3N52A

Crystal structure analysis of mip2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
SELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-X-C motif chemokine 2
publication title A Model of GAG/MIP-2/CXCR2 Interfaces and Its Functional Effects.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3n52A00
2L1BA 5CORA 2B2WC 2B2UA 1KNEA 1HFGA 5AFWA 5T1GA 5EKIA 2KECA 3F2UA 2FFKB 2NYZD 1WTXA 1F2LA 4MHEA 1AZQA 2B2TC 5EPLA 2H1EA 1XYIA 1RJTA 4ZKCB 5EPJA 2Q8TA 2MJ8A 1TVXA 2N88A 5CBEE 5JJZA 2RSNA 1NAPA 1EL0A 1RTOA 3QO2A 3P7JA 4ZLTF 1HRJA 1JICA 1G2SA 3HP3A 1PDQA 2R3ZA 1DOKA 1KNAA 2K01A 1PFNA 2Q8RE 2X6LA 3MWYW 2MGSA 1X3PA 4O42A 1JE4A 2VXWA 1U4RA 2X6GA 4RAUC 2IL8A 1WTVA 1CA6A 4X3TA 1EIGA 1NCVA 4X3UA 4IUVA 1ML0D 3DEPA 2KOLA 3KBXA 1X32A 2FHTA 2KVMA 1WD0A 2FMMA 2HCIA 1BBXC 2EE1A 4XDXA 2CVRA 1BF4A 2SDFA 4R9WA 4X3SA 5E4XA 4IUUA 1ICWA 1U4LA 2HUGA 2FINB 2XIWA 4UAIA 1A15A 2B2VC 1MGSA 1O80A 2HDMA 3I8ZA 2M2LA 4OIJA 1GUWA 1IKMA 3SVMA 1HA6A 2D9UA 1AP0A 1QNKA 2JYOA 3TZDA 4DN4M 3ONAB 1IL8A 4HAEA 1HHVA 1DOMA 3G7LA 2K28A 2KUMA 4ZAIA 2KEEA 2B2YA 4ZK9B 3I91A 2RSOA 5D65A 4U68A 1MSHA 2B2UC 4IURA 5EQ0A 1PFMA 1PLFA 3FDTA 5DNFA 3R93A 4R8IA 1J8IA 3IFDA 3Q6SA 1X3QA 2K04A 3DEOA 4X3KA 2EPBA 4CJ2C 4XT3B 1O7YA 1WTOA 1ZXTA 1EQTA 2NZ1D 3IL8A 3MTSA 1E0BA 3D6WA 1O7ZA 5E4WC 2L12A 3UI2A 1DZ1A 2B2WA 1DONA 1RHPA 4ZKBB 2B2YC 3I90A 1WD1A 1NR2A 1VMCA 2MP1A 2DY8A 1NR4A 2K03A 2RVLA 1AZPA 1MI2A 1QE6A 1SAPA 1CM9A 3TN2A 3H91A 4IUQA 1F9SA 1U4MA 5CBAE 2RA4A 4HSVA 1HUMA 1F9PA 4NW2A 3DM1A 4HCSA 4LMQD 1SSOA 1ESRA 3N52A 4QUFA 1Q3LA 1SDFA 2HDLA 2K1BA 2L9HA 2NWGA 1RODA 1PFBA 4HEDA 1BO0A 1WTQA 2K05A 4RWSC 1F9QA 2HCCA 2X69A 1G91A 1B3AA 1B53A 2MPMA 4IUPA 3KUPA 4MN3A 5EPKA 1B50A 1WTRA 4CJ1B 4QUCA 2L11A 1EIHA 1CA5A 2BDNA 1IKLA 2DY7A 1MSGA 5EJWA 1HUNA 1EOTA 4IUTA 5COYA 4XT1B 1J9OA 1U4PA 3I3CA 1WTWA 1WTPA 1G2TA 1DOLA 3GV6A 5T1IA 5CMDA 3GV3A 2B2VA 2EOTA 2B2TA 4RA8A 1C8CA 1BNZA 2J7ZA 1QG7A 2L4NA 1XX8A 1G6ZA 1RTNA 3FPUB 4CJ0B 1ILQA 2N55A 1ILPA 1VMPA 1B2TA 1WVLA 4OIKA 5D14A 2JP1A 2FJ2A 1F9RA 1HFNA 1B4OA 1LV9A 1S4ZA 1M8AA 2KEDA 3LWEA
chains in the Genus database with same CATH superfamily
2BH8A 4TQUS 4QQBX 1F77A 1VQCA 2FMCA 2HQLA 2Z6BA 2HIXA 4MHEA 4HJ5A 3U58A 4KTAA 3I4NB 4MZ9A 1EL0A 4HIKA 4ZLTF 3I7FA 3P7JA 3J81j 4N8FA 1JICA 1FGBD 4DA2A 2A6HC 2K01A 2RDHA 4R8NA 3EBEA 4C3JH 3GTMB 1I4RA 3PIPA 5EKKA 1K0SA 3PMFA 1I6HB 3TP5A 2QF7A 3I4MB 3W3AA 2I5MX 4KY6A 3M4OH 4GLXA 3H6MA 4JCVE 2KVMA 1GUOA 2BA0A 5DM63 2WACA 2E8GA 1ET6A 4KY7A 1X9NA 4JI4L 3KBGA 4YY3L 1BKBA 1HZCA 1JOOA 1YNJC 1ZYRD 1V8QA 3FP9A 1KABA 3ONAB 5JAVA 3G7LA 1KAWA 1EQQA 1E7ZA 1S5CD 2ZXPA 4I65A 4XQNA 1PLFA 3D6CA 1LTLA 1H9SB 4O1NA 1Y1WG 1E3PA 3MTSA 5I9PA 3KLRA 2NZOA 2L12A 2ICIA 5IGCA 4AYBE 4A3DB 4CKEA 1T5XD 1SYBA 3DWPA 4BY1G 4C3JB 1H95A 1DONA 4C3IB 2QEJC 1QZHA 3C46A 5C4HA 1K3RA 4X64L 4IFDI 3M4OB 3HKZB 1F9SA 2AHOB 1CFMA 1EY0A 4HCSA 1WYDA 3N52A 4F87A 4FYDA 1A6XA 3HKSA 5C44H 3A5UA 2F0JA 1F9QA 1DCZA 4QF4A 2CFMA 1I4HA 3CQZH 1CA5A 1SYCA 3NBIA 2Z4HA 1EFID 3E3XA 4IUTA 5COYA 4XT1B 4GS3A 3HOZG 2D0PA 3QJYA 3FPUB 2K52A 1VQ8A 5M3FG 3JAME 3BVGA 5EBCA 4K5WA 4K6DA 3T1HQ 4CGYB 2JA8G 4LF9Q 4BS9A 3CC4A 4LF5L 5EKIA 1B9MA 4JI3L 4DR4Q 4B3SL 1HNWQ 4KD4A 1Q86C 4JK1C 1EU3A 2B63G 4JYAL 2MJ8A 3SDZA 1ZEQX 3A8JE 2CH4W 1C4QA 1BCPD 2ALYB 1EYAA 4HJ9A 5IT9L 3K5LA 4MNOA 2DUDA 1LT5D 1Y8OB 1CA6A 4L6TB 1ML0D 3DEPA 2WINB 4FF2A 1SJHD 4OL7A 4IFDH 4X65Q 3NEMA 4DK3C 1SN8A 4Y7NB 3AYHB 1SE3A 1WTHA 2Y0SE 3S1RH 1VQMA 5IGEA 4H44C 1O7LA 4I7ZC 1TWCH 2JYOA 2Q8IB 1PRTD 2E76C 4R4CA 4RGMA 1I4XA 4QIWB 2PYKA 4ZAIA 3M85A 1EZ6A 1LACA 1LTAD 2VQEL 4LF7L 3AFQA 4I7AA 1VQFA 2NN6G 3J81L 4DR2L 4P71A 4FNFA 5ELOA 3L2PA 4DU9A 1LTID 2XWJB 2JA9A 2NVXH 2L15A 4K8IA 1LO5D 3I4OA 2N3SA 3RUZA 3VR5A 3RN5A 2MP1A 4K14A 3GQBA 4FF4A 2F0UA 1ASYA 1WCMG 3U4VA 1GUGA 4QUFA 2NWGA 3S1RB 4ALPA 4L5QA 2E2DC 1SYDA 1TWCB 2JE6I 3A8KE 1GUNA 4QUCA 1V1PB 4DV2Q 4A3CH 3SEBA 2F0DA 3GV3A 1G6PA 4JI0L 3S1MH 1UE1A 2XSCA 5A2QE 2QW7A 1STYA 1LABA 5DAUA 1MJEA 3S1NB 1W6JA 2JA6G 4OIKA 5D14A 1PZJD 1HNXL 3SHLA 3AB9A 3CCQA 2NVXB 2B2WC 3MC0B 4QCLA 4JI6Q 3VR2A 4POFA 2B2TC 2E75C 2RF4A 1RJTA 3KF6A 2CH4A 1TR5A 4A3BH 5FLXE 4L63B 1E2VA 1VDZA 2ZJRA 3S1QH 1WOCA 2UUAQ 5EAYA 4C56C 5IWAL 5LMNW 1QZGA 4K5XA 1X3PA 5CV8A 1YVCA 2D0OA 3S16H 2RDFA 4DV5Q 3ND8A 1WTVA 3V96A 1E2WA 1JWUD 1CUKA 1CT1D 1B9NA 1UE5A 4IPCA 1VQGA 3O13A 1MJCA 4ZRZA 5IGGA 1EEFD 2JA5H 2K32A 4F88A 2WAQB 1D2BA 4JI0Q 4P2CB 4JW0A 3J7AF 1HA5A 4A3MG 2KA7A 2J4XA 4DN4M 4HAEA 1HHVA 3GTGB 1EQRA 1A3TA 1HNXQ 5I6WA 3G71A 1QWYA 1PA6A 3CP0A 1UNSA 3GDEA 3AMUA 3Q6SA 4AQYQ 4BXXH 4CDEC 3EN2A 2JA7H 2V1CC 2L55A 4A3BB 3NP8A 2F0GA 4GLAC 2BH2A 3I2ZA 3S1QB 3S14B 1CQVA 4QMGA 5IWAQ 3OW7A 1PTOD 3VYTA 2MFIA 3TZUA 3S15H 1KLGD 2E5LL 1CM9A 1EY8A 4IUQA 4ZYSA 1BVSA 2CQOA 2SEBD 5LMNL 3DHQA 2OQKA 1I4PA 2NB0A 3MXGA 4OO1G 2GA4B 2JK8A 2UUCQ 2DY7A 5C4ZA 1ENCA 3C2PA 2A69D 3CCVA 2VW9A 1W2BA 1G2TA 2V4DA 4C1NI 3GV6A 1TIID 3F1ZA 3K5OA 3T1YL 1JOQA 1IBLQ 4JBMA 2K5QA 5M5WH 4A3JG 1QJOA 1LV9A 4RGNA 5CV5A 4FO2A 1STAA 2B8GA 3FRPB 1HQRD 1N8RC 1JCKB 4LK1C 3I73A 1LTBD 1U9RA 4OELB 3S15B 1NMGA 1EY7A 1CZWA 2E5LQ 1J5EQ 1L0XB 3NELA 4LF8L 1TS5A 3NUCA 3KOJA 3MWYW 1JE4A 3NE5B 1K28A 2VXWA 4XQQA 5IODA 4A3LG 1CKOA 1D8LA 1EOVA 4IUVA 1GXDC 1EY6A 4DK1A 1BBXC 4OGQC 3R8BA 1HR0Q 2UUBQ 3PUZA 4X3SA 4CHTB 4PZ6A 1SE2A 4H0LC 5C0XG 4JI5L 3TREA 3HOWB 4FF1A 1OXVA 5FJ8G 4LF6Q 1VQAA 1QNKA 3S2HB 5M5WB 1S5DD 1D1KA 4DV1L 2E2JH 2KUMA 4YCWA 2F0TA 1Y8NB 2F0EA 3CCRA 4DPGA 5C4JH 2OTLA 5FO9B 4X66L 4A3FH 3TRZA 2EY5A 3HOXH 2PZTA 1SLJA 4M8AA 4RG1A 4F7XA 1QVGA 4B3ML 3MAQA 1O7YA 3QWNA 1WTOA 1EWHA 4B3TL 5LMUL 1U5KA 4AYBB 1LTSD 4DAYB 1TT2A 1DZ1A 2JEBI 5BR8L 3B6YA 3I4NG 4S3SA 3KK7A 3EQLC 1II3A 2IW3A 2A6HD 2RA4A 4NW2A 4QIWE 4BBRB 2HDLA 5KYIA 4A76A 3I4MG 3NTKA 3MEHA 2Q2TA 1A2TA 2WV6D 2NBFA 4RKLA 1FYCA 1VF5C 3N6RA 3U9SA 4CJ1B 2GN5A 1AW7A 1FJGQ 4K2LA 1EIHA 3J80E 3TS2A 2AQ2B 5IY0A 4JPBW 2ZJQA 3NBHA 4DR6Q 1U4PA 5C4JB 1NNXA 5T1IA 3PF4A 1YNJD 4XYOA 2DNEA 2RHQB 3D3RA 3Q23A 1WVLA 4GOPB 1I4QA 3MFGA 2IPKD 5LMUQ 2KEDA 1AE2A 1PMRA 3MVVA 3W1BA 3K80C 3DM3A 5I9OA 4CKCA 4QGUA 4X62Q 3KF8A 4DUZQ 3EVQA 1XYIA 1JQYD 3NXWA 2YTXA 2N88A 4GKKL 1NAPA 3BVMA 4YIJA 1IBML 1YBYA 4P72A 4C3IG 3D4RA 4KHPQ 2NUCA 2MGSA 1BXTA 1L1OB 2IT1A 2IY5B 3HKZG 1N9WA 1STGA 4X3TA 4R4OA 2EYHA 2HCIA 5A35A 2Y0SB 4OWWB 2HD3A 2MO0A 5IT9E 2I0QA 2PNHA 4LUOA 2D9UA 3GTOH 5ELNA 2EXZA 1IXRA 1I3QH 3H3VC 4ZCKA 1D7QA 2EYFA 4BBSH 3OHXC 2B2UC 3R93A 1UE7A 3K7UC 3IKJA 4A3EH 3MHBA 2Z8LA 3GTJH 2C9OA 3MXUA 4DUYL 1R9TH 1TXYA 3VDYA 4JI1Q 1YJWA 1IW7C 1FVIA 1GD7A 3UI2A 5M3MB 3CCJA 1TWFH 1XPRA 2MO1A 2PQAA 4P74A 2K14A 4TRDA 2TMPA 5KEEA 5M9OA 2O5IC 1MI2A 1G8ZD 5KGUA 3K5NA 3J81E 1U4MA 2UXDL 4UP7A 4K2KA 1RODA 3TS0A 4B08A 1PFBA 2K5DA 2KCTA 2R7DA 2ICEC 5IYBH 2CWAA 1SNMA 1YHAA 3EROA 2F0PA 4IUPA 3IAYA 5EPKA 2F03A 2UU9L 3CMAA 3GTOB 2JJQA 4Z9CB 4TVAB 1EOTA 1I3QB 1K83H 2YTYA 3C1FA 3KLWA 4BBSB 5JVG3 1I4GA 1KQSA 3HEJA 1E1TA 1ASZA 4ZUIA 1R4PB 5J22A 1Y8PB 4A4IA 3PO2H 4PV1C 4A75A 1HFNA 1R9TB 1E24A 1HJPA 2RKSA 2MQHA 2MHVA 1Q7YC 5IE8A 1UUPA 2F0VA 4YWLA 5BN3A 1X6OA 1FL0A 1A8VA 1TS3A 5GAGC 5IOCA 5EPJA 1CTMA 4HN7A 1STBA 2XGTA 3LWUA 1I94Q 1DOKA 1GHJA 2R7ZB 4LWCA 4UP9A 1UEBA 4X3UA 4ZUJA 5C3WA 5HGQA 3FKIG 4Q5VA 1K83B 1VQDA 4XDXA 5C3EH 2KHSA 4C1NK 3GD7A 1W6KA 4IPHA 4UDUC 1LM0A 3PUXA 1U4LA 1ENAA 2XIWA 2FINB 4RFBA 3I8ZA 2M2LA 2AQ1B 2R92G 2NVYH 1IL8A 5J1ZA 1VQ9A 3I91A 1HTPA 2O4XA 1JC7A 4EQOA 1PFMA 3SGIA 1YI2A 3L3OC 1EY5A 3PIOA 4X6AH 1YHBA 4BY7H 3AU7A 3MEFA 4H7BA 2JXMB 5KNDA 1X56A 3KJOA 5C5MA 2NVQH 4C2MH 5FO7B 2K33A 5DEHA 4UP8A 3ULJA 2SNSA 2SNMA 3SR1A 4YWMA 5JEAG 4EQPA 4A3KH 3K5MA 1IYVA 3G6EA 2B2WA 1VQHA 3I4LA 1TKWB 1L1OC 2A5HA 3K57A 3I90A 2ES2A 1STHA 3TMEA 2K03A 4IOCA 2LKVA 2F0NA 2K5WA 2BE5D 1SXTA 2MUYA 5C3EB 3BYTB 2VZAA 1VQPA 4PG3A 2HCCA 5F2DA 3WDNA 1K8AC 1I6VC 1YJNA 1WTRA 3T1HL 2B3GA 5C5LA 1PV4A 5IP7G 4TSSA 2NVYB 1IKLA 4LF9L 1MSGA 1A3UA 2WAQG 5CV4A 4HJAA 1EFWA 4DR4L 3R2TA 2ENBA 1HNWL 4PQXA 4YHHQ 3BG3A 4BY7B 5C4XG 4GNXC 3S9WA 4JBJA 4C2MB 3CCUA 1GUTA 1JWSD 2FJ2A 5I6YA 3G4SA 2D5DA 2WFWA 4A3KB 5CORA 2OXPA 1KNEA 3LNNA 2KECA 3BZDB 1OO9B 1AFPA 1PH4A 2BDOA 1JJCB 4X65L 4WJWA 2Q8TA 3OW2A 5E1FA 2LY7A 1N34Q 2R93H 5I4DA 1KNAA 1KAAA 1EY4A 4J6HA 4K6LA 5JVH3 4DK6C 2K7VA 3M7NA 1E2ZA 3KBXA 2FHTA 2Z4IA 1SRUA 5CC4A 2K50A 5M5XH 2SDFA 4BA2I 3QB3A 4Y52H 2RBMA 4IJHA 1IZ6A 2I46A 1VQNA 2ATWA 3KDFA 1Y1VH 1IKMA 2RQXA 1FR3A 3GTLH 3TZDA 1QOHA 5G3LF 3RZDH 2XN9C 1DOMA 1VQJA 3OTOQ 5C44B 4LUZA 4ODGA 4ZK9B 3Q0AA 3AFPA 1K8OA 4IURA 3SE0A 4PMWA 2M9VA 3PV0A 4HSPA 1IBKQ 3CQZB 2F0QA 3ZJYC 2EPBA 5C0XJ 1EYGA 5K36H 3GTPH 3P20A 1GUSA 2ZM6Q 2F0WA 1N33L 5FLMG 4R4TA 1KIXA 5IP9G 3A0JA 1NTGA 4FP5D 2Q2UA 4KLKA 3SK4A 3BS1A 4YCVA 4DV2L 1AE3A 3ULPA 5M5XB 1SDFA 2HIVA 1EWIA 1DGSA 4KKUA 4WJ4A 2KJXA 2CQAA 2PW5A 2EYOA 1QVCA 3PO3G 4K0KQ 2LMCB 2IWHA 2WB1E 2VB2X 5DLQE 2EYJA 4JI6L 4JI2Q 2NVTH 5HY6A 5IYDG 1I50H 3HOWG 1S3OA 1VQ4A 1TU2B 1RTNA 1DD2A 1BCPB 1SNPA 3GTPB 2B39A 1F9RA 2UUAL 5KRUA 1UWVA 4ME3A 1AN8A 4DV3Q 1N33Q 1CQFA 2K6AA 1C0AA 4DV5L 2FFKB 4LF4L 4DFAA 5JPMC 3HOYG 2GVBA 3HS0C 4AYBG 1TVXA 3M4PA 4DR3Q 1JJGA 1RTOA 1CKMA 1HRJA 2VUMG 3A7LA 2PI2A 4DV0Q 1SYEA 4K8JA 1PRTB 3TP6A 1U4RA 3UE0A 3CC7A 3H0GG 3PF5A 4BBRG 2AUJD 3T56B 2YTVA 1PYWD 2NVTB 1DYQA 1Y1WH 4L5SA 1I50B 4AQYL 1Z6HA 1RD9D 4FF3A 3M7GA 4HIMA 1VQ5A 3SVMA 4BY1H 2IHEA 1J6QA 2C35B 2RHSB 4XIGS 1V43A 4E6IA 4DNRB 4LFBQ 4DF7A 2B2YA 3RN2A 1ENFA 5LL6S 3KJPA 2RDGA 3DXJC 1XNQQ 5EGTA 1Y14B 5CGKA 3CCMA 4LF4Q 4GZYC 1NE3A 1OXUA 1PFSA 2KENA 1SNCA 3C1EA 4ILWA 1HR0W 1PZID 5E4WC 4RGTA 3S1MB 1EEID 1EUJA 5HGTA 1X65A 3NENA 3MXPA 3RZOH 1RL2A 5D3IB 1PH5A 3ICEA 2UUCL 3VR4A 1NR4A 3FVQA 3OIQA 1SAPA 2A74C 3I55A 3HOZH 2NN6I 4DR5Q 3J80c 2EVBA 2EJGC 1ESRA 2D2CC 3VYRA 1LLRD 5KYLA 5M3FH 1Y1WB 3TDQA 2AUKA 1BO0A 2LXJA 2K05A 3BDCA 1SE8A 2DN8A 3ZYYX 2JA8H 5JJKA 1FGUA 1IBLL 3KUPA 5JPNC 2Y0SG 4A3GG 3BDOA 1L0WA 3KF6B 1HXYD 1K0RA 3S2DH 5AJ3Q 3CPWA 3I3CA 1WTPA 2B63H 1VQ6A 1QUQA 3CW2C 3S16B 4RA8A 4L5TA 3K0YA 1XJVA 3GP7A 3I70A 4DR1Q 1J5EL 1S5ED 4J8QA 4B9XA 3CHBD 1XMQL 1B4OA 1PTOH 3NWTA 2GVAA 5IYCG 5CR3A 2L1BA 2JA5B 3TP7A 2B2UA 4WFN3 3RZOB 2PO4A 3F2UA 2Z1CA 3HG9A 4A3IG 2ZTCA 4A93G 3FPPA 4LFAQ 1IW7D 3A7AB 5M3MG 3HOZB 4FXGC 1HR0L 2UUBL 2JEAI 1HCZA 1GJXA 3D0FA 4HTHA 2E2HH 5M3FB 2VB3X 4DAVA 3NQIA 4LF6L 2JA8B 1B8AA 3DUZA 2JA7B 3Q22A 2IL8A 1JB3A 4FXDA 1EY9A 3S17H 1BBUA 1NY4A 4DKAC 2QILA 3HRZC 2NN6H 3S2DB 4RHSA 1K3BC 2B63B 1BF4A 1FNVA 1EWCA 5M5YH 1Q81C 2ZXOA 3NSWA 1G291 1T9HA 2QDBA 4DAPA 4MTKA 2K75A 3ER0A 1XMQQ 1I5FA 1BUVT 1H9RA 1CZGA 4FXKC 4U68A 1WCMH 3LX0A 1MSHA 3R3OA 2KHIA 1X3QA 4NXML 3HOVG 2H4OA 4V190 2F0SA 3OMCA 1L2FA 2AWNA 4KJOA 5TSSA 2I5HA 2NZ1D 3HOUG 3CRKC 4C3HG 3WOFA 2E2HB 2F0FA 3MFYA 3GTKH 1FJGL 5ISRA 1CI3M 1SR3A 4QY7A 1MHWC 1D6EC 1GOZA 2AQ3B 2E2IH 4EQNA 2IX1A 4DR6L 1F9PA 5JEAJ 1Q3LA 1UAPA 1STEA 4JOIA 2L9HA 1KD1C 5IGFA 1KL9A 1IYUA 2JA6H 3OYYA 4QL5A 1Z7TA 1G91A 2OT2A 1B53A 4OHJA 2D62A 1WFQA 1C9OA 3D4WA 3G48A 3M3YH 1LT6D 3URYA 1AH9A 1C7YA 4EQ5A 2Q2IA 4X62L 1WTWA 3RNUA 4DUZL 3F2DA 1BNZA 4G7ZC 2QDLA 1YNNC 4JBKA 2PZWA 4JV5L 4CJ0B 1AEXA 1XXGA 4NXMQ 1VMPA 2DNCA 4CDCC 4KHPL 1GHKA 3MA2B 1S4ZA 4PZ8A 4OO1I 3K59A 2G9HD 3X3MA 1HFGA 5AFWA 4G4KA 3GTKB 1XMOL 2QKIC 3VR3A 1HTLD 2VY3A 3A5ZB 1KLUD 3TSSA 2E2JB 3V2TA 2E2IB 2A68C 3D8GA 2PQEA 5LHY1 1SNQA 3MXNA 4A3FB 1WJJA 4A3MH 2XRSD 5C3XA 1D5XC 3HOXB 1BOSA 1CSQA 4IOAA 4B3RQ 2ZTDA 3M3YB 1SMXA 2AWOA 2F0MA 2F52A 2F4IA 2F3VA 1KDAA 1YHQA 2NTSA 4JI8Q 4RGOS 1KXLA 4DNTB 3OWFA 4HJ8A 4KD3A 1LTTD 2EIFA 4JV5Q 4FDBA 3PGZA 4KK7A 4A3DG 2IX0A 4JI1L 1VQOA 2M00A 2A1AA 4C3JG 1K8GA 3T4AC 4LW1A 1S40A 4GKJL 2KEEA 3GTQH 2WKDA 5KNCA 2G5DA 3FDTA 4R8IA 2MNAA 1XMOQ 3SK8A 1BCPF 4CJ2C 2C5CA 4OWTB 3BZKA 4GNXA 1N36Q 3MZ5A 2LS01 5C0XI 1LT4D 5NUCA 5GADC 1O7ZA 2DJGC 4OO1H 4A3MB 3NTHA 4JI7Q 1K9MC 3NBHB 1XTCD 1A3VA 2IHFA 4WJ3M 4L5RC 4KN7C 1CKNA 1DJRD 1F2YA 2F3IA 3OPOA 1JB7A 4FVMA 2BA1A 5CBAE 3ITPA 1OXXK 4RKBA 2CWPA 4A3JH 1PRTF 3UDFA 5H1SE 5CV9A 1JT8A 4DV6L 1S5BD 3J7YW 2WB1B 3KF8B 3L7ZC 4XTCS 1PHJA 4IO9A 1FNWA 4GKJQ 3GTQB 1TWAH 4OONA 1E22A 2NZHA 5EKLA 5CMDA 2L4NA 1XX8A 1QILA 1ILPA 4CKBA 2PI2E 1EZ8A 2JSOA 4K5VA 3WWVA 5C44G 1XTDA 1I94L 4A3LH 3I56A 3Q8DA 2ZTEA 4GLVB 3CU7A 1H9KA 3T53B 2VL6A 5EPLA 2H1EA 3JAMc 3HOUH 4C3HH 1PYSB 1OXTA 1DM0B 4UY8C 2OTJA 2RSNA 5C0XH 5EBDA 2UXCL 1A62A 2L5TA 2R6GA 3SK6A 1PDQA 5FJ8H 2K5HA 4ABNA 2Q8RE 4A3EB 4OWXB 4O42A 3K7AH 2F3WA 3FMCA 3STBC 3GTJB 2X6GA 4OX9Q 3A74A 2A6EC 4DV6Q 2VQFQ 1KDBA 2KOLA 3TEHB 3PIO3 1OXSC 1Q12A 4NXNQ 2K5VA 1TWFB 2SOBA 1TWHH 3CMEA 4DR7L 1TWAB 5E3FA 3TQYA 1ICWA 3H09A 1A15A 1GVPA 1Q46A 4KY5A 2PQAB 2F4VQ 1A2UA 4DV7Q 1MD2D 3I4NH 2CKZB 3KLSA 2R7FA 1PVOA 3M4QA 3J7A5 3CPFA 4EVOA 5ELDA 5EQ0A 4IFDG 1CHQD 5J3BA 1N32Q 1SROA 4V0BA 1I6HH 3I4MH 1RDPD 1SNOA 3SK5A 4HMIA 5HURA 3E9HA 2KQ3A 2UXCQ 3L9AX 1B44D 2VNUD 1ZKOA 3CCSA 2H5XA 3K7AB 4GOPC 3PO2B 2EY2A 3T16A 4DGZA 2WIIB 1VQBA 1TWHB 2EJFC 4XYQA 1H9SA 4DR7Q 1F2MA 4YHHL 1VQKA 1EIYB 2N8NA 3ERSX 1D5ZC 1Q8KA 1EQVA 1NSNS 3VR6A 1Z47A 3NQTA 3GO5A 4OEMB 4PMBA 1P16A 1EIFA 2B8FA 1DOLA 4A3DH 2B2TA 2R61A 2Z6KC 1C8CA 1MKHA 4DXGA 4C3IH 1BR9A 5IGBA 1XPUA 2PMZE 1VS0A 5GAHC 1SMYC 1N34L 1B3QA 4KV6A 2L0CA 5GQOA 1PTOF 2DGYA 1M4VA 2UXBQ 2EQSA 1PZKD 3VYUA 1TY2A 1JORA 1W3SA 1LYLA 3CAMA 4ZKCB 2N78A 1Q90A 2F1MA 2KCMA 2JQOA 4HCEA 4A3CG 4MTNA 4NB3A 1XNRQ 3HZXA 2B29A 4NP5A 3OOCA 1QNUA 3JAMi 1G2SA 2R3ZA 1VQEA 1PFNA 4ULLA 3J7AV 4J15A 1NBWA 3E0JA 2NVQB 1KDCA 3OTOL 1KHIA 1O78A 1GKHA 1X3GA 5FLXc 1WD0A 2FMMA 4CBVA 3UDXA 5GROA 2YYZA 2E74C 1IBKL 4IUUA 2HUGA 1BQQT 4UAIA 3DMUA 4A3BG 2B2VC 4RMFA 1HQMC 2K4KA 4LNQA 3UDIA 1EYCA 1ESFA 4Q0FA 3H15A 2ZM6L 3J80L 2K28A 4IALA 1EU4A 1D1IA 4APVA 2CW0C 3VA7A 3K0XA 1UEAB 5DNFA 4JI4Q 1E1OA 3BJUA 4RCOA 4YY3Q 4YCUA 2F0KA 4XQJA 2JA5G 5FO8B 1EQTA 1IHZA 3IL8A 4P75A 1X3EA 1DXMA 1K73C 3OMGA 2EDGA 1IL2A 4Y7NH 4ZQ3A 4K0KL 1NR2A 3UDGA 4RHRA 3IRBA 5I2YA 4HSVA 4JI2L 1X55A 4LMQD 4BXXG 3QOLA 2JA7G 1IYJB 4RCNA 1WTQA 2MPMA 1S72A 5BN5A 1PH6A 3PUWA 4J1MA 2J0TD 1CHPD 1O7IA 4DV3L 2R93B 4X64Q 1JJ2A 3DWQA 4RH6A 2PW7A 1QG7A 4DR3L 3QIAA 2EY6A 3E9IA 3NPPA 2A73B 4N9TA 1S5FD 4LFCL 1RIPA 4KHVA 1RCVD 4DV0L 4R1JA 1B50A 5T1GA 3V05A 3FKIH 1V1PA 3VA5A 1Y1VB 2NYZD 1T5EA 3GTLB 3RZDB 1XPOA 4TKOB 1SBBB 2BOSA 2AKWB 3KDFB 5JJIA 5GAEC 1Q1BA 1KRSA 1STNA 2RCNA 2A8VA 2R92H 1Q8IA 3TBIB 2IX3A 3E6ZX 4HIDA 4LF5Q 2KCNA 4LFBL 1EIGA 1NCVA 4JI3Q 4B3SQ 4R4IA 3S1NH 4H02A 2OCEA 4JYAQ 1CSPA 2K5NA 1PH9A 5E4XA 1GO3E 1XNQL 2OWOA 1SYFA 5JEAH 2EY1A 1QCBD 2KHJA 3OIPA 1PXUA 3RLFA 5IIFA 1AP0A 4LFCQ 3U50C 3S24A 1YNND 5DM73 1HZAA 2FXQA 3FKIB 2I5LX 4IUNA 4F8MA 1R4QB 3T13A 4BA1I 3K8AA 2EYPA 2OEOA 4DR5L 4XT3B 1D5MC 2LSSA 4MIUA 2EYLA 2ID0A 4KKSA 1M90C 3QR8A 2N49A 4HMJA 4HIOA 3G6JB 2R92B 5CV6A 5IP7H 4ZKBB 3KYHC 1VMCA 2A68D 3U4ZA 2VQEQ 4LF7Q 3K81C 1QE6A 3TN2A 4CDFC 4IZ8A 1FNUA 5AJ3L 4DR2Q 4A3FG 1HUMA 5C4XH 3HOXG 4KN4C 2K1BA 3GTGH 3EJIA 1QVFA 4P73A 1YIJA 3H3VI 4DR1L 2TSSA 2X69A 1B3AA 4NPSA 4KI0A 4EGVA 1YJ9A 1JE5A 1X3FA 2BDNA 1A0IA 2ZXRA 1ZYRC 4AH6A 1LTGD 2KBNA 3NHHA 2F0IA 2BE5C 3S14H 1PH7A 4LFAL 1B70B 1VCIA 4N9PA 4B9WA 1ILQA 3HGBA 1VQIA 2JP1A 3W5OA 1SFOH 1M8AA 3BDLA 3LWEA 1PH3A 2Z9HA 3RMHA 1B7YB 4BY1B 1AZQA 3NTIA 5CBEE 3D31A 3PSIA 3QO2A 5C4XB 4LAAA 5JJLA 1VF7A 4H13C 1TWGH 3K6OA 4U673 2X6LA 3A54A 3WOEA 4WORA 3BZCA 1ICFB 4KHZA 4CDDC 5FK9C 1Y69U 2XRQD 3X3NA 3AQQA 4KKTA 4ME5A 4R9WA 4WRDA 1VQLA 1U0LA 3CRLC 2WB1G 2HDMA 3H3VH 4UHVA 5FLMH 2Z0SA 4EX5A 2XTIA 1HNZL 1CK1A 5IP9H 1SFOB 5ELCA 3OWEB 2EZVA 1M1KC 1GM5A 1TQOA 2HQEA 2WKCA 3RR5A 5IT9c 3BYYB 4X3KA 2LXKA 2ASBA 1H9JA 4KMUC 1ZXTA 2OQ0A 5FOBB 4HJ7A 3A56A 3PO3H 3TP8A 1V1OA 1YEZA 3ULLA 1TWGB 3BU2A 2YV5A 1BCPC 3E0EA 3Q24A 3VYSA 3J7ZC 2OF1A 4IFDJ 2EYMA 1QUQB 2AMCB 2RVLA 4PMCA 5IYDH 3IFTA 3HOWH 4QJFA 4BBSG 1BDOA 1PTOB 3S2HH 1G51A 3DM1A 1SSOA 3HKZE 4A3EG 4JG2A 3STBD 2ZJPA 4HEDA 2A6ED 2QEXA 1PH1A 4M1UB 3JAML 4XXEA 2WP8J 4MN3A 4DAYA 3J81c 1XWEA 1HNZQ 3P1HA 1HUNA 3HFZB 3E5SA 5L37A 3HOYH 3L0OA 2QA4A 1UE6A 1PRTC 4N8X1 1ONLA 2EOTA 2PMZB 3CXCA 2F0HA 5LMNQ 5C6AA 2PZUA 4GN3B 2VUMH 3S17B 1G6ZA 2N55A 4NMZA 2RCFA 2CCZA 2R7ZG 2DJFC 3F2CA 1LT3D 5IYBG 3PO3B 3M9BA 4AIMA 5M5YB 3H0GH 3J80i 4BBRH 5G3LD 4HR7B 1C48A 1WTXA 4B3RL 1F2LA 3PQIA 3K58A 3W1GA 4G7OC 3FEWX 1VQ7A 5JJZA 1HPCA 3T1YQ 5ELFA 1X54A 3CD6A 5ELBA 3CCLA 1WCMB 4JI8L 2G9DA 3D4DA 3PO2G 2QCPX 3PCOB 4GOPA 2A19A 1FD7D 4RAUC 4DV4L 1ET9A 1LTRD 3PUVA 3PUYA 1X32A 2EE1A 3DWAA 3HOYB 2CVRA 2BCOA 4LF8Q 3KFUA 1NMFA 1N36L 4ID6A 3JC66 1O80A 1SNDA 2VUMB 3W2DA 4OIJA 3A8IE 1GUWA 1HA6A 1JOKA 3CF5A 5LL6X 2XNAC 4JI7L 3F2BA 2JA6B 1L1OA 5CV7A 3H0GB 4DNIA 2RSOA 1WI5A 5D65A 2Z6KA 1L0YB 1SMYD 1SEBD 2XWBB 3IFDA 4DK0A 2K04A 5C3EG 4O2DA 4JI5Q 3NWSA 2ZT9C 4KJNA 3D6WA 1KRTA 4DV1Q 2LFNA 4UPAA 4A3GH 2B2YC 4YWKA 1OTCA 1RF2D 1WD1A 2KCCA 4X66Q 1QB5D 1F2ZA 1TS4A 2DY8A 1AZPA 2F0OA 4DV4Q 1TS2A 2IJ0A 4B3MQ 4B3TQ 4BY7G 4IJLA 5A2QL 2PCFB 3BVZA 4RWSC 2QGQA 4DAMA 5BR8Q 1HZBA 2YU9H 5IYCH 4A3KG 2NTTA 1TY0A 4A3IH 4A93H 4IQZA 5KIXA 1PH2A 3RD4A 4IPDA 3J81i 5J39A 2XVSA 3A55A 5M3MH 2EJMA 2B2VA 3MXNB 3QG1A 1Z9FA 1B2TA 5FLXL 3C3LA 2HHHL 4G7HC 1JMCA 1V9PA 2CW0D 3R2IA 4NDXA 4A3GB 4OX9L 2VQFL 3EFXD 4GN4B 2P5ZX 4NXNL 4GN5A 1K8MA 1PTOC 3P75A 3LGJA 4NKLA 4OXPA 4R4QA 2O5JC 2I07B 3HP3A 2HT1A 1PYBA 5E7NA 2CHBD 2PPBC 3QOJA 4LUVA 1PH8A 1A63A 3F8TA 4POGA 2F4VL 1V1QA 3EA6A 3KLSX 5D3DA 2JN4A 5BN4A 4DV7L 1JWMD 3ND9A 5KNBA 2YU9B 3AEVA 3H94A 5ELEA 1SJED 4A3IB 3CKIB 4GNXB 3HOVH 4A93B 4GKKQ 1NUCA 1P8LA 1IBMQ 4QB4A 4JC0A 1N32L 1LUZA 1MGSA 2A69C 4O0AA 2WAQE 4IPGA 2EXDA 2R93G 2HHHQ 1CKNB 1H9MA 3EIVA 1Q82C 4A3JB 1JR0D 1HH2P 5IGDA 3CC2A 4L8JA 3SXHA 1J8IA 1NJIC 2R7ZH 3DEOA 1RKNA 3T51B 1YITA 1E0BA 5I2XA 1SYGA 1Y1VG 1RHPA 2F0LA 3RLNA 2PNRC 1YNXA 4PNYA 1SE4A 1BBWA 3DLLA 5CYUA 4BWGB 3UE1A 3H91A 4LJZC 3PIP3 4IN3A 3NK9A 1KTKA 3HOVB 4DUYQ 5K36G 5JOBA 1EYDA 3GTMH 3HOUB 3ERQA 4C3HB 4PZ7A 3I72A 3M4YA 2L11A 1Q1EA 5EJWA 4DXFA 1B1ZA 3OSOA 2O2LD 1J9OA 2UXBL 3FHWA 3U9OA 1MIUA 5FKAC 3CCEA 2VS1A 4JOIC 2UXDQ 2J7ZA 2Q2HA 4G57A 1XNRL 5K5PA 4JBWA 2UU9Q 4JVZA 1KC8C 1HZ9A 3RLOA 1MBYA 1YZ6A
chains in the Genus database with same CATH topology
4TQUS 1F77A 2FMCA 4MHEA 4KTAA 3I4NB 1EL0A 4ZLTF 3P7JA 1JICA 1FGBD 4DA2A 2A6HC 2K01A 2RDHA 4R8NA 3GTMB 1I4RA 5EKKA 3PMFA 1I6HB 3TP5A 2QF7A 3I4MB 3W3AA 4KY6A 3H6MA 2KVMA 1GUOA 2BA0A 5DM63 2WACA 4KY7A 1ET6A 3KBGA 1JOOA 1YNJC 1ZYRD 1V8QA 1KABA 3ONAB 5JAVA 3G7LA 1S5CD 2ZXPA 4I65A 4XQNA 1PLFA 3D6CA 1H9SB 4O1NA 3MTSA 5I9PA 3KLRA 2L12A 2ICIA 5IGCA 4A3DB 4CKEA 1T5XD 1SYBA 3DWPA 4C3JB 1DONA 4C3IB 2QEJC 3C46A 5C4HA 4IFDI 3M4OB 3HKZB 1F9SA 1CFMA 1EY0A 4HCSA 3N52A 4F87A 4FYDA 1A6XA 2F0JA 1F9QA 1DCZA 4QF4A 1I4HA 1CA5A 1SYCA 3NBIA 2Z4HA 1EFID 4IUTA 5COYA 4XT1B 3QJYA 3FPUB 3JAME 3BVGA 5EBCA 4K5WA 4K6DA 4CGYB 4BS9A 5EKIA 1B9MA 4KD4A 4JK1C 1EU3A 2MJ8A 3SDZA 1ZEQX 3A8JE 1C4QA 1BCPD 1EYAA 5IT9L 3K5LA 1LT5D 1Y8OB 1CA6A 4L6TB 1ML0D 3DEPA 2WINB 4FF2A 1SJHD 4OL7A 4IFDH 4Y7NB 1SE3A 5IGEA 4H44C 1O7LA 4I7ZC 2JYOA 2Q8IB 1PRTD 2E76C 4RGMA 1I4XA 4QIWB 2PYKA 4ZAIA 3M85A 1EZ6A 1LACA 1LTAD 2NN6G 3J81L 4FNFA 4DU9A 1LTID 2XWJB 4K8IA 1LO5D 3RUZA 3VR5A 2MP1A 4K14A 3GQBA 4FF4A 2F0UA 1GUGA 4QUFA 2NWGA 3S1RB 2E2DC 1SYDA 1TWCB 2JE6I 3A8KE 1GUNA 4QUCA 1V1PB 3SEBA 2F0DA 3GV3A 2XSCA 5A2QE 1STYA 1LABA 5DAUA 3S1NB 1W6JA 4OIKA 5D14A 1PZJD 3SHLA 3AB9A 2NVXB 2B2WC 3MC0B 4QCLA 3VR2A 2B2TC 2E75C 1RJTA 1TR5A 5FLXE 4L63B 1E2VA 1VDZA 4C56C 4K5XA 1X3PA 5CV8A 2RDFA 3ND8A 1WTVA 3V96A 1E2WA 1JWUD 1CT1D 1B9NA 3O13A 4ZRZA 5IGGA 1EEFD 2K32A 4F88A 2WAQB 1D2BA 4P2CB 3J7AF 1HA5A 2KA7A 2J4XA 4DN4M 4HAEA 1HHVA 3GTGB 1A3TA 5I6WA 1QWYA 1UNSA 3AMUA 3Q6SA 2L55A 4A3BB 3NP8A 2F0GA 3S1QB 3S14B 1CQVA 4QMGA 3OW7A 1PTOD 3VYTA 3TZUA 1KLGD 1CM9A 1EY8A 4IUQA 4ZYSA 2SEBD 3DHQA 1I4PA 2NB0A 3MXGA 4OO1G 2GA4B 2DY7A 5C4ZA 1ENCA 3C2PA 2A69D 1G2TA 2V4DA 4C1NI 3GV6A 1TIID 3K5OA 1JOQA 2K5QA 1QJOA 1LV9A 4RGNA 5CV5A 4FO2A 1STAA 2B8GA 3FRPB 1HQRD 1JCKB 4LK1C 1U9RA 1LTBD 3I73A 3S15B 1EY7A 1CZWA 1L0XB 1TS5A 3NUCA 3MWYW 1JE4A 5IODA 3NE5B 2VXWA 4XQQA 4IUVA 1GXDC 1EY6A 4DK1A 1BBXC 4OGQC 3R8BA 3PUZA 4X3SA 4CHTB 1SE2A 4H0LC 5C0XG 3HOWB 4FF1A 1OXVA 1QNKA 3S2HB 5M5WB 1S5DD 1D1KA 2KUMA 2F0TA 1Y8NB 2F0EA 5FO9B 2EY5A 2PZTA 4M8AA 4F7XA 3MAQA 1O7YA 3QWNA 1WTOA 1EWHA 4AYBB 1LTSD 1TT2A 1DZ1A 2JEBI 4S3SA 3KK7A 3EQLC 1II3A 2IW3A 2A6HD 2RA4A 4NW2A 4BBRB 2HDLA 5KYIA 3NTKA 3MEHA 1A2TA 2WV6D 2NBFA 4RKLA 1FYCA 1VF5C 3N6RA 3U9SA 4CJ1B 1AW7A 4K2LA 1EIHA 3J80E 2AQ2B 3NBHA 1U4PA 5C4JB 5T1IA 1YNJD 4XYOA 2DNEA 3D3RA 3Q23A 1WVLA 1I4QA 3MFGA 2IPKD 2KEDA 1PMRA 3MVVA 5I9OA 4CKCA 3KF8A 3EVQA 1XYIA 1JQYD 3NXWA 2N88A 1NAPA 3BVMA 4YIJA 4C3IG 3D4RA 2NUCA 2MGSA 1BXTA 2IT1A 1STGA 4X3TA 2EYHA 2HCIA 5A35A 2Y0SB 5IT9E 2D9UA 2EXZA 3H3VC 2EYFA 3OHXC 2B2UC 3R93A 3IKJA 3MHBA 2Z8LA 2C9OA 3MXUA 1IW7C 3UI2A 5M3MB 4TRDA 2TMPA 5KEEA 5M9OA 2O5IC 1MI2A 1G8ZD 5KGUA 3K5NA 3J81E 1U4MA 4K2KA 1RODA 4B08A 1PFBA 2K5DA 2ICEC 2F0PA 1SNMA 3EROA 4IUPA 3IAYA 5EPKA 2F03A 3GTOB 4Z9CB 1EOTA 1I3QB 3C1FA 4BBSB 5JVG3 1I4GA 3HEJA 4ZUIA 1R4PB 5J22A 1Y8PB 4PV1C 1HFNA 1R9TB 2RKSA 2MHVA 1UUPA 2F0VA 5BN3A 1TS3A 5IOCA 5EPJA 1CTMA 4HN7A 1STBA 3LWUA 1DOKA 1GHJA 2R7ZB 4X3UA 4ZUJA 5C3WA 4Q5VA 1K83B 4XDXA 2KHSA 4C1NK 3GD7A 1W6KA 4UDUC 3PUXA 1U4LA 1ENAA 2XIWA 2FINB 4RFBA 3I8ZA 2M2LA 2AQ1B 1IL8A 5J1ZA 3I91A 1HTPA 2O4XA 1JC7A 4EQOA 1PFMA 3L3OC 1EY5A 3AU7A 4H7BA 2JXMB 5KNDA 5C5MA 5FO7B 2K33A 5DEHA 2SNSA 2SNMA 3SR1A 5JEAG 4EQPA 3K5MA 1IYVA 2B2WA 3I4LA 1TKWB 2A5HA 3K57A 3I90A 1STHA 3TMEA 2K03A 2LKVA 2F0NA 2K5WA 2BE5D 1SXTA 2MUYA 5C3EB 3BYTB 2HCCA 5F2DA 3WDNA 1I6VC 1WTRA 5C5LA 4TSSA 2NVYB 1IKLA 1MSGA 1A3UA 5CV4A 3R2TA 2ENBA 4PQXA 3BG3A 4BY7B 3S9WA 4C2MB 1GUTA 1JWSD 2FJ2A 5I6YA 2D5DA 4A3KB 5CORA 2OXPA 1KNEA 3LNNA 2KECA 3BZDB 1OO9B 1AFPA 2BDOA 4WJWA 2Q8TA 5E1FA 2LY7A 5I4DA 1KNAA 1KAAA 1EY4A 4J6HA 4K6LA 5JVH3 2K7VA 3M7NA 1E2ZA 3KBXA 2FHTA 2Z4IA 5CC4A 2SDFA 4BA2I 3QB3A 2RBMA 2I46A 1IKMA 2RQXA 1FR3A 3TZDA 1QOHA 5G3LF 2XN9C 1DOMA 5C44B 4ODGA 4ZK9B 3Q0AA 1K8OA 4IURA 3SE0A 4PMWA 2M9VA 3PV0A 4HSPA 3CQZB 2F0QA 5C0XJ 2EPBA 5K36H 3P20A 1GUSA 2F0WA 4FP5D 3SK4A 3BS1A 5M5XB 1SDFA 4KKUA 2KJXA 2CQAA 2PW5A 2EYOA 2LMCB 2IWHA 2VB2X 2EYJA 1TU2B 1RTNA 1DD2A 1BCPB 1SNPA 3GTPB 2B39A 1F9RA 5KRUA 1AN8A 1CQFA 2K6AA 2FFKB 4DFAA 5JPMC 3HS0C 1TVXA 1RTOA 1HRJA 3A7LA 1SYEA 4K8JA 1PRTB 3TP6A 1U4RA 2AUJD 3T56B 1PYWD 2NVTB 1DYQA 1I50B 1Z6HA 1RD9D 4FF3A 3M7GA 3SVMA 4XIGS 1V43A 4E6IA 4DNRB 4DF7A 2B2YA 1ENFA 5LL6S 2RDGA 3DXJC 5EGTA 4GZYC 5CGKA 1OXUA 1SNCA 3C1EA 4ILWA 1PZID 5E4WC 4RGTA 3S1MB 1EEID 5HGTA 3MXPA 5D3IB 3VR4A 1NR4A 3FVQA 3OIQA 1SAPA 2A74C 2NN6I 2EVBA 2EJGC 1ESRA 2D2CC 3VYRA 1LLRD 5KYLA 1Y1WB 3TDQA 2AUKA 1BO0A 2K05A 3BDCA 2DN8A 3ZYYX 3KUPA 5JPNC 3BDOA 1HXYD 3I3CA 1WTPA 3S16B 4RA8A 3K0YA 3GP7A 3I70A 1S5ED 4J8QA 4B9XA 3CHBD 1B4OA 1PTOH 3NWTA 2JA5B 5CR3A 2L1BA 3TP7A 2B2UA 4WFN3 3RZOB 2PO4A 3F2UA 2Z1CA 3HG9A 3FPPA 1IW7D 3A7AB 3HOZB 4FXGC 2JEAI 1HCZA 1GJXA 4HTHA 5M3FB 2VB3X 4DAVA 3NQIA 2JA8B 3DUZA 2JA7B 3Q22A 2IL8A 1JB3A 4FXDA 1EY9A 2QILA 3HRZC 2NN6H 3S2DB 4RHSA 2B63B 1BF4A 1FNVA 1EWCA 2ZXOA 3NSWA 1G291 2QDBA 4DAPA 1BUVT 1H9RA 1CZGA 4FXKC 4U68A 3LX0A 1MSHA 3R3OA 1X3QA 2H4OA 4V190 2F0SA 3OMCA 2AWNA 4KJOA 5TSSA 2NZ1D 3CRKC 4C3HG 3WOFA 2E2HB 2F0FA 3MFYA 5ISRA 1CI3M 1D6EC 1GOZA 2AQ3B 4EQNA 2IX1A 1F9PA 5JEAJ 1Q3LA 1UAPA 1STEA 2L9HA 5IGFA 1IYUA 1Z7TA 1G91A 2OT2A 1B53A 4OHJA 2D62A 3D4WA 1LT6D 3URYA 1WTWA 1BNZA 4G7ZC 1YNNC 2PZWA 4CJ0B 1AEXA 1XXGA 1VMPA 2DNCA 1GHKA 3MA2B 1S4ZA 4OO1I 3K59A 2G9HD 3X3MA 1HFGA 5AFWA 4G4KA 3GTKB 2QKIC 3VR3A 1HTLD 1KLUD 3TSSA 2E2JB 3V2TA 2E2IB 2A68C 3D8GA 2PQEA 5LHY1 1SNQA 3MXNA 4A3FB 2XRSD 5C3XA 1D5XC 3HOXB 1BOSA 3M3YB 2AWOA 2F0MA 2F4IA 2F3VA 1KDAA 2NTSA 4RGOS 4DNTB 3OWFA 4KD3A 1LTTD 4KK7A 2IX0A 2M00A 4C3JG 3T4AC 2KEEA 2WKDA 5KNCA 3FDTA 4R8IA 3SK8A 1BCPF 4CJ2C 2C5CA 3MZ5A 2LS01 5C0XI 1LT4D 5NUCA 1O7ZA 4OO1H 4A3MB 3NTHA 1XTCD 1A3VA 4KN7C 1DJRD 1F2YA 3OPOA 4FVMA 2BA1A 5CBAE 3ITPA 1OXXK 4RKBA 1PRTF 5CV9A 1S5BD 3J7YW 2WB1B 3L7ZC 4XTCS 1FNWA 3GTQB 5EKLA 5CMDA 2L4NA 1XX8A 1QILA 1ILPA 4CKBA 1EZ8A 2JSOA 4K5VA 3CU7A 1H9KA 3T53B 5EPLA 2H1EA 1OXTA 1DM0B 2RSNA 5C0XH 5EBDA 2L5TA 2R6GA 3SK6A 1PDQA 4ABNA 2Q8RE 4A3EB 4O42A 2F3WA 3FMCA 3GTJB 2X6GA 2A6EC 1KDBA 2KOLA 3PIO3 1OXSC 1Q12A 1TWFB 2SOBA 1TWAB 5E3FA 1ICWA 3H09A 1A15A 4KY5A 1A2UA 1MD2D 3KLSA 4EVOA 5ELDA 5EQ0A 4IFDG 1CHQD 4V0BA 1RDPD 1SNOA 3SK5A 4HMIA 5HURA 2KQ3A 3L9AX 1B44D 2VNUD 1ZKOA 3K7AB 3PO2B 2EY2A 3T16A 4DGZA 2WIIB 1TWHB 2EJFC 4XYQA 1H9SA 1F2MA 1D5ZC 1EQVA 1NSNS 3VR6A 1Z47A 3NQTA 3GO5A 4PMBA 2B8FA 1DOLA 2B2TA 2R61A 1C8CA 4DXGA 1BR9A 5IGBA 1SMYC 4KV6A 2L0CA 1PTOF 1M4VA 1PZKD 3VYUA 1TY2A 1JORA 4ZKCB 1Q90A 2F1MA 4HCEA 3HZXA 4NP5A 3OOCA 1QNUA 1G2SA 2R3ZA 1PFNA 4ULLA 3J7AV 3E0JA 2NVQB 1KDCA 1O78A 1WD0A 2FMMA 4CBVA 2YYZA 2E74C 4IUUA 2HUGA 1BQQT 4UAIA 3DMUA 2B2VC 1HQMC 1EYCA 1ESFA 4Q0FA 3J80L 2K28A 4IALA 1EU4A 1D1IA 2CW0C 3VA7A 1UEAB 5DNFA 4RCOA 2F0KA 4XQJA 5FO8B 1EQTA 1IHZA 3IL8A 1DXMA 3OMGA 2EDGA 4ZQ3A 1NR2A 4RHRA 5I2YA 4HSVA 4LMQD 3QOLA 4RCNA 1WTQA 2MPMA 5BN5A 3PUWA 4J1MA 2J0TD 1CHPD 2R93B 3DWQA 4RH6A 2PW7A 1QG7A 3QIAA 2EY6A 3NPPA 2A73B 4N9TA 1S5FD 4KHVA 1RCVD 1B50A 5T1GA 3V05A 1V1PA 3VA5A 1Y1VB 2NYZD 1T5EA 3GTLB 3RZDB 4TKOB 1SBBB 2BOSA 1Q1BA 1STNA 1Q8IA 3TBIB 2IX3A 3E6ZX 2KCNA 1EIGA 1NCVA 5E4XA 1SYFA 5JEAH 2EY1A 1QCBD 3OIPA 3RLFA 1PXUA 5IIFA 1AP0A 1YNND 5DM73 3FKIB 4F8MA 4IUNA 1R4QB 3T13A 4BA1I 2EYPA 2OEOA 4XT3B 1D5MC 4MIUA 2EYLA 2ID0A 4KKSA 4HMJA 3G6JB 2R92B 5CV6A 4ZKBB 1VMCA 2A68D 1QE6A 3TN2A 4IZ8A 1FNUA 1HUMA 4KN4C 2K1BA 3EJIA 2TSSA 2X69A 1B3AA 4KI0A 4EGVA 2BDNA 2ZXRA 1ZYRC 1LTGD 3NHHA 2F0IA 2BE5C 1VCIA 4N9PA 4B9WA 1ILQA 3HGBA 2JP1A 1M8AA 3BDLA 3LWEA 3RMHA 4BY1B 1AZQA 3NTIA 5CBEE 3D31A 3QO2A 5C4XB 4LAAA 1VF7A 4H13C 3K6OA 4U673 2X6LA 3A54A 3WOEA 4WORA 4KHZA 5FK9C 1Y69U 2XRQD 3X3NA 4KKTA 4ME5A 4R9WA 4WRDA 3CRLC 2HDMA 1CK1A 1SFOB 5ELCA 3OWEB 2EZVA 1TQOA 2HQEA 2WKCA 3BYYB 4X3KA 1H9JA 4KMUC 1ZXTA 5FOBB 3A56A 3TP8A 1V1OA 1TWGB 1BCPC 3Q24A 3VYSA 2OF1A 4IFDJ 2EYMA 2RVLA 4PMCA 3IFTA 1BDOA 1PTOB 3DM1A 1SSOA 4HEDA 2A6ED 4M1UB 3JAML 4XXEA 2WP8J 4MN3A 4DAYA 1XWEA 3P1HA 1HUNA 3E5SA 1PRTC 1ONLA 2EOTA 2PMZB 2F0HA 5C6AA 2PZUA 3S17B 1G6ZA 2N55A 4NMZA 3PO3B 1LT3D 5M5YB 5G3LD 4HR7B 1C48A 1WTXA 1F2LA 3K58A 4G7OC 3FEWX 5JJZA 1HPCA 5ELFA 5ELBA 1WCMB 2G9DA 3D4DA 2QCPX 1FD7D 4RAUC 1ET9A 1LTRD 3PUVA 1X32A 3PUYA 2EE1A 3DWAA 3HOYB 2CVRA 2BCOA 4ID6A 1O80A 1SNDA 2VUMB 3W2DA 4OIJA 3A8IE 1GUWA 1HA6A 1JOKA 5LL6X 2XNAC 2JA6B 5CV7A 3H0GB 2RSOA 5D65A 1L0YB 1SMYD 1SEBD 2XWBB 3IFDA 4DK0A 2K04A 3NWSA 2ZT9C 4KJNA 3D6WA 2LFNA 2B2YC 1RF2D 1WD1A 2KCCA 1QB5D 1F2ZA 1TS4A 2DY8A 1AZPA 2F0OA 1TS2A 2IJ0A 5A2QL 2PCFB 3BVZA 4RWSC 2NTTA 1TY0A 4IQZA 5KIXA 3RD4A 5J39A 2XVSA 3A55A 2EJMA 2B2VA 3QG1A 1B2TA 5FLXL 3C3LA 4G7HC 2CW0D 3R2IA 4NDXA 4A3GB 3EFXD 1K8MA 1PTOC 3P75A 4NKLA 2O5JC 2I07B 3HP3A 2CHBD 2PPBC 3QOJA 3EA6A 3KLSX 5D3DA 2YU9B 5BN4A 1JWMD 3ND9A 5KNBA 3H94A 5ELEA 1SJED 4A3IB 3CKIB 4A93B 1NUCA 4QB4A 1MGSA 2A69C 1H9MA 4A3JB 1JR0D 5IGDA 4L8JA 3SXHA 1J8IA 3DEOA 1RKNA 3T51B 1E0BA 5I2XA 1SYGA 1RHPA 2F0LA 2PNRC 4PNYA 1SE4A 5CYUA 4BWGB 3H91A 4LJZC 3PIP3 4IN3A 3NK9A 1KTKA 3HOVB 5K36G 5JOBA 1EYDA 3HOUB 3ERQA 4C3HB 3I72A 3M4YA 2L11A 1Q1EA 5EJWA 4DXFA 1B1ZA 3OSOA 2O2LD 1J9OA 3U9OA 5FKAC 2J7ZA 4G57A 5K5PA 4JBWA 1MBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  5COR A;  2B2W C;  2B2U A;  1KNE A;  1HFG A;  5AFW A;  5T1G A;  5EKI A;  2KEC A;  3F2U A;  2FFK B;  2NYZ D;  1WTX A;  1F2L A;  4MHE A;  1AZQ A;  2B2T C;  5EPL A;  2H1E A;  1XYI A;  1RJT A;  4ZKC B;  5EPJ A;  2Q8T A;  2MJ8 A;  1TVX A;  2N88 A;  5CBE E;  5JJZ A;  2RSN A;  1NAP A;  1EL0 A;  1RTO A;  3QO2 A;  3P7J A;  4ZLT F;  1HRJ A;  1JIC A;  1G2S A;  3HP3 A;  1PDQ A;  2R3Z A;  1DOK A;  1KNA A;  2K01 A;  1PFN A;  2Q8R E;  2X6L A;  3MWY W;  2MGS A;  1X3P A;  4O42 A;  1JE4 A;  2VXW A;  1U4R A;  2X6G A;  4RAU C;  2IL8 A;  1WTV A;  1CA6 A;  4X3T A;  1EIG A;  1NCV A;  4X3U A;  4IUV A;  1ML0 D;  3DEP A;  2KOL A;  3KBX A;  1X32 A;  2FHT A;  2KVM A;  1WD0 A;  2FMM A;  2HCI A;  1BBX C;  2EE1 A;  4XDX A;  2CVR A;  1BF4 A;  2SDF A;  4R9W A;  4X3S A;  5E4X A;  4IUU A;  1ICW A;  1U4L A;  2HUG A;  2FIN B;  2XIW A;  4UAI A;  1A15 A;  2B2V C;  1MGS A;  1O80 A;  2HDM A;  3I8Z A;  2M2L A;  4OIJ A;  1GUW A;  1IKM A;  3SVM A;  1HA6 A;  2D9U A;  1AP0 A;  1QNK A;  2JYO A;  3TZD A;  4DN4 M;  3ONA B;  1IL8 A;  4HAE A;  1HHV A;  1DOM A;  3G7L A;  2K28 A;  2KUM A;  4ZAI A;  2KEE A;  2B2Y A;  4ZK9 B;  3I91 A;  2RSO A;  5D65 A;  4U68 A;  1MSH A;  2B2U C;  4IUR A;  5EQ0 A;  1PFM A;  1PLF A;  3FDT A;  5DNF A;  3R93 A;  4R8I A;  1J8I A;  3IFD A;  3Q6S A;  1X3Q A;  2K04 A;  3DEO A;  4X3K A;  2EPB A;  4CJ2 C;  4XT3 B;  1O7Y A;  1WTO A;  1ZXT A;  1EQT A;  2NZ1 D;  3IL8 A;  3MTS A;  1E0B A;  3D6W A;  1O7Z A;  5E4W C;  2L12 A;  3UI2 A;  1DZ1 A;  2B2W A;  1DON A;  1RHP A;  4ZKB B;  2B2Y C;  3I90 A;  1WD1 A;  1NR2 A;  1VMC A;  2MP1 A;  2DY8 A;  1NR4 A;  2K03 A;  2RVL A;  1AZP A;  1MI2 A;  1QE6 A;  1SAP A;  1CM9 A;  3TN2 A;  3H91 A;  4IUQ A;  1F9S A;  1U4M A;  5CBA E;  2RA4 A;  4HSV A;  1HUM A;  1F9P A;  4NW2 A;  3DM1 A;  4HCS A;  4LMQ D;  1SSO A;  1ESR A;  3N52 A;  4QUF A;  1Q3L A;  1SDF A;  2HDL A;  2K1B A;  2L9H A;  2NWG A;  1ROD A;  1PFB A;  4HED A;  1BO0 A;  1WTQ A;  2K05 A;  4RWS C;  1F9Q A;  2HCC A;  2X69 A;  1G91 A;  1B3A A;  1B53 A;  2MPM A;  4IUP A;  3KUP A;  4MN3 A;  5EPK A;  1B50 A;  1WTR A;  4CJ1 B;  4QUC A;  2L11 A;  1EIH A;  1CA5 A;  2BDN A;  1IKL A;  2DY7 A;  1MSG A;  5EJW A;  1HUN A;  1EOT A;  4IUT A;  5COY A;  4XT1 B;  1J9O A;  1U4P A;  3I3C A;  1WTW A;  1WTP A;  1G2T A;  1DOL A;  3GV6 A;  5T1I A;  5CMD A;  3GV3 A;  2B2V A;  2EOT A;  2B2T A;  4RA8 A;  1C8C A;  1BNZ A;  2J7Z A;  1QG7 A;  2L4N A;  1XX8 A;  1G6Z A;  1RTN A;  3FPU B;  4CJ0 B;  1ILQ A;  2N55 A;  1ILP A;  1VMP A;  1B2T A;  1WVL A;  4OIK A;  5D14 A;  2JP1 A;  2FJ2 A;  1F9R A;  1HFN A;  1B4O A;  1LV9 A;  1S4Z A;  1M8A A;  2KED A;  3LWE A; 
#chains in the Genus database with same CATH topology
 2BH8 A;  4TQU S;  4QQB X;  1F77 A;  1VQC A;  2FMC A;  2HQL A;  2Z6B A;  2HIX A;  4MHE A;  4HJ5 A;  3U58 A;  4KTA A;  3I4N B;  4MZ9 A;  1EL0 A;  4HIK A;  4ZLT F;  3I7F A;  3P7J A;  3J81 j;  4N8F A;  1JIC A;  1FGB D;  4DA2 A;  2A6H C;  2K01 A;  2RDH A;  4R8N A;  3EBE A;  4C3J H;  3GTM B;  1I4R A;  3PIP A;  5EKK A;  1K0S A;  3PMF A;  1I6H B;  3TP5 A;  2QF7 A;  3I4M B;  3W3A A;  2I5M X;  4KY6 A;  3M4O H;  4GLX A;  3H6M A;  4JCV E;  2KVM A;  1GUO A;  2BA0 A;  5DM6 3;  2WAC A;  2E8G A;  1ET6 A;  4KY7 A;  1X9N A;  4JI4 L;  3KBG A;  4YY3 L;  1BKB A;  1HZC A;  1JOO A;  1YNJ C;  1ZYR D;  1V8Q A;  3FP9 A;  1KAB A;  3ONA B;  5JAV A;  3G7L A;  1KAW A;  1EQQ A;  1E7Z A;  1S5C D;  2ZXP A;  4I65 A;  4XQN A;  1PLF A;  3D6C A;  1LTL A;  1H9S B;  4O1N A;  1Y1W G;  1E3P A;  3MTS A;  5I9P A;  3KLR A;  2NZO A;  2L12 A;  2ICI A;  5IGC A;  4AYB E;  4A3D B;  4CKE A;  1T5X D;  1SYB A;  3DWP A;  4BY1 G;  4C3J B;  1H95 A;  1DON A;  4C3I B;  2QEJ C;  1QZH A;  3C46 A;  5C4H A;  1K3R A;  4X64 L;  4IFD I;  3M4O B;  3HKZ B;  1F9S A;  2AHO B;  1CFM A;  1EY0 A;  4HCS A;  1WYD A;  3N52 A;  4F87 A;  4FYD A;  1A6X A;  3HKS A;  5C44 H;  3A5U A;  2F0J A;  1F9Q A;  1DCZ A;  4QF4 A;  2CFM A;  1I4H A;  3CQZ H;  1CA5 A;  1SYC A;  3NBI A;  2Z4H A;  1EFI D;  3E3X A;  4IUT A;  5COY A;  4XT1 B;  4GS3 A;  3HOZ G;  2D0P A;  3QJY A;  3FPU B;  2K52 A;  1VQ8 A;  5M3F G;  3JAM E;  3BVG A;  5EBC A;  4K5W A;  4K6D A;  3T1H Q;  4CGY B;  2JA8 G;  4LF9 Q;  4BS9 A;  3CC4 A;  4LF5 L;  5EKI A;  1B9M A;  4JI3 L;  4DR4 Q;  4B3S L;  1HNW Q;  4KD4 A;  1Q86 C;  4JK1 C;  1EU3 A;  2B63 G;  4JYA L;  2MJ8 A;  3SDZ A;  1ZEQ X;  3A8J E;  2CH4 W;  1C4Q A;  1BCP D;  2ALY B;  1EYA A;  4HJ9 A;  5IT9 L;  3K5L A;  4MNO A;  2DUD A;  1LT5 D;  1Y8O B;  1CA6 A;  4L6T B;  1ML0 D;  3DEP A;  2WIN B;  4FF2 A;  1SJH D;  4OL7 A;  4IFD H;  4X65 Q;  3NEM A;  4DK3 C;  1SN8 A;  4Y7N B;  3AYH B;  1SE3 A;  1WTH A;  2Y0S E;  3S1R H;  1VQM A;  5IGE A;  4H44 C;  1O7L A;  4I7Z C;  1TWC H;  2JYO A;  2Q8I B;  1PRT D;  2E76 C;  4R4C A;  4RGM A;  1I4X A;  4QIW B;  2PYK A;  4ZAI A;  3M85 A;  1EZ6 A;  1LAC A;  1LTA D;  2VQE L;  4LF7 L;  3AFQ A;  4I7A A;  1VQF A;  2NN6 G;  3J81 L;  4DR2 L;  4P71 A;  4FNF A;  5ELO A;  3L2P A;  4DU9 A;  1LTI D;  2XWJ B;  2JA9 A;  2NVX H;  2L15 A;  4K8I A;  1LO5 D;  3I4O A;  2N3S A;  3RUZ A;  3VR5 A;  3RN5 A;  2MP1 A;  4K14 A;  3GQB A;  4FF4 A;  2F0U A;  1ASY A;  1WCM G;  3U4V A;  1GUG A;  4QUF A;  2NWG A;  3S1R B;  4ALP A;  4L5Q A;  2E2D C;  1SYD A;  1TWC B;  2JE6 I;  3A8K E;  1GUN A;  4QUC A;  1V1P B;  4DV2 Q;  4A3C H;  3SEB A;  2F0D A;  3GV3 A;  1G6P A;  4JI0 L;  3S1M H;  1UE1 A;  2XSC A;  5A2Q E;  2QW7 A;  1STY A;  1LAB A;  5DAU A;  1MJE A;  3S1N B;  1W6J A;  2JA6 G;  4OIK A;  5D14 A;  1PZJ D;  1HNX L;  3SHL A;  3AB9 A;  3CCQ A;  2NVX B;  2B2W C;  3MC0 B;  4QCL A;  4JI6 Q;  3VR2 A;  4POF A;  2B2T C;  2E75 C;  2RF4 A;  1RJT A;  3KF6 A;  2CH4 A;  1TR5 A;  4A3B H;  5FLX E;  4L63 B;  1E2V A;  1VDZ A;  2ZJR A;  3S1Q H;  1WOC A;  2UUA Q;  5EAY A;  4C56 C;  5IWA L;  5LMN W;  1QZG A;  4K5X A;  1X3P A;  5CV8 A;  1YVC A;  2D0O A;  3S16 H;  2RDF A;  4DV5 Q;  3ND8 A;  1WTV A;  3V96 A;  1E2W A;  1JWU D;  1CUK A;  1CT1 D;  1B9N A;  1UE5 A;  4IPC A;  1VQG A;  3O13 A;  1MJC A;  4ZRZ A;  5IGG A;  1EEF D;  2JA5 H;  2K32 A;  4F88 A;  2WAQ B;  1D2B A;  4JI0 Q;  4P2C B;  4JW0 A;  3J7A F;  1HA5 A;  4A3M G;  2KA7 A;  2J4X A;  4DN4 M;  4HAE A;  1HHV A;  3GTG B;  1EQR A;  1A3T A;  1HNX Q;  5I6W A;  3G71 A;  1QWY A;  1PA6 A;  3CP0 A;  1UNS A;  3GDE A;  3AMU A;  3Q6S A;  4AQY Q;  4BXX H;  4CDE C;  3EN2 A;  2JA7 H;  2V1C C;  2L55 A;  4A3B B;  3NP8 A;  2F0G A;  4GLA C;  2BH2 A;  3I2Z A;  3S1Q B;  3S14 B;  1CQV A;  4QMG A;  5IWA Q;  3OW7 A;  1PTO D;  3VYT A;  2MFI A;  3TZU A;  3S15 H;  1KLG D;  2E5L L;  1CM9 A;  1EY8 A;  4IUQ A;  4ZYS A;  1BVS A;  2CQO A;  2SEB D;  5LMN L;  3DHQ A;  2OQK A;  1I4P A;  2NB0 A;  3MXG A;  4OO1 G;  2GA4 B;  2JK8 A;  2UUC Q;  2DY7 A;  5C4Z A;  1ENC A;  3C2P A;  2A69 D;  3CCV A;  2VW9 A;  1W2B A;  1G2T A;  2V4D A;  4C1N I;  3GV6 A;  1TII D;  3F1Z A;  3K5O A;  3T1Y L;  1JOQ A;  1IBL Q;  4JBM A;  2K5Q A;  5M5W H;  4A3J G;  1QJO A;  1LV9 A;  4RGN A;  5CV5 A;  4FO2 A;  1STA A;  2B8G A;  3FRP B;  1HQR D;  1N8R C;  1JCK B;  4LK1 C;  3I73 A;  1LTB D;  1U9R A;  4OEL B;  3S15 B;  1NMG A;  1EY7 A;  1CZW A;  2E5L Q;  1J5E Q;  1L0X B;  3NEL A;  4LF8 L;  1TS5 A;  3NUC A;  3KOJ A;  3MWY W;  1JE4 A;  3NE5 B;  1K28 A;  2VXW A;  4XQQ A;  5IOD A;  4A3L G;  1CKO A;  1D8L A;  1EOV A;  4IUV A;  1GXD C;  1EY6 A;  4DK1 A;  1BBX C;  4OGQ C;  3R8B A;  1HR0 Q;  2UUB Q;  3PUZ A;  4X3S A;  4CHT B;  4PZ6 A;  1SE2 A;  4H0L C;  5C0X G;  4JI5 L;  3TRE A;  3HOW B;  4FF1 A;  1OXV A;  5FJ8 G;  4LF6 Q;  1VQA A;  1QNK A;  3S2H B;  5M5W B;  1S5D D;  1D1K A;  4DV1 L;  2E2J H;  2KUM A;  4YCW A;  2F0T A;  1Y8N B;  2F0E A;  3CCR A;  4DPG A;  5C4J H;  2OTL A;  5FO9 B;  4X66 L;  4A3F H;  3TRZ A;  2EY5 A;  3HOX H;  2PZT A;  1SLJ A;  4M8A A;  4RG1 A;  4F7X A;  1QVG A;  4B3M L;  3MAQ A;  1O7Y A;  3QWN A;  1WTO A;  1EWH A;  4B3T L;  5LMU L;  1U5K A;  4AYB B;  1LTS D;  4DAY B;  1TT2 A;  1DZ1 A;  2JEB I;  5BR8 L;  3B6Y A;  3I4N G;  4S3S A;  3KK7 A;  3EQL C;  1II3 A;  2IW3 A;  2A6H D;  2RA4 A;  4NW2 A;  4QIW E;  4BBR B;  2HDL A;  5KYI A;  4A76 A;  3I4M G;  3NTK A;  3MEH A;  2Q2T A;  1A2T A;  2WV6 D;  2NBF A;  4RKL A;  1FYC A;  1VF5 C;  3N6R A;  3U9S A;  4CJ1 B;  2GN5 A;  1AW7 A;  1FJG Q;  4K2L A;  1EIH A;  3J80 E;  3TS2 A;  2AQ2 B;  5IY0 A;  4JPB W;  2ZJQ A;  3NBH A;  4DR6 Q;  1U4P A;  5C4J B;  1NNX A;  5T1I A;  3PF4 A;  1YNJ D;  4XYO A;  2DNE A;  2RHQ B;  3D3R A;  3Q23 A;  1WVL A;  4GOP B;  1I4Q A;  3MFG A;  2IPK D;  5LMU Q;  2KED A;  1AE2 A;  1PMR A;  3MVV A;  3W1B A;  3K80 C;  3DM3 A;  5I9O A;  4CKC A;  4QGU A;  4X62 Q;  3KF8 A;  4DUZ Q;  3EVQ A;  1XYI A;  1JQY D;  3NXW A;  2YTX A;  2N88 A;  4GKK L;  1NAP A;  3BVM A;  4YIJ A;  1IBM L;  1YBY A;  4P72 A;  4C3I G;  3D4R A;  4KHP Q;  2NUC A;  2MGS A;  1BXT A;  1L1O B;  2IT1 A;  2IY5 B;  3HKZ G;  1N9W A;  1STG A;  4X3T A;  4R4O A;  2EYH A;  2HCI A;  5A35 A;  2Y0S B;  4OWW B;  2HD3 A;  2MO0 A;  5IT9 E;  2I0Q A;  2PNH A;  4LUO A;  2D9U A;  3GTO H;  5ELN A;  2EXZ A;  1IXR A;  1I3Q H;  3H3V C;  4ZCK A;  1D7Q A;  2EYF A;  4BBS H;  3OHX C;  2B2U C;  3R93 A;  1UE7 A;  3K7U C;  3IKJ A;  4A3E H;  3MHB A;  2Z8L A;  3GTJ H;  2C9O A;  3MXU A;  4DUY L;  1R9T H;  1TXY A;  3VDY A;  4JI1 Q;  1YJW A;  1IW7 C;  1FVI A;  1GD7 A;  3UI2 A;  5M3M B;  3CCJ A;  1TWF H;  1XPR A;  2MO1 A;  2PQA A;  4P74 A;  2K14 A;  4TRD A;  2TMP A;  5KEE A;  5M9O A;  2O5I C;  1MI2 A;  1G8Z D;  5KGU A;  3K5N A;  3J81 E;  1U4M A;  2UXD L;  4UP7 A;  4K2K A;  1ROD A;  3TS0 A;  4B08 A;  1PFB A;  2K5D A;  2KCT A;  2R7D A;  2ICE C;  5IYB H;  2CWA A;  1SNM A;  1YHA A;  3ERO A;  2F0P A;  4IUP A;  3IAY A;  5EPK A;  2F03 A;  2UU9 L;  3CMA A;  3GTO B;  2JJQ A;  4Z9C B;  4TVA B;  1EOT A;  1I3Q B;  1K83 H;  2YTY A;  3C1F A;  3KLW A;  4BBS B;  5JVG 3;  1I4G A;  1KQS A;  3HEJ A;  1E1T A;  1ASZ A;  4ZUI A;  1R4P B;  5J22 A;  1Y8P B;  4A4I A;  3PO2 H;  4PV1 C;  4A75 A;  1HFN A;  1R9T B;  1E24 A;  1HJP A;  2RKS A;  2MQH A;  2MHV A;  1Q7Y C;  5IE8 A;  1UUP A;  2F0V A;  4YWL A;  5BN3 A;  1X6O A;  1FL0 A;  1A8V A;  1TS3 A;  5GAG C;  5IOC A;  5EPJ A;  1CTM A;  4HN7 A;  1STB A;  2XGT A;  3LWU A;  1I94 Q;  1DOK A;  1GHJ A;  2R7Z B;  4LWC A;  4UP9 A;  1UEB A;  4X3U A;  4ZUJ A;  5C3W A;  5HGQ A;  3FKI G;  4Q5V A;  1K83 B;  1VQD A;  4XDX A;  5C3E H;  2KHS A;  4C1N K;  3GD7 A;  1W6K A;  4IPH A;  4UDU C;  1LM0 A;  3PUX A;  1U4L A;  1ENA A;  2XIW A;  2FIN B;  4RFB A;  3I8Z A;  2M2L A;  2AQ1 B;  2R92 G;  2NVY H;  1IL8 A;  5J1Z A;  1VQ9 A;  3I91 A;  1HTP A;  2O4X A;  1JC7 A;  4EQO A;  1PFM A;  3SGI A;  1YI2 A;  3L3O C;  1EY5 A;  3PIO A;  4X6A H;  1YHB A;  4BY7 H;  3AU7 A;  3MEF A;  4H7B A;  2JXM B;  5KND A;  1X56 A;  3KJO A;  5C5M A;  2NVQ H;  4C2M H;  5FO7 B;  2K33 A;  5DEH A;  4UP8 A;  3ULJ A;  2SNS A;  2SNM A;  3SR1 A;  4YWM A;  5JEA G;  4EQP A;  4A3K H;  3K5M A;  1IYV A;  3G6E A;  2B2W A;  1VQH A;  3I4L A;  1TKW B;  1L1O C;  2A5H A;  3K57 A;  3I90 A;  2ES2 A;  1STH A;  3TME A;  2K03 A;  4IOC A;  2LKV A;  2F0N A;  2K5W A;  2BE5 D;  1SXT A;  2MUY A;  5C3E B;  3BYT B;  2VZA A;  1VQP A;  4PG3 A;  2HCC A;  5F2D A;  3WDN A;  1K8A C;  1I6V C;  1YJN A;  1WTR A;  3T1H L;  2B3G A;  5C5L A;  1PV4 A;  5IP7 G;  4TSS A;  2NVY B;  1IKL A;  4LF9 L;  1MSG A;  1A3U A;  2WAQ G;  5CV4 A;  4HJA A;  1EFW A;  4DR4 L;  3R2T A;  2ENB A;  1HNW L;  4PQX A;  4YHH Q;  3BG3 A;  4BY7 B;  5C4X G;  4GNX C;  3S9W A;  4JBJ A;  4C2M B;  3CCU A;  1GUT A;  1JWS D;  2FJ2 A;  5I6Y A;  3G4S A;  2D5D A;  2WFW A;  4A3K B;  5COR A;  2OXP A;  1KNE A;  3LNN A;  2KEC A;  3BZD B;  1OO9 B;  1AFP A;  1PH4 A;  2BDO A;  1JJC B;  4X65 L;  4WJW A;  2Q8T A;  3OW2 A;  5E1F A;  2LY7 A;  1N34 Q;  2R93 H;  5I4D A;  1KNA A;  1KAA A;  1EY4 A;  4J6H A;  4K6L A;  5JVH 3;  4DK6 C;  2K7V A;  3M7N A;  1E2Z A;  3KBX A;  2FHT A;  2Z4I A;  1SRU A;  5CC4 A;  2K50 A;  5M5X H;  2SDF A;  4BA2 I;  3QB3 A;  4Y52 H;  2RBM A;  4IJH A;  1IZ6 A;  2I46 A;  1VQN A;  2ATW A;  3KDF A;  1Y1V H;  1IKM A;  2RQX A;  1FR3 A;  3GTL H;  3TZD A;  1QOH A;  5G3L F;  3RZD H;  2XN9 C;  1DOM A;  1VQJ A;  3OTO Q;  5C44 B;  4LUZ A;  4ODG A;  4ZK9 B;  3Q0A A;  3AFP A;  1K8O A;  4IUR A;  3SE0 A;  4PMW A;  2M9V A;  3PV0 A;  4HSP A;  1IBK Q;  3CQZ B;  2F0Q A;  3ZJY C;  2EPB A;  5C0X J;  1EYG A;  5K36 H;  3GTP H;  3P20 A;  1GUS A;  2ZM6 Q;  2F0W A;  1N33 L;  5FLM G;  4R4T A;  1KIX A;  5IP9 G;  3A0J A;  1NTG A;  4FP5 D;  2Q2U A;  4KLK A;  3SK4 A;  3BS1 A;  4YCV A;  4DV2 L;  1AE3 A;  3ULP A;  5M5X B;  1SDF A;  2HIV A;  1EWI A;  1DGS A;  4KKU A;  4WJ4 A;  2KJX A;  2CQA A;  2PW5 A;  2EYO A;  1QVC A;  3PO3 G;  4K0K Q;  2LMC B;  2IWH A;  2WB1 E;  2VB2 X;  5DLQ E;  2EYJ A;  4JI6 L;  4JI2 Q;  2NVT H;  5HY6 A;  5IYD G;  1I50 H;  3HOW G;  1S3O A;  1VQ4 A;  1TU2 B;  1RTN A;  1DD2 A;  1BCP B;  1SNP A;  3GTP B;  2B39 A;  1F9R A;  2UUA L;  5KRU A;  1UWV A;  4ME3 A;  1AN8 A;  4DV3 Q;  1N33 Q;  1CQF A;  2K6A A;  1C0A A;  4DV5 L;  2FFK B;  4LF4 L;  4DFA A;  5JPM C;  3HOY G;  2GVB A;  3HS0 C;  4AYB G;  1TVX A;  3M4P A;  4DR3 Q;  1JJG A;  1RTO A;  1CKM A;  1HRJ A;  2VUM G;  3A7L A;  2PI2 A;  4DV0 Q;  1SYE A;  4K8J A;  1PRT B;  3TP6 A;  1U4R A;  3UE0 A;  3CC7 A;  3H0G G;  3PF5 A;  4BBR G;  2AUJ D;  3T56 B;  2YTV A;  1PYW D;  2NVT B;  1DYQ A;  1Y1W H;  4L5S A;  1I50 B;  4AQY L;  1Z6H A;  1RD9 D;  4FF3 A;  3M7G A;  4HIM A;  1VQ5 A;  3SVM A;  4BY1 H;  2IHE A;  1J6Q A;  2C35 B;  2RHS B;  4XIG S;  1V43 A;  4E6I A;  4DNR B;  4LFB Q;  4DF7 A;  2B2Y A;  3RN2 A;  1ENF A;  5LL6 S;  3KJP A;  2RDG A;  3DXJ C;  1XNQ Q;  5EGT A;  1Y14 B;  5CGK A;  3CCM A;  4LF4 Q;  4GZY C;  1NE3 A;  1OXU A;  1PFS A;  2KEN A;  1SNC A;  3C1E A;  4ILW A;  1HR0 W;  1PZI D;  5E4W C;  4RGT A;  3S1M B;  1EEI D;  1EUJ A;  5HGT A;  1X65 A;  3NEN A;  3MXP A;  3RZO H;  1RL2 A;  5D3I B;  1PH5 A;  3ICE A;  2UUC L;  3VR4 A;  1NR4 A;  3FVQ A;  3OIQ A;  1SAP A;  2A74 C;  3I55 A;  3HOZ H;  2NN6 I;  4DR5 Q;  3J80 c;  2EVB A;  2EJG C;  1ESR A;  2D2C C;  3VYR A;  1LLR D;  5KYL A;  5M3F H;  1Y1W B;  3TDQ A;  2AUK A;  1BO0 A;  2LXJ A;  2K05 A;  3BDC A;  1SE8 A;  2DN8 A;  3ZYY X;  2JA8 H;  5JJK A;  1FGU A;  1IBL L;  3KUP A;  5JPN C;  2Y0S G;  4A3G G;  3BDO A;  1L0W A;  3KF6 B;  1HXY D;  1K0R A;  3S2D H;  5AJ3 Q;  3CPW A;  3I3C A;  1WTP A;  2B63 H;  1VQ6 A;  1QUQ A;  3CW2 C;  3S16 B;  4RA8 A;  4L5T A;  3K0Y A;  1XJV A;  3GP7 A;  3I70 A;  4DR1 Q;  1J5E L;  1S5E D;  4J8Q A;  4B9X A;  3CHB D;  1XMQ L;  1B4O A;  1PTO H;  3NWT A;  2GVA A;  5IYC G;  5CR3 A;  2L1B A;  2JA5 B;  3TP7 A;  2B2U A;  4WFN 3;  3RZO B;  2PO4 A;  3F2U A;  2Z1C A;  3HG9 A;  4A3I G;  2ZTC A;  4A93 G;  3FPP A;  4LFA Q;  1IW7 D;  3A7A B;  5M3M G;  3HOZ B;  4FXG C;  1HR0 L;  2UUB L;  2JEA I;  1HCZ A;  1GJX A;  3D0F A;  4HTH A;  2E2H H;  5M3F B;  2VB3 X;  4DAV A;  3NQI A;  4LF6 L;  2JA8 B;  1B8A A;  3DUZ A;  2JA7 B;  3Q22 A;  2IL8 A;  1JB3 A;  4FXD A;  1EY9 A;  3S17 H;  1BBU A;  1NY4 A;  4DKA C;  2QIL A;  3HRZ C;  2NN6 H;  3S2D B;  4RHS A;  1K3B C;  2B63 B;  1BF4 A;  1FNV A;  1EWC A;  5M5Y H;  1Q81 C;  2ZXO A;  3NSW A;  1G29 1;  1T9H A;  2QDB A;  4DAP A;  4MTK A;  2K75 A;  3ER0 A;  1XMQ Q;  1I5F A;  1BUV T;  1H9R A;  1CZG A;  4FXK C;  4U68 A;  1WCM H;  3LX0 A;  1MSH A;  3R3O A;  2KHI A;  1X3Q A;  4NXM L;  3HOV G;  2H4O A;  4V19 0;  2F0S A;  3OMC A;  1L2F A;  2AWN A;  4KJO A;  5TSS A;  2I5H A;  2NZ1 D;  3HOU G;  3CRK C;  4C3H G;  3WOF A;  2E2H B;  2F0F A;  3MFY A;  3GTK H;  1FJG L;  5ISR A;  1CI3 M;  1SR3 A;  4QY7 A;  1MHW C;  1D6E C;  1GOZ A;  2AQ3 B;  2E2I H;  4EQN A;  2IX1 A;  4DR6 L;  1F9P A;  5JEA J;  1Q3L A;  1UAP A;  1STE A;  4JOI A;  2L9H A;  1KD1 C;  5IGF A;  1KL9 A;  1IYU A;  2JA6 H;  3OYY A;  4QL5 A;  1Z7T A;  1G91 A;  2OT2 A;  1B53 A;  4OHJ A;  2D62 A;  1WFQ A;  1C9O A;  3D4W A;  3G48 A;  3M3Y H;  1LT6 D;  3URY A;  1AH9 A;  1C7Y A;  4EQ5 A;  2Q2I A;  4X62 L;  1WTW A;  3RNU A;  4DUZ L;  3F2D A;  1BNZ A;  4G7Z C;  2QDL A;  1YNN C;  4JBK A;  2PZW A;  4JV5 L;  4CJ0 B;  1AEX A;  1XXG A;  4NXM Q;  1VMP A;  2DNC A;  4CDC C;  4KHP L;  1GHK A;  3MA2 B;  1S4Z A;  4PZ8 A;  4OO1 I;  3K59 A;  2G9H D;  3X3M A;  1HFG A;  5AFW A;  4G4K A;  3GTK B;  1XMO L;  2QKI C;  3VR3 A;  1HTL D;  2VY3 A;  3A5Z B;  1KLU D;  3TSS A;  2E2J B;  3V2T A;  2E2I B;  2A68 C;  3D8G A;  2PQE A;  5LHY 1;  1SNQ A;  3MXN A;  4A3F B;  1WJJ A;  4A3M H;  2XRS D;  5C3X A;  1D5X C;  3HOX B;  1BOS A;  1CSQ A;  4IOA A;  4B3R Q;  2ZTD A;  3M3Y B;  1SMX A;  2AWO A;  2F0M A;  2F52 A;  2F4I A;  2F3V A;  1KDA A;  1YHQ A;  2NTS A;  4JI8 Q;  4RGO S;  1KXL A;  4DNT B;  3OWF A;  4HJ8 A;  4KD3 A;  1LTT D;  2EIF A;  4JV5 Q;  4FDB A;  3PGZ A;  4KK7 A;  4A3D G;  2IX0 A;  4JI1 L;  1VQO A;  2M00 A;  2A1A A;  4C3J G;  1K8G A;  3T4A C;  4LW1 A;  1S40 A;  4GKJ L;  2KEE A;  3GTQ H;  2WKD A;  5KNC A;  2G5D A;  3FDT A;  4R8I A;  2MNA A;  1XMO Q;  3SK8 A;  1BCP F;  4CJ2 C;  2C5C A;  4OWT B;  3BZK A;  4GNX A;  1N36 Q;  3MZ5 A;  2LS0 1;  5C0X I;  1LT4 D;  5NUC A;  5GAD C;  1O7Z A;  2DJG C;  4OO1 H;  4A3M B;  3NTH A;  4JI7 Q;  1K9M C;  3NBH B;  1XTC D;  1A3V A;  2IHF A;  4WJ3 M;  4L5R C;  4KN7 C;  1CKN A;  1DJR D;  1F2Y A;  2F3I A;  3OPO A;  1JB7 A;  4FVM A;  2BA1 A;  5CBA E;  3ITP A;  1OXX K;  4RKB A;  2CWP A;  4A3J H;  1PRT F;  3UDF A;  5H1S E;  5CV9 A;  1JT8 A;  4DV6 L;  1S5B D;  3J7Y W;  2WB1 B;  3KF8 B;  3L7Z C;  4XTC S;  1PHJ A;  4IO9 A;  1FNW A;  4GKJ Q;  3GTQ B;  1TWA H;  4OON A;  1E22 A;  2NZH A;  5EKL A;  5CMD A;  2L4N A;  1XX8 A;  1QIL A;  1ILP A;  4CKB A;  2PI2 E;  1EZ8 A;  2JSO A;  4K5V A;  3WWV A;  5C44 G;  1XTD A;  1I94 L;  4A3L H;  3I56 A;  3Q8D A;  2ZTE A;  4GLV B;  3CU7 A;  1H9K A;  3T53 B;  2VL6 A;  5EPL A;  2H1E A;  3JAM c;  3HOU H;  4C3H H;  1PYS B;  1OXT A;  1DM0 B;  4UY8 C;  2OTJ A;  2RSN A;  5C0X H;  5EBD A;  2UXC L;  1A62 A;  2L5T A;  2R6G A;  3SK6 A;  1PDQ A;  5FJ8 H;  2K5H A;  4ABN A;  2Q8R E;  4A3E B;  4OWX B;  4O42 A;  3K7A H;  2F3W A;  3FMC A;  3STB C;  3GTJ B;  2X6G A;  4OX9 Q;  3A74 A;  2A6E C;  4DV6 Q;  2VQF Q;  1KDB A;  2KOL A;  3TEH B;  3PIO 3;  1OXS C;  1Q12 A;  4NXN Q;  2K5V A;  1TWF B;  2SOB A;  1TWH H;  3CME A;  4DR7 L;  1TWA B;  5E3F A;  3TQY A;  1ICW A;  3H09 A;  1A15 A;  1GVP A;  1Q46 A;  4KY5 A;  2PQA B;  2F4V Q;  1A2U A;  4DV7 Q;  1MD2 D;  3I4N H;  2CKZ B;  3KLS A;  2R7F A;  1PVO A;  3M4Q A;  3J7A 5;  3CPF A;  4EVO A;  5ELD A;  5EQ0 A;  4IFD G;  1CHQ D;  5J3B A;  1N32 Q;  1SRO A;  4V0B A;  1I6H H;  3I4M H;  1RDP D;  1SNO A;  3SK5 A;  4HMI A;  5HUR A;  3E9H A;  2KQ3 A;  2UXC Q;  3L9A X;  1B44 D;  2VNU D;  1ZKO A;  3CCS A;  2H5X A;  3K7A B;  4GOP C;  3PO2 B;  2EY2 A;  3T16 A;  4DGZ A;  2WII B;  1VQB A;  1TWH B;  2EJF C;  4XYQ A;  1H9S A;  4DR7 Q;  1F2M A;  4YHH L;  1VQK A;  1EIY B;  2N8N A;  3ERS X;  1D5Z C;  1Q8K A;  1EQV A;  1NSN S;  3VR6 A;  1Z47 A;  3NQT A;  3GO5 A;  4OEM B;  4PMB A;  1P16 A;  1EIF A;  2B8F A;  1DOL A;  4A3D H;  2B2T A;  2R61 A;  2Z6K C;  1C8C A;  1MKH A;  4DXG A;  4C3I H;  1BR9 A;  5IGB A;  1XPU A;  2PMZ E;  1VS0 A;  5GAH C;  1SMY C;  1N34 L;  1B3Q A;  4KV6 A;  2L0C A;  5GQO A;  1PTO F;  2DGY A;  1M4V A;  2UXB Q;  2EQS A;  1PZK D;  3VYU A;  1TY2 A;  1JOR A;  1W3S A;  1LYL A;  3CAM A;  4ZKC B;  2N78 A;  1Q90 A;  2F1M A;  2KCM A;  2JQO A;  4HCE A;  4A3C G;  4MTN A;  4NB3 A;  1XNR Q;  3HZX A;  2B29 A;  4NP5 A;  3OOC A;  1QNU A;  3JAM i;  1G2S A;  2R3Z A;  1VQE A;  1PFN A;  4ULL A;  3J7A V;  4J15 A;  1NBW A;  3E0J A;  2NVQ B;  1KDC A;  3OTO L;  1KHI A;  1O78 A;  1GKH A;  1X3G A;  5FLX c;  1WD0 A;  2FMM A;  4CBV A;  3UDX A;  5GRO A;  2YYZ A;  2E74 C;  1IBK L;  4IUU A;  2HUG A;  1BQQ T;  4UAI A;  3DMU A;  4A3B G;  2B2V C;  4RMF A;  1HQM C;  2K4K A;  4LNQ A;  3UDI A;  1EYC A;  1ESF A;  4Q0F A;  3H15 A;  2ZM6 L;  3J80 L;  2K28 A;  4IAL A;  1EU4 A;  1D1I A;  4APV A;  2CW0 C;  3VA7 A;  3K0X A;  1UEA B;  5DNF A;  4JI4 Q;  1E1O A;  3BJU A;  4RCO A;  4YY3 Q;  4YCU A;  2F0K A;  4XQJ A;  2JA5 G;  5FO8 B;  1EQT A;  1IHZ A;  3IL8 A;  4P75 A;  1X3E A;  1DXM A;  1K73 C;  3OMG A;  2EDG A;  1IL2 A;  4Y7N H;  4ZQ3 A;  4K0K L;  1NR2 A;  3UDG A;  4RHR A;  3IRB A;  5I2Y A;  4HSV A;  4JI2 L;  1X55 A;  4LMQ D;  4BXX G;  3QOL A;  2JA7 G;  1IYJ B;  4RCN A;  1WTQ A;  2MPM A;  1S72 A;  5BN5 A;  1PH6 A;  3PUW A;  4J1M A;  2J0T D;  1CHP D;  1O7I A;  4DV3 L;  2R93 B;  4X64 Q;  1JJ2 A;  3DWQ A;  4RH6 A;  2PW7 A;  1QG7 A;  4DR3 L;  3QIA A;  2EY6 A;  3E9I A;  3NPP A;  2A73 B;  4N9T A;  1S5F D;  4LFC L;  1RIP A;  4KHV A;  1RCV D;  4DV0 L;  4R1J A;  1B50 A;  5T1G A;  3V05 A;  3FKI H;  1V1P A;  3VA5 A;  1Y1V B;  2NYZ D;  1T5E A;  3GTL B;  3RZD B;  1XPO A;  4TKO B;  1SBB B;  2BOS A;  2AKW B;  3KDF B;  5JJI A;  5GAE C;  1Q1B A;  1KRS A;  1STN A;  2RCN A;  2A8V A;  2R92 H;  1Q8I A;  3TBI B;  2IX3 A;  3E6Z X;  4HID A;  4LF5 Q;  2KCN A;  4LFB L;  1EIG A;  1NCV A;  4JI3 Q;  4B3S Q;  4R4I A;  3S1N H;  4H02 A;  2OCE A;  4JYA Q;  1CSP A;  2K5N A;  1PH9 A;  5E4X A;  1GO3 E;  1XNQ L;  2OWO A;  1SYF A;  5JEA H;  2EY1 A;  1QCB D;  2KHJ A;  3OIP A;  1PXU A;  3RLF A;  5IIF A;  1AP0 A;  4LFC Q;  3U50 C;  3S24 A;  1YNN D;  5DM7 3;  1HZA A;  2FXQ A;  3FKI B;  2I5L X;  4IUN A;  4F8M A;  1R4Q B;  3T13 A;  4BA1 I;  3K8A A;  2EYP A;  2OEO A;  4DR5 L;  4XT3 B;  1D5M C;  2LSS A;  4MIU A;  2EYL A;  2ID0 A;  4KKS A;  1M90 C;  3QR8 A;  2N49 A;  4HMJ A;  4HIO A;  3G6J B;  2R92 B;  5CV6 A;  5IP7 H;  4ZKB B;  3KYH C;  1VMC A;  2A68 D;  3U4Z A;  2VQE Q;  4LF7 Q;  3K81 C;  1QE6 A;  3TN2 A;  4CDF C;  4IZ8 A;  1FNU A;  5AJ3 L;  4DR2 Q;  4A3F G;  1HUM A;  5C4X H;  3HOX G;  4KN4 C;  2K1B A;  3GTG H;  3EJI A;  1QVF A;  4P73 A;  1YIJ A;  3H3V I;  4DR1 L;  2TSS A;  2X69 A;  1B3A A;  4NPS A;  4KI0 A;  4EGV A;  1YJ9 A;  1JE5 A;  1X3F A;  2BDN A;  1A0I A;  2ZXR A;  1ZYR C;  4AH6 A;  1LTG D;  2KBN A;  3NHH A;  2F0I A;  2BE5 C;  3S14 H;  1PH7 A;  4LFA L;  1B70 B;  1VCI A;  4N9P A;  4B9W A;  1ILQ A;  3HGB A;  1VQI A;  2JP1 A;  3W5O A;  1SFO H;  1M8A A;  3BDL A;  3LWE A;  1PH3 A;  2Z9H A;  3RMH A;  1B7Y B;  4BY1 B;  1AZQ A;  3NTI A;  5CBE E;  3D31 A;  3PSI A;  3QO2 A;  5C4X B;  4LAA A;  5JJL A;  1VF7 A;  4H13 C;  1TWG H;  3K6O A;  4U67 3;  2X6L A;  3A54 A;  3WOE A;  4WOR A;  3BZC A;  1ICF B;  4KHZ A;  4CDD C;  5FK9 C;  1Y69 U;  2XRQ D;  3X3N A;  3AQQ A;  4KKT A;  4ME5 A;  4R9W A;  4WRD A;  1VQL A;  1U0L A;  3CRL C;  2WB1 G;  2HDM A;  3H3V H;  4UHV A;  5FLM H;  2Z0S A;  4EX5 A;  2XTI A;  1HNZ L;  1CK1 A;  5IP9 H;  1SFO B;  5ELC A;  3OWE B;  2EZV A;  1M1K C;  1GM5 A;  1TQO A;  2HQE A;  2WKC A;  3RR5 A;  5IT9 c;  3BYY B;  4X3K A;  2LXK A;  2ASB A;  1H9J A;  4KMU C;  1ZXT A;  2OQ0 A;  5FOB B;  4HJ7 A;  3A56 A;  3PO3 H;  3TP8 A;  1V1O A;  1YEZ A;  3ULL A;  1TWG B;  3BU2 A;  2YV5 A;  1BCP C;  3E0E A;  3Q24 A;  3VYS A;  3J7Z C;  2OF1 A;  4IFD J;  2EYM A;  1QUQ B;  2AMC B;  2RVL A;  4PMC A;  5IYD H;  3IFT A;  3HOW H;  4QJF A;  4BBS G;  1BDO A;  1PTO B;  3S2H H;  1G51 A;  3DM1 A;  1SSO A;  3HKZ E;  4A3E G;  4JG2 A;  3STB D;  2ZJP A;  4HED A;  2A6E D;  2QEX A;  1PH1 A;  4M1U B;  3JAM L;  4XXE A;  2WP8 J;  4MN3 A;  4DAY A;  3J81 c;  1XWE A;  1HNZ Q;  3P1H A;  1HUN A;  3HFZ B;  3E5S A;  5L37 A;  3HOY H;  3L0O A;  2QA4 A;  1UE6 A;  1PRT C;  4N8X 1;  1ONL A;  2EOT A;  2PMZ B;  3CXC A;  2F0H A;  5LMN Q;  5C6A A;  2PZU A;  4GN3 B;  2VUM H;  3S17 B;  1G6Z A;  2N55 A;  4NMZ A;  2RCF A;  2CCZ A;  2R7Z G;  2DJF C;  3F2C A;  1LT3 D;  5IYB G;  3PO3 B;  3M9B A;  4AIM A;  5M5Y B;  3H0G H;  3J80 i;  4BBR H;  5G3L D;  4HR7 B;  1C48 A;  1WTX A;  4B3R L;  1F2L A;  3PQI A;  3K58 A;  3W1G A;  4G7O C;  3FEW X;  1VQ7 A;  5JJZ A;  1HPC A;  3T1Y Q;  5ELF A;  1X54 A;  3CD6 A;  5ELB A;  3CCL A;  1WCM B;  4JI8 L;  2G9D A;  3D4D A;  3PO2 G;  2QCP X;  3PCO B;  4GOP A;  2A19 A;  1FD7 D;  4RAU C;  4DV4 L;  1ET9 A;  1LTR D;  3PUV A;  3PUY A;  1X32 A;  2EE1 A;  3DWA A;  3HOY B;  2CVR A;  2BCO A;  4LF8 Q;  3KFU A;  1NMF A;  1N36 L;  4ID6 A;  3JC6 6;  1O80 A;  1SND A;  2VUM B;  3W2D A;  4OIJ A;  3A8I E;  1GUW A;  1HA6 A;  1JOK A;  3CF5 A;  5LL6 X;  2XNA C;  4JI7 L;  3F2B A;  2JA6 B;  1L1O A;  5CV7 A;  3H0G B;  4DNI A;  2RSO A;  1WI5 A;  5D65 A;  2Z6K A;  1L0Y B;  1SMY D;  1SEB D;  2XWB B;  3IFD A;  4DK0 A;  2K04 A;  5C3E G;  4O2D A;  4JI5 Q;  3NWS A;  2ZT9 C;  4KJN A;  3D6W A;  1KRT A;  4DV1 Q;  2LFN A;  4UPA A;  4A3G H;  2B2Y C;  4YWK A;  1OTC A;  1RF2 D;  1WD1 A;  2KCC A;  4X66 Q;  1QB5 D;  1F2Z A;  1TS4 A;  2DY8 A;  1AZP A;  2F0O A;  4DV4 Q;  1TS2 A;  2IJ0 A;  4B3M Q;  4B3T Q;  4BY7 G;  4IJL A;  5A2Q L;  2PCF B;  3BVZ A;  4RWS C;  2QGQ A;  4DAM A;  5BR8 Q;  1HZB A;  2YU9 H;  5IYC H;  4A3K G;  2NTT A;  1TY0 A;  4A3I H;  4A93 H;  4IQZ A;  5KIX A;  1PH2 A;  3RD4 A;  4IPD A;  3J81 i;  5J39 A;  2XVS A;  3A55 A;  5M3M H;  2EJM A;  2B2V A;  3MXN B;  3QG1 A;  1Z9F A;  1B2T A;  5FLX L;  3C3L A;  2HHH L;  4G7H C;  1JMC A;  1V9P A;  2CW0 D;  3R2I A;  4NDX A;  4A3G B;  4OX9 L;  2VQF L;  3EFX D;  4GN4 B;  2P5Z X;  4NXN L;  4GN5 A;  1K8M A;  1PTO C;  3P75 A;  3LGJ A;  4NKL A;  4OXP A;  4R4Q A;  2O5J C;  2I07 B;  3HP3 A;  2HT1 A;  1PYB A;  5E7N A;  2CHB D;  2PPB C;  3QOJ A;  4LUV A;  1PH8 A;  1A63 A;  3F8T A;  4POG A;  2F4V L;  1V1Q A;  3EA6 A;  3KLS X;  5D3D A;  2JN4 A;  5BN4 A;  4DV7 L;  1JWM D;  3ND9 A;  5KNB A;  2YU9 B;  3AEV A;  3H94 A;  5ELE A;  1SJE D;  4A3I B;  3CKI B;  4GNX B;  3HOV H;  4A93 B;  4GKK Q;  1NUC A;  1P8L A;  1IBM Q;  4QB4 A;  4JC0 A;  1N32 L;  1LUZ A;  1MGS A;  2A69 C;  4O0A A;  2WAQ E;  4IPG A;  2EXD A;  2R93 G;  2HHH Q;  1CKN B;  1H9M A;  3EIV A;  1Q82 C;  4A3J B;  1JR0 D;  1HH2 P;  5IGD A;  3CC2 A;  4L8J A;  3SXH A;  1J8I A;  1NJI C;  2R7Z H;  3DEO A;  1RKN A;  3T51 B;  1YIT A;  1E0B A;  5I2X A;  1SYG A;  1Y1V G;  1RHP A;  2F0L A;  3RLN A;  2PNR C;  1YNX A;  4PNY A;  1SE4 A;  1BBW A;  3DLL A;  5CYU A;  4BWG B;  3UE1 A;  3H91 A;  4LJZ C;  3PIP 3;  4IN3 A;  3NK9 A;  1KTK A;  3HOV B;  4DUY Q;  5K36 G;  5JOB A;  1EYD A;  3GTM H;  3HOU B;  3ERQ A;  4C3H B;  4PZ7 A;  3I72 A;  3M4Y A;  2L11 A;  1Q1E A;  5EJW A;  4DXF A;  1B1Z A;  3OSO A;  2O2L D;  1J9O A;  2UXB L;  3FHW A;  3U9O A;  1MIU A;  5FKA C;  3CCE A;  2VS1 A;  4JOI C;  2UXD Q;  2J7Z A;  2Q2H A;  4G57 A;  1XNR L;  5K5P A;  4JBW A;  2UU9 Q;  4JVZ A;  1KC8 C;  1HZ9 A;  3RLO A;  1MBY A;  1YZ6 A; 
#chains in the Genus database with same CATH homology
 4TQU S;  1F77 A;  2FMC A;  4MHE A;  4KTA A;  3I4N B;  1EL0 A;  4ZLT F;  3P7J A;  1JIC A;  1FGB D;  4DA2 A;  2A6H C;  2K01 A;  2RDH A;  4R8N A;  3GTM B;  1I4R A;  5EKK A;  3PMF A;  1I6H B;  3TP5 A;  2QF7 A;  3I4M B;  3W3A A;  4KY6 A;  3H6M A;  2KVM A;  1GUO A;  2BA0 A;  5DM6 3;  2WAC A;  4KY7 A;  1ET6 A;  3KBG A;  1JOO A;  1YNJ C;  1ZYR D;  1V8Q A;  1KAB A;  3ONA B;  5JAV A;  3G7L A;  1S5C D;  2ZXP A;  4I65 A;  4XQN A;  1PLF A;  3D6C A;  1H9S B;  4O1N A;  3MTS A;  5I9P A;  3KLR A;  2L12 A;  2ICI A;  5IGC A;  4A3D B;  4CKE A;  1T5X D;  1SYB A;  3DWP A;  4C3J B;  1DON A;  4C3I B;  2QEJ C;  3C46 A;  5C4H A;  4IFD I;  3M4O B;  3HKZ B;  1F9S A;  1CFM A;  1EY0 A;  4HCS A;  3N52 A;  4F87 A;  4FYD A;  1A6X A;  2F0J A;  1F9Q A;  1DCZ A;  4QF4 A;  1I4H A;  1CA5 A;  1SYC A;  3NBI A;  2Z4H A;  1EFI D;  4IUT A;  5COY A;  4XT1 B;  3QJY A;  3FPU B;  3JAM E;  3BVG A;  5EBC A;  4K5W A;  4K6D A;  4CGY B;  4BS9 A;  5EKI A;  1B9M A;  4KD4 A;  4JK1 C;  1EU3 A;  2MJ8 A;  3SDZ A;  1ZEQ X;  3A8J E;  1C4Q A;  1BCP D;  1EYA A;  5IT9 L;  3K5L A;  1LT5 D;  1Y8O B;  1CA6 A;  4L6T B;  1ML0 D;  3DEP A;  2WIN B;  4FF2 A;  1SJH D;  4OL7 A;  4IFD H;  4Y7N B;  1SE3 A;  5IGE A;  4H44 C;  1O7L A;  4I7Z C;  2JYO A;  2Q8I B;  1PRT D;  2E76 C;  4RGM A;  1I4X A;  4QIW B;  2PYK A;  4ZAI A;  3M85 A;  1EZ6 A;  1LAC A;  1LTA D;  2NN6 G;  3J81 L;  4FNF A;  4DU9 A;  1LTI D;  2XWJ B;  4K8I A;  1LO5 D;  3RUZ A;  3VR5 A;  2MP1 A;  4K14 A;  3GQB A;  4FF4 A;  2F0U A;  1GUG A;  4QUF A;  2NWG A;  3S1R B;  2E2D C;  1SYD A;  1TWC B;  2JE6 I;  3A8K E;  1GUN A;  4QUC A;  1V1P B;  3SEB A;  2F0D A;  3GV3 A;  2XSC A;  5A2Q E;  1STY A;  1LAB A;  5DAU A;  3S1N B;  1W6J A;  4OIK A;  5D14 A;  1PZJ D;  3SHL A;  3AB9 A;  2NVX B;  2B2W C;  3MC0 B;  4QCL A;  3VR2 A;  2B2T C;  2E75 C;  1RJT A;  1TR5 A;  5FLX E;  4L63 B;  1E2V A;  1VDZ A;  4C56 C;  4K5X A;  1X3P A;  5CV8 A;  2RDF A;  3ND8 A;  1WTV A;  3V96 A;  1E2W A;  1JWU D;  1CT1 D;  1B9N A;  3O13 A;  4ZRZ A;  5IGG A;  1EEF D;  2K32 A;  4F88 A;  2WAQ B;  1D2B A;  4P2C B;  3J7A F;  1HA5 A;  2KA7 A;  2J4X A;  4DN4 M;  4HAE A;  1HHV A;  3GTG B;  1A3T A;  5I6W A;  1QWY A;  1UNS A;  3AMU A;  3Q6S A;  2L55 A;  4A3B B;  3NP8 A;  2F0G A;  3S1Q B;  3S14 B;  1CQV A;  4QMG A;  3OW7 A;  1PTO D;  3VYT A;  3TZU A;  1KLG D;  1CM9 A;  1EY8 A;  4IUQ A;  4ZYS A;  2SEB D;  3DHQ A;  1I4P A;  2NB0 A;  3MXG A;  4OO1 G;  2GA4 B;  2DY7 A;  5C4Z A;  1ENC A;  3C2P A;  2A69 D;  1G2T A;  2V4D A;  4C1N I;  3GV6 A;  1TII D;  3K5O A;  1JOQ A;  2K5Q A;  1QJO A;  1LV9 A;  4RGN A;  5CV5 A;  4FO2 A;  1STA A;  2B8G A;  3FRP B;  1HQR D;  1JCK B;  4LK1 C;  1U9R A;  1LTB D;  3I73 A;  3S15 B;  1EY7 A;  1CZW A;  1L0X B;  1TS5 A;  3NUC A;  3MWY W;  1JE4 A;  5IOD A;  3NE5 B;  2VXW A;  4XQQ A;  4IUV A;  1GXD C;  1EY6 A;  4DK1 A;  1BBX C;  4OGQ C;  3R8B A;  3PUZ A;  4X3S A;  4CHT B;  1SE2 A;  4H0L C;  5C0X G;  3HOW B;  4FF1 A;  1OXV A;  1QNK A;  3S2H B;  5M5W B;  1S5D D;  1D1K A;  2KUM A;  2F0T A;  1Y8N B;  2F0E A;  5FO9 B;  2EY5 A;  2PZT A;  4M8A A;  4F7X A;  3MAQ A;  1O7Y A;  3QWN A;  1WTO A;  1EWH A;  4AYB B;  1LTS D;  1TT2 A;  1DZ1 A;  2JEB I;  4S3S A;  3KK7 A;  3EQL C;  1II3 A;  2IW3 A;  2A6H D;  2RA4 A;  4NW2 A;  4BBR B;  2HDL A;  5KYI A;  3NTK A;  3MEH A;  1A2T A;  2WV6 D;  2NBF A;  4RKL A;  1FYC A;  1VF5 C;  3N6R A;  3U9S A;  4CJ1 B;  1AW7 A;  4K2L A;  1EIH A;  3J80 E;  2AQ2 B;  3NBH A;  1U4P A;  5C4J B;  5T1I A;  1YNJ D;  4XYO A;  2DNE A;  3D3R A;  3Q23 A;  1WVL A;  1I4Q A;  3MFG A;  2IPK D;  2KED A;  1PMR A;  3MVV A;  5I9O A;  4CKC A;  3KF8 A;  3EVQ A;  1XYI A;  1JQY D;  3NXW A;  2N88 A;  1NAP A;  3BVM A;  4YIJ A;  4C3I G;  3D4R A;  2NUC A;  2MGS A;  1BXT A;  2IT1 A;  1STG A;  4X3T A;  2EYH A;  2HCI A;  5A35 A;  2Y0S B;  5IT9 E;  2D9U A;  2EXZ A;  3H3V C;  2EYF A;  3OHX C;  2B2U C;  3R93 A;  3IKJ A;  3MHB A;  2Z8L A;  2C9O A;  3MXU A;  1IW7 C;  3UI2 A;  5M3M B;  4TRD A;  2TMP A;  5KEE A;  5M9O A;  2O5I C;  1MI2 A;  1G8Z D;  5KGU A;  3K5N A;  3J81 E;  1U4M A;  4K2K A;  1ROD A;  4B08 A;  1PFB A;  2K5D A;  2ICE C;  2F0P A;  1SNM A;  3ERO A;  4IUP A;  3IAY A;  5EPK A;  2F03 A;  3GTO B;  4Z9C B;  1EOT A;  1I3Q B;  3C1F A;  4BBS B;  5JVG 3;  1I4G A;  3HEJ A;  4ZUI A;  1R4P B;  5J22 A;  1Y8P B;  4PV1 C;  1HFN A;  1R9T B;  2RKS A;  2MHV A;  1UUP A;  2F0V A;  5BN3 A;  1TS3 A;  5IOC A;  5EPJ A;  1CTM A;  4HN7 A;  1STB A;  3LWU A;  1DOK A;  1GHJ A;  2R7Z B;  4X3U A;  4ZUJ A;  5C3W A;  4Q5V A;  1K83 B;  4XDX A;  2KHS A;  4C1N K;  3GD7 A;  1W6K A;  4UDU C;  3PUX A;  1U4L A;  1ENA A;  2XIW A;  2FIN B;  4RFB A;  3I8Z A;  2M2L A;  2AQ1 B;  1IL8 A;  5J1Z A;  3I91 A;  1HTP A;  2O4X A;  1JC7 A;  4EQO A;  1PFM A;  3L3O C;  1EY5 A;  3AU7 A;  4H7B A;  2JXM B;  5KND A;  5C5M A;  5FO7 B;  2K33 A;  5DEH A;  2SNS A;  2SNM A;  3SR1 A;  5JEA G;  4EQP A;  3K5M A;  1IYV A;  2B2W A;  3I4L A;  1TKW B;  2A5H A;  3K57 A;  3I90 A;  1STH A;  3TME A;  2K03 A;  2LKV A;  2F0N A;  2K5W A;  2BE5 D;  1SXT A;  2MUY A;  5C3E B;  3BYT B;  2HCC A;  5F2D A;  3WDN A;  1I6V C;  1WTR A;  5C5L A;  4TSS A;  2NVY B;  1IKL A;  1MSG A;  1A3U A;  5CV4 A;  3R2T A;  2ENB A;  4PQX A;  3BG3 A;  4BY7 B;  3S9W A;  4C2M B;  1GUT A;  1JWS D;  2FJ2 A;  5I6Y A;  2D5D A;  4A3K B;  5COR A;  2OXP A;  1KNE A;  3LNN A;  2KEC A;  3BZD B;  1OO9 B;  1AFP A;  2BDO A;  4WJW A;  2Q8T A;  5E1F A;  2LY7 A;  5I4D A;  1KNA A;  1KAA A;  1EY4 A;  4J6H A;  4K6L A;  5JVH 3;  2K7V A;  3M7N A;  1E2Z A;  3KBX A;  2FHT A;  2Z4I A;  5CC4 A;  2SDF A;  4BA2 I;  3QB3 A;  2RBM A;  2I46 A;  1IKM A;  2RQX A;  1FR3 A;  3TZD A;  1QOH A;  5G3L F;  2XN9 C;  1DOM A;  5C44 B;  4ODG A;  4ZK9 B;  3Q0A A;  1K8O A;  4IUR A;  3SE0 A;  4PMW A;  2M9V A;  3PV0 A;  4HSP A;  3CQZ B;  2F0Q A;  5C0X J;  2EPB A;  5K36 H;  3P20 A;  1GUS A;  2F0W A;  4FP5 D;  3SK4 A;  3BS1 A;  5M5X B;  1SDF A;  4KKU A;  2KJX A;  2CQA A;  2PW5 A;  2EYO A;  2LMC B;  2IWH A;  2VB2 X;  2EYJ A;  1TU2 B;  1RTN A;  1DD2 A;  1BCP B;  1SNP A;  3GTP B;  2B39 A;  1F9R A;  5KRU A;  1AN8 A;  1CQF A;  2K6A A;  2FFK B;  4DFA A;  5JPM C;  3HS0 C;  1TVX A;  1RTO A;  1HRJ A;  3A7L A;  1SYE A;  4K8J A;  1PRT B;  3TP6 A;  1U4R A;  2AUJ D;  3T56 B;  1PYW D;  2NVT B;  1DYQ A;  1I50 B;  1Z6H A;  1RD9 D;  4FF3 A;  3M7G A;  3SVM A;  4XIG S;  1V43 A;  4E6I A;  4DNR B;  4DF7 A;  2B2Y A;  1ENF A;  5LL6 S;  2RDG A;  3DXJ C;  5EGT A;  4GZY C;  5CGK A;  1OXU A;  1SNC A;  3C1E A;  4ILW A;  1PZI D;  5E4W C;  4RGT A;  3S1M B;  1EEI D;  5HGT A;  3MXP A;  5D3I B;  3VR4 A;  1NR4 A;  3FVQ A;  3OIQ A;  1SAP A;  2A74 C;  2NN6 I;  2EVB A;  2EJG C;  1ESR A;  2D2C C;  3VYR A;  1LLR D;  5KYL A;  1Y1W B;  3TDQ A;  2AUK A;  1BO0 A;  2K05 A;  3BDC A;  2DN8 A;  3ZYY X;  3KUP A;  5JPN C;  3BDO A;  1HXY D;  3I3C A;  1WTP A;  3S16 B;  4RA8 A;  3K0Y A;  3GP7 A;  3I70 A;  1S5E D;  4J8Q A;  4B9X A;  3CHB D;  1B4O A;  1PTO H;  3NWT A;  2JA5 B;  5CR3 A;  2L1B A;  3TP7 A;  2B2U A;  4WFN 3;  3RZO B;  2PO4 A;  3F2U A;  2Z1C A;  3HG9 A;  3FPP A;  1IW7 D;  3A7A B;  3HOZ B;  4FXG C;  2JEA I;  1HCZ A;  1GJX A;  4HTH A;  5M3F B;  2VB3 X;  4DAV A;  3NQI A;  2JA8 B;  3DUZ A;  2JA7 B;  3Q22 A;  2IL8 A;  1JB3 A;  4FXD A;  1EY9 A;  2QIL A;  3HRZ C;  2NN6 H;  3S2D B;  4RHS A;  2B63 B;  1BF4 A;  1FNV A;  1EWC A;  2ZXO A;  3NSW A;  1G29 1;  2QDB A;  4DAP A;  1BUV T;  1H9R A;  1CZG A;  4FXK C;  4U68 A;  3LX0 A;  1MSH A;  3R3O A;  1X3Q A;  2H4O A;  4V19 0;  2F0S A;  3OMC A;  2AWN A;  4KJO A;  5TSS A;  2NZ1 D;  3CRK C;  4C3H G;  3WOF A;  2E2H B;  2F0F A;  3MFY A;  5ISR A;  1CI3 M;  1D6E C;  1GOZ A;  2AQ3 B;  4EQN A;  2IX1 A;  1F9P A;  5JEA J;  1Q3L A;  1UAP A;  1STE A;  2L9H A;  5IGF A;  1IYU A;  1Z7T A;  1G91 A;  2OT2 A;  1B53 A;  4OHJ A;  2D62 A;  3D4W A;  1LT6 D;  3URY A;  1WTW A;  1BNZ A;  4G7Z C;  1YNN C;  2PZW A;  4CJ0 B;  1AEX A;  1XXG A;  1VMP A;  2DNC A;  1GHK A;  3MA2 B;  1S4Z A;  4OO1 I;  3K59 A;  2G9H D;  3X3M A;  1HFG A;  5AFW A;  4G4K A;  3GTK B;  2QKI C;  3VR3 A;  1HTL D;  1KLU D;  3TSS A;  2E2J B;  3V2T A;  2E2I B;  2A68 C;  3D8G A;  2PQE A;  5LHY 1;  1SNQ A;  3MXN A;  4A3F B;  2XRS D;  5C3X A;  1D5X C;  3HOX B;  1BOS A;  3M3Y B;  2AWO A;  2F0M A;  2F4I A;  2F3V A;  1KDA A;  2NTS A;  4RGO S;  4DNT B;  3OWF A;  4KD3 A;  1LTT D;  4KK7 A;  2IX0 A;  2M00 A;  4C3J G;  3T4A C;  2KEE A;  2WKD A;  5KNC A;  3FDT A;  4R8I A;  3SK8 A;  1BCP F;  4CJ2 C;  2C5C A;  3MZ5 A;  2LS0 1;  5C0X I;  1LT4 D;  5NUC A;  1O7Z A;  4OO1 H;  4A3M B;  3NTH A;  1XTC D;  1A3V A;  4KN7 C;  1DJR D;  1F2Y A;  3OPO A;  4FVM A;  2BA1 A;  5CBA E;  3ITP A;  1OXX K;  4RKB A;  1PRT F;  5CV9 A;  1S5B D;  3J7Y W;  2WB1 B;  3L7Z C;  4XTC S;  1FNW A;  3GTQ B;  5EKL A;  5CMD A;  2L4N A;  1XX8 A;  1QIL A;  1ILP A;  4CKB A;  1EZ8 A;  2JSO A;  4K5V A;  3CU7 A;  1H9K A;  3T53 B;  5EPL A;  2H1E A;  1OXT A;  1DM0 B;  2RSN A;  5C0X H;  5EBD A;  2L5T A;  2R6G A;  3SK6 A;  1PDQ A;  4ABN A;  2Q8R E;  4A3E B;  4O42 A;  2F3W A;  3FMC A;  3GTJ B;  2X6G A;  2A6E C;  1KDB A;  2KOL A;  3PIO 3;  1OXS C;  1Q12 A;  1TWF B;  2SOB A;  1TWA B;  5E3F A;  1ICW A;  3H09 A;  1A15 A;  4KY5 A;  1A2U A;  1MD2 D;  3KLS A;  4EVO A;  5ELD A;  5EQ0 A;  4IFD G;  1CHQ D;  4V0B A;  1RDP D;  1SNO A;  3SK5 A;  4HMI A;  5HUR A;  2KQ3 A;  3L9A X;  1B44 D;  2VNU D;  1ZKO A;  3K7A B;  3PO2 B;  2EY2 A;  3T16 A;  4DGZ A;  2WII B;  1TWH B;  2EJF C;  4XYQ A;  1H9S A;  1F2M A;  1D5Z C;  1EQV A;  1NSN S;  3VR6 A;  1Z47 A;  3NQT A;  3GO5 A;  4PMB A;  2B8F A;  1DOL A;  2B2T A;  2R61 A;  1C8C A;  4DXG A;  1BR9 A;  5IGB A;  1SMY C;  4KV6 A;  2L0C A;  1PTO F;  1M4V A;  1PZK D;  3VYU A;  1TY2 A;  1JOR A;  4ZKC B;  1Q90 A;  2F1M A;  4HCE A;  3HZX A;  4NP5 A;  3OOC A;  1QNU A;  1G2S A;  2R3Z A;  1PFN A;  4ULL A;  3J7A V;  3E0J A;  2NVQ B;  1KDC A;  1O78 A;  1WD0 A;  2FMM A;  4CBV A;  2YYZ A;  2E74 C;  4IUU A;  2HUG A;  1BQQ T;  4UAI A;  3DMU A;  2B2V C;  1HQM C;  1EYC A;  1ESF A;  4Q0F A;  3J80 L;  2K28 A;  4IAL A;  1EU4 A;  1D1I A;  2CW0 C;  3VA7 A;  1UEA B;  5DNF A;  4RCO A;  2F0K A;  4XQJ A;  5FO8 B;  1EQT A;  1IHZ A;  3IL8 A;  1DXM A;  3OMG A;  2EDG A;  4ZQ3 A;  1NR2 A;  4RHR A;  5I2Y A;  4HSV A;  4LMQ D;  3QOL A;  4RCN A;  1WTQ A;  2MPM A;  5BN5 A;  3PUW A;  4J1M A;  2J0T D;  1CHP D;  2R93 B;  3DWQ A;  4RH6 A;  2PW7 A;  1QG7 A;  3QIA A;  2EY6 A;  3NPP A;  2A73 B;  4N9T A;  1S5F D;  4KHV A;  1RCV D;  1B50 A;  5T1G A;  3V05 A;  1V1P A;  3VA5 A;  1Y1V B;  2NYZ D;  1T5E A;  3GTL B;  3RZD B;  4TKO B;  1SBB B;  2BOS A;  1Q1B A;  1STN A;  1Q8I A;  3TBI B;  2IX3 A;  3E6Z X;  2KCN A;  1EIG A;  1NCV A;  5E4X A;  1SYF A;  5JEA H;  2EY1 A;  1QCB D;  3OIP A;  3RLF A;  1PXU A;  5IIF A;  1AP0 A;  1YNN D;  5DM7 3;  3FKI B;  4F8M A;  4IUN A;  1R4Q B;  3T13 A;  4BA1 I;  2EYP A;  2OEO A;  4XT3 B;  1D5M C;  4MIU A;  2EYL A;  2ID0 A;  4KKS A;  4HMJ A;  3G6J B;  2R92 B;  5CV6 A;  4ZKB B;  1VMC A;  2A68 D;  1QE6 A;  3TN2 A;  4IZ8 A;  1FNU A;  1HUM A;  4KN4 C;  2K1B A;  3EJI A;  2TSS A;  2X69 A;  1B3A A;  4KI0 A;  4EGV A;  2BDN A;  2ZXR A;  1ZYR C;  1LTG D;  3NHH A;  2F0I A;  2BE5 C;  1VCI A;  4N9P A;  4B9W A;  1ILQ A;  3HGB A;  2JP1 A;  1M8A A;  3BDL A;  3LWE A;  3RMH A;  4BY1 B;  1AZQ A;  3NTI A;  5CBE E;  3D31 A;  3QO2 A;  5C4X B;  4LAA A;  1VF7 A;  4H13 C;  3K6O A;  4U67 3;  2X6L A;  3A54 A;  3WOE A;  4WOR A;  4KHZ A;  5FK9 C;  1Y69 U;  2XRQ D;  3X3N A;  4KKT A;  4ME5 A;  4R9W A;  4WRD A;  3CRL C;  2HDM A;  1CK1 A;  1SFO B;  5ELC A;  3OWE B;  2EZV A;  1TQO A;  2HQE A;  2WKC A;  3BYY B;  4X3K A;  1H9J A;  4KMU C;  1ZXT A;  5FOB B;  3A56 A;  3TP8 A;  1V1O A;  1TWG B;  1BCP C;  3Q24 A;  3VYS A;  2OF1 A;  4IFD J;  2EYM A;  2RVL A;  4PMC A;  3IFT A;  1BDO A;  1PTO B;  3DM1 A;  1SSO A;  4HED A;  2A6E D;  4M1U B;  3JAM L;  4XXE A;  2WP8 J;  4MN3 A;  4DAY A;  1XWE A;  3P1H A;  1HUN A;  3E5S A;  1PRT C;  1ONL A;  2EOT A;  2PMZ B;  2F0H A;  5C6A A;  2PZU A;  3S17 B;  1G6Z A;  2N55 A;  4NMZ A;  3PO3 B;  1LT3 D;  5M5Y B;  5G3L D;  4HR7 B;  1C48 A;  1WTX A;  1F2L A;  3K58 A;  4G7O C;  3FEW X;  5JJZ A;  1HPC A;  5ELF A;  5ELB A;  1WCM B;  2G9D A;  3D4D A;  2QCP X;  1FD7 D;  4RAU C;  1ET9 A;  1LTR D;  3PUV A;  1X32 A;  3PUY A;  2EE1 A;  3DWA A;  3HOY B;  2CVR A;  2BCO A;  4ID6 A;  1O80 A;  1SND A;  2VUM B;  3W2D A;  4OIJ A;  3A8I E;  1GUW A;  1HA6 A;  1JOK A;  5LL6 X;  2XNA C;  2JA6 B;  5CV7 A;  3H0G B;  2RSO A;  5D65 A;  1L0Y B;  1SMY D;  1SEB D;  2XWB B;  3IFD A;  4DK0 A;  2K04 A;  3NWS A;  2ZT9 C;  4KJN A;  3D6W A;  2LFN A;  2B2Y C;  1RF2 D;  1WD1 A;  2KCC A;  1QB5 D;  1F2Z A;  1TS4 A;  2DY8 A;  1AZP A;  2F0O A;  1TS2 A;  2IJ0 A;  5A2Q L;  2PCF B;  3BVZ A;  4RWS C;  2NTT A;  1TY0 A;  4IQZ A;  5KIX A;  3RD4 A;  5J39 A;  2XVS A;  3A55 A;  2EJM A;  2B2V A;  3QG1 A;  1B2T A;  5FLX L;  3C3L A;  4G7H C;  2CW0 D;  3R2I A;  4NDX A;  4A3G B;  3EFX D;  1K8M A;  1PTO C;  3P75 A;  4NKL A;  2O5J C;  2I07 B;  3HP3 A;  2CHB D;  2PPB C;  3QOJ A;  3EA6 A;  3KLS X;  5D3D A;  2YU9 B;  5BN4 A;  1JWM D;  3ND9 A;  5KNB A;  3H94 A;  5ELE A;  1SJE D;  4A3I B;  3CKI B;  4A93 B;  1NUC A;  4QB4 A;  1MGS A;  2A69 C;  1H9M A;  4A3J B;  1JR0 D;  5IGD A;  4L8J A;  3SXH A;  1J8I A;  3DEO A;  1RKN A;  3T51 B;  1E0B A;  5I2X A;  1SYG A;  1RHP A;  2F0L A;  2PNR C;  4PNY A;  1SE4 A;  5CYU A;  4BWG B;  3H91 A;  4LJZ C;  3PIP 3;  4IN3 A;  3NK9 A;  1KTK A;  3HOV B;  5K36 G;  5JOB A;  1EYD A;  3HOU B;  3ERQ A;  4C3H B;  3I72 A;  3M4Y A;  2L11 A;  1Q1E A;  5EJW A;  4DXF A;  1B1Z A;  3OSO A;  2O2L D;  1J9O A;  3U9O A;  5FKA C;  2J7Z A;  4G57 A;  5K5P A;  4JBW A;  1MBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...