1SE8A 4R4CA 2K4KA 2MNAA 1E1TA 1HNWL 2CKZB 3KFUA 3EBEA 4L5QA 4KHZA 3K81C 1H95A 1Q1BA 1Q46A 1U0LA 3I4OA 5C4XH 4QJFA 2CWAA 3KF8B 3PUXA 4R4QA 2YTYA 3M4PA 4DUYQ 4DR3Q 1N34L 1N32Q 3M4QA 2EIFA 1S40A 1K8GA 1I50H 3E0EA 3A5UA 1B70B 2JA9A 5C0XJ 4A3KG 1Q86C 2JA5G 3PF4A 4KHPQ 4A3CH 3RR5A 5IWAQ 3I56A 1C7YA 2OQKA 3NELA 2KHJA 4DV6Q 4YWLA 4YY3L 1PFSA 4GOPB 4R4TA 1Q8KA 2N8NA 3UDXA 3ULJA 4A93G 1VQMA 3AFPA 3S1RH 3HOWH 3CCJA 1G291 4GOPC 1OXSC 4OWXB 4XIGS 5FLMH 3TREA 4A3IG 4X66L 3S2HH 4POFA 1Y1WH 4LF9L 4A3GG 2ES2A 2VL6A 3W1BA 4DK6C 3PF5A 4O2DA 1O7IA 2VS1A 2A1AA 3G48A 3D31A 2Q2HA 4B3SQ 2VUMG 4GLXA 4QQBX 1XMQQ 4JV5L 2AKWB 4JBKA 4J15A 2Z0SA 1KC8C 1Q12A 1VQEA 3ERSX 5IYCG 4K0KL 1D8LA 2C35B 4UP9A 1XJVA 1I6HH 2JK8A 2UXBL 3U4ZA 1VQ5A 3FHWA 1YHBA 1SROA 4GLVB 4A75A 4OWWB 1SRUA 1CKNA 1PH2A 3U50C 2PI2E 1YJ9A 3PUZA 3CP0A 2VQFL 1SFOH 2GVAA 1CSQA 1DGSA 2NZHA 1K9MC 3CXCA 3KF6B 4Y7NH 3U58A 3BU2A 4LF7Q 2B63G 4JI3L 4JI8Q 2D62A 2IT1A 2WFWA 4JG2A 3J7ZC 1Z47A 4RMFA 4DV1Q 1PH5A 1N9WA 4A3DG 1C0AA 1QVGA 3PUYA 2VQEQ 2D0OA 4BA1I 4Y52H 2KCTA 5BR8L 4A76A 2YTVA 4DV0L 3S1QH 2WAQG 3F8TA 5FLXc 2JA7H 3I4MH 2F3IA 1L1OB 3D0FA 4YHHQ 1X65A 1Q81C 1Q7YC 1PV4A 5JEAJ 1PH8A 4DV1L 1GVPA 3CMEA 1HNZQ 4LUVA 1LYLA 2BA1A 5C4XG 3FKIH 1IZ6A 2EXDA 4HJ9A 3PO2H 4GKJL 2OTJA 2HHHQ 1V1QA 1XNRL 5M5XH 1VQNA 3STBD 5FJ8H 4L5RC 1HZCA 3OYYA 1YJWA 4NB3A 1QZGA 1A8VA 1C9OA 1X3EA 1PHJA 4B3ML 1XPUA 1W2BA 3ICEA 4ALPA 3J80i 3DLLA 4NXML 3H3VI 2VW9A 4HJ8A 1YVCA 1N8RC 4JI1Q 2OTLA 1V43A 2YV5A 3M7NA 4DR4L 1I3QH 4IJLA 4C2MH 1L2FA 2E8GA 2RHQB 3RZDH 2XGTA 4GS3A 3HOWG 1TWGH 2NVYH 3H15A 1Q1EA 4YCUA 3PCOB 1MJEA 2K5VA 3M3YH 1NBWA 5FLMG 4KLKA 1FGUA 4BBRH 1PH3A 4OX9Q 3CD6A 1Y1WG 4LFAL 2E2IH 3CCVA 4PMWA 4GNXC 1UE5A 3L0OA 4HJ5A 2VY3A 4JI0L 1WYDA 3UDFA 5HY6A 1E3PA 4BY1H 4P72A 3L7ZC 3CPWA 1I5FA 2NZOA 3CPFA 2MO1A 1U5KA 3EN2A 3UE0A 5JEAG 4OX9L 4A3LH 1G6PA 3B6YA 4B3TQ 5LMNL 2E5LL 4L5TA 2MO0A 3HFZB 3KLWA 3G71A 1EIYB 1B8AA 3OTOQ 3J81j 4X64L 5GROA 4LF5L 4QIWE 2ZJPA 2JE6I 4GKKQ 4LFCQ 1Y14B 1LTLA 3AYHB 2Z6KA 2IY5B 2N78A 3NBHB 5IY0A 3MEFA 2CCZA 4IFDI 4JYAL 1FL0A 4JC0A 2K5NA 4IPCA 4BA2I 1K8AC 4JI4Q 2NN6I 3GD7A 4PZ6A 2F52A 3E9IA 4DUZQ 4DR5L 3JAMi 2RHSB 5C44H 4JI7Q 1JJGA 1GM5A 4PZ8A 4GKKL 3CMAA 5M3MH 1VQFA 3J80c 3LGJA 1HR0Q 3CC7A 1E22A 2WAQE 1P16A 4HJAA 2UU9L 2JA7G 3HKSA 3I4MG 2R7FA 3GDEA 4LUOA 4DK3C 1EFWA 4MNOA 5J3BA 1CKNB 1M1KC 3HOXH 1VQ9A 2UUAQ 5ELNA 4JI7L 5IP7H 1JT8A 3HOZH 3K8AA 3FKIG 2AWNA 2JA8H 3J81i 2QEXA 3PO2G 3NENA 2YTXA 3RLFA 1ASYA 4DUYL 4DKAC 4DR3L 2R7ZH 3GTMH 1UE7A 1FJGQ 1N32L 2MQHA 5FJ8G 1SLJA 4B3RQ 1NY4A 1PH6A 2A8VA 4OO1G 3S16H 4KHPL 5IWAL 5M3FH 2V1CC 4DV6L 5C3EH 2GN5A 1PH4A 1QUQA 3K0XA 4A4IA 1P8LA 1CKMA 1TXYA 5GAHC 1IBKQ 2RCNA 2F4VQ 2ZTDA 4JI2Q 1MIUA 1IBLQ 4DR2Q 3ULLA 4R4OA 3M85A 1VQPA 4JCVE 3GTQH 2JA6H 5LMNW 2B3GA 2UXCQ 4BBRG 1X54A 4TQUS 5M5YH 1K3RA 4P73A 1X55A 3HOVH 5AJ3Q 2I0QA 3PUWA 3BZCA 3GTJH 2ZTEA 3RLNA 1UEBA 3CAMA 4A3JH 4AYBG
chains in the Genus database with same CATH superfamily
2CFMA 2HQLA 3S1QB 2K5DA 4C1NI 2EQSA 4BY1G 5KYLA 3JAMc 1WTQA 3CCUA 2Q2TA 2JA7B 1BBUA 1EQQA 2E2JH 3AQQA 3HRZC 3EIVA 4QB4A 4RH6A 1KHIA 4DN4M 3I70A 5KNDA 1ET9A 1YHAA 4HTHA 3TBIB 4DR6Q 1ASZA 5C5MA 2E2HH 2RDGA 2RSNA 5C44G 1EQRA 2XRQD 1LT6D 1F9RA 1CKOA 4K8JA 5M3MG 2FFKB 4IUTA 2NVYB 3KYHC 1AEXA 3A56A 5EQ0A 3HOZB 2HCIA 2Y0SG 3PUVA 3GTLB 2F0QA 1IL8A 1B3QA 1A3UA 3S15H 4N8X1 1PYBA 1IHZA 3RZOH 4KK7A 4IUUA 3DWQA 5ELFA 5BN3A 2R7ZG 1U9RA 1QOHA 3CW2C 2J4XA 4BBSG 4HMJA 1U4PA 3J81L 3Q24A 1K83H 2ZT9C 4DNRB 3H0GB 1M90C 2OEOA 1PRTC 2OT2A 2PO4A 5IYDH 1PVOA 1TS2A 2PYKA 5IGBA 1QE6A 1EYCA 4H44C 2WINB 2OQ0A 4AYBE 2L15A 4DV4L 2E76C 3JC66 5KNCA 2CQOA 2R6GA 4DAMA 3Q23A 5KNBA 5HGQA 5IP9G 1IW7D 3PGZA 4P71A 1FR3A 4BXXH 1D7QA 1G51A 3AB9A 2KBNA 4AH6A 1T5EA 4R4IA 4YIJA 2XWBB 3QR8A 3RD4A 1SMXA 4KTAA 1SR3A 1D6EC 1UAPA 1WJJA 1RCVD 2KHIA 3BDLA 2PMZE 2BCOA 1WD1A 3CCLA 2QGQA 5EBDA 3GTKH 3GTQB 3HKZE 5M9OA 4A3BH 3F1ZA 4G7OC 2DJFC 3NHHA 4RHSA 2RF4A 3P75A 5EAYA 5BN4A 3K5NA 3RNUA 2AUKA 4A3EG 3J7A5 2F4IA 1AZPA 4XYOA 1KAAA 1FNWA 2K32A 3PO3H 3KJOA 1YI2A 2NUCA 2EZVA 1JMCA 1JC7A 2A6EC 1PYSB 3PIPA 1VQOA 5LL6X 2R92G 2BDOA 4PZ7A 3OSOA 5IYBH 3RN2A 5DNFA 1YITA 4WFN3 2J0TD 5CV4A 1Y1VG 2F4VL 1FD7D 1WCMG 1ENCA 3AU7A 4DR2L 3HOYH 1HQMC 3OOCA 3S1MH 5J22A 2E2HB 2VB2X 1KNAA 4RFBA 1O7LA 2UXBQ 2CWPA 1A15A 3GO5A 1RL2A 5I6YA 2M00A 3LX0A 2KENA 5EJWA 3KF8A 2O5JC 3TP5A 1NSNS 1TWCB 4R9WA 2QEJC 1L0YB 5LMUL 1HR0W 2F3VA 2F0MA 1E1OA 1NTGA 4A3KB 1JICA 1I94L 4DR7L 3FPPA 1JB7A 3F2CA 2DN8A 3QOLA 3CKIB 4DK0A 1D5ZC 1IXRA 1LTGD 1T9HA 1GHKA 1STAA 1K83B 3STBC 1KLUD 1BXTA 4X62L 1SE3A 1EYAA 1OO9B 3PQIA 4MTKA 4A3GB 2JA5H 1DOMA 4M1UB 3S17B 3F2BA 4Q5VA 4K5XA 2OF1A 3GTPH 1IYJB 1B9NA 4KKSA 1HFNA 4A93H 1MSGA 1Q90A 4A3CG 1GUNA 1K28A 3NUCA 2NVQH 2EOTA 3PSIA 3K7UC 1WTXA 2MPMA 1CSPA 1WTVA 1RF2D 4LFAQ 4A3IH 1TWFH 3TZDA 4LFBL 2ZM6L 2WACA 2XN9C 3KOJA 1J5EL 5CV8A 5IGGA 4KN7C 3ULPA 1IYUA 2G5DA 2QDBA 4JI0Q 1JJ2A 2NVTH 1SEBD 3HOUH 1DONA 1F2MA 2R93G 2B2YC 4GN3B 4O0AA 4F7XA 1X3GA 2I5LX 4LNQA 2JXMB 2HIVA 1YHQA 1YIJA 5IYCH 1VQDA 1F2YA 2CW0D 3DMUA 2SOBA 3AFQA 1YNJC 4M8AA 4OIJA 2C9OA 3I72A 1NMFA 2O2LD 1AE3A 1BCPC 1STNA 1B50A 3VYSA 2D0PA 5DLQE 4IALA 1RDPD 3SEBA 4XTCS 3H3VC 2QILA 4F8MA 5JPMC 1SSOA 4PMCA 3VR3A 2VNUD 1TWHH 1I50B 2IHEA 2IX1A 4IURA 1N36L 1SE8A 5ELEA 4TSSA 1I4QA 2CKZB 1H95A 2EVBA 1JR0D 1BF4A 4RHRA 2K1BA 2YTYA 4R4QA 3KLRA 4DUYQ 4DR3Q 3HOYB 3S1MB 4FVMA 1K8GA 3E0EA 1B70B 3PF4A 3HGBA 3I56A 2RDHA 3NELA 4CDDC 4DV6Q 4YY3L 1PFSA 4RKBA 4R4TA 3G6JB 3NQIA 2EJMA 2N8NA 1AZQA 4FXDA 3ULJA 1VQMA 1B1ZA 2R61A 3HOWH 4DFAA 5C3XA 4GOPC 4J6HA 1RKNA 2FMCA 2JN4A 1JORA 2MGSA 4XDXA 4DAVA 4FXKC 4MN3A 4P2CB 3PF5A 4K2KA 2DNEA 3G48A 3JAME 4QQBX 2VUMG 3KLSX 4JV5L 2AKWB 4BS9A 4KV6A 1KC8C 2CH4A 1VQEA 1D8LA 1XJVA 3QG1A 3BDOA 4A75A 2PI2E 2L9HA 4RGMA 1SFOH 2VQFL 4ZYSA 2IPKD 1DGSA 4ZQ3A 1K9MC 4Y7NH 3U58A 3BU2A 2B63G 3QOJA 2B8GA 2NB0A 1EY8A 2D62A 2WFWA 4A3DG 1Z47A 1PH5A 2D0OA 5BR8L 3G7LA 1ZEQX 4A93B 1R4QB 3F8TA 3MC0B 1L1OB 2EYLA 2FINB 1X65A 3D0FA 4LJZC 1Q7YC 4A3IB 1PV4A 1PH8A 1TWFB 1YNND 3VR4A 1STHA 1V1PB 1I3QB 4C2MB 3NTIA 3WDNA 5C4ZA 3MAQA 3FKIH 4HJ9A 5J39A 5M5XH 5FJ8H 4BBRB 1YJWA 4OO1H 5G3LD 3ICEA 1LABA 3C3LA 4NXML 4ZKCB 1JQYD 4HJ8A 4DAYA 1N8RC 2OTLA 3M7NA 3SXHA 4IJLA 1EEID 4PNYA 4QIWB 1S5BD 3A8IE 1GUSA 2XGTA 1TWGH 3H15A 3SR1A 2HCCA 1S5FD 1MJEA 1JWMD 4KLKA 1FGUA 4XQQA 3CCVA 1II3A 1SNOA 4HJ5A 1TS3A 1GXDC 4HSPA 4NMZA 5T1GA 3CU7A 1WYDA 2B8FA 3UDFA 3T56B 1U5KA 4A3LH 3UE0A 4CJ2C 2SNSA 4OX9L 3OW7A 2E5LL 5C44B 2MO0A 3A8JE 1B8AA 1MHWC 3J81j 3HZXA 3J7AF 5CYUA 4LF5L 2PW5A 2JE6I 1LTLA 3AYHB 4L8JA 1GUTA 1BR9A 5AFWA 3VR2A 3MEFA 2CCZA 4OIKA 1FGBD 2K5NA 1VF7A 4RAUC 3TP7A 2A68D 2L5TA 1STGA 4PZ8A 1B53A 4OELB 3J80c 3S16B 2K5QA 5I4DA 2PPBC 1EY0A 1TY0A 4ME5A 2F1MA 4KKUA 5K36H 2JA8H 2AWNA 3PMFA 4O1NA 3PO2G 2I46A 1XX8A 3GTMH 3VYRA 4WJWA 1H9MA 1CHQD 5I2YA 1QWYA 4KHPL 5IWAL 3TDQA 5C3EH 2GN5A 1PH4A 1QUQA 2TSSA 2RCNA 4X3UA 2F4VQ 2NTTA 2WV6D 4DR2Q 2RKSA 4RGTA 3NTKA 2GA4B 4KD3A 1X54A 1K3RA 3HOVH 1X55A 1IKLA 2I0QA 3MWYW 3GTJH 1TKWB 3RLNA 1B44D 4CJ0B 4A3JH 4KJNA 5IGDA 4B9WA 5DM73 1DM0B 5A2QL 4B3SL 5EBCA 5C0XG 3DWAA 1CK1A 1VQJA 1A0IA 5C4HA 1R4PB 1D2BA 3MXUA 4U68A 1EOVA 4EVOA 4A3FH 3M9BA 1O78A 1GUOA 2NWGA 2Q2IA 1QG7A 1NE3A 3N52A 1AH9A 5LMUQ 4DR7Q 3MFGA 3ZJYC 1I94Q 3IFDA 5BN5A 1VCIA 4A3EB 1MSHA 3BZDB 3J81c 1PH1A 2AUJD 4JI8L 4QCLA 1I4RA 3OW2A 1BQQT 2FXQA 1H9KA 1Q82C 2R92B 5JJKA 4FO2A 4X62Q 2RCFA 1Z7TA 5G3LF 1XPRA 1EIHA 1GUGA 2RQXA 3K59A 1VDZA 3MA2B 4RG1A 3NK9A 3KJPA 3HOXG 1HUNA 1Y1VB 5D3IB 3DWPA 3CC4A 5E4WC 2HHHL 2VB3X 4A3BG 4H13C 1CUKA 3T53B 1PFNA 2EXZA 5COYA 2B2UC 4A3MH 3DM3A 1PZJD 4LFBQ 3UDGA 3HOZH 1PH9A 2ZM6Q 3PO3G 4JVZA 2H4OA 1J5EQ 3GTLH 4JI1L 4CKCA 4DNIA 2Z1CA 1QVFA 3EFXD 3IRBA 1JCKB 3MXNB 1NJIC 2JA6G 3KDFA 2ZJRA 4YWKA 2JEAI 1F77A 1EWHA 2PW7A 4ME3A 1B2TA 1RHPA 1X3PA 3H0GH 3HKZB 2JSOA 4EQOA 1IBMQ 3WOFA 3Q6SA 3Q22A 3OTOL 2VZAA 3CQZB 4JI6Q 1DD2A 2LKVA 3GTMB 4WORA 1JOKA 1Z6HA 3CC2A 1N36Q 2EYFA 1ZYRC 4IPGA 1GOZA 2R3ZA 4FDBA 4C3JG 1TS4A 1CHPD 1EFID 2WB1G 1Q8IA 1CA6A 2B2YA 1OXXK 1VS0A 3NSWA 3UDIA 2E2DC 2LFNA 1S72A 2Y0SE 3K5LA 3E9HA 3NPPA 3GTOB 3A74A 1KXLA 3CRKC 4YY3Q 2UUAL 4XQJA 1HZAA 2KECA 2R93B 4XXEA 2X6GA 1Y8NB 4B3RL 1PFMA 1LLRD 1R9TB 2NVXB 1I4GA 4IN3A 4GN4B 3KLSA 1O80A 3ITPA 3TEHB 4JV5Q 4QUFA 2UXCL 1AW7A 3TN2A 4B9XA 1H9SA 1EUJA 2JEBI 1EY7A 3K5MA 3HOUG 1NMGA 5JPNC 1FNUA 1LT4D 3A55A 1KDAA 4KMUC 2VQFQ 3CCQA 2QCPX 4JI5L 1WFQA 2HUGA 1LACA 4EQNA 3C1FA 2MHVA 3T16A 1E2WA 1QNUA 1XMOL 4QF4A 2ALYB 2F3WA 1SNCA 1VQHA 2F0GA 4CBVA 5IODA 5A35A 2Q8IB 5IT9c 1K0RA 5C0XI 2F0WA 5BR8Q 2HD3A 4GOPA 3I2ZA 4A3MB 5KYIA 1PA6A 2E75C 5I9PA 2PCFB 3G6EA 2FHTA 2QA4A 3S2DB 4QL5A 1TWCH 3I91A 3BJUA 3K7AH 3I4NG 2NZ1D 2A69C 4P74A 3I8ZA 5E4XA 4LF6L 3S14B 4A3KH 4C3IG 5D14A 1CTMA 4BY7G 2F0OA 1X56A 4FF1A 4NXMQ 2JP1A 2AQ1B 2KCMA 2JQOA 1X9NA 2K01A 4DR1L 3FEWX 2VUMB 2BE5C 3A5ZB 2EY6A 1SMYD 4NXNL 2SEBD 1ESFA 2EJFC 4DV5L 1KAWA 1YZ6A 4K8IA 4A3GH 1HNXL 3I7FA 4LF8L 3KF6A 2HDLA 4IOCA 3Q8DA 3S17H 3X3NA 3EQLC 4UHVA 1I4PA 2UUBL 1V1OA 4FYDA 1Z9FA 4GNXB 2A73B 4LF4L 4C3HH 4GN5A 1VQ8A 1ILQA 1QILA 1TY2A 3NE5B 4AQYL 4FF2A 4A3DB 2E5LQ 4QMGA 4IFDG 4HEDA 1SDFA 2PQEA 2KJXA 2NN6G 4LF5Q 5JJLA 1AN8A 2F0LA 2Z4HA 3I73A 2UUCL 4DV3L 1I6VC 3QIAA 2AHOB 4ILWA 2ASBA 3WWVA 1NAPA 4GLAC 4G7HC 3J80E 4PQXA 2E74C 1XPOA 3R8BA 3QB3A 4EQPA 4PV1C 1EOTA 2XWJB 3DUZA 1U0LA 1Q46A 5C4XH 2N88A 3BDCA 2K33A 1I50H 5C0XJ 2Z6BA 4KHPQ 5IWAQ 2NBFA 3MHBA 2QKIC 1Q8KA 5T1IA 1LTBD 1D1KA 3K0YA 3AFPA 3S1RH 4K5WA 1G291 5FLMH 4X66L 4R8IA 1PFBA 4POFA 2F0PA 4LF9L 1UNSA 2VL6A 4J8QA 5DAUA 3NQTA 3D31A 4XT1B 4B3SQ 2B2TA 2CHBD 5JEAH 4GLXA 1U4MA 2Z0SA 1Q12A 4K0KL 1FYCA 3A8KE 3K7AB 1VQ5A 3A54A 5KGUA 1SAPA 1PH2A 1CKNA 3P20A 3U50C 2F0VA 2GVAA 3J81E 3CXCA 4JI8Q 3MTSA 3J7ZC 2EYJA 4RMFA 3PO2B 4K14A 1QVGA 1EL0A 1JOQA 4GZYC 4Y52H 1RJTA 2KCTA 1BNZA 1UUPA 4DV0L 4XYQA 2WAQG 5FLXc 2F3IA 1B9MA 5JEAJ 4DV1L 1S4ZA 4NDXA 4LUVA 2BA1A 3SK8A 4C3HB 2HHHQ 3R2TA 4DNTB 4L5RC 2LMCB 1A8VA 4B3ML 5IT9L 5EKIA 1C8CA 3H3VI 4JI1Q 1V43A 4DR4L 4ZUIA 1CI3M 1V8QA 1I3QH 4C2MH 5I2XA 1WTRA 1HTPA 1L2FA 2RHQB 3MVVA 5CV7A 4R8NA 4GS3A 1PRTB 1Q1EA 4YCUA 2PZTA 3PCOB 4BBRH 1DOKA 1KABA 1Y1WG 2E2IH 1PMRA 3GV6A 2VY3A 1PTOD 1SBBB 4BY1H 1IW7C 3CPWA 1I5FA 1STYA 2NZOA 5LL6S 2MO1A 3SVMA 1G6PA 2F0EA 2O5IC 5EGTA 1AP0A 1EZ6A 3KLWA 1EZ8A 1DOLA 1HTLD 1XTCD 1WTPA 1EIYB 3OTOQ 1F9SA 5C4XB 1ET6A 5GROA 1SXTA 4KY5A 4ZAIA 4GKKQ 2B2UA 2N78A 3NBHB 4IFDI 4HSVA 1FL0A 1G2SA 1PLFA 3A7AB 3HOXB 4BA2I 2F0JA 2NN6I 3GD7A 1M4VA 2F52A 3E9IA 1U4RA 4DR5L 5C44H 1GM5A 3BVMA 5M3MH 3S1RB 3CC7A 2EYOA 2JA7G 3HKSA 3I4MG 3GDEA 3EROA 1A3TA 3NXWA 4ULLA 5CBAE 1W6KA 4DK3C 4HCSA 1NNXA 4MNOA 1VQ9A 4JI7L 2UUAQ 4HR7B 2EY5A 2QEXA 2YTXA 2R7ZH 2JA6B 4DKAC 1N32L 2HQEA 1QB5D 1SNMA 1UE7A 3TMEA 4B3RQ 3IL8A 2IL8A 2A8VA 3S16H 1CZGA 4QUCA 2V1CC 4K6DA 5JAVA 1K0SA 4BWGB 4F88A 3ULLA 4JCVE 2D9UA 2NTSA 3K57A 2UXCQ 4IQZA 1IKMA 2EPBA 4E6IA 4P73A 2EDGA 3TSSA 1LTID 3BZCA 2ZTEA 4L63B 3VYUA 1M1KC 1EWCA 3T4AC 3J7AV 2PZWA 1ILPA 2AMCB 3K80C 2IJ0A 1LT3D 1KQSA 4JI5Q 1XMQL 4C3JB 2HT1A 4L5SA 5IP9H 1KDCA 2WB1B 5NUCA 1XMOQ 2BA0A 3U9OA 2RBMA 4EX5A 4DA2A 5IIFA 1PH7A 1JWSD 1CQVA 3E6ZX 4ZUJA 5EKKA 1EIFA 2F0HA 2GVBA 1NUCA 2KOLA 5K5PA 4LF6Q 2R7DA 1VQ6A 4A3EH 4OWTB 1X32A 3KUPA 2E2IB 1RTOA 1SNPA 2F0TA 1HNZL 5IP7G 2DUDA 4IFDJ 2IX3A 4DR1Q 2L1BA 2K05A 4QGUA 3CCRA 1A62A 5DM63 4BY1B 4MHEA 4XT3B 1BUVT 3P7JA 4NXNQ 2R92H 5ELBA 1KL9A 1ZKOA 3S1NB 1PTOF 5ELCA 4DV5Q 1JJCB 3C1EA 5M3FG 1HNXQ 1KTKA 2LSSA 2Z9HA 4LF8Q 1LUZA 5FLXL 2A6HD 5IGFA 1EIGA 2UUBQ 2K7VA 1Y1VH 5GADC 4DV4Q 1HQRD 1WCMH 4LF4Q 3EJIA 3MXPA 2HIXA 4AQYQ 2CW0C 1UE1A 4DXGA 3K5OA 3AEVA 2F0UA 1FVIA 4LWCA 5GAGC 1D5MC 1HZBA 3DEOA 5M3MB 2DNCA 1PTOH 4L6TB 3CHBD 4RA8A 2O4XA 4NPSA 2Y0SB 4PMBA 2XTIA 2UUCQ 4DV3Q 1HZ9A 1GUWA 1SNQA 3L2PA 2ZXRA 4HIDA 2R7ZB 2PZUA 4J1MA 4C3IB 2A5HA 3NP8A 4Z9CB 1S5DD 3TZUA 4BY7B 1G91A 4BBSB 1F2ZA 4B08A 1CQFA 1GHJA 1QZHA 2B2TC 3VDYA 2ID0A 1HA5A 1WI5A 3W5OA 5FO8B 2D5DA 1WVLA 1A6XA 4FNFA 3CQZH 1H9SB 4OEMB 1ICFB 1AE2A 4IJHA 3TP6A 4DU9A 4IO9A 5HGTA 2NYZD 4DAPA 4MTNA 1FJGL 4KD4A 2RSOA 5EPKA 4X66Q 1U4LA 4ZCKA 1T5XD 4LF9Q 4IPHA 4FF4A 1OXVA 3MZ5A 1SN8A 3GTOH 2C5CA 1TIID 3OHXC 3UE1A 5JVH3 1IBKL 4JI2L 5IYDG 1IBLL 3M4OB 2R93H 4ODGA 3CCSA 2ATWA 4K0KQ 3QJYA 1YBYA 3TS0A 5AJ3L 1SYBA 3EVQA 1EY5A 4OXPA 1R9TH 1EYGA 2NVXH 1UEAB 2WP8J 1Y8OB 1GD7A 3DM1A 4LK1C 1V9PA 4H02A 3SK4A 4CGYB 2B29A 5IE8A 2PQAA 2F0KA 5J1ZA 4LUZA 4DV2L 2XRSD 2IX0A 4BXXG 5GAEC 2UXDL 4JBWA 1VMCA 1YEZA 4DV0Q 3RN5A 1B7YB 1YNNC 1A2TA 5EPJA 4HIMA 1SE2A 4OHJA 3ERQA 1E24A 2G9HD 4OONA 2WB1E 4G7ZC 5KRUA 4CKBA 3Q0AA 1WCMB 3U9SA 3T1YL 5D3DA 1LM0A 3I55A 4B3MQ 2MJ8A 3D6CA 3MEHA 1LTTD 2MUYA 4HN7A 1W6JA 1UWVA 5M5WB 3WOEA 1YNXA 4DR4Q 1JE5A 2DY8A 3S2DH 1PTOB 4OL7A 2Q2UA 1DCZA 4IOAA 1N33L 3I90A 4KY7A 4JW0A 1GKHA 3S14H 5IYBG 3T1HL 3V2TA 4DV7L 3GTGH 3PV0A 4JOIC 5IOCA 4HMIA 1AFPA 1JWUD 4DGZA 1F9QA 4UP8A 4CDEC 3HOYG 3URYA 1HJPA 2BE5D 2VUMH 1CZWA 1TT2A 1PRTD 2EY1A 4X65L 5H1SE 2LXJA 3W1GA 2YU9H 1L0WA 1L1OA 4HIOA 4KI0A 1KIXA 2WAQB 1V1PA 1LTAD 2KEDA 1ICWA 4JK1C 4KKTA 3RUZA 4UY8C 5FK9C 2A68C 3KBXA 2B63H 2DY7A 4A3DH 2F0FA 1EWIA 2OWOA 4DR5Q 1XNQL 2QF7A 4K2LA 3SHLA 4YCVA 1MJCA 2Z8LA 2CQAA 3NWTA 2K4KA 2MNAA 3IKJA 5ELDA 4WRDA 1HNWL 4EGVA 3KFUA 5A2QE 3K81C 4N8FA 4LAAA 2CWAA 3KF8B 3PUXA 1PXUA 1N32Q 5JJZA 1N34L 1S40A 2IWHA 1ENAA 3A5UA 2JA9A 1Q86C 1Y1WB 2JA5G 1M8AA 3RR5A 1NR2A 1C7YA 1EYDA 2OQKA 4YWLA 3OPOA 3SK6A 3FMCA 1HA6A 3UDXA 1VF5C 1SNDA 2RVLA 4A93G 4XIGS 3FPUB 1I6HB 2A6ED 4A3IG 1SYEA 4H7BA 2ES2A 4O2DA 1G6ZA 2Q2HA 1XMQQ 4JBKA 4J15A 2Q8TA 5IYCG 4UP9A 3S9WA 4UDUC 2JK8A 2F0DA 3I4MB 4I65A 1MGSA 1CSQA 2EJGC 3FVQA 3IAYA 1X3QA 4JI3L 4C1NK 1N9WA 4N9PA 3KBGA 4NW2A 4BA1I 2YTVA 1BOSA 2Q8RE 2F0SA 2XSCA 1LO5D 5FO7B 3GTGB 3CMEA 3V05A 1HNZQ 3BVGA 2XVSA 3RZDB 2EXDA 5CC4A 3PO2H 4GKJL 1XNRL 1B3AA 2KCNA 3STBD 1HZCA 3OYYA 2I07B 4NB3A 3ND8A 1QZGA 2LY7A 1G8ZD 2YU9B 4ALPA 3DLLA 2F0NA 4K6LA 1TR5A 1YVCA 4I7ZC 2YV5A 2G9DA 1HXYD 1PRTF 1EY6A 2E8GA 4X3TA 1NR4A 3HOWG 1SYGA 1F2LA 5CMDA 2B63B 2K5VA 3M3YH 1NBWA 1SYDA 4OX9Q 3CD6A 4DXFA 1XYIA 5I6WA 2KEEA 2V4DA 1LV9A 5D65A 4CDFC 5HY6A 1E3PA 4P72A 3CPFA 3EN2A 5KIXA 5C0XH 1D1IA 5EKLA 4C56C 2WIIB 3VA5A 5LMNL 3G71A 3LNNA 1K8OA 1ENFA 2F03A 4IUNA 2CH4W 3D4DA 3OIQA 4X64L 2XIWA 2ZJPA 2EY2A 2IY5B 3H94A 1IYVA 4CKEA 1YNJD 2H1EA 4G57A 4JYAL 1Y8PB 1C48A 1CA5A 1CFMA 4PZ6A 1STBA 3JAMi 2RHSB 1BCPD 3I3CA 1HUMA 3I4LA 2RA4A 4K5VA 3CMAA 1VQFA 1WD0A 3IFTA 2RDFA 2WAQE 2B2VC 4RCNA 1P16A 2UU9L 5M3FB 2QW7A 1A2UA 3MXNA 1KLGD 3D4RA 3BG3A 5J3BA 1DZ1A 3HOXH 1JT8A 5ISRA 3FKIG 3RLFA 3M4YA 1FJGQ 2MQHA 3VA7A 5FJ8G 1PH6A 4OO1G 5DEHA 2SNMA 3QWNA 3K0XA 4A4IA 1CKMA 5IGCA 5GAHC 3N6RA 1IBKQ 4TKOB 4JI2Q 1J9OA 3V96A 2QDLA 1IBLQ 2E2JB 4KHVA 4R4OA 3M85A 2JA6H 4V0BA 2B3GA 5M5YH 1QCBD 5AJ3Q 3MXGA 3CAMA 1CT1D 4AYBG 2JYOA 4DK1A 3SGIA 4YCWA 4A3LG 3UI2A 4DAYB 1KRTA 4UPAA 3TQYA 1MBYA 4DV2Q 5FOBB 3NWSA 5F2DA 1KRSA 1SYFA 4HJ7A 2UXDQ 3QO2A 3PIOA 3X3MA 5KEEA 2JJQA 1TVXA 1MKHA 2K50A 1BVSA 1QVCA 1VQIA 4LF7L 3S15B 5ELOA 4HIKA 3ONAB 3E0JA 4C3JH 3RZOB 2WKCA 2VQEL 1RTNA 1XTDA 4JBMA 1E0BA 3T1YQ 1L1OC 3K58A 1F9PA 4NKLA 1HH2P 2L4NA 3HKZG 3M3YB 4YHHL 3CRLC 5C5LA 3JAML 1EQVA 3NEMA 1OTCA 2L12A 1IL2A 1SMYC 5K36G 2JA8G 4KY6A 2I5HA 3GV3A 3W2DA 1PYWD 3PIP3 5GQOA 1N33Q 1SYCA 3D8GA 1BBWA 2Z6KC 3G4SA 4POGA 1SE4A 3FDTA 3J7YW 3T1HQ 4DV7Q 2EE1A 2LXKA 5C3EG 4LMQD 1E2ZA 5CV9A 1WTWA 4LW1A 2L55A 1BBXC 2ENBA 3RLOA 4IPDA 4X65Q 1D5XC 2IHFA 2K52A 3HOVG 2M2LA 4HCEA 4TVAB 3TRZA 3S1NH 4A3JG 2ZJQA 1SJED 3PIO3 2WKDA 3ZYYX 2J7ZA 3HEJA 5C6AA 1S3OA 2KA7A 1BCPF 1QUQB 4B3TL 2ICIA 1WOCA 1PZID 2KCCA 4A3FG 3OWEB 3BVZA 2N49A 5FO9B 2ZXOA 1XNQQ 2PNHA 3GTKB 1GO3E 4YWMA 4WJ4A 4A3BB 4ZRZA 4PG3A 5TSSA 4LFCL 1IBML 1E2VA 1O7ZA 4KN4C 1HNWQ 1EU4A 4JOIA 4JI4L 3PO3B 1BO0A 4DUZL 4JI6L 2K28A 2DGYA 3I4NH 2TMPA 2ZTCA 1N34Q 3A0JA 3H3VH 1HR0L 4APVA 1VQKA 2K14A 4JBJA 4C3IH 1MD2D 4GNXA 4BY7H 5M5YB 3U4VA 1EY9A 4BBSH 3CF5A 5CBEE 1RD9D 2PQAB 2H5XA 4G4KA 2N55A 2BH2A 4A3MG 1BKBA 3ER0A 4WJ3M 1K73C 3HOZG 1X3FA 5E1FA 1Y69U 4RGOS 4HAEA 1HRJA 4DPGA 4RGNA 5CGKA 2EYMA 3S24A 4OO1I 1H9JA 3TS2A 3HS0C 1JE4A 1E7ZA 1Q3LA 4X3KA 1S5CD 3GP7A 3W3AA 3H6MA 1L0XB 1EQTA 4RCOA 1GJXA 4IFDH 2NN6H 1J6QA 5IT9E 2MFIA 4R1JA 3H0GG 3F2DA 4P75A 3DHQA 4RKLA 2OXPA 2OCEA 3HG9A 3M4OH 3ND9A 4JI3Q 5JJIA 2KVMA 1X6OA 2K6AA 4OGQC 2VXWA 4UP7A 3OMCA 3KDFB 4DR6L 2JA5B 4MZ9A 2PI2A 3OWFA 1KD1C 2D2CC 3GTPB 2FJ2A 1HPCA 4IUVA 1VQ7A 2N3SA 1TWAH 3DEPA 3DXJC 5E7NA 1LTSD 5E3FA 4GKJQ 2F0IA 2NVQB 3OIPA 1VQGA 3FP9A 1OXTA 1H9RA 3LWUA 3SK5A 1XNRQ 4X6AH 3VR5A 2B2WA 3A7LA 2I5MX 3E5SA 2AWOA 1QJOA 3NTHA 2NVTB 3HOUB 3KK7A 2KHSA 1EEFD 3CCMA 1RODA 1VQAA 1VQLA 3GQBA 1G2TA 4ZK9B 1VQCA 1VQBA 3CCEA 4U673 3R3OA 2ZXPA 1PTOC 4EQ5A 1PDQA 4QY7A 1PZKD 5M5WH 5CR3A 2AQ2B 3H09A 2L0CA 1W3SA 1RIPA 5L37A 5LMNQ 3EA6A 2BDNA 1S5ED 1OXUA 1TWHB 4X64Q 1LTRD 3I4NB 1BCPB 1UE6A 3L9AX 4AIMA 3HP3A 5C4JH 3C2PA 4JYAQ 2K5HA 1YJNA 3BZKA 2A19A 2Z4IA 1B4OA 1KNEA 1MI2A 5JOBA 1LT5D 2UU9Q 2YYZA 1CM9A 2BH8A 2HDMA 3L3OC 2K75A 1VQ4A 3E3XA 1A63A 4R4CA 2B39A 1E1TA 1HFGA 5CV6A 4Q0FA 2X69A 5JVG3 3EBEA 4L5QA 2EYHA 4KHZA 1Q1BA 3I4OA 1ZYRD 4QJFA 3H91A 3HOWB 3RMHA 3M4PA 3M4QA 2EIFA 3VR6A 4A3KG 4A3CH 5C3WA 3NBIA 2KHJA 5I9OA 2KQ3A 4GOPB 1ESRA 4N9TA 5LHY1 2EYPA 3TP8A 1K3BC 3CCJA 1OXSC 4OWXB 4IZ8A 1TS5A 3TREA 3S2HH 4FF3A 1Y1WH 4A3GG 3NBHA 3W1BA 4XQNA 1SFOB 2B2VA 4DK6C 2BOSA 1O7IA 4ABNA 2VS1A 1SJHD 2A1AA 2A74C 4C3HG 4Y7NB 3OMGA 2MP1A 4RWSC 3R93A 4KJOA 3ERSX 1TWAB 2C35B 1I6HH 2UXBL 1TU2B 4JPBW 3FHWA 1YHBA 3U4ZA 1SROA 4GLVB 1WTOA 4OWWB 1SRUA 1YJ9A 1DYQA 3PUZA 3CP0A 3MFYA 4X3SA 1J8IA 2NZHA 5FKAC 5FLXE 3KF6B 4LF7Q 4IUQA 2IT1A 3O13A 4JG2A 3FKIB 1C0AA 4DV1Q 5CORA 3PUYA 2VQEQ 5EPLA 5M5XB 2IW3A 4A76A 1ZXTA 4FP5D 3S1QH 2DJGC 2M9VA 2JA7H 1DJRD 3I4MH 4YHHQ 1Q81C 1GVPA 4CHTB 1C4QA 4V190 1LYLA 3M7GA 5C4XG 2ICEC 1IZ6A 1TWGB 2OTJA 4CJ1B 1V1QA 1VQNA 2A69D 1C9OA 1X3EA 3F2UA 1PHJA 1XPUA 1W2BA 2A6HC 3BS1A 3J80i 4FXGC 1ONLA 4AYBB 3C46A 3K6OA 2VW9A 2XNAC 2FMMA 4IUPA 3VYTA 5C4JB 1O7YA 2KUMA 1KDBA 3RZDH 2NVYH 2L11A 1K8MA 5FLMG 1PH3A 2P5ZX 4LFAL 4S3SA 4PMWA 3FRPB 4GNXC 1UE5A 3L0OA 1NCVA 1DXMA 4JI0L 2PNRC 2K5WA 3T51B 3D4WA 2K03A 3P1HA 3AMUA 3L7ZC 5JEAG 4F87A 1EY4A 1ML0D 3LWEA 2PMZB 3B6YA 4B3TQ 3BYYB 4L5TA 3HFZB 3BYTB 1HCZA 4O42A 3SDZA 4QIWE 4LFCQ 1Y14B 2Z6KA 4CDCC 5IY0A 2CVRA 4TRDA 4JC0A 4IPCA 1WTHA 1K8AC 4ZKBB 4JI4Q 3D3RA 2JA8B 2X6LA 3T13A 4DUZQ 4JI7Q 1JJGA 5IGEA 4MIUA 1JOOA 2LS01 4GKKL 1STEA 4I7AA 3LGJA 4DF7A 1HR0Q 1E22A 1HHVA 4HJAA 1I4HA 2R7FA 5CV5A 1A3VA 5C3EB 3S2HB 1FNVA 4LUOA 5HURA 1EFWA 1CKNB 2AQ3B 5ELNA 5IP7H 4NP5A 3K8AA 1XXGA 3J81i 3NENA 2K04A 1ASYA 4DUYL 4DR3L 1TQOA 1VMPA 1SLJA 1XWEA 1I4XA 1NY4A 3HOVB 3GTJB 5M3FH 4H0LC 4A3JB 4DV6L 3SE0A 1P8LA 1TXYA 1BDOA 2ZTDA 4ID6A 1MIUA 1VQPA 1JB3A 4UAIA 4ZLTF 3GTQH 1EU3A 4A3FB 5LMNW 3J80L 3D6WA 4BBRG 4TQUS 1QNKA 2SDFA 3PUWA 1UEBA 2B2WC 3R2IA
chains in the Genus database with same CATH topology
2CFMA 2HQLA 3SGIA 2AMCB 2EQSA 3K80C 4BY1G 4YCWA 3JAMc 3CCUA 2Q2TA 1KQSA 1BBUA 5C0XG 1EQQA 4B3SL 2E2JH 1XMQL 4JI5Q 3AQQA 4A3LG 4DAYB 1VQJA 2HT1A 1A0IA 3EIVA 4L5SA 1KRTA 1KHIA 4UPAA 3TQYA 5IP9H 1EOVA 4DV2Q 4A3FH 1XMOQ 2BA0A 3M9BA 1KRSA 1YHAA 4HJ7A 2Q2IA 2UXDQ 3PIOA 1NE3A 1AH9A 5LMUQ 2JJQA 4DR6Q 4DR7Q 3ZJYC 1I94Q 1MKHA 1VCIA 2K50A 4EX5A 1ASZA 2E2HH 3J81c 1BVSA 1QVCA 1VQIA 1PH1A 4LF7L 5ELOA 4HIKA 4JI8L 1PH7A 4C3JH 3OW2A 5C44G 2FXQA 1EQRA 2VQEL 1XTDA 1CKOA 1Q82C 4JBMA 4X62Q 5JJKA 5M3MG 1XPRA 3T1YQ 1L1OC 3KYHC 1EIFA 2GVBA 1HH2P 4LF6Q 3HKZG 2R7DA 4YHHL 1VQ6A 2Y0SG 3PUVA 4RG1A 4A3EH 4OWTB 3KJPA 3NEMA 3HOXG 1OTCA 1IL2A 1HNZL 5IP7G 3S15H 2DUDA 4IFDJ 5K36G 4DR1Q 2JA8G 1PYBA 3CC4A 4QGUA 3CCRA 3RZOH 1A62A 2R7ZG 2I5HA 2HHHL 4A3BG 5GQOA 4NXNQ 1N33Q 3CW2C 2R92H 1CUKA 1KL9A 1BBWA 2Z6KC 4A3MH 4LFBL 3DM3A 3G4SA 4DV5Q 4POGA 1JJCB 4LFBQ 5M3FG 3UDGA 3T1HQ 4BBSG 1HNXQ 4DV7Q 1PH9A 2LSSA 2LXKA 5C3EG 2ZM6Q 4LF8Q 3PO3G 1LUZA 1J5EQ 3GTLH 1K83H 4JI1L 4DNIA 1M90C 1QVFA 4LW1A 2UUBQ 1Y1VH 5GADC 4DV4Q 3IRBA 5IYDH 1WCMH 4LF4Q 1PVOA 3MXNB 2HIXA 1NJIC 4AQYQ 3RLOA 4IPDA 1UE1A 2JA6G 4X65Q 3KDFA 2IHFA 2ZJRA 3AEVA 1FVIA 2K52A 3HOVG 4A3GH 4LWCA 4TVAB 4YWKA 2JEAI 3TRZA 3S1NH 5GAGC 4A3JG 2OQ0A 2ZJQA 1HZBA 4AYBE 2L15A 4DV4L 4ME3A 3JC66 3H0GH 1S3OA 2CQOA 2R6GA 4NPSA 4DAMA 1IBMQ 2XTIA 2UUCQ 1QUQB 5HGQA 4DV3Q 4B3TL 1HZ9A 1WOCA 5IP9G 3L2PA 3PGZA 4A3FG 3OTOL 2N49A 2VZAA 4P71A 1XNQQ 4BXXH 2PNHA 1D7QA 4JI6Q 4HIDA 1GO3E 1G51A 4YWMA 2KBNA 4AH6A 4R4IA 4WJ4A 4PG3A 4LFCL 3CC2A 1IBML 1N36Q 1SMXA 1SR3A 1WJJA 2KHIA 1HNWQ 4JOIA 4IPGA 1QZHA 4JI4L 2PMZE 4FDBA 4DUZL 4JI6L 3VDYA 2ID0A 2WB1G 3CCLA 2DGYA 3I4NH 2QGQA 1WI5A 2ZTCA 3W5OA 1VS0A 1OXXK 3A0JA 1N34Q 3CQZH 4APVA 3UDIA 1HR0L 1VQKA 3GTKH 3H3VH 3HKZE 1S72A 4A3BH 3F1ZA 2K14A 2Y0SE 4JBJA 2RF4A 5EAYA 1AE2A 3E9HA 4C3IH 4GNXA 3RNUA 4IJHA 4A3EG 3J7A5 3A74A 1KXLA 3U4VA 4YY3Q 2UUAL 4BBSH 4BY7H 3CF5A 4IO9A 4LNQA 1HZAA 3PO3H 3KJOA 1YI2A 1JMCA 4DR6L 2PQAB 1PYSB 2H5XA 3PIPA 1VQOA 4MTNA 1FJGL 2R92G 4PZ7A 2BH2A 4B3RL 4A3MG 1BKBA 3ER0A 4WJ3M 4X66Q 5IYBH 1K73C 4LF9Q 4IPHA 3HOZG 1X3FA 4GN4B 1OXVA 3GTOH 1SN8A 3RN2A 3S14H 4DPGA 1YITA 1IBKL 3S24A 3UE1A 1Y1VG 2F4VL 4OO1I 4JI2L 5IYDG 1IBLL 1WCMG 4DR2L 3HOYH 3S1MH 3TS2A 2R93H 3TEHB 4JV5Q 3CCSA 2ATWA 1E7ZA 2UXCL 4K0KQ 3TS0A 1YBYA 5AJ3L 2UXBQ 1EUJA 2CWPA 2JEBI 4OXPA 1R9TH 3GO5A 1EYGA 1RL2A 2NVXH 3HOUG 1NMGA 1J6QA 2WP8J 2MFIA 4R1JA 3H0GG 2VQFQ 3F2DA 1GD7A 2KENA 3CCQA 1V9PA 4H02A 4P75A 4JI5L 1WFQA 2B29A 2OCEA 5IE8A 3M4OH 4JI3Q 5JJIA 2PQAA 4LUZA 4DV2L 1XMOL 2ALYB 1VQHA 1X6OA 2IX0A 4BXXG 4UP7A 5GAEC 5IT9c 2UXDL 1K0RA 5C0XI 4JBWA 5BR8Q 5LMUL 1HR0W 4DR7L 3KDFB 1E1OA 1NTGA 1YEZA 1B7YB 4DV0Q 3I2ZA 4GOPA 3RN5A 1I94L 1JB7A 3F2CA 4HIMA 4MZ9A 2PI2A 1PA6A 1KD1C 3G6EA 1IXRA 2QA4A 1T9HA 1VQ7A 2N3SA 1E24A 1TWAH 4OONA 1TWCH 4QL5A 2WB1E 3BJUA 5E7NA 3K7AH 3STBC 3I4NG 4P74A 4GKJQ 4X62L 1VQGA 3FP9A 1OXTA 1LM0A 3T1YL 1XNRQ 4X6AH 3I55A 4LF6L 4A3KH 4B3MQ 2JA5H 4BY7G 2I5MX 1X56A 3F2BA 4NXMQ 2AWOA 1UWVA 2KCMA 3GTPH 2JQOA 1IYJB 1YNXA 4DR4Q 1JE5A 1X9NA 4DR1L 3CCMA 3S2DH 1VQAA 3A5ZB 1VQLA 2Q2UA 4A93H 4IOAA 4NXNL 1N33L 1VQCA 4A3CG 2NVQH 1VQBA 3PSIA 3CCEA 3K7UC 1CSPA 1GKHA 4DV5L 1KAWA 1YZ6A 4LFAQ 5IYBG 1TWFH 3T1HL 4A3IH 1HNXL 4DV7L 3I7FA 4LF8L 3KF6A 2ZM6L 4IOCA 3Q8DA 3PV0A 4EQ5A 3KOJA 1J5EL 4QY7A 4JOIC 3GTGH 3S17H 3ULPA 5M5WH 1JJ2A 2UUBL 4JI0Q 2NVTH 1Z9FA 4UP8A 4GNXB 3HOUH 3HOYG 4LF4L 4C3HH 4GN5A 1VQ8A 1HJPA 2R93G 2VUMH 4GN3B 4AQYL 4O0AA 1X3GA 2I5LX 1W3SA 1RIPA 2LXJA 2HIVA 5H1SE 3W1GA 4X65L 5LMNQ 1YHQA 2E5LQ 1L0WA 1YIJA 5IYCH 2YU9H 1OXUA 1L1OA 1VQDA 4HIOA 4X64Q 4IFDG 1UE6A 4KI0A 3AFQA 1KIXA 2NN6G 4AIMA 4LF5Q 5JJLA 5C4JH 1NMFA 4UY8C 4JYAQ 2K5HA 1AE3A 1YJNA 2UUCL 4DV3L 2D0PA 2B63H 5DLQE 4XTCS 2AHOB 2ASBA 4A3DH 3WWVA 3BZKA 1EWIA 2A19A 4DR5Q 4GLAC 2OWOA 1XNQL 2VNUD 1TWHH 4YCVA 2IHEA 1MJCA 2IX1A 2UU9Q 2YYZA 2BH8A 1XPOA 2K75A 1VQ4A 1N36L 1A63A 1SE8A 4R4CA 2K4KA 2MNAA 1E1TA 1HNWL 2CKZB 3KFUA 3EBEA 4L5QA 4KHZA 3K81C 1H95A 1Q1BA 1Q46A 1U0LA 3I4OA 5C4XH 4QJFA 2CWAA 3KF8B 3PUXA 4R4QA 2YTYA 3M4PA 4DUYQ 4DR3Q 1N34L 1N32Q 3M4QA 2EIFA 1S40A 1K8GA 1I50H 3E0EA 3A5UA 1B70B 2JA9A 5C0XJ 4A3KG 1Q86C 2JA5G 3PF4A 4KHPQ 4A3CH 3RR5A 5IWAQ 3I56A 1C7YA 2OQKA 3NELA 2KHJA 4DV6Q 4YWLA 4YY3L 1PFSA 4GOPB 4R4TA 1Q8KA 2N8NA 3UDXA 3ULJA 4A93G 1VQMA 3AFPA 3S1RH 3HOWH 3CCJA 1G291 4GOPC 1OXSC 4OWXB 4XIGS 5FLMH 3TREA 4A3IG 4X66L 3S2HH 4POFA 1Y1WH 4LF9L 4A3GG 2ES2A 2VL6A 3W1BA 4DK6C 3PF5A 4O2DA 1O7IA 2VS1A 2A1AA 3G48A 3D31A 2Q2HA 4B3SQ 2VUMG 4GLXA 4QQBX 1XMQQ 4JV5L 2AKWB 4JBKA 4J15A 2Z0SA 1KC8C 1Q12A 1VQEA 3ERSX 5IYCG 4K0KL 1D8LA 2C35B 4UP9A 1XJVA 1I6HH 2JK8A 2UXBL 3U4ZA 1VQ5A 3FHWA 1YHBA 1SROA 4GLVB 4A75A 4OWWB 1SRUA 1CKNA 1PH2A 3U50C 2PI2E 1YJ9A 3PUZA 3CP0A 2VQFL 1SFOH 2GVAA 1CSQA 1DGSA 2NZHA 1K9MC 3CXCA 3KF6B 4Y7NH 3U58A 3BU2A 4LF7Q 2B63G 4JI3L 4JI8Q 2D62A 2IT1A 2WFWA 4JG2A 3J7ZC 1Z47A 4RMFA 4DV1Q 1PH5A 1N9WA 4A3DG 1C0AA 1QVGA 3PUYA 2VQEQ 2D0OA 4BA1I 4Y52H 2KCTA 5BR8L 4A76A 2YTVA 4DV0L 3S1QH 2WAQG 3F8TA 5FLXc 2JA7H 3I4MH 2F3IA 1L1OB 3D0FA 4YHHQ 1X65A 1Q81C 1Q7YC 1PV4A 5JEAJ 1PH8A 4DV1L 1GVPA 3CMEA 1HNZQ 4LUVA 1LYLA 2BA1A 5C4XG 3FKIH 1IZ6A 2EXDA 4HJ9A 3PO2H 4GKJL 2OTJA 2HHHQ 1V1QA 1XNRL 5M5XH 1VQNA 3STBD 5FJ8H 4L5RC 1HZCA 3OYYA 1YJWA 4NB3A 1QZGA 1A8VA 1C9OA 1X3EA 1PHJA 4B3ML 1XPUA 1W2BA 3ICEA 4ALPA 3J80i 3DLLA 4NXML 3H3VI 2VW9A 4HJ8A 1YVCA 1N8RC 4JI1Q 2OTLA 1V43A 2YV5A 3M7NA 4DR4L 1I3QH 4IJLA 4C2MH 1L2FA 2E8GA 2RHQB 3RZDH 2XGTA 4GS3A 3HOWG 1TWGH 2NVYH 3H15A 1Q1EA 4YCUA 3PCOB 1MJEA 2K5VA 3M3YH 1NBWA 5FLMG 4KLKA 1FGUA 4BBRH 1PH3A 4OX9Q 3CD6A 1Y1WG 4LFAL 2E2IH 3CCVA 4PMWA 4GNXC 1UE5A 3L0OA 4HJ5A 2VY3A 4JI0L 1WYDA 3UDFA 5HY6A 1E3PA 4BY1H 4P72A 3L7ZC 3CPWA 1I5FA 2NZOA 3CPFA 2MO1A 1U5KA 3EN2A 3UE0A 5JEAG 4OX9L 4A3LH 1G6PA 3B6YA 4B3TQ 5LMNL 2E5LL 4L5TA 2MO0A 3HFZB 3KLWA 3G71A 1EIYB 1B8AA 3OTOQ 3J81j 4X64L 5GROA 4LF5L 4QIWE 2ZJPA 2JE6I 4GKKQ 4LFCQ 1Y14B 1LTLA 3AYHB 2Z6KA 2IY5B 2N78A 3NBHB 5IY0A 3MEFA 2CCZA 4IFDI 4JYAL 1FL0A 4JC0A 2K5NA 4IPCA 4BA2I 1K8AC 4JI4Q 2NN6I 3GD7A 4PZ6A 2F52A 3E9IA 4DUZQ 4DR5L 3JAMi 2RHSB 5C44H 4JI7Q 1JJGA 1GM5A 4PZ8A 4GKKL 3CMAA 5M3MH 1VQFA 3J80c 3LGJA 1HR0Q 3CC7A 1E22A 2WAQE 1P16A 4HJAA 2UU9L 2JA7G 3HKSA 3I4MG 2R7FA 3GDEA 4LUOA 4DK3C 1EFWA 4MNOA 5J3BA 1CKNB 1M1KC 3HOXH 1VQ9A 2UUAQ 5ELNA 4JI7L 5IP7H 1JT8A 3HOZH 3K8AA 3FKIG 2AWNA 2JA8H 3J81i 2QEXA 3PO2G 3NENA 2YTXA 3RLFA 1ASYA 4DUYL 4DKAC 4DR3L 2R7ZH 3GTMH 1UE7A 1FJGQ 1N32L 2MQHA 5FJ8G 1SLJA 4B3RQ 1NY4A 1PH6A 2A8VA 4OO1G 3S16H 4KHPL 5IWAL 5M3FH 2V1CC 4DV6L 5C3EH 2GN5A 1PH4A 1QUQA 3K0XA 4A4IA 1P8LA 1CKMA 1TXYA 5GAHC 1IBKQ 2RCNA 2F4VQ 2ZTDA 4JI2Q 1MIUA 1IBLQ 4DR2Q 3ULLA 4R4OA 3M85A 1VQPA 4JCVE 3GTQH 2JA6H 5LMNW 2B3GA 2UXCQ 4BBRG 1X54A 4TQUS 5M5YH 1K3RA 4P73A 1X55A 3HOVH 5AJ3Q 2I0QA 3PUWA 3BZCA 3GTJH 2ZTEA 3RLNA 1UEBA 3CAMA 4A3JH 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFM A;  2HQL A;  3SGI A;  2AMC B;  2EQS A;  3K80 C;  4BY1 G;  4YCW A;  3JAM c;  3CCU A;  2Q2T A;  1KQS A;  1BBU A;  5C0X G;  1EQQ A;  4B3S L;  2E2J H;  1XMQ L;  4JI5 Q;  3AQQ A;  4A3L G;  4DAY B;  1VQJ A;  2HT1 A;  1A0I A;  3EIV A;  4L5S A;  1KRT A;  1KHI A;  4UPA A;  3TQY A;  5IP9 H;  1EOV A;  4DV2 Q;  4A3F H;  1XMO Q;  2BA0 A;  3M9B A;  1KRS A;  1YHA A;  4HJ7 A;  2Q2I A;  2UXD Q;  3PIO A;  1NE3 A;  1AH9 A;  5LMU Q;  2JJQ A;  4DR6 Q;  4DR7 Q;  3ZJY C;  1I94 Q;  1MKH A;  1VCI A;  2K50 A;  4EX5 A;  1ASZ A;  2E2H H;  3J81 c;  1BVS A;  1QVC A;  1VQI A;  1PH1 A;  4LF7 L;  5ELO A;  4HIK A;  4JI8 L;  1PH7 A;  4C3J H;  3OW2 A;  5C44 G;  2FXQ A;  1EQR A;  2VQE L;  1XTD A;  1CKO A;  1Q82 C;  4JBM A;  4X62 Q;  5JJK A;  5M3M G;  1XPR A;  3T1Y Q;  1L1O C;  3KYH C;  1EIF A;  2GVB A;  1HH2 P;  4LF6 Q;  3HKZ G;  2R7D A;  4YHH L;  1VQ6 A;  2Y0S G;  3PUV A;  4RG1 A;  4A3E H;  4OWT B;  3KJP A;  3NEM A;  3HOX G;  1OTC A;  1IL2 A;  1HNZ L;  5IP7 G;  3S15 H;  2DUD A;  4IFD J;  5K36 G;  4DR1 Q;  2JA8 G;  1PYB A;  3CC4 A;  4QGU A;  3CCR A;  3RZO H;  1A62 A;  2R7Z G;  2I5H A;  2HHH L;  4A3B G;  5GQO A;  4NXN Q;  1N33 Q;  3CW2 C;  2R92 H;  1CUK A;  1KL9 A;  1BBW A;  2Z6K C;  4A3M H;  4LFB L;  3DM3 A;  3G4S A;  4DV5 Q;  4POG A;  1JJC B;  4LFB Q;  5M3F G;  3UDG A;  3T1H Q;  4BBS G;  1HNX Q;  4DV7 Q;  1PH9 A;  2LSS A;  2LXK A;  5C3E G;  2ZM6 Q;  4LF8 Q;  3PO3 G;  1LUZ A;  1J5E Q;  3GTL H;  1K83 H;  4JI1 L;  4DNI A;  1M90 C;  1QVF A;  4LW1 A;  2UUB Q;  1Y1V H;  5GAD C;  4DV4 Q;  3IRB A;  5IYD H;  1WCM H;  4LF4 Q;  1PVO A;  3MXN B;  2HIX A;  1NJI C;  4AQY Q;  3RLO A;  4IPD A;  1UE1 A;  2JA6 G;  4X65 Q;  3KDF A;  2IHF A;  2ZJR A;  3AEV A;  1FVI A;  2K52 A;  3HOV G;  4A3G H;  4LWC A;  4TVA B;  4YWK A;  2JEA I;  3TRZ A;  3S1N H;  5GAG C;  4A3J G;  2OQ0 A;  2ZJQ A;  1HZB A;  4AYB E;  2L15 A;  4DV4 L;  4ME3 A;  3JC6 6;  3H0G H;  1S3O A;  2CQO A;  2R6G A;  4NPS A;  4DAM A;  1IBM Q;  2XTI A;  2UUC Q;  1QUQ B;  5HGQ A;  4DV3 Q;  4B3T L;  1HZ9 A;  1WOC A;  5IP9 G;  3L2P A;  3PGZ A;  4A3F G;  3OTO L;  2N49 A;  2VZA A;  4P71 A;  1XNQ Q;  4BXX H;  2PNH A;  1D7Q A;  4JI6 Q;  4HID A;  1GO3 E;  1G51 A;  4YWM A;  2KBN A;  4AH6 A;  4R4I A;  4WJ4 A;  4PG3 A;  4LFC L;  3CC2 A;  1IBM L;  1N36 Q;  1SMX A;  1SR3 A;  1WJJ A;  2KHI A;  1HNW Q;  4JOI A;  4IPG A;  1QZH A;  4JI4 L;  2PMZ E;  4FDB A;  4DUZ L;  4JI6 L;  3VDY A;  2ID0 A;  2WB1 G;  3CCL A;  2DGY A;  3I4N H;  2QGQ A;  1WI5 A;  2ZTC A;  3W5O A;  1VS0 A;  1OXX K;  3A0J A;  1N34 Q;  3CQZ H;  4APV A;  3UDI A;  1HR0 L;  1VQK A;  3GTK H;  3H3V H;  3HKZ E;  1S72 A;  4A3B H;  3F1Z A;  2K14 A;  2Y0S E;  4JBJ A;  2RF4 A;  5EAY A;  1AE2 A;  3E9H A;  4C3I H;  4GNX A;  3RNU A;  4IJH A;  4A3E G;  3J7A 5;  3A74 A;  1KXL A;  3U4V A;  4YY3 Q;  2UUA L;  4BBS H;  4BY7 H;  3CF5 A;  4IO9 A;  4LNQ A;  1HZA A;  3PO3 H;  3KJO A;  1YI2 A;  1JMC A;  4DR6 L;  2PQA B;  1PYS B;  2H5X A;  3PIP A;  1VQO A;  4MTN A;  1FJG L;  2R92 G;  4PZ7 A;  2BH2 A;  4B3R L;  4A3M G;  1BKB A;  3ER0 A;  4WJ3 M;  4X66 Q;  5IYB H;  1K73 C;  4LF9 Q;  4IPH A;  3HOZ G;  1X3F A;  4GN4 B;  1OXV A;  3GTO H;  1SN8 A;  3RN2 A;  3S14 H;  4DPG A;  1YIT A;  1IBK L;  3S24 A;  3UE1 A;  1Y1V G;  2F4V L;  4OO1 I;  4JI2 L;  5IYD G;  1IBL L;  1WCM G;  4DR2 L;  3HOY H;  3S1M H;  3TS2 A;  2R93 H;  3TEH B;  4JV5 Q;  3CCS A;  2ATW A;  1E7Z A;  2UXC L;  4K0K Q;  3TS0 A;  1YBY A;  5AJ3 L;  2UXB Q;  1EUJ A;  2CWP A;  2JEB I;  4OXP A;  1R9T H;  3GO5 A;  1EYG A;  1RL2 A;  2NVX H;  3HOU G;  1NMG A;  1J6Q A;  2WP8 J;  2MFI A;  4R1J A;  3H0G G;  2VQF Q;  3F2D A;  1GD7 A;  2KEN A;  3CCQ A;  1V9P A;  4H02 A;  4P75 A;  4JI5 L;  1WFQ A;  2B29 A;  2OCE A;  5IE8 A;  3M4O H;  4JI3 Q;  5JJI A;  2PQA A;  4LUZ A;  4DV2 L;  1XMO L;  2ALY B;  1VQH A;  1X6O A;  2IX0 A;  4BXX G;  4UP7 A;  5GAE C;  5IT9 c;  2UXD L;  1K0R A;  5C0X I;  4JBW A;  5BR8 Q;  5LMU L;  1HR0 W;  4DR7 L;  3KDF B;  1E1O A;  1NTG A;  1YEZ A;  1B7Y B;  4DV0 Q;  3I2Z A;  4GOP A;  3RN5 A;  1I94 L;  1JB7 A;  3F2C A;  4HIM A;  4MZ9 A;  2PI2 A;  1PA6 A;  1KD1 C;  3G6E A;  1IXR A;  2QA4 A;  1T9H A;  1VQ7 A;  2N3S A;  1E24 A;  1TWA H;  4OON A;  1TWC H;  4QL5 A;  2WB1 E;  3BJU A;  5E7N A;  3K7A H;  3STB C;  3I4N G;  4P74 A;  4GKJ Q;  4X62 L;  1VQG A;  3FP9 A;  1OXT A;  1LM0 A;  3T1Y L;  1XNR Q;  4X6A H;  3I55 A;  4LF6 L;  4A3K H;  4B3M Q;  2JA5 H;  4BY7 G;  2I5M X;  1X56 A;  3F2B A;  4NXM Q;  2AWO A;  1UWV A;  2KCM A;  3GTP H;  2JQO A;  1IYJ B;  1YNX A;  4DR4 Q;  1JE5 A;  1X9N A;  4DR1 L;  3CCM A;  3S2D H;  1VQA A;  3A5Z B;  1VQL A;  2Q2U A;  4A93 H;  4IOA A;  4NXN L;  1N33 L;  1VQC A;  4A3C G;  2NVQ H;  1VQB A;  3PSI A;  3CCE A;  3K7U C;  1CSP A;  1GKH A;  4DV5 L;  1KAW A;  1YZ6 A;  4LFA Q;  5IYB G;  1TWF H;  3T1H L;  4A3I H;  1HNX L;  4DV7 L;  3I7F A;  4LF8 L;  3KF6 A;  2ZM6 L;  4IOC A;  3Q8D A;  3PV0 A;  4EQ5 A;  3KOJ A;  1J5E L;  4QY7 A;  4JOI C;  3GTG H;  3S17 H;  3ULP A;  5M5W H;  1JJ2 A;  2UUB L;  4JI0 Q;  2NVT H;  1Z9F A;  4UP8 A;  4GNX B;  3HOU H;  3HOY G;  4LF4 L;  4C3H H;  4GN5 A;  1VQ8 A;  1HJP A;  2R93 G;  2VUM H;  4GN3 B;  4AQY L;  4O0A A;  1X3G A;  2I5L X;  1W3S A;  1RIP A;  2LXJ A;  2HIV A;  5H1S E;  3W1G A;  4X65 L;  5LMN Q;  1YHQ A;  2E5L Q;  1L0W A;  1YIJ A;  5IYC H;  2YU9 H;  1OXU A;  1L1O A;  1VQD A;  4HIO A;  4X64 Q;  4IFD G;  1UE6 A;  4KI0 A;  3AFQ A;  1KIX A;  2NN6 G;  4AIM A;  4LF5 Q;  5JJL A;  5C4J H;  1NMF A;  4UY8 C;  4JYA Q;  2K5H A;  1AE3 A;  1YJN A;  2UUC L;  4DV3 L;  2D0P A;  2B63 H;  5DLQ E;  4XTC S;  2AHO B;  2ASB A;  4A3D H;  3WWV A;  3BZK A;  1EWI A;  2A19 A;  4DR5 Q;  4GLA C;  2OWO A;  1XNQ L;  2VNU D;  1TWH H;  4YCV A;  2IHE A;  1MJC A;  2IX1 A;  2UU9 Q;  2YYZ A;  2BH8 A;  1XPO A;  2K75 A;  1VQ4 A;  1N36 L;  1A63 A;  1SE8 A;  4R4C A;  2K4K A;  2MNA A;  1E1T A;  1HNW L;  2CKZ B;  3KFU A;  3EBE A;  4L5Q A;  4KHZ A;  3K81 C;  1H95 A;  1Q1B A;  1Q46 A;  1U0L A;  3I4O A;  5C4X H;  4QJF A;  2CWA A;  3KF8 B;  3PUX A;  4R4Q A;  2YTY A;  3M4P A;  4DUY Q;  4DR3 Q;  1N34 L;  1N32 Q;  3M4Q A;  2EIF A;  1S40 A;  1K8G A;  1I50 H;  3E0E A;  3A5U A;  1B70 B;  2JA9 A;  5C0X J;  4A3K G;  1Q86 C;  2JA5 G;  3PF4 A;  4KHP Q;  4A3C H;  3RR5 A;  5IWA Q;  3I56 A;  1C7Y A;  2OQK A;  3NEL A;  2KHJ A;  4DV6 Q;  4YWL A;  4YY3 L;  1PFS A;  4GOP B;  4R4T A;  1Q8K A;  2N8N A;  3UDX A;  3ULJ A;  4A93 G;  1VQM A;  3AFP A;  3S1R H;  3HOW H;  3CCJ A;  1G29 1;  4GOP C;  1OXS C;  4OWX B;  4XIG S;  5FLM H;  3TRE A;  4A3I G;  4X66 L;  3S2H H;  4POF A;  1Y1W H;  4LF9 L;  4A3G G;  2ES2 A;  2VL6 A;  3W1B A;  4DK6 C;  3PF5 A;  4O2D A;  1O7I A;  2VS1 A;  2A1A A;  3G48 A;  3D31 A;  2Q2H A;  4B3S Q;  2VUM G;  4GLX A;  4QQB X;  1XMQ Q;  4JV5 L;  2AKW B;  4JBK A;  4J15 A;  2Z0S A;  1KC8 C;  1Q12 A;  1VQE A;  3ERS X;  5IYC G;  4K0K L;  1D8L A;  2C35 B;  4UP9 A;  1XJV A;  1I6H H;  2JK8 A;  2UXB L;  3U4Z A;  1VQ5 A;  3FHW A;  1YHB A;  1SRO A;  4GLV B;  4A75 A;  4OWW B;  1SRU A;  1CKN A;  1PH2 A;  3U50 C;  2PI2 E;  1YJ9 A;  3PUZ A;  3CP0 A;  2VQF L;  1SFO H;  2GVA A;  1CSQ A;  1DGS A;  2NZH A;  1K9M C;  3CXC A;  3KF6 B;  4Y7N H;  3U58 A;  3BU2 A;  4LF7 Q;  2B63 G;  4JI3 L;  4JI8 Q;  2D62 A;  2IT1 A;  2WFW A;  4JG2 A;  3J7Z C;  1Z47 A;  4RMF A;  4DV1 Q;  1PH5 A;  1N9W A;  4A3D G;  1C0A A;  1QVG A;  3PUY A;  2VQE Q;  2D0O A;  4BA1 I;  4Y52 H;  2KCT A;  5BR8 L;  4A76 A;  2YTV A;  4DV0 L;  3S1Q H;  2WAQ G;  3F8T A;  5FLX c;  2JA7 H;  3I4M H;  2F3I A;  1L1O B;  3D0F A;  4YHH Q;  1X65 A;  1Q81 C;  1Q7Y C;  1PV4 A;  5JEA J;  1PH8 A;  4DV1 L;  1GVP A;  3CME A;  1HNZ Q;  4LUV A;  1LYL A;  2BA1 A;  5C4X G;  3FKI H;  1IZ6 A;  2EXD A;  4HJ9 A;  3PO2 H;  4GKJ L;  2OTJ A;  2HHH Q;  1V1Q A;  1XNR L;  5M5X H;  1VQN A;  3STB D;  5FJ8 H;  4L5R C;  1HZC A;  3OYY A;  1YJW A;  4NB3 A;  1QZG A;  1A8V A;  1C9O A;  1X3E A;  1PHJ A;  4B3M L;  1XPU A;  1W2B A;  3ICE A;  4ALP A;  3J80 i;  3DLL A;  4NXM L;  3H3V I;  2VW9 A;  4HJ8 A;  1YVC A;  1N8R C;  4JI1 Q;  2OTL A;  1V43 A;  2YV5 A;  3M7N A;  4DR4 L;  1I3Q H;  4IJL A;  4C2M H;  1L2F A;  2E8G A;  2RHQ B;  3RZD H;  2XGT A;  4GS3 A;  3HOW G;  1TWG H;  2NVY H;  3H15 A;  1Q1E A;  4YCU A;  3PCO B;  1MJE A;  2K5V A;  3M3Y H;  1NBW A;  5FLM G;  4KLK A;  1FGU A;  4BBR H;  1PH3 A;  4OX9 Q;  3CD6 A;  1Y1W G;  4LFA L;  2E2I H;  3CCV A;  4PMW A;  4GNX C;  1UE5 A;  3L0O A;  4HJ5 A;  2VY3 A;  4JI0 L;  1WYD A;  3UDF A;  5HY6 A;  1E3P A;  4BY1 H;  4P72 A;  3L7Z C;  3CPW A;  1I5F A;  2NZO A;  3CPF A;  2MO1 A;  1U5K A;  3EN2 A;  3UE0 A;  5JEA G;  4OX9 L;  4A3L H;  1G6P A;  3B6Y A;  4B3T Q;  5LMN L;  2E5L L;  4L5T A;  2MO0 A;  3HFZ B;  3KLW A;  3G71 A;  1EIY B;  1B8A A;  3OTO Q;  3J81 j;  4X64 L;  5GRO A;  4LF5 L;  4QIW E;  2ZJP A;  2JE6 I;  4GKK Q;  4LFC Q;  1Y14 B;  1LTL A;  3AYH B;  2Z6K A;  2IY5 B;  2N78 A;  3NBH B;  5IY0 A;  3MEF A;  2CCZ A;  4IFD I;  4JYA L;  1FL0 A;  4JC0 A;  2K5N A;  4IPC A;  4BA2 I;  1K8A C;  4JI4 Q;  2NN6 I;  3GD7 A;  4PZ6 A;  2F52 A;  3E9I A;  4DUZ Q;  4DR5 L;  3JAM i;  2RHS B;  5C44 H;  4JI7 Q;  1JJG A;  1GM5 A;  4PZ8 A;  4GKK L;  3CMA A;  5M3M H;  1VQF A;  3J80 c;  3LGJ A;  1HR0 Q;  3CC7 A;  1E22 A;  2WAQ E;  1P16 A;  4HJA A;  2UU9 L;  2JA7 G;  3HKS A;  3I4M G;  2R7F A;  3GDE A;  4LUO A;  4DK3 C;  1EFW A;  4MNO A;  5J3B A;  1CKN B;  1M1K C;  3HOX H;  1VQ9 A;  2UUA Q;  5ELN A;  4JI7 L;  5IP7 H;  1JT8 A;  3HOZ H;  3K8A A;  3FKI G;  2AWN A;  2JA8 H;  3J81 i;  2QEX A;  3PO2 G;  3NEN A;  2YTX A;  3RLF A;  1ASY A;  4DUY L;  4DKA C;  4DR3 L;  2R7Z H;  3GTM H;  1UE7 A;  1FJG Q;  1N32 L;  2MQH A;  5FJ8 G;  1SLJ A;  4B3R Q;  1NY4 A;  1PH6 A;  2A8V A;  4OO1 G;  3S16 H;  4KHP L;  5IWA L;  5M3F H;  2V1C C;  4DV6 L;  5C3E H;  2GN5 A;  1PH4 A;  1QUQ A;  3K0X A;  4A4I A;  1P8L A;  1CKM A;  1TXY A;  5GAH C;  1IBK Q;  2RCN A;  2F4V Q;  2ZTD A;  4JI2 Q;  1MIU A;  1IBL Q;  4DR2 Q;  3ULL A;  4R4O A;  3M85 A;  1VQP A;  4JCV E;  3GTQ H;  2JA6 H;  5LMN W;  2B3G A;  2UXC Q;  4BBR G;  1X54 A;  4TQU S;  5M5Y H;  1K3R A;  4P73 A;  1X55 A;  3HOV H;  5AJ3 Q;  2I0Q A;  3PUW A;  3BZC A;  3GTJ H;  2ZTE A;  3RLN A;  1UEB A;  3CAM A;  4A3J H;  4AYB G; 
#chains in the Genus database with same CATH topology
 2CFM A;  2HQL A;  3S1Q B;  2K5D A;  4C1N I;  2EQS A;  4BY1 G;  5KYL A;  3JAM c;  1WTQ A;  3CCU A;  2Q2T A;  2JA7 B;  1BBU A;  1EQQ A;  2E2J H;  3AQQ A;  3HRZ C;  3EIV A;  4QB4 A;  4RH6 A;  1KHI A;  4DN4 M;  3I70 A;  5KND A;  1ET9 A;  1YHA A;  4HTH A;  3TBI B;  4DR6 Q;  1ASZ A;  5C5M A;  2E2H H;  2RDG A;  2RSN A;  5C44 G;  1EQR A;  2XRQ D;  1LT6 D;  1F9R A;  1CKO A;  4K8J A;  5M3M G;  2FFK B;  4IUT A;  2NVY B;  3KYH C;  1AEX A;  3A56 A;  5EQ0 A;  3HOZ B;  2HCI A;  2Y0S G;  3PUV A;  3GTL B;  2F0Q A;  1IL8 A;  1B3Q A;  1A3U A;  3S15 H;  4N8X 1;  1PYB A;  1IHZ A;  3RZO H;  4KK7 A;  4IUU A;  3DWQ A;  5ELF A;  5BN3 A;  2R7Z G;  1U9R A;  1QOH A;  3CW2 C;  2J4X A;  4BBS G;  4HMJ A;  1U4P A;  3J81 L;  3Q24 A;  1K83 H;  2ZT9 C;  4DNR B;  3H0G B;  1M90 C;  2OEO A;  1PRT C;  2OT2 A;  2PO4 A;  5IYD H;  1PVO A;  1TS2 A;  2PYK A;  5IGB A;  1QE6 A;  1EYC A;  4H44 C;  2WIN B;  2OQ0 A;  4AYB E;  2L15 A;  4DV4 L;  2E76 C;  3JC6 6;  5KNC A;  2CQO A;  2R6G A;  4DAM A;  3Q23 A;  5KNB A;  5HGQ A;  5IP9 G;  1IW7 D;  3PGZ A;  4P71 A;  1FR3 A;  4BXX H;  1D7Q A;  1G51 A;  3AB9 A;  2KBN A;  4AH6 A;  1T5E A;  4R4I A;  4YIJ A;  2XWB B;  3QR8 A;  3RD4 A;  1SMX A;  4KTA A;  1SR3 A;  1D6E C;  1UAP A;  1WJJ A;  1RCV D;  2KHI A;  3BDL A;  2PMZ E;  2BCO A;  1WD1 A;  3CCL A;  2QGQ A;  5EBD A;  3GTK H;  3GTQ B;  3HKZ E;  5M9O A;  4A3B H;  3F1Z A;  4G7O C;  2DJF C;  3NHH A;  4RHS A;  2RF4 A;  3P75 A;  5EAY A;  5BN4 A;  3K5N A;  3RNU A;  2AUK A;  4A3E G;  3J7A 5;  2F4I A;  1AZP A;  4XYO A;  1KAA A;  1FNW A;  2K32 A;  3PO3 H;  3KJO A;  1YI2 A;  2NUC A;  2EZV A;  1JMC A;  1JC7 A;  2A6E C;  1PYS B;  3PIP A;  1VQO A;  5LL6 X;  2R92 G;  2BDO A;  4PZ7 A;  3OSO A;  5IYB H;  3RN2 A;  5DNF A;  1YIT A;  4WFN 3;  2J0T D;  5CV4 A;  1Y1V G;  2F4V L;  1FD7 D;  1WCM G;  1ENC A;  3AU7 A;  4DR2 L;  3HOY H;  1HQM C;  3OOC A;  3S1M H;  5J22 A;  2E2H B;  2VB2 X;  1KNA A;  4RFB A;  1O7L A;  2UXB Q;  2CWP A;  1A15 A;  3GO5 A;  1RL2 A;  5I6Y A;  2M00 A;  3LX0 A;  2KEN A;  5EJW A;  3KF8 A;  2O5J C;  3TP5 A;  1NSN S;  1TWC B;  4R9W A;  2QEJ C;  1L0Y B;  5LMU L;  1HR0 W;  2F3V A;  2F0M A;  1E1O A;  1NTG A;  4A3K B;  1JIC A;  1I94 L;  4DR7 L;  3FPP A;  1JB7 A;  3F2C A;  2DN8 A;  3QOL A;  3CKI B;  4DK0 A;  1D5Z C;  1IXR A;  1LTG D;  1T9H A;  1GHK A;  1STA A;  1K83 B;  3STB C;  1KLU D;  1BXT A;  4X62 L;  1SE3 A;  1EYA A;  1OO9 B;  3PQI A;  4MTK A;  4A3G B;  2JA5 H;  1DOM A;  4M1U B;  3S17 B;  3F2B A;  4Q5V A;  4K5X A;  2OF1 A;  3GTP H;  1IYJ B;  1B9N A;  4KKS A;  1HFN A;  4A93 H;  1MSG A;  1Q90 A;  4A3C G;  1GUN A;  1K28 A;  3NUC A;  2NVQ H;  2EOT A;  3PSI A;  3K7U C;  1WTX A;  2MPM A;  1CSP A;  1WTV A;  1RF2 D;  4LFA Q;  4A3I H;  1TWF H;  3TZD A;  4LFB L;  2ZM6 L;  2WAC A;  2XN9 C;  3KOJ A;  1J5E L;  5CV8 A;  5IGG A;  4KN7 C;  3ULP A;  1IYU A;  2G5D A;  2QDB A;  4JI0 Q;  1JJ2 A;  2NVT H;  1SEB D;  3HOU H;  1DON A;  1F2M A;  2R93 G;  2B2Y C;  4GN3 B;  4O0A A;  4F7X A;  1X3G A;  2I5L X;  4LNQ A;  2JXM B;  2HIV A;  1YHQ A;  1YIJ A;  5IYC H;  1VQD A;  1F2Y A;  2CW0 D;  3DMU A;  2SOB A;  3AFQ A;  1YNJ C;  4M8A A;  4OIJ A;  2C9O A;  3I72 A;  1NMF A;  2O2L D;  1AE3 A;  1BCP C;  1STN A;  1B50 A;  3VYS A;  2D0P A;  5DLQ E;  4IAL A;  1RDP D;  3SEB A;  4XTC S;  3H3V C;  2QIL A;  4F8M A;  5JPM C;  1SSO A;  4PMC A;  3VR3 A;  2VNU D;  1TWH H;  1I50 B;  2IHE A;  2IX1 A;  4IUR A;  1N36 L;  1SE8 A;  5ELE A;  4TSS A;  1I4Q A;  2CKZ B;  1H95 A;  2EVB A;  1JR0 D;  1BF4 A;  4RHR A;  2K1B A;  2YTY A;  4R4Q A;  3KLR A;  4DUY Q;  4DR3 Q;  3HOY B;  3S1M B;  4FVM A;  1K8G A;  3E0E A;  1B70 B;  3PF4 A;  3HGB A;  3I56 A;  2RDH A;  3NEL A;  4CDD C;  4DV6 Q;  4YY3 L;  1PFS A;  4RKB A;  4R4T A;  3G6J B;  3NQI A;  2EJM A;  2N8N A;  1AZQ A;  4FXD A;  3ULJ A;  1VQM A;  1B1Z A;  2R61 A;  3HOW H;  4DFA A;  5C3X A;  4GOP C;  4J6H A;  1RKN A;  2FMC A;  2JN4 A;  1JOR A;  2MGS A;  4XDX A;  4DAV A;  4FXK C;  4MN3 A;  4P2C B;  3PF5 A;  4K2K A;  2DNE A;  3G48 A;  3JAM E;  4QQB X;  2VUM G;  3KLS X;  4JV5 L;  2AKW B;  4BS9 A;  4KV6 A;  1KC8 C;  2CH4 A;  1VQE A;  1D8L A;  1XJV A;  3QG1 A;  3BDO A;  4A75 A;  2PI2 E;  2L9H A;  4RGM A;  1SFO H;  2VQF L;  4ZYS A;  2IPK D;  1DGS A;  4ZQ3 A;  1K9M C;  4Y7N H;  3U58 A;  3BU2 A;  2B63 G;  3QOJ A;  2B8G A;  2NB0 A;  1EY8 A;  2D62 A;  2WFW A;  4A3D G;  1Z47 A;  1PH5 A;  2D0O A;  5BR8 L;  3G7L A;  1ZEQ X;  4A93 B;  1R4Q B;  3F8T A;  3MC0 B;  1L1O B;  2EYL A;  2FIN B;  1X65 A;  3D0F A;  4LJZ C;  1Q7Y C;  4A3I B;  1PV4 A;  1PH8 A;  1TWF B;  1YNN D;  3VR4 A;  1STH A;  1V1P B;  1I3Q B;  4C2M B;  3NTI A;  3WDN A;  5C4Z A;  3MAQ A;  3FKI H;  4HJ9 A;  5J39 A;  5M5X H;  5FJ8 H;  4BBR B;  1YJW A;  4OO1 H;  5G3L D;  3ICE A;  1LAB A;  3C3L A;  4NXM L;  4ZKC B;  1JQY D;  4HJ8 A;  4DAY A;  1N8R C;  2OTL A;  3M7N A;  3SXH A;  4IJL A;  1EEI D;  4PNY A;  4QIW B;  1S5B D;  3A8I E;  1GUS A;  2XGT A;  1TWG H;  3H15 A;  3SR1 A;  2HCC A;  1S5F D;  1MJE A;  1JWM D;  4KLK A;  1FGU A;  4XQQ A;  3CCV A;  1II3 A;  1SNO A;  4HJ5 A;  1TS3 A;  1GXD C;  4HSP A;  4NMZ A;  5T1G A;  3CU7 A;  1WYD A;  2B8F A;  3UDF A;  3T56 B;  1U5K A;  4A3L H;  3UE0 A;  4CJ2 C;  2SNS A;  4OX9 L;  3OW7 A;  2E5L L;  5C44 B;  2MO0 A;  3A8J E;  1B8A A;  1MHW C;  3J81 j;  3HZX A;  3J7A F;  5CYU A;  4LF5 L;  2PW5 A;  2JE6 I;  1LTL A;  3AYH B;  4L8J A;  1GUT A;  1BR9 A;  5AFW A;  3VR2 A;  3MEF A;  2CCZ A;  4OIK A;  1FGB D;  2K5N A;  1VF7 A;  4RAU C;  3TP7 A;  2A68 D;  2L5T A;  1STG A;  4PZ8 A;  1B53 A;  4OEL B;  3J80 c;  3S16 B;  2K5Q A;  5I4D A;  2PPB C;  1EY0 A;  1TY0 A;  4ME5 A;  2F1M A;  4KKU A;  5K36 H;  2JA8 H;  2AWN A;  3PMF A;  4O1N A;  3PO2 G;  2I46 A;  1XX8 A;  3GTM H;  3VYR A;  4WJW A;  1H9M A;  1CHQ D;  5I2Y A;  1QWY A;  4KHP L;  5IWA L;  3TDQ A;  5C3E H;  2GN5 A;  1PH4 A;  1QUQ A;  2TSS A;  2RCN A;  4X3U A;  2F4V Q;  2NTT A;  2WV6 D;  4DR2 Q;  2RKS A;  4RGT A;  3NTK A;  2GA4 B;  4KD3 A;  1X54 A;  1K3R A;  3HOV H;  1X55 A;  1IKL A;  2I0Q A;  3MWY W;  3GTJ H;  1TKW B;  3RLN A;  1B44 D;  4CJ0 B;  4A3J H;  4KJN A;  5IGD A;  4B9W A;  5DM7 3;  1DM0 B;  5A2Q L;  4B3S L;  5EBC A;  5C0X G;  3DWA A;  1CK1 A;  1VQJ A;  1A0I A;  5C4H A;  1R4P B;  1D2B A;  3MXU A;  4U68 A;  1EOV A;  4EVO A;  4A3F H;  3M9B A;  1O78 A;  1GUO A;  2NWG A;  2Q2I A;  1QG7 A;  1NE3 A;  3N52 A;  1AH9 A;  5LMU Q;  4DR7 Q;  3MFG A;  3ZJY C;  1I94 Q;  3IFD A;  5BN5 A;  1VCI A;  4A3E B;  1MSH A;  3BZD B;  3J81 c;  1PH1 A;  2AUJ D;  4JI8 L;  4QCL A;  1I4R A;  3OW2 A;  1BQQ T;  2FXQ A;  1H9K A;  1Q82 C;  2R92 B;  5JJK A;  4FO2 A;  4X62 Q;  2RCF A;  1Z7T A;  5G3L F;  1XPR A;  1EIH A;  1GUG A;  2RQX A;  3K59 A;  1VDZ A;  3MA2 B;  4RG1 A;  3NK9 A;  3KJP A;  3HOX G;  1HUN A;  1Y1V B;  5D3I B;  3DWP A;  3CC4 A;  5E4W C;  2HHH L;  2VB3 X;  4A3B G;  4H13 C;  1CUK A;  3T53 B;  1PFN A;  2EXZ A;  5COY A;  2B2U C;  4A3M H;  3DM3 A;  1PZJ D;  4LFB Q;  3UDG A;  3HOZ H;  1PH9 A;  2ZM6 Q;  3PO3 G;  4JVZ A;  2H4O A;  1J5E Q;  3GTL H;  4JI1 L;  4CKC A;  4DNI A;  2Z1C A;  1QVF A;  3EFX D;  3IRB A;  1JCK B;  3MXN B;  1NJI C;  2JA6 G;  3KDF A;  2ZJR A;  4YWK A;  2JEA I;  1F77 A;  1EWH A;  2PW7 A;  4ME3 A;  1B2T A;  1RHP A;  1X3P A;  3H0G H;  3HKZ B;  2JSO A;  4EQO A;  1IBM Q;  3WOF A;  3Q6S A;  3Q22 A;  3OTO L;  2VZA A;  3CQZ B;  4JI6 Q;  1DD2 A;  2LKV A;  3GTM B;  4WOR A;  1JOK A;  1Z6H A;  3CC2 A;  1N36 Q;  2EYF A;  1ZYR C;  4IPG A;  1GOZ A;  2R3Z A;  4FDB A;  4C3J G;  1TS4 A;  1CHP D;  1EFI D;  2WB1 G;  1Q8I A;  1CA6 A;  2B2Y A;  1OXX K;  1VS0 A;  3NSW A;  3UDI A;  2E2D C;  2LFN A;  1S72 A;  2Y0S E;  3K5L A;  3E9H A;  3NPP A;  3GTO B;  3A74 A;  1KXL A;  3CRK C;  4YY3 Q;  2UUA L;  4XQJ A;  1HZA A;  2KEC A;  2R93 B;  4XXE A;  2X6G A;  1Y8N B;  4B3R L;  1PFM A;  1LLR D;  1R9T B;  2NVX B;  1I4G A;  4IN3 A;  4GN4 B;  3KLS A;  1O80 A;  3ITP A;  3TEH B;  4JV5 Q;  4QUF A;  2UXC L;  1AW7 A;  3TN2 A;  4B9X A;  1H9S A;  1EUJ A;  2JEB I;  1EY7 A;  3K5M A;  3HOU G;  1NMG A;  5JPN C;  1FNU A;  1LT4 D;  3A55 A;  1KDA A;  4KMU C;  2VQF Q;  3CCQ A;  2QCP X;  4JI5 L;  1WFQ A;  2HUG A;  1LAC A;  4EQN A;  3C1F A;  2MHV A;  3T16 A;  1E2W A;  1QNU A;  1XMO L;  4QF4 A;  2ALY B;  2F3W A;  1SNC A;  1VQH A;  2F0G A;  4CBV A;  5IOD A;  5A35 A;  2Q8I B;  5IT9 c;  1K0R A;  5C0X I;  2F0W A;  5BR8 Q;  2HD3 A;  4GOP A;  3I2Z A;  4A3M B;  5KYI A;  1PA6 A;  2E75 C;  5I9P A;  2PCF B;  3G6E A;  2FHT A;  2QA4 A;  3S2D B;  4QL5 A;  1TWC H;  3I91 A;  3BJU A;  3K7A H;  3I4N G;  2NZ1 D;  2A69 C;  4P74 A;  3I8Z A;  5E4X A;  4LF6 L;  3S14 B;  4A3K H;  4C3I G;  5D14 A;  1CTM A;  4BY7 G;  2F0O A;  1X56 A;  4FF1 A;  4NXM Q;  2JP1 A;  2AQ1 B;  2KCM A;  2JQO A;  1X9N A;  2K01 A;  4DR1 L;  3FEW X;  2VUM B;  2BE5 C;  3A5Z B;  2EY6 A;  1SMY D;  4NXN L;  2SEB D;  1ESF A;  2EJF C;  4DV5 L;  1KAW A;  1YZ6 A;  4K8I A;  4A3G H;  1HNX L;  3I7F A;  4LF8 L;  3KF6 A;  2HDL A;  4IOC A;  3Q8D A;  3S17 H;  3X3N A;  3EQL C;  4UHV A;  1I4P A;  2UUB L;  1V1O A;  4FYD A;  1Z9F A;  4GNX B;  2A73 B;  4LF4 L;  4C3H H;  4GN5 A;  1VQ8 A;  1ILQ A;  1QIL A;  1TY2 A;  3NE5 B;  4AQY L;  4FF2 A;  4A3D B;  2E5L Q;  4QMG A;  4IFD G;  4HED A;  1SDF A;  2PQE A;  2KJX A;  2NN6 G;  4LF5 Q;  5JJL A;  1AN8 A;  2F0L A;  2Z4H A;  3I73 A;  2UUC L;  4DV3 L;  1I6V C;  3QIA A;  2AHO B;  4ILW A;  2ASB A;  3WWV A;  1NAP A;  4GLA C;  4G7H C;  3J80 E;  4PQX A;  2E74 C;  1XPO A;  3R8B A;  3QB3 A;  4EQP A;  4PV1 C;  1EOT A;  2XWJ B;  3DUZ A;  1U0L A;  1Q46 A;  5C4X H;  2N88 A;  3BDC A;  2K33 A;  1I50 H;  5C0X J;  2Z6B A;  4KHP Q;  5IWA Q;  2NBF A;  3MHB A;  2QKI C;  1Q8K A;  5T1I A;  1LTB D;  1D1K A;  3K0Y A;  3AFP A;  3S1R H;  4K5W A;  1G29 1;  5FLM H;  4X66 L;  4R8I A;  1PFB A;  4POF A;  2F0P A;  4LF9 L;  1UNS A;  2VL6 A;  4J8Q A;  5DAU A;  3NQT A;  3D31 A;  4XT1 B;  4B3S Q;  2B2T A;  2CHB D;  5JEA H;  4GLX A;  1U4M A;  2Z0S A;  1Q12 A;  4K0K L;  1FYC A;  3A8K E;  3K7A B;  1VQ5 A;  3A54 A;  5KGU A;  1SAP A;  1PH2 A;  1CKN A;  3P20 A;  3U50 C;  2F0V A;  2GVA A;  3J81 E;  3CXC A;  4JI8 Q;  3MTS A;  3J7Z C;  2EYJ A;  4RMF A;  3PO2 B;  4K14 A;  1QVG A;  1EL0 A;  1JOQ A;  4GZY C;  4Y52 H;  1RJT A;  2KCT A;  1BNZ A;  1UUP A;  4DV0 L;  4XYQ A;  2WAQ G;  5FLX c;  2F3I A;  1B9M A;  5JEA J;  4DV1 L;  1S4Z A;  4NDX A;  4LUV A;  2BA1 A;  3SK8 A;  4C3H B;  2HHH Q;  3R2T A;  4DNT B;  4L5R C;  2LMC B;  1A8V A;  4B3M L;  5IT9 L;  5EKI A;  1C8C A;  3H3V I;  4JI1 Q;  1V43 A;  4DR4 L;  4ZUI A;  1CI3 M;  1V8Q A;  1I3Q H;  4C2M H;  5I2X A;  1WTR A;  1HTP A;  1L2F A;  2RHQ B;  3MVV A;  5CV7 A;  4R8N A;  4GS3 A;  1PRT B;  1Q1E A;  4YCU A;  2PZT A;  3PCO B;  4BBR H;  1DOK A;  1KAB A;  1Y1W G;  2E2I H;  1PMR A;  3GV6 A;  2VY3 A;  1PTO D;  1SBB B;  4BY1 H;  1IW7 C;  3CPW A;  1I5F A;  1STY A;  2NZO A;  5LL6 S;  2MO1 A;  3SVM A;  1G6P A;  2F0E A;  2O5I C;  5EGT A;  1AP0 A;  1EZ6 A;  3KLW A;  1EZ8 A;  1DOL A;  1HTL D;  1XTC D;  1WTP A;  1EIY B;  3OTO Q;  1F9S A;  5C4X B;  1ET6 A;  5GRO A;  1SXT A;  4KY5 A;  4ZAI A;  4GKK Q;  2B2U A;  2N78 A;  3NBH B;  4IFD I;  4HSV A;  1FL0 A;  1G2S A;  1PLF A;  3A7A B;  3HOX B;  4BA2 I;  2F0J A;  2NN6 I;  3GD7 A;  1M4V A;  2F52 A;  3E9I A;  1U4R A;  4DR5 L;  5C44 H;  1GM5 A;  3BVM A;  5M3M H;  3S1R B;  3CC7 A;  2EYO A;  2JA7 G;  3HKS A;  3I4M G;  3GDE A;  3ERO A;  1A3T A;  3NXW A;  4ULL A;  5CBA E;  1W6K A;  4DK3 C;  4HCS A;  1NNX A;  4MNO A;  1VQ9 A;  4JI7 L;  2UUA Q;  4HR7 B;  2EY5 A;  2QEX A;  2YTX A;  2R7Z H;  2JA6 B;  4DKA C;  1N32 L;  2HQE A;  1QB5 D;  1SNM A;  1UE7 A;  3TME A;  4B3R Q;  3IL8 A;  2IL8 A;  2A8V A;  3S16 H;  1CZG A;  4QUC A;  2V1C C;  4K6D A;  5JAV A;  1K0S A;  4BWG B;  4F88 A;  3ULL A;  4JCV E;  2D9U A;  2NTS A;  3K57 A;  2UXC Q;  4IQZ A;  1IKM A;  2EPB A;  4E6I A;  4P73 A;  2EDG A;  3TSS A;  1LTI D;  3BZC A;  2ZTE A;  4L63 B;  3VYU A;  1M1K C;  1EWC A;  3T4A C;  3J7A V;  2PZW A;  1ILP A;  2AMC B;  3K80 C;  2IJ0 A;  1LT3 D;  1KQS A;  4JI5 Q;  1XMQ L;  4C3J B;  2HT1 A;  4L5S A;  5IP9 H;  1KDC A;  2WB1 B;  5NUC A;  1XMO Q;  2BA0 A;  3U9O A;  2RBM A;  4EX5 A;  4DA2 A;  5IIF A;  1PH7 A;  1JWS D;  1CQV A;  3E6Z X;  4ZUJ A;  5EKK A;  1EIF A;  2F0H A;  2GVB A;  1NUC A;  2KOL A;  5K5P A;  4LF6 Q;  2R7D A;  1VQ6 A;  4A3E H;  4OWT B;  1X32 A;  3KUP A;  2E2I B;  1RTO A;  1SNP A;  2F0T A;  1HNZ L;  5IP7 G;  2DUD A;  4IFD J;  2IX3 A;  4DR1 Q;  2L1B A;  2K05 A;  4QGU A;  3CCR A;  1A62 A;  5DM6 3;  4BY1 B;  4MHE A;  4XT3 B;  1BUV T;  3P7J A;  4NXN Q;  2R92 H;  5ELB A;  1KL9 A;  1ZKO A;  3S1N B;  1PTO F;  5ELC A;  4DV5 Q;  1JJC B;  3C1E A;  5M3F G;  1HNX Q;  1KTK A;  2LSS A;  2Z9H A;  4LF8 Q;  1LUZ A;  5FLX L;  2A6H D;  5IGF A;  1EIG A;  2UUB Q;  2K7V A;  1Y1V H;  5GAD C;  4DV4 Q;  1HQR D;  1WCM H;  4LF4 Q;  3EJI A;  3MXP A;  2HIX A;  4AQY Q;  2CW0 C;  1UE1 A;  4DXG A;  3K5O A;  3AEV A;  2F0U A;  1FVI A;  4LWC A;  5GAG C;  1D5M C;  1HZB A;  3DEO A;  5M3M B;  2DNC A;  1PTO H;  4L6T B;  3CHB D;  4RA8 A;  2O4X A;  4NPS A;  2Y0S B;  4PMB A;  2XTI A;  2UUC Q;  4DV3 Q;  1HZ9 A;  1GUW A;  1SNQ A;  3L2P A;  2ZXR A;  4HID A;  2R7Z B;  2PZU A;  4J1M A;  4C3I B;  2A5H A;  3NP8 A;  4Z9C B;  1S5D D;  3TZU A;  4BY7 B;  1G91 A;  4BBS B;  1F2Z A;  4B08 A;  1CQF A;  1GHJ A;  1QZH A;  2B2T C;  3VDY A;  2ID0 A;  1HA5 A;  1WI5 A;  3W5O A;  5FO8 B;  2D5D A;  1WVL A;  1A6X A;  4FNF A;  3CQZ H;  1H9S B;  4OEM B;  1ICF B;  1AE2 A;  4IJH A;  3TP6 A;  4DU9 A;  4IO9 A;  5HGT A;  2NYZ D;  4DAP A;  4MTN A;  1FJG L;  4KD4 A;  2RSO A;  5EPK A;  4X66 Q;  1U4L A;  4ZCK A;  1T5X D;  4LF9 Q;  4IPH A;  4FF4 A;  1OXV A;  3MZ5 A;  1SN8 A;  3GTO H;  2C5C A;  1TII D;  3OHX C;  3UE1 A;  5JVH 3;  1IBK L;  4JI2 L;  5IYD G;  1IBL L;  3M4O B;  2R93 H;  4ODG A;  3CCS A;  2ATW A;  4K0K Q;  3QJY A;  1YBY A;  3TS0 A;  5AJ3 L;  1SYB A;  3EVQ A;  1EY5 A;  4OXP A;  1R9T H;  1EYG A;  2NVX H;  1UEA B;  2WP8 J;  1Y8O B;  1GD7 A;  3DM1 A;  4LK1 C;  1V9P A;  4H02 A;  3SK4 A;  4CGY B;  2B29 A;  5IE8 A;  2PQA A;  2F0K A;  5J1Z A;  4LUZ A;  4DV2 L;  2XRS D;  2IX0 A;  4BXX G;  5GAE C;  2UXD L;  4JBW A;  1VMC A;  1YEZ A;  4DV0 Q;  3RN5 A;  1B7Y B;  1YNN C;  1A2T A;  5EPJ A;  4HIM A;  1SE2 A;  4OHJ A;  3ERQ A;  1E24 A;  2G9H D;  4OON A;  2WB1 E;  4G7Z C;  5KRU A;  4CKB A;  3Q0A A;  1WCM B;  3U9S A;  3T1Y L;  5D3D A;  1LM0 A;  3I55 A;  4B3M Q;  2MJ8 A;  3D6C A;  3MEH A;  1LTT D;  2MUY A;  4HN7 A;  1W6J A;  1UWV A;  5M5W B;  3WOE A;  1YNX A;  4DR4 Q;  1JE5 A;  2DY8 A;  3S2D H;  1PTO B;  4OL7 A;  2Q2U A;  1DCZ A;  4IOA A;  1N33 L;  3I90 A;  4KY7 A;  4JW0 A;  1GKH A;  3S14 H;  5IYB G;  3T1H L;  3V2T A;  4DV7 L;  3GTG H;  3PV0 A;  4JOI C;  5IOC A;  4HMI A;  1AFP A;  1JWU D;  4DGZ A;  1F9Q A;  4UP8 A;  4CDE C;  3HOY G;  3URY A;  1HJP A;  2BE5 D;  2VUM H;  1CZW A;  1TT2 A;  1PRT D;  2EY1 A;  4X65 L;  5H1S E;  2LXJ A;  3W1G A;  2YU9 H;  1L0W A;  1L1O A;  4HIO A;  4KI0 A;  1KIX A;  2WAQ B;  1V1P A;  1LTA D;  2KED A;  1ICW A;  4JK1 C;  4KKT A;  3RUZ A;  4UY8 C;  5FK9 C;  2A68 C;  3KBX A;  2B63 H;  2DY7 A;  4A3D H;  2F0F A;  1EWI A;  2OWO A;  4DR5 Q;  1XNQ L;  2QF7 A;  4K2L A;  3SHL A;  4YCV A;  1MJC A;  2Z8L A;  2CQA A;  3NWT A;  2K4K A;  2MNA A;  3IKJ A;  5ELD A;  4WRD A;  1HNW L;  4EGV A;  3KFU A;  5A2Q E;  3K81 C;  4N8F A;  4LAA A;  2CWA A;  3KF8 B;  3PUX A;  1PXU A;  1N32 Q;  5JJZ A;  1N34 L;  1S40 A;  2IWH A;  1ENA A;  3A5U A;  2JA9 A;  1Q86 C;  1Y1W B;  2JA5 G;  1M8A A;  3RR5 A;  1NR2 A;  1C7Y A;  1EYD A;  2OQK A;  4YWL A;  3OPO A;  3SK6 A;  3FMC A;  1HA6 A;  3UDX A;  1VF5 C;  1SND A;  2RVL A;  4A93 G;  4XIG S;  3FPU B;  1I6H B;  2A6E D;  4A3I G;  1SYE A;  4H7B A;  2ES2 A;  4O2D A;  1G6Z A;  2Q2H A;  1XMQ Q;  4JBK A;  4J15 A;  2Q8T A;  5IYC G;  4UP9 A;  3S9W A;  4UDU C;  2JK8 A;  2F0D A;  3I4M B;  4I65 A;  1MGS A;  1CSQ A;  2EJG C;  3FVQ A;  3IAY A;  1X3Q A;  4JI3 L;  4C1N K;  1N9W A;  4N9P A;  3KBG A;  4NW2 A;  4BA1 I;  2YTV A;  1BOS A;  2Q8R E;  2F0S A;  2XSC A;  1LO5 D;  5FO7 B;  3GTG B;  3CME A;  3V05 A;  1HNZ Q;  3BVG A;  2XVS A;  3RZD B;  2EXD A;  5CC4 A;  3PO2 H;  4GKJ L;  1XNR L;  1B3A A;  2KCN A;  3STB D;  1HZC A;  3OYY A;  2I07 B;  4NB3 A;  3ND8 A;  1QZG A;  2LY7 A;  1G8Z D;  2YU9 B;  4ALP A;  3DLL A;  2F0N A;  4K6L A;  1TR5 A;  1YVC A;  4I7Z C;  2YV5 A;  2G9D A;  1HXY D;  1PRT F;  1EY6 A;  2E8G A;  4X3T A;  1NR4 A;  3HOW G;  1SYG A;  1F2L A;  5CMD A;  2B63 B;  2K5V A;  3M3Y H;  1NBW A;  1SYD A;  4OX9 Q;  3CD6 A;  4DXF A;  1XYI A;  5I6W A;  2KEE A;  2V4D A;  1LV9 A;  5D65 A;  4CDF C;  5HY6 A;  1E3P A;  4P72 A;  3CPF A;  3EN2 A;  5KIX A;  5C0X H;  1D1I A;  5EKL A;  4C56 C;  2WII B;  3VA5 A;  5LMN L;  3G71 A;  3LNN A;  1K8O A;  1ENF A;  2F03 A;  4IUN A;  2CH4 W;  3D4D A;  3OIQ A;  4X64 L;  2XIW A;  2ZJP A;  2EY2 A;  2IY5 B;  3H94 A;  1IYV A;  4CKE A;  1YNJ D;  2H1E A;  4G57 A;  4JYA L;  1Y8P B;  1C48 A;  1CA5 A;  1CFM A;  4PZ6 A;  1STB A;  3JAM i;  2RHS B;  1BCP D;  3I3C A;  1HUM A;  3I4L A;  2RA4 A;  4K5V A;  3CMA A;  1VQF A;  1WD0 A;  3IFT A;  2RDF A;  2WAQ E;  2B2V C;  4RCN A;  1P16 A;  2UU9 L;  5M3F B;  2QW7 A;  1A2U A;  3MXN A;  1KLG D;  3D4R A;  3BG3 A;  5J3B A;  1DZ1 A;  3HOX H;  1JT8 A;  5ISR A;  3FKI G;  3RLF A;  3M4Y A;  1FJG Q;  2MQH A;  3VA7 A;  5FJ8 G;  1PH6 A;  4OO1 G;  5DEH A;  2SNM A;  3QWN A;  3K0X A;  4A4I A;  1CKM A;  5IGC A;  5GAH C;  3N6R A;  1IBK Q;  4TKO B;  4JI2 Q;  1J9O A;  3V96 A;  2QDL A;  1IBL Q;  2E2J B;  4KHV A;  4R4O A;  3M85 A;  2JA6 H;  4V0B A;  2B3G A;  5M5Y H;  1QCB D;  5AJ3 Q;  3MXG A;  3CAM A;  1CT1 D;  4AYB G;  2JYO A;  4DK1 A;  3SGI A;  4YCW A;  4A3L G;  3UI2 A;  4DAY B;  1KRT A;  4UPA A;  3TQY A;  1MBY A;  4DV2 Q;  5FOB B;  3NWS A;  5F2D A;  1KRS A;  1SYF A;  4HJ7 A;  2UXD Q;  3QO2 A;  3PIO A;  3X3M A;  5KEE A;  2JJQ A;  1TVX A;  1MKH A;  2K50 A;  1BVS A;  1QVC A;  1VQI A;  4LF7 L;  3S15 B;  5ELO A;  4HIK A;  3ONA B;  3E0J A;  4C3J H;  3RZO B;  2WKC A;  2VQE L;  1RTN A;  1XTD A;  4JBM A;  1E0B A;  3T1Y Q;  1L1O C;  3K58 A;  1F9P A;  4NKL A;  1HH2 P;  2L4N A;  3HKZ G;  3M3Y B;  4YHH L;  3CRL C;  5C5L A;  3JAM L;  1EQV A;  3NEM A;  1OTC A;  2L12 A;  1IL2 A;  1SMY C;  5K36 G;  2JA8 G;  4KY6 A;  2I5H A;  3GV3 A;  3W2D A;  1PYW D;  3PIP 3;  5GQO A;  1N33 Q;  1SYC A;  3D8G A;  1BBW A;  2Z6K C;  3G4S A;  4POG A;  1SE4 A;  3FDT A;  3J7Y W;  3T1H Q;  4DV7 Q;  2EE1 A;  2LXK A;  5C3E G;  4LMQ D;  1E2Z A;  5CV9 A;  1WTW A;  4LW1 A;  2L55 A;  1BBX C;  2ENB A;  3RLO A;  4IPD A;  4X65 Q;  1D5X C;  2IHF A;  2K52 A;  3HOV G;  2M2L A;  4HCE A;  4TVA B;  3TRZ A;  3S1N H;  4A3J G;  2ZJQ A;  1SJE D;  3PIO 3;  2WKD A;  3ZYY X;  2J7Z A;  3HEJ A;  5C6A A;  1S3O A;  2KA7 A;  1BCP F;  1QUQ B;  4B3T L;  2ICI A;  1WOC A;  1PZI D;  2KCC A;  4A3F G;  3OWE B;  3BVZ A;  2N49 A;  5FO9 B;  2ZXO A;  1XNQ Q;  2PNH A;  3GTK B;  1GO3 E;  4YWM A;  4WJ4 A;  4A3B B;  4ZRZ A;  4PG3 A;  5TSS A;  4LFC L;  1IBM L;  1E2V A;  1O7Z A;  4KN4 C;  1HNW Q;  1EU4 A;  4JOI A;  4JI4 L;  3PO3 B;  1BO0 A;  4DUZ L;  4JI6 L;  2K28 A;  2DGY A;  3I4N H;  2TMP A;  2ZTC A;  1N34 Q;  3A0J A;  3H3V H;  1HR0 L;  4APV A;  1VQK A;  2K14 A;  4JBJ A;  4C3I H;  1MD2 D;  4GNX A;  4BY7 H;  5M5Y B;  3U4V A;  1EY9 A;  4BBS H;  3CF5 A;  5CBE E;  1RD9 D;  2PQA B;  2H5X A;  4G4K A;  2N55 A;  2BH2 A;  4A3M G;  1BKB A;  3ER0 A;  4WJ3 M;  1K73 C;  3HOZ G;  1X3F A;  5E1F A;  1Y69 U;  4RGO S;  4HAE A;  1HRJ A;  4DPG A;  4RGN A;  5CGK A;  2EYM A;  3S24 A;  4OO1 I;  1H9J A;  3TS2 A;  3HS0 C;  1JE4 A;  1E7Z A;  1Q3L A;  4X3K A;  1S5C D;  3GP7 A;  3W3A A;  3H6M A;  1L0X B;  1EQT A;  4RCO A;  1GJX A;  4IFD H;  2NN6 H;  1J6Q A;  5IT9 E;  2MFI A;  4R1J A;  3H0G G;  3F2D A;  4P75 A;  3DHQ A;  4RKL A;  2OXP A;  2OCE A;  3HG9 A;  3M4O H;  3ND9 A;  4JI3 Q;  5JJI A;  2KVM A;  1X6O A;  2K6A A;  4OGQ C;  2VXW A;  4UP7 A;  3OMC A;  3KDF B;  4DR6 L;  2JA5 B;  4MZ9 A;  2PI2 A;  3OWF A;  1KD1 C;  2D2C C;  3GTP B;  2FJ2 A;  1HPC A;  4IUV A;  1VQ7 A;  2N3S A;  1TWA H;  3DEP A;  3DXJ C;  5E7N A;  1LTS D;  5E3F A;  4GKJ Q;  2F0I A;  2NVQ B;  3OIP A;  1VQG A;  3FP9 A;  1OXT A;  1H9R A;  3LWU A;  3SK5 A;  1XNR Q;  4X6A H;  3VR5 A;  2B2W A;  3A7L A;  2I5M X;  3E5S A;  2AWO A;  1QJO A;  3NTH A;  2NVT B;  3HOU B;  3KK7 A;  2KHS A;  1EEF D;  3CCM A;  1ROD A;  1VQA A;  1VQL A;  3GQB A;  1G2T A;  4ZK9 B;  1VQC A;  1VQB A;  3CCE A;  4U67 3;  3R3O A;  2ZXP A;  1PTO C;  4EQ5 A;  1PDQ A;  4QY7 A;  1PZK D;  5M5W H;  5CR3 A;  2AQ2 B;  3H09 A;  2L0C A;  1W3S A;  1RIP A;  5L37 A;  5LMN Q;  3EA6 A;  2BDN A;  1S5E D;  1OXU A;  1TWH B;  4X64 Q;  1LTR D;  3I4N B;  1BCP B;  1UE6 A;  3L9A X;  4AIM A;  3HP3 A;  5C4J H;  3C2P A;  4JYA Q;  2K5H A;  1YJN A;  3BZK A;  2A19 A;  2Z4I A;  1B4O A;  1KNE A;  1MI2 A;  5JOB A;  1LT5 D;  2UU9 Q;  2YYZ A;  1CM9 A;  2BH8 A;  2HDM A;  3L3O C;  2K75 A;  1VQ4 A;  3E3X A;  1A63 A;  4R4C A;  2B39 A;  1E1T A;  1HFG A;  5CV6 A;  4Q0F A;  2X69 A;  5JVG 3;  3EBE A;  4L5Q A;  2EYH A;  4KHZ A;  1Q1B A;  3I4O A;  1ZYR D;  4QJF A;  3H91 A;  3HOW B;  3RMH A;  3M4P A;  3M4Q A;  2EIF A;  3VR6 A;  4A3K G;  4A3C H;  5C3W A;  3NBI A;  2KHJ A;  5I9O A;  2KQ3 A;  4GOP B;  1ESR A;  4N9T A;  5LHY 1;  2EYP A;  3TP8 A;  1K3B C;  3CCJ A;  1OXS C;  4OWX B;  4IZ8 A;  1TS5 A;  3TRE A;  3S2H H;  4FF3 A;  1Y1W H;  4A3G G;  3NBH A;  3W1B A;  4XQN A;  1SFO B;  2B2V A;  4DK6 C;  2BOS A;  1O7I A;  4ABN A;  2VS1 A;  1SJH D;  2A1A A;  2A74 C;  4C3H G;  4Y7N B;  3OMG A;  2MP1 A;  4RWS C;  3R93 A;  4KJO A;  3ERS X;  1TWA B;  2C35 B;  1I6H H;  2UXB L;  1TU2 B;  4JPB W;  3FHW A;  1YHB A;  3U4Z A;  1SRO A;  4GLV B;  1WTO A;  4OWW B;  1SRU A;  1YJ9 A;  1DYQ A;  3PUZ A;  3CP0 A;  3MFY A;  4X3S A;  1J8I A;  2NZH A;  5FKA C;  5FLX E;  3KF6 B;  4LF7 Q;  4IUQ A;  2IT1 A;  3O13 A;  4JG2 A;  3FKI B;  1C0A A;  4DV1 Q;  5COR A;  3PUY A;  2VQE Q;  5EPL A;  5M5X B;  2IW3 A;  4A76 A;  1ZXT A;  4FP5 D;  3S1Q H;  2DJG C;  2M9V A;  2JA7 H;  1DJR D;  3I4M H;  4YHH Q;  1Q81 C;  1GVP A;  4CHT B;  1C4Q A;  4V19 0;  1LYL A;  3M7G A;  5C4X G;  2ICE C;  1IZ6 A;  1TWG B;  2OTJ A;  4CJ1 B;  1V1Q A;  1VQN A;  2A69 D;  1C9O A;  1X3E A;  3F2U A;  1PHJ A;  1XPU A;  1W2B A;  2A6H C;  3BS1 A;  3J80 i;  4FXG C;  1ONL A;  4AYB B;  3C46 A;  3K6O A;  2VW9 A;  2XNA C;  2FMM A;  4IUP A;  3VYT A;  5C4J B;  1O7Y A;  2KUM A;  1KDB A;  3RZD H;  2NVY H;  2L11 A;  1K8M A;  5FLM G;  1PH3 A;  2P5Z X;  4LFA L;  4S3S A;  4PMW A;  3FRP B;  4GNX C;  1UE5 A;  3L0O A;  1NCV A;  1DXM A;  4JI0 L;  2PNR C;  2K5W A;  3T51 B;  3D4W A;  2K03 A;  3P1H A;  3AMU A;  3L7Z C;  5JEA G;  4F87 A;  1EY4 A;  1ML0 D;  3LWE A;  2PMZ B;  3B6Y A;  4B3T Q;  3BYY B;  4L5T A;  3HFZ B;  3BYT B;  1HCZ A;  4O42 A;  3SDZ A;  4QIW E;  4LFC Q;  1Y14 B;  2Z6K A;  4CDC C;  5IY0 A;  2CVR A;  4TRD A;  4JC0 A;  4IPC A;  1WTH A;  1K8A C;  4ZKB B;  4JI4 Q;  3D3R A;  2JA8 B;  2X6L A;  3T13 A;  4DUZ Q;  4JI7 Q;  1JJG A;  5IGE A;  4MIU A;  1JOO A;  2LS0 1;  4GKK L;  1STE A;  4I7A A;  3LGJ A;  4DF7 A;  1HR0 Q;  1E22 A;  1HHV A;  4HJA A;  1I4H A;  2R7F A;  5CV5 A;  1A3V A;  5C3E B;  3S2H B;  1FNV A;  4LUO A;  5HUR A;  1EFW A;  1CKN B;  2AQ3 B;  5ELN A;  5IP7 H;  4NP5 A;  3K8A A;  1XXG A;  3J81 i;  3NEN A;  2K04 A;  1ASY A;  4DUY L;  4DR3 L;  1TQO A;  1VMP A;  1SLJ A;  1XWE A;  1I4X A;  1NY4 A;  3HOV B;  3GTJ B;  5M3F H;  4H0L C;  4A3J B;  4DV6 L;  3SE0 A;  1P8L A;  1TXY A;  1BDO A;  2ZTD A;  4ID6 A;  1MIU A;  1VQP A;  1JB3 A;  4UAI A;  4ZLT F;  3GTQ H;  1EU3 A;  4A3F B;  5LMN W;  3J80 L;  3D6W A;  4BBR G;  4TQU S;  1QNK A;  2SDF A;  3PUW A;  1UEB A;  2B2W C;  3R2I A; 
#chains in the Genus database with same CATH homology
 2CFM A;  2HQL A;  3SGI A;  2AMC B;  2EQS A;  3K80 C;  4BY1 G;  4YCW A;  3JAM c;  3CCU A;  2Q2T A;  1KQS A;  1BBU A;  5C0X G;  1EQQ A;  4B3S L;  2E2J H;  1XMQ L;  4JI5 Q;  3AQQ A;  4A3L G;  4DAY B;  1VQJ A;  2HT1 A;  1A0I A;  3EIV A;  4L5S A;  1KRT A;  1KHI A;  4UPA A;  3TQY A;  5IP9 H;  1EOV A;  4DV2 Q;  4A3F H;  1XMO Q;  2BA0 A;  3M9B A;  1KRS A;  1YHA A;  4HJ7 A;  2Q2I A;  2UXD Q;  3PIO A;  1NE3 A;  1AH9 A;  5LMU Q;  2JJQ A;  4DR6 Q;  4DR7 Q;  3ZJY C;  1I94 Q;  1MKH A;  1VCI A;  2K50 A;  4EX5 A;  1ASZ A;  2E2H H;  3J81 c;  1BVS A;  1QVC A;  1VQI A;  1PH1 A;  4LF7 L;  5ELO A;  4HIK A;  4JI8 L;  1PH7 A;  4C3J H;  3OW2 A;  5C44 G;  2FXQ A;  1EQR A;  2VQE L;  1XTD A;  1CKO A;  1Q82 C;  4JBM A;  4X62 Q;  5JJK A;  5M3M G;  1XPR A;  3T1Y Q;  1L1O C;  3KYH C;  1EIF A;  2GVB A;  1HH2 P;  4LF6 Q;  3HKZ G;  2R7D A;  4YHH L;  1VQ6 A;  2Y0S G;  3PUV A;  4RG1 A;  4A3E H;  4OWT B;  3KJP A;  3NEM A;  3HOX G;  1OTC A;  1IL2 A;  1HNZ L;  5IP7 G;  3S15 H;  2DUD A;  4IFD J;  5K36 G;  4DR1 Q;  2JA8 G;  1PYB A;  3CC4 A;  4QGU A;  3CCR A;  3RZO H;  1A62 A;  2R7Z G;  2I5H A;  2HHH L;  4A3B G;  5GQO A;  4NXN Q;  1N33 Q;  3CW2 C;  2R92 H;  1CUK A;  1KL9 A;  1BBW A;  2Z6K C;  4A3M H;  4LFB L;  3DM3 A;  3G4S A;  4DV5 Q;  4POG A;  1JJC B;  4LFB Q;  5M3F G;  3UDG A;  3T1H Q;  4BBS G;  1HNX Q;  4DV7 Q;  1PH9 A;  2LSS A;  2LXK A;  5C3E G;  2ZM6 Q;  4LF8 Q;  3PO3 G;  1LUZ A;  1J5E Q;  3GTL H;  1K83 H;  4JI1 L;  4DNI A;  1M90 C;  1QVF A;  4LW1 A;  2UUB Q;  1Y1V H;  5GAD C;  4DV4 Q;  3IRB A;  5IYD H;  1WCM H;  4LF4 Q;  1PVO A;  3MXN B;  2HIX A;  1NJI C;  4AQY Q;  3RLO A;  4IPD A;  1UE1 A;  2JA6 G;  4X65 Q;  3KDF A;  2IHF A;  2ZJR A;  3AEV A;  1FVI A;  2K52 A;  3HOV G;  4A3G H;  4LWC A;  4TVA B;  4YWK A;  2JEA I;  3TRZ A;  3S1N H;  5GAG C;  4A3J G;  2OQ0 A;  2ZJQ A;  1HZB A;  4AYB E;  2L15 A;  4DV4 L;  4ME3 A;  3JC6 6;  3H0G H;  1S3O A;  2CQO A;  2R6G A;  4NPS A;  4DAM A;  1IBM Q;  2XTI A;  2UUC Q;  1QUQ B;  5HGQ A;  4DV3 Q;  4B3T L;  1HZ9 A;  1WOC A;  5IP9 G;  3L2P A;  3PGZ A;  4A3F G;  3OTO L;  2N49 A;  2VZA A;  4P71 A;  1XNQ Q;  4BXX H;  2PNH A;  1D7Q A;  4JI6 Q;  4HID A;  1GO3 E;  1G51 A;  4YWM A;  2KBN A;  4AH6 A;  4R4I A;  4WJ4 A;  4PG3 A;  4LFC L;  3CC2 A;  1IBM L;  1N36 Q;  1SMX A;  1SR3 A;  1WJJ A;  2KHI A;  1HNW Q;  4JOI A;  4IPG A;  1QZH A;  4JI4 L;  2PMZ E;  4FDB A;  4DUZ L;  4JI6 L;  3VDY A;  2ID0 A;  2WB1 G;  3CCL A;  2DGY A;  3I4N H;  2QGQ A;  1WI5 A;  2ZTC A;  3W5O A;  1VS0 A;  1OXX K;  3A0J A;  1N34 Q;  3CQZ H;  4APV A;  3UDI A;  1HR0 L;  1VQK A;  3GTK H;  3H3V H;  3HKZ E;  1S72 A;  4A3B H;  3F1Z A;  2K14 A;  2Y0S E;  4JBJ A;  2RF4 A;  5EAY A;  1AE2 A;  3E9H A;  4C3I H;  4GNX A;  3RNU A;  4IJH A;  4A3E G;  3J7A 5;  3A74 A;  1KXL A;  3U4V A;  4YY3 Q;  2UUA L;  4BBS H;  4BY7 H;  3CF5 A;  4IO9 A;  4LNQ A;  1HZA A;  3PO3 H;  3KJO A;  1YI2 A;  1JMC A;  4DR6 L;  2PQA B;  1PYS B;  2H5X A;  3PIP A;  1VQO A;  4MTN A;  1FJG L;  2R92 G;  4PZ7 A;  2BH2 A;  4B3R L;  4A3M G;  1BKB A;  3ER0 A;  4WJ3 M;  4X66 Q;  5IYB H;  1K73 C;  4LF9 Q;  4IPH A;  3HOZ G;  1X3F A;  4GN4 B;  1OXV A;  3GTO H;  1SN8 A;  3RN2 A;  3S14 H;  4DPG A;  1YIT A;  1IBK L;  3S24 A;  3UE1 A;  1Y1V G;  2F4V L;  4OO1 I;  4JI2 L;  5IYD G;  1IBL L;  1WCM G;  4DR2 L;  3HOY H;  3S1M H;  3TS2 A;  2R93 H;  3TEH B;  4JV5 Q;  3CCS A;  2ATW A;  1E7Z A;  2UXC L;  4K0K Q;  3TS0 A;  1YBY A;  5AJ3 L;  2UXB Q;  1EUJ A;  2CWP A;  2JEB I;  4OXP A;  1R9T H;  3GO5 A;  1EYG A;  1RL2 A;  2NVX H;  3HOU G;  1NMG A;  1J6Q A;  2WP8 J;  2MFI A;  4R1J A;  3H0G G;  2VQF Q;  3F2D A;  1GD7 A;  2KEN A;  3CCQ A;  1V9P A;  4H02 A;  4P75 A;  4JI5 L;  1WFQ A;  2B29 A;  2OCE A;  5IE8 A;  3M4O H;  4JI3 Q;  5JJI A;  2PQA A;  4LUZ A;  4DV2 L;  1XMO L;  2ALY B;  1VQH A;  1X6O A;  2IX0 A;  4BXX G;  4UP7 A;  5GAE C;  5IT9 c;  2UXD L;  1K0R A;  5C0X I;  4JBW A;  5BR8 Q;  5LMU L;  1HR0 W;  4DR7 L;  3KDF B;  1E1O A;  1NTG A;  1YEZ A;  1B7Y B;  4DV0 Q;  3I2Z A;  4GOP A;  3RN5 A;  1I94 L;  1JB7 A;  3F2C A;  4HIM A;  4MZ9 A;  2PI2 A;  1PA6 A;  1KD1 C;  3G6E A;  1IXR A;  2QA4 A;  1T9H A;  1VQ7 A;  2N3S A;  1E24 A;  1TWA H;  4OON A;  1TWC H;  4QL5 A;  2WB1 E;  3BJU A;  5E7N A;  3K7A H;  3STB C;  3I4N G;  4P74 A;  4GKJ Q;  4X62 L;  1VQG A;  3FP9 A;  1OXT A;  1LM0 A;  3T1Y L;  1XNR Q;  4X6A H;  3I55 A;  4LF6 L;  4A3K H;  4B3M Q;  2JA5 H;  4BY7 G;  2I5M X;  1X56 A;  3F2B A;  4NXM Q;  2AWO A;  1UWV A;  2KCM A;  3GTP H;  2JQO A;  1IYJ B;  1YNX A;  4DR4 Q;  1JE5 A;  1X9N A;  4DR1 L;  3CCM A;  3S2D H;  1VQA A;  3A5Z B;  1VQL A;  2Q2U A;  4A93 H;  4IOA A;  4NXN L;  1N33 L;  1VQC A;  4A3C G;  2NVQ H;  1VQB A;  3PSI A;  3CCE A;  3K7U C;  1CSP A;  1GKH A;  4DV5 L;  1KAW A;  1YZ6 A;  4LFA Q;  5IYB G;  1TWF H;  3T1H L;  4A3I H;  1HNX L;  4DV7 L;  3I7F A;  4LF8 L;  3KF6 A;  2ZM6 L;  4IOC A;  3Q8D A;  3PV0 A;  4EQ5 A;  3KOJ A;  1J5E L;  4QY7 A;  4JOI C;  3GTG H;  3S17 H;  3ULP A;  5M5W H;  1JJ2 A;  2UUB L;  4JI0 Q;  2NVT H;  1Z9F A;  4UP8 A;  4GNX B;  3HOU H;  3HOY G;  4LF4 L;  4C3H H;  4GN5 A;  1VQ8 A;  1HJP A;  2R93 G;  2VUM H;  4GN3 B;  4AQY L;  4O0A A;  1X3G A;  2I5L X;  1W3S A;  1RIP A;  2LXJ A;  2HIV A;  5H1S E;  3W1G A;  4X65 L;  5LMN Q;  1YHQ A;  2E5L Q;  1L0W A;  1YIJ A;  5IYC H;  2YU9 H;  1OXU A;  1L1O A;  1VQD A;  4HIO A;  4X64 Q;  4IFD G;  1UE6 A;  4KI0 A;  3AFQ A;  1KIX A;  2NN6 G;  4AIM A;  4LF5 Q;  5JJL A;  5C4J H;  1NMF A;  4UY8 C;  4JYA Q;  2K5H A;  1AE3 A;  1YJN A;  2UUC L;  4DV3 L;  2D0P A;  2B63 H;  5DLQ E;  4XTC S;  2AHO B;  2ASB A;  4A3D H;  3WWV A;  3BZK A;  1EWI A;  2A19 A;  4DR5 Q;  4GLA C;  2OWO A;  1XNQ L;  2VNU D;  1TWH H;  4YCV A;  2IHE A;  1MJC A;  2IX1 A;  2UU9 Q;  2YYZ A;  2BH8 A;  1XPO A;  2K75 A;  1VQ4 A;  1N36 L;  1A63 A;  1SE8 A;  4R4C A;  2K4K A;  2MNA A;  1E1T A;  1HNW L;  2CKZ B;  3KFU A;  3EBE A;  4L5Q A;  4KHZ A;  3K81 C;  1H95 A;  1Q1B A;  1Q46 A;  1U0L A;  3I4O A;  5C4X H;  4QJF A;  2CWA A;  3KF8 B;  3PUX A;  4R4Q A;  2YTY A;  3M4P A;  4DUY Q;  4DR3 Q;  1N34 L;  1N32 Q;  3M4Q A;  2EIF A;  1S40 A;  1K8G A;  1I50 H;  3E0E A;  3A5U A;  1B70 B;  2JA9 A;  5C0X J;  4A3K G;  1Q86 C;  2JA5 G;  3PF4 A;  4KHP Q;  4A3C H;  3RR5 A;  5IWA Q;  3I56 A;  1C7Y A;  2OQK A;  3NEL A;  2KHJ A;  4DV6 Q;  4YWL A;  4YY3 L;  1PFS A;  4GOP B;  4R4T A;  1Q8K A;  2N8N A;  3UDX A;  3ULJ A;  4A93 G;  1VQM A;  3AFP A;  3S1R H;  3HOW H;  3CCJ A;  1G29 1;  4GOP C;  1OXS C;  4OWX B;  4XIG S;  5FLM H;  3TRE A;  4A3I G;  4X66 L;  3S2H H;  4POF A;  1Y1W H;  4LF9 L;  4A3G G;  2ES2 A;  2VL6 A;  3W1B A;  4DK6 C;  3PF5 A;  4O2D A;  1O7I A;  2VS1 A;  2A1A A;  3G48 A;  3D31 A;  2Q2H A;  4B3S Q;  2VUM G;  4GLX A;  4QQB X;  1XMQ Q;  4JV5 L;  2AKW B;  4JBK A;  4J15 A;  2Z0S A;  1KC8 C;  1Q12 A;  1VQE A;  3ERS X;  5IYC G;  4K0K L;  1D8L A;  2C35 B;  4UP9 A;  1XJV A;  1I6H H;  2JK8 A;  2UXB L;  3U4Z A;  1VQ5 A;  3FHW A;  1YHB A;  1SRO A;  4GLV B;  4A75 A;  4OWW B;  1SRU A;  1CKN A;  1PH2 A;  3U50 C;  2PI2 E;  1YJ9 A;  3PUZ A;  3CP0 A;  2VQF L;  1SFO H;  2GVA A;  1CSQ A;  1DGS A;  2NZH A;  1K9M C;  3CXC A;  3KF6 B;  4Y7N H;  3U58 A;  3BU2 A;  4LF7 Q;  2B63 G;  4JI3 L;  4JI8 Q;  2D62 A;  2IT1 A;  2WFW A;  4JG2 A;  3J7Z C;  1Z47 A;  4RMF A;  4DV1 Q;  1PH5 A;  1N9W A;  4A3D G;  1C0A A;  1QVG A;  3PUY A;  2VQE Q;  2D0O A;  4BA1 I;  4Y52 H;  2KCT A;  5BR8 L;  4A76 A;  2YTV A;  4DV0 L;  3S1Q H;  2WAQ G;  3F8T A;  5FLX c;  2JA7 H;  3I4M H;  2F3I A;  1L1O B;  3D0F A;  4YHH Q;  1X65 A;  1Q81 C;  1Q7Y C;  1PV4 A;  5JEA J;  1PH8 A;  4DV1 L;  1GVP A;  3CME A;  1HNZ Q;  4LUV A;  1LYL A;  2BA1 A;  5C4X G;  3FKI H;  1IZ6 A;  2EXD A;  4HJ9 A;  3PO2 H;  4GKJ L;  2OTJ A;  2HHH Q;  1V1Q A;  1XNR L;  5M5X H;  1VQN A;  3STB D;  5FJ8 H;  4L5R C;  1HZC A;  3OYY A;  1YJW A;  4NB3 A;  1QZG A;  1A8V A;  1C9O A;  1X3E A;  1PHJ A;  4B3M L;  1XPU A;  1W2B A;  3ICE A;  4ALP A;  3J80 i;  3DLL A;  4NXM L;  3H3V I;  2VW9 A;  4HJ8 A;  1YVC A;  1N8R C;  4JI1 Q;  2OTL A;  1V43 A;  2YV5 A;  3M7N A;  4DR4 L;  1I3Q H;  4IJL A;  4C2M H;  1L2F A;  2E8G A;  2RHQ B;  3RZD H;  2XGT A;  4GS3 A;  3HOW G;  1TWG H;  2NVY H;  3H15 A;  1Q1E A;  4YCU A;  3PCO B;  1MJE A;  2K5V A;  3M3Y H;  1NBW A;  5FLM G;  4KLK A;  1FGU A;  4BBR H;  1PH3 A;  4OX9 Q;  3CD6 A;  1Y1W G;  4LFA L;  2E2I H;  3CCV A;  4PMW A;  4GNX C;  1UE5 A;  3L0O A;  4HJ5 A;  2VY3 A;  4JI0 L;  1WYD A;  3UDF A;  5HY6 A;  1E3P A;  4BY1 H;  4P72 A;  3L7Z C;  3CPW A;  1I5F A;  2NZO A;  3CPF A;  2MO1 A;  1U5K A;  3EN2 A;  3UE0 A;  5JEA G;  4OX9 L;  4A3L H;  1G6P A;  3B6Y A;  4B3T Q;  5LMN L;  2E5L L;  4L5T A;  2MO0 A;  3HFZ B;  3KLW A;  3G71 A;  1EIY B;  1B8A A;  3OTO Q;  3J81 j;  4X64 L;  5GRO A;  4LF5 L;  4QIW E;  2ZJP A;  2JE6 I;  4GKK Q;  4LFC Q;  1Y14 B;  1LTL A;  3AYH B;  2Z6K A;  2IY5 B;  2N78 A;  3NBH B;  5IY0 A;  3MEF A;  2CCZ A;  4IFD I;  4JYA L;  1FL0 A;  4JC0 A;  2K5N A;  4IPC A;  4BA2 I;  1K8A C;  4JI4 Q;  2NN6 I;  3GD7 A;  4PZ6 A;  2F52 A;  3E9I A;  4DUZ Q;  4DR5 L;  3JAM i;  2RHS B;  5C44 H;  4JI7 Q;  1JJG A;  1GM5 A;  4PZ8 A;  4GKK L;  3CMA A;  5M3M H;  1VQF A;  3J80 c;  3LGJ A;  1HR0 Q;  3CC7 A;  1E22 A;  2WAQ E;  1P16 A;  4HJA A;  2UU9 L;  2JA7 G;  3HKS A;  3I4M G;  2R7F A;  3GDE A;  4LUO A;  4DK3 C;  1EFW A;  4MNO A;  5J3B A;  1CKN B;  1M1K C;  3HOX H;  1VQ9 A;  2UUA Q;  5ELN A;  4JI7 L;  5IP7 H;  1JT8 A;  3HOZ H;  3K8A A;  3FKI G;  2AWN A;  2JA8 H;  3J81 i;  2QEX A;  3PO2 G;  3NEN A;  2YTX A;  3RLF A;  1ASY A;  4DUY L;  4DKA C;  4DR3 L;  2R7Z H;  3GTM H;  1UE7 A;  1FJG Q;  1N32 L;  2MQH A;  5FJ8 G;  1SLJ A;  4B3R Q;  1NY4 A;  1PH6 A;  2A8V A;  4OO1 G;  3S16 H;  4KHP L;  5IWA L;  5M3F H;  2V1C C;  4DV6 L;  5C3E H;  2GN5 A;  1PH4 A;  1QUQ A;  3K0X A;  4A4I A;  1P8L A;  1CKM A;  1TXY A;  5GAH C;  1IBK Q;  2RCN A;  2F4V Q;  2ZTD A;  4JI2 Q;  1MIU A;  1IBL Q;  4DR2 Q;  3ULL A;  4R4O A;  3M85 A;  1VQP A;  4JCV E;  3GTQ H;  2JA6 H;  5LMN W;  2B3G A;  2UXC Q;  4BBR G;  1X54 A;  4TQU S;  5M5Y H;  1K3R A;  4P73 A;  1X55 A;  3HOV H;  5AJ3 Q;  2I0Q A;  3PUW A;  3BZC A;  3GTJ H;  2ZTE A;  3RLN A;  1UEB A;  3CAM A;  4A3J H;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...