1ZEQX

1.5 a structure of apo-cusf residues 6-88 from escherichia coli
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
METMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusF
publication title A Novel Copper-Binding Fold for the Periplasmic Copper Resistance Protein CusF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zeqX01
2VB3X 2L55A 1ZEQX 2QCPX 2VB2X 3E6ZX 3TDQA
chains in the Genus database with same CATH superfamily
1E1TA 3E9HA 2WB1G 3OMGA 1Y1WG 3K57A 3EVQA 2IWHA 3NTIA 1MD2D 3L0OA 4JI7Q 2E76C 3HG9A 5C4XB 4QL5A 1LTID 3MA2B 1EEFD 1AZPA 4K5VA 2RHQB 1ZYRC 2B2UC 2E2IH 1UEAB 3KOJA 2WAQB 2UXCL 3KYHC 1Q8KA 1LABA 4P74A 1NTGA 1QCBD 5BR8Q 1NY4A 3Q6SA 1OXXK 1X56A 3K7AB 4PZ8A 2KHSA 3OIPA 4OWTB 1TS2A 3BVGA 1SYDA 4FNFA 2RDFA 1CQVA 4LF7L 1ENFA 1IBLQ 4GZYC 1IW7D 4OIJA 2IW3A 3S1NB 1YBYA 3MFGA 3H3VC 3STBC 1DOKA 1HQRD 3CMAA 1VQ4A 3KF6B 4G7OC 2WIIB 1LACA 5AJ3Q 4LF5L 4BBSG 4DV3Q 3T1HL 2KECA 1N34L 4C3HG 2JA5G 4K2KA 3RZDB 3SEBA 2K50A 5G3LF 1KIXA 1S5FD 1BF4A 4A3FB 1DXMA 4DKAC 1A6XA 3OPOA 3BZDB 2EYHA 2OQ0A 3T53B 4YY3L 3HOUG 4IFDJ 4LF8L 4QQBX 3KLRA 5LMNL 4QCLA 2N78A 3H0GH 1S40A 1ZKOA 5D3IB 1XTDA 2JA8B 5J22A 5CGKA 5ELNA 5BN3A 5KIXA 1TWAB 1JCKB 4FF2A 2ICIA 1EY4A 2ZTEA 1V1PB 4FYDA 3JC66 4JI6L 4IZ8A 3PO2G 2YV5A 5IGDA 2D0PA 2MP1A 1YNJD 1IBMQ 3NHHA 1JWUD 5EAYA 5K36H 1D2BA 4KHPL 1T5EA 4JBJA 1IKMA 3CCSA 2EY2A 4LW1A 1F2MA 3TQYA 4AYBB 1L1OB 2O4XA 1O7YA 2CCZA 3U4ZA 5JJKA 1B9MA 1D5ZC 4JOIC 3EJIA 4A3JH 2JA7H 2DY7A 4KMUC 3GTQH 4QIWB 1ZEQX 3BYYB 1LM0A 4OELB 1CA5A 1E2ZA 1S4ZA 3A0JA 2D2CC 2KBNA 2EIFA 1Y1WH 5ELFA 5M9OA 1S5CD 3DWQA 4K0KL 4B08A 1CFMA 2F0UA 2N8NA 4JI1Q 3AB9A 3HOZB 5IYBG 4F8MA 1BCPB 3FPPA 4KJOA 2Z1CA 2A74C 3A7AB 1F9PA 4CDEC 1I4PA 2ZM6Q 2ZXPA 4ABNA 3GTJH 4ULLA 3CCVA 3KLSA 1HTLD 2HDMA 4TVAB 2VXWA 1QB5D 4C3HB 4IJHA 2R7DA 4G7ZC 1ASYA 5FJ8G 2BDOA 3KF8A 5DM63 4YCUA 3G6EA 1GUGA 3CAMA 1KAWA 1TVXA 1C9OA 1F9SA 2X6LA 4MNOA 3EN2A 4WJ3M 3GTOH 4C2MB 1STAA 5CR3A 2CQAA 4BBSH 5IIFA 2CWPA 4C3HH 1C7YA 2JA5H 3S14H 2HQEA 1KDAA 3J7ZC 1VDZA 4IURA 5HGQA 1GHKA 1SE3A 2VL6A 2Q8TA 1TWCH 1PH7A 4LNQA 1C4QA 3VR2A 1LTRD 1JQYD 3HOUH 3PF4A 2F0FA 3A74A 1ET9A 1SMXA 1WYDA 4WJWA 4DV7L 3HOYB 2Z6KA 1HCZA 3F2BA 1BVSA 1XNRL 1NUCA 3L2PA 5IGCA 3BG3A 3DEPA 3PO2H 2D62A 3N52A 1Q7YC 2L12A 1PMRA 1XMOQ 2IHEA 1UAPA 3CCJA 4PQXA 3RR5A 4DNTB 4H44C 1Y8NB 3MHBA 4YHHQ 1K83B 1HA6A 2QEJC 3WOEA 3GTGB 3S1QB 1XTCD 3A5ZB 1WVLA 1P8LA 1U9RA 4DK1A 1QVGA 4JBWA 4FXDA 4HIDA 2HCCA 2B2TA 1SNQA 2CWAA 2EPBA 3MXNA 1KL9A 1PVOA 1AE3A 4P2CB 4H0LC 1PYBA 4HJ9A 4B3SQ 1JJCB 2BDNA 2KEDA 4QMGA 4CDDC 2O5JC 1NNXA 2R93B 2R7FA 1YHQA 1A3UA 1VQ9A 3I90A 2AWOA 4G7HC 1L0YB 5IYBH 3I55A 1A15A 1F2LA 1KQSA 2DNEA 3ICEA 2VQEL 2WKCA 3HGBA 1VF5C 1QWYA 2KOLA 3GTMH 2K04A 2UXCQ 1K73C 1BCPD 1EOTA 1ESRA 1YNJC 2B2YA 2EY1A 2K1BA 4K2LA 2RDGA 4IUTA 5J1ZA 4ID6A 3AFPA 2SNMA 1RIPA 4IUPA 4A3MG 3C46A 1W6JA 4IPGA 1SAPA 2Q2TA 4LF7Q 1QVCA 1D1KA 2LFNA 1NR4A 1DM0B 5FJ8H 4DR2L 4C3IB 1VQEA 1G6PA 1CI3M 1PH2A 1VQLA 3K80C 4HMJA 3S2HB 2JE6I 4QUCA 1RKNA 3T51B 4LF5Q 2VW9A 1SEBD 3R2IA 2HD3A 3T1HQ 5M5YB 3IFDA 3T1YL 1N34Q 1HNXL 2WAQE 2FJ2A 4A3KB 1EUJA 4BY1G 1IHZA 1VQ5A 1XNQL 4IUUA 1BBUA 2RHSB 4ZUIA 3MXPA 2LXKA 3TREA 4HMIA 4YY3Q 5IT9E 4Y7NB 4LF8Q 1VQGA 5LMNQ 1BUVT 2PQAB 2CKZB 5I9PA 3NK9A 3RMHA 5IT9L 2K32A 1H9JA 1EEID 1MSHA 5JPMC 4ME5A 5M5YH 2VB3X 1G2SA 2Q8RE 4JI6Q 2E75C 2EYJA 4B3TL 3RN2A 2UXDL 3M3YH 4HSPA 1IYVA 1F9RA 4A3DG 1OXUA 3T16A 1PV4A 1J9OA 3VR4A 4Y7NH 4I65A 4KHPQ 3NE5B 4PG3A 2K75A 2PW5A 1AP0A 3VR5A 4GKJL 5HY6A 2RSOA 1TWGB 1HPCA 4JI5L 1QUQA 3J81E 1EYGA 1GOZA 3FHWA 3KUPA 3L7ZC 2DUDA 1WTQA 1JOKA 1TS3A 2EXDA 3G7LA 2B2VA 3OW7A 1EIGA 2VNUD 1EZ8A 3J81L 2WP8J 2C5CA 1GM5A 1T5XD 3AU7A 4JYAL 3ND8A 1Z47A 1Q3LA 3CC2A 2XRSD 3UE0A 1X32A 2AHOB 1QJOA 1PH6A 3D4WA 1WFQA 4K0KQ 4N8FA 3I4NG 4PNYA 3BYTB 3CKIB 4O0AA 3HOVG 3K0YA 5C4ZA 3S16B 2SOBA 4KI0A 4R4CA 4AYBE 1VQFA 5DM73 5KGUA 1JMCA 2HHHL 4XYQA 3PCOB 3NWTA 1HFGA 4EQOA 5M5WB 1LT4D 4CJ1B 4R9WA 1B3QA 3R93A 4A3MH 3TP5A 1FD7D 1IL8A 2CH4A 4X3SA 5G3LD 3OTOL 1I4XA 3CHBD 2PZTA 4LMQD 1I3QH 3VDYA 1I4QA 1R4QB 2B2WC 4NB3A 2NTSA 3PIP3 2K03A 2KCMA 5H1SE 4IUNA 5I9OA 4RCOA 4Z9CB 1EYAA 3KDFA 4C3JB 2BCOA 1MGSA 4X64L 2K5WA 1L1OC 1B9NA 2PMZE 1JC7A 3I7FA 3GTPB 2A5HA 1UEBA 5M5XH 4HR7B 2QA4A 1LT3D 4BY1H 2B2WA 1N8RC 5IGFA 1X55A 4JCVE 5IYCG 2EYPA 4ZAIA 3D6WA 1GJXA 1RODA 1WCMG 3F2UA 1EY9A 4YCVA 1MKHA 2AQ2B 4KY5A 3EFXD 1M90C 4IPDA 1D1IA 4KKUA 2F0TA 5JEAJ 3NSWA 1SYCA 1PFSA 2E2DC 2VZAA 3U50C 4HAEA 3J7A5 3MXUA 1MI2A 4LJZC 4F88A 2NVQB 1PYWD 1XNRQ 2B29A 2VS1A 3H15A 1X3GA 5C44B 4GN3B 3IFTA 1G8ZD 4C56C 4DV2L 4XDXA 3NQTA 3AEVA 3RZOB 2K5VA 2JYOA 2NVYH 4A3DH 4IPCA 2RF4A 1E24A 5I4DA 4XTCS 4DAYA 4E6IA 1QOHA 2NYZD 1D5MC 4K6DA 1UWVA 1YNND 2R92B 3G6JB 2R7ZG 3GP7A 2R61A 1EOVA 4TKOB 4HIMA 1KHIA 1HR0W 4Q0FA 5FO9B 2HCIA 1BR9A 2N3SA 4TSSA 5DNFA 4XXEA 2IY5B 1WD1A 4BA2I 3QB3A 4HIKA 1SBBB 3HOWG 5CV7A 3DHQA 1HRJA 1H9SA 3RLNA 3S17B 3EROA 4BY7B 2R6GA 5JVG3 3SK5A 2Q8IB 1Y14B 1I6HB 2B63B 5TSSA 1RD9D 4MIUA 5ELCA 5C5MA 5JJIA 5IYDG 4C1NI 1PTOF 1Y1VB 5GQOA 3I4MB 3TP8A 1CHQD 1DYQA 5IGGA 3I4NH 4OXPA 3PMFA 1SRUA 3ULLA 2VQEQ 2ENBA 3S15B 1KXLA 2AWNA 2E74C 1HHVA 3E9IA 4UHVA 2YTVA 5C3XA 3HKZB 1VQPA 4X3KA 1EIHA 5CMDA 2M2LA 4X66L 1WTWA 3Q22A 5I6WA 4DK3C 4H7BA 3KJPA 1U4MA 2PYKA 3I70A 3MWYW 1M4VA 2JQOA 4KD3A 1EFID 4DR2Q 3KK7A 1X65A 3OWEB 4KKSA 3BVZA 2E2IB 1JWSD 4GKKL 5E1FA 4FF3A 5CV8A 5D14A 2K6AA 5JAVA 4YIJA 2UUAL 5LHY1 3T1YQ 1HNXQ 1K8OA 2XSCA 1W3SA 2K7VA 1RHPA 1WTVA 2ATWA 1XNQQ 3D4DA 3A56A 4HJAA 1Z7TA 1VQ8A 4K8JA 1E2VA 3FDTA 3J81j 1AN8A 3K7UC 1L2FA 5IYCH 4R4OA 4BXXG 2L55A 1BO0A 1WCMH 2DY8A 4XT1B 5FOBB 3BVMA 4CKBA 2N49A 1FL0A 4EQ5A 5M3MG 2OT2A 2K5QA 4DR3L 3M7NA 4DAMA 4FXKC 1D8LA 3W5OA 1MSGA 4HSVA 4LK1C 5E4WC 1G6ZA 2Z4HA 4XIGS 2Z0SA 4KHZA 4B3TQ 3E5SA 5GAGC 2UXDQ 4BBRG 2E5LL 2B2UA 3SXHA 4RGOS 4IUQA 3K5MA 1TS5A 2Z8LA 3PUZA 1TXYA 2Z6BA 4GKJQ 4A93G 3H0GB 3TS0A 2R7ZH 4JI5Q 4AIMA 1V1QA 1V8QA 1F77A 2WV6D 2Y0SE 2RCFA 4DV6L 2KA7A 3I91A 5FLMG 4B9XA 3RUZA 2A69D 1O80A 5IP9G 2NUCA 1PHJA 5NUCA 1SNCA 1QNUA 4JG2A 1RL2A 2RDHA 2XN9C 4JYAQ 2I5LX 3HOWH 3P75A 3JAMc 1ILPA 4P75A 4A4IA 1II3A 3B6YA 1B8AA 1EYCA 1LTGD 1PRTB 4DF7A 1HA5A 3K81C 1IL2A 1JORA 5IYDH 1K8MA 1YITA 2KCNA 3NBHA 1NBWA 2NWGA 2PPBC 4RWSC 1X3EA 1RF2D 3G4SA 4A3JB 1TR5A 2JA7B 2K5NA 3GTQB 2HHHQ 3P1HA 4GLXA 5FLXc 1PZJD 3VR6A 3HZXA 1B1ZA 1B70B 2NN6I 4KN4C 2WB1B 1KRTA 1Y1WB 4R8IA 3AQQA 1XPRA 1YNNC 2PQAA 3OTOQ 3D31A 2IT1A 5C6AA 5C4HA 1VQNA 3SHLA 4X62L 5CV9A 3D3RA 4P73A 4P72A 4XYOA 4DR5L 5I2YA 3BZKA 1SSOA 1AH9A 4Y52H 3WWVA 1MJEA 3KJOA 1JOQA 4FO2A 2JEAI 3K5LA 4RKBA 4RA8A 1DCZA 2EYMA 2SNSA 4X64Q 3TS2A 2NN6G 1GO3E 1SLJA 4EQPA 4DR1L 4CJ2C 4MTNA 1NMFA 3OIQA 3ONAB 3GTJB 3CCUA 2EVBA 3VYTA 1STEA 3J81i 4IUVA 3I4OA 3P7JA 1U0LA 4BBRB 1GUNA 2QGQA 5KEEA 5KNCA 2VUMG 2A68C 1HXYD 4JOIA 1B4OA 1EY7A 4BXXH 3H6MA 2MPMA 3GTOB 4DV0L 3GTLH 1SE2A 4WORA 5M3MH 3CPFA 2MUYA 3K58A 3H91A 2J0TD 4BBSB 1CKNB 3TZUA 4N9PA 3RLOA 1SYFA 4UY8C 4ME3A 2XWBB 1D5XC 2I0QA 2F4VL 3S14B 1GD7A 2JA5B 4MZ9A 3CPWA 4DV2Q 4ZRZA 1FGBD 4NXML 3HP3A 1R4PB 1FVIA 2JN4A 4BBRH 3VYUA 2D5DA 1BXTA 3IKJA 1TWCB 1Y69U 4NXNL 1KLGD 3PV0A 4DR6L 2EJGC 4R1JA 3S1MH 3HOUB 1W6KA 3FMCA 1JB3A 1EQVA 4A3CG 1EWHA 4A93H 5ELOA 2JSOA 2OEOA 1VQKA 1A63A 1V1OA 3PSIA 5KYLA 3S9WA 2O2LD 5JOBA 5FLMH 2J4XA 5IP9H 2KHJA 4ZUJA 2AUJD 3PO2B 3AYHB 3MAQA 1QG7A 2EY5A 2RBMA 2F0PA 1H9RA 1Q86C 2F03A 4K14A 1AZQA 1NMGA 2EJFC 3H3VI 1SFOH 1PTOH 4CHTB 2KHIA 2GVBA 1B53A 5FKAC 4ZYSA 1S72A 1HZAA 3M9BA 4AQYQ 1Q81C 4HJ8A 1PRTD 4IN3A 3MVVA 3CU7A 4DN4M 3MFYA 4GNXB 2VY3A 1OXVA 4OO1I 3SE0A 1G2TA 4DUYL 1L0WA 5CV6A 1IW7C 1JOOA 1OXTA 1WJJA 4L5TA 3MTSA 3Q0AA 4DR4L 3MEFA 4B9WA 3CXCA 4GOPB 4O42A 1DONA 1V43A 3CQZH 3W3AA 2AKWB 2EYOA 2F0IA 4OO1G 1KC8C 2DNCA 4GKKQ 4BA1I 3PO3G 3DUZA 1B2TA 2NN6H 3GTMB 1I4HA 3FKIG 2UUAQ 1RDPD 3FRPB 4CGYB 2ZJPA 2F0DA 2WINB 4P71A 1X9NA 2O5IC 1I4GA 4MHEA 2Y0SG 3TEHB 5FO7B 3Q8DA 3MZ5A 5FO8B 2LMCB 1ML0D 3U9SA 1PXUA 4DAVA 4U673 3HKSA 4KHVA 2VUMH 5BN5A 3KLWA 2PQEA 2Z9HA 4A3EG 1K8AC 2E2HH 2Q2IA 4DR3Q 2HT1A 1UNSA 1A0IA 2H4OA 5DLQE 1JJGA 5HURA 4RH6A 2DJFC 3U9OA 4OEMB 1IYUA 1ESFA 2E5LQ 4PMWA 1O78A 2H5XA 1BNZA 1JWMD 4A3CH 3M4QA 2K01A 4L5RC 1U4LA 3S1RH 4JI0L 3OW2A 2A6ED 1KTKA 3Q24A 3J7YW 4DV6Q 3NXWA 3LGJA 2N88A 3GO5A 1VQBA 1F2YA 1VQDA 2RSNA 2EY6A 4LFAL 3T4AC 4I7AA 1L0XB 3K5NA 1HJPA 2F0EA 3M3YB 4LUZA 2NVTH 2N55A 2Q2HA 1R9TH 2UUCL 5LL6S 1XXGA 4AH6A 4CJ0B 1SE4A 2IJ0A 4V0BA 4RGNA 1TWHH 5LMUL 2HDLA 1UE7A 5ELEA 1W2BA 3D0FA 1VQJA 1WTHA 4I7ZC 5C4JH 1SNMA 4DR7L 4RKLA 4RHRA 1CQFA 1VQAA 1PYSB 1YZ6A 1VMCA 2JA6G 1PA6A 4ZK9B 1CT1D 2ZXOA 1EWCA 3H3VH 1CSQA 1H9MA 4DV4L 4OIKA 5J39A 4B3ML 1HTPA 2C9OA 4KKTA 4K6LA 1SYEA 3OOCA 4UP7A 1A8VA 3QIAA 1HZCA 4X62Q 2F0QA 2E2JH 1IKLA 3NPPA 2HUGA 2JK8A 1EU3A 3D6CA 4DR5Q 1VQ6A 2LS01 4GS3A 2F0VA 1TY0A 4OO1H 1UE6A 4IOAA 1H9KA 3QOLA 1PFBA 1STYA 2F0WA 1SYGA 4TRDA 3TZDA 2OWOA 4JK1C 3UI2A 4DR1Q 3PO3H 2UU9L 3CC4A 4XQQA 2X6GA 1Y8OB 2JEBI 3FKIH 4UAIA 3A8JE 2DJGC 4OWXB 1PFNA 3UDGA 3ERQA 4POFA 3HOXG 4DXGA 1WI5A 4A75A 4A3MB 2F0MA 3C1EA 2WB1E 4S3SA 4A3GG 1J8IA 1I3QB 2L5TA 3KF6A 1K8GA 3HRZC 1T9HA 2FXQA 3I3CA 3E0JA 1PRTC 4DV0Q 2KJXA 1JB7A 5IP7G 2OCEA 4A3EH 1FR3A 3WOFA 5C3EG 1CUKA 3F2CA 1SNOA 5JJLA 2IHFA 5M5XB 2F4VQ 4QIWE 1A3VA 4BY1B 3IAYA 3C1FA 2G5DA 4NXMQ 2KCTA 1O7LA 1XWEA 4ZKCB 1HFNA 3M4OH 2RQXA 1G291 3RD4A 4Q5VA 4A3BG 4O1NA 4DR6Q 3TSSA 4GLVB 1ZYRD 1RCVD 4PMBA 1V1PA 4ALPA 4M8AA 3M85A 3V96A 2BA0A 3PIO3 4A3IG 4FDBA 3EQLC 1DOLA 3QOJA 1YJWA 3K0XA 1K0RA 2PZUA 4QY7A 2EYFA 2G9HD 1QNKA 5LL6X 3SVMA 1B50A 2NVYB 4A3DB 5M3FG 3I2ZA 5IGEA 1NR2A 1L1OA 5LMNW 1E22A 1GUOA 1ASZA 3G71A 3FP9A 2YU9H 4DV7Q 5E4XA 1BCPC 2ASBA 4RMFA 1O7ZA 4N8X1 3J80L 4M1UB 1K3BC 3I73A 1VF7A 2JA6H 2K14A 3DM3A 4GN5A 1E0BA 1SMYD 4L6TB 3QWNA 1EIYB 1J5EL 3UDXA 5EBDA 4DUYQ 2ES2A 1EWIA 3UDFA 4B3RL 3SGIA 3NUCA 2FMCA 3OSOA 2K4KA 2NZHA 2OTLA 3X3NA 3CC7A 1SJED 4DR4Q 2L4NA 4K5XA 2AUKA 3DM1A 2KVMA 3C3LA 1N33L 1SR3A 3UE1A 4HCSA 4ZKBB 2I07B 4DV5L 1MBYA 3I4NB 3CW2C 2EYLA 1OO9B 3S24A 1ENCA 3NTKA 3HOVB 1D7QA 1E2WA 3MXNB 5HGTA 3QO2A 3NP8A 1IZ6A 1TIID 3G48A 4G57A 2V1CC 5C4XG 2FMMA 2I5HA 4RG1A 1N9WA 3PUXA 4ZQ3A 2BE5D 3HOXH 1HNWL 1BCPF 1G51A 3KFUA 3DWAA 4IO9A 3BJUA 3FPUB 4PMCA 4A3GH 2WAQG 2MHVA 2B3GA 4N9TA 1E7ZA 1STNA 2EXZA 3QJYA 5I2XA 2ZJQA 2Q2UA 3P20A 4J1MA 5IP7H 1WD0A 3NENA 1EFWA 2VQFL 3HOVH 4IFDI 1PZID 2F3WA 4O2DA 2PI2E 3W1BA 3K6OA 5C3EH 3OWFA 1SNPA 4DUZL 4GNXC 3JAME 4QGUA 1LTBD 2F0OA 5BN4A 1XPUA 1QZHA 1PH5A 3JAML 2K5DA 1PZKD 4FP5D 3A55A 1IBKL 4UP8A 3L3OC 2HQLA 4A3BH 2CQOA 2GA4B 4IFDG 2JP1A 1CZGA 3GDEA 1WCMB 1QILA 1X3FA 4GOPC 3SK6A 3S2DH 3URYA 4JI0Q 1YHAA 4A3FG 1TWFH 2JXMB 3J80c 3KBXA 2F3IA 4A3IH 3D8GA 2D9UA 2YTXA 5FLXL 4LFAQ 5I6YA 3CMEA 2OXPA 5E7NA 1ET6A 2FINB 3O13A 1EIFA 2F0HA 2UUCQ 2UUBL 5EBCA 1Q12A 4GOPA 1XYIA 3MEHA 2JA8G 1HUMA 4DU9A 1QZGA 1LUZA 2L0CA 1D6EC 4JBKA 4JI3L 5M3FH 3AMUA 3PIPA 5LMUQ 4LF6L 4V190 4R4QA 2QDLA 4DXFA 4DR7Q 4NMZA 2R7ZB 3RLFA 3SK8A 1EL0A 1DZ1A 3BDCA 2BH2A 4B3SL 1AE2A 1I5FA 3LX0A 4F7XA 1EY8A 2EE1A 2F0SA 1RTNA 5CV4A 4OX9L 4A3LG 1LT5D 2LXJA 1H95A 2F0NA 2PNRC 4DV4Q 2XRQD 5JVH3 3HOWB 4AYBG 1KDBA 4B3MQ 1PH4A 3GTKH 2GVAA 3EA6A 4CKEA 1Q8IA 2JJQA 4RGTA 5A35A 1BBXC 2F52A 4KY7A 4QB4A 1QUQB 3RN5A 2F0KA 1PH1A 1OTCA 2SDFA 2RA4A 4KTAA 4YCWA 2UU9Q 2HIXA 1DJRD 1NCVA 5EPKA 5C4XH 3HOZG 2NBFA 3PF5A 3ZJYC 1BQQT 3LWEA 2L1BA 1DD2A 2DGYA 3ER0A 4LF9L 1STHA 5L37A 3U4VA 5IWAL 2PNHA 4G4KA 1GUWA 4RAUC 4ZLTF 1FNWA 2IX3A 1IYJB 5EPJA 1SNDA 2QW7A 4JV5L 1CKMA 3K7AH 2A73B 1SMYC 3GV3A 2IX1A 2QDBA 4JI4L 1I4RA 1TKWB 1UUPA 1LLRD 1XMQL 1PH8A 3CP0A 4J15A 4JI8L 1EU4A 2F0GA 4QJFA 3OMCA 1PDQA 4DGZA 4DV1L 3S1NH 4IPHA 2J7ZA 5D3DA 5F2DA 3J7AV 3NBIA 1CKOA 3FEWX 4IFDH 1DGSA 3RZDH 3KDFB 3GTLB 4C1NK 5M3MB 1KDCA 4A3FH 1SROA 2UXBL 1SN8A 3EBEA 2BE5C 2B8GA 3VYSA 1Z9FA 2BA1A 4KV6A 1M8AA 5CORA 1OXSC 3U58A 1SE8A 4FF1A 3A5UA 2K52A 4L8JA 1A2TA 3HOYG 2JA8H 1KNEA 2EZVA 4H13C 1JJ2A 1TWAH 3S1MB 3E6ZX 1HR0L 4YWLA 3NELA 3C2PA 4A93B 1ICFB 4NPSA 3CCQA 4JI2L 1GXDC 2K05A 3I56A 1GHJA 4KN7C 1S5ED 3K5OA 2F4IA 4KK7A 2F3VA 1PLFA 2WKDA 1BDOA 1NJIC 2XIWA 1J5EQ 2EQSA 3IL8A 4A3LH 1YEZA 4B3RQ 2PCFB 2PZWA 5EKKA 4DAYB 4JBMA 2E8GA 2PMZB 5C5LA 4DNRB 1WTXA 4DNIA 1PTOB 1SFOB 5EKLA 1N33Q 1I94L 1JICA 4POGA 3CCMA 1RJTA 4DV5Q 2AQ1B 1VQMA 3X3MA 1CHPD 4LUOA 3QG1A 2R93G 1S5DD 1XX8A 1HUNA 2CH4W 2OF1A 2PW7A 1STGA 2G9DA 2CW0D 1JE4A 5T1GA 1IXRA 2FFKB 3HOZH 1H9SB 3TP6A 2L9HA 4KY6A 3SDZA 1HNWQ 2I46A 2L15A 1EYDA 2AQ3B 3E3XA 1E1OA 2XNAC 5COYA 1WOCA 2RVLA 1LV9A 1VQIA 1X54A 1I50B 3CQZB 3WDNA 1QVFA 2EJMA 3K59A 2JA9A 3NEMA 4L63B 1ZXTA 4ILWA 1VS0A 1VCIA 4NKLA 4YWMA 2VQFQ 4EX5A 5JPNC 3A54A 2Z6KC 1N36L 5IOCA 1S5BD 3BU2A 4QUFA 3J80i 4UP9A 3UDIA 2QEXA 4DUZQ 1Q1EA 1YIJA 4C3IG 4X66Q 4HIOA 2RKSA 4C2MH 2F0JA 4OGQC 4EVOA 1QE6A 3MXGA 2TMPA 4CDCC 1IBKQ 2VUMB 4H02A 1FYCA 2A6HD 3TN2A 3V05A 2HIVA 2YYZA 1I50H 5JJZA 4K5WA 4A3KG 1SJHD 2E2HB 1YVCA 2A69C 4LAAA 3TDQA 1N32L 1Z6HA 2QCPX 1FJGL 2B2TC 1BBWA 1EY0A 1GVPA 3LNNA 4RGMA 2V4DA 2H1EA 1ONLA 4WFN3 3HKZE 2UUBQ 3F2DA 1FGUA 5EKIA 1EY5A 4LF4L 3HOYH 4JI3Q 4LFCL 4IJLA 4X3TA 1CZWA 3R8BA 5K5PA 1LTSD 2MO1A 2ZTDA 3I72A 1BOSA 3M4YA 3PUVA 3ERSX 4X65L 4HJ5A 3TRZA 4LF6Q 2XGTA 3DEOA 1GUTA 4TQUS 3S1RB 1BKBA 1MJCA 2K33A 2M9VA 2OQKA 5C0XI 1LTAD 5DEHA 2SEBD 3PUWA 2B2YC 5E3FA 1VQOA 1DOMA 4OX9Q 4A76A 4PZ7A 1K83H 4DPGA 2NVTB 1JR0D 1R9TB 3GTGH 3S1QH 2EDGA 2XTIA 3QR8A 4LWCA 4MN3A 1AFPA 1CM9A 2ZTCA 2NVXB 3JAMi 4MTKA 5EPLA 1TWHB 4FVMA 2KEEA 5C0XG 5C4JB 2IL8A 2Z4IA 3F1ZA 4R4TA 1FNUA 1PTOD 1YHBA 4KD4A 4DK6C 1PH3A 2R93H 2C35B 2MGSA 1VQ7A 2I5MX 1B3AA 3I4LA 5D65A 4DA2A 2IPKD 3N6RA 1WTRA 4QF4A 4NW2A 1TU2B 4BWGB 2VB2X 1C8CA 4EQNA 3MC0B 4LF9Q 2EOTA 1HNZL 3OHXC 2OTJA 3BDOA 5IWAQ 1C0AA 4LFBL 2NVXH 2MQHA 1NSNS 1UE1A 1ILQA 4UPAA 2E2JB 1JT8A 4L5QA 4HTHA 5FK9C 4J8QA 1TT2A 3TMEA 3NBHB 4JV5Q 2QF7A 3I8ZA 5A2QE 1B7YB 2RCNA 2X69A 3ZYYX 1HZ9A 4OONA 3R2TA 4JI4Q 3PO3B 4JI7L 3FKIB 5A2QL 4JPBW 3ITPA 1XMQQ 2KUMA 4APVA 4JI8Q 2LKVA 5KRUA 3Q23A 4C3IH 2ZXRA 1A62A 2AMCB 4DV1Q 2Y0SB 4JW0A 3S2HH 1FNVA 4RCNA 1NE3A 4DK0A 4C3JG 1YNXA 4CDFC 4JVZA 4RFBA 1ICWA 3HS0C 4WRDA 3VR3A 4X3UA 3AFQA 4A3KH 4A3EB 5BR8L 4KLKA 5JEAG 1HH2P 1I6VC 2CW0C 4J6HA 2UXBQ 1K3RA 3CRLC 1AW7A 2B2VC 3VA7A 4IALA 1YJ9A 1IBLL 3KBGA 1EY6A 1GUSA 1X6OA 2ZT9C 3A7LA 2ICEC 3KLSX 3M4OB 2XWJB 5KNBA 5AJ3L 3VA5A 1EZ6A 1GKHA 1HR0Q 4DV3L 2NTTA 2BOSA 5C44G 5GADC 1C48A 1CSPA 4JI2Q 2NB0A 1A3TA 4K8IA 2PO4A 3EIVA 1LTTD 5EQ0A 3W2DA 3HEJA 3T56B 2D0OA 1KABA 3CRKC 1KNAA 3BDLA 3NTHA 1V9PA 5C0XJ 2R92G 3LWUA 1CA6A 1Q1BA 3A8KE 2A6HC 3V2TA 5DAUA 1PH9A 1TWGH 3KF8B 1E3PA 4L5SA 4NXNQ 1F2ZA 3CCRA 3IRBA 3PQIA 4XQJA 5GROA 1ENAA 3FVQA 4HCEA 5C0XH 1I94Q 2YU9B 2WACA 1VQHA 1S3OA 5CYUA 1B44D 1IBML 2B39A 2JA6B 2R3ZA 1Q90A 2A19A 4BY7G 3H09A 1KD1C 2B63G 1LT6D 1KRSA 4IOCA 1P16A 3A8IE 1Y1VG 5EJWA 1PRTF 4WJ4A 3I4MG 2K28A 1G91A 3ULPA 2BH8A 5IT9c 4OHJA 4EGVA 3S16H 1J6QA 3J80E 3ND9A 3STBD 5J3BA 3HKZG 5M5WH 2B8FA 4OWWB 2KENA 4CBVA 1WTOA 1EQQA 5IODA 4X6AH 3ULJA 3CCLA 2DN8A 1HQMC 3CD6A 5KYIA 1N36Q 3PUYA 4ODGA 5GAHC 3W1GA 2TSSA 4HJ7A 4JI1L 1M1KC 5KNDA 3F8TA 3HOXB 2MJ8A 4R4IA 1KAAA 1AEXA 4UDUC 2P5ZX 4JC0A 4C3JH 1XPOA 3L9AX 4A3GB 2ZM6L 2A6EC 4U68A 1TS4A 1XJVA 3GTPH 1CKNA 4GN4B 5CV5A 1PTOC 3NQIA 1SYBA 3J81c 4HN7A 2CVRA 4YWKA 3T13A 1N32Q 5ELBA 1HZBA 3R3OA 3GQBA 5JEAH 2NZOA 2L11A 3DWPA 2FHTA 4NDXA 3K8AA 1A2UA 1STBA 1FJGQ 4GLAC 5C3EB 5CBAE 5CBEE 1O7IA 3VYRA 1MIUA 2A1AA 3BZCA 5CC4A 2LY7A 3GD7A 2LSSA 3HFZB 3TP7A 2ID0A 4LF4Q 4LFCQ 1Q46A 1CTMA 4XQNA 2QKIC 1VMPA 2F0LA 4A3BB 4X65Q 2NVQH 1U5KA 3E0EA 1YJNA 3CF5A 1Y8PB 5C44H 2XVSA 3DLLA 2CHBD 2NZ1D 3S2DB 1SDFA 3SR1A 5C3WA 4OL7A 1PFMA 2KCCA 2A8VA 2MNAA 1TWFB 3RNUA 1YI2A 3DXJC 3PGZA 3GV6A 3RZOH 4A3IB 3TBIB 5T1IA 2M00A 4NP5A 1CK1A 1UE5A 3NWSA 4FXGC 3SK4A 1JE5A 3BS1A 4FF4A 1WTPA 4ZCKA 4XT3B 2CFMA 1K28A 3H0GG 4IQZA 2R92H 1LYLA 2WFWA 2A68D 2MO0A 5ELDA 1KLUD 5ISRA 3CCEA 5M3FB 4AQYL 1MHWC 1X3QA 1F9QA 4LUVA 2YTYA 1EQRA 4GNXA 1VQCA 1X3PA 5FLXE 1K0SA 4PZ6A 5AFWA 1LO5D 5GAEC 1NAPA 2ALYB 4PV1C 3M7GA 1Q82C 4CKCA 1U4RA 1TY2A 1XMOL 4RHSA 1EQTA 2MFIA 3S17H 5K36G 3J7AF 4BY7H 4R8NA 2ZJRA 1TQOA 2QILA 4F87A 3OYYA 5EGTA 1I6HH 2B63H 1SXTA 1U4PA 2F1MA 4DFAA 5IE8A 4YHHL 1Y1VH 2GN5A 3I4MH 3M4PA 3H94A 1HNZQ 3GTKB 1LTLA 2PI2A 5IGBA 3S15H 4LFBQ 4DAPA 1RTOA 4A3JG 1K9MC 2JA7G 5IY0A 4KJNA 3D4RA 3DMUA 4BS9A 4HEDA 2K5HA 3PIOA 2KQ3A 2IX0A
chains in the Genus database with same CATH topology
3OMGA 3K57A 3EVQA 2IWHA 3NTIA 1MD2D 2E76C 3HG9A 5C4XB 1LTID 3MA2B 1EEFD 1AZPA 4K5VA 1ZYRC 2B2UC 1UEAB 2WAQB 1LABA 1QCBD 3Q6SA 1OXXK 3K7AB 2KHSA 3OIPA 1TS2A 3BVGA 1SYDA 4FNFA 2RDFA 1CQVA 1ENFA 4GZYC 1IW7D 4OIJA 2IW3A 3S1NB 3MFGA 3H3VC 1DOKA 1HQRD 4G7OC 2WIIB 1LACA 2KECA 4C3HG 4K2KA 3RZDB 3SEBA 5G3LF 1S5FD 1BF4A 4A3FB 1DXMA 1A6XA 3OPOA 3BZDB 2EYHA 3T53B 4IFDJ 3KLRA 4QCLA 1ZKOA 5D3IB 2JA8B 5J22A 5CGKA 5BN3A 5KIXA 1TWAB 1JCKB 4FF2A 2ICIA 1EY4A 1V1PB 4FYDA 4IZ8A 5IGDA 2MP1A 1YNJD 3NHHA 1JWUD 5K36H 1D2BA 1T5EA 1IKMA 2EY2A 1F2MA 4AYBB 2O4XA 1O7YA 1B9MA 1D5ZC 3EJIA 2DY7A 4KMUC 4QIWB 1ZEQX 3BYYB 1CA5A 1E2ZA 1S4ZA 2D2CC 5ELFA 5M9OA 1S5CD 3DWQA 4B08A 1CFMA 2F0UA 3AB9A 3HOZB 4F8MA 1BCPB 3FPPA 4KJOA 2Z1CA 2A74C 3A7AB 1F9PA 1I4PA 2ZXPA 4ABNA 4ULLA 3KLSA 1HTLD 2HDMA 4C3HB 2VXWA 1QB5D 4G7ZC 2BDOA 3KF8A 5DM63 1GUGA 1TVXA 1F9SA 2X6LA 4C2MB 1STAA 5CR3A 2CQAA 5IIFA 2HQEA 1KDAA 1VDZA 4IURA 1GHKA 1SE3A 2Q8TA 1C4QA 3VR2A 1LTRD 1JQYD 2F0FA 1ET9A 4WJWA 3HOYB 1HCZA 1NUCA 5IGCA 3BG3A 3DEPA 2D62A 3N52A 2L12A 1PMRA 1UAPA 4PQXA 4DNTB 4H44C 1Y8NB 3MHBA 1K83B 1HA6A 2QEJC 3WOEA 3GTGB 3S1QB 1XTCD 1WVLA 1U9RA 4DK1A 4JBWA 4FXDA 2HCCA 2B2TA 1SNQA 2EPBA 3MXNA 4P2CB 4H0LC 2BDNA 2KEDA 4QMGA 2O5JC 2R93B 1A3UA 3I90A 2AWOA 4G7HC 1L0YB 1A15A 1F2LA 2DNEA 2WKCA 3HGBA 1VF5C 1QWYA 2KOLA 2K04A 1BCPD 1EOTA 1ESRA 1YNJC 2B2YA 2EY1A 2K1BA 4K2LA 2RDGA 4IUTA 5J1ZA 4ID6A 2SNMA 4IUPA 3C46A 1W6JA 1SAPA 1D1KA 2LFNA 1NR4A 1DM0B 4C3IB 1CI3M 4HMJA 3S2HB 2JE6I 4QUCA 1RKNA 3T51B 1SEBD 3R2IA 5M5YB 3IFDA 2FJ2A 4A3KB 1IHZA 4IUUA 4ZUIA 3MXPA 4HMIA 5IT9E 4Y7NB 1BUVT 5I9PA 3NK9A 3RMHA 5IT9L 2K32A 1H9JA 1EEID 1MSHA 5JPMC 4ME5A 2VB3X 1G2SA 2Q8RE 2E75C 2EYJA 4HSPA 1IYVA 1F9RA 1OXUA 3T16A 1J9OA 3VR4A 4I65A 3NE5B 2PW5A 1AP0A 3VR5A 2RSOA 1TWGB 1HPCA 3J81E 1GOZA 3KUPA 3L7ZC 1WTQA 1JOKA 1TS3A 3G7LA 2B2VA 3OW7A 1EIGA 2VNUD 1EZ8A 3J81L 2WP8J 2C5CA 1T5XD 3AU7A 3ND8A 1Z47A 1Q3LA 2XRSD 1X32A 1QJOA 3D4WA 4PNYA 3BYTB 3CKIB 3K0YA 5C4ZA 3S16B 2SOBA 4KI0A 5DM73 5KGUA 4XYQA 3NWTA 1HFGA 4EQOA 5M5WB 1LT4D 4CJ1B 4R9WA 3R93A 3TP5A 1FD7D 1IL8A 4X3SA 5G3LD 1I4XA 3CHBD 2PZTA 4LMQD 1I4QA 1R4QB 2B2WC 2NTSA 3PIP3 2K03A 4IUNA 5I9OA 4RCOA 4Z9CB 1EYAA 4C3JB 2BCOA 1MGSA 2K5WA 1B9NA 1JC7A 3GTPB 2A5HA 4HR7B 1LT3D 2B2WA 5IGFA 2EYPA 4ZAIA 3D6WA 1GJXA 1RODA 3F2UA 1EY9A 2AQ2B 4KY5A 3EFXD 1D1IA 4KKUA 2F0TA 5JEAJ 3NSWA 1SYCA 2E2DC 4HAEA 3MXUA 1MI2A 4LJZC 4F88A 2NVQB 1PYWD 5C44B 3IFTA 1G8ZD 4C56C 4XDXA 3NQTA 3RZOB 2JYOA 5I4DA 4XTCS 4DAYA 4E6IA 1QOHA 2NYZD 1D5MC 4K6DA 1YNND 2R92B 3G6JB 3GP7A 2R61A 4TKOB 4Q0FA 5FO9B 2HCIA 1BR9A 4TSSA 5DNFA 4XXEA 1WD1A 4BA2I 3QB3A 1SBBB 5CV7A 3DHQA 1HRJA 1H9SA 3S17B 3EROA 4BY7B 2R6GA 5JVG3 3SK5A 2Q8IB 1I6HB 2B63B 5TSSA 1RD9D 4MIUA 5ELCA 5C5MA 4C1NI 1PTOF 1Y1VB 3I4MB 3TP8A 1CHQD 1DYQA 5IGGA 3PMFA 3S15B 2ENBA 2AWNA 2E74C 1HHVA 5C3XA 3HKZB 4X3KA 1EIHA 5CMDA 2M2LA 1WTWA 3Q22A 5I6WA 4H7BA 1U4MA 2PYKA 3I70A 3MWYW 1M4VA 4KD3A 1EFID 3KK7A 3OWEB 4KKSA 3BVZA 2E2IB 1JWSD 5E1FA 4FF3A 5CV8A 5D14A 2K6AA 5JAVA 4YIJA 5LHY1 1K8OA 2XSCA 2K7VA 1RHPA 1WTVA 3D4DA 3A56A 1Z7TA 4K8JA 1E2VA 3FDTA 1AN8A 2L55A 1BO0A 2DY8A 4XT1B 5FOBB 3BVMA 4CKBA 2OT2A 2K5QA 3M7NA 4FXKC 1MSGA 4HSVA 4LK1C 5E4WC 1G6ZA 2Z4HA 4XIGS 4KHZA 3E5SA 2B2UA 3SXHA 4RGOS 4IUQA 3K5MA 1TS5A 2Z8LA 3PUZA 3H0GB 1V8QA 1F77A 2WV6D 2KA7A 3I91A 4B9XA 3RUZA 2A69D 1O80A 2NUCA 5NUCA 1SNCA 1QNUA 2RDHA 2XN9C 3P75A 1ILPA 1II3A 1LTGD 1EYCA 1PRTB 4DF7A 1HA5A 1JORA 1K8MA 2KCNA 3NBHA 2NWGA 2PPBC 4RWSC 1RF2D 4A3JB 1TR5A 2JA7B 3GTQB 3P1HA 1PZJD 3VR6A 3HZXA 1B1ZA 2NN6I 4KN4C 2WB1B 1Y1WB 4R8IA 1YNNC 3D31A 2IT1A 5C6AA 5C4HA 3SHLA 5CV9A 3D3RA 4XYOA 5I2YA 1SSOA 1JOQA 4FO2A 2JEAI 3K5LA 4RKBA 4RA8A 1DCZA 2EYMA 2SNSA 4EQPA 2NN6G 4CJ2C 3OIQA 3ONAB 3GTJB 2EVBA 3VYTA 1STEA 4IUVA 3P7JA 4BBRB 1GUNA 5KEEA 5KNCA 2A68C 1HXYD 1B4OA 1EY7A 3H6MA 2MPMA 3GTOB 1SE2A 4WORA 2MUYA 3K58A 3H91A 2J0TD 4BBSB 3TZUA 4N9PA 1SYFA 2XWBB 1D5XC 3S14B 2JA5B 4ZRZA 1FGBD 3HP3A 1R4PB 3VYUA 2D5DA 1BXTA 3IKJA 1TWCB 1Y69U 1KLGD 3PV0A 2EJGC 3HOUB 1W6KA 3FMCA 1JB3A 1EQVA 1EWHA 2JSOA 2OEOA 1V1OA 5KYLA 3S9WA 2O2LD 5JOBA 2J4XA 4ZUJA 2AUJD 3PO2B 3MAQA 1QG7A 2EY5A 2RBMA 2F0PA 1H9RA 2F03A 4K14A 1AZQA 2EJFC 1PTOH 4CHTB 1B53A 5FKAC 4ZYSA 1PRTD 4IN3A 3MVVA 3CU7A 4DN4M 3MFYA 1OXVA 4OO1I 3SE0A 1G2TA 5CV6A 1IW7C 1JOOA 1OXTA 3MTSA 3Q0AA 4B9WA 4O42A 1DONA 1V43A 3W3AA 2EYOA 2F0IA 4OO1G 2DNCA 4BA1I 3DUZA 1B2TA 2NN6H 3GTMB 1I4HA 1RDPD 3FRPB 4CGYB 2F0DA 2WINB 2O5IC 1I4GA 4MHEA 5FO7B 3MZ5A 5FO8B 2LMCB 1ML0D 3U9SA 1PXUA 4DAVA 4U673 4KHVA 5BN5A 2PQEA 1UNSA 2H4OA 5HURA 4RH6A 3U9OA 1IYUA 1ESFA 4PMWA 1O78A 1BNZA 1JWMD 2K01A 1U4LA 2A6ED 1KTKA 3Q24A 3J7YW 3NXWA 2N88A 3GO5A 1F2YA 2RSNA 2EY6A 3T4AC 1L0XB 3K5NA 2F0EA 3M3YB 2N55A 5LL6S 1XXGA 4CJ0B 1SE4A 2IJ0A 4V0BA 4RGNA 2HDLA 5ELEA 4I7ZC 1SNMA 4RKLA 4RHRA 1CQFA 1VMCA 4ZK9B 1CT1D 2ZXOA 1EWCA 1H9MA 4OIKA 5J39A 1HTPA 2C9OA 4KKTA 4K6LA 1SYEA 3OOCA 3QIAA 2F0QA 1IKLA 3NPPA 2HUGA 1EU3A 3D6CA 2LS01 2F0VA 1TY0A 4OO1H 1H9KA 3QOLA 1PFBA 1STYA 2F0WA 1SYGA 4TRDA 3TZDA 4JK1C 3UI2A 4XQQA 2X6GA 1Y8OB 2JEBI 4UAIA 3A8JE 1PFNA 3ERQA 4DXGA 4A3MB 2F0MA 3C1EA 4S3SA 1J8IA 1I3QB 2L5TA 3HRZC 3I3CA 3E0JA 1PRTC 2KJXA 1FR3A 3WOFA 1SNOA 5M5XB 1A3VA 4BY1B 3IAYA 3C1FA 1O7LA 1XWEA 4ZKCB 1HFNA 2RQXA 1G291 3RD4A 4Q5VA 4O1NA 3TSSA 1ZYRD 1RCVD 4PMBA 1V1PA 4M8AA 3M85A 3V96A 2BA0A 3PIO3 3EQLC 1DOLA 3QOJA 2PZUA 2EYFA 2G9HD 1QNKA 5LL6X 3SVMA 1B50A 2NVYB 4A3DB 5IGEA 1NR2A 1GUOA 5E4XA 1BCPC 1O7ZA 3J80L 4M1UB 3I73A 1VF7A 1E0BA 1SMYD 4L6TB 3QWNA 5EBDA 3NUCA 2FMCA 3OSOA 3X3NA 1SJED 2L4NA 4K5XA 2AUKA 3DM1A 2KVMA 3C3LA 4HCSA 4ZKBB 2I07B 1MBYA 3I4NB 2EYLA 1OO9B 1ENCA 3NTKA 3HOVB 1E2WA 5HGTA 3QO2A 3NP8A 1TIID 4G57A 2FMMA 3PUXA 4ZQ3A 2BE5D 1BCPF 3DWAA 3FPUB 4PMCA 2MHVA 4N9TA 1STNA 2EXZA 3QJYA 5I2XA 3P20A 4J1MA 1WD0A 4IFDI 1PZID 2F3WA 3K6OA 3OWFA 1SNPA 3JAME 1LTBD 2F0OA 5BN4A 3JAML 2K5DA 1PZKD 4FP5D 3A55A 3L3OC 2GA4B 4IFDG 2JP1A 1CZGA 1WCMB 1QILA 3SK6A 3URYA 2JXMB 3KBXA 3D8GA 2D9UA 5FLXL 5I6YA 2OXPA 1ET6A 2FINB 3O13A 2F0HA 5EBCA 1Q12A 1XYIA 3MEHA 1HUMA 4DU9A 2L0CA 1D6EC 3AMUA 4V190 4DXFA 4NMZA 2R7ZB 3RLFA 3SK8A 1EL0A 1DZ1A 3BDCA 3LX0A 4F7XA 1EY8A 2EE1A 2F0SA 1RTNA 5CV4A 1LT5D 2F0NA 2PNRC 2XRQD 5JVH3 3HOWB 1KDBA 3EA6A 4CKEA 1Q8IA 4RGTA 5A35A 1BBXC 4KY7A 4QB4A 2F0KA 2SDFA 2RA4A 4KTAA 1DJRD 1NCVA 5EPKA 2NBFA 1BQQT 3LWEA 2L1BA 1DD2A 1STHA 4G4KA 1GUWA 4RAUC 4ZLTF 1FNWA 2IX3A 5EPJA 1SNDA 2A73B 1SMYC 3GV3A 2IX1A 2QDBA 1I4RA 1TKWB 1UUPA 1LLRD 1EU4A 2F0GA 3OMCA 1PDQA 4DGZA 2J7ZA 5D3DA 5F2DA 3J7AV 3NBIA 3FEWX 4IFDH 3GTLB 4C1NK 5M3MB 1KDCA 2BE5C 2B8GA 3VYSA 2BA1A 4KV6A 1M8AA 5CORA 1OXSC 4FF1A 4L8JA 1A2TA 1KNEA 2EZVA 4H13C 3S1MB 3E6ZX 3C2PA 4A93B 1GXDC 2K05A 1GHJA 4KN7C 1S5ED 3K5OA 2F4IA 4KK7A 2F3VA 1PLFA 2WKDA 1BDOA 2XIWA 3IL8A 2PCFB 2PZWA 5EKKA 2PMZB 5C5LA 4DNRB 1WTXA 1SFOB 1PTOB 5EKLA 1JICA 1RJTA 2AQ1B 3X3MA 1CHPD 3QG1A 1S5DD 1XX8A 1HUNA 2OF1A 2PW7A 1STGA 2G9DA 2CW0D 1JE4A 5T1GA 2FFKB 1H9SB 3TP6A 2L9HA 4KY6A 3SDZA 2I46A 1EYDA 2AQ3B 2XNAC 5COYA 2RVLA 1LV9A 1I50B 3CQZB 3WDNA 2EJMA 3K59A 4L63B 1ZXTA 4ILWA 1VCIA 4NKLA 5JPNC 3A54A 5IOCA 1S5BD 4QUFA 1Q1EA 4C3IG 2RKSA 2F0JA 4OGQC 4EVOA 1QE6A 3MXGA 2TMPA 2VUMB 1FYCA 2A6HD 3TN2A 3V05A 2YYZA 5JJZA 4K5WA 1SJHD 2E2HB 2A69C 4LAAA 3TDQA 1Z6HA 2QCPX 2B2TC 1EY0A 3LNNA 4RGMA 2V4DA 2H1EA 1ONLA 4WFN3 5EKIA 1EY5A 4X3TA 1CZWA 3R8BA 5K5PA 1LTSD 3I72A 1BOSA 3M4YA 3PUVA 3DEOA 1GUTA 4TQUS 3S1RB 2K33A 2M9VA 5C0XI 1LTAD 5DEHA 2SEBD 3PUWA 2B2YC 5E3FA 1DOMA 2NVTB 1JR0D 1R9TB 2EDGA 4MN3A 1AFPA 1CM9A 2NVXB 5EPLA 1TWHB 4FVMA 2KEEA 5C0XG 5C4JB 2IL8A 2Z4IA 1FNUA 1PTOD 4KD4A 2MGSA 1B3AA 3I4LA 5D65A 4DA2A 2IPKD 3N6RA 1WTRA 4QF4A 4NW2A 1TU2B 4BWGB 2VB2X 1C8CA 4EQNA 3MC0B 2EOTA 3OHXC 3BDOA 1NSNS 1ILQA 2E2JB 4HTHA 5FK9C 4J8QA 1TT2A 3TMEA 2QF7A 3I8ZA 5A2QE 2X69A 3ZYYX 3R2TA 3PO3B 3FKIB 5A2QL 3ITPA 2KUMA 2LKVA 5KRUA 3Q23A 2ZXRA 2Y0SB 1FNVA 4RCNA 4DK0A 4C3JG 4RFBA 1ICWA 3HS0C 4WRDA 3VR3A 4X3UA 4A3EB 5JEAG 1I6VC 2CW0C 4J6HA 3CRLC 1AW7A 2B2VC 3VA7A 4IALA 3KBGA 1EY6A 1GUSA 2ZT9C 3A7LA 2ICEC 3KLSX 3M4OB 2XWJB 5KNBA 3VA5A 1EZ6A 2NTTA 2BOSA 1C48A 2NB0A 1A3TA 4K8IA 2PO4A 1LTTD 5EQ0A 3W2DA 3HEJA 3T56B 1KABA 3CRKC 1KNAA 3BDLA 3NTHA 5C0XJ 3LWUA 1CA6A 1Q1BA 3A8KE 2A6HC 3V2TA 5DAUA 1F2ZA 4XQJA 1ENAA 3FVQA 4HCEA 5C0XH 2YU9B 2WACA 5CYUA 1B44D 2B39A 2JA6B 2R3ZA 1Q90A 3H09A 1LT6D 3A8IE 5EJWA 1PRTF 2K28A 1G91A 4OHJA 4EGVA 3J80E 3ND9A 2B8FA 4CBVA 1WTOA 5IODA 2DN8A 1HQMC 5KYIA 3PUYA 4ODGA 2TSSA 5KNDA 3HOXB 2MJ8A 1KAAA 1AEXA 4UDUC 3L9AX 4A3GB 2A6EC 4U68A 1TS4A 5CV5A 1PTOC 3NQIA 1SYBA 4HN7A 2CVRA 3T13A 5ELBA 3R3OA 3GQBA 5JEAH 2L11A 3DWPA 2FHTA 4NDXA 1A2UA 1STBA 5C3EB 5CBAE 5CBEE 3VYRA 5CC4A 2LY7A 3GD7A 3TP7A 2ID0A 1CTMA 4XQNA 2QKIC 1VMPA 2F0LA 4A3BB 1Y8PB 2XVSA 2CHBD 2NZ1D 3S2DB 5C3WA 1SDFA 3SR1A 4OL7A 1PFMA 2KCCA 1TWFB 3DXJC 3GV6A 4A3IB 3TBIB 5T1IA 2M00A 4NP5A 1CK1A 3NWSA 4FXGC 3SK4A 3BS1A 4FF4A 1WTPA 4XT3B 4IQZA 2A68D 5ELDA 1KLUD 5ISRA 5M3FB 1X3QA 1F9QA 1X3PA 5FLXE 5AFWA 1LO5D 1NAPA 4PV1C 3M7GA 4CKCA 1U4RA 1TY2A 4RHSA 1EQTA 5K36G 3J7AF 4R8NA 1TQOA 2QILA 4F87A 5EGTA 1SXTA 1U4PA 2F1MA 4DFAA 3H94A 3GTKB 5IGBA 4DAPA 1RTOA 4KJNA 3D4RA 3DMUA 4BS9A 4HEDA 2KQ3A 2IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  2L55 A;  1ZEQ X;  2QCP X;  2VB2 X;  3E6Z X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 1E1T A;  3E9H A;  2WB1 G;  3OMG A;  1Y1W G;  3K57 A;  3EVQ A;  2IWH A;  3NTI A;  1MD2 D;  3L0O A;  4JI7 Q;  2E76 C;  3HG9 A;  5C4X B;  4QL5 A;  1LTI D;  3MA2 B;  1EEF D;  1AZP A;  4K5V A;  2RHQ B;  1ZYR C;  2B2U C;  2E2I H;  1UEA B;  3KOJ A;  2WAQ B;  2UXC L;  3KYH C;  1Q8K A;  1LAB A;  4P74 A;  1NTG A;  1QCB D;  5BR8 Q;  1NY4 A;  3Q6S A;  1OXX K;  1X56 A;  3K7A B;  4PZ8 A;  2KHS A;  3OIP A;  4OWT B;  1TS2 A;  3BVG A;  1SYD A;  4FNF A;  2RDF A;  1CQV A;  4LF7 L;  1ENF A;  1IBL Q;  4GZY C;  1IW7 D;  4OIJ A;  2IW3 A;  3S1N B;  1YBY A;  3MFG A;  3H3V C;  3STB C;  1DOK A;  1HQR D;  3CMA A;  1VQ4 A;  3KF6 B;  4G7O C;  2WII B;  1LAC A;  5AJ3 Q;  4LF5 L;  4BBS G;  4DV3 Q;  3T1H L;  2KEC A;  1N34 L;  4C3H G;  2JA5 G;  4K2K A;  3RZD B;  3SEB A;  2K50 A;  5G3L F;  1KIX A;  1S5F D;  1BF4 A;  4A3F B;  1DXM A;  4DKA C;  1A6X A;  3OPO A;  3BZD B;  2EYH A;  2OQ0 A;  3T53 B;  4YY3 L;  3HOU G;  4IFD J;  4LF8 L;  4QQB X;  3KLR A;  5LMN L;  4QCL A;  2N78 A;  3H0G H;  1S40 A;  1ZKO A;  5D3I B;  1XTD A;  2JA8 B;  5J22 A;  5CGK A;  5ELN A;  5BN3 A;  5KIX A;  1TWA B;  1JCK B;  4FF2 A;  2ICI A;  1EY4 A;  2ZTE A;  1V1P B;  4FYD A;  3JC6 6;  4JI6 L;  4IZ8 A;  3PO2 G;  2YV5 A;  5IGD A;  2D0P A;  2MP1 A;  1YNJ D;  1IBM Q;  3NHH A;  1JWU D;  5EAY A;  5K36 H;  1D2B A;  4KHP L;  1T5E A;  4JBJ A;  1IKM A;  3CCS A;  2EY2 A;  4LW1 A;  1F2M A;  3TQY A;  4AYB B;  1L1O B;  2O4X A;  1O7Y A;  2CCZ A;  3U4Z A;  5JJK A;  1B9M A;  1D5Z C;  4JOI C;  3EJI A;  4A3J H;  2JA7 H;  2DY7 A;  4KMU C;  3GTQ H;  4QIW B;  1ZEQ X;  3BYY B;  1LM0 A;  4OEL B;  1CA5 A;  1E2Z A;  1S4Z A;  3A0J A;  2D2C C;  2KBN A;  2EIF A;  1Y1W H;  5ELF A;  5M9O A;  1S5C D;  3DWQ A;  4K0K L;  4B08 A;  1CFM A;  2F0U A;  2N8N A;  4JI1 Q;  3AB9 A;  3HOZ B;  5IYB G;  4F8M A;  1BCP B;  3FPP A;  4KJO A;  2Z1C A;  2A74 C;  3A7A B;  1F9P A;  4CDE C;  1I4P A;  2ZM6 Q;  2ZXP A;  4ABN A;  3GTJ H;  4ULL A;  3CCV A;  3KLS A;  1HTL D;  2HDM A;  4TVA B;  2VXW A;  1QB5 D;  4C3H B;  4IJH A;  2R7D A;  4G7Z C;  1ASY A;  5FJ8 G;  2BDO A;  3KF8 A;  5DM6 3;  4YCU A;  3G6E A;  1GUG A;  3CAM A;  1KAW A;  1TVX A;  1C9O A;  1F9S A;  2X6L A;  4MNO A;  3EN2 A;  4WJ3 M;  3GTO H;  4C2M B;  1STA A;  5CR3 A;  2CQA A;  4BBS H;  5IIF A;  2CWP A;  4C3H H;  1C7Y A;  2JA5 H;  3S14 H;  2HQE A;  1KDA A;  3J7Z C;  1VDZ A;  4IUR A;  5HGQ A;  1GHK A;  1SE3 A;  2VL6 A;  2Q8T A;  1TWC H;  1PH7 A;  4LNQ A;  1C4Q A;  3VR2 A;  1LTR D;  1JQY D;  3HOU H;  3PF4 A;  2F0F A;  3A74 A;  1ET9 A;  1SMX A;  1WYD A;  4WJW A;  4DV7 L;  3HOY B;  2Z6K A;  1HCZ A;  3F2B A;  1BVS A;  1XNR L;  1NUC A;  3L2P A;  5IGC A;  3BG3 A;  3DEP A;  3PO2 H;  2D62 A;  3N52 A;  1Q7Y C;  2L12 A;  1PMR A;  1XMO Q;  2IHE A;  1UAP A;  3CCJ A;  4PQX A;  3RR5 A;  4DNT B;  4H44 C;  1Y8N B;  3MHB A;  4YHH Q;  1K83 B;  1HA6 A;  2QEJ C;  3WOE A;  3GTG B;  3S1Q B;  1XTC D;  3A5Z B;  1WVL A;  1P8L A;  1U9R A;  4DK1 A;  1QVG A;  4JBW A;  4FXD A;  4HID A;  2HCC A;  2B2T A;  1SNQ A;  2CWA A;  2EPB A;  3MXN A;  1KL9 A;  1PVO A;  1AE3 A;  4P2C B;  4H0L C;  1PYB A;  4HJ9 A;  4B3S Q;  1JJC B;  2BDN A;  2KED A;  4QMG A;  4CDD C;  2O5J C;  1NNX A;  2R93 B;  2R7F A;  1YHQ A;  1A3U A;  1VQ9 A;  3I90 A;  2AWO A;  4G7H C;  1L0Y B;  5IYB H;  3I55 A;  1A15 A;  1F2L A;  1KQS A;  2DNE A;  3ICE A;  2VQE L;  2WKC A;  3HGB A;  1VF5 C;  1QWY A;  2KOL A;  3GTM H;  2K04 A;  2UXC Q;  1K73 C;  1BCP D;  1EOT A;  1ESR A;  1YNJ C;  2B2Y A;  2EY1 A;  2K1B A;  4K2L A;  2RDG A;  4IUT A;  5J1Z A;  4ID6 A;  3AFP A;  2SNM A;  1RIP A;  4IUP A;  4A3M G;  3C46 A;  1W6J A;  4IPG A;  1SAP A;  2Q2T A;  4LF7 Q;  1QVC A;  1D1K A;  2LFN A;  1NR4 A;  1DM0 B;  5FJ8 H;  4DR2 L;  4C3I B;  1VQE A;  1G6P A;  1CI3 M;  1PH2 A;  1VQL A;  3K80 C;  4HMJ A;  3S2H B;  2JE6 I;  4QUC A;  1RKN A;  3T51 B;  4LF5 Q;  2VW9 A;  1SEB D;  3R2I A;  2HD3 A;  3T1H Q;  5M5Y B;  3IFD A;  3T1Y L;  1N34 Q;  1HNX L;  2WAQ E;  2FJ2 A;  4A3K B;  1EUJ A;  4BY1 G;  1IHZ A;  1VQ5 A;  1XNQ L;  4IUU A;  1BBU A;  2RHS B;  4ZUI A;  3MXP A;  2LXK A;  3TRE A;  4HMI A;  4YY3 Q;  5IT9 E;  4Y7N B;  4LF8 Q;  1VQG A;  5LMN Q;  1BUV T;  2PQA B;  2CKZ B;  5I9P A;  3NK9 A;  3RMH A;  5IT9 L;  2K32 A;  1H9J A;  1EEI D;  1MSH A;  5JPM C;  4ME5 A;  5M5Y H;  2VB3 X;  1G2S A;  2Q8R E;  4JI6 Q;  2E75 C;  2EYJ A;  4B3T L;  3RN2 A;  2UXD L;  3M3Y H;  4HSP A;  1IYV A;  1F9R A;  4A3D G;  1OXU A;  3T16 A;  1PV4 A;  1J9O A;  3VR4 A;  4Y7N H;  4I65 A;  4KHP Q;  3NE5 B;  4PG3 A;  2K75 A;  2PW5 A;  1AP0 A;  3VR5 A;  4GKJ L;  5HY6 A;  2RSO A;  1TWG B;  1HPC A;  4JI5 L;  1QUQ A;  3J81 E;  1EYG A;  1GOZ A;  3FHW A;  3KUP A;  3L7Z C;  2DUD A;  1WTQ A;  1JOK A;  1TS3 A;  2EXD A;  3G7L A;  2B2V A;  3OW7 A;  1EIG A;  2VNU D;  1EZ8 A;  3J81 L;  2WP8 J;  2C5C A;  1GM5 A;  1T5X D;  3AU7 A;  4JYA L;  3ND8 A;  1Z47 A;  1Q3L A;  3CC2 A;  2XRS D;  3UE0 A;  1X32 A;  2AHO B;  1QJO A;  1PH6 A;  3D4W A;  1WFQ A;  4K0K Q;  4N8F A;  3I4N G;  4PNY A;  3BYT B;  3CKI B;  4O0A A;  3HOV G;  3K0Y A;  5C4Z A;  3S16 B;  2SOB A;  4KI0 A;  4R4C A;  4AYB E;  1VQF A;  5DM7 3;  5KGU A;  1JMC A;  2HHH L;  4XYQ A;  3PCO B;  3NWT A;  1HFG A;  4EQO A;  5M5W B;  1LT4 D;  4CJ1 B;  4R9W A;  1B3Q A;  3R93 A;  4A3M H;  3TP5 A;  1FD7 D;  1IL8 A;  2CH4 A;  4X3S A;  5G3L D;  3OTO L;  1I4X A;  3CHB D;  2PZT A;  4LMQ D;  1I3Q H;  3VDY A;  1I4Q A;  1R4Q B;  2B2W C;  4NB3 A;  2NTS A;  3PIP 3;  2K03 A;  2KCM A;  5H1S E;  4IUN A;  5I9O A;  4RCO A;  4Z9C B;  1EYA A;  3KDF A;  4C3J B;  2BCO A;  1MGS A;  4X64 L;  2K5W A;  1L1O C;  1B9N A;  2PMZ E;  1JC7 A;  3I7F A;  3GTP B;  2A5H A;  1UEB A;  5M5X H;  4HR7 B;  2QA4 A;  1LT3 D;  4BY1 H;  2B2W A;  1N8R C;  5IGF A;  1X55 A;  4JCV E;  5IYC G;  2EYP A;  4ZAI A;  3D6W A;  1GJX A;  1ROD A;  1WCM G;  3F2U A;  1EY9 A;  4YCV A;  1MKH A;  2AQ2 B;  4KY5 A;  3EFX D;  1M90 C;  4IPD A;  1D1I A;  4KKU A;  2F0T A;  5JEA J;  3NSW A;  1SYC A;  1PFS A;  2E2D C;  2VZA A;  3U50 C;  4HAE A;  3J7A 5;  3MXU A;  1MI2 A;  4LJZ C;  4F88 A;  2NVQ B;  1PYW D;  1XNR Q;  2B29 A;  2VS1 A;  3H15 A;  1X3G A;  5C44 B;  4GN3 B;  3IFT A;  1G8Z D;  4C56 C;  4DV2 L;  4XDX A;  3NQT A;  3AEV A;  3RZO B;  2K5V A;  2JYO A;  2NVY H;  4A3D H;  4IPC A;  2RF4 A;  1E24 A;  5I4D A;  4XTC S;  4DAY A;  4E6I A;  1QOH A;  2NYZ D;  1D5M C;  4K6D A;  1UWV A;  1YNN D;  2R92 B;  3G6J B;  2R7Z G;  3GP7 A;  2R61 A;  1EOV A;  4TKO B;  4HIM A;  1KHI A;  1HR0 W;  4Q0F A;  5FO9 B;  2HCI A;  1BR9 A;  2N3S A;  4TSS A;  5DNF A;  4XXE A;  2IY5 B;  1WD1 A;  4BA2 I;  3QB3 A;  4HIK A;  1SBB B;  3HOW G;  5CV7 A;  3DHQ A;  1HRJ A;  1H9S A;  3RLN A;  3S17 B;  3ERO A;  4BY7 B;  2R6G A;  5JVG 3;  3SK5 A;  2Q8I B;  1Y14 B;  1I6H B;  2B63 B;  5TSS A;  1RD9 D;  4MIU A;  5ELC A;  5C5M A;  5JJI A;  5IYD G;  4C1N I;  1PTO F;  1Y1V B;  5GQO A;  3I4M B;  3TP8 A;  1CHQ D;  1DYQ A;  5IGG A;  3I4N H;  4OXP A;  3PMF A;  1SRU A;  3ULL A;  2VQE Q;  2ENB A;  3S15 B;  1KXL A;  2AWN A;  2E74 C;  1HHV A;  3E9I A;  4UHV A;  2YTV A;  5C3X A;  3HKZ B;  1VQP A;  4X3K A;  1EIH A;  5CMD A;  2M2L A;  4X66 L;  1WTW A;  3Q22 A;  5I6W A;  4DK3 C;  4H7B A;  3KJP A;  1U4M A;  2PYK A;  3I70 A;  3MWY W;  1M4V A;  2JQO A;  4KD3 A;  1EFI D;  4DR2 Q;  3KK7 A;  1X65 A;  3OWE B;  4KKS A;  3BVZ A;  2E2I B;  1JWS D;  4GKK L;  5E1F A;  4FF3 A;  5CV8 A;  5D14 A;  2K6A A;  5JAV A;  4YIJ A;  2UUA L;  5LHY 1;  3T1Y Q;  1HNX Q;  1K8O A;  2XSC A;  1W3S A;  2K7V A;  1RHP A;  1WTV A;  2ATW A;  1XNQ Q;  3D4D A;  3A56 A;  4HJA A;  1Z7T A;  1VQ8 A;  4K8J A;  1E2V A;  3FDT A;  3J81 j;  1AN8 A;  3K7U C;  1L2F A;  5IYC H;  4R4O A;  4BXX G;  2L55 A;  1BO0 A;  1WCM H;  2DY8 A;  4XT1 B;  5FOB B;  3BVM A;  4CKB A;  2N49 A;  1FL0 A;  4EQ5 A;  5M3M G;  2OT2 A;  2K5Q A;  4DR3 L;  3M7N A;  4DAM A;  4FXK C;  1D8L A;  3W5O A;  1MSG A;  4HSV A;  4LK1 C;  5E4W C;  1G6Z A;  2Z4H A;  4XIG S;  2Z0S A;  4KHZ A;  4B3T Q;  3E5S A;  5GAG C;  2UXD Q;  4BBR G;  2E5L L;  2B2U A;  3SXH A;  4RGO S;  4IUQ A;  3K5M A;  1TS5 A;  2Z8L A;  3PUZ A;  1TXY A;  2Z6B A;  4GKJ Q;  4A93 G;  3H0G B;  3TS0 A;  2R7Z H;  4JI5 Q;  4AIM A;  1V1Q A;  1V8Q A;  1F77 A;  2WV6 D;  2Y0S E;  2RCF A;  4DV6 L;  2KA7 A;  3I91 A;  5FLM G;  4B9X A;  3RUZ A;  2A69 D;  1O80 A;  5IP9 G;  2NUC A;  1PHJ A;  5NUC A;  1SNC A;  1QNU A;  4JG2 A;  1RL2 A;  2RDH A;  2XN9 C;  4JYA Q;  2I5L X;  3HOW H;  3P75 A;  3JAM c;  1ILP A;  4P75 A;  4A4I A;  1II3 A;  3B6Y A;  1B8A A;  1EYC A;  1LTG D;  1PRT B;  4DF7 A;  1HA5 A;  3K81 C;  1IL2 A;  1JOR A;  5IYD H;  1K8M A;  1YIT A;  2KCN A;  3NBH A;  1NBW A;  2NWG A;  2PPB C;  4RWS C;  1X3E A;  1RF2 D;  3G4S A;  4A3J B;  1TR5 A;  2JA7 B;  2K5N A;  3GTQ B;  2HHH Q;  3P1H A;  4GLX A;  5FLX c;  1PZJ D;  3VR6 A;  3HZX A;  1B1Z A;  1B70 B;  2NN6 I;  4KN4 C;  2WB1 B;  1KRT A;  1Y1W B;  4R8I A;  3AQQ A;  1XPR A;  1YNN C;  2PQA A;  3OTO Q;  3D31 A;  2IT1 A;  5C6A A;  5C4H A;  1VQN A;  3SHL A;  4X62 L;  5CV9 A;  3D3R A;  4P73 A;  4P72 A;  4XYO A;  4DR5 L;  5I2Y A;  3BZK A;  1SSO A;  1AH9 A;  4Y52 H;  3WWV A;  1MJE A;  3KJO A;  1JOQ A;  4FO2 A;  2JEA I;  3K5L A;  4RKB A;  4RA8 A;  1DCZ A;  2EYM A;  2SNS A;  4X64 Q;  3TS2 A;  2NN6 G;  1GO3 E;  1SLJ A;  4EQP A;  4DR1 L;  4CJ2 C;  4MTN A;  1NMF A;  3OIQ A;  3ONA B;  3GTJ B;  3CCU A;  2EVB A;  3VYT A;  1STE A;  3J81 i;  4IUV A;  3I4O A;  3P7J A;  1U0L A;  4BBR B;  1GUN A;  2QGQ A;  5KEE A;  5KNC A;  2VUM G;  2A68 C;  1HXY D;  4JOI A;  1B4O A;  1EY7 A;  4BXX H;  3H6M A;  2MPM A;  3GTO B;  4DV0 L;  3GTL H;  1SE2 A;  4WOR A;  5M3M H;  3CPF A;  2MUY A;  3K58 A;  3H91 A;  2J0T D;  4BBS B;  1CKN B;  3TZU A;  4N9P A;  3RLO A;  1SYF A;  4UY8 C;  4ME3 A;  2XWB B;  1D5X C;  2I0Q A;  2F4V L;  3S14 B;  1GD7 A;  2JA5 B;  4MZ9 A;  3CPW A;  4DV2 Q;  4ZRZ A;  1FGB D;  4NXM L;  3HP3 A;  1R4P B;  1FVI A;  2JN4 A;  4BBR H;  3VYU A;  2D5D A;  1BXT A;  3IKJ A;  1TWC B;  1Y69 U;  4NXN L;  1KLG D;  3PV0 A;  4DR6 L;  2EJG C;  4R1J A;  3S1M H;  3HOU B;  1W6K A;  3FMC A;  1JB3 A;  1EQV A;  4A3C G;  1EWH A;  4A93 H;  5ELO A;  2JSO A;  2OEO A;  1VQK A;  1A63 A;  1V1O A;  3PSI A;  5KYL A;  3S9W A;  2O2L D;  5JOB A;  5FLM H;  2J4X A;  5IP9 H;  2KHJ A;  4ZUJ A;  2AUJ D;  3PO2 B;  3AYH B;  3MAQ A;  1QG7 A;  2EY5 A;  2RBM A;  2F0P A;  1H9R A;  1Q86 C;  2F03 A;  4K14 A;  1AZQ A;  1NMG A;  2EJF C;  3H3V I;  1SFO H;  1PTO H;  4CHT B;  2KHI A;  2GVB A;  1B53 A;  5FKA C;  4ZYS A;  1S72 A;  1HZA A;  3M9B A;  4AQY Q;  1Q81 C;  4HJ8 A;  1PRT D;  4IN3 A;  3MVV A;  3CU7 A;  4DN4 M;  3MFY A;  4GNX B;  2VY3 A;  1OXV A;  4OO1 I;  3SE0 A;  1G2T A;  4DUY L;  1L0W A;  5CV6 A;  1IW7 C;  1JOO A;  1OXT A;  1WJJ A;  4L5T A;  3MTS A;  3Q0A A;  4DR4 L;  3MEF A;  4B9W A;  3CXC A;  4GOP B;  4O42 A;  1DON A;  1V43 A;  3CQZ H;  3W3A A;  2AKW B;  2EYO A;  2F0I A;  4OO1 G;  1KC8 C;  2DNC A;  4GKK Q;  4BA1 I;  3PO3 G;  3DUZ A;  1B2T A;  2NN6 H;  3GTM B;  1I4H A;  3FKI G;  2UUA Q;  1RDP D;  3FRP B;  4CGY B;  2ZJP A;  2F0D A;  2WIN B;  4P71 A;  1X9N A;  2O5I C;  1I4G A;  4MHE A;  2Y0S G;  3TEH B;  5FO7 B;  3Q8D A;  3MZ5 A;  5FO8 B;  2LMC B;  1ML0 D;  3U9S A;  1PXU A;  4DAV A;  4U67 3;  3HKS A;  4KHV A;  2VUM H;  5BN5 A;  3KLW A;  2PQE A;  2Z9H A;  4A3E G;  1K8A C;  2E2H H;  2Q2I A;  4DR3 Q;  2HT1 A;  1UNS A;  1A0I A;  2H4O A;  5DLQ E;  1JJG A;  5HUR A;  4RH6 A;  2DJF C;  3U9O A;  4OEM B;  1IYU A;  1ESF A;  2E5L Q;  4PMW A;  1O78 A;  2H5X A;  1BNZ A;  1JWM D;  4A3C H;  3M4Q A;  2K01 A;  4L5R C;  1U4L A;  3S1R H;  4JI0 L;  3OW2 A;  2A6E D;  1KTK A;  3Q24 A;  3J7Y W;  4DV6 Q;  3NXW A;  3LGJ A;  2N88 A;  3GO5 A;  1VQB A;  1F2Y A;  1VQD A;  2RSN A;  2EY6 A;  4LFA L;  3T4A C;  4I7A A;  1L0X B;  3K5N A;  1HJP A;  2F0E A;  3M3Y B;  4LUZ A;  2NVT H;  2N55 A;  2Q2H A;  1R9T H;  2UUC L;  5LL6 S;  1XXG A;  4AH6 A;  4CJ0 B;  1SE4 A;  2IJ0 A;  4V0B A;  4RGN A;  1TWH H;  5LMU L;  2HDL A;  1UE7 A;  5ELE A;  1W2B A;  3D0F A;  1VQJ A;  1WTH A;  4I7Z C;  5C4J H;  1SNM A;  4DR7 L;  4RKL A;  4RHR A;  1CQF A;  1VQA A;  1PYS B;  1YZ6 A;  1VMC A;  2JA6 G;  1PA6 A;  4ZK9 B;  1CT1 D;  2ZXO A;  1EWC A;  3H3V H;  1CSQ A;  1H9M A;  4DV4 L;  4OIK A;  5J39 A;  4B3M L;  1HTP A;  2C9O A;  4KKT A;  4K6L A;  1SYE A;  3OOC A;  4UP7 A;  1A8V A;  3QIA A;  1HZC A;  4X62 Q;  2F0Q A;  2E2J H;  1IKL A;  3NPP A;  2HUG A;  2JK8 A;  1EU3 A;  3D6C A;  4DR5 Q;  1VQ6 A;  2LS0 1;  4GS3 A;  2F0V A;  1TY0 A;  4OO1 H;  1UE6 A;  4IOA A;  1H9K A;  3QOL A;  1PFB A;  1STY A;  2F0W A;  1SYG A;  4TRD A;  3TZD A;  2OWO A;  4JK1 C;  3UI2 A;  4DR1 Q;  3PO3 H;  2UU9 L;  3CC4 A;  4XQQ A;  2X6G A;  1Y8O B;  2JEB I;  3FKI H;  4UAI A;  3A8J E;  2DJG C;  4OWX B;  1PFN A;  3UDG A;  3ERQ A;  4POF A;  3HOX G;  4DXG A;  1WI5 A;  4A75 A;  4A3M B;  2F0M A;  3C1E A;  2WB1 E;  4S3S A;  4A3G G;  1J8I A;  1I3Q B;  2L5T A;  3KF6 A;  1K8G A;  3HRZ C;  1T9H A;  2FXQ A;  3I3C A;  3E0J A;  1PRT C;  4DV0 Q;  2KJX A;  1JB7 A;  5IP7 G;  2OCE A;  4A3E H;  1FR3 A;  3WOF A;  5C3E G;  1CUK A;  3F2C A;  1SNO A;  5JJL A;  2IHF A;  5M5X B;  2F4V Q;  4QIW E;  1A3V A;  4BY1 B;  3IAY A;  3C1F A;  2G5D A;  4NXM Q;  2KCT A;  1O7L A;  1XWE A;  4ZKC B;  1HFN A;  3M4O H;  2RQX A;  1G29 1;  3RD4 A;  4Q5V A;  4A3B G;  4O1N A;  4DR6 Q;  3TSS A;  4GLV B;  1ZYR D;  1RCV D;  4PMB A;  1V1P A;  4ALP A;  4M8A A;  3M85 A;  3V96 A;  2BA0 A;  3PIO 3;  4A3I G;  4FDB A;  3EQL C;  1DOL A;  3QOJ A;  1YJW A;  3K0X A;  1K0R A;  2PZU A;  4QY7 A;  2EYF A;  2G9H D;  1QNK A;  5LL6 X;  3SVM A;  1B50 A;  2NVY B;  4A3D B;  5M3F G;  3I2Z A;  5IGE A;  1NR2 A;  1L1O A;  5LMN W;  1E22 A;  1GUO A;  1ASZ A;  3G71 A;  3FP9 A;  2YU9 H;  4DV7 Q;  5E4X A;  1BCP C;  2ASB A;  4RMF A;  1O7Z A;  4N8X 1;  3J80 L;  4M1U B;  1K3B C;  3I73 A;  1VF7 A;  2JA6 H;  2K14 A;  3DM3 A;  4GN5 A;  1E0B A;  1SMY D;  4L6T B;  3QWN A;  1EIY B;  1J5E L;  3UDX A;  5EBD A;  4DUY Q;  2ES2 A;  1EWI A;  3UDF A;  4B3R L;  3SGI A;  3NUC A;  2FMC A;  3OSO A;  2K4K A;  2NZH A;  2OTL A;  3X3N A;  3CC7 A;  1SJE D;  4DR4 Q;  2L4N A;  4K5X A;  2AUK A;  3DM1 A;  2KVM A;  3C3L A;  1N33 L;  1SR3 A;  3UE1 A;  4HCS A;  4ZKB B;  2I07 B;  4DV5 L;  1MBY A;  3I4N B;  3CW2 C;  2EYL A;  1OO9 B;  3S24 A;  1ENC A;  3NTK A;  3HOV B;  1D7Q A;  1E2W A;  3MXN B;  5HGT A;  3QO2 A;  3NP8 A;  1IZ6 A;  1TII D;  3G48 A;  4G57 A;  2V1C C;  5C4X G;  2FMM A;  2I5H A;  4RG1 A;  1N9W A;  3PUX A;  4ZQ3 A;  2BE5 D;  3HOX H;  1HNW L;  1BCP F;  1G51 A;  3KFU A;  3DWA A;  4IO9 A;  3BJU A;  3FPU B;  4PMC A;  4A3G H;  2WAQ G;  2MHV A;  2B3G A;  4N9T A;  1E7Z A;  1STN A;  2EXZ A;  3QJY A;  5I2X A;  2ZJQ A;  2Q2U A;  3P20 A;  4J1M A;  5IP7 H;  1WD0 A;  3NEN A;  1EFW A;  2VQF L;  3HOV H;  4IFD I;  1PZI D;  2F3W A;  4O2D A;  2PI2 E;  3W1B A;  3K6O A;  5C3E H;  3OWF A;  1SNP A;  4DUZ L;  4GNX C;  3JAM E;  4QGU A;  1LTB D;  2F0O A;  5BN4 A;  1XPU A;  1QZH A;  1PH5 A;  3JAM L;  2K5D A;  1PZK D;  4FP5 D;  3A55 A;  1IBK L;  4UP8 A;  3L3O C;  2HQL A;  4A3B H;  2CQO A;  2GA4 B;  4IFD G;  2JP1 A;  1CZG A;  3GDE A;  1WCM B;  1QIL A;  1X3F A;  4GOP C;  3SK6 A;  3S2D H;  3URY A;  4JI0 Q;  1YHA A;  4A3F G;  1TWF H;  2JXM B;  3J80 c;  3KBX A;  2F3I A;  4A3I H;  3D8G A;  2D9U A;  2YTX A;  5FLX L;  4LFA Q;  5I6Y A;  3CME A;  2OXP A;  5E7N A;  1ET6 A;  2FIN B;  3O13 A;  1EIF A;  2F0H A;  2UUC Q;  2UUB L;  5EBC A;  1Q12 A;  4GOP A;  1XYI A;  3MEH A;  2JA8 G;  1HUM A;  4DU9 A;  1QZG A;  1LUZ A;  2L0C A;  1D6E C;  4JBK A;  4JI3 L;  5M3F H;  3AMU A;  3PIP A;  5LMU Q;  4LF6 L;  4V19 0;  4R4Q A;  2QDL A;  4DXF A;  4DR7 Q;  4NMZ A;  2R7Z B;  3RLF A;  3SK8 A;  1EL0 A;  1DZ1 A;  3BDC A;  2BH2 A;  4B3S L;  1AE2 A;  1I5F A;  3LX0 A;  4F7X A;  1EY8 A;  2EE1 A;  2F0S A;  1RTN A;  5CV4 A;  4OX9 L;  4A3L G;  1LT5 D;  2LXJ A;  1H95 A;  2F0N A;  2PNR C;  4DV4 Q;  2XRQ D;  5JVH 3;  3HOW B;  4AYB G;  1KDB A;  4B3M Q;  1PH4 A;  3GTK H;  2GVA A;  3EA6 A;  4CKE A;  1Q8I A;  2JJQ A;  4RGT A;  5A35 A;  1BBX C;  2F52 A;  4KY7 A;  4QB4 A;  1QUQ B;  3RN5 A;  2F0K A;  1PH1 A;  1OTC A;  2SDF A;  2RA4 A;  4KTA A;  4YCW A;  2UU9 Q;  2HIX A;  1DJR D;  1NCV A;  5EPK A;  5C4X H;  3HOZ G;  2NBF A;  3PF5 A;  3ZJY C;  1BQQ T;  3LWE A;  2L1B A;  1DD2 A;  2DGY A;  3ER0 A;  4LF9 L;  1STH A;  5L37 A;  3U4V A;  5IWA L;  2PNH A;  4G4K A;  1GUW A;  4RAU C;  4ZLT F;  1FNW A;  2IX3 A;  1IYJ B;  5EPJ A;  1SND A;  2QW7 A;  4JV5 L;  1CKM A;  3K7A H;  2A73 B;  1SMY C;  3GV3 A;  2IX1 A;  2QDB A;  4JI4 L;  1I4R A;  1TKW B;  1UUP A;  1LLR D;  1XMQ L;  1PH8 A;  3CP0 A;  4J15 A;  4JI8 L;  1EU4 A;  2F0G A;  4QJF A;  3OMC A;  1PDQ A;  4DGZ A;  4DV1 L;  3S1N H;  4IPH A;  2J7Z A;  5D3D A;  5F2D A;  3J7A V;  3NBI A;  1CKO A;  3FEW X;  4IFD H;  1DGS A;  3RZD H;  3KDF B;  3GTL B;  4C1N K;  5M3M B;  1KDC A;  4A3F H;  1SRO A;  2UXB L;  1SN8 A;  3EBE A;  2BE5 C;  2B8G A;  3VYS A;  1Z9F A;  2BA1 A;  4KV6 A;  1M8A A;  5COR A;  1OXS C;  3U58 A;  1SE8 A;  4FF1 A;  3A5U A;  2K52 A;  4L8J A;  1A2T A;  3HOY G;  2JA8 H;  1KNE A;  2EZV A;  4H13 C;  1JJ2 A;  1TWA H;  3S1M B;  3E6Z X;  1HR0 L;  4YWL A;  3NEL A;  3C2P A;  4A93 B;  1ICF B;  4NPS A;  3CCQ A;  4JI2 L;  1GXD C;  2K05 A;  3I56 A;  1GHJ A;  4KN7 C;  1S5E D;  3K5O A;  2F4I A;  4KK7 A;  2F3V A;  1PLF A;  2WKD A;  1BDO A;  1NJI C;  2XIW A;  1J5E Q;  2EQS A;  3IL8 A;  4A3L H;  1YEZ A;  4B3R Q;  2PCF B;  2PZW A;  5EKK A;  4DAY B;  4JBM A;  2E8G A;  2PMZ B;  5C5L A;  4DNR B;  1WTX A;  4DNI A;  1PTO B;  1SFO B;  5EKL A;  1N33 Q;  1I94 L;  1JIC A;  4POG A;  3CCM A;  1RJT A;  4DV5 Q;  2AQ1 B;  1VQM A;  3X3M A;  1CHP D;  4LUO A;  3QG1 A;  2R93 G;  1S5D D;  1XX8 A;  1HUN A;  2CH4 W;  2OF1 A;  2PW7 A;  1STG A;  2G9D A;  2CW0 D;  1JE4 A;  5T1G A;  1IXR A;  2FFK B;  3HOZ H;  1H9S B;  3TP6 A;  2L9H A;  4KY6 A;  3SDZ A;  1HNW Q;  2I46 A;  2L15 A;  1EYD A;  2AQ3 B;  3E3X A;  1E1O A;  2XNA C;  5COY A;  1WOC A;  2RVL A;  1LV9 A;  1VQI A;  1X54 A;  1I50 B;  3CQZ B;  3WDN A;  1QVF A;  2EJM A;  3K59 A;  2JA9 A;  3NEM A;  4L63 B;  1ZXT A;  4ILW A;  1VS0 A;  1VCI A;  4NKL A;  4YWM A;  2VQF Q;  4EX5 A;  5JPN C;  3A54 A;  2Z6K C;  1N36 L;  5IOC A;  1S5B D;  3BU2 A;  4QUF A;  3J80 i;  4UP9 A;  3UDI A;  2QEX A;  4DUZ Q;  1Q1E A;  1YIJ A;  4C3I G;  4X66 Q;  4HIO A;  2RKS A;  4C2M H;  2F0J A;  4OGQ C;  4EVO A;  1QE6 A;  3MXG A;  2TMP A;  4CDC C;  1IBK Q;  2VUM B;  4H02 A;  1FYC A;  2A6H D;  3TN2 A;  3V05 A;  2HIV A;  2YYZ A;  1I50 H;  5JJZ A;  4K5W A;  4A3K G;  1SJH D;  2E2H B;  1YVC A;  2A69 C;  4LAA A;  3TDQ A;  1N32 L;  1Z6H A;  2QCP X;  1FJG L;  2B2T C;  1BBW A;  1EY0 A;  1GVP A;  3LNN A;  4RGM A;  2V4D A;  2H1E A;  1ONL A;  4WFN 3;  3HKZ E;  2UUB Q;  3F2D A;  1FGU A;  5EKI A;  1EY5 A;  4LF4 L;  3HOY H;  4JI3 Q;  4LFC L;  4IJL A;  4X3T A;  1CZW A;  3R8B A;  5K5P A;  1LTS D;  2MO1 A;  2ZTD A;  3I72 A;  1BOS A;  3M4Y A;  3PUV A;  3ERS X;  4X65 L;  4HJ5 A;  3TRZ A;  4LF6 Q;  2XGT A;  3DEO A;  1GUT A;  4TQU S;  3S1R B;  1BKB A;  1MJC A;  2K33 A;  2M9V A;  2OQK A;  5C0X I;  1LTA D;  5DEH A;  2SEB D;  3PUW A;  2B2Y C;  5E3F A;  1VQO A;  1DOM A;  4OX9 Q;  4A76 A;  4PZ7 A;  1K83 H;  4DPG A;  2NVT B;  1JR0 D;  1R9T B;  3GTG H;  3S1Q H;  2EDG A;  2XTI A;  3QR8 A;  4LWC A;  4MN3 A;  1AFP A;  1CM9 A;  2ZTC A;  2NVX B;  3JAM i;  4MTK A;  5EPL A;  1TWH B;  4FVM A;  2KEE A;  5C0X G;  5C4J B;  2IL8 A;  2Z4I A;  3F1Z A;  4R4T A;  1FNU A;  1PTO D;  1YHB A;  4KD4 A;  4DK6 C;  1PH3 A;  2R93 H;  2C35 B;  2MGS A;  1VQ7 A;  2I5M X;  1B3A A;  3I4L A;  5D65 A;  4DA2 A;  2IPK D;  3N6R A;  1WTR A;  4QF4 A;  4NW2 A;  1TU2 B;  4BWG B;  2VB2 X;  1C8C A;  4EQN A;  3MC0 B;  4LF9 Q;  2EOT A;  1HNZ L;  3OHX C;  2OTJ A;  3BDO A;  5IWA Q;  1C0A A;  4LFB L;  2NVX H;  2MQH A;  1NSN S;  1UE1 A;  1ILQ A;  4UPA A;  2E2J B;  1JT8 A;  4L5Q A;  4HTH A;  5FK9 C;  4J8Q A;  1TT2 A;  3TME A;  3NBH B;  4JV5 Q;  2QF7 A;  3I8Z A;  5A2Q E;  1B7Y B;  2RCN A;  2X69 A;  3ZYY X;  1HZ9 A;  4OON A;  3R2T A;  4JI4 Q;  3PO3 B;  4JI7 L;  3FKI B;  5A2Q L;  4JPB W;  3ITP A;  1XMQ Q;  2KUM A;  4APV A;  4JI8 Q;  2LKV A;  5KRU A;  3Q23 A;  4C3I H;  2ZXR A;  1A62 A;  2AMC B;  4DV1 Q;  2Y0S B;  4JW0 A;  3S2H H;  1FNV A;  4RCN A;  1NE3 A;  4DK0 A;  4C3J G;  1YNX A;  4CDF C;  4JVZ A;  4RFB A;  1ICW A;  3HS0 C;  4WRD A;  3VR3 A;  4X3U A;  3AFQ A;  4A3K H;  4A3E B;  5BR8 L;  4KLK A;  5JEA G;  1HH2 P;  1I6V C;  2CW0 C;  4J6H A;  2UXB Q;  1K3R A;  3CRL C;  1AW7 A;  2B2V C;  3VA7 A;  4IAL A;  1YJ9 A;  1IBL L;  3KBG A;  1EY6 A;  1GUS A;  1X6O A;  2ZT9 C;  3A7L A;  2ICE C;  3KLS X;  3M4O B;  2XWJ B;  5KNB A;  5AJ3 L;  3VA5 A;  1EZ6 A;  1GKH A;  1HR0 Q;  4DV3 L;  2NTT A;  2BOS A;  5C44 G;  5GAD C;  1C48 A;  1CSP A;  4JI2 Q;  2NB0 A;  1A3T A;  4K8I A;  2PO4 A;  3EIV A;  1LTT D;  5EQ0 A;  3W2D A;  3HEJ A;  3T56 B;  2D0O A;  1KAB A;  3CRK C;  1KNA A;  3BDL A;  3NTH A;  1V9P A;  5C0X J;  2R92 G;  3LWU A;  1CA6 A;  1Q1B A;  3A8K E;  2A6H C;  3V2T A;  5DAU A;  1PH9 A;  1TWG H;  3KF8 B;  1E3P A;  4L5S A;  4NXN Q;  1F2Z A;  3CCR A;  3IRB A;  3PQI A;  4XQJ A;  5GRO A;  1ENA A;  3FVQ A;  4HCE A;  5C0X H;  1I94 Q;  2YU9 B;  2WAC A;  1VQH A;  1S3O A;  5CYU A;  1B44 D;  1IBM L;  2B39 A;  2JA6 B;  2R3Z A;  1Q90 A;  2A19 A;  4BY7 G;  3H09 A;  1KD1 C;  2B63 G;  1LT6 D;  1KRS A;  4IOC A;  1P16 A;  3A8I E;  1Y1V G;  5EJW A;  1PRT F;  4WJ4 A;  3I4M G;  2K28 A;  1G91 A;  3ULP A;  2BH8 A;  5IT9 c;  4OHJ A;  4EGV A;  3S16 H;  1J6Q A;  3J80 E;  3ND9 A;  3STB D;  5J3B A;  3HKZ G;  5M5W H;  2B8F A;  4OWW B;  2KEN A;  4CBV A;  1WTO A;  1EQQ A;  5IOD A;  4X6A H;  3ULJ A;  3CCL A;  2DN8 A;  1HQM C;  3CD6 A;  5KYI A;  1N36 Q;  3PUY A;  4ODG A;  5GAH C;  3W1G A;  2TSS A;  4HJ7 A;  4JI1 L;  1M1K C;  5KND A;  3F8T A;  3HOX B;  2MJ8 A;  4R4I A;  1KAA A;  1AEX A;  4UDU C;  2P5Z X;  4JC0 A;  4C3J H;  1XPO A;  3L9A X;  4A3G B;  2ZM6 L;  2A6E C;  4U68 A;  1TS4 A;  1XJV A;  3GTP H;  1CKN A;  4GN4 B;  5CV5 A;  1PTO C;  3NQI A;  1SYB A;  3J81 c;  4HN7 A;  2CVR A;  4YWK A;  3T13 A;  1N32 Q;  5ELB A;  1HZB A;  3R3O A;  3GQB A;  5JEA H;  2NZO A;  2L11 A;  3DWP A;  2FHT A;  4NDX A;  3K8A A;  1A2U A;  1STB A;  1FJG Q;  4GLA C;  5C3E B;  5CBA E;  5CBE E;  1O7I A;  3VYR A;  1MIU A;  2A1A A;  3BZC A;  5CC4 A;  2LY7 A;  3GD7 A;  2LSS A;  3HFZ B;  3TP7 A;  2ID0 A;  4LF4 Q;  4LFC Q;  1Q46 A;  1CTM A;  4XQN A;  2QKI C;  1VMP A;  2F0L A;  4A3B B;  4X65 Q;  2NVQ H;  1U5K A;  3E0E A;  1YJN A;  3CF5 A;  1Y8P B;  5C44 H;  2XVS A;  3DLL A;  2CHB D;  2NZ1 D;  3S2D B;  1SDF A;  3SR1 A;  5C3W A;  4OL7 A;  1PFM A;  2KCC A;  2A8V A;  2MNA A;  1TWF B;  3RNU A;  1YI2 A;  3DXJ C;  3PGZ A;  3GV6 A;  3RZO H;  4A3I B;  3TBI B;  5T1I A;  2M00 A;  4NP5 A;  1CK1 A;  1UE5 A;  3NWS A;  4FXG C;  3SK4 A;  1JE5 A;  3BS1 A;  4FF4 A;  1WTP A;  4ZCK A;  4XT3 B;  2CFM A;  1K28 A;  3H0G G;  4IQZ A;  2R92 H;  1LYL A;  2WFW A;  2A68 D;  2MO0 A;  5ELD A;  1KLU D;  5ISR A;  3CCE A;  5M3F B;  4AQY L;  1MHW C;  1X3Q A;  1F9Q A;  4LUV A;  2YTY A;  1EQR A;  4GNX A;  1VQC A;  1X3P A;  5FLX E;  1K0S A;  4PZ6 A;  5AFW A;  1LO5 D;  5GAE C;  1NAP A;  2ALY B;  4PV1 C;  3M7G A;  1Q82 C;  4CKC A;  1U4R A;  1TY2 A;  1XMO L;  4RHS A;  1EQT A;  2MFI A;  3S17 H;  5K36 G;  3J7A F;  4BY7 H;  4R8N A;  2ZJR A;  1TQO A;  2QIL A;  4F87 A;  3OYY A;  5EGT A;  1I6H H;  2B63 H;  1SXT A;  1U4P A;  2F1M A;  4DFA A;  5IE8 A;  4YHH L;  1Y1V H;  2GN5 A;  3I4M H;  3M4P A;  3H94 A;  1HNZ Q;  3GTK B;  1LTL A;  2PI2 A;  5IGB A;  3S15 H;  4LFB Q;  4DAP A;  1RTO A;  4A3J G;  1K9M C;  2JA7 G;  5IY0 A;  4KJN A;  3D4R A;  3DMU A;  4BS9 A;  4HED A;  2K5H A;  3PIO A;  2KQ3 A;  2IX0 A; 
#chains in the Genus database with same CATH homology
 3OMG A;  3K57 A;  3EVQ A;  2IWH A;  3NTI A;  1MD2 D;  2E76 C;  3HG9 A;  5C4X B;  1LTI D;  3MA2 B;  1EEF D;  1AZP A;  4K5V A;  1ZYR C;  2B2U C;  1UEA B;  2WAQ B;  1LAB A;  1QCB D;  3Q6S A;  1OXX K;  3K7A B;  2KHS A;  3OIP A;  1TS2 A;  3BVG A;  1SYD A;  4FNF A;  2RDF A;  1CQV A;  1ENF A;  4GZY C;  1IW7 D;  4OIJ A;  2IW3 A;  3S1N B;  3MFG A;  3H3V C;  1DOK A;  1HQR D;  4G7O C;  2WII B;  1LAC A;  2KEC A;  4C3H G;  4K2K A;  3RZD B;  3SEB A;  5G3L F;  1S5F D;  1BF4 A;  4A3F B;  1DXM A;  1A6X A;  3OPO A;  3BZD B;  2EYH A;  3T53 B;  4IFD J;  3KLR A;  4QCL A;  1ZKO A;  5D3I B;  2JA8 B;  5J22 A;  5CGK A;  5BN3 A;  5KIX A;  1TWA B;  1JCK B;  4FF2 A;  2ICI A;  1EY4 A;  1V1P B;  4FYD A;  4IZ8 A;  5IGD A;  2MP1 A;  1YNJ D;  3NHH A;  1JWU D;  5K36 H;  1D2B A;  1T5E A;  1IKM A;  2EY2 A;  1F2M A;  4AYB B;  2O4X A;  1O7Y A;  1B9M A;  1D5Z C;  3EJI A;  2DY7 A;  4KMU C;  4QIW B;  1ZEQ X;  3BYY B;  1CA5 A;  1E2Z A;  1S4Z A;  2D2C C;  5ELF A;  5M9O A;  1S5C D;  3DWQ A;  4B08 A;  1CFM A;  2F0U A;  3AB9 A;  3HOZ B;  4F8M A;  1BCP B;  3FPP A;  4KJO A;  2Z1C A;  2A74 C;  3A7A B;  1F9P A;  1I4P A;  2ZXP A;  4ABN A;  4ULL A;  3KLS A;  1HTL D;  2HDM A;  4C3H B;  2VXW A;  1QB5 D;  4G7Z C;  2BDO A;  3KF8 A;  5DM6 3;  1GUG A;  1TVX A;  1F9S A;  2X6L A;  4C2M B;  1STA A;  5CR3 A;  2CQA A;  5IIF A;  2HQE A;  1KDA A;  1VDZ A;  4IUR A;  1GHK A;  1SE3 A;  2Q8T A;  1C4Q A;  3VR2 A;  1LTR D;  1JQY D;  2F0F A;  1ET9 A;  4WJW A;  3HOY B;  1HCZ A;  1NUC A;  5IGC A;  3BG3 A;  3DEP A;  2D62 A;  3N52 A;  2L12 A;  1PMR A;  1UAP A;  4PQX A;  4DNT B;  4H44 C;  1Y8N B;  3MHB A;  1K83 B;  1HA6 A;  2QEJ C;  3WOE A;  3GTG B;  3S1Q B;  1XTC D;  1WVL A;  1U9R A;  4DK1 A;  4JBW A;  4FXD A;  2HCC A;  2B2T A;  1SNQ A;  2EPB A;  3MXN A;  4P2C B;  4H0L C;  2BDN A;  2KED A;  4QMG A;  2O5J C;  2R93 B;  1A3U A;  3I90 A;  2AWO A;  4G7H C;  1L0Y B;  1A15 A;  1F2L A;  2DNE A;  2WKC A;  3HGB A;  1VF5 C;  1QWY A;  2KOL A;  2K04 A;  1BCP D;  1EOT A;  1ESR A;  1YNJ C;  2B2Y A;  2EY1 A;  2K1B A;  4K2L A;  2RDG A;  4IUT A;  5J1Z A;  4ID6 A;  2SNM A;  4IUP A;  3C46 A;  1W6J A;  1SAP A;  1D1K A;  2LFN A;  1NR4 A;  1DM0 B;  4C3I B;  1CI3 M;  4HMJ A;  3S2H B;  2JE6 I;  4QUC A;  1RKN A;  3T51 B;  1SEB D;  3R2I A;  5M5Y B;  3IFD A;  2FJ2 A;  4A3K B;  1IHZ A;  4IUU A;  4ZUI A;  3MXP A;  4HMI A;  5IT9 E;  4Y7N B;  1BUV T;  5I9P A;  3NK9 A;  3RMH A;  5IT9 L;  2K32 A;  1H9J A;  1EEI D;  1MSH A;  5JPM C;  4ME5 A;  2VB3 X;  1G2S A;  2Q8R E;  2E75 C;  2EYJ A;  4HSP A;  1IYV A;  1F9R A;  1OXU A;  3T16 A;  1J9O A;  3VR4 A;  4I65 A;  3NE5 B;  2PW5 A;  1AP0 A;  3VR5 A;  2RSO A;  1TWG B;  1HPC A;  3J81 E;  1GOZ A;  3KUP A;  3L7Z C;  1WTQ A;  1JOK A;  1TS3 A;  3G7L A;  2B2V A;  3OW7 A;  1EIG A;  2VNU D;  1EZ8 A;  3J81 L;  2WP8 J;  2C5C A;  1T5X D;  3AU7 A;  3ND8 A;  1Z47 A;  1Q3L A;  2XRS D;  1X32 A;  1QJO A;  3D4W A;  4PNY A;  3BYT B;  3CKI B;  3K0Y A;  5C4Z A;  3S16 B;  2SOB A;  4KI0 A;  5DM7 3;  5KGU A;  4XYQ A;  3NWT A;  1HFG A;  4EQO A;  5M5W B;  1LT4 D;  4CJ1 B;  4R9W A;  3R93 A;  3TP5 A;  1FD7 D;  1IL8 A;  4X3S A;  5G3L D;  1I4X A;  3CHB D;  2PZT A;  4LMQ D;  1I4Q A;  1R4Q B;  2B2W C;  2NTS A;  3PIP 3;  2K03 A;  4IUN A;  5I9O A;  4RCO A;  4Z9C B;  1EYA A;  4C3J B;  2BCO A;  1MGS A;  2K5W A;  1B9N A;  1JC7 A;  3GTP B;  2A5H A;  4HR7 B;  1LT3 D;  2B2W A;  5IGF A;  2EYP A;  4ZAI A;  3D6W A;  1GJX A;  1ROD A;  3F2U A;  1EY9 A;  2AQ2 B;  4KY5 A;  3EFX D;  1D1I A;  4KKU A;  2F0T A;  5JEA J;  3NSW A;  1SYC A;  2E2D C;  4HAE A;  3MXU A;  1MI2 A;  4LJZ C;  4F88 A;  2NVQ B;  1PYW D;  5C44 B;  3IFT A;  1G8Z D;  4C56 C;  4XDX A;  3NQT A;  3RZO B;  2JYO A;  5I4D A;  4XTC S;  4DAY A;  4E6I A;  1QOH A;  2NYZ D;  1D5M C;  4K6D A;  1YNN D;  2R92 B;  3G6J B;  3GP7 A;  2R61 A;  4TKO B;  4Q0F A;  5FO9 B;  2HCI A;  1BR9 A;  4TSS A;  5DNF A;  4XXE A;  1WD1 A;  4BA2 I;  3QB3 A;  1SBB B;  5CV7 A;  3DHQ A;  1HRJ A;  1H9S A;  3S17 B;  3ERO A;  4BY7 B;  2R6G A;  5JVG 3;  3SK5 A;  2Q8I B;  1I6H B;  2B63 B;  5TSS A;  1RD9 D;  4MIU A;  5ELC A;  5C5M A;  4C1N I;  1PTO F;  1Y1V B;  3I4M B;  3TP8 A;  1CHQ D;  1DYQ A;  5IGG A;  3PMF A;  3S15 B;  2ENB A;  2AWN A;  2E74 C;  1HHV A;  5C3X A;  3HKZ B;  4X3K A;  1EIH A;  5CMD A;  2M2L A;  1WTW A;  3Q22 A;  5I6W A;  4H7B A;  1U4M A;  2PYK A;  3I70 A;  3MWY W;  1M4V A;  4KD3 A;  1EFI D;  3KK7 A;  3OWE B;  4KKS A;  3BVZ A;  2E2I B;  1JWS D;  5E1F A;  4FF3 A;  5CV8 A;  5D14 A;  2K6A A;  5JAV A;  4YIJ A;  5LHY 1;  1K8O A;  2XSC A;  2K7V A;  1RHP A;  1WTV A;  3D4D A;  3A56 A;  1Z7T A;  4K8J A;  1E2V A;  3FDT A;  1AN8 A;  2L55 A;  1BO0 A;  2DY8 A;  4XT1 B;  5FOB B;  3BVM A;  4CKB A;  2OT2 A;  2K5Q A;  3M7N A;  4FXK C;  1MSG A;  4HSV A;  4LK1 C;  5E4W C;  1G6Z A;  2Z4H A;  4XIG S;  4KHZ A;  3E5S A;  2B2U A;  3SXH A;  4RGO S;  4IUQ A;  3K5M A;  1TS5 A;  2Z8L A;  3PUZ A;  3H0G B;  1V8Q A;  1F77 A;  2WV6 D;  2KA7 A;  3I91 A;  4B9X A;  3RUZ A;  2A69 D;  1O80 A;  2NUC A;  5NUC A;  1SNC A;  1QNU A;  2RDH A;  2XN9 C;  3P75 A;  1ILP A;  1II3 A;  1LTG D;  1EYC A;  1PRT B;  4DF7 A;  1HA5 A;  1JOR A;  1K8M A;  2KCN A;  3NBH A;  2NWG A;  2PPB C;  4RWS C;  1RF2 D;  4A3J B;  1TR5 A;  2JA7 B;  3GTQ B;  3P1H A;  1PZJ D;  3VR6 A;  3HZX A;  1B1Z A;  2NN6 I;  4KN4 C;  2WB1 B;  1Y1W B;  4R8I A;  1YNN C;  3D31 A;  2IT1 A;  5C6A A;  5C4H A;  3SHL A;  5CV9 A;  3D3R A;  4XYO A;  5I2Y A;  1SSO A;  1JOQ A;  4FO2 A;  2JEA I;  3K5L A;  4RKB A;  4RA8 A;  1DCZ A;  2EYM A;  2SNS A;  4EQP A;  2NN6 G;  4CJ2 C;  3OIQ A;  3ONA B;  3GTJ B;  2EVB A;  3VYT A;  1STE A;  4IUV A;  3P7J A;  4BBR B;  1GUN A;  5KEE A;  5KNC A;  2A68 C;  1HXY D;  1B4O A;  1EY7 A;  3H6M A;  2MPM A;  3GTO B;  1SE2 A;  4WOR A;  2MUY A;  3K58 A;  3H91 A;  2J0T D;  4BBS B;  3TZU A;  4N9P A;  1SYF A;  2XWB B;  1D5X C;  3S14 B;  2JA5 B;  4ZRZ A;  1FGB D;  3HP3 A;  1R4P B;  3VYU A;  2D5D A;  1BXT A;  3IKJ A;  1TWC B;  1Y69 U;  1KLG D;  3PV0 A;  2EJG C;  3HOU B;  1W6K A;  3FMC A;  1JB3 A;  1EQV A;  1EWH A;  2JSO A;  2OEO A;  1V1O A;  5KYL A;  3S9W A;  2O2L D;  5JOB A;  2J4X A;  4ZUJ A;  2AUJ D;  3PO2 B;  3MAQ A;  1QG7 A;  2EY5 A;  2RBM A;  2F0P A;  1H9R A;  2F03 A;  4K14 A;  1AZQ A;  2EJF C;  1PTO H;  4CHT B;  1B53 A;  5FKA C;  4ZYS A;  1PRT D;  4IN3 A;  3MVV A;  3CU7 A;  4DN4 M;  3MFY A;  1OXV A;  4OO1 I;  3SE0 A;  1G2T A;  5CV6 A;  1IW7 C;  1JOO A;  1OXT A;  3MTS A;  3Q0A A;  4B9W A;  4O42 A;  1DON A;  1V43 A;  3W3A A;  2EYO A;  2F0I A;  4OO1 G;  2DNC A;  4BA1 I;  3DUZ A;  1B2T A;  2NN6 H;  3GTM B;  1I4H A;  1RDP D;  3FRP B;  4CGY B;  2F0D A;  2WIN B;  2O5I C;  1I4G A;  4MHE A;  5FO7 B;  3MZ5 A;  5FO8 B;  2LMC B;  1ML0 D;  3U9S A;  1PXU A;  4DAV A;  4U67 3;  4KHV A;  5BN5 A;  2PQE A;  1UNS A;  2H4O A;  5HUR A;  4RH6 A;  3U9O A;  1IYU A;  1ESF A;  4PMW A;  1O78 A;  1BNZ A;  1JWM D;  2K01 A;  1U4L A;  2A6E D;  1KTK A;  3Q24 A;  3J7Y W;  3NXW A;  2N88 A;  3GO5 A;  1F2Y A;  2RSN A;  2EY6 A;  3T4A C;  1L0X B;  3K5N A;  2F0E A;  3M3Y B;  2N55 A;  5LL6 S;  1XXG A;  4CJ0 B;  1SE4 A;  2IJ0 A;  4V0B A;  4RGN A;  2HDL A;  5ELE A;  4I7Z C;  1SNM A;  4RKL A;  4RHR A;  1CQF A;  1VMC A;  4ZK9 B;  1CT1 D;  2ZXO A;  1EWC A;  1H9M A;  4OIK A;  5J39 A;  1HTP A;  2C9O A;  4KKT A;  4K6L A;  1SYE A;  3OOC A;  3QIA A;  2F0Q A;  1IKL A;  3NPP A;  2HUG A;  1EU3 A;  3D6C A;  2LS0 1;  2F0V A;  1TY0 A;  4OO1 H;  1H9K A;  3QOL A;  1PFB A;  1STY A;  2F0W A;  1SYG A;  4TRD A;  3TZD A;  4JK1 C;  3UI2 A;  4XQQ A;  2X6G A;  1Y8O B;  2JEB I;  4UAI A;  3A8J E;  1PFN A;  3ERQ A;  4DXG A;  4A3M B;  2F0M A;  3C1E A;  4S3S A;  1J8I A;  1I3Q B;  2L5T A;  3HRZ C;  3I3C A;  3E0J A;  1PRT C;  2KJX A;  1FR3 A;  3WOF A;  1SNO A;  5M5X B;  1A3V A;  4BY1 B;  3IAY A;  3C1F A;  1O7L A;  1XWE A;  4ZKC B;  1HFN A;  2RQX A;  1G29 1;  3RD4 A;  4Q5V A;  4O1N A;  3TSS A;  1ZYR D;  1RCV D;  4PMB A;  1V1P A;  4M8A A;  3M85 A;  3V96 A;  2BA0 A;  3PIO 3;  3EQL C;  1DOL A;  3QOJ A;  2PZU A;  2EYF A;  2G9H D;  1QNK A;  5LL6 X;  3SVM A;  1B50 A;  2NVY B;  4A3D B;  5IGE A;  1NR2 A;  1GUO A;  5E4X A;  1BCP C;  1O7Z A;  3J80 L;  4M1U B;  3I73 A;  1VF7 A;  1E0B A;  1SMY D;  4L6T B;  3QWN A;  5EBD A;  3NUC A;  2FMC A;  3OSO A;  3X3N A;  1SJE D;  2L4N A;  4K5X A;  2AUK A;  3DM1 A;  2KVM A;  3C3L A;  4HCS A;  4ZKB B;  2I07 B;  1MBY A;  3I4N B;  2EYL A;  1OO9 B;  1ENC A;  3NTK A;  3HOV B;  1E2W A;  5HGT A;  3QO2 A;  3NP8 A;  1TII D;  4G57 A;  2FMM A;  3PUX A;  4ZQ3 A;  2BE5 D;  1BCP F;  3DWA A;  3FPU B;  4PMC A;  2MHV A;  4N9T A;  1STN A;  2EXZ A;  3QJY A;  5I2X A;  3P20 A;  4J1M A;  1WD0 A;  4IFD I;  1PZI D;  2F3W A;  3K6O A;  3OWF A;  1SNP A;  3JAM E;  1LTB D;  2F0O A;  5BN4 A;  3JAM L;  2K5D A;  1PZK D;  4FP5 D;  3A55 A;  3L3O C;  2GA4 B;  4IFD G;  2JP1 A;  1CZG A;  1WCM B;  1QIL A;  3SK6 A;  3URY A;  2JXM B;  3KBX A;  3D8G A;  2D9U A;  5FLX L;  5I6Y A;  2OXP A;  1ET6 A;  2FIN B;  3O13 A;  2F0H A;  5EBC A;  1Q12 A;  1XYI A;  3MEH A;  1HUM A;  4DU9 A;  2L0C A;  1D6E C;  3AMU A;  4V19 0;  4DXF A;  4NMZ A;  2R7Z B;  3RLF A;  3SK8 A;  1EL0 A;  1DZ1 A;  3BDC A;  3LX0 A;  4F7X A;  1EY8 A;  2EE1 A;  2F0S A;  1RTN A;  5CV4 A;  1LT5 D;  2F0N A;  2PNR C;  2XRQ D;  5JVH 3;  3HOW B;  1KDB A;  3EA6 A;  4CKE A;  1Q8I A;  4RGT A;  5A35 A;  1BBX C;  4KY7 A;  4QB4 A;  2F0K A;  2SDF A;  2RA4 A;  4KTA A;  1DJR D;  1NCV A;  5EPK A;  2NBF A;  1BQQ T;  3LWE A;  2L1B A;  1DD2 A;  1STH A;  4G4K A;  1GUW A;  4RAU C;  4ZLT F;  1FNW A;  2IX3 A;  5EPJ A;  1SND A;  2A73 B;  1SMY C;  3GV3 A;  2IX1 A;  2QDB A;  1I4R A;  1TKW B;  1UUP A;  1LLR D;  1EU4 A;  2F0G A;  3OMC A;  1PDQ A;  4DGZ A;  2J7Z A;  5D3D A;  5F2D A;  3J7A V;  3NBI A;  3FEW X;  4IFD H;  3GTL B;  4C1N K;  5M3M B;  1KDC A;  2BE5 C;  2B8G A;  3VYS A;  2BA1 A;  4KV6 A;  1M8A A;  5COR A;  1OXS C;  4FF1 A;  4L8J A;  1A2T A;  1KNE A;  2EZV A;  4H13 C;  3S1M B;  3E6Z X;  3C2P A;  4A93 B;  1GXD C;  2K05 A;  1GHJ A;  4KN7 C;  1S5E D;  3K5O A;  2F4I A;  4KK7 A;  2F3V A;  1PLF A;  2WKD A;  1BDO A;  2XIW A;  3IL8 A;  2PCF B;  2PZW A;  5EKK A;  2PMZ B;  5C5L A;  4DNR B;  1WTX A;  1SFO B;  1PTO B;  5EKL A;  1JIC A;  1RJT A;  2AQ1 B;  3X3M A;  1CHP D;  3QG1 A;  1S5D D;  1XX8 A;  1HUN A;  2OF1 A;  2PW7 A;  1STG A;  2G9D A;  2CW0 D;  1JE4 A;  5T1G A;  2FFK B;  1H9S B;  3TP6 A;  2L9H A;  4KY6 A;  3SDZ A;  2I46 A;  1EYD A;  2AQ3 B;  2XNA C;  5COY A;  2RVL A;  1LV9 A;  1I50 B;  3CQZ B;  3WDN A;  2EJM A;  3K59 A;  4L63 B;  1ZXT A;  4ILW A;  1VCI A;  4NKL A;  5JPN C;  3A54 A;  5IOC A;  1S5B D;  4QUF A;  1Q1E A;  4C3I G;  2RKS A;  2F0J A;  4OGQ C;  4EVO A;  1QE6 A;  3MXG A;  2TMP A;  2VUM B;  1FYC A;  2A6H D;  3TN2 A;  3V05 A;  2YYZ A;  5JJZ A;  4K5W A;  1SJH D;  2E2H B;  2A69 C;  4LAA A;  3TDQ A;  1Z6H A;  2QCP X;  2B2T C;  1EY0 A;  3LNN A;  4RGM A;  2V4D A;  2H1E A;  1ONL A;  4WFN 3;  5EKI A;  1EY5 A;  4X3T A;  1CZW A;  3R8B A;  5K5P A;  1LTS D;  3I72 A;  1BOS A;  3M4Y A;  3PUV A;  3DEO A;  1GUT A;  4TQU S;  3S1R B;  2K33 A;  2M9V A;  5C0X I;  1LTA D;  5DEH A;  2SEB D;  3PUW A;  2B2Y C;  5E3F A;  1DOM A;  2NVT B;  1JR0 D;  1R9T B;  2EDG A;  4MN3 A;  1AFP A;  1CM9 A;  2NVX B;  5EPL A;  1TWH B;  4FVM A;  2KEE A;  5C0X G;  5C4J B;  2IL8 A;  2Z4I A;  1FNU A;  1PTO D;  4KD4 A;  2MGS A;  1B3A A;  3I4L A;  5D65 A;  4DA2 A;  2IPK D;  3N6R A;  1WTR A;  4QF4 A;  4NW2 A;  1TU2 B;  4BWG B;  2VB2 X;  1C8C A;  4EQN A;  3MC0 B;  2EOT A;  3OHX C;  3BDO A;  1NSN S;  1ILQ A;  2E2J B;  4HTH A;  5FK9 C;  4J8Q A;  1TT2 A;  3TME A;  2QF7 A;  3I8Z A;  5A2Q E;  2X69 A;  3ZYY X;  3R2T A;  3PO3 B;  3FKI B;  5A2Q L;  3ITP A;  2KUM A;  2LKV A;  5KRU A;  3Q23 A;  2ZXR A;  2Y0S B;  1FNV A;  4RCN A;  4DK0 A;  4C3J G;  4RFB A;  1ICW A;  3HS0 C;  4WRD A;  3VR3 A;  4X3U A;  4A3E B;  5JEA G;  1I6V C;  2CW0 C;  4J6H A;  3CRL C;  1AW7 A;  2B2V C;  3VA7 A;  4IAL A;  3KBG A;  1EY6 A;  1GUS A;  2ZT9 C;  3A7L A;  2ICE C;  3KLS X;  3M4O B;  2XWJ B;  5KNB A;  3VA5 A;  1EZ6 A;  2NTT A;  2BOS A;  1C48 A;  2NB0 A;  1A3T A;  4K8I A;  2PO4 A;  1LTT D;  5EQ0 A;  3W2D A;  3HEJ A;  3T56 B;  1KAB A;  3CRK C;  1KNA A;  3BDL A;  3NTH A;  5C0X J;  3LWU A;  1CA6 A;  1Q1B A;  3A8K E;  2A6H C;  3V2T A;  5DAU A;  1F2Z A;  4XQJ A;  1ENA A;  3FVQ A;  4HCE A;  5C0X H;  2YU9 B;  2WAC A;  5CYU A;  1B44 D;  2B39 A;  2JA6 B;  2R3Z A;  1Q90 A;  3H09 A;  1LT6 D;  3A8I E;  5EJW A;  1PRT F;  2K28 A;  1G91 A;  4OHJ A;  4EGV A;  3J80 E;  3ND9 A;  2B8F A;  4CBV A;  1WTO A;  5IOD A;  2DN8 A;  1HQM C;  5KYI A;  3PUY A;  4ODG A;  2TSS A;  5KND A;  3HOX B;  2MJ8 A;  1KAA A;  1AEX A;  4UDU C;  3L9A X;  4A3G B;  2A6E C;  4U68 A;  1TS4 A;  5CV5 A;  1PTO C;  3NQI A;  1SYB A;  4HN7 A;  2CVR A;  3T13 A;  5ELB A;  3R3O A;  3GQB A;  5JEA H;  2L11 A;  3DWP A;  2FHT A;  4NDX A;  1A2U A;  1STB A;  5C3E B;  5CBA E;  5CBE E;  3VYR A;  5CC4 A;  2LY7 A;  3GD7 A;  3TP7 A;  2ID0 A;  1CTM A;  4XQN A;  2QKI C;  1VMP A;  2F0L A;  4A3B B;  1Y8P B;  2XVS A;  2CHB D;  2NZ1 D;  3S2D B;  5C3W A;  1SDF A;  3SR1 A;  4OL7 A;  1PFM A;  2KCC A;  1TWF B;  3DXJ C;  3GV6 A;  4A3I B;  3TBI B;  5T1I A;  2M00 A;  4NP5 A;  1CK1 A;  3NWS A;  4FXG C;  3SK4 A;  3BS1 A;  4FF4 A;  1WTP A;  4XT3 B;  4IQZ A;  2A68 D;  5ELD A;  1KLU D;  5ISR A;  5M3F B;  1X3Q A;  1F9Q A;  1X3P A;  5FLX E;  5AFW A;  1LO5 D;  1NAP A;  4PV1 C;  3M7G A;  4CKC A;  1U4R A;  1TY2 A;  4RHS A;  1EQT A;  5K36 G;  3J7A F;  4R8N A;  1TQO A;  2QIL A;  4F87 A;  5EGT A;  1SXT A;  1U4P A;  2F1M A;  4DFA A;  3H94 A;  3GTK B;  5IGB A;  4DAP A;  1RTO A;  4KJN A;  3D4R A;  3DMU A;  4BS9 A;  4HED A;  2KQ3 A;  2IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...