1F9RA

Crystal structure of platelet factor 4 mutant 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
total genus 8
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9rA00
2FMMA 2B2WC 5COYA 1EOTA 1G6ZA 4IUQA 3G7LA 1BO0A 3HP3A 2L9HA 3I8ZA 1BF4A 1O7YA 1XX8A 3KBXA 1TVXA 3TZDA 1ICWA 5CBAE 2JYOA 4NW2A 5E4XA 4CJ0B 2NWGA 4RA8A 1BNZA 1NCVA 1RHPA 2B2YC 2K1BA 4IUTA 4UAIA 2CVRA 1F9QA 3KUPA 2L4NA 5T1GA 1C8CA 2HDMA 2DY8A 5CORA 1O80A 1X3PA 1X3QA 2IL8A 1SAPA 4ZLTF 3F2UA 2HCCA 1U4RA 2DY7A 1WD1A 2FFKB 2XIWA 1IKLA 4XDXA 1IL8A 1U4PA 2EOTA 1S4ZA 1ZXTA 2B2VC 1SSOA 1WVLA 2L12A 1DOKA 1VMPA 1WTQA 3IL8A 1RODA 1HA6A 1NR2A 1G2SA 2N55A 2D9UA 1F9RA 1U4LA 3D6WA 1KNEA 2K04A 4HSVA 5JJZA 3UI2A 1PDQA 1AZPA 5D65A 1AP0A 4ZKBB 1HUNA 2FINB 5DNFA 5CMDA 1MGSA 2FJ2A 5EQ0A 1LV9A 5T1IA 1J9OA 2KVMA 3DEOA 1F2LA 1IKMA 1MSHA 2B2UA 3FPUB 2M2LA 2KEDA 2B2WA 1PFBA 4O42A 4XT1B 1PFMA 2J7ZA 2N88A 1WTPA 1BBXC 1F9PA 4X3UA 2B2TC 3I90A 3LWEA 5CBEE 4XT3B 4X3SA 5D14A 1Q3LA 1RTOA 2MPMA 2NYZD 2RVLA 1B3AA 4OIJA 4HEDA 1O7ZA 1CM9A 1RJTA 3I3CA 1E0BA 3MTSA 5EPKA 4QUFA 1HHVA 4OIKA 1MSGA 2L1BA 2BDNA 1HFGA 3Q6SA 4IUUA 1WTOA 4X3KA 1WTVA 2R3ZA 1G2TA 2HUGA 1QE6A 4CJ1B 4IUVA 1SDFA 4ZKCB 2KECA 2RA4A 1DOLA 1JE4A 3IFDA 4QUCA 1KNAA 1EQTA 2JP1A 1U4MA 2L11A 2RSNA 2SDFA 3P7JA 3I91A 5E4WC 1AZQA 1B50A 1RTNA 3R93A 4MHEA 5AFWA 4IURA 2X69A 4ZK9B 1J8IA 2B2VA 4MN3A 2EE1A 1DOMA 1NR4A 3GV3A 3MWYW 1HUMA 4R9WA 1EL0A 1G91A 2MJ8A 5EJWA 1VMCA 5EPJA 3QO2A 1NAPA 2K01A 4RWSC 1QG7A 2VXWA 4CJ2C 4U68A 2MGSA 1CA6A 4X3TA 1A15A 1PFNA 2B2YA 2B2UC 1ILPA 2KOLA 3FDTA 3TN2A 2X6LA 2H1EA 2MP1A 1ML0D 2FHTA 1ILQA 1MI2A 4HAEA 4HCSA 2EPBA 4LMQD 2Q8TA 2B2TA 1JICA 1HRJA 2HCIA 3N52A 2X6GA 1X32A 5EKIA 3DM1A 3DEPA 2K03A 1WTWA 1WTXA 2Q8RE 2HDLA 3ONAB 1CA5A 1EIHA 1WD0A 1ESRA 4R8IA 1DZ1A 1B4OA 4IUPA 4ZAIA 2KUMA 1HFNA 1EIGA 3GV6A 1WTRA 2K28A 1B53A 2K05A 1PLFA 4RAUC 1DONA 1GUWA 3SVMA 1QNKA 2NZ1D 2RSOA 5EPLA 1M8AA 3H91A 2KEEA 4DN4M 1F9SA 1XYIA 1B2TA
chains in the Genus database with same CATH superfamily
2E2DC 1A2TA 3HKSA 2K32A 5F2DA 3PIP3 3TZDA 2VQEQ 4ILWA 2N8NA 1RHPA 4IUTA 1X3FA 3HOXB 3J7AV 1MIUA 5D3DA 2MFIA 4B9XA 4IO9A 3PO3H 1QCBD 1WTHA 1VQBA 4A3CG 4PZ6A 1PVOA 2DY7A 3KBGA 1QUQA 2WKCA 2HD3A 2JEAI 3G6EA 4DR5Q 1I94Q 2RBMA 4A3IB 1VQFA 3SK5A 4X64Q 3CCEA 4DV4Q 3IL8A 3S9WA 1NR2A 5H1SE 3H09A 4LF5L 2JA5B 3FRPB 2CCZA 3DEOA 3W2DA 1HR0Q 4K8JA 3UDFA 1IYJB 3QR8A 2JJQA 3DWAA 4DR6L 1YI2A 3QIAA 4CDCC 2A6HD 4X65Q 3LWEA 1WFQA 4JI5L 1VQDA 1VQCA 4RGNA 2OEOA 1DOLA 2EJGC 2KHIA 1CQVA 3HFZB 1W3SA 2K75A 2H4OA 3KLRA 1EZ8A 3P20A 3HOVB 1C48A 1MJEA 1C4QA 3URYA 5I9OA 4HMJA 2ZXRA 1OXXK 3MWYW 1FNVA 1A3TA 5BN4A 3PIPA 4EVOA 4UP7A 1CKMA 4DXGA 4JI0L 3M4YA 3V2TA 2ZTEA 2Q2HA 2N49A 4ABNA 1K8MA 3NXWA 2PNRC 1EY9A 3M85A 3BVGA 4E6IA 4IZ8A 4HJ7A 5M3FH 4LW1A 3J80c 2CW0C 5C3WA 4JI1L 2SNSA 2I0QA 2ICEC 3BU2A 4ZAIA 2AMCB 1XMQQ 1KD1C 4LF7Q 2F4IA 4ZRZA 2WAQG 3NWSA 4BXXG 5HURA 1FD7D 2E2HH 4HIDA 1EEFD 5C4ZA 1T5XD 4CBVA 1EY4A 4A93G 4NXML 1F9SA 1SE4A 1XYIA 1YBYA 4KKUA 4KHVA 1CZWA 1GM5A 3AEVA 4JBJA 1JC7A 3CPFA 1VQAA 3OIPA 5E4XA 1BNZA 1AEXA 4KJNA 5IP7G 1EWHA 1JCKB 1S3OA 1D1KA 4BA1I 3G4SA 1LT5D 4LFAQ 3HOXH 1X3QA 3AB9A 3F2UA 1PV4A 3EFXD 4GN3B 2SNMA 2ZM6L 3A0JA 3HOZB 2VB3X 1TWFB 1MHWC 2QCPX 1OO9B 4LUZA 4GZYC 1L0WA 3VDYA 3EQLC 4A3IH 1R4QB 3BYTB 4OXPA 4BY1B 4DV3Q 3S2HB 4P75A 4LF8L 1HNZL 2JA5H 1UNSA 3E9HA 1A63A 2XTIA 2KHJA 4H7BA 1KRTA 1VQGA 2EDGA 4AIMA 1PH8A 2UUCQ 2F0UA 3SDZA 1D6EC 5C0XG 2ZXPA 1G51A 2B63G 1STHA 4JI2Q 4ALPA 3NTKA 2SDFA 2E2JB 2K5VA 2O4XA 5BR8Q 4IURA 1KRSA 4TSSA 4OWWB 4NDXA 1B9NA 4KD4A 3HOVH 1K0RA 2WV6D 3OW2A 2FXQA 3QO2A 1LM0A 1NAPA 2IJ0A 2RHSB 4N8X1 4DV0Q 3FDTA 3L0OA 3BZCA 1A3UA 2QA4A 1MI2A 4A3LH 5IOCA 4FF2A 3TQYA 3M7NA 4KV6A 4DUYQ 1AE2A 1EQVA 1NMGA 3ONAB 3J7ZC 2F3WA 3F2DA 1NUCA 2EJMA 1Y8NB 1LACA 1S5BD 4YCUA 4YWLA 3EN2A 3MXNB 2CWPA 3ER0A 1XXGA 5GAHC 3RN2A 4WJ3M 1I4GA 1SNDA 5DEHA 4XYQA 1CKOA 1EOTA 4RH6A 4IPHA 2KCCA 4ULLA 1S5FD 1O7YA 5LL6S 1S72A 4L5RC 1F2ZA 2JYOA 1NCVA 4NMZA 4DPGA 3TP7A 2CVRA 3RNUA 4A3DG 5ELEA 3S1NB 1LTLA 3CW2C 2KHSA 2VL6A 1VQ6A 2FMCA 2ZTCA 2L55A 3VR4A 1LT3D 1X3PA 4FF1A 5I4DA 2PI2E 4H13C 2NN6H 3HOUG 1Y1VG 1U4PA 4DR1L 1K3BC 4LUOA 1TKWB 1J6QA 1V43A 1HZAA 1S40A 1B44D 3OWEB 2CHBD 3HOZH 4GOPB 3LWUA 4HTHA 4Y52H 1TWFH 4DKAC 1XTDA 3MVVA 1CSQA 1EQRA 1F2LA 4F8MA 3NQIA 1ZEQX 1I4XA 1SNQA 4BY1H 2F4VL 2DGYA 3S2HH 1M90C 3SK4A 3I90A 5LMNQ 1XNRL 3DWQA 2B39A 1GUNA 1JOKA 1PH1A 1ENFA 1EY6A 4GN4B 4X3KA 2GN5A 1YHBA 1SDFA 3DMUA 1MBYA 1O78A 3IFDA 5IGBA 5L37A 4JC0A 4RHSA 5HY6A 1P16A 1FJGL 3PUVA 4LF9Q 1PH2A 5AFWA 3W3AA 1IL2A 2CH4W 5J1ZA 3TMEA 4B3SQ 5JEAJ 4NPSA 4GOPC 4J8QA 4C1NI 3PV0A 1OXVA 2E2JH 4JBKA 3K8AA 1QVGA 2VXWA 2A68D 2HQEA 1JB3A 2MP1A 4POFA 1F2MA 2EJFC 4KMUC 5I2YA 3U9OA 3PF4A 2X6GA 5EKIA 2P5ZX 1HZBA 4BBRG 4UY8C 2PZUA 3FVQA 1PXUA 2E2IB 2NTSA 4LNQA 1DM0B 3PUXA 3I4MB 2WFWA 3RLNA 2PNHA 2HIXA 3MXNA 1PLFA 1NTGA 5IODA 4A3KG 2ENBA 1SYCA 2F0IA 2NZOA 2F0HA 1SNMA 3NSWA 1SYFA 1VF5C 2KQ3A 5KRUA 3H15A 2KENA 4KN7C 4NW2A 5I6WA 1IBML 3F1ZA 1H9KA 3NWTA 3H6MA 3NPPA 1RKNA 5C4XG 1SLJA 2K14A 1B70B 4JG2A 1FNUA 2IPKD 3S1NH 4B08A 1U5KA 1HQMC 2FFKB 3CCJA 4FO2A 2LSSA 4QJFA 1W6KA 3BDCA 1EWCA 5JOBA 1VQKA 3PGZA 3KYHC 1X65A 3A8JE 5AJ3L 4FXKC 2MO1A 5CC4A 3S2DB 4GOPA 2D9UA 3HZXA 1LABA 2ALYB 4ZKBB 5DNFA 1B3QA 2F3VA 2VQEL 3D4WA 1IKMA 1I4QA 2B8FA 3PUWA 4O42A 1X56A 3HS0C 1PH4A 2RDHA 1NY4A 3K0YA 2M00A 1N36Q 2F3IA 4B3RQ 2NYZD 3NBHA 4N9TA 5T1IA 3PUYA 4DGZA 4L5TA 4JI3Q 4R4TA 1HNWQ 3K80C 2AQ1B 1IBLQ 4DR5L 1I94L 1QVFA 2A6HC 4X64L 4DV4L 4JBMA 3LNNA 3CD6A 4YWMA 2OQKA 2KCTA 3TP6A 1K0SA 2OCEA 3JAML 3GV3A 5IT9c 2EXDA 1HR0L 1R9TB 2F03A 4KTAA 1FYCA 1BKBA 4ME3A 4X65L 1AE3A 3MXGA 5FJ8G 2BE5C 4LMQD 1X9NA 2JA6B 2JA8B 1EEID 2F0WA 1HZCA 1X32A 1JJ2A 2AWNA 1X55A 1LTGD 1LTTD 3HRZC 1BVSA 3T13A 1EIGA 3M9BA 2NUCA 2F0VA 3MXUA 2EYFA 5GQOA 3FPPA 2K5NA 2E2IH 3PO2B 4DFAA 3I4MH 4MZ9A 2K50A 4IJHA 4GS3A 4QF4A 2EY2A 3OHXC 2Z8LA 1SRUA 1KDCA 3LGJA 3S1QB 2MO0A 4A4IA 1C0AA 2IWHA 3CQZB 2AQ3B 2E76C 4H02A 1D7QA 1C8CA 1XMQL 4G7OC 1GOZA 2DY8A 4LF7L 4JK1C 1XPUA 3GTQB 1BBWA 1S4ZA 4IPGA 5JEAG 4R4OA 4IN3A 4YHHQ 3D6WA 2GVBA 2D62A 4C3HG 5JJZA 1K8GA 5D65A 2EY6A 2JSOA 2QW7A 4A3MG 3TZUA 1RDPD 5M9OA 3S2DH 1QILA 1Q8KA 3FPUB 2F4VQ 5HGQA 3GTGB 2XRSD 5M5YB 3CXCA 1EFID 1Q82C 2MPMA 3EROA 3T56B 4LFAL 3MTSA 3U9SA 3T16A 2LFNA 1YHQA 1K8AC 4XTCS 3VYSA 4GNXC 1X3EA 3QOJA 1UE1A 2E75C 3STBD 2D5DA 5C44B 3NTIA 1H95A 3CRLC 2XGTA 4KN4C 1DXMA 1AZQA 1EY7A 1STBA 5IP9G 1EYAA 2A5HA 4DV3L 4A3GB 4DU9A 4C3JG 4I7ZC 3G6JB 5EJWA 3D6CA 1I4HA 3JAME 2F0MA 1PYWD 5IGFA 3E3XA 5IYBH 1YHAA 1CHQD 3CU7A 3RLFA 1R9TH 2LMCB 1A15A 2UUCL 5IGGA 2OF1A 2YU9B 1ILQA 1EYGA 5GADC 4FP5D 1EU3A 2R93B 4DR4Q 2N78A 4JI2L 1L0YB 4LK1C 1IZ6A 1YITA 4PMWA 2HDLA 3HG9A 2QILA 2JA6H 2JA8H 4DR3Q 1ESRA 1DZ1A 3GP7A 2AWOA 3CRKC 3PQIA 1OXTA 4CDDC 1Q1EA 4IFDI 5BR8L 2TSSA 3D8GA 4QGUA 1ZKOA 5EAYA 1SJED 1LO5D 3ND8A 2I5HA 1EFWA 1E3PA 1PTOD 2YV5A 1YNJD 2UU9L 3PO2H 1B2TA 1OXSC 1G6ZA 2QEXA 4DV0L 1M4VA 2EYLA 4FDBA 2BOSA 1TWHB 1IBMQ 4Q0FA 2ZXOA 3I4NH 3TRZA 2R7ZG 1SMXA 2K1BA 4LF4Q 4P72A 3SR1A 3VR2A 4DUYL 4YCWA 4C2MB 2VW9A 2RCFA 3S1QH 1W6JA 1UEAB 3CQZH 3AU7A 1CTMA 1GD7A 2EOTA 1DD2A 2HIVA 3GTQH 2IHEA 1HA6A 3VA7A 1KNEA 1AZPA 4A3BB 1KTKA 1HUNA 1TXYA 3TEHB 3KOJA 1K9MC 4JCVE 1YEZA 3J80L 4RG1A 2N88A 4BY7G 1TT2A 3MA2B 5CR3A 3BVMA 1KHIA 3C2PA 1A3VA 1GUTA 1Q3LA 1YIJA 3FKIG 3VYUA 3GTGH 1HHVA 3Q23A 5M5YH 1G2TA 2F0KA 2D0PA 4HN7A 2GVAA 5FO9B 3E5SA 2PO4A 3D4DA 2UXCQ 2JA7G 2HT1A 3VA5A 3F2CA 5GAEC 2PQEA 1E1OA 3CCUA 5JAVA 4IFDJ 3T1YQ 2X69A 1X54A 3CCMA 5C44H 1DOMA 4XQNA 4FF3A 4DK0A 3M4QA 1EWIA 2AQ2B 2EYJA 4A3GH 5LMNL 1CA6A 3NUCA 1FNWA 4PG3A 2Q8IB 3AYHB 3TN2A 1LTBD 1NMFA 2IX3A 1LUZA 3M4OB 1ML0D 2FHTA 4WORA 3CC7A 4K14A 4JI7Q 4UDUC 1YJWA 2PCFB 3GTKB 1W2BA 4A3JG 3N52A 5A2QL 2YU9H 2A68C 1XNQQ 3GDEA 1Z9FA 2R93H 4F88A 3GV6A 2HQLA 3TSSA 1XWEA 3NHHA 4LF9L 1TWGB 4PV1C 3BDLA 3HOVG 3SVMA 3UE0A 1I3QB 4B3SL 1JWSD 3U4ZA 1RD9D 3T1HQ 4QL5A 4RCOA 4HJ8A 2OTJA 1E7ZA 4I65A 2NVTB 3A55A 3I73A 4DR7Q 5C4JB 4CJ0B 4RA8A 2YTYA 5FLXL 1SROA 1SE8A 1I6HB 3L9AX 1TWHH 3L3OC 2IX0A 4PZ7A 1JWUD 4K2KA 2F0SA 2HDMA 4EGVA 5IIFA 4J6HA 5IYCH 4OO1H 3TP5A 4C2MH 1Y14B 2CQOA 4ZUJA 1SNCA 3A7LA 4RHRA 4B3TL 1Q12A 1YJNA 5K36G 3VR6A 4KD3A 1STAA 1AW7A 2Z6BA 1Q1BA 1J9OA 1UWVA 2PPBC 4A93B 4PNYA 4A3BH 2PYKA 1IW7D 3NE5B 4X6AH 5D14A 3J80E 1BCPD 4QUFA 5JVH3 1D5XC 3EJIA 4N8FA 1EQQA 4QQBX 1WTVA 3RUZA 3NELA 3H3VH 4A3EG 3W5OA 1EYCA 3J81i 2G9DA 2NTTA 3HOYG 3W1BA 1KXLA 3MEFA 3HOZG 2R7FA 3R93A 4MHEA 1SYEA 3RLOA 5E7NA 4A3CH 1HUMA 1EYDA 1WCMG 4OWTB 3H0GG 3NQTA 4BBSG 1QG7A 2L15A 1MKHA 2B2UC 1N36L 4B3RL 3UE1A 5FLXc 1HRJA 2R92G 2EPBA 4JI3L 2Q8TA 1HNWL 3PCOB 2JXMB 1IBLL 3M4OH 3DM1A 1LLRD 3I2ZA 3NTHA 4OL7A 1VQ7A 3ND9A 3GTKH 3RMHA 5A2QE 1N9WA 2B63B 1V9PA 4QCLA 1HA5A 2EZVA 2K7VA 2JEBI 3PMFA 4RAUC 2XWJB 4JI8Q 1NNXA 2A6ED 1CKNB 2RSOA 5EPLA 2K4KA 4BS9A 2UU9Q 3H91A 1TWGH 1H9RA 1I3QH 1Q86C 1SJHD 2VUMG 1P8LA 3KBXA 1VQ5A 2B2YC 4K2LA 3OMGA 3F2BA 1EY8A 4PZ8A 2NVTH 1DJRD 3CHBD 4AQYQ 5C4JH 3MXPA 2KCMA 1TU2B 1I6HH 4IFDG 4LF6Q 4CDEC 3X3MA 2Q2IA 1IL8A 2DJGC 3S1RB 1GO3E 2IW3A 2G5DA 4WFN3 2J4XA 5CV9A 2QF7A 1YNND 4DR2Q 2Y0SG 2FINB 3QOLA 1HH2P 1VQHA 1FR3A 2B2UA 3U58A 3E0JA 4X3UA 4A93H 3GD7A 5C3XA 5TSSA 5EPKA 1JR0D 1QWYA 3AQQA 4A3DB 1VF7A 1QE6A 2YYZA 1LT6D 2KECA 2RA4A 3KLSX 1SNOA 3WOFA 4DV2Q 3I91A 1PH6A 3RZDB 4YHHL 3HOUB 1Y1VB 1J8IA 2B2VA 3QB3A 3CKIB 3I70A 5C3EG 1EL0A 1II3A 2UXDQ 2DNEA 3STBC 4WJ4A 4CJ2C 1VQJA 1I50B 2B2YA 3C1FA 3D4RA 4R4QA 3I56A 3NBHB 2IHFA 2PW7A 2I5MX 1G291 1PTOB 2ID0A 3KJPA 5IE8A 2HCIA 4G7HC 3DEPA 4ZQ3A 1WTWA 2CQAA 4LUVA 2UUBQ 1SNPA 4AYBB 1STGA 5E1FA 5FLMG 3CCVA 2KUMA 1B53A 2JE6I 3HOWG 4C3IG 3HKZG 4EQOA 1GXDC 1CKNA 2F0DA 5C0XH 4DV5Q 3DXJC 1L2FA 2O5IC 2B63H 4B9WA 4GKKQ 4DAVA 2NZ1D 2PMZB 3NP8A 1TS5A 1TS3A 3OWFA 3I4OA 3S17B 1HZ9A 4YIJA 1PYBA 1N8RC 4IUQA 1ENCA 1BO0A 3I8ZA 3CC4A 2BCOA 5LHY1 1D8LA 1PMRA 5KNCA 5IWAQ 1BCPF 4O1NA 2NWGA 3P1HA 1SEBD 2A73B 2Z6KA 1STNA 2CKZB 2VS1A 1CHPD 1PTOC 3Q8DA 4DR4L 4X66Q 1KLUD 1YNJC 4DV1Q 1HTPA 2L4NA 3VR3A 4M1UB 5ISRA 2RKSA 4CGYB 2XNAC 5T1GA 4HJ5A 4DR3L 1I4RA 4DV7Q 1BXTA 1SAPA 4ODGA 4BBRB 2EVBA 1B7YB 2JA9A 1SMYD 5IT9L 4B3TQ 4GKJQ 1LYLA 5EGTA 4DNIA 1UE6A 5JJLA 2F0OA 3I4MG 1MJCA 4UP9A 1VMPA 1WTQA 1WOCA 4UPAA 5HGTA 3A74A 1TR5A 3KLWA 4OWXB 1ICFB 4DA2A 1K83B 4HSVA 3S1RH 1PDQA 1ENAA 4PMCA 4NXNQ 5LMUQ 4A3KB 1GJXA 3BG3A 3K6OA 2M2LA 2B2WA 1PFBA 3QJYA 4LF4L 3MFGA 4XT1B 2A19A 1T9HA 1K73C 4HJAA 3U4VA 4POGA 2K52A 4JOIA 3BZDB 4GLAC 1RJTA 2NVXB 1BOSA 5EBCA 1SFOB 2SOBA 4IJLA 3HEJA 5CV4A 5C4XB 1JJGA 2ZJRA 1G8ZD 1D5MC 1LTRD 4LAAA 4A3DH 3CF5A 1UE7A 1D5ZC 2MUYA 4ME5A 1GHKA 1TWAB 2OQ0A 3BZKA 3EBEA 3RZDH 3HOUH 1VMCA 1Y1VH 5EPJA 4CDFC 5M5XB 1TIID 4YWKA 2N3SA 3B6YA 1CK1A 4KLKA 4NB3A 2B2TA 1JICA 3OMCA 1I50H 4HIOA 4K5XA 1K8OA 1PTOH 2UXCL 3QWNA 1LTSD 2IX1A 2Z4IA 3BS1A 2UXBQ 4TKOB 1WTRA 2RHQB 5EKKA 3T1YL 5J22A 3QG1A 4JYAL 4IPCA 4Y7NB 1GUOA 3C1EA 2LKVA 4L63B 4APVA 4FNFA 1Y1WG 4RMFA 2A74C 5COYA 5M3MG 4L6TB 4OEMB 3S17H 4Q5VA 2O2LD 4JI7L 4JVZA 3PUZA 3MAQA 1KAAA 1KL9A 4MTNA 4NP5A 1PRTD 2OT2A 1XNQL 2JA8G 3OTOL 3VYRA 4HR7B 1A62A 4DK3C 4OHJA 4X62Q 1VQ8A 4ZCKA 4CKCA 1JOQA 4L5QA 4XDXA 4V0BA 1O7IA 1VQEA 4JW0A 1BCPB 4A3FG 3I4NB 1TY0A 1VCIA 3T1HL 4BBRH 5IT9E 1XPRA 1SYBA 3PO2G 4DNRB 5FOBB 4MNOA 5CGKA 4JI6Q 1JT8A 1A6XA 2D0OA 2FJ2A 4LFBQ 5ELNA 1LV9A 5EQ0A 5IYDG 1B9MA 1K83H 4DR7L 2E74C 4P71A 1IBKQ 4A3KH 3E0EA 2F0EA 2A8VA 2H5XA 2EY1A 5E3FA 1RTOA 4QY7A 2QKIC 4IUNA 2XWBB 2NN6I 4HMIA 1MSGA 2L1BA 3Q24A 1IYUA 2UUAQ 2R3ZA 2DN8A 5BN3A 1S5ED 2NVXH 1SFOH 4C1NK 1L1OB 5E4WC 1CQFA 1BCPC 5C4XH 1QZGA 1T5EA 3NENA 1H9SB 4MN3A 1TWCB 3CCRA 1VQLA 4C3HB 2EIFA 1TWAH 2NVYB 4RKBA 3PO3G 4A3MB 3UDGA 2KOLA 5M5XH 2X6LA 1PH7A 2E5LQ 5C4HA 4DUZQ 1D2BA 4TRDA 1NE3A 3S16B 1FGUA 3M7GA 2QDBA 3GTPB 3CC2A 1I4PA 3FMCA 1ZYRD 4R8IA 3J81j 1E1TA 2ICIA 4P2CB 1HQRD 1XTCD 2K28A 4C56C 2K05A 4JBWA 3TREA 5J3BA 5DM73 4BWGB 4V190 1NSNS 1E22A 1LTID 3VR5A 1XPOA 1OTCA 2YTXA 4Y7NH 1A0IA 3AFPA 1XMOQ 4C3JB 3JC66 3NEMA 3J81c 1TVXA 2OXPA 1ICWA 1RCVD 4TVAB 5M5WB 3BDOA 3ERSX 2A69D 3AFQA 4LFCL 2IT1A 2R93G 2BH2A 1I5FA 5FJ8H 3K59A 3C46A 1U4RA 3A54A 4EX5A 4KY7A 2PZWA 4L8JA 5KYLA 4JI8L 1CFMA 1SSOA 1IYVA 2WB1B 5IY0A 3RD4A 4GLXA 1MGSA 4PQXA 5M3FG 2WKDA 2F0QA 2KEDA 5CV8A 1KABA 1FVIA 1PFMA 4AYBE 5DLQE 5CBEE 4WJWA 5GAGC 4AQYL 4G57A 4BA2I 2ASBA 2DJFC 2RVLA 2R7ZB 1TS2A 1O7ZA 2M9VA 2NB0A 5IYCG 1A2UA 1HFGA 4LF6L 2PMZE 2HUGA 4CJ1B 1L1OA 4ZKCB 1JE4A 1SE2A 4R8NA 5KIXA 1U4MA 3MFYA 1H9SA 4M8AA 3ICEA 2C9OA 3O13A 4DR2L 2ZTDA 3PF5A 4FYDA 1H9JA 3ITPA 1B8AA 4A3BG 1JE5A 1N32L 1Y69U 3G48A 2K01A 5JEAH 4U68A 3HOXG 1TWCH 4HSPA 1PRTF 1A8VA 2VNUD 2AHOB 4C3HH 1Z6HA 3S1MB 2NVYH 2AUJD 1JQYD 4HAEA 4HCSA 3DHQA 3SGIA 4A3MH 4BY7B 5IGEA 4MTKA 1WTXA 4H44C 3FKIB 5DAUA 3ULJA 4DV2L 4A3IG 3S16H 1Q81C 3R8BA 2BDOA 1YZ6A 3GTPH 4JYAQ 1KC8C 4RGOS 2JA5G 2RDFA 2JA7B 2JQOA 1SYGA 1EY5A 2UXDL 5CV7A 1N34Q 2NVQB 3LX0A 3TBIB 1PZKD 3H3VC 4P73A 1BF4A 4DAYB 4EQPA 1EIYB 5IP9H 1JJCB 1R4PB 4C3JH 4HIMA 3OTOQ 4CKBA 2UUBL 5M5WH 2K6AA 5CORA 4A3JB 1PH3A 3SK6A 2VQFQ 4DF7A 1E2VA 3ULPA 4K8IA 4DV5L 4GKKL 3K58A 1PH9A 4QB4A 2KA7A 3I72A 1DOKA 2CFMA 3DM3A 1SE3A 3UI2A 3C3LA 5NUCA 4A3LG 3SHLA 5IWAL 2BE5D 4FF4A 4KJOA 1PZJD 1SMYC 2B8GA 2PI2A 2R6GA 5DM63 3RZOB 1IHZA 1E2ZA 3VYTA 4X66L 3GTMB 4DV1L 1F2YA 2DUDA 3KDFB 3KF8B 5JPMC 1AN8A 1E0BA 3BJUA 4DV7L 4HJ9A 2Q2TA 4OIKA 4IUUA 1WTOA 3E6ZX 3E9IA 2KCNA 3JAMi 4NKLA 4GKJL 2R7ZH 2EXZA 1QJOA 2WAQB 1SR3A 2V4DA 1EQTA 1JOOA 2L11A 3P7JA 4ZUIA 4PMBA 1GVPA 1RTNA 1F77A 4B3MQ 2L0CA 4NXNL 5IGDA 5LMUL 3X3NA 2EE1A 2WP8J 3S15B 4KI0A 2MJ8A 1PZID 1STEA 2QEJC 4OELB 2HHHQ 3HGBA 4KK7A 3IFTA 3K0XA 1RIPA 5KNDA 3GTJB 1YVCA 3SK8A 2NN6G 1X3GA 3WWVA 1PTOF 3S1MH 4LJZC 2ES2A 2RDGA 4BY7H 1CZGA 5FKAC 2K5HA 3FHWA 5I9PA 1YJ9A 2K5DA 4A3EB 4KHZA 3FKIH 2F52A 1ASYA 3HOYB 1PRTB 2QGQA 1J5EQ 1DONA 1GUWA 4BY1G 3KK7A 3A5ZB 4K0KQ 4QMGA 4EQNA 3FP9A 1BQQT 2JA7H 4UP8A 1G6PA 1UE5A 4DAYA 1WCMB 3A7AB 1QNUA 2XSCA 4DXFA 4XQJA 4A75A 3H0GB 2NVQH 4JV5Q 5CBAE 4A76A 4BBSB 2JK8A 3WDNA 4IALA 4KHPQ 1UAPA 2K33A 2MHVA 4LFCQ 1X6OA 1KAWA 2C35B 2R92B 1HJPA 4O0AA 3KLSA 1JMCA 2UXBL 1SN8A 5J39A 1PA6A 4YY3Q 2F0PA 4R4CA 2ZJQA 1KLGD 1IKLA 5JJIA 3RN5A 1V1PB 2XN9C 5CYUA 1AH9A 4A3JH 1V8QA 1D1IA 2B2VC 1WVLA 2WACA 1PRTC 2NBFA 1RODA 1G2SA 1F9RA 2K04A 1ESFA 4K6DA 4R4IA 4YCVA 3K7AB 2TMPA 4XQQA 3CCLA 3N6RA 3KDFA 2LXKA 2QDLA 4F87A 1BBXC 1N33Q 1KDBA 3KF8A 4XXEA 5FLXE 2VUMB 2O5JC 2LXJA 4XT3B 5CV5A 1QZHA 2I07B 4OX9Q 3RZOH 4IQZA 1L0XB 4HEDA 2XRQD 1CM9A 1U9RA 1VQPA 3GTMH 1FL0A 4X62L 1H9MA 4JI4Q 1KNAA 1CT1D 1QVCA 2CWAA 2JP1A 3Q22A 5KEEA 3DLLA 1HCZA 1IXRA 1QB5D 1EUJA 4K6LA 1DCZA 4JI6L 4BXXH 1NR4A 3S14B 4LFBL 1N32Q 3W1GA 1HPCA 4DV6Q 1EU4A 2EYMA 1U0LA 4OGQC 2ZJPA 1IBKL 3J7AF 2ZT9C 4FXDA 2Y0SB 3S15H 4X3TA 1C9OA 1PFNA 2Z6KC 3H94A 4O2DA 5K36H 3ULLA 2F1MA 5IGCA 2OWOA 4DNTB 2UUAL 4HIKA 3GTJH 2WB1E 1EY0A 1EZ6A 4FVMA 5IP7H 2K03A 5ELOA 3MZ5A 4G7ZC 1BR9A 1CI3M 2LY7A 4EQ5A 1CSPA 3EA6A 2RCNA 5GROA 3GTLB 5FK9C 2PQAB 2Z9HA 2E8GA 4P74A 5BN5A 4A3EH 1ZYRC 4LF5Q 2KBNA 2WIIB 3DUZA 3HOYH 2B2WC 2NZHA 5C3EB 3HP3A 2L9HA 3Q0AA 2E5LL 4DUZL 2I46A 3I7FA 2PZTA 4JOIC 1WCMH 2BA0A 4DR6Q 4KY5A 5C5MA 3H0GH 3R3OA 1I6VC 4BBSH 1NBWA 2CH4A 4JI5Q 4QIWB 1V1PA 4TQUS 2HCCA 5ELBA 4AYBG 1TY2A 2BH8A 4IPDA 2R92H 4K5WA 3KF6B 2A69C 3K7UC 3BVZA 4DAPA 1HNXL 2IY5B 3J80i 3HOWB 4C3IB 4GLVB 3HKZB 3OIQA 2V1CC 3TDQA 3A8IE 1XMOL 2RQXA 3K5MA 2KVMA 1EIFA 3R2IA 3EVQA 2J7ZA 4JI0Q 1AFPA 2B2TC 3K7AH 3L2PA 4X3SA 3PIO3 4OO1I 4OIJA 4I7AA 2L5TA 4R1JA 4OONA 2VUMH 2BDNA 1KDAA 5JPNC 4JI1Q 4IUVA 2YTVA 4QUCA 3T51B 1BDOA 3U50C 2BA1A 3SEBA 3EIVA 4N9PA 1GUSA 1VQNA 4ZK9B 2MQHA 4L5SA 3D31A 4IFDH 4R9WA 1O7LA 2VZAA 5I2XA 3A5UA 2CW0D 3V05A 4NXMQ 2Z0SA 3S14H 4MIUA 1KIXA 4K5VA 4DK1A 1XJVA 3J7A5 3MHBA 2R7DA 2H1EA 3H3VI 1ONLA 1PFSA 2VY3A 2F0JA 3UDIA 4UHVA 2K5QA 1V1QA 1Y8OB 1HR0W 1VS0A 3OSOA 4IUPA 2C5CA 1BBUA 2J0TD 1EOVA 1HFNA 2PQAA 2K5WA 2RF4A 5D3IB 5KNBA 1QOHA 3F8TA 1GUGA 2B29A 1Z47A 3MEHA 4GN5A 3A56A 2ZM6Q 3FEWX 4RGMA 1Q90A 3GTLH 2KEEA 1E24A 2LS01 2FMMA 3OW7A 3M3YB 1SXTA 4LF8Q 3PIOA 1HNZQ 5G3LD 1M1KC 2WAQE 5C3EH 1NJIC 5FO7B 4XIGS 4U673 3KUPA 1LT4D 5ELDA 1GKHA 1Z7TA 2F0NA 2IL8A 5C6AA 3KF6A 1OXUA 1WD1A 2KJXA 5EBDA 1VQ4A 2PW5A 1ZXTA 5EKLA 5IYBG 2L12A 3P75A 1N34L 1PYSB 1VQOA 3GTOB 1ASZA 5FLMH 3DWPA 5CMDA 3CP0A 3CCQA 3HOWH 1LTAD 4C3IH 1Y1WB 5M3MB 3CMAA 4ID6A 3SE0A 3K5NA 1F9PA 1WYDA 2ATWA 2JA6G 3S24A 1PH5A 5JVG3 2EQSA 3CAMA 4H0LC 1B3AA 2A1AA 5KGUA 2F0GA 2VQFL 2Z4HA 1Q46A 2Q2UA 3CCSA 4S3SA 4HCEA 1V1OA 2EYHA 1VQIA 3G71A 3PSIA 2MNAA 3I4NG 1MD2D 3I4LA 3J81L 4A3FB 1RL2A 1B1ZA 1YNXA 2F0FA 1PHJA 3K5LA 3D0FA 2OTLA 3RR5A 4KKSA 3T53B 5CV6A 1TS4A 3KJOA 1IW7C 3OOCA 1K3RA 1GHJA 1UEBA 1FGBD 2JN4A 2I5LX 2Q8RE 1CA5A 1B4OA 2VB2X 4WRDA 4B3ML 1JORA 1SBBB 3K5OA 4J1MA 4GNXB 1S5DD 4DR1Q 1KQSA 3V96A 2AUKA 4IOAA 1M8AA 3L7ZC 2D2CC 4DAMA 1Y8PB 2HHHL 3G7LA 5K5PA 3JAMc 1XX8A 4F7XA 3PO3B 3K81C 2G9HD 4UAIA 3M3YH 1BUVT 1F9QA 1XNRQ 2F0LA 3IKJA 3ZYYX 1E2WA 1L1OC 5C44G 1K28A 1O80A 1Q8IA 3TS2A 5C0XI 4ZLTF 2XIWA 3IRBA 1J5EL 1JB7A 1HNXQ 4RGTA 1QUQB 2Y0SE 4RFBA 4A3GG 1S5CD 2XVSA 4K0KL 2EYPA 3T4AC 2N55A 3MC0B 3J7YW 1U4LA 1FJGQ 5ELFA 1HXYD 1C7YA 1AP0A 1VQ9A 4JPBW 3BYYB 4CHTB 4CKEA 3OPOA 3K57A 3SXHA 2Z1CA 2A6EC 4JV5L 1MSHA 4RCNA 3GTOH 1UUPA 4XYOA 3A8KE 4KHPL 2F0TA 1RF2D 2SEBD 1WTPA 2B3GA 3WOEA 3TP8A 1Y1WH 4ZYSA 5M3MH 3I3CA 1ET9A 1DGSA 3TS0A 3IAYA 4YY3L 1JWMD 2DNCA 2EYOA 1STYA 3Q6SA 1VDZA 2WINB 4G4KA 3I55A 2R61A 5ELCA 4Z9CB 2RSNA 3GO5A 5A35A 1CUKA 1HTLD 3OYYA 1B50A 3R2TA 2WB1G 5C5LA 3GQBA 3UDXA 1G91A 5G3LF 1ET6A 4DK6C 2GA4B 4IOCA 4RWSC 3J81E 3CPWA 1N33L 4A3FH 1YNNC 3ERQA 2MGSA 5M3FB 4AH6A 4OX9L 4QIWE 1ILPA 4OO1G 4FXGC 5I6YA 1TQOA 1WI5A 5FO8B 3AMUA 1DYQA 5IYDH 3ZJYC 4JI4L 1VQMA 5KYIA 1Q7YC 1EIHA 3HKZE 1WD0A 5JJKA 2E2HB 2AKWB 4GNXA 4KKTA 3D3RA 2EY5A 3NK9A 5C0XJ 4KY6A 1WJJA 3M4PA 5LMNW 4LWCA 5LL6X 3CMEA 4J15A 1QNKA 4DV6L 3NBIA 4RKLA 5AJ3Q 1SYDA 4DN4M 3KFUA
chains in the Genus database with same CATH topology
2E2DC 1A2TA 2K32A 5F2DA 3PIP3 3TZDA 4ILWA 1RHPA 4IUTA 3HOXB 3J7AV 5D3DA 4B9XA 1QCBD 2DY7A 3KBGA 2WKCA 2JEAI 2RBMA 4A3IB 3SK5A 3IL8A 3S9WA 1NR2A 3H09A 2JA5B 3FRPB 3DEOA 3W2DA 4K8JA 3DWAA 3QIAA 2A6HD 3LWEA 4RGNA 2OEOA 1DOLA 2EJGC 1CQVA 2H4OA 3KLRA 1EZ8A 3P20A 3HOVB 1C48A 1C4QA 3URYA 5I9OA 4HMJA 2ZXRA 1OXXK 3MWYW 1FNVA 1A3TA 5BN4A 4EVOA 4DXGA 3M4YA 3V2TA 4ABNA 1K8MA 3NXWA 2PNRC 1EY9A 3M85A 3BVGA 4E6IA 4IZ8A 2CW0C 5C3WA 2SNSA 2ICEC 4ZAIA 2F4IA 4ZRZA 3NWSA 5HURA 1FD7D 1EEFD 5C4ZA 1T5XD 4CBVA 1EY4A 1F9SA 1SE4A 1XYIA 4KKUA 4KHVA 1CZWA 1JC7A 3OIPA 5E4XA 1BNZA 1AEXA 4KJNA 1EWHA 1JCKB 1D1KA 4BA1I 1LT5D 1X3QA 3AB9A 3F2UA 3EFXD 2SNMA 3HOZB 2VB3X 1TWFB 2QCPX 1OO9B 4GZYC 3EQLC 1R4QB 3BYTB 4BY1B 3S2HB 1UNSA 4H7BA 2EDGA 2F0UA 3SDZA 1D6EC 5C0XG 2ZXPA 1STHA 3NTKA 2SDFA 2E2JB 2O4XA 4IURA 4TSSA 4NDXA 1B9NA 4KD4A 2WV6D 3QO2A 1NAPA 2IJ0A 3FDTA 1A3UA 1MI2A 5IOCA 4FF2A 3M7NA 4KV6A 1EQVA 3ONAB 2F3WA 1NUCA 2EJMA 1Y8NB 1LACA 1S5BD 1XXGA 1I4GA 1SNDA 5DEHA 4XYQA 1EOTA 4RH6A 2KCCA 4ULLA 1S5FD 1O7YA 5LL6S 1F2ZA 2JYOA 1NCVA 4NMZA 3TP7A 2CVRA 5ELEA 3S1NB 2KHSA 2FMCA 2L55A 3VR4A 1LT3D 1X3PA 4FF1A 5I4DA 4H13C 2NN6H 1U4PA 1TKWB 1V43A 1B44D 3OWEB 2CHBD 3LWUA 4HTHA 3MVVA 1F2LA 4F8MA 3NQIA 1ZEQX 1I4XA 1SNQA 3SK4A 3I90A 3DWQA 2B39A 1GUNA 1JOKA 1ENFA 1EY6A 4X3KA 1SDFA 3DMUA 1MBYA 1O78A 3IFDA 5IGBA 4RHSA 3PUVA 5AFWA 3W3AA 5J1ZA 3TMEA 5JEAJ 4J8QA 4C1NI 3PV0A 1OXVA 2VXWA 2A68D 2HQEA 1JB3A 2MP1A 1F2MA 2EJFC 4KMUC 5I2YA 3U9OA 2X6GA 5EKIA 2PZUA 3FVQA 1PXUA 2E2IB 2NTSA 1DM0B 3PUXA 3I4MB 3MXNA 1PLFA 5IODA 2ENBA 1SYCA 2F0IA 2F0HA 1SNMA 3NSWA 1SYFA 1VF5C 2KQ3A 5KRUA 4KN7C 4NW2A 5I6WA 1H9KA 3NWTA 3H6MA 3NPPA 1RKNA 1FNUA 2IPKD 4B08A 1HQMC 2FFKB 4FO2A 1W6KA 3BDCA 1EWCA 5JOBA 3A8JE 4FXKC 5CC4A 3S2DB 2D9UA 3HZXA 1LABA 4ZKBB 5DNFA 2F3VA 3D4WA 1IKMA 1I4QA 2B8FA 3PUWA 4O42A 3HS0C 2RDHA 3K0YA 2M00A 2NYZD 3NBHA 4N9TA 5T1IA 3PUYA 4DGZA 2AQ1B 2A6HC 3LNNA 3TP6A 3JAML 3GV3A 1R9TB 2F03A 4KTAA 1FYCA 3MXGA 2BE5C 4LMQD 2JA6B 2JA8B 1EEID 2F0WA 1X32A 2AWNA 1LTGD 1LTTD 3HRZC 3T13A 1EIGA 2NUCA 2F0VA 3MXUA 2EYFA 3FPPA 3PO2B 4DFAA 4QF4A 2EY2A 3OHXC 2Z8LA 1KDCA 3S1QB 2IWHA 3CQZB 2AQ3B 2E76C 1C8CA 4G7OC 1GOZA 2DY8A 4JK1C 3GTQB 1S4ZA 5JEAG 4IN3A 3D6WA 2D62A 4C3HG 5JJZA 5D65A 2EY6A 2JSOA 3TZUA 1RDPD 5M9OA 1QILA 3FPUB 3GTGB 2XRSD 5M5YB 1EFID 2MPMA 3EROA 3T56B 3MTSA 3U9SA 3T16A 2LFNA 4XTCS 3VYSA 3QOJA 2E75C 2D5DA 5C44B 3NTIA 3CRLC 4KN4C 1DXMA 1AZQA 1EY7A 1STBA 1EYAA 2A5HA 4A3GB 4DU9A 4C3JG 4I7ZC 3G6JB 5EJWA 3D6CA 1I4HA 3JAME 2F0MA 1PYWD 5IGFA 1CHQD 3CU7A 3RLFA 2LMCB 1A15A 5IGGA 2OF1A 2YU9B 1ILQA 4FP5D 1EU3A 2R93B 1L0YB 4LK1C 4PMWA 2HDLA 3HG9A 2QILA 1ESRA 1DZ1A 3GP7A 2AWOA 3CRKC 1OXTA 1Q1EA 4IFDI 2TSSA 3D8GA 1ZKOA 1SJED 1LO5D 3ND8A 1PTOD 1YNJD 1B2TA 1OXSC 1G6ZA 1M4VA 2EYLA 2BOSA 1TWHB 4Q0FA 2ZXOA 2K1BA 3SR1A 3VR2A 4C2MB 1W6JA 1UEAB 3AU7A 1CTMA 2EOTA 1DD2A 1HA6A 3VA7A 1KNEA 1AZPA 4A3BB 1KTKA 1HUNA 3J80L 2N88A 1TT2A 3MA2B 5CR3A 3BVMA 3C2PA 1A3VA 1GUTA 1Q3LA 3VYUA 1HHVA 3Q23A 1G2TA 2F0KA 4HN7A 5FO9B 3E5SA 2PO4A 3D4DA 3VA5A 2PQEA 4IFDJ 5JAVA 2X69A 1DOMA 4XQNA 4FF3A 4DK0A 2AQ2B 2EYJA 1CA6A 3NUCA 1FNWA 2Q8IB 3TN2A 1LTBD 2IX3A 3M4OB 1ML0D 2FHTA 4WORA 4K14A 4UDUC 2PCFB 3GTKB 3N52A 5A2QL 2A68C 4F88A 3GV6A 3TSSA 1XWEA 3NHHA 1TWGB 4PV1C 3BDLA 3SVMA 1I3QB 1JWSD 1RD9D 4RCOA 4I65A 2NVTB 3A55A 3I73A 5C4JB 4CJ0B 4RA8A 5FLXL 1I6HB 3L9AX 3L3OC 2IX0A 1JWUD 4K2KA 2F0SA 2HDMA 4EGVA 5IIFA 4J6HA 4OO1H 3TP5A 4ZUJA 1SNCA 3A7LA 4RHRA 1Q12A 5K36G 3VR6A 4KD3A 1STAA 1AW7A 1Q1BA 1J9OA 4A93B 2PPBC 4PNYA 2PYKA 1IW7D 3NE5B 5D14A 3J80E 1BCPD 4QUFA 5JVH3 1D5XC 3EJIA 1WTVA 3RUZA 1EYCA 2G9DA 2NTTA 3R93A 4MHEA 1SYEA 1HUMA 1EYDA 3NQTA 1QG7A 2B2UC 1HRJA 2EPBA 2Q8TA 2JXMB 3DM1A 1LLRD 3NTHA 4OL7A 3ND9A 3RMHA 5A2QE 2B63B 4QCLA 1HA5A 2EZVA 2K7VA 2JEBI 3PMFA 4RAUC 2XWJB 2A6ED 2RSOA 5EPLA 4BS9A 3H91A 1H9RA 1SJHD 3KBXA 2B2YC 4K2LA 3OMGA 1EY8A 1DJRD 3CHBD 3MXPA 1TU2B 4IFDG 3X3MA 1IL8A 3S1RB 2IW3A 4WFN3 2J4XA 5CV9A 2QF7A 1YNND 3QOLA 2FINB 1FR3A 2B2UA 3E0JA 4X3UA 3GD7A 5C3XA 5TSSA 5EPKA 1JR0D 1QWYA 4A3DB 1VF7A 1QE6A 2YYZA 1LT6D 2KECA 2RA4A 3KLSX 1SNOA 3WOFA 3I91A 3RZDB 3HOUB 1Y1VB 1J8IA 2B2VA 3QB3A 3CKIB 3I70A 1EL0A 1II3A 2DNEA 4CJ2C 1I50B 2B2YA 3C1FA 3D4RA 2PW7A 1G291 1PTOB 2ID0A 2HCIA 4G7HC 3DEPA 4ZQ3A 1WTWA 2CQAA 1SNPA 4AYBB 1STGA 5E1FA 2KUMA 1B53A 2JE6I 4C3IG 4EQOA 1GXDC 2F0DA 2O5IC 5C0XH 3DXJC 4B9WA 4DAVA 2NZ1D 2PMZB 3NP8A 1TS5A 1TS3A 3OWFA 3S17B 4YIJA 4IUQA 1ENCA 1BO0A 3I8ZA 2BCOA 5LHY1 1PMRA 5KNCA 1BCPF 4O1NA 2NWGA 3P1HA 1SEBD 2A73B 1STNA 1CHPD 1PTOC 1KLUD 1YNJC 1HTPA 2L4NA 3VR3A 4M1UB 5ISRA 2RKSA 4CGYB 2XNAC 5T1GA 1I4RA 1BXTA 1SAPA 4ODGA 4BBRB 2EVBA 1SMYD 5IT9L 5EGTA 2F0OA 1VMPA 1WTQA 5HGTA 1TR5A 4DA2A 1K83B 4HSVA 1PDQA 1ENAA 4PMCA 4A3KB 1GJXA 3BG3A 3K6OA 2M2LA 2B2WA 1PFBA 3QJYA 3MFGA 4XT1B 3BZDB 2NVXB 1RJTA 1BOSA 5EBCA 1SFOB 2SOBA 3HEJA 5CV4A 5C4XB 1G8ZD 1D5MC 1LTRD 4LAAA 1D5ZC 2MUYA 4ME5A 1GHKA 1TWAB 1VMCA 5EPJA 5M5XB 1TIID 1CK1A 2B2TA 1JICA 3OMCA 4K5XA 1K8OA 1PTOH 3QWNA 1LTSD 2IX1A 2Z4IA 3BS1A 4TKOB 1WTRA 5EKKA 5J22A 3QG1A 4Y7NB 1GUOA 3C1EA 2LKVA 4L63B 4FNFA 2A74C 5COYA 4L6TB 4Q5VA 2O2LD 3PUZA 3MAQA 1KAAA 4NP5A 1PRTD 2OT2A 3VYRA 4HR7B 4OHJA 4CKCA 1JOQA 4XDXA 4V0BA 1BCPB 3I4NB 1TY0A 1VCIA 5IT9E 1SYBA 4DNRB 5FOBB 5CGKA 1A6XA 2FJ2A 5EQ0A 1LV9A 1B9MA 2E74C 2F0EA 2EY1A 5E3FA 1RTOA 2QKIC 4IUNA 2XWBB 2NN6I 4HMIA 1MSGA 2L1BA 3Q24A 1IYUA 2R3ZA 2DN8A 5BN3A 1S5ED 4C1NK 5E4WC 1CQFA 1BCPC 1T5EA 1H9SB 4MN3A 1TWCB 4C3HB 2NVYB 4RKBA 4A3MB 2KOLA 2X6LA 5C4HA 1D2BA 4TRDA 3S16B 3M7GA 2QDBA 3GTPB 1I4PA 3FMCA 1ZYRD 4R8IA 2ICIA 4P2CB 1HQRD 1XTCD 2K28A 4C56C 2K05A 4JBWA 5DM73 4BWGB 4V190 1NSNS 1LTID 3VR5A 4C3JB 1TVXA 2OXPA 1ICWA 1RCVD 5M5WB 3BDOA 2A69D 2IT1A 3K59A 3C46A 1U4RA 3A54A 4KY7A 2PZWA 4L8JA 5KYLA 1CFMA 1SSOA 1IYVA 2WB1B 3RD4A 1MGSA 4PQXA 2WKDA 2F0QA 2KEDA 5CV8A 1KABA 1PFMA 5CBEE 4WJWA 4G57A 4BA2I 2RVLA 2R7ZB 1TS2A 1O7ZA 2M9VA 2NB0A 1A2UA 1HFGA 2HUGA 4CJ1B 4ZKCB 1JE4A 1SE2A 4R8NA 5KIXA 1U4MA 3MFYA 1H9SA 4M8AA 2C9OA 3O13A 4FYDA 1H9JA 3ITPA 1Y69U 2K01A 5JEAH 4U68A 4HSPA 1PRTF 2VNUD 1Z6HA 3S1MB 4HAEA 2AUJD 1JQYD 4HCSA 3DHQA 4BY7B 5IGEA 1WTXA 4H44C 3FKIB 5DAUA 3R8BA 2BDOA 4RGOS 2RDFA 2JA7B 1SYGA 1EY5A 5CV7A 2NVQB 3LX0A 3TBIB 1PZKD 3H3VC 1BF4A 4EQPA 1R4PB 4CKBA 2K6AA 5CORA 4A3JB 3SK6A 4DF7A 1E2VA 4K8IA 3K58A 4QB4A 2KA7A 3I72A 1DOKA 1SE3A 3UI2A 3C3LA 5NUCA 3SHLA 2BE5D 4FF4A 4KJOA 1PZJD 1SMYC 2B8GA 3RZOB 2R6GA 5DM63 1IHZA 1E2ZA 3VYTA 3GTMB 1F2YA 5JPMC 1AN8A 1E0BA 4OIKA 4IUUA 1WTOA 3E6ZX 2KCNA 4NKLA 2EXZA 1QJOA 2WAQB 2V4DA 1EQTA 1JOOA 2L11A 3P7JA 4ZUIA 4PMBA 1RTNA 1F77A 2L0CA 5IGDA 3X3NA 2EE1A 2WP8J 3S15B 4KI0A 2MJ8A 1PZID 1STEA 2QEJC 3HGBA 4KK7A 3IFTA 5KNDA 3GTJB 3SK8A 2NN6G 1PTOF 4LJZC 2RDGA 1CZGA 5FKAC 5I9PA 2K5DA 4A3EB 4KHZA 3HOYB 1PRTB 1DONA 1GUWA 3KK7A 4QMGA 4EQNA 1BQQT 4DAYA 1WCMB 3A7AB 1QNUA 2XSCA 4DXFA 4XQJA 3H0GB 5CBAE 4BBSB 3WDNA 4IALA 1UAPA 2K33A 2MHVA 2R92B 3KLSA 5J39A 2F0PA 1KLGD 1IKLA 1V1PB 2XN9C 5CYUA 1V8QA 1D1IA 2B2VC 1WVLA 2WACA 1PRTC 2NBFA 1RODA 1G2SA 1F9RA 2K04A 1ESFA 4K6DA 3K7AB 2TMPA 4XQQA 3N6RA 4F87A 1BBXC 1KDBA 3KF8A 4XXEA 5FLXE 2VUMB 2O5JC 4XT3B 5CV5A 2I07B 4IQZA 1L0XB 4HEDA 2XRQD 1CM9A 1U9RA 1H9MA 1KNAA 1CT1D 3Q22A 2JP1A 5KEEA 1HCZA 1QB5D 4K6LA 1DCZA 1NR4A 3S14B 1HPCA 1EU4A 2EYMA 4OGQC 3J7AF 2ZT9C 4FXDA 2Y0SB 4X3TA 1PFNA 3H94A 5K36H 2F1MA 5IGCA 4DNTB 1EY0A 1EZ6A 4FVMA 2K03A 3MZ5A 4G7ZC 1BR9A 1CI3M 2LY7A 3EA6A 3GTLB 5FK9C 5BN5A 1ZYRC 2WIIB 3DUZA 2B2WC 5C3EB 3HP3A 2L9HA 3Q0AA 2I46A 2PZTA 2BA0A 4KY5A 5C5MA 3R3OA 1I6VC 4QIWB 1V1PA 4TQUS 2HCCA 5ELBA 1TY2A 4K5WA 2A69C 3BVZA 4DAPA 3HOWB 4C3IB 3HKZB 3OIQA 3TDQA 3A8IE 2RQXA 3K5MA 2KVMA 3R2IA 3EVQA 2J7ZA 1AFPA 2B2TC 4X3SA 3PIO3 4OO1I 4OIJA 2L5TA 2BDNA 1KDAA 5JPNC 4IUVA 4QUCA 3T51B 1BDOA 2BA1A 3SEBA 4N9PA 1GUSA 4ZK9B 3D31A 4IFDH 4R9WA 1O7LA 5I2XA 2CW0D 3V05A 4MIUA 4K5VA 4DK1A 3MHBA 2H1EA 1ONLA 2F0JA 2K5QA 1Y8OB 3OSOA 4IUPA 2C5CA 2J0TD 1HFNA 2K5WA 5D3IB 5KNBA 1QOHA 1GUGA 1Z47A 3MEHA 3A56A 3FEWX 4RGMA 1Q90A 2KEEA 2LS01 2FMMA 3OW7A 3M3YB 1SXTA 5G3LD 5FO7B 4XIGS 4U673 3KUPA 1LT4D 5ELDA 2IL8A 1Z7TA 2F0NA 5C6AA 1OXUA 1WD1A 2KJXA 5EBDA 2PW5A 1ZXTA 5EKLA 2L12A 3P75A 3GTOB 3DWPA 5CMDA 1LTAD 1Y1WB 5M3MB 4ID6A 3SE0A 3K5NA 1F9PA 5JVG3 4H0LC 1B3AA 5KGUA 2F0GA 2Z4HA 4S3SA 4HCEA 1V1OA 2EYHA 1MD2D 3I4LA 3J81L 4A3FB 1B1ZA 2F0FA 3K5LA 4KKSA 3T53B 5CV6A 1TS4A 1IW7C 3OOCA 1GHJA 1FGBD 2Q8RE 1CA5A 1B4OA 2VB2X 4WRDA 1JORA 1SBBB 3K5OA 4J1MA 1S5DD 3V96A 2AUKA 1M8AA 3L7ZC 2D2CC 1Y8PB 3G7LA 5K5PA 1XX8A 4F7XA 3PO3B 2G9HD 4UAIA 1BUVT 1F9QA 2F0LA 3IKJA 3ZYYX 1E2WA 1O80A 1Q8IA 5C0XI 4ZLTF 2XIWA 4RGTA 4RFBA 1S5CD 2XVSA 2EYPA 3T4AC 2N55A 3MC0B 3J7YW 1U4LA 5ELFA 1HXYD 1AP0A 3BYYB 4CHTB 4CKEA 3OPOA 3K57A 3SXHA 2Z1CA 2A6EC 1MSHA 4RCNA 1UUPA 4XYOA 3A8KE 2F0TA 1RF2D 2SEBD 1WTPA 3WOEA 3TP8A 4ZYSA 3I3CA 1ET9A 3IAYA 1JWMD 2DNCA 2EYOA 1STYA 3Q6SA 1VDZA 2WINB 4G4KA 2R61A 5ELCA 4Z9CB 2RSNA 3GO5A 5A35A 1HTLD 1B50A 3R2TA 5C5LA 3GQBA 1G91A 5G3LF 1ET6A 2GA4B 4RWSC 3J81E 1YNNC 3ERQA 2MGSA 5M3FB 1ILPA 4OO1G 4FXGC 5I6YA 1TQOA 5FO8B 3AMUA 1DYQA 5KYIA 1EIHA 1WD0A 2E2HB 4KKTA 3D3RA 2EY5A 3NK9A 5C0XJ 4KY6A 5LL6X 1QNKA 3NBIA 4RKLA 1SYDA 4DN4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMM A;  2B2W C;  5COY A;  1EOT A;  1G6Z A;  4IUQ A;  3G7L A;  1BO0 A;  3HP3 A;  2L9H A;  3I8Z A;  1BF4 A;  1O7Y A;  1XX8 A;  3KBX A;  1TVX A;  3TZD A;  1ICW A;  5CBA E;  2JYO A;  4NW2 A;  5E4X A;  4CJ0 B;  2NWG A;  4RA8 A;  1BNZ A;  1NCV A;  1RHP A;  2B2Y C;  2K1B A;  4IUT A;  4UAI A;  2CVR A;  1F9Q A;  3KUP A;  2L4N A;  5T1G A;  1C8C A;  2HDM A;  2DY8 A;  5COR A;  1O80 A;  1X3P A;  1X3Q A;  2IL8 A;  1SAP A;  4ZLT F;  3F2U A;  2HCC A;  1U4R A;  2DY7 A;  1WD1 A;  2FFK B;  2XIW A;  1IKL A;  4XDX A;  1IL8 A;  1U4P A;  2EOT A;  1S4Z A;  1ZXT A;  2B2V C;  1SSO A;  1WVL A;  2L12 A;  1DOK A;  1VMP A;  1WTQ A;  3IL8 A;  1ROD A;  1HA6 A;  1NR2 A;  1G2S A;  2N55 A;  2D9U A;  1F9R A;  1U4L A;  3D6W A;  1KNE A;  2K04 A;  4HSV A;  5JJZ A;  3UI2 A;  1PDQ A;  1AZP A;  5D65 A;  1AP0 A;  4ZKB B;  1HUN A;  2FIN B;  5DNF A;  5CMD A;  1MGS A;  2FJ2 A;  5EQ0 A;  1LV9 A;  5T1I A;  1J9O A;  2KVM A;  3DEO A;  1F2L A;  1IKM A;  1MSH A;  2B2U A;  3FPU B;  2M2L A;  2KED A;  2B2W A;  1PFB A;  4O42 A;  4XT1 B;  1PFM A;  2J7Z A;  2N88 A;  1WTP A;  1BBX C;  1F9P A;  4X3U A;  2B2T C;  3I90 A;  3LWE A;  5CBE E;  4XT3 B;  4X3S A;  5D14 A;  1Q3L A;  1RTO A;  2MPM A;  2NYZ D;  2RVL A;  1B3A A;  4OIJ A;  4HED A;  1O7Z A;  1CM9 A;  1RJT A;  3I3C A;  1E0B A;  3MTS A;  5EPK A;  4QUF A;  1HHV A;  4OIK A;  1MSG A;  2L1B A;  2BDN A;  1HFG A;  3Q6S A;  4IUU A;  1WTO A;  4X3K A;  1WTV A;  2R3Z A;  1G2T A;  2HUG A;  1QE6 A;  4CJ1 B;  4IUV A;  1SDF A;  4ZKC B;  2KEC A;  2RA4 A;  1DOL A;  1JE4 A;  3IFD A;  4QUC A;  1KNA A;  1EQT A;  2JP1 A;  1U4M A;  2L11 A;  2RSN A;  2SDF A;  3P7J A;  3I91 A;  5E4W C;  1AZQ A;  1B50 A;  1RTN A;  3R93 A;  4MHE A;  5AFW A;  4IUR A;  2X69 A;  4ZK9 B;  1J8I A;  2B2V A;  4MN3 A;  2EE1 A;  1DOM A;  1NR4 A;  3GV3 A;  3MWY W;  1HUM A;  4R9W A;  1EL0 A;  1G91 A;  2MJ8 A;  5EJW A;  1VMC A;  5EPJ A;  3QO2 A;  1NAP A;  2K01 A;  4RWS C;  1QG7 A;  2VXW A;  4CJ2 C;  4U68 A;  2MGS A;  1CA6 A;  4X3T A;  1A15 A;  1PFN A;  2B2Y A;  2B2U C;  1ILP A;  2KOL A;  3FDT A;  3TN2 A;  2X6L A;  2H1E A;  2MP1 A;  1ML0 D;  2FHT A;  1ILQ A;  1MI2 A;  4HAE A;  4HCS A;  2EPB A;  4LMQ D;  2Q8T A;  2B2T A;  1JIC A;  1HRJ A;  2HCI A;  3N52 A;  2X6G A;  1X32 A;  5EKI A;  3DM1 A;  3DEP A;  2K03 A;  1WTW A;  1WTX A;  2Q8R E;  2HDL A;  3ONA B;  1CA5 A;  1EIH A;  1WD0 A;  1ESR A;  4R8I A;  1DZ1 A;  1B4O A;  4IUP A;  4ZAI A;  2KUM A;  1HFN A;  1EIG A;  3GV6 A;  1WTR A;  2K28 A;  1B53 A;  2K05 A;  1PLF A;  4RAU C;  1DON A;  1GUW A;  3SVM A;  1QNK A;  2NZ1 D;  2RSO A;  5EPL A;  1M8A A;  3H91 A;  2KEE A;  4DN4 M;  1F9S A;  1XYI A;  1B2T A; 
#chains in the Genus database with same CATH topology
 2E2D C;  1A2T A;  3HKS A;  2K32 A;  5F2D A;  3PIP 3;  3TZD A;  2VQE Q;  4ILW A;  2N8N A;  1RHP A;  4IUT A;  1X3F A;  3HOX B;  3J7A V;  1MIU A;  5D3D A;  2MFI A;  4B9X A;  4IO9 A;  3PO3 H;  1QCB D;  1WTH A;  1VQB A;  4A3C G;  4PZ6 A;  1PVO A;  2DY7 A;  3KBG A;  1QUQ A;  2WKC A;  2HD3 A;  2JEA I;  3G6E A;  4DR5 Q;  1I94 Q;  2RBM A;  4A3I B;  1VQF A;  3SK5 A;  4X64 Q;  3CCE A;  4DV4 Q;  3IL8 A;  3S9W A;  1NR2 A;  5H1S E;  3H09 A;  4LF5 L;  2JA5 B;  3FRP B;  2CCZ A;  3DEO A;  3W2D A;  1HR0 Q;  4K8J A;  3UDF A;  1IYJ B;  3QR8 A;  2JJQ A;  3DWA A;  4DR6 L;  1YI2 A;  3QIA A;  4CDC C;  2A6H D;  4X65 Q;  3LWE A;  1WFQ A;  4JI5 L;  1VQD A;  1VQC A;  4RGN A;  2OEO A;  1DOL A;  2EJG C;  2KHI A;  1CQV A;  3HFZ B;  1W3S A;  2K75 A;  2H4O A;  3KLR A;  1EZ8 A;  3P20 A;  3HOV B;  1C48 A;  1MJE A;  1C4Q A;  3URY A;  5I9O A;  4HMJ A;  2ZXR A;  1OXX K;  3MWY W;  1FNV A;  1A3T A;  5BN4 A;  3PIP A;  4EVO A;  4UP7 A;  1CKM A;  4DXG A;  4JI0 L;  3M4Y A;  3V2T A;  2ZTE A;  2Q2H A;  2N49 A;  4ABN A;  1K8M A;  3NXW A;  2PNR C;  1EY9 A;  3M85 A;  3BVG A;  4E6I A;  4IZ8 A;  4HJ7 A;  5M3F H;  4LW1 A;  3J80 c;  2CW0 C;  5C3W A;  4JI1 L;  2SNS A;  2I0Q A;  2ICE C;  3BU2 A;  4ZAI A;  2AMC B;  1XMQ Q;  1KD1 C;  4LF7 Q;  2F4I A;  4ZRZ A;  2WAQ G;  3NWS A;  4BXX G;  5HUR A;  1FD7 D;  2E2H H;  4HID A;  1EEF D;  5C4Z A;  1T5X D;  4CBV A;  1EY4 A;  4A93 G;  4NXM L;  1F9S A;  1SE4 A;  1XYI A;  1YBY A;  4KKU A;  4KHV A;  1CZW A;  1GM5 A;  3AEV A;  4JBJ A;  1JC7 A;  3CPF A;  1VQA A;  3OIP A;  5E4X A;  1BNZ A;  1AEX A;  4KJN A;  5IP7 G;  1EWH A;  1JCK B;  1S3O A;  1D1K A;  4BA1 I;  3G4S A;  1LT5 D;  4LFA Q;  3HOX H;  1X3Q A;  3AB9 A;  3F2U A;  1PV4 A;  3EFX D;  4GN3 B;  2SNM A;  2ZM6 L;  3A0J A;  3HOZ B;  2VB3 X;  1TWF B;  1MHW C;  2QCP X;  1OO9 B;  4LUZ A;  4GZY C;  1L0W A;  3VDY A;  3EQL C;  4A3I H;  1R4Q B;  3BYT B;  4OXP A;  4BY1 B;  4DV3 Q;  3S2H B;  4P75 A;  4LF8 L;  1HNZ L;  2JA5 H;  1UNS A;  3E9H A;  1A63 A;  2XTI A;  2KHJ A;  4H7B A;  1KRT A;  1VQG A;  2EDG A;  4AIM A;  1PH8 A;  2UUC Q;  2F0U A;  3SDZ A;  1D6E C;  5C0X G;  2ZXP A;  1G51 A;  2B63 G;  1STH A;  4JI2 Q;  4ALP A;  3NTK A;  2SDF A;  2E2J B;  2K5V A;  2O4X A;  5BR8 Q;  4IUR A;  1KRS A;  4TSS A;  4OWW B;  4NDX A;  1B9N A;  4KD4 A;  3HOV H;  1K0R A;  2WV6 D;  3OW2 A;  2FXQ A;  3QO2 A;  1LM0 A;  1NAP A;  2IJ0 A;  2RHS B;  4N8X 1;  4DV0 Q;  3FDT A;  3L0O A;  3BZC A;  1A3U A;  2QA4 A;  1MI2 A;  4A3L H;  5IOC A;  4FF2 A;  3TQY A;  3M7N A;  4KV6 A;  4DUY Q;  1AE2 A;  1EQV A;  1NMG A;  3ONA B;  3J7Z C;  2F3W A;  3F2D A;  1NUC A;  2EJM A;  1Y8N B;  1LAC A;  1S5B D;  4YCU A;  4YWL A;  3EN2 A;  3MXN B;  2CWP A;  3ER0 A;  1XXG A;  5GAH C;  3RN2 A;  4WJ3 M;  1I4G A;  1SND A;  5DEH A;  4XYQ A;  1CKO A;  1EOT A;  4RH6 A;  4IPH A;  2KCC A;  4ULL A;  1S5F D;  1O7Y A;  5LL6 S;  1S72 A;  4L5R C;  1F2Z A;  2JYO A;  1NCV A;  4NMZ A;  4DPG A;  3TP7 A;  2CVR A;  3RNU A;  4A3D G;  5ELE A;  3S1N B;  1LTL A;  3CW2 C;  2KHS A;  2VL6 A;  1VQ6 A;  2FMC A;  2ZTC A;  2L55 A;  3VR4 A;  1LT3 D;  1X3P A;  4FF1 A;  5I4D A;  2PI2 E;  4H13 C;  2NN6 H;  3HOU G;  1Y1V G;  1U4P A;  4DR1 L;  1K3B C;  4LUO A;  1TKW B;  1J6Q A;  1V43 A;  1HZA A;  1S40 A;  1B44 D;  3OWE B;  2CHB D;  3HOZ H;  4GOP B;  3LWU A;  4HTH A;  4Y52 H;  1TWF H;  4DKA C;  1XTD A;  3MVV A;  1CSQ A;  1EQR A;  1F2L A;  4F8M A;  3NQI A;  1ZEQ X;  1I4X A;  1SNQ A;  4BY1 H;  2F4V L;  2DGY A;  3S2H H;  1M90 C;  3SK4 A;  3I90 A;  5LMN Q;  1XNR L;  3DWQ A;  2B39 A;  1GUN A;  1JOK A;  1PH1 A;  1ENF A;  1EY6 A;  4GN4 B;  4X3K A;  2GN5 A;  1YHB A;  1SDF A;  3DMU A;  1MBY A;  1O78 A;  3IFD A;  5IGB A;  5L37 A;  4JC0 A;  4RHS A;  5HY6 A;  1P16 A;  1FJG L;  3PUV A;  4LF9 Q;  1PH2 A;  5AFW A;  3W3A A;  1IL2 A;  2CH4 W;  5J1Z A;  3TME A;  4B3S Q;  5JEA J;  4NPS A;  4GOP C;  4J8Q A;  4C1N I;  3PV0 A;  1OXV A;  2E2J H;  4JBK A;  3K8A A;  1QVG A;  2VXW A;  2A68 D;  2HQE A;  1JB3 A;  2MP1 A;  4POF A;  1F2M A;  2EJF C;  4KMU C;  5I2Y A;  3U9O A;  3PF4 A;  2X6G A;  5EKI A;  2P5Z X;  1HZB A;  4BBR G;  4UY8 C;  2PZU A;  3FVQ A;  1PXU A;  2E2I B;  2NTS A;  4LNQ A;  1DM0 B;  3PUX A;  3I4M B;  2WFW A;  3RLN A;  2PNH A;  2HIX A;  3MXN A;  1PLF A;  1NTG A;  5IOD A;  4A3K G;  2ENB A;  1SYC A;  2F0I A;  2NZO A;  2F0H A;  1SNM A;  3NSW A;  1SYF A;  1VF5 C;  2KQ3 A;  5KRU A;  3H15 A;  2KEN A;  4KN7 C;  4NW2 A;  5I6W A;  1IBM L;  3F1Z A;  1H9K A;  3NWT A;  3H6M A;  3NPP A;  1RKN A;  5C4X G;  1SLJ A;  2K14 A;  1B70 B;  4JG2 A;  1FNU A;  2IPK D;  3S1N H;  4B08 A;  1U5K A;  1HQM C;  2FFK B;  3CCJ A;  4FO2 A;  2LSS A;  4QJF A;  1W6K A;  3BDC A;  1EWC A;  5JOB A;  1VQK A;  3PGZ A;  3KYH C;  1X65 A;  3A8J E;  5AJ3 L;  4FXK C;  2MO1 A;  5CC4 A;  3S2D B;  4GOP A;  2D9U A;  3HZX A;  1LAB A;  2ALY B;  4ZKB B;  5DNF A;  1B3Q A;  2F3V A;  2VQE L;  3D4W A;  1IKM A;  1I4Q A;  2B8F A;  3PUW A;  4O42 A;  1X56 A;  3HS0 C;  1PH4 A;  2RDH A;  1NY4 A;  3K0Y A;  2M00 A;  1N36 Q;  2F3I A;  4B3R Q;  2NYZ D;  3NBH A;  4N9T A;  5T1I A;  3PUY A;  4DGZ A;  4L5T A;  4JI3 Q;  4R4T A;  1HNW Q;  3K80 C;  2AQ1 B;  1IBL Q;  4DR5 L;  1I94 L;  1QVF A;  2A6H C;  4X64 L;  4DV4 L;  4JBM A;  3LNN A;  3CD6 A;  4YWM A;  2OQK A;  2KCT A;  3TP6 A;  1K0S A;  2OCE A;  3JAM L;  3GV3 A;  5IT9 c;  2EXD A;  1HR0 L;  1R9T B;  2F03 A;  4KTA A;  1FYC A;  1BKB A;  4ME3 A;  4X65 L;  1AE3 A;  3MXG A;  5FJ8 G;  2BE5 C;  4LMQ D;  1X9N A;  2JA6 B;  2JA8 B;  1EEI D;  2F0W A;  1HZC A;  1X32 A;  1JJ2 A;  2AWN A;  1X55 A;  1LTG D;  1LTT D;  3HRZ C;  1BVS A;  3T13 A;  1EIG A;  3M9B A;  2NUC A;  2F0V A;  3MXU A;  2EYF A;  5GQO A;  3FPP A;  2K5N A;  2E2I H;  3PO2 B;  4DFA A;  3I4M H;  4MZ9 A;  2K50 A;  4IJH A;  4GS3 A;  4QF4 A;  2EY2 A;  3OHX C;  2Z8L A;  1SRU A;  1KDC A;  3LGJ A;  3S1Q B;  2MO0 A;  4A4I A;  1C0A A;  2IWH A;  3CQZ B;  2AQ3 B;  2E76 C;  4H02 A;  1D7Q A;  1C8C A;  1XMQ L;  4G7O C;  1GOZ A;  2DY8 A;  4LF7 L;  4JK1 C;  1XPU A;  3GTQ B;  1BBW A;  1S4Z A;  4IPG A;  5JEA G;  4R4O A;  4IN3 A;  4YHH Q;  3D6W A;  2GVB A;  2D62 A;  4C3H G;  5JJZ A;  1K8G A;  5D65 A;  2EY6 A;  2JSO A;  2QW7 A;  4A3M G;  3TZU A;  1RDP D;  5M9O A;  3S2D H;  1QIL A;  1Q8K A;  3FPU B;  2F4V Q;  5HGQ A;  3GTG B;  2XRS D;  5M5Y B;  3CXC A;  1EFI D;  1Q82 C;  2MPM A;  3ERO A;  3T56 B;  4LFA L;  3MTS A;  3U9S A;  3T16 A;  2LFN A;  1YHQ A;  1K8A C;  4XTC S;  3VYS A;  4GNX C;  1X3E A;  3QOJ A;  1UE1 A;  2E75 C;  3STB D;  2D5D A;  5C44 B;  3NTI A;  1H95 A;  3CRL C;  2XGT A;  4KN4 C;  1DXM A;  1AZQ A;  1EY7 A;  1STB A;  5IP9 G;  1EYA A;  2A5H A;  4DV3 L;  4A3G B;  4DU9 A;  4C3J G;  4I7Z C;  3G6J B;  5EJW A;  3D6C A;  1I4H A;  3JAM E;  2F0M A;  1PYW D;  5IGF A;  3E3X A;  5IYB H;  1YHA A;  1CHQ D;  3CU7 A;  3RLF A;  1R9T H;  2LMC B;  1A15 A;  2UUC L;  5IGG A;  2OF1 A;  2YU9 B;  1ILQ A;  1EYG A;  5GAD C;  4FP5 D;  1EU3 A;  2R93 B;  4DR4 Q;  2N78 A;  4JI2 L;  1L0Y B;  4LK1 C;  1IZ6 A;  1YIT A;  4PMW A;  2HDL A;  3HG9 A;  2QIL A;  2JA6 H;  2JA8 H;  4DR3 Q;  1ESR A;  1DZ1 A;  3GP7 A;  2AWO A;  3CRK C;  3PQI A;  1OXT A;  4CDD C;  1Q1E A;  4IFD I;  5BR8 L;  2TSS A;  3D8G A;  4QGU A;  1ZKO A;  5EAY A;  1SJE D;  1LO5 D;  3ND8 A;  2I5H A;  1EFW A;  1E3P A;  1PTO D;  2YV5 A;  1YNJ D;  2UU9 L;  3PO2 H;  1B2T A;  1OXS C;  1G6Z A;  2QEX A;  4DV0 L;  1M4V A;  2EYL A;  4FDB A;  2BOS A;  1TWH B;  1IBM Q;  4Q0F A;  2ZXO A;  3I4N H;  3TRZ A;  2R7Z G;  1SMX A;  2K1B A;  4LF4 Q;  4P72 A;  3SR1 A;  3VR2 A;  4DUY L;  4YCW A;  4C2M B;  2VW9 A;  2RCF A;  3S1Q H;  1W6J A;  1UEA B;  3CQZ H;  3AU7 A;  1CTM A;  1GD7 A;  2EOT A;  1DD2 A;  2HIV A;  3GTQ H;  2IHE A;  1HA6 A;  3VA7 A;  1KNE A;  1AZP A;  4A3B B;  1KTK A;  1HUN A;  1TXY A;  3TEH B;  3KOJ A;  1K9M C;  4JCV E;  1YEZ A;  3J80 L;  4RG1 A;  2N88 A;  4BY7 G;  1TT2 A;  3MA2 B;  5CR3 A;  3BVM A;  1KHI A;  3C2P A;  1A3V A;  1GUT A;  1Q3L A;  1YIJ A;  3FKI G;  3VYU A;  3GTG H;  1HHV A;  3Q23 A;  5M5Y H;  1G2T A;  2F0K A;  2D0P A;  4HN7 A;  2GVA A;  5FO9 B;  3E5S A;  2PO4 A;  3D4D A;  2UXC Q;  2JA7 G;  2HT1 A;  3VA5 A;  3F2C A;  5GAE C;  2PQE A;  1E1O A;  3CCU A;  5JAV A;  4IFD J;  3T1Y Q;  2X69 A;  1X54 A;  3CCM A;  5C44 H;  1DOM A;  4XQN A;  4FF3 A;  4DK0 A;  3M4Q A;  1EWI A;  2AQ2 B;  2EYJ A;  4A3G H;  5LMN L;  1CA6 A;  3NUC A;  1FNW A;  4PG3 A;  2Q8I B;  3AYH B;  3TN2 A;  1LTB D;  1NMF A;  2IX3 A;  1LUZ A;  3M4O B;  1ML0 D;  2FHT A;  4WOR A;  3CC7 A;  4K14 A;  4JI7 Q;  4UDU C;  1YJW A;  2PCF B;  3GTK B;  1W2B A;  4A3J G;  3N52 A;  5A2Q L;  2YU9 H;  2A68 C;  1XNQ Q;  3GDE A;  1Z9F A;  2R93 H;  4F88 A;  3GV6 A;  2HQL A;  3TSS A;  1XWE A;  3NHH A;  4LF9 L;  1TWG B;  4PV1 C;  3BDL A;  3HOV G;  3SVM A;  3UE0 A;  1I3Q B;  4B3S L;  1JWS D;  3U4Z A;  1RD9 D;  3T1H Q;  4QL5 A;  4RCO A;  4HJ8 A;  2OTJ A;  1E7Z A;  4I65 A;  2NVT B;  3A55 A;  3I73 A;  4DR7 Q;  5C4J B;  4CJ0 B;  4RA8 A;  2YTY A;  5FLX L;  1SRO A;  1SE8 A;  1I6H B;  3L9A X;  1TWH H;  3L3O C;  2IX0 A;  4PZ7 A;  1JWU D;  4K2K A;  2F0S A;  2HDM A;  4EGV A;  5IIF A;  4J6H A;  5IYC H;  4OO1 H;  3TP5 A;  4C2M H;  1Y14 B;  2CQO A;  4ZUJ A;  1SNC A;  3A7L A;  4RHR A;  4B3T L;  1Q12 A;  1YJN A;  5K36 G;  3VR6 A;  4KD3 A;  1STA A;  1AW7 A;  2Z6B A;  1Q1B A;  1J9O A;  1UWV A;  2PPB C;  4A93 B;  4PNY A;  4A3B H;  2PYK A;  1IW7 D;  3NE5 B;  4X6A H;  5D14 A;  3J80 E;  1BCP D;  4QUF A;  5JVH 3;  1D5X C;  3EJI A;  4N8F A;  1EQQ A;  4QQB X;  1WTV A;  3RUZ A;  3NEL A;  3H3V H;  4A3E G;  3W5O A;  1EYC A;  3J81 i;  2G9D A;  2NTT A;  3HOY G;  3W1B A;  1KXL A;  3MEF A;  3HOZ G;  2R7F A;  3R93 A;  4MHE A;  1SYE A;  3RLO A;  5E7N A;  4A3C H;  1HUM A;  1EYD A;  1WCM G;  4OWT B;  3H0G G;  3NQT A;  4BBS G;  1QG7 A;  2L15 A;  1MKH A;  2B2U C;  1N36 L;  4B3R L;  3UE1 A;  5FLX c;  1HRJ A;  2R92 G;  2EPB A;  4JI3 L;  2Q8T A;  1HNW L;  3PCO B;  2JXM B;  1IBL L;  3M4O H;  3DM1 A;  1LLR D;  3I2Z A;  3NTH A;  4OL7 A;  1VQ7 A;  3ND9 A;  3GTK H;  3RMH A;  5A2Q E;  1N9W A;  2B63 B;  1V9P A;  4QCL A;  1HA5 A;  2EZV A;  2K7V A;  2JEB I;  3PMF A;  4RAU C;  2XWJ B;  4JI8 Q;  1NNX A;  2A6E D;  1CKN B;  2RSO A;  5EPL A;  2K4K A;  4BS9 A;  2UU9 Q;  3H91 A;  1TWG H;  1H9R A;  1I3Q H;  1Q86 C;  1SJH D;  2VUM G;  1P8L A;  3KBX A;  1VQ5 A;  2B2Y C;  4K2L A;  3OMG A;  3F2B A;  1EY8 A;  4PZ8 A;  2NVT H;  1DJR D;  3CHB D;  4AQY Q;  5C4J H;  3MXP A;  2KCM A;  1TU2 B;  1I6H H;  4IFD G;  4LF6 Q;  4CDE C;  3X3M A;  2Q2I A;  1IL8 A;  2DJG C;  3S1R B;  1GO3 E;  2IW3 A;  2G5D A;  4WFN 3;  2J4X A;  5CV9 A;  2QF7 A;  1YNN D;  4DR2 Q;  2Y0S G;  2FIN B;  3QOL A;  1HH2 P;  1VQH A;  1FR3 A;  2B2U A;  3U58 A;  3E0J A;  4X3U A;  4A93 H;  3GD7 A;  5C3X A;  5TSS A;  5EPK A;  1JR0 D;  1QWY A;  3AQQ A;  4A3D B;  1VF7 A;  1QE6 A;  2YYZ A;  1LT6 D;  2KEC A;  2RA4 A;  3KLS X;  1SNO A;  3WOF A;  4DV2 Q;  3I91 A;  1PH6 A;  3RZD B;  4YHH L;  3HOU B;  1Y1V B;  1J8I A;  2B2V A;  3QB3 A;  3CKI B;  3I70 A;  5C3E G;  1EL0 A;  1II3 A;  2UXD Q;  2DNE A;  3STB C;  4WJ4 A;  4CJ2 C;  1VQJ A;  1I50 B;  2B2Y A;  3C1F A;  3D4R A;  4R4Q A;  3I56 A;  3NBH B;  2IHF A;  2PW7 A;  2I5M X;  1G29 1;  1PTO B;  2ID0 A;  3KJP A;  5IE8 A;  2HCI A;  4G7H C;  3DEP A;  4ZQ3 A;  1WTW A;  2CQA A;  4LUV A;  2UUB Q;  1SNP A;  4AYB B;  1STG A;  5E1F A;  5FLM G;  3CCV A;  2KUM A;  1B53 A;  2JE6 I;  3HOW G;  4C3I G;  3HKZ G;  4EQO A;  1GXD C;  1CKN A;  2F0D A;  5C0X H;  4DV5 Q;  3DXJ C;  1L2F A;  2O5I C;  2B63 H;  4B9W A;  4GKK Q;  4DAV A;  2NZ1 D;  2PMZ B;  3NP8 A;  1TS5 A;  1TS3 A;  3OWF A;  3I4O A;  3S17 B;  1HZ9 A;  4YIJ A;  1PYB A;  1N8R C;  4IUQ A;  1ENC A;  1BO0 A;  3I8Z A;  3CC4 A;  2BCO A;  5LHY 1;  1D8L A;  1PMR A;  5KNC A;  5IWA Q;  1BCP F;  4O1N A;  2NWG A;  3P1H A;  1SEB D;  2A73 B;  2Z6K A;  1STN A;  2CKZ B;  2VS1 A;  1CHP D;  1PTO C;  3Q8D A;  4DR4 L;  4X66 Q;  1KLU D;  1YNJ C;  4DV1 Q;  1HTP A;  2L4N A;  3VR3 A;  4M1U B;  5ISR A;  2RKS A;  4CGY B;  2XNA C;  5T1G A;  4HJ5 A;  4DR3 L;  1I4R A;  4DV7 Q;  1BXT A;  1SAP A;  4ODG A;  4BBR B;  2EVB A;  1B7Y B;  2JA9 A;  1SMY D;  5IT9 L;  4B3T Q;  4GKJ Q;  1LYL A;  5EGT A;  4DNI A;  1UE6 A;  5JJL A;  2F0O A;  3I4M G;  1MJC A;  4UP9 A;  1VMP A;  1WTQ A;  1WOC A;  4UPA A;  5HGT A;  3A74 A;  1TR5 A;  3KLW A;  4OWX B;  1ICF B;  4DA2 A;  1K83 B;  4HSV A;  3S1R H;  1PDQ A;  1ENA A;  4PMC A;  4NXN Q;  5LMU Q;  4A3K B;  1GJX A;  3BG3 A;  3K6O A;  2M2L A;  2B2W A;  1PFB A;  3QJY A;  4LF4 L;  3MFG A;  4XT1 B;  2A19 A;  1T9H A;  1K73 C;  4HJA A;  3U4V A;  4POG A;  2K52 A;  4JOI A;  3BZD B;  4GLA C;  1RJT A;  2NVX B;  1BOS A;  5EBC A;  1SFO B;  2SOB A;  4IJL A;  3HEJ A;  5CV4 A;  5C4X B;  1JJG A;  2ZJR A;  1G8Z D;  1D5M C;  1LTR D;  4LAA A;  4A3D H;  3CF5 A;  1UE7 A;  1D5Z C;  2MUY A;  4ME5 A;  1GHK A;  1TWA B;  2OQ0 A;  3BZK A;  3EBE A;  3RZD H;  3HOU H;  1VMC A;  1Y1V H;  5EPJ A;  4CDF C;  5M5X B;  1TII D;  4YWK A;  2N3S A;  3B6Y A;  1CK1 A;  4KLK A;  4NB3 A;  2B2T A;  1JIC A;  3OMC A;  1I50 H;  4HIO A;  4K5X A;  1K8O A;  1PTO H;  2UXC L;  3QWN A;  1LTS D;  2IX1 A;  2Z4I A;  3BS1 A;  2UXB Q;  4TKO B;  1WTR A;  2RHQ B;  5EKK A;  3T1Y L;  5J22 A;  3QG1 A;  4JYA L;  4IPC A;  4Y7N B;  1GUO A;  3C1E A;  2LKV A;  4L63 B;  4APV A;  4FNF A;  1Y1W G;  4RMF A;  2A74 C;  5COY A;  5M3M G;  4L6T B;  4OEM B;  3S17 H;  4Q5V A;  2O2L D;  4JI7 L;  4JVZ A;  3PUZ A;  3MAQ A;  1KAA A;  1KL9 A;  4MTN A;  4NP5 A;  1PRT D;  2OT2 A;  1XNQ L;  2JA8 G;  3OTO L;  3VYR A;  4HR7 B;  1A62 A;  4DK3 C;  4OHJ A;  4X62 Q;  1VQ8 A;  4ZCK A;  4CKC A;  1JOQ A;  4L5Q A;  4XDX A;  4V0B A;  1O7I A;  1VQE A;  4JW0 A;  1BCP B;  4A3F G;  3I4N B;  1TY0 A;  1VCI A;  3T1H L;  4BBR H;  5IT9 E;  1XPR A;  1SYB A;  3PO2 G;  4DNR B;  5FOB B;  4MNO A;  5CGK A;  4JI6 Q;  1JT8 A;  1A6X A;  2D0O A;  2FJ2 A;  4LFB Q;  5ELN A;  1LV9 A;  5EQ0 A;  5IYD G;  1B9M A;  1K83 H;  4DR7 L;  2E74 C;  4P71 A;  1IBK Q;  4A3K H;  3E0E A;  2F0E A;  2A8V A;  2H5X A;  2EY1 A;  5E3F A;  1RTO A;  4QY7 A;  2QKI C;  4IUN A;  2XWB B;  2NN6 I;  4HMI A;  1MSG A;  2L1B A;  3Q24 A;  1IYU A;  2UUA Q;  2R3Z A;  2DN8 A;  5BN3 A;  1S5E D;  2NVX H;  1SFO H;  4C1N K;  1L1O B;  5E4W C;  1CQF A;  1BCP C;  5C4X H;  1QZG A;  1T5E A;  3NEN A;  1H9S B;  4MN3 A;  1TWC B;  3CCR A;  1VQL A;  4C3H B;  2EIF A;  1TWA H;  2NVY B;  4RKB A;  3PO3 G;  4A3M B;  3UDG A;  2KOL A;  5M5X H;  2X6L A;  1PH7 A;  2E5L Q;  5C4H A;  4DUZ Q;  1D2B A;  4TRD A;  1NE3 A;  3S16 B;  1FGU A;  3M7G A;  2QDB A;  3GTP B;  3CC2 A;  1I4P A;  3FMC A;  1ZYR D;  4R8I A;  3J81 j;  1E1T A;  2ICI A;  4P2C B;  1HQR D;  1XTC D;  2K28 A;  4C56 C;  2K05 A;  4JBW A;  3TRE A;  5J3B A;  5DM7 3;  4BWG B;  4V19 0;  1NSN S;  1E22 A;  1LTI D;  3VR5 A;  1XPO A;  1OTC A;  2YTX A;  4Y7N H;  1A0I A;  3AFP A;  1XMO Q;  4C3J B;  3JC6 6;  3NEM A;  3J81 c;  1TVX A;  2OXP A;  1ICW A;  1RCV D;  4TVA B;  5M5W B;  3BDO A;  3ERS X;  2A69 D;  3AFQ A;  4LFC L;  2IT1 A;  2R93 G;  2BH2 A;  1I5F A;  5FJ8 H;  3K59 A;  3C46 A;  1U4R A;  3A54 A;  4EX5 A;  4KY7 A;  2PZW A;  4L8J A;  5KYL A;  4JI8 L;  1CFM A;  1SSO A;  1IYV A;  2WB1 B;  5IY0 A;  3RD4 A;  4GLX A;  1MGS A;  4PQX A;  5M3F G;  2WKD A;  2F0Q A;  2KED A;  5CV8 A;  1KAB A;  1FVI A;  1PFM A;  4AYB E;  5DLQ E;  5CBE E;  4WJW A;  5GAG C;  4AQY L;  4G57 A;  4BA2 I;  2ASB A;  2DJF C;  2RVL A;  2R7Z B;  1TS2 A;  1O7Z A;  2M9V A;  2NB0 A;  5IYC G;  1A2U A;  1HFG A;  4LF6 L;  2PMZ E;  2HUG A;  4CJ1 B;  1L1O A;  4ZKC B;  1JE4 A;  1SE2 A;  4R8N A;  5KIX A;  1U4M A;  3MFY A;  1H9S A;  4M8A A;  3ICE A;  2C9O A;  3O13 A;  4DR2 L;  2ZTD A;  3PF5 A;  4FYD A;  1H9J A;  3ITP A;  1B8A A;  4A3B G;  1JE5 A;  1N32 L;  1Y69 U;  3G48 A;  2K01 A;  5JEA H;  4U68 A;  3HOX G;  1TWC H;  4HSP A;  1PRT F;  1A8V A;  2VNU D;  2AHO B;  4C3H H;  1Z6H A;  3S1M B;  2NVY H;  2AUJ D;  1JQY D;  4HAE A;  4HCS A;  3DHQ A;  3SGI A;  4A3M H;  4BY7 B;  5IGE A;  4MTK A;  1WTX A;  4H44 C;  3FKI B;  5DAU A;  3ULJ A;  4DV2 L;  4A3I G;  3S16 H;  1Q81 C;  3R8B A;  2BDO A;  1YZ6 A;  3GTP H;  4JYA Q;  1KC8 C;  4RGO S;  2JA5 G;  2RDF A;  2JA7 B;  2JQO A;  1SYG A;  1EY5 A;  2UXD L;  5CV7 A;  1N34 Q;  2NVQ B;  3LX0 A;  3TBI B;  1PZK D;  3H3V C;  4P73 A;  1BF4 A;  4DAY B;  4EQP A;  1EIY B;  5IP9 H;  1JJC B;  1R4P B;  4C3J H;  4HIM A;  3OTO Q;  4CKB A;  2UUB L;  5M5W H;  2K6A A;  5COR A;  4A3J B;  1PH3 A;  3SK6 A;  2VQF Q;  4DF7 A;  1E2V A;  3ULP A;  4K8I A;  4DV5 L;  4GKK L;  3K58 A;  1PH9 A;  4QB4 A;  2KA7 A;  3I72 A;  1DOK A;  2CFM A;  3DM3 A;  1SE3 A;  3UI2 A;  3C3L A;  5NUC A;  4A3L G;  3SHL A;  5IWA L;  2BE5 D;  4FF4 A;  4KJO A;  1PZJ D;  1SMY C;  2B8G A;  2PI2 A;  2R6G A;  5DM6 3;  3RZO B;  1IHZ A;  1E2Z A;  3VYT A;  4X66 L;  3GTM B;  4DV1 L;  1F2Y A;  2DUD A;  3KDF B;  3KF8 B;  5JPM C;  1AN8 A;  1E0B A;  3BJU A;  4DV7 L;  4HJ9 A;  2Q2T A;  4OIK A;  4IUU A;  1WTO A;  3E6Z X;  3E9I A;  2KCN A;  3JAM i;  4NKL A;  4GKJ L;  2R7Z H;  2EXZ A;  1QJO A;  2WAQ B;  1SR3 A;  2V4D A;  1EQT A;  1JOO A;  2L11 A;  3P7J A;  4ZUI A;  4PMB A;  1GVP A;  1RTN A;  1F77 A;  4B3M Q;  2L0C A;  4NXN L;  5IGD A;  5LMU L;  3X3N A;  2EE1 A;  2WP8 J;  3S15 B;  4KI0 A;  2MJ8 A;  1PZI D;  1STE A;  2QEJ C;  4OEL B;  2HHH Q;  3HGB A;  4KK7 A;  3IFT A;  3K0X A;  1RIP A;  5KND A;  3GTJ B;  1YVC A;  3SK8 A;  2NN6 G;  1X3G A;  3WWV A;  1PTO F;  3S1M H;  4LJZ C;  2ES2 A;  2RDG A;  4BY7 H;  1CZG A;  5FKA C;  2K5H A;  3FHW A;  5I9P A;  1YJ9 A;  2K5D A;  4A3E B;  4KHZ A;  3FKI H;  2F52 A;  1ASY A;  3HOY B;  1PRT B;  2QGQ A;  1J5E Q;  1DON A;  1GUW A;  4BY1 G;  3KK7 A;  3A5Z B;  4K0K Q;  4QMG A;  4EQN A;  3FP9 A;  1BQQ T;  2JA7 H;  4UP8 A;  1G6P A;  1UE5 A;  4DAY A;  1WCM B;  3A7A B;  1QNU A;  2XSC A;  4DXF A;  4XQJ A;  4A75 A;  3H0G B;  2NVQ H;  4JV5 Q;  5CBA E;  4A76 A;  4BBS B;  2JK8 A;  3WDN A;  4IAL A;  4KHP Q;  1UAP A;  2K33 A;  2MHV A;  4LFC Q;  1X6O A;  1KAW A;  2C35 B;  2R92 B;  1HJP A;  4O0A A;  3KLS A;  1JMC A;  2UXB L;  1SN8 A;  5J39 A;  1PA6 A;  4YY3 Q;  2F0P A;  4R4C A;  2ZJQ A;  1KLG D;  1IKL A;  5JJI A;  3RN5 A;  1V1P B;  2XN9 C;  5CYU A;  1AH9 A;  4A3J H;  1V8Q A;  1D1I A;  2B2V C;  1WVL A;  2WAC A;  1PRT C;  2NBF A;  1ROD A;  1G2S A;  1F9R A;  2K04 A;  1ESF A;  4K6D A;  4R4I A;  4YCV A;  3K7A B;  2TMP A;  4XQQ A;  3CCL A;  3N6R A;  3KDF A;  2LXK A;  2QDL A;  4F87 A;  1BBX C;  1N33 Q;  1KDB A;  3KF8 A;  4XXE A;  5FLX E;  2VUM B;  2O5J C;  2LXJ A;  4XT3 B;  5CV5 A;  1QZH A;  2I07 B;  4OX9 Q;  3RZO H;  4IQZ A;  1L0X B;  4HED A;  2XRQ D;  1CM9 A;  1U9R A;  1VQP A;  3GTM H;  1FL0 A;  4X62 L;  1H9M A;  4JI4 Q;  1KNA A;  1CT1 D;  1QVC A;  2CWA A;  2JP1 A;  3Q22 A;  5KEE A;  3DLL A;  1HCZ A;  1IXR A;  1QB5 D;  1EUJ A;  4K6L A;  1DCZ A;  4JI6 L;  4BXX H;  1NR4 A;  3S14 B;  4LFB L;  1N32 Q;  3W1G A;  1HPC A;  4DV6 Q;  1EU4 A;  2EYM A;  1U0L A;  4OGQ C;  2ZJP A;  1IBK L;  3J7A F;  2ZT9 C;  4FXD A;  2Y0S B;  3S15 H;  4X3T A;  1C9O A;  1PFN A;  2Z6K C;  3H94 A;  4O2D A;  5K36 H;  3ULL A;  2F1M A;  5IGC A;  2OWO A;  4DNT B;  2UUA L;  4HIK A;  3GTJ H;  2WB1 E;  1EY0 A;  1EZ6 A;  4FVM A;  5IP7 H;  2K03 A;  5ELO A;  3MZ5 A;  4G7Z C;  1BR9 A;  1CI3 M;  2LY7 A;  4EQ5 A;  1CSP A;  3EA6 A;  2RCN A;  5GRO A;  3GTL B;  5FK9 C;  2PQA B;  2Z9H A;  2E8G A;  4P74 A;  5BN5 A;  4A3E H;  1ZYR C;  4LF5 Q;  2KBN A;  2WII B;  3DUZ A;  3HOY H;  2B2W C;  2NZH A;  5C3E B;  3HP3 A;  2L9H A;  3Q0A A;  2E5L L;  4DUZ L;  2I46 A;  3I7F A;  2PZT A;  4JOI C;  1WCM H;  2BA0 A;  4DR6 Q;  4KY5 A;  5C5M A;  3H0G H;  3R3O A;  1I6V C;  4BBS H;  1NBW A;  2CH4 A;  4JI5 Q;  4QIW B;  1V1P A;  4TQU S;  2HCC A;  5ELB A;  4AYB G;  1TY2 A;  2BH8 A;  4IPD A;  2R92 H;  4K5W A;  3KF6 B;  2A69 C;  3K7U C;  3BVZ A;  4DAP A;  1HNX L;  2IY5 B;  3J80 i;  3HOW B;  4C3I B;  4GLV B;  3HKZ B;  3OIQ A;  2V1C C;  3TDQ A;  3A8I E;  1XMO L;  2RQX A;  3K5M A;  2KVM A;  1EIF A;  3R2I A;  3EVQ A;  2J7Z A;  4JI0 Q;  1AFP A;  2B2T C;  3K7A H;  3L2P A;  4X3S A;  3PIO 3;  4OO1 I;  4OIJ A;  4I7A A;  2L5T A;  4R1J A;  4OON A;  2VUM H;  2BDN A;  1KDA A;  5JPN C;  4JI1 Q;  4IUV A;  2YTV A;  4QUC A;  3T51 B;  1BDO A;  3U50 C;  2BA1 A;  3SEB A;  3EIV A;  4N9P A;  1GUS A;  1VQN A;  4ZK9 B;  2MQH A;  4L5S A;  3D31 A;  4IFD H;  4R9W A;  1O7L A;  2VZA A;  5I2X A;  3A5U A;  2CW0 D;  3V05 A;  4NXM Q;  2Z0S A;  3S14 H;  4MIU A;  1KIX A;  4K5V A;  4DK1 A;  1XJV A;  3J7A 5;  3MHB A;  2R7D A;  2H1E A;  3H3V I;  1ONL A;  1PFS A;  2VY3 A;  2F0J A;  3UDI A;  4UHV A;  2K5Q A;  1V1Q A;  1Y8O B;  1HR0 W;  1VS0 A;  3OSO A;  4IUP A;  2C5C A;  1BBU A;  2J0T D;  1EOV A;  1HFN A;  2PQA A;  2K5W A;  2RF4 A;  5D3I B;  5KNB A;  1QOH A;  3F8T A;  1GUG A;  2B29 A;  1Z47 A;  3MEH A;  4GN5 A;  3A56 A;  2ZM6 Q;  3FEW X;  4RGM A;  1Q90 A;  3GTL H;  2KEE A;  1E24 A;  2LS0 1;  2FMM A;  3OW7 A;  3M3Y B;  1SXT A;  4LF8 Q;  3PIO A;  1HNZ Q;  5G3L D;  1M1K C;  2WAQ E;  5C3E H;  1NJI C;  5FO7 B;  4XIG S;  4U67 3;  3KUP A;  1LT4 D;  5ELD A;  1GKH A;  1Z7T A;  2F0N A;  2IL8 A;  5C6A A;  3KF6 A;  1OXU A;  1WD1 A;  2KJX A;  5EBD A;  1VQ4 A;  2PW5 A;  1ZXT A;  5EKL A;  5IYB G;  2L12 A;  3P75 A;  1N34 L;  1PYS B;  1VQO A;  3GTO B;  1ASZ A;  5FLM H;  3DWP A;  5CMD A;  3CP0 A;  3CCQ A;  3HOW H;  1LTA D;  4C3I H;  1Y1W B;  5M3M B;  3CMA A;  4ID6 A;  3SE0 A;  3K5N A;  1F9P A;  1WYD A;  2ATW A;  2JA6 G;  3S24 A;  1PH5 A;  5JVG 3;  2EQS A;  3CAM A;  4H0L C;  1B3A A;  2A1A A;  5KGU A;  2F0G A;  2VQF L;  2Z4H A;  1Q46 A;  2Q2U A;  3CCS A;  4S3S A;  4HCE A;  1V1O A;  2EYH A;  1VQI A;  3G71 A;  3PSI A;  2MNA A;  3I4N G;  1MD2 D;  3I4L A;  3J81 L;  4A3F B;  1RL2 A;  1B1Z A;  1YNX A;  2F0F A;  1PHJ A;  3K5L A;  3D0F A;  2OTL A;  3RR5 A;  4KKS A;  3T53 B;  5CV6 A;  1TS4 A;  3KJO A;  1IW7 C;  3OOC A;  1K3R A;  1GHJ A;  1UEB A;  1FGB D;  2JN4 A;  2I5L X;  2Q8R E;  1CA5 A;  1B4O A;  2VB2 X;  4WRD A;  4B3M L;  1JOR A;  1SBB B;  3K5O A;  4J1M A;  4GNX B;  1S5D D;  4DR1 Q;  1KQS A;  3V96 A;  2AUK A;  4IOA A;  1M8A A;  3L7Z C;  2D2C C;  4DAM A;  1Y8P B;  2HHH L;  3G7L A;  5K5P A;  3JAM c;  1XX8 A;  4F7X A;  3PO3 B;  3K81 C;  2G9H D;  4UAI A;  3M3Y H;  1BUV T;  1F9Q A;  1XNR Q;  2F0L A;  3IKJ A;  3ZYY X;  1E2W A;  1L1O C;  5C44 G;  1K28 A;  1O80 A;  1Q8I A;  3TS2 A;  5C0X I;  4ZLT F;  2XIW A;  3IRB A;  1J5E L;  1JB7 A;  1HNX Q;  4RGT A;  1QUQ B;  2Y0S E;  4RFB A;  4A3G G;  1S5C D;  2XVS A;  4K0K L;  2EYP A;  3T4A C;  2N55 A;  3MC0 B;  3J7Y W;  1U4L A;  1FJG Q;  5ELF A;  1HXY D;  1C7Y A;  1AP0 A;  1VQ9 A;  4JPB W;  3BYY B;  4CHT B;  4CKE A;  3OPO A;  3K57 A;  3SXH A;  2Z1C A;  2A6E C;  4JV5 L;  1MSH A;  4RCN A;  3GTO H;  1UUP A;  4XYO A;  3A8K E;  4KHP L;  2F0T A;  1RF2 D;  2SEB D;  1WTP A;  2B3G A;  3WOE A;  3TP8 A;  1Y1W H;  4ZYS A;  5M3M H;  3I3C A;  1ET9 A;  1DGS A;  3TS0 A;  3IAY A;  4YY3 L;  1JWM D;  2DNC A;  2EYO A;  1STY A;  3Q6S A;  1VDZ A;  2WIN B;  4G4K A;  3I55 A;  2R61 A;  5ELC A;  4Z9C B;  2RSN A;  3GO5 A;  5A35 A;  1CUK A;  1HTL D;  3OYY A;  1B50 A;  3R2T A;  2WB1 G;  5C5L A;  3GQB A;  3UDX A;  1G91 A;  5G3L F;  1ET6 A;  4DK6 C;  2GA4 B;  4IOC A;  4RWS C;  3J81 E;  3CPW A;  1N33 L;  4A3F H;  1YNN C;  3ERQ A;  2MGS A;  5M3F B;  4AH6 A;  4OX9 L;  4QIW E;  1ILP A;  4OO1 G;  4FXG C;  5I6Y A;  1TQO A;  1WI5 A;  5FO8 B;  3AMU A;  1DYQ A;  5IYD H;  3ZJY C;  4JI4 L;  1VQM A;  5KYI A;  1Q7Y C;  1EIH A;  3HKZ E;  1WD0 A;  5JJK A;  2E2H B;  2AKW B;  4GNX A;  4KKT A;  3D3R A;  2EY5 A;  3NK9 A;  5C0X J;  4KY6 A;  1WJJ A;  3M4P A;  5LMN W;  4LWC A;  5LL6 X;  3CME A;  4J15 A;  1QNK A;  4DV6 L;  3NBI A;  4RKL A;  5AJ3 Q;  1SYD A;  4DN4 M;  3KFU A; 
#chains in the Genus database with same CATH homology
 2E2D C;  1A2T A;  2K32 A;  5F2D A;  3PIP 3;  3TZD A;  4ILW A;  1RHP A;  4IUT A;  3HOX B;  3J7A V;  5D3D A;  4B9X A;  1QCB D;  2DY7 A;  3KBG A;  2WKC A;  2JEA I;  2RBM A;  4A3I B;  3SK5 A;  3IL8 A;  3S9W A;  1NR2 A;  3H09 A;  2JA5 B;  3FRP B;  3DEO A;  3W2D A;  4K8J A;  3DWA A;  3QIA A;  2A6H D;  3LWE A;  4RGN A;  2OEO A;  1DOL A;  2EJG C;  1CQV A;  2H4O A;  3KLR A;  1EZ8 A;  3P20 A;  3HOV B;  1C48 A;  1C4Q A;  3URY A;  5I9O A;  4HMJ A;  2ZXR A;  1OXX K;  3MWY W;  1FNV A;  1A3T A;  5BN4 A;  4EVO A;  4DXG A;  3M4Y A;  3V2T A;  4ABN A;  1K8M A;  3NXW A;  2PNR C;  1EY9 A;  3M85 A;  3BVG A;  4E6I A;  4IZ8 A;  2CW0 C;  5C3W A;  2SNS A;  2ICE C;  4ZAI A;  2F4I A;  4ZRZ A;  3NWS A;  5HUR A;  1FD7 D;  1EEF D;  5C4Z A;  1T5X D;  4CBV A;  1EY4 A;  1F9S A;  1SE4 A;  1XYI A;  4KKU A;  4KHV A;  1CZW A;  1JC7 A;  3OIP A;  5E4X A;  1BNZ A;  1AEX A;  4KJN A;  1EWH A;  1JCK B;  1D1K A;  4BA1 I;  1LT5 D;  1X3Q A;  3AB9 A;  3F2U A;  3EFX D;  2SNM A;  3HOZ B;  2VB3 X;  1TWF B;  2QCP X;  1OO9 B;  4GZY C;  3EQL C;  1R4Q B;  3BYT B;  4BY1 B;  3S2H B;  1UNS A;  4H7B A;  2EDG A;  2F0U A;  3SDZ A;  1D6E C;  5C0X G;  2ZXP A;  1STH A;  3NTK A;  2SDF A;  2E2J B;  2O4X A;  4IUR A;  4TSS A;  4NDX A;  1B9N A;  4KD4 A;  2WV6 D;  3QO2 A;  1NAP A;  2IJ0 A;  3FDT A;  1A3U A;  1MI2 A;  5IOC A;  4FF2 A;  3M7N A;  4KV6 A;  1EQV A;  3ONA B;  2F3W A;  1NUC A;  2EJM A;  1Y8N B;  1LAC A;  1S5B D;  1XXG A;  1I4G A;  1SND A;  5DEH A;  4XYQ A;  1EOT A;  4RH6 A;  2KCC A;  4ULL A;  1S5F D;  1O7Y A;  5LL6 S;  1F2Z A;  2JYO A;  1NCV A;  4NMZ A;  3TP7 A;  2CVR A;  5ELE A;  3S1N B;  2KHS A;  2FMC A;  2L55 A;  3VR4 A;  1LT3 D;  1X3P A;  4FF1 A;  5I4D A;  4H13 C;  2NN6 H;  1U4P A;  1TKW B;  1V43 A;  1B44 D;  3OWE B;  2CHB D;  3LWU A;  4HTH A;  3MVV A;  1F2L A;  4F8M A;  3NQI A;  1ZEQ X;  1I4X A;  1SNQ A;  3SK4 A;  3I90 A;  3DWQ A;  2B39 A;  1GUN A;  1JOK A;  1ENF A;  1EY6 A;  4X3K A;  1SDF A;  3DMU A;  1MBY A;  1O78 A;  3IFD A;  5IGB A;  4RHS A;  3PUV A;  5AFW A;  3W3A A;  5J1Z A;  3TME A;  5JEA J;  4J8Q A;  4C1N I;  3PV0 A;  1OXV A;  2VXW A;  2A68 D;  2HQE A;  1JB3 A;  2MP1 A;  1F2M A;  2EJF C;  4KMU C;  5I2Y A;  3U9O A;  2X6G A;  5EKI A;  2PZU A;  3FVQ A;  1PXU A;  2E2I B;  2NTS A;  1DM0 B;  3PUX A;  3I4M B;  3MXN A;  1PLF A;  5IOD A;  2ENB A;  1SYC A;  2F0I A;  2F0H A;  1SNM A;  3NSW A;  1SYF A;  1VF5 C;  2KQ3 A;  5KRU A;  4KN7 C;  4NW2 A;  5I6W A;  1H9K A;  3NWT A;  3H6M A;  3NPP A;  1RKN A;  1FNU A;  2IPK D;  4B08 A;  1HQM C;  2FFK B;  4FO2 A;  1W6K A;  3BDC A;  1EWC A;  5JOB A;  3A8J E;  4FXK C;  5CC4 A;  3S2D B;  2D9U A;  3HZX A;  1LAB A;  4ZKB B;  5DNF A;  2F3V A;  3D4W A;  1IKM A;  1I4Q A;  2B8F A;  3PUW A;  4O42 A;  3HS0 C;  2RDH A;  3K0Y A;  2M00 A;  2NYZ D;  3NBH A;  4N9T A;  5T1I A;  3PUY A;  4DGZ A;  2AQ1 B;  2A6H C;  3LNN A;  3TP6 A;  3JAM L;  3GV3 A;  1R9T B;  2F03 A;  4KTA A;  1FYC A;  3MXG A;  2BE5 C;  4LMQ D;  2JA6 B;  2JA8 B;  1EEI D;  2F0W A;  1X32 A;  2AWN A;  1LTG D;  1LTT D;  3HRZ C;  3T13 A;  1EIG A;  2NUC A;  2F0V A;  3MXU A;  2EYF A;  3FPP A;  3PO2 B;  4DFA A;  4QF4 A;  2EY2 A;  3OHX C;  2Z8L A;  1KDC A;  3S1Q B;  2IWH A;  3CQZ B;  2AQ3 B;  2E76 C;  1C8C A;  4G7O C;  1GOZ A;  2DY8 A;  4JK1 C;  3GTQ B;  1S4Z A;  5JEA G;  4IN3 A;  3D6W A;  2D62 A;  4C3H G;  5JJZ A;  5D65 A;  2EY6 A;  2JSO A;  3TZU A;  1RDP D;  5M9O A;  1QIL A;  3FPU B;  3GTG B;  2XRS D;  5M5Y B;  1EFI D;  2MPM A;  3ERO A;  3T56 B;  3MTS A;  3U9S A;  3T16 A;  2LFN A;  4XTC S;  3VYS A;  3QOJ A;  2E75 C;  2D5D A;  5C44 B;  3NTI A;  3CRL C;  4KN4 C;  1DXM A;  1AZQ A;  1EY7 A;  1STB A;  1EYA A;  2A5H A;  4A3G B;  4DU9 A;  4C3J G;  4I7Z C;  3G6J B;  5EJW A;  3D6C A;  1I4H A;  3JAM E;  2F0M A;  1PYW D;  5IGF A;  1CHQ D;  3CU7 A;  3RLF A;  2LMC B;  1A15 A;  5IGG A;  2OF1 A;  2YU9 B;  1ILQ A;  4FP5 D;  1EU3 A;  2R93 B;  1L0Y B;  4LK1 C;  4PMW A;  2HDL A;  3HG9 A;  2QIL A;  1ESR A;  1DZ1 A;  3GP7 A;  2AWO A;  3CRK C;  1OXT A;  1Q1E A;  4IFD I;  2TSS A;  3D8G A;  1ZKO A;  1SJE D;  1LO5 D;  3ND8 A;  1PTO D;  1YNJ D;  1B2T A;  1OXS C;  1G6Z A;  1M4V A;  2EYL A;  2BOS A;  1TWH B;  4Q0F A;  2ZXO A;  2K1B A;  3SR1 A;  3VR2 A;  4C2M B;  1W6J A;  1UEA B;  3AU7 A;  1CTM A;  2EOT A;  1DD2 A;  1HA6 A;  3VA7 A;  1KNE A;  1AZP A;  4A3B B;  1KTK A;  1HUN A;  3J80 L;  2N88 A;  1TT2 A;  3MA2 B;  5CR3 A;  3BVM A;  3C2P A;  1A3V A;  1GUT A;  1Q3L A;  3VYU A;  1HHV A;  3Q23 A;  1G2T A;  2F0K A;  4HN7 A;  5FO9 B;  3E5S A;  2PO4 A;  3D4D A;  3VA5 A;  2PQE A;  4IFD J;  5JAV A;  2X69 A;  1DOM A;  4XQN A;  4FF3 A;  4DK0 A;  2AQ2 B;  2EYJ A;  1CA6 A;  3NUC A;  1FNW A;  2Q8I B;  3TN2 A;  1LTB D;  2IX3 A;  3M4O B;  1ML0 D;  2FHT A;  4WOR A;  4K14 A;  4UDU C;  2PCF B;  3GTK B;  3N52 A;  5A2Q L;  2A68 C;  4F88 A;  3GV6 A;  3TSS A;  1XWE A;  3NHH A;  1TWG B;  4PV1 C;  3BDL A;  3SVM A;  1I3Q B;  1JWS D;  1RD9 D;  4RCO A;  4I65 A;  2NVT B;  3A55 A;  3I73 A;  5C4J B;  4CJ0 B;  4RA8 A;  5FLX L;  1I6H B;  3L9A X;  3L3O C;  2IX0 A;  1JWU D;  4K2K A;  2F0S A;  2HDM A;  4EGV A;  5IIF A;  4J6H A;  4OO1 H;  3TP5 A;  4ZUJ A;  1SNC A;  3A7L A;  4RHR A;  1Q12 A;  5K36 G;  3VR6 A;  4KD3 A;  1STA A;  1AW7 A;  1Q1B A;  1J9O A;  4A93 B;  2PPB C;  4PNY A;  2PYK A;  1IW7 D;  3NE5 B;  5D14 A;  3J80 E;  1BCP D;  4QUF A;  5JVH 3;  1D5X C;  3EJI A;  1WTV A;  3RUZ A;  1EYC A;  2G9D A;  2NTT A;  3R93 A;  4MHE A;  1SYE A;  1HUM A;  1EYD A;  3NQT A;  1QG7 A;  2B2U C;  1HRJ A;  2EPB A;  2Q8T A;  2JXM B;  3DM1 A;  1LLR D;  3NTH A;  4OL7 A;  3ND9 A;  3RMH A;  5A2Q E;  2B63 B;  4QCL A;  1HA5 A;  2EZV A;  2K7V A;  2JEB I;  3PMF A;  4RAU C;  2XWJ B;  2A6E D;  2RSO A;  5EPL A;  4BS9 A;  3H91 A;  1H9R A;  1SJH D;  3KBX A;  2B2Y C;  4K2L A;  3OMG A;  1EY8 A;  1DJR D;  3CHB D;  3MXP A;  1TU2 B;  4IFD G;  3X3M A;  1IL8 A;  3S1R B;  2IW3 A;  4WFN 3;  2J4X A;  5CV9 A;  2QF7 A;  1YNN D;  3QOL A;  2FIN B;  1FR3 A;  2B2U A;  3E0J A;  4X3U A;  3GD7 A;  5C3X A;  5TSS A;  5EPK A;  1JR0 D;  1QWY A;  4A3D B;  1VF7 A;  1QE6 A;  2YYZ A;  1LT6 D;  2KEC A;  2RA4 A;  3KLS X;  1SNO A;  3WOF A;  3I91 A;  3RZD B;  3HOU B;  1Y1V B;  1J8I A;  2B2V A;  3QB3 A;  3CKI B;  3I70 A;  1EL0 A;  1II3 A;  2DNE A;  4CJ2 C;  1I50 B;  2B2Y A;  3C1F A;  3D4R A;  2PW7 A;  1G29 1;  1PTO B;  2ID0 A;  2HCI A;  4G7H C;  3DEP A;  4ZQ3 A;  1WTW A;  2CQA A;  1SNP A;  4AYB B;  1STG A;  5E1F A;  2KUM A;  1B53 A;  2JE6 I;  4C3I G;  4EQO A;  1GXD C;  2F0D A;  2O5I C;  5C0X H;  3DXJ C;  4B9W A;  4DAV A;  2NZ1 D;  2PMZ B;  3NP8 A;  1TS5 A;  1TS3 A;  3OWF A;  3S17 B;  4YIJ A;  4IUQ A;  1ENC A;  1BO0 A;  3I8Z A;  2BCO A;  5LHY 1;  1PMR A;  5KNC A;  1BCP F;  4O1N A;  2NWG A;  3P1H A;  1SEB D;  2A73 B;  1STN A;  1CHP D;  1PTO C;  1KLU D;  1YNJ C;  1HTP A;  2L4N A;  3VR3 A;  4M1U B;  5ISR A;  2RKS A;  4CGY B;  2XNA C;  5T1G A;  1I4R A;  1BXT A;  1SAP A;  4ODG A;  4BBR B;  2EVB A;  1SMY D;  5IT9 L;  5EGT A;  2F0O A;  1VMP A;  1WTQ A;  5HGT A;  1TR5 A;  4DA2 A;  1K83 B;  4HSV A;  1PDQ A;  1ENA A;  4PMC A;  4A3K B;  1GJX A;  3BG3 A;  3K6O A;  2M2L A;  2B2W A;  1PFB A;  3QJY A;  3MFG A;  4XT1 B;  3BZD B;  2NVX B;  1RJT A;  1BOS A;  5EBC A;  1SFO B;  2SOB A;  3HEJ A;  5CV4 A;  5C4X B;  1G8Z D;  1D5M C;  1LTR D;  4LAA A;  1D5Z C;  2MUY A;  4ME5 A;  1GHK A;  1TWA B;  1VMC A;  5EPJ A;  5M5X B;  1TII D;  1CK1 A;  2B2T A;  1JIC A;  3OMC A;  4K5X A;  1K8O A;  1PTO H;  3QWN A;  1LTS D;  2IX1 A;  2Z4I A;  3BS1 A;  4TKO B;  1WTR A;  5EKK A;  5J22 A;  3QG1 A;  4Y7N B;  1GUO A;  3C1E A;  2LKV A;  4L63 B;  4FNF A;  2A74 C;  5COY A;  4L6T B;  4Q5V A;  2O2L D;  3PUZ A;  3MAQ A;  1KAA A;  4NP5 A;  1PRT D;  2OT2 A;  3VYR A;  4HR7 B;  4OHJ A;  4CKC A;  1JOQ A;  4XDX A;  4V0B A;  1BCP B;  3I4N B;  1TY0 A;  1VCI A;  5IT9 E;  1SYB A;  4DNR B;  5FOB B;  5CGK A;  1A6X A;  2FJ2 A;  5EQ0 A;  1LV9 A;  1B9M A;  2E74 C;  2F0E A;  2EY1 A;  5E3F A;  1RTO A;  2QKI C;  4IUN A;  2XWB B;  2NN6 I;  4HMI A;  1MSG A;  2L1B A;  3Q24 A;  1IYU A;  2R3Z A;  2DN8 A;  5BN3 A;  1S5E D;  4C1N K;  5E4W C;  1CQF A;  1BCP C;  1T5E A;  1H9S B;  4MN3 A;  1TWC B;  4C3H B;  2NVY B;  4RKB A;  4A3M B;  2KOL A;  2X6L A;  5C4H A;  1D2B A;  4TRD A;  3S16 B;  3M7G A;  2QDB A;  3GTP B;  1I4P A;  3FMC A;  1ZYR D;  4R8I A;  2ICI A;  4P2C B;  1HQR D;  1XTC D;  2K28 A;  4C56 C;  2K05 A;  4JBW A;  5DM7 3;  4BWG B;  4V19 0;  1NSN S;  1LTI D;  3VR5 A;  4C3J B;  1TVX A;  2OXP A;  1ICW A;  1RCV D;  5M5W B;  3BDO A;  2A69 D;  2IT1 A;  3K59 A;  3C46 A;  1U4R A;  3A54 A;  4KY7 A;  2PZW A;  4L8J A;  5KYL A;  1CFM A;  1SSO A;  1IYV A;  2WB1 B;  3RD4 A;  1MGS A;  4PQX A;  2WKD A;  2F0Q A;  2KED A;  5CV8 A;  1KAB A;  1PFM A;  5CBE E;  4WJW A;  4G57 A;  4BA2 I;  2RVL A;  2R7Z B;  1TS2 A;  1O7Z A;  2M9V A;  2NB0 A;  1A2U A;  1HFG A;  2HUG A;  4CJ1 B;  4ZKC B;  1JE4 A;  1SE2 A;  4R8N A;  5KIX A;  1U4M A;  3MFY A;  1H9S A;  4M8A A;  2C9O A;  3O13 A;  4FYD A;  1H9J A;  3ITP A;  1Y69 U;  2K01 A;  5JEA H;  4U68 A;  4HSP A;  1PRT F;  2VNU D;  1Z6H A;  3S1M B;  4HAE A;  2AUJ D;  1JQY D;  4HCS A;  3DHQ A;  4BY7 B;  5IGE A;  1WTX A;  4H44 C;  3FKI B;  5DAU A;  3R8B A;  2BDO A;  4RGO S;  2RDF A;  2JA7 B;  1SYG A;  1EY5 A;  5CV7 A;  2NVQ B;  3LX0 A;  3TBI B;  1PZK D;  3H3V C;  1BF4 A;  4EQP A;  1R4P B;  4CKB A;  2K6A A;  5COR A;  4A3J B;  3SK6 A;  4DF7 A;  1E2V A;  4K8I A;  3K58 A;  4QB4 A;  2KA7 A;  3I72 A;  1DOK A;  1SE3 A;  3UI2 A;  3C3L A;  5NUC A;  3SHL A;  2BE5 D;  4FF4 A;  4KJO A;  1PZJ D;  1SMY C;  2B8G A;  3RZO B;  2R6G A;  5DM6 3;  1IHZ A;  1E2Z A;  3VYT A;  3GTM B;  1F2Y A;  5JPM C;  1AN8 A;  1E0B A;  4OIK A;  4IUU A;  1WTO A;  3E6Z X;  2KCN A;  4NKL A;  2EXZ A;  1QJO A;  2WAQ B;  2V4D A;  1EQT A;  1JOO A;  2L11 A;  3P7J A;  4ZUI A;  4PMB A;  1RTN A;  1F77 A;  2L0C A;  5IGD A;  3X3N A;  2EE1 A;  2WP8 J;  3S15 B;  4KI0 A;  2MJ8 A;  1PZI D;  1STE A;  2QEJ C;  3HGB A;  4KK7 A;  3IFT A;  5KND A;  3GTJ B;  3SK8 A;  2NN6 G;  1PTO F;  4LJZ C;  2RDG A;  1CZG A;  5FKA C;  5I9P A;  2K5D A;  4A3E B;  4KHZ A;  3HOY B;  1PRT B;  1DON A;  1GUW A;  3KK7 A;  4QMG A;  4EQN A;  1BQQ T;  4DAY A;  1WCM B;  3A7A B;  1QNU A;  2XSC A;  4DXF A;  4XQJ A;  3H0G B;  5CBA E;  4BBS B;  3WDN A;  4IAL A;  1UAP A;  2K33 A;  2MHV A;  2R92 B;  3KLS A;  5J39 A;  2F0P A;  1KLG D;  1IKL A;  1V1P B;  2XN9 C;  5CYU A;  1V8Q A;  1D1I A;  2B2V C;  1WVL A;  2WAC A;  1PRT C;  2NBF A;  1ROD A;  1G2S A;  1F9R A;  2K04 A;  1ESF A;  4K6D A;  3K7A B;  2TMP A;  4XQQ A;  3N6R A;  4F87 A;  1BBX C;  1KDB A;  3KF8 A;  4XXE A;  5FLX E;  2VUM B;  2O5J C;  4XT3 B;  5CV5 A;  2I07 B;  4IQZ A;  1L0X B;  4HED A;  2XRQ D;  1CM9 A;  1U9R A;  1H9M A;  1KNA A;  1CT1 D;  3Q22 A;  2JP1 A;  5KEE A;  1HCZ A;  1QB5 D;  4K6L A;  1DCZ A;  1NR4 A;  3S14 B;  1HPC A;  1EU4 A;  2EYM A;  4OGQ C;  3J7A F;  2ZT9 C;  4FXD A;  2Y0S B;  4X3T A;  1PFN A;  3H94 A;  5K36 H;  2F1M A;  5IGC A;  4DNT B;  1EY0 A;  1EZ6 A;  4FVM A;  2K03 A;  3MZ5 A;  4G7Z C;  1BR9 A;  1CI3 M;  2LY7 A;  3EA6 A;  3GTL B;  5FK9 C;  5BN5 A;  1ZYR C;  2WII B;  3DUZ A;  2B2W C;  5C3E B;  3HP3 A;  2L9H A;  3Q0A A;  2I46 A;  2PZT A;  2BA0 A;  4KY5 A;  5C5M A;  3R3O A;  1I6V C;  4QIW B;  1V1P A;  4TQU S;  2HCC A;  5ELB A;  1TY2 A;  4K5W A;  2A69 C;  3BVZ A;  4DAP A;  3HOW B;  4C3I B;  3HKZ B;  3OIQ A;  3TDQ A;  3A8I E;  2RQX A;  3K5M A;  2KVM A;  3R2I A;  3EVQ A;  2J7Z A;  1AFP A;  2B2T C;  4X3S A;  3PIO 3;  4OO1 I;  4OIJ A;  2L5T A;  2BDN A;  1KDA A;  5JPN C;  4IUV A;  4QUC A;  3T51 B;  1BDO A;  2BA1 A;  3SEB A;  4N9P A;  1GUS A;  4ZK9 B;  3D31 A;  4IFD H;  4R9W A;  1O7L A;  5I2X A;  2CW0 D;  3V05 A;  4MIU A;  4K5V A;  4DK1 A;  3MHB A;  2H1E A;  1ONL A;  2F0J A;  2K5Q A;  1Y8O B;  3OSO A;  4IUP A;  2C5C A;  2J0T D;  1HFN A;  2K5W A;  5D3I B;  5KNB A;  1QOH A;  1GUG A;  1Z47 A;  3MEH A;  3A56 A;  3FEW X;  4RGM A;  1Q90 A;  2KEE A;  2LS0 1;  2FMM A;  3OW7 A;  3M3Y B;  1SXT A;  5G3L D;  5FO7 B;  4XIG S;  4U67 3;  3KUP A;  1LT4 D;  5ELD A;  2IL8 A;  1Z7T A;  2F0N A;  5C6A A;  1OXU A;  1WD1 A;  2KJX A;  5EBD A;  2PW5 A;  1ZXT A;  5EKL A;  2L12 A;  3P75 A;  3GTO B;  3DWP A;  5CMD A;  1LTA D;  1Y1W B;  5M3M B;  4ID6 A;  3SE0 A;  3K5N A;  1F9P A;  5JVG 3;  4H0L C;  1B3A A;  5KGU A;  2F0G A;  2Z4H A;  4S3S A;  4HCE A;  1V1O A;  2EYH A;  1MD2 D;  3I4L A;  3J81 L;  4A3F B;  1B1Z A;  2F0F A;  3K5L A;  4KKS A;  3T53 B;  5CV6 A;  1TS4 A;  1IW7 C;  3OOC A;  1GHJ A;  1FGB D;  2Q8R E;  1CA5 A;  1B4O A;  2VB2 X;  4WRD A;  1JOR A;  1SBB B;  3K5O A;  4J1M A;  1S5D D;  3V96 A;  2AUK A;  1M8A A;  3L7Z C;  2D2C C;  1Y8P B;  3G7L A;  5K5P A;  1XX8 A;  4F7X A;  3PO3 B;  2G9H D;  4UAI A;  1BUV T;  1F9Q A;  2F0L A;  3IKJ A;  3ZYY X;  1E2W A;  1O80 A;  1Q8I A;  5C0X I;  4ZLT F;  2XIW A;  4RGT A;  4RFB A;  1S5C D;  2XVS A;  2EYP A;  3T4A C;  2N55 A;  3MC0 B;  3J7Y W;  1U4L A;  5ELF A;  1HXY D;  1AP0 A;  3BYY B;  4CHT B;  4CKE A;  3OPO A;  3K57 A;  3SXH A;  2Z1C A;  2A6E C;  1MSH A;  4RCN A;  1UUP A;  4XYO A;  3A8K E;  2F0T A;  1RF2 D;  2SEB D;  1WTP A;  3WOE A;  3TP8 A;  4ZYS A;  3I3C A;  1ET9 A;  3IAY A;  1JWM D;  2DNC A;  2EYO A;  1STY A;  3Q6S A;  1VDZ A;  2WIN B;  4G4K A;  2R61 A;  5ELC A;  4Z9C B;  2RSN A;  3GO5 A;  5A35 A;  1HTL D;  1B50 A;  3R2T A;  5C5L A;  3GQB A;  1G91 A;  5G3L F;  1ET6 A;  2GA4 B;  4RWS C;  3J81 E;  1YNN C;  3ERQ A;  2MGS A;  5M3F B;  1ILP A;  4OO1 G;  4FXG C;  5I6Y A;  1TQO A;  5FO8 B;  3AMU A;  1DYQ A;  5KYI A;  1EIH A;  1WD0 A;  2E2H B;  4KKT A;  3D3R A;  2EY5 A;  3NK9 A;  5C0X J;  4KY6 A;  5LL6 X;  1QNK A;  3NBI A;  4RKL A;  1SYD A;  4DN4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...