1CZGA

Structure of the g62t mutant of shiga-like toxin i b subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGTFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords SHIGA TOXIN B-CHAIN
publication title STRUCTURE OF THE G62T MUTANT OF SHIGA-LIKE TOXIN I B SUBUNIT
rcsb
source organism Phage h30
total genus 18
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1czgA00
1BOSA 4P2CB 1CZGA 4ULLA 2XSCA 1DM0B 3MXGA 1C4QA 1C48A 1R4PB 2GA4B 1D1KA 4M1UB 1QOHA 1QNUA 1CZWA 1D1IA 2C5CA 1CQFA 1R4QB 2BOSA
chains in the Genus database with same CATH superfamily
1YNJC 4A3KG 4R4IA 2YU9H 2B2UA 4XTCS 2EJGC 2WIIB 4P2CB 1BR9A 2IW3A 2XWBB 3OMGA 3F2CA 5A2QL 2VQEQ 1LABA 1U4LA 4YCVA 3GP7A 3GTLB 3CQZB 4A3DH 1F2YA 3I7FA 3DWQA 3PO2G 1WCMG 2IX0A 3V2TA 2CVRA 2IT1A 5BN5A 3MEFA 3S1NB 5BR8Q 1A6XA 3K0YA 3S15H 4I7AA 2OQ0A 5EQ0A 5CV7A 1V1QA 4LUVA 1G91A 3QB3A 2NZHA 2UU9Q 1A3VA 4LF6Q 3GTQB 1OXTA 2AHOB 3PIP3 4DR5L 1N34L 1HJPA 2A6ED 4CJ1B 3S9WA 2CKZB 4GOPB 1W2BA 1D7QA 2YTXA 1I4XA 1D5XC 1X3GA 2JP1A 3QO2A 5JJIA 2JA7G 3JAME 1PTOB 1Y8PB 1PV4A 2MGSA 4A3KH 1CA6A 1PH6A 3V05A 1NMGA 4DAYA 3M4OH 2IL8A 4A3IB 1N36Q 4GLVB 1WJJA 2E2HH 3QIAA 2HCIA 1SNDA 4C3HB 1VMPA 4JI0Q 1KNAA 1XX8A 3U58A 5FLXE 3GTJB 1JORA 3PO2H 1LT4D 4F8MA 4JPBW 4OO1G 5CYUA 5EKIA 4DK6C 4F7XA 3I4MB 2SEBD 5JPMC 3M3YH 3OYYA 2EJMA 1K3RA 2BA1A 2JQOA 4GKJL 4JK1C 2XTIA 4FXKC 4JC0A 2R7ZG 2BH8A 2VS1A 4B3RL 2R92H 1GHKA 3E6ZX 2B2UC 4A3BH 4G57A 3HOZB 2Q2TA 1EY6A 1S5DD 2JA7H 3M4PA 2NVYB 4A3EB 1FGUA 1TWGH 1I94L 2JA5G 4IUVA 4LW1A 2OEOA 3SHLA 4IPDA 4RWSC 5C5LA 5C44B 1QOHA 2CH4W 1F9PA 4KLKA 4IZ8A 4BY7H 3CMAA 4UY8C 4L5SA 1NE3A 5J1ZA 4DUYQ 1PFNA 4HCSA 1JE4A 1JWUD 3S1MH 3X3MA 5AJ3L 3H3VI 3EIVA 5FK9C 2Y0SG 4OO1H 3BDCA 3L9AX 5D14A 4BBRG 1UE5A 5C3EG 1CTMA 3G48A 1VQJA 3SXHA 2AQ1B 1B3AA 3K7AB 1N9WA 2NB0A 5ELFA 2NVQH 1Q46A 1SR3A 1HQMC 4HAEA 1YITA 2IPKD 3CCSA 1PFMA 1LTRD 2H5XA 1SE8A 4X64Q 2DY8A 3VA7A 1JE5A 4IO9A 2JA5H 3LNNA 3HG9A 1O7ZA 2BA0A 3SK4A 1J5EL 1TVXA 2PCFB 1XMOL 1BO0A 2IJ0A 1ZYRD 5C4ZA 3U9SA 1EIFA 1TXYA 3J80L 1SRUA 1D5MC 2B3GA 1ENAA 4MIUA 3S17H 4QUCA 2EXDA 3GTPH 5DNFA 4EVOA 2LXKA 1B7YB 2QILA 4C3IG 4B3MQ 3KLSA 2B2VA 2D0OA 1N32Q 5C3EH 2ZTCA 1FD7D 4FNFA 3IKJA 4IALA 3J81c 1JC7A 3SEBA 2XSCA 4A93G 1TWHH 3GTMH 1EUJA 4B3SQ 3NUCA 1DYQA 1IYVA 2RDGA 1Y69U 1YHBA 4ZKBB 2WAQE 2K32A 3CW2C 2C5CA 3L0OA 1L1OA 4DV1L 5CBAE 2WACA 2K14A 1VQPA 1G291 5M5WB 2UUCQ 2UXBL 2CWPA 2HUGA 1HUNA 2K4KA 1EQTA 4A3FH 3GD7A 1B70B 4JI6Q 3N52A 1IYJB 1RD9D 1QJOA 3S2HB 4C3IH 1AN8A 1VQDA 5A35A 4YHHQ 1R9TB 5LL6S 1S4ZA 2K5HA 4XXEA 4BS9A 5C44G 4R4CA 1E1TA 4A93H 3PUZA 1IZ6A 2JA9A 3OIQA 1V1PA 4X62L 3D4DA 2Z4HA 1WFQA 5I4DA 2TSSA 3J7YW 4CKCA 1PH1A 1MJCA 3QG1A 1O7LA 3HOYG 2A69D 4C2MH 3ERSX 1J6QA 4FXGC 1CFMA 3UDGA 2J4XA 1NUCA 1QCBD 3HOVG 2PNHA 1NBWA 2MHVA 3GO5A 2B2VC 1XMQL 2ZXPA 5EJWA 1IBMQ 1O7IA 2F0PA 2AMCB 1H9SA 3CCJA 1K0RA 4J6HA 3ZJYC 2WFWA 4ABNA 1WTQA 2R93H 1R4PB 3PUVA 3V96A 1O80A 4AQYL 1E1OA 4O0AA 1EZ8A 2DJGC 3W1BA 3R8BA 1PDQA 1EU3A 4AYBB 1Q1BA 1FJGL 5IGBA 3NWSA 1D1IA 2QW7A 3D3RA 1BBXC 1GHJA 1L1OC 4C3JG 4QCLA 1S5ED 3LWEA 3DHQA 2UXDL 5M3FG 1BKBA 4A3GB 1JB7A 3VR4A 3AEVA 1RTNA 1LT5D 3A7AB 3Q8DA 4LF5Q 1GUNA 4LNQA 1W6KA 1GD7A 1TWCH 3R2TA 1KABA 4NW2A 3HRZC 1J8IA 3D4WA 3CMEA 5JAVA 4KHPQ 3HOVH 4XT1B 3J7A5 3KFUA 3ERQA 1KDBA 1YEZA 4WJ3M 4DV4Q 3S14H 5IT9c 1M1KC 4BY1B 1DCZA 1ET9A 1EY9A 1STEA 4QQBX 2D9UA 3DEPA 5C0XH 3S1QB 3AMUA 3G4SA 4DR6L 3PO3H 5EBDA 2A5HA 5J3BA 4C3JH 2KECA 1EQVA 1DOLA 4UHVA 4DXFA 5KYIA 3T13A 3A5ZB 3K8AA 2HD3A 3BZDB 4JI1Q 5M3FH 1HNZQ 2EYMA 4JW0A 1BCPF 2UXCL 2B2YA 3J80c 3J81i 2ZJPA 4G7OC 1HNXQ 1A3UA 2HQLA 1K8MA 4TVAB 2PZTA 2F4VL 1B2TA 2R7FA 3RZOH 1AZPA 1NY4A 3AYHB 1YJ9A 4PMWA 3CC2A 4K0KQ 4OX9Q 4DF7A 3AB9A 3S16H 1EY4A 2F0KA 4K2LA 3H0GB 3TREA 5JVG3 5GADC 3W2DA 2BCOA 2K75A 5G3LD 3PIPA 1L1OB 4Y7NB 2OT2A 4B9XA 2Z8LA 3KF6A 3ND8A 4LFAL 3I4NB 3EN2A 2XRQD 1XNQL 3NELA 1E24A 4FF2A 4RGTA 1ICFB 5E7NA 2A6EC 1HZ9A 2JK8A 3BYTB 4KHZA 4BBSG 4GZYC 1K83B 3EA6A 1MHWC 4X66L 1ENFA 1LTID 5C4XG 2F0GA 4ODGA 5M5YB 1ASZA 1ENCA 2XWJB 1PA6A 3K80C 4OEMB 1RKNA 1EYCA 5C4HA 4A3MB 2KHIA 4PZ6A 4IOCA 2QF7A 2NVXH 3TQYA 4YWLA 1TS5A 4P71A 5FOBB 2MFIA 2NVTH 2FXQA 2K5QA 4DNTB 2G9DA 1PZJD 1KDAA 2DJFC 4B3TQ 1PLFA 4E6IA 2CFMA 4V190 1EY0A 2E74C 3KJPA 4OWWB 2E75C 4CDDC 4HJ7A 2I0QA 1VF5C 4C56C 5JEAJ 3TSSA 3FPPA 1U0LA 1PHJA 4LWCA 3BG3A 1JMCA 1D8LA 2UU9L 3DM1A 1MI2A 2RDHA 4LF6L 3EQLC 1H9SB 1Q82C 2X69A 1A2UA 4M8AA 4LF9L 5C4XH 3J7AV 2QGQA 1SXTA 5IGEA 4Z9CB 1Q8KA 2WB1G 1VQ4A 4H0LC 1QILA 3MC0B 4POGA 1ILPA 1J9OA 2JEAI 3FKIH 3FVQA 3J7ZC 2AKWB 4NP5A 2E2DC 3EJIA 5LMNQ 4YCUA 4QJFA 2KCNA 1SYDA 1EWHA 1VQFA 1N36L 2MP1A 3DWAA 1HQRD 4X65Q 4LF7Q 1PRTD 2YU9B 4XYOA 4Q5VA 3VA5A 4JI0L 1NNXA 3RD4A 1UE6A 1ESRA 3GTGB 1H9JA 4OGQC 5K5PA 1BBUA 2WB1E 4WJWA 4A3JB 1AZQA 1TIID 3GTKH 3OWEB 3PF5A 2CW0D 1WTOA 4NKLA 3UE0A 5IP7H 1GVPA 1D1KA 4LFBQ 1MKHA 2EDGA 2WINB 3IFDA 5KEEA 3VDYA 3KDFB 3S15B 1AFPA 3PQIA 3K5LA 1A2TA 4PZ8A 1KQSA 1CUKA 1TY2A 4JG2A 3T1HL 1B9NA 1TT2A 4QF4A 1ILQA 1ZYRC 3PGZA 3NBHB 2Z9HA 1GUOA 3MZ5A 2JYOA 2HHHQ 3J80i 4RKLA 1Y14B 1T5EA 1VQGA 3TDQA 2IWHA 1D6EC 2KHSA 1PZKD 4KK7A 1B53A 1C9OA 3UI2A 1MGSA 1F9SA 4HJ8A 2H4OA 3I91A 5J22A 2G9HD 1WVLA 2XVSA 1AP0A 1H9KA 3A0JA 1STHA 3VR6A 3SVMA 4ULLA 5DM73 3MAQA 4LJZC 3H3VH 3CCRA 4LF8Q 2MQHA 4GS3A 1G6ZA 1RHPA 1STBA 2FFKB 3QWNA 1VDZA 1EFWA 4HTHA 2IX3A 4JBKA 3R2IA 2D5DA 4PZ7A 4X64L 4OHJA 1HZCA 4A3BB 3H15A 3OIPA 4LUZA 4X3TA 1Z6HA 1QVCA 2LSSA 1X3EA 5IY0A 3CCLA 1TWGB 1GO3E 4IURA 2LMCB 4XIGS 2JA6H 4RCNA 1DZ1A 1UWVA 4NDXA 1WD0A 4A75A 4BY7B 1QNUA 2KEDA 5T1GA 2MO0A 3UE1A 1OO9B 3VR5A 5M9OA 1KAAA 1L0YB 3Q6SA 2UUBL 1N32L 1VQBA 1GUSA 3MVVA 4IUTA 1X3FA 4DAMA 1RCVD 1QZHA 1TU2B 1S5FD 4DV6L 4GN4B 4B3SL 1CA5A 4KHVA 3RLFA 3NENA 5K36G 4HMIA 1A3TA 3M7NA 5E1FA 2A69C 2EVBA 4A3JG 4K8IA 4IUQA 3A8IE 1A15A 1K0SA 1F9RA 3E9HA 2TMPA 2I5HA 1VQ8A 1GJXA 2UUCL 4RKBA 3J81L 4UP8A 4GN3B 1EEFD 4JV5Q 2JSOA 4B9WA 5D3IB 4JI6L 1Q1EA 5EPKA 2A68C 2NTTA 2WKCA 2F0OA 1XXGA 2Z4IA 5E3FA 2A74C 4O2DA 1Q86C 1I3QH 4GKKL 3HKZG 1TKWB 2AQ2B 3Q24A 1HR0L 2PW5A 2EIFA 1B9MA 2R61A 4QMGA 2PO4A 2PI2A 3M4YA 5K36H 2Z6BA 2F0WA 3KOJA 2F52A 3HOXB 3A55A 4BA1I 1TWHB 2VZAA 1IBKL 4DV2L 2EY2A 3RZDB 4DK1A 4BXXG 4OL7A 3KJOA 1SEBD 2PZUA 4PQXA 3ONAB 3HKZE 2DGYA 2RVLA 3I4OA 1H95A 3R3OA 3I8ZA 3TN2A 3HOWG 2B63B 2OTJA 2G5DA 2MJ8A 4DKAC 4JI8L 4OIJA 1BOSA 2V4DA 1O7YA 4RA8A 3F1ZA 2B2WA 4CKEA 3H94A 1EU4A 4A3FB 1RTOA 3IRBA 4ME5A 1STYA 4DUZQ 3BVZA 1WCMH 2WAQB 1BNZA 2NZ1D 1PYWD 4P74A 4H02A 3SE0A 1EOVA 4JI7L 2AUKA 1B50A 1TWFH 1AE2A 1XNRQ 4FDBA 4OELB 1B3QA 2OWOA 3URYA 5LMNW 4LF5L 3BZCA 1TS2A 2XRSD 5C3WA 3NTHA 1SYCA 5M5XB 2R6GA 5IODA 2EY6A 2KA7A 2XNAC 1EYDA 4A3LG 4X3SA 1ML0D 2ES2A 3P1HA 2CH4A 1PTOF 4KHPL 4QY7A 4MZ9A 3HOWH 3K0XA 4DU9A 1OXXK 1SAPA 1EIYB 4DV4L 1Y1WG 1W6JA 3A5UA 1EZ6A 2IHFA 5FLXc 1HPCA 1HA6A 1KDCA 1WOCA 2FJ2A 2R93B 5I9PA 4IOAA 4PNYA 1EIGA 1KL9A 3CXCA 4DR7L 3NHHA 3MXNB 5GQOA 1STGA 4JI1L 2JA8B 2WKDA 2R7ZH 1DD2A 3VYUA 3AU7A 1HNXL 2BDNA 1U9RA 5IT9L 1N8RC 2IX1A 3OTOQ 2ALYB 2E76C 1TWAH 4K6LA 2B2WC 1EL0A 1E2ZA 2Y0SE 2A73B 4O1NA 2GN5A 3NXWA 4OX9L 2VQFQ 4ZCKA 1SFOB 4RCOA 3J81E 3HOXG 4G7HC 4YIJA 3D0FA 1Y1WH 1WTVA 1PVOA 1Y1VB 4TKOB 1DOKA 4DR3Q 5A2QE 1Q90A 5EPLA 3NWTA 1YIJA 1EY7A 2EYFA 4BBRH 5CBEE 1CZGA 4K5XA 3KBGA 1SYEA 3J81j 4A3IG 3OMCA 3PO3B 4FXDA 5KGUA 1QB5D 4C3HG 1ICWA 3CQZH 1I6HB 1L2FA 3CPFA 1UNSA 4HIKA 4RGOS 1CQVA 1U4MA 1VQHA 1KRSA 2SNSA 1PRTC 3LWUA 4JI3Q 3S1NH 4HCEA 3EFXD 3QOJA 3I4MG 2ZTEA 2DY7A 3DWPA 4QB4A 2YV5A 1K3BC 1I50B 4KN7C 1Q7YC 3GTQH 1E7ZA 3T53B 4NB3A 2CW0C 4DR2L 1SE2A 2D2CC 1JQYD 2KEEA 4R1JA 1JOKA 1QUQB 3C1EA 3HOZG 3S24A 1C8CA 3I70A 3K6OA 1PTOH 1FNVA 4A3EG 2L11A 3OPOA 2HCCA 4IFDJ 1I4HA 3HKSA 2B29A 1FR3A 4GLXA 1SJED 2XGTA 4CGYB 4A3IH 3Q22A 1PZID 3S2DH 3VR3A 1SROA 2Q8IB 4C3HH 3GTOB 5DAUA 5M3MB 1PH7A 3DMUA 3GTJH 4P73A 5G3LF 1OXSC 3O13A 5IYBG 2A19A 2RCFA 1SSOA 2MUYA 4DA2A 3WWVA 2WP8J 4ZK9B 1CSPA 1NAPA 1KRTA 2JA8G 3GV3A 3M7GA 3NQTA 2R7DA 3I4LA 3S1RB 4LAAA 2E8GA 5LMUL 1JICA 2LFNA 2PYKA 3K58A 1Z9FA 3HOZH 1JCKB 4IPGA 4DR1L 5DEHA 2F3WA 2NVYH 4A3EH 1OXUA 4DR5Q 1N34Q 2RCNA 2YTYA 4MTNA 2CCZA 2KJXA 3H91A 2L4NA 2A68D 1CHQD 1VQMA 2HIXA 5C44H 1PRTB 4LF4L 4KJNA 1JT8A 2F03A 5EAYA 2VB2X 4HMJA 1EQRA 1X6OA 2FMMA 3NP8A 1XTCD 3KF8A 2K5WA 2B2TC 3TEHB 5IYCG 5I9OA 4R8IA 4GLAC 1PH2A 1II3A 4YY3L 5I2YA 1YHAA 1C4QA 2HHHL 2UUAL 4FF4A 3J7AF 1Y8NB 2M9VA 4ZYSA 4WFN3 3HOYH 2NWGA 1STNA 2F0EA 4LUOA 3R93A 3W3AA 2XIWA 1YNXA 3L7ZC 4XQQA 1IL8A 4DV3Q 4JYAQ 4RGMA 3K7AH 1SE3A 5H1SE 4MNOA 4DNRB 2Q2HA 4KKUA 2F0UA 2ID0A 3TZDA 3IAYA 5E4WC 5JJZA 3MA2B 1IBLQ 3A7LA 3KDFA 3J80E 5DM63 2ZXRA 5IGDA 1LTLA 4K6DA 1S5BD 5EBCA 4LF8L 3GTKB 3TBIB 2K50A 2ASBA 5KYLA 2YTVA 2ENBA 2CWAA 3W5OA 4ZQ3A 3NBHA 1HUMA 4NXNL 2AWOA 2I46A 2NZOA 4HJ5A 3KLWA 1VQ7A 2RKSA 4DR4Q 1LACA 5JEAG 1VS0A 1LTBD 5IYCH 4H44C 1DXMA 1XWEA 3L2PA 1K9MC 2EZVA 3K5OA 3H09A 3HS0C 3KLSX 2E2IH 1SN8A 4A4IA 5ELCA 1EIHA 2EOTA 3LX0A 3BDLA 2K52A 4FVMA 1S5CD 3T16A 1CSQA 2PNRC 1X54A 4C1NK 1WD1A 1MSGA 4J1MA 2CQOA 3E5SA 1HTPA 3PV0A 3FMCA 3RN2A 4JOIC 1K8AC 3BZKA 4UAIA 2F0NA 3NE5B 2KVMA 5M5WH 5FKAC 4IUUA 4WRDA 4S3SA 3RN5A 4JBJA 1XMOQ 4HEDA 1D5ZC 3CD6A 3UDXA 2LY7A 1B4OA 4N8FA 3MXPA 1EFID 1WYDA 3WDNA 3S2HH 4J8QA 1CZWA 1K28A 1JOOA 5C0XJ 3TRZA 1R9TH 3KUPA 4CDCC 2R3ZA 1F2ZA 2NN6I 4C1NI 3CHBD 4LFCQ 5BN3A 4AYBG 2E2JB 1LTSD 3HFZB 3WOEA 3K7UC 4POFA 4CBVA 3HOUB 1MIUA 2VQEL 4L8JA 2F0SA 3F2BA 3AFQA 1PFBA 3F2DA 3CCMA 2JA6B 4A3GG 1NR2A 2O4XA 4QIWE 3VR2A 4R4TA 2VW9A 3HZXA 2RHQB 1UEAB 2QKIC 3UDIA 1P8LA 5BR8L 3ULLA 2EYLA 4Q0FA 1YNND 2F0HA 4IUPA 2NTSA 2EXZA 1WTRA 1A63A 4CHTB 3A8JE 4KMUC 1VQLA 4BBSH 2L12A 2ZJRA 2PZWA 4NPSA 2K5VA 2D0PA 4BY1G 1SMXA 3FRPB 2GA4B 2VUMB 3NSWA 1FYCA 1PH3A 1BXTA 1HH2P 3E9IA 2DUDA 1VQ6A 2PMZE 3JC66 1X55A 5COYA 3KF8B 5IWAQ 1I4QA 4H13C 1HCZA 3G7LA 3HGBA 3A54A 4A3GH 4CDFC 4HSPA 2VNUD 1CI3M 3TP7A 2DNEA 2PQAB 4N9PA 1C48A 1DGSA 2K01A 1KC8C 2L5TA 1UUPA 1ZKOA 4NXMQ 4A3DB 1G2TA 3CCEA 1SJHD 1HXYD 3I55A 1PFSA 3CCQA 2HQEA 1HZAA 1IW7D 3MHBA 3H0GG 3C2PA 1KIXA 3PUXA 1EEID 4IPCA 1Q3LA 1XNRL 5GAGC 3DXJC 2KBNA 1DOMA 5CORA 4PV1C 3VYRA 3D4RA 3TP5A 1XMQQ 3I4NG 3CC7A 1GM5A 3S1QH 4DV5Q 1NSNS 4G4KA 5KRUA 2EPBA 1U5KA 1TS3A 2EYHA 4ID6A 5ELNA 1RIPA 4ZAIA 4MN3A 1ZXTA 5LHY1 4A3KB 4JI5Q 2N49A 4R4QA 1XPRA 1FJGQ 1ZEQX 4KY6A 4DUYL 3UDFA 3M4OB 2IHEA 1AEXA 2Q8RE 3U4ZA 2E2HB 2HDLA 4EQOA 2UXDQ 1CT1D 3JAML 5KIXA 5IYDG 5CV4A 1WI5A 4PMBA 3N6RA 1DM0B 2JEBI 4A3MG 2EE1A 5EKLA 3PO2B 1MD2D 1WCMB 4ALPA 3HOUG 2K04A 3RLNA 1KHIA 3H0GH 4F88A 2PW7A 3CRLC 3M3YB 1M8AA 5D65A 1OTCA 2L1BA 5FLXL 3OTOL 3D8GA 1TWFB 4PG3A 1LT6D 5GROA 3I4NH 4RHRA 1M4VA 2R92B 4P72A 1YVCA 2JJQA 1G8ZD 2D62A 4FO2A 3I73A 1XJVA 3TS2A 2JA7B 1IKLA 2FINB 3BJUA 3BVGA 3NPPA 1K83H 1I4GA 4DR6Q 5L37A 4DK0A 1B1ZA 5M5YH 4DR3L 1PH9A 3MXNA 4XQNA 1AW7A 3SK5A 3RLOA 4RAUC 2AQ3B 1HHVA 4TRDA 5IYDH 3S1MB 4B3ML 1Y8OB 1CM9A 5E4XA 1VF7A 3RMHA 4I7ZC 2F4VQ 2F0MA 1E3PA 5HY6A 5IGGA 5I6YA 2ICEC 4R8NA 5HGTA 3VYSA 4JI2Q 2AUJD 5JVH3 4DXGA 2R7ZB 4HN7A 4JI3L 5C4JH 2EY1A 2NVQB 5IOCA 2P5ZX 1SYFA 3NTKA 3F8TA 3P7JA 2I5MX 1C7YA 2C35B 1P16A 5CV5A 3MWYW 5T1IA 2HIVA 2JA5B 2IY5B 3DEOA 1Z47A 3ULJA 1VQIA 4HR7B 3FEWX 4KTAA 2F4IA 2PQEA 1EOTA 2F0IA 3EBEA 4HIOA 1X3PA 1YJNA 2RF4A 4K14A 4X66Q 2K5DA 4IPHA 4YHHL 1KD1C 3S17B 5GAHC 2MNAA 3ER0A 2KCTA 4A76A 3NTIA 3GTPB 1FNWA 4IN3A 2KHJA 4YWMA 2K7VA 5C5MA 2Y0SB 5IIFA 4APVA 1GUTA 2MO1A 4BBRB 1PH5A 1VCIA 2BE5D 4IUNA 4DV0Q 3MTSA 5C3EB 2A8VA 1HNWQ 3GTGH 2EYOA 2EYPA 1GXDC 3KLRA 3GTMB 4A3JH 2E5LQ 1KXLA 3U9OA 1FVIA 5JJKA 1JJGA 1H9MA 1TY0A 1QE6A 5JJLA 1K73C 4CJ2C 5FO8B 1QUQA 1JJCB 3CU7A 3G6EA 4L63B 1C0AA 3F2UA 3MEHA 1NCVA 4CJ0B 3T1YQ 4BA2I 3WOFA 1D2BA 4X3KA 4OWXB 4HSVA 4L5RC 1IBML 1SMYD 4EQPA 4L5QA 2VB3X 2R92G 1IL2A 1GUWA 4LF9Q 2N88A 4MTKA 4RFBA 4HIDA 4A3BG 1YJWA 1O78A 1VQKA 2YYZA 4ZRZA 5EGTA 2Q2UA 2EJFC 4QUFA 1CHPD 1S72A 1RF2D 5ELEA 4C3IB 1EQQA 1UE7A 4U673 1FGBD 4A3CG 1S3OA 4WJ4A 4KKSA 4XDXA 4BY7G 4A93B 3S2DB 3T51B 4CDEC 2K5NA 1BDOA 3A8KE 1A0IA 1VQ5A 5GAEC 2QEXA 3EROA 3HP3A 4BXXH 3JAMc 1F2MA 4DV3L 3I90A 4JYAL 3BU2A 3B6YA 3SK6A 3SR1A 4EQNA 3FPUB 1I4RA 4C2MB 2L9HA 2C9OA 1B44D 5CC4A 1F2LA 1T9HA 1IBLL 3PSIA 3K81C 3A56A 4X3UA 5ELDA 1QZGA 3ITPA 2VY3A 3STBD 3T1HQ 1N33Q 3CKIB 5FO7B 3OWFA 1E2VA 1SDFA 2SDFA 4KI0A 4HJAA 4DR4L 4A3CH 1CKNA 5KNBA 2J7ZA 4IFDG 3OW7A 1H9RA 1HNZL 1LTAD 2X6GA 2I07B 5IGCA 3I3CA 1LO5D 4QGUA 2F3IA 1HRJA 1STAA 1SNCA 2Z1CA 4JI4Q 1DONA 4A3LH 1A62A 1LV9A 4GNXA 1VQEA 1E0BA 2M2LA 1BF4A 2XN9C 3HOYB 2N78A 2NN6G 2ZM6Q 4K0KL 3K57A 1EY5A 1TWCB 3PIO3 1V8QA 2L0CA 1YBYA 4DPGA 3M85A 1YNNC 3HOVB 1V43A 4RGNA 4KJOA 4AIMA 2LXJA 3S14B 4RHSA 1SLJA 1NJIC 3GV6A 2PPBC 2QDBA 2B63G 4IFDH 1RODA 4O42A 4FF3A 2OXPA 1QG7A 4N9TA 2B39A 3CP0A 3EVQA 5ISRA 4U68A 4K5VA 1QWYA 2O5JC 1MBYA 3NEMA 1S40A 3GTLH 4C3JB 1Q8IA 4A3FG 4M1UB 1U4PA 2GVAA 3Q0AA 5CV6A 5M3FB 2WAQG 3P20A 4LFCL 4KN4C 2EQSA 4DNIA 5CV8A 2E2IB 2AWNA 5CGKA 2UUBQ 2NN6H 3G6JB 4HJ9A 2B2TA 1PH4A 4KD4A 2V1CC 1A8VA 2BH2A 3RZOB 3HOXH 1XTDA 4L5TA 2KQ3A 4B3TL 1UE1A 3SK8A 3T56B 4DV6Q 3RZDH 1KNEA 1TQOA 3S16B 3X3NA 1PMRA 4DV7Q 1QNKA 1IW7C 3AFPA 2ATWA 1B8AA 3C1FA 4OONA 3BVMA 1CQFA 1IHZA 3GQBA 2H1EA 2B63H 4OXPA 3M9BA 4JCVE 2ICIA 1EY8A 1BCPC 2RBMA 2KCMA 1AH9A 1XYIA 1SNOA 4GNXC 1FL0A 1IKMA 2OCEA 3BS1A 4QL5A 2ZT9C 1RJTA 1T5XD 1JJ2A 2QCPX 2FHTA 5BN4A 4TSSA 1EYGA 3SGIA 2HT1A 2JXMB 1VQ9A 5JOBA 2R93G 1X56A 5LMNL 3I4MH 4DAYB 5F2DA 4K5WA 4F87A 4EGVA 5IWAL 2RHSB 1PTOD 4X65L 4LF7L 4GKKQ 3D6WA 1HR0Q 3OSOA 3H6MA 3JAMi 4K8JA 4NMZA 2K1BA 4WORA 2NVXB 1CK1A 3NK9A 3DUZA 3E0EA 2NVTB 2A6HD 4MHEA 4UP7A 4KY5A 5M5XH 2F0DA 4NXML 1IBKQ 1GOZA 4B08A 4DV2Q 1ONLA 5FJ8G 4LFBL 3U50C 1SNPA 2ZTDA 2J0TD 4V0BA 1SYGA 3MFGA 1JR0D 4JOIA 1Y1VG 2F0TA 1PH8A 4BBSB 1TR5A 1YNJD 4JI8Q 1KLGD 4ME3A 4DV5L 1V1OA 4YCWA 1X65A 5I2XA 3I72A 4QIWB 1ASYA 1QVFA 5C4XB 5IYBH 3RUZA 5IT9E 1CKNB 2KCCA 3BDOA 4ILWA 3H3VC 3ND9A 1EWCA 5EKKA 3DM3A 4KV6A 1VQNA 2PQAA 4LMQD 1VQOA 5AFWA 5CV9A 5C0XG 4JI5L 4EX5A 3FKIB 4XT3B 2JA8H 3TP8A 3PO3G 1YZ6A 4JI7Q 2BOSA 3D31A 3BYYB 1BCPB 4OWTB 5LL6X 4GKJQ 1LT3D 4JVZA 2RQXA 2OF1A 3NBIA 4B3RQ 1LTTD 4GNXB 1LUZA 5FJ8H 4DFAA 2Z6KA 3I2ZA 4UP9A 5IP9G 3OOCA 1SNMA 3CCUA 1NTGA 2JE6I 4JBWA 2O5IC 1CKOA 1SFOH 1LLRD 4XQJA 2PMZB 1HZBA 1I94Q 1PRTF 1VQCA 1JOQA 1Y1VH 3K5MA 1VMCA 1F9QA 2MPMA 3CC4A 3RR5A 4RMFA 1W3SA 1L0XB 1U4RA 1G2SA 4OO1I 2WB1B 2PI2E 4J15A 3TS0A 1V9PA 2KOLA 5AJ3Q 3KBXA 2F0JA 3CRKC 1JWSD 4BWGB 3KK7A 1EWIA 4KD3A 1KTKA 4ZKCB 4DN4M 4I65A 5M3MG 2CQAA 4DR7Q 1I6HH 2KUMA 1BVSA 1X32A 1SBBB 1EYAA 2K05A 3FDTA 1KAWA 5IP9H 1K8OA 2BE5C 2K6AA 1I50H 4IFDI 1I6VC 1WTHA 1M90C 2VL6A 1JB3A 4JI2L 3MXGA 5KNCA 3VYTA 4DK3C 3QR8A 1HFNA 2O2LD 3D6CA 5JEAH 1J5EQ 5ELOA 4RH6A 4IJLA 1BQQT 1OXVA 4GN5A 4ZUJA 1PXUA 2N8NA 1SMYC 1PYBA 3HEJA 1TS4A 2LKVA 4JV5L 2K33A 5HURA 2Z6KC 3CF5A 3GTOH 2QEJC 5CR3A 5M3MH 4ZUIA 2B8FA 2N3SA 1GKHA 3FP9A 3T4AC 2SNMA 5DLQE 4R9WA 1SE4A 3C46A 5C3XA 4Y52H 4N8X1 3FKIG 4RG1A 3MXUA 1JWMD 3CCVA 4H7BA 3PUWA 4AYBE 5FLMG 3K5NA 1LTGD 2QA4A 4DV0L 4DV1Q 3S1RH 4FF1A 1V1PB 1HNWL 4X6AH 3ZYYX 2OTLA 2NBFA 2E5LL 3PF4A 2B8GA 2UXBQ 3LGJA 2ZJQA 2DN8A 4DR2Q 4UPAA 4DGZA 2CHBD 1QVGA 2F0FA 3SDZA 5C4JB 3T1YL 3A74A 2I5LX 3GDEA 1I5FA 2B2YC 5IP7G 2A1AA 3TMEA 4IQZA 2ZXOA 4P75A 2GVBA 3G71A 4FYDA 2KENA 1WTXA 1HTLD 2RSOA 3STBC 4LK1C 2RSNA 5IGFA 3ICEA 4DUZL 2L55A 1SNQA 4X62Q 5NUCA 5JPNC 3IL8A 2F3VA 4DAVA 5FLMH 1I3QB 3QJYA 4DAPA 1PYSB 4R4OA 4G7ZC 2F1MA 2NUCA 3ULPA 4AH6A 2F0VA 2HDMA 3PIOA 5C6AA 4KY7A 1UAPA 4BY1H 1VQAA 3IFTA 1BCPD 5LMUQ 1KLUD 4PMCA 1K8GA 4L6TB 4DR1Q 1HR0W 2QDLA 2JN4A 1ESFA 5IE8A 4GOPA 1LYLA 2F0QA 4AQYQ 1Z7TA 2VXWA 3RNUA 1G6PA 2DNCA 3QOLA 4LF4Q 1FNUA 2OQKA 1X9NA 3MFYA 2RDFA 3PMFA 4TQUS 1CKMA 3I56A 1N33L 1E2WA 4YY3Q 2NYZD 3M4QA 5FO9B 2EYJA 3E0JA 4OIKA 1L0WA 5EPJA 2UUAQ 1DJRD 1ET6A 3HKZB 1UEBA 4YWKA 1XPOA 1NR4A 1Q12A 1G51A 2JA6G 1SYBA 5J39A 5CMDA 4Y7NH 5D3DA 3W1GA 4JI4L 2Q8TA 3Q23A 3U4VA 5C0XI 1YI2A 2BDOA 3K59A 4EQ5A 2ZM6L 3CAMA 1E22A 2VQFL 1IXRA 2FMCA 2K03A 1I4PA 3TZUA 1X3QA 3AQQA 3HOWB 2Q2IA 4XYQA 2F0LA 3L3OC 4NXNQ 3KF6B 1WTPA 1HFGA 2L15A 3NQIA 5ELBA 2X6LA 1RL2A 2VUMG 3TP6A 2UXCQ 2E2JH 3OHXC 4A3MH 1XPUA 2EY5A 3HOUH 2RA4A 3OW2A 1MJEA 1WTWA 1YHQA 4GOPC 4HIMA 5KNDA 3CPWA 4IJHA 1PTOC 3FHWA 1HA5A 2K28A 1RDPD 4A3DG 1R4QB 4CKBA 2SOBA 1MSHA 3PCOB 1AE3A 1BBWA 4FP5D 2N55A 2M00A 1TWAB 4LFAQ 2A6HC 5TSSA 3PUYA 5I6WA 1XNQQ 3C3LA 1GUGA 4K2KA 3E3XA 4JBMA 3P75A 1Q81C 4DV7L 1NMFA 2WV6D 5HGQA 4UDUC 2VUMH 1Y1WB 4KKTA 2Z0SA 2LS01 1LM0A 3KYHC 3DLLA 1BUVT 4ZLTF 1IYUA 1F77A
chains in the Genus database with same CATH topology
1YNJC 2B2UA 4XTCS 2EJGC 2WIIB 4P2CB 1BR9A 2IW3A 2XWBB 3OMGA 5A2QL 1LABA 1U4LA 3GP7A 3GTLB 3CQZB 1F2YA 3DWQA 2IX0A 3V2TA 2CVRA 2IT1A 5BN5A 3S1NB 1A6XA 3K0YA 5EQ0A 5CV7A 1G91A 3QB3A 1A3VA 3GTQB 1OXTA 3PIP3 2A6ED 4CJ1B 3S9WA 1I4XA 1D5XC 2JP1A 3QO2A 3JAME 1PTOB 1Y8PB 2MGSA 1CA6A 3V05A 4DAYA 2IL8A 4A3IB 3QIAA 2HCIA 1SNDA 4C3HB 1VMPA 1KNAA 1XX8A 5FLXE 3GTJB 1JORA 1LT4D 4F8MA 4OO1G 5CYUA 5EKIA 4F7XA 3I4MB 2SEBD 5JPMC 2EJMA 2BA1A 4JK1C 4FXKC 1GHKA 3E6ZX 2B2UC 4G57A 3HOZB 1EY6A 1S5DD 2NVYB 4A3EB 4IUVA 2OEOA 3SHLA 4RWSC 5C5LA 5C44B 1QOHA 1F9PA 4IZ8A 5J1ZA 1PFNA 4HCSA 1JE4A 1JWUD 3X3MA 5FK9C 4OO1H 3BDCA 3L9AX 5D14A 1CTMA 3SXHA 2AQ1B 1B3AA 3K7AB 5ELFA 2NB0A 1HQMC 4HAEA 2IPKD 1PFMA 1LTRD 2DY8A 3VA7A 3LNNA 3HG9A 3SK4A 1O7ZA 2BA0A 1TVXA 2PCFB 1BO0A 2IJ0A 1ZYRD 5C4ZA 3U9SA 3J80L 1D5MC 1ENAA 4MIUA 4QUCA 5DNFA 4EVOA 2QILA 4C3IG 3KLSA 2B2VA 1FD7D 4FNFA 3IKJA 4IALA 1JC7A 3SEBA 2XSCA 3NUCA 1DYQA 1IYVA 2RDGA 1Y69U 4ZKBB 2K32A 2C5CA 5CBAE 2WACA 1G291 5M5WB 1HUNA 2HUGA 1EQTA 3GD7A 3N52A 1RD9D 1QJOA 3S2HB 1AN8A 5A35A 1R9TB 5LL6S 1S4ZA 4XXEA 4BS9A 3PUZA 3OIQA 1V1PA 3D4DA 2Z4HA 5I4DA 2TSSA 3J7YW 4CKCA 3QG1A 1O7LA 2A69D 4FXGC 1CFMA 2J4XA 1NUCA 1QCBD 2MHVA 3GO5A 2B2VC 2ZXPA 5EJWA 2F0PA 1H9SA 4J6HA 4ABNA 1WTQA 1R4PB 3PUVA 3V96A 1O80A 1EZ8A 3R8BA 1PDQA 1EU3A 4AYBB 1Q1BA 5IGBA 3NWSA 1D1IA 3D3RA 1BBXC 1GHJA 4QCLA 4C3JG 1S5ED 3LWEA 3DHQA 4A3GB 3VR4A 1RTNA 1LT5D 3A7AB 1GUNA 1W6KA 3R2TA 1KABA 4NW2A 3HRZC 1J8IA 3D4WA 5JAVA 4XT1B 3ERQA 1KDBA 4BY1B 1DCZA 1ET9A 1EY9A 1STEA 2D9UA 3DEPA 5C0XH 3S1QB 3AMUA 5EBDA 2A5HA 2KECA 1EQVA 1DOLA 5KYIA 4DXFA 3T13A 3BZDB 2EYMA 1BCPF 2B2YA 4G7OC 1A3UA 1K8MA 2PZTA 1B2TA 1AZPA 4PMWA 4DF7A 3AB9A 1EY4A 2F0KA 4K2LA 3H0GB 5JVG3 3W2DA 2BCOA 5G3LD 4Y7NB 2OT2A 4B9XA 2Z8LA 3ND8A 3I4NB 2XRQD 4FF2A 4RGTA 2A6EC 3BYTB 4KHZA 4GZYC 1K83B 3EA6A 1ENFA 1LTID 2F0GA 4ODGA 5M5YB 1ENCA 2XWJB 1RKNA 1EYCA 5C4HA 4A3MB 2QF7A 1TS5A 5FOBB 4DNTB 2K5QA 2G9DA 1PZJD 1KDAA 1PLFA 4E6IA 4V190 1EY0A 2E74C 2E75C 1VF5C 4C56C 5JEAJ 3TSSA 3FPPA 3BG3A 3DM1A 1MI2A 2RDHA 3EQLC 1H9SB 2X69A 1A2UA 4M8AA 3J7AV 1SXTA 5IGEA 4Z9CB 4H0LC 1QILA 3MC0B 1ILPA 1J9OA 2JEAI 3FVQA 4NP5A 2E2DC 3EJIA 2KCNA 1SYDA 1EWHA 2MP1A 3DWAA 1HQRD 1PRTD 2YU9B 4XYOA 4Q5VA 3VA5A 3RD4A 1ESRA 3GTGB 1H9JA 4OGQC 5K5PA 4WJWA 4A3JB 1AZQA 1TIID 3OWEB 2CW0D 1WTOA 4NKLA 1D1KA 2EDGA 2WINB 3IFDA 5KEEA 3S15B 1AFPA 3K5LA 1A2TA 1TY2A 1B9NA 1TT2A 4QF4A 1ILQA 1ZYRC 1GUOA 3MZ5A 2JYOA 4RKLA 1T5EA 3TDQA 2IWHA 1D6EC 2KHSA 1PZKD 4KK7A 1B53A 3UI2A 1MGSA 1F9SA 2H4OA 3I91A 5J22A 2G9HD 1WVLA 2XVSA 1AP0A 1H9KA 1STHA 3VR6A 3SVMA 4ULLA 5DM73 3MAQA 4LJZC 1G6ZA 1RHPA 1STBA 2FFKB 3QWNA 1VDZA 4HTHA 2IX3A 3R2IA 2D5DA 4OHJA 4A3BB 3OIPA 4X3TA 1Z6HA 1TWGB 4IURA 2LMCB 4XIGS 4RCNA 1DZ1A 4NDXA 1WD0A 4BY7B 1QNUA 2KEDA 5T1GA 1OO9B 3VR5A 5M9OA 1KAAA 1L0YB 3Q6SA 1GUSA 3MVVA 4IUTA 1RCVD 1TU2B 1S5FD 1CA5A 4KHVA 3RLFA 5K36G 4HMIA 1A3TA 3M7NA 5E1FA 2A69C 2EVBA 4K8IA 4IUQA 3A8IE 1A15A 1F9RA 2TMPA 1GJXA 4RKBA 3J81L 1EEFD 2JSOA 4B9WA 5D3IB 1Q1EA 5EPKA 2A68C 2NTTA 2WKCA 2F0OA 1XXGA 2Z4IA 5E3FA 2A74C 1TKWB 2AQ2B 3Q24A 2PW5A 1B9MA 2R61A 4QMGA 2PO4A 3M4YA 5K36H 2F0WA 3HOXB 3A55A 4BA1I 1TWHB 3RZDB 2EY2A 4DK1A 4OL7A 1SEBD 2PZUA 4PQXA 3ONAB 2RVLA 3R3OA 3I8ZA 3TN2A 2B63B 2MJ8A 4OIJA 1BOSA 2V4DA 1O7YA 4RA8A 4CKEA 2B2WA 3H94A 1EU4A 4A3FB 1RTOA 4ME5A 1STYA 3BVZA 2WAQB 1BNZA 2NZ1D 1PYWD 3SE0A 2AUKA 1B50A 3URYA 1TS2A 2XRSD 5C3WA 3NTHA 1SYCA 5M5XB 2R6GA 5IODA 2EY6A 2KA7A 2XNAC 1EYDA 4X3SA 1ML0D 3P1HA 1PTOF 4DU9A 1OXXK 1SAPA 1W6JA 1EZ6A 1HPCA 1HA6A 1KDCA 2FJ2A 2R93B 5I9PA 4PNYA 1EIGA 3NHHA 1STGA 2JA8B 2WKDA 1DD2A 3VYUA 3AU7A 2BDNA 1U9RA 5IT9L 2IX1A 2E76C 4K6LA 2B2WC 1EL0A 1E2ZA 2A73B 4O1NA 3NXWA 1SFOB 4RCOA 3J81E 4G7HC 4YIJA 1WTVA 1Y1VB 4TKOB 1DOKA 5A2QE 1Q90A 5EPLA 3NWTA 1EY7A 2EYFA 5CBEE 1CZGA 4K5XA 3KBGA 1SYEA 3OMCA 3PO3B 4FXDA 5KGUA 1QB5D 4C3HG 1ICWA 1I6HB 1UNSA 4RGOS 1CQVA 1U4MA 2SNSA 1PRTC 3LWUA 4HCEA 3EFXD 3QOJA 2DY7A 3DWPA 4QB4A 1I50B 4KN7C 3T53B 2CW0C 1SE2A 2D2CC 1JQYD 2KEEA 1JOKA 3C1EA 1C8CA 3I70A 3K6OA 1PTOH 1FNVA 2L11A 3OPOA 2HCCA 4IFDJ 1I4HA 1FR3A 1SJED 4CGYB 3Q22A 1PZID 3VR3A 2Q8IB 3GTOB 5DAUA 5M3MB 3DMUA 5G3LF 1OXSC 3O13A 4DA2A 1SSOA 2MUYA 2WP8J 4ZK9B 1NAPA 3GV3A 3M7GA 3NQTA 3I4LA 3S1RB 4LAAA 1JICA 2LFNA 2PYKA 3K58A 1JCKB 5DEHA 2F3WA 1OXUA 2KJXA 3H91A 2L4NA 2A68D 1CHQD 1PRTB 4KJNA 2F03A 2VB2X 4HMJA 2FMMA 3NP8A 1XTCD 3KF8A 2K5WA 2B2TC 5I9OA 4R8IA 1II3A 5I2YA 3J7AF 1C4QA 4FF4A 1Y8NB 2M9VA 4ZYSA 4WFN3 2NWGA 1STNA 2F0EA 3R93A 2XIWA 3W3AA 3L7ZC 4XQQA 1IL8A 4RGMA 1SE3A 4DNRB 4KKUA 2F0UA 2ID0A 3TZDA 3IAYA 5E4WC 5JJZA 3MA2B 3A7LA 3J80E 5DM63 2ZXRA 5IGDA 4K6DA 1S5BD 5EBCA 3GTKB 3TBIB 5KYLA 2ENBA 4ZQ3A 3NBHA 1HUMA 2AWOA 2I46A 2RKSA 1LACA 5JEAG 1LTBD 4H44C 1DXMA 1XWEA 2EZVA 3K5OA 3H09A 3HS0C 3KLSX 5ELCA 1EIHA 2EOTA 3LX0A 3BDLA 4FVMA 1S5CD 3T16A 4C1NK 2PNRC 1WD1A 1MSGA 4J1MA 3E5SA 1HTPA 3PV0A 3FMCA 4UAIA 2F0NA 3NE5B 2KVMA 5FKAC 4IUUA 4WRDA 4S3SA 4HEDA 1D5ZC 2LY7A 1B4OA 3MXPA 1EFID 3WDNA 4J8QA 1CZWA 1JOOA 5C0XJ 3KUPA 2R3ZA 1F2ZA 2NN6I 4C1NI 3CHBD 5BN3A 2E2JB 1LTSD 3WOEA 4CBVA 3HOUB 4L8JA 2F0SA 2JA6B 1PFBA 1NR2A 2O4XA 3VR2A 3HZXA 1UEAB 2QKIC 2EYLA 4Q0FA 1YNND 2F0HA 4IUPA 2NTSA 2EXZA 1WTRA 4CHTB 3A8JE 4KMUC 2L12A 2PZWA 3FRPB 2GA4B 2VUMB 3NSWA 1FYCA 1BXTA 5COYA 1I4QA 4H13C 1HCZA 3G7LA 3HGBA 3A54A 4HSPA 2VNUD 1CI3M 3TP7A 2DNEA 4N9PA 1C48A 2K01A 2L5TA 1UUPA 1ZKOA 4A3DB 1G2TA 1SJHD 1HXYD 2HQEA 1IW7D 3MHBA 3C2PA 3PUXA 1EEID 1Q3LA 3DXJC 1DOMA 5CORA 4PV1C 3VYRA 3D4RA 3TP5A 1NSNS 4G4KA 5KRUA 2EPBA 2EYHA 1TS3A 4ID6A 4ZAIA 4MN3A 1ZXTA 5LHY1 4A3KB 1ZEQX 4KY6A 3M4OB 1AEXA 2Q8RE 2E2HB 2HDLA 4EQOA 1CT1D 3JAML 5KIXA 5CV4A 4PMBA 3N6RA 1DM0B 2JEBI 2EE1A 5EKLA 3PO2B 1MD2D 1WCMB 2K04A 4F88A 2PW7A 3CRLC 3M3YB 1M8AA 5D65A 2L1BA 5FLXL 3D8GA 1TWFB 1LT6D 4RHRA 1M4VA 2R92B 1G8ZD 2D62A 4FO2A 3I73A 2JA7B 1IKLA 2FINB 3BVGA 3NPPA 1I4GA 4DK0A 1B1ZA 3MXNA 4XQNA 1AW7A 3SK5A 4RAUC 2AQ3B 1HHVA 4TRDA 3S1MB 1Y8OB 1CM9A 5E4XA 1VF7A 3RMHA 4I7ZC 2F0MA 5IGGA 5I6YA 2ICEC 4R8NA 5HGTA 3VYSA 2AUJD 5JVH3 4DXGA 2R7ZB 4HN7A 2EY1A 2NVQB 5IOCA 1SYFA 3NTKA 3P7JA 5CV5A 3MWYW 5T1IA 2JA5B 3DEOA 1Z47A 4HR7B 3FEWX 4KTAA 2F4IA 2PQEA 1EOTA 2F0IA 1X3PA 4K14A 2K5DA 3S17B 3GTPB 3NTIA 1FNWA 4IN3A 2K7VA 5C5MA 2Y0SB 5IIFA 1GUTA 4BBRB 4IUNA 1VCIA 2BE5D 3MTSA 5C3EB 2EYOA 2EYPA 1GXDC 3KLRA 3GTMB 3U9OA 1H9MA 1TY0A 1QE6A 4CJ2C 5FO8B 3CU7A 4L63B 3F2UA 3MEHA 1NCVA 4CJ0B 4BA2I 3WOFA 1D2BA 4X3KA 4HSVA 1SMYD 4EQPA 2VB3X 1GUWA 2N88A 4RFBA 1O78A 2YYZA 4ZRZA 5EGTA 2EJFC 4QUFA 1CHPD 1RF2D 5ELEA 4C3IB 4U673 1FGBD 4KKSA 4XDXA 4A93B 3S2DB 3T51B 1BDOA 3A8KE 3EROA 3HP3A 1F2MA 3I90A 3SK6A 3SR1A 4EQNA 3FPUB 1I4RA 4C2MB 2L9HA 2C9OA 1B44D 5CC4A 1F2LA 3A56A 4X3UA 5ELDA 3ITPA 3CKIB 5FO7B 3OWFA 1E2VA 1SDFA 2SDFA 4KI0A 5KNBA 2J7ZA 4IFDG 3OW7A 1H9RA 1LTAD 2X6GA 2I07B 5IGCA 3I3CA 1LO5D 1HRJA 1STAA 1SNCA 2Z1CA 1DONA 1LV9A 1E0BA 2M2LA 1BF4A 2XN9C 3HOYB 2NN6G 3K57A 1EY5A 1TWCB 3PIO3 1V8QA 2L0CA 3M85A 1YNNC 3HOVB 1V43A 4RGNA 4KJOA 3S14B 4RHSA 3GV6A 2PPBC 2QDBA 4IFDH 1RODA 4O42A 4FF3A 2OXPA 1QG7A 4N9TA 2B39A 5ISRA 3EVQA 4U68A 4K5VA 1QWYA 2O5JC 1MBYA 4C3JB 1Q8IA 4M1UB 1U4PA 3Q0AA 5CV6A 5M3FB 3P20A 4KN4C 5CV8A 2E2IB 2AWNA 5CGKA 2NN6H 3G6JB 2B2TA 4KD4A 3RZOB 2KQ3A 3SK8A 3T56B 1KNEA 1TQOA 3S16B 3X3NA 1PMRA 1QNKA 1IW7C 3C1FA 3BVMA 1CQFA 1IHZA 3GQBA 2H1EA 2ICIA 1EY8A 1BCPC 2RBMA 1XYIA 1SNOA 1IKMA 3BS1A 2ZT9C 1RJTA 1T5XD 2QCPX 2FHTA 5BN4A 4TSSA 2JXMB 5JOBA 5F2DA 4K5WA 4F87A 4EGVA 1PTOD 3D6WA 3OSOA 3H6MA 4K8JA 4NMZA 2K1BA 4WORA 2NVXB 1CK1A 3NK9A 3DUZA 2NVTB 2A6HD 4MHEA 4KY5A 2F0DA 1GOZA 4B08A 1ONLA 1SNPA 2J0TD 4V0BA 1SYGA 3MFGA 1JR0D 2F0TA 4BBSB 1TR5A 1YNJD 1KLGD 1V1OA 5I2XA 3I72A 4QIWB 5C4XB 3RUZA 5IT9E 2KCCA 3BDOA 4ILWA 3H3VC 3ND9A 1EWCA 5EKKA 4KV6A 4LMQD 5AFWA 5CV9A 5C0XG 3FKIB 4XT3B 3TP8A 2BOSA 3D31A 3BYYB 1BCPB 5LL6X 1LT3D 2RQXA 2OF1A 3NBIA 1LTTD 4DFAA 3OOCA 1SNMA 2JE6I 4JBWA 2O5IC 1LLRD 4XQJA 2PMZB 1PRTF 1JOQA 3K5MA 1VMCA 1F9QA 2MPMA 1L0XB 1U4RA 1G2SA 4OO1I 2WB1B 2KOLA 3KBXA 2F0JA 3CRKC 1JWSD 4BWGB 3KK7A 4KD3A 1KTKA 4ZKCB 4DN4M 4I65A 2CQAA 2KUMA 1X32A 1SBBB 1EYAA 2K05A 3FDTA 1K8OA 2BE5C 2K6AA 4IFDI 1I6VC 1JB3A 3MXGA 5KNCA 3VYTA 1HFNA 2O2LD 3D6CA 5JEAH 4RH6A 1BQQT 1OXVA 4ZUJA 1PXUA 1SMYC 3HEJA 1TS4A 2LKVA 2K33A 5HURA 2QEJC 5CR3A 4ZUIA 2B8FA 3T4AC 2SNMA 4R9WA 1SE4A 3C46A 5C3XA 3MXUA 1JWMD 4H7BA 3PUWA 3K5NA 1LTGD 4FF1A 1V1PB 3ZYYX 2NBFA 2B8GA 2DN8A 4DGZA 2CHBD 2F0FA 3SDZA 5C4JB 2B2YC 3TMEA 4IQZA 2ZXOA 4FYDA 1WTXA 1HTLD 2RSOA 4LK1C 2RSNA 5IGFA 2L55A 1SNQA 5NUCA 5JPNC 3IL8A 2F3VA 4DAVA 1I3QB 3QJYA 4DAPA 4G7ZC 2F1MA 2NUCA 2F0VA 2HDMA 5C6AA 4KY7A 1UAPA 3IFTA 1BCPD 1KLUD 4PMCA 4L6TB 1ESFA 2F0QA 1Z7TA 2VXWA 2DNCA 3QOLA 1FNUA 3MFYA 2RDFA 3PMFA 4TQUS 1E2WA 2NYZD 5FO9B 2EYJA 3E0JA 4OIKA 5EPJA 1DJRD 1ET6A 3HKZB 1NR4A 1Q12A 1SYBA 5J39A 5CMDA 5D3DA 2Q8TA 3Q23A 5C0XI 2BDOA 3K59A 2FMCA 2K03A 1I4PA 3TZUA 1X3QA 3HOWB 4XYQA 2F0LA 3L3OC 1WTPA 1HFGA 3NQIA 5ELBA 2X6LA 3TP6A 3OHXC 2EY5A 2RA4A 1WTWA 5KNDA 1PTOC 1HA5A 2K28A 1RDPD 1R4QB 4CKBA 2SOBA 1MSHA 4FP5D 2N55A 2M00A 1TWAB 2A6HC 5TSSA 3PUYA 5I6WA 3C3LA 1GUGA 4K2KA 3P75A 2WV6D 4UDUC 1Y1WB 4KKTA 2LS01 1BUVT 4ZLTF 1IYUA 1F77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOS A;  4P2C B;  1CZG A;  4ULL A;  2XSC A;  1DM0 B;  3MXG A;  1C4Q A;  1C48 A;  1R4P B;  2GA4 B;  1D1K A;  4M1U B;  1QOH A;  1QNU A;  1CZW A;  1D1I A;  2C5C A;  1CQF A;  1R4Q B;  2BOS A; 
#chains in the Genus database with same CATH topology
 1YNJ C;  4A3K G;  4R4I A;  2YU9 H;  2B2U A;  4XTC S;  2EJG C;  2WII B;  4P2C B;  1BR9 A;  2IW3 A;  2XWB B;  3OMG A;  3F2C A;  5A2Q L;  2VQE Q;  1LAB A;  1U4L A;  4YCV A;  3GP7 A;  3GTL B;  3CQZ B;  4A3D H;  1F2Y A;  3I7F A;  3DWQ A;  3PO2 G;  1WCM G;  2IX0 A;  3V2T A;  2CVR A;  2IT1 A;  5BN5 A;  3MEF A;  3S1N B;  5BR8 Q;  1A6X A;  3K0Y A;  3S15 H;  4I7A A;  2OQ0 A;  5EQ0 A;  5CV7 A;  1V1Q A;  4LUV A;  1G91 A;  3QB3 A;  2NZH A;  2UU9 Q;  1A3V A;  4LF6 Q;  3GTQ B;  1OXT A;  2AHO B;  3PIP 3;  4DR5 L;  1N34 L;  1HJP A;  2A6E D;  4CJ1 B;  3S9W A;  2CKZ B;  4GOP B;  1W2B A;  1D7Q A;  2YTX A;  1I4X A;  1D5X C;  1X3G A;  2JP1 A;  3QO2 A;  5JJI A;  2JA7 G;  3JAM E;  1PTO B;  1Y8P B;  1PV4 A;  2MGS A;  4A3K H;  1CA6 A;  1PH6 A;  3V05 A;  1NMG A;  4DAY A;  3M4O H;  2IL8 A;  4A3I B;  1N36 Q;  4GLV B;  1WJJ A;  2E2H H;  3QIA A;  2HCI A;  1SND A;  4C3H B;  1VMP A;  4JI0 Q;  1KNA A;  1XX8 A;  3U58 A;  5FLX E;  3GTJ B;  1JOR A;  3PO2 H;  1LT4 D;  4F8M A;  4JPB W;  4OO1 G;  5CYU A;  5EKI A;  4DK6 C;  4F7X A;  3I4M B;  2SEB D;  5JPM C;  3M3Y H;  3OYY A;  2EJM A;  1K3R A;  2BA1 A;  2JQO A;  4GKJ L;  4JK1 C;  2XTI A;  4FXK C;  4JC0 A;  2R7Z G;  2BH8 A;  2VS1 A;  4B3R L;  2R92 H;  1GHK A;  3E6Z X;  2B2U C;  4A3B H;  4G57 A;  3HOZ B;  2Q2T A;  1EY6 A;  1S5D D;  2JA7 H;  3M4P A;  2NVY B;  4A3E B;  1FGU A;  1TWG H;  1I94 L;  2JA5 G;  4IUV A;  4LW1 A;  2OEO A;  3SHL A;  4IPD A;  4RWS C;  5C5L A;  5C44 B;  1QOH A;  2CH4 W;  1F9P A;  4KLK A;  4IZ8 A;  4BY7 H;  3CMA A;  4UY8 C;  4L5S A;  1NE3 A;  5J1Z A;  4DUY Q;  1PFN A;  4HCS A;  1JE4 A;  1JWU D;  3S1M H;  3X3M A;  5AJ3 L;  3H3V I;  3EIV A;  5FK9 C;  2Y0S G;  4OO1 H;  3BDC A;  3L9A X;  5D14 A;  4BBR G;  1UE5 A;  5C3E G;  1CTM A;  3G48 A;  1VQJ A;  3SXH A;  2AQ1 B;  1B3A A;  3K7A B;  1N9W A;  2NB0 A;  5ELF A;  2NVQ H;  1Q46 A;  1SR3 A;  1HQM C;  4HAE A;  1YIT A;  2IPK D;  3CCS A;  1PFM A;  1LTR D;  2H5X A;  1SE8 A;  4X64 Q;  2DY8 A;  3VA7 A;  1JE5 A;  4IO9 A;  2JA5 H;  3LNN A;  3HG9 A;  1O7Z A;  2BA0 A;  3SK4 A;  1J5E L;  1TVX A;  2PCF B;  1XMO L;  1BO0 A;  2IJ0 A;  1ZYR D;  5C4Z A;  3U9S A;  1EIF A;  1TXY A;  3J80 L;  1SRU A;  1D5M C;  2B3G A;  1ENA A;  4MIU A;  3S17 H;  4QUC A;  2EXD A;  3GTP H;  5DNF A;  4EVO A;  2LXK A;  1B7Y B;  2QIL A;  4C3I G;  4B3M Q;  3KLS A;  2B2V A;  2D0O A;  1N32 Q;  5C3E H;  2ZTC A;  1FD7 D;  4FNF A;  3IKJ A;  4IAL A;  3J81 c;  1JC7 A;  3SEB A;  2XSC A;  4A93 G;  1TWH H;  3GTM H;  1EUJ A;  4B3S Q;  3NUC A;  1DYQ A;  1IYV A;  2RDG A;  1Y69 U;  1YHB A;  4ZKB B;  2WAQ E;  2K32 A;  3CW2 C;  2C5C A;  3L0O A;  1L1O A;  4DV1 L;  5CBA E;  2WAC A;  2K14 A;  1VQP A;  1G29 1;  5M5W B;  2UUC Q;  2UXB L;  2CWP A;  2HUG A;  1HUN A;  2K4K A;  1EQT A;  4A3F H;  3GD7 A;  1B70 B;  4JI6 Q;  3N52 A;  1IYJ B;  1RD9 D;  1QJO A;  3S2H B;  4C3I H;  1AN8 A;  1VQD A;  5A35 A;  4YHH Q;  1R9T B;  5LL6 S;  1S4Z A;  2K5H A;  4XXE A;  4BS9 A;  5C44 G;  4R4C A;  1E1T A;  4A93 H;  3PUZ A;  1IZ6 A;  2JA9 A;  3OIQ A;  1V1P A;  4X62 L;  3D4D A;  2Z4H A;  1WFQ A;  5I4D A;  2TSS A;  3J7Y W;  4CKC A;  1PH1 A;  1MJC A;  3QG1 A;  1O7L A;  3HOY G;  2A69 D;  4C2M H;  3ERS X;  1J6Q A;  4FXG C;  1CFM A;  3UDG A;  2J4X A;  1NUC A;  1QCB D;  3HOV G;  2PNH A;  1NBW A;  2MHV A;  3GO5 A;  2B2V C;  1XMQ L;  2ZXP A;  5EJW A;  1IBM Q;  1O7I A;  2F0P A;  2AMC B;  1H9S A;  3CCJ A;  1K0R A;  4J6H A;  3ZJY C;  2WFW A;  4ABN A;  1WTQ A;  2R93 H;  1R4P B;  3PUV A;  3V96 A;  1O80 A;  4AQY L;  1E1O A;  4O0A A;  1EZ8 A;  2DJG C;  3W1B A;  3R8B A;  1PDQ A;  1EU3 A;  4AYB B;  1Q1B A;  1FJG L;  5IGB A;  3NWS A;  1D1I A;  2QW7 A;  3D3R A;  1BBX C;  1GHJ A;  1L1O C;  4C3J G;  4QCL A;  1S5E D;  3LWE A;  3DHQ A;  2UXD L;  5M3F G;  1BKB A;  4A3G B;  1JB7 A;  3VR4 A;  3AEV A;  1RTN A;  1LT5 D;  3A7A B;  3Q8D A;  4LF5 Q;  1GUN A;  4LNQ A;  1W6K A;  1GD7 A;  1TWC H;  3R2T A;  1KAB A;  4NW2 A;  3HRZ C;  1J8I A;  3D4W A;  3CME A;  5JAV A;  4KHP Q;  3HOV H;  4XT1 B;  3J7A 5;  3KFU A;  3ERQ A;  1KDB A;  1YEZ A;  4WJ3 M;  4DV4 Q;  3S14 H;  5IT9 c;  1M1K C;  4BY1 B;  1DCZ A;  1ET9 A;  1EY9 A;  1STE A;  4QQB X;  2D9U A;  3DEP A;  5C0X H;  3S1Q B;  3AMU A;  3G4S A;  4DR6 L;  3PO3 H;  5EBD A;  2A5H A;  5J3B A;  4C3J H;  2KEC A;  1EQV A;  1DOL A;  4UHV A;  4DXF A;  5KYI A;  3T13 A;  3A5Z B;  3K8A A;  2HD3 A;  3BZD B;  4JI1 Q;  5M3F H;  1HNZ Q;  2EYM A;  4JW0 A;  1BCP F;  2UXC L;  2B2Y A;  3J80 c;  3J81 i;  2ZJP A;  4G7O C;  1HNX Q;  1A3U A;  2HQL A;  1K8M A;  4TVA B;  2PZT A;  2F4V L;  1B2T A;  2R7F A;  3RZO H;  1AZP A;  1NY4 A;  3AYH B;  1YJ9 A;  4PMW A;  3CC2 A;  4K0K Q;  4OX9 Q;  4DF7 A;  3AB9 A;  3S16 H;  1EY4 A;  2F0K A;  4K2L A;  3H0G B;  3TRE A;  5JVG 3;  5GAD C;  3W2D A;  2BCO A;  2K75 A;  5G3L D;  3PIP A;  1L1O B;  4Y7N B;  2OT2 A;  4B9X A;  2Z8L A;  3KF6 A;  3ND8 A;  4LFA L;  3I4N B;  3EN2 A;  2XRQ D;  1XNQ L;  3NEL A;  1E24 A;  4FF2 A;  4RGT A;  1ICF B;  5E7N A;  2A6E C;  1HZ9 A;  2JK8 A;  3BYT B;  4KHZ A;  4BBS G;  4GZY C;  1K83 B;  3EA6 A;  1MHW C;  4X66 L;  1ENF A;  1LTI D;  5C4X G;  2F0G A;  4ODG A;  5M5Y B;  1ASZ A;  1ENC A;  2XWJ B;  1PA6 A;  3K80 C;  4OEM B;  1RKN A;  1EYC A;  5C4H A;  4A3M B;  2KHI A;  4PZ6 A;  4IOC A;  2QF7 A;  2NVX H;  3TQY A;  4YWL A;  1TS5 A;  4P71 A;  5FOB B;  2MFI A;  2NVT H;  2FXQ A;  2K5Q A;  4DNT B;  2G9D A;  1PZJ D;  1KDA A;  2DJF C;  4B3T Q;  1PLF A;  4E6I A;  2CFM A;  4V19 0;  1EY0 A;  2E74 C;  3KJP A;  4OWW B;  2E75 C;  4CDD C;  4HJ7 A;  2I0Q A;  1VF5 C;  4C56 C;  5JEA J;  3TSS A;  3FPP A;  1U0L A;  1PHJ A;  4LWC A;  3BG3 A;  1JMC A;  1D8L A;  2UU9 L;  3DM1 A;  1MI2 A;  2RDH A;  4LF6 L;  3EQL C;  1H9S B;  1Q82 C;  2X69 A;  1A2U A;  4M8A A;  4LF9 L;  5C4X H;  3J7A V;  2QGQ A;  1SXT A;  5IGE A;  4Z9C B;  1Q8K A;  2WB1 G;  1VQ4 A;  4H0L C;  1QIL A;  3MC0 B;  4POG A;  1ILP A;  1J9O A;  2JEA I;  3FKI H;  3FVQ A;  3J7Z C;  2AKW B;  4NP5 A;  2E2D C;  3EJI A;  5LMN Q;  4YCU A;  4QJF A;  2KCN A;  1SYD A;  1EWH A;  1VQF A;  1N36 L;  2MP1 A;  3DWA A;  1HQR D;  4X65 Q;  4LF7 Q;  1PRT D;  2YU9 B;  4XYO A;  4Q5V A;  3VA5 A;  4JI0 L;  1NNX A;  3RD4 A;  1UE6 A;  1ESR A;  3GTG B;  1H9J A;  4OGQ C;  5K5P A;  1BBU A;  2WB1 E;  4WJW A;  4A3J B;  1AZQ A;  1TII D;  3GTK H;  3OWE B;  3PF5 A;  2CW0 D;  1WTO A;  4NKL A;  3UE0 A;  5IP7 H;  1GVP A;  1D1K A;  4LFB Q;  1MKH A;  2EDG A;  2WIN B;  3IFD A;  5KEE A;  3VDY A;  3KDF B;  3S15 B;  1AFP A;  3PQI A;  3K5L A;  1A2T A;  4PZ8 A;  1KQS A;  1CUK A;  1TY2 A;  4JG2 A;  3T1H L;  1B9N A;  1TT2 A;  4QF4 A;  1ILQ A;  1ZYR C;  3PGZ A;  3NBH B;  2Z9H A;  1GUO A;  3MZ5 A;  2JYO A;  2HHH Q;  3J80 i;  4RKL A;  1Y14 B;  1T5E A;  1VQG A;  3TDQ A;  2IWH A;  1D6E C;  2KHS A;  1PZK D;  4KK7 A;  1B53 A;  1C9O A;  3UI2 A;  1MGS A;  1F9S A;  4HJ8 A;  2H4O A;  3I91 A;  5J22 A;  2G9H D;  1WVL A;  2XVS A;  1AP0 A;  1H9K A;  3A0J A;  1STH A;  3VR6 A;  3SVM A;  4ULL A;  5DM7 3;  3MAQ A;  4LJZ C;  3H3V H;  3CCR A;  4LF8 Q;  2MQH A;  4GS3 A;  1G6Z A;  1RHP A;  1STB A;  2FFK B;  3QWN A;  1VDZ A;  1EFW A;  4HTH A;  2IX3 A;  4JBK A;  3R2I A;  2D5D A;  4PZ7 A;  4X64 L;  4OHJ A;  1HZC A;  4A3B B;  3H15 A;  3OIP A;  4LUZ A;  4X3T A;  1Z6H A;  1QVC A;  2LSS A;  1X3E A;  5IY0 A;  3CCL A;  1TWG B;  1GO3 E;  4IUR A;  2LMC B;  4XIG S;  2JA6 H;  4RCN A;  1DZ1 A;  1UWV A;  4NDX A;  1WD0 A;  4A75 A;  4BY7 B;  1QNU A;  2KED A;  5T1G A;  2MO0 A;  3UE1 A;  1OO9 B;  3VR5 A;  5M9O A;  1KAA A;  1L0Y B;  3Q6S A;  2UUB L;  1N32 L;  1VQB A;  1GUS A;  3MVV A;  4IUT A;  1X3F A;  4DAM A;  1RCV D;  1QZH A;  1TU2 B;  1S5F D;  4DV6 L;  4GN4 B;  4B3S L;  1CA5 A;  4KHV A;  3RLF A;  3NEN A;  5K36 G;  4HMI A;  1A3T A;  3M7N A;  5E1F A;  2A69 C;  2EVB A;  4A3J G;  4K8I A;  4IUQ A;  3A8I E;  1A15 A;  1K0S A;  1F9R A;  3E9H A;  2TMP A;  2I5H A;  1VQ8 A;  1GJX A;  2UUC L;  4RKB A;  3J81 L;  4UP8 A;  4GN3 B;  1EEF D;  4JV5 Q;  2JSO A;  4B9W A;  5D3I B;  4JI6 L;  1Q1E A;  5EPK A;  2A68 C;  2NTT A;  2WKC A;  2F0O A;  1XXG A;  2Z4I A;  5E3F A;  2A74 C;  4O2D A;  1Q86 C;  1I3Q H;  4GKK L;  3HKZ G;  1TKW B;  2AQ2 B;  3Q24 A;  1HR0 L;  2PW5 A;  2EIF A;  1B9M A;  2R61 A;  4QMG A;  2PO4 A;  2PI2 A;  3M4Y A;  5K36 H;  2Z6B A;  2F0W A;  3KOJ A;  2F52 A;  3HOX B;  3A55 A;  4BA1 I;  1TWH B;  2VZA A;  1IBK L;  4DV2 L;  2EY2 A;  3RZD B;  4DK1 A;  4BXX G;  4OL7 A;  3KJO A;  1SEB D;  2PZU A;  4PQX A;  3ONA B;  3HKZ E;  2DGY A;  2RVL A;  3I4O A;  1H95 A;  3R3O A;  3I8Z A;  3TN2 A;  3HOW G;  2B63 B;  2OTJ A;  2G5D A;  2MJ8 A;  4DKA C;  4JI8 L;  4OIJ A;  1BOS A;  2V4D A;  1O7Y A;  4RA8 A;  3F1Z A;  2B2W A;  4CKE A;  3H94 A;  1EU4 A;  4A3F B;  1RTO A;  3IRB A;  4ME5 A;  1STY A;  4DUZ Q;  3BVZ A;  1WCM H;  2WAQ B;  1BNZ A;  2NZ1 D;  1PYW D;  4P74 A;  4H02 A;  3SE0 A;  1EOV A;  4JI7 L;  2AUK A;  1B50 A;  1TWF H;  1AE2 A;  1XNR Q;  4FDB A;  4OEL B;  1B3Q A;  2OWO A;  3URY A;  5LMN W;  4LF5 L;  3BZC A;  1TS2 A;  2XRS D;  5C3W A;  3NTH A;  1SYC A;  5M5X B;  2R6G A;  5IOD A;  2EY6 A;  2KA7 A;  2XNA C;  1EYD A;  4A3L G;  4X3S A;  1ML0 D;  2ES2 A;  3P1H A;  2CH4 A;  1PTO F;  4KHP L;  4QY7 A;  4MZ9 A;  3HOW H;  3K0X A;  4DU9 A;  1OXX K;  1SAP A;  1EIY B;  4DV4 L;  1Y1W G;  1W6J A;  3A5U A;  1EZ6 A;  2IHF A;  5FLX c;  1HPC A;  1HA6 A;  1KDC A;  1WOC A;  2FJ2 A;  2R93 B;  5I9P A;  4IOA A;  4PNY A;  1EIG A;  1KL9 A;  3CXC A;  4DR7 L;  3NHH A;  3MXN B;  5GQO A;  1STG A;  4JI1 L;  2JA8 B;  2WKD A;  2R7Z H;  1DD2 A;  3VYU A;  3AU7 A;  1HNX L;  2BDN A;  1U9R A;  5IT9 L;  1N8R C;  2IX1 A;  3OTO Q;  2ALY B;  2E76 C;  1TWA H;  4K6L A;  2B2W C;  1EL0 A;  1E2Z A;  2Y0S E;  2A73 B;  4O1N A;  2GN5 A;  3NXW A;  4OX9 L;  2VQF Q;  4ZCK A;  1SFO B;  4RCO A;  3J81 E;  3HOX G;  4G7H C;  4YIJ A;  3D0F A;  1Y1W H;  1WTV A;  1PVO A;  1Y1V B;  4TKO B;  1DOK A;  4DR3 Q;  5A2Q E;  1Q90 A;  5EPL A;  3NWT A;  1YIJ A;  1EY7 A;  2EYF A;  4BBR H;  5CBE E;  1CZG A;  4K5X A;  3KBG A;  1SYE A;  3J81 j;  4A3I G;  3OMC A;  3PO3 B;  4FXD A;  5KGU A;  1QB5 D;  4C3H G;  1ICW A;  3CQZ H;  1I6H B;  1L2F A;  3CPF A;  1UNS A;  4HIK A;  4RGO S;  1CQV A;  1U4M A;  1VQH A;  1KRS A;  2SNS A;  1PRT C;  3LWU A;  4JI3 Q;  3S1N H;  4HCE A;  3EFX D;  3QOJ A;  3I4M G;  2ZTE A;  2DY7 A;  3DWP A;  4QB4 A;  2YV5 A;  1K3B C;  1I50 B;  4KN7 C;  1Q7Y C;  3GTQ H;  1E7Z A;  3T53 B;  4NB3 A;  2CW0 C;  4DR2 L;  1SE2 A;  2D2C C;  1JQY D;  2KEE A;  4R1J A;  1JOK A;  1QUQ B;  3C1E A;  3HOZ G;  3S24 A;  1C8C A;  3I70 A;  3K6O A;  1PTO H;  1FNV A;  4A3E G;  2L11 A;  3OPO A;  2HCC A;  4IFD J;  1I4H A;  3HKS A;  2B29 A;  1FR3 A;  4GLX A;  1SJE D;  2XGT A;  4CGY B;  4A3I H;  3Q22 A;  1PZI D;  3S2D H;  3VR3 A;  1SRO A;  2Q8I B;  4C3H H;  3GTO B;  5DAU A;  5M3M B;  1PH7 A;  3DMU A;  3GTJ H;  4P73 A;  5G3L F;  1OXS C;  3O13 A;  5IYB G;  2A19 A;  2RCF A;  1SSO A;  2MUY A;  4DA2 A;  3WWV A;  2WP8 J;  4ZK9 B;  1CSP A;  1NAP A;  1KRT A;  2JA8 G;  3GV3 A;  3M7G A;  3NQT A;  2R7D A;  3I4L A;  3S1R B;  4LAA A;  2E8G A;  5LMU L;  1JIC A;  2LFN A;  2PYK A;  3K58 A;  1Z9F A;  3HOZ H;  1JCK B;  4IPG A;  4DR1 L;  5DEH A;  2F3W A;  2NVY H;  4A3E H;  1OXU A;  4DR5 Q;  1N34 Q;  2RCN A;  2YTY A;  4MTN A;  2CCZ A;  2KJX A;  3H91 A;  2L4N A;  2A68 D;  1CHQ D;  1VQM A;  2HIX A;  5C44 H;  1PRT B;  4LF4 L;  4KJN A;  1JT8 A;  2F03 A;  5EAY A;  2VB2 X;  4HMJ A;  1EQR A;  1X6O A;  2FMM A;  3NP8 A;  1XTC D;  3KF8 A;  2K5W A;  2B2T C;  3TEH B;  5IYC G;  5I9O A;  4R8I A;  4GLA C;  1PH2 A;  1II3 A;  4YY3 L;  5I2Y A;  1YHA A;  1C4Q A;  2HHH L;  2UUA L;  4FF4 A;  3J7A F;  1Y8N B;  2M9V A;  4ZYS A;  4WFN 3;  3HOY H;  2NWG A;  1STN A;  2F0E A;  4LUO A;  3R93 A;  3W3A A;  2XIW A;  1YNX A;  3L7Z C;  4XQQ A;  1IL8 A;  4DV3 Q;  4JYA Q;  4RGM A;  3K7A H;  1SE3 A;  5H1S E;  4MNO A;  4DNR B;  2Q2H A;  4KKU A;  2F0U A;  2ID0 A;  3TZD A;  3IAY A;  5E4W C;  5JJZ A;  3MA2 B;  1IBL Q;  3A7L A;  3KDF A;  3J80 E;  5DM6 3;  2ZXR A;  5IGD A;  1LTL A;  4K6D A;  1S5B D;  5EBC A;  4LF8 L;  3GTK B;  3TBI B;  2K50 A;  2ASB A;  5KYL A;  2YTV A;  2ENB A;  2CWA A;  3W5O A;  4ZQ3 A;  3NBH A;  1HUM A;  4NXN L;  2AWO A;  2I46 A;  2NZO A;  4HJ5 A;  3KLW A;  1VQ7 A;  2RKS A;  4DR4 Q;  1LAC A;  5JEA G;  1VS0 A;  1LTB D;  5IYC H;  4H44 C;  1DXM A;  1XWE A;  3L2P A;  1K9M C;  2EZV A;  3K5O A;  3H09 A;  3HS0 C;  3KLS X;  2E2I H;  1SN8 A;  4A4I A;  5ELC A;  1EIH A;  2EOT A;  3LX0 A;  3BDL A;  2K52 A;  4FVM A;  1S5C D;  3T16 A;  1CSQ A;  2PNR C;  1X54 A;  4C1N K;  1WD1 A;  1MSG A;  4J1M A;  2CQO A;  3E5S A;  1HTP A;  3PV0 A;  3FMC A;  3RN2 A;  4JOI C;  1K8A C;  3BZK A;  4UAI A;  2F0N A;  3NE5 B;  2KVM A;  5M5W H;  5FKA C;  4IUU A;  4WRD A;  4S3S A;  3RN5 A;  4JBJ A;  1XMO Q;  4HED A;  1D5Z C;  3CD6 A;  3UDX A;  2LY7 A;  1B4O A;  4N8F A;  3MXP A;  1EFI D;  1WYD A;  3WDN A;  3S2H H;  4J8Q A;  1CZW A;  1K28 A;  1JOO A;  5C0X J;  3TRZ A;  1R9T H;  3KUP A;  4CDC C;  2R3Z A;  1F2Z A;  2NN6 I;  4C1N I;  3CHB D;  4LFC Q;  5BN3 A;  4AYB G;  2E2J B;  1LTS D;  3HFZ B;  3WOE A;  3K7U C;  4POF A;  4CBV A;  3HOU B;  1MIU A;  2VQE L;  4L8J A;  2F0S A;  3F2B A;  3AFQ A;  1PFB A;  3F2D A;  3CCM A;  2JA6 B;  4A3G G;  1NR2 A;  2O4X A;  4QIW E;  3VR2 A;  4R4T A;  2VW9 A;  3HZX A;  2RHQ B;  1UEA B;  2QKI C;  3UDI A;  1P8L A;  5BR8 L;  3ULL A;  2EYL A;  4Q0F A;  1YNN D;  2F0H A;  4IUP A;  2NTS A;  2EXZ A;  1WTR A;  1A63 A;  4CHT B;  3A8J E;  4KMU C;  1VQL A;  4BBS H;  2L12 A;  2ZJR A;  2PZW A;  4NPS A;  2K5V A;  2D0P A;  4BY1 G;  1SMX A;  3FRP B;  2GA4 B;  2VUM B;  3NSW A;  1FYC A;  1PH3 A;  1BXT A;  1HH2 P;  3E9I A;  2DUD A;  1VQ6 A;  2PMZ E;  3JC6 6;  1X55 A;  5COY A;  3KF8 B;  5IWA Q;  1I4Q A;  4H13 C;  1HCZ A;  3G7L A;  3HGB A;  3A54 A;  4A3G H;  4CDF C;  4HSP A;  2VNU D;  1CI3 M;  3TP7 A;  2DNE A;  2PQA B;  4N9P A;  1C48 A;  1DGS A;  2K01 A;  1KC8 C;  2L5T A;  1UUP A;  1ZKO A;  4NXM Q;  4A3D B;  1G2T A;  3CCE A;  1SJH D;  1HXY D;  3I55 A;  1PFS A;  3CCQ A;  2HQE A;  1HZA A;  1IW7 D;  3MHB A;  3H0G G;  3C2P A;  1KIX A;  3PUX A;  1EEI D;  4IPC A;  1Q3L A;  1XNR L;  5GAG C;  3DXJ C;  2KBN A;  1DOM A;  5COR A;  4PV1 C;  3VYR A;  3D4R A;  3TP5 A;  1XMQ Q;  3I4N G;  3CC7 A;  1GM5 A;  3S1Q H;  4DV5 Q;  1NSN S;  4G4K A;  5KRU A;  2EPB A;  1U5K A;  1TS3 A;  2EYH A;  4ID6 A;  5ELN A;  1RIP A;  4ZAI A;  4MN3 A;  1ZXT A;  5LHY 1;  4A3K B;  4JI5 Q;  2N49 A;  4R4Q A;  1XPR A;  1FJG Q;  1ZEQ X;  4KY6 A;  4DUY L;  3UDF A;  3M4O B;  2IHE A;  1AEX A;  2Q8R E;  3U4Z A;  2E2H B;  2HDL A;  4EQO A;  2UXD Q;  1CT1 D;  3JAM L;  5KIX A;  5IYD G;  5CV4 A;  1WI5 A;  4PMB A;  3N6R A;  1DM0 B;  2JEB I;  4A3M G;  2EE1 A;  5EKL A;  3PO2 B;  1MD2 D;  1WCM B;  4ALP A;  3HOU G;  2K04 A;  3RLN A;  1KHI A;  3H0G H;  4F88 A;  2PW7 A;  3CRL C;  3M3Y B;  1M8A A;  5D65 A;  1OTC A;  2L1B A;  5FLX L;  3OTO L;  3D8G A;  1TWF B;  4PG3 A;  1LT6 D;  5GRO A;  3I4N H;  4RHR A;  1M4V A;  2R92 B;  4P72 A;  1YVC A;  2JJQ A;  1G8Z D;  2D62 A;  4FO2 A;  3I73 A;  1XJV A;  3TS2 A;  2JA7 B;  1IKL A;  2FIN B;  3BJU A;  3BVG A;  3NPP A;  1K83 H;  1I4G A;  4DR6 Q;  5L37 A;  4DK0 A;  1B1Z A;  5M5Y H;  4DR3 L;  1PH9 A;  3MXN A;  4XQN A;  1AW7 A;  3SK5 A;  3RLO A;  4RAU C;  2AQ3 B;  1HHV A;  4TRD A;  5IYD H;  3S1M B;  4B3M L;  1Y8O B;  1CM9 A;  5E4X A;  1VF7 A;  3RMH A;  4I7Z C;  2F4V Q;  2F0M A;  1E3P A;  5HY6 A;  5IGG A;  5I6Y A;  2ICE C;  4R8N A;  5HGT A;  3VYS A;  4JI2 Q;  2AUJ D;  5JVH 3;  4DXG A;  2R7Z B;  4HN7 A;  4JI3 L;  5C4J H;  2EY1 A;  2NVQ B;  5IOC A;  2P5Z X;  1SYF A;  3NTK A;  3F8T A;  3P7J A;  2I5M X;  1C7Y A;  2C35 B;  1P16 A;  5CV5 A;  3MWY W;  5T1I A;  2HIV A;  2JA5 B;  2IY5 B;  3DEO A;  1Z47 A;  3ULJ A;  1VQI A;  4HR7 B;  3FEW X;  4KTA A;  2F4I A;  2PQE A;  1EOT A;  2F0I A;  3EBE A;  4HIO A;  1X3P A;  1YJN A;  2RF4 A;  4K14 A;  4X66 Q;  2K5D A;  4IPH A;  4YHH L;  1KD1 C;  3S17 B;  5GAH C;  2MNA A;  3ER0 A;  2KCT A;  4A76 A;  3NTI A;  3GTP B;  1FNW A;  4IN3 A;  2KHJ A;  4YWM A;  2K7V A;  5C5M A;  2Y0S B;  5IIF A;  4APV A;  1GUT A;  2MO1 A;  4BBR B;  1PH5 A;  1VCI A;  2BE5 D;  4IUN A;  4DV0 Q;  3MTS A;  5C3E B;  2A8V A;  1HNW Q;  3GTG H;  2EYO A;  2EYP A;  1GXD C;  3KLR A;  3GTM B;  4A3J H;  2E5L Q;  1KXL A;  3U9O A;  1FVI A;  5JJK A;  1JJG A;  1H9M A;  1TY0 A;  1QE6 A;  5JJL A;  1K73 C;  4CJ2 C;  5FO8 B;  1QUQ A;  1JJC B;  3CU7 A;  3G6E A;  4L63 B;  1C0A A;  3F2U A;  3MEH A;  1NCV A;  4CJ0 B;  3T1Y Q;  4BA2 I;  3WOF A;  1D2B A;  4X3K A;  4OWX B;  4HSV A;  4L5R C;  1IBM L;  1SMY D;  4EQP A;  4L5Q A;  2VB3 X;  2R92 G;  1IL2 A;  1GUW A;  4LF9 Q;  2N88 A;  4MTK A;  4RFB A;  4HID A;  4A3B G;  1YJW A;  1O78 A;  1VQK A;  2YYZ A;  4ZRZ A;  5EGT A;  2Q2U A;  2EJF C;  4QUF A;  1CHP D;  1S72 A;  1RF2 D;  5ELE A;  4C3I B;  1EQQ A;  1UE7 A;  4U67 3;  1FGB D;  4A3C G;  1S3O A;  4WJ4 A;  4KKS A;  4XDX A;  4BY7 G;  4A93 B;  3S2D B;  3T51 B;  4CDE C;  2K5N A;  1BDO A;  3A8K E;  1A0I A;  1VQ5 A;  5GAE C;  2QEX A;  3ERO A;  3HP3 A;  4BXX H;  3JAM c;  1F2M A;  4DV3 L;  3I90 A;  4JYA L;  3BU2 A;  3B6Y A;  3SK6 A;  3SR1 A;  4EQN A;  3FPU B;  1I4R A;  4C2M B;  2L9H A;  2C9O A;  1B44 D;  5CC4 A;  1F2L A;  1T9H A;  1IBL L;  3PSI A;  3K81 C;  3A56 A;  4X3U A;  5ELD A;  1QZG A;  3ITP A;  2VY3 A;  3STB D;  3T1H Q;  1N33 Q;  3CKI B;  5FO7 B;  3OWF A;  1E2V A;  1SDF A;  2SDF A;  4KI0 A;  4HJA A;  4DR4 L;  4A3C H;  1CKN A;  5KNB A;  2J7Z A;  4IFD G;  3OW7 A;  1H9R A;  1HNZ L;  1LTA D;  2X6G A;  2I07 B;  5IGC A;  3I3C A;  1LO5 D;  4QGU A;  2F3I A;  1HRJ A;  1STA A;  1SNC A;  2Z1C A;  4JI4 Q;  1DON A;  4A3L H;  1A62 A;  1LV9 A;  4GNX A;  1VQE A;  1E0B A;  2M2L A;  1BF4 A;  2XN9 C;  3HOY B;  2N78 A;  2NN6 G;  2ZM6 Q;  4K0K L;  3K57 A;  1EY5 A;  1TWC B;  3PIO 3;  1V8Q A;  2L0C A;  1YBY A;  4DPG A;  3M85 A;  1YNN C;  3HOV B;  1V43 A;  4RGN A;  4KJO A;  4AIM A;  2LXJ A;  3S14 B;  4RHS A;  1SLJ A;  1NJI C;  3GV6 A;  2PPB C;  2QDB A;  2B63 G;  4IFD H;  1ROD A;  4O42 A;  4FF3 A;  2OXP A;  1QG7 A;  4N9T A;  2B39 A;  3CP0 A;  3EVQ A;  5ISR A;  4U68 A;  4K5V A;  1QWY A;  2O5J C;  1MBY A;  3NEM A;  1S40 A;  3GTL H;  4C3J B;  1Q8I A;  4A3F G;  4M1U B;  1U4P A;  2GVA A;  3Q0A A;  5CV6 A;  5M3F B;  2WAQ G;  3P20 A;  4LFC L;  4KN4 C;  2EQS A;  4DNI A;  5CV8 A;  2E2I B;  2AWN A;  5CGK A;  2UUB Q;  2NN6 H;  3G6J B;  4HJ9 A;  2B2T A;  1PH4 A;  4KD4 A;  2V1C C;  1A8V A;  2BH2 A;  3RZO B;  3HOX H;  1XTD A;  4L5T A;  2KQ3 A;  4B3T L;  1UE1 A;  3SK8 A;  3T56 B;  4DV6 Q;  3RZD H;  1KNE A;  1TQO A;  3S16 B;  3X3N A;  1PMR A;  4DV7 Q;  1QNK A;  1IW7 C;  3AFP A;  2ATW A;  1B8A A;  3C1F A;  4OON A;  3BVM A;  1CQF A;  1IHZ A;  3GQB A;  2H1E A;  2B63 H;  4OXP A;  3M9B A;  4JCV E;  2ICI A;  1EY8 A;  1BCP C;  2RBM A;  2KCM A;  1AH9 A;  1XYI A;  1SNO A;  4GNX C;  1FL0 A;  1IKM A;  2OCE A;  3BS1 A;  4QL5 A;  2ZT9 C;  1RJT A;  1T5X D;  1JJ2 A;  2QCP X;  2FHT A;  5BN4 A;  4TSS A;  1EYG A;  3SGI A;  2HT1 A;  2JXM B;  1VQ9 A;  5JOB A;  2R93 G;  1X56 A;  5LMN L;  3I4M H;  4DAY B;  5F2D A;  4K5W A;  4F87 A;  4EGV A;  5IWA L;  2RHS B;  1PTO D;  4X65 L;  4LF7 L;  4GKK Q;  3D6W A;  1HR0 Q;  3OSO A;  3H6M A;  3JAM i;  4K8J A;  4NMZ A;  2K1B A;  4WOR A;  2NVX B;  1CK1 A;  3NK9 A;  3DUZ A;  3E0E A;  2NVT B;  2A6H D;  4MHE A;  4UP7 A;  4KY5 A;  5M5X H;  2F0D A;  4NXM L;  1IBK Q;  1GOZ A;  4B08 A;  4DV2 Q;  1ONL A;  5FJ8 G;  4LFB L;  3U50 C;  1SNP A;  2ZTD A;  2J0T D;  4V0B A;  1SYG A;  3MFG A;  1JR0 D;  4JOI A;  1Y1V G;  2F0T A;  1PH8 A;  4BBS B;  1TR5 A;  1YNJ D;  4JI8 Q;  1KLG D;  4ME3 A;  4DV5 L;  1V1O A;  4YCW A;  1X65 A;  5I2X A;  3I72 A;  4QIW B;  1ASY A;  1QVF A;  5C4X B;  5IYB H;  3RUZ A;  5IT9 E;  1CKN B;  2KCC A;  3BDO A;  4ILW A;  3H3V C;  3ND9 A;  1EWC A;  5EKK A;  3DM3 A;  4KV6 A;  1VQN A;  2PQA A;  4LMQ D;  1VQO A;  5AFW A;  5CV9 A;  5C0X G;  4JI5 L;  4EX5 A;  3FKI B;  4XT3 B;  2JA8 H;  3TP8 A;  3PO3 G;  1YZ6 A;  4JI7 Q;  2BOS A;  3D31 A;  3BYY B;  1BCP B;  4OWT B;  5LL6 X;  4GKJ Q;  1LT3 D;  4JVZ A;  2RQX A;  2OF1 A;  3NBI A;  4B3R Q;  1LTT D;  4GNX B;  1LUZ A;  5FJ8 H;  4DFA A;  2Z6K A;  3I2Z A;  4UP9 A;  5IP9 G;  3OOC A;  1SNM A;  3CCU A;  1NTG A;  2JE6 I;  4JBW A;  2O5I C;  1CKO A;  1SFO H;  1LLR D;  4XQJ A;  2PMZ B;  1HZB A;  1I94 Q;  1PRT F;  1VQC A;  1JOQ A;  1Y1V H;  3K5M A;  1VMC A;  1F9Q A;  2MPM A;  3CC4 A;  3RR5 A;  4RMF A;  1W3S A;  1L0X B;  1U4R A;  1G2S A;  4OO1 I;  2WB1 B;  2PI2 E;  4J15 A;  3TS0 A;  1V9P A;  2KOL A;  5AJ3 Q;  3KBX A;  2F0J A;  3CRK C;  1JWS D;  4BWG B;  3KK7 A;  1EWI A;  4KD3 A;  1KTK A;  4ZKC B;  4DN4 M;  4I65 A;  5M3M G;  2CQA A;  4DR7 Q;  1I6H H;  2KUM A;  1BVS A;  1X32 A;  1SBB B;  1EYA A;  2K05 A;  3FDT A;  1KAW A;  5IP9 H;  1K8O A;  2BE5 C;  2K6A A;  1I50 H;  4IFD I;  1I6V C;  1WTH A;  1M90 C;  2VL6 A;  1JB3 A;  4JI2 L;  3MXG A;  5KNC A;  3VYT A;  4DK3 C;  3QR8 A;  1HFN A;  2O2L D;  3D6C A;  5JEA H;  1J5E Q;  5ELO A;  4RH6 A;  4IJL A;  1BQQ T;  1OXV A;  4GN5 A;  4ZUJ A;  1PXU A;  2N8N A;  1SMY C;  1PYB A;  3HEJ A;  1TS4 A;  2LKV A;  4JV5 L;  2K33 A;  5HUR A;  2Z6K C;  3CF5 A;  3GTO H;  2QEJ C;  5CR3 A;  5M3M H;  4ZUI A;  2B8F A;  2N3S A;  1GKH A;  3FP9 A;  3T4A C;  2SNM A;  5DLQ E;  4R9W A;  1SE4 A;  3C46 A;  5C3X A;  4Y52 H;  4N8X 1;  3FKI G;  4RG1 A;  3MXU A;  1JWM D;  3CCV A;  4H7B A;  3PUW A;  4AYB E;  5FLM G;  3K5N A;  1LTG D;  2QA4 A;  4DV0 L;  4DV1 Q;  3S1R H;  4FF1 A;  1V1P B;  1HNW L;  4X6A H;  3ZYY X;  2OTL A;  2NBF A;  2E5L L;  3PF4 A;  2B8G A;  2UXB Q;  3LGJ A;  2ZJQ A;  2DN8 A;  4DR2 Q;  4UPA A;  4DGZ A;  2CHB D;  1QVG A;  2F0F A;  3SDZ A;  5C4J B;  3T1Y L;  3A74 A;  2I5L X;  3GDE A;  1I5F A;  2B2Y C;  5IP7 G;  2A1A A;  3TME A;  4IQZ A;  2ZXO A;  4P75 A;  2GVB A;  3G71 A;  4FYD A;  2KEN A;  1WTX A;  1HTL D;  2RSO A;  3STB C;  4LK1 C;  2RSN A;  5IGF A;  3ICE A;  4DUZ L;  2L55 A;  1SNQ A;  4X62 Q;  5NUC A;  5JPN C;  3IL8 A;  2F3V A;  4DAV A;  5FLM H;  1I3Q B;  3QJY A;  4DAP A;  1PYS B;  4R4O A;  4G7Z C;  2F1M A;  2NUC A;  3ULP A;  4AH6 A;  2F0V A;  2HDM A;  3PIO A;  5C6A A;  4KY7 A;  1UAP A;  4BY1 H;  1VQA A;  3IFT A;  1BCP D;  5LMU Q;  1KLU D;  4PMC A;  1K8G A;  4L6T B;  4DR1 Q;  1HR0 W;  2QDL A;  2JN4 A;  1ESF A;  5IE8 A;  4GOP A;  1LYL A;  2F0Q A;  4AQY Q;  1Z7T A;  2VXW A;  3RNU A;  1G6P A;  2DNC A;  3QOL A;  4LF4 Q;  1FNU A;  2OQK A;  1X9N A;  3MFY A;  2RDF A;  3PMF A;  4TQU S;  1CKM A;  3I56 A;  1N33 L;  1E2W A;  4YY3 Q;  2NYZ D;  3M4Q A;  5FO9 B;  2EYJ A;  3E0J A;  4OIK A;  1L0W A;  5EPJ A;  2UUA Q;  1DJR D;  1ET6 A;  3HKZ B;  1UEB A;  4YWK A;  1XPO A;  1NR4 A;  1Q12 A;  1G51 A;  2JA6 G;  1SYB A;  5J39 A;  5CMD A;  4Y7N H;  5D3D A;  3W1G A;  4JI4 L;  2Q8T A;  3Q23 A;  3U4V A;  5C0X I;  1YI2 A;  2BDO A;  3K59 A;  4EQ5 A;  2ZM6 L;  3CAM A;  1E22 A;  2VQF L;  1IXR A;  2FMC A;  2K03 A;  1I4P A;  3TZU A;  1X3Q A;  3AQQ A;  3HOW B;  2Q2I A;  4XYQ A;  2F0L A;  3L3O C;  4NXN Q;  3KF6 B;  1WTP A;  1HFG A;  2L15 A;  3NQI A;  5ELB A;  2X6L A;  1RL2 A;  2VUM G;  3TP6 A;  2UXC Q;  2E2J H;  3OHX C;  4A3M H;  1XPU A;  2EY5 A;  3HOU H;  2RA4 A;  3OW2 A;  1MJE A;  1WTW A;  1YHQ A;  4GOP C;  4HIM A;  5KND A;  3CPW A;  4IJH A;  1PTO C;  3FHW A;  1HA5 A;  2K28 A;  1RDP D;  4A3D G;  1R4Q B;  4CKB A;  2SOB A;  1MSH A;  3PCO B;  1AE3 A;  1BBW A;  4FP5 D;  2N55 A;  2M00 A;  1TWA B;  4LFA Q;  2A6H C;  5TSS A;  3PUY A;  5I6W A;  1XNQ Q;  3C3L A;  1GUG A;  4K2K A;  3E3X A;  4JBM A;  3P75 A;  1Q81 C;  4DV7 L;  1NMF A;  2WV6 D;  5HGQ A;  4UDU C;  2VUM H;  1Y1W B;  4KKT A;  2Z0S A;  2LS0 1;  1LM0 A;  3KYH C;  3DLL A;  1BUV T;  4ZLT F;  1IYU A;  1F77 A; 
#chains in the Genus database with same CATH homology
 1YNJ C;  2B2U A;  4XTC S;  2EJG C;  2WII B;  4P2C B;  1BR9 A;  2IW3 A;  2XWB B;  3OMG A;  5A2Q L;  1LAB A;  1U4L A;  3GP7 A;  3GTL B;  3CQZ B;  1F2Y A;  3DWQ A;  2IX0 A;  3V2T A;  2CVR A;  2IT1 A;  5BN5 A;  3S1N B;  1A6X A;  3K0Y A;  5EQ0 A;  5CV7 A;  1G91 A;  3QB3 A;  1A3V A;  3GTQ B;  1OXT A;  3PIP 3;  2A6E D;  4CJ1 B;  3S9W A;  1I4X A;  1D5X C;  2JP1 A;  3QO2 A;  3JAM E;  1PTO B;  1Y8P B;  2MGS A;  1CA6 A;  3V05 A;  4DAY A;  2IL8 A;  4A3I B;  3QIA A;  2HCI A;  1SND A;  4C3H B;  1VMP A;  1KNA A;  1XX8 A;  5FLX E;  3GTJ B;  1JOR A;  1LT4 D;  4F8M A;  4OO1 G;  5CYU A;  5EKI A;  4F7X A;  3I4M B;  2SEB D;  5JPM C;  2EJM A;  2BA1 A;  4JK1 C;  4FXK C;  1GHK A;  3E6Z X;  2B2U C;  4G57 A;  3HOZ B;  1EY6 A;  1S5D D;  2NVY B;  4A3E B;  4IUV A;  2OEO A;  3SHL A;  4RWS C;  5C5L A;  5C44 B;  1QOH A;  1F9P A;  4IZ8 A;  5J1Z A;  1PFN A;  4HCS A;  1JE4 A;  1JWU D;  3X3M A;  5FK9 C;  4OO1 H;  3BDC A;  3L9A X;  5D14 A;  1CTM A;  3SXH A;  2AQ1 B;  1B3A A;  3K7A B;  5ELF A;  2NB0 A;  1HQM C;  4HAE A;  2IPK D;  1PFM A;  1LTR D;  2DY8 A;  3VA7 A;  3LNN A;  3HG9 A;  3SK4 A;  1O7Z A;  2BA0 A;  1TVX A;  2PCF B;  1BO0 A;  2IJ0 A;  1ZYR D;  5C4Z A;  3U9S A;  3J80 L;  1D5M C;  1ENA A;  4MIU A;  4QUC A;  5DNF A;  4EVO A;  2QIL A;  4C3I G;  3KLS A;  2B2V A;  1FD7 D;  4FNF A;  3IKJ A;  4IAL A;  1JC7 A;  3SEB A;  2XSC A;  3NUC A;  1DYQ A;  1IYV A;  2RDG A;  1Y69 U;  4ZKB B;  2K32 A;  2C5C A;  5CBA E;  2WAC A;  1G29 1;  5M5W B;  1HUN A;  2HUG A;  1EQT A;  3GD7 A;  3N52 A;  1RD9 D;  1QJO A;  3S2H B;  1AN8 A;  5A35 A;  1R9T B;  5LL6 S;  1S4Z A;  4XXE A;  4BS9 A;  3PUZ A;  3OIQ A;  1V1P A;  3D4D A;  2Z4H A;  5I4D A;  2TSS A;  3J7Y W;  4CKC A;  3QG1 A;  1O7L A;  2A69 D;  4FXG C;  1CFM A;  2J4X A;  1NUC A;  1QCB D;  2MHV A;  3GO5 A;  2B2V C;  2ZXP A;  5EJW A;  2F0P A;  1H9S A;  4J6H A;  4ABN A;  1WTQ A;  1R4P B;  3PUV A;  3V96 A;  1O80 A;  1EZ8 A;  3R8B A;  1PDQ A;  1EU3 A;  4AYB B;  1Q1B A;  5IGB A;  3NWS A;  1D1I A;  3D3R A;  1BBX C;  1GHJ A;  4QCL A;  4C3J G;  1S5E D;  3LWE A;  3DHQ A;  4A3G B;  3VR4 A;  1RTN A;  1LT5 D;  3A7A B;  1GUN A;  1W6K A;  3R2T A;  1KAB A;  4NW2 A;  3HRZ C;  1J8I A;  3D4W A;  5JAV A;  4XT1 B;  3ERQ A;  1KDB A;  4BY1 B;  1DCZ A;  1ET9 A;  1EY9 A;  1STE A;  2D9U A;  3DEP A;  5C0X H;  3S1Q B;  3AMU A;  5EBD A;  2A5H A;  2KEC A;  1EQV A;  1DOL A;  5KYI A;  4DXF A;  3T13 A;  3BZD B;  2EYM A;  1BCP F;  2B2Y A;  4G7O C;  1A3U A;  1K8M A;  2PZT A;  1B2T A;  1AZP A;  4PMW A;  4DF7 A;  3AB9 A;  1EY4 A;  2F0K A;  4K2L A;  3H0G B;  5JVG 3;  3W2D A;  2BCO A;  5G3L D;  4Y7N B;  2OT2 A;  4B9X A;  2Z8L A;  3ND8 A;  3I4N B;  2XRQ D;  4FF2 A;  4RGT A;  2A6E C;  3BYT B;  4KHZ A;  4GZY C;  1K83 B;  3EA6 A;  1ENF A;  1LTI D;  2F0G A;  4ODG A;  5M5Y B;  1ENC A;  2XWJ B;  1RKN A;  1EYC A;  5C4H A;  4A3M B;  2QF7 A;  1TS5 A;  5FOB B;  4DNT B;  2K5Q A;  2G9D A;  1PZJ D;  1KDA A;  1PLF A;  4E6I A;  4V19 0;  1EY0 A;  2E74 C;  2E75 C;  1VF5 C;  4C56 C;  5JEA J;  3TSS A;  3FPP A;  3BG3 A;  3DM1 A;  1MI2 A;  2RDH A;  3EQL C;  1H9S B;  2X69 A;  1A2U A;  4M8A A;  3J7A V;  1SXT A;  5IGE A;  4Z9C B;  4H0L C;  1QIL A;  3MC0 B;  1ILP A;  1J9O A;  2JEA I;  3FVQ A;  4NP5 A;  2E2D C;  3EJI A;  2KCN A;  1SYD A;  1EWH A;  2MP1 A;  3DWA A;  1HQR D;  1PRT D;  2YU9 B;  4XYO A;  4Q5V A;  3VA5 A;  3RD4 A;  1ESR A;  3GTG B;  1H9J A;  4OGQ C;  5K5P A;  4WJW A;  4A3J B;  1AZQ A;  1TII D;  3OWE B;  2CW0 D;  1WTO A;  4NKL A;  1D1K A;  2EDG A;  2WIN B;  3IFD A;  5KEE A;  3S15 B;  1AFP A;  3K5L A;  1A2T A;  1TY2 A;  1B9N A;  1TT2 A;  4QF4 A;  1ILQ A;  1ZYR C;  1GUO A;  3MZ5 A;  2JYO A;  4RKL A;  1T5E A;  3TDQ A;  2IWH A;  1D6E C;  2KHS A;  1PZK D;  4KK7 A;  1B53 A;  3UI2 A;  1MGS A;  1F9S A;  2H4O A;  3I91 A;  5J22 A;  2G9H D;  1WVL A;  2XVS A;  1AP0 A;  1H9K A;  1STH A;  3VR6 A;  3SVM A;  4ULL A;  5DM7 3;  3MAQ A;  4LJZ C;  1G6Z A;  1RHP A;  1STB A;  2FFK B;  3QWN A;  1VDZ A;  4HTH A;  2IX3 A;  3R2I A;  2D5D A;  4OHJ A;  4A3B B;  3OIP A;  4X3T A;  1Z6H A;  1TWG B;  4IUR A;  2LMC B;  4XIG S;  4RCN A;  1DZ1 A;  4NDX A;  1WD0 A;  4BY7 B;  1QNU A;  2KED A;  5T1G A;  1OO9 B;  3VR5 A;  5M9O A;  1KAA A;  1L0Y B;  3Q6S A;  1GUS A;  3MVV A;  4IUT A;  1RCV D;  1TU2 B;  1S5F D;  1CA5 A;  4KHV A;  3RLF A;  5K36 G;  4HMI A;  1A3T A;  3M7N A;  5E1F A;  2A69 C;  2EVB A;  4K8I A;  4IUQ A;  3A8I E;  1A15 A;  1F9R A;  2TMP A;  1GJX A;  4RKB A;  3J81 L;  1EEF D;  2JSO A;  4B9W A;  5D3I B;  1Q1E A;  5EPK A;  2A68 C;  2NTT A;  2WKC A;  2F0O A;  1XXG A;  2Z4I A;  5E3F A;  2A74 C;  1TKW B;  2AQ2 B;  3Q24 A;  2PW5 A;  1B9M A;  2R61 A;  4QMG A;  2PO4 A;  3M4Y A;  5K36 H;  2F0W A;  3HOX B;  3A55 A;  4BA1 I;  1TWH B;  3RZD B;  2EY2 A;  4DK1 A;  4OL7 A;  1SEB D;  2PZU A;  4PQX A;  3ONA B;  2RVL A;  3R3O A;  3I8Z A;  3TN2 A;  2B63 B;  2MJ8 A;  4OIJ A;  1BOS A;  2V4D A;  1O7Y A;  4RA8 A;  4CKE A;  2B2W A;  3H94 A;  1EU4 A;  4A3F B;  1RTO A;  4ME5 A;  1STY A;  3BVZ A;  2WAQ B;  1BNZ A;  2NZ1 D;  1PYW D;  3SE0 A;  2AUK A;  1B50 A;  3URY A;  1TS2 A;  2XRS D;  5C3W A;  3NTH A;  1SYC A;  5M5X B;  2R6G A;  5IOD A;  2EY6 A;  2KA7 A;  2XNA C;  1EYD A;  4X3S A;  1ML0 D;  3P1H A;  1PTO F;  4DU9 A;  1OXX K;  1SAP A;  1W6J A;  1EZ6 A;  1HPC A;  1HA6 A;  1KDC A;  2FJ2 A;  2R93 B;  5I9P A;  4PNY A;  1EIG A;  3NHH A;  1STG A;  2JA8 B;  2WKD A;  1DD2 A;  3VYU A;  3AU7 A;  2BDN A;  1U9R A;  5IT9 L;  2IX1 A;  2E76 C;  4K6L A;  2B2W C;  1EL0 A;  1E2Z A;  2A73 B;  4O1N A;  3NXW A;  1SFO B;  4RCO A;  3J81 E;  4G7H C;  4YIJ A;  1WTV A;  1Y1V B;  4TKO B;  1DOK A;  5A2Q E;  1Q90 A;  5EPL A;  3NWT A;  1EY7 A;  2EYF A;  5CBE E;  1CZG A;  4K5X A;  3KBG A;  1SYE A;  3OMC A;  3PO3 B;  4FXD A;  5KGU A;  1QB5 D;  4C3H G;  1ICW A;  1I6H B;  1UNS A;  4RGO S;  1CQV A;  1U4M A;  2SNS A;  1PRT C;  3LWU A;  4HCE A;  3EFX D;  3QOJ A;  2DY7 A;  3DWP A;  4QB4 A;  1I50 B;  4KN7 C;  3T53 B;  2CW0 C;  1SE2 A;  2D2C C;  1JQY D;  2KEE A;  1JOK A;  3C1E A;  1C8C A;  3I70 A;  3K6O A;  1PTO H;  1FNV A;  2L11 A;  3OPO A;  2HCC A;  4IFD J;  1I4H A;  1FR3 A;  1SJE D;  4CGY B;  3Q22 A;  1PZI D;  3VR3 A;  2Q8I B;  3GTO B;  5DAU A;  5M3M B;  3DMU A;  5G3L F;  1OXS C;  3O13 A;  4DA2 A;  1SSO A;  2MUY A;  2WP8 J;  4ZK9 B;  1NAP A;  3GV3 A;  3M7G A;  3NQT A;  3I4L A;  3S1R B;  4LAA A;  1JIC A;  2LFN A;  2PYK A;  3K58 A;  1JCK B;  5DEH A;  2F3W A;  1OXU A;  2KJX A;  3H91 A;  2L4N A;  2A68 D;  1CHQ D;  1PRT B;  4KJN A;  2F03 A;  2VB2 X;  4HMJ A;  2FMM A;  3NP8 A;  1XTC D;  3KF8 A;  2K5W A;  2B2T C;  5I9O A;  4R8I A;  1II3 A;  5I2Y A;  3J7A F;  1C4Q A;  4FF4 A;  1Y8N B;  2M9V A;  4ZYS A;  4WFN 3;  2NWG A;  1STN A;  2F0E A;  3R93 A;  2XIW A;  3W3A A;  3L7Z C;  4XQQ A;  1IL8 A;  4RGM A;  1SE3 A;  4DNR B;  4KKU A;  2F0U A;  2ID0 A;  3TZD A;  3IAY A;  5E4W C;  5JJZ A;  3MA2 B;  3A7L A;  3J80 E;  5DM6 3;  2ZXR A;  5IGD A;  4K6D A;  1S5B D;  5EBC A;  3GTK B;  3TBI B;  5KYL A;  2ENB A;  4ZQ3 A;  3NBH A;  1HUM A;  2AWO A;  2I46 A;  2RKS A;  1LAC A;  5JEA G;  1LTB D;  4H44 C;  1DXM A;  1XWE A;  2EZV A;  3K5O A;  3H09 A;  3HS0 C;  3KLS X;  5ELC A;  1EIH A;  2EOT A;  3LX0 A;  3BDL A;  4FVM A;  1S5C D;  3T16 A;  4C1N K;  2PNR C;  1WD1 A;  1MSG A;  4J1M A;  3E5S A;  1HTP A;  3PV0 A;  3FMC A;  4UAI A;  2F0N A;  3NE5 B;  2KVM A;  5FKA C;  4IUU A;  4WRD A;  4S3S A;  4HED A;  1D5Z C;  2LY7 A;  1B4O A;  3MXP A;  1EFI D;  3WDN A;  4J8Q A;  1CZW A;  1JOO A;  5C0X J;  3KUP A;  2R3Z A;  1F2Z A;  2NN6 I;  4C1N I;  3CHB D;  5BN3 A;  2E2J B;  1LTS D;  3WOE A;  4CBV A;  3HOU B;  4L8J A;  2F0S A;  2JA6 B;  1PFB A;  1NR2 A;  2O4X A;  3VR2 A;  3HZX A;  1UEA B;  2QKI C;  2EYL A;  4Q0F A;  1YNN D;  2F0H A;  4IUP A;  2NTS A;  2EXZ A;  1WTR A;  4CHT B;  3A8J E;  4KMU C;  2L12 A;  2PZW A;  3FRP B;  2GA4 B;  2VUM B;  3NSW A;  1FYC A;  1BXT A;  5COY A;  1I4Q A;  4H13 C;  1HCZ A;  3G7L A;  3HGB A;  3A54 A;  4HSP A;  2VNU D;  1CI3 M;  3TP7 A;  2DNE A;  4N9P A;  1C48 A;  2K01 A;  2L5T A;  1UUP A;  1ZKO A;  4A3D B;  1G2T A;  1SJH D;  1HXY D;  2HQE A;  1IW7 D;  3MHB A;  3C2P A;  3PUX A;  1EEI D;  1Q3L A;  3DXJ C;  1DOM A;  5COR A;  4PV1 C;  3VYR A;  3D4R A;  3TP5 A;  1NSN S;  4G4K A;  5KRU A;  2EPB A;  2EYH A;  1TS3 A;  4ID6 A;  4ZAI A;  4MN3 A;  1ZXT A;  5LHY 1;  4A3K B;  1ZEQ X;  4KY6 A;  3M4O B;  1AEX A;  2Q8R E;  2E2H B;  2HDL A;  4EQO A;  1CT1 D;  3JAM L;  5KIX A;  5CV4 A;  4PMB A;  3N6R A;  1DM0 B;  2JEB I;  2EE1 A;  5EKL A;  3PO2 B;  1MD2 D;  1WCM B;  2K04 A;  4F88 A;  2PW7 A;  3CRL C;  3M3Y B;  1M8A A;  5D65 A;  2L1B A;  5FLX L;  3D8G A;  1TWF B;  1LT6 D;  4RHR A;  1M4V A;  2R92 B;  1G8Z D;  2D62 A;  4FO2 A;  3I73 A;  2JA7 B;  1IKL A;  2FIN B;  3BVG A;  3NPP A;  1I4G A;  4DK0 A;  1B1Z A;  3MXN A;  4XQN A;  1AW7 A;  3SK5 A;  4RAU C;  2AQ3 B;  1HHV A;  4TRD A;  3S1M B;  1Y8O B;  1CM9 A;  5E4X A;  1VF7 A;  3RMH A;  4I7Z C;  2F0M A;  5IGG A;  5I6Y A;  2ICE C;  4R8N A;  5HGT A;  3VYS A;  2AUJ D;  5JVH 3;  4DXG A;  2R7Z B;  4HN7 A;  2EY1 A;  2NVQ B;  5IOC A;  1SYF A;  3NTK A;  3P7J A;  5CV5 A;  3MWY W;  5T1I A;  2JA5 B;  3DEO A;  1Z47 A;  4HR7 B;  3FEW X;  4KTA A;  2F4I A;  2PQE A;  1EOT A;  2F0I A;  1X3P A;  4K14 A;  2K5D A;  3S17 B;  3GTP B;  3NTI A;  1FNW A;  4IN3 A;  2K7V A;  5C5M A;  2Y0S B;  5IIF A;  1GUT A;  4BBR B;  4IUN A;  1VCI A;  2BE5 D;  3MTS A;  5C3E B;  2EYO A;  2EYP A;  1GXD C;  3KLR A;  3GTM B;  3U9O A;  1H9M A;  1TY0 A;  1QE6 A;  4CJ2 C;  5FO8 B;  3CU7 A;  4L63 B;  3F2U A;  3MEH A;  1NCV A;  4CJ0 B;  4BA2 I;  3WOF A;  1D2B A;  4X3K A;  4HSV A;  1SMY D;  4EQP A;  2VB3 X;  1GUW A;  2N88 A;  4RFB A;  1O78 A;  2YYZ A;  4ZRZ A;  5EGT A;  2EJF C;  4QUF A;  1CHP D;  1RF2 D;  5ELE A;  4C3I B;  4U67 3;  1FGB D;  4KKS A;  4XDX A;  4A93 B;  3S2D B;  3T51 B;  1BDO A;  3A8K E;  3ERO A;  3HP3 A;  1F2M A;  3I90 A;  3SK6 A;  3SR1 A;  4EQN A;  3FPU B;  1I4R A;  4C2M B;  2L9H A;  2C9O A;  1B44 D;  5CC4 A;  1F2L A;  3A56 A;  4X3U A;  5ELD A;  3ITP A;  3CKI B;  5FO7 B;  3OWF A;  1E2V A;  1SDF A;  2SDF A;  4KI0 A;  5KNB A;  2J7Z A;  4IFD G;  3OW7 A;  1H9R A;  1LTA D;  2X6G A;  2I07 B;  5IGC A;  3I3C A;  1LO5 D;  1HRJ A;  1STA A;  1SNC A;  2Z1C A;  1DON A;  1LV9 A;  1E0B A;  2M2L A;  1BF4 A;  2XN9 C;  3HOY B;  2NN6 G;  3K57 A;  1EY5 A;  1TWC B;  3PIO 3;  1V8Q A;  2L0C A;  3M85 A;  1YNN C;  3HOV B;  1V43 A;  4RGN A;  4KJO A;  3S14 B;  4RHS A;  3GV6 A;  2PPB C;  2QDB A;  4IFD H;  1ROD A;  4O42 A;  4FF3 A;  2OXP A;  1QG7 A;  4N9T A;  2B39 A;  5ISR A;  3EVQ A;  4U68 A;  4K5V A;  1QWY A;  2O5J C;  1MBY A;  4C3J B;  1Q8I A;  4M1U B;  1U4P A;  3Q0A A;  5CV6 A;  5M3F B;  3P20 A;  4KN4 C;  5CV8 A;  2E2I B;  2AWN A;  5CGK A;  2NN6 H;  3G6J B;  2B2T A;  4KD4 A;  3RZO B;  2KQ3 A;  3SK8 A;  3T56 B;  1KNE A;  1TQO A;  3S16 B;  3X3N A;  1PMR A;  1QNK A;  1IW7 C;  3C1F A;  3BVM A;  1CQF A;  1IHZ A;  3GQB A;  2H1E A;  2ICI A;  1EY8 A;  1BCP C;  2RBM A;  1XYI A;  1SNO A;  1IKM A;  3BS1 A;  2ZT9 C;  1RJT A;  1T5X D;  2QCP X;  2FHT A;  5BN4 A;  4TSS A;  2JXM B;  5JOB A;  5F2D A;  4K5W A;  4F87 A;  4EGV A;  1PTO D;  3D6W A;  3OSO A;  3H6M A;  4K8J A;  4NMZ A;  2K1B A;  4WOR A;  2NVX B;  1CK1 A;  3NK9 A;  3DUZ A;  2NVT B;  2A6H D;  4MHE A;  4KY5 A;  2F0D A;  1GOZ A;  4B08 A;  1ONL A;  1SNP A;  2J0T D;  4V0B A;  1SYG A;  3MFG A;  1JR0 D;  2F0T A;  4BBS B;  1TR5 A;  1YNJ D;  1KLG D;  1V1O A;  5I2X A;  3I72 A;  4QIW B;  5C4X B;  3RUZ A;  5IT9 E;  2KCC A;  3BDO A;  4ILW A;  3H3V C;  3ND9 A;  1EWC A;  5EKK A;  4KV6 A;  4LMQ D;  5AFW A;  5CV9 A;  5C0X G;  3FKI B;  4XT3 B;  3TP8 A;  2BOS A;  3D31 A;  3BYY B;  1BCP B;  5LL6 X;  1LT3 D;  2RQX A;  2OF1 A;  3NBI A;  1LTT D;  4DFA A;  3OOC A;  1SNM A;  2JE6 I;  4JBW A;  2O5I C;  1LLR D;  4XQJ A;  2PMZ B;  1PRT F;  1JOQ A;  3K5M A;  1VMC A;  1F9Q A;  2MPM A;  1L0X B;  1U4R A;  1G2S A;  4OO1 I;  2WB1 B;  2KOL A;  3KBX A;  2F0J A;  3CRK C;  1JWS D;  4BWG B;  3KK7 A;  4KD3 A;  1KTK A;  4ZKC B;  4DN4 M;  4I65 A;  2CQA A;  2KUM A;  1X32 A;  1SBB B;  1EYA A;  2K05 A;  3FDT A;  1K8O A;  2BE5 C;  2K6A A;  4IFD I;  1I6V C;  1JB3 A;  3MXG A;  5KNC A;  3VYT A;  1HFN A;  2O2L D;  3D6C A;  5JEA H;  4RH6 A;  1BQQ T;  1OXV A;  4ZUJ A;  1PXU A;  1SMY C;  3HEJ A;  1TS4 A;  2LKV A;  2K33 A;  5HUR A;  2QEJ C;  5CR3 A;  4ZUI A;  2B8F A;  3T4A C;  2SNM A;  4R9W A;  1SE4 A;  3C46 A;  5C3X A;  3MXU A;  1JWM D;  4H7B A;  3PUW A;  3K5N A;  1LTG D;  4FF1 A;  1V1P B;  3ZYY X;  2NBF A;  2B8G A;  2DN8 A;  4DGZ A;  2CHB D;  2F0F A;  3SDZ A;  5C4J B;  2B2Y C;  3TME A;  4IQZ A;  2ZXO A;  4FYD A;  1WTX A;  1HTL D;  2RSO A;  4LK1 C;  2RSN A;  5IGF A;  2L55 A;  1SNQ A;  5NUC A;  5JPN C;  3IL8 A;  2F3V A;  4DAV A;  1I3Q B;  3QJY A;  4DAP A;  4G7Z C;  2F1M A;  2NUC A;  2F0V A;  2HDM A;  5C6A A;  4KY7 A;  1UAP A;  3IFT A;  1BCP D;  1KLU D;  4PMC A;  4L6T B;  1ESF A;  2F0Q A;  1Z7T A;  2VXW A;  2DNC A;  3QOL A;  1FNU A;  3MFY A;  2RDF A;  3PMF A;  4TQU S;  1E2W A;  2NYZ D;  5FO9 B;  2EYJ A;  3E0J A;  4OIK A;  5EPJ A;  1DJR D;  1ET6 A;  3HKZ B;  1NR4 A;  1Q12 A;  1SYB A;  5J39 A;  5CMD A;  5D3D A;  2Q8T A;  3Q23 A;  5C0X I;  2BDO A;  3K59 A;  2FMC A;  2K03 A;  1I4P A;  3TZU A;  1X3Q A;  3HOW B;  4XYQ A;  2F0L A;  3L3O C;  1WTP A;  1HFG A;  3NQI A;  5ELB A;  2X6L A;  3TP6 A;  3OHX C;  2EY5 A;  2RA4 A;  1WTW A;  5KND A;  1PTO C;  1HA5 A;  2K28 A;  1RDP D;  1R4Q B;  4CKB A;  2SOB A;  1MSH A;  4FP5 D;  2N55 A;  2M00 A;  1TWA B;  2A6H C;  5TSS A;  3PUY A;  5I6W A;  3C3L A;  1GUG A;  4K2K A;  3P75 A;  2WV6 D;  4UDU C;  1Y1W B;  4KKT A;  2LS0 1;  1BUV T;  4ZLT F;  1IYU A;  1F77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...