3N52A

Crystal structure analysis of mip2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
SELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-X-C motif chemokine 2
publication title A Model of GAG/MIP-2/CXCR2 Interfaces and Its Functional Effects.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3n52A00
2CVRA 1RTNA 1QNKA 2HDLA 2SDFA 2NYZD 2K03A 3MWYW 4HCSA 2J7ZA 1S4ZA 1QE6A 2K01A 2FJ2A 3TN2A 2K04A 5EJWA 1X3PA 2NZ1D 1O80A 3I91A 1EQTA 3FPUB 5D65A 1IKLA 4UAIA 1O7ZA 2DY8A 4IURA 4CJ1B 1RTOA 1MI2A 4IUTA 4R9WA 2K1BA 2MJ8A 2RA4A 1WTQA 1E0BA 1PLFA 1SAPA 2FMMA 1WTPA 2B2YA 3P7JA 5COYA 1VMPA 1F9SA 1PFBA 1BF4A 4ZKCB 3SVMA 1G2TA 5E4XA 3DEOA 1M8AA 2JP1A 1HUMA 1HHVA 1NR2A 1B53A 2X6GA 4MN3A 4RWSC 1NAPA 2L11A 2L12A 3D6WA 4ZAIA 1RJTA 1DOKA 1WTVA 1ILQA 2RVLA 2X69A 2BDNA 2L1BA 2RSNA 1B50A 1MGSA 1G6ZA 1CM9A 3Q6SA 1U4RA 2B2YC 1PDQA 2B2UA 4IUPA 1Q3LA 2HDMA 1G91A 1DOLA 1BO0A 2MGSA 2DY7A 1F9RA 1PFMA 4QUCA 4DN4M 3FDTA 2RSOA 3H91A 2B2WA 3UI2A 5JJZA 1BBXC 3R93A 5EPKA 2MPMA 5T1IA 4X3SA 4HAEA 1SDFA 4RA8A 5T1GA 2B2TA 1O7YA 2HCCA 2KEDA 3G7LA 4OIJA 1WD0A 1BNZA 2IL8A 1TVXA 1ML0D 4QUFA 4R8IA 1HA6A 1NR4A 2Q8TA 1B3AA 4XT3B 4OIKA 5EPJA 2HCIA 5EPLA 2FINB 5DNFA 3DEPA 1C8CA 5CORA 2EOTA 2MP1A 1B4OA 3F2UA 2B2UC 2B2VA 2L9HA 1KNEA 1ILPA 1QG7A 1ZXTA 2N88A 1SSOA 3IFDA 4O42A 5EKIA 1WTOA 5CMDA 1JE4A 1JICA 2R3ZA 4MHEA 4CJ0B 3KUPA 1HFGA 1EIHA 3I3CA 2FHTA 1MSHA 1EIGA 2B2WC 2H1EA 3LWEA 3MTSA 1X3QA 1MSGA 1DOMA 4X3TA 3TZDA 2B2TC 3HP3A 2EE1A 2KVMA 1WTWA 1IKMA 1XX8A 4IUVA 1NCVA 3I90A 4ZKBB 1AP0A 4NW2A 2Q8RE 1CA6A 5EQ0A 1CA5A 1U4PA 1HRJA 2JYOA 4ZLTF 1AZPA 1XYIA 4HEDA 1ICWA 2N55A 2B2VC 4X3KA 4XDXA 1DZ1A 4HSVA 5AFWA 1IL8A 1WTRA 2K28A 1EL0A 2D9UA 1EOTA 2EPBA 4RAUC 1F9PA 1F9QA 2XIWA 1LV9A 5E4WC 3KBXA 2KOLA 5D14A 1G2SA 4CJ2C 2NWGA 4U68A 1WD1A 1RODA 1F2LA 2KEEA 1J8IA 2L4NA 1RHPA 4IUUA 3IL8A 2FFKB 1AZQA 5CBEE 3GV6A 1ESRA 2X6LA 1J9OA 1PFNA 1U4LA 3N52A 2KUMA 1WTXA 1GUWA 1X32A 3GV3A 3I8ZA 3QO2A 1B2TA 1KNAA 4IUQA 1HUNA 2KECA 2K05A 2M2LA 4XT1B 2VXWA 3ONAB 1DONA 2HUGA 4LMQD 4X3UA 1WVLA 3DM1A 1U4MA 4ZK9B 1HFNA 1A15A 1VMCA 5CBAE
chains in the Genus database with same CATH superfamily
4LWCA 4OWXB 2HDLA 5IYDH 5G3LF 3PIPA 2P5ZX 4CKEA 1I6HH 1CUKA 2K04A 4ZUJA 3I91A 3T13A 4EQPA 4U673 1O7ZA 5JEAH 2LFNA 4KN7C 3GTLB 1Q90A 1VF7A 1E0BA 1NNXA 3S9WA 1QOHA 1SE2A 2IHEA 5C4ZA 2A6HD 1STYA 4A3LH 5C0XG 4R4OA 3M4QA 5FLXL 2BA0A 2L12A 4DF7A 3HG9A 3AFQA 1X9NA 1TU2B 3SEBA 4ID6A 5CV7A 1VQIA 1O7IA 3WDNA 4QIWE 2CWAA 5IWAQ 4JI6L 3MXUA 4IUPA 3RD4A 1Q3LA 3TRZA 3BDOA 1VCIA 3SK8A 2B8FA 2F0OA 1SN8A 2EXZA 1EYAA 1S5ED 5CGKA 3JAMi 4DV0Q 5DM73 2JSOA 2PI2E 2B63B 3K5LA 1BCPD 2NB0A 1DM0B 1O78A 1W6KA 2NUCA 4QUFA 5FO9B 2A8VA 2RDFA 1NR4A 3C46A 1WI5A 3S17H 1I94Q 1A8VA 4JYAL 3MA2B 2ZXOA 2HIVA 4AYBE 1GUNA 3DWAA 2C9OA 1KNEA 4QMGA 4LFCL 2DN8A 5JPNC 2E2IB 3IKJA 3NQIA 2ASBA 4TQUS 3CW2C 4CDCC 2O5JC 3F2BA 3HKSA 3D4RA 3A5UA 3BYYB 4A93H 1AP0A 4RGOS 3CC4A 2K5DA 1FYCA 4WRDA 1DCZA 2C5CA 1PH7A 1W3SA 4JI4Q 2R7DA 4FXKC 1KL9A 5M3FH 4MNOA 4JI7L 4BY7H 5D14A 3U9SA 2QDBA 4JPBW 3DM3A 5KNCA 2I5MX 3JAMc 2VS1A 3MXNA 4RH6A 1SYCA 5KYLA 2X6LA 4GN4B 3N52A 4LF8Q 4JV5Q 5GQOA 3QO2A 4IUQA 1IXRA 1FNVA 2OTLA 4FXGC 2JA8H 4K8JA 1I5FA 5J39A 3M3YB 4B3MQ 1H9MA 2K03A 4GNXB 5J22A 1QE6A 3I56A 2R6GA 4KKUA 4YHHL 4ZRZA 3FPUB 2JA7G 2ES2A 4JI2Q 4H02A 4BS9A 2UUCQ 3HKZE 1CFMA 3DWQA 3I2ZA 1SAPA 1L0YB 1S3OA 1JR0D 2UU9L 3HOWG 5KYIA 1VQ4A 4A3GG 3HOXH 2A1AA 5NUCA 4CDDC 2L5TA 2QGQA 2VB3X 4JOIC 5JPMC 2G9HD 3S1QB 2F03A 2R93H 4X64L 4RWSC 3PCOB 1HA5A 2IJ0A 1D6EC 3A8JE 5M5XH 1B9NA 1JJCB 4HR7B 3D3RA 1T5XD 1MIUA 1STGA 3M4OB 1B7YB 2B2WA 1PH9A 4L63B 2B2TA 4JVZA 1ML0D 2O4XA 4A3DG 3NTKA 3GTQH 1H9SB 2JEBI 1DD2A 3K7AB 1B4OA 3VR3A 3H0GB 2RKSA 4IJHA 1OTCA 2B2UC 4V190 2B2VA 1EY9A 4DR1Q 1YNJC 4FDBA 5C4HA 2OQ0A 1HFGA 4L5RC 3BVGA 3RLOA 1MSGA 2KHIA 1ZKOA 1AE2A 4YCUA 1WTWA 2N3SA 3CCVA 1XX8A 1NCVA 3VR6A 4K5XA 1IBLL 4YCVA 3CQZB 1CA5A 2E76C 5BR8Q 4DV4Q 4PMWA 2TMPA 5EKLA 3MZ5A 4ME3A 2B8GA 3S1NB 5AFWA 1TS4A 3OW2A 1SNMA 4GKKQ 1EOTA 1JOOA 4X66Q 2AMCB 4N8FA 3RN5A 2R92H 4HJ5A 2A19A 1WD1A 1EOVA 1KLUD 3F1ZA 1PH5A 4LFAL 1JJ2A 1EUJA 1E7ZA 1X55A 3HOVB 4DR7L 1GUWA 3I8ZA 2M2LA 1X3GA 2NTSA 3PO3H 5C4XB 3NWSA 3DM1A 1KTKA 1Y8NB 1U4MA 2KBNA 5KNDA 3V96A 4YWLA 1JOKA 4N9TA 2K01A 1EIYB 5ELOA 3S1MH 3TN2A 5J1ZA 5LMNW 1KDAA 3HFZB 4ABNA 3DHQA 1FR3A 1CSPA 2DY8A 4IURA 3NTHA 1N32Q 4LF5L 4JBJA 1OXVA 1EY5A 1OXXK 4IFDI 4NXML 3UDGA 2CWPA 2Z9HA 1V8QA 1B53A 2KENA 4B9WA 5JEAJ 4DV6Q 2GVAA 3J81E 3A8IE 3C2PA 1TKWB 3KF8B 2X69A 2BDNA 3UDXA 1TR5A 4OO1H 4O1NA 1JC7A 1QB5D 2I07B 5DEHA 4HMJA 2A68D 2IHFA 1VQAA 3CU7A 3L3OC 1ZYRD 4DGZA 1SDFA 1TQOA 2V1CC 4Z9CB 1O7YA 1WD0A 1LTBD 4R8IA 5E3FA 4EGVA 1KD1C 2A6HC 2KHSA 1YIJA 4DNTB 3KBGA 5DNFA 3TP7A 1SRUA 2ICEC 1JOQA 1DJRD 3PO2H 1CI3M 1Q82C 5FK9C 1MSHA 4RHSA 2F0TA 4G7OC 3ITPA 1X3EA 1S5DD 5I9PA 1Q81C 1KABA 5GAHC 2R7ZB 2D62A 1NBWA 1K0RA 3HRZC 5I9OA 1PXUA 4JCVE 1ICWA 3I4NH 2UXCQ 2D0OA 2FMCA 2RBMA 1RCVD 2LXKA 1TS5A 4NDXA 2QW7A 1KRSA 3NENA 1IYJB 2PZUA 3EJIA 2K32A 1GUOA 1VQEA 1KAAA 1K3BC 4BBRG 1PH1A 2F3IA 4DK0A 2BCOA 4X62L 1JWMD 4KY5A 1KDBA 1C9OA 4MIUA 4O2DA 3GTJH 5KRUA 5FJ8H 2VXWA 1E3PA 4KD4A 4FF2A 2UXDL 3BVMA 5LMUL 1I4XA 1TWFB 1UE5A 1S5FD 1K3RA 4NP5A 5HGQA 4AYBG 4AQYQ 3A55A 4DUYL 1YJ9A 1EEID 2OT2A 5ELBA 4C3IG 2Z6KC 4B3SL 5IODA 4BBSG 2K1BA 2MJ8A 4POFA 2PZTA 2VB2X 5IP9H 2FMMA 4QY7A 2EJMA 5K36G 1I4RA 2HQEA 5ELCA 4L5SA 3GTKB 2RDHA 1I4QA 1R4QB 1EZ8A 1XXGA 4NXNL 1NR2A 3SR1A 2QEXA 1HR0L 2BH8A 4A3FB 4K2KA 2EIFA 3L7ZC 2F4VQ 3D6WA 4ZAIA 2YTVA 4BY7B 4QIWB 1WCMB 3O13A 1BVSA 4KKTA 2IPKD 5IGGA 4EX5A 5C4JB 3RZDB 1XTCD 1PTOB 1MGSA 4RGTA 2B2YC 1LTID 1PDQA 1V1PB 3OIPA 3FHWA 2K5NA 3M9BA 5M5YB 5M9OA 3TDQA 2PQAB 1TS2A 4IQZA 2E2IH 5I4DA 4A3BG 1W6JA 3FDTA 2MPMA 1HCZA 1B1ZA 4RMFA 4AIMA 3E9HA 4OX9L 4JI3L 1TVXA 3EVQA 1H9JA 2KA7A 2Y0SB 5AJ3L 1TT2A 3AYHB 1LT4D 4ZCKA 2E75C 3E0JA 3EN2A 3HKZG 4DAMA 2QDLA 2L9HA 4DU9A 2G5DA 4GNXC 1CKNB 1VQMA 1SJED 3CAMA 1L1OB 3TP8A 1PTOD 3F2CA 1SE3A 2Q2HA 1TWHB 3OW7A 3RZOB 4KD3A 2PO4A 3I90A 3VA7A 1SYGA 4X65Q 1SYDA 3NPPA 3CF5A 1CQVA 3M3YH 1L0WA 1EL0A 2CH4A 3L2PA 1F9PA 5M5XB 4RG1A 1HNWL 1V1QA 3NBIA 2NWGA 3K5NA 1RDPD 1KC8C 1RHPA 5CR3A 1PFNA 4GKJQ 1OO9B 5FO7B 4LFBL 1N34Q 2F3VA 1X65A 5IE8A 2AWNA 1HFNA 1J5EL 2PW7A 2F0WA 1Y8PB 4K14A 4A3KG 4JOIA 3S1QH 2XTIA 3MC0B 4YWKA 3PIP3 3EBEA 1HTPA 2VQFL 2R7FA 4DR3Q 3J7A5 3UE0A 4GOPB 3DWPA 4YY3Q 4XQJA 4HSPA 1VQ9A 1PLFA 5D3IB 2NZOA 4NMZA 3NXWA 4I7ZC 1CHQD 3BG3A 2ZXPA 5IYBG 1VQ6A 1CKMA 2NTTA 3DEOA 3M4OH 2JJQA 4KY6A 4C1NI 1S40A 2CKZB 4CKBA 4BY1G 1C48A 4IN3A 1PH6A 2R92B 3MFGA 3KFUA 5C3WA 1GUSA 4QJFA 3K7AH 1M4VA 2WAQE 3H0GH 2B2UA 1DOLA 3K7UC 3NUCA 1UEBA 4C3HG 1PYSB 4P71A 1N9WA 1RKNA 4P72A 2F1MA 1LABA 1EIFA 4FF1A 3BZDB 2TSSA 3HOUG 3CQZH 4DK3C 2IWHA 2CCZA 4F88A 1K8GA 1I4HA 4JI8Q 4DV5Q 1ILPA 1IW7C 3S1NH 4X6AH 2R3ZA 4LW1A 3TP6A 1E1TA 3KF6A 3AU7A 2Z4HA 1TWCB 4J15A 1NMGA 2PW5A 3WOEA 2A68C 3J7ZC 3GP7A 2A73B 3HOVH 1ZYRC 3PMFA 4DV2Q 4DUZQ 5C4XH 3FKIG 2MO1A 1TXYA 4XDXA 3HOZB 1T9HA 5BN3A 3CCQA 4N9PA 3BYTB 1H9KA 1SNDA 4KMUC 1QVGA 3KK7A 1K9MC 4LF6Q 1RODA 2F0FA 1J8IA 5C3EG 4H44C 4J8QA 4DAVA 3ICEA 2K75A 1YBYA 4IO9A 1WTXA 2A74C 4OO1I 2A6ED 4XT1B 1BKBA 3J81c 2N78A 1WVLA 4YIJA 2KCCA 1A15A 5J3BA 1EYCA 1RTNA 5C6AA 4A3CG 3WOFA 2LS01 2QA4A 2VL6A 5JVH3 3OOCA 4TSSA 2JA9A 4A3EG 1PYWD 2UUAQ 4K8IA 1VF5C 1W2BA 4CGYB 4A3MB 1G2TA 3SVMA 4DV3Q 3NK9A 3U50C 3I4MG 2JE6I 1EY6A 1PZKD 3I72A 1NAPA 1XMQQ 4H0LC 3V05A 1O7LA 1JORA 3SGIA 3BS1A 4KJNA 3VR5A 3NQTA 1E24A 4DR6Q 1RF2D 3S24A 2WB1E 3GTJB 1JT8A 1Y1WG 1BCPB 1JB7A 1ICFB 3R93A 5T1IA 2LY7A 4K6LA 2XNAC 1SJHD 4JI5Q 3HOYB 2AQ3B 2EJGC 4A3JG 5EPLA 3PUXA 3KJOA 2Z0SA 2R7ZH 3JC66 1VQNA 3BVZA 4Y52H 2NZHA 4JI0Q 5IT9c 4C2MH 1GXDC 1S5BD 1EIGA 1EY7A 5FOBB 3TZDA 5C0XJ 1IKMA 2HHHQ 1QJOA 3CPFA 3M7GA 3NP8A 1TY2A 1U4PA 3LWUA 1SROA 1PZID 1P16A 4O0AA 1PYBA 1X6OA 2F0MA 2N55A 2Q2UA 2PZWA 1TWFH 3JAML 2K28A 5DM63 3CD6A 4BA2I 1PH4A 3K5OA 2BOSA 2KEEA 4IOCA 4RKBA 3ERSX 2Z6KA 1JMCA 4C1NK 4C3JG 1PTOC 3GV3A 4FNFA 4IPHA 2AHOB 1NJIC 4DR1L 4DXGA 4JW0A 4LMQD 1FGUA 3T1YQ 1IBKL 1E2ZA 1EU3A 2DJFC 1EY8A 3SHLA 3GTKH 1A6XA 3GTMB 4M1UB 1S4ZA 3MVVA 3F2DA 1PMRA 1X3PA 4A3FH 1HNZQ 3T1HQ 3X3NA 1JQYD 1OXUA 4KHPQ 5EBCA 1VDZA 1WCMH 4DV4L 2E5LQ 2I5HA 3KLSA 2ALYB 2EYOA 2XWJB 4DK6C 5C4JH 3FPPA 3RZDH 4B3TQ 5G3LD 1PTOH 4LNQA 1STHA 2EZVA 1WTPA 2B2YA 4GKKL 4BBRH 4POGA 5M5YH 1ONLA 1L1OC 1IL2A 1Z47A 4DR5Q 1A62A 1Q8KA 3K6OA 4J6HA 3ERQA 4L5TA 4G7ZC 4OHJA 3BDLA 2YTXA 1N33Q 1AE3A 1TS3A 3K0YA 1DOKA 2RVLA 4K0KL 2L1BA 1QZHA 1SXTA 1M90C 3G48A 1B50A 4CDFC 3CMEA 2MHVA 2EYFA 4C3IH 2ENBA 5FLMG 4GNXA 1VQFA 4DN4M 1PRTF 1X56A 3PUVA 3VYTA 1D1IA 1TWHH 5EBDA 2JEAI 4OIJA 3OTOL 1HA6A 3RZOH 4L8JA 3PUWA 2ZT9C 3RLFA 2HCIA 2ZM6L 4ZQ3A 4FXDA 1NE3A 3NHHA 2DGYA 1B9MA 1JE4A 2JA5G 2UXBQ 4LF9L 1EIHA 2K14A 4XXEA 2OQKA 2WP8J 4UY8C 2NN6H 5I6YA 3PF5A 2MQHA 3HP3A 2KVMA 2RDGA 2VY3A 4F8MA 4GOPC 3BU2A 4IOAA 4CBVA 3A0JA 2ICIA 4LF7L 4A3BH 2JYOA 1CK1A 2CQAA 2OTJA 3SXHA 4NB3A 4HSVA 1WTRA 2WAQG 1D7QA 1MJEA 2JA7B 1GHKA 5HY6A 4DA2A 1H9SA 4FF4A 3TMEA 4MZ9A 1ESRA 2J0TD 3W1BA 5C3XA 1QZGA 4JYAQ 1X32A 1KNAA 3HOWB 1XPRA 1HUNA 3ONAB 4LFCQ 1QVCA 3QOJA 4LF4L 3S2DH 4A3GB 1EY0A 1PRTB 4DV1Q 4HCSA 1SNOA 3AMUA 3CXCA 4IFDG 1CZWA 3DUZA 4RKLA 2AUJD 3RR5A 3Q22A 4DAPA 2RHQB 5EAYA 2ZJQA 2IX0A 1WJJA 2Z8LA 2A6EC 4XIGS 4NKLA 4JI7Q 2GA4B 1TWGB 4JI1L 4IPDA 2GN5A 1PA6A 1Q86C 4A3DB 3UDFA 1EU4A 3FVQA 2VUMG 1BUVT 1PRTD 3URYA 2YU9B 3CP0A 4YCWA 2DNEA 2RSNA 3FMCA 4A3KH 2BH2A 2RCNA 1VQPA 2XWBB 3KOJA 3NWTA 4PV1C 3I4OA 1IYUA 3VYSA 3VDYA 3Q0AA 2UUBL 4IZ8A 2R61A 5IYDG 2MNAA 1TWCH 3P1HA 4RFBA 4K5WA 4QL5A 1L0XB 1VQ5A 4DNIA 3K58A 2Q2IA 1B3AA 4OIKA 1K0SA 3H15A 1B8AA 1K28A 1YEZA 1K83B 4BY1H 3HOZH 1LTAD 1QCBD 5A2QE 3D0FA 2IW3A 3KUPA 3PSIA 4X64Q 1X54A 2FHTA 3SK4A 2F4VL 4A3LG 3KF8A 1I4PA 4C3HH 3CC7A 1Z9FA 3OYYA 4BA1I 3J80i 2SOBA 4P73A 4GS3A 1IL8A 1D8LA 4UDUC 1D5ZC 4ALPA 5GAEC 2WB1G 4HMIA 2K52A 3U9OA 3P75A 3IL8A 2CH4W 3G4SA 4QQBX 5KGUA 5BN4A 4DV7Q 3KDFB 2KUMA 4P75A 1VQ7A 1YJNA 1UE6A 1T5EA 2K05A 2ATWA 5K5PA 4UP7A 2JN4A 4A3MH 4QCLA 1XNRQ 4GLAC 1A3UA 5LMNL 1HNXL 1BCPC 3CCLA 4C2MB 2EYPA 2QKIC 4ZYSA 3LNNA 2VW9A 2CW0D 1V1OA 4UAIA 4F87A 2NVQH 2HIXA 4A93G 5IT9E 1YVCA 1VMPA 5KNBA 5C3EH 1F9SA 2NVYH 1EZ6A 3J80c 2PYKA 3RUZA 1ET9A 3OPOA 5JAVA 1HUMA 1QILA 1YHAA 1K8MA 4A76A 4LFAQ 3STBD 5M3FG 1SE4A 1QVFA 2HQLA 2F0LA 4GKJL 2YV5A 3MXPA 3HOYH 5E1FA 1E22A 1BDOA 1E2VA 1Z7TA 5IP7G 1BBWA 3I4LA 1KRTA 2VQEL 4A3CH 5A35A 1G8ZD 3PV0A 1C7YA 3A74A 3BJUA 3VR4A 4DR2L 1G91A 2JA8G 2NBFA 4HJAA 1KHIA 4QUCA 1H95A 2AKWB 3I73A 3RNUA 1XMOQ 2E2HB 3NTIA 1UWVA 4KV6A 3QOLA 2FINB 4BXXH 4LF5Q 1GUGA 3SE0A 1YI2A 1GJXA 1OXSC 1WTHA 2RQXA 4HJ9A 4NXMQ 4JG2A 5M3MG 5EKIA 4DFAA 1EEFD 4HIOA 1F2MA 2B3GA 2QCPX 4BBRB 3HOXG 1HPCA 2H1EA 1KQSA 4B3RQ 3TBIB 5FLXE 2EE1A 2R93G 3OHXC 3ZJYC 1CKOA 1I50B 1XTDA 2K5HA 1Y1WH 1BQQT 4IUNA 2WIIB 3BZCA 2Q8RE 5EQ0A 1V1PA 1Q1EA 4Y7NH 1VQLA 3KJPA 3KLSX 4G4KA 3PIOA 2PI2A 2PQAA 3PUYA 1DZ1A 1EQQA 4AYBB 1XNQL 2D9UA 3MFYA 3GTMH 4A3JH 5C0XH 4C3IB 3OSOA 3Q23A 4HIDA 1N36L 5GADC 1Y69U 4BBSB 1RL2A 2WACA 2F0UA 1II3A 2OF1A 4TRDA 3LX0A 3A7LA 4B08A 1JWSD 4WJWA 2E8GA 4KJOA 2ZJPA 1CKNA 1LYLA 4TKOB 1L1OA 3BZKA 4HJ8A 1D1KA 1LT6D 1SBBB 3OWEB 4KTAA 3KYHC 5IIFA 2F0DA 1SFOB 2NZ1D 3D8GA 3M4YA 1EWIA 3DXJC 1LTLA 1V9PA 1IKLA 1B44D 3D6CA 1EQRA 2E2JH 3CPWA 4R9WA 4DUZL 4R1JA 4KI0A 4XYOA 4S3SA 4DR4Q 2XGTA 1IZ6A 2QF7A 3P7JA 3A8KE 2NN6I 3U4ZA 2XN9C 1CSQA 4KLKA 1BF4A 4A3BB 1UUPA 3X3MA 1HHVA 1SNCA 3UDIA 2PQEA 4L5QA 3ULLA 3GTGB 1GUTA 4WORA 3WWVA 2XVSA 1RJTA 5JJLA 2AQ1B 3H6MA 4GN5A 3HKZB 3T4AC 2UXDQ 4R4IA 5LMUQ 1NMFA 3PO3G 1EWCA 1ZEQX 1Q12A 3AB9A 4I7AA 4DUYQ 5IYCG 2DY7A 4CDEC 1F9RA 4JC0A 4K5VA 1LLRD 3S2DB 5JJZA 2EDGA 4B3SQ 1D5XC 3R3OA 4RHRA 1HQRD 2UUAL 1BNZA 2IL8A 4GOPA 1A0IA 1EFWA 3S1RH 2JA6G 3DEPA 1C8CA 1PV4A 4N8X1 2IX3A 1PRTC 3QB3A 1WTOA 3IFDA 3QG1A 4NXNQ 4O42A 4R4TA 1JICA 4A3IG 2WFWA 1HR0Q 3G71A 1A2TA 1TY0A 1GD7A 3I3CA 1XMQL 4X3TA 1VQOA 1DOMA 3BDCA 2JA7H 1VQGA 5JOBA 1ET6A 5FLMH 1C4QA 3ZYYX 1N8RC 1LM0A 2F0QA 1HRJA 3HOWH 5C44G 4HEDA 4A3GH 1R9TH 1MD2D 5CV6A 2CQOA 3HS0C 4A3KB 4OO1G 5L37A 2WV6D 3MHBA 3RLNA 3K81C 4OX9Q 4JI3Q 2LKVA 3J81L 1CHPD 3GV6A 2JA5H 3CCSA 1U0LA 3Q8DA 4HIMA 3K5MA 1VQKA 3K0XA 3E9IA 4PMBA 3SK6A 1PFSA 3TEHB 4X3KA 2PMZE 5IWAL 4FF3A 1TWGH 1PHJA 3PO2G 1E2WA 3IFTA 1IBMQ 3Q24A 4BY1B 2YYZA 5EJWA 4A3DH 5GROA 4DV0L 1FD7D 4PMCA 5CV4A 4CJ1B 4HCEA 2YU9H 1TWAH 2K7VA 4DK1A 3M4PA 1YNND 4A3IB 4RCNA 1CTMA 1I94L 1Z6HA 2XSCA 4C3HB 1G51A 4WJ4A 2EY1A 3I4NG 2Z1CA 1M8AA 2BDOA 1QNUA 2SNSA 2X6GA 4MN3A 4OXPA 1LACA 2L11A 3CHBD 2I0QA 3HOUB 1K8AC 3J7AF 4XTCS 4LFBQ 2N8NA 2HD3A 3TQYA 3E6ZX 2CW0C 1CM9A 2EY5A 3EA6A 1U4RA 1J5EQ 5FJ8G 1K83H 4IPGA 2F0KA 3KLWA 4H7BA 1YNXA 4JBKA 1AEXA 3W3AA 4K2LA 4JI4L 4UP8A 2RSOA 1BBXC 3E0EA 2VQFQ 4KHPL 4HAEA 5T1GA 3E3XA 1XPUA 2KEDA 3CRLC 5IT9L 1LTTD 1DXMA 4B3TL 2BE5D 3T16A 3FKIB 4LF8L 3OIQA 4JV5L 1Q7YC 2MP1A 5IP9G 1YHBA 4DR5L 2NVQB 1EYDA 5CMDA 4QF4A 4CJ0B 1VS0A 4B3ML 5C3EB 2B39A 1KDCA 1YJWA 2ZJRA 2NVYB 4QB4A 2B63G 1XWEA 1BOSA 3NELA 1SMYD 4OELB 4JI2L 2E2DC 4QGUA 4RCOA 3EQLC 2UUCL 4HTHA 3J80E 1EWHA 2A69D 1R4PB 1F9QA 5IGCA 5E4WC 4ME5A 2ID0A 3OMCA 4A3EB 4CHTB 1GO3E 3W2DA 3RMHA 2ZXRA 3GTPB 2EXDA 2K33A 1EFID 2F4IA 3VR2A 2F0VA 3H3VC 1MBYA 2UXBL 3I4MB 2PNRC 2CVRA 3K57A 1UAPA 2A5HA 1O80A 1XJVA 4LUZA 1STEA 3EIVA 5D65A 2SEBD 2K4KA 1PZJD 4EQNA 3NE5B 1WFQA 4DKAC 3GQBA 1Y1WB 3H3VH 2KQ3A 4DPGA 4Y7NB 1VQ8A 1FL0A 4EQ5A 1D2BA 3VA5A 1VQJA 1JE5A 4KK7A 2LMCB 1NTGA 2E2HH 4GLVB 2O5IC 3CRKC 1I6VC 4A3JB 3D4WA 1SYEA 3HZXA 1CZGA 4PZ6A 1J6QA 2Y0SE 1F2YA 1FGBD 5FLXc 5C0XI 4FYDA 5BR8L 4DV1L 2RHSB 3RN2A 1FJGQ 2AWOA 2F52A 3UE1A 4OWTB 4X66L 3CCJA 2L0CA 3A56A 4R4CA 1I50H 3MXNB 5IGBA 1HTLD 1MHWC 1CT1D 1G291 2E2JB 2F0JA 4R4QA 1SLJA 1BXTA 1ZXTA 1SSOA 1HH2P 3I70A 4XYQA 5IP7H 5HURA 3S14B 3D31A 3ND8A 3CCEA 4C3JB 4BBSH 2ZTEA 2K5VA 2V4DA 4ULLA 1FNUA 5K36H 5ELDA 1AZPA 5IY0A 2IY5B 2I46A 5M5WB 1N32L 1E1OA 1Y1VG 3H0GG 4WFN3 3IAYA 1LV9A 2KCTA 3G6EA 2EJFC 1G2SA 1U9RA 4U68A 5DLQE 1ESFA 1SFOH 3N6RA 4IUUA 1JJGA 4DV6L 5CBEE 3S15B 1HZCA 3VYRA 5M3MH 3K80C 2EYLA 4DXFA 2Z6BA 2HUGA 3MAQA 3NEMA 5CYUA 2SNMA 2PPBC 1D5MC 3S1RB 3MEFA 4AH6A 5LHY1 3GO5A 1VMCA 4JI6Q 1PH3A 4P74A 1STNA 4C56C 3J7YW 3GTGH 2D2CC 5I2XA 4NPSA 4IUTA 2XRSD 5GAGC 5LL6X 5CV5A 3HOVG 2ZTDA 1XPOA 1FNWA 3I7FA 1JB3A 1WYDA 1PFBA 2F0PA 4ZKCB 5C4XG 4LUVA 1HXYD 2G9DA 2JP1A 2KCMA 1R9TB 4IPCA 1IYVA 2BA1A 4DV7L 2CFMA 2EYJA 1Y1VB 4FVMA 3MEHA 1WTVA 1ILQA 1P8LA 4E6IA 5JJIA 3DLLA 1VQHA 1IBKQ 1AH9A 1G6ZA 1XNRL 3Q6SA 2Z4IA 2K6AA 3TSSA 5ELNA 2OCEA 4JBMA 1QWYA 1WOCA 5F2DA 1ENAA 2JA5B 1YNNC 2UXCL 5I6WA 4HIKA 5JJKA 1SMXA 1HZ9A 3H91A 3GTOH 5IGFA 2FXQA 2K5WA 4LK1C 5EPKA 1X3FA 1OXTA 1SYFA 3VYUA 1U5KA 2RCFA 5LL6S 2MO0A 1B70B 4IFDJ 2F0IA 1Q1BA 4IJLA 2EOTA 3J7AV 1TWAB 3SK5A 2WAQB 3T53B 1C0AA 2N88A 5HGTA 3FEWX 2VNUD 1TIID 2Q8IB 1KXLA 1F77A 3LWEA 4AQYL 3PF4A 2EQSA 4K0KQ 4YHHQ 3QWNA 1A3VA 4P2CB 5IYCH 4PNYA 5ELFA 4NW2A 1GM5A 5IYBH 1SNPA 2DNCA 3S2HB 3S16B 4ZUIA 2BE5C 3PIO3 2UU9Q 5JEAG 3C3LA 4UPAA 1XMOL 4XQQA 2JA6H 1AFPA 1I3QB 3OTOQ 2OEOA 1F2LA 1NUCA 1AZQA 2WINB 3R8BA 2F0GA 4OL7A 2ZM6Q 2AUKA 4A3IH 2NVXB 1B2TA 4L6TB 2M9VA 2MFIA 1LO5D 2R7ZG 1DONA 2PMZB 2F0SA 1SMYC 4LF9Q 4V0BA 5CBAE 4B3RL 3CKIB 2SDFA 2NYZD 3MWYW 4H13C 2JQOA 2HT1A 1SR3A 1GVPA 1BBUA 1IW7D 2VUMB 2A69C 2EY2A 5C44H 3W1GA 4BWGB 2J4XA 1EQTA 1AW7A 1SYBA 3B6YA 3T56B 3J80L 1YZ6A 4LF7Q 1UNSA 3HOUH 1RTOA 4PG3A 1WTQA 2EYHA 1LUZA 2DJGC 2YTYA 2QILA 4JBWA 2PCFB 3T51B 4RGMA 4FO2A 1HZBA 1SEBD 1I6HB 3AFPA 3KDFA 5FO8B 1HR0W 1F2ZA 3FKIH 3TZUA 4LF4Q 1K8OA 1IBLQ 4KY7A 2IT1A 4GZYC 4B9XA 1PH2A 4X65L 1EYGA 1SNQA 1PFMA 3CCRA 1G6PA 1DGSA 4RA8A 2HCCA 2H5XA 3A7AB 2NVTH 4A3FG 1RIPA 4DR4L 1PTOF 4BY7G 1WCMG 4DR7Q 5CORA 3F2UA 3DMUA 1NY4A 5D3DA 3V2TA 1N34L 1FVIA 4JI1Q 1HQMC 2WB1B 1LT3D 2OWOA 4MHEA 4A3EH 3GTLH 2XRQD 1HJPA 1V43A 3GTPH 1RD9D 4ZKBB 4FP5D 3S17B 4DR3L 3H3VI 4K6DA 4LJZC 2EY6A 1LTGD 3PUZA 3SDZA 2Y0SG 4YY3L 3MXGA 4KN4C 1XYIA 2IX1A 2KHJA 2RF4A 2UUBQ 3I4MH 4G7HC 2EPBA 4RAUC 3QR8A 2XIWA 3KBXA 1ASZA 1YITA 1S72A 4CJ2C 3ULJA 3L9AX 4KHZA 4A75A 5CV9A 3H94A 4A93B 2DUDA 3E5SA 4KKSA 1PVOA 3C1EA 3ND9A 4ZK9B 2B63H 3M85A 5M3FB 2E74C 2F3WA 3PGZA 2FJ2A 5CV8A 4Q5VA 1KLGD 4YWMA 2NN6G 1EQVA 2VZAA 3HEJA 1IHZA 1GHJA 2D0PA 2JA8B 1JWUD 2F0EA 1A3TA 4R8NA 2EYMA 4JI8L 3JAME 3D4DA 4DV5L 3U58A 5KEEA 5IGEA 1Q46A 1L2FA 1Y14B 3ULPA 4G57A 3KLRA 4GN3B 1K73C 3W5OA 2JK8A 3TREA 2H4OA 2LXJA 2L15A 5LMNQ 1HNXQ 4DV2L 5M3MB 1ASYA 2HDMA 1BR9A 2AQ2B 4MTKA 1BO0A 4EVOA 1IBML 3CCMA 3HOXB 2Q2TA 4EQOA 2C35B 2MGSA 4OWWB 5JVG3 4APVA 3S14H 2D5DA 3UI2A 2R93B 4C3JH 5IOCA 4LF6L 4UP9A 2Q8TA 2K50A 3L0OA 4X62Q 2R92G 3CCUA 2M00A 1B3QA 1CQFA 5M5WH 2CHBD 1QG7A 2LSSA 2EVBA 1AN8A 2K5QA 4HN7A 1GOZA 1STBA 1KIXA 1MKHA 3FP9A 3HGBA 1UE1A 1YHQA 2B2WC 2B29A 3MTSA 4I65A 2KJXA 3J81j 2F0NA 2B2TC 2VQEQ 1MJCA 3S15H 3GTQB 5TSSA 1HZAA 1S5CD 3C1FA 3P20A 4DR2Q 4A4IA 4PZ8A 5FKAC 2B2VC 4DNRB 1VQBA 2OXPA 2WKCA 3R2TA 3K59A 4DV3L 2JXMB 4ILWA 1H9RA 3A54A 4KHVA 3OMGA 2FFKB 1KAWA 2ZTCA 3GTOB 3M7NA 3AQQA 2N49A 3GDEA 4X3UA 4RGNA 3TS0A 5I2YA 4DR6L 2KECA 4OGQC 3TP5A 1QNKA 3HOZG 2J7ZA 1ENFA 5BN5A 2O2LD 2F0HA 3QJYA 4CKCA 1Y1VH 2MUYA 4J1MA 1SE8A 4JI5L 1MI2A 1NSNS 4IALA 3CMAA 2RA4A 3TS2A 1LT5D 3PO3B 1Q8IA 1XNQQ 5AJ3Q 3A5ZB 5COYA 3H09A 4PZ7A 3PQIA 5A2QL 4XQNA 3EROA 4JI0L 5E4XA 4TVAB 1LTSD 2I5LX 1N36Q 3LGJA 5EGTA 1STAA 3S1MB 1VQCA 3J81i 1DYQA 4MTNA 3NSWA 3KF6B 1A2UA 2JA6B 4F7XA 2HHHL 1YNJD 1Y8OB 1VQDA 3K8AA 1A63A 5KIXA 4A3MG 3R2IA 3CC2A 4UHVA 1ENCA 1QUQB 4X3SA 1HNWQ 3G7LA 1JCKB 4DAYB 4XT3B 1GKHA 5EPJA 4OONA 5C44B 3IRBA 3F8TA 5ELEA 2PNHA 1QUQA 3G6JB 3S2HH 3S16H 2QEJC 3U4VA 2L55A 4DAYA 3T1YL 1BCPF 4PQXA 1I3QH 4IFDH 1X3QA 3EFXD 5C5MA 3OWFA 3ER0A 4ODGA 1HNZL 4IUVA 3T1HL 1PH8A 5EKKA 4JK1C 3HOYG 2NVXH 1CA6A 2GVBA 2E5LL 4ZLTF 5E7NA 1I4GA 3STBC 1FJGL 2WKDA 4M8AA 5ISRA 3PO2B 3NBHB 5H1SE 1EY4A 2KCNA 5DAUA 2KOLA 3I55A 4OEMB 4Q0FA 2VUMH 4WJ3M 1UEAB 2L4NA 5C5LA 3FRPB 4HJ7A 1UE7A 3NBHA 1J9OA 1U4LA 1M1KC 1N33L 5IGDA 5CC4A 4GLXA 4BXXG 3AEVA 2NVTB 1LTRD 3I4NB 4LAAA 4LUOA 3GD7A 3QIAA
chains in the Genus database with same CATH topology
2HDLA 5G3LF 4CKEA 2K04A 4ZUJA 3I91A 3T13A 4EQPA 4U673 1O7ZA 5JEAH 2LFNA 4KN7C 3GTLB 1Q90A 1VF7A 1E0BA 3S9WA 1QOHA 1SE2A 5C4ZA 2A6HD 1STYA 5C0XG 5FLXL 2BA0A 2L12A 4DF7A 3HG9A 1TU2B 3SEBA 4ID6A 5CV7A 3WDNA 3MXUA 4IUPA 3RD4A 1Q3LA 3BDOA 1VCIA 3SK8A 2B8FA 2F0OA 2EXZA 1EYAA 1S5ED 5CGKA 5DM73 2JSOA 2B63B 3K5LA 1BCPD 2NB0A 1DM0B 1O78A 1W6KA 2NUCA 4QUFA 5FO9B 2RDFA 1NR4A 3C46A 3MA2B 2ZXOA 1GUNA 3DWAA 2C9OA 1KNEA 4QMGA 2DN8A 5JPNC 2E2IB 3IKJA 3NQIA 4TQUS 2O5JC 3D4RA 3BYYB 1AP0A 4RGOS 2K5DA 1FYCA 4WRDA 1DCZA 2C5CA 4FXKC 5D14A 3U9SA 2QDBA 5KNCA 3MXNA 4RH6A 1SYCA 5KYLA 2X6LA 3N52A 3QO2A 4IUQA 1FNVA 4FXGC 4K8JA 5J39A 3M3YB 1H9MA 2K03A 5J22A 1QE6A 2R6GA 4KKUA 4ZRZA 3FPUB 4BS9A 1CFMA 3DWQA 1SAPA 1L0YB 1JR0D 5KYIA 5NUCA 2L5TA 2VB3X 5JPMC 2G9HD 3S1QB 2F03A 4RWSC 1HA5A 2IJ0A 1D6EC 3A8JE 1B9NA 4HR7B 3D3RA 1T5XD 1STGA 3M4OB 2B2WA 4L63B 2B2TA 1ML0D 2O4XA 3NTKA 1H9SB 2JEBI 1DD2A 1B4OA 3K7AB 3VR3A 3H0GB 2RKSA 4V190 2B2UC 2B2VA 1EY9A 1YNJC 5C4HA 1HFGA 3BVGA 1MSGA 1ZKOA 1WTWA 1XX8A 1NCVA 3VR6A 4K5XA 3CQZB 1CA5A 2E76C 4PMWA 2TMPA 5EKLA 3MZ5A 2B8GA 3S1NB 5AFWA 1TS4A 1SNMA 1EOTA 1JOOA 1WD1A 1KLUD 3HOVB 1GUWA 3I8ZA 2M2LA 2NTSA 5C4XB 3NWSA 3DM1A 1KTKA 1Y8NB 1U4MA 5KNDA 3V96A 1JOKA 4N9TA 2K01A 3TN2A 5J1ZA 1KDAA 4ABNA 3DHQA 1FR3A 2DY8A 4IURA 3NTHA 1OXVA 1EY5A 1OXXK 4IFDI 1V8QA 1B53A 4B9WA 5JEAJ 3J81E 3A8IE 3C2PA 1TKWB 2X69A 2BDNA 1TR5A 4OO1H 4O1NA 1JC7A 1QB5D 2I07B 5DEHA 4HMJA 2A68D 3CU7A 3L3OC 1ZYRD 4DGZA 1SDFA 1TQOA 4Z9CB 1O7YA 1WD0A 1LTBD 4R8IA 5E3FA 4EGVA 2A6HC 2KHSA 4DNTB 3KBGA 5DNFA 3TP7A 1JOQA 2ICEC 1DJRD 1CI3M 5FK9C 1MSHA 4RHSA 2F0TA 4G7OC 3ITPA 1S5DD 5I9PA 1KABA 2R7ZB 2D62A 3HRZC 5I9OA 1PXUA 1ICWA 2FMCA 2RBMA 1RCVD 4NDXA 1TS5A 2PZUA 3EJIA 2K32A 1GUOA 1KAAA 4DK0A 2BCOA 1JWMD 4KY5A 1KDBA 4MIUA 5KRUA 2VXWA 4KD4A 4FF2A 3BVMA 1I4XA 1TWFB 1S5FD 4NP5A 3A55A 1EEID 2OT2A 5ELBA 4C3IG 5IODA 2K1BA 2MJ8A 2PZTA 2VB2X 2FMMA 2EJMA 5K36G 1I4RA 2HQEA 5ELCA 3GTKB 2RDHA 1I4QA 1R4QB 1EZ8A 1XXGA 1NR2A 3SR1A 4A3FB 4K2KA 3L7ZC 3D6WA 4ZAIA 4BY7B 4QIWB 1WCMB 3O13A 4KKTA 2IPKD 5IGGA 5C4JB 3RZDB 1XTCD 1PTOB 1MGSA 4RGTA 2B2YC 1LTID 1PDQA 1V1PB 3OIPA 5M5YB 5M9OA 3TDQA 1TS2A 4IQZA 5I4DA 1W6JA 3FDTA 2MPMA 1HCZA 1B1ZA 1TVXA 3EVQA 1H9JA 2KA7A 2Y0SB 1TT2A 1LT4D 2E75C 3E0JA 2L9HA 4DU9A 1SJED 3TP8A 1PTOD 1SE3A 1TWHB 3OW7A 3RZOB 4KD3A 2PO4A 3I90A 3VA7A 1SYGA 1SYDA 3NPPA 1CQVA 1EL0A 5M5XB 1F9PA 3NBIA 2NWGA 3K5NA 1RDPD 1RHPA 5CR3A 1PFNA 1OO9B 5FO7B 2F3VA 2AWNA 1HFNA 2PW7A 2F0WA 1Y8PB 4K14A 3MC0B 3PIP3 1HTPA 3DWPA 4XQJA 4HSPA 1PLFA 5D3IB 4NMZA 3NXWA 4I7ZC 1CHQD 3BG3A 2ZXPA 2NTTA 3DEOA 4KY6A 4C1NI 4CKBA 1C48A 4IN3A 2R92B 3MFGA 5C3WA 1GUSA 1M4VA 2B2UA 1DOLA 3NUCA 4C3HG 1RKNA 2F1MA 1LABA 4FF1A 3BZDB 2TSSA 2IWHA 4F88A 1I4HA 1ILPA 1IW7C 2R3ZA 3TP6A 3AU7A 2Z4HA 1TWCB 2PW5A 3WOEA 2A68C 3GP7A 2A73B 1ZYRC 3PMFA 4XDXA 3HOZB 5BN3A 4N9PA 3BYTB 1H9KA 1SNDA 4KMUC 3KK7A 1RODA 2F0FA 1J8IA 4H44C 4J8QA 4DAVA 1WTXA 2A74C 4OO1I 2A6ED 4XT1B 1WVLA 4YIJA 2KCCA 1A15A 1EYCA 1RTNA 5C6AA 3WOFA 2LS01 5JVH3 3OOCA 4TSSA 1PYWD 4K8IA 1VF5C 4CGYB 4A3MB 1G2TA 3SVMA 3NK9A 2JE6I 1EY6A 1PZKD 3I72A 1NAPA 4H0LC 3V05A 1O7LA 1JORA 3BS1A 4KJNA 3VR5A 3NQTA 1RF2D 3GTJB 1BCPB 3R93A 5T1IA 2LY7A 4K6LA 2XNAC 1SJHD 3HOYB 2AQ3B 2EJGC 5EPLA 3PUXA 3BVZA 1GXDC 1S5BD 1EIGA 1EY7A 5FOBB 3TZDA 5C0XJ 1IKMA 1QJOA 3M7GA 3NP8A 1TY2A 1U4PA 3LWUA 1PZID 2N55A 2F0MA 2PZWA 3JAML 2K28A 5DM63 4BA2I 3K5OA 2BOSA 2KEEA 4RKBA 4C1NK 4C3JG 1PTOC 3GV3A 4FNFA 4DXGA 4LMQD 1E2ZA 1EU3A 1EY8A 3SHLA 1A6XA 3GTMB 4M1UB 1S4ZA 3MVVA 1PMRA 1X3PA 3X3NA 1JQYD 1OXUA 5EBCA 1VDZA 2XWJB 3KLSA 2EYOA 3FPPA 5G3LD 1PTOH 1STHA 2EZVA 1WTPA 2B2YA 1ONLA 1Z47A 3K6OA 4J6HA 3ERQA 4G7ZC 4OHJA 3BDLA 1TS3A 3K0YA 1DOKA 2RVLA 2L1BA 1B50A 1SXTA 2MHVA 2EYFA 2ENBA 4DN4M 1PRTF 3PUVA 3VYTA 1D1IA 5EBDA 2JEAI 4OIJA 1HA6A 4L8JA 3PUWA 2ZT9C 3RLFA 2HCIA 4ZQ3A 4FXDA 3NHHA 1B9MA 1JE4A 1EIHA 4XXEA 2WP8J 2NN6H 5I6YA 3HP3A 2KVMA 2RDGA 4F8MA 4CBVA 2ICIA 2JYOA 1CK1A 2CQAA 3SXHA 4HSVA 1WTRA 2JA7B 1GHKA 4DA2A 1H9SA 4FF4A 3TMEA 1ESRA 2J0TD 5C3XA 1X32A 1KNAA 3HOWB 1HUNA 3ONAB 3QOJA 4A3GB 1EY0A 1PRTB 4HCSA 1SNOA 3AMUA 4IFDG 1CZWA 3DUZA 4RKLA 2AUJD 3Q22A 4DAPA 2IX0A 2Z8LA 2A6EC 4XIGS 4NKLA 2GA4B 1TWGB 4A3DB 1EU4A 3FVQA 1BUVT 1PRTD 3URYA 2YU9B 2DNEA 2RSNA 3FMCA 2XWBB 3NWTA 4PV1C 1IYUA 3VYSA 3Q0AA 4IZ8A 2R61A 3P1HA 4RFBA 4K5WA 1L0XB 3K58A 1B3AA 4OIKA 1K83B 1LTAD 1QCBD 5A2QE 2IW3A 3KUPA 2FHTA 3SK4A 3KF8A 1I4PA 4BA1I 2SOBA 1IL8A 4UDUC 1D5ZC 4HMIA 3U9OA 3P75A 3IL8A 5KGUA 5BN4A 2KUMA 1T5EA 2K05A 5K5PA 4QCLA 1A3UA 1BCPC 4C2MB 2EYPA 2QKIC 4ZYSA 3LNNA 2CW0D 1V1OA 4UAIA 4F87A 5IT9E 1VMPA 5KNBA 1F9SA 1EZ6A 2PYKA 3RUZA 1ET9A 3OPOA 5JAVA 1HUMA 1QILA 1K8MA 1SE4A 2F0LA 3MXPA 5E1FA 1BDOA 1E2VA 1Z7TA 3I4LA 5A35A 1G8ZD 3PV0A 3VR4A 1G91A 2NBFA 4QUCA 3I73A 2E2HB 3NTIA 4KV6A 3QOLA 2FINB 1GUGA 3SE0A 1GJXA 1OXSC 2RQXA 5EKIA 4DFAA 1EEFD 1F2MA 2QCPX 4BBRB 1HPCA 2H1EA 3TBIB 5FLXE 2EE1A 3OHXC 1I50B 1BQQT 4IUNA 2WIIB 2Q8RE 5EQ0A 1V1PA 1Q1EA 3KLSX 4G4KA 3PUYA 1DZ1A 4AYBB 2D9UA 3MFYA 5C0XH 4C3IB 3OSOA 3Q23A 1Y69U 4BBSB 2WACA 2F0UA 1II3A 2OF1A 4TRDA 3LX0A 3A7LA 4B08A 1JWSD 4WJWA 4KJOA 4TKOB 1D1KA 1LT6D 1SBBB 3OWEB 4KTAA 5IIFA 2F0DA 1SFOB 2NZ1D 3D8GA 3M4YA 3DXJC 3D6CA 1IKLA 1B44D 4R9WA 4KI0A 4XYOA 4S3SA 2QF7A 3P7JA 3A8KE 2NN6I 2XN9C 4A3BB 1BF4A 1UUPA 3X3MA 1HHVA 1SNCA 2PQEA 3GTGB 1GUTA 4WORA 2XVSA 1RJTA 2AQ1B 3H6MA 3HKZB 3T4AC 1EWCA 1ZEQX 1Q12A 3AB9A 2DY7A 1F9RA 4K5VA 1LLRD 3S2DB 5JJZA 2EDGA 1D5XC 3R3OA 4RHRA 1HQRD 1BNZA 2IL8A 3DEPA 1C8CA 2IX3A 1PRTC 3QB3A 1WTOA 3IFDA 3QG1A 4O42A 1JICA 1A2TA 1TY0A 3I3CA 4X3TA 1DOMA 3BDCA 5JOBA 1ET6A 1C4QA 3ZYYX 2F0QA 1HRJA 4HEDA 1MD2D 5CV6A 3HS0C 4A3KB 4OO1G 2WV6D 3MHBA 2LKVA 3J81L 1CHPD 3GV6A 3K5MA 4PMBA 3SK6A 4X3KA 4FF3A 1E2WA 3IFTA 3Q24A 4BY1B 2YYZA 5EJWA 1FD7D 4PMCA 4CJ1B 5CV4A 4HCEA 4DK1A 2K7VA 4A3IB 1YNND 4RCNA 1CTMA 1Z6HA 2XSCA 4C3HB 2EY1A 2Z1CA 1M8AA 2BDOA 1QNUA 2SNSA 2X6GA 4MN3A 1LACA 2L11A 3CHBD 3HOUB 3J7AF 4XTCS 3E6ZX 2CW0C 1CM9A 2EY5A 3EA6A 1U4RA 2F0KA 4H7BA 1AEXA 3W3AA 4K2LA 2RSOA 1BBXC 4HAEA 5T1GA 2KEDA 3CRLC 5IT9L 1LTTD 1DXMA 2BE5D 3T16A 3FKIB 3OIQA 2MP1A 2NVQB 1EYDA 5CMDA 4QF4A 4CJ0B 5C3EB 2B39A 1KDCA 2NVYB 4QB4A 1XWEA 1BOSA 1SMYD 2E2DC 4RCOA 3EQLC 4HTHA 3J80E 1EWHA 2A69D 1R4PB 1F9QA 5IGCA 5E4WC 4ME5A 2ID0A 3OMCA 4A3EB 4CHTB 3W2DA 3RMHA 2ZXRA 3GTPB 2K33A 1EFID 2F4IA 3VR2A 2F0VA 3H3VC 1MBYA 3I4MB 2PNRC 2CVRA 3K57A 1UAPA 2A5HA 1O80A 1STEA 5D65A 2SEBD 1PZJD 4EQNA 3NE5B 3GQBA 1Y1WB 2KQ3A 4Y7NB 1D2BA 3VA5A 4KK7A 2LMCB 2O5IC 3CRKC 1I6VC 4A3JB 3D4WA 1SYEA 3HZXA 1CZGA 1F2YA 1FGBD 5C0XI 4FYDA 2AWOA 2L0CA 3A56A 5IGBA 1HTLD 1CT1D 1G291 2E2JB 2F0JA 1BXTA 1ZXTA 1SSOA 3I70A 4XYQA 5HURA 3S14B 3D31A 3ND8A 4C3JB 2V4DA 4ULLA 1FNUA 5K36H 5ELDA 1AZPA 2I46A 5M5WB 4WFN3 3IAYA 1LV9A 2EJFC 1G2SA 1U9RA 4U68A 1ESFA 3N6RA 4IUUA 5CBEE 3S15B 3VYRA 2EYLA 4DXFA 2HUGA 3MAQA 5CYUA 2SNMA 2PPBC 1D5MC 3S1RB 5LHY1 3GO5A 1VMCA 1STNA 4C56C 3J7YW 2D2CC 5I2XA 4IUTA 2XRSD 5LL6X 5CV5A 1FNWA 1JB3A 2F0PA 1PFBA 4ZKCB 1HXYD 2G9DA 2JP1A 1R9TB 1IYVA 2BA1A 2EYJA 1Y1VB 4FVMA 3MEHA 1WTVA 1ILQA 4E6IA 1G6ZA 3Q6SA 2Z4IA 2K6AA 3TSSA 1QWYA 5F2DA 1ENAA 2JA5B 1YNNC 5I6WA 3H91A 5IGFA 2K5WA 4LK1C 5EPKA 1OXTA 1SYFA 3VYUA 5LL6S 4IFDJ 2F0IA 1Q1BA 2EOTA 3J7AV 1TWAB 3SK5A 2WAQB 3T53B 2N88A 5HGTA 3FEWX 2VNUD 1TIID 2Q8IB 1F77A 3LWEA 3QWNA 1A3VA 4P2CB 4PNYA 5ELFA 4NW2A 1SNPA 2DNCA 3S2HB 3S16B 4ZUIA 2BE5C 3PIO3 5JEAG 3C3LA 4XQQA 1AFPA 1I3QB 2OEOA 1F2LA 1NUCA 1AZQA 2WINB 3R8BA 2F0GA 4OL7A 2AUKA 2NVXB 1B2TA 4L6TB 2M9VA 1LO5D 1DONA 2PMZB 2F0SA 1SMYC 4V0BA 5CBAE 3CKIB 2SDFA 2NYZD 3MWYW 4H13C 1IW7D 2VUMB 2A69C 2EY2A 4BWGB 2J4XA 1EQTA 1AW7A 1SYBA 3T56B 3J80L 1UNSA 1RTOA 1WTQA 2EYHA 2QILA 4JBWA 2PCFB 3T51B 4RGMA 4FO2A 1SEBD 1I6HB 5FO8B 1F2ZA 3TZUA 1K8OA 4KY7A 2IT1A 4GZYC 4B9XA 1SNQA 1PFMA 4RA8A 2HCCA 3A7AB 1PTOF 5CORA 3F2UA 3DMUA 5D3DA 3V2TA 1HQMC 2WB1B 1LT3D 4MHEA 2XRQD 1V43A 1RD9D 4ZKBB 4FP5D 3S17B 4K6DA 4LJZC 2EY6A 1LTGD 3PUZA 3SDZA 2IX1A 3MXGA 4KN4C 1XYIA 4G7HC 2EPBA 4RAUC 2XIWA 3KBXA 4CJ2C 3L9AX 4KHZA 5CV9A 3H94A 4A93B 3E5SA 4KKSA 3C1EA 3ND9A 4ZK9B 3M85A 5M3FB 2E74C 2F3WA 2FJ2A 5CV8A 4Q5VA 1KLGD 2NN6G 1EQVA 3HEJA 1IHZA 1GHJA 2JA8B 1JWUD 2F0EA 1A3TA 4R8NA 2EYMA 3JAME 3D4DA 5KEEA 5IGEA 4G57A 3KLRA 2H4OA 5M3MB 2HDMA 1BR9A 2AQ2B 1BO0A 4EVOA 3HOXB 4EQOA 2MGSA 5JVG3 2D5DA 3UI2A 2R93B 5IOCA 2Q8TA 2M00A 1CQFA 2CHBD 1QG7A 2EVBA 1AN8A 2K5QA 4HN7A 1GOZA 1STBA 3HGBA 2B2WC 3MTSA 4I65A 2KJXA 2F0NA 2B2TC 3GTQB 5TSSA 1S5CD 3C1FA 3P20A 5FKAC 2B2VC 4DNRB 2OXPA 2WKCA 3R2TA 3K59A 2JXMB 4ILWA 1H9RA 3A54A 4KHVA 3OMGA 2FFKB 3GTOB 3M7NA 4X3UA 4RGNA 5I2YA 2KECA 4OGQC 3TP5A 1QNKA 2J7ZA 1ENFA 5BN5A 2O2LD 2F0HA 3QJYA 4CKCA 2MUYA 4J1MA 1MI2A 1NSNS 4IALA 2RA4A 1LT5D 3PO3B 1Q8IA 5COYA 3H09A 5A2QL 4XQNA 3EROA 5E4XA 1LTSD 5EGTA 3S1MB 1STAA 1DYQA 3NSWA 1A2UA 2JA6B 4F7XA 1YNJD 1Y8OB 5KIXA 3R2IA 1ENCA 4X3SA 3G7LA 1JCKB 4XT3B 5EPJA 5C44B 5ELEA 3G6JB 2QEJC 2L55A 4DAYA 1BCPF 4PQXA 4IFDH 1X3QA 3EFXD 5C5MA 3OWFA 4ODGA 4IUVA 5EKKA 4JK1C 1CA6A 4ZLTF 1I4GA 2WKDA 4M8AA 5ISRA 3PO2B 1EY4A 2KCNA 5DAUA 2KOLA 4Q0FA 1UEAB 2L4NA 5C5LA 3FRPB 3NBHA 1J9OA 1U4LA 5IGDA 5CC4A 2NVTB 1LTRD 3I4NB 4LAAA 3GD7A 3QIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVR A;  1RTN A;  1QNK A;  2HDL A;  2SDF A;  2NYZ D;  2K03 A;  3MWY W;  4HCS A;  2J7Z A;  1S4Z A;  1QE6 A;  2K01 A;  2FJ2 A;  3TN2 A;  2K04 A;  5EJW A;  1X3P A;  2NZ1 D;  1O80 A;  3I91 A;  1EQT A;  3FPU B;  5D65 A;  1IKL A;  4UAI A;  1O7Z A;  2DY8 A;  4IUR A;  4CJ1 B;  1RTO A;  1MI2 A;  4IUT A;  4R9W A;  2K1B A;  2MJ8 A;  2RA4 A;  1WTQ A;  1E0B A;  1PLF A;  1SAP A;  2FMM A;  1WTP A;  2B2Y A;  3P7J A;  5COY A;  1VMP A;  1F9S A;  1PFB A;  1BF4 A;  4ZKC B;  3SVM A;  1G2T A;  5E4X A;  3DEO A;  1M8A A;  2JP1 A;  1HUM A;  1HHV A;  1NR2 A;  1B53 A;  2X6G A;  4MN3 A;  4RWS C;  1NAP A;  2L11 A;  2L12 A;  3D6W A;  4ZAI A;  1RJT A;  1DOK A;  1WTV A;  1ILQ A;  2RVL A;  2X69 A;  2BDN A;  2L1B A;  2RSN A;  1B50 A;  1MGS A;  1G6Z A;  1CM9 A;  3Q6S A;  1U4R A;  2B2Y C;  1PDQ A;  2B2U A;  4IUP A;  1Q3L A;  2HDM A;  1G91 A;  1DOL A;  1BO0 A;  2MGS A;  2DY7 A;  1F9R A;  1PFM A;  4QUC A;  4DN4 M;  3FDT A;  2RSO A;  3H91 A;  2B2W A;  3UI2 A;  5JJZ A;  1BBX C;  3R93 A;  5EPK A;  2MPM A;  5T1I A;  4X3S A;  4HAE A;  1SDF A;  4RA8 A;  5T1G A;  2B2T A;  1O7Y A;  2HCC A;  2KED A;  3G7L A;  4OIJ A;  1WD0 A;  1BNZ A;  2IL8 A;  1TVX A;  1ML0 D;  4QUF A;  4R8I A;  1HA6 A;  1NR4 A;  2Q8T A;  1B3A A;  4XT3 B;  4OIK A;  5EPJ A;  2HCI A;  5EPL A;  2FIN B;  5DNF A;  3DEP A;  1C8C A;  5COR A;  2EOT A;  2MP1 A;  1B4O A;  3F2U A;  2B2U C;  2B2V A;  2L9H A;  1KNE A;  1ILP A;  1QG7 A;  1ZXT A;  2N88 A;  1SSO A;  3IFD A;  4O42 A;  5EKI A;  1WTO A;  5CMD A;  1JE4 A;  1JIC A;  2R3Z A;  4MHE A;  4CJ0 B;  3KUP A;  1HFG A;  1EIH A;  3I3C A;  2FHT A;  1MSH A;  1EIG A;  2B2W C;  2H1E A;  3LWE A;  3MTS A;  1X3Q A;  1MSG A;  1DOM A;  4X3T A;  3TZD A;  2B2T C;  3HP3 A;  2EE1 A;  2KVM A;  1WTW A;  1IKM A;  1XX8 A;  4IUV A;  1NCV A;  3I90 A;  4ZKB B;  1AP0 A;  4NW2 A;  2Q8R E;  1CA6 A;  5EQ0 A;  1CA5 A;  1U4P A;  1HRJ A;  2JYO A;  4ZLT F;  1AZP A;  1XYI A;  4HED A;  1ICW A;  2N55 A;  2B2V C;  4X3K A;  4XDX A;  1DZ1 A;  4HSV A;  5AFW A;  1IL8 A;  1WTR A;  2K28 A;  1EL0 A;  2D9U A;  1EOT A;  2EPB A;  4RAU C;  1F9P A;  1F9Q A;  2XIW A;  1LV9 A;  5E4W C;  3KBX A;  2KOL A;  5D14 A;  1G2S A;  4CJ2 C;  2NWG A;  4U68 A;  1WD1 A;  1ROD A;  1F2L A;  2KEE A;  1J8I A;  2L4N A;  1RHP A;  4IUU A;  3IL8 A;  2FFK B;  1AZQ A;  5CBE E;  3GV6 A;  1ESR A;  2X6L A;  1J9O A;  1PFN A;  1U4L A;  3N52 A;  2KUM A;  1WTX A;  1GUW A;  1X32 A;  3GV3 A;  3I8Z A;  3QO2 A;  1B2T A;  1KNA A;  4IUQ A;  1HUN A;  2KEC A;  2K05 A;  2M2L A;  4XT1 B;  2VXW A;  3ONA B;  1DON A;  2HUG A;  4LMQ D;  4X3U A;  1WVL A;  3DM1 A;  1U4M A;  4ZK9 B;  1HFN A;  1A15 A;  1VMC A;  5CBA E; 
#chains in the Genus database with same CATH topology
 4LWC A;  4OWX B;  2HDL A;  5IYD H;  5G3L F;  3PIP A;  2P5Z X;  4CKE A;  1I6H H;  1CUK A;  2K04 A;  4ZUJ A;  3I91 A;  3T13 A;  4EQP A;  4U67 3;  1O7Z A;  5JEA H;  2LFN A;  4KN7 C;  3GTL B;  1Q90 A;  1VF7 A;  1E0B A;  1NNX A;  3S9W A;  1QOH A;  1SE2 A;  2IHE A;  5C4Z A;  2A6H D;  1STY A;  4A3L H;  5C0X G;  4R4O A;  3M4Q A;  5FLX L;  2BA0 A;  2L12 A;  4DF7 A;  3HG9 A;  3AFQ A;  1X9N A;  1TU2 B;  3SEB A;  4ID6 A;  5CV7 A;  1VQI A;  1O7I A;  3WDN A;  4QIW E;  2CWA A;  5IWA Q;  4JI6 L;  3MXU A;  4IUP A;  3RD4 A;  1Q3L A;  3TRZ A;  3BDO A;  1VCI A;  3SK8 A;  2B8F A;  2F0O A;  1SN8 A;  2EXZ A;  1EYA A;  1S5E D;  5CGK A;  3JAM i;  4DV0 Q;  5DM7 3;  2JSO A;  2PI2 E;  2B63 B;  3K5L A;  1BCP D;  2NB0 A;  1DM0 B;  1O78 A;  1W6K A;  2NUC A;  4QUF A;  5FO9 B;  2A8V A;  2RDF A;  1NR4 A;  3C46 A;  1WI5 A;  3S17 H;  1I94 Q;  1A8V A;  4JYA L;  3MA2 B;  2ZXO A;  2HIV A;  4AYB E;  1GUN A;  3DWA A;  2C9O A;  1KNE A;  4QMG A;  4LFC L;  2DN8 A;  5JPN C;  2E2I B;  3IKJ A;  3NQI A;  2ASB A;  4TQU S;  3CW2 C;  4CDC C;  2O5J C;  3F2B A;  3HKS A;  3D4R A;  3A5U A;  3BYY B;  4A93 H;  1AP0 A;  4RGO S;  3CC4 A;  2K5D A;  1FYC A;  4WRD A;  1DCZ A;  2C5C A;  1PH7 A;  1W3S A;  4JI4 Q;  2R7D A;  4FXK C;  1KL9 A;  5M3F H;  4MNO A;  4JI7 L;  4BY7 H;  5D14 A;  3U9S A;  2QDB A;  4JPB W;  3DM3 A;  5KNC A;  2I5M X;  3JAM c;  2VS1 A;  3MXN A;  4RH6 A;  1SYC A;  5KYL A;  2X6L A;  4GN4 B;  3N52 A;  4LF8 Q;  4JV5 Q;  5GQO A;  3QO2 A;  4IUQ A;  1IXR A;  1FNV A;  2OTL A;  4FXG C;  2JA8 H;  4K8J A;  1I5F A;  5J39 A;  3M3Y B;  4B3M Q;  1H9M A;  2K03 A;  4GNX B;  5J22 A;  1QE6 A;  3I56 A;  2R6G A;  4KKU A;  4YHH L;  4ZRZ A;  3FPU B;  2JA7 G;  2ES2 A;  4JI2 Q;  4H02 A;  4BS9 A;  2UUC Q;  3HKZ E;  1CFM A;  3DWQ A;  3I2Z A;  1SAP A;  1L0Y B;  1S3O A;  1JR0 D;  2UU9 L;  3HOW G;  5KYI A;  1VQ4 A;  4A3G G;  3HOX H;  2A1A A;  5NUC A;  4CDD C;  2L5T A;  2QGQ A;  2VB3 X;  4JOI C;  5JPM C;  2G9H D;  3S1Q B;  2F03 A;  2R93 H;  4X64 L;  4RWS C;  3PCO B;  1HA5 A;  2IJ0 A;  1D6E C;  3A8J E;  5M5X H;  1B9N A;  1JJC B;  4HR7 B;  3D3R A;  1T5X D;  1MIU A;  1STG A;  3M4O B;  1B7Y B;  2B2W A;  1PH9 A;  4L63 B;  2B2T A;  4JVZ A;  1ML0 D;  2O4X A;  4A3D G;  3NTK A;  3GTQ H;  1H9S B;  2JEB I;  1DD2 A;  3K7A B;  1B4O A;  3VR3 A;  3H0G B;  2RKS A;  4IJH A;  1OTC A;  2B2U C;  4V19 0;  2B2V A;  1EY9 A;  4DR1 Q;  1YNJ C;  4FDB A;  5C4H A;  2OQ0 A;  1HFG A;  4L5R C;  3BVG A;  3RLO A;  1MSG A;  2KHI A;  1ZKO A;  1AE2 A;  4YCU A;  1WTW A;  2N3S A;  3CCV A;  1XX8 A;  1NCV A;  3VR6 A;  4K5X A;  1IBL L;  4YCV A;  3CQZ B;  1CA5 A;  2E76 C;  5BR8 Q;  4DV4 Q;  4PMW A;  2TMP A;  5EKL A;  3MZ5 A;  4ME3 A;  2B8G A;  3S1N B;  5AFW A;  1TS4 A;  3OW2 A;  1SNM A;  4GKK Q;  1EOT A;  1JOO A;  4X66 Q;  2AMC B;  4N8F A;  3RN5 A;  2R92 H;  4HJ5 A;  2A19 A;  1WD1 A;  1EOV A;  1KLU D;  3F1Z A;  1PH5 A;  4LFA L;  1JJ2 A;  1EUJ A;  1E7Z A;  1X55 A;  3HOV B;  4DR7 L;  1GUW A;  3I8Z A;  2M2L A;  1X3G A;  2NTS A;  3PO3 H;  5C4X B;  3NWS A;  3DM1 A;  1KTK A;  1Y8N B;  1U4M A;  2KBN A;  5KND A;  3V96 A;  4YWL A;  1JOK A;  4N9T A;  2K01 A;  1EIY B;  5ELO A;  3S1M H;  3TN2 A;  5J1Z A;  5LMN W;  1KDA A;  3HFZ B;  4ABN A;  3DHQ A;  1FR3 A;  1CSP A;  2DY8 A;  4IUR A;  3NTH A;  1N32 Q;  4LF5 L;  4JBJ A;  1OXV A;  1EY5 A;  1OXX K;  4IFD I;  4NXM L;  3UDG A;  2CWP A;  2Z9H A;  1V8Q A;  1B53 A;  2KEN A;  4B9W A;  5JEA J;  4DV6 Q;  2GVA A;  3J81 E;  3A8I E;  3C2P A;  1TKW B;  3KF8 B;  2X69 A;  2BDN A;  3UDX A;  1TR5 A;  4OO1 H;  4O1N A;  1JC7 A;  1QB5 D;  2I07 B;  5DEH A;  4HMJ A;  2A68 D;  2IHF A;  1VQA A;  3CU7 A;  3L3O C;  1ZYR D;  4DGZ A;  1SDF A;  1TQO A;  2V1C C;  4Z9C B;  1O7Y A;  1WD0 A;  1LTB D;  4R8I A;  5E3F A;  4EGV A;  1KD1 C;  2A6H C;  2KHS A;  1YIJ A;  4DNT B;  3KBG A;  5DNF A;  3TP7 A;  1SRU A;  2ICE C;  1JOQ A;  1DJR D;  3PO2 H;  1CI3 M;  1Q82 C;  5FK9 C;  1MSH A;  4RHS A;  2F0T A;  4G7O C;  3ITP A;  1X3E A;  1S5D D;  5I9P A;  1Q81 C;  1KAB A;  5GAH C;  2R7Z B;  2D62 A;  1NBW A;  1K0R A;  3HRZ C;  5I9O A;  1PXU A;  4JCV E;  1ICW A;  3I4N H;  2UXC Q;  2D0O A;  2FMC A;  2RBM A;  1RCV D;  2LXK A;  1TS5 A;  4NDX A;  2QW7 A;  1KRS A;  3NEN A;  1IYJ B;  2PZU A;  3EJI A;  2K32 A;  1GUO A;  1VQE A;  1KAA A;  1K3B C;  4BBR G;  1PH1 A;  2F3I A;  4DK0 A;  2BCO A;  4X62 L;  1JWM D;  4KY5 A;  1KDB A;  1C9O A;  4MIU A;  4O2D A;  3GTJ H;  5KRU A;  5FJ8 H;  2VXW A;  1E3P A;  4KD4 A;  4FF2 A;  2UXD L;  3BVM A;  5LMU L;  1I4X A;  1TWF B;  1UE5 A;  1S5F D;  1K3R A;  4NP5 A;  5HGQ A;  4AYB G;  4AQY Q;  3A55 A;  4DUY L;  1YJ9 A;  1EEI D;  2OT2 A;  5ELB A;  4C3I G;  2Z6K C;  4B3S L;  5IOD A;  4BBS G;  2K1B A;  2MJ8 A;  4POF A;  2PZT A;  2VB2 X;  5IP9 H;  2FMM A;  4QY7 A;  2EJM A;  5K36 G;  1I4R A;  2HQE A;  5ELC A;  4L5S A;  3GTK B;  2RDH A;  1I4Q A;  1R4Q B;  1EZ8 A;  1XXG A;  4NXN L;  1NR2 A;  3SR1 A;  2QEX A;  1HR0 L;  2BH8 A;  4A3F B;  4K2K A;  2EIF A;  3L7Z C;  2F4V Q;  3D6W A;  4ZAI A;  2YTV A;  4BY7 B;  4QIW B;  1WCM B;  3O13 A;  1BVS A;  4KKT A;  2IPK D;  5IGG A;  4EX5 A;  5C4J B;  3RZD B;  1XTC D;  1PTO B;  1MGS A;  4RGT A;  2B2Y C;  1LTI D;  1PDQ A;  1V1P B;  3OIP A;  3FHW A;  2K5N A;  3M9B A;  5M5Y B;  5M9O A;  3TDQ A;  2PQA B;  1TS2 A;  4IQZ A;  2E2I H;  5I4D A;  4A3B G;  1W6J A;  3FDT A;  2MPM A;  1HCZ A;  1B1Z A;  4RMF A;  4AIM A;  3E9H A;  4OX9 L;  4JI3 L;  1TVX A;  3EVQ A;  1H9J A;  2KA7 A;  2Y0S B;  5AJ3 L;  1TT2 A;  3AYH B;  1LT4 D;  4ZCK A;  2E75 C;  3E0J A;  3EN2 A;  3HKZ G;  4DAM A;  2QDL A;  2L9H A;  4DU9 A;  2G5D A;  4GNX C;  1CKN B;  1VQM A;  1SJE D;  3CAM A;  1L1O B;  3TP8 A;  1PTO D;  3F2C A;  1SE3 A;  2Q2H A;  1TWH B;  3OW7 A;  3RZO B;  4KD3 A;  2PO4 A;  3I90 A;  3VA7 A;  1SYG A;  4X65 Q;  1SYD A;  3NPP A;  3CF5 A;  1CQV A;  3M3Y H;  1L0W A;  1EL0 A;  2CH4 A;  3L2P A;  1F9P A;  5M5X B;  4RG1 A;  1HNW L;  1V1Q A;  3NBI A;  2NWG A;  3K5N A;  1RDP D;  1KC8 C;  1RHP A;  5CR3 A;  1PFN A;  4GKJ Q;  1OO9 B;  5FO7 B;  4LFB L;  1N34 Q;  2F3V A;  1X65 A;  5IE8 A;  2AWN A;  1HFN A;  1J5E L;  2PW7 A;  2F0W A;  1Y8P B;  4K14 A;  4A3K G;  4JOI A;  3S1Q H;  2XTI A;  3MC0 B;  4YWK A;  3PIP 3;  3EBE A;  1HTP A;  2VQF L;  2R7F A;  4DR3 Q;  3J7A 5;  3UE0 A;  4GOP B;  3DWP A;  4YY3 Q;  4XQJ A;  4HSP A;  1VQ9 A;  1PLF A;  5D3I B;  2NZO A;  4NMZ A;  3NXW A;  4I7Z C;  1CHQ D;  3BG3 A;  2ZXP A;  5IYB G;  1VQ6 A;  1CKM A;  2NTT A;  3DEO A;  3M4O H;  2JJQ A;  4KY6 A;  4C1N I;  1S40 A;  2CKZ B;  4CKB A;  4BY1 G;  1C48 A;  4IN3 A;  1PH6 A;  2R92 B;  3MFG A;  3KFU A;  5C3W A;  1GUS A;  4QJF A;  3K7A H;  1M4V A;  2WAQ E;  3H0G H;  2B2U A;  1DOL A;  3K7U C;  3NUC A;  1UEB A;  4C3H G;  1PYS B;  4P71 A;  1N9W A;  1RKN A;  4P72 A;  2F1M A;  1LAB A;  1EIF A;  4FF1 A;  3BZD B;  2TSS A;  3HOU G;  3CQZ H;  4DK3 C;  2IWH A;  2CCZ A;  4F88 A;  1K8G A;  1I4H A;  4JI8 Q;  4DV5 Q;  1ILP A;  1IW7 C;  3S1N H;  4X6A H;  2R3Z A;  4LW1 A;  3TP6 A;  1E1T A;  3KF6 A;  3AU7 A;  2Z4H A;  1TWC B;  4J15 A;  1NMG A;  2PW5 A;  3WOE A;  2A68 C;  3J7Z C;  3GP7 A;  2A73 B;  3HOV H;  1ZYR C;  3PMF A;  4DV2 Q;  4DUZ Q;  5C4X H;  3FKI G;  2MO1 A;  1TXY A;  4XDX A;  3HOZ B;  1T9H A;  5BN3 A;  3CCQ A;  4N9P A;  3BYT B;  1H9K A;  1SND A;  4KMU C;  1QVG A;  3KK7 A;  1K9M C;  4LF6 Q;  1ROD A;  2F0F A;  1J8I A;  5C3E G;  4H44 C;  4J8Q A;  4DAV A;  3ICE A;  2K75 A;  1YBY A;  4IO9 A;  1WTX A;  2A74 C;  4OO1 I;  2A6E D;  4XT1 B;  1BKB A;  3J81 c;  2N78 A;  1WVL A;  4YIJ A;  2KCC A;  1A15 A;  5J3B A;  1EYC A;  1RTN A;  5C6A A;  4A3C G;  3WOF A;  2LS0 1;  2QA4 A;  2VL6 A;  5JVH 3;  3OOC A;  4TSS A;  2JA9 A;  4A3E G;  1PYW D;  2UUA Q;  4K8I A;  1VF5 C;  1W2B A;  4CGY B;  4A3M B;  1G2T A;  3SVM A;  4DV3 Q;  3NK9 A;  3U50 C;  3I4M G;  2JE6 I;  1EY6 A;  1PZK D;  3I72 A;  1NAP A;  1XMQ Q;  4H0L C;  3V05 A;  1O7L A;  1JOR A;  3SGI A;  3BS1 A;  4KJN A;  3VR5 A;  3NQT A;  1E24 A;  4DR6 Q;  1RF2 D;  3S24 A;  2WB1 E;  3GTJ B;  1JT8 A;  1Y1W G;  1BCP B;  1JB7 A;  1ICF B;  3R93 A;  5T1I A;  2LY7 A;  4K6L A;  2XNA C;  1SJH D;  4JI5 Q;  3HOY B;  2AQ3 B;  2EJG C;  4A3J G;  5EPL A;  3PUX A;  3KJO A;  2Z0S A;  2R7Z H;  3JC6 6;  1VQN A;  3BVZ A;  4Y52 H;  2NZH A;  4JI0 Q;  5IT9 c;  4C2M H;  1GXD C;  1S5B D;  1EIG A;  1EY7 A;  5FOB B;  3TZD A;  5C0X J;  1IKM A;  2HHH Q;  1QJO A;  3CPF A;  3M7G A;  3NP8 A;  1TY2 A;  1U4P A;  3LWU A;  1SRO A;  1PZI D;  1P16 A;  4O0A A;  1PYB A;  1X6O A;  2F0M A;  2N55 A;  2Q2U A;  2PZW A;  1TWF H;  3JAM L;  2K28 A;  5DM6 3;  3CD6 A;  4BA2 I;  1PH4 A;  3K5O A;  2BOS A;  2KEE A;  4IOC A;  4RKB A;  3ERS X;  2Z6K A;  1JMC A;  4C1N K;  4C3J G;  1PTO C;  3GV3 A;  4FNF A;  4IPH A;  2AHO B;  1NJI C;  4DR1 L;  4DXG A;  4JW0 A;  4LMQ D;  1FGU A;  3T1Y Q;  1IBK L;  1E2Z A;  1EU3 A;  2DJF C;  1EY8 A;  3SHL A;  3GTK H;  1A6X A;  3GTM B;  4M1U B;  1S4Z A;  3MVV A;  3F2D A;  1PMR A;  1X3P A;  4A3F H;  1HNZ Q;  3T1H Q;  3X3N A;  1JQY D;  1OXU A;  4KHP Q;  5EBC A;  1VDZ A;  1WCM H;  4DV4 L;  2E5L Q;  2I5H A;  3KLS A;  2ALY B;  2EYO A;  2XWJ B;  4DK6 C;  5C4J H;  3FPP A;  3RZD H;  4B3T Q;  5G3L D;  1PTO H;  4LNQ A;  1STH A;  2EZV A;  1WTP A;  2B2Y A;  4GKK L;  4BBR H;  4POG A;  5M5Y H;  1ONL A;  1L1O C;  1IL2 A;  1Z47 A;  4DR5 Q;  1A62 A;  1Q8K A;  3K6O A;  4J6H A;  3ERQ A;  4L5T A;  4G7Z C;  4OHJ A;  3BDL A;  2YTX A;  1N33 Q;  1AE3 A;  1TS3 A;  3K0Y A;  1DOK A;  2RVL A;  4K0K L;  2L1B A;  1QZH A;  1SXT A;  1M90 C;  3G48 A;  1B50 A;  4CDF C;  3CME A;  2MHV A;  2EYF A;  4C3I H;  2ENB A;  5FLM G;  4GNX A;  1VQF A;  4DN4 M;  1PRT F;  1X56 A;  3PUV A;  3VYT A;  1D1I A;  1TWH H;  5EBD A;  2JEA I;  4OIJ A;  3OTO L;  1HA6 A;  3RZO H;  4L8J A;  3PUW A;  2ZT9 C;  3RLF A;  2HCI A;  2ZM6 L;  4ZQ3 A;  4FXD A;  1NE3 A;  3NHH A;  2DGY A;  1B9M A;  1JE4 A;  2JA5 G;  2UXB Q;  4LF9 L;  1EIH A;  2K14 A;  4XXE A;  2OQK A;  2WP8 J;  4UY8 C;  2NN6 H;  5I6Y A;  3PF5 A;  2MQH A;  3HP3 A;  2KVM A;  2RDG A;  2VY3 A;  4F8M A;  4GOP C;  3BU2 A;  4IOA A;  4CBV A;  3A0J A;  2ICI A;  4LF7 L;  4A3B H;  2JYO A;  1CK1 A;  2CQA A;  2OTJ A;  3SXH A;  4NB3 A;  4HSV A;  1WTR A;  2WAQ G;  1D7Q A;  1MJE A;  2JA7 B;  1GHK A;  5HY6 A;  4DA2 A;  1H9S A;  4FF4 A;  3TME A;  4MZ9 A;  1ESR A;  2J0T D;  3W1B A;  5C3X A;  1QZG A;  4JYA Q;  1X32 A;  1KNA A;  3HOW B;  1XPR A;  1HUN A;  3ONA B;  4LFC Q;  1QVC A;  3QOJ A;  4LF4 L;  3S2D H;  4A3G B;  1EY0 A;  1PRT B;  4DV1 Q;  4HCS A;  1SNO A;  3AMU A;  3CXC A;  4IFD G;  1CZW A;  3DUZ A;  4RKL A;  2AUJ D;  3RR5 A;  3Q22 A;  4DAP A;  2RHQ B;  5EAY A;  2ZJQ A;  2IX0 A;  1WJJ A;  2Z8L A;  2A6E C;  4XIG S;  4NKL A;  4JI7 Q;  2GA4 B;  1TWG B;  4JI1 L;  4IPD A;  2GN5 A;  1PA6 A;  1Q86 C;  4A3D B;  3UDF A;  1EU4 A;  3FVQ A;  2VUM G;  1BUV T;  1PRT D;  3URY A;  2YU9 B;  3CP0 A;  4YCW A;  2DNE A;  2RSN A;  3FMC A;  4A3K H;  2BH2 A;  2RCN A;  1VQP A;  2XWB B;  3KOJ A;  3NWT A;  4PV1 C;  3I4O A;  1IYU A;  3VYS A;  3VDY A;  3Q0A A;  2UUB L;  4IZ8 A;  2R61 A;  5IYD G;  2MNA A;  1TWC H;  3P1H A;  4RFB A;  4K5W A;  4QL5 A;  1L0X B;  1VQ5 A;  4DNI A;  3K58 A;  2Q2I A;  1B3A A;  4OIK A;  1K0S A;  3H15 A;  1B8A A;  1K28 A;  1YEZ A;  1K83 B;  4BY1 H;  3HOZ H;  1LTA D;  1QCB D;  5A2Q E;  3D0F A;  2IW3 A;  3KUP A;  3PSI A;  4X64 Q;  1X54 A;  2FHT A;  3SK4 A;  2F4V L;  4A3L G;  3KF8 A;  1I4P A;  4C3H H;  3CC7 A;  1Z9F A;  3OYY A;  4BA1 I;  3J80 i;  2SOB A;  4P73 A;  4GS3 A;  1IL8 A;  1D8L A;  4UDU C;  1D5Z C;  4ALP A;  5GAE C;  2WB1 G;  4HMI A;  2K52 A;  3U9O A;  3P75 A;  3IL8 A;  2CH4 W;  3G4S A;  4QQB X;  5KGU A;  5BN4 A;  4DV7 Q;  3KDF B;  2KUM A;  4P75 A;  1VQ7 A;  1YJN A;  1UE6 A;  1T5E A;  2K05 A;  2ATW A;  5K5P A;  4UP7 A;  2JN4 A;  4A3M H;  4QCL A;  1XNR Q;  4GLA C;  1A3U A;  5LMN L;  1HNX L;  1BCP C;  3CCL A;  4C2M B;  2EYP A;  2QKI C;  4ZYS A;  3LNN A;  2VW9 A;  2CW0 D;  1V1O A;  4UAI A;  4F87 A;  2NVQ H;  2HIX A;  4A93 G;  5IT9 E;  1YVC A;  1VMP A;  5KNB A;  5C3E H;  1F9S A;  2NVY H;  1EZ6 A;  3J80 c;  2PYK A;  3RUZ A;  1ET9 A;  3OPO A;  5JAV A;  1HUM A;  1QIL A;  1YHA A;  1K8M A;  4A76 A;  4LFA Q;  3STB D;  5M3F G;  1SE4 A;  1QVF A;  2HQL A;  2F0L A;  4GKJ L;  2YV5 A;  3MXP A;  3HOY H;  5E1F A;  1E22 A;  1BDO A;  1E2V A;  1Z7T A;  5IP7 G;  1BBW A;  3I4L A;  1KRT A;  2VQE L;  4A3C H;  5A35 A;  1G8Z D;  3PV0 A;  1C7Y A;  3A74 A;  3BJU A;  3VR4 A;  4DR2 L;  1G91 A;  2JA8 G;  2NBF A;  4HJA A;  1KHI A;  4QUC A;  1H95 A;  2AKW B;  3I73 A;  3RNU A;  1XMO Q;  2E2H B;  3NTI A;  1UWV A;  4KV6 A;  3QOL A;  2FIN B;  4BXX H;  4LF5 Q;  1GUG A;  3SE0 A;  1YI2 A;  1GJX A;  1OXS C;  1WTH A;  2RQX A;  4HJ9 A;  4NXM Q;  4JG2 A;  5M3M G;  5EKI A;  4DFA A;  1EEF D;  4HIO A;  1F2M A;  2B3G A;  2QCP X;  4BBR B;  3HOX G;  1HPC A;  2H1E A;  1KQS A;  4B3R Q;  3TBI B;  5FLX E;  2EE1 A;  2R93 G;  3OHX C;  3ZJY C;  1CKO A;  1I50 B;  1XTD A;  2K5H A;  1Y1W H;  1BQQ T;  4IUN A;  2WII B;  3BZC A;  2Q8R E;  5EQ0 A;  1V1P A;  1Q1E A;  4Y7N H;  1VQL A;  3KJP A;  3KLS X;  4G4K A;  3PIO A;  2PI2 A;  2PQA A;  3PUY A;  1DZ1 A;  1EQQ A;  4AYB B;  1XNQ L;  2D9U A;  3MFY A;  3GTM H;  4A3J H;  5C0X H;  4C3I B;  3OSO A;  3Q23 A;  4HID A;  1N36 L;  5GAD C;  1Y69 U;  4BBS B;  1RL2 A;  2WAC A;  2F0U A;  1II3 A;  2OF1 A;  4TRD A;  3LX0 A;  3A7L A;  4B08 A;  1JWS D;  4WJW A;  2E8G A;  4KJO A;  2ZJP A;  1CKN A;  1LYL A;  4TKO B;  1L1O A;  3BZK A;  4HJ8 A;  1D1K A;  1LT6 D;  1SBB B;  3OWE B;  4KTA A;  3KYH C;  5IIF A;  2F0D A;  1SFO B;  2NZ1 D;  3D8G A;  3M4Y A;  1EWI A;  3DXJ C;  1LTL A;  1V9P A;  1IKL A;  1B44 D;  3D6C A;  1EQR A;  2E2J H;  3CPW A;  4R9W A;  4DUZ L;  4R1J A;  4KI0 A;  4XYO A;  4S3S A;  4DR4 Q;  2XGT A;  1IZ6 A;  2QF7 A;  3P7J A;  3A8K E;  2NN6 I;  3U4Z A;  2XN9 C;  1CSQ A;  4KLK A;  1BF4 A;  4A3B B;  1UUP A;  3X3M A;  1HHV A;  1SNC A;  3UDI A;  2PQE A;  4L5Q A;  3ULL A;  3GTG B;  1GUT A;  4WOR A;  3WWV A;  2XVS A;  1RJT A;  5JJL A;  2AQ1 B;  3H6M A;  4GN5 A;  3HKZ B;  3T4A C;  2UXD Q;  4R4I A;  5LMU Q;  1NMF A;  3PO3 G;  1EWC A;  1ZEQ X;  1Q12 A;  3AB9 A;  4I7A A;  4DUY Q;  5IYC G;  2DY7 A;  4CDE C;  1F9R A;  4JC0 A;  4K5V A;  1LLR D;  3S2D B;  5JJZ A;  2EDG A;  4B3S Q;  1D5X C;  3R3O A;  4RHR A;  1HQR D;  2UUA L;  1BNZ A;  2IL8 A;  4GOP A;  1A0I A;  1EFW A;  3S1R H;  2JA6 G;  3DEP A;  1C8C A;  1PV4 A;  4N8X 1;  2IX3 A;  1PRT C;  3QB3 A;  1WTO A;  3IFD A;  3QG1 A;  4NXN Q;  4O42 A;  4R4T A;  1JIC A;  4A3I G;  2WFW A;  1HR0 Q;  3G71 A;  1A2T A;  1TY0 A;  1GD7 A;  3I3C A;  1XMQ L;  4X3T A;  1VQO A;  1DOM A;  3BDC A;  2JA7 H;  1VQG A;  5JOB A;  1ET6 A;  5FLM H;  1C4Q A;  3ZYY X;  1N8R C;  1LM0 A;  2F0Q A;  1HRJ A;  3HOW H;  5C44 G;  4HED A;  4A3G H;  1R9T H;  1MD2 D;  5CV6 A;  2CQO A;  3HS0 C;  4A3K B;  4OO1 G;  5L37 A;  2WV6 D;  3MHB A;  3RLN A;  3K81 C;  4OX9 Q;  4JI3 Q;  2LKV A;  3J81 L;  1CHP D;  3GV6 A;  2JA5 H;  3CCS A;  1U0L A;  3Q8D A;  4HIM A;  3K5M A;  1VQK A;  3K0X A;  3E9I A;  4PMB A;  3SK6 A;  1PFS A;  3TEH B;  4X3K A;  2PMZ E;  5IWA L;  4FF3 A;  1TWG H;  1PHJ A;  3PO2 G;  1E2W A;  3IFT A;  1IBM Q;  3Q24 A;  4BY1 B;  2YYZ A;  5EJW A;  4A3D H;  5GRO A;  4DV0 L;  1FD7 D;  4PMC A;  5CV4 A;  4CJ1 B;  4HCE A;  2YU9 H;  1TWA H;  2K7V A;  4DK1 A;  3M4P A;  1YNN D;  4A3I B;  4RCN A;  1CTM A;  1I94 L;  1Z6H A;  2XSC A;  4C3H B;  1G51 A;  4WJ4 A;  2EY1 A;  3I4N G;  2Z1C A;  1M8A A;  2BDO A;  1QNU A;  2SNS A;  2X6G A;  4MN3 A;  4OXP A;  1LAC A;  2L11 A;  3CHB D;  2I0Q A;  3HOU B;  1K8A C;  3J7A F;  4XTC S;  4LFB Q;  2N8N A;  2HD3 A;  3TQY A;  3E6Z X;  2CW0 C;  1CM9 A;  2EY5 A;  3EA6 A;  1U4R A;  1J5E Q;  5FJ8 G;  1K83 H;  4IPG A;  2F0K A;  3KLW A;  4H7B A;  1YNX A;  4JBK A;  1AEX A;  3W3A A;  4K2L A;  4JI4 L;  4UP8 A;  2RSO A;  1BBX C;  3E0E A;  2VQF Q;  4KHP L;  4HAE A;  5T1G A;  3E3X A;  1XPU A;  2KED A;  3CRL C;  5IT9 L;  1LTT D;  1DXM A;  4B3T L;  2BE5 D;  3T16 A;  3FKI B;  4LF8 L;  3OIQ A;  4JV5 L;  1Q7Y C;  2MP1 A;  5IP9 G;  1YHB A;  4DR5 L;  2NVQ B;  1EYD A;  5CMD A;  4QF4 A;  4CJ0 B;  1VS0 A;  4B3M L;  5C3E B;  2B39 A;  1KDC A;  1YJW A;  2ZJR A;  2NVY B;  4QB4 A;  2B63 G;  1XWE A;  1BOS A;  3NEL A;  1SMY D;  4OEL B;  4JI2 L;  2E2D C;  4QGU A;  4RCO A;  3EQL C;  2UUC L;  4HTH A;  3J80 E;  1EWH A;  2A69 D;  1R4P B;  1F9Q A;  5IGC A;  5E4W C;  4ME5 A;  2ID0 A;  3OMC A;  4A3E B;  4CHT B;  1GO3 E;  3W2D A;  3RMH A;  2ZXR A;  3GTP B;  2EXD A;  2K33 A;  1EFI D;  2F4I A;  3VR2 A;  2F0V A;  3H3V C;  1MBY A;  2UXB L;  3I4M B;  2PNR C;  2CVR A;  3K57 A;  1UAP A;  2A5H A;  1O80 A;  1XJV A;  4LUZ A;  1STE A;  3EIV A;  5D65 A;  2SEB D;  2K4K A;  1PZJ D;  4EQN A;  3NE5 B;  1WFQ A;  4DKA C;  3GQB A;  1Y1W B;  3H3V H;  2KQ3 A;  4DPG A;  4Y7N B;  1VQ8 A;  1FL0 A;  4EQ5 A;  1D2B A;  3VA5 A;  1VQJ A;  1JE5 A;  4KK7 A;  2LMC B;  1NTG A;  2E2H H;  4GLV B;  2O5I C;  3CRK C;  1I6V C;  4A3J B;  3D4W A;  1SYE A;  3HZX A;  1CZG A;  4PZ6 A;  1J6Q A;  2Y0S E;  1F2Y A;  1FGB D;  5FLX c;  5C0X I;  4FYD A;  5BR8 L;  4DV1 L;  2RHS B;  3RN2 A;  1FJG Q;  2AWO A;  2F52 A;  3UE1 A;  4OWT B;  4X66 L;  3CCJ A;  2L0C A;  3A56 A;  4R4C A;  1I50 H;  3MXN B;  5IGB A;  1HTL D;  1MHW C;  1CT1 D;  1G29 1;  2E2J B;  2F0J A;  4R4Q A;  1SLJ A;  1BXT A;  1ZXT A;  1SSO A;  1HH2 P;  3I70 A;  4XYQ A;  5IP7 H;  5HUR A;  3S14 B;  3D31 A;  3ND8 A;  3CCE A;  4C3J B;  4BBS H;  2ZTE A;  2K5V A;  2V4D A;  4ULL A;  1FNU A;  5K36 H;  5ELD A;  1AZP A;  5IY0 A;  2IY5 B;  2I46 A;  5M5W B;  1N32 L;  1E1O A;  1Y1V G;  3H0G G;  4WFN 3;  3IAY A;  1LV9 A;  2KCT A;  3G6E A;  2EJF C;  1G2S A;  1U9R A;  4U68 A;  5DLQ E;  1ESF A;  1SFO H;  3N6R A;  4IUU A;  1JJG A;  4DV6 L;  5CBE E;  3S15 B;  1HZC A;  3VYR A;  5M3M H;  3K80 C;  2EYL A;  4DXF A;  2Z6B A;  2HUG A;  3MAQ A;  3NEM A;  5CYU A;  2SNM A;  2PPB C;  1D5M C;  3S1R B;  3MEF A;  4AH6 A;  5LHY 1;  3GO5 A;  1VMC A;  4JI6 Q;  1PH3 A;  4P74 A;  1STN A;  4C56 C;  3J7Y W;  3GTG H;  2D2C C;  5I2X A;  4NPS A;  4IUT A;  2XRS D;  5GAG C;  5LL6 X;  5CV5 A;  3HOV G;  2ZTD A;  1XPO A;  1FNW A;  3I7F A;  1JB3 A;  1WYD A;  1PFB A;  2F0P A;  4ZKC B;  5C4X G;  4LUV A;  1HXY D;  2G9D A;  2JP1 A;  2KCM A;  1R9T B;  4IPC A;  1IYV A;  2BA1 A;  4DV7 L;  2CFM A;  2EYJ A;  1Y1V B;  4FVM A;  3MEH A;  1WTV A;  1ILQ A;  1P8L A;  4E6I A;  5JJI A;  3DLL A;  1VQH A;  1IBK Q;  1AH9 A;  1G6Z A;  1XNR L;  3Q6S A;  2Z4I A;  2K6A A;  3TSS A;  5ELN A;  2OCE A;  4JBM A;  1QWY A;  1WOC A;  5F2D A;  1ENA A;  2JA5 B;  1YNN C;  2UXC L;  5I6W A;  4HIK A;  5JJK A;  1SMX A;  1HZ9 A;  3H91 A;  3GTO H;  5IGF A;  2FXQ A;  2K5W A;  4LK1 C;  5EPK A;  1X3F A;  1OXT A;  1SYF A;  3VYU A;  1U5K A;  2RCF A;  5LL6 S;  2MO0 A;  1B70 B;  4IFD J;  2F0I A;  1Q1B A;  4IJL A;  2EOT A;  3J7A V;  1TWA B;  3SK5 A;  2WAQ B;  3T53 B;  1C0A A;  2N88 A;  5HGT A;  3FEW X;  2VNU D;  1TII D;  2Q8I B;  1KXL A;  1F77 A;  3LWE A;  4AQY L;  3PF4 A;  2EQS A;  4K0K Q;  4YHH Q;  3QWN A;  1A3V A;  4P2C B;  5IYC H;  4PNY A;  5ELF A;  4NW2 A;  1GM5 A;  5IYB H;  1SNP A;  2DNC A;  3S2H B;  3S16 B;  4ZUI A;  2BE5 C;  3PIO 3;  2UU9 Q;  5JEA G;  3C3L A;  4UPA A;  1XMO L;  4XQQ A;  2JA6 H;  1AFP A;  1I3Q B;  3OTO Q;  2OEO A;  1F2L A;  1NUC A;  1AZQ A;  2WIN B;  3R8B A;  2F0G A;  4OL7 A;  2ZM6 Q;  2AUK A;  4A3I H;  2NVX B;  1B2T A;  4L6T B;  2M9V A;  2MFI A;  1LO5 D;  2R7Z G;  1DON A;  2PMZ B;  2F0S A;  1SMY C;  4LF9 Q;  4V0B A;  5CBA E;  4B3R L;  3CKI B;  2SDF A;  2NYZ D;  3MWY W;  4H13 C;  2JQO A;  2HT1 A;  1SR3 A;  1GVP A;  1BBU A;  1IW7 D;  2VUM B;  2A69 C;  2EY2 A;  5C44 H;  3W1G A;  4BWG B;  2J4X A;  1EQT A;  1AW7 A;  1SYB A;  3B6Y A;  3T56 B;  3J80 L;  1YZ6 A;  4LF7 Q;  1UNS A;  3HOU H;  1RTO A;  4PG3 A;  1WTQ A;  2EYH A;  1LUZ A;  2DJG C;  2YTY A;  2QIL A;  4JBW A;  2PCF B;  3T51 B;  4RGM A;  4FO2 A;  1HZB A;  1SEB D;  1I6H B;  3AFP A;  3KDF A;  5FO8 B;  1HR0 W;  1F2Z A;  3FKI H;  3TZU A;  4LF4 Q;  1K8O A;  1IBL Q;  4KY7 A;  2IT1 A;  4GZY C;  4B9X A;  1PH2 A;  4X65 L;  1EYG A;  1SNQ A;  1PFM A;  3CCR A;  1G6P A;  1DGS A;  4RA8 A;  2HCC A;  2H5X A;  3A7A B;  2NVT H;  4A3F G;  1RIP A;  4DR4 L;  1PTO F;  4BY7 G;  1WCM G;  4DR7 Q;  5COR A;  3F2U A;  3DMU A;  1NY4 A;  5D3D A;  3V2T A;  1N34 L;  1FVI A;  4JI1 Q;  1HQM C;  2WB1 B;  1LT3 D;  2OWO A;  4MHE A;  4A3E H;  3GTL H;  2XRQ D;  1HJP A;  1V43 A;  3GTP H;  1RD9 D;  4ZKB B;  4FP5 D;  3S17 B;  4DR3 L;  3H3V I;  4K6D A;  4LJZ C;  2EY6 A;  1LTG D;  3PUZ A;  3SDZ A;  2Y0S G;  4YY3 L;  3MXG A;  4KN4 C;  1XYI A;  2IX1 A;  2KHJ A;  2RF4 A;  2UUB Q;  3I4M H;  4G7H C;  2EPB A;  4RAU C;  3QR8 A;  2XIW A;  3KBX A;  1ASZ A;  1YIT A;  1S72 A;  4CJ2 C;  3ULJ A;  3L9A X;  4KHZ A;  4A75 A;  5CV9 A;  3H94 A;  4A93 B;  2DUD A;  3E5S A;  4KKS A;  1PVO A;  3C1E A;  3ND9 A;  4ZK9 B;  2B63 H;  3M85 A;  5M3F B;  2E74 C;  2F3W A;  3PGZ A;  2FJ2 A;  5CV8 A;  4Q5V A;  1KLG D;  4YWM A;  2NN6 G;  1EQV A;  2VZA A;  3HEJ A;  1IHZ A;  1GHJ A;  2D0P A;  2JA8 B;  1JWU D;  2F0E A;  1A3T A;  4R8N A;  2EYM A;  4JI8 L;  3JAM E;  3D4D A;  4DV5 L;  3U58 A;  5KEE A;  5IGE A;  1Q46 A;  1L2F A;  1Y14 B;  3ULP A;  4G57 A;  3KLR A;  4GN3 B;  1K73 C;  3W5O A;  2JK8 A;  3TRE A;  2H4O A;  2LXJ A;  2L15 A;  5LMN Q;  1HNX Q;  4DV2 L;  5M3M B;  1ASY A;  2HDM A;  1BR9 A;  2AQ2 B;  4MTK A;  1BO0 A;  4EVO A;  1IBM L;  3CCM A;  3HOX B;  2Q2T A;  4EQO A;  2C35 B;  2MGS A;  4OWW B;  5JVG 3;  4APV A;  3S14 H;  2D5D A;  3UI2 A;  2R93 B;  4C3J H;  5IOC A;  4LF6 L;  4UP9 A;  2Q8T A;  2K50 A;  3L0O A;  4X62 Q;  2R92 G;  3CCU A;  2M00 A;  1B3Q A;  1CQF A;  5M5W H;  2CHB D;  1QG7 A;  2LSS A;  2EVB A;  1AN8 A;  2K5Q A;  4HN7 A;  1GOZ A;  1STB A;  1KIX A;  1MKH A;  3FP9 A;  3HGB A;  1UE1 A;  1YHQ A;  2B2W C;  2B29 A;  3MTS A;  4I65 A;  2KJX A;  3J81 j;  2F0N A;  2B2T C;  2VQE Q;  1MJC A;  3S15 H;  3GTQ B;  5TSS A;  1HZA A;  1S5C D;  3C1F A;  3P20 A;  4DR2 Q;  4A4I A;  4PZ8 A;  5FKA C;  2B2V C;  4DNR B;  1VQB A;  2OXP A;  2WKC A;  3R2T A;  3K59 A;  4DV3 L;  2JXM B;  4ILW A;  1H9R A;  3A54 A;  4KHV A;  3OMG A;  2FFK B;  1KAW A;  2ZTC A;  3GTO B;  3M7N A;  3AQQ A;  2N49 A;  3GDE A;  4X3U A;  4RGN A;  3TS0 A;  5I2Y A;  4DR6 L;  2KEC A;  4OGQ C;  3TP5 A;  1QNK A;  3HOZ G;  2J7Z A;  1ENF A;  5BN5 A;  2O2L D;  2F0H A;  3QJY A;  4CKC A;  1Y1V H;  2MUY A;  4J1M A;  1SE8 A;  4JI5 L;  1MI2 A;  1NSN S;  4IAL A;  3CMA A;  2RA4 A;  3TS2 A;  1LT5 D;  3PO3 B;  1Q8I A;  1XNQ Q;  5AJ3 Q;  3A5Z B;  5COY A;  3H09 A;  4PZ7 A;  3PQI A;  5A2Q L;  4XQN A;  3ERO A;  4JI0 L;  5E4X A;  4TVA B;  1LTS D;  2I5L X;  1N36 Q;  3LGJ A;  5EGT A;  1STA A;  3S1M B;  1VQC A;  3J81 i;  1DYQ A;  4MTN A;  3NSW A;  3KF6 B;  1A2U A;  2JA6 B;  4F7X A;  2HHH L;  1YNJ D;  1Y8O B;  1VQD A;  3K8A A;  1A63 A;  5KIX A;  4A3M G;  3R2I A;  3CC2 A;  4UHV A;  1ENC A;  1QUQ B;  4X3S A;  1HNW Q;  3G7L A;  1JCK B;  4DAY B;  4XT3 B;  1GKH A;  5EPJ A;  4OON A;  5C44 B;  3IRB A;  3F8T A;  5ELE A;  2PNH A;  1QUQ A;  3G6J B;  3S2H H;  3S16 H;  2QEJ C;  3U4V A;  2L55 A;  4DAY A;  3T1Y L;  1BCP F;  4PQX A;  1I3Q H;  4IFD H;  1X3Q A;  3EFX D;  5C5M A;  3OWF A;  3ER0 A;  4ODG A;  1HNZ L;  4IUV A;  3T1H L;  1PH8 A;  5EKK A;  4JK1 C;  3HOY G;  2NVX H;  1CA6 A;  2GVB A;  2E5L L;  4ZLT F;  5E7N A;  1I4G A;  3STB C;  1FJG L;  2WKD A;  4M8A A;  5ISR A;  3PO2 B;  3NBH B;  5H1S E;  1EY4 A;  2KCN A;  5DAU A;  2KOL A;  3I55 A;  4OEM B;  4Q0F A;  2VUM H;  4WJ3 M;  1UEA B;  2L4N A;  5C5L A;  3FRP B;  4HJ7 A;  1UE7 A;  3NBH A;  1J9O A;  1U4L A;  1M1K C;  1N33 L;  5IGD A;  5CC4 A;  4GLX A;  4BXX G;  3AEV A;  2NVT B;  1LTR D;  3I4N B;  4LAA A;  4LUO A;  3GD7 A;  3QIA A; 
#chains in the Genus database with same CATH homology
 2HDL A;  5G3L F;  4CKE A;  2K04 A;  4ZUJ A;  3I91 A;  3T13 A;  4EQP A;  4U67 3;  1O7Z A;  5JEA H;  2LFN A;  4KN7 C;  3GTL B;  1Q90 A;  1VF7 A;  1E0B A;  3S9W A;  1QOH A;  1SE2 A;  5C4Z A;  2A6H D;  1STY A;  5C0X G;  5FLX L;  2BA0 A;  2L12 A;  4DF7 A;  3HG9 A;  1TU2 B;  3SEB A;  4ID6 A;  5CV7 A;  3WDN A;  3MXU A;  4IUP A;  3RD4 A;  1Q3L A;  3BDO A;  1VCI A;  3SK8 A;  2B8F A;  2F0O A;  2EXZ A;  1EYA A;  1S5E D;  5CGK A;  5DM7 3;  2JSO A;  2B63 B;  3K5L A;  1BCP D;  2NB0 A;  1DM0 B;  1O78 A;  1W6K A;  2NUC A;  4QUF A;  5FO9 B;  2RDF A;  1NR4 A;  3C46 A;  3MA2 B;  2ZXO A;  1GUN A;  3DWA A;  2C9O A;  1KNE A;  4QMG A;  2DN8 A;  5JPN C;  2E2I B;  3IKJ A;  3NQI A;  4TQU S;  2O5J C;  3D4R A;  3BYY B;  1AP0 A;  4RGO S;  2K5D A;  1FYC A;  4WRD A;  1DCZ A;  2C5C A;  4FXK C;  5D14 A;  3U9S A;  2QDB A;  5KNC A;  3MXN A;  4RH6 A;  1SYC A;  5KYL A;  2X6L A;  3N52 A;  3QO2 A;  4IUQ A;  1FNV A;  4FXG C;  4K8J A;  5J39 A;  3M3Y B;  1H9M A;  2K03 A;  5J22 A;  1QE6 A;  2R6G A;  4KKU A;  4ZRZ A;  3FPU B;  4BS9 A;  1CFM A;  3DWQ A;  1SAP A;  1L0Y B;  1JR0 D;  5KYI A;  5NUC A;  2L5T A;  2VB3 X;  5JPM C;  2G9H D;  3S1Q B;  2F03 A;  4RWS C;  1HA5 A;  2IJ0 A;  1D6E C;  3A8J E;  1B9N A;  4HR7 B;  3D3R A;  1T5X D;  1STG A;  3M4O B;  2B2W A;  4L63 B;  2B2T A;  1ML0 D;  2O4X A;  3NTK A;  1H9S B;  2JEB I;  1DD2 A;  1B4O A;  3K7A B;  3VR3 A;  3H0G B;  2RKS A;  4V19 0;  2B2U C;  2B2V A;  1EY9 A;  1YNJ C;  5C4H A;  1HFG A;  3BVG A;  1MSG A;  1ZKO A;  1WTW A;  1XX8 A;  1NCV A;  3VR6 A;  4K5X A;  3CQZ B;  1CA5 A;  2E76 C;  4PMW A;  2TMP A;  5EKL A;  3MZ5 A;  2B8G A;  3S1N B;  5AFW A;  1TS4 A;  1SNM A;  1EOT A;  1JOO A;  1WD1 A;  1KLU D;  3HOV B;  1GUW A;  3I8Z A;  2M2L A;  2NTS A;  5C4X B;  3NWS A;  3DM1 A;  1KTK A;  1Y8N B;  1U4M A;  5KND A;  3V96 A;  1JOK A;  4N9T A;  2K01 A;  3TN2 A;  5J1Z A;  1KDA A;  4ABN A;  3DHQ A;  1FR3 A;  2DY8 A;  4IUR A;  3NTH A;  1OXV A;  1EY5 A;  1OXX K;  4IFD I;  1V8Q A;  1B53 A;  4B9W A;  5JEA J;  3J81 E;  3A8I E;  3C2P A;  1TKW B;  2X69 A;  2BDN A;  1TR5 A;  4OO1 H;  4O1N A;  1JC7 A;  1QB5 D;  2I07 B;  5DEH A;  4HMJ A;  2A68 D;  3CU7 A;  3L3O C;  1ZYR D;  4DGZ A;  1SDF A;  1TQO A;  4Z9C B;  1O7Y A;  1WD0 A;  1LTB D;  4R8I A;  5E3F A;  4EGV A;  2A6H C;  2KHS A;  4DNT B;  3KBG A;  5DNF A;  3TP7 A;  1JOQ A;  2ICE C;  1DJR D;  1CI3 M;  5FK9 C;  1MSH A;  4RHS A;  2F0T A;  4G7O C;  3ITP A;  1S5D D;  5I9P A;  1KAB A;  2R7Z B;  2D62 A;  3HRZ C;  5I9O A;  1PXU A;  1ICW A;  2FMC A;  2RBM A;  1RCV D;  4NDX A;  1TS5 A;  2PZU A;  3EJI A;  2K32 A;  1GUO A;  1KAA A;  4DK0 A;  2BCO A;  1JWM D;  4KY5 A;  1KDB A;  4MIU A;  5KRU A;  2VXW A;  4KD4 A;  4FF2 A;  3BVM A;  1I4X A;  1TWF B;  1S5F D;  4NP5 A;  3A55 A;  1EEI D;  2OT2 A;  5ELB A;  4C3I G;  5IOD A;  2K1B A;  2MJ8 A;  2PZT A;  2VB2 X;  2FMM A;  2EJM A;  5K36 G;  1I4R A;  2HQE A;  5ELC A;  3GTK B;  2RDH A;  1I4Q A;  1R4Q B;  1EZ8 A;  1XXG A;  1NR2 A;  3SR1 A;  4A3F B;  4K2K A;  3L7Z C;  3D6W A;  4ZAI A;  4BY7 B;  4QIW B;  1WCM B;  3O13 A;  4KKT A;  2IPK D;  5IGG A;  5C4J B;  3RZD B;  1XTC D;  1PTO B;  1MGS A;  4RGT A;  2B2Y C;  1LTI D;  1PDQ A;  1V1P B;  3OIP A;  5M5Y B;  5M9O A;  3TDQ A;  1TS2 A;  4IQZ A;  5I4D A;  1W6J A;  3FDT A;  2MPM A;  1HCZ A;  1B1Z A;  1TVX A;  3EVQ A;  1H9J A;  2KA7 A;  2Y0S B;  1TT2 A;  1LT4 D;  2E75 C;  3E0J A;  2L9H A;  4DU9 A;  1SJE D;  3TP8 A;  1PTO D;  1SE3 A;  1TWH B;  3OW7 A;  3RZO B;  4KD3 A;  2PO4 A;  3I90 A;  3VA7 A;  1SYG A;  1SYD A;  3NPP A;  1CQV A;  1EL0 A;  5M5X B;  1F9P A;  3NBI A;  2NWG A;  3K5N A;  1RDP D;  1RHP A;  5CR3 A;  1PFN A;  1OO9 B;  5FO7 B;  2F3V A;  2AWN A;  1HFN A;  2PW7 A;  2F0W A;  1Y8P B;  4K14 A;  3MC0 B;  3PIP 3;  1HTP A;  3DWP A;  4XQJ A;  4HSP A;  1PLF A;  5D3I B;  4NMZ A;  3NXW A;  4I7Z C;  1CHQ D;  3BG3 A;  2ZXP A;  2NTT A;  3DEO A;  4KY6 A;  4C1N I;  4CKB A;  1C48 A;  4IN3 A;  2R92 B;  3MFG A;  5C3W A;  1GUS A;  1M4V A;  2B2U A;  1DOL A;  3NUC A;  4C3H G;  1RKN A;  2F1M A;  1LAB A;  4FF1 A;  3BZD B;  2TSS A;  2IWH A;  4F88 A;  1I4H A;  1ILP A;  1IW7 C;  2R3Z A;  3TP6 A;  3AU7 A;  2Z4H A;  1TWC B;  2PW5 A;  3WOE A;  2A68 C;  3GP7 A;  2A73 B;  1ZYR C;  3PMF A;  4XDX A;  3HOZ B;  5BN3 A;  4N9P A;  3BYT B;  1H9K A;  1SND A;  4KMU C;  3KK7 A;  1ROD A;  2F0F A;  1J8I A;  4H44 C;  4J8Q A;  4DAV A;  1WTX A;  2A74 C;  4OO1 I;  2A6E D;  4XT1 B;  1WVL A;  4YIJ A;  2KCC A;  1A15 A;  1EYC A;  1RTN A;  5C6A A;  3WOF A;  2LS0 1;  5JVH 3;  3OOC A;  4TSS A;  1PYW D;  4K8I A;  1VF5 C;  4CGY B;  4A3M B;  1G2T A;  3SVM A;  3NK9 A;  2JE6 I;  1EY6 A;  1PZK D;  3I72 A;  1NAP A;  4H0L C;  3V05 A;  1O7L A;  1JOR A;  3BS1 A;  4KJN A;  3VR5 A;  3NQT A;  1RF2 D;  3GTJ B;  1BCP B;  3R93 A;  5T1I A;  2LY7 A;  4K6L A;  2XNA C;  1SJH D;  3HOY B;  2AQ3 B;  2EJG C;  5EPL A;  3PUX A;  3BVZ A;  1GXD C;  1S5B D;  1EIG A;  1EY7 A;  5FOB B;  3TZD A;  5C0X J;  1IKM A;  1QJO A;  3M7G A;  3NP8 A;  1TY2 A;  1U4P A;  3LWU A;  1PZI D;  2N55 A;  2F0M A;  2PZW A;  3JAM L;  2K28 A;  5DM6 3;  4BA2 I;  3K5O A;  2BOS A;  2KEE A;  4RKB A;  4C1N K;  4C3J G;  1PTO C;  3GV3 A;  4FNF A;  4DXG A;  4LMQ D;  1E2Z A;  1EU3 A;  1EY8 A;  3SHL A;  1A6X A;  3GTM B;  4M1U B;  1S4Z A;  3MVV A;  1PMR A;  1X3P A;  3X3N A;  1JQY D;  1OXU A;  5EBC A;  1VDZ A;  2XWJ B;  3KLS A;  2EYO A;  3FPP A;  5G3L D;  1PTO H;  1STH A;  2EZV A;  1WTP A;  2B2Y A;  1ONL A;  1Z47 A;  3K6O A;  4J6H A;  3ERQ A;  4G7Z C;  4OHJ A;  3BDL A;  1TS3 A;  3K0Y A;  1DOK A;  2RVL A;  2L1B A;  1B50 A;  1SXT A;  2MHV A;  2EYF A;  2ENB A;  4DN4 M;  1PRT F;  3PUV A;  3VYT A;  1D1I A;  5EBD A;  2JEA I;  4OIJ A;  1HA6 A;  4L8J A;  3PUW A;  2ZT9 C;  3RLF A;  2HCI A;  4ZQ3 A;  4FXD A;  3NHH A;  1B9M A;  1JE4 A;  1EIH A;  4XXE A;  2WP8 J;  2NN6 H;  5I6Y A;  3HP3 A;  2KVM A;  2RDG A;  4F8M A;  4CBV A;  2ICI A;  2JYO A;  1CK1 A;  2CQA A;  3SXH A;  4HSV A;  1WTR A;  2JA7 B;  1GHK A;  4DA2 A;  1H9S A;  4FF4 A;  3TME A;  1ESR A;  2J0T D;  5C3X A;  1X32 A;  1KNA A;  3HOW B;  1HUN A;  3ONA B;  3QOJ A;  4A3G B;  1EY0 A;  1PRT B;  4HCS A;  1SNO A;  3AMU A;  4IFD G;  1CZW A;  3DUZ A;  4RKL A;  2AUJ D;  3Q22 A;  4DAP A;  2IX0 A;  2Z8L A;  2A6E C;  4XIG S;  4NKL A;  2GA4 B;  1TWG B;  4A3D B;  1EU4 A;  3FVQ A;  1BUV T;  1PRT D;  3URY A;  2YU9 B;  2DNE A;  2RSN A;  3FMC A;  2XWB B;  3NWT A;  4PV1 C;  1IYU A;  3VYS A;  3Q0A A;  4IZ8 A;  2R61 A;  3P1H A;  4RFB A;  4K5W A;  1L0X B;  3K58 A;  1B3A A;  4OIK A;  1K83 B;  1LTA D;  1QCB D;  5A2Q E;  2IW3 A;  3KUP A;  2FHT A;  3SK4 A;  3KF8 A;  1I4P A;  4BA1 I;  2SOB A;  1IL8 A;  4UDU C;  1D5Z C;  4HMI A;  3U9O A;  3P75 A;  3IL8 A;  5KGU A;  5BN4 A;  2KUM A;  1T5E A;  2K05 A;  5K5P A;  4QCL A;  1A3U A;  1BCP C;  4C2M B;  2EYP A;  2QKI C;  4ZYS A;  3LNN A;  2CW0 D;  1V1O A;  4UAI A;  4F87 A;  5IT9 E;  1VMP A;  5KNB A;  1F9S A;  1EZ6 A;  2PYK A;  3RUZ A;  1ET9 A;  3OPO A;  5JAV A;  1HUM A;  1QIL A;  1K8M A;  1SE4 A;  2F0L A;  3MXP A;  5E1F A;  1BDO A;  1E2V A;  1Z7T A;  3I4L A;  5A35 A;  1G8Z D;  3PV0 A;  3VR4 A;  1G91 A;  2NBF A;  4QUC A;  3I73 A;  2E2H B;  3NTI A;  4KV6 A;  3QOL A;  2FIN B;  1GUG A;  3SE0 A;  1GJX A;  1OXS C;  2RQX A;  5EKI A;  4DFA A;  1EEF D;  1F2M A;  2QCP X;  4BBR B;  1HPC A;  2H1E A;  3TBI B;  5FLX E;  2EE1 A;  3OHX C;  1I50 B;  1BQQ T;  4IUN A;  2WII B;  2Q8R E;  5EQ0 A;  1V1P A;  1Q1E A;  3KLS X;  4G4K A;  3PUY A;  1DZ1 A;  4AYB B;  2D9U A;  3MFY A;  5C0X H;  4C3I B;  3OSO A;  3Q23 A;  1Y69 U;  4BBS B;  2WAC A;  2F0U A;  1II3 A;  2OF1 A;  4TRD A;  3LX0 A;  3A7L A;  4B08 A;  1JWS D;  4WJW A;  4KJO A;  4TKO B;  1D1K A;  1LT6 D;  1SBB B;  3OWE B;  4KTA A;  5IIF A;  2F0D A;  1SFO B;  2NZ1 D;  3D8G A;  3M4Y A;  3DXJ C;  3D6C A;  1IKL A;  1B44 D;  4R9W A;  4KI0 A;  4XYO A;  4S3S A;  2QF7 A;  3P7J A;  3A8K E;  2NN6 I;  2XN9 C;  4A3B B;  1BF4 A;  1UUP A;  3X3M A;  1HHV A;  1SNC A;  2PQE A;  3GTG B;  1GUT A;  4WOR A;  2XVS A;  1RJT A;  2AQ1 B;  3H6M A;  3HKZ B;  3T4A C;  1EWC A;  1ZEQ X;  1Q12 A;  3AB9 A;  2DY7 A;  1F9R A;  4K5V A;  1LLR D;  3S2D B;  5JJZ A;  2EDG A;  1D5X C;  3R3O A;  4RHR A;  1HQR D;  1BNZ A;  2IL8 A;  3DEP A;  1C8C A;  2IX3 A;  1PRT C;  3QB3 A;  1WTO A;  3IFD A;  3QG1 A;  4O42 A;  1JIC A;  1A2T A;  1TY0 A;  3I3C A;  4X3T A;  1DOM A;  3BDC A;  5JOB A;  1ET6 A;  1C4Q A;  3ZYY X;  2F0Q A;  1HRJ A;  4HED A;  1MD2 D;  5CV6 A;  3HS0 C;  4A3K B;  4OO1 G;  2WV6 D;  3MHB A;  2LKV A;  3J81 L;  1CHP D;  3GV6 A;  3K5M A;  4PMB A;  3SK6 A;  4X3K A;  4FF3 A;  1E2W A;  3IFT A;  3Q24 A;  4BY1 B;  2YYZ A;  5EJW A;  1FD7 D;  4PMC A;  4CJ1 B;  5CV4 A;  4HCE A;  4DK1 A;  2K7V A;  4A3I B;  1YNN D;  4RCN A;  1CTM A;  1Z6H A;  2XSC A;  4C3H B;  2EY1 A;  2Z1C A;  1M8A A;  2BDO A;  1QNU A;  2SNS A;  2X6G A;  4MN3 A;  1LAC A;  2L11 A;  3CHB D;  3HOU B;  3J7A F;  4XTC S;  3E6Z X;  2CW0 C;  1CM9 A;  2EY5 A;  3EA6 A;  1U4R A;  2F0K A;  4H7B A;  1AEX A;  3W3A A;  4K2L A;  2RSO A;  1BBX C;  4HAE A;  5T1G A;  2KED A;  3CRL C;  5IT9 L;  1LTT D;  1DXM A;  2BE5 D;  3T16 A;  3FKI B;  3OIQ A;  2MP1 A;  2NVQ B;  1EYD A;  5CMD A;  4QF4 A;  4CJ0 B;  5C3E B;  2B39 A;  1KDC A;  2NVY B;  4QB4 A;  1XWE A;  1BOS A;  1SMY D;  2E2D C;  4RCO A;  3EQL C;  4HTH A;  3J80 E;  1EWH A;  2A69 D;  1R4P B;  1F9Q A;  5IGC A;  5E4W C;  4ME5 A;  2ID0 A;  3OMC A;  4A3E B;  4CHT B;  3W2D A;  3RMH A;  2ZXR A;  3GTP B;  2K33 A;  1EFI D;  2F4I A;  3VR2 A;  2F0V A;  3H3V C;  1MBY A;  3I4M B;  2PNR C;  2CVR A;  3K57 A;  1UAP A;  2A5H A;  1O80 A;  1STE A;  5D65 A;  2SEB D;  1PZJ D;  4EQN A;  3NE5 B;  3GQB A;  1Y1W B;  2KQ3 A;  4Y7N B;  1D2B A;  3VA5 A;  4KK7 A;  2LMC B;  2O5I C;  3CRK C;  1I6V C;  4A3J B;  3D4W A;  1SYE A;  3HZX A;  1CZG A;  1F2Y A;  1FGB D;  5C0X I;  4FYD A;  2AWO A;  2L0C A;  3A56 A;  5IGB A;  1HTL D;  1CT1 D;  1G29 1;  2E2J B;  2F0J A;  1BXT A;  1ZXT A;  1SSO A;  3I70 A;  4XYQ A;  5HUR A;  3S14 B;  3D31 A;  3ND8 A;  4C3J B;  2V4D A;  4ULL A;  1FNU A;  5K36 H;  5ELD A;  1AZP A;  2I46 A;  5M5W B;  4WFN 3;  3IAY A;  1LV9 A;  2EJF C;  1G2S A;  1U9R A;  4U68 A;  1ESF A;  3N6R A;  4IUU A;  5CBE E;  3S15 B;  3VYR A;  2EYL A;  4DXF A;  2HUG A;  3MAQ A;  5CYU A;  2SNM A;  2PPB C;  1D5M C;  3S1R B;  5LHY 1;  3GO5 A;  1VMC A;  1STN A;  4C56 C;  3J7Y W;  2D2C C;  5I2X A;  4IUT A;  2XRS D;  5LL6 X;  5CV5 A;  1FNW A;  1JB3 A;  2F0P A;  1PFB A;  4ZKC B;  1HXY D;  2G9D A;  2JP1 A;  1R9T B;  1IYV A;  2BA1 A;  2EYJ A;  1Y1V B;  4FVM A;  3MEH A;  1WTV A;  1ILQ A;  4E6I A;  1G6Z A;  3Q6S A;  2Z4I A;  2K6A A;  3TSS A;  1QWY A;  5F2D A;  1ENA A;  2JA5 B;  1YNN C;  5I6W A;  3H91 A;  5IGF A;  2K5W A;  4LK1 C;  5EPK A;  1OXT A;  1SYF A;  3VYU A;  5LL6 S;  4IFD J;  2F0I A;  1Q1B A;  2EOT A;  3J7A V;  1TWA B;  3SK5 A;  2WAQ B;  3T53 B;  2N88 A;  5HGT A;  3FEW X;  2VNU D;  1TII D;  2Q8I B;  1F77 A;  3LWE A;  3QWN A;  1A3V A;  4P2C B;  4PNY A;  5ELF A;  4NW2 A;  1SNP A;  2DNC A;  3S2H B;  3S16 B;  4ZUI A;  2BE5 C;  3PIO 3;  5JEA G;  3C3L A;  4XQQ A;  1AFP A;  1I3Q B;  2OEO A;  1F2L A;  1NUC A;  1AZQ A;  2WIN B;  3R8B A;  2F0G A;  4OL7 A;  2AUK A;  2NVX B;  1B2T A;  4L6T B;  2M9V A;  1LO5 D;  1DON A;  2PMZ B;  2F0S A;  1SMY C;  4V0B A;  5CBA E;  3CKI B;  2SDF A;  2NYZ D;  3MWY W;  4H13 C;  1IW7 D;  2VUM B;  2A69 C;  2EY2 A;  4BWG B;  2J4X A;  1EQT A;  1AW7 A;  1SYB A;  3T56 B;  3J80 L;  1UNS A;  1RTO A;  1WTQ A;  2EYH A;  2QIL A;  4JBW A;  2PCF B;  3T51 B;  4RGM A;  4FO2 A;  1SEB D;  1I6H B;  5FO8 B;  1F2Z A;  3TZU A;  1K8O A;  4KY7 A;  2IT1 A;  4GZY C;  4B9X A;  1SNQ A;  1PFM A;  4RA8 A;  2HCC A;  3A7A B;  1PTO F;  5COR A;  3F2U A;  3DMU A;  5D3D A;  3V2T A;  1HQM C;  2WB1 B;  1LT3 D;  4MHE A;  2XRQ D;  1V43 A;  1RD9 D;  4ZKB B;  4FP5 D;  3S17 B;  4K6D A;  4LJZ C;  2EY6 A;  1LTG D;  3PUZ A;  3SDZ A;  2IX1 A;  3MXG A;  4KN4 C;  1XYI A;  4G7H C;  2EPB A;  4RAU C;  2XIW A;  3KBX A;  4CJ2 C;  3L9A X;  4KHZ A;  5CV9 A;  3H94 A;  4A93 B;  3E5S A;  4KKS A;  3C1E A;  3ND9 A;  4ZK9 B;  3M85 A;  5M3F B;  2E74 C;  2F3W A;  2FJ2 A;  5CV8 A;  4Q5V A;  1KLG D;  2NN6 G;  1EQV A;  3HEJ A;  1IHZ A;  1GHJ A;  2JA8 B;  1JWU D;  2F0E A;  1A3T A;  4R8N A;  2EYM A;  3JAM E;  3D4D A;  5KEE A;  5IGE A;  4G57 A;  3KLR A;  2H4O A;  5M3M B;  2HDM A;  1BR9 A;  2AQ2 B;  1BO0 A;  4EVO A;  3HOX B;  4EQO A;  2MGS A;  5JVG 3;  2D5D A;  3UI2 A;  2R93 B;  5IOC A;  2Q8T A;  2M00 A;  1CQF A;  2CHB D;  1QG7 A;  2EVB A;  1AN8 A;  2K5Q A;  4HN7 A;  1GOZ A;  1STB A;  3HGB A;  2B2W C;  3MTS A;  4I65 A;  2KJX A;  2F0N A;  2B2T C;  3GTQ B;  5TSS A;  1S5C D;  3C1F A;  3P20 A;  5FKA C;  2B2V C;  4DNR B;  2OXP A;  2WKC A;  3R2T A;  3K59 A;  2JXM B;  4ILW A;  1H9R A;  3A54 A;  4KHV A;  3OMG A;  2FFK B;  3GTO B;  3M7N A;  4X3U A;  4RGN A;  5I2Y A;  2KEC A;  4OGQ C;  3TP5 A;  1QNK A;  2J7Z A;  1ENF A;  5BN5 A;  2O2L D;  2F0H A;  3QJY A;  4CKC A;  2MUY A;  4J1M A;  1MI2 A;  1NSN S;  4IAL A;  2RA4 A;  1LT5 D;  3PO3 B;  1Q8I A;  5COY A;  3H09 A;  5A2Q L;  4XQN A;  3ERO A;  5E4X A;  1LTS D;  5EGT A;  3S1M B;  1STA A;  1DYQ A;  3NSW A;  1A2U A;  2JA6 B;  4F7X A;  1YNJ D;  1Y8O B;  5KIX A;  3R2I A;  1ENC A;  4X3S A;  3G7L A;  1JCK B;  4XT3 B;  5EPJ A;  5C44 B;  5ELE A;  3G6J B;  2QEJ C;  2L55 A;  4DAY A;  1BCP F;  4PQX A;  4IFD H;  1X3Q A;  3EFX D;  5C5M A;  3OWF A;  4ODG A;  4IUV A;  5EKK A;  4JK1 C;  1CA6 A;  4ZLT F;  1I4G A;  2WKD A;  4M8A A;  5ISR A;  3PO2 B;  1EY4 A;  2KCN A;  5DAU A;  2KOL A;  4Q0F A;  1UEA B;  2L4N A;  5C5L A;  3FRP B;  3NBH A;  1J9O A;  1U4L A;  5IGD A;  5CC4 A;  2NVT B;  1LTR D;  3I4N B;  4LAA A;  3GD7 A;  3QIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...