1F9RA

Crystal structure of platelet factor 4 mutant 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
b'GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9rA00
4LMQD 3GV3A 3D6WA 1G2TA 4CJ1B 4MHEA 2JP1A 4ZLTF 1TVXA 4U68A 1X3QA 1BO0A 4QUFA 1WTOA 5CBEE 1EIHA 1HRJA 1NR2A 2DY8A 1G91A 1HHVA 5JJZA 1F9PA 2B2WA 1KNEA 2NZ1D 3I91A 2B2TA 1DONA 5E4XA 1SAPA 1O7ZA 2X6LA 4O42A 2XIWA 2N55A 1WTVA 1WTRA 1PDQA 1U4LA 3N52A 4HSVA 1VMCA 3QO2A 4X3SA 4HAEA 1WTXA 2MPMA 1G6ZA 3FPUB 2X69A 1XYIA 1F9RA 4CJ2C 1MGSA 1PFMA 2X6GA 5AFWA 1ESRA 4R8IA 2RSNA 1NAPA 1DZ1A 1LV9A 2KOLA 4IUVA 1B50A 2B2YA 3H91A 3IFDA 2HCIA 5CORA 2KUMA 1WTWA 3SVMA 5EPKA 5T1IA 2L4NA 2MP1A 2B2VC 2FMMA 1EL0A 4UAIA 3I8ZA 5T1GA 4IUUA 1ILQA 1WD1A 4RA8A 1NCVA 1MSGA 3ONAB 1HFNA 1BBXC 2R3ZA 1JICA 1HFGA 4RAUC 2VXWA 1EOTA 1WTPA 4XT3B 3TN2A 1DOKA 2KECA 1QE6A 3P7JA 1MI2A 2J7ZA 2MGSA 2K01A 1PLFA 1F2LA 4RWSC 3G7LA 3KBXA 3HP3A 1RHPA 1AZPA 1EQTA 1M8AA 5E4WC 1IKMA 5EPJA 5COYA 1J9OA 2B2UC 1JE4A 2HUGA 2K28A 2NYZD 3FDTA 1WTQA 2HDLA 3GV6A 2KEDA 1B53A 4IURA 1C8CA 1ICWA 1F9QA 2FJ2A 2IL8A 1VMPA 1X32A 1SSOA 2D9UA 2L1BA 3KUPA 1AZQA 1O80A 2EOTA 5EJWA 1B2TA 4MN3A 4IUTA 2FFKB 3UI2A 1G2SA 2RSOA 4X3TA 1J8IA 5EKIA 2FINB 3LWEA 5CMDA 2HCCA 1GUWA 1IL8A 1IKLA 1DOLA 3DM1A 4XDXA 3I90A 3R93A 1CA5A 4XT1B 2BDNA 1HUMA 1U4RA 2MJ8A 4ZKBB 1ML0D 3MWYW 2RA4A 1RODA 1BNZA 1EIGA 4ZKCB 2N88A 4OIJA 1MSHA 2K1BA 1QG7A 4OIKA 1RTNA 2B2VA 4R9WA 1E0BA 2B2WC 5DNFA 4DN4M 1AP0A 1U4MA 2B2TC 2KEEA 1WVLA 2M2LA 4IUPA 1ILPA 2HDMA 4ZAIA 1QNKA 2CVRA 2L9HA 5CBAE 4X3KA 1PFBA 1RTOA 4HEDA 2K03A 4NW2A 4X3UA 1RJTA 3MTSA 3F2UA 2KVMA 2Q8TA 1DOMA 1U4PA 1SDFA 3TZDA 2L12A 2NWGA 2B2UA 1NR4A 2K05A 2B2YC 1F9SA 1B4OA 3IL8A 1WD0A 1HUNA 1PFNA 1Q3LA 2DY7A 2H1EA 5D14A 3DEPA 4CJ0B 1ZXTA 4HCSA 3Q6SA 2EPBA 4QUCA 4ZK9B 5D65A 1HA6A 5EPLA 1S4ZA 1XX8A 2K04A 3I3CA 1X3PA 2FHTA 2JYOA 2Q8RE 2RVLA 4IUQA 1CM9A 1O7YA 2EE1A 1B3AA 5EQ0A 1CA6A 1BF4A 2L11A 2SDFA 1KNAA 1A15A 3DEOA
chains in the Genus database with same CATH superfamily
2XN9C 2MO1A 3OMCA 2UU9L 3H0GG 4HCEA 1PRTD 4DAYA 4DK3C 4G4KA 4FXDA 4F7XA 1I4RA 1STHA 2EY6A 3J7A5 1I50H 4ULLA 3I4NG 5C44H 4JBJA 1Z9FA 5M5WB 1SEBD 4PMWA 3FHWA 4IPHA 3K57A 2Q2IA 2RKSA 2ZJRA 1JT8A 3KBGA 1PFMA 4ID6A 5ELDA 5LMUQ 3H91A 4HIMA 2F4IA 3PUWA 5LMUL 4DV3Q 3I8ZA 2F0LA 3EROA 4DV3L 1D1IA 2JK8A 4Q0FA 2KECA 2VW9A 2EDGA 3P7JA 4BBSG 4A3KH 5GROA 4EQOA 3H94A 3AMUA 2XTIA 3I55A 2AQ3B 4CKBA 3BZDB 1N8RC 3KF6A 2RBMA 1GUSA 2CWAA 5I9OA 4DK6C 1KRTA 5C4XH 4HIKA 1HH2P 1ZYRD 1SE3A 3HOXH 1FJGL 2WB1B 1QVFA 4GKJQ 2K5WA 4X3TA 1XNRQ 1ET6A 3T56B 4GKJL 1XNRL 1H9MA 2PMZE 2HQEA 2Q2UA 2JA6H 1D6EC 2MO0A 1PYWD 1VQMA 3TEHB 1SROA 1WFQA 1Q12A 3E9HA 4OIKA 1VQNA 4DR4Q 1AP0A 4FYDA 2NVXH 2CH4A 4DR4L 4BY1B 2K33A 3F2BA 4BS9A 1QWYA 1BBWA 3LWUA 2QEJC 5LL6S 2Q8TA 1K73C 2EXZA 2K05A 1B70B 2F3VA 4IFDH 1NTGA 4XQNA 1KDBA 1Q7YC 1PFNA 1Q3LA 1KDCA 1HJPA 4RFBA 2EPBA 5IYDG 2WKDA 2R92G 2IX0A 2VUMB 2PNRC 3RR5A 1F2MA 2KCMA 3NXWA 2K5QA 1SYFA 1IBMQ 1I50B 4ZRZA 3L0OA 1IBML 3MEHA 2AWNA 1KD1C 3STBD 1EWCA 4QUFA 2ZXPA 3EFXD 2DY8A 1G91A 4NKLA 2Y0SE 4RMFA 1E1TA 1B8AA 1LACA 2J4XA 1Z47A 1BVSA 4X3SA 1C7YA 3QO2A 3CCLA 2RHQB 2EJMA 4XQJA 5DAUA 1SBBB 2VNUD 2UUAQ 3PO2H 1S5CD 3V96A 3NENA 4M1UB 3K59A 1WTWA 2CFMA 2UXCQ 1LT4D 4C1NI 2UXCL 1I5FA 1L1OB 1GOZA 1YBYA 3D6CA 4C3JB 2ZJQA 3NWTA 1NCVA 1L1OA 2YTXA 2F0TA 3BYTB 2B39A 1ESFA 2AHOB 3D4RA 3A54A 2MNAA 3SR1A 2EYHA 1YNNC 5IOCA 2WAQG 4O2DA 3CCJA 3G7LA 1VQ6A 1STEA 4Y7NB 5C4XB 3L3OC 1HZAA 3GTOH 2QA4A 3HOXB 3K7AH 1Y8NB 1EWIA 3M4OH 1CK1A 2JA6B 1K83H 3HOUH 1J8IA 2F0HA 4GKKQ 5IP9H 1GUWA 4GKKL 1NUCA 2AKWB 3IAYA 4DF7A 3S17B 1UNSA 4A3IB 1HZ9A 1NSNS 2D0PA 2K5VA 3KLRA 5D3IB 4N8X1 1Y69U 1BKBA 2E76C 2F52A 2F0UA 1CQFA 2E2DC 3H3VH 4X3KA 3I4MG 3TBIB 4QIWE 1LYLA 5C3WA 2PZTA 4OHJA 5C0XH 1S3OA 2PZWA 3AFQA 3H0GH 2WACA 3M7GA 2KJXA 3TREA 4I7ZC 2NWGA 4QL5A 3MFYA 1B1ZA 4BY7G 5CR3A 1L0YB 2UUCQ 4A3FG 1EEFD 5D65A 3I4NH 2K5DA 1Y1VG 4P71A 3BS1A 3I3CA 4CDFC 5KNDA 3HOWB 2UUCL 3U4ZA 1TS4A 3OSOA 1TR5A 5M3MG 1AEXA 1SRUA 2J0TD 3TP6A 1XPOA 5CV9A 3DEOA 4QMGA 1OXVA 3DM3A 2EYJA 4CJ1B 4X65Q 5JPNC 1Y14B 1SYDA 2YTVA 4X65L 1GXDC 4HN7A 2QDBA 3KLWA 1HHVA 4L5QA 5DEHA 3VA7A 1TWGB 3WWVA 1SAPA 2FMCA 1STBA 4AYBG 1LTSD 3GTLB 4BBSH 2JE6I 1A3TA 4R8IA 3LX0A 2CW0C 3S2DH 1DZ1A 2R61A 2KOLA 2VQFQ 5ELCA 2EYMA 1Y8OB 2VQFL 1JMCA 2K4KA 1KC8C 5KYIA 5C3XA 4FF4A 3ER0A 1G51A 3TSSA 3AYHB 4XYQA 3A5UA 4A3GB 3OOCA 1V1PB 2EYOA 4FF2A 2WFWA 3VYUA 1BUVT 1KLGD 1V1PA 1WI5A 3DWPA 4LAAA 2RQXA 4AQYQ 4A3DH 3M4OB 3MZ5A 1SFOB 2HDLA 4IURA 4AQYL 3W1BA 3HOUB 1A6XA 1ICWA 3HOYH 4JVZA 2I5MX 4A3MG 2K32A 5BN3A 2OTJA 1G2SA 1W3SA 2QW7A 3LWEA 1IW7C 3C46A 1IKLA 4P72A 2F0NA 4ZKBB 4R4IA 2GVAA 1H95A 4DXGA 1SN8A 2PI2A 4R9WA 2BH2A 5IYDH 2R92H 5KEEA 1E2ZA 2KEEA 4KK7A 2M2LA 4TRDA 3PUVA 5CBAE 4CDDC 1CSPA 1VQPA 3NTIA 3G71A 1G8ZD 1E2WA 4F88A 1KHIA 1STAA 1JB3A 1Q8KA 3SE0A 4NB3A 1B7YB 1E24A 3CRKC 3JAME 3C2PA 3EBEA 3NTKA 4HMIA 3T13A 2WAQE 5IGDA 1GM5A 3A56A 3KF8B 3P1HA 4JV5Q 3NE5B 4OGQC 1PH8A 3A5ZB 4JV5L 3SXHA 1G2TA 1KXLA 2ZXRA 1BO0A 4R8NA 4B9XA 4TKOB 3BVMA 4DR7Q 2Z4IA 4YWMA 3K6OA 3HOVB 2K5NA 1DONA 1XJVA 4DR7L 4R4OA 3I7FA 4Z9CB 2LFNA 4NMZA 3VR6A 3BYYB 4XTCS 1VQ8A 4A3JB 3HKZE 5C5MA 1SXTA 5CV6A 3E5SA 1EZ6A 1HNWQ 4POFA 4DK1A 1A8VA 1HNWL 5T1GA 1EU3A 1MSGA 4BBRG 5L37A 3CC4A 1WTPA 2NUCA 2A68C 1GUGA 2V4DA 4A3DB 3A8IE 2J7ZA 3E0JA 4H7BA 4QY7A 3AB9A 1QZGA 3C3LA 3CCQA 3HOYB 2KCCA 5E4WC 5EPJA 1D8LA 3J80L 3GTJH 1YIJA 1JWUD 4KY5A 3S1MH 2WP8J 5HURA 3UI2A 3S14H 3I4MH 2F0PA 1R4PB 1QCBD 3I90A 2A74C 1LT3D 2MJ8A 2LMCB 1RODA 4AYBE 5LMNQ 4BY7H 1EIGA 5FLXL 2I0QA 3CC7A 5LMNL 1SLJA 4YHHQ 4I7AA 4A3FH 3FPPA 2SOBA 2PW7A 1VQ5A 1UWVA 3SK5A 4YHHL 2CVRA 4JI0Q 1BBUA 5M3MH 1L0XB 3G48A 3FKIG 4WORA 1I4XA 1UE6A 4JI0L 4IFDJ 5FJ8G 1FVIA 3PQIA 3J80c 1GVPA 1ASYA 1MIUA 1VQBA 4DV1Q 2WV6D 2ZJPA 5FLMG 4DV1L 1CKNB 4JW0A 4R4QA 3VR4A 1CKNA 1HA6A 3HOZG 2RVLA 2EY2A 1JR0D 2L11A 2M00A 1D7QA 4GLVB 1KAAA 1NBWA 4H44C 4ZUIA 4JG2A 3FEWX 5IGFA 1WTOA 1NR2A 1BQQT 2G9HD 3CCEA 1E7ZA 4BA1I 1VQAA 3EJIA 4KKTA 3ERSX 5E4XA 1O7ZA 4K8IA 1PDQA 1U4LA 2OWOA 3CU7A 1I3QH 2E75C 2MPMA 4YWLA 1SMXA 5C3EH 3M4QA 2K6AA 2X69A 3FPUB 3K5MA 4LUVA 3S15B 5FO8B 3TMEA 1CUKA 1AN8A 4IUVA 4JYAQ 1B50A 5C4JH 2DNCA 4ME5A 1Y1WG 4JYAL 4LUOA 4JI6Q 3K58A 1P16A 5IYBG 3X3NA 3J7ZC 1LUZA 4J8QA 3PSIA 4JI6L 4KHZA 2PO4A 3KJPA 3G4SA 5M5YB 3TS0A 3NTHA 1MI2A 1OXSC 3GTJB 1SYGA 1SJED 4DPGA 1SNCA 2YTYA 4GNXC 2F4VQ 3S1NB 5COYA 1WTQA 2B2UC 2HUGA 2F4VL 3S1MB 5IT9c 4CHTB 1CTMA 1TWAB 5EJWA 2D5DA 5EKIA 1FGBD 1V9PA 1S5ED 3VR2A 5IGCA 3DM1A 1DOLA 4DV0Q 3SK8A 2BDNA 3L9AX 5KNBA 4DV0L 4TSSA 1V8QA 2B8GA 3J7AF 2LXJA 5GQOA 3PIOA 1C4QA 3A8KE 2JA8B 4Y52H 1PFSA 2F0QA 1PTOD 4A3EH 4MIUA 3SEBA 5A2QL 1DOMA 2E2HB 2WB1E 2E2IH 1K3BC 2Y0SG 4P2CB 5ELEA 2PQEA 5I2YA 2PQAA 4CJ0B 3U58A 2HHHQ 1QNUA 2YV5A 2A6HD 1JOKA 2HHHL 2Z6KA 2EE1A 3ULLA 3CPWA 2O5IC 2PPBC 4LJZC 2IWHA 4JI3Q 4NDXA 1W6JA 1TWFH 4JI3L 3KFUA 2ID0A 4GNXB 5CBEE 1I3QB 1I4HA 5C3EB 2NVYB 1XPUA 2B29A 3I91A 3RD4A 1I4QA 4V0BA 4BBRH 2A69D 5JJIA 1J6QA 2IW3A 4EQNA 3QOJA 4KTAA 2AWOA 3KYHC 2JA7G 1ESRA 1QZHA 4PMBA 2MFIA 1STYA 3VA5A 1VQ7A 1YJ9A 3BDCA 1H9JA 1FL0A 1RDPD 3S1RB 3J7YW 4RHRA 1TY2A 4H02A 4L5SA 3CRLC 4UP9A 3BDLA 1KQSA 2K52A 3QIAA 1XWEA 2N3SA 1STNA 2CKZB 3ERQA 4HIDA 1PLFA 2ZTEA 5ELFA 4HJ9A 4RWSC 3WOFA 2KQ3A 1Q82C 4PG3A 1E3PA 2MHVA 3GV6A 4DU9A 2ALYB 1N33Q 2RDGA 4IOAA 1DXMA 1PH9A 2F0OA 4A3CG 2NN6I 3J81L 1TWHH 1N33L 4O0AA 2DNEA 2R93G 2Z6BA 4MN3A 1C9OA 4X66Q 3DWQA 3FKIH 2RSOA 1PH4A 4B3RQ 1D2BA 1DJRD 4X66L 1PZID 4B3RL 2HD3A 4B3MQ 5KNCA 1FNWA 1HUMA 4IJHA 4F87A 1Y8PB 5FLMH 2CQOA 4B3ML 1NMGA 4LF5Q 2BE5C 1VQDA 4UPAA 4A3EB 4LF5L 3KF6B 1ICFB 3HOZH 1LABA 4CBVA 3DLLA 5FK9C 1QNKA 4K0KQ 4JCVE 2E2IB 1YHAA 3S2HH 2BH8A 1PZJD 4K0KL 1O7LA 5LMNW 1OXXK 1EY7A 1FJGQ 1H9SB 2H4OA 2R7ZG 3P75A 3J81c 5NUCA 2ZXOA 1H9SA 5M3FH 4K6DA 4WRDA 1X55A 1WD0A 4A4IA 1PTOH 4KHPQ 3CKIB 1LTID 4A76A 3RZDB 4KHPL 1L1OC 3P20A 2JA5H 4QF4A 2WKCA 2SDFA 5JOBA 2DN8A 1WCMH 5C4ZA 4RG1A 4MNOA 2NVTH 4WJ4A 2JA9A 2B63G 4K8JA 3PGZA 1Y1WH 5JJZA 5FO7B 3KLSX 4G57A 2D0OA 4IN3A 5IYBH 2Q2TA 3PUZA 4BXXG 2F0JA 1WTHA 2O5JC 1TS3A 1VMCA 1XMOQ 3UDIA 1HA5A 1XMOL 1OTCA 1QOHA 2B2YA 4YCWA 2WIIB 3SVMA 1JJGA 1XNQQ 1X3EA 3DHQA 5C44B 3OIPA 1XNQL 1U5KA 3ONAB 2A6HC 5BR8Q 1I4PA 1Q86C 4XT3B 1W2BA 5IODA 5ELBA 3FRPB 5BR8L 1EQRA 3PO3G 3MFGA 1CT1D 1M8AA 1DCZA 3K0YA 1OXUA 1I94Q 4V190 2Q8IB 1GD7A 2K28A 1B53A 4LUZA 1I94L 1SE2A 5KIXA 4Q5VA 2FJ2A 2KENA 2L55A 1NMFA 1G291 3K5NA 1S5BD 5LL6X 3T1YQ 5CGKA 3GP7A 4A3KB 4HJAA 3RNUA 2AUKA 3J81j 1PMRA 3T1YL 3R93A 4YCVA 3PMFA 4A3BH 3M4PA 1QJOA 1U4RA 2YU9H 4JI5Q 1HR0Q 4JI5L 4B3SQ 1JJ2A 1RTNA 1HR0L 1PRTC 4LF4Q 3L7ZC 4B3SL 1H9KA 2RF4A 3GTQH 1K3RA 4LF4L 2JXMB 5M3FB 1JCKB 4GLXA 4ILWA 1PTOB 3OIQA 2A73B 2VB3X 2DGYA 1FNVA 1NR4A 1W6KA 2JA5B 2KBNA 2H1EA 4C3IG 5GADC 5FO9B 1CSQA 2NVXB 1R9TH 3E0EA 1CZGA 1XX8A 1WCMB 3BZCA 3Q24A 4JI8Q 4RCOA 1DM0B 3NWSA 3R2IA 2HQLA 3BVZA 2AUJD 3GTPH 1CA6A 3HKZG 4JI8L 4LWCA 2XWBB 1TT2A 4JOIC 2JA7H 3TP7A 5EKKA 1C48A 1TVXA 2NVQH 4DV6Q 2XGTA 4C3HG 1CI3M 2LSSA 2O2LD 4DV6L 1F9PA 1LTAD 2PMZB 3CCVA 2QILA 5CV7A 2B2TA 1SE8A 3N6RA 4GLAC 4O42A 5JPMC 4DKAC 3A7AB 4M8AA 3NELA 5JEAG 3D4DA 1XTDA 2HIVA 4J1MA 1ZYRC 4JBWA 2ASBA 2SEBD 1YEZA 3VR5A 1VQ9A 4LFBQ 2JEAI 3QB3A 1YJWA 4LFBL 3U50C 1UEBA 4A3CH 1EL0A 1ILQA 4RA8A 1PRTB 3H3VC 3J7AV 1QVGA 2R93H 1TKWB 4PZ6A 3ULPA 4B9WA 1EEID 4MTNA 1A2TA 4DXFA 4KJNA 4A93G 2BA1A 2V1CC 2K5HA 4PZ8A 4RGTA 3MC0B 3PO2B 1I6HH 2JJQA 1IKMA 1UE1A 1CQVA 3PV0A 2NYZD 3W1GA 2Z1CA 1EY8A 5K5PA 3C1FA 4BA2I 2F3IA 2L1BA 1FYCA 4K14A 3PIP3 1QILA 4A3BB 2I46A 3BG3A 2YU9B 4B3TQ 2ZTCA 1EY6A 2A1AA 3D0FA 4B3TL 3A0JA 5BN5A 1LT6D 5HGTA 3GTOB 2QKIC 4WJ3M 3GTQB 1SR3A 4JOIA 3H09A 4K2KA 1MSHA 3K7AB 2B2VA 3CCRA 3QJYA 3FVQA 3STBC 2IX3A 4ZAIA 1K83B 4A3LG 3CQZH 2EQSA 4RGNA 5C5LA 4A75A 4UY8C 1RTOA 2CH4W 1L0WA 1IYJB 1RJTA 1XXGA 2EVBA 2ICIA 4CDCC 2B63H 5A35A 1LTTD 1X3FA 3KJOA 2F0VA 5ISRA 4HJ5A 3NBHA 2IHFA 4QUCA 3KK7A 5EPLA 1U9RA 2DJFC 1ASZA 4OONA 1SNDA 1O7YA 2ZM6Q 2NVQB 4OX9Q 4QCLA 1TWCH 2ZM6L 3HOWG 3J80E 3IRBA 4LMQD 3H0GB 2HT1A 4OX9L 4MHEA 5M9OA 1SNPA 5JVH3 3U9SA 1PTOF 1CHQD 3I4NB 1O7IA 2NZ1D 4LF8Q 4LF8L 4HSVA 3HG9A 1TS5A 2NBFA 1MGSA 3MXUA 3F1ZA 5FLXE 1MKHA 4DR6Q 2RSNA 3PO3H 1G6PA 4QIWB 2HCIA 4FP5D 2KUMA 5G3LF 3TZUA 4DR6L 4G7OC 1VQGA 4DNIA 3SHLA 1KLUD 3ND9A 2L4NA 4O1NA 5CV8A 4UAIA 1WD1A 3W2DA 4R4TA 5ELNA 4X64Q 4KMUC 1I6HB 3R8BA 1UE7A 4BBSB 4X64L 2KHJA 1GKHA 1D1KA 3S2DB 1EOVA 3M3YH 3UDFA 3RLOA 2DUDA 2F3WA 4YY3Q 1HTPA 3EQLC 1RD9D 4YY3L 3KUPA 1E1OA 1YNJD 3V2TA 1K8AC 2Z4HA 4L6TB 3D3RA 2WB1G 4EX5A 5CMDA 2HCCA 1BDOA 2F0DA 4EVOA 3GTKH 1PRTF 4XDXA 5IP7G 2RCFA 4OWWB 4HTHA 2CWPA 4J15A 4FNFA 2ENBA 4PV1C 4ZQ3A 2EZVA 2RDHA 1JOQA 3RUZA 3DUZA 1JC7A 4BY1G 2K03A 2RDFA 4X3UA 1EY5A 1HR0W 3B6YA 4DV5Q 2P5ZX 4H13C 2CCZA 1VS0A 1U4PA 1JE5A 4DV5L 5CV5A 3Q8DA 1KIXA 4C3HH 1BCPD 4GOPA 2R92B 1DGSA 1H9RA 3CMAA 3HFZB 2VUMG 1GHKA 4K5WA 2LXKA 4XIGS 1YITA 4IZ8A 5K36G 1Y1VH 5JEAH 2EJGC 3GV3A 4ZCKA 4GS3A 4EQ5A 5I2XA 5ELOA 3TP5A 3K5OA 1S5DD 3G6JB 4HJ8A 1FGUA 5JJLA 1RIPA 2B2WA 3UDXA 1IYUA 4DA2A 4NXMQ 5IE8A 1YVCA 3I56A 3HKSA 2PYKA 3NK9A 4J6HA 4NXML 1WTXA 3T1HQ 1X6OA 4A93H 1PA6A 2KHSA 3T1HL 2NZOA 1LV9A 1HCZA 2C35B 1I6VC 1K9MC 4F8MA 2IT1A 2NTTA 4PNYA 2NB0A 1XMQQ 4KJOA 4C3JG 4E6IA 1XMQL 1BBXC 2ATWA 2R3ZA 3M3YB 4EQPA 5A2QE 3TN2A 3I72A 3OYYA 1Z7TA 2WAQB 1UE5A 4IPDA 5E3FA 1JWMD 4DAMA 5IT9L 3JAMc 3HEJA 3OW2A 5C4XG 5FKAC 3AEVA 5CYUA 4XYOA 2KEDA 4KN7C 1S72A 3I2ZA 2BOSA 3HOXG 1YZ6A 1TY0A 1A0IA 2PW5A 3J80i 2Z6KC 2JA6G 2OCEA 4A3MH 5I6YA 3VYRA 2B3GA 1Q8IA 1BXTA 2AMCB 1HQRD 3MWYW 2RA4A 4A3IG 2BCOA 1HNXQ 2NN6G 2CQAA 3S9WA 5I9PA 2RCNA 2K1BA 1HNXL 4NXNQ 1E0BA 4IUNA 4NXNL 1ILPA 3T51B 4PZ7A 3S14B 3U9OA 3I4MB 1K8MA 2SNMA 3NHHA 3MTSA 3HOWH 1LT5D 1WJJA 2BDOA 2L15A 1ENAA 2L12A 4BY7B 3S24A 1F9SA 4C1NK 4CKCA 4A3FB 1ZXTA 3NSWA 1Y1VB 3NQTA 1U0LA 2DJGC 4K6LA 4IUQA 5M3MB 1CM9A 4HR7B 4RGMA 5M5WH 1B9MA 2XWJB 5JJKA 4IOCA 3KOJA 3OHXC 4YIJA 3BJUA 3J81E 1GUNA 5IWAQ 3GD7A 4LF9Q 5IWAL 3ITPA 2RHSB 2PQAB 4LF9L 3K7UC 2Z0SA 1MHWC 5KGUA 2X6LA 4G7HC 2N55A 4AYBB 1II3A 4QB4A 2EYPA 3AU7A 1OO9B 5I4DA 5D3DA 4YWKA 3EA6A 3WOEA 4OWTB 2VL6A 1FNUA 2F0WA 3AQQA 5CC4A 3GTMH 5IGBA 5T1IA 3CCMA 1BCPC 2ES2A 4R1JA 4JK1C 4GZYC 4A3GG 1Q1BA 2A8VA 4YCUA 3KBXA 5IGEA 4ODGA 5IP7H 1NNXA 1UUPA 5C4JB 1T5XD 1LTLA 1MJCA 1QUQA 4ZUJA 2C9OA 1FD7D 2XNAC 3HOUG 3TRZA 3E9IA 4DV2Q 2IL8A 1VMPA 4L5TA 4A3MB 4DV2L 3A8JE 1B2TA 3Q0AA 1ONLA 3OWFA 1VQ4A 1CZWA 2JN4A 3MAQA 2VZAA 1HNZQ 2F03A 1SYCA 3HRZC 1HNZL 1VQEA 4IPCA 3SK6A 1Q1EA 1VQJA 1A3VA 2QDLA 4QJFA 3OMGA 1VQHA 1YNND 1Q81C 5C0XG 2ZT9C 3CC2A 4KN4C 1X65A 3QG1A 5KYLA 5BN4A 1ENFA 1KRSA 1VQOA 4NW2A 4L63B 5K36H 3TQYA 3ICEA 1K8GA 2KVMA 5I6WA 1SDFA 2CHBD 3TZDA 1S40A 1ENCA 2OT2A 2B2YC 3VDYA 5FJ8H 1HUNA 4IFDI 1X54A 2EYLA 1S4ZA 3NP8A 1BCPB 1Q46A 3F2DA 2JYOA 1D5ZC 3K80C 4XQQA 3MXGA 4DAPA 3SDZA 1KNAA 4UP7A 1PH1A 2A5HA 2PCFB 1M4VA 3KLSA 1X3QA 4MZ9A 1AE3A 1EIYB 3JC66 1L2FA 1VF5C 4KY7A 3OW7A 2I5HA 4IPGA 1YI2A 1KNEA 3HOVG 3AFPA 3I70A 4C3JH 1WTVA 2VS1A 5HGQA 1HPCA 4DUZQ 4WFN3 3ZYYX 1DD2A 3GTMB 4CJ2C 5AFWA 4DUZL 2X6GA 1TWFB 3NEMA 4U673 4A3JG 3BZKA 2ICEC 3RLNA 4NPSA 2F0FA 4Y7NH 3IFDA 3C1EA 5EPKA 4FF3A 5J22A 4OEMB 3I73A 1JWSD 2FMMA 4BBRB 3UE0A 3RMHA 2E8GA 2OF1A 4LK1C 2OTLA 4TVAB 1N36Q 4A3DG 5IY0A 3TS2A 1P8LA 1N36L 1X3GA 1HZCA 1MD2D 4DR3Q 3HOYG 1PTOC 3QWNA 2LS01 3S17H 2E2JH 4A3IH 2NN6H 4DR3L 1GUOA 1ZKOA 3H6MA 1SSOA 2CW0D 4P75A 2L5TA 1D5XC 4FXKC 1GUTA 1TQOA 3J81i 4DAVA 1PZKD 4RKLA 4HMJA 1SE4A 4QQBX 1S5FD 3M4YA 1TS2A 1CFMA 3T53B 1FR3A 1TWHB 2F0GA 3NPPA 1SMYD 2B2TC 1X56A 1WVLA 1NY4A 4LNQA 4DV4Q 1VQIA 1YHBA 3FKIB 2NTSA 1Z6HA 4DV4L 3H3VI 2M9VA 3UDGA 2A69C 5C0XI 1B3QA 1PHJA 1VQKA 3HOZB 5JEAJ 3WDNA 1A3UA 1TWGH 1IW7D 5DM63 5EQ0A 3S2HB 4GN5A 1LLRD 1VQCA 3EIVA 2OQ0A 4JC0A 3GTLH 2UUAL 1VQFA 3Q23A 4KV6A 3D4WA 2MQHA 3CHBD 4RHSA 3E3XA 1RL2A 4KKSA 4KI0A 1VF7A 4P74A 2I5LX 4AIMA 1WTRA 3I4OA 3ZJYC 5GAEC 4DUYQ 1PH6A 4APVA 1HZBA 2XSCA 4HAEA 3MXPA 3KDFB 4CGYB 1G6ZA 4A3GH 2PI2E 4DUYL 1LTGD 1XYIA 1F9RA 2R6GA 3PCOB 3CPFA 4RH6A 5E1FA 1BCPF 3KDFA 5IIFA 3LNNA 2NVTB 1MJEA 4IALA 1NAPA 1Y1WB 3X3MA 1SFOH 1F2ZA 2UXBQ 2B2VC 4ABNA 4ALPA 2K7VA 2UXBL 5EBCA 3I4LA 2D62A 1HXYD 1DOKA 2OXPA 3W3AA 4KHVA 3G6EA 2E2JB 5HY6A 3Q22A 3FMCA 4DGZA 1F2LA 1PXUA 3S16H 3HP3A 2AQ1B 1AZPA 1EQTA 2JQOA 1JE4A 5GAHC 2EYFA 1C8CA 1EUJA 1KL9A 1BOSA 1TXYA 3EVQA 4JBMA 4UP8A 2IJ0A 4K2LA 3O13A 2IHEA 3W5OA 4DR5Q 2FINB 4IQZA 2Z9HA 4P73A 1SNOA 4LF7Q 4DR5L 1GJXA 3NQIA 2E5LQ 4LF7L 4XT1B 4POGA 4BWGB 4KY6A 2E5LL 3MA2B 2IX1A 1CKOA 5EKLA 1TU2B 2A68D 3TDQA 3QR8A 1ET9A 3LGJA 2ZTDA 1WOCA 4KD3A 2JA8G 1CHPD 1PFBA 1EQQA 3OTOQ 1LO5D 3IFTA 3VYSA 3OTOL 2Y0SB 2G5DA 1XTCD 2KHIA 3PUYA 5C4HA 4CKEA 4DNTB 1LM0A 1SJHD 1BR9A 1QB5D 1ZEQX 5D14A 2R7ZH 2UUBQ 4HCSA 5EBDA 2K04A 1JORA 2A19A 2UUBL 2EY5A 3HOVH 4IO9A 2F0IA 1K0RA 2KCTA 1J5EQ 3M85A 1A15A 1J5EL 1EY9A 2C5CA 2VB2X 4HIOA 4A3JH 2JP1A 4DR2Q 1EY0A 4RKBA 4S3SA 4AH6A 1HRJA 4DR2L 5TSSA 1GO3E 2HIXA 4JPBW 3H15A 3SGIA 1R9TB 2Z8LA 5C3EG 4UHVA 3NBHB 2R7DA 1SMYC 3GTPB 3CF5A 3N52A 4JI4Q 1RKNA 3MHBA 1EWHA 4JI4L 2JA7B 1KTKA 2EJFC 4BXXH 1E2VA 3L2PA 1C0AA 3A7LA 3PIPA 1JB7A 3RN2A 5M5XH 2OEOA 2IY5B 4OXPA 2OQKA 4RGOS 1XPRA 4IUUA 5JAVA 3S16B 4RAUC 1JQYD 1EOTA 5LHY1 3NBIA 2IPKD 1QE6A 2QCPX 5E7NA 4IJLA 1K28A 2H5XA 5F2DA 1DYQA 1RHPA 3CP0A 3CMEA 3RLFA 1J9OA 3GDEA 3E6ZX 3FDTA 3T4AC 1PH3A 3NUCA 4HSPA 2LY7A 4GOPC 3K5LA 3M7NA 1NJIC 4L8JA 4C56C 2R93B 2NZHA 1O80A 2VY3A 4IUTA 4NP5A 3SK4A 4R4CA 3K8AA 4H0LC 3QOLA 3URYA 1VCIA 2KA7A 2N88A 2N78A 3ND8A 5H1SE 4DN4M 2B2WC 3KF8A 4X62Q 4A3EG 4JBKA 4UDUC 2BA0A 3PF4A 1A63A 1B9NA 4OL7A 1IHZA 4X62L 5JVG3 5AJ3Q 2FXQA 4LF6Q 3HZXA 4HEDA 2TMPA 2F0EA 5AJ3L 1CKMA 3CCSA 2A6ED 4LF6L 2R7ZB 1OXTA 2EIFA 3DMUA 3UE1A 2EY1A 4DV7Q 2XVSA 4FF1A 2MUYA 1IBKQ 3A55A 2D2CC 2GVBA 4RCNA 4DV7L 4ZK9B 3PUXA 1IBKL 4WJWA 3GTGH 5EGTA 1JOOA 1X3PA 2FHTA 2Q8RE 3CQZB 2O4XA 5IT9E 4C3IH 2K14A 4LW1A 4OO1G 3D8GA 3GO5A 5CV4A 1EYGA 4FVMA 1V1QA 4OWXB 3S15H 4C2MH 2B63B 4ZLTF 4U68A 3F2CA 1WYDA 1EYCA 2UXDQ 3DWAA 5IYCG 3CCUA 1PYBA 4G7ZC 3S1QH 2UXDL 4GOPB 2B8FA 2XIWA 2R7FA 2LKVA 2KCNA 5M5XB 5M5YH 1EZ8A 2JEBI 1TWCB 3RN5A 3BDOA 3BU2A 4DR1Q 4DR1L 5CORA 3S1NH 3OWEB 1EQVA 1O78A 4MTKA 3K0XA 2MP1A 5C44G 4KKUA 3GQBA 1HFNA 4DK0A 3JAML 1HFGA 1PVOA 1TWAH 1STGA 3OPOA 3V05A 1TIID 1LTRD 3PO3B 5FOBB 1UAPA 1PYSB 2K75A 2GA4B 1IYVA 4PQXA 4KD4A 4KLKA 1F9QA 2EXDA 1EU4A 4X6AH 1PH7A 1EYAA 1KDAA 1AZQA 1MBYA 2XRQD 4ME3A 3HGBA 1EY4A 1IZ6A 4DFAA 1KAWA 2FFKB 1N34Q 2I07B 1PV4A 2JA8H 4A3KG 4L5RC 4HJ7A 4N9TA 2AQ2B 5J3BA 1N34L 1IL8A 4GN3B 1EFWA 1N9WA 5EAYA 5J39A 2E2HH 1ML0D 1BNZA 4JI2Q 5GAGC 4ZKCB 2WINB 2F0KA 4JI2L 5DNFA 5J1ZA 5IGGA 1F2YA 1IXRA 2HDMA 3R2TA 5C6AA 3RZOH 5FLXc 1HTLD 1EYDA 5M3FG 1PH5A 3CAMA 4PMCA 2QGQA 3GTKB 2L0CA 3F2UA 4A3LH 1YHQA 3GTGB 1UEAB 1NE3A 4LFAQ 1B4OA 2JA5G 4C3IB 1KABA 2DY7A 4LFAL 3DEPA 3Q6SA 1V43A 1X9NA 2NVYH 1WCMG 1K0SA 4FO2A 4C2MB 1T5EA 3HKZB 3MXNB 1B3AA 3T16A 4EGVA 1VDZA 1N32Q 3MXNA 2BE5D 4GN4B 3S1QB 1SNMA 1HQMC 1N32L 3D6WA 3K81C 5DLQE 3PIO3 1QVCA 4XXEA 1I4GA 4IFDG 1EIHA 4OO1I 4C3HB 4TQUS 3ULJA 1YNXA 4JI7Q 3S1RH 4B08A 4QGUA 1AFPA 3DXJC 1SYBA 4JI7L 1YJNA 1VQLA 3VR3A 4I65A 3JAMi 3EN2A 4FDBA 2A6EC 2F1MA 1YNJC 2PZUA 2YYZA 1Q90A 5DM73 1AH9A 1E22A 1M90C 4N9PA 1PH2A 3MVVA 3A74A 1SNQA 1IBLQ 4JI1Q 3R3OA 1IBLL 1B44D 4JI1L 2PNHA 4CDEC 2TSSA 1JICA 1K8OA 2VXWA 3CXCA 2F0SA 4A93B 2MGSA 3VYTA 2K01A 4K5VA 3PO2G 1EFID 2N8NA 2QEXA 5C0XJ 4FXGC 2E74C 1A62A 5KRUA 1V1OA 1X32A 2D9UA 3IKJA 2EOTA 4A3BG 1AE2A 1LTBD 2G9DA 2F0MA 3U4VA 1CA5A 3PF5A 1F77A 1GHJA 1RF2D 2N49A 4DNRB 1R4QB 5G3LD 1M1KC 3RZOB 1SYEA 4OIJA 2SNSA 1QG7A 1QUQB 1RCVD 1IL2A 2Q2HA 1A2UA 3MEFA 1U4MA 4LFCQ 2XRSD 4K5XA 4N8FA 4IUPA 4ZYSA 4LFCL 3RZDH 2L9HA 3BVGA 3TP8A 4OO1H 5IP9G 3CW2C 1JJCB 4BY1H 4OELB 2GN5A 4GNXA 2B2UA 3IL8A 3F8TA 2JSOA 5IYCH 3M9BA 3HS0C 1T9HA 2QF7A 3CD6A 1AW7A 1D5MC 2VQEQ 2K50A 1BF4A 1EIFA 2VQEL 2UU9Q 2VUMH 3D31A 3FP9A 4DAYB
chains in the Genus database with same CATH topology
2XN9C 3OMCA 4HCEA 1PRTD 4DAYA 4G4KA 4FXDA 4F7XA 1I4RA 1STHA 2EY6A 4ULLA 5M5WB 1SEBD 4PMWA 3K57A 2RKSA 3KBGA 1PFMA 4ID6A 5ELDA 3H91A 2F4IA 3PUWA 3I8ZA 2F0LA 3EROA 1D1IA 4Q0FA 2KECA 2EDGA 3P7JA 4EQOA 3H94A 3AMUA 2AQ3B 4CKBA 3BZDB 2RBMA 1GUSA 5I9OA 1ZYRD 1SE3A 2WB1B 2K5WA 4X3TA 1ET6A 3T56B 1H9MA 2HQEA 1D6EC 1PYWD 1Q12A 4OIKA 1AP0A 4FYDA 4BY1B 2K33A 4BS9A 1QWYA 3LWUA 2QEJC 5LL6S 2Q8TA 2EXZA 2K05A 2F3VA 4IFDH 4XQNA 1KDBA 1PFNA 1Q3LA 1KDCA 4RFBA 2EPBA 2WKDA 2IX0A 2VUMB 2PNRC 1F2MA 3NXWA 2K5QA 1SYFA 1I50B 4ZRZA 3MEHA 2AWNA 1EWCA 4QUFA 2ZXPA 3EFXD 2DY8A 1G91A 4NKLA 1LACA 2J4XA 1Z47A 4X3SA 3QO2A 2EJMA 4XQJA 5DAUA 1SBBB 2VNUD 1S5CD 3V96A 4M1UB 3K59A 1WTWA 1LT4D 4C1NI 1GOZA 3D6CA 4C3JB 3NWTA 1NCVA 2F0TA 3BYTB 2B39A 1ESFA 3D4RA 3A54A 3SR1A 2EYHA 1YNNC 5IOCA 3G7LA 1STEA 4Y7NB 5C4XB 3L3OC 3HOXB 1Y8NB 1CK1A 2JA6B 1J8IA 2F0HA 1GUWA 1NUCA 3IAYA 4DF7A 3S17B 1UNSA 4A3IB 1NSNS 3KLRA 5D3IB 1Y69U 2E76C 2F0UA 1CQFA 2E2DC 4X3KA 3TBIB 5C3WA 2PZTA 4OHJA 5C0XH 2PZWA 2WACA 3M7GA 2KJXA 4I7ZC 2NWGA 3MFYA 1B1ZA 5CR3A 1L0YB 1EEFD 5D65A 2K5DA 3BS1A 3I3CA 5KNDA 3HOWB 1TS4A 3OSOA 1TR5A 1AEXA 2J0TD 3TP6A 5CV9A 3DEOA 4QMGA 1OXVA 2EYJA 4CJ1B 5JPNC 1SYDA 1GXDC 4HN7A 2QDBA 1HHVA 5DEHA 3VA7A 1TWGB 1SAPA 2FMCA 1STBA 1LTSD 3GTLB 2JE6I 1A3TA 4R8IA 3LX0A 2CW0C 1DZ1A 2R61A 2KOLA 5ELCA 2EYMA 1Y8OB 5KYIA 5C3XA 4FF4A 3TSSA 4XYQA 4A3GB 3OOCA 1V1PB 2EYOA 4FF2A 3VYUA 1BUVT 1KLGD 1V1PA 3DWPA 4LAAA 2RQXA 3M4OB 3MZ5A 1SFOB 2HDLA 4IURA 3HOUB 1A6XA 1ICWA 2K32A 5BN3A 1G2SA 3LWEA 1IW7C 3C46A 1IKLA 2F0NA 4ZKBB 4DXGA 4R9WA 5KEEA 1E2ZA 2KEEA 4KK7A 2M2LA 4TRDA 3PUVA 5CBAE 3NTIA 1G8ZD 1E2WA 4F88A 1STAA 1JB3A 3SE0A 3CRKC 3JAME 3C2PA 3NTKA 4HMIA 3T13A 5IGDA 3A56A 3P1HA 3NE5B 4OGQC 3SXHA 1G2TA 2ZXRA 1BO0A 4R8NA 4B9XA 4TKOB 3BVMA 2Z4IA 3K6OA 3HOVB 1DONA 4Z9CB 2LFNA 4NMZA 3VR6A 3BYYB 4XTCS 4A3JB 5C5MA 1SXTA 5CV6A 3E5SA 1EZ6A 4DK1A 5T1GA 1EU3A 1MSGA 1WTPA 2NUCA 2A68C 1GUGA 2V4DA 4A3DB 3A8IE 2J7ZA 3E0JA 4H7BA 3AB9A 3C3LA 3HOYB 2KCCA 5E4WC 5EPJA 3J80L 1JWUD 4KY5A 2WP8J 5HURA 3UI2A 2F0PA 1R4PB 1QCBD 3I90A 2A74C 1LT3D 2MJ8A 2LMCB 1RODA 1EIGA 5FLXL 3FPPA 2SOBA 2PW7A 3SK5A 2CVRA 1L0XB 4WORA 1I4XA 4IFDJ 2WV6D 3VR4A 1HA6A 2RVLA 2EY2A 1JR0D 2L11A 2M00A 1KAAA 4H44C 4ZUIA 3FEWX 5IGFA 1WTOA 1NR2A 1BQQT 2G9HD 4BA1I 3EJIA 4KKTA 5E4XA 1O7ZA 4K8IA 1PDQA 1U4LA 3CU7A 2E75C 2MPMA 3K5MA 2K6AA 2X69A 3FPUB 3S15B 5FO8B 3TMEA 1AN8A 4IUVA 1B50A 2DNCA 4ME5A 3K58A 3X3NA 4J8QA 4KHZA 2PO4A 5M5YB 3NTHA 1MI2A 1OXSC 3GTJB 1SYGA 1SJED 1SNCA 3S1NB 5COYA 1WTQA 2B2UC 2HUGA 3S1MB 4CHTB 1CTMA 1TWAB 5EJWA 2D5DA 5EKIA 1FGBD 1S5ED 3VR2A 5IGCA 3DM1A 1DOLA 3SK8A 2BDNA 3L9AX 5KNBA 4TSSA 1V8QA 2B8GA 3J7AF 1C4QA 3A8KE 2JA8B 2F0QA 1PTOD 4MIUA 3SEBA 5A2QL 1DOMA 2E2HB 4P2CB 5ELEA 2PQEA 5I2YA 4CJ0B 1QNUA 2A6HD 1JOKA 2EE1A 2O5IC 2PPBC 4LJZC 2IWHA 4NDXA 1W6JA 2ID0A 5CBEE 1I3QB 1I4HA 5C3EB 2NVYB 3I91A 3RD4A 1I4QA 4V0BA 2A69D 2IW3A 4EQNA 3QOJA 4KTAA 2AWOA 1ESRA 4PMBA 1STYA 3VA5A 3BDCA 1H9JA 1RDPD 3S1RB 3J7YW 4RHRA 1TY2A 3CRLC 3BDLA 3QIAA 1XWEA 3ERQA 1STNA 1PLFA 5ELFA 4RWSC 3WOFA 2KQ3A 2MHVA 3GV6A 4DU9A 2RDGA 1DXMA 2F0OA 2NN6I 3J81L 2DNEA 4MN3A 3DWQA 2RSOA 1D2BA 1DJRD 1PZID 5KNCA 1FNWA 1HUMA 4F87A 1Y8PB 2BE5C 4A3EB 1LABA 4CBVA 5FK9C 1QNKA 2E2IB 1PZJD 1O7LA 1OXXK 1EY7A 1H9SB 2H4OA 3P75A 5NUCA 2ZXOA 1H9SA 4K6DA 4WRDA 1WD0A 1PTOH 3CKIB 1LTID 3RZDB 3P20A 4QF4A 2WKCA 2SDFA 5JOBA 2DN8A 5C4ZA 4K8JA 5JJZA 5FO7B 3KLSX 4G57A 4IN3A 3PUZA 2F0JA 2O5JC 1TS3A 1VMCA 1HA5A 1QOHA 2B2YA 2WIIB 3SVMA 3DHQA 5C44B 3OIPA 3ONAB 2A6HC 1I4PA 4XT3B 5IODA 5ELBA 3FRPB 3MFGA 1CT1D 1M8AA 1DCZA 3K0YA 1OXUA 4V190 2Q8IB 2K28A 1B53A 1SE2A 5KIXA 4Q5VA 2FJ2A 2L55A 1G291 3K5NA 1S5BD 5LL6X 4A3KB 5CGKA 3GP7A 2AUKA 1PMRA 3R93A 3PMFA 1QJOA 1U4RA 1RTNA 1PRTC 3L7ZC 1H9KA 2JXMB 5M3FB 1JCKB 4ILWA 1PTOB 3OIQA 2A73B 2VB3X 1FNVA 1NR4A 1W6KA 2JA5B 2H1EA 4C3IG 5FO9B 2NVXB 1CZGA 1XX8A 1WCMB 3Q24A 4RCOA 1DM0B 3NWSA 3R2IA 3BVZA 2AUJD 1CA6A 2XWBB 1TT2A 3TP7A 5EKKA 1C48A 1TVXA 4C3HG 1CI3M 2O2LD 1F9PA 1LTAD 2PMZB 2QILA 5CV7A 2B2TA 3N6RA 4O42A 5JPMC 3A7AB 4M8AA 5JEAG 3D4DA 4J1MA 1ZYRC 4JBWA 2SEBD 3VR5A 2JEAI 3QB3A 1EL0A 1ILQA 4RA8A 1PRTB 3H3VC 3J7AV 1TKWB 4B9WA 1EEID 1A2TA 4DXFA 4KJNA 2BA1A 4RGTA 3MC0B 3PO2B 1IKMA 1CQVA 3PV0A 2NYZD 2Z1CA 1EY8A 5K5PA 3C1FA 4BA2I 2L1BA 1FYCA 4K14A 3PIP3 1QILA 4A3BB 2I46A 3BG3A 2YU9B 1EY6A 5BN5A 1LT6D 5HGTA 3GTOB 2QKIC 3GTQB 3H09A 4K2KA 1MSHA 3K7AB 2B2VA 3QJYA 3FVQA 2IX3A 4ZAIA 1K83B 5C5LA 4RGNA 1RTOA 1XXGA 1RJTA 2ICIA 2EVBA 5A35A 1LTTD 2F0VA 5ISRA 3NBHA 4QUCA 3KK7A 5EPLA 1U9RA 1SNDA 1O7YA 2NVQB 4QCLA 3J80E 4LMQD 3H0GB 4MHEA 5M9OA 1SNPA 5JVH3 3U9SA 1PTOF 1CHQD 3I4NB 2NZ1D 4HSVA 3HG9A 1TS5A 2NBFA 1MGSA 3MXUA 5FLXE 2RSNA 4QIWB 2HCIA 4FP5D 2KUMA 5G3LF 3TZUA 4G7OC 3SHLA 1KLUD 3ND9A 2L4NA 4O1NA 5CV8A 4UAIA 1WD1A 3W2DA 4KMUC 1I6HB 3R8BA 4BBSB 1D1KA 3S2DB 2F3WA 1HTPA 3EQLC 1RD9D 3KUPA 1YNJD 3V2TA 2Z4HA 4L6TB 3D3RA 5CMDA 2HCCA 1BDOA 2F0DA 4EVOA 1PRTF 4XDXA 4HTHA 4FNFA 2ENBA 4PV1C 4ZQ3A 2EZVA 2RDHA 1JOQA 3RUZA 3DUZA 1JC7A 2K03A 2RDFA 4X3UA 1EY5A 4H13C 1U4PA 5CV5A 1BCPD 2R92B 1H9RA 1GHKA 4K5WA 4XIGS 4IZ8A 5K36G 5JEAH 2EJGC 3GV3A 5I2XA 3TP5A 3K5OA 1S5DD 3G6JB 2B2WA 1IYUA 4DA2A 2PYKA 3NK9A 4J6HA 1WTXA 2KHSA 1LV9A 1HCZA 1I6VC 4F8MA 2IT1A 2NTTA 4PNYA 2NB0A 4KJOA 4C3JG 4E6IA 1BBXC 2R3ZA 3M3YB 4EQPA 5A2QE 3TN2A 3I72A 1Z7TA 2WAQB 5E3FA 1JWMD 5IT9L 3HEJA 5FKAC 5CYUA 4XYOA 2KEDA 4KN7C 2BOSA 1TY0A 2PW5A 5I6YA 3VYRA 1Q8IA 1BXTA 1HQRD 3MWYW 2RA4A 2BCOA 2NN6G 2CQAA 3S9WA 5I9PA 2K1BA 1E0BA 4IUNA 1ILPA 3T51B 3S14B 3U9OA 3I4MB 1K8MA 2SNMA 3NHHA 3MTSA 1LT5D 2BDOA 2L12A 1ENAA 4BY7B 1F9SA 4C1NK 4CKCA 4A3FB 1ZXTA 3NSWA 1Y1VB 3NQTA 4K6LA 4IUQA 5M3MB 1CM9A 4HR7B 4RGMA 1B9MA 2XWJB 3OHXC 4YIJA 3J81E 1GUNA 3GD7A 3ITPA 5KGUA 2X6LA 4G7HC 2N55A 4AYBB 1II3A 4QB4A 2EYPA 3AU7A 1OO9B 5I4DA 5D3DA 3EA6A 3WOEA 1FNUA 2F0WA 5CC4A 5IGBA 5T1IA 1BCPC 4JK1C 4GZYC 1Q1BA 3KBXA 5IGEA 4ODGA 1UUPA 5C4JB 1T5XD 4ZUJA 2C9OA 1FD7D 2XNAC 2IL8A 1VMPA 4A3MB 3A8JE 1B2TA 3Q0AA 1ONLA 3OWFA 1CZWA 3MAQA 2F03A 1SYCA 3HRZC 3SK6A 1Q1EA 1A3VA 3OMGA 1YNND 5C0XG 2ZT9C 4KN4C 3QG1A 5KYLA 5BN4A 1ENFA 4NW2A 4L63B 5K36H 2KVMA 5I6WA 1SDFA 2CHBD 3TZDA 1ENCA 2OT2A 2B2YC 1HUNA 4IFDI 2EYLA 1S4ZA 3NP8A 1BCPB 2JYOA 1D5ZC 4XQQA 3MXGA 4DAPA 3SDZA 1KNAA 2A5HA 2PCFB 1M4VA 3KLSA 1X3QA 1VF5C 4KY7A 3OW7A 1KNEA 3I70A 1WTVA 1HPCA 4WFN3 3ZYYX 1DD2A 3GTMB 4CJ2C 5AFWA 2X6GA 1TWFB 4U673 2ICEC 2F0FA 3IFDA 3C1EA 5EPKA 4FF3A 5J22A 3I73A 1JWSD 2FMMA 4BBRB 3RMHA 2OF1A 4LK1C 1MD2D 1PTOC 3QWNA 2LS01 2NN6H 1GUOA 1ZKOA 3H6MA 1SSOA 2CW0D 2L5TA 1D5XC 4FXKC 1GUTA 1TQOA 4DAVA 1PZKD 4RKLA 4HMJA 1SE4A 1S5FD 3M4YA 1TS2A 1CFMA 3T53B 1FR3A 1TWHB 2F0GA 3NPPA 1SMYD 2B2TC 1WVLA 3FKIB 2NTSA 1Z6HA 2M9VA 2A69C 5C0XI 3HOZB 5JEAJ 3WDNA 1A3UA 1IW7D 5DM63 5EQ0A 3S2HB 1LLRD 3Q23A 4KV6A 3D4WA 3CHBD 4RHSA 4KKSA 4KI0A 1VF7A 1WTRA 2XSCA 4HAEA 3MXPA 4CGYB 1G6ZA 1LTGD 1XYIA 1F9RA 2R6GA 4RH6A 5E1FA 1BCPF 5IIFA 3LNNA 2NVTB 4IALA 1NAPA 1Y1WB 3X3MA 1F2ZA 2B2VC 4ABNA 2K7VA 5EBCA 3I4LA 2D62A 1HXYD 1DOKA 2OXPA 3W3AA 4KHVA 2E2JB 3Q22A 3FMCA 4DGZA 1F2LA 1PXUA 3HP3A 2AQ1B 1AZPA 1EQTA 1JE4A 2EYFA 1C8CA 1BOSA 3EVQA 2IJ0A 4K2LA 3O13A 2FINB 4IQZA 1SNOA 1GJXA 3NQIA 4XT1B 4BWGB 4KY6A 3MA2B 2IX1A 5EKLA 1TU2B 2A68D 3TDQA 1ET9A 4KD3A 1CHPD 1PFBA 1LO5D 3IFTA 3VYSA 2Y0SB 1XTCD 3PUYA 5C4HA 4CKEA 4DNTB 1SJHD 1BR9A 1QB5D 1ZEQX 5D14A 4HCSA 5EBDA 2K04A 1JORA 2EY5A 2F0IA 3M85A 1A15A 1EY9A 2C5CA 2VB2X 2JP1A 1EY0A 4RKBA 4S3SA 1HRJA 5TSSA 1R9TB 2Z8LA 1SMYC 3GTPB 3N52A 1RKNA 3MHBA 1EWHA 2JA7B 1KTKA 2EJFC 1E2VA 3A7LA 2OEOA 4RGOS 4IUUA 5JAVA 3S16B 4RAUC 1JQYD 1EOTA 5LHY1 3NBIA 2IPKD 1QE6A 2QCPX 5F2DA 1DYQA 1RHPA 3RLFA 1J9OA 3E6ZX 3FDTA 3T4AC 3NUCA 4HSPA 2LY7A 3K5LA 3M7NA 4L8JA 4C56C 2R93B 1O80A 4IUTA 4NP5A 3SK4A 3URYA 4H0LC 3QOLA 1VCIA 2KA7A 2N88A 3ND8A 4DN4M 2B2WC 3KF8A 4UDUC 2BA0A 1B9NA 4OL7A 1IHZA 5JVG3 3HZXA 4HEDA 2TMPA 2F0EA 2A6ED 2R7ZB 1OXTA 3DMUA 2EY1A 4FF1A 2XVSA 2MUYA 3A55A 2D2CC 4RCNA 4ZK9B 3PUXA 4WJWA 5EGTA 1JOOA 1X3PA 2FHTA 2Q8RE 3CQZB 2O4XA 5IT9E 4OO1G 3D8GA 3GO5A 5CV4A 4FVMA 2B63B 4ZLTF 4U68A 1EYCA 3DWAA 4G7ZC 2B8FA 2XIWA 2LKVA 2KCNA 5M5XB 1EZ8A 2JEBI 1TWCB 3BDOA 5CORA 3OWEB 1EQVA 1O78A 2MP1A 4KKUA 3GQBA 1HFNA 4DK0A 3JAML 1HFGA 1STGA 3OPOA 3V05A 1TIID 1LTRD 3PO3B 5FOBB 1UAPA 2GA4B 1IYVA 4PQXA 4KD4A 1F9QA 1EU4A 1EYAA 1KDAA 1AZQA 1MBYA 2XRQD 3HGBA 1EY4A 4DFAA 2FFKB 2I07B 4N9TA 2AQ2B 1IL8A 5J39A 1ML0D 1BNZA 4ZKCB 2WINB 2F0KA 5DNFA 5J1ZA 5IGGA 1F2YA 2HDMA 3R2TA 5C6AA 1HTLD 1EYDA 4PMCA 3GTKB 2L0CA 3F2UA 3GTGB 1UEAB 1B4OA 4C3IB 1KABA 2DY7A 3DEPA 3Q6SA 1V43A 4FO2A 4C2MB 1T5EA 3HKZB 1B3AA 3T16A 4EGVA 1VDZA 3MXNA 2BE5D 3S1QB 1SNMA 1HQMC 3D6WA 3PIO3 4XXEA 1I4GA 4IFDG 1EIHA 4OO1I 4C3HB 4TQUS 4B08A 1AFPA 3DXJC 1SYBA 3VR3A 4I65A 2A6EC 2F1MA 1YNJC 2PZUA 2YYZA 1Q90A 5DM73 4N9PA 3MVVA 1SNQA 3R3OA 1B44D 2TSSA 1JICA 1K8OA 2VXWA 2F0SA 4A93B 2MGSA 3VYTA 2K01A 4K5VA 1EFID 5C0XJ 4FXGC 2E74C 5KRUA 1V1OA 1X32A 2D9UA 3IKJA 2EOTA 1LTBD 2G9DA 2F0MA 1CA5A 1F77A 1GHJA 1RF2D 4DNRB 1R4QB 5G3LD 3RZOB 1SYEA 4OIJA 2SNSA 1QG7A 1RCVD 1A2UA 1U4MA 2XRSD 4K5XA 4IUPA 4ZYSA 2L9HA 3BVGA 3TP8A 4OO1H 2B2UA 3IL8A 2JSOA 3HS0C 2QF7A 1AW7A 1D5MC 1BF4A 3D31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMQ D;  3GV3 A;  3D6W A;  1G2T A;  4CJ1 B;  4MHE A;  2JP1 A;  4ZLT F;  1TVX A;  4U68 A;  1X3Q A;  1BO0 A;  4QUF A;  1WTO A;  5CBE E;  1EIH A;  1HRJ A;  1NR2 A;  2DY8 A;  1G91 A;  1HHV A;  5JJZ A;  1F9P A;  2B2W A;  1KNE A;  2NZ1 D;  3I91 A;  2B2T A;  1DON A;  5E4X A;  1SAP A;  1O7Z A;  2X6L A;  4O42 A;  2XIW A;  2N55 A;  1WTV A;  1WTR A;  1PDQ A;  1U4L A;  3N52 A;  4HSV A;  1VMC A;  3QO2 A;  4X3S A;  4HAE A;  1WTX A;  2MPM A;  1G6Z A;  3FPU B;  2X69 A;  1XYI A;  1F9R A;  4CJ2 C;  1MGS A;  1PFM A;  2X6G A;  5AFW A;  1ESR A;  4R8I A;  2RSN A;  1NAP A;  1DZ1 A;  1LV9 A;  2KOL A;  4IUV A;  1B50 A;  2B2Y A;  3H91 A;  3IFD A;  2HCI A;  5COR A;  2KUM A;  1WTW A;  3SVM A;  5EPK A;  5T1I A;  2L4N A;  2MP1 A;  2B2V C;  2FMM A;  1EL0 A;  4UAI A;  3I8Z A;  5T1G A;  4IUU A;  1ILQ A;  1WD1 A;  4RA8 A;  1NCV A;  1MSG A;  3ONA B;  1HFN A;  1BBX C;  2R3Z A;  1JIC A;  1HFG A;  4RAU C;  2VXW A;  1EOT A;  1WTP A;  4XT3 B;  3TN2 A;  1DOK A;  2KEC A;  1QE6 A;  3P7J A;  1MI2 A;  2J7Z A;  2MGS A;  2K01 A;  1PLF A;  1F2L A;  4RWS C;  3G7L A;  3KBX A;  3HP3 A;  1RHP A;  1AZP A;  1EQT A;  1M8A A;  5E4W C;  1IKM A;  5EPJ A;  5COY A;  1J9O A;  2B2U C;  1JE4 A;  2HUG A;  2K28 A;  2NYZ D;  3FDT A;  1WTQ A;  2HDL A;  3GV6 A;  2KED A;  1B53 A;  4IUR A;  1C8C A;  1ICW A;  1F9Q A;  2FJ2 A;  2IL8 A;  1VMP A;  1X32 A;  1SSO A;  2D9U A;  2L1B A;  3KUP A;  1AZQ A;  1O80 A;  2EOT A;  5EJW A;  1B2T A;  4MN3 A;  4IUT A;  2FFK B;  3UI2 A;  1G2S A;  2RSO A;  4X3T A;  1J8I A;  5EKI A;  2FIN B;  3LWE A;  5CMD A;  2HCC A;  1GUW A;  1IL8 A;  1IKL A;  1DOL A;  3DM1 A;  4XDX A;  3I90 A;  3R93 A;  1CA5 A;  4XT1 B;  2BDN A;  1HUM A;  1U4R A;  2MJ8 A;  4ZKB B;  1ML0 D;  3MWY W;  2RA4 A;  1ROD A;  1BNZ A;  1EIG A;  4ZKC B;  2N88 A;  4OIJ A;  1MSH A;  2K1B A;  1QG7 A;  4OIK A;  1RTN A;  2B2V A;  4R9W A;  1E0B A;  2B2W C;  5DNF A;  4DN4 M;  1AP0 A;  1U4M A;  2B2T C;  2KEE A;  1WVL A;  2M2L A;  4IUP A;  1ILP A;  2HDM A;  4ZAI A;  1QNK A;  2CVR A;  2L9H A;  5CBA E;  4X3K A;  1PFB A;  1RTO A;  4HED A;  2K03 A;  4NW2 A;  4X3U A;  1RJT A;  3MTS A;  3F2U A;  2KVM A;  2Q8T A;  1DOM A;  1U4P A;  1SDF A;  3TZD A;  2L12 A;  2NWG A;  2B2U A;  1NR4 A;  2K05 A;  2B2Y C;  1F9S A;  1B4O A;  3IL8 A;  1WD0 A;  1HUN A;  1PFN A;  1Q3L A;  2DY7 A;  2H1E A;  5D14 A;  3DEP A;  4CJ0 B;  1ZXT A;  4HCS A;  3Q6S A;  2EPB A;  4QUC A;  4ZK9 B;  5D65 A;  1HA6 A;  5EPL A;  1S4Z A;  1XX8 A;  2K04 A;  3I3C A;  1X3P A;  2FHT A;  2JYO A;  2Q8R E;  2RVL A;  4IUQ A;  1CM9 A;  1O7Y A;  2EE1 A;  1B3A A;  5EQ0 A;  1CA6 A;  1BF4 A;  2L11 A;  2SDF A;  1KNA A;  1A15 A;  3DEO A; 
#chains in the Genus database with same CATH topology
 2XN9 C;  2MO1 A;  3OMC A;  2UU9 L;  3H0G G;  4HCE A;  1PRT D;  4DAY A;  4DK3 C;  4G4K A;  4FXD A;  4F7X A;  1I4R A;  1STH A;  2EY6 A;  3J7A 5;  1I50 H;  4ULL A;  3I4N G;  5C44 H;  4JBJ A;  1Z9F A;  5M5W B;  1SEB D;  4PMW A;  3FHW A;  4IPH A;  3K57 A;  2Q2I A;  2RKS A;  2ZJR A;  1JT8 A;  3KBG A;  1PFM A;  4ID6 A;  5ELD A;  5LMU Q;  3H91 A;  4HIM A;  2F4I A;  3PUW A;  5LMU L;  4DV3 Q;  3I8Z A;  2F0L A;  3ERO A;  4DV3 L;  1D1I A;  2JK8 A;  4Q0F A;  2KEC A;  2VW9 A;  2EDG A;  3P7J A;  4BBS G;  4A3K H;  5GRO A;  4EQO A;  3H94 A;  3AMU A;  2XTI A;  3I55 A;  2AQ3 B;  4CKB A;  3BZD B;  1N8R C;  3KF6 A;  2RBM A;  1GUS A;  2CWA A;  5I9O A;  4DK6 C;  1KRT A;  5C4X H;  4HIK A;  1HH2 P;  1ZYR D;  1SE3 A;  3HOX H;  1FJG L;  2WB1 B;  1QVF A;  4GKJ Q;  2K5W A;  4X3T A;  1XNR Q;  1ET6 A;  3T56 B;  4GKJ L;  1XNR L;  1H9M A;  2PMZ E;  2HQE A;  2Q2U A;  2JA6 H;  1D6E C;  2MO0 A;  1PYW D;  1VQM A;  3TEH B;  1SRO A;  1WFQ A;  1Q12 A;  3E9H A;  4OIK A;  1VQN A;  4DR4 Q;  1AP0 A;  4FYD A;  2NVX H;  2CH4 A;  4DR4 L;  4BY1 B;  2K33 A;  3F2B A;  4BS9 A;  1QWY A;  1BBW A;  3LWU A;  2QEJ C;  5LL6 S;  2Q8T A;  1K73 C;  2EXZ A;  2K05 A;  1B70 B;  2F3V A;  4IFD H;  1NTG A;  4XQN A;  1KDB A;  1Q7Y C;  1PFN A;  1Q3L A;  1KDC A;  1HJP A;  4RFB A;  2EPB A;  5IYD G;  2WKD A;  2R92 G;  2IX0 A;  2VUM B;  2PNR C;  3RR5 A;  1F2M A;  2KCM A;  3NXW A;  2K5Q A;  1SYF A;  1IBM Q;  1I50 B;  4ZRZ A;  3L0O A;  1IBM L;  3MEH A;  2AWN A;  1KD1 C;  3STB D;  1EWC A;  4QUF A;  2ZXP A;  3EFX D;  2DY8 A;  1G91 A;  4NKL A;  2Y0S E;  4RMF A;  1E1T A;  1B8A A;  1LAC A;  2J4X A;  1Z47 A;  1BVS A;  4X3S A;  1C7Y A;  3QO2 A;  3CCL A;  2RHQ B;  2EJM A;  4XQJ A;  5DAU A;  1SBB B;  2VNU D;  2UUA Q;  3PO2 H;  1S5C D;  3V96 A;  3NEN A;  4M1U B;  3K59 A;  1WTW A;  2CFM A;  2UXC Q;  1LT4 D;  4C1N I;  2UXC L;  1I5F A;  1L1O B;  1GOZ A;  1YBY A;  3D6C A;  4C3J B;  2ZJQ A;  3NWT A;  1NCV A;  1L1O A;  2YTX A;  2F0T A;  3BYT B;  2B39 A;  1ESF A;  2AHO B;  3D4R A;  3A54 A;  2MNA A;  3SR1 A;  2EYH A;  1YNN C;  5IOC A;  2WAQ G;  4O2D A;  3CCJ A;  3G7L A;  1VQ6 A;  1STE A;  4Y7N B;  5C4X B;  3L3O C;  1HZA A;  3GTO H;  2QA4 A;  3HOX B;  3K7A H;  1Y8N B;  1EWI A;  3M4O H;  1CK1 A;  2JA6 B;  1K83 H;  3HOU H;  1J8I A;  2F0H A;  4GKK Q;  5IP9 H;  1GUW A;  4GKK L;  1NUC A;  2AKW B;  3IAY A;  4DF7 A;  3S17 B;  1UNS A;  4A3I B;  1HZ9 A;  1NSN S;  2D0P A;  2K5V A;  3KLR A;  5D3I B;  4N8X 1;  1Y69 U;  1BKB A;  2E76 C;  2F52 A;  2F0U A;  1CQF A;  2E2D C;  3H3V H;  4X3K A;  3I4M G;  3TBI B;  4QIW E;  1LYL A;  5C3W A;  2PZT A;  4OHJ A;  5C0X H;  1S3O A;  2PZW A;  3AFQ A;  3H0G H;  2WAC A;  3M7G A;  2KJX A;  3TRE A;  4I7Z C;  2NWG A;  4QL5 A;  3MFY A;  1B1Z A;  4BY7 G;  5CR3 A;  1L0Y B;  2UUC Q;  4A3F G;  1EEF D;  5D65 A;  3I4N H;  2K5D A;  1Y1V G;  4P71 A;  3BS1 A;  3I3C A;  4CDF C;  5KND A;  3HOW B;  2UUC L;  3U4Z A;  1TS4 A;  3OSO A;  1TR5 A;  5M3M G;  1AEX A;  1SRU A;  2J0T D;  3TP6 A;  1XPO A;  5CV9 A;  3DEO A;  4QMG A;  1OXV A;  3DM3 A;  2EYJ A;  4CJ1 B;  4X65 Q;  5JPN C;  1Y14 B;  1SYD A;  2YTV A;  4X65 L;  1GXD C;  4HN7 A;  2QDB A;  3KLW A;  1HHV A;  4L5Q A;  5DEH A;  3VA7 A;  1TWG B;  3WWV A;  1SAP A;  2FMC A;  1STB A;  4AYB G;  1LTS D;  3GTL B;  4BBS H;  2JE6 I;  1A3T A;  4R8I A;  3LX0 A;  2CW0 C;  3S2D H;  1DZ1 A;  2R61 A;  2KOL A;  2VQF Q;  5ELC A;  2EYM A;  1Y8O B;  2VQF L;  1JMC A;  2K4K A;  1KC8 C;  5KYI A;  5C3X A;  4FF4 A;  3ER0 A;  1G51 A;  3TSS A;  3AYH B;  4XYQ A;  3A5U A;  4A3G B;  3OOC A;  1V1P B;  2EYO A;  4FF2 A;  2WFW A;  3VYU A;  1BUV T;  1KLG D;  1V1P A;  1WI5 A;  3DWP A;  4LAA A;  2RQX A;  4AQY Q;  4A3D H;  3M4O B;  3MZ5 A;  1SFO B;  2HDL A;  4IUR A;  4AQY L;  3W1B A;  3HOU B;  1A6X A;  1ICW A;  3HOY H;  4JVZ A;  2I5M X;  4A3M G;  2K32 A;  5BN3 A;  2OTJ A;  1G2S A;  1W3S A;  2QW7 A;  3LWE A;  1IW7 C;  3C46 A;  1IKL A;  4P72 A;  2F0N A;  4ZKB B;  4R4I A;  2GVA A;  1H95 A;  4DXG A;  1SN8 A;  2PI2 A;  4R9W A;  2BH2 A;  5IYD H;  2R92 H;  5KEE A;  1E2Z A;  2KEE A;  4KK7 A;  2M2L A;  4TRD A;  3PUV A;  5CBA E;  4CDD C;  1CSP A;  1VQP A;  3NTI A;  3G71 A;  1G8Z D;  1E2W A;  4F88 A;  1KHI A;  1STA A;  1JB3 A;  1Q8K A;  3SE0 A;  4NB3 A;  1B7Y B;  1E24 A;  3CRK C;  3JAM E;  3C2P A;  3EBE A;  3NTK A;  4HMI A;  3T13 A;  2WAQ E;  5IGD A;  1GM5 A;  3A56 A;  3KF8 B;  3P1H A;  4JV5 Q;  3NE5 B;  4OGQ C;  1PH8 A;  3A5Z B;  4JV5 L;  3SXH A;  1G2T A;  1KXL A;  2ZXR A;  1BO0 A;  4R8N A;  4B9X A;  4TKO B;  3BVM A;  4DR7 Q;  2Z4I A;  4YWM A;  3K6O A;  3HOV B;  2K5N A;  1DON A;  1XJV A;  4DR7 L;  4R4O A;  3I7F A;  4Z9C B;  2LFN A;  4NMZ A;  3VR6 A;  3BYY B;  4XTC S;  1VQ8 A;  4A3J B;  3HKZ E;  5C5M A;  1SXT A;  5CV6 A;  3E5S A;  1EZ6 A;  1HNW Q;  4POF A;  4DK1 A;  1A8V A;  1HNW L;  5T1G A;  1EU3 A;  1MSG A;  4BBR G;  5L37 A;  3CC4 A;  1WTP A;  2NUC A;  2A68 C;  1GUG A;  2V4D A;  4A3D B;  3A8I E;  2J7Z A;  3E0J A;  4H7B A;  4QY7 A;  3AB9 A;  1QZG A;  3C3L A;  3CCQ A;  3HOY B;  2KCC A;  5E4W C;  5EPJ A;  1D8L A;  3J80 L;  3GTJ H;  1YIJ A;  1JWU D;  4KY5 A;  3S1M H;  2WP8 J;  5HUR A;  3UI2 A;  3S14 H;  3I4M H;  2F0P A;  1R4P B;  1QCB D;  3I90 A;  2A74 C;  1LT3 D;  2MJ8 A;  2LMC B;  1ROD A;  4AYB E;  5LMN Q;  4BY7 H;  1EIG A;  5FLX L;  2I0Q A;  3CC7 A;  5LMN L;  1SLJ A;  4YHH Q;  4I7A A;  4A3F H;  3FPP A;  2SOB A;  2PW7 A;  1VQ5 A;  1UWV A;  3SK5 A;  4YHH L;  2CVR A;  4JI0 Q;  1BBU A;  5M3M H;  1L0X B;  3G48 A;  3FKI G;  4WOR A;  1I4X A;  1UE6 A;  4JI0 L;  4IFD J;  5FJ8 G;  1FVI A;  3PQI A;  3J80 c;  1GVP A;  1ASY A;  1MIU A;  1VQB A;  4DV1 Q;  2WV6 D;  2ZJP A;  5FLM G;  4DV1 L;  1CKN B;  4JW0 A;  4R4Q A;  3VR4 A;  1CKN A;  1HA6 A;  3HOZ G;  2RVL A;  2EY2 A;  1JR0 D;  2L11 A;  2M00 A;  1D7Q A;  4GLV B;  1KAA A;  1NBW A;  4H44 C;  4ZUI A;  4JG2 A;  3FEW X;  5IGF A;  1WTO A;  1NR2 A;  1BQQ T;  2G9H D;  3CCE A;  1E7Z A;  4BA1 I;  1VQA A;  3EJI A;  4KKT A;  3ERS X;  5E4X A;  1O7Z A;  4K8I A;  1PDQ A;  1U4L A;  2OWO A;  3CU7 A;  1I3Q H;  2E75 C;  2MPM A;  4YWL A;  1SMX A;  5C3E H;  3M4Q A;  2K6A A;  2X69 A;  3FPU B;  3K5M A;  4LUV A;  3S15 B;  5FO8 B;  3TME A;  1CUK A;  1AN8 A;  4IUV A;  4JYA Q;  1B50 A;  5C4J H;  2DNC A;  4ME5 A;  1Y1W G;  4JYA L;  4LUO A;  4JI6 Q;  3K58 A;  1P16 A;  5IYB G;  3X3N A;  3J7Z C;  1LUZ A;  4J8Q A;  3PSI A;  4JI6 L;  4KHZ A;  2PO4 A;  3KJP A;  3G4S A;  5M5Y B;  3TS0 A;  3NTH A;  1MI2 A;  1OXS C;  3GTJ B;  1SYG A;  1SJE D;  4DPG A;  1SNC A;  2YTY A;  4GNX C;  2F4V Q;  3S1N B;  5COY A;  1WTQ A;  2B2U C;  2HUG A;  2F4V L;  3S1M B;  5IT9 c;  4CHT B;  1CTM A;  1TWA B;  5EJW A;  2D5D A;  5EKI A;  1FGB D;  1V9P A;  1S5E D;  3VR2 A;  5IGC A;  3DM1 A;  1DOL A;  4DV0 Q;  3SK8 A;  2BDN A;  3L9A X;  5KNB A;  4DV0 L;  4TSS A;  1V8Q A;  2B8G A;  3J7A F;  2LXJ A;  5GQO A;  3PIO A;  1C4Q A;  3A8K E;  2JA8 B;  4Y52 H;  1PFS A;  2F0Q A;  1PTO D;  4A3E H;  4MIU A;  3SEB A;  5A2Q L;  1DOM A;  2E2H B;  2WB1 E;  2E2I H;  1K3B C;  2Y0S G;  4P2C B;  5ELE A;  2PQE A;  5I2Y A;  2PQA A;  4CJ0 B;  3U58 A;  2HHH Q;  1QNU A;  2YV5 A;  2A6H D;  1JOK A;  2HHH L;  2Z6K A;  2EE1 A;  3ULL A;  3CPW A;  2O5I C;  2PPB C;  4LJZ C;  2IWH A;  4JI3 Q;  4NDX A;  1W6J A;  1TWF H;  4JI3 L;  3KFU A;  2ID0 A;  4GNX B;  5CBE E;  1I3Q B;  1I4H A;  5C3E B;  2NVY B;  1XPU A;  2B29 A;  3I91 A;  3RD4 A;  1I4Q A;  4V0B A;  4BBR H;  2A69 D;  5JJI A;  1J6Q A;  2IW3 A;  4EQN A;  3QOJ A;  4KTA A;  2AWO A;  3KYH C;  2JA7 G;  1ESR A;  1QZH A;  4PMB A;  2MFI A;  1STY A;  3VA5 A;  1VQ7 A;  1YJ9 A;  3BDC A;  1H9J A;  1FL0 A;  1RDP D;  3S1R B;  3J7Y W;  4RHR A;  1TY2 A;  4H02 A;  4L5S A;  3CRL C;  4UP9 A;  3BDL A;  1KQS A;  2K52 A;  3QIA A;  1XWE A;  2N3S A;  1STN A;  2CKZ B;  3ERQ A;  4HID A;  1PLF A;  2ZTE A;  5ELF A;  4HJ9 A;  4RWS C;  3WOF A;  2KQ3 A;  1Q82 C;  4PG3 A;  1E3P A;  2MHV A;  3GV6 A;  4DU9 A;  2ALY B;  1N33 Q;  2RDG A;  4IOA A;  1DXM A;  1PH9 A;  2F0O A;  4A3C G;  2NN6 I;  3J81 L;  1TWH H;  1N33 L;  4O0A A;  2DNE A;  2R93 G;  2Z6B A;  4MN3 A;  1C9O A;  4X66 Q;  3DWQ A;  3FKI H;  2RSO A;  1PH4 A;  4B3R Q;  1D2B A;  1DJR D;  4X66 L;  1PZI D;  4B3R L;  2HD3 A;  4B3M Q;  5KNC A;  1FNW A;  1HUM A;  4IJH A;  4F87 A;  1Y8P B;  5FLM H;  2CQO A;  4B3M L;  1NMG A;  4LF5 Q;  2BE5 C;  1VQD A;  4UPA A;  4A3E B;  4LF5 L;  3KF6 B;  1ICF B;  3HOZ H;  1LAB A;  4CBV A;  3DLL A;  5FK9 C;  1QNK A;  4K0K Q;  4JCV E;  2E2I B;  1YHA A;  3S2H H;  2BH8 A;  1PZJ D;  4K0K L;  1O7L A;  5LMN W;  1OXX K;  1EY7 A;  1FJG Q;  1H9S B;  2H4O A;  2R7Z G;  3P75 A;  3J81 c;  5NUC A;  2ZXO A;  1H9S A;  5M3F H;  4K6D A;  4WRD A;  1X55 A;  1WD0 A;  4A4I A;  1PTO H;  4KHP Q;  3CKI B;  1LTI D;  4A76 A;  3RZD B;  4KHP L;  1L1O C;  3P20 A;  2JA5 H;  4QF4 A;  2WKC A;  2SDF A;  5JOB A;  2DN8 A;  1WCM H;  5C4Z A;  4RG1 A;  4MNO A;  2NVT H;  4WJ4 A;  2JA9 A;  2B63 G;  4K8J A;  3PGZ A;  1Y1W H;  5JJZ A;  5FO7 B;  3KLS X;  4G57 A;  2D0O A;  4IN3 A;  5IYB H;  2Q2T A;  3PUZ A;  4BXX G;  2F0J A;  1WTH A;  2O5J C;  1TS3 A;  1VMC A;  1XMO Q;  3UDI A;  1HA5 A;  1XMO L;  1OTC A;  1QOH A;  2B2Y A;  4YCW A;  2WII B;  3SVM A;  1JJG A;  1XNQ Q;  1X3E A;  3DHQ A;  5C44 B;  3OIP A;  1XNQ L;  1U5K A;  3ONA B;  2A6H C;  5BR8 Q;  1I4P A;  1Q86 C;  4XT3 B;  1W2B A;  5IOD A;  5ELB A;  3FRP B;  5BR8 L;  1EQR A;  3PO3 G;  3MFG A;  1CT1 D;  1M8A A;  1DCZ A;  3K0Y A;  1OXU A;  1I94 Q;  4V19 0;  2Q8I B;  1GD7 A;  2K28 A;  1B53 A;  4LUZ A;  1I94 L;  1SE2 A;  5KIX A;  4Q5V A;  2FJ2 A;  2KEN A;  2L55 A;  1NMF A;  1G29 1;  3K5N A;  1S5B D;  5LL6 X;  3T1Y Q;  5CGK A;  3GP7 A;  4A3K B;  4HJA A;  3RNU A;  2AUK A;  3J81 j;  1PMR A;  3T1Y L;  3R93 A;  4YCV A;  3PMF A;  4A3B H;  3M4P A;  1QJO A;  1U4R A;  2YU9 H;  4JI5 Q;  1HR0 Q;  4JI5 L;  4B3S Q;  1JJ2 A;  1RTN A;  1HR0 L;  1PRT C;  4LF4 Q;  3L7Z C;  4B3S L;  1H9K A;  2RF4 A;  3GTQ H;  1K3R A;  4LF4 L;  2JXM B;  5M3F B;  1JCK B;  4GLX A;  4ILW A;  1PTO B;  3OIQ A;  2A73 B;  2VB3 X;  2DGY A;  1FNV A;  1NR4 A;  1W6K A;  2JA5 B;  2KBN A;  2H1E A;  4C3I G;  5GAD C;  5FO9 B;  1CSQ A;  2NVX B;  1R9T H;  3E0E A;  1CZG A;  1XX8 A;  1WCM B;  3BZC A;  3Q24 A;  4JI8 Q;  4RCO A;  1DM0 B;  3NWS A;  3R2I A;  2HQL A;  3BVZ A;  2AUJ D;  3GTP H;  1CA6 A;  3HKZ G;  4JI8 L;  4LWC A;  2XWB B;  1TT2 A;  4JOI C;  2JA7 H;  3TP7 A;  5EKK A;  1C48 A;  1TVX A;  2NVQ H;  4DV6 Q;  2XGT A;  4C3H G;  1CI3 M;  2LSS A;  2O2L D;  4DV6 L;  1F9P A;  1LTA D;  2PMZ B;  3CCV A;  2QIL A;  5CV7 A;  2B2T A;  1SE8 A;  3N6R A;  4GLA C;  4O42 A;  5JPM C;  4DKA C;  3A7A B;  4M8A A;  3NEL A;  5JEA G;  3D4D A;  1XTD A;  2HIV A;  4J1M A;  1ZYR C;  4JBW A;  2ASB A;  2SEB D;  1YEZ A;  3VR5 A;  1VQ9 A;  4LFB Q;  2JEA I;  3QB3 A;  1YJW A;  4LFB L;  3U50 C;  1UEB A;  4A3C H;  1EL0 A;  1ILQ A;  4RA8 A;  1PRT B;  3H3V C;  3J7A V;  1QVG A;  2R93 H;  1TKW B;  4PZ6 A;  3ULP A;  4B9W A;  1EEI D;  4MTN A;  1A2T A;  4DXF A;  4KJN A;  4A93 G;  2BA1 A;  2V1C C;  2K5H A;  4PZ8 A;  4RGT A;  3MC0 B;  3PO2 B;  1I6H H;  2JJQ A;  1IKM A;  1UE1 A;  1CQV A;  3PV0 A;  2NYZ D;  3W1G A;  2Z1C A;  1EY8 A;  5K5P A;  3C1F A;  4BA2 I;  2F3I A;  2L1B A;  1FYC A;  4K14 A;  3PIP 3;  1QIL A;  4A3B B;  2I46 A;  3BG3 A;  2YU9 B;  4B3T Q;  2ZTC A;  1EY6 A;  2A1A A;  3D0F A;  4B3T L;  3A0J A;  5BN5 A;  1LT6 D;  5HGT A;  3GTO B;  2QKI C;  4WJ3 M;  3GTQ B;  1SR3 A;  4JOI A;  3H09 A;  4K2K A;  1MSH A;  3K7A B;  2B2V A;  3CCR A;  3QJY A;  3FVQ A;  3STB C;  2IX3 A;  4ZAI A;  1K83 B;  4A3L G;  3CQZ H;  2EQS A;  4RGN A;  5C5L A;  4A75 A;  4UY8 C;  1RTO A;  2CH4 W;  1L0W A;  1IYJ B;  1RJT A;  1XXG A;  2EVB A;  2ICI A;  4CDC C;  2B63 H;  5A35 A;  1LTT D;  1X3F A;  3KJO A;  2F0V A;  5ISR A;  4HJ5 A;  3NBH A;  2IHF A;  4QUC A;  3KK7 A;  5EPL A;  1U9R A;  2DJF C;  1ASZ A;  4OON A;  1SND A;  1O7Y A;  2ZM6 Q;  2NVQ B;  4OX9 Q;  4QCL A;  1TWC H;  2ZM6 L;  3HOW G;  3J80 E;  3IRB A;  4LMQ D;  3H0G B;  2HT1 A;  4OX9 L;  4MHE A;  5M9O A;  1SNP A;  5JVH 3;  3U9S A;  1PTO F;  1CHQ D;  3I4N B;  1O7I A;  2NZ1 D;  4LF8 Q;  4LF8 L;  4HSV A;  3HG9 A;  1TS5 A;  2NBF A;  1MGS A;  3MXU A;  3F1Z A;  5FLX E;  1MKH A;  4DR6 Q;  2RSN A;  3PO3 H;  1G6P A;  4QIW B;  2HCI A;  4FP5 D;  2KUM A;  5G3L F;  3TZU A;  4DR6 L;  4G7O C;  1VQG A;  4DNI A;  3SHL A;  1KLU D;  3ND9 A;  2L4N A;  4O1N A;  5CV8 A;  4UAI A;  1WD1 A;  3W2D A;  4R4T A;  5ELN A;  4X64 Q;  4KMU C;  1I6H B;  3R8B A;  1UE7 A;  4BBS B;  4X64 L;  2KHJ A;  1GKH A;  1D1K A;  3S2D B;  1EOV A;  3M3Y H;  3UDF A;  3RLO A;  2DUD A;  2F3W A;  4YY3 Q;  1HTP A;  3EQL C;  1RD9 D;  4YY3 L;  3KUP A;  1E1O A;  1YNJ D;  3V2T A;  1K8A C;  2Z4H A;  4L6T B;  3D3R A;  2WB1 G;  4EX5 A;  5CMD A;  2HCC A;  1BDO A;  2F0D A;  4EVO A;  3GTK H;  1PRT F;  4XDX A;  5IP7 G;  2RCF A;  4OWW B;  4HTH A;  2CWP A;  4J15 A;  4FNF A;  2ENB A;  4PV1 C;  4ZQ3 A;  2EZV A;  2RDH A;  1JOQ A;  3RUZ A;  3DUZ A;  1JC7 A;  4BY1 G;  2K03 A;  2RDF A;  4X3U A;  1EY5 A;  1HR0 W;  3B6Y A;  4DV5 Q;  2P5Z X;  4H13 C;  2CCZ A;  1VS0 A;  1U4P A;  1JE5 A;  4DV5 L;  5CV5 A;  3Q8D A;  1KIX A;  4C3H H;  1BCP D;  4GOP A;  2R92 B;  1DGS A;  1H9R A;  3CMA A;  3HFZ B;  2VUM G;  1GHK A;  4K5W A;  2LXK A;  4XIG S;  1YIT A;  4IZ8 A;  5K36 G;  1Y1V H;  5JEA H;  2EJG C;  3GV3 A;  4ZCK A;  4GS3 A;  4EQ5 A;  5I2X A;  5ELO A;  3TP5 A;  3K5O A;  1S5D D;  3G6J B;  4HJ8 A;  1FGU A;  5JJL A;  1RIP A;  2B2W A;  3UDX A;  1IYU A;  4DA2 A;  4NXM Q;  5IE8 A;  1YVC A;  3I56 A;  3HKS A;  2PYK A;  3NK9 A;  4J6H A;  4NXM L;  1WTX A;  3T1H Q;  1X6O A;  4A93 H;  1PA6 A;  2KHS A;  3T1H L;  2NZO A;  1LV9 A;  1HCZ A;  2C35 B;  1I6V C;  1K9M C;  4F8M A;  2IT1 A;  2NTT A;  4PNY A;  2NB0 A;  1XMQ Q;  4KJO A;  4C3J G;  4E6I A;  1XMQ L;  1BBX C;  2ATW A;  2R3Z A;  3M3Y B;  4EQP A;  5A2Q E;  3TN2 A;  3I72 A;  3OYY A;  1Z7T A;  2WAQ B;  1UE5 A;  4IPD A;  5E3F A;  1JWM D;  4DAM A;  5IT9 L;  3JAM c;  3HEJ A;  3OW2 A;  5C4X G;  5FKA C;  3AEV A;  5CYU A;  4XYO A;  2KED A;  4KN7 C;  1S72 A;  3I2Z A;  2BOS A;  3HOX G;  1YZ6 A;  1TY0 A;  1A0I A;  2PW5 A;  3J80 i;  2Z6K C;  2JA6 G;  2OCE A;  4A3M H;  5I6Y A;  3VYR A;  2B3G A;  1Q8I A;  1BXT A;  2AMC B;  1HQR D;  3MWY W;  2RA4 A;  4A3I G;  2BCO A;  1HNX Q;  2NN6 G;  2CQA A;  3S9W A;  5I9P A;  2RCN A;  2K1B A;  1HNX L;  4NXN Q;  1E0B A;  4IUN A;  4NXN L;  1ILP A;  3T51 B;  4PZ7 A;  3S14 B;  3U9O A;  3I4M B;  1K8M A;  2SNM A;  3NHH A;  3MTS A;  3HOW H;  1LT5 D;  1WJJ A;  2BDO A;  2L15 A;  1ENA A;  2L12 A;  4BY7 B;  3S24 A;  1F9S A;  4C1N K;  4CKC A;  4A3F B;  1ZXT A;  3NSW A;  1Y1V B;  3NQT A;  1U0L A;  2DJG C;  4K6L A;  4IUQ A;  5M3M B;  1CM9 A;  4HR7 B;  4RGM A;  5M5W H;  1B9M A;  2XWJ B;  5JJK A;  4IOC A;  3KOJ A;  3OHX C;  4YIJ A;  3BJU A;  3J81 E;  1GUN A;  5IWA Q;  3GD7 A;  4LF9 Q;  5IWA L;  3ITP A;  2RHS B;  2PQA B;  4LF9 L;  3K7U C;  2Z0S A;  1MHW C;  5KGU A;  2X6L A;  4G7H C;  2N55 A;  4AYB B;  1II3 A;  4QB4 A;  2EYP A;  3AU7 A;  1OO9 B;  5I4D A;  5D3D A;  4YWK A;  3EA6 A;  3WOE A;  4OWT B;  2VL6 A;  1FNU A;  2F0W A;  3AQQ A;  5CC4 A;  3GTM H;  5IGB A;  5T1I A;  3CCM A;  1BCP C;  2ES2 A;  4R1J A;  4JK1 C;  4GZY C;  4A3G G;  1Q1B A;  2A8V A;  4YCU A;  3KBX A;  5IGE A;  4ODG A;  5IP7 H;  1NNX A;  1UUP A;  5C4J B;  1T5X D;  1LTL A;  1MJC A;  1QUQ A;  4ZUJ A;  2C9O A;  1FD7 D;  2XNA C;  3HOU G;  3TRZ A;  3E9I A;  4DV2 Q;  2IL8 A;  1VMP A;  4L5T A;  4A3M B;  4DV2 L;  3A8J E;  1B2T A;  3Q0A A;  1ONL A;  3OWF A;  1VQ4 A;  1CZW A;  2JN4 A;  3MAQ A;  2VZA A;  1HNZ Q;  2F03 A;  1SYC A;  3HRZ C;  1HNZ L;  1VQE A;  4IPC A;  3SK6 A;  1Q1E A;  1VQJ A;  1A3V A;  2QDL A;  4QJF A;  3OMG A;  1VQH A;  1YNN D;  1Q81 C;  5C0X G;  2ZT9 C;  3CC2 A;  4KN4 C;  1X65 A;  3QG1 A;  5KYL A;  5BN4 A;  1ENF A;  1KRS A;  1VQO A;  4NW2 A;  4L63 B;  5K36 H;  3TQY A;  3ICE A;  1K8G A;  2KVM A;  5I6W A;  1SDF A;  2CHB D;  3TZD A;  1S40 A;  1ENC A;  2OT2 A;  2B2Y C;  3VDY A;  5FJ8 H;  1HUN A;  4IFD I;  1X54 A;  2EYL A;  1S4Z A;  3NP8 A;  1BCP B;  1Q46 A;  3F2D A;  2JYO A;  1D5Z C;  3K80 C;  4XQQ A;  3MXG A;  4DAP A;  3SDZ A;  1KNA A;  4UP7 A;  1PH1 A;  2A5H A;  2PCF B;  1M4V A;  3KLS A;  1X3Q A;  4MZ9 A;  1AE3 A;  1EIY B;  3JC6 6;  1L2F A;  1VF5 C;  4KY7 A;  3OW7 A;  2I5H A;  4IPG A;  1YI2 A;  1KNE A;  3HOV G;  3AFP A;  3I70 A;  4C3J H;  1WTV A;  2VS1 A;  5HGQ A;  1HPC A;  4DUZ Q;  4WFN 3;  3ZYY X;  1DD2 A;  3GTM B;  4CJ2 C;  5AFW A;  4DUZ L;  2X6G A;  1TWF B;  3NEM A;  4U67 3;  4A3J G;  3BZK A;  2ICE C;  3RLN A;  4NPS A;  2F0F A;  4Y7N H;  3IFD A;  3C1E A;  5EPK A;  4FF3 A;  5J22 A;  4OEM B;  3I73 A;  1JWS D;  2FMM A;  4BBR B;  3UE0 A;  3RMH A;  2E8G A;  2OF1 A;  4LK1 C;  2OTL A;  4TVA B;  1N36 Q;  4A3D G;  5IY0 A;  3TS2 A;  1P8L A;  1N36 L;  1X3G A;  1HZC A;  1MD2 D;  4DR3 Q;  3HOY G;  1PTO C;  3QWN A;  2LS0 1;  3S17 H;  2E2J H;  4A3I H;  2NN6 H;  4DR3 L;  1GUO A;  1ZKO A;  3H6M A;  1SSO A;  2CW0 D;  4P75 A;  2L5T A;  1D5X C;  4FXK C;  1GUT A;  1TQO A;  3J81 i;  4DAV A;  1PZK D;  4RKL A;  4HMJ A;  1SE4 A;  4QQB X;  1S5F D;  3M4Y A;  1TS2 A;  1CFM A;  3T53 B;  1FR3 A;  1TWH B;  2F0G A;  3NPP A;  1SMY D;  2B2T C;  1X56 A;  1WVL A;  1NY4 A;  4LNQ A;  4DV4 Q;  1VQI A;  1YHB A;  3FKI B;  2NTS A;  1Z6H A;  4DV4 L;  3H3V I;  2M9V A;  3UDG A;  2A69 C;  5C0X I;  1B3Q A;  1PHJ A;  1VQK A;  3HOZ B;  5JEA J;  3WDN A;  1A3U A;  1TWG H;  1IW7 D;  5DM6 3;  5EQ0 A;  3S2H B;  4GN5 A;  1LLR D;  1VQC A;  3EIV A;  2OQ0 A;  4JC0 A;  3GTL H;  2UUA L;  1VQF A;  3Q23 A;  4KV6 A;  3D4W A;  2MQH A;  3CHB D;  4RHS A;  3E3X A;  1RL2 A;  4KKS A;  4KI0 A;  1VF7 A;  4P74 A;  2I5L X;  4AIM A;  1WTR A;  3I4O A;  3ZJY C;  5GAE C;  4DUY Q;  1PH6 A;  4APV A;  1HZB A;  2XSC A;  4HAE A;  3MXP A;  3KDF B;  4CGY B;  1G6Z A;  4A3G H;  2PI2 E;  4DUY L;  1LTG D;  1XYI A;  1F9R A;  2R6G A;  3PCO B;  3CPF A;  4RH6 A;  5E1F A;  1BCP F;  3KDF A;  5IIF A;  3LNN A;  2NVT B;  1MJE A;  4IAL A;  1NAP A;  1Y1W B;  3X3M A;  1SFO H;  1F2Z A;  2UXB Q;  2B2V C;  4ABN A;  4ALP A;  2K7V A;  2UXB L;  5EBC A;  3I4L A;  2D62 A;  1HXY D;  1DOK A;  2OXP A;  3W3A A;  4KHV A;  3G6E A;  2E2J B;  5HY6 A;  3Q22 A;  3FMC A;  4DGZ A;  1F2L A;  1PXU A;  3S16 H;  3HP3 A;  2AQ1 B;  1AZP A;  1EQT A;  2JQO A;  1JE4 A;  5GAH C;  2EYF A;  1C8C A;  1EUJ A;  1KL9 A;  1BOS A;  1TXY A;  3EVQ A;  4JBM A;  4UP8 A;  2IJ0 A;  4K2L A;  3O13 A;  2IHE A;  3W5O A;  4DR5 Q;  2FIN B;  4IQZ A;  2Z9H A;  4P73 A;  1SNO A;  4LF7 Q;  4DR5 L;  1GJX A;  3NQI A;  2E5L Q;  4LF7 L;  4XT1 B;  4POG A;  4BWG B;  4KY6 A;  2E5L L;  3MA2 B;  2IX1 A;  1CKO A;  5EKL A;  1TU2 B;  2A68 D;  3TDQ A;  3QR8 A;  1ET9 A;  3LGJ A;  2ZTD A;  1WOC A;  4KD3 A;  2JA8 G;  1CHP D;  1PFB A;  1EQQ A;  3OTO Q;  1LO5 D;  3IFT A;  3VYS A;  3OTO L;  2Y0S B;  2G5D A;  1XTC D;  2KHI A;  3PUY A;  5C4H A;  4CKE A;  4DNT B;  1LM0 A;  1SJH D;  1BR9 A;  1QB5 D;  1ZEQ X;  5D14 A;  2R7Z H;  2UUB Q;  4HCS A;  5EBD A;  2K04 A;  1JOR A;  2A19 A;  2UUB L;  2EY5 A;  3HOV H;  4IO9 A;  2F0I A;  1K0R A;  2KCT A;  1J5E Q;  3M85 A;  1A15 A;  1J5E L;  1EY9 A;  2C5C A;  2VB2 X;  4HIO A;  4A3J H;  2JP1 A;  4DR2 Q;  1EY0 A;  4RKB A;  4S3S A;  4AH6 A;  1HRJ A;  4DR2 L;  5TSS A;  1GO3 E;  2HIX A;  4JPB W;  3H15 A;  3SGI A;  1R9T B;  2Z8L A;  5C3E G;  4UHV A;  3NBH B;  2R7D A;  1SMY C;  3GTP B;  3CF5 A;  3N52 A;  4JI4 Q;  1RKN A;  3MHB A;  1EWH A;  4JI4 L;  2JA7 B;  1KTK A;  2EJF C;  4BXX H;  1E2V A;  3L2P A;  1C0A A;  3A7L A;  3PIP A;  1JB7 A;  3RN2 A;  5M5X H;  2OEO A;  2IY5 B;  4OXP A;  2OQK A;  4RGO S;  1XPR A;  4IUU A;  5JAV A;  3S16 B;  4RAU C;  1JQY D;  1EOT A;  5LHY 1;  3NBI A;  2IPK D;  1QE6 A;  2QCP X;  5E7N A;  4IJL A;  1K28 A;  2H5X A;  5F2D A;  1DYQ A;  1RHP A;  3CP0 A;  3CME A;  3RLF A;  1J9O A;  3GDE A;  3E6Z X;  3FDT A;  3T4A C;  1PH3 A;  3NUC A;  4HSP A;  2LY7 A;  4GOP C;  3K5L A;  3M7N A;  1NJI C;  4L8J A;  4C56 C;  2R93 B;  2NZH A;  1O80 A;  2VY3 A;  4IUT A;  4NP5 A;  3SK4 A;  4R4C A;  3K8A A;  4H0L C;  3QOL A;  3URY A;  1VCI A;  2KA7 A;  2N88 A;  2N78 A;  3ND8 A;  5H1S E;  4DN4 M;  2B2W C;  3KF8 A;  4X62 Q;  4A3E G;  4JBK A;  4UDU C;  2BA0 A;  3PF4 A;  1A63 A;  1B9N A;  4OL7 A;  1IHZ A;  4X62 L;  5JVG 3;  5AJ3 Q;  2FXQ A;  4LF6 Q;  3HZX A;  4HED A;  2TMP A;  2F0E A;  5AJ3 L;  1CKM A;  3CCS A;  2A6E D;  4LF6 L;  2R7Z B;  1OXT A;  2EIF A;  3DMU A;  3UE1 A;  2EY1 A;  4DV7 Q;  2XVS A;  4FF1 A;  2MUY A;  1IBK Q;  3A55 A;  2D2C C;  2GVB A;  4RCN A;  4DV7 L;  4ZK9 B;  3PUX A;  1IBK L;  4WJW A;  3GTG H;  5EGT A;  1JOO A;  1X3P A;  2FHT A;  2Q8R E;  3CQZ B;  2O4X A;  5IT9 E;  4C3I H;  2K14 A;  4LW1 A;  4OO1 G;  3D8G A;  3GO5 A;  5CV4 A;  1EYG A;  4FVM A;  1V1Q A;  4OWX B;  3S15 H;  4C2M H;  2B63 B;  4ZLT F;  4U68 A;  3F2C A;  1WYD A;  1EYC A;  2UXD Q;  3DWA A;  5IYC G;  3CCU A;  1PYB A;  4G7Z C;  3S1Q H;  2UXD L;  4GOP B;  2B8F A;  2XIW A;  2R7F A;  2LKV A;  2KCN A;  5M5X B;  5M5Y H;  1EZ8 A;  2JEB I;  1TWC B;  3RN5 A;  3BDO A;  3BU2 A;  4DR1 Q;  4DR1 L;  5COR A;  3S1N H;  3OWE B;  1EQV A;  1O78 A;  4MTK A;  3K0X A;  2MP1 A;  5C44 G;  4KKU A;  3GQB A;  1HFN A;  4DK0 A;  3JAM L;  1HFG A;  1PVO A;  1TWA H;  1STG A;  3OPO A;  3V05 A;  1TII D;  1LTR D;  3PO3 B;  5FOB B;  1UAP A;  1PYS B;  2K75 A;  2GA4 B;  1IYV A;  4PQX A;  4KD4 A;  4KLK A;  1F9Q A;  2EXD A;  1EU4 A;  4X6A H;  1PH7 A;  1EYA A;  1KDA A;  1AZQ A;  1MBY A;  2XRQ D;  4ME3 A;  3HGB A;  1EY4 A;  1IZ6 A;  4DFA A;  1KAW A;  2FFK B;  1N34 Q;  2I07 B;  1PV4 A;  2JA8 H;  4A3K G;  4L5R C;  4HJ7 A;  4N9T A;  2AQ2 B;  5J3B A;  1N34 L;  1IL8 A;  4GN3 B;  1EFW A;  1N9W A;  5EAY A;  5J39 A;  2E2H H;  1ML0 D;  1BNZ A;  4JI2 Q;  5GAG C;  4ZKC B;  2WIN B;  2F0K A;  4JI2 L;  5DNF A;  5J1Z A;  5IGG A;  1F2Y A;  1IXR A;  2HDM A;  3R2T A;  5C6A A;  3RZO H;  5FLX c;  1HTL D;  1EYD A;  5M3F G;  1PH5 A;  3CAM A;  4PMC A;  2QGQ A;  3GTK B;  2L0C A;  3F2U A;  4A3L H;  1YHQ A;  3GTG B;  1UEA B;  1NE3 A;  4LFA Q;  1B4O A;  2JA5 G;  4C3I B;  1KAB A;  2DY7 A;  4LFA L;  3DEP A;  3Q6S A;  1V43 A;  1X9N A;  2NVY H;  1WCM G;  1K0S A;  4FO2 A;  4C2M B;  1T5E A;  3HKZ B;  3MXN B;  1B3A A;  3T16 A;  4EGV A;  1VDZ A;  1N32 Q;  3MXN A;  2BE5 D;  4GN4 B;  3S1Q B;  1SNM A;  1HQM C;  1N32 L;  3D6W A;  3K81 C;  5DLQ E;  3PIO 3;  1QVC A;  4XXE A;  1I4G A;  4IFD G;  1EIH A;  4OO1 I;  4C3H B;  4TQU S;  3ULJ A;  1YNX A;  4JI7 Q;  3S1R H;  4B08 A;  4QGU A;  1AFP A;  3DXJ C;  1SYB A;  4JI7 L;  1YJN A;  1VQL A;  3VR3 A;  4I65 A;  3JAM i;  3EN2 A;  4FDB A;  2A6E C;  2F1M A;  1YNJ C;  2PZU A;  2YYZ A;  1Q90 A;  5DM7 3;  1AH9 A;  1E22 A;  1M90 C;  4N9P A;  1PH2 A;  3MVV A;  3A74 A;  1SNQ A;  1IBL Q;  4JI1 Q;  3R3O A;  1IBL L;  1B44 D;  4JI1 L;  2PNH A;  4CDE C;  2TSS A;  1JIC A;  1K8O A;  2VXW A;  3CXC A;  2F0S A;  4A93 B;  2MGS A;  3VYT A;  2K01 A;  4K5V A;  3PO2 G;  1EFI D;  2N8N A;  2QEX A;  5C0X J;  4FXG C;  2E74 C;  1A62 A;  5KRU A;  1V1O A;  1X32 A;  2D9U A;  3IKJ A;  2EOT A;  4A3B G;  1AE2 A;  1LTB D;  2G9D A;  2F0M A;  3U4V A;  1CA5 A;  3PF5 A;  1F77 A;  1GHJ A;  1RF2 D;  2N49 A;  4DNR B;  1R4Q B;  5G3L D;  1M1K C;  3RZO B;  1SYE A;  4OIJ A;  2SNS A;  1QG7 A;  1QUQ B;  1RCV D;  1IL2 A;  2Q2H A;  1A2U A;  3MEF A;  1U4M A;  4LFC Q;  2XRS D;  4K5X A;  4N8F A;  4IUP A;  4ZYS A;  4LFC L;  3RZD H;  2L9H A;  3BVG A;  3TP8 A;  4OO1 H;  5IP9 G;  3CW2 C;  1JJC B;  4BY1 H;  4OEL B;  2GN5 A;  4GNX A;  2B2U A;  3IL8 A;  3F8T A;  2JSO A;  5IYC H;  3M9B A;  3HS0 C;  1T9H A;  2QF7 A;  3CD6 A;  1AW7 A;  1D5M C;  2VQE Q;  2K50 A;  1BF4 A;  1EIF A;  2VQE L;  2UU9 Q;  2VUM H;  3D31 A;  3FP9 A;  4DAY B; 
#chains in the Genus database with same CATH homology
 2XN9 C;  3OMC A;  4HCE A;  1PRT D;  4DAY A;  4G4K A;  4FXD A;  4F7X A;  1I4R A;  1STH A;  2EY6 A;  4ULL A;  5M5W B;  1SEB D;  4PMW A;  3K57 A;  2RKS A;  3KBG A;  1PFM A;  4ID6 A;  5ELD A;  3H91 A;  2F4I A;  3PUW A;  3I8Z A;  2F0L A;  3ERO A;  1D1I A;  4Q0F A;  2KEC A;  2EDG A;  3P7J A;  4EQO A;  3H94 A;  3AMU A;  2AQ3 B;  4CKB A;  3BZD B;  2RBM A;  1GUS A;  5I9O A;  1ZYR D;  1SE3 A;  2WB1 B;  2K5W A;  4X3T A;  1ET6 A;  3T56 B;  1H9M A;  2HQE A;  1D6E C;  1PYW D;  1Q12 A;  4OIK A;  1AP0 A;  4FYD A;  4BY1 B;  2K33 A;  4BS9 A;  1QWY A;  3LWU A;  2QEJ C;  5LL6 S;  2Q8T A;  2EXZ A;  2K05 A;  2F3V A;  4IFD H;  4XQN A;  1KDB A;  1PFN A;  1Q3L A;  1KDC A;  4RFB A;  2EPB A;  2WKD A;  2IX0 A;  2VUM B;  2PNR C;  1F2M A;  3NXW A;  2K5Q A;  1SYF A;  1I50 B;  4ZRZ A;  3MEH A;  2AWN A;  1EWC A;  4QUF A;  2ZXP A;  3EFX D;  2DY8 A;  1G91 A;  4NKL A;  1LAC A;  2J4X A;  1Z47 A;  4X3S A;  3QO2 A;  2EJM A;  4XQJ A;  5DAU A;  1SBB B;  2VNU D;  1S5C D;  3V96 A;  4M1U B;  3K59 A;  1WTW A;  1LT4 D;  4C1N I;  1GOZ A;  3D6C A;  4C3J B;  3NWT A;  1NCV A;  2F0T A;  3BYT B;  2B39 A;  1ESF A;  3D4R A;  3A54 A;  3SR1 A;  2EYH A;  1YNN C;  5IOC A;  3G7L A;  1STE A;  4Y7N B;  5C4X B;  3L3O C;  3HOX B;  1Y8N B;  1CK1 A;  2JA6 B;  1J8I A;  2F0H A;  1GUW A;  1NUC A;  3IAY A;  4DF7 A;  3S17 B;  1UNS A;  4A3I B;  1NSN S;  3KLR A;  5D3I B;  1Y69 U;  2E76 C;  2F0U A;  1CQF A;  2E2D C;  4X3K A;  3TBI B;  5C3W A;  2PZT A;  4OHJ A;  5C0X H;  2PZW A;  2WAC A;  3M7G A;  2KJX A;  4I7Z C;  2NWG A;  3MFY A;  1B1Z A;  5CR3 A;  1L0Y B;  1EEF D;  5D65 A;  2K5D A;  3BS1 A;  3I3C A;  5KND A;  3HOW B;  1TS4 A;  3OSO A;  1TR5 A;  1AEX A;  2J0T D;  3TP6 A;  5CV9 A;  3DEO A;  4QMG A;  1OXV A;  2EYJ A;  4CJ1 B;  5JPN C;  1SYD A;  1GXD C;  4HN7 A;  2QDB A;  1HHV A;  5DEH A;  3VA7 A;  1TWG B;  1SAP A;  2FMC A;  1STB A;  1LTS D;  3GTL B;  2JE6 I;  1A3T A;  4R8I A;  3LX0 A;  2CW0 C;  1DZ1 A;  2R61 A;  2KOL A;  5ELC A;  2EYM A;  1Y8O B;  5KYI A;  5C3X A;  4FF4 A;  3TSS A;  4XYQ A;  4A3G B;  3OOC A;  1V1P B;  2EYO A;  4FF2 A;  3VYU A;  1BUV T;  1KLG D;  1V1P A;  3DWP A;  4LAA A;  2RQX A;  3M4O B;  3MZ5 A;  1SFO B;  2HDL A;  4IUR A;  3HOU B;  1A6X A;  1ICW A;  2K32 A;  5BN3 A;  1G2S A;  3LWE A;  1IW7 C;  3C46 A;  1IKL A;  2F0N A;  4ZKB B;  4DXG A;  4R9W A;  5KEE A;  1E2Z A;  2KEE A;  4KK7 A;  2M2L A;  4TRD A;  3PUV A;  5CBA E;  3NTI A;  1G8Z D;  1E2W A;  4F88 A;  1STA A;  1JB3 A;  3SE0 A;  3CRK C;  3JAM E;  3C2P A;  3NTK A;  4HMI A;  3T13 A;  5IGD A;  3A56 A;  3P1H A;  3NE5 B;  4OGQ C;  3SXH A;  1G2T A;  2ZXR A;  1BO0 A;  4R8N A;  4B9X A;  4TKO B;  3BVM A;  2Z4I A;  3K6O A;  3HOV B;  1DON A;  4Z9C B;  2LFN A;  4NMZ A;  3VR6 A;  3BYY B;  4XTC S;  4A3J B;  5C5M A;  1SXT A;  5CV6 A;  3E5S A;  1EZ6 A;  4DK1 A;  5T1G A;  1EU3 A;  1MSG A;  1WTP A;  2NUC A;  2A68 C;  1GUG A;  2V4D A;  4A3D B;  3A8I E;  2J7Z A;  3E0J A;  4H7B A;  3AB9 A;  3C3L A;  3HOY B;  2KCC A;  5E4W C;  5EPJ A;  3J80 L;  1JWU D;  4KY5 A;  2WP8 J;  5HUR A;  3UI2 A;  2F0P A;  1R4P B;  1QCB D;  3I90 A;  2A74 C;  1LT3 D;  2MJ8 A;  2LMC B;  1ROD A;  1EIG A;  5FLX L;  3FPP A;  2SOB A;  2PW7 A;  3SK5 A;  2CVR A;  1L0X B;  4WOR A;  1I4X A;  4IFD J;  2WV6 D;  3VR4 A;  1HA6 A;  2RVL A;  2EY2 A;  1JR0 D;  2L11 A;  2M00 A;  1KAA A;  4H44 C;  4ZUI A;  3FEW X;  5IGF A;  1WTO A;  1NR2 A;  1BQQ T;  2G9H D;  4BA1 I;  3EJI A;  4KKT A;  5E4X A;  1O7Z A;  4K8I A;  1PDQ A;  1U4L A;  3CU7 A;  2E75 C;  2MPM A;  3K5M A;  2K6A A;  2X69 A;  3FPU B;  3S15 B;  5FO8 B;  3TME A;  1AN8 A;  4IUV A;  1B50 A;  2DNC A;  4ME5 A;  3K58 A;  3X3N A;  4J8Q A;  4KHZ A;  2PO4 A;  5M5Y B;  3NTH A;  1MI2 A;  1OXS C;  3GTJ B;  1SYG A;  1SJE D;  1SNC A;  3S1N B;  5COY A;  1WTQ A;  2B2U C;  2HUG A;  3S1M B;  4CHT B;  1CTM A;  1TWA B;  5EJW A;  2D5D A;  5EKI A;  1FGB D;  1S5E D;  3VR2 A;  5IGC A;  3DM1 A;  1DOL A;  3SK8 A;  2BDN A;  3L9A X;  5KNB A;  4TSS A;  1V8Q A;  2B8G A;  3J7A F;  1C4Q A;  3A8K E;  2JA8 B;  2F0Q A;  1PTO D;  4MIU A;  3SEB A;  5A2Q L;  1DOM A;  2E2H B;  4P2C B;  5ELE A;  2PQE A;  5I2Y A;  4CJ0 B;  1QNU A;  2A6H D;  1JOK A;  2EE1 A;  2O5I C;  2PPB C;  4LJZ C;  2IWH A;  4NDX A;  1W6J A;  2ID0 A;  5CBE E;  1I3Q B;  1I4H A;  5C3E B;  2NVY B;  3I91 A;  3RD4 A;  1I4Q A;  4V0B A;  2A69 D;  2IW3 A;  4EQN A;  3QOJ A;  4KTA A;  2AWO A;  1ESR A;  4PMB A;  1STY A;  3VA5 A;  3BDC A;  1H9J A;  1RDP D;  3S1R B;  3J7Y W;  4RHR A;  1TY2 A;  3CRL C;  3BDL A;  3QIA A;  1XWE A;  3ERQ A;  1STN A;  1PLF A;  5ELF A;  4RWS C;  3WOF A;  2KQ3 A;  2MHV A;  3GV6 A;  4DU9 A;  2RDG A;  1DXM A;  2F0O A;  2NN6 I;  3J81 L;  2DNE A;  4MN3 A;  3DWQ A;  2RSO A;  1D2B A;  1DJR D;  1PZI D;  5KNC A;  1FNW A;  1HUM A;  4F87 A;  1Y8P B;  2BE5 C;  4A3E B;  1LAB A;  4CBV A;  5FK9 C;  1QNK A;  2E2I B;  1PZJ D;  1O7L A;  1OXX K;  1EY7 A;  1H9S B;  2H4O A;  3P75 A;  5NUC A;  2ZXO A;  1H9S A;  4K6D A;  4WRD A;  1WD0 A;  1PTO H;  3CKI B;  1LTI D;  3RZD B;  3P20 A;  4QF4 A;  2WKC A;  2SDF A;  5JOB A;  2DN8 A;  5C4Z A;  4K8J A;  5JJZ A;  5FO7 B;  3KLS X;  4G57 A;  4IN3 A;  3PUZ A;  2F0J A;  2O5J C;  1TS3 A;  1VMC A;  1HA5 A;  1QOH A;  2B2Y A;  2WII B;  3SVM A;  3DHQ A;  5C44 B;  3OIP A;  3ONA B;  2A6H C;  1I4P A;  4XT3 B;  5IOD A;  5ELB A;  3FRP B;  3MFG A;  1CT1 D;  1M8A A;  1DCZ A;  3K0Y A;  1OXU A;  4V19 0;  2Q8I B;  2K28 A;  1B53 A;  1SE2 A;  5KIX A;  4Q5V A;  2FJ2 A;  2L55 A;  1G29 1;  3K5N A;  1S5B D;  5LL6 X;  4A3K B;  5CGK A;  3GP7 A;  2AUK A;  1PMR A;  3R93 A;  3PMF A;  1QJO A;  1U4R A;  1RTN A;  1PRT C;  3L7Z C;  1H9K A;  2JXM B;  5M3F B;  1JCK B;  4ILW A;  1PTO B;  3OIQ A;  2A73 B;  2VB3 X;  1FNV A;  1NR4 A;  1W6K A;  2JA5 B;  2H1E A;  4C3I G;  5FO9 B;  2NVX B;  1CZG A;  1XX8 A;  1WCM B;  3Q24 A;  4RCO A;  1DM0 B;  3NWS A;  3R2I A;  3BVZ A;  2AUJ D;  1CA6 A;  2XWB B;  1TT2 A;  3TP7 A;  5EKK A;  1C48 A;  1TVX A;  4C3H G;  1CI3 M;  2O2L D;  1F9P A;  1LTA D;  2PMZ B;  2QIL A;  5CV7 A;  2B2T A;  3N6R A;  4O42 A;  5JPM C;  3A7A B;  4M8A A;  5JEA G;  3D4D A;  4J1M A;  1ZYR C;  4JBW A;  2SEB D;  3VR5 A;  2JEA I;  3QB3 A;  1EL0 A;  1ILQ A;  4RA8 A;  1PRT B;  3H3V C;  3J7A V;  1TKW B;  4B9W A;  1EEI D;  1A2T A;  4DXF A;  4KJN A;  2BA1 A;  4RGT A;  3MC0 B;  3PO2 B;  1IKM A;  1CQV A;  3PV0 A;  2NYZ D;  2Z1C A;  1EY8 A;  5K5P A;  3C1F A;  4BA2 I;  2L1B A;  1FYC A;  4K14 A;  3PIP 3;  1QIL A;  4A3B B;  2I46 A;  3BG3 A;  2YU9 B;  1EY6 A;  5BN5 A;  1LT6 D;  5HGT A;  3GTO B;  2QKI C;  3GTQ B;  3H09 A;  4K2K A;  1MSH A;  3K7A B;  2B2V A;  3QJY A;  3FVQ A;  2IX3 A;  4ZAI A;  1K83 B;  5C5L A;  4RGN A;  1RTO A;  1XXG A;  1RJT A;  2ICI A;  2EVB A;  5A35 A;  1LTT D;  2F0V A;  5ISR A;  3NBH A;  4QUC A;  3KK7 A;  5EPL A;  1U9R A;  1SND A;  1O7Y A;  2NVQ B;  4QCL A;  3J80 E;  4LMQ D;  3H0G B;  4MHE A;  5M9O A;  1SNP A;  5JVH 3;  3U9S A;  1PTO F;  1CHQ D;  3I4N B;  2NZ1 D;  4HSV A;  3HG9 A;  1TS5 A;  2NBF A;  1MGS A;  3MXU A;  5FLX E;  2RSN A;  4QIW B;  2HCI A;  4FP5 D;  2KUM A;  5G3L F;  3TZU A;  4G7O C;  3SHL A;  1KLU D;  3ND9 A;  2L4N A;  4O1N A;  5CV8 A;  4UAI A;  1WD1 A;  3W2D A;  4KMU C;  1I6H B;  3R8B A;  4BBS B;  1D1K A;  3S2D B;  2F3W A;  1HTP A;  3EQL C;  1RD9 D;  3KUP A;  1YNJ D;  3V2T A;  2Z4H A;  4L6T B;  3D3R A;  5CMD A;  2HCC A;  1BDO A;  2F0D A;  4EVO A;  1PRT F;  4XDX A;  4HTH A;  4FNF A;  2ENB A;  4PV1 C;  4ZQ3 A;  2EZV A;  2RDH A;  1JOQ A;  3RUZ A;  3DUZ A;  1JC7 A;  2K03 A;  2RDF A;  4X3U A;  1EY5 A;  4H13 C;  1U4P A;  5CV5 A;  1BCP D;  2R92 B;  1H9R A;  1GHK A;  4K5W A;  4XIG S;  4IZ8 A;  5K36 G;  5JEA H;  2EJG C;  3GV3 A;  5I2X A;  3TP5 A;  3K5O A;  1S5D D;  3G6J B;  2B2W A;  1IYU A;  4DA2 A;  2PYK A;  3NK9 A;  4J6H A;  1WTX A;  2KHS A;  1LV9 A;  1HCZ A;  1I6V C;  4F8M A;  2IT1 A;  2NTT A;  4PNY A;  2NB0 A;  4KJO A;  4C3J G;  4E6I A;  1BBX C;  2R3Z A;  3M3Y B;  4EQP A;  5A2Q E;  3TN2 A;  3I72 A;  1Z7T A;  2WAQ B;  5E3F A;  1JWM D;  5IT9 L;  3HEJ A;  5FKA C;  5CYU A;  4XYO A;  2KED A;  4KN7 C;  2BOS A;  1TY0 A;  2PW5 A;  5I6Y A;  3VYR A;  1Q8I A;  1BXT A;  1HQR D;  3MWY W;  2RA4 A;  2BCO A;  2NN6 G;  2CQA A;  3S9W A;  5I9P A;  2K1B A;  1E0B A;  4IUN A;  1ILP A;  3T51 B;  3S14 B;  3U9O A;  3I4M B;  1K8M A;  2SNM A;  3NHH A;  3MTS A;  1LT5 D;  2BDO A;  2L12 A;  1ENA A;  4BY7 B;  1F9S A;  4C1N K;  4CKC A;  4A3F B;  1ZXT A;  3NSW A;  1Y1V B;  3NQT A;  4K6L A;  4IUQ A;  5M3M B;  1CM9 A;  4HR7 B;  4RGM A;  1B9M A;  2XWJ B;  3OHX C;  4YIJ A;  3J81 E;  1GUN A;  3GD7 A;  3ITP A;  5KGU A;  2X6L A;  4G7H C;  2N55 A;  4AYB B;  1II3 A;  4QB4 A;  2EYP A;  3AU7 A;  1OO9 B;  5I4D A;  5D3D A;  3EA6 A;  3WOE A;  1FNU A;  2F0W A;  5CC4 A;  5IGB A;  5T1I A;  1BCP C;  4JK1 C;  4GZY C;  1Q1B A;  3KBX A;  5IGE A;  4ODG A;  1UUP A;  5C4J B;  1T5X D;  4ZUJ A;  2C9O A;  1FD7 D;  2XNA C;  2IL8 A;  1VMP A;  4A3M B;  3A8J E;  1B2T A;  3Q0A A;  1ONL A;  3OWF A;  1CZW A;  3MAQ A;  2F03 A;  1SYC A;  3HRZ C;  3SK6 A;  1Q1E A;  1A3V A;  3OMG A;  1YNN D;  5C0X G;  2ZT9 C;  4KN4 C;  3QG1 A;  5KYL A;  5BN4 A;  1ENF A;  4NW2 A;  4L63 B;  5K36 H;  2KVM A;  5I6W A;  1SDF A;  2CHB D;  3TZD A;  1ENC A;  2OT2 A;  2B2Y C;  1HUN A;  4IFD I;  2EYL A;  1S4Z A;  3NP8 A;  1BCP B;  2JYO A;  1D5Z C;  4XQQ A;  3MXG A;  4DAP A;  3SDZ A;  1KNA A;  2A5H A;  2PCF B;  1M4V A;  3KLS A;  1X3Q A;  1VF5 C;  4KY7 A;  3OW7 A;  1KNE A;  3I70 A;  1WTV A;  1HPC A;  4WFN 3;  3ZYY X;  1DD2 A;  3GTM B;  4CJ2 C;  5AFW A;  2X6G A;  1TWF B;  4U67 3;  2ICE C;  2F0F A;  3IFD A;  3C1E A;  5EPK A;  4FF3 A;  5J22 A;  3I73 A;  1JWS D;  2FMM A;  4BBR B;  3RMH A;  2OF1 A;  4LK1 C;  1MD2 D;  1PTO C;  3QWN A;  2LS0 1;  2NN6 H;  1GUO A;  1ZKO A;  3H6M A;  1SSO A;  2CW0 D;  2L5T A;  1D5X C;  4FXK C;  1GUT A;  1TQO A;  4DAV A;  1PZK D;  4RKL A;  4HMJ A;  1SE4 A;  1S5F D;  3M4Y A;  1TS2 A;  1CFM A;  3T53 B;  1FR3 A;  1TWH B;  2F0G A;  3NPP A;  1SMY D;  2B2T C;  1WVL A;  3FKI B;  2NTS A;  1Z6H A;  2M9V A;  2A69 C;  5C0X I;  3HOZ B;  5JEA J;  3WDN A;  1A3U A;  1IW7 D;  5DM6 3;  5EQ0 A;  3S2H B;  1LLR D;  3Q23 A;  4KV6 A;  3D4W A;  3CHB D;  4RHS A;  4KKS A;  4KI0 A;  1VF7 A;  1WTR A;  2XSC A;  4HAE A;  3MXP A;  4CGY B;  1G6Z A;  1LTG D;  1XYI A;  1F9R A;  2R6G A;  4RH6 A;  5E1F A;  1BCP F;  5IIF A;  3LNN A;  2NVT B;  4IAL A;  1NAP A;  1Y1W B;  3X3M A;  1F2Z A;  2B2V C;  4ABN A;  2K7V A;  5EBC A;  3I4L A;  2D62 A;  1HXY D;  1DOK A;  2OXP A;  3W3A A;  4KHV A;  2E2J B;  3Q22 A;  3FMC A;  4DGZ A;  1F2L A;  1PXU A;  3HP3 A;  2AQ1 B;  1AZP A;  1EQT A;  1JE4 A;  2EYF A;  1C8C A;  1BOS A;  3EVQ A;  2IJ0 A;  4K2L A;  3O13 A;  2FIN B;  4IQZ A;  1SNO A;  1GJX A;  3NQI A;  4XT1 B;  4BWG B;  4KY6 A;  3MA2 B;  2IX1 A;  5EKL A;  1TU2 B;  2A68 D;  3TDQ A;  1ET9 A;  4KD3 A;  1CHP D;  1PFB A;  1LO5 D;  3IFT A;  3VYS A;  2Y0S B;  1XTC D;  3PUY A;  5C4H A;  4CKE A;  4DNT B;  1SJH D;  1BR9 A;  1QB5 D;  1ZEQ X;  5D14 A;  4HCS A;  5EBD A;  2K04 A;  1JOR A;  2EY5 A;  2F0I A;  3M85 A;  1A15 A;  1EY9 A;  2C5C A;  2VB2 X;  2JP1 A;  1EY0 A;  4RKB A;  4S3S A;  1HRJ A;  5TSS A;  1R9T B;  2Z8L A;  1SMY C;  3GTP B;  3N52 A;  1RKN A;  3MHB A;  1EWH A;  2JA7 B;  1KTK A;  2EJF C;  1E2V A;  3A7L A;  2OEO A;  4RGO S;  4IUU A;  5JAV A;  3S16 B;  4RAU C;  1JQY D;  1EOT A;  5LHY 1;  3NBI A;  2IPK D;  1QE6 A;  2QCP X;  5F2D A;  1DYQ A;  1RHP A;  3RLF A;  1J9O A;  3E6Z X;  3FDT A;  3T4A C;  3NUC A;  4HSP A;  2LY7 A;  3K5L A;  3M7N A;  4L8J A;  4C56 C;  2R93 B;  1O80 A;  4IUT A;  4NP5 A;  3SK4 A;  3URY A;  4H0L C;  3QOL A;  1VCI A;  2KA7 A;  2N88 A;  3ND8 A;  4DN4 M;  2B2W C;  3KF8 A;  4UDU C;  2BA0 A;  1B9N A;  4OL7 A;  1IHZ A;  5JVG 3;  3HZX A;  4HED A;  2TMP A;  2F0E A;  2A6E D;  2R7Z B;  1OXT A;  3DMU A;  2EY1 A;  4FF1 A;  2XVS A;  2MUY A;  3A55 A;  2D2C C;  4RCN A;  4ZK9 B;  3PUX A;  4WJW A;  5EGT A;  1JOO A;  1X3P A;  2FHT A;  2Q8R E;  3CQZ B;  2O4X A;  5IT9 E;  4OO1 G;  3D8G A;  3GO5 A;  5CV4 A;  4FVM A;  2B63 B;  4ZLT F;  4U68 A;  1EYC A;  3DWA A;  4G7Z C;  2B8F A;  2XIW A;  2LKV A;  2KCN A;  5M5X B;  1EZ8 A;  2JEB I;  1TWC B;  3BDO A;  5COR A;  3OWE B;  1EQV A;  1O78 A;  2MP1 A;  4KKU A;  3GQB A;  1HFN A;  4DK0 A;  3JAM L;  1HFG A;  1STG A;  3OPO A;  3V05 A;  1TII D;  1LTR D;  3PO3 B;  5FOB B;  1UAP A;  2GA4 B;  1IYV A;  4PQX A;  4KD4 A;  1F9Q A;  1EU4 A;  1EYA A;  1KDA A;  1AZQ A;  1MBY A;  2XRQ D;  3HGB A;  1EY4 A;  4DFA A;  2FFK B;  2I07 B;  4N9T A;  2AQ2 B;  1IL8 A;  5J39 A;  1ML0 D;  1BNZ A;  4ZKC B;  2WIN B;  2F0K A;  5DNF A;  5J1Z A;  5IGG A;  1F2Y A;  2HDM A;  3R2T A;  5C6A A;  1HTL D;  1EYD A;  4PMC A;  3GTK B;  2L0C A;  3F2U A;  3GTG B;  1UEA B;  1B4O A;  4C3I B;  1KAB A;  2DY7 A;  3DEP A;  3Q6S A;  1V43 A;  4FO2 A;  4C2M B;  1T5E A;  3HKZ B;  1B3A A;  3T16 A;  4EGV A;  1VDZ A;  3MXN A;  2BE5 D;  3S1Q B;  1SNM A;  1HQM C;  3D6W A;  3PIO 3;  4XXE A;  1I4G A;  4IFD G;  1EIH A;  4OO1 I;  4C3H B;  4TQU S;  4B08 A;  1AFP A;  3DXJ C;  1SYB A;  3VR3 A;  4I65 A;  2A6E C;  2F1M A;  1YNJ C;  2PZU A;  2YYZ A;  1Q90 A;  5DM7 3;  4N9P A;  3MVV A;  1SNQ A;  3R3O A;  1B44 D;  2TSS A;  1JIC A;  1K8O A;  2VXW A;  2F0S A;  4A93 B;  2MGS A;  3VYT A;  2K01 A;  4K5V A;  1EFI D;  5C0X J;  4FXG C;  2E74 C;  5KRU A;  1V1O A;  1X32 A;  2D9U A;  3IKJ A;  2EOT A;  1LTB D;  2G9D A;  2F0M A;  1CA5 A;  1F77 A;  1GHJ A;  1RF2 D;  4DNR B;  1R4Q B;  5G3L D;  3RZO B;  1SYE A;  4OIJ A;  2SNS A;  1QG7 A;  1RCV D;  1A2U A;  1U4M A;  2XRS D;  4K5X A;  4IUP A;  4ZYS A;  2L9H A;  3BVG A;  3TP8 A;  4OO1 H;  2B2U A;  3IL8 A;  2JSO A;  3HS0 C;  2QF7 A;  1AW7 A;  1D5M C;  1BF4 A;  3D31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...