1ZEQX

1.5 a structure of apo-cusf residues 6-88 from escherichia coli
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
b'METMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusF
publication title A Novel Copper-Binding Fold for the Periplasmic Copper Resistance Protein CusF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zeqX01
2QCPX 2VB2X 3E6ZX 2L55A 1ZEQX 2VB3X 3TDQA
chains in the Genus database with same CATH superfamily
4DK1A 4A76A 4DV6Q 1WCMH 5CBEE 3CD6A 5JJLA 2ZTEA 3M4QA 3IAYA 3CPFA 1PTOC 3DLLA 1AEXA 5AJ3L 1X3QA 1Y1WB 1YHAA 4CKCA 5M5XH 4A3JB 1CTMA 4BWGB 5D3DA 3BDLA 3J7ZC 5FLMG 3VA5A 4PQXA 3SGIA 4Y7NH 3K81C 1TWGB 1PH7A 1BXTA 2AUJD 2VQEQ 1D5XC 4BY7G 3I91A 1LT3D 2K32A 4GN5A 4RG1A 1Y8OB 4J15A 5HURA 5GAHC 4GKJQ 1V9PA 1TWAB 4C56C 1BNZA 4IUTA 3I55A 4A3FG 3E3XA 2PZWA 3UE1A 4ZUJA 1H9KA 4ZQ3A 3EROA 3NBHB 1IYVA 2YTXA 3PUVA 4YCVA 1IYUA 1TT2A 3S24A 4KY6A 4JYAQ 5LMNL 1W6KA 2KA7A 3BZDB 1SNDA 4DV3Q 4DV0Q 1EFWA 4JI4L 5H1SE 1SBBB 2YTYA 1I4XA 1O78A 5J3BA 1KL9A 1EY8A 1SMXA 2NVTH 5KEEA 1EIHA 2F0FA 2NVYH 4ID6A 2SNMA 3PMFA 5LMUQ 4QGUA 5C5MA 1NBWA 2J0TD 3KJPA 3OOCA 5DLQE 4MZ9A 5FLXE 2I5LX 5CV6A 1KTKA 3EJIA 5CV7A 1EFID 4KI0A 3CC7A 4X65Q 4YWKA 5IT9E 3NQIA 1SE3A 1RL2A 4EQOA 2PI2E 5FKAC 5GADC 2HCIA 2DNEA 3LX0A 3J80E 2EYFA 1ENCA 1XWEA 1YJWA 4IUNA 4B3RL 4XTCS 5FLMH 2ZTDA 2L9HA 3VA7A 2R93G 1IBLQ 4C3HB 5E4XA 1E1TA 2Z1CA 3TP8A 3KLRA 1TS4A 2QEXA 4L5TA 2ZT9C 4R4QA 3HKSA 3CCJA 1H9JA 3GTQB 2JXMB 2YV5A 4EGVA 2E74C 5I9PA 4A3FH 4DGZA 3NK9A 4X62L 3Q8DA 5M3MG 4JV5L 3OIQA 4LF5Q 3W3AA 4A3CH 1R9TB 1LTGD 3PUYA 3TZDA 3OYYA 4HMJA 1E22A 2HIVA 5C3XA 3G48A 2BH8A 3UDGA 3I4LA 3MEFA 3OW2A 5E7NA 2R7ZH 4JI6Q 3GTLB 4BY1B 2WFWA 2ZXOA 4P75A 3EBEA 2A69C 4FXDA 1ESRA 3MWYW 1Q12A 4K5XA 3S2HB 1IHZA 3IFTA 3NTIA 2JA9A 1Q3LA 1BF4A 1B1ZA 2NN6I 2F0UA 3E0JA 1LV9A 2VW9A 5M3FH 4CGYB 3DMUA 4LF4Q 1VQBA 2AQ1B 1WCMB 2Q2IA 1K83H 4R9WA 2TSSA 2IJ0A 2JA5H 1SYDA 5EKKA 4DNTB 1A15A 1IL2A 3S1NH 2MP1A 4A3LH 1IL8A 1GO3E 2ZXPA 3HG9A 3RZDB 1EYAA 3MXUA 3STBC 2Q8IB 1UEAB 2RVLA 2K5NA 1K8OA 3PUXA 1W2BA 4Y7NB 1PRTF 1QZHA 2B2UC 2K28A 1XPRA 3CHBD 2RDFA 2IX3A 2Z6KC 1I4GA 3GTGB 3I4OA 4GN4B 1Q8IA 3AQQA 4YHHQ 4XQNA 1SNMA 1VQMA 3OTOL 5IP7H 3BDCA 1M4VA 3LWEA 5IODA 1DYQA 1KQSA 2J4XA 1I50H 2K52A 3BZKA 3H09A 5IYDH 3TN2A 2HIXA 3HS0C 2KVMA 1I3QH 3D0FA 2RKSA 3C3LA 3R93A 3SE0A 2L11A 4IOAA 4LJZC 2NVTB 4EQ5A 4UDUC 4L5RC 4HMIA 1BUVT 1S5BD 5C5LA 1ZYRC 3RN2A 1A2UA 4JCVE 2EJMA 4YWMA 1F9SA 3J81E 4TKOB 1AZQA 2N49A 4DR4L 3OHXC 2KBNA 5FJ8G 1G8ZD 4HJ9A 4KHVA 3PSIA 2QILA 4CDCC 1AE3A 2KHIA 3C1FA 1QVGA 1SNPA 4NP5A 2KCCA 3PO3H 4CKBA 1QE6A 2DN8A 2B2YA 2VQFL 1B70B 4J6HA 1Z9FA 1WJJA 1S4ZA 4B9WA 4POGA 4C3JG 1FNUA 2DJFC 3AB9A 4X64L 4BBSH 4LF9L 2BH2A 2QKIC 3T51B 1E0BA 3NWSA 1PH4A 4OONA 1N34Q 2LS01 4FF4A 3S16H 4DAYB 2F0JA 2FJ2A 2KJXA 1YNJD 2L0CA 4HCEA 4RGMA 1HPCA 4QUFA 3TS0A 1K73C 4ZAIA 1SE8A 3T56B 1VQFA 2FFKB 4MNOA 2NVQH 2MGSA 5ELNA 3UE0A 3V05A 1O7ZA 2KUMA 4PG3A 1JQYD 2NUCA 2BOSA 5CGKA 3T1HL 4DAYA 4LK1C 1SJED 1S5DD 4WFN3 4C3IB 4DV1Q 3VR5A 5CV8A 3PO2G 2QDLA 2F0VA 2F3VA 2JA6H 3HKZE 1K8MA 3F1ZA 2WAQB 2E2IB 1VQ5A 3FDTA 3D6CA 2CKZB 2HHHL 4LF7L 2AQ2B 2JA5B 1Q90A 2OT2A 2WB1E 1TWHH 3S1NB 4A3IH 2XWBB 4KMUC 3A8KE 5I4DA 2XRSD 4DAPA 1X3EA 3CCUA 1HZ9A 4OIJA 2D9UA 4IFDJ 2F4IA 1Y1VG 1XTDA 2VY3A 4QMGA 5C4HA 1BCPD 1N8RC 2M9VA 1XNQL 4L6TB 4DV4L 3CCRA 4DXGA 3X3NA 1HNWL 5M5YH 1L1OC 1QVCA 1J5EQ 4ZRZA 4RCNA 1GUTA 1C0AA 4OWXB 1RKNA 1QB5D 4R4IA 1C7YA 4DFAA 2IPKD 1EZ8A 4CBVA 1CFMA 2GVBA 5E1FA 4EVOA 3FKIH 1STEA 1CK1A 5CORA 4K6DA 1SLJA 1I3QB 1VQHA 5C0XG 1VQNA 1Q81C 2YU9H 2PPBC 1EEFD 2OTJA 2EJFC 5F2DA 4RHRA 1HNXQ 3PO2H 1NSNS 2D0OA 1DOKA 1TQOA 1IW7D 3E6ZX 1OO9B 1DCZA 5C44G 3IFDA 1CZWA 4BA1I 1VQ6A 3S14H 4DR2Q 4JI7L 2EYOA 2Z9HA 4YIJA 4UHVA 1R4QB 1EWCA 1ENAA 2CW0C 1B3AA 4HR7B 4X66L 2UXBQ 2EE1A 1UWVA 2H1EA 4CDDC 1GVPA 4F88A 1M90C 3J80i 3RD4A 1PH5A 3VYRA 3CC2A 2B63G 2EDGA 1A3VA 4ABNA 1K8AC 1GXDC 2HUGA 1SNOA 1TWCH 2LXKA 4GS3A 4YWLA 3HOWH 1WFQA 4JK1C 4DXFA 2PCFB 3R2TA 2CQAA 4CDFC 1Y1VH 2SOBA 4BBRH 2Q2HA 2F0KA 1JC7A 3M4OB 1X9NA 1K9MC 5I2YA 2VUMG 1Y1WG 3OW7A 1K28A 1FJGL 3S16B 3DWPA 4A3JG 4DPGA 2JA7H 5JAVA 1PTOD 5ELOA 1PRTB 3A0JA 4A3GG 4DV6L 2PW7A 2NVQB 2SDFA 3CMEA 2VQFQ 2ATWA 1MJCA 1U4MA 5FO8B 4GNXC 5KGUA 4RMFA 5C0XH 1FYCA 1PFBA 3KF6A 5IP9H 1VQ7A 2NVXH 3M4YA 4A93H 3K5LA 1XXGA 3NE5B 4A3MB 3RZOH 1JT8A 1VQEA 1Q86C 3SEBA 2EQSA 4GLXA 5ELEA 4H13C 3FRPB 2D62A 2N55A 4ZUIA 3BG3A 3RLFA 2MPMA 4O2DA 1C9OA 4A3DB 4GKJL 1AN8A 4TQUS 2PI2A 1PLFA 3W2DA 2B63H 1EIFA 2XN9C 2OQKA 1A6XA 2LFNA 1HQMC 2WIIB 5IGBA 1PMRA 1Y8PB 1GHKA 2F0IA 3S1RH 3HOVB 2AHOB 4HN7A 4DV3L 3M7GA 4CJ2C 4DV0L 2Z6BA 1HRJA 4OO1G 2M00A 1GM5A 1O7LA 2HHHQ 1SJHD 4LF7Q 1U4RA 4BXXH 3CRLC 4FF3A 2VUMH 1B2TA 5IIFA 1W6JA 2A6EC 2MO0A 2RSOA 1MKHA 1O7IA 1P16A 3RUZA 1B3QA 1X65A 5KYIA 3K58A 3K7AB 1W3SA 1G291 3DEOA 3TBIB 2B2TA 3HFZB 2JA8H 2EY1A 1SSOA 1FGBD 4FXGC 1T5XD 5FK9C 3PCOB 4YCWA 1V1PB 1E2VA 3CRKC 4GN3B 2YU9B 1SE4A 1AE2A 2B2VC 1XNQQ 2IY5B 3EFXD 4TSSA 4DV4Q 1ESFA 4C2MB 1PH3A 4A3EH 4GZYC 3JAMc 4N9PA 5BN4A 2K5HA 4ALPA 5LMNW 4IN3A 1VMPA 1V1PA 1UNSA 1WTPA 3T13A 2MO1A 1FVIA 2KHJA 3D31A 1IBMQ 3K0XA 4GOPC 1WTHA 1RD9D 4N8FA 2O5JC 4RGOS 4POFA 4DKAC 4TRDA 1TY0A 3AU7A 1SN8A 2QEJC 3ULPA 3W5OA 3NHHA 4DK3C 1H9SB 1LTID 4JI7Q 3OWEB 4LUZA 2B2VA 3G6JB 2NTTA 2Y0SG 3TEHB 2A69D 1XNRQ 4JI6L 1L0YB 2BE5C 4HIOA 1AW7A 4GOPB 3OMGA 3K7UC 1BR9A 1SR3A 4IPDA 5CR3A 3U50C 2QDBA 1H9SA 1PH8A 5J22A 4A3BH 4LF4L 5JEAG 3VYTA 2EYLA 5KNBA 3KUPA 3HOYH 3STBD 1Z7TA 3KF8B 4FF1A 2RDHA 2Z4IA 3F2BA 1O7YA 4OXPA 5DM63 2NVXB 4P73A 4QB4A 3EA6A 4A93B 1X56A 1SYEA 2L55A 1YHBA 3M3YH 5C0XI 5A2QL 5L37A 3CF5A 1VQCA 2R92G 3A8IE 3R3OA 2DJGC 2E2JB 1SYBA 3KF8A 2L4NA 2O4XA 4Y52H 4P74A 3O13A 1GKHA 1YBYA 4R4TA 1Q1EA 4DK0A 5CBAE 4P71A 3K5NA 1Q82C 4YHHL 1E7ZA 3B6YA 3I4NG 2UXDL 2PZTA 3KK7A 1OXUA 3P75A 1PFSA 2K5VA 4IJHA 3H3VC 3NTKA 1KXLA 1RDPD 1FR3A 3G4SA 1VQ4A 5KNCA 1GUWA 3I4MH 5C4JH 2IHEA 1WVLA 4K5WA 3G71A 3H91A 1F2ZA 4IOCA 1ICFB 2OXPA 3P7JA 1O80A 5K36G 1ZYRD 4IO9A 4IALA 4U68A 3BYTB 2HDLA 4IZ8A 2FXQA 4OL7A 4PV1C 5D3IB 4IFDH 4NMZA 3N6RA 5CV5A 1EWHA 5BR8L 4PNYA 2DGYA 5JEAH 3BS1A 2K6AA 2LSSA 5I6YA 2JP1A 1KC8C 1CHQD 1QUQB 3HKZB 1EQTA 1DGSA 3E5SA 4K8IA 3L9AX 4AH6A 3RMHA 1EY9A 1VQAA 3BJUA 1LTBD 4ME3A 4KD3A 4HJ5A 2CH4W 4A3EB 2I46A 2F0LA 3HEJA 4CDEC 5JJIA 1BOSA 2WB1B 3MFYA 3DM3A 1CUKA 2EYMA 4NW2A 5KNDA 5EAYA 1QUQA 2QW7A 4GLVB 3WOEA 4DUZQ 2EIFA 1PYWD 4HAEA 4MN3A 1N34L 3D4WA 1V1QA 1EY4A 3I4NH 1RCVD 1EIGA 1SXTA 1YJNA 4QUCA 1XX8A 4H0LC 1KAWA 3BVGA 2WAQG 4LUVA 2I5MX 2EPBA 2CQOA 2VB2X 2NBFA 2VL6A 2F0HA 4U673 1FNWA 3JAML 4BY7H 1STYA 4DV1L 5C0XJ 3SK6A 1DM0B 4LFCQ 1HZAA 1LT6D 1EQRA 2E8GA 1HA6A 1I6HB 1A3UA 3QOJA 3T4AC 3HOXG 1KD1C 3HOZG 1PVOA 1FGUA 1SAPA 1JORA 1BKBA 1A63A 3HOYB 1KLGD 3BVZA 2NB0A 1TIID 4KK7A 3S2DB 1HZCA 4WJ4A 2F4VQ 1HR0Q 3U58A 1JOOA 4AQYL 3MHBA 4ULLA 1X55A 5EPLA 4YY3Q 4ME5A 2F0QA 4JPBW 2CH4A 4JOIA 1DJRD 1STGA 1E3PA 3Q6SA 1JCKB 1N9WA 2XNAC 1J5EL 1NTGA 3EN2A 3NPPA 1EYGA 3PUWA 2PMZE 1QWYA 3VR6A 3UDXA 3V2TA 3ERQA 4APVA 1PA6A 2K5WA 2KQ3A 3HZXA 5M5XB 4R4OA 1KRSA 2ASBA 3PF4A 3HP3A 2R93H 3KYHC 5IYBG 3Q24A 5C4JB 5JVH3 3I4MB 4A3KG 1Z47A 1D8LA 4H44C 4UAIA 3QO2A 1HNXL 4NXMQ 5CYUA 2UXCQ 5IGFA 5M3MH 2UXDQ 3NTHA 1BVSA 3T16A 5EJWA 5JVG3 4R4CA 4DR2L 4FNFA 2CW0D 2Q8TA 1HUMA 5JPMC 3HOUG 1S40A 3J7AV 1X3FA 3U4ZA 2B2YC 1EL0A 2UXBL 1ILPA 1OXTA 5EPJA 4LF8Q 1H95A 4IFDI 3OMCA 1EQVA 1SRUA 2R61A 4OIKA 1VQ9A 2NVYB 1PH9A 1YI2A 2DY7A 1BDOA 3P20A 2TMPA 2L1BA 1V43A 2MFIA 1MJEA 5BR8Q 3MFGA 1SMYC 1NJIC 1V1OA 3GTJH 4JBWA 3U9SA 4XYOA 4F7XA 1YIJA 4A3MG 2PO4A 4RKLA 4Z9CB 3N52A 4B3TL 3NUCA 2RSNA 2F0GA 4L5SA 1VS0A 3GDEA 1Q1BA 4L5QA 1PV4A 2EYHA 2NYZD 4BY7B 2JEAI 4WJ3M 3KOJA 2R7FA 1DZ1A 1VF5C 1F9RA 1LLRD 3GP7A 3R2IA 3KBGA 4AYBG 4A3FB 1OXSC 2K5DA 5JJZA 4IQZA 4RGNA 4OGQC 1I6VC 2KCTA 1VQKA 3HOUH 5C4XG 1LT4D 3CC4A 4B9XA 2B8GA 4B3SQ 4RKBA 4DN4M 1WTRA 1ZXTA 3TP5A 4RGTA 1ET9A 1WTWA 3GO5A 2R7ZB 2VXWA 1CQFA 1X32A 4L63B 1CI3M 3GTKH 4OHJA 2KENA 4NKLA 4ZYSA 2ZM6L 4DR7L 1GJXA 1TY2A 3DXJC 3K6OA 1WTVA 5M3FB 3K80C 1PHJA 3H0GG 3GV3A 1STAA 1JWMD 2A6ED 2I07B 4GLAC 1K83B 5FJ8H 2F0TA 1UE7A 2MHVA 3TSSA 3PUZA 4WORA 2RHQB 1B9NA 2I0QA 5C3EG 3S1QH 3TP7A 1BCPF 1BQQT 3IRBA 3ICEA 2E2HH 2F3IA 2Q2TA 3V96A 1WTOA 4AQYQ 2R93B 3DWAA 4QL5A 5FLXc 3BDOA 5JEAJ 4C3JH 1AFPA 1KDAA 1EYDA 5IT9c 1A2TA 4PZ6A 1KHIA 1RHPA 4HJ7A 2SEBD 3F2CA 2EY5A 3ZYYX 1B53A 1YNNC 3J80c 2NZOA 3CCEA 4R8IA 1CZGA 1F77A 3IKJA 5ELCA 3NEMA 2LXJA 4FF2A 1MSHA 3VR3A 4V0BA 1I50B 4QJFA 1IBML 4S3SA 1M1KC 4XQJA 1D1KA 2Z0SA 1LO5D 3CU7A 1E1OA 3WDNA 4EX5A 3MAQA 3WOFA 1EIYB 4IPGA 2A74C 1EU3A 3Q22A 1ICWA 5C6AA 5EGTA 3A5UA 1DOMA 1UE6A 1A62A 2BE5D 1JB7A 4HJAA 2K5QA 1XNRL 3A55A 4J8QA 3BVMA 5IE8A 1KIXA 3MXPA 4UY8C 1QG7A 1PZID 3LNNA 4FP5D 4DNRB 3DWQA 1Y69U 1PXUA 5J1ZA 5I2XA 3PIP3 4DV7Q 5LHY1 4H7BA 4YCUA 1XPUA 3PO3B 1PYSB 1G2TA 1PRTC 3PIOA 4IPHA 4CKEA 3D8GA 2A19A 5M5WH 5IY0A 5ELFA 3ULLA 5D65A 4A75A 1PH2A 3CCMA 4BBSB 4X3UA 1DXMA 2F0OA 1PTOF 2F03A 5DNFA 4K2KA 3KF6B 1S5FD 3QB3A 4PMCA 1EQQA 3HGBA 3FPPA 2UUAL 3I70A 2Y0SE 1FL0A 4B3TQ 2CCZA 1ASYA 3U4VA 3PF5A 3M7NA 1JWUD 2YYZA 3WWVA 1ET6A 4RA8A 2Q2UA 1WOCA 1HQRD 4EQPA 3I8ZA 3GTKB 2F0PA 1EZ6A 1XMQQ 4Q5VA 1YEZA 2JA6B 2RF4A 3D4DA 5C44H 1JOQA 2AMCB 4XQQA 4HSPA 3S9WA 1QVFA 3FPUB 4MTKA 4HCSA 3NXWA 3X3MA 1A8VA 2B2TC 3P1HA 5EQ0A 3RLOA 1NR2A 1TWHB 4A3IB 5IYCG 4HTHA 4K0KL 4KV6A 3UDIA 1I4QA 1LT5D 3QJYA 2E2HB 3ND8A 2F0WA 2ZM6Q 4DR7Q 1E24A 3OSOA 3ULJA 2CWAA 2KEEA 4LFBQ 1H9MA 1STHA 4JI2L 1Y14B 3J81c 1NNXA 2GVAA 4JI0L 3SK8A 1LTSD 5FOBB 5M5YB 3ND9A 1L0XB 1SYCA 2EZVA 3GTOH 1SNQA 3VYSA 1Y1WH 5LL6X 3J7YW 2XIWA 4A3JH 1SEBD 5DEHA 4P72A 3SHLA 4DR5Q 4C3HG 1ILQA 2MQHA 1XPOA 4A3GH 1IXRA 1CT1D 3CPWA 4DUZL 1MGSA 4ZLTF 2R7DA 3FKIB 1PTOH 1SDFA 3QWNA 1WI5A 5KRUA 4R1JA 1L2FA 4X3KA 3A7AB 1EWIA 3PO2B 2PMZB 2E2DC 1U9RA 1X54A 3T1YL 3H3VH 1EY5A 5IT9L 3S14B 3J7A5 5EBDA 3L2PA 1EEID 5GAGC 3D6WA 2UU9Q 2A68C 2A1AA 2DUDA 2H5XA 5NUCA 3D3RA 4LFCL 3FHWA 3K5OA 5EPKA 5G3LD 2NN6G 3SVMA 1GHJA 4BY1G 5IYCH 1RIPA 3L3OC 2WKDA 4RWSC 5E3FA 1JE4A 5FO7B 2ALYB 1PH1A 1TWCB 4KJOA 3HOWB 3MXNB 4IPCA 2F0NA 4KY5A 4OO1H 1Y1VB 4BBRB 1WCMG 2SNSA 2ZJPA 2GA4B 2UUBL 2FINB 5LL6S 5GAEC 1SYGA 2F4VL 1HR0L 4XDXA 4O0AA 3AFQA 4L8JA 2B2WA 5IGGA 1LTTD 5EKIA 1BCPB 2WAQE 4YY3L 3LWUA 4K14A 5C3WA 5CMDA 3MXNA 1BBWA 2AKWB 1PFMA 4IURA 1D7QA 2JA7B 1NR4A 2PW5A 1EY0A 3BU2A 4KY7A 4EQNA 3L0OA 1GUGA 1KDBA 2E76C 4DU9A 4DR1L 4O42A 1N33Q 1E2WA 2HQLA 1OXXK 2P5ZX 1VQLA 2IWHA 1NE3A 1XTCD 1LABA 4E6IA 3JAMi 1H9RA 3I3CA 2WINB 1XJVA 2OTLA 3RZOB 4LAAA 2N88A 4JI3Q 2K14A 4FO2A 4JVZA 5EKLA 5T1GA 1HHVA 1D5MC 3J7AF 3K5MA 1CSQA 4G7ZC 3RN5A 1XYIA 3F8TA 1YITA 4K5VA 2UUAQ 5IOCA 1KNAA 2K75A 4FDBA 4WRDA 2EVBA 2G9HD 2NTSA 4B08A 4NXML 4JI8L 3Q23A 4KLKA 2AWNA 4MIUA 2EXZA 2UXCL 3GTLH 4NPSA 4BY1H 2B63B 5CV4A 3SXHA 3S2HH 1FNVA 4LF6L 3ONAB 3SK4A 3S1RB 3DUZA 4N9TA 3W1BA 4LF8L 4XIGS 2K05A 5HGTA 2DY8A 3D4RA 2EY6A 1TS5A 2RQXA 4DUYL 3TRZA 3GTOB 3TP6A 2VUMB 1D5ZC 4HIDA 3RNUA 2WP8J 2LMCB 3A56A 3RZDH 2JQOA 2DNCA 1G91A 4K0KQ 1SMYD 5E4WC 4A3GB 1RTOA 2JSOA 4J1MA 4JI1L 2K1BA 1S72A 1J6QA 2JA8B 3ERSX 2B39A 1CM9A 4JI2Q 2F0DA 3GV6A 3GTGH 1PTOB 4JI0Q 2PQAB 1YVCA 4XT1B 3FMCA 1K3RA 4I7AA 4ILWA 3I7FA 5ELBA 3J81L 4A3CG 2WKCA 4N8X1 4K8JA 2R92H 2PQEA 3EVQA 2A6HC 1Q8KA 3CCQA 1F9PA 4JBKA 2PQAA 4G7HC 1Z6HA 3KLSA 4QY7A 3H3VI 4KN7C 2JK8A 3C1EA 1VQGA 2AWOA 2R7ZG 4I65A 2R3ZA 4LWCA 1U4PA 1NMGA 3NBHA 1UAPA 4C3IG 3K8AA 3K0YA 1RF2D 1STNA 3M4PA 4QQBX 4C1NK 4DF7A 1GOZA 4CJ1B 4KJNA 4MTNA 4B3SL 5M3FG 5IGEA 3T1YQ 1HZBA 3DM1A 3C46A 2F3WA 2I5HA 1A3TA 4ZKCB 2C9OA 1RTNA 1JJ2A 1NAPA 4JOIC 3W1GA 2JA5G 1IYJB 5K36H 4A3LG 1EY6A 5COYA 5CC4A 3AMUA 4OO1I 4JG2A 2CVRA 2N8NA 2D0PA 3TZUA 4DV5Q 1F2LA 2K03A 4A3BB 3H6MA 3I72A 1S5ED 3OIPA 2E5LQ 2L12A 1CQVA 1VQPA 4P2CB 3LGJA 3GD7A 4AYBE 1V8QA 3PQIA 4KKSA 1JMCA 2UUBQ 1N32L 1PYBA 4QIWE 5TSSA 2JJQA 4RH6A 5IP7G 3M3YB 4PMWA 1MBYA 4CJ0B 3NWTA 1YHQA 2Z4HA 4JI5L 5DAUA 5IYDG 1YNND 5I6WA 4JW0A 1ONLA 4DR1Q 5GROA 2JYOA 1QZGA 2HDMA 5ELDA 1IKLA 1B8AA 1K0RA 2BCOA 2J7ZA 4KHPQ 2BDNA 3GTMH 4C3IH 1IZ6A 2O2LD 4HJ8A 1QNKA 1U5KA 2PYKA 1VQJA 4NXNL 4DV2Q 1QCBD 4I7ZC 1TXYA 2IX1A 3CW2C 2QA4A 2E2IH 1WD1A 1AP0A 2ICIA 5A2QE 2Y0SB 1PDQA 4TVAB 1UE1A 1VF7A 1J9OA 4JI8Q 5GQOA 2UUCQ 1JJGA 2VS1A 1D1IA 4K2LA 1JR0D 3HRZC 1LUZA 3U9OA 3HOXH 1BBUA 3PO3G 2X6LA 2MUYA 3HOZH 1HFNA 2D5DA 3E9IA 1I94L 4LF6Q 3CP0A 4OEMB 4B3ML 1DONA 1ENFA 3G6EA 1SFOH 1TR5A 2XGTA 4F87A 4BBSG 4PZ7A 1VQ8A 1PRTD 2IT1A 3M9BA 3FEWX 1PFNA 2A5HA 4DUYQ 3ZJYC 4DV7L 5AJ3Q 1Y8NB 4JBJA 4R8NA 3J81j 2R92B 4X6AH 3DEPA 4HIMA 1JOKA 3TQYA 4JI1Q 5JPNC 1TS2A 3JC66 2RA4A 2AUKA 2GN5A 1NCVA 1B4OA 2C35B 3I4NB 4ZK9B 2OCEA 5C4ZA 1E2ZA 2JA6G 1SYFA 2B2UA 2E75C 2PZUA 5IYBH 2Z6KA 3I56A 1T9HA 4A3DG 1II3A 3TMEA 5LMNQ 4A3KH 4QCLA 2FMCA 1M8AA 4UPAA 2EJGC 2V4DA 3TREA 1R4PB 5D14A 5IWAL 4JI4Q 1K3BC 4ZCKA 4A3IG 3MC0B 1XMQL 1GUNA 2R6GA 4DA2A 3RLNA 1A0IA 1X3PA 4MHEA 1G2SA 3HOVG 1CKOA 3ER0A 1EU4A 1KDCA 3NBIA 1OTCA 1C4QA 4LUOA 2VNUD 2ZTCA 3OWFA 3K59A 4BA2I 3I90A 3CKIB 1DD2A 3A5ZB 1VQOA 3M4OH 4C1NI 4FYDA 3QG1A 2F0SA 3A7LA 3E9HA 2C5CA 3PIO3 4G4KA 2BA1A 5HY6A 3JAME 2F52A 3BYYB 4JC0A 4HEDA 1B44D 4KD4A 1B7YB 1WD0A 2XVSA 2K04A 4LFBL 1K0SA 2NWGA 3ITPA 4O1NA 1KRTA 4B3RQ 2FHTA 2WV6D 2OEOA 3FKIG 1TKWB 2VB3X 2OF1A 2EXDA 1LTAD 2G9DA 1YNXA 1RODA 3GTMB 4LMQD 1LM0A 2QGQA 4XXEA 1N32Q 1P8LA 4A3MH 4HIKA 4DR5L 3S15H 1LACA 4X62Q 1CHPD 1N36L 2ENBA 4JV5Q 1TS3A 2M2LA 4IUQA 1KLUD 1HTLD 4A3DH 1I4RA 3T53B 1B50A 4H02A 4JI5Q 4FXKC 4AIMA 1C8CA 3F2UA 3G7LA 1SNCA 1AH9A 2N78A 5J39A 3A74A 2EOTA 5K5PA 5M3MB 1WTXA 1UE5A 2JN4A 1VMCA 2A68D 3HOXB 3HOVH 3CQZH 1KABA 3HOWG 3HOZB 3PV0A 4RHSA 5C4XH 3NQTA 2UU9L 4NXNQ 4KHZA 4IUPA 4M8AA 4BBRG 3H15A 4G57A 4GKKL 4CHTB 4DR3L 1SFOB 4KKUA 2XSCA 3E0EA 3MZ5A 1MIUA 3URYA 4DAVA 5AFWA 2VZAA 1IBKL 2K33A 1VQIA 2KECA 1EOVA 1NMFA 3KLSX 4FVMA 1D6EC 1VQDA 2JA7G 3K7AH 5IGCA 1DOLA 3S17H 3IL8A 1ZEQX 3H0GH 3Q0AA 1I94Q 2IL8A 2EYJA 2K4KA 1HFGA 4B3MQ 4ODGA 2B8FA 2IX0A 2KOLA 5JOBA 4X3SA 2F1MA 5IP9G 3GTJB 1Q46A 1JICA 1L1OB 2X6GA 4C2MH 4V190 1S3OA 1HNZL 4LFAL 4A93G 3QIAA 5C3EH 2PNRC 2PNHA 2L5TA 1QOHA 3OTOQ 4K6LA 1LTLA 2KHSA 2H4OA 2BDOA 3TDQA 1N33L 3MEHA 5BN3A 2RDGA 2K50A 3NENA 4A3KB 1PZJD 1FD7D 3PGZA 1L1OA 3I73A 3GTPH 2HQEA 3MVVA 3RR5A 4RFBA 1AZPA 3UI2A 1PH6A 4XYQA 4NDXA 1XMOL 1HTPA 1TWFH 5EBCA 4JI3L 2KCNA 3L7ZC 1GD7A 1L0WA 5ISRA 2G5DA 1EUJA 3CCLA 4DR6L 3A54A 1CA5A 1U4LA 1EY7A 2F0MA 1IKMA 3HOUB 3TS2A 3KJOA 1U0LA 3S1MH 4OX9L 3CCVA 2L15A 2ZJRA 1I5FA 1HR0W 4UP7A 2BA0A 4DR4Q 3FP9A 4BXXG 1JB3A 3MA2B 5IWAQ 1PZKD 1CSPA 1LYLA 2Z8LA 4Q0FA 1GUSA 2HCCA 4IUVA 3KLWA 4QF4A 3K57A 4HSVA 1UUPA 4XT3B 2XRQD 1YZ6A 2JA8G 1YJ9A 3HKZG 3H94A 1C48A 1X3GA 2LKVA 2YTVA 4IUUA 2B3GA 2QF7A 4OELB 1QILA 2FMMA 1RJTA 1NY4A 4X64Q 2ES2A 1WYDA 2JEBI 1G51A 1VDZA 3SK5A 4LF9Q 2A8VA 4A3EG 5CV9A 1EOTA 2WB1G 3OPOA 3S1QB 3S15B 2RHSB 2XWJB 2F0EA 5KYLA 1KAAA 1F2MA 1BO0A 3VYUA 2RBMA 2D2CC 1I4HA 2EY2A 2MJ8A 2VQEL 2E2JH 1HA5A 2ICEC 1MSGA 4DK6C 1WTQA 1MI2A 1YNJC 1HUNA 5T1IA 4C3JB 4GNXB 2RCNA 3F2DA 3R8BA 2AQ3B 4IJLA 1G6ZA 1HXYD 2X69A 5A35A 3T1HQ 1D2BA 2A6HD 3AYHB 4AYBB 1GUOA 3NP8A 1CKNB 1OXVA 1TVXA 2B29A 2CHBD 4DNIA 3MXGA 4WJWA 5IGDA 4KTAA 4JYAL 2HD3A 4QIWB 1B9MA 3CQZB 1N36Q 5C4XB 1JE5A 4GNXA 1TWGH 4KKTA 3C2PA 3QOLA 1KNEA 5HGQA 1CKNA 2WACA 4OWWB 1TWAH 5LMUL 4NB3A 3EQLC 1CA6A 5FLXL 1UEBA 5JJKA 3CAMA 2B2WC 4A3BG 3KBXA 1HCZA 5BN5A 2LY7A 5G3LF 3S17B 3KDFB 4X65L 4LW1A 1ML0D 3H0GB 2JE6I 2CWPA 2OWOA 1F9QA 3J80L 3HOYG 2HT1A 3PIPA 2KCMA 3QR8A 4GKKQ 5DM73 4DAMA 4OWTB 4F8MA 2MNAA 4DR3Q 3CXCA 1Q7YC 1TU2B 1HNWQ 1BCPC 2IHFA 4DV5L 4RAUC 5C3EB 1IBLL 3KDFA 1ZKOA 3FVQA 1NUCA 1IBKQ 4X3TA 1QNUA 2E5LL 2O5IC 1MHWC 3J81i 3MTSA 1JJCB 2Q8RE 3DHQA 3AFPA 5M5WB 1X6OA 1SE2A 3SR1A 4PZ8A 3GTPB 2OQ0A 2NZHA 1BBXC 3NSWA 5FO9B 2ZJQA 4LF5L 1TWFB 3KFUA 3VR4A 1LTRD 1HNZQ 4LFAQ 3CMAA 1EYCA 4C3HH 4UP9A 2KEDA 5M9OA 4RCOA 3VR2A 3I4MG 3S1MB 1VCIA 4M1UB 1IW7C 2ZXRA 4JBMA 3GQBA 4KHPL 3UDFA 4A4IA 3GTQH 2CFMA 1MD2D 1I4PA 2NZ1D 4X66Q 2A73B 2IW3A 1HJPA 1SROA 4PMBA 2N3SA 4DV2L 1STBA 1I6HH 2K01A 1XMOQ 3EIVA 1F2YA 3AEVA 1HH2P 1R9TH 1JWSD 1QJOA 5C44B 3CCSA 1S5CD 2ID0A 3NELA 3VDYA 4IFDG 4DR6Q 3M85A 4G7OC 4GOPA 3A8JE 2RCFA 4ZKBB 2V1CC 3SDZA 2QCPX 1J8IA 4OX9Q 1T5EA 2UUCL 5I9OA 3S2DH 2NN6H 5KIXA 2XTIA 2K7VA 4BS9A 1K8GA 3BZCA 1CKMA 1ASZA 4KN4C 4LNQA 1G6PA 1FJGQ 4UP8A 2EYPA 3I2ZA
chains in the Genus database with same CATH topology
4DK1A 5CBEE 3IAYA 1PTOC 1AEXA 1X3QA 1Y1WB 4CKCA 4A3JB 1CTMA 4BWGB 5D3DA 3BDLA 3VA5A 4PQXA 1TWGB 1BXTA 2AUJD 1D5XC 3I91A 1LT3D 2K32A 5HURA 1Y8OB 1TWAB 4C56C 1BNZA 4IUTA 2PZWA 4ZUJA 1H9KA 4ZQ3A 3EROA 1IYVA 3PUVA 1IYUA 1TT2A 4KY6A 1W6KA 2KA7A 3BZDB 1SNDA 1SBBB 1I4XA 1O78A 1EY8A 5KEEA 1EIHA 2F0FA 4ID6A 2SNMA 3PMFA 5C5MA 2J0TD 3OOCA 5FLXE 5CV6A 1KTKA 3EJIA 5CV7A 1EFID 4KI0A 5IT9E 3NQIA 1SE3A 4EQOA 5FKAC 2HCIA 2DNEA 3LX0A 3J80E 2EYFA 1ENCA 1XWEA 4IUNA 4XTCS 2L9HA 3VA7A 4C3HB 5E4XA 2Z1CA 3TP8A 3KLRA 1TS4A 2ZT9C 1H9JA 3GTQB 2JXMB 4EGVA 2E74C 5I9PA 4DGZA 3NK9A 3OIQA 3W3AA 1R9TB 1LTGD 3PUYA 3TZDA 4HMJA 5C3XA 3I4LA 3GTLB 4BY1B 2ZXOA 2A69C 4FXDA 1ESRA 3MWYW 1Q12A 4K5XA 3S2HB 1IHZA 3IFTA 3NTIA 1Q3LA 1BF4A 1B1ZA 2NN6I 2F0UA 3E0JA 1LV9A 4CGYB 3DMUA 2AQ1B 1WCMB 4R9WA 2TSSA 2IJ0A 1SYDA 5EKKA 4DNTB 1A15A 2MP1A 1IL8A 2ZXPA 3HG9A 3RZDB 1EYAA 3MXUA 2Q8IB 1UEAB 2RVLA 1K8OA 3PUXA 4Y7NB 1PRTF 2B2UC 2K28A 3CHBD 2RDFA 2IX3A 1I4GA 3GTGB 1Q8IA 4XQNA 1SNMA 3BDCA 1M4VA 3LWEA 5IODA 1DYQA 2J4XA 3H09A 3TN2A 3HS0C 2KVMA 2RKSA 3C3LA 3R93A 3SE0A 2L11A 4LJZC 2NVTB 4UDUC 4HMIA 1BUVT 1S5BD 5C5LA 1ZYRC 1A2UA 2EJMA 1F9SA 3J81E 4TKOB 1AZQA 3OHXC 1G8ZD 4KHVA 2QILA 3C1FA 1SNPA 4NP5A 2KCCA 4CKBA 1QE6A 2DN8A 2B2YA 4J6HA 1S4ZA 4B9WA 4C3JG 1FNUA 3AB9A 2QKIC 3T51B 1E0BA 3NWSA 2LS01 4FF4A 2F0JA 2FJ2A 2KJXA 4QUFA 1YNJD 2L0CA 4HCEA 1HPCA 4RGMA 4ZAIA 3T56B 2FFKB 2MGSA 3V05A 1O7ZA 2KUMA 1JQYD 2NUCA 2BOSA 5CGKA 4DAYA 4LK1C 1SJED 1S5DD 4WFN3 4C3IB 3VR5A 5CV8A 2F0VA 2F3VA 1K8MA 2WAQB 2E2IB 3FDTA 3D6CA 2AQ2B 2JA5B 1Q90A 2OT2A 3S1NB 2XWBB 4KMUC 3A8KE 5I4DA 2XRSD 4DAPA 4OIJA 2D9UA 4IFDJ 2F4IA 5C4HA 4QMGA 1BCPD 2M9VA 4L6TB 4DXGA 3X3NA 4ZRZA 4RCNA 1GUTA 1RKNA 1QB5D 4DFAA 2IPKD 1EZ8A 4CBVA 1CFMA 5E1FA 4EVOA 1STEA 1CK1A 5CORA 4K6DA 1I3QB 5C0XG 2PPBC 1EEFD 2EJFC 5F2DA 4RHRA 1NSNS 1DOKA 1TQOA 1IW7D 3E6ZX 1OO9B 1DCZA 3IFDA 1CZWA 4BA1I 2EYOA 4YIJA 1R4QB 1EWCA 1ENAA 2CW0C 1B3AA 4HR7B 2EE1A 2H1EA 4F88A 3RD4A 3VYRA 2EDGA 1A3VA 4ABNA 1GXDC 2HUGA 1SNOA 4JK1C 4DXFA 2PCFB 3R2TA 2CQAA 2SOBA 2F0KA 1JC7A 3M4OB 5I2YA 3OW7A 3S16B 3DWPA 5JAVA 1PTOD 1PRTB 2NVQB 2PW7A 2SDFA 1U4MA 5FO8B 5KGUA 5C0XH 1FYCA 1PFBA 3M4YA 3K5LA 1XXGA 3NE5B 4A3MB 3SEBA 5ELEA 4H13C 3FRPB 2D62A 2N55A 4ZUIA 3BG3A 3RLFA 2MPMA 4A3DB 1AN8A 4TQUS 1PLFA 3W2DA 2XN9C 1A6XA 2LFNA 1HQMC 2WIIB 5IGBA 1PMRA 1Y8PB 1GHKA 2F0IA 3HOVB 4HN7A 3M7GA 4CJ2C 1HRJA 4OO1G 2M00A 1O7LA 1SJHD 1U4RA 3CRLC 4FF3A 1B2TA 5IIFA 1W6JA 2A6EC 2RSOA 3RUZA 5KYIA 3K58A 3K7AB 3DEOA 1G291 3TBIB 2B2TA 2EY1A 1SSOA 1FGBD 4FXGC 1T5XD 5FK9C 1V1PB 1E2VA 3CRKC 2YU9B 1SE4A 2B2VC 3EFXD 4TSSA 1ESFA 4C2MB 4GZYC 4N9PA 5BN4A 4IN3A 1VMPA 1V1PA 1UNSA 1WTPA 3T13A 3D31A 1RD9D 2O5JC 4RGOS 4TRDA 1TY0A 3AU7A 2QEJC 3NHHA 1H9SB 1LTID 3OWEB 2B2VA 3G6JB 2NTTA 2A69D 1L0YB 2BE5C 1AW7A 3OMGA 1BR9A 5CR3A 2QDBA 1H9SA 5J22A 5JEAG 3VYTA 2EYLA 5KNBA 3KUPA 1Z7TA 4FF1A 2RDHA 2Z4IA 1O7YA 2NVXB 5DM63 4QB4A 3EA6A 4A93B 2L55A 1SYEA 5C0XI 5A2QL 3A8IE 3R3OA 2E2JB 1SYBA 3KF8A 2L4NA 2O4XA 3O13A 4DK0A 5CBAE 1Q1EA 3K5NA 2PZTA 3KK7A 1OXUA 3P75A 3H3VC 3NTKA 1RDPD 1FR3A 5KNCA 1GUWA 1WVLA 4K5WA 3H91A 1F2ZA 3P7JA 2OXPA 1O80A 5K36G 1ZYRD 4IALA 4U68A 3BYTB 2HDLA 4IZ8A 4OL7A 5D3IB 4PV1C 4IFDH 4NMZA 3N6RA 5CV5A 1EWHA 4PNYA 5JEAH 3BS1A 2K6AA 5I6YA 2JP1A 1CHQD 3HKZB 1EQTA 3E5SA 4K8IA 3L9AX 3RMHA 1EY9A 1LTBD 4KD3A 4A3EB 2I46A 2F0LA 3HEJA 1BOSA 2WB1B 3MFYA 2EYMA 4NW2A 5KNDA 3WOEA 1PYWD 4HAEA 4MN3A 3D4WA 1EY4A 1RCVD 1EIGA 1SXTA 4QUCA 1XX8A 4H0LC 3BVGA 2EPBA 2VB2X 2NBFA 2F0HA 4U673 1FNWA 3JAML 1STYA 5C0XJ 3SK6A 1DM0B 1LT6D 1HA6A 1I6HB 1A3UA 3QOJA 3T4AC 1SAPA 1JORA 3HOYB 1KLGD 3BVZA 2NB0A 1TIID 4KK7A 3S2DB 1JOOA 3MHBA 4ULLA 5EPLA 4ME5A 2F0QA 1DJRD 1STGA 3Q6SA 1JCKB 2XNAC 3NPPA 3PUWA 1QWYA 3VR6A 3V2TA 3ERQA 2K5WA 2KQ3A 3HZXA 5M5XB 3HP3A 3Q24A 5C4JB 5JVH3 3I4MB 1Z47A 4H44C 4UAIA 3QO2A 5CYUA 5IGFA 3NTHA 3T16A 5JVG3 5EJWA 4FNFA 2CW0D 2Q8TA 1HUMA 5JPMC 3J7AV 2B2YC 1EL0A 1ILPA 1OXTA 5EPJA 4IFDI 3OMCA 1EQVA 2R61A 4OIKA 2NVYB 2DY7A 1BDOA 3P20A 2TMPA 2L1BA 1V43A 3MFGA 1SMYC 1V1OA 4JBWA 3U9SA 4XYOA 4F7XA 2PO4A 4RKLA 4Z9CB 3N52A 3NUCA 2RSNA 2F0GA 1Q1BA 2EYHA 2NYZD 4BY7B 2JEAI 1DZ1A 1VF5C 1F9RA 1LLRD 3GP7A 3R2IA 3KBGA 4A3FB 1OXSC 2K5DA 5JJZA 4IQZA 4RGNA 4OGQC 1I6VC 1LT4D 4B9XA 2B8GA 4RKBA 4DN4M 1WTRA 1ZXTA 3TP5A 4RGTA 1ET9A 1WTWA 3GO5A 2R7ZB 2VXWA 1CQFA 1X32A 4L63B 1CI3M 4OHJA 4NKLA 4ZYSA 1GJXA 1TY2A 3DXJC 3K6OA 1WTVA 5M3FB 3GV3A 1STAA 1JWMD 2A6ED 2I07B 1K83B 2F0TA 2MHVA 3TSSA 3PUZA 4WORA 1B9NA 3TP7A 1BCPF 1BQQT 3V96A 1WTOA 2R93B 3DWAA 3BDOA 5JEAJ 1AFPA 1KDAA 1EYDA 1A2TA 1RHPA 2SEBD 2EY5A 3ZYYX 1B53A 1YNNC 4R8IA 1CZGA 1F77A 3IKJA 5ELCA 4FF2A 1MSHA 3VR3A 4V0BA 1I50B 4S3SA 4XQJA 1D1KA 1LO5D 3CU7A 3WDNA 3MAQA 3WOFA 2A74C 1EU3A 3Q22A 1ICWA 5C6AA 5EGTA 1DOMA 2BE5D 2K5QA 3A55A 4J8QA 3BVMA 3MXPA 1QG7A 1PZID 3LNNA 4FP5D 4DNRB 3DWQA 1Y69U 1PXUA 5J1ZA 5I2XA 3PIP3 5LHY1 4H7BA 3PO3B 1G2TA 1PRTC 4CKEA 3D8GA 5ELFA 5D65A 4BBSB 4X3UA 1DXMA 2F0OA 1PTOF 2F03A 5DNFA 4K2KA 1S5FD 3QB3A 4PMCA 3HGBA 3FPPA 3I70A 3M7NA 1JWUD 2YYZA 1ET6A 4RA8A 1HQRD 4EQPA 3I8ZA 3GTKB 2F0PA 1EZ6A 4Q5VA 2JA6B 3D4DA 1JOQA 4XQQA 4HSPA 3S9WA 3FPUB 4HCSA 3NXWA 3X3MA 2B2TC 3P1HA 5EQ0A 1NR2A 1TWHB 4A3IB 4HTHA 4KV6A 1I4QA 1LT5D 3QJYA 2E2HB 3ND8A 2F0WA 3OSOA 2KEEA 1H9MA 1STHA 3SK8A 1LTSD 5FOBB 5M5YB 3ND9A 1L0XB 1SYCA 2EZVA 1SNQA 3VYSA 5LL6X 3J7YW 2XIWA 1SEBD 5DEHA 3SHLA 4C3HG 1ILQA 1CT1D 1MGSA 4ZLTF 3FKIB 1PTOH 1SDFA 3QWNA 5KRUA 4X3KA 3A7AB 3PO2B 2PMZB 2E2DC 1U9RA 1EY5A 5IT9L 3S14B 5EBDA 1EEID 3D6WA 2A68C 5NUCA 3D3RA 3K5OA 5EPKA 5G3LD 2NN6G 3SVMA 1GHJA 3L3OC 2WKDA 4RWSC 5E3FA 1JE4A 5FO7B 1TWCB 4KJOA 3HOWB 2F0NA 4KY5A 4OO1H 1Y1VB 4BBRB 2SNSA 2GA4B 2FINB 5LL6S 1SYGA 4XDXA 4L8JA 2B2WA 5IGGA 1LTTD 5EKIA 1BCPB 3LWUA 4K14A 5C3WA 5CMDA 3MXNA 1PFMA 4IURA 2JA7B 1NR4A 2PW5A 1EY0A 4KY7A 4EQNA 1GUGA 1KDBA 2E76C 4DU9A 4O42A 1E2WA 1OXXK 2IWHA 1XTCD 1LABA 4E6IA 1H9RA 3I3CA 2WINB 3RZOB 4LAAA 2N88A 1HHVA 4FO2A 5EKLA 5T1GA 1D5MC 3J7AF 3K5MA 4G7ZC 1XYIA 4K5VA 5IOCA 1KNAA 4WRDA 2EVBA 2G9HD 2NTSA 4B08A 3Q23A 2AWNA 4MIUA 2EXZA 2B63B 5CV4A 3SXHA 1FNVA 3ONAB 3SK4A 3S1RB 3DUZA 4N9TA 4XIGS 2K05A 5HGTA 2DY8A 3D4RA 2EY6A 1TS5A 2RQXA 3GTOB 3TP6A 2VUMB 1D5ZC 2WP8J 2LMCB 3A56A 2DNCA 1G91A 1SMYD 5E4WC 4A3GB 1RTOA 2JSOA 4J1MA 2K1BA 2JA8B 2B39A 1CM9A 2F0DA 3GV6A 1PTOB 4XT1B 3FMCA 4ILWA 5ELBA 3J81L 2WKCA 4K8JA 2PQEA 3EVQA 2A6HC 1F9PA 4G7HC 1Z6HA 3KLSA 4KN7C 3C1EA 2AWOA 4I65A 2R3ZA 1U4PA 3NBHA 4C3IG 1UAPA 3K0YA 1RF2D 1STNA 4C1NK 4DF7A 1GOZA 4CJ1B 4KJNA 5IGEA 3DM1A 3C46A 2F3WA 1A3TA 4ZKCB 2C9OA 1RTNA 1NAPA 5K36H 1EY6A 5COYA 5CC4A 3AMUA 4OO1I 2CVRA 3TZUA 1F2LA 2K03A 4A3BB 3H6MA 3I72A 1S5ED 3OIPA 2L12A 1CQVA 4P2CB 3GD7A 1V8QA 4KKSA 5TSSA 4RH6A 3M3YB 4PMWA 1MBYA 4CJ0B 3NWTA 2Z4HA 5DAUA 1YNND 5I6WA 1ONLA 2JYOA 2HDMA 5ELDA 1IKLA 2BCOA 2J7ZA 2BDNA 2O2LD 1QNKA 2PYKA 1QCBD 4I7ZC 2IX1A 1WD1A 1AP0A 2ICIA 5A2QE 2Y0SB 1PDQA 1VF7A 1J9OA 1D1IA 4K2LA 1JR0D 3HRZC 3U9OA 2X6LA 2MUYA 1HFNA 2D5DA 1DONA 1ENFA 1TR5A 4F87A 1PRTD 2IT1A 3FEWX 1PFNA 2A5HA 1Y8NB 4R8NA 2R92B 3DEPA 1JOKA 5JPNC 1TS2A 2RA4A 2AUKA 1NCVA 1B4OA 3I4NB 4ZK9B 5C4ZA 1E2ZA 1SYFA 2B2UA 2E75C 2PZUA 1II3A 3TMEA 4QCLA 2FMCA 1M8AA 2EJGC 2V4DA 1R4PB 5D14A 3MC0B 1GUNA 2R6GA 4DA2A 1X3PA 4MHEA 1G2SA 1EU4A 1KDCA 3NBIA 1C4QA 2VNUD 3OWFA 3K59A 4BA2I 3I90A 3CKIB 1DD2A 4C1NI 4FYDA 3QG1A 2F0SA 3A7LA 3PIO3 2C5CA 4G4KA 2BA1A 3JAME 3BYYB 4HEDA 1B44D 4KD4A 1WD0A 2XVSA 2K04A 2NWGA 3ITPA 4O1NA 2FHTA 2WV6D 2OEOA 1TKWB 2VB3X 2OF1A 1LTAD 2G9DA 1RODA 3GTMB 4LMQD 4XXEA 1LACA 1CHPD 2ENBA 1TS3A 2M2LA 4IUQA 1KLUD 1HTLD 1I4RA 3T53B 1B50A 4FXKC 1C8CA 3F2UA 3G7LA 1SNCA 5J39A 2EOTA 5K5PA 5M3MB 1WTXA 1VMCA 2A68D 3HOXB 1KABA 3HOZB 3PV0A 4RHSA 3NQTA 4KHZA 4IUPA 4M8AA 4G57A 4CHTB 1SFOB 4KKUA 2XSCA 3MZ5A 3URYA 4DAVA 5AFWA 2K33A 2KECA 3KLSX 4FVMA 1D6EC 5IGCA 1DOLA 3IL8A 1ZEQX 3Q0AA 2IL8A 2EYJA 1HFGA 4ODGA 2B8FA 2IX0A 2KOLA 5JOBA 4X3SA 2F1MA 3GTJB 1JICA 2X6GA 4V190 3QIAA 2PNRC 2L5TA 1QOHA 4K6LA 2KHSA 2H4OA 2BDOA 3TDQA 3MEHA 5BN3A 2RDGA 4A3KB 1PZJD 1FD7D 3I73A 2HQEA 3MVVA 4RFBA 1AZPA 3UI2A 4XYQA 4NDXA 1HTPA 5EBCA 2KCNA 3L7ZC 5ISRA 3A54A 1CA5A 1U4LA 1EY7A 2F0MA 1IKMA 3HOUB 2BA0A 1JB3A 3MA2B 1PZKD 2Z8LA 4Q0FA 1GUSA 2HCCA 4IUVA 4QF4A 3K57A 4HSVA 1UUPA 4XT3B 2XRQD 3H94A 1C48A 2LKVA 4IUUA 2QF7A 1QILA 2FMMA 1RJTA 2JEBI 1VDZA 3SK5A 5CV9A 1EOTA 3OPOA 3S1QB 3S15B 2XWJB 2F0EA 5KYLA 1KAAA 1F2MA 1BO0A 3VYUA 2RBMA 2D2CC 1I4HA 2EY2A 2MJ8A 1HA5A 2ICEC 1MSGA 1WTQA 1MI2A 1YNJC 1HUNA 5T1IA 4C3JB 3R8BA 2AQ3B 1G6ZA 1HXYD 2X69A 5A35A 1D2BA 2A6HD 4AYBB 1GUOA 3NP8A 1OXVA 1TVXA 2CHBD 5IGDA 3MXGA 4WJWA 4KTAA 4QIWB 1B9MA 3CQZB 5C4XB 4KKTA 3C2PA 3QOLA 1KNEA 2WACA 3EQLC 1CA6A 5FLXL 2B2WC 3KBXA 1HCZA 5BN5A 2LY7A 5G3LF 3S17B 1ML0D 3H0GB 2JE6I 1F9QA 3J80L 5DM73 4F8MA 1TU2B 1BCPC 4RAUC 5C3EB 1ZKOA 3FVQA 1NUCA 4X3TA 1QNUA 2O5IC 3MTSA 2Q8RE 3DHQA 5M5WB 3GTPB 1SE2A 3SR1A 1BBXC 3NSWA 5FO9B 1TWFB 3VR4A 1LTRD 1EYCA 2KEDA 5M9OA 4RCOA 3VR2A 3S1MB 1VCIA 4M1UB 1IW7C 2ZXRA 3GQBA 1MD2D 1I4PA 2NZ1D 2A73B 2IW3A 4PMBA 1STBA 2K01A 1F2YA 1JWSD 1QJOA 5C44B 1S5CD 2ID0A 4IFDG 3M85A 4G7OC 3A8JE 4ZKBB 3SDZA 2QCPX 1J8IA 1T5EA 5I9OA 2NN6H 5KIXA 2K7VA 4BS9A 4KN4C 2EYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCP X;  2VB2 X;  3E6Z X;  2L55 A;  1ZEQ X;  2VB3 X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 4DK1 A;  4A76 A;  4DV6 Q;  1WCM H;  5CBE E;  3CD6 A;  5JJL A;  2ZTE A;  3M4Q A;  3IAY A;  3CPF A;  1PTO C;  3DLL A;  1AEX A;  5AJ3 L;  1X3Q A;  1Y1W B;  1YHA A;  4CKC A;  5M5X H;  4A3J B;  1CTM A;  4BWG B;  5D3D A;  3BDL A;  3J7Z C;  5FLM G;  3VA5 A;  4PQX A;  3SGI A;  4Y7N H;  3K81 C;  1TWG B;  1PH7 A;  1BXT A;  2AUJ D;  2VQE Q;  1D5X C;  4BY7 G;  3I91 A;  1LT3 D;  2K32 A;  4GN5 A;  4RG1 A;  1Y8O B;  4J15 A;  5HUR A;  5GAH C;  4GKJ Q;  1V9P A;  1TWA B;  4C56 C;  1BNZ A;  4IUT A;  3I55 A;  4A3F G;  3E3X A;  2PZW A;  3UE1 A;  4ZUJ A;  1H9K A;  4ZQ3 A;  3ERO A;  3NBH B;  1IYV A;  2YTX A;  3PUV A;  4YCV A;  1IYU A;  1TT2 A;  3S24 A;  4KY6 A;  4JYA Q;  5LMN L;  1W6K A;  2KA7 A;  3BZD B;  1SND A;  4DV3 Q;  4DV0 Q;  1EFW A;  4JI4 L;  5H1S E;  1SBB B;  2YTY A;  1I4X A;  1O78 A;  5J3B A;  1KL9 A;  1EY8 A;  1SMX A;  2NVT H;  5KEE A;  1EIH A;  2F0F A;  2NVY H;  4ID6 A;  2SNM A;  3PMF A;  5LMU Q;  4QGU A;  5C5M A;  1NBW A;  2J0T D;  3KJP A;  3OOC A;  5DLQ E;  4MZ9 A;  5FLX E;  2I5L X;  5CV6 A;  1KTK A;  3EJI A;  5CV7 A;  1EFI D;  4KI0 A;  3CC7 A;  4X65 Q;  4YWK A;  5IT9 E;  3NQI A;  1SE3 A;  1RL2 A;  4EQO A;  2PI2 E;  5FKA C;  5GAD C;  2HCI A;  2DNE A;  3LX0 A;  3J80 E;  2EYF A;  1ENC A;  1XWE A;  1YJW A;  4IUN A;  4B3R L;  4XTC S;  5FLM H;  2ZTD A;  2L9H A;  3VA7 A;  2R93 G;  1IBL Q;  4C3H B;  5E4X A;  1E1T A;  2Z1C A;  3TP8 A;  3KLR A;  1TS4 A;  2QEX A;  4L5T A;  2ZT9 C;  4R4Q A;  3HKS A;  3CCJ A;  1H9J A;  3GTQ B;  2JXM B;  2YV5 A;  4EGV A;  2E74 C;  5I9P A;  4A3F H;  4DGZ A;  3NK9 A;  4X62 L;  3Q8D A;  5M3M G;  4JV5 L;  3OIQ A;  4LF5 Q;  3W3A A;  4A3C H;  1R9T B;  1LTG D;  3PUY A;  3TZD A;  3OYY A;  4HMJ A;  1E22 A;  2HIV A;  5C3X A;  3G48 A;  2BH8 A;  3UDG A;  3I4L A;  3MEF A;  3OW2 A;  5E7N A;  2R7Z H;  4JI6 Q;  3GTL B;  4BY1 B;  2WFW A;  2ZXO A;  4P75 A;  3EBE A;  2A69 C;  4FXD A;  1ESR A;  3MWY W;  1Q12 A;  4K5X A;  3S2H B;  1IHZ A;  3IFT A;  3NTI A;  2JA9 A;  1Q3L A;  1BF4 A;  1B1Z A;  2NN6 I;  2F0U A;  3E0J A;  1LV9 A;  2VW9 A;  5M3F H;  4CGY B;  3DMU A;  4LF4 Q;  1VQB A;  2AQ1 B;  1WCM B;  2Q2I A;  1K83 H;  4R9W A;  2TSS A;  2IJ0 A;  2JA5 H;  1SYD A;  5EKK A;  4DNT B;  1A15 A;  1IL2 A;  3S1N H;  2MP1 A;  4A3L H;  1IL8 A;  1GO3 E;  2ZXP A;  3HG9 A;  3RZD B;  1EYA A;  3MXU A;  3STB C;  2Q8I B;  1UEA B;  2RVL A;  2K5N A;  1K8O A;  3PUX A;  1W2B A;  4Y7N B;  1PRT F;  1QZH A;  2B2U C;  2K28 A;  1XPR A;  3CHB D;  2RDF A;  2IX3 A;  2Z6K C;  1I4G A;  3GTG B;  3I4O A;  4GN4 B;  1Q8I A;  3AQQ A;  4YHH Q;  4XQN A;  1SNM A;  1VQM A;  3OTO L;  5IP7 H;  3BDC A;  1M4V A;  3LWE A;  5IOD A;  1DYQ A;  1KQS A;  2J4X A;  1I50 H;  2K52 A;  3BZK A;  3H09 A;  5IYD H;  3TN2 A;  2HIX A;  3HS0 C;  2KVM A;  1I3Q H;  3D0F A;  2RKS A;  3C3L A;  3R93 A;  3SE0 A;  2L11 A;  4IOA A;  4LJZ C;  2NVT B;  4EQ5 A;  4UDU C;  4L5R C;  4HMI A;  1BUV T;  1S5B D;  5C5L A;  1ZYR C;  3RN2 A;  1A2U A;  4JCV E;  2EJM A;  4YWM A;  1F9S A;  3J81 E;  4TKO B;  1AZQ A;  2N49 A;  4DR4 L;  3OHX C;  2KBN A;  5FJ8 G;  1G8Z D;  4HJ9 A;  4KHV A;  3PSI A;  2QIL A;  4CDC C;  1AE3 A;  2KHI A;  3C1F A;  1QVG A;  1SNP A;  4NP5 A;  2KCC A;  3PO3 H;  4CKB A;  1QE6 A;  2DN8 A;  2B2Y A;  2VQF L;  1B70 B;  4J6H A;  1Z9F A;  1WJJ A;  1S4Z A;  4B9W A;  4POG A;  4C3J G;  1FNU A;  2DJF C;  3AB9 A;  4X64 L;  4BBS H;  4LF9 L;  2BH2 A;  2QKI C;  3T51 B;  1E0B A;  3NWS A;  1PH4 A;  4OON A;  1N34 Q;  2LS0 1;  4FF4 A;  3S16 H;  4DAY B;  2F0J A;  2FJ2 A;  2KJX A;  1YNJ D;  2L0C A;  4HCE A;  4RGM A;  1HPC A;  4QUF A;  3TS0 A;  1K73 C;  4ZAI A;  1SE8 A;  3T56 B;  1VQF A;  2FFK B;  4MNO A;  2NVQ H;  2MGS A;  5ELN A;  3UE0 A;  3V05 A;  1O7Z A;  2KUM A;  4PG3 A;  1JQY D;  2NUC A;  2BOS A;  5CGK A;  3T1H L;  4DAY A;  4LK1 C;  1SJE D;  1S5D D;  4WFN 3;  4C3I B;  4DV1 Q;  3VR5 A;  5CV8 A;  3PO2 G;  2QDL A;  2F0V A;  2F3V A;  2JA6 H;  3HKZ E;  1K8M A;  3F1Z A;  2WAQ B;  2E2I B;  1VQ5 A;  3FDT A;  3D6C A;  2CKZ B;  2HHH L;  4LF7 L;  2AQ2 B;  2JA5 B;  1Q90 A;  2OT2 A;  2WB1 E;  1TWH H;  3S1N B;  4A3I H;  2XWB B;  4KMU C;  3A8K E;  5I4D A;  2XRS D;  4DAP A;  1X3E A;  3CCU A;  1HZ9 A;  4OIJ A;  2D9U A;  4IFD J;  2F4I A;  1Y1V G;  1XTD A;  2VY3 A;  4QMG A;  5C4H A;  1BCP D;  1N8R C;  2M9V A;  1XNQ L;  4L6T B;  4DV4 L;  3CCR A;  4DXG A;  3X3N A;  1HNW L;  5M5Y H;  1L1O C;  1QVC A;  1J5E Q;  4ZRZ A;  4RCN A;  1GUT A;  1C0A A;  4OWX B;  1RKN A;  1QB5 D;  4R4I A;  1C7Y A;  4DFA A;  2IPK D;  1EZ8 A;  4CBV A;  1CFM A;  2GVB A;  5E1F A;  4EVO A;  3FKI H;  1STE A;  1CK1 A;  5COR A;  4K6D A;  1SLJ A;  1I3Q B;  1VQH A;  5C0X G;  1VQN A;  1Q81 C;  2YU9 H;  2PPB C;  1EEF D;  2OTJ A;  2EJF C;  5F2D A;  4RHR A;  1HNX Q;  3PO2 H;  1NSN S;  2D0O A;  1DOK A;  1TQO A;  1IW7 D;  3E6Z X;  1OO9 B;  1DCZ A;  5C44 G;  3IFD A;  1CZW A;  4BA1 I;  1VQ6 A;  3S14 H;  4DR2 Q;  4JI7 L;  2EYO A;  2Z9H A;  4YIJ A;  4UHV A;  1R4Q B;  1EWC A;  1ENA A;  2CW0 C;  1B3A A;  4HR7 B;  4X66 L;  2UXB Q;  2EE1 A;  1UWV A;  2H1E A;  4CDD C;  1GVP A;  4F88 A;  1M90 C;  3J80 i;  3RD4 A;  1PH5 A;  3VYR A;  3CC2 A;  2B63 G;  2EDG A;  1A3V A;  4ABN A;  1K8A C;  1GXD C;  2HUG A;  1SNO A;  1TWC H;  2LXK A;  4GS3 A;  4YWL A;  3HOW H;  1WFQ A;  4JK1 C;  4DXF A;  2PCF B;  3R2T A;  2CQA A;  4CDF C;  1Y1V H;  2SOB A;  4BBR H;  2Q2H A;  2F0K A;  1JC7 A;  3M4O B;  1X9N A;  1K9M C;  5I2Y A;  2VUM G;  1Y1W G;  3OW7 A;  1K28 A;  1FJG L;  3S16 B;  3DWP A;  4A3J G;  4DPG A;  2JA7 H;  5JAV A;  1PTO D;  5ELO A;  1PRT B;  3A0J A;  4A3G G;  4DV6 L;  2PW7 A;  2NVQ B;  2SDF A;  3CME A;  2VQF Q;  2ATW A;  1MJC A;  1U4M A;  5FO8 B;  4GNX C;  5KGU A;  4RMF A;  5C0X H;  1FYC A;  1PFB A;  3KF6 A;  5IP9 H;  1VQ7 A;  2NVX H;  3M4Y A;  4A93 H;  3K5L A;  1XXG A;  3NE5 B;  4A3M B;  3RZO H;  1JT8 A;  1VQE A;  1Q86 C;  3SEB A;  2EQS A;  4GLX A;  5ELE A;  4H13 C;  3FRP B;  2D62 A;  2N55 A;  4ZUI A;  3BG3 A;  3RLF A;  2MPM A;  4O2D A;  1C9O A;  4A3D B;  4GKJ L;  1AN8 A;  4TQU S;  2PI2 A;  1PLF A;  3W2D A;  2B63 H;  1EIF A;  2XN9 C;  2OQK A;  1A6X A;  2LFN A;  1HQM C;  2WII B;  5IGB A;  1PMR A;  1Y8P B;  1GHK A;  2F0I A;  3S1R H;  3HOV B;  2AHO B;  4HN7 A;  4DV3 L;  3M7G A;  4CJ2 C;  4DV0 L;  2Z6B A;  1HRJ A;  4OO1 G;  2M00 A;  1GM5 A;  1O7L A;  2HHH Q;  1SJH D;  4LF7 Q;  1U4R A;  4BXX H;  3CRL C;  4FF3 A;  2VUM H;  1B2T A;  5IIF A;  1W6J A;  2A6E C;  2MO0 A;  2RSO A;  1MKH A;  1O7I A;  1P16 A;  3RUZ A;  1B3Q A;  1X65 A;  5KYI A;  3K58 A;  3K7A B;  1W3S A;  1G29 1;  3DEO A;  3TBI B;  2B2T A;  3HFZ B;  2JA8 H;  2EY1 A;  1SSO A;  1FGB D;  4FXG C;  1T5X D;  5FK9 C;  3PCO B;  4YCW A;  1V1P B;  1E2V A;  3CRK C;  4GN3 B;  2YU9 B;  1SE4 A;  1AE2 A;  2B2V C;  1XNQ Q;  2IY5 B;  3EFX D;  4TSS A;  4DV4 Q;  1ESF A;  4C2M B;  1PH3 A;  4A3E H;  4GZY C;  3JAM c;  4N9P A;  5BN4 A;  2K5H A;  4ALP A;  5LMN W;  4IN3 A;  1VMP A;  1V1P A;  1UNS A;  1WTP A;  3T13 A;  2MO1 A;  1FVI A;  2KHJ A;  3D31 A;  1IBM Q;  3K0X A;  4GOP C;  1WTH A;  1RD9 D;  4N8F A;  2O5J C;  4RGO S;  4POF A;  4DKA C;  4TRD A;  1TY0 A;  3AU7 A;  1SN8 A;  2QEJ C;  3ULP A;  3W5O A;  3NHH A;  4DK3 C;  1H9S B;  1LTI D;  4JI7 Q;  3OWE B;  4LUZ A;  2B2V A;  3G6J B;  2NTT A;  2Y0S G;  3TEH B;  2A69 D;  1XNR Q;  4JI6 L;  1L0Y B;  2BE5 C;  4HIO A;  1AW7 A;  4GOP B;  3OMG A;  3K7U C;  1BR9 A;  1SR3 A;  4IPD A;  5CR3 A;  3U50 C;  2QDB A;  1H9S A;  1PH8 A;  5J22 A;  4A3B H;  4LF4 L;  5JEA G;  3VYT A;  2EYL A;  5KNB A;  3KUP A;  3HOY H;  3STB D;  1Z7T A;  3KF8 B;  4FF1 A;  2RDH A;  2Z4I A;  3F2B A;  1O7Y A;  4OXP A;  5DM6 3;  2NVX B;  4P73 A;  4QB4 A;  3EA6 A;  4A93 B;  1X56 A;  1SYE A;  2L55 A;  1YHB A;  3M3Y H;  5C0X I;  5A2Q L;  5L37 A;  3CF5 A;  1VQC A;  2R92 G;  3A8I E;  3R3O A;  2DJG C;  2E2J B;  1SYB A;  3KF8 A;  2L4N A;  2O4X A;  4Y52 H;  4P74 A;  3O13 A;  1GKH A;  1YBY A;  4R4T A;  1Q1E A;  4DK0 A;  5CBA E;  4P71 A;  3K5N A;  1Q82 C;  4YHH L;  1E7Z A;  3B6Y A;  3I4N G;  2UXD L;  2PZT A;  3KK7 A;  1OXU A;  3P75 A;  1PFS A;  2K5V A;  4IJH A;  3H3V C;  3NTK A;  1KXL A;  1RDP D;  1FR3 A;  3G4S A;  1VQ4 A;  5KNC A;  1GUW A;  3I4M H;  5C4J H;  2IHE A;  1WVL A;  4K5W A;  3G71 A;  3H91 A;  1F2Z A;  4IOC A;  1ICF B;  2OXP A;  3P7J A;  1O80 A;  5K36 G;  1ZYR D;  4IO9 A;  4IAL A;  4U68 A;  3BYT B;  2HDL A;  4IZ8 A;  2FXQ A;  4OL7 A;  4PV1 C;  5D3I B;  4IFD H;  4NMZ A;  3N6R A;  5CV5 A;  1EWH A;  5BR8 L;  4PNY A;  2DGY A;  5JEA H;  3BS1 A;  2K6A A;  2LSS A;  5I6Y A;  2JP1 A;  1KC8 C;  1CHQ D;  1QUQ B;  3HKZ B;  1EQT A;  1DGS A;  3E5S A;  4K8I A;  3L9A X;  4AH6 A;  3RMH A;  1EY9 A;  1VQA A;  3BJU A;  1LTB D;  4ME3 A;  4KD3 A;  4HJ5 A;  2CH4 W;  4A3E B;  2I46 A;  2F0L A;  3HEJ A;  4CDE C;  5JJI A;  1BOS A;  2WB1 B;  3MFY A;  3DM3 A;  1CUK A;  2EYM A;  4NW2 A;  5KND A;  5EAY A;  1QUQ A;  2QW7 A;  4GLV B;  3WOE A;  4DUZ Q;  2EIF A;  1PYW D;  4HAE A;  4MN3 A;  1N34 L;  3D4W A;  1V1Q A;  1EY4 A;  3I4N H;  1RCV D;  1EIG A;  1SXT A;  1YJN A;  4QUC A;  1XX8 A;  4H0L C;  1KAW A;  3BVG A;  2WAQ G;  4LUV A;  2I5M X;  2EPB A;  2CQO A;  2VB2 X;  2NBF A;  2VL6 A;  2F0H A;  4U67 3;  1FNW A;  3JAM L;  4BY7 H;  1STY A;  4DV1 L;  5C0X J;  3SK6 A;  1DM0 B;  4LFC Q;  1HZA A;  1LT6 D;  1EQR A;  2E8G A;  1HA6 A;  1I6H B;  1A3U A;  3QOJ A;  3T4A C;  3HOX G;  1KD1 C;  3HOZ G;  1PVO A;  1FGU A;  1SAP A;  1JOR A;  1BKB A;  1A63 A;  3HOY B;  1KLG D;  3BVZ A;  2NB0 A;  1TII D;  4KK7 A;  3S2D B;  1HZC A;  4WJ4 A;  2F4V Q;  1HR0 Q;  3U58 A;  1JOO A;  4AQY L;  3MHB A;  4ULL A;  1X55 A;  5EPL A;  4YY3 Q;  4ME5 A;  2F0Q A;  4JPB W;  2CH4 A;  4JOI A;  1DJR D;  1STG A;  1E3P A;  3Q6S A;  1JCK B;  1N9W A;  2XNA C;  1J5E L;  1NTG A;  3EN2 A;  3NPP A;  1EYG A;  3PUW A;  2PMZ E;  1QWY A;  3VR6 A;  3UDX A;  3V2T A;  3ERQ A;  4APV A;  1PA6 A;  2K5W A;  2KQ3 A;  3HZX A;  5M5X B;  4R4O A;  1KRS A;  2ASB A;  3PF4 A;  3HP3 A;  2R93 H;  3KYH C;  5IYB G;  3Q24 A;  5C4J B;  5JVH 3;  3I4M B;  4A3K G;  1Z47 A;  1D8L A;  4H44 C;  4UAI A;  3QO2 A;  1HNX L;  4NXM Q;  5CYU A;  2UXC Q;  5IGF A;  5M3M H;  2UXD Q;  3NTH A;  1BVS A;  3T16 A;  5EJW A;  5JVG 3;  4R4C A;  4DR2 L;  4FNF A;  2CW0 D;  2Q8T A;  1HUM A;  5JPM C;  3HOU G;  1S40 A;  3J7A V;  1X3F A;  3U4Z A;  2B2Y C;  1EL0 A;  2UXB L;  1ILP A;  1OXT A;  5EPJ A;  4LF8 Q;  1H95 A;  4IFD I;  3OMC A;  1EQV A;  1SRU A;  2R61 A;  4OIK A;  1VQ9 A;  2NVY B;  1PH9 A;  1YI2 A;  2DY7 A;  1BDO A;  3P20 A;  2TMP A;  2L1B A;  1V43 A;  2MFI A;  1MJE A;  5BR8 Q;  3MFG A;  1SMY C;  1NJI C;  1V1O A;  3GTJ H;  4JBW A;  3U9S A;  4XYO A;  4F7X A;  1YIJ A;  4A3M G;  2PO4 A;  4RKL A;  4Z9C B;  3N52 A;  4B3T L;  3NUC A;  2RSN A;  2F0G A;  4L5S A;  1VS0 A;  3GDE A;  1Q1B A;  4L5Q A;  1PV4 A;  2EYH A;  2NYZ D;  4BY7 B;  2JEA I;  4WJ3 M;  3KOJ A;  2R7F A;  1DZ1 A;  1VF5 C;  1F9R A;  1LLR D;  3GP7 A;  3R2I A;  3KBG A;  4AYB G;  4A3F B;  1OXS C;  2K5D A;  5JJZ A;  4IQZ A;  4RGN A;  4OGQ C;  1I6V C;  2KCT A;  1VQK A;  3HOU H;  5C4X G;  1LT4 D;  3CC4 A;  4B9X A;  2B8G A;  4B3S Q;  4RKB A;  4DN4 M;  1WTR A;  1ZXT A;  3TP5 A;  4RGT A;  1ET9 A;  1WTW A;  3GO5 A;  2R7Z B;  2VXW A;  1CQF A;  1X32 A;  4L63 B;  1CI3 M;  3GTK H;  4OHJ A;  2KEN A;  4NKL A;  4ZYS A;  2ZM6 L;  4DR7 L;  1GJX A;  1TY2 A;  3DXJ C;  3K6O A;  1WTV A;  5M3F B;  3K80 C;  1PHJ A;  3H0G G;  3GV3 A;  1STA A;  1JWM D;  2A6E D;  2I07 B;  4GLA C;  1K83 B;  5FJ8 H;  2F0T A;  1UE7 A;  2MHV A;  3TSS A;  3PUZ A;  4WOR A;  2RHQ B;  1B9N A;  2I0Q A;  5C3E G;  3S1Q H;  3TP7 A;  1BCP F;  1BQQ T;  3IRB A;  3ICE A;  2E2H H;  2F3I A;  2Q2T A;  3V96 A;  1WTO A;  4AQY Q;  2R93 B;  3DWA A;  4QL5 A;  5FLX c;  3BDO A;  5JEA J;  4C3J H;  1AFP A;  1KDA A;  1EYD A;  5IT9 c;  1A2T A;  4PZ6 A;  1KHI A;  1RHP A;  4HJ7 A;  2SEB D;  3F2C A;  2EY5 A;  3ZYY X;  1B53 A;  1YNN C;  3J80 c;  2NZO A;  3CCE A;  4R8I A;  1CZG A;  1F77 A;  3IKJ A;  5ELC A;  3NEM A;  2LXJ A;  4FF2 A;  1MSH A;  3VR3 A;  4V0B A;  1I50 B;  4QJF A;  1IBM L;  4S3S A;  1M1K C;  4XQJ A;  1D1K A;  2Z0S A;  1LO5 D;  3CU7 A;  1E1O A;  3WDN A;  4EX5 A;  3MAQ A;  3WOF A;  1EIY B;  4IPG A;  2A74 C;  1EU3 A;  3Q22 A;  1ICW A;  5C6A A;  5EGT A;  3A5U A;  1DOM A;  1UE6 A;  1A62 A;  2BE5 D;  1JB7 A;  4HJA A;  2K5Q A;  1XNR L;  3A55 A;  4J8Q A;  3BVM A;  5IE8 A;  1KIX A;  3MXP A;  4UY8 C;  1QG7 A;  1PZI D;  3LNN A;  4FP5 D;  4DNR B;  3DWQ A;  1Y69 U;  1PXU A;  5J1Z A;  5I2X A;  3PIP 3;  4DV7 Q;  5LHY 1;  4H7B A;  4YCU A;  1XPU A;  3PO3 B;  1PYS B;  1G2T A;  1PRT C;  3PIO A;  4IPH A;  4CKE A;  3D8G A;  2A19 A;  5M5W H;  5IY0 A;  5ELF A;  3ULL A;  5D65 A;  4A75 A;  1PH2 A;  3CCM A;  4BBS B;  4X3U A;  1DXM A;  2F0O A;  1PTO F;  2F03 A;  5DNF A;  4K2K A;  3KF6 B;  1S5F D;  3QB3 A;  4PMC A;  1EQQ A;  3HGB A;  3FPP A;  2UUA L;  3I70 A;  2Y0S E;  1FL0 A;  4B3T Q;  2CCZ A;  1ASY A;  3U4V A;  3PF5 A;  3M7N A;  1JWU D;  2YYZ A;  3WWV A;  1ET6 A;  4RA8 A;  2Q2U A;  1WOC A;  1HQR D;  4EQP A;  3I8Z A;  3GTK B;  2F0P A;  1EZ6 A;  1XMQ Q;  4Q5V A;  1YEZ A;  2JA6 B;  2RF4 A;  3D4D A;  5C44 H;  1JOQ A;  2AMC B;  4XQQ A;  4HSP A;  3S9W A;  1QVF A;  3FPU B;  4MTK A;  4HCS A;  3NXW A;  3X3M A;  1A8V A;  2B2T C;  3P1H A;  5EQ0 A;  3RLO A;  1NR2 A;  1TWH B;  4A3I B;  5IYC G;  4HTH A;  4K0K L;  4KV6 A;  3UDI A;  1I4Q A;  1LT5 D;  3QJY A;  2E2H B;  3ND8 A;  2F0W A;  2ZM6 Q;  4DR7 Q;  1E24 A;  3OSO A;  3ULJ A;  2CWA A;  2KEE A;  4LFB Q;  1H9M A;  1STH A;  4JI2 L;  1Y14 B;  3J81 c;  1NNX A;  2GVA A;  4JI0 L;  3SK8 A;  1LTS D;  5FOB B;  5M5Y B;  3ND9 A;  1L0X B;  1SYC A;  2EZV A;  3GTO H;  1SNQ A;  3VYS A;  1Y1W H;  5LL6 X;  3J7Y W;  2XIW A;  4A3J H;  1SEB D;  5DEH A;  4P72 A;  3SHL A;  4DR5 Q;  4C3H G;  1ILQ A;  2MQH A;  1XPO A;  4A3G H;  1IXR A;  1CT1 D;  3CPW A;  4DUZ L;  1MGS A;  4ZLT F;  2R7D A;  3FKI B;  1PTO H;  1SDF A;  3QWN A;  1WI5 A;  5KRU A;  4R1J A;  1L2F A;  4X3K A;  3A7A B;  1EWI A;  3PO2 B;  2PMZ B;  2E2D C;  1U9R A;  1X54 A;  3T1Y L;  3H3V H;  1EY5 A;  5IT9 L;  3S14 B;  3J7A 5;  5EBD A;  3L2P A;  1EEI D;  5GAG C;  3D6W A;  2UU9 Q;  2A68 C;  2A1A A;  2DUD A;  2H5X A;  5NUC A;  3D3R A;  4LFC L;  3FHW A;  3K5O A;  5EPK A;  5G3L D;  2NN6 G;  3SVM A;  1GHJ A;  4BY1 G;  5IYC H;  1RIP A;  3L3O C;  2WKD A;  4RWS C;  5E3F A;  1JE4 A;  5FO7 B;  2ALY B;  1PH1 A;  1TWC B;  4KJO A;  3HOW B;  3MXN B;  4IPC A;  2F0N A;  4KY5 A;  4OO1 H;  1Y1V B;  4BBR B;  1WCM G;  2SNS A;  2ZJP A;  2GA4 B;  2UUB L;  2FIN B;  5LL6 S;  5GAE C;  1SYG A;  2F4V L;  1HR0 L;  4XDX A;  4O0A A;  3AFQ A;  4L8J A;  2B2W A;  5IGG A;  1LTT D;  5EKI A;  1BCP B;  2WAQ E;  4YY3 L;  3LWU A;  4K14 A;  5C3W A;  5CMD A;  3MXN A;  1BBW A;  2AKW B;  1PFM A;  4IUR A;  1D7Q A;  2JA7 B;  1NR4 A;  2PW5 A;  1EY0 A;  3BU2 A;  4KY7 A;  4EQN A;  3L0O A;  1GUG A;  1KDB A;  2E76 C;  4DU9 A;  4DR1 L;  4O42 A;  1N33 Q;  1E2W A;  2HQL A;  1OXX K;  2P5Z X;  1VQL A;  2IWH A;  1NE3 A;  1XTC D;  1LAB A;  4E6I A;  3JAM i;  1H9R A;  3I3C A;  2WIN B;  1XJV A;  2OTL A;  3RZO B;  4LAA A;  2N88 A;  4JI3 Q;  2K14 A;  4FO2 A;  4JVZ A;  5EKL A;  5T1G A;  1HHV A;  1D5M C;  3J7A F;  3K5M A;  1CSQ A;  4G7Z C;  3RN5 A;  1XYI A;  3F8T A;  1YIT A;  4K5V A;  2UUA Q;  5IOC A;  1KNA A;  2K75 A;  4FDB A;  4WRD A;  2EVB A;  2G9H D;  2NTS A;  4B08 A;  4NXM L;  4JI8 L;  3Q23 A;  4KLK A;  2AWN A;  4MIU A;  2EXZ A;  2UXC L;  3GTL H;  4NPS A;  4BY1 H;  2B63 B;  5CV4 A;  3SXH A;  3S2H H;  1FNV A;  4LF6 L;  3ONA B;  3SK4 A;  3S1R B;  3DUZ A;  4N9T A;  3W1B A;  4LF8 L;  4XIG S;  2K05 A;  5HGT A;  2DY8 A;  3D4R A;  2EY6 A;  1TS5 A;  2RQX A;  4DUY L;  3TRZ A;  3GTO B;  3TP6 A;  2VUM B;  1D5Z C;  4HID A;  3RNU A;  2WP8 J;  2LMC B;  3A56 A;  3RZD H;  2JQO A;  2DNC A;  1G91 A;  4K0K Q;  1SMY D;  5E4W C;  4A3G B;  1RTO A;  2JSO A;  4J1M A;  4JI1 L;  2K1B A;  1S72 A;  1J6Q A;  2JA8 B;  3ERS X;  2B39 A;  1CM9 A;  4JI2 Q;  2F0D A;  3GV6 A;  3GTG H;  1PTO B;  4JI0 Q;  2PQA B;  1YVC A;  4XT1 B;  3FMC A;  1K3R A;  4I7A A;  4ILW A;  3I7F A;  5ELB A;  3J81 L;  4A3C G;  2WKC A;  4N8X 1;  4K8J A;  2R92 H;  2PQE A;  3EVQ A;  2A6H C;  1Q8K A;  3CCQ A;  1F9P A;  4JBK A;  2PQA A;  4G7H C;  1Z6H A;  3KLS A;  4QY7 A;  3H3V I;  4KN7 C;  2JK8 A;  3C1E A;  1VQG A;  2AWO A;  2R7Z G;  4I65 A;  2R3Z A;  4LWC A;  1U4P A;  1NMG A;  3NBH A;  1UAP A;  4C3I G;  3K8A A;  3K0Y A;  1RF2 D;  1STN A;  3M4P A;  4QQB X;  4C1N K;  4DF7 A;  1GOZ A;  4CJ1 B;  4KJN A;  4MTN A;  4B3S L;  5M3F G;  5IGE A;  3T1Y Q;  1HZB A;  3DM1 A;  3C46 A;  2F3W A;  2I5H A;  1A3T A;  4ZKC B;  2C9O A;  1RTN A;  1JJ2 A;  1NAP A;  4JOI C;  3W1G A;  2JA5 G;  1IYJ B;  5K36 H;  4A3L G;  1EY6 A;  5COY A;  5CC4 A;  3AMU A;  4OO1 I;  4JG2 A;  2CVR A;  2N8N A;  2D0P A;  3TZU A;  4DV5 Q;  1F2L A;  2K03 A;  4A3B B;  3H6M A;  3I72 A;  1S5E D;  3OIP A;  2E5L Q;  2L12 A;  1CQV A;  1VQP A;  4P2C B;  3LGJ A;  3GD7 A;  4AYB E;  1V8Q A;  3PQI A;  4KKS A;  1JMC A;  2UUB Q;  1N32 L;  1PYB A;  4QIW E;  5TSS A;  2JJQ A;  4RH6 A;  5IP7 G;  3M3Y B;  4PMW A;  1MBY A;  4CJ0 B;  3NWT A;  1YHQ A;  2Z4H A;  4JI5 L;  5DAU A;  5IYD G;  1YNN D;  5I6W A;  4JW0 A;  1ONL A;  4DR1 Q;  5GRO A;  2JYO A;  1QZG A;  2HDM A;  5ELD A;  1IKL A;  1B8A A;  1K0R A;  2BCO A;  2J7Z A;  4KHP Q;  2BDN A;  3GTM H;  4C3I H;  1IZ6 A;  2O2L D;  4HJ8 A;  1QNK A;  1U5K A;  2PYK A;  1VQJ A;  4NXN L;  4DV2 Q;  1QCB D;  4I7Z C;  1TXY A;  2IX1 A;  3CW2 C;  2QA4 A;  2E2I H;  1WD1 A;  1AP0 A;  2ICI A;  5A2Q E;  2Y0S B;  1PDQ A;  4TVA B;  1UE1 A;  1VF7 A;  1J9O A;  4JI8 Q;  5GQO A;  2UUC Q;  1JJG A;  2VS1 A;  1D1I A;  4K2L A;  1JR0 D;  3HRZ C;  1LUZ A;  3U9O A;  3HOX H;  1BBU A;  3PO3 G;  2X6L A;  2MUY A;  3HOZ H;  1HFN A;  2D5D A;  3E9I A;  1I94 L;  4LF6 Q;  3CP0 A;  4OEM B;  4B3M L;  1DON A;  1ENF A;  3G6E A;  1SFO H;  1TR5 A;  2XGT A;  4F87 A;  4BBS G;  4PZ7 A;  1VQ8 A;  1PRT D;  2IT1 A;  3M9B A;  3FEW X;  1PFN A;  2A5H A;  4DUY Q;  3ZJY C;  4DV7 L;  5AJ3 Q;  1Y8N B;  4JBJ A;  4R8N A;  3J81 j;  2R92 B;  4X6A H;  3DEP A;  4HIM A;  1JOK A;  3TQY A;  4JI1 Q;  5JPN C;  1TS2 A;  3JC6 6;  2RA4 A;  2AUK A;  2GN5 A;  1NCV A;  1B4O A;  2C35 B;  3I4N B;  4ZK9 B;  2OCE A;  5C4Z A;  1E2Z A;  2JA6 G;  1SYF A;  2B2U A;  2E75 C;  2PZU A;  5IYB H;  2Z6K A;  3I56 A;  1T9H A;  4A3D G;  1II3 A;  3TME A;  5LMN Q;  4A3K H;  4QCL A;  2FMC A;  1M8A A;  4UPA A;  2EJG C;  2V4D A;  3TRE A;  1R4P B;  5D14 A;  5IWA L;  4JI4 Q;  1K3B C;  4ZCK A;  4A3I G;  3MC0 B;  1XMQ L;  1GUN A;  2R6G A;  4DA2 A;  3RLN A;  1A0I A;  1X3P A;  4MHE A;  1G2S A;  3HOV G;  1CKO A;  3ER0 A;  1EU4 A;  1KDC A;  3NBI A;  1OTC A;  1C4Q A;  4LUO A;  2VNU D;  2ZTC A;  3OWF A;  3K59 A;  4BA2 I;  3I90 A;  3CKI B;  1DD2 A;  3A5Z B;  1VQO A;  3M4O H;  4C1N I;  4FYD A;  3QG1 A;  2F0S A;  3A7L A;  3E9H A;  2C5C A;  3PIO 3;  4G4K A;  2BA1 A;  5HY6 A;  3JAM E;  2F52 A;  3BYY B;  4JC0 A;  4HED A;  1B44 D;  4KD4 A;  1B7Y B;  1WD0 A;  2XVS A;  2K04 A;  4LFB L;  1K0S A;  2NWG A;  3ITP A;  4O1N A;  1KRT A;  4B3R Q;  2FHT A;  2WV6 D;  2OEO A;  3FKI G;  1TKW B;  2VB3 X;  2OF1 A;  2EXD A;  1LTA D;  2G9D A;  1YNX A;  1ROD A;  3GTM B;  4LMQ D;  1LM0 A;  2QGQ A;  4XXE A;  1N32 Q;  1P8L A;  4A3M H;  4HIK A;  4DR5 L;  3S15 H;  1LAC A;  4X62 Q;  1CHP D;  1N36 L;  2ENB A;  4JV5 Q;  1TS3 A;  2M2L A;  4IUQ A;  1KLU D;  1HTL D;  4A3D H;  1I4R A;  3T53 B;  1B50 A;  4H02 A;  4JI5 Q;  4FXK C;  4AIM A;  1C8C A;  3F2U A;  3G7L A;  1SNC A;  1AH9 A;  2N78 A;  5J39 A;  3A74 A;  2EOT A;  5K5P A;  5M3M B;  1WTX A;  1UE5 A;  2JN4 A;  1VMC A;  2A68 D;  3HOX B;  3HOV H;  3CQZ H;  1KAB A;  3HOW G;  3HOZ B;  3PV0 A;  4RHS A;  5C4X H;  3NQT A;  2UU9 L;  4NXN Q;  4KHZ A;  4IUP A;  4M8A A;  4BBR G;  3H15 A;  4G57 A;  4GKK L;  4CHT B;  4DR3 L;  1SFO B;  4KKU A;  2XSC A;  3E0E A;  3MZ5 A;  1MIU A;  3URY A;  4DAV A;  5AFW A;  2VZA A;  1IBK L;  2K33 A;  1VQI A;  2KEC A;  1EOV A;  1NMF A;  3KLS X;  4FVM A;  1D6E C;  1VQD A;  2JA7 G;  3K7A H;  5IGC A;  1DOL A;  3S17 H;  3IL8 A;  1ZEQ X;  3H0G H;  3Q0A A;  1I94 Q;  2IL8 A;  2EYJ A;  2K4K A;  1HFG A;  4B3M Q;  4ODG A;  2B8F A;  2IX0 A;  2KOL A;  5JOB A;  4X3S A;  2F1M A;  5IP9 G;  3GTJ B;  1Q46 A;  1JIC A;  1L1O B;  2X6G A;  4C2M H;  4V19 0;  1S3O A;  1HNZ L;  4LFA L;  4A93 G;  3QIA A;  5C3E H;  2PNR C;  2PNH A;  2L5T A;  1QOH A;  3OTO Q;  4K6L A;  1LTL A;  2KHS A;  2H4O A;  2BDO A;  3TDQ A;  1N33 L;  3MEH A;  5BN3 A;  2RDG A;  2K50 A;  3NEN A;  4A3K B;  1PZJ D;  1FD7 D;  3PGZ A;  1L1O A;  3I73 A;  3GTP H;  2HQE A;  3MVV A;  3RR5 A;  4RFB A;  1AZP A;  3UI2 A;  1PH6 A;  4XYQ A;  4NDX A;  1XMO L;  1HTP A;  1TWF H;  5EBC A;  4JI3 L;  2KCN A;  3L7Z C;  1GD7 A;  1L0W A;  5ISR A;  2G5D A;  1EUJ A;  3CCL A;  4DR6 L;  3A54 A;  1CA5 A;  1U4L A;  1EY7 A;  2F0M A;  1IKM A;  3HOU B;  3TS2 A;  3KJO A;  1U0L A;  3S1M H;  4OX9 L;  3CCV A;  2L15 A;  2ZJR A;  1I5F A;  1HR0 W;  4UP7 A;  2BA0 A;  4DR4 Q;  3FP9 A;  4BXX G;  1JB3 A;  3MA2 B;  5IWA Q;  1PZK D;  1CSP A;  1LYL A;  2Z8L A;  4Q0F A;  1GUS A;  2HCC A;  4IUV A;  3KLW A;  4QF4 A;  3K57 A;  4HSV A;  1UUP A;  4XT3 B;  2XRQ D;  1YZ6 A;  2JA8 G;  1YJ9 A;  3HKZ G;  3H94 A;  1C48 A;  1X3G A;  2LKV A;  2YTV A;  4IUU A;  2B3G A;  2QF7 A;  4OEL B;  1QIL A;  2FMM A;  1RJT A;  1NY4 A;  4X64 Q;  2ES2 A;  1WYD A;  2JEB I;  1G51 A;  1VDZ A;  3SK5 A;  4LF9 Q;  2A8V A;  4A3E G;  5CV9 A;  1EOT A;  2WB1 G;  3OPO A;  3S1Q B;  3S15 B;  2RHS B;  2XWJ B;  2F0E A;  5KYL A;  1KAA A;  1F2M A;  1BO0 A;  3VYU A;  2RBM A;  2D2C C;  1I4H A;  2EY2 A;  2MJ8 A;  2VQE L;  2E2J H;  1HA5 A;  2ICE C;  1MSG A;  4DK6 C;  1WTQ A;  1MI2 A;  1YNJ C;  1HUN A;  5T1I A;  4C3J B;  4GNX B;  2RCN A;  3F2D A;  3R8B A;  2AQ3 B;  4IJL A;  1G6Z A;  1HXY D;  2X69 A;  5A35 A;  3T1H Q;  1D2B A;  2A6H D;  3AYH B;  4AYB B;  1GUO A;  3NP8 A;  1CKN B;  1OXV A;  1TVX A;  2B29 A;  2CHB D;  4DNI A;  3MXG A;  4WJW A;  5IGD A;  4KTA A;  4JYA L;  2HD3 A;  4QIW B;  1B9M A;  3CQZ B;  1N36 Q;  5C4X B;  1JE5 A;  4GNX A;  1TWG H;  4KKT A;  3C2P A;  3QOL A;  1KNE A;  5HGQ A;  1CKN A;  2WAC A;  4OWW B;  1TWA H;  5LMU L;  4NB3 A;  3EQL C;  1CA6 A;  5FLX L;  1UEB A;  5JJK A;  3CAM A;  2B2W C;  4A3B G;  3KBX A;  1HCZ A;  5BN5 A;  2LY7 A;  5G3L F;  3S17 B;  3KDF B;  4X65 L;  4LW1 A;  1ML0 D;  3H0G B;  2JE6 I;  2CWP A;  2OWO A;  1F9Q A;  3J80 L;  3HOY G;  2HT1 A;  3PIP A;  2KCM A;  3QR8 A;  4GKK Q;  5DM7 3;  4DAM A;  4OWT B;  4F8M A;  2MNA A;  4DR3 Q;  3CXC A;  1Q7Y C;  1TU2 B;  1HNW Q;  1BCP C;  2IHF A;  4DV5 L;  4RAU C;  5C3E B;  1IBL L;  3KDF A;  1ZKO A;  3FVQ A;  1NUC A;  1IBK Q;  4X3T A;  1QNU A;  2E5L L;  2O5I C;  1MHW C;  3J81 i;  3MTS A;  1JJC B;  2Q8R E;  3DHQ A;  3AFP A;  5M5W B;  1X6O A;  1SE2 A;  3SR1 A;  4PZ8 A;  3GTP B;  2OQ0 A;  2NZH A;  1BBX C;  3NSW A;  5FO9 B;  2ZJQ A;  4LF5 L;  1TWF B;  3KFU A;  3VR4 A;  1LTR D;  1HNZ Q;  4LFA Q;  3CMA A;  1EYC A;  4C3H H;  4UP9 A;  2KED A;  5M9O A;  4RCO A;  3VR2 A;  3I4M G;  3S1M B;  1VCI A;  4M1U B;  1IW7 C;  2ZXR A;  4JBM A;  3GQB A;  4KHP L;  3UDF A;  4A4I A;  3GTQ H;  2CFM A;  1MD2 D;  1I4P A;  2NZ1 D;  4X66 Q;  2A73 B;  2IW3 A;  1HJP A;  1SRO A;  4PMB A;  2N3S A;  4DV2 L;  1STB A;  1I6H H;  2K01 A;  1XMO Q;  3EIV A;  1F2Y A;  3AEV A;  1HH2 P;  1R9T H;  1JWS D;  1QJO A;  5C44 B;  3CCS A;  1S5C D;  2ID0 A;  3NEL A;  3VDY A;  4IFD G;  4DR6 Q;  3M85 A;  4G7O C;  4GOP A;  3A8J E;  2RCF A;  4ZKB B;  2V1C C;  3SDZ A;  2QCP X;  1J8I A;  4OX9 Q;  1T5E A;  2UUC L;  5I9O A;  3S2D H;  2NN6 H;  5KIX A;  2XTI A;  2K7V A;  4BS9 A;  1K8G A;  3BZC A;  1CKM A;  1ASZ A;  4KN4 C;  4LNQ A;  1G6P A;  1FJG Q;  4UP8 A;  2EYP A;  3I2Z A; 
#chains in the Genus database with same CATH homology
 4DK1 A;  5CBE E;  3IAY A;  1PTO C;  1AEX A;  1X3Q A;  1Y1W B;  4CKC A;  4A3J B;  1CTM A;  4BWG B;  5D3D A;  3BDL A;  3VA5 A;  4PQX A;  1TWG B;  1BXT A;  2AUJ D;  1D5X C;  3I91 A;  1LT3 D;  2K32 A;  5HUR A;  1Y8O B;  1TWA B;  4C56 C;  1BNZ A;  4IUT A;  2PZW A;  4ZUJ A;  1H9K A;  4ZQ3 A;  3ERO A;  1IYV A;  3PUV A;  1IYU A;  1TT2 A;  4KY6 A;  1W6K A;  2KA7 A;  3BZD B;  1SND A;  1SBB B;  1I4X A;  1O78 A;  1EY8 A;  5KEE A;  1EIH A;  2F0F A;  4ID6 A;  2SNM A;  3PMF A;  5C5M A;  2J0T D;  3OOC A;  5FLX E;  5CV6 A;  1KTK A;  3EJI A;  5CV7 A;  1EFI D;  4KI0 A;  5IT9 E;  3NQI A;  1SE3 A;  4EQO A;  5FKA C;  2HCI A;  2DNE A;  3LX0 A;  3J80 E;  2EYF A;  1ENC A;  1XWE A;  4IUN A;  4XTC S;  2L9H A;  3VA7 A;  4C3H B;  5E4X A;  2Z1C A;  3TP8 A;  3KLR A;  1TS4 A;  2ZT9 C;  1H9J A;  3GTQ B;  2JXM B;  4EGV A;  2E74 C;  5I9P A;  4DGZ A;  3NK9 A;  3OIQ A;  3W3A A;  1R9T B;  1LTG D;  3PUY A;  3TZD A;  4HMJ A;  5C3X A;  3I4L A;  3GTL B;  4BY1 B;  2ZXO A;  2A69 C;  4FXD A;  1ESR A;  3MWY W;  1Q12 A;  4K5X A;  3S2H B;  1IHZ A;  3IFT A;  3NTI A;  1Q3L A;  1BF4 A;  1B1Z A;  2NN6 I;  2F0U A;  3E0J A;  1LV9 A;  4CGY B;  3DMU A;  2AQ1 B;  1WCM B;  4R9W A;  2TSS A;  2IJ0 A;  1SYD A;  5EKK A;  4DNT B;  1A15 A;  2MP1 A;  1IL8 A;  2ZXP A;  3HG9 A;  3RZD B;  1EYA A;  3MXU A;  2Q8I B;  1UEA B;  2RVL A;  1K8O A;  3PUX A;  4Y7N B;  1PRT F;  2B2U C;  2K28 A;  3CHB D;  2RDF A;  2IX3 A;  1I4G A;  3GTG B;  1Q8I A;  4XQN A;  1SNM A;  3BDC A;  1M4V A;  3LWE A;  5IOD A;  1DYQ A;  2J4X A;  3H09 A;  3TN2 A;  3HS0 C;  2KVM A;  2RKS A;  3C3L A;  3R93 A;  3SE0 A;  2L11 A;  4LJZ C;  2NVT B;  4UDU C;  4HMI A;  1BUV T;  1S5B D;  5C5L A;  1ZYR C;  1A2U A;  2EJM A;  1F9S A;  3J81 E;  4TKO B;  1AZQ A;  3OHX C;  1G8Z D;  4KHV A;  2QIL A;  3C1F A;  1SNP A;  4NP5 A;  2KCC A;  4CKB A;  1QE6 A;  2DN8 A;  2B2Y A;  4J6H A;  1S4Z A;  4B9W A;  4C3J G;  1FNU A;  3AB9 A;  2QKI C;  3T51 B;  1E0B A;  3NWS A;  2LS0 1;  4FF4 A;  2F0J A;  2FJ2 A;  2KJX A;  4QUF A;  1YNJ D;  2L0C A;  4HCE A;  1HPC A;  4RGM A;  4ZAI A;  3T56 B;  2FFK B;  2MGS A;  3V05 A;  1O7Z A;  2KUM A;  1JQY D;  2NUC A;  2BOS A;  5CGK A;  4DAY A;  4LK1 C;  1SJE D;  1S5D D;  4WFN 3;  4C3I B;  3VR5 A;  5CV8 A;  2F0V A;  2F3V A;  1K8M A;  2WAQ B;  2E2I B;  3FDT A;  3D6C A;  2AQ2 B;  2JA5 B;  1Q90 A;  2OT2 A;  3S1N B;  2XWB B;  4KMU C;  3A8K E;  5I4D A;  2XRS D;  4DAP A;  4OIJ A;  2D9U A;  4IFD J;  2F4I A;  5C4H A;  4QMG A;  1BCP D;  2M9V A;  4L6T B;  4DXG A;  3X3N A;  4ZRZ A;  4RCN A;  1GUT A;  1RKN A;  1QB5 D;  4DFA A;  2IPK D;  1EZ8 A;  4CBV A;  1CFM A;  5E1F A;  4EVO A;  1STE A;  1CK1 A;  5COR A;  4K6D A;  1I3Q B;  5C0X G;  2PPB C;  1EEF D;  2EJF C;  5F2D A;  4RHR A;  1NSN S;  1DOK A;  1TQO A;  1IW7 D;  3E6Z X;  1OO9 B;  1DCZ A;  3IFD A;  1CZW A;  4BA1 I;  2EYO A;  4YIJ A;  1R4Q B;  1EWC A;  1ENA A;  2CW0 C;  1B3A A;  4HR7 B;  2EE1 A;  2H1E A;  4F88 A;  3RD4 A;  3VYR A;  2EDG A;  1A3V A;  4ABN A;  1GXD C;  2HUG A;  1SNO A;  4JK1 C;  4DXF A;  2PCF B;  3R2T A;  2CQA A;  2SOB A;  2F0K A;  1JC7 A;  3M4O B;  5I2Y A;  3OW7 A;  3S16 B;  3DWP A;  5JAV A;  1PTO D;  1PRT B;  2NVQ B;  2PW7 A;  2SDF A;  1U4M A;  5FO8 B;  5KGU A;  5C0X H;  1FYC A;  1PFB A;  3M4Y A;  3K5L A;  1XXG A;  3NE5 B;  4A3M B;  3SEB A;  5ELE A;  4H13 C;  3FRP B;  2D62 A;  2N55 A;  4ZUI A;  3BG3 A;  3RLF A;  2MPM A;  4A3D B;  1AN8 A;  4TQU S;  1PLF A;  3W2D A;  2XN9 C;  1A6X A;  2LFN A;  1HQM C;  2WII B;  5IGB A;  1PMR A;  1Y8P B;  1GHK A;  2F0I A;  3HOV B;  4HN7 A;  3M7G A;  4CJ2 C;  1HRJ A;  4OO1 G;  2M00 A;  1O7L A;  1SJH D;  1U4R A;  3CRL C;  4FF3 A;  1B2T A;  5IIF A;  1W6J A;  2A6E C;  2RSO A;  3RUZ A;  5KYI A;  3K58 A;  3K7A B;  3DEO A;  1G29 1;  3TBI B;  2B2T A;  2EY1 A;  1SSO A;  1FGB D;  4FXG C;  1T5X D;  5FK9 C;  1V1P B;  1E2V A;  3CRK C;  2YU9 B;  1SE4 A;  2B2V C;  3EFX D;  4TSS A;  1ESF A;  4C2M B;  4GZY C;  4N9P A;  5BN4 A;  4IN3 A;  1VMP A;  1V1P A;  1UNS A;  1WTP A;  3T13 A;  3D31 A;  1RD9 D;  2O5J C;  4RGO S;  4TRD A;  1TY0 A;  3AU7 A;  2QEJ C;  3NHH A;  1H9S B;  1LTI D;  3OWE B;  2B2V A;  3G6J B;  2NTT A;  2A69 D;  1L0Y B;  2BE5 C;  1AW7 A;  3OMG A;  1BR9 A;  5CR3 A;  2QDB A;  1H9S A;  5J22 A;  5JEA G;  3VYT A;  2EYL A;  5KNB A;  3KUP A;  1Z7T A;  4FF1 A;  2RDH A;  2Z4I A;  1O7Y A;  2NVX B;  5DM6 3;  4QB4 A;  3EA6 A;  4A93 B;  2L55 A;  1SYE A;  5C0X I;  5A2Q L;  3A8I E;  3R3O A;  2E2J B;  1SYB A;  3KF8 A;  2L4N A;  2O4X A;  3O13 A;  4DK0 A;  5CBA E;  1Q1E A;  3K5N A;  2PZT A;  3KK7 A;  1OXU A;  3P75 A;  3H3V C;  3NTK A;  1RDP D;  1FR3 A;  5KNC A;  1GUW A;  1WVL A;  4K5W A;  3H91 A;  1F2Z A;  3P7J A;  2OXP A;  1O80 A;  5K36 G;  1ZYR D;  4IAL A;  4U68 A;  3BYT B;  2HDL A;  4IZ8 A;  4OL7 A;  5D3I B;  4PV1 C;  4IFD H;  4NMZ A;  3N6R A;  5CV5 A;  1EWH A;  4PNY A;  5JEA H;  3BS1 A;  2K6A A;  5I6Y A;  2JP1 A;  1CHQ D;  3HKZ B;  1EQT A;  3E5S A;  4K8I A;  3L9A X;  3RMH A;  1EY9 A;  1LTB D;  4KD3 A;  4A3E B;  2I46 A;  2F0L A;  3HEJ A;  1BOS A;  2WB1 B;  3MFY A;  2EYM A;  4NW2 A;  5KND A;  3WOE A;  1PYW D;  4HAE A;  4MN3 A;  3D4W A;  1EY4 A;  1RCV D;  1EIG A;  1SXT A;  4QUC A;  1XX8 A;  4H0L C;  3BVG A;  2EPB A;  2VB2 X;  2NBF A;  2F0H A;  4U67 3;  1FNW A;  3JAM L;  1STY A;  5C0X J;  3SK6 A;  1DM0 B;  1LT6 D;  1HA6 A;  1I6H B;  1A3U A;  3QOJ A;  3T4A C;  1SAP A;  1JOR A;  3HOY B;  1KLG D;  3BVZ A;  2NB0 A;  1TII D;  4KK7 A;  3S2D B;  1JOO A;  3MHB A;  4ULL A;  5EPL A;  4ME5 A;  2F0Q A;  1DJR D;  1STG A;  3Q6S A;  1JCK B;  2XNA C;  3NPP A;  3PUW A;  1QWY A;  3VR6 A;  3V2T A;  3ERQ A;  2K5W A;  2KQ3 A;  3HZX A;  5M5X B;  3HP3 A;  3Q24 A;  5C4J B;  5JVH 3;  3I4M B;  1Z47 A;  4H44 C;  4UAI A;  3QO2 A;  5CYU A;  5IGF A;  3NTH A;  3T16 A;  5JVG 3;  5EJW A;  4FNF A;  2CW0 D;  2Q8T A;  1HUM A;  5JPM C;  3J7A V;  2B2Y C;  1EL0 A;  1ILP A;  1OXT A;  5EPJ A;  4IFD I;  3OMC A;  1EQV A;  2R61 A;  4OIK A;  2NVY B;  2DY7 A;  1BDO A;  3P20 A;  2TMP A;  2L1B A;  1V43 A;  3MFG A;  1SMY C;  1V1O A;  4JBW A;  3U9S A;  4XYO A;  4F7X A;  2PO4 A;  4RKL A;  4Z9C B;  3N52 A;  3NUC A;  2RSN A;  2F0G A;  1Q1B A;  2EYH A;  2NYZ D;  4BY7 B;  2JEA I;  1DZ1 A;  1VF5 C;  1F9R A;  1LLR D;  3GP7 A;  3R2I A;  3KBG A;  4A3F B;  1OXS C;  2K5D A;  5JJZ A;  4IQZ A;  4RGN A;  4OGQ C;  1I6V C;  1LT4 D;  4B9X A;  2B8G A;  4RKB A;  4DN4 M;  1WTR A;  1ZXT A;  3TP5 A;  4RGT A;  1ET9 A;  1WTW A;  3GO5 A;  2R7Z B;  2VXW A;  1CQF A;  1X32 A;  4L63 B;  1CI3 M;  4OHJ A;  4NKL A;  4ZYS A;  1GJX A;  1TY2 A;  3DXJ C;  3K6O A;  1WTV A;  5M3F B;  3GV3 A;  1STA A;  1JWM D;  2A6E D;  2I07 B;  1K83 B;  2F0T A;  2MHV A;  3TSS A;  3PUZ A;  4WOR A;  1B9N A;  3TP7 A;  1BCP F;  1BQQ T;  3V96 A;  1WTO A;  2R93 B;  3DWA A;  3BDO A;  5JEA J;  1AFP A;  1KDA A;  1EYD A;  1A2T A;  1RHP A;  2SEB D;  2EY5 A;  3ZYY X;  1B53 A;  1YNN C;  4R8I A;  1CZG A;  1F77 A;  3IKJ A;  5ELC A;  4FF2 A;  1MSH A;  3VR3 A;  4V0B A;  1I50 B;  4S3S A;  4XQJ A;  1D1K A;  1LO5 D;  3CU7 A;  3WDN A;  3MAQ A;  3WOF A;  2A74 C;  1EU3 A;  3Q22 A;  1ICW A;  5C6A A;  5EGT A;  1DOM A;  2BE5 D;  2K5Q A;  3A55 A;  4J8Q A;  3BVM A;  3MXP A;  1QG7 A;  1PZI D;  3LNN A;  4FP5 D;  4DNR B;  3DWQ A;  1Y69 U;  1PXU A;  5J1Z A;  5I2X A;  3PIP 3;  5LHY 1;  4H7B A;  3PO3 B;  1G2T A;  1PRT C;  4CKE A;  3D8G A;  5ELF A;  5D65 A;  4BBS B;  4X3U A;  1DXM A;  2F0O A;  1PTO F;  2F03 A;  5DNF A;  4K2K A;  1S5F D;  3QB3 A;  4PMC A;  3HGB A;  3FPP A;  3I70 A;  3M7N A;  1JWU D;  2YYZ A;  1ET6 A;  4RA8 A;  1HQR D;  4EQP A;  3I8Z A;  3GTK B;  2F0P A;  1EZ6 A;  4Q5V A;  2JA6 B;  3D4D A;  1JOQ A;  4XQQ A;  4HSP A;  3S9W A;  3FPU B;  4HCS A;  3NXW A;  3X3M A;  2B2T C;  3P1H A;  5EQ0 A;  1NR2 A;  1TWH B;  4A3I B;  4HTH A;  4KV6 A;  1I4Q A;  1LT5 D;  3QJY A;  2E2H B;  3ND8 A;  2F0W A;  3OSO A;  2KEE A;  1H9M A;  1STH A;  3SK8 A;  1LTS D;  5FOB B;  5M5Y B;  3ND9 A;  1L0X B;  1SYC A;  2EZV A;  1SNQ A;  3VYS A;  5LL6 X;  3J7Y W;  2XIW A;  1SEB D;  5DEH A;  3SHL A;  4C3H G;  1ILQ A;  1CT1 D;  1MGS A;  4ZLT F;  3FKI B;  1PTO H;  1SDF A;  3QWN A;  5KRU A;  4X3K A;  3A7A B;  3PO2 B;  2PMZ B;  2E2D C;  1U9R A;  1EY5 A;  5IT9 L;  3S14 B;  5EBD A;  1EEI D;  3D6W A;  2A68 C;  5NUC A;  3D3R A;  3K5O A;  5EPK A;  5G3L D;  2NN6 G;  3SVM A;  1GHJ A;  3L3O C;  2WKD A;  4RWS C;  5E3F A;  1JE4 A;  5FO7 B;  1TWC B;  4KJO A;  3HOW B;  2F0N A;  4KY5 A;  4OO1 H;  1Y1V B;  4BBR B;  2SNS A;  2GA4 B;  2FIN B;  5LL6 S;  1SYG A;  4XDX A;  4L8J A;  2B2W A;  5IGG A;  1LTT D;  5EKI A;  1BCP B;  3LWU A;  4K14 A;  5C3W A;  5CMD A;  3MXN A;  1PFM A;  4IUR A;  2JA7 B;  1NR4 A;  2PW5 A;  1EY0 A;  4KY7 A;  4EQN A;  1GUG A;  1KDB A;  2E76 C;  4DU9 A;  4O42 A;  1E2W A;  1OXX K;  2IWH A;  1XTC D;  1LAB A;  4E6I A;  1H9R A;  3I3C A;  2WIN B;  3RZO B;  4LAA A;  2N88 A;  1HHV A;  4FO2 A;  5EKL A;  5T1G A;  1D5M C;  3J7A F;  3K5M A;  4G7Z C;  1XYI A;  4K5V A;  5IOC A;  1KNA A;  4WRD A;  2EVB A;  2G9H D;  2NTS A;  4B08 A;  3Q23 A;  2AWN A;  4MIU A;  2EXZ A;  2B63 B;  5CV4 A;  3SXH A;  1FNV A;  3ONA B;  3SK4 A;  3S1R B;  3DUZ A;  4N9T A;  4XIG S;  2K05 A;  5HGT A;  2DY8 A;  3D4R A;  2EY6 A;  1TS5 A;  2RQX A;  3GTO B;  3TP6 A;  2VUM B;  1D5Z C;  2WP8 J;  2LMC B;  3A56 A;  2DNC A;  1G91 A;  1SMY D;  5E4W C;  4A3G B;  1RTO A;  2JSO A;  4J1M A;  2K1B A;  2JA8 B;  2B39 A;  1CM9 A;  2F0D A;  3GV6 A;  1PTO B;  4XT1 B;  3FMC A;  4ILW A;  5ELB A;  3J81 L;  2WKC A;  4K8J A;  2PQE A;  3EVQ A;  2A6H C;  1F9P A;  4G7H C;  1Z6H A;  3KLS A;  4KN7 C;  3C1E A;  2AWO A;  4I65 A;  2R3Z A;  1U4P A;  3NBH A;  4C3I G;  1UAP A;  3K0Y A;  1RF2 D;  1STN A;  4C1N K;  4DF7 A;  1GOZ A;  4CJ1 B;  4KJN A;  5IGE A;  3DM1 A;  3C46 A;  2F3W A;  1A3T A;  4ZKC B;  2C9O A;  1RTN A;  1NAP A;  5K36 H;  1EY6 A;  5COY A;  5CC4 A;  3AMU A;  4OO1 I;  2CVR A;  3TZU A;  1F2L A;  2K03 A;  4A3B B;  3H6M A;  3I72 A;  1S5E D;  3OIP A;  2L12 A;  1CQV A;  4P2C B;  3GD7 A;  1V8Q A;  4KKS A;  5TSS A;  4RH6 A;  3M3Y B;  4PMW A;  1MBY A;  4CJ0 B;  3NWT A;  2Z4H A;  5DAU A;  1YNN D;  5I6W A;  1ONL A;  2JYO A;  2HDM A;  5ELD A;  1IKL A;  2BCO A;  2J7Z A;  2BDN A;  2O2L D;  1QNK A;  2PYK A;  1QCB D;  4I7Z C;  2IX1 A;  1WD1 A;  1AP0 A;  2ICI A;  5A2Q E;  2Y0S B;  1PDQ A;  1VF7 A;  1J9O A;  1D1I A;  4K2L A;  1JR0 D;  3HRZ C;  3U9O A;  2X6L A;  2MUY A;  1HFN A;  2D5D A;  1DON A;  1ENF A;  1TR5 A;  4F87 A;  1PRT D;  2IT1 A;  3FEW X;  1PFN A;  2A5H A;  1Y8N B;  4R8N A;  2R92 B;  3DEP A;  1JOK A;  5JPN C;  1TS2 A;  2RA4 A;  2AUK A;  1NCV A;  1B4O A;  3I4N B;  4ZK9 B;  5C4Z A;  1E2Z A;  1SYF A;  2B2U A;  2E75 C;  2PZU A;  1II3 A;  3TME A;  4QCL A;  2FMC A;  1M8A A;  2EJG C;  2V4D A;  1R4P B;  5D14 A;  3MC0 B;  1GUN A;  2R6G A;  4DA2 A;  1X3P A;  4MHE A;  1G2S A;  1EU4 A;  1KDC A;  3NBI A;  1C4Q A;  2VNU D;  3OWF A;  3K59 A;  4BA2 I;  3I90 A;  3CKI B;  1DD2 A;  4C1N I;  4FYD A;  3QG1 A;  2F0S A;  3A7L A;  3PIO 3;  2C5C A;  4G4K A;  2BA1 A;  3JAM E;  3BYY B;  4HED A;  1B44 D;  4KD4 A;  1WD0 A;  2XVS A;  2K04 A;  2NWG A;  3ITP A;  4O1N A;  2FHT A;  2WV6 D;  2OEO A;  1TKW B;  2VB3 X;  2OF1 A;  1LTA D;  2G9D A;  1ROD A;  3GTM B;  4LMQ D;  4XXE A;  1LAC A;  1CHP D;  2ENB A;  1TS3 A;  2M2L A;  4IUQ A;  1KLU D;  1HTL D;  1I4R A;  3T53 B;  1B50 A;  4FXK C;  1C8C A;  3F2U A;  3G7L A;  1SNC A;  5J39 A;  2EOT A;  5K5P A;  5M3M B;  1WTX A;  1VMC A;  2A68 D;  3HOX B;  1KAB A;  3HOZ B;  3PV0 A;  4RHS A;  3NQT A;  4KHZ A;  4IUP A;  4M8A A;  4G57 A;  4CHT B;  1SFO B;  4KKU A;  2XSC A;  3MZ5 A;  3URY A;  4DAV A;  5AFW A;  2K33 A;  2KEC A;  3KLS X;  4FVM A;  1D6E C;  5IGC A;  1DOL A;  3IL8 A;  1ZEQ X;  3Q0A A;  2IL8 A;  2EYJ A;  1HFG A;  4ODG A;  2B8F A;  2IX0 A;  2KOL A;  5JOB A;  4X3S A;  2F1M A;  3GTJ B;  1JIC A;  2X6G A;  4V19 0;  3QIA A;  2PNR C;  2L5T A;  1QOH A;  4K6L A;  2KHS A;  2H4O A;  2BDO A;  3TDQ A;  3MEH A;  5BN3 A;  2RDG A;  4A3K B;  1PZJ D;  1FD7 D;  3I73 A;  2HQE A;  3MVV A;  4RFB A;  1AZP A;  3UI2 A;  4XYQ A;  4NDX A;  1HTP A;  5EBC A;  2KCN A;  3L7Z C;  5ISR A;  3A54 A;  1CA5 A;  1U4L A;  1EY7 A;  2F0M A;  1IKM A;  3HOU B;  2BA0 A;  1JB3 A;  3MA2 B;  1PZK D;  2Z8L A;  4Q0F A;  1GUS A;  2HCC A;  4IUV A;  4QF4 A;  3K57 A;  4HSV A;  1UUP A;  4XT3 B;  2XRQ D;  3H94 A;  1C48 A;  2LKV A;  4IUU A;  2QF7 A;  1QIL A;  2FMM A;  1RJT A;  2JEB I;  1VDZ A;  3SK5 A;  5CV9 A;  1EOT A;  3OPO A;  3S1Q B;  3S15 B;  2XWJ B;  2F0E A;  5KYL A;  1KAA A;  1F2M A;  1BO0 A;  3VYU A;  2RBM A;  2D2C C;  1I4H A;  2EY2 A;  2MJ8 A;  1HA5 A;  2ICE C;  1MSG A;  1WTQ A;  1MI2 A;  1YNJ C;  1HUN A;  5T1I A;  4C3J B;  3R8B A;  2AQ3 B;  1G6Z A;  1HXY D;  2X69 A;  5A35 A;  1D2B A;  2A6H D;  4AYB B;  1GUO A;  3NP8 A;  1OXV A;  1TVX A;  2CHB D;  5IGD A;  3MXG A;  4WJW A;  4KTA A;  4QIW B;  1B9M A;  3CQZ B;  5C4X B;  4KKT A;  3C2P A;  3QOL A;  1KNE A;  2WAC A;  3EQL C;  1CA6 A;  5FLX L;  2B2W C;  3KBX A;  1HCZ A;  5BN5 A;  2LY7 A;  5G3L F;  3S17 B;  1ML0 D;  3H0G B;  2JE6 I;  1F9Q A;  3J80 L;  5DM7 3;  4F8M A;  1TU2 B;  1BCP C;  4RAU C;  5C3E B;  1ZKO A;  3FVQ A;  1NUC A;  4X3T A;  1QNU A;  2O5I C;  3MTS A;  2Q8R E;  3DHQ A;  5M5W B;  3GTP B;  1SE2 A;  3SR1 A;  1BBX C;  3NSW A;  5FO9 B;  1TWF B;  3VR4 A;  1LTR D;  1EYC A;  2KED A;  5M9O A;  4RCO A;  3VR2 A;  3S1M B;  1VCI A;  4M1U B;  1IW7 C;  2ZXR A;  3GQB A;  1MD2 D;  1I4P A;  2NZ1 D;  2A73 B;  2IW3 A;  4PMB A;  1STB A;  2K01 A;  1F2Y A;  1JWS D;  1QJO A;  5C44 B;  1S5C D;  2ID0 A;  4IFD G;  3M85 A;  4G7O C;  3A8J E;  4ZKB B;  3SDZ A;  2QCP X;  1J8I A;  1T5E A;  5I9O A;  2NN6 H;  5KIX A;  2K7V A;  4BS9 A;  4KN4 C;  2EYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...