1ZEQX

1.5 a structure of apo-cusf residues 6-88 from escherichia coli
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
METMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Cation efflux system protein cusF
publication title A Novel Copper-Binding Fold for the Periplasmic Copper Resistance Protein CusF.
pubmed doi rcsb
source organism Escherichia coli
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zeqX01
2VB3X 2L55A 2QCPX 1ZEQX 3TDQA 2VB2X 3E6ZX
chains in the Genus database with same CATH superfamily
1FL0A 1HZ9A 1FNVA 1TWGB 1JWSD 2B2TA 1CKOA 5I2YA 2F0UA 2UU9L 2HQEA 2A68D 3NENA 4HTHA 5D3DA 4F8MA 1G2TA 3D4WA 1FVIA 5EBDA 5DAUA 3GTPH 1PTOH 3UDFA 3SK5A 3QOJA 1QZHA 4LF4L 4A3JB 3W1BA 3A8KE 5GAGC 1FD7D 2C35B 1M90C 5JOBA 2F3WA 1AE2A 2I5MX 3JC66 3WOEA 1XTDA 1JOQA 3S1QB 2FMMA 4IPGA 2IWHA 3BDCA 3RD4A 1AW7A 2A69D 4JI8L 4UP8A 2N55A 2KCTA 1XMQQ 4JVZA 1ENCA 1Z9FA 3NEMA 1N36L 1H9KA 4POFA 1BXTA 3RNUA 3VA5A 1EY7A 3PMFA 4HEDA 4DV6L 4BY1B 4A93B 5FK9C 3AYHB 1L1OA 2EY2A 3TRZA 4KTAA 4JOIA 3M7GA 1JE4A 1DZ1A 1JOOA 1TS3A 3HKZG 4UP9A 2JYOA 3ITPA 4A3JG 2EVBA 1Q46A 1TS5A 1VQFA 1BR9A 1Q3LA 1PH6A 4MHEA 1QUQA 1WTXA 2K75A 1A2UA 4FXGC 3ER0A 3AU7A 2N49A 5J39A 2K1BA 2D2CC 2NZOA 4A3LG 4JI0Q 1HH2P 4LW1A 2HDMA 4XQJA 1XX8A 1IKMA 3A55A 4OWXB 2WV6D 3MTSA 1VQ8A 4QB4A 2Q2TA 3LWUA 1GJXA 3PO3H 1Q1BA 2B63G 1YJ9A 2DN8A 2LKVA 4ULLA 1FNWA 2D0PA 4BY1G 4A93G 4ALPA 1HFGA 2A6HC 3PGZA 4KV6A 3U9SA 3TP8A 4RKLA 1PH4A 2LMCB 3BJUA 2JA5B 3R93A 4K6DA 2FXQA 3WDNA 3S16H 3U50C 1W3SA 2EIFA 3PF5A 1YITA 2PNRC 3BZCA 1KTKA 3ULLA 3M4YA 1YZ6A 3BYTB 5FO8B 5EQ0A 4DV4Q 4TKOB 1YNND 1X56A 4PV1C 4A3EH 1NSNS 4R8IA 1N8RC 4H0LC 1U4PA 5CBAE 4DNIA 5IGEA 1XPRA 1G6ZA 3BU2A 5EPKA 3A8IE 3M7NA 1VQ9A 1H9JA 3S14B 2CHBD 1NY4A 2EDGA 3W2DA 2JA5G 1B8AA 2J0TD 3CPWA 2B8FA 3ZJYC 5JJIA 5AJ3Q 2VW9A 5FLXL 4C2MH 1SXTA 3T53B 1GO3E 2WFWA 1D2BA 1X3QA 1GXDC 1STAA 4A3CG 2NVXB 5DNFA 2NUCA 2VZAA 4G7ZC 1PH2A 2DUDA 4B3RL 2M9VA 3I8ZA 2HD3A 2CH4A 3VYTA 1GUTA 4IUTA 2CFMA 1XMQL 4QUFA 1LM0A 1CFMA 2F0KA 2QEJC 2RHQB 4P72A 1R9TH 5KEEA 5M5XH 5G3LD 4RHSA 4RA8A 5FJ8G 1SNDA 3GTPB 5BN5A 1PTOB 3C1EA 4UPAA 4IJHA 5CC4A 4C1NI 3T1HQ 1RKNA 3QOLA 5IP7H 4B3TQ 1GUSA 1Z47A 1QG7A 4MIUA 4DR2L 5EBCA 4IPHA 4OELB 2A19A 4G7OC 3NWSA 5EKKA 1SYGA 2Z6KC 1PYSB 4JI0L 5CGKA 3CCVA 3JAME 4DR5L 1JE5A 2HIXA 4L5RC 1EL0A 4E6IA 4DR4Q 3VYSA 2Z4HA 4A3IH 1E2WA 2NYZD 3IFDA 2UXCL 1VQGA 2DJFC 1VQCA 4LF8Q 1EFID 1LT5D 3DXJC 2KCMA 5CV4A 2D5DA 1MIUA 1JJCB 4X64L 2KECA 2XGTA 5D14A 3SK6A 1GHKA 2EYJA 4JBJA 3SXHA 2RBMA 5LMNW 1LT3D 4BWGB 1T5EA 4Y52H 3E5SA 3J7YW 1TS4A 2PMZB 5IT9c 3H3VH 3I4MH 1ET9A 3CD6A 4KD3A 3A54A 1HHVA 3H0GH 2A6EC 2QA4A 4DV4L 4BBSG 2N8NA 5IGCA 4LJZC 3NTHA 3GQBA 4YCUA 3HOWH 1A6XA 5I6WA 1VQJA 3PO3B 4BXXG 2MUYA 3H15A 4JYAQ 3SR1A 3OMCA 2F0GA 3GTLB 4EQOA 1SNPA 1LTBD 4JW0A 1OXUA 4GKJQ 1B3QA 4DF7A 2AHOB 3S16B 3D4RA 1AFPA 1PH5A 1GUNA 2L55A 3TZDA 1K83H 3UDGA 1Q8KA 1SNCA 2SEBD 2F3VA 4DV2Q 3KYHC 4GOPB 4KI0A 5CV8A 4HN7A 3DMUA 4NPSA 4A3EB 1BDOA 1HJPA 1PDQA 2E8GA 4FF4A 1N34Q 1B7YB 3QWNA 1SROA 1X32A 3PO3G 1PH1A 1SSOA 1U4LA 2NZ1D 1R4QB 4KN4C 1HA5A 1IYJB 4X3KA 3RZOH 3E0JA 1EY8A 5GADC 3ULJA 1S5BD 4IPCA 3BS1A 3T1HL 4FYDA 1XWEA 2K03A 4FNFA 1G291 4R4QA 2E74C 5D3IB 3DHQA 2LFNA 4B3TL 3J7AF 4YY3Q 5H1SE 1VQDA 2QKIC 2DJGC 2F0VA 3GV3A 3U9OA 3PIOA 4R9WA 1SFOH 3L0OA 4DV7Q 3J80i 3HS0C 1ESFA 3CCUA 2YYZA 4KJOA 2BA0A 4DK6C 1S72A 4TRDA 2KCNA 1PYWD 2KHJA 4A3EG 4OO1H 2ZM6Q 1LTAD 4M1UB 4HSPA 1Q90A 1WFQA 1KLGD 4DR4L 3V96A 5M5XB 2AQ3B 1B1ZA 3KBGA 4O0AA 2LXKA 4AH6A 2L5TA 4LF8L 1CA5A 2PZUA 1V43A 1K0RA 2WAQE 1ASZA 3RN5A 5C5MA 2O5IC 4PMWA 3SGIA 4JI6Q 5JEAJ 2IX3A 1I5FA 4OWWB 3D6CA 2LS01 2ZTDA 3KLSX 2Y0SE 3CMEA 1L0WA 3G48A 2AKWB 1IL8A 3J7ZC 5T1IA 4LFBQ 1F2ZA 1X65A 1I94Q 3J80c 3NTIA 4YWLA 1A0IA 1WCMH 1LT6D 4P73A 2FJ2A 2IJ0A 4FXKC 2CKZB 4UDUC 2MJ8A 5C0XJ 1PRTD 5GAEC 5GROA 1NMGA 4JYAL 1K3BC 2A74C 4I7ZC 4LFAQ 5IYDG 1QVGA 1K3RA 3UE0A 5IP7G 2L11A 4GKJL 3OOCA 2Q8RE 3W1GA 1C4QA 1STNA 5COYA 2Z4IA 2WIIB 3L7ZC 1VCIA 3J81i 1VQ7A 3AMUA 1IXRA 1PLFA 1STBA 3KJOA 4X62Q 4GNXA 3H0GB 3T16A 3A56A 3I56A 1BBXC 1XNRL 5C3EH 2O2LD 4JC0A 3MEFA 4PZ7A 1N34L 2ATWA 3VDYA 1IYVA 4DAMA 1UE6A 1DM0B 5ELNA 3ND8A 2LXJA 4ZKBB 2L0CA 4MTKA 1SJHD 2BDNA 4H44C 3UDIA 3CCLA 5M5WH 1AZQA 1SNMA 1JICA 3NK9A 1HNWQ 1E22A 2B2YC 1K83B 1SNQA 2EYMA 1PZJD 2K52A 4DV7L 1QB5D 2MQHA 3J81c 3W3AA 2L1BA 3DWPA 1BQQT 1TY2A 1H9MA 5JVG3 4KMUC 1VQPA 4DV3Q 5CR3A 2BE5D 1M8AA 5A2QL 2ZM6L 2R92H 1G51A 3Q23A 5JAVA 4NP5A 4WJ4A 2K32A 1YHBA 3KDFA 1F9SA 1KAAA 5IGDA 3RZOB 1NR4A 1SRUA 1LTLA 3DM3A 3ULPA 3MFYA 4NKLA 1YHQA 2F0IA 3FHWA 1U4MA 5EAYA 4DN4M 3RR5A 1D7QA 5K36G 1EOVA 1B70B 1SFOB 1LLRD 1HR0Q 1OXXK 2EY1A 1QVFA 1ZXTA 4OHJA 3J81j 3UDXA 3IKJA 1TR5A 1HXYD 1X9NA 4LFBL 1LABA 4R4OA 3L3OC 3CXCA 2ZJQA 4LF9L 2XVSA 2K5WA 4KY6A 3OIQA 1V1PA 2ASBA 4DUYL 2SOBA 3K80C 2J7ZA 1NCVA 2E76C 1EY5A 5I9PA 1I50H 4JV5Q 2F0LA 4YWKA 2EJMA 4GN3B 3HZXA 1VQIA 1EOTA 2AQ1B 3E9HA 3R2IA 4BBRH 5C4XG 4LFAL 1S5ED 4XIGS 2HHHQ 1EYCA 5IYCH 4HMIA 4OIKA 3K5MA 3K58A 3H6MA 4K8IA 5JEAG 3PUYA 3QG1A 1EYGA 5IYBH 2ZXOA 1X54A 1XMOQ 2MHVA 1HCZA 2F4VL 4X62L 2L12A 4A75A 4RKBA 1B3AA 2RDHA 1WCMB 3FEWX 2L9HA 4CGYB 4OO1G 4GLXA 4JI4Q 4HIOA 5CBEE 1KQSA 2UXBQ 1YI2A 2HT1A 3GTMH 1YNJC 3TBIB 1E2VA 1EQTA 5C0XG 2TMPA 5G3LF 1U9RA 5ELBA 1D5MC 1YJWA 1U4RA 2EPBA 3I55A 2WKDA 1QNKA 3GO5A 1PFSA 1Y1WH 4ME5A 1D8LA 4DAYA 4LF6Q 1VQNA 4YWMA 3KJPA 2ICIA 2XRQD 1WCMG 1SLJA 4C3HH 1Q82C 1GVPA 2K7VA 3AB9A 2AUJD 1J8IA 2FFKB 2GA4B 4OWTB 4ABNA 1BCPC 5M3MB 2K5QA 2JSOA 2XWBB 4LK1C 1CI3M 1O7LA 3A5UA 1N32L 4PMCA 4DXGA 2CCZA 1M4VA 1YHAA 3T1YL 1UE7A 2J4XA 1STGA 3ERQA 3NP8A 5I6YA 1UEBA 4P2CB 4FF2A 4DR7Q 1JB3A 2E2HH 1NE3A 4RGNA 4KY7A 3A8JE 2PI2E 2PZTA 5BN4A 1UNSA 3M3YH 5E4WC 2JA6H 5JPNC 1NAPA 2C9OA 1HPCA 4X66Q 4NXNQ 4YHHL 1PFMA 4JV5L 3RLNA 2RDFA 5M3MG 1ENFA 2F0OA 1JJ2A 2OT2A 3S1RH 2I46A 1KNAA 4GS3A 3D8GA 4JI1L 2HHHL 3FKIH 2X6LA 4U68A 5ELDA 4IUQA 2BOSA 2RVLA 3S2DB 3JAMi 4IFDH 1KC8C 2WAQB 3DLLA 3TSSA 4ZK9B 4DUZQ 1J5EL 3J7AV 1K8AC 1XMOL 1I3QH 1XYIA 3BVMA 2CWPA 1HNXL 5ELOA 2IY5B 2Y0SB 1STHA 1ONLA 3MZ5A 4JI4L 4F88A 1PYBA 4NDXA 2D9UA 4RGTA 1TWAH 1EEFD 1VQEA 1H9SB 1F2MA 3J7A5 1KDCA 2Z6KA 3QR8A 1KXLA 3B6YA 4IUPA 2ID0A 1A62A 5HGQA 4IFDJ 1JORA 3R2TA 4LWCA 1WTOA 3F2BA 3HOYH 3ERSX 5IT9L 1JMCA 2RSNA 4AQYL 1WTVA 1K73C 2UXDQ 1S3OA 3KF6B 2KEEA 2WAQG 4L5QA 4L8JA 5T1GA 2NB0A 1PXUA 1V1PB 1VMCA 3JAMc 4XYOA 1SR3A 4ZKCB 3AFPA 3HRZC 4RH6A 3HFZB 2Y0SG 2B2VC 5C4JB 5IE8A 2GVAA 3M4OH 1VQ5A 4JBMA 4LFCQ 3GTMB 3QJYA 1PH9A 1FJGL 2WACA 4DA2A 5E7NA 3HP3A 4MTNA 1AN8A 2OTJA 4OIJA 1TWFH 3CCSA 2PI2A 2CQOA 4K2KA 5D65A 3T51B 1RTNA 4DAVA 1EUJA 3K81C 4HIMA 5A35A 4A3DH 2CQAA 5IYCG 1Y1WB 1EYAA 4K8JA 4LF7Q 1SAPA 4KHVA 2GVBA 5FLMH 1I6HH 2OTLA 3NBHA 1HZAA 5IYBG 4RWSC 5LL6X 1CZGA 4DR7L 5KRUA 4BA2I 3G4SA 4RFBA 1Q86C 4APVA 3CRKC 4C1NK 2H4OA 4C3HB 2Q2HA 2M00A 1A3TA 4K14A 2E5LL 1Q12A 2DY8A 2K5VA 4IUNA 2IHEA 5AFWA 4A76A 2ZT9C 1Z7TA 1XXGA 4A4IA 1PRTF 2OCEA 1IBLQ 3S2HH 2A6HD 1HFNA 2MGSA 2ZJPA 2NN6I 4X66L 3HEJA 2VQFQ 4POGA 3I4NH 3HOUH 1EY9A 2ZJRA 2JA8H 1ET6A 3FDTA 4WJ3M 2F0NA 4YCVA 5IOCA 2D0OA 4GZYC 3S1MH 2UUAQ 4QF4A 1LTSD 3E9IA 5JVH3 1Y1WG 3CQZH 4DAYB 2YU9H 1MGSA 4JBKA 2N88A 2QDLA 4ZRZA 1PTOC 3KLSA 1HUNA 2JXMB 3N6RA 5C3WA 2E2HB 3EQLC 1KABA 2F0DA 1F9RA 2EY6A 4V0BA 2EE1A 3BDLA 4DV5Q 4C3HG 1E1OA 1Y69U 1PFNA 4JG2A 5IGBA 1MJCA 3OWFA 4RCOA 5A2QE 4LF5Q 2JA6B 4QL5A 1QWYA 1Y1VH 2QGQA 2G9HD 4IPDA 2B2TC 3TP7A 4U673 1Q81C 1ZYRC 1EIHA 2DGYA 4K6LA 4CDFC 4NXMQ 2FMCA 4RAUC 1TVXA 4XT1B 3MWYW 3FKIB 2RSOA 1QZGA 4CJ1B 3KOJA 2PO4A 4RCNA 2K04A 3STBC 4IQZA 2R7ZH 1Y8PB 4R4CA 2UXDL 2FHTA 3MXPA 1PH3A 2B3GA 2EJFC 1SYCA 1EEID 2KBNA 1PV4A 2ICEC 5IWAQ 1YIJA 1FYCA 1EFWA 1T9HA 5ISRA 2JA6G 3EJIA 1TWAB 1C48A 2F0WA 1SYBA 5J1ZA 1A3UA 5CMDA 1U5KA 2F0TA 3HKSA 4EGVA 3DM1A 3WWVA 1MD2D 3I3CA 4DR6Q 2K5HA 1IW7C 3FKIG 3EN2A 3DUZA 1GUOA 3H09A 3PSIA 1MJEA 4IFDG 2RQXA 2RCFA 1D1IA 3NBIA 4O1NA 1B53A 4LUOA 4CKEA 3GTGH 1IL2A 4HCEA 3GTKH 4OL7A 3VYUA 1B9MA 3HOVH 3G71A 1QNUA 4GOPC 3EROA 2IHFA 3NQIA 5C0XI 1RODA 3KBXA 1RL2A 3S24A 1L1OB 1BBWA 1TWFB 2I5LX 2VQFL 2B39A 1TXYA 4K5WA 1PVOA 4NMZA 4OGQC 1IKLA 4J1MA 1PH8A 3MXGA 3AFQA 3RN2A 1SN8A 4A3DB 5KIXA 1BO0A 1CM9A 1M1KC 5AJ3L 4UY8C 1QUQB 2NWGA 1WYDA 3SE0A 1G91A 4ZCKA 3AEVA 3M4QA 3M4PA 2A6ED 4HCSA 1SMYC 3CW2C 4X6AH 5C3XA 2ZXPA 4KJNA 2DNCA 1VS0A 4G4KA 1HTPA 1V8QA 1HQMC 2SNMA 1WVLA 2B2YA 4LF5L 3S2HB 5KNCA 3HGBA 2F0HA 3I4NB 3F2CA 3HOUB 2CVRA 3L2PA 2JA8B 1U0LA 3T13A 5M9OA 1QE6A 1I4QA 1I4HA 1LTTD 4S3SA 3S1MB 1ZEQX 4NXML 4DNTB 1HR0W 4A3DG 1E1TA 4RGOS 3CQZB 4C2MB 2K28A 3NBHB 5FLMG 1BUVT 4KHPQ 4CBVA 1KRSA 5JJZA 4C3IH 5IODA 2KCCA 4ZYSA 3OIPA 1EZ8A 4HJ8A 2XNAC 4ODGA 5IWAL 2K4KA 5C44H 3TEHB 1R9TB 2EXDA 3I4NG 3HOUG 4A3GH 1DONA 2JA8G 4Z9CB 2QCPX 2WB1E 3EIVA 4KHZA 4DR6L 1B44D 3VYRA 4N8X1 3RUZA 2I0QA 1EIYB 4L5TA 2R7ZB 4N9TA 3CCEA 1MHWC 2CW0C 2EXZA 1CSQA 1S5DD 3HKZE 2WINB 1MKHA 3KLRA 4DKAC 2QW7A 3RLOA 3DEOA 1ASYA 3KFUA 3H3VC 2QILA 5K5PA 4IOAA 3TS2A 5M3FH 4A3IB 3BYYB 4KLKA 1QJOA 4FVMA 1W6KA 1PZID 2VS1A 4Y7NH 2ZXRA 4LMQD 1A3VA 3PO2H 1PH7A 4DAPA 5IT9E 3K57A 1G6PA 3GV6A 2B2WA 1CQFA 2R7ZG 4LNQA 4XYQA 1PRTB 1DGSA 1P16A 1LT4D 3D4DA 3I4MB 3IRBA 4DV2L 3GTGB 2RKSA 3GTKB 1I4PA 4HAEA 1I6VC 3HOWB 3PQIA 4DK0A 1X3GA 1XJVA 3I73A 5LMUQ 4CJ2C 2EOTA 4QJFA 2PNHA 1Q8IA 3FMCA 4A3IG 2X69A 1V1QA 3BVZA 1AE3A 2AMCB 4KD4A 4KY5A 2GN5A 1QILA 1SJED 4FO2A 5C6AA 1Q7YC 2IPKD 1EQRA 3P1HA 4XDXA 4IZ8A 1SEBD 4YY3L 1DOMA 1LYLA 2SNSA 4QQBX 3I4MG 4IALA 5IGFA 4DR3Q 3K7AH 1H95A 3H0GG 3CCQA 3FVQA 5FOBB 2K01A 1YBYA 1I4XA 4DNRB 3HOWG 2F1MA 3G7LA 4KKSA 5I4DA 1E0BA 1J6QA 4GKKQ 3T56B 4X3TA 1OTCA 5KNDA 1JB7A 1C8CA 1X55A 4IN3A 1K8MA 2BCOA 3TDQA 3I91A 3I7FA 4HIDA 1D6EC 1A2TA 5DLQE 5FLXE 2L4NA 2OF1A 4JI6L 1MSHA 2JJQA 2JA9A 2NVQH 4CDDC 2ES2A 4BA1I 4X65Q 4C3IB 1TKWB 3RZDH 1I94L 4PQXA 1GUWA 4B08A 5C44B 1V9PA 4JI2Q 1SYEA 1WJJA 4IURA 4B9WA 4JI3Q 3TP5A 4A3GB 4DV0Q 4WORA 1BNZA 1ICFB 1B50A 3A7AB 1WTPA 4C3JH 2XSCA 4JBWA 2HQLA 1UE5A 5IP9H 5CV9A 3MXNA 4LUZA 3JAML 3HG9A 3E6ZX 4XQNA 4DK1A 1TWHH 1Y8NB 3CP0A 2UU9Q 2M2LA 4A3MH 4QIWE 4OEMB 2B63H 4JI5Q 4BY1H 4BS9A 1UAPA 4R4TA 1JQYD 3G6EA 1NR2A 5LMUL 3S15H 4JK1C 5M3FB 4NB3A 2P5ZX 4I65A 1YVCA 1HQRD 4DU9A 4Y7NB 4DGZA 3PO2B 4KN7C 3FPPA 2B2VA 2BH2A 4JI8Q 4R1JA 1EQVA 1HNWL 5EJWA 4EVOA 5DM63 4N9PA 4LUVA 1W6JA 1WD0A 3R8BA 1AZPA 1L0XB 1CT1D 3TP6A 5C3EB 1WI5A 4TVAB 3URYA 4UAIA 4F7XA 2R93H 1VQ6A 4CJ0B 1LTRD 3LGJA 1YNJD 4DV3L 1UEAB 3VR3A 4FDBA 4RG1A 3LNNA 3X3NA 4GKKL 2IT1A 3CF5A 3RLFA 2HUGA 1EZ6A 1O7YA 1VQHA 2F0JA 2Q8IB 1CKNA 3K6OA 3PF4A 2F03A 3BVGA 3PO2G 4F87A 5M5WB 4A3CH 2V4DA 2EYOA 3V05A 1EIGA 3SDZA 3Q8DA 1WTHA 2R61A 2B2UC 3DEPA 1HR0L 1X3FA 2IX1A 4X65L 4GNXB 1X3PA 3K7AB 2G9DA 4K5XA 2B29A 4CKCA 2WKCA 2R6GA 3OTOQ 5C3EG 1O7ZA 3NUCA 2K50A 3N52A 1DJRD 3MFGA 2A68C 3QO2A 3A0JA 5JPMC 2JQOA 2R92B 3T4AC 3S9WA 2OWOA 4O42A 4DXFA 1BCPD 2RCNA 4DV0L 2A5HA 2VNUD 3PUXA 3D0FA 4ILWA 2VB3X 1NTGA 3MXUA 2AUKA 4X3UA 5KGUA 4QCLA 3O13A 2NVQB 3VR5A 2H5XA 2WB1B 5EKLA 2BA1A 1TQOA 2ZTEA 2HDLA 2A69C 3RZDB 3KUPA 5FKAC 2I07B 1JC7A 4WFN3 2KA7A 2MP1A 2QDBA 1ESRA 4JI5L 2E2DC 2R7DA 1ML0D 2OEOA 1C7YA 2MO1A 2R92G 4EX5A 3HKZB 3KDFB 1K28A 1EQQA 2VY3A 1YJNA 2UXBL 2AQ2B 3U4VA 1I50B 4G57A 4GN5A 4C3JB 3DWQA 4BBRB 3DWAA 1BBUA 1CSPA 2K5DA 2Z8LA 1RCVD 3PUZA 3CMAA 1YEZA 3L9AX 2JN4A 4B3RQ 2YTXA 3KK7A 3CCJA 2WB1G 4BBSH 1VMPA 3VR6A 3HOZH 2ZTCA 3I2ZA 3A7LA 1TWHB 4LF6L 3CC7A 4A3MB 4BXXH 1SE2A 1P8LA 2B63B 2LSSA 4L5SA 3Q6SA 1LV9A 2Z9HA 1XTCD 3NPPA 4JPBW 4A3KH 3S15B 3IL8A 1DCZA 1WOCA 1SYFA 3Q24A 3KLWA 2CH4W 4QGUA 4AYBE 2XRSD 4OX9Q 1L0YB 3CRLC 4ZQ3A 4DR2Q 2TSSA 1HNZQ 1EWHA 4PG3A 4QY7A 4J8QA 1X3EA 3I4OA 4C3JG 4BBRG 3P75A 5IP9G 1XNQQ 1A63A 4R4IA 5BN3A 1NNXA 5DEHA 1ILPA 2JK8A 3BZKA 3MXNB 4GOPA 2F52A 4DR5Q 1S40A 2HCCA 1AH9A 3V2TA 2E2JH 1YNNC 3A5ZB 1E24A 4A3MG 1VQLA 1UE1A 2R3ZA 3SHLA 2UXCQ 2A1AA 2MFIA 2PCFB 3OTOL 2R93B 3GTLH 4X64Q 2NVTH 1TS2A 3K0XA 4FP5D 3NXWA 1JR0D 4HIKA 2VL6A 3CHBD 2RDGA 1LTID 1MBYA 2KQ3A 4NXNL 3LX0A 4J6HA 3EA6A 3NSWA 4CHTB 3BZDB 3TN2A 1F2LA 3Q0AA 1BKBA 1EU3A 3MC0B 5GQOA 2PPBC 4O2DA 2EZVA 3H3VI 1UWVA 3MHBA 1UUPA 1Y14B 3AQQA 1GD7A 5ELEA 1VQMA 2EJGC 4DUZL 1IHZA 2F0FA 1I4GA 3BDOA 2R93G 5HURA 3K5OA 1YNXA 3M3YB 4PZ8A 5E1FA 1FGBD 2E2IH 1QOHA 4WRDA 4UP7A 5BR8Q 1CKNB 4UHVA 3OW7A 2K14A 2G5DA 1VQOA 3S1RB 4GLAC 4DK3C 1SMXA 1D5XC 1ICWA 4P71A 1HRJA 5CORA 1OO9B 1PTOD 5GAHC 1XPOA 2PQAA 2HIVA 4MNOA 1K8GA 1SNOA 3NWTA 2PW7A 3MVVA 1VQKA 3J80L 5ELFA 2F3IA 4JI7Q 2DY7A 3UI2A 1I3QB 1EWIA 2NTSA 4YCWA 1CHQD 2Z1CA 1LUZA 2F0EA 2K33A 2I5HA 3FPUB 4PMBA 5IYDH 4XT3B 1EWCA 1CK1A 4LFCL 3MA2B 1ZYRD 1RDPD 4OX9L 3Q22A 4QIWB 4TSSA 2EYFA 3E3XA 1KDBA 1IBKQ 1HNZL 4P75A 2BDOA 3K5NA 1RIPA 1V1OA 4A3BH 4IO9A 2KOLA 3STBD 1XNQL 1XPUA 2K5NA 3HOYB 1L1OC 2UUCQ 4BBSB 4ME3A 4JOIC 3HOZB 3SEBA 1CUKA 3RMHA 4LF7L 1GKHA 5NUCA 3PUVA 2RA4A 2XN9C 3FP9A 4ID6A 1WTWA 2PZWA 4P74A 4OO1I 2SDFA 4A3KB 3QIAA 2A8VA 1KIXA 5E3FA 4I7AA 2AWOA 3M4OB 2VB2X 2NN6H 4A3FH 3C2PA 4IJLA 3UE1A 1NBWA 3TZUA 1IBLL 5I9OA 4K2LA 1GM5A 4B9XA 2OQKA 1RD9D 1IW7D 1W2BA 4B3MQ 1B2TA 3CCMA 1SDFA 2EY5A 3HOYG 1QVCA 2UUAL 4R8NA 1RF2D 3HOZG 1I6HB 4KKUA 3J81L 1AEXA 1GUGA 3K59A 3K5LA 2E2JB 3K8AA 1ILQA 1F77A 1Z6HA 5M5YH 2Z0SA 3NQTA 1I4RA 1FGUA 1EY0A 3KF8A 4A3KG 4DV5L 3K0YA 3SK8A 2NVTB 1X6OA 1SE4A 3H91A 4K0KQ 3CKIB 2WP8J 4HSVA 4ZUJA 1HZCA 5C5LA 3CU7A 3EVQA 1TWCH 1WD1A 5FO7B 5ELCA 4EQ5A 5F2DA 2EYHA 5K36H 1VQAA 1C9OA 5BR8L 2FINB 4IUVA 3GTOH 5IY0A 1PFBA 3U4ZA 2OQ0A 3S1NH 3D3RA 2E75C 2JE6I 3GP7A 4HR7B 1XNRQ 5EPJA 1VQ4A 1N33Q 2YU9B 1F9PA 1SE8A 2HCIA 2LY7A 1EY4A 1VQBA 2F0SA 1SMYD 4HJ9A 5CYUA 2F0QA 2YTYA 1TU2B 2KVMA 4OONA 2VQEQ 3PV0A 1K0SA 4JI7L 1VDZA 2Q8TA 3ICEA 4HJ5A 2KHSA 1JWUD 4WJWA 5E4XA 1HZBA 2KHIA 4DR1Q 1TY0A 5C4XH 2E2IB 4N8FA 3F8TA 1Y1VB 1T5XD 1D1KA 3ND9A 1L2FA 1H9RA 3PCOB 3QB3A 1CA6A 1IBKL 5HY6A 2VUMH 2JEAI 5FLXc 1EIFA 3PIO3 5JEAH 2JA7H 2X6GA 2IW3A 2UUCL 1BVSA 4EQNA 4G7HC 1GHJA 4ZUIA 1II3A 1HA6A 5LHY1 2MO0A 3TS0A 3NELA 2KJXA 3NE5B 5JJLA 1E7ZA 1PRTC 1PMRA 5C0XH 1SYDA 4CDCC 1EY6A 3S17H 2KEDA 1G8ZD 1BCPF 2O4XA 1MI2A 1Y1VG 2KUMA 3NTKA 2XIWA 5I2XA 3I4LA 3OW2A 4A3BB 2NBFA 4B3ML 1JOKA 4OXPA 4AYBB 1GOZA 1S4ZA 2NTTA 2PQAB 4LF9Q 1FNUA 1OXTA 2CW0D 3SVMA 1PHJA 1NMFA 3HOXH 4K5VA 1TT2A 4DV1Q 4RGMA 4DUYQ 3NHHA 3U58A 1E3PA 1OXSC 1PA6A 4JCVE 2YTVA 3WOFA 4CDEC 3GTJH 2YV5A 2L15A 4MZ9A 5EKIA 3HOVB 4HJAA 4A3FB 4K0KL 1B9NA 1JT8A 5CV7A 1VF7A 2F0MA 1DXMA 2EYPA 2Q2IA 3C1FA 3GTQH 1JWMD 2PYKA 4A3BG 5C4ZA 3OWEB 2NVYH 2AWNA 5LMNQ 4AYBG 2QEXA 4J15A 2F4VQ 3EBEA 4IUUA 1KD1C 1F2YA 2D62A 3BG3A 4MN3A 2ENBA 3M85A 1DOLA 2IX0A 3TMEA 1N33L 1CKMA 1BF4A 5CV5A 4FF3A 2F4IA 3D31A 1FR3A 2A73B 1AP0A 4KHPL 4XTCS 1DD2A 2VQEL 4BY7H 5M5YB 1A15A 1DOKA 2BE5C 3F1ZA 2ALYB 1G2SA 2K6AA 2H1EA 1S5CD 3R3OA 3HOVG 2NN6G 1RJTA 5M3MH 1DYQA 1STYA 4A3FG 2B2UA 1NJIC 1TWCB 4DR1L 2CWAA 3CC4A 5KYLA 3F2DA 1F9QA 3P20A 3GTOB 4GLVB 1D5ZC 2Q2UA 4B3SQ 3S1NB 3I90A 1Y8OB 2KENA 2QF7A 4V190 3PIPA 5FO9B 3GDEA 1IYUA 1B4OA 3PIP3 1IBMQ 4H02A 3P7JA 3ZYYX 4ZLTF 3OSOA 1KHIA 1TWGH 2XWJB 3KF8B 3CAMA 3PUWA 3ONAB 3IAYA 1JCKB 1H9SA 3OYYA 1A8VA 2JP1A 3F2UA 1CZWA 1WTRA 1N32Q 5C4XB 3OPOA 1J9OA 4EQPA 1O7IA 1SBBB 5J22A 3T1YQ 1O80A 1SE3A 4HJ7A 3I72A 4H7BA 3MAQA 3CPFA 4A3JH 1KL9A 2VUMB 5IIFA 1KAWA 3SK4A 5L37A 3H94A 4CKBA 3S2DH 5J3BA 2EQSA 2JA7B 4GN4B 1CTMA 3KF6A 1MSGA 3I70A 2MNAA 3FRPB 3S1QH 4A3LH 3EFXD 2UUBQ 4FXDA 4AIMA 4DV1L 4KKTA 1LTGD 3J80E 3TQYA 4C3IG 2NZHA 3VR2A 5DM73 1OXVA 4RMFA 1LO5D 1KLUD 4YHHQ 1WTQA 2JEBI 4DFAA 4LAAA 2DNEA 5C44G 4A93H 3K7UC 3MEHA 3S17B 1EU4A 4JI1Q 4DPGA 3IFTA 4LF4Q 1NUCA 3OHXC 4A3GG 1CHPD 4NW2A 2VUMG 4M8AA 1TIID 1J5EQ 4PNYA 2JA7G 2MPMA 2Z6BA 5LMNL 1KDAA 3X3MA 5KNBA 3HOXB 4IFDI 1PTOF 1HNXQ 2EYLA 2OXPA 2R7FA 2N78A 3E0EA 1ZKOA 2V1CC 1K8OA 1RTOA 4X3SA 4IOCA 5C4JH 1N36Q 4QUCA 5CV6A 2B2WC 3GTJB 1HTLD 4DR3L 1RHPA 4YIJA 4DV6Q 4RHRA 4PZ6A 3GD7A 4H13C 1O78A 1E2ZA 4XQQA 5JJKA 4TQUS 5EGTA 4GNXC 5EPLA 2PMZE 2XTIA 3D6WA 5M3FG 2JA5H 2RF4A 3A74A 4AQYQ 1PZKD 1K9MC 3GTQB 4L63B 2NVYB 3C3LA 2VXWA 4ZAIA 2IL8A 2RHSB 5IGGA 2N3SA 4B3SL 3C46A 3M9BA 2K05A 1CQVA 2PQEA 3HOXG 5C4HA 1IZ6A 3CC2A 3J81E 4Q0FA 5TSSA 1IBML 2B8GA 4BY7B 1LACA 1N9WA 1FJGQ 1BOSA 5LL6S 3VR4A 1S5FD 5KYIA 4XXEA 5HGTA 1QCBD 1KNEA 4HMJA 1R4PB 1EYDA 1HUMA 3S14H 5FJ8H 4L6TB 2O5JC 4JI2L 4QMGA 1STEA 4JI3L 4FF1A 1Q1EA 4KK7A 3OMGA 1KRTA 3W5OA 4C56C 1JJGA 2BH8A 1C0AA 2F0PA 2C5CA 2NVXH 3CCRA 3TREA 3VA7A 2E5LQ 1VF5C 2PW5A 3G6JB 2UUBL 4Q5VA 1ENAA 4BY7G 1BCPB 3LWEA
chains in the Genus database with same CATH topology
1TWGB 1FNVA 1JWSD 2B2TA 5I2YA 2F0UA 2HQEA 2A68D 4HTHA 5D3DA 4F8MA 1G2TA 3D4WA 5EBDA 5DAUA 1PTOH 3SK5A 3QOJA 4A3JB 3A8KE 1FD7D 5JOBA 2F3WA 3WOEA 1JOQA 3S1QB 2FMMA 2IWHA 3BDCA 3RD4A 1AW7A 2A69D 2N55A 1ENCA 1H9KA 1BXTA 3VA5A 1EY7A 3PMFA 4HEDA 4BY1B 4A93B 5FK9C 2EY2A 4KTAA 3M7GA 1JE4A 1DZ1A 1JOOA 1TS3A 2JYOA 3ITPA 2EVBA 1TS5A 1BR9A 1Q3LA 4MHEA 1WTXA 1A2UA 4FXGC 3AU7A 5J39A 2K1BA 2D2CC 2HDMA 4XQJA 1XX8A 1IKMA 3A55A 2WV6D 3MTSA 4QB4A 3LWUA 1GJXA 1Q1BA 2DN8A 2LKVA 4ULLA 1FNWA 1HFGA 2A6HC 4KV6A 3U9SA 3TP8A 4RKLA 2LMCB 2JA5B 3R93A 4K6DA 3WDNA 2PNRC 1KTKA 3M4YA 3BYTB 5FO8B 5EQ0A 4TKOB 1YNND 4PV1C 1NSNS 4R8IA 4H0LC 1U4PA 5CBAE 1G6ZA 5IGEA 5EPKA 3A8IE 3M7NA 1H9JA 3S14B 2CHBD 2EDGA 3W2DA 2J0TD 2B8FA 5FLXL 1SXTA 3T53B 1D2BA 1X3QA 1GXDC 1STAA 2NVXB 5DNFA 2NUCA 4G7ZC 2M9VA 3I8ZA 3VYTA 1GUTA 4IUTA 4QUFA 1CFMA 2F0KA 2QEJC 5KEEA 5G3LD 4RHSA 4RA8A 1SNDA 3GTPB 5BN5A 1PTOB 3C1EA 5CC4A 4C1NI 1RKNA 3QOLA 1GUSA 1Z47A 1QG7A 4MIUA 5EBCA 4G7OC 3NWSA 5EKKA 1SYGA 5CGKA 3JAME 1EL0A 4E6IA 3VYSA 2Z4HA 1E2WA 2NYZD 3IFDA 1EFID 1LT5D 3DXJC 5CV4A 2D5DA 2KECA 5D14A 3SK6A 1GHKA 2EYJA 3SXHA 2RBMA 1LT3D 4BWGB 1T5EA 3E5SA 3J7YW 1TS4A 2PMZB 1ET9A 4KD3A 3A54A 1HHVA 2A6EC 5IGCA 4LJZC 3NTHA 3GQBA 1A6XA 5I6WA 3PO3B 2MUYA 3SR1A 3OMCA 2F0GA 3GTLB 4EQOA 1SNPA 1LTBD 1OXUA 4DF7A 3S16B 3D4RA 1AFPA 1GUNA 2L55A 3TZDA 1SNCA 2SEBD 2F3VA 4KI0A 5CV8A 4HN7A 3DMUA 4A3EB 1BDOA 1PDQA 4FF4A 3QWNA 1X32A 1SSOA 1U4LA 2NZ1D 1R4QB 4KN4C 1HA5A 4X3KA 3E0JA 1EY8A 1S5BD 3BS1A 4FYDA 1XWEA 2K03A 4FNFA 1G291 5D3IB 2E74C 3DHQA 2LFNA 3J7AF 2QKIC 2F0VA 3GV3A 3U9OA 4R9WA 3HS0C 1ESFA 2YYZA 4KJOA 2BA0A 4TRDA 2KCNA 1PYWD 4OO1H 1LTAD 4M1UB 4HSPA 1Q90A 1KLGD 3V96A 5M5XB 2AQ3B 1B1ZA 3KBGA 2L5TA 1CA5A 2PZUA 1V43A 5C5MA 2O5IC 4PMWA 5JEAJ 2IX3A 3D6CA 2LS01 3KLSX 1IL8A 5T1IA 1F2ZA 3NTIA 1LT6D 2FJ2A 2IJ0A 4FXKC 4UDUC 5C0XJ 2MJ8A 1PRTD 2A74C 4I7ZC 2L11A 3OOCA 2Q8RE 1C4QA 1STNA 5COYA 2Z4IA 2WIIB 3L7ZC 1VCIA 3AMUA 1PLFA 1STBA 3H0GB 3T16A 3A56A 1BBXC 2O2LD 1IYVA 1DM0B 3ND8A 4ZKBB 2L0CA 1SJHD 2BDNA 4H44C 1AZQA 1SNMA 1JICA 3NK9A 2B2YC 1K83B 1SNQA 2EYMA 1PZJD 1QB5D 3W3AA 2L1BA 3DWPA 1BQQT 1TY2A 1H9MA 5JVG3 4KMUC 5CR3A 2BE5D 1M8AA 5A2QL 3Q23A 5JAVA 4NP5A 2K32A 1F9SA 1KAAA 5IGDA 3RZOB 1NR4A 3MFYA 4NKLA 2F0IA 1U4MA 4DN4M 5K36G 1SFOB 1LLRD 1OXXK 2EY1A 1ZXTA 4OHJA 3IKJA 1TR5A 1HXYD 1LABA 3L3OC 2XVSA 2K5WA 4KY6A 3OIQA 1V1PA 2SOBA 2J7ZA 1NCVA 2E76C 1EY5A 5I9PA 2F0LA 2EJMA 3HZXA 1EOTA 2AQ1B 3R2IA 1S5ED 4XIGS 1EYCA 4HMIA 4OIKA 3K5MA 3K58A 3H6MA 4K8IA 5JEAG 3PUYA 3QG1A 2ZXOA 2MHVA 1HCZA 2L12A 4RKBA 1B3AA 2RDHA 1WCMB 3FEWX 2L9HA 4CGYB 4OO1G 5CBEE 1YNJC 3TBIB 1E2VA 1EQTA 5C0XG 2TMPA 5G3LF 1U9RA 5ELBA 1D5MC 1U4RA 2EPBA 2WKDA 1QNKA 3GO5A 4ME5A 4DAYA 2ICIA 2XRQD 2K7VA 3AB9A 2AUJD 1J8IA 2FFKB 2GA4B 4ABNA 1BCPC 5M3MB 2K5QA 2JSOA 2XWBB 4LK1C 1CI3M 1O7LA 4PMCA 4DXGA 1M4VA 2J4XA 1STGA 3ERQA 3NP8A 5I6YA 4P2CB 4FF2A 1JB3A 4RGNA 4KY7A 3A8JE 2PZTA 5BN4A 1UNSA 5E4WC 5JPNC 1NAPA 2C9OA 1HPCA 1PFMA 2RDFA 1ENFA 2F0OA 2OT2A 2I46A 1KNAA 3D8GA 2X6LA 4U68A 5ELDA 4IUQA 2BOSA 2RVLA 3S2DB 4IFDH 2WAQB 3TSSA 4ZK9B 3J7AV 1XYIA 3BVMA 2Y0SB 1STHA 1ONLA 3MZ5A 4F88A 4NDXA 2D9UA 4RGTA 1EEFD 1H9SB 1F2MA 1KDCA 4IUPA 2ID0A 4IFDJ 1JORA 3R2TA 1WTOA 5IT9L 2RSNA 1WTVA 2KEEA 4L8JA 5T1GA 2NB0A 1PXUA 1V1PB 1VMCA 4XYOA 4ZKCB 3HRZC 4RH6A 2B2VC 5C4JB 3GTMB 3QJYA 2WACA 4DA2A 3HP3A 1AN8A 4OIJA 4K2KA 5D65A 3T51B 1RTNA 4DAVA 5A35A 2CQAA 1Y1WB 1EYAA 4K8JA 1SAPA 4KHVA 3NBHA 4RWSC 5LL6X 1CZGA 5KRUA 4BA2I 4RFBA 3CRKC 4C1NK 2H4OA 4C3HB 2M00A 1A3TA 4K14A 1Q12A 2DY8A 4IUNA 5AFWA 2ZT9C 1Z7TA 1XXGA 1PRTF 2A6HD 1HFNA 2MGSA 2NN6I 3HEJA 1EY9A 1ET6A 3FDTA 2F0NA 5IOCA 4GZYC 4QF4A 1LTSD 5JVH3 1MGSA 2N88A 4ZRZA 1PTOC 3KLSA 1HUNA 2JXMB 3N6RA 5C3WA 2E2HB 3EQLC 1KABA 2F0DA 1F9RA 2EY6A 4V0BA 2EE1A 3BDLA 4C3HG 1Y69U 1PFNA 5IGBA 3OWFA 4RCOA 5A2QE 2JA6B 1QWYA 2G9HD 4U673 2B2TC 3TP7A 1EIHA 1ZYRC 4K6LA 2FMCA 4RAUC 1TVXA 4XT1B 3MWYW 3FKIB 2RSOA 4CJ1B 2PO4A 4RCNA 2K04A 4IQZA 1Y8PB 2FHTA 3MXPA 2EJFC 1SYCA 1EEID 2ICEC 1FYCA 5ISRA 3EJIA 1TWAB 1C48A 2F0WA 1SYBA 5J1ZA 1A3UA 5CMDA 2F0TA 4EGVA 3DM1A 1MD2D 3I3CA 1IW7C 3DUZA 1GUOA 3H09A 4IFDG 2RQXA 1D1IA 3NBIA 4O1NA 1B53A 4CKEA 4HCEA 4OL7A 3VYUA 1B9MA 1QNUA 3EROA 3NQIA 5C0XI 1RODA 3KBXA 1TWFB 2B39A 4K5WA 4NMZA 4OGQC 1IKLA 4J1MA 3MXGA 4A3DB 5KIXA 1BO0A 1CM9A 2NWGA 3SE0A 1G91A 2A6ED 4HCSA 1SMYC 5C3XA 2ZXPA 4KJNA 2DNCA 4G4KA 1HTPA 1V8QA 1HQMC 2SNMA 1WVLA 2B2YA 3S2HB 5KNCA 3HGBA 2F0HA 3I4NB 3HOUB 2CVRA 2JA8B 3T13A 5M9OA 1QE6A 1I4QA 1I4HA 1LTTD 4S3SA 3S1MB 1ZEQX 4DNTB 4RGOS 3CQZB 4C2MB 2K28A 1BUVT 4CBVA 5JJZA 5IODA 2KCCA 4ZYSA 3OIPA 1EZ8A 2XNAC 4ODGA 1R9TB 1DONA 4Z9CB 2QCPX 4KHZA 1B44D 3VYRA 3RUZA 2R7ZB 4N9TA 2CW0C 2EXZA 1S5DD 2WINB 3KLRA 3DEOA 3H3VC 2QILA 5K5PA 4A3IB 3BYYB 1QJOA 1W6KA 4FVMA 1PZID 2ZXRA 4LMQD 1A3VA 4DAPA 5IT9E 3K57A 3GV6A 2B2WA 1CQFA 4XYQA 1PRTB 1LT4D 3D4DA 3I4MB 3GTGB 2RKSA 3GTKB 1I4PA 4HAEA 1I6VC 3HOWB 4DK0A 3I73A 4CJ2C 2EOTA 1Q8IA 3FMCA 2X69A 3BVZA 4KD4A 4KY5A 1QILA 1SJED 4FO2A 5C6AA 2IPKD 3P1HA 4XDXA 4IZ8A 1SEBD 1DOMA 2SNSA 4IALA 5IGFA 3FVQA 5FOBB 2K01A 1I4XA 4DNRB 2F1MA 3G7LA 4KKSA 5I4DA 1E0BA 3T56B 4X3TA 5KNDA 1C8CA 4IN3A 1K8MA 2BCOA 3TDQA 3I91A 1D6EC 1A2TA 5FLXE 2L4NA 2OF1A 1MSHA 4BA1I 4C3IB 1TKWB 4PQXA 1GUWA 4B08A 5C44B 1SYEA 4IURA 4B9WA 4A3GB 3TP5A 4WORA 1BNZA 1B50A 3A7AB 1WTPA 2XSCA 4JBWA 5CV9A 3MXNA 3JAML 3HG9A 3E6ZX 4XQNA 4DK1A 1Y8NB 2M2LA 4BS9A 1UAPA 1JQYD 1NR2A 4JK1C 5M3FB 4I65A 1HQRD 4DU9A 4Y7NB 4DGZA 3PO2B 4KN7C 3FPPA 2B2VA 1EQVA 5EJWA 4EVOA 5DM63 4N9PA 1W6JA 1WD0A 3R8BA 1AZPA 1L0XB 1CT1D 3TP6A 5C3EB 3URYA 4UAIA 4F7XA 4CJ0B 1LTRD 1YNJD 1UEAB 3VR3A 3LNNA 3X3NA 2IT1A 3RLFA 2HUGA 1EZ6A 1O7YA 2F0JA 2Q8IB 3K6OA 2F03A 3BVGA 4F87A 5M5WB 2V4DA 2EYOA 3V05A 1EIGA 3SDZA 2R61A 2B2UC 3DEPA 2IX1A 1X3PA 3K7AB 2G9DA 4K5XA 4CKCA 2WKCA 2R6GA 1O7ZA 3NUCA 3N52A 1DJRD 3MFGA 2A68C 3QO2A 5JPMC 2R92B 3T4AC 3S9WA 4O42A 4DXFA 1BCPD 2A5HA 2VNUD 3PUXA 4ILWA 2VB3X 3MXUA 2AUKA 4X3UA 5KGUA 4QCLA 3O13A 2NVQB 3VR5A 2WB1B 5EKLA 2BA1A 1TQOA 2HDLA 2A69C 3RZDB 3KUPA 5FKAC 2I07B 1JC7A 4WFN3 2KA7A 2MP1A 2QDBA 1ESRA 2E2DC 1ML0D 2OEOA 3HKZB 2AQ2B 1I50B 4G57A 4C3JB 3DWQA 4BBRB 3DWAA 2K5DA 2Z8LA 1RCVD 3PUZA 3L9AX 3KK7A 1VMPA 3VR6A 3A7LA 1TWHB 4A3MB 1SE2A 2B63B 1LV9A 3Q6SA 1XTCD 3NPPA 3S15B 3IL8A 1DCZA 1SYFA 3Q24A 2XRSD 1L0YB 3CRLC 4ZQ3A 2TSSA 1EWHA 4J8QA 4C3JG 3P75A 5BN3A 1ILPA 5DEHA 2HCCA 3V2TA 1YNNC 2R3ZA 3SHLA 2PCFB 2R93B 1TS2A 4FP5D 3NXWA 1JR0D 3CHBD 2RDGA 1LTID 1MBYA 2KQ3A 3LX0A 4J6HA 3EA6A 3NSWA 4CHTB 3BZDB 3TN2A 1F2LA 3Q0AA 1EU3A 3MC0B 2PPBC 2EZVA 3MHBA 1UUPA 5ELEA 2EJGC 1IHZA 2F0FA 1I4GA 3BDOA 5HURA 3K5OA 3M3YB 5E1FA 1FGBD 1QOHA 4WRDA 3OW7A 3S1RB 1D5XC 1ICWA 1HRJA 5CORA 1OO9B 1PTOD 1SNOA 3NWTA 2PW7A 3MVVA 3J80L 5ELFA 2DY7A 3UI2A 1I3QB 2NTSA 1CHQD 2Z1CA 2F0EA 2K33A 3FPUB 4PMBA 4XT3B 1EWCA 1CK1A 3MA2B 1ZYRD 1RDPD 3Q22A 4QIWB 4TSSA 2EYFA 1KDBA 2BDOA 3K5NA 1V1OA 2KOLA 3HOYB 4BBSB 3HOZB 3SEBA 3RMHA 5NUCA 3PUVA 2RA4A 2XN9C 4ID6A 1WTWA 2PZWA 4OO1I 2SDFA 4A3KB 3QIAA 5E3FA 2AWOA 3M4OB 2VB2X 2NN6H 3C2PA 3TZUA 5I9OA 4K2LA 4B9XA 1RD9D 1IW7D 1B2TA 1SDFA 2EY5A 4R8NA 1RF2D 1I6HB 4KKUA 3J81L 1AEXA 1GUGA 3K59A 3K5LA 2E2JB 1ILQA 1F77A 1Z6HA 3NQTA 1I4RA 1EY0A 3KF8A 3K0YA 3SK8A 2NVTB 1SE4A 3H91A 3CKIB 2WP8J 4HSVA 4ZUJA 5C5LA 3CU7A 3EVQA 1WD1A 5FO7B 5ELCA 5F2DA 2EYHA 5K36H 2FINB 4IUVA 1PFBA 3D3RA 2E75C 2JE6I 3GP7A 4HR7B 5EPJA 2YU9B 1F9PA 2LY7A 2HCIA 1EY4A 2F0SA 1SMYD 5CYUA 2F0QA 1TU2B 2KVMA 3PV0A 1VDZA 2Q8TA 2KHSA 1JWUD 4WJWA 5E4XA 1TY0A 2E2IB 1Y1VB 1T5XD 1D1KA 3ND9A 3QB3A 1H9RA 1CA6A 2JEAI 3PIO3 5JEAH 2X6GA 2IW3A 4EQNA 4G7HC 1GHJA 4ZUIA 1II3A 1HA6A 5LHY1 2KJXA 3NE5B 1PRTC 1PMRA 5C0XH 1SYDA 1EY6A 2KEDA 1G8ZD 1BCPF 2O4XA 1MI2A 2KUMA 3NTKA 2XIWA 5I2XA 3I4LA 4A3BB 2NBFA 1JOKA 4AYBB 1GOZA 1S4ZA 2NTTA 1FNUA 1OXTA 2CW0D 3SVMA 4K5VA 1TT2A 4RGMA 3NHHA 1OXSC 3WOFA 5EKIA 3HOVB 4A3FB 1B9NA 5CV7A 1VF7A 2F0MA 1DXMA 2EYPA 3C1FA 1JWMD 2PYKA 5C4ZA 3OWEB 2AWNA 4IUUA 1F2YA 2D62A 3BG3A 4MN3A 2ENBA 3M85A 1DOLA 2IX0A 3TMEA 1BF4A 5CV5A 4FF3A 2F4IA 3D31A 1FR3A 2A73B 1AP0A 4XTCS 1DD2A 5M5YB 1A15A 1DOKA 2BE5C 1G2SA 2K6AA 2H1EA 1S5CD 3R3OA 2NN6G 1RJTA 1DYQA 1STYA 2B2UA 1TWCB 5KYLA 1F9QA 3P20A 3GTOB 1D5ZC 3S1NB 3I90A 1Y8OB 2QF7A 4V190 5FO9B 1IYUA 1B4OA 3PIP3 3P7JA 3ZYYX 4ZLTF 3OSOA 2XWJB 3PUWA 3ONAB 3IAYA 1JCKB 1H9SA 2JP1A 3F2UA 1CZWA 1WTRA 5C4XB 3OPOA 1J9OA 4EQPA 1SBBB 5J22A 1O80A 1SE3A 3I72A 4H7BA 3MAQA 2VUMB 5IIFA 3SK4A 3H94A 4CKBA 2JA7B 1CTMA 1MSGA 3I70A 3FRPB 3EFXD 4FXDA 4KKTA 1LTGD 3J80E 4C3IG 3VR2A 5DM73 1OXVA 1LO5D 1KLUD 1WTQA 2JEBI 4DFAA 4LAAA 2DNEA 3MEHA 3S17B 1EU4A 3IFTA 1NUCA 3OHXC 1CHPD 4NW2A 4M8AA 1TIID 4PNYA 2MPMA 1KDAA 3X3MA 5KNBA 3HOXB 4IFDI 1PTOF 2EYLA 2OXPA 1ZKOA 1K8OA 1RTOA 4X3SA 4QUCA 5CV6A 2B2WC 3GTJB 1HTLD 1RHPA 4YIJA 4RHRA 3GD7A 4H13C 1O78A 1E2ZA 4XQQA 4TQUS 5EGTA 5EPLA 3D6WA 1PZKD 3GTQB 4L63B 2NVYB 3C3LA 2VXWA 4ZAIA 2IL8A 5IGGA 3C46A 2K05A 1CQVA 2PQEA 5C4HA 3J81E 4Q0FA 5TSSA 2B8GA 4BY7B 1LACA 1BOSA 5LL6S 3VR4A 1S5FD 5KYIA 4XXEA 5HGTA 1QCBD 1KNEA 4HMJA 1R4PB 1EYDA 1HUMA 4L6TB 2O5JC 4QMGA 1STEA 4FF1A 1Q1EA 4KK7A 3OMGA 4C56C 2F0PA 2C5CA 3VA7A 1VF5C 2PW5A 3G6JB 4Q5VA 1ENAA 1BCPB 3LWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  2L55 A;  2QCP X;  1ZEQ X;  3TDQ A;  2VB2 X;  3E6Z X; 
#chains in the Genus database with same CATH topology
 1FL0 A;  1HZ9 A;  1FNV A;  1TWG B;  1JWS D;  2B2T A;  1CKO A;  5I2Y A;  2F0U A;  2UU9 L;  2HQE A;  2A68 D;  3NEN A;  4HTH A;  5D3D A;  4F8M A;  1G2T A;  3D4W A;  1FVI A;  5EBD A;  5DAU A;  3GTP H;  1PTO H;  3UDF A;  3SK5 A;  3QOJ A;  1QZH A;  4LF4 L;  4A3J B;  3W1B A;  3A8K E;  5GAG C;  1FD7 D;  2C35 B;  1M90 C;  5JOB A;  2F3W A;  1AE2 A;  2I5M X;  3JC6 6;  3WOE A;  1XTD A;  1JOQ A;  3S1Q B;  2FMM A;  4IPG A;  2IWH A;  3BDC A;  3RD4 A;  1AW7 A;  2A69 D;  4JI8 L;  4UP8 A;  2N55 A;  2KCT A;  1XMQ Q;  4JVZ A;  1ENC A;  1Z9F A;  3NEM A;  1N36 L;  1H9K A;  4POF A;  1BXT A;  3RNU A;  3VA5 A;  1EY7 A;  3PMF A;  4HED A;  4DV6 L;  4BY1 B;  4A93 B;  5FK9 C;  3AYH B;  1L1O A;  2EY2 A;  3TRZ A;  4KTA A;  4JOI A;  3M7G A;  1JE4 A;  1DZ1 A;  1JOO A;  1TS3 A;  3HKZ G;  4UP9 A;  2JYO A;  3ITP A;  4A3J G;  2EVB A;  1Q46 A;  1TS5 A;  1VQF A;  1BR9 A;  1Q3L A;  1PH6 A;  4MHE A;  1QUQ A;  1WTX A;  2K75 A;  1A2U A;  4FXG C;  3ER0 A;  3AU7 A;  2N49 A;  5J39 A;  2K1B A;  2D2C C;  2NZO A;  4A3L G;  4JI0 Q;  1HH2 P;  4LW1 A;  2HDM A;  4XQJ A;  1XX8 A;  1IKM A;  3A55 A;  4OWX B;  2WV6 D;  3MTS A;  1VQ8 A;  4QB4 A;  2Q2T A;  3LWU A;  1GJX A;  3PO3 H;  1Q1B A;  2B63 G;  1YJ9 A;  2DN8 A;  2LKV A;  4ULL A;  1FNW A;  2D0P A;  4BY1 G;  4A93 G;  4ALP A;  1HFG A;  2A6H C;  3PGZ A;  4KV6 A;  3U9S A;  3TP8 A;  4RKL A;  1PH4 A;  2LMC B;  3BJU A;  2JA5 B;  3R93 A;  4K6D A;  2FXQ A;  3WDN A;  3S16 H;  3U50 C;  1W3S A;  2EIF A;  3PF5 A;  1YIT A;  2PNR C;  3BZC A;  1KTK A;  3ULL A;  3M4Y A;  1YZ6 A;  3BYT B;  5FO8 B;  5EQ0 A;  4DV4 Q;  4TKO B;  1YNN D;  1X56 A;  4PV1 C;  4A3E H;  1NSN S;  4R8I A;  1N8R C;  4H0L C;  1U4P A;  5CBA E;  4DNI A;  5IGE A;  1XPR A;  1G6Z A;  3BU2 A;  5EPK A;  3A8I E;  3M7N A;  1VQ9 A;  1H9J A;  3S14 B;  2CHB D;  1NY4 A;  2EDG A;  3W2D A;  2JA5 G;  1B8A A;  2J0T D;  3CPW A;  2B8F A;  3ZJY C;  5JJI A;  5AJ3 Q;  2VW9 A;  5FLX L;  4C2M H;  1SXT A;  3T53 B;  1GO3 E;  2WFW A;  1D2B A;  1X3Q A;  1GXD C;  1STA A;  4A3C G;  2NVX B;  5DNF A;  2NUC A;  2VZA A;  4G7Z C;  1PH2 A;  2DUD A;  4B3R L;  2M9V A;  3I8Z A;  2HD3 A;  2CH4 A;  3VYT A;  1GUT A;  4IUT A;  2CFM A;  1XMQ L;  4QUF A;  1LM0 A;  1CFM A;  2F0K A;  2QEJ C;  2RHQ B;  4P72 A;  1R9T H;  5KEE A;  5M5X H;  5G3L D;  4RHS A;  4RA8 A;  5FJ8 G;  1SND A;  3GTP B;  5BN5 A;  1PTO B;  3C1E A;  4UPA A;  4IJH A;  5CC4 A;  4C1N I;  3T1H Q;  1RKN A;  3QOL A;  5IP7 H;  4B3T Q;  1GUS A;  1Z47 A;  1QG7 A;  4MIU A;  4DR2 L;  5EBC A;  4IPH A;  4OEL B;  2A19 A;  4G7O C;  3NWS A;  5EKK A;  1SYG A;  2Z6K C;  1PYS B;  4JI0 L;  5CGK A;  3CCV A;  3JAM E;  4DR5 L;  1JE5 A;  2HIX A;  4L5R C;  1EL0 A;  4E6I A;  4DR4 Q;  3VYS A;  2Z4H A;  4A3I H;  1E2W A;  2NYZ D;  3IFD A;  2UXC L;  1VQG A;  2DJF C;  1VQC A;  4LF8 Q;  1EFI D;  1LT5 D;  3DXJ C;  2KCM A;  5CV4 A;  2D5D A;  1MIU A;  1JJC B;  4X64 L;  2KEC A;  2XGT A;  5D14 A;  3SK6 A;  1GHK A;  2EYJ A;  4JBJ A;  3SXH A;  2RBM A;  5LMN W;  1LT3 D;  4BWG B;  1T5E A;  4Y52 H;  3E5S A;  3J7Y W;  1TS4 A;  2PMZ B;  5IT9 c;  3H3V H;  3I4M H;  1ET9 A;  3CD6 A;  4KD3 A;  3A54 A;  1HHV A;  3H0G H;  2A6E C;  2QA4 A;  4DV4 L;  4BBS G;  2N8N A;  5IGC A;  4LJZ C;  3NTH A;  3GQB A;  4YCU A;  3HOW H;  1A6X A;  5I6W A;  1VQJ A;  3PO3 B;  4BXX G;  2MUY A;  3H15 A;  4JYA Q;  3SR1 A;  3OMC A;  2F0G A;  3GTL B;  4EQO A;  1SNP A;  1LTB D;  4JW0 A;  1OXU A;  4GKJ Q;  1B3Q A;  4DF7 A;  2AHO B;  3S16 B;  3D4R A;  1AFP A;  1PH5 A;  1GUN A;  2L55 A;  3TZD A;  1K83 H;  3UDG A;  1Q8K A;  1SNC A;  2SEB D;  2F3V A;  4DV2 Q;  3KYH C;  4GOP B;  4KI0 A;  5CV8 A;  4HN7 A;  3DMU A;  4NPS A;  4A3E B;  1BDO A;  1HJP A;  1PDQ A;  2E8G A;  4FF4 A;  1N34 Q;  1B7Y B;  3QWN A;  1SRO A;  1X32 A;  3PO3 G;  1PH1 A;  1SSO A;  1U4L A;  2NZ1 D;  1R4Q B;  4KN4 C;  1HA5 A;  1IYJ B;  4X3K A;  3RZO H;  3E0J A;  1EY8 A;  5GAD C;  3ULJ A;  1S5B D;  4IPC A;  3BS1 A;  3T1H L;  4FYD A;  1XWE A;  2K03 A;  4FNF A;  1G29 1;  4R4Q A;  2E74 C;  5D3I B;  3DHQ A;  2LFN A;  4B3T L;  3J7A F;  4YY3 Q;  5H1S E;  1VQD A;  2QKI C;  2DJG C;  2F0V A;  3GV3 A;  3U9O A;  3PIO A;  4R9W A;  1SFO H;  3L0O A;  4DV7 Q;  3J80 i;  3HS0 C;  1ESF A;  3CCU A;  2YYZ A;  4KJO A;  2BA0 A;  4DK6 C;  1S72 A;  4TRD A;  2KCN A;  1PYW D;  2KHJ A;  4A3E G;  4OO1 H;  2ZM6 Q;  1LTA D;  4M1U B;  4HSP A;  1Q90 A;  1WFQ A;  1KLG D;  4DR4 L;  3V96 A;  5M5X B;  2AQ3 B;  1B1Z A;  3KBG A;  4O0A A;  2LXK A;  4AH6 A;  2L5T A;  4LF8 L;  1CA5 A;  2PZU A;  1V43 A;  1K0R A;  2WAQ E;  1ASZ A;  3RN5 A;  5C5M A;  2O5I C;  4PMW A;  3SGI A;  4JI6 Q;  5JEA J;  2IX3 A;  1I5F A;  4OWW B;  3D6C A;  2LS0 1;  2ZTD A;  3KLS X;  2Y0S E;  3CME A;  1L0W A;  3G48 A;  2AKW B;  1IL8 A;  3J7Z C;  5T1I A;  4LFB Q;  1F2Z A;  1X65 A;  1I94 Q;  3J80 c;  3NTI A;  4YWL A;  1A0I A;  1WCM H;  1LT6 D;  4P73 A;  2FJ2 A;  2IJ0 A;  4FXK C;  2CKZ B;  4UDU C;  2MJ8 A;  5C0X J;  1PRT D;  5GAE C;  5GRO A;  1NMG A;  4JYA L;  1K3B C;  2A74 C;  4I7Z C;  4LFA Q;  5IYD G;  1QVG A;  1K3R A;  3UE0 A;  5IP7 G;  2L11 A;  4GKJ L;  3OOC A;  2Q8R E;  3W1G A;  1C4Q A;  1STN A;  5COY A;  2Z4I A;  2WII B;  3L7Z C;  1VCI A;  3J81 i;  1VQ7 A;  3AMU A;  1IXR A;  1PLF A;  1STB A;  3KJO A;  4X62 Q;  4GNX A;  3H0G B;  3T16 A;  3A56 A;  3I56 A;  1BBX C;  1XNR L;  5C3E H;  2O2L D;  4JC0 A;  3MEF A;  4PZ7 A;  1N34 L;  2ATW A;  3VDY A;  1IYV A;  4DAM A;  1UE6 A;  1DM0 B;  5ELN A;  3ND8 A;  2LXJ A;  4ZKB B;  2L0C A;  4MTK A;  1SJH D;  2BDN A;  4H44 C;  3UDI A;  3CCL A;  5M5W H;  1AZQ A;  1SNM A;  1JIC A;  3NK9 A;  1HNW Q;  1E22 A;  2B2Y C;  1K83 B;  1SNQ A;  2EYM A;  1PZJ D;  2K52 A;  4DV7 L;  1QB5 D;  2MQH A;  3J81 c;  3W3A A;  2L1B A;  3DWP A;  1BQQ T;  1TY2 A;  1H9M A;  5JVG 3;  4KMU C;  1VQP A;  4DV3 Q;  5CR3 A;  2BE5 D;  1M8A A;  5A2Q L;  2ZM6 L;  2R92 H;  1G51 A;  3Q23 A;  5JAV A;  4NP5 A;  4WJ4 A;  2K32 A;  1YHB A;  3KDF A;  1F9S A;  1KAA A;  5IGD A;  3RZO B;  1NR4 A;  1SRU A;  1LTL A;  3DM3 A;  3ULP A;  3MFY A;  4NKL A;  1YHQ A;  2F0I A;  3FHW A;  1U4M A;  5EAY A;  4DN4 M;  3RR5 A;  1D7Q A;  5K36 G;  1EOV A;  1B70 B;  1SFO B;  1LLR D;  1HR0 Q;  1OXX K;  2EY1 A;  1QVF A;  1ZXT A;  4OHJ A;  3J81 j;  3UDX A;  3IKJ A;  1TR5 A;  1HXY D;  1X9N A;  4LFB L;  1LAB A;  4R4O A;  3L3O C;  3CXC A;  2ZJQ A;  4LF9 L;  2XVS A;  2K5W A;  4KY6 A;  3OIQ A;  1V1P A;  2ASB A;  4DUY L;  2SOB A;  3K80 C;  2J7Z A;  1NCV A;  2E76 C;  1EY5 A;  5I9P A;  1I50 H;  4JV5 Q;  2F0L A;  4YWK A;  2EJM A;  4GN3 B;  3HZX A;  1VQI A;  1EOT A;  2AQ1 B;  3E9H A;  3R2I A;  4BBR H;  5C4X G;  4LFA L;  1S5E D;  4XIG S;  2HHH Q;  1EYC A;  5IYC H;  4HMI A;  4OIK A;  3K5M A;  3K58 A;  3H6M A;  4K8I A;  5JEA G;  3PUY A;  3QG1 A;  1EYG A;  5IYB H;  2ZXO A;  1X54 A;  1XMO Q;  2MHV A;  1HCZ A;  2F4V L;  4X62 L;  2L12 A;  4A75 A;  4RKB A;  1B3A A;  2RDH A;  1WCM B;  3FEW X;  2L9H A;  4CGY B;  4OO1 G;  4GLX A;  4JI4 Q;  4HIO A;  5CBE E;  1KQS A;  2UXB Q;  1YI2 A;  2HT1 A;  3GTM H;  1YNJ C;  3TBI B;  1E2V A;  1EQT A;  5C0X G;  2TMP A;  5G3L F;  1U9R A;  5ELB A;  1D5M C;  1YJW A;  1U4R A;  2EPB A;  3I55 A;  2WKD A;  1QNK A;  3GO5 A;  1PFS A;  1Y1W H;  4ME5 A;  1D8L A;  4DAY A;  4LF6 Q;  1VQN A;  4YWM A;  3KJP A;  2ICI A;  2XRQ D;  1WCM G;  1SLJ A;  4C3H H;  1Q82 C;  1GVP A;  2K7V A;  3AB9 A;  2AUJ D;  1J8I A;  2FFK B;  2GA4 B;  4OWT B;  4ABN A;  1BCP C;  5M3M B;  2K5Q A;  2JSO A;  2XWB B;  4LK1 C;  1CI3 M;  1O7L A;  3A5U A;  1N32 L;  4PMC A;  4DXG A;  2CCZ A;  1M4V A;  1YHA A;  3T1Y L;  1UE7 A;  2J4X A;  1STG A;  3ERQ A;  3NP8 A;  5I6Y A;  1UEB A;  4P2C B;  4FF2 A;  4DR7 Q;  1JB3 A;  2E2H H;  1NE3 A;  4RGN A;  4KY7 A;  3A8J E;  2PI2 E;  2PZT A;  5BN4 A;  1UNS A;  3M3Y H;  5E4W C;  2JA6 H;  5JPN C;  1NAP A;  2C9O A;  1HPC A;  4X66 Q;  4NXN Q;  4YHH L;  1PFM A;  4JV5 L;  3RLN A;  2RDF A;  5M3M G;  1ENF A;  2F0O A;  1JJ2 A;  2OT2 A;  3S1R H;  2I46 A;  1KNA A;  4GS3 A;  3D8G A;  4JI1 L;  2HHH L;  3FKI H;  2X6L A;  4U68 A;  5ELD A;  4IUQ A;  2BOS A;  2RVL A;  3S2D B;  3JAM i;  4IFD H;  1KC8 C;  2WAQ B;  3DLL A;  3TSS A;  4ZK9 B;  4DUZ Q;  1J5E L;  3J7A V;  1K8A C;  1XMO L;  1I3Q H;  1XYI A;  3BVM A;  2CWP A;  1HNX L;  5ELO A;  2IY5 B;  2Y0S B;  1STH A;  1ONL A;  3MZ5 A;  4JI4 L;  4F88 A;  1PYB A;  4NDX A;  2D9U A;  4RGT A;  1TWA H;  1EEF D;  1VQE A;  1H9S B;  1F2M A;  3J7A 5;  1KDC A;  2Z6K A;  3QR8 A;  1KXL A;  3B6Y A;  4IUP A;  2ID0 A;  1A62 A;  5HGQ A;  4IFD J;  1JOR A;  3R2T A;  4LWC A;  1WTO A;  3F2B A;  3HOY H;  3ERS X;  5IT9 L;  1JMC A;  2RSN A;  4AQY L;  1WTV A;  1K73 C;  2UXD Q;  1S3O A;  3KF6 B;  2KEE A;  2WAQ G;  4L5Q A;  4L8J A;  5T1G A;  2NB0 A;  1PXU A;  1V1P B;  1VMC A;  3JAM c;  4XYO A;  1SR3 A;  4ZKC B;  3AFP A;  3HRZ C;  4RH6 A;  3HFZ B;  2Y0S G;  2B2V C;  5C4J B;  5IE8 A;  2GVA A;  3M4O H;  1VQ5 A;  4JBM A;  4LFC Q;  3GTM B;  3QJY A;  1PH9 A;  1FJG L;  2WAC A;  4DA2 A;  5E7N A;  3HP3 A;  4MTN A;  1AN8 A;  2OTJ A;  4OIJ A;  1TWF H;  3CCS A;  2PI2 A;  2CQO A;  4K2K A;  5D65 A;  3T51 B;  1RTN A;  4DAV A;  1EUJ A;  3K81 C;  4HIM A;  5A35 A;  4A3D H;  2CQA A;  5IYC G;  1Y1W B;  1EYA A;  4K8J A;  4LF7 Q;  1SAP A;  4KHV A;  2GVB A;  5FLM H;  1I6H H;  2OTL A;  3NBH A;  1HZA A;  5IYB G;  4RWS C;  5LL6 X;  1CZG A;  4DR7 L;  5KRU A;  4BA2 I;  3G4S A;  4RFB A;  1Q86 C;  4APV A;  3CRK C;  4C1N K;  2H4O A;  4C3H B;  2Q2H A;  2M00 A;  1A3T A;  4K14 A;  2E5L L;  1Q12 A;  2DY8 A;  2K5V A;  4IUN A;  2IHE A;  5AFW A;  4A76 A;  2ZT9 C;  1Z7T A;  1XXG A;  4A4I A;  1PRT F;  2OCE A;  1IBL Q;  3S2H H;  2A6H D;  1HFN A;  2MGS A;  2ZJP A;  2NN6 I;  4X66 L;  3HEJ A;  2VQF Q;  4POG A;  3I4N H;  3HOU H;  1EY9 A;  2ZJR A;  2JA8 H;  1ET6 A;  3FDT A;  4WJ3 M;  2F0N A;  4YCV A;  5IOC A;  2D0O A;  4GZY C;  3S1M H;  2UUA Q;  4QF4 A;  1LTS D;  3E9I A;  5JVH 3;  1Y1W G;  3CQZ H;  4DAY B;  2YU9 H;  1MGS A;  4JBK A;  2N88 A;  2QDL A;  4ZRZ A;  1PTO C;  3KLS A;  1HUN A;  2JXM B;  3N6R A;  5C3W A;  2E2H B;  3EQL C;  1KAB A;  2F0D A;  1F9R A;  2EY6 A;  4V0B A;  2EE1 A;  3BDL A;  4DV5 Q;  4C3H G;  1E1O A;  1Y69 U;  1PFN A;  4JG2 A;  5IGB A;  1MJC A;  3OWF A;  4RCO A;  5A2Q E;  4LF5 Q;  2JA6 B;  4QL5 A;  1QWY A;  1Y1V H;  2QGQ A;  2G9H D;  4IPD A;  2B2T C;  3TP7 A;  4U67 3;  1Q81 C;  1ZYR C;  1EIH A;  2DGY A;  4K6L A;  4CDF C;  4NXM Q;  2FMC A;  4RAU C;  1TVX A;  4XT1 B;  3MWY W;  3FKI B;  2RSO A;  1QZG A;  4CJ1 B;  3KOJ A;  2PO4 A;  4RCN A;  2K04 A;  3STB C;  4IQZ A;  2R7Z H;  1Y8P B;  4R4C A;  2UXD L;  2FHT A;  3MXP A;  1PH3 A;  2B3G A;  2EJF C;  1SYC A;  1EEI D;  2KBN A;  1PV4 A;  2ICE C;  5IWA Q;  1YIJ A;  1FYC A;  1EFW A;  1T9H A;  5ISR A;  2JA6 G;  3EJI A;  1TWA B;  1C48 A;  2F0W A;  1SYB A;  5J1Z A;  1A3U A;  5CMD A;  1U5K A;  2F0T A;  3HKS A;  4EGV A;  3DM1 A;  3WWV A;  1MD2 D;  3I3C A;  4DR6 Q;  2K5H A;  1IW7 C;  3FKI G;  3EN2 A;  3DUZ A;  1GUO A;  3H09 A;  3PSI A;  1MJE A;  4IFD G;  2RQX A;  2RCF A;  1D1I A;  3NBI A;  4O1N A;  1B53 A;  4LUO A;  4CKE A;  3GTG H;  1IL2 A;  4HCE A;  3GTK H;  4OL7 A;  3VYU A;  1B9M A;  3HOV H;  3G71 A;  1QNU A;  4GOP C;  3ERO A;  2IHF A;  3NQI A;  5C0X I;  1ROD A;  3KBX A;  1RL2 A;  3S24 A;  1L1O B;  1BBW A;  1TWF B;  2I5L X;  2VQF L;  2B39 A;  1TXY A;  4K5W A;  1PVO A;  4NMZ A;  4OGQ C;  1IKL A;  4J1M A;  1PH8 A;  3MXG A;  3AFQ A;  3RN2 A;  1SN8 A;  4A3D B;  5KIX A;  1BO0 A;  1CM9 A;  1M1K C;  5AJ3 L;  4UY8 C;  1QUQ B;  2NWG A;  1WYD A;  3SE0 A;  1G91 A;  4ZCK A;  3AEV A;  3M4Q A;  3M4P A;  2A6E D;  4HCS A;  1SMY C;  3CW2 C;  4X6A H;  5C3X A;  2ZXP A;  4KJN A;  2DNC A;  1VS0 A;  4G4K A;  1HTP A;  1V8Q A;  1HQM C;  2SNM A;  1WVL A;  2B2Y A;  4LF5 L;  3S2H B;  5KNC A;  3HGB A;  2F0H A;  3I4N B;  3F2C A;  3HOU B;  2CVR A;  3L2P A;  2JA8 B;  1U0L A;  3T13 A;  5M9O A;  1QE6 A;  1I4Q A;  1I4H A;  1LTT D;  4S3S A;  3S1M B;  1ZEQ X;  4NXM L;  4DNT B;  1HR0 W;  4A3D G;  1E1T A;  4RGO S;  3CQZ B;  4C2M B;  2K28 A;  3NBH B;  5FLM G;  1BUV T;  4KHP Q;  4CBV A;  1KRS A;  5JJZ A;  4C3I H;  5IOD A;  2KCC A;  4ZYS A;  3OIP A;  1EZ8 A;  4HJ8 A;  2XNA C;  4ODG A;  5IWA L;  2K4K A;  5C44 H;  3TEH B;  1R9T B;  2EXD A;  3I4N G;  3HOU G;  4A3G H;  1DON A;  2JA8 G;  4Z9C B;  2QCP X;  2WB1 E;  3EIV A;  4KHZ A;  4DR6 L;  1B44 D;  3VYR A;  4N8X 1;  3RUZ A;  2I0Q A;  1EIY B;  4L5T A;  2R7Z B;  4N9T A;  3CCE A;  1MHW C;  2CW0 C;  2EXZ A;  1CSQ A;  1S5D D;  3HKZ E;  2WIN B;  1MKH A;  3KLR A;  4DKA C;  2QW7 A;  3RLO A;  3DEO A;  1ASY A;  3KFU A;  3H3V C;  2QIL A;  5K5P A;  4IOA A;  3TS2 A;  5M3F H;  4A3I B;  3BYY B;  4KLK A;  1QJO A;  4FVM A;  1W6K A;  1PZI D;  2VS1 A;  4Y7N H;  2ZXR A;  4LMQ D;  1A3V A;  3PO2 H;  1PH7 A;  4DAP A;  5IT9 E;  3K57 A;  1G6P A;  3GV6 A;  2B2W A;  1CQF A;  2R7Z G;  4LNQ A;  4XYQ A;  1PRT B;  1DGS A;  1P16 A;  1LT4 D;  3D4D A;  3I4M B;  3IRB A;  4DV2 L;  3GTG B;  2RKS A;  3GTK B;  1I4P A;  4HAE A;  1I6V C;  3HOW B;  3PQI A;  4DK0 A;  1X3G A;  1XJV A;  3I73 A;  5LMU Q;  4CJ2 C;  2EOT A;  4QJF A;  2PNH A;  1Q8I A;  3FMC A;  4A3I G;  2X69 A;  1V1Q A;  3BVZ A;  1AE3 A;  2AMC B;  4KD4 A;  4KY5 A;  2GN5 A;  1QIL A;  1SJE D;  4FO2 A;  5C6A A;  1Q7Y C;  2IPK D;  1EQR A;  3P1H A;  4XDX A;  4IZ8 A;  1SEB D;  4YY3 L;  1DOM A;  1LYL A;  2SNS A;  4QQB X;  3I4M G;  4IAL A;  5IGF A;  4DR3 Q;  3K7A H;  1H95 A;  3H0G G;  3CCQ A;  3FVQ A;  5FOB B;  2K01 A;  1YBY A;  1I4X A;  4DNR B;  3HOW G;  2F1M A;  3G7L A;  4KKS A;  5I4D A;  1E0B A;  1J6Q A;  4GKK Q;  3T56 B;  4X3T A;  1OTC A;  5KND A;  1JB7 A;  1C8C A;  1X55 A;  4IN3 A;  1K8M A;  2BCO A;  3TDQ A;  3I91 A;  3I7F A;  4HID A;  1D6E C;  1A2T A;  5DLQ E;  5FLX E;  2L4N A;  2OF1 A;  4JI6 L;  1MSH A;  2JJQ A;  2JA9 A;  2NVQ H;  4CDD C;  2ES2 A;  4BA1 I;  4X65 Q;  4C3I B;  1TKW B;  3RZD H;  1I94 L;  4PQX A;  1GUW A;  4B08 A;  5C44 B;  1V9P A;  4JI2 Q;  1SYE A;  1WJJ A;  4IUR A;  4B9W A;  4JI3 Q;  3TP5 A;  4A3G B;  4DV0 Q;  4WOR A;  1BNZ A;  1ICF B;  1B50 A;  3A7A B;  1WTP A;  4C3J H;  2XSC A;  4JBW A;  2HQL A;  1UE5 A;  5IP9 H;  5CV9 A;  3MXN A;  4LUZ A;  3JAM L;  3HG9 A;  3E6Z X;  4XQN A;  4DK1 A;  1TWH H;  1Y8N B;  3CP0 A;  2UU9 Q;  2M2L A;  4A3M H;  4QIW E;  4OEM B;  2B63 H;  4JI5 Q;  4BY1 H;  4BS9 A;  1UAP A;  4R4T A;  1JQY D;  3G6E A;  1NR2 A;  5LMU L;  3S15 H;  4JK1 C;  5M3F B;  4NB3 A;  2P5Z X;  4I65 A;  1YVC A;  1HQR D;  4DU9 A;  4Y7N B;  4DGZ A;  3PO2 B;  4KN7 C;  3FPP A;  2B2V A;  2BH2 A;  4JI8 Q;  4R1J A;  1EQV A;  1HNW L;  5EJW A;  4EVO A;  5DM6 3;  4N9P A;  4LUV A;  1W6J A;  1WD0 A;  3R8B A;  1AZP A;  1L0X B;  1CT1 D;  3TP6 A;  5C3E B;  1WI5 A;  4TVA B;  3URY A;  4UAI A;  4F7X A;  2R93 H;  1VQ6 A;  4CJ0 B;  1LTR D;  3LGJ A;  1YNJ D;  4DV3 L;  1UEA B;  3VR3 A;  4FDB A;  4RG1 A;  3LNN A;  3X3N A;  4GKK L;  2IT1 A;  3CF5 A;  3RLF A;  2HUG A;  1EZ6 A;  1O7Y A;  1VQH A;  2F0J A;  2Q8I B;  1CKN A;  3K6O A;  3PF4 A;  2F03 A;  3BVG A;  3PO2 G;  4F87 A;  5M5W B;  4A3C H;  2V4D A;  2EYO A;  3V05 A;  1EIG A;  3SDZ A;  3Q8D A;  1WTH A;  2R61 A;  2B2U C;  3DEP A;  1HR0 L;  1X3F A;  2IX1 A;  4X65 L;  4GNX B;  1X3P A;  3K7A B;  2G9D A;  4K5X A;  2B29 A;  4CKC A;  2WKC A;  2R6G A;  3OTO Q;  5C3E G;  1O7Z A;  3NUC A;  2K50 A;  3N52 A;  1DJR D;  3MFG A;  2A68 C;  3QO2 A;  3A0J A;  5JPM C;  2JQO A;  2R92 B;  3T4A C;  3S9W A;  2OWO A;  4O42 A;  4DXF A;  1BCP D;  2RCN A;  4DV0 L;  2A5H A;  2VNU D;  3PUX A;  3D0F A;  4ILW A;  2VB3 X;  1NTG A;  3MXU A;  2AUK A;  4X3U A;  5KGU A;  4QCL A;  3O13 A;  2NVQ B;  3VR5 A;  2H5X A;  2WB1 B;  5EKL A;  2BA1 A;  1TQO A;  2ZTE A;  2HDL A;  2A69 C;  3RZD B;  3KUP A;  5FKA C;  2I07 B;  1JC7 A;  4WFN 3;  2KA7 A;  2MP1 A;  2QDB A;  1ESR A;  4JI5 L;  2E2D C;  2R7D A;  1ML0 D;  2OEO A;  1C7Y A;  2MO1 A;  2R92 G;  4EX5 A;  3HKZ B;  3KDF B;  1K28 A;  1EQQ A;  2VY3 A;  1YJN A;  2UXB L;  2AQ2 B;  3U4V A;  1I50 B;  4G57 A;  4GN5 A;  4C3J B;  3DWQ A;  4BBR B;  3DWA A;  1BBU A;  1CSP A;  2K5D A;  2Z8L A;  1RCV D;  3PUZ A;  3CMA A;  1YEZ A;  3L9A X;  2JN4 A;  4B3R Q;  2YTX A;  3KK7 A;  3CCJ A;  2WB1 G;  4BBS H;  1VMP A;  3VR6 A;  3HOZ H;  2ZTC A;  3I2Z A;  3A7L A;  1TWH B;  4LF6 L;  3CC7 A;  4A3M B;  4BXX H;  1SE2 A;  1P8L A;  2B63 B;  2LSS A;  4L5S A;  3Q6S A;  1LV9 A;  2Z9H A;  1XTC D;  3NPP A;  4JPB W;  4A3K H;  3S15 B;  3IL8 A;  1DCZ A;  1WOC A;  1SYF A;  3Q24 A;  3KLW A;  2CH4 W;  4QGU A;  4AYB E;  2XRS D;  4OX9 Q;  1L0Y B;  3CRL C;  4ZQ3 A;  4DR2 Q;  2TSS A;  1HNZ Q;  1EWH A;  4PG3 A;  4QY7 A;  4J8Q A;  1X3E A;  3I4O A;  4C3J G;  4BBR G;  3P75 A;  5IP9 G;  1XNQ Q;  1A63 A;  4R4I A;  5BN3 A;  1NNX A;  5DEH A;  1ILP A;  2JK8 A;  3BZK A;  3MXN B;  4GOP A;  2F52 A;  4DR5 Q;  1S40 A;  2HCC A;  1AH9 A;  3V2T A;  2E2J H;  1YNN C;  3A5Z B;  1E24 A;  4A3M G;  1VQL A;  1UE1 A;  2R3Z A;  3SHL A;  2UXC Q;  2A1A A;  2MFI A;  2PCF B;  3OTO L;  2R93 B;  3GTL H;  4X64 Q;  2NVT H;  1TS2 A;  3K0X A;  4FP5 D;  3NXW A;  1JR0 D;  4HIK A;  2VL6 A;  3CHB D;  2RDG A;  1LTI D;  1MBY A;  2KQ3 A;  4NXN L;  3LX0 A;  4J6H A;  3EA6 A;  3NSW A;  4CHT B;  3BZD B;  3TN2 A;  1F2L A;  3Q0A A;  1BKB A;  1EU3 A;  3MC0 B;  5GQO A;  2PPB C;  4O2D A;  2EZV A;  3H3V I;  1UWV A;  3MHB A;  1UUP A;  1Y14 B;  3AQQ A;  1GD7 A;  5ELE A;  1VQM A;  2EJG C;  4DUZ L;  1IHZ A;  2F0F A;  1I4G A;  3BDO A;  2R93 G;  5HUR A;  3K5O A;  1YNX A;  3M3Y B;  4PZ8 A;  5E1F A;  1FGB D;  2E2I H;  1QOH A;  4WRD A;  4UP7 A;  5BR8 Q;  1CKN B;  4UHV A;  3OW7 A;  2K14 A;  2G5D A;  1VQO A;  3S1R B;  4GLA C;  4DK3 C;  1SMX A;  1D5X C;  1ICW A;  4P71 A;  1HRJ A;  5COR A;  1OO9 B;  1PTO D;  5GAH C;  1XPO A;  2PQA A;  2HIV A;  4MNO A;  1K8G A;  1SNO A;  3NWT A;  2PW7 A;  3MVV A;  1VQK A;  3J80 L;  5ELF A;  2F3I A;  4JI7 Q;  2DY7 A;  3UI2 A;  1I3Q B;  1EWI A;  2NTS A;  4YCW A;  1CHQ D;  2Z1C A;  1LUZ A;  2F0E A;  2K33 A;  2I5H A;  3FPU B;  4PMB A;  5IYD H;  4XT3 B;  1EWC A;  1CK1 A;  4LFC L;  3MA2 B;  1ZYR D;  1RDP D;  4OX9 L;  3Q22 A;  4QIW B;  4TSS A;  2EYF A;  3E3X A;  1KDB A;  1IBK Q;  1HNZ L;  4P75 A;  2BDO A;  3K5N A;  1RIP A;  1V1O A;  4A3B H;  4IO9 A;  2KOL A;  3STB D;  1XNQ L;  1XPU A;  2K5N A;  3HOY B;  1L1O C;  2UUC Q;  4BBS B;  4ME3 A;  4JOI C;  3HOZ B;  3SEB A;  1CUK A;  3RMH A;  4LF7 L;  1GKH A;  5NUC A;  3PUV A;  2RA4 A;  2XN9 C;  3FP9 A;  4ID6 A;  1WTW A;  2PZW A;  4P74 A;  4OO1 I;  2SDF A;  4A3K B;  3QIA A;  2A8V A;  1KIX A;  5E3F A;  4I7A A;  2AWO A;  3M4O B;  2VB2 X;  2NN6 H;  4A3F H;  3C2P A;  4IJL A;  3UE1 A;  1NBW A;  3TZU A;  1IBL L;  5I9O A;  4K2L A;  1GM5 A;  4B9X A;  2OQK A;  1RD9 D;  1IW7 D;  1W2B A;  4B3M Q;  1B2T A;  3CCM A;  1SDF A;  2EY5 A;  3HOY G;  1QVC A;  2UUA L;  4R8N A;  1RF2 D;  3HOZ G;  1I6H B;  4KKU A;  3J81 L;  1AEX A;  1GUG A;  3K59 A;  3K5L A;  2E2J B;  3K8A A;  1ILQ A;  1F77 A;  1Z6H A;  5M5Y H;  2Z0S A;  3NQT A;  1I4R A;  1FGU A;  1EY0 A;  3KF8 A;  4A3K G;  4DV5 L;  3K0Y A;  3SK8 A;  2NVT B;  1X6O A;  1SE4 A;  3H91 A;  4K0K Q;  3CKI B;  2WP8 J;  4HSV A;  4ZUJ A;  1HZC A;  5C5L A;  3CU7 A;  3EVQ A;  1TWC H;  1WD1 A;  5FO7 B;  5ELC A;  4EQ5 A;  5F2D A;  2EYH A;  5K36 H;  1VQA A;  1C9O A;  5BR8 L;  2FIN B;  4IUV A;  3GTO H;  5IY0 A;  1PFB A;  3U4Z A;  2OQ0 A;  3S1N H;  3D3R A;  2E75 C;  2JE6 I;  3GP7 A;  4HR7 B;  1XNR Q;  5EPJ A;  1VQ4 A;  1N33 Q;  2YU9 B;  1F9P A;  1SE8 A;  2HCI A;  2LY7 A;  1EY4 A;  1VQB A;  2F0S A;  1SMY D;  4HJ9 A;  5CYU A;  2F0Q A;  2YTY A;  1TU2 B;  2KVM A;  4OON A;  2VQE Q;  3PV0 A;  1K0S A;  4JI7 L;  1VDZ A;  2Q8T A;  3ICE A;  4HJ5 A;  2KHS A;  1JWU D;  4WJW A;  5E4X A;  1HZB A;  2KHI A;  4DR1 Q;  1TY0 A;  5C4X H;  2E2I B;  4N8F A;  3F8T A;  1Y1V B;  1T5X D;  1D1K A;  3ND9 A;  1L2F A;  1H9R A;  3PCO B;  3QB3 A;  1CA6 A;  1IBK L;  5HY6 A;  2VUM H;  2JEA I;  5FLX c;  1EIF A;  3PIO 3;  5JEA H;  2JA7 H;  2X6G A;  2IW3 A;  2UUC L;  1BVS A;  4EQN A;  4G7H C;  1GHJ A;  4ZUI A;  1II3 A;  1HA6 A;  5LHY 1;  2MO0 A;  3TS0 A;  3NEL A;  2KJX A;  3NE5 B;  5JJL A;  1E7Z A;  1PRT C;  1PMR A;  5C0X H;  1SYD A;  4CDC C;  1EY6 A;  3S17 H;  2KED A;  1G8Z D;  1BCP F;  2O4X A;  1MI2 A;  1Y1V G;  2KUM A;  3NTK A;  2XIW A;  5I2X A;  3I4L A;  3OW2 A;  4A3B B;  2NBF A;  4B3M L;  1JOK A;  4OXP A;  4AYB B;  1GOZ A;  1S4Z A;  2NTT A;  2PQA B;  4LF9 Q;  1FNU A;  1OXT A;  2CW0 D;  3SVM A;  1PHJ A;  1NMF A;  3HOX H;  4K5V A;  1TT2 A;  4DV1 Q;  4RGM A;  4DUY Q;  3NHH A;  3U58 A;  1E3P A;  1OXS C;  1PA6 A;  4JCV E;  2YTV A;  3WOF A;  4CDE C;  3GTJ H;  2YV5 A;  2L15 A;  4MZ9 A;  5EKI A;  3HOV B;  4HJA A;  4A3F B;  4K0K L;  1B9N A;  1JT8 A;  5CV7 A;  1VF7 A;  2F0M A;  1DXM A;  2EYP A;  2Q2I A;  3C1F A;  3GTQ H;  1JWM D;  2PYK A;  4A3B G;  5C4Z A;  3OWE B;  2NVY H;  2AWN A;  5LMN Q;  4AYB G;  2QEX A;  4J15 A;  2F4V Q;  3EBE A;  4IUU A;  1KD1 C;  1F2Y A;  2D62 A;  3BG3 A;  4MN3 A;  2ENB A;  3M85 A;  1DOL A;  2IX0 A;  3TME A;  1N33 L;  1CKM A;  1BF4 A;  5CV5 A;  4FF3 A;  2F4I A;  3D31 A;  1FR3 A;  2A73 B;  1AP0 A;  4KHP L;  4XTC S;  1DD2 A;  2VQE L;  4BY7 H;  5M5Y B;  1A15 A;  1DOK A;  2BE5 C;  3F1Z A;  2ALY B;  1G2S A;  2K6A A;  2H1E A;  1S5C D;  3R3O A;  3HOV G;  2NN6 G;  1RJT A;  5M3M H;  1DYQ A;  1STY A;  4A3F G;  2B2U A;  1NJI C;  1TWC B;  4DR1 L;  2CWA A;  3CC4 A;  5KYL A;  3F2D A;  1F9Q A;  3P20 A;  3GTO B;  4GLV B;  1D5Z C;  2Q2U A;  4B3S Q;  3S1N B;  3I90 A;  1Y8O B;  2KEN A;  2QF7 A;  4V19 0;  3PIP A;  5FO9 B;  3GDE A;  1IYU A;  1B4O A;  3PIP 3;  1IBM Q;  4H02 A;  3P7J A;  3ZYY X;  4ZLT F;  3OSO A;  1KHI A;  1TWG H;  2XWJ B;  3KF8 B;  3CAM A;  3PUW A;  3ONA B;  3IAY A;  1JCK B;  1H9S A;  3OYY A;  1A8V A;  2JP1 A;  3F2U A;  1CZW A;  1WTR A;  1N32 Q;  5C4X B;  3OPO A;  1J9O A;  4EQP A;  1O7I A;  1SBB B;  5J22 A;  3T1Y Q;  1O80 A;  1SE3 A;  4HJ7 A;  3I72 A;  4H7B A;  3MAQ A;  3CPF A;  4A3J H;  1KL9 A;  2VUM B;  5IIF A;  1KAW A;  3SK4 A;  5L37 A;  3H94 A;  4CKB A;  3S2D H;  5J3B A;  2EQS A;  2JA7 B;  4GN4 B;  1CTM A;  3KF6 A;  1MSG A;  3I70 A;  2MNA A;  3FRP B;  3S1Q H;  4A3L H;  3EFX D;  2UUB Q;  4FXD A;  4AIM A;  4DV1 L;  4KKT A;  1LTG D;  3J80 E;  3TQY A;  4C3I G;  2NZH A;  3VR2 A;  5DM7 3;  1OXV A;  4RMF A;  1LO5 D;  1KLU D;  4YHH Q;  1WTQ A;  2JEB I;  4DFA A;  4LAA A;  2DNE A;  5C44 G;  4A93 H;  3K7U C;  3MEH A;  3S17 B;  1EU4 A;  4JI1 Q;  4DPG A;  3IFT A;  4LF4 Q;  1NUC A;  3OHX C;  4A3G G;  1CHP D;  4NW2 A;  2VUM G;  4M8A A;  1TII D;  1J5E Q;  4PNY A;  2JA7 G;  2MPM A;  2Z6B A;  5LMN L;  1KDA A;  3X3M A;  5KNB A;  3HOX B;  4IFD I;  1PTO F;  1HNX Q;  2EYL A;  2OXP A;  2R7F A;  2N78 A;  3E0E A;  1ZKO A;  2V1C C;  1K8O A;  1RTO A;  4X3S A;  4IOC A;  5C4J H;  1N36 Q;  4QUC A;  5CV6 A;  2B2W C;  3GTJ B;  1HTL D;  4DR3 L;  1RHP A;  4YIJ A;  4DV6 Q;  4RHR A;  4PZ6 A;  3GD7 A;  4H13 C;  1O78 A;  1E2Z A;  4XQQ A;  5JJK A;  4TQU S;  5EGT A;  4GNX C;  5EPL A;  2PMZ E;  2XTI A;  3D6W A;  5M3F G;  2JA5 H;  2RF4 A;  3A74 A;  4AQY Q;  1PZK D;  1K9M C;  3GTQ B;  4L63 B;  2NVY B;  3C3L A;  2VXW A;  4ZAI A;  2IL8 A;  2RHS B;  5IGG A;  2N3S A;  4B3S L;  3C46 A;  3M9B A;  2K05 A;  1CQV A;  2PQE A;  3HOX G;  5C4H A;  1IZ6 A;  3CC2 A;  3J81 E;  4Q0F A;  5TSS A;  1IBM L;  2B8G A;  4BY7 B;  1LAC A;  1N9W A;  1FJG Q;  1BOS A;  5LL6 S;  3VR4 A;  1S5F D;  5KYI A;  4XXE A;  5HGT A;  1QCB D;  1KNE A;  4HMJ A;  1R4P B;  1EYD A;  1HUM A;  3S14 H;  5FJ8 H;  4L6T B;  2O5J C;  4JI2 L;  4QMG A;  1STE A;  4JI3 L;  4FF1 A;  1Q1E A;  4KK7 A;  3OMG A;  1KRT A;  3W5O A;  4C56 C;  1JJG A;  2BH8 A;  1C0A A;  2F0P A;  2C5C A;  2NVX H;  3CCR A;  3TRE A;  3VA7 A;  2E5L Q;  1VF5 C;  2PW5 A;  3G6J B;  2UUB L;  4Q5V A;  1ENA A;  4BY7 G;  1BCP B;  3LWE A; 
#chains in the Genus database with same CATH homology
 1TWG B;  1FNV A;  1JWS D;  2B2T A;  5I2Y A;  2F0U A;  2HQE A;  2A68 D;  4HTH A;  5D3D A;  4F8M A;  1G2T A;  3D4W A;  5EBD A;  5DAU A;  1PTO H;  3SK5 A;  3QOJ A;  4A3J B;  3A8K E;  1FD7 D;  5JOB A;  2F3W A;  3WOE A;  1JOQ A;  3S1Q B;  2FMM A;  2IWH A;  3BDC A;  3RD4 A;  1AW7 A;  2A69 D;  2N55 A;  1ENC A;  1H9K A;  1BXT A;  3VA5 A;  1EY7 A;  3PMF A;  4HED A;  4BY1 B;  4A93 B;  5FK9 C;  2EY2 A;  4KTA A;  3M7G A;  1JE4 A;  1DZ1 A;  1JOO A;  1TS3 A;  2JYO A;  3ITP A;  2EVB A;  1TS5 A;  1BR9 A;  1Q3L A;  4MHE A;  1WTX A;  1A2U A;  4FXG C;  3AU7 A;  5J39 A;  2K1B A;  2D2C C;  2HDM A;  4XQJ A;  1XX8 A;  1IKM A;  3A55 A;  2WV6 D;  3MTS A;  4QB4 A;  3LWU A;  1GJX A;  1Q1B A;  2DN8 A;  2LKV A;  4ULL A;  1FNW A;  1HFG A;  2A6H C;  4KV6 A;  3U9S A;  3TP8 A;  4RKL A;  2LMC B;  2JA5 B;  3R93 A;  4K6D A;  3WDN A;  2PNR C;  1KTK A;  3M4Y A;  3BYT B;  5FO8 B;  5EQ0 A;  4TKO B;  1YNN D;  4PV1 C;  1NSN S;  4R8I A;  4H0L C;  1U4P A;  5CBA E;  1G6Z A;  5IGE A;  5EPK A;  3A8I E;  3M7N A;  1H9J A;  3S14 B;  2CHB D;  2EDG A;  3W2D A;  2J0T D;  2B8F A;  5FLX L;  1SXT A;  3T53 B;  1D2B A;  1X3Q A;  1GXD C;  1STA A;  2NVX B;  5DNF A;  2NUC A;  4G7Z C;  2M9V A;  3I8Z A;  3VYT A;  1GUT A;  4IUT A;  4QUF A;  1CFM A;  2F0K A;  2QEJ C;  5KEE A;  5G3L D;  4RHS A;  4RA8 A;  1SND A;  3GTP B;  5BN5 A;  1PTO B;  3C1E A;  5CC4 A;  4C1N I;  1RKN A;  3QOL A;  1GUS A;  1Z47 A;  1QG7 A;  4MIU A;  5EBC A;  4G7O C;  3NWS A;  5EKK A;  1SYG A;  5CGK A;  3JAM E;  1EL0 A;  4E6I A;  3VYS A;  2Z4H A;  1E2W A;  2NYZ D;  3IFD A;  1EFI D;  1LT5 D;  3DXJ C;  5CV4 A;  2D5D A;  2KEC A;  5D14 A;  3SK6 A;  1GHK A;  2EYJ A;  3SXH A;  2RBM A;  1LT3 D;  4BWG B;  1T5E A;  3E5S A;  3J7Y W;  1TS4 A;  2PMZ B;  1ET9 A;  4KD3 A;  3A54 A;  1HHV A;  2A6E C;  5IGC A;  4LJZ C;  3NTH A;  3GQB A;  1A6X A;  5I6W A;  3PO3 B;  2MUY A;  3SR1 A;  3OMC A;  2F0G A;  3GTL B;  4EQO A;  1SNP A;  1LTB D;  1OXU A;  4DF7 A;  3S16 B;  3D4R A;  1AFP A;  1GUN A;  2L55 A;  3TZD A;  1SNC A;  2SEB D;  2F3V A;  4KI0 A;  5CV8 A;  4HN7 A;  3DMU A;  4A3E B;  1BDO A;  1PDQ A;  4FF4 A;  3QWN A;  1X32 A;  1SSO A;  1U4L A;  2NZ1 D;  1R4Q B;  4KN4 C;  1HA5 A;  4X3K A;  3E0J A;  1EY8 A;  1S5B D;  3BS1 A;  4FYD A;  1XWE A;  2K03 A;  4FNF A;  1G29 1;  5D3I B;  2E74 C;  3DHQ A;  2LFN A;  3J7A F;  2QKI C;  2F0V A;  3GV3 A;  3U9O A;  4R9W A;  3HS0 C;  1ESF A;  2YYZ A;  4KJO A;  2BA0 A;  4TRD A;  2KCN A;  1PYW D;  4OO1 H;  1LTA D;  4M1U B;  4HSP A;  1Q90 A;  1KLG D;  3V96 A;  5M5X B;  2AQ3 B;  1B1Z A;  3KBG A;  2L5T A;  1CA5 A;  2PZU A;  1V43 A;  5C5M A;  2O5I C;  4PMW A;  5JEA J;  2IX3 A;  3D6C A;  2LS0 1;  3KLS X;  1IL8 A;  5T1I A;  1F2Z A;  3NTI A;  1LT6 D;  2FJ2 A;  2IJ0 A;  4FXK C;  4UDU C;  5C0X J;  2MJ8 A;  1PRT D;  2A74 C;  4I7Z C;  2L11 A;  3OOC A;  2Q8R E;  1C4Q A;  1STN A;  5COY A;  2Z4I A;  2WII B;  3L7Z C;  1VCI A;  3AMU A;  1PLF A;  1STB A;  3H0G B;  3T16 A;  3A56 A;  1BBX C;  2O2L D;  1IYV A;  1DM0 B;  3ND8 A;  4ZKB B;  2L0C A;  1SJH D;  2BDN A;  4H44 C;  1AZQ A;  1SNM A;  1JIC A;  3NK9 A;  2B2Y C;  1K83 B;  1SNQ A;  2EYM A;  1PZJ D;  1QB5 D;  3W3A A;  2L1B A;  3DWP A;  1BQQ T;  1TY2 A;  1H9M A;  5JVG 3;  4KMU C;  5CR3 A;  2BE5 D;  1M8A A;  5A2Q L;  3Q23 A;  5JAV A;  4NP5 A;  2K32 A;  1F9S A;  1KAA A;  5IGD A;  3RZO B;  1NR4 A;  3MFY A;  4NKL A;  2F0I A;  1U4M A;  4DN4 M;  5K36 G;  1SFO B;  1LLR D;  1OXX K;  2EY1 A;  1ZXT A;  4OHJ A;  3IKJ A;  1TR5 A;  1HXY D;  1LAB A;  3L3O C;  2XVS A;  2K5W A;  4KY6 A;  3OIQ A;  1V1P A;  2SOB A;  2J7Z A;  1NCV A;  2E76 C;  1EY5 A;  5I9P A;  2F0L A;  2EJM A;  3HZX A;  1EOT A;  2AQ1 B;  3R2I A;  1S5E D;  4XIG S;  1EYC A;  4HMI A;  4OIK A;  3K5M A;  3K58 A;  3H6M A;  4K8I A;  5JEA G;  3PUY A;  3QG1 A;  2ZXO A;  2MHV A;  1HCZ A;  2L12 A;  4RKB A;  1B3A A;  2RDH A;  1WCM B;  3FEW X;  2L9H A;  4CGY B;  4OO1 G;  5CBE E;  1YNJ C;  3TBI B;  1E2V A;  1EQT A;  5C0X G;  2TMP A;  5G3L F;  1U9R A;  5ELB A;  1D5M C;  1U4R A;  2EPB A;  2WKD A;  1QNK A;  3GO5 A;  4ME5 A;  4DAY A;  2ICI A;  2XRQ D;  2K7V A;  3AB9 A;  2AUJ D;  1J8I A;  2FFK B;  2GA4 B;  4ABN A;  1BCP C;  5M3M B;  2K5Q A;  2JSO A;  2XWB B;  4LK1 C;  1CI3 M;  1O7L A;  4PMC A;  4DXG A;  1M4V A;  2J4X A;  1STG A;  3ERQ A;  3NP8 A;  5I6Y A;  4P2C B;  4FF2 A;  1JB3 A;  4RGN A;  4KY7 A;  3A8J E;  2PZT A;  5BN4 A;  1UNS A;  5E4W C;  5JPN C;  1NAP A;  2C9O A;  1HPC A;  1PFM A;  2RDF A;  1ENF A;  2F0O A;  2OT2 A;  2I46 A;  1KNA A;  3D8G A;  2X6L A;  4U68 A;  5ELD A;  4IUQ A;  2BOS A;  2RVL A;  3S2D B;  4IFD H;  2WAQ B;  3TSS A;  4ZK9 B;  3J7A V;  1XYI A;  3BVM A;  2Y0S B;  1STH A;  1ONL A;  3MZ5 A;  4F88 A;  4NDX A;  2D9U A;  4RGT A;  1EEF D;  1H9S B;  1F2M A;  1KDC A;  4IUP A;  2ID0 A;  4IFD J;  1JOR A;  3R2T A;  1WTO A;  5IT9 L;  2RSN A;  1WTV A;  2KEE A;  4L8J A;  5T1G A;  2NB0 A;  1PXU A;  1V1P B;  1VMC A;  4XYO A;  4ZKC B;  3HRZ C;  4RH6 A;  2B2V C;  5C4J B;  3GTM B;  3QJY A;  2WAC A;  4DA2 A;  3HP3 A;  1AN8 A;  4OIJ A;  4K2K A;  5D65 A;  3T51 B;  1RTN A;  4DAV A;  5A35 A;  2CQA A;  1Y1W B;  1EYA A;  4K8J A;  1SAP A;  4KHV A;  3NBH A;  4RWS C;  5LL6 X;  1CZG A;  5KRU A;  4BA2 I;  4RFB A;  3CRK C;  4C1N K;  2H4O A;  4C3H B;  2M00 A;  1A3T A;  4K14 A;  1Q12 A;  2DY8 A;  4IUN A;  5AFW A;  2ZT9 C;  1Z7T A;  1XXG A;  1PRT F;  2A6H D;  1HFN A;  2MGS A;  2NN6 I;  3HEJ A;  1EY9 A;  1ET6 A;  3FDT A;  2F0N A;  5IOC A;  4GZY C;  4QF4 A;  1LTS D;  5JVH 3;  1MGS A;  2N88 A;  4ZRZ A;  1PTO C;  3KLS A;  1HUN A;  2JXM B;  3N6R A;  5C3W A;  2E2H B;  3EQL C;  1KAB A;  2F0D A;  1F9R A;  2EY6 A;  4V0B A;  2EE1 A;  3BDL A;  4C3H G;  1Y69 U;  1PFN A;  5IGB A;  3OWF A;  4RCO A;  5A2Q E;  2JA6 B;  1QWY A;  2G9H D;  4U67 3;  2B2T C;  3TP7 A;  1EIH A;  1ZYR C;  4K6L A;  2FMC A;  4RAU C;  1TVX A;  4XT1 B;  3MWY W;  3FKI B;  2RSO A;  4CJ1 B;  2PO4 A;  4RCN A;  2K04 A;  4IQZ A;  1Y8P B;  2FHT A;  3MXP A;  2EJF C;  1SYC A;  1EEI D;  2ICE C;  1FYC A;  5ISR A;  3EJI A;  1TWA B;  1C48 A;  2F0W A;  1SYB A;  5J1Z A;  1A3U A;  5CMD A;  2F0T A;  4EGV A;  3DM1 A;  1MD2 D;  3I3C A;  1IW7 C;  3DUZ A;  1GUO A;  3H09 A;  4IFD G;  2RQX A;  1D1I A;  3NBI A;  4O1N A;  1B53 A;  4CKE A;  4HCE A;  4OL7 A;  3VYU A;  1B9M A;  1QNU A;  3ERO A;  3NQI A;  5C0X I;  1ROD A;  3KBX A;  1TWF B;  2B39 A;  4K5W A;  4NMZ A;  4OGQ C;  1IKL A;  4J1M A;  3MXG A;  4A3D B;  5KIX A;  1BO0 A;  1CM9 A;  2NWG A;  3SE0 A;  1G91 A;  2A6E D;  4HCS A;  1SMY C;  5C3X A;  2ZXP A;  4KJN A;  2DNC A;  4G4K A;  1HTP A;  1V8Q A;  1HQM C;  2SNM A;  1WVL A;  2B2Y A;  3S2H B;  5KNC A;  3HGB A;  2F0H A;  3I4N B;  3HOU B;  2CVR A;  2JA8 B;  3T13 A;  5M9O A;  1QE6 A;  1I4Q A;  1I4H A;  1LTT D;  4S3S A;  3S1M B;  1ZEQ X;  4DNT B;  4RGO S;  3CQZ B;  4C2M B;  2K28 A;  1BUV T;  4CBV A;  5JJZ A;  5IOD A;  2KCC A;  4ZYS A;  3OIP A;  1EZ8 A;  2XNA C;  4ODG A;  1R9T B;  1DON A;  4Z9C B;  2QCP X;  4KHZ A;  1B44 D;  3VYR A;  3RUZ A;  2R7Z B;  4N9T A;  2CW0 C;  2EXZ A;  1S5D D;  2WIN B;  3KLR A;  3DEO A;  3H3V C;  2QIL A;  5K5P A;  4A3I B;  3BYY B;  1QJO A;  1W6K A;  4FVM A;  1PZI D;  2ZXR A;  4LMQ D;  1A3V A;  4DAP A;  5IT9 E;  3K57 A;  3GV6 A;  2B2W A;  1CQF A;  4XYQ A;  1PRT B;  1LT4 D;  3D4D A;  3I4M B;  3GTG B;  2RKS A;  3GTK B;  1I4P A;  4HAE A;  1I6V C;  3HOW B;  4DK0 A;  3I73 A;  4CJ2 C;  2EOT A;  1Q8I A;  3FMC A;  2X69 A;  3BVZ A;  4KD4 A;  4KY5 A;  1QIL A;  1SJE D;  4FO2 A;  5C6A A;  2IPK D;  3P1H A;  4XDX A;  4IZ8 A;  1SEB D;  1DOM A;  2SNS A;  4IAL A;  5IGF A;  3FVQ A;  5FOB B;  2K01 A;  1I4X A;  4DNR B;  2F1M A;  3G7L A;  4KKS A;  5I4D A;  1E0B A;  3T56 B;  4X3T A;  5KND A;  1C8C A;  4IN3 A;  1K8M A;  2BCO A;  3TDQ A;  3I91 A;  1D6E C;  1A2T A;  5FLX E;  2L4N A;  2OF1 A;  1MSH A;  4BA1 I;  4C3I B;  1TKW B;  4PQX A;  1GUW A;  4B08 A;  5C44 B;  1SYE A;  4IUR A;  4B9W A;  4A3G B;  3TP5 A;  4WOR A;  1BNZ A;  1B50 A;  3A7A B;  1WTP A;  2XSC A;  4JBW A;  5CV9 A;  3MXN A;  3JAM L;  3HG9 A;  3E6Z X;  4XQN A;  4DK1 A;  1Y8N B;  2M2L A;  4BS9 A;  1UAP A;  1JQY D;  1NR2 A;  4JK1 C;  5M3F B;  4I65 A;  1HQR D;  4DU9 A;  4Y7N B;  4DGZ A;  3PO2 B;  4KN7 C;  3FPP A;  2B2V A;  1EQV A;  5EJW A;  4EVO A;  5DM6 3;  4N9P A;  1W6J A;  1WD0 A;  3R8B A;  1AZP A;  1L0X B;  1CT1 D;  3TP6 A;  5C3E B;  3URY A;  4UAI A;  4F7X A;  4CJ0 B;  1LTR D;  1YNJ D;  1UEA B;  3VR3 A;  3LNN A;  3X3N A;  2IT1 A;  3RLF A;  2HUG A;  1EZ6 A;  1O7Y A;  2F0J A;  2Q8I B;  3K6O A;  2F03 A;  3BVG A;  4F87 A;  5M5W B;  2V4D A;  2EYO A;  3V05 A;  1EIG A;  3SDZ A;  2R61 A;  2B2U C;  3DEP A;  2IX1 A;  1X3P A;  3K7A B;  2G9D A;  4K5X A;  4CKC A;  2WKC A;  2R6G A;  1O7Z A;  3NUC A;  3N52 A;  1DJR D;  3MFG A;  2A68 C;  3QO2 A;  5JPM C;  2R92 B;  3T4A C;  3S9W A;  4O42 A;  4DXF A;  1BCP D;  2A5H A;  2VNU D;  3PUX A;  4ILW A;  2VB3 X;  3MXU A;  2AUK A;  4X3U A;  5KGU A;  4QCL A;  3O13 A;  2NVQ B;  3VR5 A;  2WB1 B;  5EKL A;  2BA1 A;  1TQO A;  2HDL A;  2A69 C;  3RZD B;  3KUP A;  5FKA C;  2I07 B;  1JC7 A;  4WFN 3;  2KA7 A;  2MP1 A;  2QDB A;  1ESR A;  2E2D C;  1ML0 D;  2OEO A;  3HKZ B;  2AQ2 B;  1I50 B;  4G57 A;  4C3J B;  3DWQ A;  4BBR B;  3DWA A;  2K5D A;  2Z8L A;  1RCV D;  3PUZ A;  3L9A X;  3KK7 A;  1VMP A;  3VR6 A;  3A7L A;  1TWH B;  4A3M B;  1SE2 A;  2B63 B;  1LV9 A;  3Q6S A;  1XTC D;  3NPP A;  3S15 B;  3IL8 A;  1DCZ A;  1SYF A;  3Q24 A;  2XRS D;  1L0Y B;  3CRL C;  4ZQ3 A;  2TSS A;  1EWH A;  4J8Q A;  4C3J G;  3P75 A;  5BN3 A;  1ILP A;  5DEH A;  2HCC A;  3V2T A;  1YNN C;  2R3Z A;  3SHL A;  2PCF B;  2R93 B;  1TS2 A;  4FP5 D;  3NXW A;  1JR0 D;  3CHB D;  2RDG A;  1LTI D;  1MBY A;  2KQ3 A;  3LX0 A;  4J6H A;  3EA6 A;  3NSW A;  4CHT B;  3BZD B;  3TN2 A;  1F2L A;  3Q0A A;  1EU3 A;  3MC0 B;  2PPB C;  2EZV A;  3MHB A;  1UUP A;  5ELE A;  2EJG C;  1IHZ A;  2F0F A;  1I4G A;  3BDO A;  5HUR A;  3K5O A;  3M3Y B;  5E1F A;  1FGB D;  1QOH A;  4WRD A;  3OW7 A;  3S1R B;  1D5X C;  1ICW A;  1HRJ A;  5COR A;  1OO9 B;  1PTO D;  1SNO A;  3NWT A;  2PW7 A;  3MVV A;  3J80 L;  5ELF A;  2DY7 A;  3UI2 A;  1I3Q B;  2NTS A;  1CHQ D;  2Z1C A;  2F0E A;  2K33 A;  3FPU B;  4PMB A;  4XT3 B;  1EWC A;  1CK1 A;  3MA2 B;  1ZYR D;  1RDP D;  3Q22 A;  4QIW B;  4TSS A;  2EYF A;  1KDB A;  2BDO A;  3K5N A;  1V1O A;  2KOL A;  3HOY B;  4BBS B;  3HOZ B;  3SEB A;  3RMH A;  5NUC A;  3PUV A;  2RA4 A;  2XN9 C;  4ID6 A;  1WTW A;  2PZW A;  4OO1 I;  2SDF A;  4A3K B;  3QIA A;  5E3F A;  2AWO A;  3M4O B;  2VB2 X;  2NN6 H;  3C2P A;  3TZU A;  5I9O A;  4K2L A;  4B9X A;  1RD9 D;  1IW7 D;  1B2T A;  1SDF A;  2EY5 A;  4R8N A;  1RF2 D;  1I6H B;  4KKU A;  3J81 L;  1AEX A;  1GUG A;  3K59 A;  3K5L A;  2E2J B;  1ILQ A;  1F77 A;  1Z6H A;  3NQT A;  1I4R A;  1EY0 A;  3KF8 A;  3K0Y A;  3SK8 A;  2NVT B;  1SE4 A;  3H91 A;  3CKI B;  2WP8 J;  4HSV A;  4ZUJ A;  5C5L A;  3CU7 A;  3EVQ A;  1WD1 A;  5FO7 B;  5ELC A;  5F2D A;  2EYH A;  5K36 H;  2FIN B;  4IUV A;  1PFB A;  3D3R A;  2E75 C;  2JE6 I;  3GP7 A;  4HR7 B;  5EPJ A;  2YU9 B;  1F9P A;  2LY7 A;  2HCI A;  1EY4 A;  2F0S A;  1SMY D;  5CYU A;  2F0Q A;  1TU2 B;  2KVM A;  3PV0 A;  1VDZ A;  2Q8T A;  2KHS A;  1JWU D;  4WJW A;  5E4X A;  1TY0 A;  2E2I B;  1Y1V B;  1T5X D;  1D1K A;  3ND9 A;  3QB3 A;  1H9R A;  1CA6 A;  2JEA I;  3PIO 3;  5JEA H;  2X6G A;  2IW3 A;  4EQN A;  4G7H C;  1GHJ A;  4ZUI A;  1II3 A;  1HA6 A;  5LHY 1;  2KJX A;  3NE5 B;  1PRT C;  1PMR A;  5C0X H;  1SYD A;  1EY6 A;  2KED A;  1G8Z D;  1BCP F;  2O4X A;  1MI2 A;  2KUM A;  3NTK A;  2XIW A;  5I2X A;  3I4L A;  4A3B B;  2NBF A;  1JOK A;  4AYB B;  1GOZ A;  1S4Z A;  2NTT A;  1FNU A;  1OXT A;  2CW0 D;  3SVM A;  4K5V A;  1TT2 A;  4RGM A;  3NHH A;  1OXS C;  3WOF A;  5EKI A;  3HOV B;  4A3F B;  1B9N A;  5CV7 A;  1VF7 A;  2F0M A;  1DXM A;  2EYP A;  3C1F A;  1JWM D;  2PYK A;  5C4Z A;  3OWE B;  2AWN A;  4IUU A;  1F2Y A;  2D62 A;  3BG3 A;  4MN3 A;  2ENB A;  3M85 A;  1DOL A;  2IX0 A;  3TME A;  1BF4 A;  5CV5 A;  4FF3 A;  2F4I A;  3D31 A;  1FR3 A;  2A73 B;  1AP0 A;  4XTC S;  1DD2 A;  5M5Y B;  1A15 A;  1DOK A;  2BE5 C;  1G2S A;  2K6A A;  2H1E A;  1S5C D;  3R3O A;  2NN6 G;  1RJT A;  1DYQ A;  1STY A;  2B2U A;  1TWC B;  5KYL A;  1F9Q A;  3P20 A;  3GTO B;  1D5Z C;  3S1N B;  3I90 A;  1Y8O B;  2QF7 A;  4V19 0;  5FO9 B;  1IYU A;  1B4O A;  3PIP 3;  3P7J A;  3ZYY X;  4ZLT F;  3OSO A;  2XWJ B;  3PUW A;  3ONA B;  3IAY A;  1JCK B;  1H9S A;  2JP1 A;  3F2U A;  1CZW A;  1WTR A;  5C4X B;  3OPO A;  1J9O A;  4EQP A;  1SBB B;  5J22 A;  1O80 A;  1SE3 A;  3I72 A;  4H7B A;  3MAQ A;  2VUM B;  5IIF A;  3SK4 A;  3H94 A;  4CKB A;  2JA7 B;  1CTM A;  1MSG A;  3I70 A;  3FRP B;  3EFX D;  4FXD A;  4KKT A;  1LTG D;  3J80 E;  4C3I G;  3VR2 A;  5DM7 3;  1OXV A;  1LO5 D;  1KLU D;  1WTQ A;  2JEB I;  4DFA A;  4LAA A;  2DNE A;  3MEH A;  3S17 B;  1EU4 A;  3IFT A;  1NUC A;  3OHX C;  1CHP D;  4NW2 A;  4M8A A;  1TII D;  4PNY A;  2MPM A;  1KDA A;  3X3M A;  5KNB A;  3HOX B;  4IFD I;  1PTO F;  2EYL A;  2OXP A;  1ZKO A;  1K8O A;  1RTO A;  4X3S A;  4QUC A;  5CV6 A;  2B2W C;  3GTJ B;  1HTL D;  1RHP A;  4YIJ A;  4RHR A;  3GD7 A;  4H13 C;  1O78 A;  1E2Z A;  4XQQ A;  4TQU S;  5EGT A;  5EPL A;  3D6W A;  1PZK D;  3GTQ B;  4L63 B;  2NVY B;  3C3L A;  2VXW A;  4ZAI A;  2IL8 A;  5IGG A;  3C46 A;  2K05 A;  1CQV A;  2PQE A;  5C4H A;  3J81 E;  4Q0F A;  5TSS A;  2B8G A;  4BY7 B;  1LAC A;  1BOS A;  5LL6 S;  3VR4 A;  1S5F D;  5KYI A;  4XXE A;  5HGT A;  1QCB D;  1KNE A;  4HMJ A;  1R4P B;  1EYD A;  1HUM A;  4L6T B;  2O5J C;  4QMG A;  1STE A;  4FF1 A;  1Q1E A;  4KK7 A;  3OMG A;  4C56 C;  2F0P A;  2C5C A;  3VA7 A;  1VF5 C;  2PW5 A;  3G6J B;  4Q5V A;  1ENA A;  1BCP B;  3LWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...