1F9RA

Crystal structure of platelet factor 4 mutant 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9rA00
1NAPA 2L12A 2MJ8A 5EQ0A 1QG7A 2B2YC 2H1EA 1EIGA 1HA6A 2XIWA 4QUCA 3UI2A 2IL8A 4CJ2C 3DEOA 3I8ZA 5D14A 1IKLA 4HSVA 1JICA 1HUNA 2Q8RE 1Q3LA 1WTXA 2HDLA 1A15A 3MWYW 1WTRA 3I3CA 4X3SA 1E0BA 2JYOA 2NZ1D 3TN2A 3DM1A 1TVXA 1X3QA 2KECA 2K01A 1HFNA 1AP0A 1F9RA 1KNAA 2B2VC 5E4XA 5CBAE 3R93A 1AZQA 4ZAIA 1CA5A 2FFKB 2FMMA 3SVMA 1B3AA 2B2UA 2DY8A 1WTPA 1J9OA 1HRJA 4RWSC 5CORA 1F2LA 4RA8A 1NCVA 1G91A 4HEDA 5CMDA 1BO0A 2CVRA 2K05A 4OIKA 1ESRA 2FHTA 1ILPA 4IURA 1F9QA 1U4RA 3QO2A 1B4OA 3KUPA 1KNEA 5EPKA 1NR4A 2DY7A 2J7ZA 4X3UA 4X3KA 2B2TC 3MTSA 1U4LA 1SSOA 2JP1A 1O80A 3I90A 2FJ2A 3IL8A 4ZLTF 1MI2A 2KOLA 2N88A 5EKIA 2B2WC 2RVLA 3D6WA 2SDFA 4LMQD 1DOMA 1VMPA 2NYZD 2X6GA 1EIHA 1PLFA 1EQTA 4CJ0B 1BNZA 2MPMA 3DEPA 3FDTA 2RSNA 1G6ZA 4XT1B 1S4ZA 4RAUC 1BF4A 1LV9A 1QE6A 2L9HA 1G2TA 4HCSA 2KEEA 4U68A 2B2YA 3ONAB 5T1IA 4IUTA 1B2TA 1RODA 2MP1A 4IUUA 1GUWA 1F9SA 4DN4M 2K28A 5JJZA 2NWGA 3GV6A 4O42A 5EPLA 2VXWA 1ML0D 2D9UA 1AZPA 1O7ZA 2BDNA 4IUVA 1SDFA 2X69A 3FPUB 4R9WA 1DZ1A 1WTOA 1MSGA 4MHEA 4CJ1B 5E4WC 1WD1A 1QNKA 2R3ZA 4IUPA 2HCIA 1XX8A 3I91A 5EPJA 1HHVA 4MN3A 1WTWA 5AFWA 1MSHA 3P7JA 1DONA 2B2VA 5EJWA 4R8IA 1BBXC 1XYIA 2L4NA 2L11A 4XDXA 3N52A 1IKMA 1ICWA 5COYA 1RHPA 2KVMA 1JE4A 2MGSA 2FINB 1DOKA 4QUFA 1B50A 5T1GA 1DOLA 4NW2A 2EPBA 4XT3B 1MGSA 4HAEA 1F9PA 1PFNA 4ZK9B 3H91A 1RTOA 1C8CA 3TZDA 4ZKCB 1U4PA 3LWEA 2B2UC 1ZXTA 1EOTA 2HDMA 2N55A 2Q8TA 1EL0A 1SAPA 2X6LA 3IFDA 1VMCA 2M2LA 1ILQA 2B2TA 4X3TA 2L1BA 2K04A 5CBEE 3HP3A 3G7LA 1X32A 1IL8A 3F2UA 1WVLA 1O7YA 1B53A 1RJTA 1NR2A 2KEDA 3KBXA 5D65A 1WD0A 1PFBA 2B2WA 1PDQA 2HUGA 2RA4A 3GV3A 4IUQA 2HCCA 1G2SA 1WTVA 2RSOA 5DNFA 1U4MA 1HFGA 1CA6A 1J8IA 2EE1A 1WTQA 2K1BA 1RTNA 1M8AA 1X3PA 1PFMA 4ZKBB 2K03A 1HUMA 4OIJA 2EOTA 2KUMA 1CM9A 3Q6SA 4UAIA
chains in the Genus database with same CATH superfamily
4DAMA 3N6RA 3J7AV 1TS4A 3I4MH 1IBMQ 1VQLA 3PIP3 1PH8A 1EY7A 2HHHQ 1N34Q 2SNMA 2NVTH 2F03A 1X3QA 4KKTA 1STHA 3D4WA 3C1EA 1PZKD 1IXRA 1KNAA 3HKZG 5BR8L 1AZQA 1CA5A 2B2UA 4DV1Q 1WTPA 3MXUA 2LSSA 4R4QA 4HSPA 3TS0A 4AYBG 3AFPA 1YHQA 3P20A 4FNFA 1T5EA 2JA5H 1YNXA 4IZ8A 4LF6L 4BA1I 1EIYB 2F0UA 4X3UA 2LMCB 4YIJA 3BDCA 4J8QA 3RLFA 3A7AB 2K5VA 1LYLA 2EYHA 4BBSG 1KLGD 4A3KB 4NP5A 4CJ0B 4JC0A 3L2PA 4FF1A 4RGNA 2MO1A 3TSSA 2Z1CA 1HNZQ 1CUKA 3PUYA 2NTTA 1S3OA 1HTPA 3I2ZA 4EQNA 3M85A 2N8NA 1XMQQ 2X69A 2Q2IA 1GVPA 1HQMC 1YJ9A 4GKJQ 1F2MA 1L1OB 3PSIA 2E2HH 2PI2E 2B63H 5IGEA 5JEAJ 3RN2A 1VQCA 1QVFA 3PCOB 4K0KL 3NEMA 1H9RA 3HGBA 1HCZA 1TWGB 1GUOA 3HOVH 2C9OA 1AFPA 1TWHB 4YHHQ 3D31A 4RMFA 4LF8Q 1PTOC 4C3HH 4KJNA 1EQQA 1Q8IA 1HR0Q 2Q8IB 2A74C 1LT5D 3HOUH 4DR7Q 1J8IA 3GTKB 3CCVA 1K73C 1PYSB 1VQBA 2EE1A 3CCJA 3CC4A 5EKLA 5I4DA 1SFOH 2VNUD 1EU4A 4G4KA 4ZKBB 3HG9A 4GKKQ 3HZXA 2DUDA 5A2QE 1XNQL 5TSSA 4L5TA 1Y69U 4DXGA 4DK0A 1YVCA 5D14A 2YU9B 1GKHA 2ASBA 4DV4Q 5AJ3L 1G291 2JYOA 1T9HA 2XVSA 2Z9HA 4B3TL 5IP9G 4X65L 3VR5A 2B2VC 5CV4A 2FFKB 4IPCA 2PPBC 2YYZA 4DK6C 4JI3L 5HGTA 2NZOA 2D5DA 1EWIA 4EVOA 2WAQE 5E7NA 4DR5L 4B3MQ 2E2JB 4HIDA 3CQZB 4POFA 3KUPA 4PZ8A 1X3GA 1O80A 4A3GB 2OQ0A 3BG3A 1XJVA 4TRDA 2BA0A 2RVLA 3L3OC 1EQTA 1CKOA 4QQBX 1NBWA 4A3MG 1VQGA 3S2DB 4A3KG 2KQ3A 4DA2A 1YJWA 1GO3E 2A68D 1QVCA 3VR3A 5JJZA 4M1UB 2AMCB 1AZPA 3W1GA 1GHJA 4IUVA 1QUQA 2F4VQ 1EY5A 1WD1A 5DAUA 4R4OA 3OTOL 5IOCA 3KFUA 4JI0Q 4DR3Q 4B3RQ 2HD3A 2YV5A 1ASZA 1DGSA 3I4MB 1CKMA 2A1AA 4JI7Q 5E1FA 4NXNL 1P16A 4HAEA 1PFNA 4HMJA 5LMNQ 3S24A 3NUCA 4L6TB 2NVTB 1N8RC 3F2BA 2L1BA 1HNXQ 4IPHA 4A3LG 4OX9Q 2OT2A 4QY7A 1B53A 3DM3A 4UY8C 1GUTA 2CKZB 1X6OA 4HCEA 5C5LA 3J7AF 2RSOA 1HXYD 3F8TA 1XPUA 2JA5B 2L0CA 2PMZE 2F0VA 3CPWA 4PMWA 1SRUA 3K0YA 2BA1A 1K28A 3H0GH 4K5XA 3V96A 1Z47A 4DUYQ 2GA4B 1ESFA 5LL6S 4DPGA 3S1MH 1J5EQ 3ULPA 4BY1H 2R92H 3A7LA 2M9VA 1H95A 3NHHA 1TWCH 3ERQA 4RCOA 1Y1WG 5JJLA 2WINB 1L0WA 3OW2A 2H5XA 2NN6I 1Q86C 2A19A 1OXUA 4LF9Q 2FMMA 1B3AA 1PVOA 2DY8A 4IJHA 2DJFC 3ZYYX 1EWHA 2AWOA 2CQOA 1KXLA 1AH9A 3FRPB 3H94A 3NE5B 4ODGA 2IJ0A 4DAVA 2UXBQ 2E2HB 4GLVB 1I50B 2K5QA 2B63B 4LJZC 1S5FD 3MTSA 2E5LQ 2VQEL 4KN7C 4X66Q 3M4YA 2ZJPA 2JXMB 1VF7A 1TY2A 4RHRA 1GM5A 1E3PA 1KD1C 4OO1H 4MZ9A 4C3HB 1LV9A 2QF7A 4HCSA 3DWQA 4DK1A 2UUBQ 1XPOA 3PO2H 4KMUC 4JI1L 5EPLA 4FYDA 1CZGA 3HOUB 4J15A 3K81C 2KBNA 1HPCA 3SDZA 1UE6A 4F8MA 1R9TH 5DEHA 1SFOB 3T51B 4EQ5A 3BU2A 2RBMA 4XXEA 2NVYH 3BDOA 1FNWA 4P2CB 1FL0A 1FJGL 4KD4A 2B2VA 3J81i 4XDXA 4JCVE 5EBDA 4OELB 1V1PA 3I4MG 1MGSA 4RGOS 2WAQB 4ZKCB 1ZXTA 1EOTA 2XTIA 3CW2C 3T56B 3C1FA 3SE0A 1HH2P 3E0EA 3G7LA 3MEHA 3A8JE 4KJOA 1EQVA 1N36L 1SNMA 1JE5A 2EYMA 2HCCA 1CSQA 3STBC 1KRTA 3HKZE 5KEEA 4HJ8A 2CW0D 2VZAA 3MXNB 2F0TA 3HOXG 5ELNA 4AYBE 3KF8B 4BBSH 2IX3A 4QUCA 3OOCA 3UI2A 2JE6I 4B08A 2Z6BA 3GTOH 4LFBL 3U50C 2PQAB 4A75A 3U9SA 1AP0A 4ZUIA 1SE3A 2LS01 3R2IA 2MUYA 2F0DA 5C4XG 5FLXL 1I4PA 1IBML 2UUCQ 2JEAI 1R4QB 5FO7B 1BO0A 4QCLA 3PIOA 2KHIA 2BOSA 5G3LF 2HHHL 2O2LD 2VW9A 1A2UA 5CV8A 3L7ZC 4HJ9A 3ZJYC 1N34L 3IKJA 4FXDA 3OWEB 5JPNC 3BJUA 2LY7A 1E7ZA 2PNRC 5JVG3 2PO4A 1EQRA 4GZYC 3BDLA 3M9BA 4DV1L 2WKCA 5C0XJ 2CW0C 2HIVA 4OWWB 2PW5A 4C56C 3HOVG 2ZT9C 1E1TA 2F0HA 3ONAB 2B8GA 4ZUJA 3SGIA 4O42A 1LT3D 3GTQH 2HQLA 1PXUA 1E24A 1JORA 2IX0A 1PRTC 1KAAA 3HOUG 1MSGA 5FOBB 4DV7Q 5EPJA 1JWSD 1ENFA 1SNPA 3H0GB 2RDFA 1TT2A 2K33A 2Y0SB 3S1MB 3EJIA 3SK6A 3M4PA 5COYA 1HNZL 3EBEA 1K83H 3FMCA 1SYGA 2F0WA 3SEBA 1BXTA 4IO9A 4BY1B 3K5MA 3HOZH 1AW7A 4XT3B 3WWVA 1TWCB 1XMQL 2N49A 4X62Q 2OQKA 1C8CA 4WJ3M 1EL0A 5IP9H 2L5TA 3QOLA 4LK1C 3ULJA 2CHBD 4GKJL 1D5MC 5A35A 2ZTCA 2FXQA 1WVLA 5KNCA 4DXFA 1PDQA 2EVBA 4WJ4A 3J81c 4JBKA 1HFGA 2ZXOA 3J81L 2A8VA 1LTID 2HIXA 1SEBD 3FVQA 4YHHL 4L63B 2LFNA 4LF8L 2XRSD 1YHBA 1NAPA 2MJ8A 4CDCC 4A3MH 4HIKA 3LX0A 1HR0L 1XXGA 4DAYB 1VQOA 4DR7L 1IHZA 3HFZB 1FD7D 1Q3LA 3C2PA 1NJIC 2HDLA 4M8AA 4A3DG 5FO9B 1OTCA 1HZ9A 3QG1A 4X3SA 1E0BA 3Q0AA 3PO2B 1ZYRD 1TVXA 3PUVA 2F0IA 1SR3A 2K50A 2KECA 4ILWA 4GKKL 1RIPA 2NZHA 1VQJA 5C4JH 4DUZQ 4RCNA 2MNAA 1R9TB 1JOQA 1IBKL 1NMGA 1STEA 2VUMH 1D5ZC 2IWHA 1TS5A 2NVYB 3G4SA 2VB3X 1UUPA 4F88A 4C1NI 2F0KA 3S1RH 4DV4L 5E3FA 3T4AC 1CHPD 1A62A 1ILPA 1CK1A 4DK3C 5JEAH 4LF7Q 3FPPA 5IGDA 4C3JH 2EYJA 4BA2I 2FJ2A 1BDOA 2IPKD 1MI2A 3MA2B 3OW7A 3L0OA 3IRBA 1JCKB 4A3LH 3HKZB 1VQ8A 3TREA 5C0XG 1B44D 2MPMA 2K5NA 2PZTA 2RSNA 4HTHA 1BOSA 4B3ML 1W6KA 1BBWA 2K5WA 4AYBB 4PNYA 1HUNA 1Y8PB 3T1YQ 1RODA 2MP1A 3KJOA 1PH6A 1TY0A 3CU7A 4EQOA 3S17H 1BCPD 2D9UA 3PF4A 3TBIB 1VQAA 3I4OA 1I4HA 4R9WA 1WCMG 2R7FA 1WTOA 4ME3A 5JVH3 3NXWA 2PNHA 1SNDA 3NBHB 5M3FH 4C3IG 4DV2Q 4BBSB 1DONA 1O7IA 3H0GG 2LXJA 4F87A 2J0TD 2XWJB 1Y1WH 2R6GA 3DWAA 2R92G 1U9RA 3TZDA 3GTOB 3BYYB 1OXVA 1SLJA 2Q8TA 2F4VL 1PV4A 1JJGA 3WOFA 1G6PA 3PUXA 2M2LA 4X3TA 1HQRD 3RN5A 4B3SQ 5C44G 3HOWG 4JI0L 1F2ZA 4NKLA 2RA4A 1LTGD 1W2BA 1G2SA 1B9NA 2DN8A 1V1QA 4JI7L 3K5OA 2A6ED 2XNAC 4DNTB 2JN4A 5LMNL 2F0NA 3I4LA 3GTPH 4K2KA 1HUMA 1I3QH 4UAIA 1HNXL 4OX9L 2PW7A 3CCSA 3BZKA 3LWUA 3JAMc 3C3LA 1I94Q 1Z7TA 3D6CA 5F2DA 1IKLA 1QJOA 4GS3A 3V2TA 2I0QA 3H3VC 4CDEC 4HJAA 3MWYW 5HURA 4PQXA 5ELFA 5JJIA 2CH4A 4N9PA 3RZOH 1VQFA 3GTQB 2EJMA 4N8FA 2JA9A 4DUYL 2F3IA 1GJXA 1J5EL 1ZEQX 4A3EG 3HKSA 1JWMD 1L1OC 2FHTA 4I65A 5D3IB 1PTOH 1B7YB 4I7ZC 4BS9A 5EPKA 1N32Q 3AQQA 3K5LA 1K83B 1Y8OB 2B2TC 3JC66 2Q2TA 4KHPQ 1I6HH 2R93H 5EAYA 4O0AA 2P5ZX 3GQBA 5C3WA 2A6EC 4ZYSA 1PH4A 4LF9L 2H4OA 3J7ZC 2IT1A 3D6WA 4IJLA 5C4HA 3UDGA 1N33Q 2ALYB 3GTMH 2F0FA 2XGTA 4ABNA 3SK4A 3A56A 1AE2A 2AQ1B 1WTHA 2UXBL 3CCLA 5FLMG 3I4NH 2QW7A 1K8OA 1VQDA 2MO0A 3DXJC 5C6AA 1RD9D 3M3YH 5IT9c 3QB3A 4V0BA 3A55A 2TMPA 4UP9A 2O5IC 1EEFD 5IT9L 2E5LL 3FPUB 4TQUS 3GTJH 1RF2D 3G6EA 3HOXH 1S5ED 5E4WC 4X66L 4IN3A 1PTOD 1Y1VG 4K6LA 4MN3A 1YNJD 2G5DA 4DNRB 5LMUL 1KAWA 4MNOA 4A3MB 1X3FA 3S2HH 3WDNA 1HR0W 3TRZA 4JW0A 1W6JA 4GNXB 1QCBD 4ZK9B 1IYJB 4YWKA 2ICIA 3LWEA 3OIQA 4DU9A 3I70A 4IFDJ 1I5FA 3GDEA 4LF5L 5GAGC 5C4JB 5M9OA 5C4XH 2I07B 1BCPB 4FDBA 2VUMB 2EDGA 4IUQA 3FHWA 1PH5A 5ELOA 1EY8A 1V9PA 3S1RB 3TP8A 2DNCA 4KN4C 1CKNA 3K58A 3AB9A 2XN9C 4C3JB 1EYGA 5JAVA 1YI2A 3K7UC 3T53B 2H1EA 2L15A 3MFYA 1PH2A 2PCFB 2BCOA 4LF4L 3DEOA 4KHVA 4H44C 1YNJC 1MBYA 1TS3A 1UNSA 4GN3B 3K80C 3DM1A 3S17B 1YHAA 3PUWA 4DR1Q 4YCWA 1D8LA 1VQ7A 1B1ZA 1TU2B 4ZAIA 5CGKA 3CF5A 1QUQB 5M3FB 2NVQH 1HJPA 5GAEC 2DGYA 1BBUA 1S5CD 1Y1WB 1SYEA 2O4XA 4JPBW 4X64Q 1R4PB 4UP7A 3HOZG 1DXMA 4LMQD 1SE2A 1V43A 4ULLA 2UUCL 4OL7A 2E75C 4JI6Q 4RAUC 2DNEA 5T1IA 4O1NA 1ENAA 1CFMA 3E5SA 1BQQT 2K28A 4J1MA 4LWCA 4YY3Q 5FK9C 2CWAA 4CBVA 1TR5A 3GO5A 2EQSA 2MHVA 1SNCA 5M5XH 1A3TA 5LMNW 3GTPB 1DZ1A 3NP8A 1LT6D 1LTBD 3A54A 4NDXA 2ZJQA 2JA7H 1I3QB 1WTWA 1Q46A 2R7ZH 4UP8A 1SNQA 4R8IA 4IALA 4FP5D 1EU3A 4A3CG 1QZHA 1B50A 3OSOA 2FINB 1NTGA 4A3DH 1TS2A 2ZXRA 3AEVA 1L1OA 1H9KA 1EY0A 3RZOB 4DV7L 1YITA 3KBGA 3TP5A 1F77A 2B2TA 1M90C 3F2UA 1JOKA 3KBXA 1UE1A 1WTVA 2ENBA 2R61A 4N8X1 1U4MA 1TWFH 1CA6A 2VUMG 2JA8G 1K3RA 1GXDC 4X62L 1PTOB 3CCMA 1M8AA 4K2LA 2AHOB 3SK5A 5JEAG 3S15H 3Q6SA 1I6HB 2K6AA 2SOBA 2R93B 4C3JG 2V4DA 3E9HA 5I2YA 5C0XH 2IY5B 4BBRG 2O5JC 1QG7A 5I9OA 4JBWA 4IFDI 5ELDA 3CCUA 3GTMB 1LABA 3NTKA 1C9OA 4G7HC 4Y7NH 3KOJA 3MZ5A 1K8AC 4UPAA 4KLKA 2EXZA 3I4NB 1MKHA 1AE3A 3TN2A 2YTYA 3M3YB 1WCMH 5IGGA 2NN6G 1JB7A 2K01A 1HFNA 1SMYC 4NMZA 5IYDG 1QOHA 2EZVA 3GTJB 3HOXB 2EYOA 4C3IH 4A3JG 3H3VI 1D2BA 1F2LA 4HEDA 1WFQA 3J80E 2CVRA 3FKIG 3W5OA 3QO2A 1NY4A 5M3FG 1PZJD 5LHY1 2I5HA 4GN4B 3VR6A 4MTNA 3S2HB 1U0LA 1QNUA 4GOPC 1SSOA 1GUSA 4DUZL 2VY3A 2UXCQ 2SDFA 5IY0A 1DOMA 2KCCA 5C44H 2ATWA 3HOWH 1PLFA 3T1HQ 3H6MA 1UE5A 1CI3M 5M3MG 5C4XB 2BE5D 1B2TA 4A3FG 4NPSA 4LF7L 4IUUA 1GUWA 1F9SA 2Z4HA 1IL2A 5C3EG 3MFGA 2ZJRA 1O7ZA 4KHZA 4P71A 2CCZA 5EBCA 3O13A 1ENCA 4WFN3 3K57A 1Q82C 4QIWE 4B9WA 1Q7YC 1MIUA 5CV6A 3HOVB 1FGUA 3A8KE 3T1YL 3F2CA 1L0YB 3STBD 1Q8KA 3X3NA 1FYCA 4LFCQ 1JJ2A 1VQHA 1MHWC 5CBEE 4DV2L 1VQ4A 2RF4A 3EQLC 4A3EH 1PMRA 5GROA 1PFBA 1NNXA 4QL5A 5KRUA 3U4ZA 1UE7A 5I2XA 4DV5Q 2NVQB 2CWPA 3J81j 1BCPF 1H9SA 4WJWA 1C7YA 1PYBA 1PFSA 2WP8J 2BE5C 3NQIA 2K03A 3CKIB 3MVVA 4B3SL 1VF5C 3OWFA 2L12A 2YTVA 2R93G 4L5SA 2B2YC 3H09A 3R3OA 4IPDA 4CJ2C 3I8ZA 1RKNA 5FLMH 3S1NH 1VQ6A 3PF5A 2WB1E 2SEBD 2B39A 3DLLA 2GVBA 1SYFA 4NB3A 3I4NG 1AN8A 1F9RA 2EYPA 4H02A 4HJ7A 5M5XB 1Y1VH 2F4IA 4GLAC 1VQEA 1DJRD 2JA7B 1I94L 4RWSC 3CCRA 1HNWL 1NCVA 5CMDA 2RKSA 5IE8A 1YNND 1ESRA 2K7VA 4IURA 1YZ6A 1JQYD 5IP7G 1VCIA 4A3DB 2NBFA 1PRTD 3IL8A 4ZLTF 3B6YA 1TKWB 4P74A 1M4VA 2RDHA 3EIVA 3Q24A 4A3IG 2CFMA 3NWSA 3FDTA 1WJJA 5FLXc 4U68A 1XNRQ 2JQOA 2B8FA 3GV6A 1KLUD 1TWFB 4KHPL 4KTAA 4K8IA 1VQPA 4MHEA 1PH7A 4IUPA 3S1QH 3S9WA 2BH8A 2AQ3B 1UWVA 5CC4A 2PMZB 1PH9A 3TP6A 1FVIA 4Y7NB 1RCVD 4DR2Q 1YNNC 1STYA 4A4IA 1Y14B 4YWLA 4Q5VA 4LFAQ 1WCMB 4GOPA 4A3BH 1XWEA 3I56A 4DF7A 2F3VA 5D65A 3M7GA 4C3IB 3KDFA 3CRLC 3MEFA 2PZWA 2F0QA 2OTLA 5IGBA 4V190 3PV0A 4KKSA 1EIFA 1LO5D 1RTNA 4JYAQ 3M4QA 1B3QA 2R92B 1D7QA 3AU7A 1HTLD 4JOIC 2N3SA 4LUOA 5IYCG 1PTOF 4AQYQ 3KLWA 1SYCA 1I4RA 1EIGA 5C44B 3HOWB 2A69C 3PGZA 2EJFC 3EFXD 1LUZA 3I3CA 4XTCS 1Q81C 5KIXA 1IBLQ 3BVZA 1X56A 2LXKA 5CYUA 3OTOQ 3KLSA 4P73A 5CBAE 3CMAA 1HRJA 1W3SA 5FJ8H 1CQFA 4A3CH 2JA7G 4IPGA 1PHJA 1NSNS 2PYKA 2R7ZG 1NMFA 4G57A 1EWCA 1NR4A 2DY7A 4KY5A 4R4CA 3PO3G 3I90A 2NUCA 1NUCA 2Q2UA 1IZ6A 2EY6A 1K9MC 3TS2A 4IFDH 1H9JA 1CZWA 4KK7A 1PZID 2I46A 3E9IA 3A5ZB 1CSPA 4XT1B 1S4ZA 4JBMA 4A3EB 1K3BC 2JA6G 2B2YA 1PH3A 3NWTA 1A2TA 2K52A 1SMXA 2JA8H 2ES2A 3S14H 2D62A 1DCZA 1STGA 2BDNA 3PIPA 2DJGC 1XPRA 3H3VH 4X64L 2VQFQ 4QF4A 4TKOB 3HOYH 1XX8A 2MQHA 3KYHC 4BBRH 4L5QA 4JI6L 1S72A 3N52A 1PRTB 1RHPA 1OXTA 1JE4A 5A2QL 1YJNA 2A6HD 4YY3L 1SYBA 3S1NB 4FXGC 4A93H 1F9PA 3VDYA 4OXPA 2NN6H 2EY1A 5HY6A 5IYDH 1JWUD 2EYFA 3PIO3 4A3JH 3GTLH 2KCMA 3HP3A 2ZM6Q 2G9DA 5NUCA 4EX5A 1Y1VB 2AWNA 1WD0A 2C35B 3FKIH 3ND8A 5DNFA 1QB5D 3QIAA 4RH6A 1UEBA 2AUKA 3F2DA 2K1BA 1II3A 2QKIC 2E74C 1VDZA 1CM9A 1A8VA 4BY7G 3URYA 4Q0FA 4S3SA 4NXMQ 5L37A 3TQYA 1VQ9A 2F52A 3U58A 1BKBA 2F0MA 2IL8A 5M3MH 2OEOA 3L9AX 4A3FH 4HSVA 3VYRA 3BYTB 1S5BD 4RG1A 4DR3L 4B3RL 1Y8NB 5J39A 5C3EH 2QCPX 4K6DA 4DAYA 1I4QA 2KENA 4CDFC 4POGA 2A6HC 3ND9A 3AYHB 1V1OA 5KNDA 1EY6A 3X3MA 4K5VA 3S1QB 5CORA 4XQJA 4RA8A 1G91A 5J22A 4DAPA 3ER0A 1F9QA 3QJYA 3AMUA 1KNEA 1SXTA 5IGCA 2WKDA 4TSSA 3G71A 1U4LA 4FO2A 1STBA 3QOJA 2D2CC 3W2DA 4QB4A 2N88A 1SNOA 1B9MA 4RFBA 1Q12A 4JI8Q 1S5DD 2IHEA 1WI5A 3D3RA 5IIFA 1BNZA 1A3UA 4A3BB 4JOIA 4A3GH 2WV6D 5I6YA 2KEEA 4AH6A 2XRQD 2EY2A 5KNBA 4DN4M 3VR2A 3LNNA 3ERSX 4JI4Q 4PMBA 2ICEC 2E2IH 1KTKA 1SE8A 2HT1A 4IQZA 4MTKA 3SHLA 2UXCL 1TXYA 1CKNB 3OIPA 2WB1G 3T1HL 3HOZB 3KF6A 4FF4A 3P7JA 4E6IA 3RLOA 1HZAA 3EN2A 1XMOQ 1ICWA 4KI0A 2RHSB 3J80L 3NBHA 1PYWD 4ZRZA 4H13C 2G9HD 4DV0Q 1IW7D 4MIUA 4QGUA 3H91A 1Q90A 3VYTA 2VB2X 3I55A 3QR8A 1MD2D 4LUVA 3LGJA 1PH1A 4DR4Q 1X32A 1RJTA 1NR2A 1HA5A 1SJHD 4OO1I 3NELA 4L8JA 3SR1A 2QEXA 4KY6A 2E2DC 5IP7H 4JI5Q 1ASYA 2QA4A 1OXXK 5M5YH 2UUBL 2ZTDA 4OIJA 1C0AA 5LL6X 1KHIA 4LFCL 4FVMA 2WIIB 3Q8DA 5EQ0A 4JI2Q 4A3IH 2UXDQ 4R8NA 4HIOA 3WOEA 1E2ZA 4DV5L 1C4QA 2Q8RE 1WTXA 2K32A 2D0PA 4R1JA 1OXSC 2JA8B 3S14B 1GD7A 2F0EA 3M7NA 5K36H 3ITPA 1KABA 5E4XA 1ET9A 3GTGH 1B8AA 1IW7C 2OF1A 2ZTEA 4C2MH 3MAQA 1J9OA 1CQVA 5KYLA 3J81E 3HOYB 3CC2A 1FNUA 2PZUA 1KDBA 2QGQA 4BBRB 3E3XA 4OIKA 1E1OA 1EUJA 2E8GA 3FEWX 2SNSA 3V05A 1B4OA 3RZDH 3I73A 2JSOA 3A5UA 4K14A 5DM63 4A93B 1PA6A 3K0XA 2L55A 5EKIA 4IUNA 2OXPA 2B2WC 1I50H 3UDFA 1EFID 4A3JB 3GTLB 4IOCA 1K8GA 1GOZA 1G6ZA 1LM0A 1A6XA 5IYBG 1JMCA 1G2TA 3TZUA 5BN4A 5GADC 4A3BG 4JG2A 3FKIB 3HRZC 3FP9A 1JJCB 1E2WA 1STNA 1YBYA 1Q1BA 4L5RC 3P1HA 1SDFA 1TQOA 5IYCH 2NTSA 1QNKA 2A73B 5M5WH 2RDGA 1QVGA 1SJED 4XIGS 5EJWA 3CHBD 4P72A 3MC0B 1XNRL 1A3VA 5M3MB 3OMGA 4KD3A 4A3FB 2R7DA 2QEJC 3NTHA 1XTDA 1PRTF 4K8JA 5C3EB 4FXKC 2Z4IA 1IBKQ 1GHKA 4GNXA 1SE4A 1ICFB 2BH2A 3DWPA 2K04A 3TDQA 1IL8A 4PZ6A 1D1KA 4PV1C 2J4XA 2GN5A 5I6WA 4OONA 2V1CC 5I9PA 3I7FA 3GD7A 4LW1A 1BR9A 1LT4D 5FJ8G 4DR2L 2IX1A 1O78A 3PO3H 2D0OA 2ID0A 3P75A 2EOTA 1SMYD 2YTXA 4LFAL 4EQPA 1SN8A 1K0SA 4KY7A 1SYDA 2ZXPA 4UDUC 2JK8A 3NK9A 3RNUA 4IFDG 4APVA 2JA6H 3CC7A 3TMEA 2OTJA 2IW3A 1B70B 3RMHA 5ELEA 4JYAL 4JV5Q 1G8ZD 4AQYL 2E2IB 3R93A 4RKBA 1VS0A 3NPPA 5GAHC 3K5NA 4YWMA 2UU9Q 1CHQD 5C3XA 3TP7A 3HOYG 1WOCA 2K05A 3DHQA 4A76A 4GLXA 3OPOA 2NVXH 2KHSA 1LACA 3AFQA 1IBLL 2AUJD 5BN5A 3PQIA 1VQIA 2RQXA 3BZCA 5DM73 1P8LA 3UDXA 3JAME 4A93G 3KLRA 3OYYA 2LKVA 1KRSA 1I4XA 5GQOA 4BXXG 3IAYA 2B3GA 2QILA 1DYQA 4RHSA 4DV3Q 3MHBA 1QWYA 2K4KA 3A74A 4RGTA 5J3BA 3G6JB 2F0LA 4XQNA 5DLQE 3RD4A 3A0JA 3D8GA 3UE0A 2B29A 2Q2HA 2CQAA 3EROA 4BY7H 1CTMA 4CJ1B 1H9SB 5M5YB 4WRDA 3ULLA 1ET6A 5ELBA 1MSHA 1Z9FA 1V1PB 3TEHB 1XYIA 2KHJA 4A3IB 1LTRD 4FF2A 3R2TA 3NSWA 5IWAQ 5CR3A 5CV7A 4X6AH 2KVMA 3M4OH 4R4IA 2A68C 3NQTA 4DV6Q 3UE1A 4NW2A 2EPBA 3CAMA 4G7ZC 3NTIA 1U4PA 2VQFL 1WYDA 4LAAA 2X6LA 1N9WA 4DR6Q 1VQKA 4OHJA 2UUAQ 1Z6HA 2XSCA 3BVMA 4ME5A 3GTGB 4C2MB 2KJXA 4ZCKA 2B2WA 4HIMA 5IT9E 3SK8A 2OCEA 3BVGA 1EYAA 5K5PA 5D3DA 2Y0SE 1A63A 1WTQA 3RZDB 1DM0B 4OWTB 1X3PA 5C4ZA 2I5MX 2KA7A 4GN5A 3MXGA 2RCFA 3T13A 2ZM6L 4J6HA 5BR8Q 2F0OA 3QWNA 1HA6A 2XIWA 2RHQB 4XYQA 5KGUA 1ZKOA 1IYUA 1JICA 1GUNA 2GVAA 4LF6Q 3D0FA 1CT1D 4A3GG 5C5MA 2WFWA 3RUZA 1JR0D 4DNIA 5LMUQ 4NXML 3UDIA 1VQNA 4XYOA 3C46A 1XTCD 2KCTA 5M5WB 2Z6KC 4RKLA 3RR5A 3CP0A 2F0GA 3ICEA 3VA5A 1KL9A 4DFAA 2XWBB 4LF5Q 5IODA 3BZDB 3PUZA 1D5XC 1EZ8A 4H0LC 4ZQ3A 2CH4W 3PMFA 2K75A 1SROA 4FF3A 4C1NK 3U9OA 4CGYB 3E6ZX 1TWAH 5JJKA 4GOPB 1BF4A 2RCNA 3T16A 1O7LA 1QE6A 2EY5A 2L9HA 3DMUA 2PI2A 1KDCA 1X3EA 1L2FA 3NBIA 3CXCA 3KDFB 3OHXC 3IFTA 2R7ZB 5HGQA 3CCEA 3W1BA 4K0KQ 2FMCA 4IOAA 1EY4A 1QZGA 3PO3B 2MFIA 2R3ZA 1OO9B 4JI8L 4CKEA 1SBBB 1LTTD 3J7A5 4LF4Q 1VQ5A 4F7XA 3D4RA 5CV9A 3A8IE 1IKMA 1EOVA 2L4NA 2WACA 3DUZA 3H15A 2JA5G 1DOKA 4QUFA 1S40A 2JA6B 4UHVA 4JI4L 4JVZA 1N32L 1ONLA 1SAPA 3KK7A 3IFDA 1H9MA 1XNQQ 4JK1C 1O7YA 2KEDA 5BN3A 5K36G 4G7OC 2A69D 1XMOL 2NB0A 4CHTB 1N33L 1X55A 1U5KA 3KJPA 3S15B 1I6VC 5AJ3Q 1MJCA 4DV0L 4H7BA 2NVXB 5EKKA 3VYUA 3VA7A 5FO8B 2EJGC 1PFMA 4U673 4B3TQ 1YEZA 4YCVA 4X65Q 1AEXA 4DR4L 3K6OA 3U4VA 4ALPA 3G48A 2M00A 4PMCA 4JI3Q 3S16H 1NE3A 3K7AH 2OWOA 5IYBH 4DR5Q 4LUZA 2B63G 1A15A 4JI5L 1STAA 4K5WA 4XQQA 3EA6A 1E22A 1UEAB 1T5XD 1C48A 4JI2L 2UXDL 1HZCA 1UAPA 4BY7B 3R8BA 4C3HG 2F0JA 2IHFA 2BDOA 1MJEA 3MXNA 3GP7A 3M4OB 2PQEA 3KLSX 1EYDA 3KF8A 1RDPD 2JP1A 4KKUA 1EY9A 1FGBD 4QIWB 3HS0C 1KDAA 1L0XB 2C5CA 1VMPA 2NYZD 1EIHA 5CV5A 2QDBA 3EVQA 2PQAA 4IUTA 1BVSA 1DD2A 2WAQG 4NXNQ 1ML0D 3JAMi 1JT8A 2EXDA 4QMGA 1GUGA 3I91A 1HHVA 4ID6A 1J6QA 5AFWA 4DR1L 2F0PA 1BBXC 2VL6A 2L11A 4AIMA 5EGTA 4OWXB 2MGSA 3J80i 2Z6KA 4OEMB 5T1GA 1KC8C 4EGVA 1LTSD 3SXHA 2B2UC 2N55A 3K8AA 4A3KH 1VMCA 3F1ZA 3CD6A 2VS1A 1I4GA 1KIXA 5ISRA 2WB1B 2AKWB 1LLRD 3MXPA 1LTAD 4HN7A 3I72A 3W3AA 2KUMA 5ELCA 1K8MA 2E76C 3CCQA 2EYLA 4DKAC 1VQMA 1LTLA 2K5HA 5KYIA 4PG3A 4BXXH 5FKAC 1TWAB 3OMCA 4HJ5A 1YIJA 1WTRA 1G51A 1TWGH 4JBJA 4Z9CB 4BWGB 2NZ1D 2F3WA 1IYVA 1RL2A 5JPMC 1TWHH 2AQ2B 2VQEQ 3J7YW 1D6EC 1TIID 3SVMA 2Z0SA 1EZ6A 1QILA 4N9TA 4WORA 5IGFA 3BS1A 3GTKH 3KF6B 1U4RA 5JOBA 4QJFA 4R4TA 3CMEA 4JI1Q 2J7ZA 4X3KA 1HZBA 1ZYRC 2F0SA 4JV5L 2KOLA 5C0XI 2QDLA 2X6GA 2UU9L 3VYSA 1JB3A 2Y0SG 2F1MA 3DEPA 2YU9H 1F2YA 1FJGQ 3HEJA 4BY1G 3NENA 3K59A 2N78A 4KV6A 1BUVT 3Q23A 1X9NA 4CKBA 3CRKC 4TVAB 2NWGA 2VXWA 2A5HA 2JEBI 2K5DA 1EFWA 4B9XA 4O2DA 1EYCA 1Q1EA 3CPFA 4GNXC 2HCIA 1X54A 2JJQA 1X65A 1FNVA 4CKCA 3VR4A 2E2JH 1JOOA 2K14A 4HR7B 2I5LX 3CQZH 4DV3L 1N36Q 2TSSA 3S16B 3K7AB 4I7AA 2Z8LA 2KCNA 1K0RA 1DOLA 1A0IA 4OGQC 1BCPC 4P75A 1RTOA 4PZ7A 5J1ZA 1KQSA 2HDMA 1ILQA 1HNWQ 4DGZA 3JAML 3S2DH 5FLXE 5H1SE 3Q22A 1EEID 2HUGA 1E2VA 3GV3A 5IWAL 4OO1G 4YCUA 1V8QA 4DV6L 5G3LD 3E0JA 1M1KC 3PO2G 2EIFA 3J80c 1FR3A 4CDDC 2HQEA 4LFBQ 1D1IA 3RLNA 4RGMA 3D4DA 4LNQA 4Y52H 4DR6L 4HMIA 2UUAL 1JC7A
chains in the Genus database with same CATH topology
3N6RA 3J7AV 1TS4A 3PIP3 1EY7A 2SNMA 2F03A 1X3QA 4KKTA 1STHA 3D4WA 3C1EA 1PZKD 1KNAA 1AZQA 1CA5A 2B2UA 1WTPA 3MXUA 4HSPA 3P20A 4FNFA 1T5EA 4IZ8A 4BA1I 2F0UA 4X3UA 2LMCB 4YIJA 3BDCA 4J8QA 3RLFA 3A7AB 2EYHA 1KLGD 4A3KB 4NP5A 4CJ0B 4FF1A 4RGNA 3TSSA 2Z1CA 3PUYA 2NTTA 1HTPA 4EQNA 3M85A 2X69A 1HQMC 1F2MA 5IGEA 5JEAJ 1H9RA 3HGBA 1HCZA 1TWGB 1GUOA 2C9OA 1AFPA 1TWHB 3D31A 1PTOC 4KJNA 1Q8IA 2Q8IB 2A74C 1LT5D 1J8IA 3GTKB 2EE1A 5EKLA 5I4DA 2VNUD 1EU4A 4G4KA 4ZKBB 3HG9A 3HZXA 5A2QE 5TSSA 1Y69U 4DXGA 4DK0A 5D14A 2YU9B 1G291 2JYOA 2XVSA 3VR5A 2B2VC 5CV4A 2FFKB 2PPBC 2YYZA 5HGTA 2D5DA 4EVOA 2E2JB 3CQZB 3KUPA 1O80A 4A3GB 3BG3A 4TRDA 2BA0A 2RVLA 3L3OC 1EQTA 3S2DB 2KQ3A 4DA2A 2A68D 3VR3A 5JJZA 4M1UB 1AZPA 1GHJA 4IUVA 1EY5A 1WD1A 5DAUA 5IOCA 3I4MB 5E1FA 4HAEA 1PFNA 4HMJA 3NUCA 4L6TB 2NVTB 2L1BA 2OT2A 1B53A 1GUTA 5C5LA 4HCEA 3J7AF 2RSOA 1HXYD 2JA5B 2L0CA 2F0VA 4PMWA 3K0YA 2BA1A 4K5XA 3V96A 1Z47A 2GA4B 1ESFA 5LL6S 3A7LA 2M9VA 3NHHA 3ERQA 4RCOA 2WINB 2NN6I 1OXUA 2FMMA 1B3AA 2DY8A 3ZYYX 1EWHA 2AWOA 3FRPB 3H94A 3NE5B 4ODGA 2IJ0A 4DAVA 2E2HB 1I50B 2K5QA 2B63B 4LJZC 1S5FD 3MTSA 4KN7C 3M4YA 2JXMB 1VF7A 1TY2A 4RHRA 4OO1H 4C3HB 1LV9A 2QF7A 4HCSA 3DWQA 4DK1A 4KMUC 5EPLA 4FYDA 1CZGA 3HOUB 1HPCA 3SDZA 4F8MA 5DEHA 1SFOB 3T51B 2RBMA 4XXEA 3BDOA 1FNWA 4P2CB 4KD4A 2B2VA 4XDXA 5EBDA 1V1PA 1MGSA 4RGOS 2WAQB 4ZKCB 1ZXTA 1EOTA 3T56B 3C1FA 3SE0A 3G7LA 3MEHA 3A8JE 4KJOA 1EQVA 1SNMA 2EYMA 2HCCA 5KEEA 2CW0D 2F0TA 2IX3A 4QUCA 3OOCA 3UI2A 2JE6I 4B08A 3U9SA 1AP0A 4ZUIA 1SE3A 2LS01 3R2IA 2MUYA 2F0DA 5FLXL 1I4PA 2JEAI 1R4QB 5FO7B 1BO0A 4QCLA 2BOSA 5G3LF 2O2LD 1A2UA 5CV8A 3L7ZC 3IKJA 4FXDA 3OWEB 5JPNC 2LY7A 2PNRC 5JVG3 2PO4A 4GZYC 3BDLA 2WKCA 5C0XJ 2CW0C 2PW5A 4C56C 2ZT9C 2F0HA 3ONAB 2B8GA 4ZUJA 4O42A 1LT3D 1PXUA 1JORA 2IX0A 1PRTC 1KAAA 1MSGA 5FOBB 5EPJA 1JWSD 1ENFA 1SNPA 3H0GB 2RDFA 1TT2A 2K33A 2Y0SB 3S1MB 3EJIA 3SK6A 5COYA 3FMCA 1SYGA 2F0WA 3SEBA 1BXTA 4BY1B 3K5MA 1AW7A 4XT3B 1TWCB 1C8CA 1EL0A 2L5TA 3QOLA 4LK1C 2CHBD 1D5MC 5A35A 1WVLA 5KNCA 4DXFA 1PDQA 2EVBA 1HFGA 2ZXOA 3J81L 1LTID 1SEBD 3FVQA 4L63B 2LFNA 2XRSD 1NAPA 2MJ8A 3LX0A 1XXGA 1IHZA 1FD7D 1Q3LA 3C2PA 2HDLA 4M8AA 5FO9B 3QG1A 4X3SA 1E0BA 3Q0AA 3PO2B 1ZYRD 1TVXA 3PUVA 2F0IA 2KECA 4ILWA 4RCNA 1R9TB 1JOQA 1STEA 1D5ZC 2IWHA 1TS5A 2NVYB 2VB3X 1UUPA 4F88A 4C1NI 2F0KA 5E3FA 3T4AC 1CHPD 1ILPA 1CK1A 5JEAH 3FPPA 5IGDA 2EYJA 4BA2I 2FJ2A 1BDOA 2IPKD 1MI2A 3MA2B 3OW7A 1JCKB 3HKZB 5C0XG 1B44D 2MPMA 2PZTA 2RSNA 4HTHA 1BOSA 1W6KA 2K5WA 4AYBB 4PNYA 1HUNA 1Y8PB 1RODA 2MP1A 1TY0A 3CU7A 4EQOA 1BCPD 2D9UA 3TBIB 1I4HA 4R9WA 1WTOA 5JVH3 3NXWA 1SNDA 4C3IG 4BBSB 1DONA 4F87A 2J0TD 2XWJB 2R6GA 3DWAA 1U9RA 3TZDA 3GTOB 3BYYB 1OXVA 2Q8TA 3WOFA 3PUXA 2M2LA 4X3TA 1HQRD 1F2ZA 4NKLA 2RA4A 1LTGD 1G2SA 1B9NA 2DN8A 3K5OA 2A6ED 2XNAC 4DNTB 2F0NA 3I4LA 4K2KA 1HUMA 4UAIA 2PW7A 3LWUA 3C3LA 1Z7TA 3D6CA 5F2DA 1IKLA 1QJOA 3V2TA 3H3VC 3MWYW 5HURA 4PQXA 5ELFA 4N9PA 3GTQB 2EJMA 1GJXA 1ZEQX 1JWMD 2FHTA 4I65A 5D3IB 1PTOH 4I7ZC 4BS9A 5EPKA 3K5LA 1K83B 1Y8OB 2B2TC 3GQBA 5C3WA 2A6EC 4ZYSA 2H4OA 2IT1A 3D6WA 5C4HA 2F0FA 4ABNA 3SK4A 3A56A 2AQ1B 1K8OA 3DXJC 5C6AA 1RD9D 3QB3A 4V0BA 3A55A 2TMPA 2O5IC 1EEFD 5IT9L 3FPUB 4TQUS 1RF2D 1S5ED 5E4WC 4IN3A 1PTOD 4K6LA 4MN3A 1YNJD 4DNRB 4A3MB 3WDNA 1W6JA 1QCBD 4ZK9B 2ICIA 3LWEA 3OIQA 4DU9A 3I70A 4IFDJ 5C4JB 5M9OA 2I07B 1BCPB 2VUMB 2EDGA 4IUQA 1EY8A 3S1RB 3TP8A 2DNCA 4KN4C 3K58A 3AB9A 2XN9C 4C3JB 5JAVA 3T53B 2H1EA 3MFYA 2PCFB 2BCOA 3DEOA 4KHVA 4H44C 1YNJC 1MBYA 1TS3A 1UNSA 3DM1A 3S17B 3PUWA 1B1ZA 1TU2B 4ZAIA 5CGKA 5M3FB 1S5CD 1Y1WB 1SYEA 2O4XA 1R4PB 1DXMA 4LMQD 1SE2A 1V43A 4ULLA 4OL7A 2E75C 4RAUC 2DNEA 5T1IA 4O1NA 1ENAA 1CFMA 3E5SA 1BQQT 2K28A 4J1MA 5FK9C 4CBVA 1TR5A 3GO5A 2MHVA 1SNCA 1DZ1A 1A3TA 3GTPB 3A54A 1LT6D 1LTBD 3NP8A 4NDXA 1I3QB 1WTWA 1SNQA 4R8IA 4IALA 4FP5D 1EU3A 1B50A 3OSOA 2FINB 1TS2A 2ZXRA 1H9KA 1EY0A 3RZOB 3KBGA 3TP5A 1F77A 2B2TA 3F2UA 1JOKA 3KBXA 1WTVA 2ENBA 2R61A 1U4MA 1CA6A 1GXDC 1PTOB 1M8AA 4K2LA 3SK5A 5JEAG 3Q6SA 1I6HB 2K6AA 2SOBA 2R93B 4C3JG 2V4DA 5I2YA 5C0XH 2O5JC 1QG7A 5I9OA 4JBWA 4IFDI 5ELDA 3GTMB 1LABA 3NTKA 4G7HC 3MZ5A 2EXZA 3I4NB 3TN2A 3M3YB 5IGGA 2NN6G 2K01A 1HFNA 1SMYC 4NMZA 1QOHA 2EZVA 3GTJB 3HOXB 2EYOA 1D2BA 1F2LA 4HEDA 3J80E 2CVRA 3QO2A 1PZJD 5LHY1 3VR6A 3S2HB 1QNUA 1SSOA 1GUSA 2SDFA 1DOMA 2KCCA 1PLFA 3H6MA 1CI3M 5C4XB 2BE5D 1B2TA 4IUUA 1GUWA 1F9SA 2Z4HA 3MFGA 1O7ZA 4KHZA 5EBCA 3O13A 1ENCA 4WFN3 3K57A 4B9WA 5CV6A 3HOVB 3A8KE 1L0YB 3X3NA 1FYCA 5CBEE 3EQLC 1PMRA 1PFBA 5KRUA 5I2XA 2NVQB 1BCPF 1H9SA 4WJWA 2WP8J 2BE5C 3NQIA 2K03A 3CKIB 3MVVA 1VF5C 3OWFA 2L12A 2B2YC 3H09A 3R3OA 4CJ2C 3I8ZA 1RKNA 2SEBD 2B39A 1SYFA 1AN8A 1F9RA 2EYPA 5M5XB 2F4IA 1DJRD 2JA7B 4RWSC 1NCVA 5CMDA 2RKSA 1YNND 1ESRA 2K7VA 4IURA 1JQYD 1VCIA 4A3DB 2NBFA 1PRTD 3IL8A 4ZLTF 1TKWB 1M4VA 2RDHA 3Q24A 3NWSA 3FDTA 4U68A 2B8FA 3GV6A 1KLUD 1TWFB 4KTAA 4K8IA 4MHEA 4IUPA 3S9WA 2AQ3B 5CC4A 2PMZB 3TP6A 4Y7NB 1RCVD 1YNNC 1STYA 4Q5VA 1WCMB 1XWEA 4DF7A 2F3VA 5D65A 3M7GA 4C3IB 3CRLC 2PZWA 2F0QA 5IGBA 4V190 3PV0A 4KKSA 1LO5D 1RTNA 2R92B 3AU7A 1HTLD 1PTOF 1SYCA 1I4RA 1EIGA 5C44B 3HOWB 2A69C 2EJFC 3EFXD 3I3CA 4XTCS 5KIXA 3BVZA 5CYUA 3KLSA 5CBAE 1HRJA 1CQFA 1NSNS 2PYKA 4G57A 1EWCA 1NR4A 2DY7A 4KY5A 3I90A 2NUCA 1NUCA 2EY6A 4IFDH 1H9JA 1CZWA 4KK7A 1PZID 2I46A 4XT1B 1S4ZA 4A3EB 2B2YA 3NWTA 1A2TA 2D62A 1DCZA 1STGA 2BDNA 4QF4A 4TKOB 1XX8A 3N52A 1PRTB 1RHPA 1OXTA 1JE4A 5A2QL 2A6HD 1SYBA 3S1NB 4FXGC 1F9PA 2NN6H 2EY1A 1JWUD 2EYFA 3PIO3 3HP3A 2G9DA 5NUCA 1Y1VB 2AWNA 1WD0A 3ND8A 5DNFA 1QB5D 3QIAA 4RH6A 2AUKA 2K1BA 1II3A 2QKIC 2E74C 1VDZA 1CM9A 3URYA 4Q0FA 4S3SA 2F0MA 2IL8A 2OEOA 3L9AX 4HSVA 3VYRA 3BYTB 1S5BD 1Y8NB 5J39A 2QCPX 4K6DA 4DAYA 1I4QA 2A6HC 3ND9A 1V1OA 5KNDA 1EY6A 3X3MA 4K5VA 3S1QB 5CORA 4XQJA 4RA8A 1G91A 5J22A 4DAPA 1F9QA 3QJYA 3AMUA 1KNEA 1SXTA 5IGCA 2WKDA 4TSSA 1U4LA 4FO2A 1STBA 3QOJA 2D2CC 3W2DA 4QB4A 2N88A 1SNOA 1B9MA 4RFBA 1Q12A 1S5DD 3D3RA 1BNZA 5IIFA 1A3UA 4A3BB 2WV6D 5I6YA 2KEEA 2XRQD 2EY2A 5KNBA 4DN4M 3VR2A 3LNNA 4PMBA 2ICEC 1KTKA 4IQZA 3SHLA 3OIPA 3HOZB 4FF4A 3P7JA 4E6IA 1ICWA 4KI0A 3J80L 3NBHA 1PYWD 4ZRZA 4H13C 2G9HD 1IW7D 4MIUA 3H91A 1Q90A 3VYTA 2VB2X 1MD2D 1X32A 1RJTA 1NR2A 1HA5A 1SJHD 4OO1I 4L8JA 3SR1A 4KY6A 2E2DC 1OXXK 4OIJA 5LL6X 4FVMA 2WIIB 5EQ0A 4R8NA 3WOEA 1E2ZA 1C4QA 2Q8RE 1WTXA 2K32A 1OXSC 2JA8B 3S14B 2F0EA 3M7NA 5K36H 3ITPA 1KABA 5E4XA 1ET9A 1IW7C 2OF1A 3MAQA 1J9OA 1CQVA 5KYLA 3J81E 3HOYB 1FNUA 2PZUA 1KDBA 4BBRB 4OIKA 3FEWX 2SNSA 3V05A 1B4OA 3I73A 2JSOA 4K14A 5DM63 4A93B 5EKIA 2L55A 4IUNA 2OXPA 2B2WC 1EFID 4A3JB 3GTLB 1GOZA 1G6ZA 1A6XA 1G2TA 3TZUA 5BN4A 3FKIB 3HRZC 1E2WA 1STNA 1Q1BA 3P1HA 1SDFA 1TQOA 2NTSA 1QNKA 2A73B 2RDGA 1SJED 4XIGS 5EJWA 3CHBD 3MC0B 1A3VA 5M3MB 3OMGA 4KD3A 4A3FB 2QEJC 3NTHA 1PRTF 4K8JA 5C3EB 4FXKC 2Z4IA 1GHKA 1SE4A 3DWPA 2K04A 3TDQA 1IL8A 1D1KA 4PV1C 2J4XA 5I6WA 5I9PA 3GD7A 1BR9A 1LT4D 2IX1A 1O78A 2ID0A 3P75A 2EOTA 1SMYD 4EQPA 4KY7A 1SYDA 2ZXPA 4UDUC 3NK9A 4IFDG 3TMEA 2IW3A 3RMHA 5ELEA 1G8ZD 2E2IB 3R93A 4RKBA 3NPPA 3K5NA 1CHQD 5C3XA 3TP7A 2K05A 3DHQA 3OPOA 2KHSA 1LACA 2AUJD 5BN5A 2RQXA 5DM73 3JAME 3KLRA 2LKVA 1I4XA 3IAYA 4RHSA 2QILA 1DYQA 3MHBA 1QWYA 4RGTA 3G6JB 2F0LA 4XQNA 3RD4A 3D8GA 2CQAA 3EROA 1CTMA 4CJ1B 1H9SB 5M5YB 4WRDA 1ET6A 5ELBA 1MSHA 1V1PB 1XYIA 4A3IB 1LTRD 4FF2A 3R2TA 3NSWA 5CR3A 5CV7A 2KVMA 2A68C 3NQTA 4NW2A 2EPBA 4G7ZC 3NTIA 1U4PA 4LAAA 2X6LA 4OHJA 1Z6HA 2XSCA 3BVMA 4ME5A 3GTGB 4C2MB 2KJXA 2B2WA 5IT9E 3SK8A 3BVGA 1EYAA 5K5PA 5D3DA 1WTQA 3RZDB 1DM0B 1X3PA 5C4ZA 2KA7A 3MXGA 3T13A 4J6HA 2F0OA 3QWNA 1HA6A 2XIWA 4XYQA 5KGUA 1ZKOA 1IYUA 1JICA 1GUNA 1CT1D 5C5MA 3RUZA 1JR0D 4XYOA 3C46A 1XTCD 5M5WB 4RKLA 2F0GA 3VA5A 4DFAA 2XWBB 5IODA 3BZDB 3PUZA 1D5XC 1EZ8A 4H0LC 4ZQ3A 3PMFA 4FF3A 4C1NK 3U9OA 4CGYB 3E6ZX 1BF4A 3T16A 1O7LA 1QE6A 2EY5A 2L9HA 3DMUA 1KDCA 3NBIA 3OHXC 3IFTA 2R7ZB 2FMCA 1EY4A 3PO3B 2R3ZA 1OO9B 4CKEA 1SBBB 1LTTD 4F7XA 3D4RA 5CV9A 3A8IE 1IKMA 2L4NA 2WACA 3DUZA 1DOKA 4QUFA 2JA6B 1ONLA 1SAPA 3KK7A 3IFDA 1H9MA 4JK1C 1O7YA 2KEDA 5BN3A 5K36G 4G7OC 2A69D 2NB0A 4CHTB 3S15B 1I6VC 2NVXB 4H7BA 5EKKA 3VYUA 3VA7A 5FO8B 2EJGC 1PFMA 4U673 1AEXA 3K6OA 2M00A 4PMCA 1A15A 1STAA 4K5WA 4XQQA 3EA6A 1UEAB 1T5XD 1C48A 1UAPA 4BY7B 3R8BA 4C3HG 2F0JA 2BDOA 3MXNA 3GP7A 3M4OB 2PQEA 3KLSX 1EYDA 3KF8A 1RDPD 2JP1A 4KKUA 1EY9A 1FGBD 4QIWB 3HS0C 1KDAA 1L0XB 2C5CA 1VMPA 2NYZD 1EIHA 5CV5A 2QDBA 3EVQA 4IUTA 1DD2A 1ML0D 4QMGA 1GUGA 3I91A 1HHVA 4ID6A 5AFWA 2F0PA 1BBXC 2L11A 5EGTA 2MGSA 5T1GA 4EGVA 1LTSD 3SXHA 2B2UC 2N55A 1VMCA 1I4GA 5ISRA 2WB1B 1LLRD 3MXPA 1LTAD 4HN7A 3I72A 3W3AA 2KUMA 5ELCA 1K8MA 2E76C 2EYLA 5KYIA 5FKAC 1TWAB 3OMCA 1WTRA 4Z9CB 4BWGB 2NZ1D 2F3WA 1IYVA 5JPMC 2AQ2B 3J7YW 1D6EC 1TIID 3SVMA 1EZ6A 1QILA 4N9TA 4WORA 5IGFA 3BS1A 1U4RA 5JOBA 2J7ZA 4X3KA 1ZYRC 2F0SA 2KOLA 5C0XI 2X6GA 3VYSA 1JB3A 2F1MA 3DEPA 1F2YA 3HEJA 3K59A 4KV6A 1BUVT 3Q23A 4CKBA 3CRKC 2NWGA 2VXWA 2A5HA 2JEBI 2K5DA 4B9XA 1EYCA 1Q1EA 2HCIA 1FNVA 4CKCA 3VR4A 1JOOA 4HR7B 2TSSA 3S16B 3K7AB 2Z8LA 2KCNA 1DOLA 4OGQC 1BCPC 5J1ZA 1RTOA 2HDMA 1ILQA 4DGZA 3JAML 5FLXE 3Q22A 1EEID 2HUGA 1E2VA 3GV3A 4OO1G 1V8QA 5G3LD 3E0JA 1FR3A 2HQEA 1D1IA 4RGMA 3D4DA 4HMIA 1JC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAP A;  2L12 A;  2MJ8 A;  5EQ0 A;  1QG7 A;  2B2Y C;  2H1E A;  1EIG A;  1HA6 A;  2XIW A;  4QUC A;  3UI2 A;  2IL8 A;  4CJ2 C;  3DEO A;  3I8Z A;  5D14 A;  1IKL A;  4HSV A;  1JIC A;  1HUN A;  2Q8R E;  1Q3L A;  1WTX A;  2HDL A;  1A15 A;  3MWY W;  1WTR A;  3I3C A;  4X3S A;  1E0B A;  2JYO A;  2NZ1 D;  3TN2 A;  3DM1 A;  1TVX A;  1X3Q A;  2KEC A;  2K01 A;  1HFN A;  1AP0 A;  1F9R A;  1KNA A;  2B2V C;  5E4X A;  5CBA E;  3R93 A;  1AZQ A;  4ZAI A;  1CA5 A;  2FFK B;  2FMM A;  3SVM A;  1B3A A;  2B2U A;  2DY8 A;  1WTP A;  1J9O A;  1HRJ A;  4RWS C;  5COR A;  1F2L A;  4RA8 A;  1NCV A;  1G91 A;  4HED A;  5CMD A;  1BO0 A;  2CVR A;  2K05 A;  4OIK A;  1ESR A;  2FHT A;  1ILP A;  4IUR A;  1F9Q A;  1U4R A;  3QO2 A;  1B4O A;  3KUP A;  1KNE A;  5EPK A;  1NR4 A;  2DY7 A;  2J7Z A;  4X3U A;  4X3K A;  2B2T C;  3MTS A;  1U4L A;  1SSO A;  2JP1 A;  1O80 A;  3I90 A;  2FJ2 A;  3IL8 A;  4ZLT F;  1MI2 A;  2KOL A;  2N88 A;  5EKI A;  2B2W C;  2RVL A;  3D6W A;  2SDF A;  4LMQ D;  1DOM A;  1VMP A;  2NYZ D;  2X6G A;  1EIH A;  1PLF A;  1EQT A;  4CJ0 B;  1BNZ A;  2MPM A;  3DEP A;  3FDT A;  2RSN A;  1G6Z A;  4XT1 B;  1S4Z A;  4RAU C;  1BF4 A;  1LV9 A;  1QE6 A;  2L9H A;  1G2T A;  4HCS A;  2KEE A;  4U68 A;  2B2Y A;  3ONA B;  5T1I A;  4IUT A;  1B2T A;  1ROD A;  2MP1 A;  4IUU A;  1GUW A;  1F9S A;  4DN4 M;  2K28 A;  5JJZ A;  2NWG A;  3GV6 A;  4O42 A;  5EPL A;  2VXW A;  1ML0 D;  2D9U A;  1AZP A;  1O7Z A;  2BDN A;  4IUV A;  1SDF A;  2X69 A;  3FPU B;  4R9W A;  1DZ1 A;  1WTO A;  1MSG A;  4MHE A;  4CJ1 B;  5E4W C;  1WD1 A;  1QNK A;  2R3Z A;  4IUP A;  2HCI A;  1XX8 A;  3I91 A;  5EPJ A;  1HHV A;  4MN3 A;  1WTW A;  5AFW A;  1MSH A;  3P7J A;  1DON A;  2B2V A;  5EJW A;  4R8I A;  1BBX C;  1XYI A;  2L4N A;  2L11 A;  4XDX A;  3N52 A;  1IKM A;  1ICW A;  5COY A;  1RHP A;  2KVM A;  1JE4 A;  2MGS A;  2FIN B;  1DOK A;  4QUF A;  1B50 A;  5T1G A;  1DOL A;  4NW2 A;  2EPB A;  4XT3 B;  1MGS A;  4HAE A;  1F9P A;  1PFN A;  4ZK9 B;  3H91 A;  1RTO A;  1C8C A;  3TZD A;  4ZKC B;  1U4P A;  3LWE A;  2B2U C;  1ZXT A;  1EOT A;  2HDM A;  2N55 A;  2Q8T A;  1EL0 A;  1SAP A;  2X6L A;  3IFD A;  1VMC A;  2M2L A;  1ILQ A;  2B2T A;  4X3T A;  2L1B A;  2K04 A;  5CBE E;  3HP3 A;  3G7L A;  1X32 A;  1IL8 A;  3F2U A;  1WVL A;  1O7Y A;  1B53 A;  1RJT A;  1NR2 A;  2KED A;  3KBX A;  5D65 A;  1WD0 A;  1PFB A;  2B2W A;  1PDQ A;  2HUG A;  2RA4 A;  3GV3 A;  4IUQ A;  2HCC A;  1G2S A;  1WTV A;  2RSO A;  5DNF A;  1U4M A;  1HFG A;  1CA6 A;  1J8I A;  2EE1 A;  1WTQ A;  2K1B A;  1RTN A;  1M8A A;  1X3P A;  1PFM A;  4ZKB B;  2K03 A;  1HUM A;  4OIJ A;  2EOT A;  2KUM A;  1CM9 A;  3Q6S A;  4UAI A; 
#chains in the Genus database with same CATH topology
 4DAM A;  3N6R A;  3J7A V;  1TS4 A;  3I4M H;  1IBM Q;  1VQL A;  3PIP 3;  1PH8 A;  1EY7 A;  2HHH Q;  1N34 Q;  2SNM A;  2NVT H;  2F03 A;  1X3Q A;  4KKT A;  1STH A;  3D4W A;  3C1E A;  1PZK D;  1IXR A;  1KNA A;  3HKZ G;  5BR8 L;  1AZQ A;  1CA5 A;  2B2U A;  4DV1 Q;  1WTP A;  3MXU A;  2LSS A;  4R4Q A;  4HSP A;  3TS0 A;  4AYB G;  3AFP A;  1YHQ A;  3P20 A;  4FNF A;  1T5E A;  2JA5 H;  1YNX A;  4IZ8 A;  4LF6 L;  4BA1 I;  1EIY B;  2F0U A;  4X3U A;  2LMC B;  4YIJ A;  3BDC A;  4J8Q A;  3RLF A;  3A7A B;  2K5V A;  1LYL A;  2EYH A;  4BBS G;  1KLG D;  4A3K B;  4NP5 A;  4CJ0 B;  4JC0 A;  3L2P A;  4FF1 A;  4RGN A;  2MO1 A;  3TSS A;  2Z1C A;  1HNZ Q;  1CUK A;  3PUY A;  2NTT A;  1S3O A;  1HTP A;  3I2Z A;  4EQN A;  3M85 A;  2N8N A;  1XMQ Q;  2X69 A;  2Q2I A;  1GVP A;  1HQM C;  1YJ9 A;  4GKJ Q;  1F2M A;  1L1O B;  3PSI A;  2E2H H;  2PI2 E;  2B63 H;  5IGE A;  5JEA J;  3RN2 A;  1VQC A;  1QVF A;  3PCO B;  4K0K L;  3NEM A;  1H9R A;  3HGB A;  1HCZ A;  1TWG B;  1GUO A;  3HOV H;  2C9O A;  1AFP A;  1TWH B;  4YHH Q;  3D31 A;  4RMF A;  4LF8 Q;  1PTO C;  4C3H H;  4KJN A;  1EQQ A;  1Q8I A;  1HR0 Q;  2Q8I B;  2A74 C;  1LT5 D;  3HOU H;  4DR7 Q;  1J8I A;  3GTK B;  3CCV A;  1K73 C;  1PYS B;  1VQB A;  2EE1 A;  3CCJ A;  3CC4 A;  5EKL A;  5I4D A;  1SFO H;  2VNU D;  1EU4 A;  4G4K A;  4ZKB B;  3HG9 A;  4GKK Q;  3HZX A;  2DUD A;  5A2Q E;  1XNQ L;  5TSS A;  4L5T A;  1Y69 U;  4DXG A;  4DK0 A;  1YVC A;  5D14 A;  2YU9 B;  1GKH A;  2ASB A;  4DV4 Q;  5AJ3 L;  1G29 1;  2JYO A;  1T9H A;  2XVS A;  2Z9H A;  4B3T L;  5IP9 G;  4X65 L;  3VR5 A;  2B2V C;  5CV4 A;  2FFK B;  4IPC A;  2PPB C;  2YYZ A;  4DK6 C;  4JI3 L;  5HGT A;  2NZO A;  2D5D A;  1EWI A;  4EVO A;  2WAQ E;  5E7N A;  4DR5 L;  4B3M Q;  2E2J B;  4HID A;  3CQZ B;  4POF A;  3KUP A;  4PZ8 A;  1X3G A;  1O80 A;  4A3G B;  2OQ0 A;  3BG3 A;  1XJV A;  4TRD A;  2BA0 A;  2RVL A;  3L3O C;  1EQT A;  1CKO A;  4QQB X;  1NBW A;  4A3M G;  1VQG A;  3S2D B;  4A3K G;  2KQ3 A;  4DA2 A;  1YJW A;  1GO3 E;  2A68 D;  1QVC A;  3VR3 A;  5JJZ A;  4M1U B;  2AMC B;  1AZP A;  3W1G A;  1GHJ A;  4IUV A;  1QUQ A;  2F4V Q;  1EY5 A;  1WD1 A;  5DAU A;  4R4O A;  3OTO L;  5IOC A;  3KFU A;  4JI0 Q;  4DR3 Q;  4B3R Q;  2HD3 A;  2YV5 A;  1ASZ A;  1DGS A;  3I4M B;  1CKM A;  2A1A A;  4JI7 Q;  5E1F A;  4NXN L;  1P16 A;  4HAE A;  1PFN A;  4HMJ A;  5LMN Q;  3S24 A;  3NUC A;  4L6T B;  2NVT B;  1N8R C;  3F2B A;  2L1B A;  1HNX Q;  4IPH A;  4A3L G;  4OX9 Q;  2OT2 A;  4QY7 A;  1B53 A;  3DM3 A;  4UY8 C;  1GUT A;  2CKZ B;  1X6O A;  4HCE A;  5C5L A;  3J7A F;  2RSO A;  1HXY D;  3F8T A;  1XPU A;  2JA5 B;  2L0C A;  2PMZ E;  2F0V A;  3CPW A;  4PMW A;  1SRU A;  3K0Y A;  2BA1 A;  1K28 A;  3H0G H;  4K5X A;  3V96 A;  1Z47 A;  4DUY Q;  2GA4 B;  1ESF A;  5LL6 S;  4DPG A;  3S1M H;  1J5E Q;  3ULP A;  4BY1 H;  2R92 H;  3A7L A;  2M9V A;  1H95 A;  3NHH A;  1TWC H;  3ERQ A;  4RCO A;  1Y1W G;  5JJL A;  2WIN B;  1L0W A;  3OW2 A;  2H5X A;  2NN6 I;  1Q86 C;  2A19 A;  1OXU A;  4LF9 Q;  2FMM A;  1B3A A;  1PVO A;  2DY8 A;  4IJH A;  2DJF C;  3ZYY X;  1EWH A;  2AWO A;  2CQO A;  1KXL A;  1AH9 A;  3FRP B;  3H94 A;  3NE5 B;  4ODG A;  2IJ0 A;  4DAV A;  2UXB Q;  2E2H B;  4GLV B;  1I50 B;  2K5Q A;  2B63 B;  4LJZ C;  1S5F D;  3MTS A;  2E5L Q;  2VQE L;  4KN7 C;  4X66 Q;  3M4Y A;  2ZJP A;  2JXM B;  1VF7 A;  1TY2 A;  4RHR A;  1GM5 A;  1E3P A;  1KD1 C;  4OO1 H;  4MZ9 A;  4C3H B;  1LV9 A;  2QF7 A;  4HCS A;  3DWQ A;  4DK1 A;  2UUB Q;  1XPO A;  3PO2 H;  4KMU C;  4JI1 L;  5EPL A;  4FYD A;  1CZG A;  3HOU B;  4J15 A;  3K81 C;  2KBN A;  1HPC A;  3SDZ A;  1UE6 A;  4F8M A;  1R9T H;  5DEH A;  1SFO B;  3T51 B;  4EQ5 A;  3BU2 A;  2RBM A;  4XXE A;  2NVY H;  3BDO A;  1FNW A;  4P2C B;  1FL0 A;  1FJG L;  4KD4 A;  2B2V A;  3J81 i;  4XDX A;  4JCV E;  5EBD A;  4OEL B;  1V1P A;  3I4M G;  1MGS A;  4RGO S;  2WAQ B;  4ZKC B;  1ZXT A;  1EOT A;  2XTI A;  3CW2 C;  3T56 B;  3C1F A;  3SE0 A;  1HH2 P;  3E0E A;  3G7L A;  3MEH A;  3A8J E;  4KJO A;  1EQV A;  1N36 L;  1SNM A;  1JE5 A;  2EYM A;  2HCC A;  1CSQ A;  3STB C;  1KRT A;  3HKZ E;  5KEE A;  4HJ8 A;  2CW0 D;  2VZA A;  3MXN B;  2F0T A;  3HOX G;  5ELN A;  4AYB E;  3KF8 B;  4BBS H;  2IX3 A;  4QUC A;  3OOC A;  3UI2 A;  2JE6 I;  4B08 A;  2Z6B A;  3GTO H;  4LFB L;  3U50 C;  2PQA B;  4A75 A;  3U9S A;  1AP0 A;  4ZUI A;  1SE3 A;  2LS0 1;  3R2I A;  2MUY A;  2F0D A;  5C4X G;  5FLX L;  1I4P A;  1IBM L;  2UUC Q;  2JEA I;  1R4Q B;  5FO7 B;  1BO0 A;  4QCL A;  3PIO A;  2KHI A;  2BOS A;  5G3L F;  2HHH L;  2O2L D;  2VW9 A;  1A2U A;  5CV8 A;  3L7Z C;  4HJ9 A;  3ZJY C;  1N34 L;  3IKJ A;  4FXD A;  3OWE B;  5JPN C;  3BJU A;  2LY7 A;  1E7Z A;  2PNR C;  5JVG 3;  2PO4 A;  1EQR A;  4GZY C;  3BDL A;  3M9B A;  4DV1 L;  2WKC A;  5C0X J;  2CW0 C;  2HIV A;  4OWW B;  2PW5 A;  4C56 C;  3HOV G;  2ZT9 C;  1E1T A;  2F0H A;  3ONA B;  2B8G A;  4ZUJ A;  3SGI A;  4O42 A;  1LT3 D;  3GTQ H;  2HQL A;  1PXU A;  1E24 A;  1JOR A;  2IX0 A;  1PRT C;  1KAA A;  3HOU G;  1MSG A;  5FOB B;  4DV7 Q;  5EPJ A;  1JWS D;  1ENF A;  1SNP A;  3H0G B;  2RDF A;  1TT2 A;  2K33 A;  2Y0S B;  3S1M B;  3EJI A;  3SK6 A;  3M4P A;  5COY A;  1HNZ L;  3EBE A;  1K83 H;  3FMC A;  1SYG A;  2F0W A;  3SEB A;  1BXT A;  4IO9 A;  4BY1 B;  3K5M A;  3HOZ H;  1AW7 A;  4XT3 B;  3WWV A;  1TWC B;  1XMQ L;  2N49 A;  4X62 Q;  2OQK A;  1C8C A;  4WJ3 M;  1EL0 A;  5IP9 H;  2L5T A;  3QOL A;  4LK1 C;  3ULJ A;  2CHB D;  4GKJ L;  1D5M C;  5A35 A;  2ZTC A;  2FXQ A;  1WVL A;  5KNC A;  4DXF A;  1PDQ A;  2EVB A;  4WJ4 A;  3J81 c;  4JBK A;  1HFG A;  2ZXO A;  3J81 L;  2A8V A;  1LTI D;  2HIX A;  1SEB D;  3FVQ A;  4YHH L;  4L63 B;  2LFN A;  4LF8 L;  2XRS D;  1YHB A;  1NAP A;  2MJ8 A;  4CDC C;  4A3M H;  4HIK A;  3LX0 A;  1HR0 L;  1XXG A;  4DAY B;  1VQO A;  4DR7 L;  1IHZ A;  3HFZ B;  1FD7 D;  1Q3L A;  3C2P A;  1NJI C;  2HDL A;  4M8A A;  4A3D G;  5FO9 B;  1OTC A;  1HZ9 A;  3QG1 A;  4X3S A;  1E0B A;  3Q0A A;  3PO2 B;  1ZYR D;  1TVX A;  3PUV A;  2F0I A;  1SR3 A;  2K50 A;  2KEC A;  4ILW A;  4GKK L;  1RIP A;  2NZH A;  1VQJ A;  5C4J H;  4DUZ Q;  4RCN A;  2MNA A;  1R9T B;  1JOQ A;  1IBK L;  1NMG A;  1STE A;  2VUM H;  1D5Z C;  2IWH A;  1TS5 A;  2NVY B;  3G4S A;  2VB3 X;  1UUP A;  4F88 A;  4C1N I;  2F0K A;  3S1R H;  4DV4 L;  5E3F A;  3T4A C;  1CHP D;  1A62 A;  1ILP A;  1CK1 A;  4DK3 C;  5JEA H;  4LF7 Q;  3FPP A;  5IGD A;  4C3J H;  2EYJ A;  4BA2 I;  2FJ2 A;  1BDO A;  2IPK D;  1MI2 A;  3MA2 B;  3OW7 A;  3L0O A;  3IRB A;  1JCK B;  4A3L H;  3HKZ B;  1VQ8 A;  3TRE A;  5C0X G;  1B44 D;  2MPM A;  2K5N A;  2PZT A;  2RSN A;  4HTH A;  1BOS A;  4B3M L;  1W6K A;  1BBW A;  2K5W A;  4AYB B;  4PNY A;  1HUN A;  1Y8P B;  3T1Y Q;  1ROD A;  2MP1 A;  3KJO A;  1PH6 A;  1TY0 A;  3CU7 A;  4EQO A;  3S17 H;  1BCP D;  2D9U A;  3PF4 A;  3TBI B;  1VQA A;  3I4O A;  1I4H A;  4R9W A;  1WCM G;  2R7F A;  1WTO A;  4ME3 A;  5JVH 3;  3NXW A;  2PNH A;  1SND A;  3NBH B;  5M3F H;  4C3I G;  4DV2 Q;  4BBS B;  1DON A;  1O7I A;  3H0G G;  2LXJ A;  4F87 A;  2J0T D;  2XWJ B;  1Y1W H;  2R6G A;  3DWA A;  2R92 G;  1U9R A;  3TZD A;  3GTO B;  3BYY B;  1OXV A;  1SLJ A;  2Q8T A;  2F4V L;  1PV4 A;  1JJG A;  3WOF A;  1G6P A;  3PUX A;  2M2L A;  4X3T A;  1HQR D;  3RN5 A;  4B3S Q;  5C44 G;  3HOW G;  4JI0 L;  1F2Z A;  4NKL A;  2RA4 A;  1LTG D;  1W2B A;  1G2S A;  1B9N A;  2DN8 A;  1V1Q A;  4JI7 L;  3K5O A;  2A6E D;  2XNA C;  4DNT B;  2JN4 A;  5LMN L;  2F0N A;  3I4L A;  3GTP H;  4K2K A;  1HUM A;  1I3Q H;  4UAI A;  1HNX L;  4OX9 L;  2PW7 A;  3CCS A;  3BZK A;  3LWU A;  3JAM c;  3C3L A;  1I94 Q;  1Z7T A;  3D6C A;  5F2D A;  1IKL A;  1QJO A;  4GS3 A;  3V2T A;  2I0Q A;  3H3V C;  4CDE C;  4HJA A;  3MWY W;  5HUR A;  4PQX A;  5ELF A;  5JJI A;  2CH4 A;  4N9P A;  3RZO H;  1VQF A;  3GTQ B;  2EJM A;  4N8F A;  2JA9 A;  4DUY L;  2F3I A;  1GJX A;  1J5E L;  1ZEQ X;  4A3E G;  3HKS A;  1JWM D;  1L1O C;  2FHT A;  4I65 A;  5D3I B;  1PTO H;  1B7Y B;  4I7Z C;  4BS9 A;  5EPK A;  1N32 Q;  3AQQ A;  3K5L A;  1K83 B;  1Y8O B;  2B2T C;  3JC6 6;  2Q2T A;  4KHP Q;  1I6H H;  2R93 H;  5EAY A;  4O0A A;  2P5Z X;  3GQB A;  5C3W A;  2A6E C;  4ZYS A;  1PH4 A;  4LF9 L;  2H4O A;  3J7Z C;  2IT1 A;  3D6W A;  4IJL A;  5C4H A;  3UDG A;  1N33 Q;  2ALY B;  3GTM H;  2F0F A;  2XGT A;  4ABN A;  3SK4 A;  3A56 A;  1AE2 A;  2AQ1 B;  1WTH A;  2UXB L;  3CCL A;  5FLM G;  3I4N H;  2QW7 A;  1K8O A;  1VQD A;  2MO0 A;  3DXJ C;  5C6A A;  1RD9 D;  3M3Y H;  5IT9 c;  3QB3 A;  4V0B A;  3A55 A;  2TMP A;  4UP9 A;  2O5I C;  1EEF D;  5IT9 L;  2E5L L;  3FPU B;  4TQU S;  3GTJ H;  1RF2 D;  3G6E A;  3HOX H;  1S5E D;  5E4W C;  4X66 L;  4IN3 A;  1PTO D;  1Y1V G;  4K6L A;  4MN3 A;  1YNJ D;  2G5D A;  4DNR B;  5LMU L;  1KAW A;  4MNO A;  4A3M B;  1X3F A;  3S2H H;  3WDN A;  1HR0 W;  3TRZ A;  4JW0 A;  1W6J A;  4GNX B;  1QCB D;  4ZK9 B;  1IYJ B;  4YWK A;  2ICI A;  3LWE A;  3OIQ A;  4DU9 A;  3I70 A;  4IFD J;  1I5F A;  3GDE A;  4LF5 L;  5GAG C;  5C4J B;  5M9O A;  5C4X H;  2I07 B;  1BCP B;  4FDB A;  2VUM B;  2EDG A;  4IUQ A;  3FHW A;  1PH5 A;  5ELO A;  1EY8 A;  1V9P A;  3S1R B;  3TP8 A;  2DNC A;  4KN4 C;  1CKN A;  3K58 A;  3AB9 A;  2XN9 C;  4C3J B;  1EYG A;  5JAV A;  1YI2 A;  3K7U C;  3T53 B;  2H1E A;  2L15 A;  3MFY A;  1PH2 A;  2PCF B;  2BCO A;  4LF4 L;  3DEO A;  4KHV A;  4H44 C;  1YNJ C;  1MBY A;  1TS3 A;  1UNS A;  4GN3 B;  3K80 C;  3DM1 A;  3S17 B;  1YHA A;  3PUW A;  4DR1 Q;  4YCW A;  1D8L A;  1VQ7 A;  1B1Z A;  1TU2 B;  4ZAI A;  5CGK A;  3CF5 A;  1QUQ B;  5M3F B;  2NVQ H;  1HJP A;  5GAE C;  2DGY A;  1BBU A;  1S5C D;  1Y1W B;  1SYE A;  2O4X A;  4JPB W;  4X64 Q;  1R4P B;  4UP7 A;  3HOZ G;  1DXM A;  4LMQ D;  1SE2 A;  1V43 A;  4ULL A;  2UUC L;  4OL7 A;  2E75 C;  4JI6 Q;  4RAU C;  2DNE A;  5T1I A;  4O1N A;  1ENA A;  1CFM A;  3E5S A;  1BQQ T;  2K28 A;  4J1M A;  4LWC A;  4YY3 Q;  5FK9 C;  2CWA A;  4CBV A;  1TR5 A;  3GO5 A;  2EQS A;  2MHV A;  1SNC A;  5M5X H;  1A3T A;  5LMN W;  3GTP B;  1DZ1 A;  3NP8 A;  1LT6 D;  1LTB D;  3A54 A;  4NDX A;  2ZJQ A;  2JA7 H;  1I3Q B;  1WTW A;  1Q46 A;  2R7Z H;  4UP8 A;  1SNQ A;  4R8I A;  4IAL A;  4FP5 D;  1EU3 A;  4A3C G;  1QZH A;  1B50 A;  3OSO A;  2FIN B;  1NTG A;  4A3D H;  1TS2 A;  2ZXR A;  3AEV A;  1L1O A;  1H9K A;  1EY0 A;  3RZO B;  4DV7 L;  1YIT A;  3KBG A;  3TP5 A;  1F77 A;  2B2T A;  1M90 C;  3F2U A;  1JOK A;  3KBX A;  1UE1 A;  1WTV A;  2ENB A;  2R61 A;  4N8X 1;  1U4M A;  1TWF H;  1CA6 A;  2VUM G;  2JA8 G;  1K3R A;  1GXD C;  4X62 L;  1PTO B;  3CCM A;  1M8A A;  4K2L A;  2AHO B;  3SK5 A;  5JEA G;  3S15 H;  3Q6S A;  1I6H B;  2K6A A;  2SOB A;  2R93 B;  4C3J G;  2V4D A;  3E9H A;  5I2Y A;  5C0X H;  2IY5 B;  4BBR G;  2O5J C;  1QG7 A;  5I9O A;  4JBW A;  4IFD I;  5ELD A;  3CCU A;  3GTM B;  1LAB A;  3NTK A;  1C9O A;  4G7H C;  4Y7N H;  3KOJ A;  3MZ5 A;  1K8A C;  4UPA A;  4KLK A;  2EXZ A;  3I4N B;  1MKH A;  1AE3 A;  3TN2 A;  2YTY A;  3M3Y B;  1WCM H;  5IGG A;  2NN6 G;  1JB7 A;  2K01 A;  1HFN A;  1SMY C;  4NMZ A;  5IYD G;  1QOH A;  2EZV A;  3GTJ B;  3HOX B;  2EYO A;  4C3I H;  4A3J G;  3H3V I;  1D2B A;  1F2L A;  4HED A;  1WFQ A;  3J80 E;  2CVR A;  3FKI G;  3W5O A;  3QO2 A;  1NY4 A;  5M3F G;  1PZJ D;  5LHY 1;  2I5H A;  4GN4 B;  3VR6 A;  4MTN A;  3S2H B;  1U0L A;  1QNU A;  4GOP C;  1SSO A;  1GUS A;  4DUZ L;  2VY3 A;  2UXC Q;  2SDF A;  5IY0 A;  1DOM A;  2KCC A;  5C44 H;  2ATW A;  3HOW H;  1PLF A;  3T1H Q;  3H6M A;  1UE5 A;  1CI3 M;  5M3M G;  5C4X B;  2BE5 D;  1B2T A;  4A3F G;  4NPS A;  4LF7 L;  4IUU A;  1GUW A;  1F9S A;  2Z4H A;  1IL2 A;  5C3E G;  3MFG A;  2ZJR A;  1O7Z A;  4KHZ A;  4P71 A;  2CCZ A;  5EBC A;  3O13 A;  1ENC A;  4WFN 3;  3K57 A;  1Q82 C;  4QIW E;  4B9W A;  1Q7Y C;  1MIU A;  5CV6 A;  3HOV B;  1FGU A;  3A8K E;  3T1Y L;  3F2C A;  1L0Y B;  3STB D;  1Q8K A;  3X3N A;  1FYC A;  4LFC Q;  1JJ2 A;  1VQH A;  1MHW C;  5CBE E;  4DV2 L;  1VQ4 A;  2RF4 A;  3EQL C;  4A3E H;  1PMR A;  5GRO A;  1PFB A;  1NNX A;  4QL5 A;  5KRU A;  3U4Z A;  1UE7 A;  5I2X A;  4DV5 Q;  2NVQ B;  2CWP A;  3J81 j;  1BCP F;  1H9S A;  4WJW A;  1C7Y A;  1PYB A;  1PFS A;  2WP8 J;  2BE5 C;  3NQI A;  2K03 A;  3CKI B;  3MVV A;  4B3S L;  1VF5 C;  3OWF A;  2L12 A;  2YTV A;  2R93 G;  4L5S A;  2B2Y C;  3H09 A;  3R3O A;  4IPD A;  4CJ2 C;  3I8Z A;  1RKN A;  5FLM H;  3S1N H;  1VQ6 A;  3PF5 A;  2WB1 E;  2SEB D;  2B39 A;  3DLL A;  2GVB A;  1SYF A;  4NB3 A;  3I4N G;  1AN8 A;  1F9R A;  2EYP A;  4H02 A;  4HJ7 A;  5M5X B;  1Y1V H;  2F4I A;  4GLA C;  1VQE A;  1DJR D;  2JA7 B;  1I94 L;  4RWS C;  3CCR A;  1HNW L;  1NCV A;  5CMD A;  2RKS A;  5IE8 A;  1YNN D;  1ESR A;  2K7V A;  4IUR A;  1YZ6 A;  1JQY D;  5IP7 G;  1VCI A;  4A3D B;  2NBF A;  1PRT D;  3IL8 A;  4ZLT F;  3B6Y A;  1TKW B;  4P74 A;  1M4V A;  2RDH A;  3EIV A;  3Q24 A;  4A3I G;  2CFM A;  3NWS A;  3FDT A;  1WJJ A;  5FLX c;  4U68 A;  1XNR Q;  2JQO A;  2B8F A;  3GV6 A;  1KLU D;  1TWF B;  4KHP L;  4KTA A;  4K8I A;  1VQP A;  4MHE A;  1PH7 A;  4IUP A;  3S1Q H;  3S9W A;  2BH8 A;  2AQ3 B;  1UWV A;  5CC4 A;  2PMZ B;  1PH9 A;  3TP6 A;  1FVI A;  4Y7N B;  1RCV D;  4DR2 Q;  1YNN C;  1STY A;  4A4I A;  1Y14 B;  4YWL A;  4Q5V A;  4LFA Q;  1WCM B;  4GOP A;  4A3B H;  1XWE A;  3I56 A;  4DF7 A;  2F3V A;  5D65 A;  3M7G A;  4C3I B;  3KDF A;  3CRL C;  3MEF A;  2PZW A;  2F0Q A;  2OTL A;  5IGB A;  4V19 0;  3PV0 A;  4KKS A;  1EIF A;  1LO5 D;  1RTN A;  4JYA Q;  3M4Q A;  1B3Q A;  2R92 B;  1D7Q A;  3AU7 A;  1HTL D;  4JOI C;  2N3S A;  4LUO A;  5IYC G;  1PTO F;  4AQY Q;  3KLW A;  1SYC A;  1I4R A;  1EIG A;  5C44 B;  3HOW B;  2A69 C;  3PGZ A;  2EJF C;  3EFX D;  1LUZ A;  3I3C A;  4XTC S;  1Q81 C;  5KIX A;  1IBL Q;  3BVZ A;  1X56 A;  2LXK A;  5CYU A;  3OTO Q;  3KLS A;  4P73 A;  5CBA E;  3CMA A;  1HRJ A;  1W3S A;  5FJ8 H;  1CQF A;  4A3C H;  2JA7 G;  4IPG A;  1PHJ A;  1NSN S;  2PYK A;  2R7Z G;  1NMF A;  4G57 A;  1EWC A;  1NR4 A;  2DY7 A;  4KY5 A;  4R4C A;  3PO3 G;  3I90 A;  2NUC A;  1NUC A;  2Q2U A;  1IZ6 A;  2EY6 A;  1K9M C;  3TS2 A;  4IFD H;  1H9J A;  1CZW A;  4KK7 A;  1PZI D;  2I46 A;  3E9I A;  3A5Z B;  1CSP A;  4XT1 B;  1S4Z A;  4JBM A;  4A3E B;  1K3B C;  2JA6 G;  2B2Y A;  1PH3 A;  3NWT A;  1A2T A;  2K52 A;  1SMX A;  2JA8 H;  2ES2 A;  3S14 H;  2D62 A;  1DCZ A;  1STG A;  2BDN A;  3PIP A;  2DJG C;  1XPR A;  3H3V H;  4X64 L;  2VQF Q;  4QF4 A;  4TKO B;  3HOY H;  1XX8 A;  2MQH A;  3KYH C;  4BBR H;  4L5Q A;  4JI6 L;  1S72 A;  3N52 A;  1PRT B;  1RHP A;  1OXT A;  1JE4 A;  5A2Q L;  1YJN A;  2A6H D;  4YY3 L;  1SYB A;  3S1N B;  4FXG C;  4A93 H;  1F9P A;  3VDY A;  4OXP A;  2NN6 H;  2EY1 A;  5HY6 A;  5IYD H;  1JWU D;  2EYF A;  3PIO 3;  4A3J H;  3GTL H;  2KCM A;  3HP3 A;  2ZM6 Q;  2G9D A;  5NUC A;  4EX5 A;  1Y1V B;  2AWN A;  1WD0 A;  2C35 B;  3FKI H;  3ND8 A;  5DNF A;  1QB5 D;  3QIA A;  4RH6 A;  1UEB A;  2AUK A;  3F2D A;  2K1B A;  1II3 A;  2QKI C;  2E74 C;  1VDZ A;  1CM9 A;  1A8V A;  4BY7 G;  3URY A;  4Q0F A;  4S3S A;  4NXM Q;  5L37 A;  3TQY A;  1VQ9 A;  2F52 A;  3U58 A;  1BKB A;  2F0M A;  2IL8 A;  5M3M H;  2OEO A;  3L9A X;  4A3F H;  4HSV A;  3VYR A;  3BYT B;  1S5B D;  4RG1 A;  4DR3 L;  4B3R L;  1Y8N B;  5J39 A;  5C3E H;  2QCP X;  4K6D A;  4DAY A;  1I4Q A;  2KEN A;  4CDF C;  4POG A;  2A6H C;  3ND9 A;  3AYH B;  1V1O A;  5KND A;  1EY6 A;  3X3M A;  4K5V A;  3S1Q B;  5COR A;  4XQJ A;  4RA8 A;  1G91 A;  5J22 A;  4DAP A;  3ER0 A;  1F9Q A;  3QJY A;  3AMU A;  1KNE A;  1SXT A;  5IGC A;  2WKD A;  4TSS A;  3G71 A;  1U4L A;  4FO2 A;  1STB A;  3QOJ A;  2D2C C;  3W2D A;  4QB4 A;  2N88 A;  1SNO A;  1B9M A;  4RFB A;  1Q12 A;  4JI8 Q;  1S5D D;  2IHE A;  1WI5 A;  3D3R A;  5IIF A;  1BNZ A;  1A3U A;  4A3B B;  4JOI A;  4A3G H;  2WV6 D;  5I6Y A;  2KEE A;  4AH6 A;  2XRQ D;  2EY2 A;  5KNB A;  4DN4 M;  3VR2 A;  3LNN A;  3ERS X;  4JI4 Q;  4PMB A;  2ICE C;  2E2I H;  1KTK A;  1SE8 A;  2HT1 A;  4IQZ A;  4MTK A;  3SHL A;  2UXC L;  1TXY A;  1CKN B;  3OIP A;  2WB1 G;  3T1H L;  3HOZ B;  3KF6 A;  4FF4 A;  3P7J A;  4E6I A;  3RLO A;  1HZA A;  3EN2 A;  1XMO Q;  1ICW A;  4KI0 A;  2RHS B;  3J80 L;  3NBH A;  1PYW D;  4ZRZ A;  4H13 C;  2G9H D;  4DV0 Q;  1IW7 D;  4MIU A;  4QGU A;  3H91 A;  1Q90 A;  3VYT A;  2VB2 X;  3I55 A;  3QR8 A;  1MD2 D;  4LUV A;  3LGJ A;  1PH1 A;  4DR4 Q;  1X32 A;  1RJT A;  1NR2 A;  1HA5 A;  1SJH D;  4OO1 I;  3NEL A;  4L8J A;  3SR1 A;  2QEX A;  4KY6 A;  2E2D C;  5IP7 H;  4JI5 Q;  1ASY A;  2QA4 A;  1OXX K;  5M5Y H;  2UUB L;  2ZTD A;  4OIJ A;  1C0A A;  5LL6 X;  1KHI A;  4LFC L;  4FVM A;  2WII B;  3Q8D A;  5EQ0 A;  4JI2 Q;  4A3I H;  2UXD Q;  4R8N A;  4HIO A;  3WOE A;  1E2Z A;  4DV5 L;  1C4Q A;  2Q8R E;  1WTX A;  2K32 A;  2D0P A;  4R1J A;  1OXS C;  2JA8 B;  3S14 B;  1GD7 A;  2F0E A;  3M7N A;  5K36 H;  3ITP A;  1KAB A;  5E4X A;  1ET9 A;  3GTG H;  1B8A A;  1IW7 C;  2OF1 A;  2ZTE A;  4C2M H;  3MAQ A;  1J9O A;  1CQV A;  5KYL A;  3J81 E;  3HOY B;  3CC2 A;  1FNU A;  2PZU A;  1KDB A;  2QGQ A;  4BBR B;  3E3X A;  4OIK A;  1E1O A;  1EUJ A;  2E8G A;  3FEW X;  2SNS A;  3V05 A;  1B4O A;  3RZD H;  3I73 A;  2JSO A;  3A5U A;  4K14 A;  5DM6 3;  4A93 B;  1PA6 A;  3K0X A;  2L55 A;  5EKI A;  4IUN A;  2OXP A;  2B2W C;  1I50 H;  3UDF A;  1EFI D;  4A3J B;  3GTL B;  4IOC A;  1K8G A;  1GOZ A;  1G6Z A;  1LM0 A;  1A6X A;  5IYB G;  1JMC A;  1G2T A;  3TZU A;  5BN4 A;  5GAD C;  4A3B G;  4JG2 A;  3FKI B;  3HRZ C;  3FP9 A;  1JJC B;  1E2W A;  1STN A;  1YBY A;  1Q1B A;  4L5R C;  3P1H A;  1SDF A;  1TQO A;  5IYC H;  2NTS A;  1QNK A;  2A73 B;  5M5W H;  2RDG A;  1QVG A;  1SJE D;  4XIG S;  5EJW A;  3CHB D;  4P72 A;  3MC0 B;  1XNR L;  1A3V A;  5M3M B;  3OMG A;  4KD3 A;  4A3F B;  2R7D A;  2QEJ C;  3NTH A;  1XTD A;  1PRT F;  4K8J A;  5C3E B;  4FXK C;  2Z4I A;  1IBK Q;  1GHK A;  4GNX A;  1SE4 A;  1ICF B;  2BH2 A;  3DWP A;  2K04 A;  3TDQ A;  1IL8 A;  4PZ6 A;  1D1K A;  4PV1 C;  2J4X A;  2GN5 A;  5I6W A;  4OON A;  2V1C C;  5I9P A;  3I7F A;  3GD7 A;  4LW1 A;  1BR9 A;  1LT4 D;  5FJ8 G;  4DR2 L;  2IX1 A;  1O78 A;  3PO3 H;  2D0O A;  2ID0 A;  3P75 A;  2EOT A;  1SMY D;  2YTX A;  4LFA L;  4EQP A;  1SN8 A;  1K0S A;  4KY7 A;  1SYD A;  2ZXP A;  4UDU C;  2JK8 A;  3NK9 A;  3RNU A;  4IFD G;  4APV A;  2JA6 H;  3CC7 A;  3TME A;  2OTJ A;  2IW3 A;  1B70 B;  3RMH A;  5ELE A;  4JYA L;  4JV5 Q;  1G8Z D;  4AQY L;  2E2I B;  3R93 A;  4RKB A;  1VS0 A;  3NPP A;  5GAH C;  3K5N A;  4YWM A;  2UU9 Q;  1CHQ D;  5C3X A;  3TP7 A;  3HOY G;  1WOC A;  2K05 A;  3DHQ A;  4A76 A;  4GLX A;  3OPO A;  2NVX H;  2KHS A;  1LAC A;  3AFQ A;  1IBL L;  2AUJ D;  5BN5 A;  3PQI A;  1VQI A;  2RQX A;  3BZC A;  5DM7 3;  1P8L A;  3UDX A;  3JAM E;  4A93 G;  3KLR A;  3OYY A;  2LKV A;  1KRS A;  1I4X A;  5GQO A;  4BXX G;  3IAY A;  2B3G A;  2QIL A;  1DYQ A;  4RHS A;  4DV3 Q;  3MHB A;  1QWY A;  2K4K A;  3A74 A;  4RGT A;  5J3B A;  3G6J B;  2F0L A;  4XQN A;  5DLQ E;  3RD4 A;  3A0J A;  3D8G A;  3UE0 A;  2B29 A;  2Q2H A;  2CQA A;  3ERO A;  4BY7 H;  1CTM A;  4CJ1 B;  1H9S B;  5M5Y B;  4WRD A;  3ULL A;  1ET6 A;  5ELB A;  1MSH A;  1Z9F A;  1V1P B;  3TEH B;  1XYI A;  2KHJ A;  4A3I B;  1LTR D;  4FF2 A;  3R2T A;  3NSW A;  5IWA Q;  5CR3 A;  5CV7 A;  4X6A H;  2KVM A;  3M4O H;  4R4I A;  2A68 C;  3NQT A;  4DV6 Q;  3UE1 A;  4NW2 A;  2EPB A;  3CAM A;  4G7Z C;  3NTI A;  1U4P A;  2VQF L;  1WYD A;  4LAA A;  2X6L A;  1N9W A;  4DR6 Q;  1VQK A;  4OHJ A;  2UUA Q;  1Z6H A;  2XSC A;  3BVM A;  4ME5 A;  3GTG B;  4C2M B;  2KJX A;  4ZCK A;  2B2W A;  4HIM A;  5IT9 E;  3SK8 A;  2OCE A;  3BVG A;  1EYA A;  5K5P A;  5D3D A;  2Y0S E;  1A63 A;  1WTQ A;  3RZD B;  1DM0 B;  4OWT B;  1X3P A;  5C4Z A;  2I5M X;  2KA7 A;  4GN5 A;  3MXG A;  2RCF A;  3T13 A;  2ZM6 L;  4J6H A;  5BR8 Q;  2F0O A;  3QWN A;  1HA6 A;  2XIW A;  2RHQ B;  4XYQ A;  5KGU A;  1ZKO A;  1IYU A;  1JIC A;  1GUN A;  2GVA A;  4LF6 Q;  3D0F A;  1CT1 D;  4A3G G;  5C5M A;  2WFW A;  3RUZ A;  1JR0 D;  4DNI A;  5LMU Q;  4NXM L;  3UDI A;  1VQN A;  4XYO A;  3C46 A;  1XTC D;  2KCT A;  5M5W B;  2Z6K C;  4RKL A;  3RR5 A;  3CP0 A;  2F0G A;  3ICE A;  3VA5 A;  1KL9 A;  4DFA A;  2XWB B;  4LF5 Q;  5IOD A;  3BZD B;  3PUZ A;  1D5X C;  1EZ8 A;  4H0L C;  4ZQ3 A;  2CH4 W;  3PMF A;  2K75 A;  1SRO A;  4FF3 A;  4C1N K;  3U9O A;  4CGY B;  3E6Z X;  1TWA H;  5JJK A;  4GOP B;  1BF4 A;  2RCN A;  3T16 A;  1O7L A;  1QE6 A;  2EY5 A;  2L9H A;  3DMU A;  2PI2 A;  1KDC A;  1X3E A;  1L2F A;  3NBI A;  3CXC A;  3KDF B;  3OHX C;  3IFT A;  2R7Z B;  5HGQ A;  3CCE A;  3W1B A;  4K0K Q;  2FMC A;  4IOA A;  1EY4 A;  1QZG A;  3PO3 B;  2MFI A;  2R3Z A;  1OO9 B;  4JI8 L;  4CKE A;  1SBB B;  1LTT D;  3J7A 5;  4LF4 Q;  1VQ5 A;  4F7X A;  3D4R A;  5CV9 A;  3A8I E;  1IKM A;  1EOV A;  2L4N A;  2WAC A;  3DUZ A;  3H15 A;  2JA5 G;  1DOK A;  4QUF A;  1S40 A;  2JA6 B;  4UHV A;  4JI4 L;  4JVZ A;  1N32 L;  1ONL A;  1SAP A;  3KK7 A;  3IFD A;  1H9M A;  1XNQ Q;  4JK1 C;  1O7Y A;  2KED A;  5BN3 A;  5K36 G;  4G7O C;  2A69 D;  1XMO L;  2NB0 A;  4CHT B;  1N33 L;  1X55 A;  1U5K A;  3KJP A;  3S15 B;  1I6V C;  5AJ3 Q;  1MJC A;  4DV0 L;  4H7B A;  2NVX B;  5EKK A;  3VYU A;  3VA7 A;  5FO8 B;  2EJG C;  1PFM A;  4U67 3;  4B3T Q;  1YEZ A;  4YCV A;  4X65 Q;  1AEX A;  4DR4 L;  3K6O A;  3U4V A;  4ALP A;  3G48 A;  2M00 A;  4PMC A;  4JI3 Q;  3S16 H;  1NE3 A;  3K7A H;  2OWO A;  5IYB H;  4DR5 Q;  4LUZ A;  2B63 G;  1A15 A;  4JI5 L;  1STA A;  4K5W A;  4XQQ A;  3EA6 A;  1E22 A;  1UEA B;  1T5X D;  1C48 A;  4JI2 L;  2UXD L;  1HZC A;  1UAP A;  4BY7 B;  3R8B A;  4C3H G;  2F0J A;  2IHF A;  2BDO A;  1MJE A;  3MXN A;  3GP7 A;  3M4O B;  2PQE A;  3KLS X;  1EYD A;  3KF8 A;  1RDP D;  2JP1 A;  4KKU A;  1EY9 A;  1FGB D;  4QIW B;  3HS0 C;  1KDA A;  1L0X B;  2C5C A;  1VMP A;  2NYZ D;  1EIH A;  5CV5 A;  2QDB A;  3EVQ A;  2PQA A;  4IUT A;  1BVS A;  1DD2 A;  2WAQ G;  4NXN Q;  1ML0 D;  3JAM i;  1JT8 A;  2EXD A;  4QMG A;  1GUG A;  3I91 A;  1HHV A;  4ID6 A;  1J6Q A;  5AFW A;  4DR1 L;  2F0P A;  1BBX C;  2VL6 A;  2L11 A;  4AIM A;  5EGT A;  4OWX B;  2MGS A;  3J80 i;  2Z6K A;  4OEM B;  5T1G A;  1KC8 C;  4EGV A;  1LTS D;  3SXH A;  2B2U C;  2N55 A;  3K8A A;  4A3K H;  1VMC A;  3F1Z A;  3CD6 A;  2VS1 A;  1I4G A;  1KIX A;  5ISR A;  2WB1 B;  2AKW B;  1LLR D;  3MXP A;  1LTA D;  4HN7 A;  3I72 A;  3W3A A;  2KUM A;  5ELC A;  1K8M A;  2E76 C;  3CCQ A;  2EYL A;  4DKA C;  1VQM A;  1LTL A;  2K5H A;  5KYI A;  4PG3 A;  4BXX H;  5FKA C;  1TWA B;  3OMC A;  4HJ5 A;  1YIJ A;  1WTR A;  1G51 A;  1TWG H;  4JBJ A;  4Z9C B;  4BWG B;  2NZ1 D;  2F3W A;  1IYV A;  1RL2 A;  5JPM C;  1TWH H;  2AQ2 B;  2VQE Q;  3J7Y W;  1D6E C;  1TII D;  3SVM A;  2Z0S A;  1EZ6 A;  1QIL A;  4N9T A;  4WOR A;  5IGF A;  3BS1 A;  3GTK H;  3KF6 B;  1U4R A;  5JOB A;  4QJF A;  4R4T A;  3CME A;  4JI1 Q;  2J7Z A;  4X3K A;  1HZB A;  1ZYR C;  2F0S A;  4JV5 L;  2KOL A;  5C0X I;  2QDL A;  2X6G A;  2UU9 L;  3VYS A;  1JB3 A;  2Y0S G;  2F1M A;  3DEP A;  2YU9 H;  1F2Y A;  1FJG Q;  3HEJ A;  4BY1 G;  3NEN A;  3K59 A;  2N78 A;  4KV6 A;  1BUV T;  3Q23 A;  1X9N A;  4CKB A;  3CRK C;  4TVA B;  2NWG A;  2VXW A;  2A5H A;  2JEB I;  2K5D A;  1EFW A;  4B9X A;  4O2D A;  1EYC A;  1Q1E A;  3CPF A;  4GNX C;  2HCI A;  1X54 A;  2JJQ A;  1X65 A;  1FNV A;  4CKC A;  3VR4 A;  2E2J H;  1JOO A;  2K14 A;  4HR7 B;  2I5L X;  3CQZ H;  4DV3 L;  1N36 Q;  2TSS A;  3S16 B;  3K7A B;  4I7A A;  2Z8L A;  2KCN A;  1K0R A;  1DOL A;  1A0I A;  4OGQ C;  1BCP C;  4P75 A;  1RTO A;  4PZ7 A;  5J1Z A;  1KQS A;  2HDM A;  1ILQ A;  1HNW Q;  4DGZ A;  3JAM L;  3S2D H;  5FLX E;  5H1S E;  3Q22 A;  1EEI D;  2HUG A;  1E2V A;  3GV3 A;  5IWA L;  4OO1 G;  4YCU A;  1V8Q A;  4DV6 L;  5G3L D;  3E0J A;  1M1K C;  3PO2 G;  2EIF A;  3J80 c;  1FR3 A;  4CDD C;  2HQE A;  4LFB Q;  1D1I A;  3RLN A;  4RGM A;  3D4D A;  4LNQ A;  4Y52 H;  4DR6 L;  4HMI A;  2UUA L;  1JC7 A; 
#chains in the Genus database with same CATH homology
 3N6R A;  3J7A V;  1TS4 A;  3PIP 3;  1EY7 A;  2SNM A;  2F03 A;  1X3Q A;  4KKT A;  1STH A;  3D4W A;  3C1E A;  1PZK D;  1KNA A;  1AZQ A;  1CA5 A;  2B2U A;  1WTP A;  3MXU A;  4HSP A;  3P20 A;  4FNF A;  1T5E A;  4IZ8 A;  4BA1 I;  2F0U A;  4X3U A;  2LMC B;  4YIJ A;  3BDC A;  4J8Q A;  3RLF A;  3A7A B;  2EYH A;  1KLG D;  4A3K B;  4NP5 A;  4CJ0 B;  4FF1 A;  4RGN A;  3TSS A;  2Z1C A;  3PUY A;  2NTT A;  1HTP A;  4EQN A;  3M85 A;  2X69 A;  1HQM C;  1F2M A;  5IGE A;  5JEA J;  1H9R A;  3HGB A;  1HCZ A;  1TWG B;  1GUO A;  2C9O A;  1AFP A;  1TWH B;  3D31 A;  1PTO C;  4KJN A;  1Q8I A;  2Q8I B;  2A74 C;  1LT5 D;  1J8I A;  3GTK B;  2EE1 A;  5EKL A;  5I4D A;  2VNU D;  1EU4 A;  4G4K A;  4ZKB B;  3HG9 A;  3HZX A;  5A2Q E;  5TSS A;  1Y69 U;  4DXG A;  4DK0 A;  5D14 A;  2YU9 B;  1G29 1;  2JYO A;  2XVS A;  3VR5 A;  2B2V C;  5CV4 A;  2FFK B;  2PPB C;  2YYZ A;  5HGT A;  2D5D A;  4EVO A;  2E2J B;  3CQZ B;  3KUP A;  1O80 A;  4A3G B;  3BG3 A;  4TRD A;  2BA0 A;  2RVL A;  3L3O C;  1EQT A;  3S2D B;  2KQ3 A;  4DA2 A;  2A68 D;  3VR3 A;  5JJZ A;  4M1U B;  1AZP A;  1GHJ A;  4IUV A;  1EY5 A;  1WD1 A;  5DAU A;  5IOC A;  3I4M B;  5E1F A;  4HAE A;  1PFN A;  4HMJ A;  3NUC A;  4L6T B;  2NVT B;  2L1B A;  2OT2 A;  1B53 A;  1GUT A;  5C5L A;  4HCE A;  3J7A F;  2RSO A;  1HXY D;  2JA5 B;  2L0C A;  2F0V A;  4PMW A;  3K0Y A;  2BA1 A;  4K5X A;  3V96 A;  1Z47 A;  2GA4 B;  1ESF A;  5LL6 S;  3A7L A;  2M9V A;  3NHH A;  3ERQ A;  4RCO A;  2WIN B;  2NN6 I;  1OXU A;  2FMM A;  1B3A A;  2DY8 A;  3ZYY X;  1EWH A;  2AWO A;  3FRP B;  3H94 A;  3NE5 B;  4ODG A;  2IJ0 A;  4DAV A;  2E2H B;  1I50 B;  2K5Q A;  2B63 B;  4LJZ C;  1S5F D;  3MTS A;  4KN7 C;  3M4Y A;  2JXM B;  1VF7 A;  1TY2 A;  4RHR A;  4OO1 H;  4C3H B;  1LV9 A;  2QF7 A;  4HCS A;  3DWQ A;  4DK1 A;  4KMU C;  5EPL A;  4FYD A;  1CZG A;  3HOU B;  1HPC A;  3SDZ A;  4F8M A;  5DEH A;  1SFO B;  3T51 B;  2RBM A;  4XXE A;  3BDO A;  1FNW A;  4P2C B;  4KD4 A;  2B2V A;  4XDX A;  5EBD A;  1V1P A;  1MGS A;  4RGO S;  2WAQ B;  4ZKC B;  1ZXT A;  1EOT A;  3T56 B;  3C1F A;  3SE0 A;  3G7L A;  3MEH A;  3A8J E;  4KJO A;  1EQV A;  1SNM A;  2EYM A;  2HCC A;  5KEE A;  2CW0 D;  2F0T A;  2IX3 A;  4QUC A;  3OOC A;  3UI2 A;  2JE6 I;  4B08 A;  3U9S A;  1AP0 A;  4ZUI A;  1SE3 A;  2LS0 1;  3R2I A;  2MUY A;  2F0D A;  5FLX L;  1I4P A;  2JEA I;  1R4Q B;  5FO7 B;  1BO0 A;  4QCL A;  2BOS A;  5G3L F;  2O2L D;  1A2U A;  5CV8 A;  3L7Z C;  3IKJ A;  4FXD A;  3OWE B;  5JPN C;  2LY7 A;  2PNR C;  5JVG 3;  2PO4 A;  4GZY C;  3BDL A;  2WKC A;  5C0X J;  2CW0 C;  2PW5 A;  4C56 C;  2ZT9 C;  2F0H A;  3ONA B;  2B8G A;  4ZUJ A;  4O42 A;  1LT3 D;  1PXU A;  1JOR A;  2IX0 A;  1PRT C;  1KAA A;  1MSG A;  5FOB B;  5EPJ A;  1JWS D;  1ENF A;  1SNP A;  3H0G B;  2RDF A;  1TT2 A;  2K33 A;  2Y0S B;  3S1M B;  3EJI A;  3SK6 A;  5COY A;  3FMC A;  1SYG A;  2F0W A;  3SEB A;  1BXT A;  4BY1 B;  3K5M A;  1AW7 A;  4XT3 B;  1TWC B;  1C8C A;  1EL0 A;  2L5T A;  3QOL A;  4LK1 C;  2CHB D;  1D5M C;  5A35 A;  1WVL A;  5KNC A;  4DXF A;  1PDQ A;  2EVB A;  1HFG A;  2ZXO A;  3J81 L;  1LTI D;  1SEB D;  3FVQ A;  4L63 B;  2LFN A;  2XRS D;  1NAP A;  2MJ8 A;  3LX0 A;  1XXG A;  1IHZ A;  1FD7 D;  1Q3L A;  3C2P A;  2HDL A;  4M8A A;  5FO9 B;  3QG1 A;  4X3S A;  1E0B A;  3Q0A A;  3PO2 B;  1ZYR D;  1TVX A;  3PUV A;  2F0I A;  2KEC A;  4ILW A;  4RCN A;  1R9T B;  1JOQ A;  1STE A;  1D5Z C;  2IWH A;  1TS5 A;  2NVY B;  2VB3 X;  1UUP A;  4F88 A;  4C1N I;  2F0K A;  5E3F A;  3T4A C;  1CHP D;  1ILP A;  1CK1 A;  5JEA H;  3FPP A;  5IGD A;  2EYJ A;  4BA2 I;  2FJ2 A;  1BDO A;  2IPK D;  1MI2 A;  3MA2 B;  3OW7 A;  1JCK B;  3HKZ B;  5C0X G;  1B44 D;  2MPM A;  2PZT A;  2RSN A;  4HTH A;  1BOS A;  1W6K A;  2K5W A;  4AYB B;  4PNY A;  1HUN A;  1Y8P B;  1ROD A;  2MP1 A;  1TY0 A;  3CU7 A;  4EQO A;  1BCP D;  2D9U A;  3TBI B;  1I4H A;  4R9W A;  1WTO A;  5JVH 3;  3NXW A;  1SND A;  4C3I G;  4BBS B;  1DON A;  4F87 A;  2J0T D;  2XWJ B;  2R6G A;  3DWA A;  1U9R A;  3TZD A;  3GTO B;  3BYY B;  1OXV A;  2Q8T A;  3WOF A;  3PUX A;  2M2L A;  4X3T A;  1HQR D;  1F2Z A;  4NKL A;  2RA4 A;  1LTG D;  1G2S A;  1B9N A;  2DN8 A;  3K5O A;  2A6E D;  2XNA C;  4DNT B;  2F0N A;  3I4L A;  4K2K A;  1HUM A;  4UAI A;  2PW7 A;  3LWU A;  3C3L A;  1Z7T A;  3D6C A;  5F2D A;  1IKL A;  1QJO A;  3V2T A;  3H3V C;  3MWY W;  5HUR A;  4PQX A;  5ELF A;  4N9P A;  3GTQ B;  2EJM A;  1GJX A;  1ZEQ X;  1JWM D;  2FHT A;  4I65 A;  5D3I B;  1PTO H;  4I7Z C;  4BS9 A;  5EPK A;  3K5L A;  1K83 B;  1Y8O B;  2B2T C;  3GQB A;  5C3W A;  2A6E C;  4ZYS A;  2H4O A;  2IT1 A;  3D6W A;  5C4H A;  2F0F A;  4ABN A;  3SK4 A;  3A56 A;  2AQ1 B;  1K8O A;  3DXJ C;  5C6A A;  1RD9 D;  3QB3 A;  4V0B A;  3A55 A;  2TMP A;  2O5I C;  1EEF D;  5IT9 L;  3FPU B;  4TQU S;  1RF2 D;  1S5E D;  5E4W C;  4IN3 A;  1PTO D;  4K6L A;  4MN3 A;  1YNJ D;  4DNR B;  4A3M B;  3WDN A;  1W6J A;  1QCB D;  4ZK9 B;  2ICI A;  3LWE A;  3OIQ A;  4DU9 A;  3I70 A;  4IFD J;  5C4J B;  5M9O A;  2I07 B;  1BCP B;  2VUM B;  2EDG A;  4IUQ A;  1EY8 A;  3S1R B;  3TP8 A;  2DNC A;  4KN4 C;  3K58 A;  3AB9 A;  2XN9 C;  4C3J B;  5JAV A;  3T53 B;  2H1E A;  3MFY A;  2PCF B;  2BCO A;  3DEO A;  4KHV A;  4H44 C;  1YNJ C;  1MBY A;  1TS3 A;  1UNS A;  3DM1 A;  3S17 B;  3PUW A;  1B1Z A;  1TU2 B;  4ZAI A;  5CGK A;  5M3F B;  1S5C D;  1Y1W B;  1SYE A;  2O4X A;  1R4P B;  1DXM A;  4LMQ D;  1SE2 A;  1V43 A;  4ULL A;  4OL7 A;  2E75 C;  4RAU C;  2DNE A;  5T1I A;  4O1N A;  1ENA A;  1CFM A;  3E5S A;  1BQQ T;  2K28 A;  4J1M A;  5FK9 C;  4CBV A;  1TR5 A;  3GO5 A;  2MHV A;  1SNC A;  1DZ1 A;  1A3T A;  3GTP B;  3A54 A;  1LT6 D;  1LTB D;  3NP8 A;  4NDX A;  1I3Q B;  1WTW A;  1SNQ A;  4R8I A;  4IAL A;  4FP5 D;  1EU3 A;  1B50 A;  3OSO A;  2FIN B;  1TS2 A;  2ZXR A;  1H9K A;  1EY0 A;  3RZO B;  3KBG A;  3TP5 A;  1F77 A;  2B2T A;  3F2U A;  1JOK A;  3KBX A;  1WTV A;  2ENB A;  2R61 A;  1U4M A;  1CA6 A;  1GXD C;  1PTO B;  1M8A A;  4K2L A;  3SK5 A;  5JEA G;  3Q6S A;  1I6H B;  2K6A A;  2SOB A;  2R93 B;  4C3J G;  2V4D A;  5I2Y A;  5C0X H;  2O5J C;  1QG7 A;  5I9O A;  4JBW A;  4IFD I;  5ELD A;  3GTM B;  1LAB A;  3NTK A;  4G7H C;  3MZ5 A;  2EXZ A;  3I4N B;  3TN2 A;  3M3Y B;  5IGG A;  2NN6 G;  2K01 A;  1HFN A;  1SMY C;  4NMZ A;  1QOH A;  2EZV A;  3GTJ B;  3HOX B;  2EYO A;  1D2B A;  1F2L A;  4HED A;  3J80 E;  2CVR A;  3QO2 A;  1PZJ D;  5LHY 1;  3VR6 A;  3S2H B;  1QNU A;  1SSO A;  1GUS A;  2SDF A;  1DOM A;  2KCC A;  1PLF A;  3H6M A;  1CI3 M;  5C4X B;  2BE5 D;  1B2T A;  4IUU A;  1GUW A;  1F9S A;  2Z4H A;  3MFG A;  1O7Z A;  4KHZ A;  5EBC A;  3O13 A;  1ENC A;  4WFN 3;  3K57 A;  4B9W A;  5CV6 A;  3HOV B;  3A8K E;  1L0Y B;  3X3N A;  1FYC A;  5CBE E;  3EQL C;  1PMR A;  1PFB A;  5KRU A;  5I2X A;  2NVQ B;  1BCP F;  1H9S A;  4WJW A;  2WP8 J;  2BE5 C;  3NQI A;  2K03 A;  3CKI B;  3MVV A;  1VF5 C;  3OWF A;  2L12 A;  2B2Y C;  3H09 A;  3R3O A;  4CJ2 C;  3I8Z A;  1RKN A;  2SEB D;  2B39 A;  1SYF A;  1AN8 A;  1F9R A;  2EYP A;  5M5X B;  2F4I A;  1DJR D;  2JA7 B;  4RWS C;  1NCV A;  5CMD A;  2RKS A;  1YNN D;  1ESR A;  2K7V A;  4IUR A;  1JQY D;  1VCI A;  4A3D B;  2NBF A;  1PRT D;  3IL8 A;  4ZLT F;  1TKW B;  1M4V A;  2RDH A;  3Q24 A;  3NWS A;  3FDT A;  4U68 A;  2B8F A;  3GV6 A;  1KLU D;  1TWF B;  4KTA A;  4K8I A;  4MHE A;  4IUP A;  3S9W A;  2AQ3 B;  5CC4 A;  2PMZ B;  3TP6 A;  4Y7N B;  1RCV D;  1YNN C;  1STY A;  4Q5V A;  1WCM B;  1XWE A;  4DF7 A;  2F3V A;  5D65 A;  3M7G A;  4C3I B;  3CRL C;  2PZW A;  2F0Q A;  5IGB A;  4V19 0;  3PV0 A;  4KKS A;  1LO5 D;  1RTN A;  2R92 B;  3AU7 A;  1HTL D;  1PTO F;  1SYC A;  1I4R A;  1EIG A;  5C44 B;  3HOW B;  2A69 C;  2EJF C;  3EFX D;  3I3C A;  4XTC S;  5KIX A;  3BVZ A;  5CYU A;  3KLS A;  5CBA E;  1HRJ A;  1CQF A;  1NSN S;  2PYK A;  4G57 A;  1EWC A;  1NR4 A;  2DY7 A;  4KY5 A;  3I90 A;  2NUC A;  1NUC A;  2EY6 A;  4IFD H;  1H9J A;  1CZW A;  4KK7 A;  1PZI D;  2I46 A;  4XT1 B;  1S4Z A;  4A3E B;  2B2Y A;  3NWT A;  1A2T A;  2D62 A;  1DCZ A;  1STG A;  2BDN A;  4QF4 A;  4TKO B;  1XX8 A;  3N52 A;  1PRT B;  1RHP A;  1OXT A;  1JE4 A;  5A2Q L;  2A6H D;  1SYB A;  3S1N B;  4FXG C;  1F9P A;  2NN6 H;  2EY1 A;  1JWU D;  2EYF A;  3PIO 3;  3HP3 A;  2G9D A;  5NUC A;  1Y1V B;  2AWN A;  1WD0 A;  3ND8 A;  5DNF A;  1QB5 D;  3QIA A;  4RH6 A;  2AUK A;  2K1B A;  1II3 A;  2QKI C;  2E74 C;  1VDZ A;  1CM9 A;  3URY A;  4Q0F A;  4S3S A;  2F0M A;  2IL8 A;  2OEO A;  3L9A X;  4HSV A;  3VYR A;  3BYT B;  1S5B D;  1Y8N B;  5J39 A;  2QCP X;  4K6D A;  4DAY A;  1I4Q A;  2A6H C;  3ND9 A;  1V1O A;  5KND A;  1EY6 A;  3X3M A;  4K5V A;  3S1Q B;  5COR A;  4XQJ A;  4RA8 A;  1G91 A;  5J22 A;  4DAP A;  1F9Q A;  3QJY A;  3AMU A;  1KNE A;  1SXT A;  5IGC A;  2WKD A;  4TSS A;  1U4L A;  4FO2 A;  1STB A;  3QOJ A;  2D2C C;  3W2D A;  4QB4 A;  2N88 A;  1SNO A;  1B9M A;  4RFB A;  1Q12 A;  1S5D D;  3D3R A;  1BNZ A;  5IIF A;  1A3U A;  4A3B B;  2WV6 D;  5I6Y A;  2KEE A;  2XRQ D;  2EY2 A;  5KNB A;  4DN4 M;  3VR2 A;  3LNN A;  4PMB A;  2ICE C;  1KTK A;  4IQZ A;  3SHL A;  3OIP A;  3HOZ B;  4FF4 A;  3P7J A;  4E6I A;  1ICW A;  4KI0 A;  3J80 L;  3NBH A;  1PYW D;  4ZRZ A;  4H13 C;  2G9H D;  1IW7 D;  4MIU A;  3H91 A;  1Q90 A;  3VYT A;  2VB2 X;  1MD2 D;  1X32 A;  1RJT A;  1NR2 A;  1HA5 A;  1SJH D;  4OO1 I;  4L8J A;  3SR1 A;  4KY6 A;  2E2D C;  1OXX K;  4OIJ A;  5LL6 X;  4FVM A;  2WII B;  5EQ0 A;  4R8N A;  3WOE A;  1E2Z A;  1C4Q A;  2Q8R E;  1WTX A;  2K32 A;  1OXS C;  2JA8 B;  3S14 B;  2F0E A;  3M7N A;  5K36 H;  3ITP A;  1KAB A;  5E4X A;  1ET9 A;  1IW7 C;  2OF1 A;  3MAQ A;  1J9O A;  1CQV A;  5KYL A;  3J81 E;  3HOY B;  1FNU A;  2PZU A;  1KDB A;  4BBR B;  4OIK A;  3FEW X;  2SNS A;  3V05 A;  1B4O A;  3I73 A;  2JSO A;  4K14 A;  5DM6 3;  4A93 B;  5EKI A;  2L55 A;  4IUN A;  2OXP A;  2B2W C;  1EFI D;  4A3J B;  3GTL B;  1GOZ A;  1G6Z A;  1A6X A;  1G2T A;  3TZU A;  5BN4 A;  3FKI B;  3HRZ C;  1E2W A;  1STN A;  1Q1B A;  3P1H A;  1SDF A;  1TQO A;  2NTS A;  1QNK A;  2A73 B;  2RDG A;  1SJE D;  4XIG S;  5EJW A;  3CHB D;  3MC0 B;  1A3V A;  5M3M B;  3OMG A;  4KD3 A;  4A3F B;  2QEJ C;  3NTH A;  1PRT F;  4K8J A;  5C3E B;  4FXK C;  2Z4I A;  1GHK A;  1SE4 A;  3DWP A;  2K04 A;  3TDQ A;  1IL8 A;  1D1K A;  4PV1 C;  2J4X A;  5I6W A;  5I9P A;  3GD7 A;  1BR9 A;  1LT4 D;  2IX1 A;  1O78 A;  2ID0 A;  3P75 A;  2EOT A;  1SMY D;  4EQP A;  4KY7 A;  1SYD A;  2ZXP A;  4UDU C;  3NK9 A;  4IFD G;  3TME A;  2IW3 A;  3RMH A;  5ELE A;  1G8Z D;  2E2I B;  3R93 A;  4RKB A;  3NPP A;  3K5N A;  1CHQ D;  5C3X A;  3TP7 A;  2K05 A;  3DHQ A;  3OPO A;  2KHS A;  1LAC A;  2AUJ D;  5BN5 A;  2RQX A;  5DM7 3;  3JAM E;  3KLR A;  2LKV A;  1I4X A;  3IAY A;  4RHS A;  2QIL A;  1DYQ A;  3MHB A;  1QWY A;  4RGT A;  3G6J B;  2F0L A;  4XQN A;  3RD4 A;  3D8G A;  2CQA A;  3ERO A;  1CTM A;  4CJ1 B;  1H9S B;  5M5Y B;  4WRD A;  1ET6 A;  5ELB A;  1MSH A;  1V1P B;  1XYI A;  4A3I B;  1LTR D;  4FF2 A;  3R2T A;  3NSW A;  5CR3 A;  5CV7 A;  2KVM A;  2A68 C;  3NQT A;  4NW2 A;  2EPB A;  4G7Z C;  3NTI A;  1U4P A;  4LAA A;  2X6L A;  4OHJ A;  1Z6H A;  2XSC A;  3BVM A;  4ME5 A;  3GTG B;  4C2M B;  2KJX A;  2B2W A;  5IT9 E;  3SK8 A;  3BVG A;  1EYA A;  5K5P A;  5D3D A;  1WTQ A;  3RZD B;  1DM0 B;  1X3P A;  5C4Z A;  2KA7 A;  3MXG A;  3T13 A;  4J6H A;  2F0O A;  3QWN A;  1HA6 A;  2XIW A;  4XYQ A;  5KGU A;  1ZKO A;  1IYU A;  1JIC A;  1GUN A;  1CT1 D;  5C5M A;  3RUZ A;  1JR0 D;  4XYO A;  3C46 A;  1XTC D;  5M5W B;  4RKL A;  2F0G A;  3VA5 A;  4DFA A;  2XWB B;  5IOD A;  3BZD B;  3PUZ A;  1D5X C;  1EZ8 A;  4H0L C;  4ZQ3 A;  3PMF A;  4FF3 A;  4C1N K;  3U9O A;  4CGY B;  3E6Z X;  1BF4 A;  3T16 A;  1O7L A;  1QE6 A;  2EY5 A;  2L9H A;  3DMU A;  1KDC A;  3NBI A;  3OHX C;  3IFT A;  2R7Z B;  2FMC A;  1EY4 A;  3PO3 B;  2R3Z A;  1OO9 B;  4CKE A;  1SBB B;  1LTT D;  4F7X A;  3D4R A;  5CV9 A;  3A8I E;  1IKM A;  2L4N A;  2WAC A;  3DUZ A;  1DOK A;  4QUF A;  2JA6 B;  1ONL A;  1SAP A;  3KK7 A;  3IFD A;  1H9M A;  4JK1 C;  1O7Y A;  2KED A;  5BN3 A;  5K36 G;  4G7O C;  2A69 D;  2NB0 A;  4CHT B;  3S15 B;  1I6V C;  2NVX B;  4H7B A;  5EKK A;  3VYU A;  3VA7 A;  5FO8 B;  2EJG C;  1PFM A;  4U67 3;  1AEX A;  3K6O A;  2M00 A;  4PMC A;  1A15 A;  1STA A;  4K5W A;  4XQQ A;  3EA6 A;  1UEA B;  1T5X D;  1C48 A;  1UAP A;  4BY7 B;  3R8B A;  4C3H G;  2F0J A;  2BDO A;  3MXN A;  3GP7 A;  3M4O B;  2PQE A;  3KLS X;  1EYD A;  3KF8 A;  1RDP D;  2JP1 A;  4KKU A;  1EY9 A;  1FGB D;  4QIW B;  3HS0 C;  1KDA A;  1L0X B;  2C5C A;  1VMP A;  2NYZ D;  1EIH A;  5CV5 A;  2QDB A;  3EVQ A;  4IUT A;  1DD2 A;  1ML0 D;  4QMG A;  1GUG A;  3I91 A;  1HHV A;  4ID6 A;  5AFW A;  2F0P A;  1BBX C;  2L11 A;  5EGT A;  2MGS A;  5T1G A;  4EGV A;  1LTS D;  3SXH A;  2B2U C;  2N55 A;  1VMC A;  1I4G A;  5ISR A;  2WB1 B;  1LLR D;  3MXP A;  1LTA D;  4HN7 A;  3I72 A;  3W3A A;  2KUM A;  5ELC A;  1K8M A;  2E76 C;  2EYL A;  5KYI A;  5FKA C;  1TWA B;  3OMC A;  1WTR A;  4Z9C B;  4BWG B;  2NZ1 D;  2F3W A;  1IYV A;  5JPM C;  2AQ2 B;  3J7Y W;  1D6E C;  1TII D;  3SVM A;  1EZ6 A;  1QIL A;  4N9T A;  4WOR A;  5IGF A;  3BS1 A;  1U4R A;  5JOB A;  2J7Z A;  4X3K A;  1ZYR C;  2F0S A;  2KOL A;  5C0X I;  2X6G A;  3VYS A;  1JB3 A;  2F1M A;  3DEP A;  1F2Y A;  3HEJ A;  3K59 A;  4KV6 A;  1BUV T;  3Q23 A;  4CKB A;  3CRK C;  2NWG A;  2VXW A;  2A5H A;  2JEB I;  2K5D A;  4B9X A;  1EYC A;  1Q1E A;  2HCI A;  1FNV A;  4CKC A;  3VR4 A;  1JOO A;  4HR7 B;  2TSS A;  3S16 B;  3K7A B;  2Z8L A;  2KCN A;  1DOL A;  4OGQ C;  1BCP C;  5J1Z A;  1RTO A;  2HDM A;  1ILQ A;  4DGZ A;  3JAM L;  5FLX E;  3Q22 A;  1EEI D;  2HUG A;  1E2V A;  3GV3 A;  4OO1 G;  1V8Q A;  5G3L D;  3E0J A;  1FR3 A;  2HQE A;  1D1I A;  4RGM A;  3D4D A;  4HMI A;  1JC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...