1ZEQX

1.5 a structure of apo-cusf residues 6-88 from escherichia coli
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
METMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Copper-Binding Fold for the Periplasmic Copper Resistance Protein CusF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Cation efflux system protein cusF
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zeqX01
2VB3X 2L55A 3TDQA 3E6ZX 2VB2X 1ZEQX 2QCPX
chains in the Genus database with same CATH superfamily
4X3UA 1PFMA 1EYDA 2XRQD 4O0AA 2JA6G 1RHPA 2ES2A 1N33L 5KYLA 3AFPA 5H1SE 1RL2A 2CQOA 5M5WB 1X3EA 1KIXA 2NN6G 1QJOA 5K5PA 1TS2A 4JI5Q 1AZPA 2YV5A 1JWMD 1A3VA 4JOIA 1AP0A 1SR3A 3A7LA 1PH6A 1VF5C 2RBMA 3RD4A 1H9SB 3FHWA 4A3IH 3Q23A 2DUDA 3M85A 3FVQA 2R7ZB 4H7BA 1BOSA 4K2KA 3K5NA 2F0TA 1PV4A 5DEHA 5F2DA 4JCVE 3MFGA 3LNNA 2EXDA 4FDBA 4KN7C 3T1YL 2VZAA 2ZTEA 4KKTA 3CMEA 3VA5A 4C1NK 3J7A5 1EY9A 2NZ1D 4LF6Q 4XXEA 5JOBA 5JVG3 1PRTD 1GJXA 1WTRA 5C44B 1XNRL 4P71A 4LUZA 5CC4A 1VQGA 4HJAA 3NBHB 3W1GA 1LT3D 1N34L 4BY7G 1JC7A 4M8AA 5FLMG 1YHQA 5C4XH 2JA7B 4B3SL 4WJ4A 1I4PA 2K5NA 2NYZD 3JAML 1X3FA 3QIAA 3TP5A 4A3EG 5ISRA 2F0IA 3QG1A 4GLAC 3EVQA 2KECA 5M3MG 4GKKQ 5FK9C 2A6HD 3M4OH 1BKBA 5FOBB 1FNVA 3BU2A 3RLFA 2AQ3B 5IGCA 1PZID 5J39A 3S1RH 4OONA 2Z9HA 2HCIA 2CWAA 1VF7A 2OXPA 3HOVH 1HQMC 1IL8A 4DR4L 3MXPA 1HTPA 1RJTA 3D4DA 1UE5A 2V1CC 2Z6KC 1VQBA 1TU2B 3CCEA 3HOVG 5J3BA 3EJIA 1GUGA 2O4XA 3KF6B 3HP3A 1PH4A 3I4MG 3ULPA 3C46A 3D8GA 1I50H 4AYBB 4Y7NB 1BO0A 4V190 3D4WA 2RHQB 1SLJA 2K4KA 2OEOA 3BDLA 4A3LG 1ZKOA 1I4XA 3RNUA 1YEZA 2IL8A 1KAWA 1J5EQ 1PZJD 1A3TA 1E1OA 4H44C 1Y8PB 4JOIC 1TXYA 1SYGA 2L5TA 3KK7A 1ZYRD 4ILWA 3DEOA 5BN4A 5FLXc 3SK4A 3M4PA 1PTOC 3TRZA 5ELCA 2BE5C 1E2VA 4E6IA 3M9BA 1PLFA 3X3MA 1T9HA 5EGTA 1KAAA 2FJ2A 5NUCA 4WFN3 1KC8C 2BE5D 4LMQD 1YJWA 2YYZA 3RZDB 3K0XA 2PNHA 2A5HA 1EQVA 1SYFA 1SE3A 3CRKC 4DXGA 4HAEA 4LF9Q 3NPPA 3S17B 4JI7Q 1CZWA 2B29A 5DNFA 2FFKB 1FYCA 2MO0A 3R2TA 4X66Q 1B50A 3CCJA 2JXMB 1KRTA 1LT6D 2JSOA 3P75A 3T4AC 2MNAA 3AFQA 4PMCA 4JI1L 2L0CA 4FF4A 1V43A 2JJQA 4FF1A 1QWYA 2E2JH 2RSOA 4GN5A 1S5CD 2E2DC 5GAEC 3AEVA 1PFNA 3QOJA 1EQQA 4S3SA 2KCNA 3IAYA 3KF8A 3K7UC 1L1OA 1DOMA 1A2UA 3GTMB 1CKNA 3K5MA 1K8MA 2RKSA 3H09A 4XIGS 4P72A 2DN8A 3E0EA 3H3VH 3MA2B 2EZVA 2H4OA 1E1TA 1HFGA 3K59A 1G8ZD 1N33Q 4DF7A 2WB1G 4Q5VA 2FMMA 2B2YC 4MZ9A 1GOZA 1U9RA 3TEHB 2MUYA 4GN4B 1CHPD 5CV8A 5A2QE 3ICEA 2HCCA 4NXNL 2QEJC 1BR9A 3BDCA 1XJVA 1KLGD 2L12A 4RGMA 4X65L 2F0SA 5E4WC 3PO3G 3TBIB 4KD4A 2JA7G 4BY1H 5IE8A 1BXTA 1GHJA 5E7NA 4LF7L 2D62A 2NB0A 1PA6A 1GM5A 1EYGA 4LFBL 1D1KA 4ZYSA 1Y69U 4DK3C 3HOXH 1HQRD 4JBJA 1TIID 1SNQA 1EWCA 2R7DA 4OWWB 4FO2A 2NWGA 3T1YQ 3QWNA 1SYDA 1CFMA 4LF6L 3I4NB 2CVRA 3HOWG 1VQ6A 5TSSA 1Z7TA 3KBGA 4OXPA 2K5WA 1PXUA 1TS3A 5LL6X 1SAPA 4QB4A 3P1HA 3PQIA 3Q6SA 4RCOA 2R92B 2F0KA 1JMCA 5EKLA 1JOKA 2M9VA 2F3WA 1CKMA 1JQYD 3UDIA 2JQOA 4TSSA 4DUZL 1RF2D 1AN8A 3GO5A 2IX3A 3H15A 2ZJRA 3M4YA 1J8IA 1K3RA 2OF1A 2OTLA 1NTGA 1S4ZA 5BN3A 1B1ZA 1NAPA 4GOPC 1C4QA 2JA7H 5C4XB 1EIFA 1GKHA 1Y1WG 1QNKA 4A3JH 1VQ8A 1I94Q 3CQZH 4QQBX 2GA4B 3N6RA 1UWVA 2WAQB 2Z4HA 1J6QA 5LHY1 1NJIC 1WTHA 4CGYB 2NVQH 1QE6A 2LXJA 3K58A 2F4VQ 2NN6H 3L7ZC 3S24A 1V1OA 3I73A 3DWAA 3GTJH 3F8TA 1Q46A 4L5QA 2UUCQ 2KCTA 3S14B 1MBYA 1KD1C 3K7AB 1ASYA 4RGTA 5I6YA 1YITA 1LTBD 4DR7Q 3MAQA 4CBVA 4APVA 3Q24A 1WTVA 1HR0W 3L3OC 1RDPD 1SFOB 4Z9CB 4PZ8A 2F0PA 3F2DA 3JAMc 4QGUA 2Q8RE 3U50C 4C3JG 1KHIA 4R4OA 3WOFA 2UUAL 4PNYA 4JI3Q 4UP7A 3GTQB 5KNCA 3LWUA 1OO9B 2EJGC 2OCEA 3ND8A 1IW7D 1EZ8A 4JI8L 2PMZE 3PUYA 4A76A 2WV6D 3I55A 3AYHB 1MGSA 4A3EB 2QW7A 5C5LA 1EY4A 1DGSA 1EIYB 1IXRA 1K0RA 4JI7L 5M5YB 2GN5A 1C48A 2ZJQA 4DAPA 4A4IA 3K5LA 4N9PA 1EYAA 4DK0A 1WTPA 4AQYL 1FD7D 4A3FB 4AIMA 4DN4M 5CV5A 5EPJA 3CCSA 2JA6H 2XRSD 4H13C 1Y1VH 1BBUA 3GV6A 2NTSA 3JAMi 4A3DB 2B3GA 1CQFA 1EIGA 1EEFD 3GQBA 3SEBA 3GP7A 2F0DA 5JPNC 3J7YW 1A2TA 3GTPB 2NBFA 1E2WA 3MXNA 1QUQB 3GTPH 4A3BB 4MHEA 3OMCA 5M3FH 1AE3A 1DM0B 1QNUA 4G7OC 4G7ZC 1PH9A 3WWVA 4G4KA 1EWIA 1IBLQ 3A5UA 1A63A 1UE6A 5E3FA 3DHQA 5IYCG 4RHSA 2C5CA 1Q1EA 4RGOS 4HIDA 2KCMA 4FXGC 3KYHC 5KGUA 3QR8A 2MQHA 4JG2A 3HOZH 1VQ5A 2F52A 1ZYRC 1XPOA 4IUPA 3EFXD 1SJHD 2PZTA 3CF5A 1D8LA 4XT1B 2B2WA 1KNAA 1SEBD 4H02A 1TWGB 4X65Q 1HA6A 2JK8A 4AYBG 3C2PA 4GN3B 5HGQA 4LF7Q 3ERQA 4EQPA 5IODA 1OXVA 1VQPA 3VR5A 3GDEA 4LFBQ 4XYOA 5BN5A 3PUWA 1YNJC 4JC0A 1TS5A 5D3DA 4CKBA 3EBEA 1RCVD 4A3CG 3BYTB 4JBWA 5KNDA 2IW3A 4MIUA 1WTQA 2Q8TA 2EXZA 2H1EA 2N55A 5M3FG 2JE6I 5JEAJ 2EY6A 2SOBA 4K5VA 1SFOH 1HZAA 4NB3A 1Y1WB 1SMXA 4HEDA 4C3IB 4DPGA 4DV3L 1H9MA 5IP7H 3S1RB 4OELB 2F0UA 2E8GA 4ZQ3A 1STAA 2L55A 2VL6A 1JE5A 2FHTA 3SVMA 1VQAA 3BS1A 1MKHA 1SNMA 1PTOF 2D0PA 1XMQQ 1SXTA 3TZUA 2KA7A 4JI6L 5D14A 3S2HB 5IWAQ 4FXKC 4YWLA 1GD7A 1YI2A 3NQIA 5DM63 1U4MA 1F2ZA 3NHHA 3RZOB 4NDXA 4HIOA 1R4QB 1GHKA 3QB3A 4HJ5A 2PQAA 1HZBA 4B3TL 3S2DB 1XTDA 3CCLA 1F9PA 2MJ8A 5A35A 1STNA 1B4OA 1O7IA 1I94L 1O78A 1S72A 3MZ5A 5FO8B 5C4JB 3E0JA 2E2IB 3MWYW 3RZOH 1HNXQ 1ZXTA 4GLVB 2WB1E 2SNMA 1B9MA 2IX0A 2F4VL 1I6HH 1DD2A 2C35B 3HOXB 1IL2A 4C2MH 1LV9A 2SDFA 4XT3B 4DR7L 2H5XA 3URYA 1XXGA 4K14A 1EOTA 2MHVA 5C3XA 5ELEA 5FLXE 1V9PA 4A3GB 1NUCA 4BXXH 3M7GA 2LSSA 1Y8NB 2KJXA 4P73A 3S16H 2NVTB 2A1AA 2B63G 4JI3L 5A2QL 2AHOB 1KDCA 5J1ZA 1F9RA 5CV4A 2VQEQ 1BNZA 1PYWD 2WIIB 3VYUA 4QUFA 5I2YA 4X62Q 2UUBQ 3NE5B 4QJFA 4X66L 2JA5G 3HOWH 5I4DA 3F2CA 1JOQA 3V2TA 1LTTD 4A3EH 1XPUA 2AWOA 1EQTA 2F0NA 2NVYH 1D7QA 1DONA 2Q2UA 5BR8Q 1FVIA 1Y8OB 5C3WA 2E5LL 4HMIA 3PO2G 3H3VC 3A54A 3HZXA 4J15A 1I3QH 2BDNA 2HIXA 1HRJA 2FXQA 1L2FA 1W6JA 4AQYQ 1TY2A 4IOAA 3SK5A 2BOSA 1HNWL 2XIWA 5C0XI 4HJ7A 3EA6A 1O80A 1U5KA 5JVH3 1L0YB 3NBHA 4NKLA 2EDGA 5C6AA 2RVLA 3U4VA 4IFDJ 3ONAB 2DNEA 4HSVA 4YIJA 3CP0A 4OO1H 4LF8Q 4OL7A 1IBLL 1JJ2A 1CI3M 3MVVA 4TQUS 5C4XG 2NVYB 1DOKA 2JA9A 3TP6A 3K0YA 1BCPB 1ICWA 4G7HC 4WJ3M 3D4RA 3PF4A 2F4IA 2B2YA 2Z8LA 2ZTDA 4MN3A 3G4SA 4IPDA 4OIKA 3VYTA 1D1IA 3KLWA 5M3FB 3J80i 3T16A 3PIPA 4FVMA 1DOLA 1EU3A 2V4DA 3TS0A 1TWGH 3EN2A 1Q82C 1JJCB 2RDFA 5C3EH 1X3PA 2AMCB 4RG1A 2J7ZA 1IKMA 1YHBA 4HCEA 5EJWA 3NTIA 3I70A 2WP8J 3VR4A 5LMNW 2K03A 4ZKCB 1W6KA 5G3LD 2PMZB 3LGJA 2RDGA 4IJLA 1FNWA 3STBC 2AQ2B 2O5IC 3MTSA 4JK1C 1H9RA 1C8CA 1F9QA 1GUWA 3E9IA 4XDXA 1SE4A 4PQXA 3OHXC 4C3JB 2C9OA 4J6HA 1I6VC 5C0XJ 4DUZQ 1LTID 5KIXA 3T13A 3TDQA 4NPSA 5C0XH 1PH1A 1NR2A 4DV3Q 1BBXC 2A69D 1HTLD 1CHQD 1VDZA 2K5HA 3KLSA 5IP9G 2ID0A 1C7YA 2PQEA 1DZ1A 4IALA 4BBRB 2JA5H 4JI6Q 2ZJPA 4O2DA 1Z47A 5IWAL 1VQKA 4HJ8A 3T51B 4R4TA 1STHA 2BCOA 5EPKA 1HFNA 2NVXB 4A3BG 1EFID 3B6YA 4L5TA 1WTOA 2XSCA 5M9OA 5IGFA 4A3KH 2I5MX 3FPPA 5GROA 1X6OA 3J81j 5FJ8G 3Q22A 2ZXRA 3JAME 1SNOA 1W3SA 2NVXH 2JEBI 1PRTC 4ZKBB 1I5FA 1HNXL 3PIP3 1XX8A 2KCCA 4R1JA 4ABNA 1IYVA 1JWUD 1LTSD 2XWJB 1I50B 1ILQA 2K04A 4BBSG 1I6HB 1VQEA 3AU7A 2NTTA 3LWEA 3OIQA 3PUVA 3L2PA 1JR0D 5IGDA 2E2JB 5E1FA 1LTGD 4JI8Q 2CFMA 4CJ2C 1YJNA 3PMFA 1B8AA 3J7ZC 3TS2A 2SEBD 3KUPA 2F0WA 2L11A 2QGQA 3FRPB 4NXMQ 1II3A 2N88A 3BYYB 2QA4A 3K7AH 2D9UA 4ZUJA 3EROA 4K6LA 1CZGA 5COYA 4FNFA 4DKAC 4X62L 2UUBL 1A6XA 1K73C 3OW2A 1X3GA 1F77A 3T1HQ 1HZCA 5LL6S 3KDFB 2NVQB 2CH4W 1EWHA 1R4PB 2Y0SG 4X3KA 1EL0A 4ZAIA 1K0SA 3BVZA 3BG3A 2A69C 5FJ8H 3HGBA 1EY7A 4JI2L 1YNNC 2EY2A 2UU9Q 2X6LA 1VQ4A 4JW0A 4RH6A 2R7FA 4DR6Q 3SK6A 1HNWQ 1K3BC 1ESRA 2KBNA 4YHHQ 5JEAH 5IYBH 2Y0SE 1IYUA 4UPAA 3GTKH 3MEHA 1SMYC 4LUVA 4C3HB 5M3MB 1RKNA 3R8BA 4LJZC 3X3NA 3HOXG 3S1MB 1M8AA 2KVMA 1IYJB 4B9WA 2E2HH 3GTMH 2AUKA 4LF8L 1LABA 2VUMG 1DYQA 4KJOA 1P8LA 4F88A 2KEEA 2L9HA 2PZWA 5K36G 4R8IA 3CC7A 5IT9E 2QDLA 4GNXC 4IUQA 1YZ6A 4L5RC 4IOCA 3KOJA 4TKOB 1A8VA 2R93G 5FO7B 2BA1A 3W2DA 2JA8B 4A3MG 4K2LA 3G6EA 4AH6A 3H91A 4DV5Q 5HURA 3EQLC 3I4OA 4B3RL 4DV1Q 1X32A 1XMQL 3S15H 2ZM6L 4LFAL 2XNAC 3P20A 3HOZG 4XQQA 4OGQC 3TSSA 1NMGA 4KY6A 2P5ZX 1TWCH 2B63B 4U68A 3E3XA 3VR6A 2B2TC 4NW2A 5EKKA 3CHBD 4IUTA 1FL0A 4B3TQ 1ESFA 5KYIA 1GUTA 1HZ9A 1S5ED 1VQDA 1X65A 1G2TA 2JA5B 5D65A 4IPCA 1VQHA 2B8GA 1O7LA 2EIFA 3ND9A 3CC2A 1A15A 5L37A 5KEEA 5EBDA 1YNJD 1STEA 1UE1A 1WJJA 1KNEA 1J9OA 1IKLA 4JBMA 5IYDG 3CXCA 4C2MB 3NK9A 2K5DA 4Y7NH 1F9SA 3OW7A 1L0WA 4BBRH 2A74C 2WAQG 1CM9A 5I2XA 1CUKA 5FKAC 1MI2A 1JICA 2VXWA 2EPBA 1V1PB 4N9TA 2KUMA 3RZDH 1K28A 4L8JA 2JEAI 1U4LA 2F0JA 4KY7A 1X54A 4L6TB 1EIHA 2WKCA 1YJ9A 1ONLA 1TY0A 2VQEL 4KK7A 3S9WA 3H0GG 4BY7B 3J81c 2ZT9C 3MXNB 3U58A 1PTOH 2F0GA 5C4ZA 1HUMA 4FP5D 1Q81C 3HOYB 1UUPA 4NXML 5GAHC 3PO2H 2RQXA 1HUNA 5LMNQ 4IUNA 3VR2A 3C1EA 4LW1A 3R93A 4ALPA 5CR3A 5BR8L 4DGZA 2CKZB 5CV9A 2IX1A 2E5LQ 4K8IA 3C1FA 1PTOB 3P7JA 2I5HA 4A3FH 1G6PA 1PYBA 3A0JA 5CV7A 4DR2Q 1N36L 4RA8A 1RIPA 4IJHA 3LX0A 3OTOQ 1NCVA 2GVAA 3I2ZA 3BVGA 4EQNA 1E24A 3EIVA 4GKJL 4PG3A 3S1MH 4DR5L 5GQOA 3PCOB 1KQSA 3A55A 2UU9L 1GO3E 2EE1A 1Y14B 4YY3Q 1BDOA 1HJPA 4A3DG 2B2UA 1WCMH 4DR6L 3CC4A 5FLMH 3NSWA 3KF8B 1X9NA 3S1QB 1L1OB 1QZGA 2R7ZH 1C9OA 3BJUA 1CQVA 1IW7C 3A74A 3DLLA 5C4HA 2J4XA 2LY7A 3HG9A 4BBSB 3RUZA 4DV2L 3S2HH 1WTWA 1SRUA 3GV3A 3U9SA 4A3CH 2B2WC 1ENFA 2YU9H 3L9AX 1SE2A 3NWSA 2K52A 3F2BA 1E7ZA 2RF4A 2R92G 4DAVA 2Z6KA 2HQLA 4C3IH 2F0MA 4A93H 3K57A 4JI0Q 2VQFL 2D5DA 4I7AA 3T56B 1WVLA 1AE2A 3SGIA 2ATWA 1LTAD 1R9TH 2D0OA 3MXGA 2YU9B 4POFA 3CD6A 3IKJA 3OOCA 2G9DA 3S1QH 1B70B 2RA4A 1Y1WH 5AJ3L 5IT9c 1XMOL 4A3KB 3KF6A 4O42A 1JE4A 1L1OC 1PFBA 1OXTA 2HHHQ 1TT2A 3MHBA 3I56A 5JJLA 2ZM6Q 2DNCA 4LFAQ 2K6AA 3I72A 3CCUA 2L15A 1KDBA 3M3YH 1LM0A 1HH2P 2VUMB 3D6WA 5C3EG 2DJGC 1MSHA 3S14H 2F0VA 1B2TA 4Q0FA 1MSGA 3QJYA 4RKBA 1RD9D 2FINB 4UP8A 4C3HG 3TN2A 3HOUH 1B53A 4C3JH 3ERSX 2Y0SB 2RDHA 3UI2A 5CBEE 5C44G 4DV4L 1M90C 2PCFB 4PMBA 4A3JG 3KLSX 1D5XC 4CDFC 4HR7B 1H9KA 2K05A 4XQNA 5C0XG 3D6CA 4FYDA 1S3OA 2F3VA 3CPWA 1VQ7A 1QVFA 5CGKA 2EQSA 3RLNA 3KBXA 3VYSA 2CH4A 3WDNA 2JYOA 4IUUA 2JA8H 1D5ZC 2NUCA 4K0KQ 3A7AB 1CA5A 3A8IE 1BF4A 3VR3A 1TWAB 2EYLA 2OQKA 2F1MA 3DM3A 1IHZA 2VY3A 1UE7A 2SNSA 4DU9A 4DA2A 4XYQA 2FMCA 1BQQT 4KKSA 5M5WH 3T1HL 4A3GG 4OHJA 4IURA 3S1NB 1V8QA 3HEJA 1HNZQ 3J81L 1KABA 1BCPC 3DM1A 4ZK9B 4A3IB 1TWAH 4OWXB 2K14A 4C3HH 1QG7A 2F03A 1JB7A 4IO9A 4OO1I 2IWHA 5JJZA 1NBWA 4RFBA 2K75A 3NENA 1MD2D 2IPKD 4JI2Q 3GTLH 5IGBA 4FF3A 4DK6C 4I7ZC 4UY8C 3MXUA 4JPBW 2R93B 5ELDA 1VS0A 3HFZB 4DR2L 1N36Q 2LXKA 4YHHL 5HGTA 5E4XA 3CPFA 1Q12A 1F2YA 1E22A 4LWCA 4QCLA 4ME5A 4PV1C 3C3LA 1TWFB 3FEWX 4GKJQ 4DXFA 2JP1A 1XTCD 4B3ML 4LF5Q 3I7FA 3J7AV 2F0QA 4OX9L 2ZTCA 1DJRD 4YY3L 1K8GA 1SYEA 2O2LD 2WFWA 4OEMB 3TZDA 3UE0A 3MC0B 1Q7YC 1Y1VB 3GD7A 3QOLA 4FXDA 1MJCA 4LFCQ 4JI4Q 3L0OA 5DM73 4GNXA 2N8NA 3NBIA 2CW0D 4K5WA 1L0XB 3HOYG 1XPRA 1WOCA 5IOCA 4HIMA 2LKVA 4L63B 4LF4Q 2ALYB 3FKIH 1N9WA 1PH5A 4DAYA 4DV2Q 2A6EC 3FKIB 1IBKQ 1WCMB 2YTYA 1YBYA 2XTIA 3HKZG 4F7XA 5IYBG 4C3IG 4HSPA 1O7YA 1Q3LA 3H0GB 2E2IH 2KHIA 1K83B 3DWQA 4KHPL 2DJFC 5CMDA 1ZEQX 4A3LH 4P75A 2RHSB 4ODGA 4DV7Q 4JI0L 2AKWB 4DV5L 1VQJA 4B3RQ 1EEID 1PYSB 4QIWE 3ULLA 4DV0L 3S2DH 3FMCA 4DV1L 2IY5B 2BA0A 3D31A 4HTHA 1ET9A 1SSOA 4UP9A 3DEPA 2VB2X 4PZ6A 1QOHA 4AYBE 2PYKA 3K5OA 3GTKB 4DK1A 4O1NA 2HQEA 4ZRZA 4F8MA 2HT1A 3M4QA 1XMOQ 3CKIB 1X3QA 3IL8A 1ILPA 2Q2HA 1EFWA 3S16B 4I65A 3CAMA 3I4MB 4KLKA 1ASZA 2HHHL 3NEMA 3DUZA 1IBMQ 2K7VA 4A3JB 2E74C 3PGZA 3VDYA 1EYCA 3J80E 4DR3L 1OXUA 4C56C 3PSIA 1N8RC 1FJGQ 1SNDA 4DNTB 3GTGH 3G48A 2ENBA 1UEAB 2OWOA 2PI2A 4DFAA 3TQYA 1S5DD 1GUOA 1HXYD 2KHSA 3OIPA 2R3ZA 4IFDI 2EJMA 1PDQA 4KTAA 1SJED 4X6AH 3MEFA 2KQ3A 2I5LX 5JAVA 1HPCA 4EQ5A 1H95A 1SROA 1BCPF 1JWSD 3MFYA 3SK8A 1I4HA 3GTOB 1PH7A 3KFUA 4A3KG 1WD0A 2Z0SA 4JV5Q 1S40A 2EYOA 4G57A 4HJ9A 3S1NH 3U4ZA 2K33A 1SE8A 2BDOA 3UE1A 1LYLA 3RR5A 2Z4IA 1PRTF 1O7ZA 4KKUA 1E3PA 4K5XA 4KMUC 3PO2B 5LMNL 2E75C 1ICFB 5HY6A 4X3TA 1SBBB 4KY5A 3I90A 2YTVA 1CSPA 4J1MA 2EOTA 4LAAA 4R9WA 3HOUG 4MNOA 4ME3A 2MO1A 4IPHA 3OSOA 1VCIA 1XNQL 1HNZL 3OTOL 1UNSA 2CHBD 2WKDA 1HHVA 4GZYC 1B3AA 3A8JE 1B7YB 1N32Q 1EUJA 3I4LA 2Q2IA 1F2MA 4DV6L 4GNXB 4BY7H 3O13A 4DR5Q 5J22A 3G71A 2B8FA 3NXWA 2PPBC 3H94A 3UDGA 2K50A 3G7LA 2EY5A 3BZKA 3SDZA 1QILA 4ULLA 3VA7A 2R61A 3FPUB 5GAGC 1JJGA 2G5DA 2MP1A 2QDBA 4RKLA 1EY8A 5JPMC 2K5VA 2HDMA 3NTKA 1D5MC 3PO3B 4LK1C 3AMUA 4RHRA 4BA1I 2N3SA 4TVAB 3DMUA 4QUCA 3DWPA 4KJNA 3PF5A 4PZ7A 1B3QA 3HS0C 1KTKA 5C3EB 4CDDC 3BZDB 4IZ8A 4LFCL 2WB1B 4MTKA 1PMRA 4HN7A 1TWFH 3IRBA 3KJOA 2F0LA 3ZYYX 2VQFQ 1VQIA 1TWHH 4BXXG 3H3VI 1IBKL 4V0BA 3ITPA 1Z9FA 1F2LA 3SR1A 1PH8A 1VQNA 1PVOA 5AJ3Q 4KHPQ 1XWEA 1MIUA 2CWPA 2EYMA 5JJIA 4P74A 4M1UB 2RSNA 3PV0A 5IIFA 3GTQH 1X55A 1FGUA 4LNQA 2EYPA 1NSNS 1OXSC 3TREA 5IGGA 5IYDH 4IQZA 3VYRA 2Z6BA 2A8VA 4IN3A 2A6HC 1IZ6A 1ENAA 2F0HA 2EY1A 4A93G 1SYBA 3IFDA 3JC66 2R92H 2KOLA 5JJKA 4YWKA 3GTOH 1IBML 1SNPA 1TKWB 3K81C 4QMGA 1B9NA 1A0IA 2NZHA 3NP8A 2PW5A 3QO2A 4DV4Q 1SN8A 2Q8IB 2DGYA 4JVZA 3IFTA 1PH3A 2D2CC 1QZHA 1SDFA 4OIJA 1W2BA 1D2BA 4K6DA 1Q1BA 4TRDA 1T5EA 4BS9A 3HKZE 4A3BH 5LMUQ 1PFSA 3NUCA 4C1NI 1STYA 1NMFA 4RGNA 4IFDG 4P2CB 3CCVA 4DR1Q 1PHJA 5M5XH 5CYUA 1LT4D 4CDEC 3FKIG 4K0KL 1U0LA 5T1IA 1Q90A 1G51A 4YWMA 4RAUC 2PZUA 4JV5L 3DXJC 5C4JH 5KNBA 2HDLA 1QVGA 4HMJA 4JBKA 1V1PA 5IP9H 4B9XA 4HCSA 2TSSA 2IJ0A 4WORA 4BY1G 4ZLTF 4KHZA 4UDUC 4KI0A 1LTRD 1QCBD 2VNUD 2AUJD 1MHWC 1EY0A 1GVPA 1H9JA 3J80L 4WJWA 2I0QA 1WCMG 2IHFA 2AWNA 1WFQA 4RMFA 4K8JA 2Q2TA 1VQMA 2QEXA 1FGBD 1GUSA 1U4RA 1CSQA 4KV6A 1WYDA 4JI5L 3K8AA 4PMWA 1XNQQ 2UXBL 5CV6A 1KXLA 5AFWA 2OQ0A 4XTCS 3BZCA 1PZKD 4FF2A 1N32L 3OWEB 4X64Q 1JCKB 3PIO3 4DUYQ 2PO4A 4JYAQ 2EYJA 4B3MQ 4LF5L 4A3FG 3I8ZA 2E76C 3ER0A 4OX9Q 1R9TB 1KRSA 3V05A 2J0TD 1CKNB 1XYIA 2B39A 4J8QA 4NMZA 4F87A 3PIOA 1TWCB 2KHJA 3HRZC 1KDAA 1YIJA 4JI4L 1ML0D 1PTOD 4NP5A 1N34Q 2EVBA 1WI5A 2LS01 1SNCA 3PO3H 4LF4L 1B44D 1HR0L 4CHTB 3I3CA 4IPGA 1YNND 4N8X1 4RCNA 1VQLA 2JA8G 4XQJA 3CU7A 4KD3A 3SE0A 1LTLA 4GKKL 3H0GH 1Q86C 3TP7A 2MGSA 1Z6HA 3E9HA 2VUMH 2DY7A 3K80C 1FR3A 2F3IA 1G6ZA 1NY4A 5C5MA 4DV7L 3HOZB 4EQOA 4DV0Q 2R7ZG 2PW7A 4EVOA 1LO5D 3S17H 4KHVA 3OWFA 3KLRA 2OT2A 2EYHA 5ELOA 1NR4A 4CKEA 4DR4Q 1NNXA 3J7AF 1M4VA 4QIWB 3NTHA 1NE3A 3R2IA 3M4OB 4RWSC 2ZXOA 3NWTA 2QKIC 1SYCA 3J80c 2M2LA 4BWGB 2A73B 2F0OA 4MTNA 4DNIA 4OO1G 3GTGB 5JEAG 2MPMA 3D0FA 3UDFA 5IYCH 1J5EL 2K5QA 3A8KE 3CCQA 4DR3Q 4R4QA 5ELFA 1FJGL 1QVCA 1TS4A 2JA6B 1TVXA 3F2UA 1M1KC 2ICIA 2NVTH 2L1BA 3FP9A 3WOEA 3A5ZB 3M7NA 3HOUB 2UXCQ 1UAPA 3CQZB 4GOPB 4IUVA 2JN4A 2PI2E 2NN6I 4UHVA 5IY0A 2ZXPA 3SHLA 4CDCC 3N52A 1JT8A 1VQFA 3NQTA 4WRDA 2K28A 2BH8A 4H0LC 4YCUA 3M3YB 3A56A 2VW9A 1JORA 1YHAA 2XWBB 2PNRC 2HD3A 4POGA 3CW2C 3J81i 3NELA 1D6EC 3HOVB 5DAUA 1AW7A 2AQ1B 4IFDH 1SMYD 1GXDC 4GS3A 1V1QA 4YCWA 2IHEA 1UEBA 4EGVA 2QCPX 2GVBA 1I3QB 5LMUL 3RMHA 4QL5A 1A62A 5EKIA 1AH9A 3J81E 4Y52H 4DR1L 1DCZA 2E2HB 1EY6A 1AZQA 2R6GA 2UXDQ 4JI1Q 1GUNA 1TQOA 4ZUIA 2ASBA 4BBRG 3BDOA 5IT9L 1BVSA 4EX5A 2KEDA 5EAYA 5CBAE 3I4MH 3V96A 3OPOA 4A3MB 5CORA 1BBWA 1X56A 5D3IB 3R3OA 1TWHB 3RN5A 3F1ZA 1JB3A 5M5XB 2N78A 1WTXA 5M3MH 1LACA 1OTCA 1I4RA 2CW0C 5M5YH 1EZ6A 5EQ0A 3GTLB 4DV6Q 3STBD 1QUQA 5KRUA 4A93B 2CCZA 1TR5A 3CMAA 2F0EA 2YTXA 3OMGA 1K8OA 4ZCKA 1Q8KA 1LLRD 1KLUD 2LFNA 1OXXK 4QF4A 1KL9A 3CCMA 4DAMA 2EYFA 3CCRA 2UXBQ 4NXNQ 2A6ED 3AB9A 1VQOA 2L4NA 3HOYH 5GADC 5K36H 2B2VC 2I07B 2EJFC 3TMEA 2A19A 3E5SA 1XNRQ 5FLXL 2A68D 4X64L 2B2UC 4UAIA 5C44H 4R8NA 2K32A 5IGEA 3CRLC 4DUYL 4JYAL 4A3MH 4B3SQ 2KENA 2X6GA 2R93H 2A68C 2I46A 1VQ9A 4DAYB 3W1BA 5ELNA 2MFIA 2XGTA 1H9SA 1HA5A 1CTMA 1EY5A 5T1GA 2XN9C 3I4NH 3BVMA 2IT1A 3I91A 1K83H 2QF7A 1CT1D 4BY1B 1CKOA 2PQAB 1JOOA 4X3SA 2K01A 2NZOA 5I6WA 3PUXA 1RODA 4QY7A 3GTJB 1DXMA 4CJ1B 2VB3X 1PRTB 1S5BD 2F0FA 1I4QA 5I9OA 1Y1VG 1BCPD 1HR0Q 1HCZA 1AFPA 1STBA 1G291 2RCFA 4U673 4KN4C 2N49A 3T53B 4A3GH 5I9PA 1QB5D 2QILA 4R4IA 4HIKA 4BBSH 3HKZB 1EQRA 2WAQE 2O5JC 1LUZA 1C0AA 3Q8DA 4GLXA 3S15B 3D3RA 4BA2I 1P16A 1RTNA 3FDTA 3W3AA 1BUVT 2B63H 1E2ZA 3AQQA 4L5SA 5ELBA 3RN2A 2OTJA 1G91A 3I4NG 2X69A 2UUCL 1I4GA 4LUOA 3H6MA 1U4PA 2DY8A 3U9OA 3Q0AA 4CKCA 1ET6A 1T5XD 5G3LF 1LT5D 1EU4A 2XVSA 3ZJYC 1E0BA 1AEXA 1FNUA 4N8FA 1EOVA 4B08A 4CJ0B 2HUGA 2B2TA 2B2VA 2G9HD 1CA6A 3K6OA 1PH2A 5EPLA 1ENCA 2UUAQ 1MJEA 4YCVA 1YVCA 1CK1A 4A75A 4A3IG 1STGA 4LF9L 2UXCL 3HKSA 2WINB 3KDFA 4OWTB 4GOPA 1YNXA 2CQAA 1A3UA 3OYYA 5IP7G 5EBCA 2ICEC 1S5FD 4DNRB 3RLOA 3E6ZX 1VMPA 1VMCA 2LMCB 2Z1CA 2TMPA 1WD1A 3W5OA 1VQCA 3SXHA 1K8AC 2RCNA 1Q8IA 2K1BA 2VS1A 4ID6A 1K9MC 2WACA 3G6JB 5FO9B 1G2SA 3ULJA 2M00A 5DLQE 3HOWB 2BH2A 3UDXA 3TP8A 3KJPA 2UXDL 4A3DH 3PUZA 2HIVA 1RTOA 4R4CA
chains in the Genus database with same CATH topology
4X3UA 1PFMA 1EYDA 2XRQD 1RHPA 5KYLA 5M5WB 2NN6G 1QJOA 5K5PA 1TS2A 1AZPA 1JWMD 1A3VA 1AP0A 3A7LA 1VF5C 2RBMA 3RD4A 1H9SB 3Q23A 3M85A 3FVQA 2R7ZB 4H7BA 1BOSA 4K2KA 3K5NA 2F0TA 5DEHA 5F2DA 3MFGA 3LNNA 4KN7C 4KKTA 3VA5A 4C1NK 1EY9A 2NZ1D 4XXEA 5JOBA 5JVG3 1PRTD 1GJXA 1WTRA 5C44B 5CC4A 1LT3D 1JC7A 4M8AA 2JA7B 1I4PA 2NYZD 3JAML 3QIAA 3TP5A 5ISRA 2F0IA 3QG1A 3EVQA 2KECA 5FK9C 2A6HD 5FOBB 1FNVA 3RLFA 2AQ3B 5IGCA 1PZID 5J39A 2HCIA 1VF7A 2OXPA 1HQMC 1IL8A 3MXPA 1HTPA 1RJTA 3D4DA 1TU2B 3EJIA 1GUGA 2O4XA 3HP3A 3C46A 3D8GA 4AYBB 4Y7NB 1BO0A 4V190 3D4WA 2OEOA 3BDLA 1ZKOA 1I4XA 2IL8A 1PZJD 1A3TA 4H44C 1Y8PB 1SYGA 2L5TA 3KK7A 1ZYRD 4ILWA 3DEOA 5BN4A 3SK4A 1PTOC 5ELCA 2BE5C 1E2VA 4E6IA 1PLFA 3X3MA 5EGTA 1KAAA 2FJ2A 4WFN3 5NUCA 2BE5D 4LMQD 2YYZA 3RZDB 2A5HA 1EQVA 1SYFA 1SE3A 3CRKC 4DXGA 4HAEA 3NPPA 3S17B 1CZWA 5DNFA 2FFKB 1FYCA 3R2TA 1B50A 2JXMB 1LT6D 2JSOA 3P75A 3T4AC 4PMCA 2L0CA 4FF4A 1V43A 4FF1A 1QWYA 2RSOA 1S5CD 2E2DC 1PFNA 3QOJA 4S3SA 2KCNA 3IAYA 3KF8A 1DOMA 1A2UA 3GTMB 3K5MA 1K8MA 2RKSA 3H09A 4XIGS 2DN8A 3MA2B 2EZVA 2H4OA 1HFGA 3K59A 1G8ZD 4DF7A 4Q5VA 2FMMA 2B2YC 1GOZA 1U9RA 2MUYA 5A2QE 1CHPD 5CV8A 2HCCA 2QEJC 1BR9A 3BDCA 1KLGD 2L12A 4RGMA 2F0SA 5E4WC 3TBIB 4KD4A 1BXTA 1GHJA 2D62A 2NB0A 1D1KA 4ZYSA 1Y69U 1HQRD 1TIID 1SNQA 1EWCA 2NWGA 4FO2A 3QWNA 1SYDA 1CFMA 3I4NB 2CVRA 5TSSA 1Z7TA 3KBGA 2K5WA 5LL6X 1PXUA 1TS3A 1SAPA 4QB4A 3P1HA 3Q6SA 4RCOA 2R92B 2F0KA 5EKLA 1JOKA 2M9VA 2F3WA 1JQYD 4TSSA 1RF2D 1AN8A 3GO5A 2IX3A 3M4YA 1J8IA 2OF1A 1S4ZA 5BN3A 1B1ZA 1NAPA 5C4XB 1C4QA 1QNKA 2GA4B 3N6RA 2WAQB 2Z4HA 5LHY1 4CGYB 1QE6A 3K58A 2NN6H 3L7ZC 1V1OA 3I73A 3DWAA 3S14B 1MBYA 3K7AB 4RGTA 5I6YA 1LTBD 3MAQA 4CBVA 3Q24A 1WTVA 3L3OC 1RDPD 1SFOB 4Z9CB 2F0PA 2Q8RE 4C3JG 3WOFA 4PNYA 3GTQB 5KNCA 3LWUA 1OO9B 2EJGC 3ND8A 1IW7D 1EZ8A 3PUYA 2WV6D 1MGSA 4A3EB 5C5LA 1EY4A 5M5YB 1C48A 4DAPA 3K5LA 4N9PA 1EYAA 4DK0A 1WTPA 1FD7D 4A3FB 4DN4M 5CV5A 5EPJA 2XRSD 4H13C 3GV6A 2NTSA 4A3DB 1CQFA 1EIGA 1EEFD 3GQBA 3SEBA 3GP7A 2F0DA 5JPNC 3J7YW 1A2TA 3GTPB 2NBFA 1E2WA 3MXNA 4A3BB 4MHEA 3OMCA 1DM0B 1QNUA 4G7OC 4G7ZC 4G4KA 5E3FA 3DHQA 4RHSA 2C5CA 1Q1EA 4RGOS 4FXGC 5KGUA 1ZYRC 4IUPA 3EFXD 1SJHD 2PZTA 4XT1B 2B2WA 1KNAA 1SEBD 1TWGB 1HA6A 3C2PA 3ERQA 4EQPA 5IODA 1OXVA 3VR5A 4XYOA 5BN5A 3PUWA 1YNJC 5D3DA 1TS5A 4CKBA 1RCVD 3BYTB 4JBWA 5KNDA 2IW3A 4MIUA 1WTQA 2Q8TA 2EXZA 2H1EA 2N55A 5JEAJ 2JE6I 2EY6A 2SOBA 4K5VA 1Y1WB 4HEDA 4C3IB 1H9MA 3S1RB 2F0UA 4ZQ3A 1STAA 2L55A 3SVMA 2FHTA 3BS1A 1SNMA 1PTOF 1SXTA 3TZUA 2KA7A 5D14A 3S2HB 4FXKC 5DM63 3NQIA 1U4MA 1F2ZA 3NHHA 3RZOB 4NDXA 1R4QB 1GHKA 3QB3A 3S2DB 1F9PA 2MJ8A 5A35A 1STNA 1B4OA 1O78A 3MZ5A 5FO8B 5C4JB 3E0JA 2E2IB 3MWYW 1ZXTA 2SNMA 1B9MA 2IX0A 1DD2A 3HOXB 1LV9A 2SDFA 4XT3B 3URYA 1XXGA 4K14A 1EOTA 2MHVA 5C3XA 5ELEA 5FLXE 4A3GB 1NUCA 3M7GA 1Y8NB 2KJXA 2NVTB 5A2QL 1KDCA 5J1ZA 1F9RA 5CV4A 1BNZA 1PYWD 2WIIB 3VYUA 4QUFA 5I2YA 3NE5B 5I4DA 1JOQA 3V2TA 1LTTD 2AWOA 1EQTA 2F0NA 1DONA 1Y8OB 5C3WA 4HMIA 3H3VC 3A54A 3HZXA 2BDNA 1HRJA 1W6JA 1TY2A 3SK5A 2BOSA 2XIWA 5C0XI 3EA6A 1O80A 1L0YB 3NBHA 4NKLA 2EDGA 5C6AA 2RVLA 4IFDJ 3ONAB 2DNEA 4HSVA 4YIJA 4OO1H 4OL7A 1CI3M 3MVVA 4TQUS 2NVYB 1DOKA 3TP6A 3K0YA 1BCPB 1ICWA 4G7HC 3D4RA 2F4IA 2B2YA 2Z8LA 4MN3A 4OIKA 3VYTA 1D1IA 5M3FB 3T16A 4FVMA 1DOLA 1EU3A 2V4DA 2RDFA 1X3PA 2J7ZA 1IKMA 4HCEA 5EJWA 3NTIA 3I70A 2WP8J 3VR4A 2K03A 4ZKCB 1W6KA 5G3LD 2PMZB 2RDGA 1FNWA 2AQ2B 2O5IC 3MTSA 4JK1C 1H9RA 1C8CA 1F9QA 1GUWA 4XDXA 1SE4A 4PQXA 3OHXC 4C3JB 2C9OA 4J6HA 1I6VC 5C0XJ 1LTID 5KIXA 3T13A 3TDQA 5C0XH 1NR2A 1BBXC 2A69D 1HTLD 1CHQD 1VDZA 3KLSA 2ID0A 2PQEA 1DZ1A 4IALA 4BBRB 1Z47A 3T51B 1STHA 2BCOA 5EPKA 1HFNA 2NVXB 1EFID 1WTOA 2XSCA 5M9OA 5IGFA 3FPPA 3Q22A 2ZXRA 3JAME 1SNOA 2JEBI 1PRTC 4ZKBB 3PIP3 1XX8A 2KCCA 4ABNA 1IYVA 1JWUD 1LTSD 2XWJB 1I50B 1ILQA 2K04A 1I6HB 3AU7A 2NTTA 3LWEA 3OIQA 3PUVA 1JR0D 5IGDA 2E2JB 5E1FA 1LTGD 4CJ2C 3PMFA 2F0WA 3KUPA 2SEBD 2L11A 3FRPB 1II3A 2N88A 3BYYB 4ZUJA 2D9UA 3EROA 4K6LA 1CZGA 5COYA 4FNFA 1A6XA 1F77A 5LL6S 2NVQB 1EWHA 1R4PB 4X3KA 1EL0A 4ZAIA 3BVZA 3BG3A 2A69C 3HGBA 1EY7A 1YNNC 2EY2A 2X6LA 4RH6A 3SK6A 1ESRA 5JEAH 1IYUA 3MEHA 1SMYC 4C3HB 5M3MB 1RKNA 3R8BA 4LJZC 3X3NA 3S1MB 1M8AA 2KVMA 4B9WA 2AUKA 1LABA 1DYQA 4KJOA 4F88A 2KEEA 2L9HA 2PZWA 5K36G 4R8IA 5IT9E 4IUQA 4TKOB 5FO7B 2BA1A 3W2DA 2JA8B 4K2LA 3H91A 5HURA 3EQLC 1X32A 2XNAC 3P20A 4XQQA 4OGQC 3TSSA 4KY6A 2B63B 4U68A 3VR6A 2B2TC 4NW2A 5EKKA 3CHBD 4IUTA 1ESFA 5KYIA 1GUTA 1S5ED 1G2TA 2JA5B 5D65A 2B8GA 1O7LA 3ND9A 1A15A 5KEEA 5EBDA 1YNJD 1STEA 1KNEA 1J9OA 1IKLA 4C2MB 3NK9A 2K5DA 1F9SA 3OW7A 2A74C 1CM9A 5I2XA 5FKAC 1MI2A 1JICA 2VXWA 2EPBA 1V1PB 4N9TA 2KUMA 4L8JA 2JEAI 1U4LA 2F0JA 4KY7A 4L6TB 1EIHA 2WKCA 1ONLA 1TY0A 4KK7A 3S9WA 4BY7B 2ZT9C 1PTOH 2F0GA 5C4ZA 1HUMA 4FP5D 3HOYB 1UUPA 2RQXA 1HUNA 4IUNA 3VR2A 3C1EA 3R93A 5CR3A 1RTOA 4DGZA 2IX1A 5CV9A 4K8IA 3C1FA 1PTOB 3P7JA 5CV7A 4RA8A 3LX0A 1NCVA 3BVGA 4EQNA 3A55A 2EE1A 1BDOA 2B2UA 3NSWA 3S1QB 1CQVA 1IW7C 5C4HA 2J4XA 2LY7A 3HG9A 4BBSB 3RUZA 1WTWA 3GV3A 3U9SA 2B2WC 1ENFA 3L9AX 1SE2A 3NWSA 4DAVA 2F0MA 3K57A 2D5DA 3T56B 1WVLA 1LTAD 3MXGA 2YU9B 3IKJA 3OOCA 2G9DA 2RA4A 4A3KB 4O42A 1JE4A 1PFBA 1OXTA 1TT2A 3MHBA 2DNCA 2K6AA 3I72A 1KDBA 2VUMB 3D6WA 1MSHA 2F0VA 1B2TA 4Q0FA 1MSGA 3QJYA 4RKBA 1RD9D 2FINB 4C3HG 3TN2A 1B53A 2Y0SB 2RDHA 3UI2A 5CBEE 2PCFB 4PMBA 3KLSX 1D5XC 4HR7B 1H9KA 2K05A 4XQNA 5C0XG 3D6CA 4FYDA 2F3VA 5CGKA 3KBXA 3VYSA 3WDNA 2JYOA 4IUUA 1D5ZC 2NUCA 3A7AB 1CA5A 3A8IE 1BF4A 3VR3A 1TWAB 2EYLA 2F1MA 1IHZA 2SNSA 4DU9A 4DA2A 4XYQA 2FMCA 1BQQT 4KKSA 4OHJA 4IURA 3S1NB 1V8QA 3HEJA 3J81L 1KABA 1BCPC 3DM1A 4ZK9B 4A3IB 1QG7A 2F03A 4OO1I 2IWHA 5JJZA 4RFBA 1MD2D 2IPKD 5IGBA 4FF3A 4I7ZC 3MXUA 2R93B 5ELDA 5HGTA 5E4XA 1Q12A 1F2YA 4QCLA 4ME5A 4PV1C 3C3LA 1TWFB 3FEWX 4DXFA 2JP1A 1XTCD 3J7AV 2F0QA 1DJRD 1SYEA 2O2LD 3TZDA 3MC0B 1Y1VB 3GD7A 3QOLA 4FXDA 5DM73 3NBIA 2CW0D 4K5WA 1L0XB 5IOCA 2LKVA 4L63B 4DAYA 2A6EC 3FKIB 1WCMB 4F7XA 4C3IG 4HSPA 1O7YA 1Q3LA 3H0GB 1K83B 3DWQA 5CMDA 1ZEQX 4ODGA 1EEID 3FMCA 2BA0A 3D31A 4HTHA 1ET9A 1SSOA 3DEPA 2VB2X 1QOHA 2PYKA 3K5OA 3GTKB 4DK1A 4O1NA 2HQEA 4ZRZA 4F8MA 3CKIB 1X3QA 3IL8A 1ILPA 3S16B 4I65A 3I4MB 3DUZA 2K7VA 4A3JB 2E74C 1EYCA 3J80E 1OXUA 4C56C 1SNDA 4DNTB 2ENBA 1UEAB 4DFAA 1S5DD 1GUOA 1HXYD 2KHSA 3OIPA 2R3ZA 4IFDI 2EJMA 1PDQA 4KTAA 1SJED 2KQ3A 5JAVA 1HPCA 1BCPF 1JWSD 3MFYA 3SK8A 1I4HA 3GTOB 1WD0A 2EYOA 4G57A 2K33A 2BDOA 2Z4IA 1PRTF 1O7ZA 4KKUA 4K5XA 4KMUC 3PO2B 2E75C 4X3TA 1SBBB 4KY5A 3I90A 4J1MA 2EOTA 4LAAA 4R9WA 3OSOA 1VCIA 1UNSA 2CHBD 2WKDA 1HHVA 4GZYC 1B3AA 3A8JE 3I4LA 1F2MA 3O13A 5J22A 2B8FA 3NXWA 2PPBC 3H94A 3G7LA 2EY5A 3SDZA 1QILA 4ULLA 3VA7A 2R61A 3FPUB 2MP1A 2QDBA 4RKLA 1EY8A 5JPMC 2HDMA 3NTKA 1D5MC 3PO3B 4LK1C 3AMUA 4RHRA 4BA1I 3DMUA 4QUCA 3DWPA 4KJNA 3HS0C 1KTKA 5C3EB 3BZDB 4IZ8A 2WB1B 1PMRA 4HN7A 3ZYYX 2F0LA 4V0BA 3ITPA 1F2LA 3SR1A 1XWEA 2EYMA 4M1UB 2RSNA 3PV0A 5IIFA 2EYPA 1NSNS 1OXSC 5IGGA 4IQZA 3VYRA 4IN3A 2A6HC 1ENAA 2F0HA 2EY1A 1SYBA 3IFDA 2KOLA 1SNPA 1TKWB 4QMGA 1B9NA 3NP8A 2PW5A 3QO2A 2Q8IB 3IFTA 2D2CC 1SDFA 4OIJA 1D2BA 4K6DA 1Q1BA 4TRDA 1T5EA 4BS9A 3NUCA 4C1NI 1STYA 4RGNA 4IFDG 4P2CB 5CYUA 1LT4D 5T1IA 1Q90A 4RAUC 2PZUA 3DXJC 5KNBA 2HDLA 4HMJA 1V1PA 4B9XA 4HCSA 2TSSA 2IJ0A 4WORA 4ZLTF 4KHZA 4UDUC 4KI0A 1LTRD 1QCBD 2VNUD 2AUJD 1EY0A 1H9JA 3J80L 4WJWA 2AWNA 4K8JA 1FGBD 1GUSA 1U4RA 4KV6A 4PMWA 5CV6A 5AFWA 4XTCS 1PZKD 4FF2A 3OWEB 1JCKB 3PIO3 2PO4A 2EYJA 3I8ZA 2E76C 1R9TB 3V05A 2J0TD 1XYIA 2B39A 4J8QA 4NMZA 4F87A 1TWCB 3HRZC 1KDAA 1ML0D 1PTOD 4NP5A 2EVBA 2LS01 1SNCA 1B44D 4CHTB 3I3CA 1YNND 4RCNA 4XQJA 3CU7A 4KD3A 3SE0A 3TP7A 2MGSA 1Z6HA 2DY7A 1FR3A 1G6ZA 5C5MA 3HOZB 4EQOA 2PW7A 4EVOA 1LO5D 4KHVA 3OWFA 3KLRA 2OT2A 2EYHA 1NR4A 4CKEA 3J7AF 1M4VA 4QIWB 3NTHA 3R2IA 3M4OB 4RWSC 2ZXOA 3NWTA 2QKIC 1SYCA 2M2LA 4BWGB 2A73B 2F0OA 4OO1G 3GTGB 5JEAG 2MPMA 2K5QA 3A8KE 5ELFA 2JA6B 1TS4A 1TVXA 3F2UA 2ICIA 3M7NA 2L1BA 3WOEA 3HOUB 1UAPA 3CQZB 4IUVA 2NN6I 2ZXPA 3SHLA 3N52A 3NQTA 4WRDA 2K28A 4H0LC 3M3YB 3A56A 1JORA 2XWBB 2PNRC 1D6EC 3HOVB 5DAUA 1AW7A 2AQ1B 4IFDH 1SMYD 1GXDC 4EGVA 2QCPX 1I3QB 3RMHA 5EKIA 3J81E 1DCZA 2E2HB 1EY6A 1AZQA 2R6GA 1GUNA 1TQOA 4ZUIA 3BDOA 5IT9L 2KEDA 5CBAE 3V96A 3OPOA 4A3MB 5CORA 5D3IB 3R3OA 1TWHB 1JB3A 5M5XB 1WTXA 1LACA 1I4RA 2CW0C 1EZ6A 5EQ0A 3GTLB 5KRUA 4A93B 1TR5A 2F0EA 1K8OA 3OMGA 4QF4A 1LLRD 1KLUD 2LFNA 1OXXK 2EYFA 2A6ED 3AB9A 2L4NA 5K36H 2B2VC 2I07B 2EJFC 3TMEA 3E5SA 5FLXL 2A68D 2B2UC 4UAIA 4R8NA 2K32A 5IGEA 3CRLC 2X6GA 2A68C 2I46A 1H9SA 1HA5A 1CTMA 1EY5A 5T1GA 2XN9C 3BVMA 2IT1A 3I91A 2QF7A 1CT1D 4BY1B 1JOOA 4X3SA 2K01A 5I6WA 3PUXA 1RODA 3GTJB 1DXMA 4CJ1B 2VB3X 1PRTB 1S5BD 2F0FA 1I4QA 5I9OA 1AFPA 1BCPD 1HCZA 1STBA 1G291 4U673 4KN4C 3T53B 5I9PA 1QB5D 2QILA 3HKZB 2O5JC 3S15B 3D3RA 4BA2I 1RTNA 3FDTA 3W3AA 1BUVT 1E2ZA 5ELBA 1G91A 2X69A 1I4GA 3H6MA 1U4PA 2DY8A 3Q0AA 3U9OA 4CKCA 1ET6A 1T5XD 5G3LF 1LT5D 1EU4A 2XVSA 1E0BA 1AEXA 1FNUA 4B08A 4CJ0B 2HUGA 2B2TA 2B2VA 2G9HD 1CA6A 3K6OA 5EPLA 1ENCA 1CK1A 1STGA 2WINB 2CQAA 1A3UA 5EBCA 2ICEC 1S5FD 4DNRB 3E6ZX 1VMPA 1VMCA 2LMCB 2Z1CA 2TMPA 1WD1A 3SXHA 1Q8IA 2K1BA 4ID6A 2WACA 3G6JB 5FO9B 1G2SA 3HOWB 2M00A 3TP8A 3PUZA 5JVH3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  2L55 A;  3TDQ A;  3E6Z X;  2VB2 X;  1ZEQ X;  2QCP X; 
#chains in the Genus database with same CATH topology
 4X3U A;  1PFM A;  1EYD A;  2XRQ D;  4O0A A;  2JA6 G;  1RHP A;  2ES2 A;  1N33 L;  5KYL A;  3AFP A;  5H1S E;  1RL2 A;  2CQO A;  5M5W B;  1X3E A;  1KIX A;  2NN6 G;  1QJO A;  5K5P A;  1TS2 A;  4JI5 Q;  1AZP A;  2YV5 A;  1JWM D;  1A3V A;  4JOI A;  1AP0 A;  1SR3 A;  3A7L A;  1PH6 A;  1VF5 C;  2RBM A;  3RD4 A;  1H9S B;  3FHW A;  4A3I H;  3Q23 A;  2DUD A;  3M85 A;  3FVQ A;  2R7Z B;  4H7B A;  1BOS A;  4K2K A;  3K5N A;  2F0T A;  1PV4 A;  5DEH A;  5F2D A;  4JCV E;  3MFG A;  3LNN A;  2EXD A;  4FDB A;  4KN7 C;  3T1Y L;  2VZA A;  2ZTE A;  4KKT A;  3CME A;  3VA5 A;  4C1N K;  3J7A 5;  1EY9 A;  2NZ1 D;  4LF6 Q;  4XXE A;  5JOB A;  5JVG 3;  1PRT D;  1GJX A;  1WTR A;  5C44 B;  1XNR L;  4P71 A;  4LUZ A;  5CC4 A;  1VQG A;  4HJA A;  3NBH B;  3W1G A;  1LT3 D;  1N34 L;  4BY7 G;  1JC7 A;  4M8A A;  5FLM G;  1YHQ A;  5C4X H;  2JA7 B;  4B3S L;  4WJ4 A;  1I4P A;  2K5N A;  2NYZ D;  3JAM L;  1X3F A;  3QIA A;  3TP5 A;  4A3E G;  5ISR A;  2F0I A;  3QG1 A;  4GLA C;  3EVQ A;  2KEC A;  5M3M G;  4GKK Q;  5FK9 C;  2A6H D;  3M4O H;  1BKB A;  5FOB B;  1FNV A;  3BU2 A;  3RLF A;  2AQ3 B;  5IGC A;  1PZI D;  5J39 A;  3S1R H;  4OON A;  2Z9H A;  2HCI A;  2CWA A;  1VF7 A;  2OXP A;  3HOV H;  1HQM C;  1IL8 A;  4DR4 L;  3MXP A;  1HTP A;  1RJT A;  3D4D A;  1UE5 A;  2V1C C;  2Z6K C;  1VQB A;  1TU2 B;  3CCE A;  3HOV G;  5J3B A;  3EJI A;  1GUG A;  2O4X A;  3KF6 B;  3HP3 A;  1PH4 A;  3I4M G;  3ULP A;  3C46 A;  3D8G A;  1I50 H;  4AYB B;  4Y7N B;  1BO0 A;  4V19 0;  3D4W A;  2RHQ B;  1SLJ A;  2K4K A;  2OEO A;  3BDL A;  4A3L G;  1ZKO A;  1I4X A;  3RNU A;  1YEZ A;  2IL8 A;  1KAW A;  1J5E Q;  1PZJ D;  1A3T A;  1E1O A;  4H44 C;  1Y8P B;  4JOI C;  1TXY A;  1SYG A;  2L5T A;  3KK7 A;  1ZYR D;  4ILW A;  3DEO A;  5BN4 A;  5FLX c;  3SK4 A;  3M4P A;  1PTO C;  3TRZ A;  5ELC A;  2BE5 C;  1E2V A;  4E6I A;  3M9B A;  1PLF A;  3X3M A;  1T9H A;  5EGT A;  1KAA A;  2FJ2 A;  5NUC A;  4WFN 3;  1KC8 C;  2BE5 D;  4LMQ D;  1YJW A;  2YYZ A;  3RZD B;  3K0X A;  2PNH A;  2A5H A;  1EQV A;  1SYF A;  1SE3 A;  3CRK C;  4DXG A;  4HAE A;  4LF9 Q;  3NPP A;  3S17 B;  4JI7 Q;  1CZW A;  2B29 A;  5DNF A;  2FFK B;  1FYC A;  2MO0 A;  3R2T A;  4X66 Q;  1B50 A;  3CCJ A;  2JXM B;  1KRT A;  1LT6 D;  2JSO A;  3P75 A;  3T4A C;  2MNA A;  3AFQ A;  4PMC A;  4JI1 L;  2L0C A;  4FF4 A;  1V43 A;  2JJQ A;  4FF1 A;  1QWY A;  2E2J H;  2RSO A;  4GN5 A;  1S5C D;  2E2D C;  5GAE C;  3AEV A;  1PFN A;  3QOJ A;  1EQQ A;  4S3S A;  2KCN A;  3IAY A;  3KF8 A;  3K7U C;  1L1O A;  1DOM A;  1A2U A;  3GTM B;  1CKN A;  3K5M A;  1K8M A;  2RKS A;  3H09 A;  4XIG S;  4P72 A;  2DN8 A;  3E0E A;  3H3V H;  3MA2 B;  2EZV A;  2H4O A;  1E1T A;  1HFG A;  3K59 A;  1G8Z D;  1N33 Q;  4DF7 A;  2WB1 G;  4Q5V A;  2FMM A;  2B2Y C;  4MZ9 A;  1GOZ A;  1U9R A;  3TEH B;  2MUY A;  4GN4 B;  1CHP D;  5CV8 A;  5A2Q E;  3ICE A;  2HCC A;  4NXN L;  2QEJ C;  1BR9 A;  3BDC A;  1XJV A;  1KLG D;  2L12 A;  4RGM A;  4X65 L;  2F0S A;  5E4W C;  3PO3 G;  3TBI B;  4KD4 A;  2JA7 G;  4BY1 H;  5IE8 A;  1BXT A;  1GHJ A;  5E7N A;  4LF7 L;  2D62 A;  2NB0 A;  1PA6 A;  1GM5 A;  1EYG A;  4LFB L;  1D1K A;  4ZYS A;  1Y69 U;  4DK3 C;  3HOX H;  1HQR D;  4JBJ A;  1TII D;  1SNQ A;  1EWC A;  2R7D A;  4OWW B;  4FO2 A;  2NWG A;  3T1Y Q;  3QWN A;  1SYD A;  1CFM A;  4LF6 L;  3I4N B;  2CVR A;  3HOW G;  1VQ6 A;  5TSS A;  1Z7T A;  3KBG A;  4OXP A;  2K5W A;  1PXU A;  1TS3 A;  5LL6 X;  1SAP A;  4QB4 A;  3P1H A;  3PQI A;  3Q6S A;  4RCO A;  2R92 B;  2F0K A;  1JMC A;  5EKL A;  1JOK A;  2M9V A;  2F3W A;  1CKM A;  1JQY D;  3UDI A;  2JQO A;  4TSS A;  4DUZ L;  1RF2 D;  1AN8 A;  3GO5 A;  2IX3 A;  3H15 A;  2ZJR A;  3M4Y A;  1J8I A;  1K3R A;  2OF1 A;  2OTL A;  1NTG A;  1S4Z A;  5BN3 A;  1B1Z A;  1NAP A;  4GOP C;  1C4Q A;  2JA7 H;  5C4X B;  1EIF A;  1GKH A;  1Y1W G;  1QNK A;  4A3J H;  1VQ8 A;  1I94 Q;  3CQZ H;  4QQB X;  2GA4 B;  3N6R A;  1UWV A;  2WAQ B;  2Z4H A;  1J6Q A;  5LHY 1;  1NJI C;  1WTH A;  4CGY B;  2NVQ H;  1QE6 A;  2LXJ A;  3K58 A;  2F4V Q;  2NN6 H;  3L7Z C;  3S24 A;  1V1O A;  3I73 A;  3DWA A;  3GTJ H;  3F8T A;  1Q46 A;  4L5Q A;  2UUC Q;  2KCT A;  3S14 B;  1MBY A;  1KD1 C;  3K7A B;  1ASY A;  4RGT A;  5I6Y A;  1YIT A;  1LTB D;  4DR7 Q;  3MAQ A;  4CBV A;  4APV A;  3Q24 A;  1WTV A;  1HR0 W;  3L3O C;  1RDP D;  1SFO B;  4Z9C B;  4PZ8 A;  2F0P A;  3F2D A;  3JAM c;  4QGU A;  2Q8R E;  3U50 C;  4C3J G;  1KHI A;  4R4O A;  3WOF A;  2UUA L;  4PNY A;  4JI3 Q;  4UP7 A;  3GTQ B;  5KNC A;  3LWU A;  1OO9 B;  2EJG C;  2OCE A;  3ND8 A;  1IW7 D;  1EZ8 A;  4JI8 L;  2PMZ E;  3PUY A;  4A76 A;  2WV6 D;  3I55 A;  3AYH B;  1MGS A;  4A3E B;  2QW7 A;  5C5L A;  1EY4 A;  1DGS A;  1EIY B;  1IXR A;  1K0R A;  4JI7 L;  5M5Y B;  2GN5 A;  1C48 A;  2ZJQ A;  4DAP A;  4A4I A;  3K5L A;  4N9P A;  1EYA A;  4DK0 A;  1WTP A;  4AQY L;  1FD7 D;  4A3F B;  4AIM A;  4DN4 M;  5CV5 A;  5EPJ A;  3CCS A;  2JA6 H;  2XRS D;  4H13 C;  1Y1V H;  1BBU A;  3GV6 A;  2NTS A;  3JAM i;  4A3D B;  2B3G A;  1CQF A;  1EIG A;  1EEF D;  3GQB A;  3SEB A;  3GP7 A;  2F0D A;  5JPN C;  3J7Y W;  1A2T A;  3GTP B;  2NBF A;  1E2W A;  3MXN A;  1QUQ B;  3GTP H;  4A3B B;  4MHE A;  3OMC A;  5M3F H;  1AE3 A;  1DM0 B;  1QNU A;  4G7O C;  4G7Z C;  1PH9 A;  3WWV A;  4G4K A;  1EWI A;  1IBL Q;  3A5U A;  1A63 A;  1UE6 A;  5E3F A;  3DHQ A;  5IYC G;  4RHS A;  2C5C A;  1Q1E A;  4RGO S;  4HID A;  2KCM A;  4FXG C;  3KYH C;  5KGU A;  3QR8 A;  2MQH A;  4JG2 A;  3HOZ H;  1VQ5 A;  2F52 A;  1ZYR C;  1XPO A;  4IUP A;  3EFX D;  1SJH D;  2PZT A;  3CF5 A;  1D8L A;  4XT1 B;  2B2W A;  1KNA A;  1SEB D;  4H02 A;  1TWG B;  4X65 Q;  1HA6 A;  2JK8 A;  4AYB G;  3C2P A;  4GN3 B;  5HGQ A;  4LF7 Q;  3ERQ A;  4EQP A;  5IOD A;  1OXV A;  1VQP A;  3VR5 A;  3GDE A;  4LFB Q;  4XYO A;  5BN5 A;  3PUW A;  1YNJ C;  4JC0 A;  1TS5 A;  5D3D A;  4CKB A;  3EBE A;  1RCV D;  4A3C G;  3BYT B;  4JBW A;  5KND A;  2IW3 A;  4MIU A;  1WTQ A;  2Q8T A;  2EXZ A;  2H1E A;  2N55 A;  5M3F G;  2JE6 I;  5JEA J;  2EY6 A;  2SOB A;  4K5V A;  1SFO H;  1HZA A;  4NB3 A;  1Y1W B;  1SMX A;  4HED A;  4C3I B;  4DPG A;  4DV3 L;  1H9M A;  5IP7 H;  3S1R B;  4OEL B;  2F0U A;  2E8G A;  4ZQ3 A;  1STA A;  2L55 A;  2VL6 A;  1JE5 A;  2FHT A;  3SVM A;  1VQA A;  3BS1 A;  1MKH A;  1SNM A;  1PTO F;  2D0P A;  1XMQ Q;  1SXT A;  3TZU A;  2KA7 A;  4JI6 L;  5D14 A;  3S2H B;  5IWA Q;  4FXK C;  4YWL A;  1GD7 A;  1YI2 A;  3NQI A;  5DM6 3;  1U4M A;  1F2Z A;  3NHH A;  3RZO B;  4NDX A;  4HIO A;  1R4Q B;  1GHK A;  3QB3 A;  4HJ5 A;  2PQA A;  1HZB A;  4B3T L;  3S2D B;  1XTD A;  3CCL A;  1F9P A;  2MJ8 A;  5A35 A;  1STN A;  1B4O A;  1O7I A;  1I94 L;  1O78 A;  1S72 A;  3MZ5 A;  5FO8 B;  5C4J B;  3E0J A;  2E2I B;  3MWY W;  3RZO H;  1HNX Q;  1ZXT A;  4GLV B;  2WB1 E;  2SNM A;  1B9M A;  2IX0 A;  2F4V L;  1I6H H;  1DD2 A;  2C35 B;  3HOX B;  1IL2 A;  4C2M H;  1LV9 A;  2SDF A;  4XT3 B;  4DR7 L;  2H5X A;  3URY A;  1XXG A;  4K14 A;  1EOT A;  2MHV A;  5C3X A;  5ELE A;  5FLX E;  1V9P A;  4A3G B;  1NUC A;  4BXX H;  3M7G A;  2LSS A;  1Y8N B;  2KJX A;  4P73 A;  3S16 H;  2NVT B;  2A1A A;  2B63 G;  4JI3 L;  5A2Q L;  2AHO B;  1KDC A;  5J1Z A;  1F9R A;  5CV4 A;  2VQE Q;  1BNZ A;  1PYW D;  2WII B;  3VYU A;  4QUF A;  5I2Y A;  4X62 Q;  2UUB Q;  3NE5 B;  4QJF A;  4X66 L;  2JA5 G;  3HOW H;  5I4D A;  3F2C A;  1JOQ A;  3V2T A;  1LTT D;  4A3E H;  1XPU A;  2AWO A;  1EQT A;  2F0N A;  2NVY H;  1D7Q A;  1DON A;  2Q2U A;  5BR8 Q;  1FVI A;  1Y8O B;  5C3W A;  2E5L L;  4HMI A;  3PO2 G;  3H3V C;  3A54 A;  3HZX A;  4J15 A;  1I3Q H;  2BDN A;  2HIX A;  1HRJ A;  2FXQ A;  1L2F A;  1W6J A;  4AQY Q;  1TY2 A;  4IOA A;  3SK5 A;  2BOS A;  1HNW L;  2XIW A;  5C0X I;  4HJ7 A;  3EA6 A;  1O80 A;  1U5K A;  5JVH 3;  1L0Y B;  3NBH A;  4NKL A;  2EDG A;  5C6A A;  2RVL A;  3U4V A;  4IFD J;  3ONA B;  2DNE A;  4HSV A;  4YIJ A;  3CP0 A;  4OO1 H;  4LF8 Q;  4OL7 A;  1IBL L;  1JJ2 A;  1CI3 M;  3MVV A;  4TQU S;  5C4X G;  2NVY B;  1DOK A;  2JA9 A;  3TP6 A;  3K0Y A;  1BCP B;  1ICW A;  4G7H C;  4WJ3 M;  3D4R A;  3PF4 A;  2F4I A;  2B2Y A;  2Z8L A;  2ZTD A;  4MN3 A;  3G4S A;  4IPD A;  4OIK A;  3VYT A;  1D1I A;  3KLW A;  5M3F B;  3J80 i;  3T16 A;  3PIP A;  4FVM A;  1DOL A;  1EU3 A;  2V4D A;  3TS0 A;  1TWG H;  3EN2 A;  1Q82 C;  1JJC B;  2RDF A;  5C3E H;  1X3P A;  2AMC B;  4RG1 A;  2J7Z A;  1IKM A;  1YHB A;  4HCE A;  5EJW A;  3NTI A;  3I70 A;  2WP8 J;  3VR4 A;  5LMN W;  2K03 A;  4ZKC B;  1W6K A;  5G3L D;  2PMZ B;  3LGJ A;  2RDG A;  4IJL A;  1FNW A;  3STB C;  2AQ2 B;  2O5I C;  3MTS A;  4JK1 C;  1H9R A;  1C8C A;  1F9Q A;  1GUW A;  3E9I A;  4XDX A;  1SE4 A;  4PQX A;  3OHX C;  4C3J B;  2C9O A;  4J6H A;  1I6V C;  5C0X J;  4DUZ Q;  1LTI D;  5KIX A;  3T13 A;  3TDQ A;  4NPS A;  5C0X H;  1PH1 A;  1NR2 A;  4DV3 Q;  1BBX C;  2A69 D;  1HTL D;  1CHQ D;  1VDZ A;  2K5H A;  3KLS A;  5IP9 G;  2ID0 A;  1C7Y A;  2PQE A;  1DZ1 A;  4IAL A;  4BBR B;  2JA5 H;  4JI6 Q;  2ZJP A;  4O2D A;  1Z47 A;  5IWA L;  1VQK A;  4HJ8 A;  3T51 B;  4R4T A;  1STH A;  2BCO A;  5EPK A;  1HFN A;  2NVX B;  4A3B G;  1EFI D;  3B6Y A;  4L5T A;  1WTO A;  2XSC A;  5M9O A;  5IGF A;  4A3K H;  2I5M X;  3FPP A;  5GRO A;  1X6O A;  3J81 j;  5FJ8 G;  3Q22 A;  2ZXR A;  3JAM E;  1SNO A;  1W3S A;  2NVX H;  2JEB I;  1PRT C;  4ZKB B;  1I5F A;  1HNX L;  3PIP 3;  1XX8 A;  2KCC A;  4R1J A;  4ABN A;  1IYV A;  1JWU D;  1LTS D;  2XWJ B;  1I50 B;  1ILQ A;  2K04 A;  4BBS G;  1I6H B;  1VQE A;  3AU7 A;  2NTT A;  3LWE A;  3OIQ A;  3PUV A;  3L2P A;  1JR0 D;  5IGD A;  2E2J B;  5E1F A;  1LTG D;  4JI8 Q;  2CFM A;  4CJ2 C;  1YJN A;  3PMF A;  1B8A A;  3J7Z C;  3TS2 A;  2SEB D;  3KUP A;  2F0W A;  2L11 A;  2QGQ A;  3FRP B;  4NXM Q;  1II3 A;  2N88 A;  3BYY B;  2QA4 A;  3K7A H;  2D9U A;  4ZUJ A;  3ERO A;  4K6L A;  1CZG A;  5COY A;  4FNF A;  4DKA C;  4X62 L;  2UUB L;  1A6X A;  1K73 C;  3OW2 A;  1X3G A;  1F77 A;  3T1H Q;  1HZC A;  5LL6 S;  3KDF B;  2NVQ B;  2CH4 W;  1EWH A;  1R4P B;  2Y0S G;  4X3K A;  1EL0 A;  4ZAI A;  1K0S A;  3BVZ A;  3BG3 A;  2A69 C;  5FJ8 H;  3HGB A;  1EY7 A;  4JI2 L;  1YNN C;  2EY2 A;  2UU9 Q;  2X6L A;  1VQ4 A;  4JW0 A;  4RH6 A;  2R7F A;  4DR6 Q;  3SK6 A;  1HNW Q;  1K3B C;  1ESR A;  2KBN A;  4YHH Q;  5JEA H;  5IYB H;  2Y0S E;  1IYU A;  4UPA A;  3GTK H;  3MEH A;  1SMY C;  4LUV A;  4C3H B;  5M3M B;  1RKN A;  3R8B A;  4LJZ C;  3X3N A;  3HOX G;  3S1M B;  1M8A A;  2KVM A;  1IYJ B;  4B9W A;  2E2H H;  3GTM H;  2AUK A;  4LF8 L;  1LAB A;  2VUM G;  1DYQ A;  4KJO A;  1P8L A;  4F88 A;  2KEE A;  2L9H A;  2PZW A;  5K36 G;  4R8I A;  3CC7 A;  5IT9 E;  2QDL A;  4GNX C;  4IUQ A;  1YZ6 A;  4L5R C;  4IOC A;  3KOJ A;  4TKO B;  1A8V A;  2R93 G;  5FO7 B;  2BA1 A;  3W2D A;  2JA8 B;  4A3M G;  4K2L A;  3G6E A;  4AH6 A;  3H91 A;  4DV5 Q;  5HUR A;  3EQL C;  3I4O A;  4B3R L;  4DV1 Q;  1X32 A;  1XMQ L;  3S15 H;  2ZM6 L;  4LFA L;  2XNA C;  3P20 A;  3HOZ G;  4XQQ A;  4OGQ C;  3TSS A;  1NMG A;  4KY6 A;  2P5Z X;  1TWC H;  2B63 B;  4U68 A;  3E3X A;  3VR6 A;  2B2T C;  4NW2 A;  5EKK A;  3CHB D;  4IUT A;  1FL0 A;  4B3T Q;  1ESF A;  5KYI A;  1GUT A;  1HZ9 A;  1S5E D;  1VQD A;  1X65 A;  1G2T A;  2JA5 B;  5D65 A;  4IPC A;  1VQH A;  2B8G A;  1O7L A;  2EIF A;  3ND9 A;  3CC2 A;  1A15 A;  5L37 A;  5KEE A;  5EBD A;  1YNJ D;  1STE A;  1UE1 A;  1WJJ A;  1KNE A;  1J9O A;  1IKL A;  4JBM A;  5IYD G;  3CXC A;  4C2M B;  3NK9 A;  2K5D A;  4Y7N H;  1F9S A;  3OW7 A;  1L0W A;  4BBR H;  2A74 C;  2WAQ G;  1CM9 A;  5I2X A;  1CUK A;  5FKA C;  1MI2 A;  1JIC A;  2VXW A;  2EPB A;  1V1P B;  4N9T A;  2KUM A;  3RZD H;  1K28 A;  4L8J A;  2JEA I;  1U4L A;  2F0J A;  4KY7 A;  1X54 A;  4L6T B;  1EIH A;  2WKC A;  1YJ9 A;  1ONL A;  1TY0 A;  2VQE L;  4KK7 A;  3S9W A;  3H0G G;  4BY7 B;  3J81 c;  2ZT9 C;  3MXN B;  3U58 A;  1PTO H;  2F0G A;  5C4Z A;  1HUM A;  4FP5 D;  1Q81 C;  3HOY B;  1UUP A;  4NXM L;  5GAH C;  3PO2 H;  2RQX A;  1HUN A;  5LMN Q;  4IUN A;  3VR2 A;  3C1E A;  4LW1 A;  3R93 A;  4ALP A;  5CR3 A;  5BR8 L;  4DGZ A;  2CKZ B;  5CV9 A;  2IX1 A;  2E5L Q;  4K8I A;  3C1F A;  1PTO B;  3P7J A;  2I5H A;  4A3F H;  1G6P A;  1PYB A;  3A0J A;  5CV7 A;  4DR2 Q;  1N36 L;  4RA8 A;  1RIP A;  4IJH A;  3LX0 A;  3OTO Q;  1NCV A;  2GVA A;  3I2Z A;  3BVG A;  4EQN A;  1E24 A;  3EIV A;  4GKJ L;  4PG3 A;  3S1M H;  4DR5 L;  5GQO A;  3PCO B;  1KQS A;  3A55 A;  2UU9 L;  1GO3 E;  2EE1 A;  1Y14 B;  4YY3 Q;  1BDO A;  1HJP A;  4A3D G;  2B2U A;  1WCM H;  4DR6 L;  3CC4 A;  5FLM H;  3NSW A;  3KF8 B;  1X9N A;  3S1Q B;  1L1O B;  1QZG A;  2R7Z H;  1C9O A;  3BJU A;  1CQV A;  1IW7 C;  3A74 A;  3DLL A;  5C4H A;  2J4X A;  2LY7 A;  3HG9 A;  4BBS B;  3RUZ A;  4DV2 L;  3S2H H;  1WTW A;  1SRU A;  3GV3 A;  3U9S A;  4A3C H;  2B2W C;  1ENF A;  2YU9 H;  3L9A X;  1SE2 A;  3NWS A;  2K52 A;  3F2B A;  1E7Z A;  2RF4 A;  2R92 G;  4DAV A;  2Z6K A;  2HQL A;  4C3I H;  2F0M A;  4A93 H;  3K57 A;  4JI0 Q;  2VQF L;  2D5D A;  4I7A A;  3T56 B;  1WVL A;  1AE2 A;  3SGI A;  2ATW A;  1LTA D;  1R9T H;  2D0O A;  3MXG A;  2YU9 B;  4POF A;  3CD6 A;  3IKJ A;  3OOC A;  2G9D A;  3S1Q H;  1B70 B;  2RA4 A;  1Y1W H;  5AJ3 L;  5IT9 c;  1XMO L;  4A3K B;  3KF6 A;  4O42 A;  1JE4 A;  1L1O C;  1PFB A;  1OXT A;  2HHH Q;  1TT2 A;  3MHB A;  3I56 A;  5JJL A;  2ZM6 Q;  2DNC A;  4LFA Q;  2K6A A;  3I72 A;  3CCU A;  2L15 A;  1KDB A;  3M3Y H;  1LM0 A;  1HH2 P;  2VUM B;  3D6W A;  5C3E G;  2DJG C;  1MSH A;  3S14 H;  2F0V A;  1B2T A;  4Q0F A;  1MSG A;  3QJY A;  4RKB A;  1RD9 D;  2FIN B;  4UP8 A;  4C3H G;  3TN2 A;  3HOU H;  1B53 A;  4C3J H;  3ERS X;  2Y0S B;  2RDH A;  3UI2 A;  5CBE E;  5C44 G;  4DV4 L;  1M90 C;  2PCF B;  4PMB A;  4A3J G;  3KLS X;  1D5X C;  4CDF C;  4HR7 B;  1H9K A;  2K05 A;  4XQN A;  5C0X G;  3D6C A;  4FYD A;  1S3O A;  2F3V A;  3CPW A;  1VQ7 A;  1QVF A;  5CGK A;  2EQS A;  3RLN A;  3KBX A;  3VYS A;  2CH4 A;  3WDN A;  2JYO A;  4IUU A;  2JA8 H;  1D5Z C;  2NUC A;  4K0K Q;  3A7A B;  1CA5 A;  3A8I E;  1BF4 A;  3VR3 A;  1TWA B;  2EYL A;  2OQK A;  2F1M A;  3DM3 A;  1IHZ A;  2VY3 A;  1UE7 A;  2SNS A;  4DU9 A;  4DA2 A;  4XYQ A;  2FMC A;  1BQQ T;  4KKS A;  5M5W H;  3T1H L;  4A3G G;  4OHJ A;  4IUR A;  3S1N B;  1V8Q A;  3HEJ A;  1HNZ Q;  3J81 L;  1KAB A;  1BCP C;  3DM1 A;  4ZK9 B;  4A3I B;  1TWA H;  4OWX B;  2K14 A;  4C3H H;  1QG7 A;  2F03 A;  1JB7 A;  4IO9 A;  4OO1 I;  2IWH A;  5JJZ A;  1NBW A;  4RFB A;  2K75 A;  3NEN A;  1MD2 D;  2IPK D;  4JI2 Q;  3GTL H;  5IGB A;  4FF3 A;  4DK6 C;  4I7Z C;  4UY8 C;  3MXU A;  4JPB W;  2R93 B;  5ELD A;  1VS0 A;  3HFZ B;  4DR2 L;  1N36 Q;  2LXK A;  4YHH L;  5HGT A;  5E4X A;  3CPF A;  1Q12 A;  1F2Y A;  1E22 A;  4LWC A;  4QCL A;  4ME5 A;  4PV1 C;  3C3L A;  1TWF B;  3FEW X;  4GKJ Q;  4DXF A;  2JP1 A;  1XTC D;  4B3M L;  4LF5 Q;  3I7F A;  3J7A V;  2F0Q A;  4OX9 L;  2ZTC A;  1DJR D;  4YY3 L;  1K8G A;  1SYE A;  2O2L D;  2WFW A;  4OEM B;  3TZD A;  3UE0 A;  3MC0 B;  1Q7Y C;  1Y1V B;  3GD7 A;  3QOL A;  4FXD A;  1MJC A;  4LFC Q;  4JI4 Q;  3L0O A;  5DM7 3;  4GNX A;  2N8N A;  3NBI A;  2CW0 D;  4K5W A;  1L0X B;  3HOY G;  1XPR A;  1WOC A;  5IOC A;  4HIM A;  2LKV A;  4L63 B;  4LF4 Q;  2ALY B;  3FKI H;  1N9W A;  1PH5 A;  4DAY A;  4DV2 Q;  2A6E C;  3FKI B;  1IBK Q;  1WCM B;  2YTY A;  1YBY A;  2XTI A;  3HKZ G;  4F7X A;  5IYB G;  4C3I G;  4HSP A;  1O7Y A;  1Q3L A;  3H0G B;  2E2I H;  2KHI A;  1K83 B;  3DWQ A;  4KHP L;  2DJF C;  5CMD A;  1ZEQ X;  4A3L H;  4P75 A;  2RHS B;  4ODG A;  4DV7 Q;  4JI0 L;  2AKW B;  4DV5 L;  1VQJ A;  4B3R Q;  1EEI D;  1PYS B;  4QIW E;  3ULL A;  4DV0 L;  3S2D H;  3FMC A;  4DV1 L;  2IY5 B;  2BA0 A;  3D31 A;  4HTH A;  1ET9 A;  1SSO A;  4UP9 A;  3DEP A;  2VB2 X;  4PZ6 A;  1QOH A;  4AYB E;  2PYK A;  3K5O A;  3GTK B;  4DK1 A;  4O1N A;  2HQE A;  4ZRZ A;  4F8M A;  2HT1 A;  3M4Q A;  1XMO Q;  3CKI B;  1X3Q A;  3IL8 A;  1ILP A;  2Q2H A;  1EFW A;  3S16 B;  4I65 A;  3CAM A;  3I4M B;  4KLK A;  1ASZ A;  2HHH L;  3NEM A;  3DUZ A;  1IBM Q;  2K7V A;  4A3J B;  2E74 C;  3PGZ A;  3VDY A;  1EYC A;  3J80 E;  4DR3 L;  1OXU A;  4C56 C;  3PSI A;  1N8R C;  1FJG Q;  1SND A;  4DNT B;  3GTG H;  3G48 A;  2ENB A;  1UEA B;  2OWO A;  2PI2 A;  4DFA A;  3TQY A;  1S5D D;  1GUO A;  1HXY D;  2KHS A;  3OIP A;  2R3Z A;  4IFD I;  2EJM A;  1PDQ A;  4KTA A;  1SJE D;  4X6A H;  3MEF A;  2KQ3 A;  2I5L X;  5JAV A;  1HPC A;  4EQ5 A;  1H95 A;  1SRO A;  1BCP F;  1JWS D;  3MFY A;  3SK8 A;  1I4H A;  3GTO B;  1PH7 A;  3KFU A;  4A3K G;  1WD0 A;  2Z0S A;  4JV5 Q;  1S40 A;  2EYO A;  4G57 A;  4HJ9 A;  3S1N H;  3U4Z A;  2K33 A;  1SE8 A;  2BDO A;  3UE1 A;  1LYL A;  3RR5 A;  2Z4I A;  1PRT F;  1O7Z A;  4KKU A;  1E3P A;  4K5X A;  4KMU C;  3PO2 B;  5LMN L;  2E75 C;  1ICF B;  5HY6 A;  4X3T A;  1SBB B;  4KY5 A;  3I90 A;  2YTV A;  1CSP A;  4J1M A;  2EOT A;  4LAA A;  4R9W A;  3HOU G;  4MNO A;  4ME3 A;  2MO1 A;  4IPH A;  3OSO A;  1VCI A;  1XNQ L;  1HNZ L;  3OTO L;  1UNS A;  2CHB D;  2WKD A;  1HHV A;  4GZY C;  1B3A A;  3A8J E;  1B7Y B;  1N32 Q;  1EUJ A;  3I4L A;  2Q2I A;  1F2M A;  4DV6 L;  4GNX B;  4BY7 H;  3O13 A;  4DR5 Q;  5J22 A;  3G71 A;  2B8F A;  3NXW A;  2PPB C;  3H94 A;  3UDG A;  2K50 A;  3G7L A;  2EY5 A;  3BZK A;  3SDZ A;  1QIL A;  4ULL A;  3VA7 A;  2R61 A;  3FPU B;  5GAG C;  1JJG A;  2G5D A;  2MP1 A;  2QDB A;  4RKL A;  1EY8 A;  5JPM C;  2K5V A;  2HDM A;  3NTK A;  1D5M C;  3PO3 B;  4LK1 C;  3AMU A;  4RHR A;  4BA1 I;  2N3S A;  4TVA B;  3DMU A;  4QUC A;  3DWP A;  4KJN A;  3PF5 A;  4PZ7 A;  1B3Q A;  3HS0 C;  1KTK A;  5C3E B;  4CDD C;  3BZD B;  4IZ8 A;  4LFC L;  2WB1 B;  4MTK A;  1PMR A;  4HN7 A;  1TWF H;  3IRB A;  3KJO A;  2F0L A;  3ZYY X;  2VQF Q;  1VQI A;  1TWH H;  4BXX G;  3H3V I;  1IBK L;  4V0B A;  3ITP A;  1Z9F A;  1F2L A;  3SR1 A;  1PH8 A;  1VQN A;  1PVO A;  5AJ3 Q;  4KHP Q;  1XWE A;  1MIU A;  2CWP A;  2EYM A;  5JJI A;  4P74 A;  4M1U B;  2RSN A;  3PV0 A;  5IIF A;  3GTQ H;  1X55 A;  1FGU A;  4LNQ A;  2EYP A;  1NSN S;  1OXS C;  3TRE A;  5IGG A;  5IYD H;  4IQZ A;  3VYR A;  2Z6B A;  2A8V A;  4IN3 A;  2A6H C;  1IZ6 A;  1ENA A;  2F0H A;  2EY1 A;  4A93 G;  1SYB A;  3IFD A;  3JC6 6;  2R92 H;  2KOL A;  5JJK A;  4YWK A;  3GTO H;  1IBM L;  1SNP A;  1TKW B;  3K81 C;  4QMG A;  1B9N A;  1A0I A;  2NZH A;  3NP8 A;  2PW5 A;  3QO2 A;  4DV4 Q;  1SN8 A;  2Q8I B;  2DGY A;  4JVZ A;  3IFT A;  1PH3 A;  2D2C C;  1QZH A;  1SDF A;  4OIJ A;  1W2B A;  1D2B A;  4K6D A;  1Q1B A;  4TRD A;  1T5E A;  4BS9 A;  3HKZ E;  4A3B H;  5LMU Q;  1PFS A;  3NUC A;  4C1N I;  1STY A;  1NMF A;  4RGN A;  4IFD G;  4P2C B;  3CCV A;  4DR1 Q;  1PHJ A;  5M5X H;  5CYU A;  1LT4 D;  4CDE C;  3FKI G;  4K0K L;  1U0L A;  5T1I A;  1Q90 A;  1G51 A;  4YWM A;  4RAU C;  2PZU A;  4JV5 L;  3DXJ C;  5C4J H;  5KNB A;  2HDL A;  1QVG A;  4HMJ A;  4JBK A;  1V1P A;  5IP9 H;  4B9X A;  4HCS A;  2TSS A;  2IJ0 A;  4WOR A;  4BY1 G;  4ZLT F;  4KHZ A;  4UDU C;  4KI0 A;  1LTR D;  1QCB D;  2VNU D;  2AUJ D;  1MHW C;  1EY0 A;  1GVP A;  1H9J A;  3J80 L;  4WJW A;  2I0Q A;  1WCM G;  2IHF A;  2AWN A;  1WFQ A;  4RMF A;  4K8J A;  2Q2T A;  1VQM A;  2QEX A;  1FGB D;  1GUS A;  1U4R A;  1CSQ A;  4KV6 A;  1WYD A;  4JI5 L;  3K8A A;  4PMW A;  1XNQ Q;  2UXB L;  5CV6 A;  1KXL A;  5AFW A;  2OQ0 A;  4XTC S;  3BZC A;  1PZK D;  4FF2 A;  1N32 L;  3OWE B;  4X64 Q;  1JCK B;  3PIO 3;  4DUY Q;  2PO4 A;  4JYA Q;  2EYJ A;  4B3M Q;  4LF5 L;  4A3F G;  3I8Z A;  2E76 C;  3ER0 A;  4OX9 Q;  1R9T B;  1KRS A;  3V05 A;  2J0T D;  1CKN B;  1XYI A;  2B39 A;  4J8Q A;  4NMZ A;  4F87 A;  3PIO A;  1TWC B;  2KHJ A;  3HRZ C;  1KDA A;  1YIJ A;  4JI4 L;  1ML0 D;  1PTO D;  4NP5 A;  1N34 Q;  2EVB A;  1WI5 A;  2LS0 1;  1SNC A;  3PO3 H;  4LF4 L;  1B44 D;  1HR0 L;  4CHT B;  3I3C A;  4IPG A;  1YNN D;  4N8X 1;  4RCN A;  1VQL A;  2JA8 G;  4XQJ A;  3CU7 A;  4KD3 A;  3SE0 A;  1LTL A;  4GKK L;  3H0G H;  1Q86 C;  3TP7 A;  2MGS A;  1Z6H A;  3E9H A;  2VUM H;  2DY7 A;  3K80 C;  1FR3 A;  2F3I A;  1G6Z A;  1NY4 A;  5C5M A;  4DV7 L;  3HOZ B;  4EQO A;  4DV0 Q;  2R7Z G;  2PW7 A;  4EVO A;  1LO5 D;  3S17 H;  4KHV A;  3OWF A;  3KLR A;  2OT2 A;  2EYH A;  5ELO A;  1NR4 A;  4CKE A;  4DR4 Q;  1NNX A;  3J7A F;  1M4V A;  4QIW B;  3NTH A;  1NE3 A;  3R2I A;  3M4O B;  4RWS C;  2ZXO A;  3NWT A;  2QKI C;  1SYC A;  3J80 c;  2M2L A;  4BWG B;  2A73 B;  2F0O A;  4MTN A;  4DNI A;  4OO1 G;  3GTG B;  5JEA G;  2MPM A;  3D0F A;  3UDF A;  5IYC H;  1J5E L;  2K5Q A;  3A8K E;  3CCQ A;  4DR3 Q;  4R4Q A;  5ELF A;  1FJG L;  1QVC A;  1TS4 A;  2JA6 B;  1TVX A;  3F2U A;  1M1K C;  2ICI A;  2NVT H;  2L1B A;  3FP9 A;  3WOE A;  3A5Z B;  3M7N A;  3HOU B;  2UXC Q;  1UAP A;  3CQZ B;  4GOP B;  4IUV A;  2JN4 A;  2PI2 E;  2NN6 I;  4UHV A;  5IY0 A;  2ZXP A;  3SHL A;  4CDC C;  3N52 A;  1JT8 A;  1VQF A;  3NQT A;  4WRD A;  2K28 A;  2BH8 A;  4H0L C;  4YCU A;  3M3Y B;  3A56 A;  2VW9 A;  1JOR A;  1YHA A;  2XWB B;  2PNR C;  2HD3 A;  4POG A;  3CW2 C;  3J81 i;  3NEL A;  1D6E C;  3HOV B;  5DAU A;  1AW7 A;  2AQ1 B;  4IFD H;  1SMY D;  1GXD C;  4GS3 A;  1V1Q A;  4YCW A;  2IHE A;  1UEB A;  4EGV A;  2QCP X;  2GVB A;  1I3Q B;  5LMU L;  3RMH A;  4QL5 A;  1A62 A;  5EKI A;  1AH9 A;  3J81 E;  4Y52 H;  4DR1 L;  1DCZ A;  2E2H B;  1EY6 A;  1AZQ A;  2R6G A;  2UXD Q;  4JI1 Q;  1GUN A;  1TQO A;  4ZUI A;  2ASB A;  4BBR G;  3BDO A;  5IT9 L;  1BVS A;  4EX5 A;  2KED A;  5EAY A;  5CBA E;  3I4M H;  3V96 A;  3OPO A;  4A3M B;  5COR A;  1BBW A;  1X56 A;  5D3I B;  3R3O A;  1TWH B;  3RN5 A;  3F1Z A;  1JB3 A;  5M5X B;  2N78 A;  1WTX A;  5M3M H;  1LAC A;  1OTC A;  1I4R A;  2CW0 C;  5M5Y H;  1EZ6 A;  5EQ0 A;  3GTL B;  4DV6 Q;  3STB D;  1QUQ A;  5KRU A;  4A93 B;  2CCZ A;  1TR5 A;  3CMA A;  2F0E A;  2YTX A;  3OMG A;  1K8O A;  4ZCK A;  1Q8K A;  1LLR D;  1KLU D;  2LFN A;  1OXX K;  4QF4 A;  1KL9 A;  3CCM A;  4DAM A;  2EYF A;  3CCR A;  2UXB Q;  4NXN Q;  2A6E D;  3AB9 A;  1VQO A;  2L4N A;  3HOY H;  5GAD C;  5K36 H;  2B2V C;  2I07 B;  2EJF C;  3TME A;  2A19 A;  3E5S A;  1XNR Q;  5FLX L;  2A68 D;  4X64 L;  2B2U C;  4UAI A;  5C44 H;  4R8N A;  2K32 A;  5IGE A;  3CRL C;  4DUY L;  4JYA L;  4A3M H;  4B3S Q;  2KEN A;  2X6G A;  2R93 H;  2A68 C;  2I46 A;  1VQ9 A;  4DAY B;  3W1B A;  5ELN A;  2MFI A;  2XGT A;  1H9S A;  1HA5 A;  1CTM A;  1EY5 A;  5T1G A;  2XN9 C;  3I4N H;  3BVM A;  2IT1 A;  3I91 A;  1K83 H;  2QF7 A;  1CT1 D;  4BY1 B;  1CKO A;  2PQA B;  1JOO A;  4X3S A;  2K01 A;  2NZO A;  5I6W A;  3PUX A;  1ROD A;  4QY7 A;  3GTJ B;  1DXM A;  4CJ1 B;  2VB3 X;  1PRT B;  1S5B D;  2F0F A;  1I4Q A;  5I9O A;  1Y1V G;  1BCP D;  1HR0 Q;  1HCZ A;  1AFP A;  1STB A;  1G29 1;  2RCF A;  4U67 3;  4KN4 C;  2N49 A;  3T53 B;  4A3G H;  5I9P A;  1QB5 D;  2QIL A;  4R4I A;  4HIK A;  4BBS H;  3HKZ B;  1EQR A;  2WAQ E;  2O5J C;  1LUZ A;  1C0A A;  3Q8D A;  4GLX A;  3S15 B;  3D3R A;  4BA2 I;  1P16 A;  1RTN A;  3FDT A;  3W3A A;  1BUV T;  2B63 H;  1E2Z A;  3AQQ A;  4L5S A;  5ELB A;  3RN2 A;  2OTJ A;  1G91 A;  3I4N G;  2X69 A;  2UUC L;  1I4G A;  4LUO A;  3H6M A;  1U4P A;  2DY8 A;  3U9O A;  3Q0A A;  4CKC A;  1ET6 A;  1T5X D;  5G3L F;  1LT5 D;  1EU4 A;  2XVS A;  3ZJY C;  1E0B A;  1AEX A;  1FNU A;  4N8F A;  1EOV A;  4B08 A;  4CJ0 B;  2HUG A;  2B2T A;  2B2V A;  2G9H D;  1CA6 A;  3K6O A;  1PH2 A;  5EPL A;  1ENC A;  2UUA Q;  1MJE A;  4YCV A;  1YVC A;  1CK1 A;  4A75 A;  4A3I G;  1STG A;  4LF9 L;  2UXC L;  3HKS A;  2WIN B;  3KDF A;  4OWT B;  4GOP A;  1YNX A;  2CQA A;  1A3U A;  3OYY A;  5IP7 G;  5EBC A;  2ICE C;  1S5F D;  4DNR B;  3RLO A;  3E6Z X;  1VMP A;  1VMC A;  2LMC B;  2Z1C A;  2TMP A;  1WD1 A;  3W5O A;  1VQC A;  3SXH A;  1K8A C;  2RCN A;  1Q8I A;  2K1B A;  2VS1 A;  4ID6 A;  1K9M C;  2WAC A;  3G6J B;  5FO9 B;  1G2S A;  3ULJ A;  2M00 A;  5DLQ E;  3HOW B;  2BH2 A;  3UDX A;  3TP8 A;  3KJP A;  2UXD L;  4A3D H;  3PUZ A;  2HIV A;  1RTO A;  4R4C A; 
#chains in the Genus database with same CATH homology
 4X3U A;  1PFM A;  1EYD A;  2XRQ D;  1RHP A;  5KYL A;  5M5W B;  2NN6 G;  1QJO A;  5K5P A;  1TS2 A;  1AZP A;  1JWM D;  1A3V A;  1AP0 A;  3A7L A;  1VF5 C;  2RBM A;  3RD4 A;  1H9S B;  3Q23 A;  3M85 A;  3FVQ A;  2R7Z B;  4H7B A;  1BOS A;  4K2K A;  3K5N A;  2F0T A;  5DEH A;  5F2D A;  3MFG A;  3LNN A;  4KN7 C;  4KKT A;  3VA5 A;  4C1N K;  1EY9 A;  2NZ1 D;  4XXE A;  5JOB A;  5JVG 3;  1PRT D;  1GJX A;  1WTR A;  5C44 B;  5CC4 A;  1LT3 D;  1JC7 A;  4M8A A;  2JA7 B;  1I4P A;  2NYZ D;  3JAM L;  3QIA A;  3TP5 A;  5ISR A;  2F0I A;  3QG1 A;  3EVQ A;  2KEC A;  5FK9 C;  2A6H D;  5FOB B;  1FNV A;  3RLF A;  2AQ3 B;  5IGC A;  1PZI D;  5J39 A;  2HCI A;  1VF7 A;  2OXP A;  1HQM C;  1IL8 A;  3MXP A;  1HTP A;  1RJT A;  3D4D A;  1TU2 B;  3EJI A;  1GUG A;  2O4X A;  3HP3 A;  3C46 A;  3D8G A;  4AYB B;  4Y7N B;  1BO0 A;  4V19 0;  3D4W A;  2OEO A;  3BDL A;  1ZKO A;  1I4X A;  2IL8 A;  1PZJ D;  1A3T A;  4H44 C;  1Y8P B;  1SYG A;  2L5T A;  3KK7 A;  1ZYR D;  4ILW A;  3DEO A;  5BN4 A;  3SK4 A;  1PTO C;  5ELC A;  2BE5 C;  1E2V A;  4E6I A;  1PLF A;  3X3M A;  5EGT A;  1KAA A;  2FJ2 A;  4WFN 3;  5NUC A;  2BE5 D;  4LMQ D;  2YYZ A;  3RZD B;  2A5H A;  1EQV A;  1SYF A;  1SE3 A;  3CRK C;  4DXG A;  4HAE A;  3NPP A;  3S17 B;  1CZW A;  5DNF A;  2FFK B;  1FYC A;  3R2T A;  1B50 A;  2JXM B;  1LT6 D;  2JSO A;  3P75 A;  3T4A C;  4PMC A;  2L0C A;  4FF4 A;  1V43 A;  4FF1 A;  1QWY A;  2RSO A;  1S5C D;  2E2D C;  1PFN A;  3QOJ A;  4S3S A;  2KCN A;  3IAY A;  3KF8 A;  1DOM A;  1A2U A;  3GTM B;  3K5M A;  1K8M A;  2RKS A;  3H09 A;  4XIG S;  2DN8 A;  3MA2 B;  2EZV A;  2H4O A;  1HFG A;  3K59 A;  1G8Z D;  4DF7 A;  4Q5V A;  2FMM A;  2B2Y C;  1GOZ A;  1U9R A;  2MUY A;  5A2Q E;  1CHP D;  5CV8 A;  2HCC A;  2QEJ C;  1BR9 A;  3BDC A;  1KLG D;  2L12 A;  4RGM A;  2F0S A;  5E4W C;  3TBI B;  4KD4 A;  1BXT A;  1GHJ A;  2D62 A;  2NB0 A;  1D1K A;  4ZYS A;  1Y69 U;  1HQR D;  1TII D;  1SNQ A;  1EWC A;  2NWG A;  4FO2 A;  3QWN A;  1SYD A;  1CFM A;  3I4N B;  2CVR A;  5TSS A;  1Z7T A;  3KBG A;  2K5W A;  5LL6 X;  1PXU A;  1TS3 A;  1SAP A;  4QB4 A;  3P1H A;  3Q6S A;  4RCO A;  2R92 B;  2F0K A;  5EKL A;  1JOK A;  2M9V A;  2F3W A;  1JQY D;  4TSS A;  1RF2 D;  1AN8 A;  3GO5 A;  2IX3 A;  3M4Y A;  1J8I A;  2OF1 A;  1S4Z A;  5BN3 A;  1B1Z A;  1NAP A;  5C4X B;  1C4Q A;  1QNK A;  2GA4 B;  3N6R A;  2WAQ B;  2Z4H A;  5LHY 1;  4CGY B;  1QE6 A;  3K58 A;  2NN6 H;  3L7Z C;  1V1O A;  3I73 A;  3DWA A;  3S14 B;  1MBY A;  3K7A B;  4RGT A;  5I6Y A;  1LTB D;  3MAQ A;  4CBV A;  3Q24 A;  1WTV A;  3L3O C;  1RDP D;  1SFO B;  4Z9C B;  2F0P A;  2Q8R E;  4C3J G;  3WOF A;  4PNY A;  3GTQ B;  5KNC A;  3LWU A;  1OO9 B;  2EJG C;  3ND8 A;  1IW7 D;  1EZ8 A;  3PUY A;  2WV6 D;  1MGS A;  4A3E B;  5C5L A;  1EY4 A;  5M5Y B;  1C48 A;  4DAP A;  3K5L A;  4N9P A;  1EYA A;  4DK0 A;  1WTP A;  1FD7 D;  4A3F B;  4DN4 M;  5CV5 A;  5EPJ A;  2XRS D;  4H13 C;  3GV6 A;  2NTS A;  4A3D B;  1CQF A;  1EIG A;  1EEF D;  3GQB A;  3SEB A;  3GP7 A;  2F0D A;  5JPN C;  3J7Y W;  1A2T A;  3GTP B;  2NBF A;  1E2W A;  3MXN A;  4A3B B;  4MHE A;  3OMC A;  1DM0 B;  1QNU A;  4G7O C;  4G7Z C;  4G4K A;  5E3F A;  3DHQ A;  4RHS A;  2C5C A;  1Q1E A;  4RGO S;  4FXG C;  5KGU A;  1ZYR C;  4IUP A;  3EFX D;  1SJH D;  2PZT A;  4XT1 B;  2B2W A;  1KNA A;  1SEB D;  1TWG B;  1HA6 A;  3C2P A;  3ERQ A;  4EQP A;  5IOD A;  1OXV A;  3VR5 A;  4XYO A;  5BN5 A;  3PUW A;  1YNJ C;  5D3D A;  1TS5 A;  4CKB A;  1RCV D;  3BYT B;  4JBW A;  5KND A;  2IW3 A;  4MIU A;  1WTQ A;  2Q8T A;  2EXZ A;  2H1E A;  2N55 A;  5JEA J;  2JE6 I;  2EY6 A;  2SOB A;  4K5V A;  1Y1W B;  4HED A;  4C3I B;  1H9M A;  3S1R B;  2F0U A;  4ZQ3 A;  1STA A;  2L55 A;  3SVM A;  2FHT A;  3BS1 A;  1SNM A;  1PTO F;  1SXT A;  3TZU A;  2KA7 A;  5D14 A;  3S2H B;  4FXK C;  5DM6 3;  3NQI A;  1U4M A;  1F2Z A;  3NHH A;  3RZO B;  4NDX A;  1R4Q B;  1GHK A;  3QB3 A;  3S2D B;  1F9P A;  2MJ8 A;  5A35 A;  1STN A;  1B4O A;  1O78 A;  3MZ5 A;  5FO8 B;  5C4J B;  3E0J A;  2E2I B;  3MWY W;  1ZXT A;  2SNM A;  1B9M A;  2IX0 A;  1DD2 A;  3HOX B;  1LV9 A;  2SDF A;  4XT3 B;  3URY A;  1XXG A;  4K14 A;  1EOT A;  2MHV A;  5C3X A;  5ELE A;  5FLX E;  4A3G B;  1NUC A;  3M7G A;  1Y8N B;  2KJX A;  2NVT B;  5A2Q L;  1KDC A;  5J1Z A;  1F9R A;  5CV4 A;  1BNZ A;  1PYW D;  2WII B;  3VYU A;  4QUF A;  5I2Y A;  3NE5 B;  5I4D A;  1JOQ A;  3V2T A;  1LTT D;  2AWO A;  1EQT A;  2F0N A;  1DON A;  1Y8O B;  5C3W A;  4HMI A;  3H3V C;  3A54 A;  3HZX A;  2BDN A;  1HRJ A;  1W6J A;  1TY2 A;  3SK5 A;  2BOS A;  2XIW A;  5C0X I;  3EA6 A;  1O80 A;  1L0Y B;  3NBH A;  4NKL A;  2EDG A;  5C6A A;  2RVL A;  4IFD J;  3ONA B;  2DNE A;  4HSV A;  4YIJ A;  4OO1 H;  4OL7 A;  1CI3 M;  3MVV A;  4TQU S;  2NVY B;  1DOK A;  3TP6 A;  3K0Y A;  1BCP B;  1ICW A;  4G7H C;  3D4R A;  2F4I A;  2B2Y A;  2Z8L A;  4MN3 A;  4OIK A;  3VYT A;  1D1I A;  5M3F B;  3T16 A;  4FVM A;  1DOL A;  1EU3 A;  2V4D A;  2RDF A;  1X3P A;  2J7Z A;  1IKM A;  4HCE A;  5EJW A;  3NTI A;  3I70 A;  2WP8 J;  3VR4 A;  2K03 A;  4ZKC B;  1W6K A;  5G3L D;  2PMZ B;  2RDG A;  1FNW A;  2AQ2 B;  2O5I C;  3MTS A;  4JK1 C;  1H9R A;  1C8C A;  1F9Q A;  1GUW A;  4XDX A;  1SE4 A;  4PQX A;  3OHX C;  4C3J B;  2C9O A;  4J6H A;  1I6V C;  5C0X J;  1LTI D;  5KIX A;  3T13 A;  3TDQ A;  5C0X H;  1NR2 A;  1BBX C;  2A69 D;  1HTL D;  1CHQ D;  1VDZ A;  3KLS A;  2ID0 A;  2PQE A;  1DZ1 A;  4IAL A;  4BBR B;  1Z47 A;  3T51 B;  1STH A;  2BCO A;  5EPK A;  1HFN A;  2NVX B;  1EFI D;  1WTO A;  2XSC A;  5M9O A;  5IGF A;  3FPP A;  3Q22 A;  2ZXR A;  3JAM E;  1SNO A;  2JEB I;  1PRT C;  4ZKB B;  3PIP 3;  1XX8 A;  2KCC A;  4ABN A;  1IYV A;  1JWU D;  1LTS D;  2XWJ B;  1I50 B;  1ILQ A;  2K04 A;  1I6H B;  3AU7 A;  2NTT A;  3LWE A;  3OIQ A;  3PUV A;  1JR0 D;  5IGD A;  2E2J B;  5E1F A;  1LTG D;  4CJ2 C;  3PMF A;  2F0W A;  3KUP A;  2SEB D;  2L11 A;  3FRP B;  1II3 A;  2N88 A;  3BYY B;  4ZUJ A;  2D9U A;  3ERO A;  4K6L A;  1CZG A;  5COY A;  4FNF A;  1A6X A;  1F77 A;  5LL6 S;  2NVQ B;  1EWH A;  1R4P B;  4X3K A;  1EL0 A;  4ZAI A;  3BVZ A;  3BG3 A;  2A69 C;  3HGB A;  1EY7 A;  1YNN C;  2EY2 A;  2X6L A;  4RH6 A;  3SK6 A;  1ESR A;  5JEA H;  1IYU A;  3MEH A;  1SMY C;  4C3H B;  5M3M B;  1RKN A;  3R8B A;  4LJZ C;  3X3N A;  3S1M B;  1M8A A;  2KVM A;  4B9W A;  2AUK A;  1LAB A;  1DYQ A;  4KJO A;  4F88 A;  2KEE A;  2L9H A;  2PZW A;  5K36 G;  4R8I A;  5IT9 E;  4IUQ A;  4TKO B;  5FO7 B;  2BA1 A;  3W2D A;  2JA8 B;  4K2L A;  3H91 A;  5HUR A;  3EQL C;  1X32 A;  2XNA C;  3P20 A;  4XQQ A;  4OGQ C;  3TSS A;  4KY6 A;  2B63 B;  4U68 A;  3VR6 A;  2B2T C;  4NW2 A;  5EKK A;  3CHB D;  4IUT A;  1ESF A;  5KYI A;  1GUT A;  1S5E D;  1G2T A;  2JA5 B;  5D65 A;  2B8G A;  1O7L A;  3ND9 A;  1A15 A;  5KEE A;  5EBD A;  1YNJ D;  1STE A;  1KNE A;  1J9O A;  1IKL A;  4C2M B;  3NK9 A;  2K5D A;  1F9S A;  3OW7 A;  2A74 C;  1CM9 A;  5I2X A;  5FKA C;  1MI2 A;  1JIC A;  2VXW A;  2EPB A;  1V1P B;  4N9T A;  2KUM A;  4L8J A;  2JEA I;  1U4L A;  2F0J A;  4KY7 A;  4L6T B;  1EIH A;  2WKC A;  1ONL A;  1TY0 A;  4KK7 A;  3S9W A;  4BY7 B;  2ZT9 C;  1PTO H;  2F0G A;  5C4Z A;  1HUM A;  4FP5 D;  3HOY B;  1UUP A;  2RQX A;  1HUN A;  4IUN A;  3VR2 A;  3C1E A;  3R93 A;  5CR3 A;  1RTO A;  4DGZ A;  2IX1 A;  5CV9 A;  4K8I A;  3C1F A;  1PTO B;  3P7J A;  5CV7 A;  4RA8 A;  3LX0 A;  1NCV A;  3BVG A;  4EQN A;  3A55 A;  2EE1 A;  1BDO A;  2B2U A;  3NSW A;  3S1Q B;  1CQV A;  1IW7 C;  5C4H A;  2J4X A;  2LY7 A;  3HG9 A;  4BBS B;  3RUZ A;  1WTW A;  3GV3 A;  3U9S A;  2B2W C;  1ENF A;  3L9A X;  1SE2 A;  3NWS A;  4DAV A;  2F0M A;  3K57 A;  2D5D A;  3T56 B;  1WVL A;  1LTA D;  3MXG A;  2YU9 B;  3IKJ A;  3OOC A;  2G9D A;  2RA4 A;  4A3K B;  4O42 A;  1JE4 A;  1PFB A;  1OXT A;  1TT2 A;  3MHB A;  2DNC A;  2K6A A;  3I72 A;  1KDB A;  2VUM B;  3D6W A;  1MSH A;  2F0V A;  1B2T A;  4Q0F A;  1MSG A;  3QJY A;  4RKB A;  1RD9 D;  2FIN B;  4C3H G;  3TN2 A;  1B53 A;  2Y0S B;  2RDH A;  3UI2 A;  5CBE E;  2PCF B;  4PMB A;  3KLS X;  1D5X C;  4HR7 B;  1H9K A;  2K05 A;  4XQN A;  5C0X G;  3D6C A;  4FYD A;  2F3V A;  5CGK A;  3KBX A;  3VYS A;  3WDN A;  2JYO A;  4IUU A;  1D5Z C;  2NUC A;  3A7A B;  1CA5 A;  3A8I E;  1BF4 A;  3VR3 A;  1TWA B;  2EYL A;  2F1M A;  1IHZ A;  2SNS A;  4DU9 A;  4DA2 A;  4XYQ A;  2FMC A;  1BQQ T;  4KKS A;  4OHJ A;  4IUR A;  3S1N B;  1V8Q A;  3HEJ A;  3J81 L;  1KAB A;  1BCP C;  3DM1 A;  4ZK9 B;  4A3I B;  1QG7 A;  2F03 A;  4OO1 I;  2IWH A;  5JJZ A;  4RFB A;  1MD2 D;  2IPK D;  5IGB A;  4FF3 A;  4I7Z C;  3MXU A;  2R93 B;  5ELD A;  5HGT A;  5E4X A;  1Q12 A;  1F2Y A;  4QCL A;  4ME5 A;  4PV1 C;  3C3L A;  1TWF B;  3FEW X;  4DXF A;  2JP1 A;  1XTC D;  3J7A V;  2F0Q A;  1DJR D;  1SYE A;  2O2L D;  3TZD A;  3MC0 B;  1Y1V B;  3GD7 A;  3QOL A;  4FXD A;  5DM7 3;  3NBI A;  2CW0 D;  4K5W A;  1L0X B;  5IOC A;  2LKV A;  4L63 B;  4DAY A;  2A6E C;  3FKI B;  1WCM B;  4F7X A;  4C3I G;  4HSP A;  1O7Y A;  1Q3L A;  3H0G B;  1K83 B;  3DWQ A;  5CMD A;  1ZEQ X;  4ODG A;  1EEI D;  3FMC A;  2BA0 A;  3D31 A;  4HTH A;  1ET9 A;  1SSO A;  3DEP A;  2VB2 X;  1QOH A;  2PYK A;  3K5O A;  3GTK B;  4DK1 A;  4O1N A;  2HQE A;  4ZRZ A;  4F8M A;  3CKI B;  1X3Q A;  3IL8 A;  1ILP A;  3S16 B;  4I65 A;  3I4M B;  3DUZ A;  2K7V A;  4A3J B;  2E74 C;  1EYC A;  3J80 E;  1OXU A;  4C56 C;  1SND A;  4DNT B;  2ENB A;  1UEA B;  4DFA A;  1S5D D;  1GUO A;  1HXY D;  2KHS A;  3OIP A;  2R3Z A;  4IFD I;  2EJM A;  1PDQ A;  4KTA A;  1SJE D;  2KQ3 A;  5JAV A;  1HPC A;  1BCP F;  1JWS D;  3MFY A;  3SK8 A;  1I4H A;  3GTO B;  1WD0 A;  2EYO A;  4G57 A;  2K33 A;  2BDO A;  2Z4I A;  1PRT F;  1O7Z A;  4KKU A;  4K5X A;  4KMU C;  3PO2 B;  2E75 C;  4X3T A;  1SBB B;  4KY5 A;  3I90 A;  4J1M A;  2EOT A;  4LAA A;  4R9W A;  3OSO A;  1VCI A;  1UNS A;  2CHB D;  2WKD A;  1HHV A;  4GZY C;  1B3A A;  3A8J E;  3I4L A;  1F2M A;  3O13 A;  5J22 A;  2B8F A;  3NXW A;  2PPB C;  3H94 A;  3G7L A;  2EY5 A;  3SDZ A;  1QIL A;  4ULL A;  3VA7 A;  2R61 A;  3FPU B;  2MP1 A;  2QDB A;  4RKL A;  1EY8 A;  5JPM C;  2HDM A;  3NTK A;  1D5M C;  3PO3 B;  4LK1 C;  3AMU A;  4RHR A;  4BA1 I;  3DMU A;  4QUC A;  3DWP A;  4KJN A;  3HS0 C;  1KTK A;  5C3E B;  3BZD B;  4IZ8 A;  2WB1 B;  1PMR A;  4HN7 A;  3ZYY X;  2F0L A;  4V0B A;  3ITP A;  1F2L A;  3SR1 A;  1XWE A;  2EYM A;  4M1U B;  2RSN A;  3PV0 A;  5IIF A;  2EYP A;  1NSN S;  1OXS C;  5IGG A;  4IQZ A;  3VYR A;  4IN3 A;  2A6H C;  1ENA A;  2F0H A;  2EY1 A;  1SYB A;  3IFD A;  2KOL A;  1SNP A;  1TKW B;  4QMG A;  1B9N A;  3NP8 A;  2PW5 A;  3QO2 A;  2Q8I B;  3IFT A;  2D2C C;  1SDF A;  4OIJ A;  1D2B A;  4K6D A;  1Q1B A;  4TRD A;  1T5E A;  4BS9 A;  3NUC A;  4C1N I;  1STY A;  4RGN A;  4IFD G;  4P2C B;  5CYU A;  1LT4 D;  5T1I A;  1Q90 A;  4RAU C;  2PZU A;  3DXJ C;  5KNB A;  2HDL A;  4HMJ A;  1V1P A;  4B9X A;  4HCS A;  2TSS A;  2IJ0 A;  4WOR A;  4ZLT F;  4KHZ A;  4UDU C;  4KI0 A;  1LTR D;  1QCB D;  2VNU D;  2AUJ D;  1EY0 A;  1H9J A;  3J80 L;  4WJW A;  2AWN A;  4K8J A;  1FGB D;  1GUS A;  1U4R A;  4KV6 A;  4PMW A;  5CV6 A;  5AFW A;  4XTC S;  1PZK D;  4FF2 A;  3OWE B;  1JCK B;  3PIO 3;  2PO4 A;  2EYJ A;  3I8Z A;  2E76 C;  1R9T B;  3V05 A;  2J0T D;  1XYI A;  2B39 A;  4J8Q A;  4NMZ A;  4F87 A;  1TWC B;  3HRZ C;  1KDA A;  1ML0 D;  1PTO D;  4NP5 A;  2EVB A;  2LS0 1;  1SNC A;  1B44 D;  4CHT B;  3I3C A;  1YNN D;  4RCN A;  4XQJ A;  3CU7 A;  4KD3 A;  3SE0 A;  3TP7 A;  2MGS A;  1Z6H A;  2DY7 A;  1FR3 A;  1G6Z A;  5C5M A;  3HOZ B;  4EQO A;  2PW7 A;  4EVO A;  1LO5 D;  4KHV A;  3OWF A;  3KLR A;  2OT2 A;  2EYH A;  1NR4 A;  4CKE A;  3J7A F;  1M4V A;  4QIW B;  3NTH A;  3R2I A;  3M4O B;  4RWS C;  2ZXO A;  3NWT A;  2QKI C;  1SYC A;  2M2L A;  4BWG B;  2A73 B;  2F0O A;  4OO1 G;  3GTG B;  5JEA G;  2MPM A;  2K5Q A;  3A8K E;  5ELF A;  2JA6 B;  1TS4 A;  1TVX A;  3F2U A;  2ICI A;  3M7N A;  2L1B A;  3WOE A;  3HOU B;  1UAP A;  3CQZ B;  4IUV A;  2NN6 I;  2ZXP A;  3SHL A;  3N52 A;  3NQT A;  4WRD A;  2K28 A;  4H0L C;  3M3Y B;  3A56 A;  1JOR A;  2XWB B;  2PNR C;  1D6E C;  3HOV B;  5DAU A;  1AW7 A;  2AQ1 B;  4IFD H;  1SMY D;  1GXD C;  4EGV A;  2QCP X;  1I3Q B;  3RMH A;  5EKI A;  3J81 E;  1DCZ A;  2E2H B;  1EY6 A;  1AZQ A;  2R6G A;  1GUN A;  1TQO A;  4ZUI A;  3BDO A;  5IT9 L;  2KED A;  5CBA E;  3V96 A;  3OPO A;  4A3M B;  5COR A;  5D3I B;  3R3O A;  1TWH B;  1JB3 A;  5M5X B;  1WTX A;  1LAC A;  1I4R A;  2CW0 C;  1EZ6 A;  5EQ0 A;  3GTL B;  5KRU A;  4A93 B;  1TR5 A;  2F0E A;  1K8O A;  3OMG A;  4QF4 A;  1LLR D;  1KLU D;  2LFN A;  1OXX K;  2EYF A;  2A6E D;  3AB9 A;  2L4N A;  5K36 H;  2B2V C;  2I07 B;  2EJF C;  3TME A;  3E5S A;  5FLX L;  2A68 D;  2B2U C;  4UAI A;  4R8N A;  2K32 A;  5IGE A;  3CRL C;  2X6G A;  2A68 C;  2I46 A;  1H9S A;  1HA5 A;  1CTM A;  1EY5 A;  5T1G A;  2XN9 C;  3BVM A;  2IT1 A;  3I91 A;  2QF7 A;  1CT1 D;  4BY1 B;  1JOO A;  4X3S A;  2K01 A;  5I6W A;  3PUX A;  1ROD A;  3GTJ B;  1DXM A;  4CJ1 B;  2VB3 X;  1PRT B;  1S5B D;  2F0F A;  1I4Q A;  5I9O A;  1AFP A;  1BCP D;  1HCZ A;  1STB A;  1G29 1;  4U67 3;  4KN4 C;  3T53 B;  5I9P A;  1QB5 D;  2QIL A;  3HKZ B;  2O5J C;  3S15 B;  3D3R A;  4BA2 I;  1RTN A;  3FDT A;  3W3A A;  1BUV T;  1E2Z A;  5ELB A;  1G91 A;  2X69 A;  1I4G A;  3H6M A;  1U4P A;  2DY8 A;  3Q0A A;  3U9O A;  4CKC A;  1ET6 A;  1T5X D;  5G3L F;  1LT5 D;  1EU4 A;  2XVS A;  1E0B A;  1AEX A;  1FNU A;  4B08 A;  4CJ0 B;  2HUG A;  2B2T A;  2B2V A;  2G9H D;  1CA6 A;  3K6O A;  5EPL A;  1ENC A;  1CK1 A;  1STG A;  2WIN B;  2CQA A;  1A3U A;  5EBC A;  2ICE C;  1S5F D;  4DNR B;  3E6Z X;  1VMP A;  1VMC A;  2LMC B;  2Z1C A;  2TMP A;  1WD1 A;  3SXH A;  1Q8I A;  2K1B A;  4ID6 A;  2WAC A;  3G6J B;  5FO9 B;  1G2S A;  3HOW B;  2M00 A;  3TP8 A;  3PUZ A;  5JVH 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...