1ZEQX

1.5 a structure of apo-cusf residues 6-88 from escherichia coli
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
b'METMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusF
publication title A Novel Copper-Binding Fold for the Periplasmic Copper Resistance Protein CusF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zeqX01
3TDQA 3E6ZX 2VB2X 2L55A 2QCPX 1ZEQX 2VB3X
chains in the Genus database with same CATH superfamily
3SEBA 1LUZA 3VR6A 4K6LA 3HOVB 1T5EA 4DA2A 2A19A 5BN3A 4ALPA 3PUXA 1JC7A 5ISRA 4A93B 2HHHQ 4OGQC 1E7ZA 1PH7A 1OXXK 1STGA 5E3FA 2LKVA 1K83B 1TWHB 2ZJRA 1I4HA 2BA1A 4XYQA 1Y8PB 4WJ3M 1K28A 2ZXOA 1R4PB 4IJHA 1QE6A 4DK1A 5HGTA 4X3SA 5IT9E 1FJGQ 3R93A 2FFKB 3T1HQ 4BBSB 3E0EA 2Z6KA 1VQCA 1KNEA 3UDGA 1LTBD 1F2MA 1MIUA 4GZYC 3F2DA 2M2LA 1SYBA 2IX3A 1PH4A 1U4LA 1IYJB 3OYYA 4KJNA 2AHOB 2BH8A 2EY6A 4C2MH 3BZKA 2F4IA 2JYOA 1PZKD 1GHKA 1GUGA 3PV0A 1K3RA 5AJ3L 1E2WA 3NP8A 2R7DA 3K5MA 1VMCA 2Q8IB 1LM0A 4LWCA 1U4PA 1H9KA 1SYFA 1JJ2A 2F0JA 1JICA 1NBWA 3I4NG 3M3YH 2ID0A 4PV1C 2NYZD 3IL8A 3I4OA 2Z1CA 3EIVA 1XMOL 4QQBX 2AQ3B 4R4IA 3J81L 1SMYC 2E76C 1LACA 4NKLA 4JI4Q 3HKSA 1HR0W 3D8GA 5EGTA 1BKBA 4DV5Q 4LFCL 5C3EB 1NNXA 1LLRD 3CU7A 1JWSD 5IYDH 2LY7A 4B3TQ 3GTGH 2K5NA 4RKLA 3Q24A 1SR3A 1PYSB 1QVCA 1SSOA 1A15A 1IKLA 4PMWA 2L55A 1L0XB 3DMUA 4Q0FA 1VQMA 4HJAA 3S16H 3PO2H 4M8AA 2VQEL 4POFA 4A3JG 4JK1C 4JV5L 2N3SA 3U9OA 1ET6A 3OW2A 4JBWA 2X69A 4TVAB 1HNWQ 5EAYA 5DAUA 3S17H 3TP6A 3C2PA 5CBAE 3AFQA 4RA8A 1XTDA 5IT9L 3CXCA 1W3SA 1SJHD 4PMCA 2L9HA 3FMCA 1QNKA 1I3QH 1KDBA 5LHY1 3TQYA 2PQAB 5IGFA 4C3JH 1VQNA 2RDHA 3E6ZX 2B39A 3E5SA 1WTWA 4OX9Q 3D6CA 1DM0B 3CAMA 1E2VA 1PRTF 1AZQA 1IBKQ 3JAMi 4JCVE 4FP5D 3VYTA 3CPWA 4O0AA 3GV6A 2A8VA 4R8IA 3LNNA 2F03A 2NVXH 5IYBG 1W6KA 4B3MQ 1FD7D 2A68C 1YNND 2HDMA 1J9OA 1HPCA 1S5ED 2K33A 4DR7Q 1EZ6A 3TBIB 1W6JA 4B3RL 1DZ1A 3NQTA 1QG7A 3PMFA 1CKNA 4A3DB 2E2IH 1PZID 4KHZA 1XPRA 4FXDA 1EYCA 4JYAL 4DR5L 1QVFA 1DOMA 4MZ9A 2A5HA 1BCPF 4EX5A 2B2UC 1VQLA 2LSSA 4B3SQ 1AN8A 3TZUA 1EEFD 4IUNA 2K32A 3H0GH 4TQUS 2L11A 1RD9D 4DAYB 3S1NH 1O80A 5BR8Q 3FKIB 2K6AA 3RD4A 3HOUG 1KD1C 2SOBA 3CD6A 1G2SA 4JI3L 1E22A 4RAUC 1SNQA 1O7YA 2J4XA 4CKBA 3CCJA 2MQHA 4AYBE 3KDFB 5DM63 3D4RA 2VB3X 4X65L 2EYMA 4P73A 1UWVA 2F0DA 3I56A 1QB5D 4RFBA 2QDBA 1ENFA 1CT1D 3ZYYX 2E2HB 1DGSA 1CQFA 2NN6G 3A7LA 3KBGA 5C4JB 1DONA 2E2JB 4X66Q 4WFN3 1WTVA 2UXBQ 4J15A 1E2ZA 4MHEA 2EY1A 2BE5C 3EQLC 1GXDC 5E4XA 4A3EB 1G91A 4ZKBB 3DWQA 1EY9A 3TDQA 3OSOA 4DV0Q 1VQFA 1NTGA 2KCTA 1V1OA 1HRJA 1DJRD 4RH6A 3K59A 2JA6G 4H02A 4MTKA 5FLXc 3N52A 2ZJQA 1RODA 3I4MG 3HGBA 5IWAL 3Q23A 1OXSC 1WCMB 3F2BA 4JI2L 5C6AA 3H15A 3HOVG 5L37A 2Q2TA 1CFMA 2TSSA 2EXZA 4A93G 1ESFA 1TY2A 1VQHA 4GKKL 4A3CG 5EKKA 1ZEQX 1K8AC 5EKIA 5JVH3 4LF8Q 3GTKH 4OO1G 1NJIC 1TXYA 1B8AA 3TSSA 4DV7L 3T1YL 1SEBD 3OMGA 5FK9C 3K0XA 2YTYA 3PO3B 1YIJA 2EDGA 1KABA 3VR2A 4BBSG 4HJ8A 2KCNA 1EY5A 4DU9A 1PH1A 2PQAA 4N8FA 3RR5A 1SNPA 1N34Q 1I6HH 4BA1I 3TEHB 2EPBA 4WJWA 5T1IA 4R1JA 2YYZA 5C0XH 2FXQA 2F3WA 4JI5Q 1A3UA 2EXDA 1FVIA 1TWAH 2HHHL 1X6OA 3OMCA 4N9PA 2NVYB 3L3OC 3ITPA 4IN3A 3S2DB 2PQEA 3RNUA 3CCEA 1MGSA 4IUVA 2HT1A 3FVQA 3H09A 3DWAA 1N36L 5D14A 2CQAA 2A1AA 5ELEA 2DY8A 3H91A 1AFPA 3QOLA 3GTQH 2F0SA 5EQ0A 1QZGA 3W1BA 2JA7B 1OXVA 2HQLA 4NDXA 1HR0L 3C46A 3KK7A 1FJGL 2FJ2A 3R2IA 3T1HL 5C3EG 4LNQA 1YNJC 3I4LA 1U4MA 4YIJA 2KUMA 2QDLA 1KAWA 1EIHA 3G6EA 1PMRA 3DEPA 4DUYQ 3HOXB 1A2TA 3SE0A 2VS1A 4DV2L 1HJPA 5IGEA 4DAYA 4M1UB 2BH2A 4IJLA 3TMEA 3S1MH 1NMGA 1ZYRD 3VA5A 3C3LA 2JSOA 1MSGA 1HFNA 4LJZC 2PW7A 4DR3Q 2E74C 3FP9A 4DV1Q 3KDFA 2F0TA 2I0QA 3KJPA 5AFWA 4KY7A 5J3BA 2D0PA 4OL7A 4QMGA 4JBKA 3MEHA 3FHWA 3TN2A 3OIQA 5FLMH 2SEBD 4XDXA 1C0AA 1I4PA 3SXHA 1EYDA 4OWTB 2IW3A 5JEAJ 2XGTA 1G51A 3TP7A 1D6EC 2QGQA 5COYA 2BDNA 2MHVA 5JJLA 2R93B 2KBNA 4QUCA 4DPGA 4EQPA 4IOCA 2I07B 1TWGH 4KTAA 4LFAL 1A3TA 2KA7A 3BVMA 2KHJA 3A54A 4HJ5A 5FO8B 3GTLB 1A6XA 1H9SB 1VF5C 3TREA 1T9HA 1IKMA 3IFDA 2A6HC 4HMIA 2IX1A 2B63H 5A35A 1VQ6A 1R9TH 1TWCB 4I7ZC 1M1KC 4Y7NH 5IT9c 2R7ZH 2NUCA 2F0NA 4YCUA 1WTPA 1ASYA 5I2XA 2J0TD 4ME5A 3FKIG 4DXGA 1IBKL 4RGNA 1G291 1UEAB 3CC4A 4G57A 3JC66 3QOJA 4U68A 1EOVA 1EFID 2IJ0A 4FDBA 4DR7L 3WWVA 3U4ZA 3HKZB 5JEAH 4C56C 2EJMA 3K6OA 1GVPA 4GOPC 3QWNA 4RGTA 3K80C 3P1HA 3VR3A 1ESRA 1L1OC 1HQRD 1WTHA 4PQXA 3U4VA 1H9MA 4FNFA 1VQDA 4C3HB 1X3GA 3HOYB 2ZT9C 5J39A 4GKJQ 2QCPX 1CKOA 3CP0A 2WB1E 1JOOA 4A3EG 2DY7A 3HEJA 4HR7B 5BR8L 4RGMA 3NEMA 4LFBQ 1RDPD 2Z4HA 2VUMH 4UDUC 4IALA 3CCUA 3GTMH 5C3XA 5IYCG 2WV6D 3URYA 1HQMC 4DF7A 3U9SA 5I9OA 4QGUA 4OONA 1F9RA 3A8JE 4XIGS 2G5DA 4HJ7A 1CA5A 1CZWA 5IYBH 3VYRA 1UE6A 1CKMA 1WCMG 3S1RB 3EN2A 4J6HA 2KHSA 2MNAA 1D5XC 3K8AA 3OIPA 5C44B 3KLSA 1S5DD 1IW7D 3CPFA 2YU9B 2WKDA 3P7JA 4J1MA 4X66L 1KHIA 5ELCA 5JVG3 1SDFA 2F0HA 3I2ZA 5FO9B 2JA8B 1VMPA 2F0EA 2OTJA 3K5OA 3GTOB 2F0PA 4HCEA 1QUQB 4ODGA 2A73B 4K5WA 3T56B 4A3GB 1A63A 1PDQA 3Q8DA 4FF1A 4K5XA 3HOZB 2F0QA 2UXDQ 3PO3G 3KF6B 3BVGA 3RZDH 1BBUA 3TZDA 1TWFB 1VQGA 3PF5A 3RUZA 4EVOA 4WRDA 2JA5H 2CH4A 2AUKA 3BYTB 4CJ0B 2XIWA 2H4OA 1G6ZA 3DHQA 1VQBA 4JI0Q 1PHJA 3MHBA 1EUJA 5D3DA 2KENA 1KQSA 2V1CC 4OELB 4BY7G 5KNCA 2AQ1B 2RDFA 4KKSA 3NE5B 1VQ7A 2Z0SA 1TKWB 5GADC 4EQOA 4DR6Q 2K7VA 1SE8A 5C0XI 1TVXA 4EQ5A 1F2LA 4CBVA 4DFAA 1K3BC 3M7NA 4FO2A 4XT1B 1B53A 2EYOA 1KLUD 5I4DA 4IOAA 3ER0A 3BJUA 1H9SA 2RVLA 3W5OA 4QUFA 3K5NA 1KL9A 2QF7A 1J8IA 2F1MA 4TRDA 1PTOD 1SYEA 1S72A 2JA7G 1N8RC 3OTOQ 1E3PA 1F2YA 2PZTA 3MXPA 1EOTA 4P74A 4IPCA 4DR2Q 1VQPA 3AEVA 3AMUA 2UUCQ 1I50B 1EIFA 2Y0SE 5LMUQ 1Y8OB 1DYQA 3MFGA 3HOXG 4N8X1 4UP7A 1XNRQ 4R4TA 4ZQ3A 2NVQB 4UP8A 3SK8A 3GO5A 2FMMA 2OT2A 1SE3A 3HOVH 2BOSA 1SFOH 2ZTCA 4CKEA 4DK3C 3G71A 2ZXPA 2L5TA 3J81E 4F88A 4ZYSA 4ME3A 5K5PA 3F1ZA 3K7AB 1Y69U 2GVAA 1XPOA 5JAVA 2FHTA 4BY1H 1VS0A 2MO1A 3RN5A 1BVSA 4RKBA 1ZXTA 2RSOA 1EWCA 4KHVA 4BXXG 1CM9A 1AZPA 1ASZA 3K81C 1SN8A 3MZ5A 4IFDI 1YBYA 1Y1WB 4O42A 2FINB 1IHZA 3PQIA 2R93G 2IHFA 4BBSH 1M4VA 1JWMD 3GTJH 4P72A 4K8JA 1O7IA 4FF2A 5FO7B 3T4AC 4A3KB 5CR3A 1HZAA 2F0LA 1J5EQ 1PH8A 2D0OA 1PZJD 4F87A 2OTLA 2O2LD 4KN7C 4DV1L 1WFQA 3QJYA 4X3TA 2VXWA 1FNUA 3WOFA 4IFDG 1J6QA 4XYOA 4DKAC 1LO5D 4R4OA 2AMCB 3T51B 1X3QA 3RLOA 2WFWA 1RJTA 3NWTA 4JW0A 1EY6A 1KTKA 4R4CA 1S3OA 3CRLC 2PI2A 4K14A 1SMXA 2N8NA 5DM73 4A3BH 2PZUA 3KLWA 2ZTDA 1HCZA 2RKSA 1STEA 2UXCQ 2EJFC 3H6MA 1LT6D 1B2TA 1EQRA 4HAEA 2NTSA 1OTCA 3S15B 4ZRZA 3HOWH 4A3FH 1QUQA 4CDDC 1B9NA 4OWWB 5T1GA 2B29A 3HKZG 3RMHA 2KCCA 2EYPA 3KF6A 3G6JB 1NE3A 1STAA 2R3ZA 3FRPB 1YHQA 3M7GA 1RKNA 1Z47A 3TS2A 1SMYD 5KYIA 4H44C 2CFMA 1EQTA 4C2MB 3FPUB 5GAHC 2MP1A 4C3HG 1XTCD 1RTNA 5JJZA 1O7LA 3HOYG 1QVGA 4IURA 4DR1Q 1DOKA 1KLGD 3EFXD 2EZVA 4A76A 2PMZE 3J80L 2ATWA 2E5LQ 4QIWB 3M3YB 1HNZQ 1JB7A 2WAQG 1CTMA 1LTID 4RCOA 1N32Q 4MIUA 1SROA 1TS2A 1MJCA 5C5LA 3S1QH 5K36G 4A75A 3M4OH 3OOCA 1YITA 5D65A 1IZ6A 2YTXA 2DUDA 1GUNA 3GTGB 3LX0A 4DN4M 5C44G 1V1QA 3TRZA 1WOCA 1V8QA 1ENAA 4IUTA 3UE0A 2EYFA 5G3LD 3SGIA 5BN5A 3S16B 4C3IB 3PO2B 4K8IA 1EL0A 5DNFA 3KBXA 3PIP3 3EA6A 1JQYD 5M3FH 4A3MH 2JA8G 4GKJL 3G4SA 3MFYA 2F3IA 2IL8A 1UE5A 3P75A 5ELNA 3S17B 1UNSA 3GQBA 1N9WA 1SRUA 1EQQA 4A3GG 2OEOA 1B70B 1V43A 2I46A 2Q2HA 4K2KA 2PW5A 3HOZG 1GHJA 1RL2A 2F0IA 3R8BA 3STBD 2R92H 4MNOA 2B2YC 4K2LA 3FKIH 5A2QE 3KOJA 2MPMA 4KI0A 3VR4A 3J7AV 3VDYA 1I3QB 3R2TA 3V2TA 3CCSA 1I4XA 2Q2IA 2K5DA 4ZKCB 4C3JB 3OWEB 1X65A 4KV6A 4X3UA 4Z9CB 1B3AA 1A0IA 4HIKA 1EWIA 1T5XD 3A5UA 3OW7A 1X56A 2PNHA 2NVXB 2A74C 5FJ8G 4LW1A 4K0KQ 1LTRD 4YCVA 5C4XH 2VW9A 3IFTA 4ID6A 1ILPA 4IPHA 4HSPA 4UAIA 3I55A 1HHVA 2E2IB 2V4DA 1I4RA 3UI2A 3OPOA 1EFWA 4A3EH 1Y1VB 2X6LA 3I7FA 1VQ8A 3M85A 2JA9A 2VY3A 1XMQQ 3MWYW 3A74A 2VL6A 3F8TA 1PRTC 1AEXA 3H0GB 5IYCH 3K58A 1X3PA 3NTHA 4JI0L 1HA6A 1Q8KA 1CA6A 5HURA 3G48A 3S1NB 3CMAA 1WYDA 5LL6S 3OHXC 4FF4A 2WACA 4YY3Q 1KDAA 4DR6L 4A3IG 1EY8A 2IX0A 4N9TA 3W2DA 1C7YA 4E6IA 1C4QA 2I5LX 1FNVA 1N33Q 2LS01 2JQOA 4HN7A 2LFNA 4JI8Q 4I7AA 3PUWA 3AQQA 2VQFQ 2EYHA 5A2QL 2L1BA 2RQXA 1BCPC 2ES2A 5JOBA 5IOCA 3OTOL 2L0CA 2CCZA 1FGBD 2DGYA 2GVBA 3MXGA 5I6YA 5CORA 3NWSA 3NTKA 1Y1WG 4TSSA 3P20A 1MBYA 4KD4A 3PO3H 1XNRL 2A69D 1IBLL 2OQKA 2UU9L 4X62Q 4NP5A 4MTNA 5I9PA 4A3KG 3OWFA 1K73C 1GUWA 1PH9A 5M5YH 1U4RA 4JVZA 1PH5A 3KJOA 1GM5A 3F2CA 4GNXC 1DOLA 2B2VC 2PYKA 1ML0D 4BY7H 4L5QA 3BDOA 4IUQA 1U5KA 4O1NA 2UUAQ 1HUMA 1BCPB 1Q1EA 3F2UA 1D8LA 4HTHA 5M3MH 1HZ9A 2K1BA 4DNRB 2F0WA 2Z4IA 3UE1A 1FGUA 3MXUA 4J8QA 4LF6Q 1GJXA 2KEEA 3PSIA 2JA7H 3GTKB 4KD3A 5CBEE 3S24A 5JPMC 2VB2X 1EY0A 2O5JC 3MAQA 2PO4A 5IODA 2AKWB 1YJNA 1MI2A 3RLNA 3J7YW 2RCFA 3HG9A 2NZOA 1I6HB 1EZ8A 2CW0C 1B7YB 1EQVA 4WORA 5TSSA 3BG3A 1L0YB 2UXCL 3NXWA 2WIIB 1H9JA 1ZYRC 2HIXA 1WD1A 5M5XH 1X9NA 1K9MC 3GTQB 3NBIA 2B2TC 1Q86C 4IQZA 5IGCA 3I70A 4JI4L 2G9HD 4NMZA 1LABA 1I94Q 4DV5L 1B44D 1C48A 2AQ2B 1VQKA 2B2UA 1KRSA 3A56A 3TS0A 4B3TL 1SBBB 4ZCKA 3J81c 1QJOA 2K03A 2N78A 5C5MA 3PF4A 3KYHC 5DLQE 2GA4B 4LF9Q 4DV6Q 2JP1A 1G8ZD 4C3IG 3CC2A 4RCNA 4ZAIA 3PO2G 3S1MB 4DNIA 2NVTB 4HCSA 2R7FA 4DR1L 2CVRA 2EQSA 1IYVA 1IL8A 1HNWL 1STBA 1BO0A 2RA4A 2E5LL 1M8AA 5KRUA 1TWCH 4A3DG 4H13C 1N32L 3DM1A 1KAAA 2HCCA 1GUSA 5EPKA 2F4VQ 2K01A 2Q2UA 1A2UA 4JBMA 3E9HA 3EROA 1S5BD 3W1GA 4APVA 3J80c 4G7OC 3I4NH 5I2YA 1I4QA 2PNRC 4C3JG 3V05A 1XMOQ 1G6PA 3GD7A 3PUVA 1U9RA 2A6HD 3LWEA 3BZCA 1K8GA 4OX9L 1PVOA 1E1TA 2B8GA 1YJ9A 5EPLA 1CZGA 1X54A 2K4KA 1YHBA 3Q0AA 5M9OA 1G2TA 5IGGA 1TWGB 3J7A5 4ABNA 2QKIC 1A3VA 4BWGB 3CF5A 1GUOA 3GP7A 2D5DA 4DAVA 4B3ML 2NWGA 1NMFA 1VDZA 1X55A 4JI7Q 3HOYH 2VQEQ 4DV3Q 3T16A 4JV5Q 1K8OA 2AWOA 4BA2I 4A3JH 1JB3A 4LF5Q 1F9SA 1VQAA 2LXJA 4DGZA 1Y1VG 2B63B 5GROA 2K05A 5EBCA 4B3SL 3A5ZB 4HSVA 2WINB 4CJ1B 3H0GG 2Z6KC 1Q82C 2R7ZB 2NBFA 3RN2A 1HA5A 4RGOS 3CHBD 1MJEA 2AUJD 2KJXA 3CC7A 1II3A 2A6ED 1KDCA 3TP5A 4B9XA 3PGZA 3CQZH 5C44H 1HFGA 4NXMQ 4NXNQ 4K0KL 5CV6A 2PMZB 4GN3B 1VCIA 3X3NA 2QW7A 4HMJA 4UHVA 1ICWA 3MA2B 2XWJB 1H95A 4ZLTF 1HH2P 2JA8H 3S2HH 1VF7A 4LF7Q 1XPUA 4GOPB 1XYIA 3IKJA 4LK1C 3G7LA 4LF4Q 2K5HA 1L1OB 1STNA 1LYLA 1PTOF 3A8IE 2RSNA 1XMQL 1IL2A 1R4QB 1O78A 5I6WA 2UXBL 5LMNQ 4B08A 1JORA 2F52A 4YWKA 2MO0A 1Q12A 2Q8RE 3ND9A 2XWBB 4OIKA 4R4QA 4DK0A 2F3VA 4H7BA 2VUMB 4YY3L 2KQ3A 2R6GA 4ILWA 1GKHA 1PH6A 3GTMB 4DV0L 2KHIA 3L9AX 4AIMA 1FYCA 4L6TB 3DLLA 1FL0A 5F2DA 4O2DA 4U673 1VQ4A 3HOUH 3RZOH 4JI8L 2ALYB 2I5HA 5KNBA 5ELOA 2VQFL 3GTPH 2CHBD 1WTOA 5FJ8H 4KHPQ 3A0JA 2K5VA 2YTVA 2OXPA 3D4WA 4X65Q 4LMQD 4LUZA 1P8LA 3J81i 3J81j 1HTPA 2RHQB 2RF4A 2F0MA 4XQQA 1NCVA 3HZXA 2D9UA 3ULPA 1EU4A 4LF8L 1S5CD 2HUGA 2NN6H 3QG1A 4X62L 3KLRA 2F0GA 3GV3A 1TS5A 3K57A 4CJ2C 2GN5A 1A8VA 1TY0A 2D2CC 3DM3A 1X32A 1PFBA 3RZDB 1I4GA 4LUVA 4AYBB 1STYA 1ENCA 3A8KE 2JA5B 1BQQT 1GUTA 4A3IH 2B2TA 1XX8A 3DWPA 1IBMQ 1QWYA 2JA6H 4KKTA 1JT8A 3M4YA 1PTOC 1SXTA 3CMEA 1N34L 3H3VC 5E1FA 4BBRB 1PTOH 5C0XG 2EOTA 3NELA 1B9MA 3I72A 3H3VH 3I4MH 2DN8A 2TMPA 4JI5L 1JE5A 3LGJA 1KIXA 4JI2Q 4GLXA 5BN4A 1GO3E 2CWAA 2HDLA 4EGVA 4A4IA 1BBWA 2LXKA 2ENBA 1XNQQ 4FXGC 4UPAA 4A93H 1JMCA 3EBEA 4YWMA 4P2CB 1Y1WH 4A3CH 5KEEA 3PIPA 4CDCC 3ERSX 2RBMA 4DV7Q 4OO1H 4IUUA 2ZM6Q 3ICEA 1K83H 1TWHH 1WTXA 5M5WB 2EJGC 5CMDA 1SJED 3T1YQ 2F0VA 4OHJA 1CI3M 4XTCS 3EJIA 4JI1Q 3VA7A 4K5VA 4K6DA 1Z6HA 4DUYL 2B8FA 1D5ZC 1EU3A 4G7ZC 1QNUA 2JN4A 1TS4A 3VYSA 1O7ZA 3J80E 5DEHA 1WD0A 2EYJA 1RIPA 2PZWA 1OXUA 1SFOB 4DR3L 4V190 4PZ6A 3S14B 2HD3A 2MFIA 2OQ0A 5IP7G 3QIAA 4BY1B 4KY6A 1N36Q 5FLMG 4GOPA 1MSHA 3D4DA 4YHHQ 3S15H 1I94L 1L1OA 5HGQA 1F2ZA 2SNMA 1DXMA 4R9WA 4C1NI 3J7AF 1GOZA 1KXLA 1HR0Q 1STHA 2QILA 2RHSB 3BDLA 4JG2A 4LF9L 4DV6L 3QB3A 3MVVA 5C3EH 4X3KA 3GTJB 1QOHA 2EYLA 3I91A 2WP8J 3L0OA 5G3LF 1MHWC 2NZ1D 4DV2Q 4JPBW 3DEOA 4Q5VA 3Q22A 4FYDA 3SK5A 1SNCA 5FOBB 3TP8A 2X6GA 3X3MA 2F4VL 4ZUIA 5E4WC 2B63G 5J1ZA 3HKZE 5IP9G 1YJWA 3D31A 2M00A 3D3RA 3ONAB 5ELFA 4NB3A 1H9RA 1I6VC 4G7HC 4CHTB 2R7ZG 2ICIA 4PZ8A 4A3BB 1EYAA 2N55A 1SAPA 2O4XA 5C4ZA 4HIMA 4DK6C 4FVMA 5ELBA 2IHEA 2K5WA 4LUOA 2MGSA 3MEFA 3HOWB 1F9PA 2QEJC 3B6YA 4DNTB 4A3FB 3CCRA 2Z6BA 4HEDA 1Q8IA 5JEAG 2WAQE 2B3GA 4JI7L 4LFAQ 4C3IH 4A3LG 2J7ZA 1Q90A 4DV3L 1S4ZA 3H94A 3KF8B 4X64Q 1QZHA 4DXFA 4LF5L 3IAYA 4QL5A 1ICFB 2FMCA 4RG1A 1Y8NB 1PV4A 2K75A 1JOQA 4A3DH 3R3OA 4KY5A 3K7UC 3K0YA 4ZK9B 1JWUD 4DV4Q 1JE4A 3CKIB 1JJGA 1CHPD 1YEZA 2BCOA 3T13A 5KYLA 1E24A 1JJCB 4Y52H 2L12A 2VUMG 4LFBL 2PI2E 3AU7A 4QCLA 3PIO3 2A68D 2DNCA 1XWEA 1V9PA 4NXML 4G4KA 4DAMA 4NXNL 5GAGC 3S1QB 1YNNC 5CV4A 1YNXA 4F8MA 3CCLA 1HXYD 2XRQD 3ERQA 3NQIA 4FXKC 5D3IB 1EEID 3I73A 3M4OB 1B4OA 4KJOA 1AH9A 4WJ4A 4L63B 2SDFA 4LF7L 4JOIC 3STBC 1OO9B 4DR4Q 2AWNA 1PFNA 4LF4L 1PFMA 5CC4A 1WVLA 1MKHA 1X3EA 1HUNA 3D6WA 3E3XA 4IPGA 4OWXB 2RCNA 5JPNC 5M3FB 4A3MB 4RHRA 5LMNL 1OXTA 1Y1VH 2OF1A 2XRSD 2E2HH 1AW7A 1TR5A 5C4JH 4L5TA 1D1IA 4IPDA 4ULLA 3L7ZC 2YV5A 2E2JH 1PYBA 3HP3A 3SK4A 1EYGA 1L2FA 1AE2A 1BBXC 2NN6I 5EBDA 2EY5A 4HJ9A 1Q7YC 2R92B 1Q81C 3HFZB 2UXDL 4XT3B 2IT1A 1LT5D 4AYBG 3CCMA 4OIJA 5C4HA 2JA5G 2UUBQ 4IO9A 4S3SA 2JEBI 3U50C 5IE8A 4KHPL 4JBJA 1BNZA 1F9QA 3JAME 4L8JA 4BBRG 1PXUA 2QEXA 2M9VA 1PRTD 1QILA 1SE2A 3NPPA 4DAPA 2NZHA 1WCMH 4RMFA 3VYUA 2BE5D 2WB1B 3H3VI 1EY4A 1SYCA 5C4XB 4ZUJA 2XNAC 5JJIA 1MD2D 1LTLA 3I8ZA 4DUZQ 2MJ8A 4LAAA 4RWSC 3CW2C 1RTOA 2IPKD 2P5ZX 2K04A 1BF4A 1PYWD 4DR2L 2ICEC 2UUCL 5C0XJ 2ZTEA 1BCPD 4OO1I 5LMUL 3PUZA 1IBML 3V96A 3NHHA 1LTTD 1PRTB 4JI6Q 2DNEA 1E1OA 1Q3LA 3KFUA 1VQ9A 3IRBA 1BXTA 1NUCA 3M9BA 3UDFA 4XQJA 2SNSA 1P16A 4AQYQ 1CSPA 2A69C 1S40A 1XNQL 5CV7A 2KVMA 3KUPA 2NVYH 4BY1G 4UP9A 4BS9A 3KF8A 3SK6A 3S2DH 1HZCA 1QCBD 3W3AA 2H5XA 4CGYB 1SNMA 2ZM6L 5FKAC 4CDEC 4L5RC 2Z9HA 3JAML 4JI1L 1U0LA 5JJKA 2XSCA 2L4NA 3EVQA 2Z8LA 2F0OA 5CGKA 1PFSA 2JJQA 1SNOA 2E75C 5M5YB 3HOXH 1CUKA 3M4QA 1AE3A 1J5EL 1LT3D 1Z9FA 3QO2A 2C9OA 4BY7B 2C35B 4GNXB 4KKUA 1C8CA 4IFDJ 1B50A 1SNDA 3D0FA 5KNDA 2DJGC 5CV9A 1HNXQ 2KEDA 4QF4A 1BR9A 1SE4A 4P75A 1YVCA 5M3MB 3NTIA 1EIYB 4PG3A 2LMCB 1YNJD 1SLJA 3CCVA 3ULJA 4HIOA 1BOSA 3BVZA 4YHHL 4POGA 2Y0SB 3E9IA 1TWAB 1WI5A 1EIGA 1Q1BA 1JOKA 5GAEC 2JEAI 2K52A 3SR1A 5KIXA 2MUYA 2CWPA 4A3BG 3J7ZC 4JC0A 1PLFA 2DJFC 3CRKC 2CW0D 3A55A 1VQEA 4BXXH 1UUPA 3A7AB 3HOWG 5IGDA 4A3FG 2K50A 5KGUA 5E7NA 1FNWA 3HRZC 2R93H 4QIWE 2EVBA 3FDTA 4GS3A 2NVTH 2B2YA 4GLVB 1IYUA 5IYDG 3ZJYC 2ZXRA 3UDXA 3GTLH 3NBHB 1KC8C 1A62A 4JOIA 1NR4A 2B2WC 2XN9C 2XVSA 1TT2A 2E2DC 5IP7H 5NUCA 4IFDH 1TIID 1WTQA 3BU2A 2EIFA 5AJ3Q 1HNZL 1BDOA 2CQOA 5LL6X 1X3FA 1LV9A 4HIDA 3PUYA 5M5XB 1Y14B 3I3CA 1YI2A 2Q8TA 1K0RA 1PH3A 2BDOA 1L0WA 4IUPA 5CYUA 1ONLA 1VQOA 3UDIA 3VR5A 4X64L 1BUVT 1PA6A 2NTTA 1CSQA 4UY8C 1RF2D 3MXNB 4L5SA 4PZ7A 2JE6I 2K14A 1ILQA 2JK8A 5C3WA 4LFCQ 3FEWX 1JCKB 5M3FG 4A3MG 4DV4L 3ULLA 3I90A 4NPSA 5EKLA 1D1KA 4MN3A 1VQIA 2N49A 5IP9H 1RCVD 1CK1A 3QR8A 4C3HH 1V1PB 3HS0C 1D7QA 3BS1A 2F0KA 2OCEA 2R92G 1LTSD 3C1EA 5IIFA 4X6AH 4XQNA 1DD2A 3MC0B 2L15A 1GD7A 1LTAD 3I4NB 2WKCA 1XJVA 5J22A 1R9TB 1LT4D 1ET9A 2CH4W 4Y7NB 3GDEA 5K36H 4DR4L 1TQOA 1UE1A 1JR0D 3K5LA 4A3LH 1M90C 1VQJA 3RLFA 3S1RH 4YWLA 1SYGA 2K5QA 2WB1G 2F0FA 5C4XG 2HIVA 3AYHB 5EJWA 2YU9H 3BYYB 3C1FA 2A6EC 1YHAA 1Q46A 4CDFC 1K8MA 5FLXE 4GNXA 1XXGA 2B2VA 2BA0A 3DUZA 2E8GA 4A3JB 2HQEA 3U58A 4CKCA 3WDNA 4GN4B 1TU2B 3N6RA 4AH6A 4XXEA 1FR3A 2K28A 1PH2A 2HCIA 4B3RQ 3NUCA 2IY5B 2NB0A 2WAQB 3AB9A 3GTOH 4A3GH 1I5FA 2UUBL 4JYAQ 4DR5Q 1YZ6A 3HOZH 1NY4A 1S5FD 2RDGA 2IWHA 3E0JA 2R61A 3NSWA 1K0SA 1TWFH 1IW7C 1CQVA 1UAPA 2VNUD 4KN4C 4KLKA 4TKOB 4YCWA 2F0UA 3ND8A 2XTIA 3SHLA 3CQZB 1F77A 4KMUC 1KRTA 1D2BA 2D62A 2N88A 1AP0A 1N33L 2KOLA 4I65A 2EY2A 1WJJA 1NR2A 4DUZL 4V0BA 5EPJA 1UE7A 4JI3Q 3S2HB 2KCMA 3FPPA 3NK9A 2ASBA 1B3QA 4QJFA 3DXJC 4OEMB 1KNAA 2I5MX 3NBHA 2JXMB 4PNYA 3AFPA 3BDCA 2O5IC 1HTLD 1NAPA 1D5MC 1TS3A 5LMNW 4JI6L 1SYDA 5IGBA 1I50H 4P71A 5IY0A 2PCFB 3WOEA 2VZAA 4AQYL 5CV5A 4QY7A 2NVQH 4BBRH 2H1EA 5FLXL 4EQNA 1CHQD 1HZBA 3KLSX 1Z7TA 4GN5A 4IZ8A 3HOUB 1B1ZA 3RZOB 1VQ5A 3GTPB 3J80i 4NW2A 1EY7A 4KK7A 4FF3A 2PPBC 1E0BA 2UUAL 5M3MG 3LWUA 1EWHA 5ELDA 4R8NA 4QB4A 3MXNA 2QA4A 5GQOA 3K7AH 5IWAQ 2Y0SG 4LF6L 1UEBA 2G9DA 2EE1A 1NSNS 2B2WA 3S9WA 1RHPA 5M5WH 3M4PA 3NENA 4B9WA 4GKKQ 4H0LC 3JAMc 1DCZA 3BZDB 4GLAC 3CCQA 2ZJPA 3SVMA 1IBLQ 1V1PA 1IXRA 2UU9Q 1LTGD 2KECA 1ZKOA 1WTRA 3PCOB 2CKZB 4A3KH 1W2BA 4A3IB 3L2PA 4PMBA 1HNXL 3PIOA 3O13A 2JA6B 1C9OA 4F7XA 1CKNB 2C5CA 3S14H 1PTOB 3MTSA 5CV8A 3SDZA 5HY6A 2OWOA 3I4MB 4C1NK 3T53B 3Q6SA 4OXPA 4RHSA 5H1SE
chains in the Genus database with same CATH topology
3SEBA 3VR6A 4K6LA 3HOVB 1T5EA 4DA2A 5BN3A 3PUXA 1JC7A 5ISRA 4A93B 4OGQC 1OXXK 1STGA 5E3FA 2LKVA 1K83B 1TWHB 1I4HA 2BA1A 4XYQA 1Y8PB 2ZXOA 1R4PB 1QE6A 4DK1A 5HGTA 4X3SA 5IT9E 3R93A 2FFKB 4BBSB 1KNEA 1LTBD 1F2MA 4GZYC 2M2LA 1SYBA 2IX3A 1U4LA 4KJNA 2EY6A 2F4IA 2JYOA 1PZKD 1GHKA 1GUGA 3PV0A 1E2WA 3NP8A 3K5MA 1VMCA 2Q8IB 1U4PA 1H9KA 1SYFA 2F0JA 1JICA 2ID0A 4PV1C 2NYZD 3IL8A 2Z1CA 2AQ3B 3J81L 1SMYC 2E76C 1LACA 4NKLA 3D8GA 5EGTA 5C3EB 1LLRD 3CU7A 1JWSD 2LY7A 4RKLA 3Q24A 1SSOA 1A15A 1IKLA 4PMWA 2L55A 1L0XB 3DMUA 4Q0FA 4M8AA 4JK1C 3U9OA 1ET6A 4JBWA 2X69A 5DAUA 3TP6A 3C2PA 5CBAE 4RA8A 5IT9L 1SJHD 4PMCA 2L9HA 3FMCA 1QNKA 1KDBA 5LHY1 5IGFA 2RDHA 3E6ZX 2B39A 3E5SA 1WTWA 3D6CA 1DM0B 1E2VA 1PRTF 1AZQA 4FP5D 3VYTA 3GV6A 4R8IA 3LNNA 2F03A 1W6KA 1FD7D 2A68C 1YNND 2HDMA 1J9OA 1HPCA 1S5ED 2K33A 1EZ6A 3TBIB 1W6JA 1DZ1A 3NQTA 1QG7A 3PMFA 4A3DB 1PZID 4KHZA 4FXDA 1EYCA 1DOMA 2A5HA 1BCPF 2B2UC 1AN8A 3TZUA 1EEFD 4IUNA 2K32A 4TQUS 2L11A 1RD9D 1O80A 3FKIB 2K6AA 3RD4A 2SOBA 1G2SA 4RAUC 1SNQA 1O7YA 2J4XA 4CKBA 5DM63 3D4RA 2VB3X 2EYMA 2F0DA 1QB5D 4RFBA 2QDBA 1ENFA 1CT1D 3ZYYX 2E2HB 1CQFA 2NN6G 3A7LA 3KBGA 5C4JB 1DONA 2E2JB 4WFN3 1WTVA 1E2ZA 4MHEA 2EY1A 2BE5C 3EQLC 1GXDC 5E4XA 4A3EB 1G91A 4ZKBB 3DWQA 1EY9A 3TDQA 3OSOA 1HRJA 1V1OA 1DJRD 4RH6A 3K59A 3N52A 1RODA 3HGBA 3Q23A 1OXSC 1WCMB 5C6AA 1CFMA 2TSSA 2EXZA 1ESFA 1TY2A 5EKKA 1ZEQX 5EKIA 5JVH3 4OO1G 3TSSA 1SEBD 3OMGA 5FK9C 3PO3B 2EDGA 1KABA 3VR2A 2KCNA 1EY5A 4DU9A 1SNPA 4BA1I 2EPBA 4WJWA 5T1IA 2YYZA 5C0XH 2F3WA 1A3UA 3OMCA 4N9PA 2NVYB 3L3OC 3ITPA 4IN3A 3S2DB 2PQEA 1MGSA 4IUVA 3FVQA 3H09A 3DWAA 5D14A 2CQAA 5ELEA 2DY8A 3H91A 1AFPA 3QOLA 2F0SA 5EQ0A 2JA7B 1OXVA 4NDXA 3C46A 3KK7A 2FJ2A 3R2IA 1YNJC 3I4LA 1U4MA 4YIJA 2KUMA 1EIHA 1PMRA 3DEPA 3HOXB 1A2TA 3SE0A 5IGEA 4DAYA 4M1UB 3TMEA 1ZYRD 3VA5A 3C3LA 2JSOA 1MSGA 1HFNA 4LJZC 2PW7A 2E74C 2F0TA 5AFWA 4KY7A 4OL7A 4QMGA 3MEHA 3TN2A 3OIQA 2SEBD 4XDXA 1I4PA 3SXHA 1EYDA 2IW3A 5JEAJ 3TP7A 1D6EC 5COYA 2BDNA 2MHVA 2R93B 4QUCA 4EQPA 2I07B 4KTAA 1A3TA 2KA7A 3BVMA 3A54A 5FO8B 3GTLB 1A6XA 1H9SB 1VF5C 1IKMA 3IFDA 2A6HC 4HMIA 2IX1A 5A35A 1TWCB 4I7ZC 2NUCA 2F0NA 1WTPA 5I2XA 2J0TD 4ME5A 4DXGA 4RGNA 1G291 1UEAB 4G57A 3QOJA 4U68A 1EFID 2IJ0A 3HKZB 5JEAH 4C56C 2EJMA 3K6OA 3QWNA 4RGTA 3P1HA 3VR3A 1ESRA 1HQRD 4PQXA 1H9MA 4FNFA 4C3HB 3HOYB 2ZT9C 5J39A 2QCPX 1JOOA 2DY7A 3HEJA 4HR7B 4RGMA 1RDPD 2Z4HA 4UDUC 4IALA 5C3XA 2WV6D 3URYA 1HQMC 4DF7A 3U9SA 5I9OA 1F9RA 3A8JE 4XIGS 1CA5A 1CZWA 3S1RB 3VYRA 4J6HA 2KHSA 1D5XC 3OIPA 5C44B 3KLSA 1S5DD 1IW7D 2YU9B 2WKDA 3P7JA 4J1MA 5ELCA 5JVG3 1SDFA 2F0HA 5FO9B 2JA8B 1VMPA 2F0EA 3K5OA 3GTOB 2F0PA 4HCEA 4A3GB 3T56B 2A73B 4K5WA 4ODGA 1PDQA 4FF1A 4K5XA 3HOZB 2F0QA 3BVGA 3TZDA 1TWFB 3RUZA 4EVOA 4WRDA 2AUKA 3BYTB 4CJ0B 2XIWA 2H4OA 1G6ZA 3DHQA 3MHBA 5D3DA 5KNCA 2AQ1B 2RDFA 4KKSA 3NE5B 1TKWB 4EQOA 2K7VA 5C0XI 1TVXA 1F2LA 4CBVA 4DFAA 3M7NA 4FO2A 4XT1B 1B53A 2EYOA 1KLUD 5I4DA 1H9SA 2RVLA 3K5NA 4QUFA 2QF7A 1J8IA 2F1MA 4TRDA 1PTOD 1SYEA 1F2YA 3MXPA 2PZTA 1EOTA 3AMUA 1I50B 1Y8OB 1DYQA 3MFGA 4ZQ3A 2NVQB 3SK8A 3GO5A 2FMMA 2OT2A 1SE3A 2BOSA 4CKEA 2ZXPA 2L5TA 3J81E 4F88A 4ZYSA 5K5PA 3K7AB 1Y69U 5JAVA 2FHTA 4RKBA 1ZXTA 2RSOA 1EWCA 4KHVA 1CM9A 1AZPA 3MZ5A 4IFDI 1Y1WB 4O42A 2FINB 1IHZA 1M4VA 1JWMD 4K8JA 4FF2A 5FO7B 3T4AC 4A3KB 5CR3A 2F0LA 1PZJD 4F87A 2O2LD 4KN7C 3QJYA 4X3TA 2VXWA 1FNUA 3WOFA 4IFDG 4XYOA 1LO5D 3T51B 1X3QA 1RJTA 3NWTA 1EY6A 1KTKA 3CRLC 4K14A 5DM73 2PZUA 1HCZA 2RKSA 1STEA 2EJFC 3H6MA 1LT6D 1B2TA 4HAEA 2NTSA 3S15B 4ZRZA 1B9NA 5T1GA 3RMHA 2KCCA 2EYPA 3G6JB 1STAA 2R3ZA 3FRPB 3M7GA 1RKNA 1Z47A 1SMYD 5KYIA 4H44C 1EQTA 4C2MB 3FPUB 2MP1A 4C3HG 1XTCD 1RTNA 5JJZA 1O7LA 4IURA 1DOKA 1KLGD 3EFXD 2EZVA 3J80L 4QIWB 3M3YB 1CTMA 1LTID 4RCOA 4MIUA 1TS2A 5C5LA 5K36G 3OOCA 5D65A 1GUNA 3GTGB 3LX0A 4DN4M 1V8QA 1ENAA 4IUTA 2EYFA 5G3LD 5BN5A 3S16B 4C3IB 3PO2B 4K8IA 1EL0A 5DNFA 3KBXA 3PIP3 3EA6A 1JQYD 3MFYA 2IL8A 3P75A 3S17B 1UNSA 3GQBA 2OEOA 1V43A 2I46A 4K2KA 2PW5A 1GHJA 2F0IA 3R8BA 2B2YC 4K2LA 5A2QE 2MPMA 4KI0A 3VR4A 3J7AV 1I3QB 3R2TA 3V2TA 1I4XA 4ZKCB 2K5DA 4C3JB 3OWEB 4KV6A 4X3UA 4Z9CB 1B3AA 1T5XD 3OW7A 2NVXB 2A74C 1LTRD 3IFTA 4ID6A 1ILPA 4HSPA 4UAIA 1HHVA 2E2IB 2V4DA 1I4RA 3UI2A 3OPOA 1Y1VB 2X6LA 3M85A 3MWYW 1PRTC 1AEXA 3H0GB 3K58A 1X3PA 3NTHA 1HA6A 1CA6A 5HURA 3S1NB 5LL6S 3OHXC 4FF4A 2WACA 1KDAA 1EY8A 2IX0A 4N9TA 3W2DA 4E6IA 1C4QA 1FNVA 2LS01 4HN7A 2LFNA 3PUWA 2EYHA 5A2QL 2L1BA 2RQXA 1BCPC 5JOBA 5IOCA 2L0CA 1FGBD 3MXGA 5I6YA 5CORA 3NWSA 3NTKA 4TSSA 3P20A 1MBYA 4KD4A 2A69D 4NP5A 5I9PA 3OWFA 1GUWA 1U4RA 1DOLA 2B2VC 2PYKA 1ML0D 3BDOA 4IUQA 4O1NA 1HUMA 1BCPB 1Q1EA 3F2UA 4HTHA 2K1BA 4DNRB 2F0WA 2Z4IA 3MXUA 4J8QA 1GJXA 2KEEA 3GTKB 4KD3A 5CBEE 5JPMC 2VB2X 1EY0A 2O5JC 3MAQA 2PO4A 5IODA 1MI2A 3J7YW 3HG9A 1I6HB 1EZ8A 2CW0C 1EQVA 4WORA 5TSSA 3BG3A 1L0YB 3NXWA 2WIIB 1H9JA 1ZYRC 1WD1A 3GTQB 3NBIA 2B2TC 4IQZA 5IGCA 3I70A 2G9HD 4NMZA 1LABA 1B44D 1C48A 2AQ2B 2B2UA 3A56A 1SBBB 1QJOA 2K03A 5C5MA 2GA4B 2JP1A 1G8ZD 4C3IG 3S1MB 4RCNA 4ZAIA 2NVTB 4HCSA 2CVRA 1IYVA 1IL8A 1STBA 1BO0A 2RA4A 1M8AA 5KRUA 4H13C 3DM1A 1KAAA 2HCCA 1GUSA 5EPKA 2K01A 1A2UA 3EROA 1S5BD 4G7OC 5I2YA 1I4QA 2PNRC 4C3JG 3V05A 3GD7A 3PUVA 1U9RA 2A6HD 3LWEA 2B8GA 5EPLA 1CZGA 3Q0AA 5M9OA 1G2TA 5IGGA 1TWGB 4ABNA 2QKIC 1A3VA 4BWGB 1GUOA 3GP7A 2D5DA 4DAVA 2NWGA 1VDZA 3T16A 1K8OA 2AWOA 4BA2I 1JB3A 1F9SA 4DGZA 2B63B 2K05A 5EBCA 4HSVA 2WINB 4CJ1B 2R7ZB 2NBFA 1HA5A 4RGOS 3CHBD 2AUJD 2KJXA 1II3A 2A6ED 1KDCA 3TP5A 4B9XA 1HFGA 5CV6A 2PMZB 1VCIA 3X3NA 4HMJA 1ICWA 3MA2B 2XWJB 4ZLTF 1VF7A 1XYIA 3IKJA 4LK1C 3G7LA 1STNA 1PTOF 3A8IE 2RSNA 1R4QB 1O78A 5I6WA 4B08A 1JORA 1Q12A 2Q8RE 3ND9A 2XWBB 4OIKA 4DK0A 2F3VA 4H7BA 2VUMB 2KQ3A 2R6GA 4ILWA 3GTMB 3L9AX 1FYCA 4L6TB 5F2DA 4U673 5KNBA 2CHBD 1WTOA 2OXPA 3D4WA 4LMQD 1HTPA 2F0MA 4XQQA 1NCVA 3HZXA 2D9UA 1EU4A 1S5CD 2HUGA 2NN6H 3QG1A 3KLRA 2F0GA 3GV3A 1TS5A 3K57A 4CJ2C 1TY0A 2D2CC 1X32A 1PFBA 3RZDB 1I4GA 4AYBB 1STYA 1ENCA 3A8KE 2JA5B 1BQQT 1GUTA 2B2TA 1XX8A 3DWPA 1QWYA 4KKTA 3M4YA 1PTOC 1SXTA 3H3VC 5E1FA 4BBRB 1PTOH 5C0XG 2EOTA 1B9MA 3I72A 2DN8A 2TMPA 5BN4A 2HDLA 4EGVA 2ENBA 4FXGC 4P2CB 5KEEA 2RBMA 4OO1H 4IUUA 1WTXA 5M5WB 2EJGC 5CMDA 1SJED 2F0VA 4OHJA 1CI3M 4XTCS 3EJIA 3VA7A 4K5VA 4K6DA 1Z6HA 2B8FA 1D5ZC 1EU3A 4G7ZC 1QNUA 1TS4A 3VYSA 1O7ZA 3J80E 5DEHA 1WD0A 2EYJA 2PZWA 1OXUA 1SFOB 4V190 3S14B 3QIAA 4BY1B 4KY6A 1MSHA 3D4DA 1F2ZA 2SNMA 1DXMA 4R9WA 4C1NI 3J7AF 1GOZA 1STHA 2QILA 3BDLA 3QB3A 3MVVA 4X3KA 3GTJB 1QOHA 2EYLA 3I91A 2WP8J 5G3LF 2NZ1D 3DEOA 4Q5VA 3Q22A 4FYDA 3SK5A 1SNCA 5FOBB 3TP8A 2X6GA 3X3MA 4ZUIA 5E4WC 5J1ZA 3D31A 2M00A 3D3RA 3ONAB 5ELFA 1H9RA 1I6VC 4G7HC 4CHTB 2ICIA 4A3BB 1EYAA 2N55A 1SAPA 2O4XA 5C4ZA 4FVMA 5ELBA 2K5WA 2MGSA 3HOWB 1F9PA 2QEJC 4A3FB 4DNTB 4HEDA 1Q8IA 5JEAG 2J7ZA 1Q90A 1S4ZA 3H94A 4DXFA 3IAYA 2FMCA 1Y8NB 1JOQA 3R3OA 4KY5A 3K0YA 4ZK9B 1JWUD 1JE4A 3CKIB 1CHPD 2BCOA 3T13A 5KYLA 2L12A 3AU7A 4QCLA 3PIO3 2A68D 2DNCA 1XWEA 4G4KA 3S1QB 1YNNC 5CV4A 4F8MA 1HXYD 2XRQD 3ERQA 3NQIA 4FXKC 5D3IB 1EEID 3I73A 3M4OB 1B4OA 4KJOA 4L63B 2SDFA 1OO9B 2AWNA 1PFNA 1PFMA 5CC4A 1WVLA 1HUNA 3D6WA 5JPNC 5M3FB 4A3MB 4RHRA 1OXTA 2OF1A 2XRSD 1AW7A 1TR5A 1D1IA 4ULLA 3L7ZC 3HP3A 3SK4A 1BBXC 2NN6I 5EBDA 2EY5A 2R92B 4XT3B 2IT1A 1LT5D 4OIJA 5C4HA 4S3SA 2JEBI 1BNZA 1F9QA 3JAME 4L8JA 1PXUA 2M9VA 1PRTD 1QILA 1SE2A 3NPPA 4DAPA 3VYUA 2BE5D 2WB1B 1EY4A 1SYCA 5C4XB 4ZUJA 2XNAC 1MD2D 3I8ZA 2MJ8A 4LAAA 4RWSC 1RTOA 2IPKD 2K04A 1BF4A 1PYWD 2ICEC 5C0XJ 1BCPD 4OO1I 3PUZA 3V96A 3NHHA 1LTTD 1PRTB 2DNEA 1Q3LA 1BXTA 1NUCA 4XQJA 2SNSA 2A69C 5CV7A 2KVMA 3KUPA 4BS9A 3KF8A 3SK6A 1QCBD 3W3AA 4CGYB 1SNMA 5FKAC 3JAML 2XSCA 2L4NA 3EVQA 2Z8LA 2F0OA 5CGKA 1SNOA 2E75C 5M5YB 1LT3D 3QO2A 2C9OA 4BY7B 4KKUA 1C8CA 4IFDJ 1B50A 1SNDA 5KNDA 5CV9A 2KEDA 4QF4A 1BR9A 1SE4A 5M3MB 3NTIA 2LMCB 1YNJD 1BOSA 3BVZA 2Y0SB 1TWAB 1EIGA 1Q1BA 1JOKA 2JEAI 3SR1A 5KIXA 2MUYA 1PLFA 3CRKC 2CW0D 3A55A 1UUPA 3A7AB 5IGDA 5KGUA 1FNWA 3HRZC 2EVBA 3FDTA 2B2YA 1IYUA 2ZXRA 1NR4A 2B2WC 2XN9C 2XVSA 1TT2A 2E2DC 5NUCA 4IFDH 1TIID 1WTQA 1BDOA 5LL6X 1LV9A 3PUYA 5M5XB 3I3CA 2Q8TA 2BDOA 4IUPA 5CYUA 1ONLA 3VR5A 1BUVT 2NTTA 1RF2D 2JE6I 1ILQA 5C3WA 3FEWX 1JCKB 3I90A 5EKLA 1D1KA 4MN3A 1RCVD 1CK1A 1V1PB 3HS0C 3BS1A 2F0KA 1LTSD 3C1EA 5IIFA 4XQNA 1DD2A 3MC0B 1LTAD 3I4NB 2WKCA 5J22A 1R9TB 1LT4D 1ET9A 4Y7NB 5K36H 1TQOA 1JR0D 3K5LA 3RLFA 1SYGA 2K5QA 2F0FA 5EJWA 3BYYB 3C1FA 2A6EC 1K8MA 5FLXE 1XXGA 2B2VA 2BA0A 3DUZA 4A3JB 2HQEA 4CKCA 3WDNA 1TU2B 3N6RA 4XXEA 1FR3A 2K28A 2HCIA 3NUCA 2NB0A 2WAQB 3AB9A 1S5FD 2RDGA 2IWHA 3E0JA 2R61A 3NSWA 1IW7C 1CQVA 1UAPA 2VNUD 4KN4C 4TKOB 2F0UA 3ND8A 3SHLA 3CQZB 1F77A 4KMUC 1D2BA 2D62A 2N88A 1AP0A 2KOLA 4I65A 2EY2A 1NR2A 4V0BA 5EPJA 3S2HB 3FPPA 3NK9A 3DXJC 1KNAA 3NBHA 2JXMB 4PNYA 3BDCA 2O5IC 1HTLD 1NAPA 1D5MC 1TS3A 1SYDA 5IGBA 2PCFB 3WOEA 5CV5A 2H1EA 5FLXL 4EQNA 1CHQD 3KLSX 1Z7TA 4IZ8A 3HOUB 1B1ZA 3RZOB 3GTPB 4NW2A 1EY7A 4KK7A 4FF3A 2PPBC 1E0BA 3LWUA 1EWHA 5ELDA 4R8NA 4QB4A 3MXNA 2G9DA 2EE1A 1NSNS 2B2WA 3S9WA 1RHPA 4B9WA 4H0LC 1DCZA 3BZDB 3SVMA 1V1PA 1LTGD 2KECA 1ZKOA 1WTRA 4A3IB 4PMBA 3O13A 2JA6B 4F7XA 2C5CA 1PTOB 3MTSA 5CV8A 3SDZA 3I4MB 4C1NK 3T53B 3Q6SA 4RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDQ A;  3E6Z X;  2VB2 X;  2L55 A;  2QCP X;  1ZEQ X;  2VB3 X; 
#chains in the Genus database with same CATH topology
 3SEB A;  1LUZ A;  3VR6 A;  4K6L A;  3HOV B;  1T5E A;  4DA2 A;  2A19 A;  5BN3 A;  4ALP A;  3PUX A;  1JC7 A;  5ISR A;  4A93 B;  2HHH Q;  4OGQ C;  1E7Z A;  1PH7 A;  1OXX K;  1STG A;  5E3F A;  2LKV A;  1K83 B;  1TWH B;  2ZJR A;  1I4H A;  2BA1 A;  4XYQ A;  1Y8P B;  4WJ3 M;  1K28 A;  2ZXO A;  1R4P B;  4IJH A;  1QE6 A;  4DK1 A;  5HGT A;  4X3S A;  5IT9 E;  1FJG Q;  3R93 A;  2FFK B;  3T1H Q;  4BBS B;  3E0E A;  2Z6K A;  1VQC A;  1KNE A;  3UDG A;  1LTB D;  1F2M A;  1MIU A;  4GZY C;  3F2D A;  2M2L A;  1SYB A;  2IX3 A;  1PH4 A;  1U4L A;  1IYJ B;  3OYY A;  4KJN A;  2AHO B;  2BH8 A;  2EY6 A;  4C2M H;  3BZK A;  2F4I A;  2JYO A;  1PZK D;  1GHK A;  1GUG A;  3PV0 A;  1K3R A;  5AJ3 L;  1E2W A;  3NP8 A;  2R7D A;  3K5M A;  1VMC A;  2Q8I B;  1LM0 A;  4LWC A;  1U4P A;  1H9K A;  1SYF A;  1JJ2 A;  2F0J A;  1JIC A;  1NBW A;  3I4N G;  3M3Y H;  2ID0 A;  4PV1 C;  2NYZ D;  3IL8 A;  3I4O A;  2Z1C A;  3EIV A;  1XMO L;  4QQB X;  2AQ3 B;  4R4I A;  3J81 L;  1SMY C;  2E76 C;  1LAC A;  4NKL A;  4JI4 Q;  3HKS A;  1HR0 W;  3D8G A;  5EGT A;  1BKB A;  4DV5 Q;  4LFC L;  5C3E B;  1NNX A;  1LLR D;  3CU7 A;  1JWS D;  5IYD H;  2LY7 A;  4B3T Q;  3GTG H;  2K5N A;  4RKL A;  3Q24 A;  1SR3 A;  1PYS B;  1QVC A;  1SSO A;  1A15 A;  1IKL A;  4PMW A;  2L55 A;  1L0X B;  3DMU A;  4Q0F A;  1VQM A;  4HJA A;  3S16 H;  3PO2 H;  4M8A A;  2VQE L;  4POF A;  4A3J G;  4JK1 C;  4JV5 L;  2N3S A;  3U9O A;  1ET6 A;  3OW2 A;  4JBW A;  2X69 A;  4TVA B;  1HNW Q;  5EAY A;  5DAU A;  3S17 H;  3TP6 A;  3C2P A;  5CBA E;  3AFQ A;  4RA8 A;  1XTD A;  5IT9 L;  3CXC A;  1W3S A;  1SJH D;  4PMC A;  2L9H A;  3FMC A;  1QNK A;  1I3Q H;  1KDB A;  5LHY 1;  3TQY A;  2PQA B;  5IGF A;  4C3J H;  1VQN A;  2RDH A;  3E6Z X;  2B39 A;  3E5S A;  1WTW A;  4OX9 Q;  3D6C A;  1DM0 B;  3CAM A;  1E2V A;  1PRT F;  1AZQ A;  1IBK Q;  3JAM i;  4JCV E;  4FP5 D;  3VYT A;  3CPW A;  4O0A A;  3GV6 A;  2A8V A;  4R8I A;  3LNN A;  2F03 A;  2NVX H;  5IYB G;  1W6K A;  4B3M Q;  1FD7 D;  2A68 C;  1YNN D;  2HDM A;  1J9O A;  1HPC A;  1S5E D;  2K33 A;  4DR7 Q;  1EZ6 A;  3TBI B;  1W6J A;  4B3R L;  1DZ1 A;  3NQT A;  1QG7 A;  3PMF A;  1CKN A;  4A3D B;  2E2I H;  1PZI D;  4KHZ A;  1XPR A;  4FXD A;  1EYC A;  4JYA L;  4DR5 L;  1QVF A;  1DOM A;  4MZ9 A;  2A5H A;  1BCP F;  4EX5 A;  2B2U C;  1VQL A;  2LSS A;  4B3S Q;  1AN8 A;  3TZU A;  1EEF D;  4IUN A;  2K32 A;  3H0G H;  4TQU S;  2L11 A;  1RD9 D;  4DAY B;  3S1N H;  1O80 A;  5BR8 Q;  3FKI B;  2K6A A;  3RD4 A;  3HOU G;  1KD1 C;  2SOB A;  3CD6 A;  1G2S A;  4JI3 L;  1E22 A;  4RAU C;  1SNQ A;  1O7Y A;  2J4X A;  4CKB A;  3CCJ A;  2MQH A;  4AYB E;  3KDF B;  5DM6 3;  3D4R A;  2VB3 X;  4X65 L;  2EYM A;  4P73 A;  1UWV A;  2F0D A;  3I56 A;  1QB5 D;  4RFB A;  2QDB A;  1ENF A;  1CT1 D;  3ZYY X;  2E2H B;  1DGS A;  1CQF A;  2NN6 G;  3A7L A;  3KBG A;  5C4J B;  1DON A;  2E2J B;  4X66 Q;  4WFN 3;  1WTV A;  2UXB Q;  4J15 A;  1E2Z A;  4MHE A;  2EY1 A;  2BE5 C;  3EQL C;  1GXD C;  5E4X A;  4A3E B;  1G91 A;  4ZKB B;  3DWQ A;  1EY9 A;  3TDQ A;  3OSO A;  4DV0 Q;  1VQF A;  1NTG A;  2KCT A;  1V1O A;  1HRJ A;  1DJR D;  4RH6 A;  3K59 A;  2JA6 G;  4H02 A;  4MTK A;  5FLX c;  3N52 A;  2ZJQ A;  1ROD A;  3I4M G;  3HGB A;  5IWA L;  3Q23 A;  1OXS C;  1WCM B;  3F2B A;  4JI2 L;  5C6A A;  3H15 A;  3HOV G;  5L37 A;  2Q2T A;  1CFM A;  2TSS A;  2EXZ A;  4A93 G;  1ESF A;  1TY2 A;  1VQH A;  4GKK L;  4A3C G;  5EKK A;  1ZEQ X;  1K8A C;  5EKI A;  5JVH 3;  4LF8 Q;  3GTK H;  4OO1 G;  1NJI C;  1TXY A;  1B8A A;  3TSS A;  4DV7 L;  3T1Y L;  1SEB D;  3OMG A;  5FK9 C;  3K0X A;  2YTY A;  3PO3 B;  1YIJ A;  2EDG A;  1KAB A;  3VR2 A;  4BBS G;  4HJ8 A;  2KCN A;  1EY5 A;  4DU9 A;  1PH1 A;  2PQA A;  4N8F A;  3RR5 A;  1SNP A;  1N34 Q;  1I6H H;  4BA1 I;  3TEH B;  2EPB A;  4WJW A;  5T1I A;  4R1J A;  2YYZ A;  5C0X H;  2FXQ A;  2F3W A;  4JI5 Q;  1A3U A;  2EXD A;  1FVI A;  1TWA H;  2HHH L;  1X6O A;  3OMC A;  4N9P A;  2NVY B;  3L3O C;  3ITP A;  4IN3 A;  3S2D B;  2PQE A;  3RNU A;  3CCE A;  1MGS A;  4IUV A;  2HT1 A;  3FVQ A;  3H09 A;  3DWA A;  1N36 L;  5D14 A;  2CQA A;  2A1A A;  5ELE A;  2DY8 A;  3H91 A;  1AFP A;  3QOL A;  3GTQ H;  2F0S A;  5EQ0 A;  1QZG A;  3W1B A;  2JA7 B;  1OXV A;  2HQL A;  4NDX A;  1HR0 L;  3C46 A;  3KK7 A;  1FJG L;  2FJ2 A;  3R2I A;  3T1H L;  5C3E G;  4LNQ A;  1YNJ C;  3I4L A;  1U4M A;  4YIJ A;  2KUM A;  2QDL A;  1KAW A;  1EIH A;  3G6E A;  1PMR A;  3DEP A;  4DUY Q;  3HOX B;  1A2T A;  3SE0 A;  2VS1 A;  4DV2 L;  1HJP A;  5IGE A;  4DAY A;  4M1U B;  2BH2 A;  4IJL A;  3TME A;  3S1M H;  1NMG A;  1ZYR D;  3VA5 A;  3C3L A;  2JSO A;  1MSG A;  1HFN A;  4LJZ C;  2PW7 A;  4DR3 Q;  2E74 C;  3FP9 A;  4DV1 Q;  3KDF A;  2F0T A;  2I0Q A;  3KJP A;  5AFW A;  4KY7 A;  5J3B A;  2D0P A;  4OL7 A;  4QMG A;  4JBK A;  3MEH A;  3FHW A;  3TN2 A;  3OIQ A;  5FLM H;  2SEB D;  4XDX A;  1C0A A;  1I4P A;  3SXH A;  1EYD A;  4OWT B;  2IW3 A;  5JEA J;  2XGT A;  1G51 A;  3TP7 A;  1D6E C;  2QGQ A;  5COY A;  2BDN A;  2MHV A;  5JJL A;  2R93 B;  2KBN A;  4QUC A;  4DPG A;  4EQP A;  4IOC A;  2I07 B;  1TWG H;  4KTA A;  4LFA L;  1A3T A;  2KA7 A;  3BVM A;  2KHJ A;  3A54 A;  4HJ5 A;  5FO8 B;  3GTL B;  1A6X A;  1H9S B;  1VF5 C;  3TRE A;  1T9H A;  1IKM A;  3IFD A;  2A6H C;  4HMI A;  2IX1 A;  2B63 H;  5A35 A;  1VQ6 A;  1R9T H;  1TWC B;  4I7Z C;  1M1K C;  4Y7N H;  5IT9 c;  2R7Z H;  2NUC A;  2F0N A;  4YCU A;  1WTP A;  1ASY A;  5I2X A;  2J0T D;  4ME5 A;  3FKI G;  4DXG A;  1IBK L;  4RGN A;  1G29 1;  1UEA B;  3CC4 A;  4G57 A;  3JC6 6;  3QOJ A;  4U68 A;  1EOV A;  1EFI D;  2IJ0 A;  4FDB A;  4DR7 L;  3WWV A;  3U4Z A;  3HKZ B;  5JEA H;  4C56 C;  2EJM A;  3K6O A;  1GVP A;  4GOP C;  3QWN A;  4RGT A;  3K80 C;  3P1H A;  3VR3 A;  1ESR A;  1L1O C;  1HQR D;  1WTH A;  4PQX A;  3U4V A;  1H9M A;  4FNF A;  1VQD A;  4C3H B;  1X3G A;  3HOY B;  2ZT9 C;  5J39 A;  4GKJ Q;  2QCP X;  1CKO A;  3CP0 A;  2WB1 E;  1JOO A;  4A3E G;  2DY7 A;  3HEJ A;  4HR7 B;  5BR8 L;  4RGM A;  3NEM A;  4LFB Q;  1RDP D;  2Z4H A;  2VUM H;  4UDU C;  4IAL A;  3CCU A;  3GTM H;  5C3X A;  5IYC G;  2WV6 D;  3URY A;  1HQM C;  4DF7 A;  3U9S A;  5I9O A;  4QGU A;  4OON A;  1F9R A;  3A8J E;  4XIG S;  2G5D A;  4HJ7 A;  1CA5 A;  1CZW A;  5IYB H;  3VYR A;  1UE6 A;  1CKM A;  1WCM G;  3S1R B;  3EN2 A;  4J6H A;  2KHS A;  2MNA A;  1D5X C;  3K8A A;  3OIP A;  5C44 B;  3KLS A;  1S5D D;  1IW7 D;  3CPF A;  2YU9 B;  2WKD A;  3P7J A;  4J1M A;  4X66 L;  1KHI A;  5ELC A;  5JVG 3;  1SDF A;  2F0H A;  3I2Z A;  5FO9 B;  2JA8 B;  1VMP A;  2F0E A;  2OTJ A;  3K5O A;  3GTO B;  2F0P A;  4HCE A;  1QUQ B;  4ODG A;  2A73 B;  4K5W A;  3T56 B;  4A3G B;  1A63 A;  1PDQ A;  3Q8D A;  4FF1 A;  4K5X A;  3HOZ B;  2F0Q A;  2UXD Q;  3PO3 G;  3KF6 B;  3BVG A;  3RZD H;  1BBU A;  3TZD A;  1TWF B;  1VQG A;  3PF5 A;  3RUZ A;  4EVO A;  4WRD A;  2JA5 H;  2CH4 A;  2AUK A;  3BYT B;  4CJ0 B;  2XIW A;  2H4O A;  1G6Z A;  3DHQ A;  1VQB A;  4JI0 Q;  1PHJ A;  3MHB A;  1EUJ A;  5D3D A;  2KEN A;  1KQS A;  2V1C C;  4OEL B;  4BY7 G;  5KNC A;  2AQ1 B;  2RDF A;  4KKS A;  3NE5 B;  1VQ7 A;  2Z0S A;  1TKW B;  5GAD C;  4EQO A;  4DR6 Q;  2K7V A;  1SE8 A;  5C0X I;  1TVX A;  4EQ5 A;  1F2L A;  4CBV A;  4DFA A;  1K3B C;  3M7N A;  4FO2 A;  4XT1 B;  1B53 A;  2EYO A;  1KLU D;  5I4D A;  4IOA A;  3ER0 A;  3BJU A;  1H9S A;  2RVL A;  3W5O A;  4QUF A;  3K5N A;  1KL9 A;  2QF7 A;  1J8I A;  2F1M A;  4TRD A;  1PTO D;  1SYE A;  1S72 A;  2JA7 G;  1N8R C;  3OTO Q;  1E3P A;  1F2Y A;  2PZT A;  3MXP A;  1EOT A;  4P74 A;  4IPC A;  4DR2 Q;  1VQP A;  3AEV A;  3AMU A;  2UUC Q;  1I50 B;  1EIF A;  2Y0S E;  5LMU Q;  1Y8O B;  1DYQ A;  3MFG A;  3HOX G;  4N8X 1;  4UP7 A;  1XNR Q;  4R4T A;  4ZQ3 A;  2NVQ B;  4UP8 A;  3SK8 A;  3GO5 A;  2FMM A;  2OT2 A;  1SE3 A;  3HOV H;  2BOS A;  1SFO H;  2ZTC A;  4CKE A;  4DK3 C;  3G71 A;  2ZXP A;  2L5T A;  3J81 E;  4F88 A;  4ZYS A;  4ME3 A;  5K5P A;  3F1Z A;  3K7A B;  1Y69 U;  2GVA A;  1XPO A;  5JAV A;  2FHT A;  4BY1 H;  1VS0 A;  2MO1 A;  3RN5 A;  1BVS A;  4RKB A;  1ZXT A;  2RSO A;  1EWC A;  4KHV A;  4BXX G;  1CM9 A;  1AZP A;  1ASZ A;  3K81 C;  1SN8 A;  3MZ5 A;  4IFD I;  1YBY A;  1Y1W B;  4O42 A;  2FIN B;  1IHZ A;  3PQI A;  2R93 G;  2IHF A;  4BBS H;  1M4V A;  1JWM D;  3GTJ H;  4P72 A;  4K8J A;  1O7I A;  4FF2 A;  5FO7 B;  3T4A C;  4A3K B;  5CR3 A;  1HZA A;  2F0L A;  1J5E Q;  1PH8 A;  2D0O A;  1PZJ D;  4F87 A;  2OTL A;  2O2L D;  4KN7 C;  4DV1 L;  1WFQ A;  3QJY A;  4X3T A;  2VXW A;  1FNU A;  3WOF A;  4IFD G;  1J6Q A;  4XYO A;  4DKA C;  1LO5 D;  4R4O A;  2AMC B;  3T51 B;  1X3Q A;  3RLO A;  2WFW A;  1RJT A;  3NWT A;  4JW0 A;  1EY6 A;  1KTK A;  4R4C A;  1S3O A;  3CRL C;  2PI2 A;  4K14 A;  1SMX A;  2N8N A;  5DM7 3;  4A3B H;  2PZU A;  3KLW A;  2ZTD A;  1HCZ A;  2RKS A;  1STE A;  2UXC Q;  2EJF C;  3H6M A;  1LT6 D;  1B2T A;  1EQR A;  4HAE A;  2NTS A;  1OTC A;  3S15 B;  4ZRZ A;  3HOW H;  4A3F H;  1QUQ A;  4CDD C;  1B9N A;  4OWW B;  5T1G A;  2B29 A;  3HKZ G;  3RMH A;  2KCC A;  2EYP A;  3KF6 A;  3G6J B;  1NE3 A;  1STA A;  2R3Z A;  3FRP B;  1YHQ A;  3M7G A;  1RKN A;  1Z47 A;  3TS2 A;  1SMY D;  5KYI A;  4H44 C;  2CFM A;  1EQT A;  4C2M B;  3FPU B;  5GAH C;  2MP1 A;  4C3H G;  1XTC D;  1RTN A;  5JJZ A;  1O7L A;  3HOY G;  1QVG A;  4IUR A;  4DR1 Q;  1DOK A;  1KLG D;  3EFX D;  2EZV A;  4A76 A;  2PMZ E;  3J80 L;  2ATW A;  2E5L Q;  4QIW B;  3M3Y B;  1HNZ Q;  1JB7 A;  2WAQ G;  1CTM A;  1LTI D;  4RCO A;  1N32 Q;  4MIU A;  1SRO A;  1TS2 A;  1MJC A;  5C5L A;  3S1Q H;  5K36 G;  4A75 A;  3M4O H;  3OOC A;  1YIT A;  5D65 A;  1IZ6 A;  2YTX A;  2DUD A;  1GUN A;  3GTG B;  3LX0 A;  4DN4 M;  5C44 G;  1V1Q A;  3TRZ A;  1WOC A;  1V8Q A;  1ENA A;  4IUT A;  3UE0 A;  2EYF A;  5G3L D;  3SGI A;  5BN5 A;  3S16 B;  4C3I B;  3PO2 B;  4K8I A;  1EL0 A;  5DNF A;  3KBX A;  3PIP 3;  3EA6 A;  1JQY D;  5M3F H;  4A3M H;  2JA8 G;  4GKJ L;  3G4S A;  3MFY A;  2F3I A;  2IL8 A;  1UE5 A;  3P75 A;  5ELN A;  3S17 B;  1UNS A;  3GQB A;  1N9W A;  1SRU A;  1EQQ A;  4A3G G;  2OEO A;  1B70 B;  1V43 A;  2I46 A;  2Q2H A;  4K2K A;  2PW5 A;  3HOZ G;  1GHJ A;  1RL2 A;  2F0I A;  3R8B A;  3STB D;  2R92 H;  4MNO A;  2B2Y C;  4K2L A;  3FKI H;  5A2Q E;  3KOJ A;  2MPM A;  4KI0 A;  3VR4 A;  3J7A V;  3VDY A;  1I3Q B;  3R2T A;  3V2T A;  3CCS A;  1I4X A;  2Q2I A;  2K5D A;  4ZKC B;  4C3J B;  3OWE B;  1X65 A;  4KV6 A;  4X3U A;  4Z9C B;  1B3A A;  1A0I A;  4HIK A;  1EWI A;  1T5X D;  3A5U A;  3OW7 A;  1X56 A;  2PNH A;  2NVX B;  2A74 C;  5FJ8 G;  4LW1 A;  4K0K Q;  1LTR D;  4YCV A;  5C4X H;  2VW9 A;  3IFT A;  4ID6 A;  1ILP A;  4IPH A;  4HSP A;  4UAI A;  3I55 A;  1HHV A;  2E2I B;  2V4D A;  1I4R A;  3UI2 A;  3OPO A;  1EFW A;  4A3E H;  1Y1V B;  2X6L A;  3I7F A;  1VQ8 A;  3M85 A;  2JA9 A;  2VY3 A;  1XMQ Q;  3MWY W;  3A74 A;  2VL6 A;  3F8T A;  1PRT C;  1AEX A;  3H0G B;  5IYC H;  3K58 A;  1X3P A;  3NTH A;  4JI0 L;  1HA6 A;  1Q8K A;  1CA6 A;  5HUR A;  3G48 A;  3S1N B;  3CMA A;  1WYD A;  5LL6 S;  3OHX C;  4FF4 A;  2WAC A;  4YY3 Q;  1KDA A;  4DR6 L;  4A3I G;  1EY8 A;  2IX0 A;  4N9T A;  3W2D A;  1C7Y A;  4E6I A;  1C4Q A;  2I5L X;  1FNV A;  1N33 Q;  2LS0 1;  2JQO A;  4HN7 A;  2LFN A;  4JI8 Q;  4I7A A;  3PUW A;  3AQQ A;  2VQF Q;  2EYH A;  5A2Q L;  2L1B A;  2RQX A;  1BCP C;  2ES2 A;  5JOB A;  5IOC A;  3OTO L;  2L0C A;  2CCZ A;  1FGB D;  2DGY A;  2GVB A;  3MXG A;  5I6Y A;  5COR A;  3NWS A;  3NTK A;  1Y1W G;  4TSS A;  3P20 A;  1MBY A;  4KD4 A;  3PO3 H;  1XNR L;  2A69 D;  1IBL L;  2OQK A;  2UU9 L;  4X62 Q;  4NP5 A;  4MTN A;  5I9P A;  4A3K G;  3OWF A;  1K73 C;  1GUW A;  1PH9 A;  5M5Y H;  1U4R A;  4JVZ A;  1PH5 A;  3KJO A;  1GM5 A;  3F2C A;  4GNX C;  1DOL A;  2B2V C;  2PYK A;  1ML0 D;  4BY7 H;  4L5Q A;  3BDO A;  4IUQ A;  1U5K A;  4O1N A;  2UUA Q;  1HUM A;  1BCP B;  1Q1E A;  3F2U A;  1D8L A;  4HTH A;  5M3M H;  1HZ9 A;  2K1B A;  4DNR B;  2F0W A;  2Z4I A;  3UE1 A;  1FGU A;  3MXU A;  4J8Q A;  4LF6 Q;  1GJX A;  2KEE A;  3PSI A;  2JA7 H;  3GTK B;  4KD3 A;  5CBE E;  3S24 A;  5JPM C;  2VB2 X;  1EY0 A;  2O5J C;  3MAQ A;  2PO4 A;  5IOD A;  2AKW B;  1YJN A;  1MI2 A;  3RLN A;  3J7Y W;  2RCF A;  3HG9 A;  2NZO A;  1I6H B;  1EZ8 A;  2CW0 C;  1B7Y B;  1EQV A;  4WOR A;  5TSS A;  3BG3 A;  1L0Y B;  2UXC L;  3NXW A;  2WII B;  1H9J A;  1ZYR C;  2HIX A;  1WD1 A;  5M5X H;  1X9N A;  1K9M C;  3GTQ B;  3NBI A;  2B2T C;  1Q86 C;  4IQZ A;  5IGC A;  3I70 A;  4JI4 L;  2G9H D;  4NMZ A;  1LAB A;  1I94 Q;  4DV5 L;  1B44 D;  1C48 A;  2AQ2 B;  1VQK A;  2B2U A;  1KRS A;  3A56 A;  3TS0 A;  4B3T L;  1SBB B;  4ZCK A;  3J81 c;  1QJO A;  2K03 A;  2N78 A;  5C5M A;  3PF4 A;  3KYH C;  5DLQ E;  2GA4 B;  4LF9 Q;  4DV6 Q;  2JP1 A;  1G8Z D;  4C3I G;  3CC2 A;  4RCN A;  4ZAI A;  3PO2 G;  3S1M B;  4DNI A;  2NVT B;  4HCS A;  2R7F A;  4DR1 L;  2CVR A;  2EQS A;  1IYV A;  1IL8 A;  1HNW L;  1STB A;  1BO0 A;  2RA4 A;  2E5L L;  1M8A A;  5KRU A;  1TWC H;  4A3D G;  4H13 C;  1N32 L;  3DM1 A;  1KAA A;  2HCC A;  1GUS A;  5EPK A;  2F4V Q;  2K01 A;  2Q2U A;  1A2U A;  4JBM A;  3E9H A;  3ERO A;  1S5B D;  3W1G A;  4APV A;  3J80 c;  4G7O C;  3I4N H;  5I2Y A;  1I4Q A;  2PNR C;  4C3J G;  3V05 A;  1XMO Q;  1G6P A;  3GD7 A;  3PUV A;  1U9R A;  2A6H D;  3LWE A;  3BZC A;  1K8G A;  4OX9 L;  1PVO A;  1E1T A;  2B8G A;  1YJ9 A;  5EPL A;  1CZG A;  1X54 A;  2K4K A;  1YHB A;  3Q0A A;  5M9O A;  1G2T A;  5IGG A;  1TWG B;  3J7A 5;  4ABN A;  2QKI C;  1A3V A;  4BWG B;  3CF5 A;  1GUO A;  3GP7 A;  2D5D A;  4DAV A;  4B3M L;  2NWG A;  1NMF A;  1VDZ A;  1X55 A;  4JI7 Q;  3HOY H;  2VQE Q;  4DV3 Q;  3T16 A;  4JV5 Q;  1K8O A;  2AWO A;  4BA2 I;  4A3J H;  1JB3 A;  4LF5 Q;  1F9S A;  1VQA A;  2LXJ A;  4DGZ A;  1Y1V G;  2B63 B;  5GRO A;  2K05 A;  5EBC A;  4B3S L;  3A5Z B;  4HSV A;  2WIN B;  4CJ1 B;  3H0G G;  2Z6K C;  1Q82 C;  2R7Z B;  2NBF A;  3RN2 A;  1HA5 A;  4RGO S;  3CHB D;  1MJE A;  2AUJ D;  2KJX A;  3CC7 A;  1II3 A;  2A6E D;  1KDC A;  3TP5 A;  4B9X A;  3PGZ A;  3CQZ H;  5C44 H;  1HFG A;  4NXM Q;  4NXN Q;  4K0K L;  5CV6 A;  2PMZ B;  4GN3 B;  1VCI A;  3X3N A;  2QW7 A;  4HMJ A;  4UHV A;  1ICW A;  3MA2 B;  2XWJ B;  1H95 A;  4ZLT F;  1HH2 P;  2JA8 H;  3S2H H;  1VF7 A;  4LF7 Q;  1XPU A;  4GOP B;  1XYI A;  3IKJ A;  4LK1 C;  3G7L A;  4LF4 Q;  2K5H A;  1L1O B;  1STN A;  1LYL A;  1PTO F;  3A8I E;  2RSN A;  1XMQ L;  1IL2 A;  1R4Q B;  1O78 A;  5I6W A;  2UXB L;  5LMN Q;  4B08 A;  1JOR A;  2F52 A;  4YWK A;  2MO0 A;  1Q12 A;  2Q8R E;  3ND9 A;  2XWB B;  4OIK A;  4R4Q A;  4DK0 A;  2F3V A;  4H7B A;  2VUM B;  4YY3 L;  2KQ3 A;  2R6G A;  4ILW A;  1GKH A;  1PH6 A;  3GTM B;  4DV0 L;  2KHI A;  3L9A X;  4AIM A;  1FYC A;  4L6T B;  3DLL A;  1FL0 A;  5F2D A;  4O2D A;  4U67 3;  1VQ4 A;  3HOU H;  3RZO H;  4JI8 L;  2ALY B;  2I5H A;  5KNB A;  5ELO A;  2VQF L;  3GTP H;  2CHB D;  1WTO A;  5FJ8 H;  4KHP Q;  3A0J A;  2K5V A;  2YTV A;  2OXP A;  3D4W A;  4X65 Q;  4LMQ D;  4LUZ A;  1P8L A;  3J81 i;  3J81 j;  1HTP A;  2RHQ B;  2RF4 A;  2F0M A;  4XQQ A;  1NCV A;  3HZX A;  2D9U A;  3ULP A;  1EU4 A;  4LF8 L;  1S5C D;  2HUG A;  2NN6 H;  3QG1 A;  4X62 L;  3KLR A;  2F0G A;  3GV3 A;  1TS5 A;  3K57 A;  4CJ2 C;  2GN5 A;  1A8V A;  1TY0 A;  2D2C C;  3DM3 A;  1X32 A;  1PFB A;  3RZD B;  1I4G A;  4LUV A;  4AYB B;  1STY A;  1ENC A;  3A8K E;  2JA5 B;  1BQQ T;  1GUT A;  4A3I H;  2B2T A;  1XX8 A;  3DWP A;  1IBM Q;  1QWY A;  2JA6 H;  4KKT A;  1JT8 A;  3M4Y A;  1PTO C;  1SXT A;  3CME A;  1N34 L;  3H3V C;  5E1F A;  4BBR B;  1PTO H;  5C0X G;  2EOT A;  3NEL A;  1B9M A;  3I72 A;  3H3V H;  3I4M H;  2DN8 A;  2TMP A;  4JI5 L;  1JE5 A;  3LGJ A;  1KIX A;  4JI2 Q;  4GLX A;  5BN4 A;  1GO3 E;  2CWA A;  2HDL A;  4EGV A;  4A4I A;  1BBW A;  2LXK A;  2ENB A;  1XNQ Q;  4FXG C;  4UPA A;  4A93 H;  1JMC A;  3EBE A;  4YWM A;  4P2C B;  1Y1W H;  4A3C H;  5KEE A;  3PIP A;  4CDC C;  3ERS X;  2RBM A;  4DV7 Q;  4OO1 H;  4IUU A;  2ZM6 Q;  3ICE A;  1K83 H;  1TWH H;  1WTX A;  5M5W B;  2EJG C;  5CMD A;  1SJE D;  3T1Y Q;  2F0V A;  4OHJ A;  1CI3 M;  4XTC S;  3EJI A;  4JI1 Q;  3VA7 A;  4K5V A;  4K6D A;  1Z6H A;  4DUY L;  2B8F A;  1D5Z C;  1EU3 A;  4G7Z C;  1QNU A;  2JN4 A;  1TS4 A;  3VYS A;  1O7Z A;  3J80 E;  5DEH A;  1WD0 A;  2EYJ A;  1RIP A;  2PZW A;  1OXU A;  1SFO B;  4DR3 L;  4V19 0;  4PZ6 A;  3S14 B;  2HD3 A;  2MFI A;  2OQ0 A;  5IP7 G;  3QIA A;  4BY1 B;  4KY6 A;  1N36 Q;  5FLM G;  4GOP A;  1MSH A;  3D4D A;  4YHH Q;  3S15 H;  1I94 L;  1L1O A;  5HGQ A;  1F2Z A;  2SNM A;  1DXM A;  4R9W A;  4C1N I;  3J7A F;  1GOZ A;  1KXL A;  1HR0 Q;  1STH A;  2QIL A;  2RHS B;  3BDL A;  4JG2 A;  4LF9 L;  4DV6 L;  3QB3 A;  3MVV A;  5C3E H;  4X3K A;  3GTJ B;  1QOH A;  2EYL A;  3I91 A;  2WP8 J;  3L0O A;  5G3L F;  1MHW C;  2NZ1 D;  4DV2 Q;  4JPB W;  3DEO A;  4Q5V A;  3Q22 A;  4FYD A;  3SK5 A;  1SNC A;  5FOB B;  3TP8 A;  2X6G A;  3X3M A;  2F4V L;  4ZUI A;  5E4W C;  2B63 G;  5J1Z A;  3HKZ E;  5IP9 G;  1YJW A;  3D31 A;  2M00 A;  3D3R A;  3ONA B;  5ELF A;  4NB3 A;  1H9R A;  1I6V C;  4G7H C;  4CHT B;  2R7Z G;  2ICI A;  4PZ8 A;  4A3B B;  1EYA A;  2N55 A;  1SAP A;  2O4X A;  5C4Z A;  4HIM A;  4DK6 C;  4FVM A;  5ELB A;  2IHE A;  2K5W A;  4LUO A;  2MGS A;  3MEF A;  3HOW B;  1F9P A;  2QEJ C;  3B6Y A;  4DNT B;  4A3F B;  3CCR A;  2Z6B A;  4HED A;  1Q8I A;  5JEA G;  2WAQ E;  2B3G A;  4JI7 L;  4LFA Q;  4C3I H;  4A3L G;  2J7Z A;  1Q90 A;  4DV3 L;  1S4Z A;  3H94 A;  3KF8 B;  4X64 Q;  1QZH A;  4DXF A;  4LF5 L;  3IAY A;  4QL5 A;  1ICF B;  2FMC A;  4RG1 A;  1Y8N B;  1PV4 A;  2K75 A;  1JOQ A;  4A3D H;  3R3O A;  4KY5 A;  3K7U C;  3K0Y A;  4ZK9 B;  1JWU D;  4DV4 Q;  1JE4 A;  3CKI B;  1JJG A;  1CHP D;  1YEZ A;  2BCO A;  3T13 A;  5KYL A;  1E24 A;  1JJC B;  4Y52 H;  2L12 A;  2VUM G;  4LFB L;  2PI2 E;  3AU7 A;  4QCL A;  3PIO 3;  2A68 D;  2DNC A;  1XWE A;  1V9P A;  4NXM L;  4G4K A;  4DAM A;  4NXN L;  5GAG C;  3S1Q B;  1YNN C;  5CV4 A;  1YNX A;  4F8M A;  3CCL A;  1HXY D;  2XRQ D;  3ERQ A;  3NQI A;  4FXK C;  5D3I B;  1EEI D;  3I73 A;  3M4O B;  1B4O A;  4KJO A;  1AH9 A;  4WJ4 A;  4L63 B;  2SDF A;  4LF7 L;  4JOI C;  3STB C;  1OO9 B;  4DR4 Q;  2AWN A;  1PFN A;  4LF4 L;  1PFM A;  5CC4 A;  1WVL A;  1MKH A;  1X3E A;  1HUN A;  3D6W A;  3E3X A;  4IPG A;  4OWX B;  2RCN A;  5JPN C;  5M3F B;  4A3M B;  4RHR A;  5LMN L;  1OXT A;  1Y1V H;  2OF1 A;  2XRS D;  2E2H H;  1AW7 A;  1TR5 A;  5C4J H;  4L5T A;  1D1I A;  4IPD A;  4ULL A;  3L7Z C;  2YV5 A;  2E2J H;  1PYB A;  3HP3 A;  3SK4 A;  1EYG A;  1L2F A;  1AE2 A;  1BBX C;  2NN6 I;  5EBD A;  2EY5 A;  4HJ9 A;  1Q7Y C;  2R92 B;  1Q81 C;  3HFZ B;  2UXD L;  4XT3 B;  2IT1 A;  1LT5 D;  4AYB G;  3CCM A;  4OIJ A;  5C4H A;  2JA5 G;  2UUB Q;  4IO9 A;  4S3S A;  2JEB I;  3U50 C;  5IE8 A;  4KHP L;  4JBJ A;  1BNZ A;  1F9Q A;  3JAM E;  4L8J A;  4BBR G;  1PXU A;  2QEX A;  2M9V A;  1PRT D;  1QIL A;  1SE2 A;  3NPP A;  4DAP A;  2NZH A;  1WCM H;  4RMF A;  3VYU A;  2BE5 D;  2WB1 B;  3H3V I;  1EY4 A;  1SYC A;  5C4X B;  4ZUJ A;  2XNA C;  5JJI A;  1MD2 D;  1LTL A;  3I8Z A;  4DUZ Q;  2MJ8 A;  4LAA A;  4RWS C;  3CW2 C;  1RTO A;  2IPK D;  2P5Z X;  2K04 A;  1BF4 A;  1PYW D;  4DR2 L;  2ICE C;  2UUC L;  5C0X J;  2ZTE A;  1BCP D;  4OO1 I;  5LMU L;  3PUZ A;  1IBM L;  3V96 A;  3NHH A;  1LTT D;  1PRT B;  4JI6 Q;  2DNE A;  1E1O A;  1Q3L A;  3KFU A;  1VQ9 A;  3IRB A;  1BXT A;  1NUC A;  3M9B A;  3UDF A;  4XQJ A;  2SNS A;  1P16 A;  4AQY Q;  1CSP A;  2A69 C;  1S40 A;  1XNQ L;  5CV7 A;  2KVM A;  3KUP A;  2NVY H;  4BY1 G;  4UP9 A;  4BS9 A;  3KF8 A;  3SK6 A;  3S2D H;  1HZC A;  1QCB D;  3W3A A;  2H5X A;  4CGY B;  1SNM A;  2ZM6 L;  5FKA C;  4CDE C;  4L5R C;  2Z9H A;  3JAM L;  4JI1 L;  1U0L A;  5JJK A;  2XSC A;  2L4N A;  3EVQ A;  2Z8L A;  2F0O A;  5CGK A;  1PFS A;  2JJQ A;  1SNO A;  2E75 C;  5M5Y B;  3HOX H;  1CUK A;  3M4Q A;  1AE3 A;  1J5E L;  1LT3 D;  1Z9F A;  3QO2 A;  2C9O A;  4BY7 B;  2C35 B;  4GNX B;  4KKU A;  1C8C A;  4IFD J;  1B50 A;  1SND A;  3D0F A;  5KND A;  2DJG C;  5CV9 A;  1HNX Q;  2KED A;  4QF4 A;  1BR9 A;  1SE4 A;  4P75 A;  1YVC A;  5M3M B;  3NTI A;  1EIY B;  4PG3 A;  2LMC B;  1YNJ D;  1SLJ A;  3CCV A;  3ULJ A;  4HIO A;  1BOS A;  3BVZ A;  4YHH L;  4POG A;  2Y0S B;  3E9I A;  1TWA B;  1WI5 A;  1EIG A;  1Q1B A;  1JOK A;  5GAE C;  2JEA I;  2K52 A;  3SR1 A;  5KIX A;  2MUY A;  2CWP A;  4A3B G;  3J7Z C;  4JC0 A;  1PLF A;  2DJF C;  3CRK C;  2CW0 D;  3A55 A;  1VQE A;  4BXX H;  1UUP A;  3A7A B;  3HOW G;  5IGD A;  4A3F G;  2K50 A;  5KGU A;  5E7N A;  1FNW A;  3HRZ C;  2R93 H;  4QIW E;  2EVB A;  3FDT A;  4GS3 A;  2NVT H;  2B2Y A;  4GLV B;  1IYU A;  5IYD G;  3ZJY C;  2ZXR A;  3UDX A;  3GTL H;  3NBH B;  1KC8 C;  1A62 A;  4JOI A;  1NR4 A;  2B2W C;  2XN9 C;  2XVS A;  1TT2 A;  2E2D C;  5IP7 H;  5NUC A;  4IFD H;  1TII D;  1WTQ A;  3BU2 A;  2EIF A;  5AJ3 Q;  1HNZ L;  1BDO A;  2CQO A;  5LL6 X;  1X3F A;  1LV9 A;  4HID A;  3PUY A;  5M5X B;  1Y14 B;  3I3C A;  1YI2 A;  2Q8T A;  1K0R A;  1PH3 A;  2BDO A;  1L0W A;  4IUP A;  5CYU A;  1ONL A;  1VQO A;  3UDI A;  3VR5 A;  4X64 L;  1BUV T;  1PA6 A;  2NTT A;  1CSQ A;  4UY8 C;  1RF2 D;  3MXN B;  4L5S A;  4PZ7 A;  2JE6 I;  2K14 A;  1ILQ A;  2JK8 A;  5C3W A;  4LFC Q;  3FEW X;  1JCK B;  5M3F G;  4A3M G;  4DV4 L;  3ULL A;  3I90 A;  4NPS A;  5EKL A;  1D1K A;  4MN3 A;  1VQI A;  2N49 A;  5IP9 H;  1RCV D;  1CK1 A;  3QR8 A;  4C3H H;  1V1P B;  3HS0 C;  1D7Q A;  3BS1 A;  2F0K A;  2OCE A;  2R92 G;  1LTS D;  3C1E A;  5IIF A;  4X6A H;  4XQN A;  1DD2 A;  3MC0 B;  2L15 A;  1GD7 A;  1LTA D;  3I4N B;  2WKC A;  1XJV A;  5J22 A;  1R9T B;  1LT4 D;  1ET9 A;  2CH4 W;  4Y7N B;  3GDE A;  5K36 H;  4DR4 L;  1TQO A;  1UE1 A;  1JR0 D;  3K5L A;  4A3L H;  1M90 C;  1VQJ A;  3RLF A;  3S1R H;  4YWL A;  1SYG A;  2K5Q A;  2WB1 G;  2F0F A;  5C4X G;  2HIV A;  3AYH B;  5EJW A;  2YU9 H;  3BYY B;  3C1F A;  2A6E C;  1YHA A;  1Q46 A;  4CDF C;  1K8M A;  5FLX E;  4GNX A;  1XXG A;  2B2V A;  2BA0 A;  3DUZ A;  2E8G A;  4A3J B;  2HQE A;  3U58 A;  4CKC A;  3WDN A;  4GN4 B;  1TU2 B;  3N6R A;  4AH6 A;  4XXE A;  1FR3 A;  2K28 A;  1PH2 A;  2HCI A;  4B3R Q;  3NUC A;  2IY5 B;  2NB0 A;  2WAQ B;  3AB9 A;  3GTO H;  4A3G H;  1I5F A;  2UUB L;  4JYA Q;  4DR5 Q;  1YZ6 A;  3HOZ H;  1NY4 A;  1S5F D;  2RDG A;  2IWH A;  3E0J A;  2R61 A;  3NSW A;  1K0S A;  1TWF H;  1IW7 C;  1CQV A;  1UAP A;  2VNU D;  4KN4 C;  4KLK A;  4TKO B;  4YCW A;  2F0U A;  3ND8 A;  2XTI A;  3SHL A;  3CQZ B;  1F77 A;  4KMU C;  1KRT A;  1D2B A;  2D62 A;  2N88 A;  1AP0 A;  1N33 L;  2KOL A;  4I65 A;  2EY2 A;  1WJJ A;  1NR2 A;  4DUZ L;  4V0B A;  5EPJ A;  1UE7 A;  4JI3 Q;  3S2H B;  2KCM A;  3FPP A;  3NK9 A;  2ASB A;  1B3Q A;  4QJF A;  3DXJ C;  4OEM B;  1KNA A;  2I5M X;  3NBH A;  2JXM B;  4PNY A;  3AFP A;  3BDC A;  2O5I C;  1HTL D;  1NAP A;  1D5M C;  1TS3 A;  5LMN W;  4JI6 L;  1SYD A;  5IGB A;  1I50 H;  4P71 A;  5IY0 A;  2PCF B;  3WOE A;  2VZA A;  4AQY L;  5CV5 A;  4QY7 A;  2NVQ H;  4BBR H;  2H1E A;  5FLX L;  4EQN A;  1CHQ D;  1HZB A;  3KLS X;  1Z7T A;  4GN5 A;  4IZ8 A;  3HOU B;  1B1Z A;  3RZO B;  1VQ5 A;  3GTP B;  3J80 i;  4NW2 A;  1EY7 A;  4KK7 A;  4FF3 A;  2PPB C;  1E0B A;  2UUA L;  5M3M G;  3LWU A;  1EWH A;  5ELD A;  4R8N A;  4QB4 A;  3MXN A;  2QA4 A;  5GQO A;  3K7A H;  5IWA Q;  2Y0S G;  4LF6 L;  1UEB A;  2G9D A;  2EE1 A;  1NSN S;  2B2W A;  3S9W A;  1RHP A;  5M5W H;  3M4P A;  3NEN A;  4B9W A;  4GKK Q;  4H0L C;  3JAM c;  1DCZ A;  3BZD B;  4GLA C;  3CCQ A;  2ZJP A;  3SVM A;  1IBL Q;  1V1P A;  1IXR A;  2UU9 Q;  1LTG D;  2KEC A;  1ZKO A;  1WTR A;  3PCO B;  2CKZ B;  4A3K H;  1W2B A;  4A3I B;  3L2P A;  4PMB A;  1HNX L;  3PIO A;  3O13 A;  2JA6 B;  1C9O A;  4F7X A;  1CKN B;  2C5C A;  3S14 H;  1PTO B;  3MTS A;  5CV8 A;  3SDZ A;  5HY6 A;  2OWO A;  3I4M B;  4C1N K;  3T53 B;  3Q6S A;  4OXP A;  4RHS A;  5H1S E; 
#chains in the Genus database with same CATH homology
 3SEB A;  3VR6 A;  4K6L A;  3HOV B;  1T5E A;  4DA2 A;  5BN3 A;  3PUX A;  1JC7 A;  5ISR A;  4A93 B;  4OGQ C;  1OXX K;  1STG A;  5E3F A;  2LKV A;  1K83 B;  1TWH B;  1I4H A;  2BA1 A;  4XYQ A;  1Y8P B;  2ZXO A;  1R4P B;  1QE6 A;  4DK1 A;  5HGT A;  4X3S A;  5IT9 E;  3R93 A;  2FFK B;  4BBS B;  1KNE A;  1LTB D;  1F2M A;  4GZY C;  2M2L A;  1SYB A;  2IX3 A;  1U4L A;  4KJN A;  2EY6 A;  2F4I A;  2JYO A;  1PZK D;  1GHK A;  1GUG A;  3PV0 A;  1E2W A;  3NP8 A;  3K5M A;  1VMC A;  2Q8I B;  1U4P A;  1H9K A;  1SYF A;  2F0J A;  1JIC A;  2ID0 A;  4PV1 C;  2NYZ D;  3IL8 A;  2Z1C A;  2AQ3 B;  3J81 L;  1SMY C;  2E76 C;  1LAC A;  4NKL A;  3D8G A;  5EGT A;  5C3E B;  1LLR D;  3CU7 A;  1JWS D;  2LY7 A;  4RKL A;  3Q24 A;  1SSO A;  1A15 A;  1IKL A;  4PMW A;  2L55 A;  1L0X B;  3DMU A;  4Q0F A;  4M8A A;  4JK1 C;  3U9O A;  1ET6 A;  4JBW A;  2X69 A;  5DAU A;  3TP6 A;  3C2P A;  5CBA E;  4RA8 A;  5IT9 L;  1SJH D;  4PMC A;  2L9H A;  3FMC A;  1QNK A;  1KDB A;  5LHY 1;  5IGF A;  2RDH A;  3E6Z X;  2B39 A;  3E5S A;  1WTW A;  3D6C A;  1DM0 B;  1E2V A;  1PRT F;  1AZQ A;  4FP5 D;  3VYT A;  3GV6 A;  4R8I A;  3LNN A;  2F03 A;  1W6K A;  1FD7 D;  2A68 C;  1YNN D;  2HDM A;  1J9O A;  1HPC A;  1S5E D;  2K33 A;  1EZ6 A;  3TBI B;  1W6J A;  1DZ1 A;  3NQT A;  1QG7 A;  3PMF A;  4A3D B;  1PZI D;  4KHZ A;  4FXD A;  1EYC A;  1DOM A;  2A5H A;  1BCP F;  2B2U C;  1AN8 A;  3TZU A;  1EEF D;  4IUN A;  2K32 A;  4TQU S;  2L11 A;  1RD9 D;  1O80 A;  3FKI B;  2K6A A;  3RD4 A;  2SOB A;  1G2S A;  4RAU C;  1SNQ A;  1O7Y A;  2J4X A;  4CKB A;  5DM6 3;  3D4R A;  2VB3 X;  2EYM A;  2F0D A;  1QB5 D;  4RFB A;  2QDB A;  1ENF A;  1CT1 D;  3ZYY X;  2E2H B;  1CQF A;  2NN6 G;  3A7L A;  3KBG A;  5C4J B;  1DON A;  2E2J B;  4WFN 3;  1WTV A;  1E2Z A;  4MHE A;  2EY1 A;  2BE5 C;  3EQL C;  1GXD C;  5E4X A;  4A3E B;  1G91 A;  4ZKB B;  3DWQ A;  1EY9 A;  3TDQ A;  3OSO A;  1HRJ A;  1V1O A;  1DJR D;  4RH6 A;  3K59 A;  3N52 A;  1ROD A;  3HGB A;  3Q23 A;  1OXS C;  1WCM B;  5C6A A;  1CFM A;  2TSS A;  2EXZ A;  1ESF A;  1TY2 A;  5EKK A;  1ZEQ X;  5EKI A;  5JVH 3;  4OO1 G;  3TSS A;  1SEB D;  3OMG A;  5FK9 C;  3PO3 B;  2EDG A;  1KAB A;  3VR2 A;  2KCN A;  1EY5 A;  4DU9 A;  1SNP A;  4BA1 I;  2EPB A;  4WJW A;  5T1I A;  2YYZ A;  5C0X H;  2F3W A;  1A3U A;  3OMC A;  4N9P A;  2NVY B;  3L3O C;  3ITP A;  4IN3 A;  3S2D B;  2PQE A;  1MGS A;  4IUV A;  3FVQ A;  3H09 A;  3DWA A;  5D14 A;  2CQA A;  5ELE A;  2DY8 A;  3H91 A;  1AFP A;  3QOL A;  2F0S A;  5EQ0 A;  2JA7 B;  1OXV A;  4NDX A;  3C46 A;  3KK7 A;  2FJ2 A;  3R2I A;  1YNJ C;  3I4L A;  1U4M A;  4YIJ A;  2KUM A;  1EIH A;  1PMR A;  3DEP A;  3HOX B;  1A2T A;  3SE0 A;  5IGE A;  4DAY A;  4M1U B;  3TME A;  1ZYR D;  3VA5 A;  3C3L A;  2JSO A;  1MSG A;  1HFN A;  4LJZ C;  2PW7 A;  2E74 C;  2F0T A;  5AFW A;  4KY7 A;  4OL7 A;  4QMG A;  3MEH A;  3TN2 A;  3OIQ A;  2SEB D;  4XDX A;  1I4P A;  3SXH A;  1EYD A;  2IW3 A;  5JEA J;  3TP7 A;  1D6E C;  5COY A;  2BDN A;  2MHV A;  2R93 B;  4QUC A;  4EQP A;  2I07 B;  4KTA A;  1A3T A;  2KA7 A;  3BVM A;  3A54 A;  5FO8 B;  3GTL B;  1A6X A;  1H9S B;  1VF5 C;  1IKM A;  3IFD A;  2A6H C;  4HMI A;  2IX1 A;  5A35 A;  1TWC B;  4I7Z C;  2NUC A;  2F0N A;  1WTP A;  5I2X A;  2J0T D;  4ME5 A;  4DXG A;  4RGN A;  1G29 1;  1UEA B;  4G57 A;  3QOJ A;  4U68 A;  1EFI D;  2IJ0 A;  3HKZ B;  5JEA H;  4C56 C;  2EJM A;  3K6O A;  3QWN A;  4RGT A;  3P1H A;  3VR3 A;  1ESR A;  1HQR D;  4PQX A;  1H9M A;  4FNF A;  4C3H B;  3HOY B;  2ZT9 C;  5J39 A;  2QCP X;  1JOO A;  2DY7 A;  3HEJ A;  4HR7 B;  4RGM A;  1RDP D;  2Z4H A;  4UDU C;  4IAL A;  5C3X A;  2WV6 D;  3URY A;  1HQM C;  4DF7 A;  3U9S A;  5I9O A;  1F9R A;  3A8J E;  4XIG S;  1CA5 A;  1CZW A;  3S1R B;  3VYR A;  4J6H A;  2KHS A;  1D5X C;  3OIP A;  5C44 B;  3KLS A;  1S5D D;  1IW7 D;  2YU9 B;  2WKD A;  3P7J A;  4J1M A;  5ELC A;  5JVG 3;  1SDF A;  2F0H A;  5FO9 B;  2JA8 B;  1VMP A;  2F0E A;  3K5O A;  3GTO B;  2F0P A;  4HCE A;  4A3G B;  3T56 B;  2A73 B;  4K5W A;  4ODG A;  1PDQ A;  4FF1 A;  4K5X A;  3HOZ B;  2F0Q A;  3BVG A;  3TZD A;  1TWF B;  3RUZ A;  4EVO A;  4WRD A;  2AUK A;  3BYT B;  4CJ0 B;  2XIW A;  2H4O A;  1G6Z A;  3DHQ A;  3MHB A;  5D3D A;  5KNC A;  2AQ1 B;  2RDF A;  4KKS A;  3NE5 B;  1TKW B;  4EQO A;  2K7V A;  5C0X I;  1TVX A;  1F2L A;  4CBV A;  4DFA A;  3M7N A;  4FO2 A;  4XT1 B;  1B53 A;  2EYO A;  1KLU D;  5I4D A;  1H9S A;  2RVL A;  3K5N A;  4QUF A;  2QF7 A;  1J8I A;  2F1M A;  4TRD A;  1PTO D;  1SYE A;  1F2Y A;  3MXP A;  2PZT A;  1EOT A;  3AMU A;  1I50 B;  1Y8O B;  1DYQ A;  3MFG A;  4ZQ3 A;  2NVQ B;  3SK8 A;  3GO5 A;  2FMM A;  2OT2 A;  1SE3 A;  2BOS A;  4CKE A;  2ZXP A;  2L5T A;  3J81 E;  4F88 A;  4ZYS A;  5K5P A;  3K7A B;  1Y69 U;  5JAV A;  2FHT A;  4RKB A;  1ZXT A;  2RSO A;  1EWC A;  4KHV A;  1CM9 A;  1AZP A;  3MZ5 A;  4IFD I;  1Y1W B;  4O42 A;  2FIN B;  1IHZ A;  1M4V A;  1JWM D;  4K8J A;  4FF2 A;  5FO7 B;  3T4A C;  4A3K B;  5CR3 A;  2F0L A;  1PZJ D;  4F87 A;  2O2L D;  4KN7 C;  3QJY A;  4X3T A;  2VXW A;  1FNU A;  3WOF A;  4IFD G;  4XYO A;  1LO5 D;  3T51 B;  1X3Q A;  1RJT A;  3NWT A;  1EY6 A;  1KTK A;  3CRL C;  4K14 A;  5DM7 3;  2PZU A;  1HCZ A;  2RKS A;  1STE A;  2EJF C;  3H6M A;  1LT6 D;  1B2T A;  4HAE A;  2NTS A;  3S15 B;  4ZRZ A;  1B9N A;  5T1G A;  3RMH A;  2KCC A;  2EYP A;  3G6J B;  1STA A;  2R3Z A;  3FRP B;  3M7G A;  1RKN A;  1Z47 A;  1SMY D;  5KYI A;  4H44 C;  1EQT A;  4C2M B;  3FPU B;  2MP1 A;  4C3H G;  1XTC D;  1RTN A;  5JJZ A;  1O7L A;  4IUR A;  1DOK A;  1KLG D;  3EFX D;  2EZV A;  3J80 L;  4QIW B;  3M3Y B;  1CTM A;  1LTI D;  4RCO A;  4MIU A;  1TS2 A;  5C5L A;  5K36 G;  3OOC A;  5D65 A;  1GUN A;  3GTG B;  3LX0 A;  4DN4 M;  1V8Q A;  1ENA A;  4IUT A;  2EYF A;  5G3L D;  5BN5 A;  3S16 B;  4C3I B;  3PO2 B;  4K8I A;  1EL0 A;  5DNF A;  3KBX A;  3PIP 3;  3EA6 A;  1JQY D;  3MFY A;  2IL8 A;  3P75 A;  3S17 B;  1UNS A;  3GQB A;  2OEO A;  1V43 A;  2I46 A;  4K2K A;  2PW5 A;  1GHJ A;  2F0I A;  3R8B A;  2B2Y C;  4K2L A;  5A2Q E;  2MPM A;  4KI0 A;  3VR4 A;  3J7A V;  1I3Q B;  3R2T A;  3V2T A;  1I4X A;  4ZKC B;  2K5D A;  4C3J B;  3OWE B;  4KV6 A;  4X3U A;  4Z9C B;  1B3A A;  1T5X D;  3OW7 A;  2NVX B;  2A74 C;  1LTR D;  3IFT A;  4ID6 A;  1ILP A;  4HSP A;  4UAI A;  1HHV A;  2E2I B;  2V4D A;  1I4R A;  3UI2 A;  3OPO A;  1Y1V B;  2X6L A;  3M85 A;  3MWY W;  1PRT C;  1AEX A;  3H0G B;  3K58 A;  1X3P A;  3NTH A;  1HA6 A;  1CA6 A;  5HUR A;  3S1N B;  5LL6 S;  3OHX C;  4FF4 A;  2WAC A;  1KDA A;  1EY8 A;  2IX0 A;  4N9T A;  3W2D A;  4E6I A;  1C4Q A;  1FNV A;  2LS0 1;  4HN7 A;  2LFN A;  3PUW A;  2EYH A;  5A2Q L;  2L1B A;  2RQX A;  1BCP C;  5JOB A;  5IOC A;  2L0C A;  1FGB D;  3MXG A;  5I6Y A;  5COR A;  3NWS A;  3NTK A;  4TSS A;  3P20 A;  1MBY A;  4KD4 A;  2A69 D;  4NP5 A;  5I9P A;  3OWF A;  1GUW A;  1U4R A;  1DOL A;  2B2V C;  2PYK A;  1ML0 D;  3BDO A;  4IUQ A;  4O1N A;  1HUM A;  1BCP B;  1Q1E A;  3F2U A;  4HTH A;  2K1B A;  4DNR B;  2F0W A;  2Z4I A;  3MXU A;  4J8Q A;  1GJX A;  2KEE A;  3GTK B;  4KD3 A;  5CBE E;  5JPM C;  2VB2 X;  1EY0 A;  2O5J C;  3MAQ A;  2PO4 A;  5IOD A;  1MI2 A;  3J7Y W;  3HG9 A;  1I6H B;  1EZ8 A;  2CW0 C;  1EQV A;  4WOR A;  5TSS A;  3BG3 A;  1L0Y B;  3NXW A;  2WII B;  1H9J A;  1ZYR C;  1WD1 A;  3GTQ B;  3NBI A;  2B2T C;  4IQZ A;  5IGC A;  3I70 A;  2G9H D;  4NMZ A;  1LAB A;  1B44 D;  1C48 A;  2AQ2 B;  2B2U A;  3A56 A;  1SBB B;  1QJO A;  2K03 A;  5C5M A;  2GA4 B;  2JP1 A;  1G8Z D;  4C3I G;  3S1M B;  4RCN A;  4ZAI A;  2NVT B;  4HCS A;  2CVR A;  1IYV A;  1IL8 A;  1STB A;  1BO0 A;  2RA4 A;  1M8A A;  5KRU A;  4H13 C;  3DM1 A;  1KAA A;  2HCC A;  1GUS A;  5EPK A;  2K01 A;  1A2U A;  3ERO A;  1S5B D;  4G7O C;  5I2Y A;  1I4Q A;  2PNR C;  4C3J G;  3V05 A;  3GD7 A;  3PUV A;  1U9R A;  2A6H D;  3LWE A;  2B8G A;  5EPL A;  1CZG A;  3Q0A A;  5M9O A;  1G2T A;  5IGG A;  1TWG B;  4ABN A;  2QKI C;  1A3V A;  4BWG B;  1GUO A;  3GP7 A;  2D5D A;  4DAV A;  2NWG A;  1VDZ A;  3T16 A;  1K8O A;  2AWO A;  4BA2 I;  1JB3 A;  1F9S A;  4DGZ A;  2B63 B;  2K05 A;  5EBC A;  4HSV A;  2WIN B;  4CJ1 B;  2R7Z B;  2NBF A;  1HA5 A;  4RGO S;  3CHB D;  2AUJ D;  2KJX A;  1II3 A;  2A6E D;  1KDC A;  3TP5 A;  4B9X A;  1HFG A;  5CV6 A;  2PMZ B;  1VCI A;  3X3N A;  4HMJ A;  1ICW A;  3MA2 B;  2XWJ B;  4ZLT F;  1VF7 A;  1XYI A;  3IKJ A;  4LK1 C;  3G7L A;  1STN A;  1PTO F;  3A8I E;  2RSN A;  1R4Q B;  1O78 A;  5I6W A;  4B08 A;  1JOR A;  1Q12 A;  2Q8R E;  3ND9 A;  2XWB B;  4OIK A;  4DK0 A;  2F3V A;  4H7B A;  2VUM B;  2KQ3 A;  2R6G A;  4ILW A;  3GTM B;  3L9A X;  1FYC A;  4L6T B;  5F2D A;  4U67 3;  5KNB A;  2CHB D;  1WTO A;  2OXP A;  3D4W A;  4LMQ D;  1HTP A;  2F0M A;  4XQQ A;  1NCV A;  3HZX A;  2D9U A;  1EU4 A;  1S5C D;  2HUG A;  2NN6 H;  3QG1 A;  3KLR A;  2F0G A;  3GV3 A;  1TS5 A;  3K57 A;  4CJ2 C;  1TY0 A;  2D2C C;  1X32 A;  1PFB A;  3RZD B;  1I4G A;  4AYB B;  1STY A;  1ENC A;  3A8K E;  2JA5 B;  1BQQ T;  1GUT A;  2B2T A;  1XX8 A;  3DWP A;  1QWY A;  4KKT A;  3M4Y A;  1PTO C;  1SXT A;  3H3V C;  5E1F A;  4BBR B;  1PTO H;  5C0X G;  2EOT A;  1B9M A;  3I72 A;  2DN8 A;  2TMP A;  5BN4 A;  2HDL A;  4EGV A;  2ENB A;  4FXG C;  4P2C B;  5KEE A;  2RBM A;  4OO1 H;  4IUU A;  1WTX A;  5M5W B;  2EJG C;  5CMD A;  1SJE D;  2F0V A;  4OHJ A;  1CI3 M;  4XTC S;  3EJI A;  3VA7 A;  4K5V A;  4K6D A;  1Z6H A;  2B8F A;  1D5Z C;  1EU3 A;  4G7Z C;  1QNU A;  1TS4 A;  3VYS A;  1O7Z A;  3J80 E;  5DEH A;  1WD0 A;  2EYJ A;  2PZW A;  1OXU A;  1SFO B;  4V19 0;  3S14 B;  3QIA A;  4BY1 B;  4KY6 A;  1MSH A;  3D4D A;  1F2Z A;  2SNM A;  1DXM A;  4R9W A;  4C1N I;  3J7A F;  1GOZ A;  1STH A;  2QIL A;  3BDL A;  3QB3 A;  3MVV A;  4X3K A;  3GTJ B;  1QOH A;  2EYL A;  3I91 A;  2WP8 J;  5G3L F;  2NZ1 D;  3DEO A;  4Q5V A;  3Q22 A;  4FYD A;  3SK5 A;  1SNC A;  5FOB B;  3TP8 A;  2X6G A;  3X3M A;  4ZUI A;  5E4W C;  5J1Z A;  3D31 A;  2M00 A;  3D3R A;  3ONA B;  5ELF A;  1H9R A;  1I6V C;  4G7H C;  4CHT B;  2ICI A;  4A3B B;  1EYA A;  2N55 A;  1SAP A;  2O4X A;  5C4Z A;  4FVM A;  5ELB A;  2K5W A;  2MGS A;  3HOW B;  1F9P A;  2QEJ C;  4A3F B;  4DNT B;  4HED A;  1Q8I A;  5JEA G;  2J7Z A;  1Q90 A;  1S4Z A;  3H94 A;  4DXF A;  3IAY A;  2FMC A;  1Y8N B;  1JOQ A;  3R3O A;  4KY5 A;  3K0Y A;  4ZK9 B;  1JWU D;  1JE4 A;  3CKI B;  1CHP D;  2BCO A;  3T13 A;  5KYL A;  2L12 A;  3AU7 A;  4QCL A;  3PIO 3;  2A68 D;  2DNC A;  1XWE A;  4G4K A;  3S1Q B;  1YNN C;  5CV4 A;  4F8M A;  1HXY D;  2XRQ D;  3ERQ A;  3NQI A;  4FXK C;  5D3I B;  1EEI D;  3I73 A;  3M4O B;  1B4O A;  4KJO A;  4L63 B;  2SDF A;  1OO9 B;  2AWN A;  1PFN A;  1PFM A;  5CC4 A;  1WVL A;  1HUN A;  3D6W A;  5JPN C;  5M3F B;  4A3M B;  4RHR A;  1OXT A;  2OF1 A;  2XRS D;  1AW7 A;  1TR5 A;  1D1I A;  4ULL A;  3L7Z C;  3HP3 A;  3SK4 A;  1BBX C;  2NN6 I;  5EBD A;  2EY5 A;  2R92 B;  4XT3 B;  2IT1 A;  1LT5 D;  4OIJ A;  5C4H A;  4S3S A;  2JEB I;  1BNZ A;  1F9Q A;  3JAM E;  4L8J A;  1PXU A;  2M9V A;  1PRT D;  1QIL A;  1SE2 A;  3NPP A;  4DAP A;  3VYU A;  2BE5 D;  2WB1 B;  1EY4 A;  1SYC A;  5C4X B;  4ZUJ A;  2XNA C;  1MD2 D;  3I8Z A;  2MJ8 A;  4LAA A;  4RWS C;  1RTO A;  2IPK D;  2K04 A;  1BF4 A;  1PYW D;  2ICE C;  5C0X J;  1BCP D;  4OO1 I;  3PUZ A;  3V96 A;  3NHH A;  1LTT D;  1PRT B;  2DNE A;  1Q3L A;  1BXT A;  1NUC A;  4XQJ A;  2SNS A;  2A69 C;  5CV7 A;  2KVM A;  3KUP A;  4BS9 A;  3KF8 A;  3SK6 A;  1QCB D;  3W3A A;  4CGY B;  1SNM A;  5FKA C;  3JAM L;  2XSC A;  2L4N A;  3EVQ A;  2Z8L A;  2F0O A;  5CGK A;  1SNO A;  2E75 C;  5M5Y B;  1LT3 D;  3QO2 A;  2C9O A;  4BY7 B;  4KKU A;  1C8C A;  4IFD J;  1B50 A;  1SND A;  5KND A;  5CV9 A;  2KED A;  4QF4 A;  1BR9 A;  1SE4 A;  5M3M B;  3NTI A;  2LMC B;  1YNJ D;  1BOS A;  3BVZ A;  2Y0S B;  1TWA B;  1EIG A;  1Q1B A;  1JOK A;  2JEA I;  3SR1 A;  5KIX A;  2MUY A;  1PLF A;  3CRK C;  2CW0 D;  3A55 A;  1UUP A;  3A7A B;  5IGD A;  5KGU A;  1FNW A;  3HRZ C;  2EVB A;  3FDT A;  2B2Y A;  1IYU A;  2ZXR A;  1NR4 A;  2B2W C;  2XN9 C;  2XVS A;  1TT2 A;  2E2D C;  5NUC A;  4IFD H;  1TII D;  1WTQ A;  1BDO A;  5LL6 X;  1LV9 A;  3PUY A;  5M5X B;  3I3C A;  2Q8T A;  2BDO A;  4IUP A;  5CYU A;  1ONL A;  3VR5 A;  1BUV T;  2NTT A;  1RF2 D;  2JE6 I;  1ILQ A;  5C3W A;  3FEW X;  1JCK B;  3I90 A;  5EKL A;  1D1K A;  4MN3 A;  1RCV D;  1CK1 A;  1V1P B;  3HS0 C;  3BS1 A;  2F0K A;  1LTS D;  3C1E A;  5IIF A;  4XQN A;  1DD2 A;  3MC0 B;  1LTA D;  3I4N B;  2WKC A;  5J22 A;  1R9T B;  1LT4 D;  1ET9 A;  4Y7N B;  5K36 H;  1TQO A;  1JR0 D;  3K5L A;  3RLF A;  1SYG A;  2K5Q A;  2F0F A;  5EJW A;  3BYY B;  3C1F A;  2A6E C;  1K8M A;  5FLX E;  1XXG A;  2B2V A;  2BA0 A;  3DUZ A;  4A3J B;  2HQE A;  4CKC A;  3WDN A;  1TU2 B;  3N6R A;  4XXE A;  1FR3 A;  2K28 A;  2HCI A;  3NUC A;  2NB0 A;  2WAQ B;  3AB9 A;  1S5F D;  2RDG A;  2IWH A;  3E0J A;  2R61 A;  3NSW A;  1IW7 C;  1CQV A;  1UAP A;  2VNU D;  4KN4 C;  4TKO B;  2F0U A;  3ND8 A;  3SHL A;  3CQZ B;  1F77 A;  4KMU C;  1D2B A;  2D62 A;  2N88 A;  1AP0 A;  2KOL A;  4I65 A;  2EY2 A;  1NR2 A;  4V0B A;  5EPJ A;  3S2H B;  3FPP A;  3NK9 A;  3DXJ C;  1KNA A;  3NBH A;  2JXM B;  4PNY A;  3BDC A;  2O5I C;  1HTL D;  1NAP A;  1D5M C;  1TS3 A;  1SYD A;  5IGB A;  2PCF B;  3WOE A;  5CV5 A;  2H1E A;  5FLX L;  4EQN A;  1CHQ D;  3KLS X;  1Z7T A;  4IZ8 A;  3HOU B;  1B1Z A;  3RZO B;  3GTP B;  4NW2 A;  1EY7 A;  4KK7 A;  4FF3 A;  2PPB C;  1E0B A;  3LWU A;  1EWH A;  5ELD A;  4R8N A;  4QB4 A;  3MXN A;  2G9D A;  2EE1 A;  1NSN S;  2B2W A;  3S9W A;  1RHP A;  4B9W A;  4H0L C;  1DCZ A;  3BZD B;  3SVM A;  1V1P A;  1LTG D;  2KEC A;  1ZKO A;  1WTR A;  4A3I B;  4PMB A;  3O13 A;  2JA6 B;  4F7X A;  2C5C A;  1PTO B;  3MTS A;  5CV8 A;  3SDZ A;  3I4M B;  4C1N K;  3T53 B;  3Q6S A;  4RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...